5M3FH

Yeast rna polymerase i elongation complex at 3.8a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
144
structure length
131
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of RNA polymerase I transcribing ribosomal DNA genes.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase I subunit RPA190
total genus 21
structure length 131
sequence length 144
ec nomenclature
pdb deposition date 2016-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m3fH00
2ID0A 3A5UA 2D0PA 1VQBA 3FHWA 3SGIA 2I5LX 4C3JH 4RG1A 1IBLQ 3CCLA 1KQSA 4B3SL 1OXXK 4KHZA 4B3MQ 1YHQA 4DV6L 1VQDA 2ZTDA 4OO1I 2WB1G 1K9MC 3I4NH 1UWVA 2I5MX 2VY3A 1LTLA 4OWWB 1E7ZA 1WJJA 3FKIH 3BZCA 5LMUQ 4A3MG 5M3FG 4A3CH 1X3EA 1BBWA 1QVGA 1YJWA 1I94L 3UDGA 4BY7G 4IOAA 1HNZL 2E8GA 1TXYA 1VQ8A 4LFAL 1BVSA 2N8NA 1PA6A 1YIJA 1Q86C 4K0KQ 1JE5A 2YTXA 3UDXA 2RF4A 2E2JH 2AWOA 2MFIA 3NEMA 2VQEQ 1V9PA 3T1HQ 1SLJA 3UE0A 5K36G 4DAMA 3ULLA 3S1MH 4O0AA 1CKNB 4DR6L 4NXMQ 3HKZE 5BR8L 3T1YQ 4IPHA 4DV6Q 1S72A 3GTOH 3M4PA 5M3MH 1AE3A 3RLFA 4JI2Q 1VQNA 2UXCQ 1K0RA 3J80c 5GAEC 1T9HA 5LMNQ 3STBD 3CPFA 2CWAA 3G4SA 1QZHA 3UDFA 1IBLL 1FJGQ 1LYLA 4IFDJ 3CCSA 3PUYA 1Y1WG 3F8TA 5JEAG 1XTDA 4OX9L 4JI4Q 4DV0Q 2JEBI 2A19A 5GAHC 3S1RH 3KF6A 1U5KA 2VUMG 2ES2A 1Z9FA 3RR5A 1VQMA 4YY3Q 3GDEA 1HNWQ 3HOXG 4DV5Q 4JYAQ 4IPGA 3ERSX 1G51A 1OXVA 3ER0A 3CMAA 3K0XA 1BBUA 2Q2IA 1IBML 1X65A 2CQOA 2WFWA 4R4CA 5H1SE 4DV4L 2IY5B 3G6EA 4L5SA 2IX1A 3RN2A 4UPAA 5LMNL 2YTVA 4LUZA 2UXBL 3FKIG 4A3FH 4GLXA 1FVIA 2ZTEA 4JI7L 1GM5A 4LF6Q 1JJ2A 4BA1I 3KYHC 5IYCH 5IE8A 4J15A 5M5XH 3KF8B 3H0GG 1W3SA 2BA1A 5AJ3L 1N8RC 1PH3A 1VQIA 1PH5A 2HIXA 2MQHA 4P72A 1L0WA 4C2MH 2Y0SE 1D8LA 1PH4A 1YHBA 4K0KL 2ALYB 1VCIA 2NN6G 1AH9A 1YEZA 4B3SQ 5IP7H 3OYYA 3PF4A 3CCEA 1LM0A 3S2DH 1GVPA 1C0AA 3E0EA 3S14H 1GD7A 3I56A 1E1TA 2BH8A 1SRUA 4JI1L 2PQAB 4XTCS 1K8AC 4EX5A 4AQYL 4BY1H 5IYDH 3I55A 2R7ZH 1CKMA 1VS0A 2K5VA 4R4IA 3BZKA 4DV7L 1XNQQ 1L1OC 3ULPA 4HJ8A 1KAWA 1X3GA 4DV3Q 4A3JG 1UE1A 3J81c 2Q2TA 3S2HH 4X65L 1HR0Q 4PZ6A 5AJ3Q 5JJLA 1VQEA 2HQLA 3A5ZB 1YVCA 2DGYA 3BJUA 3L2PA 4POGA 3NENA 4DKAC 3S24A 3EN2A 4LW1A 3RLNA 4A3KH 1PH7A 3M3YH 1YZ6A 3MEFA 4A93G 1G291 4UP7A 3CCVA 5FLMH 1JT8A 2KCTA 2YU9H 4FDBA 3GTKH 2QA4A 3GTLH 4NXML 4A3LH 1TWGH 2H5XA 5M5YH 3RNUA 2JEAI 3K81C 4P75A 5FJ8G 4A3FG 1NE3A 4A3BH 4UP8A 4DR1L 1ASYA 1YJ9A 3CCQA 2K14A 1E22A 1VQJA 4BY7H 2NZHA 3A74A 4OWXB 2ASBA 3UDIA 4A75A 5IYDG 4JI0L 4LF9L 2ATWA 2UUBL 2N49A 1Y1WH 2KHJA 1JJCB 1H95A 3OTOQ 1PYBA 1S3OA 3S1QH 1OTCA 4LF5Q 5GQOA 5C4JH 1PVOA 3K7UC 1QUQB 1EWIA 1P8LA 3HOVH 4DR7Q 4R1JA 1Q8KA 4DAYB 4YY3L 3T1YL 2UU9L 3BU2A 3AQQA 1I3QH 1N34Q 4BXXH 4DUYQ 4LWCA 2D62A 3HKZG 4GLVB 5M3MG 3CMEA 4LF7L 5IYBG 2KENA 3J7A5 3F2CA 1FGUA 4OX9Q 4JI5L 5IWAL 4JI8L 3F2DA 1HNXL 4PZ7A 4DR2Q 1M1KC 1Y1VH 2B29A 4JI2L 4DR5Q 2NVTH 4YHHL 1XPRA 4IJHA 2F3IA 1U0LA 2ZM6L 4LF8L 4BBSH 4KI0A 1I94Q 1A63A 3CCRA 1UE6A 4O2DA 4A93H 3M85A 4A3DH 1SE8A 3HKSA 5IP9G 2HHHL 1V1QA 3I7FA 4GNXA 4NXNQ 2UXDL 1KL9A 4IFDI 2JJQA 2NVYH 4WJ4A 3ZJYC 3CAMA 1TWCH 3AEVA 3LGJA 4A3LG 3F1ZA 4QL5A 1N33Q 2EQSA 4DV2L 1NJIC 4B3RQ 1YI2A 4AQYQ 2E5LL 4C3HH 5IT9c 4A3GH 3CP0A 1HNZQ 1AE2A 1B8AA 1XPOA 4JBMA 1C7YA 3PCOB 2VZAA 1SFOH 4JI4L 3M9BA 1Q81C 2ZJRA 2Q2HA 2Z6KA 3A0JA 1Q7YC 4R4TA 5IYBH 1VQOA 2K4KA 3JC66 4GKKQ 2XGTA 4B3ML 5FLMG 1QUQA 1Q46A 3PUVA 4X64Q 1J5EL 1KXLA 4YCUA 1CUKA 1VQPA 1PH1A 1HZBA 4IJLA 3OW2A 2HHHQ 2UUCL 4PZ8A 1Y14B 1N36L 1SMXA 2QEXA 1A62A 1K83H 1NTGA 5C44H 1QVFA 4DPGA 4PG3A 1VQCA 4IOCA 3HFZB 3J81j 1KD1C 3S16H 4LUOA 4JOIA 4QIWE 1B70B 4HIOA 2PMZE 4UP9A 1OXTA 4JI5Q 1PYSB 2R92G 3CQZH 3VDYA 2MO1A 4LF4L 4JYAL 1EFWA 3I4NG 1IYJB 4BBRH 4DUYL 4IPCA 4UY8C 2K75A 2D0OA 5C4XG 4A76A 2Q2UA 4JI6L 1X55A 3HOVG 5J3BA 3DM3A 4JI3Q 3KJPA 4DR3L 1LUZA 1VQLA 4DR7L 1ASZA 4LNQA 1X6OA 3I4OA 1XMQL 1PHJA 2OQ0A 4X62Q 3PIPA 1K73C 1N32L 1KC8C 2UUBQ 4A3GG 2CFMA 4LFCQ 3CCMA 4JC0A 2VL6A 3AYHB 2F52A 1I50H 1HH2P 2KCMA 3L0OA 1TWFH 4A3IG 3RN5A 3D31A 2MO0A 1PH2A 5GADC 1N36Q 4A3DG 1MJCA 1P16A 1Q12A 5ELOA 1XMOL 1NMFA 4NPSA 1IBKQ 3HOUH 1V43A 2JK8A 4DK3C 2VQEL 3DLLA 1K3RA 4OONA 3K8AA 2ZJPA 1YNXA 4GN4B 4YHHQ 3NELA 4QGUA 2JA7H 4HJAA 2RHSB 3TS2A 3KF6B 1HZCA 4JG2A 2R7DA 1N32Q 4PMWA 3PIOA 1CKNA 2WAQG 2VUMH 2JA8G 4KHPL 1MJEA 1PFSA 4MTNA 2Z0SA 4WJ3M 1I5FA 3S17H 3H0GH 1E24A 1CSPA 1PV4A 4BY1G 3KJOA 3W5OA 4X66L 4LFCL 4OXPA 2F4VL 3HOWH 3W1BA 4QJFA 1UEBA 4A3JH 1O7IA 3KDFB 1VQ5A 1KRSA 3U4ZA 4GOPB 1SR3A 3JAMc 4GKJQ 2JA6H 3IRBA 4P73A 4GNXB 3M4OH 1EYGA 4C3IH 4HIMA 1VQ7A 1VQGA 4DNIA 3TS0A 1KHIA 2XTIA 3TRZA 2I0QA 1XNRL 1YITA 5DLQE 1C9OA 3KLWA 2PI2E 1R9TH 3W1GA 2ZJQA 2BH2A 4JV5L 3ICEA 1BKBA 3E9IA 1XPUA 4KHPQ 4HJ7A 1J5EQ 1B7YB 1Z47A 2BA0A 2KBNA 3G48A 5EAYA 2CCZA 4BBRG 3PO2G 1IXRA 3ULJA 3EIVA 4AH6A 2KHIA 4A4IA 3I4MH 2UXBQ 2R6GA 3EBEA 1WCMG 3J81i 3PUXA 3Q8DA 3CD6A 2DUDA 5C0XG 4DUZQ 1HNXQ 3H3VH 4HJ9A 1IBMQ 2MNAA 1A8VA 5C0XJ 3GTJH 1E3PA 2OTJA 1S40A 4LF9Q 2IHEA 4DV1Q 1YJNA 5GROA 4YCVA 3WWVA 5GAGC 3PF5A 2PNHA 4DV7Q 2GVBA 4GN5A 1X3FA 4A3CG 1D7QA 2JA5H 3PGZA 3I4MG 3D0FA 2PI2A 4DV0L 1OXSC 4JI1Q 1VQ4A 1SROA 3HOYG 4LF8Q 4POFA 1VQAA 4P71A 4B3TL 1FJGL 2LXJA 4JI0Q 4YWKA 1PH6A 4JBKA 4DV2Q 4B3RL 3CF5A 4LFBQ 1WFQA 4R4QA 4QQBX 5FJ8H 1JJGA 1X9NA 4BBSG 5JJKA 4YCWA 2UUCQ 4LF4Q 2K5HA 4L5QA 3H15A 1XMOQ 1GO3E 1N9WA 5IYCG 4A3KG 4JBJA 1PH8A 4MNOA 3CCUA 4LF7Q 2JA8H 1A0IA 4DUZL 1HZ9A 1CKOA 1J6QA 2OWOA 4APVA 1UE7A 3UE1A 1M90C 4JI7Q 2WB1E 2JA7G 1RIPA 1HR0W 3HOWG 1VQKA 3HOZG 2OTLA 4Y7NH 5C3EH 5C0XI 1YHAA 4A3MH 3RZDH 5C4XH 4GNXC 1XMQQ 1Q82C 3CC2A 1NBWA 5LMUL 4X64L 1FL0A 3HOXH 3AFQA 4X66Q 1N34L 3PV0A 4DK6C 4X6AH 2CWPA 4JI3L 2HIVA 3HOYH 4LFBL 2N78A 2A8VA 1GKHA 2OCEA 2R7ZG 3PO3H 4GN3B 3TREA 5HY6A 5IY0A 4JCVE 1TWHH 3L7ZC 4MZ9A 3GTQH 4X62L 1L2FA 5IP7G 2GN5A 2Z6KC 5C3EG 2YYZA 3GD7A 1K8GA 3PSIA 2R93H 2EIFA 1G6PA 4AYBE 3GTGH 4L5TA 2C35B 2NZOA 1JB7A 1L1OB 1NY4A 4DR5L 3U4VA 1QVCA 2K50A 2K5NA 4DV4Q 4DV1L 1X56A 3S1NH 1W2BA 4ALPA 5JEAJ 3CXCA 2IHFA 4IFDG 3STBC 3K80C 4DV3L 2LSSA 2OQKA 2RCNA 1XNQL 2AMCB 3NBHB 2JA6G 4A3EG 4A3EH 4QY7A 3U50C 4A3IH 4L5RC 3CW2C 4B3TQ 1HZAA 1I6HH 4IO9A 4JOIC 4OO1G 5JJIA 2K52A 3H3VI 4DR4L 3MXNB 4H02A 1IBKL 2E2IH 4P74A 2GVAA 3HOUG 2L15A 1WOCA 1DGSA 4DR3Q 4R4OA 1XNRQ 2UU9Q 1N33L 4AYBG 1VQHA 1IZ6A 4GOPA 1L1OA 1OXUA 3KDFA 4OWTB 4DR1Q 4A3BG 2B3GA 2B63H 1KIXA 4LF5L 2B63G 3RZOH 4EQ5A 2UXDQ 1NMGA 2QGQA 5C44G 1VQFA 3OTOL 2WAQE 2EXDA 2N3SA 1E1OA 2LXKA 1WYDA 2I5HA 3GO5A 2VQFQ 2AHOB 3E9HA 4KLKA 2E5LQ 3TQYA 3CCJA 2R92H 5HGQA 1HJPA 2NN6I 1SN8A 3TEHB 2WP8J 3GTMH 1VQ9A 1MKHA 3M4QA 4TVAB 4YWMA 5IWAQ 3J80i 1XJVA 4AIMA 4DR6Q 1TWAH 4NXNL 3S15H 4TQUS 4HIKA 5M5WH 4ME3A 3I2ZA 3T1HL 2YV5A 1MIUA 4GKKL 1HNWL 2NVXH 3K7AH 1EQQA 2NVQH 2CKZB 3PO3G 1WI5A 4GKJL 1EQRA 1X54A 2FXQA 3J7ZC 4DR2L 3PUZA 5LMNW 1Q1BA 3PUWA 2VQFL 2V1CC 4JI8Q 4IPDA 1EIYB 2IT1A 1CSQA 4XIGS 2JE6I 3CPWA 2VNUD 2F4VQ 1Q1EA 3F2BA 2UXCL 5IP9H 4DV5L 1YBYA 2JA5G 4LUVA 4YWLA 2R7FA 4BA2I 1JMCA 2Y0SG 2UUAQ 1RL2A 1WCMH 3B6YA 4RMFA 4JBWA 2AWNA 2HT1A 5FLXc 1KRTA 3GTPH 2ZTCA 1VQ6A 1EUJA 2JQOA 4NB3A 2R93G 2A1AA 1IL2A 3KFUA 4DR4Q 5ELNA 4GLAC 2ZM6Q 2YTYA 3FP9A 1PH9A 2VW9A 3G71A 2PQAA 5E7NA 3KOJA 2E2HH 4GOPC 1UE5A 4JI6Q 5BR8Q 4BXXG 2RHQB 4GS3A 1EOVA 3CC4A 3CC7A 3JAMi 4HIDA 4X65Q 2IX0A 4HJ5A 1HR0L 4JV5Q 2JA9A 3AFPA 3RLOA 2VS1A 3U58A 1Y1VG 1QZGA 2UUAL 3M7NA 4LF6L 3HOZH 4Y52H 4LFAQ 2AKWB 5M3FH 1EIFA 3PO2H
chains in the Genus database with same CATH superfamily
2KCNA 5KIXA 5T1GA 1KAAA 1PTOC 3HG9A 2I5LX 3DWQA 3M4OB 1IBLQ 1SYGA 4B3MQ 2ZTDA 1BBXC 1UWVA 5KNBA 1LT6D 5JPNC 1WJJA 3NXWA 5M3FG 4A3CH 1X3EA 1BBWA 5CBEE 5IIFA 4BY7G 3A56A 3BDOA 3M4YA 1BVSA 1JE5A 2ICEC 2EYOA 3FRPB 2PZTA 2VQEQ 3D4WA 5AFWA 3T1HQ 1A3UA 5EPLA 3S1MH 1CKNB 4OIJA 3TP6A 3HOYB 1WD1A 3T1YQ 3M4PA 5M3MH 1ESRA 1VQNA 1PTOH 1IBLL 1EYAA 5LMNQ 3STBD 5K5PA 3C46A 1LYLA 3OIQA 3PUYA 3F8TA 5BN3A 1XTDA 1ZXTA 1S5FD 1QILA 4ZYSA 1U5KA 4ZCKA 2VUMG 2ES2A 4YY3Q 3LWUA 2XWBB 4JYAQ 1GUNA 3CMAA 2D5DA 3X3MA 1CA5A 1JC7A 3PO2B 4O42A 1GHKA 5H1SE 5JEAH 3D6CA 2IX1A 2VXWA 5LMNL 1LT5D 5CV8A 2A74C 4RH6A 4J15A 3KF8B 3ERQA 2BA1A 5AJ3L 1VQIA 3JAML 2TSSA 4P72A 1L0WA 1IL8A 1D8LA 1EIHA 1WD0A 1VCIA 1RF2D 4QF4A 2E75C 1AH9A 1JCKB 3AB9A 2XVSA 3LX0A 3S2DH 4JW0A 3S14H 3I56A 2DY8A 1YNNC 4XTCS 2QEJC 1I6VC 3I55A 1XNQQ 3ULPA 4HJ8A 1X3GA 4A3JG 5CV4A 4IUPA 3J81c 4OHJA 2Q2TA 4PZ6A 1VQEA 1DJRD 2PZUA 1A6XA 4DKAC 3S24A 4LW1A 3RLNA 2L12A 3MEFA 2RDGA 1SE3A 1TIID 4CDDC 1Z7TA 1TWGH 1ET6A 4H44C 1EWHA 1LV9A 3MVVA 4V0BA 1GUOA 3CCQA 2K14A 2BDOA 4OWXB 2ASBA 2Z8LA 4ZQ3A 1FR3A 1EYDA 3SXHA 5IYDG 1Q3LA 4LF9L 2ATWA 1HFNA 2UUBL 1H95A 1K83B 1S3OA 4BWGB 1OTCA 3K7UC 1P8LA 4DR7Q 1SYFA 3DUZA 1I3QH 3K7AB 1HRJA 1N34Q 5IGGA 2D62A 5M3MG 4LF7L 5DNFA 5IYBG 4ABNA 1QOHA 4OX9Q 4JI8L 1HNXL 1K0SA 1ZYRC 4PZ7A 3IAYA 4JI2L 1KLGD 4I7ZC 3D4RA 4FXGC 3HKSA 2HHHL 4GNXA 3EFXD 3I7FA 2UXDL 3L3OC 1KL9A 2WIIB 2NVYH 4WJ4A 3ZJYC 3LGJA 2QILA 3F1ZA 1LT4D 1SFOB 4DV2L 1NJIC 1MSHA 2Z6KA 3PIO3 3A0JA 2F4IA 2EOTA 1VQOA 5FO7B 5CV5A 4LK1C 2XGTA 4QCLA 1AP0A 3VR6A 3RZDB 1J5EL 4L6TB 4YCUA 1CUKA 2HHHQ 1SMYD 1Y14B 1K83H 3W3AA 2LS01 4RGOS 1QVFA 3I70A 3OIPA 4PG3A 3NPPA 3HFZB 3S16H 1BCPF 2Z4IA 3MEHA 4QIWE 4HIOA 1EL0A 1OXTA 1PZJD 2K01A 1CT1D 4LF4L 1W6KA 2HCIA 3I4NG 1IYJB 4BBRH 4G7ZC 2K75A 2D0OA 3DM3A 3KJPA 1RDPD 1X6OA 2G5DA 4FP5D 3QJYA 3PIPA 1CZWA 1H9SB 1RTOA 2UUBQ 2VUMB 4LFCQ 3MFYA 1TWFH 2XNAC 4A3IG 3MXGA 3D31A 2MO0A 