3G7LA

Chromodomain of chp1 in complex with histone h3k9me3 peptide
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
55
structure length
55
Chain Sequence
ADVYEVEDILADRVNKNGINEYYIKWAGYDWYDNTWEPEQNLFGAEKVLKKWKKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords Chromo domain-containing protein 1
publication title High-affinity binding of Chp1 chromodomain to K9 methylated histone H3 is required to establish centromeric heterochromatin
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 10
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2009-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3g7lA00
1DOMA 2B2WA 2L1BA 1MSGA 1GUWA 4X3KA 1NR2A 1J8IA 1G2SA 1O7YA 4IUPA 3R93A 4IUTA 1U4PA 4R8IA 2RSNA 4ZLTF 1B4OA 4X3TA 3KBXA 5D14A 2Q8TA 1MI2A 1ML0D 1PLFA 2EE1A 5D65A 2X6LA 1J9OA 2H1EA 1WVLA 1CM9A 1SSOA 3D6WA 3G7LA 1X32A 4X3UA 1ICWA 2B2VA 1KNAA 2KEEA 1HUMA 2NYZD 1U4RA 2K03A 2X6GA 3MWYW 4HAEA 4ZKBB 2R3ZA 1WTVA 2HCIA 2RSOA 2RVLA 1ILPA 2HDLA 1EL0A 1RTOA 4RA8A 4X3SA 4QUFA 1WD0A 1VMCA 1NR4A 2FFKB 2L9HA 1QNKA 4HCSA 2K1BA 4R9WA 4OIJA 2L4NA 2K05A 1PFMA 1SAPA 2B2YA 1MSHA 1X3PA 4IUUA 2B2UC 1ILQA 3IL8A 1IL8A 4IUVA 1WTXA 1B3AA 1B53A 1PDQA 1QG7A 3HP3A 5EPLA 4CJ2C 4IUQA 1AP0A 4ZK9B 2DY7A 2KUMA 4NW2A 2NZ1D 3ONAB 1S4ZA 2B2TA 2MGSA 1HFNA 1MGSA 2N55A 2JP1A 1WTPA 2L12A 1WTOA 4XDXA 4XT3B 1DONA 3DM1A 3IFDA 1C8CA 1EOTA 1Q3LA 2IL8A 1PFNA 4CJ0B 1HUNA 3I3CA 2B2VC 4O42A 5JJZA 1CA6A 5E4XA 1LV9A 4U68A 1KNEA 4DN4M 5E4WC 2DY8A 1AZQA 3F2UA 4HSVA 5CMDA 1F9RA 2MPMA 1U4MA 2MP1A 1SDFA 1O80A 1HFGA 2XIWA 3LWEA 2VXWA 2K04A 4RAUC 1HHVA 1HA6A 2KVMA 1HRJA 1WTWA 1RODA 1WD1A 1JE4A 2EOTA 2FJ2A 3FPUB 5EJWA 4LMQD 4UAIA 1ESRA 5CORA 5COYA 2N88A 3I90A 2RA4A 3DEOA 1IKLA 3DEPA 2B2WC 5CBAE 2JYOA 4QUCA 1RHPA 2K01A 1BBXC 1B50A 2SDFA 1DOLA 3Q6SA 2CVRA 2X69A 3P7JA 4XT1B 2HDMA 2FINB 2Q8RE 3MTSA 4MN3A 4RWSC 5EPKA 3UI2A 4ZKCB 2FMMA 2KOLA 4HEDA 5EPJA 4ZAIA 1BNZA 1QE6A 1VMPA 1XX8A 2KEDA 2B2UA 1ZXTA 2M2LA 4CJ1B 2MJ8A 1G6ZA 1IKMA 5T1IA 1WTRA 1XYIA 2BDNA 1RJTA 1U4LA 1B2TA 5CBEE 1E0BA 1F9QA 3GV6A 1F2LA 3H91A 1DZ1A 3N52A 2HCCA 3QO2A 1DOKA 4IURA 1NAPA 1A15A 1AZPA 2HUGA 2KECA 3FDTA 3I8ZA 1BO0A 1RTNA 1G2TA 2K28A 2NWGA 1O7ZA 2B2YC 3TZDA 1G91A 1TVXA 3KUPA 4OIKA 1X3QA 1EQTA 3TN2A 3SVMA 2L11A 1PFBA 1EIGA 1JICA 2D9UA 2FHTA 1F9SA 2EPBA 1EIHA 2B2TC 1F9PA 5EQ0A 1CA5A 1M8AA 5AFWA 5EKIA 4MHEA 3I91A 5T1GA 3GV3A 2J7ZA 1BF4A 1NCVA 1WTQA 5DNFA
chains in the Genus database with same CATH superfamily
4X6AH 1A3TA 1EY6A 1IW7C 2B63B 2R93G 3R93A 1U4PA 1C48A 4OHJA 1P8LA 4GOPC 1MI2A 2CWAA 4GZYC 4EX5A 2H1EA 1T5EA 3S1RH 1UE6A 3SK4A 2YU9H 4KHVA 1EEFD 5FOBB 1SNDA 5JEAH 2NVQH 1PH3A 1Y1VH 2Z6BA 2G5DA 1R9TH 4OELB 3CQZB 1X54A 3G6JB 1D8LA 4R9WA 4DR1L 4LF5Q 1CI3M 3KLSA 3I4NB 4QGUA 4DR5Q 2JA6B 4XTCS 4DV2Q 4P74A 3G71A 2F1MA 3ONAB 2B2TA 4BY7H 1I4GA 2TSSA 4DR3L 1WTPA 4L63B 4WJ3M 4A75A 4FXKC 4NMZA 4JI5L 4DV6L 2YTVA 1EOTA 1Q3LA 1NTGA 5ELBA 1HNZQ 3HKZG 3S2HH 1CA6A 1AH9A 1KNEA 1STEA 4QB4A 2IX1A 4A3GG 2F0DA 3F2UA 2PQAA 2F0FA 4JBMA 1ENFA 2KENA 1KC8C 1HFGA 2DNEA 1IYJB 1PHJA 5EJWA 1TWHH 4UAIA 4DR4L 5CORA 2JA8B 1FL0A 2DGYA 2YTXA 1N36L 2K14A 2N3SA 1KL9A 1PZKD 1VQDA 1EQVA 4HEDA 5GADC 4A3DB 5KEEA 1HRJA 4JOIC 1MBYA 4KLKA 3L9AX 1J5EL 3HOUH 4R4IA 2B63H 3QOLA 3J81j 4V190 1EFID 2VW9A 4IO9A 1NAPA 5D3DA 3RZOB 1SE4A 4BY1G 1L0YB 1QUQA 4OX9L 3I8ZA 4GNXA 4Q5VA 5IYDH 2E74C 2Z4IA 3CW2C 2L5TA 3RD4A 1F9SA 3EN2A 4CDFC 1VQMA 2E75C 5T1GA 1WTQA 2K5WA 4RGNA 4ULLA 1DM0B 5IGBA 1UAPA 1FYCA 4K8IA 2ICEC 4IUTA 5J39A 3KLSX 2Q8TA 4CDEC 2JA5G 2G9HD 4YWKA 4JI1L 1WVLA 3G7LA 1Q12A 3F1ZA 1K9MC 1YBYA 4F7XA 1Z47A 2OQKA 3RLFA 1HR0Q 3U4VA 1LTBD 1SLJA 1VQAA 4CBVA 3D4RA 1G6PA 2F0TA 2FFKB 4JV5Q 2F0GA 4DXFA 3IKJA 2VNUD 1GM5A 1DGSA 2Z6KC 4C2MB 1JOKA 1S5ED 2JA8H 4QCLA 5FLMG 2N55A 4UP7A 1TS2A 2EZVA 4BWGB 1XXGA 3TQYA 3MHBA 4LFCL 4RKLA 4J8QA 1O80A 4APVA 2KQ3A 3PIO3 1HA6A 3AFQA 1EWIA 1DD2A 2UXBQ 3NELA 3PQIA 4HTHA 5KNBA 1NUCA 3DXJC 2PI2A 3CCSA 4JI6L 5HURA 2NVYB 1CTMA 2K01A 2R7ZG 1HQMC 3VA7A 4DUYL 2CVRA 3HRZC 5NUCA 4MN3A 3OTOQ 5EPJA 1EY0A 1VMPA 3DWQA 4LF6L 1QB5D 4A3EB 2MJ8A 5GAHC 2NVXH 2BDNA 4KV6A 5FK9C 4DR7L 1CHPD 5M5YB 2PNHA 4BXXH 3P1HA 3KDFA 3GV6A 4LAAA 2EXZA 5LMNL 5DAUA 3I73A 1W2BA 2JA9A 5E3FA 1C4QA 1U9RA 1GXDC 1HCZA 3J7A5 1EQTA 3BDOA 3PO2H 5FO8B 5IIFA 3A74A 1HH2P 2QCPX 1GVPA 1V8QA 3CCRA 1PH8A 1V1PB 2CQAA 1N34L 1FGUA 1LT3D 3CCUA 1O78A 1VQPA 3DWAA 4IALA 1CHQD 5C5MA 4B9XA 5BR8L 4JBWA 4C2MH 3PUXA 1I4XA 4RGMA 2E2IB 1U0LA 3NP8A 4LFAQ 5M3FB 2R93H 1XPRA 2UXDL 3V96A 2A6ED 1S3OA 1FR3A 1WTVA 4K5XA 1IBKQ 3S2DB 4JK1C 1TY2A 5FKAC 5IYBH 1B9MA 2L9HA 3L3OC 4A3MH 1PRTD 1QNKA 2C5CA 5LMUQ 4CDCC 2J0TD 3M4OH 2K05A 4H13C 1D5MC 1IL8A 1PDQA 5EPLA 1L1OB 1HZCA 1VQBA 4IUQA 1MJEA 4LF4L 2BE5C 5JJIA 2JN4A 3GTOB 1EWCA 1H95A 2UXCL 3TP7A 1C8CA 2IX3A 2IL8A 1MD2D 5JJZA 2EY5A 3CXCA 1DXMA 5KNCA 1HZBA 3D31A 4IQZA 3K80C 3GP7A 4OL7A 5DLQE 1F9RA 3OW7A 2MP1A 4IUNA 5M5YH 4YWMA 2XIWA 4RAUC 2I5LX 3VYRA 2KVMA 4NXNL 2PPBC 1EU3A 4K6LA 1RDPD 1HQRD 2QEXA 3DEPA 4NPSA 2A6EC 1EYDA 2SDFA 2I5HA 2NZHA 3TS0A 4A3FG 3MZ5A 1SFOH 1I94L 1HNXQ 1YI2A 5ELNA 4DK1A 4LJZC 2IT1A 4DAYB 4F88A 5J1ZA 1WTRA 1EU4A 3TP5A 3NBHB 2RCNA 2BOSA 1Q8IA 3BDLA 3ZJYC 1ENCA 2MUYA 1XJVA 1DOKA 1V1PA 3J7AV 2XVSA 1SE2A 4C3JG 1H9SB 1G291 1G2TA 2OWOA 4OWXB 5BN4A 5M5WB 4BY1H 3AQQA 3U58A 2QDBA 2D9UA 3KLWA 2WAQB 4A3IG 3A8KE 3G48A 4WRDA 1M90C 4GN4B 4PG3A 3BS1A 2LS01 5C44B 2AHOB 1SBBB 1Q81C 4ZUJA 2BA0A 2JA7H 2JE6I 3RUZA 4EVOA 4V0BA 3EQLC 2X6LA 2VY3A 2F0QA 1ICWA 5C3EB 3EROA 4A93G 1CKNB 2GA4B 3SDZA 2KCNA 4RCNA 5ELEA 5C4JH 3M7GA 1VQ5A 4DR1Q 1ASYA 2WACA 2KCCA 2B2YA 3ERQA 4IUUA 3PUYA 3MXNA 3EA6A 1SRUA 4ZK9B 3GTGH 4C3HB 4DR3Q 5A2QL 1TKWB 1YZ6A 4JI5Q 4DV6Q 1STBA 2HD3A 4JCVE 2ZJRA 4MTNA 1WTOA 5CV4A 3AEVA 1AEXA 4O0AA 3H94A 4O1NA 2UUAL 3H3VH 5FLMH 3VYTA 4DNRB 3CKIB 2R92B 4TKOB 1KRSA 1U4MA 4ME3A 4CKBA 2CH4A 3CCVA 1AE2A 1PH2A 4DAYA 4DR4Q 2F4IA 4HJ8A 1CQVA 1RODA 2IHFA 4NXML 2EOTA 1PTOF 1Q1EA 1VQHA 1TQOA 3NPPA 3LNNA 3Q0AA 1N36Q 3DEOA 4TQUS 2N8NA 3CC7A 1UNSA 4RHRA 2HIVA 1ET9A 2E2HB 4FF3A 3O13A 1B7YB 5IGEA 1QOHA 2Y0SG 1J5EQ 1WYDA 4HIOA 2YYZA 1QCBD 1EUJA 3X3NA 5G3LF 3OW2A 2VUMG 3WOFA 3Q22A 3GTMH 1F2LA 3TEHB 1FGBD 4OX9Q 4A3BG 1M1KC 1TIID 1EYGA 3GTPH 3E0JA 4JBJA 4OIKA 3TN2A 3JAMc 1TY0A 1PFBA 2FMCA 1A2TA 3D6CA 3M3YB 5D3IB 1BKBA 2PO4A 1E2ZA 1F9PA 1CKNA 3I91A 4LF9L 3W1GA 2A19A 3GTLH 1NCVA 1ZEQX 4HMIA 3UDGA 1XMOL 3HOVG 1NNXA 4XQJA 5IYCG 4K2LA 4PQXA 4BBRH 2F0EA 1D2BA 1N9WA 3MVVA 1LTSD 4C3IG 2PMZB 4JI1Q 5H1SE 3I4MB 2C9OA 2R61A 5D14A 1ICFB 2ZT9C 4G7HC 1J9OA 4X66L 3S1NH 2R7DA 3C1FA 1D5ZC 3S9WA 1PTOH 1KNAA 3BZCA 2NBFA 1EY5A 1Y8NB 1I4RA 1JJ2A 3F2CA 4GKKL 1ILPA 1HZ9A 2HDLA 5DM73 4G4KA 1TS5A 1SNPA 1QVFA 4R4OA 2HHHL 3GTKB 3K5OA 5CV5A 3AMUA 4GS3A 1WTXA 4DPGA 3FKIB 2DY7A 2NZ1D 1S4ZA 2WB1G 1BCPD 1EY4A 2NN6G 5EAYA 2CHBD 4FP5D 2DN8A 2E2HH 1PFNA 2NVTH 4LFCQ 1G51A 1VQFA 2B2VC 5E4XA 3I4NG 4ZUIA 1EOVA 1R4PB 3KJPA 2BH2A 3ICEA 1K83B 4KY6A 1HXYD 3M4QA 2LSSA 3DWPA 2NB0A 5KRUA 1F2ZA 5I6WA 2ZM6L 2E5LL 1WJJA 1VQKA 1SYFA 3U50C 1JE4A 1OXSC 3F2DA 2JQOA 4JI6Q 1YNJD 4S3SA 1KIXA 1SJED 2B2WC 4DUYQ 2K7VA 4OONA 4OWTB 3CCLA 1I3QH 3R3OA 3Q6SA 2YU9B 3P7JA 2X69A 3Q24A 1RD9D 2F3IA 4LF6Q 2NVQB 2GVAA 3KOJA 2O5IC 1Y1VB 1YIJA 2BA1A 3KLRA 4DR7Q 1R9TB 3B6YA 1OXUA 2E2JH 2IJ0A 1B70B 3D4DA 5LMNQ 1Q8KA 5CGKA 4K14A 3QJYA 1GHJA 2XNAC 3RR5A 3GDEA 1LACA 1EWHA 3NTKA 4EQOA 5BN3A 4BY7B 2Z8LA 1A62A 1IZ6A 2IHEA 2XRSD 4C3JH 4DV1Q 2PQAB 2AUKA 3NWTA 1XPUA 2Z1CA 3S2HB 1S5DD 1I4HA 1N34Q 4DR2L 4G57A 3CPFA 1KXLA 1JJCB 2CW0D 3T1YL 1E24A 1YHAA 4A3IH 5BR8Q 2B8GA 2HIXA 2K52A 4X3KA 3S16H 1YNJC 4KI0A 4XQQA 2F03A 3BJUA 3KBXA 1ML0D 3SK5A 2UXDQ 1CM9A 5ELOA 2AQ1B 1LUZA 4HAEA 4I7ZC 2R3ZA 1BXTA 2IX0A 2F0KA 4QMGA 1XNRL 1K8GA 2NUCA 4A93H 4JW0A 5KYIA 3E6ZX 1PH9A 3K58A 4HCSA 3HOUB 1JB7A 1QUQB 3RMHA 4LFBL 2KHSA 4LF4Q 1MSHA 1X3PA 2B2UC 3HP3A 1I5FA 3DMUA 2BCOA 1BVSA 2UXCQ 3S1MB 5C3WA 4N8FA 1Y1WH 3W3AA 2EXDA 1AW7A 2WIIB 3TP6A 4UP8A 2A5HA 5HY6A 1YHBA 3I55A 1Q1BA 1IBLL 2DY8A 2MNAA 1RF2D 2MPMA 2XN9C 4E6IA 4IPDA 3K5MA 4GOPA 3F2BA 4NXNQ 5JPNC 4IZ8A 1AE3A 1D5XC 4OEMB 4UDUC 2LFNA 2FJ2A 3HKSA 5FO9B 3FVQA 2K6AA 1JR0D 3CCMA 1I94Q 2QDLA 4AYBB 3J80L 3HG9A 2XWBB 1HZAA 3AU7A 2FINB 3CP0A 2D62A 3EBEA 4HJAA 2FMMA 2KOLA 1IYVA 1H9MA 3CF5A 1XX8A 5F2DA 2EY2A 2KEDA 4KN4C 1G6ZA 1STYA 1VQ8A 3CRLC 2ZTCA 1V43A 1PH5A 1E0BA 3U9OA 4WORA 3OHXC 4PZ7A 2PI2E 3JAME 1PYBA 3J81c 1P16A 2K28A 1XWEA 1OXTA 4A3EG 5M5XH 4KN7C 5IWAL 2OTJA 5JJKA 3L2PA 4IPGA 1CSPA 1VQIA 3I72A 1C9OA 2SNSA 