5DNFA

Crystal structure of cc chemokine 5 (ccl5) oligomer in complex with heparin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
SSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C motif chemokine 5
publication title Structural basis for oligomerization and glycosaminoglycan binding of CCL5 and CCL3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 14
structure length 65
sequence length 65
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2015-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5dnfA00
1X32A 1MGSA 1MSHA 1QE6A 1WTOA 3F2UA 3G7LA 2K04A 2M2LA 1CM9A 1RTNA 1ZXTA 1AZPA 1U4PA 1MSGA 1F2LA 2CVRA 4MN3A 1G6ZA 4IUVA 2J7ZA 1QNKA 3QO2A 1SDFA 1PFBA 2NZ1D 1EOTA 3SVMA 4DN4M 2RVLA 1MI2A 3GV6A 3IFDA 1QG7A 3Q6SA 5D65A 1F9RA 4HCSA 1RODA 3P7JA 5CBEE 2XIWA 4UAIA 4R9WA 3TN2A 4ZKCB 1U4LA 1HA6A 4O42A 1HRJA 4X3KA 2HDLA 1XYIA 1GUWA 1PFMA 4CJ1B 4NW2A 1WVLA 2HCCA 1ILPA 3I3CA 1B2TA 2KECA 1SSOA 1IKMA 3TZDA 1EIHA 1EQTA 3MTSA 1M8AA 2DY8A 3ONAB 4HAEA 1O7ZA 5AFWA 4QUCA 2K28A 1G91A 2VXWA 4IUQA 1BO0A 1HUMA 2K01A 1PFNA 5EPLA 1DOMA 1NAPA 4RA8A 2KEDA 1ESRA 2KEEA 5T1IA 1RTOA 1EIGA 1WTVA 2FFKB 4X3UA 2KVMA 4X3TA 2MPMA 4ZKBB 2N55A 3MWYW 1HFGA 4HEDA 1KNEA 1F9SA 1IKLA 2K05A 2L4NA 1DOKA 1CA6A 2X6LA 4XDXA 1HFNA 1HUNA 3DM1A 1RJTA 1WD1A 1ILQA 3H91A 3N52A 5DNFA 2KUMA 1O80A 5E4WC 5EPKA 1EL0A 1DOLA 1S4ZA 1F9PA 2JYOA 3FDTA 4X3SA 2B2UC 1BBXC 2MGSA 3I90A 2HCIA 2RA4A 2K03A 1O7YA 3HP3A 2Q8TA 1WD0A 5CBAE 1F9QA 1XX8A 5E4XA 4RWSC 1ML0D 2RSOA 3DEOA 4ZAIA 2BDNA 1TVXA 1JE4A 5CORA 2FMMA 1J9OA 3I91A 2L12A 4OIJA 1NR2A 5EPJA 3R93A 1HHVA 5EKIA 3IL8A 1CA5A 1B50A 2B2UA 2B2YC 4XT1B 1WTRA 2HUGA 2X6GA 2B2VC 3LWEA 2N88A 2NYZD 1U4MA 4IUPA 4CJ2C 5CMDA 2EE1A 3UI2A 4QUFA 2IL8A 4MHEA 5EJWA 2MP1A 1X3PA 1BNZA 2NWGA 2H1EA 5JJZA 1WTXA 1LV9A 1VMPA 2B2TC 4R8IA 1IL8A 2K1BA 1JICA 3I8ZA 4ZK9B 2X69A 1NCVA 2DY7A 2B2YA 1DONA 4XT3B 2D9UA 1BF4A 1C8CA 2B2VA 2EPBA 3KUPA 1AZQA 3DEPA 4HSVA 1WTQA 1E0BA 1RHPA 1PDQA 3FPUB 3KBXA 1Q3LA 1WTWA 2EOTA 1DZ1A 1VMCA 2B2WC 2SDFA 4OIKA 3GV3A 1B53A 1U4RA 1B4OA 1PLFA 1B3AA 4RAUC 4IUUA 2B2TA 1KNAA 4ZLTF 1AP0A 5EQ0A 1G2SA 1X3QA 1WTPA 2L9HA 1G2TA 2FHTA 1A15A 1ICWA 2RSNA 4U68A 4CJ0B 2FJ2A 2R3ZA 3D6WA 1SAPA 2Q8RE 2HDMA 2FINB 4LMQD 4IUTA 5COYA 2MJ8A 4IURA 5D14A 2KOLA 1NR4A 5T1GA 1J8IA 2L11A 2L1BA 2JP1A 2B2WA