4IALA 2E2IB 1GUTA 1N36Q 1BO0A 1NMFA 1H9MA 2EJGC 3C1EA 2DNEA 4DK3C 1C48A 3DXJC 1SNOA 3QIAA 2ZJPA 4OIKA 1YNXA 4GN4B 1SE4A 4QGUA 2A69D 1SJHD 1TS5A 3KF6B 3V96A 1HZCA 2R7DA 1JWMD 1CKNA 2WAQG 4KHPL 2AUKA 4L63B 3K6OA 5ISRA 4F8MA 3H0GH 1HA6A 3TMEA 5E3FA 5EKIA 1PFMA 4BY1G 1J9OA 3W5OA 2PO4A 1VMCA 4OXPA 3W1BA 4A3JH 1PRTD 1VQ5A 1TVXA 3U4ZA 3NUCA 5C6AA 3J7AV 3IRBA 4GNXB 3MC0B 4I65A 4C3IH 4J6HA 1VQGA 2KECA 2X6LA 3AMUA 3ZYYX 1RKNA 1YITA 5DLQE 1C9OA 2BH2A 1BKBA 3E9IA 4KHPQ 1J5EQ 1B7YB 1Z47A 2KBNA 4JPBW 1FGBD 1F2YA 1S4ZA 3PO2G 4HTHA 3EIVA 4LAAA 4AH6A 4L8JA 1PTOB 2R6GA 1I6HB 3SHLA 2DNCA 5C0XG 4DUZQ 5I2YA 3S1MB 1A8VA 3NQIA 5C0XJ 1E3PA 2OTJA 3KLSA 1CA6A 4DV1Q 3H3VC 5E4WC 2R93B 2PNHA 4DV7Q 4GN5A 2M2LA 4UHVA 1D7QA 2QDBA 4C1NI 4FVMA 1VQAA 4P71A 4YWKA 2JSOA 4JBKA 1ML0D 1WFQA 3P1HA 3GTLB 1JJGA 3NHHA 3NP8A 4YCWA 4LF4Q 1L0YB 2VB3X 2LKVA 4LF7Q 2A6HC 3BZDB 4YIJA 5FK9C 3CCUA 4HMJA 1HZ9A 1CKOA 5CR3A 1J6QA 5E1FA 3V05A 1GUSA 2I46A 4EGVA 5M3FB 4RHRA 1TWAB 1VQKA 4K2KA 1WTOA 1XX8A 4K6DA 3CC2A 1R4PB 3G7LA 4X64L 2EYLA 4C3IG 3CRKC 1GHJA 5A2QL 4KY5A 4JI3L 4DK0A 5D3IB 1WTHA 2A8VA 5EQ0A 1JB3A 3PO3H 5IY0A 3LWEA 4JCVE 3GTQH 1EQTA 3GTGB 4A3BB 2GN5A 1IW7D 3GD7A 5C3EG 3PSIA 3J80L 3GV3A 4KY7A 1HHVA 4L5TA 4FF2A 2AQ2B 1DXMA 4CDEC 1BXTA 4A3EB 3A54A 3MFGA 2JA6G 4A3EH 1I4QA 4A3IH 4L5RC 4B3TQ 1HZAA 2SDFA 4HEDA 4OO1G 3H3VI 4DR4L 1IBKL 2E2IH 2L15A 2EYHA 2EJFC 3BG3A 3P7JA 2DJGC 4DR3Q 1XNRQ 5C3WA 4AYBG 1IZ6A 4OWTB 5M5YB 3PO3B 1HFGA 3GO5A 2VQFQ 2F0MA 1ILPA 2XWJB 4KLKA 2E5LQ 3TQYA 3CCJA 5HGQA 2QDLA 2WINB 3HEJA 2WV6D 1TWAH 5M5WH 3I2ZA 1NR2A 2L0CA 4GKKL 3FPUB 2NVXH 2NVQH 5E4XA 2CKZB 1O80A 1WI5A 1LO5D 2K5QA 3PUZA 3PUWA 2VQFL 4IPDA 1EIYB 2X69A 1MGSA 3F2BA 1CZGA 5IP9H 4B9XA 2HDMA 4CJ1B 1AZQA 1RL2A 3KLSX 1SAPA 5BN4A 3BVGA 2BDNA 3NBIA 1IL2A 3KFUA 1EY8A 5ELNA 2YTYA 2Z6BA 1PH9A 1STEA 1A3TA 4FXDA 2E2HH 4GOPC 4BXXG 2RHQB 2K7VA 1BQQT 1EOVA 3CC7A 4HIDA 4X65Q 4HJ5A 4JV5Q 1I4RA 1B1ZA 3HOZH 4LFAQ 5CV7A 1EIFA 2D0PA 2NVXB 5KYLA 4C3IB 3E6ZX 3CCLA 1KQSA 4B3SL 3MXPA 2M00A 1YHQA 2KJXA 2WB1G 2I5MX 1QNKA 5T1IA 1JQYD 4F7XA 4QB4A 3C1FA 1YJWA 5DM73 3RMHA 2E8GA 1HNZL 1VQ8A 4LFAL 3DEPA 2R61A 2E2JH 1TT2A 5K36G 1AFPA 1TWGB 3ULLA 3T13A 2B2TC 1WTRA 4O0AA 4DR6L 4NXMQ 1NUCA 4C1NK 2KEEA 1UUPA 5I9OA 1S72A 4IPHA 4EVOA 1AE3A 1TU2B 2UXCQ 3I4MB 3J80c 1T9HA 2L5TA 3D4DA 4XDXA 3G4SA 3UDFA 1FJGQ 1KLUD 4A3IB 1Y1WG 4DV0Q 2A19A 5GAHC 1CK1A 3KF6A 4XXEA 4FNFA 1Z9FA 1VQMA 1QJOA 1QB5D 4FF1A 4IPGA 1OXVA 3ER0A 3K0XA 1BBUA 1S5BD 1VMPA 3HOVB 1D5MC 2WFWA 2IY5B 4CDCC 4HAEA 1V1PB 1G6ZA 3FKIG 3OHXC 2MHVA 1GM5A 1E2WA 4BA1I 5IYCH 5D65A 1W3SA 1PH3A 1N8RC 2MQHA 2Y0SE 1PH4A 1YHBA 2NN6G 1CI3M 3HGBA 4JVZA 5IP7H 5I2XA 5CORA 1HA5A 3K5NA 3E0EA 1SRUA 3M3YB 3VYSA 4AQYL 3CRLC 1CKMA 1VS0A 1KAWA 2F0LA 1SJED 4O1NA 5J22A 5ELCA 1HR0Q 3QG1A 3Q24A 1R9TB 2JN4A 1YVCA 2DGYA 4ID6A 3L2PA 2J7ZA 3NENA 3SVMA 4A3KH 4UP7A 3CCVA 3BDCA 2CQAA 4KKTA 3GTLH 2QA4A 1EEID 2PQEA 4KKSA 2J4XA 1CHPD 3L9AX 2ENBA 4A3FG 1NE3A 4A3GB 5IT9E 2A6HD 4DR1L 4CBVA 1YJ9A 5HGTA 1E22A 1VQJA 4BY7H 1KTKA 3S17B 4RGMA 3UDIA 4JI0L 4JK1C 2HD3A 3AU7A 2KHJA 1JJCB 3OTOQ 5JVH3 4ZKCB 1PYBA 4CKBA 5C4XB 4LF5Q 5GQOA 5C4JH 4TKOB 4IQZA 1QUQB 3VYTA 4EQNA 2A68C 3AQQA 5ELEA 3BDLA 4LWCA 3CMEA 5A35A 1H9KA 3F2CA 4OGQC 3GQBA 3OMCA 3TP5A 4DR5Q 2A68D 4YHHL 1XPRA 4IJHA 2A5HA 1TWHB 2NUCA 4KI0A 3CCRA 1UE6A 4O2DA 3M85A 4KD3A 4Z9CB 2KVMA 3J80E 3CAMA 1TWCH 4A3LG 3MXNA 1L0XB 2AUJD 3K59A 1I4PA 1XWEA 3MZ5A 3CP0A 1B8AA 4JBMA 1CTMA 1SXTA 5EJWA 3MTSA 4DAPA 2ZJRA 2Q2HA 4ZK9B 1Q81C 1Q7YC 4KTAA 4R4TA 3A55A 1TS4A 1MI2A 1SNDA 2K4KA 3QO2A 5BN5A 4NKLA 4GKKQ 1IKMA 5FLMG 1C8CA 1QUQA 3J7YW 4X64Q 1E2VA 2UUCL 1Z6HA 5ELFA 2B39A 1NTGA 5TSSA 5FO8B 2BE5C 5JAVA 3J81j 1CHQD 1KD1C 3HKZB 2DY7A 2ICIA 1TWFB 4LUOA 5C0XH 2PMZE 3CQZH 4CDFC 2B2TA 5IOCA 5M9OA 1EFWA 2B2UC 2OF1A 1WVLA 5C4XG 4A76A 1TWCB 3HOVG 4S3SA 5IGCA 2RCFA 2F0PA 4DR7L 2G9DA 2BE5D 1XMQL 1B53A 1H9SA 4PQXA 5L37A 1K73C 1N32L 4A3FB 1WTWA 1XYIA 2B8FA 3AYHB 5LL6S 4DNTB 2NZ1D 1I50H 1JOQA 1HH2P 1D5ZC 1NAPA 1YNND 4HR7B 1Q12A 1SNQA 5ELOA 2HDLA 2JK8A 1U4MA 5G3LD 3DLLA 4Q5VA 2EYMA 3K8AA 1EY4A 3NELA 2N88A 2NN6H 3FMCA 4JG2A 1MD2D 4QUCA 2L9HA 3TP8A 4OELB 1MJEA 4WJ3M 3S17H 2NVYB 4BY7B 2RKSA 3QB3A 3T4AC 3PMFA 1PTOD 1CQVA 1X32A 2F4VL 5KNDA 4ZRZA 2K04A 4QJFA 2ZXPA 1O7IA 3KDFB 1KRSA 4HCEA 1SR3A 2NB0A 4GKJQ 4P73A 3OW7A 3M4OH 1EYGA 1VQ7A 1B2TA 4DNIA 2EJMA 1KHIA 2I0QA 1KDBA 2IW3A 1XTCD 3KLWA 4J1MA 1AEXA 1R9TH 1EU4A 2MJ8A 1I3QB 3FKIB 1HQRD 4HJ7A 1M4VA 3NSWA 3G48A 1U4RA 3DEOA 5J1ZA 4BBRG 3G6JB 4A4IA 5CMDA 3EBEA 3J81i 3Q8DA 3CD6A 3NTKA 2F0VA 2IJ0A 1EZ8A 3BVZA 2J0TD 4HJ9A 3H3VH 2MNAA 3A7LA 2PPBC 2IHEA 4YCVA 3E3XA 4NDXA 3E5SA 4C3HB 4A3CG 2JA5H 1WTQA 1PZID 4JI1Q 3I90A 3HOYG 2LXJA 4JI0Q 4DV2Q 5FJ8H 3X3NA 1AW7A 3QOJA 5CBAE 4BBSG 4MN3A 1RHPA 4L5QA 4NW2A 3H15A 1XMOQ 5IYCG 1PH8A 1KABA 2KEDA 5FO9B 4CJ2C 4IN3A 1O78A 2LFNA 4APVA 1UE7A 3UE1A 5CGKA 4A3MB 2WB1E 3O13A 2K05A 1V1OA 3HOZG 2OTLA 4Y7NH 5C3EH 2L11A 4A3MH 3T56B 2MP1A 1W6JA 1LTBD 4GNXC 1XMQQ 1FL0A 1N34L 5EBDA 1VF5C 4GN3B 5HY6A 4MZ9A 3L7ZC 3FDTA 4X3UA 1L2FA 4X62L 2XN9C 1Y1VB 1G6PA 3GTGH 3NTHA 1L1OB 1NY4A 3U4VA 5KEEA 2K5NA 1QNUA 3H94A 3SK8A 4DV1L 4IZ8A 3S1NH 1W2BA 4KMUC 5JEAJ 1UAPA 2IHFA 3K80C 4DV3L 2K33A 2OQKA 1SE2A 3ND9A 1XNQL 1SNPA 2AQ3B 5JVG3 2Y0SB 2EDGA 3SK4A 3MXNB 5KGUA 4P74A 1PMRA 2B2UA 4R4OA 2NTTA 1E2ZA 5EPJA 4KV6A 1N33L 2PW7A 4DA2A 2IL8A 1OXUA 1EY9A 4K5WA 1KIXA 2B63G 5I6YA 2QGQA 4N8X1 2EXDA 2LXKA 2N3SA 2QF7A 1WYDA 3I3CA 3NQTA 5FOBB 2AHOB 3OOCA 4N9PA 2R92H 2NN6I 2D9UA 1SN8A 2K28A 4K6LA 3M4QA 1XJVA 4HN7A 4YWMA 3J80i 1SNMA 4AIMA 4HIKA 4ME3A 1LTGD 3C2PA 1Q90A 5C44B 3K7AH 4A3KB 5C5LA 3FEWX 1EQRA 1X54A 3MWYW 5KRUA 3J7ZC 1TY0A 5LMNW 2V1CC 3H91A 2IT1A 4I7AA 1JICA 1QE6A 2JE6I 2Q8RE 3NBHA 2PCFB 1EY5A 4LUVA 4YWLA 4MHEA 2CVRA 1JMCA 2UUAQ 1WCMH 3N6RA 2AWNA 1KRTA 3GTPH 4EQOA 2JQOA 1R4QB 2A1AA 4PNYA 4ZUJA 4GLAC 3BS1A 2XRQD 1MBYA 1PLFA 2KCCA 5E7NA 1SMYC 1UE5A 4XQNA 2RBMA 4GS3A 3CC4A 1SYDA 2K6AA 2B2YA 5C3XA 4IUQA 4HCSA 4XT3B 3GTJB 1EEFD 2ID0A 3A5UA 2LMCB 1IYVA 1FYCA 3FHWA 3SGIA 5ELBA 2FMCA 4RG1A 4KHZA 1PDQA 4G4KA 4LMQD 4DV6L 1K9MC 3I4NH 2VY3A 1LTLA 4OWWB 3HOWB 2IPKD 5LMUQ 3MXUA 4A3MG 1WTVA 2F0FA 2PNRC 1QVGA 1I4HA 4BY1B 4IOAA 3UDGA 2EE1A 3Q6SA 1PXUA 2N8NA 1PA6A 1Q86C 2OEOA 4K0KQ 2RF4A 3W2DA 3GTMB 1V9PA 3A8IE 3TP7A 3VR2A 2RSNA 3HKZE 4DV6Q 5IGEA 3RLFA 4JI2Q 2EVBA 1O7LA 4DFAA 2CWAA 1QZHA 4IFDJ 1U4PA 4OX9L 4JI4Q 2JEBI 4DAYA 1EWCA 5C4JB 1F9SA 3U9SA 4N9TA 3GDEA 1ZYRD 4DV5Q 2AQ1B 5NUCA 4PMBA 3VYUA 5J39A 4NP5A 3VA5A 3CKIB 1X65A 4U673 2CQOA 4R4CA 4DV4L 4L5SA 3RN2A 2L4NA 1ESFA 4LUZA 4GLXA 2ZTEA 4JI7L 2NYZD 3GTPB 4LF6Q 1M8AA 1JJ2A 2R92B 3ND8A 3KBXA 2BCOA 3H0GG 3H6MA 1HUNA 2HIXA 3BVMA 3EQLC 2C9OA 1YEZA 2F0GA 4B3SQ 3OYYA 5EBCA 3CCEA 1LM0A 4ZUIA 1GVPA 2F0DA 4ZKBB 1LABA 1E1TA 4JI1L 1BDOA 2PQAB 2QW7A 4G7OC 5IYDH 4KY6A 2JA8B 2WAQB 4R4IA 2K5VA 4U68A 1CQFA 1L1OC 1BCPD 3S1RB 1UE1A 1RD9D 5AJ3Q 5JJLA 1TS2A 2HQLA 3OPOA 4KK7A 1VF7A 3A5ZB 4POGA 3R2TA 1TQOA 1K8OA 1PH7A 3M3YH 4X3KA 1G291 3C3LA 1DOKA 4A3DB 1DZ1A 5FLMH 2KCTA 2YU9H 4FDBA 3GTKH 4A3LH 4NXML 3K81C 1OO9B 3SE0A 3D3RA 1EOTA 4DGZA 1ASYA 4FF3A 1YNJD 4CHTB 1TKWB 3A74A 4DXFA 2NTSA 4IUTA 2N49A 1Y1WH 4FO2A 3PIP3 3IFDA 4ZLTF 1UNSA 1F77A 3S1QH 1STBA 2RSOA 1D1IA 3HOVH 4R1JA 1Q8KA 4DAYB 3Q22A 3T1YL 2UU9L 1IKLA 1UEAB 4BXXH 3S1NB 2RDHA 3J7A5 3NTIA 1FGUA 2JXMB 4JI5L 2SNSA 4DR2Q 1M1KC 1Y1VH 3CHBD 2NVTH 3WDNA 2ZM6L 4BBSH 1A63A 1I94Q 2M9VA 4M8AA 4A93H 1GUGA 1JWSD 5IP9G 1V1QA 1SNCA 2B2WA 4NXNQ 2JYOA 2JJQA 3DWPA 4A93B 3AEVA 4QL5A 1N33Q 3S9WA 1YI2A 4AQYQ 4C3HH 2NVTB 1HNZQ 1AE2A 3PCOB 3M9BA 3SDZA 5IYBH 1EQVA 4X3SA 4IUNA 3JC66 3QR8A 4B3ML 1Q46A 1KXLA 3I91A 5FKAC 4IJLA 3OW2A 1QWYA 4PZ8A 1N36L 1SMXA 2QEXA 4GZYC 2FFKB 1J8IA 3VYRA 4DPGA 1VQCA 4IOCA 3URYA 5M3MB 3PQIA 4H13C 3A8JE 3RD4A 4JOIA 1B70B 4UP9A 2EY5A 5FLXE 5I4DA 3VDYA 2F0EA 2F0WA 4K8JA 2KA7A 1MSGA 4DUYL 2D2CC 4IPCA 4UY8C 1K28A 5G3LF 2Q2UA 2YU9B 3GTKB 4N8FA 5J3BA 4DR3L 1SSOA 2JP1A 1VQLA 4LNQA 3I4OA 2E2HB 2RA4A 3HOXB 2IWHA 4X62Q 1HUMA 1E0BA 1TS3A 5IT9L 3CCMA 2OT2A 1C4QA 2Z4HA 3L0OA 2KCMA 3EROA 4XT1B 1BCPB 3ONAB 3RN5A 5EKKA 2B2VC 5GADC 1PH2A 1MJCA 1P16A 4CGYB 1XMOL 4NPSA 2E2DC 1K3RA 3J81L 1FNVA 3VR3A 4YHHQ 3E0JA 1I4GA 4HJAA 2VB2X 2RHSB 4PMWA 3OMGA 1BCPC 1O7YA 1ONLA 2TMPA 4IURA 4MTNA 1K3BC 2Z0SA 1I5FA 3KF8A 1E24A 5IODA 5M5WB 3ITPA 1CSPA 5LL6X 1PV4A 2FHTA 5CC4A 1B9MA 4LFCL 1YNJC 4DAVA 2WB1B 4GOPB 3JAMc 5JOBA 4RKBA 2EPBA 2JA6H 1XXGA 4HIMA 4WJWA 2O5IC 4J8QA 2XTIA 1ILQA 3H0GB 5D14A 1Y8PB 1XNRL 1BOSA 2PI2E 3W1GA 4RAUC 4JV5L 3ICEA 3OWFA 1XPUA 2CCZA 2CW0D 4F87A 2FJ2A 4ODGA 2KHIA 1RCVD 2UXBQ 2Z1CA 1WCMG 3PUXA 2QKIC 2OXPA 3LNNA 3N52A 1IBMQ 2EY2A 4DK1A 3GTJH 1TY2A 4LF9Q 1YJNA 1DD2A 1JOOA 1S5CD 3PF5A 2GVBA 4TRDA 1ET9A 3PGZA 1ENCA 3D0FA 4RGNA 2PI2A 4M1UB 1B50A 1VQ4A 1F9RA 4POFA 4LF8Q 2Q8TA 2EYJA 3NWSA 1KNEA 2KQ3A 4B3RL 1LACA 3JAME 4IUVA 3KLRA 2EY1A 3DM1A 1X9NA 2UUCQ 2K5HA 4JBJA 1LTSD 4G57A 4DUZL 1G91A 5LHY1 3QWNA 5ELDA 3GP7A 1STNA 4JI7Q 3S2HB 1RJTA 2F0JA 2NWGA 2DN8A 4E6IA 1DONA 3RZDH 5C4XH 1F2LA 3J81E 1NBWA 5LMUL 4X66Q 4X6AH 4DK6C 2CWPA 2HCCA 1LT3D 3HOYH 2R7ZG 3RZOB 1Y8NB 3TREA 1TWHH 2QCPX 2F3WA 3IL8A 2Z6KC 2R93H 1PRTB 4XQJA 1LTRD 3R3OA 3EVQA 1FNUA 4DR5L 2XSCA 3SR1A 2B8GA 2K03A 2A73B 2F1MA 4ALPA 3CXCA 4H0LC 4K2LA 4IFDG 1D6EC 4DN4M 3STBC 4IFDH 3TBIB 2XIWA 2LSSA 1ZEQX 4XYOA 5FLXL 