5M3FH

Yeast rna polymerase i elongation complex at 3.8a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
144
structure length
131
Chain Sequence
b'NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase I subunit RPA190
publication title Structure of RNA polymerase I transcribing ribosomal DNA genes.
pubmed doi rcsb
molecule tags Transcription
total genus 21
structure length 131
sequence length 144
ec nomenclature
pdb deposition date 2016-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m3fH00
3SGIA 1ASYA 3TQYA 4HJ8A 2YYZA 2F52A 1W2BA 3J81c 1KXLA 2NVQH 1X55A 2R92H 4NXML 1RL2A 3CCQA 4DV1Q 3RN5A 4P71A 1QZGA 2E5LQ 3GTPH 4A76A 2VQFL 4OO1I 1HZAA 1Q1EA 1CUKA 3F8TA 1C0AA 3H0GG 2KHJA 3TRZA 3PCOB 3HFZB 4JBJA 1BBWA 1ASZA 1T9HA 3F2DA 4IFDI 1QVCA 5C4XG 2WFWA 3I4NH 5AJ3L 3CCUA 2ATWA 4ALPA 2E2IH 4LF8Q 3CF5A 1PH9A 2PNHA 5IYBH 4DK3C 4HIMA 4A3FH 3ERSX 2HT1A 1HNXQ 5C0XG 1TWFH 4R1JA 3HOWG 2A8VA 4IPGA 3A5ZB 5IP7G 5LMUQ 4A3KH 4LF4Q 1SRUA 1GVPA 1KAWA 3M85A 4B3TL 4JI7L 3RLNA 4DV6L 2UXCQ 5IWAQ 4P75A 5C4JH 1FGUA 3A5UA 3CCEA 4DV3Q 4HIKA 2NZOA 1M90C 5H1SE 3M4QA 4POFA 3H15A 4P73A 4DR4Q 1Y14B 1IBKQ 3OTOQ 3Q8DA 4WJ3M 4DR2L 3T1YQ 4DPGA 2V1CC 1CSPA 4QIWE 4X65L 3I2ZA 4JCVE 2QEXA 3NEMA 2JA5H 4A3CG 1HNZL 2VL6A 1SFOH 4YY3Q 3EIVA 2WAQE 2ES2A 1J6QA 5IY0A 4DUZQ 4DUYL 3CCMA 2UU9L 3PV0A 2NN6I 1C7YA 4X64L 2PQAA 4IPDA 1J5EL 2IY5B 1VQBA 4OWWB 5IYDH 5E7NA 2I0QA 4WJ4A 1KIXA 2Z0SA 3NBHB 4KHZA 2VZAA 2I5LX 1V43A 2CFMA 3RLOA 1VQ6A 3S17H 2N78A 2ZJPA 1VQCA 4LUZA 2Z6KC 2D0OA 3A74A 3G48A 4A3JG 1I94L 4X62Q 3ICEA 1VQIA 2JA9A 3KFUA 2R93G 5JJIA 4DR6L 3PUXA 3CXCA 1W3SA 4QY7A 4LF6Q 1A62A 1MIUA 3FP9A 2PQAB 4JC0A 4DV0Q 3PO2G 1KQSA 4JI8Q 1GM5A 1PVOA 2GN5A 4L5TA 5IP9G 3HKZE 3HOVG 1IZ6A 3MEFA 4UP8A 2AWOA 2K14A 1HR0L 2JA6G 2JA7H 4DR1Q 1X65A 4X6AH 2R6GA 4LF5L 4LFBQ 1Y1VH 2KCTA 1WCMH 1XMOL 2K4KA 2MO0A 3NELA 1UEBA 4GNXC 1EYGA 4A3IH 4BA2I 4BBSH 4BXXH 1C9OA 1N36Q 1IL2A 3FKIG 2ZTCA 2IT1A 3KOJA 2CQOA 2WB1E 1NY4A 4GKKL 4KHPL 3D31A 3STBD 4LUOA 4LUVA 1I50H 4UP9A 1A0IA 2ZTDA 3AFPA 2Q2IA 4YWKA 1K9MC 4GLAC 4A3LG 1XNRQ 1AH9A 2B3GA 1YJ9A 3HOZG 2UUAL 1E22A 1IBMQ 5GQOA 2VQEQ 2DGYA 4HJ5A 3UDGA 4LFCL 1N34L 1E1OA 1Q7YC 4JI1L 2IX1A 1I3QH 3RR5A 2JA8H 1HZ9A 2AHOB 4BBRG 1EQQA 1VQFA 3GTKH 4A3CH 1IBLQ 1U5KA 1LUZA 1K0RA 1PH8A 5M5WH 2JQOA 3W1GA 1G6PA 5IYCH 4B3SL 5LMNL 1G291 3CC7A 2UUBL 4BY1G 4JI4L 4DR7L 1UWVA 3BJUA 3ER0A 4JYAQ 1EFWA 3PUYA 4JV5Q 4K0KL 4PMWA 4HIDA 2D62A 4JOIA 4PZ6A 2UXDQ 1SMXA 2OQ0A 1CKNA 2K50A 3GD7A 1QVGA 3TS2A 1VS0A 3KJOA 2MQHA 4GOPA 3U50C 3I55A 1WFQA 3U58A 1NMGA 4EQ5A 3RLFA 3JAMc 5C0XJ 5IT9c 2NVXH 4A3EH 2BA1A 2Q2TA 2R93H 3JC66 1TWCH 1WI5A 4DV1L 2E5LL 4JI5L 2JEBI 3U4ZA 5C44G 4DK6C 3UE0A 2B29A 5C3EH 1VQ8A 1YNXA 3F2BA 1LM0A 1FVIA 4OX9L 2JK8A 4LF7Q 3J80c 1PH5A 1CKNB 1S3OA 3U4VA 1MJEA 1Y1WG 1X6OA 3HOYG 4PZ8A 2BA0A 4R4QA 4LF8L 4GOPB 1HR0W 1L1OA 4JI3Q 3RN2A 4A3GG 3OW2A 2OWOA 1N32L 1V9PA 3HKSA 4A93H 2H5XA 3AQQA 3L0OA 3WWVA 2UXBL 5LMUL 1JT8A 4LF4L 4HIOA 2UXCL 5ELOA 2PMZE 2FXQA 5IWAL 3K0XA 2E2HH 3NENA 3PO3H 1EIYB 4FDBA 3BZCA 4P74A 2ZJQA 2K5VA 3K7AH 1M1KC 1IYJB 4DR5Q 1X9NA 2L15A 4LFAL 4DR4L 4O0AA 2N49A 1IBKL 1JMCA 1X56A 3OTOL 1CKOA 1PH4A 1KRTA 1E24A 5FJ8G 3CMEA 3GTJH 3T1YL 1L1OB 4B3RL 4LW1A 3T1HQ 2R7ZH 4LWCA 5AJ3Q 2VUMG 1I6HH 4R4TA 2Q2HA 1YJNA 1B8AA 2YTYA 1MJCA 4IO9A 1AE3A 4IOCA 2LXKA 1HZCA 3J81j 1XPRA 4YY3L 1UE6A 1JJ2A 1VQAA 2MNAA 3HOXG 5FLXc 4DUZL 4DV5Q 1Q86C 5FLMG 2B63G 3OYYA 4OONA 4B3MQ 2GVAA 5LMNW 3I4MG 3D0FA 3TEHB 1DGSA 3STBC 4DV4L 4UY8C 1UE7A 3I4OA 1EIFA 4GLXA 4IFDJ 1WYDA 4GS3A 3RNUA 1YIJA 3K8AA 3GDEA 4UP7A 3CPFA 4ME3A 3GTOH 2EXDA 1B7YB 3S24A 1EWIA 4JI6Q 1LYLA 1YVCA 1Q46A 1YITA 1E7ZA 3CD6A 4BY7H 3G4SA 4X62L 1VCIA 4C3JH 4A75A 1KD1C 1OXVA 4LF6L 3KF8B 1S72A 4A3BG 1YBYA 4DV0L 1EUJA 4OXPA 5IE8A 4DUYQ 2K75A 4X64Q 5C44H 4L5SA 4OO1G 1J5EQ 1XMQL 1OXSC 4AH6A 4GKJQ 3S2HH 4H02A 4NXNL 3H0GH 4MTNA 5HY6A 3KJPA 4YWMA 1N9WA 1E3PA 4A3MG 4IFDG 3UDIA 1OXXK 4DR1L 2XGTA 1XNQQ 1OXTA 4GLVB 4IPCA 2BH8A 4LFBL 5C4XH 1P8LA 1Q8KA 2RCNA 5ELNA 1VQ9A 1HH2P 4DR3Q 1SROA 4TQUS 2NZHA 1N36L 3GO5A 1V1QA 1VQMA 2R92G 3S1NH 1JJGA 5BR8Q 4DR6Q 1YJWA 2OCEA 2E2JH 3HOWH 5IP7H 5JJLA 3HOUG 2Z6KA 4YCVA 4HJAA 1VQPA 1RIPA 4P72A 4QGUA 3J81i 4JI0L 1A63A 1N33Q 1QVFA 1IBML 4IJHA 4IPHA 2VQEL 2YTVA 1JJCB 3H3VH 3I4NG 4YHHQ 1HR0Q 5IYBG 3LGJA 1KRSA 1SN8A 4GN4B 4LF5Q 1K83H 1XMOQ 1TWGH 1K8GA 3PF4A 3G6EA 2UUCQ 4A3KG 1HJPA 4JOIC 4X66Q 2IX0A 3M9BA 1EOVA 4R4OA 3M3YH 2NN6G 1YHAA 4AQYQ 3K81C 3BU2A 2CWPA 4GNXA 4JYAL 2OTLA 3M4OH 5GAHC 4JI2L 3PIOA 2HIVA 1PHJA 2ZM6Q 1PA6A 2UXDL 4MZ9A 1S40A 2UUAQ 2BH2A 1VQDA 1H95A 4YCUA 3AEVA 2Y0SG 1TWAH 4JBMA 1N8RC 2HHHL 1KHIA 4GN3B 1TWHH 2JA5G 4LFCQ 2K5HA 3ULLA 1G51A 1NMFA 2F4VQ 4A3DG 1K73C 4A3JH 3F1ZA 1A8VA 3RZOH 1JE5A 1X3FA 2K52A 3E0EA 4C2MH 4LF9Q 3GTQH 4HJ9A 1YI2A 1K3RA 2DUDA 1I5FA 3ULPA 4GNXB 2YTXA 5IYDG 3PO2H 3CPWA 4RG1A 2CWAA 1VQ4A 1MKHA 1X54A 2IHFA 3GTMH 2EQSA 5IP9H 1WJJA 3HOVH 1OTCA 1YHQA 1HNWQ 4BA1I 1PH6A 4A3MH 1VQKA 3AYHB 1NJIC 3TS0A 3GTGH 5GAEC 4DV7Q 3B6YA 4OWXB 1XTDA 1GD7A 4IJLA 1PYBA 4DV2Q 2JA6H 1NBWA 2MFIA 2YV5A 3CP0A 3CC2A 3ULJA 3G71A 3S15H 1HNXL 2HIXA 1FJGQ 3PUZA 3FKIH 3UDXA 1QZHA 4QL5A 4Y52H 4NXMQ 4DV3L 3PIPA 4JI5Q 1SLJA 2AWNA 4DR5L 2VQFQ 4DKAC 3RZDH 3BZKA 3HOUH 3CQZH 4OX9Q 3S1RH 2EIFA 4AYBG 4A3LH 1O7IA 4L5QA 1VQOA 1PV4A 3IRBA 4B3ML 3DM3A 2JA7G 3HOZH 2RHQB 1VQ5A 1Z47A 3T1HL 1Y1VG 1L0WA 1WCMG 4POGA 2CKZB 3PUWA 1P16A 4BBSG 2A19A 4A3IG 4BXXG 1BBUA 4QQBX 4PG3A 3PUVA 3L2PA 2AKWB 4AIMA 4IOAA 1HZBA 1GO3E 2MO1A 4R4IA 1N32Q 3FHWA 4DV5L 4BBRH 2UXBQ 3CCSA 1IXRA 4MNOA 2YU9H 2VS1A 1EQRA 1PFSA 3UDFA 4B3TQ 4JI7Q 4DV6Q 4R4CA 2RHSB 4BY1H 2LXJA 2F3IA 3KYHC 4LFAQ 1XPOA 3E9IA 4XTCS 5HGQA 4A4IA 4JI6L 4DAYB 5M3MG 4DR2Q 4B3RQ 5M5XH 3S16H 3EBEA 1GKHA 3S1MH 2JA8G 1SR3A 2K5NA 4X65Q 5M3FG 4Y7NH 1Z9FA 2IHEA 1TXYA 4NPSA 4A3DH 2PI2E 1HNZQ 2ID0A 4PZ7A 2R7FA 3A0JA 2LSSA 5IYCG 1X3GA 2HQLA 2NVTH 1VQNA 3AFQA 4JI8L 3PF5A 4KI0A 2UU9Q 4UPAA 1Q1BA 2C35B 4GKJL 3CW2C 4JBWA 4KLKA 4QJFA 3L7ZC 4C3IH 4DV4Q 4GN5A 2N3SA 3S14H 3TREA 2D0PA 1XNQL 3HOYH 1SE8A 1Y1WH 1E1TA 3ZJYC 3MXNB 4DR3L 3PGZA 1JB7A 1I94Q 1CKMA 4A3GH 2KHIA 4A3EG 1LTLA 2AMCB 2GVBA 3F2CA 2PI2A 1Q81C 5M5YH 3EN2A 5BR8L 3CCJA 3CC4A 3CMAA 1B70B 4O2DA 2WAQG 1Q82C 5C3EG 1YEZA 2ZTEA 2R7DA 3JAMi 1FL0A 1CSQA 3J7A5 4TVAB 2KCMA 3CCLA 1XPUA 1XNRL 4YCWA 4APVA 1QUQA 1XMQQ 1N33L 3S2DH 5JJKA 1KC8C 4JBKA 1VQHA 4NXNQ 1VQJA 5EAYA 2VY3A 2Y0SE 1UE1A 4YHHL 3CCRA 1K8AC 1OXUA 2ALYB 1D7QA 5FJ8H 2A1AA 3VDYA 2RF4A 1R9TH 1PH7A 1U0LA 4A3FG 3J80i 2I5HA 2VUMH 2JE6I 1BKBA 2JJQA 4A93G 1D8LA 4EX5A 1IBLL 2UUCL 3DLLA 5C0XI 2OTJA 4LNQA 2ZJRA 1YHBA 4JG2A 4X66L 5DLQE 3PO3G 3HOXH 4C3HH 3KDFA 5J3BA 4GKKQ 4AQYL 5FLMH 2B63H 2ASBA 1PH3A 4KHPQ 1WOCA 5GROA 1QUQB 4XIGS 2QGQA 4GOPC 3CAMA 2KBNA 5GAGC 4JV5L 3I4MH 3CCVA 1UE5A 2ZM6L 3W1BA 4L5RC 4JI0Q 3HKZG 3H3VI 3M7NA 3M4PA 4OWTB 2WP8J 5JEAJ 2N8NA 1VQ7A 2Q2UA 3W5OA 2R7ZG 3KF6A 1NE3A 3S1QH 4DNIA 1VQLA 5M3MH 2F4VL 1N34Q 1AE2A 3I56A 2JEAI 2NVYH 4JI1Q 3KLWA 1VQEA 4YWLA 3UE1A 5M3FH 4HJ7A 1PYSB 4LF9L 3E9HA 1L2FA 1YZ6A 2I5MX 2VNUD 5K36G 1XJVA 3KDFB 5GADC 2WB1G 4RMFA 1Q12A 3GTLH 1NTGA 4A3BH 3K80C 3PSIA 2OQKA 2E8GA 1PH1A 4B3SQ 1L1OC 3K7UC 3I7FA 5LMNQ 2UUBQ 4JI4Q 1PH2A 4DR7Q 2KENA 4LF7L 4AYBE 4NB3A 1VQGA 1KL9A 4JI2Q 2XTIA 1BVSA 4K0KQ 3KF6B 5JEAG 3J7ZC 4DV2L 4DV7L 1HNWL 4J15A 4JI3L 2QA4A 4BY7G 2HHHQ 4DAMA 2CCZA 1X3EA 2VW9A 1FJGL
chains in the Genus database with same CATH superfamily
3SGIA 1CK1A 1GUGA 3H3VC 4HJ8A 1KXLA 4DV1Q 5CV7A 4LK1C 1CUKA 2L4NA 2KHJA 3R93A 3HFZB 3TP8A 1T9HA 1EY9A 2KQ3A 3X3MA 5C4XG 3CCUA 2EYJA 2ATWA 4ALPA 1K0SA 2HD3A 2PNHA 4DK3C 2D2CC 2HUGA 1TWFH 4R1JA 5JJZA 2OXPA 2A8VA 1HA6A 5IP7G 4LF4Q 3I4LA 1GVPA 3M85A 4JI7L 4DV6L 3A5UA 4B3ML 4DV3Q 4HIKA 4L63B 5DEHA 4POFA 2WV6D 1W6JA 2Z8LA 1CZWA 1G6ZA 4KJOA 1IBKQ 3MXPA 3HG9A 4KN4C 3AU7A 4DR2L 4P2CB 2LMCB 4I7AA 4ZUIA 2V1CC 1WD1A 3C2PA 4JCVE 4A3CG 1F9PA 1I50B 4Q0FA 4YY3Q 1PLFA 3N52A 5CYUA 1J6QA 4DUYL 3PV0A 2FMMA 2PQAA 1B50A 1KIXA 2Z0SA 4KHZA 1KABA 1YNNC 3IFTA 3IAYA 2R61A 3GTKB 2SDFA 2Z6KC 3A74A 4DA2A 4A3JG 1QCBD 1PXUA 5AFWA 4IUTA 2PO4A 4UDUC 2R93G 2RBMA 4UHVA 3CXCA 1MIUA 3FP9A 2PQAB 3HP3A 4DV0Q 1PVOA 1STHA 1CM9A 5EJWA 3DEPA 5L37A 1EL0A 2EXZA 3G7LA 2BCOA 1RJTA 3P75A 1D1IA 4FF3A 1HR0L 2JA6G 5I2YA 4QMGA 2BOSA 2NVXB 3OWEB 3MVVA 3E0JA 5F2DA 2K4KA 1EYCA 1MI2A 1EYGA 4BXXH 4BA2I 4KMUC 1C9OA 3BDOA 5IGEA 1IW7D 5CGKA 2CQOA 4KHPL 1I50H 2DN8A 2PW7A 3AFPA 5ELEA 4YWKA 2M9VA 3K58A 1K9MC 1S5ED 2PZTA 4HCEA 1BR9A 5GQOA 4HJ5A 2L55A 1N34L 4A93B 1E1OA 1ET6A 2AHOB 3PO3B 1VQFA 3GTKH 1SJED 2XVSA 2RDFA 1UAPA 2CQAA 2AQ3B 3W1GA 3CC7A 2R3ZA 5C5MA 1GUTA 3BJUA 3HKZB 2F3VA 3SHLA 2RSNA 3P7JA 4K0KL 2D62A 4JOIA 4PZ6A 1SMXA 1QWYA 3GD7A 2EYOA 1Y69U 4K5XA 1G8ZD 4GOPA 5EBDA 1Q90A 1HHVA 1STAA 1NMGA 3E5SA 3HGBA 4EQPA 5C0XJ 2NVXH 2B2VC 1WI5A 2ZXRA 4ZK9B 2JEBI 1VF5C 1AEXA 5IGCA 4ME5A 3UE0A 2B29A 1CZGA 4IUVA 5ELCA 1JWSD 5KIXA 2EYPA 4DFAA 1Y1WG 1KLGD 2BA0A 4LF8L 4C3JB 4GOPB 4K2LA 1HR0W 3RN2A 4JK1C 4U673 1KDAA 2RDHA 1SXTA 3QB3A 4A93H 3BVMA 2XWBB 5C44B 4HIOA 1SE2A 2PMZE 5IWAL 3PO3H 1EIYB 2K5VA 1M1KC 3OIPA 4O0AA 3OTOL 3C1FA 5C4XB 1H9SB 3T1YL 1DOLA 1XTCD 1Y8PB 1MHWC 4R4TA 1B8AA 1TIID 2NYZD 5FLXL 3NTIA 3SK6A 1XPRA 1RHPA 1UE6A 1JJ2A 5FLXc 3J7AF 2ZT9C 2B63G 3S9WA 3OYYA 2B2TA 1O78A 2GVAA 2F1MA 2PQEA 2WACA 3VR3A 2QDLA 2P5ZX 4GLXA 2RCFA 2K32A 4UP7A 