chains in the Genus database with same CATH superfamily
3BU2A 1CFMA 1Q7YC 4Y52H 1U4PA 2CVRA 4C3JH 1CKMA 1V8QA 3D4WA 1WYDA 2J7ZA 4JW0A 5C3WA 1NE3A 2QILA 4ILWA 4Q0FA 1EOTA 1W3SA 3MEHA 1MI2A 2PO4A 2EY2A 3PO3H 1XPRA 1QNUA 2XIWA 4N9TA 3J80c 3GO5A 1W6JA 4X64Q 4DR2L 1K8AC 5DEHA 3TSSA 5BR8L 1SEBD 2DY8A 3K5OA 1OXVA 1IZ6A 1UE7A 3F8TA 4ZQ3A 5C44B 4JYAL 3BZKA 5GADC 4Y7NB 2KEDA 3F2BA 1XNRQ 2AUJD 3BG3A 1TWHB 1EUJA 2EYJA 2L15A 3K0YA 5DNFA 3GTLB 5AJ3Q 4O0AA 4APVA 2R93H 1H9KA 1UEAB 1FNVA 1KL9A 1K3RA 2K03A 4RMFA 5IOCA 3CCSA 2Z4IA 4DGZA 2K52A 3BYYB 5KEEA 5JVH3 1K8GA 2L12A 2F0MA 4IJHA 3IL8A 2MFIA 4XT1B 4YWKA 3S2DB 3SEBA 1RCVD 1WOCA 1TS4A 1VQ7A 2NWGA 1HR0Q 4DNIA 1TKWB 1H9SA 4A3CH 3A7AB 4KTAA 2QDBA 4HJ9A 4XT3B 4P73A 3SHLA 3HOYH 2H4OA 1A3TA 3EROA 4HSVA 1VQ4A 3RZDB 1BVSA 4PV1C 3T1HL 4RGNA 2B63H 1FJGL 4EX5A 2Y0SG 2B39A 3SK6A 2I46A 3AU7A 1G2TA 3PCOB 5A2QL 4KJNA 1KABA 3E6ZX 3FP9A 4KK7A 2OWOA 1SYEA 2R7FA 5JPMC 4GNXB 2E2IB 4K14A 1EIFA 1V1OA 1GHJA 2CW0D 4B9XA 2GN5A 3F2CA 2AQ1B 4HTHA 4R4QA 4ME5A 3M4YA 3GTOH 2ENBA 4C3HG 1HZCA 1LTAD 1JB3A 4HN7A 3M4QA 2JA8H 1E22A 3JAME 1SNDA 4LF6Q 2NZ1D 1IBKQ 4L8JA 2NBFA 2AQ2B 2DN8A 1TS2A 4X66Q 4A3BB 2AHOB 5M3MH 4BY1H 1U4LA 2KENA 2R6GA 3L2PA 2XWBB 4C1NI 3I4MH 4KN4C 5M3FG 4JI6Q 5CV7A 5G3LF 4C3IB 3I7FA 3VR3A 4A93H 1R4PB 4IUQA 1IBLL 4GN3B 1DOMA 4QY7A 3PV0A 1KDAA 3W1BA 1SE3A 3NWSA 1M1KC 4WJWA 2UXBQ 1BBWA 1KNEA 3NTKA 2XNAC 3S2HH 2X6LA 4A4IA 4LNQA 4OWWB 4KJOA 4KLKA 1A63A 1EEFD 1LTLA 2NB0A 4JBMA 1CHPD 1S4ZA 3T51B 2EYFA 4A3IB 3S15B 2HCIA 4DV2Q 1I4GA 2NUCA 4RWSC 3HKZB 2QW7A 4A3DG 2FMMA 1J9OA 3HGBA 5K36G 2DUDA 1WI5A 4QF4A 2NVXB 1E2VA 4P2CB 2B2YC 1RIPA 1TY0A 2N88A 1JE5A 3MXPA 1TIID 4LF9L 3GTMB 4AYBB 5JJKA 5FLXc 5JJZA 2PPBC 1BCPB 1VMPA 3KK7A 1Z7TA 4LF8L 