5LHY1 3NWSA 4R4TA 3CAMA 4DV4L 5EGTA 1MSGA 4HSPA 3K57A 1G2SA 3KFUA 1CZGA 4OXPA 4ZLTF 1JORA 3HOVH 5IYCH 2OT2A 4UHVA 2LMCB 3S1MH 4YY3L 2ASBA 5I2YA 2KEEA 4JOIA 3D3RA 2EYJA 1YITA 1GUGA 4KD3A 2WINB 4A3KH 1N8RC 2RHSB 3GD7A 1EYCA 5HGTA 1SYCA 3KDFB 4AQYL 3A7LA 2NVXB 1I4PA 3BVZA 4OGQC 4Z9CB 5IOCA 1B3QA 4A3JG 4LF7L 5C0XJ 3J81i 1AP0A 4GLXA 3T56B 4HJ7A 2WP8J 1Y8OB 2C35B 2MGSA 2UUAQ 3BYTB 1SXTA 2PW7A 1VQ9A 4GN3B 1GJXA 2RHQB 3PO2B 1O7LA 1KDCA 2AWNA 1Q46A 3K8AA 1O7IA 1GUTA 3VYUA 4HIKA 3CC2A 4NXMQ 1HNWL 2K04A 1WCMB 2KBNA 1H9KA 4X65L 2JEBI 3J80c 2NTTA 2M9VA 1BUVT 1OXXK 4PMWA 2A8VA 2V4DA 2ATWA 2R93B 3SR1A 1DOLA 5E7NA 4XT1B 2SOBA 2Q8RE 2F3VA 5EPKA 2ZXRA 4H02A 2UU9L 1VQ4A 3J7AF 5IP7G 2Z6KA 2KA7A 4FF1A 1U4LA 4A3MB 5CBEE 4LF8L 1B2TA 4IFDJ 3HOYG 3M4OB 4A3CH 1SJHD 3QO2A 2ID0A 1PH7A 3MXPA 2EYHA 1A2UA 2HUGA 2ES2A 1RTNA 1B44D 3K7UC 3E9HA 3A55A 5C4XG 1N32L 4ME5A 1JICA 1D1IA 2CKZB 4LF9Q 1KQSA 3CD6A 1SYGA 3T51B 5EKIA 4MHEA 1XMOQ 2F4VL 4YHHL 2I0QA 3QIAA 4KY7A 2KHIA 1NMGA 4YCUA 1BR9A 4X66Q 5JPMC 3M7NA 2PW5A 4WJ4A 2BDOA 4HCEA 2QKIC 4JI2L 3N6RA 1SSOA 3EVQA 2X6GA 1HUMA 2B29A 2NYZD 1SFOB 1I50H 4GKKQ 4LNQA 4YCWA 1KDBA 2RBMA 2UUCL 2RVLA 3L7ZC 5GQOA 2HHHQ 4EQNA 2CFMA 2I5MX 5HGQA 5CV6A 5ELCA 3R2IA 1E3PA 4GKJL 5C3EG 1WCMH 4R8NA 1JMCA 3IL8A 3ERSX 3MEHA 4BBSH 3LX0A 1Z9FA 1QVCA 3HOWH 3QWNA 3UDFA 4Q0FA 1MGSA 1CK1A 3ND9A 4L5SA 4BY1B 5CC4A 1UEBA 2F0PA 4P2CB 2VZAA 4FVMA 2EQSA 3BG3A 2K50A 1QILA 4WJWA 1UUPA 1YVCA 2ZM6Q 2F3WA 2NTSA 2XWJB 1PRTF 2E5LQ 1ET6A 4JVZA 5IP9G 2NN6I 4A3LG 1C7YA 4UP9A 2CCZA 1HHVA 4ODGA 3FEWX 4JPBW 2JA7B 1VQJA 5IT9L 2N88A 4DAVA 4BA1I 5I4DA 4QUCA 2K4KA 2D5DA 1FNUA 3CC4A 3AB9A 1VQ6A 1FNVA 4MIUA 4MNOA 2JA5B 3I4OA 3A5ZB 4TSSA 1XMQL 4GN5A 1QE6A 2XGTA 1EYAA 5C4JB 2OCEA 3MXNB 1XYIA 1VF7A 4L5RC 2F0NA 5C3XA 5L37A 1XNQL 3A5UA 3J81E 2K75A 4A3GH 3PSIA 3H09A 4R1JA 1E2WA 5I2XA 1B9NA 2RDFA 3GTGB 4CHTB 2A6HD 1STAA 5LL6X 3TZDA 4DU9A 1TVXA 5KGUA 1Q7YC 1AFPA 1JT8A 4U673 4DR2Q 1EIGA 3K5NA 1PMRA 2EPBA 4KKSA 3T1YQ 1CA5A 2EIFA 1SNQA 1W3SA 3MFYA 1PRTC 2WAQE 3QB3A 1BF4A 1EIYB 3HOZG 3FP9A 1BNZA 3JC66 1DOMA 1MIUA 4FNFA 5M9OA 3PV0A 1KAAA 2E8GA 3CCQA 1K28A 5IE8A 4B3ML 3S15H 1LTAD 4K0KL 4C56C 3NUCA 2Q2TA 4YIJA 2K03A 1XNRQ 1EZ6A 4JYAL 3BVMA 4X3SA 3I4MG 3BVGA 4YCVA 1NR4A 4LFBQ 2AQ3B 1PVOA 2Z9HA 3GTMB 3PO3G 4WFN3 1A3UA 3Q23A 4DR6L 3HZXA 3HOXG 3HGBA 1QG7A 4N8X1 2A6HC 1K0RA 3GTPB 3SK6A 4A3JH 4DAMA 1GUOA 2JP1A 1EY7A 2F0UA 2DNCA 2JA5H 1IBLQ 2YV5A 1Y69U 4ID6A 1SE8A 4KHZA 4NP5A 3OWEB 1L1OC 3ULPA 3GTLB 4N9PA 1XTCD 5IT9c 2VXWA 3W5OA 4BBRB 1K3RA 1Z6HA 3CU7A 4G7OC 2ZXOA 2PQEA 1EQRA 3NEMA 1KLUD 1EZ8A 3S1NB 2EY1A 5GAEC 1X65A 1PTOB 1L2FA 4PZ8A 1TS3A 4JI4L 1X55A 4HJ9A 2PNRC 2LKVA 4H7BA 1L0XB 3MEFA 1VQCA 1EY8A 4F87A 1STGA 3K6OA 5DM63 1A15A 3CMAA 3TZUA 1QZHA 1AZPA 1YNND 4JBKA 4RCOA 3HOYH 1Y1VG 5IWAQ 2NWGA 4QIWE 4ZQ3A 4L8JA 3TRZA 1V1QA 3H0GG 1S5FD 3S17H 2NVTB 1CFMA 5C4XH 4XYOA 2R7ZH 4DFAA 1EQQA 3TBIB 1D7QA 3EFXD 4XQNA 4DV4Q 4X62L 1WD0A 4JI7L 1E1OA 1PZJD 2R6GA 3M9BA 4KD4A 3GO5A 3VR6A 4JG2A 5A35A 1CQFA 1GOZA 2K5VA 5EBDA 4X3TA 1K73C 4YY3Q 4QIWB 2GN5A 4DV3L 2PMZE 4ZYSA 5M3MG 1IXRA 1I3QB 3CRKC 4ZKBB 1SN8A 3OPOA 4QY7A 4AQYQ 3BZKA 2IWHA 4RA8A 3J7ZC 1PH6A 3RZDH 1I6HH 2E2JB 4EGVA 5KNDA 4JI3L 2K1BA 4LF7Q 2L4NA 3STBD 4IJLA 4PNYA 1YNXA 1SAPA 1YNNC 2AQ2B 4KJNA 2RF4A 4OWWB 2ZJQA 2F0OA 3K81C 4K2KA 4X64L 1B1ZA 1E22A 1LT6D 1HFNA 3CMEA 2L12A 3VR4A 2N78A 3M4YA 1DONA 3IFDA 2LXKA 4C3JB 4CJ0B 1CUKA 3QOJA 1A63A 3K59A 2B63G 5DEHA 4K5VA 5FLXL 1HNWQ 3NQTA 1A0IA 4X65Q 4R4CA 4A3IB 1K0SA 3BDCA 3S16B 2QEJC 4LMQD 5K36G 2B3GA 1LT5D 5IP9H 4HMJA 3J7YW 2A1AA 5CBAE 1EY9A 1LABA 4LUOA 1BCPF 1UWVA 2Q8IB 4PMBA 4PZ6A 2EDGA 2ENBA 3JAMi 2UU9Q 2HDMA 4L5TA 2LXJA 2P5ZX 1VQ7A 4RGOS 1UE5A 1ZKOA 4A93B 4LF8Q 4FO2A 4IPHA 5T1IA 3PUZA 1GD7A 1RJTA 2JA6G 4DKAC 5BN5A 4JI8L 3PGZA 2VQEL 2HCCA 1JE5A 4IURA 4RGTA 2EYOA 1LM0A 4ZCKA 2OQ0A 3UDXA 2KECA 2DJGC 3Q8DA 1N32Q 1Y1WB 2VB2X 3AYHB 1KD1C 2K5HA 4J6HA 4GOPB 2F4VQ 4YHHQ 4B3SL 1BBUA 4FXDA 5EQ0A 3IAYA 1UE1A 4A3FH 3MAQA 4LK1C 2JA8G 4B3TL 3MC0B 4TRDA 4K5WA 2B2WA 4LUZA 1Q90A 4RHSA 1U5KA 4JI2Q 2KCTA 4R8IA 1TWGH 1I6VC 3HOZH 3NHHA 3CPWA 1BCPC 1JJGA 3D6WA 4A3DG 3ITPA 5C0XG 4HJ5A 2UUCQ 1J6QA 2RDHA 1TXYA 3I56A 4MZ9A 1FJGL 5C4ZA 3IRBA 1RTOA 3A54A 1PYSB 4RFBA 1YJ9A 2G9DA 1NMFA 1TR5A 4GKJQ 1QJOA 2A74C 4POFA 4OIJA 4KMUC 1LT4D 5JEAJ 2Y0SB 4IUVA 4QL5A 1IW7D 2WKCA 2VUMB 1B3AA 2A68D 2F0JA 4ALPA 3PO3H 4QF4A 2EYFA 2ICIA 3ER0A 3GTJH 4Y7NH 3HOXH 5M5XB 1QNUA 3OIPA 3C2PA 5FLXc 3PCOB 1XPOA 3RLNA 3ZYYX 1TWCH 4IJHA 2MHVA 2PZUA 4DGZA 4BXXG 4O42A 1LV9A 5IT9E 2WFWA 2JSOA 1MKHA 4DV7L 5J22A 1AZQA 4DF7A 4CKCA 1VQGA 1ENAA 1TWAH 1WTWA 3NBIA 5IY0A 4IFDG 3HOVB 1W6JA 3D0FA 4C3IB 1EFWA 1BQQT 1B50A 3EIVA 1IBML 2EJMA 1XMQQ 4AYBE 2HQEA 4A3KB 4ZAIA 4FXGC 3PUVA 2CW0C 3WWVA 1XNQQ 2B2UA 1ZXTA 5CV8A 2JK8A 1TS4A 4LUVA 2Z0SA 3NENA 3KF8B 1WFQA 2A68C 5IODA 4OO1G 1LTLA 4HR7B 3N52A 1F77A 1X56A 2AWOA 3OYYA 4QJFA 3FDTA 1RL2A 4JI0L 1K8OA 1O7ZA 3RNUA 2JEAI 5IYBG 1YJWA 3PF5A 4A3MG 1MHWC 1S40A 4EQPA 2B2TC 1AN8A 2WB1B 3K7AH 4M1UB 1E1TA 3T13A 3H0GH 3A56A 3NE5B 2J7ZA 2ZTEA 1DZ1A 4DK0A 3M85A 1JB3A 4A76A 4B3MQ 1SE3A 2VUMH 4K0KQ 5FO7B 1PLFA 3RN2A 1IHZA 4X3UA 4JYAQ 4A3BH 1U4RA 2PZWA 3MWYW 3DHQA 2HCIA 3OMGA 4DK3C 5M3MH 2Q2UA 3OWFA 1GO3E 2TMPA 4NDXA 1SNOA 4DR6Q 5AJ3L 3S1QH 1PFMA 3W1BA 1RKNA 3CCJA 1PFSA 1VQLA 4DV0L 1X3FA 2K5QA 4C3IH 1NBWA 4DV5L 2MFIA 4NKLA 4KTAA 4CDDC 3T16A 4DUZL 1HTPA 4GNXC 4ZRZA 1SMXA 2F0IA 4U68A 5GROA 1F2MA 1NY4A 5CMDA 5A2QE 3VYSA 4LWCA 1SYDA 1LYLA 1MJCA 3S14B 3SXHA 5M3FG 2VL6A 5LMNW 2UUBL 3G6EA 3FHWA 4C1NI 4DAPA 5COYA 2EVBA 2O4XA 3KF8A 1IL2A 3WOEA 3H6MA 5IGDA 5K36H 4JI4Q 1I50B 1FNWA 3MTSA 4ZKCB 1LO5D 2D0OA 4QQBX 1PYWD 1Y8PB 1BDOA 2XSCA 2DJFC 1KLGD 2NN6H 5CV7A 3CQZH 4XYQA 2JA7G 1PXUA 2IY5B 2K33A 1F9QA 2JJQA 3G4SA 5IGFA 3P20A 4LW1A 3I4NH 1VQNA 3E0EA 1R4QB 5C4HA 4BBSB 2EY6A 2JA6H 3NQIA 2OEOA 3HOWB 4XIGS 1DCZA 1CSQA 2KHJA 1JQYD 1S72A 1HPCA 2QF7A 3I7FA 2RDGA 4KHPL 3T1HL 4X62Q 5AFWA 1KHIA 3VR3A 3FMCA 4JI7Q 2R7FA 4KJOA 5ISRA 1H9RA 2I07B 2L55A 3ULJA 1I4QA 4DV3Q 3HKZE 4DXGA 2KCMA 1S5BD 1X32A 4RKBA 3BU2A 2CWPA 1DYQA 3NTHA 3TMEA 1A3VA 1TU2B 1NJIC 2SEBD 1GHKA 1BOSA 4A3DH 1EL0A 5C0XH 2VQFL 2LY7A 2OXPA 3FRPB 3SK8A 4JI3Q 1ONLA 1Z7TA 2HT1A 5EKLA 4FDBA 1LTTD 2PYKA 1E7ZA 3HKZB 4CGYB 3S14H 3KK7A 5E1FA 4P72A 1ILQA 1SROA 2H5XA 3RZOH 1D6EC 4X64Q 3K5LA 1ZYRD 3J80i 4CJ2C 4A3GB 2XRQD 4KKTA 4NW2A 5FLXE 2WAQG 3VDYA 1K3BC 3H15A 3K0XA 3TSSA 4PV1C 1QWYA 3BZDB 5C5LA 2F0VA 4AIMA 3KJOA 5C44G 4IOAA 3ND8A 3CCEA 1M4VA 3HFZB 1B8AA 1SDFA 1YEZA 1JOOA 5I6YA 3T53B 3DUZA 1PRTB 1ESRA 2SNMA 1A6XA 2J4XA 2IW3A 3OMCA 2NZOA 5CR3A 3PIPA 5KYLA 2RA4A 1JOQA 1YJNA 1IKLA 3SGIA 1BBXC 3S15B 1RHPA 2BE5D 1GUSA 4J15A 4RH6A 5EKKA 4IFDH 4UY8C 2N49A 2ZXPA 5CYUA 4DV1L 1T5XD 3W2DA 4P71A 4BBRG 4L5QA 4CJ1B 1N33L 4JI8Q 1PH4A 5CV9A 1XTDA 3BYYB 2VQEQ 4C3HG 4IOCA 1ZYRC 1ASZA 3A8IE 4B3RL 1V9PA 4EQ5A 2ZTDA 5IGCA 1PH1A 2I46A 4OO1H 1EEID 1OXVA 2D0PA 4K8JA 3U9SA 4A3JB 3KUPA 1X3QA 3SVMA 1CT1D 3RLOA 4B3SQ 2R92G 1X6OA 5J3BA 4BA2I 3UE1A 2FHTA 3P75A 4H0LC 4MTKA 4B3TQ 1KAWA 3OSOA 2DUDA 5I9PA 3DLLA 1LTGD 1VCIA 2RKSA 5DNFA 2L1BA 3EJIA 1J8IA 2HQLA 1LTID 1H9JA 1GKHA 1B4OA 1UEAB 1JC7A 2Q2IA 4YWLA 2ZJPA 5KIXA 2NVYH 2PCFB 1SEBD 4ABNA 1WOCA 1FJGQ 2F0LA 2K32A 2K5DA 1RCVD 3R2TA 2E76C 1HR0W 4A3EH 1SR3A 1TT2A 2F0HA 3QR8A 2EYPA 5C0XI 1HJPA 2EYMA 3I2ZA 1B53A 4LF5L 1FD7D 1SNMA 2KUMA 2MO0A 2OF1A 3DM3A 3HOYB 4DR5L 4CKEA 4DV2L 5FJ8G 1CZWA 3DM1A 2QW7A 3S17B 2MQHA 4B08A 4DV7Q 1HUNA 2B8FA 2F0SA 5C4XB 4DN4M 2R7ZB 1HNZL 1KRTA 1CKMA 5IGGA 3V05A 4HIMA 1A8VA 4H44C 1JWMD 1X3GA 3VR5A 3SE0A 1IBMQ 2RCFA 4I7AA 4C1NK 2E2IH 2JYOA 5M3FH 3VA5A 1BBWA 2OTLA 3GTQB 2YTYA 2BH8A 3LWUA 3S2DH 3JAML 1Q82C 4TVAB 2MO1A 3RZDB 3URYA 4IFDI 2CQOA 3I4LA 1I6HB 1IKMA 3FKIG 3M4PA 4IN3A 1KTKA 3MA2B 3J80E 3H91A 5EBCA 5I9OA 4JI0Q 4FF4A 1DJRD 2PZTA 3NXWA 2B2YC 3GTOH 2RQXA 1G91A 4XXEA 1L1OA 2L11A 4OO1I 4DNTB 3TP8A 4DNIA 1SNCA 4RG1A 3GV3A 1TWFB 1RIPA 2WKDA 1Y1WG 1EIFA 1GUWA 2GVBA 1NR2A 2QA4A 5IP7H 3L0OA 2RSNA 3H3VC 4HIDA 5JEAG 3A7AB 5K5PA 3E5SA 3IFTA 3OIQA 3KF6B 1QZGA 1D1KA 3C3LA 2L15A 1HTLD 3MXUA 5ELDA 1HR0L 4UPAA 4GLVB 2WV6D 3GQBA 1X3EA 1W6KA 5AJ3Q 5GAGC 1PV4A 2Q2HA 3PMFA 2O5JC 3OOCA 5JOBA 4Y52H 4JV5L 4DV0Q 4BY7G 5TSSA 3RN5A 3NBHA 1PTOD 2B39A 3K0YA 1Y14B 4DV5Q 5M5WH 2Z4HA 4DUZQ 4XT3B 2JXMB 3QG1A 3GTQH 4N9TA 1H9SA 3AFPA 1OTCA 4I65A 3I3CA 3NSWA 5ELFA 3TDQA 1WTHA 2H4OA 4HSVA 3U4ZA 4AH6A 4A3FB 3UDIA 5G3LD 1L0WA 5C44H 3LWEA 2UUBQ 3PUWA 4FF2A 4P75A 3D4WA 4G7ZC 1WD1A 3KBGA 