5DNFA

Crystal structure of cc chemokine 5 (ccl5) oligomer in complex with heparin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
SSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords C-C motif chemokine 5
publication title Structural basis for oligomerization and glycosaminoglycan binding of CCL5 and CCL3.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 65
sequence length 65
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5dnfA00
3TN2A 1F9QA 3R93A 1RTNA 2NYZD 2JP1A 2X69A 1BF4A 2L12A 2K05A 4U68A 3KUPA 3MWYW 4IURA 4XDXA 1B2TA 4IUUA 2B2VA 3GV6A 1A15A 1SAPA 1ILQA 2KUMA 2B2WC 1JE4A 1ICWA 2MP1A 4RWSC 5DNFA 1BBXC 1HFNA 2Q8TA 1G91A 1WTRA 5AFWA 2B2UC 1Q3LA 4ZK9B 1VMPA 4R9WA 5E4XA 2H1EA 1S4ZA 4X3SA 1QG7A 1WTVA 1WD1A 1NR4A 2K01A 2B2WA 4OIKA 4QUCA 4ZKCB 2EE1A 1G2SA 1PFNA 1JICA 2CVRA 1PFMA 2D9UA 2MJ8A 3P7JA 1BO0A 4HEDA 5T1IA 1KNEA 4HSVA 5JJZA 1DOMA 1LV9A 5EPLA 1ILPA 2FHTA 3I3CA 1HHVA 1HUNA 3HP3A 1B53A 4RA8A 5T1GA 1WTXA 1NAPA 1EL0A 2B2UA 1DOKA 1E0BA 1DOLA 4CJ2C 1SDFA 2NZ1D 1F9RA 1RTOA 2X6LA 4ZLTF 1X3QA 1AP0A 1B4OA 2FINB 1CA6A 1WTOA 3F2UA 2L4NA 1WVLA 2HDLA 3N52A 3SVMA 2Q8RE 1U4PA 1WTQA 2JYOA 1BNZA 4UAIA 2B2TC 4RAUC 2K1BA 5EPKA 4OIJA 3Q6SA 5EQ0A 1TVXA 1MSGA 2L9HA 2RSOA 4HAEA 4IUVA 2HUGA 1O7ZA 3ONAB 1WTPA 1J9OA 1U4MA 1O80A 2L11A 4IUPA 4CJ1B 3GV3A 1EOTA 2IL8A 2K04A 2MPMA 2R3ZA 2RVLA 3FDTA 4CJ0B 2DY7A 1NR2A 4X3KA 2HDMA 3IL8A 4XT1B 4MHEA 1XX8A 4X3TA 1CA5A 3DEPA 2MGSA 3QO2A 2BDNA 2K28A 5EKIA 1DONA 3DM1A 1MGSA 2B2TA 1C8CA 1O7YA 1PDQA 1F9SA 1KNAA 1F9PA 1SSOA 3I8ZA 5EJWA 4X3UA 4ZAIA 1HFGA 1DZ1A 4ZKBB 2FFKB 2KECA 2FJ2A 4IUTA 1X3PA 5CMDA 1RODA 1QNKA 2KEEA 1HRJA 1AZPA 2KOLA 2HCIA 2KEDA 2XIWA 5D65A 1ESRA 3TZDA 1X32A 4MN3A 2K03A 3FPUB 2EPBA 1PLFA 1IL8A 2B2YC 3KBXA 5E4WC 5D14A 5CBAE 1U4RA 2FMMA 1F2LA 4QUFA 1WTWA 3LWEA 1MI2A 1U4LA 5COYA 1EIGA 1HUMA 1ML0D 2L1BA 4HCSA 1G2TA 3IFDA 1CM9A 1NCVA 2X6GA 1EIHA 1GUWA 3MTSA 4NW2A 1PFBA 1ZXTA 2M2LA 1J8IA 3H91A 2SDFA 3DEOA 3UI2A 1HA6A 2N55A 2EOTA 2N88A 1RHPA 1WD0A 5CBEE 5CORA 2B2YA 1RJTA 2HCCA 3I90A 3G7LA 1AZQA 4DN4M 1IKMA 4XT3B 1B50A 3D6WA 3I91A 2RSNA 1G6ZA 1VMCA 2RA4A 1EQTA 2KVMA 1B3AA 2B2VC 1MSHA 5EPJA 4IUQA 1M8AA 1IKLA 4LMQD 4O42A 2DY8A 4R8IA 1XYIA 2VXWA 2NWGA 1QE6A 2J7ZA
chains in the Genus database with same CATH superfamily
4GKKL 4JI3L 4YHHQ 4DV2Q 4IOCA 3HOYG 1VQIA 5C6AA 3HOVB 1JJ2A 4DV3L 3KJPA 1H9RA 3J7A5 4BBSH 2LKVA 4IUUA 2DNEA 1I3QB 4KHVA 1RL2A 1A3UA 1YI2A 4Y7NB 4LFCL 2MP1A 3TP8A 1K9MC 2Z9HA 4GZYC 1TWHH 1GUNA 4BBRH 1VF5C 2FXQA 2M9VA 2UU9L 3S1RB 3BZKA 5IYBH 2J4XA 1VQDA 4R9WA 4C3HB 3MHBA 1JJCB 4BS9A 1LM0A 4K8JA 3U9OA 4X62Q 1PRTB 2VB3X 4JK1C 4JI7L 1BKBA 1PRTC 4LF7Q 1WTXA 1EL0A 1C9OA 1Q1EA 3MXPA 1B4OA 1E1OA 3UE0A 3NSWA 3K80C 1PMRA 3N52A 1KAWA 3W5OA 5IP9G 3J80L 5JOBA 4OIJA 4IUVA 2L9HA 3PO3B 1O7ZA 2BCOA 1O80A 1XJVA 5E3FA 2RHQB 4A3KB 2VQFL 1I6HB 1PYWD 3IL8A 4PMCA 1PTOF 3DLLA 5C4XB 4RFBA 5EKIA 4RMFA 4FF4A 1ENAA 3CQZH 4OO1I 4KD3A 5EJWA 5DM63 2Q8IB 4DFAA 3DHQA 2FFKB 4OELB 1HNXL 3MXGA 3GTJH 1GUTA 4K6DA 3S2DB 2F0LA 4RGOS 3Q8DA 1SFOB 2K6AA 1PH6A 2YYZA 3I4MB 1SLJA 1ICFB 1EQQA 1EIGA 1HUMA 2G9DA 3OWFA 3OWEB 1EIYB 4A3EG 3I4NG 2DJGC 4UP9A 1E2WA 1HH2P 4DR3Q 4HJ9A 3H91A 2Y0SB 1K0RA 5C44G 2N55A 5JAVA 1DXMA 4DV5Q 3D6WA 2K5WA 1G6ZA 2RA4A 4IPGA 3RMHA 1CI3M 4JI8L 1Q46A 4C2MB 2F0DA 1GVPA 1JWMD 1S72A 4C3IB 1X56A 2EVBA 1IKLA 1SJED 5I9OA 3RD4A 4CDEC 2SOBA 2VXWA 2NVQB 2R6GA 4CBVA 3D6CA 3H09A 5E1FA 3BYTB 3DWQA 3T1HQ 4C3JB 1D1IA 2XNAC 1B2TA 4DV0L 3HOVH 1PHJA 4L5QA 1I4GA 2BDOA 4S3SA 5JPNC 5JEAJ 5C0XH 2ZJPA 3MZ5A 1IZ6A 3E0EA 3OYYA 1I3QH 4QF4A 5DNFA 3J80i 4B3ML 4DR4Q 4DV6L 3E3XA 1BVSA 2YTYA 4JI4L 4Y7NH 3P1HA 2WB1E 1X9NA 3PUZA 1J5EQ 2H1EA 5KNBA 1QG7A 1WTVA 1D5ZC 1BBWA 1VQ4A 2MJ8A 1BCPF 4OGQC 4C3HH 1SE8A 1HUNA 2Z6BA 5K5PA 3UE1A 3SK6A 5T1GA 5LMNW 4IQZA 2EY5A 5ELBA 2PMZB 2E2DC 3BZDB 2VNUD 3KF6A 4DK0A 2ZJRA 3K7UC 3H3VH 2LFNA 4A3IB 2V4DA 2A8VA 1VQ7A 2CW0D 2O5IC 3NP8A 2EJGC 2JXMB 3PUXA 3NUCA 5CV4A 3PO3H 2O2LD 4MIUA 4LAAA 1Q8IA 1XX8A 4KKUA 1IBLQ 4J6HA 3K5OA 1NNXA 3TP7A 4A3KH 1I6HH 1NMGA 2JA8B 2PQAA 3PIOA 3PO2H 4C1NI 5C4XH 4AYBB 4P75A 4GOPA 4BY7G 2NN6I 4V0BA 1FYCA 4EQNA 1KRSA 5J22A 1T5XD 4RKLA 3OTOQ 1XNQL 3PSIA 5J1ZA 3VR6A 1LYLA 4JBMA 3S2DH 3R2TA 1F2LA 2IT1A 2L0CA 2PI2A 2ZXPA 3OSOA 4MTKA 1BUVT 2ID0A 2H5XA 3C46A 2RDHA 4CDDC 1NTGA 1ZXTA 3OMCA 1N36L 4LF4L 2F4IA 3T13A 2B2YA 1B3QA 1LABA 2NN6G 2DNCA 3G7LA 1TS3A 3J7YW 2B63B 1SROA 2RSNA 2R7ZB 4DV1Q 5FLMH 4DR5L 1OO9B 4PQXA 1UE7A 3SDZA 4HIKA 1EY5A 3A56A 3CCSA 5IYCH 2CW0C 1STHA 4LF6Q 4XQNA 4M8AA 1F9QA 1CFMA 5H1SE 1G6PA 1VCIA 2NYZD 4LF8L 3GTKB 1I4QA 3W2DA 4DXGA 1EU3A 1YNND 3CRLC 2NVQH 2K4KA 5IWAQ 4LW1A 3GV6A 5FLXc 1ILQA 1SBBB 4H7BA 4C3JH 1LACA 1J6QA 3AEVA 1PH1A 3CMAA 1VQCA 4JV5Q 1FR3A 2Q8TA 1TKWB 2JA6B 1AE2A 2A74C 3DUZA 3KF6B 1L0WA 4HSPA 3EJIA 3K8AA 4ZCKA 5GQOA 2F0UA 5M5WB 3IKJA 1D7QA 2A6HC 1PFNA 1SYEA 4TSSA 4H44C 1QZGA 1SYGA 4QCLA 4LUZA 5IY0A 2BH8A 2PQAB 2B3GA 3U4ZA 4BBSG 1XPOA 4NKLA 5EPKA 3JAMc 4HJ5A 5EQ0A 3TDQA 4HAEA 4A3IH 3A8JE 4LFBQ 2ZTDA 4GOPB 1XMQL 2IL8A 1ASZA 4GOPC 1NR2A 3CCUA 1ENCA 4V190 4BBRG 2UUBQ 2F3VA 1NY4A 3GTPB 5IYBG 1EYDA 3JAME 3PIP3 1JC7A 1YNNC 1TWFH 5G3LF 4JYAQ 2JA8H 2OQKA 4KMUC 4HTHA 1H9KA 5DAUA 4RGNA 2XIWA 1YITA 2SNSA 1IL8A 2B2YC 4DUYQ 1EWCA 3S24A 1XPUA 5ELOA 5GADC 2ES2A 4X66L 4ZQ3A 3OIPA 4JCVE 1IXRA 5EBCA 1TU2B 1EIHA 2XRQD 1W2BA 3EBEA 3M3YB 4NXNL 1U9RA 1B50A 4A3CH 2Z1CA 1L1OA 5L37A 3VDYA 3CCJA 4LFAQ 2Q2UA 2HQEA 4ZUIA 4A3DH 4NXML 1FNWA 2B63H 3S1MB 2R7ZH 4O42A 4QB4A 1SXTA 1GXDC 1KL9A 3NTKA 3BU2A 4JI2L 1OXXK 4U68A 5DEHA 1RKNA 1QUQA 4KLKA 3D31A 1B7YB 2JK8A 1JE4A 3NXWA 4FF3A 4IUNA 1Q12A 1N32L 4KKTA 1JE5A 5A35A 1HZ9A 1U0LA 1P16A 4A93B 3BDLA 2JA6H 4ZKCB 1G2SA 2VQEQ 2E76C 5T1IA 1HCZA 1PH9A 4DR1Q 2PZTA 2AHOB 1KDAA 2MQHA 1QVCA 1E0BA 4NDXA 4XYOA 1F9RA 1HQRD 1SMYD 5IGGA 1Q90A 4Q0FA 1CKNA 4EGVA 5LMNQ 3IAYA 3HOVG 4C1NK 5ELNA 4B3RQ 5C0XG 3QJYA 2F52A 5DM73 3NEMA 1I4HA 1PH2A 1YEZA 2HHHQ 3G6EA 1TXYA 2NVXB 2F0QA 1HNZQ 4QIWB 1LTSD 2BA1A 3GTPH 2MUYA 3L3OC 2A68C 5AJ3L 4JI0Q 5HGQA 1D6EC 1V1OA 4C3HG 1IBML 1KTKA 5KIXA 1BOSA 1ESRA 5JEAH 4OO1H 5CC4A 3AFQA 3KK7A 1L1OB 1I4RA 4X65L 5D14A 2K5NA 1L1OC 4JVZA 1MI2A 5COYA 4BY1B 4QY7A 1CM9A 3NHHA 5BR8Q 4LWCA 1R9TB 3PUVA 4P71A 3UI2A 2N88A 5I6YA 5CBEE 4RHSA 3PO3G 2KHJA 1IBKQ 5C3EB 5FO7B 2CWPA 3RLFA 4A3KG 2EY2A 1QUQB 2OXPA 1JR0D 2KCMA 4JI1L 2PW7A 3QOLA 5C4XG 1C0AA 4A3BH 2ICIA 2NTSA 4L5RC 1CHPD 4GLAC 1VS0A 3KBGA 1EYAA 2ZXRA 4XDXA 2EYJA 4O1NA 2F0IA 3CXCA 1SAPA 3GTGH 4CGYB 1VQMA 2JSOA 2K5HA 3QG1A 1HFNA 1PZJD 4JI5Q 5IYDH 2YTXA 2O4XA 1G291 3TP5A 1CKNB 3A8KE 1PH3A 1H9JA 2Y0SG 4PZ8A 5FLMG 3K5LA 3DM3A 4QUCA 4A93H 4KJNA 2K75A 2VW9A 3RZDB 5IYCG 1B53A 3DWPA 1SDFA 1BQQT 4E6IA 3KJOA 2AUKA 1EEID 2HDLA 3HGBA 3CF5A 1VDZA 1BNZA 2KBNA 4UAIA 2UUAQ 1TWAB 1V1PB 4K8IA 2AKWB 1E2ZA 3AU7A 4IPCA 4C3JG 5BN3A 3H6MA 3ONAB 2F1MA 2L11A 1VQNA 1K83H 3MVVA 3CKIB 3MEHA 1WOCA 3MC0B 4TVAB 1EEFD 1X3EA 3PF4A 2F0HA 3TBIB 1LT6D 1DONA 2MO1A 1MGSA 2AQ1B 4IJHA 5BN4A 1O7YA 2CFMA 1S5CD 2QCPX 2NVXH 2EQSA 3IFTA 3R8BA 3W3AA 1RODA 1SNCA 2KEDA 1EZ8A 4IFDJ 2I5HA 1Q1BA 1PLFA 2NB0A 2UXCQ 1I6VC 1PVOA 1LO5D 1HZAA 1A8VA 1RDPD 2MHVA 1CZWA 3EN2A 2R93B 2ALYB 3DMUA 4DNRB 3S14H 4A3IG 5CV5A 4BY1H 2EOTA 4LNQA 4KHPL 4ZRZA 5IT9c 1RJTA 4DUZL 3M4QA 1JT8A 1VQBA 1B9NA 3KF8A 1R9TH 4B3SQ 3F2CA 1VMCA 3PQIA 4DXFA 1TY0A 1B3AA 5C3EH 2Z8LA 3CCMA 2E5LL 1N8RC 2JA8G 1EY9A 1HTPA 5IT9E 2RQXA 3M4OB 2F0KA 2X69A 2B8GA 3K7AH 1PRTD 5IGBA 5M5YH 2NUCA 1EFWA 1SJHD 4GNXA 1LTBD 2N3SA 4ME5A 2ZM6Q 3E9IA 1S5DD 3ULJA 1GJXA 3ICEA 3DWAA 3K0YA 4A3CG 4K0KL 2WINB 3T53B 1FJGQ 2K52A 1GKHA 1A63A 1EYCA 2PZWA 4A3DG 1AZPA 2B63G 1BO0A 2R7ZG 1ILPA 2FHTA 3I3CA 1AN8A 1DOKA 4OX9L 4DPGA 3CCLA 1Y14B 4HIDA 2NZ1D 4UY8C 4DR6Q 1U5KA 1EWIA 3OIQA 2QW7A 4ALPA 4ZYSA 1LUZA 2IPKD 5LHY1 4EQPA 3V2TA 1E1TA 1TWAH 3VYSA 2IJ0A 4FXDA 2HDMA 1I50B 2QEXA 1CK1A 1XMOQ 1DM0B 1CZGA 4A3FB 2B2TA 4LF5L 1CQFA 3PIPA 5NUCA 2JA6G 4UHVA 3RLOA 3KLWA 1X3PA 2UXBL 2I5MX 4OL7A 4DV4L 1SNPA 1I94Q 3M7NA 3KF8B 1V9PA 3E9HA 3KOJA 1UAPA 3AYHB 3RZOB 3CAMA 3ULPA 1R4QB 1ET6A 3QIAA 4JI6L 1G2TA 2Q2HA 1Z7TA 3UDFA 4B3TL 3N6RA 3HOZB 3SK5A 1MHWC 4O0AA 3KDFA 3NTIA 5C4JB 2HIXA 2KQ3A 1GOZA 3CPWA 3ND8A 3NBIA 1LTLA 1MSHA 1RF2D 4TRDA 2XWJB 3I56A 4PV1C 4GN4B 4GNXB 5GAHC 1HQMC 4R8NA 5JVG3 4GNXC 3BDOA 3GQBA 1CT1D 2AUJD 5JEAG 3PV0A 5HY6A 4OO1G 3WWVA 4BWGB 2F0NA 1XXGA 1YNJD 3M4OH 2A69D 5CV6A 2A1AA 4PZ7A 1VQLA 3GTMB 2YU9H 4RWSC 2VS1A 4YY3Q 3GDEA 4ME3A 4AQYQ 4A3MH 5ISRA 1JOQA 1Y1WB 