2CCZA

Crystal structure of e. coli primosomol protein prib bound to ssdna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
121
structure length
121
Chain Sequence
MDPNSLMTNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELIDSVDKLAAALEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complexed Crystal Structure of Replication Restart Primsome Protein Prib Reveals a Novel Single-Stranded DNA-Binding Mode.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna/replication
molecule keywords PRIMOSOMAL REPLICATION PROTEIN N
total genus 15
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2cczA00
4A3IH 4DK6C 2VQFQ 4OX9L 1J6QA 1VQCA 3NBHB 4DV7L 1IBML 4OO1I 4HJ5A 4HIMA 1SRUA 1GKHA 4UP9A 3T1YL 1SN8A 1VQGA 2VL6A 4IPHA 4HJ7A 1L2FA 4BXXG 1XMQQ 3RN2A 2PNHA 3ER0A 1XTDA 4GN4B 4KHPQ 4BBRH 1JJCB 3TREA 3UDFA 4BY7H 2D62A 2K50A 4OO1G 4QJFA 3GTQH 3IRBA 1EYGA 1S40A 2ID0A 1JMCA 4LW1A 5JJIA 4BY1G 2JQOA 4MTNA 3I55A 4HJ8A 2ZTDA 1X65A 3TQYA 4B3TQ 3CC2A 4X66Q 1FJGL 1PYBA 4NPSA 4DV6L 4OWWB 2JA8H 1KRTA 1CUKA 3KFUA 4ME3A 2HQLA 3GTPH 1IZ6A 2AWOA 4X65Q 1L1OB 3TRZA 2VQEL 1PFSA 4A3KG 4IFDI 1OXTA 3A5ZB 5GQOA 1E3PA 2I5HA 4DV5Q 1OXUA 5BR8Q 1YJ9A 2A19A 4DV1L 4JI0Q 4LF4Q 1IXRA 2PQAA 5C3EG 4DR4L 1VQDA 4DK3C 4P71A 5IYBG 1VQEA 5C0XG 3VDYA 1HNZL 4P73A 2F4VL 2KENA 4IPDA 1M1KC 4JI7L 1G6PA 5IWAL 3RLOA 4NXNQ 4P75A 5FLMG 2OQ0A 2NVTH 4P74A 4MNOA 3K8AA 3L2PA 1SR3A 3PO2G 1N32L 2MNAA 1U0LA 4XIGS 3S24A 2E5LQ 3S1NH 2B3GA 4ALPA 4GOPB 4JI1Q 4JI1L 3M4PA 1FVIA 3K80C 4BA1I 5C44H 4POGA 4DR6L 2Q2TA 1UE7A 3CAMA 4L5TA 4UY8C 4YY3Q 1PHJA 2MFIA 4A3BH 5JJKA 1OXSC 1WOCA 3KF6B 1IBLQ 3CCJA 1J5EL 2NVYH 2YTVA 4R1JA 4DUZL 2R7DA 3CCLA 3CCMA 1XNQQ 3H3VH 4A3DH 4X62Q 3CXCA 3KYHC 3OYYA 2HT1A 1C9OA 1XPUA 4A93G 1NE3A 3STBD 3JAMi 2YU9H 4BBSG 3S16H 2JJQA 3KDFA 3CCQA 1Q1EA 5GADC 2GN5A 1XMOQ 2R7ZG 1K8GA 4LF9L 4A3GG 3CCEA 4NXML 3PV0A 5C4JH 4R4TA 5GAEC 1NMFA 1UEBA 1OXXK 2CWAA 1OTCA 3TS2A 4JI3L 1VQBA 1QZHA 2HIVA 2JA6G 3KDFB 3I4OA 4JI2L 4B3RL 1EFWA 1WCMH 1GVPA 2Y0SE 4YHHL 1YI2A 2N3SA 2PI2E 5GAGC 4MZ9A 2VZAA 1RIPA 1HJPA 1I50H 3KF6A 1YBYA 3PCOB 4LFBL 2EQSA 2JA5H 2ZJRA 1VQJA 3GTOH 4PMWA 2CKZB 3TEHB 1VQ7A 1V9PA 2UU9L 4B3ML 4JBMA 2QA4A 3EN2A 2I5LX 3CMEA 1CSQA 4DR2Q 1Q81C 1A0IA 5ELOA 4A75A 1IBKL 1TWHH 4OX9Q 2OQKA 2YV5A 1ASYA 1XNQL 2PI2A 2I0QA 4BXXH 3GTLH 1CKOA 4LF9Q 3CC4A 3AQQA 1XPRA 1MJCA 3KOJA 1TXYA 5BR8L 2VW9A 1YHAA 2ZM6Q 4HIOA 2IX1A 3S14H 1G51A 4C3IH 2OTLA 1N36L 1L0WA 4HIDA 2E8GA 4Y52H 4XTCS 1YNXA 2H5XA 3F2DA 1HR0Q 4B3SQ 1Q1BA 4JI6Q 4A4IA 1C7YA 4JI5Q 5M3FG 3U4ZA 1N8RC 3ULJA 3S2HH 3AFQA 1PYSB 1YHQA 4GLXA 2HHHQ 2JEAI 3CD6A 2R93H 3AFPA 5JEAJ 1N32Q 2WP8J 4QQBX 4A3EG 2YYZA 1B70B 2JA5G 2HIXA 4YCVA 1FJGQ 4A3LH 4IPCA 1K3RA 1B8AA 2WAQE 4A3FH 4X64L 1WYDA 4LF6L 5C0XJ 4IFDG 3HOWH 1EOVA 4X6AH 1JT8A 3K81C 2VUMH 1E22A 1PH2A 1N34L 5AJ3Q 4DV1Q 4QY7A 5E7NA 1YIJA 1Q7YC 1XNRQ 3PIOA 2UXBQ 2B29A 5EAYA 2E2IH 1NJIC 2LXKA 4OONA 3S17H 3EIVA 3E9IA 4GN5A 3GO5A 2AWNA 5M3FH 2LXJA 2CQOA 4BY7G 4QL5A 2IHEA 2JA7H 3KF8B 4GKJL 2N78A 1J5EQ 4DV2Q 3DLLA 2UUBQ 3PO3H 1EIYB 4B3MQ 3ULLA 2UU9Q 4GNXA 3PUVA 1VQOA 1H95A 3PIPA 5IT9c 4A3IG 1TWAH 1KC8C 3K0XA 3U50C 1VQ5A 3EBEA 1N36Q 3CQZH 2KHIA 4H02A 1UE5A 1KAWA 1V43A 5C0XI 3UE0A 2ZJPA 1I5FA 1YHBA 4APVA 1W2BA 1VQ8A 2UUCL 4AQYQ 2RHSB 1VQKA 3H15A 2UUBL 3I4MG 2D0PA 2YTXA 1X3FA 1KRSA 5M5XH 4A3KH 2NVQH 3H3VI 2IX0A 4UPAA 4OWXB 4DUYL 1CSPA 4JCVE 5IE8A 1LTLA 1HR0W 2B63G 1T9HA 1X56A 3PO2H 2KCTA 4KLKA 1KIXA 3F2BA 2L15A 5FLMH 4PG3A 1I94L 2K75A 1IYJB 1YEZA 2RHQB 4JI6L 5AJ3L 4A3EH 1C0AA 2VS1A 4LWCA 2OCEA 2VQEQ 2JA7G 3A0JA 1K0RA 3J80i 4YCWA 3UDXA 3T1YQ 2AMCB 3K7AH 1VQLA 3HOUG 2ZTEA 4DV7Q 1IBMQ 1QUQB 4DUYQ 4YWLA 3AYHB 1WJJA 4BBRG 4JI0L 4LF4L 4GNXB 3G6EA 4UP7A 2UUCQ 3GTGH 4DR5Q 4BBSH 3S1RH 4LNQA 3PF4A 4KI0A 1VQFA 1VQIA 1WI5A 2ES2A 4JI4L 1QVGA 5IYBH 3FKIG 3CCUA 1HZCA 3CCRA 4O2DA 1PVOA 3OTOL 1S3OA 4EX5A 4A3CG 4LFBQ 4OXPA 4NB3A 1VCIA 3CPFA 4IJHA 4JOIA 5M3MG 4DR1Q 3M85A 4LF7L 3HOXH 1O7IA 3OW2A 1P8LA 3RLFA 4DNIA 2JEBI 1PH9A 1GD7A 3G48A 1QVFA 1VQNA 5JEAG 1NY4A 3GTMH 4GKJQ 4A3MH 4JOIC 1BBUA 1BKBA 3D0FA 2VQFL 1V1QA 1PH8A 1VQ9A 2VUMG 2JA8G 4L5QA 4DV0Q 1QUQA 1BBWA 4LUOA 4AQYL 3H0GH 5LMUQ 3PO3G 2HHHL 2MO1A 1YJNA 3G71A 4JBWA 3OTOQ 4DV5L 1X54A 4TQUS 1NBWA 3HOVH 4DR3L 2JK8A 5LMNW 5IY0A 1QZGA 4BY1H 2JE6I 5HY6A 1JE5A 2K14A 3Q8DA 3M4QA 3CP0A 4DV3Q 4HIKA 3UE1A 1Y1VH 3HKSA 3NENA 1YJWA 5IP9H 4DV2L 1Q82C 3A5UA 2IY5B 4DR7Q 1A62A 1SLJA 4Y7NH 2NN6I 3NELA 4X66L 1JB7A 4DR4Q 1TWGH 2KBNA 1LYLA 2ZJQA 1E1OA 5IYDG 1HNXL 4J15A 3CMAA 3S1QH 5IYCH 1E7ZA 3CCSA 3G4SA 2OWOA 1B7YB 1N9WA 3D31A 2UUAQ 4RMFA 2K5VA 1VQAA 4A76A 4A3MG 1X9NA 4L5SA 3GDEA 1EQQA 1XNRL 2UXBL 1L1OC 1Q12A 4PZ8A 4JI8Q 5K36G 2R92G 1VQMA 3BZCA 4GS3A 1K9MC 3M9BA 4QGUA 5J3BA 4FDBA 2LSSA 3J81i 4LFAQ 1KL9A 1P16A 3RLNA 3ULPA 1VQHA 1EQRA 4A3GH 1XPOA 2MQHA 1Z9FA 3PUWA 2WFWA 3STBC 5GAHC 3MXNB 3I4NG 3HOYH 2UXCL 3HOYG 1CKNB 1K83H 1KHIA 1PH5A 4X65L 1YZ6A 2E2JH 4LFCQ 1I6HH 3RZOH 1GO3E 2YTYA 3K7UC 4GOPC 3GTJH 5IWAQ 1HZBA 1EUJA 1BVSA 2NZOA 2ATWA 2IHFA 3PGZA 4B3RQ 2VNUD 3JAMc 1OXVA 2R92H 4KHZA 4JYAL 1LM0A 1KD1C 2AKWB 2IT1A 2Z6KA 4C2MH 1IBLL 1IL2A 1HR0L 4B3SL 1PH4A 3J81c 2ASBA 2N8NA 1TWFH 3HOZH 1XJVA 4DR6Q 4JG2A 4YWKA 4HJAA 1JJ2A 2K5HA 3BJUA 3PUYA 2E2HH 4DV4L 2CCZA 1A63A 1MIUA 4O0AA 3KLWA 4KHPL 2JA9A 3B6YA 3LGJA 1IBKQ 1KXLA 2FXQA 2N49A 4QIWE 4DR2L 2CWPA 3UDGA 1PH6A 4X64Q 3UDIA 1E1TA 2EIFA 4GOPA 4C3JH 4JV5L 4R4CA 1GM5A 4YY3L 1E24A 3GD7A 1G291 4B3TL 1HNWL 1WFQA 1VQPA 1SMXA 2DGYA 1VQ6A 1CKNA 3J7ZC 1PH3A 3HOVG 4IFDJ 1HZ9A 1SROA 1AH9A 2K5NA 3E0EA 1N33L 2ZTCA 1N33Q 2BH2A 4NXMQ 2F52A 4JI5L 3RNUA 1TWCH 1EIFA 3I2ZA 4UP8A 2B63H 4LF8L 2ZM6L 1XMQL 4A3LG 1UE1A 3I56A 3E9HA 4GN3B 5GROA 4IO9A 3HKZE 4R4QA 5C4XH 3FP9A 3MEFA 4X62L 1PH1A 1NMGA 3HOXG 1W3SA 4RG1A 1RL2A 2EXDA 2OTJA 4AH6A 3W1GA 2WAQG 1LUZA 1X3EA 1JJGA 4YWMA 3RN5A 3CCVA 3FKIH 4JBJA 3HOWG 4PZ7A 4GKKL 2GVAA 3L0OA 1WCMG 1QVCA 3PUZA 3T1HL 1N34Q 5IYDH 2Z0SA 2RCNA 2Y0SG 5LMNL 4LFAL 4R4OA 2VY3A 1K8AC 3JC66 4EQ5A 1NTGA 1U5KA 4P72A 4YHHQ 4JC0A 5IP7H 1A8VA 1PH7A 4LF5Q 2DUDA 4R4IA 3W5OA 3HOUH 4JI7Q 1UWVA 1KQSA 4LF8Q 2MO0A 3HKZG 3SGIA 2UUAL 2R7ZH 3W1BA 1R9TH 2D0OA 3NEMA 4LUVA 3WWVA 3KJOA 4L5RC 1Y14B 2Z6KC 3S2DH 5M5YH 2RF4A 4OWTB 2GVBA 3CPWA 1XMOL 2E5LL 2CFMA 4JBKA 2WB1E 3J80c 1SFOH 4NXNL 1MKHA 2XGTA 4GLAC 4A3FG 4TVAB 1Y1WH 2F3IA 4BA2I 3PF5A 2JA6H 1CKMA 5C4XG 3I4MH 4DUZQ 5LMNQ 1UE6A 5IP9G 3TS0A 2R93G 1ASZA 5IP7G 5LMUL 1K73C 3A74A 1AE3A 5HGQA 1PA6A 1Z47A 4IJLA 1I94Q 3M4OH 4YCUA 2Q2HA 3L7ZC 3F8TA 3CW2C 2V1CC 3U58A 3GTKH 2ALYB 3I7FA 2WB1G 5H1SE 3HOZG 3M7NA 4POFA 3CF5A 1X6OA 3FHWA 4PZ6A 4DAYB 3J81j 4DV4Q 4DR7L 3CC7A 3KJPA 4LF7Q 5FJ8G 1Q8KA 5JJLA 4JI2Q 2KCMA 3RZDH 5DLQE 3F2CA 4A3JG 4JI3Q 2BH8A 2AHOB 1YVCA 1FL0A 4AYBG 4DR3Q 5M3MH 4JYAQ 1L1OA 2I5MX 5FJ8H 4DR5L 1HH2P 2UXCQ 4DPGA 4A93H 4WJ4A 1D7QA 1I3QH 4DV0L 3PSIA 1SE8A 3ICEA 4A3DG 3BU2A 4WJ3M 4LUZA 4K0KL 2KHJA 4JV5Q 2R7FA 1D8LA 4LFCL 3ZJYC 2UXDQ 1AE2A 2BA0A 3I4NH 1DGSA 3ERSX 2A1AA 5ELNA 1X55A 3F1ZA 4JI8L 5C3EH 5C44G 4DV6Q 1S72A 3T1HQ 2PQAB 2BA1A 2NN6G 2Q2UA 1FGUA 3U4VA 3M3YH 1EWIA 1Q86C 1PV4A 1Q46A 4DAMA 3HFZB 4GNXC 4AYBE 4LF6Q 2A8VA 4DKAC 2QEXA 4LF5L 4K0KQ 4AIMA 3AEVA 3H0GG 3S1MH 1X3GA 2XTIA 3RR5A 2NZHA 5IYCG 3S15H 3DM3A 2K4KA 2NVXH 1VQ4A 2PMZE 4IPGA 4IOAA 4DR1L 2UXDL 4HJ9A 4A3BG 1HNZQ 2R6GA 2F4VQ 4DV3L 1HZAA 2QGQA 3BZKA 3J7A5 4GKKQ 4C3HH 4JI4Q 4A3JH 1HNXQ 4IOCA 1M90C 3PUXA 1Y1VG 1YITA 4GLVB 1VS0A 2C35B 2K52A 5FLXc 1HNWQ 4A3CH 1MJEA 1Y1WG 5M5WH 2Q2IA
chains in the Genus database with same CATH superfamily
4A3IH 4OX9L 5C4ZA 3NBHB 4DV7L 5KYIA 4HJ5A 3PO2B 3RN2A 3ER0A 1XTDA 4KHPQ 1JJCB 4ZUIA 3UDFA 1O7YA 1S5CD 2FHTA 4BY7H 1IYUA 3IRBA 3T56B 2ID0A 1JMCA 4LW1A 3IAYA 5K5PA 2O5IC 2JQOA 2ZTDA 2SNMA 2BOSA 4B3TQ 3MC0B 4OO1H 1RF2D 2JA8H 3QWNA 1KRTA 1E2VA 2HQLA 4N8FA 1STNA 4ZLTF 3FVQA 2AWOA 4X65Q 1L0XB 5G3LF 4IFDI 4DV5Q 1OXUA 2F0EA 4J1MA 2K01A 4JI0Q 3K5OA 4IN3A 4DR4L 4KHVA 1VQDA 4P71A 3C3LA 5C0XG 3G6JB 4P73A 1M1KC 3SK4A 5IWAL 3NBHA 3TSSA 5FLMG 2OQ0A 1QOHA 4HSVA 2E75C 3L2PA 4Q0FA 3PO3B 4XIGS 3GP7A 2B3GA 1TKWB 2Z6BA 3M4PA 4IALA 3C46A 2RQXA 3CU7A 2KEDA 4POGA 1HUMA 2NVYB 3CAMA 1PHJA 3DWQA 1VF5C 5FO9B 3NK9A 1WOCA 2Q8TA 1J5EL 5IGGA 5EPKA 3CCLA 4A3DH 2GA4B 3CXCA 3KYHC 2HT1A 4A93G 1NE3A 3OWFA 2YU9H 4BBSG 1JR0D 3IFTA 3W2DA 3FPUB 3SR1A 1WTWA 2RDFA 5I2XA 2GN5A 4ZCKA 1XMOQ 4MN3A 3VR4A 3CCEA 4NXML 1NMFA 2CWAA 1OXXK 2B2TC 3TS2A 2HIVA 1FNVA 1ENFA 1V1PB 3KDFB 4IUUA 4RA8A 2ICEC 4FXKC 1WCMH 3C1FA 2PI2E 1BCPF 5GAGC 2VZAA 1QWYA 1CI3M 1HJPA 1I50H 2L0CA 3KF6A 5I9OA 2JA8B 3Q24A 5I6WA 1A6XA 4H0LC 1FD7D 3FRPB 3VA5A 1V9PA 4U673 1PLFA 1A0IA 2F0QA 3NQTA 2YV5A 2QKIC 2I0QA 1I4XA 1CKOA 2QEJC 1MJCA 1XPRA 4HIOA 1YHAA 1G51A 4C3IH 5D14A 2E8GA 4XTCS 4JI6Q 2I46A 2KA7A 3ULJA 4K2LA 3S2HH 1YHQA 3CD6A 5C5LA 2HHHQ 3SHLA 4G7ZC 2RSNA 3AFPA 2WP8J 3CQZB 4QQBX 1MBYA 1B70B 5C44B 2JA5G 4OEMB 1FJGQ 1K3RA 1D1KA 3R2IA 1WYDA 4LF6L 1ICFB 1SNMA 3GTOB 1E22A 5EPLA 1SSOA 4CBVA 1JB3A 4DV1Q 5IIFA 4P2CB 5M3FB 3DEOA 4G7HC 1SAPA 4DNRB 1O7ZA 2AWNA 3GO5A 1H9SB 2LXJA 4BY7G 2IHEA 4EGVA 3KF8B 5T1IA 4PMBA 2Q8RE 2KOLA 2UUBQ 3P1HA 1U4MA 1EIYB 3S1NB 4B3MQ 3GTPB 1H95A 3J7AF 4K6DA 4DK1A 4A3IG 2NTTA 1VQ5A 3EBEA 4C3HB 2KHIA 2ZJPA 5C0XI 3UE0A 2H4OA 4APVA 1NUCA 2RHSB 3J7AV 3I4MG 1AEXA 5KIXA 2IX0A 4UPAA 1C48A 2XNAC 4FF3A 5IE8A 1PMRA 1M8AA 4PG3A 2JP1A 1PTOF 3GV3A 4A3EH 1MI2A 