4IPCA 1TWGB 3HOZB 1PZID 3I90A 2A69D 2UXBL 2AUJD 4A4IA 2CH4W 5C3EH 4L6TB 4GLAC 2O2LD 1BCPB 2M00A 3UE0A 3HOUG 3TS2A 3OTOL 4M8AA 1LTRD 2M2LA 2IPKD 3PF4A 2QGQA 5LL6S 1ESFA 1E2VA 1LLRD 1TWFH 1PTOC 1UE7A 2F52A 5IYDG 4PMCA 4O2DA 4C3HH 1PA6A 4A3KG 3PO3B 4A3LH 3PIP3 1STNA 3GTJB 4Y7NB 2VB3X 2EJFC 3HS0C 3HOXB 1F2YA 4KHPQ 2K5NA 3T1HQ 3TREA 3X3MA 3HEJA 3NTIA 1X9NA 1TWCB 5JJLA 1G8ZD 1K8MA 5C6AA 4RMFA 4BS9A 1VDZA 5JVG3 3KF6A 4JC0A 2R92H 4R4QA 3STBC 2EJGC 1S5CD 4KK7A 2A73B 3I70A 4AYBG 1O7YA 1GUNA 2A69C 1TWAB 4IUPA 4DA2A 1FVIA 2QILA 1SYBA 2D2CC 4KY5A 4HN7A 2EE1A 5D65A 1JWUD 3MFGA 2B2VA 3FPPA 1VF5C 4LFAL 1SYEA 2VQFQ 3A8JE 1JCKB 2RSOA 4KKUA 1NE3A 4J1MA 3S24A 3H3VI 4QUFA 1Q86C 1OO9B 1IBKL 3VR2A 1NSNS 1VMCA 1T9HA 3PIOA 1K8AC 1WI5A 4B9WA 2F0MA 5JAVA 2AMCB 5LMUL 1SMYD 4F8MA 2Y0SE 3E9IA 3T4AC 3S1RB 3NK9A 1YHQA 4XDXA 1VQEA 3M3YH 1II3A 2F0WA 4ILWA 3K7AB 4A3CG 1KDAA 5E4WC 2KJXA 3H0GB 5FJ8H 3KYHC 4DK6C 3LGJA 3WDNA 3R8BA 3C1EA 3C46A 2L0CA 3I4MH 1IYUA 3FPUB 4POGA 3SHLA 2FXQA 3ULLA 3V2TA 2XTIA 3F8TA 3CHBD 3J81L 4A3BB 1STHA 3UI2A 4RWSC 4FYDA 3A0JA 1N33Q 1HNXL 5M3MB 2AKWB 5JVH3 1VQOA 1V1OA 2E2DC 2EYLA 3GTKH 3MXGA 1JWSD 4B3RQ 1SMYC 1VS0A 3S1QB 2V1CC 1TWHB 4NB3A 3FKIH 1CKOA 3PO2G 2VS1A 1BO0A 1KABA 4K6DA 3SEBA 4P73A 1HA5A 1C0AA 3E3XA 1QVGA 1EIHA 1WCMG 1M8AA 4BBSG 3D8GA 2ALYB 1K83H 2WB1E 3HOWG 4GNXB
chains in the Genus database with same CATH topology
1A3TA 1EY6A 1IW7C 2B63B 3R93A 1U4PA 1C48A 4OHJA 1MI2A 4GZYC 2H1EA 1T5EA 3SK4A 4KHVA 1EEFD 5FOBB 1SNDA 5JEAH 3CQZB 3G6JB 4R9WA 1CI3M 3KLSA 3I4NB 2JA6B 4XTCS 2F1MA 3ONAB 2B2TA 1I4GA 2TSSA 1WTPA 4L63B 4FXKC 4NMZA 1EOTA 1Q3LA 5ELBA 1CA6A 1KNEA 1STEA 4QB4A 2IX1A 2F0DA 3F2UA 2F0FA 1ENFA 1HFGA 2DNEA 5EJWA 4UAIA 5CORA 2JA8B 1PZKD 1EQVA 4HEDA 4A3DB 5KEEA 1HRJA 1MBYA 3L9AX 3QOLA 4V190 1EFID 1NAPA 5D3DA 3RZOB 1SE4A 1L0YB 3I8ZA 4Q5VA 2E74C 2Z4IA 2L5TA 3RD4A 1F9SA 2E75C 5T1GA 1WTQA 2K5WA 4RGNA 5IGBA 1DM0B 4ULLA 1UAPA 1FYCA 4K8IA 2ICEC 4IUTA 5J39A 3KLSX 2Q8TA 2G9HD 1WVLA 3G7LA 1Q12A 4F7XA 1Z47A 3RLFA 1LTBD 4CBVA 3D4RA 2F0TA 2FFKB 2F0GA 4DXFA 3IKJA 2VNUD 4C2MB 1JOKA 1S5ED 4QCLA 2N55A 1TS2A 2EZVA 4BWGB 1XXGA 3MHBA 4RKLA 4J8QA 1O80A 2KQ3A 3PIO3 1HA6A 1DD2A 4HTHA 5KNBA 1NUCA 3DXJC 5HURA 2NVYB 1CTMA 2K01A 1HQMC 3VA7A 2CVRA 3HRZC 5NUCA 4MN3A 5EPJA 1EY0A 1VMPA 3DWQA 1QB5D 4A3EB 2MJ8A 2BDNA 4KV6A 5FK9C 1CHPD 5M5YB 3P1HA 3GV6A 4LAAA 2EXZA 5DAUA 3I73A 5E3FA 1C4QA 1U9RA 1GXDC 1HCZA 1EQTA 3BDOA 5FO8B 5IIFA 2QCPX 1V8QA 1V1PB 2CQAA 1LT3D 1O78A 3DWAA 4IALA 1CHQD 5C5MA 4B9XA 4JBWA 3PUXA 1I4XA 4RGMA 2E2IB 3NP8A 5M3FB 3V96A 2A6ED 1FR3A 1WTVA 4K5XA 3S2DB 4JK1C 1TY2A 5FKAC 1B9MA 2L9HA 3L3OC 1PRTD 1QNKA 2C5CA 2J0TD 2K05A 4H13C 1D5MC 1IL8A 1PDQA 5EPLA 4IUQA 2BE5C 3GTOB 1EWCA 3TP7A 1C8CA 2IX3A 2IL8A 1MD2D 5JJZA 2EY5A 1DXMA 5KNCA 3D31A 4IQZA 3GP7A 4OL7A 1F9RA 3OW7A 2MP1A 4IUNA 2XIWA 4RAUC 3VYRA 2KVMA 2PPBC 1EU3A 4K6LA 1RDPD 1HQRD 3DEPA 2A6EC 1EYDA 2SDFA 3MZ5A 4DK1A 4LJZC 2IT1A 4F88A 5J1ZA 1WTRA 1EU4A 3TP5A 2BOSA 1Q8IA 3BDLA 1ENCA 2MUYA 1DOKA 1V1PA 3J7AV 2XVSA 1SE2A 4C3JG 1H9SB 1G291 1G2TA 5BN4A 5M5WB 2QDBA 2D9UA 2WAQB 3A8KE 4WRDA 3BS1A 2LS01 5C44B 1SBBB 4ZUJA 2BA0A 2JE6I 3RUZA 4EVOA 4V0BA 3EQLC 2X6LA 2F0QA 1ICWA 5C3EB 3EROA 2GA4B 3SDZA 2KCNA 4RCNA 5ELEA 3M7GA 2WACA 2KCCA 2B2YA 3ERQA 4IUUA 3PUYA 3MXNA 3EA6A 4ZK9B 4C3HB 5A2QL 1TKWB 1STBA 1WTOA 5CV4A 1AEXA 4O1NA 3H94A 3VYTA 4DNRB 3CKIB 2R92B 4TKOB 1U4MA 4CKBA 4DAYA 2F4IA 1CQVA 1RODA 2EOTA 1PTOF 1Q1EA 1TQOA 3NPPA 3LNNA 3Q0AA 3DEOA 4TQUS 1UNSA 4RHRA 1ET9A 2E2HB 4FF3A 3O13A 5IGEA 1QOHA 2YYZA 1QCBD 3X3NA 5G3LF 3WOFA 3Q22A 1F2LA 1FGBD 1TIID 3E0JA 4OIKA 3TN2A 1TY0A 1PFBA 2FMCA 1A2TA 3D6CA 3M3YB 5D3IB 2PO4A 1E2ZA 1F9PA 3I91A 1NCVA 1ZEQX 4HMIA 4XQJA 4K2LA 4PQXA 2F0EA 1D2BA 3MVVA 1LTSD 4C3IG 2PMZB 3I4MB 2C9OA 2R61A 5D14A 2ZT9C 4G7HC 1J9OA 3C1FA 1D5ZC 3S9WA 1PTOH 1KNAA 2NBFA 1EY5A 1Y8NB 1I4RA 1ILPA 2HDLA 5DM73 4G4KA 1TS5A 1SNPA 3GTKB 3K5OA 5CV5A 3AMUA 1WTXA 3FKIB 2DY7A 2NZ1D 1S4ZA 1BCPD 1EY4A 2NN6G 2CHBD 4FP5D 2DN8A 1PFNA 2B2VC 5E4XA 4ZUIA 1R4PB 1K83B 4KY6A 1HXYD 3DWPA 2NB0A 5KRUA 1F2ZA 5I6WA 1SYFA 1JE4A 1OXSC 1YNJD 4S3SA 1SJED 2B2WC 2K7VA 3R3OA 3Q6SA 2YU9B 3P7JA 2X69A 3Q24A 1RD9D 2NVQB 2O5IC 1Y1VB 2BA1A 3KLRA 1R9TB 1OXUA 2IJ0A 3D4DA 5CGKA 4K14A 3QJYA 1GHJA 2XNAC 1LACA 1EWHA 3NTKA 4EQOA 5BN3A 4BY7B 2Z8LA 2XRSD 3NWTA 2AUKA 2Z1CA 3S2HB 1S5DD 1I4HA 4G57A 2CW0D 2B8GA 4X3KA 1YNJC 4KI0A 4XQQA 2F03A 3KBXA 1ML0D 3SK5A 1CM9A 2AQ1B 4HAEA 4I7ZC 2R3ZA 1BXTA 2IX0A 2F0KA 4QMGA 2NUCA 5KYIA 3E6ZX 3K58A 4HCSA 3HOUB 3RMHA 2KHSA 1MSHA 1X3PA 2B2UC 3HP3A 3DMUA 2BCOA 3S1MB 5C3WA 3W3AA 1AW7A 2WIIB 3TP6A 2A5HA 1Q1BA 2DY8A 1RF2D 2MPMA 2XN9C 4E6IA 3K5MA 5JPNC 4IZ8A 1D5XC 4UDUC 2LFNA 2FJ2A 5FO9B 3FVQA 2K6AA 1JR0D 4AYBB 3J80L 3HG9A 2XWBB 3AU7A 2FINB 2D62A 2FMMA 2KOLA 1IYVA 1H9MA 1XX8A 5F2DA 2EY2A 2KEDA 4KN4C 1G6ZA 1STYA 3CRLC 1V43A 1E0BA 3U9OA 4WORA 3OHXC 3JAME 2K28A 1XWEA 1OXTA 4KN7C 3I72A 2SNSA 5LHY1 3NWSA 5EGTA 1MSGA 4HSPA 3K57A 1G2SA 1CZGA 4ZLTF 1JORA 2OT2A 2LMCB 5I2YA 2KEEA 3D3RA 2EYJA 1GUGA 4KD3A 2WINB 3GD7A 1EYCA 5HGTA 1SYCA 3A7LA 2NVXB 1I4PA 3BVZA 4OGQC 4Z9CB 5IOCA 5C0XJ 1AP0A 3T56B 2WP8J 1Y8OB 2MGSA 3BYTB 1SXTA 2PW7A 1GJXA 3PO2B 1O7LA 1KDCA 2AWNA 1GUTA 3VYUA 2K04A 1WCMB 1H9KA 2JEBI 2NTTA 2M9VA 1OXXK 1BUVT 4PMWA 2V4DA 2R93B 3SR1A 1DOLA 4XT1B 2SOBA 2Q8RE 2F3VA 5EPKA 2ZXRA 3J7AF 2KA7A 4FF1A 1U4LA 4A3MB 5CBEE 1B2TA 4IFDJ 3M4OB 1SJHD 3QO2A 2ID0A 3MXPA 2EYHA 1A2UA 2HUGA 1RTNA 1B44D 3A55A 4ME5A 1JICA 1D1IA 1SYGA 3T51B 5EKIA 4MHEA 3QIAA 4KY7A 1BR9A 5JPMC 3M7NA 2PW5A 2BDOA 4HCEA 2QKIC 3N6RA 1SSOA 3EVQA 2X6GA 1HUMA 2NYZD 1SFOB 1KDBA 2RBMA 2RVLA 3L7ZC 4EQNA 5CV6A 5ELCA 3R2IA 4R8NA 3IL8A 3MEHA 3LX0A 3QWNA 4Q0FA 1MGSA 1CK1A 3ND9A 4BY1B 5CC4A 2F0PA 4P2CB 4FVMA 3BG3A 1QILA 4WJWA 1UUPA 2F3WA 2NTSA 2XWJB 1PRTF 1ET6A 2NN6I 1HHVA 4ODGA 3FEWX 2JA7B 5IT9L 2N88A 4DAVA 4BA1I 5I4DA 4QUCA 2D5DA 1FNUA 3AB9A 1FNVA 4MIUA 2JA5B 4TSSA 1QE6A 1EYAA 5C4JB 1XYIA 1VF7A 2F0NA 5C3XA 3J81E 3H09A 5I2XA 1E2WA 1B9NA 2RDFA 3GTGB 4CHTB 2A6HD 1STAA 5LL6X 3TZDA 4DU9A 1TVXA 5KGUA 1AFPA 4U673 1EIGA 3K5NA 1PMRA 2EPBA 4KKSA 1CA5A 1SNQA 1PRTC 3MFYA 3QB3A 1BF4A 1BNZA 1DOMA 4FNFA 5M9OA 3PV0A 1KAAA 1LTAD 4C56C 3NUCA 4YIJA 2K03A 1EZ6A 3BVMA 4X3SA 3BVGA 1NR4A 2AQ3B 3GTMB 4WFN3 1A3UA 3Q23A 3HZXA 3HGBA 1QG7A 2A6HC 3GTPB 3SK6A 1GUOA 2JP1A 1EY7A 2F0UA 2DNCA 1Y69U 4ID6A 4KHZA 4NP5A 3OWEB 3GTLB 4N9PA 1XTCD 2VXWA 4BBRB 1Z6HA 3CU7A 4G7OC 2ZXOA 2PQEA 1KLUD 1EZ8A 3S1NB 2EY1A 1PTOB 1TS3A 2PNRC 2LKVA 4H7BA 1L0XB 1EY8A 4F87A 1STGA 3K6OA 5DM63 1A15A 3TZUA 1AZPA 1YNND 4RCOA 2NWGA 4ZQ3A 4L8JA 1S5FD 2NVTB 1CFMA 4XYOA 4DFAA 3TBIB 3EFXD 4XQNA 1WD0A 1PZJD 2R6GA 4KD4A 3GO5A 3VR6A 5A35A 1CQFA 1GOZA 5EBDA 4X3TA 4QIWB 4ZYSA 1I3QB 3CRKC 4ZKBB 3OPOA 2IWHA 4RA8A 2E2JB 4EGVA 5KNDA 2K1BA 2L4NA 4PNYA 1SAPA 1YNNC 2AQ2B 4KJNA 2F0OA 4K2KA 1B1ZA 1LT6D 1HFNA 2L12A 3VR4A 3M4YA 1DONA 3IFDA 4C3JB 4CJ0B 3QOJA 3K59A 5DEHA 4K5VA 5FLXL 3NQTA 4A3IB 3BDCA 3S16B 2QEJC 4LMQD 5K36G 1LT5D 4HMJA 3J7YW 5CBAE 1EY9A 1LABA 1BCPF 2Q8IB 4PMBA 2EDGA 2ENBA 2HDMA 4RGOS 1ZKOA 4A93B 4FO2A 5T1IA 3PUZA 1RJTA 5BN5A 2HCCA 4IURA 4RGTA 2EYOA 2KECA 1Y1WB 2VB2X 4J6HA 4FXDA 5EQ0A 3IAYA 3MAQA 4LK1C 3MC0B 4TRDA 4K5WA 2B2WA 4RHSA 1Q90A 4R8IA 1I6VC 3NHHA 1BCPC 3D6WA 3ITPA 5C0XG 2RDHA 5C4ZA 1RTOA 3A54A 4RFBA 2G9DA 1TR5A 1QJOA 2A74C 4OIJA 4KMUC 1LT4D 5JEAJ 2Y0SB 4IUVA 1IW7D 2WKCA 2VUMB 1B3AA 2A68D 2F0JA 4QF4A 2EYFA 2ICIA 5M5XB 1QNUA 3OIPA 3C2PA 3ZYYX 2MHVA 2PZUA 4DGZA 4O42A 1LV9A 5IT9E 2JSOA 1AZQA 5J22A 4DF7A 4CKCA 1ENAA 1WTWA 3NBIA 4IFDG 3HOVB 1W6JA 4C3IB 1B50A 1BQQT 2EJMA 2HQEA 4A3KB 4ZAIA 4FXGC 3PUVA 2CW0C 2B2UA 1ZXTA 5CV8A 1TS4A 2A68C 5IODA 4OO1G 4HR7B 3N52A 1F77A 2AWOA 3FDTA 1K8OA 1O7ZA 2JEAI 4EQPA 2B2TC 1AN8A 2WB1B 4M1UB 3T13A 3A56A 3NE5B 2J7ZA 1DZ1A 4DK0A 3M85A 1JB3A 1SE3A 5FO7B 1PLFA 1IHZA 4X3UA 1U4RA 2PZWA 3MWYW 3DHQA 2HCIA 3OMGA 3OWFA 2TMPA 4NDXA 1SNOA 1PFMA 1RKNA 2K5QA 4NKLA 4KTAA 3T16A 1HTPA 4ZRZA 2F0IA 4U68A 1F2MA 5CMDA 5A2QE 3VYSA 1SYDA 3S14B 3SXHA 4C1NI 4DAPA 5COYA 2EVBA 2O4XA 3KF8A 3WOEA 3H6MA 5IGDA 5K36H 1I50B 1FNWA 3MTSA 4ZKCB 1LO5D 1PYWD 1Y8PB 1BDOA 2XSCA 1KLGD 2NN6H 5CV7A 4XYQA 1PXUA 2K33A 1F9QA 5IGFA 3P20A 1R4QB 5C4HA 4BBSB 2EY6A 3NQIA 2OEOA 3HOWB 4XIGS 1DCZA 1JQYD 1HPCA 2QF7A 2RDGA 5AFWA 3VR3A 3FMCA 4KJOA 5ISRA 1H9RA 2I07B 2L55A 1I4QA 4DXGA 1S5BD 1X32A 4RKBA 1DYQA 3NTHA 3TMEA 1A3VA 1TU2B 2SEBD 1GHKA 1BOSA 1EL0A 5C0XH 2LY7A 2OXPA 3FRPB 3SK8A 1ONLA 1Z7TA 5EKLA 1LTTD 2PYKA 3HKZB 4CGYB 3KK7A 5E1FA 1ILQA 4A3GB 