5M5WH

Rna polymerase i open complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
144
structure length
134
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase I subunit RPA190
publication title Molecular Structures of Transcribing RNA Polymerase I.
pubmed doi rcsb
molecule tags Transcription
total genus 16
structure length 134
sequence length 144
ec nomenclature
pdb deposition date 2016-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m5wH00
4ME3A 2QEXA 2VQEL 3T1HL 1IXRA 3AFPA 1U0LA 1EWIA 2F4VL 1BBUA 1Q8KA 4QL5A 3NELA 4DV2L 2BH8A 1H95A 2EXDA 1KL9A 2RF4A 3UE1A 2ZJPA 4A76A 4DUYQ 2KBNA 1BVSA 3K8AA 3G4SA 3HKZG 1N33L 1VQNA 1PH1A 5IYCG 4IFDG 4A3JG 1FJGL 1XNRQ 3HOXH 4YCWA 3F8TA 4LF9L 1C0AA 1YITA 1SE8A 3HOZH 3PUZA 4EX5A 3U4ZA 5HGQA 2BA1A 1VQ4A 2Y0SG 3CP0A 4JI0Q 2I5HA 4DK3C 3K80C 1FL0A 5IYBH 1NE3A 5IP7G 2JK8A 3L7ZC 5GAGC 5M5XH 5LMUL 3BZCA 3CCEA 1VQOA 1EFWA 3CQZH 1G6PA 1K73C 5C44G 4PZ7A 1D8LA 4AQYL 1R9TH 5HY6A 5FJ8G 3T1YL 4HIOA 1MKHA 3FKIH 1X55A 2K14A 2L15A 3K81C 2QGQA 4A3FH 3H0GH 4JOIA 2JA7G 2NVYH 1C7YA 3U50C 4BA1I 2A19A 3KDFB 3HOYH 1UWVA 4C3HH 4L5SA 3PV0A 1E7ZA 2AMCB 3M4QA 4QJFA 4LF7L 3GTLH 3M9BA 1RL2A 2ZTDA 4DV0L 1UE1A 2AWNA 3PUVA 4JI1L 1K83H 3CC7A 2IHFA 1VQ6A 2WFWA 1P8LA 2JQOA 1JJCB 1Q12A 4LFCL 3J7ZC 1Q46A 2JE6I 1IBLQ 5IE8A 1VQCA 2B63H 5DLQE 4JI4Q 2IHEA 4JBJA 2VL6A 1YZ6A 2AHOB 2UUAL 1V1QA 3HOXG 4KLKA 3S15H 1VQAA 4YWKA 4YHHL 3S16H 2NZHA 4X65L 2R92H 3HOWH 4Y7NH 1IYJB 1K0RA 3HOZG 3BU2A 4BA2I 4APVA 2Q2IA 4DR6L 2UUCQ 4B3TL 2UXDQ 3F1ZA 5JJKA 4LUZA 2R93H 3VDYA 4DV4Q 1VQJA 3G48A 4EQ5A 5IYBG 1IL2A 3CCRA 4HIKA 4JOIC 2ZJRA 1LUZA 4WJ3M 1K8GA 2R7ZG 4LFBQ 4DV5Q 2CFMA 1FGUA 1E3PA 1CSQA 4OONA 4R4OA 1YJ9A 2K75A 1I94L 5JJLA 1KC8C 4OX9Q 4DR7L 2JEAI 2IY5B 1SMXA 1HH2P 5BR8Q 1YHAA 4GLAC 5C4XH 1MJEA 5AJ3L 3FKIG 2VQFL 3W1BA 4ALPA 2A8VA 3UDFA 1G51A 4A3FG 1EYGA 3H0GG 2N8NA 1NY4A 5IP9H 4DNIA 1XMQL 2Q2UA 3S1QH 3J81c 3HOYG 2E2IH 5EAYA 4Y52H 4DV7Q 4A3EH 1HR0Q 4A3GH 4X66L 3GTGH 1WCMH 4JI6Q 2ALYB 4YWMA 2MNAA 1GKHA 2WAQE 3A0JA 1VQDA 5J3BA 4A4IA 4LF6Q 3STBC 5H1SE 1S3OA 1B7YB 1GO3E 1TWFH 2ES2A 4KHPQ 2HHHL 5IT9c 1YHBA 3WWVA 1N32Q 1JE5A 3G6EA 1DGSA 1JJ2A 1E1TA 4NPSA 2B63G 1HR0W 4JI3Q 4BBSH 1VQHA 3F2CA 2IX0A 2PMZE 4B3SL 2OTJA 2ZM6Q 4DPGA 4DUZL 2Q2HA 1WYDA 2DGYA 3KJPA 4A3IH 4PZ6A 2R92G 4BY1H 3HOWG 2VW9A 4K0KQ 4LF4Q 1IBMQ 1PVOA 1I3QH 5K36G 4B3RQ 3D0FA 1XNQL 1X3EA 4DAYB 2D0PA 1XJVA 2PQAA 2AKWB 3KF8B 5LMNQ 4BY7H 4IFDJ 4JV5Q 2R93G 4PG3A 3CW2C 2JEBI 3KYHC 2K4KA 4L5QA 4LNQA 4DUYL 2B29A 4YY3L 4QY7A 3CCSA 2UXCL 5GAEC 1HNWQ 3TS0A 1XNRL 5C4XG 2AWOA 4GN3B 2GVBA 3RLOA 1QUQB 4DR3Q 5FLMH 1TWGH 1LYLA 2NZOA 4DV3L 1V43A 1Q86C 4A3CH 1HNXL 4OWTB 5C3EH 5IP9G 2MQHA 4JI0L 3I4MH 4DR4Q 2F52A 4GLVB 4DV1L 1K8AC 4A3GG 4LF8Q 1X6OA 3ULLA 1K3RA 1WCMG 4DAMA 3CCJA 3KOJA 1L2FA 1VQ8A 1I5FA 4JBWA 4HJ9A 3L0OA 1N34Q 1AH9A 1ASYA 1NTGA 1MIUA 1Q1EA 3HOVH 3J80c 4QQBX 3HKZE 3CAMA 2CWAA 4GLXA 3S17H 4RG1A 3M4OH 3S24A 4BBSG 1X3FA 3PUXA 3OTOL 3M7NA 3ZJYC 2PI2E 4DKAC 3F2DA 2F3IA 1LM0A 2K50A 4A3IG 3RZDH 1XPRA 4NXMQ 4MZ9A 4BY1G 4DR1Q 2Y0SE 2UUBL 1Y14B 5C4JH 1XMOL 3G71A 4BY7G 2BH2A 1EUJA 1N36L 3A5UA 1OXUA 4O0AA 4JI5Q 2D0OA 3J81j 4GN4B 5E7NA 4A75A 1VQKA 2KHIA 1UE7A 3E0EA 3I7FA 1KAWA 3ER0A 4JG2A 4P73A 3CCVA 1PYBA 4HIMA 1VQLA 3S1MH 4UP7A 3K7UC 5JEAG 3ICEA 3GTPH 5FLMG 3IRBA 1HZAA 4DV6Q 1BKBA 2UXDL 4A3CG 4GKJQ 1PV4A 2OQKA 2K5VA 1GD7A 5C3EG 2VQEQ 4H02A 2K5HA 4LUVA 3I4MG 3KLWA 3T1HQ 4IPGA 4YCUA 5IYDH 1XPUA 1E22A 1VQMA 2I5LX 1YEZA 2EQSA 4DV2Q 1SLJA 4LFAQ 1VQGA 1FVIA 1OXSC 4OWXB 3TQYA 3PF4A 2IX1A 2NVQH 1X3GA 2JA8H 5BR8L 5M3FH 1N33Q 3HOVG 2UXBL 4UPAA 3MXNB 1C9OA 4R1JA 1QVFA 2VY3A 4LF9Q 3HFZB 2UU9Q 4UY8C 1CKNA 3ULPA 4DR2Q 1QZGA 1YHQA 2WB1G 1HR0L 4LUOA 3E9IA 3KF6A 4IPDA 1O7IA 2N3SA 1XTDA 3LGJA 4X64Q 4JI6L 2VNUD 1CUKA 3Q8DA 5ELOA 1JB7A 4WJ4A 5JJIA 4X62Q 1PH4A 3HKSA 4AYBE 1VQ7A 2R6GA 5LMUQ 1QVCA 3FHWA 3OYYA 4KHPL 5IWAQ 1I6HH 1N32L 1X65A 3PO2H 4HJ8A 1HZBA 4AQYQ 3SGIA 3T1YQ 3GTMH 1IBKQ 4BBRH 2JA6H 1HZ9A 2NN6I 4QIWE 3PGZA 3U58A 3CCUA 1NMGA 3A74A 3AFQA 1JMCA 4JI2L 4LF5L 3TREA 3KJOA 1PH2A 4K0KL 4GOPA 3S14H 1OXTA 1E24A 3K0XA 2E5LL 4LF7Q 3PUYA 2GVAA 2CWPA 1WJJA 3GO5A 4OXPA 4DV0Q 3M3YH 4A3BH 4JV5L 4L5RC 2K52A 5IYDG 1UE5A 4A3DH 2A1AA 4GNXA 4KI0A 2OQ0A 4JYAL 2VZAA 4A3LH 4NXNQ 1VQ9A 1PA6A 4BXXH 2HIXA 4XIGS 2KCMA 4A93H 1WOCA 2N78A 3GDEA 4POGA 2CKZB 2JA8G 2E8GA 5M3FG 3TS2A 3TRZA 2IT1A 1E1OA 4R4CA 4JI7L 1SN8A 3CCQA 2UUAQ 1A63A 4B3MQ 5M5WH 4NB3A 1SRUA 2GN5A 4X6AH 1VQFA 4A3KH 1RIPA 4R4QA 3J80i 1GM5A 4DR4L 1UEBA 1Z9FA 3EIVA 2PQAB 5GAHC 3AEVA 1HZCA 3CCMA 1P16A 4UP9A 1NJIC 1ASZA 1A62A 2KHJA 2MO0A 2NN6G 3S1NH 1Q1BA 2WAQG 4IOCA 2R7DA 1PFSA 2V1CC 4JCVE 1QVGA 1N34L 2R7FA 1PYSB 2LXKA 2D62A 3H15A 4DV6L 4GOPC 4DR7Q 3PO2G 2RHSB 3NENA 3AYHB 4BBRG 5AJ3Q 3I56A 3M4PA 2VQFQ 5LMNW 3RLNA 2N49A 3L2PA 4OWWB 2JA6G 3J7A5 4GNXC 4C2MH 2NVTH 4IPCA 3RLFA 4C3IH 1PHJA 3PO3H 4L5TA 4NXML 4DR1L 5M3MH 2I0QA 2WP8J 1KRTA 4A3EG 1M90C 1MJCA 4A3BG 5GROA 5GQOA 2C35B 5JEAJ 1PH7A 4A3DG 1Z47A 1JJGA 3UDGA 1B70B 4R4IA 3RZOH 4A3LG 2K5NA 4PMWA 1L1OB 3ERSX 2HHHQ 4BXXG 3S2HH 1D7QA 5C0XI 3PIOA 1J5EQ 1L1OA 4A93G 4POFA 1EIYB 4HJ5A 2PNHA 3W5OA 3BJUA 3I55A 1OTCA 1EIFA 4PZ8A 5M5YH 1JT8A 2JA5H 4A3KG 3B6YA 2ZJQA 4C3JH 2ID0A 1HNZQ 1QZHA 4FDBA 1XNQQ 2VS1A 1S40A 2E2JH 3HOUH 2OCEA 3I4NG 2KCTA 1A0IA 1IBLL 3PCOB 4LFAL 3E9HA 4GKKQ 1IZ6A 4DR5Q 1X56A 3K7AH 2HIVA 4P71A 3JAMc 1EQQA 4YY3Q 2DUDA 2OTLA 4JI4L 1G291 3I4OA 3UE0A 2UXCQ 3TEHB 1BBWA 4JI8Q 1VQ5A 2UU9L 3S2DH 1SROA 1Q82C 2XTIA 4JBMA 4DR2L 1UE6A 2FXQA 4MNOA 4DV3Q 1KQSA 1YIJA 1M1KC 1HNXQ 3FP9A 2UUCL 3PO3G 3CPWA 4YCVA 1AE3A 5C0XG 2QA4A 5M3MG 1Y1VH 4IJHA 1B8AA 4X64L 1YI2A 4R4TA 1TXYA 2YYZA 4KHZA 3UDIA 4DV1Q 4DV4L 1Q81C 4X62L 1L1OC 3MEFA 2Q2TA 2F4VQ 2EIFA 1YVCA 3NBHB 2R7ZH 2H5XA 4JBKA 1Y1WH 4P72A 4DV5L 4LFBL 2ZTEA 3J81i 4OO1I 2I5MX 5IWAL 4OX9L 1L0WA 2ATWA 3H3VH 1K9MC 3BZKA 2VUMH 1IBKL 1CSPA 4HJAA 3CC2A 2ASBA 2NVXH 1FJGQ 3M85A 3CC4A 1CKNB 3OTOQ 4AH6A 4P75A 1VQBA 1AE2A 3KDFA 3KF6B 1VCIA 4DV7L 2WB1E 2E2HH 2JA5G 2LXJA 2UUBQ 1PH9A 3H3VI 3PF5A 3PUWA 1XMOQ 2CQOA 3GTKH 2B3GA 4IPHA 3OW2A 4LF6L 2YU9H 1EQRA 3EN2A 3UDXA 2HQLA 1XPOA 1PH3A 1N36Q 3HOUG 3CMAA 4NXNL 2Z6KA 1A8VA 3U4VA 4JI3L 3CPFA 3EBEA 3GD7A 1KIXA 3KFUA 3RNUA 3CMEA 2ZM6L 2YTVA 1Q7YC 4B3ML 4OO1G 4GOPB 3DM3A 3ULJA 5FLXc 1KHIA 4LF4L 1IBML 4RMFA 2OWOA 4B3RL 3D31A 2JJQA 5LMNL 1Y1VG 4GNXB 1W3SA 1HJPA 1VQIA 1WFQA 4JI1Q 4AYBG 4AIMA 2RHQB 1PH8A 4LFCQ 1U5KA 2YTYA 5GADC 1Y1WG 1S72A 4TQUS 2RCNA 4A3MH 1NMFA 3DLLA 2Z0SA 2YTXA 1HNWL 1X9NA 3PIPA 2VUMG 4LW1A 4DR3L 2UXBQ 3W1GA 3RR5A 1KD1C 1YJWA 3I4NH 1SR3A 4YHHQ 3CF5A 2MFIA 1J6QA 3JC66 4X65Q 3CCLA 3CD6A 1SFOH 3RN2A 2Z6KC 2HT1A 3STBD 1N9WA 1YNXA 2XGTA 4O2DA 4B3TQ 4TVAB 1W2BA 1LTLA 4LF8L 4DR6Q 4JC0A 4P74A 1EOVA 1PH5A 4DK6C 1YBYA 1NBWA 4IO9A 1GVPA 1I50H 2ZTCA 3F2BA 1I94Q 5IYCH 1J5EL 4A3JH 4LWCA 4GN5A 1VQPA 2LSSA 4HJ7A 4LF5Q 3GTOH 4J15A 4JI2Q 3JAMi 1XMQQ 2PI2A 1V9PA 2YV5A 3NEMA 1HNZL 1WI5A 1OXXK 1VQEA 2E5LQ 3GTQH 3S1RH 3RN5A 4X66Q 5IP7H 4IOAA 4IFDI 1TWHH 4UP8A 3GTJH 3AQQA 1TWCH 3I2ZA 1KRSA 4JI5L 5C44H 1X54A 1N8RC 4GKKL 4DR5L 3PSIA 4YWLA 4JYAQ 1VS0A 2KENA 1CKOA 1TWAH 5FJ8H 2BA0A 4QGUA 5C0XJ 4A3MG 2CCZA 4JI8L 3CXCA 2MO1A 3A5ZB 1T9HA 2JA9A 5ELNA 2JA7H 1CKMA 4IJLA 4MTNA 1OXVA 4B3SQ 5IY0A 4JI7Q 1PH6A 1KXLA 4XTCS 4GS3A 4DUZQ 1QUQA 1YJNA 4HIDA 4GKJL
chains in the Genus database with same CATH superfamily
4B08A 4C3JB 4RHRA 1S4ZA 2XWBB 1BBUA 3SDZA 2RF4A 4DK1A 2ZJPA 3C3LA 1MGSA 4DUYQ 3K8AA 1N33L 3HKZG 4KY6A 3SVMA 3L3OC 4IFDG 1FJGL 4DK0A 4LF9L 1YITA 1SE8A 1XWEA 2EOTA 2JP1A 3U4ZA 3KBGA 2HQEA 2K05A 3CP0A 1EY0A 2I5HA 4QF4A 1FL0A 4OEMB 5JVH3 5LMUL 3CQZH 1K73C 4PZ7A 3QIAA 1HPCA 5HY6A 3OMGA 1IL8A 3K81C 2QGQA 4MHEA 3HRZC 4QIWB 3H0GH 4A3FH 2NVYH 2RBMA 2A19A 1HTPA 2PCFB 4F87A 4QJFA 2E2HB 1TR5A 4DV0L 3BG3A 3PUVA 3IKJA 1F2ZA 5KNCA 3GTKB 3OPOA 2RSOA 1S5CD 2JE6I 1LT4D 2VL6A 2AHOB 1BOSA 1GUGA 1S5DD 3HOXG 3MXNA 1HUMA 2X69A 4IQZA 2NZHA 4X65L 5K36H 3HOWH 2R92B 4Y7NH 4KHVA 4BA2I 2UUCQ 3F1ZA 4KK7A 3V96A 3VDYA 1I4XA 4DV4Q 1VQJA 3T56B 5I2XA 1IL2A 3A8JE 2CFMA 1E3PA 1CSQA 4R4OA 4JPBW 1I94L 2K75A 5JJLA 1CTMA 2JEAI 1YHAA 1WVLA 2VQFL 3FKIG 1GXDC 2FINB 4MN3A 3UDFA 2D5DA 2F1MA 2N8NA 2NWGA 2NZ1D 5IP9H 1XMQL 4G7OC 3C46A 1ZXTA 2FJ2A 1QE6A 4DV7Q 4A3EH 4X66L 3GTGH 2ALYB 4ME5A 4KMUC 4A4IA 1S3OA 4KHPQ 2F0HA 2HUGA 5IT9c 4G7HC 1JJ2A 4NPSA 2B63G 1D5MC 4BBSH 1TVXA 4CBVA 3MA2B 2PMZE 4B3SL 3A7AB 2ZM6Q 2F0UA 2OT2A 3KJPA 2R92G 4BY1H 2VW9A 2TMPA 1IBMQ 1I3QH 1STNA 4B3RQ 3D0FA 1XJVA 4DAYB 2D0PA 4IFDJ 2PQAA 3H09A 2R93G 1ICWA 3KYHC 4L5QA 1B53A 4LNQA 4YY3L 4QY7A 1HTLD 1LV9A 1TWAB 1DXMA 1W6KA 5C4XG 1QUQB 5DAUA 5FLMH 1TWGH 1LYLA 4DV3L 1HNXL 4OWTB 1MD2D 4QMGA 3QOJA 4K6DA 4LF8Q 4DAMA 3KOJA 1L2FA 4K2KA 1SE2A 2ZXPA 3FDTA 3E0JA 1EU4A 4WRDA 1NTGA 4CJ1B 1MIUA 3HOVH 4OIJA 3HKZE 3CAMA 2CWAA 2FFKB 1TQOA 4RG1A 1JE4A 2XWJB 3PUXA 3M7NA 3F2DA 2K50A 4A3IG 3HOZB 4MZ9A 3CRKC 1MSGA 4N8X1 2PW7A 1ESFA 3G71A 1EUJA 2KECA 3A5UA 1H9SB 1RODA 4HSPA 2EYFA 1STAA 4DF7A 1R9TB 4PV1C 4JG2A 3E0EA 1KAWA 3SK4A 1PYBA 3S1MH 2WINB 4UP7A 4ABNA 1EIHA 5CC4A 4X3UA 3I4MG 1GD7A 2K28A 3KLWA 3T1HQ 1HFGA 4YCUA 1E22A 2KVMA 2KA7A 2R61A 1FGBD 3PMFA 4IUNA 4LFAQ 4HMIA 5A35A 4RCOA 3PF4A 3OWEB 5M3FH 1JWMD 4R1JA 2XIWA 1O78A 2UU9Q 3S15B 4G7ZC 3NTIA 1TU2B 1QZGA 1YHQA 2WB1G 4IPDA 4TRDA 1XYIA 3WOFA 4X64Q 3Q8DA 4X62Q 5LL6X 