5M5WH

Rna polymerase i open complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
144
structure length
134
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase I subunit RPA190
publication title Molecular Structures of Transcribing RNA Polymerase I.
pubmed doi rcsb
total genus 16
structure length 134
sequence length 144
ec nomenclature
pdb deposition date 2016-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m5wH00
5DLQE 4LF4L 4B3RL 3E9HA 2UXDQ 2ALYB 1PH3A 4GKKL 3K80C 1XMQL 3HKZE 1C9OA 1AH9A 1KRSA 1HR0W 1Q46A 2NVTH 1VS0A 1AE2A 4A3EH 1YITA 1N33Q 3M7NA 3TRZA 2E2HH 3RZDH 3SGIA 4DV5Q 4LF7L 3GTLH 1K3RA 2PI2A 1YJ9A 2D62A 1XNQQ 4PZ8A 1VQKA 1UE6A 3M9BA 3PF4A 1B70B 3OYYA 4NB3A 4X65L 1QUQA 2GVAA 2JA7G 4MNOA 5IYCH 2F52A 4LF6Q 2B29A 4L5SA 4A3BH 1TWFH 2K5VA 5C44G 4JI4Q 1L1OB 1X3EA 5HY6A 1R9TH 1LYLA 3NELA 1X9NA 2MNAA 2AMCB 1N34L 4DUZL 3S15H 2A1AA 4GLAC 4X62L 2HQLA 2Z6KA 1VQIA 2A8VA 1CKNA 4IOAA 4LF4Q 4B3RQ 3K7AH 3HFZB 2OQKA 4DNIA 1KXLA 2VZAA 4GKKQ 4B3ML 1P16A 3K8AA 3G71A 1XMQQ 2JQOA 3UDFA 5LMNW 1YBYA 3J81j 2WP8J 3GO5A 1G51A 1VQ9A 4B3SL 2OTLA 2I5HA 1E24A 2NN6G 4LF8L 2BA1A 2ASBA 3CXCA 4ALPA 1V43A 3PUVA 4JOIA 4QL5A 4JI5L 1PH9A 4LF7Q 4IFDJ 4IFDG 5H1SE 2QEXA 4YY3L 1E1TA 3HOYG 1X6OA 4DV0L 3L2PA 2R93H 4NXML 4HJ9A 2JA8G 1PV4A 4X65Q 2PMZE 1G291 2FXQA 1KHIA 2UU9Q 4DV2L 4A3DG 2ID0A 3K7UC 4YWLA 4RG1A 1WI5A 4A3GH 1CSPA 2N78A 1WOCA 4GN4B 3CC4A 4BXXG 3D31A 2I0QA 1L1OC 3I4NG 3HOXG 3HOZG 1N34Q 1VQBA 4K0KL 4DUZQ 3B6YA 4X64L 4X62Q 4L5TA 4BY1H 3HOWH 4HJAA 3HKZG 2GN5A 3S2DH 5FJ8G 1PH4A 2L15A 2R6GA 1EQRA 3BZCA 1NMGA 3HKSA 5M5XH 1XNRL 2F4VL 2JEAI 3PO2H 5GAEC 2VUMG 2UXCQ 1W2BA 4B3MQ 4OX9L 1YHQA 4A4IA 2LSSA 4A3JG 4JI6L 1CKMA 1NBWA 3D0FA 4A93H 4B3SQ 4LF8Q 1Y1VG 4LFAL 4LFCL 1SFOH 2QGQA 1PFSA 1IBKQ 4JI5Q 1L2FA 3JAMc 4XIGS 2JA5H 1VQHA 1VQ8A 1J6QA 4YY3Q 4DV0Q 3RZOH 1O7IA 5IE8A 2Q2HA 3PF5A 2KHIA 4R4QA 3PGZA 1Y1WG 5FLXc 5IYBH 1VCIA 4DV2Q 5GQOA 3WWVA 5GROA 1XJVA 2ES2A 4R1JA 1YNXA 4OO1G 3J80i 3UDXA 1VQ5A 3GTGH 4PG3A 3CMEA 1BKBA 4BBRH 4J15A 1BBWA 3CC7A 3UDGA 4K0KQ 2MO1A 3E0EA 4X64Q 3PV0A 4MTNA 4JI8L 4DAYB 4KLKA 3S1MH 1HZBA 1XNRQ 5EAYA 3U4ZA 4DV7L 2F4VQ 3S2HH 4OX9Q 4HIDA 1PH1A 4BY7H 2NZHA 4LNQA 4B3TL 1K0RA 3CQZH 4JI6Q 1JT8A 2IT1A 4UP7A 1EFWA 3KLWA 5E7NA 4IPGA 4A3IH 2B3GA 4L5RC 1VQEA 4LFAQ 4IO9A 1SRUA 1V9PA 5C4XG 4GN3B 1D8LA 3ER0A 1S3OA 5LMUL 4C3IH 2RHQB 2WFWA 1LM0A 2CCZA 1Q8KA 4YWKA 3W1BA 5BR8Q 4OWTB 4GOPA 5GADC 3KJPA 1YEZA 4BA2I 2DUDA 4P71A 1HJPA 1XPUA 3ULPA 3T1YL 3FHWA 2XTIA 1QVFA 2R7ZG 4UP8A 1W3SA 1MIUA 1KQSA 3GTOH 1OXUA 2VQFL 3CCMA 3I4OA 2E2IH 1EWIA 5JJIA 3W1GA 3OTOL 1QZHA 4A3FG 5M3FG 4R4TA 3HOVG 3HOYH 4JI8Q 4X6AH 1GD7A 2ATWA 1N36L 1X56A 3CCVA 4DV7Q 1UE5A 4MZ9A 4R4CA 2KCMA 1WYDA 1YJWA 1YJNA 2BA0A 1JMCA 3CCSA 4A3DH 4B3TQ 1OTCA 4BBSG 1HH2P 1N9WA 1X54A 2AHOB 3PSIA 5IP9H 1YZ6A 2E8GA 4TVAB 1SE8A 3HOZH 2IHEA 2YTYA 2PI2E 1SR3A 3CCUA 2LXKA 4DK6C 5LMUQ 4TQUS 4C3HH 2Q2TA 2R92G 4PMWA 1PH2A 3I55A 4GNXA 1VQPA 1IBMQ 2JJQA 1KRTA 1D7QA 2VUMH 3CF5A 1A63A 3GTQH 3ULJA 4GLVB 2UU9L 4DR7L 3NEMA 3M85A 4WJ3M 2A19A 3T1YQ 3FKIH 3J81i 1PH6A 4O0AA 1WCMG 2EQSA 4JI1L 1MJCA 2VQFQ 4A75A 2KCTA 2VS1A 2HIXA 3M4PA 4JI7L 1VQMA 3RLOA 4HIMA 4LFBQ 3PCOB 5JJLA 4A3CG 2BH2A 3NBHB 3OTOQ 4DV6Q 2E5LQ 3CCQA 3PIPA 1VQFA 3KYHC 5J3BA 4HJ5A 1XTDA 4FDBA 4A3KG 1N36Q 4LUVA 3AYHB 1FGUA 2UXCL 5FLMH 2JA9A 4JBWA 1IYJB 5M3MG 1IBLL 3STBC 2PQAA 5IP7H 2IX0A 3TS0A 1YIJA 2HT1A 3U50C 1X3FA 3A5UA 4GN5A 2I5MX 3J7A5 4APVA 4DR6L 4DR4L 4JI3L 1IBKL 2CFMA 2GVBA 4PZ6A 2UUCQ 2ZJRA 3GTKH 1BBUA 3KF6B 3UDIA 1E3PA 1SROA 3A5ZB 1RL2A 2LXJA 2HIVA 3CPFA 4DPGA 4POFA 5GAHC 5AJ3L 3F2DA 4DR2L 2K52A 2KBNA 4A76A 3H15A 3F2BA 2HHHQ 4JC0A 2OTJA 4DR7Q 1WJJA 1IL2A 2AWNA 1VQDA 2RF4A 3CCEA 2NVXH 1HNWQ 4POGA 3I4MG 2NVYH 1A8VA 2ZTCA 4A3LG 1U0LA 3CP0A 2UXBQ 3CAMA 4JI1Q 4JI7Q 2B63G 1UEBA 1X65A 2V1CC 3AFPA 1I94L 5C4XH 1VQ6A 3CW2C 1CSQA 4IPDA 1A62A 5IWAL 1YHBA 5JJKA 2I5LX 3GD7A 2N49A 1K9MC 4HJ8A 1Q81C 4QIWE 3PO3G 2WAQE 1HR0L 2R7ZH 1M1KC 1IBLQ 3KDFB 4DK3C 4QGUA 5IYDG 1YVCA 3CCLA 1UWVA 1NE3A 1XPOA 2ZTEA 4DR6Q 1N32Q 1JE5A 4DR4Q 3DLLA 4JI3Q 3BZKA 1PVOA 5M3FH 1ASZA 3GTPH 1WFQA 5AJ3Q 4LF9L 2MFIA 5BR8L 4DR2Q 1HZ9A 1L1OA 1Z47A 1HZCA 3EN2A 4GLXA 2RCNA 4YWMA 2H5XA 4JG2A 1VQJA 4X66L 4JI2L 2DGYA 4C3JH 5IYCG 2NVQH 4A3BG 4OXPA 3BU2A 4HJ7A 1I94Q 1IZ6A 3KFUA 4JBMA 1JB7A 4AIMA 1HNXL 1HNZL 2BH8A 4AH6A 5IWAQ 2OCEA 4R4IA 2JA7H 4AYBG 1LUZA 2CWPA 4P73A 5LMNL 4LF5L 3J81c 3PUXA 3AQQA 3S16H 5C44H 1HR0Q 3W5OA 1T9HA 1UE7A 3H3VH 1X3GA 4EQ5A 2AKWB 1N32L 1DGSA 1Z9FA 4XTCS 5C3EG 1LTLA 5ELOA 3K81C 1QUQB 4RMFA 2YTXA 4LUOA 2KENA 4LWCA 1EIFA 2R7DA 3I2ZA 4P72A 4LF9Q 3HOUG 4OONA 1IBML 2K5HA 4Y7NH 4P75A 3CCJA 2R93G 1SMXA 2MO0A 5M3MH 1SN8A 4DR1L 4HIOA 1E7ZA 1TWHH 4EX5A 4X66Q 4JI2Q 3CCRA 4LFBL 3ZJYC 1CKNB 3KJOA 4DV6L 2E5LL 4A3GG 3G48A 1A0IA 1K8AC 3TEHB 2Q2IA 3ULLA 2JA6G 1M90C 2WAQG 3A0JA 1HNXQ 1HNZQ 3KDFA 2E2JH 2JA8H 2WB1E 3HOWG 3CD6A 1GKHA 3L7ZC 4DUYL 1OXSC 3TQYA 4OWXB 5LMNQ 4QY7A 4LF5Q 3Q8DA 1JJCB 3PO2G 3EIVA 2K50A 1J5EL 3TS2A 4P74A 4BXXH 1Q86C 3GDEA 3RR5A 2VW9A 4C2MH 1SLJA 3H0GG 4AQYL 2JEBI 3ERSX 2Y0SG 3HOXH 2OQ0A 4JI0L 3FP9A 2MQHA 2UUCL 1Q82C 3I4NH 4DV4L 2D0PA 5C0XI 1VQ4A 5FJ8H 4IPHA 1NMFA 3UE0A 1VQLA 5K36G 3DM3A 4DR3Q 2HHHL 1GVPA 5M5WH 1YI2A 3G6EA 2ZJPA 4A3JH 3PO3H 3PUWA 1VQGA 3I7FA 4O2DA 4DR1Q 2UXBL 1EUJA 3STBD 4GKJL 5IYDH 3ICEA 1PYBA 1Y1VH 5IYBG 1L0WA 1KD1C 2YU9H 2QA4A 2CKZB 2YTVA 2Z6KC 2VQEL 4NPSA 1NY4A 1IXRA 3RNUA 4BBRG 4A3MG 1KIXA 1PH8A 1EQQA 4JYAQ 4PZ7A 4YHHL 3J7ZC 3I56A 3VDYA 2N3SA 4DUYQ 1Y1WH 1JJ2A 3LGJA 3M3YH 3J80c 3U4VA 4YCUA 1HZAA 1J5EQ 4GS3A 4JV5L 4AYBE 4JOIC 1CUKA 1VQAA 4AQYQ 4BY7G 1MKHA 1PA6A 4JI0Q 1Q1BA 3S24A 2YV5A 3F1ZA 4DV4Q 3KF8B 2EIFA 2R7FA 1E1OA 4A3IG 3GTMH 1TWAH 4KHPL 1I5FA 4HIKA 2AWOA 3F8TA 1I50H 1ASYA 1X55A 4KI0A 3AFQA 3EBEA 4ME3A 3M4QA 2K4KA 1EYGA 1S72A 2UUBL 4UY8C 4JBKA 4GKJQ 3PIOA 4Y52H 4IJLA 1VQOA 2IX1A 5C3EH 2WB1G 4JCVE 3UE1A 1FVIA 3RLNA 2VQEQ 4UPAA 1OXXK 3T1HL 1VQ7A 1CKOA 1XPRA 3HOUH 4DV1L 4NXNL 2PNHA 4DR5L 4YHHQ 1EOVA 5HGQA 3BJUA 4BA1I 2VY3A 3RN2A 1KL9A 4R4OA 2ZJQA 1TWCH 1AE3A 3CC2A 4YCWA 3NENA 2CQOA 2IHFA 1E22A 3PUYA 3G4SA 4JV5Q 2D0OA 4GOPB 3AEVA 5M5YH 4H02A 4A3EG 4A3FH 1S40A 2IY5B 5IP9G 1G6PA 3HOVH 4KHPQ 2RHSB 5IY0A 2JA6H 3H3VI 2VNUD 4DV3L 2UUAL 1OXTA 3IRBA 2Y0SE 2JK8A 2ZTDA 1QVCA 1B8AA 4IPCA 3S17H 3OW2A 1EIYB 3M4OH 1BVSA 4BBSH 2UUBQ 3F2CA 1FL0A 3E9IA 3FKIG 3H0GH 3TREA 2K14A 1RIPA 2VL6A 2C35B 3T1HQ 1PHJA 2R92H 2NN6I 1K73C 4DV1Q 1GO3E 1PH7A 4NXNQ 4DR5Q 3RN5A 3U58A 3S14H 1YHAA 2OWOA 2EXDA 4IFDI 2JE6I 4DAMA 4NXMQ 3PUZA 1WCMH 3KF6A 5IT9c 1I3QH 2YYZA 5FLMG 5C0XJ 2ZM6L 3S1RH 5C0XG 4IJHA 1OXVA 5IP7G 4GNXB 1K83H 1NJIC 4A3CH 1I6HH 4YCVA 4QQBX 4GOPC 2NZOA 1Q12A 3KOJA 1N8RC 4DV3Q 4A3MH 1XMOL 2UUAQ 2CWAA 4QJFA 4IOCA 3MEFA 4UP9A 1U5KA 3JAMi 4DR3L 4A3KH 1FJGL 1HNWL 1JJGA 2N8NA 2Q2UA 2UXDL 3MXNB 5C4JH 1MJEA 3S1NH 3CPWA 1H95A 1GM5A 3GTJH 4WJ4A 4OWWB 1Y14B 1N33L 1PYSB 5JEAJ 2K75A 3S1QH 1PH5A 3CMAA 4DV5L 1C7YA 1NTGA 5JEAG 4LFCQ 2PQAB 4KHZA 4BY1G 4JYAL 1V1QA 1XNQL 4L5QA 5ELNA 3JC66 1K8GA 3I4MH 1KAWA 2K5NA 4LW1A 4DKAC 1Q7YC 1KC8C 2XGTA 5GAGC 1VQNA 4A3LH 1TWGH 4LF6L 2KHJA 3A74A 2ZM6Q 1Q1EA 4LUZA 1C0AA 1TXYA 4JI4L 2B63H 4A93G 1P8LA 1VQCA 4JBJA 1UE1A 3K0XA 1B7YB 4OO1I 2F3IA 4GNXC 1QVGA 3L0OA 1XMOQ 2Z0SA 1QZGA 2JA5G 3RLFA 1FJGQ
chains in the Genus database with same CATH superfamily
2BOSA 4NMZA 2ALYB 1PH3A 2RCFA 4R9WA 2C9OA 1XMQL 3HKZE 1S5ED 2NVTH 1AE2A 2HDMA 3SGIA 1PZJD 4DV5Q 4NDXA 2M2LA 1K3RA 1GHJA 2BCOA 4PZ8A 1WTVA 2EJFC 1SNCA 3C1EA 3OYYA 1SYCA 1RTOA 5D3DA 5IYCH 2F52A 1X32A 2RVLA 3OIPA 1NR2A 4A93B 1L1OB 1X3EA 1LYLA 5JPMC 1TIID 1SFOB 1TU2B 4X62L 1PFBA 1SYBA 2H4OA 1VQIA 1CKNA 5NUCA 4CDCC 3K7AH 4DNIA 4B3ML 1IYVA 3G7LA 1AZQA 1XMQQ 3UDFA 1YBYA 1G51A 3V05A 4KKSA 1RODA 1E24A 2NVQB 1LT6D 3CXCA 1T5EA 1V43A 4JOIA 1IHZA 3SR1A 5ELFA 3VYUA 4YY3L 1X6OA 4DV0L 4QUFA 1PV4A 2BDNA 2FXQA 4K14A 1MGSA 1QJOA 2F0SA 2UU9Q 2ID0A 4GN4B 4QUCA 4R8NA 1DYQA 3SK5A 3Q6SA 3B6YA 3HOWH 4X62Q 2FJ2A 4DK1A 2GN5A 3U9OA 3MA2B 1PTOB 5K5PA 1XNRL 2UXCQ 4B3MQ 1JICA 1K3BC 1NBWA 2F0MA 2IL8A 1H9KA 1RKNA 4LFAL 3HRZC 1L2FA 4XIGS 2JA5H 1HTPA 1EY5A 3D8GA 4YY3Q 4CKCA 4DV0Q 3RZOH 2PZTA 5IE8A 4X3UA 2IX3A 1S4ZA 3PF5A 2E2JB 3MFYA 2QEJC 1JOOA 1Y1WG 2ES2A 1VMCA 1YNXA 3ND9A 4WORA 4BBRH 4J15A 2EY2A 1BBWA 1FNVA 1HZBA 1XNRQ 2NYZD 1AW7A 2F0LA 1AN8A 2NZHA 3P7JA 3CQZH 1JT8A 2IT1A 4UP7A 5E7NA 4A3IH 2B3GA 1VQEA 1DOLA 4LFAQ 1BUVT 1V9PA 1BBXC 2L0CA 3ER0A 1S3OA 5LMUL 3H91A 2CCZA 4YWKA 2PO4A 4OWTB 1U4LA 4BA2I 1XPUA 3ULPA 2XTIA 1OXUA 4FYDA 1FR3A 2IWHA 3OIQA 1ZYRC 2DY8A 5ELEA 1QZHA 4A3FG 5FLXL 4X6AH 1S5BD 5C5LA 5CMDA 1EEID 2BA0A 2WACA 4OIKA 1ONLA 1B1ZA 3OMCA 3PSIA 4RKLA 2RKSA 1YNND 4HMIA 1SE8A 4G4KA 2PMZB 1K8OA 5LMUQ 1SJHD 1VQPA 2F3WA 2B2UC 3EFXD 3M85A 2R7ZB 3J81i 2EE1A 4A75A 2VS1A 2HIXA 1VQMA 5JJLA 5M3FB 3HOVB 5J3BA 1XTDA 4EQPA 4KKTA 1FGUA 5FLMH 3Q23A 1IYJB 4I65A 1WTPA 1YIJA 1X3FA 3A5UA 1G6ZA 3E3XA 2B2UA 4APVA 4DR4L 4JI3L 4PZ6A 3NWTA 4DAVA 1BBUA 1A6XA 1Y8PB 1DD2A 1RL2A 4IURA 3F2DA 2K1BA 2R92B 4A76A 3F2BA 2HHHQ 4JC0A 2OTJA 2FMMA 4BWGB 1R4QB 2UXBQ 1O7LA 5JEAH 1X65A 3GV6A 1STEA 3SK4A 1VQ6A 1Q3LA 3P75A 1A62A 2A5HA 2I5LX 2O2LD 1K9MC 1Q81C 2SOBA 4PQXA 4MTKA 4QIWE 3PO3G 5M3MB 4CKBA 2RSOA 5C4JB 3NXWA 5ISRA 5EKIA 4DK3C 4QGUA 1KNEA 3CCLA 3BYYB 1NE3A 2ZTEA 1CM9A 4DR4Q 4JI3Q 2Z4IA 2WIIB 4ILWA 2Z6BA 