1D6EC 3K5LA 1ZYRD 4CJ2C 2XRQD 4KKTA 4NW2A 5FLXE 3TSSA 4PV1C 1QWYA 3BZDB 5C5LA 2F0VA 3ND8A 1M4VA 1SDFA 1JOOA 5I6YA 3T53B 3DUZA 1PRTB 1ESRA 2SNMA 1A6XA 2J4XA 2IW3A 3OMCA 5CR3A 5KYLA 2RA4A 1JOQA 1IKLA 1BBXC 3S15B 1RHPA 2BE5D 1GUSA 4RH6A 5EKKA 4IFDH 2ZXPA 5CYUA 1T5XD 3W2DA 4CJ1B 5CV9A 3BYYB 4C3HG 1ZYRC 3A8IE 5IGCA 2I46A 4OO1H 1EEID 1OXVA 4K8JA 3U9SA 4A3JB 3KUPA 1X3QA 3SVMA 1CT1D 4BA2I 2FHTA 3P75A 4H0LC 3OSOA 5I9PA 1LTGD 1VCIA 2RKSA 5DNFA 2L1BA 3EJIA 1J8IA 1LTID 1H9JA 1B4OA 1UEAB 1JC7A 5KIXA 2PCFB 1SEBD 4ABNA 2F0LA 2K32A 2K5DA 1RCVD 3R2TA 2E76C 1TT2A 2F0HA 2EYPA 5C0XI 2EYMA 1B53A 1FD7D 1SNMA 2KUMA 2OF1A 3HOYB 4CKEA 1CZWA 3DM1A 3S17B 4B08A 1HUNA 2B8FA 2F0SA 5C4XB 4DN4M 2R7ZB 5IGGA 3V05A 4H44C 1JWMD 3VR5A 3SE0A 4C1NK 2JYOA 3VA5A 3GTQB 3LWUA 3JAML 4IFDI 3RZDB 3URYA 3I4LA 1I6HB 1IKMA 4IN3A 1KTKA 3MA2B 3J80E 3H91A 5EBCA 5I9OA 4FF4A 1DJRD 2PZTA 3NXWA 2B2YC 2RQXA 1G91A 4XXEA 2L11A 4OO1I 4DNTB 3TP8A 1SNCA 3GV3A 1TWFB 2WKDA 1GUWA 1NR2A 2RSNA 3H3VC 5JEAG 3A7AB 5K5PA 3E5SA 3IFTA 3OIQA 1D1KA 3C3LA 1HTLD 3MXUA 5ELDA 2WV6D 3GQBA 1W6KA 3PMFA 2O5JC 3OOCA 5JOBA 5TSSA 3NBHA 1PTOD 2B39A 3K0YA 2Z4HA 4XT3B 2JXMB 3QG1A 4N9TA 1H9SA 4I65A 3I3CA 3NSWA 5ELFA 3TDQA 2H4OA 4HSVA 4A3FB 5G3LD 3LWEA 3PUWA 4FF2A 4G7ZC 3D4WA 1WD1A 3KBGA 1TWGB 3HOZB 1PZID 3I90A 2A69D 2AUJD 4L6TB 2O2LD 1BCPB 2M00A 4M8AA 1LTRD 2M2LA 2IPKD 5LL6S 1ESFA 1E2VA 1LLRD 1PTOC 4PMCA 3PO3B 3PIP3 1STNA 3GTJB 4Y7NB 2VB3X 2EJFC 3HS0C 3HOXB 1F2YA 3X3MA 3HEJA 3NTIA 1TWCB 1G8ZD 1K8MA 5C6AA 4BS9A 1VDZA 5JVG3 2EJGC 1S5CD 4KK7A 2A73B 3I70A 1O7YA 1GUNA 2A69C 1TWAB 4IUPA 4DA2A 2QILA 1SYBA 2D2CC 4KY5A 4HN7A 2EE1A 5D65A 1JWUD 3MFGA 2B2VA 3FPPA 1VF5C 1SYEA 3A8JE 1JCKB 2RSOA 4KKUA 4J1MA 4QUFA 1OO9B 3VR2A 1NSNS 1VMCA 4B9WA 2F0MA 5JAVA 1SMYD 4F8MA 3T4AC 3S1RB 3NK9A 4XDXA 1II3A 2F0WA 4ILWA 3K7AB 1KDAA 5E4WC 2KJXA 3H0GB 3WDNA 3R8BA 3C1EA 3C46A 2L0CA 1IYUA 3FPUB 3SHLA 3V2TA 3CHBD 3J81L 4A3BB 1STHA 3UI2A 4RWSC 4FYDA 5M3MB 5JVH3 1V1OA 2E2DC 2EYLA 3MXGA 1JWSD 1SMYC 3S1QB 1TWHB 1BO0A 1KABA 4K6DA 3SEBA 1HA5A 1EIHA 1M8AA 3D8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOM A;  2B2W A;  2L1B A;  1MSG A;  1GUW A;  4X3K A;  1NR2 A;  1J8I A;  1G2S A;  1O7Y A;  4IUP A;  3R93 A;  4IUT A;  1U4P A;  4R8I A;  2RSN A;  4ZLT F;  1B4O A;  4X3T A;  3KBX A;  5D14 A;  2Q8T A;  1MI2 A;  1ML0 D;  1PLF A;  2EE1 A;  5D65 A;  2X6L A;  1J9O A;  2H1E A;  1WVL A;  1CM9 A;  1SSO A;  3D6W A;  3G7L A;  1X32 A;  4X3U A;  1ICW A;  2B2V A;  1KNA A;  2KEE A;  1HUM A;  2NYZ D;  1U4R A;  2K03 A;  2X6G A;  3MWY W;  4HAE A;  4ZKB B;  2R3Z A;  1WTV A;  2HCI A;  2RSO A;  2RVL A;  1ILP A;  2HDL A;  1EL0 A;  1RTO A;  4RA8 A;  4X3S A;  4QUF A;  1WD0 A;  1VMC A;  1NR4 A;  2FFK B;  2L9H A;  1QNK A;  4HCS A;  2K1B A;  4R9W A;  4OIJ A;  2L4N A;  2K05 A;  1PFM A;  1SAP A;  2B2Y A;  1MSH A;  1X3P A;  4IUU A;  2B2U C;  1ILQ A;  3IL8 A;  1IL8 A;  4IUV A;  1WTX A;  1B3A A;  1B53 A;  1PDQ A;  1QG7 A;  3HP3 A;  5EPL A;  4CJ2 C;  4IUQ A;  1AP0 A;  4ZK9 B;  2DY7 A;  2KUM A;  4NW2 A;  2NZ1 D;  3ONA B;  1S4Z A;  2B2T A;  2MGS A;  1HFN A;  1MGS A;  2N55 A;  2JP1 A;  1WTP A;  2L12 A;  1WTO A;  4XDX A;  4XT3 B;  1DON A;  3DM1 A;  3IFD A;  1C8C A;  1EOT A;  1Q3L A;  2IL8 A;  1PFN A;  4CJ0 B;  1HUN A;  3I3C A;  2B2V C;  4O42 A;  5JJZ A;  1CA6 A;  5E4X A;  1LV9 A;  4U68 A;  1KNE A;  4DN4 M;  5E4W C;  2DY8 A;  1AZQ A;  3F2U A;  4HSV A;  5CMD A;  1F9R A;  2MPM A;  1U4M A;  2MP1 A;  1SDF A;  1O80 A;  1HFG A;  2XIW A;  3LWE A;  2VXW A;  2K04 A;  4RAU C;  1HHV A;  1HA6 A;  2KVM A;  1HRJ A;  1WTW A;  1ROD A;  1WD1 A;  1JE4 A;  2EOT A;  2FJ2 A;  3FPU B;  5EJW A;  4LMQ D;  4UAI A;  1ESR A;  5COR A;  5COY A;  2N88 A;  3I90 A;  2RA4 A;  3DEO A;  1IKL A;  3DEP A;  2B2W C;  5CBA E;  2JYO A;  4QUC A;  1RHP A;  2K01 A;  1BBX C;  1B50 A;  2SDF A;  1DOL A;  3Q6S A;  2CVR A;  2X69 A;  3P7J A;  4XT1 B;  2HDM A;  2FIN B;  2Q8R E;  3MTS A;  4MN3 A;  4RWS C;  5EPK A;  3UI2 A;  4ZKC B;  2FMM A;  2KOL A;  4HED A;  5EPJ A;  4ZAI A;  1BNZ A;  1QE6 A;  1VMP A;  1XX8 A;  2KED A;  2B2U A;  1ZXT A;  2M2L A;  4CJ1 B;  2MJ8 A;  1G6Z A;  1IKM A;  5T1I A;  1WTR A;  1XYI A;  2BDN A;  1RJT A;  1U4L A;  1B2T A;  5CBE E;  1E0B A;  1F9Q A;  3GV6 A;  1F2L A;  3H91 A;  1DZ1 A;  3N52 A;  2HCC A;  3QO2 A;  1DOK A;  4IUR A;  1NAP A;  1A15 A;  1AZP A;  2HUG A;  2KEC A;  3FDT A;  3I8Z A;  1BO0 A;  1RTN A;  1G2T A;  2K28 A;  2NWG A;  1O7Z A;  2B2Y C;  3TZD A;  1G91 A;  1TVX A;  3KUP A;  4OIK A;  1X3Q A;  1EQT A;  3TN2 A;  3SVM A;  2L11 A;  1PFB A;  1EIG A;  1JIC A;  2D9U A;  2FHT A;  1F9S A;  2EPB A;  1EIH A;  2B2T C;  1F9P A;  5EQ0 A;  1CA5 A;  1M8A A;  5AFW A;  5EKI A;  4MHE A;  3I91 A;  5T1G A;  3GV3 A;  2J7Z A;  1BF4 A;  1NCV A;  1WTQ A;  5DNF A; 
#chains in the Genus database with same CATH topology
 4X6A H;  1A3T A;  1EY6 A;  1IW7 C;  2B63 B;  2R93 G;  3R93 A;  1U4P A;  1C48 A;  4OHJ A;  1P8L A;  4GOP C;  1MI2 A;  2CWA A;  4GZY C;  4EX5 A;  2H1E A;  1T5E A;  3S1R H;  1UE6 A;  3SK4 A;  2YU9 H;  4KHV A;  1EEF D;  5FOB B;  1SND A;  5JEA H;  2NVQ H;  1PH3 A;  1Y1V H;  2Z6B A;  2G5D A;  1R9T H;  4OEL B;  3CQZ B;  1X54 A;  3G6J B;  1D8L A;  4R9W A;  4DR1 L;  4LF5 Q;  1CI3 M;  3KLS A;  3I4N B;  4QGU A;  4DR5 Q;  2JA6 B;  4XTC S;  4DV2 Q;  4P74 A;  3G71 A;  2F1M A;  3ONA B;  2B2T A;  4BY7 H;  1I4G A;  2TSS A;  4DR3 L;  1WTP A;  4L63 B;  4WJ3 M;  4A75 A;  4FXK C;  4NMZ A;  4JI5 L;  4DV6 L;  2YTV A;  1EOT A;  1Q3L A;  1NTG A;  5ELB A;  1HNZ Q;  3HKZ G;  3S2H H;  1CA6 A;  1AH9 A;  1KNE A;  1STE A;  4QB4 A;  2IX1 A;  4A3G G;  2F0D A;  3F2U A;  2PQA A;  2F0F A;  4JBM A;  1ENF A;  2KEN A;  1KC8 C;  1HFG A;  2DNE A;  1IYJ B;  1PHJ A;  5EJW A;  1TWH H;  4UAI A;  4DR4 L;  5COR A;  2JA8 B;  1FL0 A;  2DGY A;  2YTX A;  1N36 L;  2K14 A;  2N3S A;  1KL9 A;  1PZK D;  1VQD A;  1EQV A;  4HED A;  5GAD C;  4A3D B;  5KEE A;  1HRJ A;  4JOI C;  1MBY A;  4KLK A;  3L9A X;  1J5E L;  3HOU H;  4R4I A;  2B63 H;  3QOL A;  3J81 j;  4V19 0;  1EFI D;  2VW9 A;  4IO9 A;  1NAP A;  5D3D A;  3RZO B;  1SE4 A;  4BY1 G;  1L0Y B;  1QUQ A;  4OX9 L;  3I8Z A;  4GNX A;  4Q5V A;  5IYD H;  2E74 C;  2Z4I A;  3CW2 C;  2L5T A;  3RD4 A;  1F9S A;  3EN2 A;  4CDF C;  1VQM A;  2E75 C;  5T1G A;  1WTQ A;  2K5W A;  4RGN A;  4ULL A;  1DM0 B;  5IGB A;  1UAP A;  1FYC A;  4K8I A;  2ICE C;  4IUT A;  5J39 A;  3KLS X;  2Q8T A;  4CDE C;  2JA5 G;  2G9H D;  4YWK A;  4JI1 L;  1WVL A;  3G7L A;  1Q12 A;  3F1Z A;  1K9M C;  1YBY A;  4F7X A;  1Z47 A;  2OQK A;  3RLF A;  1HR0 Q;  3U4V A;  1LTB D;  1SLJ A;  1VQA A;  4CBV A;  3D4R A;  1G6P A;  2F0T A;  2FFK B;  4JV5 Q;  2F0G A;  4DXF A;  3IKJ A;  2VNU D;  1GM5 A;  1DGS A;  2Z6K C;  4C2M B;  1JOK A;  1S5E D;  2JA8 H;  4QCL A;  5FLM G;  2N55 A;  4UP7 A;  1TS2 A;  2EZV A;  4BWG B;  1XXG A;  3TQY A;  3MHB A;  4LFC L;  4RKL A;  4J8Q A;  1O80 A;  4APV A;  2KQ3 A;  3PIO 3;  1HA6 A;  3AFQ A;  1EWI A;  1DD2 A;  2UXB Q;  3NEL A;  3PQI A;  4HTH A;  5KNB A;  1NUC A;  3DXJ C;  2PI2 A;  3CCS A;  4JI6 L;  5HUR A;  2NVY B;  1CTM A;  2K01 A;  2R7Z G;  1HQM C;  3VA7 A;  4DUY L;  2CVR A;  3HRZ C;  5NUC A;  4MN3 A;  3OTO Q;  5EPJ A;  1EY0 A;  1VMP A;  3DWQ A;  4LF6 L;  1QB5 D;  4A3E B;  2MJ8 A;  5GAH C;  2NVX H;  2BDN A;  4KV6 A;  5FK9 C;  4DR7 L;  1CHP D;  5M5Y B;  2PNH A;  4BXX H;  3P1H A;  3KDF A;  3GV6 A;  4LAA A;  2EXZ A;  5LMN L;  5DAU A;  3I73 A;  1W2B A;  2JA9 A;  5E3F A;  1C4Q A;  1U9R A;  1GXD C;  1HCZ A;  3J7A 5;  1EQT A;  3BDO A;  3PO2 H;  5FO8 B;  5IIF A;  3A74 A;  1HH2 P;  2QCP X;  1GVP A;  1V8Q A;  3CCR A;  1PH8 A;  1V1P B;  2CQA A;  1N34 L;  1FGU A;  1LT3 D;  3CCU A;  1O78 A;  1VQP A;  3DWA A;  4IAL A;  1CHQ D;  5C5M A;  4B9X A;  5BR8 L;  4JBW A;  4C2M H;  3PUX A;  1I4X A;  4RGM A;  2E2I B;  1U0L A;  3NP8 A;  4LFA Q;  5M3F B;  2R93 H;  1XPR A;  2UXD L;  3V96 A;  2A6E D;  1S3O A;  1FR3 A;  1WTV A;  4K5X A;  1IBK Q;  3S2D B;  4JK1 C;  1TY2 A;  5FKA C;  5IYB H;  1B9M A;  2L9H A;  3L3O C;  4A3M H;  1PRT D;  1QNK A;  2C5C A;  5LMU Q;  4CDC C;  2J0T D;  3M4O H;  2K05 A;  4H13 C;  1D5M C;  1IL8 A;  1PDQ A;  5EPL A;  1L1O B;  1HZC A;  1VQB A;  4IUQ A;  1MJE A;  4LF4 L;  2BE5 C;  5JJI A;  2JN4 A;  3GTO B;  1EWC A;  1H95 A;  2UXC L;  3TP7 A;  1C8C A;  2IX3 A;  2IL8 A;  1MD2 D;  5JJZ A;  2EY5 A;  3CXC A;  1DXM A;  5KNC A;  1HZB A;  3D31 A;  4IQZ A;  3K80 C;  3GP7 A;  4OL7 A;  5DLQ E;  1F9R A;  3OW7 A;  2MP1 A;  4IUN A;  5M5Y H;  