2EQSA 1KC8C 4HIOA 4DR3Q 2WFWA 5IT9E 1N32Q 1DONA 1STBA 1BF4A 4YHHL 2JA7G 4DPGA 5FOBB 1BCPD 1DZ1A 3J7A5 3S24A 1Y1VH 4RHRA 2VQFL 4QL5A 1OTCA 1EYAA 2RSNA 3H0GH 1CI3M 1R4QB 2YYZA 4Z9CB 2K5DA 3SK5A 4FYDA 4KHPQ 4TSSA 4LF5L 2JA6G 1MGSA 1HNXL 1K3BC 5HGTA 4HJ8A 2UUCL 1T5XD 3KF6B 1IYVA 1UE1A 1MSGA 3A54A 2OEOA 1SYDA 2JEAI 3GTQB 3HOZB 4GLVB 2PMZB 4HJAA 1TT2A 1RF2D 4ALPA 1BBUA 3M4OH 2IWHA 4EVOA 1TWAB 2VQEL 3G48A 1QB5D 4ZYSA 1B3QA 1WVLA 3TREA 1Y8NB 3A5UA 1EZ8A 3TZDA 1Q8KA 1H95A 3CCEA 2ZXOA 4GN4B 4DUZQ 3T53B 4HJ7A 3A55A 2QA4A 1VQFA 1FNUA 1PRTB 1IKLA 2Z6KA 1CA6A 1BQQT 4WJ3M 3GTKB 5ELOA 1PRTD 4X3SA 4A3GG 4NKLA 3RMHA 4K2LA 1Y8OB 2RA4A 3HP3A 5TSSA 1X54A 1UEBA 4HCEA 3AYHB 1S3OA 4BBRH 2J4XA 5CGKA 4DNRB 3U9SA 4OIJA 3AMUA 2PNHA 3KF6A 1FNWA 4KY6A 4LJZC 1VQBA 5C4XB 4QIWE 1K8MA 2OF1A 4CKCA 4BY7G 2C5CA 1ENAA 1JCKB 1C7YA 3RLNA 1YJ9A 2B2TC 1FR3A 4MIUA 4FF3A 3CF5A 3HOVB 1CUKA 3KLSA 5C5LA 1IW7D 1I3QH 4IPCA 5CR3A 4IQZA 1PH9A 3W3AA 1VQ6A 1SBBB 4A3DH 4U68A 4KV6A 1H9MA 1BXTA 3D6WA 1Y1VB 2F0TA 2VUMG 2IY5B 1TWCH 3GD7A 2Q8IB 3NP8A 3ERSX 5IYDH 1X65A 1R9TB 4A76A 3HKZE 4DV4L 1IBML 2XWJB 4P71A 1OXXK 1PTOF 3AB9A 4IO9A 1N34L 1SJED 3NBHA 4BA2I 2F4VL 1VQAA 4ZUIA 1DJRD 4J1MA 3UE1A 2ES2A 4B9WA 4MN3A 1JMCA 1G6ZA 1QNKA 2A6HC 5IT9L 4MTKA 2NZOA 1S40A 4AYBE 3PIO3 4X6AH 1SE8A 2IX1A 3P7JA 3HOUB 1BUVT 3C3LA 4O42A 4M8AA 4GOPB 2OQKA 4XXEA 4BA1I 4LFBQ 3ULPA 4LF7Q 3BZDB 3WWVA 1IKMA 1M8AA 5LL6S 2UUBQ 1UAPA 5AFWA 1G91A 4LF4L 3EQLC 2JA5B 2F4IA 2N3SA 3HOWG 2JA6H 1XNQL 1V1QA 3CD6A 2OQ0A 2VNUD 4RGTA 3HEJA 1YNND 4RKBA 2ZTDA 4QCLA 4UP8A 1HFGA 3I4NG 2K5VA 1L0WA 3F2DA 3EA6A 1CTMA 4H13C 3HOXB 3J7AV 1A3VA 1NMGA 1VQJA 1Q46A 2EIFA 2RF4A 2PMZE 4B3RQ 1Y1WB 4JOIA 3S14H 3K59A 4BBRB 1WCMG 2NN6G 4JI4Q 3PF5A 2HUGA 2CH4A 4F8MA 1U4MA 1F2MA 2WB1G 2ICEC 4KHZA 4O1NA 5LMUL 3QG1A 4MHEA 3M7NA 5M5WH 2ALYB 2GVAA 4IFDG 3E0EA 4JK1C 1J5EQ 3PUXA 4DR6Q 2Q2IA 4C2MB 1SMYC 1DXMA 2LFNA 3VR6A 5ELNA 4G7HC 1A3UA 2A74C 3ZJYC 3S1RH 1JWMD 1AE2A 4GOPA 4A3GH 5FLMG 3S9WA 1N36L 4BXXH 3SR1A 3TP5A 1VMCA 4OIKA 3GV3A 3G71A 