2MGSA 1F2YA 1SEBD 3FHWA 4B9XA 1I6HH 2DY7A 2ZXRA 1BUVT 1J9OA 2QW7A 3SGIA 2X6LA 2A73B 1IBKQ 4HCEA 2NN6I 4QIWE 3PGZA 2MHVA 1CZWA 1JMCA 1CM9A 3M7GA 2E2IB 2XN9C 4LF7Q 1WJJA 3M3YH 4A3BH 2PW5A 1E2VA 1FR3A 4V190 4OELB 2L12A 2PYKA 1B50A 3N6RA 1OO9B 3NTKA 4G4KA 2X6GA 3P7JA 2HIXA 2F0FA 3TP5A 3TN2A 4A93B 2CKZB 1ZEQX 4R4CA 3VR6A 3V05A 3CCQA 2UUAQ 1A63A 5E4WC 2P5ZX 2GN5A 1O80A 3J80i 1SNOA 4NW2A 3OOCA 4UP9A 1ASZA 1A62A 1VMPA 2NN6G 3S1NH 3D3RA 1B3AA 1HFNA 5DM63 1Q1BA 2WAQG 2E75C 3K59A 2D62A 1JWUD 1BNZA 4DR7Q 2RHSB 5AJ3Q 3RLNA 2F0EA 4OWWB 1JOQA 4GNXC 1ET9A 3PO3H 5C0XH 4DR1L 2I0QA 1YNNC 2MJ8A 2WP8J 3Q22A 1MJCA 2ICEC 1Z47A 3RZOH 4Q5VA 4BXXG 1R4QB 1D7QA 5JPNC 4A93G 4POFA 3BJUA 3I55A 1EIFA 3VA5A 5M5YH 2JA5H 3B6YA 3QR8A 2NUCA 2EE1A 1TY0A 4RFBA 1NR2A 2E2JH 2Z1CA 1A0IA 1IBLL 3TP8A 4ZCKA 4GKKQ 4DR5Q 4C1NK 2HIVA 3JAMc 2DUDA 4JI4L 2AQ3B 4HTHA 4OO1H 1LTSD 1SROA 4LK1C 2XTIA 3OIQA 2SEBD 1UAPA 2KJXA 4JBMA 2B2YC 4MNOA 3GTPB 1WD1A 1M1KC 2R3ZA 3FP9A 4C3IG 3K58A 4IJHA 3U9OA 4DV1Q 4KHZA 3ITPA 1YVCA 5J22A 2H5XA 5I6WA 1Y1WH 4OX9L 3J7YW 4HJAA 1K3BC 3MXGA 1C48A 2NBFA 2K5DA 3PQIA 4P75A 1K28A 1AE2A 4R8IA 1XX8A 2WB1E 2ZXOA 2UUBQ 3A55A 2Z6BA 4DN4M 2A6EC 3OW2A 4MTKA 3UDXA 3Q23A 1N36Q 4NXNL 5CV8A 1IKLA 1LT3D 4GZYC 4ZLTF 3U4VA 5EPLA 3KFUA 4BBRB 3RNUA 2JA6B 5JJZA 4XXEA 3CU7A 4LF4L 2OWOA 3S14B 1DOKA 3NSWA 1TS4A 5I9PA 4HSVA 1W3SA 4DAPA 4JI1Q 4A3DB 4AIMA 4LFCQ 1ENFA 2C5CA 2RCNA 4A3MH 1BCPC 5FK9C 1DM0B 4KJNA 2VUMG 3DXJC 3W1GA 2PZWA 5M5WB 4F7XA 4A3KB 3K5LA 1N9WA 4DR6Q 4B3TQ 3TSSA 4JC0A 1EOVA 5IGBA 1CA5A 1CZGA 2K01A 3BYYB 4DK6C 1NBWA 2B2TA 1Y8PB 1MHWC 1I50H 5IYCH 1J5EL 4LWCA 4YIJA 2ENBA 5DNFA 4C2MB 2PI2A 1AZPA 1V9PA 2YV5A 3NEMA 5M3MB 3D6WA 1UEAB 3GTJH 4DAYA 2WKDA 1TWCH 1KRSA 1ONLA 2CW0C 4X3KA 3W2DA 4JYAQ 1VS0A 5FJ8H 2CCZA 1GUTA 2MO1A 3A5ZB 1PTOH 2JA7H 2XVSA 1PRTC 4IJLA 1SYGA 1OXVA 5IY0A 1QUQA 2KUMA 1YNJC 2QEXA 1Z7TA 3LX0A 5E4XA 2HD3A 3W3AA 1U0LA 1EWIA 1I4GA 1FYCA 3HOUB 4QL5A 4DV2L 1KL9A 3UE1A 1S5ED 3K7AB 2KBNA 3P75A 2JYOA 2RA4A 1PH1A 4JK1C 4A3JG 3F8TA 5IGCA 3S2DB 3A8KE 5M9OA 4EX5A 4E6IA 4JI0Q 3PIO3 2JXMB 4DK3C 1Y1VB 5IYBH 4AYBB 5IP7G 2JK8A 1NNXA 4NKLA 4EGVA 5M5XH 2R7ZB 1HRJA 3BZCA 1VQOA 4KKTA 1LT6D 5C44G 1H9SA 3I91A 4AQYL 2J0TD 1MKHA 1KTKA 1X55A 1EWCA 3J7AV 1I4HA 2NVXB 4JOIA 3NQTA 5I2YA 4BA1I 2KEDA 3KDFB 1D1IA 3HOYH 4C3HH 3PV0A 4RKLA 3I4LA 4F88A 3GTLH 3M9BA 3DWPA 2IW3A 1K83H 1VQ6A 4P2CB 2WFWA 3BVZA 3MFGA 3J7ZC 2HCIA 2L1BA 2RKSA 5FO8B 1L0YB 3TZDA 2PMZB 1JC7A 4KN4C 3TZUA 4K6LA 3S16H 2F0OA 1GOZA 1S5BD 4Y7NB 3BU2A 1O7ZA 2UXDQ 5ELCA 2EJFC 4KKUA 4EQ5A 3HGBA 4HIKA 4WJ3M 1RKNA 2R7ZG 4LFBQ 2Z8LA 3BS1A 1SMXA 1HH2P 4GLAC 1EQVA 2L11A 1G51A 4ILWA 4A3FG 3H0GG 1EYGA 3S1QH 1SFOB 3DEPA 3Q6SA 5EAYA 4A3GH 1HR0Q 1BXTA 1KDCA 1WCMH 4JI6Q 5C4HA 2MNAA 3A0JA 1VQDA 4LF6Q 4B9WA 3STBC 4IALA 1LT5D 1GO3E 2ES2A 4OHJA 1CQVA 2GA4B 5FOBB 1N32Q 1DGSA 1EOTA 4KJOA 5E3FA 1PDQA 4BBSB 1WTHA 2OTJA 5C3WA 4DUZL 2Q2HA 1WYDA 2DGYA 5LL6S 1IKMA 5K36G 3HOWG 5A2QL 4K0KQ 1PVOA 2K5WA 1SYFA 2RDHA 1X3EA 4BY7H 1TWHB 5CV4A 2JEBI 2K4KA 1BDOA 4DUYL 2B29A 4CGYB 2UXCL 3SR1A 5C5MA 1FNUA 1WTRA 5JEAH 2AWOA 4DR3Q 2DY8A 3KLSA 2EYOA 1K8MA 1Q86C 3P1HA 5C3EH 5IP9G 5D3IB 1K8OA 4LMQD 3ULLA 1K3RA 1EZ8A 3CCJA 4O1NA 3EQLC 4HJ9A 1U4LA 1AH9A 1WTPA 1Q1EA 4EQPA 1SXTA 3J80c 4QQBX 3QOLA 1DOLA 3HOVB 3M4OH 3E6ZX 4BBSG 3HOXB 1X3FA 4N9TA 4DKAC 1FD7D 3RZDH 1XPRA 3OW7A 4DU9A 5KNBA 4BY1G 1Y14B 1XMOL 1U4MA 1STYA 1ILQA 4X3SA 3BVGA 5E7NA 2A74C 4RGNA 2G9DA 1O7LA 4A75A 3I7FA 4P73A 1D5ZC 3FKIB 2L9HA 5A2QE 1QNKA 3K7UC 1SE3A 3ICEA 3C2PA 4C56C 2SNMA 5FLMG 1HZAA 2M9VA 4DV6Q 1V8QA 2K5HA 4H02A 4LAAA 1NCVA 3M4YA 3NE5B 5IYDH 5G3LD 1WTQA 2E74C 2B2VA 2EQSA 4KY5A 3TMEA 1G6ZA 4OWXB 1OXSC 1BQQT 2B2UC 2XRSD 3BYTB 2JA8H 2B63B 1N33Q 3HOVG 4QCLA 2UXBL 3BDCA 3SK8A 2IL8A 1QVFA 4LF9Q 2IX3A 1V1PB 4UY8C 4F8MA 2A6ED 4RA8A 1CT1D 1A3UA 3AU7A 4LUOA 3E9IA 4RGTA 2N3SA 1XTDA 2K04A 4WJ4A 5JJIA 1CUKA 1JB7A 2R93B 4OGQC 4AYBE 5EKIA 2R6GA 5ELFA 5LMUQ 4KHPL 5IWAQ 1X65A 3PO2H 3GTMH 5C4XB 2K7VA 1PMRA 3CHBD 1NMGA 2M00A 3CCUA 3KJOA 1PH2A 4CDFC 3KLSX 1RD9D 2E5LL 3PUYA 2GVAA 4OXPA 2K1BA 4HN7A 3S9WA 4DV0Q 3X3NA 1BCPD 4ZAIA 2A1AA 4CDCC 4IUTA 4A3LH 1TWFB 4UHVA 1BCPF 2N78A 4POGA 5M3FG 1HQRD 1PZKD 4UDUC 3TRZA 1H9RA 1T5EA 4JI7L 1SN8A 2EY1A 4B3MQ 1SRUA 4A3IB 1RIPA 1UEBA 5GAHC 4XT1B 5EGTA 1STHA 2FMCA 2F0MA 4ZUJA 1D1KA 2QDLA 4PMBA 2BCOA 5I9OA 2EZVA 1VF5C 3LWUA 3CKIB 4JCVE 2LXKA 2J4XA 4GOPC 1JR0D 2RDFA 2Q8IB 2A68C 2E76C 2VQFQ 5LMNW 3M4PA 4RCNA 2QEJC 3IFTA 3PO3B 3I4MB 2CW0D 1KRTA 2BDOA 1M90C 4A3BG 1JORA 5GROA 1ZKOA 3SE0A 1JJGA 1PH7A 2F0WA 3NWSA 1PRTD 2K5NA 4JVZA 4PMWA 5C0XI 4KD3A 1YNJD 1L1OA 1SE4A 4HJ5A 2K6AA 3LNNA 3U9SA 1SYEA 5M5YB 2WB1B 2ZJQA 4C3JH 2ID0A 1H9KA 1G2SA 3N52A 1RHPA 5IODA 5C4JB 1GHKA 3BDLA 2OCEA 3SK5A 4LFAL 1U4RA 2OTLA 4YY3Q 4CDEC 1WTWA 2UU9L 1Q82C 1RDPD 3MHBA 2F0VA 3A54A 3URYA 1UE6A 2FXQA 4DV3Q 1HNXQ 2XSCA 3PO3G 3CPWA 5C0XG 1AE3A 2WKCA 3I72A 1B8AA 2DJFC 4X64L 4R4TA 1TXYA 3UDIA 2RCFA 3VR3A 3MVVA 4X62L 1TS2A 2F4VQ 1LO5D 2EIFA 4OO1I 1A2TA 2H4OA 2ZTEA 4DV5L 1TT2A 2EYHA 3H3VH 3QJYA 1K9MC 2NVQB 1IBKL 3SK6A 3I73A 1MBYA 4KD4A 1CK1A 1PZID 1B1ZA 3I90A 4AH6A 2A69D 3KF6B 2E2HH 3KDFA 1VCIA 3OMCA 5D65A 4IN3A 2JA5G 1SNCA 4G57A 3GTKH 2WAQB 2B3GA 5HGTA 3EN2A 1XPOA 1PH3A 4JI3L 2B39A 2PO4A 3EBEA 1U9RA 4HEDA 4DFAA 3K0YA 4OO1G 3VR4A 3TBIB 3T51B 1V1OA 3OWFA 1GJXA 2JJQA 5LMNL 4GNXB 2EY5A 1WTXA 1HJPA 5C5LA 5JPMC 2RHQB 1PH8A 4KY7A 4FXGC 2YTYA 1Y1WG 2RDGA 1CFMA 4HAEA 1S5FD 1HNWL 1X9NA 1EY8A 1I4RA 3PIPA 1ZYRC 1WD0A 3K5NA 1YJWA 1B9MA 2KEEA 3I4NH 2KOLA 4YHHQ 1J6QA 3CD6A 2Z6KC 1KNAA 3STBD 1CQFA 3TP6A 4TVAB 1M8AA 4NP5A 2EDGA 1PH5A 3GQBA 3OHXC 4IO9A 4FF2A 2BE5C 2ZTCA 1MI2A 4RKBA 1A3VA 1DZ1A 3V2TA 4XQQA 1CA6A 3H6MA 3MTSA 3DUZA 1EY7A 4HJ7A 5CR3A 3GTOH 4J15A 3T16A 2NVTB 4C3IB 3BVMA 2NTTA 4C1NI 5C3XA 1WI5A 1F2LA 1CHPD 3RN5A 1IW7C 4I7ZC 4IOAA 3AQQA 4U68A 2K5QA 2C9OA 2IWHA 4JI5L 1X54A 4GKKL 4DR5L 3PSIA 4FVMA 1CKOA 1TWAH 5EKKA 4QGUA 1AN8A 3E5SA 5C0XJ 4A3MG 3CXCA 3S2HB 1EYAA 2B8FA 2F0LA 1IYUA 5FKAC 1CKMA 2L0CA 5F2DA 2EXZA 4GS3A 2D2CC 4HIDA 4GKJL 5EPKA 4ME3A 5IOCA 2VQEL 3R2TA 1BF4A 1Q8KA 3NELA 5FLXL 2BH8A 1ENAA 1ET6A 1TS5A 3K57A 1BVSA 2B2WC 2O4XA 1VQNA 3D4WA 5IYCG 1XNRQ 3Q24A 5L37A 3K6OA 4Z9CB 3SEBA 3HOZH 5HGQA 5D14A 2BA1A 2Y0SG 4RH6A 2F0NA 3K80C 5BN3A 3T53B 4PMCA 3MAQA 5JAVA 3CCEA 1EFWA 5I6YA 1PTOC 1GUSA 1KLGD 1D8LA 1R9TH 5FJ8G 3T1YL 2VUMB 2V4DA 1JQYD 2JA7G 1BCPB 1VMCA 3U50C 1UWVA 2Q8TA 2TSSA 2SNSA 1E7ZA 5IT9L 3M4QA 2XRQD 4KN7C 1RL2A 2PNRC 2ZTDA 1LTRD 1UE1A 2AWNA 4JI1L 2BDNA 1EWHA 2IHFA 3CC7A 2I46A 2HDMA 1P8LA 2JQOA 1Q12A 4LFCL 1IBLQ 1Q46A 4QB4A 5IE8A 4ZKCB 5KGUA 4JI4Q 1HHVA 2IHEA 4JBJA 1V1QA 3S15H 4XYQA 1VQAA 2F0QA 2OXPA 1K0RA 5T1IA 1JWSD 2Q2IA 4DR6L 4B3TL 5JJKA 4MIUA 5FLXE 4LUZA 3G48A 5IYBG 3CCRA 2ZJRA 5KRUA 1TKWB 2AQ1B 1FGUA 4PQXA 1SJHD 1KC8C 3GV6A 4OX9Q 5NUCA 3QB3A 5BR8Q 1QJOA 1R4PB 3W1BA 1DYQA 1NY4A 4DNIA 2Q2UA 4ZYSA 3HOYG 4K2LA 2E2IH 4C3HG 1PRTB 3MEHA 2PZUA 4RAUC 3VYSA 1JOOA 1WCMB 3BZDB 4YWMA 1GKHA 2WAQE 1PFMA 2PQEA 5H1SE 4EQOA 2HHHL 1YHBA 4KV6A 3WWVA 1JE5A 3G6EA 1F9QA 3L9AX 1E1TA 4A3JB 1HR0W 3R8BA 3DEOA 3F2CA 1T5XD 2IX0A 5IT9E 3FRPB 4X3TA 4IUQA 4LF4Q 1JICA 3NTHA 1XNQL 5KYIA 3GTQB 3KF8B 1RF2D 2EYPA 5ELEA 3S1RB 5EJWA 4JV5Q 2KCNA 5IGGA 2EVBA 3CW2C 3EVQA 5CV9A 2A68D 5C44B 4L63B 3CCSA 1C4QA 5EPJA 5GAEC 4ZK9B 3TS0A 1Y69U 4GN3B 3RLOA 3VR5A 4A3CH 2MQHA 5COYA 5IGFA 4N8FA 4JI0L 4DR4Q 2F52A 1K8AC 4A3GG 1X6OA 1HA5A 1WCMG 1PXUA 1VQ8A 1N34Q 2EYLA 3L0OA 4GLXA 3S17H 3NQIA 2PZTA 3IL8A 3S24A 2F4IA 1LABA 3OTOL 5BN4A 5FO7B 4NXMQ 2Y0SE 2RQXA 3X3MA 1G2TA 2VB3X 4BY7G 5DEHA 1OXUA 2CVRA 3VYUA 4O0AA 3CQZB 3J81L 4GN4B 2QCPX 1VQKA 2KHIA 1UE7A 3G6JB 4HIMA 3ER0A 3NK9A 3CCVA 3LWEA 4A3FB 5JEAG 3H0GB 4CDDC 2NVYB 3GTPH 3IRBA 3FPPA 1BKBA 3NUCA 5IGEA 2UXDL 1PV4A 5TSSA 2HCCA 2OQKA 2K5VA 5C3EG 4LUVA 4IPGA 1FNVA 1WTVA 1LTBD 2XNAC 2A69C 1VQMA 2I5LX 1YEZA 4TKOB 4DV2Q 1VQGA 3TQYA 3SHLA 1EYCA 2WACA 1X3GA 4LJZC 2VY3A 1HQMC 1XTCD 4DR2Q 1XXGA 1JCKB 3ULPA 3HOWB 1HR0L 3KF6A 4JI6L 1A6XA 3LGJA 4BS9A 5ELOA 4FXKC 4WFN3 1PH4A 2MPMA 3DWAA 1VQ7A 1QVCA 1NSNS 1RTOA 5FO9B 4ZRZA 1N32L 4HJ8A 4AQYQ 1EU3A 4BBRH 2JA6H 1H9JA 1TIID 1SMYD 4LF5L 3AFQA 5E1FA 1EY5A 4JI2L 2Z9HA 1DD2A 4K0KL 3S14H 3K0XA 2BOSA 3GO5A 2CWPA 3F2UA 4A3EB 4K5VA 1F77A 3GTGB 3J81E 3I8ZA 2K52A 5IYDG 1UE5A 4A3DH 4GNXA 1QWYA 2VB2X 2F0KA 3H91A 4KI0A 2OQ0A 1Q3LA 1ZYRD 1VQ9A 2WIIB 4XIGS 1WOCA 3TS2A 3GDEA 2JA8G 3VA7A 4NMZA 4IURA 5M5WH 3A8IE 4K5WA 4H44C 4A3KH 1JB3A 4X6AH 4R4QA 5IGDA 3JAML 4BY1B 1IYVA 3VYTA 1RTNA 1I3QB 3AEVA 3CCMA 1P16A 1NJIC 2BE5D 4J1MA 2KHJA 4BWGB 2F03A 4IOCA 2R7DA 2V1CC 4J6HA 3NBIA 2R7FA 3H15A 2AUKA 3VYRA 3ERQA 2KCCA 3PO2G 3NENA 5CGKA 1NR4A 2EY2A 3I56A 3L2PA 2N49A 3J7A5 1ILPA 1IW7D 1TWGB 4C2MH 4NDXA 4L6TB 2O2LD 5M3MH 4K5XA 4ZUIA 4U673 1QCBD 2LFNA 4ID6A 5ELBA 4PNYA 4A3EG 3I70A 5JEAJ 3D8GA 2B2YA 1U4PA 3R93A 1B70B 3ONAB 4A3LG 3KK7A 3KBXA 5CV7A 2VXWA 1DOMA 1EIYB 1I4PA 1OTCA 4O42A 1EY9A 4PZ8A 1HNZQ 5ISRA 3K5MA 3HOUH 2KCTA 1IZ6A 3Q0AA 3K7AH 4P71A 2UXCQ 3I4OA 4M8AA 2CH4W 3TEHB 1BBWA 4JI8Q 1NAPA 3JAME 1VQ5A 3S1MB 3S2DH 2OEOA 3IAYA 1YIJA 1SAPA 3FEWX 2UUCL 4YCVA 1PTOD 1Y1VH 4EVOA 2Z4IA 1Q81C 4DV4L 3NBHB 2R7ZH 4JBKA 3EFXD 5IWAL 1PTOF 1BR9A 1L0WA 2ATWA 3BZKA 2AQ2B 5G3LF 5M3FB 2ASBA 5CYUA 2NVXH 1FJGQ 1CKNB 5C4ZA 1G8ZD 1STBA 3E3XA 1G91A 4R9WA 1VQBA 3MXPA 2EYMA 4DV7L 4J8QA 