5M3FH

Yeast rna polymerase i elongation complex at 3.8a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
144
structure length
131
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase I subunit RPA190
publication title Structure of RNA polymerase I transcribing ribosomal DNA genes.
pubmed doi rcsb
total genus 21
structure length 131
sequence length 144
ec nomenclature
pdb deposition date 2016-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m3fH00
5FJ8H 1HZ9A 4YY3L 4DR5L 1X6OA 5GAEC 2OQKA 4LUZA 5C44G 3I56A 4DV0Q 1X54A 2Y0SE 4HJAA 3M3YH 3GTGH 4JOIA 3HOYG 4LWCA 2JEAI 1X65A 4BBRG 3BZKA 3ULJA 5LMNL 4DAYB 3KF6A 5IYCH 3GTJH 4GNXC 3GO5A 1GVPA 4A3BG 1LYLA 1XPOA 4LFCQ 2OCEA 3CXCA 1MKHA 2GVBA 1E24A 1KL9A 4UP9A 3J81i 1HNWQ 4GLVB 2JA5G 3AEVA 1XMOL 4BY7G 4NB3A 3GTMH 1IYJB 1SRUA 4A3JG 4LF5L 4BA1I 3FHWA 4PG3A 3OTOL 1QVFA 4DV5L 3KOJA 3HKZE 1V9PA 4X64Q 1N34L 2BH2A 1CKNB 3TQYA 1TWHH 4DV7L 3PV0A 2HIVA 3S1RH 2YYZA 1WOCA 1N32Q 4DUZQ 1XNQL 1EQRA 4DR3L 1QUQA 3ZJYC 2L15A 4DV4Q 3H3VI 4P72A 3PGZA 4A3LG 4NXML 2OTJA 1BBWA 4TQUS 4Y52H 2EIFA 4A3BH 2Q2TA 3I2ZA 4DK3C 2IHFA 4LF4Q 1CKMA 4NPSA 4IPGA 3TS0A 3K8AA 2R7FA 4IJHA 4P74A 3J80c 3NEMA 4DV1Q 2JA5H 2N8NA 2I5HA 4A3JH 1PH7A 2A8VA 3AFQA 3TRZA 3UDXA 1H95A 3PUVA 4J15A 4OX9Q 4P73A 1JMCA 5BR8L 1HNZQ 4JI7L 1D8LA 3PSIA 3NENA 1K3RA 2JA8G 4A4IA 1EIYB 4R4CA 4GLXA 4A3MG 2F4VL 3CQZH 3PUWA 3UE0A 4GKKQ 1S40A 1C9OA 4A93G 3K7UC 1PH5A 3HOWH 4DPGA 4B3SQ 4A3LH 1S72A 3GDEA 4JI5L 2F52A 4GN3B 2BA1A 1L1OB 4A3KG 4HJ9A 5IWAL 5C3EH 4MZ9A 2VQEQ 3J7ZC 4LF8L 4JI1Q 5AJ3Q 4DR6Q 1QVGA 4JV5L 1RL2A 1A8VA 4JG2A 4JI8L 4X65Q 1Q86C 2RHSB 2K75A 2Z6KC 3ER0A 3W1GA 4DR1L 2UUBQ 3S17H 4JI0L 4LNQA 2JA8H 2UXDQ 3F1ZA 4JBMA 1D7QA 3F2DA 3RNUA 4JI6Q 4A3MH 4YHHQ 2MQHA 3KLWA 1HNXL 5M5XH 4A93H 1FJGQ 2UXCQ 1CKNA 3M4PA 1NY4A 1O7IA 3CD6A 1I94Q 4KLKA 4R4OA 5ELOA 1VQMA 2RHQB 1IBML 1E7ZA 4A3IG 2R93H 3RR5A 1KAWA 2NN6I 4TVAB 3VDYA 4A3KH 1JT8A 3ULLA 4R4IA 4DV3Q 4JI2L 1OXXK 3CC2A 4K0KQ 3I55A 4PZ7A 5IY0A 4GOPC 1EUJA 3PO2G 4A3DG 1YJNA 1AE3A 4B3RL 4RG1A 2A19A 2N3SA 2ID0A 3T1HL 2JK8A 2VNUD 3OYYA 3H0GG 5C4JH 4X62Q 4AQYQ 2YV5A 4L5QA 1TWGH 4OO1I 1TWAH 2ALYB 1LTLA 2UUAQ 4LF6Q 1AH9A 3OW2A 1VQJA 4XTCS 5EAYA 4C3JH 3T1YQ 4A3IH 1C0AA 2Q2UA 4LF9L 4YWKA 4R4TA 1KIXA 3RLOA 5DLQE 1VQCA 3S24A 2NZOA 4JYAQ 3PUZA 4IOCA 1JJCB 1VQOA 3I4NG 4LFBQ 1SROA 2ZTCA 2KCTA 3EBEA 3HOXG 4AIMA 1Q12A 4P71A 2E2JH 4DUYQ 1L1OA 4GS3A 2CKZB 4RMFA 3G4SA 4IO9A 4A76A 2K50A 5IYDG 5JJIA 4DV0L 1N33L 1BBUA 2K5HA 3DM3A 4UPAA 1Z47A 3E9HA 3G48A 4X66Q 1YJ9A 4NXNQ 3RZDH 3H0GH 4GNXB 4QL5A 1VQAA 2E5LL 1XPUA 1EFWA 1Y1WG 2I5LX 2R7ZH 2Y0SG 1UEBA 5JEAG 1CSQA 4LFCL 4QGUA 1YJWA 1YVCA 1NBWA 2E2IH 1U0LA 4L5TA 4IFDG 1OXVA 4MNOA 1KRTA 2UU9Q 4DV6Q 1Y1VH 3I4NH 1PH3A 1SMXA 1A62A 4YCVA 2HT1A 1QVCA 4B3ML 3HOXH 2QA4A 3STBC 2IX1A 3JAMi 2PI2A 2LSSA 1LUZA 4R4QA 4JBWA 5LMNW 2LXJA 1SE8A 3LGJA 1VQ9A 4JI3Q 1UE1A 3ICEA 1IBLQ 2K52A 5JEAJ 4B3TQ 5IYDH 1PVOA 3PUYA 1MJCA 4JC0A 4DUZL 4DV2Q 1MIUA 1VCIA 3CCSA 2C35B 4HIDA 3M9BA 1KC8C 3GD7A 3GTOH 3HKZG 4YY3Q 4DR5Q 3E9IA 1P8LA 4LFAL 5JJKA 2JQOA 2MO0A 2NZHA 1IBKL 3J81j 1XNRL 5IP9H 5JJLA 1Y1WH 1J6QA 1PH6A 4AYBE 4KHZA 5C0XG 1PA6A 4PZ6A 4HIMA 2Q2IA 3S2HH 4LF7L 1G291 2XTIA 4MTNA 1C7YA 3HOZG 2AHOB 2PMZE 1B70B 3TREA 5LMNQ 1Q7YC 2UUCQ 3HOWG 2AWNA 1BKBA 1HH2P 1PYSB 3KDFB 5IT9c 1VQIA 1KHIA 5C4XG 5C3EG 2CQOA 2VW9A 3J7A5 1PH9A 4LW1A 5GQOA 1XMOQ 5C0XJ 1GD7A 1IXRA 2PQAB 3OTOQ 4LF5Q 3HOVG 4DV5Q 2A1AA 2B29A 3AFPA 1N36L 1WCMG 1N34Q 2R7DA 1V1QA 2CFMA 4P75A 1EQQA 1ASYA 2R92G 4DV7Q 4GKKL 3A5UA 4YWMA 1TWCH 1VQDA 2WB1E 1J5EL 2JE6I 3ULPA 3L0OA 4A75A 4R1JA 3HOZH 2WB1G 4QY7A 3TEHB 1VQGA 4POFA 1XNQQ 1SN8A 3PIOA 1T9HA 2VQFL 4GNXA 4DR3Q 2F3IA 4GKJL 3PCOB 1NJIC 4UP7A 4NXMQ 2KBNA 1YEZA 5IYBH 4BXXG 2R93G 1OXSC 4HJ8A 4BA2I 1Q1BA 1JJGA 5C4XH 4HIOA 3CCRA 5LMUQ 2ZTEA 2ZM6L 1HJPA 3CCJA 1YI2A 1VQKA 3HOVH 3U58A 2NVYH 4BXXH 1WCMH 1CUKA 4H02A 5BR8Q 3RN2A 2VL6A 4JI7Q 3I4MH 2EQSA 2R92H 1A63A 2KHJA 4PMWA 5IP7H 1JB7A 1VQ7A 1Y14B 2F4VQ 2K5VA 3CCEA 3KJPA 3SGIA 2WFWA 3FKIH 3S1MH 4GOPB 3H15A 3I4OA 3CCMA 1VQNA 1Q1EA 1EOVA 4AH6A 1WI5A 3GTPH 3UDIA 1U5KA 4C3IH 4C3HH 4JI5Q 1P16A 1VQEA 1X3GA 1TXYA 3ERSX 3CW2C 4YWLA 4ME3A 1SFOH 4DR7L 4IPCA 1HZCA 3F2BA 1CKOA 1PH1A 1X3EA 1KQSA 5IWAQ 2KHIA 2YTYA 4IPHA 5M3MH 4LF8Q 4KHPL 2B3GA 3KDFA 4DKAC 3K81C 5ELNA 4IPDA 2HHHL 3S1QH 3D0FA 4JV5Q 2I5MX 4JI8Q 3J81c 4L5RC 1L0WA 3RLNA 3Q8DA 2IHEA 3JAMc 4UY8C 4WJ3M 2JA9A 2OTLA 4DR1Q 1G6PA 4JOIC 2D62A 2PQAA 1OTCA 2JA6G 4DR4L 1UE5A 4DR2L 1SLJA 1B8AA 1VQ6A 1EWIA 1OXTA 3L7ZC 3J80i 1HNXQ 1HR0L 3FP9A 4DAMA 4KI0A 3CF5A 2R7ZG 1N9WA 2AWOA 1VQ4A 2E8GA 4L5SA 1K73C 4LUVA 2Z0SA 2QGQA 1Y1VG 1JE5A 4DUYL 1WJJA 1X56A 1W3SA 1DGSA 2K5NA 3CP0A 4JI2Q 1XMQL 5M5WH 3E0EA 3W1BA 3KFUA 1WYDA 1NE3A 3S16H 1PFSA 2CWAA 2Z6KA 4B3RQ 2MNAA 1QZHA 2PI2E 1LM0A 2VS1A 1L2FA 3BZCA 1W2BA 4LUOA 2UXBQ 2ATWA 1R9TH 2JA6H 3T1HQ 5IE8A 3CCVA 3EN2A 3JC66 1VQBA 2KCMA 2WP8J 4IJLA 3W5OA 3G71A 5IP9G 1I50H 4PZ8A 4C2MH 4QQBX 3NBHB 3CC7A 4DK6C 5FLMH 3CAMA 3AQQA 5M5YH 4A3EH 4OWTB 3UDGA 1HNWL 4LF9Q 4JCVE 1QZGA 1JJ2A 3CC4A 4O0AA 2AKWB 2JA7H 2NVQH 2RCNA 2D0PA 2VY3A 4GOPA 1RIPA 2D0OA 4EQ5A 3B6YA 4X64L 3L2PA 4DV2L 1PYBA 3H3VH 2YTVA 3KJOA 1ASZA 1N32L 1AE2A 1Q46A 1GKHA 5H1SE 2CCZA 1N33Q 2NVTH 2B63H 2WAQE 3CPFA 4HJ7A 1VQFA 2VUMH 1HZBA 3UDFA 4DV4L 1KD1C 2WAQG 3MEFA 2UUCL 2E5LQ 2JJQA 1Q8KA 1HZAA 2DGYA 4LF4L 1X9NA 2YTXA 3EIVA 3M7NA 2IY5B 3F8TA 4AYBG 4Y7NH 4JI4L 1YZ6A 4DV1L 3PF5A 4OWWB 2Q2HA 1X55A 5IYBG 1NMGA 4BBSH 3TS2A 4FDBA 5HY6A 4OX9L 4BY1G 5M3FH 3S2DH 4B3MQ 1PH4A 1HNZL 1VS0A 1E1TA 1CSPA 4EX5A 4DNIA 1K8AC 2YU9H 3M4QA 2BH8A 1YNXA 2CWPA 5C44H 2NN6G 3A74A 3HFZB 1MJEA 1X3FA 1B7YB 3HOYH 4OONA 3I4MG 1KXLA 4POGA 2AMCB 2NVXH 4BBRH 1VQPA 2EXDA 2V1CC 4LFAQ 4OWXB 4B3SL 5IP7G 1IBKQ 1XNRQ 1OXUA 1M90C 3MXNB 4A3CG 2VZAA 1FVIA 2BA0A 1GM5A 3FKIG 3U4ZA 4LF7Q 1NMFA 2VQEL 3U50C 5LMUL 4JI1L 4BY7H 3K0XA 5AJ3L 4O2DA 4DR6L 3I7FA 3F2CA 3PF4A 1NTGA 4X65L 4BY1H 3GTQH 4OO1G 3G6EA 1VQLA 2MFIA 1GO3E 2ZTDA 3STBD 2UUBL 3K80C 4YCUA 5M3MG 4HJ5A 2UXDL 4JBJA 4IFDI 2I0QA 3PIPA 4GN4B 2FXQA 1YHAA 4JI6L 2GN5A 4YHHL 5FLXc 3CMEA 2K14A 1EIFA 3AYHB 3BU2A 3CCQA 1YHQA 1N36Q 2UXCL 1FJGL 1E3PA 3BJUA 5J3BA 4HIKA 1I94L 5GAHC 3S1NH 1BVSA 1XTDA 3GTLH 4A3CH 1J5EQ 1K9MC 4A3FG 3CCLA 3NELA 1YHBA 4DV3L 2OQ0A 2VQFQ 1UWVA 4K0KL 4GKJQ 1WFQA 2ZJPA 2R6GA 4APVA 2XGTA 5C0XI 1K8GA 2N78A 1L1OC 2GVAA 3WWVA 2N49A 3IRBA 3DLLA 2ZJRA 1M1KC 2ZJQA 3A0JA 2ZM6Q 1UE6A 1KRSA 4X62L 1VQ5A 4AQYL 1PH8A 1UE7A 4QIWE 4QJFA 2H5XA 3KF6B 1N8RC 3S15H 1YIJA 2HQLA 3HKSA 3M4OH 1PV4A 3RLFA 4JI0Q 2UUAL 4LF6L 4IFDJ 3K7AH 1Z9FA 3D31A 3T1YL 2HIXA 3HOUG 2RF4A 1G51A 4A3FH 1XPRA 1IL2A 4UP8A 2PNHA 4X6AH 3CPWA 3RZOH 3PO3G 4JYAL 5FLMG 1I5FA 1PH2A 4LFBL 1PHJA 4A3EG 2K4KA 1IBMQ 3U4VA 1XJVA 2ASBA 3GTKH 1E1OA 4WJ4A 5E7NA 3A5ZB 2KENA 2MO1A 4XIGS 5GADC 3M85A 4DR7Q 5K36G 2JA7G 1SR3A 1HR0W 4X66L 4NXNL 3KF8B 2OWOA 4KHPQ 4A3GG 2UXBL 1YITA 2HHHQ 4GLAC 1QUQB 3CCUA 5FJ8G 3PUXA 4JI4Q 1YBYA 5GAGC 1S3OA 4ALPA 2E2HH 2B63G 3CMAA 5HGQA 3RN5A 1I6HH 5GROA 2VUMG 4OXPA 3HOUH 4DR4Q 1IZ6A 4DR2Q 2DUDA 4JBKA 1A0IA 2JEBI 1VQ8A 3KYHC 5IYCG 2UU9L 2IT1A 4DV6L 3S14H 1HR0Q 3PO3H 4IOAA 4GN5A 1E22A 2LXKA 1VQHA 1EYGA 3UE1A 4YCWA 1Q81C 1FGUA 1K0RA 3PO2H 4A3DH 1Q82C 4BBSG 4JI3L 1V43A 1K83H 1IBLL 2QEXA 2IX0A 1XMQQ 2ES2A 4B3TL 1I3QH 5M3FG 1FL0A 4A3GH 1TWFH
chains in the Genus database with same CATH superfamily
2A69C 2Z9HA 1BUVT 5GAEC 3M3YH 4DV0Q 1X54A 4ILWA 5CYUA 1E0BA 3BZKA 3I4MB 1KDBA 2XWBB 4GNXC 5J22A 2FMMA 1HUNA 4A3BG 1XPOA 2OCEA 1MKHA 1E24A 4X3UA 4UP9A 1CHPD 3J81i 1HNWQ 3GTMH 1IYJB 3FHWA 3OTOL 4C3HB 4KJOA 5DAUA 2BH2A 4TRDA 1STEA 3E6ZX 3TQYA 1N32Q 5J1ZA 2F0VA 1ENFA 3KF8A 3WOEA 4DV4Q 2IW3A 5HGTA 4A3BH 4LF4Q 2IHFA 1PYWD 2DY8A 2BCOA 4IPGA 3X3MA 3CC4A 1AW7A 1EY0A 2F0LA 2I5HA 1PH7A 2A73B 2IWHA 4HCEA 1KDAA 4P73A 5I9OA 5BR8L 3EA6A 1HNZQ 2ENBA 1EIGA 3TP5A 1TY2A 2KCCA 1JOOA 4R4CA 1HTLD 1K8MA 4PNYA 2K1BA 1PH5A 3HOWH 1SMYD 1ET9A 4GN3B 4C1NK 4QMGA 4FVMA 1X3PA 4R9WA 4HJ9A 1JWSD 3BS1A 3T16A 3J7ZC 1HQMC 4A3EB 4DR6Q 5KNBA 1A8VA 2K75A 2Z6KC 4C1NI 1GJXA 3NPPA 3W1GA 1G91A 2PCFB 4JI0L 2B2YC 1H9MA 1SYGA 1TWFB 4YHHQ 4H44C 4NW2A 3M4PA 1O7IA 4F7XA 4JK1C 2NVTB 2NBFA 1VQMA 1HA6A 2SNMA 2RHQB 3TP6A 1E7ZA 4C3JG 2IL8A 3RR5A 1IBML 1KAWA 3D4DA 4FP5D 3VDYA 1SNCA 2A6HC 4DAVA 3CC2A 2LKVA 1RTOA 5IY0A 3DMUA 3PO2G 4K2LA 1F9SA 2A19A 3TMEA 2N3SA 5M3FB 3H0GG 3T13A 1TWGH 3DHQA 2ALYB 5KYIA 1EU3A 1HPCA 4XTCS 4PMBA 4C3JH 3T1YQ 1F2MA 4YWKA 2NVXB 4R4TA 2I46A 1VQCA 4JYAQ 1VQOA 4LFBQ 5FO7B 1GUTA 1SROA 2KCTA 3EBEA 1W6JA 1VF7A 1E2WA 1Q12A 4P71A 3CU7A 4GS3A 1BF4A 4FF3A 3G4SA 4BY7B 3QR8A 5IYDG 4X66Q 3DM3A 5KGUA 1D5XC 3EJIA 1QWYA 3H0GH 4QL5A 1VQAA 1Y1WG 3TN2A 2Y0SG 1UEBA 4LFCL 1GHKA 1YVCA 3E3XA 1Y8PB 4MNOA 1KRTA 3S1NB 4OELB 1SMXA 1LTGD 1KNAA 1Y69U 2QA4A 3STBC 1KLUD 5DNFA 3ICEA 5IYDH 1WD0A 1EY7A 2F3VA 1M90C 4JC0A 4DUZL 1EEID 5JJKA 3PIO3 3E9IA 4G7ZC 1IBKL 4DA2A 1XXGA 1Y1WH 2F0JA 2EDGA 1G291 2XTIA 4MTNA 1C7YA 3HOZG 3TREA 2NZ1D 2AWNA 3X3NA 1R4QB 3KDFB 4FO2A 5T1IA 3PIP3 3SDZA 1VQIA 1CZGA 1PDQA 3MHBA 2QEJC 2RCFA 1EY5A 1KABA 2A6ED 5JOBA 4X3KA 2QDBA 3OTOQ 3J7AF 2A1AA 4S3SA 2EYJA 3RMHA 1V1QA 2CFMA 3BVMA 4P75A 2GA4B 2A69D 1EZ8A 3D3RA 1Q90A 1TWCH 1VQDA 4DXFA 1J5EL 4UDUC 1F2YA 5ISRA 3HOZH 1FYCA 1VQGA 4F87A 1EU4A 4GKJL 2A5HA 1TWAB 3PCOB 4UAIA 4C3HG 1LT5D 1RDPD 5C3WA 1ZYRC 1HJPA 