5M5WH

Rna polymerase i open complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
144
structure length
134
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase I subunit RPA190
publication title Molecular Structures of Transcribing RNA Polymerase I.
pubmed doi rcsb
molecule tags Transcription
total genus 16
structure length 134
sequence length 144
ec nomenclature
pdb deposition date 2016-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m5wH00
1VQNA 1VS0A 4JI8L 3W1GA 1VQEA 1EIYB 4X66Q 3HOUH 3M4OH 3S2HH 3KJOA 2KENA 3GTOH 4UY8C 1MIUA 1HNXQ 4IPCA 2ES2A 1LYLA 2LXJA 1TWFH 2R7ZG 3S16H 3WWVA 1Q8KA 2VUMG 1KD1C 1NBWA 4DV3L 1M90C 2JA5H 5HGQA 2ZM6L 2YV5A 3CCQA 1J5EL 3A5UA 2RHSB 1PH6A 4DV0Q 3HOXH 2R92G 1XJVA 4AQYQ 4GLAC 3HOWH 4B3TQ 4JI4Q 4X66L 4BY7H 1WCMH 5IP7G 1Y1VG 4A3GG 4KHZA 1H95A 3MEFA 4KHPL 1P8LA 2CFMA 2QEXA 2UUBQ 2YTYA 1K0RA 5M3MG 3PF4A 2WB1G 1YI2A 1IBML 3F8TA 3CAMA 3GTQH 1E3PA 1IYJB 3K8AA 3PUZA 1WYDA 3J80i 3SGIA 3A74A 2A8VA 4A3KH 4DV0L 4BY1G 4AH6A 5FLMG 4AQYL 2E2HH 3J81i 4JI4L 4LF7Q 1C7YA 1W3SA 3KFUA 3KDFA 2E8GA 3FKIH 4DK6C 5ELNA 4DR1L 1K9MC 3S17H 3EIVA 2DUDA 1HNWQ 2ZJRA 4JI6Q 4DR7L 1TWGH 4TQUS 3RN2A 5JJIA 1YITA 1G51A 3CPFA 3GTMH 2N49A 3HOZG 3ULPA 2UUCQ 1PH4A 4YCVA 2A19A 1YIJA 2I0QA 2AWNA 3CMEA 4DK3C 1JB7A 1TWHH 1O7IA 3D0FA 5JJLA 1B7YB 1HNWL 2RCNA 3I7FA 2QA4A 4GKJQ 4JI6L 3TEHB 5IYCH 4A3CG 3OTOQ 4A93G 1QZGA 5IWAL 1AH9A 4X65L 4YY3Q 1VQBA 1N34Q 4LF6Q 4UP8A 2UUCL 3UE0A 4BA2I 1PYSB 1T9HA 2GN5A 2Z0SA 1X3GA 3TQYA 3S2DH 4JI7Q 5FJ8G 1XMQL 3ERSX 2EIFA 1SR3A 2NZHA 3CW2C 4OWWB 1NJIC 5IYBH 1FJGQ 3Q8DA 4B3SL 4A3DH 1PH8A 3HKZG 5GAHC 1D8LA 4L5QA 5GAEC 3HOXG 4GKJL 4DUZL 3OTOL 3BZKA 1Z9FA 4OO1I 3BJUA 2IX1A 4YHHQ 1VQPA 1KRSA 1HNZQ 1N34L 3PIOA 1U5KA 5M5YH 3A0JA 4LF6L 4EX5A 1OXTA 4GKKQ 1X9NA 2L15A 5C0XG 2IX0A 1BBUA 1MKHA 3A5ZB 4DAMA 4GOPC 3PUWA 4GLXA 3CCVA 1UE1A 1OXXK 5IT9c 1FJGL 2R7ZH 2ALYB 4DR4Q 2VUMH 2UXBQ 4LUVA 2ATWA 3I4NG 3CC7A 4A3KG 3TS2A 4DV1L 1FL0A 3D31A 2BH8A 2PI2A 1I94L 3ICEA 1VQHA 2NVYH 4B3RL 3M7NA 4YHHL 1CKOA 3KJPA 4OONA 3T1YL 1R9TH 1K73C 2JEAI 1VQ6A 2R92H 2OWOA 4OWTB 2JA7G 4GKKL 1L1OA 4QIWE 5IP7H 4A3GH 4HIKA 3F2CA 1TWAH 3J80c 4NPSA 2H5XA 2N8NA 2RHQB 4GOPA 2ZTEA 4IPGA 4IPHA 1XTDA 3PUVA 3J81c 3NELA 5M3MH 5C44G 2JA6G 4DR4L 1JJGA 1MJEA 2F4VQ 3ZJYC 2VY3A 1QVFA 4GNXB 1SROA 3W5OA 4QJFA 1VQMA 4A3IG 2UU9Q 4LF5Q 3B6YA 1YEZA 2UXDL 1G6PA 3CPWA 4A3JG 3ER0A 4JI1Q 3GTJH 3GTLH 1N36Q 1A63A 4APVA 3TS0A 2CWAA 2Y0SE 3I4OA 1EFWA 3HOZH 1Y14B 3F1ZA 2CCZA 1HH2P 3CF5A 1TXYA 2K14A 4HJ9A 4PZ6A 5GROA 4C2MH 4LF9Q 4A3EG 3PO2G 1UE7A 1VQ4A 4B3MQ 2VQEQ 2LXKA 1KL9A 4YCWA 5FLXc 4A93H 4A3CH 1N32Q 3EBEA 1NMGA 2VQFQ 5AJ3Q 4LF4L 1N33Q 1J6QA 4JI5Q 4LNQA 2XTIA 1K8AC 4A3BG 3PF5A 2B63G 1PVOA 5IYDG 2MO1A 4LF9L 5FJ8H 3I56A 5LMUQ 5M5WH 1VQGA 2YTVA 3UDXA 2CQOA 3NEMA 2NZOA 4LUZA 1ASZA 2F3IA 2VQEL 4DV2Q 4B3ML 3GTPH 2VS1A 1FGUA 1UE5A 4LUOA 4OX9Q 5C0XI 3ULJA 4JBWA 1N9WA 1YBYA 5C3EG 1SMXA 1SFOH 2KCMA 5AJ3L 2ASBA 1N33L 1A8VA 3S15H 4JI5L 4A3FG 1HNXL 1L0WA 2E2IH 2PI2E 3S1MH 4POFA 1QVGA 4A3MG 1BBWA 2NN6I 4DV2L 3K7AH 1UEBA 1KC8C 2NVXH 3W1BA 4NXNQ 3I4NH 2R7DA 5M5XH 1YJWA 2NVQH 4B3TL 1CKMA 2ID0A 4X64Q 2DGYA 1U0LA 4O2DA 4ALPA 1I5FA 1DGSA 1VQLA 2AKWB 1PH1A 2CKZB 2JA7H 2PQAB 3JAMi 2K75A 2BH2A 2PNHA 1X3FA 2UUBL 2JEBI 3RLNA 1E1TA 2WAQE 3EN2A 4IPDA 4X62Q 3M85A 4A4IA 3UE1A 4R4TA 4HJAA 4NXNL 4MZ9A 5C44H 2JA6H 2D0PA 3U50C 2FXQA 1G291 4HIOA 4LF7L 4A3LG 4IFDG 4X64L 2R93G 1GD7A 3GTKH 4JI3Q 3J7A5 4R1JA 3K7UC 3K81C 5JEAJ 2K4KA 4QY7A 4JYAQ 1PH9A 3E9HA 3H15A 1EYGA 4UP9A 5LMNQ 4A3IH 2Q2UA 4R4CA 3U4VA 4L5TA 5IE8A 4A3JH 3G4SA 4IOAA 4MNOA 3L7ZC 3UDFA 1OTCA 4JG2A 1OXUA 4IJHA 2Q2HA 5H1SE 3J81j 3G71A 3RN5A 3CCSA 4JYAL 4A3EH 3PO2H 1HZAA 2KHJA 3OW2A 2K5HA 2IHFA 3FHWA 3CCMA 5LMNL 3CC4A 1YNXA 3UDIA 1YHBA 1C9OA 4GN4B 1K3RA 4C3IH 4WJ3M 1K83H 1NY4A 1PHJA 4YY3L 4A76A 1XNRQ 2UXDQ 1L1OC 2JK8A 1VQOA 1NE3A 1PH5A 1QUQB 3CCEA 3LGJA 4JI7L 2N3SA 3DM3A 2IY5B 1LUZA 2HQLA 3CMAA 1SN8A 4LF8Q 2B63H 5ELOA 2Q2TA 4A3BH 5IYDH 4GNXC 1WFQA 4JV5Q 4OWXB 1PH2A 1SRUA 5J3BA 5JJKA 3T1HQ 3JC66 1HNZL 4DR5Q 4JCVE 3IRBA 1IL2A 2I5HA 5C3EH 2OQKA 2GVAA 5LMNW 2YTXA 4YWLA 4A3FH 1LM0A 3VDYA 1V43A 1OXVA 1Q1BA 4LFCQ 1I3QH 1RIPA 1IXRA 3MXNB 4XTCS 2UXBL 3KF6A 1W2BA 1D7QA 2AHOB 3G6EA 4GNXA 5GADC 4A3MH 4ME3A 3TRZA 3RZDH 4H02A 1KHIA 2OQ0A 3KF6B 4JBJA 1VQCA 4C3JH 4DV5Q 2QGQA 1VQAA 1VQFA 3T1HL 1EQQA 1I6HH 5C4XG 1E24A 2RF4A 4UPAA 2HIXA 1WOCA 3PO3G 4BBRG 2MO0A 2ZTDA 4J15A 5IP9G 4LFCL 1V1QA 1Q46A 1Q81C 1UWVA 4IJLA 1KQSA 2MFIA 5C4JH 2F4VL 4DV5L 2KCTA 1CUKA 2Y0SG 1HZ9A 1KRTA 4C3HH 1E22A 2BA1A 4DR2Q 1XMOQ 1PYBA 1B70B 4P74A 3BZCA 4A3LH 3J7ZC 1S3OA 1WI5A 3PUYA 2R93H 2K5NA 4TVAB 4JBMA 2JQOA 1X6OA 2UU9L 1EUJA 3E0EA 1HR0Q 4DR3Q 4LF5L 3S24A 1N8RC 2HT1A 1EWIA 2JA9A 1IBLQ 3E9IA 1VQ8A 1HZCA 4JI1L 2E5LQ 1N36L 5K36G 3I4MG 4JI2Q 4DV7Q 4Y52H 3HOYG 2BA0A 1XMOL 1VQKA 2NVTH 4JI8Q 3PV0A 2GVBA 2JA8H 4BXXG 1B8AA 5C0XJ 1A62A 4JOIA 4DR3L 5DLQE 4AYBE 1EQRA 2D0OA 3CCRA 1IBLL 2WP8J 1E7ZA 5M3FG 4QGUA 1VQ7A 4L5RC 4DV3Q 3TREA 2E5LL 1OXSC 1N32L 3GO5A 3AYHB 1V9PA 2ZM6Q 3OYYA 2VQFL 3STBD 4DV7L 1J5EQ 4JI2L 4POGA 2OTJA 4JI0Q 4R4IA 2EQSA 3AFQA 3CCUA 2Z6KC 3S1QH 1HJPA 5LMUL 4OO1G 4GN5A 2F52A 1S72A 3L2PA 3H3VI 1SLJA 4KHPQ 1X55A 2VNUD 1IBKQ 4DAYB 1EIFA 3UDGA 1VQ5A 1Q82C 2YYZA 3I2ZA 1IBMQ 4OX9L 1S40A 4DPGA 3L0OA 2PQAA 3G48A 4DUYQ 1PA6A 1IZ6A 3M4QA 1XNQQ 1A0IA 3H3VH 2WFWA 3PUXA 4DKAC 4UP7A 1HR0W 4JI0L 3CD6A 1X65A 4P73A 1NTGA 4KLKA 1EOVA 1Q12A 2E2JH 1L2FA 2YU9H 2Z6KA 3CP0A 3RZOH 3PCOB 4DR1Q 3HOVH 1MJCA 4O0AA 2WAQG 4NB3A 5EAYA 1IBKL 2WB1E 2HIVA 2B3GA 3F2DA 4DR7Q 2AWOA 4BBSG 4R4QA 4GLVB 4P75A 4DUYL 3M3YH 2D62A 2UXCQ 1XNQL 5C4XH 1M1KC 3HFZB 4PZ8A 1X56A 2ZJPA 4P72A 3AEVA 1XPRA 3CCLA 3S1NH 2V1CC 3U58A 1HZBA 3PO3H 4BBRH 5IP9H 1PH7A 2JE6I 4XIGS 4X62L 1QZHA 4DV4Q 3NENA 4LFBQ 3KDFB 1KIXA 1KAWA 4LWCA 3GTGH 5IWAQ 3KF8B 4X65Q 2JA8G 1ASYA 4K0KQ 4AIMA 4JI3L 2UXCL 3H0GG 4HJ5A 1NMFA 2PMZE 1Y1WH 5HY6A 3KLWA 3U4ZA 2ZTCA 1XMQQ 4P71A 3NBHB 4B3SQ 1QUQA 5GAGC 1GO3E 4DV4L 3AQQA 3PGZA 4LFBL 3KOJA 1P16A 4DUZQ 3I4MH 1YHAA 3CCJA 1JMCA 4JBKA 2CWPA 3HOUG 3HOYH 1CSQA 2JJQA 3RLFA 4K0KL 3HKSA 3M9BA 2OCEA 1KXLA 1Q7YC 4YWMA 3GD7A 1YJNA 3AFPA 4QQBX 2MQHA 1YZ6A 2UUAQ 1XPOA 2LSSA 4BXXH 2R6GA 4IO9A 3BU2A 2ZJQA 1TWCH 2JA5G 3HKZE 1YVCA 4DR6Q 2VZAA 1JE5A 3PSIA 2K52A 2K5VA 2KBNA 4LW1A 5M3FH 1RL2A 1XNRL 4JC0A 5E7NA 4DV1Q 1YHQA 1GVPA 1JJ2A 1Q86C 4HIMA 1X3EA 1VQDA 2A1AA 5GQOA 1I94Q 3HOWG 4B3RQ 4BY7G 2R7FA 1GM5A 1WCMG 4QL5A 1QVCA 1Z47A 3T1YQ 2AMCB 1FVIA 1UE6A 4LF8L 3CC2A 1XPUA 3HOVG 1X54A 1AE2A 4JV5L 1YJ9A 2EXDA 4HJ8A 2UUAL 1I50H 1E1OA 1WJJA 4R4OA 4LFAQ 1PV4A 3S1RH 4MTNA 4DR6L 3JAMc 4DR5L 1JJCB 1CKNA 4NXMQ 1C0AA 2N78A 2HHHQ 3ULLA 1CSPA 3RR5A 4PG3A 4KI0A 1PFSA 2NN6G 1CKNB 4PMWA 3FKIG 4IFDJ 1BKBA 4GN3B 2Q2IA 5BR8Q 2I5LX 2KHIA 4YWKA 3CXCA 4PZ7A 2K50A 4EQ5A 4YCUA 1BVSA 1Y1VH 5IY0A 4Y7NH 3PIPA 4RMFA 4IFDI 2B29A 1VQJA 2I5MX 4DV6Q 4LFAL 1L1OB 1VQ9A 4BBSH 1Y1WG 3STBC 4NXML 4GOPB 2HHHL 4X6AH 4JOIC 2IHEA 1VQIA 1GKHA 4OXPA 4FDBA 4A75A 2OTLA 4BY1H 1JT8A 3K0XA 5FLMH 5BR8L 2VL6A 3GDEA 4HJ7A 5IYCG 4L5SA 1SE8A 3CQZH 2VW9A 4DV6L 4HIDA 1K8GA 4DR2L 2MNAA 1Q1EA 3RLOA 4LF4Q 4DNIA 5JEAG 1AE3A 3M4PA 1VCIA 3S14H 2IT1A 3H0GH 4IOCA 1HR0L 5IYBG 1PH3A 4WJ4A 4RG1A 3RNUA 3FP9A 3K80C 4GS3A 3KYHC 1LTLA 4AYBG 3F2BA 4A3DG 4BA1I 3I55A 3DLLA 2XGTA 2C35B
chains in the Genus database with same CATH superfamily
3OW7A 2JA8B 2XRSD 3W1GA 3IFDA 1EIYB 3KJOA 3GTOH 4UY8C 4IUQA 1MIUA 1B44D 2ZXOA 2VUMG 3HEJA 1M90C 5HGQA 2RHSB 3HOUB 1XJVA 4AQYQ 4GLAC 1TT2A 1YNND 4X66L 2ICIA 2SOBA 5I9PA 1JWMD 5IP7G 1DYQA 3MEFA 2EYJA 3P75A 1H9SB 4DK0A 5KYLA 1C8CA 1SDFA 1E2ZA 1EWCA 3CAMA 1PRTF 3K8AA 2MGSA 3AMUA 1TS3A 1BXTA 4AH6A 4JI4L 4LF7Q 2L4NA 1SMYC 3ND9A 3KDFA 4DK6C 3S17H 3QOLA 3QWNA 4FF4A 1HNWQ 1B4OA 1TWGH 5HGTA 3RN2A 5C4XB 5EBDA 2K5QA 3CPFA 5IGBA 3HOZG 4ZLTF 3PO3B 4CHTB 3CMEA 1SNDA 4J8QA 4DK3C 1JB7A 1TWHH 1O7IA 1E2WA 5JJLA 2EY6A 3C1FA 3GTGB 3BG3A 4HN7A 2RSOA 2IW3A 3TEHB 3OTOQ 5C5MA 5C3WA 1A3VA 4B9WA 2UUCL 2GN5A 5JEAH 2NZHA 1O7YA 5IYBH 4A3DH 1PH8A 3I4MB 4EQPA 1D8LA 4H0LC 3HOXG 3HOYB 3BZKA 2IX1A 1ENFA 1KDCA 1VQPA 1N34L 3PMFA 4TRDA 4CDCC 1ESFA 1OXTA 2QDLA 1X9NA 2D9UA 3E6ZX 5C0XG 4RKBA 1MKHA 1EZ6A 1FJGL 5IT9c 2ALYB 2VUMH 4XT1B 4TKOB 1QE6A 4DV1L 3RUZA 1BOSA 1Y8OB 4B3RL 1CKOA 1CK1A 3KJPA 1EY0A 2F0KA 2NB0A 4OWTB 4QIWE 5IP7H 3S1RB 3FMCA 3TP8A 1EY5A 4UHVA 2N8NA 2P5ZX 4IPGA 4CKCA 2KOLA 4G57A 2K03A 1QB5D 3ZJYC 2F4VQ 4O1NA 4HAEA 3W5OA 4Y7NB 5EBCA 1VQMA 4A3IG 2L1BA 1WTPA 3EROA 1KNAA 3CPWA 4A3JG 2K7VA 4JI1Q 2Y0SE 3HOZH 3CF5A 2K14A 3KLRA 1YNNC 2RBMA 1BCPF 2FMMA 3CQZB 1RD9D 2LXKA 2A68D 5CORA 1LTGD 4YCWA 2IWHA 3PQIA 3EBEA 3HP3A 2XTIA 1K8AC 4A3BG 2WKCA 2EPBA 1PVOA 4LF9L 2K01A 5LMUQ 4FP5D 2YTVA 1ASZA 2F3IA 4B3ML 3NHHA 3VR3A 1A3UA 3M4OB 3S2HB 2A6HD 5C3EG 1SMXA 1HFGA 1A8VA 3S16B 2XN9C 5C0XH 5F2DA 1QVGA 3HKZB 4B9XA 2EJGC 2NN6I 4HCEA 4G7ZC 3HOWB 1SSOA 1H9KA 1EY9A 1LTTD 1WCMB 2R7DA 2E75C 2NVQH 1CKMA 1PZID 2DGYA 4O2DA 1CZGA 1DGSA 3DWQA 2RQXA 3JAMi 3NBIA 5JAVA 4K5WA 4A3KB 4K6DA 3M85A 3DWAA 4C3HG 4R4TA 5IGFA 2FXQA 4HIOA 3K5NA 1PFNA 4LF7L 1GD7A 2B2YC 2E74C 3K7UC 3K81C 5JEAJ 2K4KA 3E9HA 1EYGA 2JP1A 4A3IH 3GTMB 4R4CA 1GOZA 1T5EA 4IUUA 4L6TB 4A3JH 3G4SA 1SEBD 1S5BD 3UDFA 1EYCA 4JG2A 5H1SE 3CCSA 2WKDA 3R2IA 1LACA 1HZAA 2KHJA 1DZ1A 1I6VC 3FHWA 3GV3A 3UDIA 1K3RA 1F2YA 1K83H 