3T4AC 1TWGB 4M8AA 1E7ZA 4RH6A 2KCCA 2G9DA 1AZPA 4C3JH 4A75A 1KD1C 3M3YB 1LTGD 4LF6L 1S72A 1YNJD 1EUJA 5IE8A 2LY7A 2NTTA 5C44H 4OO1G 4X3KA 3EQLC 4AH6A 3DWQA 4K5VA 4MTNA 5HY6A 3KJPA 2GA4B 4H13C 3K5OA 5IGDA 1B4OA 4A3JB 5C4XH 2FFKB 5ELNA 2B39A 1HH2P 1LTSD 3FPPA 1C4QA 1HFGA 2F0HA 1VQMA 3C46A 1YJWA 2OCEA 2F03A 2AUKA 2KEDA 5IP7H 5JJLA 3PMFA 3FVQA 4DAVA 3GQBA 1RIPA 4GZYC 4NKLA 4JI0L 3GTGB 2JA6B 2FINB 2MPMA 1QVFA 4IJHA 4CJ2C 1JJCB 1GHKA 4NP5A 3S15B 3VA7A 5IYBG 3LGJA 1KRSA 3R2IA 2V4DA 1XMOQ 1TWGH 4XT3B 3NTKA 4A3KG 1NAPA 4JOIC 4X66Q 1B53A 5DM73 3M3YH 2NN6G 1IL8A 3BU2A 3DWPA 1FD7D 4JI2L 3BYTB 1FNWA 2XIWA 1WTVA 1M4VA 1PHJA 1EYAA 1D5ZC 2UUAQ 3D6CA 4YCUA 3OHXC 1N8RC 2HHHL 1S5CD 2JA5G 3FRPB 1G51A 1NMFA 2YU9B 1PTOB 4A3JH 1B3AA 3I72A 4JVZA 5E4WC 3Q23A 4BS9A 2DY8A 3V05A 1EY7A 1PTOD 2RKSA 1ZKOA 1S5FD 4RG1A 1K28A 5J39A 3PIP3 3S1MB 1YHQA 4BA1I 1NJIC 3GTGH 4B9WA 2JA6H 1JOKA 1NBWA 3S15H 2HIXA 1B9NA 1FJGQ 4RGMA 4ZRZA 3U9SA 3F2UA 3E3XA 1TVXA 1HTPA 4QL5A 5FO7B 3WDNA 4DV3L 2AWNA 4DR5L 3S14B 4DKAC 3L9AX 1YNJC 1S5BD 2RSOA 2XRQD 4FNFA 1Y1WB 3R2TA 1PV4A 3DM3A 2Q8TA 1Z47A 1EU4A 4ZAIA 5IGFA 3T1HL 1WCMG 3W2DA 3GV3A 1ILPA 2B2TC 1MGSA 4NW2A 4A3IG 4PG3A 3PUVA 3L2PA 4AIMA 4IOAA 5CV6A 1HZBA 2C9OA 5I4DA 2YU9H 1PTOH 1SE3A 1I4HA 2LFNA 4JI7Q 4DV6Q 2F0QA 4R4CA 5A35A 3FDTA 3KYHC 2F3IA 1AP0A 4LFAQ 2XSCA 4XTCS 1H9JA 2CH4W 1HPCA 1RODA 4A4IA 1JICA 4DR2Q 3S1MH 2JA8G 1SR3A 2F0GA 3Q22A 2F0IA 2B63B 3O13A 2ID0A 1BBXC 2LSSA 1KNEA 1CTMA 3R8BA 4C1NI 4GKJL 3CW2C 3D4WA 3EFXD 3NWSA 4GN5A 2N3SA 5M3MB 3S14H 1XNQL 4K14A 3CKIB 1Y1WH 5M3FB 1STNA 4MIUA 2LKVA 4H7BA 3KK7A 3GTLB 2AMCB 2PI2A 5BR8L 1VDZA 2F3WA 3EN2A 1J8IA 4Q5VA 4KK7A 1JOOA 2R7DA 4J1MA 3J7A5 4YCWA 5JVG3 1N33L 4JBKA 1PTOC 1VQJA 5EAYA 1Z6HA 1D7QA 1OXUA 2ALYB 3I73A 1E2VA 3C1EA 1U0LA 1D2BA 2I5HA 2QDBA 2NVQB 4DF7A 5D14A 3GTPB 4KKSA 3Q24A 4LNQA 5FO9B 4DU9A 4KHPQ 2B63H 2AUJD 3CAMA 1UE5A 2B2WA 4ZQ3A 3TP6A 1VQ7A 2Q2UA 1EQTA 2N8NA 4A3FB 1HUNA 4H0LC 5M3MH 1NUCA 1AE2A 1N34Q 5M3FH 4A3KB 3UE1A 4LF9L 2VNUD 3MEHA 5GADC 4RMFA 5C3XA 3GTLH 1NTGA 3A56A 1SYFA 3K80C 2OQKA 1L1OC 1GUNA 3K7UC 2EYMA 4OO1H 1U9RA 4AYBE 3K5NA 4K0KQ 3J7ZC 2RVLA 3ND8A 1HNWL 2JA5B 4J15A 1X3EA 1ASYA 3TQYA 2F52A 1W2BA 2NVQH 1JOQA 2F0UA 3ZYYX 3RN5A 1QZGA 3GTPH 2HQEA 1GHJA 1HZAA 1C0AA 3F8TA 4R9WA 1SAPA 3TRZA 3S17B 4JBJA 5BN4A 1BBWA 1ASZA 3F2DA 5KGUA 1VMCA 1PMRA 4LF8Q 2L5TA 5IYBH 4A3FH 3ERSX 1EY0A 4L6TB 2WIIB 4XQJA 4R8IA 1HNXQ 2IJ0A 4A3KH 1SRUA 4B3TL 3U9OA 5IWAQ 4P75A 3CCEA 1E2WA 1CFMA 2NN6H 3OMCA 2X69A 1SNPA 2VB3X 1JORA 2F4IA 3OTOQ 1A3VA 1QJOA 3NBHA 1WCMB 4WJ3M 3T1YQ 4A3IB 4QIWE 2TSSA 4XYOA 2QEXA 2JA5H 3OPOA 4IN3A 1HA5A 1ZEQX 2ES2A 3CCMA 2UU9L 1C7YA 1BQQT 1WVLA 4OWWB 4XQQA 5E7NA 1FNUA 3Q6SA 1K3BC 3NBHB 4MHEA 1V43A 3RLOA 4G57A 1I3QB 2JA8B 3S17H 2N78A 3J7YW 1G91A 3CRKC 1GJXA 1NR2A 4KY6A 4LF6Q 1GM5A 2GN5A 2EYLA 1V1OA 3EROA 4UP8A 2AWOA 1DOMA 2NTSA 1L0XB 4DK1A 1OO9B 1PRTD 1WCMH 1XMOL 2MO0A 5K5PA 4IUQA 1UEBA 4A3IH 5IIFA 3D6WA 3KBGA 2D5DA 2B2WC 4X3UA 2ZTCA 3KOJA 2WB1E 4EVOA 4GKKL 2CHBD 1J9OA 4LUOA 1YNND 2F0PA 3P20A 4GLAC 4A3LG 1XNRQ 2B3GA 3HOZG 2UUAL 4K6LA 1EOTA 1E22A 2PPBC 2DGYA 4FYDA 4JI1L 3D4DA 1I3QH 2JA8H 1HZ9A 3KLSX 1IBLQ 1WTPA 3NK9A 5IT9E 1K0RA 1G6PA 4B3SL 2UUBL 4JI4L 2OT2A 1BUVT 2O2LD 2EY5A 1M8AA 1EFWA 4JV5Q 1I6HB 1EY6A 4N8FA 3HS0C 2EJMA 5IT9L 1EIGA 1VS0A 2IX3A 3KJOA 1RDPD 1AW7A 2BDOA 3U50C 3I55A 3IKJA 5FO8B 5IT9c 2BA1A 3JC66 2E5LL 5C44G 1VQ8A 4LAAA 3ND9A 1FVIA 4C3IG 1CQFA 2E75C 3BG3A 4C56C 3J80c 1PH5A 3QWNA 3HOYG 1TS4A 3MWYW 1ENCA 1QOHA 2A6ED 4JI3Q 1LV9A 4FF1A 3L0OA 3WWVA 3NUCA 5ELOA 1WTQA 1V1PA 3VYTA 2FXQA 4ODGA 4K8IA 3NENA 3S2HB 4P74A 1BCPB 4DR5Q 2L15A 4LFAL 2N49A 1PRTF 4ID6A 1PH4A 1F2YA 1KRTA 1SYGA 4RKLA 4CHTB 1ENAA 1BCPD 3T1HQ 4LWCA 5AJ3Q 1I6HH 2Q2HA 4IOCA 1TKWB 1SSOA 1AE3A 1HZCA 4HN7A 1V1PB 2OEOA 3QJYA 1PRTC 3DMUA 2MNAA 3HOXG 4V0BA 2NZ1D 1Q86C 5FLMG 3KF8A 3ONAB 4OONA 4I7ZC 2NB0A 4GS3A 4FF4A 4TKOB 3CPFA 4CKCA 1B7YB 3NE5B 1EWIA 1Q8IA 1YITA 2F0FA 2ICEC 4X62L 2A69D 1TY0A 1LT4D 1TR5A 1KDCA 2PMZB 3KF8B 5ELBA 4IALA 4WJWA 4OXPA 2K75A 4CDCC 4GKJQ 3S2HH 2F0NA 5CMDA 2PCFB 1LTTD 1N9WA 1E3PA 4DR1L 5BN3A 2XGTA 1XNQQ 1Q8KA 1SDFA 1PZKD 1VQ9A 3I8ZA 1SROA 4TQUS 1SJHD 2NZHA 1N36L 3DXJC 4RHRA 1JJGA 5BR8Q 1UEAB 1TU2B 3GTMB 1RTOA 4YCVA 1ZXTA 1G2TA 4QGUA 4A3MB 1N33Q 4IPHA 3I4NG 1QG7A 1WTOA 4G7ZC 4ZUJA 2A6EC 2PYKA 2ENBA 5COYA 3HOUB 2IX0A 3M9BA 1EOVA 2N55A 2CWPA 2QCPX 4GNXA 3HOZB 5T1IA 3M4OH 5ISRA 1DM0B 3PIOA 2HIVA 2UXDL 2L11A 1S40A 2K5HA 1HCZA 1K73C 3F1ZA 1BCPC 1X3FA 4LF9Q 1YI2A 3KLSA 2DUDA 2I46A 2EJGC 1I5FA 3ULPA 5T1GA 4GNXB 5IYDG 3I3CA 3OSOA 1MKHA 1G2SA 1X54A 2IHFA 3AB9A 3GTMH 2EQSA 4Z9CB 1LTAD 3NSWA 1PH6A 4A3MH 1H9SA 1O7ZA 3AYHB 3K6OA 3B6YA 4OWXB 3TMEA 1GD7A 2DY7A 1PYBA 2KOLA 4A3DB 1HNWQ 3CP0A 1LO5D 3G71A 1HNXL 1LACA 3PUZA 5EKIA 3QIAA 4CJ0B 4L8JA 1CA5A 2A69C 5FLXE 4C3IB 1SLJA 1WTHA 1I4PA 2XN9C 3HOUH 5JAVA 3HOYB 1DYQA 4OX9Q 3H09A 4AYBG 4A3LH 1O7IA 4L5QA 3NQTA 1VQOA 1X3QA 2JA7G 5D3IB 3HOZH 4HAEA 1GUOA 1Y1VG 1B44D 5EPLA 3BDCA 5EKLA 4BBSG 2A19A 1BBUA 4QQBX 4HMIA 3HRZC 2BDNA 2MO1A 1N32Q 3FHWA 2ZXPA 1IYVA 4RKBA 3CCSA 3EJIA 4IQZA 1EQRA 1PFSA 4B3TQ 3CRLC 3A8KE 3SK5A 2F0SA 5KYLA 1JCKB 5IOCA 1A2TA 4IURA 3QOJA 1F2ZA 5HGQA 5DM63 5M3MG 2K5NA 3IL8A 5M3FG 1Z9FA 3MXNA 3GP7A 1TXYA 3HOXB 4A3DH 3OW7A 3RMHA 2R7FA 3A0JA 1JR0D 5IYCG 2HQLA 4H44C 3D4RA 3AFQA 4OGQC 1VQNA 2H4OA 4PQXA 2UU9Q 2MHVA 2FHTA 1EYDA 4JBWA 4KLKA 4C3IH 3S1QB 3TREA 1S4ZA 5KNCA 1BF4A 2NVYB 4KJNA 3HOYH 2M2LA 1RD9D 1E1TA 3MXNB 3PGZA 2FJ2A 2JP1A 2KHIA 1LTLA 2GVBA 2NWGA 3K5LA 1A6XA 1Q82C 5IGBA 1FL0A 1PFMA 2KCMA 3SK8A 4NMZA 1XNRL 5JJKA 3BZDB 2Y0SE 2DNEA 2QW7A 1EQVA 3KLRA 4A3FG 1FGBD 3J80i 3K0YA 1E0BA 2JE6I 2KCNA 4EX5A 1IBLL 3TN2A 3DLLA 2ZJRA 1YHBA 5DLQE 2Q8IB 5J1ZA 3HOXH 4GKKQ 1XYIA 4AQYL 5FLMH 2ASBA 2A74C 4DK0A 4GOPC 5GAGC 4JV5L 3CCVA 3M7NA 3I4NB 3W1BA 4L5RC 1SYEA 3H3VI 4OWTB 3TZDA 2E2IB 2K5QA 3S1QH 4DNIA 4HSPA 2F4VL 2A6HD 3I56A 2JEAI 2NVYH 4JI1Q 1VQEA 1LLRD 5K36G 5HGTA 4B9XA 2WB1G 3J81E 3PSIA 2E8GA 1PH1A 4PV1C 4B3SQ 2UUBQ 4JI4Q 1O7LA 2SNSA 1NCVA 3A8IE 4NB3A 1IKLA 4DV2L 1BOSA 1W6KA 4JI3L 4WORA 1WD0A 4DAMA 3J81L 2CCZA 1KQSA 2Z6BA 1Z7TA 2YYZA 4QUCA 3FPUB 3X3NA 3J81c 1X55A 1Y8NB 4NXML 1XWEA 3QG1A 2DJGC 2E5LQ 3NWTA 3TSSA 2VQFL 1CI3M 1STBA 4U68A 3H0GG 3NXWA 2F0KA 3MZ5A 3PCOB 4RHSA 4ZKCB 4IFDI 5E4XA 1QVCA 2WFWA 3I4NH 4QB4A 5AJ3L 3K59A 2E2IH 3CF5A 3VYRA 4HIMA 1JWMD 3OWFA 5NUCA 5CBAE 3VR2A 1PFNA 4WRDA 2K28A 1WTWA 4IPGA 1DD2A 3RLNA 1JE4A 2ZXOA 5HURA 1A15A 2NZOA 3M4QA 4FF2A 4AYBB 1UUPA 3H15A 4CDFC 2JA7B 1Y1VB 3Q8DA 5EBCA 4BBSB 1STGA 4DPGA 3BS1A 1CSPA 4X65L 1HQRD 2D9UA 1H9RA 3BVGA 3A55A 1HNZL 2XRSD 3C3LA 1ET9A 4ILWA 2WAQE 1MSHA 3HEJA 4N9PA 4IPDA 2JYOA 5IYDH 2I0QA 3AMUA 2E76C 2CFMA 3MXGA 3PQIA 2EPBA 5J22A 2MGSA 1VQCA 1GXDC 1ESFA 1PTOF 1CHQD 4X62Q 3ICEA 3KFUA 3RD4A 2IPKD 2KA7A 4N8X1 1II3A 2A6HC 1W3SA 4QY7A 2N88A 2SEBD 2VXWA 4L5TA 2B2UA 3KBXA 1RTNA 1IZ6A 3MEFA 4TSSA 2K14A 2JA7H 4DR1Q 1X65A 4QIWB 1Y1VH 2KCTA 2CW0D 3LNNA 1LTRD 4BBSH 1TWCB 1EZ8A 2O5IC 1N36Q 1IL2A 5JPMC 2IT1A 1LABA 2F0MA 1XX8A 3D31A 3STBD 1A0IA 1ML0D 2B8FA 2ZTDA 2F0WA 1U4RA 1YJ9A 1GOZA 4DGZA 2Z9HA 5E3FA 4ZCKA 5G3LD 4F88A 2E2HB 1U5KA 1QILA 3K7AB 3TP7A 4K6DA 2JQOA 3GV6A 5IYCH 5LMNL 1G291 5I6WA 3H6MA 1UWVA 3T53B 2F0DA 1BO0A 3PUYA 4PMWA 2UXDQ 2OQ0A 1CKNA 2K50A 3TS2A 5EPJA 4EQOA 4QUFA 1LTBD 2KECA 3FEWX 3U58A 1GUWA 2PW5A 2WB1B 3T13A 4FXDA 2Q2TA 1PFBA 1VF7A 3FMCA 1TWCH 1ESRA 3U4ZA 1F9SA 1F77A 1YNXA 4OX9L 3I70A 2JK8A 3OOCA 4LF7Q 3GTOB 1CKNB 1MJEA 3U4VA 1R4PB 1K8OA 4BWGB 1UNSA 4A3GG 5KNBA 1N32L 3HKSA 2H5XA 3AQQA 1JT8A 5LMUL 1AZQA 2UXCL 3MTSA 2E2HH 3K0XA 4FDBA 3UI2A 3BZCA 3H0GB 2AQ2B 2K01A 3K7AH 2F0TA 1IYJB 1X9NA 2A68D 4DR4L 1JMCA 3NPPA 5FJ8G 1HQMC 3CMEA 1B3QA 4LW1A 5KNDA 2VUMG 1EY8A 3S1NB 1MJCA 2LXKA 2K04A 4KKTA 4PMBA 2CW0C 1X32A 4DUZL 5K36H 4XDXA 4ZLTF 4DNRB 5LMNW 3D0FA 3STBC 2EDGA 1UE7A 2AQ1B 3I4OA 1D5MC 3K8AA 3GDEA 4G4KA 2DJFC 5G3LF 1NSNS 3SVMA 3GTOH 1LYLA 1YVCA 4CBVA 2C5CA 3CD6A 5ELDA 1V8QA 4JPBW 4RGOS 1OXVA 5LHY1 4A3BG 1SBBB 4K8JA 4X64Q 1J5EQ 1OXSC 1PZID 1CHPD 1TWAB 4H02A 3H0GH 4YWMA 4A3MG 1TWHB 3UDIA 2SNMA 1OXTA 3QOLA 4GLVB 3I91A 4LFBL 3W3AA 2RCNA 3GTQB 1I4RA 3IFDA 1V1QA 2R92G 3S1NH 4ZYSA 3R3OA 4DR6Q 4MN3A 5KRUA 5CV4A 2Z6KA 3HOUG 5EQ0A 1B9MA 1VQPA 3J81i 4J8QA 1IBML 2HDMA 2VQEL 2YTVA 3H3VH 3K57A 2K5WA 3M4YA 5CV9A 3M7GA 1SN8A 4LF5Q 1SNQA 1K8GA 2WKCA 3PF4A 3G6EA 3H91A 1HJPA 3RZDB 2RA4A 3DHQA 1AN8A 1YHAA 4AQYQ 4G7HC 4JYAL 5I6YA 5GAHC 3A54A 1RF2D 5ELFA 5M9OA 1PA6A 3V96A 2BH2A 2L0CA 3J80E 2Y0SG 1TWAH 2A68C 2LS01 2PZWA 4JBMA 2F0EA 1TWHH 4LFCQ 2F4VQ 4A3DG 4XYQA 1JE5A 3E0EA 2K52A 3BVZA 3GTQH 1QB5D 4HJ9A 2QEJC 3J80L 4IUNA 1KLUD 2PZUA 5M5XB 3S16B 1WJJA 1OTCA 1X3PA 4Y7NB 5GAEC 4DV2Q 1HTLD 2YV5A 3CC2A 1TQOA 1B1ZA 1ILQA 2NVTB 4OELB 4FXGC 1QZHA 4Y52H 4NXMQ 3PIPA 4JI5Q 3RZDH 2VQFQ 3BZKA 3VYUA 2B2VA 4A3GB 1O7YA 3ERQA 1L0WA 4POGA 2CKZB 3KUPA 3PUWA 4DAYA 1P16A 3SEBA 1I4QA 5M5YB 2KEEA 2XWJB 4DNTB 4ABNA 2AKWB 4R4IA 4DV5L 4KY5A 2UXBQ 4G7OC 1IXRA 4MNOA 3S2DB 3UDFA 3NTHA 4KTAA 1SNCA 2PNRC 3H94A 1XPOA 2KJXA 4IUPA 1I6VC 5D65A 2VUMB 2G5DA 4B08A 4JI6L 4DAYB 1F9QA 4B3RQ 5M5XH 3S16H 3EBEA 1GKHA 2E74C 4X65Q 3MC0B 4Y7NH 2IHEA 4NPSA 3TZUA 1HNZQ 2NVTH 3M4OB 3PF5A 2C35B 2IL8A 4QJFA 3L7ZC 4DV4Q 2JSOA 2K03A 1SE8A 1TT2A 4N9TA 4DR3L 3EA6A 4A3GH 4A3EG 1EEFD 4A3BB 3DWAA 3VR4A 5M5YH 3CC4A 3CMAA 