3CCJA 5M9OA 4A3DB 2Z8LA 1BO0A 5BR8Q 3I4MH 4J1MA 4PMWA 1S5BD 2OXPA 1WTHA 3CCEA 1ESRA 3BG3A 3H15A 3I4OA 3SR1A 3CCMA 1Q1EA 1QOHA 4C3HH 4YWLA 1VQEA 3ERSX 1PFNA 4IPCA 2EJMA 5JPMC 1M4VA 1HCZA 1PH1A 1LTAD 1B3QA 2YTYA 4IPDA 3S1QH 3D0FA 2I5MX 1RJTA 4L5RC 2DJGC 1EWCA 3QG1A 3JAMc 4UY8C 3K57A 1WTPA 1BDOA 2L11A 2D62A 1SE2A 1MSGA 1TWHB 3S1RB 2QCPX 1HR0L 3L7ZC 1WD1A 5FO9B 4QCLA 4WJWA 1TU2B 5BN3A 2K7VA 4LUVA 1SYFA 1JE5A 1WJJA 1DGSA 1C48A 2HCCA 1WYDA 4EQPA 3D8GA 2PI2E 1W2BA 5IIFA 1LTRD 3EN2A 1VQBA 3FDTA 3G71A 1PFBA 1NAPA 1HQRD 3HP3A 4A3EH 3CQZB 2F0DA 1JOQA 2C9OA 4KKSA 2Q8IB 1QZGA 5C4HA 2A6HD 2F0IA 2RCNA 1SNOA 5KRUA 2VY3A 4EQ5A 2XRQD 4X64L 4I7AA 3L2PA 4DV2L 3BDCA 2KA7A 5EPLA 2DN8A 5C3EB 1D6EC 3DEOA 1TKWB 2NVTH 3CPFA 2L5TA 3MEFA 4H0LC 1Q8KA 2ZXRA 4IUQA 2DGYA 1SYDA 2YTXA 3EIVA 2F4IA 3M7NA 1U4MA 4JI4L 4DV1L 3PF5A 1NMGA 2EY2A 3TS2A 5HY6A 4BY1G 5M3FH 4CJ2C 4A3KB 1PH4A 1VS0A 5A35A 3BVGA 3M4QA 3FMCA 3A74A 5EJWA 1E2VA 3QB3A 4WORA 2HD3A 2M00A 3OPOA 2NVXH 1WTWA 1BCPC 1G2SA 3NWSA 4RCNA 1S5FD 1IBKQ 5CV8A 1OXUA 5I2YA 3MXNB 2PW5A 3FKIG 4CBVA 3U50C 4JVZA 4BY7H 4DN4M 4X65L 4BY1H 3SK4A 1AEXA 2BE5C 4RGMA 3PMFA 3STBD 4YCUA 3RD4A 2LS01 2FXQA 1YHAA 1PRTF 5A2QE 3CMEA 3E0JA 3BU2A 1YHQA 2UXCL 4DNRB 5IGFA 4JW0A 1FJGL 3HG9A 5J3BA 3T4AC 5GAHC 3S1NH 1XTDA 4FYDA 1J5EQ 1DXMA 2F0PA 4DAPA 1LV9A 2RA4A 2OQ0A 3Q0AA 1CTMA 3EFXD 4GKJQ 1EWHA 5K5PA 2R7ZB 1NR4A 2M9VA 5C0XI 2O5IC 3WWVA 3URYA 1Y1VB 3IRBA 1M1KC 1UE6A 3MAQA 1BNZA 5CR3A 4OEMB 4AQYL 3I70A 4QJFA 2H5XA 3KF6B 1YIJA 2HQLA 3HKSA 3RLFA 2UUAL 4LF6L 5BN4A 3EROA 3D31A 2D9UA 2RF4A 1XPRA 1ZKOA 4X6AH 3PO3G 1PH2A 2K4KA 3U4VA 3S2HB 4RGOS 2HQEA 3A5ZB 2KENA 4OGQC 5E7NA 2WV6D 5HURA 1HFNA 2PZWA 3OMCA 4IUUA 4IZ8A 3BYTB 4OL7A 1ZYRD 5G3LF 2UXBL 4ZCKA 1YITA 2Z1CA 5FJ8G 3OWEB 1S3OA 2E2HH 1SE3A 2B63G 3CMAA 3GP7A 2CVRA 1SYEA 2NTSA 3KUPA 3PO3H 1HR0Q 2CW0C 1LTID 3A55A 1ENCA 1EYGA 4YCWA 4A3DH 1YNNC 1Q82C 2ZXPA 4B9XA 4JI3L 1WVLA 1IBLL 4B3TL 2VXWA 4CDFC 3D4RA 3W5OA 5FJ8H 1HZ9A 4YY3L 4G7OC 1NSNS 1TS5A 3CRKC 2JEAI 1X65A 1G2TA 2BOSA 2NUCA 1LYLA 2K05A 2GVBA 5IGDA 2JA5G 1XMOL 2KEEA 4LAAA 4IUNA 3GTPB 4A3JG 4LF5L 4BA1I 1ILPA 3KOJA 1SFOB 1AN8A 4X64Q 3F2UA 1CKNB 1TWHH 2Z4IA 3S1RH 3PV0A 2HIVA 1BR9A 2YYZA 1WOCA 3TP7A 1EY6A 2DNCA 1M8AA 5JEAH 2G9DA 1TVXA 4DR3L 2L15A 3H3VI 4NXML 1BBWA 5D14A 4CJ1B 1A3VA 4N8X1 2Q2TA 3I2ZA 4DK3C 2FHTA 1CKMA 3CKIB 4NPSA 1EL0A 2JA5H 4IJHA 4JI4Q 4P74A 1PZKD 3NEMA 4DV1Q 2N8NA 5EKIA 4A3JH 4HMIA 1H95A 4KN4C 3UI2A 2K03A 4K6LA 2BDNA 3NENA 2B8FA 4RWSC 5M5WB 4A3MG 3CQZH 3JAML 3PUWA 3K7UC 4L63B 2KECA 4DPGA 4DFAA 1S72A 3IAYA 1R9TB 2JA6B 4CKCA 4M8AA 3P20A 1UNSA 4A3KG 5J39A 5C3EH 4MZ9A 3MFYA 2SOBA 1DYQA 2N55A 4JG2A 4X65Q 4HSVA 1Q86C 1Z6HA 2JYOA 1ESFA 2V4DA 2JA7B 4JBMA 4QB4A 4A3MH 1ONLA 1V1PB 2MQHA 2UXCQ 1FJGQ 1NY4A 1BCPD 1PTOB 4A3IG 1PRTD 2VUMB 2AUKA 4JPBW 4A3KH 3ULLA 4R4IA 2D2CC 4PZ7A 2EYPA 1EUJA 1T5XD 2AQ2B 4B3RL 2H1EA 2BE5D 4BBSB 2ID0A 3S2DB 3A54A 4O1NA 3IFDA 4AQYQ 2YV5A 5F2DA 2XWJB 5DM73 3SXHA 5CMDA 1LTLA 2UUAQ 2EYMA 2XNAC 5C44B 4LF6Q 3OW2A 1VQJA 4IALA 3HOYB 4A3IH 2HCIA 4BBRB 2BDOA 3P75A 3S24A 2ZTCA 1D5ZC 4DUYQ 2CKZB 2RKSA 3BDLA 1BBUA 4UPAA 1YJ9A 3E9HA 3G48A 1SAPA 2NTTA 5IODA 1CFMA 3TBIB 1A6XA 2E5LL 2TMPA 4DK1A 3J7YW 5JVG3 2R7ZH 5G3LD 2E2IH 1E2ZA 1B4OA 2PW7A 2K5QA 1Y1VH 1PH3A 3GTLB 4YCVA 2HT1A 4L6TB 4B3ML 4CJ0B 2EJGC 2IX1A 2LSSA 3D6CA 4JBWA 3J80L 1SE8A 4JI3Q 1UE1A 1IBLQ 4B3TQ 1PVOA 1MJCA 1KC8C 3GD7A 3HKZG 4YY3Q 4LFAL 2JQOA 3I72A 2MO0A 3S17B 5JJLA 4AYBE 4KHZA 5C0XG 1PA6A 2PPBC 4PZ6A 3S15B 2Q2IA 1JQYD 3J7A5 3S2HH 2UUCQ 4V190 3HOWG 2B2TA 3MXGA 3J80E 2CW0D 3FRPB 3NWTA 3OIPA 3W3AA 1YNND 1XMOQ 5C0XJ 4LF5Q 3HOVG 3FEWX 1WTXA 3GTKB 1TR5A 2B29A 3IKJA 1GUSA 2R7DA 3R3OA 2CQAA 1S5DD 4GKKL 2O2LD 2E2DC 4KHVA 4IUVA 3VA7A 4HEDA 5C0XH 3L0OA 4R1JA 4XYOA 1SN8A 3PIOA 1LACA 4DR3Q 2L4NA 3IL8A 4UP7A 4NXMQ 2KBNA 3GQBA 5IYBH 1I6HB 2H4OA 1JJGA 4G57A 3CCRA 3S14B 5LMUQ 2ZTEA 4H7BA 1YI2A 1VQKA 3HOVH 3I4LA 1C8CA 4H02A 2WIIB 2E2JB 1TY0A 3GTGB 1LLRD 1T5EA 3KBGA 2KHJA 1G8ZD 2KOLA 4OHJA 3VYTA 1JB3A 3KJPA 4GOPB 2Z4HA 3GTPH 4AH6A 3K6OA 1EOVA 1SJED 1WI5A 4Y52H 5FKAC 3CW2C 1SFOH 4DR7L 5I2XA 1I4GA 4NKLA 3F2BA 1X3EA 1KQSA 1VMCA 4IPHA 3J81E 3I4NB 2XSCA 3KDFA 5FK9C 2HHHL 2Q8RE 1QG7A 5C3XA 1X3QA 3DWAA 3RLNA 1H9JA 2IHEA 4WJ3M 1MGSA 4CHTB 3C1EA 3I3CA 1SE4A 1SYBA 2QW7A 2JA6G 4DR4L 1SLJA 1B53A 1OXTA 3FP9A 2ICEC 4KI0A 4DAMA 3CF5A 2AWOA 2E8GA 4L5SA 3VYUA 5EBCA 1SJHD 2QILA 1TS3A 3G6JB 1X56A 1SEBD 1STYA 4CKBA 5M5WH 1UEAB 4HSPA 1LT3D 1PFSA 3VR5A 4B3RQ 1V1OA 2MNAA 2VS1A 1HFGA 3QOJA 2ATWA 1R9TH 2JA6H 1DOKA 5EKKA 5IE8A 3DEPA 1UAPA 2WP8J 4IJLA 3C46A 4PZ8A 4DK6C 3H6MA 5E4WC 1QNUA 4O0AA 2AKWB 2EVBA 3A56A 2F03A 2D0PA 2D0OA 5I6YA 3H3VH 5C4XB 1ASZA 3SHLA 1PTOH 2VUMH 1WCMB 1HZBA 2PNRC 5D65A 1KD1C 3MA2B 2JA8B 2E5LQ 2Q8TA 4ZRZA 2IY5B 3A7LA 5M5XB 3MZ5A 5I6WA 4BBSH 1I4RA 2R93B 3DXJC 3S2DH 4B3MQ 1Z7TA 1B2TA 4DNIA 2IPKD 3ZYYX 1DM0B 4CDEC 5C44H 3HFZB 3HOYH 3I4MG 2AMCB 1Q3LA 4BBRH 1HHVA 2EXDA 2V1CC 4LFAQ 3WOFA 4A3CG 1EYCA 4KKTA 5C4JB 1NMFA 2VQEL 4JI1L 3K0XA 3MWYW 4O2DA 5AJ3L 3KK7A 1YNJC 3G6EA 3HRZC 2UUBL 1JR0D 4JBJA 4GN4B 3AYHB 1VDZA 1GUGA 2RBMA 1BVSA 3GTLH 4A3CH 1K9MC 1O7LA 1YHBA 1WTQA 1I50B 1WFQA 5LHY1 1W6KA 5CV4A 3NP8A 4APVA 2XGTA 2N78A 2GVAA 2NVQB 3DLLA 2ZJQA 3A0JA 3BZDB 3K5OA 1KRSA 3ND9A 1VQ5A 3S15H 1UE7A 3VYSA 1PV4A 4JI0Q 4KN7C 1QILA 2J7ZA 1NUCA 1G51A 1EFID 3C1FA 3GTOB 4UP8A 3CPWA 2PYKA 1I5FA 5EBDA 2N88A 5I9PA 4A3EG 1IBMQ 1XJVA 2ASBA 3GTKH 1E1OA 3MXNA 2LFNA 5K36G 4DR7Q 4CDCC 1HR0W 4NXNL 1SNPA 3L9AX 2HHHQ 1QUQB 4TSSA 3MFGA 2F0FA 4ALPA 2F0QA 2K32A 5HGQA 4XXEA 3RN5A 1I6HH 5GROA 2B2VA 1B50A 4QUFA 3R2TA 4DR4Q 2MUYA 4JBKA 1A0IA 1VQ8A 3TDQA 5IYCG 2UU9L 4DV6L 2B2TC 3S14H 1V8QA 4ME5A 4GN5A 3VR6A 4KY6A 3TZUA 1K0RA 3C3LA 3DUZA 5K36H 4AYBB 2F0WA 2EY1A 1LABA 2ES2A 3GTGH 4EGVA 5M3FG 1TWFH 1X6OA 4G4KA 4PQXA 5CORA 4C56C 2OQKA 3K5NA 4LUZA 2Y0SE 1XX8A 4K14A 4JOIA 3N6RA 1A3TA 4LWCA 2NVYB 5LMNL 2R92B 4DAYB 3KF6A 5IYCH 1L0XB 1L0YB 2EOTA 4LFCQ 3CXCA 1VMPA 4GLVB 3S1MB 4BY7G 4NB3A 1SRUA 1H9SB 1QVFA 4IURA 1N34L 1FNWA 3S9WA 3A7AB 4DV7L 2R61A 5M3MB 1F77A 4FXGC 4RHRA 4DUZQ 1S5CD 1XNQL 1EQRA 3ZJYC 5A2QL 1PRTC 3PGZA 4A3LG 4IFDH 2EIFA 2X6GA 5TSSA 4A3FB 2R7FA 1K28A 2B2WA 3J80c 1CQVA 3TRZA 4J6HA 1STGA 3PUVA 4IUPA 4J15A 4TKOB 1K3RA 5FLXE 2JA8G 1EQVA 1HTPA 5I4DA 4A4IA 2EYLA 1EIYB 2F4VL 1DOMA 5D3IB 3S16B 3UE0A 1TS2A 2HDMA 4A3LH 3GDEA 3OHXC 4JI5L 5KNDA 1Q8IA 2BA1A 1L1OB 4E6IA 3GV6A 1JE4A 1STHA 3HOUB 2L9HA 2G5DA 4C2MB 2QDLA 2VQEQ 4JI1Q 2FFKB 1I6VC 5AJ3Q 1II3A 4JV5L 1RL2A 1SYCA 2UUBQ 5JJZA 2JA8H 3F1ZA 3F2DA 1LO5D 2F1MA 2A68C 1STNA 5M5XH 1F9PA 1CKNA 3AU7A 3M3YB 3CD6A 3Q23A 4KLKA 4R4OA 2R93H 3NHHA 4TVAB 4ZLTF 2F0NA 1JT8A 2F0KA 5C5LA 1OXXK 1K3BC 3I55A 2RDHA 4A3DG 1EOTA 4RHSA 4Y7NB 1JWMD 1YNJD 2B39A 2CHBD 3HZXA 4ZQ3A 1AZPA 3AB9A 1JICA 3H09A 2JK8A 2VNUD 3OYYA 2XVSA 5C4JH 2NYZD 4L5QA 1JCKB 2I07B 4RAUC 3NTKA 1TWAH 1AH9A 2KUMA 5EAYA 2K5DA 2Q2UA 2D5DA 3RLOA 5DLQE 2NZOA 3PUZA 4HN7A 4I65A 5KNCA 4IOCA 1JJCB 3AMUA 5ELBA 4A3BB 4RMFA 4IO9A 4A76A 2K50A 4DV0L 3NTIA 1N33L 2K5HA 4F8MA 3KBXA 1Z47A 4NXNQ 3DWPA 4GNXB 2PO4A 1RCVD 3OIQA 1STAA 4B9WA 1XPUA 1EFWA 2E74C 1YJWA 2WKDA 5JEAG 1CSQA 1NBWA 4L5TA 1OXVA 1V1PA 2UU9Q 4DV6Q 5E4XA 1HRJA 1XWEA 2RSNA 4KJNA 5CV6A 3JAMi 2PI2A 5T1GA 2DY7A 2LXJA 1VQ9A 1MSHA 4IUTA 5JEAJ 1AP0A 4DV2Q 1EQTA 3CCSA 3GTOH 4ODGA 1P8LA 2L55A 4XDXA 2K33A 3K58A 2KQ3A 5IP9H 2F3WA 3W2DA 1PH6A 5NUCA 4HIMA 4LF7L 1ET6A 2AHOB 2PMZE 1B70B 5LMNQ 1Q7YC 1BKBA 1HH2P 3K7AB 4KD3A 3D4WA 5CBEE 2IJ0A 1KHIA 5C3EG 4R8NA 5JPNC 1IXRA 1GD7A 1XTCD 2PQAB 4RGNA 1EYAA 1IW7C 2B2UA 3AFPA 1N36L 1N34Q 1EQQA 1ASYA 2R92G 4DV7Q 4YWMA 1QNKA 2WB1E 1MD2D 5C5MA 3HGBA 4A75A 1XNQQ 1S4ZA 1RTNA 2VQFL 1GOZA 1T9HA 2JXMB 2NB0A 4BXXG 4C3JB 2VB3X 4HJ8A 1Q1BA 4BA2I 1FGBD 1HA5A 3LWUA 2RQXA 2C5CA 1I4PA 5FOBB 3U58A 3PO2B 2NVYH 1I4QA 1CUKA 2SEBD 4XQNA 1CA6A 1K83B 2EQSA 4K2KA 2R92H 4U673 3NQTA 5IP7H 2EZVA 1JB7A 5C4ZA 1JOKA 4RFBA 2B2VC 2F4VQ 3VYRA 3OSOA 3SGIA 2WFWA 3I73A 3S1MH 1VQNA 3O13A 4BXXH 1U5KA 1IYUA 1A2TA 4JI5Q 1P16A 1X3GA 3VR4A 4ME3A 5KIXA 1IKMA 1HZCA 1SNMA 2F0GA 1CKOA 4DNTB 3GTJB 4ZUIA 2F0SA 5M3MH 1HXYD 5ELNA 4JV5Q 1Y8NB 1L0WA 2JA9A 2B8GA 1RODA 4JOIC 5C6AA 1G6ZA 1OTCA 4LK1C 2P5ZX 4RKLA 1B8AA 5BN5A 1VQ6A 1LTTD 3J80i 1IHZA 1EZ6A 2R7ZG 1QJOA 1B9NA 1Y1WB 4Z9CB 2Y0SB 4CKEA 3BVZA 3NK9A 2QGQA 1Y1VG 1O7ZA 4MIUA 1XMQL 1W3SA 3CP0A 3G7LA 2EE1A 3W1BA 3LX0A 3KFUA 1NE3A 3S16H 2CWAA 1WTVA 1X32A 3LWEA 1QZHA 1LM0A 2UXBQ 2MPMA 4FXKC 1A3UA 3CCVA 2KCMA 3I8ZA 2A68D 5FO8B 4C2MH 2L12A 3NBHB 3CC7A 5FLMH 3CAMA 2QF7A 3UDGA 3KLSX 4JCVE 1JJ2A 3HOZB 1PZJD 2B2WC 1KTKA 4GOPA 1RIPA 3SK5A 3VR3A 1JORA 1AE2A 1Q46A 1IL8A 2CCZA 1N33Q 2WAQE 2K5WA 4HJ7A 1H9RA 1UUPA 1BOSA 2RDGA 3UDFA 4FF1A 3SVMA 2X6LA 4FNFA 1X9NA 1WTOA 4Y7NH 5IT9E 1YZ6A 5IOCA 4A93B 4XT1B 4U68A 4OWWB 5IYBG 1RHPA 4FDBA 5IGEA 4OX9L 4A3GH 1D2BA 1K8OA 1SDFA 1E1TA 1CSPA 2EY5A 2BH8A 1YNXA 2CWPA 4KV6A 1B7YB 2EJFC 4YIJA 1GUWA 5CV9A 4OONA 3S1QB 4NDXA 4POGA 1O7YA 1VQPA 4OWXB 4B3SL 4G7HC 2MGSA 5D3DA 3Q24A 5ELFA 4XQJA 2F0MA 3QWNA 1EIHA 4LF7Q 2TSSA 4Q5VA 4ZAIA 4IN3A 3I7FA 3F2CA 1NTGA 1AZQA 3U9OA 5CGKA 2J0TD 1GO3E 2MFIA 2ZTDA 5LL6X 3J7AV 2Z6BA 1O78A 2LMCB 3K80C 2UXDL 2MP1A 1BQQT 4IFDI 3PIPA 1SNQA 1F9RA 4JI6L 2GN5A 2KCNA 1PLFA 5FLXc 3L3OC 2K14A 1EIFA 4K8IA 3J81L 3CCQA 1N36Q 1B3AA 4N9TA 3BJUA 1I94L 3R2IA 4PV1C 1ZXTA 3C2PA 