3MHBA 3TZDA 1XNRQ 1GUWA 1VQOA 1PH5A 3LGJA 3DM3A 2Z8LA 4EGVA 4AYBB 2M9VA 1SN8A 4A3BH 5ELOA 3E3XA 4GNXC 1PH2A 2K33A 2D5DA 5J3BA 3JC66 4N9TA 4DR5Q 1II3A 3IRBA 3IAYA 2I5HA 3TP5A 1UUPA 5C3EH 3D8GA 4XT3B 2MHVA 1SE4A 5D14A 1Q1BA 1W6JA 3OHXC 2F0SA 3DMUA 2XIWA 4R9WA 3G6EA 1X3PA 4ME3A 3VR4A 4QMGA 1KHIA 2A68C 2OQ0A 4JBJA 3T1HL 5I9OA 1VQAA 1VQFA 3BVGA 5C4XG 1E24A 4A3GB 1TWAB 3PO3G 2ZTDA 4LFCL 5M3MB 1Q81C 1UWVA 1KQSA 4RH6A 2MFIA 2N88A 2A73B 1U9RA 4RHSA 2F4VL 1EU3A 1Y69U 4DV5L 2KCTA 3BVZA 4C3HH 4F7XA 3Q0AA 1XMOQ 2H4OA 4CGYB 2A6HC 4C1NI 2F0LA 4HTHA 2KHSA 2J4XA 2F0VA 2EDGA 4TVAB 2JQOA 1BNZA 1EUJA 3E0EA 1BQQT 3GTLB 4WJWA 1VQ8A 3LWEA 4JI1L 2E5LQ 2O4XA 3I4MG 4K5XA 4DV7Q 4Y52H 3HOYG 5BN3A 1PTOB 4JI8Q 2KVMA 3MWYW 4R8IA 2JA8H 1B8AA 5C0XJ 1A62A 4DR3L 5DLQE 1BR9A 1IBLL 2WP8J 2F0OA 5IGEA 4DV3Q 3TREA 1J5EQ 1RJTA 1OO9B 3AFQA 3CCUA 1HJPA 5LMUL 1ZYRD 3GTPB 5C4ZA 3H94A 1S72A 1QOHA 2VNUD 4KHPQ 1X55A 1TY0A 1SFOB 1GXDC 1VQ5A 5CC4A 5KNDA 4IUTA 1Q82C 3I2ZA 1IBMQ 2HD3A 3ITPA 1S40A 3AB9A 2PQAA 4L63B 1IZ6A 3M4QA 2E2IB 1JJGA 2WFWA 4DKAC 4UP7A 1CA6A 2Z9HA 3BDOA 1NTGA 3VYTA 3K7AB 2NVXB 1HQRD 2Z6KA 1IKLA 3I4NB 3D3RA 3K5OA 1MJCA 1HTPA 5EAYA 1IBKL 2WB1E 4DR7Q 2JN4A 4GLVB 2DJGC 4DUYL 2LMCB 5C4XH 1RHPA 2ZJPA 5DEHA 1XPRA 3CCLA 3LNNA 3PO3H 1FD7D 4CJ1B 3VA5A 2JE6I 5C44B 4HMIA 3KF8A 3GTGH 3KF8B 1ASYA 4B08A 2B2UC 2QKIC 1IW7D 4K8IA 1GUTA 5HY6A 1CT1D 1IYVA 1LABA 4PMCA 4N9PA 4ME5A 1RCVD 2EJFC 1QUQA 1GO3E 3AQQA 4LFBL 5E1FA 3DUZA 3I4MH 3OIQA 4ZCKA 3HOYH 2JJQA 3M9BA 3KK7A 1Q7YC 1YJNA 1Q90A 2MQHA 2UUAQ 1XPOA 2R6GA 2ZJQA 3BU2A 2KUMA 3HKZE 3EQLC 5CBEE 2K5VA 1XNRL 3A55A 1YHQA 1I94Q 1GVPA 3HOWG 1B3QA 1VQDA 5A2QL 1WCMG 4QL5A 4RFBA 2WIIB 1ONLA 1FVIA 3NP8A 1JC7A 2C5CA 3V05A 1DOMA 4HCSA 2TMPA 2MJ8A 1E1OA 4LFAQ 1PV4A 3S1RH 4DR5L 3EJIA 3NUCA 1CKNA 4FNFA 1C0AA 1HXYD 2G9HD 3DEPA 3RR5A 2XNAC 1CKNB 4H44C 4PMWA 4GN3B 5M9OA 3SK6A 2B8FA 3CXCA 1I6HB 2K50A 4Y7NH 4IFDI 1LTBD 2B29A 4DV6Q 1ZKOA 1JOKA 4NXML 5JVG3 2IHEA 4OXPA 1JT8A 4XYQA 3D6WA 2F0TA 1XTCD 1ZYRC 5IGDA 5IYCG 4DFAA 3H91A 1STNA 3CQZH 5IGCA 4HIDA 4V190 1Q1EA 1XWEA 4U68A 3SHLA 1AE3A 4K6LA 2N55A 1GHKA 3F2BA 4XQJA 4AYBG 1LTLA 2I07B 2AQ3B 2RVLA 1F2MA 2AUKA 4BA1I 2RDFA 2X69A 3FEWX 3I55A 3DLLA 2XGTA 1SE2A 1SNQA 1VS0A 3DM1A 4JI8L 1B50A 4X66Q 3M4OH 3S2HH 2Q8IB 2M00A 4DAYA 4RGTA 1HNXQ 1KLUD 4IPCA 1EY4A 1LYLA 4NMZA 3S16H 4FYDA 3WWVA 1O7LA 1NBWA 4F8MA 4DV3L 3CCQA 1J5EL 3A5UA 4TSSA 1CHPD 1F9PA 3HOWH 4JI4Q 5EPLA 2HCCA 1WCMH 3VYUA 4A3GG 3TDQA 4KHZA 4IUVA 4YIJA 1IW7C 3MXPA 4KHPL 1ILQA 5M3MG 1IBML 1E3PA 1IYJB 3PUZA 5EJWA 3DEOA 1H9RA 3A74A 1B2TA 4A3KH 4QIWB 3IL8A 2B39A 4BY1G 2E2HH 2YU9B 3J81i 1JB3A 2LY7A 3KFUA 1JCKB 4DNTB 1QILA 2JSOA 4K8JA 3ND8A 1ESRA 4DR7L 1CM9A 3EVQA 1G51A 3GTMH 3S1NB 2UUCQ 2A19A 1YIJA 2I0QA 2AWNA 2PZWA 4JK1C 3D0FA 1B7YB 4P2CB 2Y0SB 5IYCH 1HPCA 1BCPC 4YY3Q 1VQBA 1Y1WB 1N34Q 3K5LA 1PYSB 2Z0SA 2A6ED 3TQYA 4JI7Q 5FJ8G 2EXZA 3ERSX 2WV6D 2EIFA 1SR3A 4OWWB 1NJIC 1X32A 1FJGQ 3A56A 3Q8DA 5I2YA 1WTRA 1HUMA 5GAHC 4XXEA 2CW0D 2XWJB 4GKJL 4KTAA 1Z9FA 2Q8RE 2K05A 1HNZQ 1EFID 1KRSA 2R3ZA 3A0JA 4GLXA 1UE1A 4LUVA 3I4NG 1I94L 3D31A 2X6LA 1VQHA 2ZXPA 2F3VA 4MN3A 5J1ZA 1QWYA 3G6JB 4YHHL 1VQ6A 4K2LA 1I50B 4QUCA 4ZK9B 3KLSA 1L1OA 4QF4A 2PPBC 1G2SA 4EQOA 4HIKA 4A3GH 1TWAH 2ENBA 1RODA 2RHQB 4GOPA 5FO8B 4IPHA 1JWSD 4DR4L 2I46A 5M3MH 5C44G 1SJHD 4JPBW 2VY3A 2EY2A 2NTSA 4H13C 1SROA 1Y1VB 2PZUA 2PO4A 1PZKD 2AQ2B 4KJOA 1TQOA 3KBGA 2UU9Q 2AQ1B 3ER0A 3GTLH 1N36Q 4APVA 5K5PA 3I4OA 4PQXA 3J7AV 4HJ9A 4PZ6A 4LF9Q 2LS01 5JPMC 1PTOH 3GV6A 4B3MQ 2BCOA 4C3IG 5BN5A 3GTJB 1KL9A 1FYCA 1PLFA 2KECA 1DXMA 1J6QA 2PQEA 3WOEA 3PF5A 1PRTB 4J6HA 2MO1A 5FJ8H 3VYRA 1Y8NB 1VQGA 3SR1A 1D1IA 3JAML 2VQEL 3GTPH 1E0BA 1EQTA 5C0XI 3ULJA 1N9WA 1YBYA 1SFOH 5AJ3L 1H9SA 1N33L 4KY6A 4JI5L 1HNXL 5ISRA 3R93A 2E2IH 4POFA 3I90A 1ZEQX 1BBWA 4DV2L 3K7AH 3M4YA 4KKTA 1B9NA 2NYZD 2NVXH 3D4RA 5TSSA 3I4NH 3J81E 1YJWA 1SNMA 2OT2A 1I4XA 2ID0A 1L0YB 1U0LA 4ALPA 1I5FA 1VQLA 2A6EC 2O5IC 2AKWB 2BH2A 3GTQB 2JEBI 4KD3A 1SYBA 1B1ZA 3I8ZA 3RLNA 1E1TA 2WAQE 3EN2A 4KJNA 4NKLA 5AFWA 4X62Q 4HJAA 2CW0C 1AFPA 5C44H 1V8QA 2D0PA 3U50C 3FKIB 4JI3Q 1O80A 5T1IA 4QY7A 1PH9A 4UAIA 3MXGA 4UP9A 1PDQA 1L0XB 4L5TA 1JQYD 4C56C 3L7ZC 5CV4A 1OTCA 2KA7A 4QB4A 1OXUA 4PMBA 3TBIB 3PIP3 4JYAL 3C3LA 2IHFA 3CCMA 4WJ3M 1EQVA 4C3IH 5DAUA 4YY3L 1HQMC 5HURA 4M1UB 1C48A 1KLGD 1SYEA 4JI7L 3KLSX 3V2TA 3SK8A 4BS9A 1G2TA 3SE0A 2RSNA 1EY7A 1WVLA 5M5YB 3T1HQ 3S9WA 4NP5A 1HNZL 1LTSD 1S5CD 3GQBA 4GZYC 2R7ZB 3MC0B 1V43A 5A2QE 4LFCQ 3MAQA 3MXNB 3KF6A 2NVYB 4CKEA 2EYOA 5GADC 1S5DD 4H02A 1BCPB 2KJXA 1R9TB 1K0SA 3KF6B 2MPMA 1VQCA 4ZUJA 4DV5Q 2QGQA 1I6HH 2F0GA 2EYPA 1RTNA 2RF4A 4FF3A 2HIXA 1C4QA 2MO0A 2KQ3A 1EOTA 3I70A 1Q46A 2WB1B 3OOCA 3L9AX 1G8ZD 1SE3A 2J0TD 2Y0SG 1CUKA 1F9SA 1HZ9A 4JW0A 2BA1A 4DR2Q 4P74A 1D5ZC 1WI5A 3PUYA 1X6OA 2UU9L 3TN2A 4DR3Q 2HT1A 1IBLQ 3P7JA 3E9IA 1HZCA 1AN8A 1N36L 1U4RA 2VB3X 4ZAIA 5DNFA 1U4MA 4C2MB 2GVBA 2F0JA 4BXXG 1VDZA 1BBXC 4JOIA 1BDOA 3ERQA 3V96A 2D0OA 4L5RC 4QGUA 4POGA 1V9PA 2ZM6Q 4JI2L 2OTJA 3RD4A 4WFN3 3FVQA 1UAPA 4DAPA 2Z6KC 5KRUA 4LAAA 5C3XA 3MXUA 4Z9CB 1IBKQ 2B2VC 1STGA 5FOBB 4DPGA 3L0OA 4DUYQ 2G5DA 3H3VH 4JI0L 3CD6A 4HSVA 1X65A 4EQNA 1AP0A 4KLKA 2YU9H 2QW7A 3RZOH 4NB3A 1QNKA 1TY2A 2EY5A 4S3SA 4R4QA 3PIO3 5D3IB 4C1NK 1K8OA 3QO2A 1ICFB 2V4DA 3S1NH 5DM73 3NTIA 2JA6B 4X62L 4LFBQ 3CU7A 1KIXA 3GTKB 4LWCA 5IWAQ 2F0FA 4UDUC 2JA8G 4AIMA 4JI3L 1SYDA 2UXCL 3C46A 1NMFA 1Y1WH 3U4ZA 3C1EA 3D4DA 3WDNA 1AZPA 4DV4L 1K3BC 1GUNA 1P16A 4DUZQ 1YHAA 1WTXA 4JBKA 3OWEB 2CWPA 3OSOA 3HOUG 4K0KL 5DM63 4A3EB 2OCEA 3PO2B 3K0YA 4QQBX 1R4PB 1HA6A 4BXXH 3W3AA 1JR0D 2F0NA 3GP7A 2VZAA 4O42A 4OELB 2GA4B 1VMPA 2KBNA 3DHQA 4LW1A 1RL2A 3NK9A 4JC0A 3IFTA 2RDHA 1XX8A 5EGTA 4PNYA 3R3OA 1GM5A 5CV8A 1QVCA 1Z47A 1IHZA 2JYOA 3T1YQ 4A3FH 2ICEC 2F1MA 3CC2A 4OIJA 1DOLA 1I50H 1LT3D 4R4OA 4DR6L 2BE5D 1H9MA 4CJ0B 2D2CC 5FKAC 4X3TA 4NXMQ 4ID6A 1CSPA 2SNMA 1PFSA 2NN6G 3FKIG 1AEXA 4A3MB 2I5LX 2KHIA 4YWKA 4C3JB 4EQ5A 3PIPA 1Y1VH 3BYTB 1PMRA 1NCVA 5CR3A 1VQJA 3T4AC 1X3QA 3P20A 1STYA 5EKKA 4DXFA 2L11A 5KNCA 3NTKA 5FLMH 3MFYA 3GDEA 3OIPA 2CH4W 2VW9A 1K8GA 5IODA 1ICWA 4DR2L 2R93B 3I72A 5CMDA 1D5MC 2X6GA 1NNXA 4LF4Q 2OF1A 3M4PA 4G7OC 4IOCA 4WJ4A 1PH3A 3RNUA 3FP9A 3I73A 3T56B 1LTRD 1ML0D 1VQNA 1Z7TA 2CQAA 1FGBD 2NZ1D 3HOUH 2EY1A 2M2LA 2DY8A 1SYGA 2QEJC 3J81L 2R7ZG 2B2TA 5ELEA 1UNSA 1TIID 1CHQD 2ZM6L 5ELDA 1PH6A 3JAME 5ELFA 1VMCA 1H95A 3L3OC 1JOQA 2CFMA 2QEXA 2BDNA 2YTYA 3KUPA 4XQNA 3E5SA 2UUBQ 2WB1G 1YI2A 3F8TA 3GTQH 1WYDA 3J80i 3SGIA 1MD2D 4DV0L 3TMEA 3HOVB 1W3SA 2NN6H 3SEBA 1LO5D 3X3MA 2E8GA 3FKIH 3EIVA 2A69D 5IGGA 2DUDA 2ZJRA 2TSSA 4KD4A 5JVH3 5JJIA 3WOFA 3RMHA 2F0IA 2N49A 3ULPA 4YCVA 1TVXA 2F0HA 3QB3A 1GUOA 2F03A 1J9OA 2RCNA 4GKJQ 1CA5A 4JI6L 4A3CG 5IWAL 1AH9A 1T5XD 1MGSA 2B2WC 4BA2I 1DJRD 1T9HA 3QJYA 4LK1C 3QOJA 4LJZC 3HKZG 4DU9A 3SK5A 4L5QA 2KCCA 5GAEC 3LWUA 1F2ZA 4DUZL 4OO1I 4DAVA 4ZKCB 4YHHQ 1MBYA 3PIOA 5M5YH 4LF6L 4EX5A 1TWCB 1QCBD 4K5VA 1S5FD 2IX0A 1BBUA 4DAMA 4GOPC 2EYFA 3ONAB 3PUWA 3CCVA 2L12A 1OXXK 2UXBQ 2R7ZH 1RTOA 4DR4Q 2ATWA 3CC7A 4A3KG 1FL0A 3ICEA 2BH8A 2NVYH 1MSGA 3T1YL 1R9TH 4OONA 3BZDB 2OWOA 4J1MA 1JICA 4GKKL 2EYLA 3Q23A 2H5XA 2PW7A 1LT5D 3W2DA 2K32A 1XTDA 3J81c 2JA6G 1CQFA 1MJEA 4GNXB 4BWGB 2SEBD 2WAQB 4LF5Q 3B6YA 5EPJA 5BN4A 5JJZA 5I2XA 1Q3LA 3TS0A 2CWAA 1EFWA 1Y14B 2CCZA 1HH2P 1EYDA 2F0WA 5KIXA 5GROA 4C2MH 4A3EG 3PO2G 2ZXRA 4ODGA 2RA4A 2VQEQ 2L5TA 3CRKC 4E6IA 1DD2A 2KEDA 4A3CH 3S14B 5CYUA 1N32Q 1NMGA 1GHJA 5AJ3Q 4LF4L 1N33Q 1CTMA 4JI5Q 1K28A 2WINB 1WTVA 2NTTA 3UDXA 3NEMA 4LUZA 4DV2Q 2A69C 2VS1A 4LUOA 1KAAA 4OX9Q 2KCMA 1TWFB 1ET9A 1L0WA 2PI2E 1EZ8A 1I4PA 2JA5B 3J7AF 4A3MG 3QIAA 4KY7A 1TS2A 4C3JG 4LMQD 3HOXB 1KC8C 3W1BA 4BY7B 1PXUA 4OHJA 1FNWA 4DA2A 1R4QB 4RAUC 2VB2X 3QG1A 2CKZB 1HRJA 2PNHA 1X3FA 2UUBL 3EA6A 2DNEA 4IPDA 4A4IA 3UE1A 4NXNL 4DF7A 2JA6H 2CH4A 1G291 1DCZA 2Z4HA 4A3LG 4IFDG 4X64L 2R93G 4OGQC 3GTKH 3J7A5 1ENAA 1LV9A 2IX3A 3U9SA 4JYAQ 3H15A 1SNOA 2SNSA 1MHWC 3CRLC 2EE1A 5IE8A 3NXWA 2A74C 3CKIB 4MNOA 5EQ0A 5FLXE 4OEMB 4Q5VA 3OMCA 2L9HA 4IJHA 2Q2HA 4A3EH 3PO2H 1Q8IA 3CHBD 2K5HA 5LMNL 3CC4A 1YNXA 3VR2A 1C9OA 3G7LA 5G3LD 3FPUB 4A76A 5ELBA 3S2DB 4G4KA 3BVMA 1HA5A 1NE3A 3CCEA 2IY5B 2F3WA 2F0PA 1LUZA 4CDDC 2HQLA 5CBAE 1O78A 2Q2TA 2B2UA 1WFQA 4DN4M 1KTKA 2FFKB 1SRUA 4KN7C 1F9RA 2PZTA 4X3UA 2OQKA 2GVAA 1A3TA 2YTXA 3VDYA 1RDPD 1RIPA 1IXRA 1LT4D 2UXBL 1D7QA 1W2BA 4A3MH 3TRZA 2LFNA 3NQTA 4I7ZC 4C3JH 2R92B 3ZYYX 1FR3A 3N6RA 4UPAA 1WOCA 2IPKD 4MHEA 4J15A 1LTAD 1V1QA 3SK4A 4FF2A 2FINB 2QF7A 5E4XA 1KRTA 3BZCA 2QDBA 4A3LH 4IFDH 1S3OA 2R93H 2K5NA 4LF5L 1HR0Q 2JXMB 2HCIA 5COYA 1EWIA 2F0MA 2F0EA 2K6AA 4CKBA 5K36G 4JI2Q 1JORA 2BA0A 1IKMA 1PZJD 3T53B 1PTOD 5IT9L 3K5MA 3O13A 4A93B 2PCFB 1VQ7A 1K8MA 1OXSC 3A8IE 3GO5A 2F0UA 3NQIA 1N32L 3OYYA 3A8JE 1QJOA 4JI0Q 4R4IA 5M5WB 3L2PA 3H3VI 1SLJA 2K04A 3S15B 1JOOA 4OX9L 1A2TA 4KY5A 1SAPA 1TR5A 3S1MB 4OIKA 1HR0W 5FO9B 2DJFC 4P73A 1Q12A 4RHRA 1L2FA 1RKNA 4MIUA 5IIFA 3CP0A 4DR1Q 3HOVH 5M5XB 2WAQG 5A35A 2HIVA 2AWOA 3OPOA 2JA7B 2D62A 2UXCQ 1XNQL 2KCNA 3NE5B 4PZ8A 1U4PA 2V1CC 3K59A 3U58A 1PH7A 2FHTA 4DV4Q 1LLRD 3KDFB 1QNUA 4X65Q 1STEA 4K0KQ 2QCPX 2PMZE 3NBHA 1XMQQ 4P71A 3NBHB 2RDGA 5I4DA 1ZXTA 4B3SQ 1NR4A 3A54A 5K36H 4RCNA 3CCJA 1JMCA 3Q6SA 1CSQA 3RLFA 1KXLA 3GD7A 1YZ6A 4F87A 4IO9A 1TWCH 