2CCZA

Crystal structure of e. coli primosomol protein prib bound to ssdna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
121
structure length
121
Chain Sequence
MDPNSLMTNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSVDKLAAALEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna/replication
molecule keywords PRIMOSOMAL REPLICATION PROTEIN N
publication title Complexed Crystal Structure of Replication Restart Primsome Protein Prib Reveals a Novel Single-Stranded DNA-Binding Mode.
pubmed doi rcsb
source organism Escherichia coli
total genus 15
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2cczA00
2NVTH 3K7UC 3T1HL 5IP9G 2UUCL 3GTJH 3I4NH 1UE5A 5IP7G 4YY3L 5IYCH 3M7NA 1JJGA 1G51A 3HOYH 3GTMH 4AH6A 4A3MG 2F4VQ 1EUJA 4C3IH 4GLXA 2EQSA 4ALPA 2JA6H 5EAYA 3UE0A 1Q8KA 4YWMA 1IZ6A 3S16H 4HJAA 1EQQA 4OONA 4HJ9A 1YHBA 2CWPA 3KF8B 3ULPA 2NVXH 5LMNQ 2K50A 1VQ8A 4Y52H 1VQEA 2R93G 4DR3Q 5M5YH 3CCJA 1AE3A 1FVIA 1UWVA 4DR2L 1NMFA 1TWAH 3JAMc 4BY7H 1PVOA 1LUZA 1TWFH 4BBRH 4BBSG 1HNWQ 3M9BA 1I94L 3S17H 2IT1A 4DK6C 1VQAA 1WI5A 4DV7L 1G291 2D62A 2XTIA 5M5WH 1XPOA 2UUBQ 1A62A 1XMOQ 2KCTA 2Q2TA 3I55A 4R4OA 1Z47A 3CC2A 5JJLA 1C0AA 2ZTCA 1UEBA 4GOPC 1YJNA 1Q1EA 1KRTA 3L2PA 4A3JH 1PH7A 4NXMQ 4GLAC 3GTKH 4DR6L 4LWCA 3CCUA 4LFBQ 1B70B 1A8VA 1KQSA 1GD7A 4A3LG 1RIPA 2A1AA 4FDBA 3RLFA 4QGUA 2JA8G 3PCOB 3VDYA 4DV5Q 3JC66 3ULJA 4IOAA 2AKWB 3S15H 1GKHA 4NXNL 1HJPA 3D0FA 3RR5A 1VQIA 2OQKA 1Y1WG 1UE1A 2JK8A 1VQLA 2VQEL 4DV3L 4GKKQ 1EOVA 1PYBA 2F52A 3H0GH 3SGIA 3NEMA 4DV6Q 2MQHA 5GAGC 5IY0A 2HHHQ 3CW2C 4JI4Q 3H3VH 2VS1A 1VQMA 4A3GH 5GAHC 2F4VL 4GN5A 5FLMH 1VS0A 3S1MH 2YYZA 3HKZE 3I2ZA 5ELNA 1VQDA 2NZHA 1YZ6A 4JCVE 1PH4A 2R6GA 1YJWA 4LF7Q 4IJLA 4JYAQ 4JV5Q 4LF8Q 1BKBA 2C35B 1Q86C 2Q2IA 4GS3A 4GNXC 4P73A 3PO3G 3UE1A 5C4JH 3H3VI 1O7IA 4HJ7A 1IL2A 1HNXQ 5LMNL 4BXXH 2AMCB 2E2IH 3NELA 3HFZB 4IO9A 4DR3L 4OX9Q 2RF4A 4GOPA 4LW1A 3GTQH 1MJCA 1FL0A 1JJCB 1GO3E 3S1NH 1V1QA 3I4NG 2K5NA 3HOYG 1YBYA 3UDIA 1FJGL 4UPAA 4DV0L 2UUBL 2ZJPA 2VUMG 1XNQQ 3B6YA 4X66Q 1X3EA 1V9PA 1TWGH 1VQOA 3PV0A 1T9HA 3HOXG 2XGTA 3AQQA 5IYDH 4ME3A 1WFQA 2GVBA 2VZAA 3CP0A 4PZ8A 4JI0Q 3S2DH 2VQFQ 2JA5H 3KFUA 1HR0Q 4PZ6A 3CF5A 2KBNA 1ASYA 1L1OC 3PF4A 2CKZB 4DK3C 5IYBH 3KF6A 3CD6A 3RZOH 3S14H 2E2JH 4BBRG 1QZHA 4YWKA 3G71A 1LM0A 4X62Q 4GNXA 2HQLA 4LFAL 2K52A 2K14A 1L2FA 4JI4L 2CQOA 4C3JH 4A3EG 2HHHL 2ID0A 4UP8A 1KC8C 2N3SA 1X56A 1KHIA 3ICEA 2JE6I 2UUAL 4A3JG 2NZOA 2K5VA 4DV2Q 2E5LQ 1VCIA 4X6AH 4JBWA 1PH2A 5M5XH 3G48A 3J7ZC 1ASZA 1V43A 1X3GA 2RHSB 3CCRA 2Y0SG 3I56A 2IHFA 1HZBA 1XMQL 1NJIC 4QQBX 3PGZA 3I4MH 2LSSA 3BZKA 3F2BA 3CC4A 1X9NA 3CCSA 4HIKA 4IPDA 4JI6Q 5C44H 4X64Q 3WWVA 4APVA 2QEXA 1BVSA 1YHQA 4A3GG 2NN6I 5J3BA 1CKOA 1L1OA 1G6PA 1UE7A 5FLMG 3KDFA 2N49A 3L7ZC 1XNQL 1U5KA 4X66L 2PQAA 1Z9FA 4J15A 4C2MH 5IT9c 1XJVA 4LF4Q 2IX1A 1VQGA 4PMWA 4YHHQ 4LF9L 3A0JA 5DLQE 2CFMA 4R1JA 4L5QA 4BA2I 1WCMH 2AWNA 3K7AH 4H02A 4MTNA 4POGA 4DR7Q 1VQ9A 2UXDQ 1VQ7A 4JI0L 2UXCQ 3MXNB 3AFQA 4BXXG 2VQFL 3GO5A 4LFCQ 1CKNB 1HR0L 4GKJQ 1HR0W 4BY1G 1B8AA 3W1GA 3D31A 3TS0A 1X54A 3F2CA 4JBMA 1PFSA 2PMZE 2RHQB 1Y1VH 4B3TQ 1R9TH 4A93H 1I6HH 4DV4Q 3FP9A 3K0XA 1U0LA 4DPGA 3G4SA 2CWAA 4A3BH 5AJ3Q 2E8GA 3UDXA 4AQYL 5E7NA 4PZ7A 1K83H 4DUZQ 2LXKA 1Q81C 1I50H 1IBMQ 2IHEA 2R7FA 4MNOA 4HIOA 4B3RQ 4LNQA 2YU9H 1E22A 2E5LL 3CCVA 1OXXK 2QA4A 1QVFA 5IYDG 1I3QH 2JQOA 2PNHA 3PIPA 2B63H 3K8AA 1YHAA 4KI0A 1N34Q 2JA5G 2VNUD 3U50C 3J81i 1K9MC 3OTOQ 5IYBG 3J80c 4DUYL 4A3CG 1KL9A 4JOIC 4OO1G 4IPHA 5C4XH 1IBKQ 1SROA 1QUQB 4DR1Q 3CCQA 4A76A 3E0EA 5HGQA 5HY6A 1QVCA 1YNXA 4XTCS 1PHJA 1K8AC 4X64L 1RL2A 2R92H 1OXTA 2R7ZG 4IFDG 5K36G 1Q7YC 5C0XI 1EQRA 1EYGA 3T1YQ 3PO2H 4R4TA 1X65A 1HH2P 4RG1A 3CPFA 4MZ9A 5GADC 4LF4L 1CSQA 1PH5A 4P75A 1XPUA 5GAEC 3FKIH 4A3IH 1D8LA 1MKHA 3M4OH 3GTLH 1W3SA 3PUZA 4DR7L 2UXDL 1YI2A 4X65Q 2UXCL 2BH2A 4LFCL 4DNIA 2V1CC 4GKJL 3CQZH 3ERSX 4QJFA 5JJKA 2WB1E 1YEZA 2B29A 3PSIA 3STBC 3ZJYC 5FJ8G 2Z6KC 4A3FH 2VY3A 3K81C 3CCMA 3STBD 5LMNW 2I5LX 1HZCA 4IJHA 2DGYA 2R7DA 4DKAC 2ATWA 3HOWG 4YWLA 3TRZA 1N36Q 4AYBE 4UY8C 1WOCA 3HKZG 3U4VA 1PH9A 1H95A 1HNWL 5IYCG 4JOIA 4DUZL 1IBML 2Z0SA 2DUDA 4JI1Q 1EFWA 5IP9H 2RCNA 1XMOL 2K5HA 1DGSA 4DV1Q 1J5EQ 4KHZA 2JA6G 1XPRA 1A63A 4IFDJ 4GOPB 4A3MH 4A75A 2Q2HA 3HOUH 4B3MQ 4DAMA 3G6EA 3KJPA 3L0OA 4NXML 3AEVA 1N33Q 4O2DA 2ES2A 1Y14B 3CCEA 3GTGH 4JC0A 2AHOB 4LFBL 4DR5Q 3HOVH 1PYSB 4JG2A 4A93G 1LYLA 4K0KQ 1S3OA 4DV5L 3KJOA 3U58A 4LUVA 2ZM6Q 2OWOA 4BY7G 1IYJB 3K80C 3TQYA 1E1TA 4RMFA 5M3MH 3T1YL 2MO1A 3AYHB 5GROA 2Z6KA 1SMXA 4JI7Q 1PV4A 4DAYB 4GKKL 3T1HQ 2UUCQ 2A19A 3RZDH 1XNRQ 3HOZH 3Q8DA 4NPSA 4YY3Q 4DV6L 4BBSH 2PI2E 3JAMi 4JI2Q 3M4QA 1KIXA 4Y7NH 2B63G 4TVAB 2L15A 3PUYA 1N32Q 1SRUA 3PUXA 4X65L 4JI6L 1PH3A 3PUVA 3U4ZA 4LF7L 1VQPA 4JV5L 4LF8L 5C4XG 3PUWA 1AE2A 2CCZA 1KXLA 4OWTB 5M3FH 2IX0A 3KLWA 1HNXL 2ZJRA 4JI8Q 4A3LH 4OX9L 3ULLA 2JA9A 1E3PA 1HNZQ 2JA8H 3PO2G 2WAQE 2WFWA 1L0WA 3H0GG 2E2HH 1Y1WH 1PH8A 1XTDA 4AIMA 3ER0A 3CMEA 4OXPA 4DV7Q 4A3IG 3GTPH 4P74A 1A0IA 1M1KC 1VQKA 5JJIA 1KD1C 4C3HH 2ZJQA 3A5ZB 1HZAA 1SE8A 1K8GA 3S1QH 1CKMA 3LGJA 4B3ML 4LF5Q 3TS2A 4A3FG 3AFPA 3S24A 3RNUA 1N33L 4OWWB 4DR6Q 4JI5Q 2EIFA 4P72A 2OQ0A 3KDFB 1IXRA 1E7ZA 1P16A 1SR3A 5LMUQ 2PQAB 3RLNA 4UP7A 2A8VA 2PI2A 1NBWA 4PG3A 3EBEA 1YVCA 3PF5A 2BH8A 4X62L 4JI7L 4O0AA 2VQEQ 4DV3Q 1NMGA 1WYDA 1YITA 1VQ5A 1XNRL 2JA7H 3M3YH 2GN5A 2QGQA 1WJJA 3HKSA 1E1OA 4JI2L 2HIXA 4OWXB 1VQJA 3NENA 3GD7A 3HOUG 1VQFA 1MIUA 2VUMH 1KRSA 1N32L 4DV2L 1W2BA 2H5XA 2JEBI 1J6QA 3W1BA 4EQ5A 4L5SA 2VL6A 3HOXH 2HT1A 3HOVG 4A3DH 1KAWA 4TQUS 4R4QA 4JBJA 1E24A 1NY4A 3NBHB 1AH9A 4GN4B 5C3EH 2KHIA 3RN2A 2OTJA 4JI8L 1VQ4A 3BZCA 1QVGA 1IBLQ 1HNZL 1TWHH 5M3MG 4NB3A 4R4CA 1P8LA 3CPWA 1Q1BA 2N78A 3KYHC 3S2HH 3HOZG 4BA1I 1NTGA 2KCMA 2D0OA 2YTYA 3BU2A 5IWAQ 3OYYA 1FJGQ 4DV0Q 4P71A 1QUQA 4A3EH 4KLKA 3RN5A 2UU9Q 4IPGA 2UXBQ 4LUZA 4YHHL 4LF5L 2JEAI 1VQHA 1K0RA 4YCVA 4HIDA 2ASBA 2KHJA 1FGUA 3GTOH 1NE3A 2FXQA 2NN6G 2F3IA 2ZTDA 5M3FG 1JT8A 4JI5L 1S72A 3DLLA 2N8NA 2K4KA 2EXDA 3S1RH 3I4MG 3CCLA 4DR4Q 3CMAA 5LMUL 2AWOA 4POFA 3A5UA 3CXCA 4KHPQ 3F2DA 4A3KH 5BR8Q 5IE8A 5C44G 1C9OA 3CC7A 3F1ZA 4B3TL 3E9IA 1GVPA 1OXVA 4DV4L 4JI3Q 4LFAQ 1N8RC 1OXUA 1PH6A 3M4PA 1I5FA 3UDFA 5H1SE 1CUKA 5AJ3L 4LF6Q 2I5HA 2K75A 2YTXA 2MNAA 1JJ2A 4XIGS 4B3RL 1EIFA 2WB1G 3GDEA 2YV5A 1Q46A 2UUAQ 5IP7H 1WCMG 2GVAA 1LTLA 1TWCH 4L5TA 1N34L 1CSPA 4HJ5A 1HZ9A 3DM3A 3IRBA 3BJUA 2BA1A 4AYBG 2I5MX 4UP9A 3OTOL 4HJ8A 1XMQQ 4GLVB 4QY7A 3W5OA 1Q82C 1IBLL 1Y1VG 1IBKL 4B3SQ 4BY1H 3E9HA 4GN3B 1EIYB 4DR1L 3PIOA 4JBKA 2BA0A 1OTCA 2KENA 2MFIA 3J81j 1PA6A 1GM5A 2JA7G 2ALYB 1YJ9A 4YCWA 5JEAG 5GQOA 4A3BG 2R93H 3KOJA 4HIMA 1SFOH 4IOCA 5IWAL 1JB7A 2MO0A 3A74A 1N9WA 1EWIA 4L5RC 1X3FA 3J81c 2UU9L 1M90C 2UXBL 2HIVA 4A3DG 4LF9Q 1D7QA 3EIVA 3KF6B 4QIWE 5C0XG 1YIJA 1X55A 1QZGA 5C3EG 1JMCA 2OCEA 4GNXB 1C7YA 4WJ3M 2Q2UA 2OTLA 4DR4L 2JJQA 4KHPL 1K73C 4A3CH 4EX5A 5BR8L 1SN8A 1S40A 2R92G 1X6OA 4JI3L 1UE6A 3TREA 4YCUA 1BBWA 3J80i 3OW2A 3F8TA 1N36L 1VQ6A 2NVQH 4DR2Q 1TXYA 2Y0SE 2IY5B 5FLXc 2LXJA 2ZTEA 3I7FA 3H15A 4LF6L 2R7ZH 3CAMA 1OXSC 4AQYQ 1PH1A 1I94Q 1VQNA 1K3RA 2NVYH 3FKIG 1MJEA 4QL5A 4JI1L 3M85A 3RLOA 3FHWA 4OO1I 4DV1L 1J5EL 1JE5A 3I4OA 1B7YB 2D0PA 5JEAJ 2YTVA 4IFDI 3J7A5 1VQBA 1SLJA 2WAQG 3TEHB 4DUYQ 5ELOA 4A3KG 4DR5L 1L1OB 3EN2A 4B3SL 5FJ8H 3PO3H 4K0KL 2VW9A 1VQCA 3MEFA 2ZM6L 5C0XJ 3UDGA 4IPCA 4LUOA 4R4IA 4A4IA 2I0QA 4JYAL 1BBUA 3HOWH 4NXNQ 2WP8J 4WJ4A 1Q12A 1CKNA 2B3GA
chains in the Genus database with same CATH superfamily
3K7UC 1QG7A 2Q8IB 2UUCL 3I4NH 5C4XB 4YY3L 4IUPA 3GTMH 4A3MG 1CFMA 2R92B 2EDGA 4C3IH 2EQSA 2DY8A 4YWMA 3NK9A 1S5CD 3R2TA 4OONA 1JWUD 3ULPA 2K50A 3OIQA 3GTLB 4G57A 1JORA 1C4QA 4DR2L 1NMFA 5I9OA 3OSOA 1TWFH 1W6KA 3CQZB 3NBHA 2WAQB 1WI5A 2D62A 3M7GA 5M5WH 1XMOQ 1I4QA 2Q2TA 1Z47A 1STGA 1DYQA 2ZTCA 1PH7A 1YJNA 1Q1EA 3L2PA 4GLAC 2NBFA 4LWCA 1B70B 5I2YA 5G3LF 1RIPA 2A1AA 4QGUA 3VDYA 2D5DA 3S15H 1GKHA 1U4MA 4F88A 1HJPA 1LTBD 2RVLA 3BDOA 1VQIA 1Y1WG 1M8AA 4CKEA 4GKKQ 1KAAA 4JI4Q 2F52A 3SGIA 3S1QH 5GAGC 3CW2C 2VS1A 5IGEA 3HKZE 5M3MB 3I2ZA 5ELNA 1VQDA 1PH4A 4LF7Q 3HOZB 3M4YA 1U4PA 4LF8Q 1BKBA 2C35B 3PO3G 2Q2IA 4GNXC 1UUPA 4ABNA 4HJ7A 1IL2A 2AMCB 2E2IH 3NELA 1TVXA 4IO9A 3ND9A 2RF4A 5EBDA 4LW1A 1FL0A 3I4NG 2K5NA 1YBYA 2B2VA 3VA7A 1FJGL 1HPCA 5JJZA 4N8FA 1GXDC 2VUMG 3C1FA 3I91A 3PV0A 5C44B 2ZT9C 2EYLA 1SE3A 4ILWA 4ME3A 2VZAA 2A6EC 1B2TA 3S2DH 3CF5A 1L1OC 2ICIA 4DK3C 3E0JA 3CD6A 3DWPA 1CQVA 4F7XA 2XNAC 1QZHA 3G71A 4EGVA 1PXUA 4R8NA 4KKTA 2K14A 4JI4L 2JXMB 2DNCA 4A3EG 1SE4A 2ID0A 2F3VA 4K5XA 3ICEA 2UUAL 1IL8A 3DEPA 2K5VA 2E5LQ 3BS1A 4X6AH 1SEBD 2JA7B 4A3BB 3G48A 3M3YB 1ASZA 1X3GA 2NN6H 3I56A 1HZBA 2D2CC 3A55A 3F2BA 4XT1B 2BOSA 3QOLA 4A3DB 4XQJA 5C44H 4DAPA 4X64Q 1TY0A 2K5WA 2QEXA 5C3EB 3KDFA 1WTPA 2NYZD 3FPUB 2MP1A 1XYIA 1STEA 2VB3X 1AW7A 3MWYW 2CFMA 1F9QA 4MTNA 4POGA 2LMCB 1VQ9A 1VQ7A 3AFQA 4LFCQ 1F9RA 2KOLA 4GKJQ 1V1PA 3H91A 4BY1G 1HR0W 3D31A 1SYGA 4KY7A 1H9MA 1AFPA 1PFSA 3FPPA 2H1EA 3G4SA 4A3BH 2HQEA 3S1RB 5JEAH 3KF8A 4PZ7A 4FNFA 4A3KB 2F0GA 4B3RQ 1SDFA 2E5LL 3E6ZX 2JQOA 1ET6A 4XQNA 3PIPA 1HFGA 1YHAA 1N34Q 1IKMA 5C3WA 3FVQA 3K5LA 3SVMA 3OTOQ 4DUYL 3J80c 1Y69U 4HSPA 1CZGA 1MHWC 3KBXA 4OO1G 4IPHA 1IBKQ 4DU9A 3CCQA 4A76A 5HY6A 1QVCA 1PHJA 4X64L 1RL2A 2KECA 4IZ8A 1X65A 1B53A 4RG1A 1PH5A 