4DNTB 2LXJA 3RUZA 2NTSA 3ND8A 4IUPA 4C3JG 1PH9A 3H3VI 4RGMA 4CJ2C 1XMOQ 2CQOA 5HURA 2YU9H 1EQRA 3MFYA 2HQLA 3CMAA 1EFID 1STEA 1I6HB 5AFWA 1SYDA 3GD7A 1KIXA 3NP8A 2ZM6L 1Q7YC 4B3ML 1SDFA 4GOPB 3ULJA 5FLXc 1KHIA 1DJRD 3R3OA 1IBML 4B3RL 3DM1A 2EY6A 3D31A 5CORA 3M3YB 5DM73 4A3BB 3QO2A 3H3VC 2L55A 2A6HC 1U5KA 5GADC 1S72A 2EJMA 4TQUS 3DLLA 2Z0SA 2H1EA 2PPBC 4LW1A 2UXBQ 3RR5A 3I4NB 4M1UB 4X65Q 2LS01 1SFOH 3RN2A 2HT1A 4H0LC 1SNPA 2M2LA 1YNXA 2XGTA 4O2DA 1AFPA 1W2BA 4LF8L 1SBBB 4P74A 1ML0D 2K33A 3S1NB 1QG7A 5BN5A 3NHHA 1GVPA 2F0TA 1I94Q 1J8IA 4IFDH 2MUYA 2F0JA 2HDLA 4WORA 1QNUA 3D4RA 3ND9A 1EYDA 1Q8IA 2LSSA 3EROA 3GTOB 1XMQQ 4IUUA 1F9SA 1VQEA 2E5LQ 1PZJD 4X66Q 2LY7A 1TWHH 1VF7A 4XDXA 5KNDA 3KF8A 3I2ZA 5KEEA 1N8RC 1KABA 2F3VA 3K5OA 3AB9A 3RZOB 4K8JA 5ELNA 4MTNA 1EZ6A 1PRTF 4B3SQ 2B8GA 1SNDA 3FMCA 4OIKA 4JI7Q 2B2TC 1YJNA 3I4NG 4ODGA 2JA5B 3T1HL 3C1FA 4FF3A 1IXRA 3VR2A 3AFPA 2F4VL 1KNEA 2E2JB 1H95A 1SSOA 2F0IA 2EXDA 3CRLC 1QB5D 4A76A 3RMHA 3G4SA 3HOXH 1LTTD 4L8JA 1EEFD 4YCWA 1C0AA 2F0GA 2G9HD 1BO0A 3PUZA 2DNEA 1VQ4A 1B44D 4HMJA 3AMUA 4H13C 4EQNA 1II3A 1NE3A 3TP7A 3L7ZC 5GAGC 3GV3A 1IHZA 2JN4A 1G6PA 1Y1WB 3KLRA 1PFBA 1C8CA 4HIOA 3FKIH 2K14A 2L15A 4XQJA 1C7YA 3QG1A 4XYOA 4L5SA 2AMCB 4LF7L 3DHQA 4FO2A 1GUOA 4N9PA 1JJCB 2SOBA 1B3QA 1VQCA 2B63H 3G7LA 5DLQE 1AW7A 1YZ6A 2UUAL 4KLKA 4YHHL 4YWKA 1QOHA 2R92H 5EBDA 2CHBD 1IYJB 3HOZG 1HA6A 4APVA 1SMYC 2L5TA 3NXWA 5EKLA 1TY2A 4RHSA 2R93H 1GUNA 1PFNA 4JOIC 1LUZA 1QILA 3OSOA 1K8GA 1BBXC 4DV5Q 4OONA 1YJ9A 4A3MB 4DR7L 2IY5B 1WTOA 5C4XH 1MJEA 4QUCA 5AJ3L 4ALPA 2A8VA 3TDQA 2IPKD 4I65A 3J81c 1D5XC 2QF7A 3J80L 3MC0B 4Y52H 1A3TA 1F9RA 5J3BA 2D9UA 4K8IA 4V0BA 1B7YB 1TWFH 1I50B 4DXGA 3D6CA 1KLUD 2N55A 4JI3Q 1I4QA 1VQHA 4DPGA 4A3IH 2DN8A 2RVLA 4PZ6A 2Y0SB 4RWSC 3PIP3 2AKWB 4FNFA 5LMNQ 4PG3A 5KIXA 3GTJB 3MWYW 1TWCB 2E2DC 1KAAA 5J1ZA 4CJ0B 3RD4A 1K0SA 1HNWQ 1X3QA 1XNRL 1PTOB 2OF1A 2JA7B 2GVBA 1ICFB 2NZOA 1V43A 2FHTA 3I4MH 5EQ0A 4GLVB 4DV1L 2A5HA 1EY4A 1HXYD 4CKBA 2AUJD 1STGA 3O13A 1I5FA 4JBWA 4CKEA 1ASYA 1KDAA 3S17B 1SNQA 1W6JA 1AEXA 4DXFA 3J80E 2CH4A 2LMCB 3ZJYC 2PI2E 2K32A 2F3IA 1LM0A 2JSOA 4CKCA 2B2UA 2CQAA 4DR1Q 5K5PA 2UUBL 3H94A 4FXDA 5C4JH 1SYCA 2BH2A 1N36L 1SJED 1AZQA 5M5XB 4JI5Q 2D0OA 3J81j 4IZ8A 1A2UA 4DAVA 4FYDA 1VQLA 1LTGD 1ENCA 3HZXA 4FP5D 2RSNA 1RJTA 3NPPA 5LHY1 3HOYB 4C3HB 4A3CG 4GKJQ 2VQEQ 3GTLB 1XPUA 3J7AF 4IUVA 1K83B 2O5IC 1PLFA 3FPUB 3NBHA 1SLJA 1FVIA 2IX1A 2NVQH 5BR8L 4UPAA 3MXNB 4FF1A 1C9OA 3HFZB 4FF4A 3S16B 1DCZA 2I07B 1CKNA 1V1PA 1UNSA 2O5JC 1LTID 2NN6H 1O7IA 2VNUD 4DGZA 5JVG3 2MP1A 1B4OA 5T1GA 3HKSA 1F2MA 4DNRB 1X3PA 3OYYA 2NYZD 3ZYYX 1EL0A 1Y8NB 1HZBA 3T1YQ 2FMMA 3GP7A 1HZ9A 2F0SA 4KTAA 3EA6A 3U58A 4K14A 3A74A 1F9PA 2QKIC 2B2VC 3TREA 2KHSA 4GOPA 3T13A 1OXTA 1E24A 2F0DA 3S1QB 1LACA 1M4VA 2A6HD 4A3GB 3A56A 4JV5L 4L5RC 5CBEE 3C1EA 2VZAA 1PYWD 4JYAL 5CV5A 4NXNQ 2QDBA 1PA6A 4ZKBB 4BXXH 2KCMA 4A93H 2KQ3A 2E8GA 4WJWA 3OIPA 2IT1A 1E1OA 3IFDA 1AP0A 1I6VC 4NB3A 2EYJA 1HUNA 1VQFA 4ZQ3A 1UUPA 1GM5A 4DR4L 3EIVA 1Z9FA 2PQAB 4OL7A 1HZCA 5EBCA 1EY6A 4CHTB 2MO0A 4BY7B 1PFSA 5IIFA 1QVGA 1N34L 3HEJA 1PYSB 1Y8OB 3UI2A 3DMUA 3AYHB 3T4AC 4BBRG 5ELDA 2JA6G 4XQNA 2ZT9C 2NVTH 4IPCA 3RLFA 4C3IH 1PHJA 4L5TA 4NXML 4H7BA 1X32A 5C3EB 3DWQA 1MSHA 3D4DA 5GQOA 2C35B 4A3DG 3UDGA 4R4IA 1L1OB 3ERSX 2HHHQ 3S2HH 4HR7B 1NUCA 1E0BA 3PIOA 1J5EQ 3M4OB 2PNHA 3W5OA 2EJGC 1JT8A 3RZDB 4A3KG 4DA2A 4KKSA 5J39A 1QZHA 2K03A 4FDBA 1XNQQ 2VS1A 1LLRD 1S40A 1EIGA 4QUFA 3PCOB 1E2ZA 2Q8RE 3E9HA 1X56A 1EQQA 1G291 3UE0A 3SXHA 2LKVA 3A7LA 4XT3B 4Q0FA 2DJGC 1CHQD 1GHJA 1JOKA 1VDZA 4RGOS 3WOEA 3QWNA 4DR2L 1KQSA 2QA4A 1D6EC 5M3MG 2F0PA 1YI2A 2YYZA 4HCSA 2Q2TA 1L1OC 3MEFA 5CV6A 5D3DA 5CBAE 4LFBL 4P72A 5C6AA 1L0XB 5I4DA 3J81i 2I5MX 1LTAD 2SDFA 3FVQA 2VUMH 2JA8B 1CSPA 3CC2A 3M85A 3CC4A 1Z6HA 3OTOQ 4R8NA 3MXUA 2DNCA 3PF5A 3PUWA 4IPHA 4LF6L 3MZ5A 2YU9B 3HOUG 1SYBA 2QILA 2Z6KA 1A8VA 1Q90A 1CI3M 2NB0A 3I3CA 1DONA 1KDBA 3PO2B 3HP3A 3CPFA 3GTMB 3CMEA 4TSSA 2YTVA 3P20A 1H9MA 3DM3A 5JOBA 4RMFA 1B9NA 2IJ0A 1Y1VG 4ULLA 1VQIA 1EQTA 1WFQA 2WV6D 4AYBG 2L4NA 1TS3A 1O7YA 1FNWA 4UAIA 1NMFA 1EEID 2YTXA 1ESRA 2ICIA 4DR3L 1KD1C 3HG9A 1SR3A 3CF5A 2MFIA 3JC66 3WDNA 3CCLA 1A15A 3NWTA 1LTLA 1D2BA 1YBYA 3HS0C 5KYLA 2N88A 3F2BA 3HKZB 4A3JH 2Z4HA 4GN5A 1VQPA 3EJIA 4S3SA 2G5DA 4LF5Q 3BDOA 1E2WA 1RCVD 3KUPA 4JI2Q 3JAMi 1SNMA 2B2WA 5CMDA 1HCZA 1HNZL 1OXXK 3GTQH 3S1RH 5IP7H 1GUWA 4JW0A 4IFDI 2J7ZA 4UP8A 5C44H 4YWLA 2KENA 2EPBA 2BA0A 3R2IA 4JI8L 1T9HA 2F3WA 2JA9A 1B2TA 1YNND 4I7AA 1KXLA 1PH6A 4XTCS 4DUZQ 4DV6L
chains in the Genus database with same CATH topology
4ME3A 2QEXA 2VQEL 3T1HL 1IXRA 3AFPA 1U0LA 1EWIA 2F4VL 1BBUA 1Q8KA 4QL5A 3NELA 4DV2L 2BH8A 1H95A 2EXDA 1KL9A 2RF4A 3UE1A 2ZJPA 4A76A 4DUYQ 2KBNA 1BVSA 3K8AA 3G4SA 3HKZG 1N33L 1VQNA 1PH1A 5IYCG 4IFDG 4A3JG 1FJGL 1XNRQ 3HOXH 4YCWA 3F8TA 4LF9L 1C0AA 1YITA 1SE8A 3HOZH 3PUZA 4EX5A 3U4ZA 5HGQA 2BA1A 1VQ4A 2Y0SG 3CP0A 4JI0Q 2I5HA 4DK3C 3K80C 1FL0A 5IYBH 1NE3A 5IP7G 2JK8A 3L7ZC 5GAGC 5M5XH 5LMUL 3BZCA 3CCEA 1VQOA 1EFWA 3CQZH 1G6PA 1K73C 5C44G 4PZ7A 1D8LA 4AQYL 1R9TH 5HY6A 5FJ8G 3T1YL 4HIOA 1MKHA 3FKIH 1X55A 2K14A 2L15A 3K81C 2QGQA 4A3FH 3H0GH 4JOIA 2JA7G 2NVYH 1C7YA 3U50C 4BA1I 2A19A 3KDFB 3HOYH 1UWVA 4C3HH 4L5SA 3PV0A 1E7ZA 2AMCB 3M4QA 4QJFA 4LF7L 3GTLH 3M9BA 1RL2A 2ZTDA 4DV0L 1UE1A 2AWNA 3PUVA 4JI1L 1K83H 3CC7A 2IHFA 1VQ6A 2WFWA 1P8LA 2JQOA 1JJCB 1Q12A 4LFCL 3J7ZC 1Q46A 2JE6I 1IBLQ 5IE8A 1VQCA 2B63H 5DLQE 4JI4Q 2IHEA 4JBJA 2VL6A 1YZ6A 2AHOB 2UUAL 1V1QA 3HOXG 4KLKA 3S15H 1VQAA 4YWKA 4YHHL 3S16H 2NZHA 4X65L 2R92H 3HOWH 4Y7NH 1IYJB 1K0RA 3HOZG 3BU2A 4BA2I 4APVA 2Q2IA 4DR6L 2UUCQ 4B3TL 2UXDQ 3F1ZA 5JJKA 4LUZA 2R93H 3VDYA 4DV4Q 1VQJA 3G48A 4EQ5A 5IYBG 1IL2A 3CCRA 4HIKA 4JOIC 2ZJRA 1LUZA 4WJ3M 1K8GA 2R7ZG 4LFBQ 4DV5Q 2CFMA 1FGUA 1E3PA 1CSQA 4OONA 4R4OA 1YJ9A 2K75A 1I94L 5JJLA 1KC8C 4OX9Q 4DR7L 2JEAI 2IY5B 1SMXA 1HH2P 5BR8Q 1YHAA 4GLAC 5C4XH 1MJEA 5AJ3L 3FKIG 2VQFL 3W1BA 4ALPA 2A8VA 3UDFA 1G51A 4A3FG 1EYGA 3H0GG 2N8NA 1NY4A 5IP9H 4DNIA 1XMQL 2Q2UA 3S1QH 3J81c 3HOYG 2E2IH 5EAYA 4Y52H 4DV7Q 4A3EH 1HR0Q 4A3GH 4X66L 3GTGH 1WCMH 4JI6Q 2ALYB 4YWMA 2MNAA 1GKHA 2WAQE 3A0JA 1VQDA 5J3BA 4A4IA 4LF6Q 3STBC 5H1SE 1S3OA 1B7YB 1GO3E 1TWFH 2ES2A 4KHPQ 2HHHL 5IT9c 1YHBA 3WWVA 1N32Q 1JE5A 3G6EA 1DGSA 1JJ2A 1E1TA 4NPSA 2B63G 1HR0W 4JI3Q 4BBSH 1VQHA 3F2CA 2IX0A 2PMZE 4B3SL 2OTJA 2ZM6Q 4DPGA 4DUZL 2Q2HA 1WYDA 2DGYA 3KJPA 4A3IH 4PZ6A 2R92G 4BY1H 3HOWG 2VW9A 4K0KQ 4LF4Q 1IBMQ 1PVOA 1I3QH 5K36G 4B3RQ 3D0FA 1XNQL 1X3EA 4DAYB 2D0PA 1XJVA 2PQAA 2AKWB 3KF8B 5LMNQ 4BY7H 4IFDJ 4JV5Q 2R93G 4PG3A 3CW2C 2JEBI 3KYHC 2K4KA 4L5QA 4LNQA 4DUYL 2B29A 4YY3L 4QY7A 3CCSA 2UXCL 5GAEC 1HNWQ 3TS0A 1XNRL 5C4XG 2AWOA 4GN3B 2GVBA 3RLOA 1QUQB 4DR3Q 5FLMH 1TWGH 1LYLA 2NZOA 4DV3L 1V43A 1Q86C 4A3CH 1HNXL 4OWTB 5C3EH 5IP9G 2MQHA 4JI0L 3I4MH 4DR4Q 2F52A 4GLVB 4DV1L 1K8AC 4A3GG 4LF8Q 1X6OA 3ULLA 1K3RA 1WCMG 4DAMA 3CCJA 3KOJA 1L2FA 1VQ8A 1I5FA 4JBWA 4HJ9A 3L0OA 1N34Q 1AH9A 1ASYA 1NTGA 1MIUA 1Q1EA 3HOVH 3J80c 4QQBX 3HKZE 3CAMA 2CWAA 4GLXA 3S17H 4RG1A 3M4OH 3S24A 4BBSG 1X3FA 3PUXA 3OTOL 3M7NA 3ZJYC 2PI2E 4DKAC 3F2DA 2F3IA 1LM0A 2K50A 4A3IG 3RZDH 1XPRA 4NXMQ 4MZ9A 4BY1G 4DR1Q 2Y0SE 2UUBL 1Y14B 5C4JH 1XMOL 3G71A 4BY7G 2BH2A 1EUJA 1N36L 3A5UA 1OXUA 4O0AA 4JI5Q 2D0OA 3J81j 4GN4B 5E7NA 4A75A 1VQKA 2KHIA 1UE7A 3E0EA 3I7FA 1KAWA 3ER0A 4JG2A 4P73A 3CCVA 1PYBA 4HIMA 1VQLA 3S1MH 4UP7A 3K7UC 5JEAG 3ICEA 3GTPH 5FLMG 3IRBA 1HZAA 4DV6Q 1BKBA 2UXDL 4A3CG 4GKJQ 1PV4A 2OQKA 2K5VA 1GD7A 5C3EG 2VQEQ 4H02A 2K5HA 4LUVA 3I4MG 3KLWA 3T1HQ 4IPGA 4YCUA 5IYDH 1XPUA 1E22A 1VQMA 2I5LX 1YEZA 2EQSA 4DV2Q 1SLJA 4LFAQ 1VQGA 1FVIA 1OXSC 4OWXB 3TQYA 3PF4A 2IX1A 2NVQH 1X3GA 2JA8H 5BR8L 5M3FH 1N33Q 3HOVG 2UXBL 4UPAA 3MXNB 1C9OA 4R1JA 1QVFA 2VY3A 4LF9Q 3HFZB 2UU9Q 4UY8C 1CKNA 3ULPA 4DR2Q 1QZGA 1YHQA 2WB1G 1HR0L 4LUOA 3E9IA 3KF6A 4IPDA 1O7IA 2N3SA 1XTDA 3LGJA 4X64Q 4JI6L 2VNUD 1CUKA 3Q8DA 5ELOA 1JB7A 4WJ4A 5JJIA 4X62Q 1PH4A 3HKSA 4AYBE 1VQ7A 2R6GA 5LMUQ 1QVCA 3FHWA 3OYYA 4KHPL 5IWAQ 1I6HH 1N32L 1X65A 3PO2H 4HJ8A 1HZBA 4AQYQ 3SGIA 3T1YQ 3GTMH 1IBKQ 4BBRH 2JA6H 1HZ9A 2NN6I 4QIWE 3PGZA 3U58A 3CCUA 1NMGA 3A74A 3AFQA 1JMCA 4JI2L 4LF5L 3TREA 3KJOA 1PH2A 4K0KL 4GOPA 3S14H 1OXTA 1E24A 3K0XA 2E5LL 4LF7Q 3PUYA 2GVAA 2CWPA 1WJJA 3GO5A 4OXPA 4DV0Q 3M3YH 4A3BH 4JV5L 4L5RC 2K52A 5IYDG 1UE5A 4A3DH 2A1AA 4GNXA 4KI0A 2OQ0A 4JYAL 2VZAA 4A3LH 4NXNQ 1VQ9A 1PA6A 4BXXH 2HIXA 4XIGS 2KCMA 4A93H 1WOCA 2N78A 3GDEA 4POGA 2CKZB 2JA8G 2E8GA 5M3FG 3TS2A 3TRZA 2IT1A 1E1OA 4R4CA 4JI7L 1SN8A 3CCQA 2UUAQ 1A63A 4B3MQ 5M5WH 4NB3A 1SRUA 2GN5A 4X6AH 1VQFA 4A3KH 1RIPA 4R4QA 3J80i 1GM5A 4DR4L 1UEBA 1Z9FA 3EIVA 2PQAB 5GAHC 3AEVA 1HZCA 3CCMA 1P16A 4UP9A 1NJIC 1ASZA 1A62A 2KHJA 2MO0A 2NN6G 3S1NH 1Q1BA 2WAQG 4IOCA 2R7DA 1PFSA 2V1CC 4JCVE 1QVGA 1N34L 2R7FA 1PYSB 2LXKA 2D62A 3H15A 4DV6L 4GOPC 4DR7Q 3PO2G 2RHSB 3NENA 3AYHB 4BBRG 5AJ3Q 3I56A 3M4PA 2VQFQ 5LMNW 3RLNA 2N49A 3L2PA 4OWWB 2JA6G 3J7A5 4GNXC 4C2MH 2NVTH 4IPCA 3RLFA 4C3IH 1PHJA 3PO3H 4L5TA 4NXML 4DR1L 5M3MH 2I0QA 2WP8J 1KRTA 4A3EG 1M90C 1MJCA 4A3BG 5GROA 5GQOA 2C35B 5JEAJ 1PH7A 4A3DG 1Z47A 1JJGA 3UDGA 1B70B 4R4IA 3RZOH 4A3LG 2K5NA 4PMWA 1L1OB 3ERSX 2HHHQ 4BXXG 3S2HH 1D7QA 5C0XI 3PIOA 1J5EQ 1L1OA 4A93G 4POFA 1EIYB 4HJ5A 2PNHA 3W5OA 3BJUA 3I55A 1OTCA 1EIFA 4PZ8A 