2JA5G 1YVCA 4DR6Q 3Q22A 1JE5A 1EEID 1HTLD 5EKIA 5E7NA 1JJ2A 4HIMA 3MXNA 2B63B 1JWUD 4BY7G 5FK9C 1XXGA 1FNUA 1UE6A 3FPPA 4IQZA 4HJ8A 1W6KA 5JOBA 1WJJA 2Z6BA 3JAMc 3Q24A 2L0CA 4A3FB 3A7AB 4KV6A 1I3QB 3VYSA 4IFDJ 1G91A 1BKBA 2Q2IA 3RZDB 1PTOC 1BVSA 1YNJD 2R61A 4RKLA 5E4WC 1VQ9A 3D4WA 3N52A 4NDXA 1VF5C 1BUVT 2HUGA 1WD1A 1BO0A 1Y1WG 2HHHL 3R2TA 1EY6A 1VQIA 4A75A 4FDBA 5C4JB 3R8BA 2PYKA 4XYOA 5BR8L 4HJ7A 4IURA 1AW7A 1SE8A 3DWPA 1NR2A 1EU4A 3BDCA 2ZT9C 5NUCA 1J8IA 3MA2B 1NAPA 1EIGA 3S14H 3HRZC 1VCIA 4L8JA 1HR0L 2B2TC 2PW5A 4RG1A 4RGMA 4WORA 1RF2D 1FNVA 5EKLA 1WD0A 2NVTB 1PFBA 1VQEA 1Z6HA 1D6EC 5C4HA 1DM0B 3J80L 2KENA 1EL0A 2ES2A 1PYWD 2LXJA 1TWFH 1GUSA 1Q8KA 2IL8A 1KD1C 1STAA 2XSCA 2HDLA 2JA5H 3TP7A 2YV5A 3NWTA 3DXJC 3S1QB 4DV0Q 3HOXH 2R92G 1D2BA 4B3TQ 1A6XA 4I7AA 4BY7H 4IUPA 1Y1VG 2IJ0A 2KEEA 1P8LA 3K57A 4WRDA 3PF4A 4RA8A 1K0RA 2A8VA 3BDLA 2FMCA 4ZRZA 2E2JB 1H9JA 5FLMG 4AQYL 1C7YA 2DY7A 3SXHA 2BDOA 1SBBB 5ELNA 4DR1L 1K9MC 5FLXL 2Q8TA 4JI6Q 4TQUS 3M3YB 3NWSA 2E2HB 4BBRB 1PH4A 2A5HA 1EEFD 1TU2B 4X3SA 1UEAB 2G9DA 1HNWL 3I7FA 2QA4A 4A93G 1QZGA 4DNRB 4X65L 3SVMA 2EOTA 4LF6Q 1M8AA 4UP8A 3UE0A 4CDEC 3I3CA 5C5LA 1X3GA 3S2DH 1XMQL 1WTOA 3CW2C 3T13A 3MZ5A 3A8KE 5CV7A 4B3SL 1EIHA 2RCFA 1D1KA 1YNJC 3OTOL 3BJUA 1LT6D 5LL6S 1MI2A 5CV5A 1EY8A 1U5KA 2XVSA 1KABA 1F9QA 4GKKQ 2L15A 1I4GA 3A5ZB 5M3FB 1CZWA 4ZUIA 4KKSA 3QR8A 3TS2A 1A2UA 4FXKC 2PI2A 4M8AA 3TP6A 2XWBB 3M7NA 1K73C 5KNBA 2JEAI 2R92H 4FO2A 5G3LF 2JA7G 1M4VA 3F2CA 1V1OA 2Z4IA 1SYCA 3J80c 4FF1A 4NPSA 4QUFA 2NBFA 2ZTEA 3PUVA 1O7ZA 3NELA 1WTQA 4QCLA 2LKVA 3OWFA 1QVFA 4QJFA 1HCZA 1S4ZA 2FJ2A 1QG7A 1YEZA 4OL7A 2SDFA 4DK1A 4N8X1 1B53A 1V1PA 4BBSB 1G6PA 2HDMA 2HQEA 2F4IA 3GTJH 1A63A 1HUNA 1V1PB 4PV1C 1E2VA 4BY1B 3F1ZA 1TXYA 5J39A 3U9OA 1UE7A 4H7BA 5D65A 1VQ4A 2E76C 4DXGA 1SNPA 4K2KA 1VF7A 4KN4C 5FLXc 4A93H 3M7GA 3H0GB 2VQFQ 2B8GA 3H3VC 3NSWA 4LNQA 2RKSA 2B63G 5IYDG 3I56A 5M5WH 1PRTD 2CQOA 2NZOA 5FO7B 1FGUA 1UE5A 5IT9E 2MP1A 4KK7A 4U673 3GTOB 4JBWA 2ASBA 2BOSA 2QILA 4A3FG 3S15H 3EFXD 3UI2A 1G6ZA 1D5XC 1JE4A 3S1MH 1HHVA 1NUCA 1PTOF 1UEBA 4CDFC 4NXNQ 4G7HC 5M5XH 4B3TL 4X64Q 3T16A 2EZVA 2WACA 4ULLA 3P1HA 2JA7H 2PQAB 2K75A 2J7ZA 4ZYSA 4MZ9A 1XYIA 1B9MA 2B2VA 3S17B 4R1JA 1TWGB 2CVRA 1HFNA 1GJXA 5LMNQ 2Q2UA 3U4VA 4X3KA 2BE5C 4ZKBB 4IOAA 1TWHB 4KMUC 3HS0C 1IL8A 3J81j 3G71A 2B2YA 2NWGA 3RN5A 2AUJD 4RCOA 3OW2A 5IOCA 1YHBA 4GN4B 3H09A 1NY4A 1PHJA 1B3AA 2UXDQ 4ABNA 1L1OC 2JK8A 3J7YW 1QUQB 2N3SA 3K58A 4A3DB 3CMAA 4LF8Q 2B63H 5IYDH 3F2UA 4JV5Q 4OWXB 4C3IB 3MFGA 4MTKA 2Z1CA 5JJKA 3A7LA 3VR5A 4IN3A 4JCVE 1IL2A 4HR7B 5LMNW 4YWLA 5L37A 1LM0A 1STHA 1Y8PB 1OXVA 2K5WA 1MSHA 1I3QH 2XRQD 4RWSC 2VUMB 3FRPB 4XTCS 2AHOB 4GNXA 3KBXA 5I6WA 3RZDH 1EQQA 1BCPD 4XQQA 4F88A 1SJED 4BBRG 2DN8A 5IP9G 3H6MA 1CQVA 1PRTC 4IJLA 5ELCA 5C4JH 3NPPA 3AU7A 1PH1A 5KGUA 1E22A 3HGBA 1PYBA 1B70B 4IUNA 3HZXA 4CBVA 3J7ZC 1F77A 4JBMA 5JPNC 2O2LD 3S24A 1N8RC 2JA9A 4RGNA 3HOZB 1PFMA 1ILPA 1XMOL 1VQKA 2PMZB 3MTSA 3X3NA 2NVTH 3PV0A 4HSPA 1STBA 2K5DA 1ET6A 2L55A 4AYBE 1EQRA 4Q0FA 3CCRA 1E7ZA 5M3FG 3URYA 5I6YA 3SDZA 2E5LL 3AYHB 2VQFL 1EYAA 4DV7L 3STBD 3TSSA 4ZQ3A 2OXPA 2EQSA 3S1QH 3E0JA 3D6CA 4HEDA 4OO1G 4GN5A 2F52A 2NUCA 4KKUA 3HG9A 3J80E 4DAYB 1EIFA 1I4HA 3UDGA 1KNEA 2YYZA 4EVOA 2EYHA 3G48A 1PA6A 3MVVA 1XNQQ 1A0IA 1TKWB 3PUXA 5CV6A 2C9OA 2CHBD 4JVZA 3VR6A 3FDTA 4I65A 1EOVA 2E2JH 3K6OA 4IALA 1AZQA 3PCOB 1KDBA 2E2DC 4O0AA 2NVQB 4V0BA 4CJ2C 4R8NA 2B3GA 3F2DA 2K28A 5T1GA 4BBSG 4P75A 3M3YH 4FVMA 2EVBA 1M1KC 3HFZB 1X56A 4P72A 3AEVA 3RZOB 1HZBA 1EWHA 1KDAA 4BBRH 5IP9H 5J22A 5KEEA 5D3DA 4XIGS 1SNCA 1QZHA 3NENA 1DONA 1KAWA 1S5ED 3T51B 2K1BA 1WTWA 1ENCA 1WTHA 3H0GG 4FXGC 3I4LA 4HJ5A 4A3IB 3KLWA 2ZTCA 1IYUA 4A3JB 3BYYB 2H1EA 3C2PA 5GAGC 3PGZA 3KOJA 5CV9A 1GUGA 5E3FA 2MUYA 1BF4A 1LTID 4XDXA 3HKSA 1SMYD 3OMGA 4KHVA 4YWMA 5LHY1 3AFPA 3MEHA 4RGOS 3VA7A 1K83B 2LSSA 4DGZA 4FXDA 4ILWA 3PSIA 2PNRC 4HMJA 2K52A 1NSNS 5M3FH 2UXDL 4DV1Q 4IZ8A 1Q86C 1X3EA 2F0DA 2A1AA 5GQOA 2EYMA 4B3RQ 4A3BB 2R7FA 4K14A 2AMCB 4LF8L 2O5JC 1I4QA 5LL6X 1XPUA 3HOVG 1TS5A 1AE2A 1X54A 2B2WA 3TZUA 4JV5L 1YJ9A 2EXDA 4OO1H 2UUAL 2EJMA 2F0QA 4MTNA 1DOKA 5C3EB 2OEOA 3I91A 1JJCB 2N78A 2HHHQ 3LX0A 3ULLA 4PG3A 4KI0A 5C6AA 5BR8Q 1SXTA 4PZ7A 5IY0A 4YCUA 1I4RA 4RMFA 2I5MX 4LFAL 1L1OB 1CFMA 5EPKA 3BS1A 5KYIA 4BBSH 1SYFA 1TS4A 3STBC 4X6AH 4GOPB 3IKJA 4JOIC 1CI3M 1F2LA 1GKHA 2OTLA 4BY1H 3K0XA 2VL6A 4C3HB 4L5SA 2DNCA 4N8FA 5CGKA 4DV6L 2MNAA 1U4LA 4NW2A 3RLOA 4DNIA 5JEAG 2IT1A 3H0GH 3NTHA 5IYBG 4A3DG 3K80C 4GS3A 3KYHC 1A15A 2VXWA 1YITA 2C35B
chains in the Genus database with same CATH topology
1VQNA 1VS0A 4JI8L 3W1GA 1VQEA 1EIYB 4X66Q 3HOUH 3M4OH 3S2HH 3KJOA 2KENA 3GTOH 4UY8C 1MIUA 1HNXQ 4IPCA 2ES2A 1LYLA 2LXJA 1TWFH 2R7ZG 3S16H 3WWVA 1Q8KA 2VUMG 1KD1C 1NBWA 4DV3L 1M90C 2JA5H 5HGQA 2ZM6L 2YV5A 3CCQA 1J5EL 3A5UA 2RHSB 1PH6A 4DV0Q 3HOXH 2R92G 1XJVA 4AQYQ 4GLAC 3HOWH 4B3TQ 4JI4Q 4X66L 4BY7H 1WCMH 5IP7G 1Y1VG 4A3GG 4KHZA 1H95A 3MEFA 4KHPL 1P8LA 2CFMA 2QEXA 2UUBQ 2YTYA 1K0RA 5M3MG 3PF4A 2WB1G 1YI2A 1IBML 3F8TA 3CAMA 3GTQH 1E3PA 1IYJB 3K8AA 3PUZA 1WYDA 3J80i 3SGIA 3A74A 2A8VA 4A3KH 4DV0L 4BY1G 4AH6A 5FLMG 4AQYL 2E2HH 3J81i 4JI4L 4LF7Q 1C7YA 1W3SA 3KFUA 3KDFA 2E8GA 3FKIH 4DK6C 5ELNA 4DR1L 1K9MC 3S17H 3EIVA 2DUDA 1HNWQ 2ZJRA 4JI6Q 4DR7L 1TWGH 4TQUS 3RN2A 5JJIA 1YITA 1G51A 3CPFA 3GTMH 2N49A 3HOZG 3ULPA 2UUCQ 1PH4A 4YCVA 2A19A 1YIJA 2I0QA 2AWNA 3CMEA 4DK3C 1JB7A 1TWHH 1O7IA 3D0FA 5JJLA 1B7YB 1HNWL 2RCNA 3I7FA 2QA4A 4GKJQ 4JI6L 3TEHB 5IYCH 4A3CG 3OTOQ 4A93G 1QZGA 5IWAL 1AH9A 4X65L 4YY3Q 1VQBA 1N34Q 4LF6Q 4UP8A 2UUCL 3UE0A 4BA2I 1PYSB 1T9HA 2GN5A 2Z0SA 1X3GA 3TQYA 3S2DH 4JI7Q 5FJ8G 1XMQL 3ERSX 2EIFA 1SR3A 2NZHA 3CW2C 4OWWB 1NJIC 5IYBH 1FJGQ 3Q8DA 4B3SL 4A3DH 1PH8A 3HKZG 5GAHC 1D8LA 4L5QA 5GAEC 3HOXG 4GKJL 4DUZL 3OTOL 3BZKA 1Z9FA 4OO1I 3BJUA 2IX1A 4YHHQ 1VQPA 1KRSA 1HNZQ 1N34L 3PIOA 1U5KA 5M5YH 3A0JA 4LF6L 4EX5A 1OXTA 4GKKQ 1X9NA 2L15A 5C0XG 2IX0A 1BBUA 1MKHA 3A5ZB 4DAMA 4GOPC 3PUWA 4GLXA 3CCVA 1UE1A 1OXXK 5IT9c 1FJGL 2R7ZH 2ALYB 4DR4Q 2VUMH 2UXBQ 4LUVA 2ATWA 3I4NG 3CC7A 4A3KG 3TS2A 4DV1L 1FL0A 3D31A 2BH8A 2PI2A 1I94L 3ICEA 1VQHA 2NVYH 4B3RL 3M7NA 4YHHL 1CKOA 3KJPA 4OONA 3T1YL 1R9TH 1K73C 2JEAI 1VQ6A 2R92H 2OWOA 4OWTB 2JA7G 4GKKL 1L1OA 4QIWE 5IP7H 4A3GH 4HIKA 3F2CA 1TWAH 3J80c 4NPSA 2H5XA 2N8NA 2RHQB 4GOPA 2ZTEA 4IPGA 4IPHA 1XTDA 3PUVA 3J81c 3NELA 5M3MH 5C44G 2JA6G 4DR4L 1JJGA 1MJEA 2F4VQ 3ZJYC 2VY3A 1QVFA 4GNXB 1SROA 3W5OA 4QJFA 1VQMA 4A3IG 2UU9Q 4LF5Q 3B6YA 1YEZA 2UXDL 1G6PA 3CPWA 4A3JG 3ER0A 4JI1Q 3GTJH 3GTLH 1N36Q 1A63A 4APVA 3TS0A 2CWAA 2Y0SE 3I4OA 1EFWA 3HOZH 1Y14B 3F1ZA 2CCZA 1HH2P 3CF5A 1TXYA 2K14A 4HJ9A 4PZ6A 5GROA 4C2MH 4LF9Q 4A3EG 3PO2G 1UE7A 1VQ4A 4B3MQ 2VQEQ 2LXKA 1KL9A 4YCWA 5FLXc 4A93H 4A3CH 1N32Q 3EBEA 1NMGA 2VQFQ 5AJ3Q 4LF4L 1N33Q 1J6QA 4JI5Q 4LNQA 2XTIA 1K8AC 4A3BG 3PF5A 2B63G 1PVOA 5IYDG 2MO1A 4LF9L 5FJ8H 3I56A 5LMUQ 5M5WH 1VQGA 2YTVA 3UDXA 2CQOA 3NEMA 2NZOA 4LUZA 1ASZA 2F3IA 2VQEL 4DV2Q 4B3ML 3GTPH 2VS1A 1FGUA 1UE5A 4LUOA 4OX9Q 5C0XI 3ULJA 4JBWA 1N9WA 1YBYA 5C3EG 1SMXA 1SFOH 2KCMA 5AJ3L 2ASBA 1N33L 1A8VA 3S15H 4JI5L 4A3FG 1HNXL 1L0WA 2E2IH 2PI2E 3S1MH 4POFA 1QVGA 4A3MG 1BBWA 2NN6I 4DV2L 3K7AH 1UEBA 1KC8C 2NVXH 3W1BA 4NXNQ 3I4NH 2R7DA 5M5XH 1YJWA 2NVQH 4B3TL 1CKMA 2ID0A 4X64Q 2DGYA 1U0LA 4O2DA 4ALPA 1I5FA 1DGSA 1VQLA 2AKWB 1PH1A 2CKZB 2JA7H 2PQAB 3JAMi 2K75A 2BH2A 2PNHA 1X3FA 2UUBL 2JEBI 3RLNA 1E1TA 2WAQE 3EN2A 4IPDA 4X62Q 3M85A 4A4IA 3UE1A 4R4TA 4HJAA 4NXNL 4MZ9A 5C44H 2JA6H 2D0PA 3U50C 2FXQA 1G291 4HIOA 4LF7L 4A3LG 4IFDG 4X64L 2R93G 1GD7A 3GTKH 4JI3Q 3J7A5 4R1JA 3K7UC 3K81C 5JEAJ 2K4KA 4QY7A 4JYAQ 1PH9A 3E9HA 3H15A 1EYGA 4UP9A 5LMNQ 4A3IH 2Q2UA 4R4CA 3U4VA 4L5TA 5IE8A 4A3JH 3G4SA 4IOAA 4MNOA 3L7ZC 3UDFA 1OTCA 4JG2A 1OXUA 4IJHA 2Q2HA 5H1SE 3J81j 3G71A 3RN5A 3CCSA 4JYAL 4A3EH 3PO2H 1HZAA 2KHJA 3OW2A 2K5HA 2IHFA 3FHWA 3CCMA 5LMNL 3CC4A 1YNXA 3UDIA 1YHBA 1C9OA 4GN4B 1K3RA 4C3IH 4WJ3M 1K83H 1NY4A 1PHJA 4YY3L 4A76A 1XNRQ 2UXDQ 1L1OC 2JK8A 1VQOA 1NE3A 1PH5A 1QUQB 3CCEA 3LGJA 4JI7L 2N3SA 3DM3A 2IY5B 1LUZA 2HQLA 3CMAA 1SN8A 4LF8Q 2B63H 5ELOA 2Q2TA 4A3BH 5IYDH 4GNXC 1WFQA 4JV5Q 4OWXB 1PH2A 1SRUA 5J3BA 5JJKA 3T1HQ 3JC66 1HNZL 4DR5Q 4JCVE 3IRBA 1IL2A 2I5HA 5C3EH 2OQKA 2GVAA 5LMNW 2YTXA 4YWLA 4A3FH 1LM0A 3VDYA 1V43A 1OXVA 1Q1BA 4LFCQ 1I3QH 1RIPA 1IXRA 3MXNB 4XTCS 2UXBL 3KF6A 1W2BA 1D7QA 2AHOB 3G6EA 4GNXA 5GADC 4A3MH 4ME3A 3TRZA 3RZDH 4H02A 1KHIA 2OQ0A 3KF6B 4JBJA 1VQCA 4C3JH 4DV5Q 2QGQA 1VQAA 1VQFA 3T1HL 1EQQA 1I6HH 5C4XG 1E24A 2RF4A 4UPAA 2HIXA 1WOCA 3PO3G 4BBRG 2MO0A 2ZTDA 4J15A 5IP9G 4LFCL 1V1QA 1Q46A 1Q81C 1UWVA 4IJLA 1KQSA 2MFIA 5C4JH 2F4VL 4DV5L 2KCTA 1CUKA 2Y0SG 1HZ9A 1KRTA 4C3HH 1E22A 2BA1A 4DR2Q 1XMOQ 1PYBA 1B70B 4P74A 3BZCA 4A3LH 3J7ZC 1S3OA 1WI5A 3PUYA 2R93H 2K5NA 4TVAB 4JBMA 2JQOA 1X6OA 2UU9L 1EUJA 3E0EA 1HR0Q 4DR3Q 4LF5L 3S24A 1N8RC 2HT1A 1EWIA 2JA9A 1IBLQ 3E9IA 1VQ8A 1HZCA 4JI1L 2E5LQ 1N36L 5K36G 3I4MG 4JI2Q 4DV7Q 4Y52H 3HOYG 2BA0A 1XMOL 1VQKA 2NVTH 4JI8Q 3PV0A 2GVBA 2JA8H 4BXXG 1B8AA 5C0XJ 1A62A 4JOIA 4DR3L 5DLQE 4AYBE 1EQRA 2D0OA 3CCRA 1IBLL 2WP8J 1E7ZA 5M3FG 4QGUA 1VQ7A 4L5RC 4DV3Q 3TREA 2E5LL 1OXSC 1N32L 3GO5A 3AYHB 1V9PA 2ZM6Q 3OYYA 2VQFL 3STBD 4DV7L 1J5EQ 4JI2L 4POGA 2OTJA 4JI0Q 4R4IA 2EQSA 3AFQA 3CCUA 2Z6KC 3S1QH 1HJPA 5LMUL 4OO1G 4GN5A 