2WAQG 3OMGA 5C3EG 1YEZA 1XPUA 4RAUC 1XMQQ 3S2DH 2MUYA 1KC8C 4NXNQ 2VY3A 4YHHL 3CCRA 5FJ8H 3VDYA 2RF4A 4FVMA 2VUMH 4RCOA 2JJQA 3G6JB 2R92B 2WKDA 3LWEA 1D8LA 2UUCL 5C0XI 3VA5A 2MP1A 4WFN3 5J3BA 1SYBA 2I07B 1PH3A 1WOCA 1KNAA 1BCPF 2SOBA 2KBNA 2ZM6L 4E6IA 3J7AV 4X3TA 5JEAJ 3W5OA 2R7ZG 3KF6A 1VQLA 2CH4A 3KLWA 1H9KA 2QKIC 5C4JB 1L2FA 1YZ6A 2I5MX 5I9OA 1XJVA 3VR6A 2B2YA 1Q12A 4A3BH 4DXFA 4DXGA 4S3SA 5LMNQ 4KV6A 1K8MA 4LF7L 1VMPA 1NR4A 1KL9A 2Y0SB 1BVSA 3P1HA 2RDGA 3KF6B 5JEAG 4DV7L 1SFOB 4BY7G 1WTXA 2O4XA 2VW9A 1TS5A 3RNUA 1EEID 5I9PA 2EVBA 1IHZA 2FMCA 2R92H 1SMYD 4RCNA 1RL2A 3CCQA 4P71A 5KYIA 4A76A 4EGVA 4OO1I 2K1BA 1Q1EA 3EVQA 4JW0A 4HCSA 5A2QE 1QE6A 1HRJA 5IODA 4FXKC 1PH9A 3MAQA 1DOKA 2IW3A 3MXUA 1FYCA 4F87A 5C0XG 1DZ1A 1A2UA 3HOWG 5A2QL 3A5ZB 5LMUQ 2UXCQ 1KAWA 1XXGA 4XXEA 5DAUA 1FGUA 5C4JH 1M90C 4J6HA 5H1SE 3L3OC 4P73A 4DR4Q 1Y14B 2J0TD 3I2ZA 1SNDA 2CVRA 3NEMA 1ONLA 2VL6A 1HXYD 1SFOH 3BDLA 2TMPA 3VYSA 1GUSA 3EIVA 3SXHA 5IY0A 1SEBD 4DUZQ 2NN6I 4X64L 2IY5B 1J5EL 1IW7C 1VQBA 4RWSC 4WJ4A 1I4GA 2VZAA 2I5LX 3BYYB 1VQ6A 5CBEE 5D3DA 1S5DD 2ZJPA 4LUZA 1JQYD 2D0OA 1I94L 3G48A 3SK4A 5M5WB 1VQIA 2JA9A 3Q0AA 5JJIA 4DR6L 4RGNA 3PUXA 1A62A 3PO2G 4JC0A 1SYDA 4JI8Q 5IP9G 1JC7A 3HKZE 4LJZC 3HOVG 5C6AA 2QILA 2X6LA 4X6AH 2R6GA 4HMJA 4LF5L 4LFBQ 2OF1A 4A3EB 1SE4A 2KHSA 3NELA 4GNXC 2X6GA 1PYWD 2J7ZA 2R93B 2MJ8A 2B8GA 3RUZA 2WAQB 3FKIG 5C3EB 5DNFA 1NY4A 4LUVA 4UP9A 2Q2IA 5TSSA 1SMYC 4OL7A 4RFBA 1AH9A 1EFID 5FOBB 1IBMQ 3MHBA 2VQEQ 1LTID 2B2YC 2EE1A 3UDGA 1EY4A 2BE5D 4LFCL 5I2XA 1Q3LA 5CV8A 1Q7YC 2IX1A 3RR5A 5LL6X 4BBRG 1EQQA 4A3CH 1AFPA 1U4LA 3JAME 1LUZA 1PH8A 4OHJA 5M5WH 3QR8A 1STYA 3DUZA 2KUMA 1QNUA 4BY1G 1ICWA 4DR7L 2IWHA 4KD3A 3WOEA 3ER0A 1DJRD 1I4XA 4C1NK 3GTJB 4JYAQ 1DONA 2R7ZB 4XT1B 4HIDA 4K2KA 1NNXA 1SYCA 1CA6A 3MFYA 1QVGA 3JAML 4CKBA 2MQHA 4KY7A 1WFQA 2HT1A 4EQ5A 3RLFA 3JAMc 4A3EH 2NBFA 2R93H 4DV1L 4JI5L 2K7VA 4YIJA 2L9HA 4DK6C 5C3EH 5CC4A 2K5DA 1LT5D 3F2BA 1LM0A 1C8CA 2JN4A 1S3OA 5EKKA 1X6OA 4CDDC 3HZXA 4BY7B 4PZ8A 4R4QA 1DCZA 2K6AA 4OIJA 1O80A 1L1OA 1IKMA 3OW2A 2OWOA 1V9PA 3LX0A 2UXBL 4LF4L 1R4QB 1HFNA 1ENFA 3URYA 1PDQA 4IUUA 2ZJQA 1A3UA 2EOTA 5BN5A 1IBKL 4CGYB 1X56A 1CKOA 5C4HA 1E24A 4V190 3GTJH 1L1OB 4B3RL 1EWHA 2R7ZH 1YJNA 2YTYA 4IO9A 3HOWB 2F0VA 3J81j 2E2JB 1EIHA 2XNAC 2F0JA 4YY3L 3CU7A 1VQAA 4DV5Q 4C3HG 1IYUA 3OIQA 2EYHA 4B3MQ 1STEA 3I4MG 3TEHB 1DGSA 3D3RA 4DV4L 4UY8C 3T16A 1EIFA 2EJFC 4IFDJ 4QCLA 1WYDA 5CR3A 1K83B 1YIJA 4IZ8A 4ME3A 2EXDA 1EZ6A 3S24A 5JEAH 4JI6Q 1H9MA 4FO2A 1Q46A 2J4XA 3MFGA 4BY7H 3G4SA 1VCIA 1QNKA 3TP5A 4OEMB 2BE5C 1YBYA 1F2LA 4DV0L 4DUYQ 2JXMB 4L5SA 1XMQL 3ITPA 4NXNL 4IFDG 1OXXK 1D6EC 2BH8A 4IPCA 1F9RA 1ZYRD 1P8LA 3RZOB 2HCIA 4C2MB 4XQNA 1BDOA 4DR3Q 4RGTA 3GO5A 3PO2B 5C0XH 1KDBA 1A3TA 3NBIA 2E2JH 3HOWH 1BXTA 4HJAA 4X3SA 3HOVB 3E6ZX 4P72A 1A63A 3DEOA 1EU3A 3VR5A 4YHHQ 1HR0Q 3A7LA 4KKUA 4PMCA 3PIO3 4GN4B 1K83H 5JPNC 3FKIB 1HUMA 1MSGA 2UUCQ 2K33A 4R4OA 3CQZB 3QO2A 3S1RB 4DAPA 3K81C 3SE0A 2OTLA 3NHHA 4K5WA 4CKEA 3NQIA 2ZM6Q 2NUCA 4MZ9A 1VQDA 1H95A 1JB3A 1C48A 1U4PA 3N6RA 4DN4M 3V2TA 3AEVA 2KVMA 1KHIA 4GN3B 2EY1A 5CV5A 3ULLA 4I65A 4BBRB 1PZJD 1A8VA 1KAAA 2A5HA 3RZOH 4C2MH 2EY6A 4TRDA 4BY1B 1K3RA 2A73B 2YTXA 3PO2H 3CPWA 1T5EA 1SNOA 2CWAA 2Z1CA 4KHVA 2Z4IA 1VQ4A 3TDQA 5IP9H 3HOVH 4O1NA 1VQKA 1D5XC 2G9HD 3TS0A 4DV7Q 1XTDA 4IJLA 2MFIA 4HR7B 3ULJA 1CT1D 4HSVA 5EPKA 3FKIH 3UDXA 5EGTA 3T51B 4ZKBB 4F8MA 1Y8OB 2EYFA 5KEEA 2WINB 1EY5A 3CQZH 4OIKA 3S1RH 2EIFA 5LL6S 3IRBA 2RHQB 1VQ5A 2L1BA 4F7XA 3T56B 2H1EA 4FP5D 1U4MA 4BXXG 1T5XD 3I90A 1GO3E 4EQNA 1ZYRC 4BBRH 1TS2A 2VS1A 4CDEC 2RQXA 2HCCA 3SDZA 2RHSB 4BY1H 2LXJA 2L12A 1BNZA 3E9IA 1R9TB 5FK9C 1JWUD 2EY2A 1LT3D 1LT6D 2B2UC 2PI2E 4C3HB 4O42A 4PZ7A 5FKAC 4HEDA 4KN7C 2Z4HA 1WTRA 3LWUA 1X3GA 4JI8L 4KI0A 5JOBA 3I4MB 4HTHA 1ICFB 4UPAA 1Q1BA 1CQVA 3CHBD 2D0PA 1MBYA 4NDXA 2Q8RE 3ZJYC 4R8NA 1F2MA 1JB7A 1I94Q 1B2TA 3MA2B 1CKMA 2F0LA 3F2CA 1Q81C 3CCJA 1B70B 4MTKA 2QF7A 4O2DA 4LMQD 2EZVA 2ZTEA 4M1UB 3JAMi 5C4ZA 1CSQA 4TVAB 3CCLA 4KD4A 4APVA 1QUQA 3TBIB 1PRTB 2M00A 1VQHA 3A8JE 1MD2D 1UE1A 1K8AC 2A1AA 1SNMA 4RA8A 2DNCA 5CORA 1R9TH 1PH7A 4UAIA 1RCVD 1BKBA 2F0OA 4A93G 3D8GA 2OTJA 4JG2A 4X66L 3PO3G 1E2ZA 3DM1A 4QF4A 4C3HH 3KDFA 5C3WA 3A7AB 5GROA 1QUQB 1TS3A 4XIGS 2QGQA 5IGGA 3I4MH 2O5JC 5C5LA 3HKZG 4JI0Q 3M4PA 1FR3A 2WP8J 1RKNA 3NP8A 2K05A 2HDLA 1NE3A 4ULLA 1FNVA 1D1KA 1DXMA 1TWFB 1EWCA 4PNYA 4YWLA 2VB2X 4HJ7A 1PYSB 3K5MA 3E9HA 3WOFA 1TY2A 3KDFB 5E1FA 2ICIA 5JVH3 3I7FA 4DR7Q 1PH2A 2KENA 1VQGA 4JI2Q 2XTIA 2E2DC 3SR1A 4CJ1B 4IFDH 2QA4A 2HHHQ 1L0YB 1KTKA 4C3JG 1FJGL
chains in the Genus database with same CATH topology
3SGIA 1ASYA 3TQYA 4HJ8A 2YYZA 2F52A 1W2BA 3J81c 1KXLA 2NVQH 1X55A 2R92H 4NXML 1RL2A 3CCQA 4DV1Q 3RN5A 4P71A 1QZGA 2E5LQ 3GTPH 4A76A 2VQFL 4OO1I 1HZAA 1Q1EA 1CUKA 3F8TA 1C0AA 3H0GG 2KHJA 3TRZA 3PCOB 3HFZB 4JBJA 1BBWA 1ASZA 1T9HA 3F2DA 4IFDI 1QVCA 5C4XG 2WFWA 3I4NH 5AJ3L 3CCUA 2ATWA 4ALPA 2E2IH 4LF8Q 3CF5A 1PH9A 2PNHA 5IYBH 4DK3C 4HIMA 4A3FH 3ERSX 2HT1A 1HNXQ 5C0XG 1TWFH 4R1JA 3HOWG 2A8VA 4IPGA 3A5ZB 5IP7G 5LMUQ 4A3KH 4LF4Q 1SRUA 1GVPA 1KAWA 3M85A 4B3TL 4JI7L 3RLNA 4DV6L 2UXCQ 5IWAQ 4P75A 5C4JH 1FGUA 3A5UA 3CCEA 4DV3Q 4HIKA 2NZOA 1M90C 5H1SE 3M4QA 4POFA 3H15A 4P73A 4DR4Q 1Y14B 1IBKQ 3OTOQ 3Q8DA 4WJ3M 4DR2L 3T1YQ 4DPGA 2V1CC 1CSPA 4QIWE 4X65L 3I2ZA 4JCVE 2QEXA 3NEMA 2JA5H 4A3CG 1HNZL 2VL6A 1SFOH 4YY3Q 3EIVA 2WAQE 2ES2A 1J6QA 5IY0A 4DUZQ 4DUYL 3CCMA 2UU9L 3PV0A 2NN6I 1C7YA 4X64L 2PQAA 4IPDA 1J5EL 2IY5B 1VQBA 4OWWB 5IYDH 5E7NA 2I0QA 4WJ4A 1KIXA 2Z0SA 3NBHB 4KHZA 2VZAA 2I5LX 1V43A 2CFMA 3RLOA 1VQ6A 3S17H 2N78A 2ZJPA 1VQCA 4LUZA 2Z6KC 2D0OA 3A74A 3G48A 4A3JG 1I94L 4X62Q 3ICEA 1VQIA 2JA9A 3KFUA 2R93G 5JJIA 4DR6L 3PUXA 3CXCA 1W3SA 4QY7A 4LF6Q 1A62A 1MIUA 3FP9A 2PQAB 4JC0A 4DV0Q 3PO2G 1KQSA 4JI8Q 1GM5A 1PVOA 2GN5A 4L5TA 5IP9G 3HKZE 3HOVG 1IZ6A 3MEFA 4UP8A 2AWOA 2K14A 1HR0L 2JA6G 2JA7H 4DR1Q 1X65A 4X6AH 2R6GA 4LF5L 4LFBQ 1Y1VH 2KCTA 1WCMH 1XMOL 2K4KA 2MO0A 3NELA 1UEBA 4GNXC 1EYGA 4A3IH 4BA2I 4BBSH 4BXXH 1C9OA 1N36Q 1IL2A 3FKIG 2ZTCA 2IT1A 3KOJA 2CQOA 2WB1E 1NY4A 4GKKL 4KHPL 3D31A 3STBD 4LUOA 4LUVA 1I50H 4UP9A 1A0IA 2ZTDA 3AFPA 2Q2IA 4YWKA 1K9MC 4GLAC 4A3LG 1XNRQ 1AH9A 2B3GA 1YJ9A 3HOZG 2UUAL 1E22A 1IBMQ 5GQOA 2VQEQ 2DGYA 4HJ5A 3UDGA 4LFCL 1N34L 1E1OA 1Q7YC 4JI1L 2IX1A 1I3QH 3RR5A 2JA8H 1HZ9A 2AHOB 4BBRG 1EQQA 1VQFA 3GTKH 4A3CH 1IBLQ 1U5KA 1LUZA 1K0RA 1PH8A 5M5WH 2JQOA 3W1GA 1G6PA 5IYCH 4B3SL 5LMNL 1G291 3CC7A 2UUBL 4BY1G 4JI4L 4DR7L 1UWVA 3BJUA 3ER0A 4JYAQ 1EFWA 3PUYA 4JV5Q 4K0KL 4PMWA 4HIDA 2D62A 4JOIA 4PZ6A 2UXDQ 1SMXA 2OQ0A 1CKNA 2K50A 3GD7A 1QVGA 3TS2A 1VS0A 3KJOA 2MQHA 4GOPA 3U50C 3I55A 1WFQA 3U58A 1NMGA 4EQ5A 3RLFA 3JAMc 5C0XJ 5IT9c 2NVXH 4A3EH 2BA1A 2Q2TA 2R93H 3JC66 1TWCH 1WI5A 4DV1L 2E5LL 4JI5L 2JEBI 3U4ZA 5C44G 4DK6C 3UE0A 2B29A 5C3EH 1VQ8A 1YNXA 3F2BA 1LM0A 1FVIA 4OX9L 2JK8A 4LF7Q 3J80c 1PH5A 1CKNB 1S3OA 3U4VA 1MJEA 1Y1WG 1X6OA 3HOYG 4PZ8A 2BA0A 4R4QA 4LF8L 4GOPB 1HR0W 1L1OA 4JI3Q 3RN2A 4A3GG 3OW2A 2OWOA 1N32L 1V9PA 3HKSA 4A93H 2H5XA 3AQQA 3L0OA 3WWVA 2UXBL 5LMUL 1JT8A 4LF4L 4HIOA 2UXCL 5ELOA 2PMZE 2FXQA 5IWAL 3K0XA 2E2HH 3NENA 3PO3H 1EIYB 4FDBA 3BZCA 4P74A 2ZJQA 2K5VA 3K7AH 1M1KC 1IYJB 4DR5Q 1X9NA 2L15A 4LFAL 4DR4L 4O0AA 2N49A 1IBKL 1JMCA 1X56A 3OTOL 1CKOA 1PH4A 1KRTA 1E24A 5FJ8G 3CMEA 3GTJH 3T1YL 1L1OB 4B3RL 4LW1A 3T1HQ 2R7ZH 4LWCA 5AJ3Q 2VUMG 1I6HH 4R4TA 2Q2HA 1YJNA 1B8AA 2YTYA 1MJCA 4IO9A 1AE3A 4IOCA 2LXKA 1HZCA 3J81j 1XPRA 4YY3L 1UE6A 1JJ2A 1VQAA 2MNAA 3HOXG 5FLXc 4DUZL 4DV5Q 1Q86C 5FLMG 2B63G 3OYYA 4OONA 4B3MQ 2GVAA 5LMNW 3I4MG 3D0FA 3TEHB 1DGSA 3STBC 4DV4L 4UY8C 1UE7A 3I4OA 1EIFA 4GLXA 4IFDJ 1WYDA 4GS3A 3RNUA 1YIJA 3K8AA 3GDEA 4UP7A 3CPFA 4ME3A 3GTOH 2EXDA 1B7YB 3S24A 1EWIA 4JI6Q 1LYLA 1YVCA 1Q46A 1YITA 1E7ZA 3CD6A 4BY7H 3G4SA 4X62L 1VCIA 4C3JH 4A75A 1KD1C 1OXVA 4LF6L 3KF8B 1S72A 4A3BG 1YBYA 4DV0L 1EUJA 4OXPA 5IE8A 4DUYQ 2K75A 4X64Q 5C44H 4L5SA 4OO1G 1J5EQ 1XMQL 1OXSC 4AH6A 4GKJQ 3S2HH 4H02A 4NXNL 3H0GH 4MTNA 5HY6A 3KJPA 4YWMA 1N9WA 1E3PA 4A3MG 4IFDG 3UDIA 1OXXK 4DR1L 2XGTA 1XNQQ 1OXTA 4GLVB 4IPCA 2BH8A 4LFBL 5C4XH 1P8LA 1Q8KA 2RCNA 5ELNA 1VQ9A 1HH2P 4DR3Q 1SROA 4TQUS 2NZHA 1N36L 3GO5A 1V1QA 1VQMA 2R92G 3S1NH 1JJGA 5BR8Q 4DR6Q 1YJWA 2OCEA 2E2JH 3HOWH 5IP7H 5JJLA 3HOUG 2Z6KA 4YCVA 4HJAA 1VQPA 1RIPA 4P72A 4QGUA 3J81i 4JI0L 1A63A 1N33Q 1QVFA 1IBML 4IJHA 4IPHA 2VQEL 2YTVA 1JJCB 3H3VH 3I4NG 4YHHQ 1HR0Q 5IYBG 3LGJA 1KRSA 1SN8A 4GN4B 4LF5Q 1K83H 1XMOQ 1TWGH 1K8GA 3PF4A 3G6EA 2UUCQ 4A3KG 1HJPA 4JOIC 4X66Q 2IX0A 3M9BA 1EOVA 4R4OA 3M3YH 2NN6G 1YHAA 4AQYQ 3K81C 3BU2A 2CWPA 4GNXA 4JYAL 2OTLA 3M4OH 5GAHC 4JI2L 3PIOA 2HIVA 1PHJA 2ZM6Q 1PA6A 2UXDL 4MZ9A 1S40A 2UUAQ 2BH2A 1VQDA 1H95A 4YCUA 3AEVA 2Y0SG 1TWAH 4JBMA 1N8RC 2HHHL 1KHIA 4GN3B 1TWHH 2JA5G 4LFCQ 2K5HA 3ULLA 1G51A 1NMFA 2F4VQ 4A3DG 1K73C 4A3JH 3F1ZA 1A8VA 3RZOH 1JE5A 1X3FA 2K52A 3E0EA 4C2MH 4LF9Q 3GTQH 4HJ9A 1YI2A 1K3RA 2DUDA 1I5FA 3ULPA 4GNXB 2YTXA 5IYDG 3PO2H 3CPWA 4RG1A 2CWAA 1VQ4A 1MKHA 1X54A 2IHFA 3GTMH 2EQSA 5IP9H 1WJJA 3HOVH 1OTCA 1YHQA 1HNWQ 4BA1I 1PH6A 4A3MH 1VQKA 3AYHB 1NJIC 3TS0A 3GTGH 5GAEC 4DV7Q 3B6YA 4OWXB 1XTDA 1GD7A 4IJLA 1PYBA 4DV2Q 2JA6H 1NBWA 2MFIA 2YV5A 3CP0A 3CC2A 3ULJA 3G71A 3S15H 1HNXL 2HIXA 1FJGQ 3PUZA 3FKIH 3UDXA 1QZHA 4QL5A 4Y52H 4NXMQ 4DV3L 3PIPA 4JI5Q 1SLJA 