1GOZA 5T1GA 3ND9A 1S5DD 4LWCA 3UDXA 5DEHA 1IBMQ 4YWLA 4BBRG 3S2HB 3A7LA 3G6EA 1CFMA 4A3DB 4LJZC 1WD1A 4KI0A 1VQFA 2CH4W 5EKLA 2E76C 5C3XA 3CCUA 1HZCA 4RGTA 4O2DA 4RAUC 2IW3A 4EX5A 3HOWB 4OXPA 4DR1Q 3M85A 4LF7L 3BVGA 3HGBA 1PDQA 3RLFA 1GD7A 4AYBB 1VDZA 5JEAG 3GTMH 1TWFB 4OELB 1STYA 4DF7A 1WTXA 3K5LA 2VQFL 1V1QA 1VQ9A 2VUMG 2JA8G 3VYTA 2MO1A 4JBWA 4DXFA 5IGDA 3HOVH 4DAYA 5IY0A 4FO2A 2JE6I 3VR5A 4HIKA 3CP0A 1PZID 1Y1VH 1WTQA 1YNJD 2A68D 3EVQA 2ICIA 4DR7Q 3NELA 1HFNA 1TWGH 2KBNA 2ZJQA 1HNXL 3LNNA 4KKSA 1V8QA 2B39A 1B7YB 4RMFA 1EQQA 2HCCA 1L1OC 1Q12A 2B63B 1A3VA 2O2LD 4IZ8A 1DM0B 1KL9A 1S5FD 4ABNA 3D8GA 2K5DA 2MQHA 4EQPA 3PUWA 2WFWA 3STBC 4A3CH 1WTHA 4RWSC 2OXPA 1WD0A 3SK8A 4FF4A 3E3XA 4X65L 3Q22A 1RHPA 1EY7A 4Y7NB 3PGZA 4IUTA 1PZJD 2HCIA 2EY6A 3AB9A 3JAMc 2Z8LA 2XRQD 2QILA 4C2MH 3VR3A 4CGYB 4K14A 1MD2D 1VMPA 2ZXOA 4JG2A 3S1MB 1JJ2A 3BG3A 3FKIB 1A63A 4KHPL 3DUZA 2FXQA 4QIWE 1E1TA 1SNQA 4C3JH 1F77A 2B2WA 3U9OA 4KD4A 4B3TL 1HNWL 2EYOA 1VQPA 5CV4A 5JPNC 1AH9A 2K5NA 3E0EA 2BH2A 2ZTCA 4X3KA 1N33Q 5ELDA 4CJ0B 4UP8A 1CTMA 2A73B 2C5CA 4LF8L 4IQZA 2ZM6L 1TY0A 3IL8A 1STHA 2CH4A 5C4XH 3FP9A 5CV5A 3VYSA 3D6WA 2F3VA 2EXDA 2OTJA 1AP0A 4AH6A 1X3EA 4JBJA 4UAIA 2IJ0A 3HOWG 2E2DC 3L0OA 1WCMG 1QVCA 3PUZA 4FXDA 1X32A 5G3LD 1B3QA 3JC66 4EQ5A 1RTOA 2K5WA 2L5TA 2F0TA 4P72A 4JC0A 1PH7A 3KLSA 2R92B 2DUDA 4R4IA 5ISRA 1XXGA 5HGTA 3HOUH 3HKZG 1ILQA 3W1BA 3GTJB 1Z6HA 3S2DH 3KJOA 1Y14B 5BN5A 1SNCA 1FYCA 2E5LL 1XMOL 1F9QA 3K57A 1SFOH 4DA2A 4TVAB 1B9MA 5JEAH 1EYDA 3Q23A 1ET6A 5DAUA 1BCPB 1UE6A 5IP9G 2R93G 2EYLA 4C3JG 2O4XA 5IP7G 1AE3A 2LKVA 1AW7A 5FKAC 1S5BD 2Q2HA 4ZK9B 5IGEA 1U9RA 3U58A 2ALYB 3RZOB 1B9NA 4POFA 3D4DA 3J81j 1EQTA 1EWHA 1PFBA 3H6MA 5EQ0A 3KBGA 1H9SA 4JI2Q 1LACA 3I8ZA 1Y8NB 5DLQE 5M3MB 3F2CA 1KDBA 4JI3Q 2BH8A 2XWJB 1HXYD 1YVCA 4DR3Q 4AYBG 2HQEA 5M3MH 2I5MX 5FJ8H 1XYIA 4K8JA 3VA7A 1I3QH 4KKUA 4DV0L 3PSIA 1SE8A 1LO5D 3QOJA 2KHJA 4LFCL 1T5XD 4XYOA 5ELNA 1D6EC 3KLSX 1STBA 3F1ZA 4JI8L 5C3EH 5C44G 2JA5B 2JYOA 3T1HQ 2DJFC 1R9TB 2PW5A 4J6HA 1Q86C 1PV4A 1Q46A 3A8IE 1E0BA 1B2TA 4RHRA 4LF6Q 4DKAC 5CORA 3V96A 3DM3A 5E4WC 2NVXH 4IOAA 1IKLA 4HJ9A 2MHVA 2F4VQ 4DV3L 2J0TD 1U4PA 1Y1WB 4GKKQ 2XWBB 4JI4Q 4A3JH 2ZT9C 4JW0A 3PUXA 3HP3A 1Y1VG 1SYFA 2C35B 2PNRC 1Y1WG 1EIHA 2RSOA 1NAPA 2VQFQ 1VQCA 5D3IB 4HIMA 4UP9A 1GKHA 1SN8A 2VL6A 2WKDA 1L2FA 5CV6A 1JE4A 1XMQQ 4OL7A 4GN4B 3HOUB 1ONLA 1K3BC 3TREA 4K2KA 3L9AX 4LK1C 2AQ1B 5JJIA 1J9OA 1X65A 2XRSD 1TVXA 4V0BA 2D9UA 4EQOA 1FJGL 1BR9A 1PYBA 4DV6L 3MXGA 3A8JE 5C4HA 1VF7A 3Q0AA 1CUKA 3KFUA 3GTPH 4UDUC 4ID6A 3HKZB 3TRZA 4RHSA 1LTID 4R9WA 1YJ9A 4N9TA 2A19A 1SEBD 4XXEA 5JJZA 1VQEA 4JI7L 2LFNA 1B44D 4P75A 4P74A 5CGKA 3K8AA 3S9WA 3J80L 1N32L 1U0LA 3BDLA 3G7LA 3S24A 5C4XB 4ALPA 2KCNA 2OT2A 3NE5B 5C44H 2X6LA 2Q2TA 1I3QB 4YY3Q 5JJKA 1OXSC 1SE4A 3KF6B 4DUZL 1H9KA 1XNQQ 2A74C 1G6ZA 3EA6A 1C9OA 2IPKD 2E74C 2F0VA 2EJMA 4HEDA 1K8OA 5FO7B 3T51B 5KYLA 1K28A 2YU9B 4IUNA 4RKLA 5GADC 4IUVA 1K8GA 4A3GG 3NXWA 3S2DB 4R4TA 4RH6A 1SYEA 1UEBA 2L11A 1VQBA 4XQJA 1EY9A 2JA6G 3I4OA 4A3GB 3S15B 4IUQA 4DU9A 1YI2A 3WOEA 1LABA 1DD2A 2B8GA 3IFDA 4OIKA 3I91A 2JA5H 1VQJA 2NVQB 1CA6A 3GTOH 1STAA 1TQOA 4JK1C 2M2LA 4Z9CB 5M5WB 2UU9L 3QJYA 5DM63 4B3ML 4F8MA 5CMDA 1K8MA 1KLGD 2QA4A 2L55A 1QCBD 1TWHH 4OX9Q 2OQKA 1XNQL 1QJOA 2K04A 4BXXH 2I07B 3CC4A 2Z9HA 5AFWA 2VW9A 5BR8L 2IX1A 3S14H 3R8BA 2OTLA 1N36L 1L0WA 3F2DA 1YNXA 2H5XA 3BVZA 3L3OC 1C7YA 4QCLA 2R93H 4FF1A 4HSPA 4H44C 1N32Q 4A3EG 2F0NA 2X6GA 1C4QA 4YCVA 3BDOA 3DMUA 5ELFA 1BNZA 4IFDG 3HOWH 1EOVA 1JT8A 1PH2A 1M4VA 5AJ3Q 4N8X1 1XNRQ 2UXBQ 2NYZD 1NJIC 4DN4M 1D5XC 3GTLB 1CA5A 4LMQD 4OONA 2EJFC 1QNKA 5M3FH 2A6EC 3D4RA 4QL5A 1TR5A 2JA7H 4I65A 3S17B 1WVLA 1K0SA 3OW7A 2N78A 5CBEE 5IGCA 2RDGA 1LTTD 3ZYYX 3PO3H 1D5ZC 3AU7A 5IT9c 4WORA 1KC8C 3K0XA 1SYGA 4H02A 4X6AH 2B2YA 4RCOA 2HDMA 2IX3A 1YHBA 4QF4A 1X3FA 4OWXB 1CSPA 1BO0A 4JCVE 5M5XB 4A3KB 1HR0W 3SE0A 1X56A 2KCTA 1KIXA 3F2BA 5FLMH 2KJXA 5JPMC 2K75A 4KY6A 3K7AB 3J80i 4A3EB 4YCWA 2JN4A 1LLRD 3T1YQ 2ZTEA 4DUYQ 1ESFA 1WJJA 3N6RA 4LF4L 2OEOA 5FK9C 4UP7A 2UUCQ 3GTGH 5CV9A 2F0IA 1IYVA 3F2UA 1ZYRD 3PF4A 1VQIA 4J8QA 4RGMA 2ES2A 1QVGA 3FKIG 3NBIA 3CCRA 2F0MA 2CQAA 1S3OA 4OO1G 4NB3A 1VCIA 5EGTA 3HOXH 1EIGA 3A54A 2B2UC 2JEBI 1KNAA 1VQNA 1NY4A 1F9PA 4I7AA 4KN4C 1BBUA 2F4IA 4L5QA 4DV0Q 1KTKA 1BBWA 5LMUQ 3H94A 3PO3G 1YJNA 1EQVA 1JOOA 4XT3B 3OTOQ 4DV5L 2JK8A 3H0GB 1QZGA 5JAVA 4DV3Q 2K03A 1JE5A 2K14A 4JI6L 3HOVB 3UE1A 3J80E 3HKSA 1YJWA 3MXNA 1Q82C 3A5UA 5C3EB 4NMZA 2DN8A 1NR2A 4RGOS 1G2SA 4DR4Q 1E1OA 3S1QH 5IYCH 3TDQA 2B2VA 4KMUC 3OIQA 2K5VA 4L5SA 1A3UA 3FDTA 4JI8Q 5K36G 2HDLA 3K58A 1VQMA 3BZCA 4PV1C 2R92G 4FDBA 2LSSA 4KJOA 3ULPA 1HCZA 1GJXA 1EQRA 3FPPA 5C6AA 4KN7C 2Y0SB 2F0PA 1SXTA 3V05A 2EOTA 4F88A 3I4NG 3HOYH 1ENAA 2MPMA 1Q90A 3HOYG 2ZXRA 1CKNB 5C0XH 2E2JH 3GTKB 1RTNA 3I4NB 3NWSA 3R3OA 3S1QB 2PPBC 3GTJH 2ATWA 4B3RQ 1DOMA 2MUYA 1OXVA 2R92H 1Q3LA 4KHZA 3H3VC 5JOBA 2JSOA 1AZQA 1PH4A 3ONAB 3K5MA 2RVLA 5E3FA 2ASBA 2N8NA 1TWFH 1H9MA 1XJVA 2BCOA 5ELBA 5HURA 3BJUA 2MJ8A 3PUYA 5D3DA 4DV4L 2PQEA 4O0AA 3LGJA 2N49A 1PH6A 2G9HD 2CWPA 1JWUD 4X64Q 2B2YC 1K83B 1G91A 4X3SA 4R4CA 4QB4A 3R2TA 4YY3L 1GM5A 1E24A 1SJED 1SMXA 2DGYA 1O7LA 1CKNA 4RFBA 1PH3A 2Z1CA 1HZ9A 2XSCA 3D4WA 2X69A 1N33L 2K32A 4NXMQ 4JI5L 3BYTB 1EIFA 2E2IB 2K1BA 1TWCB 4A3LG 1UE1A 1A15A 5LL6S 2AQ2B 1ILPA 3MEFA 4X62L 3HOXG 4RG1A 1RL2A 2KHSA 1LUZA 2WAQG 4A3JB 3HOYB 2NB0A 3CCVA 3FKIH 4PZ7A 2IL8A 2GVAA 5IYDH 4UHVA 1N34Q 2CW0D 1BQQT 2Z0SA 2RCNA 5LMNL 2VY3A 1LV9A 4YHHQ 1I4RA 1A8VA 1TT2A 4LF5Q 3W5OA 4JVZA 1KQSA 4LF8Q 1L0YB 2R7ZH 2KUMA 4LAAA 2D0OA 4LUVA 4L5RC 2Z6KC 1H9RA 1O80A 3RZDB 1MSGA 2QDBA 3OWEB 2Q8IB 3CPWA 4OWTB 1WTVA 4JBKA 2CFMA 2WB1E 2NWGA 3TP5A 4L8JA 4CJ1B 5FLXE 1MKHA 2XGTA 4GLAC 3HZXA 1KLUD 4BA2I 3PF5A 3X3MA 2EJGC 4C3HG 2RA4A 3EROA 3GV6A 4K5XA 1K73C 1PA6A 3A74A 5HGQA 1Z47A 3EFXD 2L9HA 3M4OH 4YCUA 3SDZA 4B08A 4C3IG 2WV6D 1E2WA 2V1CC 1JOKA 3C1EA 1CQFA 1CM9A 3HS0C 3M3YB 2KVMA 1X6OA 3FHWA 4PZ6A 3CF5A 4DV4Q 4DR7L 3CC7A 1Q8KA 5JJLA 2FFKB 2F0HA 4A3JG 1D5MC 1W6KA 3A7AB 3PQIA 1SDFA 4DR5L 2F0GA 4IURA 2UXCQ 4DPGA 4A93H 4ODGA 1STGA 1A3TA 1KDCA 4A3DG 3BU2A 4JV5Q 2F0SA 3V2TA 1U4RA 2A6ED 1ET9A 5I9PA 1X55A 2BA1A 2NN6G 1FGUA 1GUOA 2F0OA 1EWIA 4CKCA 5DM73 4AYBE 4LF5L 3AEVA 1DXMA 2PZUA 3K6OA 3LX0A 4IPGA 2UXDL 1Y8PB 3BZKA 3J7A5 2K5QA 5CV8A 4C3HH 1HNXQ 5ELCA 1M90C 5EKIA 4GLVB 1VS0A 5FLXc 4CDDC 4CKEA 3GQBA 1J6QA 5DNFA 2A69D 2L12A 5M9OA 1SRUA 4GKJQ 3T1YL 4BXXG 4IPHA 3X3NA 3PIP3 2CHBD 4L63B 4BY7B 2PNHA 1QB5D 4BBRH 1TU2B 1DOLA 2D62A 2K50A 3NSWA 4QJFA 2AUKA 3T16A 3GTQH 3OMCA 1HQRD 4BY1G 3I55A 2PYKA 3CC2A 4X66Q 4ULLA 4NPSA 1LTBD 4OWWB 3SK5A 1F2MA 2A69C 4A93B 4A3FB 1PTOC 1DYQA 1IZ6A 2BDOA 1KABA 4U68A 2F0LA 1CT1D 5GQOA 1E3PA 3D3RA 2P5ZX 4L6TB 4ZAIA 2NN6H 2EY1A 1IKMA 4DV1L 4LF4Q 1IXRA 2PQAA 3DWPA 3WOFA 5IYBG 3CKIB 4HMIA 2F4VL 1G6PA 1RKNA 1JICA 3RLOA 2NVTH 2BDNA 1I4PA 2MNAA 2E5LQ 4GOPB 4JI1L 4BA1I 4DR6L 1UE7A 4L5TA 4A3BH 1D1IA 4JPBW 3DXJC 3CCJA 4R1JA 3HEJA 1EYCA 2NUCA 3OYYA 1XPUA 3S16H 3KDFA 2B2WC 4LF9L 1DONA 3PV0A 1OTCA 4JI3L 5J1ZA 1PRTF 4I7ZC 4JI2L 4B3RL 4M8AA 4KV6A 1EFWA 1GVPA 2Y0SE 2N3SA 4MZ9A 3KK7A 4IUPA 4BBSB 1CK1A 4TSSA 3PCOB 4LFBL 1YNNC 2EQSA 1MSHA 3TBIB 1F9SA 4PMWA 4F7XA 1ENCA 3VR6A 3DM1A 4B9XA 3MVVA 2PCFB 3EN2A 3CMEA 1CSQA 4DR2Q 2DJGC 5ELOA 5BN3A 5D65A 4A75A 1IBKL 4CDEC 1ASYA 5C5MA 2PI2A 3GTLH 4LF9Q 1B3AA 3KOJA 1GUTA 2R93B 1HR0Q 3NP8A 4B3SQ 1Q1BA 4WRDA 4A4IA 4DK0A 4JI5Q 5M3FG 3AFQA 4CKBA 2JEAI 3BZDB 5JVG3 1SBBB 5JEAJ 3I70A 4OHJA 4TRDA 3MXPA 4C3JB 2QDLA 2HIXA 4A3LH 4GZYC 4X64L 5C0XJ 5I6YA 1N34L 4MHEA 1YIJA 4QY7A 5E7NA 4XQQA 1SNPA 2B29A 2E2IH 3UI2A 4QUFA 1EEID 1BCPC 4O42A 2SDFA 3EIVA 3E9IA 4GN5A 1TWHB 2CQOA 2RCFA 5FO8B 1PRTB 4PNYA 1J5EQ 4DV2Q 3DLLA 1JWSD 3TP6A 3ULLA 3JAME 4GNXA 1VQOA 1Z7TA 2WKCA 1TWAH 4F87A 1UE5A 1V43A 2EPBA 2UUCL 4AQYQ 5CYUA 3H15A 2D0PA 1KRSA 2NVQH 4DUYL 2V4DA 2LMCB 4K5VA 4OGQC 1T9HA 1JQYD 3PO2H 2Z4HA 5FOBB 3SXHA 4KLKA 2L15A 1Q8IA 1HRJA 3CRLC 1I94L 1IYJB 4HN7A 5FLXL 2CVRA 4NKLA 1O78A 2VQEQ 2OCEA 1K0RA 3HOUG 3K7AH 1VQLA 1KDAA 4FVMA 1B4OA 3QIAA 3AYHB 1EYAA 4GNXB 1CZGA 1II3A 4DR5Q 1BBXC 4LNQA 1EY4A 1TY2A 5E1FA 1WI5A 5IGBA 2B2UA 4MTKA 5IYBH 1TS3A 2RBMA 1S5ED 1A2TA 2AQ3B 4XDXA 1PVOA 3OTOL 1ICWA 4A3CG 4LFBQ 4DXGA 4ZKBB 3CPFA 4IJHA 3C2PA 3KLRA 1CHPD 1O7IA 3VR2A 3OW2A 1DZ1A 1LT6D 3GTMB 1PH9A 3HOXB 3A8KE 3G48A 1QVFA 3K5NA 4JOIC 3QO2A 1BKBA 3RMHA 1EEFD 1PH8A 1B50A 1QUQA 5EJWA 4AQYL 1DCZA 4QIWB 2HHHL 1I50B 3G71A 3NTHA 4H13C 2DNEA 1NBWA 4DR3L 1WTPA 5LMNW 4BY1H 5HY6A 1FNUA 3NENA 4DV2L 1HFGA 2IY5B 1A62A 1G8ZD 1SLJA 1SYBA 2NN6I 3H09A 4CDCC 5A2QE 3CCSA 1OO9B 5KEEA 2OWOA 2UUAQ 3TZDA 1VQAA 1LT5D 1PTOB 3P20A 4A3MG 1X9NA 3GDEA 1SMYC 1RD9D 2SOBA 4GS3A 3A55A 3J81i 2F0KA 4LFAQ 1P16A 3NUCA 1XPOA 1Z9FA 1BF4A 3MXNB 1ZYRC 1KHIA 1GHJA 4XQNA 4LFCQ 1XTCD 1I6HH 2PZTA 3RZOH 2D5DA 3K7UC 1HZBA 1EUJA 1BVSA 2NZOA 3T13A 2IHFA 2VNUD 5C3WA 1EL0A 3TMEA 2AKWB 2Z6KA 1IBLL 3MFYA 3J81c 5KNCA 4A3MB 2OF1A 3HOZH 4YWKA 4HJAA 3NQIA 2E2HH 2CCZA 3OOCA 1XWEA 1ZXTA 2FMMA 2JA9A 3KLWA 5EPJA 1H9JA 2E2HB 4HAEA 1I4HA 4GOPA 3J81E 2A6HC 1SMYD 3GD7A 1G291 2BE5D 1GUSA 2WIIB 3HOVG 2B2TA 1E2ZA 3M4OB 1SROA 5ELEA 3BYYB 1EY8A 2PZWA 4C1NI 3I2ZA 4HCSA 4FNFA 4IFDH 2B63H 5A35A 1XMQL 5KGUA 2PO4A 1S4ZA 5LL6X 3PMFA 3I56A 1GUNA 1IHZA 3E9HA 4GN3B 5F2DA 3HKZE 2G5DA 1PH1A 4NP5A 