2F4VL 2K5QA 3F1ZA 5AFWA 3NQIA 3T1YQ 3X3NA 1NR4A 3HG9A 1KQSA 4A3BG 4G7OC 1Y1VB 2BE5D 3SHLA 2VL6A 4JPBW 2WAQE 4HCEA 4LUVA 1X3QA 1VQ8A 4DA2A 4UP8A 1F77A 2F0EA 2B2TC 4RAUC 4WRDA 4JBWA 1H9SA 3HKZE 2J0TD 4LJZC 5J3BA 2PCFB 4CKBA 3K59A 3S1RH 2WB1B 5IYDG 4ODGA 2BDNA 2K28A 2K32A 3GTOB 2EXDA 1QB5D 2AQ2B 2IX3A 1PDQA 3S17B 4DNTB 1KNAA 2DGYA 2SEBD 1F9PA 1UE1A 2F3IA 3VYUA 1Q86C 4A3FH 1YNJC 1FGUA 4DR7Q 3WDNA 4A93G 1IHZA 2A69C 2PQEA 1HNWQ 2NBFA 2DUDA 1HRJA 2KOLA 2ZXOA 4IN3A 1SE2A 3KDFB 1QWYA 2K03A 4BXXH 1K3RA 4NMZA 4U673 1ESFA 2GN5A 3L0OA 4B9XA 1QZHA 1AEXA 2CH4A 1HTLD 2F0SA 2ZT9C 1ML0D 2XSCA 2KCCA 1QNUA 4NPSA 5EKLA 5FO8B 2OQ0A 4KHZA 4G7ZC 3CW2C 2B39A 2BE5C 2UUCL 1KLUD 3C3LA 1YIJA 1JWUD 3HOZH 4J1MA 1NMFA 2EY1A 2PNHA 5C4JH 3S16B 3K0XA 5EKKA 1B1ZA 5EPJA 4EQ5A 1D5XC 1Q8KA 2JN4A 3BZCA 1H95A 3P75A 2ZJQA 4X64Q 2A6HD 3PMFA 1VQ6A 3L9AX 1SFOH 2K05A 3MWYW 3I4MH 3HEJA 4GN5A 1CKOA 2NVTB 3M4YA 5IE8A 4YIJA 4Z9CB 2QKIC 3CD6A 1EU4A 2R7FA 1VQGA 4GN3B 3TSSA 1HR0L 1A6XA 2MNAA 3HZXA 2B29A 3OW2A 5J39A 4BY1G 3SGIA 4N9PA 1EY8A 3GTMH 1N34L 1IL2A 2A73B 4N8FA 2AMCB 1Y1WH 2N49A 4C2MH 4GKJQ 4IFDH 1H9SB 5C3EG 2CVRA 4C3IH 3PUWA 3BDCA 3HOWB 1LV9A 3T51B 2F0WA 5LMUL 4OXPA 3HOYB 1NAPA 2IW3A 1N33Q 1L0XB 1EIFA 1WVLA 1EY4A 1CUKA 4FYDA 1WTQA 2KA7A 1HA5A 4FVMA 4A3GB 4POFA 5ELCA 3EIVA 1CTMA 3G4SA 1FL0A 2K04A 5C4HA 1I4PA 1YHBA 1S5ED 3I73A 1UEBA 2E74C 4MHEA 1TS4A 2PNRC 2WKDA 1KC8C 3FEWX 1DZ1A 2EYLA 3RR5A 5JVH3 5CMDA 4DV7Q 3S17H 2XN9C 2OT2A 2HT1A 1SYFA 4HIOA 1XWEA 3ND9A 2QA4A 1TWGB 3FPUB 4KV6A 1D1KA 1PA6A 1XNRQ 3W1GA 2UXDL 5CBAE 5CR3A 2Q2TA 4RGTA 1RCVD 1PRTF 4YCUA 4DNIA 2K14A 2JE6I 1HZBA 2X6GA 3BVMA 1GUWA 1UWVA 3EROA 4DV2L 1E3PA 1PFBA 4RCOA 1C4QA 1Y8OB 2M2LA 1J8IA 5IP7H 4ZUJA 3T56B 3G48A 3IRBA 1KAAA 1GUOA 4R4CA 1K8MA 1QCBD 1X65A 4DN4M 4WORA 3BJUA 2K50A 1YVCA 3J81c 1S5FD 1KIXA 2TMPA 2RF4A 4DR2Q 1QVFA 3J7ZC 1RIPA 3NENA 4IUQA 1KABA 1M8AA 1IW7D 4XQQA 5CV7A 2J7ZA 3S16H 2N78A 2L55A 2OWOA 1HJPA 2L12A 2RBMA 3J81E 1M1KC 4LF9Q 4RH6A 4HJ7A 1GD7A 1MJCA 3TREA 3WOEA 4X62L 1W6KA 4XYQA 4A3EB 4LF7L 2LS01 4EQOA 2E8GA 2EIFA 3T16A 4GKKQ 2H4OA 4JI3Q 2JEBI 5FLXL 5C3WA 3Q0AA 1QILA 1EYGA 4DV3Q 1VQPA 1O78A 2K01A 2GVBA 3V96A 2LMCB 4FXKC 3K6OA 2B8FA 1STNA 4JC0A 2IHFA 4LFCQ 3GTKH 1DOLA 1NUCA 2A68D 3MXNB 1CA6A 1NE3A 2UU9Q 1Q7YC 2BH2A 2BOSA 1STGA 3Q6SA 4GLXA 1KRTA 5I2XA 1M90C 4O2DA 3FDTA 2WP8J 4A3GH 4FF2A 4IJLA 2KHIA 2EJFC 4I65A 4JI7Q 2OCEA 4A3MG 5M3FB 1IW7C 3JAML 3RUZA 3QO2A 1TT2A 2F0JA 3KLSX 3DM1A 2A6ED 3FKIB 2RCNA 2QDLA 3I8ZA 2LY7A 5M5WH 4QGUA 3NBHA 4K5VA 2KECA 1STBA 2Q2IA 3D0FA 4DR3L 1ASYA 2JA5B 2KEEA 4ILWA 4MTNA 3A54A 5KEEA 3NQTA 4DV5L 3K57A 2VQFQ 1GUGA 3GO5A 2QILA 1U4RA 1XPRA 2JA7B 3ITPA 1E2VA 1JOKA 3HKSA 4RHRA 1AH9A 3S15B 4L5SA 3A0JA 4WJ3M 3QWNA 4HMIA 4FXGC 1DJRD 3T1HL 1V1PA 1HNXQ 3MEFA 1A62A 1QJOA 3A55A 3EFXD 1JCKB 1ZKOA 3NTHA 4QMGA 3U4VA 1EY6A 1SN8A 4A3FG 4BY7B 1MJEA 4DR4L 1VQFA 3OW7A 4L8JA 2R92B 1QE6A 4JG2A 4CHTB 4HJ8A 5IGCA 3AMUA 3Q23A 1YJWA 1CKMA 1J5EL 5DLQE 2VUMB 1G51A 4BXXG 1DGSA 1PTOB 4FO2A 4F88A 2EJMA 1GO3E 1PTOC 3QOJA 1A15A 2A6EC 4JI8Q 3K58A 2F0FA 4GLVB 1ICWA 5C5LA 3M3YH 2NZOA 1E24A 3JC66 5M3MB 3CCRA 4N9TA 1WTRA 3OOCA 1UUPA 2D0OA 3UDXA 3HOZG 1WCMB 4X3SA 1WD1A 4KK7A 4DV0Q 5C0XJ 3ZYYX 1STEA 3S1MH 3JAMi 2D9UA 3NWSA 3P7JA 2CCZA 4J15A 5EPLA 2IY5B 3HP3A 2I07B 1IBLL 3VR2A 1L2FA 4B3MQ 4DV6Q 3F2UA 5TSSA 4JI4Q 1U4PA 2K33A 4OEMB 1Z6HA 5HGTA 3I4MG 3RLNA 4IFDI 1OXSC 3F8TA 2E75C 3NBHB 5FKAC 3URYA 5IIFA 1EOVA 2HUGA 3HOUB 3LX0A 4L5TA 3OTOL 3LGJA 4XT1B 5JJLA 2PZUA 3SR1A 1LT3D 1PXUA 4JOIA 1LTID 1SSOA 2MO0A 1TQOA 4FDBA 5M3FH 1Y1WG 3HOXB 1HFGA 3SEBA 1LTGD 1KDCA 4IFDG 4C3IG 1AE3A 2E2HB 3FKIH 2AWOA 2ZTEA 4DGZA 2JA5H 1X32A 4DV1L 1VQ9A 1Y1VG 2FMMA 2Z4HA 4DAYA 4BBSB 1DCZA 5I4DA 4OWXB 3TRZA 3S9WA 4LF6L 1LTAD 4DKAC 2F0TA 4NW2A 1O7LA 5C5MA 3SXHA 2K5VA 2JA7H 1ONLA 4LK1C 2HD3A 1TWHB 5EBDA 1Y69U 1BCPB 1Q81C 1AZQA 3MFYA 2F0VA 4XT3B 3AQQA 5D3IB 5IWAL 3I91A 1XNQQ 4K14A 3D4WA 2JA9A 4KI0A 2QF7A 3DXJC 3VR5A 4R4IA 2WB1G 5KNCA 4JV5L 4LMQD 2G9HD 1Z9FA 2DY8A 2XTIA 3L7ZC 2CHBD 1ENFA 4UDUC 1N36Q 1RTNA 5A2QL 1JQYD 1FVIA 1V8QA 4LF4Q 1VQOA 2R92H 4XXEA 1EQVA 1WTHA 4DR5Q 2VUMH 1P8LA 3CCEA 1N34Q 4FF1A 5IP7G 1JORA 1SMXA 2XRSD 2EYOA 4JBJA 4DK1A 4L6TB 4LF8Q 3CC2A 1EUJA 5M3MH 4IPHA 3PF5A 1I5FA 3A8IE 1S4ZA 1PYSB 3SE0A 4LFBL 1OXVA 4AYBG 4FNFA 3QB3A 3WOFA 5HURA 3J80c 4HSVA 1X54A 1WCMH 1BBUA 5M5XB 2UUBL 1C8CA 3ZJYC 2JJQA 1EFID 2TSSA 3G71A 2L4NA 1I4XA 3KLRA 5I9PA 4P73A 4OHJA 2K1BA 4JYAL 3CRKC 3P20A 4JOIC 2VB2X 2EXZA 3J80E 1GM5A 1UEAB 4XTCS 3GV3A 3FHWA 2AWNA 2VY3A 1BDOA 1QOHA 2I46A 4K5XA 5IODA 4DUYL 2O5JC 1XTCD 3CP0A 4OWTB 2WIIB 4DAYB 3GTQB 4MNOA 5D3DA 4WJWA 4X3UA 3K5NA 2KENA 3RZDH 3HOXH 3J7AV 1XMQQ 2C5CA 1EWHA 1PH8A 5JJKA 1HZCA 1GHKA 2E2HH 1SNDA 2EPBA 4LFAL 4F8MA 3FMCA 5GROA 2Z0SA 1VQJA 2A19A 2WFWA 4KY7A 5KYLA 2A5HA 5IOCA 3W1BA 1A2UA 4A3GG 2NZHA 1MIUA 3S2HB 3I90A 3NK9A 1SEBD 1S5BD 3E6ZX 2L15A 3K5MA 5I6WA 4X66Q 3GTLB 4AIMA 5IT9L 1CHQD 2NWGA 1TS2A 3G6JB 1SRUA 1ET9A 4NXNQ 4HN7A 1OTCA 2F0PA 1SYCA 3PGZA 4OWWB 2XGTA 3H3VC 3RN2A 2VQEL 1NBWA 3O13A 1NJIC 2R93H 4I7ZC 4DR1L 2R7DA 1JWSD 4NXMQ 1YHAA 2RDFA 5LMNL 2XVSA 4ZK9B 2QDBA 2KJXA 4JI2Q 1MKHA 3VA5A 5CYUA 4R4TA 3B6YA 3PO2B 1F2ZA 4B3RL 2B2WA 1SYBA 1CQVA 1JICA 2VZAA 3CHBD 5JJZA 5K36H 1KNEA 2HHHL 3I72A 1HNZL 3H94A 2B2UA 1N32Q 4G7HC 4IOAA 1VQKA 5M5XH 4JW0A 2JYOA 1H9MA 3CC4A 3OHXC 1A2TA 3E0JA 3EVQA 4JI0L 3TQYA 2MPMA 3MFGA 4QQBX 3RN5A 2M00A 2Y0SE 3BVZA 1CA5A 1W3SA 2ATWA 4A4IA 3TS2A 3SK4A 2WV6D 5EGTA 5BR8L 1D8LA 4IUTA 2WAQB 3OMGA 4KN4C 3GTQH 1QNKA 4PNYA 4PG3A 3L2PA 1IBKL 3I70A 3CPFA 3A74A 3UDGA 1KD1C 3KBXA 3VYTA 1DYQA 3S1QB 5LL6S 3ULLA 4QUFA 1TR5A 1LTTD 3HKZB 2SNMA 2K7VA 1PH4A 2L1BA 5GAEC 1JB3A 3MTSA 5M9OA 2DJFC 5ELEA 3TEHB 5AJ3Q 1I50H 1M4VA 1RHPA 4J8QA 2RKSA 1IBMQ 1GHJA 2GA4B 3E5SA 4CDFC 1E22A 3D4DA 1D5MC 4X65Q 3S2HH 5M3FG 4DU9A 2FMCA 4JI5L 5F2DA 4R8IA 3FKIG 3TN2A 3GTLH 4R4OA 3Q24A 3C2PA 2JA5G 2PMZE 4KKSA 2OEOA 3RZOH 1OXTA 3X3MA 4A3LH 1L0YB 3BYYB 3J81j 4JI1Q 2B2WC 3TP6A 2IX1A 4A3JB 1VQ5A 1BBXC 2JA7G 4LUOA 1G91A 2B2UC 3NE5B 1WYDA 3HS0C 2UUAL 2C9OA 2RHSB 5GAGC 5IGDA 1TWFB 1EY7A 3U58A 4C56C 3ERQA 3K81C 4A75A 2EY6A 1MD2D 1JMCA 1DOMA 1A3VA 2P5ZX 1CSPA 4AYBE 3CCVA 3NPPA 4MZ9A 4F87A 1RTOA 3M7GA 1N9WA 2ENBA 3H0GB 5I2YA 2R92G 3SVMA 1A3TA 4B9WA 2F03A 1TWCB 1XTDA 2IX0A 1X3FA 1SR3A 2RSOA 2PO4A 3A5UA 4A76A 2VUMG 1EQRA 2EYPA 2LXJA 1UNSA 1EOTA 2EDGA 2RVLA 4CJ1B 3CC7A 4B08A 2AQ3B 2ZTCA 5C3XA 4N8X1 4P74A 3AB9A 2DN8A 3LNNA 4X6AH 2UXCL 2CQAA 1T9HA 2IWHA 4IZ8A 3QR8A 1YNXA 5M3MG 2PYKA 2EZVA 1YJNA 1VQHA 4ZKBB 3FP9A 4A3DB 1Y1VH 1B44D 1WCMG 2HCIA 4B3SL 4MN3A 2F3WA 4JBKA 3NWTA 3LWEA 1U4LA 2F0GA 3M4PA 2E2JB 1A0IA 3MXNA 3S1QH 5E7NA 3SK8A 1UE6A 1HA6A 1WJJA 2Z6KA 3HOUG 3GTOH 4H02A 2QEJC 1K8AC 1LTRD 1EQTA 1OXUA 1LLRD 4EVOA 1PH7A 4QL5A 1X6OA 4OONA 1ZEQX 5FLXE 2ZM6L 3HOXG 3R93A 5FJ8H 3VA7A 2F0MA 1TS5A 1BXTA 4H0LC 1BF4A 5C4ZA 5EAYA 4KHPQ 1FJGL 1IYUA 2NVYB 4K2KA 4DUZQ 4YHHL 4DAPA 1WFQA 1YZ6A 3EQLC 4KTAA 2KUMA 4POGA 1WI5A 2E5LQ 4HJAA 2EYMA 4DR6L 3F2BA 2EYFA 1PH5A 1JOOA 1PV4A 2BA0A 3FVQA 1Q3LA 1TIID 4A3JH 1C48A 1PZKD 4DK3C 4YCWA 1HR0W 3VYRA 1VF7A 3RNUA 3Q22A 2PI2E 4PZ6A 4UPAA 3R3OA 1PYBA 1JJGA 4G57A 3OPOA 1XMOL 2K5DA 3GD7A 4ZLTF 1BR9A 3MXUA 3I4NB 2Q8RE 2NVTH 3LWUA 2HIVA 2I5LX 1SNQA 4QJFA 4K0KQ 5C44B 3H0GH 1TVXA 2R93G 1TWCH 1AW7A 4X3KA 3I7FA 1I94L 5IGFA 4ABNA 4X3TA 4OX9Q 3KYHC 3CU7A 1F9SA 2CKZB 1IYVA 4YCVA 1KDBA 2WKCA 3BVGA 4ZAIA 1QVGA 1AFPA 1K8GA 4A3BB 3HOWH 5K36G 1LT4D 5ELDA 4EX5A 3I55A 3HOYH 2C35B 3TZDA 2PPBC 1FNVA 5CV8A 2Z6KC 3M85A 1F2MA 1SNOA 2L5TA 4LF5Q 1SNMA 4F7XA 4KN7C 3GTGB 5BN5A 3IFDA 1NCVA 4YWLA 5FOBB 1PTOD 1SE4A 1Z47A 2E2JH 4K6LA 1WD0A 2UXBQ 1K3BC 4PMWA 4R1JA 4KD4A 4DV4Q 1VQAA 2IHEA 2LSSA 1JB7A 3MA2B 4WFN3 2KVMA 3HRZC 3TZUA 2NTTA 1V1QA 3A7LA 4YY3L 4JI6Q 3AFPA 4AQYL 5C0XI 1PFSA 2MFIA 1FNUA 4B3TQ 3J81L 2JP1A 2KCNA 1TWGH 3VR4A 4K2LA 3T1YL 5IP9H 4G4KA 2I0QA 5JJIA 2B2VA 1ZYRD 2LXKA 1VQEA 2NVYH 4RKBA 3KLSA 3VR3A 2Z4IA 2HQLA 3PUYA 1DD2A 1K83B 3S1NB 4ID6A 1STYA 5ELFA 1VMPA 5JPMC 5E4XA 2R61A 4GS3A 1CSQA 4IPDA 1B8AA 4QIWE 1STAA 3T4AC 3H3VI 1F2YA 4OIKA 2E2IB 2EE1A 2ICEC 5LL6X 4HEDA 1IKMA 3C1EA 3MAQA 1K28A 2RDGA 4HR7B 4CKEA 3I4LA 2CH4W 3H15A 4IO9A 1V43A 2FINB 2JQOA 4RCNA 4TQUS 2F4VQ 1W6JA 3FPPA 1Y8NB 4DR7L 4A3LG 1HNWL 1MSGA 1WTPA 4A3EH 3I4NH 1J9OA 1K8OA 3S14B 1HPCA 2JEAI 5C44H 4Y52H 5FO9B 5KGUA 3TS0A 3J7AF 2EYHA 2MGSA 1II3A 3PIO3 4KY6A 3M9BA 1BCPD 3TMEA 4DAVA 2ASBA 3FRPB 1HXYD 2YTVA 4I7AA 4BA2I 1ZYRC 1SMYC 4WJ4A 3ER0A 3PO2G 4HIMA 2RCFA 3R2IA 4FP5D 4M1UB 5CGKA 3HFZB 3K7AB 1B70B 1GUSA 1KHIA 3STBD 4BA1I 1WTWA 5M5YB 3J81i 4HCSA 5A2QE 4DAMA 4X64L 2SDFA 1E7ZA 1X3GA 2HCCA 1IYJB 4RGMA 1SYDA 3C1FA 2B2VC 1Y8PB 4DK6C 5FK9C 1SE3A 4L63B 3A7AB 4KJOA 4KY5A 2G5DA 4HMJA 4H13C 1MBYA 4ULLA 3V05A 3D8GA 2WAQG 3KUPA 4P72A 4YWMA 1S40A 1K73C 2UUCQ 4IURA 4GKJL 4TKOB 4BBRB 5KRUA 1BCPC 1PZID 3S15H 1N33L 4AH6A 2V1CC 4Q5VA 3HKZG 5KYIA 4NB3A 1G8ZD 3D3RA 3S1NH 1FGBD 2WACA 1FD7D 3STBC 1RD9D 1PFMA 4BY7H 1YBYA 1EY0A 1HR0Q 1HHVA 4RA8A 2E2IH 4CJ2C 2X6LA 1R4PB 4UP7A 1NSNS 5FJ8G 1AP0A 1O7IA 1WTOA 1PTOH 3EA6A 2D2CC 3CMEA 3BG3A 4DV7L 3F2DA 1KXLA 4YWKA 4RG1A 4XQJA 4XIGS 1U4MA 1YHQA 4IUPA 4CJ0B 2R3ZA 3U50C 2N8NA 1K0SA 2DY7A 3CQZB 3UDIA 2D0PA 1EZ6A 4CKCA 1XNRL 2NN6H 2KHSA 2F0OA 5LMUQ 4P2CB 4APVA 3DEPA 2CWAA 3BS1A 1C7YA 4A3JG 2OTJA 4NP5A 1Q82C 4DF7A 2YV5A 2CQOA 5KNDA 3GTJB 2D62A 1KLGD 2FJ2A 2XWBB 4PMBA 2QGQA 5IGEA 5D65A 1D2BA 1LT5D 4K5WA 2OF1A 1TY2A 5E4WC 3CCQA 4DR2L 2KCTA 2PW5A 1X55A 4IALA 3PCOB 3D4RA 3H0GG 3HOUH 3I2ZA 1S3OA 4CDCC 2YU9B 3A5ZB 3DEOA 4A3MB 5CORA 2D5DA 5CV9A 4LF9L 1UE5A 3ERSX 5G3LD 2UXDQ 3KFUA 2OTLA 3NELA 3I4OA 4R4QA 1B9MA 1XYIA 3GP7A 1YJ9A 2GVAA 3HOWG 3U9SA 1T5EA
