5M3FH

Yeast rna polymerase i elongation complex at 3.8a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
144
structure length
131
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of RNA polymerase I transcribing ribosomal DNA genes.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase I subunit RPA190
total genus 21
structure length 131
sequence length 144
ec nomenclature
pdb deposition date 2016-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m3fH00
4A3GH 1IXRA 2F4VQ 2R92H 2WB1G 2R7ZH 4PZ7A 1E1TA 2KHJA 1VS0A 4JOIC 2JA7G 2WB1E 5GAHC 2A8VA 3OYYA 1LM0A 2CFMA 2NZHA 1IBML 2Z6KA 4HIMA 2UXDL 3HKZG 1B70B 1QVGA 1WOCA 4ALPA 1JJGA 4DR5L 1JE5A 3PF5A 1YHBA 4DV5L 4YCUA 1VQHA 5AJ3Q 1I3QH 4OX9L 5H1SE 2ZJPA 1NY4A 1P8LA 3K8AA 4DUYL 5IP9G 2KENA 2R92G 3EBEA 3KYHC 1ASZA 4LF8Q 1FJGQ 4NXML 1A8VA 1KQSA 2CCZA 4IJHA 1VQ5A 4JI6L 3M4QA 3CF5A 2KHIA 3FKIH 4TQUS 2VY3A 1PHJA 3RN5A 5IT9c 1L1OA 3CQZH 4A3BG 4DR7Q 3W5OA 2UUAQ 2IX1A 3RR5A 3AEVA 1K9MC 4LUOA 4DR1L 2NN6G 4IJLA 4P74A 1I50H 1N36Q 4GN4B 2PQAA 4OWXB 2JEBI 1OXUA 2BA1A 1S40A 3GTPH 1V43A 2ZJRA 1XNQL 1B7YB 5FLMH 3CW2C 4POGA 2HIXA 1Q12A 2RHSB 2JA5H 3HOZH 2VQEL 4BBSH 4DK3C 3GO5A 3UE1A 4TVAB 4YY3Q 1Y1WH 3S1MH 5C4XG 3U50C 2ZTDA 4GNXA 1HR0Q 3SGIA 4BXXG 2LXKA 4JI4L 4KLKA 4AQYL 4H02A 4A3DH 1CKMA 4LF6Q 1NMFA 4R4OA 1K83H 2YTYA 4DR4Q 1N36L 2EXDA 2LXJA 1Z47A 4X64Q 3KFUA 1X65A 2UUCL 1N33L 1X56A 1XJVA 3GTMH 1SRUA 3CC2A 3CMEA 3JAMi 1OXVA 3S1RH 3HOYG 1VQNA 3HOWH 4PMWA 1MKHA 2YTXA 4K0KQ 1E3PA 1Q46A 4GOPB 3H0GG 1WFQA 4GN3B 3CCSA 1YITA 3I4NG 4A3KG 1EIYB 5LMNL 3PUZA 1ASYA 4JI0L 4JBJA 4LWCA 3CPFA 4IO9A 3W1BA 4DR4L 1M1KC 4B3MQ 1VQ9A 1PA6A 4UP8A 1PVOA 1VQLA 1J5EL 1VQOA 1JB7A 3J80i 1N34L 1Q81C 1XNRQ 1EQRA 2XTIA 2Y0SG 5C44H 4JYAQ 3EN2A 1IYJB 4QIWE 4X62L 3GTOH 1RL2A 1H95A 2CWPA 3PV0A 4P75A 4HJAA 1TWGH 5BR8Q 1S72A 1VCIA 1IBLQ 2HHHQ 3H15A 4O0AA 2MNAA 5M5XH 4A93G 3AYHB 1LYLA 4LNQA 2R7DA 2MO1A 4IFDG 1AH9A 2YYZA 1SR3A 2PI2A 4B3TL 4GKKL 1VQKA 4R1JA 3OW2A 4Y7NH 1SE8A 2AKWB 5GQOA 3PIOA 2JA9A 4JV5Q 2ZTCA 4R4CA 4X6AH 2K5HA 1V9PA 4AYBG 2QA4A 1Q86C 4JI4Q 2ASBA 4A3LG 4R4QA 4B3RL 1YHQA 4R4IA 1VQJA 4LFBQ 3HOXG 2K14A 5IYCH 2VL6A 3ULJA 2GN5A 2HHHL 4OX9Q 1VQMA 1B8AA 2UUCQ 1EFWA 4LFAQ 4C3HH 3I4MG 1Y14B 1G51A 1N8RC 2Z0SA 3KLWA 2F4VL 4OO1I 4L5QA 4EX5A 3PUYA 5LMNW 3GD7A 4DV7L 4POFA 1XMQL 4B3SL 4JBMA 3S15H 3G6EA 2VW9A 4UPAA 1K8AC 3M3YH 4LF9L 1YJWA 1OXXK 2JA6G 2OCEA 4OXPA 3S24A 2E2IH 2AHOB 2WP8J 1RIPA 4A3CH 4P71A 3ER0A 5HY6A 4DUZQ 4DR2Q 3KOJA 1HZ9A 3K80C 1YJNA 1TWHH 1HR0L 2JA7H 3M7NA 2EIFA 1UE6A 4DKAC 3F2DA 2JA8G 1KIXA 3GTJH 3I55A 1HNXL 3S2DH 2JE6I 3PGZA 2R7FA 4DUYQ 4A3EH 2JQOA 5GAEC 5AJ3L 5M3FH 2PNHA 2VNUD 4LF9Q 4LF6L 3G48A 2ALYB 4DV1Q 1PH1A 3CCUA 5M3MG 3U4ZA 3VDYA 3HOZG 4AQYQ 4LF5L 3PCOB 4MNOA 4GKJQ 1OTCA 1Y1VG 5IYBH 4MZ9A 4YHHL 1NJIC 3TRZA 3A5ZB 2K5VA 2Y0SE 4YCWA 1EWIA 3MEFA 4DUZL 4DR2L 2K75A 2E5LL 3NEMA 3RN2A 1X3EA 1PH3A 4BXXH 2B29A 5J3BA 4IFDI 3U4VA 5LMUQ 1AE3A 2KBNA 3HKSA 3PO2G 3KJOA 4IOAA 3DM3A 1GKHA 2HT1A 5M3FG 3S1QH 4KHPL 4B3ML 4OWWB 3BU2A 3S16H 3EIVA 2GVAA 1VQBA 1WJJA 1BBWA 3DLLA 1PH8A 3IRBA 4LUZA 4IFDJ 4BY1G 2D0PA 4LFCQ 3RLFA 3CXCA 3PUXA 3RLOA 4DV6Q 2ZM6Q 1QVFA 2ES2A 2H5XA 1GVPA 4DV3Q 1TWAH 4NXMQ 4IPGA 4WJ3M 1PH4A 1I6HH 1DGSA 1WYDA 3H3VH 1IL2A 1EUJA 1MJCA 1HR0W 1A62A 4GLAC 2VUMG 4BA2I 2KCTA 1KRSA 3BZCA 4P72A 2LSSA 3TREA 3I7FA 5JJIA 3AFPA 4JI1Q 1GD7A 2UUBQ 4BY7G 1HNWQ 3H3VI 2Q2HA 4A3GG 2F3IA 3CAMA 1XTDA 4DV1L 5GROA 4A3KH 4JBWA 1PYSB 1G291 1FL0A 2NVTH 1I5FA 5IP7H 3J81i 4A75A 4JI2L 2R93H 4DV3L 2JA8H 1G6PA 3E0EA 5IYDH 4A4IA 4GOPC 1CUKA 3NBHB 3PIPA 3E9IA 3Q8DA 1HZBA 3WWVA 2RCNA 3J81j 1YBYA 4DV2L 1IBLL 4RMFA 2B63G 2HQLA 4X64L 2EQSA 4BBSG 2RHQB 2R7ZG 1D7QA 2Q2IA 1QZHA 3F2BA 2CQOA 2E2HH 5ELNA 3CPWA 2NVXH 3M9BA 3PUWA 3UE0A 1VQ7A 4DR7L 1T9HA 4B3TQ 1GO3E 4GKKQ 1WCMG 2N49A 4XTCS 4YWLA 1KL9A 4BY1H 3A0JA 3UDXA 1IZ6A 1QZGA 2OQKA 2C35B 3FHWA 3J7ZC 4UP9A 4JI0Q 3PUVA 5K36G 4HJ5A 1SFOH 5IY0A 4GOPA 2K52A 3T1HL 3HKZE 1CKNA 2QEXA 2ZM6L 5IP9H 2VS1A 3HFZB 3HOYH 2R6GA 1X6OA 3PSIA 4X66L 1L1OB 1UE1A 1EIFA 1YI2A 1K73C 1N34Q 2MO0A 1N9WA 4JI1L 5DLQE 1E24A 4DAYB 3KF6A 5JEAJ 4A93H 1HJPA 4X65L 1Y1WG 1IBKL 1C0AA 3CCQA 3KDFB 2D0OA 5IWAQ 1I94Q 4DR6L 2WAQE 4GLVB 1L2FA 2F52A 4R4TA 1YIJA 4A3LH 3W1GA 4JCVE 2B63H 2QGQA 4L5SA 1FJGL 3CCJA 1W2BA 3CCRA 5HGQA 2MFIA 4DR1Q 1VQIA 1Z9FA 4QQBX 3TS0A 4GS3A 2OWOA 1NMGA 3K81C 1XNQQ 2I0QA 4LW1A 4KHPQ 3KF8B 2N8NA 4JOIA 3CCVA 1HNXQ 3CCLA 1CKNB 3G4SA 3KJPA 1N32Q 3I4NH 2ID0A 3I2ZA 2FXQA 1SROA 4ME3A 3J80c 3FP9A 4YY3L 1X9NA 1IBMQ 2I5LX 4AH6A 4DNIA 4JI7L 5JJLA 3S17H 4GN5A 5E7NA 2GVBA 4LF4L 5C0XI 4DV0L 4JI3Q 3PO3H 4JI5Q 3RZOH 3ULPA 3HOWG 4LF8L 4LF5Q 1O7IA 2VQFL 4DR5Q 1PH5A 3S2HH 1L0WA 1YZ6A 3TEHB 1XMQQ 2JA5G 1X55A 4NXNQ 1WI5A 1YJ9A 3OTOL 3CD6A 3AFQA 4MTNA 3RZDH 4OWTB 3GTKH 4UP7A 1JMCA 2DGYA 3ERSX 2CWAA 2RF4A 3NELA 4HIDA 2UUAL 3HOVH 3J7A5 1XPOA 3K7UC 1KRTA 3UDGA 2NZOA 4BBRG 2YTVA 1XPRA 3PF4A 3BJUA 4JG2A 4YWMA 4K0KL 1HZAA 4JI8Q 5C44G 4JI5L 4JI2Q 4DR6Q 4A3FH 4QGUA 1KC8C 4LF7Q 4A3JG 1X3FA 2NN6I 3S14H 3UDIA 1HNZL 2AWOA 2UU9Q 2VQEQ 4Y52H 3TQYA 1SLJA 1XMOQ 4YHHQ 3GDEA 4A3MG 2IX0A 1BKBA 2IHEA 2IHFA 3GTLH 1J5EQ 4QY7A 1K8GA 4DV7Q 4LUVA 5ELOA 1U0LA 2I5MX 1QVCA 2R93G 1SN8A 1VQFA 4LFAL 3A74A 1VQ6A 3UDFA 1YEZA 3D31A 3E9HA 2IY5B 1A0IA 1TXYA 1QUQA 2AMCB 4BA1I 2BA0A 1A63A 2VQFQ 5JEAG 4HJ9A 1VQDA 1VQAA 3KDFA 5IE8A 1C7YA 3L0OA 4IOCA 2K4KA 1WCMH 4JV5L 1K3RA 3FKIG 2VUMH 5EAYA 4HIOA 3OTOQ 4C2MH 3HOUG 3K0XA 4C3JH 5IYDG 2UXBQ 3F8TA 2L15A 4X66Q 3L2PA 1YHAA 4PZ6A 3U58A 1EOVA 3B6YA 5FLXc 3A5UA 2MQHA 4IPHA 4DV4L 1TWFH 3STBC 3G71A 5FJ8G 2A19A 4KI0A 5M5YH 1HH2P 5BR8L 5C3EG 1PH2A 1BBUA 1FVIA 1VQ4A 1PH7A 4DR3Q 1VQ8A 2E5LQ 2JA6H 4BY7H 3K7AH 3JAMc 3LGJA 3F1ZA 5M3MH 3CC7A 2D62A 1XNRL 4JYAL 3F2CA 1BVSA 1P16A 5M5WH 1HNWL 1YNXA 1OXTA 2JEAI 4OO1G 1XMOL 2UXBL 4KHZA 4IPCA 1UWVA 2E8GA 4PG3A 3ICEA 1HZCA 4BBRH 4UY8C 2UXCQ 4HJ7A 1PH6A 4DV4Q 1E1OA 4NXNL 2B3GA 2Z6KC 4DV2Q 4A3MH 3T1YQ 5C4JH 3RLNA 5LMUL 1AE2A 5IYBG 3KF6B 4A3DG 4JI3L 5C3EH 4DV0Q 4DV6L 4A3CG 3L7ZC 4IPDA 1CSPA 1VQPA 1V1QA 5IWAL 4A3IG 1Q82C 3STBD 1I94L 3S1NH 3HOUH 3H0GH 2HIVA 2PQAB 5C4XH 4X65Q 3TS2A 2UXCL 4JC0A 1M90C 1NTGA 4XIGS 2ATWA 4GKJL 1CSQA 2WFWA 4J15A 4YCVA 4B3SQ 4C3IH 4L5TA 2K50A 4YWKA 3ULLA 2YV5A 5FJ8H 1UEBA 1VQCA 4GNXB 1MIUA 2VZAA 3JC66 1LUZA 2BH2A 4P73A 1PH9A 1U5KA 2BH8A 4GNXC 4OONA 1KD1C 1JJ2A 2NVYH 2ZJQA 4L5RC 4LF7L 2K5NA 3MXNB 4JI8L 1LTLA 1UE5A 4PZ8A 4O2DA 1R9TH 4FDBA 5IYCG 1Y1VH 1IBKQ 1W3SA 1PYBA 1Q1BA 1VQEA 2N78A 1D8LA 2JK8A 2OQ0A 2PMZE 3CCEA 1YVCA 4DR3L 3I4MH 1Q1EA 4EQ5A 1CKOA 1K0RA 1EYGA 1NBWA 4DPGA 4A3FG 2N3SA 3GTGH 3PO2H 1EQQA 5GAGC 1X3GA 4WJ4A 1L1OC 2XGTA 4A3IH 4LFBL 2UXDQ 3BZKA 4LFCL 1S3OA 4B3RQ 2PI2E 3M85A 3T1YL 1VQGA 3M4PA 1Q8KA 3PO3G 1KAWA 2E2JH 1KXLA 2DUDA 4X62Q 1C9OA 4GLXA 3NENA 1TWCH 3HOVG 4AYBE 4DV5Q 4A76A 2OTLA 1E22A 1Q7YC 1XPUA 2AWNA 2KCMA 4DK6C 4JBKA 1N32L 1JT8A 2WAQG 2ZTEA 2Q2TA 4NPSA 4HJ8A 1X54A 2UUBL 1PV4A 4DAMA 5IP7G 4NB3A 1KHIA 4A3JH 1UE7A 3M4OH 4LF4Q 1QUQB 3D0FA 4QL5A 3AQQA 3HOXH 1HNZQ 2UU9L 4JI7Q 1FGUA 5LMNQ 3T1HQ 1GM5A 4HIKA 2V1CC 3RNUA 4JI6Q 5C0XJ 5JJKA 1PFSA 1NE3A 1MJEA 1J6QA 1SMXA 5GADC 4APVA 2JJQA 5FLMG 3J81c 3CP0A 2NVQH 3CCMA 1N33Q 5C0XG 3CMAA 3I56A 3ZJYC 3I4OA 4RG1A 1JJCB 2A1AA 4A3EG 2OTJA 2I5HA 4QJFA 2CKZB 2IT1A 4A3BH 3GTQH 2YU9H 1E7ZA 1OXSC 3CC4A 2Q2UA 4AIMA
chains in the Genus database with same CATH superfamily
1WTPA 1S5FD 1SE3A 2WB1G 4PZ7A 1TWFB 1E0BA 4LJZC 2MGSA 5GAHC 1WTWA 2A8VA 1IBML 1LM0A 2CFMA 4KKSA 2QEJC 4A3EB 2Z6KA 3HKZG 3D4DA 3I8ZA 3E3XA 4RHSA 3CHBD 1JE4A 1TQOA 4A3BB 2KECA 1CA5A 1LV9A 1YHBA 2WB1B 4DV5L 4YCUA 4V190 2P5ZX 4QB4A 2KENA 3KBXA 1W6KA 1RHPA 3M4QA 3FKIH 1PHJA 3RN5A 1K0SA 1ICWA 5IT9c 1PTOF 3CQZH 4A3BG 1SFOB 3W5OA 3RR5A 1K9MC 4IJLA 2PQAA 2JEBI 2DNEA 1UNSA 5FLMH 2RHSB 4KY5A 2JA5H 4G57A 2VQEL 1TS4A 1MD2D 2WIIB 4P2CB 2NZ1D 4PV1C 2ZTDA 5A35A 4JPBW 4KLKA 3FEWX 4H02A 1CKMA 3VR4A 1NMFA 1R4QB 1SMYD 1K83H 2XWBB 4R4OA 4DR4Q 4RKLA 2EXDA 2KQ3A 4RA8A 2KEDA 4B9WA 1Z47A 4X64Q 1N33L 1X56A 3GTMH 1SRUA 3CC2A 4PNYA 3JAMi 1OXVA 5DNFA 3S1RH 3HOYG 3SDZA 2HQEA 1MKHA 2YTXA 1O78A 1BO0A 3H0GG 4GN3B 3A7LA 3V05A 1M8AA 4F87A 4A3KG 1EIYB 3Q6SA 4RGMA 2Z4IA 1VQ9A 1PA6A 1O80A 1VQOA 1J5EL 3OIQA 3M4YA 1Q81C 1XNRQ 1EQRA 2Y0SG 3MXNA 4RAUC 2WAQB 1BDOA 1BF4A 1H95A 2CWPA 1D5XC 1JC7A 3I90A 3AYHB 5C4HA 1VDZA 3TZDA 4K6DA 1X3QA 2YYZA 3LWUA 1VQKA 2F0VA 3P7JA 3NHHA 1BOSA 1ET9A 2E2HB 3RD4A 1DONA 2XNAC 1E2VA 4H13C 4XYQA 3S1QB 1TT2A 4A3DB 3BYYB 4DXGA 2QA4A 4A3LG 2F0QA 4B3RL 4R4QA 4OO1H 2O5JC 4R4IA 1VQJA 4LFBQ 5FLXE 4C56C 2VL6A 1BR9A 4IURA 3R2IA 2N55A 4UDUC 1B8AA 2A68D 4IUUA 1VQMA 1EFWA 4LFAQ 1G51A 2Z0SA 2F4VL 3PUYA 4C3IB 4DV7L 4JBMA 4POFA 4CKEA 1A6XA 5M5WB 1LTID 4HCEA 2DNCA 1SNDA 3MFYA 1K8AC 4LF9L 3M3YH 4FYDA 1OXXK 2L11A 1SYCA 3L9AX 2A73B 4N9PA 1EY8A 1RIPA 1SNCA 4P71A 5HY6A 4DUZQ 4DR2Q 3KOJA 4NW2A 1HR0L 2JA7H 2EIFA 4FO2A 1X3PA 2SOBA 4E6IA 3GTJH 4C3IG 1HUMA 2BE5C 2E74C 2XVSA 2R7FA 4Z9CB 1LTSD 2JQOA 3FMCA 3F2UA 1G2TA 1HTPA 1B3QA 4K8IA 3S16B 4F8MA 4AQYQ 4LF5L 3PCOB 4MNOA 3SEBA 1OTCA 4K5WA 4MZ9A 2FMCA 2XRSD 3TRZA 4CDEC 2Y0SE 4XQQA 1EWIA 2Z4HA 1ET6A 3T56B 3VR6A 4BXXH 2BCOA 3K6OA 2ZXOA 3LNNA 2KBNA 3HKSA 4IOAA 4CDCC 1SYFA 2KCNA 3SK6A 3EIVA 1VQBA 2ZT9C 2WACA 5JOBA 1PH8A 3IRBA 4LUZA 2AUKA 4BY1G 3K0YA 2D0PA 1GUOA 2ES2A 4DV3Q 1TWAH 4IPGA 1CQVA 2L9HA 3A56A 