1HTLD 1CA5A 2OEOA 1ENFA 3T51B 2R93B 2E75C 3QR8A 1FNUA 4LFCL 4DNIA 2V1CC 1PRTF 4GKJL 1ZXTA 4FVMA 4F8MA 4A3FH 5FJ8G 4BBSB 3ZJYC 2VY3A 3K81C 2K5DA 1A3UA 1SNMA 3MHBA 4IJHA 2DGYA 1N36Q 1B1ZA 2F0WA 4AYBE 3HKZG 1GOZA 1HNWL 4KK7A 4U673 1NR4A 2AUJD 1VDZA 1J5EQ 1DD2A 1CQFA 5FO9B 4IFDJ 2Q2HA 2RA4A 4RKLA 3HOUH 4NXML 3L0OA 3GTGH 5DM63 1PRTD 1H9SA 2EYMA 2PZTA 2EY1A 3HOVH 1X3QA 4C3HB 2F0DA 4OELB 4DV5L 2OWOA 4IQZA 3H09A 2ZM6Q 3AU7A 2MPMA 4RMFA 1EY7A 2Z6KA 2NWGA 4RAUC 2AQ1B 4JI7Q 2AQ2B 4BBSH 3Q8DA 3BVMA 4IALA 1PMRA 3QJYA 1ML0D 1RKNA 1EWHA 1HA5A 3URYA 3K0YA 1YNJD 3WOFA 4UAIA 5ELBA 4OL7A 5DNFA 3PUVA 2NVTB 4JV5L 4DF7A 3PUWA 2CCZA 2O4XA 4OWTB 1HNXL 2HCCA 2HUGA 3CRLC 5NUCA 2RSNA 1E3PA 2F0EA 2F0NA 3Q22A 1RD9D 1EU4A 2NVXB 3ER0A 4DV7Q 4P74A 5JJIA 1KD1C 4C3HH 4BY7B 3VYUA 4BBRB 4BWGB 4A3FG 3RNUA 3S17B 4K2KA 3TN2A 1KDAA 3KDFB 1IXRA 1E7ZA 1WTHA 5LMUQ 4UP7A 4PV1C 4LK1C 4IUTA 1YVCA 4A3JB 2L0CA 1PFBA 1SXTA 3T16A 4JI7L 4EVOA 4XYQA 4FO2A 4DV3Q 3HP3A 5E3FA 1V1PB 1WJJA 3I72A 4PNYA 3FEWX 1D5XC 5C3XA 1SYFA 3HOUG 5CGKA 4DV2L 3GQBA 1W2BA 3EVQA 1X3PA 3GV6A 4NW2A 2HT1A 2HDMA 3HOVG 4H44C 1VMCA 2FMCA 3H0GB 4R4QA 1HHVA 2G9HD 4A3GB 2K32A 1UEAB 4GN4B 1YNNC 3BZCA 1F2YA 1P8LA 1ILQA 1Q1BA 4C3JG 5C4JB 2KCMA 2EYOA 4KY5A 4DV0Q 4KD3A 1QUQA 3GTQB 3MXUA 2EPBA 5KIXA 3S1NB 2CW0D 5KNBA 4HMJA 4YCVA 1SJHD 2KHJA 1SFOB 1JOQA 2ZTDA 1S72A 2KVMA 3DLLA 3I4MG 1O7YA 5LMUL 4ZK9B 3A54A 3CC7A 3F1ZA 2A6HD 1N8RC 1OXUA 1I5FA 5CBEE 1E2ZA 1Z6HA 1JJ2A 3J81L 3S14B 1R4PB 2E2JB 2YV5A 4FF3A 2GVAA 1LTLA 1J8IA 1PTOC 2R7ZB 5D14A 2BA1A 4AYBG 1NAPA 2I5MX 1ZEQX 2JP1A 2MUYA 3D4WA 1EY0A 3OMGA 4B3SQ 4DR1L 2DNEA 5M5XB 2FFKB 2BA0A 3OPOA 1PA6A 5KYLA 1X32A 1SFOH 3KLRA 1X3FA 2WKCA 3I90A 4QUCA 1CT1D 5CV6A 5C6AA 4QIWE 4MHEA 1S4ZA 2OCEA 4ZCKA 1C7YA 4JK1C 2OTLA 1HA6A 3MA2B 3T4AC 4A3CH 5M9OA 4U68A 2JA6B 1TU2B 2SDFA 2NVQH 1TXYA 2Y0SE 4RGNA 2R7ZH 2ZTEA 3I7FA 1Q8IA 1STYA 1SNOA 2BDNA 5CBAE 1CM9A 4FF4A 4I65A 1BUVT 4JI1L 3M85A 1I6HB 5JAVA 3QOJA 1SNQA 1B7YB 2CQAA 2D0PA 4IUVA 1HQMC 5IOCA 4DR5L 4B3SL 2B63B 5C0XJ 4R4IA 4CKCA 2I0QA 5FOBB 5LL6S 2PO4A 1QNUA 2B3GA 1U4RA 5IP9G 3GTJH 4B08A 5IYCH 1JJGA 1A3TA 1G51A 3HOYH 1I4PA 2F4VQ 2F0LA 2F3WA 1EUJA 2RDHA 5F2DA 2JA6H 3MTSA 3KLSX 1B9NA 1Q8KA 2JYOA 3P75A 1IZ6A 1D5ZC 1EQQA 1EYCA 4JVZA 3FKIB 4HJ9A 2MJ8A 4RHSA 1GUNA 2QKIC 1VQ8A 4ZUIA 4I7AA 4DR3Q 1FVIA 4J8QA 1PVOA 1LUZA 3H6MA 4DK6C 4K2LA 2EYJA 2X6GA 2UUBQ 2OT2A 2QCPX 3I55A 3IAYA 5JJLA 1C0AA 2F0PA 5KNCA 3C3LA 5EGTA 1C8CA 4DR6L 3R8BA 1MSGA 4LFBQ 2B39A 1KQSA 2QILA 2JA8G 1EWCA 3L3OC 1ET9A 3VR4A 1KLGD 4Z9CB 3RR5A 2RKSA 1SNPA 1UE1A 2JK8A 1HUMA 2ZXOA 2IL8A 1EOVA 4Y52H 1AP0A 1M4VA 2MQHA 3H3VH 2F0HA 3NHHA 2SNMA 5GAHC 2F4VL 3RZOB 5I6WA 2HDLA 3S1MH 3VA5A 3H94A 2NZHA 1E2VA 2PZUA 1YZ6A 2HCIA 1C48A 1STAA 1YJWA 3OHXC 2RSOA 1IW7D 3GV3A 3UE1A 4LJZC 3HFZB 5CV5A 5DM73 4DR3L 4QF4A 4OX9Q 1MJCA 4HR7B 5I2XA 3OMCA 3HOYG 4UPAA 2UUBL 4P2CB 1X3EA 4NMZA 3JAME 3VR3A 1T9HA 3NPPA 1RJTA 5I4DA 2XGTA 2F03A 1WTWA 4DA2A 3AQQA 4FP5D 1Y1WB 1AZQA 1WFQA 3CP0A 2KHSA 1JR0D 2VQFQ 2JA5H 3NTIA 4PZ6A 1HR0Q 2KBNA 1DOLA 1ASYA 3RZOH 1O7LA 1Y8PB 4OIKA 1GHJA 1WCMB 2Z4IA 1Y8OB 1LM0A 4GNXA 2K52A 5K36H 4DXGA 1SJED 1D6EC 4UP8A 5CV8A 2N3SA 1X56A 5K5PA 3ITPA 3D3RA 2JE6I 1Y1VB 1A2UA 2AUKA 1R9TB 2BCOA 3J7ZC 2WIIB 2IX3A 2RHSB 2Y0SG 4XQQA 1B50A 3PGZA 2OXPA 2X6LA 3BZKA 2B2UC 1X9NA 1SAPA 4G7OC 2BE5D 1SNCA 4APVA 2NN6I 1CKOA 1L1OA 1B4OA 4FXGC 4H13C 2MHVA 1LABA 2N49A 3I70A 1TWHB 5IT9c 4J15A 4C2MH 2IX1A 4PMWA 2F1MA 2E76C 4R1JA 4L5QA 1WCMH 2AWNA 4H02A 2UXDQ 1E2WA 5IGGA 1EIHA 3J80L 2VQFL 3GO5A 2XN9C 1HR0L 4A3EB 4IURA 2WINB 3TS0A 4IUUA 1QNKA 3BDLA 1Y1VH 1R9TH 1U0LA 2CWAA 5AJ3Q 3FRPB 1STBA 4AQYL 2L5TA 1IBMQ 2EVBA 2IHEA 2R7FA 4MNOA 1JOKA 1QJOA 1E22A 3TP7A 3CCVA 2JSOA 3A56A 3K8AA 4KI0A 2JA5G 2VNUD 2VB2X 1O7ZA 5J1ZA 4TRDA 3ONAB 1RF2D 3HS0C 4IN3A 5C4XH 1TWCB 3E0EA 5HGQA 2ZXPA 2R92H 5K36G 1JICA 2A68D 2EYPA 4R9WA 4BY1B 1EY6A 1XPUA 4K5VA 1MKHA 2EY5A 3GTLH 1TT2A 2UXDL 2A5HA 4M1UB 4C1NK 2NZ1D 3CQZH 5JJKA 3STBC 3TRZA 3IFTA 3U4VA 4BS9A 1PH9A 1CI3M 2KEDA 5DEHA 1IBML 1PLFA 3T56B 2RCNA 4C3IG 1XMOL 2K5HA 1DGSA 4DV1Q 4KHZA 1XPRA 1A63A 4A75A 4M8AA 4B3MQ 3AEVA 2XIWA 2IJ0A 4O2DA 5T1IA 3Q24A 3DUZA 2XRSD 1EQVA 1ZKOA 2J7ZA 4K0KQ 1SMYC 3KJOA 5D65A 1A15A 3K80C 3N6RA 5E4XA 5M3MH 1Y8NB 2F0UA 2LY7A 1SMXA 1PV4A 5EJWA 4GKKL 1MSHA 3T1HQ 3HOZH 2A19A 1RTOA 4NPSA 4G4KA 3JAMi 3SXHA 1WTQA 2L15A 1N32Q 3PUXA 4LF7L 3U4ZA 4LF8L 1I4RA 5C4XG 2M9VA 3A8IE 2ZJRA 5IGCA 4A3LH 2JA9A 2SOBA 1TY2A 3DWQA 4OGQC 3HOXB 1NR2A 2B2TC 1XTDA 4OXPA 4WFN3 1M1KC 5IGFA 1VQKA 4K6LA 4CJ2C 2ZJQA 5M5YB 1BQQT 1TWAB 1SYCA 1ZYRC 4KKUA 4B3ML 1OO9B 4LF5Q 2F0IA 4X3TA 3KUPA 3VR2A 2A69C 2OQ0A 2LFNA 3OWFA 5C5MA 3K5MA 3K5OA 2A8VA 2XSCA 1NBWA 3GTKB 3W2DA 4QUFA 3I8ZA 2BDOA 3MFYA 2VQEQ 1PZID 2JA7H 2VXWA 1WYDA 3M3YH 2GN5A 2QGQA 3P7JA 1A2TA 3NENA 1EL0A 3GD7A 1SYBA 4CDFC 1MIUA 2O2LD 4FF2A 1N32L 2H5XA 3WOEA 1NUCA 4L5SA 4A3DH 3HOXH 4XXEA 1XWEA 2I07B 1KAWA 5BN3A 1E24A 1NY4A 3NBHB 5C3EH 2OTJA 3IFDA 1VQ4A 4KN7C 1HRJA 1QVGA 1IBLQ 5M3MG 5JVG3 4DN4M 4R4CA 1PZKD 3CPWA 1CHPD 1ESFA 3I73A 3HOZG 2Z9HA 2EYFA 1NTGA 3BU2A 5FK9C 1RCVD 1BCPC 1RODA 3D6CA 1K28A 4KLKA 3RN5A 2UXBQ 4LUZA 4QB4A 4GZYC 1H9RA 4LF5L 1K0RA 1FGUA 1MGSA 1NE3A 3R3OA 2NN6G 3Q0AA 4MTKA 2EXDA 3U9OA 3S9WA 3S1RH 2B2VC 1TWGB 2K05A 1LTSD 1PYWD 4POFA 3A5UA 1EY4A 4ZUJA 4A3KH 5BR8Q 5C44G 2EOTA 1S5ED 4LFAQ 2CVRA 1BNZA 3NUCA 3M4PA 3UDFA 5H1SE 4LF6Q 2I5HA 2TMPA 2IW3A 2YTXA 4B3RL 1ICFB 3GDEA 1Q46A 5IP7H 4K5WA 2L55A 1IW7C 1N34L 1HZ9A 1PFNA 3IRBA 3BJUA 1BXTA 3OTOL 3BZDB 1MI2A 1XMQQ 4GLVB 4QY7A 3W5OA 1IBLL 1RTNA 1IBKL 1R4QB 3DXJC 4GN3B 1EIYB 2O5JC 1EZ8A 2KENA 2MFIA 5FO7B 4HCEA 1GM5A 2JA7G 1YJ9A 4A3BG 4YCWA 5JEAG 5GQOA 2R93H 1VF7A 1EWIA 4L5RC 5CYUA 3I4MB 2UXBL 4CDDC 2HIVA 4A3DG 3A8JE 4LF9Q 5EPLA 3HOWB 1YIJA 5LL6X 4L6TB 5C3EG 1JMCA 4WJ3M 4CDEC 2XVSA 1K73C 4EX5A 5BR8L 3K7AB 3K59A 1N36L 3X3MA 1S5DD 2I46A 4LF6L 3AB9A 4IFDH 3S16B 3CAMA 1OXSC 4AYBB 4KD4A 3ZYYX 1I94Q 1K3RA 1TS5A 4QL5A 1LACA 1KABA 1J5EL 4A93B 3I4OA 3SR1A 2K01A 2F0QA 1QB5D 2F0MA 4PMBA 3MAQA 1K83B 1VQBA 3LX0A 3TEHB 3J7A5 1O78A 4A3KG 1NCVA 2YU9B 1I3QB 2ZM6L 3UDGA 1JCKB 1CZWA 2EJMA 4HMIA 3P1HA 3HOWH 4NXNQ 2WP8J 3CKIB 3MXNA 1Q12A 4WJ4A 3HGBA 2NVTH 2F0VA 2XWBB 1UE5A 3TDQA 5IP7G 1G2TA 1TKWB 5C4HA 4AH6A 3PO2B 4ALPA 1JWSD 5IODA 2QEJC 5EAYA 3J81E 1GUTA 5HURA 3HZXA 3S16H 1FR3A 4KJOA 1DZ1A 3KF8B 4A3IB 1WVLA 2NVXH 1KDCA 3FDTA 3M4OB 1VQEA 2K7VA 2R93G 3T13A 1AE3A 1UWVA 3EA6A 4BY7H 2P5ZX 4BBRH 4BBSG 1SE2A 1I94L 3S17H 4ZKBB 1VQAA 4DV7L 2XTIA 2KCTA 4DNTB 3C2PA 1T5XD 3CC2A 3TMEA 2WKDA 3OW7A 1UEBA 4GOPC 4NP5A 1KRTA 3EROA 4A3JH 1D2BA 1FD7D 4WJWA 1GHKA 1GD7A 2A73B 4FDBA 3RLFA 1LT4D 3JC66 4IOAA 2AKWB 4NXNL 3D0FA 2PMZB 4QCLA 4DV3L 2EE1A 3H0GH 1LTAD 3NEMA 4C3HG 4DV6Q 5IY0A 4A3GH 1EOTA 1VQMA 2PW5A 4GN5A 5FLMH 2PQEA 1BOSA 4IJLA 2SNSA 4OIJA 1Q86C 4P73A 2Q8TA 5C4JH 3H3VI 4Y7NB 4BXXH 5KEEA 3Q23A 1DONA 4KJNA 3GTQH 5JPMC 1JJCB 1GO3E 1KNAA 2DJGC 3S1NH 1V1QA 3DM1A 5M3FB 3NQIA 4DV0L 2EYHA 1D1IA 4PQXA 1H9SB 1XNQQ 2JA8B 1EZ6A 3LWUA 1ENAA 2K5QA 5IYDH 1K0SA 4HN7A 3GTPB 4C56C 4EQNA 2A6ED 3PF4A 3KF6A 3IKJA 3S14H 1BDOA 4ODGA 2E2JH 4BBRG 1H9JA 4X62Q 2HQLA 4RGMA 1S5BD 3EQLC 1L2FA 1I4XA 2OF1A 5IT9L 3D6WA 3G6JB 1AN8A 4A3JG 2NZOA 1PTOB 1VCIA 5JOBA 1KLUD 1HCZA 5M5XH 4DK1A 1QOHA 1V43A 1HXYD 2IHFA 2L4NA 3NWTA 3H3VC 4XT3B 4RFBA 2LSSA 2B2YC 3TP5A 3TSSA 3WWVA 5ELEA 4A3GG 1VF5C 3W3AA 5J3BA 5FLMG 1RDPD 4WORA 1XNQL 2PQAA 4LF4Q 4RWSC 1JC7A 1G8ZD 4YHHQ 3A0JA 1LO5D 3D4DA 4MIUA 4BA2I 4DR7Q 1MBYA 2K03A 2UXCQ 3MXNB 4BXXG 1XX8A 5ELDA 1B8AA 4V0BA 4C1NI 3SK5A 1DCZA 4B3TQ 1G6ZA 1I6HH 5A2QL 4DV4Q 1LT6D 4DXFA 1K8MA 3UDXA 1Q81C 5E7NA 1LLRD 1B3AA 2Y0SB 3I4LA 5A35A 2B2UA 4LNQA 2ENBA 3GP7A 4H0LC 5IYDG 1BF4A 2PNHA 5FLXE 2B63H 5CR3A 3U50C 5C0XH 3J81i 1K9MC 4A3CG 4JOIC 5DAUA 3OWEB 1E0BA 4XYOA 1SROA 2KCCA 1QUQB 4LAAA 1HFNA 1K8AC 4A3MB 1YNXA 4XTCS 4PMCA 2R7ZG 4DNRB 3D8GA 1Q7YC 1EQRA 2C5CA 2ZXRA 1DM0B 3UI2A 1EYGA 4R4TA 5GADC 4TKOB 4YIJA 1CSQA 2K1BA 4P75A 4LF4L 5GAEC 3FKIH 4KV6A 4O42A 5CC4A 4KHVA 1L0XB 1W3SA 1EYAA 3PUZA 2B8FA 3VYRA 4DR7L 1YI2A 2UXCL 2A74C 1CHQD 4QJFA 2WB1E 2B29A 2PYKA 3PSIA 1I4HA 3CCMA 4DK0A 2I5LX 1HZCA 4MN3A 1KDBA 4YWLA 1NSNS 3J7YW 2NTSA 4ZAIA 1WOCA 1H95A 5IYCG 2Z0SA 5E4WC 1WTXA 1EFWA 1EU3A 4ZRZA 4J1MA 1A6XA 1LT3D 2JA6G 3N52A 4A3MH 4N8X1 1PRTC 4DAMA 4K14A 1Y14B 3V05A 2AHOB 2QW7A 4LFBL 1PYSB 3OOCA 4JG2A 5J22A 1LYLA 2RDGA 4LUVA 2Z8LA 1IYJB 2DJFC 2JN4A 3C46A 3TQYA 1E1TA 3J80E 1WTOA 5GROA 4ZLTF 2GA4B 2EY2A 2UUCQ 1XNRQ 3PO3B 4YY3Q 1BBXC 2PI2E 2B63G 3M4QA 1KIXA 1YNJC 4TVAB 1DXMA 3WDNA 3LNNA 2EJGC 3A7AB 3TP6A 1VQPA 3I4NB 1AE2A 4HSVA 2NB0A 2SEBD 3QWNA 1DJRD 4OX9L 3ULLA 2VUMB 2WAQE 2IWHA 1G91A 2WFWA 3MXGA 1Y1WH 1PH8A 2PZWA 2B2WC 1F9SA 2K04A 3A8KE 3R93A 1U9RA 1HZAA 3BG3A 1EQTA 1SE8A 4ZYSA 1K8GA 1CKMA 1TWFB 3S2HB 3PIP3 3TS2A 3S24A 5LHY1 5E1FA 4JI5Q 5EBCA 3MC0B 1SR3A 1LTTD 4DFAA 2PQAB 5ELFA 1WD0A 5BN5A 3JAML 4PG3A 3PF5A 3GTOB 1NNXA 4KTAA 1J9OA 1XNRL 1SNDA 2EXZA 3HKSA 5FO8B 1E1OA 4OWXB 3S15B 3Q6SA 1VQFA 2VUMH 1KRSA 2KUMA 2O5IC 3W1BA 5EQ0A 2B2TA 5J39A 1LTRD 1TQOA 2VL6A 2NTTA 3MFGA 5TSSA 4F87A 3S1QB 4JBJA 2KEEA 1YNND 1TWHH 4EQPA 2CH4A 3KYHC 1B9MA 3S2HH 2D0OA 1TS3A 5IWAQ 1FJGQ 5CV4A 2E2IB 4P71A 1SSOA 4A3EH 2CW0C 3R2IA 4IPGA 3BDCA 5IIFA 2JEAI 1VQHA 4HIDA 3GTOH 3X3NA 1JT8A 2FXQA 1PTOF 2F3IA 3I3CA 4JI5L 1II3A 2F0SA 2Q8RE 2N8NA 2K4KA 3CCLA 