5M3FH

Yeast rna polymerase i elongation complex at 3.8a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
144
structure length
131
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase I subunit RPA190
publication title Structure of RNA polymerase I transcribing ribosomal DNA genes.
pubmed doi rcsb
molecule tags Transcription
total genus 21
structure length 131
sequence length 144
ec nomenclature
pdb deposition date 2016-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m3fH00
3S2DH 5ELOA 4XTCS 5JJIA 1YJNA 4BBSG 1XJVA 5IY0A 2C35B 1VQAA 1KD1C 3RN5A 4LWCA 2UUBQ 1VQ7A 1Q7YC 3GDEA 1QUQB 1KRSA 3ULPA 3K8AA 4DV1L 2D62A 4YWMA 4YCWA 5M5XH 3RN2A 1IBKL 1B70B 1PH5A 4LF9Q 2E5LL 5LMNL 1LYLA 3GTJH 4OX9L 1N9WA 5FLMG 3HOYG 2Z6KC 4X64Q 3JAMc 5C0XG 3CD6A 1RL2A 3S24A 3RLOA 4KI0A 2K50A 1GKHA 2PI2E 4DV4Q 2EXDA 4HJ7A 1N8RC 2CFMA 2WAQE 2N78A 1SR3A 1Q86C 4BBRH 3TS0A 1JJ2A 2JK8A 2K4KA 1A63A 3CP0A 5JEAG 3T1YL 1G6PA 1YJWA 2UXBQ 3UDGA 1IZ6A 3T1HQ 4QGUA 4DV0Q 3CC4A 3RR5A 4AIMA 2MNAA 4PMWA 1I5FA 4A3MH 4ALPA 4LF5L 2BH8A 2KHIA 1SFOH 1X65A 2RHQB 4GNXC 4PZ8A 2BA0A 1XPUA 1K8GA 3CMAA 3KFUA 3NBHB 3ER0A 4L5QA 1IBML 1E7ZA 5AJ3L 2UUAL 2N3SA 4DR6L 3GTKH 4OWTB 3MXNB 5LMUQ 2CWAA 2RHSB 1WOCA 1KIXA 1HNXQ 5FJ8H 4X6AH 5C3EH 1SE8A 3PO3G 1E3PA 4JBKA 3J7ZC 1QUQA 2UUBL 3GTQH 2JE6I 2UU9Q 1QZGA 4ME3A 2E2IH 1L1OC 1NJIC 4R4OA 1K73C 3GTLH 2F4VL 2JA6H 2ZJQA 2R7ZG 4NPSA 2IY5B 4IJHA 4A3DG 4JI4L 1QVGA 3CC7A 2JA8G 4P75A 5IT9c 4GOPB 1YNXA 1SRUA 3D0FA 1YJ9A 2Q2TA 1PH1A 2NVQH 5E7NA 4DV7Q 1TWAH 4DV4L 1FJGQ 2H5XA 2CQOA 1JMCA 3M3YH 1UE6A 1HR0L 4JI1Q 1NMGA 4JI5Q 2UXCL 2UXBL 3U4VA 2UUCQ 2JA7H 3E9IA 4DV0L 4OWWB 3ULJA 5GQOA 2YU9H 1A0IA 2JQOA 1MJEA 5IYDG 4JOIA 1CSPA 5M3FG 4DNIA 4DV6Q 3B6YA 4DV2Q 1S3OA 3BZCA 4LF4Q 2AWNA 4A93H 1V9PA 2VY3A 1S72A 3GTGH 4HIKA 4YHHL 3KJOA 4LFBQ 1W3SA 2R93H 1PA6A 4BA2I 1JE5A 3PO2G 1QVFA 1HNXL 1KXLA 2Q2IA 4LF8Q 4BBSH 4X65L 3CCSA 3TQYA 1K8AC 2D0PA 3J81j 3F2BA 1MIUA 2MO0A 2UU9L 4DR5Q 1XMOL 2BH2A 1PH9A 3CF5A 1IXRA 1V1QA 3KYHC 2E5LQ 3PF4A 4LF7L 5LMNQ 2Q2HA 5C4XG 4FDBA 3PV0A 3TREA 3W1BA 2I0QA 4OX9Q 1E22A 2LSSA 1Q12A 3HOYH 4X62Q 3GTPH 2ZTCA 2R7DA 2AWOA 1E24A 2K5VA 2XTIA 3PGZA 4P74A 2NN6I 4PZ6A 4DK3C 1GM5A 2OTLA 1FJGL 1PFSA 2Q2UA 4DAYB 5GAHC 2EQSA 4B3SQ 4NXMQ 4JI1L 4YCUA 1I3QH 1R9TH 3CC2A 4JI5L 3I4NG 4A3EG 1Z9FA 4A3CG 1B8AA 1UE1A 1NE3A 3H3VH 2WB1G 1CSQA 1JJGA 3A5ZB 4C3HH 2N49A 3PCOB 1EQQA 1S40A 2PMZE 3CCMA 3EBEA 4EX5A 4DUZQ 4DPGA 4DV2L 2E2JH 1A8VA 1LUZA 2ASBA 4A93G 1IBMQ 2UUAQ 1BVSA 5M5WH 2ZJRA 4OO1I 3CQZH 3CCRA 2ES2A 2R7FA 3G48A 4BA1I 1EUJA 3I4OA 5IYBG 3CCUA 4HJ8A 1M90C 3S1MH 3HOUG 3TS2A 4GKJQ 2MO1A 5M5YH 4NXNL 1GO3E 2F52A 1WFQA 2EIFA 2QGQA 4GN4B 4LF8L 1PYSB 4JI0L 3Q8DA 2VW9A 2JJQA 1VQ9A 3PO3H 4DR5L 2Y0SG 3HOWG 4GLXA 1NY4A 4O0AA 4BY7G 1BKBA 2F4VQ 3AQQA 4AH6A 1UE5A 4MZ9A 4JI4Q 3I4MH 2R7ZH 3FHWA 1OXVA 1X3FA 3DM3A 1HJPA 4AQYL 1XNQQ 2JA8H 4JI2Q 2NN6G 4A3DH 3S2HH 1Y1WG 4HIMA 4LNQA 1SROA 4LUZA 4X62L 4JI3Q 3NEMA 1YBYA 1WI5A 4IPDA 3KF6B 2VUMG 2IX0A 3NELA 4UP8A 4R4IA 4B3RL 4B3SL 3PUZA 1PH8A 4H02A 1CKOA 1HR0Q 4NXML 3KLWA 5HY6A 4A3IG 4EQ5A 4DR4Q 4AYBG 2UXCQ 3M85A 1KL9A 1IBLQ 4JI8L 3BJUA 2GVAA 5IP7G 4GKKQ 2CCZA 3J80i 4R4TA 3I56A 1YI2A 4MNOA 3G4SA 4J15A 1PH7A 5IYDH 1JJCB 1SLJA 5M3FH 4DUZL 4OO1G 2DUDA 4A76A 1ASYA 4YY3Q 4UP9A 3HKZG 1PH4A 1IL2A 1J5EQ 1UWVA 3CMEA 3CW2C 2YTVA 4YHHQ 2IX1A 4NB3A 4GKJL 4OWXB 1HR0W 1FGUA 1TWHH 3IRBA 4GN5A 4IPCA 4JOIC 4GNXB 3PO2H 1PH6A 3PUVA 2CKZB 4A3GG 4X65Q 2R92G 2OCEA 1HNZL 1E1OA 1N34L 4UY8C 1XMOQ 4RG1A 3SGIA 1C7YA 4A4IA 3I4MG 1NTGA 3H0GG 3KF8B 3LGJA 4LF7Q 1AE2A 3F1ZA 3EIVA 5DLQE 5C4XH 2MQHA 3J81i 1YHQA 1XNQL 4LFBL 1VQEA 1DGSA 4JI2L 1OTCA 1MKHA 1SN8A 4IOCA 2OWOA 4POGA 4JI3L 3AEVA 4A3LG 3KF6A 1JB7A 4TQUS 4HIDA 5J3BA 2RCNA 1T9HA 1WCMG 1W2BA 4DR4L 3G6EA 1XPOA 1IBLL 4R1JA 1P8LA 1M1KC 4LFAL 1YHBA 4A3EH 3I4NH 4JV5Q 1Y1VG 1VQ8A 1OXTA 2YTXA 4A3CH 1HZAA 3M9BA 4GKKL 5C4JH 3BZKA 3RZOH 4C2MH 3K81C 4YWKA 1MJCA 4QL5A 2XGTA 1Q46A 5IE8A 1Y14B 4APVA 4YY3L 2ZTDA 4HJAA 2VNUD 2KCTA 1J5EL 1VQCA 3ULLA 3PUXA 3CCLA 4KHZA 1VQKA 3J80c 1I50H 2CWPA 1XTDA 1VQ6A 5IYBH 4NXNQ 3HOUH 1C9OA 2B3GA 2WFWA 4JI0Q 3STBC 1IYJB 2JA5G 1OXSC 1FVIA 2E8GA 4DV5L 4IPGA 3ERSX 3S17H 3K7AH 2AKWB 3KDFB 1EFWA 1TWCH 3RNUA 3HOWH 4BY7H 1PVOA 4WJ4A 2QA4A 2D0OA 2UXDQ 1KQSA 5IP9G 4GOPA 4AQYQ 4IJLA 1KHIA 1EWIA 1LTLA 1PYBA 3PSIA 1PV4A 1EIYB 4DKAC 1X9NA 4DV3L 1Y1WH 1TWFH 2IT1A 3UDFA 2VUMH 1N32L 3J81c 3PUYA 1YIJA 4HJ9A 3D31A 4JI8Q 3UDIA 5M3MG 4DR3L 1EIFA 3VDYA 1X3GA 4A3IH 1Z47A 4GN3B 3S1QH 4JV5L 2ZM6Q 3H15A 2HQLA 4YCVA 5IP7H 2JA9A 4PZ7A 5LMNW 3GD7A 5GAEC 2OTJA 4B3TQ 3CCJA 2K52A 2NVYH 3FKIH 2B63G 1VQDA 3K7UC 1VQMA 3E0EA 3S1RH 2WAQG 5IWAL 2HHHL 4QIWE 1FL0A 4BXXH 1VS0A 4A3FG 4LF6Q 3S14H 4GLVB 2OQKA 3U4ZA 3M4PA 2ATWA 4R4CA 4L5RC 3AFQA 3STBD 3PF5A 3RZDH 3HKSA 4LW1A 2N8NA 1VQHA 1HNZQ 4YWLA 2VQFQ 1VQLA 1N34Q 4JI7L 4IFDG 2R92H 2VZAA 4A3GH 3L7ZC 4JYAQ 3KDFA 2K14A 4LFCQ 4K0KL 1TWGH 3HOVG 4JBMA 3K80C 5H1SE 3WWVA 4X66L 3H0GH 1VQ4A 4JI6Q 1SMXA 1X55A 4DR7Q 2UXDL 4B3RQ 4Y52H 1BBUA 3AFPA 1X56A 3G71A 4A3KH 2NVXH 3TRZA 3ZJYC 2VQEQ 4UPAA 2QEXA 4RMFA 1HH2P 4LUVA 2DGYA 1LM0A 4A3LH 1K83H 4XIGS 2LXKA 3PUWA 1XPRA 1AH9A 1E1TA 1UEBA 1AE3A 2OQ0A 1WCMH 1QZHA 5JJLA 1HZ9A 2JEBI 3K0XA 1V43A 3M4QA 4LFAQ 5C44H 1N33L 3M7NA 1K9MC 2ZM6L 1VQ5A 4A75A 1UE7A 4L5SA 4IPHA 1Y1VH 1OXUA 2VL6A 3GO5A 1PHJA 4BY1G 1XNRL 3HOZG 5JJKA 1G291 2WB1E 1NBWA 2YYZA 3FKIG 4B3TL 2YTYA 4LUOA 3E9HA 5IYCG 3A0JA 4BXXG 1VQFA 2I5MX 4A3BH 1NMFA 2K75A 4MTNA 1VCIA 2ZJPA 3RLFA 4LF6L 3CPFA 3KOJA 1EQRA 4QJFA 3A74A 1A62A 4C3JH 1OXXK 4O2DA 4HJ5A 4DV5Q 2VQFL 5K36G 4B3ML 2E2HH 2JA5H 4JYAL 2NZOA 4QY7A 4DR2Q 4LFCL 1EYGA 4IOAA 4WJ3M 4DK6C 1CUKA 4A3JG 3U58A 2Y0SE 1PH2A 3I55A 3OW2A 4DUYL 3L0OA 4Y7NH 4JI6L 1L0WA 5BR8Q 4A3KG 1KAWA 3HFZB 3UE1A 2AMCB 1G51A 1Q82C 4DR7L 2YV5A 2A1AA 4P71A 5IP9H 4IO9A 1VQPA 1L1OB 2VQEL 2GVBA 4DV3Q 1XMQQ 2KHJA 2NVTH 5GAGC 2KBNA 3S15H 1Q8KA 4DR1Q 3A5UA 3L2PA 1QVCA 2KENA 2Z6KA 3OYYA 3S1NH 1I6HH 1N32Q 1ASZA 5GADC 5C44G 3GTOH 4QQBX 4DR3Q 4GOPC 2A8VA 1YEZA 1HNWQ 4P73A 4AYBE 1N36Q 5M3MH 1D8LA 3CCEA 2PQAB 4LF9L 3GTMH 1I94Q 1HZBA 3F8TA 1X54A 1KRTA 3KJPA 3CCQA 4KLKA 2F3IA 1KC8C 4JCVE 4X64L 3MEFA 3CPWA 3W1GA 4A3BG 2IHEA 2B63H 1O7IA 5IWAQ 2HHHQ 3HKZE 4BBRG 3HOXH 3JC66 1YZ6A 4GNXA 5FLXc 1PH3A 4A3FH 3ICEA 3M4OH 4KHPQ 4P72A 4A3MG 2LXJA 3EN2A 4DAMA 3T1HL 1YHAA 1EOVA 4JI7Q 1C0AA 2ZTEA 1J6QA 2BA1A 4DR2L 4K0KQ 3UDXA 3RLNA 1CKNB 2VS1A 1H95A 2PNHA 3W5OA 2PI2A 4X66Q 3HOVH 4IFDI 1K3RA 3AYHB 1Q1EA 5BR8L 3F2DA 1GVPA 1CKMA 1L1OA 2HIXA 3S16H 2HT1A 1B7YB 1RIPA 2JEAI 2L15A 4TVAB 3OTOQ 1XMQL 3J7A5 2HIVA 1YITA 4JC0A 3PIOA 3F2CA 3I7FA 2K5NA 5LMUL 4DR1L 2I5HA 1BBWA 5FJ8G 4PG3A 5C3EG 4IFDJ 1X6OA 2A19A 2FXQA 3TEHB 1VQBA 2Z0SA 3DLLA 2WP8J 4GLAC 3JAMi 2IHFA 5GROA 1HNWL 2ID0A 4UP7A 1N33Q 1VQJA 3CXCA 2PQAA 5EAYA 4DV1Q 1Q1BA 1N36L 2KCMA 1IBKQ 1WJJA 1XNRQ 2JA6G 4JG2A 1K0RA 1I94L 3HOZH 5ELNA 4HIOA 4BY1H 2NZHA 2K5HA 5HGQA 3FP9A 4R4QA 5IYCH 5FLMH 1P16A 2V1CC 3HOXG 3PIPA 4DV7L 2RF4A 1VQOA 5C0XI 4KHPL 2R6GA 4C3IH 3U50C 3T1YQ 1JT8A 1L2FA 1VQNA 4POFA 2JA7G 3CAMA 4JBWA 2UUCL 3NENA 3UE0A 1D7QA 2MFIA 4OONA 4B3MQ 1YVCA 2B29A 1CKNA 5C0XJ 4LF5Q 3H3VI 2I5LX 1WYDA 4JBJA 1U5KA 1VQGA 3BU2A 4DUYQ 4DV6L 4L5TA 4A3JH 1Q81C 4GS3A 4OXPA 1HZCA 4LF4L 1VQIA 1U0LA 3I2ZA 5JEAJ 5AJ3Q 2AHOB 3CCVA 2R93G 1TXYA 1X3EA 3OTOL 4DR6Q 2ALYB 2GN5A 1GD7A
chains in the Genus database with same CATH superfamily
5ELOA 5LL6S 1ENFA 2EOTA 5IY0A 1KD1C 3RN5A 5HGTA 1Q7YC 1QUQB 3UI2A 1DOKA 5D65A 1SFOB 2D62A 1WTWA 1IBKL 2E5LL 1HQRD 2KJXA 3CU7A 4OX9L 2PCFB 2Z6KC 2M2LA 3V05A 3CD6A 3RLOA 1NNXA 1Q86C 1JJ2A 3TS0A 3T1YL 1G6PA 3H6MA 1YJWA 2E2IB 3J80E 3AB9A 5JPMC 1EWCA 3CC4A 4AIMA 1LT6D 3Q6SA 4ALPA 1XX8A 4C3HG 1STNA 1Q90A 2BH8A 3AU7A 1EYCA 2KHIA 1SFOH 1X65A 4G4KA 1S5BD 2OF1A 3KFUA 2A6HC 1IBML 1WOCA 2N88A 2JA7B 2IWHA 1PZKD 5FJ8H 4X6AH 2KCCA 3FEWX 3DMUA 2UU9Q 1BO0A 5LL6X 2E2IH 1VF5C 3J81E 1RTNA 1SMYC 1SYEA 1G91A 4JI4L 1QVGA 4XT3B 2JA8G 3DUZA 5IT9c 1E2ZA 3NWTA 1MD2D 4QUCA 4DV7Q 2F0LA 4DV4L 1IHZA 4BBSB 1JMCA 5BN4A 1IW7C 3KUPA 3LWUA 2RSNA 3N6RA 2JA7H 1QNUA 5IYDG 4JOIA 1CSPA 4DV2Q 4LF4Q 1K8MA 2A6HD 3A56A 3NBHA 4X3UA 3BVZA 1AZQA 1S72A 3MXNA 1LTBD 1D5ZC 4YHHL 1PA6A 1EU4A 1GUWA 2AUKA 1KXLA 1BNZA 3T4AC 1HFGA 4BBSH 1K8AC 2BH2A 4DR5Q 1SMYD 4MTKA 1IXRA 3KYHC 5M9OA 5DNFA 1Q12A 1ZEQX 1O7YA 3MTSA 4H0LC 2EJFC 5C0XH 2R7DA 1E24A 2K5VA 1FJGL 2Q2UA 3HP3A 2EQSA 3CC2A 4JI5L 1KDBA 3K58A 5JEAH 3OHXC 1FR3A 3X3MA 1NE3A 1CSQA 2F0DA 2G9HD 4RGTA 1O78A 1BUVT 4XQNA 1CZWA 3MEHA 3I8ZA 1DOLA 4K5VA 4OO1I 2R7FA 3G48A 3CCUA 1EUJA 4LFBL 1D6EC 2MO1A 2XN9C 1GO3E 1HTPA 4KKUA 4LF8L 4JI0L 4V190 2KOLA 2JJQA 4BY7G 1BKBA 5M3FB 4M8AA 1UE5A 2K05A 3DM3A 4WJWA 4K2LA 4EQPA 2NN6G 4G57A 1Y1WG 1EZ8A 4JI3Q 3PQIA 1RF2D 2IPKD 3FVQA 3NBIA 2BDOA 4R4IA 4B3SL 2CW0C 5KEEA 1HR0Q 5HY6A 4AYBG 3VA5A 4TRDA 3J80L 2A68D 1WD0A 4HSVA 2IL8A 4U673 1CZGA 2RQXA 4DUZL 5M3FH 1F9QA 2ZXPA 3HKZG 2FINB 2EJMA 4HTHA 1IL2A 2YTVA 2IX1A 2EE1A 2K1BA 2K33A 4OWXB 1B53A 4ILWA 1HR0W 4A3EB 1TU2B 3RZOB 3OW7A 1N34L 4C2MB 5ELCA 1XMOQ 4RG1A 1STGA 3CKIB 1C7YA 3H0GG 2K28A 4C56C 3J81L 2A5HA 4A93B 1AE2A 1YHQA 1QOHA 2J7ZA 4J6HA 2WAQB 1RCVD 4HR7B 4IOCA 2OWOA 3AEVA 5AFWA 3J7AF 4KKSA 4A3LG 1PTOF 2F4IA 5I6YA 3HOUB 5J3BA 4DN4M 2E76C 1WCMG 3G6EA 1XPOA 1IBLL 4R1JA 1Y8PB 5IGFA 1M1KC 3K7AB 2Y0SB 4A3EH 4HEDA 1FD7D 1OXTA 