chains in the Genus database with same CATH topology
5C6AA 3HOVB 1H9RA 2LKVA 4IUUA 2DNEA 1I3QB 4KHVA 1A3UA 4Y7NB 2MP1A 3TP8A 4GZYC 1GUNA 1VF5C 2M9VA 3S1RB 2J4XA 4R9WA 4C3HB 3MHBA 4BS9A 4K8JA 3U9OA 1PRTB 2VB3X 4JK1C 1PRTC 1WTXA 1EL0A 1Q1EA 3MXPA 1B4OA 3NSWA 1PMRA 3N52A 3J80L 5JOBA 4OIJA 4IUVA 2L9HA 3PO3B 1O7ZA 2BCOA 1O80A 5E3FA 4A3KB 1I6HB 1PYWD 3IL8A 4PMCA 1PTOF 5C4XB 4RFBA 5EKIA 4FF4A 1ENAA 4OO1I 4KD3A 5EJWA 5DM63 2Q8IB 4DFAA 3DHQA 2FFKB 3MXGA 1GUTA 4K6DA 3S2DB 2F0LA 4RGOS 1SFOB 2K6AA 2YYZA 3I4MB 1EIGA 1HUMA 2G9DA 3OWFA 3OWEB 1E2WA 3H91A 2Y0SB 2N55A 5JAVA 1DXMA 3D6WA 2K5WA 1G6ZA 2RA4A 3RMHA 1CI3M 4C2MB 2F0DA 1JWMD 4C3IB 2EVBA 5I9OA 1IKLA 1SJED 3RD4A 2SOBA 2VXWA 2NVQB 2R6GA 4CBVA 3D6CA 3H09A 5E1FA 3BYTB 3DWQA 4C3JB 1D1IA 2XNAC 1B2TA 1I4GA 2BDOA 4S3SA 5JPNC 5JEAJ 5C0XH 3MZ5A 4QF4A 5DNFA 3P1HA 3PUZA 2H1EA 5KNBA 1QG7A 1WTVA 1D5ZC 2MJ8A 1BCPF 4OGQC 1HUNA 5K5PA 3SK6A 5T1GA 4IQZA 2EY5A 5ELBA 2PMZB 2E2DC 3BZDB 2VNUD 4DK0A 2LFNA 4A3IB 2V4DA 2CW0D 2O5IC 3NP8A 2EJGC 2JXMB 3PUXA 3NUCA 5CV4A 2O2LD 4MIUA 4LAAA 1Q8IA 1XX8A 4KKUA 4J6HA 3K5OA 3TP7A 2JA8B 4C1NI 4AYBB 2NN6I 4V0BA 1FYCA 4EQNA 5J22A 1T5XD 4RKLA 5J1ZA 3VR6A 3R2TA 1F2LA 2IT1A 2L0CA 2ZXPA 3OSOA 1BUVT 2ID0A 3C46A 2RDHA 1ZXTA 3OMCA 2F4IA 3T13A 2B2YA 1LABA 2NN6G 2DNCA 3G7LA 1TS3A 3J7YW 2B63B 2RSNA 2R7ZB 1OO9B 4PQXA 3SDZA 1EY5A 3A56A 2CW0C 1STHA 4XQNA 4M8AA 1F9QA 1CFMA 1VCIA 2NYZD 3GTKB 1I4QA 3W2DA 4DXGA 1EU3A 1YNND 3CRLC 3GV6A 1ILQA 1SBBB 4H7BA 1LACA 1FR3A 2Q8TA 1TKWB 2JA6B 2A74C 3DUZA 4HSPA 3EJIA 2F0UA 5M5WB 3IKJA 2A6HC 1PFNA 1SYEA 4TSSA 4H44C 1SYGA 4QCLA 4NKLA 5EPKA 5EQ0A 4HAEA 3A8JE 2IL8A 1NR2A 1ENCA 4V190 2F3VA 3GTPB 1EYDA 3JAME 3PIP3 1JC7A 1YNNC 5G3LF 4KMUC 4HTHA 1H9KA 5DAUA 4RGNA 2XIWA 2SNSA 1IL8A 2B2YC 1EWCA 4ZQ3A 3OIPA 5EBCA 1TU2B 1EIHA 2XRQD 3M3YB 1U9RA 1B50A 2Z1CA 2HQEA 4ZUIA 1FNWA 3S1MB 4O42A 4QB4A 1GXDC 3NTKA 1OXXK 4U68A 5DEHA 1RKNA 3D31A 1JE4A 3NXWA 4FF3A 4IUNA 1Q12A 4KKTA 5A35A 4A93B 3BDLA 4ZKCB 1G2SA 2E76C 5T1IA 1HCZA 2PZTA 1KDAA 1E0BA 4NDXA 4XYOA 1F9RA 1HQRD 1SMYD 5IGGA 1Q90A 4Q0FA 4EGVA 3IAYA 4C1NK 5C0XG 3QJYA 5DM73 1I4HA 2NVXB 2F0QA 4QIWB 1LTSD 2BA1A 2MUYA 3L3OC 2A68C 1D6EC 1V1OA 4C3HG 1KTKA 5KIXA 1BOSA 1ESRA 5JEAH 4OO1H 5CC4A 3KK7A 1I4RA 5D14A 1MI2A 5COYA 4BY1B 1CM9A 3NHHA 1R9TB 3PUVA 3UI2A 2N88A 5I6YA 5CBEE 4RHSA 5C3EB 5FO7B 3RLFA 2EY2A 2OXPA 1JR0D 2PW7A 3QOLA 2ICIA 2NTSA 1CHPD 3KBGA 1EYAA 2ZXRA 4XDXA 2EYJA 4O1NA 2F0IA 1SAPA 4CGYB 2JSOA 3QG1A 1HFNA 1PZJD 2O4XA 1G291 3TP5A 3A8KE 1H9JA 3K5LA 4QUCA 4KJNA 3RZDB 1B53A 3DWPA 1SDFA 1BQQT 4E6IA 2AUKA 1EEID 2HDLA 3HGBA 1BNZA 1VDZA 4UAIA 1TWAB 1V1PB 4K8IA 1E2ZA 3AU7A 4C3JG 5BN3A 3H6MA 3ONAB 2F1MA 2L11A 3MVVA 3CKIB 3MEHA 3MC0B 1EEFD 2F0HA 3TBIB 1LT6D 1DONA 1MGSA 2AQ1B 5BN4A 1O7YA 1S5CD 2QCPX 3IFTA 3R8BA 3W3AA 1RODA 1SNCA 2KEDA 1EZ8A 4IFDJ 1Q1BA 1PLFA 2NB0A 1I6VC 1LO5D 1RDPD 2MHVA 1CZWA 2R93B 3DMUA 4DNRB 5CV5A 2EOTA 4ZRZA 1RJTA 1B9NA 3KF8A 1VMCA 4DXFA 1TY0A 1B3AA 2Z8LA 1EY9A 1HTPA 5IT9E 2RQXA 3M4OB 2F0KA 2X69A 2B8GA 1PRTD 5IGBA 2NUCA 1SJHD 1LTBD 4ME5A 1S5DD 1GJXA 3DWAA 3K0YA 2WINB 3T53B 1EYCA 2PZWA 1AZPA 1BO0A 1ILPA 2FHTA 3I3CA 1AN8A 1DOKA 2NZ1D 3OIQA 4ZYSA 2IPKD 5LHY1 4EQPA 3V2TA 3VYSA 2IJ0A 4FXDA 2HDMA 1I50B 1CK1A 1DM0B 1CZGA 4A3FB 2B2TA 1CQFA 5NUCA 1X3PA 4OL7A 1SNPA 3M7NA 1UAPA 3RZOB 1R4QB 1ET6A 3QIAA 1G2TA 1Z7TA 3N6RA 3HOZB 3SK5A 3NTIA 5C4JB 2KQ3A 1GOZA 3ND8A 3NBIA 1MSHA 1RF2D 4TRDA 2XWJB 4PV1C 1HQMC 4R8NA 5JVG3 3BDOA 3GQBA 1CT1D 2AUJD 5JEAG 3PV0A 4OO1G 4BWGB 2F0NA 1XXGA 1YNJD 2A69D 5CV6A 3GTMB 4RWSC 1JOQA 5ISRA 1Y1WB 2K5QA 5AFWA 3NQIA 3X3NA 1NR4A 3HG9A 4G7OC 1Y1VB 2BE5D 3SHLA 4HCEA 1X3QA 4DA2A 1F77A 2F0EA 2B2TC 4RAUC 4WRDA 4JBWA 1H9SA 2J0TD 4LJZC 2PCFB 4CKBA 3K59A 2WB1B 4ODGA 2BDNA 2K28A 2K32A 3GTOB 1QB5D 2AQ2B 2IX3A 1PDQA 3S17B 4DNTB 1KNAA 2SEBD 1F9PA 3VYUA 1YNJC 3WDNA 1IHZA 2A69C 2PQEA 2NBFA 1HRJA 2KOLA 2ZXOA 4IN3A 1SE2A 1QWYA 2K03A 4NMZA 4U673 1ESFA 4B9XA 1AEXA 1HTLD 2F0SA 2ZT9C 1ML0D 2XSCA 2KCCA 1QNUA 5EKLA 5FO8B 4KHZA 4G7ZC 2B39A 2BE5C 1KLUD 3C3LA 1JWUD 4J1MA 2EY1A 3S16B 5EKKA 1B1ZA 5EPJA 1D5XC 3P75A 2A6HD 3PMFA 3L9AX 2K05A 3MWYW 3HEJA 2NVTB 3M4YA 4YIJA 4Z9CB 2QKIC 1EU4A 3TSSA 1A6XA 3HZXA 5J39A 4N9PA 1EY8A 2A73B 4IFDH 1H9SB 2CVRA 3PUWA 3BDCA 3HOWB 1LV9A 3T51B 2F0WA 3HOYB 1NAPA 2IW3A 1L0XB 1WVLA 1EY4A 4FYDA 1WTQA 2KA7A 1HA5A 4FVMA 4A3GB 5ELCA 1CTMA 2K04A 5C4HA 1I4PA 1S5ED 3I73A 2E74C 4MHEA 1TS4A 2PNRC 2WKDA 3FEWX 1DZ1A 2EYLA 5JVH3 5CMDA 2XN9C 2OT2A 1SYFA 1XWEA 3ND9A 1TWGB 3FPUB 4KV6A 1D1KA 5CBAE 5CR3A 4RGTA 1RCVD 1PRTF 2JE6I 2X6GA 3BVMA 1GUWA 3EROA 1PFBA 4RCOA 1C4QA 1Y8OB 2M2LA 1J8IA 4ZUJA 3T56B 1KAAA 1GUOA 1K8MA 1QCBD 4DN4M 4WORA 1S5FD 2TMPA 4IUQA 1KABA 1M8AA 1IW7D 4XQQA 5CV7A 2J7ZA 2L55A 2L12A 2RBMA 3J81E 4RH6A 3WOEA 1W6KA 4XYQA 4A3EB 2LS01 4EQOA 3T16A 2H4OA 2JEBI 5FLXL 5C3WA 3Q0AA 1QILA 1O78A 2K01A 3V96A 2LMCB 4FXKC 3K6OA 2B8FA 1STNA 1DOLA 1NUCA 2A68D 1CA6A 2BOSA 1STGA 3Q6SA 5I2XA 3FDTA 2WP8J 4FF2A 2EJFC 4I65A 5M3FB 1IW7C 3JAML 3RUZA 3QO2A 1TT2A 2F0JA 3KLSX 3DM1A 2A6ED 3FKIB 3I8ZA 2LY7A 3NBHA 4K5VA 2KECA 1STBA 2JA5B 2KEEA 4ILWA 5KEEA 3A54A 3NQTA 3K57A 1GUGA 3GO5A 2QILA 1U4RA 2JA7B 3ITPA 1E2VA 1JOKA 4RHRA 3S15B 3QWNA 4HMIA 4FXGC 1DJRD 1V1PA 1QJOA 3A55A 3EFXD 1JCKB 1ZKOA 3NTHA 4QMGA 1EY6A 4BY7B 3OW7A 4L8JA 2R92B 1QE6A 4CHTB 5IGCA 3AMUA 3Q23A 2VUMB 1PTOB 4FO2A 4F88A 2EJMA 1PTOC 3QOJA 1A15A 2A6EC 3K58A 2F0FA 1ICWA 5C5LA 5M3MB 4N9TA 1WTRA 3OOCA 1UUPA 1WCMB 4X3SA 1WD1A 4KK7A 5C0XJ 3ZYYX 1STEA 2D9UA 3NWSA 3P7JA 5EPLA 3HP3A 2I07B 3VR2A 3F2UA 5TSSA 1U4PA 2K33A 4IFDI 1Z6HA 5HGTA 1OXSC 2E75C 5FKAC 3URYA 5IIFA 2HUGA 3HOUB 3LX0A 4XT1B 2PZUA 3SR1A 1LT3D 1PXUA 1LTID 1SSOA 3HOXB 1TQOA 1HFGA 3SEBA 1LTGD 1KDCA 4IFDG 4C3IG 2E2HB 2AWOA 4DGZA 1X32A 2FMMA 2Z4HA 4DAYA 4BBSB 1DCZA 5I4DA 3S9WA 1LTAD 2F0TA 4NW2A 1O7LA 5C5MA 3SXHA 1ONLA 4LK1C 5EBDA 1TWHB 1Y69U 1BCPB 1AZQA 3MFYA 2F0VA 4XT3B 5D3IB 3I91A 4K14A 3D4WA 4KI0A 2QF7A 3DXJC 3VR5A 5KNCA 4LMQD 2G9HD 2DY8A 3L7ZC 2CHBD 1ENFA 4UDUC 1RTNA 5A2QL 1JQYD 1V8QA 4XXEA 1EQVA 4FF1A 1JORA 2XRSD 2EYOA 4DK1A 4L6TB 3A8IE 1S4ZA 3SE0A 1OXVA 4FNFA 3QB3A 3WOFA 5HURA 4HSVA 5M5XB 1C8CA 1EFID 2TSSA 2L4NA 1I4XA 3KLRA 5I9PA 4OHJA 2K1BA 3CRKC 3P20A 2VB2X 2EXZA 3J80E 1UEAB 4XTCS 3GV3A 2AWNA 1BDOA 1QOHA 2I46A 4K5XA 5IODA 2O5JC 1XTCD 2WIIB 3GTQB 5D3DA 4WJWA 4X3UA 3K5NA 3J7AV 2C5CA 1EWHA 1GHKA 1SNDA 2EPBA 4F8MA 3FMCA 4KY7A 5KYLA 2A5HA 5IOCA 1A2UA 3S2HB 3I90A 3NK9A 1SEBD 1S5BD 3E6ZX 3K5MA 5I6WA 3GTLB 5IT9L 1CHQD 2NWGA 1TS2A 3G6JB 1ET9A 4HN7A 2F0PA 1SYCA 3H3VC 3O13A 4I7ZC 1JWSD 2RDFA 2XVSA 4ZK9B 2QDBA 2KJXA 3VA5A 5CYUA 3PO2B 1F2ZA 2B2WA 1SYBA 1CQVA 1JICA 3CHBD 5JJZA 5K36H 1KNEA 3I72A 3H94A 2B2UA 4G7HC 2JYOA 1H9MA 3OHXC 1A2TA 3E0JA 3EVQA 2MPMA 1T5EA 3MFGA 2M00A 3BVZA 1CA5A 3SK4A 2WV6D 5EGTA 4IUTA 2WAQB 3OMGA 4KN4C 1QNKA 4PNYA 3I70A 3KBXA 3VYTA 1DYQA 3S1QB 5LL6S 4QUFA 1TR5A 1LTTD 3HKZB 2SNMA 2K7VA 2L1BA 1JB3A 3MTSA 5M9OA 5ELEA 4J8QA 1M4VA 1RHPA 2RKSA 1GHJA 2GA4B 3E5SA 3D4DA 1D5MC 4DU9A 2FMCA 5F2DA 4R8IA 3TN2A 3Q24A 3C2PA 4KKSA 2OEOA 1OXTA 3X3MA 1L0YB 3BYYB 2B2WC 3TP6A 2IX1A 4A3JB 1BBXC 1G91A 2B2UC 3NE5B 3HS0C 2C9OA 5IGDA 1TWFB 1EY7A 4C56C 3ERQA 2EY6A 1MD2D 1DOMA 1A3VA 3NPPA 4F87A 1RTOA 3M7GA 2ENBA 3H0GB 5I2YA 3SVMA 1A3TA 4B9WA 2F03A 