3NBHB 3P75A 4A3EG 4QY7A 3U50C 1O7ZA 4RCOA 4IO9A 1I6HH 5JJIA 2K52A 4H02A 2KHSA 3HOUG 2IX3A 4B08A 4FF4A 1DGSA 1JR0D 2UU9Q 4X3TA 4GOPA 1VQHA 4A3BG 1L1OA 3RZOH 4XYQA 1HTLD 4EQ5A 1NMGA 1VQFA 2WAQE 2G9HD 3K5OA 1E1OA 5CYUA 2F3VA 4ILWA 4Q0FA 1U4LA 2K5WA 5C4ZA 1HJPA 4MTKA 1RODA 1SBBB 3TEHB 1LTTD 2WP8J 4CKEA 1MKHA 5F2DA 1VQ9A 2B2VA 4TVAB 4DR6Q 4NXNL 3Q23A 4CJ0B 2N55A 1SEBD 4R9WA 3T1HL 1KDAA 2YV5A 1MIUA 1EZ6A 1HNWL 1EQQA 2KOLA 3PO3G 4BBSB 4GKJL 4DR2L 2F03A 1GUWA 1CSQA 5DM63 3CPWA 1G2TA 1G8ZD 4BA2I 4RMFA 4JBWA 2HT1A 2O2LD 4KD4A 1V1PA 4C3HG 1NNXA 2Z9HA 3S1QB 3G71A 2PQAA 3KOJA 2EXZA 2V4DA 4HMIA 1BUVT 3U9OA 4OEMB 2KUMA 1HR0L 3VR5A 1KDCA 2A69C 1HXYD 2JA9A 2VS1A 3RLOA 4BBRB 1Y1VG 4QUFA 5I6WA 4K14A 5A2QE 4LF6L 5C3EB 4Y52H 3P20A 2AKWB 2R7ZB 3PO2H 2A6EC 3S16B 5EGTA 4BS9A 1VQBA 1SDFA 4C3JH 1A2UA 1B3AA 1OXXK 1VQDA 4OO1I 1A15A 1JE4A 3HOZB 3EA6A 1E7ZA 1ICFB 3FKIH 3BZCA 2EYPA 1QCBD 2X6GA 1I94L 2EY6A 1PYWD 2LY7A 1TXYA 1IHZA 5D3DA 1YIJA 1EFID 2YTXA 4EQPA 3UDXA 2AWOA 2MFIA 3NEMA 1SLJA 3UE0A 2CHBD 4DAMA 3I8ZA 3I73A 5BR8L 4UDUC 3GTOH 4MIUA 4C3JG 2MUYA 1K0RA 5GAEC 5DAUA 3CPFA 3HRZC 5IGFA 3CCSA 1Y69U 5JEAG 5JPMC 3S1RH 3I4LA 3RR5A 4FYDA 4HSVA 1HNWQ 1D5XC 3HOXG 2MPMA 3ERSX 1G51A 4G7HC 3F2UA 1T5XD 2Q2IA 4XQQA 1IBML 1H9JA 3G6EA 1STHA 4UPAA 1KNAA 2YTVA 3VA7A 2L1BA 2UXBL 4A3FH 1H9RA 1FVIA 1ENFA 1GXDC 3V2TA 3K5LA 3MHBA 3KK7A 3KYHC 5IE8A 5M5XH 2ZXRA 1PH5A 4C2MH 2RQXA 2CH4A 4K0KL 2ALYB 3PF4A 3CQZB 1C0AA 1GD7A 2BH8A 1D2BA 1K8AC 4EX5A 4ME5A 4BY1H 1MHWC 2R7ZH 4DV7L 3BZKA 1I50B 2F0TA 1DOLA 4DV3Q 1HPCA 3S2HH 4X65L 3T53B 1EY6A 5EPKA 3BJUA 1DM0B 3HP3A 3S15H 4A93G 3EN2A 1YZ6A 3MA2B 3A7AB 1CFMA 1JT8A 4KN7C 2K32A 2H5XA 5M5YH 2F0NA 1HCZA 3RNUA 5FJ8G 4P75A 2JEAI 2O5JC 3DMUA 1EY7A 3GV6A 4A3BH 3SEBA 4UP8A 1Q8IA 3A8KE 1SYBA 1JWUD 2C5CA 3BYYB 2NZHA 1FNWA 3MAQA 2RVLA 4WFN3 4A75A 1F9QA 1AZPA 5C4HA 2ZT9C 2F0HA 3S15B 5HURA 2SNMA 1PVOA 3I4NB 3J7AF 1EWIA 3H09A 1STAA 4YY3L 2R3ZA 3BU2A 4LJZC 4DUYQ 3HKZG 4GLVB 3R8BA 2Q8IB 2KENA 1LTAD 2A6ED 2WKDA 5IWAL 3F2DA 3T16A 3Q0AA 2B29A 5IGDA 4V190 2F3IA 3GTQB 1U0LA 4LF8L 4K5VA 4A3DH 1SE8A 2CH4W 4C2MB 4IFDI 3WOFA 2HQEA 2K5DA 2EQSA 4B3RQ 4RA8A 2E5LL 4A3GH 5IT9c 1XPOA 1C7YA 2RDFA 2VZAA 1SFOH 4JI4L 2F0IA 5JJZA 1D1KA 4FXKC 1T5EA 1F2MA 4DXGA 2H1EA 1DOMA 1HQMC 3PUVA 4F88A 1PH1A 1VQPA 4RGTA 1HZBA 1A3VA 4PMCA 1A62A 3DHQA 3M7GA 1PFBA 5C44H 1V8QA 1LTID 2R92G 4JI5Q 1PYSB 1DCZA 2MO1A 4UAIA 4JYAL 1QG7A 4JI6L 1X55A 4JI3Q 2K1BA 1LUZA 1ASZA 1BF4A 2CW0C 3BYTB 1PHJA 2OQ0A 1JORA 3NE5B 1KC8C 4A3GG 2CFMA 1I4XA 2F0KA 4JC0A 4KKUA 2VL6A 3TZUA 5KNCA 5K36H 2F52A 1F9PA 4A3DG 4KJNA 4C3JB 3D6WA 1IBKQ 3HOUH 1V43A 2VQEL 1X3PA 4OONA 2FINB 5DEHA 2JA7H 1Y8OB 4A3JB 3TS2A 1N32Q 3PIOA 1IYUA 5I9PA 2VUMH 2L55A 2JA8G 1ENAA 1PFSA 1HTPA 2DJFC 3R2IA 2PZWA 2P5ZX 1STYA 4RFBA 3KJOA 3S14B 2HUGA 3NWTA 1CM9A 4X66L 3HOWH 1B3QA 2EYFA 1UEBA 3SK6A 4H7BA 1PFNA 1SYEA 3OSOA 2ZXOA 1IW7C 5EKLA 4QIWB 4K5XA 3TS0A 3TRZA 2SOBA 3T51B 4DF7A 2ZJQA 5CV9A 4OL7A 4Y7NB 3FVQA 2B2YC 4DU9A 2BA0A 5EAYA 3IFTA 1IXRA 5COYA 3KBGA 3ULJA 3I4MH 2PW5A 4DNRB 2DUDA 1HNXQ 3VR4A 4QMGA 1B4OA 1S40A 5GROA 3WWVA 5GAGC 2E2JB 3FPPA 1Y1WB 1LLRD 4IUUA 1X3FA 1EIGA 4TSSA 3TSSA 3I4MG 4KHVA 1ICWA 4DV0L 1G2SA 1OXSC 1TR5A 2JA5B 1SROA 4PV1C 4B3TL 1FJGL 3TDQA 1PH6A 3CF5A 4LFBQ 4QQBX 4R4QA 4WRDA 1S5ED 1II3A 5JJKA 1NSNS 2SEBD 3K5MA 4ZAIA 1M90C 1GO3E 1N9WA 4A3KG 4MNOA 2JA8H 1A0IA 2OWOA 1B9NA 3DWAA 2JA7G 1RIPA 3WOEA 1HR0W 1F2ZA 3HOWG 5C0XI 1NCVA 1YHAA 4R8IA 4RCNA 2B2WC 1Q82C 4C56C 3HOXH 4ULLA 3AFQA 2NVQB 3PV0A 4RKLA 3GTOB 2FMMA 2HIVA 4LFBL 4OO1H 4RHSA 2N78A 1GKHA 2OCEA 3TZDA 3HZXA 1A2TA 2MGSA 5IP7G 1SYCA 1K8GA 2YYZA 2BOSA 3EJIA 2EIFA 4WORA 4AYBE 2NBFA 1JB7A 2C35B 2NZOA 2GA4B 2O4XA 2WACA 3CU7A 1QVCA 2K50A 1B44D 2E74C 4R8NA 4RWSC 4DV4Q 4CKCA 2H4OA 1X56A 1K8MA 1AN8A 2RCNA 1ZKOA 2AMCB 1WTXA 1GOZA 1FD7D 1EY0A 3KUPA 4KN4C 1PZKD 3CW2C 1PTOF 4JOIC 1U9RA 1DYQA 3D8GA 3R93A 2GVAA 1WOCA 3S2DB 2WKCA 3NK9A 1EYCA 3KDFA 4DR1Q 2F0SA 2B3GA 2B63H 1STGA 3K58A 2I07B 4LF5L 2UXDQ 2XRSD 5C44G 4B9WA 3OTOL 1EU3A 2I5HA 3E9HA 3UI2A 3OWEB 4HSPA 3GTMH 1NR4A 5IWAQ 2JA7B 4TQUS 3K57A 3I72A 4KJOA 1PRTF 4NMZA 2B63B 1JOKA 1X3QA 2FXQA 1Q1BA 2E76C 4AYBB 4JI8Q 1BR9A 1GJXA 5KYIA 4XIGS 2VNUD 3HS0C 2F4VQ 1VDZA 1Q1EA 2UXCL 3QOLA 4DV5L 3HOUB 1YBYA 2JA5G 2R7FA 2EZVA 3K0YA 2Y0SG 4K8IA 3B6YA 2F0UA 5FLXc 2F0OA 1RTNA 2JA6B 2ZTCA 4P2CB 1EUJA 1VQ6A 4NB3A 2R93G 4DR4Q 5CV6A 5C5MA 5IGBA 2ZM6Q 3FP9A 3IKJA 2VW9A 4JI6Q 5BR8Q 3TN2A 2PYKA 1WCMB 2F0QA 3JAMi 5M5XB 1S5DD 2IX0A 1BNZA 3AFPA 3U58A 1QZGA 3M7NA 2UUAL 3SK5A 2PMZB 1WTPA 5M3FH 3RUZA 1PRTC
chains in the Genus database with same CATH topology
2ID0A 3A5UA 2D0PA 1VQBA 3FHWA 3SGIA 2I5LX 4C3JH 4RG1A 1IBLQ 3CCLA 1KQSA 4B3SL 1OXXK 4KHZA 4B3MQ 1YHQA 4DV6L 1VQDA 2ZTDA 4OO1I 2WB1G 1K9MC 3I4NH 1UWVA 2I5MX 2VY3A 1LTLA 4OWWB 1E7ZA 1WJJA 3FKIH 3BZCA 5LMUQ 4A3MG 5M3FG 4A3CH 1X3EA 1BBWA 1QVGA 1YJWA 1I94L 3UDGA 4BY7G 4IOAA 1HNZL 2E8GA 1TXYA 1VQ8A 4LFAL 1BVSA 2N8NA 1PA6A 1YIJA 1Q86C 4K0KQ 1JE5A 2YTXA 3UDXA 2RF4A 2E2JH 2AWOA 2MFIA 3NEMA 2VQEQ 1V9PA 3T1HQ 1SLJA 3UE0A 5K36G 4DAMA 3ULLA 3S1MH 4O0AA 1CKNB 4DR6L 4NXMQ 3HKZE 5BR8L 3T1YQ 4IPHA 4DV6Q 1S72A 3GTOH 3M4PA 5M3MH 1AE3A 3RLFA 4JI2Q 1VQNA 2UXCQ 1K0RA 3J80c 5GAEC 1T9HA 5LMNQ 3STBD 3CPFA 2CWAA 3G4SA 1QZHA 3UDFA 1IBLL 1FJGQ 1LYLA 4IFDJ 3CCSA 3PUYA 1Y1WG 3F8TA 5JEAG 1XTDA 4OX9L 4JI4Q 4DV0Q 2JEBI 2A19A 5GAHC 3S1RH 3KF6A 1U5KA 2VUMG 2ES2A 1Z9FA 3RR5A 1VQMA 4YY3Q 3GDEA 1HNWQ 3HOXG 4DV5Q 4JYAQ 4IPGA 3ERSX 1G51A 1OXVA 3ER0A 3CMAA 3K0XA 1BBUA 2Q2IA 1IBML 1X65A 2CQOA 2WFWA 4R4CA 5H1SE 4DV4L 2IY5B 3G6EA 4L5SA 2IX1A 3RN2A 4UPAA 5LMNL 2YTVA 4LUZA 2UXBL 3FKIG 4A3FH 4GLXA 1FVIA 2ZTEA 4JI7L 1GM5A 4LF6Q 1JJ2A 4BA1I 3KYHC 5IYCH 5IE8A 4J15A 5M5XH 3KF8B 3H0GG 1W3SA 2BA1A 5AJ3L 1N8RC 1PH3A 1VQIA 1PH5A 2HIXA 2MQHA 4P72A 1L0WA 4C2MH 2Y0SE 1D8LA 1PH4A 1YHBA 4K0KL 2ALYB 1VCIA 2NN6G 1AH9A 1YEZA 4B3SQ 5IP7H 3OYYA 3PF4A 3CCEA 1LM0A 3S2DH 1GVPA 1C0AA 3E0EA 3S14H 1GD7A 3I56A 1E1TA 2BH8A 1SRUA 4JI1L 2PQAB 4XTCS 1K8AC 4EX5A 4AQYL 4BY1H 5IYDH 3I55A 2R7ZH 1CKMA 1VS0A 2K5VA 4R4IA 3BZKA 4DV7L 1XNQQ 1L1OC 3ULPA 4HJ8A 1KAWA 1X3GA 4DV3Q 4A3JG 1UE1A 3J81c 2Q2TA 3S2HH 4X65L 1HR0Q 4PZ6A 5AJ3Q 5JJLA 1VQEA 2HQLA 3A5ZB 1YVCA 2DGYA 3BJUA 3L2PA 4POGA 3NENA 4DKAC 3S24A 3EN2A 4LW1A 3RLNA 4A3KH 1PH7A 3M3YH 1YZ6A 3MEFA 4A93G 1G291 4UP7A 3CCVA 5FLMH 1JT8A 2KCTA 2YU9H 4FDBA 3GTKH 2QA4A 3GTLH 4NXML 4A3LH 1TWGH 2H5XA 5M5YH 3RNUA 2JEAI 3K81C 4P75A 5FJ8G 4A3FG 1NE3A 4A3BH 4UP8A 4DR1L 1ASYA 1YJ9A 3CCQA 2K14A 1E22A 1VQJA 4BY7H 2NZHA 3A74A 4OWXB 2ASBA 3UDIA 4A75A 5IYDG 4JI0L 4LF9L 2ATWA 2UUBL 2N49A 1Y1WH 2KHJA 1JJCB 1H95A 3OTOQ 1PYBA 1S3OA 3S1QH 1OTCA 4LF5Q 5GQOA 5C4JH 1PVOA 3K7UC 1QUQB 1EWIA 1P8LA 3HOVH 4DR7Q 4R1JA 1Q8KA 4DAYB 4YY3L 3T1YL 2UU9L 3BU2A 3AQQA 1I3QH 1N34Q 4BXXH 4DUYQ 4LWCA 2D62A 3HKZG 4GLVB 5M3MG 3CMEA 4LF7L 5IYBG 2KENA 3J7A5 3F2CA 1FGUA 4OX9Q 4JI5L 5IWAL 4JI8L 3F2DA 1HNXL 4PZ7A 4DR2Q 1M1KC 1Y1VH 2B29A 4JI2L 4DR5Q 2NVTH 4YHHL 1XPRA 4IJHA 2F3IA 1U0LA 2ZM6L 4LF8L 4BBSH 4KI0A 1I94Q 1A63A 3CCRA 1UE6A 4O2DA 4A93H 3M85A 4A3DH 1SE8A 3HKSA 5IP9G 2HHHL 1V1QA 3I7FA 4GNXA 4NXNQ 2UXDL 1KL9A 4IFDI 2JJQA 2NVYH 4WJ4A 3ZJYC 3CAMA 1TWCH 3AEVA 3LGJA 4A3LG 3F1ZA 4QL5A 1N33Q 2EQSA 4DV2L 1NJIC 4B3RQ 1YI2A 4AQYQ 2E5LL 4C3HH 5IT9c 4A3GH 3CP0A 1HNZQ 1AE2A 1B8AA 1XPOA 4JBMA 1C7YA 3PCOB 2VZAA 1SFOH 4JI4L 3M9BA 1Q81C 2ZJRA 2Q2HA 2Z6KA 3A0JA 1Q7YC 4R4TA 5IYBH 1VQOA 2K4KA 3JC66 4GKKQ 2XGTA 4B3ML 5FLMG 1QUQA 1Q46A 3PUVA 4X64Q 1J5EL 1KXLA 4YCUA 1CUKA 1VQPA 1PH1A 1HZBA 4IJLA 3OW2A 2HHHQ 2UUCL 4PZ8A 1Y14B 1N36L 1SMXA 2QEXA 1A62A 1K83H 1NTGA 5C44H 1QVFA 4DPGA 4PG3A 1VQCA 4IOCA 3HFZB 3J81j 1KD1C 3S16H 4LUOA 4JOIA 4QIWE 1B70B 4HIOA 2PMZE 4UP9A 1OXTA 4JI5Q 1PYSB 2R92G 3CQZH 3VDYA 2MO1A 4LF4L 4JYAL 1EFWA 3I4NG 1IYJB 4BBRH 4DUYL 4IPCA 4UY8C 2K75A 2D0OA 5C4XG 4A76A 2Q2UA 4JI6L 1X55A 3HOVG 5J3BA 3DM3A 4JI3Q 3KJPA 4DR3L 1LUZA 1VQLA 4DR7L 1ASZA 4LNQA 1X6OA 3I4OA 1XMQL 1PHJA 2OQ0A 4X62Q 3PIPA 1K73C 1N32L 1KC8C 2UUBQ 4A3GG 2CFMA 4LFCQ 3CCMA 4JC0A 2VL6A 3AYHB 2F52A 1I50H 1HH2P 2KCMA 3L0OA 1TWFH 4A3IG 3RN5A 3D31A 2MO0A 1PH2A 5GADC 1N36Q 4A3DG 1MJCA 1P16A 1Q12A 5ELOA 1XMOL 1NMFA 4NPSA 1IBKQ 3HOUH 1V43A 2JK8A 4DK3C 2VQEL 3DLLA 1K3RA 4OONA 3K8AA 2ZJPA 1YNXA 4GN4B 4YHHQ 3NELA 4QGUA 2JA7H 4HJAA 2RHSB 3TS2A 3KF6B 1HZCA 4JG2A 2R7DA 1N32Q 4PMWA 3PIOA 1CKNA 2WAQG 2VUMH 2JA8G 4KHPL 1MJEA 1PFSA 4MTNA 2Z0SA 4WJ3M 1I5FA 3S17H 3H0GH 1E24A 1CSPA 1PV4A 4BY1G 3KJOA 3W5OA 4X66L 4LFCL 4OXPA 2F4VL 3HOWH 3W1BA 4QJFA 1UEBA 4A3JH 1O7IA 3KDFB 1VQ5A 1KRSA 3U4ZA 4GOPB 1SR3A 3JAMc 4GKJQ 2JA6H 3IRBA 4P73A 4GNXB 3M4OH 1EYGA 4C3IH 4HIMA 1VQ7A 1VQGA 4DNIA 3TS0A 1KHIA 2XTIA 3TRZA 2I0QA 1XNRL 1YITA 5DLQE 1C9OA 3KLWA 2PI2E 1R9TH 3W1GA 2ZJQA 2BH2A 4JV5L 3ICEA 1BKBA 3E9IA 1XPUA 4KHPQ 4HJ7A 1J5EQ 1B7YB 1Z47A 2BA0A 2KBNA 3G48A 5EAYA 2CCZA 4BBRG 3PO2G 1IXRA 3ULJA 3EIVA 4AH6A 2KHIA 4A4IA 3I4MH 2UXBQ 2R6GA 3EBEA 1WCMG 3J81i 3PUXA 3Q8DA 3CD6A 2DUDA 5C0XG 4DUZQ 1HNXQ 3H3VH 4HJ9A 1IBMQ 2MNAA 1A8VA 5C0XJ 3GTJH 1E3PA 2OTJA 1S40A 4LF9Q 2IHEA 4DV1Q 1YJNA 5GROA 4YCVA 3WWVA 5GAGC 3PF5A 2PNHA 4DV7Q 2GVBA 4GN5A 1X3FA 4A3CG 1D7QA 2JA5H 3PGZA 3I4MG 3D0FA 2PI2A 4DV0L 1OXSC 4JI1Q 1VQ4A 1SROA 3HOYG 4LF8Q 4POFA 1VQAA 4P71A 4B3TL 1FJGL 2LXJA 4JI0Q 4YWKA 1PH6A 4JBKA 4DV2Q 4B3RL 3CF5A 4LFBQ 1WFQA 4R4QA 4QQBX 5FJ8H 