2AWNA 4DR5L 2VQFQ 4DKAC 3RZDH 3BZKA 3HOUH 3CQZH 4OX9Q 3S1RH 2EIFA 4AYBG 4A3LH 1O7IA 4L5QA 1VQOA 1PV4A 3IRBA 4B3ML 3DM3A 2JA7G 3HOZH 2RHQB 1VQ5A 1Z47A 3T1HL 1Y1VG 1L0WA 1WCMG 4POGA 2CKZB 3PUWA 1P16A 4BBSG 2A19A 4A3IG 4BXXG 1BBUA 4QQBX 4PG3A 3PUVA 3L2PA 2AKWB 4AIMA 4IOAA 1HZBA 1GO3E 2MO1A 4R4IA 1N32Q 3FHWA 4DV5L 4BBRH 2UXBQ 3CCSA 1IXRA 4MNOA 2YU9H 2VS1A 1EQRA 1PFSA 3UDFA 4B3TQ 4JI7Q 4DV6Q 4R4CA 2RHSB 4BY1H 2LXJA 2F3IA 3KYHC 4LFAQ 1XPOA 3E9IA 4XTCS 5HGQA 4A4IA 4JI6L 4DAYB 5M3MG 4DR2Q 4B3RQ 5M5XH 3S16H 3EBEA 1GKHA 3S1MH 2JA8G 1SR3A 2K5NA 4X65Q 5M3FG 4Y7NH 1Z9FA 2IHEA 1TXYA 4NPSA 4A3DH 2PI2E 1HNZQ 2ID0A 4PZ7A 2R7FA 3A0JA 2LSSA 5IYCG 1X3GA 2HQLA 2NVTH 1VQNA 3AFQA 4JI8L 3PF5A 4KI0A 2UU9Q 4UPAA 1Q1BA 2C35B 4GKJL 3CW2C 4JBWA 4KLKA 4QJFA 3L7ZC 4C3IH 4DV4Q 4GN5A 2N3SA 3S14H 3TREA 2D0PA 1XNQL 3HOYH 1SE8A 1Y1WH 1E1TA 3ZJYC 3MXNB 4DR3L 3PGZA 1JB7A 1I94Q 1CKMA 4A3GH 2KHIA 4A3EG 1LTLA 2AMCB 2GVBA 3F2CA 2PI2A 1Q81C 5M5YH 3EN2A 5BR8L 3CCJA 3CC4A 3CMAA 1B70B 4O2DA 2WAQG 1Q82C 5C3EG 1YEZA 2ZTEA 2R7DA 3JAMi 1FL0A 1CSQA 3J7A5 4TVAB 2KCMA 3CCLA 1XPUA 1XNRL 4YCWA 4APVA 1QUQA 1XMQQ 1N33L 3S2DH 5JJKA 1KC8C 4JBKA 1VQHA 4NXNQ 1VQJA 5EAYA 2VY3A 2Y0SE 1UE1A 4YHHL 3CCRA 1K8AC 1OXUA 2ALYB 1D7QA 5FJ8H 2A1AA 3VDYA 2RF4A 1R9TH 1PH7A 1U0LA 4A3FG 3J80i 2I5HA 2VUMH 2JE6I 1BKBA 2JJQA 4A93G 1D8LA 4EX5A 1IBLL 2UUCL 3DLLA 5C0XI 2OTJA 4LNQA 2ZJRA 1YHBA 4JG2A 4X66L 5DLQE 3PO3G 3HOXH 4C3HH 3KDFA 5J3BA 4GKKQ 4AQYL 5FLMH 2B63H 2ASBA 1PH3A 4KHPQ 1WOCA 5GROA 1QUQB 4XIGS 2QGQA 4GOPC 3CAMA 2KBNA 5GAGC 4JV5L 3I4MH 3CCVA 1UE5A 2ZM6L 3W1BA 4L5RC 4JI0Q 3HKZG 3H3VI 3M7NA 3M4PA 4OWTB 2WP8J 5JEAJ 2N8NA 1VQ7A 2Q2UA 3W5OA 2R7ZG 3KF6A 1NE3A 3S1QH 4DNIA 1VQLA 5M3MH 2F4VL 1N34Q 1AE2A 3I56A 2JEAI 2NVYH 4JI1Q 3KLWA 1VQEA 4YWLA 3UE1A 5M3FH 4HJ7A 1PYSB 4LF9L 3E9HA 1L2FA 1YZ6A 2I5MX 2VNUD 5K36G 1XJVA 3KDFB 5GADC 2WB1G 4RMFA 1Q12A 3GTLH 1NTGA 4A3BH 3K80C 3PSIA 2OQKA 2E8GA 1PH1A 4B3SQ 1L1OC 3K7UC 3I7FA 5LMNQ 2UUBQ 4JI4Q 1PH2A 4DR7Q 2KENA 4LF7L 4AYBE 4NB3A 1VQGA 1KL9A 4JI2Q 2XTIA 1BVSA 4K0KQ 3KF6B 5JEAG 3J7ZC 4DV2L 4DV7L 1HNWL 4J15A 4JI3L 2QA4A 4BY7G 2HHHQ 4DAMA 2CCZA 1X3EA 2VW9A 1FJGL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SGI A;  1ASY A;  3TQY A;  4HJ8 A;  2YYZ A;  2F52 A;  1W2B A;  3J81 c;  1KXL A;  2NVQ H;  1X55 A;  2R92 H;  4NXM L;  1RL2 A;  3CCQ A;  4DV1 Q;  3RN5 A;  4P71 A;  1QZG A;  2E5L Q;  3GTP H;  4A76 A;  2VQF L;  4OO1 I;  1HZA A;  1Q1E A;  1CUK A;  3F8T A;  1C0A A;  3H0G G;  2KHJ A;  3TRZ A;  3PCO B;  3HFZ B;  4JBJ A;  1BBW A;  1ASZ A;  1T9H A;  3F2D A;  4IFD I;  1QVC A;  5C4X G;  2WFW A;  3I4N H;  5AJ3 L;  3CCU A;  2ATW A;  4ALP A;  2E2I H;  4LF8 Q;  3CF5 A;  1PH9 A;  2PNH A;  5IYB H;  4DK3 C;  4HIM A;  4A3F H;  3ERS X;  2HT1 A;  1HNX Q;  5C0X G;  1TWF H;  4R1J A;  3HOW G;  2A8V A;  4IPG A;  3A5Z B;  5IP7 G;  5LMU Q;  4A3K H;  4LF4 Q;  1SRU A;  1GVP A;  1KAW A;  3M85 A;  4B3T L;  4JI7 L;  3RLN A;  4DV6 L;  2UXC Q;  5IWA Q;  4P75 A;  5C4J H;  1FGU A;  3A5U A;  3CCE A;  4DV3 Q;  4HIK A;  2NZO A;  1M90 C;  5H1S E;  3M4Q A;  4POF A;  3H15 A;  4P73 A;  4DR4 Q;  1Y14 B;  1IBK Q;  3OTO Q;  3Q8D A;  4WJ3 M;  4DR2 L;  3T1Y Q;  4DPG A;  2V1C C;  1CSP A;  4QIW E;  4X65 L;  3I2Z A;  4JCV E;  2QEX A;  3NEM A;  2JA5 H;  4A3C G;  1HNZ L;  2VL6 A;  1SFO H;  4YY3 Q;  3EIV A;  2WAQ E;  2ES2 A;  1J6Q A;  5IY0 A;  4DUZ Q;  4DUY L;  3CCM A;  2UU9 L;  3PV0 A;  2NN6 I;  1C7Y A;  4X64 L;  2PQA A;  4IPD A;  1J5E L;  2IY5 B;  1VQB A;  4OWW B;  5IYD H;  5E7N A;  2I0Q A;  4WJ4 A;  1KIX A;  2Z0S A;  3NBH B;  4KHZ A;  2VZA A;  2I5L X;  1V43 A;  2CFM A;  3RLO A;  1VQ6 A;  3S17 H;  2N78 A;  2ZJP A;  1VQC A;  4LUZ A;  2Z6K C;  2D0O A;  3A74 A;  3G48 A;  4A3J G;  1I94 L;  4X62 Q;  3ICE A;  1VQI A;  2JA9 A;  3KFU A;  2R93 G;  5JJI A;  4DR6 L;  3PUX A;  3CXC A;  1W3S A;  4QY7 A;  4LF6 Q;  1A62 A;  1MIU A;  3FP9 A;  2PQA B;  4JC0 A;  4DV0 Q;  3PO2 G;  1KQS A;  4JI8 Q;  1GM5 A;  1PVO A;  2GN5 A;  4L5T A;  5IP9 G;  3HKZ E;  3HOV G;  1IZ6 A;  3MEF A;  4UP8 A;  2AWO A;  2K14 A;  1HR0 L;  2JA6 G;  2JA7 H;  4DR1 Q;  1X65 A;  4X6A H;  2R6G A;  4LF5 L;  4LFB Q;  1Y1V H;  2KCT A;  1WCM H;  1XMO L;  2K4K A;  2MO0 A;  3NEL A;  1UEB A;  4GNX C;  1EYG A;  4A3I H;  4BA2 I;  4BBS H;  4BXX H;  1C9O A;  1N36 Q;  1IL2 A;  3FKI G;  2ZTC A;  2IT1 A;  3KOJ A;  2CQO A;  2WB1 E;  1NY4 A;  4GKK L;  4KHP L;  3D31 A;  3STB D;  4LUO A;  4LUV A;  1I50 H;  4UP9 A;  1A0I A;  2ZTD A;  3AFP A;  2Q2I A;  4YWK A;  1K9M C;  4GLA C;  4A3L G;  1XNR Q;  1AH9 A;  2B3G A;  1YJ9 A;  3HOZ G;  2UUA L;  1E22 A;  1IBM Q;  5GQO A;  2VQE Q;  2DGY A;  4HJ5 A;  3UDG A;  4LFC L;  1N34 L;  1E1O A;  1Q7Y C;  4JI1 L;  2IX1 A;  1I3Q H;  3RR5 A;  2JA8 H;  1HZ9 A;  2AHO B;  4BBR G;  1EQQ A;  1VQF A;  3GTK H;  4A3C H;  1IBL Q;  1U5K A;  1LUZ A;  1K0R A;  1PH8 A;  5M5W H;  2JQO A;  3W1G A;  1G6P A;  5IYC H;  4B3S L;  5LMN L;  1G29 1;  3CC7 A;  2UUB L;  4BY1 G;  4JI4 L;  4DR7 L;  1UWV A;  3BJU A;  3ER0 A;  4JYA Q;  1EFW A;  3PUY A;  4JV5 Q;  4K0K L;  4PMW A;  4HID A;  2D62 A;  4JOI A;  4PZ6 A;  2UXD Q;  1SMX A;  2OQ0 A;  1CKN A;  2K50 A;  3GD7 A;  1QVG A;  3TS2 A;  1VS0 A;  3KJO A;  2MQH A;  4GOP A;  3U50 C;  3I55 A;  1WFQ A;  3U58 A;  1NMG A;  4EQ5 A;  3RLF A;  3JAM c;  5C0X J;  5IT9 c;  2NVX H;  4A3E H;  2BA1 A;  2Q2T A;  2R93 H;  3JC6 6;  1TWC H;  1WI5 A;  4DV1 L;  2E5L L;  4JI5 L;  2JEB I;  3U4Z A;  5C44 G;  4DK6 C;  3UE0 A;  2B29 A;  5C3E H;  1VQ8 A;  1YNX A;  3F2B A;  1LM0 A;  1FVI A;  4OX9 L;  2JK8 A;  4LF7 Q;  3J80 c;  1PH5 A;  1CKN B;  1S3O A;  3U4V A;  1MJE A;  1Y1W G;  1X6O A;  3HOY G;  4PZ8 A;  2BA0 A;  4R4Q A;  4LF8 L;  4GOP B;  1HR0 W;  1L1O A;  4JI3 Q;  3RN2 A;  4A3G G;  3OW2 A;  2OWO A;  1N32 L;  1V9P A;  3HKS A;  4A93 H;  2H5X A;  3AQQ A;  3L0O A;  3WWV A;  2UXB L;  5LMU L;  1JT8 A;  4LF4 L;  4HIO A;  2UXC L;  5ELO A;  2PMZ E;  2FXQ A;  5IWA L;  3K0X A;  2E2H H;  3NEN A;  3PO3 H;  1EIY B;  4FDB A;  3BZC A;  4P74 A;  2ZJQ A;  2K5V A;  3K7A H;  1M1K C;  1IYJ B;  4DR5 Q;  1X9N A;  2L15 A;  4LFA L;  4DR4 L;  4O0A A;  2N49 A;  1IBK L;  1JMC A;  1X56 A;  3OTO L;  1CKO A;  1PH4 A;  1KRT A;  1E24 A;  5FJ8 G;  3CME A;  3GTJ H;  3T1Y L;  1L1O B;  4B3R L;  4LW1 A;  3T1H Q;  2R7Z H;  4LWC A;  5AJ3 Q;  2VUM G;  1I6H H;  4R4T A;  2Q2H A;  1YJN A;  1B8A A;  2YTY A;  1MJC A;  4IO9 A;  1AE3 A;  4IOC A;  2LXK A;  1HZC A;  3J81 j;  1XPR A;  4YY3 L;  1UE6 A;  1JJ2 A;  1VQA A;  2MNA A;  3HOX G;  5FLX c;  4DUZ L;  4DV5 Q;  1Q86 C;  5FLM G;  2B63 G;  3OYY A;  4OON A;  4B3M Q;  2GVA A;  5LMN W;  3I4M G;  3D0F A;  3TEH B;  1DGS A;  3STB C;  4DV4 L;  4UY8 C;  1UE7 A;  3I4O A;  1EIF A;  4GLX A;  4IFD J;  1WYD A;  4GS3 A;  3RNU A;  1YIJ A;  3K8A A;  3GDE A;  4UP7 A;  3CPF A;  4ME3 A;  3GTO H;  2EXD A;  1B7Y B;  3S24 A;  1EWI A;  4JI6 Q;  1LYL A;  1YVC A;  1Q46 A;  1YIT A;  1E7Z A;  3CD6 A;  4BY7 H;  3G4S A;  4X62 L;  1VCI A;  4C3J H;  4A75 A;  1KD1 C;  1OXV A;  4LF6 L;  3KF8 B;  1S72 A;  4A3B G;  1YBY A;  4DV0 L;  1EUJ A;  4OXP A;  5IE8 A;  4DUY Q;  2K75 A;  4X64 Q;  5C44 H;  4L5S A;  4OO1 G;  1J5E Q;  1XMQ L;  1OXS C;  4AH6 A;  4GKJ Q;  3S2H H;  4H02 A;  4NXN L;  3H0G H;  4MTN A;  5HY6 A;  3KJP A;  4YWM A;  1N9W A;  1E3P A;  4A3M G;  4IFD G;  3UDI A;  1OXX K;  4DR1 L;  2XGT A;  1XNQ Q;  1OXT A;  4GLV B;  4IPC A;  2BH8 A;  4LFB L;  5C4X H;  1P8L A;  1Q8K A;  2RCN A;  5ELN A;  1VQ9 A;  1HH2 P;  4DR3 Q;  1SRO A;  4TQU S;  2NZH A;  1N36 L;  3GO5 A;  1V1Q A;  1VQM A;  2R92 G;  3S1N H;  1JJG A;  5BR8 Q;  4DR6 Q;  1YJW A;  2OCE A;  2E2J H;  3HOW H;  5IP7 H;  5JJL A;  3HOU G;  2Z6K A;  4YCV A;  4HJA A;  1VQP A;  1RIP A;  4P72 A;  4QGU A;  3J81 i;  4JI0 L;  1A63 A;  1N33 Q;  1QVF A;  1IBM L;  4IJH A;  4IPH A;  2VQE L;  2YTV A;  1JJC B;  3H3V H;  3I4N G;  4YHH Q;  1HR0 Q;  5IYB G;  3LGJ A;  1KRS A;  1SN8 A;  4GN4 B;  4LF5 Q;  1K83 H;  1XMO Q;  1TWG H;  1K8G A;  3PF4 A;  3G6E A;  2UUC Q;  4A3K G;  1HJP A;  4JOI C;  4X66 Q;  2IX0 A;  3M9B A;  1EOV A;  4R4O A;  3M3Y H;  2NN6 G;  1YHA A;  4AQY Q;  3K81 C;  3BU2 A;  2CWP A;  4GNX A;  4JYA L;  2OTL A;  3M4O H;  5GAH C;  4JI2 L;  3PIO A;  2HIV A;  1PHJ A;  2ZM6 Q;  1PA6 A;  2UXD L;  4MZ9 A;  1S40 A;  2UUA Q;  2BH2 A;  1VQD A;  1H95 A;  4YCU A;  3AEV A;  2Y0S G;  1TWA H;  4JBM A;  1N8R C;  2HHH L;  1KHI A;  4GN3 B;  1TWH H;  2JA5 G;  4LFC Q;  2K5H A;  3ULL A;  1G51 A;  1NMF A;  2F4V Q;  4A3D G;  1K73 C;  4A3J H;  3F1Z A;  1A8V A;  3RZO H;  1JE5 A;  1X3F A;  2K52 A;  3E0E A;  4C2M H;  4LF9 Q;  3GTQ H;  4HJ9 A;  1YI2 A;  1K3R A;  2DUD A;  1I5F A;  3ULP A;  4GNX B;  2YTX A;  5IYD G;  3PO2 H;  3CPW A;  4RG1 A;  2CWA A;  1VQ4 A;  1MKH A;  1X54 A;  2IHF A;  3GTM H;  2EQS A;  5IP9 H;  1WJJ A;  3HOV H;  1OTC A;  1YHQ A;  1HNW Q;  4BA1 I;  1PH6 A;  4A3M H;  1VQK A;  3AYH B;  1NJI C;  3TS0 A;  3GTG H;  5GAE C;  4DV7 Q;  3B6Y A;  4OWX B;  1XTD A;  1GD7 A;  4IJL A;  1PYB A;  4DV2 Q;  2JA6 H;  1NBW A;  2MFI A;  2YV5 A;  3CP0 A;  3CC2 A;  3ULJ A;  3G71 A;  3S15 H;  1HNX L;  2HIX A;  1FJG Q;  3PUZ A;  3FKI H;  3UDX A;  1QZH A;  4QL5 A;  4Y52 H;  4NXM Q;  4DV3 L;  3PIP A;  4JI5 Q;  1SLJ A;  2AWN A;  4DR5 L;  2VQF Q;  4DKA C;  3RZD H;  3BZK A;  3HOU H;  3CQZ H;  4OX9 Q;  3S1R H;  2EIF A;  4AYB G;  