2HCCA 2KCCA 1BXTA 4IUNA 2MFIA 5BR8L 4XDXA 1HZ9A 3S9WA 1L1OA 1HZCA 3EN2A 2H5XA 3I4MB 4K2LA 2DJGC 1TWGB 4A3BG 1TKWB 3EA6A 2IPKD 4OXPA 3TZDA 3H3VC 2G9HD 1IZ6A 4PNYA 1XX8A 4JBMA 2BH8A 1LUZA 4A3JB 4P73A 3J81c 3KLSA 3PUXA 3AQQA 4X3SA 1HA6A 5KNBA 1X3GA 4DF7A 1DGSA 2NVTB 2EY5A 3K81C 2AQ3B 2PZWA 5DM63 4OONA 1STAA 2EYJA 2R93G 4M8AA 2HD3A 1W6KA 4DR1L 3QR8A 3BVGA 4LFBL 4HSPA 3A54A 3KJOA 2EZVA 4ID6A 1M90C 3LX0A 4DU9A 4RAUC 3L7ZC 3K7AB 1U9RA 1JJCB 2K50A 3TS2A 2LMCB 1Q86C 2K33A 1SLJA 1K0SA 2Y0SG 3FP9A 5C3EB 1Q82C 4DV4L 1EL0A 1KABA 3VYTA 4ME5A 2Q8RE 5K36G 3DM3A 1EY9A 3T51B 5M5WH 5I2XA 2L4NA 3PQIA 3G6EA 2ZJPA 3J81E 2D2CC 1TWCB 3I7FA 3KUPA 4UHVA 2E75C 4DR1Q 2B2WC 5IYDH 3TP5A 3A8JE 3CRLC 5IYBG 1ENAA 1KD1C 2Z6KC 2K5DA 2VQEL 1S5DD 1IXRA 2JA6B 1GUSA 2WAQB 1PH8A 1EQQA 3HOWB 4PZ7A 3VDYA 1Y1WH 1JJ2A 3BG3A 1TS4A 2X6GA 4XQQA 3M3YH 5JVH3 4YCUA 1EY7A 3K6OA 5C3WA 3BDCA 1CUKA 4BY7G 3LWUA 2A6ED 3S24A 4G7ZC 4DV4Q 4IN3A 4RFBA 1E1OA 2R7FA 4KHPL 3BS1A 3L9AX 3HG9A 3OSOA 1X55A 4KI0A 5I6WA 3EBEA 3RZOB 1U4MA 5EQ0A 5C3XA 4R8IA 1EY0A 4IJLA 2IX1A 5KEEA 2WB1G 1H9SB 1FVIA 3NWSA 3RLNA 2VQEQ 2KA7A 1VQ7A 4BBRB 1XPRA 3HOUH 1F9QA 4NXNL 1SMYC 2LY7A 1EOVA 3BJUA 2VY3A 3DM1A 1KL9A 2ZJQA 2EXZA 1NR4A 1AE3A 2HQEA 3CC2A 4YCWA 3C46A 3PUYA 1CK1A 2M00A 4H02A 4H44C 4A3FH 5IP9G 4A3IB 4KHPQ 2RHSB 1MSHA 1OXTA 2Y0SE 2JK8A 4XYOA 1LT5D 4S3SA 3OW2A 3TDQA 4FF1A 3F2CA 5EPKA 3NK9A 3H0GH 3IFTA 3I3CA 1I4PA 2NN6I 3SEBA 1WTWA 4NXNQ 1UAPA 1GUNA 2QW7A 1YHAA 4DNRB 3SVMA 5DEHA 2YYZA 1SNDA 2ZM6L 1EY4A 4KY7A 3S1RH 2K05A 1I6HH 4GOPC 1PTOF 1Z7TA 4QJFA 3AMUA 3MEFA 1JJGA 1FJGL 2UXDL 4ZLTF 4WJWA 1MJEA 3OW7A 1VF7A 1EY6A 1Y14B 2F0OA 2K7VA 1ZXTA 1GUTA 2JXMB 3D6CA 1PH5A 2EY6A 1NTGA 1V1OA 5I6YA 3VR6A 4AYBB 3OPOA 3JC66 1KAWA 2Z1CA 1EY8A 5FKAC 3M4YA 4LF6L 2KHJA 2ZM6Q 4DN4M 4LUZA 1C8CA 1P8LA 3TP8A 3K0XA 4GNXC 1YNJC 3ND8A 2Z0SA 5IT9L 2JA5G 3J7YW 1FJGQ 4C1NI 4LF4L 4B3RL 4FNFA 2UXDQ 4GKKL 1PDQA 1Q46A 2PW5A 4IQZA 4A3EH 3TRZA 2E2HH 1UUPA 1XWEA 4LF7L 4BY1B 3N6RA 2D62A 4KMUC 1B70B 4NB3A 4CDFC 2GVAA 2JA7G 4LF6Q 4A3BH 2B29A 3QIAA 4OELB 1W6JA 5IGEA 4OIJA 1ZKOA 5HY6A 3NELA 4CJ0B 3OHXC 3J7AF 2AMCB 1N34L 1BCPC 4DUZL 2A1AA 4GLAC 5C4HA 1SE2A 4LF4Q 4B3RQ 1KXLA 2OQKA 4G57A 2VZAA 4GKKQ 3K8AA 4QCLA 1SSOA 2JQOA 5LMNW 2X6LA 2WP8J 4F88A 3A7AB 2B8GA 1FYCA 3GTGB 2ASBA 1RD9D 4ALPA 2JYOA 4KD3A 4LF7Q 1PH9A 4RHSA 1U4RA 5H1SE 3I73A 5KYLA 2R93H 1PLFA 4NXML 4HTHA 1A3TA 4IUQA 2R3ZA 1G291 2HDLA 2ZT9C 3K7UC 4K6LA 4RG1A 1CSPA 3I91A 1KDCA 3D31A 2B2VC 1N34Q 1VQBA 2EJGC 4K0KL 4DUZQ 3S2DH 3VR5A 3HKZG 4HJAA 1PH4A 2L15A 5M5XH 4MHEA 2F4VL 2JEAI 5EKKA 2B2YA 1F2YA 2QF7A 2LSSA 4A4IA 4JI6L 2EPBA 1F2LA 5A35A 3DMUA 2QGQA 1PFSA 5K36H 2SNMA 1B44D 1WTHA 4I7ZC 1CHPD 1WTXA 1GXDC 1ML0D 1PRTC 2Q2HA 1B4OA 2KHIA 3PGZA 2NWGA 3NSWA 5FLXc 5IYBH 4HSVA 3P1HA 3NTKA 5GQOA 4R1JA 1VQ5A 5E4WC 3CMEA 2EVBA 3WOEA 1LLRD 2N88A 4K0KQ 5CV5A 1CZGA 2MO1A 1HA5A 3E0EA 4FP5D 4KLKA 3S1MH 1PZKD 1H9SA 1RJTA 5EAYA 1ENCA 2F4VQ 3S2HH 3HS0C 3Q24A 1H9JA 1SNQA 1M4VA 1V8QA 1PH1A 1EEFD 4BY7H 2Z8LA 4LNQA 4B3TL 5C4ZA 4JI6Q 4X3TA 2KCNA 2F0FA 4IO9A 2BDOA 1SRUA 1EYCA 4FXGC 5E3FA 2WFWA 1XXGA 1Q8KA 4M1UB 1M8AA 4CDDC 1QOHA 2NB0A 3KJPA 2K04A 4P71A 3RUZA 4H7BA 5COYA 1GHKA 1Y1WB 3JAML 1KQSA 1MIUA 3GTOH 4F8MA 1I4QA 2E2IH 1EWIA 5JJIA 3W1GA 3GTKB 1CFMA 3HOYH 1GD7A 1STBA 3CCVA 3Q0AA 4R4CA 4K8IA 3K5LA 1YJWA 3CCSA 4A3DH 5FLXE 2NVYB 1JWSD 4B3TQ 4BBSG 1HH2P 2AHOB 5IP9H 1DJRD 2E8GA 1LV9A 4H0LC 3HOZH 3T56B 1NNXA 2J4XA 2EJMA 4DK6C 2Q2TA 4HMJA 2F0QA 1PH2A 2C5CA 2D9UA 2VUMH 2PQEA 3GTQH 3TP6A 3ULJA 2UU9L 3NEMA 2A19A 5CBEE 1LTBD 1PH6A 4O0AA 1WCMG 4KK7A 1MJCA 4ZKCB 2A68C 2KCTA 2QILA 3RLOA 4HIMA 4A3CG 3NBHB 2E5LQ 4A3FB 4K8JA 4ZUIA 4RA8A 3KYHC 4IUVA 1D5MC 3AYHB 4LUVA 2UXCL 2HCIA 4F7XA 1WTRA 3R2IA 1BCPF 1IBLL 3STBC 3TS0A 3FVQA 3U50C 3EQLC 2I5MX 3J7A5 1A3UA 2ZJRA 3MXUA 3A5ZB 2HIVA 5GAHC 2K52A 2KBNA 1TY0A 1WJJA 3S16B 4POGA 1A8VA 4A3LG 1U0LA 3CP0A 1EQVA 4ZAIA 1UEBA 1I6HB 3HP3A 5C4XH 1LTGD 1CI3M 5DAUA 3PMFA 5FK9C 5CV4A 2F03A 2RQXA 1HR0L 1M1KC 1IBLQ 5IYDG 3GP7A 4FO2A 1UEAB 5G3LD 3DLLA 2V4DA 4EVOA 5FO9B 1Q8IA 3GTPH 1WFQA 3DUZA 4DK0A 3HEJA 2KJXA 1WD1A 2RCNA 4YWMA 3BDLA 2K01A 1MI2A 4X66L 4C3JH 5IOCA 1PRTF 3KFUA 2SDFA 4AIMA 3I4LA 1HNXL 1LTSD 4R4IA 2WKDA 2JA7H 3PO3B 4LF5L 1EYDA 5I9PA 5JAVA 1HR0Q 1RHPA 2F0IA 2AKWB 4FF2A 1HTLD 4V190 4XTCS 1LTLA 5ELOA 2L1BA 3I8ZA 2E2HB 2A6HD 2CH4W 1EIFA 3I2ZA 3HOUG 2RDHA 3VR2A 2DN8A 2K5HA 4YIJA 4Y7NH 1T5XD 1SMXA 3W2DA 2MO0A 1A3VA 1E7ZA 2AUKA 2L55A 4OGQC 4X66Q 4A3BB 3ZJYC 3R8BA 4RHRA 4A3GG 3G48A 1SXTA 1DCZA 3GTMB 1FGBD 1HNXQ 3KDFA 3CD6A 1GKHA 2KEEA 4LF5Q 4QY7A 3L3OC 3Q8DA 3PO2G 1QILA 3H0GG 2L12A 2OQ0A 3X3NA 2MQHA 5C0XI 1E0BA 1HQMC 1SYDA 3LNNA 3UE0A 2WV6D 4DAPA 1H9MA 2HHHL 4K5XA 1GVPA 1YI2A 2R93B 4QF4A 2CHBD 4O2DA 2UXBL 1PFMA 5E4XA 4ZK9B 1SYEA 2YU9H 2CKZB 5EGTA 5M5YB 1LABA 4NPSA 1NY4A 3RNUA 4LK1C 3S2DB 4JYAQ 1D1KA 4YHHL 3J7ZC 3M4OB 2N3SA 3QG1A 3HZXA 1R4PB 4FF3A 5FO8B 1VQAA 1PA6A 1LO5D 3AU7A 1Q1BA 2Q8TA 3F1ZA 3KF8B 2P5ZX 5IGBA 1I5FA 5IGDA 2AWOA 3F8TA 1JOKA 1HQRD 3OWFA 1I50H 4C3IG 3DWQA 1WTOA 1HPCA 1ASYA 2JSOA 2BE5D 3IAYA 1ILPA 2VB3X 2DY7A 3R2TA 5EBDA 4UPAA 1TR5A 1OXXK 4DV1L 1CZWA 2AQ2B 2PNHA 4DR5L 5D14A 4YHHQ 5HGQA 2RSNA 3E0JA 3S2HB 3EVQA 1E22A 3G4SA 4BY7B 4GOPB 2F0UA 3WOFA 4A3EG 1XYIA 4K2KA 3H3VI 5IY0A 3IRBA 1QVCA 1B8AA 3FPPA 4IPCA 4MIUA 3S17H 4C3HG 1EIYB 4U68A 3NBHA 4BBSH 1FL0A 1A15A 3E9IA 3FKIG 2WB1B 2ICIA 1FNUA 2IW3A 1RIPA 2E2IB 3DEPA 2OF1A 4DV1Q 2FINB 4UAIA 4DR5Q 3RN5A 2OWOA 4IFDI 3DEOA 4HN7A 2JE6I 3SE0A 3SHLA 1QB5D 1WCMH 5IT9c 5C0XJ 2MGSA 5IP7G 3K5MA 4GNXB 4A3CH 5IIFA 1ICFB 2AQ1B 1EYAA 2NZOA 1Q12A 1IW7D 2AUJD 4A3MH 1XMOL 2NTTA 4IZ8A 2CWAA 2PW7A 3MXNB 3MXGA 3GTQB 1H95A 3GTJH 1N33L 1PYSB 3J7AV 4C56C 5ELDA 4CHTB 4LFCQ 1CA5A 2EY1A 1XNQL 1MBYA 4L5QA 5ELNA 2O5IC 1K8GA 5A2QE 2K5NA 4DKAC 1Q7YC 4A3LH 5GAGC 5BN3A 3A74A 4JI4L 1VQCA 1BCPB 3OMGA 4JBJA 5C6AA 4OO1I 1Q90A 3MEHA 1XMOQ 2A6HC 3SK6A 3JAMi 1DZ1A 1CHQD 3D4WA 1QG7A 3E9HA 3IKJA 5IT9E 1WTQA 2R61A 5I2YA 1AH9A 5HURA 1I6VC 1VS0A 1N33Q 4Q0FA 1D5ZC 3MAQA 2VXWA 3GTLH 1YJ9A 2PI2A 1XNQQ 3M9BA 4WRDA 1KDAA 5CR3A 1B9NA 5I9OA 3CU7A 1ESFA 4CBVA 4G7OC 2K5VA 5C44G 4JI4Q 2I46A 1YNNC 1R9TH 2B2WA 2MNAA 2PZUA 3K58A 2JA5B 2HQLA 1SNMA 2Z6KA 3URYA 2A8VA 4IOAA 4B9WA 2KHSA 1UNSA 2ZXOA 3G71A 3FDTA 4EQNA 1VQ9A 2OTLA 2I5HA 3AB9A 4LF8L 2NN6G 2BA1A 2F0NA 2XVSA 4IFDJ 4JI5L 1PRTB 1E1TA 3HOYG 4HJ9A 2JA8G 1VF5C 4DNTB 2PMZE 4OHJA 2JA7B 2K5WA 2CQAA 1F9RA 4A3DG 5CC4A 4YWLA 3CQZB 1WI5A 1LTRD 4UDUC 4A3GH 4BXXG 1ZEQX 3I4NG 3HOXG 1KAAA 3HOZG 1ILQA 5CV7A 5FJ8G 1STGA 2R6GA 3BZCA 1NMGA 5J1ZA 1TQOA 1X3PA 1E2VA 3PO2H 4Y7NB 4J6HA 5C5MA 1W2BA 4OX9L 2VUMG 4A3JG 4EQOA 3K57A 2EYOA 4XYQA 3VYSA 1CKMA 4A93H 3D0FA 5D3IB 4LF8Q 1Y1VG 1RDPD 1SFOH 1IBKQ 4JI5Q 3JAMc 2TSSA 5JVG3 3A8IE 1VQ8A 1J6QA 2A74C 4FXKC 2OXPA 3KLRA 4RKBA 1BNZA 3KF8A 4R4QA 4L6TB 2QCPX 5KGUA 5GROA 3J80i 3UDXA 1TY2A 2A73B 4PG3A 1F9PA 1BKBA 3CC7A 2EOTA 3HKZB 3PV0A 5CGKA 4DAYB 4JI8L 4WFN3 2KUMA 5KNCA 3U4ZA 4ULLA 4OX9Q 4HIDA 4CGYB 1K0RA 1B2TA 1J9OA 4IPGA 1JWMD 2G9DA 2YU9B 2DNEA 4GZYC 5C4XG 4C3IH 2RHQB 1LM0A 3CKIB 4GOPA 2FFKB 1YEZA 4KTAA 3U9SA 4UP8A 5KNDA 2VQFL 4I7AA 4MN3A 5JOBA 4RH6A 1NAPA 3OTOL 4CJ2C 3JAME 1IW7C 4JI8Q 2ATWA 2VB2X 2KQ3A 4N8FA 1I50B 1UE5A 1WYDA 2K6AA 1L0YB 5BN5A 1D5XC 1OTCA 2ICEC 4OL7A 4C3JG 1YZ6A 3EROA 1LTID 2EYHA 2IHEA 1SR3A 3CCUA 2LXKA 4TQUS 4C3HH 3FMCA 4PMWA 1NCVA 4DA2A 4GNXA 1IBMQ 1KRTA 1D7QA 3CF5A 4DR7L 4GLVB 3FKIH 2KECA 4HR7B 4ZUJA 5M9OA 4JI1L 2NZ1D 2VQFQ 1G91A 3FPUB 1JWUD 1HUNA 3MFGA 3MXNA 3PCOB 1U4PA 3OTOQ 4DV6Q 4HJ5A 2L5TA 1B9MA 3GV3A 3TMEA 4A3KG 4OEMB 3C2PA 5EKLA 1HUMA 2JA9A 1G2SA 1X3QA 4JBWA 5EBCA 5ELBA 3R3OA 3T53B 5HGTA 2HT1A 5IP7H 4BBSB 2IX0A 4HAEA 4B9XA 4OO1H 4BS9A 1ESRA 4DR6L 1SYGA 1TS2A 2UUCQ 3KF6B 1SROA 1QWYA 5AJ3L 4POFA 4DR2L 3NPPA 2MJ8A 4TSSA 5CV6A 3H15A 1S5FD 2ENBA 4DR7Q 1JCKB 1VQDA 2AWNA 2RF4A 3CCEA 2NVXH 4K5WA 2HUGA 1WCMB 4JI1Q 1EWCA 2A6EC 2B63G 3NTIA 1E2WA 2B2TC 1TT2A 1JR0D 3T13A 1CSQA 4IPDA 4RCOA 5IWAL 5JJKA 4HJ8A 2PYKA 4JVZA 2NBFA 2WAQE 2R7ZH 3KDFB 3NE5B 1YVCA 1UWVA 4P2CB 1XPOA 4DR6Q 1JE5A 3IL8A 2N55A 5M3FH 1AZPA 1MD2D 5AJ3Q 2SEBD 2B2VA 4DR2Q 2K32A 1AFPA 3A56A 2LS01 4GLXA 1VQJA 1K8MA 4JI2L 2DGYA 1DONA 3BU2A 3K5OA 5D65A 1HFGA 3H09A 3G6JB 3DWPA 1HNZL 5IWAQ 5M5WB 4AYBG 3MHBA 2CWPA 2QDLA 2XN9C 3BZDB 4N8X1 5C44H 5J22A 3VR4A 1T9HA 1UE7A 1N32L 1Z9FA 1AP0A 4L63B 1QUQB 1ZYRD 2YTXA 4RMFA 2Q8IB 2KENA 4LWCA 3NHHA 5J39A 3KK7A 1ET6A 4P72A 2XRSD 2F0TA 3CCJA 2F0VA 1KLUD 2OT2A 5M3MH 1SN8A 3M3YB 4HIOA 1TWHH 3BVZA 3CCRA 4JI2Q 1DOMA 2NN6H 1IKLA 1PXUA 2E5LL 1A0IA 2Z9HA 2B8FA 2L9HA 2Q2IA 1R9TB 3K5NA 1HHVA 1HNZQ 2JA8H 1GUOA 3TSSA 4DUYL 1OXSC 1GUGA 3EIVA 1J5EL 4P74A 4BXXH 2VW9A 4C2MH 1N32Q 3I4NH 3HOXH 3D3RA 2IJ0A 5T1IA 5FJ8H 3HOUB 1NMFA 5EJWA 1VQLA 4O1NA 4DR3Q 1Y8NB 2F1MA 2F0GA 1D6EC 4ZRZA 4A3JH 5JJZA 2F4IA 3ICEA 2D5DA 1PYBA 1Y1VH 3UI2A 4DAYA 1DXMA 4A3GB 3W3AA 3MXPA 4QIWB 2A69D 2CVRA 4A3MG 1VDZA 1WVLA 2XSCA 3N52A 3D4DA 3I56A 4DUYQ 3PO2B 1NUCA 1HZAA 1J5EQ 4GS3A 2XRQD 4JV5L 4AYBE 4JOIC 3H0GB 3C3LA 3V96A 2B39A 1MKHA 2YV5A 1TWAH 4HIKA 1K28A 4TRDA 1TVXA 4XT3B 1B53A 4ME3A 1EYGA 1S72A 4UY8C 3PIOA 1J8IA 4Y52H 3S1RB 3MVVA 5C3EH 4K6DA 3UE1A 1B3QA 3DWAA 4PMBA 2NUCA 4FF4A 4JPBW 5L37A 3RN2A 1TWCH 2CQOA 1B3AA 2MHVA 1JE4A 4O42A 4Q5VA 4JV5Q 3BVMA 4KV6A 2D0OA 1E2ZA 4KHVA 3V2TA 2IY5B 4U673 1G6PA 