3RZOH 1H9SA 4C2MH 1II3A 2SOBA 2RDHA 5IE8A 4EVOA 4HJAA 2KCTA 2FJ2A 1DJRD 5JJZA 1V1PB 2VUMB 1XTDA 3QR8A 4A3IB 4NXNQ 3HOUH 1C9OA 2B3GA 3I90A 1W6KA 2WFWA 5E3FA 4DV5L 1A6XA 1TKWB 4IPGA 4ZLTF 3D4WA 1A2UA 3K7AH 2AKWB 1U9RA 2EY5A 2KEEA 3KDFB 2QA4A 1JCKB 4GOPA 1ET9A 4CHTB 1G2TA 3S14B 3GV6A 2A6ED 2OT2A 4DV3L 1R4PB 1YNJC 2VUMH 3DHQA 1N32L 1TS3A 4HJ9A 4A3IH 1G2SA 2TSSA 4PNYA 5M3MG 4GN3B 2ZM6Q 3D8GA 4KD3A 3H15A 3MAQA 5IP7H 2B2WC 2SDFA 3SHLA 3CCJA 1K0SA 3DEPA 2WAQG 1K83B 3S14H 1LT5D 3M4PA 1UEAB 3PF5A 1CK1A 3HKSA 1EOTA 2N8NA 1Y1VB 1HNZQ 4YWLA 2PQEA 1RDPD 4JYAQ 1HRJA 3MXUA 3HS0C 2L12A 1VQ4A 2A73B 2UXDL 4Y52H 4B3RQ 1BBUA 1H9JA 3ZJYC 3A8JE 1YNJD 2NUCA 4RMFA 4G7HC 3IAYA 5EKLA 4LUVA 2DGYA 1LM0A 3DEOA 1K83H 1EZ6A 2LFNA 4XT1B 2E2HB 2JA5B 1AE3A 4ZCKA 1QZHA 2K5QA 1I4GA 4CGYB 1K9MC 1VQ5A 4IUPA 2LS01 1Y1VH 4N8X1 3M4YA 1NBWA 2YTYA 5IYCG 2NVTB 1SEBD 3A0JA 2RCFA 1VQFA 2I5MX 1VCIA 3RLFA 1FNWA 4LF6L 1EQRA 4L6TB 3A74A 1A62A 4O2DA 1GHKA 2CHBD 4B3ML 2E2HH 2JA5H 3K6OA 5E1FA 4DK6C 4DNRB 2Y0SE 4FF2A 4JI6L 3NSWA 3E5SA 5T1GA 4DR7L 3IL8A 1KAWA 1PTOD 2ICIA 2NVTH 3A5UA 4UHVA 2Z4IA 1QVCA 3OYYA 3WDNA 4F88A 1ASZA 1EY4A 1MBYA 4DR3Q 2A8VA 1H9KA 3U9OA 2PQAB 1WVLA 3F8TA 3S16B 1KRTA 3CCQA 1LLRD 4I7ZC 2PZWA 3MEFA 4QUFA 1EL0A 2ZXOA 1AW7A 1SYFA 1YZ6A 2XRSD 4IUQA 4GNXA 4ULLA 4KHPQ 1NSNS 2F1MA 1DZ1A 4JI7Q 2CQAA 1UUPA 1F2LA 3RLNA 1CKNB 2PNHA 5DAUA 4X66Q 4IFDI 5BR8L 1IKLA 5CC4A 3S16H 2L15A 1BCPB 2HIVA 2O5IC 3K5LA 5C3XA 2I5HA 4PG3A 5C3EG 4CJ0B 2CVRA 4GLAC 4K6DA 4G7OC 1E0BA 5GROA 1QB5D 4UP7A 1N33Q 3CXCA 5EAYA 1Q1BA 1XNRQ 3KLSX 4K8IA 4Q5VA 2K5HA 4F87A 4R4QA 2P5ZX 3BVMA 5FLMH 3K5OA 5EJWA 4DV7L 1QJOA 1QILA 2F0SA 5C0XI 1H9MA 1VMPA 1GUSA 2B2YA 2R6GA 1JT8A 4ZYSA 4JBWA 2F0HA 3J7AV 2MFIA 5K36H 2PO4A 3GTJB 2I5LX 4XXEA 4ID6A 1WYDA 4CDEC 1Q81C 4DUYQ 4HMIA 1DYQA 4LF4L 3MXPA 2R93G 4BBRB 5IODA 4JC0A 2AQ3B 2ICEC 3DWAA 4A3MB 1VQAA 4LWCA 3TSSA 2Q8RE 3GDEA 1KRSA 3ULPA 4DV1L 4YWMA 1B70B 4N9TA 1HXYD 2DNCA 3OPOA 4B9WA 3GTJH 5FLMG 3HOYG 2PZTA 1EFID 3JAMc 4KK7A 2B2UC 4KJNA 1HA6A 2K50A 2B2WA 2PI2E 2CFMA 4BBRH 2JK8A 2K4KA 1A63A 3CP0A 1GUOA 1LTID 1ICFB 1I4QA 3TN2A 1LTAD 2UXBQ 1RKNA 2MNAA 4A3MH 1WD1A 4PMWA 4FNFA 2F3WA 4LF5L 1STHA 1R4QB 2Z1CA 4FF1A 3WOFA 2NVQB 3CMAA 2WKCA 2N3SA 3PIP3 4DR6L 4OWTB 2D2CC 2CWAA 1PXUA 2RHSB 3SR1A 1KIXA 3I72A 2F0VA 3PO3G 1E3PA 2YU9B 2UUBL 1S5DD 1QZGA 1NJIC 4DAPA 5FO8B 4R4OA 1PDQA 1K73C 2R7ZG 4NPSA 4IUNA 1MSHA 1DCZA 4GOPB 2ZT9C 1SRUA 1YJ9A 2NVQH 1PH1A 1NAPA 1T5EA 4DK1A 4DNTB 1HR0L 1NMGA 2G9DA 3E9IA 4DV0L 4OWWB 3ULJA 3LX0A 5GQOA 2RKSA 1A0IA 1TR5A 5EQ0A 2YU9H 2JYOA 1SE4A 2XIWA 2KECA 5EBDA 4KD4A 3ND8A 4L63B 1V9PA 1EYAA 4FVMA 5E4XA 1R9TB 1I3QB 1W3SA 4BA2I 5K5PA 5D3IB 1HNXL 2HD3A 2Q2IA 4H13C 1EEID 2N55A 5KGUA 1WTPA 3TQYA 4FXDA 2D0PA 4C3HB 3GQBA 4BS9A 1XMOL 3NXWA 3CF5A 2E2JB 2TMPA 2GA4B 3P75A 2Q2HA 5C4XG 3PV0A 3W1BA 3A54A 1E22A 2LSSA 4HSPA 4X62Q 1AZPA 2AWOA 4DK3C 1U4MA 1OTCA 4PZ6A 4HCEA 2QEJC 5GAHC 1JE4A 4RCOA 4LK1C 4JI1L 1R9TH 1I3QH 4NXMQ 1BOSA 3I4NG 2XNAC 1Z9FA 2VXWA 1B8AA 1PFMA 1SBBB 3IFDA 1X32A 3S2HB 4RGOS 4C3HH 2JA8B 3PCOB 2E2JH 3I91A 2ASBA 4GZYC 1A8VA 1XWEA 3BYYB 5C5LA 1BVSA 2CH4W 3TMEA 3V2TA 3I4OA 1M90C 4GKJQ 1BQQT 1CM9A 1GHJA 4NXNL 5EKKA 2F52A 2EIFA 2QGQA 4GN4B 5JVH3 1NR4A 1SSOA 5KYLA 3HOWG 3QG1A 4K14A 2F4VQ 3EQLC 4FYDA 2MUYA 1OXVA 3S2HH 2JA8H 2EYOA 3HG9A 1BDOA 3HZXA 5I2XA 2A69D 3NEMA 3NK9A 1TWHB 2MHVA 4DAYA 2J0TD 3KF6B 3R2TA 4MHEA 1B50A 1G6ZA 3KLWA 1F77A 2FHTA 4EQ5A 1SDFA 2AUJD 4FXKC 3FPPA 3J80i 4KY7A 1YI2A 4MNOA 5IYDH 3F2UA 2RDGA 3T56B 4A76A 1ASYA 4UP9A 1PH4A 1ZXTA 4IALA 4OGQC 1J5EQ 3PMFA 3CW2C 3R8BA 2IJ0A 4GN5A 1TWHH 3IRBA 4GNXB 3VR2A 1H9RA 2ZXRA 1SYCA 2JN4A 4X65Q 2R92G 1HNZL 4A3GG 1RHPA 3SGIA 1PRTB 3VYSA 5DLQE 1XNQL 2MQHA 3J81i 3IKJA 1VQEA 4JI2L 5DEHA 4POGA 5CMDA 2I07B 4DR4L 4LAAA 2B2UA 3FRPB 4JV5Q 1TWCB 4BY7B 4GKKL 3BZKA 2K04A 1CA5A 1RTOA 1MJCA 1Y14B 1SNQA 1Y1WB 4YY3L 2ZTDA 4B08A 2PZUA 1Y8NB 3ULLA 4KHZA 4AYBB 1A3UA 2F0TA 4RA8A 3ERSX 5J39A 1KNAA 4WRDA 3T51B 1EFWA 1TWCH 3FKIB 4BY7H 4XYOA 2D0OA 4AQYQ 3T16A 3HKZB 3NPPA 4IJLA 1KHIA 2HDMA 2KHSA 2RVLA 4DKAC 2NN6H 1STEA 1LO5D 1Y1WH 1TS2A 3RZDB 1IW7D 2ENBA 1S4ZA 2K6AA 5KNDA 3D31A 4JI8Q 4DR3L 1TWGB 3OIPA 1X3GA 1Z47A 1A15A 1CQVA 2HQLA 3H0GB 4PQXA 2EXZA 1SYBA 5GAEC 3P20A 3CHBD 4NMZA 3R93A 4B3TQ 4DF7A 2OTJA 4F8MA 3FKIH 1PYWD 1V8QA 1VQDA 5IGCA 3SVMA 3K7UC 2F0GA 3E0EA 1WTRA 1PFBA 1FL0A 1VS0A 4A3FG 4GLVB 2OQKA 1CHPD 1WCMB 4L5RC 1JOQA 3AFQA 3RZDH 2F03A 1VQHA 4JI7L 4IFDG 1JOKA 2VZAA 3L7ZC 1TWGH 1S5CD 3HOVG 4I7AA 5D14A 4X66L 2NB0A 5FK9C 3H0GH 4XQQA 1SMXA 2K7VA 3AFPA 3G71A 4A3KH 2VQEQ 1HH2P 1EEFD 5CBAE 5IT9E 4EQOA 4A3LH 4XIGS 3PUWA 4L8JA 2PNRC 1UEBA 1SYGA 4IUVA 1WCMH 1V43A 1N33L 2G5DA 3D6WA 4L5SA 1UE7A 1XNRL 1OXUA 3GO5A 4BY1G 3QOLA 5JJKA 3L9AX 3FKIG 4KV6A 4LUOA 3E9HA 3HEJA 3I3CA 3C2PA 4EQNA 3VYRA 1NMFA 2K75A 4MTNA 4WFN3 3PIO3 2ZJPA 1I6HB 4C3IG 4CJ1B 1LV9A 1YNNC 5M3MB 1OXXK 1A2TA 2VQFL 4CDFC 4QY7A 4LFCL 1PTOH 2BE5C 2M00A 1PH2A 3OW2A 4DUYL 1L0WA 1WTHA 4A3KG 1KLGD 3UE1A 1B9MA 4WJ4A 4IURA 3KLRA 3HOXB 1L1OB 1Z7TA 2KBNA 1Q8KA 3ITPA 2LMCB 2CW0D 2KENA 1PRTC 2Z6KA 1I6HH 1B9NA 1WTVA 5GADC 1OO9B 5L37A 1ICWA 4AYBE 3Q23A 1N36Q 5M3MH 4UDUC 3CCEA 4NP5A 1HZBA 5J1ZA 5FKAC 1KTKA 2F3IA 1EIHA 4JCVE 2F0KA 5JPNC 1VDZA 2HHHQ 3HKZE 3HOXH 5FLXc 1FYCA 2F0WA 1RODA 2LXJA 4R8NA 4DAMA 1C0AA 2BA1A 4DR2L 4K0KQ 1E2WA 3KF8A 4K5WA 2VS1A 1HFNA 3W5OA 3KK7A 1GVPA 4DA2A 2HIXA 1K3BC 5ELDA 2HT1A 1B7YB 1RIPA 3OTOQ 1XMQL 3J7A5 1YITA 3PIOA 3A7AB 1JWSD 1D1KA 4DR1L 2KCNA 3OMCA 1V1OA 2B2TC 2A19A 2FXQA 3SK6A 3TEHB 2Z0SA 4O1NA 1HNWL 1KDCA 3K5MA 3VR5A 2JA6G 1IBKQ 1ZYRC 4JG2A 2F0QA 1I94L 5ELNA 5KIXA 4UAIA 5IYCH 3S2DB 3HOXG 2OXPA 2F0EA 2R61A 1VQOA 1JB3A 1STYA 2QKIC 3T1YQ 4KMUC 3U50C 4R8IA 4POFA 4DXFA 1X3QA 1D7QA 1YVCA 4JBJA 1U5KA 1VQGA 3DWQA 3R3OA 5EPLA 4GS3A 4OXPA 1T5XD 2QF7A 3VR6A 3ZYYX 3NTHA 1TXYA 1X3EA 3OIQA 2ALYB 2GN5A 1E2VA 1GD7A 5IT9L 1A3TA 3S2DH 5JJIA 1YJNA 1XJVA 2F0IA 2C35B 3KBXA 4RHSA 1O7LA 2F0JA 3K8AA 2PMZB 4YCWA 3RN2A 1PH5A 4LF9Q 2NWGA 3EA6A 3TP7A 1LYLA 2D9UA 4QIWB 1N9WA 2RBMA 3GTKB 3Q0AA 1SXTA 1RL2A 1VMCA 2LY7A 2EYMA 5T1IA 2EXDA 4CDCC 5C3EB 4DV4Q 1N8RC 1BXTA 2WAQE 2N78A 1O7ZA 2Q8IB 3UDGA 1CTMA 3T1HQ 3RR5A 1SAPA 4JVZA 4ODGA 5TSSA 5A35A 1ENAA 1MSGA 3DM1A 5I4DA 4H7BA 1HUMA 3V96A 4C1NK 2RHQB 1XPUA 2BA0A 1K8GA 4QF4A 2HDLA 5CV7A 1TWAB 4QMGA 2WINB 3NBHB 1E7ZA 5AJ3L 3M3YB 3GTKH 3MXNB 2JXMB 5C3EH 4QCLA 1SE8A 4JBKA 1QUQA 4CKCA 2HUGA 2JE6I 1L1OC 5BN5A 1PMRA 2F4VL 2IY5B 2NBFA 4IJHA 5KRUA 1SNOA 4A3DG 3CC7A 4RHRA 1BF4A 3MA2B 3GTGB 3D4RA 2R93B 5EPKA 4XQJA 5A2QE 1TWAH 4CJ2C 1FJGQ 3P1HA 3M3YH 1LT4D 1LTRD 4JI5Q 2BDNA 4OIJA 5C4ZA 2JQOA 2F0NA 1CHQD 4Z9CB 3MWYW 5EPJA 3N52A 4DV6Q 3HOYB 1S3OA 3BZCA 3GTPB 2AWNA 1D5XC 3GTGH 3ND9A 3NP8A 3KJOA 4LFBQ 2R93H 5CV5A 2O4XA 3PO2G 1QVFA 4LF8Q 5ELFA 5KNCA 4X65L 2UU9L 1HQMC 3J81j 2MO0A 1ESFA 1PH9A 1KNEA 4ZKBB 1V1QA 3PF4A 3EJIA 5LMNQ 3TREA 2I0QA 5M5WB 2DY7A 3CQZB 3HOYH 3MFYA 3GTPH 2ZTCA 2NYZD 5M5YB 2XTIA 4P74A 5JAVA 2NN6I 1I6VC 3E3XA 2OTLA 2IX3A 1PFSA 3TDQA 4B3SQ 3TZDA 1SE3A 3PO3B 4A3CG 1UE1A 1DM0B 1Z6HA 3H3VH 1ILPA 2WB1G 2R7ZB 2WV6D 4RKBA 1EQQA 1S40A 1FNUA 2PMZE 3CCMA 4DUZQ 4DV2L 1LUZA 4OO1H 2UUAQ 5M5WH 4K2KA 1EU3A 3CQZH 1XYIA 2ES2A 4BA1I 5IYBG 1LT3D 5M5YH 4HMJA 4JPBW 1PYSB 5FOBB 3Q8DA 1VQ9A 3PO3H 4DR5L 1HHVA 1NY4A 4O0AA 2B2TA 2EY1A 1D1IA 1BCPF 2B2VC 4MIUA 4AH6A 4MZ9A 2R7ZH 1X3FA 1HJPA 4AQYL 1D5MC 3P7JA 1SROA 4LUZA 1YBYA 2WIIB 2I46A 3MHBA 4UP8A 1K28A 3PUZA 1PH8A 3MVVA 4PMBA 2UXCQ 4B9XA 1KL9A 4DXGA 1IBLQ 5CR3A 4JI8L 3BJUA 1JICA 3SXHA 2DN8A 3GP7A 3I4LA 5C4XB 4OHJA 2LKVA 2DJFC 1H9SB 1SLJA 4OO1G 4NDXA 4S3SA 2PYKA 4IN3A 3CMEA 1FNVA 4NB3A 2JP1A 3I4NB 4JOIC 5I9PA 1PH6A 2CKZB 3E6ZX 1E1OA 3IFTA 1NTGA 3KF8B 3LGJA 4LF7Q 2NTSA 5CBEE 2XVSA 3F1ZA 3EIVA 2E74C 5C4XH 5COYA 3TP5A 1MKHA 1SN8A 1SNPA 4JI3L 2PPBC 1JB7A 4V0BA 4F7XA 1GOZA 1P8LA 3A8KE 2XRQD 1YHBA 3Q22A 3I4NH 3HOWB 5CV8A 4CBVA 1GUGA 1HZAA 4PV1C 3BYTB 1Y8OB 3TBIB 1TY0A 1Q46A 1TWFB 4APVA 2VNUD 4RFBA 1VQCA 2EYFA 2XWJB 3CCLA 1VQKA 3J80c 3K57A 3A55A 2JSOA 4CKBA 4CDDC 3HRZC 3STBC 1IYJB 4RGMA 2EPBA 1CA6A 2C5CA 1BCPC 1EY9A 1X3PA 4JK1C 3HOWH 2UXDQ 2B8GA 1KQSA 3G7LA 5IP9G 3S1RB 2EYJA 2FMMA 1EWIA 3M7GA 5CGKA 3BDCA 4X3KA 1TWFH 2J4XA 3JAME 2BOSA 2IT1A 4A3GB 2R92B 3J81c 3UDIA 3VDYA 1KAAA 1DXMA 4YCVA 1JC7A 3MC0B 3GD7A 2NVXB 2Z6BA 4ABNA 3QWNA 2B63G 4H44C 3T13A 4DK0A 1V1PA 3S1RH 3G6JB 2HHHL 3BDLA 4KJOA 1DD2A 4LF6Q 2EYLA 4I65A 3SK5A 4JW0A 1K8OA 4TKOB 5C44B 3STBD 2X6LA 1VQLA 1BCPD 4A3GH 2R92H 2FFKB 4K0KL 3KDFA 2EYPA 1JR0D 4JBMA 2WACA 4Q0FA 2SEBD 3H94A 5H1SE 3EROA 3VR4A 4JI6Q 4DR7Q 1CT1D 4FO2A 1X56A 2NZ1D 2NVXH 4UPAA 4HN7A 5CV4A 1F2ZA 4C3JB 1XPRA 1AH9A 2L11A 1E1TA 4RKLA 5EBCA 1HZ9A 2JEBI 4LFAQ 3M7NA 5C44H 2AQ1B 2ZM6L 4A75A 2MP1A 4IPHA 3HOZG 4Y7NB 4ZUJA 4J1MA 2YYZA 1AEXA 2SNMA 2L4NA 1B4OA 5IGGA 1PZID 2QDLA 1MHWC 3L3OC 5EGTA 1EY5A 3CPFA 5F2DA 3KOJA 3GTOB 2KA7A 5C3WA 3AMUA 4KY6A 2XSCA 1A3VA 1QE6A 4C3JH 5I2YA 1AFPA 4EGVA 3GTMB 4JYAL 4IOAA 2KUMA 1CUKA 1EY0A 1LACA 3U58A 2Z8LA 4A3JG 3I55A 3NE5B 4Y7NH 1C8CA 5BR8Q 4DU9A 4B3RL 2AMCB 1Q82C 1G8ZD 4IO9A 2A1AA 4P71A 1VQPA 2X69A 5KNBA 4A3FB 2B2VA 2QILA 4RGNA 2QDBA 1JWUD 3QIAA 5C44G 1M8AA 3GTOH 4QQBX 4GOPC 2K32A 1YEZA 4PMCA 4P73A 2DJGC 3HOVB 3FDTA 1PZJD 4LF9L 3GTMH 4IQZA 4N9PA 1TIID 4KKTA 1X54A 1J8IA 1ET6A 1QCBD 2H1EA 1WTOA 3CPWA 2WKDA 2IHEA 3RD4A 5IWAQ 