4A3L H;  1O7I A;  4L5Q A;  1VQO A;  1PV4 A;  3IRB A;  4B3M L;  3DM3 A;  2JA7 G;  3HOZ H;  2RHQ B;  1VQ5 A;  1Z47 A;  3T1H L;  1Y1V G;  1L0W A;  1WCM G;  4POG A;  2CKZ B;  3PUW A;  1P16 A;  4BBS G;  2A19 A;  4A3I G;  4BXX G;  1BBU A;  4QQB X;  4PG3 A;  3PUV A;  3L2P A;  2AKW B;  4AIM A;  4IOA A;  1HZB A;  1GO3 E;  2MO1 A;  4R4I A;  1N32 Q;  3FHW A;  4DV5 L;  4BBR H;  2UXB Q;  3CCS A;  1IXR A;  4MNO A;  2YU9 H;  2VS1 A;  1EQR A;  1PFS A;  3UDF A;  4B3T Q;  4JI7 Q;  4DV6 Q;  4R4C A;  2RHS B;  4BY1 H;  2LXJ A;  2F3I A;  3KYH C;  4LFA Q;  1XPO A;  3E9I A;  4XTC S;  5HGQ A;  4A4I A;  4JI6 L;  4DAY B;  5M3M G;  4DR2 Q;  4B3R Q;  5M5X H;  3S16 H;  3EBE A;  1GKH A;  3S1M H;  2JA8 G;  1SR3 A;  2K5N A;  4X65 Q;  5M3F G;  4Y7N H;  1Z9F A;  2IHE A;  1TXY A;  4NPS A;  4A3D H;  2PI2 E;  1HNZ Q;  2ID0 A;  4PZ7 A;  2R7F A;  3A0J A;  2LSS A;  5IYC G;  1X3G A;  2HQL A;  2NVT H;  1VQN A;  3AFQ A;  4JI8 L;  3PF5 A;  4KI0 A;  2UU9 Q;  4UPA A;  1Q1B A;  2C35 B;  4GKJ L;  3CW2 C;  4JBW A;  4KLK A;  4QJF A;  3L7Z C;  4C3I H;  4DV4 Q;  4GN5 A;  2N3S A;  3S14 H;  3TRE A;  2D0P A;  1XNQ L;  3HOY H;  1SE8 A;  1Y1W H;  1E1T A;  3ZJY C;  3MXN B;  4DR3 L;  3PGZ A;  1JB7 A;  1I94 Q;  1CKM A;  4A3G H;  2KHI A;  4A3E G;  1LTL A;  2AMC B;  2GVB A;  3F2C A;  2PI2 A;  1Q81 C;  5M5Y H;  3EN2 A;  5BR8 L;  3CCJ A;  3CC4 A;  3CMA A;  1B70 B;  4O2D A;  2WAQ G;  1Q82 C;  5C3E G;  1YEZ A;  2ZTE A;  2R7D A;  3JAM i;  1FL0 A;  1CSQ A;  3J7A 5;  4TVA B;  2KCM A;  3CCL A;  1XPU A;  1XNR L;  4YCW A;  4APV A;  1QUQ A;  1XMQ Q;  1N33 L;  3S2D H;  5JJK A;  1KC8 C;  4JBK A;  1VQH A;  4NXN Q;  1VQJ A;  5EAY A;  2VY3 A;  2Y0S E;  1UE1 A;  4YHH L;  3CCR A;  1K8A C;  1OXU A;  2ALY B;  1D7Q A;  5FJ8 H;  2A1A A;  3VDY A;  2RF4 A;  1R9T H;  1PH7 A;  1U0L A;  4A3F G;  3J80 i;  2I5H A;  2VUM H;  2JE6 I;  1BKB A;  2JJQ A;  4A93 G;  1D8L A;  4EX5 A;  1IBL L;  2UUC L;  3DLL A;  5C0X I;  2OTJ A;  4LNQ A;  2ZJR A;  1YHB A;  4JG2 A;  4X66 L;  5DLQ E;  3PO3 G;  3HOX H;  4C3H H;  3KDF A;  5J3B A;  4GKK Q;  4AQY L;  5FLM H;  2B63 H;  2ASB A;  1PH3 A;  4KHP Q;  1WOC A;  5GRO A;  1QUQ B;  4XIG S;  2QGQ A;  4GOP C;  3CAM A;  2KBN A;  5GAG C;  4JV5 L;  3I4M H;  3CCV A;  1UE5 A;  2ZM6 L;  3W1B A;  4L5R C;  4JI0 Q;  3HKZ G;  3H3V I;  3M7N A;  3M4P A;  4OWT B;  2WP8 J;  5JEA J;  2N8N A;  1VQ7 A;  2Q2U A;  3W5O A;  2R7Z G;  3KF6 A;  1NE3 A;  3S1Q H;  4DNI A;  1VQL A;  5M3M H;  2F4V L;  1N34 Q;  1AE2 A;  3I56 A;  2JEA I;  2NVY H;  4JI1 Q;  3KLW A;  1VQE A;  4YWL A;  3UE1 A;  5M3F H;  4HJ7 A;  1PYS B;  4LF9 L;  3E9H A;  1L2F A;  1YZ6 A;  2I5M X;  2VNU D;  5K36 G;  1XJV A;  3KDF B;  5GAD C;  2WB1 G;  4RMF A;  1Q12 A;  3GTL H;  1NTG A;  4A3B H;  3K80 C;  3PSI A;  2OQK A;  2E8G A;  1PH1 A;  4B3S Q;  1L1O C;  3K7U C;  3I7F A;  5LMN Q;  2UUB Q;  4JI4 Q;  1PH2 A;  4DR7 Q;  2KEN A;  4LF7 L;  4AYB E;  4NB3 A;  1VQG A;  1KL9 A;  4JI2 Q;  2XTI A;  1BVS A;  4K0K Q;  3KF6 B;  5JEA G;  3J7Z C;  4DV2 L;  4DV7 L;  1HNW L;  4J15 A;  4JI3 L;  2QA4 A;  4BY7 G;  2HHH Q;  4DAM A;  2CCZ A;  1X3E A;  2VW9 A;  1FJG L; 
#chains in the Genus database with same CATH topology
 3SGI A;  1CK1 A;  1GUG A;  3H3V C;  4HJ8 A;  1KXL A;  4DV1 Q;  5CV7 A;  4LK1 C;  1CUK A;  2L4N A;  2KHJ A;  3R93 A;  3HFZ B;  3TP8 A;  1T9H A;  1EY9 A;  2KQ3 A;  3X3M A;  5C4X G;  3CCU A;  2EYJ A;  2ATW A;  4ALP A;  1K0S A;  2HD3 A;  2PNH A;  4DK3 C;  2D2C C;  2HUG A;  1TWF H;  4R1J A;  5JJZ A;  2OXP A;  2A8V A;  1HA6 A;  5IP7 G;  4LF4 Q;  3I4L A;  1GVP A;  3M85 A;  4JI7 L;  4DV6 L;  3A5U A;  4B3M L;  4DV3 Q;  4HIK A;  4L63 B;  5DEH A;  4POF A;  2WV6 D;  1W6J A;  2Z8L A;  1CZW A;  1G6Z A;  4KJO A;  1IBK Q;  3MXP A;  3HG9 A;  4KN4 C;  3AU7 A;  4DR2 L;  4P2C B;  2LMC B;  4I7A A;  4ZUI A;  2V1C C;  1WD1 A;  3C2P A;  4JCV E;  4A3C G;  1F9P A;  1I50 B;  4Q0F A;  4YY3 Q;  1PLF A;  3N52 A;  5CYU A;  1J6Q A;  4DUY L;  3PV0 A;  2FMM A;  2PQA A;  1B50 A;  1KIX A;  2Z0S A;  4KHZ A;  1KAB A;  1YNN C;  3IFT A;  3IAY A;  2R61 A;  3GTK B;  2SDF A;  2Z6K C;  3A74 A;  4DA2 A;  4A3J G;  1QCB D;  1PXU A;  5AFW A;  4IUT A;  2PO4 A;  4UDU C;  2R93 G;  2RBM A;  4UHV A;  3CXC A;  1MIU A;  3FP9 A;  2PQA B;  3HP3 A;  4DV0 Q;  1PVO A;  1STH A;  1CM9 A;  5EJW A;  3DEP A;  5L37 A;  1EL0 A;  2EXZ A;  3G7L A;  2BCO A;  1RJT A;  3P75 A;  1D1I A;  4FF3 A;  1HR0 L;  2JA6 G;  5I2Y A;  4QMG A;  2BOS A;  2NVX B;  3OWE B;  3MVV A;  3E0J A;  5F2D A;  2K4K A;  1EYC A;  1MI2 A;  1EYG A;  4BXX H;  4BA2 I;  4KMU C;  1C9O A;  3BDO A;  5IGE A;  1IW7 D;  5CGK A;  2CQO A;  4KHP L;  1I50 H;  2DN8 A;  2PW7 A;  3AFP A;  5ELE A;  4YWK A;  2M9V A;  3K58 A;  1K9M C;  1S5E D;  2PZT A;  4HCE A;  1BR9 A;  5GQO A;  4HJ5 A;  2L55 A;  1N34 L;  4A93 B;  1E1O A;  1ET6 A;  2AHO B;  3PO3 B;  1VQF A;  3GTK H;  1SJE D;  2XVS A;  2RDF A;  1UAP A;  2CQA A;  2AQ3 B;  3W1G A;  3CC7 A;  2R3Z A;  5C5M A;  1GUT A;  3BJU A;  3HKZ B;  2F3V A;  3SHL A;  2RSN A;  3P7J A;  4K0K L;  2D62 A;  4JOI A;  4PZ6 A;  1SMX A;  1QWY A;  3GD7 A;  2EYO A;  1Y69 U;  4K5X A;  1G8Z D;  4GOP A;  5EBD A;  1Q90 A;  1HHV A;  1STA A;  1NMG A;  3E5S A;  3HGB A;  4EQP A;  5C0X J;  2NVX H;  2B2V C;  1WI5 A;  2ZXR A;  4ZK9 B;  2JEB I;  1VF5 C;  1AEX A;  5IGC A;  4ME5 A;  3UE0 A;  2B29 A;  1CZG A;  4IUV A;  5ELC A;  1JWS D;  5KIX A;  2EYP A;  4DFA A;  1Y1W G;  1KLG D;  2BA0 A;  4LF8 L;  4C3J B;  4GOP B;  4K2L A;  1HR0 W;  3RN2 A;  4JK1 C;  4U67 3;  1KDA A;  2RDH A;  1SXT A;  3QB3 A;  4A93 H;  3BVM A;  2XWB B;  5C44 B;  4HIO A;  1SE2 A;  2PMZ E;  5IWA L;  3PO3 H;  1EIY B;  2K5V A;  1M1K C;  3OIP A;  4O0A A;  3OTO L;  3C1F A;  5C4X B;  1H9S B;  3T1Y L;  1DOL A;  1XTC D;  1Y8P B;  1MHW C;  4R4T A;  1B8A A;  1TII D;  2NYZ D;  5FLX L;  3NTI A;  3SK6 A;  1XPR A;  1RHP A;  1UE6 A;  1JJ2 A;  5FLX c;  3J7A F;  2ZT9 C;  2B63 G;  3S9W A;  3OYY A;  2B2T A;  1O78 A;  2GVA A;  2F1M A;  2PQE A;  2WAC A;  3VR3 A;  2QDL A;  2P5Z X;  4GLX A;  2RCF A;  2K32 A;  4UP7 A;  3T4A C;  1TWG B;  4M8A A;  1E7Z A;  4RH6 A;  2KCC A;  2G9D A;  1AZP A;  4C3J H;  4A75 A;  1KD1 C;  3M3Y B;  1LTG D;  4LF6 L;  1S72 A;  1YNJ D;  1EUJ A;  5IE8 A;  2LY7 A;  2NTT A;  5C44 H;  4OO1 G;  4X3K A;  3EQL C;  4AH6 A;  3DWQ A;  4K5V A;  4MTN A;  5HY6 A;  3KJP A;  2GA4 B;  4H13 C;  3K5O A;  5IGD A;  1B4O A;  4A3J B;  5C4X H;  2FFK B;  5ELN A;  2B39 A;  1HH2 P;  1LTS D;  3FPP A;  1C4Q A;  1HFG A;  2F0H A;  1VQM A;  3C46 A;  1YJW A;  2OCE A;  2F03 A;  2AUK A;  2KED A;  5IP7 H;  5JJL A;  3PMF A;  3FVQ A;  4DAV A;  3GQB A;  1RIP A;  4GZY C;  4NKL A;  4JI0 L;  3GTG B;  2JA6 B;  2FIN B;  2MPM A;  1QVF A;  4IJH A;  4CJ2 C;  1JJC B;  1GHK A;  4NP5 A;  3S15 B;  3VA7 A;  5IYB G;  3LGJ A;  1KRS A;  3R2I A;  2V4D A;  1XMO Q;  1TWG H;  4XT3 B;  3NTK A;  4A3K G;  1NAP A;  4JOI C;  4X66 Q;  1B53 A;  5DM7 3;  3M3Y H;  2NN6 G;  1IL8 A;  3BU2 A;  3DWP A;  1FD7 D;  4JI2 L;  3BYT B;  1FNW A;  2XIW A;  1WTV A;  1M4V A;  1PHJ A;  1EYA A;  1D5Z C;  2UUA Q;  3D6C A;  4YCU A;  3OHX C;  1N8R C;  2HHH L;  1S5C D;  2JA5 G;  3FRP B;  1G51 A;  1NMF A;  2YU9 B;  1PTO B;  4A3J H;  1B3A A;  3I72 A;  4JVZ A;  5E4W C;  3Q23 A;  4BS9 A;  2DY8 A;  3V05 A;  1EY7 A;  1PTO D;  2RKS A;  1ZKO A;  1S5F D;  4RG1 A;  1K28 A;  5J39 A;  3PIP 3;  3S1M B;  1YHQ A;  4BA1 I;  1NJI C;  3GTG H;  4B9W A;  2JA6 H;  1JOK A;  1NBW A;  3S15 H;  2HIX A;  1B9N A;  1FJG Q;  4RGM A;  4ZRZ A;  3U9S A;  3F2U A;  3E3X A;  1TVX A;  1HTP A;  4QL5 A;  5FO7 B;  3WDN A;  4DV3 L;  2AWN A;  4DR5 L;  3S14 B;  4DKA C;  3L9A X;  1YNJ C;  1S5B D;  2RSO A;  2XRQ D;  4FNF A;  1Y1W B;  3R2T A;  1PV4 A;  3DM3 A;  2Q8T A;  1Z47 A;  1EU4 A;  4ZAI A;  5IGF A;  3T1H L;  1WCM G;  3W2D A;  3GV3 A;  1ILP A;  2B2T C;  1MGS A;  4NW2 A;  4A3I G;  4PG3 A;  3PUV A;  3L2P A;  4AIM A;  4IOA A;  5CV6 A;  1HZB A;  2C9O A;  5I4D A;  2YU9 H;  1PTO H;  1SE3 A;  1I4H A;  2LFN A;  4JI7 Q;  4DV6 Q;  2F0Q A;  4R4C A;  5A35 A;  3FDT A;  3KYH C;  2F3I A;  1AP0 A;  4LFA Q;  2XSC A;  4XTC S;  1H9J A;  2CH4 W;  1HPC A;  1ROD A;  4A4I A;  1JIC A;  4DR2 Q;  3S1M H;  2JA8 G;  1SR3 A;  2F0G A;  3Q22 A;  2F0I A;  2B63 B;  3O13 A;  2ID0 A;  1BBX C;  2LSS A;  1KNE A;  1CTM A;  3R8B A;  4C1N I;  4GKJ L;  3CW2 C;  3D4W A;  3EFX D;  3NWS A;  4GN5 A;  2N3S A;  5M3M B;  3S14 H;  1XNQ L;  4K14 A;  3CKI B;  1Y1W H;  5M3F B;  1STN A;  4MIU A;  2LKV A;  4H7B A;  3KK7 A;  3GTL B;  2AMC B;  2PI2 A;  5BR8 L;  1VDZ A;  2F3W A;  3EN2 A;  1J8I A;  4Q5V A;  4KK7 A;  1JOO A;  2R7D A;  4J1M A;  3J7A 5;  4YCW A;  5JVG 3;  1N33 L;  4JBK A;  1PTO C;  1VQJ A;  5EAY A;  1Z6H A;  1D7Q A;  1OXU A;  2ALY B;  3I73 A;  1E2V A;  3C1E A;  1U0L A;  1D2B A;  2I5H A;  2QDB A;  2NVQ B;  4DF7 A;  5D14 A;  3GTP B;  4KKS A;  3Q24 A;  4LNQ A;  5FO9 B;  4DU9 A;  4KHP Q;  2B63 H;  2AUJ D;  3CAM A;  1UE5 A;  2B2W A;  4ZQ3 A;  3TP6 A;  1VQ7 A;  2Q2U A;  1EQT A;  2N8N A;  4A3F B;  1HUN A;  4H0L C;  5M3M H;  1NUC A;  1AE2 A;  1N34 Q;  5M3F H;  4A3K B;  3UE1 A;  4LF9 L;  2VNU D;  3MEH A;  5GAD C;  4RMF A;  5C3X A;  3GTL H;  1NTG A;  3A56 A;  1SYF A;  3K80 C;  2OQK A;  1L1O C;  1GUN A;  3K7U C;  2EYM A;  4OO1 H;  1U9R A;  4AYB E;  3K5N A;  4K0K Q;  3J7Z C;  2RVL A;  3ND8 A;  1HNW L;  2JA5 B;  4J15 A;  1X3E