3RZDB 1CQFA 4OIJA 4DV3L 2VQFQ 2M2LA 4K0KL 3M7GA 2ZJPA 3OW7A 1DOLA 2EYHA 4X3SA 5ELDA 3MXUA 2N49A 4IQZA 2ZJRA 5IGBA 3HOXB 4WFN3 2DJFC 4X62L 4QIWE 1IW7D 1N8RC 3V05A 1CI3M 1SBBB 1KLGD 1PMRA 3EQLC 3K7AH 1D1IA 5ELCA 4H13C 4MTKA 2FMCA 4ID6A 2X69A 3H3VC 1J8IA 1PTOC 1TT2A 2OT2A 4B08A 4OIKA 2MO1A 1GUNA 1ILQA 1NCVA 2JA7G 1SR3A 1EY8A 5EQ0A 3KF8B 2OWOA 1F2LA 1U4LA 1FD7D 2EXZA 2EPBA 3A8IE 5JVH3 1D1KA 5LL6S 1YBYA 2EYFA 5EPJA 3R93A 1PTOF 4DGZA 2VUMG 2O4XA 4OXPA 3TP8A 4CGYB 2JEBI 1CK1A 3KYHC 4IOAA 1E22A 2LXKA 1RD9D 3TSSA 3PO2H 2F0UA 1PXUA 2ZT9C 4BBSG 2JA7H 1V43A 1K83H 4KMUC 2QEXA 2PMZB 1XMQQ 1XYIA 1FL0A 2CH4W 2B2UC 4BY1B 4DR5L 5CV5A 1LT4D 5C44G 3I56A 4HJAA 3VR2A 3HOYG 3EVQA 4BBRG 3ULJA 4CDDC 2EYOA 3NTHA 3GTJH 3GO5A 1GVPA 2FJ2A 1KL9A 2PQEA 2WB1B 5E3FA 3FKIB 3AEVA 3MXPA 4PG3A 3OOCA 4C3IB 4DV5L 3MVVA 3HKZE 1BCPB 1V9PA 2KVMA 3NUCA 1PFMA 3TZDA 1PRTB 2XRSD 1LTBD 4M1UB 4HR7B 1DJRD 2A74C 1QUQA 2K01A 4P72A 2OTJA 2G9HD 4TQUS 1VF5C 2AUJD 1DONA 3VA5A 3TS0A 4KTAA 3K8AA 1NNXA 3I91A 5CC4A 2A8VA 3AFQA 3UDXA 4KY7A 4V0BA 4OX9Q 1JMCA 4RKBA 1ENAA 4JI7L 1D8LA 3KLSA 3PSIA 1F9QA 2KEDA 3H94A 1CZWA 1ML0D 4GLXA 3NSWA 1QCBD 4GKKQ 1S40A 1C9OA 4A93G 1ICFB 4RA8A 2DNEA 4B3SQ 2E2HB 3SEBA 1CA5A 2F52A 4K6DA 4RGTA 2K04A 1B9MA 3HS0C 5IWAL 3PO3B 4LF8L 4DAYA 5M5YB 1QVGA 4JI8L 4ZKCB 2RHSB 3ER0A 4ULLA 4DR1L 1RF2D 3S17H 4LNQA 2UXDQ 2XN9C 1D7QA 4HTHA 1H9SA 3RNUA 4JI6Q 4J8QA 4LMQD 3KLWA 1HNXL 4NMZA 4A93H 3E5SA 2MJ8A 5EGTA 1I94Q 1HUMA 3FPPA 5ELOA 2WACA 2B63B 1GHJA 2NN6I 3BDOA 3NBIA 4DV3Q 4KKUA 4JI2L 4K0KQ 4GOPC 2F0TA 1YJNA 1AE3A 3RUZA 4RG1A 2J4XA 1R4PB 2K6AA 3T1HL 2LY7A 1J9OA 4X62Q 4OO1I 3FVQA 2YU9B 2NWGA 5COYA 1BBXC 5CBAE 1C0AA 4LF9L 1KIXA 2WAQB 2F0EA 5DM63 3I4NG 3QIAA 1TQOA 4LJZC 3K5LA 3HOXG 4AIMA 3Q22A 2E2JH 1L1OA 1Y8OB 5IGGA 2ICIA 2JA5B 5JJIA 5EPKA 4A3JB 2XIWA 3MC0B 3GTQB 3RZDH 3R8BA 3FPUB 3ND8A 4EQOA 3IFTA 1B1ZA 4FF4A 1CM9A 2I5LX 4DK0A 4FF2A 4QGUA 3P7JA 3T53B 1U0LA 3H91A 4IFDG 4BWGB 2QKIC 1ZEQX 4DU9A 1CT1D 3I4NH 1A62A 1QVCA 3HOXH 1PTOD 1SXTA 3MEHA 4R4QA 1LUZA 4PMCA 5LMNW 4K5WA 3LGJA 2E75C 2K52A 5EKLA 4KD4A 3PUYA 3QJYA 4HIDA 1MIUA 1VCIA 2C35B 3M9BA 4IFDJ 4HAEA 4DR5Q 5DEHA 2NZHA 1XNRL 3J81j 3MTSA 1J6QA 4ZYSA 3NE5B 5FLXL 1QE6A 4A3MB 3M4OB 1FR3A 2MHVA 1U4PA 1WTRA 3I90A 1PYSB 4O42A 4P2CB 5IT9c 1I4HA 5C4XG 1EEFD 2KHSA 2CQOA 1A2UA 2VW9A 1PH9A 3RZOB 3HEJA 4LW1A 4N8FA 5E1FA 5GQOA 4F88A 3SE0A 2FINB 2CH4A 4DV5Q 5ELEA 1WCMG 2VB2X 4ZKBB 3A5UA 2OF1A 3QO2A 1B44D 2AQ1B 2JE6I 3ULPA 2HDLA 3K5MA 2SDFA 2WB1G 1LT6D 4QY7A 3TEHB 4POFA 4GNXA 1KNEA 3CRLC 2F3IA 4I7ZC 4QIWB 2RSOA 1NJIC 3NXWA 3GV3A 2R93G 2R3ZA 1YEZA 4C3IG 5KEEA 1H9KA 4QUCA 1OXSC 3ERQA 4A3IB 4ZK9B 5C4XH 3D6WA 2OEOA 4HIOA 1IKLA 1BCPF 4EQNA 2ZM6L 2L1BA 2L0CA 1DZ1A 1WCMH 3RN2A 4JI7Q 2VL6A 3M4YA 1AFPA 1A63A 1I3QB 4A3GB 1VQ7A 2E76C 5IGCA 1Y14B 2K5VA 4Q0FA 2EY6A 1U9RA 3FKIH 2JP1A 3UDIA 4C3IH 1SNDA 2PZTA 1TXYA 2E2IB 3SK8A 1EY4A 1LTSD 5IWAQ 5CV7A 2KHIA 4LF8Q 4KHPL 2B3GA 4DKAC 4WRDA 3K81C 1EY9A 4K5XA 5KYLA 4JI8Q 3J81c 4K8JA 3Q8DA 3GTMB 2OTLA 4DR1Q 1G6PA 3T51B 2PQAA 2RDFA 1UE5A 4DR2L 1FNVA 1EWIA 1HNXQ 1N9WA 1VQ4A 4R8IA 1K73C 2Z0SA 4DUYL 2K5NA 4JI2Q 1JWUD 1KDCA 3E0EA 4GZYC 4ZUJA 1SSOA 2Z6KA 2B2YA 3BZCA 1F2ZA 1L2FA 4LUOA 3T1HQ 3JC66 1O80A 3HKZB 5IP9G 1I50H 3QOLA 4QQBX 1DCZA 3AQQA 2JN4A 5M5YH 4OWTB 1HNWL 4LF9Q 4XYQA 2NVQH 4FXDA 3HOWB 4MHEA 1CHQD 4XQQA 2PZUA 3B6YA 1PYBA 4RCOA 2YTVA 3KJOA 1MBYA 1N32L 1GKHA 5H1SE 3T56B 1C4QA 2KJXA 2B63H 3HOVB 1KAAA 1VQFA 3N52A 2UUCL 1SMYC 4HMJA 4DV4L 2WAQG 2JJQA 1JC7A 1HZAA 4RH6A 2ZXOA 4LF4L 3F8TA 1D5MC 4AYBG 4QF4A 2Q2HA 1X55A 3LNNA 2RVLA 3ITPA 1HNZL 3P1HA 2SNSA 4EX5A 4K5VA 1K8AC 2YU9H 4DF7A 2K28A 2NN6G 1MJEA 1X3FA 1KXLA 2HUGA 1OO9B 2WINB 3Q6SA 5IP7G 4ABNA 3ONAB 1XNRQ 2VZAA 3V96A 1FVIA 2BA0A 3SK6A 3BYYB 1GM5A 3U4ZA 1TWGB 2JSOA 4XT3B 1DD2A 5LMUL 1TIID 1GXDC 1BXTA 4DR6L 3NBHA 3PF4A 3GTQH 4OO1G 1NR2A 1S5ED 1VQLA 1A15A 3A8KE 5M3MG 4HJ5A 2I0QA 2NN6H 1TS4A 4YHHL 2AQ3B 2O5JC 4X3TA 1PZID 4MN3A 1EYDA 1E3PA 3PQIA 1K0SA 4HIKA 1RKNA 3H0GB 4A3FG 3CCLA 3NELA 1ICWA 1UWVA 3DWQA 3OWFA 1FNUA 4OO1H 2R6GA 3WDNA 1K8GA 1L1OC 4KY5A 2ZM6Q 3JAME 1PH8A 1IYVA 3M4OH 2F0HA 1U4RA 4NP5A 1Z9FA 3T1YL 2HIXA 4UHVA 3HOUG 4A3FH 1STBA 4L8JA 1IL2A 2PNHA 3KLRA 3RZOH 4JYAL 1MHWC 5FLMG 4LFBL 1PHJA 3DM1A 4KK7A 4WJ4A 3M85A 4N9PA 4XIGS 5GADC 1I4XA 5AFWA 3U9SA 4X66L 4KHPQ 4A3GG 1GUOA 4GLAC 3CCUA 3PUXA 1MI2A 4EVOA 5GAGC 3NQIA 3K0YA 3V2TA 3OMGA 3HOUH 5L37A 1IZ6A 4DR2Q 2DUDA 4BS9A 2IT1A 1TWCB 5JAVA 1VQHA 3CHBD 3UE1A 4DXGA 1FGUA 1Q81C 4HCSA 2IX3A 3A8JE 2A6EC 2F0OA 3K59A 2IX0A 5IT9L 1I3QH 1QB5D 2WKCA
chains in the Genus database with same CATH topology
5FJ8H 1HZ9A 4YY3L 4DR5L 1X6OA 5GAEC 2OQKA 4LUZA 5C44G 3I56A 4DV0Q 1X54A 2Y0SE 4HJAA 3M3YH 3GTGH 4JOIA 3HOYG 4LWCA 2JEAI 1X65A 4BBRG 3BZKA 3ULJA 5LMNL 4DAYB 3KF6A 5IYCH 3GTJH 4GNXC 3GO5A 1GVPA 4A3BG 1LYLA 1XPOA 4LFCQ 2OCEA 3CXCA 1MKHA 2GVBA 1E24A 1KL9A 4UP9A 3J81i 1HNWQ 4GLVB 2JA5G 3AEVA 1XMOL 4BY7G 4NB3A 3GTMH 1IYJB 1SRUA 4A3JG 4LF5L 4BA1I 3FHWA 4PG3A 3OTOL 1QVFA 4DV5L 3KOJA 3HKZE 1V9PA 4X64Q 1N34L 2BH2A 1CKNB 3TQYA 1TWHH 4DV7L 3PV0A 2HIVA 3S1RH 2YYZA 1WOCA 1N32Q 4DUZQ 1XNQL 1EQRA 4DR3L 1QUQA 3ZJYC 2L15A 4DV4Q 3H3VI 4P72A 3PGZA 4A3LG 4NXML 2OTJA 1BBWA 4TQUS 4Y52H 2EIFA 4A3BH 2Q2TA 3I2ZA 4DK3C 2IHFA 4LF4Q 1CKMA 4NPSA 4IPGA 3TS0A 3K8AA 2R7FA 4IJHA 4P74A 3J80c 3NEMA 4DV1Q 2JA5H 2N8NA 2I5HA 4A3JH 1PH7A 2A8VA 3AFQA 3TRZA 3UDXA 1H95A 3PUVA 4J15A 4OX9Q 4P73A 1JMCA 5BR8L 1HNZQ 4JI7L 1D8LA 3PSIA 3NENA 1K3RA 2JA8G 4A4IA 1EIYB 4R4CA 4GLXA 4A3MG 2F4VL 3CQZH 3PUWA 3UE0A 4GKKQ 1S40A 1C9OA 4A93G 3K7UC 1PH5A 3HOWH 4DPGA 4B3SQ 4A3LH 1S72A 3GDEA 4JI5L 2F52A 4GN3B 2BA1A 1L1OB 4A3KG 4HJ9A 5IWAL 5C3EH 4MZ9A 2VQEQ 3J7ZC 4LF8L 4JI1Q 5AJ3Q 4DR6Q 1QVGA 4JV5L 1RL2A 1A8VA 4JG2A 4JI8L 4X65Q 1Q86C 2RHSB 2K75A 2Z6KC 3ER0A 3W1GA 4DR1L 2UUBQ 3S17H 4JI0L 4LNQA 2JA8H 2UXDQ 3F1ZA 4JBMA 1D7QA 3F2DA 3RNUA 4JI6Q 4A3MH 4YHHQ 2MQHA 3KLWA 1HNXL 5M5XH 4A93H 1FJGQ 2UXCQ 1CKNA 3M4PA 1NY4A 1O7IA 3CD6A 1I94Q 4KLKA 4R4OA 5ELOA 1VQMA 2RHQB 1IBML 1E7ZA 4A3IG 2R93H 3RR5A 1KAWA 2NN6I 4TVAB 3VDYA 4A3KH 1JT8A 3ULLA 4R4IA 4DV3Q 4JI2L 1OXXK 3CC2A 4K0KQ 3I55A 4PZ7A 5IY0A 4GOPC 1EUJA 3PO2G 4A3DG 1YJNA 1AE3A 4B3RL 4RG1A 2A19A 2N3SA 2ID0A 3T1HL 2JK8A 2VNUD 3OYYA 3H0GG 5C4JH 4X62Q 4AQYQ 2YV5A 4L5QA 1TWGH 4OO1I 1TWAH 2ALYB 1LTLA 2UUAQ 4LF6Q 1AH9A 3OW2A 1VQJA 4XTCS 5EAYA 4C3JH 3T1YQ 4A3IH 1C0AA 2Q2UA 4LF9L 4YWKA 4R4TA 1KIXA 3RLOA 5DLQE 1VQCA 3S24A 2NZOA 4JYAQ 3PUZA 4IOCA 1JJCB 1VQOA 3I4NG 4LFBQ 1SROA 2ZTCA 2KCTA 3EBEA 3HOXG 4AIMA 1Q12A 4P71A 2E2JH 4DUYQ 1L1OA 4GS3A 2CKZB 4RMFA 3G4SA 4IO9A 4A76A 2K50A 5IYDG 5JJIA 4DV0L 1N33L 1BBUA 2K5HA 3DM3A 4UPAA 1Z47A 3E9HA 3G48A 4X66Q 1YJ9A 4NXNQ 3RZDH 3H0GH 4GNXB 4QL5A 1VQAA 2E5LL 1XPUA 1EFWA 1Y1WG 2I5LX 2R7ZH 2Y0SG 1UEBA 5JEAG 1CSQA 4LFCL 4QGUA 1YJWA 1YVCA 1NBWA 2E2IH 1U0LA 4L5TA 4IFDG 1OXVA 4MNOA 1KRTA 2UU9Q 4DV6Q 1Y1VH 3I4NH 1PH3A 1SMXA 1A62A 4YCVA 2HT1A 1QVCA 4B3ML 3HOXH 2QA4A 3STBC 2IX1A 3JAMi 2PI2A 2LSSA 1LUZA 4R4QA 4JBWA 5LMNW 2LXJA 1SE8A 3LGJA 1VQ9A 4JI3Q 1UE1A 3ICEA 1IBLQ 2K52A 5JEAJ 4B3TQ 5IYDH 1PVOA 3PUYA 1MJCA 4JC0A 4DUZL 4DV2Q 1MIUA 1VCIA 3CCSA 2C35B 4HIDA 3M9BA 1KC8C 3GD7A 3GTOH 3HKZG 4YY3Q 4DR5Q 3E9IA 1P8LA 4LFAL 5JJKA 2JQOA 2MO0A 2NZHA 1IBKL 3J81j 1XNRL 5IP9H 5JJLA 1Y1WH 1J6QA 1PH6A 4AYBE 4KHZA 5C0XG 1PA6A 4PZ6A 4HIMA 2Q2IA 3S2HH 4LF7L 1G291 2XTIA 4MTNA 1C7YA 3HOZG 2AHOB 2PMZE 1B70B 3TREA 5LMNQ 1Q7YC 2UUCQ 3HOWG 2AWNA 1BKBA 1HH2P 1PYSB 3KDFB 5IT9c 1VQIA 1KHIA 5C4XG 5C3EG 2CQOA 2VW9A 3J7A5 1PH9A 4LW1A 5GQOA 1XMOQ 5C0XJ 1GD7A 1IXRA 2PQAB 3OTOQ 4LF5Q 3HOVG 4DV5Q 2A1AA 2B29A 3AFPA 1N36L 1WCMG 1N34Q 2R7DA 1V1QA 2CFMA 4P75A 1EQQA 1ASYA 2R92G 4DV7Q 4GKKL 3A5UA 4YWMA 1TWCH 1VQDA 2WB1E 1J5EL 2JE6I 3ULPA 3L0OA 4A75A 4R1JA 3HOZH 2WB1G 4QY7A 3TEHB 1VQGA 4POFA 1XNQQ 1SN8A 3PIOA 1T9HA 2VQFL 4GNXA 4DR3Q 2F3IA 4GKJL 3PCOB 1NJIC 4UP7A 4NXMQ 2KBNA 1YEZA 5IYBH 4BXXG 2R93G 1OXSC 4HJ8A 4BA2I 1Q1BA 1JJGA 5C4XH 4HIOA 3CCRA 5LMUQ 2ZTEA 2ZM6L 1HJPA 3CCJA 1YI2A 1VQKA 3HOVH 3U58A 2NVYH 4BXXH 1WCMH 1CUKA 4H02A 5BR8Q 3RN2A 2VL6A 4JI7Q 3I4MH 2EQSA 2R92H 1A63A 2KHJA 4PMWA 5IP7H 1JB7A 1VQ7A 1Y14B 2F4VQ 2K5VA 3CCEA 3KJPA 3SGIA 2WFWA 3FKIH 3S1MH 4GOPB 3H15A 3I4OA 3CCMA 1VQNA 1Q1EA 1EOVA 4AH6A 1WI5A 3GTPH 3UDIA 1U5KA 4C3IH 4C3HH 4JI5Q 1P16A 1VQEA 1X3GA 1TXYA 3ERSX 3CW2C 4YWLA 4ME3A 1SFOH 4DR7L 4IPCA 1HZCA 3F2BA 1CKOA 1PH1A 1X3EA 1KQSA 5IWAQ 2KHIA 2YTYA 4IPHA 5M3MH 4LF8Q 4KHPL 2B3GA 3KDFA 4DKAC 3K81C 5ELNA 4IPDA 2HHHL 3S1QH 3D0FA 4JV5Q 2I5MX 4JI8Q 3J81c 4L5RC 1L0WA 3RLNA 3Q8DA 2IHEA 3JAMc 4UY8C 4WJ3M 2JA9A 2OTLA 4DR1Q 1G6PA 4JOIC 2D62A 2PQAA 1OTCA 2JA6G 4DR4L 1UE5A 4DR2L 1SLJA 1B8AA 1VQ6A 1EWIA 1OXTA 3L7ZC 3J80i 1HNXQ 1HR0L 3FP9A 4DAMA 4KI0A 3CF5A 2R7ZG 1N9WA 2AWOA 1VQ4A 2E8GA 4L5SA 1K73C 4LUVA 2Z0SA 2QGQA 1Y1VG 1JE5A 4DUYL 1WJJA 1X56A 1W3SA 1DGSA 2K5NA 3CP0A 4JI2Q 1XMQL 5M5WH 3E0EA 3W1BA 3KFUA 1WYDA 1NE3A 3S16H 1PFSA 2CWAA 2Z6KA 4B3RQ 2MNAA 1QZHA 2PI2E 1LM0A 2VS1A 1L2FA 3BZCA 1W2BA 4LUOA 2UXBQ 2ATWA 1R9TH 2JA6H 3T1HQ 5IE8A 3CCVA 3EN2A 3JC66 1VQBA 2KCMA 2WP8J 4IJLA 3W5OA 3G71A 5IP9G 1I50H 4PZ8A 4C2MH 4QQBX 3NBHB 3CC7A 4DK6C 5FLMH 3CAMA 3AQQA 5M5YH 4A3EH 4OWTB 3UDGA 1HNWL 4LF9Q 4JCVE 1QZGA 1JJ2A 3CC4A 4O0AA 2AKWB 2JA7H 2NVQH 2RCNA 2D0PA 2VY3A 4GOPA 1RIPA 2D0OA 4EQ5A 3B6YA 4X64L 3L2PA 4DV2L 1PYBA 3H3VH 2YTVA 