2VB2X 1B53A 1XMOL 5IYBG 5H1SE 2EYOA 2VL6A 3HZXA 2FHTA 4RCOA 5IWAQ 3NEMA 4IN3A 4CJ0B 1KAWA 1GUGA 1E7ZA 2XVSA 3K8AA 1PH7A 3TRZA 2RBMA 2MNAA 4YCVA 4JVZA 2NTTA 1JT8A 3T16A 4JPBW 4DR1L 5I4DA 4NPSA 4HCSA 1SE4A 3LGJA 1L1OC 3KOJA 1K0RA 4JG2A 2GA4B 5ELDA 1EEID 1VQEA 4A3BG 1VQ5A 2VUMH 1LT4D 2RQXA 1LTRD 4QUCA 2EJGC 4NXMQ 1HA5A 4GKJQ 5D3IB 4RA8A 4ZUJA 1EIGA 4WRDA 3K7AH 3OMCA 3EN2A 3K58A 2NN6I 5GAEC 1PH1A 2HIXA 2Z0SA 4XIGS 3TDQA 2ZM6Q 4KD3A 2K50A 4XDXA 5HGQA 1GUTA 4IFDI 2YU9B 4L63B 2JXMB 3OIPA 2BCOA 1SNCA 1PH8A 1YBYA 2N49A 3M7GA 1JJ2A 1PRTF 2AWNA 2EXZA 4PZ7A 4RHSA 1EIYB 5IP7H 5L37A 5JVG3 4FXDA 4K5XA 5IP9H 1Q8IA 1C48A 4EQNA 4JI1Q 2G9HD 1WFQA 2KJXA 4PNYA 3DHQA 3J80i 1A8VA 3HOWH 3GTPB 1IXRA 4B3MQ 2X6GA 4PZ8A 1MJCA 2EE1A 2BA1A 2HQEA 2F0GA 1BNZA 3K0XA 3CQZB 3PO2G 4K5WA 5M5WB 2PCFB 4CDFC 1XJVA 2F0OA 2A69D 2XSCA 4A3FG 1F2YA 2LXJA 2KQ3A 1XMQQ 1EQRA 1WTQA 2DNEA 2E75C 1LT3D 2I5HA 2XRQD 3PF4A 5KYLA 4KKUA 4PZ6A 4ZLTF 2BE5C 4PQXA 3K81C 1CKNA 4JYAQ 4KMUC 2N8NA 3OTOQ 4OXPA 3U4VA 3CMEA 4KY5A 2MJ8A 2O2LD 4R4IA 4K2KA 2CH4W 3FEWX 3H6MA 4JI2L 3Q22A 1J8IA 1JQYD 2B2WA 3Q23A 4DV6L 1D5ZC 5LMNQ 4DR7Q 1GOZA 1H9RA 1AZPA 4QGUA 4OX9L 1I6HH 1EFWA 2PZWA 5KYIA 1SMXA 3OMGA 3L7ZC 1SJHD 1Z47A 2LXKA 4GN5A 1KD1C 5IYCH 3DLLA 1EWIA 3TN2A 1GO3E 1XYIA 3D0FA 5IIFA 2QCPX 3S1QB 1KTKA 3JAMc 1OXUA 5KIXA 4DFAA 4J15A 3TZUA 2MHVA 3SGIA 4MTNA 3A8KE 3A56A 1YNJC 2AUKA 1OXTA 1LO5D 4K0KL 4I7ZC 1N33Q 2LSSA 3UDFA 4ZKBB 2N55A 1VDZA 2NVYH 3RZOB 4JV5L 2KUMA 1DOLA 3S1NB 2A6HD 3FKIB 3VR5A 3CCUA 3VA5A 1HQRD 5IODA 3QJYA 1ML0D 4ZAIA 1Y8PB 4A3JG 3U4ZA 3DWQA 1NNXA 2E2HH 3M3YH 1CA5A 1MKHA 3ERQA 1D6EC 2MO0A 1G8ZD 3NTHA 1YHBA 1X3PA 1SXTA 1IL8A 2Z4HA 3ULLA 2SEBD 3CCMA 1CZWA 4UPAA 3TBIB 3NBIA 2D9UA 4H0LC 4K5VA 4A3MH 3FPUB 2UXDL 1Q3LA 4Q5VA 2R92B 5C3XA 2UXCQ 3VYSA 1ENCA 1KNAA 4FF4A 1JR0D 2K75A 4HSPA 4A3LG 2OXPA 4LMQD 2JN4A 3K5MA 2F0SA 2ZJPA 2EYHA 2K7VA 3FVQA 1JOOA 4QQBX 2VS1A 4NMZA 1VQDA 3S1MH 1WTOA 2CFMA 1SN8A 3PO2H 2K04A 5BN3A 3CC7A 4IPDA 1K8OA 4A3FH 1NBWA 2M9VA 2Z1CA 1TWGH 4YY3Q 1YHQA 