4KHPQ 2AWOA 3CXCA 2A6HC 4H7BA 3E9IA 4JI3Q 1ONLA 3L9AX 5IGBA 1SYEA 3QG1A 2DY7A 3S2DB 1CUKA 5AJ3L 4TSSA 2K75A 2RCFA 2MNAA 1JB3A 2QDLA 4XIGS 1EEID 1EIFA 2WB1G 2UUAQ 1WCMG 1IKLA 5CMDA 5ELCA 1TWCH 4L5TA 5C4ZA 3TBIB 3DM3A 1PTOD 3MZ5A 2NVYB 5G3LD 1Q82C 4BY1H 1Y1VG 4DAVA 1B3QA 3PIOA 4JYAQ 3CU7A 3KOJA 1JB7A 4IOCA 2D9UA 5IWAL 2MO0A 3A74A 5AFWA 2Z1CA 1M90C 4O1NA 2EZVA 5EPJA 3NTKA 1TIID 1X55A 2IPKD 3HKZB 2FMMA 4GNXB 3SK4A 2JJQA 4KHPL 1ESRA 1SN8A 5T1GA 1F77A 2R92G 1ILPA 4OO1H 1X6OA 4JI3L 1UE6A 3NBIA 1VQ6A 3J80i 3OW2A 1AH9A 2CHBD 2IY5B 5FLXc 2LXJA 3H15A 1PH1A 2NVYH 3FHWA 4DV1L 1GUWA 4I7ZC 5JEAJ 3U9SA 3J7AF 4IFDI 1CK1A 1SLJA 2WAQG 1LT5D 4DUYQ 1L1OB 5L37A 5FJ8H 2LKVA 1JWMD 2NUCA 2V4DA 4K0KL 1VQCA 3OIPA 1FYCA 3NWSA 4IPCA 4LUOA 4A4IA 4JYAL 2R61A 1BBUA 1PZJD 3NP8A 5CORA 1FGBD 4ULLA 1CKNA 5I9PA 3T1HL 3M7NA 2L1BA 4GLXA 5D3DA 3UE0A 4HCSA 3J7AV 4HJAA 3DWAA 1YHBA 2CWPA 2F0FA 1UNSA 5LMNQ 5M5YH 3CCJA 3BYYB 1TWAH 3JAMc 4KMUC 4UHVA 4L8JA 4A3FB 1HNWQ 1JOOA 3M9BA 2Z6BA 2IT1A 1FNVA 4RCOA 1G291 4IUNA 3PQIA 1XPOA 1A62A 4CDCC 1F2ZA 3FMCA 1STNA 4R4OA 5JVH3 4NXMQ 3GTKH 5EKIA 3CCUA 1A8VA 2KJXA 2EY6A 2QF7A 4A3LG 1Q3LA 1EFID 3PCOB 5EKLA 4DV5Q 5HGTA 3ULJA 3HOUB 3GTGB 2OQKA 5ISRA 1VQLA 3HOVB 2VQEL 1PYBA 4FYDA 2HHHQ 4HAEA 4K8IA 1VS0A 2YYZA 3G7LA 4JCVE 2R6GA 4JV5Q 3ND8A 3CRKC 1HQRD 4C3JB 4ZKCB 4GS3A 4CKBA 4K6DA 1O7IA 3SK6A 1HNXQ 5LMNL 2F4IA 4GOPA 1EEFD 2PNRC 1BCPB 3UDIA 4CHTB 4V190 1IHZA 2ZJPA 4CJ1B 3B6YA 3SE0A 4X66Q 1V9PA 1TWGH 1AEXA 1VQOA 3HOXG 3P20A 4E6IA 1EYDA 4DAYA 1HTPA 2GVBA 4PZ8A 4JI0Q 1I6VC 1QWYA 3KFUA 4R8IA 2C9OA 1SYDA 2CKZB 5IYBH 1WD1A 5CV7A 1LTID 2R3ZA 4YWKA 3K58A 3V96A 4LFAL 1BR9A 1FNWA 2CQOA 4C3JH 4N9TA 2HHHL 2FINB 1KC8C 1KHIA 4OEMB 4DV2Q 1K3BC 4JBWA 1PH2A 4RH6A 3VR6A 2X69A 3CHBD 4N9PA 3CCRA 1I50B 3IL8A 1XMQL 3NSWA 1NJIC 4QQBX 4QMGA 3I4MH 1IYVA 3CC4A 2BE5C 3CCSA 4HIKA 3KBGA 4IPDA 4JI6Q 4RCNA 1BVSA 1YHQA 5KRUA 1G6PA 1UE7A 2M00A 3L7ZC 1U5KA 4X66L 1Z9FA 1XJVA 2L12A 3QO2A 1VQGA 2K28A 4Q5VA 4LF9L 5DLQE 3K7AH 2F0TA 4CBVA 4JI0L 1EY9A 1O80A 1CKNB 4XDXA 1UAPA 3W1GA 1X54A 3F2CA 2N55A 4JBMA 4G7HC 2PMZE 3A7LA 2RHQB 4A93H 4NKLA 3VYTA 2KA7A 3FP9A 3K0XA 4DPGA 2E8GA 5COYA 5D3IB 2PPBC 1K83H 4DUZQ 2LXKA 3BYTB 1I50H 2B2YA 2HD3A 4CJ0B 4B9WA 5EPKA 4HIOA 2YU9H 4G7ZC 1OXXK 2QA4A 1QVFA 1H9KA 1I3QH 3MEHA 5IYBG 1KL9A 4L63B 1IYUA 3RUZA 4DR1Q 2AQ3B 4JI6L 2CH4W 2A68C 1LV9A 1OXTA 3E3XA 4IFDG 1LTGD 5C0XI 3T1YQ 3PO2H 3V2TA 1HH2P 3K5NA 3CPFA 4MZ9A 1GUOA 3EFXD 4A3IH 1D8LA 1CA6A 4LMQD 2WACA 5IGDA 3M4OH 3T53B 2EJFC 4X65Q 3E5SA 2BH2A 5IT9E 3HRZC 3ERSX 2H4OA 3RZDB 1YEZA 3DHQA 2Z6KC 3STBD 3MXPA 1TR5A 5LMNW 4HEDA 4DKAC 2R7DA 2ATWA 3HOWG 1F9PA 4UY8C 1GUSA 3QB3A 3RMHA 3BVZA 4JOIA 4DUZL 2J4XA 1DOKA 2DUDA 1HUNA 4JI1Q 5IP9H 4UDUC 3PMFA 2NVQB 1EY5A 4GOPB 1TS4A 3NE5B 3LWEA 3G6EA 3KJPA 1N33Q 2ES2A 2E2HB 3CCEA 1JQYD 2KQ3A 4JC0A 5CV9A 4DR5Q 1QE6A 4A93G 1S3OA 3U58A 4BY7G 1SMYD 3QIAA 1AZPA 2WV6D 3T1YL 3TZDA 2MO1A 3AYHB 4DAYB 1CTMA 5JPNC 3RZDH 4DV6L 4FXDA 2F0KA 5KNDA 4JI2Q 4Y7NH 5A2QE 3NTHA 2K33A 3PUYA 1SRUA 4X65L 2G9DA 1PH3A 2MGSA 3GTJB 4B9XA 4RHRA 4Q0FA 1KXLA 3HOYB 5M3FH 2IX0A 3KLWA 4OHJA 4JI8Q 4KN4C 1HNZQ 2JA8H 3PO2G 4ME5A 4X3KA 1L0WA 3H0GG 2E2HH 1F2LA 4RGOS 4AIMA 3CMEA 1VMPA 4A3IG 3GTPH 1A0IA 5BN4A 3MVVA 1D1KA 1SBBB 3A5ZB 1W6JA 4S3SA 2QDBA 2E2DC 3LGJA 5C5LA 1B44D 1QILA 1ZYRD 3AFPA 1N33L 4OWWB 2RQXA 4DR6Q 4QIWB 1Q90A 2EIFA 5FKAC 4P72A 1P16A 2A69D 1XTCD 3RLNA 1EY8A 5I6YA 2PI2A 1GJXA 3EBEA 4K8JA 1PTOH 1PFMA 2BH8A 4X62L 4O0AA 1G2SA 1NMGA 1YITA 1VQ5A 4EQOA 4RA8A 4JI2L 1F2MA 2HIXA 3SEBA 1KNEA 1VQJA 1BCPF 1V8QA 2TSSA 3BVGA 3TP8A 3NXWA 4JPBW 2JEBI 4EQ5A 1J6QA 4KKSA 3DMUA 2B2WA 4TQUS 1TS2A 3F2UA 1ICWA 2KHIA 3RN2A 3S1MB 4JI8L 1HNZL 4NB3A 1ENCA 2F0OA 2N78A 1V1OA 1D5MC 2M2LA 2PW7A 4HTHA 4BA1I 2YTYA 3RD4A 3OYYA 1STHA 3TZUA 1K8OA 2UU9Q 1BCPD 3O13A 4RGTA 4YHHL 3K57A 4FF1A 2ASBA 1Z7TA 2ICEC 5M3FG 3KLSA 4DR4Q 2DN8A 3CMAA 2RBMA 2N88A 3F2DA 4CGYB 5IE8A 1C9OA 3PIO3 4B3TL 1GVPA 1OXVA 2L11A 4DV4L 3HG9A 1PH6A 2JA5B 1XXGA 4X3SA 2F0JA 2E74C 3SK8A 3AMUA 4ID6A 1S5FD 4J6HA 1CSPA 4HJ5A 2XRQD 2KCNA 1A3VA 4UP9A 1L0YB 2G5DA 4HJ8A 1WTRA 3VR5A 1JE4A 5EKKA 2RDFA 3E9HA 4FXKC 4JBKA 5KGUA 1OTCA 4JW0A 1KTKA 5FLXL 3J81j 2ALYB 3SHLA 2K6AA 1MD2D 4HIMA 3C1EA 4KY6A 4IUQA 3HEJA 5KYIA 1N9WA 1RHPA 3VYSA 2L9HA 3J81c 1I4GA 1QCBD 2UU9L 2PCFB 2FHTA 2J0TD 1D7QA 3EIVA 3KF6B 3DEOA 2B8GA 5C0XG 1QZGA 4X3UA 1EIGA 3D4RA 3KK7A 2Q2UA 4DR4L 4C2MB 3GTMB 4RKBA 2WB1B 1S40A 4C3IB 3TREA 4YCUA 1BBWA 1U4LA 1WTVA 3F8TA 4DR2Q 3EJIA 4AQYQ 1VQNA 1GUGA 3FKIG 3ERQA 4WRDA 1MJEA 3RLOA 4OO1I 3NQTA 2Z4HA 1JE5A 1BO0A 1PRTB 2LS01 2YTVA 3K6OA 4NDXA 5ELOA 2FJ2A 5M5WB 3EN2A 2XWJB 4ZQ3A 3PO3H 2VW9A 1DOMA 3MEFA 4DGZA 1T5EA 3SDZA 1PDQA
chains in the Genus database with same CATH topology
2NVTH 3K7UC 3T1HL 5IP9G 2UUCL 3GTJH 3I4NH 1UE5A 5IP7G 4YY3L 5IYCH 3M7NA 1JJGA 1G51A 3HOYH 3GTMH 4AH6A 4A3MG 2F4VQ 1EUJA 4C3IH 4GLXA 2EQSA 4ALPA 2JA6H 5EAYA 3UE0A 1Q8KA 4YWMA 1IZ6A 3S16H 4HJAA 1EQQA 4OONA 4HJ9A 1YHBA 2CWPA 3KF8B 3ULPA 2NVXH 5LMNQ 2K50A 1VQ8A 4Y52H 1VQEA 2R93G 4DR3Q 5M5YH 3CCJA 1AE3A 1FVIA 1UWVA 4DR2L 1NMFA 1TWAH 3JAMc 4BY7H 1PVOA 1LUZA 1TWFH 4BBRH 4BBSG 1HNWQ 3M9BA 1I94L 3S17H 2IT1A 4DK6C 1VQAA 1WI5A 4DV7L 1G291 2D62A 2XTIA 5M5WH 1XPOA 2UUBQ 1A62A 1XMOQ 2KCTA 2Q2TA 3I55A 4R4OA 1Z47A 3CC2A 5JJLA 1C0AA 2ZTCA 1UEBA 4GOPC 1YJNA 1Q1EA 1KRTA 3L2PA 4A3JH 1PH7A 4NXMQ 4GLAC 3GTKH 4DR6L 4LWCA 3CCUA 4LFBQ 1B70B 1A8VA 1KQSA 1GD7A 4A3LG 1RIPA 2A1AA 4FDBA 3RLFA 4QGUA 2JA8G 3PCOB 3VDYA 4DV5Q 3JC66 3ULJA 4IOAA 2AKWB 3S15H 1GKHA 4NXNL 1HJPA 3D0FA 3RR5A 1VQIA 2OQKA 1Y1WG 1UE1A 2JK8A 1VQLA 2VQEL 4DV3L 4GKKQ 1EOVA 1PYBA 2F52A 3H0GH 3SGIA 3NEMA 4DV6Q 2MQHA 5GAGC 5IY0A 2HHHQ 3CW2C 4JI4Q 3H3VH 2VS1A 1VQMA 4A3GH 5GAHC 2F4VL 4GN5A 5FLMH 1VS0A 3S1MH 2YYZA 3HKZE 3I2ZA 5ELNA 1VQDA 2NZHA 1YZ6A 4JCVE 1PH4A 2R6GA 1YJWA 4LF7Q 4IJLA 4JYAQ 4JV5Q 4LF8Q 1BKBA 2C35B 1Q86C 2Q2IA 4GS3A 4GNXC 4P73A 3PO3G 3UE1A 5C4JH 3H3VI 1O7IA 4HJ7A 1IL2A 1HNXQ 5LMNL 4BXXH 2AMCB 2E2IH 3NELA 3HFZB 4IO9A 4DR3L 4OX9Q 2RF4A 4GOPA 4LW1A 3GTQH 1MJCA 1FL0A 1JJCB 1GO3E 3S1NH 1V1QA 3I4NG 2K5NA 3HOYG 1YBYA 3UDIA 1FJGL 4UPAA 4DV0L 2UUBL 2ZJPA 2VUMG 1XNQQ 3B6YA 4X66Q 1X3EA 1V9PA 1TWGH 1VQOA 3PV0A 1T9HA 3HOXG 2XGTA 3AQQA 5IYDH 4ME3A 1WFQA 2GVBA 2VZAA 3CP0A 4PZ8A 4JI0Q 3S2DH 2VQFQ 2JA5H 3KFUA 1HR0Q 4PZ6A 3CF5A 2KBNA 1ASYA 1L1OC 3PF4A 2CKZB 4DK3C 5IYBH 3KF6A 3CD6A 3RZOH 3S14H 2E2JH 4BBRG 1QZHA 4YWKA 3G71A 1LM0A 4X62Q 4GNXA 2HQLA 4LFAL 2K52A 2K14A 1L2FA 4JI4L 2CQOA 4C3JH 4A3EG 2HHHL 2ID0A 4UP8A 1KC8C 2N3SA 1X56A 1KHIA 3ICEA 2JE6I 2UUAL 4A3JG 2NZOA 2K5VA 4DV2Q 2E5LQ 1VCIA 4X6AH 4JBWA 1PH2A 5M5XH 3G48A 3J7ZC 1ASZA 1V43A 1X3GA 2RHSB 3CCRA 2Y0SG 3I56A 2IHFA 1HZBA 1XMQL 1NJIC 4QQBX 3PGZA 3I4MH 2LSSA 3BZKA 3F2BA 3CC4A 1X9NA 3CCSA 4HIKA 4IPDA 4JI6Q 5C44H 4X64Q 3WWVA 4APVA 2QEXA 1BVSA 1YHQA 4A3GG 2NN6I 5J3BA 1CKOA 1L1OA 1G6PA 1UE7A 5FLMG 3KDFA 2N49A 3L7ZC 1XNQL 1U5KA 4X66L 2PQAA 1Z9FA 4J15A 4C2MH 5IT9c 1XJVA 4LF4Q 2IX1A 1VQGA 4PMWA 4YHHQ 4LF9L 3A0JA 5DLQE 2CFMA 4R1JA 4L5QA 4BA2I 1WCMH 2AWNA 3K7AH 4H02A 4MTNA 4POGA 4DR7Q 1VQ9A 2UXDQ 1VQ7A 4JI0L 2UXCQ 3MXNB 3AFQA 4BXXG 2VQFL 3GO5A 4LFCQ 1CKNB 1HR0L 4GKJQ 1HR0W 4BY1G 1B8AA 3W1GA 3D31A 3TS0A 1X54A 3F2CA 4JBMA 1PFSA 2PMZE 2RHQB 1Y1VH 4B3TQ 1R9TH 4A93H 1I6HH 4DV4Q 3FP9A 3K0XA 1U0LA 4DPGA 3G4SA 2CWAA 4A3BH 5AJ3Q 2E8GA 3UDXA 4AQYL 5E7NA 4PZ7A 1K83H 4DUZQ 2LXKA 1Q81C 1I50H 1IBMQ 2IHEA 2R7FA 4MNOA 4HIOA 4B3RQ 4LNQA 2YU9H 1E22A 2E5LL 3CCVA 1OXXK 2QA4A 1QVFA 5IYDG 1I3QH 2JQOA 2PNHA 3PIPA 2B63H 3K8AA 1YHAA 4KI0A 1N34Q 2JA5G 2VNUD 3U50C 3J81i 1K9MC 3OTOQ 5IYBG 3J80c 4DUYL 4A3CG 1KL9A 4JOIC 4OO1G 4IPHA 5C4XH 1IBKQ 1SROA 1QUQB 4DR1Q 3CCQA 4A76A 3E0EA 5HGQA 5HY6A 1QVCA 1YNXA 4XTCS 1PHJA 1K8AC 4X64L 1RL2A 2R92H 1OXTA 2R7ZG 4IFDG 5K36G 1Q7YC 5C0XI 1EQRA 1EYGA 3T1YQ 3PO2H 4R4TA 1X65A 1HH2P 4RG1A 3CPFA 4MZ9A 5GADC 4LF4L 1CSQA 1PH5A 4P75A 1XPUA 5GAEC 3FKIH 4A3IH 1D8LA 1MKHA 3M4OH 3GTLH 1W3SA 3PUZA 4DR7L 2UXDL 1YI2A 4X65Q 2UXCL 2BH2A 4LFCL 4DNIA 2V1CC 4GKJL 3CQZH 3ERSX 4QJFA 5JJKA 2WB1E 1YEZA 2B29A 3PSIA 3STBC 3ZJYC 5FJ8G 2Z6KC 4A3FH 2VY3A 3K81C 3CCMA 3STBD 5LMNW 2I5LX 1HZCA 4IJHA 2DGYA 2R7DA 4DKAC 2ATWA 3HOWG 4YWLA 3TRZA 1N36Q 4AYBE 4UY8C 1WOCA 3HKZG 3U4VA 1PH9A 1H95A 1HNWL 5IYCG 4JOIA 4DUZL 1IBML 2Z0SA 2DUDA 4JI1Q 1EFWA 5IP9H 2RCNA 1XMOL 2K5HA 1DGSA 4DV1Q 1J5EQ 4KHZA 2JA6G 1XPRA 1A63A 4IFDJ 4GOPB 4A3MH 4A75A 2Q2HA 3HOUH 4B3MQ 4DAMA 3G6EA 3KJPA 3L0OA 4NXML 3AEVA 1N33Q 4O2DA 2ES2A 1Y14B 3CCEA 3GTGH 4JC0A 2AHOB 4LFBL 4DR5Q 3HOVH 1PYSB 4JG2A 4A93G 1LYLA 4K0KQ 1S3OA 4DV5L 3KJOA 3U58A 4LUVA 2ZM6Q 2OWOA 4BY7G 1IYJB 3K80C 3TQYA 1E1TA 4RMFA 5M3MH 3T1YL 2MO1A 3AYHB 5GROA 2Z6KA 1SMXA 4JI7Q 1PV4A 4DAYB 4GKKL 3T1HQ 2UUCQ 2A19A 3RZDH 1XNRQ 3HOZH 3Q8DA 4NPSA 4YY3Q 4DV6L 4BBSH 2PI2E 3JAMi 4JI2Q 3M4QA 1KIXA 4Y7NH 2B63G 4TVAB 2L15A 3PUYA 1N32Q 1SRUA 3PUXA 4X65L 4JI6L 1PH3A 3PUVA 3U4ZA 4LF7L 1VQPA 4JV5L 4LF8L 5C4XG 3PUWA 1AE2A 2CCZA 1KXLA 4OWTB 5M3FH 2IX0A 3KLWA 1HNXL 2ZJRA 4JI8Q 4A3LH 4OX9L 3ULLA 2JA9A 1E3PA 1HNZQ 2JA8H 3PO2G 2WAQE 2WFWA 1L0WA 3H0GG 2E2HH 1Y1WH 1PH8A 1XTDA 4AIMA 3ER0A 3CMEA 4OXPA 4DV7Q 4A3IG 3GTPH 4P74A 1A0IA 1M1KC 1VQKA 5JJIA 1KD1C 4C3HH 2ZJQA 3A5ZB 1HZAA 1SE8A 1K8GA 3S1QH 1CKMA 3LGJA 4B3ML 4LF5Q 3TS2A 4A3FG 3AFPA 3S24A 3RNUA 1N33L 4OWWB 4DR6Q 4JI5Q 2EIFA 4P72A 2OQ0A 3KDFB 1IXRA 1E7ZA 1P16A 