1TWCB 2IX0A 2RSOA 2PO4A 2EYPA 4CJ1B 1UNSA 1EOTA 2EDGA 2RVLA 4B08A 2AQ3B 5C3XA 3AB9A 2DN8A 3LNNA 2CQAA 2IWHA 4IZ8A 2PYKA 2EZVA 4ZKBB 4A3DB 1B44D 2HCIA 4MN3A 2F3WA 3NWTA 3LWEA 1U4LA 2F0GA 2E2JB 3MXNA 3SK8A 1HA6A 2QEJC 1LTRD 1EQTA 1OXUA 1LLRD 4EVOA 1ZEQX 5FLXE 3R93A 3VA7A 2F0MA 1TS5A 1BXTA 4H0LC 1BF4A 5C4ZA 1IYUA 2NVYB 4K2KA 4DAPA 3EQLC 4KTAA 2KUMA 2EYMA 2EYFA 1JOOA 2BA0A 3FVQA 1Q3LA 1TIID 1C48A 1PZKD 3VYRA 1VF7A 3Q22A 3R3OA 4G57A 3OPOA 2K5DA 3GD7A 4ZLTF 1BR9A 3MXUA 3I4NB 2Q8RE 3LWUA 1SNQA 5C44B 1TVXA 1AW7A 4X3KA 5IGFA 4ABNA 4X3TA 3CU7A 1F9SA 1IYVA 1KDBA 2WKCA 3BVGA 4ZAIA 1AFPA 4A3BB 5K36G 1LT4D 5ELDA 3TZDA 2PPBC 1FNVA 5CV8A 3M85A 1F2MA 1SNOA 2L5TA 1SNMA 4F7XA 4KN7C 3GTGB 5BN5A 3IFDA 1NCVA 5FOBB 1PTOD 1SE4A 1Z47A 4K6LA 1WD0A 4PMWA 4KD4A 3MA2B 4WFN3 2KVMA 3HRZC 3TZUA 2NTTA 3A7LA 5C0XI 1FNUA 3J81L 2JP1A 2KCNA 3VR4A 4K2LA 4G4KA 2B2VA 1ZYRD 4RKBA 3KLSA 3VR3A 2Z4IA 1DD2A 3PUYA 1K83B 3S1NB 4ID6A 1STYA 5ELFA 1VMPA 5JPMC 5E4XA 2R61A 3T4AC 1STAA 1F2YA 4OIKA 2E2IB 2EE1A 2ICEC 5LL6X 4HEDA 1IKMA 3C1EA 3MAQA 2RDGA 4HR7B 4CKEA 3I4LA 1V43A 2FINB 4RCNA 4TQUS 1W6JA 3FPPA 1Y8NB 1MSGA 1WTPA 1J9OA 1K8OA 3S14B 1HPCA 2JEAI 5FO9B 5KGUA 3J7AF 2EYHA 2MGSA 1II3A 3PIO3 4KY6A 3TMEA 1BCPD 4DAVA 3FRPB 1HXYD 4BA2I 1ZYRC 1SMYC 3R2IA 4FP5D 4M1UB 5CGKA 3K7AB 1GUSA 4BA1I 1WTWA 5M5YB 4HCSA 5A2QE 2SDFA 2HCCA 4RGMA 1SYDA 3C1FA 2B2VC 1Y8PB 5FK9C 1SE3A 4L63B 3A7AB 4KJOA 4KY5A 4HMJA 4H13C 1MBYA 4ULLA 3V05A 3D8GA 3KUPA 4IURA 4TKOB 4BBRB 5KRUA 1BCPC 1PZID 4Q5VA 5KYIA 1G8ZD 3D3RA 1FGBD 2WACA 1FD7D 1RD9D 1PFMA 1EY0A 1HHVA 4RA8A 4CJ2C 2X6LA 1R4PB 1AP0A 1NSNS 1WTOA 1PTOH 3EA6A 2D2CC 3BG3A 4XQJA 4XIGS 1U4MA 4IUPA 4CJ0B 2R3ZA 2DY7A 3CQZB 1EZ6A 4CKCA 2NN6H 2KHSA 2F0OA 4P2CB 3DEPA 3BS1A 4NP5A 4DF7A 5KNDA 3GTJB 2D62A 1KLGD 2FJ2A 2XWBB 4PMBA 5IGEA 5D65A 1D2BA 1LT5D 4K5WA 2OF1A 1TY2A 5E4WC 2PW5A 4IALA 3D4RA 2YU9B 3DEOA 4A3MB 5CORA 2D5DA 5CV9A 5G3LD 1XYIA 1B9MA 3GP7A 3TDQA 3U9SA 1SXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TN2 A;  1F9Q A;  3R93 A;  1RTN A;  2NYZ D;  2JP1 A;  2X69 A;  1BF4 A;  2L12 A;  2K05 A;  4U68 A;  3KUP A;  3MWY W;  4IUR A;  4XDX A;  1B2T A;  4IUU A;  2B2V A;  3GV6 A;  1A15 A;  1SAP A;  1ILQ A;  2KUM A;  2B2W C;  1JE4 A;  1ICW A;  2MP1 A;  4RWS C;  5DNF A;  1BBX C;  1HFN A;  2Q8T A;  1G91 A;  1WTR A;  5AFW A;  2B2U C;  1Q3L A;  4ZK9 B;  1VMP A;  4R9W A;  5E4X A;  2H1E A;  1S4Z A;  4X3S A;  1QG7 A;  1WTV A;  1WD1 A;  1NR4 A;  2K01 A;  2B2W A;  4OIK A;  4QUC A;  4ZKC B;  2EE1 A;  1G2S A;  1PFN A;  1JIC A;  2CVR A;  1PFM A;  2D9U A;  2MJ8 A;  3P7J A;  1BO0 A;  4HED A;  5T1I A;  1KNE A;  4HSV A;  5JJZ A;  1DOM A;  1LV9 A;  5EPL A;  1ILP A;  2FHT A;  3I3C A;  1HHV A;  1HUN A;  3HP3 A;  1B53 A;  4RA8 A;  5T1G A;  1WTX A;  1NAP A;  1EL0 A;  2B2U A;  1DOK A;  1E0B A;  1DOL A;  4CJ2 C;  1SDF A;  2NZ1 D;  1F9R A;  1RTO A;  2X6L A;  4ZLT F;  1X3Q A;  1AP0 A;  1B4O A;  2FIN B;  1CA6 A;  1WTO A;  3F2U A;  2L4N A;  1WVL A;  2HDL A;  3N52 A;  3SVM A;  2Q8R E;  1U4P A;  1WTQ A;  2JYO A;  1BNZ A;  4UAI A;  2B2T C;  4RAU C;  2K1B A;  5EPK A;  4OIJ A;  3Q6S A;  5EQ0 A;  1TVX A;  1MSG A;  2L9H A;  2RSO A;  4HAE A;  4IUV A;  2HUG A;  1O7Z A;  3ONA B;  1WTP A;  1J9O A;  1U4M A;  1O80 A;  2L11 A;  4IUP A;  4CJ1 B;  3GV3 A;  1EOT A;  2IL8 A;  2K04 A;  2MPM A;  2R3Z A;  2RVL A;  3FDT A;  4CJ0 B;  2DY7 A;  1NR2 A;  4X3K A;  2HDM A;  3IL8 A;  4XT1 B;  4MHE A;  1XX8 A;  4X3T A;  1CA5 A;  3DEP A;  2MGS A;  3QO2 A;  2BDN A;  2K28 A;  5EKI A;  1DON A;  3DM1 A;  1MGS A;  2B2T A;  1C8C A;  1O7Y A;  1PDQ A;  1F9S A;  1KNA A;  1F9P A;  1SSO A;  3I8Z A;  5EJW A;  4X3U A;  4ZAI A;  1HFG A;  1DZ1 A;  4ZKB B;  2FFK B;  2KEC A;  2FJ2 A;  4IUT A;  1X3P A;  5CMD A;  1ROD A;  1QNK A;  2KEE A;  1HRJ A;  1AZP A;  2KOL A;  2HCI A;  2KED A;  2XIW A;  5D65 A;  1ESR A;  3TZD A;  1X32 A;  4MN3 A;  2K03 A;  3FPU B;  2EPB A;  1PLF A;  1IL8 A;  2B2Y C;  3KBX A;  5E4W C;  5D14 A;  5CBA E;  1U4R A;  2FMM A;  1F2L A;  4QUF A;  1WTW A;  3LWE A;  1MI2 A;  1U4L A;  5COY A;  1EIG A;  1HUM A;  1ML0 D;  2L1B A;  4HCS A;  1G2T A;  3IFD A;  1CM9 A;  1NCV A;  2X6G A;  1EIH A;  1GUW A;  3MTS A;  4NW2 A;  1PFB A;  1ZXT A;  2M2L A;  1J8I A;  3H91 A;  2SDF A;  3DEO A;  3UI2 A;  1HA6 A;  2N55 A;  2EOT A;  2N88 A;  1RHP A;  1WD0 A;  5CBE E;  5COR A;  2B2Y A;  1RJT A;  2HCC A;  3I90 A;  3G7L A;  1AZQ A;  4DN4 M;  1IKM A;  4XT3 B;  1B50 A;  3D6W A;  3I91 A;  2RSN A;  1G6Z A;  1VMC A;  2RA4 A;  1EQT A;  2KVM A;  1B3A A;  2B2V C;  1MSH A;  5EPJ A;  4IUQ A;  1M8A A;  1IKL A;  4LMQ D;  4O42 A;  2DY8 A;  4R8I A;  1XYI A;  2VXW A;  2NWG A;  1QE6 A;  2J7Z A; 
#chains in the Genus database with same CATH topology
 4GKK L;  4JI3 L;  4YHH Q;  4DV2 Q;  4IOC A;  3HOY G;  1VQI A;  5C6A A;  3HOV B;  1JJ2 A;  4DV3 L;  3KJP A;  1H9R A;  3J7A 5;  4BBS H;  2LKV A;  4IUU A;  2DNE A;  1I3Q B;  4KHV A;  1RL2 A;  1A3U A;  1YI2 A;  4Y7N B;  4LFC L;  2MP1 A;  3TP8 A;  1K9M C;  2Z9H A;  4GZY C;  1TWH H;  1GUN A;  4BBR H;  1VF5 C;  2FXQ A;  2M9V A;  2UU9 L;  3S1R B;  3BZK A;  5IYB H;  2J4X A;  1VQD A;  4R9W A;  4C3H B;  3MHB A;  1JJC B;  4BS9 A;  1LM0 A;  4K8J A;  3U9O A;  4X62 Q;  1PRT B;  2VB3 X;  4JK1 C;  4JI7 L;  1BKB A;  1PRT C;  4LF7 Q;  1WTX A;  1EL0 A;  1C9O A;  1Q1E A;  3MXP A;  1B4O A;  1E1O A;  3UE0 A;  3NSW A;  3K80 C;  1PMR A;  3N52 A;  1KAW A;  3W5O A;  5IP9 G;  3J80 L;  5JOB A;  4OIJ A;  4IUV A;  2L9H A;  3PO3 B;  1O7Z A;  2BCO A;  1O80 A;  1XJV A;  5E3F A;  2RHQ B;  4A3K B;  2VQF L;  1I6H B;  1PYW D;  3IL8 A;  4PMC A;  1PTO F;  3DLL A;  5C4X B;  4RFB A;  5EKI A;  4RMF A;  4FF4 A;  1ENA A;  3CQZ H;  4OO1 I;  4KD3 A;  5EJW A;  5DM6 3;  2Q8I B;  4DFA A;  3DHQ A;  2FFK B;  4OEL B;  1HNX L;  3MXG A;  3GTJ H;  1GUT A;  4K6D A;  3S2D B;  2F0L A;  4RGO S;  3Q8D A;  1SFO B;  2K6A A;  1PH6 A;  2YYZ A;  3I4M B;  1SLJ A;  1ICF B;  1EQQ A;  1EIG A;  1HUM A;  2G9D A;  3OWF A;  3OWE B;  1EIY B;  4A3E G;  3I4N G;  2DJG C;  4UP9 A;  1E2W A;  1HH2 P;  4DR3 Q;  4HJ9 A;  3H91 A;  2Y0S B;  1K0R A;  5C44 G;  2N55 A;  5JAV A;  1DXM A;  4DV5 Q;  3D6W A;  2K5W A;  1G6Z A;  2RA4 A;  4IPG A;  3RMH A;  1CI3 M;  4JI8 L;  1Q46 A;  4C2M B;  2F0D A;  1GVP A;  1JWM D;  1S72 A;  4C3I B;  1X56 A;  2EVB A;  1IKL A;  1SJE D;  5I9O A;  3RD4 A;  4CDE C;  2SOB A;  2VXW A;  2NVQ B;  2R6G A;  4CBV A;  3D6C A;  3H09 A;  5E1F A;  3BYT B;  3DWQ A;  3T1H Q;  4C3J B;  1D1I A;  2XNA C;  1B2T A;  4DV0 L;  3HOV H;  1PHJ A;  4L5Q A;  1I4G A;  2BDO A;  4S3S A;  5JPN C;  5JEA J;  5C0X H;  2ZJP A;  3MZ5 A;  1IZ6 A;  3E0E A;  3OYY A;  1I3Q H;  4QF4 A;  5DNF A;  3J80 i;  4B3M L;  4DR4 Q;  4DV6 L;  3E3X A;  1BVS A;  2YTY A;  4JI4 L;  4Y7N H;  3P1H A;  2WB1 E;  1X9N A;  3PUZ A;  1J5E Q;  2H1E A;  5KNB A;  1QG7 A;  1WTV A;  1D5Z C;  1BBW A;  1VQ4 A;  2MJ8 A;  1BCP F;  4OGQ C;  4C3H H;  1SE8 A;  1HUN A;  2Z6B A;  5K5P A;  3UE1 A;  3SK6 A;  5T1G A;  5LMN W;  4IQZ A;  2EY5 A;  5ELB A;  2PMZ B;  2E2D C;  3BZD B;  2VNU D;  3KF6 A;  4DK0 A;  2ZJR A;  3K7U C;  3H3V H;  2LFN A;  4A3I B;  2V4D A;  2A8V A;  1VQ7 A;  2CW0 D;  2O5I C;  3NP8 A;  2EJG C;  2JXM B;  3PUX A;  3NUC A;  5CV4 A;  3PO3 H;  2O2L D;  4MIU A;  4LAA A;  1Q8I A;  1XX8 A;  4KKU A;  1IBL Q;  4J6H A;  3K5O A;  1NNX A;  3TP7 A;  4A3K H;  1I6H H;  1NMG A;  2JA8 B;  2PQA A;  3PIO A;  3PO2 H;  4C1N I;  5C4X H;  4AYB B;  4P75 A;  4GOP A;  4BY7 G;  2NN6 I;  4V0B A;  1FYC A;  4EQN A;  1KRS A;  5J22 A;  1T5X D;  4RKL A;  3OTO Q;  1XNQ L;  3PSI A;  5J1Z A;  3VR6 A;  1LYL A;  4JBM A;  3S2D H;  3R2T A;  1F2L A;  2IT1 A;  2L0C A;  2PI2 A;  2ZXP A;  3OSO A;  4MTK A;  1BUV T;  2ID0 A;  2H5X A;  3C46 A;  2RDH A;  4CDD C;  1NTG A;  1ZXT A;  3OMC A;  1N36 L;  4LF4 L;  2F4I A;  3T13 A;  2B2Y A;  1B3Q A;  1LAB A;  2NN6 G;  2DNC A;  3G7L A;  1TS3 A;  3J7Y W;  2B63 B;  1SRO A;  2RSN A;  2R7Z B;  4DV1 Q;  5FLM H;  4DR5 L;  1OO9 B;  4PQX A;  1UE7 A;  3SDZ A;  4HIK A;  1EY5 A;  3A56 A;  3CCS A;  5IYC H;  2CW0 C;  1STH A;  4LF6 Q;  4XQN A;  4M8A A;  1F9Q A;  1CFM A;  5H1S E;  1G6P A;  1VCI A;  2NYZ D;  4LF8 L;  3GTK B;  1I4Q A;  3W2D A;  4DXG A;  1EU3 A;  1YNN D;  3CRL C;  2NVQ H;  2K4K A;  5IWA Q;  4LW1 A;  3GV6 A;  5FLX c;  1ILQ A;  1SBB B;  4H7B A;  4C3J H;  1LAC A;  1J6Q A;  3AEV A;  1PH1 A;  3CMA A;  1VQC A;  4JV5 Q;  1FR3 A;  2Q8T A;  1TKW B;  2JA6 B;  1AE2 A;  2A74 C;  3DUZ A;  3KF6 B;  1L0W A;  