3BVGA 3JC66 4DAVA 4A3FH 4P72A 4C3JG 1S5ED 5ELEA 3EN2A 3T1HL 1YHAA 1EOVA 1J6QA 4BY1B 4IFDH 2DNEA 3HOVH 2PI2A 1K3RA 3AYHB 3F2DA 1CKMA 1KABA 2F0MA 4OL7A 4TVAB 2XWBB 3F2CA 4ZQ3A 4C3IB 3I7FA 5DM63 1BBWA 5FJ8G 1B44D 3JAML 1VQBA 3DLLA 2WP8J 1PRTF 1NUCA 2RDFA 5CV9A 2ID0A 1VQJA 1JJGA 2PQAA 4DV1Q 3MFGA 2C9OA 1K0RA 2EY2A 2MPMA 4A3KB 4BY1H 1F9RA 2NZHA 3VYUA 3NTKA 3K0YA 2O2LD 1I4RA 4O42A 1DOMA 4OIKA 2F0FA 3A8IE 4KHPL 3H09A 4C3IH 1L2FA 1VQNA 2JA7G 2L5TA 5M5XB 4OONA 2A68C 1CKNA 4LF5Q 3H3VI 1HPCA 3K5NA 4DV6L 3BU2A 4CKEA 1HCZA 1HZCA 1VQIA 1IYVA 1U0LA 1C4QA 3I2ZA 1IL8A 3DWPA 4DR6Q 1STAA 4XTCS 1HTLD 1QNKA 4BBSG 5EKIA 1PTOB 2UUBQ 1VQ7A 1ZKOA 1GUTA 5M5XH 1F2MA 3T53B 2F0OA 1MGSA 5LMNL 2X6GA 4X64Q 5C0XG 3S24A 2EVBA 4KI0A 1U4RA 1GKHA 1EY7A 3RMHA 4HJ7A 1SR3A 3GTQB 4ZUIA 3Q24A 5JEAG 1LABA 1IZ6A 3GTLB 4QGUA 2IW3A 4DV0Q 2JA6B 1S5FD 1I5FA 4GNXC 4PZ8A 3ER0A 4L5QA 3TP8A 2UUAL 5LMUQ 2EYHA 4K5XA 2KEDA 1HNXQ 3VR3A 3BG3A 3MZ5A 3J7ZC 3GTQH 4NKLA 5FO7B 4ME3A 4OELB 1CFMA 1MI2A 3GTLH 3W3AA 2JA6H 1CI3M 1EIGA 2ZJQA 1JORA 2PW5A 3SE0A 4P75A 1SNMA 5CORA 5D3DA 3WOEA 2EY6A 1EQTA 1YNXA 3D0FA 2Q2TA 5E7NA 5IIFA 2A6EC 2H5XA 5IOCA 2CQOA 1UE6A 1YNND 4KN4C 4JI1Q 4DFAA 2UXCL 2UXBL 3U4VA 2UUCQ 2O5JC 3KBGA 2BE5D 1LTGD 1LTSD 1MJEA 5M3FG 4DNIA 3B6YA 1SYDA 2B2YC 4A93H 4N8FA 2PW7A 2VY3A 4HIKA 4LMQD 1JE5A 1PRTD 3QB3A 1XXGA 1CQFA 2QCPX 3HGBA 4KHVA 3CCSA 1J9OA 3F2BA 1MIUA 1ENCA 3X3NA 2R3ZA 2E5LQ 4LF7L 4IUUA 3NQIA 4FDBA 3VYTA 4OX9Q 2A74C 4X3TA 3S1MB 2K5DA 3H91A 3D3RA 1GM5A 2M9VA 3PGZA 4KN7C 1NR2A 4DAYB 1IYUA 3NHHA 4YCUA 3BDOA 4A3EG 1TS4A 1UAPA 4LJZC 4KY5A 1EYDA 3I4MB 3A5ZB 3TP6A 1Y69U 4A3DB 2N49A 1RJTA 1B2TA 1IKMA 5ISRA 3EBEA 4EX5A 4A93G 4DPGA 1IBMQ 3FMCA 2ZJRA 3VA7A 3CCRA 3S1MH 2BCOA 2HCCA 5DM73 4HJ8A 3TS2A 3J7YW 3HOUG 1HUNA 2E75C 1WFQA 1ILQA 4DGZA 3CRLC 3NQTA 2VW9A 2Y0SG 1ZYRD 4GLXA 3URYA 2D5DA 1SJHD 1TT2A 3AQQA 1ONLA 4JI4Q 3EFXD 3I4MH 3FHWA 1XNQQ 4A3DH 5C4HA 4JI2Q 4YIJA 1PTOC 4HIMA 2F3VA 4E6IA 4LNQA 4X62L 2OEOA 1WI5A 4IPDA 3PO2B 2VUMG 2IX0A 3NELA 4H02A 1CKOA 4NXML 4A3IG 4DR4Q 3M85A 4HCSA 1SJED 3DXJC 5FLXE 2GVAA 5IP7G 4GKKQ 2CCZA 4R4TA 3I56A 2Q8TA 1PH7A 3G4SA 4J15A 3C3LA 5CV6A 1JJCB 3MXGA 4ZKCB 2DUDA 3ERQA 4YY3Q 1I4HA 1BBXC 5G3LF 3KLSA 1UWVA 1M4VA 2B8FA 2L55A 4YHHQ 2MGSA 1B1ZA 4GKJL 1FGUA 4IPCA 4QB4A 1EY6A 3PO2H 1D2BA 3PUVA 4R9WA 1U4LA 5C4JB 1F9SA 2OCEA 2WB1B 1O80A 1UNSA 3QJYA 1I4PA 4FP5D 4UY8C 1JWMD 3U9SA 5LHY1 4A4IA 1FGBD 1TVXA 3I4MG 1DGSA 2QW7A 1I50B 1Q3LA 1TS5A 3KF6A 4TQUS 4HIDA 4IUTA 2RCNA 1T9HA 2HCIA 1W2BA 3D4DA 4LFAL 3S17B 1Y1VG 1VQ8A 4A3CH 2YTXA 3M9BA 5C4JH 3K81C 4YWKA 3QOJA 4XYQA 4QL5A 2XGTA 5IGEA 1KLUD 1J5EL 2H4OA 5JVG3 3PUXA 1I50H 2CWPA 1VQ6A 5IYBH 3GV3A 3S1QB 4JI0Q 3FPUB 2JA5G 1OXSC 1FVIA 2E8GA 1F9PA 4NW2A 1NCVA 1VF7A 3S17H 2CH4A 3NUCA 4XDXA 2NVYB 3RNUA 1PVOA 4X3SA 4RAUC 1XTCD 1LTLA 3PSIA 1PYBA 1PV4A 1EIYB 1W6JA 1X9NA 2F0PA 1JOOA 3UDFA 3SEBA 3PUYA 3W2DA 1YIJA 1EIFA 4JV5L 3S1QH 2L1BA 2VB3X 3NWSA 1I4XA 3OWEB 2JA9A 4PZ7A 4BWGB 5LMNW 2K52A 2NVYH 3E0JA 1VQMA 4ZRZA 1LTTD 4M1UB 5IWAL 1L0YB 4QIWE 4BXXH 2L9HA 2E2DC 3U4ZA 2ATWA 1GXDC 4R4CA 4K6LA 4LW1A 2VQFQ 1N34Q 3CRKC 4LFCQ 2K14A 5IGDA 1AN8A 3LWEA 3K80C 1QG7A 1ESRA 3OOCA 3WWVA 1X55A 3D6CA 2HQEA 4A3BB 1EWHA 2NTTA 3TRZA 4RWSC 1TY2A 2QEXA 1KDAA 3SK4A 3S9WA 2LXKA 4FF3A 3OMGA 1C48A 2OQ0A 4IZ8A 1RD9D 5JJLA 3K0XA 4K8JA 3M4QA 1ML0D 1STBA 3C1EA 5FLXL 2VL6A 1PHJA 3OWFA 4KTAA 3SDZA 2V4DA 1G291 1B3AA 1GUNA 2WB1E 4B3TL 2K01A 5G3LD 3S15B 4WORA 4BXXG 4A3BH 3S1NB 3O13A 4FF4A 4QJFA 5FO9B 4C1NI 3C1FA 1AP0A 4HJ5A 4DV5Q 5K36G 2NZOA 4DR2Q 1EYGA 4WJ3M 4ME5A 4RH6A 2Z4HA 3R2IA 3I73A 3L0OA 2B63B 4RCNA 3HFZB 1G51A 4TSSA 2YV5A 5IP9H 1PFNA 2VQEL 2GVBA 4DV3Q 1XMQQ 3M4OB 1QWYA 2KHJA 5GAGC 4P2CB 3OSOA 3S15H 5A2QL 4DR1Q 2K03A 3L2PA 1GJXA 1DONA 3S1NH 1N32Q 3RUZA 2SNSA 2KQ3A 1HNWQ 2AQ2B 2FMCA 1D8LA 1I94Q 3KJPA 4KLKA 5CYUA 5JOBA 1KC8C 4X64L 3W1GA 4A3BG 2VB2X 2B63H 1O7IA 5I9OA 1WTQA 4BBRG 1TQOA 3ICEA 3M4OH 1PH3A 4A3MG 3I70A 2ZTEA 3ONAB 2MJ8A 3HOZB 3UDXA 1EQVA 4FXGC 1H95A 5IGBA 5HURA 2DY8A 1Q1EA 3TZUA 3H3VC 2KVMA 5E4WC 1L1OA 2RA4A 2L0CA 2JEAI 2K5WA 3QO2A 3A7LA 3SK8A 2K5NA 5LMUL 5BN3A 4IFDJ 2Z9HA 1X6OA 5ELBA 1SNDA 1L0XB 1SNCA 4MN3A 5I6WA 1JQYD 4OEMB 1SE2A 2IHFA 3JAMi 4J8QA 5J22A 1PLFA 1U4PA 5C5MA 5C6AA 3BZDB 3BS1A 1N36L 2KCMA 1WJJA 4A3JB 2EDGA 3HOZH 5NUCA 4HIOA 5HGQA 4U68A 3EVQA 3FP9A 4G7ZC 1P16A 1B3QA 1BR9A 2F0UA 2V1CC 3PIPA 2A69C 1Q8IA 3NTIA 2RF4A 2RSOA 2EJGC 4ZK9B 3CAMA 2UUCL 3NENA 3UE0A 3K59A 4B3MQ 4HAEA 3C46A 2B29A 5C0XJ 3LNNA 5KYIA 4L5TA 4A3JH 4ZAIA 1WTXA 1HA5A 5JEAJ 5AJ3Q 2AHOB 3CCVA 1F2YA 3OTOL 2B39A 1EY8A 2EZVA
chains in the Genus database with same CATH topology
3S2DH 5ELOA 4XTCS 5JJIA 1YJNA 4BBSG 1XJVA 5IY0A 2C35B 1VQAA 1KD1C 3RN5A 4LWCA 2UUBQ 1VQ7A 1Q7YC 3GDEA 1QUQB 1KRSA 3ULPA 3K8AA 4DV1L 2D62A 4YWMA 4YCWA 5M5XH 3RN2A 1IBKL 1B70B 1PH5A 4LF9Q 2E5LL 5LMNL 1LYLA 3GTJH 4OX9L 1N9WA 5FLMG 3HOYG 2Z6KC 4X64Q 3JAMc 5C0XG 3CD6A 1RL2A 3S24A 3RLOA 4KI0A 2K50A 1GKHA 2PI2E 4DV4Q 2EXDA 4HJ7A 1N8RC 2CFMA 2WAQE 2N78A 1SR3A 1Q86C 4BBRH 3TS0A 1JJ2A 2JK8A 2K4KA 1A63A 3CP0A 5JEAG 3T1YL 1G6PA 1YJWA 2UXBQ 3UDGA 1IZ6A 3T1HQ 4QGUA 4DV0Q 3CC4A 3RR5A 4AIMA 2MNAA 4PMWA 1I5FA 4A3MH 4ALPA 4LF5L 2BH8A 2KHIA 1SFOH 1X65A 2RHQB 4GNXC 4PZ8A 2BA0A 1XPUA 1K8GA 3CMAA 3KFUA 3NBHB 3ER0A 4L5QA 1IBML 1E7ZA 5AJ3L 2UUAL 2N3SA 4DR6L 3GTKH 4OWTB 3MXNB 5LMUQ 2CWAA 2RHSB 1WOCA 1KIXA 1HNXQ 5FJ8H 4X6AH 5C3EH 1SE8A 3PO3G 1E3PA 4JBKA 3J7ZC 1QUQA 2UUBL 3GTQH 2JE6I 2UU9Q 1QZGA 4ME3A 2E2IH 1L1OC 1NJIC 4R4OA 1K73C 3GTLH 2F4VL 2JA6H 2ZJQA 2R7ZG 4NPSA 2IY5B 4IJHA 4A3DG 4JI4L 1QVGA 3CC7A 2JA8G 4P75A 5IT9c 4GOPB 1YNXA 1SRUA 3D0FA 1YJ9A 2Q2TA 1PH1A 2NVQH 5E7NA 4DV7Q 1TWAH 4DV4L 1FJGQ 2H5XA 2CQOA 1JMCA 3M3YH 1UE6A 1HR0L 4JI1Q 1NMGA 4JI5Q 2UXCL 2UXBL 3U4VA 2UUCQ 2JA7H 3E9IA 4DV0L 4OWWB 3ULJA 5GQOA 2YU9H 1A0IA 2JQOA 1MJEA 5IYDG 4JOIA 1CSPA 5M3FG 4DNIA 4DV6Q 3B6YA 4DV2Q 1S3OA 3BZCA 4LF4Q 2AWNA 4A93H 1V9PA 2VY3A 1S72A 3GTGH 4HIKA 4YHHL 3KJOA 4LFBQ 1W3SA 2R93H 1PA6A 4BA2I 1JE5A 3PO2G 1QVFA 1HNXL 1KXLA 2Q2IA 4LF8Q 4BBSH 4X65L 3CCSA 3TQYA 1K8AC 2D0PA 3J81j 3F2BA 1MIUA 2MO0A 2UU9L 4DR5Q 1XMOL 2BH2A 1PH9A 3CF5A 1IXRA 1V1QA 3KYHC 2E5LQ 3PF4A 4LF7L 5LMNQ 2Q2HA 5C4XG 4FDBA 3PV0A 3TREA 3W1BA 2I0QA 4OX9Q 1E22A 2LSSA 1Q12A 3HOYH 4X62Q 3GTPH 2ZTCA 2R7DA 2AWOA 1E24A 2K5VA 2XTIA 3PGZA 4P74A 2NN6I 4PZ6A 4DK3C 1GM5A 2OTLA 1FJGL 1PFSA 2Q2UA 4DAYB 5GAHC 2EQSA 4B3SQ 4NXMQ 4JI1L 4YCUA 1I3QH 1R9TH 3CC2A 4JI5L 3I4NG 4A3EG 1Z9FA 4A3CG 1B8AA 1UE1A 1NE3A 3H3VH 2WB1G 1CSQA 1JJGA 3A5ZB 4C3HH 2N49A 3PCOB 1EQQA 1S40A 2PMZE 3CCMA 3EBEA 4EX5A 4DUZQ 4DPGA 4DV2L 2E2JH 1A8VA 1LUZA 2ASBA 4A93G 1IBMQ 2UUAQ 1BVSA 5M5WH 2ZJRA 4OO1I 3CQZH 3CCRA 2ES2A 2R7FA 3G48A 4BA1I 1EUJA 3I4OA 5IYBG 3CCUA 4HJ8A 1M90C 3S1MH 3HOUG 3TS2A 4GKJQ 2MO1A 5M5YH 4NXNL 1GO3E 2F52A 1WFQA 2EIFA 2QGQA 4GN4B 4LF8L 1PYSB 4JI0L 3Q8DA 2VW9A 2JJQA 1VQ9A 3PO3H 4DR5L 2Y0SG 3HOWG 4GLXA 1NY4A 4O0AA 4BY7G 1BKBA 2F4VQ 3AQQA 4AH6A 1UE5A 4MZ9A 4JI4Q 3I4MH 2R7ZH 3FHWA 1OXVA 1X3FA 3DM3A 1HJPA 4AQYL 1XNQQ 2JA8H 4JI2Q 2NN6G 4A3DH 3S2HH 1Y1WG 4HIMA 4LNQA 1SROA 4LUZA 4X62L 4JI3Q 3NEMA 1YBYA 1WI5A 4IPDA 3KF6B 2VUMG 2IX0A 3NELA 4UP8A 4R4IA 4B3RL 4B3SL 3PUZA 1PH8A 4H02A 1CKOA 1HR0Q 4NXML 3KLWA 5HY6A 4A3IG 4EQ5A 4DR4Q 4AYBG 2UXCQ 3M85A 1KL9A 1IBLQ 4JI8L 3BJUA 2GVAA 5IP7G 4GKKQ 2CCZA 3J80i 4R4TA 3I56A 1YI2A 4MNOA 3G4SA 4J15A 1PH7A 5IYDH 1JJCB 1SLJA 5M3FH 4DUZL 4OO1G 2DUDA 4A76A 1ASYA 4YY3Q 4UP9A 3HKZG 1PH4A 1IL2A 1J5EQ 1UWVA 3CMEA 3CW2C 2YTVA 4YHHQ 2IX1A 4NB3A 4GKJL 4OWXB 1HR0W 1FGUA 1TWHH 3IRBA 4GN5A 4IPCA 4JOIC 4GNXB 3PO2H 1PH6A 3PUVA 2CKZB 4A3GG 4X65Q 2R92G 2OCEA 1HNZL 1E1OA 1N34L 4UY8C 1XMOQ 4RG1A 3SGIA 1C7YA 4A4IA 3I4MG 1NTGA 3H0GG 3KF8B 3LGJA 4LF7Q 1AE2A 3F1ZA 3EIVA 5DLQE 5C4XH 2MQHA 3J81i 1YHQA 1XNQL 4LFBL 1VQEA 1DGSA 4JI2L 1OTCA 1MKHA 1SN8A 4IOCA 2OWOA 4POGA 4JI3L 3AEVA 4A3LG 3KF6A 1JB7A 4TQUS 4HIDA 5J3BA 2RCNA 1T9HA 1WCMG 1W2BA 4DR4L 3G6EA 1XPOA 1IBLL 4R1JA 1P8LA 1M1KC 4LFAL 1YHBA 4A3EH 3I4NH 4JV5Q 1Y1VG 1VQ8A 1OXTA 2YTXA 4A3CH 1HZAA 3M9BA 4GKKL 5C4JH 3BZKA 3RZOH 4C2MH 3K81C 4YWKA 1MJCA 4QL5A 2XGTA 1Q46A 5IE8A 1Y14B 4APVA 4YY3L 2ZTDA 4HJAA 2VNUD 2KCTA 1J5EL 1VQCA 3ULLA 3PUXA 3CCLA 4KHZA 1VQKA 3J80c 1I50H 2CWPA 1XTDA 1VQ6A 5IYBH 4NXNQ 3HOUH 1C9OA 2B3GA 2WFWA 4JI0Q 3STBC 1IYJB 2JA5G 1OXSC 1FVIA 2E8GA 4DV5L 4IPGA 3ERSX 3S17H 3K7AH 2AKWB 3KDFB 1EFWA 1TWCH 3RNUA 3HOWH 4BY7H 1PVOA 4WJ4A 2QA4A 2D0OA 2UXDQ 1KQSA 5IP9G 4GOPA 4AQYQ 4IJLA 1KHIA 1EWIA 1LTLA 1PYBA 3PSIA 1PV4A 1EIYB 4DKAC 1X9NA 4DV3L 1Y1WH 1TWFH 2IT1A 3UDFA 2VUMH 1N32L 3J81c 3PUYA 1YIJA 4HJ9A 3D31A 4JI8Q 3UDIA 5M3MG 4DR3L 1EIFA 3VDYA 1X3GA 4A3IH 1Z47A 4GN3B 3S1QH 4JV5L 2ZM6Q 3H15A 2HQLA 4YCVA 5IP7H 2JA9A 4PZ7A 5LMNW 3GD7A 5GAEC 2OTJA 4B3TQ 3CCJA 2K52A 2NVYH 3FKIH 2B63G 1VQDA 3K7UC 1VQMA 3E0EA 3S1RH 2WAQG 5IWAL 2HHHL 4QIWE 1FL0A 4BXXH 1VS0A 4A3FG 4LF6Q 3S14H 4GLVB 2OQKA 3U4ZA 3M4PA 2ATWA 4R4CA 4L5RC 3AFQA 3STBD 3PF5A 3RZDH 3HKSA 4LW1A 2N8NA 1VQHA 1HNZQ 4YWLA 2VQFQ 1VQLA 1N34Q 4JI7L 4IFDG 2R92H 2VZAA 4A3GH 3L7ZC 4JYAQ 3KDFA 2K14A 4LFCQ 4K0KL 1TWGH 3HOVG 4JBMA 3K80C 5H1SE 3WWVA 4X66L 3H0GH 1VQ4A 4JI6Q 1SMXA 1X55A 4DR7Q 2UXDL 4B3RQ 4Y52H 1BBUA 3AFPA 1X56A 3G71A 4A3KH 2NVXH 3TRZA 3ZJYC 2VQEQ 4UPAA 2QEXA 4RMFA 1HH2P 4LUVA 2DGYA 1LM0A 4A3LH 1K83H 4XIGS 2LXKA 3PUWA 1XPRA 1AH9A 1E1TA 1UEBA 1AE3A 