1SR3A 5LMUQ 2PQAB 3RLNA 4UP7A 2A8VA 2PI2A 1NBWA 4PG3A 3EBEA 1YVCA 3PF5A 2BH8A 4X62L 4JI7L 4O0AA 2VQEQ 4DV3Q 1NMGA 1WYDA 1YITA 1VQ5A 1XNRL 2JA7H 3M3YH 2GN5A 2QGQA 1WJJA 3HKSA 1E1OA 4JI2L 2HIXA 4OWXB 1VQJA 3NENA 3GD7A 3HOUG 1VQFA 1MIUA 2VUMH 1KRSA 1N32L 4DV2L 1W2BA 2H5XA 2JEBI 1J6QA 3W1BA 4EQ5A 4L5SA 2VL6A 3HOXH 2HT1A 3HOVG 4A3DH 1KAWA 4TQUS 4R4QA 4JBJA 1E24A 1NY4A 3NBHB 1AH9A 4GN4B 5C3EH 2KHIA 3RN2A 2OTJA 4JI8L 1VQ4A 3BZCA 1QVGA 1IBLQ 1HNZL 1TWHH 5M3MG 4NB3A 4R4CA 1P8LA 3CPWA 1Q1BA 2N78A 3KYHC 3S2HH 3HOZG 4BA1I 1NTGA 2KCMA 2D0OA 2YTYA 3BU2A 5IWAQ 3OYYA 1FJGQ 4DV0Q 4P71A 1QUQA 4A3EH 4KLKA 3RN5A 2UU9Q 4IPGA 2UXBQ 4LUZA 4YHHL 4LF5L 2JEAI 1VQHA 1K0RA 4YCVA 4HIDA 2ASBA 2KHJA 1FGUA 3GTOH 1NE3A 2FXQA 2NN6G 2F3IA 2ZTDA 5M3FG 1JT8A 4JI5L 1S72A 3DLLA 2N8NA 2K4KA 2EXDA 3S1RH 3I4MG 3CCLA 4DR4Q 3CMAA 5LMUL 2AWOA 4POFA 3A5UA 3CXCA 4KHPQ 3F2DA 4A3KH 5BR8Q 5IE8A 5C44G 1C9OA 3CC7A 3F1ZA 4B3TL 3E9IA 1GVPA 1OXVA 4DV4L 4JI3Q 4LFAQ 1N8RC 1OXUA 1PH6A 3M4PA 1I5FA 3UDFA 5H1SE 1CUKA 5AJ3L 4LF6Q 2I5HA 2K75A 2YTXA 2MNAA 1JJ2A 4XIGS 4B3RL 1EIFA 2WB1G 3GDEA 2YV5A 1Q46A 2UUAQ 5IP7H 1WCMG 2GVAA 1LTLA 1TWCH 4L5TA 1N34L 1CSPA 4HJ5A 1HZ9A 3DM3A 3IRBA 3BJUA 2BA1A 4AYBG 2I5MX 4UP9A 3OTOL 4HJ8A 1XMQQ 4GLVB 4QY7A 3W5OA 1Q82C 1IBLL 1Y1VG 1IBKL 4B3SQ 4BY1H 3E9HA 4GN3B 1EIYB 4DR1L 3PIOA 4JBKA 2BA0A 1OTCA 2KENA 2MFIA 3J81j 1PA6A 1GM5A 2JA7G 2ALYB 1YJ9A 4YCWA 5JEAG 5GQOA 4A3BG 2R93H 3KOJA 4HIMA 1SFOH 4IOCA 5IWAL 1JB7A 2MO0A 3A74A 1N9WA 1EWIA 4L5RC 1X3FA 3J81c 2UU9L 1M90C 2UXBL 2HIVA 4A3DG 4LF9Q 1D7QA 3EIVA 3KF6B 4QIWE 5C0XG 1YIJA 1X55A 1QZGA 5C3EG 1JMCA 2OCEA 4GNXB 1C7YA 4WJ3M 2Q2UA 2OTLA 4DR4L 2JJQA 4KHPL 1K73C 4A3CH 4EX5A 5BR8L 1SN8A 1S40A 2R92G 1X6OA 4JI3L 1UE6A 3TREA 4YCUA 1BBWA 3J80i 3OW2A 3F8TA 1N36L 1VQ6A 2NVQH 4DR2Q 1TXYA 2Y0SE 2IY5B 5FLXc 2LXJA 2ZTEA 3I7FA 3H15A 4LF6L 2R7ZH 3CAMA 1OXSC 4AQYQ 1PH1A 1I94Q 1VQNA 1K3RA 2NVYH 3FKIG 1MJEA 4QL5A 4JI1L 3M85A 3RLOA 3FHWA 4OO1I 4DV1L 1J5EL 1JE5A 3I4OA 1B7YB 2D0PA 5JEAJ 2YTVA 4IFDI 3J7A5 1VQBA 1SLJA 2WAQG 3TEHB 4DUYQ 5ELOA 4A3KG 4DR5L 1L1OB 3EN2A 4B3SL 5FJ8H 3PO3H 4K0KL 2VW9A 1VQCA 3MEFA 2ZM6L 5C0XJ 3UDGA 4IPCA 4LUOA 4R4IA 4A4IA 2I0QA 4JYAL 1BBUA 3HOWH 4NXNQ 2WP8J 4WJ4A 1Q12A 1CKNA 2B3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVT H;  3K7U C;  3T1H L;  5IP9 G;  2UUC L;  3GTJ H;  3I4N H;  1UE5 A;  5IP7 G;  4YY3 L;  5IYC H;  3M7N A;  1JJG A;  1G51 A;  3HOY H;  3GTM H;  4AH6 A;  4A3M G;  2F4V Q;  1EUJ A;  4C3I H;  4GLX A;  2EQS A;  4ALP A;  2JA6 H;  5EAY A;  3UE0 A;  1Q8K A;  4YWM A;  1IZ6 A;  3S16 H;  4HJA A;  1EQQ A;  4OON A;  4HJ9 A;  1YHB A;  2CWP A;  3KF8 B;  3ULP A;  2NVX H;  5LMN Q;  2K50 A;  1VQ8 A;  4Y52 H;  1VQE A;  2R93 G;  4DR3 Q;  5M5Y H;  3CCJ A;  1AE3 A;  1FVI A;  1UWV A;  4DR2 L;  1NMF A;  1TWA H;  3JAM c;  4BY7 H;  1PVO A;  1LUZ A;  1TWF H;  4BBR H;  4BBS G;  1HNW Q;  3M9B A;  1I94 L;  3S17 H;  2IT1 A;  4DK6 C;  1VQA A;  1WI5 A;  4DV7 L;  1G29 1;  2D62 A;  2XTI A;  5M5W H;  1XPO A;  2UUB Q;  1A62 A;  1XMO Q;  2KCT A;  2Q2T A;  3I55 A;  4R4O A;  1Z47 A;  3CC2 A;  5JJL A;  1C0A A;  2ZTC A;  1UEB A;  4GOP C;  1YJN A;  1Q1E A;  1KRT A;  3L2P A;  4A3J H;  1PH7 A;  4NXM Q;  4GLA C;  3GTK H;  4DR6 L;  4LWC A;  3CCU A;  4LFB Q;  1B70 B;  1A8V A;  1KQS A;  1GD7 A;  4A3L G;  1RIP A;  2A1A A;  4FDB A;  3RLF A;  4QGU A;  2JA8 G;  3PCO B;  3VDY A;  4DV5 Q;  3JC6 6;  3ULJ A;  4IOA A;  2AKW B;  3S15 H;  1GKH A;  4NXN L;  1HJP A;  3D0F A;  3RR5 A;  1VQI A;  2OQK A;  1Y1W G;  1UE1 A;  2JK8 A;  1VQL A;  2VQE L;  4DV3 L;  4GKK Q;  1EOV A;  1PYB A;  2F52 A;  3H0G H;  3SGI A;  3NEM A;  4DV6 Q;  2MQH A;  5GAG C;  5IY0 A;  2HHH Q;  3CW2 C;  4JI4 Q;  3H3V H;  2VS1 A;  1VQM A;  4A3G H;  5GAH C;  2F4V L;  4GN5 A;  5FLM H;  1VS0 A;  3S1M H;  2YYZ A;  3HKZ E;  3I2Z A;  5ELN A;  1VQD A;  2NZH A;  1YZ6 A;  4JCV E;  1PH4 A;  2R6G A;  1YJW A;  4LF7 Q;  4IJL A;  4JYA Q;  4JV5 Q;  4LF8 Q;  1BKB A;  2C35 B;  1Q86 C;  2Q2I A;  4GS3 A;  4GNX C;  4P73 A;  3PO3 G;  3UE1 A;  5C4J H;  3H3V I;  1O7I A;  4HJ7 A;  1IL2 A;  1HNX Q;  5LMN L;  4BXX H;  2AMC B;  2E2I H;  3NEL A;  3HFZ B;  4IO9 A;  4DR3 L;  4OX9 Q;  2RF4 A;  4GOP A;  4LW1 A;  3GTQ H;  1MJC A;  1FL0 A;  1JJC B;  1GO3 E;  3S1N H;  1V1Q A;  3I4N G;  2K5N A;  3HOY G;  1YBY A;  3UDI A;  1FJG L;  4UPA A;  4DV0 L;  2UUB L;  2ZJP A;  2VUM G;  1XNQ Q;  3B6Y A;  4X66 Q;  1X3E A;  1V9P A;  1TWG H;  1VQO A;  3PV0 A;  1T9H A;  3HOX G;  2XGT A;  3AQQ A;  5IYD H;  4ME3 A;  1WFQ A;  2GVB A;  2VZA A;  3CP0 A;  4PZ8 A;  4JI0 Q;  3S2D H;  2VQF Q;  2JA5 H;  3KFU A;  1HR0 Q;  4PZ6 A;  3CF5 A;  2KBN A;  1ASY A;  1L1O C;  3PF4 A;  2CKZ B;  4DK3 C;  5IYB H;  3KF6 A;  3CD6 A;  3RZO H;  3S14 H;  2E2J H;  4BBR G;  1QZH A;  4YWK A;  3G71 A;  1LM0 A;  4X62 Q;  4GNX A;  2HQL A;  4LFA L;  2K52 A;  2K14 A;  1L2F A;  4JI4 L;  2CQO A;  4C3J H;  4A3E G;  2HHH L;  2ID0 A;  4UP8 A;  1KC8 C;  2N3S A;  1X56 A;  1KHI A;  3ICE A;  2JE6 I;  2UUA L;  4A3J G;  2NZO A;  2K5V A;  4DV2 Q;  2E5L Q;  1VCI A;  4X6A H;  4JBW A;  1PH2 A;  5M5X H;  3G48 A;  3J7Z C;  1ASZ A;  1V43 A;  1X3G A;  2RHS B;  3CCR A;  2Y0S G;  3I56 A;  2IHF A;  1HZB A;  1XMQ L;  1NJI C;  4QQB X;  3PGZ A;  3I4M H;  2LSS A;  3BZK A;  3F2B A;  3CC4 A;  1X9N A;  3CCS A;  4HIK A;  4IPD A;  4JI6 Q;  5C44 H;  4X64 Q;  3WWV A;  4APV A;  2QEX A;  1BVS A;  1YHQ A;  4A3G G;  2NN6 I;  5J3B A;  1CKO A;  1L1O A;  1G6P A;  1UE7 A;  5FLM G;  3KDF A;  2N49 A;  3L7Z C;  1XNQ L;  1U5K A;  4X66 L;  2PQA A;  1Z9F A;  4J15 A;  4C2M H;  5IT9 c;  1XJV A;  4LF4 Q;  2IX1 A;  1VQG A;  4PMW A;  4YHH Q;  4LF9 L;  3A0J A;  5DLQ E;  2CFM A;  4R1J A;  4L5Q A;  4BA2 I;  1WCM H;  2AWN A;  3K7A H;  4H02 A;  4MTN A;  4POG A;  4DR7 Q;  1VQ9 A;  2UXD Q;  1VQ7 A;  4JI0 L;  2UXC Q;  3MXN B;  3AFQ A;  4BXX G;  2VQF L;  3GO5 A;  4LFC Q;  1CKN B;  1HR0 L;  4GKJ Q;  1HR0 W;  4BY1 G;  1B8A A;  3W1G A;  3D31 A;  3TS0 A;  1X54 A;  3F2C A;  4JBM A;  1PFS A;  2PMZ E;  2RHQ B;  1Y1V H;  4B3T Q;  1R9T H;  4A93 H;  1I6H H;  4DV4 Q;  3FP9 A;  3K0X A;  1U0L A;  4DPG A;  3G4S A;  2CWA A;  4A3B H;  5AJ3 Q;  2E8G A;  3UDX A;  4AQY L;  5E7N A;  4PZ7 A;  1K83 H;  4DUZ Q;  2LXK A;  1Q81 C;  1I50 H;  1IBM Q;  2IHE A;  2R7F A;  4MNO A;  4HIO A;  4B3R Q;  4LNQ A;  2YU9 H;  1E22 A;  2E5L L;  3CCV A;  1OXX K;  2QA4 A;  1QVF A;  5IYD G;  1I3Q H;  2JQO A;  2PNH A;  3PIP A;  2B63 H;  3K8A A;  1YHA A;  4KI0 A;  1N34 Q;  2JA5 G;  2VNU D;  3U50 C;  3J81 i;  1K9M C;  3OTO Q;  5IYB G;  3J80 c;  4DUY L;  4A3C G;  1KL9 A;  4JOI C;  4OO1 G;  4IPH A;  5C4X H;  1IBK Q;  1SRO A;  1QUQ B;  4DR1 Q;  3CCQ A;  4A76 A;  3E0E A;  5HGQ A;  5HY6 A;  1QVC A;  1YNX A;  4XTC S;  1PHJ A;  1K8A C;  4X64 L;  1RL2 A;  2R92 H;  1OXT A;  2R7Z G;  4IFD G;  5K36 G;  1Q7Y C;  5C0X I;  1EQR A;  1EYG A;  3T1Y Q;  3PO2 H;  4R4T A;  1X65 A;  1HH2 P;  4RG1 A;  3CPF A;  4MZ9 A;  5GAD C;  4LF4 L;  1CSQ A;  1PH5 A;  4P75 A;  1XPU A;  5GAE C;  3FKI H;  4A3I H;  1D8L A;  1MKH A;  3M4O H;  3GTL H;  1W3S A;  3PUZ A;  4DR7 L;  2UXD L;  1YI2 A;  4X65 Q;  2UXC L;  2BH2 A;  4LFC L;  4DNI A;  2V1C C;  4GKJ L;  3CQZ H;  3ERS X;  4QJF A;  5JJK A;  2WB1 E;  1YEZ A;  2B29 A;  3PSI A;  3STB C;  3ZJY C;  5FJ8 G;  2Z6K C;  4A3F H;  2VY3 A;  3K81 C;  3CCM A;  3STB D;  5LMN W;  2I5L X;  1HZC A;  4IJH A;  2DGY A;  2R7D A;  4DKA C;  2ATW A;  3HOW G;  4YWL A;  3TRZ A;  1N36 Q;  4AYB E;  4UY8 C;  1WOC A;  3HKZ G;  3U4V A;  1PH9 A;  1H95 A;  1HNW L;  5IYC G;  4JOI A;  4DUZ L;  1IBM L;  2Z0S A;  2DUD A;  4JI1 Q;  1EFW A;  5IP9 H;  2RCN A;  1XMO L;  2K5H A;  1DGS A;  4DV1 Q;  1J5E Q;  4KHZ A;  2JA6 G;  1XPR A;  1A63 A;  4IFD J;  4GOP B;  4A3M H;  4A75 A;  2Q2H A;  3HOU H;  4B3M Q;  4DAM A;  3G6E A;  3KJP A;  3L0O A;  4NXM L;  3AEV A;  1N33 Q;  4O2D A;  2ES2 A;  1Y14 B;  3CCE A;  3GTG H;  4JC0 A;  2AHO B;  4LFB L;  4DR5 Q;  3HOV H;  1PYS B;  4JG2 A;  4A93 G;  1LYL A;  4K0K Q;  1S3O A;  4DV5 L;  3KJO A;  3U58 A;  4LUV A;  2ZM6 Q;  2OWO A;  4BY7 G;  1IYJ B;  3K80 C;  3TQY A;  1E1T A;  4RMF A;  5M3M H;  3T1Y L;  2MO1 A;  3AYH B;  5GRO A;  2Z6K A;  1SMX A;  4JI7 Q;  1PV4 A;  4DAY B;  4GKK L;  3T1H Q;  2UUC Q;  2A19 A;  3RZD H;  1XNR Q;  3HOZ H;  3Q8D A;  4NPS A;  4YY3 Q;  4DV6 L;  4BBS H;  2PI2 E;  3JAM i;  4JI2 Q;  3M4Q A;  1KIX A;  4Y7N H;  2B63 G;  4TVA B;  2L15 A;  3PUY A;  1N32 Q;  1SRU A;  3PUX A;  4X65 L;  4JI6 L;  1PH3 A;  3PUV A;  3U4Z A;  4LF7 L;  1VQP A;  4JV5 L;  4LF8 L;  5C4X G;  3PUW A;  1AE2 A;  2CCZ A;  1KXL A;  4OWT B;  5M3F H;  2IX0 A;  3KLW A;  1HNX L;  2ZJR A;  4JI8 Q;  4A3L H;  4OX9 L;  3ULL A;  2JA9 A;  1E3P A;  1HNZ Q;  2JA8 H;  3PO2 G;  2WAQ E;  2WFW A;  1L0W A;  3H0G G;  2E2H H;  1Y1W H;  1PH8 A;  1XTD A;  4AIM A;  3ER0 A;  3CME A;  4OXP A;  4DV7 Q;  4A3I G;  3GTP H;  4P74 A;  1A0I A;  1M1K C;  1VQK A;  5JJI A;  1KD1 C;  4C3H H;  2ZJQ A;  3A5Z B;  1HZA A;  1SE8 A;  1K8G A;  3S1Q H;  1CKM A;  3LGJ A;  4B3M L;  4LF5 Q;  3TS2 A;  4A3F G;  3AFP A;  3S24 A;  3RNU A;  1N33 L;  4OWW B;  4DR6 Q;  4JI5 Q;  2EIF A;  4P72 A;  2OQ0 A;  3KDF B;  1IXR A;  1E7Z A;  1P16 A;  1SR3 A;  5LMU Q;  2PQA B;  3RLN A;  4UP7 A;  2A8V A;  2PI2 A;  1NBW A;  4PG3 A;  3EBE A;  1YVC A;  3PF5 A;  2BH8 A;  4X62 L;  4JI7 L;  4O0A A;  2VQE Q;  4DV3 Q;  1NMG