A;  1ASY A;  3TQY A;  2F52 A;  1W2B A;  2NVQ H;  1JOQ A;  2F0U A;  3ZYY X;  3RN5 A;  1QZG A;  3GTP H;  2HQE A;  1GHJ A;  1HZA A;  1C0A A;  3F8T A;  4R9W A;  1SAP A;  3TRZ A;  3S17 B;  4JBJ A;  5BN4 A;  1BBW A;  1ASZ A;  3F2D A;  5KGU A;  1VMC A;  1PMR A;  4LF8 Q;  2L5T A;  5IYB H;  4A3F H;  3ERS X;  1EY0 A;  4L6T B;  2WII B;  4XQJ A;  4R8I A;  1HNX Q;  2IJ0 A;  4A3K H;  1SRU A;  4B3T L;  3U9O A;  5IWA Q;  4P75 A;  3CCE A;  1E2W A;  1CFM A;  2NN6 H;  3OMC A;  2X69 A;  1SNP A;  2VB3 X;  1JOR A;  2F4I A;  3OTO Q;  1A3V A;  1QJO A;  3NBH A;  1WCM B;  4WJ3 M;  3T1Y Q;  4A3I B;  4QIW E;  2TSS A;  4XYO A;  2QEX A;  2JA5 H;  3OPO A;  4IN3 A;  1HA5 A;  1ZEQ X;  2ES2 A;  3CCM A;  2UU9 L;  1C7Y A;  1BQQ T;  1WVL A;  4OWW B;  4XQQ A;  5E7N A;  1FNU A;  3Q6S A;  1K3B C;  3NBH B;  4MHE A;  1V43 A;  3RLO A;  4G57 A;  1I3Q B;  2JA8 B;  3S17 H;  2N78 A;  3J7Y W;  1G91 A;  3CRK C;  1GJX A;  1NR2 A;  4KY6 A;  4LF6 Q;  1GM5 A;  2GN5 A;  2EYL A;  1V1O A;  3ERO A;  4UP8 A;  2AWO A;  1DOM A;  2NTS A;  1L0X B;  4DK1 A;  1OO9 B;  1PRT D;  1WCM H;  1XMO L;  2MO0 A;  5K5P A;  4IUQ A;  1UEB A;  4A3I H;  5IIF A;  3D6W A;  3KBG A;  2D5D A;  2B2W C;  4X3U A;  2ZTC A;  3KOJ A;  2WB1 E;  4EVO A;  4GKK L;  2CHB D;  1J9O A;  4LUO A;  1YNN D;  2F0P A;  3P20 A;  4GLA C;  4A3L G;  1XNR Q;  2B3G A;  3HOZ G;  2UUA L;  4K6L A;  1EOT A;  1E22 A;  2PPB C;  2DGY A;  4FYD A;  4JI1 L;  3D4D A;  1I3Q H;  2JA8 H;  1HZ9 A;  3KLS X;  1IBL Q;  1WTP A;  3NK9 A;  5IT9 E;  1K0R A;  1G6P A;  4B3S L;  2UUB L;  4JI4 L;  2OT2 A;  1BUV T;  2O2L D;  2EY5 A;  1M8A A;  1EFW A;  4JV5 Q;  1I6H B;  1EY6 A;  4N8F A;  3HS0 C;  2EJM A;  5IT9 L;  1EIG A;  1VS0 A;  2IX3 A;  3KJO A;  1RDP D;  1AW7 A;  2BDO A;  3U50 C;  3I55 A;  3IKJ A;  5FO8 B;  5IT9 c;  2BA1 A;  3JC6 6;  2E5L L;  5C44 G;  1VQ8 A;  4LAA A;  3ND9 A;  1FVI A;  4C3I G;  1CQF A;  2E75 C;  3BG3 A;  4C56 C;  3J80 c;  1PH5 A;  3QWN A;  3HOY G;  1TS4 A;  3MWY W;  1ENC A;  1QOH A;  2A6E D;  4JI3 Q;  1LV9 A;  4FF1 A;  3L0O A;  3WWV A;  3NUC A;  5ELO A;  1WTQ A;  1V1P A;  3VYT A;  2FXQ A;  4ODG A;  4K8I A;  3NEN A;  3S2H B;  4P74 A;  1BCP B;  4DR5 Q;  2L15 A;  4LFA L;  2N49 A;  1PRT F;  4ID6 A;  1PH4 A;  1F2Y A;  1KRT A;  1SYG A;  4RKL A;  4CHT B;  1ENA A;  1BCP D;  3T1H Q;  4LWC A;  5AJ3 Q;  1I6H H;  2Q2H A;  4IOC A;  1TKW B;  1SSO A;  1AE3 A;  1HZC A;  4HN7 A;  1V1P B;  2OEO A;  3QJY A;  1PRT C;  3DMU A;  2MNA A;  3HOX G;  4V0B A;  2NZ1 D;  1Q86 C;  5FLM G;  3KF8 A;  3ONA B;  4OON A;  4I7Z C;  2NB0 A;  4GS3 A;  4FF4 A;  4TKO B;  3CPF A;  4CKC A;  1B7Y B;  3NE5 B;  1EWI A;  1Q8I A;  1YIT A;  2F0F A;  2ICE C;  4X62 L;  2A69 D;  1TY0 A;  1LT4 D;  1TR5 A;  1KDC A;  2PMZ B;  3KF8 B;  5ELB A;  4IAL A;  4WJW A;  4OXP A;  2K75 A;  4CDC C;  4GKJ Q;  3S2H H;  2F0N A;  5CMD A;  2PCF B;  1LTT D;  1N9W A;  1E3P A;  4DR1 L;  5BN3 A;  2XGT A;  1XNQ Q;  1Q8K A;  1SDF A;  1PZK D;  1VQ9 A;  3I8Z A;  1SRO A;  4TQU S;  1SJH D;  2NZH A;  1N36 L;  3DXJ C;  4RHR A;  1JJG A;  5BR8 Q;  1UEA B;  1TU2 B;  3GTM B;  1RTO A;  4YCV A;  1ZXT A;  1G2T A;  4QGU A;  4A3M B;  1N33 Q;  4IPH A;  3I4N G;  1QG7 A;  1WTO A;  4G7Z C;  4ZUJ A;  2A6E C;  2PYK A;  2ENB A;  5COY A;  3HOU B;  2IX0 A;  3M9B A;  1EOV A;  2N55 A;  2CWP A;  2QCP X;  4GNX A;  3HOZ B;  5T1I A;  3M4O H;  5ISR A;  1DM0 B;  3PIO A;  2HIV A;  2UXD L;  2L11 A;  1S40 A;  2K5H A;  1HCZ A;  1K73 C;  3F1Z A;  1BCP C;  1X3F A;  4LF9 Q;  1YI2 A;  3KLS A;  2DUD A;  2I46 A;  2EJG C;  1I5F A;  3ULP A;  5T1G A;  4GNX B;  5IYD G;  3I3C A;  3OSO A;  1MKH A;  1G2S A;  1X54 A;  2IHF A;  3AB9 A;  3GTM H;  2EQS A;  4Z9C B;  1LTA D;  3NSW A;  1PH6 A;  4A3M H;  1H9S A;  1O7Z A;  3AYH B;  3K6O A;  3B6Y A;  4OWX B;  3TME A;  1GD7 A;  2DY7 A;  1PYB A;  2KOL A;  4A3D B;  1HNW Q;  3CP0 A;  1LO5 D;  3G71 A;  1HNX L;  1LAC A;  3PUZ A;  5EKI A;  3QIA A;  4CJ0 B;  4L8J A;  1CA5 A;  2A69 C;  5FLX E;  4C3I B;  1SLJ A;  1WTH A;  1I4P A;  2XN9 C;  3HOU H;  5JAV A;  3HOY B;  1DYQ A;  4OX9 Q;  3H09 A;  4AYB G;  4A3L H;  1O7I A;  4L5Q A;  3NQT A;  1VQO A;  1X3Q A;  2JA7 G;  5D3I B;  3HOZ H;  4HAE A;  1GUO A;  1Y1V G;  1B44 D;  5EPL A;  3BDC A;  5EKL A;  4BBS G;  2A19 A;  1BBU A;  4QQB X;  4HMI A;  3HRZ C;  2BDN A;  2MO1 A;  1N32 Q;  3FHW A;  2ZXP A;  1IYV A;  4RKB A;  3CCS A;  3EJI A;  4IQZ A;  1EQR A;  1PFS A;  4B3T Q;  3CRL C;  3A8K E;  3SK5 A;  2F0S A;  5KYL A;  1JCK B;  5IOC A;  1A2T A;  4IUR A;  3QOJ A;  1F2Z A;  5HGQ A;  5DM6 3;  5M3M G;  2K5N A;  3IL8 A;  5M3F G;  1Z9F A;  3MXN A;  3GP7 A;  1TXY A;  3HOX B;  4A3D H;  3OW7 A;  3RMH A;  2R7F A;  3A0J A;  1JR0 D;  5IYC G;  2HQL A;  4H44 C;  3D4R A;  3AFQ A;  4OGQ C;  1VQN A;  2H4O A;  4PQX A;  2UU9 Q;  2MHV A;  2FHT A;  1EYD A;  4JBW A;  4KLK A;  4C3I H;  3S1Q B;  3TRE A;  1S4Z A;  5KNC A;  1BF4 A;  2NVY B;  4KJN A;  3HOY H;  2M2L A;  1RD9 D;  1E1T A;  3MXN B;  3PGZ A;  2FJ2 A;  2JP1 A;  2KHI A;  1LTL A;  2GVB A;  2NWG A;  3K5L A;  1A6X A;  1Q82 C;  5IGB A;  1FL0 A;  1PFM A;  2KCM A;  3SK8 A;  4NMZ A;  1XNR L;  5JJK A;  3BZD B;  2Y0S E;  2DNE A;  2QW7 A;  1EQV A;  3KLR A;  4A3F G;  1FGB D;  3J80 i;  3K0Y A;  1E0B A;  2JE6 I;  2KCN A;  4EX5 A;  1IBL L;  3TN2 A;  3DLL A;  2ZJR A;  1YHB A;  5DLQ E;  2Q8I B;  5J1Z A;  3HOX H;  4GKK Q;  1XYI A;  4AQY L;  5FLM H;  2ASB A;  2A74 C;  4DK0 A;  4GOP C;  5GAG C;  4JV5 L;  3CCV A;  3M7N A;  3I4N B;  3W1B A;  4L5R C;  1SYE A;  3H3V I;  4OWT B;  3TZD A;  2E2I B;  2K5Q A;  3S1Q H;  4DNI A;  4HSP A;  2F4V L;  2A6H D;  3I56 A;  2JEA I;  2NVY H;  4JI1 Q;  1VQE A;  1LLR D;  5K36 G;  5HGT A;  4B9X A;  2WB1 G;  3J81 E;  3PSI A;  2E8G A;  1PH1 A;  4PV1 C;  4B3S Q;  2UUB Q;  4JI4 Q;  1O7L A;  2SNS A;  1NCV A;  3A8I E;  4NB3 A;  1IKL A;  4DV2 L;  1BOS A;  1W6K A;  4JI3 L;  4WOR A;  1WD0 A;  4DAM A;  3J81 L;  2CCZ A;  1KQS A;  2Z6B A;  1Z7T A;  2YYZ A;  4QUC A;  3FPU B;  3X3N A;  3J81 c;  1X55 A;  1Y8N B;  4NXM L;  1XWE A;  3QG1 A;  2DJG C;  2E5L Q;  3NWT A;  3TSS A;  2VQF L;  1CI3 M;  1STB A;  4U68 A;  3H0G G;  3NXW A;  2F0K A;  3MZ5 A;  3PCO B;  4RHS A;  4ZKC B;  4IFD I;  5E4X A;  1QVC A;  2WFW A;  3I4N H;  4QB4 A;  5AJ3 L;  3K59 A;  2E2I H;  3CF5 A;  3VYR A;  4HIM A;  1JWM D;  3OWF A;  5NUC A;  5CBA E;  3VR2 A;  1PFN A;  4WRD A;  2K28 A;  1WTW A;  4IPG A;  1DD2 A;  3RLN A;  1JE4 A;  2ZXO A;  5HUR A;  1A15 A;  2NZO A;  3M4Q A;  4FF2 A;  4AYB B;  1UUP A;  3H15 A;  4CDF C;  2JA7 B;  1Y1V B;  3Q8D A;  5EBC A;  4BBS B;  1STG A;  4DPG A;  3BS1 A;  1CSP A;  4X65 L;  1HQR D;  2D9U A;  1H9R A;  3BVG A;  3A55 A;  1HNZ L;  2XRS D;  3C3L A;  1ET9 A;  4ILW A;  2WAQ E;  1MSH A;  3HEJ A;  4N9P A;  4IPD A;  2JYO A;  5IYD H;  2I0Q A;  3AMU A;  2E76 C;  2CFM A;  3MXG A;  3PQI A;  2EPB A;  5J22 A;  2MGS A;  1VQC A;  1GXD C;  1ESF A;  1PTO F;  1CHQ D;  4X62 Q;  3ICE A;  3KFU A;  3RD4 A;  2IPK D;  2KA7 A;  4N8X 1;  1II3 A;  2A6H C;  1W3S A;  4QY7 A;  2N88 A;  2SEB D;  2VXW A;  4L5T A;  2B2U A;  3KBX A;  1RTN A;  1IZ6 A;  3MEF A;  4TSS A;  2K14 A;  2JA7 H;  4DR1 Q;  1X65 A;  4QIW B;  1Y1V H;  2KCT A;  2CW0 D;  3LNN A;  1LTR D;  4BBS H;  1TWC B;  1EZ8 A;  2O5I C;  1N36 Q;  1IL2 A;  5JPM C;  2IT1 A;  1LAB A;  2F0M A;  1XX8 A;  3D31 A;  3STB D;  1A0I A;  1ML0 D;  2B8F A;  2ZTD A;  2F0W A;  1U4R A;  1YJ9 A;  1GOZ A;  4DGZ A;  2Z9H A;  5E3F A;  4ZCK A;  5G3L D;  4F88 A;  2E2H B;  1U5K A;  1QIL A;  3K7A B;  3TP7 A;  4K6D A;  2JQO A;  3GV6 A;  5IYC H;  5LMN L;  1G29 1;  5I6W A;  3H6M A;  1UWV A;  3T53 B;  2F0D A;  1BO0 A;  3PUY A;  4PMW A;  2UXD Q;  2OQ0 A;  1CKN A;  2K50 A;  3TS2 A;  5EPJ A;  4EQO A;  4QUF A;  1LTB D;  2KEC A;  3FEW X;  3U58 A;  1GUW A;  2PW5 A;  2WB1 B;  3T13 A;  4FXD A;  2Q2T A;  1PFB A;  1VF7 A;  3FMC A;  1TWC H;  1ESR A;  3U4Z A;  1F9S A;  1F77 A;  1YNX A;  4OX9 L;  3I70 A;  2JK8 A;  3OOC A;  4LF7 Q;  3GTO B;  1CKN B;  1MJE A;  3U4V A;  1R4P B;  1K8O A;  4BWG B;  1UNS A;  4A3G G;  5KNB A;  1N32 L;  3HKS A;  2H5X A;  3AQQ A;  1JT8 A;  5LMU L;  1AZQ A;  2UXC L;  3MTS A;  2E2H H;  3K0X A;  4FDB A;  3UI2 A;  3BZC A;  3H0G B;  2AQ2 B;  2K01 A;  3K7A H;  2F0T A;  1IYJ B;  1X9N A;  2A68 D;  4DR4 L;  1JMC A;  3NPP A;  5FJ8 G;  1HQM C;  3CME A;  1B3Q A;  4LW1 A;  5KND A;  2VUM G;  1EY8 A;  3S1N B;  1MJC A;  2LXK A;  2K04 A;  4KKT A;  4PMB A;  2CW0 C;  1X32 A;  4DUZ L;  5K36 H;  4XDX A;  4ZLT F;  4DNR B;  5LMN W;  3D0F A;  3STB C;  2EDG A;  1UE7 A;  2AQ1 B;  3I4O A;  1D5M C;  3K8A A;  3GDE A;  4G4K A;  2DJF C;  5G3L F;  1NSN S;  3SVM A;  3GTO H;  1LYL A;  1YVC A;  4CBV A;  2C5C A;  3CD6 A;  5ELD A;  1V8Q A;  4JPB W;  4RGO S;  1OXV A;  5LHY 1;  4A3B G;  1SBB B;  4K8J A;  4X64 Q;  1J5E Q;  1OXS C;  1PZI D;  1CHP D;  1TWA B;  4H02 A;  3H0G H;  4YWM A;  4A3M G;  1TWH B;  3UDI A;  2SNM A;  1OXT A;  3QOL A;  4GLV B;  3I91 A;  4LFB L;  3W3A A;  2RCN A;  3GTQ B;  1I4R A;  3IFD A;  1V1Q A;  2R92 G;  3S1N H;  4ZYS A;  3R3O A;  4DR6 Q;  4MN3 A;  5KRU A;  5CV4 A;  2Z6K A;  3HOU G;  5EQ0 A;  1B9M A;  1VQP A;  3J81 i;  4J8Q A;  1IBM L;  2HDM A;  2VQE L;  2YTV A;  3H3V H;  3K57 A;  2K5W A;  3M4Y A;  5CV9 A;  3M7G A;  1SN8 A;  4LF5 Q;  1SNQ A;  1K8G A;  2WKC A;  3PF4 A;  3G6E A;  3H91 A;  1HJP A;  3RZD B;  2RA4 A;  3DHQ A;  1AN8 A;  1YHA