1JJGA 1X9NA 4BBSG 5JJKA 4YCWA 2UUCQ 4LF4Q 2K5HA 4L5QA 3H15A 1XMOQ 1GO3E 1N9WA 5IYCG 4A3KG 4JBJA 1PH8A 4MNOA 3CCUA 4LF7Q 2JA8H 1A0IA 4DUZL 1HZ9A 1CKOA 1J6QA 2OWOA 4APVA 1UE7A 3UE1A 1M90C 4JI7Q 2WB1E 2JA7G 1RIPA 1HR0W 3HOWG 1VQKA 3HOZG 2OTLA 4Y7NH 5C3EH 5C0XI 1YHAA 4A3MH 3RZDH 5C4XH 4GNXC 1XMQQ 1Q82C 3CC2A 1NBWA 5LMUL 4X64L 1FL0A 3HOXH 3AFQA 4X66Q 1N34L 3PV0A 4DK6C 4X6AH 2CWPA 4JI3L 2HIVA 3HOYH 4LFBL 2N78A 2A8VA 1GKHA 2OCEA 2R7ZG 3PO3H 4GN3B 3TREA 5HY6A 5IY0A 4JCVE 1TWHH 3L7ZC 4MZ9A 3GTQH 4X62L 1L2FA 5IP7G 2GN5A 2Z6KC 5C3EG 2YYZA 3GD7A 1K8GA 3PSIA 2R93H 2EIFA 1G6PA 4AYBE 3GTGH 4L5TA 2C35B 2NZOA 1JB7A 1L1OB 1NY4A 4DR5L 3U4VA 1QVCA 2K50A 2K5NA 4DV4Q 4DV1L 1X56A 3S1NH 1W2BA 4ALPA 5JEAJ 3CXCA 2IHFA 4IFDG 3STBC 3K80C 4DV3L 2LSSA 2OQKA 2RCNA 1XNQL 2AMCB 3NBHB 2JA6G 4A3EG 4A3EH 4QY7A 3U50C 4A3IH 4L5RC 3CW2C 4B3TQ 1HZAA 1I6HH 4IO9A 4JOIC 4OO1G 5JJIA 2K52A 3H3VI 4DR4L 3MXNB 4H02A 1IBKL 2E2IH 4P74A 2GVAA 3HOUG 2L15A 1WOCA 1DGSA 4DR3Q 4R4OA 1XNRQ 2UU9Q 1N33L 4AYBG 1VQHA 1IZ6A 4GOPA 1L1OA 1OXUA 3KDFA 4OWTB 4DR1Q 4A3BG 2B3GA 2B63H 1KIXA 4LF5L 2B63G 3RZOH 4EQ5A 2UXDQ 1NMGA 2QGQA 5C44G 1VQFA 3OTOL 2WAQE 2EXDA 2N3SA 1E1OA 2LXKA 1WYDA 2I5HA 3GO5A 2VQFQ 2AHOB 3E9HA 4KLKA 2E5LQ 3TQYA 3CCJA 2R92H 5HGQA 1HJPA 2NN6I 1SN8A 3TEHB 2WP8J 3GTMH 1VQ9A 1MKHA 3M4QA 4TVAB 4YWMA 5IWAQ 3J80i 1XJVA 4AIMA 4DR6Q 1TWAH 4NXNL 3S15H 4TQUS 4HIKA 5M5WH 4ME3A 3I2ZA 3T1HL 2YV5A 1MIUA 4GKKL 1HNWL 2NVXH 3K7AH 1EQQA 2NVQH 2CKZB 3PO3G 1WI5A 4GKJL 1EQRA 1X54A 2FXQA 3J7ZC 4DR2L 3PUZA 5LMNW 1Q1BA 3PUWA 2VQFL 2V1CC 4JI8Q 4IPDA 1EIYB 2IT1A 1CSQA 4XIGS 2JE6I 3CPWA 2VNUD 2F4VQ 1Q1EA 3F2BA 2UXCL 5IP9H 4DV5L 1YBYA 2JA5G 4LUVA 4YWLA 2R7FA 4BA2I 1JMCA 2Y0SG 2UUAQ 1RL2A 1WCMH 3B6YA 4RMFA 4JBWA 2AWNA 2HT1A 5FLXc 1KRTA 3GTPH 2ZTCA 1VQ6A 1EUJA 2JQOA 4NB3A 2R93G 2A1AA 1IL2A 3KFUA 4DR4Q 5ELNA 4GLAC 2ZM6Q 2YTYA 3FP9A 1PH9A 2VW9A 3G71A 2PQAA 5E7NA 3KOJA 2E2HH 4GOPC 1UE5A 4JI6Q 5BR8Q 4BXXG 2RHQB 4GS3A 1EOVA 3CC4A 3CC7A 3JAMi 4HIDA 4X65Q 2IX0A 4HJ5A 1HR0L 4JV5Q 2JA9A 3AFPA 3RLOA 2VS1A 3U58A 1Y1VG 1QZGA 2UUAL 3M7NA 4LF6L 3HOZH 4Y52H 4LFAQ 2AKWB 5M3FH 1EIFA 3PO2H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ID0 A;  3A5U A;  2D0P A;  1VQB A;  3FHW A;  3SGI A;  2I5L X;  4C3J H;  4RG1 A;  1IBL Q;  3CCL A;  1KQS A;  4B3S L;  1OXX K;  4KHZ A;  4B3M Q;  1YHQ A;  4DV6 L;  1VQD A;  2ZTD A;  4OO1 I;  2WB1 G;  1K9M C;  3I4N H;  1UWV A;  2I5M X;  2VY3 A;  1LTL A;  4OWW B;  1E7Z A;  1WJJ A;  3FKI H;  3BZC A;  5LMU Q;  4A3M G;  5M3F G;  4A3C H;  1X3E A;  1BBW A;  1QVG A;  1YJW A;  1I94 L;  3UDG A;  4BY7 G;  4IOA A;  1HNZ L;  2E8G A;  1TXY A;  1VQ8 A;  4LFA L;  1BVS A;  2N8N A;  1PA6 A;  1YIJ A;  1Q86 C;  4K0K Q;  1JE5 A;  2YTX A;  3UDX A;  2RF4 A;  2E2J H;  2AWO A;  2MFI A;  3NEM A;  2VQE Q;  1V9P A;  3T1H Q;  1SLJ A;  3UE0 A;  5K36 G;  4DAM A;  3ULL A;  3S1M H;  4O0A A;  1CKN B;  4DR6 L;  4NXM Q;  3HKZ E;  5BR8 L;  3T1Y Q;  4IPH A;  4DV6 Q;  1S72 A;  3GTO H;  3M4P A;  5M3M H;  1AE3 A;  3RLF A;  4JI2 Q;  1VQN A;  2UXC Q;  1K0R A;  3J80 c;  5GAE C;  1T9H A;  5LMN Q;  3STB D;  3CPF A;  2CWA A;  3G4S A;  1QZH A;  3UDF A;  1IBL L;  1FJG Q;  1LYL A;  4IFD J;  3CCS A;  3PUY A;  1Y1W G;  3F8T A;  5JEA G;  1XTD A;  4OX9 L;  4JI4 Q;  4DV0 Q;  2JEB I;  2A19 A;  5GAH C;  3S1R H;  3KF6 A;  1U5K A;  2VUM G;  2ES2 A;  1Z9F A;  3RR5 A;  1VQM A;  4YY3 Q;  3GDE A;  1HNW Q;  3HOX G;  4DV5 Q;  4JYA Q;  4IPG A;  3ERS X;  1G51 A;  1OXV A;  3ER0 A;  3CMA A;  3K0X A;  1BBU A;  2Q2I A;  1IBM L;  1X65 A;  2CQO A;  2WFW A;  4R4C A;  5H1S E;  4DV4 L;  2IY5 B;  3G6E A;  4L5S A;  2IX1 A;  3RN2 A;  4UPA A;  5LMN L;  2YTV A;  4LUZ A;  2UXB L;  3FKI G;  4A3F H;  4GLX A;  1FVI A;  2ZTE A;  4JI7 L;  1GM5 A;  4LF6 Q;  1JJ2 A;  4BA1 I;  3KYH C;  5IYC H;  5IE8 A;  4J15 A;  5M5X H;  3KF8 B;  3H0G G;  1W3S A;  2BA1 A;  5AJ3 L;  1N8R C;  1PH3 A;  1VQI A;  1PH5 A;  2HIX A;  2MQH A;  4P72 A;  1L0W A;  4C2M H;  2Y0S E;  1D8L A;  1PH4 A;  1YHB A;  4K0K L;  2ALY B;  1VCI A;  2NN6 G;  1AH9 A;  1YEZ A;  4B3S Q;  5IP7 H;  3OYY A;  3PF4 A;  3CCE A;  1LM0 A;  3S2D H;  1GVP A;  1C0A A;  3E0E A;  3S14 H;  1GD7 A;  3I56 A;  1E1T A;  2BH8 A;  1SRU A;  4JI1 L;  2PQA B;  4XTC S;  1K8A C;  4EX5 A;  4AQY L;  4BY1 H;  5IYD H;  3I55 A;  2R7Z H;  1CKM A;  1VS0 A;  2K5V A;  4R4I A;  3BZK A;  4DV7 L;  1XNQ Q;  1L1O C;  3ULP A;  4HJ8 A;  1KAW A;  1X3G A;  4DV3 Q;  4A3J G;  1UE1 A;  3J81 c;  2Q2T A;  3S2H H;  4X65 L;  1HR0 Q;  4PZ6 A;  5AJ3 Q;  5JJL A;  1VQE A;  2HQL A;  3A5Z B;  1YVC A;  2DGY A;  3BJU A;  3L2P A;  4POG A;  3NEN A;  4DKA C;  3S24 A;  3EN2 A;  4LW1 A;  3RLN A;  4A3K H;  1PH7 A;  3M3Y H;  1YZ6 A;  3MEF A;  4A93 G;  1G29 1;  4UP7 A;  3CCV A;  5FLM H;  1JT8 A;  2KCT A;  2YU9 H;  4FDB A;  3GTK H;  2QA4 A;  3GTL H;  4NXM L;  4A3L H;  1TWG H;  2H5X A;  5M5Y H;  3RNU A;  2JEA I;  3K81 C;  4P75 A;  5FJ8 G;  4A3F G;  1NE3 A;  4A3B H;  4UP8 A;  4DR1 L;  1ASY A;  1YJ9 A;  3CCQ A;  2K14 A;  1E22 A;  1VQJ A;  4BY7 H;  2NZH A;  3A74 A;  4OWX B;  2ASB A;  3UDI A;  4A75 A;  5IYD G;  4JI0 L;  4LF9 L;  2ATW A;  2UUB L;  2N49 A;  1Y1W H;  2KHJ A;  1JJC B;  1H95 A;  3OTO Q;  1PYB A;  1S3O A;  3S1Q H;  1OTC A;  4LF5 Q;  5GQO A;  5C4J H;  1PVO A;  3K7U C;  1QUQ B;  1EWI A;  1P8L A;  3HOV H;  4DR7 Q;  4R1J A;  1Q8K A;  4DAY B;  4YY3 L;  3T1Y L;  2UU9 L;  3BU2 A;  3AQQ A;  1I3Q H;  1N34 Q;  4BXX H;  4DUY Q;  4LWC A;  2D62 A;  3HKZ G;  4GLV B;  5M3M G;  3CME A;  4LF7 L;  5IYB G;  2KEN A;  3J7A 5;  3F2C A;  1FGU A;  4OX9 Q;  4JI5 L;  5IWA L;  4JI8 L;  3F2D A;  1HNX L;  4PZ7 A;  4DR2 Q;  1M1K C;  1Y1V H;  2B29 A;  4JI2 L;  4DR5 Q;  2NVT H;  4YHH L;  1XPR A;  4IJH A;  2F3I A;  1U0L A;  2ZM6 L;  4LF8 L;  4BBS H;  4KI0 A;  1I94 Q;  1A63 A;  3CCR A;  1UE6 A;  4O2D A;  4A93 H;  3M85 A;  4A3D H;  1SE8 A;  3HKS A;  5IP9 G;  2HHH L;  1V1Q A;  3I7F A;  4GNX A;  4NXN Q;  2UXD L;  1KL9 A;  4IFD I;  2JJQ A;  2NVY H;  4WJ4 A;  3ZJY C;  3CAM A;  1TWC H;  3AEV A;  3LGJ A;  4A3L G;  3F1Z A;  4QL5 A;  1N33 Q;  2EQS A;  4DV2 L;  1NJI C;  4B3R Q;  1YI2 A;  4AQY Q;  2E5L L;  4C3H H;  5IT9 c;  4A3G H;  3CP0 A;  1HNZ Q;  1AE2 A;  1B8A A;  1XPO A;  4JBM A;  1C7Y A;  3PCO B;  2VZA A;  1SFO H;  4JI4 L;  3M9B A;  1Q81 C;  2ZJR A;  2Q2H A;  2Z6K A;  3A0J A;  1Q7Y C;  4R4T A;  5IYB H;  1VQO A;  2K4K A;  3JC6 6;  4GKK Q;  2XGT A;  4B3M L;  5FLM G;  1QUQ A;  1Q46 A;  3PUV A;  4X64 Q;  1J5E L;  1KXL A;  4YCU A;  1CUK A;  1VQP A;  1PH1 A;  1HZB A;  4IJL A;  3OW2 A;  2HHH Q;  2UUC L;  4PZ8 A;  1Y14 B;  1N36 L;  1SMX A;  2QEX A;  1A62 A;  1K83 H;  1NTG A;  5C44 H;  1QVF A;  4DPG A;  4PG3 A;  1VQC A;  4IOC A;  3HFZ B;  3J81 j;  1KD1 C;  3S16 H;  4LUO A;  4JOI A;  4QIW E;  1B70 B;  4HIO A;  2PMZ E;  4UP9 A;  1OXT A;  4JI5 Q;  1PYS B;  2R92 G;  3CQZ H;  3VDY A;  2MO1 A;  4LF4 L;  4JYA L;  1EFW A;  3I4N G;  1IYJ B;  4BBR H;  4DUY L;  4IPC A;  4UY8 C;  2K75 A;  2D0O A;  5C4X G;  4A76 A;  2Q2U A;  4JI6 L;  1X55 A;  3HOV G;  5J3B A;  3DM3 A;  4JI3 Q;  3KJP A;  4DR3 L;  1LUZ A;  1VQL A;  4DR7 L;  1ASZ A;  4LNQ A;  1X6O A;  3I4O A;  1XMQ L;  1PHJ A;  2OQ0 A;  4X62 Q;  3PIP A;  1K73 C;  1N32 L;  1KC8 C;  2UUB Q;  4A3G G;  2CFM A;  4LFC Q;  3CCM A;  4JC0 A;  2VL6 A;  3AYH B;  2F52 A;  1I50 H;  1HH2 P;  2KCM A;  3L0O A;  1TWF H;  4A3I G;  3RN5 A;  3D31 A;  2MO0 A;  1PH2 A;  5GAD C;  1N36 Q;  4A3D G;  1MJC A;  1P16 A;  1Q12 A;  5ELO A;  1XMO L;  1NMF A;  4NPS A;  1IBK Q;  3HOU H;  1V43 A;  2JK8 A;  4DK3 C;  2VQE L;  3DLL A;  1K3R A;  4OON A;  3K8A A;  2ZJP A;  1YNX A;  4GN4 B;  4YHH Q;  3NEL A;  4QGU A;  2JA7 H;  4HJA A;  2RHS B;  3TS2 A;  3KF6 B;  1HZC A;  4JG2 A;  2R7D A;  1N32 Q;  4PMW A;  3PIO A;  1CKN A;  2WAQ G;  2VUM H;  2JA8 G;  4KHP L;  1MJE A;  1PFS A;  4MTN A;  2Z0S A;  4WJ3 M;  1I5F A;  3S17 H;  3H0G H;  1E24 A;  1CSP A;  1PV4 A;  4BY1 G;  3KJO A;  3W5O A;  4X66 L;  4LFC L;  4OXP A;  2F4V L;  3HOW H;  3W1B A;  4QJF A;  1UEB A;  4A3J H;  1O7I A;  3KDF B;  1VQ5 A;  1KRS A;  3U4Z A;  4GOP B;  1SR3 A;  3JAM c;  4GKJ Q;  2JA6 H;  3IRB A;  4P73 A;  4GNX B;  3M4O H;  1EYG A;  4C3I H;  4HIM A;  1VQ7 A;  1VQG A;  4DNI A;  3TS0 A;  1KHI A;  2XTI A;  3TRZ A;  2I0Q A;  1XNR L;  1YIT A;  5DLQ E;  1C9O A;  3KLW A;  2PI2 E;  1R9T H;  3W1G A;  2ZJQ A;  2BH2 A;  4JV5 L;  3ICE A;  1BKB A;  3E9I A;  1XPU A;  4KHP Q;  4HJ7 A;  1J5E Q;  1B7Y B;  1Z47 A;  2BA0 A;  2KBN A;  3G48 A;  5EAY A;  2CCZ A;  4BBR G;  3PO2 G;  1IXR A;  3ULJ A;  3EIV A;  4AH6 A;  2KHI A;  4A4I A;  3I4M H;  2UXB Q;  2R6G A;  3EBE A;  1WCM G;  3J81 i;  3PUX A;  3Q8D A;  3CD6 A;  2DUD A;  5C0X G;  4DUZ Q;  1HNX Q;  3H3V H;  4HJ9 A;  1IBM Q;  2MNA A;  1A8V A;  5C0X J;  3GTJ H;  1E3P A;  2OTJ A;  1S40 A;  4LF9 Q;  2IHE A;  4DV1 Q;  1YJN A;  5GRO A;  4YCV A;  3WWV A;  5GAG C;  3PF5 A;  2PNH A;  4DV7 Q;  2GVB A;  4GN5 A;  1X3F A;  4A3C G;  1D7Q A;  2JA5 H;  3PGZ A;  3I4M G;  3D0F A;  2PI2 A;  4DV0 L;  1OXS C;  4JI1 Q;  1VQ4 A;  1SRO A;  3HOY G;  4LF8 Q;  4POF A;  1VQA A;  4P71 A;  4B3T L;  1FJG L;  2LXJ A;  4JI0 Q;  4YWK A;  1PH6 A;  4JBK A;  4DV2 Q;  4B3R L;  3CF5 A;  4LFB Q;  1WFQ A;  4R4Q A;  4QQB X;  5FJ8 H;  1JJG A;  1X9N A;  4BBS G;  5JJK A;  4YCW A;  2UUC Q;  4LF4 Q;  2K5H A;  4L5Q A;  3H15 A;  