2F52A 1S72A 3L2PA 3H3VI 1SLJA 4KHPQ 1X55A 2VNUD 1IBKQ 4DAYB 1EIFA 3UDGA 1VQ5A 1Q82C 2YYZA 3I2ZA 1IBMQ 4OX9L 1S40A 4DPGA 3L0OA 2PQAA 3G48A 4DUYQ 1PA6A 1IZ6A 3M4QA 1XNQQ 1A0IA 3H3VH 2WFWA 3PUXA 4DKAC 4UP7A 1HR0W 4JI0L 3CD6A 1X65A 4P73A 1NTGA 4KLKA 1EOVA 1Q12A 2E2JH 1L2FA 2YU9H 2Z6KA 3CP0A 3RZOH 3PCOB 4DR1Q 3HOVH 1MJCA 4O0AA 2WAQG 4NB3A 5EAYA 1IBKL 2WB1E 2HIVA 2B3GA 3F2DA 4DR7Q 2AWOA 4BBSG 4R4QA 4GLVB 4P75A 4DUYL 3M3YH 2D62A 2UXCQ 1XNQL 5C4XH 1M1KC 3HFZB 4PZ8A 1X56A 2ZJPA 4P72A 3AEVA 1XPRA 3CCLA 3S1NH 2V1CC 3U58A 1HZBA 3PO3H 4BBRH 5IP9H 1PH7A 2JE6I 4XIGS 4X62L 1QZHA 4DV4Q 3NENA 4LFBQ 3KDFB 1KIXA 1KAWA 4LWCA 3GTGH 5IWAQ 3KF8B 4X65Q 2JA8G 1ASYA 4K0KQ 4AIMA 4JI3L 2UXCL 3H0GG 4HJ5A 1NMFA 2PMZE 1Y1WH 5HY6A 3KLWA 3U4ZA 2ZTCA 1XMQQ 4P71A 3NBHB 4B3SQ 1QUQA 5GAGC 1GO3E 4DV4L 3AQQA 3PGZA 4LFBL 3KOJA 1P16A 4DUZQ 3I4MH 1YHAA 3CCJA 1JMCA 4JBKA 2CWPA 3HOUG 3HOYH 1CSQA 2JJQA 3RLFA 4K0KL 3HKSA 3M9BA 2OCEA 1KXLA 1Q7YC 4YWMA 3GD7A 1YJNA 3AFPA 4QQBX 2MQHA 1YZ6A 2UUAQ 1XPOA 2LSSA 4BXXH 2R6GA 4IO9A 3BU2A 2ZJQA 1TWCH 2JA5G 3HKZE 1YVCA 4DR6Q 2VZAA 1JE5A 3PSIA 2K52A 2K5VA 2KBNA 4LW1A 5M3FH 1RL2A 1XNRL 4JC0A 5E7NA 4DV1Q 1YHQA 1GVPA 1JJ2A 1Q86C 4HIMA 1X3EA 1VQDA 2A1AA 5GQOA 1I94Q 3HOWG 4B3RQ 4BY7G 2R7FA 1GM5A 1WCMG 4QL5A 1QVCA 1Z47A 3T1YQ 2AMCB 1FVIA 1UE6A 4LF8L 3CC2A 1XPUA 3HOVG 1X54A 1AE2A 4JV5L 1YJ9A 2EXDA 4HJ8A 2UUAL 1I50H 1E1OA 1WJJA 4R4OA 4LFAQ 1PV4A 3S1RH 4MTNA 4DR6L 3JAMc 4DR5L 1JJCB 1CKNA 4NXMQ 1C0AA 2N78A 2HHHQ 3ULLA 1CSPA 3RR5A 4PG3A 4KI0A 1PFSA 2NN6G 1CKNB 4PMWA 3FKIG 4IFDJ 1BKBA 4GN3B 2Q2IA 5BR8Q 2I5LX 2KHIA 4YWKA 3CXCA 4PZ7A 2K50A 4EQ5A 4YCUA 1BVSA 1Y1VH 5IY0A 4Y7NH 3PIPA 4RMFA 4IFDI 2B29A 1VQJA 2I5MX 4DV6Q 4LFAL 1L1OB 1VQ9A 4BBSH 1Y1WG 3STBC 4NXML 4GOPB 2HHHL 4X6AH 4JOIC 2IHEA 1VQIA 1GKHA 4OXPA 4FDBA 4A75A 2OTLA 4BY1H 1JT8A 3K0XA 5FLMH 5BR8L 2VL6A 3GDEA 4HJ7A 5IYCG 4L5SA 1SE8A 3CQZH 2VW9A 4DV6L 4HIDA 1K8GA 4DR2L 2MNAA 1Q1EA 3RLOA 4LF4Q 4DNIA 5JEAG 1AE3A 3M4PA 1VCIA 3S14H 2IT1A 3H0GH 4IOCA 1HR0L 5IYBG 1PH3A 4WJ4A 4RG1A 3RNUA 3FP9A 3K80C 4GS3A 3KYHC 1LTLA 4AYBG 3F2BA 4A3DG 4BA1I 3I55A 3DLLA 2XGTA 2C35B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQN A;  1VS0 A;  4JI8 L;  3W1G A;  1VQE A;  1EIY B;  4X66 Q;  3HOU H;  3M4O H;  3S2H H;  3KJO A;  2KEN A;  3GTO H;  4UY8 C;  1MIU A;  1HNX Q;  4IPC A;  2ES2 A;  1LYL A;  2LXJ A;  1TWF H;  2R7Z G;  3S16 H;  3WWV A;  1Q8K A;  2VUM G;  1KD1 C;  1NBW A;  4DV3 L;  1M90 C;  2JA5 H;  5HGQ A;  2ZM6 L;  2YV5 A;  3CCQ A;  1J5E L;  3A5U A;  2RHS B;  1PH6 A;  4DV0 Q;  3HOX H;  2R92 G;  1XJV A;  4AQY Q;  4GLA C;  3HOW H;  4B3T Q;  4JI4 Q;  4X66 L;  4BY7 H;  1WCM H;  5IP7 G;  1Y1V G;  4A3G G;  4KHZ A;  1H95 A;  3MEF A;  4KHP L;  1P8L A;  2CFM A;  2QEX A;  2UUB Q;  2YTY A;  1K0R A;  5M3M G;  3PF4 A;  2WB1 G;  1YI2 A;  1IBM L;  3F8T A;  3CAM A;  3GTQ H;  1E3P A;  1IYJ B;  3K8A A;  3PUZ A;  1WYD A;  3J80 i;  3SGI A;  3A74 A;  2A8V A;  4A3K H;  4DV0 L;  4BY1 G;  4AH6 A;  5FLM G;  4AQY L;  2E2H H;  3J81 i;  4JI4 L;  4LF7 Q;  1C7Y A;  1W3S A;  3KFU A;  3KDF A;  2E8G A;  3FKI H;  4DK6 C;  5ELN A;  4DR1 L;  1K9M C;  3S17 H;  3EIV A;  2DUD A;  1HNW Q;  2ZJR A;  4JI6 Q;  4DR7 L;  1TWG H;  4TQU S;  3RN2 A;  5JJI A;  1YIT A;  1G51 A;  3CPF A;  3GTM H;  2N49 A;  3HOZ G;  3ULP A;  2UUC Q;  1PH4 A;  4YCV A;  2A19 A;  1YIJ A;  2I0Q A;  2AWN A;  3CME A;  4DK3 C;  1JB7 A;  1TWH H;  1O7I A;  3D0F A;  5JJL A;  1B7Y B;  1HNW L;  2RCN A;  3I7F A;  2QA4 A;  4GKJ Q;  4JI6 L;  3TEH B;  5IYC H;  4A3C G;  3OTO Q;  4A93 G;  1QZG A;  5IWA L;  1AH9 A;  4X65 L;  4YY3 Q;  1VQB A;  1N34 Q;  4LF6 Q;  4UP8 A;  2UUC L;  3UE0 A;  4BA2 I;  1PYS B;  1T9H A;  2GN5 A;  2Z0S A;  1X3G A;  3TQY A;  3S2D H;  4JI7 Q;  5FJ8 G;  1XMQ L;  3ERS X;  2EIF A;  1SR3 A;  2NZH A;  3CW2 C;  4OWW B;  1NJI C;  5IYB H;  1FJG Q;  3Q8D A;  4B3S L;  4A3D H;  1PH8 A;  3HKZ G;  5GAH C;  1D8L A;  4L5Q A;  5GAE C;  3HOX G;  4GKJ L;  4DUZ L;  3OTO L;  3BZK A;  1Z9F A;  4OO1 I;  3BJU A;  2IX1 A;  4YHH Q;  1VQP A;  1KRS A;  1HNZ Q;  1N34 L;  3PIO A;  1U5K A;  5M5Y H;  3A0J A;  4LF6 L;  4EX5 A;  1OXT A;  4GKK Q;  1X9N A;  2L15 A;  5C0X G;  2IX0 A;  1BBU A;  1MKH A;  3A5Z B;  4DAM A;  4GOP C;  3PUW A;  4GLX A;  3CCV A;  1UE1 A;  1OXX K;  5IT9 c;  1FJG L;  2R7Z H;  2ALY B;  4DR4 Q;  2VUM H;  2UXB Q;  4LUV A;  2ATW A;  3I4N G;  3CC7 A;  4A3K G;  3TS2 A;  4DV1 L;  1FL0 A;  3D31 A;  2BH8 A;  2PI2 A;  1I94 L;  3ICE A;  1VQH A;  2NVY H;  4B3R L;  3M7N A;  4YHH L;  1CKO A;  3KJP A;  4OON A;  3T1Y L;  1R9T H;  1K73 C;  2JEA I;  1VQ6 A;  2R92 H;  2OWO A;  4OWT B;  2JA7 G;  4GKK L;  1L1O A;  4QIW E;  5IP7 H;  4A3G H;  4HIK A;  3F2C A;  1TWA H;  3J80 c;  4NPS A;  2H5X A;  2N8N A;  2RHQ B;  4GOP A;  2ZTE A;  4IPG A;  4IPH A;  1XTD A;  3PUV A;  3J81 c;  3NEL A;  5M3M H;  5C44 G;  2JA6 G;  4DR4 L;  1JJG A;  1MJE A;  2F4V Q;  3ZJY C;  2VY3 A;  1QVF A;  4GNX B;  1SRO A;  3W5O A;  4QJF A;  1VQM A;  4A3I G;  2UU9 Q;  4LF5 Q;  3B6Y A;  1YEZ A;  2UXD L;  1G6P A;  3CPW A;  4A3J G;  3ER0 A;  4JI1 Q;  3GTJ H;  3GTL H;  1N36 Q;  1A63 A;  4APV A;  3TS0 A;  2CWA A;  2Y0S E;  3I4O A;  1EFW A;  3HOZ H;  1Y14 B;  3F1Z A;  2CCZ A;  1HH2 P;  3CF5 A;  1TXY A;  2K14 A;  4HJ9 A;  4PZ6 A;  5GRO A;  4C2M H;  4LF9 Q;  4A3E G;  3PO2 G;  1UE7 A;  1VQ4 A;  4B3M Q;  2VQE Q;  2LXK A;  1KL9 A;  4YCW A;  5FLX c;  4A93 H;  4A3C H;  1N32 Q;  3EBE A;  1NMG A;  2VQF Q;  5AJ3 Q;  4LF4 L;  1N33 Q;  1J6Q A;  4JI5 Q;  4LNQ A;  2XTI A;  1K8A C;  4A3B G;  3PF5 A;  2B63 G;  1PVO A;  5IYD G;  2MO1 A;  4LF9 L;  5FJ8 H;  3I56 A;  5LMU Q;  5M5W H;  1VQG A;  2YTV A;  3UDX A;  2CQO A;  3NEM A;  2NZO A;  4LUZ A;  1ASZ A;  2F3I A;  2VQE L;  4DV2 Q;  4B3M L;  3GTP H;  2VS1 A;  1FGU A;  1UE5 A;  4LUO A;  4OX9 Q;  5C0X I;  3ULJ A;  4JBW A;  1N9W A;  1YBY A;  5C3E G;  1SMX A;  1SFO H;  2KCM A;  5AJ3 L;  2ASB A;  1N33 L;  1A8V A;  3S15 H;  4JI5 L;  4A3F G;  1HNX L;  1L0W A;  2E2I H;  2PI2 E;  3S1M H;  4POF A;  1QVG A;  4A3M G;  1BBW A;  2NN6 I;  4DV2 L;  3K7A H;  1UEB A;  1KC8 C;  2NVX H;  3W1B A;  4NXN Q;  3I4N H;  2R7D A;  5M5X H;  1YJW A;  2NVQ H;  4B3T L;  1CKM A;  2ID0 A;  4X64 Q;  2DGY A;  1U0L A;  4O2D A;  4ALP A;  1I5F A;  1DGS A;  1VQL A;  2AKW B;  1PH1 A;  2CKZ B;  2JA7 H;  2PQA B;  3JAM i;  2K75 A;  2BH2 A;  2PNH A;  1X3F A;  2UUB L;  2JEB I;  3RLN A;  1E1T A;  2WAQ E;  3EN2 A;  4IPD A;  4X62 Q;  3M85 A;  4A4I A;  3UE1 A;  4R4T A;  4HJA A;  4NXN L;  4MZ9 A;  5C44 H;  2JA6 H;  2D0P A;  3U50 C;  2FXQ A;  1G29 1;  4HIO A;  4LF7 L;  4A3L G;  4IFD G;  4X64 L;  2R93 G;  1GD7 A;  3GTK H;  4JI3 Q;  3J7A 5;  4R1J A;  3K7U C;  3K81 C;  5JEA J;  2K4K A;  4QY7 A;  4JYA Q;  1PH9 A;  3E9H A;  3H15 A;  1EYG A;  4UP9 A;  5LMN Q;  4A3I H;  2Q2U A;  4R4C A;  3U4V A;  4L5T A;  5IE8 A;  4A3J H;  3G4S A;  4IOA A;  4MNO A;  3L7Z C;  3UDF A;  1OTC A;  4JG2 A;  1OXU A;  4IJH A;  2Q2H A;  5H1S E;  3J81 j;  3G71 A;  3RN5 A;  3CCS A;  4JYA L;  4A3E H;  3PO2 H;  1HZA A;  2KHJ A;  3OW2 A;  2K5H A;  2IHF A;  3FHW A;  3CCM A;  5LMN L;  3CC4 A;  1YNX A;  3UDI A;  1YHB A;  1C9O A;  4GN4 B;  1K3R A;  4C3I H;  4WJ3 M;  1K83 H;  1NY4 A;  1PHJ A;  4YY3 L;  4A76 A;  1XNR Q;  2UXD Q;  1L1O C;  2JK8 A;  1VQO A;  1NE3 A;  1PH5 A;  1QUQ B;  3CCE A;  3LGJ A;  4JI7 L;  2N3S A;  3DM3 A;  2IY5 B;  1LUZ A;  2HQL A;  3CMA A;  1SN8 A;  4LF8 Q;  2B63 H;  5ELO A;  2Q2T A;  4A3B H;  5IYD H;  4GNX C;  1WFQ A;  4JV5 Q;  4OWX B;  1PH2 A;  1SRU A;  5J3B A;  5JJK A;  3T1H Q;  3JC6 6;  1HNZ L;  4DR5 Q;  4JCV E;  3IRB A;  1IL2 A;  2I5H A;  5C3E H;  2OQK A;  2GVA A;  5LMN W;  2YTX A;  4YWL A;  4A3F H;  1LM0 A;  3VDY A;  1V43 A;  1OXV A;  1Q1B A;  4LFC Q;  1I3Q H;  1RIP A;  1IXR A;  3MXN B;  4XTC S;  2UXB L;  3KF6 A;  1W2B A;  1D7Q A;  2AHO B;  3G6E A;  4GNX A;  5GAD C;  4A3M H;  4ME3 A;  3TRZ A;  3RZD H;  4H02 A;  1KHI A;  2OQ0 A;  3KF6 B;  4JBJ A;  1VQC A;  4C3J H;  4DV5 Q;  2QGQ A;  1VQA A;  1VQF A;  3T1H L;  1EQQ A;  1I6H H;  5C4X G;  1E24 A;  2RF4 A;  4UPA A;  2HIX A;  1WOC A;  3PO3 G;  4BBR G;  2MO0 A;  2ZTD A;  4J15 A;  5IP9 G;  4LFC L;  1V1Q A;  1Q46 A;  1Q81 C;  1UWV A;  4IJL A;  1KQS A;  2MFI A;  5C4J H;  2F4V L;  4DV5 L;  2KCT A;  1CUK A;  2Y0S G;  1HZ9 A;  1KRT A;  4C3H H;  1E22 A;  2BA1 A;  4DR2 Q;  1XMO Q;  1PYB A;  1B70 B;  4P74 A;  3BZC A;  4A3L H;  3J7Z C;  1S3O A;  1WI5 A;  3PUY A;  2R93 H;  2K5N A;  4TVA B;  4JBM A;  2JQO A;  1X6O A;  2UU9 L;  1EUJ A;  3E0E A;  1HR0 Q;  4DR3 Q;  4LF5 L;  3S24 A;  1N8R C;  2HT1 A;  1EWI A;  2JA9 A;  1IBL Q;  3E9I A;  1VQ8 A;  1HZC A;  4JI1 L;  2E5L Q;  1N36 L;  5K36 G;  3I4M G;  4JI2 Q;  4DV7 Q;  4Y52 H;  3HOY G;  2BA0 A;  1XMO L;  1VQK A;  2NVT H;  4JI8 Q;  3PV0 A;  2GVB A;  2JA8 H;  4BXX G;  1B8A A;  5C0X J;  1A62 A;  4JOI A;  4DR3 L;  5DLQ E;  4AYB E;  1EQR A;  2D0O A;  3CCR A;  1IBL L;  2WP8 J;  1E7Z A;  5M3F G;  4QGU A;  1VQ7 A;  4L5R C;  4DV3 Q;  3TRE A;  2E5L L;  1OXS C;  1N32 L;  3GO5 A;  3AYH B;  1V9P A;  2ZM6 Q;  3OYY A;  2VQF L;  3STB D;  4DV7 L;  1J5E Q;  4JI2 L;  4POG A;  2OTJ A;  4JI0 Q;  4R4I A;  2EQS A;  3AFQ A;  3CCU A;  2Z6K C;  3S1Q H;  1HJP A;  5LMU L;  4OO1 G;  4GN5 A;  2F52 A;  1S72 A;  3L2P A;  3H3V I;  1SLJ A;  4KHP Q;  1X55 A;  2VNU D;  1IBK Q;  4DAY