A;  4AQY Q;  4G7H C;  4JYA L;  5I6Y A;  5GAH C;  3A54 A;  1RF2 D;  5ELF A;  5M9O A;  1PA6 A;  3V96 A;  2BH2 A;  2L0C A;  3J80 E;  2Y0S G;  1TWA H;  2A68 C;  2LS0 1;  2PZW A;  4JBM A;  2F0E A;  1TWH H;  4LFC Q;  2F4V Q;  4A3D G;  4XYQ A;  1JE5 A;  3E0E A;  2K52 A;  3BVZ A;  3GTQ H;  1QB5 D;  4HJ9 A;  2QEJ C;  3J80 L;  4IUN A;  1KLU D;  2PZU A;  5M5X B;  3S16 B;  1WJJ A;  1OTC A;  1X3P A;  4Y7N B;  5GAE C;  4DV2 Q;  1HTL D;  2YV5 A;  3CC2 A;  1TQO A;  1B1Z A;  1ILQ A;  2NVT B;  4OEL B;  4FXG C;  1QZH A;  4Y52 H;  4NXM Q;  3PIP A;  4JI5 Q;  3RZD H;  2VQF Q;  3BZK A;  3VYU A;  2B2V A;  4A3G B;  1O7Y A;  3ERQ A;  1L0W A;  4POG A;  2CKZ B;  3KUP A;  3PUW A;  4DAY A;  1P16 A;  3SEB A;  1I4Q A;  5M5Y B;  2KEE A;  2XWJ B;  4DNT B;  4ABN A;  2AKW B;  4R4I A;  4DV5 L;  4KY5 A;  2UXB Q;  4G7O C;  1IXR A;  4MNO A;  3S2D B;  3UDF A;  3NTH A;  4KTA A;  1SNC A;  2PNR C;  3H94 A;  1XPO A;  2KJX A;  4IUP A;  1I6V C;  5D65 A;  2VUM B;  2G5D A;  4B08 A;  4JI6 L;  4DAY B;  1F9Q A;  4B3R Q;  5M5X H;  3S16 H;  3EBE A;  1GKH A;  2E74 C;  4X65 Q;  3MC0 B;  4Y7N H;  2IHE A;  4NPS A;  3TZU A;  1HNZ Q;  2NVT H;  3M4O B;  3PF5 A;  2C35 B;  2IL8 A;  4QJF A;  3L7Z C;  4DV4 Q;  2JSO A;  2K03 A;  1SE8 A;  1TT2 A;  4N9T A;  4DR3 L;  3EA6 A;  4A3G H;  4A3E G;  1EEF D;  4A3B B;  3DWA A;  3VR4 A;  5M5Y H;  3CC4 A;  3CMA A;  2WAQ G;  3OMG A;  5C3E G;  1YEZ A;  1XPU A;  4RAU C;  1XMQ Q;  3S2D H;  2MUY A;  1KC8 C;  4NXN Q;  2VY3 A;  4YHH L;  3CCR A;  5FJ8 H;  3VDY A;  2RF4 A;  4FVM A;  2VUM H;  4RCO A;  2JJQ A;  3G6J B;  2R92 B;  2WKD A;  3LWE A;  1D8L A;  2UUC L;  5C0X I;  3VA5 A;  2MP1 A;  4WFN 3;  5J3B A;  1SYB A;  2I07 B;  1PH3 A;  1WOC A;  1KNA A;  1BCP F;  2SOB A;  2KBN A;  2ZM6 L;  4E6I A;  3J7A V;  4X3T A;  5JEA J;  3W5O A;  2R7Z G;  3KF6 A;  1VQL A;  2CH4 A;  3KLW A;  1H9K A;  2QKI C;  5C4J B;  1L2F A;  1YZ6 A;  2I5M X;  5I9O A;  1XJV A;  3VR6 A;  2B2Y A;  1Q12 A;  4A3B H;  4DXF A;  4DXG A;  4S3S A;  5LMN Q;  4KV6 A;  1K8M A;  4LF7 L;  1VMP A;  1NR4 A;  1KL9 A;  2Y0S B;  1BVS A;  3P1H A;  2RDG A;  3KF6 B;  5JEA G;  4DV7 L;  1SFO B;  4BY7 G;  1WTX A;  2O4X A;  2VW9 A;  1TS5 A;  3RNU A;  1EEI D;  5I9P A;  2EVB A;  1IHZ A;  2FMC A;  2R92 H;  1SMY D;  4RCN A;  1RL2 A;  3CCQ A;  4P71 A;  5KYI A;  4A76 A;  4EGV A;  4OO1 I;  2K1B A;  1Q1E A;  3EVQ A;  4JW0 A;  4HCS A;  5A2Q E;  1QE6 A;  1HRJ A;  5IOD A;  4FXK C;  1PH9 A;  3MAQ A;  1DOK A;  2IW3 A;  3MXU A;  1FYC A;  4F87 A;  5C0X G;  1DZ1 A;  1A2U A;  3HOW G;  5A2Q L;  3A5Z B;  5LMU Q;  2UXC Q;  1KAW A;  1XXG A;  4XXE A;  5DAU A;  1FGU A;  5C4J H;  1M90 C;  4J6H A;  5H1S E;  3L3O C;  4P73 A;  4DR4 Q;  1Y14 B;  2J0T D;  3I2Z A;  1SND A;  2CVR A;  3NEM A;  1ONL A;  2VL6 A;  1HXY D;  1SFO H;  3BDL A;  2TMP A;  3VYS A;  1GUS A;  3EIV A;  3SXH A;  5IY0 A;  1SEB D;  4DUZ Q;  2NN6 I;  4X64 L;  2IY5 B;  1J5E L;  1IW7 C;  1VQB A;  4RWS C;  4WJ4 A;  1I4G A;  2VZA A;  2I5L X;  3BYY B;  1VQ6 A;  5CBE E;  5D3D A;  1S5D D;  2ZJP A;  4LUZ A;  1JQY D;  2D0O A;  1I94 L;  3G48 A;  3SK4 A;  5M5W B;  1VQI A;  2JA9 A;  3Q0A A;  5JJI A;  4DR6 L;  4RGN A;  3PUX A;  1A62 A;  3PO2 G;  4JC0 A;  1SYD A;  4JI8 Q;  5IP9 G;  1JC7 A;  3HKZ E;  4LJZ C;  3HOV G;  5C6A A;  2QIL A;  2X6L A;  4X6A H;  2R6G A;  4HMJ A;  4LF5 L;  4LFB Q;  2OF1 A;  4A3E B;  1SE4 A;  2KHS A;  3NEL A;  4GNX C;  2X6G A;  1PYW D;  2J7Z A;  2R93 B;  2MJ8 A;  2B8G A;  3RUZ A;  2WAQ B;  3FKI G;  5C3E B;  5DNF A;  1NY4 A;  4LUV A;  4UP9 A;  2Q2I A;  5TSS A;  1SMY C;  4OL7 A;  4RFB A;  1AH9 A;  1EFI D;  5FOB B;  1IBM Q;  3MHB A;  2VQE Q;  1LTI D;  2B2Y C;  2EE1 A;  3UDG A;  1EY4 A;  2BE5 D;  4LFC L;  5I2X A;  1Q3L A;  5CV8 A;  1Q7Y C;  2IX1 A;  3RR5 A;  5LL6 X;  4BBR G;  1EQQ A;  4A3C H;  1AFP A;  1U4L A;  3JAM E;  1LUZ A;  1PH8 A;  4OHJ A;  5M5W H;  3QR8 A;  1STY A;  3DUZ A;  2KUM A;  1QNU A;  4BY1 G;  1ICW A;  4DR7 L;  2IWH A;  4KD3 A;  3WOE A;  3ER0 A;  1DJR D;  1I4X A;  4C1N K;  3GTJ B;  4JYA Q;  1DON A;  2R7Z B;  4XT1 B;  4HID A;  4K2K A;  1NNX A;  1SYC A;  1CA6 A;  3MFY A;  1QVG A;  3JAM L;  4CKB A;  2MQH A;  4KY7 A;  1WFQ A;  2HT1 A;  4EQ5 A;  3RLF A;  3JAM c;  4A3E H;  2NBF A;  2R93 H;  4DV1 L;  4JI5 L;  2K7V A;  4YIJ A;  2L9H A;  4DK6 C;  5C3E H;  5CC4 A;  2K5D A;  1LT5 D;  3F2B A;  1LM0 A;  1C8C A;  2JN4 A;  1S3O A;  5EKK A;  1X6O A;  4CDD C;  3HZX A;  4BY7 B;  4PZ8 A;  4R4Q A;  1DCZ A;  2K6A A;  4OIJ A;  1O80 A;  1L1O A;  1IKM A;  3OW2 A;  2OWO A;  1V9P A;  3LX0 A;  2UXB L;  4LF4 L;  1R4Q B;  1HFN A;  1ENF A;  3URY A;  1PDQ A;  4IUU A;  2ZJQ A;  1A3U A;  2EOT A;  5BN5 A;  1IBK L;  4CGY B;  1X56 A;  1CKO A;  5C4H A;  1E24 A;  4V19 0;  3GTJ H;  1L1O B;  4B3R L;  1EWH A;  2R7Z H;  1YJN A;  2YTY A;  4IO9 A;  3HOW B;  2F0V A;  3J81 j;  2E2J B;  1EIH A;  2XNA C;  2F0J A;  4YY3 L;  3CU7 A;  1VQA A;  4DV5 Q;  4C3H G;  1IYU A;  3OIQ A;  2EYH A;  4B3M Q;  1STE A;  3I4M G;  3TEH B;  1DGS A;  3D3R A;  4DV4 L;  4UY8 C;  3T16 A;  1EIF A;  2EJF C;  4IFD J;  4QCL A;  1WYD A;  5CR3 A;  1K83 B;  1YIJ A;  4IZ8 A;  4ME3 A;  2EXD A;  1EZ6 A;  3S24 A;  5JEA H;  4JI6 Q;  1H9M A;  4FO2 A;  1Q46 A;  2J4X A;  3MFG A;  4BY7 H;  3G4S A;  1VCI A;  1QNK A;  3TP5 A;  4OEM B;  2BE5 C;  1YBY A;  1F2L A;  4DV0 L;  4DUY Q;  2JXM B;  4L5S A;  1XMQ L;  3ITP A;  4NXN L;  4IFD G;  1OXX K;  1D6E C;  2BH8 A;  4IPC A;  1F9R A;  1ZYR D;  1P8L A;  3RZO B;  2HCI A;  4C2M B;  4XQN A;  1BDO A;  4DR3 Q;  4RGT A;  3GO5 A;  3PO2 B;  5C0X H;  1KDB A;  1A3T A;  3NBI A;  2E2J H;  3HOW H;  1BXT A;  4HJA A;  4X3S A;  3HOV B;  3E6Z X;  4P72 A;  1A63 A;  3DEO A;  1EU3 A;  3VR5 A;  4YHH Q;  1HR0 Q;  3A7L A;  4KKU A;  4PMC A;  3PIO 3;  4GN4 B;  1K83 H;  5JPN C;  3FKI B;  1HUM A;  1MSG A;  2UUC Q;  2K33 A;  4R4O A;  3CQZ B;  3QO2 A;  3S1R B;  4DAP A;  3K81 C;  3SE0 A;  2OTL A;  3NHH A;  4K5W A;  4CKE A;  3NQI A;  2ZM6 Q;  2NUC A;  4MZ9 A;  1VQD A;  1H95 A;  1JB3 A;  1C48 A;  1U4P A;  3N6R A;  4DN4 M;  3V2T A;  3AEV A;  2KVM A;  1KHI A;  4GN3 B;  2EY1 A;  5CV5 A;  3ULL A;  4I65 A;  4BBR B;  1PZJ D;  1A8V A;  1KAA A;  2A5H A;  3RZO H;  4C2M H;  2EY6 A;  4TRD A;  4BY1 B;  1K3R A;  2A73 B;  2YTX A;  3PO2 H;  3CPW A;  1T5E A;  1SNO A;  2CWA A;  2Z1C A;  4KHV A;  2Z4I A;  1VQ4 A;  3TDQ A;  5IP9 H;  3HOV H;  4O1N A;  1VQK A;  1D5X C;  2G9H D;  3TS0 A;  4DV7 Q;  1XTD A;  4IJL A;  2MFI A;  4HR7 B;  3ULJ A;  1CT1 D;  4HSV A;  5EPK A;  3FKI H;  3UDX A;  5EGT A;  3T51 B;  4ZKB B;  4F8M A;  1Y8O B;  2EYF A;  5KEE A;  2WIN B;  1EY5 A;  3CQZ H;  4OIK A;  3S1R H;  2EIF A;  5LL6 S;  3IRB A;  2RHQ B;  1VQ5 A;  2L1B A;  4F7X A;  3T56 B;  2H1E A;  4FP5 D;  1U4M A;  4BXX G;  1T5X D;  3I90 A;  1GO3 E;  4EQN A;  1ZYR C;  4BBR H;  1TS2 A;  2VS1 A;  4CDE C;  2RQX A;  2HCC A;  3SDZ A;  2RHS B;  4BY1 H;  2LXJ A;  2L12 A;  1BNZ A;  3E9I A;  1R9T B;  5FK9 C;  1JWU D;  2EY2 A;  1LT3 D;  1LT6 D;  2B2U C;  2PI2 E;  4C3H B;  4O42 A;  4PZ7 A;  5FKA C;  4HED A;  4KN7 C;  2Z4H A;  1WTR A;  3LWU A;  1X3G A;  4JI8 L;  4KI0 A;  5JOB A;  3I4M B;  4HTH A;  1ICF B;  4UPA A;  1Q1B A;  1CQV A;  3CHB D;  2D0P A;  1MBY A;  4NDX A;  2Q8R E;  3ZJY C;  4R8N A;  1F2M A;  1JB7 A;  1I94 Q;  1B2T A;  3MA2 B;  1CKM A;  2F0L A;  3F2C A;  1Q81 C;  3CCJ A;  1B70 B;  4MTK A;  2QF7 A;  4O2D A;  4LMQ D;  2EZV A;  2ZTE A;  4M1U B;  3JAM i;  5C4Z A;  1CSQ A;  4TVA B;  3CCL A;  4KD4 A;  4APV A;  1QUQ A;  3TBI B;  1PRT B;  2M00 A;  1VQH A;  3A8J E;  1MD2 D;  1UE1 A;  1K8A C;  2A1A A;  1SNM A;  4RA8 A;  2DNC A;  5COR A;  1R9T H;  1PH7 A;  4UAI A;  1RCV D;  1BKB A;  2F0O A;  4A93 G;  3D8G A;  2OTJ A;  4JG2 A;  4X66 L;  3PO3 G;  1E2Z A;  3DM1 A;  4QF4 A;  4C3H H;  3KDF A;  5C3W A;  3A7A B;  5GRO A;  1QUQ B;  1TS3 A;  4XIG S;  2QGQ A;  5IGG A;  3I4M H;  2O5J C;  5C5L A;  3HKZ G;  4JI0 Q;  3M4P A;  1FR3 A;  2WP8 J;  1RKN A;  3NP8 A;  2K05 A;  2HDL A;  1NE3 A;  4ULL A;  1FNV A;  1D1K A;  1DXM A;  1TWF B;  1EWC A;  4PNY A;  4YWL A;  2VB2 X;  4HJ7 A;  1PYS B;  3K5M A;  3E9H A;  3WOF A;  1TY2 A;  3KDF B;  5E1F A;  2ICI A;  5JVH 3;  3I7F A;  4DR7 Q;  1PH2 A;  2KEN A;  1VQG A;  4JI2 Q;  2XTI A;  2E2D C;  3SR1 A;  4CJ1 B;  4IFD H;  2QA4 A;  2HHH Q;  1L0Y B;  1KTK A;  4C3J G;  1FJG L; 
#chains in the Genus database with same CATH homology