3HRZC 1W3SA 2N88A 4CDFC 3AMUA 1JJGA 3RN5A 2WINB 4GKKL 1PFNA 5TSSA 1UEAB 4KY5A 3T1HL 2F03A 1FGBD 1DJRD 4LFAL 1NTGA 4EVOA 4PMCA 1FR3A 4X3UA 5IP7H 3MHBA 2AUJD 3SGIA 2UUAL 3NEMA 5C4JB 3WWVA 5KNDA 5M5YH 5A2QL 4HTHA 1EY5A 1GUGA 4G57A 1I4QA 3RD4A 4NXNL 1Y1WH 4A3FG 1CZWA 1F2LA 2JA6H 3I4MH 1ZKOA 1IW7D 5LMNQ 5LMUL 5COYA 1SE3A 3ITPA 1PRTC 3WDNA 5I2YA 3CW2C 3P75A 1I6VC 1R4QB 5H1SE 1PTOH 3HOZG 2SEBD 3M7NA 4DAYB 5M5YB 3KJPA 1TS4A 1WTRA 2KCMA 3RZDH 2A6HD 4FXGC 3BDCA 2F0UA 3GTQB 4G4KA 4JYAQ 1HH2P 2VB3X 4XT1B 3ICEA 4WJ3M 4KKTA 4LUZA 2B8FA 3MZ5A 2R7FA 4C1NK 1PRTD 3ZJYC 2UXDQ 2BA0A 2A1AA 2F0DA 4H7BA 3VYRA 1B53A 3NTKA 4O1NA 4DV6Q 1IW7C 1NCVA 2Q2UA 2A5HA 3J7YW 2PW7A 1F2ZA 4DAMA 3QG1A 3HFZB 1FNWA 2HD3A 3QB3A 2A8VA 3MAQA 4AIMA 3H0GG 3S1MH 1NR4A 1X3GA 2F0WA 2XTIA 2NZHA 3NHHA 4BWGB 2PMZE 5EKKA 3I4MB 3FMCA 3TP8A 4Q5VA 3QOLA 2KEEA 4IOCA 1YITA 2K52A 3SEBA 4XYQA 4KJNA 5M5WH 2Q2IA 3OHXC 4DK6C 1IBML 4OO1I 2KQ3A 2RKSA 1V1OA 1VQGA 4HJ7A 5KNBA 2XN9C 4QUCA 1ZEQX 3M4YA 2EXZA 4ZYSA 3E6ZX 2TMPA 4BBRB 1S40A 1EYGA 2DY7A 4MTNA 4HJ8A 1GXDC 2K33A 3TQYA 4X3TA 1SFOB 3DHQA 4TKOB 3T53B 1DOKA 1HHVA 4ME3A 3TZUA 1LT3D 3LWEA 2BE5C 1PZKD 1L1OB 1SNOA 2VQEL 1PFSA 4DAVA 4A3KG 1OXTA 3A5ZB 2I5HA 1TS5A 3LWUA 5BR8Q 1Y69U 5CC4A 3NWTA 5C3EG 4DK3C 3HG9A 1HNZL 5IT9L 1R4PB 3VDYA 1MGSA 2KENA 4IPDA 1W6JA 4NXNQ 1EU3A 2WB1B 1UNSA 4MNOA 3PO2G 1SR3A 3FEWX 1EOTA 3S1NH 2R3ZA 4JI1Q 3I72A 1FVIA 3K80C 4E6IA 2WAQB 3VYUA 1ML0D 4UY8C 2MFIA 2EZVA 2DY8A 2F3WA 1IBLQ 1IL8A 2NVYH 1QILA 2YTVA 2R7DA 3H3VH 3CCMA 3GTGB 4X62Q 1MHWC 3DWAA 3STBD 3M7GA 3JAMi 2JJQA 3CCQA 1RODA 1Q1EA 1LTAD 2R7ZG 2JXMB 5C4JH 4PQXA 5GAEC 1LTSD 1KAAA 1QZHA 5K36H 3CHBD 1B1ZA 1PTOD 2LS01 3TP7A 2K6AA 4YHHL 1BUVT 1RIPA 1BXTA 2KCCA 1YBYA 2K05A 2ZJRA 4A3BB 1TIID 2XIWA 4KY7A 2CKZB 1I6HB 1STEA 1F2YA 3TEHB 1VQ7A 1JWMD 1BCPD 5IOCA 4JBMA 2D2CC 2I5LX 5EBDA 1JOQA 1Q81C 3P7JA 3E5SA 2NVTB 4C2MB 1BOSA 3T4AC 4C3IB 3AQQA 1TXYA 2ZM6Q 4Y52H 4HIDA 3IKJA 2SNSA 2FJ2A 3U4ZA 1N8RC 1PYSB 1HQMC 1JCKB 4GLXA 3Q6SA 1CQVA 2YYZA 4ME5A 4IPCA 2WAQE 1B8AA 4A3FH 3ERQA 4FP5D 1RDPD 3I3CA 3K81C 3I90A 3SVMA 2VUMH 3S16B 2VB2X 1Q7YC 1LTRD 3PIOA 1GUWA 5EAYA 2LXKA 4B9WA 5J22A 3K59A 3R93A 3S17H 2NTSA 3S14B 4GKJL 3MFGA 3O13A 1WCMB 5IGFA 4RCNA 1SNDA 2M9VA 2ZXPA 1LT4D 3PUVA 2UU9Q 3PIPA 4ZUJA 3U50C 1U4LA 1N36Q 3CQZH 4BS9A 1KAWA 1W2BA 1NNXA 1I5FA 1VQ8A 2UUBL 5CBAE 1C8CA 1VQKA 1GHKA 2YTXA 3H3VI 1X3QA 5M5XH 4A3KH 1LTLA 2B63G 1YEZA 4DAPA 2RHQB 5AJ3L 1EZ8A 3K0YA 1C0AA 1EY6A 2VS1A 4R8NA 3A0JA 2JA7G 2AMCB 1AN8A 4DV7Q 1TWAB 1QUQB 2J7ZA 3OSOA 1Y8OB 4JI0L 2O5JC 4BBSH 3S1RH 4JI4L 1Y1VB 2KECA 1D2BA 1NSNS 2FINB 2EE1A 4JOIA 5M3MG 2F0FA 3KUPA 1AZPA 5JVH3 5I4DA 1P8LA 2NBFA 4DNIA 4DFAA 4A3MH 3HOZB 4ZKCB 3D0FA 2QW7A 1QNUA 4HCEA 4LUOA 3H0GH 1LTGD 4C56C 1SYCA 1X54A 3OIPA 4TQUS 3KF8A 3S1RB 5BN4A 2ENBA 3Q8DA 3M4QA 2Z4IA 2K28A 1YNJC 2A68C 5IP9H 1G2TA 2HUGA 4Y7NH 4X66L 1JB7A 3QR8A 1LYLA 5IYDG 1VMCA 4J15A 3CMAA 2IWHA 2H1EA 1E7ZA 3G4SA 4NW2A 1N9WA 3D31A 4A76A 3N52A 1XNRL 2UXBL 2C9OA 4PZ8A 2NVXB 1K9MC 1V1PA 3M9BA 4QGUA 1CHQD 5J3BA 1RCVD 3RLNA 4R8IA 1VQHA 2EVBA 4A3GH 2MGSA 3U9SA 4BY1B 1HA5A 1PYWD 5GAHC 2UXCL 2VUMB 2J4XA 2XVSA 1K83H 1KNEA 1PH5A 3BVMA 1TWGB 1YZ6A 4K5WA 2EY5A 1GO3E 4DGZA 2EYPA 2YTYA 4GOPC 5IWAQ 5IT9E 3EJIA 3MEHA 4JYAL 1LM0A 1KD1C 2IT1A 1IL2A 1HR0L 4B3SL 4N9PA 1X3PA 4KTAA 4DR6Q 4RKBA 4G7OC 2K5HA 2JA6B 2L4NA 1MIUA 2QF7A 3B6YA 1BDOA 1EFID 4K8IA 3MTSA 1IBKQ 1KXLA 4DR2L 2F1MA 3UDGA 3UDIA 2EIFA 1QE6A 4JV5L 1PFMA 3CRKC 4ZQ3A 1WFQA 1VQ6A 3J7ZC 4IFDJ 4OIJA 1QG7A 3A56A 2F52A 3I73A 3RNUA 1EY0A 1TWCH 4CHTB 5EBCA 3BS1A 3D6CA 2EY2A 3H91A 4K6LA 5GROA 4WJWA 4IO9A 4R4QA 2EYJA 1A2UA 2DNCA 1NMGA 4FYDA 1EZ6A 2L1BA 3W1GA 5J39A 4YWMA 1EU4A 1SE2A 4FF2A 3JAML 5LHY1 1RJTA 2Y0SG 1JORA 4R4OA 4NDXA 1K8AC 2N55A 1U5KA 1XX8A 4M1UB 4HMJA 2EYFA 2TSSA 4K0KL 2E2JB 2R61A 4HR7B 1UWVA 4JI7Q 3E0JA 2MO0A 2PMZB 1R9TH 2FMCA 3URYA 1PXUA 1SJHD 2RF4A 2GVBA 2B2VC 4MIUA 3J80c 5NUCA 2CW0C 1HTPA 2LY7A 5CR3A 3NPPA 3NTIA 2F3IA 1UAPA 1WTOA 4ILWA 1SYDA 1CKMA 3OPOA 5C4XG 4DUZQ 2M00A 3TS0A 4DNTB 2WACA 2G9DA 1ASZA 4IJLA 3DEPA 1I94Q 1YNND 4EQNA 3L7ZC 3F8TA 4KD3A 1HPCA 3GTKH 3MXUA 3I7FA 2WB1G 4YIJA 4V190 5CV7A 1HUNA 1ESRA 3I4LA 5E4XA 4LF7Q 5FJ8G 3OMGA 1HTLD 1TS2A 1AFPA 2AHOB 2K7VA 3EQLC 1FL0A 5L37A 2NZ1D 1L1OA 4WFN3 4S3SA 4ZRZA 4CJ2C 4WJ4A 1D7QA 3TN2A 1JC7A 2EYMA 1HA6A 2MP1A 1EWCA 1D8LA 1I4GA 2F0JA 1AE2A 3I4NH 2RDHA 1DGSA 3ERSX 3KBXA 1S72A 4RGNA 2R7ZB 2PQAB 3SK6A 3U4VA 3M3YH 5KRUA 3W3AA 2EYHA 4GNXC 4KK7A 2JA7B 1UUPA 5IODA 2QEXA 3MA2B 4K0KQ 4QMGA 1J8IA 3ND8A 3RR5A 3J81L 3S15H 2EDGA 5IYCG 2K4KA 3RUZA 1VQ4A 2QCPX 4DR1L 3MWYW 1F9RA 1T5EA 1HNZQ 2R6GA 4A3BG 1HZAA 2QGQA 3PIO3 4A3IB 2VXWA 1MJEA 1HNWQ
chains in the Genus database with same CATH topology
4A3IH 4DK6C 2VQFQ 4OX9L 1J6QA 1VQCA 3NBHB 4DV7L 1IBML 4OO1I 4HJ5A 4HIMA 1SRUA 1GKHA 4UP9A 3T1YL 1SN8A 1VQGA 2VL6A 4IPHA 4HJ7A 1L2FA 4BXXG 1XMQQ 3RN2A 2PNHA 3ER0A 1XTDA 4GN4B 4KHPQ 4BBRH 1JJCB 3TREA 3UDFA 4BY7H 2D62A 2K50A 4OO1G 4QJFA 3GTQH 3IRBA 1EYGA 1S40A 2ID0A 1JMCA 4LW1A 5JJIA 4BY1G 2JQOA 4MTNA 3I55A 4HJ8A 2ZTDA 1X65A 3TQYA 4B3TQ 3CC2A 4X66Q 1FJGL 1PYBA 4NPSA 4DV6L 4OWWB 2JA8H 1KRTA 1CUKA 3KFUA 4ME3A 2HQLA 3GTPH 1IZ6A 2AWOA 4X65Q 1L1OB 3TRZA 2VQEL 1PFSA 4A3KG 4IFDI 1OXTA 3A5ZB 5GQOA 1E3PA 2I5HA 4DV5Q 1OXUA 5BR8Q 1YJ9A 2A19A 4DV1L 4JI0Q 4LF4Q 1IXRA 2PQAA 5C3EG 4DR4L 1VQDA 4DK3C 4P71A 5IYBG 1VQEA 5C0XG 3VDYA 1HNZL 4P73A 2F4VL 2KENA 4IPDA 1M1KC 4JI7L 1G6PA 5IWAL 3RLOA 4NXNQ 4P75A 5FLMG 2OQ0A 2NVTH 4P74A 4MNOA 3K8AA 3L2PA 1SR3A 3PO2G 1N32L 2MNAA 1U0LA 4XIGS 3S24A 2E5LQ 3S1NH 2B3GA 4ALPA 4GOPB 4JI1Q 4JI1L 3M4PA 1FVIA 3K80C 4BA1I 5C44H 4POGA 4DR6L 2Q2TA 1UE7A 3CAMA 4L5TA 4UY8C 4YY3Q 1PHJA 2MFIA 4A3BH 5JJKA 1OXSC 1WOCA 3KF6B 1IBLQ 3CCJA 1J5EL 2NVYH 2YTVA 4R1JA 4DUZL 2R7DA 3CCLA 3CCMA 1XNQQ 3H3VH 4A3DH 4X62Q 3CXCA 3KYHC 3OYYA 2HT1A 1C9OA 1XPUA 4A93G 1NE3A 3STBD 3JAMi 2YU9H 4BBSG 3S16H 2JJQA 3KDFA 3CCQA 1Q1EA 5GADC 2GN5A 1XMOQ 2R7ZG 1K8GA 4LF9L 4A3GG 3CCEA 4NXML 3PV0A 5C4JH 4R4TA 5GAEC 1NMFA 1UEBA 1OXXK 2CWAA 1OTCA 3TS2A 4JI3L 1VQBA 1QZHA 2HIVA 2JA6G 3KDFB 3I4OA 4JI2L 4B3RL 1EFWA 1WCMH 1GVPA 2Y0SE 4YHHL 1YI2A 2N3SA 2PI2E 5GAGC 4MZ9A 2VZAA 1RIPA 1HJPA 1I50H 3KF6A 1YBYA 3PCOB 4LFBL 2EQSA 2JA5H 2ZJRA 1VQJA 3GTOH 4PMWA 2CKZB 3TEHB 1VQ7A 1V9PA 2UU9L 4B3ML 4JBMA 2QA4A 3EN2A 2I5LX 3CMEA 1CSQA 4DR2Q 1Q81C 1A0IA 5ELOA 4A75A 1IBKL 1TWHH 4OX9Q 2OQKA 2YV5A 1ASYA 1XNQL 2PI2A 2I0QA 4BXXH 3GTLH 1CKOA 4LF9Q 3CC4A 3AQQA 1XPRA 1MJCA 3KOJA 1TXYA 5BR8L 2VW9A 1YHAA 2ZM6Q 4HIOA 2IX1A 3S14H 1G51A 4C3IH 2OTLA 1N36L 1L0WA 4HIDA 2E8GA 4Y52H 4XTCS 1YNXA 2H5XA 3F2DA 1HR0Q 4B3SQ 1Q1BA 4JI6Q 4A4IA 1C7YA 4JI5Q 5M3FG 3U4ZA 1N8RC 3ULJA 3S2HH 3AFQA 1PYSB 1YHQA 4GLXA 2HHHQ 2JEAI 3CD6A 2R93H 3AFPA 5JEAJ 1N32Q 2WP8J 4QQBX 4A3EG 2YYZA 1B70B 2JA5G 2HIXA 4YCVA 1FJGQ 4A3LH 4IPCA 1K3RA 1B8AA 2WAQE 4A3FH 4X64L 1WYDA 4LF6L 5C0XJ 4IFDG 3HOWH 1EOVA 4X6AH 1JT8A 3K81C 2VUMH 1E22A 1PH2A 1N34L 5AJ3Q 4DV1Q 4QY7A 5E7NA 1YIJA 1Q7YC 1XNRQ 3PIOA 2UXBQ 2B29A 5EAYA 2E2IH 1NJIC 2LXKA 4OONA 3S17H 3EIVA 3E9IA 4GN5A 3GO5A 2AWNA 5M3FH 2LXJA 2CQOA 4BY7G 4QL5A 2IHEA 2JA7H 3KF8B 4GKJL 2N78A 1J5EQ 4DV2Q 3DLLA 2UUBQ 3PO3H 1EIYB 4B3MQ 3ULLA 2UU9Q 4GNXA 3PUVA 1VQOA 1H95A 3PIPA 5IT9c 4A3IG 1TWAH 1KC8C 3K0XA 3U50C 1VQ5A 3EBEA 1N36Q 3CQZH 2KHIA 4H02A 1UE5A 1KAWA 1V43A 5C0XI 3UE0A 2ZJPA 1I5FA 1YHBA 4APVA 1W2BA 1VQ8A 2UUCL 4AQYQ 2RHSB 1VQKA 3H15A 2UUBL 3I4MG 2D0PA 2YTXA 1X3FA 1KRSA 5M5XH 4A3KH 2NVQH 3H3VI 2IX0A 4UPAA 4OWXB 4DUYL 1CSPA 4JCVE 5IE8A 1LTLA 1HR0W 2B63G 1T9HA 1X56A 3PO2H 2KCTA 4KLKA 1KIXA 3F2BA 2L15A 5FLMH 4PG3A 1I94L 2K75A 1IYJB 1YEZA 2RHQB 4JI6L 5AJ3L 4A3EH 1C0AA 2VS1A 4LWCA 2OCEA 2VQEQ 2JA7G 3A0JA 1K0RA 3J80i 4YCWA 3UDXA 3T1YQ 2AMCB 3K7AH 1VQLA 3HOUG 2ZTEA 4DV7Q 1IBMQ 1QUQB 4DUYQ 4YWLA 3AYHB 1WJJA 4BBRG 4JI0L 4LF4L 4GNXB 3G6EA 4UP7A 2UUCQ 3GTGH 4DR5Q 4BBSH 3S1RH 4LNQA 3PF4A 4KI0A 1VQFA 1VQIA 1WI5A 2ES2A 4JI4L 1QVGA 5IYBH 3FKIG 3CCUA 1HZCA 3CCRA 4O2DA 1PVOA 3OTOL 1S3OA 4EX5A 4A3CG 4LFBQ 4OXPA 4NB3A 1VCIA 3CPFA 4IJHA 4JOIA 5M3MG 4DR1Q 3M85A 4LF7L 3HOXH 1O7IA 3OW2A 1P8LA 3RLFA 4DNIA 2JEBI 1PH9A 1GD7A 3G48A 1QVFA 1VQNA 5JEAG 1NY4A 3GTMH 4GKJQ 4A3MH 4JOIC 1BBUA 1BKBA 3D0FA 2VQFL 1V1QA 1PH8A 1VQ9A 2VUMG 2JA8G 4L5QA 4DV0Q 1QUQA 1BBWA 4LUOA 4AQYL 3H0GH 5LMUQ 3PO3G 2HHHL 2MO1A 1YJNA 3G71A 4JBWA 3OTOQ 4DV5L 1X54A 4TQUS 1NBWA 3HOVH 4DR3L 2JK8A 5LMNW 5IY0A 1QZGA 4BY1H 2JE6I 5HY6A 1JE5A 2K14A 3Q8DA 3M4QA 3CP0A 4DV3Q 4HIKA 3UE1A 1Y1VH 3HKSA 3NENA 1YJWA 5IP9H 4DV2L 1Q82C 3A5UA 2IY5B 4DR7Q 1A62A 1SLJA 4Y7NH 2NN6I 3NELA 4X66L 1JB7A 4DR4Q 1TWGH 2KBNA 1LYLA 2ZJQA 1E1OA 5IYDG 1HNXL 4J15A 3CMAA 3S1QH 5IYCH 1E7ZA 3CCSA 3G4SA 2OWOA 1B7YB 1N9WA 3D31A 2UUAQ 4RMFA 2K5VA 1VQAA 4A76A 4A3MG 1X9NA 4L5SA 3GDEA 1EQQA 1XNRL 2UXBL 1L1OC 1Q12A 4PZ8A 4JI8Q 5K36G 2R92G 1VQMA 3BZCA 4GS3A 1K9MC 3M9BA 4QGUA 5J3BA 4FDBA 2LSSA 3J81i 4LFAQ 1KL9A 1P16A 3RLNA 3ULPA 1VQHA 1EQRA 4A3GH 1XPOA 2MQHA 1Z9FA 3PUWA 2WFWA 3STBC 5GAHC 3MXNB 3I4NG 3HOYH 2UXCL 3HOYG 1CKNB 1K83H 1KHIA 1PH5A 4X65L 1YZ6A 2E2JH 4LFCQ 1I6HH 3RZOH 1GO3E 2YTYA 3K7UC 4GOPC 3GTJH 5IWAQ 1HZBA 1EUJA 1BVSA 2NZOA 2ATWA 2IHFA 3PGZA 4B3RQ 2VNUD 3JAMc 1OXVA 2R92H 4KHZA 4JYAL 1LM0A 1KD1C 2AKWB 2IT1A 2Z6KA 4C2MH 1IBLL 1IL2A 1HR0L 4B3SL 1PH4A 3J81c 2ASBA 2N8NA 1TWFH 3HOZH 1XJVA 4DR6Q 4JG2A 4YWKA 4HJAA 1JJ2A 2K5HA 3BJUA 3PUYA 