B;  1EIF A;  3UDG A;  1VQ5 A;  1Q82 C;  2YYZ A;  3I2Z A;  1IBM Q;  4OX9 L;  1S40 A;  4DPG A;  3L0O A;  2PQA A;  3G48 A;  4DUY Q;  1PA6 A;  1IZ6 A;  3M4Q A;  1XNQ Q;  1A0I A;  3H3V H;  2WFW A;  3PUX A;  4DKA C;  4UP7 A;  1HR0 W;  4JI0 L;  3CD6 A;  1X65 A;  4P73 A;  1NTG A;  4KLK A;  1EOV A;  1Q12 A;  2E2J H;  1L2F A;  2YU9 H;  2Z6K A;  3CP0 A;  3RZO H;  3PCO B;  4DR1 Q;  3HOV H;  1MJC A;  4O0A A;  2WAQ G;  4NB3 A;  5EAY A;  1IBK L;  2WB1 E;  2HIV A;  2B3G A;  3F2D A;  4DR7 Q;  2AWO A;  4BBS G;  4R4Q A;  4GLV B;  4P75 A;  4DUY L;  3M3Y H;  2D62 A;  2UXC Q;  1XNQ L;  5C4X H;  1M1K C;  3HFZ B;  4PZ8 A;  1X56 A;  2ZJP A;  4P72 A;  3AEV A;  1XPR A;  3CCL A;  3S1N H;  2V1C C;  3U58 A;  1HZB A;  3PO3 H;  4BBR H;  5IP9 H;  1PH7 A;  2JE6 I;  4XIG S;  4X62 L;  1QZH A;  4DV4 Q;  3NEN A;  4LFB Q;  3KDF B;  1KIX A;  1KAW A;  4LWC A;  3GTG H;  5IWA Q;  3KF8 B;  4X65 Q;  2JA8 G;  1ASY A;  4K0K Q;  4AIM A;  4JI3 L;  2UXC L;  3H0G G;  4HJ5 A;  1NMF A;  2PMZ E;  1Y1W H;  5HY6 A;  3KLW A;  3U4Z A;  2ZTC A;  1XMQ Q;  4P71 A;  3NBH B;  4B3S Q;  1QUQ A;  5GAG C;  1GO3 E;  4DV4 L;  3AQQ A;  3PGZ A;  4LFB L;  3KOJ A;  1P16 A;  4DUZ Q;  3I4M H;  1YHA A;  3CCJ A;  1JMC A;  4JBK A;  2CWP A;  3HOU G;  3HOY H;  1CSQ A;  2JJQ A;  3RLF A;  4K0K L;  3HKS A;  3M9B A;  2OCE A;  1KXL A;  1Q7Y C;  4YWM A;  3GD7 A;  1YJN A;  3AFP A;  4QQB X;  2MQH A;  1YZ6 A;  2UUA Q;  1XPO A;  2LSS A;  4BXX H;  2R6G A;  4IO9 A;  3BU2 A;  2ZJQ A;  1TWC H;  2JA5 G;  3HKZ E;  1YVC A;  4DR6 Q;  2VZA A;  1JE5 A;  3PSI A;  2K52 A;  2K5V A;  2KBN A;  4LW1 A;  5M3F H;  1RL2 A;  1XNR L;  4JC0 A;  5E7N A;  4DV1 Q;  1YHQ A;  1GVP A;  1JJ2 A;  1Q86 C;  4HIM A;  1X3E A;  1VQD A;  2A1A A;  5GQO A;  1I94 Q;  3HOW G;  4B3R Q;  4BY7 G;  2R7F A;  1GM5 A;  1WCM G;  4QL5 A;  1QVC A;  1Z47 A;  3T1Y Q;  2AMC B;  1FVI A;  1UE6 A;  4LF8 L;  3CC2 A;  1XPU A;  3HOV G;  1X54 A;  1AE2 A;  4JV5 L;  1YJ9 A;  2EXD A;  4HJ8 A;  2UUA L;  1I50 H;  1E1O A;  1WJJ A;  4R4O A;  4LFA Q;  1PV4 A;  3S1R H;  4MTN A;  4DR6 L;  3JAM c;  4DR5 L;  1JJC B;  1CKN A;  4NXM Q;  1C0A A;  2N78 A;  2HHH Q;  3ULL A;  1CSP A;  3RR5 A;  4PG3 A;  4KI0 A;  1PFS A;  2NN6 G;  1CKN B;  4PMW A;  3FKI G;  4IFD J;  1BKB A;  4GN3 B;  2Q2I A;  5BR8 Q;  2I5L X;  2KHI A;  4YWK A;  3CXC A;  4PZ7 A;  2K50 A;  4EQ5 A;  4YCU A;  1BVS A;  1Y1V H;  5IY0 A;  4Y7N H;  3PIP A;  4RMF A;  4IFD I;  2B29 A;  1VQJ A;  2I5M X;  4DV6 Q;  4LFA L;  1L1O B;  1VQ9 A;  4BBS H;  1Y1W G;  3STB C;  4NXM L;  4GOP B;  2HHH L;  4X6A H;  4JOI C;  2IHE A;  1VQI A;  1GKH A;  4OXP A;  4FDB A;  4A75 A;  2OTL A;  4BY1 H;  1JT8 A;  3K0X A;  5FLM H;  5BR8 L;  2VL6 A;  3GDE A;  4HJ7 A;  5IYC G;  4L5S A;  1SE8 A;  3CQZ H;  2VW9 A;  4DV6 L;  4HID A;  1K8G A;  4DR2 L;  2MNA A;  1Q1E A;  3RLO A;  4LF4 Q;  4DNI A;  5JEA G;  1AE3 A;  3M4P A;  1VCI A;  3S14 H;  2IT1 A;  3H0G H;  4IOC A;  1HR0 L;  5IYB G;  1PH3 A;  4WJ4 A;  4RG1 A;  3RNU A;  3FP9 A;  3K80 C;  4GS3 A;  3KYH C;  1LTL A;  4AYB G;  3F2B A;  4A3D G;  4BA1 I;  3I55 A;  3DLL A;  2XGT A;  2C35 B; 
#chains in the Genus database with same CATH topology
 3OW7 A;  2JA8 B;  2XRS D;  3W1G A;  3IFD A;  1EIY B;  3KJO A;  3GTO H;  4UY8 C;  4IUQ A;  1MIU A;  1B44 D;  2ZXO A;  2VUM G;  3HEJ A;  1M90 C;  5HGQ A;  2RHS B;  3HOU B;  1XJV A;  4AQY Q;  4GLA C;  1TT2 A;  1YNN D;  4X66 L;  2ICI A;  2SOB A;  5I9P A;  1JWM D;  5IP7 G;  1DYQ A;  3MEF A;  2EYJ A;  3P75 A;  1H9S B;  4DK0 A;  5KYL A;  1C8C A;  1SDF A;  1E2Z A;  1EWC A;  3CAM A;  1PRT F;  3K8A A;  2MGS A;  3AMU A;  1TS3 A;  1BXT A;  4AH6 A;  4JI4 L;  4LF7 Q;  2L4N A;  1SMY C;  3ND9 A;  3KDF A;  4DK6 C;  3S17 H;  3QOL A;  3QWN A;  4FF4 A;  1HNW Q;  1B4O A;  1TWG H;  5HGT A;  3RN2 A;  5C4X B;  5EBD A;  2K5Q A;  3CPF A;  5IGB A;  3HOZ G;  4ZLT F;  3PO3 B;  4CHT B;  3CME A;  1SND A;  4J8Q A;  4DK3 C;  1JB7 A;  1TWH H;  1O7I A;  1E2W A;  5JJL A;  2EY6 A;  3C1F A;  3GTG B;  3BG3 A;  4HN7 A;  2RSO A;  2IW3 A;  3TEH B;  3OTO Q;  5C5M A;  5C3W A;  1A3V A;  4B9W A;  2UUC L;  2GN5 A;  5JEA H;  2NZH A;  1O7Y A;  5IYB H;  4A3D H;  1PH8 A;  3I4M B;  4EQP A;  1D8L A;  4H0L C;  3HOX G;  3HOY B;  3BZK A;  2IX1 A;  1ENF A;  1KDC A;  1VQP A;  1N34 L;  3PMF A;  4TRD A;  4CDC C;  1ESF A;  1OXT A;  2QDL A;  1X9N A;  2D9U A;  3E6Z X;  5C0X G;  4RKB A;  1MKH A;  1EZ6 A;  1FJG L;  5IT9 c;  2ALY B;  2VUM H;  4XT1 B;  4TKO B;  1QE6 A;  4DV1 L;  3RUZ A;  1BOS A;  1Y8O B;  4B3R L;  1CKO A;  1CK1 A;  3KJP A;  1EY0 A;  2F0K A;  2NB0 A;  4OWT B;  4QIW E;  5IP7 H;  3S1R B;  3FMC A;  3TP8 A;  1EY5 A;  4UHV A;  2N8N A;  2P5Z X;  4IPG A;  4CKC A;  2KOL A;  4G57 A;  2K03 A;  1QB5 D;  3ZJY C;  2F4V Q;  4O1N A;  4HAE A;  3W5O A;  4Y7N B;  5EBC A;  1VQM A;  4A3I G;  2L1B A;  1WTP A;  3ERO A;  1KNA A;  3CPW A;  4A3J G;  2K7V A;  4JI1 Q;  2Y0S E;  3HOZ H;  3CF5 A;  2K14 A;  3KLR A;  1YNN C;  2RBM A;  1BCP F;  2FMM A;  3CQZ B;  1RD9 D;  2LXK A;  2A68 D;  5COR A;  1LTG D;  4YCW A;  2IWH A;  3PQI A;  3EBE A;  3HP3 A;  2XTI A;  1K8A C;  4A3B G;  2WKC A;  2EPB A;  1PVO A;  4LF9 L;  2K01 A;  5LMU Q;  4FP5 D;  2YTV A;  1ASZ A;  2F3I A;  4B3M L;  3NHH A;  3VR3 A;  1A3U A;  3M4O B;  3S2H B;  2A6H D;  5C3E G;  1SMX A;  1HFG A;  1A8V A;  3S16 B;  2XN9 C;  5C0X H;  5F2D A;  1QVG A;  3HKZ B;  4B9X A;  2EJG C;  2NN6 I;  4HCE A;  4G7Z C;  3HOW B;  1SSO A;  1H9K A;  1EY9 A;  1LTT D;  1WCM B;  2R7D A;  2E75 C;  2NVQ H;  1CKM A;  1PZI D;  2DGY A;  4O2D A;  1CZG A;  1DGS A;  3DWQ A;  2RQX A;  3JAM i;  3NBI A;  5JAV A;  4K5W A;  4A3K B;  4K6D A;  3M85 A;  3DWA A;  4C3H G;  4R4T A;  5IGF A;  2FXQ A;  4HIO A;  3K5N A;  1PFN A;  4LF7 L;  1GD7 A;  2B2Y C;  2E74 C;  3K7U C;  3K81 C;  5JEA J;  2K4K A;  3E9H A;  1EYG A;  2JP1 A;  4A3I H;  3GTM B;  4R4C A;  1GOZ A;  1T5E A;  4IUU A;  4L6T B;  4A3J H;  3G4S A;  1SEB D;  1S5B D;  3UDF A;  1EYC A;  4JG2 A;  5H1S E;  3CCS A;  2WKD A;  3R2I A;  1LAC A;  1HZA A;  2KHJ A;  1DZ1 A;  1I6V C;  3FHW A;  3GV3 A;  3UDI A;  1K3R A;  1F2Y A;  1K83 H;  3MHB A;  3TZD A;  1XNR Q;  1GUW A;  1VQO A;  1PH5 A;  3LGJ A;  3DM3 A;  2Z8L A;  4EGV A;  4AYB B;  2M9V A;  1SN8 A;  4A3B H;  5ELO A;  3E3X A;  4GNX C;  1PH2 A;  2K33 A;  2D5D A;  5J3B A;  3JC6 6;  4N9T A;  4DR5 Q;  1II3 A;  3IRB A;  3IAY A;  2I5H A;  3TP5 A;  1UUP A;  5C3E H;  3D8G A;  4XT3 B;  2MHV A;  1SE4 A;  5D14 A;  1Q1B A;  1W6J A;  3OHX C;  2F0S A;  3DMU A;  2XIW A;  4R9W A;  3G6E A;  1X3P A;  4ME3 A;  3VR4 A;  4QMG A;  1KHI A;  2A68 C;  2OQ0 A;  4JBJ A;  3T1H L;  5I9O A;  1VQA A;  1VQF A;  3BVG A;  5C4X G;  1E24 A;  4A3G B;  1TWA B;  3PO3 G;  2ZTD A;  4LFC L;  5M3M B;  1Q81 C;  1UWV A;  1KQS A;  4RH6 A;  2MFI A;  2N88 A;  2A73 B;  1U9R A;  4RHS A;  2F4V L;  1EU3 A;  1Y69 U;  4DV5 L;  2KCT A;  3BVZ A;  4C3H H;  4F7X A;  3Q0A A;  1XMO Q;  2H4O A;  4CGY B;  2A6H C;  4C1N I;  2F0L A;  4HTH A;  2KHS A;  2J4X A;  2F0V A;  2EDG A;  4TVA B;  2JQO A;  1BNZ A;  1EUJ A;  3E0E A;  1BQQ T;  3GTL B;  4WJW A;  1VQ8 A;  3LWE A;  4JI1 L;  2E5L Q;  2O4X A;  3I4M G;  4K5X A;  4DV7 Q;  4Y52 H;  3HOY G;  5BN3 A;  1PTO B;  4JI8 Q;  2KVM A;  3MWY W;  4R8I A;  2JA8 H;  1B8A A;  5C0X J;  1A62 A;  4DR3 L;  5DLQ E;  1BR9 A;  1IBL L;  2WP8 J;  2F0O A;  5IGE A;  4DV3 Q;  3TRE A;  1J5E Q;  1RJT A;  1OO9 B;  3AFQ A;  3CCU A;  1HJP A;  5LMU L;  1ZYR D;  3GTP B;  5C4Z A;  3H94 A;  1S72 A;  1QOH A;  2VNU D;  4KHP Q;  1X55 A;  1TY0 A;  1SFO B;  1GXD C;  1VQ5 A;  5CC4 A;  5KND A;  4IUT A;  1Q82 C;  3I2Z A;  1IBM Q;  2HD3 A;  3ITP A;  1S40 A;  3AB9 A;  2PQA A;  4L63 B;  1IZ6 A;  3M4Q A;  2E2I B;  1JJG A;  2WFW A;  4DKA C;  4UP7 A;  1CA6 A;  2Z9H A;  3BDO A;  1NTG A;  3VYT A;  3K7A B;  2NVX B;  1HQR D;  2Z6K A;  1IKL A;  3I4N B;  3D3R A;  3K5O A;  1MJC A;  1HTP A;  5EAY A;  1IBK L;  2WB1 E;  4DR7 Q;  2JN4 A;  4GLV B;  2DJG C;  4DUY L;  2LMC B;  5C4X H;  1RHP A;  2ZJP A;  5DEH A;  1XPR A;  3CCL A;  3LNN A;  3PO3 H;  1FD7 D;  4CJ1 B;  3VA5 A;  2JE6 I;  5C44 B;  4HMI A;  3KF8 A;  3GTG H;  3KF8 B;  1ASY A;  4B08 A;  2B2U C;  2QKI C;  1IW7 D;  4K8I A;  1GUT A;  5HY6 A;  1CT1 D;  1IYV A;  1LAB A;  4PMC A;  4N9P A;  4ME5 A;  1RCV D;  2EJF C;  1QUQ A;  1GO3 E;  3AQQ A;  4LFB L;  5E1F A;  3DUZ A;  3I4M H;  3OIQ A;  4ZCK A;  3HOY H;  2JJQ A;  3M9B A;  3KK7 A;  1Q7Y C;  1YJN A;  1Q90 A;  2MQH A;  2UUA Q;  1XPO A;  2R6G A;  2ZJQ A;  3BU2 A;  2KUM A;  3HKZ E;  3EQL C;  5CBE E;  2K5V A;  1XNR L;  3A55 A;  1YHQ A;  1I94 Q;  1GVP A;  3HOW G;  1B3Q A;  1VQD A;  5A2Q L;  1WCM G;  4QL5 A;  4RFB A;  2WII B;  1ONL A;  1FVI A;  3NP8 A;  1JC7 A;  2C5C A;  3V05 A;  1DOM A;  4HCS A;  2TMP A;  2MJ8 A;  1E1O A;  4LFA Q;  1PV4 A;  3S1R H;  4DR5 L;  3EJI A;  3NUC A;  1CKN A;  4FNF A;  1C0A A;  1HXY D;  2G9H D;  3DEP A;  3RR5 A;  2XNA C;  1CKN B;  4H44 C;  4PMW A;  4GN3 B;  5M9O A;  3SK6 A;  2B8F A;  3CXC A;  1I6H B;  2K50 A;  4Y7N H;  4IFD I;  1LTB D;  2B29 A;  4DV6 Q;  1ZKO A;  1JOK A;  4NXM L;  5JVG 3;  2IHE A;  4OXP A;  1JT8 A;  4XYQ A;  3D6W A;  2F0T A;  1XTC D;  1ZYR C;  5IGD A;  5IYC G;  4DFA A;  3H91 A;  1STN A;  3CQZ H;  5IGC A;  4HID A;  4V19 0;  1Q1E A;  1XWE A;  4U68 A;  3SHL A;  1AE3 A;  4K6L A;  2N55 A;  1GHK A;  3F2B A;  4XQJ A;  4AYB G;  1LTL A;  2I07 