5M5YH 1JT8A 2JA5H 4A3KG 3B6YA 2ZJQA 4C3JH 2ID0A 1HNZQ 1QZHA 4FDBA 1XNQQ 2VS1A 1S40A 2E2JH 3HOUH 2OCEA 3I4NG 2KCTA 1A0IA 1IBLL 3PCOB 4LFAL 3E9HA 4GKKQ 1IZ6A 4DR5Q 1X56A 3K7AH 2HIVA 4P71A 3JAMc 1EQQA 4YY3Q 2DUDA 2OTLA 4JI4L 1G291 3I4OA 3UE0A 2UXCQ 3TEHB 1BBWA 4JI8Q 1VQ5A 2UU9L 3S2DH 1SROA 1Q82C 2XTIA 4JBMA 4DR2L 1UE6A 2FXQA 4MNOA 4DV3Q 1KQSA 1YIJA 1M1KC 1HNXQ 3FP9A 2UUCL 3PO3G 3CPWA 4YCVA 1AE3A 5C0XG 2QA4A 5M3MG 1Y1VH 4IJHA 1B8AA 4X64L 1YI2A 4R4TA 1TXYA 2YYZA 4KHZA 3UDIA 4DV1Q 4DV4L 1Q81C 4X62L 1L1OC 3MEFA 2Q2TA 2F4VQ 2EIFA 1YVCA 3NBHB 2R7ZH 2H5XA 4JBKA 1Y1WH 4P72A 4DV5L 4LFBL 2ZTEA 3J81i 4OO1I 2I5MX 5IWAL 4OX9L 1L0WA 2ATWA 3H3VH 1K9MC 3BZKA 2VUMH 1IBKL 1CSPA 4HJAA 3CC2A 2ASBA 2NVXH 1FJGQ 3M85A 3CC4A 1CKNB 3OTOQ 4AH6A 4P75A 1VQBA 1AE2A 3KDFA 3KF6B 1VCIA 4DV7L 2WB1E 2E2HH 2JA5G 2LXJA 2UUBQ 1PH9A 3H3VI 3PF5A 3PUWA 1XMOQ 2CQOA 3GTKH 2B3GA 4IPHA 3OW2A 4LF6L 2YU9H 1EQRA 3EN2A 3UDXA 2HQLA 1XPOA 1PH3A 1N36Q 3HOUG 3CMAA 4NXNL 2Z6KA 1A8VA 3U4VA 4JI3L 3CPFA 3EBEA 3GD7A 1KIXA 3KFUA 3RNUA 3CMEA 2ZM6L 2YTVA 1Q7YC 4B3ML 4OO1G 4GOPB 3DM3A 3ULJA 5FLXc 1KHIA 4LF4L 1IBML 4RMFA 2OWOA 4B3RL 3D31A 2JJQA 5LMNL 1Y1VG 4GNXB 1W3SA 1HJPA 1VQIA 1WFQA 4JI1Q 4AYBG 4AIMA 2RHQB 1PH8A 4LFCQ 1U5KA 2YTYA 5GADC 1Y1WG 1S72A 4TQUS 2RCNA 4A3MH 1NMFA 3DLLA 2Z0SA 2YTXA 1HNWL 1X9NA 3PIPA 2VUMG 4LW1A 4DR3L 2UXBQ 3W1GA 3RR5A 1KD1C 1YJWA 3I4NH 1SR3A 4YHHQ 3CF5A 2MFIA 1J6QA 3JC66 4X65Q 3CCLA 3CD6A 1SFOH 3RN2A 2Z6KC 2HT1A 3STBD 1N9WA 1YNXA 2XGTA 4O2DA 4B3TQ 4TVAB 1W2BA 1LTLA 4LF8L 4DR6Q 4JC0A 4P74A 1EOVA 1PH5A 4DK6C 1YBYA 1NBWA 4IO9A 1GVPA 1I50H 2ZTCA 3F2BA 1I94Q 5IYCH 1J5EL 4A3JH 4LWCA 4GN5A 1VQPA 2LSSA 4HJ7A 4LF5Q 3GTOH 4J15A 4JI2Q 3JAMi 1XMQQ 2PI2A 1V9PA 2YV5A 3NEMA 1HNZL 1WI5A 1OXXK 1VQEA 2E5LQ 3GTQH 3S1RH 3RN5A 4X66Q 5IP7H 4IOAA 4IFDI 1TWHH 4UP8A 3GTJH 3AQQA 1TWCH 3I2ZA 1KRSA 4JI5L 5C44H 1X54A 1N8RC 4GKKL 4DR5L 3PSIA 4YWLA 4JYAQ 1VS0A 2KENA 1CKOA 1TWAH 5FJ8H 2BA0A 4QGUA 5C0XJ 4A3MG 2CCZA 4JI8L 3CXCA 2MO1A 3A5ZB 1T9HA 2JA9A 5ELNA 2JA7H 1CKMA 4IJLA 4MTNA 1OXVA 4B3SQ 5IY0A 4JI7Q 1PH6A 1KXLA 4XTCS 4GS3A 4DUZQ 1QUQA 1YJNA 4HIDA 4GKJL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ME3 A;  2QEX A;  2VQE L;  3T1H L;  1IXR A;  3AFP A;  1U0L A;  1EWI A;  2F4V L;  1BBU A;  1Q8K A;  4QL5 A;  3NEL A;  4DV2 L;  2BH8 A;  1H95 A;  2EXD A;  1KL9 A;  2RF4 A;  3UE1 A;  2ZJP A;  4A76 A;  4DUY Q;  2KBN A;  1BVS A;  3K8A A;  3G4S A;  3HKZ G;  1N33 L;  1VQN A;  1PH1 A;  5IYC G;  4IFD G;  4A3J G;  1FJG L;  1XNR Q;  3HOX H;  4YCW A;  3F8T A;  4LF9 L;  1C0A A;  1YIT A;  1SE8 A;  3HOZ H;  3PUZ A;  4EX5 A;  3U4Z A;  5HGQ A;  2BA1 A;  1VQ4 A;  2Y0S G;  3CP0 A;  4JI0 Q;  2I5H A;  4DK3 C;  3K80 C;  1FL0 A;  5IYB H;  1NE3 A;  5IP7 G;  2JK8 A;  3L7Z C;  5GAG C;  5M5X H;  5LMU L;  3BZC A;  3CCE A;  1VQO A;  1EFW A;  3CQZ H;  1G6P A;  1K73 C;  5C44 G;  4PZ7 A;  1D8L A;  4AQY L;  1R9T H;  5HY6 A;  5FJ8 G;  3T1Y L;  4HIO A;  1MKH A;  3FKI H;  1X55 A;  2K14 A;  2L15 A;  3K81 C;  2QGQ A;  4A3F H;  3H0G H;  4JOI A;  2JA7 G;  2NVY H;  1C7Y A;  3U50 C;  4BA1 I;  2A19 A;  3KDF B;  3HOY H;  1UWV A;  4C3H H;  4L5S A;  3PV0 A;  1E7Z A;  2AMC B;  3M4Q A;  4QJF A;  4LF7 L;  3GTL H;  3M9B A;  1RL2 A;  2ZTD A;  4DV0 L;  1UE1 A;  2AWN A;  3PUV A;  4JI1 L;  1K83 H;  3CC7 A;  2IHF A;  1VQ6 A;  2WFW A;  1P8L A;  2JQO A;  1JJC B;  1Q12 A;  4LFC L;  3J7Z C;  1Q46 A;  2JE6 I;  1IBL Q;  5IE8 A;  1VQC A;  2B63 H;  5DLQ E;  4JI4 Q;  2IHE A;  4JBJ A;  2VL6 A;  1YZ6 A;  2AHO B;  2UUA L;  1V1Q A;  3HOX G;  4KLK A;  3S15 H;  1VQA A;  4YWK A;  4YHH L;  3S16 H;  2NZH A;  4X65 L;  2R92 H;  3HOW H;  4Y7N H;  1IYJ B;  1K0R A;  3HOZ G;  3BU2 A;  4BA2 I;  4APV A;  2Q2I A;  4DR6 L;  2UUC Q;  4B3T L;  2UXD Q;  3F1Z A;  5JJK A;  4LUZ A;  2R93 H;  3VDY A;  4DV4 Q;  1VQJ A;  3G48 A;  4EQ5 A;  5IYB G;  1IL2 A;  3CCR A;  4HIK A;  4JOI C;  2ZJR A;  1LUZ A;  4WJ3 M;  1K8G A;  2R7Z G;  4LFB Q;  4DV5 Q;  2CFM A;  1FGU A;  1E3P A;  1CSQ A;  4OON A;  4R4O A;  1YJ9 A;  2K75 A;  1I94 L;  5JJL A;  1KC8 C;  4OX9 Q;  4DR7 L;  2JEA I;  2IY5 B;  1SMX A;  1HH2 P;  5BR8 Q;  1YHA A;  4GLA C;  5C4X H;  1MJE A;  5AJ3 L;  3FKI G;  2VQF L;  3W1B A;  4ALP A;  2A8V A;  3UDF A;  1G51 A;  4A3F G;  1EYG A;  3H0G G;  2N8N A;  1NY4 A;  5IP9 H;  4DNI A;  1XMQ L;  2Q2U A;  3S1Q H;  3J81 c;  3HOY G;  2E2I H;  5EAY A;  4Y52 H;  4DV7 Q;  4A3E H;  1HR0 Q;  4A3G H;  4X66 L;  3GTG H;  1WCM H;  4JI6 Q;  2ALY B;  4YWM A;  2MNA A;  1GKH A;  2WAQ E;  3A0J A;  1VQD A;  5J3B A;  4A4I A;  4LF6 Q;  3STB C;  5H1S E;  1S3O A;  1B7Y B;  1GO3 E;  1TWF H;  2ES2 A;  4KHP Q;  2HHH L;  5IT9 c;  1YHB A;  3WWV A;  1N32 Q;  1JE5 A;  3G6E A;  1DGS A;  1JJ2 A;  1E1T A;  4NPS A;  2B63 G;  1HR0 W;  4JI3 Q;  4BBS H;  1VQH A;  3F2C A;  2IX0 A;  2PMZ E;  4B3S L;  2OTJ A;  2ZM6 Q;  4DPG A;  4DUZ L;  2Q2H A;  1WYD A;  2DGY A;  3KJP A;  4A3I H;  4PZ6 A;  2R92 G;  4BY1 H;  3HOW G;  2VW9 A;  4K0K Q;  4LF4 Q;  1IBM Q;  1PVO A;  1I3Q H;  5K36 G;  4B3R Q;  3D0F A;  1XNQ L;  1X3E A;  4DAY B;  2D0P A;  1XJV A;  2PQA A;  2AKW B;  3KF8 B;  5LMN Q;  4BY7 H;  4IFD J;  4JV5 Q;  2R93 G;  4PG3 A;  3CW2 C;  2JEB I;  3KYH C;  2K4K A;  4L5Q A;  4LNQ A;  4DUY L;  2B29 A;  4YY3 L;  4QY7 A;  3CCS A;  2UXC L;  5GAE C;  1HNW Q;  3TS0 A;  1XNR L;  5C4X G;  2AWO A;  4GN3 B;  2GVB A;  3RLO A;  1QUQ B;  4DR3 Q;  5FLM H;  1TWG H;  1LYL A;  2NZO A;  4DV3 L;  1V43 A;  1Q86 C;  4A3C H;  1HNX L;  4OWT B;  5C3E H;  5IP9 G;  2MQH A;  4JI0 L;  3I4M H;  4DR4 Q;  2F52 A;  4GLV B;  4DV1 L;  1K8A C;  4A3G G;  4LF8 Q;  1X6O A;  3ULL A;  1K3R A;  1WCM G;  4DAM A;  3CCJ A;  3KOJ A;  1L2F A;  1VQ8 A;  1I5F A;  4JBW A;  4HJ9 A;  3L0O A;  1N34 Q;  1AH9 A;  1ASY A;  1NTG A;  1MIU A;  1Q1E A;  3HOV H;  3J80 c;  4QQB X;  3HKZ E;  3CAM A;  2CWA A;  4GLX A;  3S17 H;  4RG1 A;  3M4O H;  3S24 A;  4BBS G;  1X3F A;  3PUX A;  3OTO L;  3M7N A;  3ZJY C;  2PI2 E;  4DKA C;  3F2D A;  2F3I A;  1LM0 A;  2K50 A;  4A3I G;  3RZD H;  1XPR A;  4NXM Q;  4MZ9 A;  4BY1 G;  4DR1 Q;  2Y0S E;  2UUB L;  1Y14 B;  5C4J H;  1XMO L;  3G71 A;  4BY7 G;  2BH2 A;  1EUJ A;  1N36 L;  3A5U A;  1OXU A;  4O0A A;  4JI5 Q;  2D0O A;  3J81 j;  4GN4 B;  5E7N A;  4A75 A;  1VQK A;  2KHI A;  1UE7 A;  3E0E A;  3I7F A;  1KAW A;  3ER0 A;  4JG2 A;  4P73 A;  3CCV A;  1PYB A;  4HIM A;  1VQL A;  3S1M H;  4UP7 A;  3K7U C;  5JEA G;  3ICE A;  3GTP H;  5FLM G;  3IRB A;  1HZA A;  4DV6 Q;  1BKB A;  2UXD L;  4A3C G;  4GKJ Q;  1PV4 A;  2OQK A;  2K5V A;  1GD7 A;  5C3E G;  2VQE Q;  4H02 A;  2K5H A;  4LUV A;  3I4M G;  3KLW A;  3T1H Q;  4IPG A;  4YCU A;  5IYD H;  1XPU A;  1E22 A;  1VQM A;  2I5L X;  1YEZ A;  2EQS A;  4DV2 Q;  1SLJ A;  4LFA Q;  1VQG A;  1FVI A;  1OXS C;  4OWX B;  3TQY A;  3PF4 A;  2IX1 A;  2NVQ H;  1X3G A;  2JA8 H;  5BR8 L;  5M3F H;  1N33 Q;  3HOV G;  2UXB L;  4UPA A;  3MXN B;  1C9O A;  4R1J A;  1QVF A;  2VY3 A;  4LF9 Q;  3HFZ B;  2UU9 Q;  4UY8 C;  1CKN A;  3ULP A;  4DR2 Q;  1QZG A;  1YHQ A;  2WB1 G;  1HR0 L;  4LUO A;  3E9I A;  3KF6 A;  4IPD A;  1O7I A;  2N3S A;  1XTD A;  3LGJ A;  4X64 Q;  4JI6 L;  2VNU D;  1CUK A;  3Q8D A;  5ELO A;  1JB7 A;  4WJ4 A;  5JJI A;  4X62 Q;  1PH4 A;  3HKS A;  4AYB E;  1VQ7 A;  2R6G A;  5LMU Q;  1QVC A;  3FHW A;  3OYY A;  4KHP L;  5IWA Q;  1I6H H;  1N32 L;  1X65 A;  3PO2 H;  4HJ8 A;  1HZB A;  4AQY Q;  3SGI A;  3T1Y Q;  3GTM H;  1IBK Q;  4BBR H;  2JA6 H;  1HZ9 A;  2NN6 I;  4QIW E;  3PGZ A;  3U58 A;  3CCU A;  1NMG A;  3A74 A;  3AFQ A;  1JMC A;  4JI2 L;  4LF5 L;  3TRE A;  3KJO A;  1PH2 A;  4K0K L;  4GOP A;  3S14 H;  1OXT A;  1E24 A;  3K0X A;  2E5L L;  4LF7 Q;  3PUY A;  2GVA A;  2CWP A;  1WJJ A;  3GO5 A;  4OXP A;  4DV0 Q;  3M3Y H;  4A3B H;  4JV5 L;  4L5R C;  2K52 A;  5IYD G;  1UE5 A;  4A3D H;  2A1A A;  4GNX A;  4KI0 A;  2OQ0 A;  4JYA L;  2VZA A;  4A3L H;  4NXN Q;  1VQ9 A;  1PA6 A;  4BXX H;  2HIX A;  4XIG S;  2KCM A;  4A93 H;  1WOC A;  2N78 A;  3GDE A;  4POG A;  2CKZ B;  2JA8 G;  2E8G A;  5M3F G;  3TS2 A;  3TRZ A;  2IT1 A;  1E1O A;  4R4C A;  4JI7 L;  1SN8 A;  3CCQ A;  2UUA Q;  1A63 A;  4B3M Q;  5M5W H;  4NB3 A;  1SRU A;  2GN5 A;  4X6A H;  1VQF A;  4A3K H;  1RIP A;  4R4Q A;  3J80 i;  1GM5 A;  4DR4 L;  1UEB A;  1Z9F A;  3EIV A;  2PQA B;  5GAH C;  3AEV A;  1HZC A;  3CCM A;  1P16 A;  4UP9 A;  1NJI C;  1ASZ A;  1A62 A;  2KHJ A;  2MO0 A;  2NN6 G;  3S1N H;  1Q1B A;  2WAQ G;  4IOC A;  2R7D A;  1PFS A;  2V1C C;  4JCV E;  1QVG A;  1N34 L;  2R7F A;  1PYS B;  2LXK A;  2D62 A;  3H15 A;  4DV6 L;  4GOP C;  4DR7 Q;  3PO2 G;  2RHS B;  3NEN A;  3AYH B;  4BBR G;  5AJ3 Q;  3I56 A;  3M4P A;  2VQF Q;  5LMN W;  3RLN A;  2N49 A;  3L2P A;  4OWW B;  2JA6 G;  3J7A 5;  4GNX C;  4C2M H;  2NVT H;  4IPC A;  3RLF A;  4C3I H;  1PHJ A;  3PO3 H;  4L5T A;  4NXM L;  4DR1 L;  5M3M H;  2I0Q A;  2WP8 J;  1KRT A;  4A3E G;  1M90 C;  1MJC A;  4A3B G;  5GRO A;  5GQO A;  2C35 B;  5JEA J;  1PH7 A;  4A3D G;  1Z47 A;  1JJG A;  3UDG A;  1B70 B;  4R4I A;  3RZO H;  4A3L G;  2K5N A;  4PMW A;  1L1O B;  3ERS X;  2HHH Q;  4BXX G;  3S2H H;  1D7Q A;  5C0X I;  3PIO A;  1J5E Q;  1L1O A;  4A93 G;  4POF A;  1EIY B;  4HJ5 A;  2PNH A;  3W5O A;  3BJU A;  3I55 A;  1OTC A;  1EIF A;  4PZ8 A;  5M5Y H;  1JT8 A;  2JA5 H;  4A3K G;  3B6Y A;  2ZJQ A;  4C3J H;  2ID0 A;  1HNZ Q;  1QZH