2E2HH 4DV4L 2CCZA 1A63A 1MIUA 4O0AA 3KLWA 4KHPL 2JA9A 3B6YA 3LGJA 1IBKQ 1KXLA 2FXQA 2N49A 4QIWE 4DR2L 2CWPA 3UDGA 1PH6A 4X64Q 3UDIA 1E1TA 2EIFA 4GOPA 4C3JH 4JV5L 4R4CA 1GM5A 4YY3L 1E24A 3GD7A 1G291 4B3TL 1HNWL 1WFQA 1VQPA 1SMXA 2DGYA 1VQ6A 1CKNA 3J7ZC 1PH3A 3HOVG 4IFDJ 1HZ9A 1SROA 1AH9A 2K5NA 3E0EA 1N33L 2ZTCA 1N33Q 2BH2A 4NXMQ 2F52A 4JI5L 3RNUA 1TWCH 1EIFA 3I2ZA 4UP8A 2B63H 4LF8L 2ZM6L 1XMQL 4A3LG 1UE1A 3I56A 3E9HA 4GN3B 5GROA 4IO9A 3HKZE 4R4QA 5C4XH 3FP9A 3MEFA 4X62L 1PH1A 1NMGA 3HOXG 1W3SA 4RG1A 1RL2A 2EXDA 2OTJA 4AH6A 3W1GA 2WAQG 1LUZA 1X3EA 1JJGA 4YWMA 3RN5A 3CCVA 3FKIH 4JBJA 3HOWG 4PZ7A 4GKKL 2GVAA 3L0OA 1WCMG 1QVCA 3PUZA 3T1HL 1N34Q 5IYDH 2Z0SA 2RCNA 2Y0SG 5LMNL 4LFAL 4R4OA 2VY3A 1K8AC 3JC66 4EQ5A 1NTGA 1U5KA 4P72A 4YHHQ 4JC0A 5IP7H 1A8VA 1PH7A 4LF5Q 2DUDA 4R4IA 3W5OA 3HOUH 4JI7Q 1UWVA 1KQSA 4LF8Q 2MO0A 3HKZG 3SGIA 2UUAL 2R7ZH 3W1BA 1R9TH 2D0OA 3NEMA 4LUVA 3WWVA 3KJOA 4L5RC 1Y14B 2Z6KC 3S2DH 5M5YH 2RF4A 4OWTB 2GVBA 3CPWA 1XMOL 2E5LL 2CFMA 4JBKA 2WB1E 3J80c 1SFOH 4NXNL 1MKHA 2XGTA 4GLAC 4A3FG 4TVAB 1Y1WH 2F3IA 4BA2I 3PF5A 2JA6H 1CKMA 5C4XG 3I4MH 4DUZQ 5LMNQ 1UE6A 5IP9G 3TS0A 2R93G 1ASZA 5IP7G 5LMUL 1K73C 3A74A 1AE3A 5HGQA 1PA6A 1Z47A 4IJLA 1I94Q 3M4OH 4YCUA 2Q2HA 3L7ZC 3F8TA 3CW2C 2V1CC 3U58A 3GTKH 2ALYB 3I7FA 2WB1G 5H1SE 3HOZG 3M7NA 4POFA 3CF5A 1X6OA 3FHWA 4PZ6A 4DAYB 3J81j 4DV4Q 4DR7L 3CC7A 3KJPA 4LF7Q 5FJ8G 1Q8KA 5JJLA 4JI2Q 2KCMA 3RZDH 5DLQE 3F2CA 4A3JG 4JI3Q 2BH8A 2AHOB 1YVCA 1FL0A 4AYBG 4DR3Q 5M3MH 4JYAQ 1L1OA 2I5MX 5FJ8H 4DR5L 1HH2P 2UXCQ 4DPGA 4A93H 4WJ4A 1D7QA 1I3QH 4DV0L 3PSIA 1SE8A 3ICEA 4A3DG 3BU2A 4WJ3M 4LUZA 4K0KL 2KHJA 4JV5Q 2R7FA 1D8LA 4LFCL 3ZJYC 2UXDQ 1AE2A 2BA0A 3I4NH 1DGSA 3ERSX 2A1AA 5ELNA 1X55A 3F1ZA 4JI8L 5C3EH 5C44G 4DV6Q 1S72A 3T1HQ 2PQAB 2BA1A 2NN6G 2Q2UA 1FGUA 3U4VA 3M3YH 1EWIA 1Q86C 1PV4A 1Q46A 4DAMA 3HFZB 4GNXC 4AYBE 4LF6Q 2A8VA 4DKAC 2QEXA 4LF5L 4K0KQ 4AIMA 3AEVA 3H0GG 3S1MH 1X3GA 2XTIA 3RR5A 2NZHA 5IYCG 3S15H 3DM3A 2K4KA 2NVXH 1VQ4A 2PMZE 4IPGA 4IOAA 4DR1L 2UXDL 4HJ9A 4A3BG 1HNZQ 2R6GA 2F4VQ 4DV3L 1HZAA 2QGQA 3BZKA 3J7A5 4GKKQ 4C3HH 4JI4Q 4A3JH 1HNXQ 4IOCA 1M90C 3PUXA 1Y1VG 1YITA 4GLVB 1VS0A 2C35B 2K52A 5FLXc 1HNWQ 4A3CH 1MJEA 1Y1WG 5M5WH 2Q2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3I H;  4DK6 C;  2VQF Q;  4OX9 L;  1J6Q A;  1VQC A;  3NBH B;  4DV7 L;  1IBM L;  4OO1 I;  4HJ5 A;  4HIM A;  1SRU A;  1GKH A;  4UP9 A;  3T1Y L;  1SN8 A;  1VQG A;  2VL6 A;  4IPH A;  4HJ7 A;  1L2F A;  4BXX G;  1XMQ Q;  3RN2 A;  2PNH A;  3ER0 A;  1XTD A;  4GN4 B;  4KHP Q;  4BBR H;  1JJC B;  3TRE A;  3UDF A;  4BY7 H;  2D62 A;  2K50 A;  4OO1 G;  4QJF A;  3GTQ H;  3IRB A;  1EYG A;  1S40 A;  2ID0 A;  1JMC A;  4LW1 A;  5JJI A;  4BY1 G;  2JQO A;  4MTN A;  3I55 A;  4HJ8 A;  2ZTD A;  1X65 A;  3TQY A;  4B3T Q;  3CC2 A;  4X66 Q;  1FJG L;  1PYB A;  4NPS A;  4DV6 L;  4OWW B;  2JA8 H;  1KRT A;  1CUK A;  3KFU A;  4ME3 A;  2HQL A;  3GTP H;  1IZ6 A;  2AWO A;  4X65 Q;  1L1O B;  3TRZ A;  2VQE L;  1PFS A;  4A3K G;  4IFD I;  1OXT A;  3A5Z B;  5GQO A;  1E3P A;  2I5H A;  4DV5 Q;  1OXU A;  5BR8 Q;  1YJ9 A;  2A19 A;  4DV1 L;  4JI0 Q;  4LF4 Q;  1IXR A;  2PQA A;  5C3E G;  4DR4 L;  1VQD A;  4DK3 C;  4P71 A;  5IYB G;  1VQE A;  5C0X G;  3VDY A;  1HNZ L;  4P73 A;  2F4V L;  2KEN A;  4IPD A;  1M1K C;  4JI7 L;  1G6P A;  5IWA L;  3RLO A;  4NXN Q;  4P75 A;  5FLM G;  2OQ0 A;  2NVT H;  4P74 A;  4MNO A;  3K8A A;  3L2P A;  1SR3 A;  3PO2 G;  1N32 L;  2MNA A;  1U0L A;  4XIG S;  3S24 A;  2E5L Q;  3S1N H;  2B3G A;  4ALP A;  4GOP B;  4JI1 Q;  4JI1 L;  3M4P A;  1FVI A;  3K80 C;  4BA1 I;  5C44 H;  4POG A;  4DR6 L;  2Q2T A;  1UE7 A;  3CAM A;  4L5T A;  4UY8 C;  4YY3 Q;  1PHJ A;  2MFI A;  4A3B H;  5JJK A;  1OXS C;  1WOC A;  3KF6 B;  1IBL Q;  3CCJ A;  1J5E L;  2NVY H;  2YTV A;  4R1J A;  4DUZ L;  2R7D A;  3CCL A;  3CCM A;  1XNQ Q;  3H3V H;  4A3D H;  4X62 Q;  3CXC A;  3KYH C;  3OYY A;  2HT1 A;  1C9O A;  1XPU A;  4A93 G;  1NE3 A;  3STB D;  3JAM i;  2YU9 H;  4BBS G;  3S16 H;  2JJQ A;  3KDF A;  3CCQ A;  1Q1E A;  5GAD C;  2GN5 A;  1XMO Q;  2R7Z G;  1K8G A;  4LF9 L;  4A3G G;  3CCE A;  4NXM L;  3PV0 A;  5C4J H;  4R4T A;  5GAE C;  1NMF A;  1UEB A;  1OXX K;  2CWA A;  1OTC A;  3TS2 A;  4JI3 L;  1VQB A;  1QZH A;  2HIV A;  2JA6 G;  3KDF B;  3I4O A;  4JI2 L;  4B3R L;  1EFW A;  1WCM H;  1GVP A;  2Y0S E;  4YHH L;  1YI2 A;  2N3S A;  2PI2 E;  5GAG C;  4MZ9 A;  2VZA A;  1RIP A;  1HJP A;  1I50 H;  3KF6 A;  1YBY A;  3PCO B;  4LFB L;  2EQS A;  2JA5 H;  2ZJR A;  1VQJ A;  3GTO H;  4PMW A;  2CKZ B;  3TEH B;  1VQ7 A;  1V9P A;  2UU9 L;  4B3M L;  4JBM A;  2QA4 A;  3EN2 A;  2I5L X;  3CME A;  1CSQ A;  4DR2 Q;  1Q81 C;  1A0I A;  5ELO A;  4A75 A;  1IBK L;  1TWH H;  4OX9 Q;  2OQK A;  2YV5 A;  1ASY A;  1XNQ L;  2PI2 A;  2I0Q A;  4BXX H;  3GTL H;  1CKO A;  4LF9 Q;  3CC4 A;  3AQQ A;  1XPR A;  1MJC A;  3KOJ A;  1TXY A;  5BR8 L;  2VW9 A;  1YHA A;  2ZM6 Q;  4HIO A;  2IX1 A;  3S14 H;  1G51 A;  4C3I H;  2OTL A;  1N36 L;  1L0W A;  4HID A;  2E8G A;  4Y52 H;  4XTC S;  1YNX A;  2H5X A;  3F2D A;  1HR0 Q;  4B3S Q;  1Q1B A;  4JI6 Q;  4A4I A;  1C7Y A;  4JI5 Q;  5M3F G;  3U4Z A;  1N8R C;  3ULJ A;  3S2H H;  3AFQ A;  1PYS B;  1YHQ A;  4GLX A;  2HHH Q;  2JEA I;  3CD6 A;  2R93 H;  3AFP A;  5JEA J;  1N32 Q;  2WP8 J;  4QQB X;  4A3E G;  2YYZ A;  1B70 B;  2JA5 G;  2HIX A;  4YCV A;  1FJG Q;  4A3L H;  4IPC A;  1K3R A;  1B8A A;  2WAQ E;  4A3F H;  4X64 L;  1WYD A;  4LF6 L;  5C0X J;  4IFD G;  3HOW H;  1EOV A;  4X6A H;  1JT8 A;  3K81 C;  2VUM H;  1E22 A;  1PH2 A;  1N34 L;  5AJ3 Q;  4DV1 Q;  4QY7 A;  5E7N A;  1YIJ A;  1Q7Y C;  1XNR Q;  3PIO A;  2UXB Q;  2B29 A;  5EAY A;  2E2I H;  1NJI C;  2LXK A;  4OON A;  3S17 H;  3EIV A;  3E9I A;  4GN5 A;  3GO5 A;  2AWN A;  5M3F H;  2LXJ A;  2CQO A;  4BY7 G;  4QL5 A;  2IHE A;  2JA7 H;  3KF8 B;  4GKJ L;  2N78 A;  1J5E Q;  4DV2 Q;  3DLL A;  2UUB Q;  3PO3 H;  1EIY B;  4B3M Q;  3ULL A;  2UU9 Q;  4GNX A;  3PUV A;  1VQO A;  1H95 A;  3PIP A;  5IT9 c;  4A3I G;  1TWA H;  1KC8 C;  3K0X A;  3U50 C;  1VQ5 A;  3EBE A;  1N36 Q;  3CQZ H;  2KHI A;  4H02 A;  1UE5 A;  1KAW A;  1V43 A;  5C0X I;  3UE0 A;  2ZJP A;  1I5F A;  1YHB A;  4APV A;  1W2B A;  1VQ8 A;  2UUC L;  4AQY Q;  2RHS B;  1VQK A;  3H15 A;  2UUB L;  3I4M G;  2D0P A;  2YTX A;  1X3F A;  1KRS A;  5M5X H;  4A3K H;  2NVQ H;  3H3V I;  2IX0 A;  4UPA A;  4OWX B;  4DUY L;  1CSP A;  4JCV E;  5IE8 A;  1LTL A;  1HR0 W;  2B63 G;  1T9H A;  1X56 A;  3PO2 H;  2KCT A;  4KLK A;  1KIX A;  3F2B A;  2L15 A;  5FLM H;  4PG3 A;  1I94 L;  2K75 A;  1IYJ B;  1YEZ A;  2RHQ B;  4JI6 L;  5AJ3 L;  4A3E H;  1C0A A;  2VS1 A;  4LWC A;  2OCE A;  2VQE Q;  2JA7 G;  3A0J A;  1K0R A;  3J80 i;  4YCW A;  3UDX A;  3T1Y Q;  2AMC B;  3K7A H;  1VQL A;  3HOU G;  2ZTE A;  4DV7 Q;  1IBM Q;  1QUQ B;  4DUY Q;  4YWL A;  3AYH B;  1WJJ A;  4BBR G;  4JI0 L;  4LF4 L;  4GNX B;  3G6E A;  4UP7 A;  2UUC Q;  3GTG H;  4DR5 Q;  4BBS H;  3S1R H;  4LNQ A;  3PF4 A;  4KI0 A;  1VQF A;  1VQI A;  1WI5 A;  2ES2 A;  4JI4 L;  1QVG A;  5IYB H;  3FKI G;  3CCU A;  1HZC A;  3CCR A;  4O2D A;  1PVO A;  3OTO L;  1S3O A;  4EX5 A;  4A3C G;  4LFB Q;  4OXP A;  4NB3 A;  1VCI A;  3CPF A;  4IJH A;  4JOI A;  5M3M G;  4DR1 Q;  3M85 A;  4LF7 L;  3HOX H;  1O7I A;  3OW2 A;  1P8L A;  3RLF A;  4DNI A;  2JEB I;  1PH9 A;  1GD7 A;  3G48 A;  1QVF A;  1VQN A;  5JEA G;  1NY4 A;  3GTM H;  4GKJ Q;  4A3M H;  4JOI C;  1BBU A;  1BKB A;  3D0F A;  2VQF L;  1V1Q A;  1PH8 A;  1VQ9 A;  2VUM G;  2JA8 G;  4L5Q A;  4DV0 Q;  1QUQ A;  1BBW A;  4LUO A;  4AQY L;  3H0G H;  5LMU Q;  3PO3 G;  2HHH L;  2MO1 A;  1YJN A;  3G71 A;  4JBW A;  3OTO Q;  4DV5 L;  1X54 A;  4TQU S;  1NBW A;  3HOV H;  4DR3 L;  2JK8 A;  5LMN W;  5IY0 A;  1QZG A;  4BY1 H;  2JE6 I;  5HY6 A;  1JE5 A;  2K14 A;  3Q8D A;  3M4Q A;  3CP0 A;  4DV3 Q;  4HIK A;  3UE1 A;  1Y1V H;  3HKS A;  3NEN A;  1YJW A;  5IP9 H;  4DV2 L;  1Q82 C;  3A5U A;  2IY5 B;  4DR7 Q;  1A62 A;  1SLJ A;  4Y7N H;  2NN6 I;  3NEL A;  4X66 L;  1JB7 A;  4DR4 Q;  1TWG H;  2KBN A;  1LYL A;  2ZJQ A;  1E1O A;  5IYD G;  1HNX L;  4J15 A;  3CMA A;  3S1Q H;  5IYC H;  1E7Z A;  3CCS A;  3G4S A;  2OWO A;  1B7Y B;  1N9W A;  3D31 A;  2UUA Q;  4RMF A;  2K5V A;  1VQA A;  4A76 A;  4A3M G;  1X9N A;  4L5S A;  3GDE A;  1EQQ A;  1XNR L;  2UXB L;  1L1O C;  1Q12 A;  4PZ8 A;  4JI8 Q;  5K36 G;  2R92 G;  1VQM A;  3BZC A;  4GS3 A;  1K9M C;  3M9B A;  4QGU A;  5J3B A;  4FDB A;  2LSS A;  3J81 i;  4LFA Q;  1KL9 A;  1P16 A;  3RLN A;  3ULP A;  1VQH A;  1EQR A;  4A3G H;  1XPO A;  2MQH A;  1Z9F A;  3PUW A;  2WFW A;  3STB C;  5GAH C;  3MXN B;  3I4N G;  3HOY H;  2UXC L;  3HOY G;  1CKN B;  1K83 H;  1KHI A;  1PH5 A;  4X65 L;  1YZ6 A;  2E2J H;  4LFC Q;  1I6H H;  3RZO H;  1GO3 E;  2YTY A;  3K7U C;  4GOP C;  3GTJ H;  5IWA Q;  1HZB A;  1EUJ A;  1BVS A;  2NZO A;  2ATW A;  2IHF A;  3PGZ A;  4B3R Q;  2VNU D;  3JAM c;  1OXV A;  2R92 H;  4KHZ A;  4JYA L;  1LM0 A;  1KD1 C;  2AKW B;  2IT1 A;  2Z6K A;  4C2M H;  1IBL L;  1IL2 A;  1HR0 L;  4B3S L;  1PH4 A;  3J81 c;  2ASB A;  2N8N A;  1TWF H;  3HOZ H;  1XJV A;  4DR6 Q;  4JG2 A;  4YWK A;  4HJA A;  1JJ2 A;  2K5H A;  3BJU A;  3PUY A;  2E2H H;  4DV4 L;  2CCZ A;  1A63 A;  1MIU A;  4O0A A;  3KLW A;  4KHP L;  2JA9 A;  3B6Y A;  3LGJ A;  1IBK Q;  1KXL A;  2FXQ A;  2N49 A;  4QIW E;  4DR2 L;  