2OQ0A 1WCMH 1QZHA 5JJLA 1HZ9A 2JEBI 3K0XA 1V43A 3M4QA 4LFAQ 5C44H 1N33L 3M7NA 1K9MC 2ZM6L 1VQ5A 4A75A 1UE7A 4L5SA 4IPHA 1Y1VH 1OXUA 2VL6A 3GO5A 1PHJA 4BY1G 1XNRL 3HOZG 5JJKA 1G291 2WB1E 1NBWA 2YYZA 3FKIG 4B3TL 2YTYA 4LUOA 3E9HA 5IYCG 3A0JA 4BXXG 1VQFA 2I5MX 4A3BH 1NMFA 2K75A 4MTNA 1VCIA 2ZJPA 3RLFA 4LF6L 3CPFA 3KOJA 1EQRA 4QJFA 3A74A 1A62A 4C3JH 1OXXK 4O2DA 4HJ5A 4DV5Q 2VQFL 5K36G 4B3ML 2E2HH 2JA5H 4JYAL 2NZOA 4QY7A 4DR2Q 4LFCL 1EYGA 4IOAA 4WJ3M 4DK6C 1CUKA 4A3JG 3U58A 2Y0SE 1PH2A 3I55A 3OW2A 4DUYL 3L0OA 4Y7NH 4JI6L 1L0WA 5BR8Q 4A3KG 1KAWA 3HFZB 3UE1A 2AMCB 1G51A 1Q82C 4DR7L 2YV5A 2A1AA 4P71A 5IP9H 4IO9A 1VQPA 1L1OB 2VQEL 2GVBA 4DV3Q 1XMQQ 2KHJA 2NVTH 5GAGC 2KBNA 3S15H 1Q8KA 4DR1Q 3A5UA 3L2PA 1QVCA 2KENA 2Z6KA 3OYYA 3S1NH 1I6HH 1N32Q 1ASZA 5GADC 5C44G 3GTOH 4QQBX 4DR3Q 4GOPC 2A8VA 1YEZA 1HNWQ 4P73A 4AYBE 1N36Q 5M3MH 1D8LA 3CCEA 2PQAB 4LF9L 3GTMH 1I94Q 1HZBA 3F8TA 1X54A 1KRTA 3KJPA 3CCQA 4KLKA 2F3IA 1KC8C 4JCVE 4X64L 3MEFA 3CPWA 3W1GA 4A3BG 2IHEA 2B63H 1O7IA 5IWAQ 2HHHQ 3HKZE 4BBRG 3HOXH 3JC66 1YZ6A 4GNXA 5FLXc 1PH3A 4A3FH 3ICEA 3M4OH 4KHPQ 4P72A 4A3MG 2LXJA 3EN2A 4DAMA 3T1HL 1YHAA 1EOVA 4JI7Q 1C0AA 2ZTEA 1J6QA 2BA1A 4DR2L 4K0KQ 3UDXA 3RLNA 1CKNB 2VS1A 1H95A 2PNHA 3W5OA 2PI2A 4X66Q 3HOVH 4IFDI 1K3RA 3AYHB 1Q1EA 5BR8L 3F2DA 1GVPA 1CKMA 1L1OA 2HIXA 3S16H 2HT1A 1B7YB 1RIPA 2JEAI 2L15A 4TVAB 3OTOQ 1XMQL 3J7A5 2HIVA 1YITA 4JC0A 3PIOA 3F2CA 3I7FA 2K5NA 5LMUL 4DR1L 2I5HA 1BBWA 5FJ8G 4PG3A 5C3EG 4IFDJ 1X6OA 2A19A 2FXQA 3TEHB 1VQBA 2Z0SA 3DLLA 2WP8J 4GLAC 3JAMi 2IHFA 5GROA 1HNWL 2ID0A 4UP7A 1N33Q 1VQJA 3CXCA 2PQAA 5EAYA 4DV1Q 1Q1BA 1N36L 2KCMA 1IBKQ 1WJJA 1XNRQ 2JA6G 4JG2A 1K0RA 1I94L 3HOZH 5ELNA 4HIOA 4BY1H 2NZHA 2K5HA 5HGQA 3FP9A 4R4QA 5IYCH 5FLMH 1P16A 2V1CC 3HOXG 3PIPA 4DV7L 2RF4A 1VQOA 5C0XI 4KHPL 2R6GA 4C3IH 3U50C 3T1YQ 1JT8A 1L2FA 1VQNA 4POFA 2JA7G 3CAMA 4JBWA 2UUCL 3NENA 3UE0A 1D7QA 2MFIA 4OONA 4B3MQ 1YVCA 2B29A 1CKNA 5C0XJ 4LF5Q 3H3VI 2I5LX 1WYDA 4JBJA 1U5KA 1VQGA 3BU2A 4DUYQ 4DV6L 4L5TA 4A3JH 1Q81C 4GS3A 4OXPA 1HZCA 4LF4L 1VQIA 1U0LA 3I2ZA 5JEAJ 5AJ3Q 2AHOB 3CCVA 2R93G 1TXYA 1X3EA 3OTOL 4DR6Q 2ALYB 2GN5A 1GD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S2D H;  5ELO A;  4XTC S;  5JJI A;  1YJN A;  4BBS G;  1XJV A;  5IY0 A;  2C35 B;  1VQA A;  1KD1 C;  3RN5 A;  4LWC A;  2UUB Q;  1VQ7 A;  1Q7Y C;  3GDE A;  1QUQ B;  1KRS A;  3ULP A;  3K8A A;  4DV1 L;  2D62 A;  4YWM A;  4YCW A;  5M5X H;  3RN2 A;  1IBK L;  1B70 B;  1PH5 A;  4LF9 Q;  2E5L L;  5LMN L;  1LYL A;  3GTJ H;  4OX9 L;  1N9W A;  5FLM G;  3HOY G;  2Z6K C;  4X64 Q;  3JAM c;  5C0X G;  3CD6 A;  1RL2 A;  3S24 A;  3RLO A;  4KI0 A;  2K50 A;  1GKH A;  2PI2 E;  4DV4 Q;  2EXD A;  4HJ7 A;  1N8R C;  2CFM A;  2WAQ E;  2N78 A;  1SR3 A;  1Q86 C;  4BBR H;  3TS0 A;  1JJ2 A;  2JK8 A;  2K4K A;  1A63 A;  3CP0 A;  5JEA G;  3T1Y L;  1G6P A;  1YJW A;  2UXB Q;  3UDG A;  1IZ6 A;  3T1H Q;  4QGU A;  4DV0 Q;  3CC4 A;  3RR5 A;  4AIM A;  2MNA A;  4PMW A;  1I5F A;  4A3M H;  4ALP A;  4LF5 L;  2BH8 A;  2KHI A;  1SFO H;  1X65 A;  2RHQ B;  4GNX C;  4PZ8 A;  2BA0 A;  1XPU A;  1K8G A;  3CMA A;  3KFU A;  3NBH B;  3ER0 A;  4L5Q A;  1IBM L;  1E7Z A;  5AJ3 L;  2UUA L;  2N3S A;  4DR6 L;  3GTK H;  4OWT B;  3MXN B;  5LMU Q;  2CWA A;  2RHS B;  1WOC A;  1KIX A;  1HNX Q;  5FJ8 H;  4X6A H;  5C3E H;  1SE8 A;  3PO3 G;  1E3P A;  4JBK A;  3J7Z C;  1QUQ A;  2UUB L;  3GTQ H;  2JE6 I;  2UU9 Q;  1QZG A;  4ME3 A;  2E2I H;  1L1O C;  1NJI C;  4R4O A;  1K73 C;  3GTL H;  2F4V L;  2JA6 H;  2ZJQ A;  2R7Z G;  4NPS A;  2IY5 B;  4IJH A;  4A3D G;  4JI4 L;  1QVG A;  3CC7 A;  2JA8 G;  4P75 A;  5IT9 c;  4GOP B;  1YNX A;  1SRU A;  3D0F A;  1YJ9 A;  2Q2T A;  1PH1 A;  2NVQ H;  5E7N A;  4DV7 Q;  1TWA H;  4DV4 L;  1FJG Q;  2H5X A;  2CQO A;  1JMC A;  3M3Y H;  1UE6 A;  1HR0 L;  4JI1 Q;  1NMG A;  4JI5 Q;  2UXC L;  2UXB L;  3U4V A;  2UUC Q;  2JA7 H;  3E9I A;  4DV0 L;  4OWW B;  3ULJ A;  5GQO A;  2YU9 H;  1A0I A;  2JQO A;  1MJE A;  5IYD G;  4JOI A;  1CSP A;  5M3F G;  4DNI A;  4DV6 Q;  3B6Y A;  4DV2 Q;  1S3O A;  3BZC A;  4LF4 Q;  2AWN A;  4A93 H;  1V9P A;  2VY3 A;  1S72 A;  3GTG H;  4HIK A;  4YHH L;  3KJO A;  4LFB Q;  1W3S A;  2R93 H;  1PA6 A;  4BA2 I;  1JE5 A;  3PO2 G;  1QVF A;  1HNX L;  1KXL A;  2Q2I A;  4LF8 Q;  4BBS H;  4X65 L;  3CCS A;  3TQY A;  1K8A C;  2D0P A;  3J81 j;  3F2B A;  1MIU A;  2MO0 A;  2UU9 L;  4DR5 Q;  1XMO L;  2BH2 A;  1PH9 A;  3CF5 A;  1IXR A;  1V1Q A;  3KYH C;  2E5L Q;  3PF4 A;  4LF7 L;  5LMN Q;  2Q2H A;  5C4X G;  4FDB A;  3PV0 A;  3TRE A;  3W1B A;  2I0Q A;  4OX9 Q;  1E22 A;  2LSS A;  1Q12 A;  3HOY H;  4X62 Q;  3GTP H;  2ZTC A;  2R7D A;  2AWO A;  1E24 A;  2K5V A;  2XTI A;  3PGZ A;  4P74 A;  2NN6 I;  4PZ6 A;  4DK3 C;  1GM5 A;  2OTL A;  1FJG L;  1PFS A;  2Q2U A;  4DAY B;  5GAH C;  2EQS A;  4B3S Q;  4NXM Q;  4JI1 L;  4YCU A;  1I3Q H;  1R9T H;  3CC2 A;  4JI5 L;  3I4N G;  4A3E G;  1Z9F A;  4A3C G;  1B8A A;  1UE1 A;  1NE3 A;  3H3V H;  2WB1 G;  1CSQ A;  1JJG A;  3A5Z B;  4C3H H;  2N49 A;  3PCO B;  1EQQ A;  1S40 A;  2PMZ E;  3CCM A;  3EBE A;  4EX5 A;  4DUZ Q;  4DPG A;  4DV2 L;  2E2J H;  1A8V A;  1LUZ A;  2ASB A;  4A93 G;  1IBM Q;  2UUA Q;  1BVS A;  5M5W H;  2ZJR A;  4OO1 I;  3CQZ H;  3CCR A;  2ES2 A;  2R7F A;  3G48 A;  4BA1 I;  1EUJ A;  3I4O A;  5IYB G;  3CCU A;  4HJ8 A;  1M90 C;  3S1M H;  3HOU G;  3TS2 A;  4GKJ Q;  2MO1 A;  5M5Y H;  4NXN L;  1GO3 E;  2F52 A;  1WFQ A;  2EIF A;  2QGQ A;  4GN4 B;  4LF8 L;  1PYS B;  4JI0 L;  3Q8D A;  2VW9 A;  2JJQ A;  1VQ9 A;  3PO3 H;  4DR5 L;  2Y0S G;  3HOW G;  4GLX A;  1NY4 A;  4O0A A;  4BY7 G;  1BKB A;  2F4V Q;  3AQQ A;  4AH6 A;  1UE5 A;  4MZ9 A;  4JI4 Q;  3I4M H;  2R7Z H;  3FHW A;  1OXV A;  1X3F A;  3DM3 A;  1HJP A;  4AQY L;  1XNQ Q;  2JA8 H;  4JI2 Q;  2NN6 G;  4A3D H;  3S2H H;  1Y1W G;  4HIM A;  4LNQ A;  1SRO A;  4LUZ A;  4X62 L;  4JI3 Q;  3NEM A;  1YBY A;  1WI5 A;  4IPD A;  3KF6 B;  2VUM G;  2IX0 A;  3NEL A;  4UP8 A;  4R4I A;  4B3R L;  4B3S L;  3PUZ A;  1PH8 A;  4H02 A;  1CKO A;  1HR0 Q;  4NXM L;  3KLW A;  5HY6 A;  4A3I G;  4EQ5 A;  4DR4 Q;  4AYB G;  2UXC Q;  3M85 A;  1KL9 A;  1IBL Q;  4JI8 L;  3BJU A;  2GVA A;  5IP7 G;  4GKK Q;  2CCZ A;  3J80 i;  4R4T A;  3I56 A;  1YI2 A;  4MNO A;  3G4S A;  4J15 A;  1PH7 A;  5IYD H;  1JJC B;  1SLJ A;  5M3F H;  4DUZ L;  4OO1 G;  2DUD A;  4A76 A;  1ASY A;  4YY3 Q;  4UP9 A;  3HKZ G;  1PH4 A;  1IL2 A;  1J5E Q;  1UWV A;  3CME A;  3CW2 C;  2YTV A;  4YHH Q;  2IX1 A;  4NB3 A;  4GKJ L;  4OWX B;  1HR0 W;  1FGU A;  1TWH H;  3IRB A;  4GN5 A;  4IPC A;  4JOI C;  4GNX B;  3PO2 H;  1PH6 A;  3PUV A;  2CKZ B;  4A3G G;  4X65 Q;  2R92 G;  2OCE A;  1HNZ L;  1E1O A;  1N34 L;  4UY8 C;  1XMO Q;  4RG1 A;  3SGI A;  1C7Y A;  4A4I A;  3I4M G;  1NTG A;  3H0G G;  3KF8 B;  3LGJ A;  4LF7 Q;  1AE2 A;  3F1Z A;  3EIV A;  5DLQ E;  5C4X H;  2MQH A;  3J81 i;  1YHQ A;  1XNQ L;  4LFB L;  1VQE A;  1DGS A;  4JI2 L;  1OTC A;  1MKH A;  1SN8 A;  4IOC A;  2OWO A;  4POG A;  4JI3 L;  3AEV A;  4A3L G;  3KF6 A;  1JB7 A;  4TQU S;  4HID A;  5J3B A;  2RCN A;  1T9H A;  1WCM G;  1W2B A;  4DR4 L;  3G6E A;  1XPO A;  1IBL L;  4R1J A;  1P8L A;  1M1K C;  4LFA L;  1YHB A;  4A3E H;  3I4N H;  4JV5 Q;  1Y1V G;  1VQ8 A;  1OXT A;  2YTX A;  4A3C H;  1HZA A;  3M9B A;  4GKK L;  5C4J H;  3BZK A;  3RZO H;  4C2M H;  3K81 C;  4YWK A;  1MJC A;  4QL5 A;  2XGT A;  1Q46 A;  5IE8 A;  1Y14 B;  4APV A;  4YY3 L;  2ZTD A;  4HJA A;  2VNU D;  2KCT A;  1J5E L;  1VQC A;  3ULL A;  3PUX A;  3CCL A;  4KHZ A;  1VQK A;  3J80 c;  1I50 H;  2CWP A;  1XTD A;  1VQ6 A;  5IYB H;  4NXN Q;  3HOU H;  1C9O A;  2B3G A;  2WFW A;  4JI0 Q;  3STB C;  1IYJ B;  2JA5 G;  1OXS C;  1FVI A;  2E8G A;  4DV5 L;  4IPG A;  3ERS X;  3S17 H;  3K7A H;  2AKW B;  3KDF B;  1EFW A;  1TWC H;  3RNU A;  3HOW H;  4BY7 H;  1PVO A;  4WJ4 A;  2QA4 A;  2D0O A;  2UXD Q;  1KQS A;  5IP9 G;  4GOP A;  4AQY Q;  4IJL A;  1KHI A;  1EWI A;  1LTL A;  1PYB A;  3PSI A;  1PV4 A;  1EIY B;  4DKA C;  1X9N A;  4DV3 L;  1Y1W H;  1TWF H;  2IT1 A;  3UDF A;  2VUM H;  1N32 L;  3J81 c;  3PUY A;  1YIJ A;  4HJ9 A;  3D31 A;  4JI8 Q;  3UDI A;  5M3M G;  4DR3 L;  1EIF A;  3VDY A;  1X3G A;  4A3I H;  1Z47 A;  4GN3 B;  3S1Q H;  4JV5 L;  2ZM6 Q;  3H15 A;  2HQL A;  4YCV A;  5IP7 H;  2JA9 A;  4PZ7 A;  5LMN W;  3GD7 A;  5GAE C;  2OTJ A;  4B3T Q;  3CCJ A;  2K52 A;  2NVY H;  3FKI H;  2B63 G;  1VQD A;  3K7U C;  1VQM A;  3E0E A;  3S1R H;  2WAQ G;  5IWA L;  2HHH L;  4QIW E;  1FL0 A;  4BXX H;  1VS0 A;  4A3F G;  4LF6 Q;  3S14 H;  4GLV B;  2OQK A;  3U4Z A;  3M4P A;  2ATW A;  4R4C A;  4L5R C;  3AFQ A;  3STB D;  3PF5 A;  3RZD H;  3HKS A;  4LW1 A;  2N8N A;  1VQH A;  1HNZ Q;  4YWL A;  2VQF Q;  1VQL A;  1N34 Q;  4JI7 L;  4IFD G;  2R92 H;  2VZA A;  4A3G H;  3L7Z C;  4JYA Q;  3KDF A;  2K14 A;  4LFC Q;  4K0K L;  1TWG H;  3HOV G;  4JBM A;  3K80 C;  5H1S E;  3WWV A;  4X66 L;  3H0G H;  1VQ4 A;  4JI6 Q;  1SMX A;  1X55 A;  4DR7 Q;  2UXD L;  4B3R Q;  4Y52 H;  1BBU A;  3AFP A;  1X56 A;  3G71 A;  4A3K H;  2NVX H;  3TRZ A;  3ZJY C;  2VQE Q;  4UPA A;  2QEX A;  4RMF A;  1HH2 P;  4LUV A;  2DGY A;  1LM0 A;  4A3L H;  1K83 H;  4XIG S;  2LXK A;  3PUW A;  1XPR A;  1AH9 A;  1E1T A;  1UEB A;  1AE3 A;  2OQ0 A;  1WCM H;  1QZH A;  5JJL A;  1HZ9 A;  2JEB I;  3K0X A;  1V43 A;  3M4Q A;  4LFA Q;  5C44 H;  1N33 L;  