A;  4FDB A;  1XNQ Q;  2VS1 A;  1S40 A;  2E2J H;  3HOU H;  2OCE A;  3I4N G;  2KCT A;  1A0I A;  1IBL L;  3PCO B;  4LFA L;  3E9H A;  4GKK Q;  1IZ6 A;  4DR5 Q;  1X56 A;  3K7A H;  2HIV A;  4P71 A;  3JAM c;  1EQQ A;  4YY3 Q;  2DUD A;  2OTL A;  4JI4 L;  1G29 1;  3I4O A;  3UE0 A;  2UXC Q;  3TEH B;  1BBW A;  4JI8 Q;  1VQ5 A;  2UU9 L;  3S2D H;  1SRO A;  1Q82 C;  2XTI A;  4JBM A;  4DR2 L;  1UE6 A;  2FXQ A;  4MNO A;  4DV3 Q;  1KQS A;  1YIJ A;  1M1K C;  1HNX Q;  3FP9 A;  2UUC L;  3PO3 G;  3CPW A;  4YCV A;  1AE3 A;  5C0X G;  2QA4 A;  5M3M G;  1Y1V H;  4IJH A;  1B8A A;  4X64 L;  1YI2 A;  4R4T A;  1TXY A;  2YYZ A;  4KHZ A;  3UDI A;  4DV1 Q;  4DV4 L;  1Q81 C;  4X62 L;  1L1O C;  3MEF A;  2Q2T A;  2F4V Q;  2EIF A;  1YVC A;  3NBH B;  2R7Z H;  2H5X A;  4JBK A;  1Y1W H;  4P72 A;  4DV5 L;  4LFB L;  2ZTE A;  3J81 i;  4OO1 I;  2I5M X;  5IWA L;  4OX9 L;  1L0W A;  2ATW A;  3H3V H;  1K9M C;  3BZK A;  2VUM H;  1IBK L;  1CSP A;  4HJA A;  3CC2 A;  2ASB A;  2NVX H;  1FJG Q;  3M85 A;  3CC4 A;  1CKN B;  3OTO Q;  4AH6 A;  4P75 A;  1VQB A;  1AE2 A;  3KDF A;  3KF6 B;  1VCI A;  4DV7 L;  2WB1 E;  2E2H H;  2JA5 G;  2LXJ A;  2UUB Q;  1PH9 A;  3H3V I;  3PF5 A;  3PUW A;  1XMO Q;  2CQO A;  3GTK H;  2B3G A;  4IPH A;  3OW2 A;  4LF6 L;  2YU9 H;  1EQR A;  3EN2 A;  3UDX A;  2HQL A;  1XPO A;  1PH3 A;  1N36 Q;  3HOU G;  3CMA A;  4NXN L;  2Z6K A;  1A8V A;  3U4V A;  4JI3 L;  3CPF A;  3EBE A;  3GD7 A;  1KIX A;  3KFU A;  3RNU A;  3CME A;  2ZM6 L;  2YTV A;  1Q7Y C;  4B3M L;  4OO1 G;  4GOP B;  3DM3 A;  3ULJ A;  5FLX c;  1KHI A;  4LF4 L;  1IBM L;  4RMF A;  2OWO A;  4B3R L;  3D31 A;  2JJQ A;  5LMN L;  1Y1V G;  4GNX B;  1W3S A;  1HJP A;  1VQI A;  1WFQ A;  4JI1 Q;  4AYB G;  4AIM A;  2RHQ B;  1PH8 A;  4LFC Q;  1U5K A;  2YTY A;  5GAD C;  1Y1W G;  1S72 A;  4TQU S;  2RCN A;  4A3M H;  1NMF A;  3DLL A;  2Z0S A;  2YTX A;  1HNW L;  1X9N A;  3PIP A;  2VUM G;  4LW1 A;  4DR3 L;  2UXB Q;  3W1G A;  3RR5 A;  1KD1 C;  1YJW A;  3I4N H;  1SR3 A;  4YHH Q;  3CF5 A;  2MFI A;  1J6Q A;  3JC6 6;  4X65 Q;  3CCL A;  3CD6 A;  1SFO H;  3RN2 A;  2Z6K C;  2HT1 A;  3STB D;  1N9W A;  1YNX A;  2XGT A;  4O2D A;  4B3T Q;  4TVA B;  1W2B A;  1LTL A;  4LF8 L;  4DR6 Q;  4JC0 A;  4P74 A;  1EOV A;  1PH5 A;  4DK6 C;  1YBY A;  1NBW A;  4IO9 A;  1GVP A;  1I50 H;  2ZTC A;  3F2B A;  1I94 Q;  5IYC H;  1J5E L;  4A3J H;  4LWC A;  4GN5 A;  1VQP A;  2LSS A;  4HJ7 A;  4LF5 Q;  3GTO H;  4J15 A;  4JI2 Q;  3JAM i;  1XMQ Q;  2PI2 A;  1V9P A;  2YV5 A;  3NEM A;  1HNZ L;  1WI5 A;  1OXX K;  1VQE A;  2E5L Q;  3GTQ H;  3S1R H;  3RN5 A;  4X66 Q;  5IP7 H;  4IOA A;  4IFD I;  1TWH H;  4UP8 A;  3GTJ H;  3AQQ A;  1TWC H;  3I2Z A;  1KRS A;  4JI5 L;  5C44 H;  1X54 A;  1N8R C;  4GKK L;  4DR5 L;  3PSI A;  4YWL A;  4JYA Q;  1VS0 A;  2KEN A;  1CKO A;  1TWA H;  5FJ8 H;  2BA0 A;  4QGU A;  5C0X J;  4A3M G;  2CCZ A;  4JI8 L;  3CXC A;  2MO1 A;  3A5Z B;  1T9H A;  2JA9 A;  5ELN A;  2JA7 H;  1CKM A;  4IJL A;  4MTN A;  1OXV A;  4B3S Q;  5IY0 A;  4JI7 Q;  1PH6 A;  1KXL A;  4XTC S;  4GS3 A;  4DUZ Q;  1QUQ A;  1YJN A;  4HID A;  4GKJ L; 
#chains in the Genus database with same CATH topology
 4B08 A;  4C3J B;  4RHR A;  1S4Z A;  2XWB B;  1BBU A;  3SDZ A;  2RF4 A;  4DK1 A;  2ZJP A;  3C3L A;  1MGS A;  4DUY Q;  3K8A A;  1N33 L;  3HKZ G;  4KY6 A;  3SVM A;  3L3O C;  4IFD G;  1FJG L;  4DK0 A;  4LF9 L;  1YIT A;  1SE8 A;  1XWE A;  2EOT A;  2JP1 A;  3U4Z A;  3KBG A;  2HQE A;  2K05 A;  3CP0 A;  1EY0 A;  2I5H A;  4QF4 A;  1FL0 A;  4OEM B;  5JVH 3;  5LMU L;  3CQZ H;  1K73 C;  4PZ7 A;  3QIA A;  1HPC A;  5HY6 A;  3OMG A;  1IL8 A;  3K81 C;  2QGQ A;  4MHE A;  3HRZ C;  4QIW B;  3H0G H;  4A3F H;  2NVY H;  2RBM A;  2A19 A;  1HTP A;  2PCF B;  4F87 A;  4QJF A;  2E2H B;  1TR5 A;  4DV0 L;  3BG3 A;  3PUV A;  3IKJ A;  1F2Z A;  5KNC A;  3GTK B;  3OPO A;  2RSO A;  1S5C D;  2JE6 I;  1LT4 D;  2VL6 A;  2AHO B;  1BOS A;  1GUG A;  1S5D D;  3HOX G;  3MXN A;  1HUM A;  2X69 A;  4IQZ A;  2NZH A;  4X65 L;  5K36 H;  3HOW H;  2R92 B;  4Y7N H;  4KHV A;  4BA2 I;  2UUC Q;  3F1Z A;  4KK7 A;  3V96 A;  3VDY A;  1I4X A;  4DV4 Q;  1VQJ A;  3T56 B;  5I2X A;  1IL2 A;  3A8J E;  2CFM A;  1E3P A;  1CSQ A;  4R4O A;  4JPB W;  1I94 L;  2K75 A;  5JJL A;  1CTM A;  2JEA I;  1YHA A;  1WVL A;  2VQF L;  3FKI G;  1GXD C;  2FIN B;  4MN3 A;  3UDF A;  2D5D A;  2F1M A;  2N8N A;  2NWG A;  2NZ1 D;  5IP9 H;  1XMQ L;  4G7O C;  3C46 A;  1ZXT A;  2FJ2 A;  1QE6 A;  4DV7 Q;  4A3E H;  4X66 L;  3GTG H;  2ALY B;  4ME5 A;  4KMU C;  4A4I A;  1S3O A;  4KHP Q;  2F0H A;  2HUG A;  5IT9 c;  4G7H C;  1JJ2 A;  4NPS A;  2B63 G;  1D5M C;  4BBS H;  1TVX A;  4CBV A;  3MA2 B;  2PMZ E;  4B3S L;  3A7A B;  2ZM6 Q;  2F0U A;  2OT2 A;  3KJP A;  2R92 G;  4BY1 H;  2VW9 A;  2TMP A;  1IBM Q;  1I3Q H;  1STN A;  4B3R Q;  3D0F A;  1XJV A;  4DAY B;  2D0P A;  4IFD J;  2PQA A;  3H09 A;  2R93 G;  1ICW A;  3KYH C;  4L5Q A;  1B53 A;  4LNQ A;  4YY3 L;  4QY7 A;  1HTL D;  1LV9 A;  1TWA B;  1DXM A;  1W6K A;  5C4X G;  1QUQ B;  5DAU A;  5FLM H;  1TWG H;  1LYL A;  4DV3 L;  1HNX L;  4OWT B;  1MD2 D;  4QMG A;  3QOJ A;  4K6D A;  4LF8 Q;  4DAM A;  3KOJ A;  1L2F A;  4K2K A;  1SE2 A;  2ZXP A;  3FDT A;  3E0J A;  1EU4 A;  4WRD A;  1NTG A;  4CJ1 B;  1MIU A;  3HOV H;  4OIJ A;  3HKZ E;  3CAM A;  2CWA A;  2FFK B;  1TQO A;  4RG1 A;  1JE4 A;  2XWJ B;  3PUX A;  3M7N A;  3F2D A;  2K50 A;  4A3I G;  3HOZ B;  4MZ9 A;  3CRK C;  1MSG A;  4N8X 1;  2PW7 A;  1ESF A;  3G71 A;  1EUJ A;  2KEC A;  3A5U A;  1H9S B;  1ROD A;  4HSP A;  2EYF A;  1STA A;  4DF7 A;  1R9T B;  4PV1 C;  4JG2 A;  3E0E A;  1KAW A;  3SK4 A;  1PYB A;  3S1M H;  2WIN B;  4UP7 A;  4ABN A;  1EIH A;  5CC4 A;  4X3U A;  3I4M G;  1GD7 A;  2K28 A;  3KLW A;  3T1H Q;  1HFG A;  4YCU A;  1E22 A;  2KVM A;  2KA7 A;  2R61 A;  1FGB D;  3PMF A;  4IUN A;  4LFA Q;  4HMI A;  5A35 A;  4RCO A;  3PF4 A;  3OWE B;  5M3F H;  1JWM D;  4R1J A;  2XIW A;  1O78 A;  2UU9 Q;  3S15 B;  4G7Z C;  3NTI A;  1TU2 B;  1QZG A;  1YHQ A;  2WB1 G;  4IPD A;  4TRD A;  1XYI A;  3WOF A;  4X64 Q;  3Q8D A;  4X62 Q;  5LL6 X;  2MGS A;  1F2Y A;  1SEB D;  3FHW A;  4B9X A;  1I6H H;  2DY7 A;  2ZXR A;  1BUV T;  1J9O A;  2QW7 A;  3SGI A;  2X6L A;  2A73 B;  1IBK Q;  4HCE A;  2NN6 I;  4QIW E;  3PGZ A;  2MHV A;  1CZW A;  1JMC A;  1CM9 A;  3M7G A;  2E2I B;  2XN9 C;  4LF7 Q;  1WJJ A;  3M3Y H;  4A3B H;  2PW5 A;  1E2V A;  1FR3 A;  4V19 0;  4OEL B;  2L12 A;  2PYK A;  1B50 A;  3N6R A;  1OO9 B;  3NTK A;  4G4K A;  2X6G A;  3P7J A;  2HIX A;  2F0F A;  3TP5 A;  3TN2 A;  4A93 B;  2CKZ B;  1ZEQ X;  4R4C A;  3VR6 A;  3V05 A;  3CCQ A;  2UUA Q;  1A63 A;  5E4W C;  2P5Z X;  2GN5 A;  1O80 A;  3J80 i;  1SNO A;  4NW2 A;  3OOC A;  4UP9 A;  1ASZ A;  1A62 A;  1VMP A;  2NN6 G;  3S1N H;  3D3R A;  1B3A A;  1HFN A;  5DM6 3;  1Q1B A;  2WAQ G;  2E75 C;  3K59 A;  2D62 A;  1JWU D;  1BNZ A;  4DR7 Q;  2RHS B;  5AJ3 Q;  3RLN A;  2F0E A;  4OWW B;  1JOQ A;  4GNX C;  1ET9 A;  3PO3 H;  5C0X H;  4DR1 L;  2I0Q A;  1YNN C;  2MJ8 A;  2WP8 J;  3Q22 A;  1MJC A;  2ICE C;  1Z47 A;  3RZO H;  4Q5V A;  4BXX G;  1R4Q B;  1D7Q A;  5JPN C;  4A93 G;  4POF A;  3BJU A;  3I55 A;  1EIF A;  3VA5 A;  5M5Y H;  2JA5 H;  3B6Y A;  3QR8 A;  2NUC A;  2EE1 A;  1TY0 A;  4RFB A;  1NR2 A;  2E2J H;  2Z1C A;  1A0I A;  1IBL L;  3TP8 A;  4ZCK A;  4GKK Q;  4DR5 Q;  4C1N K;  2HIV A;  3JAM c;  2DUD A;  4JI4 L;  2AQ3 B;  4HTH A;  4OO1 H;  1LTS D;  1SRO A;  4LK1 C;  2XTI A;  3OIQ A;  2SEB D;  1UAP A;  2KJX A;  4JBM A;  2B2Y C;  4MNO A;  3GTP B;  1WD1 A;  1M1K C;  2R3Z A;  3FP9 A;  4C3I G;  3K58 A;  4IJH A;  3U9O A;  4DV1 Q;  4KHZ A;  3ITP A;  1YVC A;  5J22 A;  2H5X A;  5I6W A;  1Y1W H;  4OX9 L;  3J7Y W;  4HJA A;  1K3B C;  3MXG A;  1C48 A;  2NBF A;  2K5D A;  3PQI A;  4P75 A;  1K28 A;  1AE2 A;  4R8I A;  1XX8 A;  2WB1 E;  2ZXO A;  2UUB Q;  3A55 A;  2Z6B A;  4DN4 M;  2A6E C;  3OW2 A;  4MTK A;  3UDX A;  3Q23 A;  1N36 Q;  4NXN L;  5CV8 A;  1IKL A;  1LT3 D;  4GZY C;  4ZLT F;  3U4V A;  5EPL A;  3KFU A;  4BBR B;  3RNU A;  2JA6 B;  5JJZ A;  4XXE A;  3CU7 A;  4LF4 L;  2OWO A;  3S14 B;  1DOK A;  3NSW A;  1TS4 A;  5I9P A;  4HSV A;  1W3S A;  4DAP A;  4JI1 Q;  4A3D B;  4AIM A;  4LFC Q;  1ENF A;  2C5C A;  2RCN A;  4A3M H;  1BCP C;  5FK9 C;  1DM0 B;  4KJN A;  2VUM G;  3DXJ C;  3W1G A;  2PZW A;  5M5W B;  4F7X A;  4A3K B;  3K5L A;  1N9W A;  4DR6 Q;  4B3T Q;  3TSS A;  4JC0 A;  1EOV A;  5IGB A;  1CA5 A;  1CZG A;  2K01 A;  3BYY B;  4DK6 C;  1NBW A;  2B2T A;  1Y8P B;  1MHW C;  1I50 H;  5IYC H;  1J5E L;  4LWC A;  4YIJ A;  2ENB A;  5DNF A;  4C2M B;  2PI2 A;  1AZP A;  1V9P A;  2YV5 A;  3NEM A;  5M3M B;  3D6W A;  1UEA B;  3GTJ H;  4DAY A;  2WKD A;  1TWC H;  1KRS A;  1ONL A;  2CW0 C;  4X3K A;  3W2D A;  4JYA Q;  1VS0 A;  5FJ8 H;  2CCZ A;  1GUT A;  2MO1 A;  3A5Z B;  1PTO H;  2JA7 H;  2XVS A;  1PRT C;  4IJL A;  1SYG A;  1OXV A;  5IY0 A;  1QUQ A;  2KUM A;  1YNJ C;  2QEX A;  1Z7T A;  3LX0 A;  5E4X A;  2HD3 A;  3W3A A;  1U0L A;  1EWI A;  1I4G A;  1FYC A;  3HOU B;  4QL5 A;  4DV2 L;  1KL9 A;  3UE1 A;  1S5E D;  3K7A B;  2KBN A;  3P75 A;  2JYO A;  2RA4 A;  1PH1 A;  4JK1 C;  4A3J G;  3F8T A;  5IGC A;  3S2D B;  3A8K E;  5M9O A;  4EX5 A;  4E6I A;  4JI0 Q;  3PIO 3;  2JXM B;  4DK3 C;  1Y1V B;  5IYB H;  4AYB B;  5IP7 G;  2JK8 A;  1NNX A;  4NKL A;  4EGV A;  5M5X