B;  2AQ3 B;  2RVL A;  1F2M A;  2AUK A;  4BA1 I;  2RDF A;  2X69 A;  3FEW X;  3I55 A;  3DLL A;  2XGT A;  1SE2 A;  1SNQ A;  1VS0 A;  3DM1 A;  4JI8 L;  1B50 A;  4X66 Q;  3M4O H;  3S2H H;  2Q8I B;  2M00 A;  4DAY A;  4RGT A;  1HNX Q;  1KLU D;  4IPC A;  1EY4 A;  1LYL A;  4NMZ A;  3S16 H;  4FYD A;  3WWV A;  1O7L A;  1NBW A;  4F8M A;  4DV3 L;  3CCQ A;  1J5E L;  3A5U A;  4TSS A;  1CHP D;  1F9P A;  3HOW H;  4JI4 Q;  5EPL A;  2HCC A;  1WCM H;  3VYU A;  4A3G G;  3TDQ A;  4KHZ A;  4IUV A;  4YIJ A;  1IW7 C;  3MXP A;  4KHP L;  1ILQ A;  5M3M G;  1IBM L;  1E3P A;  1IYJ B;  3PUZ A;  5EJW A;  3DEO A;  1H9R A;  3A74 A;  1B2T A;  4A3K H;  4QIW B;  3IL8 A;  2B39 A;  4BY1 G;  2E2H H;  2YU9 B;  3J81 i;  1JB3 A;  2LY7 A;  3KFU A;  1JCK B;  4DNT B;  1QIL A;  2JSO A;  4K8J A;  3ND8 A;  1ESR A;  4DR7 L;  1CM9 A;  3EVQ A;  1G51 A;  3GTM H;  3S1N B;  2UUC Q;  2A19 A;  1YIJ A;  2I0Q A;  2AWN A;  2PZW A;  4JK1 C;  3D0F A;  1B7Y B;  4P2C B;  2Y0S B;  5IYC H;  1HPC A;  1BCP C;  4YY3 Q;  1VQB A;  1Y1W B;  1N34 Q;  3K5L A;  1PYS B;  2Z0S A;  2A6E D;  3TQY A;  4JI7 Q;  5FJ8 G;  2EXZ A;  3ERS X;  2WV6 D;  2EIF A;  1SR3 A;  4OWW B;  1NJI C;  1X32 A;  1FJG Q;  3A56 A;  3Q8D A;  5I2Y A;  1WTR A;  1HUM A;  5GAH C;  4XXE A;  2CW0 D;  2XWJ B;  4GKJ L;  4KTA A;  1Z9F A;  2Q8R E;  2K05 A;  1HNZ Q;  1EFI D;  1KRS A;  2R3Z A;  3A0J A;  4GLX A;  1UE1 A;  4LUV A;  3I4N G;  1I94 L;  3D31 A;  2X6L A;  1VQH A;  2ZXP A;  2F3V A;  4MN3 A;  5J1Z A;  1QWY A;  3G6J B;  4YHH L;  1VQ6 A;  4K2L A;  1I50 B;  4QUC A;  4ZK9 B;  3KLS A;  1L1O A;  4QF4 A;  2PPB C;  1G2S A;  4EQO A;  4HIK A;  4A3G H;  1TWA H;  2ENB A;  1ROD A;  2RHQ B;  4GOP A;  5FO8 B;  4IPH A;  1JWS D;  4DR4 L;  2I46 A;  5M3M H;  5C44 G;  1SJH D;  4JPB W;  2VY3 A;  2EY2 A;  2NTS A;  4H13 C;  1SRO A;  1Y1V B;  2PZU A;  2PO4 A;  1PZK D;  2AQ2 B;  4KJO A;  1TQO A;  3KBG A;  2UU9 Q;  2AQ1 B;  3ER0 A;  3GTL H;  1N36 Q;  4APV A;  5K5P A;  3I4O A;  4PQX A;  3J7A V;  4HJ9 A;  4PZ6 A;  4LF9 Q;  2LS0 1;  5JPM C;  1PTO H;  3GV6 A;  4B3M Q;  2BCO A;  4C3I G;  5BN5 A;  3GTJ B;  1KL9 A;  1FYC A;  1PLF A;  2KEC A;  1DXM A;  1J6Q A;  2PQE A;  3WOE A;  3PF5 A;  1PRT B;  4J6H A;  2MO1 A;  5FJ8 H;  3VYR A;  1Y8N B;  1VQG A;  3SR1 A;  1D1I A;  3JAM L;  2VQE L;  3GTP H;  1E0B A;  1EQT A;  5C0X I;  3ULJ A;  1N9W A;  1YBY A;  1SFO H;  5AJ3 L;  1H9S A;  1N33 L;  4KY6 A;  4JI5 L;  1HNX L;  5ISR A;  3R93 A;  2E2I H;  4POF A;  3I90 A;  1ZEQ X;  1BBW A;  4DV2 L;  3K7A H;  3M4Y A;  4KKT A;  1B9N A;  2NYZ D;  2NVX H;  3D4R A;  5TSS A;  3I4N H;  3J81 E;  1YJW A;  1SNM A;  2OT2 A;  1I4X A;  2ID0 A;  1L0Y B;  1U0L A;  4ALP A;  1I5F A;  1VQL A;  2A6E C;  2O5I C;  2AKW B;  2BH2 A;  3GTQ B;  2JEB I;  4KD3 A;  1SYB A;  1B1Z A;  3I8Z A;  3RLN A;  1E1T A;  2WAQ E;  3EN2 A;  4KJN A;  4NKL A;  5AFW A;  4X62 Q;  4HJA A;  2CW0 C;  1AFP A;  5C44 H;  1V8Q A;  2D0P A;  3U50 C;  3FKI B;  4JI3 Q;  1O80 A;  5T1I A;  4QY7 A;  1PH9 A;  4UAI A;  3MXG A;  4UP9 A;  1PDQ A;  1L0X B;  4L5T A;  1JQY D;  4C56 C;  3L7Z C;  5CV4 A;  1OTC A;  2KA7 A;  4QB4 A;  1OXU A;  4PMB A;  3TBI B;  3PIP 3;  4JYA L;  3C3L A;  2IHF A;  3CCM A;  4WJ3 M;  1EQV A;  4C3I H;  5DAU A;  4YY3 L;  1HQM C;  5HUR A;  4M1U B;  1C48 A;  1KLG D;  1SYE A;  4JI7 L;  3KLS X;  3V2T A;  3SK8 A;  4BS9 A;  1G2T A;  3SE0 A;  2RSN A;  1EY7 A;  1WVL A;  5M5Y B;  3T1H Q;  3S9W A;  4NP5 A;  1HNZ L;  1LTS D;  1S5C D;  3GQB A;  4GZY C;  2R7Z B;  3MC0 B;  1V43 A;  5A2Q E;  4LFC Q;  3MAQ A;  3MXN B;  3KF6 A;  2NVY B;  4CKE A;  2EYO A;  5GAD C;  1S5D D;  4H02 A;  1BCP B;  2KJX A;  1R9T B;  1K0S A;  3KF6 B;  2MPM A;  1VQC A;  4ZUJ A;  4DV5 Q;  2QGQ A;  1I6H H;  2F0G A;  2EYP A;  1RTN A;  2RF4 A;  4FF3 A;  2HIX A;  1C4Q A;  2MO0 A;  2KQ3 A;  1EOT A;  3I70 A;  1Q46 A;  2WB1 B;  3OOC A;  3L9A X;  1G8Z D;  1SE3 A;  2J0T D;  2Y0S G;  1CUK A;  1F9S A;  1HZ9 A;  4JW0 A;  2BA1 A;  4DR2 Q;  4P74 A;  1D5Z C;  1WI5 A;  3PUY A;  1X6O A;  2UU9 L;  3TN2 A;  4DR3 Q;  2HT1 A;  1IBL Q;  3P7J A;  3E9I A;  1HZC A;  1AN8 A;  1N36 L;  1U4R A;  2VB3 X;  4ZAI A;  5DNF A;  1U4M A;  4C2M B;  2GVB A;  2F0J A;  4BXX G;  1VDZ A;  1BBX C;  4JOI A;  1BDO A;  3ERQ A;  3V96 A;  2D0O A;  4L5R C;  4QGU A;  4POG A;  1V9P A;  2ZM6 Q;  4JI2 L;  2OTJ A;  3RD4 A;  4WFN 3;  3FVQ A;  1UAP A;  4DAP A;  2Z6K C;  5KRU A;  4LAA A;  5C3X A;  3MXU A;  4Z9C B;  1IBK Q;  2B2V C;  1STG A;  5FOB B;  4DPG A;  3L0O A;  4DUY Q;  2G5D A;  3H3V H;  4JI0 L;  3CD6 A;  4HSV A;  1X65 A;  4EQN A;  1AP0 A;  4KLK A;  2YU9 H;  2QW7 A;  3RZO H;  4NB3 A;  1QNK A;  1TY2 A;  2EY5 A;  4S3S A;  4R4Q A;  3PIO 3;  5D3I B;  4C1N K;  1K8O A;  3QO2 A;  1ICF B;  2V4D A;  3S1N H;  5DM7 3;  3NTI A;  2JA6 B;  4X62 L;  4LFB Q;  3CU7 A;  1KIX A;  3GTK B;  4LWC A;  5IWA Q;  2F0F A;  4UDU C;  2JA8 G;  4AIM A;  4JI3 L;  1SYD A;  2UXC L;  3C46 A;  1NMF A;  1Y1W H;  3U4Z A;  3C1E A;  3D4D A;  3WDN A;  1AZP A;  4DV4 L;  1K3B C;  1GUN A;  1P16 A;  4DUZ Q;  1YHA A;  1WTX A;  4JBK A;  3OWE B;  2CWP A;  3OSO A;  3HOU G;  4K0K L;  5DM6 3;  4A3E B;  2OCE A;  3PO2 B;  3K0Y A;  4QQB X;  1R4P B;  1HA6 A;  4BXX H;  3W3A A;  1JR0 D;  2F0N A;  3GP7 A;  2VZA A;  4O42 A;  4OEL B;  2GA4 B;  1VMP A;  2KBN A;  3DHQ A;  4LW1 A;  1RL2 A;  3NK9 A;  4JC0 A;  3IFT A;  2RDH A;  1XX8 A;  5EGT A;  4PNY A;  3R3O A;  1GM5 A;  5CV8 A;  1QVC A;  1Z47 A;  1IHZ A;  2JYO A;  3T1Y Q;  4A3F H;  2ICE C;  2F1M A;  3CC2 A;  4OIJ A;  1DOL A;  1I50 H;  1LT3 D;  4R4O A;  4DR6 L;  2BE5 D;  1H9M A;  4CJ0 B;  2D2C C;  5FKA C;  4X3T A;  4NXM Q;  4ID6 A;  1CSP A;  2SNM A;  1PFS A;  2NN6 G;  3FKI G;  1AEX A;  4A3M B;  2I5L X;  2KHI A;  4YWK A;  4C3J B;  4EQ5 A;  3PIP A;  1Y1V H;  3BYT B;  1PMR A;  1NCV A;  5CR3 A;  1VQJ A;  3T4A C;  1X3Q A;  3P20 A;  1STY A;  5EKK A;  4DXF A;  2L11 A;  5KNC A;  3NTK A;  5FLM H;  3MFY A;  3GDE A;  3OIP A;  2CH4 W;  2VW9 A;  1K8G A;  5IOD A;  1ICW A;  4DR2 L;  2R93 B;  3I72 A;  5CMD A;  1D5M C;  2X6G A;  1NNX A;  4LF4 Q;  2OF1 A;  3M4P A;  4G7O C;  4IOC A;  4WJ4 A;  1PH3 A;  3RNU A;  3FP9 A;  3I73 A;  3T56 B;  1LTR D;  1ML0 D;  1VQN A;  1Z7T A;  2CQA A;  1FGB D;  2NZ1 D;  3HOU H;  2EY1 A;  2M2L A;  2DY8 A;  1SYG A;  2QEJ C;  3J81 L;  2R7Z G;  2B2T A;  5ELE A;  1UNS A;  1TII D;  1CHQ D;  2ZM6 L;  5ELD A;  1PH6 A;  3JAM E;  5ELF A;  1VMC A;  1H95 A;  3L3O C;  1JOQ A;  2CFM A;  2QEX A;  2BDN A;  2YTY A;  3KUP A;  4XQN A;  3E5S A;  2UUB Q;  2WB1 G;  1YI2 A;  3F8T A;  3GTQ H;  1WYD A;  3J80 i;  3SGI A;  1MD2 D;  4DV0 L;  3TME A;  3HOV B;  1W3S A;  2NN6 H;  3SEB A;  1LO5 D;  3X3M A;  2E8G A;  3FKI H;  3EIV A;  2A69 D;  5IGG A;  2DUD A;  2ZJR A;  2TSS A;  4KD4 A;  5JVH 3;  5JJI A;  3WOF A;  3RMH A;  2F0I A;  2N49 A;  3ULP A;  4YCV A;  1TVX A;  2F0H A;  3QB3 A;  1GUO A;  2F03 A;  1J9O A;  2RCN A;  4GKJ Q;  1CA5 A;  4JI6 L;  4A3C G;  5IWA L;  1AH9 A;  1T5X D;  1MGS A;  2B2W C;  4BA2 I;  1DJR D;  1T9H A;  3QJY A;  4LK1 C;  3QOJ A;  4LJZ C;  3HKZ G;  4DU9 A;  3SK5 A;  4L5Q A;  2KCC A;  5GAE C;  3LWU A;  1F2Z A;  4DUZ L;  4OO1 I;  4DAV A;  4ZKC B;  4YHH Q;  1MBY A;  3PIO A;  5M5Y H;  4LF6 L;  4EX5 A;  1TWC B;  1QCB D;  4K5V A;  1S5F D;  2IX0 A;  1BBU A;  4DAM A;  4GOP C;  2EYF A;  3ONA B;  3PUW A;  3CCV A;  2L12 A;  1OXX K;  2UXB Q;  2R7Z H;  1RTO A;  4DR4 Q;  2ATW A;  3CC7 A;  4A3K G;  1FL0 A;  3ICE A;  2BH8 A;  2NVY H;  1MSG A;  3T1Y L;  1R9T H;  4OON A;  3BZD B;  2OWO A;  4J1M A;  1JIC A;  4GKK L;  2EYL A;  3Q23 A;  2H5X A;  2PW7 A;  1LT5 D;  3W2D A;  2K32 A;  1XTD A;  3J81 c;  2JA6 G;  1CQF A;  1MJE A;  4GNX B;  4BWG B;  2SEB D;  2WAQ B;  4LF5 Q;  3B6Y A;  5EPJ A;  5BN4 A;  5JJZ A;  5I2X A;  1Q3L A;  3TS0 A;  2CWA A;  1EFW A;  1Y14 B;  2CCZ A;  1HH2 P;  1EYD A;  2F0W A;  5KIX A;  5GRO A;  4C2M H;  4A3E G;  3PO2 G;  2ZXR A;  4ODG A;  2RA4 A;  2VQE Q;  2L5T A;  3CRK C;  4E6I A;  1DD2 A;  2KED A;  4A3C H;  3S14 B;  5CYU A;  1N32 Q;  1NMG A;  1GHJ A;  5AJ3 Q;  4LF4 L;  1N33 Q;  1CTM A;  4JI5 Q;  1K28 A;  2WIN B;  1WTV A;  2NTT A;  3UDX A;  3NEM A;  4LUZ A;  4DV2 Q;  2A69 C;  2VS1 A;  4LUO A;  1KAA A;  4OX9 Q;  2KCM A;  1TWF B;  1ET9 A;  1L0W A;  2PI2 E;  1EZ8 A;  1I4P A;  2JA5 B;  3J7A F;  4A3M G;  3QIA A;  4KY7 A;  1TS2 A;  4C3J G;  4LMQ D;  3HOX B;  1KC8 C;  3W1B A;  4BY7 B;  1PXU A;  4OHJ A;  1FNW A;  4DA2 A;  1R4Q B;  4RAU C;  2VB2 X;  3QG1 A;  2CKZ B;  1HRJ A;  2PNH A;  1X3F A;  2UUB L;  3EA6 A;  2DNE A;  4IPD A;  4A4I A;  3UE1 A;  4NXN L;  4DF7 A;  2JA6 H;  2CH4 A;  1G29 1;  1DCZ A;  2Z4H A;  4A3L G;  4IFD G;  4X64 L;  2R93 G;  4OGQ C;  3GTK H;  3J7A 5;  1ENA A;  1LV9 A;  2IX3 A;  3U9S A;  4JYA Q;  3H15 A;  1SNO A;  2SNS A;  1MHW C;  3CRL C;  2EE1 A;  5IE8 A;  3NXW A;  2A74 C;  3CKI B;  4MNO A;  5EQ0 A;  5FLX E;  4OEM B;  4Q5V A;  3OMC A;  2L9H A;  4IJH A;  2Q2H A;  4A3E H;  3PO2 H;  1Q8I A;  3CHB D;  2K5H A;  5LMN L;  3CC4 A;  1YNX A;  3VR2 A;  1C9O A;  3G7L A;  5G3L D;  3FPU B;  4A76 A;  5ELB A;  3S2D B;  4G4K A;  3BVM A;  1HA5 A;  1NE3 A;  3CCE A;  2IY5 B;  2F3W A;  2F0P A;  1LUZ A;  4CDD C;  2HQL A;  5CBA E;  1O78 A;  2Q2T A;  2B2U A;  1WFQ A;  4DN4 M;  1KTK A;  2FFK B;  1SRU A;  4KN7 C;  1F9R A;  2PZT A;  4X3U A;  2OQK A;  2GVA A;  1A3T A;  2YTX A;  3VDY A;  1RDP