2CWP A;  3UDG A;  1PH6 A;  4X64 Q;  3UDI A;  1E1T A;  2EIF A;  4GOP A;  4C3J H;  4JV5 L;  4R4C A;  1GM5 A;  4YY3 L;  1E24 A;  3GD7 A;  1G29 1;  4B3T L;  1HNW L;  1WFQ A;  1VQP A;  1SMX A;  2DGY A;  1VQ6 A;  1CKN A;  3J7Z C;  1PH3 A;  3HOV G;  4IFD J;  1HZ9 A;  1SRO A;  1AH9 A;  2K5N A;  3E0E A;  1N33 L;  2ZTC A;  1N33 Q;  2BH2 A;  4NXM Q;  2F52 A;  4JI5 L;  3RNU A;  1TWC H;  1EIF A;  3I2Z A;  4UP8 A;  2B63 H;  4LF8 L;  2ZM6 L;  1XMQ L;  4A3L G;  1UE1 A;  3I56 A;  3E9H A;  4GN3 B;  5GRO A;  4IO9 A;  3HKZ E;  4R4Q A;  5C4X H;  3FP9 A;  3MEF A;  4X62 L;  1PH1 A;  1NMG A;  3HOX G;  1W3S A;  4RG1 A;  1RL2 A;  2EXD A;  2OTJ A;  4AH6 A;  3W1G A;  2WAQ G;  1LUZ A;  1X3E A;  1JJG A;  4YWM A;  3RN5 A;  3CCV A;  3FKI H;  4JBJ A;  3HOW G;  4PZ7 A;  4GKK L;  2GVA A;  3L0O A;  1WCM G;  1QVC A;  3PUZ A;  3T1H L;  1N34 Q;  5IYD H;  2Z0S A;  2RCN A;  2Y0S G;  5LMN L;  4LFA L;  4R4O A;  2VY3 A;  1K8A C;  3JC6 6;  4EQ5 A;  1NTG A;  1U5K A;  4P72 A;  4YHH Q;  4JC0 A;  5IP7 H;  1A8V A;  1PH7 A;  4LF5 Q;  2DUD A;  4R4I A;  3W5O A;  3HOU H;  4JI7 Q;  1UWV A;  1KQS A;  4LF8 Q;  2MO0 A;  3HKZ G;  3SGI A;  2UUA L;  2R7Z H;  3W1B A;  1R9T H;  2D0O A;  3NEM A;  4LUV A;  3WWV A;  3KJO A;  4L5R C;  1Y14 B;  2Z6K C;  3S2D H;  5M5Y H;  2RF4 A;  4OWT B;  2GVB A;  3CPW A;  1XMO L;  2E5L L;  2CFM A;  4JBK A;  2WB1 E;  3J80 c;  1SFO H;  4NXN L;  1MKH A;  2XGT A;  4GLA C;  4A3F G;  4TVA B;  1Y1W H;  2F3I A;  4BA2 I;  3PF5 A;  2JA6 H;  1CKM A;  5C4X G;  3I4M H;  4DUZ Q;  5LMN Q;  1UE6 A;  5IP9 G;  3TS0 A;  2R93 G;  1ASZ A;  5IP7 G;  5LMU L;  1K73 C;  3A74 A;  1AE3 A;  5HGQ A;  1PA6 A;  1Z47 A;  4IJL A;  1I94 Q;  3M4O H;  4YCU A;  2Q2H A;  3L7Z C;  3F8T A;  3CW2 C;  2V1C C;  3U58 A;  3GTK H;  2ALY B;  3I7F A;  2WB1 G;  5H1S E;  3HOZ G;  3M7N A;  4POF A;  3CF5 A;  1X6O A;  3FHW A;  4PZ6 A;  4DAY B;  3J81 j;  4DV4 Q;  4DR7 L;  3CC7 A;  3KJP A;  4LF7 Q;  5FJ8 G;  1Q8K A;  5JJL A;  4JI2 Q;  2KCM A;  3RZD H;  5DLQ E;  3F2C A;  4A3J G;  4JI3 Q;  2BH8 A;  2AHO B;  1YVC A;  1FL0 A;  4AYB G;  4DR3 Q;  5M3M H;  4JYA Q;  1L1O A;  2I5M X;  5FJ8 H;  4DR5 L;  1HH2 P;  2UXC Q;  4DPG A;  4A93 H;  4WJ4 A;  1D7Q A;  1I3Q H;  4DV0 L;  3PSI A;  1SE8 A;  3ICE A;  4A3D G;  3BU2 A;  4WJ3 M;  4LUZ A;  4K0K L;  2KHJ A;  4JV5 Q;  2R7F A;  1D8L A;  4LFC L;  3ZJY C;  2UXD Q;  1AE2 A;  2BA0 A;  3I4N H;  1DGS A;  3ERS X;  2A1A A;  5ELN A;  1X55 A;  3F1Z A;  4JI8 L;  5C3E H;  5C44 G;  4DV6 Q;  1S72 A;  3T1H Q;  2PQA B;  2BA1 A;  2NN6 G;  2Q2U A;  1FGU A;  3U4V A;  3M3Y H;  1EWI A;  1Q86 C;  1PV4 A;  1Q46 A;  4DAM A;  3HFZ B;  4GNX C;  4AYB E;  4LF6 Q;  2A8V A;  4DKA C;  2QEX A;  4LF5 L;  4K0K Q;  4AIM A;  3AEV A;  3H0G G;  3S1M H;  1X3G A;  2XTI A;  3RR5 A;  2NZH A;  5IYC G;  3S15 H;  3DM3 A;  2K4K A;  2NVX H;  1VQ4 A;  2PMZ E;  4IPG A;  4IOA A;  4DR1 L;  2UXD L;  4HJ9 A;  4A3B G;  1HNZ Q;  2R6G A;  2F4V Q;  4DV3 L;  1HZA A;  2QGQ A;  3BZK A;  3J7A 5;  4GKK Q;  4C3H H;  4JI4 Q;  4A3J H;  1HNX Q;  4IOC A;  1M90 C;  3PUX A;  1Y1V G;  1YIT A;  4GLV B;  1VS0 A;  2C35 B;  2K52 A;  5FLX c;  1HNW Q;  4A3C H;  1MJE A;  1Y1W G;  5M5W H;  2Q2I A; 
#chains in the Genus database with same CATH topology
 4A3I H;  4OX9 L;  5C4Z A;  3NBH B;  4DV7 L;  5KYI A;  4HJ5 A;  3PO2 B;  3RN2 A;  3ER0 A;  1XTD A;  4KHP Q;  1JJC B;  4ZUI A;  3UDF A;  1O7Y A;  1S5C D;  2FHT A;  4BY7 H;  1IYU A;  3IRB A;  3T56 B;  2ID0 A;  1JMC A;  4LW1 A;  3IAY A;  5K5P A;  2O5I C;  2JQO A;  2ZTD A;  2SNM A;  2BOS A;  4B3T Q;  3MC0 B;  4OO1 H;  1RF2 D;  2JA8 H;  3QWN A;  1KRT A;  1E2V A;  2HQL A;  4N8F A;  1STN A;  4ZLT F;  3FVQ A;  2AWO A;  4X65 Q;  1L0X B;  5G3L F;  4IFD I;  4DV5 Q;  1OXU A;  2F0E A;  4J1M A;  2K01 A;  4JI0 Q;  3K5O A;  4IN3 A;  4DR4 L;  4KHV A;  1VQD A;  4P71 A;  3C3L A;  5C0X G;  3G6J B;  4P73 A;  1M1K C;  3SK4 A;  5IWA L;  3NBH A;  3TSS A;  5FLM G;  2OQ0 A;  1QOH A;  4HSV A;  2E75 C;  3L2P A;  4Q0F A;  3PO3 B;  4XIG S;  3GP7 A;  2B3G A;  1TKW B;  2Z6B A;  3M4P A;  4IAL A;  3C46 A;  2RQX A;  3CU7 A;  2KED A;  4POG A;  1HUM A;  2NVY B;  3CAM A;  1PHJ A;  3DWQ A;  1VF5 C;  5FO9 B;  3NK9 A;  1WOC A;  2Q8T A;  1J5E L;  5IGG A;  5EPK A;  3CCL A;  4A3D H;  2GA4 B;  3CXC A;  3KYH C;  2HT1 A;  4A93 G;  1NE3 A;  3OWF A;  2YU9 H;  4BBS G;  1JR0 D;  3IFT A;  3W2D A;  3FPU B;  3SR1 A;  1WTW A;  2RDF A;  5I2X A;  2GN5 A;  4ZCK A;  1XMO Q;  4MN3 A;  3VR4 A;  3CCE A;  4NXM L;  1NMF A;  2CWA A;  1OXX K;  2B2T C;  3TS2 A;  2HIV A;  1FNV A;  1ENF A;  1V1P B;  3KDF B;  4IUU A;  4RA8 A;  2ICE C;  4FXK C;  1WCM H;  3C1F A;  2PI2 E;  1BCP F;  5GAG C;  2VZA A;  1QWY A;  1CI3 M;  1HJP A;  1I50 H;  2L0C A;  3KF6 A;  5I9O A;  2JA8 B;  3Q24 A;  5I6W A;  1A6X A;  4H0L C;  1FD7 D;  3FRP B;  3VA5 A;  1V9P A;  4U67 3;  1PLF A;  1A0I A;  2F0Q A;  3NQT A;  2YV5 A;  2QKI C;  2I0Q A;  1I4X A;  1CKO A;  2QEJ C;  1MJC A;  1XPR A;  4HIO A;  1YHA A;  1G51 A;  4C3I H;  5D14 A;  2E8G A;  4XTC S;  4JI6 Q;  2I46 A;  2KA7 A;  3ULJ A;  4K2L A;  3S2H H;  1YHQ A;  3CD6 A;  5C5L A;  2HHH Q;  3SHL A;  4G7Z C;  2RSN A;  3AFP A;  2WP8 J;  3CQZ B;  4QQB X;  1MBY A;  1B70 B;  5C44 B;  2JA5 G;  4OEM B;  1FJG Q;  1K3R A;  1D1K A;  3R2I A;  1WYD A;  4LF6 L;  1ICF B;  1SNM A;  3GTO B;  1E22 A;  5EPL A;  1SSO A;  4CBV A;  1JB3 A;  4DV1 Q;  5IIF A;  4P2C B;  5M3F B;  3DEO A;  4G7H C;  1SAP A;  4DNR B;  1O7Z A;  2AWN A;  3GO5 A;  1H9S B;  2LXJ A;  4BY7 G;  2IHE A;  4EGV A;  3KF8 B;  5T1I A;  4PMB A;  2Q8R E;  2KOL A;  2UUB Q;  3P1H A;  1U4M A;  1EIY B;  3S1N B;  4B3M Q;  3GTP B;  1H95 A;  3J7A F;  4K6D A;  4DK1 A;  4A3I G;  2NTT A;  1VQ5 A;  3EBE A;  4C3H B;  2KHI A;  2ZJP A;  5C0X I;  3UE0 A;  2H4O A;  4APV A;  1NUC A;  2RHS B;  3J7A V;  3I4M G;  1AEX A;  5KIX A;  2IX0 A;  4UPA A;  1C48 A;  2XNA C;  4FF3 A;  5IE8 A;  1PMR A;  1M8A A;  4PG3 A;  2JP1 A;  1PTO F;  3GV3 A;  4A3E H;  1MI2 A;  1GOZ A;  5T1G A;  3ND9 A;  1S5D D;  4LWC A;  3UDX A;  5DEH A;  1IBM Q;  4YWL A;  4BBR G;  3S2H B;  3A7L A;  3G6E A;  1CFM A;  4A3D B;  4LJZ C;  1WD1 A;  4KI0 A;  1VQF A;  2CH4 W;  5EKL A;  2E76 C;  5C3X A;  3CCU A;  1HZC A;  4RGT A;  4O2D A;  4RAU C;  2IW3 A;  4EX5 A;  3HOW B;  4OXP A;  4DR1 Q;  3M85 A;  4LF7 L;  3BVG A;  3HGB A;  1PDQ A;  3RLF A;  1GD7 A;  4AYB B;  1VDZ A;  5JEA G;  3GTM H;  1TWF B;  4OEL B;  1STY A;  4DF7 A;  1WTX A;  3K5L A;  2VQF L;  1V1Q A;  1VQ9 A;  2VUM G;  2JA8 G;  3VYT A;  2MO1 A;  4JBW A;  4DXF A;  5IGD A;  3HOV H;  4DAY A;  5IY0 A;  4FO2 A;  2JE6 I;  3VR5 A;  4HIK A;  3CP0 A;  1PZI D;  1Y1V H;  1WTQ A;  1YNJ D;  2A68 D;  3EVQ A;  2ICI A;  4DR7 Q;  3NEL A;  1HFN A;  1TWG H;  2KBN A;  2ZJQ A;  1HNX L;  3LNN A;  4KKS A;  1V8Q A;  2B39 A;  1B7Y B;  4RMF A;  1EQQ A;  2HCC A;  1L1O C;  1Q12 A;  2B63 B;  1A3V A;  2O2L D;  4IZ8 A;  1DM0 B;  1KL9 A;  1S5F D;  4ABN A;  3D8G A;  2K5D A;  2MQH A;  4EQP A;  3PUW A;  2WFW A;  3STB C;  4A3C H;  1WTH A;  4RWS C;  2OXP A;  1WD0 A;  3SK8 A;  4FF4 A;  3E3X A;  4X65 L;  3Q22 A;  1RHP A;  1EY7 A;  4Y7N B;  3PGZ A;  4IUT A;  1PZJ D;  2HCI A;  2EY6 A;  3AB9 A;  3JAM c;  2Z8L A;  2XRQ D;  2QIL A;  4C2M H;  3VR3 A;  4CGY B;  4K14 A;  1MD2 D;  1VMP A;  2ZXO A;  4JG2 A;  3S1M B;  1JJ2 A;  3BG3 A;  3FKI B;  1A63 A;  4KHP L;  3DUZ A;  2FXQ A;  4QIW E;  1E1T A;  1SNQ A;  4C3J H;  1F77 A;  2B2W A;  3U9O A;  4KD4 A;  4B3T L;  1HNW L;  2EYO A;  1VQP A;  5CV4 A;  5JPN C;  1AH9 A;  2K5N A;  3E0E A;  2BH2 A;  2ZTC A;  4X3K A;  1N33 Q;  5ELD A;  4CJ0 B;  4UP8 A;  1CTM A;  2A73 B;  2C5C A;  4LF8 L;  4IQZ A;  2ZM6 L;  1TY0 A;  3IL8 A;  1STH A;  2CH4 A;  5C4X H;  3FP9 A;  5CV5 A;  3VYS A;  3D6W A;  2F3V A;  2EXD A;  2OTJ A;  1AP0 A;  4AH6 A;  1X3E A;  4JBJ A;  4UAI A;  2IJ0 A;  3HOW G;  2E2D C;  3L0O A;  1WCM G;  1QVC A;  3PUZ A;  4FXD A;  1X32 A;  5G3L D;  1B3Q A;  3JC6 6;  4EQ5 A;  1RTO A;  2K5W A;  2L5T A;  2F0T A;  4P72 A;  4JC0 A;  1PH7 A;  3KLS A;  2R92 B;  2DUD A;  4R4I A;  5ISR A;  1XXG A;  5HGT A;  3HOU H;  3HKZ G;  1ILQ A;  3W1B A;  3GTJ B;  1Z6H A;  3S2D H;  3KJO A;  1Y14 B;  5BN5 A;  1SNC A;  1FYC A;  2E5L L;  1XMO L;  1F9Q A;  3K57 A;  1SFO H;  4DA2 A;  4TVA B;  1B9M A;  5JEA H;  1EYD A;  3Q23 A;  1ET6 A;  5DAU A;  1BCP B;  1UE6 A;  5IP9 G;  2R93 G;  2EYL A;  4C3J G;  2O4X A;  5IP7 G;  1AE3 A;  2LKV A;  1AW7 A;  5FKA C;  1S5B D;  2Q2H A;  4ZK9 B;  5IGE A;  1U9R A;  3U58 A;  2ALY B;  3RZO B;  1B9N A;  4POF A;  3D4D A;  3J81 j;  1EQT A;  1EWH A;  1PFB A;  3H6M A;  5EQ0 A;  3KBG A;  1H9S A;  4JI2 Q;  1LAC A;  3I8Z A;  1Y8N B;  5DLQ E;  5M3M B;  3F2C A;  1KDB A;  4JI3 Q;  2BH8 A;  2XWJ B;  1HXY D;  1YVC A;  4DR3 Q;  4AYB G;  2HQE A;  5M3M H;  2I5M X;  5FJ8 H;  1XYI A;  4K8J A;  3VA7 A;  1I3Q H;  4KKU A;  4DV0 L;  3PSI A;  1SE8 A;  1LO5 D;  3QOJ A;  2KHJ A;  4LFC L;  1T5X D;  4XYO A;  5ELN A;  1D6E C;  3KLS X;  1STB A;  3F1Z A;  4JI8 L;  5C3E H;  5C44 G;  2JA5 B;  2JYO A;  3T1H Q;  2DJF C;  1R9T B;  2PW5 A;  4J6H A;  1Q86 C;  1PV4 A;  1Q46 A;  3A8I E;  1E0B A;  1B2T A;  4RHR A;  4LF6 Q;  4DKA C;  5COR A;  3V96 A;  3DM3 A;  5E4W C;  2NVX H;  4IOA A;  1IKL A;  4HJ9 A;  2MHV A;  2F4V Q;  4DV3 L;  2J0T D;  1U4P A;  1Y1W B;  4GKK Q;  2XWB B;  4JI4 Q;  4A3J H;  2ZT9 C;  4JW0 A;  3PUX A;  3HP3 A;  1Y1V G;  