2VNUD 3H94A 2JA6H 4DV3L 2UUAL 3J80L 2ZTDA 1CQVA 4ZKBB 1HRJA 4C3IB 1ICWA 2EYFA 3A8KE 3E6ZX 1FNWA 1F77A 1PTOD 5E1FA 3TREA 3QWNA 1QNUA 4J8QA 5CV9A 2LKVA 1PH7A 1K73C 1GO3E 3MZ5A 3VA5A 3U58A 3S14H 2EXDA 4DAMA 3PUZA 4KD4A 3KF6A 1I3QH 5CORA 5IGFA 5C0XG 4K5VA 1KTKA 2X69A 1K83H 4A3EB 2ZXRA 3KOJA 1JOQA 4DV3Q 2UUAQ 2MP1A 4CJ1B 4A3KH 4IOCA 4UP9A 1HNWL 2F0EA 1D1IA 1BDOA 2N8NA 4C3HB 2Q2UA 2QDBA 1LT3D 3E5SA 1LACA 3S1NH 3CPWA 1BO0A 1GM5A 3FKIB 4WJ4A 4OWWB 3A7LA 5JEAJ 2K75A 3S1QH 2PQAB 3D4RA 4KHZA 4EGVA 4JYAL 3I70A 1GUWA 1C4QA 1VMPA 3LWEA 1EZ8A 2K28A 4LW1A 5FOBB 1VQNA 1KNAA 4HCSA 1LT4D 3VYRA 2F0WA 1STYA 1Q1EA 1G8ZD 4X3KA 5EPLA 1C0AA 1TXYA 4NW2A 2B63H 4ZYSA 4A93G 5CV8A 4ZCKA 4RGTA 1B7YB 3RD4A 3DXJC 1KLGD 2F3IA 1D2BA 1QVGA 4FVMA 3HGBA 1QZGA 4KKUA 3RLFA 1HNWQ 2PNRC 1WD0A 5DLQE 1CQFA 1HCZA 4QMGA 3R93A 1Y8OB 3K80C 1C9OA 3OOCA 2NVXB 1KRSA 1HR0W 3M7NA 1YITA 3RZDH 1I4HA 1VQKA 1UE6A 3PF4A 5M5XB 4X65L 1QUQA 1JC7A 4Z9CB 1SEBD 4MNOA 4L5SA 1SNOA 1TWFH 2Y0SB 2GA4B 1BQQT 2WKCA 1X9NA 2F0PA 3S15H 1RTNA 1SMYD 1PMRA 3HFZB 1P16A 3I90A 3J81j 3GO5A 4H13C 4B3SL 1ET9A 5LL6X 4J1MA 3PUVA 4QL5A 4KJNA 4IFDG 2A69C 2QEXA 3IFDA 2J0TD 3KBXA 4IALA 3L2PA 3S1MB 4X65Q 1C48A 1KHIA 3MWYW 4DV2L 2XNAC 4KN4C 4ODGA 2G5DA 5C44B 1BF4A 1QE6A 1G2TA 3NTHA 2N78A 3CC4A 1WOCA 5F2DA 2PPBC 2H1EA 2I0QA 1L1OC 1EWHA 3GQBA 3NBIA 2SNSA 4BY1H 4X64L 4L5TA 1EQRA 3F2UA 3HKSA 5AFWA 5GAEC 4RWSC 1L0XB 1YHQA 2E76C 5LL6S 3RMHA 3GTOB 4KN7C 1TWHB 4B3SQ 2J7ZA 1F2ZA 4LFCL 3NQIA 2EYPA 1PYWD 1VQHA 3HOYB 2CW0D 1EIGA 1O7IA 2JA8B 1SBBB 4A3DB 3PIP3 4DV2Q 1VCIA 1RCVD 1XJVA 1ENFA 3WWVA 1SE4A 4OO1G 3M7GA 2TMPA 4C2MB 3GTGH 1EU3A 3I4NB 3HOXB 4JK1C 1V1PB 3HOZB 3UDGA 2E2DC 4X64Q 4MTNA 3I72A 4F87A 3OWEB 4DV7L 2VUMB 1PTOC 2XWJB 1EFWA 1JQYD 3KLWA 1Y1VB 1GOZA 5T1GA 4L5RC 4GN3B 1D8LA 1YNJD 3W1BA 5BR8Q 1Y69U 2PCFB 5GADC 2DUDA 1HJPA 3T1YL 3FHWA 1QVFA 1IL8A 1RF2D 4PMCA 2R7ZG 1W3SA 1SNPA 1EFID 3CCMA 3I4OA 3NQTA 2F0DA 5M3FG 4R4TA 3HOVG 1TWAB 1N36L 3ERQA 1X56A 5KIXA 4DV7Q 4MZ9A 1AEXA 2KCMA 3SK8A 1YJNA 1JMCA 4LJZC 1A2UA 1N9WA 1X54A 3FRPB 4TVAB 1SE3A 5C4XB 1BCPD 2YTYA 2PI2E 2R92G 1EOTA 3I55A 2JJQA 2OEOA 4IUTA 3CRKC 1A63A 1IKMA 4WJ3M 3T1YQ 5ELCA 4DGZA 3CHBD 2EQSA 1BR9A 5KRUA 4JI7L 3M4PA 5DM73 4LFBQ 5KYIA 1KDBA 2BH2A 2LFNA 3CCQA 3GTPB 3PIPA 1VQFA 4FDBA 2XWBB 3T16A 1H9RA 5FO7B 1N36Q 2Z4HA 3VA7A 3X3MA 1SJED 5M3MG 5C0XH 2JP1A 1JB3A 2PQAA 3BYTB 2FHTA 4C3JB 4GN5A 3H6MA 2CFMA 2GVBA 1IBKL 3GTKH 3UDIA 1E3PA 2LXJA 4DPGA 3CPFA 3SDZA 2ZXPA 1S5CD 3S14B 2I07B 1IL2A 3I4MG 2NVYH 2ZTCA 1I3QB 3CAMA 4JI7Q 2V1CC 3AFPA 1K83B 1I94L 1PZID 3CW2C 1NSNS 5IODA 4A3KB 1YHBA 1PRTD 3GD7A 2N49A 1CTMA 2E74C 1I4GA 2RDGA 1EU4A 3O13A 2BE5C 1TS5A 2F0HA 3S1NB 4LMQD 1MSGA 1PVOA 3BZKA 2KEDA 1ASZA 3S1QB 4XT1B 4LF9L 1PFNA 1F2MA 1Z47A 4QB4A 1II3A 4RGOS 2FMCA 5IGCA 2KOLA 4JG2A 3QO2A 3TZUA 3MTSA 5IYCG 2NVQH 4N9PA 2RBMA 2B63B 2M9VA 4HJ7A 1JORA 1I94Q 1F9SA 4KJOA 1IYUA 1JB7A 1HXYD 1O80A 4AH6A 2OCEA 2NTSA 2QKIC 4NP5A 5G3LF 5LMNL 3KLSX 3S16H 4XQNA 3W5OA 2MUYA 2EYMA 5DNFA 1DM0B 3H3VH 4EQ5A 5C3EG 4LUOA 4FXDA 3RZDB 2R7DA 4LF9Q 1IBML 1PTOH 4P75A 2L11A 2CW0C 1CA6A 1GJXA 4EX5A 1CKNB 1TWFB 3NP8A 3KBGA 4DV6L 3ITPA 4IFDH 1K8AC 3TEHB 3ULLA 2JA6G 2WAQG 5A2QL 3A0JA 2E2JH 3S15B 2WB1E 3BDOA 3HOWG 1DOKA 3C1FA 3TQYA 2EDGA 4OWXB 5LMNQ 3TP7A 3QOLA 4HEDA 4DFAA 4CDEC 3GDEA 3RR5A 4AQYL 2A68D 2JEBI 1I4XA 3ERSX 4JI0L 1QNKA 2UUCL 4RCNA 2DJFC 2D0PA 4KY5A 2O4XA 5LHY1 1VQ4A 3J81L 4IPHA 2O5JC 1O78A 5CYUA 1BOSA 1I4RA 1O7YA 4TKOB 3PO3H 3PUWA 1VQGA 1V1PA 3SXHA 3T4AC 3ZYYX 1EUJA 3STBD 4GKJL 1L0WA 4KY6A 2QA4A 2YTVA 4BBRG 4ZQ3A 1KIXA 1LTAD 4L8JA 4B08A 3S17B 3QB3A 2KVMA 3TN2A 3LGJA 3J80c 3U4VA 5CBAE 5JPNC 4AQYQ 4JI0Q 2EIFA 4A3IG 3GTMH 5I4DA 3QOJA 1CT1D 1EQTA 2DNCA 3AFQA 3D6WA 2CH4A 1TS3A 3M4QA 2K4KA 2UUBL 4JBKA 4GKJQ 2K5QA 2F0KA 1VQOA 4JCVE 1SDFA 1Z6HA 4PV1C 1B50A 3T1HL 1CKOA 4A3MB 3ONAB 2B2YC 5IGGA 1XTCD 1A2TA 4BA1I 3P20A 3QJYA 4R4OA 3FEWX 5BN4A 2EYLA 3NENA 2IHFA 3TBIB 4RGNA 1EZ6A 4DXGA 3GTJB 3K59A 3AEVA 4E6IA 5M5YH 5EPJA 1S40A 4CKEA 3HOVH 2F3VA 4DXFA 4LAAA 4IUPA 2B2TA 3A55A 3M4OH 1BVSA 3J80E 2UUBQ 2XIWA 1EIHA 2RA4A 1FD7D 1STHA 2K14A 3MC0B 2VL6A 2C35B 3T1HQ 1PHJA 2R92H 1O7ZA 3NUCA 5TSSA 4HCEA 4JW0A 4NXMQ 4IUUA 5FLMG 1HFNA 4IJHA 1OXVA 1NJIC 4NKLA 4YCVA 4QQBX 3PIO3 1N8RC 3GTLB 2K03A 4DR3L 1U5KA 1MHWC 2JN4A 5C4JH 4G7HC 1SAPA 4ABNA 3K0YA 1STNA 3CMAA 4DV5L 3VR3A 4V0BA 5JEAG 1C7YA 3DHQA 4BY1G 1V1QA 1SYFA 3I4MH 1KC8C 2F0JA 2XGTA 1TWGH 1LTTD 4C1NK 4XQJA 3Q22A 3WDNA 1QCBD 4RGMA 2WINB 1UE1A 1OO9B 2MPMA 4N9TA 3L0OA 3EJIA 4XXEA 2RDFA
chains in the Genus database with same CATH topology
5DLQE 4LF4L 4B3RL 3E9HA 2UXDQ 2ALYB 1PH3A 4GKKL 3K80C 1XMQL 3HKZE 1C9OA 1AH9A 1KRSA 1HR0W 1Q46A 2NVTH 1VS0A 1AE2A 4A3EH 1YITA 1N33Q 3M7NA 3TRZA 2E2HH 3RZDH 3SGIA 4DV5Q 4LF7L 3GTLH 1K3RA 2PI2A 1YJ9A 2D62A 1XNQQ 4PZ8A 1VQKA 1UE6A 3M9BA 3PF4A 1B70B 3OYYA 4NB3A 4X65L 1QUQA 2GVAA 2JA7G 4MNOA 5IYCH 2F52A 4LF6Q 2B29A 4L5SA 4A3BH 1TWFH 2K5VA 5C44G 4JI4Q 1L1OB 1X3EA 5HY6A 1R9TH 1LYLA 3NELA 1X9NA 2MNAA 2AMCB 1N34L 4DUZL 3S15H 2A1AA 4GLAC 4X62L 2HQLA 2Z6KA 1VQIA 2A8VA 1CKNA 4IOAA 4LF4Q 4B3RQ 3K7AH 3HFZB 2OQKA 4DNIA 1KXLA 2VZAA 4GKKQ 4B3ML 1P16A 3K8AA 3G71A 1XMQQ 2JQOA 3UDFA 5LMNW 1YBYA 3J81j 2WP8J 3GO5A 1G51A 1VQ9A 4B3SL 2OTLA 2I5HA 1E24A 2NN6G 4LF8L 2BA1A 2ASBA 3CXCA 4ALPA 1V43A 3PUVA 4JOIA 4QL5A 4JI5L 1PH9A 4LF7Q 4IFDJ 4IFDG 5H1SE 2QEXA 4YY3L 1E1TA 3HOYG 1X6OA 4DV0L 3L2PA 2R93H 4NXML 4HJ9A 2JA8G 1PV4A 4X65Q 2PMZE 1G291 2FXQA 1KHIA 2UU9Q 4DV2L 4A3DG 2ID0A 3K7UC 4YWLA 4RG1A 1WI5A 4A3GH 1CSPA 2N78A 1WOCA 4GN4B 3CC4A 4BXXG 3D31A 2I0QA 1L1OC 3I4NG 3HOXG 3HOZG 1N34Q 1VQBA 4K0KL 4DUZQ 3B6YA 4X64L 4X62Q 4L5TA 4BY1H 3HOWH 4HJAA 3HKZG 2GN5A 3S2DH 5FJ8G 1PH4A 2L15A 2R6GA 1EQRA 3BZCA 1NMGA 3HKSA 5M5XH 1XNRL 2F4VL 2JEAI 3PO2H 5GAEC 2VUMG 2UXCQ 1W2BA 4B3MQ 4OX9L 1YHQA 4A4IA 2LSSA 4A3JG 4JI6L 1CKMA 1NBWA 3D0FA 4A93H 4B3SQ 4LF8Q 1Y1VG 4LFAL 4LFCL 1SFOH 2QGQA 1PFSA 1IBKQ 4JI5Q 1L2FA 3JAMc 4XIGS 2JA5H 1VQHA 1VQ8A 1J6QA 4YY3Q 4DV0Q 3RZOH 1O7IA 5IE8A 2Q2HA 3PF5A 2KHIA 4R4QA 3PGZA 1Y1WG 5FLXc 5IYBH 1VCIA 4DV2Q 5GQOA 3WWVA 5GROA 1XJVA 2ES2A 4R1JA 1YNXA 4OO1G 3J80i 3UDXA 1VQ5A 3GTGH 4PG3A 3CMEA 1BKBA 4BBRH 4J15A 1BBWA 3CC7A 3UDGA 4K0KQ 2MO1A 3E0EA 4X64Q 3PV0A 4MTNA 4JI8L 4DAYB 4KLKA 3S1MH 1HZBA 1XNRQ 5EAYA 3U4ZA 4DV7L 2F4VQ 3S2HH 4OX9Q 4HIDA 1PH1A 4BY7H 2NZHA 4LNQA 4B3TL 1K0RA 3CQZH 4JI6Q 1JT8A 2IT1A 4UP7A 1EFWA 3KLWA 5E7NA 4IPGA 4A3IH 2B3GA 4L5RC 1VQEA 4LFAQ 4IO9A 1SRUA 1V9PA 5C4XG 4GN3B 1D8LA 3ER0A 1S3OA 5LMUL 4C3IH 2RHQB 2WFWA 1LM0A 2CCZA 1Q8KA 4YWKA 3W1BA 5BR8Q 4OWTB 4GOPA 5GADC 3KJPA 1YEZA 4BA2I 2DUDA 4P71A 1HJPA 1XPUA 3ULPA 3T1YL 3FHWA 2XTIA 1QVFA 2R7ZG 4UP8A 1W3SA 1MIUA 1KQSA 3GTOH 1OXUA 2VQFL 3CCMA 3I4OA 2E2IH 1EWIA 5JJIA 3W1GA 3OTOL 1QZHA 4A3FG 5M3FG 4R4TA 3HOVG 3HOYH 4JI8Q 4X6AH 1GD7A 2ATWA 1N36L 1X56A 3CCVA 4DV7Q 1UE5A 4MZ9A 4R4CA 2KCMA 1WYDA 1YJWA 1YJNA 2BA0A 1JMCA 3CCSA 4A3DH 4B3TQ 1OTCA 4BBSG 1HH2P 1N9WA 1X54A 2AHOB 3PSIA 5IP9H 1YZ6A 2E8GA 4TVAB 1SE8A 3HOZH 2IHEA 2YTYA 2PI2E 1SR3A 3CCUA 2LXKA 4DK6C 5LMUQ 4TQUS 4C3HH 2Q2TA 2R92G 4PMWA 1PH2A 3I55A 4GNXA 1VQPA 1IBMQ 2JJQA 1KRTA 1D7QA 2VUMH 3CF5A 1A63A 3GTQH 3ULJA 4GLVB 2UU9L 4DR7L 3NEMA 3M85A 4WJ3M 2A19A 3T1YQ 3FKIH 3J81i 1PH6A 4O0AA 1WCMG 2EQSA 4JI1L 1MJCA 2VQFQ 4A75A 2KCTA 2VS1A 2HIXA 3M4PA 4JI7L 1VQMA 3RLOA 4HIMA 4LFBQ 3PCOB 5JJLA 4A3CG 2BH2A 3NBHB 3OTOQ 4DV6Q 2E5LQ 3CCQA 3PIPA 1VQFA 3KYHC 5J3BA 4HJ5A 1XTDA 4FDBA 4A3KG 1N36Q 4LUVA 3AYHB 1FGUA 2UXCL 5FLMH 2JA9A 4JBWA 1IYJB 5M3MG 1IBLL 3STBC 2PQAA 5IP7H 2IX0A 3TS0A 1YIJA 2HT1A 3U50C 1X3FA 3A5UA 4GN5A 2I5MX 3J7A5 4APVA 4DR6L 4DR4L 4JI3L 1IBKL 2CFMA 2GVBA 4PZ6A 2UUCQ 2ZJRA 3GTKH 1BBUA 3KF6B 3UDIA 1E3PA 1SROA 3A5ZB 1RL2A 2LXJA 2HIVA 3CPFA 4DPGA 4POFA 5GAHC 5AJ3L 3F2DA 4DR2L 2K52A 2KBNA 4A76A 3H15A 3F2BA 2HHHQ 4JC0A 2OTJA 4DR7Q 1WJJA 1IL2A 2AWNA 1VQDA 2RF4A 3CCEA 2NVXH 1HNWQ 4POGA 3I4MG 2NVYH 1A8VA 2ZTCA 4A3LG 1U0LA 3CP0A 2UXBQ 3CAMA 4JI1Q 4JI7Q 2B63G 1UEBA 1X65A 2V1CC 3AFPA 1I94L 5C4XH 1VQ6A 3CW2C 1CSQA 4IPDA 1A62A 5IWAL 1YHBA 5JJKA 2I5LX 3GD7A 2N49A 1K9MC 4HJ8A 1Q81C 4QIWE 3PO3G 2WAQE 1HR0L 2R7ZH 1M1KC 1IBLQ 3KDFB 4DK3C 4QGUA 5IYDG 1YVCA 3CCLA 1UWVA 1NE3A 1XPOA 2ZTEA 4DR6Q 1N32Q 1JE5A 4DR4Q 3DLLA 4JI3Q 3BZKA 1PVOA 5M3FH 1ASZA 3GTPH 1WFQA 5AJ3Q 4LF9L 2MFIA 5BR8L 4DR2Q 1HZ9A 1L1OA 1Z47A 1HZCA 3EN2A 4GLXA 2RCNA 4YWMA 2H5XA 4JG2A 1VQJA 4X66L 4JI2L 2DGYA 4C3JH 5IYCG 2NVQH 4A3BG 4OXPA 3BU2A 4HJ7A 1I94Q 1IZ6A 3KFUA 4JBMA 1JB7A 4AIMA 1HNXL 1HNZL 2BH8A 4AH6A 5IWAQ 2OCEA 4R4IA 2JA7H 4AYBG 1LUZA 2CWPA 4P73A 5LMNL 4LF5L 3J81c 3PUXA 3AQQA 3S16H 5C44H 1HR0Q 3W5OA 1T9HA 1UE7A 3H3VH 1X3GA 4EQ5A 2AKWB 1N32L 1DGSA 1Z9FA 4XTCS 5C3EG 1LTLA 5ELOA 3K81C 1QUQB 4RMFA 2YTXA 4LUOA 2KENA 4LWCA 1EIFA 2R7DA 3I2ZA 4P72A 4LF9Q 3HOUG 4OONA 1IBML 2K5HA 4Y7NH 4P75A 3CCJA 2R93G 1SMXA 2MO0A 5M3MH 1SN8A 4DR1L 4HIOA 1E7ZA 1TWHH 4EX5A 4X66Q 4JI2Q 3CCRA 4LFBL 3ZJYC 1CKNB 3KJOA 4DV6L 2E5LL 4A3GG 3G48A 1A0IA 1K8AC 3TEHB 2Q2IA 3ULLA 2JA6G 1M90C 2WAQG 3A0JA 1HNXQ 1HNZQ 3KDFA 2E2JH 2JA8H 2WB1E 3HOWG 3CD6A 1GKHA 3L7ZC 4DUYL 1OXSC 3TQYA 4OWXB 5LMNQ 4QY7A 4LF5Q 3Q8DA 1JJCB 3PO2G 3EIVA 2K50A 1J5EL 3TS2A 4P74A 4BXXH 1Q86C 3GDEA 3RR5A 2VW9A 4C2MH 1SLJA 3H0GG 4AQYL 2JEBI 3ERSX 2Y0SG 3HOXH 2OQ0A 4JI0L 3FP9A 2MQHA 2UUCL 1Q82C 3I4NH 4DV4L 2D0PA 5C0XI 1VQ4A 