4YWM A;  2XIW A;  4RAU C;  2I5L X;  3VYR A;  2KVM A;  4NXN L;  2PPB C;  1EU3 A;  4K6L A;  1RDP D;  1HQR D;  2QEX A;  3DEP A;  4NPS A;  2A6E C;  1EYD A;  2SDF A;  2I5H A;  2NZH A;  3TS0 A;  4A3F G;  3MZ5 A;  1SFO H;  1I94 L;  1HNX Q;  1YI2 A;  5ELN A;  4DK1 A;  4LJZ C;  2IT1 A;  4DAY B;  4F88 A;  5J1Z A;  1WTR A;  1EU4 A;  3TP5 A;  3NBH B;  2RCN A;  2BOS A;  1Q8I A;  3BDL A;  3ZJY C;  1ENC A;  2MUY A;  1XJV A;  1DOK A;  1V1P A;  3J7A V;  2XVS A;  1SE2 A;  4C3J G;  1H9S B;  1G29 1;  1G2T A;  2OWO A;  4OWX B;  5BN4 A;  5M5W B;  4BY1 H;  3AQQ A;  3U58 A;  2QDB A;  2D9U A;  3KLW A;  2WAQ B;  4A3I G;  3A8K E;  3G48 A;  4WRD A;  1M90 C;  4GN4 B;  4PG3 A;  3BS1 A;  2LS0 1;  5C44 B;  2AHO B;  1SBB B;  1Q81 C;  4ZUJ A;  2BA0 A;  2JA7 H;  2JE6 I;  3RUZ A;  4EVO A;  4V0B A;  3EQL C;  2X6L A;  2VY3 A;  2F0Q A;  1ICW A;  5C3E B;  3ERO A;  4A93 G;  1CKN B;  2GA4 B;  3SDZ A;  2KCN A;  4RCN A;  5ELE A;  5C4J H;  3M7G A;  1VQ5 A;  4DR1 Q;  1ASY A;  2WAC A;  2KCC A;  2B2Y A;  3ERQ A;  4IUU A;  3PUY A;  3MXN A;  3EA6 A;  1SRU A;  4ZK9 B;  3GTG H;  4C3H B;  4DR3 Q;  5A2Q L;  1TKW B;  1YZ6 A;  4JI5 Q;  4DV6 Q;  1STB A;  2HD3 A;  4JCV E;  2ZJR A;  4MTN A;  1WTO A;  5CV4 A;  3AEV A;  1AEX A;  4O0A A;  3H94 A;  4O1N A;  2UUA L;  3H3V H;  5FLM H;  3VYT A;  4DNR B;  3CKI B;  2R92 B;  4TKO B;  1KRS A;  1U4M A;  4ME3 A;  4CKB A;  2CH4 A;  3CCV A;  1AE2 A;  1PH2 A;  4DAY A;  4DR4 Q;  2F4I A;  4HJ8 A;  1CQV A;  1ROD A;  2IHF A;  4NXM L;  2EOT A;  1PTO F;  1Q1E A;  1VQH A;  1TQO A;  3NPP A;  3LNN A;  3Q0A A;  1N36 Q;  3DEO A;  4TQU S;  2N8N A;  3CC7 A;  1UNS A;  4RHR A;  2HIV A;  1ET9 A;  2E2H B;  4FF3 A;  3O13 A;  1B7Y B;  5IGE A;  1QOH A;  2Y0S G;  1J5E Q;  1WYD A;  4HIO A;  2YYZ A;  1QCB D;  1EUJ A;  3X3N A;  5G3L F;  3OW2 A;  2VUM G;  3WOF A;  3Q22 A;  3GTM H;  1F2L A;  3TEH B;  1FGB D;  4OX9 Q;  4A3B G;  1M1K C;  1TII D;  1EYG A;  3GTP H;  3E0J A;  4JBJ A;  4OIK A;  3TN2 A;  3JAM c;  1TY0 A;  1PFB A;  2FMC A;  1A2T A;  3D6C A;  3M3Y B;  5D3I B;  1BKB A;  2PO4 A;  1E2Z A;  1F9P A;  1CKN A;  3I91 A;  4LF9 L;  3W1G A;  2A19 A;  3GTL H;  1NCV A;  1ZEQ X;  4HMI A;  3UDG A;  1XMO L;  3HOV G;  1NNX A;  4XQJ A;  5IYC G;  4K2L A;  4PQX A;  4BBR H;  2F0E A;  1D2B A;  1N9W A;  3MVV A;  1LTS D;  4C3I G;  2PMZ B;  4JI1 Q;  5H1S E;  3I4M B;  2C9O A;  2R61 A;  5D14 A;  1ICF B;  2ZT9 C;  4G7H C;  1J9O A;  4X66 L;  3S1N H;  2R7D A;  3C1F A;  1D5Z C;  3S9W A;  1PTO H;  1KNA A;  3BZC A;  2NBF A;  1EY5 A;  1Y8N B;  1I4R A;  1JJ2 A;  3F2C A;  4GKK L;  1ILP A;  1HZ9 A;  2HDL A;  5DM7 3;  4G4K A;  1TS5 A;  1SNP A;  1QVF A;  4R4O A;  2HHH L;  3GTK B;  3K5O A;  5CV5 A;  3AMU A;  4GS3 A;  1WTX A;  4DPG A;  3FKI B;  2DY7 A;  2NZ1 D;  1S4Z A;  2WB1 G;  1BCP D;  1EY4 A;  2NN6 G;  5EAY A;  2CHB D;  4FP5 D;  2DN8 A;  2E2H H;  1PFN A;  2NVT H;  4LFC Q;  1G51 A;  1VQF A;  2B2V C;  5E4X A;  3I4N G;  4ZUI A;  1EOV A;  1R4P B;  3KJP A;  2BH2 A;  3ICE A;  1K83 B;  4KY6 A;  1HXY D;  3M4Q A;  2LSS A;  3DWP A;  2NB0 A;  5KRU A;  1F2Z A;  5I6W A;  2ZM6 L;  2E5L L;  1WJJ A;  1VQK A;  1SYF A;  3U50 C;  1JE4 A;  1OXS C;  3F2D A;  2JQO A;  4JI6 Q;  1YNJ D;  4S3S A;  1KIX A;  1SJE D;  2B2W C;  4DUY Q;  2K7V A;  4OON A;  4OWT B;  3CCL A;  1I3Q H;  3R3O A;  3Q6S A;  2YU9 B;  3P7J A;  2X69 A;  3Q24 A;  1RD9 D;  2F3I A;  4LF6 Q;  2NVQ B;  2GVA A;  3KOJ A;  2O5I C;  1Y1V B;  1YIJ A;  2BA1 A;  3KLR A;  4DR7 Q;  1R9T B;  3B6Y A;  1OXU A;  2E2J H;  2IJ0 A;  1B70 B;  3D4D A;  5LMN Q;  1Q8K A;  5CGK A;  4K14 A;  3QJY A;  1GHJ A;  2XNA C;  3RR5 A;  3GDE A;  1LAC A;  1EWH A;  3NTK A;  4EQO A;  5BN3 A;  4BY7 B;  2Z8L A;  1A62 A;  1IZ6 A;  2IHE A;  2XRS D;  4C3J H;  4DV1 Q;  2PQA B;  2AUK A;  3NWT A;  1XPU A;  2Z1C A;  3S2H B;  1S5D D;  1I4H A;  1N34 Q;  4DR2 L;  4G57 A;  3CPF A;  1KXL A;  1JJC B;  2CW0 D;  3T1Y L;  1E24 A;  1YHA A;  4A3I H;  5BR8 Q;  2B8G A;  2HIX A;  2K52 A;  4X3K A;  3S16 H;  1YNJ C;  4KI0 A;  4XQQ A;  2F03 A;  3BJU A;  3KBX A;  1ML0 D;  3SK5 A;  2UXD Q;  1CM9 A;  5ELO A;  2AQ1 B;  1LUZ A;  4HAE A;  4I7Z C;  2R3Z A;  1BXT A;  2IX0 A;  2F0K A;  4QMG A;  1XNR L;  1K8G A;  2NUC A;  4A93 H;  4JW0 A;  5KYI A;  3E6Z X;  1PH9 A;  3K58 A;  4HCS A;  3HOU B;  1JB7 A;  1QUQ B;  3RMH A;  4LFB L;  2KHS A;  4LF4 Q;  1MSH A;  1X3P A;  2B2U C;  3HP3 A;  1I5F A;  3DMU A;  2BCO A;  1BVS A;  2UXC Q;  3S1M B;  5C3W A;  4N8F A;  1Y1W H;  3W3A A;  2EXD A;  1AW7 A;  2WII B;  3TP6 A;  4UP8 A;  2A5H A;  5HY6 A;  1YHB A;  3I55 A;  1Q1B A;  1IBL L;  2DY8 A;  2MNA A;  1RF2 D;  2MPM A;  2XN9 C;  4E6I A;  4IPD A;  3K5M A;  4GOP A;  3F2B A;  4NXN Q;  5JPN C;  4IZ8 A;  1AE3 A;  1D5X C;  4OEM B;  4UDU C;  2LFN A;  2FJ2 A;  3HKS A;  5FO9 B;  3FVQ A;  2K6A A;  1JR0 D;  3CCM A;  1I94 Q;  2QDL A;  4AYB B;  3J80 L;  3HG9 A;  2XWB B;  1HZA A;  3AU7 A;  2FIN B;  3CP0 A;  2D62 A;  3EBE A;  4HJA A;  2FMM A;  2KOL A;  1IYV A;  1H9M A;  3CF5 A;  1XX8 A;  5F2D A;  2EY2 A;  2KED A;  4KN4 C;  1G6Z A;  1STY A;  1VQ8 A;  3CRL C;  2ZTC A;  1V43 A;  1PH5 A;  1E0B A;  3U9O A;  4WOR A;  3OHX C;  4PZ7 A;  2PI2 E;  3JAM E;  1PYB A;  3J81 c;  1P16 A;  2K28 A;  1XWE A;  1OXT A;  4A3E G;  5M5X H;  4KN7 C;  5IWA L;  2OTJ A;  5JJK A;  3L2P A;  4IPG A;  1CSP A;  1VQI A;  3I72 A;  1C9O A;  2SNS A;  5LHY 1;  3NWS A;  4R4T A;  3CAM A;  4DV4 L;  5EGT A;  1MSG A;  4HSP A;  3K57 A;  1G2S A;  3KFU A;  1CZG A;  4OXP A;  4ZLT F;  1JOR A;  3HOV H;  5IYC H;  2OT2 A;  4UHV A;  2LMC B;  3S1M H;  4YY3 L;  2ASB A;  5I2Y A;  2KEE A;  4JOI A;  3D3R A;  2EYJ A;  1YIT A;  1GUG A;  4KD3 A;  2WIN B;  4A3K H;  1N8R C;  2RHS B;  3GD7 A;  1EYC A;  5HGT A;  1SYC A;  3KDF B;  4AQY L;  3A7L A;  2NVX B;  1I4P A;  3BVZ A;  4OGQ C;  4Z9C B;  5IOC A;  1B3Q A;  4A3J G;  4LF7 L;  5C0X J;  3J81 i;  1AP0 A;  4GLX A;  3T56 B;  4HJ7 A;  2WP8 J;  1Y8O B;  2C35 B;  2MGS A;  2UUA Q;  3BYT B;  1SXT A;  2PW7 A;  1VQ9 A;  4GN3 B;  1GJX A;  2RHQ B;  3PO2 B;  1O7L A;  1KDC A;  2AWN A;  1Q46 A;  3K8A A;  1O7I A;  1GUT A;  3VYU A;  4HIK A;  3CC2 A;  4NXM Q;  1HNW L;  2K04 A;  1WCM B;  2KBN A;  1H9K A;  4X65 L;  2JEB I;  3J80 c;  2NTT A;  2M9V A;  1BUV T;  1OXX K;  4PMW A;  2A8V A;  2V4D A;  2ATW A;  2R93 B;  3SR1 A;  1DOL A;  5E7N A;  4XT1 B;  2SOB A;  2Q8R E;  2F3V A;  5EPK A;  2ZXR A;  4H02 A;  2UU9 L;  1VQ4 A;  3J7A F;  5IP7 G;  2Z6K A;  2KA7 A;  4FF1 A;  1U4L A;  4A3M B;  5CBE E;  4LF8 L;  1B2T A;  4IFD J;  3HOY G;  3M4O B;  4A3C H;  1SJH D;  3QO2 A;  2ID0 A;  1PH7 A;  3MXP A;  2EYH A;  1A2U A;  2HUG A;  2ES2 A;  1RTN A;  1B44 D;  3K7U C;  3E9H A;  3A55 A;  5C4X G;  1N32 L;  4ME5 A;  1JIC A;  1D1I A;  2CKZ B;  4LF9 Q;  1KQS A;  3CD6 A;  1SYG A;  3T51 B;  5EKI A;  4MHE A;  1XMO Q;  2F4V L;  4YHH L;  2I0Q A;  3QIA A;  4KY7 A;  2KHI A;  1NMG A;  4YCU A;  1BR9 A;  4X66 Q;  5JPM C;  3M7N A;  2PW5 A;  4WJ4 A;  2BDO A;  4HCE A;  2QKI C;  4JI2 L;  3N6R A;  1SSO A;  3EVQ A;  2X6G A;  1HUM A;  2B29 A;  2NYZ D;  1SFO B;  1I50 H;  4GKK Q;  4LNQ A;  4YCW A;  1KDB A;  2RBM A;  2UUC L;  2RVL A;  3L7Z C;  5GQO A;  2HHH Q;  4EQN A;  2CFM A;  2I5M X;  5HGQ A;  5CV6 A;  5ELC A;  3R2I A;  1E3P A;  4GKJ L;  5C3E G;  1WCM H;  4R8N A;  1JMC A;  3IL8 A;  3ERS X;  3MEH A;  4BBS H;  3LX0 A;  1Z9F A;  1QVC A;  3HOW H;  3QWN A;  3UDF A;  4Q0F A;  1MGS A;  1CK1 A;  3ND9 A;  4L5S A;  4BY1 B;  5CC4 A;  1UEB A;  2F0P A;  4P2C B;  2VZA A;  4FVM A;  2EQS A;  3BG3 A;  2K50 A;  1QIL A;  4WJW A;  1UUP A;  1YVC A;  2ZM6 Q;  2F3W A;  2NTS A;  2XWJ B;  1PRT F;  2E5L Q;  1ET6 A;  4JVZ A;  5IP9 G;  2NN6 I;  4A3L G;  1C7Y A;  4UP9 A;  2CCZ A;  1HHV A;  4ODG A;  3FEW X;  4JPB W;  2JA7 B;  1VQJ A;  5IT9 L;  2N88 A;  4DAV A;  4BA1 I;  5I4D A;  4QUC A;  2K4K A;  2D5D A;  1FNU A;  3CC4 A;  3AB9 A;  1VQ6 A;  1FNV A;  4MIU A;  4MNO A;  2JA5 B;  3I4O A;  3A5Z B;  4TSS A;  1XMQ L;  4GN5 A;  1QE6 A;  2XGT A;  1EYA A;  5C4J B;  2OCE A;  3MXN B;  1XYI A;  1VF7 A;  4L5R C;  2F0N A;  5C3X A;  5L37 A;  1XNQ L;  3A5U A;  3J81 E;  2K75 A;  4A3G H;  3PSI A;  3H09 A;  4R1J A;  1E2W A;  5I2X A;  1B9N A;  2RDF A;  3GTG B;  4CHT B;  2A6H D;  1STA A;  5LL6 X;  3TZD A;  4DU9 A;  1TVX A;  5KGU A;  1Q7Y C;  1AFP A;  1JT8 A;  4U67 3;  4DR2 Q;  1EIG A;  3K5N A;  1PMR A;  2EPB A;  4KKS A;  3T1Y Q;  1CA5 A;  2EIF A;  1SNQ A;  1W3S A;  3MFY A;  1PRT C;  2WAQ E;  3QB3 A;  1BF4 A;  1EIY B;  3HOZ G;  3FP9 A;  1BNZ A;  3JC6 6;  1DOM A;  