1SYF A;  2C35 B;  2PNR C;  1Y1W G;  1EIH A;  2RSO A;  1NAP A;  2VQF Q;  1VQC A;  5D3I B;  4HIM A;  4UP9 A;  1GKH A;  1SN8 A;  2VL6 A;  2WKD A;  1L2F A;  5CV6 A;  1JE4 A;  1XMQ Q;  4OL7 A;  4GN4 B;  3HOU B;  1ONL A;  1K3B C;  3TRE A;  4K2K A;  3L9A X;  4LK1 C;  2AQ1 B;  5JJI A;  1J9O A;  1X65 A;  2XRS D;  1TVX A;  4V0B A;  2D9U A;  4EQO A;  1FJG L;  1BR9 A;  1PYB A;  4DV6 L;  3MXG A;  3A8J E;  5C4H A;  1VF7 A;  3Q0A A;  1CUK A;  3KFU A;  3GTP H;  4UDU C;  4ID6 A;  3HKZ B;  3TRZ A;  4RHS A;  1LTI D;  4R9W A;  1YJ9 A;  4N9T A;  2A19 A;  1SEB D;  4XXE A;  5JJZ A;  1VQE A;  4JI7 L;  2LFN A;  1B44 D;  4P75 A;  4P74 A;  5CGK A;  3K8A A;  3S9W A;  3J80 L;  1N32 L;  1U0L A;  3BDL A;  3G7L A;  3S24 A;  5C4X B;  4ALP A;  2KCN A;  2OT2 A;  3NE5 B;  5C44 H;  2X6L A;  2Q2T A;  1I3Q B;  4YY3 Q;  5JJK A;  1OXS C;  1SE4 A;  3KF6 B;  4DUZ L;  1H9K A;  1XNQ Q;  2A74 C;  1G6Z A;  3EA6 A;  1C9O A;  2IPK D;  2E74 C;  2F0V A;  2EJM A;  4HED A;  1K8O A;  5FO7 B;  3T51 B;  5KYL A;  1K28 A;  2YU9 B;  4IUN A;  4RKL A;  5GAD C;  4IUV A;  1K8G A;  4A3G G;  3NXW A;  3S2D B;  4R4T A;  4RH6 A;  1SYE A;  1UEB A;  2L11 A;  1VQB A;  4XQJ A;  1EY9 A;  2JA6 G;  3I4O A;  4A3G B;  3S15 B;  4IUQ A;  4DU9 A;  1YI2 A;  3WOE A;  1LAB A;  1DD2 A;  2B8G A;  3IFD A;  4OIK A;  3I91 A;  2JA5 H;  1VQJ A;  2NVQ B;  1CA6 A;  3GTO H;  1STA A;  1TQO A;  4JK1 C;  2M2L A;  4Z9C B;  5M5W B;  2UU9 L;  3QJY A;  5DM6 3;  4B3M L;  4F8M A;  5CMD A;  1K8M A;  1KLG D;  2QA4 A;  2L55 A;  1QCB D;  1TWH H;  4OX9 Q;  2OQK A;  1XNQ L;  1QJO A;  2K04 A;  4BXX H;  2I07 B;  3CC4 A;  2Z9H A;  5AFW A;  2VW9 A;  5BR8 L;  2IX1 A;  3S14 H;  3R8B A;  2OTL A;  1N36 L;  1L0W A;  3F2D A;  1YNX A;  2H5X A;  3BVZ A;  3L3O C;  1C7Y A;  4QCL A;  2R93 H;  4FF1 A;  4HSP A;  4H44 C;  1N32 Q;  4A3E G;  2F0N A;  2X6G A;  1C4Q A;  4YCV A;  3BDO A;  3DMU A;  5ELF A;  1BNZ A;  4IFD G;  3HOW H;  1EOV A;  1JT8 A;  1PH2 A;  1M4V A;  5AJ3 Q;  4N8X 1;  1XNR Q;  2UXB Q;  2NYZ D;  1NJI C;  4DN4 M;  1D5X C;  3GTL B;  1CA5 A;  4LMQ D;  4OON A;  2EJF C;  1QNK A;  5M3F H;  2A6E C;  3D4R A;  4QL5 A;  1TR5 A;  2JA7 H;  4I65 A;  3S17 B;  1WVL A;  1K0S A;  3OW7 A;  2N78 A;  5CBE E;  5IGC A;  2RDG A;  1LTT D;  3ZYY X;  3PO3 H;  1D5Z C;  3AU7 A;  5IT9 c;  4WOR A;  1KC8 C;  3K0X A;  1SYG A;  4H02 A;  4X6A H;  2B2Y A;  4RCO A;  2HDM A;  2IX3 A;  1YHB A;  4QF4 A;  1X3F A;  4OWX B;  1CSP A;  1BO0 A;  4JCV E;  5M5X B;  4A3K B;  1HR0 W;  3SE0 A;  1X56 A;  2KCT A;  1KIX A;  3F2B A;  5FLM H;  2KJX A;  5JPM C;  2K75 A;  4KY6 A;  3K7A B;  3J80 i;  4A3E B;  4YCW A;  2JN4 A;  1LLR D;  3T1Y Q;  2ZTE A;  4DUY Q;  1ESF A;  1WJJ A;  3N6R A;  4LF4 L;  2OEO A;  5FK9 C;  4UP7 A;  2UUC Q;  3GTG H;  5CV9 A;  2F0I A;  1IYV A;  3F2U A;  1ZYR D;  3PF4 A;  1VQI A;  4J8Q A;  4RGM A;  2ES2 A;  1QVG A;  3FKI G;  3NBI A;  3CCR A;  2F0M A;  2CQA A;  1S3O A;  4OO1 G;  4NB3 A;  1VCI A;  5EGT A;  3HOX H;  1EIG A;  3A54 A;  2B2U C;  2JEB I;  1KNA A;  1VQN A;  1NY4 A;  1F9P A;  4I7A A;  4KN4 C;  1BBU A;  2F4I A;  4L5Q A;  4DV0 Q;  1KTK A;  1BBW A;  5LMU Q;  3H94 A;  3PO3 G;  1YJN A;  1EQV A;  1JOO A;  4XT3 B;  3OTO Q;  4DV5 L;  2JK8 A;  3H0G B;  1QZG A;  5JAV A;  4DV3 Q;  2K03 A;  1JE5 A;  2K14 A;  4JI6 L;  3HOV B;  3UE1 A;  3J80 E;  3HKS A;  1YJW A;  3MXN A;  1Q82 C;  3A5U A;  5C3E B;  4NMZ A;  2DN8 A;  1NR2 A;  4RGO S;  1G2S A;  4DR4 Q;  1E1O A;  3S1Q H;  5IYC H;  3TDQ A;  2B2V A;  4KMU C;  3OIQ A;  2K5V A;  4L5S A;  1A3U A;  3FDT A;  4JI8 Q;  5K36 G;  2HDL A;  3K58 A;  1VQM A;  3BZC A;  4PV1 C;  2R92 G;  4FDB A;  2LSS A;  4KJO A;  3ULP A;  1HCZ A;  1GJX A;  1EQR A;  3FPP A;  5C6A A;  4KN7 C;  2Y0S B;  2F0P A;  1SXT A;  3V05 A;  2EOT A;  4F88 A;  3I4N G;  3HOY H;  1ENA A;  2MPM A;  1Q90 A;  3HOY G;  2ZXR A;  1CKN B;  5C0X H;  2E2J H;  3GTK B;  1RTN A;  3I4N B;  3NWS A;  3R3O A;  3S1Q B;  2PPB C;  3GTJ H;  2ATW A;  4B3R Q;  1DOM A;  2MUY A;  1OXV A;  2R92 H;  1Q3L A;  4KHZ A;  3H3V C;  5JOB A;  2JSO A;  1AZQ A;  1PH4 A;  3ONA B;  3K5M A;  2RVL A;  5E3F A;  2ASB A;  2N8N A;  1TWF H;  1H9M A;  1XJV A;  2BCO A;  5ELB A;  5HUR A;  3BJU A;  2MJ8 A;  3PUY A;  5D3D A;  4DV4 L;  2PQE A;  4O0A A;  3LGJ A;  2N49 A;  1PH6 A;  2G9H D;  2CWP A;  1JWU D;  4X64 Q;  2B2Y C;  1K83 B;  1G91 A;  4X3S A;  4R4C A;  4QB4 A;  3R2T A;  4YY3 L;  1GM5 A;  1E24 A;  1SJE D;  1SMX A;  2DGY A;  1O7L A;  1CKN A;  4RFB A;  1PH3 A;  2Z1C A;  1HZ9 A;  2XSC A;  3D4W A;  2X69 A;  1N33 L;  2K32 A;  4NXM Q;  4JI5 L;  3BYT B;  1EIF A;  2E2I B;  2K1B A;  1TWC B;  4A3L G;  1UE1 A;  1A15 A;  5LL6 S;  2AQ2 B;  1ILP A;  3MEF A;  4X62 L;  3HOX G;  4RG1 A;  1RL2 A;  2KHS A;  1LUZ A;  2WAQ G;  4A3J B;  3HOY B;  2NB0 A;  3CCV A;  3FKI H;  4PZ7 A;  2IL8 A;  2GVA A;  5IYD H;  4UHV A;  1N34 Q;  2CW0 D;  1BQQ T;  2Z0S A;  2RCN A;  5LMN L;  2VY3 A;  1LV9 A;  4YHH Q;  1I4R A;  1A8V A;  1TT2 A;  4LF5 Q;  3W5O A;  4JVZ A;  1KQS A;  4LF8 Q;  1L0Y B;  2R7Z H;  2KUM A;  4LAA A;  2D0O A;  4LUV A;  4L5R C;  2Z6K C;  1H9R A;  1O80 A;  3RZD B;  1MSG A;  2QDB A;  3OWE B;  2Q8I B;  3CPW A;  4OWT B;  1WTV A;  4JBK A;  2CFM A;  2WB1 E;  2NWG A;  3TP5 A;  4L8J A;  4CJ1 B;  5FLX E;  1MKH A;  2XGT A;  4GLA C;  3HZX A;  1KLU D;  4BA2 I;  3PF5 A;  3X3M A;  2EJG C;  4C3H G;  2RA4 A;  3ERO A;  3GV6 A;  4K5X A;  1K73 C;  1PA6 A;  3A74 A;  5HGQ A;  1Z47 A;  3EFX D;  2L9H A;  3M4O H;  4YCU A;  3SDZ A;  4B08 A;  4C3I G;  2WV6 D;  1E2W A;  2V1C C;  1JOK A;  3C1E A;  1CQF A;  1CM9 A;  3HS0 C;  3M3Y B;  2KVM A;  1X6O A;  3FHW A;  4PZ6 A;  3CF5 A;  4DV4 Q;  4DR7 L;  3CC7 A;  1Q8K A;  5JJL A;  2FFK B;  2F0H A;  4A3J G;  1D5M C;  1W6K A;  3A7A B;  3PQI A;  1SDF A;  4DR5 L;  2F0G A;  4IUR A;  2UXC Q;  4DPG A;  4A93 H;  4ODG A;  1STG A;  1A3T A;  1KDC A;  4A3D G;  3BU2 A;  4JV5 Q;  2F0S A;  3V2T A;  1U4R A;  2A6E D;  1ET9 A;  5I9P A;  1X55 A;  2BA1 A;  2NN6 G;  1FGU A;  1GUO A;  2F0O A;  1EWI A;  4CKC A;  5DM7 3;  4AYB E;  4LF5 L;  3AEV A;  1DXM A;  2PZU A;  3K6O A;  3LX0 A;  4IPG A;  2UXD L;  1Y8P B;  3BZK A;  3J7A 5;  2K5Q A;  5CV8 A;  4C3H H;  1HNX Q;  5ELC A;  1M90 C;  5EKI A;  4GLV B;  1VS0 A;  5FLX c;  4CDD C;  4CKE A;  3GQB A;  1J6Q A;  5DNF A;  2A69 D;  2L12 A;  5M9O A;  1SRU A;  4GKJ Q;  3T1Y L;  4BXX G;  4IPH A;  3X3N A;  3PIP 3;  2CHB D;  4L63 B;  4BY7 B;  2PNH A;  1QB5 D;  4BBR H;  1TU2 B;  1DOL A;  2D62 A;  2K50 A;  3NSW A;  4QJF A;  2AUK A;  3T16 A;  3GTQ H;  3OMC A;  1HQR D;  4BY1 G;  3I55 A;  2PYK A;  3CC2 A;  4X66 Q;  4ULL A;  4NPS A;  1LTB D;  4OWW B;  3SK5 A;  1F2M A;  2A69 C;  4A93 B;  4A3F B;  1PTO C;  1DYQ A;  1IZ6 A;  2BDO A;  1KAB A;  4U68 A;  2F0L A;  1CT1 D;  5GQO A;  1E3P A;  3D3R A;  2P5Z X;  4L6T B;  4ZAI A;  2NN6 H;  2EY1 A;  1IKM A;  4DV1 L;  4LF4 Q;  1IXR A;  2PQA A;  3DWP A;  3WOF A;  5IYB G;  3CKI B;  4HMI A;  2F4V L;  1G6P A;  1RKN A;  1JIC A;  3RLO A;  2NVT H;  2BDN A;  1I4P A;  2MNA A;  2E5L Q;  4GOP B;  4JI1 L;  4BA1 I;  4DR6 L;  1UE7 A;  4L5T A;  4A3B H;  1D1I A;  4JPB W;  3DXJ C;  3CCJ A;  4R1J A;  3HEJ A;  1EYC A;  2NUC A;  3OYY A;  1XPU A;  3S16 H;  3KDF A;  2B2W C;  4LF9 L;  1DON A;  3PV0 A;  1OTC A;  4JI3 L;  5J1Z A;  1PRT F;  4I7Z C;  4JI2 L;  4B3R L;  4M8A A;  4KV6 A;  1EFW A;  1GVP A;  2Y0S E;  2N3S A;  4MZ9 A;  3KK7 A;  4IUP A;  4BBS B;  1CK1 A;  4TSS A;  3PCO B;  4LFB L;  1YNN C;  2EQS A;  1MSH A;  3TBI B;  1F9S A;  4PMW A;  4F7X A;  1ENC A;  3VR6 A;  3DM1 A;  4B9X A;  3MVV A;  2PCF B;  3EN2 A;  3CME A;  1CSQ A;  4DR2 Q;  2DJG C;  5ELO A;  5BN3 A;  5D65 A;  4A75 A;  1IBK L;  4CDE C;  1ASY A;  5C5M A;  2PI2 A;  3GTL H;  4LF9 Q;  1B3A A;  3KOJ A;  1GUT A;  2R93 B;  1HR0 Q;  3NP8 A;  4B3S Q;  1Q1B A;  4WRD A;  4A4I A;  4DK0 A;  4JI5 Q;  5M3F G;  3AFQ A;  4CKB A;  2JEA I;  3BZD B;  5JVG 3;  1SBB B;  5JEA J;  3I70 A;  4OHJ A;  4TRD A;  3MXP A;  4C3J B;  2QDL A;  2HIX A;  4A3L H;  4GZY C;  4X64 L;  5C0X J;  5I6Y A;  1N34 L;  4MHE A;  1YIJ A;  4QY7 A;  5E7N A;  4XQQ A;  1SNP A;  2B29 A;  2E2I H;  3UI2 A;  4QUF A;  1EEI D;  1BCP C;  4O42 A;  2SDF A;  3EIV A;  3E9I A;  4GN5 A;  1TWH B;  2CQO A;  2RCF A;  5FO8 B;  1PRT B;  4PNY A;  1J5E Q;  4DV2 Q;  3DLL A;  1JWS D;  3TP6 A;  3ULL A;  3JAM E;  4GNX A;  1VQO A;  1Z7T A;  2WKC A;  1TWA H;  4F87 A;  1UE5 A;  1V43 A;  2EPB A;  2UUC L;  4AQY Q;  5CYU A;  3H15 A;  2D0P A;  1KRS A;  2NVQ H;  4DUY L;  2V4D A;  2LMC B;  4K5V A;  4OGQ C;  1T9H A;  1JQY D;  3PO2 H;  2Z4H A;  5FOB B;  3SXH A;  4KLK A;  2L15 A;  1Q8I A;  1HRJ A;  3CRL C;  1I94 L;  1IYJ B;  4HN7 A;  5FLX L;  2CVR A;  4NKL A;  1O78 A;  2VQE Q;  2OCE A;  1K0R A;  3HOU G;  3K7A H;  1VQL A;  1KDA A;  4FVM A;  1B4O A;  3QIA A;  3AYH B;  1EYA A;  4GNX B;  1CZG A;  1II3 A;  4DR5 Q;  1BBX C;  4LNQ A;  1EY4 A;  1TY2 A;  5E1F A;  1WI5 A;  5IGB A;  2B2U A;  4MTK A;  5IYB H;  1TS3 A;  2RBM A;  1S5E D;  1A2T A;  2AQ3 B;  4XDX A;  1PVO A;  3OTO L;  1ICW A;  4A3C G;  4LFB Q;  4DXG A;  4ZKB B;  3CPF A;  4IJH A;  3C2P A;  3KLR A;  1CHP D;  1O7I A;  3VR2 A;  3OW2 A;  1DZ1 A;  1LT6 D;  3GTM B;  1PH9 A;  3HOX B;  3A8K E;  3G48 A;  1QVF A;  3K5N A;  4JOI C;  3QO2 A;  1BKB A;  3RMH A;  1EEF D;  1PH8 A;  1B50 A;  1QUQ A;  5EJW A;  4AQY L;  1DCZ A;  4QIW B;  2HHH L;  1I50 B;  3G71 A;  3NTH