4HSP A;  3EJI A;  3K8A A;  4ZCK A;  5GQO A;  2F0U A;  5M5W B;  3IKJ A;  1D7Q A;  2A6H C;  1PFN A;  1SYE A;  4TSS A;  4H44 C;  1QZG A;  1SYG A;  4QCL A;  4LUZ A;  5IY0 A;  2BH8 A;  2PQA B;  2B3G A;  3U4Z A;  4BBS G;  1XPO A;  4NKL A;  5EPK A;  3JAM c;  4HJ5 A;  5EQ0 A;  3TDQ A;  4HAE A;  4A3I H;  3A8J E;  4LFB Q;  2ZTD A;  4GOP B;  1XMQ L;  2IL8 A;  1ASZ A;  4GOP C;  1NR2 A;  3CCU A;  1ENC A;  4V19 0;  4BBR G;  2UUB Q;  2F3V A;  1NY4 A;  3GTP B;  5IYB G;  1EYD A;  3JAM E;  3PIP 3;  1JC7 A;  1YNN C;  1TWF H;  5G3L F;  4JYA Q;  2JA8 H;  2OQK A;  4KMU C;  4HTH A;  1H9K A;  5DAU A;  4RGN A;  2XIW A;  1YIT A;  2SNS A;  1IL8 A;  2B2Y C;  4DUY Q;  1EWC A;  3S24 A;  1XPU A;  5ELO A;  5GAD C;  2ES2 A;  4X66 L;  4ZQ3 A;  3OIP A;  4JCV E;  1IXR A;  5EBC A;  1TU2 B;  1EIH A;  2XRQ D;  1W2B A;  3EBE A;  3M3Y B;  4NXN L;  1U9R A;  1B50 A;  4A3C H;  2Z1C A;  1L1O A;  5L37 A;  3VDY A;  3CCJ A;  4LFA Q;  2Q2U A;  2HQE A;  4ZUI A;  4A3D H;  4NXM L;  1FNW A;  2B63 H;  3S1M B;  2R7Z H;  4O42 A;  4QB4 A;  1SXT A;  1GXD C;  1KL9 A;  3NTK A;  3BU2 A;  4JI2 L;  1OXX K;  4U68 A;  5DEH A;  1RKN A;  1QUQ A;  4KLK A;  3D31 A;  1B7Y B;  2JK8 A;  1JE4 A;  3NXW A;  4FF3 A;  4IUN A;  1Q12 A;  1N32 L;  4KKT A;  1JE5 A;  5A35 A;  1HZ9 A;  1U0L A;  1P16 A;  4A93 B;  3BDL A;  2JA6 H;  4ZKC B;  1G2S A;  2VQE Q;  2E76 C;  5T1I A;  1HCZ A;  1PH9 A;  4DR1 Q;  2PZT A;  2AHO B;  1KDA A;  2MQH A;  1QVC A;  1E0B A;  4NDX A;  4XYO A;  1F9R A;  1HQR D;  1SMY D;  5IGG A;  1Q90 A;  4Q0F A;  1CKN A;  4EGV A;  5LMN Q;  3IAY A;  3HOV G;  4C1N K;  5ELN A;  4B3R Q;  5C0X G;  3QJY A;  2F52 A;  5DM7 3;  3NEM A;  1I4H A;  1PH2 A;  1YEZ A;  2HHH Q;  3G6E A;  1TXY A;  2NVX B;  2F0Q A;  1HNZ Q;  4QIW B;  1LTS D;  2BA1 A;  3GTP H;  2MUY A;  3L3O C;  2A68 C;  5AJ3 L;  4JI0 Q;  5HGQ A;  1D6E C;  1V1O A;  4C3H G;  1IBM L;  1KTK A;  5KIX A;  1BOS A;  1ESR A;  5JEA H;  4OO1 H;  5CC4 A;  3AFQ A;  3KK7 A;  1L1O B;  1I4R A;  4X65 L;  5D14 A;  2K5N A;  1L1O C;  4JVZ A;  1MI2 A;  5COY A;  4BY1 B;  4QY7 A;  1CM9 A;  3NHH A;  5BR8 Q;  4LWC A;  1R9T B;  3PUV A;  4P71 A;  3UI2 A;  2N88 A;  5I6Y A;  5CBE E;  4RHS A;  3PO3 G;  2KHJ A;  1IBK Q;  5C3E B;  5FO7 B;  2CWP A;  3RLF A;  4A3K G;  2EY2 A;  1QUQ B;  2OXP A;  1JR0 D;  2KCM A;  4JI1 L;  2PW7 A;  3QOL A;  5C4X G;  1C0A A;  4A3B H;  2ICI A;  2NTS A;  4L5R C;  1CHP D;  4GLA C;  1VS0 A;  3KBG A;  1EYA A;  2ZXR A;  4XDX A;  2EYJ A;  4O1N A;  2F0I A;  3CXC A;  1SAP A;  3GTG H;  4CGY B;  1VQM A;  2JSO A;  2K5H A;  3QG1 A;  1HFN A;  1PZJ D;  4JI5 Q;  5IYD H;  2YTX A;  2O4X A;  1G29 1;  3TP5 A;  1CKN B;  3A8K E;  1PH3 A;  1H9J A;  2Y0S G;  4PZ8 A;  5FLM G;  3K5L A;  3DM3 A;  4QUC A;  4A93 H;  4KJN A;  2K75 A;  2VW9 A;  3RZD B;  5IYC G;  1B53 A;  3DWP A;  1SDF A;  1BQQ T;  4E6I A;  3KJO A;  2AUK A;  1EEI D;  2HDL A;  3HGB A;  3CF5 A;  1VDZ A;  1BNZ A;  2KBN A;  4UAI A;  2UUA Q;  1TWA B;  1V1P B;  4K8I A;  2AKW B;  1E2Z A;  3AU7 A;  4IPC A;  4C3J G;  5BN3 A;  3H6M A;  3ONA B;  2F1M A;  2L11 A;  1VQN A;  1K83 H;  3MVV A;  3CKI B;  3MEH A;  1WOC A;  3MC0 B;  4TVA B;  1EEF D;  1X3E A;  3PF4 A;  2F0H A;  3TBI B;  1LT6 D;  1DON A;  2MO1 A;  1MGS A;  2AQ1 B;  4IJH A;  5BN4 A;  1O7Y A;  2CFM A;  1S5C D;  2QCP X;  2NVX H;  2EQS A;  3IFT A;  3R8B A;  3W3A A;  1ROD A;  1SNC A;  2KED A;  1EZ8 A;  4IFD J;  2I5H A;  1Q1B A;  1PLF A;  2NB0 A;  2UXC Q;  1I6V C;  1PVO A;  1LO5 D;  1HZA A;  1A8V A;  1RDP D;  2MHV A;  1CZW A;  3EN2 A;  2R93 B;  2ALY B;  3DMU A;  4DNR B;  3S14 H;  4A3I G;  5CV5 A;  4BY1 H;  2EOT A;  4LNQ A;  4KHP L;  4ZRZ A;  5IT9 c;  1RJT A;  4DUZ L;  3M4Q A;  1JT8 A;  1VQB A;  1B9N A;  3KF8 A;  1R9T H;  4B3S Q;  3F2C A;  1VMC A;  3PQI A;  4DXF A;  1TY0 A;  1B3A A;  5C3E H;  2Z8L A;  3CCM A;  2E5L L;  1N8R C;  2JA8 G;  1EY9 A;  1HTP A;  5IT9 E;  2RQX A;  3M4O B;  2F0K A;  2X69 A;  2B8G A;  3K7A H;  1PRT D;  5IGB A;  5M5Y H;  2NUC A;  1EFW A;  1SJH D;  4GNX A;  1LTB D;  2N3S A;  4ME5 A;  2ZM6 Q;  3E9I A;  1S5D D;  3ULJ A;  1GJX A;  3ICE A;  3DWA A;  3K0Y A;  4A3C G;  4K0K L;  2WIN B;  3T53 B;  1FJG Q;  2K52 A;  1GKH A;  1A63 A;  1EYC A;  2PZW A;  4A3D G;  1AZP A;  2B63 G;  1BO0 A;  2R7Z G;  1ILP A;  2FHT A;  3I3C A;  1AN8 A;  1DOK A;  4OX9 L;  4DPG A;  3CCL A;  1Y14 B;  4HID A;  2NZ1 D;  4UY8 C;  4DR6 Q;  1U5K A;  1EWI A;  3OIQ A;  2QW7 A;  4ALP A;  4ZYS A;  1LUZ A;  2IPK D;  5LHY 1;  4EQP A;  3V2T A;  1E1T A;  1TWA H;  3VYS A;  2IJ0 A;  4FXD A;  2HDM A;  1I50 B;  2QEX A;  1CK1 A;  1XMO Q;  1DM0 B;  1CZG A;  4A3F B;  2B2T A;  4LF5 L;  1CQF A;  3PIP A;  5NUC A;  2JA6 G;  4UHV A;  3RLO A;  3KLW A;  1X3P A;  2UXB L;  2I5M X;  4OL7 A;  4DV4 L;  1SNP A;  1I94 Q;  3M7N A;  3KF8 B;  1V9P A;  3E9H A;  3KOJ A;  1UAP A;  3AYH B;  3RZO B;  3CAM A;  3ULP A;  1R4Q B;  1ET6 A;  3QIA A;  4JI6 L;  1G2T A;  2Q2H A;  1Z7T A;  3UDF A;  4B3T L;  3N6R A;  3HOZ B;  3SK5 A;  1MHW C;  4O0A A;  3KDF A;  3NTI A;  5C4J B;  2HIX A;  2KQ3 A;  1GOZ A;  3CPW A;  3ND8 A;  3NBI A;  1LTL A;  1MSH A;  1RF2 D;  4TRD A;  2XWJ B;  3I56 A;  4PV1 C;  4GN4 B;  4GNX B;  5GAH C;  1HQM C;  4R8N A;  5JVG 3;  4GNX C;  3BDO A;  3GQB A;  1CT1 D;  2AUJ D;  5JEA G;  3PV0 A;  5HY6 A;  4OO1 G;  3WWV A;  4BWG B;  2F0N A;  1XXG A;  1YNJ D;  3M4O H;  2A69 D;  5CV6 A;  2A1A A;  4PZ7 A;  1VQL A;  3GTM B;  2YU9 H;  4RWS C;  2VS1 A;  4YY3 Q;  3GDE A;  4ME3 A;  4AQY Q;  4A3M H;  5ISR A;  1JOQ A;  1Y1W B;  2F4V L;  2K5Q A;  3F1Z A;  5AFW A;  3NQI A;  3T1Y Q;  3X3N A;  1NR4 A;  3HG9 A;  1KQS A;  4A3B G;  4G7O C;  1Y1V B;  2BE5 D;  3SHL A;  2VL6 A;  4JPB W;  2WAQ E;  4HCE A;  4LUV A;  1X3Q A;  1VQ8 A;  4DA2 A;  4UP8 A;  1F77 A;  2F0E A;  2B2T C;  4RAU C;  4WRD A;  4JBW A;  1H9S A;  3HKZ E;  2J0T D;  4LJZ C;  5J3B A;  2PCF B;  4CKB A;  3K59 A;  3S1R H;  2WB1 B;  5IYD G;  4ODG A;  2BDN A;  2K28 A;  2K32 A;  3GTO B;  2EXD A;  1QB5 D;  2AQ2 B;  2IX3 A;  1PDQ A;  3S17 B;  4DNT B;  1KNA A;  2DGY A;  2SEB D;  1F9P A;  1UE1 A;  2F3I A;  3VYU A;  1Q86 C;  4A3F H;  1YNJ C;  1FGU A;  4DR7 Q;  3WDN A;  4A93 G;  1IHZ A;  2A69 C;  2PQE A;  1HNW Q;  2NBF A;  2DUD A;  1HRJ A;  2KOL A;  2ZXO A;  4IN3 A;  1SE2 A;  3KDF B;  1QWY A;  2K03 A;  4BXX H;  1K3R A;  4NMZ A;  4U67 3;  1ESF A;  2GN5 A;  3L0O A;  4B9X A;  1QZH A;  1AEX A;  2CH4 A;  1HTL D;  2F0S A;  2ZT9 C;  1ML0 D;  2XSC A;  2KCC A;  1QNU A;  4NPS A;  5EKL A;  5FO8 B;  2OQ0 A;  4KHZ A;  4G7Z C;  3CW2 C;  2B39 A;  2BE5 C;  2UUC L;  1KLU D;  3C3L A;  1YIJ A;  1JWU D;  3HOZ H;  4J1M A;  1NMF A;  2EY1 A;  2PNH A;  5C4J H;  3S16 B;  3K0X A;  5EKK A;  1B1Z A;  5EPJ A;  4EQ5 A;  1D5X C;  1Q8K A;  2JN4 A;  3BZC A;  1H95 A;  3P75 A;  2ZJQ A;  4X64 Q;  2A6H D;  3PMF A;  1VQ6 A;  3L9A X;  1SFO H;  2K05 A;  3MWY W;  3I4M H;  3HEJ A;  4GN5 A;  1CKO A;  2NVT B;  3M4Y A;  5IE8 A;  4YIJ A;  4Z9C B;  2QKI C;  3CD6 A;  1EU4 A;  2R7F A;  1VQG A;  4GN3 B;  3TSS A;  1HR0 L;  1A6X A;  2MNA A;  3HZX A;  2B29 A;  3OW2 A;  5J39 A;  4BY1 G;  3SGI A;  4N9P A;  1EY8 A;  3GTM H;  1N34 L;  1IL2 A;  2A73 B;  4N8F A;  2AMC B;  1Y1W H;  2N49 A;  4C2M H;  4GKJ Q;  4IFD H;  1H9S B;  5C3E G;  2CVR A;  4C3I H;  3PUW A;  3BDC A;  3HOW B;  1LV9 A;  3T51 B;  2F0W A;  5LMU L;  4OXP A;  3HOY B;  1NAP A;  2IW3 A;  1N33 Q;  1L0X B;  1EIF A;  1WVL A;  1EY4 A;  1CUK A;  4FYD A;  1WTQ A;  2KA7 A;  1HA5 A;  4FVM A;  4A3G B;  4POF A;  5ELC A;  3EIV A;  1CTM A;  3G4S A;  1FL0 A;  2K04 A;  5C4H A;  1I4P A;  1YHB A;  1S5E D;  3I73 A;  1UEB A;  2E74 C;  4MHE A;  1TS4 A;  2PNR C;  2WKD A;  1KC8 C;  3FEW X;  1DZ1 A;  2EYL A;  3RR5 A;  5JVH 3;  5CMD A;  4DV7 Q;  3S17 H;  2XN9 C;  2OT2 A;  2HT1 A;  1SYF A;  4HIO A;  1XWE A;  3ND9 A;  2QA4 A;  1TWG B;  3FPU B;  4KV6 A;  1D1K A;  1PA6 A;  1XNR Q;  3W1G A;  2UXD L;  5CBA E;  5CR3 A;  2Q2T A;  4RGT A;  1RCV D;  1PRT F;  4YCU A;  4DNI A;  2K14 A;  2JE6 I;  1HZB A;  2X6G A;  3BVM A;  1GUW A;  1UWV A;  3ERO A;  4DV2 L;  1E3P A;  1PFB A;  4RCO A;  1C4Q A;  1Y8O B;  2M2L A;  1J8I A;  5IP7 H;  4ZUJ A;  3T56 B;  3G48 A;  3IRB A;  1KAA A;  1GUO A;  4R4C A;  1K8M A;  1QCB D;  1X65 A;  4DN4 M;  4WOR A;  3BJU A;  2K50 A;  1YVC A;  3J81 c;  1S5F D;  1KIX A;  2TMP A;  2RF4 A;  4DR2 Q;  1QVF A;  3J7Z C;  1RIP A;  3NEN A;  4IUQ A;  1KAB A;  1M8A A;  1IW7 D;  4XQQ A;  5CV7 A;  2J7Z A;  3S16 H;  2N78 A;  2L55 A;  2OWO A;  1HJP A;  2L12 A;  2RBM A;  3J81 E;  