1MIU A;  4FNF A;  5M9O A;  3PV0 A;  1KAA A;  2E8G A;  3CCQ A;  1K28 A;  5IE8 A;  4B3M L;  3S15 H;  1LTA D;  4K0K L;  4C56 C;  3NUC A;  2Q2T A;  4YIJ A;  2K03 A;  1XNR Q;  1EZ6 A;  4JYA L;  3BVM A;  4X3S A;  3I4M G;  3BVG A;  4YCV A;  1NR4 A;  4LFB Q;  2AQ3 B;  1PVO A;  2Z9H A;  3GTM B;  3PO3 G;  4WFN 3;  1A3U A;  3Q23 A;  4DR6 L;  3HZX A;  3HOX G;  3HGB A;  1QG7 A;  4N8X 1;  2A6H C;  1K0R A;  3GTP B;  3SK6 A;  4A3J H;  4DAM A;  1GUO A;  2JP1 A;  1EY7 A;  2F0U A;  2DNC A;  2JA5 H;  1IBL Q;  2YV5 A;  1Y69 U;  4ID6 A;  1SE8 A;  4KHZ A;  4NP5 A;  3OWE B;  1L1O C;  3ULP A;  3GTL B;  4N9P A;  1XTC D;  5IT9 c;  2VXW A;  3W5O A;  4BBR B;  1K3R A;  1Z6H A;  3CU7 A;  4G7O C;  2ZXO A;  2PQE A;  1EQR A;  3NEM A;  1KLU D;  1EZ8 A;  3S1N B;  2EY1 A;  5GAE C;  1X65 A;  1PTO B;  1L2F A;  4PZ8 A;  1TS3 A;  4JI4 L;  1X55 A;  4HJ9 A;  2PNR C;  2LKV A;  4H7B A;  1L0X B;  3MEF A;  1VQC A;  1EY8 A;  4F87 A;  1STG A;  3K6O A;  5DM6 3;  1A15 A;  3CMA A;  3TZU A;  1QZH A;  1AZP A;  1YNN D;  4JBK A;  4RCO A;  3HOY H;  1Y1V G;  5IWA Q;  2NWG A;  4QIW E;  4ZQ3 A;  4L8J A;  3TRZ A;  1V1Q A;  3H0G G;  1S5F D;  3S17 H;  2NVT B;  1CFM A;  5C4X H;  4XYO A;  2R7Z H;  4DFA A;  1EQQ A;  3TBI B;  1D7Q A;  3EFX D;  4XQN A;  4DV4 Q;  4X62 L;  1WD0 A;  4JI7 L;  1E1O A;  1PZJ D;  2R6G A;  3M9B A;  4KD4 A;  3GO5 A;  3VR6 A;  4JG2 A;  5A35 A;  1CQF A;  1GOZ A;  2K5V A;  5EBD A;  4X3T A;  1K73 C;  4YY3 Q;  4QIW B;  2GN5 A;  4DV3 L;  2PMZ E;  4ZYS A;  5M3M G;  1IXR A;  1I3Q B;  3CRK C;  4ZKB B;  1SN8 A;  3OPO A;  4QY7 A;  4AQY Q;  3BZK A;  2IWH A;  4RA8 A;  3J7Z C;  1PH6 A;  3RZD H;  1I6H H;  2E2J B;  4EGV A;  5KND A;  4JI3 L;  2K1B A;  4LF7 Q;  2L4N A;  3STB D;  4IJL A;  4PNY A;  1YNX A;  1SAP A;  1YNN C;  2AQ2 B;  4KJN A;  2RF4 A;  4OWW B;  2ZJQ A;  2F0O A;  3K81 C;  4K2K A;  4X64 L;  1B1Z A;  1E22 A;  1LT6 D;  1HFN A;  3CME A;  2L12 A;  3VR4 A;  2N78 A;  3M4Y A;  1DON A;  3IFD A;  2LXK A;  4C3J B;  4CJ0 B;  1CUK A;  3QOJ A;  1A63 A;  3K59 A;  2B63 G;  5DEH A;  4K5V A;  5FLX L;  1HNW Q;  3NQT A;  1A0I A;  4X65 Q;  4R4C A;  4A3I B;  1K0S A;  3BDC A;  3S16 B;  2QEJ C;  4LMQ D;  5K36 G;  2B3G A;  1LT5 D;  5IP9 H;  4HMJ A;  3J7Y W;  2A1A A;  5CBA E;  1EY9 A;  1LAB A;  4LUO A;  1BCP F;  1UWV A;  2Q8I B;  4PMB A;  4PZ6 A;  2EDG A;  2ENB A;  3JAM i;  2UU9 Q;  2HDM A;  4L5T A;  2LXJ A;  2P5Z X;  1VQ7 A;  4RGO S;  1UE5 A;  1ZKO A;  4A93 B;  4LF8 Q;  4FO2 A;  4IPH A;  5T1I A;  3PUZ A;  1GD7 A;  1RJT A;  2JA6 G;  4DKA C;  5BN5 A;  4JI8 L;  3PGZ A;  2VQE L;  2HCC A;  1JE5 A;  4IUR A;  4RGT A;  2EYO A;  1LM0 A;  4ZCK A;  2OQ0 A;  3UDX A;  2KEC A;  2DJG C;  3Q8D A;  1N32 Q;  1Y1W B;  2VB2 X;  3AYH B;  1KD1 C;  2K5H A;  4J6H A;  4GOP B;  2F4V Q;  4YHH Q;  4B3S L;  1BBU A;  4FXD A;  5EQ0 A;  3IAY A;  1UE1 A;  4A3F H;  3MAQ A;  4LK1 C;  2JA8 G;  4B3T L;  3MC0 B;  4TRD A;  4K5W A;  2B2W A;  4LUZ A;  1Q90 A;  4RHS A;  1U5K A;  4JI2 Q;  2KCT A;  4R8I A;  1TWG H;  1I6V C;  3HOZ H;  3NHH A;  3CPW A;  1BCP C;  1JJG A;  3D6W A;  4A3D G;  3ITP A;  5C0X G;  4HJ5 A;  2UUC Q;  1J6Q A;  2RDH A;  1TXY A;  3I56 A;  4MZ9 A;  1FJG L;  5C4Z A;  3IRB A;  1RTO A;  3A54 A;  1PYS B;  4RFB A;  1YJ9 A;  2G9D A;  1NMF A;  1TR5 A;  4GKJ Q;  1QJO A;  2A74 C;  4POF A;  4OIJ A;  4KMU C;  1LT4 D;  5JEA J;  2Y0S B;  4IUV A;  4QL5 A;  1IW7 D;  2WKC A;  2VUM B;  1B3A A;  2A68 D;  2F0J A;  4ALP A;  3PO3 H;  4QF4 A;  2EYF A;  2ICI A;  3ER0 A;  3GTJ H;  4Y7N H;  3HOX H;  5M5X B;  1QNU A;  3OIP A;  3C2P A;  5FLX c;  3PCO B;  1XPO A;  3RLN A;  3ZYY X;  1TWC H;  4IJH A;  2MHV A;  2PZU A;  4DGZ A;  4BXX G;  4O42 A;  1LV9 A;  5IT9 E;  2WFW A;  2JSO A;  1MKH A;  4DV7 L;  5J22 A;  1AZQ A;  4DF7 A;  4CKC A;  1VQG A;  1ENA A;  1TWA H;  1WTW A;  3NBI A;  5IY0 A;  4IFD G;  3HOV B;  1W6J A;  3D0F A;  4C3I B;  1EFW A;  1BQQ T;  1B50 A;  3EIV A;  1IBM L;  2EJM A;  1XMQ Q;  4AYB E;  2HQE A;  4A3K B;  4ZAI A;  4FXG C;  3PUV A;  2CW0 C;  3WWV A;  1XNQ Q;  2B2U A;  1ZXT A;  5CV8 A;  2JK8 A;  1TS4 A;  4LUV A;  2Z0S A;  3NEN A;  3KF8 B;  1WFQ A;  2A68 C;  5IOD A;  4OO1 G;  1LTL A;  4HR7 B;  3N52 A;  1F77 A;  1X56 A;  2AWO A;  3OYY A;  4QJF A;  3FDT A;  1RL2 A;  4JI0 L;  1K8O A;  1O7Z A;  3RNU A;  2JEA I;  5IYB G;  1YJW A;  3PF5 A;  4A3M G;  1MHW C;  1S40 A;  4EQP A;  2B2T C;  1AN8 A;  2WB1 B;  3K7A H;  4M1U B;  1E1T A;  3T13 A;  3H0G H;  3A56 A;  3NE5 B;  2J7Z A;  2ZTE A;  1DZ1 A;  4DK0 A;  3M85 A;  1JB3 A;  4A76 A;  4B3M Q;  1SE3 A;  2VUM H;  4K0K Q;  5FO7 B;  1PLF A;  3RN2 A;  1IHZ A;  4X3U A;  4JYA Q;  4A3B H;  1U4R A;  2PZW A;  3MWY W;  3DHQ A;  2HCI A;  3OMG A;  4DK3 C;  5M3M H;  2Q2U A;  3OWF A;  1GO3 E;  2TMP A;  4NDX A;  1SNO A;  4DR6 Q;  5AJ3 L;  3S1Q H;  1PFM A;  3W1B A;  1RKN A;  3CCJ A;  1PFS A;  1VQL A;  4DV0 L;  1X3F A;  2K5Q A;  4C3I H;  1NBW A;  4DV5 L;  2MFI A;  4NKL A;  4KTA A;  4CDD C;  3T16 A;  4DUZ L;  1HTP A;  4GNX C;  4ZRZ A;  1SMX A;  2F0I A;  4U68 A;  5GRO A;  1F2M A;  1NY4 A;  5CMD A;  5A2Q E;  3VYS A;  4LWC A;  1SYD A;  1LYL A;  1MJC A;  3S14 B;  3SXH A;  5M3F G;  2VL6 A;  5LMN W;  2UUB L;  3G6E A;  3FHW A;  4C1N I;  4DAP A;  5COY A;  2EVB A;  2O4X A;  3KF8 A;  1IL2 A;  3WOE A;  3H6M A;  5IGD A;  5K36 H;  4JI4 Q;  1I50 B;  1FNW A;  3MTS A;  4ZKC B;  1LO5 D;  2D0O A;  4QQB X;  1PYW D;  1Y8P B;  1BDO A;  2XSC A;  2DJF C;  1KLG D;  2NN6 H;  5CV7 A;  3CQZ H;  4XYQ A;  2JA7 G;  1PXU A;  2IY5 B;  2K33 A;  1F9Q A;  2JJQ A;  3G4S A;  5IGF A;  3P20 A;  4LW1 A;  3I4N H;  1VQN A;  3E0E A;  1R4Q B;  5C4H A;  4BBS B;  2EY6 A;  2JA6 H;  3NQI A;  2OEO A;  3HOW B;  4XIG S;  1DCZ A;  1CSQ A;  2KHJ A;  1JQY D;  1S72 A;  1HPC A;  2QF7 A;  3I7F A;  2RDG A;  4KHP L;  3T1H L;  4X62 Q;  5AFW A;  1KHI A;  3VR3 A;  3FMC A;  4JI7 Q;  2R7F A;  4KJO A;  5ISR A;  1H9R A;  2I07 B;  2L55 A;  3ULJ A;  1I4Q A;  4DV3 Q;  3HKZ E;  4DXG A;  2KCM A;  1S5B D;  1X32 A;  4RKB A;  3BU2 A;  2CWP A;  1DYQ A;  3NTH A;  3TME A;  1A3V A;  1TU2 B;  1NJI C;  2SEB D;  1GHK A;  1BOS A;  4A3D H;  1EL0 A;  5C0X H;  2VQF L;  2LY7 A;  2OXP A;  3FRP B;  3SK8 A;  4JI3 Q;  1ONL A;  1Z7T A;  2HT1 A;  5EKL A;  4FDB A;  1LTT D;  2PYK A;  1E7Z A;  3HKZ B;  4CGY B;  3S14 H;  3KK7 A;  5E1F A;  4P72 A;  1ILQ A;  1SRO A;  2H5X A;  3RZO H;  1D6E C;  4X64 Q;  3K5L A;  1ZYR D;  3J80 i;  4CJ2 C;  4A3G B;  2XRQ D;  4KKT A;  4NW2 A;  5FLX E;  2WAQ G;  3VDY A;  1K3B C;  3H15 A;  3K0X A;  3TSS A;  4PV1 C;  1QWY A;  3BZD B;  5C5L A;  2F0V A;  4AIM A;  3KJO A;  5C44 G;  4IOA A;  3ND8 A;  3CCE A;  1M4V A;  3HFZ B;  1B8A A;  1SDF A;  1YEZ A;  1JOO A;  5I6Y A;  3T53 B;  3DUZ A;  1PRT B;  1ESR A;  2SNM A;  1A6X A;  2J4X A;  2IW3 A;  3OMC A;  2NZO A;  5CR3 A;  3PIP A;  5KYL A;  2RA4 A;  1JOQ A;  1YJN A;  1IKL A;  3SGI A;  1BBX C;  3S15 B;  1RHP A;  2BE5 D;  1GUS A;  4J15 A;  4RH6 A;  5EKK A;  4IFD H;  4UY8 C;  2N49 A;  2ZXP A;  5CYU A;  4DV1 L;  1T5X D;  3W2D A;  4P71 A;  4BBR G;  4L5Q A;  4CJ1 B;  1N33 L;  4JI8 Q;  1PH4 A;  5CV9 A;  1XTD A;  3BYY B;  2VQE Q;  4C3H G;  4IOC A;  1ZYR C;  1ASZ A;  3A8I E;  4B3R L;  1V9P A;  4EQ5 A;  2ZTD A;  5IGC A;  1PH1 A;  2I46 A;  4OO1 H;  1EEI D;  1OXV A;  2D0P A;  4K8J A;  3U9S A;  4A3J B;  3KUP A;  1X3Q A;  3SVM A;  1CT1 D;  3RLO A;  4B3S Q;  2R92 G;  1X6O A;  5J3B A;  4BA2 I;  3UE1 A;  2FHT A;  3P75 A;  4H0L C;  4MTK A;  4B3T Q;  1KAW A;  3OSO A;  2DUD A;  5I9P A;  3DLL A;  1LTG D;  1VCI A;  2RKS A;  5DNF A;  2L1B A;  3EJI A;  1J8I A;  2HQL A;  1LTI D;  1H9J A;  1GKH A;  1B4O A;  1UEA B;  1JC7 A;  2Q2I A;  4YWL A;  2ZJP A;  5KIX A;  2NVY H;  2PCF B;  1SEB D;  4ABN A;  1WOC A;  1FJG Q;  2F0L A;  2K32 A;  2K5D A;  1RCV D;  3R2T A;  2E76 C;  1HR0 W;  4A3E H;  1SR3 A;  1TT2 A;  2F0H A;  3QR8 A;  2EYP A;  5C0X I;  1HJP A;  2EYM A;  3I2Z A;  1B53 A;  4LF5 L;  1FD7 D;  1SNM A;  2KUM A;  2MO0 A;  2OF1 A;  3DM3 A;  3HOY B;  4DR5 L;  4CKE A;  4DV2 L;  5FJ8 G;  1CZW A;  3DM1 A;  2QW7 A;  3S17 B;  2MQH A;  4B08 A;  4DV7 Q;  1HUN A;  2B8F A;  2F0S A;  5C4X B;  4DN4 M;  2R7Z B;  1HNZ L;  1KRT A;  1CKM A;  5IGG A;  3V05 A;  4HIM A;  1A8V A;  4H44 C;  1JWM D;  1X3G A;  3VR5 A;  3SE0 A;  1IBM Q;  2RCF A;  4I7A A;  4C1N K;  2E2I H;  2JYO A;  5M3F H;  3VA5 A;  1BBW A;  2OTL A;  3GTQ B;  2YTY A;  2BH8 A;  3LWU A;  3S2D H;  3JAM L;  1Q82 C;  4TVA B;  2MO1 A;  3RZD B;  3URY A;  4IFD I;  2CQO A;  3I4L A;  1I6H B;  1IKM A;  3FKI G;  3M4P A;  