1XMO Q;  1GO3 E;  1N9W A;  5IYC G;  4A3K G;  4JBJ A;  1PH8 A;  4MNO A;  3CCU A;  4LF7 Q;  2JA8 H;  1A0I A;  4DUZ L;  1HZ9 A;  1CKO A;  1J6Q A;  2OWO A;  4APV A;  1UE7 A;  3UE1 A;  1M90 C;  4JI7 Q;  2WB1 E;  2JA7 G;  1RIP A;  1HR0 W;  3HOW G;  1VQK A;  3HOZ G;  2OTL A;  4Y7N H;  5C3E H;  5C0X I;  1YHA A;  4A3M H;  3RZD H;  5C4X H;  4GNX C;  1XMQ Q;  1Q82 C;  3CC2 A;  1NBW A;  5LMU L;  4X64 L;  1FL0 A;  3HOX H;  3AFQ A;  4X66 Q;  1N34 L;  3PV0 A;  4DK6 C;  4X6A H;  2CWP A;  4JI3 L;  2HIV A;  3HOY H;  4LFB L;  2N78 A;  2A8V A;  1GKH A;  2OCE A;  2R7Z G;  3PO3 H;  4GN3 B;  3TRE A;  5HY6 A;  5IY0 A;  4JCV E;  1TWH H;  3L7Z C;  4MZ9 A;  3GTQ H;  4X62 L;  1L2F A;  5IP7 G;  2GN5 A;  2Z6K C;  5C3E G;  2YYZ A;  3GD7 A;  1K8G A;  3PSI A;  2R93 H;  2EIF A;  1G6P A;  4AYB E;  3GTG H;  4L5T A;  2C35 B;  2NZO A;  1JB7 A;  1L1O B;  1NY4 A;  4DR5 L;  3U4V A;  1QVC A;  2K50 A;  2K5N A;  4DV4 Q;  4DV1 L;  1X56 A;  3S1N H;  1W2B A;  4ALP A;  5JEA J;  3CXC A;  2IHF A;  4IFD G;  3STB C;  3K80 C;  4DV3 L;  2LSS A;  2OQK A;  2RCN A;  1XNQ L;  2AMC B;  3NBH B;  2JA6 G;  4A3E G;  4A3E H;  4QY7 A;  3U50 C;  4A3I H;  4L5R C;  3CW2 C;  4B3T Q;  1HZA A;  1I6H H;  4IO9 A;  4JOI C;  4OO1 G;  5JJI A;  2K52 A;  3H3V I;  4DR4 L;  3MXN B;  4H02 A;  1IBK L;  2E2I H;  4P74 A;  2GVA A;  3HOU G;  2L15 A;  1WOC A;  1DGS A;  4DR3 Q;  4R4O A;  1XNR Q;  2UU9 Q;  1N33 L;  4AYB G;  1VQH A;  1IZ6 A;  4GOP A;  1L1O A;  1OXU A;  3KDF A;  4OWT B;  4DR1 Q;  4A3B G;  2B3G A;  2B63 H;  1KIX A;  4LF5 L;  2B63 G;  3RZO H;  4EQ5 A;  2UXD Q;  1NMG A;  2QGQ A;  5C44 G;  1VQF A;  3OTO L;  2WAQ E;  2EXD A;  2N3S A;  1E1O A;  2LXK A;  1WYD A;  2I5H A;  3GO5 A;  2VQF Q;  2AHO B;  3E9H A;  4KLK A;  2E5L Q;  3TQY A;  3CCJ A;  2R92 H;  5HGQ A;  1HJP A;  2NN6 I;  1SN8 A;  3TEH B;  2WP8 J;  3GTM H;  1VQ9 A;  1MKH A;  3M4Q A;  4TVA B;  4YWM A;  5IWA Q;  3J80 i;  1XJV A;  4AIM A;  4DR6 Q;  1TWA H;  4NXN L;  3S15 H;  4TQU S;  4HIK A;  5M5W H;  4ME3 A;  3I2Z A;  3T1H L;  2YV5 A;  1MIU A;  4GKK L;  1HNW L;  2NVX H;  3K7A H;  1EQQ A;  2NVQ H;  2CKZ B;  3PO3 G;  1WI5 A;  4GKJ L;  1EQR A;  1X54 A;  2FXQ A;  3J7Z C;  4DR2 L;  3PUZ A;  5LMN W;  1Q1B A;  3PUW A;  2VQF L;  2V1C C;  4JI8 Q;  4IPD A;  1EIY B;  2IT1 A;  1CSQ A;  4XIG S;  2JE6 I;  3CPW A;  2VNU D;  2F4V Q;  1Q1E A;  3F2B A;  2UXC L;  5IP9 H;  4DV5 L;  1YBY A;  2JA5 G;  4LUV A;  4YWL A;  2R7F A;  4BA2 I;  1JMC A;  2Y0S G;  2UUA Q;  1RL2 A;  1WCM H;  3B6Y A;  4RMF A;  4JBW A;  2AWN A;  2HT1 A;  5FLX c;  1KRT A;  3GTP H;  2ZTC A;  1VQ6 A;  1EUJ A;  2JQO A;  4NB3 A;  2R93 G;  2A1A A;  1IL2 A;  3KFU A;  4DR4 Q;  5ELN A;  4GLA C;  2ZM6 Q;  2YTY A;  3FP9 A;  1PH9 A;  2VW9 A;  3G71 A;  2PQA A;  5E7N A;  3KOJ A;  2E2H H;  4GOP C;  1UE5 A;  4JI6 Q;  5BR8 Q;  4BXX G;  2RHQ B;  4GS3 A;  1EOV A;  3CC4 A;  3CC7 A;  3JAM i;  4HID A;  4X65 Q;  2IX0 A;  4HJ5 A;  1HR0 L;  4JV5 Q;  2JA9 A;  3AFP A;  3RLO A;  2VS1 A;  3U58 A;  1Y1V G;  1QZG A;  2UUA L;  3M7N A;  4LF6 L;  3HOZ H;  4Y52 H;  4LFA Q;  2AKW B;  5M3F H;  1EIF A;  3PO2 H; 
#chains in the Genus database with same CATH topology
 2KCN A;  5KIX A;  5T1G A;  1KAA A;  1PTO C;  3HG9 A;  2I5L X;  3DWQ A;  3M4O B;  1IBL Q;  1SYG A;  4B3M Q;  2ZTD A;  1BBX C;  1UWV A;  5KNB A;  1LT6 D;  5JPN C;  1WJJ A;  3NXW A;  5M3F G;  4A3C H;  1X3E A;  1BBW A;  5CBE E;  5IIF A;  4BY7 G;  3A56 A;  3BDO A;  3M4Y A;  1BVS A;  1JE5 A;  2ICE C;  2EYO A;  3FRP B;  2PZT A;  2VQE Q;  3D4W A;  5AFW A;  3T1H Q;  1A3U A;  5EPL A;  3S1M H;  1CKN B;  4OIJ A;  3TP6 A;  3HOY B;  1WD1 A;  3T1Y Q;  3M4P A;  5M3M H;  1ESR A;  1VQN A;  1PTO H;  1IBL L;  1EYA A;  5LMN Q;  3STB D;  5K5P A;  3C46 A;  1LYL A;  3OIQ A;  3PUY A;  3F8T A;  5BN3 A;  1XTD A;  1ZXT A;  1S5F D;  1QIL A;  4ZYS A;  1U5K A;  4ZCK A;  2VUM G;  2ES2 A;  4YY3 Q;  3LWU A;  2XWB B;  4JYA Q;  1GUN A;  3CMA A;  2D5D A;  3X3M A;  1CA5 A;  1JC7 A;  3PO2 B;  4O42 A;  1GHK A;  5H1S E;  5JEA H;  3D6C A;  2IX1 A;  2VXW A;  5LMN L;  1LT5 D;  5CV8 A;  2A74 C;  4RH6 A;  4J15 A;  3KF8 B;  3ERQ A;  2BA1 A;  5AJ3 L;  1VQI A;  3JAM L;  2TSS A;  4P72 A;  1L0W A;  1IL8 A;  1D8L A;  1EIH A;  1WD0 A;  1VCI A;  1RF2 D;  4QF4 A;  2E75 C;  1AH9 A;  1JCK B;  3AB9 A;  2XVS A;  3LX0 A;  3S2D H;  4JW0 A;  3S14 H;  3I56 A;  2DY8 A;  1YNN C;  4XTC S;  2QEJ C;  1I6V C;  3I55 A;  1XNQ Q;  3ULP A;  4HJ8 A;  1X3G A;  4A3J G;  5CV4 A;  4IUP A;  3J81 c;  4OHJ A;  2Q2T A;  4PZ6 A;  1VQE A;  1DJR D;  2PZU A;  1A6X A;  4DKA C;  3S24 A;  4LW1 A;  3RLN A;  2L12 A;  3MEF A;  2RDG A;  1SE3 A;  1TII D;  4CDD C;  1Z7T A;  1TWG H;  1ET6 A;  4H44 C;  1EWH A;  1LV9 A;  3MVV A;  4V0B A;  1GUO A;  3CCQ A;  2K14 A;  2BDO A;  4OWX B;  2ASB A;  2Z8L A;  4ZQ3 A;  1FR3 A;  1EYD A;  3SXH A;  5IYD G;  1Q3L A;  4LF9 L;  2ATW A;  1HFN A;  2UUB L;  1H95 A;  1K83 B;  1S3O A;  4BWG B;  1OTC A;  3K7U C;  1P8L A;  4DR7 Q;  1SYF A;  3DUZ A;  1I3Q H;  3K7A B;  1HRJ A;  1N34 Q;  5IGG A;  2D62 A;  5M3M G;  4LF7 L;  5DNF A;  5IYB G;  4ABN A;  1QOH A;  4OX9 Q;  4JI8 L;  1HNX L;  1K0S A;  1ZYR C;  4PZ7 A;  3IAY A;  4JI2 L;  1KLG D;  4I7Z C;  3D4R A;  4FXG C;  3HKS A;  2HHH L;  4GNX A;  3EFX D;  3I7F A;  2UXD L;  3L3O C;  1KL9 A;  2WII B;  2NVY H;  4WJ4 A;  3ZJY C;  3LGJ A;  2QIL A;  3F1Z A;  1LT4 D;  1SFO B;  4DV2 L;  1NJI C;  1MSH A;  2Z6K A;  3PIO 3;  3A0J A;  2F4I A;  2EOT A;  1VQO A;  5FO7 B;  5CV5 A;  4LK1 C;  2XGT A;  4QCL A;  1AP0 A;  3VR6 A;  3RZD B;  1J5E L;  4L6T B;  4YCU A;  1CUK A;  2HHH Q;  1SMY D;  1Y14 B;  1K83 H;  3W3A A;  2LS0 1;  4RGO S;  1QVF A;  3I70 A;  3OIP A;  4PG3 A;  3NPP A;  3HFZ B;  3S16 H;  1BCP F;  2Z4I A;  3MEH A;  4QIW E;  4HIO A;  1EL0 A;  1OXT A;  1PZJ D;  2K01 A;  1CT1 D;  4LF4 L;  1W6K A;  2HCI A;  3I4N G;  1IYJ B;  4BBR H;  4G7Z C;  2K75 A;  2D0O A;  3DM3 A;  3KJP A;  1RDP D;  1X6O A;  2G5D A;  4FP5 D;  3QJY A;  3PIP A;  1CZW A;  1H9S B;  1RTO A;  2UUB Q;  2VUM B;  4LFC Q;  3MFY A;  1TWF H;  2XNA C;  4A3I G;  3MXG A;  3D31 A;  2MO0 A;  4IAL A;  2E2I B;  1GUT A;  1N36 Q;  1BO0 A;  1NMF A;  1H9M A;  2EJG C;  3C1E A;  2DNE A;  4DK3 C;  1C48 A;  3DXJ C;  1SNO A;  3QIA A;  2ZJP A;  4OIK A;  1YNX A;  4GN4 B;  1SE4 A;  4QGU A;  2A69 D;  1SJH D;  1TS5 A;  3KF6 B;  3V96 A;  1HZC A;  2R7D A;  1JWM D;  1CKN A;  2WAQ G;  4KHP L;  2AUK A;  4L63 B;  3K6O A;  5ISR A;  4F8M A;  3H0G H;  1HA6 A;  3TME A;  5E3F A;  5EKI A;  1PFM A;  4BY1 G;  1J9O A;  3W5O A;  2PO4 A;  1VMC A;  4OXP A;  3W1B A;  4A3J H;  1PRT D;  1VQ5 A;  1TVX A;  3U4Z A;  3NUC A;  5C6A A;  3J7A V;  3IRB A;  4GNX B;  3MC0 B;  4I65 A;  4C3I H;  4J6H A;  1VQG A;  2KEC A;  2X6L A;  3AMU A;  3ZYY X;  1RKN A;  1YIT A;  5DLQ E;  1C9O A;  2BH2 A;  1BKB A;  3E9I A;  4KHP Q;  1J5E Q;  1B7Y B;  1Z47 A;  2KBN A;  4JPB W;  1FGB D;  1F2Y A;  1S4Z A;  3PO2 G;  4HTH A;  3EIV A;  4LAA A;  4AH6 A;  4L8J A;  1PTO B;  2R6G A;  1I6H B;  3SHL A;  2DNC A;  5C0X G;  4DUZ Q;  5I2Y A;  3S1M B;  1A8V A;  3NQI A;  5C0X J;  1E3P A;  2OTJ A;  3KLS A;  1CA6 A;  4DV1 Q;  3H3V C;  5E4W C;  2R93 B;  2PNH A;  4DV7 Q;  4GN5 A;  2M2L A;  4UHV A;  1D7Q A;  2QDB A;  4C1N I;  4FVM A;  1VQA A;  4P71 A;  4YWK A;  2JSO A;  4JBK A;  1ML0 D;  1WFQ A;  3P1H A;  3GTL B;  1JJG A;  3NHH A;  3NP8 A;  4YCW A;  4LF4 Q;  1L0Y B;  2VB3 X;  2LKV A;  4LF7 Q;  2A6H C;  3BZD B;  4YIJ A;  5FK9 C;  3CCU A;  4HMJ A;  1HZ9 A;  1CKO A;  5CR3 A;  1J6Q A;  5E1F A;  3V05 A;  1GUS A;  2I46 A;  4EGV A;  5M3F B;  4RHR A;  1TWA B;  1VQK A;  4K2K A;  1WTO A;  1XX8 A;  4K6D A;  3CC2 A;  1R4P B;  3G7L A;  4X64 L;  2EYL A;  4C3I G;  3CRK C;  1GHJ A;  5A2Q L;  4KY5 A;  4JI3 L;  4DK0 A;  5D3I B;  1WTH A;  2A8V A;  5EQ0 A;  1JB3 A;  3PO3 H;  5IY0 A;  3LWE A;  4JCV E;  3GTQ H;  1EQT A;  3GTG B;  4A3B B;  2GN5 A;  1IW7 D;  3GD7 A;  5C3E G;  3PSI A;  3J80 L;  3GV3 A;  4KY7 A;  1HHV A;  4L5T A;  4FF2 A;  2AQ2 B;  1DXM A;  4CDE C;  1BXT A;  4A3E B;  3A54 A;  3MFG A;  2JA6 G;  4A3E H;  1I4Q A;  4A3I H;  4L5R C;  4B3T Q;  1HZA A;  2SDF A;  4HED A;  4OO1 G;  3H3V I;  4DR4 L;  1IBK L;  2E2I H;  2L15 A;  2EYH A;  2EJF C;  3BG3 A;  3P7J A;  2DJG C;  4DR3 Q;  1XNR Q;  5C3W A;  4AYB G;  1IZ6 A;  4OWT B;  5M5Y B;  3PO3 B;  1HFG A;  3GO5 A;  2VQF Q;  2F0M A;  1ILP A;  2XWJ B;  4KLK A;  2E5L Q;  3TQY A;  3CCJ A;  5HGQ A;  2QDL A;  2WIN B;  3HEJ A;  2WV6 D;  1TWA H;  5M5W H;  3I2Z A;  1NR2 A;  2L0C A;  4GKK L;  3FPU B;  2NVX H;  2NVQ H;  5E4X A;  2CKZ B;  1O80 A;  1WI5 A;  1LO5 D;  2K5Q A;  3PUZ A;  3PUW A;  2VQF L;  4IPD A;  1EIY B;  2X69 A;  1MGS A;  3F2B A;  1CZG A;  5IP9 H;  4B9X A;  2HDM A;  4CJ1 B;  1AZQ A;  1RL2 A;  3KLS X;  1SAP A;  5BN4 A;  3BVG A;  2BDN A;  3NBI A;  1IL2 A;  3KFU A;  1EY8 A;  5ELN A;  2YTY A;  2Z6B A;  1PH9 A;  1STE A;  1A3T A;  4FXD A;  2E2H H;  4GOP C;  4BXX G;  2RHQ B;  2K7V A;  1BQQ T;  1EOV A;  3CC7 A;  4HID A;  4X65 Q;  4HJ5 A;  4JV5 Q;  1I4R A;  1B1Z A;  3HOZ H;  4LFA Q;  5CV7 A;  1EIF A;  2D0P A;  2NVX B;  5KYL A;  4C3I B;  3E6Z X;  3CCL A;  1KQS A;  4B3S L;  3MXP A;  2M00 A;  1YHQ A;  2KJX A;  2WB1 G;  2I5M X;  1QNK A;  5T1I A;  1JQY D;  4F7X A;  4QB4 A;  3C1F A;  1YJW A;  5DM7 3;  3RMH A;  2E8G A;  1HNZ L;  1VQ8 A;  4LFA L;  3DEP A;  2R61 A;  2E2J H;  