A;  1WYD A;  1YIT A;  1VQ5 A;  1XNR L;  2JA7 H;  3M3Y H;  2GN5 A;  2QGQ A;  1WJJ A;  3HKS A;  1E1O A;  4JI2 L;  2HIX A;  4OWX B;  1VQJ A;  3NEN A;  3GD7 A;  3HOU G;  1VQF A;  1MIU A;  2VUM H;  1KRS A;  1N32 L;  4DV2 L;  1W2B A;  2H5X A;  2JEB I;  1J6Q A;  3W1B A;  4EQ5 A;  4L5S A;  2VL6 A;  3HOX H;  2HT1 A;  3HOV G;  4A3D H;  1KAW A;  4TQU S;  4R4Q A;  4JBJ A;  1E24 A;  1NY4 A;  3NBH B;  1AH9 A;  4GN4 B;  5C3E H;  2KHI A;  3RN2 A;  2OTJ A;  4JI8 L;  1VQ4 A;  3BZC A;  1QVG A;  1IBL Q;  1HNZ L;  1TWH H;  5M3M G;  4NB3 A;  4R4C A;  1P8L A;  3CPW A;  1Q1B A;  2N78 A;  3KYH C;  3S2H H;  3HOZ G;  4BA1 I;  1NTG A;  2KCM A;  2D0O A;  2YTY A;  3BU2 A;  5IWA Q;  3OYY A;  1FJG Q;  4DV0 Q;  4P71 A;  1QUQ A;  4A3E H;  4KLK A;  3RN5 A;  2UU9 Q;  4IPG A;  2UXB Q;  4LUZ A;  4YHH L;  4LF5 L;  2JEA I;  1VQH A;  1K0R A;  4YCV A;  4HID A;  2ASB A;  2KHJ A;  1FGU A;  3GTO H;  1NE3 A;  2FXQ A;  2NN6 G;  2F3I A;  2ZTD A;  5M3F G;  1JT8 A;  4JI5 L;  1S72 A;  3DLL A;  2N8N A;  2K4K A;  2EXD A;  3S1R H;  3I4M G;  3CCL A;  4DR4 Q;  3CMA A;  5LMU L;  2AWO A;  4POF A;  3A5U A;  3CXC A;  4KHP Q;  3F2D A;  4A3K H;  5BR8 Q;  5IE8 A;  5C44 G;  1C9O A;  3CC7 A;  3F1Z A;  4B3T L;  3E9I A;  1GVP A;  1OXV A;  4DV4 L;  4JI3 Q;  4LFA Q;  1N8R C;  1OXU A;  1PH6 A;  3M4P A;  1I5F A;  3UDF A;  5H1S E;  1CUK A;  5AJ3 L;  4LF6 Q;  2I5H A;  2K75 A;  2YTX A;  2MNA A;  1JJ2 A;  4XIG S;  4B3R L;  1EIF A;  2WB1 G;  3GDE A;  2YV5 A;  1Q46 A;  2UUA Q;  5IP7 H;  1WCM G;  2GVA A;  1LTL A;  1TWC H;  4L5T A;  1N34 L;  1CSP A;  4HJ5 A;  1HZ9 A;  3DM3 A;  3IRB A;  3BJU A;  2BA1 A;  4AYB G;  2I5M X;  4UP9 A;  3OTO L;  4HJ8 A;  1XMQ Q;  4GLV B;  4QY7 A;  3W5O A;  1Q82 C;  1IBL L;  1Y1V G;  1IBK L;  4B3S Q;  4BY1 H;  3E9H A;  4GN3 B;  1EIY B;  4DR1 L;  3PIO A;  4JBK A;  2BA0 A;  1OTC A;  2KEN A;  2MFI A;  3J81 j;  1PA6 A;  1GM5 A;  2JA7 G;  2ALY B;  1YJ9 A;  4YCW A;  5JEA G;  5GQO A;  4A3B G;  2R93 H;  3KOJ A;  4HIM A;  1SFO H;  4IOC A;  5IWA L;  1JB7 A;  2MO0 A;  3A74 A;  1N9W A;  1EWI A;  4L5R C;  1X3F A;  3J81 c;  2UU9 L;  1M90 C;  2UXB L;  2HIV A;  4A3D G;  4LF9 Q;  1D7Q A;  3EIV A;  3KF6 B;  4QIW E;  5C0X G;  1YIJ A;  1X55 A;  1QZG A;  5C3E G;  1JMC A;  2OCE A;  4GNX B;  1C7Y A;  4WJ3 M;  2Q2U A;  2OTL A;  4DR4 L;  2JJQ A;  4KHP L;  1K73 C;  4A3C H;  4EX5 A;  5BR8 L;  1SN8 A;  1S40 A;  2R92 G;  1X6O A;  4JI3 L;  1UE6 A;  3TRE A;  4YCU A;  1BBW A;  3J80 i;  3OW2 A;  3F8T A;  1N36 L;  1VQ6 A;  2NVQ H;  4DR2 Q;  1TXY A;  2Y0S E;  2IY5 B;  5FLX c;  2LXJ A;  2ZTE A;  3I7F A;  3H15 A;  4LF6 L;  2R7Z H;  3CAM A;  1OXS C;  4AQY Q;  1PH1 A;  1I94 Q;  1VQN A;  1K3R A;  2NVY H;  3FKI G;  1MJE A;  4QL5 A;  4JI1 L;  3M85 A;  3RLO A;  3FHW A;  4OO1 I;  4DV1 L;  1J5E L;  1JE5 A;  3I4O A;  1B7Y B;  2D0P A;  5JEA J;  2YTV A;  4IFD I;  3J7A 5;  1VQB A;  1SLJ A;  2WAQ G;  3TEH B;  4DUY Q;  5ELO A;  4A3K G;  4DR5 L;  1L1O B;  3EN2 A;  4B3S L;  5FJ8 H;  3PO3 H;  4K0K L;  2VW9 A;  1VQC A;  3MEF A;  2ZM6 L;  5C0X J;  3UDG A;  4IPC A;  4LUO A;  4R4I A;  4A4I A;  2I0Q A;  4JYA L;  1BBU A;  3HOW H;  4NXN Q;  2WP8 J;  4WJ4 A;  1Q12 A;  1CKN A;  2B3G A; 
#chains in the Genus database with same CATH topology
 3K7U C;  1QG7 A;  2Q8I B;  2UUC L;  3I4N H;  5C4X B;  4YY3 L;  4IUP A;  3GTM H;  4A3M G;  1CFM A;  2R92 B;  2EDG A;  4C3I H;  2EQS A;  2DY8 A;  4YWM A;  3NK9 A;  1S5C D;  3R2T A;  4OON A;  1JWU D;  3ULP A;  2K50 A;  3OIQ A;  3GTL B;  4G57 A;  1JOR A;  1C4Q A;  4DR2 L;  1NMF A;  5I9O A;  3OSO A;  1TWF H;  1W6K A;  3CQZ B;  3NBH A;  2WAQ B;  1WI5 A;  2D62 A;  3M7G A;  5M5W H;  1XMO Q;  1I4Q A;  2Q2T A;  1Z47 A;  1STG A;  1DYQ A;  2ZTC A;  1PH7 A;  1YJN A;  1Q1E A;  3L2P A;  4GLA C;  2NBF A;  4LWC A;  1B70 B;  5I2Y A;  5G3L F;  1RIP A;  2A1A A;  4QGU A;  3VDY A;  2D5D A;  3S15 H;  1GKH A;  1U4M A;  4F88 A;  1HJP A;  1LTB D;  2RVL A;  3BDO A;  1VQI A;  1Y1W G;  1M8A A;  4CKE A;  4GKK Q;  1KAA A;  4JI4 Q;  2F52 A;  3SGI A;  3S1Q H;  5GAG C;  3CW2 C;  2VS1 A;  5IGE A;  3HKZ E;  5M3M B;  3I2Z A;  5ELN A;  1VQD A;  1PH4 A;  4LF7 Q;  3HOZ B;  3M4Y A;  1U4P A;  4LF8 Q;  1BKB A;  2C35 B;  3PO3 G;  2Q2I A;  4GNX C;  1UUP A;  4ABN A;  4HJ7 A;  1IL2 A;  2AMC B;  2E2I H;  3NEL A;  1TVX A;  4IO9 A;  3ND9 A;  2RF4 A;  5EBD A;  4LW1 A;  1FL0 A;  3I4N G;  2K5N A;  1YBY A;  2B2V A;  3VA7 A;  1FJG L;  1HPC A;  5JJZ A;  4N8F A;  1GXD C;  2VUM G;  3C1F A;  3I91 A;  3PV0 A;  5C44 B;  2ZT9 C;  2EYL A;  1SE3 A;  4ILW A;  4ME3 A;  2VZA A;  2A6E C;  1B2T A;  3S2D H;  3CF5 A;  1L1O C;  2ICI A;  4DK3 C;  3E0J A;  3CD6 A;  3DWP A;  1CQV A;  4F7X A;  2XNA C;  1QZH A;  3G71 A;  4EGV A;  1PXU A;  4R8N A;  4KKT A;  2K14 A;  4JI4 L;  2JXM B;  2DNC A;  4A3E G;  1SE4 A;  2ID0 A;  2F3V A;  4K5X A;  3ICE A;  2UUA L;  1IL8 A;  3DEP A;  2K5V A;  2E5L Q;  3BS1 A;  4X6A H;  1SEB D;  2JA7 B;  4A3B B;  3G48 A;  3M3Y B;  1ASZ A;  1X3G A;  2NN6 H;  3I56 A;  1HZB A;  2D2C C;  3A55 A;  3F2B A;  4XT1 B;  2BOS A;  3QOL A;  4A3D B;  4XQJ A;  5C44 H;  4DAP A;  4X64 Q;  1TY0 A;  2K5W A;  2QEX A;  5C3E B;  3KDF A;  1WTP A;  2NYZ D;  3FPU B;  2MP1 A;  1XYI A;  1STE A;  2VB3 X;  1AW7 A;  3MWY W;  2CFM A;  1F9Q A;  4MTN A;  4POG A;  2LMC B;  1VQ9 A;  1VQ7 A;  3AFQ A;  4LFC Q;  1F9R A;  2KOL A;  4GKJ Q;  1V1P A;  3H91 A;  4BY1 G;  1HR0 W;  3D31 A;  1SYG A;  4KY7 A;  1H9M A;  1AFP A;  1PFS A;  3FPP A;  2H1E A;  3G4S A;  4A3B H;  2HQE A;  3S1R B;  5JEA H;  3KF8 A;  4PZ7 A;  4FNF A;  4A3K B;  2F0G A;  4B3R Q;  1SDF A;  2E5L L;  3E6Z X;  2JQO A;  1ET6 A;  4XQN A;  3PIP A;  1HFG A;  1YHA A;  1N34 Q;  1IKM A;  5C3W A;  3FVQ A;  3K5L A;  3SVM A;  3OTO Q;  4DUY L;  3J80 c;  1Y69 U;  4HSP A;  1CZG A;  1MHW C;  3KBX A;  4OO1 G;  4IPH A;  1IBK Q;  4DU9 A;  3CCQ A;  4A76 A;  5HY6 A;  1QVC A;  1PHJ A;  4X64 L;  1RL2 A;  2KEC A;  4IZ8 A;  1X65 A;  1B53 A;  4RG1 A;  1PH5 A;  1HTL D;  1CA5 A;  2OEO A;  1ENF A;  3T51 B;  2R93 B;  2E75 C;  3QR8 A;  1FNU A;  4LFC L;  4DNI A;  2V1C C;  1PRT F;  4GKJ L;  1ZXT A;  4FVM A;  4F8M A;  4A3F H;  5FJ8 G;  4BBS B;  3ZJY C;  2VY3 A;  3K81 C;  2K5D A;  1A3U A;  1SNM A;  3MHB A;  4IJH A;  2DGY A;  1N36 Q;  1B1Z A;  2F0W A;  4AYB E;  3HKZ G;  1GOZ A;  1HNW L;  4KK7 A;  4U67 3;  1NR4 A;  2AUJ D;  1VDZ A;  1J5E Q;  1DD2 A;  1CQF A;  5FO9 B;  4IFD J;  2Q2H A;  2RA4 A;  4RKL A;  3HOU H;  4NXM L;  3L0O A;  3GTG H;  5DM6 3;  1PRT D;  1H9S A;  2EYM A;  2PZT A;  2EY1 A;  3HOV H;  1X3Q A;  4C3H B;  2F0D A;  4OEL B;  4DV5 L;  2OWO A;  4IQZ A;  3H09 A;  2ZM6 Q;  3AU7 A;  2MPM A;  4RMF A;  1EY7 A;  2Z6K A;  2NWG A;  4RAU C;  2AQ1 B;  4JI7 Q;  2AQ2 B;  4BBS H;  3Q8D A;  3BVM A;  4IAL A;  1PMR A;  3QJY A;  1ML0 D;  1RKN A;  1EWH A;  1HA5 A;  3URY A;  3K0Y A;  1YNJ D;  3WOF A;  4UAI A;  5ELB A;  4OL7 A;  5DNF A;  3PUV A;  2NVT B;  4JV5 L;  4DF7 A;  3PUW A;  2CCZ A;  2O4X A;  4OWT B;  1HNX L;  2HCC A;  2HUG A;  3CRL C;  5NUC A;  2RSN A;  1E3P A;  2F0E A;  2F0N A;  3Q22 A;  1RD9 D;  1EU4 A;  2NVX B;  3ER0 A;  4DV7 Q;  4P74 A;  5JJI A;  1KD1 C;  4C3H H;  4BY7 B;  3VYU A;  4BBR B;  4BWG B;  4A3F G;  3RNU A;  3S17 B;  4K2K A;  3TN2 A;  1KDA A;  3KDF B;  1IXR A;  1E7Z A;  1WTH A;  5LMU Q;  4UP7 A;  4PV1 C;  4LK1 C;  4IUT A;  1YVC A;  4A3J B;  2L0C A;  1PFB A;  1SXT A;  3T16 A;  4JI7 L;  4EVO A;  4XYQ A;  4FO2 A;  4DV3 Q;  3HP3 A;  5E3F A;  1V1P B;  1WJJ A;  3I72 A;  4PNY A;  3FEW X;  1D5X C;  5C3X A;  1SYF A;  3HOU G;  5CGK A;  4DV2 L;  3GQB A;  1W2B A;  3EVQ A;  1X3P A;  3GV6 A;  4NW2 A;  2HT1 A;  2HDM A;  3HOV G;  4H44 C;  1VMC A;  2FMC A;  3H0G B;  4R4Q A;  1HHV A;  2G9H D;  4A3G B;  2K32 A;  1UEA B;  4GN4 B;  1YNN C;  3BZC A;  1F2Y A;  1P8L A;  1ILQ A;  1Q1B A;  4C3J G;  5C4J B;  2KCM A;  2EYO A;  4KY5 A;  4DV0 Q;  4KD3 A;  1QUQ A;  3GTQ B;  3MXU A;  2EPB A;  5KIX A;  3S1N B;  2CW0 D;  5KNB A;  4HMJ A;  4YCV A;  1SJH D;  2KHJ A;  1SFO B;  1JOQ A;  2ZTD A;  1S72 A;  2KVM A;  3DLL A;  3I4M G;  1O7Y A;  5LMU L;  4ZK9 B;  3A54 A;  3CC7 A;  3F1Z A;  2A6H D;  1N8R C;  1OXU A;  1I5F A;  5CBE E;  1E2Z A;  1Z6H A;  1JJ2 A;  3J81 L;  3S14 B;  1R4P B;  2E2J B;  2YV5 A;  4FF3 A;  2GVA A;  1LTL A;  1J8I A;  1PTO C;  2R7Z B;  5D14 A;  2BA1 A;  4AYB G;  1NAP A;  2I5M X;  1ZEQ X;  2JP1 A;  2MUY A;  3D4W A;  1EY0 A;  3OMG A;  4B3S Q;  4DR1 L;  2DNE A;  5M5X B;  2FFK B;  2BA0 A;  3OPO A;  1PA6 A;  5KYL A;  1X32 A;  1SFO H;  3KLR A;  1X3F A;  2WKC A;  3I90 A;  4QUC A;  1CT1 D;  5CV6 A;  5C6A A;  4QIW E;  4MHE A;  1S4Z A;  2OCE A;  4ZCK A;  1C7Y A;  4JK1 C;  2OTL A;  1HA6 A;  3MA2 B;  3T4A C;  4A3C H;  5M9O A;  4U68 A;  2JA6 B;  1TU2 B;  2SDF A;  2NVQ H;  1TXY A;  2Y0S E;  4RGN A;  2R7Z H;  2ZTE A;  3I7F A;  1Q8I A;  1STY A;  1SNO A;  2BDN A;  5CBA E;  1CM9 A;  4FF4 A;  4I65 A;  1BUV T;  4JI1 L;  3M85 A;  1I6H B;  5JAV A;  3QOJ A;  1SNQ A;  1B7Y B;  2CQA A;  2D0P A;  4IUV A;  1HQM C;  5IOC A;  4DR5 L;  4B3S L;  2B63 B;  5C0X J;  4R4I A;  4CKC A;  2I0Q A;  5FOB B;  5LL6 S;  2PO4 A;  1QNU A;  2B3G A;  1U4R A;  5IP9 G;  3GTJ H;  4B08 A;  5IYC H;  1JJG A;  1A3T A;  1G51 A;  3HOY H;  1I4P A;  2F4V Q;  2F0L A;  2F3W A;  1EUJ A;  2RDH A;  5F2D A;  2JA6 H;  3MTS A;  3KLS X;  1B9N A;  1Q8K A;  2JYO A;  3P75 A;  1IZ6 A;  1D5Z C;  1EQQ A;  1EYC A;  