H;  2R7Z B;  1HRJ A;  3BZC A;  1VQO A;  4KKT A;  1LT6 D;  5C44 G;  1H9S A;  3I91 A;  4AQY L;  2J0T D;  1MKH A;  1KTK A;  1X55 A;  1EWC A;  3J7A V;  1I4H A;  2NVX B;  4JOI A;  3NQT A;  5I2Y A;  4BA1 I;  2KED A;  3KDF B;  1D1I A;  3HOY H;  4C3H H;  3PV0 A;  4RKL A;  3I4L A;  4F88 A;  3GTL H;  3M9B A;  3DWP A;  2IW3 A;  1K83 H;  1VQ6 A;  4P2C B;  2WFW A;  3BVZ A;  3MFG A;  3J7Z C;  2HCI A;  2L1B A;  2RKS A;  5FO8 B;  1L0Y B;  3TZD A;  2PMZ B;  1JC7 A;  4KN4 C;  3TZU A;  4K6L A;  3S16 H;  2F0O A;  1GOZ A;  1S5B D;  4Y7N B;  3BU2 A;  1O7Z A;  2UXD Q;  5ELC A;  2EJF C;  4KKU A;  4EQ5 A;  3HGB A;  4HIK A;  4WJ3 M;  1RKN A;  2R7Z G;  4LFB Q;  2Z8L A;  3BS1 A;  1SMX A;  1HH2 P;  4GLA C;  1EQV A;  2L11 A;  1G51 A;  4ILW A;  4A3F G;  3H0G G;  1EYG A;  3S1Q H;  1SFO B;  3DEP A;  3Q6S A;  5EAY A;  4A3G H;  1HR0 Q;  1BXT A;  1KDC A;  1WCM H;  4JI6 Q;  5C4H A;  2MNA A;  3A0J A;  1VQD A;  4LF6 Q;  4B9W A;  3STB C;  4IAL A;  1LT5 D;  1GO3 E;  2ES2 A;  4OHJ A;  1CQV A;  2GA4 B;  5FOB B;  1N32 Q;  1DGS A;  1EOT A;  4KJO A;  5E3F A;  1PDQ A;  4BBS B;  1WTH A;  2OTJ A;  5C3W A;  4DUZ L;  2Q2H A;  1WYD A;  2DGY A;  5LL6 S;  1IKM A;  5K36 G;  3HOW G;  5A2Q L;  4K0K Q;  1PVO A;  2K5W A;  1SYF A;  2RDH A;  1X3E A;  4BY7 H;  1TWH B;  5CV4 A;  2JEB I;  2K4K A;  1BDO A;  4DUY L;  2B29 A;  4CGY B;  2UXC L;  3SR1 A;  5C5M A;  1FNU A;  1WTR A;  5JEA H;  2AWO A;  4DR3 Q;  2DY8 A;  3KLS A;  2EYO A;  1K8M A;  1Q86 C;  3P1H A;  5C3E H;  5IP9 G;  5D3I B;  1K8O A;  4LMQ D;  3ULL A;  1K3R A;  1EZ8 A;  3CCJ A;  4O1N A;  3EQL C;  4HJ9 A;  1U4L A;  1AH9 A;  1WTP A;  1Q1E A;  4EQP A;  1SXT A;  3J80 c;  4QQB X;  3QOL A;  1DOL A;  3HOV B;  3M4O H;  3E6Z X;  4BBS G;  3HOX B;  1X3F A;  4N9T A;  4DKA C;  1FD7 D;  3RZD H;  1XPR A;  3OW7 A;  4DU9 A;  5KNB A;  4BY1 G;  1Y14 B;  1XMO L;  1U4M A;  1STY A;  1ILQ A;  4X3S A;  3BVG A;  5E7N A;  2A74 C;  4RGN A;  2G9D A;  1O7L A;  4A75 A;  3I7F A;  4P73 A;  1D5Z C;  3FKI B;  2L9H A;  5A2Q E;  1QNK A;  3K7U C;  1SE3 A;  3ICE A;  3C2P A;  4C56 C;  2SNM A;  5FLM G;  1HZA A;  2M9V A;  4DV6 Q;  1V8Q A;  2K5H A;  4H02 A;  4LAA A;  1NCV A;  3M4Y A;  3NE5 B;  5IYD H;  5G3L D;  1WTQ A;  2E74 C;  2B2V A;  2EQS A;  4KY5 A;  3TME A;  1G6Z A;  4OWX B;  1OXS C;  1BQQ T;  2B2U C;  2XRS D;  3BYT B;  2JA8 H;  2B63 B;  1N33 Q;  3HOV G;  4QCL A;  2UXB L;  3BDC A;  3SK8 A;  2IL8 A;  1QVF A;  4LF9 Q;  2IX3 A;  1V1P B;  4UY8 C;  4F8M A;  2A6E D;  4RA8 A;  1CT1 D;  1A3U A;  3AU7 A;  4LUO A;  3E9I A;  4RGT A;  2N3S A;  1XTD A;  2K04 A;  4WJ4 A;  5JJI A;  1CUK A;  1JB7 A;  2R93 B;  4OGQ C;  4AYB E;  5EKI A;  2R6G A;  5ELF A;  5LMU Q;  4KHP L;  5IWA Q;  1X65 A;  3PO2 H;  3GTM H;  5C4X B;  2K7V A;  1PMR A;  3CHB D;  1NMG A;  2M00 A;  3CCU A;  3KJO A;  1PH2 A;  4CDF C;  3KLS X;  1RD9 D;  2E5L L;  3PUY A;  2GVA A;  4OXP A;  2K1B A;  4HN7 A;  3S9W A;  4DV0 Q;  3X3N A;  1BCP D;  4ZAI A;  2A1A A;  4CDC C;  4IUT A;  4A3L H;  1TWF B;  4UHV A;  1BCP F;  2N78 A;  4POG A;  5M3F G;  1HQR D;  1PZK D;  4UDU C;  3TRZ A;  1H9R A;  1T5E A;  4JI7 L;  1SN8 A;  2EY1 A;  4B3M Q;  1SRU A;  4A3I B;  1RIP A;  1UEB A;  5GAH C;  4XT1 B;  5EGT A;  1STH A;  2FMC A;  2F0M A;  4ZUJ A;  1D1K A;  2QDL A;  4PMB A;  2BCO A;  5I9O A;  2EZV A;  1VF5 C;  3LWU A;  3CKI B;  4JCV E;  2LXK A;  2J4X A;  4GOP C;  1JR0 D;  2RDF A;  2Q8I B;  2A68 C;  2E76 C;  2VQF Q;  5LMN W;  3M4P A;  4RCN A;  2QEJ C;  3IFT A;  3PO3 B;  3I4M B;  2CW0 D;  1KRT A;  2BDO A;  1M90 C;  4A3B G;  1JOR A;  5GRO A;  1ZKO A;  3SE0 A;  1JJG A;  1PH7 A;  2F0W A;  3NWS A;  1PRT D;  2K5N A;  4JVZ A;  4PMW A;  5C0X I;  4KD3 A;  1YNJ D;  1L1O A;  1SE4 A;  4HJ5 A;  2K6A A;  3LNN A;  3U9S A;  1SYE A;  5M5Y B;  2WB1 B;  2ZJQ A;  4C3J H;  2ID0 A;  1H9K A;  1G2S A;  3N52 A;  1RHP A;  5IOD A;  5C4J B;  1GHK A;  3BDL A;  2OCE A;  3SK5 A;  4LFA L;  1U4R A;  2OTL A;  4YY3 Q;  4CDE C;  1WTW A;  2UU9 L;  1Q82 C;  1RDP D;  3MHB A;  2F0V A;  3A54 A;  3URY A;  1UE6 A;  2FXQ A;  4DV3 Q;  1HNX Q;  2XSC A;  3PO3 G;  3CPW A;  5C0X G;  1AE3 A;  2WKC A;  3I72 A;  1B8A A;  2DJF C;  4X64 L;  4R4T A;  1TXY A;  3UDI A;  2RCF A;  3VR3 A;  3MVV A;  4X62 L;  1TS2 A;  2F4V Q;  1LO5 D;  2EIF A;  4OO1 I;  1A2T A;  2H4O A;  2ZTE A;  4DV5 L;  1TT2 A;  2EYH A;  3H3V H;  3QJY A;  1K9M C;  2NVQ B;  1IBK L;  3SK6 A;  3I73 A;  1MBY A;  4KD4 A;  1CK1 A;  1PZI D;  1B1Z A;  3I90 A;  4AH6 A;  2A69 D;  3KF6 B;  2E2H H;  3KDF A;  1VCI A;  3OMC A;  5D65 A;  4IN3 A;  2JA5 G;  1SNC A;  4G57 A;  3GTK H;  2WAQ B;  2B3G A;  5HGT A;  3EN2 A;  1XPO A;  1PH3 A;  4JI3 L;  2B39 A;  2PO4 A;  3EBE A;  1U9R A;  4HED A;  4DFA A;  3K0Y A;  4OO1 G;  3VR4 A;  3TBI B;  3T51 B;  1V1O A;  3OWF A;  1GJX A;  2JJQ A;  5LMN L;  4GNX B;  2EY5 A;  1WTX A;  1HJP A;  5C5L A;  5JPM C;  2RHQ B;  1PH8 A;  4KY7 A;  4FXG C;  2YTY A;  1Y1W G;  2RDG A;  1CFM A;  4HAE A;  1S5F D;  1HNW L;  1X9N A;  1EY8 A;  1I4R A;  3PIP A;  1ZYR C;  1WD0 A;  3K5N A;  1YJW A;  1B9M A;  2KEE A;  3I4N H;  2KOL A;  4YHH Q;  1J6Q A;  3CD6 A;  2Z6K C;  1KNA A;  3STB D;  1CQF A;  3TP6 A;  4TVA B;  1M8A A;  4NP5 A;  2EDG A;  1PH5 A;  3GQB A;  3OHX C;  4IO9 A;  4FF2 A;  2BE5 C;  2ZTC A;  1MI2 A;  4RKB A;  1A3V A;  1DZ1 A;  3V2T A;  4XQQ A;  1CA6 A;  3H6M A;  3MTS A;  3DUZ A;  1EY7 A;  4HJ7 A;  5CR3 A;  3GTO H;  4J15 A;  3T16 A;  2NVT B;  4C3I B;  3BVM A;  2NTT A;  4C1N I;  5C3X A;  1WI5 A;  1F2L A;  1CHP D;  3RN5 A;  1IW7 C;  4I7Z C;  4IOA A;  3AQQ A;  4U68 A;  2K5Q A;  2C9O A;  2IWH A;  4JI5 L;  1X54 A;  4GKK L;  4DR5 L;  3PSI A;  4FVM A;  1CKO A;  1TWA H;  5EKK A;  4QGU A;  1AN8 A;  3E5S A;  5C0X J;  4A3M G;  3CXC A;  3S2H B;  1EYA A;  2B8F A;  2F0L A;  1IYU A;  5FKA C;  1CKM A;  2L0C A;  5F2D A;  2EXZ A;  4GS3 A;  2D2C C;  4HID A;  4GKJ L;  5EPK A;  4ME3 A;  5IOC A;  2VQE L;  3R2T A;  1BF4 A;  1Q8K A;  3NEL A;  5FLX L;  2BH8 A;  1ENA A;  1ET6 A;  1TS5 A;  3K57 A;  1BVS A;  2B2W C;  2O4X A;  1VQN A;  3D4W A;  5IYC G;  1XNR Q;  3Q24 A;  5L37 A;  3K6O A;  4Z9C B;  3SEB A;  3HOZ H;  5HGQ A;  5D14 A;  2BA1 A;  2Y0S G;  4RH6 A;  2F0N A;  3K80 C;  5BN3 A;  3T53 B;  4PMC A;  3MAQ A;  5JAV A;  3CCE A;  1EFW A;  5I6Y A;  1PTO C;  1GUS A;  1KLG D;  1D8L A;  1R9T H;  5FJ8 G;  3T1Y L;  2VUM B;  2V4D A;  1JQY D;  2JA7 G;  1BCP B;  1VMC A;  3U50 C;  1UWV A;  2Q8T A;  2TSS A;  2SNS A;  1E7Z A;  5IT9 L;  3M4Q A;  2XRQ D;  4KN7 C;  1RL2 A;  2PNR C;  2ZTD A;  1LTR D;  1UE1 A;  2AWN A;  4JI1 L;  2BDN A;  1EWH A;  2IHF A;  3CC7 A;  2I46 A;  2HDM A;  1P8L A;  2JQO A;  1Q12 A;  4LFC L;  1IBL Q;  1Q46 A;  4QB4 A;  5IE8 A;  4ZKC B;  5KGU A;  4JI4 Q;  1HHV A;  2IHE A;  4JBJ A;  1V1Q A;  3S15 H;  4XYQ A;  1VQA A;  2F0Q A;  2OXP A;  1K0R A;  5T1I A;  1JWS D;  2Q2I A;  4DR6 L;  4B3T L;  5JJK A;  4MIU A;  5FLX E;  4LUZ A;  3G48 A;  5IYB G;  3CCR A;  2ZJR A;  5KRU A;  1TKW B;  2AQ1 B;  1FGU A;  4PQX A;  1SJH D;  1KC8 C;  3GV6 A;  4OX9 Q;  5NUC A;  3QB3 A;  5BR8 Q;  1QJO A;  1R4P B;  3W1B A;  1DYQ A;  1NY4 A;  4DNI A;  2Q2U A;  4ZYS A;  3HOY G;  4K2L A;  2E2I H;  4C3H G;  1PRT B;  3MEH A;  2PZU A;  4RAU C;  3VYS A;  1JOO A;  1WCM B;  3BZD B;  4YWM A;  1GKH A;  2WAQ E;  1PFM A;  2PQE A;  5H1S E;  4EQO A;  2HHH L;  1YHB A;  4KV6 A;  3WWV A;  1JE5 A;  3G6E A;  1F9Q A;  3L9A X;  1E1T A;  4A3J B;  1HR0 W;  3R8B A;  3DEO A;  3F2C A;  1T5X D;  2IX0 A;  5IT9 E;  3FRP B;  4X3T A;  4IUQ A;  4LF4 Q;  1JIC A;  3NTH A;  1XNQ L;  5KYI A;  3GTQ B;  3KF8 B;  1RF2 D;  2EYP A;  5ELE A;  3S1R B;  5EJW A;  4JV5 Q;  2KCN A;  5IGG A;  2EVB A;  3CW2 C;  3EVQ A;  5CV9 A;  2A68 D;  5C44 B;  4L63 B;  3CCS A;  1C4Q A;  5EPJ A;  5GAE C;  4ZK9 B;  3TS0 A;  1Y69 U;  4GN3 B;  3RLO A;  3VR5 A;  4A3C H;  2MQH A;  5COY A;  5IGF A;  4N8F A;  4JI0 L;  4DR4 Q;  2F52 A;  1K8A C;  4A3G G;  1X6O A;  1HA5 A;  1WCM G;  1PXU A;  1VQ8 A;  1N34 Q;  2EYL A;  3L0O A;  4GLX A;  3S17 H;  3NQI A;  2PZT A;  3IL8 A;  3S24 A;  2F4I A;  1LAB A;  3OTO L;  5BN4 A;  5FO7 B;  4NXM Q;  2Y0S E;  2RQX A;  3X3M A;  1G2T A;  2VB3 X;  4BY7 G;  5DEH A;  1OXU A;  2CVR A;  3VYU A;  4O0A A;  3CQZ B;  3J81 L;  4GN4 B;  2QCP X;  1VQK A;  2KHI A;  1UE7 A;  3G6J B;  4HIM A;  3ER0 A;  3NK9 A;  3CCV A;  3LWE A;  4A3F B;  5JEA G;  3H0G B;  4CDD C;  2NVY B;  3GTP H;  3IRB A;  3FPP A;  1BKB A;  3NUC A;  5IGE A;  2UXD L;  1PV4 A;  5TSS A;  2HCC A;  2OQK A;  2K5V A;  5C3E G;  4LUV A;  4IPG A;  1FNV A;  1WTV A;  1LTB D;  2XNA C;  2A69 C;  1VQM A;  2I5L X;  1YEZ A;  4TKO B;  4DV2 Q;  1VQG A;  3TQY A;  3SHL A;  1EYC A;  2WAC A;  1X3G A;  4LJZ C;  2VY3 A;  1HQM C;  1XTC D;  4DR2 Q;  1XXG A;  1JCK B;  3ULP A;  3HOW B;  1HR0 L;  3KF6 A;  4JI6 L;  1A6X A;  3LGJ A;  4BS9 A;  5ELO A;  4FXK C;  4WFN 3;  1PH4 A;  2MPM A;  3DWA A;  1VQ7 A;  1QVC A;  1NSN S;  1RTO A;  5FO9 B;  4ZRZ A;  1N32 L;  4HJ8 A;  4AQY Q;  1EU3 A;  4BBR H;  2JA6 H;  1H9J A;  1TII D;  1SMY D;  4LF5 L;  3AFQ A;  5E1F A;  1EY5 A;  4JI2 L;  2Z9H A;  1DD2 A;  4K0K L;  3S14 H;  3K0X A;  2BOS A;  3GO5 A;  2CWP A;  3F2U A;  4A3E B;  4K5V A;  1F77 A;  3GTG B;  3J81 E;  3I8Z A;  2K52 A;  5IYD G;  1UE5 A;  4A3D H;  4GNX A;  1QWY A;  2VB2 X;  2F0K A;  3H91 A;  4KI0 A;  2OQ0 A;  1Q3L A;  1ZYR D;  1VQ9 A;  2WII B;  4XIG S;  1WOC A;  