D;  1RIP A;  1IXR A;  1LT4 D;  2UXB L;  1D7Q A;  1W2B A;  4A3M H;  3TRZ A;  2LFN A;  3NQT A;  4I7Z C;  4C3J H;  2R92 B;  3ZYY X;  1FR3 A;  3N6R A;  4UPA A;  1WOC A;  2IPK D;  4MHE A;  4J15 A;  1LTA D;  1V1Q A;  3SK4 A;  4FF2 A;  2FIN B;  2QF7 A;  5E4X A;  1KRT A;  3BZC A;  2QDB A;  4A3L H;  4IFD H;  1S3O A;  2R93 H;  2K5N A;  4LF5 L;  1HR0 Q;  2JXM B;  2HCI A;  5COY A;  1EWI A;  2F0M A;  2F0E A;  2K6A A;  4CKB A;  5K36 G;  4JI2 Q;  1JOR A;  2BA0 A;  1IKM A;  1PZJ D;  3T53 B;  1PTO D;  5IT9 L;  3K5M A;  3O13 A;  4A93 B;  2PCF B;  1VQ7 A;  1K8M A;  1OXS C;  3A8I E;  3GO5 A;  2F0U A;  3NQI A;  1N32 L;  3OYY A;  3A8J E;  1QJO A;  4JI0 Q;  4R4I A;  5M5W B;  3L2P A;  3H3V I;  1SLJ A;  2K04 A;  3S15 B;  1JOO A;  4OX9 L;  1A2T A;  4KY5 A;  1SAP A;  1TR5 A;  3S1M B;  4OIK A;  1HR0 W;  5FO9 B;  2DJF C;  4P73 A;  1Q12 A;  4RHR A;  1L2F A;  1RKN A;  4MIU A;  5IIF A;  3CP0 A;  4DR1 Q;  3HOV H;  5M5X B;  2WAQ G;  5A35 A;  2HIV A;  2AWO A;  3OPO A;  2JA7 B;  2D62 A;  2UXC Q;  1XNQ L;  2KCN A;  3NE5 B;  4PZ8 A;  1U4P A;  2V1C C;  3K59 A;  3U58 A;  1PH7 A;  2FHT A;  4DV4 Q;  1LLR D;  3KDF B;  1QNU A;  4X65 Q;  1STE A;  4K0K Q;  2QCP X;  2PMZ E;  3NBH A;  1XMQ Q;  4P71 A;  3NBH B;  2RDG A;  5I4D A;  1ZXT A;  4B3S Q;  1NR4 A;  3A54 A;  5K36 H;  4RCN A;  3CCJ A;  1JMC A;  3Q6S A;  1CSQ A;  3RLF A;  1KXL A;  3GD7 A;  1YZ6 A;  4F87 A;  4IO9 A;  1TWC H;  2JA5 G;  1YVC A;  4DR6 Q;  3Q22 A;  1JE5 A;  1EEI D;  1HTL D;  5EKI A;  5E7N A;  1JJ2 A;  4HIM A;  3MXN A;  2B63 B;  1JWU D;  4BY7 G;  5FK9 C;  1XXG A;  1FNU A;  1UE6 A;  3FPP A;  4IQZ A;  4HJ8 A;  1W6K A;  5JOB A;  1WJJ A;  2Z6B A;  3JAM c;  3Q24 A;  2L0C A;  4A3F B;  3A7A B;  4KV6 A;  1I3Q B;  3VYS A;  4IFD J;  1G91 A;  1BKB A;  2Q2I A;  3RZD B;  1PTO C;  1BVS A;  1YNJ D;  2R61 A;  4RKL A;  5E4W C;  1VQ9 A;  3D4W A;  3N52 A;  4NDX A;  1VF5 C;  1BUV T;  2HUG A;  1WD1 A;  1BO0 A;  1Y1W G;  2HHH L;  3R2T A;  1EY6 A;  1VQI A;  4A75 A;  4FDB A;  5C4J B;  3R8B A;  2PYK A;  4XYO A;  5BR8 L;  4HJ7 A;  4IUR A;  1AW7 A;  1SE8 A;  3DWP A;  1NR2 A;  1EU4 A;  3BDC A;  2ZT9 C;  5NUC A;  1J8I A;  3MA2 B;  1NAP A;  1EIG A;  3S14 H;  3HRZ C;  1VCI A;  4L8J A;  1HR0 L;  2B2T C;  2PW5 A;  4RG1 A;  4RGM A;  4WOR A;  1RF2 D;  1FNV A;  5EKL A;  1WD0 A;  2NVT B;  1PFB A;  1VQE A;  1Z6H A;  1D6E C;  5C4H A;  1DM0 B;  3J80 L;  2KEN A;  1EL0 A;  2ES2 A;  1PYW D;  2LXJ A;  1TWF H;  1GUS A;  1Q8K A;  2IL8 A;  1KD1 C;  1STA A;  2XSC A;  2HDL A;  2JA5 H;  3TP7 A;  2YV5 A;  3NWT A;  3DXJ C;  3S1Q B;  4DV0 Q;  3HOX H;  2R92 G;  1D2B A;  4B3T Q;  1A6X A;  4I7A A;  4BY7 H;  4IUP A;  1Y1V G;  2IJ0 A;  2KEE A;  1P8L A;  3K57 A;  4WRD A;  3PF4 A;  4RA8 A;  1K0R A;  2A8V A;  3BDL A;  2FMC A;  4ZRZ A;  2E2J B;  1H9J A;  5FLM G;  4AQY L;  1C7Y A;  2DY7 A;  3SXH A;  2BDO A;  1SBB B;  5ELN A;  4DR1 L;  1K9M C;  5FLX L;  2Q8T A;  4JI6 Q;  4TQU S;  3M3Y B;  3NWS A;  2E2H B;  4BBR B;  1PH4 A;  2A5H A;  1EEF D;  1TU2 B;  4X3S A;  1UEA B;  2G9D A;  1HNW L;  3I7F A;  2QA4 A;  4A93 G;  1QZG A;  4DNR B;  4X65 L;  3SVM A;  2EOT A;  4LF6 Q;  1M8A A;  4UP8 A;  3UE0 A;  4CDE C;  3I3C A;  5C5L A;  1X3G A;  3S2D H;  1XMQ L;  1WTO A;  3CW2 C;  3T13 A;  3MZ5 A;  3A8K E;  5CV7 A;  4B3S L;  1EIH A;  2RCF A;  1D1K A;  1YNJ C;  3OTO L;  3BJU A;  1LT6 D;  5LL6 S;  1MI2 A;  5CV5 A;  1EY8 A;  1U5K A;  2XVS A;  1KAB A;  1F9Q A;  4GKK Q;  2L15 A;  1I4G A;  3A5Z B;  5M3F B;  1CZW A;  4ZUI A;  4KKS A;  3QR8 A;  3TS2 A;  1A2U A;  4FXK C;  2PI2 A;  4M8A A;  3TP6 A;  2XWB B;  3M7N A;  1K73 C;  5KNB A;  2JEA I;  2R92 H;  4FO2 A;  5G3L F;  2JA7 G;  1M4V A;  3F2C A;  1V1O A;  2Z4I A;  1SYC A;  3J80 c;  4FF1 A;  4NPS A;  4QUF A;  2NBF A;  2ZTE A;  3PUV A;  1O7Z A;  3NEL A;  1WTQ A;  4QCL A;  2LKV A;  3OWF A;  1QVF A;  4QJF A;  1HCZ A;  1S4Z A;  2FJ2 A;  1QG7 A;  1YEZ A;  4OL7 A;  2SDF A;  4DK1 A;  4N8X 1;  1B53 A;  1V1P A;  4BBS B;  1G6P A;  2HDM A;  2HQE A;  2F4I A;  3GTJ H;  1A63 A;  1HUN A;  1V1P B;  4PV1 C;  1E2V A;  4BY1 B;  3F1Z A;  1TXY A;  5J39 A;  3U9O A;  1UE7 A;  4H7B A;  5D65 A;  1VQ4 A;  2E76 C;  4DXG A;  1SNP A;  4K2K A;  1VF7 A;  4KN4 C;  5FLX c;  4A93 H;  3M7G A;  3H0G B;  2VQF Q;  2B8G A;  3H3V C;  3NSW A;  4LNQ A;  2RKS A;  2B63 G;  5IYD G;  3I56 A;  5M5W H;  1PRT D;  2CQO A;  2NZO A;  5FO7 B;  1FGU A;  1UE5 A;  5IT9 E;  2MP1 A;  4KK7 A;  4U67 3;  3GTO B;  4JBW A;  2ASB A;  2BOS A;  2QIL A;  4A3F G;  3S15 H;  3EFX D;  3UI2 A;  1G6Z A;  1D5X C;  1JE4 A;  3S1M H;  1HHV A;  1NUC A;  1PTO F;  1UEB A;  4CDF C;  4NXN Q;  4G7H C;  5M5X H;  4B3T L;  4X64 Q;  3T16 A;  2EZV A;  2WAC A;  4ULL A;  3P1H A;  2JA7 H;  2PQA B;  2K75 A;  2J7Z A;  4ZYS A;  4MZ9 A;  1XYI A;  1B9M A;  2B2V A;  3S17 B;  4R1J A;  1TWG B;  2CVR A;  1HFN A;  1GJX A;  5LMN Q;  2Q2U A;  3U4V A;  4X3K A;  2BE5 C;  4ZKB B;  4IOA A;  1TWH B;  4KMU C;  3HS0 C;  1IL8 A;  3J81 j;  3G71 A;  2B2Y A;  2NWG A;  3RN5 A;  2AUJ D;  4RCO A;  3OW2 A;  5IOC A;  1YHB A;  4GN4 B;  3H09 A;  1NY4 A;  1PHJ A;  1B3A A;  2UXD Q;  4ABN A;  1L1O C;  2JK8 A;  3J7Y W;  1QUQ B;  2N3S A;  3K58 A;  4A3D B;  3CMA A;  4LF8 Q;  2B63 H;  5IYD H;  3F2U A;  4JV5 Q;  4OWX B;  4C3I B;  3MFG A;  4MTK A;  2Z1C A;  5JJK A;  3A7L A;  3VR5 A;  4IN3 A;  4JCV E;  1IL2 A;  4HR7 B;  5LMN W;  4YWL A;  5L37 A;  1LM0 A;  1STH A;  1Y8P B;  1OXV A;  2K5W A;  1MSH A;  1I3Q H;  2XRQ D;  4RWS C;  2VUM B;  3FRP B;  4XTC S;  2AHO B;  4GNX A;  3KBX A;  5I6W A;  3RZD H;  1EQQ A;  1BCP D;  4XQQ A;  4F88 A;  1SJE D;  4BBR G;  2DN8 A;  5IP9 G;  3H6M A;  1CQV A;  1PRT C;  4IJL A;  5ELC A;  5C4J H;  3NPP A;  3AU7 A;  1PH1 A;  5KGU A;  1E22 A;  3HGB A;  1PYB A;  1B70 B;  4IUN A;  3HZX A;  4CBV A;  3J7Z C;  1F77 A;  4JBM A;  5JPN C;  2O2L D;  3S24 A;  1N8R C;  2JA9 A;  4RGN A;  3HOZ B;  1PFM A;  1ILP A;  1XMO L;  1VQK A;  2PMZ B;  3MTS A;  3X3N A;  2NVT H;  3PV0 A;  4HSP A;  1STB A;  2K5D A;  1ET6 A;  2L55 A;  4AYB E;  1EQR A;  4Q0F A;  3CCR A;  1E7Z A;  5M3F G;  3URY A;  5I6Y A;  3SDZ A;  2E5L L;  3AYH B;  2VQF L;  1EYA A;  4DV7 L;  3STB D;  3TSS A;  4ZQ3 A;  2OXP A;  2EQS A;  3S1Q H;  3E0J A;  3D6C A;  4HED A;  4OO1 G;  4GN5 A;  2F52 A;  2NUC A;  4KKU A;  3HG9 A;  3J80 E;  4DAY B;  1EIF A;  1I4H A;  3UDG A;  1KNE A;  2YYZ A;  4EVO A;  2EYH A;  3G48 A;  1PA6 A;  3MVV A;  1XNQ Q;  1A0I A;  1TKW B;  3PUX A;  5CV6 A;  2C9O A;  2CHB D;  4JVZ A;  3VR6 A;  3FDT A;  4I65 A;  1EOV A;  2E2J H;  3K6O A;  4IAL A;  1AZQ A;  3PCO B;  1KDB A;  2E2D C;  4O0A A;  2NVQ B;  4V0B A;  4CJ2 C;  4R8N A;  2B3G A;  3F2D A;  2K28 A;  5T1G A;  4BBS G;  4P75 A;  3M3Y H;  4FVM A;  2EVB A;  1M1K C;  3HFZ B;  1X56 A;  4P72 A;  3AEV A;  3RZO B;  1HZB A;  1EWH A;  1KDA A;  4BBR H;  5IP9 H;  5J22 A;  5KEE A;  5D3D A;  4XIG S;  1SNC A;  1QZH A;  3NEN A;  1DON A;  1KAW A;  1S5E D;  3T51 B;  2K1B A;  1WTW A;  1ENC A;  1WTH A;  3H0G G;  4FXG C;  3I4L A;  4HJ5 A;  4A3I B;  3KLW A;  2ZTC A;  1IYU A;  4A3J B;  3BYY B;  2H1E A;  3C2P A;  5GAG C;  3PGZ A;  3KOJ A;  5CV9 A;  1GUG A;  5E3F A;  2MUY A;  1BF4 A;  1LTI D;  4XDX A;  3HKS A;  1SMY D;  3OMG A;  4KHV A;  4YWM A;  5LHY 1;  3AFP A;  3MEH A;  4RGO S;  3VA7 A;  1K83 B;  2LSS A;  4DGZ A;  4FXD A;  4ILW A;  3PSI A;  2PNR C;  4HMJ A;  2K52 A;  1NSN S;  5M3F H;  2UXD L;  4DV1 Q;  4IZ8 A;  1Q86 C;  1X3E A;  2F0D A;  2A1A A;  5GQO A;  2EYM A;  4B3R Q;  4A3B B;  2R7F A;  4K14 A;  2AMC B;  4LF8 L;  2O5J C;  1I4Q A;  5LL6 X;  1XPU A;  3HOV G;  1TS5 A;  1AE2 A;  1X54 A;  2B2W A;  3TZU A;  4JV5 L;  1YJ9 A;  2EXD A;  4OO1 H;  2UUA L;  2EJM A;  2F0Q A;  4MTN A;  1DOK A;  5C3E B;  2OEO A;  3I91 A;  1JJC B;  2N78 A;  2HHH Q;  3LX0 A;  3ULL A;  4PG3 A;  4KI0 A;  5C6A A;  5BR8 Q;  1SXT A;  4PZ7 A;  5IY0 A;  4YCU A;  1I4R A;  4RMF A;  2I5M X;  4LFA L;  1L1O B;  1CFM A;  5EPK A;  3BS1 A;  5KYI A;  4BBS H;  1SYF A;  1TS4 A;  3STB C;  4X6A H;  4GOP B;  3IKJ A;  4JOI C;  1CI3 M;  1F2L A;  1GKH A;  2OTL A;  4BY1 H;  3K0X A;  2VL6 A;  4C3H B;  4L5S A;  2DNC A;  4N8F A;  5CGK A;  4DV6 L;  2MNA A;  1U4L A;  4NW2 A;  3RLO A;  4DNI A;  5JEA G;  2IT1 A;  3H0G H;  3NTH A;  5IYB G;  4A3D G;  3K80 C;  4GS3 A;  3KYH C;  1A15 A;  2VXW A;  1YIT A;  2C35 B; 
#chains in the Genus database with same CATH homology