4JVZ A;  3FKI B;  4HJ9 A;  2MJ8 A;  4RHS A;  1GUN A;  2QKI C;  1VQ8 A;  4ZUI A;  4I7A A;  4DR3 Q;  1FVI A;  4J8Q A;  1PVO A;  1LUZ A;  3H6M A;  4DK6 C;  4K2L A;  2EYJ A;  2X6G A;  2UUB Q;  2OT2 A;  2QCP X;  3I55 A;  3IAY A;  5JJL A;  1C0A A;  2F0P A;  5KNC A;  3C3L A;  5EGT A;  1C8C A;  4DR6 L;  3R8B A;  1MSG A;  4LFB Q;  2B39 A;  1KQS A;  2QIL A;  2JA8 G;  1EWC A;  3L3O C;  1ET9 A;  3VR4 A;  1KLG D;  4Z9C B;  3RR5 A;  2RKS A;  1SNP A;  1UE1 A;  2JK8 A;  1HUM A;  2ZXO A;  2IL8 A;  1EOV A;  4Y52 H;  1AP0 A;  1M4V A;  2MQH A;  3H3V H;  2F0H A;  3NHH A;  2SNM A;  5GAH C;  2F4V L;  3RZO B;  5I6W A;  2HDL A;  3S1M H;  3VA5 A;  3H94 A;  2NZH A;  1E2V A;  2PZU A;  1YZ6 A;  2HCI A;  1C48 A;  1STA A;  1YJW A;  3OHX C;  2RSO A;  1IW7 D;  3GV3 A;  3UE1 A;  4LJZ C;  3HFZ B;  5CV5 A;  5DM7 3;  4DR3 L;  4QF4 A;  4OX9 Q;  1MJC A;  4HR7 B;  5I2X A;  3OMC A;  3HOY G;  4UPA A;  2UUB L;  4P2C B;  1X3E A;  4NMZ A;  3JAM E;  3VR3 A;  1T9H A;  3NPP A;  1RJT A;  5I4D A;  2XGT A;  2F03 A;  1WTW A;  4DA2 A;  3AQQ A;  4FP5 D;  1Y1W B;  1AZQ A;  1WFQ A;  3CP0 A;  2KHS A;  1JR0 D;  2VQF Q;  2JA5 H;  3NTI A;  4PZ6 A;  1HR0 Q;  2KBN A;  1DOL A;  1ASY A;  3RZO H;  1O7L A;  1Y8P B;  4OIK A;  1GHJ A;  1WCM B;  2Z4I A;  1Y8O B;  1LM0 A;  4GNX A;  2K52 A;  5K36 H;  4DXG A;  1SJE D;  1D6E C;  4UP8 A;  5CV8 A;  2N3S A;  1X56 A;  5K5P A;  3ITP A;  3D3R A;  2JE6 I;  1Y1V B;  1A2U A;  2AUK A;  1R9T B;  2BCO A;  3J7Z C;  2WII B;  2IX3 A;  2RHS B;  2Y0S G;  4XQQ A;  1B50 A;  3PGZ A;  2OXP A;  2X6L A;  3BZK A;  2B2U C;  1X9N A;  1SAP A;  4G7O C;  2BE5 D;  1SNC A;  4APV A;  2NN6 I;  1CKO A;  1L1O A;  1B4O A;  4FXG C;  4H13 C;  2MHV A;  1LAB A;  2N49 A;  3I70 A;  1TWH B;  5IT9 c;  4J15 A;  4C2M H;  2IX1 A;  4PMW A;  2F1M A;  2E76 C;  4R1J A;  4L5Q A;  1WCM H;  2AWN A;  4H02 A;  2UXD Q;  1E2W A;  5IGG A;  1EIH A;  3J80 L;  2VQF L;  3GO5 A;  2XN9 C;  1HR0 L;  4A3E B;  4IUR A;  2WIN B;  3TS0 A;  4IUU A;  1QNK A;  3BDL A;  1Y1V H;  1R9T H;  1U0L A;  2CWA A;  5AJ3 Q;  3FRP B;  1STB A;  4AQY L;  2L5T A;  1IBM Q;  2EVB A;  2IHE A;  2R7F A;  4MNO A;  1JOK A;  1QJO A;  1E22 A;  3TP7 A;  3CCV A;  2JSO A;  3A56 A;  3K8A A;  4KI0 A;  2JA5 G;  2VNU D;  2VB2 X;  1O7Z A;  5J1Z A;  4TRD A;  3ONA B;  1RF2 D;  3HS0 C;  4IN3 A;  5C4X H;  1TWC B;  3E0E A;  5HGQ A;  2ZXP A;  2R92 H;  5K36 G;  1JIC A;  2A68 D;  2EYP A;  4R9W A;  4BY1 B;  1EY6 A;  1XPU A;  4K5V A;  1MKH A;  2EY5 A;  3GTL H;  1TT2 A;  2UXD L;  2A5H A;  4M1U B;  4C1N K;  2NZ1 D;  3CQZ H;  5JJK A;  3STB C;  3TRZ A;  3IFT A;  3U4V A;  4BS9 A;  1PH9 A;  1CI3 M;  2KED A;  5DEH A;  1IBM L;  1PLF A;  3T56 B;  2RCN A;  4C3I G;  1XMO L;  2K5H A;  1DGS A;  4DV1 Q;  4KHZ A;  1XPR A;  1A63 A;  4A75 A;  4M8A A;  4B3M Q;  3AEV A;  2XIW A;  2IJ0 A;  4O2D A;  5T1I A;  3Q24 A;  3DUZ A;  2XRS D;  1EQV A;  1ZKO A;  2J7Z A;  4K0K Q;  1SMY C;  3KJO A;  5D65 A;  1A15 A;  3K80 C;  3N6R A;  5E4X A;  5M3M H;  1Y8N B;  2F0U A;  2LY7 A;  1SMX A;  1PV4 A;  5EJW A;  4GKK L;  1MSH A;  3T1H Q;  3HOZ H;  2A19 A;  1RTO A;  4NPS A;  4G4K A;  3JAM i;  3SXH A;  1WTQ A;  2L15 A;  1N32 Q;  3PUX A;  4LF7 L;  3U4Z A;  4LF8 L;  1I4R A;  5C4X G;  2M9V A;  3A8I E;  2ZJR A;  5IGC A;  4A3L H;  2JA9 A;  2SOB A;  1TY2 A;  3DWQ A;  4OGQ C;  3HOX B;  1NR2 A;  2B2T C;  1XTD A;  4OXP A;  4WFN 3;  1M1K C;  5IGF A;  1VQK A;  4K6L A;  4CJ2 C;  2ZJQ A;  5M5Y B;  1BQQ T;  1TWA B;  1SYC A;  1ZYR C;  4KKU A;  4B3M L;  1OO9 B;  4LF5 Q;  2F0I A;  4X3T A;  3KUP A;  3VR2 A;  2A69 C;  2OQ0 A;  2LFN A;  3OWF A;  5C5M A;  3K5M A;  3K5O A;  2A8V A;  2XSC A;  1NBW A;  3GTK B;  3W2D A;  4QUF A;  3I8Z A;  2BDO A;  3MFY A;  2VQE Q;  1PZI D;  2JA7 H;  2VXW A;  1WYD A;  3M3Y H;  2GN5 A;  2QGQ A;  3P7J A;  1A2T A;  3NEN A;  1EL0 A;  3GD7 A;  1SYB A;  4CDF C;  1MIU A;  2O2L D;  4FF2 A;  1N32 L;  2H5X A;  3WOE A;  1NUC A;  4L5S A;  4A3D H;  3HOX H;  4XXE A;  1XWE A;  2I07 B;  1KAW A;  5BN3 A;  1E24 A;  1NY4 A;  3NBH B;  5C3E H;  2OTJ A;  3IFD A;  1VQ4 A;  4KN7 C;  1HRJ A;  1QVG A;  1IBL Q;  5M3M G;  5JVG 3;  4DN4 M;  4R4C A;  1PZK D;  3CPW A;  1CHP D;  1ESF A;  3I73 A;  3HOZ G;  2Z9H A;  2EYF A;  1NTG A;  3BU2 A;  5FK9 C;  1RCV D;  1BCP C;  1ROD A;  3D6C A;  1K28 A;  4KLK A;  3RN5 A;  2UXB Q;  4LUZ A;  4QB4 A;  4GZY C;  1H9R A;  4LF5 L;  1K0R A;  1FGU A;  1MGS A;  1NE3 A;  3R3O A;  2NN6 G;  3Q0A A;  4MTK A;  2EXD A;  3U9O A;  3S9W A;  3S1R H;  2B2V C;  1TWG B;  2K05 A;  1LTS D;  1PYW D;  4POF A;  3A5U A;  1EY4 A;  4ZUJ A;  4A3K H;  5BR8 Q;  5C44 G;  2EOT A;  1S5E D;  4LFA Q;  2CVR A;  1BNZ A;  3NUC A;  3M4P A;  3UDF A;  5H1S E;  4LF6 Q;  2I5H A;  2TMP A;  2IW3 A;  2YTX A;  4B3R L;  1ICF B;  3GDE A;  1Q46 A;  5IP7 H;  4K5W A;  2L55 A;  1IW7 C;  1N34 L;  1HZ9 A;  1PFN A;  3IRB A;  3BJU A;  1BXT A;  3OTO L;  3BZD B;  1MI2 A;  1XMQ Q;  4GLV B;  4QY7 A;  3W5O A;  1IBL L;  1RTN A;  1IBK L;  1R4Q B;  3DXJ C;  4GN3 B;  1EIY B;  2O5J C;  1EZ8 A;  2KEN A;  2MFI A;  5FO7 B;  4HCE A;  1GM5 A;  2JA7 G;  1YJ9 A;  4A3B G;  4YCW A;  5JEA G;  5GQO A;  2R93 H;  1VF7 A;  1EWI A;  4L5R C;  5CYU A;  3I4M B;  2UXB L;  4CDD C;  2HIV A;  4A3D G;  3A8J E;  4LF9 Q;  5EPL A;  3HOW B;  1YIJ A;  5LL6 X;  4L6T B;  5C3E G;  1JMC A;  4WJ3 M;  4CDE C;  2XVS A;  1K73 C;  4EX5 A;  5BR8 L;  3K7A B;  3K59 A;  1N36 L;  3X3M A;  1S5D D;  2I46 A;  4LF6 L;  3AB9 A;  4IFD H;  3S16 B;  3CAM A;  1OXS C;  4AYB B;  4KD4 A;  3ZYY X;  1I94 Q;  1K3R A;  1TS5 A;  4QL5 A;  1LAC A;  1KAB A;  1J5E L;  4A93 B;  3I4O A;  3SR1 A;  2K01 A;  2F0Q A;  1QB5 D;  2F0M A;  4PMB A;  3MAQ A;  1K83 B;  1VQB A;  3LX0 A;  3TEH B;  3J7A 5;  1O78 A;  4A3K G;  1NCV A;  2YU9 B;  1I3Q B;  2ZM6 L;  3UDG A;  1JCK B;  1CZW A;  2EJM A;  4HMI A;  3P1H A;  3HOW H;  4NXN Q;  2WP8 J;  3CKI B;  3MXN A;  1Q12 A;  4WJ4 A;  3HGB A;  2NVT H;  2F0V A;  2XWB B;  1UE5 A;  3TDQ A;  5IP7 G;  1G2T A;  1TKW B;  5C4H A;  4AH6 A;  3PO2 B;  4ALP A;  1JWS D;  5IOD A;  2QEJ C;  5EAY A;  3J81 E;  1GUT A;  5HUR A;  3HZX A;  3S16 H;  1FR3 A;  4KJO A;  1DZ1 A;  3KF8 B;  4A3I B;  1WVL A;  2NVX H;  1KDC A;  3FDT A;  3M4O B;  1VQE A;  2K7V A;  2R93 G;  3T13 A;  1AE3 A;  1UWV A;  3EA6 A;  4BY7 H;  2P5Z X;  4BBR H;  4BBS G;  1SE2 A;  1I94 L;  3S17 H;  4ZKB B;  1VQA A;  4DV7 L;  2XTI A;  2KCT A;  4DNT B;  3C2P A;  1T5X D;  3CC2 A;  3TME A;  2WKD A;  3OW7 A;  1UEB A;  4GOP C;  4NP5 A;  1KRT A;  3ERO A;  4A3J H;  1D2B A;  1FD7 D;  4WJW A;  1GHK A;  1GD7 A;  2A73 B;  4FDB A;  3RLF A;  1LT4 D;  3JC6 6;  4IOA A;  2AKW B;  4NXN L;  3D0F A;  2PMZ B;  4QCL A;  4DV3 L;  2EE1 A;  3H0G H;  1LTA D;  3NEM A;  4C3H G;  4DV6 Q;  5IY0 A;  4A3G H;  1EOT A;  1VQM A;  2PW5 A;  4GN5 A;  5FLM H;  2PQE A;  1BOS A;  4IJL A;  2SNS A;  4OIJ A;  1Q86 C;  4P73 A;  2Q8T A;  5C4J H;  3H3V I;  4Y7N B;  4BXX H;  5KEE A;  3Q23 A;  1DON A;  4KJN A;  3GTQ H;  5JPM C;  1JJC B;  1GO3 E;  1KNA A;  2DJG C;  3S1N H;  1V1Q A;  3DM1 A;  5M3F B;  3NQI A;  4DV0 L;  2EYH A;  1D1I A;  4PQX A;  1H9S B;  1XNQ Q;  2JA8 B;  1EZ6 A;  3LWU A;  1ENA A;  2K5Q A;  5IYD H;  1K0S A;  4HN7 A;  3GTP B;  4C56 C;  4EQN A;  2A6E D;  3PF4 A;  3KF6 A;  3IKJ A;  3S14 H;  1BDO A;  4ODG A;  2E2J H;  4BBR G;  1H9J A;  4X62 Q;  2HQL A;  4RGM A;  1S5B D;  3EQL C;  1L2F A;  1I4X A;  2OF1 A;  5IT9 L;  3D6W A;  3G6J B;  1AN8 A;  4A3J G;  2NZO A;  1PTO B;  1VCI A;  5JOB A;  1KLU D;  1HCZ A;  5M5X H;  4DK1 A;  1QOH A;  1V43 A;  1HXY D;  2IHF A;  2L4N A;  3NWT A;  3H3V C;  4XT3 B;  4RFB A;  2LSS A;  2B2Y C;  3TP5 A;  3TSS A;  3WWV A;  5ELE A;  4A3G G;  1VF5 C;  3W3A A;  5J3B A;  5FLM G;  1RDP D;  4WOR A;  1XNQ L;  2PQA A;  4LF4 Q;  4RWS C;  1JC7 A;  1G8Z D;  4YHH Q;  3A0J A;  1LO5 D;  3D4D A;  4MIU A;  4BA2 I;  4DR7 Q;  1MBY A;  2K03 A;  2UXC Q;  3MXN B;  4BXX G;  1XX8 A;  5ELD A;  1B8A A;  4V0B A;  4C1N I;  3SK5 A;  1DCZ A;  4B3T Q;  1G6Z A;  1I6H H;  5A2Q L;  4DV4 Q;  1LT6 D;  4DXF A;  1K8M A;  3UDX A;  1Q81 C;  5E7N A;  1LLR D;  1B3A A;  2Y0S B;  3I4L A;  5A35 A;  2B2U A;  4LNQ A;  2ENB A;  3GP7 A;  4H0L C;  5IYD G;  1BF4 A;  2PNH A;  5FLX E;  2B63 H;  5CR3 A;  3U50 C;  5C0X H;  3J81 i;  1K9M C;  4A3C G;  4JOI C;  5DAU A;  3OWE B;  1E0B A;  4XYO A;  1SRO A;  2KCC A;  1QUQ B;  4LAA A;  1HFN A;  1K8A C;  4A3M B;  1YNX A;  4XTC S;  4PMC A;  2R7Z G;  4DNR B;  3D8G A;  1Q7Y C;  1EQR A;  2C5C A;  2ZXR A;  1DM0 B;  3UI2 A;  1EYG A;  4R4T A;  5GAD C;  4TKO B;  4YIJ A;  1CSQ A;  2K1B A;  4P75 A;  4LF4 L;  5GAE C;  3FKI H;  4KV6 A;  4O42 A;  5CC4 A;  4KHV A;  1L0X B;  1W3S A;  1EYA A;  3PUZ A;  2B8F A;  3VYR A;  4DR7 L;  1YI2 A;  2UXC L;  2A74 C;  1CHQ D;  4QJF A;  2WB1 E;  2B29 A;  2PYK A;  3PSI A;  1I4H A;  3CCM A;  4DK0 A;  2I5L X;  1HZC A;  4MN3 A;  1KDB A;  4YWL A;  1NSN S;  3J7Y W;  2NTS A;  4ZAI A;  1WOC A;  1H95 A;  5IYC G;  2Z0S A;  5E4W C;  1WTX A;  1EFW A;  1EU3 A;  4ZRZ A;  4J1M A;  1A6X A;  1LT3 D;  2JA6 G;  3N52 A;  4A3M H;  4N8X 1;  1PRT C;  4DAM A;  4K14 A;  1Y14 B;  3V05 A;  2AHO B;  2QW7 A;  4LFB L;  1PYS B;  3OOC A;  4JG2 A;  5J22 A;  1LYL A;  2RDG A;  4LUV A;  2Z8L A;  1IYJ B;  2DJF C;  2JN4 A;  3C46 A;  3TQY A;  1E1T A;  3J80 E;  1WTO A;  5GRO A;  4ZLT F;  2GA4 B;  2EY2 A;  2UUC Q;  1XNR Q;  3PO3 B;  4YY3 Q;  1BBX C;  