5CV4A 3GV6A 2D5DA 1EUJA 3OPOA 1IL2A 1DOLA 1A62A 4KD3A 1TWCB 4GLAC 4IQZA 2F0JA 5CC4A 2KCTA 3X3NA 3AFPA 3H3VI 2Q2HA 4ID6A 3I73A 3NSWA 2Q8TA 3D4WA 4CDFC 2R93H 3OHXC 2K05A 4GOPC 1S4ZA 4L5RC 3PIPA 3Q8DA 3BZDB 3QOLA 2RCNA 3WWVA 1YBYA 1IBLL 2B63G 1GUWA 2HQLA 1QZHA 3UE0A 3M7GA 1DD2A 1WCMG 2N49A 1DM0B 4YWLA 3HG9A 5C3WA 3A0JA 1D5MC 1QZGA 3FHWA 3J7ZC 4UP9A 1BCPC 2ICEC 5K36G 3HRZC 2PO4A 1DXMA 3Q24A 3HKZE 4DAYA 1CT1D 1I6HB 5FO9B 1Z7TA 5IP9H 5M3MB 2R6GA 3PSIA 2CHBD 4FP5D 1L1OB 1UE1A 1EIFA 4DF7A 5EPLA 1E24A 1TVXA 4KKTA 4A93H 1C0AA 3KDFB 4DU9A 1B1ZA 4R4TA 1L2FA 3IL8A 2QGQA 1I4XA 2B2TC 4L5SA 2B2VC 2K6AA 1V1PB 1U9RA 1NMGA 3K81C 1HNXQ 3G4SA 1NCVA 2E2IB 2QDLA 3I2ZA 3J80c 2JXMB 1X9NA 3OW7A 1JICA 5ELBA 4JI7L 2GVBA 5C0XI 5KNCA 1YNNC 1GUGA 4ODGA 5AFWA 3ULPA 4JI5Q 4LF8L 4DR5Q 3S2HH 1WI5A 3MA2B 5J1ZA 3H09A 3BG3A 2UUAL 3J7A5 5M3FB 3MVVA 2NN6H 4BBRG 3PMFA 1CFMA 2F0IA 3BJUA 1EZ8A 3SE0A 4IUTA 1HZAA 1HQMC 5C44G 3RUZA 4WORA 3H3VC 4A3JG 3QWNA 2UU9Q 2AWOA 1C8CA 5CBAE 2IX0A 1BKBA 2ZXPA 2IHFA 3GTLH 3G6JB 3TN2A 4ZK9B 4DV7Q 2EOTA 1PTOH 5NUCA 2HDLA 2R93G 3J81L 1SN8A 2FFKB 1JOOA 4LFAL 1VQ6A 2E75C 1YEZA 1H9KA 4A3FB 3D8GA 2F0GA 4BA1I 1B4OA 5JEAG 2B8FA 2QF7A 3PO3B 1U4MA 4Y7NB 1K3BC 2CH4A 2A69D 3HOUG 1LABA 3K0XA 1YNND 2CH4W 4XDXA 3NPPA 1YHAA 1EOVA 1IL8A 3A5UA 3DMUA 1GJXA 5FJ8G 5C3EG 5M5YH 2F0TA 4DR3Q 2CVRA 1U4PA 5M5WH 1YNXA 1OXTA 1VMPA 1XMOL 5HURA 2E8GA 1PTOD 1HZCA 4A93B 4DV4Q 2B3GA 2F0SA 2NTTA 2XN9C 1G2SA 3KF6B 1XYIA 2NVYB 5C3EH 2K5DA 4J8QA 3L7ZC 1VQPA 1IW7C 2IJ0A 2HDMA 4NMZA 3S1NH 2HIVA 5IGCA 2HUGA 4NP5A 3TS2A 4C3HB 1A3TA 2NTSA 4DFAA 1M90C 3AMUA 2UXCL 3VA5A 2WFWA 1FNWA 2H1EA 4C3IH 2K50A 1MIUA 2M9VA 2BH2A 1BUVT 1U5KA 1JJ2A 2E76C 2K5NA 5EKIA 3S2HB 1UE5A 3MXGA 1WTQA 4FDBA 2JA6B 5ELDA 4DNTB 3CCEA 4DR3L 1EY6A 2PMZE 5CV6A 1YVCA 3I4LA 1Q1EA 1QE6A 2ICIA 1CKOA 4U673 5I4DA 3I4NB 3GTGH 3FDTA 1L1OC 3NE5B 3BZKA 2EJFC 3M85A 4FXGC 4X3TA 4GLXA 4AYBE 1H9RA 2OTLA 5EBCA 2AWNA 4J6HA 1SYEA 4HJ8A 1I4PA 5ELEA 2RQXA 4DAMA 1PV4A 4A3MB 1LTBD 1QUQB 5DEHA 3L3OC 1HNZQ 1FGUA 4OEMB 1FYCA 3A7AB 2G5DA 5GADC 4APVA 2X6GA 5C0XG 3NP8A 2IX3A 3FRPB 4I65A 1T5XD 2PW5A 1WTOA 2JA7G 2DY7A 2Q2UA 5GAGC 5C5MA 3GTJB 4J1MA 3I4MB 1M4VA 1IXRA 2F4VQ 1I4RA 5JEAH 2R92H 2R7ZH 3KK7A 2KHJA 2WB1E 1FNVA 2VXWA 5CGKA 1WTXA 1B70B 1WOCA 2NB0A 1VF7A 1V1OA 2EYFA 4K5VA 4DR5L 5EPJA 2JYOA 2KCCA 3PF5A 1TS2A 1VQHA 1I3QH 4FF2A 1HQRD 2NVXB 5H1SE 3GQBA 3K8AA 5C3XA 5IP9G 3I3CA 2K33A 2R92G 3VR3A 4LF8Q 1J9OA 4NXML 3I91A 5M9OA 5IGDA 3SHLA 1VQ5A 4JI6L 3CF5A 4QUFA 5KRUA 2VY3A 4DR7Q 1O7YA 2UUAQ 1F9QA 4LUOA 2NN6G 1N36Q 2EXZA 4GN4B 2VB3X 4OWXB 1S40A 1OXUA 3BDLA 2F0HA 1V43A 2ZJRA 1B7YB 5TSSA 3ND8A 3UE1A 2F0FA 4YY3Q 1Y1WH 3AB9A 3U50C 5EQ0A 2A5HA 1HR0Q 3SGIA 4H0LC 4N9TA 4AQYL 4A3DH 1WD0A 3SVMA 2F0PA 2F3VA 1XJVA 2JP1A 1SNMA 3CMEA 1E2WA 1VQNA 4PMWA 2QKIC 3QJYA 4K0KQ 1E3PA 3VYUA 2B2VA 2G9DA 3PUZA 4JI0L 1E2ZA 4LWCA 1LT3D 2KJXA 4B3MQ 1R4PB 4CKCA 5J39A 5KIXA 3J80i 1N34L 3K5LA 1VF5C 2XTIA 1SXTA 3EN2A 1IYJB 5KYIA 5EKKA 1BCPB 2L0CA 1TWGH 1IBLQ 2HHHQ 2MNAA 1RTNA 5M5XH 4LNQA 2R7DA 4KN4C 1I4GA 1AN8A 2RKSA 1TY2A 4Y7NH 2I07B 2JA9A 3QB3A 4JV5Q 1F9RA 4R4CA 4X6AH 4ZCKA 3NTKA 2ASBA 1HRJA 1MSGA 2K14A 3NWTA 3BVMA 5M5YB 5KNBA 1N8RC 1SYBA 4OO1I 1EYDA 1JR0D 1L0XB 4EX5A 4HEDA 5LMNW 1XMQL 3S15H 2VW9A 1EZ6A 4CJ2C 1D5ZC 2FMMA 4UPAA 4QMGA 3R3OA 3BS1A 3ER0A 3OWEB 1HZ9A 3KBGA 3DWQA 3F2DA 3MXPA 3PGZA 3HP3A 4DUYQ 4A3EH 2ZXRA 5AJ3L 5IT9E 3E5SA 2PNHA 2VNUD 4QF4A 1XWEA 5ISRA 3U4ZA 1FD7D 4GKJQ 1Y1VG 1I3QB 1A2UA 2K5VA 4YCWA 4DUZL 4DR2L 2K75A 5T1IA 4Q5VA 1Y1WB 3DXJC 1RKNA 3ITPA 1PH3A 2Z1CA 4EVOA 1UEAB 2F03A 5JJZA 4MN3A 5LMUQ 3PO2G 3KJOA 4OIKA 3S1QH 4B3ML 3MZ5A 1EY5A 2GVAA 2M00A 2PZTA 5FK9C 4IFDJ 4O42A 1KLGD 5BN4A 5IGBA 1DOKA 3IFTA 3CXCA 3PUXA 3RLOA 2ZM6Q 2H5XA 2V4DA 1SEBD 2SNMA 5KGUA 3HOYB 2PYKA 1GD7A 1X32A 1SYGA 2F3IA 3CAMA 1XTDA 5LL6S 1FL0A 3FPUB 5IP7H 2K5WA 3R8BA 4WJWA 4DV3L 2FINB 4ZRZA 1CUKA 2IWHA 4IUVA 1GUNA 2RHQB 5EPKA 2R7ZG 3WOFA 2Q2IA 1EU3A 2E2HH 2CQOA 5G3LF 1DJRD 2PZWA 3CPWA 3M9BA 4DR7L 1LT4D 2L1BA 1VQ7A 4GKKQ 1NSNS 1KL9A 1STHA 2K32A 4A3DG 2OQKA 3PUVA 1SFOH 4FF4A 1BNZA 3T1HL 1S5ED 2K5QA 5F2DA 1WD1A 3T51B 1CKNA 2ZM6L 2VS1A 3HFZB 3HOYH 4MTKA 1WTRA 2B2YC 2L55A 2MO0A 2R61A 2K04A 1SMYC 4DAYB 4X65L 1IBKL 3CCQA 4DR6L 3MWYW 2F1MA 3E0JA 1EQVA 1F2MA 1W2BA 4H7BA 1JOQA 2GA4B 4IUQA 2EYJA 1VQIA 4OELB 3A55A 4GS3A 2MUYA 2I0QA 3KF8B 2N8NA 1I4HA 3CCVA 1LO5D 1N32Q 2I46A 3I4NH 5G3LD 4ZUIA 1SROA 4C3JB 4FXDA 3FP9A 4YY3L 5JJLA 3S17H 4GN5A 1PXUA 3S1MB 4DV0L 2EDGA 5JAVA 3HOWG 1B9NA 2DJFC 4YIJA 3J7AF 3NTIA 2A6EC 2JA5G 1X55A 4NXNQ 1YJ9A 1EYAA 3OTOL 1QJOA 3RZDH 3GTKH 4RCNA 1PFNA 3K58A 2CWAA 2RF4A 2X69A 3NELA 1XPOA 2LS01 2YTVA 3PF4A 1EY9A 4K0KL 4JG2A 4DK1A 3HOWB 4WFN3 4AYBB 4DA2A 1KC8C 2RDFA 4HTHA 3UDIA 3J7AV 4ULLA 2DJGC 2E2JB 2HCCA 1SYDA 3TQYA 2WKCA 5CR3A 1PFBA 3GDEA 4YHHQ 3S9WA 3Q23A 2PPBC 2XWJB 3BDCA 2PW7A 1QCBD 4ZKCB 1EWHA 1QOHA 1XTCD 4TSSA 4PMCA 3GTOB 1Q8IA 1VQFA 1AW7A 4CJ1B 3D31A 1BCPF 4MHEA 1QUQA 2VQFQ 4HJ9A 2NVQB 1K28A 3K7AB 1VQAA 1LT6D 5IE8A 1C7YA 4IOCA 2K4KA 4JV5L 2VUMH 2K01A 1K8OA 1D2BA 4X66Q 1C48A 4PZ6A 4KTAA 3B6YA 5FLXc 1EEFD 5LL6X 4KI0A 5BR8L 4RCOA 1VQ4A 1VQ8A 4BY7H 2VB2X 2K28A 3F1ZA 4BS9A 3VA7A 4JYAL 3WOEA 1P16A 2UXBL 5CV5A 4IPCA 3TP5A 1PTOC 4BBRH 5FLXL 1ZKOA 4H44C 4UY8C 4HJ7A 4NXNL 1AZPA 4DV2Q 1A2TA 5C4JH 5LMUL 4DV0Q 3DUZA 4IPDA 1CSPA 1KTKA 1V1QA 1ONLA 3EA6A 5IWAL 4A3IG 5FOBB 1I94L 2PQAB 5C4XH 4N8FA 3KF8A 4GKJL 2MP1A 3NXWA 3ULLA 1EU4A 2MHVA 1UEBA 3JC66 1LTGD 2ENBA 1LUZA 4HN7A 4G7HC 3HS0C 4DNRB 1KD1C 2PMZB 4OONA 3X3MA 3MXNB 1STNA 2F0WA 3SXHA 5IYCG 1Y1VH 4KV6A 3VYSA 1Q1BA 5E4XA 3H91A 3NBHA 1VQEA 3HOVB 2EY6A 1F77A 4M1UB 3NQTA 3PO2H 4A3FG 2N3SA 1NNXA 2UXDQ 4B3RQ 4IUPA 3PO3G 1C9OA 3NENA 3MC0B 3G7LA 4RWSC 2L4NA 4IUNA 4A76A 1R9TB 3HOVG 4DK6C 2CQAA 1JT8A 2ZTEA 1STAA 4S3SA 2Q2TA 4NPSA 3EROA 1XX8A 4UAIA 4NB3A 1GOZA 4LF4Q 3VYRA 3D0FA 3AQQA 4JI7Q 5C3EB 3T1HQ 2BDOA 3RNUA 3UI2A 1J6QA 3J81c 5FLMG 2BE5D 3I56A 4C1NK 2L5TA 5K36H 2D9UA 2RSOA 1UAPA 4RG1A 4QCLA 4NKLA 3C1EA 1SJED 4A3BH 3Q0AA 1E7ZA 5K5PA 2EY2A 4AIMA 3S2DB 4FXKC 3HGBA 4ABNA 1E1TA 4MIUA 1ILQA 2A69C 3OYYA 2NZHA 5IT9L 2F0DA 3Q22A 2UXDL 2N88A 1F2YA 1QVGA 2EPBA 1AFPA 1JE5A 1ESRA 1BBXC 4FF3A 4KHVA 4LK1C 3C46A 2ZJPA 1NY4A 1P8LA 4DUYL 1DCZA 2B63B 3EBEA 3KYHC 1Y8PB 1A8VA 2CCZA 4GZYC 2B2YA 1IYVA 2IX1A 1HPCA 1Z6HA 3AEVA 4DR1L 1I50H 3U9OA 1QNUA 2EJMA 2BA1A 1PRTD 4POGA 3CW2C 2DN8A 1RODA 3TSSA 1SJHD 4DK3C 3GO5A 3S1MH 3S17B 1MHWC 1IKMA 4GNXA 4ZAIA 2LFNA 4BXXG 4JI4L 3HEJA 1KNAA 4LF6Q 1I50B 1N36L 3ERQA 2LXJA 3KFUA 1X65A 3VR2A 3HOZB 4HAEA 1NR4A 2EYLA 2IPKD 1Q46A 1D1IA 2K03A 3VR5A 1WFQA 1PRTF 1YITA 4KKUA 3I4NG 2B39A 1STEA 4DR4L 4IO9A 3SK4A 3W1BA 1M1KC 3M3YB 1PVOA 1VQLA 2OEOA 1PRTC 1JB7A 3PIO3 2IW3A 3C3LA 1YNJD 4JYAQ 5C44H 2WV6D 4X62L 3GTOH 1ESFA 4HJAA 5BR8Q 2X6LA 1S72A 1VCIA 1H9SB 2EJGC 4O0AA 3H15A 4CJ0B 1LYLA 1ZYRD 3GTGB 2PI2A 4GKKL 2EYOA 4EGVA 3GTPB 4BBRB 3JAME 2VUMB 1SE8A 2AKWB 3PIOA 2BOSA 1BQQT 2ZTCA 5C44B 2K5HA 1Q86C 4JI4Q 4A3GB 2O2LD 1YHQA 3HOXG 5IYCH 4CKBA 5C4ZA 3QR8A 1Q3LA 3GTMB 1GHKA 5ELCA 3URYA 2JA7B 2HHHL 1CM9A 5CV8A 4OX9Q 3I4MG 3TP6A 2A6HD 3T16A 3IAYA 3KLSX 3D6WA 5C5LA 3N52A 4PQXA 4K5XA 1HFNA 1YJWA 2H4OA 2D2CC 2KEEA 3S24A 3A54A 2AHOB 4A3CH 2OT2A 5IGGA 3K80C 1TWHH 1UE6A 4DKAC 2JA8G 3FPPA 1HNXL 3I55A 2JE6I 1AZQA 1J8IA 1EY4A 3HOUB 2KVMA 4LF9Q 4LF6L 3G48A 4DV1Q 3CCUA 1IYUA 2O4XA 5IYBH 1NJIC 2JA8B 1JQYD 1PZJD 3MTSA 3GP7A 4F7XA 3NEMA 3RN2A 4XT1B 4TRDA 1L0YB 1X3EA 1CZWA 5J3BA 3U4VA 1ZYRC 4ZUJA 1GKHA 2HT1A 4KN7C 2Z6BA 4OWWB 3BU2A 3T53B 2OF1A 1KDBA 1EQTA 3TDQA 3RLFA 4DV6Q 1QVFA 4NXMQ 3GV3A 4WJ3M 1I6HH 4C3HG 1V8QA 1QILA 1HR0W 4KD4A 3IKJA 1WTHA 4P72A 4DAPA 4JI1Q 3FVQA 1HNWQ 3HKZB 2MJ8A 3M4OB 1KAAA 1PYSB 1G291 2NVTH 1I5FA 5IOCA 1STGA 2Q8IB 4A75A 2JA8H 5IYDH 4A4IA 3NBHB 4CGYB 4X64L 2F3WA 4BBSG 1CTMA 3CKIB 2NYZD 1SNPA 3PUWA 1T9HA 2B8GA 4B3TQ 4Q0FA 4BY1H 4LMQD 1I4QA 1MBYA 5JVG3 5M5XB 3BYTB 4HJ5A 3T4AC 5IY0A 2K52A 1SE4A 3NWSA 2SEBD 1PZKD 3MAQA 5DAUA 5A2QL 4X66L 1N34Q 1YI2A 1K73C 5DLQE 5JVH3 1BCPD 1G8ZD 1HJPA 1Y1WG 2D0OA 5IWAQ 1I94Q 3W2DA 2WAQE 4RKBA 3P75A 4JCVE 4R8IA 3TBIB 2Z9HA 1FJGL 3CCJA 1ICFB 4OIJA 5HGQA 2MFIA 4DR1Q 3H0GB 3OSOA 3TS0A 4A3KB 3RZDB 2OWOA 3BVGA 1TIID 1JJGA 4LW1A 4KHPQ 4JOIA 1U4RA 2RSNA 3KJPA 2AUJD 2ID0A 4ME3A 4DNIA 5DM63 2Y0SB 5E7NA 4QIWB 1STBA 4JI3Q 3LX0A 4LF5Q 1O7IA 2VQFL 1YZ6A 2F0MA 3TEHB 1XMQQ 4IALA 3CD6A 4UP7A 1JMCA 1K83B 5C0XH 1PDQA 5BN3A 3HOVH 3R2TA 3K7UC 1KRTA 3UDGA 2NZOA 1XPRA 4YWMA 1JOKA 1MGSA 4JI5L 4DR6Q 4A3FH 4QGUA 4XYOA 1X3FA 2NN6I 3S14H 2QILA 1XXGA 3DWAA 1TKWB 1HNZL 1Y8NB 4QUCA 2VQEQ 5JPMC 1SLJA 1F2LA 1EFID 1TS3A 1QNKA 2EYMA 3H6MA 1PMRA 3MEHA 4V0BA 2RDHA 1U0LA 3HZXA 5I2XA 2HCIA 2AQ1B 1TWAB 1C4QA 4N8X1 3E9HA 5CYUA 1TXYA 1HXYD 2AMCB 3S1RB 2BA0A 1A63A 3EQLC 1VQDA 2C9OA 4O1NA 3KDFA 3NK9A 3L0OA 3D3RA 1WCMH 1K3RA 1NAPA 1DYQA 4ZLTF 5EAYA 4HIOA 3OTOQ 1KDCA 4C2MH 3J81E 4C3JH 5IYDG 4UHVA 2L15A 2F0OA 3U58A 4ZYSA 2L12A 3D6CA 2EY5A 4DV4L 3TZUA 1TWFH 1H9SA 3STBC 2R3ZA 3DEPA 1PH7A 1BBUA 1FVIA 1S5BD 2LMCB 2A6HC 2JA6H 1JORA 4ILWA 1JCKB 5M3MH 2D62A 3J7YW 1BVSA 1HFGA 3ND9A 1JWSD 2KHSA 1UWVA 2UXCQ 2LKVA 4PG3A 4C3JG 1PH6A 1E1OA 2Z6KC 4A3MH 3T1YQ 3RLNA 1AE2A 5IYBG 5D14A 1H9MA 4BY1B 4JI3L 4DV6L 1LACA 1ENFA 3NUCA 3A8JE 4KJNA 2AQ2B 4XIGS 3OMGA 2XIWA 1DOMA 4B3SQ 4HSPA 4L5TA 4YWKA 4IFDH 1V1PA 5FJ8H 