3KJOA 1ASZA 1N32L 1AE2A 1Q46A 1GKHA 5H1SE 2CCZA 1N33Q 2NVTH 2B63H 2WAQE 3CPFA 4HJ7A 1VQFA 2VUMH 1HZBA 3UDFA 4DV4L 1KD1C 2WAQG 3MEFA 2UUCL 2E5LQ 2JJQA 1Q8KA 1HZAA 2DGYA 4LF4L 1X9NA 2YTXA 3EIVA 3M7NA 2IY5B 3F8TA 4AYBG 4Y7NH 4JI4L 1YZ6A 4DV1L 3PF5A 4OWWB 2Q2HA 1X55A 5IYBG 1NMGA 4BBSH 3TS2A 4FDBA 5HY6A 4OX9L 4BY1G 5M3FH 3S2DH 4B3MQ 1PH4A 1HNZL 1VS0A 1E1TA 1CSPA 4EX5A 4DNIA 1K8AC 2YU9H 3M4QA 2BH8A 1YNXA 2CWPA 5C44H 2NN6G 3A74A 3HFZB 1MJEA 1X3FA 1B7YB 3HOYH 4OONA 3I4MG 1KXLA 4POGA 2AMCB 2NVXH 4BBRH 1VQPA 2EXDA 2V1CC 4LFAQ 4OWXB 4B3SL 5IP7G 1IBKQ 1XNRQ 1OXUA 1M90C 3MXNB 4A3CG 2VZAA 1FVIA 2BA0A 1GM5A 3FKIG 3U4ZA 4LF7Q 1NMFA 2VQEL 3U50C 5LMUL 4JI1L 4BY7H 3K0XA 5AJ3L 4O2DA 4DR6L 3I7FA 3F2CA 3PF4A 1NTGA 4X65L 4BY1H 3GTQH 4OO1G 3G6EA 1VQLA 2MFIA 1GO3E 2ZTDA 3STBD 2UUBL 3K80C 4YCUA 5M3MG 4HJ5A 2UXDL 4JBJA 4IFDI 2I0QA 3PIPA 4GN4B 2FXQA 1YHAA 4JI6L 2GN5A 4YHHL 5FLXc 3CMEA 2K14A 1EIFA 3AYHB 3BU2A 3CCQA 1YHQA 1N36Q 2UXCL 1FJGL 1E3PA 3BJUA 5J3BA 4HIKA 1I94L 5GAHC 3S1NH 1BVSA 1XTDA 3GTLH 4A3CH 1J5EQ 1K9MC 4A3FG 3CCLA 3NELA 1YHBA 4DV3L 2OQ0A 2VQFQ 1UWVA 4K0KL 4GKJQ 1WFQA 2ZJPA 2R6GA 4APVA 2XGTA 5C0XI 1K8GA 2N78A 1L1OC 2GVAA 3WWVA 2N49A 3IRBA 3DLLA 2ZJRA 1M1KC 2ZJQA 3A0JA 2ZM6Q 1UE6A 1KRSA 4X62L 1VQ5A 4AQYL 1PH8A 1UE7A 4QIWE 4QJFA 2H5XA 3KF6B 1N8RC 3S15H 1YIJA 2HQLA 3HKSA 3M4OH 1PV4A 3RLFA 4JI0Q 2UUAL 4LF6L 4IFDJ 3K7AH 1Z9FA 3D31A 3T1YL 2HIXA 3HOUG 2RF4A 1G51A 4A3FH 1XPRA 1IL2A 4UP8A 2PNHA 4X6AH 3CPWA 3RZOH 3PO3G 4JYAL 5FLMG 1I5FA 1PH2A 4LFBL 1PHJA 4A3EG 2K4KA 1IBMQ 3U4VA 1XJVA 2ASBA 3GTKH 1E1OA 4WJ4A 5E7NA 3A5ZB 2KENA 2MO1A 4XIGS 5GADC 3M85A 4DR7Q 5K36G 2JA7G 1SR3A 1HR0W 4X66L 4NXNL 3KF8B 2OWOA 4KHPQ 4A3GG 2UXBL 1YITA 2HHHQ 4GLAC 1QUQB 3CCUA 5FJ8G 3PUXA 4JI4Q 1YBYA 5GAGC 1S3OA 4ALPA 2E2HH 2B63G 3CMAA 5HGQA 3RN5A 1I6HH 5GROA 2VUMG 4OXPA 3HOUH 4DR4Q 1IZ6A 4DR2Q 2DUDA 4JBKA 1A0IA 2JEBI 1VQ8A 3KYHC 5IYCG 2UU9L 2IT1A 4DV6L 3S14H 1HR0Q 3PO3H 4IOAA 4GN5A 1E22A 2LXKA 1VQHA 1EYGA 3UE1A 4YCWA 1Q81C 1FGUA 1K0RA 3PO2H 4A3DH 1Q82C 4BBSG 4JI3L 1V43A 1K83H 1IBLL 2QEXA 2IX0A 1XMQQ 2ES2A 4B3TL 1I3QH 5M3FG 1FL0A 4A3GH 1TWFH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FJ8 H;  1HZ9 A;  4YY3 L;  4DR5 L;  1X6O A;  5GAE C;  2OQK A;  4LUZ A;  5C44 G;  3I56 A;  4DV0 Q;  1X54 A;  2Y0S E;  4HJA A;  3M3Y H;  3GTG H;  4JOI A;  3HOY G;  4LWC A;  2JEA I;  1X65 A;  4BBR G;  3BZK A;  3ULJ A;  5LMN L;  4DAY B;  3KF6 A;  5IYC H;  3GTJ H;  4GNX C;  3GO5 A;  1GVP A;  4A3B G;  1LYL A;  1XPO A;  4LFC Q;  2OCE A;  3CXC A;  1MKH A;  2GVB A;  1E24 A;  1KL9 A;  4UP9 A;  3J81 i;  1HNW Q;  4GLV B;  2JA5 G;  3AEV A;  1XMO L;  4BY7 G;  4NB3 A;  3GTM H;  1IYJ B;  1SRU A;  4A3J G;  4LF5 L;  4BA1 I;  3FHW A;  4PG3 A;  3OTO L;  1QVF A;  4DV5 L;  3KOJ A;  3HKZ E;  1V9P A;  4X64 Q;  1N34 L;  2BH2 A;  1CKN B;  3TQY A;  1TWH H;  4DV7 L;  3PV0 A;  2HIV A;  3S1R H;  2YYZ A;  1WOC A;  1N32 Q;  4DUZ Q;  1XNQ L;  1EQR A;  4DR3 L;  1QUQ A;  3ZJY C;  2L15 A;  4DV4 Q;  3H3V I;  4P72 A;  3PGZ A;  4A3L G;  4NXM L;  2OTJ A;  1BBW A;  4TQU S;  4Y52 H;  2EIF A;  4A3B H;  2Q2T A;  3I2Z A;  4DK3 C;  2IHF A;  4LF4 Q;  1CKM A;  4NPS A;  4IPG A;  3TS0 A;  3K8A A;  2R7F A;  4IJH A;  4P74 A;  3J80 c;  3NEM A;  4DV1 Q;  2JA5 H;  2N8N A;  2I5H A;  4A3J H;  1PH7 A;  2A8V A;  3AFQ A;  3TRZ A;  3UDX A;  1H95 A;  3PUV A;  4J15 A;  4OX9 Q;  4P73 A;  1JMC A;  5BR8 L;  1HNZ Q;  4JI7 L;  1D8L A;  3PSI A;  3NEN A;  1K3R A;  2JA8 G;  4A4I A;  1EIY B;  4R4C A;  4GLX A;  4A3M G;  2F4V L;  3CQZ H;  3PUW A;  3UE0 A;  4GKK Q;  1S40 A;  1C9O A;  4A93 G;  3K7U C;  1PH5 A;  3HOW H;  4DPG A;  4B3S Q;  4A3L H;  1S72 A;  3GDE A;  4JI5 L;  2F52 A;  4GN3 B;  2BA1 A;  1L1O B;  4A3K G;  4HJ9 A;  5IWA L;  5C3E H;  4MZ9 A;  2VQE Q;  3J7Z C;  4LF8 L;  4JI1 Q;  5AJ3 Q;  4DR6 Q;  1QVG A;  4JV5 L;  1RL2 A;  1A8V A;  4JG2 A;  4JI8 L;  4X65 Q;  1Q86 C;  2RHS B;  2K75 A;  2Z6K C;  3ER0 A;  3W1G A;  4DR1 L;  2UUB Q;  3S17 H;  4JI0 L;  4LNQ A;  2JA8 H;  2UXD Q;  3F1Z A;  4JBM A;  1D7Q A;  3F2D A;  3RNU A;  4JI6 Q;  4A3M H;  4YHH Q;  2MQH A;  3KLW A;  1HNX L;  5M5X H;  4A93 H;  1FJG Q;  2UXC Q;  1CKN A;  3M4P A;  1NY4 A;  1O7I A;  3CD6 A;  1I94 Q;  4KLK A;  4R4O A;  5ELO A;  1VQM A;  2RHQ B;  1IBM L;  1E7Z A;  4A3I G;  2R93 H;  3RR5 A;  1KAW A;  2NN6 I;  4TVA B;  3VDY A;  4A3K H;  1JT8 A;  3ULL A;  4R4I A;  4DV3 Q;  4JI2 L;  1OXX K;  3CC2 A;  4K0K Q;  3I55 A;  4PZ7 A;  5IY0 A;  4GOP C;  1EUJ A;  3PO2 G;  4A3D G;  1YJN A;  1AE3 A;  4B3R L;  4RG1 A;  2A19 A;  2N3S A;  2ID0 A;  3T1H L;  2JK8 A;  2VNU D;  3OYY A;  3H0G G;  5C4J H;  4X62 Q;  4AQY Q;  2YV5 A;  4L5Q A;  1TWG H;  4OO1 I;  1TWA H;  2ALY B;  1LTL A;  2UUA Q;  4LF6 Q;  1AH9 A;  3OW2 A;  1VQJ A;  4XTC S;  5EAY A;  4C3J H;  3T1Y Q;  4A3I H;  1C0A A;  2Q2U A;  4LF9 L;  4YWK A;  4R4T A;  1KIX A;  3RLO A;  5DLQ E;  1VQC A;  3S24 A;  2NZO A;  4JYA Q;  3PUZ A;  4IOC A;  1JJC B;  1VQO A;  3I4N G;  4LFB Q;  1SRO A;  2ZTC A;  2KCT A;  3EBE A;  3HOX G;  4AIM A;  1Q12 A;  4P71 A;  2E2J H;  4DUY Q;  1L1O A;  4GS3 A;  2CKZ B;  4RMF A;  3G4S A;  4IO9 A;  4A76 A;  2K50 A;  5IYD G;  5JJI A;  4DV0 L;  1N33 L;  1BBU A;  2K5H A;  3DM3 A;  4UPA A;  1Z47 A;  3E9H A;  3G48 A;  4X66 Q;  1YJ9 A;  4NXN Q;  3RZD H;  3H0G H;  4GNX B;  4QL5 A;  1VQA A;  2E5L L;  1XPU A;  1EFW A;  1Y1W G;  2I5L X;  2R7Z H;  2Y0S G;  1UEB A;  5JEA G;  1CSQ A;  4LFC L;  4QGU A;  1YJW A;  1YVC A;  1NBW A;  2E2I H;  1U0L A;  4L5T A;  4IFD G;  1OXV A;  4MNO A;  1KRT A;  2UU9 Q;  4DV6 Q;  1Y1V H;  3I4N H;  1PH3 A;  1SMX A;  1A62 A;  4YCV A;  2HT1 A;  1QVC A;  4B3M L;  3HOX H;  2QA4 A;  3STB C;  2IX1 A;  3JAM i;  2PI2 A;  2LSS A;  1LUZ A;  4R4Q A;  4JBW A;  5LMN W;  2LXJ A;  1SE8 A;  3LGJ A;  1VQ9 A;  4JI3 Q;  1UE1 A;  3ICE A;  1IBL Q;  2K52 A;  5JEA J;  4B3T Q;  5IYD H;  1PVO A;  3PUY A;  1MJC A;  4JC0 A;  4DUZ L;  4DV2 Q;  1MIU A;  1VCI A;  3CCS A;  2C35 B;  4HID A;  3M9B A;  1KC8 C;  3GD7 A;  3GTO H;  3HKZ G;  4YY3 Q;  4DR5 Q;  3E9I A;  1P8L A;  4LFA L;  5JJK A;  2JQO A;  2MO0 A;  2NZH A;  1IBK L;  3J81 j;  1XNR L;  5IP9 H;  5JJL A;  1Y1W H;  1J6Q A;  1PH6 A;  4AYB E;  4KHZ A;  5C0X G;  1PA6 A;  4PZ6 A;  4HIM A;  2Q2I A;  3S2H H;  4LF7 L;  1G29 1;  2XTI A;  4MTN A;  1C7Y A;  3HOZ G;  2AHO B;  2PMZ E;  1B70 B;  3TRE A;  5LMN Q;  1Q7Y C;  2UUC Q;  3HOW G;  2AWN A;  1BKB A;  1HH2 P;  1PYS B;  3KDF B;  5IT9 c;  1VQI A;  1KHI A;  5C4X G;  5C3E G;  2CQO A;  2VW9 A;  3J7A 5;  1PH9 A;  4LW1 A;  5GQO A;  1XMO Q;  5C0X J;  1GD7 A;  1IXR A;  2PQA B;  3OTO Q;  4LF5 Q;  3HOV G;  4DV5 Q;  2A1A A;  2B29 A;  3AFP A;  1N36 L;  1WCM G;  1N34 Q;  2R7D A;  1V1Q A;  2CFM A;  4P75 A;  1EQQ A;  1ASY A;  2R92 G;  4DV7 Q;  4GKK L;  3A5U A;  4YWM A;  1TWC H;  1VQD A;  2WB1 E;  1J5E L;  2JE6 I;  3ULP A;  3L0O A;  4A75 A;  4R1J A;  3HOZ H;  2WB1 G;  4QY7 A;  3TEH B;  1VQG A;  4POF A;  1XNQ Q;  1SN8 A;  3PIO A;  1T9H A;  2VQF L;  4GNX A;  4DR3 Q;  2F3I A;  4GKJ L;  3PCO B;  1NJI C;  4UP7 A;  4NXM Q;  2KBN A;  1YEZ A;  5IYB H;  4BXX G;  2R93 G;  1OXS C;  4HJ8 A;  4BA2 I;  1Q1B A;  1JJG A;  5C4X H;  4HIO A;  3CCR A;  5LMU Q;  2ZTE A;  2ZM6 L;  1HJP A;  3CCJ A;  1YI2 A;  1VQK A;  3HOV H;  3U58 A;  2NVY H;  4BXX H;  1WCM H;  1CUK A;  4H02 A;  5BR8 Q;  3RN2 A;  2VL6 A;  4JI7 Q;  3I4M H;  2EQS A;  2R92 H;  1A63 A;  2KHJ A;  4PMW A;  5IP7 H;  1JB7 A;  1VQ7 A;  1Y14 B;  2F4V Q;  2K5V A;  3CCE A;  3KJP A;  3SGI A;  2WFW A;  3FKI H;  3S1M H;  4GOP B;  3H15 A;  3I4O A;  3CCM A;  1VQN A;  1Q1E A;  1EOV A;  4AH6 A;  1WI5 A;  3GTP H;  3UDI A;  1U5K A;  4C3I H;  4C3H H;  4JI5 Q;  1P16 A;  1VQE A;  1X3G A;  1TXY A;  3ERS X;  3CW2 C;  4YWL A;  4ME3 A;  1SFO H;  4DR7 L;  4IPC A;  1HZC A;  3F2B A;  1CKO A;  1PH1 A;  1X3E A;  1KQS A;  5IWA Q;  2KHI A;  2YTY A;  4IPH A;  5M3M H;  4LF8 Q;  4KHP L;  2B3G A;  3KDF A;  4DKA C;  3K81 C;  5ELN A;  4IPD A;  2HHH L;  3S1Q H;  3D0F A;  4JV5 Q;  2I5M X;  4JI8 Q;  3J81 c;  4L5R C;  1L0W A;  3RLN A;  3Q8D A;  2IHE A;  3JAM c;  4UY8 C;  4WJ3 M;  2JA9 A;  2OTL A;  4DR1 Q;  1G6P A;  4JOI C;  2D62 A;  2PQA A;  1OTC A;  2JA6 G;  4DR4 L;  1UE5 A;  4DR2 L;  1SLJ A;  1B8A A;  1VQ6 A;  1EWI A;  1OXT A;  3L7Z C;  3J80 i;  1HNX Q;  1HR0 L;  3FP9 A;  4DAM A;  4KI0 A;  3CF5 A;  2R7Z G;  1N9W A;  2AWO A;  1VQ4 A;  2E8G A;  4L5S A;  1K73 C;  4LUV A;  2Z0S A;  2QGQ A;  1Y1V G;  1JE5 A;  4DUY L;  1WJJ A;  1X56 A;  1W3S A;  1DGS A;  2K5N A;  3CP0 A;  4JI2 Q;  1XMQ L;  5M5W H;  3E0E A;  3W1B A;  3KFU A;  1WYD A;  1NE3 A;  3S16 H;  1PFS A;  2CWA A;  2Z6K A;  4B3R Q;  2MNA A;  1QZH A;  2PI2 E;  1LM0 A;  2VS1 A;  1L2F A;  3BZC A;  1W2B A;  4LUO A;  2UXB Q;  2ATW A;  1R9T H;  2JA6 H;  3T1H Q;  5IE8 A;  3CCV A;  3EN2 A;  3JC6 6;  1VQB A;  2KCM A;  2WP8 J;  4IJL A;  3W5O A;  3G71 A;  5IP9 G;  1I50 H;  4PZ8 A;  4C2M H;  4QQB X;  3NBH B;  3CC7 A;  4DK6 C;  5FLM H;  3CAM A;  3AQQ A;  5M5Y H;  4A3E H;  4OWT B;  3UDG A;  1HNW L;  4LF9 Q;  4JCV E;  1QZG A;  1JJ2 A;  3CC4 A;  4O0A A;  2AKW B;  2JA7 H;  2NVQ H;  2RCN A;  2D0P A;  2VY3 A;  4GOP A;  1RIP A;  2D0O A;  4EQ5 A;  3B6Y A;  4X64 L;  3L2P A;  4DV2 L;  1PYB A;  3H3V H;  2YTV A;  3KJO A;  1ASZ A;  1N32 L;  1AE2 A;  1Q46 A;  1GKH A;  5H1S E;  2CCZ A;  1N33 Q;  2NVT