1M1K C;  4LF9 Q;  4RH6 A;  4HJ7 A;  1GD7 A;  1MJC A;  3TRE A;  3WOE A;  4X62 L;  1W6K A;  4XYQ A;  4A3E B;  4LF7 L;  2LS0 1;  4EQO A;  2E8G A;  2EIF A;  3T16 A;  4GKK Q;  2H4O A;  4JI3 Q;  2JEB I;  5FLX L;  5C3W A;  3Q0A A;  1QIL A;  1EYG A;  4DV3 Q;  1VQP A;  1O78 A;  2K01 A;  2GVB A;  3V96 A;  2LMC B;  4FXK C;  3K6O A;  2B8F A;  1STN A;  4JC0 A;  2IHF A;  4LFC Q;  3GTK H;  1DOL A;  1NUC A;  2A68 D;  3MXN B;  1CA6 A;  1NE3 A;  2UU9 Q;  1Q7Y C;  2BH2 A;  2BOS A;  1STG A;  3Q6S A;  4GLX A;  1KRT A;  5I2X A;  1M90 C;  4O2D A;  3FDT A;  2WP8 J;  4A3G H;  4FF2 A;  4IJL A;  2KHI A;  2EJF C;  4I65 A;  4JI7 Q;  2OCE A;  4A3M G;  5M3F B;  1IW7 C;  3JAM L;  3RUZ A;  3QO2 A;  1TT2 A;  2F0J A;  3KLS X;  3DM1 A;  2A6E D;  3FKI B;  2RCN A;  2QDL A;  3I8Z A;  2LY7 A;  5M5W H;  4QGU A;  3NBH A;  4K5V A;  2KEC A;  1STB A;  2Q2I A;  3D0F A;  4DR3 L;  1ASY A;  2JA5 B;  2KEE A;  4ILW A;  4MTN A;  3A54 A;  5KEE A;  3NQT A;  4DV5 L;  3K57 A;  2VQF Q;  1GUG A;  3GO5 A;  2QIL A;  1U4R A;  1XPR A;  2JA7 B;  3ITP A;  1E2V A;  1JOK A;  3HKS A;  4RHR A;  1AH9 A;  3S15 B;  4L5S A;  3A0J A;  4WJ3 M;  3QWN A;  4HMI A;  4FXG C;  1DJR D;  3T1H L;  1V1P A;  1HNX Q;  3MEF A;  1A62 A;  1QJO A;  3A55 A;  3EFX D;  1JCK B;  1ZKO A;  3NTH A;  4QMG A;  3U4V A;  1EY6 A;  1SN8 A;  4A3F G;  4BY7 B;  1MJE A;  4DR4 L;  1VQF A;  3OW7 A;  4L8J A;  2R92 B;  1QE6 A;  4JG2 A;  4CHT B;  4HJ8 A;  5IGC A;  3AMU A;  3Q23 A;  1YJW A;  1CKM A;  1J5E L;  5DLQ E;  2VUM B;  1G51 A;  4BXX G;  1DGS A;  1PTO B;  4FO2 A;  4F88 A;  2EJM A;  1GO3 E;  1PTO C;  3QOJ A;  1A15 A;  2A6E C;  4JI8 Q;  3K58 A;  2F0F A;  4GLV B;  1ICW A;  5C5L A;  3M3Y H;  2NZO A;  1E24 A;  3JC6 6;  5M3M B;  3CCR A;  4N9T A;  1WTR A;  3OOC A;  1UUP A;  2D0O A;  3UDX A;  3HOZ G;  1WCM B;  4X3S A;  1WD1 A;  4KK7 A;  4DV0 Q;  5C0X J;  3ZYY X;  1STE A;  3S1M H;  3JAM i;  2D9U A;  3NWS A;  3P7J A;  2CCZ A;  4J15 A;  5EPL A;  2IY5 B;  3HP3 A;  2I07 B;  1IBL L;  3VR2 A;  1L2F A;  4B3M Q;  4DV6 Q;  3F2U A;  5TSS A;  4JI4 Q;  1U4P A;  2K33 A;  4OEM B;  1Z6H A;  5HGT A;  3I4M G;  3RLN A;  4IFD I;  1OXS C;  3F8T A;  2E75 C;  3NBH B;  5FKA C;  3URY A;  5IIF A;  1EOV A;  2HUG A;  3HOU B;  3LX0 A;  4L5T A;  3OTO L;  3LGJ A;  4XT1 B;  5JJL A;  2PZU A;  3SR1 A;  1LT3 D;  1PXU A;  4JOI A;  1LTI D;  1SSO A;  2MO0 A;  1TQO A;  4FDB A;  5M3F H;  1Y1W G;  3HOX B;  1HFG A;  3SEB A;  1LTG D;  1KDC A;  4IFD G;  4C3I G;  1AE3 A;  2E2H B;  3FKI H;  2AWO A;  2ZTE A;  4DGZ A;  2JA5 H;  1X32 A;  4DV1 L;  1VQ9 A;  1Y1V G;  2FMM A;  2Z4H A;  4DAY A;  4BBS B;  1DCZ A;  5I4D A;  4OWX B;  3TRZ A;  3S9W A;  4LF6 L;  1LTA D;  4DKA C;  2F0T A;  4NW2 A;  1O7L A;  5C5M A;  3SXH A;  2K5V A;  2JA7 H;  1ONL A;  4LK1 C;  2HD3 A;  1TWH B;  5EBD A;  1Y69 U;  1BCP B;  1Q81 C;  1AZQ A;  3MFY A;  2F0V A;  4XT3 B;  3AQQ A;  5D3I B;  5IWA L;  3I91 A;  1XNQ Q;  4K14 A;  3D4W A;  2JA9 A;  4KI0 A;  2QF7 A;  3DXJ C;  3VR5 A;  4R4I A;  2WB1 G;  5KNC A;  4JV5 L;  4LMQ D;  2G9H D;  1Z9F A;  2DY8 A;  2XTI A;  3L7Z C;  2CHB D;  1ENF A;  4UDU C;  1N36 Q;  1RTN A;  5A2Q L;  1JQY D;  1FVI A;  1V8Q A;  4LF4 Q;  1VQO A;  2R92 H;  4XXE A;  1EQV A;  1WTH A;  4DR5 Q;  2VUM H;  1P8L A;  3CCE A;  1N34 Q;  4FF1 A;  5IP7 G;  1JOR A;  1SMX A;  2XRS D;  2EYO A;  4JBJ A;  4DK1 A;  4L6T B;  4LF8 Q;  3CC2 A;  1EUJ A;  5M3M H;  4IPH A;  3PF5 A;  1I5F A;  3A8I E;  1S4Z A;  1PYS B;  3SE0 A;  4LFB L;  1OXV A;  4AYB G;  4FNF A;  3QB3 A;  3WOF A;  5HUR A;  3J80 c;  4HSV A;  1X54 A;  1WCM H;  1BBU A;  5M5X B;  2UUB L;  1C8C A;  3ZJY C;  2JJQ A;  1EFI D;  2TSS A;  3G71 A;  2L4N A;  1I4X A;  3KLR A;  5I9P A;  4P73 A;  4OHJ A;  2K1B A;  4JYA L;  3CRK C;  3P20 A;  4JOI C;  2VB2 X;  2EXZ A;  3J80 E;  1GM5 A;  1UEA B;  4XTC S;  3GV3 A;  3FHW A;  2AWN A;  2VY3 A;  1BDO A;  1QOH A;  2I46 A;  4K5X A;  5IOD A;  4DUY L;  2O5J C;  1XTC D;  3CP0 A;  4OWT B;  2WII B;  4DAY B;  3GTQ B;  4MNO A;  5D3D A;  4WJW A;  4X3U A;  3K5N A;  2KEN A;  3RZD H;  3HOX H;  3J7A V;  1XMQ Q;  2C5C A;  1EWH A;  1PH8 A;  5JJK A;  1HZC A;  1GHK A;  2E2H H;  1SND A;  2EPB A;  4LFA L;  4F8M A;  3FMC A;  5GRO A;  2Z0S A;  1VQJ A;  2A19 A;  2WFW A;  4KY7 A;  5KYL A;  2A5H A;  5IOC A;  3W1B A;  1A2U A;  4A3G G;  2NZH A;  1MIU A;  3S2H B;  3I90 A;  3NK9 A;  1SEB D;  1S5B D;  3E6Z X;  2L15 A;  3K5M A;  5I6W A;  4X66 Q;  3GTL B;  4AIM A;  5IT9 L;  1CHQ D;  2NWG A;  1TS2 A;  3G6J B;  1SRU A;  1ET9 A;  4NXN Q;  4HN7 A;  1OTC A;  2F0P A;  1SYC A;  3PGZ A;  4OWW B;  2XGT A;  3H3V C;  3RN2 A;  2VQE L;  1NBW A;  3O13 A;  1NJI C;  2R93 H;  4I7Z C;  4DR1 L;  2R7D A;  1JWS D;  4NXM Q;  1YHA A;  2RDF A;  5LMN L;  2XVS A;  4ZK9 B;  2QDB A;  2KJX A;  4JI2 Q;  1MKH A;  3VA5 A;  5CYU A;  4R4T A;  3B6Y A;  3PO2 B;  1F2Z A;  4B3R L;  2B2W A;  1SYB A;  1CQV A;  1JIC A;  2VZA A;  3CHB D;  5JJZ A;  5K36 H;  1KNE A;  2HHH L;  3I72 A;  1HNZ L;  3H94 A;  2B2U A;  1N32 Q;  4G7H C;  4IOA A;  1VQK A;  5M5X H;  4JW0 A;  2JYO A;  1H9M A;  3CC4 A;  3OHX C;  1A2T A;  3E0J A;  3EVQ A;  4JI0 L;  3TQY A;  2MPM A;  3MFG A;  4QQB X;  3RN5 A;  2M00 A;  2Y0S E;  3BVZ A;  1CA5 A;  1W3S A;  2ATW A;  4A4I A;  3TS2 A;  3SK4 A;  2WV6 D;  5EGT A;  5BR8 L;  1D8L A;  4IUT A;  2WAQ B;  3OMG A;  4KN4 C;  3GTQ H;  1QNK A;  4PNY A;  4PG3 A;  3L2P A;  1IBK L;  3I70 A;  3CPF A;  3A74 A;  3UDG A;  1KD1 C;  3KBX A;  3VYT A;  1DYQ A;  3S1Q B;  5LL6 S;  3ULL A;  4QUF A;  1TR5 A;  1LTT D;  3HKZ B;  2SNM A;  2K7V A;  1PH4 A;  2L1B A;  5GAE C;  1JB3 A;  3MTS A;  5M9O A;  2DJF C;  5ELE A;  3TEH B;  5AJ3 Q;  1I50 H;  1M4V A;  1RHP A;  4J8Q A;  2RKS A;  1IBM Q;  1GHJ A;  2GA4 B;  3E5S A;  4CDF C;  1E22 A;  3D4D A;  1D5M C;  4X65 Q;  3S2H H;  5M3F G;  4DU9 A;  2FMC A;  4JI5 L;  5F2D A;  4R8I A;  3FKI G;  3TN2 A;  3GTL H;  4R4O A;  3Q24 A;  3C2P A;  2JA5 G;  2PMZ E;  4KKS A;  2OEO A;  3RZO H;  1OXT A;  3X3M A;  4A3L H;  1L0Y B;  3BYY B;  3J81 j;  4JI1 Q;  2B2W C;  3TP6 A;  2IX1 A;  4A3J B;  1VQ5 A;  1BBX C;  2JA7 G;  4LUO A;  1G91 A;  2B2U C;  3NE5 B;  1WYD A;  3HS0 C;  2UUA L;  2C9O A;  2RHS B;  5GAG C;  5IGD A;  1TWF B;  1EY7 A;  3U58 A;  4C56 C;  3ERQ A;  3K81 C;  4A75 A;  2EY6 A;  1MD2 D;  1JMC A;  1DOM A;  1A3V A;  2P5Z X;  1CSP A;  4AYB E;  3CCV A;  3NPP A;  4MZ9 A;  4F87 A;  1RTO A;  3M7G A;  1N9W A;  2ENB A;  3H0G B;  5I2Y A;  2R92 G;  3SVM A;  1A3T A;  4B9W A;  2F03 A;  1TWC B;  1XTD A;  2IX0 A;  1X3F A;  1SR3 A;  2RSO A;  2PO4 A;  3A5U A;  4A76 A;  2VUM G;  1EQR A;  2EYP A;  2LXJ A;  1UNS A;  1EOT A;  2EDG A;  2RVL A;  4CJ1 B;  3CC7 A;  4B08 A;  2AQ3 B;  2ZTC A;  5C3X A;  4N8X 1;  4P74 A;  3AB9 A;  2DN8 A;  3LNN A;  4X6A H;  2UXC L;  2CQA A;  1T9H A;  2IWH A;  4IZ8 A;  3QR8 A;  1YNX A;  5M3M G;  2PYK A;  2EZV A;  1YJN A;  1VQH A;  4ZKB B;  3FP9 A;  4A3D B;  1Y1V H;  1B44 D;  1WCM G;  2HCI A;  4B3S L;  4MN3 A;  2F3W A;  4JBK A;  3NWT A;  3LWE A;  1U4L A;  2F0G A;  3M4P A;  2E2J B;  1A0I A;  3MXN A;  3S1Q H;  5E7N A;  3SK8 A;  1UE6 A;  1HA6 A;  1WJJ A;  2Z6K A;  3HOU G;  3GTO H;  4H02 A;  2QEJ C;  1K8A C;  1LTR D;  1EQT A;  1OXU A;  1LLR D;  4EVO A;  1PH7 A;  4QL5 A;  1X6O A;  4OON A;  1ZEQ X;  5FLX E;  2ZM6 L;  3HOX G;  3R93 A;  5FJ8 H;  3VA7 A;  2F0M A;  1TS5 A;  1BXT A;  4H0L C;  1BF4 A;  5C4Z A;  5EAY A;  4KHP Q;  1FJG L;  1IYU A;  2NVY B;  4K2K A;  4DUZ Q;  4YHH L;  4DAP A;  1WFQ A;  1YZ6 A;  3EQL C;  4KTA A;  2KUM A;  4POG A;  1WI5 A;  2E5L Q;  4HJA A;  2EYM A;  4DR6 L;  3F2B A;  2EYF A;  1PH5 A;  1JOO A;  1PV4 A;  2BA0 A;  3FVQ A;  1Q3L A;  1TII D;  4A3J H;  1C48 A;  1PZK D;  4DK3 C;  4YCW A;  1HR0 W;  3VYR A;  1VF7 A;  3RNU A;  3Q22 A;  2PI2 E;  4PZ6 A;  4UPA A;  3R3O A;  1PYB A;  1JJG A;  4G57 A;  3OPO A;  1XMO L;  2K5D A;  3GD7 A;  4ZLT F;  1BR9 A;  3MXU A;  3I4N B;  2Q8R E;  2NVT H;  3LWU A;  2HIV A;  2I5L X;  1SNQ A;  4QJF A;  4K0K Q;  5C44 B;  3H0G H;  1TVX A;  2R93 G;  1TWC H;  1AW7 A;  4X3K A;  3I7F A;  1I94 L;  5IGF A;  4ABN A;  4X3T A;  4OX9 Q;  3KYH C;  3CU7 A;  1F9S A;  2CKZ B;  1IYV A;  4YCV A;  1KDB A;  2WKC A;  3BVG A;  4ZAI A;  1QVG A;  1AFP A;  1K8G A;  4A3B B;  3HOW H;  5K36 G;  1LT4 D;  5ELD A;  4EX5 A;  3I55 A;  3HOY H;  2C35 B;  3TZD A;  2PPB C;  1FNV A;  5CV8 A;  2Z6K C;  3M85 A;  1F2M A;  1SNO A;  2L5T A;  4LF5 Q;  1SNM A;  4F7X A;  4KN7 C;  3GTG B;  5BN5 A;  3IFD A;  1NCV A;  4YWL A;  5FOB B;  1PTO D;  1SE4 