3TS2 A;  3GDE A;  2JA8 G;  3VA7 A;  4NMZ A;  4IUR A;  5M5W H;  3A8I E;  4K5W A;  4H44 C;  4A3K H;  1JB3 A;  4X6A H;  4R4Q A;  5IGD A;  3JAM L;  4BY1 B;  1IYV A;  3VYT A;  1RTN A;  1I3Q B;  3AEV A;  3CCM A;  1P16 A;  1NJI C;  2BE5 D;  4J1M A;  2KHJ A;  4BWG B;  2F03 A;  4IOC A;  2R7D A;  2V1C C;  4J6H A;  3NBI A;  2R7F A;  3H15 A;  2AUK A;  3VYR A;  3ERQ A;  2KCC A;  3PO2 G;  3NEN A;  5CGK A;  1NR4 A;  2EY2 A;  3I56 A;  3L2P A;  2N49 A;  3J7A 5;  1ILP A;  1IW7 D;  1TWG B;  4C2M H;  4NDX A;  4L6T B;  2O2L D;  5M3M H;  4K5X A;  4ZUI A;  4U67 3;  1QCB D;  2LFN A;  4ID6 A;  5ELB A;  4PNY A;  4A3E G;  3I70 A;  5JEA J;  3D8G A;  2B2Y A;  1U4P A;  3R93 A;  1B70 B;  3ONA B;  4A3L G;  3KK7 A;  3KBX A;  5CV7 A;  2VXW A;  1DOM A;  1EIY B;  1I4P A;  1OTC A;  4O42 A;  1EY9 A;  4PZ8 A;  1HNZ Q;  5ISR A;  3K5M A;  3HOU H;  2KCT A;  1IZ6 A;  3Q0A A;  3K7A H;  4P71 A;  2UXC Q;  3I4O A;  4M8A A;  2CH4 W;  3TEH B;  1BBW A;  4JI8 Q;  1NAP A;  3JAM E;  1VQ5 A;  3S1M B;  3S2D H;  2OEO A;  3IAY A;  1YIJ A;  1SAP A;  3FEW X;  2UUC L;  4YCV A;  1PTO D;  1Y1V H;  4EVO A;  2Z4I A;  1Q81 C;  4DV4 L;  3NBH B;  2R7Z H;  4JBK A;  3EFX D;  5IWA L;  1PTO F;  1BR9 A;  1L0W A;  2ATW A;  3BZK A;  2AQ2 B;  5G3L F;  5M3F B;  2ASB A;  5CYU A;  2NVX H;  1FJG Q;  1CKN B;  5C4Z A;  1G8Z D;  1STB A;  3E3X A;  1G91 A;  4R9W A;  1VQB A;  3MXP A;  2EYM A;  4DV7 L;  4J8Q A;  4DNT B;  2LXJ A;  3RUZ A;  2NTS A;  3ND8 A;  4IUP A;  4C3J G;  1PH9 A;  3H3V I;  4RGM A;  4CJ2 C;  1XMO Q;  2CQO A;  5HUR A;  2YU9 H;  1EQR A;  3MFY A;  2HQL A;  3CMA A;  1EFI D;  1STE A;  1I6H B;  5AFW A;  1SYD A;  3GD7 A;  1KIX A;  3NP8 A;  2ZM6 L;  1Q7Y C;  4B3M L;  1SDF A;  4GOP B;  3ULJ A;  5FLX c;  1KHI A;  1DJR D;  3R3O A;  1IBM L;  4B3R L;  3DM1 A;  2EY6 A;  3D31 A;  5COR A;  3M3Y B;  5DM7 3;  4A3B B;  3QO2 A;  3H3V C;  2L55 A;  2A6H C;  1U5K A;  5GAD C;  1S72 A;  2EJM A;  4TQU S;  3DLL A;  2Z0S A;  2H1E A;  2PPB C;  4LW1 A;  2UXB Q;  3RR5 A;  3I4N B;  4M1U B;  4X65 Q;  2LS0 1;  1SFO H;  3RN2 A;  2HT1 A;  4H0L C;  1SNP A;  2M2L A;  1YNX A;  2XGT A;  4O2D A;  1AFP A;  1W2B A;  4LF8 L;  1SBB B;  4P74 A;  1ML0 D;  2K33 A;  3S1N B;  1QG7 A;  5BN5 A;  3NHH A;  1GVP A;  2F0T A;  1I94 Q;  1J8I A;  4IFD H;  2MUY A;  2F0J A;  2HDL A;  4WOR A;  1QNU A;  3D4R A;  3ND9 A;  1EYD A;  1Q8I A;  2LSS A;  3ERO A;  3GTO B;  1XMQ Q;  4IUU A;  1F9S A;  1VQE A;  2E5L Q;  1PZJ D;  4X66 Q;  2LY7 A;  1TWH H;  1VF7 A;  4XDX A;  5KND A;  3KF8 A;  3I2Z A;  5KEE A;  1N8R C;  1KAB A;  2F3V A;  3K5O A;  3AB9 A;  3RZO B;  4K8J A;  5ELN A;  4MTN A;  1EZ6 A;  1PRT F;  4B3S Q;  2B8G A;  1SND A;  3FMC A;  4OIK A;  4JI7 Q;  2B2T C;  1YJN A;  3I4N G;  4ODG A;  2JA5 B;  3T1H L;  3C1F A;  4FF3 A;  1IXR A;  3VR2 A;  3AFP A;  2F4V L;  1KNE A;  2E2J B;  1H95 A;  1SSO A;  2F0I A;  2EXD A;  3CRL C;  1QB5 D;  4A76 A;  3RMH A;  3G4S A;  3HOX H;  1LTT D;  4L8J A;  1EEF D;  4YCW A;  1C0A A;  2F0G A;  2G9H D;  1BO0 A;  3PUZ A;  2DNE A;  1VQ4 A;  1B44 D;  4HMJ A;  3AMU A;  4H13 C;  4EQN A;  1II3 A;  1NE3 A;  3TP7 A;  3L7Z C;  5GAG C;  3GV3 A;  1IHZ A;  2JN4 A;  1G6P A;  1Y1W B;  3KLR A;  1PFB A;  1C8C A;  4HIO A;  3FKI H;  2K14 A;  2L15 A;  4XQJ A;  1C7Y A;  3QG1 A;  4XYO A;  4L5S A;  2AMC B;  4LF7 L;  3DHQ A;  4FO2 A;  1GUO A;  4N9P A;  1JJC B;  2SOB A;  1B3Q A;  1VQC A;  2B63 H;  3G7L A;  5DLQ E;  1AW7 A;  1YZ6 A;  2UUA L;  4KLK A;  4YHH L;  4YWK A;  1QOH A;  2R92 H;  5EBD A;  2CHB D;  1IYJ B;  3HOZ G;  1HA6 A;  4APV A;  1SMY C;  2L5T A;  3NXW A;  5EKL A;  1TY2 A;  4RHS A;  2R93 H;  1GUN A;  1PFN A;  4JOI C;  1LUZ A;  1QIL A;  3OSO A;  1K8G A;  1BBX C;  4DV5 Q;  4OON A;  1YJ9 A;  4A3M B;  4DR7 L;  2IY5 B;  1WTO A;  5C4X H;  1MJE A;  4QUC A;  5AJ3 L;  4ALP A;  2A8V A;  3TDQ A;  2IPK D;  4I65 A;  3J81 c;  1D5X C;  2QF7 A;  3J80 L;  3MC0 B;  4Y52 H;  1A3T A;  1F9R A;  5J3B A;  2D9U A;  4K8I A;  4V0B A;  1B7Y B;  1TWF H;  1I50 B;  4DXG A;  3D6C A;  1KLU D;  2N55 A;  4JI3 Q;  1I4Q A;  1VQH A;  4DPG A;  4A3I H;  2DN8 A;  2RVL A;  4PZ6 A;  2Y0S B;  4RWS C;  3PIP 3;  2AKW B;  4FNF A;  5LMN Q;  4PG3 A;  5KIX A;  3GTJ B;  3MWY W;  1TWC B;  2E2D C;  1KAA A;  5J1Z A;  4CJ0 B;  3RD4 A;  1K0S A;  1HNW Q;  1X3Q A;  1XNR L;  1PTO B;  2OF1 A;  2JA7 B;  2GVB A;  1ICF B;  2NZO A;  1V43 A;  2FHT A;  3I4M H;  5EQ0 A;  4GLV B;  4DV1 L;  2A5H A;  1EY4 A;  1HXY D;  4CKB A;  2AUJ D;  1STG A;  3O13 A;  1I5F A;  4JBW A;  4CKE A;  1ASY A;  1KDA A;  3S17 B;  1SNQ A;  1W6J A;  1AEX A;  4DXF A;  3J80 E;  2CH4 A;  2LMC B;  3ZJY C;  2PI2 E;  2K32 A;  2F3I A;  1LM0 A;  2JSO A;  4CKC A;  2B2U A;  2CQA A;  4DR1 Q;  5K5P A;  2UUB L;  3H94 A;  4FXD A;  5C4J H;  1SYC A;  2BH2 A;  1N36 L;  1SJE D;  1AZQ A;  5M5X B;  4JI5 Q;  2D0O A;  3J81 j;  4IZ8 A;  1A2U A;  4DAV A;  4FYD A;  1VQL A;  1LTG D;  1ENC A;  3HZX A;  4FP5 D;  2RSN A;  1RJT A;  3NPP A;  5LHY 1;  3HOY B;  4C3H B;  4A3C G;  4GKJ Q;  2VQE Q;  3GTL B;  1XPU A;  3J7A F;  4IUV A;  1K83 B;  2O5I C;  1PLF A;  3FPU B;  3NBH A;  1SLJ A;  1FVI A;  2IX1 A;  2NVQ H;  5BR8 L;  4UPA A;  3MXN B;  4FF1 A;  1C9O A;  3HFZ B;  4FF4 A;  3S16 B;  1DCZ A;  2I07 B;  1CKN A;  1V1P A;  1UNS A;  2O5J C;  1LTI D;  2NN6 H;  1O7I A;  2VNU D;  4DGZ A;  5JVG 3;  2MP1 A;  1B4O A;  5T1G A;  3HKS A;  1F2M A;  4DNR B;  1X3P A;  3OYY A;  2NYZ D;  3ZYY X;  1EL0 A;  1Y8N B;  1HZB A;  3T1Y Q;  2FMM A;  3GP7 A;  1HZ9 A;  2F0S A;  4KTA A;  3EA6 A;  3U58 A;  4K14 A;  3A74 A;  1F9P A;  2QKI C;  2B2V C;  3TRE A;  2KHS A;  4GOP A;  3T13 A;  1OXT A;  1E24 A;  2F0D A;  3S1Q B;  1LAC A;  1M4V A;  2A6H D;  4A3G B;  3A56 A;  4JV5 L;  4L5R C;  5CBE E;  3C1E A;  2VZA A;  1PYW D;  4JYA L;  5CV5 A;  4NXN Q;  2QDB A;  1PA6 A;  4ZKB B;  4BXX H;  2KCM A;  4A93 H;  2KQ3 A;  2E8G A;  4WJW A;  3OIP A;  2IT1 A;  1E1O A;  3IFD A;  1AP0 A;  1I6V C;  4NB3 A;  2EYJ A;  1HUN A;  1VQF A;  4ZQ3 A;  1UUP A;  1GM5 A;  4DR4 L;  3EIV A;  1Z9F A;  2PQA B;  4OL7 A;  1HZC A;  5EBC A;  1EY6 A;  4CHT B;  2MO0 A;  4BY7 B;  1PFS A;  5IIF A;  1QVG A;  1N34 L;  3HEJ A;  1PYS B;  1Y8O B;  3UI2 A;  3DMU A;  3AYH B;  3T4A C;  4BBR G;  5ELD A;  2JA6 G;  4XQN A;  2ZT9 C;  2NVT H;  4IPC A;  3RLF A;  4C3I H;  1PHJ A;  4L5T A;  4NXM L;  4H7B A;  1X32 A;  5C3E B;  3DWQ A;  1MSH A;  3D4D A;  5GQO A;  2C35 B;  4A3D G;  3UDG A;  4R4I A;  1L1O B;  3ERS X;  2HHH Q;  3S2H H;  4HR7 B;  1NUC A;  1E0B A;  3PIO A;  1J5E Q;  3M4O B;  2PNH A;  3W5O A;  2EJG C;  1JT8 A;  3RZD B;  4A3K G;  4DA2 A;  4KKS A;  5J39 A;  1QZH A;  2K03 A;  4FDB A;  1XNQ Q;  2VS1 A;  1LLR D;  1S40 A;  1EIG A;  4QUF A;  3PCO B;  1E2Z A;  2Q8R E;  3E9H A;  1X56 A;  1EQQ A;  1G29 1;  3UE0 A;  3SXH A;  2LKV A;  3A7L A;  4XT3 B;  4Q0F A;  2DJG C;  1CHQ D;  1GHJ A;  1JOK A;  1VDZ A;  4RGO S;  3WOE A;  3QWN A;  4DR2 L;  1KQS A;  2QA4 A;  1D6E C;  5M3M G;  2F0P A;  1YI2 A;  2YYZ A;  4HCS A;  2Q2T A;  1L1O C;  3MEF A;  5CV6 A;  5D3D A;  5CBA E;  4LFB L;  4P72 A;  5C6A A;  1L0X B;  5I4D A;  3J81 i;  2I5M X;  1LTA D;  2SDF A;  3FVQ A;  2VUM H;  2JA8 B;  1CSP A;  3CC2 A;  3M85 A;  3CC4 A;  1Z6H A;  3OTO Q;  4R8N A;  3MXU A;  2DNC A;  3PF5 A;  3PUW A;  4IPH A;  4LF6 L;  3MZ5 A;  2YU9 B;  3HOU G;  1SYB A;  2QIL A;  2Z6K A;  1A8V A;  1Q90 A;  1CI3 M;  2NB0 A;  3I3C A;  1DON A;  1KDB A;  3PO2 B;  3HP3 A;  3CPF A;  3GTM B;  3CME A;  4TSS A;  2YTV A;  3P20 A;  1H9M A;  3DM3 A;  5JOB A;  4RMF A;  1B9N A;  2IJ0 A;  1Y1V G;  4ULL A;  1VQI A;  1EQT A;  1WFQ A;  2WV6 D;  4AYB G;  2L4N A;  1TS3 A;  1O7Y A;  1FNW A;  4UAI A;  1NMF A;  1EEI D;  2YTX A;  1ESR A;  2ICI A;  4DR3 L;  1KD1 C;  3HG9 A;  1SR3 A;  3CF5 A;  2MFI A;  3JC6 6;  3WDN A;  3CCL A;  1A15 A;  3NWT A;  1LTL A;  1D2B A;  1YBY A;  3HS0 C;  5KYL A;  2N88 A;  3F2B A;  3HKZ B;  4A3J H;  2Z4H A;  4GN5 A;  1VQP A;  3EJI A;  4S3S A;  2G5D A;  4LF5 Q;  3BDO A;  1E2W A;  1RCV D;  3KUP A;  4JI2 Q;  3JAM i;  1SNM A;  2B2W A;  5CMD A;  1HCZ A;  1HNZ L;  1OXX K;  3GTQ H;  3S1R H;  5IP7 H;  1GUW A;  4JW0 A;  4IFD I;  2J7Z A;  4UP8 A;  5C44 H;  4YWL A;  2KEN A;  2EPB A;  2BA0 A;  3R2I A;  4JI8 L;  1T9H A;  2F3W A;  2JA9 A;  1B2T A;  1YNN D;  4I7A A;  1KXL A;  1PH6 A;  4XTC S;  4DUZ Q;  4DV6 L; 
#chains in the Genus database with same CATH homology