1TT2 A;  5K36 G;  1AFP A;  1TWG B;  3ULL A;  3T13 A;  2B2T C;  1WTR A;  4O0A A;  4DR6 L;  4NXM Q;  1NUC A;  4C1N K;  2KEE A;  1UUP A;  5I9O A;  1S72 A;  4IPH A;  4EVO A;  1AE3 A;  1TU2 B;  2UXC Q;  3I4M B;  3J80 c;  1T9H A;  2L5T A;  3D4D A;  4XDX A;  3G4S A;  3UDF A;  1FJG Q;  1KLU D;  4A3I B;  1Y1W G;  4DV0 Q;  2A19 A;  5GAH C;  1CK1 A;  3KF6 A;  4XXE A;  4FNF A;  1Z9F A;  1VQM A;  1QJO A;  1QB5 D;  4FF1 A;  4IPG A;  1OXV A;  3ER0 A;  3K0X A;  1BBU A;  1S5B D;  1VMP A;  3HOV B;  1D5M C;  2WFW A;  2IY5 B;  4CDC C;  4HAE A;  1V1P B;  1G6Z A;  3FKI G;  3OHX C;  2MHV A;  1GM5 A;  1E2W A;  4BA1 I;  5IYC H;  5D65 A;  1W3S A;  1PH3 A;  1N8R C;  2MQH A;  2Y0S E;  1PH4 A;  1YHB A;  2NN6 G;  1CI3 M;  3HGB A;  4JVZ A;  5IP7 H;  5I2X A;  5COR A;  1HA5 A;  3K5N A;  3E0E A;  1SRU A;  3M3Y B;  3VYS A;  4AQY L;  3CRL C;  1CKM A;  1VS0 A;  1KAW A;  2F0L A;  1SJE D;  4O1N A;  5J22 A;  5ELC A;  1HR0 Q;  3QG1 A;  3Q24 A;  1R9T B;  2JN4 A;  1YVC A;  2DGY A;  4ID6 A;  3L2P A;  2J7Z A;  3NEN A;  3SVM A;  4A3K H;  4UP7 A;  3CCV A;  3BDC A;  2CQA A;  4KKT A;  3GTL H;  2QA4 A;  1EEI D;  2PQE A;  4KKS A;  2J4X A;  1CHP D;  3L9A X;  2ENB A;  4A3F G;  1NE3 A;  4A3G B;  5IT9 E;  2A6H D;  4DR1 L;  4CBV A;  1YJ9 A;  5HGT A;  1E22 A;  1VQJ A;  4BY7 H;  1KTK A;  3S17 B;  4RGM A;  3UDI A;  4JI0 L;  4JK1 C;  2HD3 A;  3AU7 A;  2KHJ A;  1JJC B;  3OTO Q;  5JVH 3;  4ZKC B;  1PYB A;  4CKB A;  5C4X B;  4LF5 Q;  5GQO A;  5C4J H;  4TKO B;  4IQZ A;  1QUQ B;  3VYT A;  4EQN A;  2A68 C;  3AQQ A;  5ELE A;  3BDL A;  4LWC A;  3CME A;  5A35 A;  1H9K A;  3F2C A;  4OGQ C;  3GQB A;  3OMC A;  3TP5 A;  4DR5 Q;  2A68 D;  4YHH L;  1XPR A;  4IJH A;  2A5H A;  1TWH B;  2NUC A;  4KI0 A;  3CCR A;  1UE6 A;  4O2D A;  3M85 A;  4KD3 A;  4Z9C B;  2KVM A;  3J80 E;  3CAM A;  1TWC H;  4A3L G;  3MXN A;  1L0X B;  2AUJ D;  3K59 A;  1I4P A;  1XWE A;  3MZ5 A;  3CP0 A;  1B8A A;  4JBM A;  1CTM A;  1SXT A;  5EJW A;  3MTS A;  4DAP A;  2ZJR A;  2Q2H A;  4ZK9 B;  1Q81 C;  1Q7Y C;  4KTA A;  4R4T A;  3A55 A;  1TS4 A;  1MI2 A;  1SND A;  2K4K A;  3QO2 A;  5BN5 A;  4NKL A;  4GKK Q;  1IKM A;  5FLM G;  1C8C A;  1QUQ A;  3J7Y W;  4X64 Q;  1E2V A;  2UUC L;  1Z6H A;  5ELF A;  2B39 A;  1NTG A;  5TSS A;  5FO8 B;  2BE5 C;  5JAV A;  3J81 j;  1CHQ D;  1KD1 C;  3HKZ B;  2DY7 A;  2ICI A;  1TWF B;  4LUO A;  5C0X H;  2PMZ E;  3CQZ H;  4CDF C;  2B2T A;  5IOC A;  5M9O A;  1EFW A;  2B2U C;  2OF1 A;  1WVL A;  5C4X G;  4A76 A;  1TWC B;  3HOV G;  4S3S A;  5IGC A;  2RCF A;  2F0P A;  4DR7 L;  2G9D A;  2BE5 D;  1XMQ L;  1B53 A;  1H9S A;  4PQX A;  5L37 A;  1K73 C;  1N32 L;  4A3F B;  1WTW A;  1XYI A;  2B8F A;  3AYH B;  5LL6 S;  4DNT B;  2NZ1 D;  1I50 H;  1JOQ A;  1HH2 P;  1D5Z C;  1NAP A;  1YNN D;  4HR7 B;  1Q12 A;  1SNQ A;  5ELO A;  2HDL A;  2JK8 A;  1U4M A;  5G3L D;  3DLL A;  4Q5V A;  2EYM A;  3K8A A;  1EY4 A;  3NEL A;  2N88 A;  2NN6 H;  3FMC A;  4JG2 A;  1MD2 D;  4QUC A;  2L9H A;  3TP8 A;  4OEL B;  1MJE A;  4WJ3 M;  3S17 H;  2NVY B;  4BY7 B;  2RKS A;  3QB3 A;  3T4A C;  3PMF A;  1PTO D;  1CQV A;  1X32 A;  2F4V L;  5KND A;  4ZRZ A;  2K04 A;  4QJF A;  2ZXP A;  1O7I A;  3KDF B;  1KRS A;  4HCE A;  1SR3 A;  2NB0 A;  4GKJ Q;  4P73 A;  3OW7 A;  3M4O H;  1EYG A;  1VQ7 A;  1B2T A;  4DNI A;  2EJM A;  1KHI A;  2I0Q A;  1KDB A;  2IW3 A;  1XTC D;  3KLW A;  4J1M A;  1AEX A;  1R9T H;  1EU4 A;  2MJ8 A;  1I3Q B;  3FKI B;  1HQR D;  4HJ7 A;  1M4V A;  3NSW A;  3G48 A;  1U4R A;  3DEO A;  5J1Z A;  4BBR G;  3G6J B;  4A4I A;  5CMD A;  3EBE A;  3J81 i;  3Q8D A;  3CD6 A;  3NTK A;  2F0V A;  2IJ0 A;  1EZ8 A;  3BVZ A;  2J0T D;  4HJ9 A;  3H3V H;  2MNA A;  3A7L A;  2PPB C;  2IHE A;  4YCV A;  3E3X A;  4NDX A;  3E5S A;  4C3H B;  4A3C G;  2JA5 H;  1WTQ A;  1PZI D;  4JI1 Q;  3I90 A;  3HOY G;  2LXJ A;  4JI0 Q;  4DV2 Q;  5FJ8 H;  3X3N A;  1AW7 A;  3QOJ A;  5CBA E;  4BBS G;  4MN3 A;  1RHP A;  4L5Q A;  4NW2 A;  3H15 A;  1XMO Q;  5IYC G;  1PH8 A;  1KAB A;  2KED A;  5FO9 B;  4CJ2 C;  4IN3 A;  1O78 A;  2LFN A;  4APV A;  1UE7 A;  3UE1 A;  5CGK A;  4A3M B;  2WB1 E;  3O13 A;  2K05 A;  1V1O A;  3HOZ G;  2OTL A;  4Y7N H;  5C3E H;  2L11 A;  4A3M H;  3T56 B;  2MP1 A;  1W6J A;  1LTB D;  4GNX C;  1XMQ Q;  1FL0 A;  1N34 L;  5EBD A;  1VF5 C;  4GN3 B;  5HY6 A;  4MZ9 A;  3L7Z C;  3FDT A;  4X3U A;  1L2F A;  4X62 L;  2XN9 C;  1Y1V B;  1G6P A;  3GTG H;  3NTH A;  1L1O B;  1NY4 A;  3U4V A;  5KEE A;  2K5N A;  1QNU A;  3H94 A;  3SK8 A;  4DV1 L;  4IZ8 A;  3S1N H;  1W2B A;  4KMU C;  5JEA J;  1UAP A;  2IHF A;  3K80 C;  4DV3 L;  2K33 A;  2OQK A;  1SE2 A;  3ND9 A;  1XNQ L;  1SNP A;  2AQ3 B;  5JVG 3;  2Y0S B;  2EDG A;  3SK4 A;  3MXN B;  5KGU A;  4P74 A;  1PMR A;  2B2U A;  4R4O A;  2NTT A;  1E2Z A;  5EPJ A;  4KV6 A;  1N33 L;  2PW7 A;  4DA2 A;  2IL8 A;  1OXU A;  1EY9 A;  4K5W A;  1KIX A;  2B63 G;  5I6Y A;  2QGQ A;  4N8X 1;  2EXD A;  2LXK A;  2N3S A;  2QF7 A;  1WYD A;  3I3C A;  3NQT A;  5FOB B;  2AHO B;  3OOC A;  4N9P A;  2R92 H;  2NN6 I;  2D9U A;  1SN8 A;  2K28 A;  4K6L A;  3M4Q A;  1XJV A;  4HN7 A;  4YWM A;  3J80 i;  1SNM A;  4AIM A;  4HIK A;  4ME3 A;  1LTG D;  3C2P A;  1Q90 A;  5C44 B;  3K7A H;  4A3K B;  5C5L A;  3FEW X;  1EQR A;  1X54 A;  3MWY W;  5KRU A;  3J7Z C;  1TY0 A;  5LMN W;  2V1C C;  3H91 A;  2IT1 A;  4I7A A;  1JIC A;  1QE6 A;  2JE6 I;  2Q8R E;  3NBH A;  2PCF B;  1EY5 A;  4LUV A;  4YWL A;  4MHE A;  2CVR A;  1JMC A;  2UUA Q;  1WCM H;  3N6R A;  2AWN A;  1KRT A;  3GTP H;  4EQO A;  2JQO A;  1R4Q B;  2A1A A;  4PNY A;  4ZUJ A;  4GLA C;  3BS1 A;  2XRQ D;  1MBY A;  1PLF A;  2KCC A;  5E7N A;  1SMY C;  1UE5 A;  4XQN A;  2RBM A;  4GS3 A;  3CC4 A;  1SYD A;  2K6A A;  2B2Y A;  5C3X A;  4IUQ A;  4HCS A;  4XT3 B;  3GTJ B;  1EEF D;  2ID0 A;  3A5U A;  2LMC B;  1IYV A;  1FYC A;  3FHW A;  3SGI A;  5ELB A;  2FMC A;  4RG1 A;  4KHZ A;  1PDQ A;  4G4K A;  4LMQ D;  4DV6 L;  1K9M C;  3I4N H;  2VY3 A;  1LTL A;  4OWW B;  3HOW B;  2IPK D;  5LMU Q;  3MXU A;  4A3M G;  1WTV A;  2F0F A;  2PNR C;  1QVG A;  1I4H A;  4BY1 B;  4IOA A;  3UDG A;  2EE1 A;  3Q6S A;  1PXU A;  2N8N A;  1PA6 A;  1Q86 C;  2OEO A;  4K0K Q;  2RF4 A;  3W2D A;  3GTM B;  1V9P A;  3A8I E;  3TP7 A;  3VR2 A;  2RSN A;  3HKZ E;  4DV6 Q;  5IGE A;  3RLF A;  4JI2 Q;  2EVB A;  1O7L A;  4DFA A;  2CWA A;  1QZH A;  4IFD J;  1U4P A;  4OX9 L;  4JI4 Q;  2JEB I;  4DAY A;  1EWC A;  5C4J B;  1F9S A;  3U9S A;  4N9T A;  3GDE A;  1ZYR D;  4DV5 Q;  2AQ1 B;  5NUC A;  4PMB A;  3VYU A;  5J39 A;  4NP5 A;  3VA5 A;  3CKI B;  1X65 A;  4U67 3;  2CQO A;  4R4C A;  4DV4 L;  4L5S A;  3RN2 A;  2L4N A;  1ESF A;  4LUZ A;  4GLX A;  2ZTE A;  4JI7 L;  2NYZ D;  3GTP B;  4LF6 Q;  1M8A A;  1JJ2 A;  2R92 B;  3ND8 A;  3KBX A;  2BCO A;  3H0G G;  3H6M A;  1HUN A;  2HIX A;  3BVM A;  3EQL C;  2C9O A;  1YEZ A;  2F0G A;  4B3S Q;  3OYY A;  5EBC A;  3CCE A;  1LM0 A;  4ZUI A;  1GVP A;  2F0D A;  4ZKB B;  1LAB A;  1E1T A;  4JI1 L;  1BDO A;  2PQA B;  2QW7 A;  4G7O C;  5IYD H;  4KY6 A;  2JA8 B;  2WAQ B;  4R4I A;  2K5V A;  4U68 A;  1CQF A;  1L1O C;  1BCP D;  3S1R B;  1UE1 A;  1RD9 D;  5AJ3 Q;  5JJL A;  1TS2 A;  2HQL A;  3OPO A;  4KK7 A;  1VF7 A;  3A5Z B;  4POG A;  3R2T A;  1TQO A;  1K8O A;  1PH7 A;  3M3Y H;  4X3K A;  1G29 1;  3C3L A;  1DOK A;  4A3D B;  1DZ1 A;  5FLM H;  2KCT A;  2YU9 H;  4FDB A;  3GTK H;  4A3L H;  4NXM L;  3K81 C;  1OO9 B;  3SE0 A;  3D3R A;  1EOT A;  4DGZ A;  1ASY A;  4FF3 A;  1YNJ D;  4CHT B;  1TKW B;  3A74 A;  4DXF A;  2NTS A;  4IUT A;  2N49 A;  1Y1W H;  4FO2 A;  3PIP 3;  3IFD A;  4ZLT F;  1UNS A;  1F77 A;  3S1Q H;  1STB A;  2RSO A;  1D1I A;  3HOV H;  4R1J A;  1Q8K A;  4DAY B;  3Q22 A;  3T1Y L;  2UU9 L;  1IKL A;  1UEA B;  4BXX H;  3S1N B;  2RDH A;  3J7A 5;  3NTI A;  1FGU A;  2JXM B;  4JI5 L;  2SNS A;  4DR2 Q;  1M1K C;  1Y1V H;  3CHB D;  2NVT H;  3WDN A;  2ZM6 L;  4BBS H;  1A63 A;  1I94 Q;  2M9V A;  4M8A A;  4A93 H;  1GUG A;  1JWS D;  5IP9 G;  1V1Q A;  1SNC A;  2B2W A;  4NXN Q;  2JYO A;  2JJQ A;  3DWP A;  4A93 B;  3AEV A;  4QL5 A;  1N33 Q;  3S9W A;  1YI2 A;  4AQY Q;  4C3H H;  2NVT B;  1HNZ Q;  1AE2 A;  3PCO B;  3M9B A;  3SDZ A;  5IYB H;  1EQV A;  4X3S A;  4IUN A;  3JC6 6;  3QR8 A;  4B3M L;  1Q46 A;  1KXL A;  3I91 A;  5FKA C;  4IJL A;  3OW2 A;  1QWY A;  4PZ8 A;  1N36 L;  1SMX A;  2QEX A;  4GZY C;  2FFK B;  1J8I A;  3VYR A;  4DPG A;  1VQC A;  4IOC A;  3URY A;  5M3M B;  3PQI A;  4H13 C;  3A8J E;  3RD4 A;  4JOI A;  1B70 B;  4UP9 A;  2EY5 A;  5FLX E;  5I4D A;  3VDY A;  2F0E A;  2F0W A;  4K8J A;  2KA7 A;  1MSG A;  4DUY L;  2D2C C;  4IPC A;  4UY8 C;  1K28 A;  5G3L F;  2Q2U A;  2YU9 B;  3GTK B;  4N8F A;  5J3B A;  4DR3 L;  1SSO A;  2JP1 A;  1VQL A;  4LNQ A;  3I4O A;  2E2H B;  2RA4 A;  3HOX B;  2IWH A;  4X62 Q;  1HUM A;  1E0B A;  1TS3 A;  5IT9 L;  3CCM A;  2OT2 A;  1C4Q A;  2Z4H A;  3L0O A;  2KCM A;  3ERO A;  4XT1 B;  1BCP B;  3ONA B;  3RN5 A;  5EKK A;  2B2V C;  5GAD C;  1PH2 A;  1MJC A;  1P16 A;  4CGY B;  1XMO L;  4NPS A;  2E2D C;  1K3R A;  3J81 L;  1FNV A;  3VR3 A;  4YHH Q;  3E0J A;  1I4G A;  4HJA A;  2VB2 X;  2RHS B;  4PMW A;  3OMG A;  1BCP C;  1O7Y A;  1ONL A;  2TMP A;  4IUR A;  4MTN A;  1K3B C;  2Z0S A;  1I5F A;  3KF8 A;  1E24 A;  5IOD A;  5M5W B;  3ITP A;  1CSP A;  5LL6 X;  1PV4 A;  2FHT A;  5CC4 A;  1B9M A;  4LFC L;  1YNJ C;  4DAV A;  2WB1 