3M7N A;  1K9M C;  2ZM6 L;  1VQ5 A;  4A75 A;  1UE7 A;  4L5S A;  4IPH A;  1Y1V H;  1OXU A;  2VL6 A;  3GO5 A;  1PHJ A;  4BY1 G;  1XNR L;  3HOZ G;  5JJK A;  1G29 1;  2WB1 E;  1NBW A;  2YYZ A;  3FKI G;  4B3T L;  2YTY A;  4LUO A;  3E9H A;  5IYC G;  3A0J A;  4BXX G;  1VQF A;  2I5M X;  4A3B H;  1NMF A;  2K75 A;  4MTN A;  1VCI A;  2ZJP A;  3RLF A;  4LF6 L;  3CPF A;  3KOJ A;  1EQR A;  4QJF A;  3A74 A;  1A62 A;  4C3J H;  1OXX K;  4O2D A;  4HJ5 A;  4DV5 Q;  2VQF L;  5K36 G;  4B3M L;  2E2H H;  2JA5 H;  4JYA L;  2NZO A;  4QY7 A;  4DR2 Q;  4LFC L;  1EYG A;  4IOA A;  4WJ3 M;  4DK6 C;  1CUK A;  4A3J G;  3U58 A;  2Y0S E;  1PH2 A;  3I55 A;  3OW2 A;  4DUY L;  3L0O A;  4Y7N H;  4JI6 L;  1L0W A;  5BR8 Q;  4A3K G;  1KAW A;  3HFZ B;  3UE1 A;  2AMC B;  1G51 A;  1Q82 C;  4DR7 L;  2YV5 A;  2A1A A;  4P71 A;  5IP9 H;  4IO9 A;  1VQP A;  1L1O B;  2VQE L;  2GVB A;  4DV3 Q;  1XMQ Q;  2KHJ A;  2NVT H;  5GAG C;  2KBN A;  3S15 H;  1Q8K A;  4DR1 Q;  3A5U A;  3L2P A;  1QVC A;  2KEN A;  2Z6K A;  3OYY A;  3S1N H;  1I6H H;  1N32 Q;  1ASZ A;  5GAD C;  5C44 G;  3GTO H;  4QQB X;  4DR3 Q;  4GOP C;  2A8V A;  1YEZ A;  1HNW Q;  4P73 A;  4AYB E;  1N36 Q;  5M3M H;  1D8L A;  3CCE A;  2PQA B;  4LF9 L;  3GTM H;  1I94 Q;  1HZB A;  3F8T A;  1X54 A;  1KRT A;  3KJP A;  3CCQ A;  4KLK A;  2F3I A;  1KC8 C;  4JCV E;  4X64 L;  3MEF A;  3CPW A;  3W1G A;  4A3B G;  2IHE A;  2B63 H;  1O7I A;  5IWA Q;  2HHH Q;  3HKZ E;  4BBR G;  3HOX H;  3JC6 6;  1YZ6 A;  4GNX A;  5FLX c;  1PH3 A;  4A3F H;  3ICE A;  3M4O H;  4KHP Q;  4P72 A;  4A3M G;  2LXJ A;  3EN2 A;  4DAM A;  3T1H L;  1YHA A;  1EOV A;  4JI7 Q;  1C0A A;  2ZTE A;  1J6Q A;  2BA1 A;  4DR2 L;  4K0K Q;  3UDX A;  3RLN A;  1CKN B;  2VS1 A;  1H95 A;  2PNH A;  3W5O A;  2PI2 A;  4X66 Q;  3HOV H;  4IFD I;  1K3R A;  3AYH B;  1Q1E A;  5BR8 L;  3F2D A;  1GVP A;  1CKM A;  1L1O A;  2HIX A;  3S16 H;  2HT1 A;  1B7Y B;  1RIP A;  2JEA I;  2L15 A;  4TVA B;  3OTO Q;  1XMQ L;  3J7A 5;  2HIV A;  1YIT A;  4JC0 A;  3PIO A;  3F2C A;  3I7F A;  2K5N A;  5LMU L;  4DR1 L;  2I5H A;  1BBW A;  5FJ8 G;  4PG3 A;  5C3E G;  4IFD J;  1X6O A;  2A19 A;  2FXQ A;  3TEH B;  1VQB A;  2Z0S A;  3DLL A;  2WP8 J;  4GLA C;  3JAM i;  2IHF A;  5GRO A;  1HNW L;  2ID0 A;  4UP7 A;  1N33 Q;  1VQJ A;  3CXC A;  2PQA A;  5EAY A;  4DV1 Q;  1Q1B A;  1N36 L;  2KCM A;  1IBK Q;  1WJJ A;  1XNR Q;  2JA6 G;  4JG2 A;  1K0R A;  1I94 L;  3HOZ H;  5ELN A;  4HIO A;  4BY1 H;  2NZH A;  2K5H A;  5HGQ A;  3FP9 A;  4R4Q A;  5IYC H;  5FLM H;  1P16 A;  2V1C C;  3HOX G;  3PIP A;  4DV7 L;  2RF4 A;  1VQO A;  5C0X I;  4KHP L;  2R6G A;  4C3I H;  3U50 C;  3T1Y Q;  1JT8 A;  1L2F A;  1VQN A;  4POF A;  2JA7 G;  3CAM A;  4JBW A;  2UUC L;  3NEN A;  3UE0 A;  1D7Q A;  2MFI A;  4OON A;  4B3M Q;  1YVC A;  2B29 A;  1CKN A;  5C0X J;  4LF5 Q;  3H3V I;  2I5L X;  1WYD A;  4JBJ A;  1U5K A;  1VQG A;  3BU2 A;  4DUY Q;  4DV6 L;  4L5T A;  4A3J H;  1Q81 C;  4GS3 A;  4OXP A;  1HZC A;  4LF4 L;  1VQI A;  1U0L A;  3I2Z A;  5JEA J;  5AJ3 Q;  2AHO B;  3CCV A;  2R93 G;  1TXY A;  1X3E A;  3OTO L;  4DR6 Q;  2ALY B;  2GN5 A;  1GD7 A; 
#chains in the Genus database with same CATH topology
 5ELO A;  5LL6 S;  1ENF A;  2EOT A;  5IY0 A;  1KD1 C;  3RN5 A;  5HGT A;  1Q7Y C;  1QUQ B;  3UI2 A;  1DOK A;  5D65 A;  1SFO B;  2D62 A;  1WTW A;  1IBK L;  2E5L L;  1HQR D;  2KJX A;  3CU7 A;  4OX9 L;  2PCF B;  2Z6K C;  2M2L A;  3V05 A;  3CD6 A;  3RLO A;  1NNX A;  1Q86 C;  1JJ2 A;  3TS0 A;  3T1Y L;  1G6P A;  3H6M A;  1YJW A;  2E2I B;  3J80 E;  3AB9 A;  5JPM C;  1EWC A;  3CC4 A;  4AIM A;  1LT6 D;  3Q6S A;  4ALP A;  1XX8 A;  4C3H G;  1STN A;  1Q90 A;  2BH8 A;  3AU7 A;  1EYC A;  2KHI A;  1SFO H;  1X65 A;  4G4K A;  1S5B D;  2OF1 A;  3KFU A;  2A6H C;  1IBM L;  1WOC A;  2N88 A;  2JA7 B;  2IWH A;  1PZK D;  5FJ8 H;  4X6A H;  2KCC A;  3FEW X;  3DMU A;  2UU9 Q;  1BO0 A;  5LL6 X;  2E2I H;  1VF5 C;  3J81 E;  1RTN A;  1SMY C;  1SYE A;  1G91 A;  4JI4 L;  1QVG A;  4XT3 B;  2JA8 G;  3DUZ A;  5IT9 c;  1E2Z A;  3NWT A;  1MD2 D;  4QUC A;  4DV7 Q;  2F0L A;  4DV4 L;  1IHZ A;  4BBS B;  1JMC A;  5BN4 A;  1IW7 C;  3KUP A;  3LWU A;  2RSN A;  3N6R A;  2JA7 H;  1QNU A;  5IYD G;  4JOI A;  1CSP A;  4DV2 Q;  4LF4 Q;  1K8M A;  2A6H D;  3A56 A;  3NBH A;  4X3U A;  3BVZ A;  1AZQ A;  1S72 A;  3MXN A;  1LTB D;  1D5Z C;  4YHH L;  1PA6 A;  1EU4 A;  1GUW A;  2AUK A;  1KXL A;  1BNZ A;  3T4A C;  1HFG A;  4BBS H;  1K8A C;  2BH2 A;  4DR5 Q;  1SMY D;  4MTK A;  1IXR A;  3KYH C;  5M9O A;  5DNF A;  1Q12 A;  1ZEQ X;  1O7Y A;  3MTS A;  4H0L C;  2EJF C;  5C0X H;  2R7D A;  1E24 A;  2K5V A;  1FJG L;  2Q2U A;  3HP3 A;  2EQS A;  3CC2 A;  4JI5 L;  1KDB A;  3K58 A;  5JEA H;  3OHX C;  1FR3 A;  3X3M A;  1NE3 A;  1CSQ A;  2F0D A;  2G9H D;  4RGT A;  1O78 A;  1BUV T;  4XQN A;  1CZW A;  3MEH A;  3I8Z A;  1DOL A;  4K5V A;  4OO1 I;  2R7F A;  3G48 A;  3CCU A;  1EUJ A;  4LFB L;  1D6E C;  2MO1 A;  2XN9 C;  1GO3 E;  1HTP A;  4KKU A;  4LF8 L;  4JI0 L;  4V19 0;  2KOL A;  2JJQ A;  4BY7 G;  1BKB A;  5M3F B;  4M8A A;  1UE5 A;  2K05 A;  3DM3 A;  4WJW A;  4K2L A;  4EQP A;  2NN6 G;  4G57 A;  1Y1W G;  1EZ8 A;  4JI3 Q;  3PQI A;  1RF2 D;  2IPK D;  3FVQ A;  3NBI A;  2BDO A;  4R4I A;  4B3S L;  2CW0 C;  5KEE A;  1HR0 Q;  5HY6 A;  4AYB G;  3VA5 A;  4TRD A;  3J80 L;  2A68 D;  1WD0 A;  4HSV A;  2IL8 A;  4U67 3;  1CZG A;  2RQX A;  4DUZ L;  5M3F H;  1F9Q A;  2ZXP A;  3HKZ G;  2FIN B;  2EJM A;  4HTH A;  1IL2 A;  2YTV A;  2IX1 A;  2EE1 A;  2K1B A;  2K33 A;  4OWX B;  1B53 A;  4ILW A;  1HR0 W;  4A3E B;  1TU2 B;  3RZO B;  3OW7 A;  1N34 L;  4C2M B;  5ELC A;  1XMO Q;  4RG1 A;  1STG A;  3CKI B;  1C7Y A;  3H0G G;  2K28 A;  4C56 C;  3J81 L;  2A5H A;  4A93 B;  1AE2 A;  1YHQ A;  1QOH A;  2J7Z A;  4J6H A;  2WAQ B;  1RCV D;  4HR7 B;  4IOC A;  2OWO A;  3AEV A;  5AFW A;  3J7A F;  4KKS A;  4A3L G;  1PTO F;  2F4I A;  5I6Y A;  3HOU B;  5J3B A;  4DN4 M;  2E76 C;  1WCM G;  3G6E A;  1XPO A;  1IBL L;  4R1J A;  1Y8P B;  5IGF A;  1M1K C;  3K7A B;  2Y0S B;  4A3E H;  4HED A;  1FD7 D;  1OXT A;  3RZO H;  1H9S A;  4C2M H;  1II3 A;  2SOB A;  2RDH A;  5IE8 A;  4EVO A;  4HJA A;  2KCT A;  2FJ2 A;  1DJR D;  5JJZ A;  1V1P B;  2VUM B;  1XTD A;  3QR8 A;  4A3I B;  4NXN Q;  3HOU H;  1C9O A;  2B3G A;  3I90 A;  1W6K A;  2WFW A;  5E3F A;  4DV5 L;  1A6X A;  1TKW B;  4IPG A;  4ZLT F;  3D4W A;  1A2U A;  3K7A H;  2AKW B;  1U9R A;  2EY5 A;  2KEE A;  3KDF B;  2QA4 A;  1JCK B;  4GOP A;  1ET9 A;  4CHT B;  1G2T A;  3S14 B;  3GV6 A;  2A6E D;  2OT2 A;  4DV3 L;  1R4P B;  1YNJ C;  2VUM H;  3DHQ A;  1N32 L;  1TS3 A;  4HJ9 A;  4A3I H;  1G2S A;  2TSS A;  4PNY A;  5M3M G;  4GN3 B;  2ZM6 Q;  3D8G A;  4KD3 A;  3H15 A;  3MAQ A;  5IP7 H;  2B2W C;  2SDF A;  3SHL A;  3CCJ A;  1K0S A;  3DEP A;  2WAQ G;  1K83 B;  3S14 H;  1LT5 D;  3M4P A;  1UEA B;  3PF5 A;  1CK1 A;  3HKS A;  1EOT A;  2N8N A;  1Y1V B;  1HNZ Q;  4YWL A;  2PQE A;  1RDP D;  4JYA Q;  1HRJ A;  3MXU A;  3HS0 C;  2L12 A;  1VQ4 A;  2A73 B;  2UXD L;  4Y52 H;  4B3R Q;  1BBU A;  1H9J A;  3ZJY C;  3A8J E;  1YNJ D;  2NUC A;  4RMF A;  4G7H C;  3IAY A;  5EKL A;  4LUV A;  2DGY A;  1LM0 A;  3DEO A;  1K83 H;  1EZ6 A;  2LFN A;  4XT1 B;  2E2H B;  2JA5 B;  1AE3 A;  4ZCK A;  1QZH A;  2K5Q A;  1I4G A;  4CGY B;  1K9M C;  1VQ5 A;  4IUP A;  2LS0 1;  1Y1V H;  4N8X 1;  3M4Y A;  1NBW A;  2YTY A;  5IYC G;  2NVT B;  1SEB D;  3A0J A;  2RCF A;  1VQF A;  2I5M X;  1VCI A;  3RLF A;  1FNW A;  4LF6 L;  1EQR A;  4L6T B;  3A74 A;  1A62 A;  4O2D A;  1GHK A;  2CHB D;  4B3M L;  2E2H H;  2JA5 H;  3K6O A;  5E1F A;  4DK6 C;  4DNR B;  2Y0S E;  4FF2 A;  4JI6 L;  3NSW A;  3E5S A;  5T1G A;  4DR7 L;  3IL8 A;  1KAW A;  1PTO D;  2ICI A;  2NVT H;  3A5U A;  4UHV A;  2Z4I A;  1QVC A;  3OYY A;  3WDN A;  4F88 A;  1ASZ A;  1EY4 A;  1MBY A;  4DR3 Q;  2A8V A;  1H9K A;  3U9O A;  2PQA B;  1WVL A;  3F8T A;  3S16 B;  1KRT A;  3CCQ A;  1LLR D;  4I7Z C;  2PZW A;  3MEF A;  4QUF A;  1EL0 A;  2ZXO A;  1AW7 A;  1SYF A;  1YZ6 A;  2XRS D;  4IUQ A;  4GNX A;  4ULL A;  4KHP Q;  1NSN S;  2F1M A;  1DZ1 A;  4JI7 Q;  2CQA A;  1UUP A;  1F2L A;  3RLN A;  1CKN B;  2PNH A;  5DAU A;  4X66 Q;  4IFD I;  5BR8 L;  1IKL A;  5CC4 A;  3S16 H;  2L15 A;  1BCP B;  2HIV A;  2O5I C;  3K5L A;  5C3X A;  2I5H A;  4PG3 A;  5C3E G;  4CJ0 B;  2CVR A;  4GLA C;  4K6D A;  4G7O C;  1E0B A;  5GRO A;  1QB5 D;  4UP7 A;  1N33 Q;  3CXC A;  5EAY A;  1Q1B A;  1XNR Q;  3KLS X;  4K8I A;  4Q5V A;  2K5H A;  4F87 A;  4R4Q A;  2P5Z X;  3BVM A;  5FLM H;  3K5O A;  5EJW A;  4DV7 L;  1QJO A;  1QIL A;  2F0S A;  5C0X I;  1H9M A;  1VMP A;  1GUS A;  2B2Y A;  2R6G A;  1JT8 A;  4ZYS A;  4JBW A;  2F0H A;  3J7A V;  2MFI A;  5K36 H;  2PO4 A;  3GTJ B;  2I5L X;  4XXE A;  4ID6 A;  1WYD A;  4CDE C;  1Q81 C;  4DUY Q;  4HMI A;  1DYQ A;  4LF4 L;  3MXP A;  2R93 G;  4BBR B;  5IOD A;  4JC0 A;  2AQ3 B;  2ICE C;  3DWA A;  4A3M B;  1VQA A;  4LWC A;  3TSS A;  2Q8R E;  3GDE A;  1KRS A;  3ULP A;  4DV1 L;  4YWM A;  1B70 B;  4N9T A;  1HXY D;  2DNC A;  3OPO A;  4B9W A;  3GTJ H;  5FLM G;  3HOY G;  2PZT A;  1EFI D;  3JAM c;  4KK7 A;  2B2U C;  4KJN A;  1HA6 A;  2K50 A;  2B2W A;  2PI2 E;  2CFM A;  4BBR H;  2JK8 A;  2K4K A;  1A63 A;  3CP0 A;  1GUO A;  1LTI D;  1ICF B;  1I4Q A;  3TN2 A;  1LTA D;  2UXB Q;  1RKN A;  2MNA A;  4A3M H;  1WD1 A;  4PMW A;  4FNF