2PI2 E;  2B63 G;  3M4Q A;  1KIX A;  1YNJ C;  4TVA B;  1DXM A;  3WDN A;  3LNN A;  2EJG C;  3A7A B;  3TP6 A;  1VQP A;  3I4N B;  1AE2 A;  4HSV A;  2NB0 A;  2SEB D;  3QWN A;  1DJR D;  4OX9 L;  3ULL A;  2VUM B;  2WAQ E;  2IWH A;  1G91 A;  2WFW A;  3MXG A;  1Y1W H;  1PH8 A;  2PZW A;  2B2W C;  1F9S A;  2K04 A;  3A8K E;  3R93 A;  1U9R A;  1HZA A;  3BG3 A;  1EQT A;  1SE8 A;  4ZYS A;  1K8G A;  1CKM A;  1TWF B;  3S2H B;  3PIP 3;  3TS2 A;  3S24 A;  5LHY 1;  5E1F A;  4JI5 Q;  5EBC A;  3MC0 B;  1SR3 A;  1LTT D;  4DFA A;  2PQA B;  5ELF A;  1WD0 A;  5BN5 A;  3JAM L;  4PG3 A;  3PF5 A;  3GTO B;  1NNX A;  4KTA A;  1J9O A;  1XNR L;  1SND A;  2EXZ A;  3HKS A;  5FO8 B;  1E1O A;  4OWX B;  3S15 B;  3Q6S A;  1VQF A;  2VUM H;  1KRS A;  2KUM A;  2O5I C;  3W1B A;  5EQ0 A;  2B2T A;  5J39 A;  1LTR D;  1TQO A;  2VL6 A;  2NTT A;  3MFG A;  5TSS A;  4F87 A;  3S1Q B;  4JBJ A;  2KEE A;  1YNN D;  1TWH H;  4EQP A;  2CH4 A;  3KYH C;  1B9M A;  3S2H H;  2D0O A;  1TS3 A;  5IWA Q;  1FJG Q;  5CV4 A;  2E2I B;  4P71 A;  1SSO A;  4A3E H;  2CW0 C;  3R2I A;  4IPG A;  3BDC A;  5IIF A;  2JEA I;  1VQH A;  4HID A;  3GTO H;  3X3N A;  1JT8 A;  2FXQ A;  1PTO F;  2F3I A;  3I3C A;  4JI5 L;  1II3 A;  2F0S A;  2Q8R E;  2N8N A;  2K4K A;  3CCL A;  4KHP Q;  2AWO A;  3CXC A;  2A6H C;  4H7B A;  3E9I A;  4JI3 Q;  1ONL A;  3L9A X;  5IGB A;  1SYE A;  3QG1 A;  2DY7 A;  3S2D B;  1CUK A;  5AJ3 L;  4TSS A;  2K75 A;  2RCF A;  2MNA A;  1JB3 A;  2QDL A;  4XIG S;  1EEI D;  1EIF A;  2WB1 G;  2UUA Q;  1WCM G;  1IKL A;  5CMD A;  5ELC A;  1TWC H;  4L5T A;  5C4Z A;  3TBI B;  3DM3 A;  1PTO D;  3MZ5 A;  2NVY B;  5G3L D;  1Q82 C;  4BY1 H;  1Y1V G;  4DAV A;  1B3Q A;  3PIO A;  4JYA Q;  3CU7 A;  3KOJ A;  1JB7 A;  4IOC A;  2D9U A;  5IWA L;  2MO0 A;  3A74 A;  5AFW A;  2Z1C A;  1M90 C;  4O1N A;  2EZV A;  5EPJ A;  3NTK A;  1TII D;  1X55 A;  2IPK D;  3HKZ B;  2FMM A;  4GNX B;  3SK4 A;  2JJQ A;  4KHP L;  1ESR A;  1SN8 A;  5T1G A;  1F77 A;  2R92 G;  1ILP A;  4OO1 H;  1X6O A;  4JI3 L;  1UE6 A;  3NBI A;  1VQ6 A;  3J80 i;  3OW2 A;  1AH9 A;  2CHB D;  2IY5 B;  5FLX c;  2LXJ A;  3H15 A;  1PH1 A;  2NVY H;  3FHW A;  4DV1 L;  1GUW A;  4I7Z C;  5JEA J;  3U9S A;  3J7A F;  4IFD I;  1CK1 A;  1SLJ A;  2WAQ G;  1LT5 D;  4DUY Q;  1L1O B;  5L37 A;  5FJ8 H;  2LKV A;  1JWM D;  2NUC A;  2V4D A;  4K0K L;  1VQC A;  3OIP A;  1FYC A;  3NWS A;  4IPC A;  4LUO A;  4A4I A;  4JYA L;  2R61 A;  1BBU A;  1PZJ D;  3NP8 A;  5COR A;  1FGB D;  4ULL A;  1CKN A;  5I9P A;  3T1H L;  3M7N A;  2L1B A;  4GLX A;  5D3D A;  3UE0 A;  4HCS A;  3J7A V;  4HJA A;  3DWA A;  1YHB A;  2CWP A;  2F0F A;  1UNS A;  5LMN Q;  5M5Y H;  3CCJ A;  3BYY B;  1TWA H;  3JAM c;  4KMU C;  4UHV A;  4L8J A;  4A3F B;  1HNW Q;  1JOO A;  3M9B A;  2Z6B A;  2IT1 A;  1FNV A;  4RCO A;  1G29 1;  4IUN A;  3PQI A;  1XPO A;  1A62 A;  4CDC C;  1F2Z A;  3FMC A;  1STN A;  4R4O A;  5JVH 3;  4NXM Q;  3GTK H;  5EKI A;  3CCU A;  1A8V A;  2KJX A;  2EY6 A;  2QF7 A;  4A3L G;  1Q3L A;  1EFI D;  3PCO B;  5EKL A;  4DV5 Q;  5HGT A;  3ULJ A;  3HOU B;  3GTG B;  2OQK A;  5ISR A;  1VQL A;  3HOV B;  2VQE L;  1PYB A;  4FYD A;  2HHH Q;  4HAE A;  4K8I A;  1VS0 A;  2YYZ A;  3G7L A;  4JCV E;  2R6G A;  4JV5 Q;  3ND8 A;  3CRK C;  1HQR D;  4C3J B;  4ZKC B;  4GS3 A;  4CKB A;  4K6D A;  1O7I A;  3SK6 A;  1HNX Q;  5LMN L;  2F4I A;  4GOP A;  1EEF D;  2PNR C;  1BCP B;  3UDI A;  4CHT B;  4V19 0;  1IHZ A;  2ZJP A;  4CJ1 B;  3B6Y A;  3SE0 A;  4X66 Q;  1V9P A;  1TWG H;  1AEX A;  1VQO A;  3HOX G;  3P20 A;  4E6I A;  1EYD A;  4DAY A;  1HTP A;  2GVB A;  4PZ8 A;  4JI0 Q;  1I6V C;  1QWY A;  3KFU A;  4R8I A;  2C9O A;  1SYD A;  2CKZ B;  5IYB H;  1WD1 A;  5CV7 A;  1LTI D;  2R3Z A;  4YWK A;  3K58 A;  3V96 A;  4LFA L;  1BR9 A;  1FNW A;  2CQO A;  4C3J H;  4N9T A;  2HHH L;  2FIN B;  1KC8 C;  1KHI A;  4OEM B;  4DV2 Q;  1K3B C;  4JBW A;  1PH2 A;  4RH6 A;  3VR6 A;  2X69 A;  3CHB D;  4N9P A;  3CCR A;  1I50 B;  3IL8 A;  1XMQ L;  3NSW A;  1NJI C;  4QQB X;  4QMG A;  3I4M H;  1IYV A;  3CC4 A;  2BE5 C;  3CCS A;  4HIK A;  3KBG A;  4IPD A;  4JI6 Q;  4RCN A;  1BVS A;  1YHQ A;  5KRU A;  1G6P A;  1UE7 A;  2M00 A;  3L7Z C;  1U5K A;  4X66 L;  1Z9F A;  1XJV A;  2L12 A;  3QO2 A;  1VQG A;  2K28 A;  4Q5V A;  4LF9 L;  5DLQ E;  3K7A H;  2F0T A;  4CBV A;  4JI0 L;  1EY9 A;  1O80 A;  1CKN B;  4XDX A;  1UAP A;  3W1G A;  1X54 A;  3F2C A;  2N55 A;  4JBM A;  4G7H C;  2PMZ E;  3A7L A;  2RHQ B;  4A93 H;  4NKL A;  3VYT A;  2KA7 A;  3FP9 A;  3K0X A;  4DPG A;  2E8G A;  5COY A;  5D3I B;  2PPB C;  1K83 H;  4DUZ Q;  2LXK A;  3BYT B;  1I50 H;  2B2Y A;  2HD3 A;  4CJ0 B;  4B9W A;  5EPK A;  4HIO A;  2YU9 H;  4G7Z C;  1OXX K;  2QA4 A;  1QVF A;  1H9K A;  1I3Q H;  3MEH A;  5IYB G;  1KL9 A;  4L63 B;  1IYU A;  3RUZ A;  4DR1 Q;  2AQ3 B;  4JI6 L;  2CH4 W;  2A68 C;  1LV9 A;  1OXT A;  3E3X A;  4IFD G;  1LTG D;  5C0X I;  3T1Y Q;  3PO2 H;  3V2T A;  1HH2 P;  3K5N A;  3CPF A;  4MZ9 A;  1GUO A;  3EFX D;  4A3I H;  1D8L A;  1CA6 A;  4LMQ D;  2WAC A;  5IGD A;  3M4O H;  3T53 B;  2EJF C;  4X65 Q;  3E5S A;  2BH2 A;  5IT9 E;  3HRZ C;  3ERS X;  2H4O A;  3RZD B;  1YEZ A;  3DHQ A;  2Z6K C;  3STB D;  3MXP A;  1TR5 A;  5LMN W;  4HED A;  4DKA C;  2R7D A;  2ATW A;  3HOW G;  1F9P A;  4UY8 C;  1GUS A;  3QB3 A;  3RMH A;  3BVZ A;  4JOI A;  4DUZ L;  2J4X A;  1DOK A;  2DUD A;  1HUN A;  4JI1 Q;  5IP9 H;  4UDU C;  3PMF A;  2NVQ B;  1EY5 A;  4GOP B;  1TS4 A;  3NE5 B;  3LWE A;  3G6E A;  3KJP A;  1N33 Q;  2ES2 A;  2E2H B;  3CCE A;  1JQY D;  2KQ3 A;  4JC0 A;  5CV9 A;  4DR5 Q;  1QE6 A;  4A93 G;  1S3O A;  3U58 A;  4BY7 G;  1SMY D;  3QIA A;  1AZP A;  2WV6 D;  3T1Y L;  3TZD A;  2MO1 A;  3AYH B;  4DAY B;  1CTM A;  5JPN C;  3RZD H;  4DV6 L;  4FXD A;  2F0K A;  5KND A;  4JI2 Q;  4Y7N H;  5A2Q E;  3NTH A;  2K33 A;  3PUY A;  1SRU A;  4X65 L;  2G9D A;  1PH3 A;  2MGS A;  3GTJ B;  4B9X A;  4RHR A;  4Q0F A;  1KXL A;  3HOY B;  5M3F H;  2IX0 A;  3KLW A;  4OHJ A;  4JI8 Q;  4KN4 C;  1HNZ Q;  2JA8 H;  3PO2 G;  4ME5 A;  4X3K A;  1L0W A;  3H0G G;  2E2H H;  1F2L A;  4RGO S;  4AIM A;  3CME A;  1VMP A;  4A3I G;  3GTP H;  1A0I A;  5BN4 A;  3MVV A;  1D1K A;  1SBB B;  3A5Z B;  1W6J A;  4S3S A;  2QDB A;  2E2D C;  3LGJ A;  5C5L A;  1B44 D;  1QIL A;  1ZYR D;  3AFP A;  1N33 L;  4OWW B;  2RQX A;  4DR6 Q;  4QIW B;  1Q90 A;  2EIF A;  5FKA C;  4P72 A;  1P16 A;  2A69 D;  1XTC D;  3RLN A;  1EY8 A;  5I6Y A;  2PI2 A;  1GJX A;  3EBE A;  4K8J A;  1PTO H;  1PFM A;  2BH8 A;  4X62 L;  4O0A A;  1G2S A;  1NMG A;  1YIT A;  1VQ5 A;  4EQO A;  4RA8 A;  4JI2 L;  1F2M A;  2HIX A;  3SEB A;  1KNE A;  1VQJ A;  1BCP F;  1V8Q A;  2TSS A;  3BVG A;  3TP8 A;  3NXW A;  4JPB W;  2JEB I;  4EQ5 A;  1J6Q A;  4KKS A;  3DMU A;  2B2W A;  4TQU S;  1TS2 A;  3F2U A;  1ICW A;  2KHI A;  3RN2 A;  3S1M B;  4JI8 L;  1HNZ L;  4NB3 A;  1ENC A;  2F0O A;  2N78 A;  1V1O A;  1D5M C;  2M2L A;  2PW7 A;  4HTH A;  4BA1 I;  2YTY A;  3RD4 A;  3OYY A;  1STH A;  3TZU A;  1K8O A;  2UU9 Q;  1BCP D;  3O13 A;  4RGT A;  4YHH L;  3K57 A;  4FF1 A;  2ASB A;  1Z7T A;  2ICE C;  5M3F G;  3KLS A;  4DR4 Q;  2DN8 A;  3CMA A;  2RBM A;  2N88 A;  3F2D A;  4CGY B;  5IE8 A;  1C9O A;  3PIO 3;  4B3T L;  1GVP A;  1OXV A;  2L11 A;  4DV4 L;  3HG9 A;  1PH6 A;  2JA5 B;  1XXG A;  4X3S A;  2F0J A;  2E74 C;  3SK8 A;  3AMU A;  4ID6 A;  1S5F D;  4J6H A;  1CSP A;  4HJ5 A;  2XRQ D;  2KCN A;  1A3V A;  4UP9 A;  1L0Y B;  2G5D A;  4HJ8 A;  1WTR A;  3VR5 A;  1JE4 A;  5EKK A;  2RDF A;  3E9H A;  4FXK C;  4JBK A;  5KGU A;  1OTC A;  4JW0 A;  1KTK A;  5FLX L;  3J81 j;  2ALY B;  3SHL A;  2K6A A;  1MD2 D;  4HIM A;  3C1E A;  4KY6 A;  4IUQ A;  3HEJ A;  5KYI A;  1N9W A;  1RHP A;  3VYS A;  2L9H A;  3J81 c;  1I4G A;  1QCB D;  2UU9 L;  2PCF B;  2FHT A;  2J0T D;  1D7Q A;  3EIV A;  3KF6 B;  3DEO A;  2B8G A;  5C0X G;  1QZG A;  4X3U A;  1EIG A;  3D4R A;  3KK7 A;  2Q2U A;  4DR4 L;  4C2M B;  3GTM B;  4RKB A;  2WB1 B;  1S40 A;  4C3I B;  3TRE A;  4YCU A;  1BBW A;  1U4L A;  1WTV A;  3F8T A;  4DR2 Q;  3EJI A;  4AQY Q;  1VQN A;  1GUG A;  3FKI G;  3ERQ A;  4WRD A;  1MJE A;  3RLO A;  4OO1 I;  3NQT A;  2Z4H A;  1JE5 A;  1BO0 A;  1PRT B;  2LS0 1;  2YTV A;  3K6O A;  4NDX A;  5ELO A;  2FJ2 A;  5M5W B;  3EN2 A;  2XWJ B;  4ZQ3 A;  3PO3 H;  2VW9 A;  1DOM A;  3MEF A;  4DGZ A;  1T5E A;  3SDZ A;  1PDQ A; 
#chains in the Genus database with same CATH homology