1SMYD 2D5DA 2LY7A 4XYOA 5J22A 2B3GA 1W6KA 4R9WA 4DV7Q 3VYUA 3E9IA 4WJ4A 3GDEA 1RKNA 2A6ED 4ID6A 2I5LX 1GM5A 4DV0Q 2E2JB 1DD2A 1PZID 2IJ0A 4A3EG 3CCRA 4KD4A 1HNWL 1C0AA 2F3IA 2EJMA 5FO9B 2XTIA 3S16H 1I4QA 3NSWA 4CDDC 4DV3L 3DUZA 4X64L 2UUAQ 4R4CA 5FO8B 4C3JB 1D7QA 1YJWA 2NVQH 2JSOA 1ZEQX 3A5ZB 1TXYA 4K8IA 1DOKA 1GUSA 3T1YQ 1U5KA 2F0WA 1WD1A 3PO3B 1VQGA 2B29A 4FF1A 1L1OB 5C4HA 1F9PA 1D5MC 4QIWB 1E2ZA 1XNRL 2OTJA 1K73C 4ZRZA 1HNZL 4AQYQ 3OPOA 5CBAE 2YTVA 4MZ9A 1VCIA 1AH9A 3DEOA 1KQSA 4JBJA 3BVGA 5EBCA 1B9MA 4XYQA 4BBSG 2K5WA 1RD9D 3HOXG 2E5LQ 5LHY1 5AJ3L 1NR2A 4XQJA 1HHVA 4LUVA 4G4KA 4DA2A 1VQ9A 3LX0A 4CJ2C 4L5TA 1AN8A 3NTIA 2JEBI 5ELBA 1MIUA 2E2HB 1MD2D 1Y1WG 3PSIA 1QZHA 4R8IA 4YWMA 1EY5A 1EY0A 5I9OA 2X69A 2EYLA 4DK0A 3RUZA 2R93B 5F2DA 4GNXA 5M5XH 1E0BA 1O7LA 3CAMA 4GKKQ 5E3FA 3OYYA 1HR0L 2K5QA 4QJFA 2AWOA 2SNMA 3SXHA 2PQEA 3IKJA 4RGOS 5IGDA 3J81i 4IUTA 5COYA 5D14A 3D6CA 2KCCA 1ZYRD 1XTCD 2L11A 3PUYA 2L1BA 3A8JE 1FGUA 5GAHC 2BOSA 1PZKD 3PIOA 3CC4A 3S1MB 3TP8A 3SK8A 1FVIA 2R7ZG 2K32A 3OWFA 4X62Q 3HOYB 3FHWA 2MQHA 2KA7A 1EYGA 3MEFA 1EFID 1STEA 1HRJA 2B63B 1Q1EA 2G5DA 4A3KG 5E7NA 1VQOA 1FL0A 3VA7A 3S17H 3KJPA 1T5EA 1KDCA 3C1FA 4LF6L 1IBKL 3MTSA 5M5YH 2BE5D 3ONAB 3E0JA 5IGFA 2VXWA 1K83H 2EJFC 2OTLA 1PYWD 1VQLA 3H3VI 3GTOB 4FNFA 4A75A 1WTVA 4N8X1 2IW3A 1DCZA 1EQVA 3BZCA 4JI6L 2MPMA 2JA8B 4DAYB 1F9SA 3ND8A 1AFPA 3GTJH 5M3MB 5ELFA 4BY1B 1SFOH 4JI0Q 2QDLA 1Q12A 4TRDA 1QVCA 4H44C 2MGSA 4X65Q 5FJ8G 1O7YA 1CKOA 5KRUA 1KRTA 3I4MB 4NDXA 2UXBL 2RSOA 3CRKC 4XQQA 2E8GA 1TVXA 3D31A 4UDUC 4A93B 1EZ6A 2K14A 4A3EH 4OHJA 1N34Q 4C3HH 2KHJA 4HMIA 1D2BA 3R93A 2TMPA 2B2UA 1Q82C 1I50H 2B2VC 3CXCA 2F0IA 2ZT9C 3MC0B 3CHBD 4IUNA 4C1NK 3RNUA 2ZJRA 5EAYA 5CV4A 4CDCC 3BJUA 3S2HB 1QOHA 4M1UB 1JWUD 2PNRC 3J81c 2D0PA 4IOCA 3DWAA 4F88A 1VQPA 1C8CA 4B3SQ 3QWNA 3D4RA 5M3FH 4KI0A 4JI5Q 1RHPA 1O78A 4QB4A 1PA6A 1K28A 1B3AA 2WAQE 1EY8A 1VQIA 1G2SA 1GD7A 3H3VH 4S3SA 4BBSH 1ICWA 1TWFH 4K6LA 2F3VA 2WKDA 4DR3L 3J7ZC 1YI2A 1N32L 2V4DA 3DM3A 1HQMC 2VB3X 4DAYA 