4IN3 A;  1KTK A;  3MA2 B;  3J80 E;  3H91 A;  5EBC A;  5I9O A;  4JI0 Q;  4FF4 A;  1DJR D;  2PZT A;  3NXW A;  2B2Y C;  3GTO H;  2RQX A;  1G91 A;  4XXE A;  1L1O A;  2L11 A;  4OO1 I;  4DNT B;  3TP8 A;  4DNI A;  1SNC A;  4RG1 A;  3GV3 A;  1TWF B;  1RIP A;  2WKD A;  1Y1W G;  1EIF A;  1GUW A;  2GVB A;  1NR2 A;  2QA4 A;  5IP7 H;  3L0O A;  2RSN A;  3H3V C;  4HID A;  5JEA G;  3A7A B;  5K5P A;  3E5S A;  3IFT A;  3OIQ A;  3KF6 B;  1QZG A;  1D1K A;  3C3L A;  2L15 A;  1HTL D;  3MXU A;  5ELD A;  1HR0 L;  4UPA A;  4GLV B;  2WV6 D;  3GQB A;  1X3E A;  1W6K A;  5AJ3 Q;  5GAG C;  1PV4 A;  2Q2H A;  3PMF A;  2O5J C;  3OOC A;  5JOB A;  4Y52 H;  4JV5 L;  4DV0 Q;  4BY7 G;  5TSS A;  3RN5 A;  3NBH A;  1PTO D;  2B39 A;  3K0Y A;  1Y14 B;  4DV5 Q;  5M5W H;  2Z4H A;  4DUZ Q;  4XT3 B;  2JXM B;  3QG1 A;  3GTQ H;  4N9T A;  1H9S A;  3AFP A;  1OTC A;  4I65 A;  3I3C A;  3NSW A;  5ELF A;  3TDQ A;  1WTH A;  2H4O A;  4HSV A;  3U4Z A;  4AH6 A;  4A3F B;  3UDI A;  5G3L D;  1L0W A;  5C44 H;  3LWE A;  2UUB Q;  3PUW A;  4FF2 A;  4P75 A;  3D4W A;  4G7Z C;  1WD1 A;  3KBG A;  4IPC A;  1TWG B;  3HOZ B;  1PZI D;  3I90 A;  2A69 D;  2UXB L;  2AUJ D;  4A4I A;  2CH4 W;  5C3E H;  4L6T B;  4GLA C;  2O2L D;  1BCP B;  2M00 A;  3UE0 A;  3HOU G;  3TS2 A;  3OTO L;  4M8A A;  1LTR D;  2M2L A;  2IPK D;  3PF4 A;  2QGQ A;  5LL6 S;  1ESF A;  1E2V A;  1LLR D;  1TWF H;  1PTO C;  1UE7 A;  2F52 A;  5IYD G;  4PMC A;  4O2D A;  4C3H H;  1PA6 A;  4A3K G;  3PO3 B;  4A3L H;  3PIP 3;  1STN A;  3GTJ B;  4Y7N B;  2VB3 X;  2EJF C;  3HS0 C;  3HOX B;  1F2Y A;  4KHP Q;  2K5N A;  3T1H Q;  3TRE A;  3X3M A;  3HEJ A;  3NTI A;  1X9N A;  1TWC B;  5JJL A;  1G8Z D;  1K8M A;  5C6A A;  4RMF A;  4BS9 A;  1VDZ A;  5JVG 3;  3KF6 A;  4JC0 A;  2R92 H;  4R4Q A;  3STB C;  2EJG C;  1S5C D;  4KK7 A;  2A73 B;  3I70 A;  4AYB G;  1O7Y A;  1GUN A;  2A69 C;  1TWA B;  4IUP A;  4DA2 A;  1FVI A;  2QIL A;  1SYB A;  2D2C C;  4KY5 A;  4HN7 A;  2EE1 A;  5D65 A;  1JWU D;  3MFG A;  2B2V A;  3FPP A;  1VF5 C;  4LFA L;  1SYE A;  2VQF Q;  3A8J E;  1JCK B;  2RSO A;  4KKU A;  1NE3 A;  4J1M A;  3S24 A;  3H3V I;  4QUF A;  1Q86 C;  1OO9 B;  1IBK L;  3VR2 A;  1NSN S;  1VMC A;  1T9H A;  3PIO A;  1K8A C;  1WI5 A;  4B9W A;  2F0M A;  5JAV A;  2AMC B;  5LMU L;  1SMY D;  4F8M A;  2Y0S E;  3E9I A;  3T4A C;  3S1R B;  3NK9 A;  1YHQ A;  4XDX A;  1VQE A;  3M3Y H;  1II3 A;  2F0W A;  4ILW A;  3K7A B;  4A3C G;  1KDA A;  5E4W C;  2KJX A;  3H0G B;  5FJ8 H;  3KYH C;  4DK6 C;  3LGJ A;  3WDN A;  3R8B A;  3C1E A;  3C46 A;  2L0C A;  3I4M H;  1IYU A;  3FPU B;  4POG A;  3SHL A;  2FXQ A;  3ULL A;  3V2T A;  2XTI A;  3F8T A;  3CHB D;  3J81 L;  4A3B B;  1STH A;  3UI2 A;  4RWS C;  4FYD A;  3A0J A;  1N33 Q;  1HNX L;  5M3M B;  2AKW B;  5JVH 3;  1VQO A;  1V1O A;  2E2D C;  2EYL A;  3GTK H;  3MXG A;  1JWS D;  4B3R Q;  1SMY C;  1VS0 A;  3S1Q B;  2V1C C;  1TWH B;  4NB3 A;  3FKI H;  1CKO A;  3PO2 G;  2VS1 A;  1BO0 A;  1KAB A;  4K6D A;  3SEB A;  4P73 A;  1HA5 A;  1C0A A;  3E3X A;  1QVG A;  1EIH A;  1WCM G;  1M8A A;  4BBS G;  3D8G A;  2ALY B;  1K83 H;  2WB1 E;  3HOW G;  4GNX B; 
#chains in the Genus database with same CATH homology
 1A3T A;  1EY6 A;  1IW7 C;  2B63 B;  3R93 A;  1U4P A;  1C48 A;  4OHJ A;  1MI2 A;  4GZY C;  2H1E A;  1T5E A;  3SK4 A;  4KHV A;  1EEF D;  5FOB B;  1SND A;  5JEA H;  3CQZ B;  3G6J B;  4R9W A;  1CI3 M;  3KLS A;  3I4N B;  2JA6 B;  4XTC S;  2F1M A;  3ONA B;  2B2T A;  1I4G A;  2TSS A;  1WTP A;  4L63 B;  4FXK C;  4NMZ A;  1EOT A;  1Q3L A;  5ELB A;  1CA6 A;  1KNE A;  1STE A;  4QB4 A;  2IX1 A;  2F0D A;  3F2U A;  2F0F A;  1ENF A;  1HFG A;  2DNE A;  5EJW A;  4UAI A;  5COR A;  2JA8 B;  1PZK D;  1EQV A;  4HED A;  4A3D B;  5KEE A;  1HRJ A;  1MBY A;  3L9A X;  3QOL A;  4V19 0;  1EFI D;  1NAP A;  5D3D A;  3RZO B;  1SE4 A;  1L0Y B;  3I8Z A;  4Q5V A;  2E74 C;  2Z4I A;  2L5T A;  3RD4 A;  1F9S A;  2E75 C;  5T1G A;  1WTQ A;  2K5W A;  4RGN A;  5IGB A;  1DM0 B;  4ULL A;  1UAP A;  1FYC A;  4K8I A;  2ICE C;  4IUT A;  5J39 A;  3KLS X;  2Q8T A;  2G9H D;  1WVL A;  3G7L A;  1Q12 A;  4F7X A;  1Z47 A;  3RLF A;  1LTB D;  4CBV A;  3D4R A;  2F0T A;  2FFK B;  2F0G A;  4DXF A;  3IKJ A;  2VNU D;  4C2M B;  1JOK A;  1S5E D;  4QCL A;  2N55 A;  1TS2 A;  2EZV A;  4BWG B;  1XXG A;  3MHB A;  4RKL A;  4J8Q A;  1O80 A;  2KQ3 A;  3PIO 3;  1HA6 A;  1DD2 A;  4HTH A;  5KNB A;  1NUC A;  3DXJ C;  5HUR A;  2NVY B;  1CTM A;  2K01 A;  1HQM C;  3VA7 A;  2CVR A;  3HRZ C;  5NUC A;  4MN3 A;  5EPJ A;  1EY0 A;  1VMP A;  3DWQ A;  1QB5 D;  4A3E B;  2MJ8 A;  2BDN A;  4KV6 A;  5FK9 C;  1CHP D;  5M5Y B;  3P1H A;  3GV6 A;  4LAA A;  2EXZ A;  5DAU A;  3I73 A;  5E3F A;  1C4Q A;  1U9R A;  1GXD C;  1HCZ A;  1EQT A;  3BDO A;  5FO8 B;  5IIF A;  2QCP X;  1V8Q A;  1V1P B;  2CQA A;  1LT3 D;  1O78 A;  3DWA A;  4IAL A;  1CHQ D;  5C5M A;  4B9X A;  4JBW A;  3PUX A;  1I4X A;  4RGM A;  2E2I B;  3NP8 A;  5M3F B;  3V96 A;  2A6E D;  1FR3 A;  1WTV A;  4K5X A;  3S2D B;  4JK1 C;  1TY2 A;  5FKA C;  1B9M A;  2L9H A;  3L3O C;  1PRT D;  1QNK A;  2C5C A;  2J0T D;  2K05 A;  4H13 C;  1D5M C;  1IL8 A;  1PDQ A;  5EPL A;  4IUQ A;  2BE5 C;  3GTO B;  1EWC A;  3TP7 A;  1C8C A;  2IX3 A;  2IL8 A;  1MD2 D;  5JJZ A;  2EY5 A;  1DXM A;  5KNC A;  3D31 A;  4IQZ A;  3GP7 A;  4OL7 A;  1F9R A;  3OW7 A;  2MP1 A;  4IUN A;  2XIW A;  4RAU C;  3VYR A;  2KVM A;  2PPB C;  1EU3 A;  4K6L A;  1RDP D;  1HQR D;  3DEP A;  2A6E C;  1EYD A;  2SDF A;  3MZ5 A;  4DK1 A;  4LJZ C;  2IT1 A;  4F88 A;  5J1Z A;  1WTR A;  1EU4 A;  3TP5 A;  2BOS A;  1Q8I A;  3BDL A;  1ENC A;  2MUY A;  1DOK A;  1V1P A;  3J7A V;  2XVS A;  1SE2 A;  4C3J G;  1H9S B;  1G29 1;  1G2T A;  5BN4 A;  5M5W B;  2QDB A;  2D9U A;  2WAQ B;  3A8K E;  4WRD A;  3BS1 A;  2LS0 1;  5C44 B;  1SBB B;  4ZUJ A;  2BA0 A;  2JE6 I;  3RUZ A;  4EVO A;  4V0B A;  3EQL C;  2X6L A;  2F0Q A;  1ICW A;  5C3E B;  3ERO A;  2GA4 B;  3SDZ A;  2KCN A;  4RCN A;  5ELE A;  3M7G A;  2WAC A;  2KCC A;  2B2Y A;  3ERQ A;  4IUU A;  3PUY A;  3MXN A;  3EA6 A;  4ZK9 B;  4C3H B;  5A2Q L;  1TKW B;  1STB A;  1WTO A;  5CV4 A;  1AEX A;  4O1N A;  3H94 A;  3VYT A;  4DNR B;  3CKI B;  2R92 B;  4TKO B;  1U4M A;  4CKB A;  4DAY A;  2F4I A;  1CQV A;  1ROD A;  2EOT A;  1PTO F;  1Q1E A;  1TQO A;  3NPP A;  3LNN A;  3Q0A A;  3DEO A;  4TQU S;  1UNS A;  4RHR A;  1ET9 A;  2E2H B;  4FF3 A;  3O13 A;  5IGE A;  1QOH A;  2YYZ A;  1QCB D;  3X3N A;  5G3L F;  3WOF A;  3Q22 A;  1F2L A;  1FGB D;  1TII D;  3E0J A;  4OIK A;  3TN2 A;  1TY0 A;  1PFB A;  2FMC A;  1A2T A;  3D6C A;  3M3Y B;  5D3I B;  2PO4 A;  1E2Z A;  1F9P A;  3I91 A;  1NCV A;  1ZEQ X;  4HMI A;  4XQJ A;  4K2L A;  4PQX A;  2F0E A;  1D2B A;  3MVV A;  1LTS D;  4C3I G;  2PMZ B;  3I4M B;  2C9O A;  2R61 A;  5D14 A;  2ZT9 C;  4G7H C;  1J9O A;  3C1F A;  1D5Z C;  3S9W A;  1PTO H;  1KNA A;  2NBF A;  1EY5 A;  1Y8N B;  1I4R A;  1ILP A;  2HDL A;  5DM7 3;  4G4K A;  1TS5 A;  1SNP A;  3GTK B;  3K5O A;  5CV5 A;  3AMU A;  1WTX A;  3FKI B;  2DY7 A;  2NZ1 D;  1S4Z A;  1BCP D;  1EY4 A;  2NN6 G;  2CHB D;  4FP5 D;  2DN8 A;  1PFN A;  2B2V C;  5E4X A;  4ZUI A;  1R4P B;  1K83 B;  4KY6 A;  1HXY D;  3DWP A;  2NB0 A;  5KRU A;  1F2Z A;  5I6W A;  1SYF A;  1JE4 A;  1OXS C;  1YNJ D;  4S3S A;  1SJE D;  2B2W C;  2K7V A;  3R3O A;  3Q6S A;  2YU9 B;  3P7J A;  2X69 A;  3Q24 A;  1RD9 D;  2NVQ B;  2O5I C;  1Y1V B;  2BA1 A;  3KLR A;  1R9T B;  1OXU A;  2IJ0 A;  3D4D A;  5CGK A;  4K14 A;  3QJY A;  1GHJ A;  2XNA C;  1LAC A;  1EWH A;  3NTK A;  4EQO A;  5BN3 A;  4BY7 B;  2Z8L A;  2XRS D;  3NWT A;  2AUK A;  2Z1C A;  3S2H B;  1S5D D;  1I4H A;  4G57 A;  2CW0 D;  2B8G A;  4X3K A;  1YNJ C;  4KI0 A;  4XQQ A;  2F03 A;  3KBX A;  1ML0 D;  3SK5 A;  1CM9 A;  2AQ1 B;  4HAE A;  4I7Z C;  2R3Z A;  1BXT A;  2IX0 A;  2F0K A;  4QMG A;  2NUC A;  5KYI A;  3E6Z X;  3K58 A;  4HCS A;  3HOU B;  3RMH A;  2KHS A;  1MSH A;  1X3P A;  2B2U C;  3HP3 A;  3DMU A;  2BCO A;  3S1M B;  5C3W A;  3W3A A;  1AW7 A;  2WII B;  3TP6 A;  2A5H A;  1Q1B A;  2DY8 A;  1RF2 D;  2MPM A;  2XN9 C;  4E6I A;  3K5M A;  5JPN C;  4IZ8 A;  1D5X C;  4UDU C;  2LFN A;  2FJ2 A;  5FO9 B;  3FVQ A;  2K6A A;  1JR0 D;  4AYB B;  3J80 L;  3HG9 A;  2XWB B;  3AU7 A;  2FIN B;  2D62 A;  2FMM A;  2KOL A;  1IYV A;  1H9M A;  1XX8 A;  5F2D A;  2EY2 A;  2KED A;  4KN4 C;  1G6Z A;  1STY A;  3CRL C;  1V43 A;  1E0B A;  3U9O A;  4WOR A;  3OHX C;  3JAM E;  2K28 A;  1XWE A;  1OXT A;  4KN7 C;  3I72 A;  2SNS A;  5LHY 1;  3NWS A;  5EGT