A;  1Z47 A;  2E2J H;  4K6L A;  1WD0 A;  2UXB Q;  1K3B C;  4PMW A;  4R1J A;  4KD4 A;  4DV4 Q;  1VQA A;  2IHE A;  2LSS A;  1JB7 A;  3MA2 B;  4WFN 3;  2KVM A;  3HRZ C;  3TZU A;  2NTT A;  1V1Q A;  3A7L A;  4YY3 L;  4JI6 Q;  3AFP A;  4AQY L;  5C0X I;  1PFS A;  2MFI A;  1FNU A;  4B3T Q;  3J81 L;  2JP1 A;  2KCN A;  1TWG H;  3VR4 A;  4K2L A;  3T1Y L;  5IP9 H;  4G4K A;  2I0Q A;  5JJI A;  2B2V A;  1ZYR D;  2LXK A;  1VQE A;  2NVY H;  4RKB A;  3KLS A;  3VR3 A;  2Z4I A;  2HQL A;  3PUY A;  1DD2 A;  1K83 B;  3S1N B;  4ID6 A;  1STY A;  5ELF A;  1VMP A;  5JPM C;  5E4X A;  2R61 A;  4GS3 A;  1CSQ A;  4IPD A;  1B8A A;  4QIW E;  1STA A;  3T4A C;  3H3V I;  1F2Y A;  4OIK A;  2E2I B;  2EE1 A;  2ICE C;  5LL6 X;  4HED A;  1IKM A;  3C1E A;  3MAQ A;  1K28 A;  2RDG A;  4HR7 B;  4CKE A;  3I4L A;  2CH4 W;  3H15 A;  4IO9 A;  1V43 A;  2FIN B;  2JQO A;  4RCN A;  4TQU S;  2F4V Q;  1W6J A;  3FPP A;  1Y8N B;  4DR7 L;  4A3L G;  1HNW L;  1MSG A;  1WTP A;  4A3E H;  3I4N H;  1J9O A;  1K8O A;  3S14 B;  1HPC A;  2JEA I;  5C44 H;  4Y52 H;  5FO9 B;  5KGU A;  3TS0 A;  3J7A F;  2EYH A;  2MGS A;  1II3 A;  3PIO 3;  4KY6 A;  3M9B A;  1BCP D;  3TME A;  4DAV A;  2ASB A;  3FRP B;  1HXY D;  2YTV A;  4I7A A;  4BA2 I;  1ZYR C;  1SMY C;  4WJ4 A;  3ER0 A;  3PO2 G;  4HIM A;  2RCF A;  3R2I A;  4FP5 D;  4M1U B;  5CGK A;  3HFZ B;  3K7A B;  1B70 B;  1GUS A;  1KHI A;  3STB D;  4BA1 I;  1WTW A;  5M5Y B;  3J81 i;  4HCS A;  5A2Q E;  4DAM A;  4X64 L;  2SDF A;  1E7Z A;  1X3G A;  2HCC A;  1IYJ B;  4RGM A;  1SYD A;  3C1F A;  2B2V C;  1Y8P B;  4DK6 C;  5FK9 C;  1SE3 A;  4L63 B;  3A7A B;  4KJO A;  4KY5 A;  2G5D A;  4HMJ A;  4H13 C;  1MBY A;  4ULL A;  3V05 A;  3D8G A;  2WAQ G;  3KUP A;  4P72 A;  4YWM A;  1S40 A;  1K73 C;  2UUC Q;  4IUR A;  4GKJ L;  4TKO B;  4BBR B;  5KRU A;  1BCP C;  1PZI D;  3S15 H;  1N33 L;  4AH6 A;  2V1C C;  4Q5V A;  3HKZ G;  5KYI A;  4NB3 A;  1G8Z D;  3D3R A;  3S1N H;  1FGB D;  2WAC A;  1FD7 D;  3STB C;  1RD9 D;  1PFM A;  4BY7 H;  1YBY A;  1EY0 A;  1HR0 Q;  1HHV A;  4RA8 A;  2E2I H;  4CJ2 C;  2X6L A;  1R4P B;  4UP7 A;  1NSN S;  5FJ8 G;  1AP0 A;  1O7I A;  1WTO A;  1PTO H;  3EA6 A;  2D2C C;  3CME A;  3BG3 A;  4DV7 L;  3F2D A;  1KXL A;  4YWK A;  4RG1 A;  4XQJ A;  4XIG S;  1U4M A;  1YHQ A;  4IUP A;  4CJ0 B;  2R3Z A;  3U50 C;  2N8N A;  1K0S A;  2DY7 A;  3CQZ B;  3UDI A;  2D0P A;  1EZ6 A;  4CKC A;  1XNR L;  2NN6 H;  2KHS A;  2F0O A;  5LMU Q;  4P2C B;  4APV A;  3DEP A;  2CWA A;  3BS1 A;  1C7Y A;  4A3J G;  2OTJ A;  4NP5 A;  1Q82 C;  4DF7 A;  2YV5 A;  2CQO A;  5KND A;  3GTJ B;  2D62 A;  1KLG D;  2FJ2 A;  2XWB B;  4PMB A;  2QGQ A;  5IGE A;  5D65 A;  1D2B A;  1LT5 D;  4K5W A;  2OF1 A;  1TY2 A;  5E4W C;  3CCQ A;  4DR2 L;  2KCT A;  2PW5 A;  1X55 A;  4IAL A;  3PCO B;  3D4R A;  3H0G G;  3HOU H;  3I2Z A;  1S3O A;  4CDC C;  2YU9 B;  3A5Z B;  3DEO A;  4A3M B;  5COR A;  2D5D A;  5CV9 A;  4LF9 L;  1UE5 A;  3ERS X;  5G3L D;  2UXD Q;  3KFU A;  2OTL A;  3NEL A;  3I4O A;  4R4Q A;  1B9M A;  1XYI A;  3GP7 A;  1YJ9 A;  2GVA A;  3HOW G;  3U9S A;  1T5E A; 
#chains in the Genus database with same CATH homology
 5C6A A;  3HOV B;  1H9R A;  2LKV A;  4IUU A;  2DNE A;  1I3Q B;  4KHV A;  1A3U A;  4Y7N B;  2MP1 A;  3TP8 A;  4GZY C;  1GUN A;  1VF5 C;  2M9V A;  3S1R B;  2J4X A;  4R9W A;  4C3H B;  3MHB A;  4BS9 A;  4K8J A;  3U9O A;  1PRT B;  2VB3 X;  4JK1 C;  1PRT C;  1WTX A;  1EL0 A;  1Q1E A;  3MXP A;  1B4O A;  3NSW A;  1PMR A;  3N52 A;  3J80 L;  5JOB A;  4OIJ A;  4IUV A;  2L9H A;  3PO3 B;  1O7Z A;  2BCO A;  1O80 A;  5E3F A;  4A3K B;  1I6H B;  1PYW D;  3IL8 A;  4PMC A;  1PTO F;  5C4X B;  4RFB A;  5EKI A;  4FF4 A;  1ENA A;  4OO1 I;  4KD3 A;  5EJW A;  5DM6 3;  2Q8I B;  4DFA A;  3DHQ A;  2FFK B;  3MXG A;  1GUT A;  4K6D A;  3S2D B;  2F0L A;  4RGO S;  1SFO B;  2K6A A;  2YYZ A;  3I4M B;  1EIG A;  1HUM A;  2G9D A;  3OWF A;  3OWE B;  1E2W A;  3H91 A;  2Y0S B;  2N55 A;  5JAV A;  1DXM A;  3D6W A;  2K5W A;  1G6Z A;  2RA4 A;  3RMH A;  1CI3 M;  4C2M B;  2F0D A;  1JWM D;  4C3I B;  2EVB A;  5I9O A;  1IKL A;  1SJE D;  3RD4 A;  2SOB A;  2VXW A;  2NVQ B;  2R6G A;  4CBV A;  3D6C A;  3H09 A;  5E1F A;  3BYT B;  3DWQ A;  4C3J B;  1D1I A;  2XNA C;  1B2T A;  1I4G A;  2BDO A;  4S3S A;  5JPN C;  5JEA J;  5C0X H;  3MZ5 A;  4QF4 A;  5DNF A;  3P1H A;  3PUZ A;  2H1E A;  5KNB A;  1QG7 A;  1WTV A;  1D5Z C;  2MJ8 A;  1BCP F;  4OGQ C;  1HUN A;  5K5P A;  3SK6 A;  5T1G A;  4IQZ A;  2EY5 A;  5ELB A;  2PMZ B;  2E2D C;  3BZD B;  2VNU D;  4DK0 A;  2LFN A;  4A3I B;  2V4D A;  2CW0 D;  2O5I C;  3NP8 A;  2EJG C;  2JXM B;  3PUX A;  3NUC A;  5CV4 A;  2O2L D;  4MIU A;  4LAA A;  1Q8I A;  1XX8 A;  4KKU A;  4J6H A;  3K5O A;  3TP7 A;  2JA8 B;  4C1N I;  4AYB B;  2NN6 I;  4V0B A;  1FYC A;  4EQN A;  5J22 A;  1T5X D;  4RKL A;  5J1Z A;  3VR6 A;  3R2T A;  1F2L A;  2IT1 A;  2L0C A;  2ZXP A;  3OSO A;  1BUV T;  2ID0 A;  3C46 A;  2RDH A;  1ZXT A;  3OMC A;  2F4I A;  3T13 A;  2B2Y A;  1LAB A;  2NN6 G;  2DNC A;  3G7L A;  1TS3 A;  3J7Y W;  2B63 B;  2RSN A;  2R7Z B;  1OO9 B;  4PQX A;  3SDZ A;  1EY5 A;  3A56 A;  2CW0 C;  1STH A;  4XQN A;  4M8A A;  1F9Q A;  1CFM A;  1VCI A;  2NYZ D;  3GTK B;  1I4Q A;  3W2D A;  4DXG A;  1EU3 A;  1YNN D;  3CRL C;  3GV6 A;  1ILQ A;  1SBB B;  4H7B A;  1LAC A;  1FR3 A;  2Q8T A;  1TKW B;  2JA6 B;  2A74 C;  3DUZ A;  4HSP A;  3EJI A;  2F0U A;  5M5W B;  3IKJ A;  2A6H C;  1PFN A;  1SYE A;  4TSS A;  4H44 C;  1SYG A;  4QCL A;  4NKL A;  5EPK A;  5EQ0 A;  4HAE A;  3A8J E;  2IL8 A;  1NR2 A;  1ENC A;  4V19 0;  2F3V A;  3GTP B;  1EYD A;  3JAM E;  3PIP 3;  1JC7 A;  1YNN C;  5G3L F;  4KMU C;  4HTH A;  1H9K A;  5DAU A;  4RGN A;  2XIW A;  2SNS A;  1IL8 A;  2B2Y C;  1EWC A;  4ZQ3 A;  3OIP A;  5EBC A;  1TU2 B;  1EIH A;  2XRQ D;  3M3Y B;  1U9R A;  1B50 A;  2Z1C A;  2HQE A;  4ZUI A;  1FNW A;  3S1M B;  4O42 A;  4QB4 A;  1GXD C;  3NTK A;  1OXX K;  4U68 A;  5DEH A;  1RKN A;  3D31 A;  1JE4 A;  3NXW A;  4FF3 A;  4IUN A;  1Q12 A;  4KKT A;  5A35 A;  4A93 B;  3BDL A;  4ZKC B;  1G2S A;  2E76 C;  5T1I A;  1HCZ A;  2PZT A;  1KDA A;  1E0B A;  4NDX A;  4XYO A;  1F9R A;  1HQR D;  1SMY D;  5IGG A;  1Q90 A;  4Q0F A;  4EGV A;  3IAY A;  4C1N K;  5C0X G;  3QJY A;  5DM7 3;  1I4H A;  2NVX B;  2F0Q A;  4QIW B;  1LTS D;  2BA1 A;  2MUY A;  3L3O C;  2A68 C;  1D6E C;  1V1O A;  4C3H G;  1KTK A;  5KIX A;  1BOS A;  1ESR A;  5JEA H;  4OO1 H;  5CC4 A;  3KK7 A;  1I4R A;  5D14 A;  1MI2 A;  5COY A;  4BY1 B;  1CM9 A;  3NHH A;  1R9T B;  3PUV A;  3UI2 A;  2N88 A;  5I6Y A;  5CBE E;  4RHS A;  5C3E B;  5FO7 B;  3RLF A;  2EY2 A;  2OXP A;  1JR0 D;  2PW7 A;  3QOL A;  2ICI A;  2NTS A;  1CHP D;  3KBG A;  1EYA A;  2ZXR A;  4XDX A;  2EYJ A;  4O1N A;  2F0I A;  1SAP A;  4CGY B;  2JSO A;  3QG1 A;  1HFN A;  1PZJ D;  2O4X A;  1G29 1;  3TP5 A;  3A8K E;  1H9J A;  3K5L A;  4QUC A;  4KJN A;  3RZD B;  1B53 A;  3DWP A;  1SDF A;  1BQQ T;  4E6I A;  2AUK A;  1EEI D;  2HDL A;  3HGB A;  1BNZ A;  1VDZ A;  4UAI A;  1TWA B;  1V1P B;  4K8I A;  1E2Z A;  3AU7 A;  4C3J G;  5BN3 A;  3H6M A;  3ONA B;  2F1M A;  2L11 A;  3MVV A;  3CKI B;  3MEH A;  3MC0 B;  1EEF D;  2F0H A;  3TBI B;  1LT6 D;  1DON A;  1MGS A;  2AQ1 B;  5BN4 A;  1O7Y A;  1S5C D;  2QCP X;  3IFT A;  3R8B A;  3W3A A;  1ROD A;  1SNC A;  2KED A;  1EZ8 A;  4IFD J;  1Q1B A;  1PLF A;  2NB0 A;  1I6V C;  1LO5 D;  1RDP D;  2MHV A;  1CZW A;  2R93 B;  3DMU A;  4DNR B;  5CV5 A;  2EOT A;  4ZRZ A;  1RJT A;  1B9N A;  3KF8 A;  1VMC A;  4DXF A;  1TY0 A;  1B3A A;  2Z8L A;  1EY9 A;  1HTP A;  5IT9 E;  2RQX A;  3M4O B;  2F0K A;  2X69 A;  2B8G A;  1PRT D;  5IGB A;  2NUC A;  1SJH D;  1LTB D;  4ME5 A;  1S5D D;  1GJX A;  3DWA A;  3K0Y A;  2WIN B;  3T53 B;  1EYC A;  2PZW A;  1AZP A;  1BO0 A;  1ILP A;  2FHT A;  3I3C A;  1AN8 A;  1DOK A;  2NZ1 D;  3OIQ A;  4ZYS A;  2IPK D;  5LHY 1;  4EQP A;  3V2T A;  3VYS A;  2IJ0 A;  4FXD A;  2HDM A;  1I50 B;  1CK1 A;  1DM0 B;  1CZG A;  4A3F B;  2B2T A;  1CQF A;  5NUC A;  1X3P A;  4OL7 A;  1SNP A;  3M7N A;  1UAP A;  3RZO B;  1R4Q B;  1ET6 A;  3QIA A;  1G2T A;  1Z7T A;  3N6R A;  3HOZ B;  3SK5 A;  3NTI A;  5C4J B;  2KQ3 A;  1GOZ A;  3ND8 A;  3NBI A;  1MSH A;  1RF2 D;  4TRD A;  2XWJ B;  4PV1 C;  1HQM C;  4R8N A;  5JVG 3;  3BDO A;  3GQB A;  1CT1 D;  2AUJ D;  5JEA G;  3PV0 A;  4OO1 G;  4BWG B;  2F0N A;  1XXG A;  1YNJ D;  2A69 D;  5CV6 A;  3GTM B;  4RWS C;  1JOQ A;  5ISR A;  1Y1W B;  2K5Q A;  5AFW A;  3NQI A;  3X3N A;  1NR4 A;  