1MSHA 1DYQA 1CM9A 1RTNA 1I94Q 2HT1A 2CWPA 3MAQA 2I0QA 1F2LA 3J7YW 3D3RA 1TQOA 3OW2A 3BVMA 2UU9Q 2KBNA 3J80L 4KHPL 2YV5A 2C35B 1HH2P 3PIP3 1BR9A 3M85A 2BH2A 3CC2A 1C9OA 5IGEA 5K36H 2HDLA 3GP7A 4CJ1B 1EY7A 4NXNL 3WOFA 2HCCA 3P75A 1ET6A 3H0GB 3NQTA 3QIAA 5C3EG 4HAEA 3O13A 3FPPA 1BO0A 1HUMA 1PFNA 5DAUA 1QVFA 2NVTH 3CCVA 4X3UA 2F0VA 2JA7H 1S5CD 2R7ZH 1PVOA 2GVBA 3I55A 1EYDA 1RJTA 4DV5Q 4DR4Q 3M4OB 3N52A 4DUZL 3BS1A 1LUZA 2JYOA 3AQQA 3HKSA 2Y0SB 3VYRA 3R3OA 4A3KH 3C2PA 1CSQA 2Q8TA 3EJIA 1KIXA 1L0YB 3FMCA 1VQCA 1B70B 4LUOA 3FKIG 1GXDC 1PZJD 4GLAC 2IX3A 1QCBD 5C44G 4OO1G 4DUYQ 4DV1Q 2E74C 2HHHQ 3DMUA 1CK1A 2I07B 4DXFA 3ICEA 4G7ZC 3NUCA 1LLRD 4PMCA 4L5SA 4OGQC 5KNBA 1K9MC 1LM0A 1QZGA 5FJ8H 1V9PA 1PDQA 1TS5A 3TQYA 1HZ9A 5M3FB 1PH3A 4R4OA 1Y69U 2KCTA 1AP0A 4P75A 5EQ0A 1IHZA 3NHHA 1WJJA 5I6WA 1A15A 1HZAA 2XRSD 4LAAA 1GHKA 2F0KA 2FJ2A 1YJNA 2Q8RE 1T9HA 3STBC 2BDOA 2R92G 2F03A 2KOLA 1JOKA 3MHBA 1NMFA 2PI2A 1E2WA 4XQNA 4WFN3 3G7LA 1VQ8A 3MXGA 1A2TA 2K4KA 3NXWA 1HJPA 3QOJA 1BOSA 4IALA 4UHVA 1UE6A 3E9HA 1JB7A 1BCPF 1I3QB 2HD3A 3HS0C 5J3BA 2WIIB 4DAVA 3TP7A 5M9OA 4X3KA 1SRUA 4A3DB 1S5BD 1ILPA 1B2TA 1NY4A 5C4JH 2KECA 3TS0A 4BY7H 1TWCB 3DXJC 4JI3Q 5CV6A 3I56A 5GROA 3PUWA 1SE2A 1PTOC 4L5QA 2CW0C 3GTGH 2XN9C 5KGUA 4DU9A 5HURA 4LFBL 1LTID 3I2ZA 4LF7L 1KAAA 2F0FA 2ATWA 4LFCL 2UUBL 1CSPA 5ISRA 3NELA 5C0XG 1GUNA 4KHVA 1O80A 4YWLA 4EQPA 4C3JG 1X3EA 1EYCA 1BBXC 2R61A 4JI8Q 3I90A 2KHSA 2V1CC 3ITPA 3R2TA 2K5NA 3K6OA 3IAYA 5C3EH 2O4XA 4WORA 3I91A 1LTTD 4KY7A 4N8FA 5EPJA 3URYA 2JA6B 3V2TA 1PH2A 4C3IG 1WTRA 4RKLA 5FLXL 3JAMi 1PMRA 4J6HA 1STAA 1M4VA 1TU2B 4DR5Q 3E5SA 2XGTA 5GQOA 4P74A 4HMJA 4B3TQ 1JICA 4CKEA 3RR5A 2B2YA 4JI4L 4ABNA 2PI2E 3KBXA 3BVZA 3D8GA 1B8AA 1STNA 2KCMA 4A3IG 3S14B 1AW7A 1NJIC 1J5EL 4DR6L 2Z8LA 5BN4A 2R93G 2Y0SE 1LTGD 2IX0A 3HKZG 5G3LD 4IURA 1ENFA 1HCZA 1VS0A 5I2YA 4KKSA 1VF5C 2CQOA 4YIJA 3I4NH 4HR7B 5C44H 2SNSA 4I65A 2VW9A 5KNCA 4XTCS 1ZKOA 5IWAL 4DR2Q 1TWHH 3V96A 4AYBG 3S1RB 2F0QA 5BR8Q 3K5LA 1DGSA 1BKBA 4LFAL 3HG9A 1PFSA 