H;  2B63 H;  2WAQ E;  3CPF A;  4HJ7 A;  1VQF A;  2VUM H;  1HZB A;  3UDF A;  4DV4 L;  1KD1 C;  2WAQ G;  3MEF A;  2UUC L;  2E5L Q;  2JJQ A;  1Q8K A;  1HZA A;  2DGY A;  4LF4 L;  1X9N A;  2YTX A;  3EIV A;  3M7N A;  2IY5 B;  3F8T A;  4AYB G;  4Y7N H;  4JI4 L;  1YZ6 A;  4DV1 L;  3PF5 A;  4OWW B;  2Q2H A;  1X55 A;  5IYB G;  1NMG A;  4BBS H;  3TS2 A;  4FDB A;  5HY6 A;  4OX9 L;  4BY1 G;  5M3F H;  3S2D H;  4B3M Q;  1PH4 A;  1HNZ L;  1VS0 A;  1E1T A;  1CSP A;  4EX5 A;  4DNI A;  1K8A C;  2YU9 H;  3M4Q A;  2BH8 A;  1YNX A;  2CWP A;  5C44 H;  2NN6 G;  3A74 A;  3HFZ B;  1MJE A;  1X3F A;  1B7Y B;  3HOY H;  4OON A;  3I4M G;  1KXL A;  4POG A;  2AMC B;  2NVX H;  4BBR H;  1VQP A;  2EXD A;  2V1C C;  4LFA Q;  4OWX B;  4B3S L;  5IP7 G;  1IBK Q;  1XNR Q;  1OXU A;  1M90 C;  3MXN B;  4A3C G;  2VZA A;  1FVI A;  2BA0 A;  1GM5 A;  3FKI G;  3U4Z A;  4LF7 Q;  1NMF A;  2VQE L;  3U50 C;  5LMU L;  4JI1 L;  4BY7 H;  3K0X A;  5AJ3 L;  4O2D A;  4DR6 L;  3I7F A;  3F2C A;  3PF4 A;  1NTG A;  4X65 L;  4BY1 H;  3GTQ H;  4OO1 G;  3G6E A;  1VQL A;  2MFI A;  1GO3 E;  2ZTD A;  3STB D;  2UUB L;  3K80 C;  4YCU A;  5M3M G;  4HJ5 A;  2UXD L;  4JBJ A;  4IFD I;  2I0Q A;  3PIP A;  4GN4 B;  2FXQ A;  1YHA A;  4JI6 L;  2GN5 A;  4YHH L;  5FLX c;  3CME A;  2K14 A;  1EIF A;  3AYH B;  3BU2 A;  3CCQ A;  1YHQ A;  1N36 Q;  2UXC L;  1FJG L;  1E3P A;  3BJU A;  5J3B A;  4HIK A;  1I94 L;  5GAH C;  3S1N H;  1BVS A;  1XTD A;  3GTL H;  4A3C H;  1J5E Q;  1K9M C;  4A3F G;  3CCL A;  3NEL A;  1YHB A;  4DV3 L;  2OQ0 A;  2VQF Q;  1UWV A;  4K0K L;  4GKJ Q;  1WFQ A;  2ZJP A;  2R6G A;  4APV A;  2XGT A;  5C0X I;  1K8G A;  2N78 A;  1L1O C;  2GVA A;  3WWV A;  2N49 A;  3IRB A;  3DLL A;  2ZJR A;  1M1K C;  2ZJQ A;  3A0J A;  2ZM6 Q;  1UE6 A;  1KRS A;  4X62 L;  1VQ5 A;  4AQY L;  1PH8 A;  1UE7 A;  4QIW E;  4QJF A;  2H5X A;  3KF6 B;  1N8R C;  3S15 H;  1YIJ A;  2HQL A;  3HKS A;  3M4O H;  1PV4 A;  3RLF A;  4JI0 Q;  2UUA L;  4LF6 L;  4IFD J;  3K7A H;  1Z9F A;  3D31 A;  3T1Y L;  2HIX A;  3HOU G;  2RF4 A;  1G51 A;  4A3F H;  1XPR A;  1IL2 A;  4UP8 A;  2PNH A;  4X6A H;  3CPW A;  3RZO H;  3PO3 G;  4JYA L;  5FLM G;  1I5F A;  1PH2 A;  4LFB L;  1PHJ A;  4A3E G;  2K4K A;  1IBM Q;  3U4V A;  1XJV A;  2ASB A;  3GTK H;  1E1O A;  4WJ4 A;  5E7N A;  3A5Z B;  2KEN A;  2MO1 A;  4XIG S;  5GAD C;  3M85 A;  4DR7 Q;  5K36 G;  2JA7 G;  1SR3 A;  1HR0 W;  4X66 L;  4NXN L;  3KF8 B;  2OWO A;  4KHP Q;  4A3G G;  2UXB L;  1YIT A;  2HHH Q;  4GLA C;  1QUQ B;  3CCU A;  5FJ8 G;  3PUX A;  4JI4 Q;  1YBY A;  5GAG C;  1S3O A;  4ALP A;  2E2H H;  2B63 G;  3CMA A;  5HGQ A;  3RN5 A;  1I6H H;  5GRO A;  2VUM G;  4OXP A;  3HOU H;  4DR4 Q;  1IZ6 A;  4DR2 Q;  2DUD A;  4JBK A;  1A0I A;  2JEB I;  1VQ8 A;  3KYH C;  5IYC G;  2UU9 L;  2IT1 A;  4DV6 L;  3S14 H;  1HR0 Q;  3PO3 H;  4IOA A;  4GN5 A;  1E22 A;  2LXK A;  1VQH A;  1EYG A;  3UE1 A;  4YCW A;  1Q81 C;  1FGU A;  1K0R A;  3PO2 H;  4A3D H;  1Q82 C;  4BBS G;  4JI3 L;  1V43 A;  1K83 H;  1IBL L;  2QEX A;  2IX0 A;  1XMQ Q;  2ES2 A;  4B3T L;  1I3Q H;  5M3F G;  1FL0 A;  4A3G H;  1TWF H; 
#chains in the Genus database with same CATH topology
 2A69 C;  2Z9H A;  1BUV T;  5GAE C;  3M3Y H;  4DV0 Q;  1X54 A;  4ILW A;  5CYU A;  1E0B A;  3BZK A;  3I4M B;  1KDB A;  2XWB B;  4GNX C;  5J22 A;  2FMM A;  1HUN A;  4A3B G;  1XPO A;  2OCE A;  1MKH A;  1E24 A;  4X3U A;  4UP9 A;  1CHP D;  3J81 i;  1HNW Q;  3GTM H;  1IYJ B;  3FHW A;  3OTO L;  4C3H B;  4KJO A;  5DAU A;  2BH2 A;  4TRD A;  1STE A;  3E6Z X;  3TQY A;  1N32 Q;  5J1Z A;  2F0V A;  1ENF A;  3KF8 A;  3WOE A;  4DV4 Q;  2IW3 A;  5HGT A;  4A3B H;  4LF4 Q;  2IHF A;  1PYW D;  2DY8 A;  2BCO A;  4IPG A;  3X3M A;  3CC4 A;  1AW7 A;  1EY0 A;  2F0L A;  2I5H A;  1PH7 A;  2A73 B;  2IWH A;  4HCE A;  1KDA A;  4P73 A;  5I9O A;  5BR8 L;  3EA6 A;  1HNZ Q;  2ENB A;  1EIG A;  3TP5 A;  1TY2 A;  2KCC A;  1JOO A;  4R4C A;  1HTL D;  1K8M A;  4PNY A;  2K1B A;  1PH5 A;  3HOW H;  1SMY D;  1ET9 A;  4GN3 B;  4C1N K;  4QMG A;  4FVM A;  1X3P A;  4R9W A;  4HJ9 A;  1JWS D;  3BS1 A;  3T16 A;  3J7Z C;  1HQM C;  4A3E B;  4DR6 Q;  5KNB A;  1A8V A;  2K75 A;  2Z6K C;  4C1N I;  1GJX A;  3NPP A;  3W1G A;  1G91 A;  2PCF B;  4JI0 L;  2B2Y C;  1H9M A;  1SYG A;  1TWF B;  4YHH Q;  4H44 C;  4NW2 A;  3M4P A;  1O7I A;  4F7X A;  4JK1 C;  2NVT B;  2NBF A;  1VQM A;  1HA6 A;  2SNM A;  2RHQ B;  3TP6 A;  1E7Z A;  4C3J G;  2IL8 A;  3RR5 A;  1IBM L;  1KAW A;  3D4D A;  4FP5 D;  3VDY A;  1SNC A;  2A6H C;  4DAV A;  3CC2 A;  2LKV A;  1RTO A;  5IY0 A;  3DMU A;  3PO2 G;  4K2L A;  1F9S A;  2A19 A;  3TME A;  2N3S A;  5M3F B;  3H0G G;  3T13 A;  1TWG H;  3DHQ A;  2ALY B;  5KYI A;  1EU3 A;  1HPC A;  4XTC S;  4PMB A;  4C3J H;  3T1Y Q;  1F2M A;  4YWK A;  2NVX B;  4R4T A;  2I46 A;  1VQC A;  4JYA Q;  1VQO A;  4LFB Q;  5FO7 B;  1GUT A;  1SRO A;  2KCT A;  3EBE A;  1W6J A;  1VF7 A;  1E2W A;  1Q12 A;  4P71 A;  3CU7 A;  4GS3 A;  1BF4 A;  4FF3 A;  3G4S A;  4BY7 B;  3QR8 A;  5IYD G;  4X66 Q;  3DM3 A;  5KGU A;  1D5X C;  3EJI A;  1QWY A;  3H0G H;  4QL5 A;  1VQA A;  1Y1W G;  3TN2 A;  2Y0S G;  1UEB A;  4LFC L;  1GHK A;  1YVC A;  3E3X A;  1Y8P B;  4MNO A;  1KRT A;  3S1N B;  4OEL B;  1SMX A;  1LTG D;  1KNA A;  1Y69 U;  2QA4 A;  3STB C;  1KLU D;  5DNF A;  3ICE A;  5IYD H;  1WD0 A;  1EY7 A;  2F3V A;  1M90 C;  4JC0 A;  4DUZ L;  1EEI D;  5JJK A;  3PIO 3;  3E9I A;  4G7Z C;  1IBK L;  4DA2 A;  1XXG A;  1Y1W H;  2F0J A;  2EDG A;  1G29 1;  2XTI A;  4MTN A;  1C7Y A;  3HOZ G;  3TRE A;  2NZ1 D;  2AWN A;  3X3N A;  1R4Q B;  3KDF B;  4FO2 A;  5T1I A;  3PIP 3;  3SDZ A;  1VQI A;  1CZG A;  1PDQ A;  3MHB A;  2QEJ C;  2RCF A;  1EY5 A;  1KAB A;  2A6E D;  5JOB A;  4X3K A;  2QDB A;  3OTO Q;  3J7A F;  2A1A A;  4S3S A;  2EYJ A;  3RMH A;  1V1Q A;  2CFM A;  3BVM A;  4P75 A;  2GA4 B;  2A69 D;  1EZ8 A;  3D3R A;  1Q90 A;  1TWC H;  1VQD A;  4DXF A;  1J5E L;  4UDU C;  1F2Y A;  5ISR A;  3HOZ H;  1FYC A;  1VQG A;  4F87 A;  1EU4 A;  4GKJ L;  2A5H A;  1TWA B;  3PCO B;  4UAI A;  4C3H G;  1LT5 D;  1RDP D;  5C3W A;  1ZYR C;  1HJP A;  3CCJ A;  5M9O A;  4A3D B;  2Z8L A;  1BO0 A;  5BR8 Q;  3I4M H;  4J1M A;  4PMW A;  1S5B D;  2OXP A;  1WTH A;  3CCE A;  1ESR A;  3BG3 A;  3H15 A;  3I4O A;  3SR1 A;  3CCM A;  1Q1E A;  1QOH A;  4C3H H;  4YWL A;  1VQE A;  3ERS X;  1PFN A;  4IPC A;  2EJM A;  5JPM C;  1M4V A;  1HCZ A;  1PH1 A;  1LTA D;  1B3Q A;  2YTY A;  4IPD A;  3S1Q H;  3D0F A;  2I5M X;  1RJT A;  4L5R C;  2DJG C;  1EWC A;  3QG1 A;  3JAM c;  4UY8 C;  3K57 A;  1WTP A;  1BDO A;  2L11 A;  2D62 A;  1SE2 A;  1MSG A;  1TWH B;  3S1R B;  2QCP X;  1HR0 L;  3L7Z C;  1WD1 A;  5FO9 B;  4QCL A;  4WJW A;  1TU2 B;  5BN3 A;  2K7V A;  4LUV A;  1SYF A;  1JE5 A;  1WJJ A;  1DGS A;  1C48 A;  2HCC A;  1WYD A;  4EQP A;  3D8G A;  2PI2 E;  1W2B A;  5IIF A;  1LTR D;  3EN2 A;  1VQB A;  3FDT A;  3G71 A;  1PFB A;  1NAP A;  1HQR D;  3HP3 A;  4A3E H;  3CQZ B;  2F0D A;  1JOQ A;  2C9O A;  4KKS A;  2Q8I B;  1QZG A;  5C4H A;  2A6H D;  2F0I A;  2RCN A;  1SNO A;  5KRU A;  2VY3 A;  4EQ5 A;  2XRQ D;  4X64 L;  4I7A A;  3L2P A;  4DV2 L;  3BDC A;  2KA7 A;  5EPL A;  2DN8 A;  5C3E B;  1D6E C;  3DEO A;  1TKW B;  2NVT H;  3CPF A;  2L5T A;  3MEF A;  4H0L C;  1Q8K A;  2ZXR A;  4IUQ A;  2DGY A;  1SYD A;  2YTX A;  3EIV A;  2F4I A;  3M7N A;  1U4M A;  4JI4 L;  4DV1 L;  3PF5 A;  1NMG A;  2EY2 A;  3TS2 A;  5HY6 A;  4BY1 G;  5M3F H;  4CJ2 C;  4A3K B;  1PH4 A;  1VS0 A;  5A35 A;  3BVG A;  3M4Q A;  3FMC A;  3A74 A;  5EJW A;  1E2V A;  3QB3 A;  4WOR A;  2HD3 A;  2M00 A;  3OPO A;  2NVX H;  1WTW A;  1BCP C;  1G2S A;  3NWS A;  4RCN A;  1S5F D;  1IBK Q;  5CV8 A;  1OXU A;  5I2Y A;  3MXN B;  2PW5 A;  3FKI G;  4CBV A;  3U50 C;  4JVZ A;  4BY7 H;  4DN4 M;  4X65 L;  4BY1 H;  3SK4 A;  1AEX A;  2BE5 C;  4RGM A;  3PMF A;  3STB D;  4YCU A;  3RD4 A;  2LS0 1;  2FXQ A;  1YHA A;  1PRT F;  5A2Q E;  3CME A;  3E0J A;  3BU2 A;  1YHQ A;  2UXC L;  4DNR B;  5IGF A;  4JW0 A;  1FJG L;  3HG9 A;  5J3B A;  3T4A C;  5GAH C;  3S1N H;  1XTD A;  4FYD A;  1J5E Q;  1DXM A;  2F0P A;  4DAP A;  1LV9 A;  2RA4 A;  2OQ0 A;  3Q0A A;  1CTM A;  3EFX D;  4GKJ Q;  1EWH A;  5K5P A;  2R7Z B;  1NR4 A;  2M9V A;  5C0X I;  2O5I C;  3WWV A;  3URY A;  1Y1V B;  3IRB A;  1M1K C;  1UE6 A;  3MAQ A;  1BNZ A;  5CR3 A;  4OEM B;  4AQY L;  3I70 A;  4QJF A;  2H5X A;  3KF6 B;  1YIJ A;  2HQL A;  3HKS A;  3RLF A;  2UUA L;  4LF6 L;  5BN4 A;  3ERO A;  3D31 A;  2D9U A;  2RF4 A;  1XPR A;  1ZKO A;  4X6A H;  3PO3 G;  1PH2 A;  2K4K A;  3U4V A;  3S2H B;  4RGO S;  2HQE A;  3A5Z B;  2KEN A;  4OGQ C;  5E7N A;  2WV6 D;  5HUR A;  1HFN A;  2PZW A;  3OMC A;  4IUU A;  4IZ8 A;  3BYT B;  4OL7 A;  1ZYR D;  5G3L F;  2UXB L;  4ZCK A;  1YIT A;  2Z1C A;  5FJ8 G;  3OWE B;  1S3O A;  2E2H H;  1SE3 A;  2B63 G;  3CMA A;  3GP7 A;  2CVR A;  1SYE A;  2NTS A;  3KUP A;  3PO3 H;  1HR0 Q;  2CW0 C;  1LTI D;  3A55 A;  1ENC A;  1EYG A;  4YCW A;  4A3D H;  1YNN C;  1Q82 C;  2ZXP A;  4B9X A;  4JI3 L;  1WVL A;  1IBL L;  4B3T L;  2VXW A;  4CDF C;  3D4R A;  3W5O A;  5FJ8 H;  1HZ9 A;  4YY3 L;  4G7O C;  1NSN S;  1TS5 A;  3CRK C;  2JEA I;  1X65 A;  1G2T A;  2BOS A;  2NUC A;  1LYL A;  2K05 A;  2GVB A;  5IGD A;  2JA5 G;  1XMO L;  2KEE A;  4LAA A;  4IUN A;  3GTP B;  4A3J G;  4LF5 L;  4BA1 I;  1ILP A;  3KOJ A;  1SFO B;  1AN8 