A;  2F3W A;  4LF5 L;  1STH A;  1R4Q B;  2Z1C A;  4FF1 A;  3WOF A;  2NVQ B;  3CMA A;  2WKC A;  2N3S A;  3PIP 3;  4DR6 L;  4OWT B;  2D2C C;  2CWA A;  1PXU A;  2RHS B;  3SR1 A;  1KIX A;  3I72 A;  2F0V A;  3PO3 G;  1E3P A;  2YU9 B;  2UUB L;  1S5D D;  1QZG A;  1NJI C;  4DAP A;  5FO8 B;  4R4O A;  1PDQ A;  1K73 C;  2R7Z G;  4NPS A;  4IUN A;  1MSH A;  1DCZ A;  4GOP B;  2ZT9 C;  1SRU A;  1YJ9 A;  2NVQ H;  1PH1 A;  1NAP A;  1T5E A;  4DK1 A;  4DNT B;  1HR0 L;  1NMG A;  2G9D A;  3E9I A;  4DV0 L;  4OWW B;  3ULJ A;  3LX0 A;  5GQO A;  2RKS A;  1A0I A;  1TR5 A;  5EQ0 A;  2YU9 H;  2JYO A;  1SE4 A;  2XIW A;  2KEC A;  5EBD A;  4KD4 A;  3ND8 A;  4L63 B;  1V9P A;  1EYA A;  4FVM A;  5E4X A;  1R9T B;  1I3Q B;  1W3S A;  4BA2 I;  5K5P A;  5D3I B;  1HNX L;  2HD3 A;  2Q2I A;  4H13 C;  1EEI D;  2N55 A;  5KGU A;  1WTP A;  3TQY A;  4FXD A;  2D0P A;  4C3H B;  3GQB A;  4BS9 A;  1XMO L;  3NXW A;  3CF5 A;  2E2J B;  2TMP A;  2GA4 B;  3P75 A;  2Q2H A;  5C4X G;  3PV0 A;  3W1B A;  3A54 A;  1E22 A;  2LSS A;  4HSP A;  4X62 Q;  1AZP A;  2AWO A;  4DK3 C;  1U4M A;  1OTC A;  4PZ6 A;  4HCE A;  2QEJ C;  5GAH C;  1JE4 A;  4RCO A;  4LK1 C;  4JI1 L;  1R9T H;  1I3Q H;  4NXM Q;  1BOS A;  3I4N G;  2XNA C;  1Z9F A;  2VXW A;  1B8A A;  1PFM A;  1SBB B;  3IFD A;  1X32 A;  3S2H B;  4RGO S;  4C3H H;  2JA8 B;  3PCO B;  2E2J H;  3I91 A;  2ASB A;  4GZY C;  1A8V A;  1XWE A;  3BYY B;  5C5L A;  1BVS A;  2CH4 W;  3TME A;  3V2T A;  3I4O A;  1M90 C;  4GKJ Q;  1BQQ T;  1CM9 A;  1GHJ A;  4NXN L;  5EKK A;  2F52 A;  2EIF A;  2QGQ A;  4GN4 B;  5JVH 3;  1NR4 A;  1SSO A;  5KYL A;  3HOW G;  3QG1 A;  4K14 A;  2F4V Q;  3EQL C;  4FYD A;  2MUY A;  1OXV A;  3S2H H;  2JA8 H;  2EYO A;  3HG9 A;  1BDO A;  3HZX A;  5I2X A;  2A69 D;  3NEM A;  3NK9 A;  1TWH B;  2MHV A;  4DAY A;  2J0T D;  3KF6 B;  3R2T A;  4MHE A;  1B50 A;  1G6Z A;  3KLW A;  1F77 A;  2FHT A;  4EQ5 A;  1SDF A;  2AUJ D;  4FXK C;  3FPP A;  3J80 i;  4KY7 A;  1YI2 A;  4MNO A;  5IYD H;  3F2U A;  2RDG A;  3T56 B;  4A76 A;  1ASY A;  4UP9 A;  1PH4 A;  1ZXT A;  4IAL A;  4OGQ C;  1J5E Q;  3PMF A;  3CW2 C;  3R8B A;  2IJ0 A;  4GN5 A;  1TWH H;  3IRB A;  4GNX B;  3VR2 A;  1H9R A;  2ZXR A;  1SYC A;  2JN4 A;  4X65 Q;  2R92 G;  1HNZ L;  4A3G G;  1RHP A;  3SGI A;  1PRT B;  3VYS A;  5DLQ E;  1XNQ L;  2MQH A;  3J81 i;  3IKJ A;  1VQE A;  4JI2 L;  5DEH A;  4POG A;  5CMD A;  2I07 B;  4DR4 L;  4LAA A;  2B2U A;  3FRP B;  4JV5 Q;  1TWC B;  4BY7 B;  4GKK L;  3BZK A;  2K04 A;  1CA5 A;  1RTO A;  1MJC A;  1Y14 B;  1SNQ A;  1Y1W B;  4YY3 L;  2ZTD A;  4B08 A;  2PZU A;  1Y8N B;  3ULL A;  4KHZ A;  4AYB B;  1A3U A;  2F0T A;  4RA8 A;  3ERS X;  5J39 A;  1KNA A;  4WRD A;  3T51 B;  1EFW A;  1TWC H;  3FKI B;  4BY7 H;  4XYO A;  2D0O A;  4AQY Q;  3T16 A;  3HKZ B;  3NPP A;  4IJL A;  1KHI A;  2HDM A;  2KHS A;  2RVL A;  4DKA C;  2NN6 H;  1STE A;  1LO5 D;  1Y1W H;  1TS2 A;  3RZD B;  1IW7 D;  2ENB A;  1S4Z A;  2K6A A;  5KND A;  3D31 A;  4JI8 Q;  4DR3 L;  1TWG B;  3OIP A;  1X3G A;  1Z47 A;  1A15 A;  1CQV A;  2HQL A;  3H0G B;  4PQX A;  2EXZ A;  1SYB A;  5GAE C;  3P20 A;  3CHB D;  4NMZ A;  3R93 A;  4B3T Q;  4DF7 A;  2OTJ A;  4F8M A;  3FKI H;  1PYW D;  1V8Q A;  1VQD A;  5IGC A;  3SVM A;  3K7U C;  2F0G A;  3E0E A;  1WTR A;  1PFB A;  1FL0 A;  1VS0 A;  4A3F G;  4GLV B;  2OQK A;  1CHP D;  1WCM B;  4L5R C;  1JOQ A;  3AFQ A;  3RZD H;  2F03 A;  1VQH A;  4JI7 L;  4IFD G;  1JOK A;  2VZA A;  3L7Z C;  1TWG H;  1S5C D;  3HOV G;  4I7A A;  5D14 A;  4X66 L;  2NB0 A;  5FK9 C;  3H0G H;  4XQQ A;  1SMX A;  2K7V A;  3AFP A;  3G71 A;  4A3K H;  2VQE Q;  1HH2 P;  1EEF D;  5CBA E;  5IT9 E;  4EQO A;  4A3L H;  4XIG S;  3PUW A;  4L8J A;  2PNR C;  1UEB A;  1SYG A;  4IUV A;  1WCM H;  1V43 A;  1N33 L;  2G5D A;  3D6W A;  4L5S A;  1UE7 A;  1XNR L;  1OXU A;  3GO5 A;  4BY1 G;  3QOL A;  5JJK A;  3L9A X;  3FKI G;  4KV6 A;  4LUO A;  3E9H A;  3HEJ A;  3I3C A;  3C2P A;  4EQN A;  3VYR A;  1NMF A;  2K75 A;  4MTN A;  4WFN 3;  3PIO 3;  2ZJP A;  1I6H B;  4C3I G;  4CJ1 B;  1LV9 A;  1YNN C;  5M3M B;  1OXX K;  1A2T A;  2VQF L;  4CDF C;  4QY7 A;  4LFC L;  1PTO H;  2BE5 C;  2M00 A;  1PH2 A;  3OW2 A;  4DUY L;  1L0W A;  1WTH A;  4A3K G;  1KLG D;  3UE1 A;  1B9M A;  4WJ4 A;  4IUR A;  3KLR A;  3HOX B;  1L1O B;  1Z7T A;  2KBN A;  1Q8K A;  3ITP A;  2LMC B;  2CW0 D;  2KEN A;  1PRT C;  2Z6K A;  1I6H H;  1B9N A;  1WTV A;  5GAD C;  1OO9 B;  5L37 A;  1ICW A;  4AYB E;  3Q23 A;  1N36 Q;  5M3M H;  4UDU C;  3CCE A;  4NP5 A;  1HZB A;  5J1Z A;  5FKA C;  1KTK A;  2F3I A;  1EIH A;  4JCV E;  2F0K A;  5JPN C;  1VDZ A;  2HHH Q;  3HKZ E;  3HOX H;  5FLX c;  1FYC A;  2F0W A;  1ROD A;  2LXJ A;  4R8N A;  4DAM A;  1C0A A;  2BA1 A;  4DR2 L;  4K0K Q;  1E2W A;  3KF8 A;  4K5W A;  2VS1 A;  1HFN A;  3W5O A;  3KK7 A;  1GVP A;  4DA2 A;  2HIX A;  1K3B C;  5ELD A;  2HT1 A;  1B7Y B;  1RIP A;  3OTO Q;  1XMQ L;  3J7A 5;  1YIT A;  3PIO A;  3A7A B;  1JWS D;  1D1K A;  4DR1 L;  2KCN A;  3OMC A;  1V1O A;  2B2T C;  2A19 A;  2FXQ A;  3SK6 A;  3TEH B;  2Z0S A;  4O1N A;  1HNW L;  1KDC A;  3K5M A;  3VR5 A;  2JA6 G;  1IBK Q;  1ZYR C;  4JG2 A;  2F0Q A;  1I94 L;  5ELN A;  5KIX A;  4UAI A;  5IYC H;  3S2D B;  3HOX G;  2OXP A;  2F0E A;  2R61 A;  1VQO A;  1JB3 A;  1STY A;  2QKI C;  3T1Y Q;  4KMU C;  3U50 C;  4R8I A;  4POF A;  4DXF A;  1X3Q A;  1D7Q A;  1YVC A;  4JBJ A;  1U5K A;  1VQG A;  3DWQ A;  3R3O A;  5EPL A;  4GS3 A;  4OXP A;  1T5X D;  2QF7 A;  3VR6 A;  3ZYY X;  3NTH A;  1TXY A;  1X3E A;  3OIQ A;  2ALY B;  2GN5 A;  1E2V A;  1GD7 A;  5IT9 L;  1A3T A;  3S2D H;  5JJI A;  1YJN A;  1XJV A;  2F0I A;  2C35 B;  3KBX A;  4RHS A;  1O7L A;  2F0J A;  3K8A A;  2PMZ B;  4YCW A;  3RN2 A;  1PH5 A;  4LF9 Q;  2NWG A;  3EA6 A;  3TP7 A;  1LYL A;  2D9U A;  4QIW B;  1N9W A;  2RBM A;  3GTK B;  3Q0A A;  1SXT A;  1RL2 A;  1VMC A;  2LY7 A;  2EYM A;  5T1I A;  2EXD A;  4CDC C;  5C3E B;  4DV4 Q;  1N8R C;  1BXT A;  2WAQ E;  2N78 A;  1O7Z A;  2Q8I B;  3UDG A;  1CTM A;  3T1H Q;  3RR5 A;  1SAP A;  4JVZ A;  4ODG A;  5TSS A;  5A35 A;  1ENA A;  1MSG A;  3DM1 A;  5I4D A;  4H7B A;  1HUM A;  3V96 A;  4C1N K;  2RHQ B;  1XPU A;  2BA0 A;  1K8G A;  4QF4 A;  2HDL A;  5CV7 A;  1TWA B;  4QMG A;  2WIN B;  3NBH B;  1E7Z A;  5AJ3 L;  3M3Y B;  3GTK H;  3MXN B;  2JXM B;  5C3E H;  4QCL A;  1SE8 A;  4JBK A;  1QUQ A;  4CKC A;  2HUG A;  2JE6 I;  1L1O C;  5BN5 A;  1PMR A;  2F4V L;  2IY5 B;  2NBF A;  4IJH A;  5KRU A;  1SNO A;  4A3D G;  3CC7 A;  4RHR A;  1BF4 A;  3MA2 B;  3GTG B;  3D4R A;  2R93 B;  5EPK A;  4XQJ A;  5A2Q E;  1TWA H;  4CJ2 C;  1FJG Q;  3P1H A;  3M3Y H;  1LT4 D;  1LTR D;  4JI5 Q;  2BDN A;  4OIJ A;  5C4Z A;  2JQO A;  2F0N A;  1CHQ D;  4Z9C B;  3MWY W;  5EPJ A;  3N52 A;  4DV6 Q;  3HOY B;  1S3O A;  3BZC A;  3GTP B;  2AWN A;  1D5X C;  3GTG H;  3ND9 A;  3NP8 A;  3KJO A;  4LFB Q;  2R93 H;  5CV5 A;  2O4X A;  3PO2 G;  1QVF A;  4LF8 Q;  5ELF A;  5KNC A;  4X65 L;  2UU9 L;  1HQM C;  3J81 j;  2MO0 A;  1ESF A;  1PH9 A;  1KNE A;  4ZKB B;  1V1Q A;  3PF4 A;  3EJI A;  5LMN Q;  3TRE A;  2I0Q A;  5M5W B;  2DY7 A;  3CQZ B;  3HOY H;  3MFY A;  3GTP H;  2ZTC A;  2NYZ D;  5M5Y B;  2XTI A;  4P74 A;  5JAV A;  2NN6 I;  1I6V C;  3E3X A;  2OTL A;  2IX3 A;  1PFS A;  3TDQ A;  4B3S Q;  3TZD A;  1SE3 A;  3PO3 B;  4A3C G;  1UE1 A;  1DM0 B;  1Z6H A;  3H3V H;  1ILP A;  2WB1 G;  2R7Z B;  2WV6 D;  4RKB A;  1EQQ A;  1S40 A;  1FNU A;  2PMZ E;  3CCM A;  4DUZ Q;  4DV2 L;  1LUZ A;  4OO1 H;  2UUA Q;  5M5W H;  4K2K A;  1EU3 A;  3CQZ H;  1XYI A;  2ES2 A;  4BA1 I;  5IYB G;  1LT3 D;  5M5Y H;  4HMJ A;  4JPB W;  1PYS B;  5FOB B;  3Q8D A;  1VQ9 A;  3PO3 H;  4DR5 L;  1HHV A;  1NY4 A;  4O0A A;  2B2T A;  2EY1 A;  1D1I A;  1BCP F;  2B2V C;  4MIU A;  4AH6 A;  4MZ9 A;  2R7Z H;  1X3F A;  1HJP A;  4AQY L;  1D5M C;  3P7J A;  1SRO A;  4LUZ A;  1YBY A;  2WII B;  2I46 A;  3MHB A;  4UP8 A;  1K28 A;  3PUZ A;  1PH8 A;  3MVV A;  4PMB A;  2UXC Q;  4B9X A;  1KL9 A;  4DXG A;  1IBL Q;  5CR3 A;  4JI8 L;  3BJU A;  1JIC A;  3SXH A;  2DN8 A;  3GP7 A;  3I4L A;  5C4X B;  4OHJ A;  2LKV A;  2DJF C;  1H9S B;  1SLJ A;  4OO1 G;  4NDX A;  4S3S A;  2PYK A;  4IN3 A;  3CME A;  1FNV A;  4NB3 A;  2JP1 A;  3I4N B;  4JOI C;  5I9P A;  1PH6 A;  2CKZ B;  3E6Z X;  1E1O A;  3IFT A;  1NTG A;  3KF8 B;  3LGJ A;  4LF7 Q;  2NTS A;  5CBE E;  2XVS A;  3F1Z A;  3EIV A;  2E74 C;  5C4X H;  5COY A;  3TP5 A;  1MKH A;  1SN8 A;  1SNP A;  4JI3 L;  2PPB C;  1JB7 A;  4V0B A;  4F7X A;  1GOZ A;  1P8L A;  3A8K E;  2XRQ D;  1YHB A;  3Q22 A;  3I4N H;  3HOW B;  5CV8 A;  4CBV A;  1GUG A;  1HZA A;  4PV1 C;  3BYT B;  1Y8O B;  3TBI B;  1TY0 A;  1Q46 A;  1TWF B;  4APV A;  2VNU D;  4RFB A;  1VQC A;  2EYF A;  2XWJ B;  3CCL A;  1VQK A;  3J80 c;  3K57 A;  3A55 A;  2JSO A;  4CKB A;  4CDD C;  3HRZ C;  3STB C;  1IYJ B;  4RGM A;  2EPB A;  1CA6 A;  2C5C A;  1BCP C;  1EY9 A;  1X3P A;  4JK1 C;  3HOW H;  2UXD Q;  2B8G A;  1KQS A;  3G7L A;  5IP9 G;  3S1R B;  2EYJ A;  2FMM A;  1EWI A;  3M7G A;  5CGK A;  3BDC A;  4X3K A;  1TWF H;  2J4X A;  3JAM E;  2BOS A;  2IT1 A;  4A3G B;  2R92 B;  3J81 c;  3UDI A;  3VDY A;  1KAA A;  1DXM A;  4YCV A;  1JC7 A;  3MC0 B;  3GD7 A;  2NVX B;  2Z6B A;  4ABN A;  3QWN A;  2B63 G;  4H44 C;  3T13 A;  4DK0 A;  1V1P A;  3S1R H;  3G6J B;  2HHH L;  3BDL A;  4KJO A;  1DD2 A;  4LF6 Q;  2EYL