4GNXB 3GTQB 1IW7D 2VZAA 1T5EA 4P73A 2ZJQA 2NVYH 4FVMA 4JI8L 1LTLA 3OIPA 3I72A 4PZ8A 1CZGA 1QG7A 4DN4M 1R9TH 4C2MB 2PZUA 3K57A 1WTVA 4I7AA 2JK8A 3I4MH 4I7ZC 4EQ5A 1ENCA 2F0EA 1EQQA 4WJ4A 2F0KA 4LFBL 5EKLA 5I6YA 4LFCL 4OL7A 1HA6A 1SE2A 2F0LA 2PI2E 1VQGA 3M4PA 1Q8KA 1B44D 1KAWA 1KXLA 2DUDA 5I9PA 2NUCA 1XPUA 5E3FA 1E22A 3EVQA 1GHJA 1IHZA 1Q7YC 1Y1VB 2KCMA 4JBKA 2AQ3B 1LT5D 2WAQG 1EWCA 1X54A 2KOLA 2UUBL 1GUTA 5IP7G 4A3JH 1UE7A 1LLRD 3LWEA 1B9MA 1ML0D 4QL5A 3HOXH 2UU9L 4EQNA 2JN4A 1TWGB 2V1CC 4HIKA 1HCZA 5CV7A 1PFSA 4KK7A 1RJTA 4RHRA 1SNOA 2RBMA 1SMXA 2JJQA 2BDNA 3CCMA 3T13A 3CMAA 3ZJYC 3I4OA 3DHQA 2K7VA 1SSOA 3MHBA 2A1AA 3S15B 2OTJA 2I5HA 4QJFA 3C1FA 2CKZB 3GTLB 2IT1A 1EL0A 1KLUD 3A8IE 2YU9H 1OXSC 3CC4A 4IZ8A 5I9OA 4A3GH 1JWMD 1Y8OB 3ZYYX 1YNJC 1TWHB 2TSSA 1VS0A 4JOIC 2NBFA 1F2ZA 4HIMA 3K5NA 1OO9B 1JB3A 5I6WA 3BVZA 5C6AA 2CW0D 4ALPA 1CK1A 4G7OC 3K5MA 5CBEE 1LTRD 5AJ3Q 5FO7B 4OX9L 3C2PA 4DGZA 1EIGA 2SDFA 1K8MA 1FJGQ 1ASZA 3I70A 1KQSA 1EIHA 1TS5A 2Z8LA 4IJHA 2KA7A 2KHIA 2XRQD 4TQUS 2EE1A 3NBIA 2B2WA 1L1OA 5C4XB 4KY7A 1F9SA 2B2UA 1A3UA 3PQIA 1MI2A 4P74A 5IGFA 4A3JB 3GTPH 5COYA 4EQPA 1XNQL 2HIXA 1Q12A 4JW0A 3HOZH 4K14A 4BBSH 3J80E 4CHTB 4FF1A 4ME5A 4TVAB 5C4XG 2G9HD 3A8KE 5LHY1 1BXTA 2LXKA 4XXEA 1CHPD 4X3UA 2YTYA 2NVTB 1ZEQX 4KJOA 4WRDA 5KYLA 2UUCL 1CHQD 2FJ2A 3HOWH 5KNDA 4X3SA 4GOPB 3CCSA 2A74C 1O7LA 5LMNL 1ASYA 4JBJA 4K6LA 3CPFA 3N6RA 4UP8A 1IKLA 2FHTA 1B2TA 1PFMA 1UUPA 3VYTA 4QIWE 3AU7A 1RL2A 1LTTD 3PV0A 4P75A 3QO2A 2JA5B 4A93G 4DK0A 3IFDA 1MSHA 2MO1A 4IFDG 1AH9A 1SR3A 5DM73 4B3TL 4R1JA 1RCVD 4B9XA 3OW2A 1WCMB 2DY8A 4RFBA 3NTHA 5GQOA 4CDDC 3E6ZX 4L8JA 2SNSA 1V9PA 4AYBG 2RA4A 2WKDA 5EBDA 1PRTB 3ULJA 2GN5A 4RGTA 2F0NA 2PNRC 1Y69U 5BN5A 2UUCQ 4C3HH 1Y14B 3V96A 3CU7A 3KLWA 2K1BA 5ELFA 4L5QA 3GD7A 2RDGA 4B3SL 2TMPA 3G6EA 1WVLA 5E4WC 2JA6G 2OCEA 4OXPA 4BWGB 2E2IH 2WP8J 1YJNA 1VMCA 4U68A 4TKOB 3M7NA 1QB5D 1RDPD 1KIXA 3S2DH 1HUNA 3V2TA 5GAEC 1TY0A 5M3FH 2ALYB 1PH1A 2HD3A 5M3MG 3VDYA 3HOZG 4YHHL 3A5ZB 1A15A 3MEFA 4JK1C 2E5LL 5KEEA 1B3AA 1F9PA 2B29A 4IFDI 3S14B 4C1NI 1AE3A 3DM3A 1A3VA 5M3FG 4KHPL 4K8JA 3S16H 1RTOA 1WJJA 1BBWA 3DLLA 2J4XA 3KLSA 2J7ZA 2EY1A 2PCFB 4LFCQ 4A3IB 1GVPA 3P1HA 1TU2B 1PH4A 1DGSA 1WYDA 3H3VH 2B2TA 1MJCA 2NWGA 3R93A 2VUMG 4OGQC 4PMBA 1KRSA 3BZCA 3KUPA 4BA2I 2LSSA 3EJIA 3I7FA 3TREA 5JJIA 2UUBQ 4BY7G 3K59A 5D3DA 4A3GG 4K2KA 4DV1L 5GROA 4A3KH 3D4RA 5D3IB 4JBWA 2O5IC 3TMEA 1SDFA 4R9WA 5D65A 3J81i 4JI2L 3E0EA 2QW7A 4HR7B 3E9IA 3J81j 1HZBA 3CRKC 4DV2L 4BY7B 4RMFA 2EQSA 4G7ZC 5L37A 1SNQA 1II3A 1D7QA 3F2BA 5ELNA 2EZVA 1EEID 2WINB 4K2LA 2NVXH 3J80L 1GO3E 4XTCS 4JVZA 5CORA 4KY6A 2E2DC 3UDXA 1IZ6A 2C35B 4JI0Q 3QIAA 5C4JB 2R93B 5IODA 4GOPA 3HOXB 2QEXA 3SK5A 1X6OA 2OXPA 3OMCA 1PZID 2EVBA 1N9WA 1PYWD 4KMUC 5FKAC 4JI1L 2JSOA 3KF6A 5JEAJ 4OHJA 1FR3A 1LTAD 4GLVB 2F52A 1QWYA 1YIJA 4A3LH 3W1GA 2B63H 2CW0C 1RF2D 3DM1A 1GXDC 3CCRA 3CQZB 4HSVA 5IGEA 1Z9FA 2M2LA 4QQBX 5FO8B 2QDBA 3W3AA 1XNQQ 1ZXTA 1AP0A 4FNFA 2MPMA 3CCLA 2A6ED 1CKNB 3ONAB 1CQFA 4ZKBB 1D1KA 2FXQA 4RGNA 3U9SA 4ZQ3A 2I5LX 4AH6A 1IBMQ 3SK8A 3SR1A 4F88A 4LF4L 1JWUD 3KLRA 3PO3H 3RZOH 1PH5A 1L0WA 5I2YA 3AFQA 4MTNA 4R8NA 1I6VC 4OWTB 3CRLC 2DGYA 3ERSX 3QG1A 4HIDA 1NUCA 1RD9D 3QOJA 1PTOB 4LAAA 3RMHA 4JI8Q 3JAML 4JI2Q 4LF7Q 4BBSB 1S5DD 3DEOA 3WDNA 4Y52H 1XMOQ 4IN3A 4A3MG 3GTKB 2IHEA 3BDOA 1B50A 1J5EQ 4QY7A 1K8GA 4LUVA 5ELOA 2I5MX 1QVCA 3A74A 2IL8A 3UDFA 1SAPA 3H94A 5EJWA 5T1GA 3S1NB 2IY5B 1A0IA 4DXFA 3MXUA 4L63B 3K5OA 2A68C 5JPNC 4CBVA 1G91A 4XT3B 3FKIG 1PLFA 2XSCA 4HMIA 3OWFA 4HMJA 3O13A 2UXBQ 3F8TA 3L2PA 2EYPA 3OOCA 2B2WC 2MQHA 3RZOB 2QCPX 1CI3M 4IPHA 3G71A 1EY0A 1KDAA 2F0UA 2A19A 4A3CG 1HH2P 1PH2A 5CV9A 2E5LQ 3FKIB 3K7AH 3JAMc 3LGJA 1EY7A 3CC7A 1NR2A 3NQIA 3F2CA 1XNRL 1HNWL 2PQEA 2JEAI 4OO1G 1AEXA 2RCFA 2Q8RE 4KHZA 3PO2B 3ICEA 1G6ZA 3TP7A 1O7ZA 3PIP3 1TR5A 2B2UC 1CA6A 3DWPA 1S5CD 1G6PA 1Q82C 1SBBB 3STBD 3HOUH 3H0GH 4X65Q 1STYA 1DZ1A 4JC0A 1NTGA 2ATWA 1CSQA 5HGTA 4J15A 4YCVA 1W6JA 2YV5A 1VQCA 1KABA 4RH6A 2BH8A 1PH9A 5E1FA 4GNXC 2C5CA 1HHVA 4LF7L 2R92B 2J0TD 4RGOS 1KNEA 4O2DA 1Q90A 1IBKQ 5CMDA 1W3SA 1PYBA 1D8LA 1B53A 2N78A 2OQ0A 2F4IA 3TP8A 1ENAA 4X3KA 2R7ZB 1K0RA 1EYGA 1H9JA 1NBWA 4L6TB 4DPGA 5IIFA 4XQJA 4XQNA 4G4KA 1X3GA 2XGTA 4A3IH 1S3OA 2EYHA 4HCSA 5A2QE 3T1YL 5EGTA 2E2JH 4X62Q 1TWCH 4DV5Q 5J22A 3P20A 4EQOA 1HA5A 1U4LA 1N32L 1D6EC 1GUSA 1ILPA 2KUMA 1KHIA 3M4OH 2YU9B 3EFXD 2RVLA 1GM5A 5LMNQ 4JI6Q 5C0XJ 4NDXA 5JJKA 1EYCA 1NE3A 1MJEA 2NVQH 3CP0A 1N33Q 4B08A 4DAVA 4M8AA 1EOTA 3MFGA 1JJCB 4A3EG 1FGBD 3GTQH 1HTLD 2LY7A 1FNUA
chains in the Genus database with same CATH topology
4A3GH 1IXRA 2F4VQ 2R92H 2WB1G 2R7ZH 4PZ7A 1E1TA 2KHJA 1VS0A 4JOIC 2JA7G 2WB1E 5GAHC 2A8VA 3OYYA 1LM0A 2CFMA 2NZHA 1IBML 2Z6KA 4HIMA 2UXDL 3HKZG 1B70B 1QVGA 1WOCA 4ALPA 1JJGA 4DR5L 1JE5A 3PF5A 1YHBA 4DV5L 4YCUA 1VQHA 5AJ3Q 1I3QH 4OX9L 5H1SE 2ZJPA 1NY4A 1P8LA 3K8AA 4DUYL 5IP9G 2KENA 2R92G 3EBEA 3KYHC 1ASZA 4LF8Q 1FJGQ 4NXML 1A8VA 1KQSA 2CCZA 4IJHA 1VQ5A 4JI6L 3M4QA 3CF5A 2KHIA 3FKIH 4TQUS 2VY3A 1PHJA 3RN5A 5IT9c 1L1OA 3CQZH 4A3BG 4DR7Q 3W5OA 2UUAQ 2IX1A 3RR5A 3AEVA 1K9MC 4LUOA 4DR1L 2NN6G 4IJLA 4P74A 1I50H 1N36Q 4GN4B 2PQAA 4OWXB 2JEBI 1OXUA 2BA1A 1S40A 3GTPH 1V43A 2ZJRA 1XNQL 1B7YB 5FLMH 3CW2C 4POGA 2HIXA 1Q12A 2RHSB 2JA5H 3HOZH 2VQEL 4BBSH 4DK3C 3GO5A 3UE1A 4TVAB 4YY3Q 1Y1WH 3S1MH 5C4XG 3U50C 2ZTDA 4GNXA 1HR0Q 3SGIA 4BXXG 2LXKA 4JI4L 4KLKA 4AQYL 4H02A 4A3DH 1CKMA 4LF6Q 1NMFA 4R4OA 1K83H 2YTYA 4DR4Q 1N36L 2EXDA 2LXJA 1Z47A 4X64Q 3KFUA 1X65A 2UUCL 1N33L 1X56A 1XJVA 3GTMH 1SRUA 3CC2A 3CMEA 3JAMi 1OXVA 3S1RH 3HOYG 1VQNA 3HOWH 4PMWA 1MKHA 2YTXA 4K0KQ 1E3PA 1Q46A 4GOPB 3H0GG 1WFQA 4GN3B 3CCSA 1YITA 3I4NG 4A3KG 1EIYB 5LMNL 3PUZA 1ASYA 4JI0L 4JBJA 4LWCA 3CPFA 4IO9A 3W1BA 4DR4L 1M1KC 4B3MQ 1VQ9A 1PA6A 4UP8A 1PVOA 1VQLA 1J5EL 1VQOA 1JB7A 3J80i 1N34L 1Q81C 1XNRQ 1EQRA 2XTIA 2Y0SG 5C44H 4JYAQ 3EN2A 1IYJB 4QIWE 4X62L 3GTOH 1RL2A 1H95A 2CWPA 3PV0A 4P75A 4HJAA 1TWGH 5BR8Q 1S72A 1VCIA 1IBLQ 2HHHQ 3H15A 4O0AA 2MNAA 5M5XH 4A93G 3AYHB 1LYLA 4LNQA 2R7DA 2MO1A 4IFDG 1AH9A 2YYZA 1SR3A 2PI2A 4B3TL 4GKKL 1VQKA 4R1JA 3OW2A 4Y7NH 1SE8A 2AKWB 5GQOA 3PIOA 2JA9A 4JV5Q 2ZTCA 4R4CA 4X6AH 2K5HA 1V9PA 4AYBG 2QA4A 1Q86C 4JI4Q 2ASBA 4A3LG 4R4QA 4B3RL 1YHQA 4R4IA 1VQJA 4LFBQ 3HOXG 2K14A 5IYCH 2VL6A 3ULJA 2GN5A 2HHHL 4OX9Q 1VQMA 1B8AA 2UUCQ 1EFWA 4LFAQ 4C3HH 3I4MG 1Y14B 1G51A 1N8RC 2Z0SA 3KLWA 2F4VL 4OO1I 4L5QA 4EX5A 3PUYA 5LMNW 3GD7A 4DV7L 4POFA 1XMQL 4B3SL 4JBMA 3S15H 3G6EA 2VW9A 4UPAA 1K8AC 3M3YH 4LF9L 1YJWA 1OXXK 2JA6G 2OCEA 4OXPA 3S24A 2E2IH 2AHOB 2WP8J 1RIPA 4A3CH 4P71A 3ER0A 5HY6A 4DUZQ 4DR2Q 3KOJA 1HZ9A 3K80C 1YJNA 1TWHH 1HR0L 2JA7H 3M7NA 2EIFA 1UE6A 4DKAC 3F2DA 2JA8G 1KIXA 3GTJH 3I55A 1HNXL 3S2DH 2JE6I 3PGZA 2R7FA 4DUYQ 4A3EH 2JQOA 5GAEC 5AJ3L 5M3FH 2PNHA 2VNUD 4LF9Q 4LF6L 3G48A 2ALYB 4DV1Q 1PH1A 3CCUA 5M3MG 3U4ZA 3VDYA 3HOZG 4AQYQ 4LF5L 3PCOB 4MNOA 4GKJQ 1OTCA 1Y1VG 5IYBH 4MZ9A 4YHHL 1NJIC 3TRZA 3A5ZB 2K5VA 2Y0SE 4YCWA 1EWIA 3MEFA 4DUZL 4DR2L 2K75A 2E5LL 3NEMA 3RN2A 1X3EA 1PH3A 4BXXH 2B29A 5J3BA 4IFDI 3U4VA 5LMUQ 1AE3A 2KBNA 3HKSA 3PO2G 3KJOA 4IOAA 3DM3A 1GKHA 2HT1A 5M3FG 3S1QH 4KHPL 4B3ML 4OWWB 3BU2A 3S16H 3EIVA 2GVAA 1VQBA 1WJJA 1BBWA 3DLLA 1PH8A 3IRBA 4LUZA 4IFDJ 4BY1G 2D0PA 4LFCQ 3RLFA 3CXCA 3PUXA 3RLOA 4DV6Q 2ZM6Q 1QVFA 2ES2A 2H5XA 1GVPA 4DV3Q 1TWAH 4NXMQ 4IPGA 4WJ3M 1PH4A 1I6HH 1DGSA 1WYDA 3H3VH 1IL2A 1EUJA 1MJCA 1HR0W 1A62A 4GLAC 2VUMG 4BA2I 2KCTA 1KRSA 3BZCA 4P72A 2LSSA 3TREA 3I7FA 5JJIA 3AFPA 4JI1Q 1GD7A 2UUBQ 4BY7G 1HNWQ 3H3VI 2Q2HA 4A3GG 2F3IA 3CAMA 1XTDA 4DV1L 5GROA 4A3KH 4JBWA 1PYSB 1G291 1FL0A 2NVTH 1I5FA 5IP7H 3J81i 4A75A 4JI2L 2R93H 4DV3L 2JA8H 1G6PA 3E0EA 5IYDH 4A4IA 4GOPC 1CUKA 3NBHB 3PIPA 3E9IA 3Q8DA 1HZBA 3WWVA 2RCNA 3J81j 1YBYA 4DV2L 1IBLL 4RMFA 2B63G 2HQLA 4X64L 2EQSA 4BBSG 2RHQB 2R7ZG 1D7QA 2Q2IA 1QZHA 3F2BA 2CQOA 2E2HH 5ELNA 3CPWA 2NVXH 3M9BA 3PUWA 3UE0A 1VQ7A 4DR7L 1T9HA 4B3TQ 1GO3E 4GKKQ 1WCMG 2N49A 4XTCS 4YWLA 1KL9A 4BY1H 3A0JA 3UDXA 1IZ6A 1QZGA 2OQKA 2C35B 3FHWA 3J7ZC 4UP9A 4JI0Q 3PUVA 5K36G 4HJ5A 1SFOH 5IY0A 4GOPA 2K52A 3T1HL 3HKZE 1CKNA 2QEXA 2ZM6L 5IP9H 2VS1A 3HFZB 3HOYH 2R6GA 1X6OA 3PSIA 4X66L 1L1OB 1UE1A 1EIFA 1YI2A 1K73C 1N34Q 2MO0A 1N9WA 4JI1L 5DLQE 1E24A 4DAYB 3KF6A 5JEAJ 4A93H 1HJPA 4X65L 1Y1WG 1IBKL 1C0AA 3CCQA 3KDFB 2D0OA 5IWAQ 1I94Q 4DR6L 2WAQE 4GLVB 1L2FA 2F52A 4R4TA 1YIJA 4A3LH 3W1GA 4JCVE 2B63H 2QGQA 4L5SA 1FJGL 3CCJA 1W2BA 3CCRA 5HGQA 2MFIA 4DR1Q 1VQIA 1Z9FA 4QQBX 3TS0A 4GS3A 2OWOA 1NMGA 3K81C 1XNQQ 2I0QA 4LW1A 4KHPQ 3KF8B 2N8NA 4JOIA 3CCVA 1HNXQ 3CCLA 1CKNB 3G4SA 3KJPA 1N32Q 3I4NH 2ID0A 3I2ZA 2FXQA 1SROA 4ME3A 3J80c 3FP9A 4YY3L 1X9NA 1IBMQ 2I5LX 4AH6A 4DNIA 4JI7L 5JJLA 3S17H 4GN5A 5E7NA 2GVBA 4LF4L 5C0XI 4DV0L 4JI3Q 3PO3H 4JI5Q 3RZOH 3ULPA 3HOWG 4LF8L 4LF5Q 1O7IA 2VQFL 4DR5Q 1PH5A 3S2HH 1L0WA 1YZ6A 3TEHB 1XMQQ 2JA5G 1X55A 4NXNQ 1WI5A 1YJ9A 3OTOL 3CD6A 3AFQA 4MTNA 3RZDH 4OWTB 3GTKH 4UP7A 1JMCA 2DGYA 3ERSX 2CWAA 2RF4A 3NELA 4HIDA 2UUAL 3HOVH 3J7A5 1XPOA 3K7UC 1KRTA 3UDGA 2NZOA 4BBRG 2YTVA 1XPRA 3PF4A 3BJUA 4JG2A 4YWMA 4K0KL 1HZAA 4JI8Q 5C44G 4JI5L 4JI2Q 4DR6Q 4A3FH 4QGUA 1KC8C 4LF7Q 4A3JG 1X3FA 2NN6I 3S14H 3UDIA 1HNZL 2AWOA 2UU9Q 2VQEQ 4Y52H 3TQYA 1SLJA 1XMOQ 4YHHQ 3GDEA 4A3MG 2IX0A 1BKBA 2IHEA 2IHFA 3GTLH 1J5EQ 4QY7A 1K8GA 4DV7Q 4LUVA 