B;  4GOP B;  3JAM c;  5JOB A;  4RKB A;  2EPB A;  2JA6 H;  1XXG A;  4HIM A;  4WJW A;  2O5I C;  4J8Q A;  2XTI A;  1ILQ A;  3H0G B;  5D14 A;  1Y8P B;  1XNR L;  1BOS A;  2PI2 E;  3W1G A;  4RAU C;  4JV5 L;  3ICE A;  3OWF A;  1XPU A;  2CCZ A;  2CW0 D;  4F87 A;  2FJ2 A;  4ODG A;  2KHI A;  1RCV D;  2UXB Q;  2Z1C A;  1WCM G;  3PUX A;  2QKI C;  2OXP A;  3LNN A;  3N52 A;  1IBM Q;  2EY2 A;  4DK1 A;  3GTJ H;  1TY2 A;  4LF9 Q;  1YJN A;  1DD2 A;  1JOO A;  1S5C D;  3PF5 A;  2GVB A;  4TRD A;  1ET9 A;  3PGZ A;  1ENC A;  3D0F A;  4RGN A;  2PI2 A;  4M1U B;  1B50 A;  1VQ4 A;  1F9R A;  4POF A;  4LF8 Q;  2Q8T A;  2EYJ A;  3NWS A;  1KNE A;  2KQ3 A;  4B3R L;  1LAC A;  3JAM E;  4IUV A;  3KLR A;  2EY1 A;  3DM1 A;  1X9N A;  2UUC Q;  2K5H A;  4JBJ A;  1LTS D;  4G57 A;  4DUZ L;  1G91 A;  5LHY 1;  3QWN A;  5ELD A;  3GP7 A;  1STN A;  4JI7 Q;  3S2H B;  1RJT A;  2F0J A;  2NWG A;  2DN8 A;  4E6I A;  1DON A;  3RZD H;  5C4X H;  1F2L A;  3J81 E;  1NBW A;  5LMU L;  4X66 Q;  4X6A H;  4DK6 C;  2CWP A;  2HCC A;  1LT3 D;  3HOY H;  2R7Z G;  3RZO B;  1Y8N B;  3TRE A;  1TWH H;  2QCP X;  2F3W A;  3IL8 A;  2Z6K C;  2R93 H;  1PRT B;  4XQJ A;  1LTR D;  3R3O A;  3EVQ A;  1FNU A;  4DR5 L;  2XSC A;  3SR1 A;  2B8G A;  2K03 A;  2A73 B;  2F1M A;  4ALP A;  3CXC A;  4H0L C;  4K2L A;  4IFD G;  1D6E C;  4DN4 M;  3STB C;  4IFD H;  3TBI B;  2XIW A;  2LSS A;  1ZEQ X;  4XYO A;  5FLX L;  3NBH B;  3P75 A;  4A3E G;  4QY7 A;  3U50 C;  1O7Z A;  4RCO A;  4IO9 A;  1I6H H;  5JJI A;  2K52 A;  4H02 A;  2KHS A;  3HOU G;  2IX3 A;  4B08 A;  4FF4 A;  1DGS A;  1JR0 D;  2UU9 Q;  4X3T A;  4GOP A;  1VQH A;  4A3B G;  1L1O A;  3RZO H;  4XYQ A;  1HTL D;  4EQ5 A;  1NMG A;  1VQF A;  2WAQ E;  2G9H D;  3K5O A;  1E1O A;  5CYU A;  2F3V A;  4ILW A;  4Q0F A;  1U4L A;  2K5W A;  5C4Z A;  1HJP A;  4MTK A;  1ROD A;  1SBB B;  3TEH B;  1LTT D;  2WP8 J;  4CKE A;  1MKH A;  5F2D A;  1VQ9 A;  2B2V A;  4TVA B;  4DR6 Q;  4NXN L;  3Q23 A;  4CJ0 B;  2N55 A;  1SEB D;  4R9W A;  3T1H L;  1KDA A;  2YV5 A;  1MIU A;  1EZ6 A;  1HNW L;  1EQQ A;  2KOL A;  3PO3 G;  4BBS B;  4GKJ L;  4DR2 L;  2F03 A;  1GUW A;  1CSQ A;  5DM6 3;  3CPW A;  1G2T A;  1G8Z D;  4BA2 I;  4RMF A;  4JBW A;  2HT1 A;  2O2L D;  4KD4 A;  1V1P A;  4C3H G;  1NNX A;  2Z9H A;  3S1Q B;  3G71 A;  2PQA A;  3KOJ A;  2EXZ A;  2V4D A;  4HMI A;  1BUV T;  3U9O A;  4OEM B;  2KUM A;  1HR0 L;  3VR5 A;  1KDC A;  2A69 C;  1HXY D;  2JA9 A;  2VS1 A;  3RLO A;  4BBR B;  1Y1V G;  4QUF A;  5I6W A;  4K14 A;  5A2Q E;  4LF6 L;  5C3E B;  4Y52 H;  3P20 A;  2AKW B;  2R7Z B;  3PO2 H;  2A6E C;  3S16 B;  5EGT A;  4BS9 A;  1VQB A;  1SDF A;  4C3J H;  1A2U A;  1B3A A;  1OXX K;  1VQD A;  4OO1 I;  1A15 A;  1JE4 A;  3HOZ B;  3EA6 A;  1E7Z A;  1ICF B;  3FKI H;  3BZC A;  2EYP A;  1QCB D;  2X6G A;  1I94 L;  2EY6 A;  1PYW D;  2LY7 A;  1TXY A;  1IHZ A;  5D3D A;  1YIJ A;  1EFI D;  2YTX A;  4EQP A;  3UDX A;  2AWO A;  2MFI A;  3NEM A;  1SLJ A;  3UE0 A;  2CHB D;  4DAM A;  3I8Z A;  3I73 A;  5BR8 L;  4UDU C;  3GTO H;  4MIU A;  4C3J G;  2MUY A;  1K0R A;  5GAE C;  5DAU A;  3CPF A;  3HRZ C;  5IGF A;  3CCS A;  1Y69 U;  5JEA G;  5JPM C;  3S1R H;  3I4L A;  3RR5 A;  4FYD A;  4HSV A;  1HNW Q;  1D5X C;  3HOX G;  2MPM A;  3ERS X;  1G51 A;  4G7H C;  3F2U A;  1T5X D;  2Q2I A;  4XQQ A;  1IBM L;  1H9J A;  3G6E A;  1STH A;  4UPA A;  1KNA A;  2YTV A;  3VA7 A;  2L1B A;  2UXB L;  4A3F H;  1H9R A;  1FVI A;  1ENF A;  1GXD C;  3V2T A;  3K5L A;  3MHB A;  3KK7 A;  3KYH C;  5IE8 A;  5M5X H;  2ZXR A;  1PH5 A;  4C2M H;  2RQX A;  2CH4 A;  4K0K L;  2ALY B;  3PF4 A;  3CQZ B;  1C0A A;  1GD7 A;  2BH8 A;  1D2B A;  1K8A C;  4EX5 A;  4ME5 A;  4BY1 H;  1MHW C;  2R7Z H;  4DV7 L;  3BZK A;  1I50 B;  2F0T A;  1DOL A;  4DV3 Q;  1HPC A;  3S2H H;  4X65 L;  3T53 B;  1EY6 A;  5EPK A;  3BJU A;  1DM0 B;  3HP3 A;  3S15 H;  4A93 G;  3EN2 A;  1YZ6 A;  3MA2 B;  3A7A B;  1CFM A;  1JT8 A;  4KN7 C;  2K32 A;  2H5X A;  5M5Y H;  2F0N A;  1HCZ A;  3RNU A;  5FJ8 G;  4P75 A;  2JEA I;  2O5J C;  3DMU A;  1EY7 A;  3GV6 A;  4A3B H;  3SEB A;  4UP8 A;  1Q8I A;  3A8K E;  1SYB A;  1JWU D;  2C5C A;  3BYY B;  2NZH A;  1FNW A;  3MAQ A;  2RVL A;  4WFN 3;  4A75 A;  1F9Q A;  1AZP A;  5C4H A;  2ZT9 C;  2F0H A;  3S15 B;  5HUR A;  2SNM A;  1PVO A;  3I4N B;  3J7A F;  1EWI A;  3H09 A;  1STA A;  4YY3 L;  2R3Z A;  3BU2 A;  4LJZ C;  4DUY Q;  3HKZ G;  4GLV B;  3R8B A;  2Q8I B;  2KEN A;  1LTA D;  2A6E D;  2WKD A;  5IWA L;  3F2D A;  3T16 A;  3Q0A A;  2B29 A;  5IGD A;  4V19 0;  2F3I A;  3GTQ B;  1U0L A;  4LF8 L;  4K5V A;  4A3D H;  1SE8 A;  2CH4 W;  4C2M B;  4IFD I;  3WOF A;  2HQE A;  2K5D A;  2EQS A;  4B3R Q;  4RA8 A;  2E5L L;  4A3G H;  5IT9 c;  1XPO A;  1C7Y A;  2RDF A;  2VZA A;  1SFO H;  4JI4 L;  2F0I A;  5JJZ A;  1D1K A;  4FXK C;  1T5E A;  1F2M A;  4DXG A;  2H1E A;  1DOM A;  1HQM C;  3PUV A;  4F88 A;  1PH1 A;  1VQP A;  4RGT A;  1HZB A;  1A3V A;  4PMC A;  1A62 A;  3DHQ A;  3M7G A;  1PFB A;  5C44 H;  1V8Q A;  1LTI D;  2R92 G;  4JI5 Q;  1PYS B;  1DCZ A;  2MO1 A;  4UAI A;  4JYA L;  1QG7 A;  4JI6 L;  1X55 A;  4JI3 Q;  2K1B A;  1LUZ A;  1ASZ A;  1BF4 A;  2CW0 C;  3BYT B;  1PHJ A;  2OQ0 A;  1JOR A;  3NE5 B;  1KC8 C;  4A3G G;  2CFM A;  1I4X A;  2F0K A;  4JC0 A;  4KKU A;  2VL6 A;  3TZU A;  5KNC A;  5K36 H;  2F52 A;  1F9P A;  4A3D G;  4KJN A;  4C3J B;  3D6W A;  1IBK Q;  3HOU H;  1V43 A;  2VQE L;  1X3P A;  4OON A;  2FIN B;  5DEH A;  2JA7 H;  1Y8O B;  4A3J B;  3TS2 A;  1N32 Q;  3PIO A;  1IYU A;  5I9P A;  2VUM H;  2L55 A;  2JA8 G;  1ENA A;  1PFS A;  1HTP A;  2DJF C;  3R2I A;  2PZW A;  2P5Z X;  1STY A;  4RFB A;  3KJO A;  3S14 B;  2HUG A;  3NWT A;  1CM9 A;  4X66 L;  3HOW H;  1B3Q A;  2EYF A;  1UEB A;  3SK6 A;  4H7B A;  1PFN A;  1SYE A;  3OSO A;  2ZXO A;  1IW7 C;  5EKL A;  4QIW B;  4K5X A;  3TS0 A;  3TRZ A;  2SOB A;  3T51 B;  4DF7 A;  2ZJQ A;  5CV9 A;  4OL7 A;  4Y7N B;  3FVQ A;  2B2Y C;  4DU9 A;  2BA0 A;  5EAY A;  3IFT A;  1IXR A;  5COY A;  3KBG A;  3ULJ A;  3I4M H;  2PW5 A;  4DNR B;  2DUD A;  1HNX Q;  3VR4 A;  4QMG A;  1B4O A;  1S40 A;  5GRO A;  3WWV A;  5GAG C;  2E2J B;  3FPP A;  1Y1W B;  1LLR D;  4IUU A;  1X3F A;  1EIG A;  4TSS A;  3TSS A;  3I4M G;  4KHV A;  1ICW A;  4DV0 L;  1G2S A;  1OXS C;  1TR5 A;  2JA5 B;  1SRO A;  4PV1 C;  4B3T L;  1FJG L;  3TDQ A;  1PH6 A;  3CF5 A;  4LFB Q;  4QQB X;  4R4Q A;  4WRD A;  1S5E D;  1II3 A;  5JJK A;  1NSN S;  2SEB D;  3K5M A;  4ZAI A;  1M90 C;  1GO3 E;  1N9W A;  4A3K G;  4MNO A;  2JA8 H;  1A0I A;  2OWO A;  1B9N A;  3DWA A;  2JA7 G;  1RIP A;  3WOE A;  1HR0 W;  1F2Z A;  3HOW G;  5C0X I;  1NCV A;  1YHA A;  4R8I A;  4RCN A;  2B2W C;  1Q82 C;  4C56 C;  3HOX H;  4ULL A;  3AFQ A;  2NVQ B;  3PV0 A;  4RKL A;  3GTO B;  2FMM A;  2HIV A;  4LFB L;  4OO1 H;  4RHS A;  2N78 A;  1GKH A;  2OCE A;  3TZD A;  3HZX A;  1A2T A;  2MGS A;  5IP7 G;  1SYC A;  1K8G A;  2YYZ A;  2BOS A;  3EJI A;  2EIF A;  4WOR A;  4AYB E;  2NBF A;  1JB7 A;  2C35 B;  2NZO A;  2GA4 B;  2O4X A;  2WAC A;  3CU7 A;  1QVC A;  2K50 A;  1B44 D;  2E74 C;  4R8N A;  4RWS C;  4DV4 Q;  4CKC A;  2H4O A;  1X56 A;  1K8M A;  1AN8 A;  2RCN A;  1ZKO A;  2AMC B;  1WTX A;  1GOZ A;  1FD7 D;  1EY0 A;  3KUP A;  4KN4 C;  1PZK D;  3CW2 C;  1PTO F;  4JOI C;  1U9R A;  1DYQ A;  3D8G A;  3R93 A;  2GVA A;  1WOC A;  3S2D B;  2WKC A;  3NK9 A;  1EYC A;  3KDF A;  4DR1 Q;  2F0S A;  2B3G A;  2B63 H;  1STG A;  3K58 A;  2I07 B;  4LF5 L;  2UXD Q;  2XRS D;  5C44 G;  4B9W A;  3OTO L;  1EU3 A;  2I5H A;  3E9H A;  3UI2 A;  3OWE B;  4HSP A;  3GTM H;  1NR4 A;  5IWA Q;  2JA7 B;  4TQU S;  3K57 A;  3I72 A;  4KJO A;  1PRT F;  4NMZ A;  2B63 B;  1JOK A;  1X3Q A;  2FXQ A;  1Q1B A;  2E76 C;  4AYB B;  4JI8 Q;  1BR9 A;  1GJX A;  5KYI A;  4XIG S;  2VNU D;  3HS0 C;  2F4V Q;  1VDZ A;  1Q1E A;  2UXC L;  3QOL A;  4DV5 L;  3HOU B;  1YBY A;  2JA5 G;  2R7F A;  2EZV A;  3K0Y A;  2Y0S G;  4K8I A;  3B6Y A;  2F0U A;  5FLX c;  2F0O A;  1RTN A;  2JA6 B;  2ZTC A;  4P2C B;  1EUJ A;  1VQ6 A;  4NB3 A;  2R93 G;  4DR4 Q;  5CV6 A;  5C5M A;  5IGB A;  2ZM6 Q;  3FP9 A;  3IKJ A;  2VW9 A;  4JI6 Q;  5BR8 Q;  3TN2 A;  2PYK A;  1WCM B;  2F0Q A;  3JAM i;  5M5X B;  1S5D D;  2IX0 A;  1BNZ A;  3AFP A;  3U58 A;  1QZG A;  3M7N A;  2UUA L;  3SK5 A;  2PMZ B;  1WTP A;  5M3F H;  3RUZ A;  1PRT C; 
#chains in the Genus database with same CATH homology