 3SGI A;  1ASY A;  3TQY A;  4HJ8 A;  2YYZ A;  2F52 A;  1W2B A;  3J81 c;  1KXL A;  2NVQ H;  1X55 A;  2R92 H;  4NXM L;  1RL2 A;  3CCQ A;  4DV1 Q;  3RN5 A;  4P71 A;  1QZG A;  2E5L Q;  3GTP H;  4A76 A;  2VQF L;  4OO1 I;  1HZA A;  1Q1E A;  1CUK A;  3F8T A;  1C0A A;  3H0G G;  2KHJ A;  3TRZ A;  3PCO B;  3HFZ B;  4JBJ A;  1BBW A;  1ASZ A;  1T9H A;  3F2D A;  4IFD I;  1QVC A;  5C4X G;  2WFW A;  3I4N H;  5AJ3 L;  3CCU A;  2ATW A;  4ALP A;  2E2I H;  4LF8 Q;  3CF5 A;  1PH9 A;  2PNH A;  5IYB H;  4DK3 C;  4HIM A;  4A3F H;  3ERS X;  2HT1 A;  1HNX Q;  5C0X G;  1TWF H;  4R1J A;  3HOW G;  2A8V A;  4IPG A;  3A5Z B;  5IP7 G;  5LMU Q;  4A3K H;  4LF4 Q;  1SRU A;  1GVP A;  1KAW A;  3M85 A;  4B3T L;  4JI7 L;  3RLN A;  4DV6 L;  2UXC Q;  5IWA Q;  4P75 A;  5C4J H;  1FGU A;  3A5U A;  3CCE A;  4DV3 Q;  4HIK A;  2NZO A;  1M90 C;  5H1S E;  3M4Q A;  4POF A;  3H15 A;  4P73 A;  4DR4 Q;  1Y14 B;  1IBK Q;  3OTO Q;  3Q8D A;  4WJ3 M;  4DR2 L;  3T1Y Q;  4DPG A;  2V1C C;  1CSP A;  4QIW E;  4X65 L;  3I2Z A;  4JCV E;  2QEX A;  3NEM A;  2JA5 H;  4A3C G;  1HNZ L;  2VL6 A;  1SFO H;  4YY3 Q;  3EIV A;  2WAQ E;  2ES2 A;  1J6Q A;  5IY0 A;  4DUZ Q;  4DUY L;  3CCM A;  2UU9 L;  3PV0 A;  2NN6 I;  1C7Y A;  4X64 L;  2PQA A;  4IPD A;  1J5E L;  2IY5 B;  1VQB A;  4OWW B;  5IYD H;  5E7N A;  2I0Q A;  4WJ4 A;  1KIX A;  2Z0S A;  3NBH B;  4KHZ A;  2VZA A;  2I5L X;  1V43 A;  2CFM A;  3RLO A;  1VQ6 A;  3S17 H;  2N78 A;  2ZJP A;  1VQC A;  4LUZ A;  2Z6K C;  2D0O A;  3A74 A;  3G48 A;  4A3J G;  1I94 L;  4X62 Q;  3ICE A;  1VQI A;  2JA9 A;  3KFU A;  2R93 G;  5JJI A;  4DR6 L;  3PUX A;  3CXC A;  1W3S A;  4QY7 A;  4LF6 Q;  1A62 A;  1MIU A;  3FP9 A;  2PQA B;  4JC0 A;  4DV0 Q;  3PO2 G;  1KQS A;  4JI8 Q;  1GM5 A;  1PVO A;  2GN5 A;  4L5T A;  5IP9 G;  3HKZ E;  3HOV G;  1IZ6 A;  3MEF A;  4UP8 A;  2AWO A;  2K14 A;  1HR0 L;  2JA6 G;  2JA7 H;  4DR1 Q;  1X65 A;  4X6A H;  2R6G A;  4LF5 L;  4LFB Q;  1Y1V H;  2KCT A;  1WCM H;  1XMO L;  2K4K A;  2MO0 A;  3NEL A;  1UEB A;  4GNX C;  1EYG A;  4A3I H;  4BA2 I;  4BBS H;  4BXX H;  1C9O A;  1N36 Q;  1IL2 A;  3FKI G;  2ZTC A;  2IT1 A;  3KOJ A;  2CQO A;  2WB1 E;  1NY4 A;  4GKK L;  4KHP L;  3D31 A;  3STB D;  4LUO A;  4LUV A;  1I50 H;  4UP9 A;  1A0I A;  2ZTD A;  3AFP A;  2Q2I A;  4YWK A;  1K9M C;  4GLA C;  4A3L G;  1XNR Q;  1AH9 A;  2B3G A;  1YJ9 A;  3HOZ G;  2UUA L;  1E22 A;  1IBM Q;  5GQO A;  2VQE Q;  2DGY A;  4HJ5 A;  3UDG A;  4LFC L;  1N34 L;  1E1O A;  1Q7Y C;  4JI1 L;  2IX1 A;  1I3Q H;  3RR5 A;  2JA8 H;  1HZ9 A;  2AHO B;  4BBR G;  1EQQ A;  1VQF A;  3GTK H;  4A3C H;  1IBL Q;  1U5K A;  1LUZ A;  1K0R A;  1PH8 A;  5M5W H;  2JQO A;  3W1G A;  1G6P A;  5IYC H;  4B3S L;  5LMN L;  1G29 1;  3CC7 A;  2UUB L;  4BY1 G;  4JI4 L;  4DR7 L;  1UWV A;  3BJU A;  3ER0 A;  4JYA Q;  1EFW A;  3PUY A;  4JV5 Q;  4K0K L;  4PMW A;  4HID A;  2D62 A;  4JOI A;  4PZ6 A;  2UXD Q;  1SMX A;  2OQ0 A;  1CKN A;  2K50 A;  3GD7 A;  1QVG A;  3TS2 A;  1VS0 A;  3KJO A;  2MQH A;  4GOP A;  3U50 C;  3I55 A;  1WFQ A;  3U58 A;  1NMG A;  4EQ5 A;  3RLF A;  3JAM c;  5C0X J;  5IT9 c;  2NVX H;  4A3E H;  2BA1 A;  2Q2T A;  2R93 H;  3JC6 6;  1TWC H;  1WI5 A;  4DV1 L;  2E5L L;  4JI5 L;  2JEB I;  3U4Z A;  5C44 G;  4DK6 C;  3UE0 A;  2B29 A;  5C3E H;  1VQ8 A;  1YNX A;  3F2B A;  1LM0 A;  1FVI A;  4OX9 L;  2JK8 A;  4LF7 Q;  3J80 c;  1PH5 A;  1CKN B;  1S3O A;  3U4V A;  1MJE A;  1Y1W G;  1X6O A;  3HOY G;  4PZ8 A;  2BA0 A;  4R4Q A;  4LF8 L;  4GOP B;  1HR0 W;  1L1O A;  4JI3 Q;  3RN2 A;  4A3G G;  3OW2 A;  2OWO A;  1N32 L;  1V9P A;  3HKS A;  4A93 H;  2H5X A;  3AQQ A;  3L0O A;  3WWV A;  2UXB L;  5LMU L;  1JT8 A;  4LF4 L;  4HIO A;  2UXC L;  5ELO A;  2PMZ E;  2FXQ A;  5IWA L;  3K0X A;  2E2H H;  3NEN A;  3PO3 H;  1EIY B;  4FDB A;  3BZC A;  4P74 A;  2ZJQ A;  2K5V A;  3K7A H;  1M1K C;  1IYJ B;  4DR5 Q;  1X9N A;  2L15 A;  4LFA L;  4DR4 L;  4O0A A;  2N49 A;  1IBK L;  1JMC A;  1X56 A;  3OTO L;  1CKO A;  1PH4 A;  1KRT A;  1E24 A;  5FJ8 G;  3CME A;  3GTJ H;  3T1Y L;  1L1O B;  4B3R L;  4LW1 A;  3T1H Q;  2R7Z H;  4LWC A;  5AJ3 Q;  2VUM G;  1I6H H;  4R4T A;  2Q2H A;  1YJN A;  1B8A A;  2YTY A;  1MJC A;  4IO9 A;  1AE3 A;  4IOC A;  2LXK A;  1HZC A;  3J81 j;  1XPR A;  4YY3 L;  1UE6 A;  1JJ2 A;  1VQA A;  2MNA A;  3HOX G;  5FLX c;  4DUZ L;  4DV5 Q;  1Q86 C;  5FLM G;  2B63 G;  3OYY A;  4OON A;  4B3M Q;  2GVA A;  5LMN W;  3I4M G;  3D0F A;  3TEH B;  1DGS A;  3STB C;  4DV4 L;  4UY8 C;  1UE7 A;  3I4O A;  1EIF A;  4GLX A;  4IFD J;  1WYD A;  4GS3 A;  3RNU A;  1YIJ A;  3K8A A;  3GDE A;  4UP7 A;  3CPF A;  4ME3 A;  3GTO H;  2EXD A;  1B7Y B;  3S24 A;  1EWI A;  4JI6 Q;  1LYL A;  1YVC A;  1Q46 A;  1YIT A;  1E7Z A;  3CD6 A;  4BY7 H;  3G4S A;  4X62 L;  1VCI A;  4C3J H;  4A75 A;  1KD1 C;  1OXV A;  4LF6 L;  3KF8 B;  1S72 A;  4A3B G;  1YBY A;  4DV0 L;  1EUJ A;  4OXP A;  5IE8 A;  4DUY Q;  2K75 A;  4X64 Q;  5C44 H;  4L5S A;  4OO1 G;  1J5E Q;  1XMQ L;  1OXS C;  4AH6 A;  4GKJ Q;  3S2H H;  4H02 A;  4NXN L;  3H0G H;  4MTN A;  5HY6 A;  3KJP A;  4YWM A;  1N9W A;  1E3P A;  4A3M G;  4IFD G;  3UDI A;  1OXX K;  4DR1 L;  2XGT A;  1XNQ Q;  1OXT A;  4GLV B;  4IPC A;  2BH8 A;  4LFB L;  5C4X H;  1P8L A;  1Q8K A;  2RCN A;  5ELN A;  1VQ9 A;  1HH2 P;  4DR3 Q;  1SRO A;  4TQU S;  2NZH A;  1N36 L;  3GO5 A;  1V1Q A;  1VQM A;  2R92 G;  3S1N H;  1JJG A;  5BR8 Q;  4DR6 Q;  1YJW A;  2OCE A;  2E2J H;  3HOW H;  5IP7 H;  5JJL A;  3HOU G;  2Z6K A;  4YCV A;  4HJA A;  1VQP A;  1RIP A;  4P72 A;  4QGU A;  3J81 i;  4JI0 L;  1A63 A;  1N33 Q;  1QVF A;  1IBM L;  4IJH A;  4IPH A;  2VQE L;  2YTV A;  1JJC B;  3H3V H;  3I4N G;  4YHH Q;  1HR0 Q;  5IYB G;  3LGJ A;  1KRS A;  1SN8 A;  4GN4 B;  4LF5 Q;  1K83 H;  1XMO Q;  1TWG H;  1K8G A;  3PF4 A;  3G6E A;  2UUC Q;  4A3K G;  1HJP A;  4JOI C;  4X66 Q;  2IX0 A;  3M9B A;  1EOV A;  4R4O A;  3M3Y H;  2NN6 G;  1YHA A;  4AQY Q;  3K81 C;  3BU2 A;  2CWP A;  4GNX A;  4JYA L;  2OTL A;  3M4O H;  5GAH C;  4JI2 L;  3PIO A;  2HIV A;  1PHJ A;  2ZM6 Q;  1PA6 A;  2UXD L;  4MZ9 A;  1S40 A;  2UUA Q;  2BH2 A;  1VQD A;  1H95 A;  4YCU A;  3AEV A;  2Y0S G;  1TWA H;  4JBM A;  1N8R C;  2HHH L;  1KHI A;  4GN3 B;  1TWH H;  2JA5 G;  4LFC Q;  2K5H A;  3ULL A;  1G51 A;  1NMF A;  2F4V Q;  4A3D G;  1K73 C;  4A3J H;  3F1Z A;  1A8V A;  3RZO H;  1JE5 A;  1X3F A;  2K52 A;  3E0E A;  4C2M H;  4LF9 Q;  3GTQ H;  4HJ9 A;  1YI2 A;  1K3R A;  2DUD A;  1I5F A;  3ULP A;  4GNX B;  2YTX A;  5IYD G;  3PO2 H;  3CPW A;  4RG1 A;  2CWA A;  1VQ4 A;  1MKH A;  1X54 A;  2IHF A;  3GTM H;  2EQS A;  5IP9 H;  1WJJ A;  3HOV H;  1OTC A;  1YHQ A;  1HNW Q;  4BA1 I;  1PH6 A;  4A3M H;  1VQK A;  3AYH B;  1NJI C;  3TS0 A;  3GTG H;  5GAE C;  4DV7 Q;  3B6Y A;  4OWX B;  1XTD A;  1GD7 A;  4IJL A;  1PYB A;  4DV2 Q;  2JA6 H;  1NBW A;  2MFI A;  2YV5 A;  3CP0 A;  3CC2 A;  3ULJ A;  3G71 A;  3S15 H;  1HNX L;  2HIX A;  1FJG Q;  3PUZ A;  3FKI H;  3UDX A;  1QZH A;  4QL5 A;  4Y52 H;  4NXM Q;  4DV3 L;  3PIP A;  4JI5 Q;  1SLJ A;  2AWN A;  4DR5 L;  2VQF Q;  4DKA C;  3RZD H;  3BZK A;  3HOU H;  3CQZ H;  4OX9 Q;  3S1R H;  2EIF A;  4AYB G;  4A3L H;  1O7I A;  4L5Q A;  1VQO A;  1PV4 A;  3IRB A;  4B3M L;  3DM3 A;  2JA7 G;  3HOZ H;  2RHQ B;  1VQ5 A;  1Z47 A;  3T1H L;  1Y1V G;  1L0W A;  1WCM G;  4POG A;  2CKZ B;  3PUW A;  1P16 A;  4BBS G;  2A19 A;  4A3I G;  4BXX G;  1BBU A;  4QQB X;  4PG3 A;  3PUV A;  3L2P A;  2AKW B;  4AIM A;  4IOA A;  1HZB A;  1GO3 E;  2MO1 A;  4R4I A;  1N32 Q;  3FHW A;  4DV5 L;  4BBR H;  2UXB Q;  3CCS A;  1IXR A;  4MNO A;  2YU9 H;  2VS1 A;  1EQR A;  1PFS A;  3UDF A;  4B3T Q;  4JI7 Q;  4DV6 Q;  4R4C A;  2RHS B;  4BY1 H;  2LXJ A;  2F3I A;  3KYH C;  4LFA Q;  1XPO A;  3E9I A;  4XTC S;  5HGQ A;  4A4I A;  4JI6 L;  4DAY B;  5M3M G;  4DR2 Q;  4B3R Q;  5M5X H;  3S16 H;  3EBE A;  1GKH A;  3S1M H;  2JA8 G;  1SR3 A;  2K5N A;  4X65 Q;  5M3F G;  4Y7N H;  1Z9F A;  2IHE A;  1TXY A;  4NPS A;  4A3D H;  2PI2 E;  1HNZ Q;  2ID0 A;  4PZ7 A;  2R7F A;  3A0J A;  2LSS A;  5IYC G;  1X3G A;  2HQL A;  2NVT H;  1VQN A;  3AFQ A;  4JI8 L;  3PF5 A;  4KI0 A;  2UU9 Q;  4UPA A;  1Q1B A;  2C35 B;  4GKJ L;  3CW2 C;  4JBW A;  4KLK A;  4QJF A;  3L7Z C;  4C3I H;  4DV4 Q;  4GN5 A;  2N3S A;  3S14 H;  3TRE A;  2D0P A;  1XNQ L;  3HOY H;  1SE8 A;  1Y1W H;  1E1T A;  3ZJY C;  3MXN B;  4DR3 L;  3PGZ A;  1JB7 A;  1I94 Q;  1CKM A;  4A3G H;  2KHI A;  4A3E G;  1LTL A;  2AMC B;  2GVB A;  3F2C A;  2PI2 A;  1Q81 C;  5M5Y H;  3EN2 A;  5BR8 L;  3CCJ A;  3CC4 A;  3CMA A;  1B70 B;  4O2D A;  2WAQ G;  1Q82 C;  5C3E G;  1YEZ A;  2ZTE A;  2R7D A;  3JAM i;  1FL0 A;  1CSQ A;  3J7A 5;  4TVA B;  2KCM A;  3CCL A;  1XPU A;  1XNR L;  4YCW A;  4APV A;  1QUQ A;  1XMQ Q;  1N33 L;  3S2D H;  5JJK A;  1KC8 C;  4JBK A;  1VQH A;  4NXN Q;  1VQJ A;  5EAY A;  2VY3 A;  2Y0S E;  1UE1 A;  4YHH L;  3CCR A;  1K8A C;  1OXU A;  2ALY B;  1D7Q A;  5FJ8 H;  2A1A A;  3VDY A;  2RF4 A;  1R9T H;  1PH7 A;  1U0L A;  4A3F G;  3J80 i;  2I5H A;  2VUM H;  2JE6 I;  1BKB A;  2JJQ A;  4A93 G;  1D8L A;  4EX5 A;  1IBL L;  2UUC L;  3DLL A;  5C0X I;  2OTJ A;  4LNQ A;  2ZJR A;  1YHB A;  4JG2 A;  4X66 L;  5DLQ E;  3PO3 G;  3HOX H;  4C3H H;  3KDF A;  5J3B A;  4GKK Q;  4AQY L;  5FLM H;  2B63 H;  2ASB A;  1PH3 A;  4KHP Q;  1WOC A;  5GRO A;  1QUQ B;  4XIG S;  2QGQ A;  4GOP C;  3CAM A;  2KBN A;  5GAG C;  4JV5 L;  3I4M H;  3CCV A;  1UE5 A;  2ZM6 L;  3W1B A;  4L5R C;  4JI0 Q;  3HKZ G;  3H3V I;  3M7N A;  3M4P A;  4OWT B;  2WP8 J;  5JEA J;  2N8N A;  1VQ7 A;  2Q2U A;  3W5O A;  2R7Z G;  3KF6 A;  1NE3 A;  3S1Q H;  4DNI A;  1VQL A;  5M3M H;  2F4V L;  1N34 Q;  1AE2 A;  3I56 A;  2JEA I;  2NVY H;  4JI1 Q;  3KLW A;  1VQE A;  4YWL A;  3UE1 A;  5M3F H;  4HJ7 A;  1PYS B;  4LF9 L;  3E9H A;  1L2F A;  1YZ6 A;  2I5M X;  2VNU D;  5K36 G;  1XJV A;  3KDF B;  5GAD C;  2WB1 G;  4RMF A;  1Q12 A;  3GTL H;  1NTG A;  4A3B H;  3K80 C;  3PSI A;  2OQK A;  2E8G A;  1PH1 A;  4B3S Q;  1L1O C;  3K7U C;  3I7F A;  5LMN Q;  2UUB Q;  4JI4 Q;  1PH2 A;  4DR7 Q;  2KEN A;  4LF7 L;  4AYB E;  4NB3 A;  1VQG A;  1KL9 A;  4JI2 Q;  2XTI A;  1BVS A;  4K0K Q;  3KF6 B;  5JEA G;  3J7Z C;  4DV2 L;  4DV7 L;  1HNW L;  4J15 A;  4JI3 L;  2QA4 A;  4BY7 G;  2HHH Q;  4DAM A;  2CCZ A;  1X3E A;  2VW9 A;  1FJG L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...