5ELOA 1U0LA 2I5MX 1QVCA 2R93G 1SN8A 1VQFA 4LFAL 3A74A 1VQ6A 3UDFA 1YEZA 3D31A 3E9HA 2IY5B 1A0IA 1TXYA 1QUQA 2AMCB 4BA1I 2BA0A 1A63A 2VQFQ 5JEAG 4HJ9A 1VQDA 1VQAA 3KDFA 5IE8A 1C7YA 3L0OA 4IOCA 2K4KA 1WCMH 4JV5L 1K3RA 3FKIG 2VUMH 5EAYA 4HIOA 3OTOQ 4C2MH 3HOUG 3K0XA 4C3JH 5IYDG 2UXBQ 3F8TA 2L15A 4X66Q 3L2PA 1YHAA 4PZ6A 3U58A 1EOVA 3B6YA 5FLXc 3A5UA 2MQHA 4IPHA 4DV4L 1TWFH 3STBC 3G71A 5FJ8G 2A19A 4KI0A 5M5YH 1HH2P 5BR8L 5C3EG 1PH2A 1BBUA 1FVIA 1VQ4A 1PH7A 4DR3Q 1VQ8A 2E5LQ 2JA6H 4BY7H 3K7AH 3JAMc 3LGJA 3F1ZA 5M3MH 3CC7A 2D62A 1XNRL 4JYAL 3F2CA 1BVSA 1P16A 5M5WH 1HNWL 1YNXA 1OXTA 2JEAI 4OO1G 1XMOL 2UXBL 4KHZA 4IPCA 1UWVA 2E8GA 4PG3A 3ICEA 1HZCA 4BBRH 4UY8C 2UXCQ 4HJ7A 1PH6A 4DV4Q 1E1OA 4NXNL 2B3GA 2Z6KC 4DV2Q 4A3MH 3T1YQ 5C4JH 3RLNA 5LMUL 1AE2A 5IYBG 3KF6B 4A3DG 4JI3L 5C3EH 4DV0Q 4DV6L 4A3CG 3L7ZC 4IPDA 1CSPA 1VQPA 1V1QA 5IWAL 4A3IG 1Q82C 3STBD 1I94L 3S1NH 3HOUH 3H0GH 2HIVA 2PQAB 5C4XH 4X65Q 3TS2A 2UXCL 4JC0A 1M90C 1NTGA 4XIGS 2ATWA 4GKJL 1CSQA 2WFWA 4J15A 4YCVA 4B3SQ 4C3IH 4L5TA 2K50A 4YWKA 3ULLA 2YV5A 5FJ8H 1UEBA 1VQCA 4GNXB 1MIUA 2VZAA 3JC66 1LUZA 2BH2A 4P73A 1PH9A 1U5KA 2BH8A 4GNXC 4OONA 1KD1C 1JJ2A 2NVYH 2ZJQA 4L5RC 4LF7L 2K5NA 3MXNB 4JI8L 1LTLA 1UE5A 4PZ8A 4O2DA 1R9TH 4FDBA 5IYCG 1Y1VH 1IBKQ 1W3SA 1PYBA 1Q1BA 1VQEA 2N78A 1D8LA 2JK8A 2OQ0A 2PMZE 3CCEA 1YVCA 4DR3L 3I4MH 1Q1EA 4EQ5A 1CKOA 1K0RA 1EYGA 1NBWA 4DPGA 4A3FG 2N3SA 3GTGH 3PO2H 1EQQA 5GAGC 1X3GA 4WJ4A 1L1OC 2XGTA 4A3IH 4LFBL 2UXDQ 3BZKA 4LFCL 1S3OA 4B3RQ 2PI2E 3M85A 3T1YL 1VQGA 3M4PA 1Q8KA 3PO3G 1KAWA 2E2JH 1KXLA 2DUDA 4X62Q 1C9OA 4GLXA 3NENA 1TWCH 3HOVG 4AYBE 4DV5Q 4A76A 2OTLA 1E22A 1Q7YC 1XPUA 2AWNA 2KCMA 4DK6C 4JBKA 1N32L 1JT8A 2WAQG 2ZTEA 2Q2TA 4NPSA 4HJ8A 1X54A 2UUBL 1PV4A 4DAMA 5IP7G 4NB3A 1KHIA 4A3JH 1UE7A 3M4OH 4LF4Q 1QUQB 3D0FA 4QL5A 3AQQA 3HOXH 1HNZQ 2UU9L 4JI7Q 1FGUA 5LMNQ 3T1HQ 1GM5A 4HIKA 2V1CC 3RNUA 4JI6Q 5C0XJ 5JJKA 1PFSA 1NE3A 1MJEA 1J6QA 1SMXA 5GADC 4APVA 2JJQA 5FLMG 3J81c 3CP0A 2NVQH 3CCMA 1N33Q 5C0XG 3CMAA 3I56A 3ZJYC 3I4OA 4RG1A 1JJCB 2A1AA 4A3EG 2OTJA 2I5HA 4QJFA 2CKZB 2IT1A 4A3BH 3GTQH 2YU9H 1E7ZA 1OXSC 3CC4A 2Q2UA 4AIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3G H;  1IXR A;  2F4V Q;  2R92 H;  2WB1 G;  2R7Z H;  4PZ7 A;  1E1T A;  2KHJ A;  1VS0 A;  4JOI C;  2JA7 G;  2WB1 E;  5GAH C;  2A8V A;  3OYY A;  1LM0 A;  2CFM A;  2NZH A;  1IBM L;  2Z6K A;  4HIM A;  2UXD L;  3HKZ G;  1B70 B;  1QVG A;  1WOC A;  4ALP A;  1JJG A;  4DR5 L;  1JE5 A;  3PF5 A;  1YHB A;  4DV5 L;  4YCU A;  1VQH A;  5AJ3 Q;  1I3Q H;  4OX9 L;  5H1S E;  2ZJP A;  1NY4 A;  1P8L A;  3K8A A;  4DUY L;  5IP9 G;  2KEN A;  2R92 G;  3EBE A;  3KYH C;  1ASZ A;  4LF8 Q;  1FJG Q;  4NXM L;  1A8V A;  1KQS A;  2CCZ A;  4IJH A;  1VQ5 A;  4JI6 L;  3M4Q A;  3CF5 A;  2KHI A;  3FKI H;  4TQU S;  2VY3 A;  1PHJ A;  3RN5 A;  5IT9 c;  1L1O A;  3CQZ H;  4A3B G;  4DR7 Q;  3W5O A;  2UUA Q;  2IX1 A;  3RR5 A;  3AEV A;  1K9M C;  4LUO A;  4DR1 L;  2NN6 G;  4IJL A;  4P74 A;  1I50 H;  1N36 Q;  4GN4 B;  2PQA A;  4OWX B;  2JEB I;  1OXU A;  2BA1 A;  1S40 A;  3GTP H;  1V43 A;  2ZJR A;  1XNQ L;  1B7Y B;  5FLM H;  3CW2 C;  4POG A;  2HIX A;  1Q12 A;  2RHS B;  2JA5 H;  3HOZ H;  2VQE L;  4BBS H;  4DK3 C;  3GO5 A;  3UE1 A;  4TVA B;  4YY3 Q;  1Y1W H;  3S1M H;  5C4X G;  3U50 C;  2ZTD A;  4GNX A;  1HR0 Q;  3SGI A;  4BXX G;  2LXK A;  4JI4 L;  4KLK A;  4AQY L;  4H02 A;  4A3D H;  1CKM A;  4LF6 Q;  1NMF A;  4R4O A;  1K83 H;  2YTY A;  4DR4 Q;  1N36 L;  2EXD A;  2LXJ A;  1Z47 A;  4X64 Q;  3KFU A;  1X65 A;  2UUC L;  1N33 L;  1X56 A;  1XJV A;  3GTM H;  1SRU A;  3CC2 A;  3CME A;  3JAM i;  1OXV A;  3S1R H;  3HOY G;  1VQN A;  3HOW H;  4PMW A;  1MKH A;  2YTX A;  4K0K Q;  1E3P A;  1Q46 A;  4GOP B;  3H0G G;  1WFQ A;  4GN3 B;  3CCS A;  1YIT A;  3I4N G;  4A3K G;  1EIY B;  5LMN L;  3PUZ A;  1ASY A;  4JI0 L;  4JBJ A;  4LWC A;  3CPF A;  4IO9 A;  3W1B A;  4DR4 L;  1M1K C;  4B3M Q;  1VQ9 A;  1PA6 A;  4UP8 A;  1PVO A;  1VQL A;  1J5E L;  1VQO A;  1JB7 A;  3J80 i;  1N34 L;  1Q81 C;  1XNR Q;  1EQR A;  2XTI A;  2Y0S G;  5C44 H;  4JYA Q;  3EN2 A;  1IYJ B;  4QIW E;  4X62 L;  3GTO H;  1RL2 A;  1H95 A;  2CWP A;  3PV0 A;  4P75 A;  4HJA A;  1TWG H;  5BR8 Q;  1S72 A;  1VCI A;  1IBL Q;  2HHH Q;  3H15 A;  4O0A A;  2MNA A;  5M5X H;  4A93 G;  3AYH B;  1LYL A;  4LNQ A;  2R7D A;  2MO1 A;  4IFD G;  1AH9 A;  2YYZ A;  1SR3 A;  2PI2 A;  4B3T L;  4GKK L;  1VQK A;  4R1J A;  3OW2 A;  4Y7N H;  1SE8 A;  2AKW B;  5GQO A;  3PIO A;  2JA9 A;  4JV5 Q;  2ZTC A;  4R4C A;  4X6A H;  2K5H A;  1V9P A;  4AYB G;  2QA4 A;  1Q86 C;  4JI4 Q;  2ASB A;  4A3L G;  4R4Q A;  4B3R L;  1YHQ A;  4R4I A;  1VQJ A;  4LFB Q;  3HOX G;  2K14 A;  5IYC H;  2VL6 A;  3ULJ A;  2GN5 A;  2HHH L;  4OX9 Q;  1VQM A;  1B8A A;  2UUC Q;  1EFW A;  4LFA Q;  4C3H H;  3I4M G;  1Y14 B;  1G51 A;  1N8R C;  2Z0S A;  3KLW A;  2F4V L;  4OO1 I;  4L5Q A;  4EX5 A;  3PUY A;  5LMN W;  3GD7 A;  4DV7 L;  4POF A;  1XMQ L;  4B3S L;  4JBM A;  3S15 H;  3G6E A;  2VW9 A;  4UPA A;  1K8A C;  3M3Y H;  4LF9 L;  1YJW A;  1OXX K;  2JA6 G;  2OCE A;  4OXP A;  3S24 A;  2E2I H;  2AHO B;  2WP8 J;  1RIP A;  4A3C H;  4P71 A;  3ER0 A;  5HY6 A;  4DUZ Q;  4DR2 Q;  3KOJ A;  1HZ9 A;  3K80 C;  1YJN A;  1TWH H;  1HR0 L;  2JA7 H;  3M7N A;  2EIF A;  1UE6 A;  4DKA C;  3F2D A;  2JA8 G;  1KIX A;  3GTJ H;  3I55 A;  1HNX L;  3S2D H;  2JE6 I;  3PGZ A;  2R7F A;  4DUY Q;  4A3E H;  2JQO A;  5GAE C;  5AJ3 L;  5M3F H;  2PNH A;  2VNU D;  4LF9 Q;  4LF6 L;  3G48 A;  2ALY B;  4DV1 Q;  1PH1 A;  3CCU A;  5M3M G;  3U4Z A;  3VDY A;  3HOZ G;  4AQY Q;  4LF5 L;  3PCO B;  4MNO A;  4GKJ Q;  1OTC A;  1Y1V G;  5IYB H;  4MZ9 A;  4YHH L;  1NJI C;  3TRZ A;  3A5Z B;  2K5V A;  2Y0S E;  4YCW A;  1EWI A;  3MEF A;  4DUZ L;  4DR2 L;  2K75 A;  2E5L L;  3NEM A;  3RN2 A;  1X3E A;  1PH3 A;  4BXX H;  2B29 A;  5J3B A;  4IFD I;  3U4V A;  5LMU Q;  1AE3 A;  2KBN A;  3HKS A;  3PO2 G;  3KJO A;  4IOA A;  3DM3 A;  1GKH A;  2HT1 A;  5M3F G;  3S1Q H;  4KHP L;  4B3M L;  4OWW B;  3BU2 A;  3S16 H;  3EIV A;  2GVA A;  1VQB A;  1WJJ A;  1BBW A;  3DLL A;  1PH8 A;  3IRB A;  4LUZ A;  4IFD J;  4BY1 G;  2D0P A;  4LFC Q;  3RLF A;  3CXC A;  3PUX A;  3RLO A;  4DV6 Q;  2ZM6 Q;  1QVF A;  2ES2 A;  2H5X A;  1GVP A;  4DV3 Q;  1TWA H;  4NXM Q;  4IPG A;  4WJ3 M;  1PH4 A;  1I6H H;  1DGS A;  1WYD A;  3H3V H;  1IL2 A;  1EUJ A;  1MJC A;  1HR0 W;  1A62 A;  4GLA C;  2VUM G;  4BA2 I;  2KCT A;  1KRS A;  3BZC A;  4P72 A;  2LSS A;  3TRE A;  3I7F A;  5JJI A;  3AFP A;  4JI1 Q;  1GD7 A;  2UUB Q;  4BY7 G;  1HNW Q;  3H3V I;  2Q2H A;  4A3G G;  2F3I A;  3CAM A;  1XTD A;  4DV1 L;  5GRO A;  4A3K H;  4JBW A;  1PYS B;  1G29 1;  1FL0 A;  2NVT H;  1I5F A;  5IP7 H;  3J81 i;  4A75 A;  4JI2 L;  2R93 H;  4DV3 L;  2JA8 H;  1G6P A;  3E0E A;  5IYD H;  4A4I A;  4GOP C;  1CUK A;  3NBH B;  3PIP A;  3E9I A;  3Q8D A;  1HZB A;  3WWV A;  2RCN A;  3J81 j;  1YBY A;  4DV2 L;  1IBL L;  4RMF A;  2B63 G;  2HQL A;  4X64 L;  2EQS A;  4BBS G;  2RHQ B;  2R7Z G;  1D7Q A;  2Q2I A;  1QZH A;  3F2B A;  2CQO A;  2E2H H;  5ELN A;  3CPW A;  2NVX H;  3M9B A;  3PUW A;  3UE0 A;  1VQ7 A;  4DR7 L;  1T9H A;  4B3T Q;  1GO3 E;  4GKK Q;  1WCM G;  2N49 A;  4XTC S;  4YWL A;  1KL9 A;  4BY1 H;  3A0J A;  3UDX A;  1IZ6 A;  1QZG A;  2OQK A;  2C35 B;  3FHW A;  3J7Z C;  4UP9 A;  4JI0 Q;  3PUV A;  5K36 G;  4HJ5 A;  1SFO H;  5IY0 A;  4GOP A;  2K52 A;  3T1H L;  3HKZ E;  1CKN A;  2QEX A;  2ZM6 L;  5IP9 H;  2VS1 A;  3HFZ B;  3HOY H;  2R6G A;  1X6O A;  3PSI A;  4X66 L;  1L1O B;  1UE1 A;  1EIF A;  1YI2 A;  1K73 C;  1N34 Q;  2MO0 A;  1N9W A;  4JI1 L;  5DLQ E;  1E24 A;  4DAY B;  3KF6 A;  5JEA J;  4A93 H;  1HJP A;  4X65 L;  1Y1W G;  1IBK L;  1C0A A;  3CCQ A;  3KDF B;  2D0O A;  5IWA Q;  1I94 Q;  4DR6 L;  2WAQ E;  4GLV B;  1L2F A;  2F52 A;  4R4T A;  1YIJ A;  4A3L H;  3W1G A;  4JCV E;  2B63 H;  2QGQ A;  4L5S A;  1FJG L;  3CCJ A;  1W2B A;  3CCR A;  5HGQ A;  2MFI A;  4DR1 Q;  1VQI A;  1Z9F A;  4QQB X;  3TS0 A;  4GS3 A;  2OWO A;  1NMG A;  3K81 C;  1XNQ Q;  2I0Q A;  4LW1 A;  4KHP Q;  3KF8 B;  2N8N A;  4JOI A;  3CCV A;  1HNX Q;  3CCL A;  1CKN B;  3G4S A;  3KJP A;  1N32 Q;  3I4N H;  2ID0 A;  3I2Z A;  2FXQ A;  1SRO A;  4ME3 A;  3J80 c;  3FP9 A;  4YY3 L;  1X9N A;  1IBM Q;  2I5L X;  4AH6 A;  4DNI A;  4JI7 L;  5JJL A;  3S17 H;  4GN5 A;  5E7N A;  2GVB A;  4LF4 L;  5C0X I;  4DV0 L;  4JI3 Q;  3PO3 H;  4JI5 Q;  3RZO H;  3ULP A;  3HOW G;  4LF8 L;  4LF5 Q;  1O7I A;  2VQF L;  4DR5 Q;  1PH5 A;  3S2H H;  1L0W A;  1YZ6 A;  3TEH B;  1XMQ Q;  2JA5 G;  1X55 A;  4NXN Q;  1WI5 A;  1YJ9 A;  3OTO L;  3CD6 A;  3AFQ A;  4MTN A;  3RZD H;  4OWT B;  3GTK H;  4UP7 A;  1JMC A;  2DGY A;  3ERS X;  2CWA A;  2RF4 A;  3NEL A;  4HID A;  2UUA L;  3HOV H;  3J7A 5;  1XPO A;  3K7U C;  1KRT A;  3UDG A;  2NZO A;  4BBR G;  2YTV A;  1XPR A;  3PF4 A;  3BJU A;  4JG2 A;  4YWM A;  4K0K L;  1HZA A;  4JI8 Q;  5C44 G;  4JI5 L;  4JI2 Q;  4DR6 Q;  4A3F H;  4QGU A;  1KC8 C;  4LF7 Q;  4A3J G;  1X3F A;  2NN6 I;  3S14 H;  3UDI A;  1HNZ L;  2AWO A;  2UU9 Q;  2VQE Q;  4Y52 H;  3TQY A;  1SLJ A;  1XMO Q;  4YHH Q;  3GDE A;  4A3M G;  2IX0 A;  1BKB A;  2IHE A;  2IHF A;  3GTL H;  1J5E Q;  4QY7 A;  1K8G A;  4DV7 Q;  4LUV A;  5ELO A;  1U0L A;  2I5M X;  1QVC A;  2R93 G;  1SN8 A;  1VQF A;  4LFA L;  3A74 A;  1VQ6 A;  3UDF A;  