 2ID0 A;  3A5U A;  2D0P A;  1VQB A;  3FHW A;  3SGI A;  2I5L X;  4C3J H;  4RG1 A;  1IBL Q;  3CCL A;  1KQS A;  4B3S L;  1OXX K;  4KHZ A;  4B3M Q;  1YHQ A;  4DV6 L;  1VQD A;  2ZTD A;  4OO1 I;  2WB1 G;  1K9M C;  3I4N H;  1UWV A;  2I5M X;  2VY3 A;  1LTL A;  4OWW B;  1E7Z A;  1WJJ A;  3FKI H;  3BZC A;  5LMU Q;  4A3M G;  5M3F G;  4A3C H;  1X3E A;  1BBW A;  1QVG A;  1YJW A;  1I94 L;  3UDG A;  4BY7 G;  4IOA A;  1HNZ L;  2E8G A;  1TXY A;  1VQ8 A;  4LFA L;  1BVS A;  2N8N A;  1PA6 A;  1YIJ A;  1Q86 C;  4K0K Q;  1JE5 A;  2YTX A;  3UDX A;  2RF4 A;  2E2J H;  2AWO A;  2MFI A;  3NEM A;  2VQE Q;  1V9P A;  3T1H Q;  1SLJ A;  3UE0 A;  5K36 G;  4DAM A;  3ULL A;  3S1M H;  4O0A A;  1CKN B;  4DR6 L;  4NXM Q;  3HKZ E;  5BR8 L;  3T1Y Q;  4IPH A;  4DV6 Q;  1S72 A;  3GTO H;  3M4P A;  5M3M H;  1AE3 A;  3RLF A;  4JI2 Q;  1VQN A;  2UXC Q;  1K0R A;  3J80 c;  5GAE C;  1T9H A;  5LMN Q;  3STB D;  3CPF A;  2CWA A;  3G4S A;  1QZH A;  3UDF A;  1IBL L;  1FJG Q;  1LYL A;  4IFD J;  3CCS A;  3PUY A;  1Y1W G;  3F8T A;  5JEA G;  1XTD A;  4OX9 L;  4JI4 Q;  4DV0 Q;  2JEB I;  2A19 A;  5GAH C;  3S1R H;  3KF6 A;  1U5K A;  2VUM G;  2ES2 A;  1Z9F A;  3RR5 A;  1VQM A;  4YY3 Q;  3GDE A;  1HNW Q;  3HOX G;  4DV5 Q;  4JYA Q;  4IPG A;  3ERS X;  1G51 A;  1OXV A;  3ER0 A;  3CMA A;  3K0X A;  1BBU A;  2Q2I A;  1IBM L;  1X65 A;  2CQO A;  2WFW A;  4R4C A;  5H1S E;  4DV4 L;  2IY5 B;  3G6E A;  4L5S A;  2IX1 A;  3RN2 A;  4UPA A;  5LMN L;  2YTV A;  4LUZ A;  2UXB L;  3FKI G;  4A3F H;  4GLX A;  1FVI A;  2ZTE A;  4JI7 L;  1GM5 A;  4LF6 Q;  1JJ2 A;  4BA1 I;  3KYH C;  5IYC H;  5IE8 A;  4J15 A;  5M5X H;  3KF8 B;  3H0G G;  1W3S A;  2BA1 A;  5AJ3 L;  1N8R C;  1PH3 A;  1VQI A;  1PH5 A;  2HIX A;  2MQH A;  4P72 A;  1L0W A;  4C2M H;  2Y0S E;  1D8L A;  1PH4 A;  1YHB A;  4K0K L;  2ALY B;  1VCI A;  2NN6 G;  1AH9 A;  1YEZ A;  4B3S Q;  5IP7 H;  3OYY A;  3PF4 A;  3CCE A;  1LM0 A;  3S2D H;  1GVP A;  1C0A A;  3E0E A;  3S14 H;  1GD7 A;  3I56 A;  1E1T A;  2BH8 A;  1SRU A;  4JI1 L;  2PQA B;  4XTC S;  1K8A C;  4EX5 A;  4AQY L;  4BY1 H;  5IYD H;  3I55 A;  2R7Z H;  1CKM A;  1VS0 A;  2K5V A;  4R4I A;  3BZK A;  4DV7 L;  1XNQ Q;  1L1O C;  3ULP A;  4HJ8 A;  1KAW A;  1X3G A;  4DV3 Q;  4A3J G;  1UE1 A;  3J81 c;  2Q2T A;  3S2H H;  4X65 L;  1HR0 Q;  4PZ6 A;  5AJ3 Q;  5JJL A;  1VQE A;  2HQL A;  3A5Z B;  1YVC A;  2DGY A;  3BJU A;  3L2P A;  4POG A;  3NEN A;  4DKA C;  3S24 A;  3EN2 A;  4LW1 A;  3RLN A;  4A3K H;  1PH7 A;  3M3Y H;  1YZ6 A;  3MEF A;  4A93 G;  1G29 1;  4UP7 A;  3CCV A;  5FLM H;  1JT8 A;  2KCT A;  2YU9 H;  4FDB A;  3GTK H;  2QA4 A;  3GTL H;  4NXM L;  4A3L H;  1TWG H;  2H5X A;  5M5Y H;  3RNU A;  2JEA I;  3K81 C;  4P75 A;  5FJ8 G;  4A3F G;  1NE3 A;  4A3B H;  4UP8 A;  4DR1 L;  1ASY A;  1YJ9 A;  3CCQ A;  2K14 A;  1E22 A;  1VQJ A;  4BY7 H;  2NZH A;  3A74 A;  4OWX B;  2ASB A;  3UDI A;  4A75 A;  5IYD G;  4JI0 L;  4LF9 L;  2ATW A;  2UUB L;  2N49 A;  1Y1W H;  2KHJ A;  1JJC B;  1H95 A;  3OTO Q;  1PYB A;  1S3O A;  3S1Q H;  1OTC A;  4LF5 Q;  5GQO A;  5C4J H;  1PVO A;  3K7U C;  1QUQ B;  1EWI A;  1P8L A;  3HOV H;  4DR7 Q;  4R1J A;  1Q8K A;  4DAY B;  4YY3 L;  3T1Y L;  2UU9 L;  3BU2 A;  3AQQ A;  1I3Q H;  1N34 Q;  4BXX H;  4DUY Q;  4LWC A;  2D62 A;  3HKZ G;  4GLV B;  5M3M G;  3CME A;  4LF7 L;  5IYB G;  2KEN A;  3J7A 5;  3F2C A;  1FGU A;  4OX9 Q;  4JI5 L;  5IWA L;  4JI8 L;  3F2D A;  1HNX L;  4PZ7 A;  4DR2 Q;  1M1K C;  1Y1V H;  2B29 A;  4JI2 L;  4DR5 Q;  2NVT H;  4YHH L;  1XPR A;  4IJH A;  2F3I A;  1U0L A;  2ZM6 L;  4LF8 L;  4BBS H;  4KI0 A;  1I94 Q;  1A63 A;  3CCR A;  1UE6 A;  4O2D A;  4A93 H;  3M85 A;  4A3D H;  1SE8 A;  3HKS A;  5IP9 G;  2HHH L;  1V1Q A;  3I7F A;  4GNX A;  4NXN Q;  2UXD L;  1KL9 A;  4IFD I;  2JJQ A;  2NVY H;  4WJ4 A;  3ZJY C;  3CAM A;  1TWC H;  3AEV A;  3LGJ A;  4A3L G;  3F1Z A;  4QL5 A;  1N33 Q;  2EQS A;  4DV2 L;  1NJI C;  4B3R Q;  1YI2 A;  4AQY Q;  2E5L L;  4C3H H;  5IT9 c;  4A3G H;  3CP0 A;  1HNZ Q;  1AE2 A;  1B8A A;  1XPO A;  4JBM A;  1C7Y A;  3PCO B;  2VZA A;  1SFO H;  4JI4 L;  3M9B A;  1Q81 C;  2ZJR A;  2Q2H A;  2Z6K A;  3A0J A;  1Q7Y C;  4R4T A;  5IYB H;  1VQO A;  2K4K A;  3JC6 6;  4GKK Q;  2XGT A;  4B3M L;  5FLM G;  1QUQ A;  1Q46 A;  3PUV A;  4X64 Q;  1J5E L;  1KXL A;  4YCU A;  1CUK A;  1VQP A;  1PH1 A;  1HZB A;  4IJL A;  3OW2 A;  2HHH Q;  2UUC L;  4PZ8 A;  1Y14 B;  1N36 L;  1SMX A;  2QEX A;  1A62 A;  1K83 H;  1NTG A;  5C44 H;  1QVF A;  4DPG A;  4PG3 A;  1VQC A;  4IOC A;  3HFZ B;  3J81 j;  1KD1 C;  3S16 H;  4LUO A;  4JOI A;  4QIW E;  1B70 B;  4HIO A;  2PMZ E;  4UP9 A;  1OXT A;  4JI5 Q;  1PYS B;  2R92 G;  3CQZ H;  3VDY A;  2MO1 A;  4LF4 L;  4JYA L;  1EFW A;  3I4N G;  1IYJ B;  4BBR H;  4DUY L;  4IPC A;  4UY8 C;  2K75 A;  2D0O A;  5C4X G;  4A76 A;  2Q2U A;  4JI6 L;  1X55 A;  3HOV G;  5J3B A;  3DM3 A;  4JI3 Q;  3KJP A;  4DR3 L;  1LUZ A;  1VQL A;  4DR7 L;  1ASZ A;  4LNQ A;  1X6O A;  3I4O A;  1XMQ L;  1PHJ A;  2OQ0 A;  4X62 Q;  3PIP A;  1K73 C;  1N32 L;  1KC8 C;  2UUB Q;  4A3G G;  2CFM A;  4LFC Q;  3CCM A;  4JC0 A;  2VL6 A;  3AYH B;  2F52 A;  1I50 H;  1HH2 P;  2KCM A;  3L0O A;  1TWF H;  4A3I G;  3RN5 A;  3D31 A;  2MO0 A;  1PH2 A;  5GAD C;  1N36 Q;  4A3D G;  1MJC A;  1P16 A;  1Q12 A;  5ELO A;  1XMO L;  1NMF A;  4NPS A;  1IBK Q;  3HOU H;  1V43 A;  2JK8 A;  4DK3 C;  2VQE L;  3DLL A;  1K3R A;  4OON A;  3K8A A;  2ZJP A;  1YNX A;  4GN4 B;  4YHH Q;  3NEL A;  4QGU A;  2JA7 H;  4HJA A;  2RHS B;  3TS2 A;  3KF6 B;  1HZC A;  4JG2 A;  2R7D A;  1N32 Q;  4PMW A;  3PIO A;  1CKN A;  2WAQ G;  2VUM H;  2JA8 G;  4KHP L;  1MJE A;  1PFS A;  4MTN A;  2Z0S A;  4WJ3 M;  1I5F A;  3S17 H;  3H0G H;  1E24 A;  1CSP A;  1PV4 A;  4BY1 G;  3KJO A;  3W5O A;  4X66 L;  4LFC L;  4OXP A;  2F4V L;  3HOW H;  3W1B A;  4QJF A;  1UEB A;  4A3J H;  1O7I A;  3KDF B;  1VQ5 A;  1KRS A;  3U4Z A;  4GOP B;  1SR3 A;  3JAM c;  4GKJ Q;  2JA6 H;  3IRB A;  4P73 A;  4GNX B;  3M4O H;  1EYG A;  4C3I H;  4HIM A;  1VQ7 A;  1VQG A;  4DNI A;  3TS0 A;  1KHI A;  2XTI A;  3TRZ A;  2I0Q A;  1XNR L;  1YIT A;  5DLQ E;  1C9O A;  3KLW A;  2PI2 E;  1R9T H;  3W1G A;  2ZJQ A;  2BH2 A;  4JV5 L;  3ICE A;  1BKB A;  3E9I A;  1XPU A;  4KHP Q;  4HJ7 A;  1J5E Q;  1B7Y B;  1Z47 A;  2BA0 A;  2KBN A;  3G48 A;  5EAY A;  2CCZ A;  4BBR G;  3PO2 G;  1IXR A;  3ULJ A;  3EIV A;  4AH6 A;  2KHI A;  4A4I A;  3I4M H;  2UXB Q;  2R6G A;  3EBE A;  1WCM G;  3J81 i;  3PUX A;  3Q8D A;  3CD6 A;  2DUD A;  5C0X G;  4DUZ Q;  1HNX Q;  3H3V H;  4HJ9 A;  1IBM Q;  2MNA A;  1A8V A;  5C0X J;  3GTJ H;  1E3P A;  2OTJ A;  1S40 A;  4LF9 Q;  2IHE A;  4DV1 Q;  1YJN A;  5GRO A;  4YCV A;  3WWV A;  5GAG C;  3PF5 A;  2PNH A;  4DV7 Q;  2GVB A;  4GN5 A;  1X3F A;  4A3C G;  1D7Q A;  2JA5 H;  3PGZ A;  3I4M G;  3D0F A;  2PI2 A;  4DV0 L;  1OXS C;  4JI1 Q;  1VQ4 A;  1SRO A;  3HOY G;  4LF8 Q;  4POF A;  1VQA A;  4P71 A;  4B3T L;  1FJG L;  2LXJ A;  4JI0 Q;  4YWK A;  1PH6 A;  4JBK A;  4DV2 Q;  4B3R L;  3CF5 A;  4LFB Q;  1WFQ A;  4R4Q A;  4QQB X;  5FJ8 H;  1JJG A;  1X9N A;  4BBS G;  5JJK A;  4YCW A;  2UUC Q;  4LF4 Q;  2K5H A;  4L5Q A;  3H15 A;  1XMO Q;  1GO3 E;  1N9W A;  5IYC G;  4A3K G;  4JBJ A;  1PH8 A;  4MNO A;  3CCU A;  4LF7 Q;  2JA8 H;  1A0I A;  4DUZ L;  1HZ9 A;  1CKO A;  1J6Q A;  2OWO A;  4APV A;  1UE7 A;  3UE1 A;  1M90 C;  4JI7 Q;  2WB1 E;  2JA7 G;  1RIP A;  1HR0 W;  3HOW G;  1VQK A;  3HOZ G;  2OTL A;  4Y7N H;  5C3E H;  5C0X I;  1YHA A;  4A3M H;  3RZD H;  5C4X H;  4GNX C;  1XMQ Q;  1Q82 C;  3CC2 A;  1NBW A;  5LMU L;  4X64 L;  1FL0 A;  3HOX H;  3AFQ A;  4X66 Q;  1N34 L;  3PV0 A;  4DK6 C;  4X6A H;  2CWP A;  4JI3 L;  2HIV A;  3HOY H;  4LFB L;  2N78 A;  2A8V A;  1GKH A;  2OCE A;  2R7Z G;  3PO3 H;  4GN3 B;  3TRE A;  5HY6 A;  5IY0 A;  4JCV E;  1TWH H;  3L7Z C;  4MZ9 A;  3GTQ H;  4X62 L;  1L2F A;  5IP7 G;  2GN5 A;  2Z6K C;  5C3E G;  2YYZ A;  3GD7 A;  1K8G A;  3PSI A;  2R93 H;  2EIF A;  1G6P A;  4AYB E;  3GTG H;  4L5T A;  2C35 B;  2NZO A;  1JB7 A;  1L1O B;  1NY4 A;  4DR5 L;  3U4V A;  1QVC A;  2K50 A;  2K5N A;  4DV4 Q;  4DV1 L;  1X56 A;  3S1N H;  1W2B A;  4ALP A;  5JEA J;  3CXC A;  2IHF A;  4IFD G;  3STB C;  3K80 C;  4DV3 L;  2LSS A;  2OQK A;  2RCN A;  1XNQ L;  2AMC B;  3NBH B;  2JA6 G;  4A3E G;  4A3E H;  4QY7 A;  3U50 C;  4A3I H;  4L5R C;  3CW2 C;  4B3T Q;  1HZA A;  1I6H H;  4IO9 A;  4JOI C;  4OO1 G;  5JJI A;  2K52 A;  3H3V I;  4DR4 L;  3MXN B;  4H02 A;  1IBK L;  2E2I H;  4P74 A;  2GVA A;  3HOU G;  2L15 A;  1WOC A;  1DGS A;  4DR3 Q;  4R4O A;  1XNR Q;  2UU9 Q;  1N33 L;  4AYB G;  1VQH A;  1IZ6 A;  4GOP A;  1L1O A;  1OXU A;  3KDF A;  4OWT B;  4DR1 Q;  4A3B G;  2B3G A;  2B63 H;  1KIX A;  4LF5 L;  2B63 G;  3RZO H;  4EQ5 A;  2UXD Q;  1NMG A;  2QGQ A;  5C44 G;  1VQF A;  3OTO L;  2WAQ E;  2EXD A;  2N3S A;  1E1O A;  2LXK A;  1WYD A;  2I5H A;  3GO5 A;  2VQF Q;  2AHO B;  3E9H A;  4KLK A;  2E5L Q;  3TQY A;  3CCJ A;  2R92 H;  5HGQ A;  1HJP A;  2NN6 I;  1SN8 A;  3TEH B;  2WP8 J;  3GTM H;  1VQ9 A;  1MKH A;  3M4Q A;  4TVA B;  4YWM A;  5IWA Q;  3J80 i;  1XJV A;  4AIM A;  4DR6 Q;  1TWA H;  4NXN L;  3S15 H;  4TQU S;  4HIK A;  5M5W H;  4ME3 A;  3I2Z A;  3T1H L;  2YV5 A;  1MIU A;  4GKK L;  1HNW L;  2NVX H;  3K7A H;  1EQQ A;  2NVQ H;  2CKZ B;  3PO3 G;  1WI5 A;  4GKJ L;  1EQR A;  1X54 A;  2FXQ A;  3J7Z C;  4DR2 L;  3PUZ A;  5LMN W;  1Q1B A;  3PUW A;  2VQF L;  2V1C C;  4JI8 Q;  4IPD A;  1EIY B;  2IT1 A;  1CSQ A;  4XIG S;  2JE6 I;  3CPW A;  2VNU D;  2F4V Q;  1Q1E A;  3F2B A;  2UXC L;  5IP9 H;  4DV5 L;  1YBY A;  2JA5 G;  4LUV A;  4YWL A;  2R7F A;  4BA2 I;  1JMC A;  2Y0S G;  2UUA Q;  1RL2 A;  1WCM H;  3B6Y A;  4RMF A;  4JBW A;  2AWN A;  2HT1 A;  5FLX c;  1KRT A;  3GTP H;  2ZTC A;  1VQ6 A;  1EUJ A;  2JQO A;  4NB3 A;  2R93 G;  2A1A A;  1IL2 A;  3KFU A;  4DR4 Q;  5ELN A;  4GLA C;  2ZM6 Q;  2YTY A;  3FP9 A;  1PH9 A;  2VW9 A;  3G71 A;  2PQA A;  5E7N A;  3KOJ A;  2E2H H;  4GOP C;  1UE5 A;  4JI6 Q;  5BR8 Q;  4BXX G;  2RHQ B;  4GS3 A;  1EOV A;  3CC4 A;  3CC7 A;  3JAM i;  4HID A;  4X65 Q;  2IX0 A;  4HJ5 A;  1HR0 L;  4JV5 Q;  2JA9 A;  3AFP A;  3RLO A;  2VS1 A;  3U58 A;  1Y1V G;  1QZG A;  2UUA L;  3M7N A;  4LF6 L;  3HOZ H;  4Y52 H;  4LFA Q;  2AKW B;  5M3F H;  1EIF A;  3PO2 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...