5FJ8H 4IPHA 1NMFA 3UE0A 1VQLA 5K36G 3DM3A 4DR3Q 2HHHL 1GVPA 5M5WH 1YI2A 3G6EA 2ZJPA 4A3JH 3PO3H 3PUWA 1VQGA 3I7FA 4O2DA 4DR1Q 2UXBL 1EUJA 3STBD 4GKJL 5IYDH 3ICEA 1PYBA 1Y1VH 5IYBG 1L0WA 1KD1C 2YU9H 2QA4A 2CKZB 2YTVA 2Z6KC 2VQEL 4NPSA 1NY4A 1IXRA 3RNUA 4BBRG 4A3MG 1KIXA 1PH8A 1EQQA 4JYAQ 4PZ7A 4YHHL 3J7ZC 3I56A 3VDYA 2N3SA 4DUYQ 1Y1WH 1JJ2A 3LGJA 3M3YH 3J80c 3U4VA 4YCUA 1HZAA 1J5EQ 4GS3A 4JV5L 4AYBE 4JOIC 1CUKA 1VQAA 4AQYQ 4BY7G 1MKHA 1PA6A 4JI0Q 1Q1BA 3S24A 2YV5A 3F1ZA 4DV4Q 3KF8B 2EIFA 2R7FA 1E1OA 4A3IG 3GTMH 1TWAH 4KHPL 1I5FA 4HIKA 2AWOA 3F8TA 1I50H 1ASYA 1X55A 4KI0A 3AFQA 3EBEA 4ME3A 3M4QA 2K4KA 1EYGA 1S72A 2UUBL 4UY8C 4JBKA 4GKJQ 3PIOA 4Y52H 4IJLA 1VQOA 2IX1A 5C3EH 2WB1G 4JCVE 3UE1A 1FVIA 3RLNA 2VQEQ 4UPAA 1OXXK 3T1HL 1VQ7A 1CKOA 1XPRA 3HOUH 4DV1L 4NXNL 2PNHA 4DR5L 4YHHQ 1EOVA 5HGQA 3BJUA 4BA1I 2VY3A 3RN2A 1KL9A 4R4OA 2ZJQA 1TWCH 1AE3A 3CC2A 4YCWA 3NENA 2CQOA 2IHFA 1E22A 3PUYA 3G4SA 4JV5Q 2D0OA 4GOPB 3AEVA 5M5YH 4H02A 4A3EG 4A3FH 1S40A 2IY5B 5IP9G 1G6PA 3HOVH 4KHPQ 2RHSB 5IY0A 2JA6H 3H3VI 2VNUD 4DV3L 2UUAL 1OXTA 3IRBA 2Y0SE 2JK8A 2ZTDA 1QVCA 1B8AA 4IPCA 3S17H 3OW2A 1EIYB 3M4OH 1BVSA 4BBSH 2UUBQ 3F2CA 1FL0A 3E9IA 3FKIG 3H0GH 3TREA 2K14A 1RIPA 2VL6A 2C35B 3T1HQ 1PHJA 2R92H 2NN6I 1K73C 4DV1Q 1GO3E 1PH7A 4NXNQ 4DR5Q 3RN5A 3U58A 3S14H 1YHAA 2OWOA 2EXDA 4IFDI 2JE6I 4DAMA 4NXMQ 3PUZA 1WCMH 3KF6A 5IT9c 1I3QH 2YYZA 5FLMG 5C0XJ 2ZM6L 3S1RH 5C0XG 4IJHA 1OXVA 5IP7G 4GNXB 1K83H 1NJIC 4A3CH 1I6HH 4YCVA 4QQBX 4GOPC 2NZOA 1Q12A 3KOJA 1N8RC 4DV3Q 4A3MH 1XMOL 2UUAQ 2CWAA 4QJFA 4IOCA 3MEFA 4UP9A 1U5KA 3JAMi 4DR3L 4A3KH 1FJGL 1HNWL 1JJGA 2N8NA 2Q2UA 2UXDL 3MXNB 5C4JH 1MJEA 3S1NH 3CPWA 1H95A 1GM5A 3GTJH 4WJ4A 4OWWB 1Y14B 1N33L 1PYSB 5JEAJ 2K75A 3S1QH 1PH5A 3CMAA 4DV5L 1C7YA 1NTGA 5JEAG 4LFCQ 2PQAB 4KHZA 4BY1G 4JYAL 1V1QA 1XNQL 4L5QA 5ELNA 3JC66 1K8GA 3I4MH 1KAWA 2K5NA 4LW1A 4DKAC 1Q7YC 1KC8C 2XGTA 5GAGC 1VQNA 4A3LH 1TWGH 4LF6L 2KHJA 3A74A 2ZM6Q 1Q1EA 4LUZA 1C0AA 1TXYA 4JI4L 2B63H 4A93G 1P8LA 1VQCA 4JBJA 1UE1A 3K0XA 1B7YB 4OO1I 2F3IA 4GNXC 1QVGA 3L0OA 1XMOQ 2Z0SA 1QZGA 2JA5G 3RLFA 1FJGQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DLQ E;  4LF4 L;  4B3R L;  3E9H A;  2UXD Q;  2ALY B;  1PH3 A;  4GKK L;  3K80 C;  1XMQ L;  3HKZ E;  1C9O A;  1AH9 A;  1KRS A;  1HR0 W;  1Q46 A;  2NVT H;  1VS0 A;  1AE2 A;  4A3E H;  1YIT A;  1N33 Q;  3M7N A;  3TRZ A;  2E2H H;  3RZD H;  3SGI A;  4DV5 Q;  4LF7 L;  3GTL H;  1K3R A;  2PI2 A;  1YJ9 A;  2D62 A;  1XNQ Q;  4PZ8 A;  1VQK A;  1UE6 A;  3M9B A;  3PF4 A;  1B70 B;  3OYY A;  4NB3 A;  4X65 L;  1QUQ A;  2GVA A;  2JA7 G;  4MNO A;  5IYC H;  2F52 A;  4LF6 Q;  2B29 A;  4L5S A;  4A3B H;  1TWF H;  2K5V A;  5C44 G;  4JI4 Q;  1L1O B;  1X3E A;  5HY6 A;  1R9T H;  1LYL A;  3NEL A;  1X9N A;  2MNA A;  2AMC B;  1N34 L;  4DUZ L;  3S15 H;  2A1A A;  4GLA C;  4X62 L;  2HQL A;  2Z6K A;  1VQI A;  2A8V A;  1CKN A;  4IOA A;  4LF4 Q;  4B3R Q;  3K7A H;  3HFZ B;  2OQK A;  4DNI A;  1KXL A;  2VZA A;  4GKK Q;  4B3M L;  1P16 A;  3K8A A;  3G71 A;  1XMQ Q;  2JQO A;  3UDF A;  5LMN W;  1YBY A;  3J81 j;  2WP8 J;  3GO5 A;  1G51 A;  1VQ9 A;  4B3S L;  2OTL A;  2I5H A;  1E24 A;  2NN6 G;  4LF8 L;  2BA1 A;  2ASB A;  3CXC A;  4ALP A;  1V43 A;  3PUV A;  4JOI A;  4QL5 A;  4JI5 L;  1PH9 A;  4LF7 Q;  4IFD J;  4IFD G;  5H1S E;  2QEX A;  4YY3 L;  1E1T A;  3HOY G;  1X6O A;  4DV0 L;  3L2P A;  2R93 H;  4NXM L;  4HJ9 A;  2JA8 G;  1PV4 A;  4X65 Q;  2PMZ E;  1G29 1;  2FXQ A;  1KHI A;  2UU9 Q;  4DV2 L;  4A3D G;  2ID0 A;  3K7U C;  4YWL A;  4RG1 A;  1WI5 A;  4A3G H;  1CSP A;  2N78 A;  1WOC A;  4GN4 B;  3CC4 A;  4BXX G;  3D31 A;  2I0Q A;  1L1O C;  3I4N G;  3HOX G;  3HOZ G;  1N34 Q;  1VQB A;  4K0K L;  4DUZ Q;  3B6Y A;  4X64 L;  4X62 Q;  4L5T A;  4BY1 H;  3HOW H;  4HJA A;  3HKZ G;  2GN5 A;  3S2D H;  5FJ8 G;  1PH4 A;  2L15 A;  2R6G A;  1EQR A;  3BZC A;  1NMG A;  3HKS A;  5M5X H;  1XNR L;  2F4V L;  2JEA I;  3PO2 H;  5GAE C;  2VUM G;  2UXC Q;  1W2B A;  4B3M Q;  4OX9 L;  1YHQ A;  4A4I A;  2LSS A;  4A3J G;  4JI6 L;  1CKM A;  1NBW A;  3D0F A;  4A93 H;  4B3S Q;  4LF8 Q;  1Y1V G;  4LFA L;  4LFC L;  1SFO H;  2QGQ A;  1PFS A;  1IBK Q;  4JI5 Q;  1L2F A;  3JAM c;  4XIG S;  2JA5 H;  1VQH A;  1VQ8 A;  1J6Q A;  4YY3 Q;  4DV0 Q;  3RZO H;  1O7I A;  5IE8 A;  2Q2H A;  3PF5 A;  2KHI A;  4R4Q A;  3PGZ A;  1Y1W G;  5FLX c;  5IYB H;  1VCI A;  4DV2 Q;  5GQO A;  3WWV A;  5GRO A;  1XJV A;  2ES2 A;  4R1J A;  1YNX A;  4OO1 G;  3J80 i;  3UDX A;  1VQ5 A;  3GTG H;  4PG3 A;  3CME A;  1BKB A;  4BBR H;  4J15 A;  1BBW A;  3CC7 A;  3UDG A;  4K0K Q;  2MO1 A;  3E0E A;  4X64 Q;  3PV0 A;  4MTN A;  4JI8 L;  4DAY B;  4KLK A;  3S1M H;  1HZB A;  1XNR Q;  5EAY A;  3U4Z A;  4DV7 L;  2F4V Q;  3S2H H;  4OX9 Q;  4HID A;  1PH1 A;  4BY7 H;  2NZH A;  4LNQ A;  4B3T L;  1K0R A;  3CQZ H;  4JI6 Q;  1JT8 A;  2IT1 A;  4UP7 A;  1EFW A;  3KLW A;  5E7N A;  4IPG A;  4A3I H;  2B3G A;  4L5R C;  1VQE A;  4LFA Q;  4IO9 A;  1SRU A;  1V9P A;  5C4X G;  4GN3 B;  1D8L A;  3ER0 A;  1S3O A;  5LMU L;  4C3I H;  2RHQ B;  2WFW A;  1LM0 A;  2CCZ A;  1Q8K A;  4YWK A;  3W1B A;  5BR8 Q;  4OWT B;  4GOP A;  5GAD C;  3KJP A;  1YEZ A;  4BA2 I;  2DUD A;  4P71 A;  1HJP A;  1XPU A;  3ULP A;  3T1Y L;  3FHW A;  2XTI A;  1QVF A;  2R7Z G;  4UP8 A;  1W3S A;  1MIU A;  1KQS A;  3GTO H;  1OXU A;  2VQF L;  3CCM A;  3I4O A;  2E2I H;  1EWI A;  5JJI A;  3W1G A;  3OTO L;  1QZH A;  4A3F G;  5M3F G;  4R4T A;  3HOV G;  3HOY H;  4JI8 Q;  4X6A H;  1GD7 A;  2ATW A;  1N36 L;  1X56 A;  3CCV A;  4DV7 Q;  1UE5 A;  4MZ9 A;  4R4C A;  2KCM A;  1WYD A;  1YJW A;  1YJN A;  2BA0 A;  1JMC A;  3CCS A;  4A3D H;  4B3T Q;  1OTC A;  4BBS G;  1HH2 P;  1N9W A;  1X54 A;  2AHO B;  3PSI A;  5IP9 H;  1YZ6 A;  2E8G A;  4TVA B;  1SE8 A;  3HOZ H;  2IHE A;  2YTY A;  2PI2 E;  1SR3 A;  3CCU A;  2LXK A;  4DK6 C;  5LMU Q;  4TQU S;  4C3H H;  2Q2T A;  2R92 G;  4PMW A;  1PH2 A;  3I55 A;  4GNX A;  1VQP A;  1IBM Q;  2JJQ A;  1KRT A;  1D7Q A;  2VUM H;  3CF5 A;  1A63 A;  3GTQ H;  3ULJ A;  4GLV B;  2UU9 L;  4DR7 L;  3NEM A;  3M85 A;  4WJ3 M;  2A19 A;  3T1Y Q;  3FKI H;  3J81 i;  1PH6 A;  4O0A A;  1WCM G;  2EQS A;  4JI1 L;  1MJC A;  2VQF Q;  4A75 A;  2KCT A;  2VS1 A;  2HIX A;  3M4P A;  4JI7 L;  1VQM A;  3RLO A;  4HIM A;  4LFB Q;  3PCO B;  5JJL A;  4A3C G;  2BH2 A;  3NBH B;  3OTO Q;  4DV6 Q;  2E5L Q;  3CCQ A;  3PIP A;  1VQF A;  3KYH C;  5J3B A;  4HJ5 A;  1XTD A;  4FDB A;  4A3K G;  1N36 Q;  4LUV A;  3AYH B;  1FGU A;  2UXC L;  5FLM H;  2JA9 A;  4JBW A;  1IYJ B;  5M3M G;  1IBL L;  3STB C;  2PQA A;  5IP7 H;  2IX0 A;  3TS0 A;  1YIJ A;  2HT1 A;  3U50 C;  1X3F A;  3A5U A;  4GN5 A;  2I5M X;  3J7A 5;  4APV A;  4DR6 L;  4DR4 L;  4JI3 L;  1IBK L;  2CFM A;  2GVB A;  4PZ6 A;  2UUC Q;  2ZJR A;  3GTK H;  1BBU A;  3KF6 B;  3UDI A;  1E3P A;  1SRO A;  3A5Z B;  1RL2 A;  2LXJ A;  2HIV A;  3CPF A;  4DPG A;  4POF A;  5GAH C;  5AJ3 L;  3F2D A;  4DR2 L;  2K52 A;  2KBN A;  4A76 A;  3H15 A;  3F2B A;  2HHH Q;  4JC0 A;  2OTJ A;  4DR7 Q;  1WJJ A;  1IL2 A;  2AWN A;  1VQD A;  2RF4 A;  3CCE A;  2NVX H;  1HNW Q;  4POG A;  3I4M G;  2NVY H;  1A8V A;  2ZTC A;  4A3L G;  1U0L A;  3CP0 A;  2UXB Q;  3CAM A;  4JI1 Q;  4JI7 Q;  2B63 G;  1UEB A;  1X65 A;  2V1C C;  3AFP A;  1I94 L;  5C4X H;  1VQ6 A;  3CW2 C;  1CSQ A;  4IPD A;  1A62 A;  5IWA L;  1YHB A;  5JJK A;  2I5L X;  3GD7 A;  2N49 A;  1K9M C;  4HJ8 A;  1Q81 C;  4QIW E;  3PO3 G;  2WAQ E;  1HR0 L;  2R7Z H;  1M1K C;  1IBL Q;  3KDF B;  4DK3 C;  4QGU A;  5IYD G;  1YVC A;  3CCL A;  1UWV A;  1NE3 A;  1XPO A;  2ZTE A;  4DR6 Q;  1N32 Q;  1JE5 A;  4DR4 Q;  3DLL A;  4JI3 Q;  3BZK A;  1PVO A;  5M3F H;  1ASZ A;  3GTP H;  1WFQ A;  5AJ3 Q;  4LF9 L;  2MFI A;  5BR8 L;  4DR2 Q;  1HZ9 A;  1L1O A;  1Z47 A;  1HZC A;  3EN2 A;  4GLX A;  2RCN A;  4YWM A;  2H5X A;  4JG2 A;  1VQJ A;  4X66 L;  4JI2 L;  2DGY A;  4C3J H;  5IYC G;  2NVQ H;  4A3B G;  4OXP A;  3BU2 A;  4HJ7 A;  1I94 Q;  1IZ6 A;  3KFU A;  4JBM A;  1JB7 A;  4AIM A;  1HNX L;  1HNZ L;  2BH8 A;  4AH6 A;  5IWA Q;  2OCE A;  4R4I A;  2JA7 H;  4AYB G;  1LUZ A;  2CWP A;  4P73 A;  5LMN L;  4LF5 L;  3J81 c;  3PUX A;  3AQQ A;  3S16 H;  5C44 H;  1HR0 Q;  3W5O A;  1T9H A;  1UE7 A;  3H3V H;  1X3G A;  4EQ5 A;  2AKW B;  1N32 L;  1DGS A;  1Z9F A;  4XTC S;  5C3E G;  1LTL A;  5ELO A;  3K81 C;  1QUQ B;  4RMF A;  2YTX A;  4LUO A;  2KEN A;  4LWC A;  1EIF A;  2R7D A;  3I2Z A;  4P72 A;  4LF9 Q;  3HOU G;  4OON A;  1IBM L;  2K5H A;  4Y7N H;  4P75 A;  3CCJ A;  2R93 G;  1SMX A;  2MO0 A;  5M3M H;  1SN8 A;  4DR1 L;  4HIO A;  1E7Z A;  1TWH H;  4EX5 A;  4X66 Q;  4JI2 Q;  3CCR A;  4LFB L;  3ZJY C;  1CKN B;  3KJO A;  4DV6 L;  2E5L L;  4A3G G;  3G48 A;  1A0I A;  1K8A C;  3TEH B;  2Q2I A;  3ULL A;  2JA6 G;  1M90 C;  2WAQ G;  3A0J A;  1HNX Q;  1HNZ Q;  3KDF A;  2E2J H;  2JA8 H;  2WB1 E;  3HOW G;  3CD6 A;  1GKH A;  3L7Z C;  4DUY L;  1OXS C;  3TQY A;  4OWX B;  5LMN Q;  4QY7 A;  4LF5 Q;  3Q8D A;  1JJC B;  3PO2 G;  3EIV A;  2K50 A;  1J5E L;  3TS2 A;  4P74 A;  4BXX H;  1Q86 C;  3GDE A;  3RR5 A;  2VW9 A;  4C2M H;  1SLJ A;  3H0G G;  4AQY L;  2JEB I;  3ERS X;  2Y0S G;  3HOX H;  2OQ0 A;  4JI0 L;  3FP9 A;  2MQH A;  2UUC L;  1Q82 C;  3I4N H;  4DV4 L;  2D0P A;  5C0X I;  1VQ4 A;  5FJ8 H;  4IPH A;  1NMF A;  3UE0 A;  1VQL A;  5K36 G;  3DM3 A;  4DR3 Q;  