1YEZ A;  3D31 A;  3E9H A;  2IY5 B;  1A0I A;  1TXY A;  1QUQ A;  2AMC B;  4BA1 I;  2BA0 A;  1A63 A;  2VQF Q;  5JEA G;  4HJ9 A;  1VQD A;  1VQA A;  3KDF A;  5IE8 A;  1C7Y A;  3L0O A;  4IOC A;  2K4K A;  1WCM H;  4JV5 L;  1K3R A;  3FKI G;  2VUM H;  5EAY A;  4HIO A;  3OTO Q;  4C2M H;  3HOU G;  3K0X A;  4C3J H;  5IYD G;  2UXB Q;  3F8T A;  2L15 A;  4X66 Q;  3L2P A;  1YHA A;  4PZ6 A;  3U58 A;  1EOV A;  3B6Y A;  5FLX c;  3A5U A;  2MQH A;  4IPH A;  4DV4 L;  1TWF H;  3STB C;  3G71 A;  5FJ8 G;  2A19 A;  4KI0 A;  5M5Y H;  1HH2 P;  5BR8 L;  5C3E G;  1PH2 A;  1BBU A;  1FVI A;  1VQ4 A;  1PH7 A;  4DR3 Q;  1VQ8 A;  2E5L Q;  2JA6 H;  4BY7 H;  3K7A H;  3JAM c;  3LGJ A;  3F1Z A;  5M3M H;  3CC7 A;  2D62 A;  1XNR L;  4JYA L;  3F2C A;  1BVS A;  1P16 A;  5M5W H;  1HNW L;  1YNX A;  1OXT A;  2JEA I;  4OO1 G;  1XMO L;  2UXB L;  4KHZ A;  4IPC A;  1UWV A;  2E8G A;  4PG3 A;  3ICE A;  1HZC A;  4BBR H;  4UY8 C;  2UXC Q;  4HJ7 A;  1PH6 A;  4DV4 Q;  1E1O A;  4NXN L;  2B3G A;  2Z6K C;  4DV2 Q;  4A3M H;  3T1Y Q;  5C4J H;  3RLN A;  5LMU L;  1AE2 A;  5IYB G;  3KF6 B;  4A3D G;  4JI3 L;  5C3E H;  4DV0 Q;  4DV6 L;  4A3C G;  3L7Z C;  4IPD A;  1CSP A;  1VQP A;  1V1Q A;  5IWA L;  4A3I G;  1Q82 C;  3STB D;  1I94 L;  3S1N H;  3HOU H;  3H0G H;  2HIV A;  2PQA B;  5C4X H;  4X65 Q;  3TS2 A;  2UXC L;  4JC0 A;  1M90 C;  1NTG A;  4XIG S;  2ATW A;  4GKJ L;  1CSQ A;  2WFW A;  4J15 A;  4YCV A;  4B3S Q;  4C3I H;  4L5T A;  2K50 A;  4YWK A;  3ULL A;  2YV5 A;  5FJ8 H;  1UEB A;  1VQC A;  4GNX B;  1MIU A;  2VZA A;  3JC6 6;  1LUZ A;  2BH2 A;  4P73 A;  1PH9 A;  1U5K A;  2BH8 A;  4GNX C;  4OON A;  1KD1 C;  1JJ2 A;  2NVY H;  2ZJQ A;  4L5R C;  4LF7 L;  2K5N A;  3MXN B;  4JI8 L;  1LTL A;  1UE5 A;  4PZ8 A;  4O2D A;  1R9T H;  4FDB A;  5IYC G;  1Y1V H;  1IBK Q;  1W3S A;  1PYB A;  1Q1B A;  1VQE A;  2N78 A;  1D8L A;  2JK8 A;  2OQ0 A;  2PMZ E;  3CCE A;  1YVC A;  4DR3 L;  3I4M H;  1Q1E A;  4EQ5 A;  1CKO A;  1K0R A;  1EYG A;  1NBW A;  4DPG A;  4A3F G;  2N3S A;  3GTG H;  3PO2 H;  1EQQ A;  5GAG C;  1X3G A;  4WJ4 A;  1L1O C;  2XGT A;  4A3I H;  4LFB L;  2UXD Q;  3BZK A;  4LFC L;  1S3O A;  4B3R Q;  2PI2 E;  3M85 A;  3T1Y L;  1VQG A;  3M4P A;  1Q8K A;  3PO3 G;  1KAW A;  2E2J H;  1KXL A;  2DUD A;  4X62 Q;  1C9O A;  4GLX A;  3NEN A;  1TWC H;  3HOV G;  4AYB E;  4DV5 Q;  4A76 A;  2OTL A;  1E22 A;  1Q7Y C;  1XPU A;  2AWN A;  2KCM A;  4DK6 C;  4JBK A;  1N32 L;  1JT8 A;  2WAQ G;  2ZTE A;  2Q2T A;  4NPS A;  4HJ8 A;  1X54 A;  2UUB L;  1PV4 A;  4DAM A;  5IP7 G;  4NB3 A;  1KHI A;  4A3J H;  1UE7 A;  3M4O H;  4LF4 Q;  1QUQ B;  3D0F A;  4QL5 A;  3AQQ A;  3HOX H;  1HNZ Q;  2UU9 L;  4JI7 Q;  1FGU A;  5LMN Q;  3T1H Q;  1GM5 A;  4HIK A;  2V1C C;  3RNU A;  4JI6 Q;  5C0X J;  5JJK A;  1PFS A;  1NE3 A;  1MJE A;  1J6Q A;  1SMX A;  5GAD C;  4APV A;  2JJQ A;  5FLM G;  3J81 c;  3CP0 A;  2NVQ H;  3CCM A;  1N33 Q;  5C0X G;  3CMA A;  3I56 A;  3ZJY C;  3I4O A;  4RG1 A;  1JJC B;  2A1A A;  4A3E G;  2OTJ A;  2I5H A;  4QJF A;  2CKZ B;  2IT1 A;  4A3B H;  3GTQ H;  2YU9 H;  1E7Z A;  1OXS C;  3CC4 A;  2Q2U A;  4AIM A; 
#chains in the Genus database with same CATH topology
 1WTP A;  1S5F D;  1SE3 A;  2WB1 G;  4PZ7 A;  1TWF B;  1E0B A;  4LJZ C;  2MGS A;  5GAH C;  1WTW A;  2A8V A;  1IBM L;  1LM0 A;  2CFM A;  4KKS A;  2QEJ C;  4A3E B;  2Z6K A;  3HKZ G;  3D4D A;  3I8Z A;  3E3X A;  4RHS A;  3CHB D;  1JE4 A;  1TQO A;  4A3B B;  2KEC A;  1CA5 A;  1LV9 A;  1YHB A;  2WB1 B;  4DV5 L;  4YCU A;  4V19 0;  2P5Z X;  4QB4 A;  2KEN A;  3KBX A;  1W6K A;  1RHP A;  3M4Q A;  3FKI H;  1PHJ A;  3RN5 A;  1K0S A;  1ICW A;  5IT9 c;  1PTO F;  3CQZ H;  4A3B G;  1SFO B;  3W5O A;  3RR5 A;  1K9M C;  4IJL A;  2PQA A;  2JEB I;  2DNE A;  1UNS A;  5FLM H;  2RHS B;  4KY5 A;  2JA5 H;  4G57 A;  2VQE L;  1TS4 A;  1MD2 D;  2WII B;  4P2C B;  2NZ1 D;  4PV1 C;  2ZTD A;  5A35 A;  4JPB W;  4KLK A;  3FEW X;  4H02 A;  1CKM A;  3VR4 A;  1NMF A;  1R4Q B;  1SMY D;  1K83 H;  2XWB B;  4R4O A;  4DR4 Q;  4RKL A;  2EXD A;  2KQ3 A;  4RA8 A;  2KED A;  4B9W A;  1Z47 A;  4X64 Q;  1N33 L;  1X56 A;  3GTM H;  1SRU A;  3CC2 A;  4PNY A;  3JAM i;  1OXV A;  5DNF A;  3S1R H;  3HOY G;  3SDZ A;  2HQE A;  1MKH A;  2YTX A;  1O78 A;  1BO0 A;  3H0G G;  4GN3 B;  3A7L A;  3V05 A;  1M8A A;  4F87 A;  4A3K G;  1EIY B;  3Q6S A;  4RGM A;  2Z4I A;  1VQ9 A;  1PA6 A;  1O80 A;  1VQO A;  1J5E L;  3OIQ A;  3M4Y A;  1Q81 C;  1XNR Q;  1EQR A;  2Y0S G;  3MXN A;  4RAU C;  2WAQ B;  1BDO A;  1BF4 A;  1H95 A;  2CWP A;  1D5X C;  1JC7 A;  3I90 A;  3AYH B;  5C4H A;  1VDZ A;  3TZD A;  4K6D A;  1X3Q A;  2YYZ A;  3LWU A;  1VQK A;  2F0V A;  3P7J A;  3NHH A;  1BOS A;  1ET9 A;  2E2H B;  3RD4 A;  1DON A;  2XNA C;  1E2V A;  4H13 C;  4XYQ A;  3S1Q B;  1TT2 A;  4A3D B;  3BYY B;  4DXG A;  2QA4 A;  4A3L G;  2F0Q A;  4B3R L;  4R4Q A;  4OO1 H;  2O5J C;  4R4I A;  1VQJ A;  4LFB Q;  5FLX E;  4C56 C;  2VL6 A;  1BR9 A;  4IUR A;  3R2I A;  2N55 A;  4UDU C;  1B8A A;  2A68 D;  4IUU A;  1VQM A;  1EFW A;  4LFA Q;  1G51 A;  2Z0S A;  2F4V L;  3PUY A;  4C3I B;  4DV7 L;  4JBM A;  4POF A;  4CKE A;  1A6X A;  5M5W B;  1LTI D;  4HCE A;  2DNC A;  1SND A;  3MFY A;  1K8A C;  4LF9 L;  3M3Y H;  4FYD A;  1OXX K;  2L11 A;  1SYC A;  3L9A X;  2A73 B;  4N9P A;  1EY8 A;  1RIP A;  1SNC A;  4P71 A;  5HY6 A;  4DUZ Q;  4DR2 Q;  3KOJ A;  4NW2 A;  1HR0 L;  2JA7 H;  2EIF A;  4FO2 A;  1X3P A;  2SOB A;  4E6I A;  3GTJ H;  4C3I G;  1HUM A;  2BE5 C;  2E74 C;  2XVS A;  2R7F A;  4Z9C B;  1LTS D;  2JQO A;  3FMC A;  3F2U A;  1G2T A;  1HTP A;  1B3Q A;  4K8I A;  3S16 B;  4F8M A;  4AQY Q;  4LF5 L;  3PCO B;  4MNO A;  3SEB A;  1OTC A;  4K5W A;  4MZ9 A;  2FMC A;  2XRS D;  3TRZ A;  4CDE C;  2Y0S E;  4XQQ A;  1EWI A;  2Z4H A;  1ET6 A;  3T56 B;  3VR6 A;  4BXX H;  2BCO A;  3K6O A;  2ZXO A;  3LNN A;  2KBN A;  3HKS A;  4IOA A;  4CDC C;  1SYF A;  2KCN A;  3SK6 A;  3EIV A;  1VQB A;  2ZT9 C;  2WAC A;  5JOB A;  1PH8 A;  3IRB A;  4LUZ A;  2AUK A;  4BY1 G;  3K0Y A;  2D0P A;  1GUO A;  2ES2 A;  4DV3 Q;  1TWA H;  4IPG A;  1CQV A;  2L9H A;  3A56 A;  5CV4 A;  3GV6 A;  2D5D A;  1EUJ A;  3OPO A;  1IL2 A;  1DOL A;  1A62 A;  4KD3 A;  1TWC B;  4GLA C;  4IQZ A;  2F0J A;  5CC4 A;  2KCT A;  3X3N A;  3AFP A;  3H3V I;  2Q2H A;  4ID6 A;  3I73 A;  3NSW A;  2Q8T A;  3D4W A;  4CDF C;  2R93 H;  3OHX C;  2K05 A;  4GOP C;  1S4Z A;  4L5R C;  3PIP A;  3Q8D A;  3BZD B;  3QOL A;  2RCN A;  3WWV A;  1YBY A;  1IBL L;  2B63 G;  1GUW A;  2HQL A;  1QZH A;  3UE0 A;  3M7G A;  1DD2 A;  1WCM G;  2N49 A;  1DM0 B;  4YWL A;  3HG9 A;  5C3W A;  3A0J A;  1D5M C;  1QZG A;  3FHW A;  3J7Z C;  4UP9 A;  1BCP C;  2ICE C;  5K36 G;  3HRZ C;  2PO4 A;  1DXM A;  3Q24 A;  3HKZ E;  4DAY A;  1CT1 D;  1I6H B;  5FO9 B;  1Z7T A;  5IP9 H;  5M3M B;  2R6G A;  3PSI A;  2CHB D;  4FP5 D;  1L1O B;  1UE1 A;  1EIF A;  4DF7 A;  5EPL A;  1E24 A;  1TVX A;  4KKT A;  4A93 H;  1C0A A;  3KDF B;  4DU9 A;  1B1Z A;  4R4T A;  1L2F A;  3IL8 A;  2QGQ A;  1I4X A;  2B2T C;  4L5S A;  2B2V C;  2K6A A;  1V1P B;  1U9R A;  1NMG A;  3K81 C;  1HNX Q;  3G4S A;  1NCV A;  2E2I B;  2QDL A;  3I2Z A;  3J80 c;  2JXM B;  1X9N A;  3OW7 A;  1JIC A;  5ELB A;  4JI7 L;  2GVB A;  5C0X I;  5KNC A;  1YNN C;  1GUG A;  4ODG A;  5AFW A;  3ULP A;  4JI5 Q;  4LF8 L;  4DR5 Q;  3S2H H;  1WI5 A;  3MA2 B;  5J1Z A;  3H09 A;  3BG3 A;  2UUA L;  3J7A 5;  5M3F B;  3MVV A;  2NN6 H;  4BBR G;  3PMF A;  1CFM A;  2F0I A;  3BJU A;  1EZ8 A;  3SE0 A;  4IUT A;  1HZA A;  1HQM C;  5C44 G;  3RUZ A;  4WOR A;  3H3V C;  4A3J G;  3QWN A;  2UU9 Q;  2AWO A;  1C8C A;  5CBA E;  2IX0 A;  1BKB A;  2ZXP A;  2IHF A;  3GTL H;  3G6J B;  3TN2 A;  4ZK9 B;  4DV7 Q;  2EOT A;  1PTO H;  5NUC A;  2HDL A;  2R93 G;  3J81 L;  1SN8 A;  2FFK B;  1JOO A;  4LFA L;  1VQ6 A;  2E75 C;  1YEZ A;  1H9K A;  4A3F B;  3D8G A;  2F0G A;  4BA1 I;  1B4O A;  5JEA G;  2B8F A;  2QF7 A;  3PO3 B;  1U4M A;  4Y7N B;  1K3B C;  2CH4 A;  2A69 D;  3HOU G;  1LAB A;  3K0X A;  1YNN D;  2CH4 W;  4XDX A;  3NPP A;  1YHA A;  1EOV A;  1IL8 A;  3A5U A;  3DMU A;  1GJX A;  5FJ8 G;  5C3E G;  5M5Y H;  2F0T A;  4DR3 Q;  2CVR A;  1U4P A;  5M5W H;  1YNX A;  1OXT A;  1VMP A;  1XMO L;  5HUR A;  2E8G A;  1PTO D;  1HZC A;  4A93 B;  4DV4 Q;  2B3G A;  2F0S A;  2NTT A;  2XN9 C;  1G2S A;  3KF6 B;  1XYI A;  2NVY B;  5C3E H;  2K5D A;  4J8Q A;  3L7Z C;  1VQP A;  1IW7 C;  2IJ0 A;  2HDM A;  4NMZ A;  3S1N H;  2HIV A;  5IGC A;  2HUG A;  4NP5 A;  3TS2 A;  4C3H B;  1A3T A;  2NTS A;  4DFA A;  1M90 C;  3AMU A;  2UXC L;  3VA5 A;  2WFW A;  1FNW A;  2H1E A;  4C3I H;  2K50 A;  1MIU A;  2M9V A;  2BH2 A;  1BUV T;  1U5K A;  1JJ2 A;  2E76 C;  2K5N A;  5EKI A;  3S2H B;  1UE5 A;  3MXG A;  1WTQ A;  4FDB A;  2JA6 B;  5ELD A;  4DNT B;  3CCE A;  4DR3 L;  1EY6 A;  2PMZ E;  5CV6 A;  1YVC A;  3I4L A;  1Q1E A;  1QE6 A;  2ICI A;  1CKO A;  4U67 3;  5I4D A;  3I4N B;  3GTG H;  3FDT A;  1L1O C;  3NE5 B;  3BZK A;  2EJF C;  3M85 A;  4FXG C;  4X3T A;  4GLX A;  4AYB E;  1H9R A;  2OTL A;  5EBC A;  2AWN A;  4J6H A;  1SYE A;  4HJ8 A;  1I4P A;  5ELE A;  2RQX A;  4DAM A;  1PV4 A;  4A3M B;  1LTB D;  1QUQ B;  5DEH A;  3L3O C;  1HNZ Q;  1FGU A;  4OEM B;  1FYC A;  3A7A B;  2G5D A;  5GAD C;  4APV A;  2X6G A;  5C0X G;  3NP8 A;  2IX3 A;  3FRP B;  4I65 A;  1T5X D;  2PW5 A;  1WTO A;  2JA7 G;  2DY7 A;  2Q2U A;  