A;  1MSG A;  4HSP A;  3K57 A;  1G2S A;  1CZG A;  4ZLT F;  1JOR A;  2OT2 A;  2LMC B;  5I2Y A;  2KEE A;  3D3R A;  2EYJ A;  1GUG A;  4KD3 A;  2WIN B;  3GD7 A;  1EYC A;  5HGT A;  1SYC A;  3A7L A;  2NVX B;  1I4P A;  3BVZ A;  4OGQ C;  4Z9C B;  5IOC A;  5C0X J;  1AP0 A;  3T56 B;  2WP8 J;  1Y8O B;  2MGS A;  3BYT B;  1SXT A;  2PW7 A;  1GJX A;  3PO2 B;  1O7L A;  1KDC A;  2AWN A;  1GUT A;  3VYU A;  2K04 A;  1WCM B;  1H9K A;  2JEB I;  2NTT A;  2M9V A;  1OXX K;  1BUV T;  4PMW A;  2V4D A;  2R93 B;  3SR1 A;  1DOL A;  4XT1 B;  2SOB A;  2Q8R E;  2F3V A;  5EPK A;  2ZXR A;  3J7A F;  2KA7 A;  4FF1 A;  1U4L A;  4A3M B;  5CBE E;  1B2T A;  4IFD J;  3M4O B;  1SJH D;  3QO2 A;  2ID0 A;  3MXP A;  2EYH A;  1A2U A;  2HUG A;  1RTN A;  1B44 D;  3A55 A;  4ME5 A;  1JIC A;  1D1I A;  1SYG A;  3T51 B;  5EKI A;  4MHE A;  3QIA A;  4KY7 A;  1BR9 A;  5JPM C;  3M7N A;  2PW5 A;  2BDO A;  4HCE A;  2QKI C;  3N6R A;  1SSO A;  3EVQ A;  2X6G A;  1HUM A;  2NYZ D;  1SFO B;  1KDB A;  2RBM A;  2RVL A;  3L7Z C;  4EQN A;  5CV6 A;  5ELC A;  3R2I A;  4R8N A;  3IL8 A;  3MEH A;  3LX0 A;  3QWN A;  4Q0F A;  1MGS A;  1CK1 A;  3ND9 A;  4BY1 B;  5CC4 A;  2F0P A;  4P2C B;  4FVM A;  3BG3 A;  1QIL A;  4WJW A;  1UUP A;  2F3W A;  2NTS A;  2XWJ B;  1PRT F;  1ET6 A;  2NN6 I;  1HHV A;  4ODG A;  3FEW X;  2JA7 B;  5IT9 L;  2N88 A;  4DAV A;  4BA1 I;  5I4D A;  4QUC A;  2D5D A;  1FNU A;  3AB9 A;  1FNV A;  4MIU A;  2JA5 B;  4TSS A;  1QE6 A;  1EYA A;  5C4J B;  1XYI A;  1VF7 A;  2F0N A;  5C3X A;  3J81 E;  3H09 A;  5I2X A;  1E2W A;  1B9N A;  2RDF A;  3GTG B;  4CHT B;  2A6H D;  1STA A;  5LL6 X;  3TZD A;  4DU9 A;  1TVX A;  5KGU A;  1AFP A;  4U67 3;  1EIG A;  3K5N A;  1PMR A;  2EPB A;  4KKS A;  1CA5 A;  1SNQ A;  1PRT C;  3MFY A;  3QB3 A;  1BF4 A;  1BNZ A;  1DOM A;  4FNF A;  5M9O A;  3PV0 A;  1KAA A;  1LTA D;  4C56 C;  3NUC A;  4YIJ A;  2K03 A;  1EZ6 A;  3BVM A;  4X3S A;  3BVG A;  1NR4 A;  2AQ3 B;  3GTM B;  4WFN 3;  1A3U A;  3Q23 A;  3HZX A;  3HGB A;  1QG7 A;  2A6H C;  3GTP B;  3SK6 A;  1GUO A;  2JP1 A;  1EY7 A;  2F0U A;  2DNC A;  1Y69 U;  4ID6 A;  4KHZ A;  4NP5 A;  3OWE B;  3GTL B;  4N9P A;  1XTC D;  2VXW A;  4BBR B;  1Z6H A;  3CU7 A;  4G7O C;  2ZXO A;  2PQE A;  1KLU D;  1EZ8 A;  3S1N B;  2EY1 A;  1PTO B;  1TS3 A;  2PNR C;  2LKV A;  4H7B A;  1L0X B;  1EY8 A;  4F87 A;  1STG A;  3K6O A;  5DM6 3;  1A15 A;  3TZU A;  1AZP A;  1YNN D;  4RCO A;  2NWG A;  4ZQ3 A;  4L8J A;  1S5F D;  2NVT B;  1CFM A;  4XYO A;  4DFA A;  3TBI B;  3EFX D;  4XQN A;  1WD0 A;  1PZJ D;  2R6G A;  4KD4 A;  3GO5 A;  3VR6 A;  5A35 A;  1CQF A;  1GOZ A;  5EBD A;  4X3T A;  4QIW B;  4ZYS A;  1I3Q B;  3CRK C;  4ZKB B;  3OPO A;  2IWH A;  4RA8 A;  2E2J B;  4EGV A;  5KND A;  2K1B A;  2L4N A;  4PNY A;  1SAP A;  1YNN C;  2AQ2 B;  4KJN A;  2F0O A;  4K2K A;  1B1Z A;  1LT6 D;  1HFN A;  2L12 A;  3VR4 A;  3M4Y A;  1DON A;  3IFD A;  4C3J B;  4CJ0 B;  3QOJ A;  3K59 A;  5DEH A;  4K5V A;  5FLX L;  3NQT A;  4A3I B;  3BDC A;  3S16 B;  2QEJ C;  4LMQ D;  5K36 G;  1LT5 D;  4HMJ A;  3J7Y W;  5CBA E;  1EY9 A;  1LAB A;  1BCP F;  2Q8I B;  4PMB A;  2EDG A;  2ENB A;  2HDM A;  4RGO S;  1ZKO A;  4A93 B;  4FO2 A;  5T1I A;  3PUZ A;  1RJT A;  5BN5 A;  2HCC A;  4IUR A;  4RGT A;  2EYO A;  2KEC A;  1Y1W B;  2VB2 X;  4J6H A;  4FXD A;  5EQ0 A;  3IAY A;  3MAQ A;  4LK1 C;  3MC0 B;  4TRD A;  4K5W A;  2B2W A;  4RHS A;  1Q90 A;  4R8I A;  1I6V C;  3NHH A;  1BCP C;  3D6W A;  3ITP A;  5C0X G;  2RDH A;  5C4Z A;  1RTO A;  3A54 A;  4RFB A;  2G9D A;  1TR5 A;  1QJO A;  2A74 C;  4OIJ A;  4KMU C;  1LT4 D;  5JEA J;  2Y0S B;  4IUV A;  1IW7 D;  2WKC A;  2VUM B;  1B3A A;  2A68 D;  2F0J A;  4QF4 A;  2EYF A;  2ICI A;  5M5X B;  1QNU A;  3OIP A;  3C2P A;  3ZYY X;  2MHV A;  2PZU A;  4DGZ A;  4O42 A;  1LV9 A;  5IT9 E;  2JSO A;  1AZQ A;  5J22 A;  4DF7 A;  4CKC A;  1ENA A;  1WTW A;  3NBI A;  4IFD G;  3HOV B;  1W6J A;  4C3I B;  1B50 A;  1BQQ T;  2EJM A;  2HQE A;  4A3K B;  4ZAI A;  4FXG C;  3PUV A;  2CW0 C;  2B2U A;  1ZXT A;  5CV8 A;  1TS4 A;  2A68 C;  5IOD A;  4OO1 G;  4HR7 B;  3N52 A;  1F77 A;  2AWO A;  3FDT A;  1K8O A;  1O7Z A;  2JEA I;  4EQP A;  2B2T C;  1AN8 A;  2WB1 B;  4M1U B;  3T13 A;  3A56 A;  3NE5 B;  2J7Z A;  1DZ1 A;  4DK0 A;  3M85 A;  1JB3 A;  1SE3 A;  5FO7 B;  1PLF A;  1IHZ A;  4X3U A;  1U4R A;  2PZW A;  3MWY W;  3DHQ A;  2HCI A;  3OMG A;  3OWF A;  2TMP A;  4NDX A;  1SNO A;  1PFM A;  1RKN A;  2K5Q A;  4NKL A;  4KTA A;  3T16 A;  1HTP A;  4ZRZ A;  2F0I A;  4U68 A;  1F2M A;  5CMD A;  5A2Q E;  3VYS A;  1SYD A;  3S14 B;  3SXH A;  4C1N I;  4DAP A;  5COY A;  2EVB A;  2O4X A;  3KF8 A;  3WOE A;  3H6M A;  5IGD A;  5K36 H;  1I50 B;  1FNW A;  3MTS A;  4ZKC B;  1LO5 D;  1PYW D;  1Y8P B;  1BDO A;  2XSC A;  1KLG D;  2NN6 H;  5CV7 A;  4XYQ A;  1PXU A;  2K33 A;  1F9Q A;  5IGF A;  3P20 A;  1R4Q B;  5C4H A;  4BBS B;  2EY6 A;  3NQI A;  2OEO A;  3HOW B;  4XIG S;  1DCZ A;  1JQY D;  1HPC A;  2QF7 A;  2RDG A;  5AFW A;  3VR3 A;  3FMC A;  4KJO A;  5ISR A;  1H9R A;  2I07 B;  2L55 A;  1I4Q A;  4DXG A;  1S5B D;  1X32 A;  4RKB A;  1DYQ A;  3NTH A;  3TME A;  1A3V A;  1TU2 B;  2SEB D;  1GHK A;  1BOS A;  1EL0 A;  5C0X H;  2LY7 A;  2OXP A;  3FRP B;  3SK8 A;  1ONL A;  1Z7T A;  5EKL A;  1LTT D;  2PYK A;  3HKZ B;  4CGY B;  3KK7 A;  5E1F A;  1ILQ A;  4A3G B;  1D6E C;  3K5L A;  1ZYR D;  4CJ2 C;  2XRQ D;  4KKT A;  4NW2 A;  5FLX E;  3TSS A;  4PV1 C;  1QWY A;  3BZD B;  5C5L A;  2F0V A;  3ND8 A;  1M4V A;  1SDF A;  1JOO A;  5I6Y A;  3T53 B;  3DUZ A;  1PRT B;  1ESR A;  2SNM A;  1A6X A;  2J4X A;  2IW3 A;  3OMC A;  5CR3 A;  5KYL A;  2RA4 A;  1JOQ A;  1IKL A;  1BBX C;  3S15 B;  1RHP A;  2BE5 D;  1GUS A;  4RH6 A;  5EKK A;  4IFD H;  2ZXP A;  5CYU A;  1T5X D;  3W2D A;  4CJ1 B;  5CV9 A;  3BYY B;  4C3H G;  1ZYR C;  3A8I E;  5IGC A;  2I46 A;  4OO1 H;  1EEI D;  1OXV A;  4K8J A;  3U9S A;  4A3J B;  3KUP A;  1X3Q A;  3SVM A;  1CT1 D;  4BA2 I;  2FHT A;  3P75 A;  4H0L C;  3OSO A;  5I9P A;  1LTG D;  1VCI A;  2RKS A;  5DNF A;  2L1B A;  3EJI A;  1J8I A;  1LTI D;  1H9J A;  1B4O A;  1UEA B;  1JC7 A;  5KIX A;  2PCF B;  1SEB D;  4ABN A;  2F0L A;  2K32 A;  2K5D A;  1RCV D;  3R2T A;  2E76 C;  1TT2 A;  2F0H A;  2EYP A;  5C0X I;  2EYM A;  1B53 A;  1FD7 D;  1SNM A;  2KUM A;  2OF1 A;  3HOY B;  4CKE A;  1CZW A;  3DM1 A;  3S17 B;  4B08 A;  1HUN A;  2B8F A;  2F0S A;  5C4X B;  4DN4 M;  2R7Z B;  5IGG A;  3V05 A;  4H44 C;  1JWM D;  3VR5 A;  3SE0 A;  4C1N K;  2JYO A;  3VA5 A;  3GTQ B;  3LWU A;  3JAM L;  4IFD I;  3RZD B;  3URY A;  3I4L A;  1I6H B;  1IKM A;  4IN3 A;  1KTK A;  3MA2 B;  3J80 E;  3H91 A;  5EBC A;  5I9O A;  4FF4 A;  1DJR D;  2PZT A;  3NXW A;  2B2Y C;  2RQX A;  1G91 A;  4XXE A;  2L11 A;  4OO1 I;  4DNT B;  3TP8 A;  1SNC A;  3GV3 A;  1TWF B;  2WKD A;  1GUW A;  1NR2 A;  2RSN A;  3H3V C;  5JEA G;  3A7A B;  5K5P A;  3E5S A;  3IFT A;  3OIQ A;  1D1K A;  3C3L A;  1HTL D;  3MXU A;  5ELD A;  2WV6 D;  3GQB A;  1W6K A;  3PMF A;  2O5J C;  3OOC A;  5JOB A;  5TSS A;  3NBH A;  1PTO D;  2B39 A;  3K0Y A;  2Z4H A;  4XT3 B;  2JXM B;  3QG1 A;  4N9T A;  1H9S A;  4I65 A;  3I3C A;  3NSW A;  5ELF A;  3TDQ A;  2H4O A;  4HSV A;  4A3F B;  5G3L D;  3LWE A;  3PUW A;  4FF2 A;  4G7Z C;  3D4W A;  1WD1 A;  3KBG A;  1TWG B;  3HOZ B;  1PZI D;  3I90 A;  2A69 D;  2AUJ D;  4L6T B;  2O2L D;  1BCP B;  2M00 A;  4M8A A;  1LTR D;  2M2L A;  2IPK D;  5LL6 S;  1ESF A;  1E2V A;  1LLR D;  1PTO C;  4PMC A;  3PO3 B;  3PIP 3;  1STN A;  3GTJ B;  4Y7N B;  2VB3 X;  2EJF C;  3HS0 C;  3HOX B;  1F2Y A;  3X3M A;  3HEJ A;  3NTI A;  1TWC B;  1G8Z D;  1K8M A;  5C6A A;  4BS9 A;  1VDZ A;  5JVG 3;  2EJG C;  1S5C D;  4KK7 A;  2A73 B;  3I70 A;  1O7Y A;  1GUN A;  2A69 C;  1TWA B;  4IUP A;  4DA2 A;  2QIL A;  1SYB A;  2D2C C;  4KY5 A;  4HN7 A;  2EE1 A;  5D65 A;  1JWU D;  3MFG A;  2B2V A;  3FPP A;  1VF5 C;  1SYE A;  3A8J E;  1JCK B;  2RSO A;  4KKU A;  4J1M A;  4QUF A;  1OO9 B;  3VR2 A;  1NSN S;  1VMC A;  4B9W A;  2F0M A;  5JAV A;  1SMY D;  4F8M A;  3T4A C;  3S1R B;  3NK9 A;  4XDX A;  1II3 A;  2F0W A;  4ILW A;  3K7A B;  1KDA A;  5E4W C;  2KJX A;  3H0G B;  3WDN A;  3R8B A;  3C1E A;  3C46 A;  2L0C A;  1IYU A;  3FPU B;  3SHL A;  3V2T A;  3CHB D;  3J81 L;  4A3B B;  1STH A;  3UI2 A;  4RWS C;  4FYD A;  5M3M B;  5JVH 3;  1V1O A;  2E2D C;  2EYL A;  3MXG A;  1JWS D;  1SMY C;  3S1Q B;  1TWH B;  1BO0 A;  1KAB A;  4K6D A;  3SEB A;  1HA5 A;  1EIH A;  1M8A A;  3D8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...