4A3GB 4RFBA 1IL2A 3I73A 3GTLH 2I5MX 4YCWA 5KNDA 2PW7A 1BCPC 1WCMH 5C0XI 4GZYC 1Z6HA 1I4PA 2NN6H 4AH6A 3CU7A 1MBYA 4IFDH 2Z6KC 1SNQA 2B63G 3RD4A 4BY7B 2JJQA 3N6RA 4U673 1IYJB 1XTDA 1NAPA 1CZGA 3G6JB 2F0NA 4C56C 1RTOA 3S2DH 1V43A 3F1ZA 4IZ8A 3BDCA 5FLMH 2CCZA 1W2BA 4HEDA 1E1OA 1FGBD 1CQFA 1HUNA 3HRZC 1F2ZA 4NXML 1QJOA 5IYBH 1HTLD 4GKJL 2JA9A 3HOZG 2L5TA 1IYUA 1EY6A 3MA2B 3AEVA 2VY3A 3RZDH 1WD0A 1XX8A 2ZM6L 2QGQA 2QEJC 2VUMB 1PTOH 1SROA 3NWTA 3EBEA 1PXUA 3VDYA 1JE4A 1ET9A 1STYA 3P20A 4PG3A 4H7BA 4RH6A 4OWXB 3UDIA 4BWGB 2RHQB 5J1ZA 2EY5A 1SR3A 4DAPA 2E2IH 3K7AB 2JK8A 3IRBA 4QUFA 1LACA 3H09A 3T1HQ 2F0JA 2IT1A 1FJGQ 1LV9A 2Q2HA 1NUCA 4KN7C 1N9WA 4ZK9B 5C0XH 5JPNC 4B3ML 4JI7L 4HIDA 3KUPA 3DEPA 1I6VC 4A3BH 1PRTC 4R4TA 4N9PA 5DM73 3GQBA 2B2TA 1HNWQ 4DKAC 1H9SB 1X3QA 2LMCB 3A7LA 4DV3Q 3ND9A 3MVVA 3HOWB 1XMQL 3TP6A 3EVQA 3CMAA 2KHIA 4C3IH 2EYPA 2F3WA 4IOAA 2L55A 5BN5A 4FO2A 3I4NB 5C4XG 2M2LA 3OTOL 3KLWA 4PMWA 1YHAA 3T4AC 1PHJA 1SYBA 1HNZQ 4DN4M 1V1PB 3GV6A 1QG7A 5I6YA 3U9OA 1RODA 1IBLQ 4FXGC 5DLQE 1HA6A 1X55A 4R8NA 5CV9A 4EQOA 5IT9c 5LMNL 3HOVG 1EOVA 1IW7C 4DR7L 1PFMA 4A3IH 2CQAA 3S15H 3NK9A 2F0HA 4IPGA 1II3A 4NP5A 1LYLA 1WCMB 4RG1A 3Q24A 1HR0W 1EWHA 2K28A 2WB1B 4RCNA 2PW5A 1YEZA 1Y1VG 2NVXH 3CPFA 1ESRA 3B6YA 3STBD 4K8JA 3H0GG 3PUZA 3H15A 2RDFA 1I6HB 3GTMH 4IFDJ 4GLXA 3KYHC 5EBDA 4UY8C 4JOIC 4JCVE 1HFNA 3X3NA 4DXGA 2FXQA 4B08A 2RDHA 2DJGC 1KXLA 3FRPB 1A62A 4O2DA 2G9DA 2ID0A 3NENA 1N33L 4RGMA 4JC0A 3HOUG 4LF9Q 2R7DA 5EKLA 2SOBA 1X9NA 2QKIC 5NUCA 1XPOA 1D1KA 4LF8Q 1PTOB 1Z9FA 2K33A 1LTBD 2AKWB 4YHHQ 2QF7A 4GOPC 1ICFB 2JA5G 4CDEC 1ASZA 1PTOD 1U9RA 1VQHA 1V1PA 3ULJA 1YNNC 2WAQB 1WTXA 1D8LA 2NVYB 3RN5A 2BA0A 2VQFQ 3CPWA 5IGCA 4DK6C 3PQIA 3GTQH 1X6OA 3HOZH 1VQKA 4FF2A 2J0TD 3RLOA 2EY6A 2EOTA 1O7IA 4LF5Q 1KLUD 3M4PA 1TWAH 1U4RA 4RAUC 1HNXQ 2UUCQ 5ELEA 5C0XJ 2LS01 3R8BA 4MNOA 1M90C 3H3VC 2NZHA 3NQIA 1WTHA 1Q81C 3M3YB 5C4ZA 5CC4A 1ONLA 1FYCA 1YITA 5EGTA 4LK1C 4BBRG 3AFQA 2E76C 2A1AA 1X56A 1X32A 2UXCL 3C1EA 3KFUA 1JJCB 3PIPA 