 2NVT H;  3K7U C;  3T1H L;  5IP9 G;  2UUC L;  3GTJ H;  3I4N H;  1UE5 A;  5IP7 G;  4YY3 L;  5IYC H;  3M7N A;  1JJG A;  1G51 A;  3HOY H;  3GTM H;  4AH6 A;  4A3M G;  2F4V Q;  1EUJ A;  4C3I H;  4GLX A;  2EQS A;  4ALP A;  2JA6 H;  5EAY A;  3UE0 A;  1Q8K A;  4YWM A;  1IZ6 A;  3S16 H;  4HJA A;  1EQQ A;  4OON A;  4HJ9 A;  1YHB A;  2CWP A;  3KF8 B;  3ULP A;  2NVX H;  5LMN Q;  2K50 A;  1VQ8 A;  4Y52 H;  1VQE A;  2R93 G;  4DR3 Q;  5M5Y H;  3CCJ A;  1AE3 A;  1FVI A;  1UWV A;  4DR2 L;  1NMF A;  1TWA H;  3JAM c;  4BY7 H;  1PVO A;  1LUZ A;  1TWF H;  4BBR H;  4BBS G;  1HNW Q;  3M9B A;  1I94 L;  3S17 H;  2IT1 A;  4DK6 C;  1VQA A;  1WI5 A;  4DV7 L;  1G29 1;  2D62 A;  2XTI A;  5M5W H;  1XPO A;  2UUB Q;  1A62 A;  1XMO Q;  2KCT A;  2Q2T A;  3I55 A;  4R4O A;  1Z47 A;  3CC2 A;  5JJL A;  1C0A A;  2ZTC A;  1UEB A;  4GOP C;  1YJN A;  1Q1E A;  1KRT A;  3L2P A;  4A3J H;  1PH7 A;  4NXM Q;  4GLA C;  3GTK H;  4DR6 L;  4LWC A;  3CCU A;  4LFB Q;  1B70 B;  1A8V A;  1KQS A;  1GD7 A;  4A3L G;  1RIP A;  2A1A A;  4FDB A;  3RLF A;  4QGU A;  2JA8 G;  3PCO B;  3VDY A;  4DV5 Q;  3JC6 6;  3ULJ A;  4IOA A;  2AKW B;  3S15 H;  1GKH A;  4NXN L;  1HJP A;  3D0F A;  3RR5 A;  1VQI A;  2OQK A;  1Y1W G;  1UE1 A;  2JK8 A;  1VQL A;  2VQE L;  4DV3 L;  4GKK Q;  1EOV A;  1PYB A;  2F52 A;  3H0G H;  3SGI A;  3NEM A;  4DV6 Q;  2MQH A;  5GAG C;  5IY0 A;  2HHH Q;  3CW2 C;  4JI4 Q;  3H3V H;  2VS1 A;  1VQM A;  4A3G H;  5GAH C;  2F4V L;  4GN5 A;  5FLM H;  1VS0 A;  3S1M H;  2YYZ A;  3HKZ E;  3I2Z A;  5ELN A;  1VQD A;  2NZH A;  1YZ6 A;  4JCV E;  1PH4 A;  2R6G A;  1YJW A;  4LF7 Q;  4IJL A;  4JYA Q;  4JV5 Q;  4LF8 Q;  1BKB A;  2C35 B;  1Q86 C;  2Q2I A;  4GS3 A;  4GNX C;  4P73 A;  3PO3 G;  3UE1 A;  5C4J H;  3H3V I;  1O7I A;  4HJ7 A;  1IL2 A;  1HNX Q;  5LMN L;  4BXX H;  2AMC B;  2E2I H;  3NEL A;  3HFZ B;  4IO9 A;  4DR3 L;  4OX9 Q;  2RF4 A;  4GOP A;  4LW1 A;  3GTQ H;  1MJC A;  1FL0 A;  1JJC B;  1GO3 E;  3S1N H;  1V1Q A;  3I4N G;  2K5N A;  3HOY G;  1YBY A;  3UDI A;  1FJG L;  4UPA A;  4DV0 L;  2UUB L;  2ZJP A;  2VUM G;  1XNQ Q;  3B6Y A;  4X66 Q;  1X3E A;  1V9P A;  1TWG H;  1VQO A;  3PV0 A;  1T9H A;  3HOX G;  2XGT A;  3AQQ A;  5IYD H;  4ME3 A;  1WFQ A;  2GVB A;  2VZA A;  3CP0 A;  4PZ8 A;  4JI0 Q;  3S2D H;  2VQF Q;  2JA5 H;  3KFU A;  1HR0 Q;  4PZ6 A;  3CF5 A;  2KBN A;  1ASY A;  1L1O C;  3PF4 A;  2CKZ B;  4DK3 C;  5IYB H;  3KF6 A;  3CD6 A;  3RZO H;  3S14 H;  2E2J H;  4BBR G;  1QZH A;  4YWK A;  3G71 A;  1LM0 A;  4X62 Q;  4GNX A;  2HQL A;  4LFA L;  2K52 A;  2K14 A;  1L2F A;  4JI4 L;  2CQO A;  4C3J H;  4A3E G;  2HHH L;  2ID0 A;  4UP8 A;  1KC8 C;  2N3S A;  1X56 A;  1KHI A;  3ICE A;  2JE6 I;  2UUA L;  4A3J G;  2NZO A;  2K5V A;  4DV2 Q;  2E5L Q;  1VCI A;  4X6A H;  4JBW A;  1PH2 A;  5M5X H;  3G48 A;  3J7Z C;  1ASZ A;  1V43 A;  1X3G A;  2RHS B;  3CCR A;  2Y0S G;  3I56 A;  2IHF A;  1HZB A;  1XMQ L;  1NJI C;  4QQB X;  3PGZ A;  3I4M H;  2LSS A;  3BZK A;  3F2B A;  3CC4 A;  1X9N A;  3CCS A;  4HIK A;  4IPD A;  4JI6 Q;  5C44 H;  4X64 Q;  3WWV A;  4APV A;  2QEX A;  1BVS A;  1YHQ A;  4A3G G;  2NN6 I;  5J3B A;  1CKO A;  1L1O A;  1G6P A;  1UE7 A;  5FLM G;  3KDF A;  2N49 A;  3L7Z C;  1XNQ L;  1U5K A;  4X66 L;  2PQA A;  1Z9F A;  4J15 A;  4C2M H;  5IT9 c;  1XJV A;  4LF4 Q;  2IX1 A;  1VQG A;  4PMW A;  4YHH Q;  4LF9 L;  3A0J A;  5DLQ E;  2CFM A;  4R1J A;  4L5Q A;  4BA2 I;  1WCM H;  2AWN A;  3K7A H;  4H02 A;  4MTN A;  4POG A;  4DR7 Q;  1VQ9 A;  2UXD Q;  1VQ7 A;  4JI0 L;  2UXC Q;  3MXN B;  3AFQ A;  4BXX G;  2VQF L;  3GO5 A;  4LFC Q;  1CKN B;  1HR0 L;  4GKJ Q;  1HR0 W;  4BY1 G;  1B8A A;  3W1G A;  3D31 A;  3TS0 A;  1X54 A;  3F2C A;  4JBM A;  1PFS A;  2PMZ E;  2RHQ B;  1Y1V H;  4B3T Q;  1R9T H;  4A93 H;  1I6H H;  4DV4 Q;  3FP9 A;  3K0X A;  1U0L A;  4DPG A;  3G4S A;  2CWA A;  4A3B H;  5AJ3 Q;  2E8G A;  3UDX A;  4AQY L;  5E7N A;  4PZ7 A;  1K83 H;  4DUZ Q;  2LXK A;  1Q81 C;  1I50 H;  1IBM Q;  2IHE A;  2R7F A;  4MNO A;  4HIO A;  4B3R Q;  4LNQ A;  2YU9 H;  1E22 A;  2E5L L;  3CCV A;  1OXX K;  2QA4 A;  1QVF A;  5IYD G;  1I3Q H;  2JQO A;  2PNH A;  3PIP A;  2B63 H;  3K8A A;  1YHA A;  4KI0 A;  1N34 Q;  2JA5 G;  2VNU D;  3U50 C;  3J81 i;  1K9M C;  3OTO Q;  5IYB G;  3J80 c;  4DUY L;  4A3C G;  1KL9 A;  4JOI C;  4OO1 G;  4IPH A;  5C4X H;  1IBK Q;  1SRO A;  1QUQ B;  4DR1 Q;  3CCQ A;  4A76 A;  3E0E A;  5HGQ A;  5HY6 A;  1QVC A;  1YNX A;  4XTC S;  1PHJ A;  1K8A C;  4X64 L;  1RL2 A;  2R92 H;  1OXT A;  2R7Z G;  4IFD G;  5K36 G;  1Q7Y C;  5C0X I;  1EQR A;  1EYG A;  3T1Y Q;  3PO2 H;  4R4T A;  1X65 A;  1HH2 P;  4RG1 A;  3CPF A;  4MZ9 A;  5GAD C;  4LF4 L;  1CSQ A;  1PH5 A;  4P75 A;  1XPU A;  5GAE C;  3FKI H;  4A3I H;  1D8L A;  1MKH A;  3M4O H;  3GTL H;  1W3S A;  3PUZ A;  4DR7 L;  2UXD L;  1YI2 A;  4X65 Q;  2UXC L;  2BH2 A;  4LFC L;  4DNI A;  2V1C C;  4GKJ L;  3CQZ H;  3ERS X;  4QJF A;  5JJK A;  2WB1 E;  1YEZ A;  2B29 A;  3PSI A;  3STB C;  3ZJY C;  5FJ8 G;  2Z6K C;  4A3F H;  2VY3 A;  3K81 C;  3CCM A;  3STB D;  5LMN W;  2I5L X;  1HZC A;  4IJH A;  2DGY A;  2R7D A;  4DKA C;  2ATW A;  3HOW G;  4YWL A;  3TRZ A;  1N36 Q;  4AYB E;  4UY8 C;  1WOC A;  3HKZ G;  3U4V A;  1PH9 A;  1H95 A;  1HNW L;  5IYC G;  4JOI A;  4DUZ L;  1IBM L;  2Z0S A;  2DUD A;  4JI1 Q;  1EFW A;  5IP9 H;  2RCN A;  1XMO L;  2K5H A;  1DGS A;  4DV1 Q;  1J5E Q;  4KHZ A;  2JA6 G;  1XPR A;  1A63 A;  4IFD J;  4GOP B;  4A3M H;  4A75 A;  2Q2H A;  3HOU H;  4B3M Q;  4DAM A;  3G6E A;  3KJP A;  3L0O A;  4NXM L;  3AEV A;  1N33 Q;  4O2D A;  2ES2 A;  1Y14 B;  3CCE A;  3GTG H;  4JC0 A;  2AHO B;  4LFB L;  4DR5 Q;  3HOV H;  1PYS B;  4JG2 A;  4A93 G;  1LYL A;  4K0K Q;  1S3O A;  4DV5 L;  3KJO A;  3U58 A;  4LUV A;  2ZM6 Q;  2OWO A;  4BY7 G;  1IYJ B;  3K80 C;  3TQY A;  1E1T A;  4RMF A;  5M3M H;  3T1Y L;  2MO1 A;  3AYH B;  5GRO A;  2Z6K A;  1SMX A;  4JI7 Q;  1PV4 A;  4DAY B;  4GKK L;  3T1H Q;  2UUC Q;  2A19 A;  3RZD H;  1XNR Q;  3HOZ H;  3Q8D A;  4NPS A;  4YY3 Q;  4DV6 L;  4BBS H;  2PI2 E;  3JAM i;  4JI2 Q;  3M4Q A;  1KIX A;  4Y7N H;  2B63 G;  4TVA B;  2L15 A;  3PUY A;  1N32 Q;  1SRU A;  3PUX A;  4X65 L;  4JI6 L;  1PH3 A;  3PUV A;  3U4Z A;  4LF7 L;  1VQP A;  4JV5 L;  4LF8 L;  5C4X G;  3PUW A;  1AE2 A;  2CCZ A;  1KXL A;  4OWT B;  5M3F H;  2IX0 A;  3KLW A;  1HNX L;  2ZJR A;  4JI8 Q;  4A3L H;  4OX9 L;  3ULL A;  2JA9 A;  1E3P A;  1HNZ Q;  2JA8 H;  3PO2 G;  2WAQ E;  2WFW A;  1L0W A;  3H0G G;  2E2H H;  1Y1W H;  1PH8 A;  1XTD A;  4AIM A;  3ER0 A;  3CME A;  4OXP A;  4DV7 Q;  4A3I G;  3GTP H;  4P74 A;  1A0I A;  1M1K C;  1VQK A;  5JJI A;  1KD1 C;  4C3H H;  2ZJQ A;  3A5Z B;  1HZA A;  1SE8 A;  1K8G A;  3S1Q H;  1CKM A;  3LGJ A;  4B3M L;  4LF5 Q;  3TS2 A;  4A3F G;  3AFP A;  3S24 A;  3RNU A;  1N33 L;  4OWW B;  4DR6 Q;  4JI5 Q;  2EIF A;  4P72 A;  2OQ0 A;  3KDF B;  1IXR A;  1E7Z A;  1P16 A;  1SR3 A;  5LMU Q;  2PQA B;  3RLN A;  4UP7 A;  2A8V A;  2PI2 A;  1NBW A;  4PG3 A;  3EBE A;  1YVC A;  3PF5 A;  2BH8 A;  4X62 L;  4JI7 L;  4O0A A;  2VQE Q;  4DV3 Q;  1NMG A;  1WYD A;  1YIT A;  1VQ5 A;  1XNR L;  2JA7 H;  3M3Y H;  2GN5 A;  2QGQ A;  1WJJ A;  3HKS A;  1E1O A;  4JI2 L;  2HIX A;  4OWX B;  1VQJ A;  3NEN A;  3GD7 A;  3HOU G;  1VQF A;  1MIU A;  2VUM H;  1KRS A;  1N32 L;  4DV2 L;  1W2B A;  2H5X A;  2JEB I;  1J6Q A;  3W1B A;  4EQ5 A;  4L5S A;  2VL6 A;  3HOX H;  2HT1 A;  3HOV G;  4A3D H;  1KAW A;  4TQU S;  4R4Q A;  4JBJ A;  1E24 A;  1NY4 A;  3NBH B;  1AH9 A;  4GN4 B;  5C3E H;  2KHI A;  3RN2 A;  2OTJ A;  4JI8 L;  1VQ4 A;  3BZC A;  1QVG A;  1IBL Q;  1HNZ L;  1TWH H;  5M3M G;  4NB3 A;  4R4C A;  1P8L A;  3CPW A;  1Q1B A;  2N78 A;  3KYH C;  3S2H H;  3HOZ G;  4BA1 I;  1NTG A;  2KCM A;  2D0O A;  2YTY A;  3BU2 A;  5IWA Q;  3OYY A;  1FJG Q;  4DV0 Q;  4P71 A;  1QUQ A;  4A3E H;  4KLK A;  3RN5 A;  2UU9 Q;  4IPG A;  2UXB Q;  4LUZ A;  4YHH L;  4LF5 L;  2JEA I;  1VQH A;  1K0R A;  4YCV A;  4HID A;  2ASB A;  2KHJ A;  1FGU A;  3GTO H;  1NE3 A;  2FXQ A;  2NN6 G;  2F3I A;  2ZTD A;  5M3F G;  1JT8 A;  4JI5 L;  1S72 A;  3DLL A;  2N8N A;  2K4K A;  2EXD A;  3S1R H;  3I4M G;  3CCL A;  4DR4 Q;  3CMA A;  5LMU L;  2AWO A;  4POF A;  3A5U A;  3CXC A;  4KHP Q;  3F2D A;  4A3K H;  5BR8 Q;  5IE8 A;  5C44 G;  1C9O A;  3CC7 A;  3F1Z A;  4B3T L;  3E9I A;  1GVP A;  1OXV A;  4DV4 L;  4JI3 Q;  4LFA Q;  1N8R C;  1OXU A;  1PH6 A;  3M4P A;  1I5F A;  3UDF A;  5H1S E;  1CUK A;  5AJ3 L;  4LF6 Q;  2I5H A;  2K75 A;  2YTX A;  2MNA A;  1JJ2 A;  4XIG S;  4B3R L;  1EIF A;  2WB1 G;  3GDE A;  2YV5 A;  1Q46 A;  2UUA Q;  5IP7 H;  1WCM G;  2GVA A;  1LTL A;  1TWC H;  4L5T A;  1N34 L;  1CSP A;  4HJ5 A;  1HZ9 A;  3DM3 A;  3IRB A;  3BJU A;  2BA1 A;  4AYB G;  2I5M X;  4UP9 A;  3OTO L;  4HJ8 A;  1XMQ Q;  4GLV B;  4QY7 A;  3W5O A;  1Q82 C;  1IBL L;  1Y1V G;  1IBK L;  4B3S Q;  4BY1 H;  3E9H A;  4GN3 B;  1EIY B;  4DR1 L;  3PIO A;  4JBK A;  2BA0 A;  1OTC A;  2KEN A;  2MFI A;  3J81 j;  1PA6 A;  1GM5 A;  2JA7 G;  2ALY B;  1YJ9 A;  4YCW A;  5JEA G;  5GQO A;  4A3B G;  2R93 H;  3KOJ A;  4HIM A;  1SFO H;  4IOC A;  5IWA L;  1JB7 A;  2MO0 A;  3A74 A;  1N9W A;  1EWI A;  4L5R C;  1X3F A;  3J81 c;  2UU9 L;  1M90 C;  2UXB L;  2HIV A;  4A3D G;  4LF9 Q;  1D7Q A;  3EIV A;  3KF6 B;  4QIW E;  5C0X G;  1YIJ A;  1X55 A;  1QZG A;  5C3E G;  1JMC A;  2OCE A;  4GNX B;  1C7Y A;  4WJ3 M;  2Q2U A;  2OTL A;  4DR4 L;  2JJQ A;  4KHP L;  1K73 C;  4A3C H;  4EX5 A;  5BR8 L;  1SN8 A;  1S40 A;  2R92 G;  1X6O A;  4JI3 L;  1UE6 A;  3TRE A;  4YCU A;  1BBW A;  3J80 i;  3OW2 A;  3F8T A;  1N36 L;  1VQ6 A;  2NVQ H;  4DR2 Q;  1TXY A;  2Y0S E;  2IY5 B;  5FLX c;  2LXJ A;  2ZTE A;  3I7F A;  3H15 A;  4LF6 L;  2R7Z H;  3CAM A;  1OXS C;  4AQY Q;  1PH1 A;  1I94 Q;  1VQN A;  1K3R A;  2NVY H;  3FKI G;  1MJE A;  4QL5 A;  4JI1 L;  3M85 A;  3RLO A;  3FHW A;  4OO1 I;  4DV1 L;  1J5E L;  1JE5 A;  3I4O A;  1B7Y B;  2D0P A;  5JEA J;  2YTV A;  4IFD I;  3J7A 5;  1VQB A;  1SLJ A;  2WAQ G;  3TEH B;  4DUY Q;  5ELO A;  4A3K G;  4DR5 L;  1L1O B;  3EN2 A;  4B3S L;  5FJ8 H;  3PO3 H;  4K0K L;  2VW9 A;  1VQC A;  3MEF A;  2ZM6 L;  5C0X J;  3UDG A;  4IPC A;  4LUO A;  4R4I A;  4A4I A;  2I0Q A;  4JYA L;  1BBU A;  3HOW H;  4NXN Q;  2WP8 J;  4WJ4 A;  1Q12 A;  1CKN A;  2B3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...