A;  4H13 C;  2DNE A;  1NBW A;  4DR3 L;  1WTP A;  5LMN W;  4BY1 H;  5HY6 A;  1FNU A;  3NEN A;  4DV2 L;  1HFG A;  2IY5 B;  1A62 A;  1G8Z D;  1SLJ A;  1SYB A;  2NN6 I;  3H09 A;  4CDC C;  5A2Q E;  3CCS A;  1OO9 B;  5KEE A;  2OWO A;  2UUA Q;  3TZD A;  1VQA A;  1LT5 D;  1PTO B;  3P20 A;  4A3M G;  1X9N A;  3GDE A;  1SMY C;  1RD9 D;  2SOB A;  4GS3 A;  3A55 A;  3J81 i;  2F0K A;  4LFA Q;  1P16 A;  3NUC A;  1XPO A;  1Z9F A;  1BF4 A;  3MXN B;  1ZYR C;  1KHI A;  1GHJ A;  4XQN A;  4LFC Q;  1XTC D;  1I6H H;  2PZT A;  3RZO H;  2D5D A;  3K7U C;  1HZB A;  1EUJ A;  1BVS A;  2NZO A;  3T13 A;  2IHF A;  2VNU D;  5C3W A;  1EL0 A;  3TME A;  2AKW B;  2Z6K A;  1IBL L;  3MFY A;  3J81 c;  5KNC A;  4A3M B;  2OF1 A;  3HOZ H;  4YWK A;  4HJA A;  3NQI A;  2E2H H;  2CCZ A;  3OOC A;  1XWE A;  1ZXT A;  2FMM A;  2JA9 A;  3KLW A;  5EPJ A;  1H9J A;  2E2H B;  4HAE A;  1I4H A;  4GOP A;  3J81 E;  2A6H C;  1SMY D;  3GD7 A;  1G29 1;  2BE5 D;  1GUS A;  2WII B;  3HOV G;  2B2T A;  1E2Z A;  3M4O B;  1SRO A;  5ELE A;  3BYY B;  1EY8 A;  2PZW A;  4C1N I;  3I2Z A;  4HCS A;  4FNF A;  4IFD H;  2B63 H;  5A35 A;  1XMQ L;  5KGU A;  2PO4 A;  1S4Z A;  5LL6 X;  3PMF A;  3I56 A;  1GUN A;  1IHZ A;  3E9H A;  4GN3 B;  5F2D A;  3HKZ E;  2G5D A;  1PH1 A;  4NP5 A;  3HRZ C;  1W3S A;  2N88 A;  4CDF C;  3AMU A;  1JJG A;  3RN5 A;  2WIN B;  4GKK L;  1PFN A;  5TSS A;  1UEA B;  4KY5 A;  3T1H L;  2F03 A;  1FGB D;  1DJR D;  4LFA L;  1NTG A;  4EVO A;  4PMC A;  1FR3 A;  4X3U A;  5IP7 H;  3MHB A;  2AUJ D;  3SGI A;  2UUA L;  3NEM A;  5C4J B;  3WWV A;  5KND A;  5M5Y H;  5A2Q L;  4HTH A;  1EY5 A;  1GUG A;  4G57 A;  1I4Q A;  3RD4 A;  4NXN L;  1Y1W H;  4A3F G;  1CZW A;  1F2L A;  2JA6 H;  3I4M H;  1ZKO A;  1IW7 D;  5LMN Q;  5LMU L;  5COY A;  1SE3 A;  3ITP A;  1PRT C;  3WDN A;  5I2Y A;  3CW2 C;  3P75 A;  1I6V C;  1R4Q B;  5H1S E;  1PTO H;  3HOZ G;  2SEB D;  3M7N A;  4DAY B;  5M5Y B;  3KJP A;  1TS4 A;  1WTR A;  2KCM A;  3RZD H;  2A6H D;  4FXG C;  3BDC A;  2F0U A;  3GTQ B;  4G4K A;  4JYA Q;  1HH2 P;  2VB3 X;  4XT1 B;  3ICE A;  4WJ3 M;  4KKT A;  4LUZ A;  2B8F A;  3MZ5 A;  2R7F A;  4C1N K;  1PRT D;  3ZJY C;  2UXD Q;  2BA0 A;  2A1A A;  2F0D A;  4H7B A;  3VYR A;  1B53 A;  3NTK A;  4O1N A;  4DV6 Q;  1IW7 C;  1NCV A;  2Q2U A;  2A5H A;  3J7Y W;  2PW7 A;  1F2Z A;  4DAM A;  3QG1 A;  3HFZ B;  1FNW A;  2HD3 A;  3QB3 A;  2A8V A;  3MAQ A;  4AIM A;  3H0G G;  3S1M H;  1NR4 A;  1X3G A;  2F0W A;  2XTI A;  2NZH A;  3NHH A;  4BWG B;  2PMZ E;  5EKK A;  3I4M B;  3FMC A;  3TP8 A;  4Q5V A;  3QOL A;  2KEE A;  4IOC A;  1YIT A;  2K52 A;  3SEB A;  4XYQ A;  4KJN A;  5M5W H;  2Q2I A;  3OHX C;  4DK6 C;  1IBM L;  4OO1 I;  2KQ3 A;  2RKS A;  1V1O A;  1VQG A;  4HJ7 A;  5KNB A;  2XN9 C;  4QUC A;  1ZEQ X;  3M4Y A;  2EXZ A;  4ZYS A;  3E6Z X;  2TMP A;  4BBR B;  1S40 A;  1EYG A;  2DY7 A;  4MTN A;  4HJ8 A;  1GXD C;  2K33 A;  3TQY A;  4X3T A;  1SFO B;  3DHQ A;  4TKO B;  3T53 B;  1DOK A;  1HHV A;  4ME3 A;  3TZU A;  1LT3 D;  3LWE A;  2BE5 C;  1PZK D;  1L1O B;  1SNO A;  2VQE L;  1PFS A;  4DAV A;  4A3K G;  1OXT A;  3A5Z B;  2I5H A;  1TS5 A;  3LWU A;  5BR8 Q;  1Y69 U;  5CC4 A;  3NWT A;  5C3E G;  4DK3 C;  3HG9 A;  1HNZ L;  5IT9 L;  1R4P B;  3VDY A;  1MGS A;  2KEN A;  4IPD A;  1W6J A;  4NXN Q;  1EU3 A;  2WB1 B;  1UNS A;  4MNO A;  3PO2 G;  1SR3 A;  3FEW X;  1EOT A;  3S1N H;  2R3Z A;  4JI1 Q;  3I72 A;  1FVI A;  3K80 C;  4E6I A;  2WAQ B;  3VYU A;  1ML0 D;  4UY8 C;  2MFI A;  2EZV A;  2DY8 A;  2F3W A;  1IBL Q;  1IL8 A;  2NVY H;  1QIL A;  2YTV A;  2R7D A;  3H3V H;  3CCM A;  3GTG B;  4X62 Q;  1MHW C;  3DWA A;  3STB D;  3M7G A;  3JAM i;  2JJQ A;  3CCQ A;  1ROD A;  1Q1E A;  1LTA D;  2R7Z G;  2JXM B;  5C4J H;  4PQX A;  5GAE C;  1LTS D;  1KAA A;  1QZH A;  5K36 H;  3CHB D;  1B1Z A;  1PTO D;  2LS0 1;  3TP7 A;  2K6A A;  4YHH L;  1BUV T;  1RIP A;  1BXT A;  2KCC A;  1YBY A;  2K05 A;  2ZJR A;  4A3B B;  1TII D;  2XIW A;  4KY7 A;  2CKZ B;  1I6H B;  1STE A;  1F2Y A;  3TEH B;  1VQ7 A;  1JWM D;  1BCP D;  5IOC A;  4JBM A;  2D2C C;  2I5L X;  5EBD A;  1JOQ A;  1Q81 C;  3P7J A;  3E5S A;  2NVT B;  4C2M B;  1BOS A;  3T4A C;  4C3I B;  3AQQ A;  1TXY A;  2ZM6 Q;  4Y52 H;  4HID A;  3IKJ A;  2SNS A;  2FJ2 A;  3U4Z A;  1N8R C;  1PYS B;  1HQM C;  1JCK B;  4GLX A;  3Q6S A;  1CQV A;  2YYZ A;  4ME5 A;  4IPC A;  2WAQ E;  1B8A A;  4A3F H;  3ERQ A;  4FP5 D;  1RDP D;  3I3C A;  3K81 C;  3I90 A;  3SVM A;  2VUM H;  3S16 B;  2VB2 X;  1Q7Y C;  1LTR D;  3PIO A;  1GUW A;  5EAY A;  2LXK A;  4B9W A;  5J22 A;  3K59 A;  3R93 A;  3S17 H;  2NTS A;  3S14 B;  4GKJ L;  3MFG A;  3O13 A;  1WCM B;  5IGF A;  4RCN A;  1SND A;  2M9V A;  2ZXP A;  1LT4 D;  3PUV A;  2UU9 Q;  3PIP A;  4ZUJ A;  3U50 C;  1U4L A;  1N36 Q;  3CQZ H;  4BS9 A;  1KAW A;  1W2B A;  1NNX A;  1I5F A;  1VQ8 A;  2UUB L;  5CBA E;  1C8C A;  1VQK A;  1GHK A;  2YTX A;  3H3V I;  1X3Q A;  5M5X H;  4A3K H;  1LTL A;  2B63 G;  1YEZ A;  4DAP A;  2RHQ B;  5AJ3 L;  1EZ8 A;  3K0Y A;  1C0A A;  1EY6 A;  2VS1 A;  4R8N A;  3A0J A;  2JA7 G;  2AMC B;  1AN8 A;  4DV7 Q;  1TWA B;  1QUQ B;  2J7Z A;  3OSO A;  1Y8O B;  4JI0 L;  2O5J C;  4BBS H;  3S1R H;  4JI4 L;  1Y1V B;  2KEC A;  1D2B A;  1NSN S;  2FIN B;  2EE1 A;  4JOI A;  5M3M G;  2F0F A;  3KUP A;  1AZP A;  5JVH 3;  5I4D A;  1P8L A;  2NBF A;  4DNI A;  4DFA A;  4A3M H;  3HOZ B;  4ZKC B;  3D0F A;  2QW7 A;  1QNU A;  4HCE A;  4LUO A;  3H0G H;  1LTG D;  4C56 C;  1SYC A;  1X54 A;  3OIP A;  4TQU S;  3KF8 A;  3S1R B;  5BN4 A;  2ENB A;  3Q8D A;  3M4Q A;  2Z4I A;  2K28 A;  1YNJ C;  2A68 C;  5IP9 H;  1G2T A;  2HUG A;  4Y7N H;  4X66 L;  1JB7 A;  3QR8 A;  1LYL A;  5IYD G;  1VMC A;  4J15 A;  3CMA A;  2IWH A;  2H1E A;  1E7Z A;  3G4S A;  4NW2 A;  1N9W A;  3D31 A;  4A76 A;  3N52 A;  1XNR L;  2UXB L;  2C9O A;  4PZ8 A;  2NVX B;  1K9M C;  1V1P A;  3M9B A;  4QGU A;  1CHQ D;  5J3B A;  1RCV D;  3RLN A;  4R8I A;  1VQH A;  2EVB A;  4A3G H;  2MGS A;  3U9S A;  4BY1 B;  1HA5 A;  1PYW D;  5GAH C;  2UXC L;  2VUM B;  2J4X A;  2XVS A;  1K83 H;  1KNE A;  1PH5 A;  3BVM A;  1TWG B;  1YZ6 A;  4K5W A;  2EY5 A;  1GO3 E;  4DGZ A;  2EYP A;  2YTY A;  4GOP C;  5IWA Q;  5IT9 E;  3EJI A;  3MEH A;  4JYA L;  1LM0 A;  1KD1 C;  2IT1 A;  1IL2 A;  1HR0 L;  4B3S L;  4N9P A;  1X3P A;  4KTA A;  4DR6 Q;  4RKB A;  4G7O C;  2K5H A;  2JA6 B;  2L4N A;  1MIU A;  2QF7 A;  3B6Y A;  1BDO A;  1EFI D;  4K8I A;  3MTS A;  1IBK Q;  1KXL A;  4DR2 L;  2F1M A;  3UDG A;  3UDI A;  2EIF A;  1QE6 A;  4JV5 L;  1PFM A;  3CRK C;  4ZQ3 A;  1WFQ A;  1VQ6 A;  3J7Z C;  4IFD J;  4OIJ A;  1QG7 A;  3A56 A;  2F52 A;  3I73 A;  3RNU A;  1EY0 A;  1TWC H;  4CHT B;  5EBC A;  3BS1 A;  3D6C A;  2EY2 A;  3H91 A;  4K6L A;  5GRO A;  4WJW A;  4IO9 A;  4R4Q A;  2EYJ A;  1A2U A;  2DNC A;  1NMG A;  4FYD A;  1EZ6 A;  2L1B A;  3W1G A;  5J39 A;  4YWM A;  1EU4 A;  1SE2 A;  4FF2 A;  3JAM L;  5LHY 1;  1RJT A;  2Y0S G;  1JOR A;  4R4O A;  4NDX A;  1K8A C;  2N55 A;  1U5K A;  1XX8 A;  4M1U B;  4HMJ A;  2EYF A;  2TSS A;  4K0K L;  2E2J B;  2R61 A;  4HR7 B;  1UWV A;  4JI7 Q;  3E0J A;  2MO0 A;  2PMZ B;  1R9T H;  2FMC A;  3URY A;  1PXU A;  1SJH D;  2RF4 A;  2GVB A;  2B2V C;  4MIU A;  3J80 c;  5NUC A;  2CW0 C;  1HTP A;  2LY7 A;  5CR3 A;  3NPP A;  3NTI A;  2F3I A;  1UAP A;  1WTO A;  4ILW A;  1SYD A;  1CKM A;  3OPO A;  5C4X G;  4DUZ Q;  2M00 A;  3TS0 A;  4DNT B;  2WAC A;  2G9D A;  1ASZ A;  4IJL A;  3DEP A;  1I94 Q;  1YNN D;  4EQN A;  3L7Z C;  3F8T A;  4KD3 A;  1HPC A;  3GTK H;  3MXU A;  3I7F A;  2WB1 G;  4YIJ A;  4V19 0;  5CV7 A;  1HUN A;  1ESR A;  3I4L A;  5E4X A;  4LF7 Q;  5FJ8 G;  3OMG A;  1HTL D;  1TS2 A;  1AFP A;  2AHO B;  2K7V A;  3EQL C;  1FL0 A;  5L37 A;  2NZ1 D;  1L1O A;  4WFN 3;  4S3S A;  4ZRZ A;  4CJ2 C;  4WJ4 A;  1D7Q A;  3TN2 A;  1JC7 A;  2EYM A;  1HA6 A;  2MP1 A;  1EWC A;  1D8L A;  1I4G A;  2F0J A;  1AE2 A;  3I4N H;  2RDH A;  1DGS A;  3ERS X;  3KBX A;  1S72 A;  4RGN A;  2R7Z B;  2PQA B;  3SK6 A;  3U4V A;  3M3Y H;  5KRU A;  3W3A A;  2EYH A;  4GNX C;  4KK7 A;  2JA7 B;  1UUP A;  5IOD A;  2QEX A;  3MA2 B;  4K0K Q;  4QMG A;  1J8I A;  3ND8 A;  3RR5 A;  3J81 L;  3S15 H;  2EDG A;  5IYC G;  2K4K A;  3RUZ A;  1VQ4 A;  2QCP X;  4DR1 L;  3MWY W;  1F9R A;  1T5E A;  1HNZ Q;  2R6G A;  4A3B G;  1HZA A;  2QGQ A;  3PIO 3;  4A3I B;  2VXW A;  1MJE A;  1HNW Q; 
#chains in the Genus database with same CATH homology