A;  4X64 Q;  3F2U A;  1CKN B;  1TWH H;  2Z4I A;  3S1R H;  3PV0 A;  2HIV A;  1BR9 A;  2YYZ A;  1WOC A;  3TP7 A;  1EY6 A;  2DNC A;  1M8A A;  5JEA H;  2G9D A;  1TVX A;  4DR3 L;  2L15 A;  3H3V I;  4NXM L;  1BBW A;  5D14 A;  4CJ1 B;  1A3V A;  4N8X 1;  2Q2T A;  3I2Z A;  4DK3 C;  2FHT A;  1CKM A;  3CKI B;  4NPS A;  1EL0 A;  2JA5 H;  4IJH A;  4JI4 Q;  4P74 A;  1PZK D;  3NEM A;  4DV1 Q;  2N8N A;  5EKI A;  4A3J H;  4HMI A;  1H95 A;  4KN4 C;  3UI2 A;  2K03 A;  4K6L A;  2BDN A;  3NEN A;  2B8F A;  4RWS C;  5M5W B;  4A3M G;  3CQZ H;  3JAM L;  3PUW A;  3K7U C;  4L63 B;  2KEC A;  4DPG A;  4DFA A;  1S72 A;  3IAY A;  1R9T B;  2JA6 B;  4CKC A;  4M8A A;  3P20 A;  1UNS A;  4A3K G;  5J39 A;  5C3E H;  4MZ9 A;  3MFY A;  2SOB A;  1DYQ A;  2N55 A;  4JG2 A;  4X65 Q;  4HSV A;  1Q86 C;  1Z6H A;  2JYO A;  1ESF A;  2V4D A;  2JA7 B;  4JBM A;  4QB4 A;  4A3M H;  1ONL A;  1V1P B;  2MQH A;  2UXC Q;  1FJG Q;  1NY4 A;  1BCP D;  1PTO B;  4A3I G;  1PRT D;  2VUM B;  2AUK A;  4JPB W;  4A3K H;  3ULL A;  4R4I A;  2D2C C;  4PZ7 A;  2EYP A;  1EUJ A;  1T5X D;  2AQ2 B;  4B3R L;  2H1E A;  2BE5 D;  4BBS B;  2ID0 A;  3S2D B;  3A54 A;  4O1N A;  3IFD A;  4AQY Q;  2YV5 A;  5F2D A;  2XWJ B;  5DM7 3;  3SXH A;  5CMD A;  1LTL A;  2UUA Q;  2EYM A;  2XNA C;  5C44 B;  4LF6 Q;  3OW2 A;  1VQJ A;  4IAL A;  3HOY B;  4A3I H;  2HCI A;  4BBR B;  2BDO A;  3P75 A;  3S24 A;  2ZTC A;  1D5Z C;  4DUY Q;  2CKZ B;  2RKS A;  3BDL A;  1BBU A;  4UPA A;  1YJ9 A;  3E9H A;  3G48 A;  1SAP A;  2NTT A;  5IOD A;  1CFM A;  3TBI B;  1A6X A;  2E5L L;  2TMP A;  4DK1 A;  3J7Y W;  5JVG 3;  2R7Z H;  5G3L D;  2E2I H;  1E2Z A;  1B4O A;  2PW7 A;  2K5Q A;  1Y1V H;  1PH3 A;  3GTL B;  4YCV A;  2HT1 A;  4L6T B;  4B3M L;  4CJ0 B;  2EJG C;  2IX1 A;  2LSS A;  3D6C A;  4JBW A;  3J80 L;  1SE8 A;  4JI3 Q;  1UE1 A;  1IBL Q;  4B3T Q;  1PVO A;  1MJC A;  1KC8 C;  3GD7 A;  3HKZ G;  4YY3 Q;  4LFA L;  2JQO A;  3I72 A;  2MO0 A;  3S17 B;  5JJL A;  4AYB E;  4KHZ A;  5C0X G;  1PA6 A;  2PPB C;  4PZ6 A;  3S15 B;  2Q2I A;  1JQY D;  3J7A 5;  3S2H H;  2UUC Q;  4V19 0;  3HOW G;  2B2T A;  3MXG A;  3J80 E;  2CW0 D;  3FRP B;  3NWT A;  3OIP A;  3W3A A;  1YNN D;  1XMO Q;  5C0X J;  4LF5 Q;  3HOV G;  3FEW X;  1WTX A;  3GTK B;  1TR5 A;  2B29 A;  3IKJ A;  1GUS A;  2R7D A;  3R3O A;  2CQA A;  1S5D D;  4GKK L;  2O2L D;  2E2D C;  4KHV A;  4IUV A;  3VA7 A;  4HED A;  5C0X H;  3L0O A;  4R1J A;  4XYO A;  1SN8 A;  3PIO A;  1LAC A;  4DR3 Q;  2L4N A;  3IL8 A;  4UP7 A;  4NXM Q;  2KBN A;  3GQB A;  5IYB H;  1I6H B;  2H4O A;  1JJG A;  4G57 A;  3CCR A;  3S14 B;  5LMU Q;  2ZTE A;  4H7B A;  1YI2 A;  1VQK A;  3HOV H;  3I4L A;  1C8C A;  4H02 A;  2WII B;  2E2J B;  1TY0 A;  3GTG B;  1LLR D;  1T5E A;  3KBG A;  2KHJ A;  1G8Z D;  2KOL A;  4OHJ A;  3VYT A;  1JB3 A;  3KJP A;  4GOP B;  2Z4H A;  3GTP H;  4AH6 A;  3K6O A;  1EOV A;  1SJE D;  1WI5 A;  4Y52 H;  5FKA C;  3CW2 C;  1SFO H;  4DR7 L;  5I2X A;  1I4G A;  4NKL A;  3F2B A;  1X3E A;  1KQS A;  1VMC A;  4IPH A;  3J81 E;  3I4N B;  2XSC A;  3KDF A;  5FK9 C;  2HHH L;  2Q8R E;  1QG7 A;  5C3X A;  1X3Q A;  3DWA A;  3RLN A;  1H9J A;  2IHE A;  4WJ3 M;  1MGS A;  4CHT B;  3C1E A;  3I3C A;  1SE4 A;  1SYB A;  2QW7 A;  2JA6 G;  4DR4 L;  1SLJ A;  1B53 A;  1OXT A;  3FP9 A;  2ICE C;  4KI0 A;  4DAM A;  3CF5 A;  2AWO A;  2E8G A;  4L5S A;  3VYU A;  5EBC A;  1SJH D;  2QIL A;  1TS3 A;  3G6J B;  1X56 A;  1SEB D;  1STY A;  4CKB A;  5M5W H;  1UEA B;  4HSP A;  1LT3 D;  1PFS A;  3VR5 A;  4B3R Q;  1V1O A;  2MNA A;  2VS1 A;  1HFG A;  3QOJ A;  2ATW A;  1R9T H;  2JA6 H;  1DOK A;  5EKK A;  5IE8 A;  3DEP A;  1UAP A;  2WP8 J;  4IJL A;  3C46 A;  4PZ8 A;  4DK6 C;  3H6M A;  5E4W C;  1QNU A;  4O0A A;  2AKW B;  2EVB A;  3A56 A;  2F03 A;  2D0P A;  2D0O A;  5I6Y A;  3H3V H;  5C4X B;  1ASZ A;  3SHL A;  1PTO H;  2VUM H;  1WCM B;  1HZB A;  2PNR C;  5D65 A;  1KD1 C;  3MA2 B;  2JA8 B;  2E5L Q;  2Q8T A;  4ZRZ A;  2IY5 B;  3A7L A;  5M5X B;  3MZ5 A;  5I6W A;  4BBS H;  1I4R A;  2R93 B;  3DXJ C;  3S2D H;  4B3M Q;  1Z7T A;  1B2T A;  4DNI A;  2IPK D;  3ZYY X;  1DM0 B;  4CDE C;  5C44 H;  3HFZ B;  3HOY H;  3I4M G;  2AMC B;  1Q3L A;  4BBR H;  1HHV A;  2EXD A;  2V1C C;  4LFA Q;  3WOF A;  4A3C G;  1EYC A;  4KKT A;  5C4J B;  1NMF A;  2VQE L;  4JI1 L;  3K0X A;  3MWY W;  4O2D A;  5AJ3 L;  3KK7 A;  1YNJ C;  3G6E A;  3HRZ C;  2UUB L;  1JR0 D;  4JBJ A;  4GN4 B;  3AYH B;  1VDZ A;  1GUG A;  2RBM A;  1BVS A;  3GTL H;  4A3C H;  1K9M C;  1O7L A;  1YHB A;  1WTQ A;  1I50 B;  1WFQ A;  5LHY 1;  1W6K A;  5CV4 A;  3NP8 A;  4APV A;  2XGT A;  2N78 A;  2GVA A;  2NVQ B;  3DLL A;  2ZJQ A;  3A0J A;  3BZD B;  3K5O A;  1KRS A;  3ND9 A;  1VQ5 A;  3S15 H;  1UE7 A;  3VYS A;  1PV4 A;  4JI0 Q;  4KN7 C;  1QIL A;  2J7Z A;  1NUC A;  1G51 A;  1EFI D;  3C1F A;  3GTO B;  4UP8 A;  3CPW A;  2PYK A;  1I5F A;  5EBD A;  2N88 A;  5I9P A;  4A3E G;  1IBM Q;  1XJV A;  2ASB A;  3GTK H;  1E1O A;  3MXN A;  2LFN A;  5K36 G;  4DR7 Q;  4CDC C;  1HR0 W;  4NXN L;  1SNP A;  3L9A X;  2HHH Q;  1QUQ B;  4TSS A;  3MFG A;  2F0F A;  4ALP A;  2F0Q A;  2K32 A;  5HGQ A;  4XXE A;  3RN5 A;  1I6H H;  5GRO A;  2B2V A;  1B50 A;  4QUF A;  3R2T A;  4DR4 Q;  2MUY A;  4JBK A;  1A0I A;  1VQ8 A;  3TDQ A;  5IYC G;  2UU9 L;  4DV6 L;  2B2T C;  3S14 H;  1V8Q A;  4ME5 A;  4GN5 A;  3VR6 A;  4KY6 A;  3TZU A;  1K0R A;  3C3L A;  3DUZ A;  5K36 H;  4AYB B;  2F0W A;  2EY1 A;  1LAB A;  2ES2 A;  3GTG H;  4EGV A;  5M3F G;  1TWF H;  1X6O A;  4G4K A;  4PQX A;  5COR A;  4C56 C;  2OQK A;  3K5N A;  4LUZ A;  2Y0S E;  1XX8 A;  4K14 A;  4JOI A;  3N6R A;  1A3T A;  4LWC A;  2NVY B;  5LMN L;  2R92 B;  4DAY B;  3KF6 A;  5IYC H;  1L0X B;  1L0Y B;  2EOT A;  4LFC Q;  3CXC A;  1VMP A;  4GLV B;  3S1M B;  4BY7 G;  4NB3 A;  1SRU A;  1H9S B;  1QVF A;  4IUR A;  1N34 L;  1FNW A;  3S9W A;  3A7A B;  4DV7 L;  2R61 A;  5M3M B;  1F77 A;  4FXG C;  4RHR A;  4DUZ Q;  1S5C D;  1XNQ L;  1EQR A;  3ZJY C;  5A2Q L;  1PRT C;  3PGZ A;  4A3L G;  4IFD H;  2EIF A;  2X6G A;  5TSS A;  4A3F B;  2R7F A;  1K28 A;  2B2W A;  3J80 c;  1CQV A;  3TRZ A;  4J6H A;  1STG A;  3PUV A;  4IUP A;  4J15 A;  4TKO B;  1K3R A;  5FLX E;  2JA8 G;  1EQV A;  1HTP A;  5I4D A;  4A4I A;  2EYL A;  1EIY B;  2F4V L;  1DOM A;  5D3I B;  3S16 B;  3UE0 A;  1TS2 A;  2HDM A;  4A3L H;  3GDE A;  3OHX C;  4JI5 L;  5KND A;  1Q8I A;  2BA1 A;  1L1O B;  4E6I A;  3GV6 A;  1JE4 A;  1STH A;  3HOU B;  2L9H A;  2G5D A;  4C2M B;  2QDL A;  2VQE Q;  4JI1 Q;  2FFK B;  1I6V C;  5AJ3 Q;  1II3 A;  4JV5 L;  1RL2 A;  1SYC A;  2UUB Q;  5JJZ A;  2JA8 H;  3F1Z A;  3F2D A;  1LO5 D;  2F1M A;  2A68 C;  1STN A;  5M5X H;  1F9P A;  1CKN A;  3AU7 A;  3M3Y B;  3CD6 A;  3Q23 A;  4KLK A;  4R4O A;  2R93 H;  3NHH A;  4TVA B;  4ZLT F;  2F0N A;  1JT8 A;  2F0K A;  5C5L A;  1OXX K;  1K3B C;  3I55 A;  2RDH A;  4A3D G;  1EOT A;  4RHS A;  4Y7N B;  1JWM D;  1YNJ D;  2B39 A;  2CHB D;  3HZX A;  4ZQ3 A;  1AZP A;  3AB9 A;  1JIC A;  3H09 A;  2JK8 A;  2VNU D;  3OYY A;  2XVS A;  5C4J H;  2NYZ D;  4L5Q A;  1JCK B;  2I07 B;  4RAU C;  3NTK A;  1TWA H;  1AH9 A;  2KUM A;  5EAY A;  2K5D A;  2Q2U A;  2D5D A;  3RLO A;  5DLQ E;  2NZO A;  3PUZ A;  4HN7 A;  4I65 A;  5KNC A;  4IOC A;  1JJC B;  3AMU A;  5ELB A;  4A3B B;  4RMF A;  4IO9 A;  4A76 A;  2K50 A;  4DV0 L;  3NTI A;  1N33 L;  2K5H A;  4F8M A;  3KBX A;  1Z47 A;  4NXN Q;  3DWP A;  4GNX B;  2PO4 A;  1RCV D;  3OIQ A;  1STA A;  4B9W A;  1XPU A;  1EFW A;  2E74 C;  1YJW A;  2WKD A;  5JEA G;  1CSQ A;  1NBW A;  4L5T A;  1OXV A;  1V1P A;  2UU9 Q;  4DV6 Q;  5E4X A;  1HRJ A;  1XWE A;  2RSN A;  4KJN A;  5CV6 A;  3JAM i;  2PI2 A;  5T1G A;  2DY7 A;  2LXJ A;  1VQ9 A;  1MSH A;  4IUT A;  5JEA J;  1AP0 A;  4DV2 Q;  1EQT A;  3CCS A;  3GTO H;  4ODG A;  1P8L A;  2L55 A;  4XDX A;  2K33 A;  3K58 A;  2KQ3 A;  5IP9 H;  2F3W A;  3W2D A;  1PH6 A;  5NUC A;  4HIM A;  4LF7 L;  1ET6 A;  2AHO B;  2PMZ E;  1B70 B;  5LMN Q;  1Q7Y C;  1BKB A;  1HH2 P;  3K7A B;  4KD3 A;  3D4W A;  5CBE E;  2IJ0 A;  1KHI A;  5C3E G;  4R8N A;  5JPN C;  1IXR A;  1GD7 A;  1XTC D;  2PQA B;  4RGN A;  1EYA A;  1IW7 C;  2B2U A;  3AFP A;  1N36 L;  1N34 Q;  1EQQ A;  1ASY A;  2R92 G;  4DV7 Q;  4YWM A;  1QNK A;  2WB1 E;  1MD2 D;  5C5M A;  3HGB A;  4A75 A;  1XNQ Q;  1S4Z A;  1RTN A;  2VQF L;  1GOZ A;  1T9H A;  2JXM B;  2NB0 A;  4BXX G;  4C3J B;  2VB3 X;  4HJ8 A;  1Q1B A;  4BA2 I;  1FGB D;  1HA5 A;  3LWU A;  2RQX A;  2C5C A;  1I4P A;  5FOB B;  3U58 A;  3PO2 B;  2NVY H;  1I4Q A;  1CUK A;  2SEB D;  4XQN A;  1CA6 A;  1K83 B;  2EQS A;  4K2K A;  2R92 H;  4U67 3;  3NQT A;  5IP7 H;  2EZV A;  1JB7 A;  5C4Z A;  1JOK A;  4RFB A;  2B2V C;  2F4V Q;  3VYR A;  3OSO A;  3SGI A;  2WFW A;  3I73 A;  3S1M H;  1VQN A;  3O13 A;  4BXX H;  1U5K A;  1IYU A;  1A2T A;  4JI5 Q;  1P16 A;  1X3G A;  3VR4 A;  4ME3 A;  5KIX A;  1IKM A;  1HZC A;  1SNM A;  2F0G A;  1CKO A;  4DNT B;  3GTJ B;  4ZUI A;  2F0S A;  5M3M H;  1HXY D;  5ELN A;  4JV5 Q;  1Y8N B;  1L0W A;  2JA9 A;  2B8G A;  1ROD A;  4JOI C;  5C6A A;  1G6Z A;  1OTC A;  4LK1 C;  2P5Z X;  4RKL A;  1B8A A;  5BN5 A;  1VQ6 A;  1LTT D;  3J80 i;  1IHZ A;  1EZ6 A;  2R7Z G;  1QJO A;  1B9N A;  1Y1W B;  4Z9C B;  2Y0S B;  4CKE A;  3BVZ A;  3NK9 A;  2QGQ A;  1Y1V G;  1O7Z A;  4MIU A;  1XMQ L;  1W3S A;  3CP0 A;  3G7L A;  2EE1 A;  3W1B A;  3LX0 A;  3KFU