A;  4I65 A;  3SK5 A;  4JW0 A;  1K8O A;  4TKO B;  5C44 B;  3STB D;  2X6L A;  1VQL A;  1BCP D;  4A3G H;  2R92 H;  2FFK B;  4K0K L;  3KDF A;  2EYP A;  1JR0 D;  4JBM A;  2WAC A;  4Q0F A;  2SEB D;  3H94 A;  5H1S E;  3ERO A;  3VR4 A;  4JI6 Q;  4DR7 Q;  1CT1 D;  4FO2 A;  1X56 A;  2NZ1 D;  2NVX H;  4UPA A;  4HN7 A;  5CV4 A;  1F2Z A;  4C3J B;  1XPR A;  1AH9 A;  2L11 A;  1E1T A;  4RKL A;  5EBC A;  1HZ9 A;  2JEB I;  4LFA Q;  3M7N A;  5C44 H;  2AQ1 B;  2ZM6 L;  4A75 A;  2MP1 A;  4IPH A;  3HOZ G;  4Y7N B;  4ZUJ A;  4J1M A;  2YYZ A;  1AEX A;  2SNM A;  2L4N A;  1B4O A;  5IGG A;  1PZI D;  2QDL A;  1MHW C;  3L3O C;  5EGT A;  1EY5 A;  3CPF A;  5F2D A;  3KOJ A;  3GTO B;  2KA7 A;  5C3W A;  3AMU A;  4KY6 A;  2XSC A;  1A3V A;  1QE6 A;  4C3J H;  5I2Y A;  1AFP A;  4EGV A;  3GTM B;  4JYA L;  4IOA A;  2KUM A;  1CUK A;  1EY0 A;  1LAC A;  3U58 A;  2Z8L A;  4A3J G;  3I55 A;  3NE5 B;  4Y7N H;  1C8C A;  5BR8 Q;  4DU9 A;  4B3R L;  2AMC B;  1Q82 C;  1G8Z D;  4IO9 A;  2A1A A;  4P71 A;  1VQP A;  2X69 A;  5KNB A;  4A3F B;  2B2V A;  2QIL A;  4RGN A;  2QDB A;  1JWU D;  3QIA A;  5C44 G;  1M8A A;  3GTO H;  4QQB X;  4GOP C;  2K32 A;  1YEZ A;  4PMC A;  4P73 A;  2DJG C;  3HOV B;  3FDT A;  1PZJ D;  4LF9 L;  3GTM H;  4IQZ A;  4N9P A;  1TII D;  4KKT A;  1X54 A;  1J8I A;  1ET6 A;  1QCB D;  2H1E A;  1WTO A;  3CPW A;  2WKD A;  2IHE A;  3RD4 A;  5IWA Q;  3BVG A;  3JC6 6;  4DAV A;  4A3F H;  4P72 A;  4C3J G;  1S5E D;  5ELE A;  3EN2 A;  3T1H L;  1YHA A;  1EOV A;  1J6Q A;  4BY1 B;  4IFD H;  2DNE A;  3HOV H;  2PI2 A;  1K3R A;  3AYH B;  3F2D A;  1CKM A;  1KAB A;  2F0M A;  4OL7 A;  4TVA B;  2XWB B;  3F2C A;  4ZQ3 A;  4C3I B;  3I7F A;  5DM6 3;  1BBW A;  5FJ8 G;  1B44 D;  3JAM L;  1VQB A;  3DLL A;  2WP8 J;  1PRT F;  1NUC A;  2RDF A;  5CV9 A;  2ID0 A;  1VQJ A;  1JJG A;  2PQA A;  4DV1 Q;  3MFG A;  2C9O A;  1K0R A;  2EY2 A;  2MPM A;  4A3K B;  4BY1 H;  1F9R A;  2NZH A;  3VYU A;  3NTK A;  3K0Y A;  2O2L D;  1I4R A;  4O42 A;  1DOM A;  4OIK A;  2F0F A;  3A8I E;  4KHP L;  3H09 A;  4C3I H;  1L2F A;  1VQN A;  2JA7 G;  2L5T A;  5M5X B;  4OON A;  2A68 C;  1CKN A;  4LF5 Q;  3H3V I;  1HPC A;  3K5N A;  4DV6 L;  3BU2 A;  4CKE A;  1HCZ A;  1HZC A;  1VQI A;  1IYV A;  1U0L A;  1C4Q A;  3I2Z A;  1IL8 A;  3DWP A;  4DR6 Q;  1STA A;  4XTC S;  1HTL D;  1QNK A;  4BBS G;  5EKI A;  1PTO B;  2UUB Q;  1VQ7 A;  1ZKO A;  1GUT A;  5M5X H;  1F2M A;  3T53 B;  2F0O A;  1MGS A;  5LMN L;  2X6G A;  4X64 Q;  5C0X G;  3S24 A;  2EVB A;  4KI0 A;  1U4R A;  1GKH A;  1EY7 A;  3RMH A;  4HJ7 A;  1SR3 A;  3GTQ B;  4ZUI A;  3Q24 A;  5JEA G;  1LAB A;  1IZ6 A;  3GTL B;  4QGU A;  2IW3 A;  4DV0 Q;  2JA6 B;  1S5F D;  1I5F A;  4GNX C;  4PZ8 A;  3ER0 A;  4L5Q A;  3TP8 A;  2UUA L;  5LMU Q;  2EYH A;  4K5X A;  2KED A;  1HNX Q;  3VR3 A;  3BG3 A;  3MZ5 A;  3J7Z C;  3GTQ H;  4NKL A;  5FO7 B;  4ME3 A;  4OEL B;  1CFM A;  1MI2 A;  3GTL H;  3W3A A;  2JA6 H;  1CI3 M;  1EIG A;  2ZJQ A;  1JOR A;  2PW5 A;  3SE0 A;  4P75 A;  1SNM A;  5COR A;  5D3D A;  3WOE A;  2EY6 A;  1EQT A;  1YNX A;  3D0F A;  2Q2T A;  5E7N A;  5IIF A;  2A6E C;  2H5X A;  5IOC A;  2CQO A;  1UE6 A;  1YNN D;  4KN4 C;  4JI1 Q;  4DFA A;  2UXC L;  2UXB L;  3U4V A;  2UUC Q;  2O5J C;  3KBG A;  2BE5 D;  1LTG D;  1LTS D;  1MJE A;  5M3F G;  4DNI A;  3B6Y A;  1SYD A;  2B2Y C;  4A93 H;  4N8F A;  2PW7 A;  2VY3 A;  4HIK A;  4LMQ D;  1JE5 A;  1PRT D;  3QB3 A;  1XXG A;  1CQF A;  2QCP X;  3HGB A;  4KHV A;  3CCS A;  1J9O A;  3F2B A;  1MIU A;  1ENC A;  3X3N A;  2R3Z A;  2E5L Q;  4LF7 L;  4IUU A;  3NQI A;  4FDB A;  3VYT A;  4OX9 Q;  2A74 C;  4X3T A;  3S1M B;  2K5D A;  3H91 A;  3D3R A;  1GM5 A;  2M9V A;  3PGZ A;  4KN7 C;  1NR2 A;  4DAY B;  1IYU A;  3NHH A;  4YCU A;  3BDO A;  4A3E G;  1TS4 A;  1UAP A;  4LJZ C;  4KY5 A;  1EYD A;  3I4M B;  3A5Z B;  3TP6 A;  1Y69 U;  4A3D B;  2N49 A;  1RJT A;  1B2T A;  1IKM A;  5ISR A;  3EBE A;  4EX5 A;  4A93 G;  4DPG A;  1IBM Q;  3FMC A;  2ZJR A;  3VA7 A;  3CCR A;  3S1M H;  2BCO A;  2HCC A;  5DM7 3;  4HJ8 A;  3TS2 A;  3J7Y W;  3HOU G;  1HUN A;  2E75 C;  1WFQ A;  1ILQ A;  4DGZ A;  3CRL C;  3NQT A;  2VW9 A;  2Y0S G;  1ZYR D;  4GLX A;  3URY A;  2D5D A;  1SJH D;  1TT2 A;  3AQQ A;  1ONL A;  4JI4 Q;  3EFX D;  3I4M H;  3FHW A;  1XNQ Q;  4A3D H;  5C4H A;  4JI2 Q;  4YIJ A;  1PTO C;  4HIM A;  2F3V A;  4E6I A;  4LNQ A;  4X62 L;  2OEO A;  1WI5 A;  4IPD A;  3PO2 B;  2VUM G;  2IX0 A;  3NEL A;  4H02 A;  1CKO A;  4NXM L;  4A3I G;  4DR4 Q;  3M85 A;  4HCS A;  1SJE D;  3DXJ C;  5FLX E;  2GVA A;  5IP7 G;  4GKK Q;  2CCZ A;  4R4T A;  3I56 A;  2Q8T A;  1PH7 A;  3G4S A;  4J15 A;  3C3L A;  5CV6 A;  1JJC B;  3MXG A;  4ZKC B;  2DUD A;  3ERQ A;  4YY3 Q;  1I4H A;  1BBX C;  5G3L F;  3KLS A;  1UWV A;  1M4V A;  2B8F A;  2L55 A;  4YHH Q;  2MGS A;  1B1Z A;  4GKJ L;  1FGU A;  4IPC A;  4QB4 A;  1EY6 A;  3PO2 H;  1D2B A;  3PUV A;  4R9W A;  1U4L A;  5C4J B;  1F9S A;  2OCE A;  2WB1 B;  1O80 A;  1UNS A;  3QJY A;  1I4P A;  4FP5 D;  4UY8 C;  1JWM D;  3U9S A;  5LHY 1;  4A4I A;  1FGB D;  1TVX A;  3I4M G;  1DGS A;  2QW7 A;  1I50 B;  1Q3L A;  1TS5 A;  3KF6 A;  4TQU S;  4HID A;  4IUT A;  2RCN A;  1T9H A;  2HCI A;  1W2B A;  3D4D A;  4LFA L;  3S17 B;  1Y1V G;  1VQ8 A;  4A3C H;  2YTX A;  3M9B A;  5C4J H;  3K81 C;  4YWK A;  3QOJ A;  4XYQ A;  4QL5 A;  2XGT A;  5IGE A;  1KLU D;  1J5E L;  2H4O A;  5JVG 3;  3PUX A;  1I50 H;  2CWP A;  1VQ6 A;  5IYB H;  3GV3 A;  3S1Q B;  4JI0 Q;  3FPU B;  2JA5 G;  1OXS C;  1FVI A;  2E8G A;  1F9P A;  4NW2 A;  1NCV A;  1VF7 A;  3S17 H;  2CH4 A;  3NUC A;  4XDX A;  2NVY B;  3RNU A;  1PVO A;  4X3S A;  4RAU C;  1XTC D;  1LTL A;  3PSI A;  1PYB A;  1PV4 A;  1EIY B;  1W6J A;  1X9N A;  2F0P A;  1JOO A;  3UDF A;  3SEB A;  3PUY A;  3W2D A;  1YIJ A;  1EIF A;  4JV5 L;  3S1Q H;  2L1B A;  2VB3 X;  3NWS A;  1I4X A;  3OWE B;  2JA9 A;  4PZ7 A;  4BWG B;  5LMN W;  2K52 A;  2NVY H;  3E0J A;  1VQM A;  4ZRZ A;  1LTT D;  4M1U B;  5IWA L;  1L0Y B;  4QIW E;  4BXX H;  2L9H A;  2E2D C;  3U4Z A;  2ATW A;  1GXD C;  4R4C A;  4K6L A;  4LW1 A;  2VQF Q;  1N34 Q;  3CRK C;  4LFC Q;  2K14 A;  5IGD A;  1AN8 A;  3LWE A;  3K80 C;  1QG7 A;  1ESR A;  3OOC A;  3WWV A;  1X55 A;  3D6C A;  2HQE A;  4A3B B;  1EWH A;  2NTT A;  3TRZ A;  4RWS C;  1TY2 A;  2QEX A;  1KDA A;  3SK4 A;  3S9W A;  2LXK A;  4FF3 A;  3OMG A;  1C48 A;  2OQ0 A;  4IZ8 A;  1RD9 D;  5JJL A;  3K0X A;  4K8J A;  3M4Q A;  1ML0 D;  1STB A;  3C1E A;  5FLX L;  2VL6 A;  1PHJ A;  3OWF A;  4KTA A;  3SDZ A;  2V4D A;  1G29 1;  1B3A A;  1GUN A;  2WB1 E;  4B3T L;  2K01 A;  5G3L D;  3S15 B;  4WOR A;  4BXX G;  4A3B H;  3S1N B;  3O13 A;  4FF4 A;  4QJF A;  5FO9 B;  4C1N I;  3C1F A;  1AP0 A;  4HJ5 A;  4DV5 Q;  5K36 G;  2NZO A;  4DR2 Q;  1EYG A;  4WJ3 M;  4ME5 A;  4RH6 A;  2Z4H A;  3R2I A;  3I73 A;  3L0O A;  2B63 B;  4RCN A;  3HFZ B;  1G51 A;  4TSS A;  2YV5 A;  5IP9 H;  1PFN A;  2VQE L;  2GVB A;  4DV3 Q;  1XMQ Q;  3M4O B;  1QWY A;  2KHJ A;  5GAG C;  4P2C B;  3OSO A;  3S15 H;  5A2Q L;  4DR1 Q;  2K03 A;  3L2P A;  1GJX A;  1DON A;  3S1N H;  1N32 Q;  3RUZ A;  2SNS A;  2KQ3 A;  1HNW Q;  2AQ2 B;  2FMC A;  1D8L A;  1I94 Q;  3KJP A;  4KLK A;  5CYU A;  5JOB A;  1KC8 C;  4X64 L;  3W1G A;  4A3B G;  2VB2 X;  2B63 H;  1O7I A;  5I9O A;  1WTQ A;  4BBR G;  1TQO A;  3ICE A;  3M4O H;  1PH3 A;  4A3M G;  3I70 A;  2ZTE A;  3ONA B;  2MJ8 A;  3HOZ B;  3UDX A;  1EQV A;  4FXG C;  1H95 A;  5IGB A;  5HUR A;  2DY8 A;  1Q1E A;  3TZU A;  3H3V C;  2KVM A;  5E4W C;  1L1O A;  2RA4 A;  2L0C A;  2JEA I;  2K5W A;  3QO2 A;  3A7L A;  3SK8 A;  2K5N A;  5LMU L;  5BN3 A;  4IFD J;  2Z9H A;  1X6O A;  5ELB A;  1SND A;  1L0X B;  1SNC A;  4MN3 A;  5I6W A;  1JQY D;  4OEM B;  1SE2 A;  2IHF A;  3JAM i;  4J8Q A;  5J22 A;  1PLF A;  1U4P A;  5C5M A;  5C6A A;  3BZD B;  3BS1 A;  1N36 L;  2KCM A;  1WJJ A;  4A3J B;  2EDG A;  3HOZ H;  5NUC A;  4HIO A;  5HGQ A;  4U68 A;  3EVQ A;  3FP9 A;  4G7Z C;  1P16 A;  1B3Q A;  1BR9 A;  2F0U A;  2V1C C;  3PIP A;  2A69 C;  1Q8I A;  3NTI A;  2RF4 A;  2RSO A;  2EJG C;  4ZK9 B;  3CAM A;  2UUC L;  3NEN A;  3UE0 A;  3K59 A;  4B3M Q;  4HAE A;  3C46 A;  2B29 A;  5C0X J;  3LNN A;  5KYI A;  4L5T A;  4A3J H;  4ZAI A;  1WTX A;  1HA5 A;  5JEA J;  5AJ3 Q;  2AHO B;  3CCV A;  1F2Y A;  3OTO L;  2B39 A;  1EY8 A;  2EZV A; 
#chains in the Genus database with same CATH homology