 4A3I H;  4DK6 C;  2VQF Q;  4OX9 L;  1J6Q A;  1VQC A;  3NBH B;  4DV7 L;  1IBM L;  4OO1 I;  4HJ5 A;  4HIM A;  1SRU A;  1GKH A;  4UP9 A;  3T1Y L;  1SN8 A;  1VQG A;  2VL6 A;  4IPH A;  4HJ7 A;  1L2F A;  4BXX G;  1XMQ Q;  3RN2 A;  2PNH A;  3ER0 A;  1XTD A;  4GN4 B;  4KHP Q;  4BBR H;  1JJC B;  3TRE A;  3UDF A;  4BY7 H;  2D62 A;  2K50 A;  4OO1 G;  4QJF A;  3GTQ H;  3IRB A;  1EYG A;  1S40 A;  2ID0 A;  1JMC A;  4LW1 A;  5JJI A;  4BY1 G;  2JQO A;  4MTN A;  3I55 A;  4HJ8 A;  2ZTD A;  1X65 A;  3TQY A;  4B3T Q;  3CC2 A;  4X66 Q;  1FJG L;  1PYB A;  4NPS A;  4DV6 L;  4OWW B;  2JA8 H;  1KRT A;  1CUK A;  3KFU A;  4ME3 A;  2HQL A;  3GTP H;  1IZ6 A;  2AWO A;  4X65 Q;  1L1O B;  3TRZ A;  2VQE L;  1PFS A;  4A3K G;  4IFD I;  1OXT A;  3A5Z B;  5GQO A;  1E3P A;  2I5H A;  4DV5 Q;  1OXU A;  5BR8 Q;  1YJ9 A;  2A19 A;  4DV1 L;  4JI0 Q;  4LF4 Q;  1IXR A;  2PQA A;  5C3E G;  4DR4 L;  1VQD A;  4DK3 C;  4P71 A;  5IYB G;  1VQE A;  5C0X G;  3VDY A;  1HNZ L;  4P73 A;  2F4V L;  2KEN A;  4IPD A;  1M1K C;  4JI7 L;  1G6P A;  5IWA L;  3RLO A;  4NXN Q;  4P75 A;  5FLM G;  2OQ0 A;  2NVT H;  4P74 A;  4MNO A;  3K8A A;  3L2P A;  1SR3 A;  3PO2 G;  1N32 L;  2MNA A;  1U0L A;  4XIG S;  3S24 A;  2E5L Q;  3S1N H;  2B3G A;  4ALP A;  4GOP B;  4JI1 Q;  4JI1 L;  3M4P A;  1FVI A;  3K80 C;  4BA1 I;  5C44 H;  4POG A;  4DR6 L;  2Q2T A;  1UE7 A;  3CAM A;  4L5T A;  4UY8 C;  4YY3 Q;  1PHJ A;  2MFI A;  4A3B H;  5JJK A;  1OXS C;  1WOC A;  3KF6 B;  1IBL Q;  3CCJ A;  1J5E L;  2NVY H;  2YTV A;  4R1J A;  4DUZ L;  2R7D A;  3CCL A;  3CCM A;  1XNQ Q;  3H3V H;  4A3D H;  4X62 Q;  3CXC A;  3KYH C;  3OYY A;  2HT1 A;  1C9O A;  1XPU A;  4A93 G;  1NE3 A;  3STB D;  3JAM i;  2YU9 H;  4BBS G;  3S16 H;  2JJQ A;  3KDF A;  3CCQ A;  1Q1E A;  5GAD C;  2GN5 A;  1XMO Q;  2R7Z G;  1K8G A;  4LF9 L;  4A3G G;  3CCE A;  4NXM L;  3PV0 A;  5C4J H;  4R4T A;  5GAE C;  1NMF A;  1UEB A;  1OXX K;  2CWA A;  1OTC A;  3TS2 A;  4JI3 L;  1VQB A;  1QZH A;  2HIV A;  2JA6 G;  3KDF B;  3I4O A;  4JI2 L;  4B3R L;  1EFW A;  1WCM H;  1GVP A;  2Y0S E;  4YHH L;  1YI2 A;  2N3S A;  2PI2 E;  5GAG C;  4MZ9 A;  2VZA A;  1RIP A;  1HJP A;  1I50 H;  3KF6 A;  1YBY A;  3PCO B;  4LFB L;  2EQS A;  2JA5 H;  2ZJR A;  1VQJ A;  3GTO H;  4PMW A;  2CKZ B;  3TEH B;  1VQ7 A;  1V9P A;  2UU9 L;  4B3M L;  4JBM A;  2QA4 A;  3EN2 A;  2I5L X;  3CME A;  1CSQ A;  4DR2 Q;  1Q81 C;  1A0I A;  5ELO A;  4A75 A;  1IBK L;  1TWH H;  4OX9 Q;  2OQK A;  2YV5 A;  1ASY A;  1XNQ L;  2PI2 A;  2I0Q A;  4BXX H;  3GTL H;  1CKO A;  4LF9 Q;  3CC4 A;  3AQQ A;  1XPR A;  1MJC A;  3KOJ A;  1TXY A;  5BR8 L;  2VW9 A;  1YHA A;  2ZM6 Q;  4HIO A;  2IX1 A;  3S14 H;  1G51 A;  4C3I H;  2OTL A;  1N36 L;  1L0W A;  4HID A;  2E8G A;  4Y52 H;  4XTC S;  1YNX A;  2H5X A;  3F2D A;  1HR0 Q;  4B3S Q;  1Q1B A;  4JI6 Q;  4A4I A;  1C7Y A;  4JI5 Q;  5M3F G;  3U4Z A;  1N8R C;  3ULJ A;  3S2H H;  3AFQ A;  1PYS B;  1YHQ A;  4GLX A;  2HHH Q;  2JEA I;  3CD6 A;  2R93 H;  3AFP A;  5JEA J;  1N32 Q;  2WP8 J;  4QQB X;  4A3E G;  2YYZ A;  1B70 B;  2JA5 G;  2HIX A;  4YCV A;  1FJG Q;  4A3L H;  4IPC A;  1K3R A;  1B8A A;  2WAQ E;  4A3F H;  4X64 L;  1WYD A;  4LF6 L;  5C0X J;  4IFD G;  3HOW H;  1EOV A;  4X6A H;  1JT8 A;  3K81 C;  2VUM H;  1E22 A;  1PH2 A;  1N34 L;  5AJ3 Q;  4DV1 Q;  4QY7 A;  5E7N A;  1YIJ A;  1Q7Y C;  1XNR Q;  3PIO A;  2UXB Q;  2B29 A;  5EAY A;  2E2I H;  1NJI C;  2LXK A;  4OON A;  3S17 H;  3EIV A;  3E9I A;  4GN5 A;  3GO5 A;  2AWN A;  5M3F H;  2LXJ A;  2CQO A;  4BY7 G;  4QL5 A;  2IHE A;  2JA7 H;  3KF8 B;  4GKJ L;  2N78 A;  1J5E Q;  4DV2 Q;  3DLL A;  2UUB Q;  3PO3 H;  1EIY B;  4B3M Q;  3ULL A;  2UU9 Q;  4GNX A;  3PUV A;  1VQO A;  1H95 A;  3PIP A;  5IT9 c;  4A3I G;  1TWA H;  1KC8 C;  3K0X A;  3U50 C;  1VQ5 A;  3EBE A;  1N36 Q;  3CQZ H;  2KHI A;  4H02 A;  1UE5 A;  1KAW A;  1V43 A;  5C0X I;  3UE0 A;  2ZJP A;  1I5F A;  1YHB A;  4APV A;  1W2B A;  1VQ8 A;  2UUC L;  4AQY Q;  2RHS B;  1VQK A;  3H15 A;  2UUB L;  3I4M G;  2D0P A;  2YTX A;  1X3F A;  1KRS A;  5M5X H;  4A3K H;  2NVQ H;  3H3V I;  2IX0 A;  4UPA A;  4OWX B;  4DUY L;  1CSP A;  4JCV E;  5IE8 A;  1LTL A;  1HR0 W;  2B63 G;  1T9H A;  1X56 A;  3PO2 H;  2KCT A;  4KLK A;  1KIX A;  3F2B A;  2L15 A;  5FLM H;  4PG3 A;  1I94 L;  2K75 A;  1IYJ B;  1YEZ A;  2RHQ B;  4JI6 L;  5AJ3 L;  4A3E H;  1C0A A;  2VS1 A;  4LWC A;  2OCE A;  2VQE Q;  2JA7 G;  3A0J A;  1K0R A;  3J80 i;  4YCW A;  3UDX A;  3T1Y Q;  2AMC B;  3K7A H;  1VQL A;  3HOU G;  2ZTE A;  4DV7 Q;  1IBM Q;  1QUQ B;  4DUY Q;  4YWL A;  3AYH B;  1WJJ A;  4BBR G;  4JI0 L;  4LF4 L;  4GNX B;  3G6E A;  4UP7 A;  2UUC Q;  3GTG H;  4DR5 Q;  4BBS H;  3S1R H;  4LNQ A;  3PF4 A;  4KI0 A;  1VQF A;  1VQI A;  1WI5 A;  2ES2 A;  4JI4 L;  1QVG A;  5IYB H;  3FKI G;  3CCU A;  1HZC A;  3CCR A;  4O2D A;  1PVO A;  3OTO L;  1S3O A;  4EX5 A;  4A3C G;  4LFB Q;  4OXP A;  4NB3 A;  1VCI A;  3CPF A;  4IJH A;  4JOI A;  5M3M G;  4DR1 Q;  3M85 A;  4LF7 L;  3HOX H;  1O7I A;  3OW2 A;  1P8L A;  3RLF A;  4DNI A;  2JEB I;  1PH9 A;  1GD7 A;  3G48 A;  1QVF A;  1VQN A;  5JEA G;  1NY4 A;  3GTM H;  4GKJ Q;  4A3M H;  4JOI C;  1BBU A;  1BKB A;  3D0F A;  2VQF L;  1V1Q A;  1PH8 A;  1VQ9 A;  2VUM G;  2JA8 G;  4L5Q A;  4DV0 Q;  1QUQ A;  1BBW A;  4LUO A;  4AQY L;  3H0G H;  5LMU Q;  3PO3 G;  2HHH L;  2MO1 A;  1YJN A;  3G71 A;  4JBW A;  3OTO Q;  4DV5 L;  1X54 A;  4TQU S;  1NBW A;  3HOV H;  4DR3 L;  2JK8 A;  5LMN W;  5IY0 A;  1QZG A;  4BY1 H;  2JE6 I;  5HY6 A;  1JE5 A;  2K14 A;  3Q8D A;  3M4Q A;  3CP0 A;  4DV3 Q;  4HIK A;  3UE1 A;  1Y1V H;  3HKS A;  3NEN A;  1YJW A;  5IP9 H;  4DV2 L;  1Q82 C;  3A5U A;  2IY5 B;  4DR7 Q;  1A62 A;  1SLJ A;  4Y7N H;  2NN6 I;  3NEL A;  4X66 L;  1JB7 A;  4DR4 Q;  1TWG H;  2KBN A;  1LYL A;  2ZJQ A;  1E1O A;  5IYD G;  1HNX L;  4J15 A;  3CMA A;  3S1Q H;  5IYC H;  1E7Z A;  3CCS A;  3G4S A;  2OWO A;  1B7Y B;  1N9W A;  3D31 A;  2UUA Q;  4RMF A;  2K5V A;  1VQA A;  4A76 A;  4A3M G;  1X9N A;  4L5S A;  3GDE A;  1EQQ A;  1XNR L;  2UXB L;  1L1O C;  1Q12 A;  4PZ8 A;  4JI8 Q;  5K36 G;  2R92 G;  1VQM A;  3BZC A;  4GS3 A;  1K9M C;  3M9B A;  4QGU A;  5J3B A;  4FDB A;  2LSS A;  3J81 i;  4LFA Q;  1KL9 A;  1P16 A;  3RLN A;  3ULP A;  1VQH A;  1EQR A;  4A3G H;  1XPO A;  2MQH A;  1Z9F A;  3PUW A;  2WFW A;  3STB C;  5GAH C;  3MXN B;  3I4N G;  3HOY H;  2UXC L;  3HOY G;  1CKN B;  1K83 H;  1KHI A;  1PH5 A;  4X65 L;  1YZ6 A;  2E2J H;  4LFC Q;  1I6H H;  3RZO H;  1GO3 E;  2YTY A;  3K7U C;  4GOP C;  3GTJ H;  5IWA Q;  1HZB A;  1EUJ A;  1BVS A;  2NZO A;  2ATW A;  2IHF A;  3PGZ A;  4B3R Q;  2VNU D;  3JAM c;  1OXV A;  2R92 H;  4KHZ A;  4JYA L;  1LM0 A;  1KD1 C;  2AKW B;  2IT1 A;  2Z6K A;  4C2M H;  1IBL L;  1IL2 A;  1HR0 L;  4B3S L;  1PH4 A;  3J81 c;  2ASB A;  2N8N A;  1TWF H;  3HOZ H;  1XJV A;  4DR6 Q;  4JG2 A;  4YWK A;  4HJA A;  1JJ2 A;  2K5H A;  3BJU A;  3PUY A;  2E2H H;  4DV4 L;  2CCZ A;  1A63 A;  1MIU A;  4O0A A;  3KLW A;  4KHP L;  2JA9 A;  3B6Y A;  3LGJ A;  1IBK Q;  1KXL A;  2FXQ A;  2N49 A;  4QIW E;  4DR2 L;  2CWP A;  3UDG A;  1PH6 A;  4X64 Q;  3UDI A;  1E1T A;  2EIF A;  4GOP A;  4C3J H;  4JV5 L;  4R4C A;  1GM5 A;  4YY3 L;  1E24 A;  3GD7 A;  1G29 1;  4B3T L;  1HNW L;  1WFQ A;  1VQP A;  1SMX A;  2DGY A;  1VQ6 A;  1CKN A;  3J7Z C;  1PH3 A;  3HOV G;  4IFD J;  1HZ9 A;  1SRO A;  1AH9 A;  2K5N A;  3E0E A;  1N33 L;  2ZTC A;  1N33 Q;  2BH2 A;  4NXM Q;  2F52 A;  4JI5 L;  3RNU A;  1TWC H;  1EIF A;  3I2Z A;  4UP8 A;  2B63 H;  4LF8 L;  2ZM6 L;  1XMQ L;  4A3L G;  1UE1 A;  3I56 A;  3E9H A;  4GN3 B;  5GRO A;  4IO9 A;  3HKZ E;  4R4Q A;  5C4X H;  3FP9 A;  3MEF A;  4X62 L;  1PH1 A;  1NMG A;  3HOX G;  1W3S A;  4RG1 A;  1RL2 A;  2EXD A;  2OTJ A;  4AH6 A;  3W1G A;  2WAQ G;  1LUZ A;  1X3E A;  1JJG A;  4YWM A;  3RN5 A;  3CCV A;  3FKI H;  4JBJ A;  3HOW G;  4PZ7 A;  4GKK L;  2GVA A;  3L0O A;  1WCM G;  1QVC A;  3PUZ A;  3T1H L;  1N34 Q;  5IYD H;  2Z0S A;  2RCN A;  2Y0S G;  5LMN L;  4LFA L;  4R4O A;  2VY3 A;  1K8A C;  3JC6 6;  4EQ5 A;  1NTG A;  1U5K A;  4P72 A;  4YHH Q;  4JC0 A;  5IP7 H;  1A8V A;  1PH7 A;  4LF5 Q;  2DUD A;  4R4I A;  3W5O A;  3HOU H;  4JI7 Q;  1UWV A;  1KQS A;  4LF8 Q;  2MO0 A;  3HKZ G;  3SGI A;  2UUA L;  2R7Z H;  3W1B A;  1R9T H;  2D0O A;  3NEM A;  4LUV A;  3WWV A;  3KJO A;  4L5R C;  1Y14 B;  2Z6K C;  3S2D H;  5M5Y H;  2RF4 A;  4OWT B;  2GVB A;  3CPW A;  1XMO L;  2E5L L;  2CFM A;  4JBK A;  2WB1 E;  3J80 c;  1SFO H;  4NXN L;  1MKH A;  2XGT A;  4GLA C;  4A3F G;  4TVA B;  1Y1W H;  2F3I A;  4BA2 I;  3PF5 A;  2JA6 H;  1CKM A;  5C4X G;  3I4M H;  4DUZ Q;  5LMN Q;  1UE6 A;  5IP9 G;  3TS0 A;  2R93 G;  1ASZ A;  5IP7 G;  5LMU L;  1K73 C;  3A74 A;  1AE3 A;  5HGQ A;  1PA6 A;  1Z47 A;  4IJL A;  1I94 Q;  3M4O H;  4YCU A;  2Q2H A;  3L7Z C;  3F8T A;  3CW2 C;  2V1C C;  3U58 A;  3GTK H;  2ALY B;  3I7F A;  2WB1 G;  5H1S E;  3HOZ G;  3M7N A;  4POF A;  3CF5 A;  1X6O A;  3FHW A;  4PZ6 A;  4DAY B;  3J81 j;  4DV4 Q;  4DR7 L;  3CC7 A;  3KJP A;  4LF7 Q;  5FJ8 G;  1Q8K A;  5JJL A;  4JI2 Q;  2KCM A;  3RZD H;  5DLQ E;  3F2C A;  4A3J G;  4JI3 Q;  2BH8 A;  2AHO B;  1YVC A;  1FL0 A;  4AYB G;  4DR3 Q;  5M3M H;  4JYA Q;  1L1O A;  2I5M X;  5FJ8 H;  4DR5 L;  1HH2 P;  2UXC Q;  4DPG A;  4A93 H;  4WJ4 A;  1D7Q A;  1I3Q H;  4DV0 L;  3PSI A;  1SE8 A;  3ICE A;  4A3D G;  3BU2 A;  4WJ3 M;  4LUZ A;  4K0K L;  2KHJ A;  4JV5 Q;  2R7F A;  1D8L A;  4LFC L;  3ZJY C;  2UXD Q;  1AE2 A;  2BA0 A;  3I4N H;  1DGS A;  3ERS X;  2A1A A;  5ELN A;  1X55 A;  3F1Z A;  4JI8 L;  5C3E H;  5C44 G;  4DV6 Q;  1S72 A;  3T1H Q;  2PQA B;  2BA1 A;  2NN6 G;  2Q2U A;  1FGU A;  3U4V A;  3M3Y H;  1EWI A;  1Q86 C;  1PV4 A;  1Q46 A;  4DAM A;  3HFZ B;  4GNX C;  4AYB E;  4LF6 Q;  2A8V A;  4DKA C;  2QEX A;  4LF5 L;  4K0K Q;  4AIM A;  3AEV A;  3H0G G;  3S1M H;  1X3G A;  2XTI A;  3RR5 A;  2NZH A;  5IYC G;  3S15 H;  3DM3 A;  2K4K A;  2NVX H;  1VQ4 A;  2PMZ E;  4IPG A;  4IOA A;  4DR1 L;  2UXD L;  4HJ9 A;  4A3B G;  1HNZ Q;  2R6G A;  2F4V Q;  4DV3 L;  1HZA A;  2QGQ A;  3BZK A;  3J7A 5;  4GKK Q;  4C3H H;  4JI4 Q;  4A3J H;  1HNX Q;  4IOC A;  1M90 C;  3PUX A;  1Y1V G;  1YIT A;  4GLV B;  1VS0 A;  2C35 B;  2K52 A;  5FLX c;  1HNW Q;  4A3C H;  1MJE A;  1Y1W G;  5M5W H;  2Q2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...