 4ME3 A;  2QEX A;  2VQE L;  3T1H L;  1IXR A;  3AFP A;  1U0L A;  1EWI A;  2F4V L;  1BBU A;  1Q8K A;  4QL5 A;  3NEL A;  4DV2 L;  2BH8 A;  1H95 A;  2EXD A;  1KL9 A;  2RF4 A;  3UE1 A;  2ZJP A;  4A76 A;  4DUY Q;  2KBN A;  1BVS A;  3K8A A;  3G4S A;  3HKZ G;  1N33 L;  1VQN A;  1PH1 A;  5IYC G;  4IFD G;  4A3J G;  1FJG L;  1XNR Q;  3HOX H;  4YCW A;  3F8T A;  4LF9 L;  1C0A A;  1YIT A;  1SE8 A;  3HOZ H;  3PUZ A;  4EX5 A;  3U4Z A;  5HGQ A;  2BA1 A;  1VQ4 A;  2Y0S G;  3CP0 A;  4JI0 Q;  2I5H A;  4DK3 C;  3K80 C;  1FL0 A;  5IYB H;  1NE3 A;  5IP7 G;  2JK8 A;  3L7Z C;  5GAG C;  5M5X H;  5LMU L;  3BZC A;  3CCE A;  1VQO A;  1EFW A;  3CQZ H;  1G6P A;  1K73 C;  5C44 G;  4PZ7 A;  1D8L A;  4AQY L;  1R9T H;  5HY6 A;  5FJ8 G;  3T1Y L;  4HIO A;  1MKH A;  3FKI H;  1X55 A;  2K14 A;  2L15 A;  3K81 C;  2QGQ A;  4A3F H;  3H0G H;  4JOI A;  2JA7 G;  2NVY H;  1C7Y A;  3U50 C;  4BA1 I;  2A19 A;  3KDF B;  3HOY H;  1UWV A;  4C3H H;  4L5S A;  3PV0 A;  1E7Z A;  2AMC B;  3M4Q A;  4QJF A;  4LF7 L;  3GTL H;  3M9B A;  1RL2 A;  2ZTD A;  4DV0 L;  1UE1 A;  2AWN A;  3PUV A;  4JI1 L;  1K83 H;  3CC7 A;  2IHF A;  1VQ6 A;  2WFW A;  1P8L A;  2JQO A;  1JJC B;  1Q12 A;  4LFC L;  3J7Z C;  1Q46 A;  2JE6 I;  1IBL Q;  5IE8 A;  1VQC A;  2B63 H;  5DLQ E;  4JI4 Q;  2IHE A;  4JBJ A;  2VL6 A;  1YZ6 A;  2AHO B;  2UUA L;  1V1Q A;  3HOX G;  4KLK A;  3S15 H;  1VQA A;  4YWK A;  4YHH L;  3S16 H;  2NZH A;  4X65 L;  2R92 H;  3HOW H;  4Y7N H;  1IYJ B;  1K0R A;  3HOZ G;  3BU2 A;  4BA2 I;  4APV A;  2Q2I A;  4DR6 L;  2UUC Q;  4B3T L;  2UXD Q;  3F1Z A;  5JJK A;  4LUZ A;  2R93 H;  3VDY A;  4DV4 Q;  1VQJ A;  3G48 A;  4EQ5 A;  5IYB G;  1IL2 A;  3CCR A;  4HIK A;  4JOI C;  2ZJR A;  1LUZ A;  4WJ3 M;  1K8G A;  2R7Z G;  4LFB Q;  4DV5 Q;  2CFM A;  1FGU A;  1E3P A;  1CSQ A;  4OON A;  4R4O A;  1YJ9 A;  2K75 A;  1I94 L;  5JJL A;  1KC8 C;  4OX9 Q;  4DR7 L;  2JEA I;  2IY5 B;  1SMX A;  1HH2 P;  5BR8 Q;  1YHA A;  4GLA C;  5C4X H;  1MJE A;  5AJ3 L;  3FKI G;  2VQF L;  3W1B A;  4ALP A;  2A8V A;  3UDF A;  1G51 A;  4A3F G;  1EYG A;  3H0G G;  2N8N A;  1NY4 A;  5IP9 H;  4DNI A;  1XMQ L;  2Q2U A;  3S1Q H;  3J81 c;  3HOY G;  2E2I H;  5EAY A;  4Y52 H;  4DV7 Q;  4A3E H;  1HR0 Q;  4A3G H;  4X66 L;  3GTG H;  1WCM H;  4JI6 Q;  2ALY B;  4YWM A;  2MNA A;  1GKH A;  2WAQ E;  3A0J A;  1VQD A;  5J3B A;  4A4I A;  4LF6 Q;  3STB C;  5H1S E;  1S3O A;  1B7Y B;  1GO3 E;  1TWF H;  2ES2 A;  4KHP Q;  2HHH L;  5IT9 c;  1YHB A;  3WWV A;  1N32 Q;  1JE5 A;  3G6E A;  1DGS A;  1JJ2 A;  1E1T A;  4NPS A;  2B63 G;  1HR0 W;  4JI3 Q;  4BBS H;  1VQH A;  3F2C A;  2IX0 A;  2PMZ E;  4B3S L;  2OTJ A;  2ZM6 Q;  4DPG A;  4DUZ L;  2Q2H A;  1WYD A;  2DGY A;  3KJP A;  4A3I H;  4PZ6 A;  2R92 G;  4BY1 H;  3HOW G;  2VW9 A;  4K0K Q;  4LF4 Q;  1IBM Q;  1PVO A;  1I3Q H;  5K36 G;  4B3R Q;  3D0F A;  1XNQ L;  1X3E A;  4DAY B;  2D0P A;  1XJV A;  2PQA A;  2AKW B;  3KF8 B;  5LMN Q;  4BY7 H;  4IFD J;  4JV5 Q;  2R93 G;  4PG3 A;  3CW2 C;  2JEB I;  3KYH C;  2K4K A;  4L5Q A;  4LNQ A;  4DUY L;  2B29 A;  4YY3 L;  4QY7 A;  3CCS A;  2UXC L;  5GAE C;  1HNW Q;  3TS0 A;  1XNR L;  5C4X G;  2AWO A;  4GN3 B;  2GVB A;  3RLO A;  1QUQ B;  4DR3 Q;  5FLM H;  1TWG H;  1LYL A;  2NZO A;  4DV3 L;  1V43 A;  1Q86 C;  4A3C H;  1HNX L;  4OWT B;  5C3E H;  5IP9 G;  2MQH A;  4JI0 L;  3I4M H;  4DR4 Q;  2F52 A;  4GLV B;  4DV1 L;  1K8A C;  4A3G G;  4LF8 Q;  1X6O A;  3ULL A;  1K3R A;  1WCM G;  4DAM A;  3CCJ A;  3KOJ A;  1L2F A;  1VQ8 A;  1I5F A;  4JBW A;  4HJ9 A;  3L0O A;  1N34 Q;  1AH9 A;  1ASY A;  1NTG A;  1MIU A;  1Q1E A;  3HOV H;  3J80 c;  4QQB X;  3HKZ E;  3CAM A;  2CWA A;  4GLX A;  3S17 H;  4RG1 A;  3M4O H;  3S24 A;  4BBS G;  1X3F A;  3PUX A;  3OTO L;  3M7N A;  3ZJY C;  2PI2 E;  4DKA C;  3F2D A;  2F3I A;  1LM0 A;  2K50 A;  4A3I G;  3RZD H;  1XPR A;  4NXM Q;  4MZ9 A;  4BY1 G;  4DR1 Q;  2Y0S E;  2UUB L;  1Y14 B;  5C4J H;  1XMO L;  3G71 A;  4BY7 G;  2BH2 A;  1EUJ A;  1N36 L;  3A5U A;  1OXU A;  4O0A A;  4JI5 Q;  2D0O A;  3J81 j;  4GN4 B;  5E7N A;  4A75 A;  1VQK A;  2KHI A;  1UE7 A;  3E0E A;  3I7F A;  1KAW A;  3ER0 A;  4JG2 A;  4P73 A;  3CCV A;  1PYB A;  4HIM A;  1VQL A;  3S1M H;  4UP7 A;  3K7U C;  5JEA G;  3ICE A;  3GTP H;  5FLM G;  3IRB A;  1HZA A;  4DV6 Q;  1BKB A;  2UXD L;  4A3C G;  4GKJ Q;  1PV4 A;  2OQK A;  2K5V A;  1GD7 A;  5C3E G;  2VQE Q;  4H02 A;  2K5H A;  4LUV A;  3I4M G;  3KLW A;  3T1H Q;  4IPG A;  4YCU A;  5IYD H;  1XPU A;  1E22 A;  1VQM A;  2I5L X;  1YEZ A;  2EQS A;  4DV2 Q;  1SLJ A;  4LFA Q;  1VQG A;  1FVI A;  1OXS C;  4OWX B;  3TQY A;  3PF4 A;  2IX1 A;  2NVQ H;  1X3G A;  2JA8 H;  5BR8 L;  5M3F H;  1N33 Q;  3HOV G;  2UXB L;  4UPA A;  3MXN B;  1C9O A;  4R1J A;  1QVF A;  2VY3 A;  4LF9 Q;  3HFZ B;  2UU9 Q;  4UY8 C;  1CKN A;  3ULP A;  4DR2 Q;  1QZG A;  1YHQ A;  2WB1 G;  1HR0 L;  4LUO A;  3E9I A;  3KF6 A;  4IPD A;  1O7I A;  2N3S A;  1XTD A;  3LGJ A;  4X64 Q;  4JI6 L;  2VNU D;  1CUK A;  3Q8D A;  5ELO A;  1JB7 A;  4WJ4 A;  5JJI A;  4X62 Q;  1PH4 A;  3HKS A;  4AYB E;  1VQ7 A;  2R6G A;  5LMU Q;  1QVC A;  3FHW A;  3OYY A;  4KHP L;  5IWA Q;  1I6H H;  1N32 L;  1X65 A;  3PO2 H;  4HJ8 A;  1HZB A;  4AQY Q;  3SGI A;  3T1Y Q;  3GTM H;  1IBK Q;  4BBR H;  2JA6 H;  1HZ9 A;  2NN6 I;  4QIW E;  3PGZ A;  3U58 A;  3CCU A;  1NMG A;  3A74 A;  3AFQ A;  1JMC A;  4JI2 L;  4LF5 L;  3TRE A;  3KJO A;  1PH2 A;  4K0K L;  4GOP A;  3S14 H;  1OXT A;  1E24 A;  3K0X A;  2E5L L;  4LF7 Q;  3PUY A;  2GVA A;  2CWP A;  1WJJ A;  3GO5 A;  4OXP A;  4DV0 Q;  3M3Y H;  4A3B H;  4JV5 L;  4L5R C;  2K52 A;  5IYD G;  1UE5 A;  4A3D H;  2A1A A;  4GNX A;  4KI0 A;  2OQ0 A;  4JYA L;  2VZA A;  4A3L H;  4NXN Q;  1VQ9 A;  1PA6 A;  4BXX H;  2HIX A;  4XIG S;  2KCM A;  4A93 H;  1WOC A;  2N78 A;  3GDE A;  4POG A;  2CKZ B;  2JA8 G;  2E8G A;  5M3F G;  3TS2 A;  3TRZ A;  2IT1 A;  1E1O A;  4R4C A;  4JI7 L;  1SN8 A;  3CCQ A;  2UUA Q;  1A63 A;  4B3M Q;  5M5W H;  4NB3 A;  1SRU A;  2GN5 A;  4X6A H;  1VQF A;  4A3K H;  1RIP A;  4R4Q A;  3J80 i;  1GM5 A;  4DR4 L;  1UEB A;  1Z9F A;  3EIV A;  2PQA B;  5GAH C;  3AEV A;  1HZC A;  3CCM A;  1P16 A;  4UP9 A;  1NJI C;  1ASZ A;  1A62 A;  2KHJ A;  2MO0 A;  2NN6 G;  3S1N H;  1Q1B A;  2WAQ G;  4IOC A;  2R7D A;  1PFS A;  2V1C C;  4JCV E;  1QVG A;  1N34 L;  2R7F A;  1PYS B;  2LXK A;  2D62 A;  3H15 A;  4DV6 L;  4GOP C;  4DR7 Q;  3PO2 G;  2RHS B;  3NEN A;  3AYH B;  4BBR G;  5AJ3 Q;  3I56 A;  3M4P A;  2VQF Q;  5LMN W;  3RLN A;  2N49 A;  3L2P A;  4OWW B;  2JA6 G;  3J7A 5;  4GNX C;  4C2M H;  2NVT H;  4IPC A;  3RLF A;  4C3I H;  1PHJ A;  3PO3 H;  4L5T A;  4NXM L;  4DR1 L;  5M3M H;  2I0Q A;  2WP8 J;  1KRT A;  4A3E G;  1M90 C;  1MJC A;  4A3B G;  5GRO A;  5GQO A;  2C35 B;  5JEA J;  1PH7 A;  4A3D G;  1Z47 A;  1JJG A;  3UDG A;  1B70 B;  4R4I A;  3RZO H;  4A3L G;  2K5N A;  4PMW A;  1L1O B;  3ERS X;  2HHH Q;  4BXX G;  3S2H H;  1D7Q A;  5C0X I;  3PIO A;  1J5E Q;  1L1O A;  4A93 G;  4POF A;  1EIY B;  4HJ5 A;  2PNH A;  3W5O A;  3BJU A;  3I55 A;  1OTC A;  1EIF A;  4PZ8 A;  5M5Y H;  1JT8 A;  2JA5 H;  4A3K G;  3B6Y A;  2ZJQ A;  4C3J H;  2ID0 A;  1HNZ Q;  1QZH A;  4FDB A;  1XNQ Q;  2VS1 A;  1S40 A;  2E2J H;  3HOU H;  2OCE A;  3I4N G;  2KCT A;  1A0I A;  1IBL L;  3PCO B;  4LFA L;  3E9H A;  4GKK Q;  1IZ6 A;  4DR5 Q;  1X56 A;  3K7A H;  2HIV A;  4P71 A;  3JAM c;  1EQQ A;  4YY3 Q;  2DUD A;  2OTL A;  4JI4 L;  1G29 1;  3I4O A;  3UE0 A;  2UXC Q;  3TEH B;  1BBW A;  4JI8 Q;  1VQ5 A;  2UU9 L;  3S2D H;  1SRO A;  1Q82 C;  2XTI A;  4JBM A;  4DR2 L;  1UE6 A;  2FXQ A;  4MNO A;  4DV3 Q;  1KQS A;  1YIJ A;  1M1K C;  1HNX Q;  3FP9 A;  2UUC L;  3PO3 G;  3CPW A;  4YCV A;  1AE3 A;  5C0X G;  2QA4 A;  5M3M G;  1Y1V H;  4IJH A;  1B8A A;  4X64 L;  1YI2 A;  4R4T A;  1TXY A;  2YYZ A;  4KHZ A;  3UDI A;  4DV1 Q;  4DV4 L;  1Q81 C;  4X62 L;  1L1O C;  3MEF A;  2Q2T A;  2F4V Q;  2EIF A;  1YVC A;  3NBH B;  2R7Z H;  2H5X A;  4JBK A;  1Y1W H;  4P72 A;  4DV5 L;  4LFB L;  2ZTE A;  3J81 i;  4OO1 I;  2I5M X;  5IWA L;  4OX9 L;  1L0W A;  2ATW A;  3H3V H;  1K9M C;  3BZK A;  2VUM H;  1IBK L;  1CSP A;  4HJA A;  3CC2 A;  2ASB A;  2NVX H;  1FJG Q;  3M85 A;  3CC4 A;  1CKN B;  3OTO Q;  4AH6 A;  4P75 A;  1VQB A;  1AE2 A;  3KDF A;  3KF6 B;  1VCI A;  4DV7 L;  2WB1 E;  2E2H H;  2JA5 G;  2LXJ A;  2UUB Q;  1PH9 A;  3H3V I;  3PF5 A;  3PUW A;  1XMO Q;  2CQO A;  3GTK H;  2B3G A;  4IPH A;  3OW2 A;  4LF6 L;  2YU9 H;  1EQR A;  3EN2 A;  3UDX A;  2HQL A;  1XPO A;  1PH3 A;  1N36 Q;  3HOU G;  3CMA A;  4NXN L;  2Z6K A;  1A8V A;  3U4V A;  4JI3 L;  3CPF A;  3EBE A;  3GD7 A;  1KIX A;  3KFU A;  3RNU A;  3CME A;  2ZM6 L;  2YTV A;  1Q7Y C;  4B3M L;  4OO1 G;  4GOP B;  3DM3 A;  3ULJ A;  5FLX c;  1KHI A;  4LF4 L;  1IBM L;  4RMF A;  2OWO A;  4B3R L;  3D31 A;  2JJQ A;  5LMN L;  1Y1V G;  4GNX B;  1W3S A;  1HJP A;  1VQI A;  1WFQ A;  4JI1 Q;  4AYB G;  4AIM A;  2RHQ B;  1PH8 A;  4LFC Q;  1U5K A;  2YTY A;  5GAD C;  1Y1W G;  1S72 A;  4TQU S;  2RCN A;  4A3M H;  1NMF A;  3DLL A;  2Z0S A;  2YTX A;  1HNW L;  1X9N A;  3PIP A;  2VUM G;  4LW1 A;  4DR3 L;  2UXB Q;  3W1G A;  3RR5 A;  1KD1 C;  1YJW A;  3I4N H;  1SR3 A;  4YHH Q;  3CF5 A;  2MFI A;  1J6Q A;  3JC6 6;  4X65 Q;  3CCL A;  3CD6 A;  1SFO H;  3RN2 A;  2Z6K C;  2HT1 A;  3STB D;  1N9W A;  1YNX A;  2XGT A;  4O2D A;  4B3T Q;  4TVA B;  1W2B A;  1LTL A;  4LF8 L;  4DR6 Q;  4JC0 A;  4P74 A;  1EOV A;  1PH5 A;  4DK6 C;  1YBY A;  1NBW A;  4IO9 A;  1GVP A;  1I50 H;  2ZTC A;  3F2B A;  1I94 Q;  5IYC H;  1J5E L;  4A3J H;  4LWC A;  4GN5 A;  1VQP A;  2LSS A;  4HJ7 A;  4LF5 Q;  3GTO H;  4J15 A;  4JI2 Q;  3JAM i;  1XMQ Q;  2PI2 A;  1V9P A;  2YV5 A;  3NEM A;  1HNZ L;  1WI5 A;  1OXX K;  1VQE A;  2E5L Q;  3GTQ H;  3S1R H;  3RN5 A;  4X66 Q;  5IP7 H;  4IOA A;  4IFD I;  1TWH H;  4UP8 A;  3GTJ H;  3AQQ A;  1TWC H;  3I2Z A;  1KRS A;  4JI5 L;  5C44 H;  1X54 A;  1N8R C;  4GKK L;  4DR5 L;  3PSI A;  4YWL A;  4JYA Q;  1VS0 A;  2KEN A;  1CKO A;  1TWA H;  5FJ8 H;  2BA0 A;  4QGU A;  5C0X J;  4A3M G;  2CCZ A;  4JI8 L;  3CXC A;  2MO1 A;  3A5Z B;  1T9H A;  2JA9 A;  5ELN A;  2JA7 H;  1CKM A;  4IJL A;  4MTN A;  1OXV A;  4B3S Q;  5IY0 A;  4JI7 Q;  1PH6 A;  1KXL A;  4XTC S;  4GS3 A;  4DUZ Q;  1QUQ A;  1YJN A;  4HID A;  4GKJ L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...