A;  1NE3 A;  3S16 H;  2CWA A;  1WTV A;  1X32 A;  3LWE A;  1QZH A;  1LM0 A;  2UXB Q;  2MPM A;  4FXK C;  1A3U A;  3CCV A;  2KCM A;  3I8Z A;  2A68 D;  5FO8 B;  4C2M H;  2L12 A;  3NBH B;  3CC7 A;  5FLM H;  3CAM A;  2QF7 A;  3UDG A;  3KLS X;  4JCV E;  1JJ2 A;  3HOZ B;  1PZJ D;  2B2W C;  1KTK A;  4GOP A;  1RIP A;  3SK5 A;  3VR3 A;  1JOR A;  1AE2 A;  1Q46 A;  1IL8 A;  2CCZ A;  1N33 Q;  2WAQ E;  2K5W A;  4HJ7 A;  1H9R A;  1UUP A;  1BOS A;  2RDG A;  3UDF A;  4FF1 A;  3SVM A;  2X6L A;  4FNF A;  1X9N A;  1WTO A;  4Y7N H;  5IT9 E;  1YZ6 A;  5IOC A;  4A93 B;  4XT1 B;  4U68 A;  4OWW B;  5IYB G;  1RHP A;  4FDB A;  5IGE A;  4OX9 L;  4A3G H;  1D2B A;  1K8O A;  1SDF A;  1E1T A;  1CSP A;  2EY5 A;  2BH8 A;  1YNX A;  2CWP A;  4KV6 A;  1B7Y B;  2EJF C;  4YIJ A;  1GUW A;  5CV9 A;  4OON A;  3S1Q B;  4NDX A;  4POG A;  1O7Y A;  1VQP A;  4OWX B;  4B3S L;  4G7H C;  2MGS A;  5D3D A;  3Q24 A;  5ELF A;  4XQJ A;  2F0M A;  3QWN A;  1EIH A;  4LF7 Q;  2TSS A;  4Q5V A;  4ZAI A;  4IN3 A;  3I7F A;  3F2C A;  1NTG A;  1AZQ A;  3U9O A;  5CGK A;  2J0T D;  1GO3 E;  2MFI A;  2ZTD A;  5LL6 X;  3J7A V;  2Z6B A;  1O78 A;  2LMC B;  3K80 C;  2UXD L;  2MP1 A;  1BQQ T;  4IFD I;  3PIP A;  1SNQ A;  1F9R A;  4JI6 L;  2GN5 A;  2KCN A;  1PLF A;  5FLX c;  3L3O C;  2K14 A;  1EIF A;  4K8I A;  3J81 L;  3CCQ A;  1N36 Q;  1B3A A;  4N9T A;  3BJU A;  1I94 L;  3R2I A;  4PV1 C;  1ZXT A;  3C2P A;  3RZD B;  1CQF A;  4OIJ A;  4DV3 L;  2VQF Q;  2M2L A;  4K0K L;  3M7G A;  2ZJP A;  3OW7 A;  1DOL A;  2EYH A;  4X3S A;  5ELD A;  3MXU A;  2N49 A;  4IQZ A;  2ZJR A;  5IGB A;  3HOX B;  4WFN 3;  2DJF C;  4X62 L;  4QIW E;  1IW7 D;  1N8R C;  3V05 A;  1CI3 M;  1SBB B;  1KLG D;  1PMR A;  3EQL C;  3K7A H;  1D1I A;  5ELC A;  4H13 C;  4MTK A;  2FMC A;  4ID6 A;  2X69 A;  3H3V C;  1J8I A;  1PTO C;  1TT2 A;  2OT2 A;  4B08 A;  4OIK A;  2MO1 A;  1GUN A;  1ILQ A;  1NCV A;  2JA7 G;  1SR3 A;  1EY8 A;  5EQ0 A;  3KF8 B;  2OWO A;  1F2L A;  1U4L A;  1FD7 D;  2EXZ A;  2EPB A;  3A8I E;  5JVH 3;  1D1K A;  5LL6 S;  1YBY A;  2EYF A;  5EPJ A;  3R93 A;  1PTO F;  4DGZ A;  2VUM G;  2O4X A;  4OXP A;  3TP8 A;  4CGY B;  2JEB I;  1CK1 A;  3KYH C;  4IOA A;  1E22 A;  2LXK A;  1RD9 D;  3TSS A;  3PO2 H;  2F0U A;  1PXU A;  2ZT9 C;  4BBS G;  2JA7 H;  1V43 A;  1K83 H;  4KMU C;  2QEX A;  2PMZ B;  1XMQ Q;  1XYI A;  1FL0 A;  2CH4 W;  2B2U C;  4BY1 B;  4DR5 L;  5CV5 A;  1LT4 D;  5C44 G;  3I56 A;  4HJA A;  3VR2 A;  3HOY G;  3EVQ A;  4BBR G;  3ULJ A;  4CDD C;  2EYO A;  3NTH A;  3GTJ H;  3GO5 A;  1GVP A;  2FJ2 A;  1KL9 A;  2PQE A;  2WB1 B;  5E3F A;  3FKI B;  3AEV A;  3MXP A;  4PG3 A;  3OOC A;  4C3I B;  4DV5 L;  3MVV A;  3HKZ E;  1BCP B;  1V9P A;  2KVM A;  3NUC A;  1PFM A;  3TZD A;  1PRT B;  2XRS D;  1LTB D;  4M1U B;  4HR7 B;  1DJR D;  2A74 C;  1QUQ A;  2K01 A;  4P72 A;  2OTJ A;  2G9H D;  4TQU S;  1VF5 C;  2AUJ D;  1DON A;  3VA5 A;  3TS0 A;  4KTA A;  3K8A A;  1NNX A;  3I91 A;  5CC4 A;  2A8V A;  3AFQ A;  3UDX A;  4KY7 A;  4V0B A;  4OX9 Q;  1JMC A;  4RKB A;  1ENA A;  4JI7 L;  1D8L A;  3KLS A;  3PSI A;  1F9Q A;  2KED A;  3H94 A;  1CZW A;  1ML0 D;  4GLX A;  3NSW A;  1QCB D;  4GKK Q;  1S40 A;  1C9O A;  4A93 G;  1ICF B;  4RA8 A;  2DNE A;  4B3S Q;  2E2H B;  3SEB A;  1CA5 A;  2F52 A;  4K6D A;  4RGT A;  2K04 A;  1B9M A;  3HS0 C;  5IWA L;  3PO3 B;  4LF8 L;  4DAY A;  5M5Y B;  1QVG A;  4JI8 L;  4ZKC B;  2RHS B;  3ER0 A;  4ULL A;  4DR1 L;  1RF2 D;  3S17 H;  4LNQ A;  2UXD Q;  2XN9 C;  1D7Q A;  4HTH A;  1H9S A;  3RNU A;  4JI6 Q;  4J8Q A;  4LMQ D;  3KLW A;  1HNX L;  4NMZ A;  4A93 H;  3E5S A;  2MJ8 A;  5EGT A;  1I94 Q;  1HUM A;  3FPP A;  5ELO A;  2WAC A;  2B63 B;  1GHJ A;  2NN6 I;  3BDO A;  3NBI A;  4DV3 Q;  4KKU A;  4JI2 L;  4K0K Q;  4GOP C;  2F0T A;  1YJN A;  1AE3 A;  3RUZ A;  4RG1 A;  2J4X A;  1R4P B;  2K6A A;  3T1H L;  2LY7 A;  1J9O A;  4X62 Q;  4OO1 I;  3FVQ A;  2YU9 B;  2NWG A;  5COY A;  1BBX C;  5CBA E;  1C0A A;  4LF9 L;  1KIX A;  2WAQ B;  2F0E A;  5DM6 3;  3I4N G;  3QIA A;  1TQO A;  4LJZ C;  3K5L A;  3HOX G;  4AIM A;  3Q22 A;  2E2J H;  1L1O A;  1Y8O B;  5IGG A;  2ICI A;  2JA5 B;  5JJI A;  5EPK A;  4A3J B;  2XIW A;  3MC0 B;  3GTQ B;  3RZD H;  3R8B A;  3FPU B;  3ND8 A;  4EQO A;  3IFT A;  1B1Z A;  4FF4 A;  1CM9 A;  2I5L X;  4DK0 A;  4FF2 A;  4QGU A;  3P7J A;  3T53 B;  1U0L A;  3H91 A;  4IFD G;  4BWG B;  2QKI C;  1ZEQ X;  4DU9 A;  1CT1 D;  3I4N H;  1A62 A;  1QVC A;  3HOX H;  1PTO D;  1SXT A;  3MEH A;  4R4Q A;  1LUZ A;  4PMC A;  5LMN W;  4K5W A;  3LGJ A;  2E75 C;  2K52 A;  5EKL A;  4KD4 A;  3PUY A;  3QJY A;  4HID A;  1MIU A;  1VCI A;  2C35 B;  3M9B A;  4IFD J;  4HAE A;  4DR5 Q;  5DEH A;  2NZH A;  1XNR L;  3J81 j;  3MTS A;  1J6Q A;  4ZYS A;  3NE5 B;  5FLX L;  1QE6 A;  4A3M B;  3M4O B;  1FR3 A;  2MHV A;  1U4P A;  1WTR A;  3I90 A;  1PYS B;  4O42 A;  4P2C B;  5IT9 c;  1I4H A;  5C4X G;  1EEF D;  2KHS A;  2CQO A;  1A2U A;  2VW9 A;  1PH9 A;  3RZO B;  3HEJ A;  4LW1 A;  4N8F A;  5E1F A;  5GQO A;  4F88 A;  3SE0 A;  2FIN B;  2CH4 A;  4DV5 Q;  5ELE A;  1WCM G;  2VB2 X;  4ZKB B;  3A5U A;  2OF1 A;  3QO2 A;  1B44 D;  2AQ1 B;  2JE6 I;  3ULP A;  2HDL A;  3K5M A;  2SDF A;  2WB1 G;  1LT6 D;  4QY7 A;  3TEH B;  4POF A;  4GNX A;  1KNE A;  3CRL C;  2F3I A;  4I7Z C;  4QIW B;  2RSO A;  1NJI C;  3NXW A;  3GV3 A;  2R93 G;  2R3Z A;  1YEZ A;  4C3I G;  5KEE A;  1H9K A;  4QUC A;  1OXS C;  3ERQ A;  4A3I B;  4ZK9 B;  5C4X H;  3D6W A;  2OEO A;  4HIO A;  1IKL A;  1BCP F;  4EQN A;  2ZM6 L;  2L1B A;  2L0C A;  1DZ1 A;  1WCM H;  3RN2 A;  4JI7 Q;  2VL6 A;  3M4Y A;  1AFP A;  1A63 A;  1I3Q B;  4A3G B;  1VQ7 A;  2E76 C;  5IGC A;  1Y14 B;  2K5V A;  4Q0F A;  2EY6 A;  1U9R A;  3FKI H;  2JP1 A;  3UDI A;  4C3I H;  1SND A;  2PZT A;  1TXY A;  2E2I B;  3SK8 A;  1EY4 A;  1LTS D;  5IWA Q;  5CV7 A;  2KHI A;  4LF8 Q;  4KHP L;  2B3G A;  4DKA C;  4WRD A;  3K81 C;  1EY9 A;  4K5X A;  5KYL A;  4JI8 Q;  3J81 c;  4K8J A;  3Q8D A;  3GTM B;  2OTL A;  4DR1 Q;  1G6P A;  3T51 B;  2PQA A;  2RDF A;  1UE5 A;  4DR2 L;  1FNV A;  1EWI A;  1HNX Q;  1N9W A;  1VQ4 A;  4R8I A;  1K73 C;  2Z0S A;  4DUY L;  2K5N A;  4JI2 Q;  1JWU D;  1KDC A;  3E0E A;  4GZY C;  4ZUJ A;  1SSO A;  2Z6K A;  2B2Y A;  3BZC A;  1F2Z A;  1L2F A;  4LUO A;  3T1H Q;  3JC6 6;  1O80 A;  3HKZ B;  5IP9 G;  1I50 H;  3QOL A;  4QQB X;  1DCZ A;  3AQQ A;  2JN4 A;  5M5Y H;  4OWT B;  1HNW L;  4LF9 Q;  4XYQ A;  2NVQ H;  4FXD A;  3HOW B;  4MHE A;  1CHQ D;  4XQQ A;  2PZU A;  3B6Y A;  1PYB A;  4RCO A;  2YTV A;  3KJO A;  1MBY A;  1N32 L;  1GKH A;  5H1S E;  3T56 B;  1C4Q A;  2KJX A;  2B63 H;  3HOV B;  1KAA A;  1VQF A;  3N52 A;  2UUC L;  1SMY C;  4HMJ A;  4DV4 L;  2WAQ G;  2JJQ A;  1JC7 A;  1HZA A;  4RH6 A;  2ZXO A;  4LF4 L;  3F8T A;  1D5M C;  4AYB G;  4QF4 A;  2Q2H A;  1X55 A;  3LNN A;  2RVL A;  3ITP A;  1HNZ L;  3P1H A;  2SNS A;  4EX5 A;  4K5V A;  1K8A C;  2YU9 H;  4DF7 A;  2K28 A;  2NN6 G;  1MJE A;  1X3F A;  1KXL A;  2HUG A;  1OO9 B;  2WIN B;  3Q6S A;  5IP7 G;  4ABN A;  3ONA B;  1XNR Q;  2VZA A;  3V96 A;  1FVI A;  2BA0 A;  3SK6 A;  3BYY B;  1GM5 A;  3U4Z A;  1TWG B;  2JSO A;  4XT3 B;  1DD2 A;  5LMU L;  1TII D;  1GXD C;  1BXT A;  4DR6 L;  3NBH A;  3PF4 A;  3GTQ H;  4OO1 G;  1NR2 A;  1S5E D;  1VQL A;  1A15 A;  3A8K E;  5M3M G;  4HJ5 A;  2I0Q A;  2NN6 H;  1TS4 A;  4YHH L;  2AQ3 B;  2O5J C;  4X3T A;  1PZI D;  4MN3 A;  1EYD A;  1E3P A;  3PQI A;  1K0S A;  4HIK A;  1RKN A;  3H0G B;  4A3F G;  3CCL A;  3NEL A;  1ICW A;  1UWV A;  3DWQ A;  3OWF A;  1FNU A;  4OO1 H;  2R6G A;  3WDN A;  1K8G A;  1L1O C;  4KY5 A;  2ZM6 Q;  3JAM E;  1PH8 A;  1IYV A;  3M4O H;  2F0H A;  1U4R A;  4NP5 A;  1Z9F A;  3T1Y L;  2HIX A;  4UHV A;  3HOU G;  4A3F H;  1STB A;  4L8J A;  1IL2 A;  2PNH A;  3KLR A;  3RZO H;  4JYA L;  1MHW C;  5FLM G;  4LFB L;  1PHJ A;  3DM1 A;  4KK7 A;  4WJ4 A;  3M85 A;  4N9P A;  4XIG S;  5GAD C;  1I4X A;  5AFW A;  3U9S A;  4X66 L;  4KHP Q;  4A3G G;  1GUO A;  4GLA C;  3CCU A;  3PUX A;  1MI2 A;  4EVO A;  5GAG C;  3NQI A;  3K0Y A;  3V2T A;  3OMG A;  3HOU H;  5L37 A;  1IZ6 A;  4DR2 Q;  2DUD A;  4BS9 A;  2IT1 A;  1TWC B;  5JAV A;  1VQH A;  3CHB D;  3UE1 A;  4DXG A;  1FGU A;  1Q81 C;  4HCS A;  2IX3 A;  3A8J E;  2A6E C;  2F0O A;  3K59 A;  2IX0 A;  5IT9 L;  1I3Q H;  1QB5 D;  2WKC A; 
#chains in the Genus database with same CATH homology