3HG9 A;  4G7O C;  1Y1V B;  2BE5 D;  3SHL A;  4HCE A;  1X3Q A;  4DA2 A;  1F77 A;  2F0E A;  2B2T C;  4RAU C;  4WRD A;  4JBW A;  1H9S A;  2J0T D;  4LJZ C;  2PCF B;  4CKB A;  3K59 A;  2WB1 B;  4ODG A;  2BDN A;  2K28 A;  2K32 A;  3GTO B;  1QB5 D;  2AQ2 B;  2IX3 A;  1PDQ A;  3S17 B;  4DNT B;  1KNA A;  2SEB D;  1F9P A;  3VYU A;  1YNJ C;  3WDN A;  1IHZ A;  2A69 C;  2PQE A;  2NBF A;  1HRJ A;  2KOL A;  2ZXO A;  4IN3 A;  1SE2 A;  1QWY A;  2K03 A;  4NMZ A;  4U67 3;  1ESF A;  4B9X A;  1AEX A;  1HTL D;  2F0S A;  2ZT9 C;  1ML0 D;  2XSC A;  2KCC A;  1QNU A;  5EKL A;  5FO8 B;  4KHZ A;  4G7Z C;  2B39 A;  2BE5 C;  1KLU D;  3C3L A;  1JWU D;  4J1M A;  2EY1 A;  3S16 B;  5EKK A;  1B1Z A;  5EPJ A;  1D5X C;  3P75 A;  2A6H D;  3PMF A;  3L9A X;  2K05 A;  3MWY W;  3HEJ A;  2NVT B;  3M4Y A;  4YIJ A;  4Z9C B;  2QKI C;  1EU4 A;  3TSS A;  1A6X A;  3HZX A;  5J39 A;  4N9P A;  1EY8 A;  2A73 B;  4IFD H;  1H9S B;  2CVR A;  3PUW A;  3BDC A;  3HOW B;  1LV9 A;  3T51 B;  2F0W A;  3HOY B;  1NAP A;  2IW3 A;  1L0X B;  1WVL A;  1EY4 A;  4FYD A;  1WTQ A;  2KA7 A;  1HA5 A;  4FVM A;  4A3G B;  5ELC A;  1CTM A;  2K04 A;  5C4H A;  1I4P A;  1S5E D;  3I73 A;  2E74 C;  4MHE A;  1TS4 A;  2PNR C;  2WKD A;  3FEW X;  1DZ1 A;  2EYL A;  5JVH 3;  5CMD A;  2XN9 C;  2OT2 A;  1SYF A;  1XWE A;  3ND9 A;  1TWG B;  3FPU B;  4KV6 A;  1D1K A;  5CBA E;  5CR3 A;  4RGT A;  1RCV D;  1PRT F;  2JE6 I;  2X6G A;  3BVM A;  1GUW A;  3ERO A;  1PFB A;  4RCO A;  1C4Q A;  1Y8O B;  2M2L A;  1J8I A;  4ZUJ A;  3T56 B;  1KAA A;  1GUO A;  1K8M A;  1QCB D;  4DN4 M;  4WOR A;  1S5F D;  2TMP A;  4IUQ A;  1KAB A;  1M8A A;  1IW7 D;  4XQQ A;  5CV7 A;  2J7Z A;  2L55 A;  2L12 A;  2RBM A;  3J81 E;  4RH6 A;  3WOE A;  1W6K A;  4XYQ A;  4A3E B;  2LS0 1;  4EQO A;  3T16 A;  2H4O A;  2JEB I;  5FLX L;  5C3W A;  3Q0A A;  1QIL A;  1O78 A;  2K01 A;  3V96 A;  2LMC B;  4FXK C;  3K6O A;  2B8F A;  1STN A;  1DOL A;  1NUC A;  2A68 D;  1CA6 A;  2BOS A;  1STG A;  3Q6S A;  5I2X A;  3FDT A;  2WP8 J;  4FF2 A;  2EJF C;  4I65 A;  5M3F B;  1IW7 C;  3JAM L;  3RUZ A;  3QO2 A;  1TT2 A;  2F0J A;  3KLS X;  3DM1 A;  2A6E D;  3FKI B;  3I8Z A;  2LY7 A;  3NBH A;  4K5V A;  2KEC A;  1STB A;  2JA5 B;  2KEE A;  4ILW A;  5KEE A;  3A54 A;  3NQT A;  3K57 A;  1GUG A;  3GO5 A;  2QIL A;  1U4R A;  2JA7 B;  3ITP A;  1E2V A;  1JOK A;  4RHR A;  3S15 B;  3QWN A;  4HMI A;  4FXG C;  1DJR D;  1V1P A;  1QJO A;  3A55 A;  3EFX D;  1JCK B;  1ZKO A;  3NTH A;  4QMG A;  1EY6 A;  4BY7 B;  3OW7 A;  4L8J A;  2R92 B;  1QE6 A;  4CHT B;  5IGC A;  3AMU A;  3Q23 A;  2VUM B;  1PTO B;  4FO2 A;  4F88 A;  2EJM A;  1PTO C;  3QOJ A;  1A15 A;  2A6E C;  3K58 A;  2F0F A;  1ICW A;  5C5L A;  5M3M B;  4N9T A;  1WTR A;  3OOC A;  1UUP A;  1WCM B;  4X3S A;  1WD1 A;  4KK7 A;  5C0X J;  3ZYY X;  1STE A;  2D9U A;  3NWS A;  3P7J A;  5EPL A;  3HP3 A;  2I07 B;  3VR2 A;  3F2U A;  5TSS A;  1U4P A;  2K33 A;  4IFD I;  1Z6H A;  5HGT A;  1OXS C;  2E75 C;  5FKA C;  3URY A;  5IIF A;  2HUG A;  3HOU B;  3LX0 A;  4XT1 B;  2PZU A;  3SR1 A;  1LT3 D;  1PXU A;  1LTI D;  1SSO A;  3HOX B;  1TQO A;  1HFG A;  3SEB A;  1LTG D;  1KDC A;  4IFD G;  4C3I G;  2E2H B;  2AWO A;  4DGZ A;  1X32 A;  2FMM A;  2Z4H A;  4DAY A;  4BBS B;  1DCZ A;  5I4D A;  3S9W A;  1LTA D;  2F0T A;  4NW2 A;  1O7L A;  5C5M A;  3SXH A;  1ONL A;  4LK1 C;  5EBD A;  1TWH B;  1Y69 U;  1BCP B;  1AZQ A;  3MFY A;  2F0V A;  4XT3 B;  5D3I B;  3I91 A;  4K14 A;  3D4W A;  4KI0 A;  2QF7 A;  3DXJ C;  3VR5 A;  5KNC A;  4LMQ D;  2G9H D;  2DY8 A;  3L7Z C;  2CHB D;  1ENF A;  4UDU C;  1RTN A;  5A2Q L;  1JQY D;  1V8Q A;  4XXE A;  1EQV A;  4FF1 A;  1JOR A;  2XRS D;  2EYO A;  4DK1 A;  4L6T B;  3A8I E;  1S4Z A;  3SE0 A;  1OXV A;  4FNF A;  3QB3 A;  3WOF A;  5HUR A;  4HSV A;  5M5X B;  1C8C A;  1EFI D;  2TSS A;  2L4N A;  1I4X A;  3KLR A;  5I9P A;  4OHJ A;  2K1B A;  3CRK C;  3P20 A;  2VB2 X;  2EXZ A;  3J80 E;  1UEA B;  4XTC S;  3GV3 A;  2AWN A;  1BDO A;  1QOH A;  2I46 A;  4K5X A;  5IOD A;  2O5J C;  1XTC D;  2WII B;  3GTQ B;  5D3D A;  4WJW A;  4X3U A;  3K5N A;  3J7A V;  2C5C A;  1EWH A;  1GHK A;  1SND A;  2EPB A;  4F8M A;  3FMC A;  4KY7 A;  5KYL A;  2A5H A;  5IOC A;  1A2U A;  3S2H B;  3I90 A;  3NK9 A;  1SEB D;  1S5B D;  3E6Z X;  3K5M A;  5I6W A;  3GTL B;  5IT9 L;  1CHQ D;  2NWG A;  1TS2 A;  3G6J B;  1ET9 A;  4HN7 A;  2F0P A;  1SYC A;  3H3V C;  3O13 A;  4I7Z C;  1JWS D;  2RDF A;  2XVS A;  4ZK9 B;  2QDB A;  2KJX A;  3VA5 A;  5CYU A;  3PO2 B;  1F2Z A;  2B2W A;  1SYB A;  1CQV A;  1JIC A;  3CHB D;  5JJZ A;  5K36 H;  1KNE A;  3I72 A;  3H94 A;  2B2U A;  4G7H C;  2JYO A;  1H9M A;  3OHX C;  1A2T A;  3E0J A;  3EVQ A;  2MPM A;  1T5E A;  3MFG A;  2M00 A;  3BVZ A;  1CA5 A;  3SK4 A;  2WV6 D;  5EGT A;  4IUT A;  2WAQ B;  3OMG A;  4KN4 C;  1QNK A;  4PNY A;  3I70 A;  3KBX A;  3VYT A;  1DYQ A;  3S1Q B;  5LL6 S;  4QUF A;  1TR5 A;  1LTT D;  3HKZ B;  2SNM A;  2K7V A;  2L1B A;  1JB3 A;  3MTS A;  5M9O A;  5ELE A;  4J8Q A;  1M4V A;  1RHP A;  2RKS A;  1GHJ A;  2GA4 B;  3E5S A;  3D4D A;  1D5M C;  4DU9 A;  2FMC A;  5F2D A;  4R8I A;  3TN2 A;  3Q24 A;  3C2P A;  4KKS A;  2OEO A;  1OXT A;  3X3M A;  1L0Y B;  3BYY B;  2B2W C;  3TP6 A;  2IX1 A;  4A3J B;  1BBX C;  1G91 A;  2B2U C;  3NE5 B;  3HS0 C;  2C9O A;  5IGD A;  1TWF B;  1EY7 A;  4C56 C;  3ERQ A;  2EY6 A;  1MD2 D;  1DOM A;  1A3V A;  3NPP A;  4F87 A;  1RTO A;  3M7G A;  2ENB A;  3H0G B;  5I2Y A;  3SVM A;  1A3T A;  4B9W A;  2F03 A;  1TWC B;  2IX0 A;  2RSO A;  2PO4 A;  2EYP A;  4CJ1 B;  1UNS A;  1EOT A;  2EDG A;  2RVL A;  4B08 A;  2AQ3 B;  5C3X A;  3AB9 A;  2DN8 A;  3LNN A;  2CQA A;  2IWH A;  4IZ8 A;  2PYK A;  2EZV A;  4ZKB B;  4A3D B;  1B44 D;  2HCI A;  4MN3 A;  2F3W A;  3NWT A;  3LWE A;  1U4L A;  2F0G A;  2E2J B;  3MXN A;  3SK8 A;  1HA6 A;  2QEJ C;  1LTR D;  1EQT A;  1OXU A;  1LLR D;  4EVO A;  1ZEQ X;  5FLX E;  3R93 A;  3VA7 A;  2F0M A;  1TS5 A;  1BXT A;  4H0L C;  1BF4 A;  5C4Z A;  1IYU A;  2NVY B;  4K2K A;  4DAP A;  3EQL C;  4KTA A;  2KUM A;  2EYM A;  2EYF A;  1JOO A;  2BA0 A;  3FVQ A;  1Q3L A;  1TII D;  1C48 A;  1PZK D;  3VYR A;  1VF7 A;  3Q22 A;  3R3O A;  4G57 A;  3OPO A;  2K5D A;  3GD7 A;  4ZLT F;  1BR9 A;  3MXU A;  3I4N B;  2Q8R E;  3LWU A;  1SNQ A;  5C44 B;  1TVX A;  1AW7 A;  4X3K A;  5IGF A;  4ABN A;  4X3T A;  3CU7 A;  1F9S A;  1IYV A;  1KDB A;  2WKC A;  3BVG A;  4ZAI A;  1AFP A;  4A3B B;  5K36 G;  1LT4 D;  5ELD A;  3TZD A;  2PPB C;  1FNV A;  5CV8 A;  3M85 A;  1F2M A;  1SNO A;  2L5T A;  1SNM A;  4F7X A;  4KN7 C;  3GTG B;  5BN5 A;  3IFD A;  1NCV A;  5FOB B;  1PTO D;  1SE4 A;  1Z47 A;  4K6L A;  1WD0 A;  4PMW A;  4KD4 A;  3MA2 B;  4WFN 3;  2KVM A;  3HRZ C;  3TZU A;  2NTT A;  3A7L A;  5C0X I;  1FNU A;  3J81 L;  2JP1 A;  2KCN A;  3VR4 A;  4K2L A;  4G4K A;  2B2V A;  1ZYR D;  4RKB A;  3KLS A;  3VR3 A;  2Z4I A;  1DD2 A;  3PUY A;  1K83 B;  3S1N B;  4ID6 A;  1STY A;  5ELF A;  1VMP A;  5JPM C;  5E4X A;  2R61 A;  3T4A C;  1STA A;  1F2Y A;  4OIK A;  2E2I B;  2EE1 A;  2ICE C;  5LL6 X;  4HED A;  1IKM A;  3C1E A;  3MAQ A;  2RDG A;  4HR7 B;  4CKE A;  3I4L A;  1V43 A;  2FIN B;  4RCN A;  4TQU S;  1W6J A;  3FPP A;  1Y8N B;  1MSG A;  1WTP A;  1J9O A;  1K8O A;  3S14 B;  1HPC A;  2JEA I;  5FO9 B;  5KGU A;  3J7A F;  2EYH A;  2MGS A;  1II3 A;  3PIO 3;  4KY6 A;  3TME A;  1BCP D;  4DAV A;  3FRP B;  1HXY D;  4BA2 I;  1ZYR C;  1SMY C;  3R2I A;  4FP5 D;  4M1U B;  5CGK A;  3K7A B;  1GUS A;  4BA1 I;  1WTW A;  5M5Y B;  4HCS A;  5A2Q E;  2SDF A;  2HCC A;  4RGM A;  1SYD A;  3C1F A;  2B2V C;  1Y8P B;  5FK9 C;  1SE3 A;  4L63 B;  3A7A B;  4KJO A;  4KY5 A;  4HMJ A;  4H13 C;  1MBY A;  4ULL A;  3V05 A;  3D8G A;  3KUP A;  4IUR A;  4TKO B;  4BBR B;  5KRU A;  1BCP C;  1PZI D;  4Q5V A;  5KYI A;  1G8Z D;  3D3R A;  1FGB D;  2WAC A;  1FD7 D;  1RD9 D;  1PFM A;  1EY0 A;  1HHV A;  4RA8 A;  4CJ2 C;  2X6L A;  1R4P B;  1AP0 A;  1NSN S;  1WTO A;  1PTO H;  3EA6 A;  2D2C C;  3BG3 A;  4XQJ A;  4XIG S;  1U4M A;  4IUP A;  4CJ0 B;  2R3Z A;  2DY7 A;  3CQZ B;  1EZ6 A;  4CKC A;  2NN6 H;  2KHS A;  2F0O A;  4P2C B;  3DEP A;  3BS1 A;  4NP5 A;  4DF7 A;  5KND A;  3GTJ B;  2D62 A;  1KLG D;  2FJ2 A;  2XWB B;  4PMB A;  5IGE A;  5D65 A;  1D2B A;  1LT5 D;  4K5W A;  2OF1 A;  1TY2 A;  5E4W C;  2PW5 A;  4IAL A;  3D4R A;  2YU9 B;  3DEO A;  4A3M B;  5COR A;  2D5D A;  5CV9 A;  5G3L D;  1XYI A;  1B9M A;  3GP7 A;  3TDQ A;  3U9S A;  1SXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...