5GAG C;  5C5M A;  3GTJ B;  4J1M A;  3I4M B;  1M4V A;  1IXR A;  2F4V Q;  1I4R A;  5JEA H;  2R92 H;  2R7Z H;  3KK7 A;  2KHJ A;  2WB1 E;  1FNV A;  2VXW A;  5CGK A;  1WTX A;  1B70 B;  1WOC A;  2NB0 A;  1VF7 A;  1V1O A;  2EYF A;  4K5V A;  4DR5 L;  5EPJ A;  2JYO A;  2KCC A;  3PF5 A;  1TS2 A;  1VQH A;  1I3Q H;  4FF2 A;  1HQR D;  2NVX B;  5H1S E;  3GQB A;  3K8A A;  5C3X A;  5IP9 G;  3I3C A;  2K33 A;  2R92 G;  3VR3 A;  4LF8 Q;  1J9O A;  4NXM L;  3I91 A;  5M9O A;  5IGD A;  3SHL A;  1VQ5 A;  4JI6 L;  3CF5 A;  4QUF A;  5KRU A;  2VY3 A;  4DR7 Q;  1O7Y A;  2UUA Q;  1F9Q A;  4LUO A;  2NN6 G;  1N36 Q;  2EXZ A;  4GN4 B;  2VB3 X;  4OWX B;  1S40 A;  1OXU A;  3BDL A;  2F0H A;  1V43 A;  2ZJR A;  1B7Y B;  5TSS A;  3ND8 A;  3UE1 A;  2F0F A;  4YY3 Q;  1Y1W H;  3AB9 A;  3U50 C;  5EQ0 A;  2A5H A;  1HR0 Q;  3SGI A;  4H0L C;  4N9T A;  4AQY L;  4A3D H;  1WD0 A;  3SVM A;  2F0P A;  2F3V A;  1XJV A;  2JP1 A;  1SNM A;  3CME A;  1E2W A;  1VQN A;  4PMW A;  2QKI C;  3QJY A;  4K0K Q;  1E3P A;  3VYU A;  2B2V A;  2G9D A;  3PUZ A;  4JI0 L;  1E2Z A;  4LWC A;  1LT3 D;  2KJX A;  4B3M Q;  1R4P B;  4CKC A;  5J39 A;  5KIX A;  3J80 i;  1N34 L;  3K5L A;  1VF5 C;  2XTI A;  1SXT A;  3EN2 A;  1IYJ B;  5KYI A;  5EKK A;  1BCP B;  2L0C A;  1TWG H;  1IBL Q;  2HHH Q;  2MNA A;  1RTN A;  5M5X H;  4LNQ A;  2R7D A;  4KN4 C;  1I4G A;  1AN8 A;  2RKS A;  1TY2 A;  4Y7N H;  2I07 B;  2JA9 A;  3QB3 A;  4JV5 Q;  1F9R A;  4R4C A;  4X6A H;  4ZCK A;  3NTK A;  2ASB A;  1HRJ A;  1MSG A;  2K14 A;  3NWT A;  3BVM A;  5M5Y B;  5KNB A;  1N8R C;  1SYB A;  4OO1 I;  1EYD A;  1JR0 D;  1L0X B;  4EX5 A;  4HED A;  5LMN W;  1XMQ L;  3S15 H;  2VW9 A;  1EZ6 A;  4CJ2 C;  1D5Z C;  2FMM A;  4UPA A;  4QMG A;  3R3O A;  3BS1 A;  3ER0 A;  3OWE B;  1HZ9 A;  3KBG A;  3DWQ A;  3F2D A;  3MXP A;  3PGZ A;  3HP3 A;  4DUY Q;  4A3E H;  2ZXR A;  5AJ3 L;  5IT9 E;  3E5S A;  2PNH A;  2VNU D;  4QF4 A;  1XWE A;  5ISR A;  3U4Z A;  1FD7 D;  4GKJ Q;  1Y1V G;  1I3Q B;  1A2U A;  2K5V A;  4YCW A;  4DUZ L;  4DR2 L;  2K75 A;  5T1I A;  4Q5V A;  1Y1W B;  3DXJ C;  1RKN A;  3ITP A;  1PH3 A;  2Z1C A;  4EVO A;  1UEA B;  2F03 A;  5JJZ A;  4MN3 A;  5LMU Q;  3PO2 G;  3KJO A;  4OIK A;  3S1Q H;  4B3M L;  3MZ5 A;  1EY5 A;  2GVA A;  2M00 A;  2PZT A;  5FK9 C;  4IFD J;  4O42 A;  1KLG D;  5BN4 A;  5IGB A;  1DOK A;  3IFT A;  3CXC A;  3PUX A;  3RLO A;  2ZM6 Q;  2H5X A;  2V4D A;  1SEB D;  2SNM A;  5KGU A;  3HOY B;  2PYK A;  1GD7 A;  1X32 A;  1SYG A;  2F3I A;  3CAM A;  1XTD A;  5LL6 S;  1FL0 A;  3FPU B;  5IP7 H;  2K5W A;  3R8B A;  4WJW A;  4DV3 L;  2FIN B;  4ZRZ A;  1CUK A;  2IWH A;  4IUV A;  1GUN A;  2RHQ B;  5EPK A;  2R7Z G;  3WOF A;  2Q2I A;  1EU3 A;  2E2H H;  2CQO A;  5G3L F;  1DJR D;  2PZW A;  3CPW A;  3M9B A;  4DR7 L;  1LT4 D;  2L1B A;  1VQ7 A;  4GKK Q;  1NSN S;  1KL9 A;  1STH A;  2K32 A;  4A3D G;  2OQK A;  3PUV A;  1SFO H;  4FF4 A;  1BNZ A;  3T1H L;  1S5E D;  2K5Q A;  5F2D A;  1WD1 A;  3T51 B;  1CKN A;  2ZM6 L;  2VS1 A;  3HFZ B;  3HOY H;  4MTK A;  1WTR A;  2B2Y C;  2L55 A;  2MO0 A;  2R61 A;  2K04 A;  1SMY C;  4DAY B;  4X65 L;  1IBK L;  3CCQ A;  4DR6 L;  3MWY W;  2F1M A;  3E0J A;  1EQV A;  1F2M A;  1W2B A;  4H7B A;  1JOQ A;  2GA4 B;  4IUQ A;  2EYJ A;  1VQI A;  4OEL B;  3A55 A;  4GS3 A;  2MUY A;  2I0Q A;  3KF8 B;  2N8N A;  1I4H A;  3CCV A;  1LO5 D;  1N32 Q;  2I46 A;  3I4N H;  5G3L D;  4ZUI A;  1SRO A;  4C3J B;  4FXD A;  3FP9 A;  4YY3 L;  5JJL A;  3S17 H;  4GN5 A;  1PXU A;  3S1M B;  4DV0 L;  2EDG A;  5JAV A;  3HOW G;  1B9N A;  2DJF C;  4YIJ A;  3J7A F;  3NTI A;  2A6E C;  2JA5 G;  1X55 A;  4NXN Q;  1YJ9 A;  1EYA A;  3OTO L;  1QJO A;  3RZD H;  3GTK H;  4RCN A;  1PFN A;  3K58 A;  2CWA A;  2RF4 A;  2X69 A;  3NEL A;  1XPO A;  2LS0 1;  2YTV A;  3PF4 A;  1EY9 A;  4K0K L;  4JG2 A;  4DK1 A;  3HOW B;  4WFN 3;  4AYB B;  4DA2 A;  1KC8 C;  2RDF A;  4HTH A;  3UDI A;  3J7A V;  4ULL A;  2DJG C;  2E2J B;  2HCC A;  1SYD A;  3TQY A;  2WKC A;  5CR3 A;  1PFB A;  3GDE A;  4YHH Q;  3S9W A;  3Q23 A;  2PPB C;  2XWJ B;  3BDC A;  2PW7 A;  1QCB D;  4ZKC B;  1EWH A;  1QOH A;  1XTC D;  4TSS A;  4PMC A;  3GTO B;  1Q8I A;  1VQF A;  1AW7 A;  4CJ1 B;  3D31 A;  1BCP F;  4MHE A;  1QUQ A;  2VQF Q;  4HJ9 A;  2NVQ B;  1K28 A;  3K7A B;  1VQA A;  1LT6 D;  5IE8 A;  1C7Y A;  4IOC A;  2K4K A;  4JV5 L;  2VUM H;  2K01 A;  1K8O A;  1D2B A;  4X66 Q;  1C48 A;  4PZ6 A;  4KTA A;  3B6Y A;  5FLX c;  1EEF D;  5LL6 X;  4KI0 A;  5BR8 L;  4RCO A;  1VQ4 A;  1VQ8 A;  4BY7 H;  2VB2 X;  2K28 A;  3F1Z A;  4BS9 A;  3VA7 A;  4JYA L;  3WOE A;  1P16 A;  2UXB L;  5CV5 A;  4IPC A;  3TP5 A;  1PTO C;  4BBR H;  5FLX L;  1ZKO A;  4H44 C;  4UY8 C;  4HJ7 A;  4NXN L;  1AZP A;  4DV2 Q;  1A2T A;  5C4J H;  5LMU L;  4DV0 Q;  3DUZ A;  4IPD A;  1CSP A;  1KTK A;  1V1Q A;  1ONL A;  3EA6 A;  5IWA L;  4A3I G;  5FOB B;  1I94 L;  2PQA B;  5C4X H;  4N8F A;  3KF8 A;  4GKJ L;  2MP1 A;  3NXW A;  3ULL A;  1EU4 A;  2MHV A;  1UEB A;  3JC6 6;  1LTG D;  2ENB A;  1LUZ A;  4HN7 A;  4G7H C;  3HS0 C;  4DNR B;  1KD1 C;  2PMZ B;  4OON A;  3X3M A;  3MXN B;  1STN A;  2F0W A;  3SXH A;  5IYC G;  1Y1V H;  4KV6 A;  3VYS A;  1Q1B A;  5E4X A;  3H91 A;  3NBH A;  1VQE A;  3HOV B;  2EY6 A;  1F77 A;  4M1U B;  3NQT A;  3PO2 H;  4A3F G;  2N3S A;  1NNX A;  2UXD Q;  4B3R Q;  4IUP A;  3PO3 G;  1C9O A;  3NEN A;  3MC0 B;  3G7L A;  4RWS C;  2L4N A;  4IUN A;  4A76 A;  1R9T B;  3HOV G;  4DK6 C;  2CQA A;  1JT8 A;  2ZTE A;  1STA A;  4S3S A;  2Q2T A;  4NPS A;  3ERO A;  1XX8 A;  4UAI A;  4NB3 A;  1GOZ A;  4LF4 Q;  3VYR A;  3D0F A;  3AQQ A;  4JI7 Q;  5C3E B;  3T1H Q;  2BDO A;  3RNU A;  3UI2 A;  1J6Q A;  3J81 c;  5FLM G;  2BE5 D;  3I56 A;  4C1N K;  2L5T A;  5K36 H;  2D9U A;  2RSO A;  1UAP A;  4RG1 A;  4QCL A;  4NKL A;  3C1E A;  1SJE D;  4A3B H;  3Q0A A;  1E7Z A;  5K5P A;  2EY2 A;  4AIM A;  3S2D B;  4FXK C;  3HGB A;  4ABN A;  1E1T A;  4MIU A;  1ILQ A;  2A69 C;  3OYY A;  2NZH A;  5IT9 L;  2F0D A;  3Q22 A;  2UXD L;  2N88 A;  1F2Y A;  1QVG A;  2EPB A;  1AFP A;  1JE5 A;  1ESR A;  1BBX C;  4FF3 A;  4KHV A;  4LK1 C;  3C46 A;  2ZJP A;  1NY4 A;  1P8L A;  4DUY L;  1DCZ A;  2B63 B;  3EBE A;  3KYH C;  1Y8P B;  1A8V A;  2CCZ A;  4GZY C;  2B2Y A;  1IYV A;  2IX1 A;  1HPC A;  1Z6H A;  3AEV A;  4DR1 L;  1I50 H;  3U9O A;  1QNU A;  2EJM A;  2BA1 A;  1PRT D;  4POG A;  3CW2 C;  2DN8 A;  1ROD A;  3TSS A;  1SJH D;  4DK3 C;  3GO5 A;  3S1M H;  3S17 B;  1MHW C;  1IKM A;  4GNX A;  4ZAI A;  2LFN A;  4BXX G;  4JI4 L;  3HEJ A;  1KNA A;  4LF6 Q;  1I50 B;  1N36 L;  3ERQ A;  2LXJ A;  3KFU A;  1X65 A;  3VR2 A;  3HOZ B;  4HAE A;  1NR4 A;  2EYL A;  2IPK D;  1Q46 A;  1D1I A;  2K03 A;  3VR5 A;  1WFQ A;  1PRT F;  1YIT A;  4KKU A;  3I4N G;  2B39 A;  1STE A;  4DR4 L;  4IO9 A;  3SK4 A;  3W1B A;  1M1K C;  3M3Y B;  1PVO A;  1VQL A;  2OEO A;  1PRT C;  1JB7 A;  3PIO 3;  2IW3 A;  3C3L A;  1YNJ D;  4JYA Q;  5C44 H;  2WV6 D;  4X62 L;  3GTO H;  1ESF A;  4HJA A;  5BR8 Q;  2X6L A;  1S72 A;  1VCI A;  1H9S B;  2EJG C;  4O0A A;  3H15 A;  4CJ0 B;  1LYL A;  1ZYR D;  3GTG B;  2PI2 A;  4GKK L;  2EYO A;  4EGV A;  3GTP B;  4BBR B;  3JAM E;  2VUM B;  1SE8 A;  2AKW B;  3PIO A;  2BOS A;  1BQQ T;  2ZTC A;  5C44 B;  2K5H A;  1Q86 C;  4JI4 Q;  4A3G B;  2O2L D;  1YHQ A;  3HOX G;  5IYC H;  4CKB A;  5C4Z A;  3QR8 A;  1Q3L A;  3GTM B;  1GHK A;  5ELC A;  3URY A;  2JA7 B;  2HHH L;  1CM9 A;  5CV8 A;  4OX9 Q;  3I4M G;  3TP6 A;  2A6H D;  3T16 A;  3IAY A;  3KLS X;  3D6W A;  5C5L A;  3N52 A;  4PQX A;  4K5X A;  1HFN A;  1YJW A;  2H4O A;  2D2C C;  2KEE A;  3S24 A;  3A54 A;  2AHO B;  4A3C H;  2OT2 A;  5IGG A;  3K80 C;  1TWH H;  1UE6 A;  4DKA C;  2JA8 G;  3FPP A;  1HNX L;  3I55 A;  2JE6 I;  1AZQ A;  1J8I A;  1EY4 A;  3HOU B;  2KVM A;  4LF9 Q;  4LF6 L;  3G48 A;  4DV1 Q;  3CCU A;  1IYU A;  2O4X A;  5IYB H;  1NJI C;  2JA8 B;  1JQY D;  1PZJ D;  3MTS A;  3GP7 A;  4F7X A;  3NEM A;  3RN2 A;  4XT1 B;  4TRD A;  1L0Y B;  1X3E A;  1CZW A;  5J3B A;  3U4V A;  1ZYR C;  4ZUJ A;  1GKH A;  2HT1 A;  4KN7 C;  2Z6B A;  4OWW B;  3BU2 A;  3T53 B;  2OF1 A;  1KDB A;  1EQT A;  3TDQ A;  3RLF A;  4DV6 Q;  1QVF A;  4NXM Q;  3GV3 A;  4WJ3 M;  1I6H H;  4C3H G;  1V8Q A;  1QIL A;  1HR0 W;  4KD4 A;  3IKJ A;  1WTH A;  4P72 A;  4DAP A;  4JI1 Q;  3FVQ A;  1HNW Q;  3HKZ B;  2MJ8 A;  3M4O B;  1KAA A;  1PYS B;  1G29 1;  2NVT H;  1I5F A;  5IOC A;  1STG A;  2Q8I B;  4A75 A;  2JA8 H;  5IYD H;  4A4I A;  3NBH B;  4CGY B;  4X64 L;  2F3W A;  4BBS G;  1CTM A;  3CKI B;  2NYZ D;  1SNP A;  3PUW A;  1T9H A;  2B8G A;  4B3T Q;  4Q0F A;  4BY1 H;  4LMQ D;  1I4Q A;  1MBY A;  5JVG 3;  5M5X B;  3BYT B;  4HJ5 A;  3T4A C;  5IY0 A;  2K52 A;  1SE4 A;  3NWS A;  2SEB D;  1PZK D;  3MAQ A;  5DAU A;  5A2Q L;  4X66 L;  1N34 Q;  1YI2 A;  1K73 C;  5DLQ E;  5JVH 3;  1BCP D;  1G8Z D;  1HJP A;  1Y1W G;  2D0O A;  5IWA Q;  1I94 Q;  3W2D A;  2WAQ E;  4RKB A;  3P75 A;  4JCV E;  4R8I A;  3TBI B;  2Z9H A;  1FJG L;  3CCJ A;  1ICF B;  4OIJ A;  5HGQ A;  2MFI A;  4DR1 Q;  3H0G B;  3OSO A;  3TS0 A;  4A3K B;  3RZD B;  2OWO A;  3BVG A;  1TII D;  1JJG A;  4LW1 A;  4KHP Q;  4JOI A;  1U4R A;  2RSN A;  3KJP A;  2AUJ D;  2ID0 A;  4ME3 A;  4DNI A;  5DM6 3;  2Y0S B;  5E7N A;  4QIW B;  1STB A;  4JI3 Q;  3LX0 A;  4LF5 Q;  1O7I A;  2VQF L;  1YZ6 A;  2F0M A;  3TEH B;  1XMQ Q;  4IAL A;  3CD6 A;  4UP7 