2HHH L;  1GVP A;  5M5W H;  1YI2 A;  3G6E A;  2ZJP A;  4A3J H;  3PO3 H;  3PUW A;  1VQG A;  3I7F A;  4O2D A;  4DR1 Q;  2UXB L;  1EUJ A;  3STB D;  4GKJ L;  5IYD H;  3ICE A;  1PYB A;  1Y1V H;  5IYB G;  1L0W A;  1KD1 C;  2YU9 H;  2QA4 A;  2CKZ B;  2YTV A;  2Z6K C;  2VQE L;  4NPS A;  1NY4 A;  1IXR A;  3RNU A;  4BBR G;  4A3M G;  1KIX A;  1PH8 A;  1EQQ A;  4JYA Q;  4PZ7 A;  4YHH L;  3J7Z C;  3I56 A;  3VDY A;  2N3S A;  4DUY Q;  1Y1W H;  1JJ2 A;  3LGJ A;  3M3Y H;  3J80 c;  3U4V A;  4YCU A;  1HZA A;  1J5E Q;  4GS3 A;  4JV5 L;  4AYB E;  4JOI C;  1CUK A;  1VQA A;  4AQY Q;  4BY7 G;  1MKH A;  1PA6 A;  4JI0 Q;  1Q1B A;  3S24 A;  2YV5 A;  3F1Z A;  4DV4 Q;  3KF8 B;  2EIF A;  2R7F A;  1E1O A;  4A3I G;  3GTM H;  1TWA H;  4KHP L;  1I5F A;  4HIK A;  2AWO A;  3F8T A;  1I50 H;  1ASY A;  1X55 A;  4KI0 A;  3AFQ A;  3EBE A;  4ME3 A;  3M4Q A;  2K4K A;  1EYG A;  1S72 A;  2UUB L;  4UY8 C;  4JBK A;  4GKJ Q;  3PIO A;  4Y52 H;  4IJL A;  1VQO A;  2IX1 A;  5C3E H;  2WB1 G;  4JCV E;  3UE1 A;  1FVI A;  3RLN A;  2VQE Q;  4UPA A;  1OXX K;  3T1H L;  1VQ7 A;  1CKO A;  1XPR A;  3HOU H;  4DV1 L;  4NXN L;  2PNH A;  4DR5 L;  4YHH Q;  1EOV A;  5HGQ A;  3BJU A;  4BA1 I;  2VY3 A;  3RN2 A;  1KL9 A;  4R4O A;  2ZJQ A;  1TWC H;  1AE3 A;  3CC2 A;  4YCW A;  3NEN A;  2CQO A;  2IHF A;  1E22 A;  3PUY A;  3G4S A;  4JV5 Q;  2D0O A;  4GOP B;  3AEV A;  5M5Y H;  4H02 A;  4A3E G;  4A3F H;  1S40 A;  2IY5 B;  5IP9 G;  1G6P A;  3HOV H;  4KHP Q;  2RHS B;  5IY0 A;  2JA6 H;  3H3V I;  2VNU D;  4DV3 L;  2UUA L;  1OXT A;  3IRB A;  2Y0S E;  2JK8 A;  2ZTD A;  1QVC A;  1B8A A;  4IPC A;  3S17 H;  3OW2 A;  1EIY B;  3M4O H;  1BVS A;  4BBS H;  2UUB Q;  3F2C A;  1FL0 A;  3E9I A;  3FKI G;  3H0G H;  3TRE A;  2K14 A;  1RIP A;  2VL6 A;  2C35 B;  3T1H Q;  1PHJ A;  2R92 H;  2NN6 I;  1K73 C;  4DV1 Q;  1GO3 E;  1PH7 A;  4NXN Q;  4DR5 Q;  3RN5 A;  3U58 A;  3S14 H;  1YHA A;  2OWO A;  2EXD A;  4IFD I;  2JE6 I;  4DAM A;  4NXM Q;  3PUZ A;  1WCM H;  3KF6 A;  5IT9 c;  1I3Q H;  2YYZ A;  5FLM G;  5C0X J;  2ZM6 L;  3S1R H;  5C0X G;  4IJH A;  1OXV A;  5IP7 G;  4GNX B;  1K83 H;  1NJI C;  4A3C H;  1I6H H;  4YCV A;  4QQB X;  4GOP C;  2NZO A;  1Q12 A;  3KOJ A;  1N8R C;  4DV3 Q;  4A3M H;  1XMO L;  2UUA Q;  2CWA A;  4QJF A;  4IOC A;  3MEF A;  4UP9 A;  1U5K A;  3JAM i;  4DR3 L;  4A3K H;  1FJG L;  1HNW L;  1JJG A;  2N8N A;  2Q2U A;  2UXD L;  3MXN B;  5C4J H;  1MJE A;  3S1N H;  3CPW A;  1H95 A;  1GM5 A;  3GTJ H;  4WJ4 A;  4OWW B;  1Y14 B;  1N33 L;  1PYS B;  5JEA J;  2K75 A;  3S1Q H;  1PH5 A;  3CMA A;  4DV5 L;  1C7Y A;  1NTG A;  5JEA G;  4LFC Q;  2PQA B;  4KHZ A;  4BY1 G;  4JYA L;  1V1Q A;  1XNQ L;  4L5Q A;  5ELN A;  3JC6 6;  1K8G A;  3I4M H;  1KAW A;  2K5N A;  4LW1 A;  4DKA C;  1Q7Y C;  1KC8 C;  2XGT A;  5GAG C;  1VQN A;  4A3L H;  1TWG H;  4LF6 L;  2KHJ A;  3A74 A;  2ZM6 Q;  1Q1E A;  4LUZ A;  1C0A A;  1TXY A;  4JI4 L;  2B63 H;  4A93 G;  1P8L A;  1VQC A;  4JBJ A;  1UE1 A;  3K0X A;  1B7Y B;  4OO1 I;  2F3I A;  4GNX C;  1QVG A;  3L0O A;  1XMO Q;  2Z0S A;  1QZG A;  2JA5 G;  3RLF A;  1FJG Q; 
#chains in the Genus database with same CATH topology
 2BOS A;  4NMZ A;  2ALY B;  1PH3 A;  2RCF A;  4R9W A;  2C9O A;  1XMQ L;  3HKZ E;  1S5E D;  2NVT H;  1AE2 A;  2HDM A;  3SGI A;  1PZJ D;  4DV5 Q;  4NDX A;  2M2L A;  1K3R A;  1GHJ A;  2BCO A;  4PZ8 A;  1WTV A;  2EJF C;  1SNC A;  3C1E A;  3OYY A;  1SYC A;  1RTO A;  5D3D A;  5IYC H;  2F52 A;  1X32 A;  2RVL A;  3OIP A;  1NR2 A;  4A93 B;  1L1O B;  1X3E A;  1LYL A;  5JPM C;  1TII D;  1SFO B;  1TU2 B;  4X62 L;  1PFB A;  1SYB A;  2H4O A;  1VQI A;  1CKN A;  5NUC A;  4CDC C;  3K7A H;  4DNI A;  4B3M L;  1IYV A;  3G7L A;  1AZQ A;  1XMQ Q;  3UDF A;  1YBY A;  1G51 A;  3V05 A;  4KKS A;  1ROD A;  1E24 A;  2NVQ B;  1LT6 D;  3CXC A;  1T5E A;  1V43 A;  4JOI A;  1IHZ A;  3SR1 A;  5ELF A;  3VYU A;  4YY3 L;  1X6O A;  4DV0 L;  4QUF A;  1PV4 A;  2BDN A;  2FXQ A;  4K14 A;  1MGS A;  1QJO A;  2F0S A;  2UU9 Q;  2ID0 A;  4GN4 B;  4QUC A;  4R8N A;  1DYQ A;  3SK5 A;  3Q6S A;  3B6Y A;  3HOW H;  4X62 Q;  2FJ2 A;  4DK1 A;  2GN5 A;  3U9O A;  3MA2 B;  1PTO B;  5K5P A;  1XNR L;  2UXC Q;  4B3M Q;  1JIC A;  1K3B C;  1NBW A;  2F0M A;  2IL8 A;  1H9K A;  1RKN A;  4LFA L;  3HRZ C;  1L2F A;  4XIG S;  2JA5 H;  1HTP A;  1EY5 A;  3D8G A;  4YY3 Q;  4CKC A;  4DV0 Q;  3RZO H;  2PZT A;  5IE8 A;  4X3U A;  2IX3 A;  1S4Z A;  3PF5 A;  2E2J B;  3MFY A;  2QEJ C;  1JOO A;  1Y1W G;  2ES2 A;  1VMC A;  1YNX A;  3ND9 A;  4WOR A;  4BBR H;  4J15 A;  2EY2 A;  1BBW A;  1FNV A;  1HZB A;  1XNR Q;  2NYZ D;  1AW7 A;  2F0L A;  1AN8 A;  2NZH A;  3P7J A;  3CQZ H;  1JT8 A;  2IT1 A;  4UP7 A;  5E7N A;  4A3I H;  2B3G A;  1VQE A;  1DOL A;  4LFA Q;  1BUV T;  1V9P A;  1BBX C;  2L0C A;  3ER0 A;  1S3O A;  5LMU L;  3H91 A;  2CCZ A;  4YWK A;  2PO4 A;  4OWT B;  1U4L A;  4BA2 I;  1XPU A;  3ULP A;  2XTI A;  1OXU A;  4FYD A;  1FR3 A;  2IWH A;  3OIQ A;  1ZYR C;  2DY8 A;  5ELE A;  1QZH A;  4A3F G;  5FLX L;  4X6A H;  1S5B D;  5C5L A;  5CMD A;  1EEI D;  2BA0 A;  2WAC A;  4OIK A;  1ONL A;  1B1Z A;  3OMC A;  3PSI A;  4RKL A;  2RKS A;  1YNN D;  4HMI A;  1SE8 A;  4G4K A;  2PMZ B;  1K8O A;  5LMU Q;  1SJH D;  1VQP A;  2F3W A;  2B2U C;  3EFX D;  3M85 A;  2R7Z B;  3J81 i;  2EE1 A;  4A75 A;  2VS1 A;  2HIX A;  1VQM A;  5JJL A;  5M3F B;  3HOV B;  5J3B A;  1XTD A;  4EQP A;  4KKT A;  1FGU A;  5FLM H;  3Q23 A;  1IYJ B;  4I65 A;  1WTP A;  1YIJ A;  1X3F A;  3A5U A;  1G6Z A;  3E3X A;  2B2U A;  4APV A;  4DR4 L;  4JI3 L;  4PZ6 A;  3NWT A;  4DAV A;  1BBU A;  1A6X A;  1Y8P B;  1DD2 A;  1RL2 A;  4IUR A;  3F2D A;  2K1B A;  2R92 B;  4A76 A;  3F2B A;  2HHH Q;  4JC0 A;  2OTJ A;  2FMM A;  4BWG B;  1R4Q B;  2UXB Q;  1O7L A;  5JEA H;  1X65 A;  3GV6 A;  1STE A;  3SK4 A;  1VQ6 A;  1Q3L A;  3P75 A;  1A62 A;  2A5H A;  2I5L X;  2O2L D;  1K9M C;  1Q81 C;  2SOB A;  4PQX A;  4MTK A;  4QIW E;  3PO3 G;  5M3M B;  4CKB A;  2RSO A;  5C4J B;  3NXW A;  5ISR A;  5EKI A;  4DK3 C;  4QGU A;  1KNE A;  3CCL A;  3BYY B;  1NE3 A;  2ZTE A;  1CM9 A;  4DR4 Q;  4JI3 Q;  2Z4I A;  2WII B;  4ILW A;  2Z6B A;  2HCC A;  2KCC A;  1BXT A;  4IUN A;  2MFI A;  5BR8 L;  4XDX A;  1HZ9 A;  3S9W A;  1L1O A;  1HZC A;  3EN2 A;  2H5X A;  3I4M B;  4K2L A;  2DJG C;  1TWG B;  4A3B G;  1TKW B;  3EA6 A;  2IPK D;  4OXP A;  3TZD A;  3H3V C;  2G9H D;  1IZ6 A;  4PNY A;  1XX8 A;  4JBM A;  2BH8 A;  1LUZ A;  4A3J B;  4P73 A;  3J81 c;  3KLS A;  3PUX A;  3AQQ A;  4X3S A;  1HA6 A;  5KNB A;  1X3G A;  4DF7 A;  1DGS A;  2NVT B;  2EY5 A;  3K81 C;  2AQ3 B;  2PZW A;  5DM6 3;  4OON A;  1STA A;  2EYJ A;  2R93 G;  4M8A A;  2HD3 A;  1W6K A;  4DR1 L;  3QR8 A;  3BVG A;  4LFB L;  4HSP A;  3A54 A;  3KJO A;  2EZV A;  4ID6 A;  1M90 C;  3LX0 A;  4DU9 A;  4RAU C;  3L7Z C;  3K7A B;  1U9R A;  1JJC B;  2K50 A;  3TS2 A;  2LMC B;  1Q86 C;  2K33 A;  1SLJ A;  1K0S A;  2Y0S G;  3FP9 A;  5C3E B;  1Q82 C;  4DV4 L;  1EL0 A;  1KAB A;  3VYT A;  4ME5 A;  2Q8R E;  5K36 G;  3DM3 A;  1EY9 A;  3T51 B;  5M5W H;  5I2X A;  2L4N A;  3PQI A;  3G6E A;  2ZJP A;  3J81 E;  2D2C C;  1TWC B;  3I7F A;  3KUP A;  4UHV A;  2E75 C;  4DR1 Q;  2B2W C;  5IYD H;  3TP5 A;  3A8J E;  3CRL C;  5IYB G;  1ENA A;  1KD1 C;  2Z6K C;  2K5D A;  2VQE L;  1S5D D;  1IXR A;  2JA6 B;  1GUS A;  2WAQ B;  1PH8 A;  1EQQ A;  3HOW B;  4PZ7 A;  3VDY A;  1Y1W H;  1JJ2 A;  3BG3 A;  1TS4 A;  2X6G A;  4XQQ A;  3M3Y H;  5JVH 3;  4YCU A;  1EY7 A;  3K6O A;  5C3W A;  3BDC A;  1CUK A;  4BY7 G;  3LWU A;  2A6E D;  3S24 A;  4G7Z C;  4DV4 Q;  4IN3 A;  4RFB A;  1E1O A;  2R7F A;  4KHP L;  3BS1 A;  3L9A X;  3HG9 A;  3OSO A;  1X55 A;  4KI0 A;  5I6W A;  3EBE A;  3RZO B;  1U4M A;  5EQ0 A;  5C3X A;  4R8I A;  1EY0 A;  4IJL A;  2IX1 A;  5KEE A;  2WB1 G;  1H9S B;  1FVI A;  3NWS A;  3RLN A;  2VQE Q;  2KA7 A;  1VQ7 A;  4BBR B;  1XPR A;  3HOU H;  1F9Q A;  4NXN L;  1SMY C;  2LY7 A;  1EOV A;  3BJU A;  2VY3 A;  3DM1 A;  1KL9 A;  2ZJQ A;  2EXZ A;  1NR4 A;  1AE3 A;  2HQE A;  3CC2 A;  4YCW A;  3C46 A;  3PUY A;  1CK1 A;  2M00 A;  4H02 A;  4H44 C;  4A3F H;  5IP9 G;  4A3I B;  4KHP Q;  2RHS B;  1MSH A;  1OXT A;  2Y0S E;  2JK8 A;  4XYO A;  1LT5 D;  4S3S A;  3OW2 A;  3TDQ A;  4FF1 A;  3F2C A;  5EPK A;  3NK9 A;  3H0G H;  3IFT A;  3I3C A;  1I4P A;  2NN6 I;  3SEB A;  1WTW A;  4NXN Q;  1UAP A;  1GUN A;  2QW7 A;  1YHA A;  4DNR B;  3SVM A;  5DEH A;  2YYZ A;  1SND A;  2ZM6 L;  1EY4 A;  4KY7 A;  3S1R H;  2K05 A;  1I6H H;  4GOP C;  1PTO F;  1Z7T A;  4QJF A;  3AMU A;  3MEF A;  1JJG A;  1FJG L;  2UXD L;  4ZLT F;  4WJW A;  1MJE A;  3OW7 A;  1VF7 A;  1EY6 A;  1Y14 B;  2F0O A;  2K7V A;  1ZXT A;  1GUT A;  2JXM B;  3D6C A;  1PH5 A;  2EY6 A;  1NTG A;  1V1O A;  5I6Y A;  3VR6 A;  4AYB B;  3OPO A;  3JC6 6;  1KAW A;  2Z1C A;  1EY8 A;  5FKA C;  3M4Y A;  4LF6 L;  2KHJ A;  2ZM6 Q;  4DN4 M;  4LUZ A;  1C8C A;  1P8L A;  3TP8 A;  3K0X A;  4GNX C;  1YNJ C;  3ND8 A;  2Z0S A;  5IT9 L;  2JA5 G;  3J7Y W;  1FJG Q;  4C1N I;  4LF4 L;  4B3R L;  4FNF A;  2UXD Q;  4GKK L;  1PDQ A;  1Q46 A;  2PW5 A;  4IQZ A;  4A3E H;  3TRZ A;  2E2H H;  1UUP A;  1XWE A;  4LF7 L;  4BY1 B;  3N6R A;  2D62 A;  4KMU C;  1B70 B;  4NB3 A;  4CDF C;  2GVA A;  2JA7 G;  4LF6 Q;  4A3B H;  2B29 A;  3QIA A;  4OEL B;  1W6J A;  5IGE A;  4OIJ A;  1ZKO A;  5HY6 A;  3NEL A;  4CJ0 B;  3OHX C;  3J7A