 1VQN A;  1VS0 A;  4JI8 L;  3W1G A;  1VQE A;  1EIY B;  4X66 Q;  3HOU H;  3M4O H;  3S2H H;  3KJO A;  2KEN A;  3GTO H;  4UY8 C;  1MIU A;  1HNX Q;  4IPC A;  2ES2 A;  1LYL A;  2LXJ A;  1TWF H;  2R7Z G;  3S16 H;  3WWV A;  1Q8K A;  2VUM G;  1KD1 C;  1NBW A;  4DV3 L;  1M90 C;  2JA5 H;  5HGQ A;  2ZM6 L;  2YV5 A;  3CCQ A;  1J5E L;  3A5U A;  2RHS B;  1PH6 A;  4DV0 Q;  3HOX H;  2R92 G;  1XJV A;  4AQY Q;  4GLA C;  3HOW H;  4B3T Q;  4JI4 Q;  4X66 L;  4BY7 H;  1WCM H;  5IP7 G;  1Y1V G;  4A3G G;  4KHZ A;  1H95 A;  3MEF A;  4KHP L;  1P8L A;  2CFM A;  2QEX A;  2UUB Q;  2YTY A;  1K0R A;  5M3M G;  3PF4 A;  2WB1 G;  1YI2 A;  1IBM L;  3F8T A;  3CAM A;  3GTQ H;  1E3P A;  1IYJ B;  3K8A A;  3PUZ A;  1WYD A;  3J80 i;  3SGI A;  3A74 A;  2A8V A;  4A3K H;  4DV0 L;  4BY1 G;  4AH6 A;  5FLM G;  4AQY L;  2E2H H;  3J81 i;  4JI4 L;  4LF7 Q;  1C7Y A;  1W3S A;  3KFU A;  3KDF A;  2E8G A;  3FKI H;  4DK6 C;  5ELN A;  4DR1 L;  1K9M C;  3S17 H;  3EIV A;  2DUD A;  1HNW Q;  2ZJR A;  4JI6 Q;  4DR7 L;  1TWG H;  4TQU S;  3RN2 A;  5JJI A;  1YIT A;  1G51 A;  3CPF A;  3GTM H;  2N49 A;  3HOZ G;  3ULP A;  2UUC Q;  1PH4 A;  4YCV A;  2A19 A;  1YIJ A;  2I0Q A;  2AWN A;  3CME A;  4DK3 C;  1JB7 A;  1TWH H;  1O7I A;  3D0F A;  5JJL A;  1B7Y B;  1HNW L;  2RCN A;  3I7F A;  2QA4 A;  4GKJ Q;  4JI6 L;  3TEH B;  5IYC H;  4A3C G;  3OTO Q;  4A93 G;  1QZG A;  5IWA L;  1AH9 A;  4X65 L;  4YY3 Q;  1VQB A;  1N34 Q;  4LF6 Q;  4UP8 A;  2UUC L;  3UE0 A;  4BA2 I;  1PYS B;  1T9H A;  2GN5 A;  2Z0S A;  1X3G A;  3TQY A;  3S2D H;  4JI7 Q;  5FJ8 G;  1XMQ L;  3ERS X;  2EIF A;  1SR3 A;  2NZH A;  3CW2 C;  4OWW B;  1NJI C;  5IYB H;  1FJG Q;  3Q8D A;  4B3S L;  4A3D H;  1PH8 A;  3HKZ G;  5GAH C;  1D8L A;  4L5Q A;  5GAE C;  3HOX G;  4GKJ L;  4DUZ L;  3OTO L;  3BZK A;  1Z9F A;  4OO1 I;  3BJU A;  2IX1 A;  4YHH Q;  1VQP A;  1KRS A;  1HNZ Q;  1N34 L;  3PIO A;  1U5K A;  5M5Y H;  3A0J A;  4LF6 L;  4EX5 A;  1OXT A;  4GKK Q;  1X9N A;  2L15 A;  5C0X G;  2IX0 A;  1BBU A;  1MKH A;  3A5Z B;  4DAM A;  4GOP C;  3PUW A;  4GLX A;  3CCV A;  1UE1 A;  1OXX K;  5IT9 c;  1FJG L;  2R7Z H;  2ALY B;  4DR4 Q;  2VUM H;  2UXB Q;  4LUV A;  2ATW A;  3I4N G;  3CC7 A;  4A3K G;  3TS2 A;  4DV1 L;  1FL0 A;  3D31 A;  2BH8 A;  2PI2 A;  1I94 L;  3ICE A;  1VQH A;  2NVY H;  4B3R L;  3M7N A;  4YHH L;  1CKO A;  3KJP A;  4OON A;  3T1Y L;  1R9T H;  1K73 C;  2JEA I;  1VQ6 A;  2R92 H;  2OWO A;  4OWT B;  2JA7 G;  4GKK L;  1L1O A;  4QIW E;  5IP7 H;  4A3G H;  4HIK A;  3F2C A;  1TWA H;  3J80 c;  4NPS A;  2H5X A;  2N8N A;  2RHQ B;  4GOP A;  2ZTE A;  4IPG A;  4IPH A;  1XTD A;  3PUV A;  3J81 c;  3NEL A;  5M3M H;  5C44 G;  2JA6 G;  4DR4 L;  1JJG A;  1MJE A;  2F4V Q;  3ZJY C;  2VY3 A;  1QVF A;  4GNX B;  1SRO A;  3W5O A;  4QJF A;  1VQM A;  4A3I G;  2UU9 Q;  4LF5 Q;  3B6Y A;  1YEZ A;  2UXD L;  1G6P A;  3CPW A;  4A3J G;  3ER0 A;  4JI1 Q;  3GTJ H;  3GTL H;  1N36 Q;  1A63 A;  4APV A;  3TS0 A;  2CWA A;  2Y0S E;  3I4O A;  1EFW A;  3HOZ H;  1Y14 B;  3F1Z A;  2CCZ A;  1HH2 P;  3CF5 A;  1TXY A;  2K14 A;  4HJ9 A;  4PZ6 A;  5GRO A;  4C2M H;  4LF9 Q;  4A3E G;  3PO2 G;  1UE7 A;  1VQ4 A;  4B3M Q;  2VQE Q;  2LXK A;  1KL9 A;  4YCW A;  5FLX c;  4A93 H;  4A3C H;  1N32 Q;  3EBE A;  1NMG A;  2VQF Q;  5AJ3 Q;  4LF4 L;  1N33 Q;  1J6Q A;  4JI5 Q;  4LNQ A;  2XTI A;  1K8A C;  4A3B G;  3PF5 A;  2B63 G;  1PVO A;  5IYD G;  2MO1 A;  4LF9 L;  5FJ8 H;  3I56 A;  5LMU Q;  5M5W H;  1VQG A;  2YTV A;  3UDX A;  2CQO A;  3NEM A;  2NZO A;  4LUZ A;  1ASZ A;  2F3I A;  2VQE L;  4DV2 Q;  4B3M L;  3GTP H;  2VS1 A;  1FGU A;  1UE5 A;  4LUO A;  4OX9 Q;  5C0X I;  3ULJ A;  4JBW A;  1N9W A;  1YBY A;  5C3E G;  1SMX A;  1SFO H;  2KCM A;  5AJ3 L;  2ASB A;  1N33 L;  1A8V A;  3S15 H;  4JI5 L;  4A3F G;  1HNX L;  1L0W A;  2E2I H;  2PI2 E;  3S1M H;  4POF A;  1QVG A;  4A3M G;  1BBW A;  2NN6 I;  4DV2 L;  3K7A H;  1UEB A;  1KC8 C;  2NVX H;  3W1B A;  4NXN Q;  3I4N H;  2R7D A;  5M5X H;  1YJW A;  2NVQ H;  4B3T L;  1CKM A;  2ID0 A;  4X64 Q;  2DGY A;  1U0L A;  4O2D A;  4ALP A;  1I5F A;  1DGS A;  1VQL A;  2AKW B;  1PH1 A;  2CKZ B;  2JA7 H;  2PQA B;  3JAM i;  2K75 A;  2BH2 A;  2PNH A;  1X3F A;  2UUB L;  2JEB I;  3RLN A;  1E1T A;  2WAQ E;  3EN2 A;  4IPD A;  4X62 Q;  3M85 A;  4A4I A;  3UE1 A;  4R4T A;  4HJA A;  4NXN L;  4MZ9 A;  5C44 H;  2JA6 H;  2D0P A;  3U50 C;  2FXQ A;  1G29 1;  4HIO A;  4LF7 L;  4A3L G;  4IFD G;  4X64 L;  2R93 G;  1GD7 A;  3GTK H;  4JI3 Q;  3J7A 5;  4R1J A;  3K7U C;  3K81 C;  5JEA J;  2K4K A;  4QY7 A;  4JYA Q;  1PH9 A;  3E9H A;  3H15 A;  1EYG A;  4UP9 A;  5LMN Q;  4A3I H;  2Q2U A;  4R4C A;  3U4V A;  4L5T A;  5IE8 A;  4A3J H;  3G4S A;  4IOA A;  4MNO A;  3L7Z C;  3UDF A;  1OTC A;  4JG2 A;  1OXU A;  4IJH A;  2Q2H A;  5H1S E;  3J81 j;  3G71 A;  3RN5 A;  3CCS A;  4JYA L;  4A3E H;  3PO2 H;  1HZA A;  2KHJ A;  3OW2 A;  2K5H A;  2IHF A;  3FHW A;  3CCM A;  5LMN L;  3CC4 A;  1YNX A;  3UDI A;  1YHB A;  1C9O A;  4GN4 B;  1K3R A;  4C3I H;  4WJ3 M;  1K83 H;  1NY4 A;  1PHJ A;  4YY3 L;  4A76 A;  1XNR Q;  2UXD Q;  1L1O C;  2JK8 A;  1VQO A;  1NE3 A;  1PH5 A;  1QUQ B;  3CCE A;  3LGJ A;  4JI7 L;  2N3S A;  3DM3 A;  2IY5 B;  1LUZ A;  2HQL A;  3CMA A;  1SN8 A;  4LF8 Q;  2B63 H;  5ELO A;  2Q2T A;  4A3B H;  5IYD H;  4GNX C;  1WFQ A;  4JV5 Q;  4OWX B;  1PH2 A;  1SRU A;  5J3B A;  5JJK A;  3T1H Q;  3JC6 6;  1HNZ L;  4DR5 Q;  4JCV E;  3IRB A;  1IL2 A;  2I5H A;  5C3E H;  2OQK A;  2GVA A;  5LMN W;  2YTX A;  4YWL A;  4A3F H;  1LM0 A;  3VDY A;  1V43 A;  1OXV A;  1Q1B A;  4LFC Q;  1I3Q H;  1RIP A;  1IXR A;  3MXN B;  4XTC S;  2UXB L;  3KF6 A;  1W2B A;  1D7Q A;  2AHO B;  3G6E A;  4GNX A;  5GAD C;  4A3M H;  4ME3 A;  3TRZ A;  3RZD H;  4H02 A;  1KHI A;  2OQ0 A;  3KF6 B;  4JBJ A;  1VQC A;  4C3J H;  4DV5 Q;  2QGQ A;  1VQA A;  1VQF A;  3T1H L;  1EQQ A;  1I6H H;  5C4X G;  1E24 A;  2RF4 A;  4UPA A;  2HIX A;  1WOC A;  3PO3 G;  4BBR G;  2MO0 A;  2ZTD A;  4J15 A;  5IP9 G;  4LFC L;  1V1Q A;  1Q46 A;  1Q81 C;  1UWV A;  4IJL A;  1KQS A;  2MFI A;  5C4J H;  2F4V L;  4DV5 L;  2KCT A;  1CUK A;  2Y0S G;  1HZ9 A;  1KRT A;  4C3H H;  1E22 A;  2BA1 A;  4DR2 Q;  1XMO Q;  1PYB A;  1B70 B;  4P74 A;  3BZC A;  4A3L H;  3J7Z C;  1S3O A;  1WI5 A;  3PUY A;  2R93 H;  2K5N A;  4TVA B;  4JBM A;  2JQO A;  1X6O A;  2UU9 L;  1EUJ A;  3E0E A;  1HR0 Q;  4DR3 Q;  4LF5 L;  3S24 A;  1N8R C;  2HT1 A;  1EWI A;  2JA9 A;  1IBL Q;  3E9I A;  1VQ8 A;  1HZC A;  4JI1 L;  2E5L Q;  1N36 L;  5K36 G;  3I4M G;  4JI2 Q;  4DV7 Q;  4Y52 H;  3HOY G;  2BA0 A;  1XMO L;  1VQK A;  2NVT H;  4JI8 Q;  3PV0 A;  2GVB A;  2JA8 H;  4BXX G;  1B8A A;  5C0X J;  1A62 A;  4JOI A;  4DR3 L;  5DLQ E;  4AYB E;  1EQR A;  2D0O A;  3CCR A;  1IBL L;  2WP8 J;  1E7Z A;  5M3F G;  4QGU A;  1VQ7 A;  4L5R C;  4DV3 Q;  3TRE A;  2E5L L;  1OXS C;  1N32 L;  3GO5 A;  3AYH B;  1V9P A;  2ZM6 Q;  3OYY A;  2VQF L;  3STB D;  4DV7 L;  1J5E Q;  4JI2 L;  4POG A;  2OTJ A;  4JI0 Q;  4R4I A;  2EQS A;  3AFQ A;  3CCU A;  2Z6K C;  3S1Q H;  1HJP A;  5LMU L;  4OO1 G;  4GN5 A;  2F52 A;  1S72 A;  3L2P A;  3H3V I;  1SLJ A;  4KHP Q;  1X55 A;  2VNU D;  1IBK Q;  4DAY B;  1EIF A;  3UDG A;  1VQ5 A;  1Q82 C;  2YYZ A;  3I2Z A;  1IBM Q;  4OX9 L;  1S40 A;  4DPG A;  3L0O A;  2PQA A;  3G48 A;  4DUY Q;  1PA6 A;  1IZ6 A;  3M4Q A;  1XNQ Q;  1A0I A;  3H3V H;  2WFW A;  3PUX A;  4DKA C;  4UP7 A;  1HR0 W;  4JI0 L;  3CD6 A;  1X65 A;  4P73 A;  1NTG A;  4KLK A;  1EOV A;  1Q12 A;  2E2J H;  1L2F A;  2YU9 H;  2Z6K A;  3CP0 A;  3RZO H;  3PCO B;  4DR1 Q;  3HOV H;  1MJC A;  4O0A A;  2WAQ G;  4NB3 A;  5EAY A;  1IBK L;  2WB1 E;  2HIV A;  2B3G A;  3F2D A;  4DR7 Q;  2AWO A;  4BBS G;  4R4Q A;  4GLV B;  4P75 A;  4DUY L;  3M3Y H;  2D62 A;  2UXC Q;  1XNQ L;  5C4X H;  1M1K C;  3HFZ B;  4PZ8 A;  1X56 A;  2ZJP A;  4P72 A;  3AEV A;  1XPR A;  3CCL A;  3S1N H;  2V1C C;  3U58 A;  1HZB A;  3PO3 H;  4BBR H;  5IP9 H;  1PH7 A;  2JE6 I;  4XIG S;  4X62 L;  1QZH A;  4DV4 Q;  3NEN A;  4LFB Q;  3KDF B;  1KIX A;  1KAW A;  4LWC A;  3GTG H;  5IWA Q;  3KF8 B;  4X65 Q;  2JA8 G;  1ASY A;  4K0K Q;  4AIM A;  4JI3 L;  2UXC L;  3H0G G;  4HJ5 A;  1NMF A;  2PMZ E;  1Y1W H;  5HY6 A;  3KLW A;  3U4Z A;  2ZTC A;  1XMQ Q;  4P71 A;  3NBH B;  4B3S Q;  1QUQ A;  5GAG C;  1GO3 E;  4DV4 L;  3AQQ A;  3PGZ A;  4LFB L;  3KOJ A;  1P16 A;  4DUZ Q;  3I4M H;  1YHA A;  3CCJ A;  1JMC A;  4JBK A;  2CWP A;  3HOU G;  3HOY H;  1CSQ A;  2JJQ A;  3RLF A;  4K0K L;  3HKS A;  3M9B A;  2OCE A;  1KXL A;  1Q7Y C;  4YWM A;  3GD7 A;  1YJN A;  3AFP A;  4QQB X;  2MQH A;  1YZ6 A;  2UUA Q;  1XPO A;  2LSS A;  4BXX H;  2R6G A;  4IO9 A;  3BU2 A;  2ZJQ A;  1TWC H;  2JA5 G;  3HKZ E;  1YVC A;  4DR6 Q;  2VZA A;  1JE5 A;  3PSI A;  2K52 A;  2K5V A;  2KBN A;  4LW1 A;  5M3F H;  1RL2 A;  1XNR L;  4JC0 A;  5E7N A;  4DV1 Q;  1YHQ A;  1GVP A;  1JJ2 A;  1Q86 C;  4HIM A;  1X3E A;  1VQD A;  2A1A A;  5GQO A;  1I94 Q;  3HOW G;  4B3R Q;  4BY7 G;  2R7F A;  1GM5 A;  1WCM G;  4QL5 A;  1QVC A;  1Z47 A;  3T1Y Q;  2AMC B;  1FVI A;  1UE6 A;  4LF8 L;  3CC2 A;  1XPU A;  3HOV G;  1X54 A;  1AE2 A;  4JV5 L;  1YJ9 A;  2EXD A;  4HJ8 A;  2UUA L;  1I50 H;  1E1O A;  1WJJ A;  4R4O A;  4LFA Q;  1PV4 A;  3S1R H;  4MTN A;  4DR6 L;  3JAM c;  4DR5 L;  1JJC B;  1CKN A;  4NXM Q;  1C0A A;  2N78 A;  2HHH Q;  3ULL A;  1CSP A;  3RR5 A;  4PG3 A;  4KI0 A;  1PFS A;  2NN6 G;  1CKN B;  4PMW A;  3FKI G;  4IFD J;  1BKB A;  4GN3 B;  2Q2I A;  5BR8 Q;  2I5L X;  2KHI A;  4YWK A;  3CXC A;  4PZ7 A;  2K50 A;  4EQ5 A;  4YCU A;  1BVS A;  1Y1V H;  5IY0 A;  4Y7N H;  3PIP A;  4RMF A;  4IFD I;  2B29 A;  1VQJ A;  2I5M X;  4DV6 Q;  4LFA L;  1L1O B;  1VQ9 A;  4BBS H;  1Y1W G;  3STB C;  4NXM L;  4GOP B;  2HHH L;  4X6A H;  4JOI C;  2IHE A;  1VQI A;  1GKH A;  4OXP A;  4FDB A;  4A75 A;  2OTL A;  4BY1 H;  1JT8 A;  3K0X A;  5FLM H;  5BR8 L;  2VL6 A;  3GDE A;  4HJ7 A;  5IYC G;  4L5S A;  1SE8 A;  3CQZ H;  2VW9 A;  4DV6 L;  4HID A;  1K8G A;  4DR2 L;  2MNA A;  1Q1E A;  3RLO A;  4LF4 Q;  4DNI A;  5JEA G;  1AE3 A;  3M4P A;  1VCI A;  3S14 H;  2IT1 A;  3H0G H;  4IOC A;  1HR0 L;  5IYB G;  1PH3 A;  4WJ4 A;  4RG1 A;  3RNU A;  3FP9 A;  3K80 C;  4GS3 A;  3KYH C;  1LTL A;  4AYB G;  3F2B A;  4A3D G;  4BA1 I;  3I55 A;  3DLL A;  2XGT A;  2C35 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...