A;  1JMC A;  1K83 B;  5C0X H;  1PDQ A;  5BN3 A;  3HOV H;  3R2T A;  3K7U C;  1KRT A;  3UDG A;  2NZO A;  1XPR A;  4YWM A;  1JOK A;  1MGS A;  4JI5 L;  4DR6 Q;  4A3F H;  4QGU A;  4XYO A;  1X3F A;  2NN6 I;  3S14 H;  2QIL A;  1XXG A;  3DWA A;  1TKW B;  1HNZ L;  1Y8N B;  4QUC A;  2VQE Q;  5JPM C;  1SLJ A;  1F2L A;  1EFI D;  1TS3 A;  1QNK A;  2EYM A;  3H6M A;  1PMR A;  3MEH A;  4V0B A;  2RDH A;  1U0L A;  3HZX A;  5I2X A;  2HCI A;  2AQ1 B;  1TWA B;  1C4Q A;  4N8X 1;  3E9H A;  5CYU A;  1TXY A;  1HXY D;  2AMC B;  3S1R B;  2BA0 A;  1A63 A;  3EQL C;  1VQD A;  2C9O A;  4O1N A;  3KDF A;  3NK9 A;  3L0O A;  3D3R A;  1WCM H;  1K3R A;  1NAP A;  1DYQ A;  4ZLT F;  5EAY A;  4HIO A;  3OTO Q;  1KDC A;  4C2M H;  3J81 E;  4C3J H;  5IYD G;  4UHV A;  2L15 A;  2F0O A;  3U58 A;  4ZYS A;  2L12 A;  3D6C A;  2EY5 A;  4DV4 L;  3TZU A;  1TWF H;  1H9S A;  3STB C;  2R3Z A;  3DEP A;  1PH7 A;  1BBU A;  1FVI A;  1S5B D;  2LMC B;  2A6H C;  2JA6 H;  1JOR A;  4ILW A;  1JCK B;  5M3M H;  2D62 A;  3J7Y W;  1BVS A;  1HFG A;  3ND9 A;  1JWS D;  2KHS A;  1UWV A;  2UXC Q;  2LKV A;  4PG3 A;  4C3J G;  1PH6 A;  1E1O A;  2Z6K C;  4A3M H;  3T1Y Q;  3RLN A;  1AE2 A;  5IYB G;  5D14 A;  1H9M A;  4BY1 B;  4JI3 L;  4DV6 L;  1LAC A;  1ENF A;  3NUC A;  3A8J E;  4KJN A;  2AQ2 B;  4XIG S;  3OMG A;  2XIW A;  1DOM A;  4B3S Q;  4HSP A;  4L5T A;  4YWK A;  4IFD H;  1V1P A;  5FJ8 H;  4GNX B;  3GTQ B;  1IW7 D;  2VZA A;  1T5E A;  4P73 A;  2ZJQ A;  2NVY H;  4FVM A;  4JI8 L;  1LTL A;  3OIP A;  3I72 A;  4PZ8 A;  1CZG A;  1QG7 A;  4DN4 M;  1R9T H;  4C2M B;  2PZU A;  3K57 A;  1WTV A;  4I7A A;  2JK8 A;  3I4M H;  4I7Z C;  4EQ5 A;  1ENC A;  2F0E A;  1EQQ A;  4WJ4 A;  2F0K A;  4LFB L;  5EKL A;  5I6Y A;  4LFC L;  4OL7 A;  1HA6 A;  1SE2 A;  2F0L A;  2PI2 E;  1VQG A;  3M4P A;  1Q8K A;  1B44 D;  1KAW A;  1KXL A;  2DUD A;  5I9P A;  2NUC A;  1XPU A;  5E3F A;  1E22 A;  3EVQ A;  1GHJ A;  1IHZ A;  1Q7Y C;  1Y1V B;  2KCM A;  4JBK A;  2AQ3 B;  1LT5 D;  2WAQ G;  1EWC A;  1X54 A;  2KOL A;  2UUB L;  1GUT A;  5IP7 G;  4A3J H;  1UE7 A;  1LLR D;  3LWE A;  1B9M A;  1ML0 D;  4QL5 A;  3HOX H;  2UU9 L;  4EQN A;  2JN4 A;  1TWG B;  2V1C C;  4HIK A;  1HCZ A;  5CV7 A;  1PFS A;  4KK7 A;  1RJT A;  4RHR A;  1SNO A;  2RBM A;  1SMX A;  2JJQ A;  2BDN A;  3CCM A;  3T13 A;  3CMA A;  3ZJY C;  3I4O A;  3DHQ A;  2K7V A;  1SSO A;  3MHB A;  2A1A A;  3S15 B;  2OTJ A;  2I5H A;  4QJF A;  3C1F A;  2CKZ B;  3GTL B;  2IT1 A;  1EL0 A;  1KLU D;  3A8I E;  2YU9 H;  1OXS C;  3CC4 A;  4IZ8 A;  5I9O A;  4A3G H;  1JWM D;  1Y8O B;  3ZYY X;  1YNJ C;  1TWH B;  2TSS A;  1VS0 A;  4JOI C;  2NBF A;  1F2Z A;  4HIM A;  3K5N A;  1OO9 B;  1JB3 A;  5I6W A;  3BVZ A;  5C6A A;  2CW0 D;  4ALP A;  1CK1 A;  4G7O C;  3K5M A;  5CBE E;  1LTR D;  5AJ3 Q;  5FO7 B;  4OX9 L;  3C2P A;  4DGZ A;  1EIG A;  2SDF A;  1K8M A;  1FJG Q;  1ASZ A;  3I70 A;  1KQS A;  1EIH A;  1TS5 A;  2Z8L A;  4IJH A;  2KA7 A;  2KHI A;  2XRQ D;  4TQU S;  2EE1 A;  3NBI A;  2B2W A;  1L1O A;  5C4X B;  4KY7 A;  1F9S A;  2B2U A;  1A3U A;  3PQI A;  1MI2 A;  4P74 A;  5IGF A;  4A3J B;  3GTP H;  5COY A;  4EQP A;  1XNQ L;  2HIX A;  1Q12 A;  4JW0 A;  3HOZ H;  4K14 A;  4BBS H;  3J80 E;  4CHT B;  4FF1 A;  4ME5 A;  4TVA B;  5C4X G;  2G9H D;  3A8K E;  5LHY 1;  1BXT A;  2LXK A;  4XXE A;  1CHP D;  4X3U A;  2YTY A;  2NVT B;  1ZEQ X;  4KJO A;  4WRD A;  5KYL A;  2UUC L;  1CHQ D;  2FJ2 A;  3HOW H;  5KND A;  4X3S A;  4GOP B;  3CCS A;  2A74 C;  1O7L A;  5LMN L;  1ASY A;  4JBJ A;  4K6L A;  3CPF A;  3N6R A;  4UP8 A;  1IKL A;  2FHT A;  1B2T A;  1PFM A;  1UUP A;  3VYT A;  4QIW E;  3AU7 A;  1RL2 A;  1LTT D;  3PV0 A;  4P75 A;  3QO2 A;  2JA5 B;  4A93 G;  4DK0 A;  3IFD A;  1MSH A;  2MO1 A;  4IFD G;  1AH9 A;  1SR3 A;  5DM7 3;  4B3T L;  4R1J A;  1RCV D;  4B9X A;  3OW2 A;  1WCM B;  2DY8 A;  4RFB A;  3NTH A;  5GQO A;  4CDD C;  3E6Z X;  4L8J A;  2SNS A;  1V9P A;  4AYB G;  2RA4 A;  2WKD A;  5EBD A;  1PRT B;  3ULJ A;  2GN5 A;  4RGT A;  2F0N A;  2PNR C;  1Y69 U;  5BN5 A;  2UUC Q;  4C3H H;  1Y14 B;  3V96 A;  3CU7 A;  3KLW A;  2K1B A;  5ELF A;  4L5Q A;  3GD7 A;  2RDG A;  4B3S L;  2TMP A;  3G6E A;  1WVL A;  5E4W C;  2JA6 G;  2OCE A;  4OXP A;  4BWG B;  2E2I H;  2WP8 J;  1YJN A;  1VMC A;  4U68 A;  4TKO B;  3M7N A;  1QB5 D;  1RDP D;  1KIX A;  3S2D H;  1HUN A;  3V2T A;  5GAE C;  1TY0 A;  5M3F H;  2ALY B;  1PH1 A;  2HD3 A;  5M3M G;  3VDY A;  3HOZ G;  4YHH L;  3A5Z B;  1A15 A;  3MEF A;  4JK1 C;  2E5L L;  5KEE A;  1B3A A;  1F9P A;  2B29 A;  4IFD I;  3S14 B;  4C1N I;  1AE3 A;  3DM3 A;  1A3V A;  5M3F G;  4KHP L;  4K8J A;  3S16 H;  1RTO A;  1WJJ A;  1BBW A;  3DLL A;  2J4X A;  3KLS A;  2J7Z A;  2EY1 A;  2PCF B;  4LFC Q;  4A3I B;  1GVP A;  3P1H A;  1TU2 B;  1PH4 A;  1DGS A;  1WYD A;  3H3V H;  2B2T A;  1MJC A;  2NWG A;  3R93 A;  2VUM G;  4OGQ C;  4PMB A;  1KRS A;  3BZC A;  3KUP A;  4BA2 I;  2LSS A;  3EJI A;  3I7F A;  3TRE A;  5JJI A;  2UUB Q;  4BY7 G;  3K59 A;  5D3D A;  4A3G G;  4K2K A;  4DV1 L;  5GRO A;  4A3K H;  3D4R A;  5D3I B;  4JBW A;  2O5I C;  3TME A;  1SDF A;  4R9W A;  5D65 A;  3J81 i;  4JI2 L;  3E0E A;  2QW7 A;  4HR7 B;  3E9I A;  3J81 j;  1HZB A;  3CRK C;  4DV2 L;  4BY7 B;  4RMF A;  2EQS A;  4G7Z C;  5L37 A;  1SNQ A;  1II3 A;  1D7Q A;  3F2B A;  5ELN A;  2EZV A;  1EEI D;  2WIN B;  4K2L A;  2NVX H;  3J80 L;  1GO3 E;  4XTC S;  4JVZ A;  5COR A;  4KY6 A;  2E2D C;  3UDX A;  1IZ6 A;  2C35 B;  4JI0 Q;  3QIA A;  5C4J B;  2R93 B;  5IOD A;  4GOP A;  3HOX B;  2QEX A;  3SK5 A;  1X6O A;  2OXP A;  3OMC A;  1PZI D;  2EVB A;  1N9W A;  1PYW D;  4KMU C;  5FKA C;  4JI1 L;  2JSO A;  3KF6 A;  5JEA J;  4OHJ A;  1FR3 A;  1LTA D;  4GLV B;  2F52 A;  1QWY A;  1YIJ A;  4A3L H;  3W1G A;  2B63 H;  2CW0 C;  1RF2 D;  3DM1 A;  1GXD C;  3CCR A;  3CQZ B;  4HSV A;  5IGE A;  1Z9F A;  2M2L A;  4QQB X;  5FO8 B;  2QDB A;  3W3A A;  1XNQ Q;  1ZXT A;  1AP0 A;  4FNF A;  2MPM A;  3CCL A;  2A6E D;  1CKN B;  3ONA B;  1CQF A;  4ZKB B;  1D1K A;  2FXQ A;  4RGN A;  3U9S A;  4ZQ3 A;  2I5L X;  4AH6 A;  1IBM Q;  3SK8 A;  3SR1 A;  4F88 A;  4LF4 L;  1JWU D;  3KLR A;  3PO3 H;  3RZO H;  1PH5 A;  1L0W A;  5I2Y A;  3AFQ A;  4MTN A;  4R8N A;  1I6V C;  4OWT B;  3CRL C;  2DGY A;  3ERS X;  3QG1 A;  4HID A;  1NUC A;  1RD9 D;  3QOJ A;  1PTO B;  4LAA A;  3RMH A;  4JI8 Q;  3JAM L;  4JI2 Q;  4LF7 Q;  4BBS B;  1S5D D;  3DEO A;  3WDN A;  4Y52 H;  1XMO Q;  4IN3 A;  4A3M G;  3GTK B;  2IHE A;  3BDO A;  1B50 A;  1J5E Q;  4QY7 A;  1K8G A;  4LUV A;  5ELO A;  2I5M X;  1QVC A;  3A74 A;  2IL8 A;  3UDF A;  1SAP A;  3H94 A;  5EJW A;  5T1G A;  3S1N B;  2IY5 B;  1A0I A;  4DXF A;  3MXU A;  4L63 B;  3K5O A;  2A68 C;  5JPN C;  4CBV A;  1G91 A;  4XT3 B;  3FKI G;  1PLF A;  2XSC A;  4HMI A;  3OWF A;  4HMJ A;  3O13 A;  2UXB Q;  3F8T A;  3L2P A;  2EYP A;  3OOC A;  2B2W C;  2MQH A;  3RZO B;  2QCP X;  1CI3 M;  4IPH A;  3G71 A;  1EY0 A;  1KDA A;  2F0U A;  2A19 A;  4A3C G;  1HH2 P;  1PH2 A;  5CV9 A;  2E5L Q;  3FKI B;  3K7A H;  3JAM c;  3LGJ A;  1EY7 A;  3CC7 A;  1NR2 A;  3NQI A;  3F2C A;  1XNR L;  1HNW L;  2PQE A;  2JEA I;  4OO1 G;  1AEX A;  2RCF A;  2Q8R E;  4KHZ A;  3PO2 B;  3ICE A;  1G6Z A;  3TP7 A;  1O7Z A;  3PIP 3;  1TR5 A;  2B2U C;  1CA6 A;  3DWP A;  1S5C D;  1G6P A;  1Q82 C;  1SBB B;  3STB D;  3HOU H;  3H0G H;  4X65 Q;  1STY A;  1DZ1 A;  4JC0 A;  1NTG A;  2ATW A;  1CSQ A;  5HGT A;  4J15 A;  4YCV A;  1W6J A;  2YV5 A;  1VQC A;  1KAB A;  4RH6 A;  2BH8 A;  1PH9 A;  5E1F A;  4GNX C;  2C5C A;  1HHV A;  4LF7 L;  2R92 B;  2J0T D;  4RGO S;  1KNE A;  4O2D A;  1Q90 A;  1IBK Q;  5CMD A;  1W3S A;  1PYB A;  1D8L A;  1B53 A;  2N78 A;  2OQ0 A;  2F4I A;  3TP8 A;  1ENA A;  4X3K A;  2R7Z B;  1K0R A;  1EYG A;  1H9J A;  1NBW A;  4L6T B;  4DPG A;  5IIF A;  4XQJ A;  4XQN A;  4G4K A;  1X3G A;  2XGT A;  4A3I H;  1S3O A;  2EYH A;  4HCS A;  5A2Q E;  3T1Y L;  5EGT A;  2E2J H;  4X62 Q;  1TWC H;  4DV5 Q;  5J22 A;  3P20 A;  4EQO A;  1HA5 A;  1U4L A;  1N32 L;  1D6E C;  1GUS A;  1ILP A;  2KUM A;  1KHI A;  3M4O H;  2YU9 B;  3EFX D;  2RVL A;  1GM5 A;  5LMN Q;  4JI6 Q;  5C0X J;  4NDX A;  5JJK A;  1EYC A;  1NE3 A;  1MJE A;  2NVQ H;  3CP0 A;  1N33 Q;  4B08 A;  4DAV A;  4M8A A;  1EOT A;  3MFG A;  1JJC B;  4A3E G;  1FGB D;  3GTQ H;  1HTL D;  2LY7 A;  1FNU A; 
#chains in the Genus database with same CATH homology