F;  2AMC B;  1N34 L;  1BCP C;  4DUZ L;  2A1A A;  4GLA C;  5C4H A;  1SE2 A;  4LF4 Q;  4B3R Q;  1KXL A;  2OQK A;  4G57 A;  2VZA A;  4GKK Q;  3K8A A;  4QCL A;  1SSO A;  2JQO A;  5LMN W;  2X6L A;  2WP8 J;  4F88 A;  3A7A B;  2B8G A;  1FYC A;  3GTG B;  2ASB A;  1RD9 D;  4ALP A;  2JYO A;  4KD3 A;  4LF7 Q;  1PH9 A;  4RHS A;  1U4R A;  5H1S E;  3I73 A;  5KYL A;  2R93 H;  1PLF A;  4NXM L;  4HTH A;  1A3T A;  4IUQ A;  2R3Z A;  1G29 1;  2HDL A;  2ZT9 C;  3K7U C;  4K6L A;  4RG1 A;  1CSP A;  3I91 A;  1KDC A;  3D31 A;  2B2V C;  1N34 Q;  1VQB A;  2EJG C;  4K0K L;  4DUZ Q;  3S2D H;  3VR5 A;  3HKZ G;  4HJA A;  1PH4 A;  2L15 A;  5M5X H;  4MHE A;  2F4V L;  2JEA I;  5EKK A;  2B2Y A;  1F2Y A;  2QF7 A;  2LSS A;  4A4I A;  4JI6 L;  2EPB A;  1F2L A;  5A35 A;  3DMU A;  2QGQ A;  1PFS A;  5K36 H;  2SNM A;  1B44 D;  1WTH A;  4I7Z C;  1CHP D;  1WTX A;  1GXD C;  1ML0 D;  1PRT C;  2Q2H A;  1B4O A;  2KHI A;  3PGZ A;  2NWG A;  3NSW A;  5FLX c;  5IYB H;  4HSV A;  3P1H A;  3NTK A;  5GQO A;  4R1J A;  1VQ5 A;  5E4W C;  3CME A;  2EVB A;  3WOE A;  1LLR D;  2N88 A;  4K0K Q;  5CV5 A;  1CZG A;  2MO1 A;  1HA5 A;  3E0E A;  4FP5 D;  4KLK A;  3S1M H;  1PZK D;  1H9S A;  1RJT A;  5EAY A;  1ENC A;  2F4V Q;  3S2H H;  3HS0 C;  3Q24 A;  1H9J A;  1SNQ A;  1M4V A;  1V8Q A;  1PH1 A;  1EEF D;  4BY7 H;  2Z8L A;  4LNQ A;  4B3T L;  5C4Z A;  4JI6 Q;  4X3T A;  2KCN A;  2F0F A;  4IO9 A;  2BDO A;  1SRU A;  1EYC A;  4FXG C;  5E3F A;  2WFW A;  1XXG A;  1Q8K A;  4M1U B;  1M8A A;  4CDD C;  1QOH A;  2NB0 A;  3KJP A;  2K04 A;  4P71 A;  3RUZ A;  4H7B A;  5COY A;  1GHK A;  1Y1W B;  3JAM L;  1KQS A;  1MIU A;  3GTO H;  4F8M A;  1I4Q A;  2E2I H;  1EWI A;  5JJI A;  3W1G A;  3GTK B;  1CFM A;  3HOY H;  1GD7 A;  1STB A;  3CCV A;  3Q0A A;  4R4C A;  4K8I A;  3K5L A;  1YJW A;  3CCS A;  4A3D H;  5FLX E;  2NVY B;  1JWS D;  4B3T Q;  4BBS G;  1HH2 P;  2AHO B;  5IP9 H;  1DJR D;  2E8G A;  1LV9 A;  4H0L C;  3HOZ H;  3T56 B;  1NNX A;  2J4X A;  2EJM A;  4DK6 C;  2Q2T A;  4HMJ A;  2F0Q A;  1PH2 A;  2C5C A;  2D9U A;  2VUM H;  2PQE A;  3GTQ H;  3TP6 A;  3ULJ A;  2UU9 L;  3NEM A;  2A19 A;  5CBE E;  1LTB D;  1PH6 A;  4O0A A;  1WCM G;  4KK7 A;  1MJC A;  4ZKC B;  2A68 C;  2KCT A;  2QIL A;  3RLO A;  4HIM A;  4A3C G;  3NBH B;  2E5L Q;  4A3F B;  4K8J A;  4ZUI A;  4RA8 A;  3KYH C;  4IUV A;  1D5M C;  3AYH B;  4LUV A;  2UXC L;  2HCI A;  4F7X A;  1WTR A;  3R2I A;  1BCP F;  1IBL L;  3STB C;  3TS0 A;  3FVQ A;  3U50 C;  3EQL C;  2I5M X;  3J7A 5;  1A3U A;  2ZJR A;  3MXU A;  3A5Z B;  2HIV A;  5GAH C;  2K52 A;  2KBN A;  1TY0 A;  1WJJ A;  3S16 B;  4POG A;  1A8V A;  4A3L G;  1U0L A;  3CP0 A;  1EQV A;  4ZAI A;  1UEB A;  1I6H B;  3HP3 A;  5C4X H;  1LTG D;  1CI3 M;  5DAU A;  3PMF A;  5FK9 C;  5CV4 A;  2F03 A;  2RQX A;  1HR0 L;  1M1K C;  1IBL Q;  5IYD G;  3GP7 A;  4FO2 A;  1UEA B;  5G3L D;  3DLL A;  2V4D A;  4EVO A;  5FO9 B;  1Q8I A;  3GTP H;  1WFQ A;  3DUZ A;  4DK0 A;  3HEJ A;  2KJX A;  1WD1 A;  2RCN A;  4YWM A;  3BDL A;  2K01 A;  1MI2 A;  4X66 L;  4C3J H;  5IOC A;  1PRT F;  3KFU A;  2SDF A;  4AIM A;  3I4L A;  1HNX L;  1LTS D;  4R4I A;  2WKD A;  2JA7 H;  3PO3 B;  4LF5 L;  1EYD A;  5I9P A;  5JAV A;  1HR0 Q;  1RHP A;  2F0I A;  2AKW B;  4FF2 A;  1HTL D;  4V19 0;  4XTC S;  1LTL A;  5ELO A;  2L1B A;  3I8Z A;  2E2H B;  2A6H D;  2CH4 W;  1EIF A;  3I2Z A;  3HOU G;  2RDH A;  3VR2 A;  2DN8 A;  2K5H A;  4YIJ A;  4Y7N H;  1T5X D;  1SMX A;  3W2D A;  2MO0 A;  1A3V A;  1E7Z A;  2AUK A;  2L55 A;  4OGQ C;  4X66 Q;  4A3B B;  3ZJY C;  3R8B A;  4RHR A;  4A3G G;  3G48 A;  1SXT A;  1DCZ A;  3GTM B;  1FGB D;  1HNX Q;  3KDF A;  3CD6 A;  1GKH A;  2KEE A;  4LF5 Q;  4QY7 A;  3L3O C;  3Q8D A;  3PO2 G;  1QIL A;  3H0G G;  2L12 A;  2OQ0 A;  3X3N A;  2MQH A;  5C0X I;  1E0B A;  1HQM C;  1SYD A;  3LNN A;  3UE0 A;  2WV6 D;  4DAP A;  1H9M A;  2HHH L;  4K5X A;  1GVP A;  1YI2 A;  2R93 B;  4QF4 A;  2CHB D;  4O2D A;  2UXB L;  1PFM A;  5E4X A;  4ZK9 B;  1SYE A;  2YU9 H;  2CKZ B;  5EGT A;  5M5Y B;  1LAB A;  4NPS A;  1NY4 A;  3RNU A;  4LK1 C;  3S2D B;  4JYA Q;  1D1K A;  4YHH L;  3J7Z C;  3M4O B;  2N3S A;  3QG1 A;  3HZX A;  1R4P B;  4FF3 A;  5FO8 B;  1VQA A;  1PA6 A;  1LO5 D;  3AU7 A;  1Q1B A;  2Q8T A;  3F1Z A;  3KF8 B;  2P5Z X;  5IGB A;  1I5F A;  5IGD A;  2AWO A;  3F8T A;  1JOK A;  1HQR D;  3OWF A;  1I50 H;  4C3I G;  3DWQ A;  1WTO A;  1HPC A;  1ASY A;  2JSO A;  2BE5 D;  3IAY A;  1ILP A;  2VB3 X;  2DY7 A;  3R2T A;  5EBD A;  4UPA A;  1TR5 A;  1OXX K;  4DV1 L;  1CZW A;  2AQ2 B;  2PNH A;  4DR5 L;  5D14 A;  4YHH Q;  5HGQ A;  2RSN A;  3E0J A;  3S2H B;  3EVQ A;  1E22 A;  3G4S A;  4BY7 B;  4GOP B;  2F0U A;  3WOF A;  4A3E G;  1XYI A;  4K2K A;  3H3V I;  5IY0 A;  3IRB A;  1QVC A;  1B8A A;  3FPP A;  4IPC A;  4MIU A;  3S17 H;  4C3H G;  1EIY B;  4U68 A;  3NBH A;  4BBS H;  1FL0 A;  1A15 A;  3E9I A;  3FKI G;  2WB1 B;  2ICI A;  1FNU A;  2IW3 A;  1RIP A;  2E2I B;  3DEP A;  2OF1 A;  4DV1 Q;  2FIN B;  4UAI A;  4DR5 Q;  3RN5 A;  2OWO A;  4IFD I;  3DEO A;  4HN7 A;  2JE6 I;  3SE0 A;  3SHL A;  1QB5 D;  1WCM H;  5IT9 c;  5C0X J;  2MGS A;  5IP7 G;  3K5M A;  4GNX B;  4A3C H;  5IIF A;  1ICF B;  2AQ1 B;  1EYA A;  2NZO A;  1Q12 A;  1IW7 D;  2AUJ D;  4A3M H;  1XMO L;  2NTT A;  4IZ8 A;  2CWA A;  2PW7 A;  3MXN B;  3MXG A;  3GTQ B;  1H95 A;  3GTJ H;  1N33 L;  1PYS B;  3J7A V;  4C56 C;  5ELD A;  4CHT B;  4LFC Q;  1CA5 A;  2EY1 A;  1XNQ L;  1MBY A;  4L5Q A;  5ELN A;  2O5I C;  1K8G A;  5A2Q E;  2K5N A;  4DKA C;  1Q7Y C;  4A3L H;  5GAG C;  5BN3 A;  3A74 A;  4JI4 L;  1VQC A;  1BCP B;  3OMG A;  4JBJ A;  5C6A A;  4OO1 I;  1Q90 A;  3MEH A;  1XMO Q;  2A6H C;  3SK6 A;  3JAM i;  1DZ1 A;  1CHQ D;  3D4W A;  1QG7 A;  3E9H A;  3IKJ A;  5IT9 E;  1WTQ A;  2R61 A;  5I2Y A;  1AH9 A;  5HUR A;  1I6V C;  1VS0 A;  1N33 Q;  4Q0F A;  1D5Z C;  3MAQ A;  2VXW A;  3GTL H;  1YJ9 A;  2PI2 A;  1XNQ Q;  3M9B A;  4WRD A;  1KDA A;  5CR3 A;  1B9N A;  5I9O A;  3CU7 A;  1ESF A;  4CBV A;  4G7O C;  2K5V A;  5C44 G;  4JI4 Q;  2I46 A;  1YNN C;  1R9T H;  2B2W A;  2MNA A;  2PZU A;  3K58 A;  2JA5 B;  2HQL A;  1SNM A;  2Z6K A;  3URY A;  2A8V A;  4IOA A;  4B9W A;  2KHS A;  1UNS A;  2ZXO A;  3G71 A;  3FDT A;  4EQN A;  1VQ9 A;  2OTL A;  2I5H A;  3AB9 A;  4LF8 L;  2NN6 G;  2BA1 A;  2F0N A;  2XVS A;  4IFD J;  4JI5 L;  1PRT B;  1E1T A;  3HOY G;  4HJ9 A;  2JA8 G;  1VF5 C;  4DNT B;  2PMZ E;  4OHJ A;  2JA7 B;  2K5W A;  2CQA A;  1F9R A;  4A3D G;  5CC4 A;  4YWL A;  3CQZ B;  1WI5 A;  1LTR D;  4UDU C;  4A3G H;  4BXX G;  1ZEQ X;  3I4N G;  3HOX G;  1KAA A;  3HOZ G;  1ILQ A;  5CV7 A;  5FJ8 G;  1STG A;  2R6G A;  3BZC A;  1NMG A;  5J1Z A;  1TQO A;  1X3P A;  1E2V A;  3PO2 H;  4Y7N B;  4J6H A;  5C5M A;  1W2B A;  4OX9 L;  2VUM G;  4A3J G;  4EQO A;  3K57 A;  2EYO A;  4XYQ A;  3VYS A;  1CKM A;  4A93 H;  3D0F A;  5D3I B;  4LF8 Q;  1Y1V G;  1RDP D;  1SFO H;  1IBK Q;  4JI5 Q;  3JAM c;  2TSS A;  5JVG 3;  3A8I E;  1VQ8 A;  1J6Q A;  2A74 C;  4FXK C;  2OXP A;  3KLR A;  4RKB A;  1BNZ A;  3KF8 A;  4R4Q A;  4L6T B;  2QCP X;  5KGU A;  5GRO A;  3J80 i;  3UDX A;  1TY2 A;  2A73 B;  4PG3 A;  1F9P A;  1BKB A;  3CC7 A;  2EOT A;  3HKZ B;  3PV0 A;  5CGK A;  4DAY B;  4JI8 L;  4WFN 3;  2KUM A;  5KNC A;  3U4Z A;  4ULL A;  4OX9 Q;  4HID A;  4CGY B;  1K0R A;  1B2T A;  1J9O A;  4IPG A;  1JWM D;  2G9D A;  2YU9 B;  2DNE A;  4GZY C;  5C4X G;  4C3I H;  2RHQ B;  1LM0 A;  3CKI B;  4GOP A;  2FFK B;  1YEZ A;  4KTA A;  3U9S A;  4UP8 A;  5KND A;  2VQF L;  4I7A A;  4MN3 A;  5JOB A;  4RH6 A;  1NAP A;  3OTO L;  4CJ2 C;  3JAM E;  1IW7 C;  4JI8 Q;  2ATW A;  2VB2 X;  2KQ3 A;  4N8F A;  1I50 B;  1UE5 A;  1WYD A;  2K6A A;  1L0Y B;  5BN5 A;  1D5X C;  1OTC A;  2ICE C;  4OL7 A;  4C3J G;  1YZ6 A;  3ERO A;  1LTI D;  2EYH A;  2IHE A;  1SR3 A;  3CCU A;  2LXK A;  4TQU S;  4C3H H;  3FMC A;  4PMW A;  1NCV A;  4DA2 A;  4GNX A;  1IBM Q;  1KRT A;  1D7Q A;  3CF5 A;  4DR7 L;  4GLV B;  3FKI H;  2KEC A;  4HR7 B;  4ZUJ A;  5M9O A;  4JI1 L;  2NZ1 D;  2VQF Q;  1G91 A;  3FPU B;  1JWU D;  1HUN A;  3MFG A;  3MXN A;  3PCO B;  1U4P A;  3OTO Q;  4DV6 Q;  4HJ5 A;  2L5T A;  1B9M A;  3GV3 A;  3TME A;  4A3K G;  4OEM B;  3C2P A;  5EKL A;  1HUM A;  2JA9 A;  1G2S A;  1X3Q A;  4JBW A;  5EBC A;  5ELB A;  3R3O A;  3T53 B;  5HGT A;  2HT1 A;  5IP7 H;  4BBS B;  2IX0 A;  4HAE A;  4B9X A;  4OO1 H;  4BS9 A;  1ESR A;  4DR6 L;  1SYG A;  1TS2 A;  2UUC Q;  3KF6 B;  1SRO A;  1QWY A;  5AJ3 L;  4POF A;  4DR2 L;  3NPP A;  2MJ8 A;  4TSS A;  5CV6 A;  3H15 A;  1S5F D;  2ENB A;  4DR7 Q;  1JCK B;  1VQD A;  2AWN A;  2RF4 A;  3CCE A;  2NVX H;  4K5W A;  2HUG A;  1WCM B;  4JI1 Q;  1EWC A;  2A6E C;  2B63 G;  3NTI A;  1E2W A;  2B2T C;  1TT2 A;  1JR0 D;  3T13 A;  1CSQ A;  4IPD A;  4RCO A;  5IWA L;  5JJK A;  4HJ8 A;  2PYK A;  4JVZ A;  2NBF A;  2WAQ E;  2R7Z H;  3KDF B;  3NE5 B;  1YVC A;  1UWV A;  4P2C B;  1XPO A;  4DR6 Q;  1JE5 A;  3IL8 A;  2N55 A;  5M3F H;  1AZP A;  1MD2 D;  5AJ3 Q;  2SEB D;  2B2V A;  4DR2 Q;  2K32 A;  1AFP A;  3A56 A;  2LS0 1;  4GLX A;  1VQJ A;  1K8M A;  4JI2 L;  2DGY A;  1DON A;  3BU2 A;  3K5O A;  5D65 A;  1HFG A;  3H09 A;  3G6J B;  3DWP A;  1HNZ L;  5IWA Q;  5M5W B;  4AYB G;  3MHB A;  2CWP A;  2QDL A;  2XN9 C;  3BZD B;  4N8X 1;  5C44 H;  5J22 A;  3VR4 A;  1T9H A;  1UE7 A;  1N32 L;  1Z9F A;  1AP0 A;  4L63 