 5FJ8 H;  1HZ9 A;  4YY3 L;  4DR5 L;  1X6O A;  5GAE C;  2OQK A;  4LUZ A;  5C44 G;  3I56 A;  4DV0 Q;  1X54 A;  2Y0S E;  4HJA A;  3M3Y H;  3GTG H;  4JOI A;  3HOY G;  4LWC A;  2JEA I;  1X65 A;  4BBR G;  3BZK A;  3ULJ A;  5LMN L;  4DAY B;  3KF6 A;  5IYC H;  3GTJ H;  4GNX C;  3GO5 A;  1GVP A;  4A3B G;  1LYL A;  1XPO A;  4LFC Q;  2OCE A;  3CXC A;  1MKH A;  2GVB A;  1E24 A;  1KL9 A;  4UP9 A;  3J81 i;  1HNW Q;  4GLV B;  2JA5 G;  3AEV A;  1XMO L;  4BY7 G;  4NB3 A;  3GTM H;  1IYJ B;  1SRU A;  4A3J G;  4LF5 L;  4BA1 I;  3FHW A;  4PG3 A;  3OTO L;  1QVF A;  4DV5 L;  3KOJ A;  3HKZ E;  1V9P A;  4X64 Q;  1N34 L;  2BH2 A;  1CKN B;  3TQY A;  1TWH H;  4DV7 L;  3PV0 A;  2HIV A;  3S1R H;  2YYZ A;  1WOC A;  1N32 Q;  4DUZ Q;  1XNQ L;  1EQR A;  4DR3 L;  1QUQ A;  3ZJY C;  2L15 A;  4DV4 Q;  3H3V I;  4P72 A;  3PGZ A;  4A3L G;  4NXM L;  2OTJ A;  1BBW A;  4TQU S;  4Y52 H;  2EIF A;  4A3B H;  2Q2T A;  3I2Z A;  4DK3 C;  2IHF A;  4LF4 Q;  1CKM A;  4NPS A;  4IPG A;  3TS0 A;  3K8A A;  2R7F A;  4IJH A;  4P74 A;  3J80 c;  3NEM A;  4DV1 Q;  2JA5 H;  2N8N A;  2I5H A;  4A3J H;  1PH7 A;  2A8V A;  3AFQ A;  3TRZ A;  3UDX A;  1H95 A;  3PUV A;  4J15 A;  4OX9 Q;  4P73 A;  1JMC A;  5BR8 L;  1HNZ Q;  4JI7 L;  1D8L A;  3PSI A;  3NEN A;  1K3R A;  2JA8 G;  4A4I A;  1EIY B;  4R4C A;  4GLX A;  4A3M G;  2F4V L;  3CQZ H;  3PUW A;  3UE0 A;  4GKK Q;  1S40 A;  1C9O A;  4A93 G;  3K7U C;  1PH5 A;  3HOW H;  4DPG A;  4B3S Q;  4A3L H;  1S72 A;  3GDE A;  4JI5 L;  2F52 A;  4GN3 B;  2BA1 A;  1L1O B;  4A3K G;  4HJ9 A;  5IWA L;  5C3E H;  4MZ9 A;  2VQE Q;  3J7Z C;  4LF8 L;  4JI1 Q;  5AJ3 Q;  4DR6 Q;  1QVG A;  4JV5 L;  1RL2 A;  1A8V A;  4JG2 A;  4JI8 L;  4X65 Q;  1Q86 C;  2RHS B;  2K75 A;  2Z6K C;  3ER0 A;  3W1G A;  4DR1 L;  2UUB Q;  3S17 H;  4JI0 L;  4LNQ A;  2JA8 H;  2UXD Q;  3F1Z A;  4JBM A;  1D7Q A;  3F2D A;  3RNU A;  4JI6 Q;  4A3M H;  4YHH Q;  2MQH A;  3KLW A;  1HNX L;  5M5X H;  4A93 H;  1FJG Q;  2UXC Q;  1CKN A;  3M4P A;  1NY4 A;  1O7I A;  3CD6 A;  1I94 Q;  4KLK A;  4R4O A;  5ELO A;  1VQM A;  2RHQ B;  1IBM L;  1E7Z A;  4A3I G;  2R93 H;  3RR5 A;  1KAW A;  2NN6 I;  4TVA B;  3VDY A;  4A3K H;  1JT8 A;  3ULL A;  4R4I A;  4DV3 Q;  4JI2 L;  1OXX K;  3CC2 A;  4K0K Q;  3I55 A;  4PZ7 A;  5IY0 A;  4GOP C;  1EUJ A;  3PO2 G;  4A3D G;  1YJN A;  1AE3 A;  4B3R L;  4RG1 A;  2A19 A;  2N3S A;  2ID0 A;  3T1H L;  2JK8 A;  2VNU D;  3OYY A;  3H0G G;  5C4J H;  4X62 Q;  4AQY Q;  2YV5 A;  4L5Q A;  1TWG H;  4OO1 I;  1TWA H;  2ALY B;  1LTL A;  2UUA Q;  4LF6 Q;  1AH9 A;  3OW2 A;  1VQJ A;  4XTC S;  5EAY A;  4C3J H;  3T1Y Q;  4A3I H;  1C0A A;  2Q2U A;  4LF9 L;  4YWK A;  4R4T A;  1KIX A;  3RLO A;  5DLQ E;  1VQC A;  3S24 A;  2NZO A;  4JYA Q;  3PUZ A;  4IOC A;  1JJC B;  1VQO A;  3I4N G;  4LFB Q;  1SRO A;  2ZTC A;  2KCT A;  3EBE A;  3HOX G;  4AIM A;  1Q12 A;  4P71 A;  2E2J H;  4DUY Q;  1L1O A;  4GS3 A;  2CKZ B;  4RMF A;  3G4S A;  4IO9 A;  4A76 A;  2K50 A;  5IYD G;  5JJI A;  4DV0 L;  1N33 L;  1BBU A;  2K5H A;  3DM3 A;  4UPA A;  1Z47 A;  3E9H A;  3G48 A;  4X66 Q;  1YJ9 A;  4NXN Q;  3RZD H;  3H0G H;  4GNX B;  4QL5 A;  1VQA A;  2E5L L;  1XPU A;  1EFW A;  1Y1W G;  2I5L X;  2R7Z H;  2Y0S G;  1UEB A;  5JEA G;  1CSQ A;  4LFC L;  4QGU A;  1YJW A;  1YVC A;  1NBW A;  2E2I H;  1U0L A;  4L5T A;  4IFD G;  1OXV A;  4MNO A;  1KRT A;  2UU9 Q;  4DV6 Q;  1Y1V H;  3I4N H;  1PH3 A;  1SMX A;  1A62 A;  4YCV A;  2HT1 A;  1QVC A;  4B3M L;  3HOX H;  2QA4 A;  3STB C;  2IX1 A;  3JAM i;  2PI2 A;  2LSS A;  1LUZ A;  4R4Q A;  4JBW A;  5LMN W;  2LXJ A;  1SE8 A;  3LGJ A;  1VQ9 A;  4JI3 Q;  1UE1 A;  3ICE A;  1IBL Q;  2K52 A;  5JEA J;  4B3T Q;  5IYD H;  1PVO A;  3PUY A;  1MJC A;  4JC0 A;  4DUZ L;  4DV2 Q;  1MIU A;  1VCI A;  3CCS A;  2C35 B;  4HID A;  3M9B A;  1KC8 C;  3GD7 A;  3GTO H;  3HKZ G;  4YY3 Q;  4DR5 Q;  3E9I A;  1P8L A;  4LFA L;  5JJK A;  2JQO A;  2MO0 A;  2NZH A;  1IBK L;  3J81 j;  1XNR L;  5IP9 H;  5JJL A;  1Y1W H;  1J6Q A;  1PH6 A;  4AYB E;  4KHZ A;  5C0X G;  1PA6 A;  4PZ6 A;  4HIM A;  2Q2I A;  3S2H H;  4LF7 L;  1G29 1;  2XTI A;  4MTN A;  1C7Y A;  3HOZ G;  2AHO B;  2PMZ E;  1B70 B;  3TRE A;  5LMN Q;  1Q7Y C;  2UUC Q;  3HOW G;  2AWN A;  1BKB A;  1HH2 P;  1PYS B;  3KDF B;  5IT9 c;  1VQI A;  1KHI A;  5C4X G;  5C3E G;  2CQO A;  2VW9 A;  3J7A 5;  1PH9 A;  4LW1 A;  5GQO A;  1XMO Q;  5C0X J;  1GD7 A;  1IXR A;  2PQA B;  3OTO Q;  4LF5 Q;  3HOV G;  4DV5 Q;  2A1A A;  2B29 A;  3AFP A;  1N36 L;  1WCM G;  1N34 Q;  2R7D A;  1V1Q A;  2CFM A;  4P75 A;  1EQQ A;  1ASY A;  2R92 G;  4DV7 Q;  4GKK L;  3A5U A;  4YWM A;  1TWC H;  1VQD A;  2WB1 E;  1J5E L;  2JE6 I;  3ULP A;  3L0O A;  4A75 A;  4R1J A;  3HOZ H;  2WB1 G;  4QY7 A;  3TEH B;  1VQG A;  4POF A;  1XNQ Q;  1SN8 A;  3PIO A;  1T9H A;  2VQF L;  4GNX A;  4DR3 Q;  2F3I A;  4GKJ L;  3PCO B;  1NJI C;  4UP7 A;  4NXM Q;  2KBN A;  1YEZ A;  5IYB H;  4BXX G;  2R93 G;  1OXS C;  4HJ8 A;  4BA2 I;  1Q1B A;  1JJG A;  5C4X H;  4HIO A;  3CCR A;  5LMU Q;  2ZTE A;  2ZM6 L;  1HJP A;  3CCJ A;  1YI2 A;  1VQK A;  3HOV H;  3U58 A;  2NVY H;  4BXX H;  1WCM H;  1CUK A;  4H02 A;  5BR8 Q;  3RN2 A;  2VL6 A;  4JI7 Q;  3I4M H;  2EQS A;  2R92 H;  1A63 A;  2KHJ A;  4PMW A;  5IP7 H;  1JB7 A;  1VQ7 A;  1Y14 B;  2F4V Q;  2K5V A;  3CCE A;  3KJP A;  3SGI A;  2WFW A;  3FKI H;  3S1M H;  4GOP B;  3H15 A;  3I4O A;  3CCM A;  1VQN A;  1Q1E A;  1EOV A;  4AH6 A;  1WI5 A;  3GTP H;  3UDI A;  1U5K A;  4C3I H;  4C3H H;  4JI5 Q;  1P16 A;  1VQE A;  1X3G A;  1TXY A;  3ERS X;  3CW2 C;  4YWL A;  4ME3 A;  1SFO H;  4DR7 L;  4IPC A;  1HZC A;  3F2B A;  1CKO A;  1PH1 A;  1X3E A;  1KQS A;  5IWA Q;  2KHI A;  2YTY A;  4IPH A;  5M3M H;  4LF8 Q;  4KHP L;  2B3G A;  3KDF A;  4DKA C;  3K81 C;  5ELN A;  4IPD A;  2HHH L;  3S1Q H;  3D0F A;  4JV5 Q;  2I5M X;  4JI8 Q;  3J81 c;  4L5R C;  1L0W A;  3RLN A;  3Q8D A;  2IHE A;  3JAM c;  4UY8 C;  4WJ3 M;  2JA9 A;  2OTL A;  4DR1 Q;  1G6P A;  4JOI C;  2D62 A;  2PQA A;  1OTC A;  2JA6 G;  4DR4 L;  1UE5 A;  4DR2 L;  1SLJ A;  1B8A A;  1VQ6 A;  1EWI A;  1OXT A;  3L7Z C;  3J80 i;  1HNX Q;  1HR0 L;  3FP9 A;  4DAM A;  4KI0 A;  3CF5 A;  2R7Z G;  1N9W A;  2AWO A;  1VQ4 A;  2E8G A;  4L5S A;  1K73 C;  4LUV A;  2Z0S A;  2QGQ A;  1Y1V G;  1JE5 A;  4DUY L;  1WJJ A;  1X56 A;  1W3S A;  1DGS A;  2K5N A;  3CP0 A;  4JI2 Q;  1XMQ L;  5M5W H;  3E0E A;  3W1B A;  3KFU A;  1WYD A;  1NE3 A;  3S16 H;  1PFS A;  2CWA A;  2Z6K A;  4B3R Q;  2MNA A;  1QZH A;  2PI2 E;  1LM0 A;  2VS1 A;  1L2F A;  3BZC A;  1W2B A;  4LUO A;  2UXB Q;  2ATW A;  1R9T H;  2JA6 H;  3T1H Q;  5IE8 A;  3CCV A;  3EN2 A;  3JC6 6;  1VQB A;  2KCM A;  2WP8 J;  4IJL A;  3W5O A;  3G71 A;  5IP9 G;  1I50 H;  4PZ8 A;  4C2M H;  4QQB X;  3NBH B;  3CC7 A;  4DK6 C;  5FLM H;  3CAM A;  3AQQ A;  5M5Y H;  4A3E H;  4OWT B;  3UDG A;  1HNW L;  4LF9 Q;  4JCV E;  1QZG A;  1JJ2 A;  3CC4 A;  4O0A A;  2AKW B;  2JA7 H;  2NVQ H;  2RCN A;  2D0P A;  2VY3 A;  4GOP A;  1RIP A;  2D0O A;  4EQ5 A;  3B6Y A;  4X64 L;  3L2P A;  4DV2 L;  1PYB A;  3H3V H;  2YTV A;  3KJO A;  1ASZ A;  1N32 L;  1AE2 A;  1Q46 A;  1GKH A;  5H1S E;  2CCZ A;  1N33 Q;  2NVT H;  2B63 H;  2WAQ E;  3CPF A;  4HJ7 A;  1VQF A;  2VUM H;  1HZB A;  3UDF A;  4DV4 L;  1KD1 C;  2WAQ G;  3MEF A;  2UUC L;  2E5L Q;  2JJQ A;  1Q8K A;  1HZA A;  2DGY A;  4LF4 L;  1X9N A;  2YTX A;  3EIV A;  3M7N A;  2IY5 B;  3F8T A;  4AYB G;  4Y7N H;  4JI4 L;  1YZ6 A;  4DV1 L;  3PF5 A;  4OWW B;  2Q2H A;  1X55 A;  5IYB G;  1NMG A;  4BBS H;  3TS2 A;  4FDB A;  5HY6 A;  4OX9 L;  4BY1 G;  5M3F H;  3S2D H;  4B3M Q;  1PH4 A;  1HNZ L;  1VS0 A;  1E1T A;  1CSP A;  4EX5 A;  4DNI A;  1K8A C;  2YU9 H;  3M4Q A;  2BH8 A;  1YNX A;  2CWP A;  5C44 H;  2NN6 G;  3A74 A;  3HFZ B;  1MJE A;  1X3F A;  1B7Y B;  3HOY H;  4OON A;  3I4M G;  1KXL A;  4POG A;  2AMC B;  2NVX H;  4BBR H;  1VQP A;  2EXD A;  2V1C C;  4LFA Q;  4OWX B;  4B3S L;  5IP7 G;  1IBK Q;  1XNR Q;  1OXU A;  1M90 C;  3MXN B;  4A3C G;  2VZA A;  1FVI A;  2BA0 A;  1GM5 A;  3FKI G;  3U4Z A;  4LF7 Q;  1NMF A;  2VQE L;  3U50 C;  5LMU L;  4JI1 L;  4BY7 H;  3K0X A;  5AJ3 L;  4O2D A;  4DR6 L;  3I7F A;  3F2C A;  3PF4 A;  1NTG A;  4X65 L;  4BY1 H;  3GTQ H;  4OO1 G;  3G6E A;  1VQL A;  2MFI A;  1GO3 E;  2ZTD A;  3STB D;  2UUB L;  3K80 C;  4YCU A;  5M3M G;  4HJ5 A;  2UXD L;  4JBJ A;  4IFD I;  2I0Q A;  3PIP A;  4GN4 B;  2FXQ A;  1YHA A;  4JI6 L;  2GN5 A;  4YHH L;  5FLX c;  3CME A;  2K14 A;  1EIF A;  3AYH B;  3BU2 A;  3CCQ A;  1YHQ A;  1N36 Q;  2UXC L;  1FJG L;  1E3P A;  3BJU A;  5J3B A;  4HIK A;  1I94 L;  5GAH C;  3S1N H;  1BVS A;  1XTD A;  3GTL H;  4A3C H;  1J5E Q;  1K9M C;  4A3F G;  3CCL A;  3NEL A;  1YHB A;  4DV3 L;  2OQ0 A;  2VQF Q;  1UWV A;  4K0K L;  4GKJ Q;  1WFQ A;  2ZJP A;  2R6G A;  4APV A;  2XGT A;  5C0X I;  1K8G A;  2N78 A;  1L1O C;  2GVA A;  3WWV A;  2N49 A;  3IRB A;  3DLL A;  2ZJR A;  1M1K C;  2ZJQ A;  3A0J A;  2ZM6 Q;  1UE6 A;  1KRS A;  4X62 L;  1VQ5 A;  4AQY L;  1PH8 A;  1UE7 A;  4QIW E;  4QJF A;  2H5X A;  3KF6 B;  1N8R C;  3S15 H;  1YIJ A;  2HQL A;  3HKS A;  3M4O H;  1PV4 A;  3RLF A;  4JI0 Q;  2UUA L;  4LF6 L;  4IFD J;  3K7A H;  1Z9F A;  3D31 A;  3T1Y L;  2HIX A;  3HOU G;  2RF4 A;  1G51 A;  4A3F H;  1XPR A;  1IL2 A;  4UP8 A;  2PNH A;  4X6A H;  3CPW A;  3RZO H;  3PO3 G;  4JYA L;  5FLM G;  1I5F A;  1PH2 A;  4LFB L;  1PHJ A;  4A3E G;  2K4K A;  1IBM Q;  3U4V A;  1XJV A;  2ASB A;  3GTK H;  1E1O A;  4WJ4 A;  5E7N A;  3A5Z B;  2KEN A;  2MO1 A;  4XIG S;  5GAD C;  3M85 A;  4DR7 Q;  5K36 G;  2JA7 G;  1SR3 A;  1HR0 W;  4X66 L;  4NXN L;  3KF8 B;  2OWO A;  4KHP Q;  4A3G G;  2UXB L;  1YIT A;  2HHH Q;  4GLA C;  1QUQ B;  3CCU A;  5FJ8 G;  3PUX A;  4JI4 Q;  1YBY A;  5GAG C;  1S3O A;  4ALP A;  2E2H H;  2B63 G;  3CMA A;  5HGQ A;  3RN5 A;  1I6H H;  5GRO A;  2VUM G;  4OXP A;  3HOU H;  4DR4 Q;  1IZ6 A;  4DR2 Q;  2DUD A;  4JBK A;  1A0I A;  2JEB I;  1VQ8 A;  3KYH C;  5IYC G;  2UU9 L;  2IT1 A;  4DV6 L;  3S14 H;  1HR0 Q;  3PO3 H;  4IOA A;  4GN5 A;  1E22 A;  2LXK A;  1VQH A;  1EYG A;  3UE1 A;  4YCW A;  1Q81 C;  1FGU A;  1K0R A;  3PO2 H;  4A3D H;  1Q82 C;  4BBS G;  4JI3 L;  1V43 A;  1K83 H;  1IBL L;  2QEX A;  2IX0 A;  1XMQ Q;  2ES2 A;  4B3T L;  1I3Q H;  5M3F G;  1FL0 A;  4A3G H;  1TWF H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...