 4A3G H;  1IXR A;  2F4V Q;  2R92 H;  2WB1 G;  2R7Z H;  4PZ7 A;  1E1T A;  2KHJ A;  1VS0 A;  4JOI C;  2JA7 G;  2WB1 E;  5GAH C;  2A8V A;  3OYY A;  1LM0 A;  2CFM A;  2NZH A;  1IBM L;  2Z6K A;  4HIM A;  2UXD L;  3HKZ G;  1B70 B;  1QVG A;  1WOC A;  4ALP A;  1JJG A;  4DR5 L;  1JE5 A;  3PF5 A;  1YHB A;  4DV5 L;  4YCU A;  1VQH A;  5AJ3 Q;  1I3Q H;  4OX9 L;  5H1S E;  2ZJP A;  1NY4 A;  1P8L A;  3K8A A;  4DUY L;  5IP9 G;  2KEN A;  2R92 G;  3EBE A;  3KYH C;  1ASZ A;  4LF8 Q;  1FJG Q;  4NXM L;  1A8V A;  1KQS A;  2CCZ A;  4IJH A;  1VQ5 A;  4JI6 L;  3M4Q A;  3CF5 A;  2KHI A;  3FKI H;  4TQU S;  2VY3 A;  1PHJ A;  3RN5 A;  5IT9 c;  1L1O A;  3CQZ H;  4A3B G;  4DR7 Q;  3W5O A;  2UUA Q;  2IX1 A;  3RR5 A;  3AEV A;  1K9M C;  4LUO A;  4DR1 L;  2NN6 G;  4IJL A;  4P74 A;  1I50 H;  1N36 Q;  4GN4 B;  2PQA A;  4OWX B;  2JEB I;  1OXU A;  2BA1 A;  1S40 A;  3GTP H;  1V43 A;  2ZJR A;  1XNQ L;  1B7Y B;  5FLM H;  3CW2 C;  4POG A;  2HIX A;  1Q12 A;  2RHS B;  2JA5 H;  3HOZ H;  2VQE L;  4BBS H;  4DK3 C;  3GO5 A;  3UE1 A;  4TVA B;  4YY3 Q;  1Y1W H;  3S1M H;  5C4X G;  3U50 C;  2ZTD A;  4GNX A;  1HR0 Q;  3SGI A;  4BXX G;  2LXK A;  4JI4 L;  4KLK A;  4AQY L;  4H02 A;  4A3D H;  1CKM A;  4LF6 Q;  1NMF A;  4R4O A;  1K83 H;  2YTY A;  4DR4 Q;  1N36 L;  2EXD A;  2LXJ A;  1Z47 A;  4X64 Q;  3KFU A;  1X65 A;  2UUC L;  1N33 L;  1X56 A;  1XJV A;  3GTM H;  1SRU A;  3CC2 A;  3CME A;  3JAM i;  1OXV A;  3S1R H;  3HOY G;  1VQN A;  3HOW H;  4PMW A;  1MKH A;  2YTX A;  4K0K Q;  1E3P A;  1Q46 A;  4GOP B;  3H0G G;  1WFQ A;  4GN3 B;  3CCS A;  1YIT A;  3I4N G;  4A3K G;  1EIY B;  5LMN L;  3PUZ A;  1ASY A;  4JI0 L;  4JBJ A;  4LWC A;  3CPF A;  4IO9 A;  3W1B A;  4DR4 L;  1M1K C;  4B3M Q;  1VQ9 A;  1PA6 A;  4UP8 A;  1PVO A;  1VQL A;  1J5E L;  1VQO A;  1JB7 A;  3J80 i;  1N34 L;  1Q81 C;  1XNR Q;  1EQR A;  2XTI A;  2Y0S G;  5C44 H;  4JYA Q;  3EN2 A;  1IYJ B;  4QIW E;  4X62 L;  3GTO H;  1RL2 A;  1H95 A;  2CWP A;  3PV0 A;  4P75 A;  4HJA A;  1TWG H;  5BR8 Q;  1S72 A;  1VCI A;  1IBL Q;  2HHH Q;  3H15 A;  4O0A A;  2MNA A;  5M5X H;  4A93 G;  3AYH B;  1LYL A;  4LNQ A;  2R7D A;  2MO1 A;  4IFD G;  1AH9 A;  2YYZ A;  1SR3 A;  2PI2 A;  4B3T L;  4GKK L;  1VQK A;  4R1J A;  3OW2 A;  4Y7N H;  1SE8 A;  2AKW B;  5GQO A;  3PIO A;  2JA9 A;  4JV5 Q;  2ZTC A;  4R4C A;  4X6A H;  2K5H A;  1V9P A;  4AYB G;  2QA4 A;  1Q86 C;  4JI4 Q;  2ASB A;  4A3L G;  4R4Q A;  4B3R L;  1YHQ A;  4R4I A;  1VQJ A;  4LFB Q;  3HOX G;  2K14 A;  5IYC H;  2VL6 A;  3ULJ A;  2GN5 A;  2HHH L;  4OX9 Q;  1VQM A;  1B8A A;  2UUC Q;  1EFW A;  4LFA Q;  4C3H H;  3I4M G;  1Y14 B;  1G51 A;  1N8R C;  2Z0S A;  3KLW A;  2F4V L;  4OO1 I;  4L5Q A;  4EX5 A;  3PUY A;  5LMN W;  3GD7 A;  4DV7 L;  4POF A;  1XMQ L;  4B3S L;  4JBM A;  3S15 H;  3G6E A;  2VW9 A;  4UPA A;  1K8A C;  3M3Y H;  4LF9 L;  1YJW A;  1OXX K;  2JA6 G;  2OCE A;  4OXP A;  3S24 A;  2E2I H;  2AHO B;  2WP8 J;  1RIP A;  4A3C H;  4P71 A;  3ER0 A;  5HY6 A;  4DUZ Q;  4DR2 Q;  3KOJ A;  1HZ9 A;  3K80 C;  1YJN A;  1TWH H;  1HR0 L;  2JA7 H;  3M7N A;  2EIF A;  1UE6 A;  4DKA C;  3F2D A;  2JA8 G;  1KIX A;  3GTJ H;  3I55 A;  1HNX L;  3S2D H;  2JE6 I;  3PGZ A;  2R7F A;  4DUY Q;  4A3E H;  2JQO A;  5GAE C;  5AJ3 L;  5M3F H;  2PNH A;  2VNU D;  4LF9 Q;  4LF6 L;  3G48 A;  2ALY B;  4DV1 Q;  1PH1 A;  3CCU A;  5M3M G;  3U4Z A;  3VDY A;  3HOZ G;  4AQY Q;  4LF5 L;  3PCO B;  4MNO A;  4GKJ Q;  1OTC A;  1Y1V G;  5IYB H;  4MZ9 A;  4YHH L;  1NJI C;  3TRZ A;  3A5Z B;  2K5V A;  2Y0S E;  4YCW A;  1EWI A;  3MEF A;  4DUZ L;  4DR2 L;  2K75 A;  2E5L L;  3NEM A;  3RN2 A;  1X3E A;  1PH3 A;  4BXX H;  2B29 A;  5J3B A;  4IFD I;  3U4V A;  5LMU Q;  1AE3 A;  2KBN A;  3HKS A;  3PO2 G;  3KJO A;  4IOA A;  3DM3 A;  1GKH A;  2HT1 A;  5M3F G;  3S1Q H;  4KHP L;  4B3M L;  4OWW B;  3BU2 A;  3S16 H;  3EIV A;  2GVA A;  1VQB A;  1WJJ A;  1BBW A;  3DLL A;  1PH8 A;  3IRB A;  4LUZ A;  4IFD J;  4BY1 G;  2D0P A;  4LFC Q;  3RLF A;  3CXC A;  3PUX A;  3RLO A;  4DV6 Q;  2ZM6 Q;  1QVF A;  2ES2 A;  2H5X A;  1GVP A;  4DV3 Q;  1TWA H;  4NXM Q;  4IPG A;  4WJ3 M;  1PH4 A;  1I6H H;  1DGS A;  1WYD A;  3H3V H;  1IL2 A;  1EUJ A;  1MJC A;  1HR0 W;  1A62 A;  4GLA C;  2VUM G;  4BA2 I;  2KCT A;  1KRS A;  3BZC A;  4P72 A;  2LSS A;  3TRE A;  3I7F A;  5JJI A;  3AFP A;  4JI1 Q;  1GD7 A;  2UUB Q;  4BY7 G;  1HNW Q;  3H3V I;  2Q2H A;  4A3G G;  2F3I A;  3CAM A;  1XTD A;  4DV1 L;  5GRO A;  4A3K H;  4JBW A;  1PYS B;  1G29 1;  1FL0 A;  2NVT H;  1I5F A;  5IP7 H;  3J81 i;  4A75 A;  4JI2 L;  2R93 H;  4DV3 L;  2JA8 H;  1G6P A;  3E0E A;  5IYD H;  4A4I A;  4GOP C;  1CUK A;  3NBH B;  3PIP A;  3E9I A;  3Q8D A;  1HZB A;  3WWV A;  2RCN A;  3J81 j;  1YBY A;  4DV2 L;  1IBL L;  4RMF A;  2B63 G;  2HQL A;  4X64 L;  2EQS A;  4BBS G;  2RHQ B;  2R7Z G;  1D7Q A;  2Q2I A;  1QZH A;  3F2B A;  2CQO A;  2E2H H;  5ELN A;  3CPW A;  2NVX H;  3M9B A;  3PUW A;  3UE0 A;  1VQ7 A;  4DR7 L;  1T9H A;  4B3T Q;  1GO3 E;  4GKK Q;  1WCM G;  2N49 A;  4XTC S;  4YWL A;  1KL9 A;  4BY1 H;  3A0J A;  3UDX A;  1IZ6 A;  1QZG A;  2OQK A;  2C35 B;  3FHW A;  3J7Z C;  4UP9 A;  4JI0 Q;  3PUV A;  5K36 G;  4HJ5 A;  1SFO H;  5IY0 A;  4GOP A;  2K52 A;  3T1H L;  3HKZ E;  1CKN A;  2QEX A;  2ZM6 L;  5IP9 H;  2VS1 A;  3HFZ B;  3HOY H;  2R6G A;  1X6O A;  3PSI A;  4X66 L;  1L1O B;  1UE1 A;  1EIF A;  1YI2 A;  1K73 C;  1N34 Q;  2MO0 A;  1N9W A;  4JI1 L;  5DLQ E;  1E24 A;  4DAY B;  3KF6 A;  5JEA J;  4A93 H;  1HJP A;  4X65 L;  1Y1W G;  1IBK L;  1C0A A;  3CCQ A;  3KDF B;  2D0O A;  5IWA Q;  1I94 Q;  4DR6 L;  2WAQ E;  4GLV B;  1L2F A;  2F52 A;  4R4T A;  1YIJ A;  4A3L H;  3W1G A;  4JCV E;  2B63 H;  2QGQ A;  4L5S A;  1FJG L;  3CCJ A;  1W2B A;  3CCR A;  5HGQ A;  2MFI A;  4DR1 Q;  1VQI A;  1Z9F A;  4QQB X;  3TS0 A;  4GS3 A;  2OWO A;  1NMG A;  3K81 C;  1XNQ Q;  2I0Q A;  4LW1 A;  4KHP Q;  3KF8 B;  2N8N A;  4JOI A;  3CCV A;  1HNX Q;  3CCL A;  1CKN B;  3G4S A;  3KJP A;  1N32 Q;  3I4N H;  2ID0 A;  3I2Z A;  2FXQ A;  1SRO A;  4ME3 A;  3J80 c;  3FP9 A;  4YY3 L;  1X9N A;  1IBM Q;  2I5L X;  4AH6 A;  4DNI A;  4JI7 L;  5JJL A;  3S17 H;  4GN5 A;  5E7N A;  2GVB A;  4LF4 L;  5C0X I;  4DV0 L;  4JI3 Q;  3PO3 H;  4JI5 Q;  3RZO H;  3ULP A;  3HOW G;  4LF8 L;  4LF5 Q;  1O7I A;  2VQF L;  4DR5 Q;  1PH5 A;  3S2H H;  1L0W A;  1YZ6 A;  3TEH B;  1XMQ Q;  2JA5 G;  1X55 A;  4NXN Q;  1WI5 A;  1YJ9 A;  3OTO L;  3CD6 A;  3AFQ A;  4MTN A;  3RZD H;  4OWT B;  3GTK H;  4UP7 A;  1JMC A;  2DGY A;  3ERS X;  2CWA A;  2RF4 A;  3NEL A;  4HID A;  2UUA L;  3HOV H;  3J7A 5;  1XPO A;  3K7U C;  1KRT A;  3UDG A;  2NZO A;  4BBR G;  2YTV A;  1XPR A;  3PF4 A;  3BJU A;  4JG2 A;  4YWM A;  4K0K L;  1HZA A;  4JI8 Q;  5C44 G;  4JI5 L;  4JI2 Q;  4DR6 Q;  4A3F H;  4QGU A;  1KC8 C;  4LF7 Q;  4A3J G;  1X3F A;  2NN6 I;  3S14 H;  3UDI A;  1HNZ L;  2AWO A;  2UU9 Q;  2VQE Q;  4Y52 H;  3TQY A;  1SLJ A;  1XMO Q;  4YHH Q;  3GDE A;  4A3M G;  2IX0 A;  1BKB A;  2IHE A;  2IHF A;  3GTL H;  1J5E Q;  4QY7 A;  1K8G A;  4DV7 Q;  4LUV A;  5ELO A;  1U0L A;  2I5M X;  1QVC A;  2R93 G;  1SN8 A;  1VQF A;  4LFA L;  3A74 A;  1VQ6 A;  3UDF A;  1YEZ A;  3D31 A;  3E9H A;  2IY5 B;  1A0I A;  1TXY A;  1QUQ A;  2AMC B;  4BA1 I;  2BA0 A;  1A63 A;  2VQF Q;  5JEA G;  4HJ9 A;  1VQD A;  1VQA A;  3KDF A;  5IE8 A;  1C7Y A;  3L0O A;  4IOC A;  2K4K A;  1WCM H;  4JV5 L;  1K3R A;  3FKI G;  2VUM H;  5EAY A;  4HIO A;  3OTO Q;  4C2M H;  3HOU G;  3K0X A;  4C3J H;  5IYD G;  2UXB Q;  3F8T A;  2L15 A;  4X66 Q;  3L2P A;  1YHA A;  4PZ6 A;  3U58 A;  1EOV A;  3B6Y A;  5FLX c;  3A5U A;  2MQH A;  4IPH A;  4DV4 L;  1TWF H;  3STB C;  3G71 A;  5FJ8 G;  2A19 A;  4KI0 A;  5M5Y H;  1HH2 P;  5BR8 L;  5C3E G;  1PH2 A;  1BBU A;  1FVI A;  1VQ4 A;  1PH7 A;  4DR3 Q;  1VQ8 A;  2E5L Q;  2JA6 H;  4BY7 H;  3K7A H;  3JAM c;  3LGJ A;  3F1Z A;  5M3M H;  3CC7 A;  2D62 A;  1XNR L;  4JYA L;  3F2C A;  1BVS A;  1P16 A;  5M5W H;  1HNW L;  1YNX A;  1OXT A;  2JEA I;  4OO1 G;  1XMO L;  2UXB L;  4KHZ A;  4IPC A;  1UWV A;  2E8G A;  4PG3 A;  3ICE A;  1HZC A;  4BBR H;  4UY8 C;  2UXC Q;  4HJ7 A;  1PH6 A;  4DV4 Q;  1E1O A;  4NXN L;  2B3G A;  2Z6K C;  4DV2 Q;  4A3M H;  3T1Y Q;  5C4J H;  3RLN A;  5LMU L;  1AE2 A;  5IYB G;  3KF6 B;  4A3D G;  4JI3 L;  5C3E H;  4DV0 Q;  4DV6 L;  4A3C G;  3L7Z C;  4IPD A;  1CSP A;  1VQP A;  1V1Q A;  5IWA L;  4A3I G;  1Q82 C;  3STB D;  1I94 L;  3S1N H;  3HOU H;  3H0G H;  2HIV A;  2PQA B;  5C4X H;  4X65 Q;  3TS2 A;  2UXC L;  4JC0 A;  1M90 C;  1NTG A;  4XIG S;  2ATW A;  4GKJ L;  1CSQ A;  2WFW A;  4J15 A;  4YCV A;  4B3S Q;  4C3I H;  4L5T A;  2K50 A;  4YWK A;  3ULL A;  2YV5 A;  5FJ8 H;  1UEB A;  1VQC A;  4GNX B;  1MIU A;  2VZA A;  3JC6 6;  1LUZ A;  2BH2 A;  4P73 A;  1PH9 A;  1U5K A;  2BH8 A;  4GNX C;  4OON A;  1KD1 C;  1JJ2 A;  2NVY H;  2ZJQ A;  4L5R C;  4LF7 L;  2K5N A;  3MXN B;  4JI8 L;  1LTL A;  1UE5 A;  4PZ8 A;  4O2D A;  1R9T H;  4FDB A;  5IYC G;  1Y1V H;  1IBK Q;  1W3S A;  1PYB A;  1Q1B A;  1VQE A;  2N78 A;  1D8L A;  2JK8 A;  2OQ0 A;  2PMZ E;  3CCE A;  1YVC A;  4DR3 L;  3I4M H;  1Q1E A;  4EQ5 A;  1CKO A;  1K0R A;  1EYG A;  1NBW A;  4DPG A;  4A3F G;  2N3S A;  3GTG H;  3PO2 H;  1EQQ A;  5GAG C;  1X3G A;  4WJ4 A;  1L1O C;  2XGT A;  4A3I H;  4LFB L;  2UXD Q;  3BZK A;  4LFC L;  1S3O A;  4B3R Q;  2PI2 E;  3M85 A;  3T1Y L;  1VQG A;  3M4P A;  1Q8K A;  3PO3 G;  1KAW A;  2E2J H;  1KXL A;  2DUD A;  4X62 Q;  1C9O A;  4GLX A;  3NEN A;  1TWC H;  3HOV G;  4AYB E;  4DV5 Q;  4A76 A;  2OTL A;  1E22 A;  1Q7Y C;  1XPU A;  2AWN A;  2KCM A;  4DK6 C;  4JBK A;  1N32 L;  1JT8 A;  2WAQ G;  2ZTE A;  2Q2T A;  4NPS A;  4HJ8 A;  1X54 A;  2UUB L;  1PV4 A;  4DAM A;  5IP7 G;  4NB3 A;  1KHI A;  4A3J H;  1UE7 A;  3M4O H;  4LF4 Q;  1QUQ B;  3D0F A;  4QL5 A;  3AQQ A;  3HOX H;  1HNZ Q;  2UU9 L;  4JI7 Q;  1FGU A;  5LMN Q;  3T1H Q;  1GM5 A;  4HIK A;  2V1C C;  3RNU A;  4JI6 Q;  5C0X J;  5JJK A;  1PFS A;  1NE3 A;  1MJE A;  1J6Q A;  1SMX A;  5GAD C;  4APV A;  2JJQ A;  5FLM G;  3J81 c;  3CP0 A;  2NVQ H;  3CCM A;  1N33 Q;  5C0X G;  3CMA A;  3I56 A;  3ZJY C;  3I4O A;  4RG1 A;  1JJC B;  2A1A A;  4A3E G;  2OTJ A;  2I5H A;  4QJF A;  2CKZ B;  2IT1 A;  4A3B H;  3GTQ H;  2YU9 H;  1E7Z A;  1OXS C;  3CC4 A;  2Q2U A;  4AIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...