B;  1QUQ B;  1ZYR D;  2YTX A;  4RMF A;  2Q8I B;  2KEN A;  4LWC A;  3NHH A;  5J39 A;  3KK7 A;  1ET6 A;  4P72 A;  2XRS D;  2F0T A;  3CCJ A;  2F0V A;  1KLU D;  2OT2 A;  5M3M H;  1SN8 A;  3M3Y B;  4HIO A;  1TWH H;  3BVZ A;  3CCR A;  4JI2 Q;  1DOM A;  2NN6 H;  1IKL A;  1PXU A;  2E5L L;  1A0I A;  2Z9H A;  2B8F A;  2L9H A;  2Q2I A;  1R9T B;  3K5N A;  1HHV A;  1HNZ Q;  2JA8 H;  1GUO A;  3TSS A;  4DUY L;  1OXS C;  1GUG A;  3EIV A;  1J5E L;  4P74 A;  4BXX H;  2VW9 A;  4C2M H;  1N32 Q;  3I4N H;  3HOX H;  3D3R A;  2IJ0 A;  5T1I A;  5FJ8 H;  3HOU B;  1NMF A;  5EJW A;  1VQL A;  4O1N A;  4DR3 Q;  1Y8N B;  2F1M A;  2F0G A;  1D6E C;  4ZRZ A;  4A3J H;  5JJZ A;  2F4I A;  3ICE A;  2D5D A;  1PYB A;  1Y1V H;  3UI2 A;  4DAY A;  1DXM A;  4A3G B;  3W3A A;  3MXP A;  4QIW B;  2A69 D;  2CVR A;  4A3M G;  1VDZ A;  1WVL A;  2XSC A;  3N52 A;  3D4D A;  3I56 A;  4DUY Q;  3PO2 B;  1NUC A;  1HZA A;  1J5E Q;  4GS3 A;  2XRQ D;  4JV5 L;  4AYB E;  4JOI C;  3H0G B;  3C3L A;  3V96 A;  2B39 A;  1MKH A;  2YV5 A;  1TWA H;  4HIK A;  1K28 A;  4TRD A;  1TVX A;  4XT3 B;  1B53 A;  4ME3 A;  1EYG A;  1S72 A;  4UY8 C;  3PIO A;  1J8I A;  4Y52 H;  3S1R B;  3MVV A;  5C3E H;  4K6D A;  3UE1 A;  1B3Q A;  3DWA A;  4PMB A;  2NUC A;  4FF4 A;  4JPB W;  5L37 A;  3RN2 A;  1TWC H;  2CQO A;  1B3A A;  2MHV A;  1JE4 A;  4O42 A;  4Q5V A;  4JV5 Q;  3BVM A;  4KV6 A;  2D0O A;  1E2Z A;  4KHV A;  3V2T A;  2IY5 B;  4U67 3;  1G6P A;  2VNU D;  3H94 A;  2JA6 H;  4DV3 L;  2UUA L;  3J80 L;  2ZTD A;  1CQV A;  4ZKB B;  1HRJ A;  4C3I B;  1ICW A;  2EYF A;  3A8K E;  3E6Z X;  1FNW A;  1F77 A;  1PTO D;  5E1F A;  3TRE A;  3QWN A;  1QNU A;  4J8Q A;  5CV9 A;  2LKV A;  1PH7 A;  1K73 C;  1GO3 E;  3MZ5 A;  3VA5 A;  3U58 A;  3S14 H;  2EXD A;  4DAM A;  3PUZ A;  4KD4 A;  3KF6 A;  1I3Q H;  5COR A;  5IGF A;  5C0X G;  4K5V A;  1KTK A;  2X69 A;  1K83 H;  4A3E B;  2ZXR A;  3KOJ A;  1JOQ A;  4DV3 Q;  2UUA Q;  2MP1 A;  4CJ1 B;  4A3K H;  4IOC A;  4UP9 A;  1HNW L;  2F0E A;  1D1I A;  1BDO A;  2N8N A;  4C3H B;  2Q2U A;  2QDB A;  1LT3 D;  3E5S A;  1LAC A;  3S1N H;  3CPW A;  1BO0 A;  1GM5 A;  3FKI B;  4WJ4 A;  4OWW B;  3A7L A;  5JEA J;  2K75 A;  3S1Q H;  2PQA B;  3D4R A;  4KHZ A;  4EGV A;  4JYA L;  3I70 A;  1GUW A;  1C4Q A;  1VMP A;  3LWE A;  1EZ8 A;  2K28 A;  4LW1 A;  5FOB B;  1VQN A;  1KNA A;  4HCS A;  1LT4 D;  3VYR A;  2F0W A;  1STY A;  1Q1E A;  1G8Z D;  4X3K A;  5EPL A;  1C0A A;  1TXY A;  4NW2 A;  2B63 H;  4ZYS A;  4A93 G;  5CV8 A;  4ZCK A;  4RGT A;  1B7Y B;  3RD4 A;  3DXJ C;  1KLG D;  2F3I A;  1D2B A;  1QVG A;  4FVM A;  3HGB A;  1QZG A;  4KKU A;  3RLF A;  1HNW Q;  2PNR C;  1WD0 A;  5DLQ E;  1CQF A;  1HCZ A;  4QMG A;  3R93 A;  1Y8O B;  3K80 C;  1C9O A;  3OOC A;  2NVX B;  1KRS A;  1HR0 W;  3M7N A;  1YIT A;  3RZD H;  1I4H A;  1VQK A;  1UE6 A;  3PF4 A;  5M5X B;  4X65 L;  1QUQ A;  1JC7 A;  4Z9C B;  1SEB D;  4MNO A;  4L5S A;  1SNO A;  1TWF H;  2Y0S B;  2GA4 B;  1BQQ T;  2WKC A;  1X9N A;  2F0P A;  3S15 H;  1RTN A;  1SMY D;  1PMR A;  3HFZ B;  1P16 A;  3I90 A;  3J81 j;  3GO5 A;  4H13 C;  4B3S L;  1ET9 A;  5LL6 X;  4J1M A;  3PUV A;  4QL5 A;  4KJN A;  4IFD G;  2A69 C;  2QEX A;  3IFD A;  2J0T D;  3KBX A;  4IAL A;  3L2P A;  3S1M B;  4X65 Q;  1C48 A;  1KHI A;  3MWY W;  4DV2 L;  2XNA C;  4KN4 C;  4ODG A;  2G5D A;  5C44 B;  1BF4 A;  1QE6 A;  1G2T A;  3NTH A;  2N78 A;  3CC4 A;  1WOC A;  5F2D A;  2PPB C;  2H1E A;  2I0Q A;  1L1O C;  1EWH A;  3GQB A;  3NBI A;  2SNS A;  4BY1 H;  4X64 L;  4L5T A;  1EQR A;  3F2U A;  3HKS A;  5AFW A;  5GAE C;  4RWS C;  1L0X B;  1YHQ A;  2E76 C;  5LL6 S;  3RMH A;  3GTO B;  4KN7 C;  1TWH B;  4B3S Q;  2J7Z A;  1F2Z A;  4LFC L;  3NQI A;  2EYP A;  1PYW D;  1VQH A;  3HOY B;  2CW0 D;  1EIG A;  1O7I A;  2JA8 B;  1SBB B;  4A3D B;  3PIP 3;  4DV2 Q;  1VCI A;  1RCV D;  1XJV A;  1ENF A;  3WWV A;  1SE4 A;  4OO1 G;  3M7G A;  2TMP A;  4C2M B;  3GTG H;  1EU3 A;  3I4N B;  3HOX B;  4JK1 C;  1V1P B;  3HOZ B;  3UDG A;  2E2D C;  4X64 Q;  4MTN A;  3I72 A;  4F87 A;  3OWE B;  4DV7 L;  2VUM B;  1PTO C;  2XWJ B;  1EFW A;  1JQY D;  3KLW A;  1Y1V B;  1GOZ A;  5T1G A;  4L5R C;  4GN3 B;  1D8L A;  1YNJ D;  3W1B A;  5BR8 Q;  1Y69 U;  2PCF B;  5GAD C;  2DUD A;  1HJP A;  3T1Y L;  3FHW A;  1QVF A;  1IL8 A;  1RF2 D;  4PMC A;  2R7Z G;  1W3S A;  1SNP A;  1EFI D;  3CCM A;  3I4O A;  3NQT A;  2F0D A;  5M3F G;  4R4T A;  3HOV G;  1TWA B;  1N36 L;  3ERQ A;  1X56 A;  5KIX A;  4DV7 Q;  4MZ9 A;  1AEX A;  2KCM A;  3SK8 A;  1YJN A;  1JMC A;  4LJZ C;  1A2U A;  1N9W A;  1X54 A;  3FRP B;  4TVA B;  1SE3 A;  5C4X B;  1BCP D;  2YTY A;  2PI2 E;  2R92 G;  1EOT A;  3I55 A;  2JJQ A;  2OEO A;  4IUT A;  3CRK C;  1A63 A;  1IKM A;  4WJ3 M;  3T1Y Q;  5ELC A;  4DGZ A;  3CHB D;  2EQS A;  1BR9 A;  5KRU A;  4JI7 L;  3M4P A;  5DM7 3;  4LFB Q;  5KYI A;  1KDB A;  2BH2 A;  2LFN A;  3CCQ A;  3GTP B;  3PIP A;  1VQF A;  4FDB A;  2XWB B;  3T16 A;  1H9R A;  5FO7 B;  1N36 Q;  2Z4H A;  3VA7 A;  3X3M A;  1SJE D;  5M3M G;  5C0X H;  2JP1 A;  1JB3 A;  2PQA A;  3BYT B;  2FHT A;  4C3J B;  4GN5 A;  3H6M A;  2CFM A;  2GVB A;  1IBK L;  3GTK H;  3UDI A;  1E3P A;  2LXJ A;  4DPG A;  3CPF A;  3SDZ A;  2ZXP A;  1S5C D;  3S14 B;  2I07 B;  1IL2 A;  3I4M G;  2NVY H;  2ZTC A;  1I3Q B;  3CAM A;  4JI7 Q;  2V1C C;  3AFP A;  1K83 B;  1I94 L;  1PZI D;  3CW2 C;  1NSN S;  5IOD A;  4A3K B;  1YHB A;  1PRT D;  3GD7 A;  2N49 A;  1CTM A;  2E74 C;  1I4G A;  2RDG A;  1EU4 A;  3O13 A;  2BE5 C;  1TS5 A;  2F0H A;  3S1N B;  4LMQ D;  1MSG A;  1PVO A;  3BZK A;  2KED A;  1ASZ A;  3S1Q B;  4XT1 B;  4LF9 L;  1PFN A;  1F2M A;  1Z47 A;  4QB4 A;  1II3 A;  4RGO S;  2FMC A;  5IGC A;  2KOL A;  4JG2 A;  3QO2 A;  3TZU A;  3MTS A;  5IYC G;  2NVQ H;  4N9P A;  2RBM A;  2B63 B;  2M9V A;  4HJ7 A;  1JOR A;  1I94 Q;  1F9S A;  4KJO A;  1IYU A;  1JB7 A;  1HXY D;  1O80 A;  4AH6 A;  2OCE A;  2NTS A;  2QKI C;  4NP5 A;  5G3L F;  5LMN L;  3KLS X;  3S16 H;  4XQN A;  3W5O A;  2MUY A;  2EYM A;  5DNF A;  1DM0 B;  3H3V H;  4EQ5 A;  5C3E G;  4LUO A;  4FXD A;  3RZD B;  2R7D A;  4LF9 Q;  1IBM L;  1PTO H;  4P75 A;  2L11 A;  2CW0 C;  1CA6 A;  1GJX A;  4EX5 A;  1CKN B;  1TWF B;  3NP8 A;  3KBG A;  4DV6 L;  3ITP A;  4IFD H;  1K8A C;  3TEH B;  3ULL A;  2JA6 G;  2WAQ G;  5A2Q L;  3A0J A;  2E2J H;  3S15 B;  2WB1 E;  3BDO A;  3HOW G;  1DOK A;  3C1F A;  3TQY A;  2EDG A;  4OWX B;  5LMN Q;  3TP7 A;  3QOL A;  4HED A;  4DFA A;  4CDE C;  3GDE A;  3RR5 A;  4AQY L;  2A68 D;  2JEB I;  1I4X A;  3ERS X;  4JI0 L;  1QNK A;  2UUC L;  4RCN A;  2DJF C;  2D0P A;  4KY5 A;  2O4X A;  5LHY 1;  1VQ4 A;  3J81 L;  4IPH A;  2O5J C;  1O78 A;  5CYU A;  1BOS A;  1I4R A;  1O7Y A;  4TKO B;  3PO3 H;  3PUW A;  1VQG A;  1V1P A;  3SXH A;  3T4A C;  3ZYY X;  1EUJ A;  3STB D;  4GKJ L;  1L0W A;  4KY6 A;  2QA4 A;  2YTV A;  4BBR G;  4ZQ3 A;  1KIX A;  1LTA D;  4L8J A;  4B08 A;  3S17 B;  3QB3 A;  2KVM A;  3TN2 A;  3LGJ A;  3J80 c;  3U4V A;  5CBA E;  5JPN C;  4AQY Q;  4JI0 Q;  2EIF A;  4A3I G;  3GTM H;  5I4D A;  3QOJ A;  1CT1 D;  1EQT A;  2DNC A;  3AFQ A;  3D6W A;  2CH4 A;  1TS3 A;  3M4Q A;  2K4K A;  2UUB L;  4JBK A;  4GKJ Q;  2K5Q A;  2F0K A;  1VQO A;  4JCV E;  1SDF A;  1Z6H A;  4PV1 C;  1B50 A;  3T1H L;  1CKO A;  4A3M B;  3ONA B;  2B2Y C;  5IGG A;  1XTC D;  1A2T A;  4BA1 I;  3P20 A;  3QJY A;  4R4O A;  3FEW X;  5BN4 A;  2EYL A;  3NEN A;  2IHF A;  3TBI B;  4RGN A;  1EZ6 A;  4DXG A;  3GTJ B;  3K59 A;  3AEV A;  4E6I A;  5M5Y H;  5EPJ A;  1S40 A;  4CKE A;  3HOV H;  2F3V A;  4DXF A;  4LAA A;  4IUP A;  2B2T A;  3A55 A;  3M4O H;  1BVS A;  3J80 E;  2UUB Q;  2XIW A;  1EIH A;  2RA4 A;  1FD7 D;  1STH A;  2K14 A;  3MC0 B;  2VL6 A;  2C35 B;  3T1H Q;  1PHJ A;  2R92 H;  1O7Z A;  3NUC A;  5TSS A;  4HCE A;  4JW0 A;  4NXM Q;  4IUU A;  5FLM G;  1HFN A;  4IJH A;  1OXV A;  1NJI C;  4NKL A;  4YCV A;  4QQB X;  3PIO 3;  1N8R C;  3GTL B;  2K03 A;  4DR3 L;  1U5K A;  1MHW C;  2JN4 A;  5C4J H;  4G7H C;  1SAP A;  4ABN A;  3K0Y A;  1STN A;  3CMA A;  4DV5 L;  3VR3 A;  4V0B A;  5JEA G;  1C7Y A;  3DHQ A;  4BY1 G;  1V1Q A;  1SYF A;  3I4M H;  1KC8 C;  2F0J A;  2XGT A;  1TWG H;  1LTT D;  4C1N K;  4XQJ A;  3Q22 A;  3WDN A;  1QCB D;  4RGM A;  2WIN B;  1UE1 A;  1OO9 B;  2MPM A;  4N9T A;  3L0O A;  3EJI A;  4XXE A;  2RDF A; 
#chains in the Genus database with same CATH homology