 3S2D H;  5ELO A;  4XTC S;  5JJI A;  1YJN A;  4BBS G;  1XJV A;  5IY0 A;  2C35 B;  1VQA A;  1KD1 C;  3RN5 A;  4LWC A;  2UUB Q;  1VQ7 A;  1Q7Y C;  3GDE A;  1QUQ B;  1KRS A;  3ULP A;  3K8A A;  4DV1 L;  2D62 A;  4YWM A;  4YCW A;  5M5X H;  3RN2 A;  1IBK L;  1B70 B;  1PH5 A;  4LF9 Q;  2E5L L;  5LMN L;  1LYL A;  3GTJ H;  4OX9 L;  1N9W A;  5FLM G;  3HOY G;  2Z6K C;  4X64 Q;  3JAM c;  5C0X G;  3CD6 A;  1RL2 A;  3S24 A;  3RLO A;  4KI0 A;  2K50 A;  1GKH A;  2PI2 E;  4DV4 Q;  2EXD A;  4HJ7 A;  1N8R C;  2CFM A;  2WAQ E;  2N78 A;  1SR3 A;  1Q86 C;  4BBR H;  3TS0 A;  1JJ2 A;  2JK8 A;  2K4K A;  1A63 A;  3CP0 A;  5JEA G;  3T1Y L;  1G6P A;  1YJW A;  2UXB Q;  3UDG A;  1IZ6 A;  3T1H Q;  4QGU A;  4DV0 Q;  3CC4 A;  3RR5 A;  4AIM A;  2MNA A;  4PMW A;  1I5F A;  4A3M H;  4ALP A;  4LF5 L;  2BH8 A;  2KHI A;  1SFO H;  1X65 A;  2RHQ B;  4GNX C;  4PZ8 A;  2BA0 A;  1XPU A;  1K8G A;  3CMA A;  3KFU A;  3NBH B;  3ER0 A;  4L5Q A;  1IBM L;  1E7Z A;  5AJ3 L;  2UUA L;  2N3S A;  4DR6 L;  3GTK H;  4OWT B;  3MXN B;  5LMU Q;  2CWA A;  2RHS B;  1WOC A;  1KIX A;  1HNX Q;  5FJ8 H;  4X6A H;  5C3E H;  1SE8 A;  3PO3 G;  1E3P A;  4JBK A;  3J7Z C;  1QUQ A;  2UUB L;  3GTQ H;  2JE6 I;  2UU9 Q;  1QZG A;  4ME3 A;  2E2I H;  1L1O C;  1NJI C;  4R4O A;  1K73 C;  3GTL H;  2F4V L;  2JA6 H;  2ZJQ A;  2R7Z G;  4NPS A;  2IY5 B;  4IJH A;  4A3D G;  4JI4 L;  1QVG A;  3CC7 A;  2JA8 G;  4P75 A;  5IT9 c;  4GOP B;  1YNX A;  1SRU A;  3D0F A;  1YJ9 A;  2Q2T A;  1PH1 A;  2NVQ H;  5E7N A;  4DV7 Q;  1TWA H;  4DV4 L;  1FJG Q;  2H5X A;  2CQO A;  1JMC A;  3M3Y H;  1UE6 A;  1HR0 L;  4JI1 Q;  1NMG A;  4JI5 Q;  2UXC L;  2UXB L;  3U4V A;  2UUC Q;  2JA7 H;  3E9I A;  4DV0 L;  4OWW B;  3ULJ A;  5GQO A;  2YU9 H;  1A0I A;  2JQO A;  1MJE A;  5IYD G;  4JOI A;  1CSP A;  5M3F G;  4DNI A;  4DV6 Q;  3B6Y A;  4DV2 Q;  1S3O A;  3BZC A;  4LF4 Q;  2AWN A;  4A93 H;  1V9P A;  2VY3 A;  1S72 A;  3GTG H;  4HIK A;  4YHH L;  3KJO A;  4LFB Q;  1W3S A;  2R93 H;  1PA6 A;  4BA2 I;  1JE5 A;  3PO2 G;  1QVF A;  1HNX L;  1KXL A;  2Q2I A;  4LF8 Q;  4BBS H;  4X65 L;  3CCS A;  3TQY A;  1K8A C;  2D0P A;  3J81 j;  3F2B A;  1MIU A;  2MO0 A;  2UU9 L;  4DR5 Q;  1XMO L;  2BH2 A;  1PH9 A;  3CF5 A;  1IXR A;  1V1Q A;  3KYH C;  2E5L Q;  3PF4 A;  4LF7 L;  5LMN Q;  2Q2H A;  5C4X G;  4FDB A;  3PV0 A;  3TRE A;  3W1B A;  2I0Q A;  4OX9 Q;  1E22 A;  2LSS A;  1Q12 A;  3HOY H;  4X62 Q;  3GTP H;  2ZTC A;  2R7D A;  2AWO A;  1E24 A;  2K5V A;  2XTI A;  3PGZ A;  4P74 A;  2NN6 I;  4PZ6 A;  4DK3 C;  1GM5 A;  2OTL A;  1FJG L;  1PFS A;  2Q2U A;  4DAY B;  5GAH C;  2EQS A;  4B3S Q;  4NXM Q;  4JI1 L;  4YCU A;  1I3Q H;  1R9T H;  3CC2 A;  4JI5 L;  3I4N G;  4A3E G;  1Z9F A;  4A3C G;  1B8A A;  1UE1 A;  1NE3 A;  3H3V H;  2WB1 G;  1CSQ A;  1JJG A;  3A5Z B;  4C3H H;  2N49 A;  3PCO B;  1EQQ A;  1S40 A;  2PMZ E;  3CCM A;  3EBE A;  4EX5 A;  4DUZ Q;  4DPG A;  4DV2 L;  2E2J H;  1A8V A;  1LUZ A;  2ASB A;  4A93 G;  1IBM Q;  2UUA Q;  1BVS A;  5M5W H;  2ZJR A;  4OO1 I;  3CQZ H;  3CCR A;  2ES2 A;  2R7F A;  3G48 A;  4BA1 I;  1EUJ A;  3I4O A;  5IYB G;  3CCU A;  4HJ8 A;  1M90 C;  3S1M H;  3HOU G;  3TS2 A;  4GKJ Q;  2MO1 A;  5M5Y H;  4NXN L;  1GO3 E;  2F52 A;  1WFQ A;  2EIF A;  2QGQ A;  4GN4 B;  4LF8 L;  1PYS B;  4JI0 L;  3Q8D A;  2VW9 A;  2JJQ A;  1VQ9 A;  3PO3 H;  4DR5 L;  2Y0S G;  3HOW G;  4GLX A;  1NY4 A;  4O0A A;  4BY7 G;  1BKB A;  2F4V Q;  3AQQ A;  4AH6 A;  1UE5 A;  4MZ9 A;  4JI4 Q;  3I4M H;  2R7Z H;  3FHW A;  1OXV A;  1X3F A;  3DM3 A;  1HJP A;  4AQY L;  1XNQ Q;  2JA8 H;  4JI2 Q;  2NN6 G;  4A3D H;  3S2H H;  1Y1W G;  4HIM A;  4LNQ A;  1SRO A;  4LUZ A;  4X62 L;  4JI3 Q;  3NEM A;  1YBY A;  1WI5 A;  4IPD A;  3KF6 B;  2VUM G;  2IX0 A;  3NEL A;  4UP8 A;  4R4I A;  4B3R L;  4B3S L;  3PUZ A;  1PH8 A;  4H02 A;  1CKO A;  1HR0 Q;  4NXM L;  3KLW A;  5HY6 A;  4A3I G;  4EQ5 A;  4DR4 Q;  4AYB G;  2UXC Q;  3M85 A;  1KL9 A;  1IBL Q;  4JI8 L;  3BJU A;  2GVA A;  5IP7 G;  4GKK Q;  2CCZ A;  3J80 i;  4R4T A;  3I56 A;  1YI2 A;  4MNO A;  3G4S A;  4J15 A;  1PH7 A;  5IYD H;  1JJC B;  1SLJ A;  5M3F H;  4DUZ L;  4OO1 G;  2DUD A;  4A76 A;  1ASY A;  4YY3 Q;  4UP9 A;  3HKZ G;  1PH4 A;  1IL2 A;  1J5E Q;  1UWV A;  3CME A;  3CW2 C;  2YTV A;  4YHH Q;  2IX1 A;  4NB3 A;  4GKJ L;  4OWX B;  1HR0 W;  1FGU A;  1TWH H;  3IRB A;  4GN5 A;  4IPC A;  4JOI C;  4GNX B;  3PO2 H;  1PH6 A;  3PUV A;  2CKZ B;  4A3G G;  4X65 Q;  2R92 G;  2OCE A;  1HNZ L;  1E1O A;  1N34 L;  4UY8 C;  1XMO Q;  4RG1 A;  3SGI A;  1C7Y A;  4A4I A;  3I4M G;  1NTG A;  3H0G G;  3KF8 B;  3LGJ A;  4LF7 Q;  1AE2 A;  3F1Z A;  3EIV A;  5DLQ E;  5C4X H;  2MQH A;  3J81 i;  1YHQ A;  1XNQ L;  4LFB L;  1VQE A;  1DGS A;  4JI2 L;  1OTC A;  1MKH A;  1SN8 A;  4IOC A;  2OWO A;  4POG A;  4JI3 L;  3AEV A;  4A3L G;  3KF6 A;  1JB7 A;  4TQU S;  4HID A;  5J3B A;  2RCN A;  1T9H A;  1WCM G;  1W2B A;  4DR4 L;  3G6E A;  1XPO A;  1IBL L;  4R1J A;  1P8L A;  1M1K C;  4LFA L;  1YHB A;  4A3E H;  3I4N H;  4JV5 Q;  1Y1V G;  1VQ8 A;  1OXT A;  2YTX A;  4A3C H;  1HZA A;  3M9B A;  4GKK L;  5C4J H;  3BZK A;  3RZO H;  4C2M H;  3K81 C;  4YWK A;  1MJC A;  4QL5 A;  2XGT A;  1Q46 A;  5IE8 A;  1Y14 B;  4APV A;  4YY3 L;  2ZTD A;  4HJA A;  2VNU D;  2KCT A;  1J5E L;  1VQC A;  3ULL A;  3PUX A;  3CCL A;  4KHZ A;  1VQK A;  3J80 c;  1I50 H;  2CWP A;  1XTD A;  1VQ6 A;  5IYB H;  4NXN Q;  3HOU H;  1C9O A;  2B3G A;  2WFW A;  4JI0 Q;  3STB C;  1IYJ B;  2JA5 G;  1OXS C;  1FVI A;  2E8G A;  4DV5 L;  4IPG A;  3ERS X;  3S17 H;  3K7A H;  2AKW B;  3KDF B;  1EFW A;  1TWC H;  3RNU A;  3HOW H;  4BY7 H;  1PVO A;  4WJ4 A;  2QA4 A;  2D0O A;  2UXD Q;  1KQS A;  5IP9 G;  4GOP A;  4AQY Q;  4IJL A;  1KHI A;  1EWI A;  1LTL A;  1PYB A;  3PSI A;  1PV4 A;  1EIY B;  4DKA C;  1X9N A;  4DV3 L;  1Y1W H;  1TWF H;  2IT1 A;  3UDF A;  2VUM H;  1N32 L;  3J81 c;  3PUY A;  1YIJ A;  4HJ9 A;  3D31 A;  4JI8 Q;  3UDI A;  5M3M G;  4DR3 L;  1EIF A;  3VDY A;  1X3G A;  4A3I H;  1Z47 A;  4GN3 B;  3S1Q H;  4JV5 L;  2ZM6 Q;  3H15 A;  2HQL A;  4YCV A;  5IP7 H;  2JA9 A;  4PZ7 A;  5LMN W;  3GD7 A;  5GAE C;  2OTJ A;  4B3T Q;  3CCJ A;  2K52 A;  2NVY H;  3FKI H;  2B63 G;  1VQD A;  3K7U C;  1VQM A;  3E0E A;  3S1R H;  2WAQ G;  5IWA L;  2HHH L;  4QIW E;  1FL0 A;  4BXX H;  1VS0 A;  4A3F G;  4LF6 Q;  3S14 H;  4GLV B;  2OQK A;  3U4Z A;  3M4P A;  2ATW A;  4R4C A;  4L5R C;  3AFQ A;  3STB D;  3PF5 A;  3RZD H;  3HKS A;  4LW1 A;  2N8N A;  1VQH A;  1HNZ Q;  4YWL A;  2VQF Q;  1VQL A;  1N34 Q;  4JI7 L;  4IFD G;  2R92 H;  2VZA A;  4A3G H;  3L7Z C;  4JYA Q;  3KDF A;  2K14 A;  4LFC Q;  4K0K L;  1TWG H;  3HOV G;  4JBM A;  3K80 C;  5H1S E;  3WWV A;  4X66 L;  3H0G H;  1VQ4 A;  4JI6 Q;  1SMX A;  1X55 A;  4DR7 Q;  2UXD L;  4B3R Q;  4Y52 H;  1BBU A;  3AFP A;  1X56 A;  3G71 A;  4A3K H;  2NVX H;  3TRZ A;  3ZJY C;  2VQE Q;  4UPA A;  2QEX A;  4RMF A;  1HH2 P;  4LUV A;  2DGY A;  1LM0 A;  4A3L H;  1K83 H;  4XIG S;  2LXK A;  3PUW A;  1XPR A;  1AH9 A;  1E1T A;  1UEB A;  1AE3 A;  2OQ0 A;  1WCM H;  1QZH A;  5JJL A;  1HZ9 A;  2JEB I;  3K0X A;  1V43 A;  3M4Q A;  4LFA Q;  5C44 H;  1N33 L;  3M7N A;  1K9M C;  2ZM6 L;  1VQ5 A;  4A75 A;  1UE7 A;  4L5S A;  4IPH A;  1Y1V H;  1OXU A;  2VL6 A;  3GO5 A;  1PHJ A;  4BY1 G;  1XNR L;  3HOZ G;  5JJK A;  1G29 1;  2WB1 E;  1NBW A;  2YYZ A;  3FKI G;  4B3T L;  2YTY A;  4LUO A;  3E9H A;  5IYC G;  3A0J A;  4BXX G;  1VQF A;  2I5M X;  4A3B H;  1NMF A;  2K75 A;  4MTN A;  1VCI A;  2ZJP A;  3RLF A;  4LF6 L;  3CPF A;  3KOJ A;  1EQR A;  4QJF A;  3A74 A;  1A62 A;  4C3J H;  1OXX K;  4O2D A;  4HJ5 A;  4DV5 Q;  2VQF L;  5K36 G;  4B3M L;  2E2H H;  2JA5 H;  4JYA L;  2NZO A;  4QY7 A;  4DR2 Q;  4LFC L;  1EYG A;  4IOA A;  4WJ3 M;  4DK6 C;  1CUK A;  4A3J G;  3U58 A;  2Y0S E;  1PH2 A;  3I55 A;  3OW2 A;  4DUY L;  3L0O A;  4Y7N H;  4JI6 L;  1L0W A;  5BR8 Q;  4A3K G;  1KAW A;  3HFZ B;  3UE1 A;  2AMC B;  1G51 A;  1Q82 C;  4DR7 L;  2YV5 A;  2A1A A;  4P71 A;  5IP9 H;  4IO9 A;  1VQP A;  1L1O B;  2VQE L;  2GVB A;  4DV3 Q;  1XMQ Q;  2KHJ A;  2NVT H;  5GAG C;  2KBN A;  3S15 H;  1Q8K A;  4DR1 Q;  3A5U A;  3L2P A;  1QVC A;  2KEN A;  2Z6K A;  3OYY A;  3S1N H;  1I6H H;  1N32 Q;  1ASZ A;  5GAD C;  5C44 G;  3GTO H;  4QQB X;  4DR3 Q;  4GOP C;  2A8V A;  1YEZ A;  1HNW Q;  4P73 A;  4AYB E;  1N36 Q;  5M3M H;  1D8L A;  3CCE A;  2PQA B;  4LF9 L;  3GTM H;  1I94 Q;  1HZB A;  3F8T A;  1X54 A;  1KRT A;  3KJP A;  3CCQ A;  4KLK A;  2F3I A;  1KC8 C;  4JCV E;  4X64 L;  3MEF A;  3CPW A;  3W1G A;  4A3B G;  2IHE A;  2B63 H;  1O7I A;  5IWA Q;  2HHH Q;  3HKZ E;  4BBR G;  3HOX H;  3JC6 6;  1YZ6 A;  4GNX A;  5FLX c;  1PH3 A;  4A3F H;  3ICE A;  3M4O H;  4KHP Q;  4P72 A;  4A3M G;  2LXJ A;  3EN2 A;  4DAM A;  3T1H L;  1YHA A;  1EOV A;  4JI7 Q;  1C0A A;  2ZTE A;  1J6Q A;  2BA1 A;  4DR2 L;  4K0K Q;  3UDX A;  3RLN A;  1CKN B;  2VS1 A;  1H95 A;  2PNH A;  3W5O A;  2PI2 A;  4X66 Q;  3HOV H;  4IFD I;  1K3R A;  3AYH B;  1Q1E A;  5BR8 L;  3F2D A;  1GVP A;  1CKM A;  1L1O A;  2HIX A;  3S16 H;  2HT1 A;  1B7Y B;  1RIP A;  2JEA I;  2L15 A;  4TVA B;  3OTO Q;  1XMQ L;  3J7A 5;  2HIV A;  1YIT A;  4JC0 A;  3PIO A;  3F2C A;  3I7F A;  2K5N A;  5LMU L;  4DR1 L;  2I5H A;  1BBW A;  5FJ8 G;  4PG3 A;  5C3E G;  4IFD J;  1X6O A;  2A19 A;  2FXQ A;  3TEH B;  1VQB A;  2Z0S A;  3DLL A;  2WP8 J;  4GLA C;  3JAM i;  2IHF A;  5GRO A;  1HNW L;  2ID0 A;  4UP7 A;  1N33 Q;  1VQJ A;  3CXC A;  2PQA A;  5EAY A;  4DV1 Q;  1Q1B A;  1N36 L;  2KCM A;  1IBK Q;  1WJJ A;  1XNR Q;  2JA6 G;  4JG2 A;  1K0R A;  1I94 L;  3HOZ H;  5ELN A;  4HIO A;  4BY1 H;  2NZH A;  2K5H A;  5HGQ A;  3FP9 A;  4R4Q A;  5IYC H;  5FLM H;  1P16 A;  2V1C C;  3HOX G;  3PIP A;  4DV7 L;  2RF4 A;  1VQO A;  5C0X I;  4KHP L;  2R6G A;  4C3I H;  3U50 C;  3T1Y Q;  1JT8 A;  1L2F A;  1VQN A;  4POF A;  2JA7 G;  3CAM A;  4JBW A;  2UUC L;  3NEN A;  3UE0 A;  1D7Q A;  2MFI A;  4OON A;  4B3M Q;  1YVC A;  2B29 A;  1CKN A;  5C0X J;  4LF5 Q;  3H3V I;  2I5L X;  1WYD A;  4JBJ A;  1U5K A;  1VQG A;  3BU2 A;  4DUY Q;  4DV6 L;  4L5T A;  4A3J H;  1Q81 C;  4GS3 A;  4OXP A;  1HZC A;  4LF4 L;  1VQI A;  1U0L A;  3I2Z A;  5JEA J;  5AJ3 Q;  2AHO B;  3CCV A;  2R93 G;  1TXY A;  1X3E A;  3OTO L;  4DR6 Q;  2ALY B;  2GN5 A;  1GD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...