 5DLQ E;  4LF4 L;  4B3R L;  3E9H A;  2UXD Q;  2ALY B;  1PH3 A;  4GKK L;  3K80 C;  1XMQ L;  3HKZ E;  1C9O A;  1AH9 A;  1KRS A;  1HR0 W;  1Q46 A;  2NVT H;  1VS0 A;  1AE2 A;  4A3E H;  1YIT A;  1N33 Q;  3M7N A;  3TRZ A;  2E2H H;  3RZD H;  3SGI A;  4DV5 Q;  4LF7 L;  3GTL H;  1K3R A;  2PI2 A;  1YJ9 A;  2D62 A;  1XNQ Q;  4PZ8 A;  1VQK A;  1UE6 A;  3M9B A;  3PF4 A;  1B70 B;  3OYY A;  4NB3 A;  4X65 L;  1QUQ A;  2GVA A;  2JA7 G;  4MNO A;  5IYC H;  2F52 A;  4LF6 Q;  2B29 A;  4L5S A;  4A3B H;  1TWF H;  2K5V A;  5C44 G;  4JI4 Q;  1L1O B;  1X3E A;  5HY6 A;  1R9T H;  1LYL A;  3NEL A;  1X9N A;  2MNA A;  2AMC B;  1N34 L;  4DUZ L;  3S15 H;  2A1A A;  4GLA C;  4X62 L;  2HQL A;  2Z6K A;  1VQI A;  2A8V A;  1CKN A;  4IOA A;  4LF4 Q;  4B3R Q;  3K7A H;  3HFZ B;  2OQK A;  4DNI A;  1KXL A;  2VZA A;  4GKK Q;  4B3M L;  1P16 A;  3K8A A;  3G71 A;  1XMQ Q;  2JQO A;  3UDF A;  5LMN W;  1YBY A;  3J81 j;  2WP8 J;  3GO5 A;  1G51 A;  1VQ9 A;  4B3S L;  2OTL A;  2I5H A;  1E24 A;  2NN6 G;  4LF8 L;  2BA1 A;  2ASB A;  3CXC A;  4ALP A;  1V43 A;  3PUV A;  4JOI A;  4QL5 A;  4JI5 L;  1PH9 A;  4LF7 Q;  4IFD J;  4IFD G;  5H1S E;  2QEX A;  4YY3 L;  1E1T A;  3HOY G;  1X6O A;  4DV0 L;  3L2P A;  2R93 H;  4NXM L;  4HJ9 A;  2JA8 G;  1PV4 A;  4X65 Q;  2PMZ E;  1G29 1;  2FXQ A;  1KHI A;  2UU9 Q;  4DV2 L;  4A3D G;  2ID0 A;  3K7U C;  4YWL A;  4RG1 A;  1WI5 A;  4A3G H;  1CSP A;  2N78 A;  1WOC A;  4GN4 B;  3CC4 A;  4BXX G;  3D31 A;  2I0Q A;  1L1O C;  3I4N G;  3HOX G;  3HOZ G;  1N34 Q;  1VQB A;  4K0K L;  4DUZ Q;  3B6Y A;  4X64 L;  4X62 Q;  4L5T A;  4BY1 H;  3HOW H;  4HJA A;  3HKZ G;  2GN5 A;  3S2D H;  5FJ8 G;  1PH4 A;  2L15 A;  2R6G A;  1EQR A;  3BZC A;  1NMG A;  3HKS A;  5M5X H;  1XNR L;  2F4V L;  2JEA I;  3PO2 H;  5GAE C;  2VUM G;  2UXC Q;  1W2B A;  4B3M Q;  4OX9 L;  1YHQ A;  4A4I A;  2LSS A;  4A3J G;  4JI6 L;  1CKM A;  1NBW A;  3D0F A;  4A93 H;  4B3S Q;  4LF8 Q;  1Y1V G;  4LFA L;  4LFC L;  1SFO H;  2QGQ A;  1PFS A;  1IBK Q;  4JI5 Q;  1L2F A;  3JAM c;  4XIG S;  2JA5 H;  1VQH A;  1VQ8 A;  1J6Q A;  4YY3 Q;  4DV0 Q;  3RZO H;  1O7I A;  5IE8 A;  2Q2H A;  3PF5 A;  2KHI A;  4R4Q A;  3PGZ A;  1Y1W G;  5FLX c;  5IYB H;  1VCI A;  4DV2 Q;  5GQO A;  3WWV A;  5GRO A;  1XJV A;  2ES2 A;  4R1J A;  1YNX A;  4OO1 G;  3J80 i;  3UDX A;  1VQ5 A;  3GTG H;  4PG3 A;  3CME A;  1BKB A;  4BBR H;  4J15 A;  1BBW A;  3CC7 A;  3UDG A;  4K0K Q;  2MO1 A;  3E0E A;  4X64 Q;  3PV0 A;  4MTN A;  4JI8 L;  4DAY B;  4KLK A;  3S1M H;  1HZB A;  1XNR Q;  5EAY A;  3U4Z A;  4DV7 L;  2F4V Q;  3S2H H;  4OX9 Q;  4HID A;  1PH1 A;  4BY7 H;  2NZH A;  4LNQ A;  4B3T L;  1K0R A;  3CQZ H;  4JI6 Q;  1JT8 A;  2IT1 A;  4UP7 A;  1EFW A;  3KLW A;  5E7N A;  4IPG A;  4A3I H;  2B3G A;  4L5R C;  1VQE A;  4LFA Q;  4IO9 A;  1SRU A;  1V9P A;  5C4X G;  4GN3 B;  1D8L A;  3ER0 A;  1S3O A;  5LMU L;  4C3I H;  2RHQ B;  2WFW A;  1LM0 A;  2CCZ A;  1Q8K A;  4YWK A;  3W1B A;  5BR8 Q;  4OWT B;  4GOP A;  5GAD C;  3KJP A;  1YEZ A;  4BA2 I;  2DUD A;  4P71 A;  1HJP A;  1XPU A;  3ULP A;  3T1Y L;  3FHW A;  2XTI A;  1QVF A;  2R7Z G;  4UP8 A;  1W3S A;  1MIU A;  1KQS A;  3GTO H;  1OXU A;  2VQF L;  3CCM A;  3I4O A;  2E2I H;  1EWI A;  5JJI A;  3W1G A;  3OTO L;  1QZH A;  4A3F G;  5M3F G;  4R4T A;  3HOV G;  3HOY H;  4JI8 Q;  4X6A H;  1GD7 A;  2ATW A;  1N36 L;  1X56 A;  3CCV A;  4DV7 Q;  1UE5 A;  4MZ9 A;  4R4C A;  2KCM A;  1WYD A;  1YJW A;  1YJN A;  2BA0 A;  1JMC A;  3CCS A;  4A3D H;  4B3T Q;  1OTC A;  4BBS G;  1HH2 P;  1N9W A;  1X54 A;  2AHO B;  3PSI A;  5IP9 H;  1YZ6 A;  2E8G A;  4TVA B;  1SE8 A;  3HOZ H;  2IHE A;  2YTY A;  2PI2 E;  1SR3 A;  3CCU A;  2LXK A;  4DK6 C;  5LMU Q;  4TQU S;  4C3H H;  2Q2T A;  2R92 G;  4PMW A;  1PH2 A;  3I55 A;  4GNX A;  1VQP A;  1IBM Q;  2JJQ A;  1KRT A;  1D7Q A;  2VUM H;  3CF5 A;  1A63 A;  3GTQ H;  3ULJ A;  4GLV B;  2UU9 L;  4DR7 L;  3NEM A;  3M85 A;  4WJ3 M;  2A19 A;  3T1Y Q;  3FKI H;  3J81 i;  1PH6 A;  4O0A A;  1WCM G;  2EQS A;  4JI1 L;  1MJC A;  2VQF Q;  4A75 A;  2KCT A;  2VS1 A;  2HIX A;  3M4P A;  4JI7 L;  1VQM A;  3RLO A;  4HIM A;  4LFB Q;  3PCO B;  5JJL A;  4A3C G;  2BH2 A;  3NBH B;  3OTO Q;  4DV6 Q;  2E5L Q;  3CCQ A;  3PIP A;  1VQF A;  3KYH C;  5J3B A;  4HJ5 A;  1XTD A;  4FDB A;  4A3K G;  1N36 Q;  4LUV A;  3AYH B;  1FGU A;  2UXC L;  5FLM H;  2JA9 A;  4JBW A;  1IYJ B;  5M3M G;  1IBL L;  3STB C;  2PQA A;  5IP7 H;  2IX0 A;  3TS0 A;  1YIJ A;  2HT1 A;  3U50 C;  1X3F A;  3A5U A;  4GN5 A;  2I5M X;  3J7A 5;  4APV A;  4DR6 L;  4DR4 L;  4JI3 L;  1IBK L;  2CFM A;  2GVB A;  4PZ6 A;  2UUC Q;  2ZJR A;  3GTK H;  1BBU A;  3KF6 B;  3UDI A;  1E3P A;  1SRO A;  3A5Z B;  1RL2 A;  2LXJ A;  2HIV A;  3CPF A;  4DPG A;  4POF A;  5GAH C;  5AJ3 L;  3F2D A;  4DR2 L;  2K52 A;  2KBN A;  4A76 A;  3H15 A;  3F2B A;  2HHH Q;  4JC0 A;  2OTJ A;  4DR7 Q;  1WJJ A;  1IL2 A;  2AWN A;  1VQD A;  2RF4 A;  3CCE A;  2NVX H;  1HNW Q;  4POG A;  3I4M G;  2NVY H;  1A8V A;  2ZTC A;  4A3L G;  1U0L A;  3CP0 A;  2UXB Q;  3CAM A;  4JI1 Q;  4JI7 Q;  2B63 G;  1UEB A;  1X65 A;  2V1C C;  3AFP A;  1I94 L;  5C4X H;  1VQ6 A;  3CW2 C;  1CSQ A;  4IPD A;  1A62 A;  5IWA L;  1YHB A;  5JJK A;  2I5L X;  3GD7 A;  2N49 A;  1K9M C;  4HJ8 A;  1Q81 C;  4QIW E;  3PO3 G;  2WAQ E;  1HR0 L;  2R7Z H;  1M1K C;  1IBL Q;  3KDF B;  4DK3 C;  4QGU A;  5IYD G;  1YVC A;  3CCL A;  1UWV A;  1NE3 A;  1XPO A;  2ZTE A;  4DR6 Q;  1N32 Q;  1JE5 A;  4DR4 Q;  3DLL A;  4JI3 Q;  3BZK A;  1PVO A;  5M3F H;  1ASZ A;  3GTP H;  1WFQ A;  5AJ3 Q;  4LF9 L;  2MFI A;  5BR8 L;  4DR2 Q;  1HZ9 A;  1L1O A;  1Z47 A;  1HZC A;  3EN2 A;  4GLX A;  2RCN A;  4YWM A;  2H5X A;  4JG2 A;  1VQJ A;  4X66 L;  4JI2 L;  2DGY A;  4C3J H;  5IYC G;  2NVQ H;  4A3B G;  4OXP A;  3BU2 A;  4HJ7 A;  1I94 Q;  1IZ6 A;  3KFU A;  4JBM A;  1JB7 A;  4AIM A;  1HNX L;  1HNZ L;  2BH8 A;  4AH6 A;  5IWA Q;  2OCE A;  4R4I A;  2JA7 H;  4AYB G;  1LUZ A;  2CWP A;  4P73 A;  5LMN L;  4LF5 L;  3J81 c;  3PUX A;  3AQQ A;  3S16 H;  5C44 H;  1HR0 Q;  3W5O A;  1T9H A;  1UE7 A;  3H3V H;  1X3G A;  4EQ5 A;  2AKW B;  1N32 L;  1DGS A;  1Z9F A;  4XTC S;  5C3E G;  1LTL A;  5ELO A;  3K81 C;  1QUQ B;  4RMF A;  2YTX A;  4LUO A;  2KEN A;  4LWC A;  1EIF A;  2R7D A;  3I2Z A;  4P72 A;  4LF9 Q;  3HOU G;  4OON A;  1IBM L;  2K5H A;  4Y7N H;  4P75 A;  3CCJ A;  2R93 G;  1SMX A;  2MO0 A;  5M3M H;  1SN8 A;  4DR1 L;  4HIO A;  1E7Z A;  1TWH H;  4EX5 A;  4X66 Q;  4JI2 Q;  3CCR A;  4LFB L;  3ZJY C;  1CKN B;  3KJO A;  4DV6 L;  2E5L L;  4A3G G;  3G48 A;  1A0I A;  1K8A C;  3TEH B;  2Q2I A;  3ULL A;  2JA6 G;  1M90 C;  2WAQ G;  3A0J A;  1HNX Q;  1HNZ Q;  3KDF A;  2E2J H;  2JA8 H;  2WB1 E;  3HOW G;  3CD6 A;  1GKH A;  3L7Z C;  4DUY L;  1OXS C;  3TQY A;  4OWX B;  5LMN Q;  4QY7 A;  4LF5 Q;  3Q8D A;  1JJC B;  3PO2 G;  3EIV A;  2K50 A;  1J5E L;  3TS2 A;  4P74 A;  4BXX H;  1Q86 C;  3GDE A;  3RR5 A;  2VW9 A;  4C2M H;  1SLJ A;  3H0G G;  4AQY L;  2JEB I;  3ERS X;  2Y0S G;  3HOX H;  2OQ0 A;  4JI0 L;  3FP9 A;  2MQH A;  2UUC L;  1Q82 C;  3I4N H;  4DV4 L;  2D0P A;  5C0X I;  1VQ4 A;  5FJ8 H;  4IPH A;  1NMF A;  3UE0 A;  1VQL A;  5K36 G;  3DM3 A;  4DR3 Q;  2HHH L;  1GVP A;  5M5W H;  1YI2 A;  3G6E A;  2ZJP A;  4A3J H;  3PO3 H;  3PUW A;  1VQG A;  3I7F A;  4O2D A;  4DR1 Q;  2UXB L;  1EUJ A;  3STB D;  4GKJ L;  5IYD H;  3ICE A;  1PYB A;  1Y1V H;  5IYB G;  1L0W A;  1KD1 C;  2YU9 H;  2QA4 A;  2CKZ B;  2YTV A;  2Z6K C;  2VQE L;  4NPS A;  1NY4 A;  1IXR A;  3RNU A;  4BBR G;  4A3M G;  1KIX A;  1PH8 A;  1EQQ A;  4JYA Q;  4PZ7 A;  4YHH L;  3J7Z C;  3I56 A;  3VDY A;  2N3S A;  4DUY Q;  1Y1W H;  1JJ2 A;  3LGJ A;  3M3Y H;  3J80 c;  3U4V A;  4YCU A;  1HZA A;  1J5E Q;  4GS3 A;  4JV5 L;  4AYB E;  4JOI C;  1CUK A;  1VQA A;  4AQY Q;  4BY7 G;  1MKH A;  1PA6 A;  4JI0 Q;  1Q1B A;  3S24 A;  2YV5 A;  3F1Z A;  4DV4 Q;  3KF8 B;  2EIF A;  2R7F A;  1E1O A;  4A3I G;  3GTM H;  1TWA H;  4KHP L;  1I5F A;  4HIK A;  2AWO A;  3F8T A;  1I50 H;  1ASY A;  1X55 A;  4KI0 A;  3AFQ A;  3EBE A;  4ME3 A;  3M4Q A;  2K4K A;  1EYG A;  1S72 A;  2UUB L;  4UY8 C;  4JBK A;  4GKJ Q;  3PIO A;  4Y52 H;  4IJL A;  1VQO A;  2IX1 A;  5C3E H;  2WB1 G;  4JCV E;  3UE1 A;  1FVI A;  3RLN A;  2VQE Q;  4UPA A;  1OXX K;  3T1H L;  1VQ7 A;  1CKO A;  1XPR A;  3HOU H;  4DV1 L;  4NXN L;  2PNH A;  4DR5 L;  4YHH Q;  1EOV A;  5HGQ A;  3BJU A;  4BA1 I;  2VY3 A;  3RN2 A;  1KL9 A;  4R4O A;  2ZJQ A;  1TWC H;  1AE3 A;  3CC2 A;  4YCW A;  3NEN A;  2CQO A;  2IHF A;  1E22 A;  3PUY A;  3G4S A;  4JV5 Q;  2D0O A;  4GOP B;  3AEV A;  5M5Y H;  4H02 A;  4A3E G;  4A3F H;  1S40 A;  2IY5 B;  5IP9 G;  1G6P A;  3HOV H;  4KHP Q;  2RHS B;  5IY0 A;  2JA6 H;  3H3V I;  2VNU D;  4DV3 L;  2UUA L;  1OXT A;  3IRB A;  2Y0S E;  2JK8 A;  2ZTD A;  1QVC A;  1B8A A;  4IPC A;  3S17 H;  3OW2 A;  1EIY B;  3M4O H;  1BVS A;  4BBS H;  2UUB Q;  3F2C A;  1FL0 A;  3E9I A;  3FKI G;  3H0G H;  3TRE A;  2K14 A;  1RIP A;  2VL6 A;  2C35 B;  3T1H Q;  1PHJ A;  2R92 H;  2NN6 I;  1K73 C;  4DV1 Q;  1GO3 E;  1PH7 A;  4NXN Q;  4DR5 Q;  3RN5 A;  3U58 A;  3S14 H;  1YHA A;  2OWO A;  2EXD A;  4IFD I;  2JE6 I;  4DAM A;  4NXM Q;  3PUZ A;  1WCM H;  3KF6 A;  5IT9 c;  1I3Q H;  2YYZ A;  5FLM G;  5C0X J;  2ZM6 L;  3S1R H;  5C0X G;  4IJH A;  1OXV A;  5IP7 G;  4GNX B;  1K83 H;  1NJI C;  4A3C H;  1I6H H;  4YCV A;  4QQB X;  4GOP C;  2NZO A;  1Q12 A;  3KOJ A;  1N8R C;  4DV3 Q;  4A3M H;  1XMO L;  2UUA Q;  2CWA A;  4QJF A;  4IOC A;  3MEF A;  4UP9 A;  1U5K A;  3JAM i;  4DR3 L;  4A3K H;  1FJG L;  1HNW L;  1JJG A;  2N8N A;  2Q2U A;  2UXD L;  3MXN B;  5C4J H;  1MJE A;  3S1N H;  3CPW A;  1H95 A;  1GM5 A;  3GTJ H;  4WJ4 A;  4OWW B;  1Y14 B;  1N33 L;  1PYS B;  5JEA J;  2K75 A;  3S1Q H;  1PH5 A;  3CMA A;  4DV5 L;  1C7Y A;  1NTG A;  5JEA G;  4LFC Q;  2PQA B;  4KHZ A;  4BY1 G;  4JYA L;  1V1Q A;  1XNQ L;  4L5Q A;  5ELN A;  3JC6 6;  1K8G A;  3I4M H;  1KAW A;  2K5N A;  4LW1 A;  4DKA C;  1Q7Y C;  1KC8 C;  2XGT A;  5GAG C;  1VQN A;  4A3L H;  1TWG H;  4LF6 L;  2KHJ A;  3A74 A;  2ZM6 Q;  1Q1E A;  4LUZ A;  1C0A A;  1TXY A;  4JI4 L;  2B63 H;  4A93 G;  1P8L A;  1VQC A;  4JBJ A;  1UE1 A;  3K0X A;  1B7Y B;  4OO1 I;  2F3I A;  4GNX C;  1QVG A;  3L0O A;  1XMO Q;  2Z0S A;  1QZG A;  2JA5 G;  3RLF A;  1FJG Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...