2VQEQ 3RLFA 3J80E 4CGYB 2RKSA 4ME3A 3SVMA 2M00A 4A3MB 2WINB 5D65A 3K57A 2D0OA 4A3JH 5CBEE 3GTKH 1YIJA 2F0PA 4GS3A 4EGVA 1RDPD 1GUWA 2JQOA 2OCEA 1DM0B 4P72A 3I4LA 3L9AX 4CBVA 1CHQD 2LKVA 3T56B 2YTYA 3CCJA 1CQVA 2AQ3B 2H5XA 2PYKA 4YY3L 1XXGA 2O5JC 5ELCA 1S5ED 2WKCA 4HJ5A 4DV7L 1L1OA 3PO2B 5C4XH 2K6AA 3OSOA 2FFKB 2KVMA 4BS9A 5IYDG 4IPHA 4DV0L 1B1ZA 4A3FB 4G57A 3MZ5A 3KLRA 5IGGA 1TWGB 2K05A 3EIVA 1J6QA 1Q1BA 1ILQA 4R1JA 5CV8A 4OWTB 2Z9HA 3KF8B 2TSSA 5JEAG 3HOVH 3T13A 4A3LH 4DNTB 2UUAL 4POGA 4L5RC 4X66L 4G7OC 1JORA 4ODGA 4POFA 2ASBA 1NTGA 3T1YL 2EY1A 2MUYA 3S16B 1EQQA 4FVMA 1TS3A 2NYZD 3SK4A 2A68C 1R9TH 2Z6BA 3CCLA 4AQYL 5EJWA 1HZBA 1SNMA 3OHXC 2NVQB 1N8RC 2F0DA 2WB1E 4IJLA 2H1EA 1QUQB 4ZCKA 2RCFA 2E5LL 2DY7A 2WACA 4E6IA 2ZXRA 2CKZB 4DF7A 4NXNQ 2HIVA 2PQAB 3MFYA 5JJIA 3TMEA 1A2UA 2B2WC 4DV4Q 1IBMQ 1I5FA 3HOUH 1B4OA 3SE0A 4IUUA 1KLGD 2F4VQ 2A5HA 1B9NA 5EKKA 3QB3A 1E24A 2JE6I 4DV2L 3EFXD 5IE8A 4CKBA 1YNJD 3WDNA 3U58A 1NR4A 2L0CA 4GKKL 3MFGA 2JA5H 3MXNB 1QE6A 3HFZB 3F2UA 4OELB 3KF8A 3CCQA 1L0XB 3A0JA 2A69C 3KLSX 2F0LA 4K6DA 2RVLA 5M5XB 1AE3A 3IFDA 3Q6SA 3G6EA 1F9RA 4LF4Q 4V190 2EYMA 3NBHB 4ZKCB 3JAML 3Q0AA 2CWAA 3HOXH 3UE0A 1XNQQ 1AEXA 3R2IA 1YVCA 4A3JB 1OO9B 3UDGA 4BXXG 4X62L 1EQTA 3I70A 3RN2A 1Y1WH 3A74A 1GVPA 2WP8J 1YNXA 1UE5A 1QUQA 1LT5D 2MO1A 5CYUA 5T1IA 4FXKC 3PMFA 1G6PA 1Q86C 4X3TA 2ICIA 2PQAA 2NTSA 5C5MA 5FKAC 1RL2A 4C2MH 3H91A 3VR2A 1L2FA 3W1GA 4JBWA 2B8FA 3FDTA 1BDOA 1LT6D 1U0LA 5LMUQ 3S17B 1F9QA 3NE5B 2N78A 3CKIB 2QEXA 2BDNA 5C6AA 5M5YB 2CHBD 1SYGA 5FLXE 3MXNA 4JI0L 1K83B 1B50A 3A8IE 4X65L 1N36Q 5CMDA 2ZTEA 3CRLC 1KDBA 1B44D 2IL8A 1SYFA 3W5OA 3K80C 1XMOQ 2A19A 3GTJB 1PH6A 1NCVA 1SFOB 2Q2UA 3OWEB 1GKHA 4JBKA 5IY0A 5JEAH 5J39A 4QMGA 3WOEA 3PUVA 1EU4A 1KRSA 1S5DD 2OT2A 3I4OA 2ZJQA 1JC7A 1ESFA 4A3EB 4C3HB 4NB3A 4B3SL 2FINB 1I50B 4L6TB 1XPUA 4JI5L 1EY4A 5IP7G 1I4XA 1YZ6A 2F1MA 4DR1Q 3KJOA 5IP9G 1A6XA 3DWPA 4LFCQ 1X3GA 5D3DA 1JJGA 4F7XA 4CHTB 2KCNA 2YTXA 1C4QA 4IUVA 1TR5A 4I7AA 3QO2A 4J8QA 1GUOA 1PFBA 4TVAB 4F87A 3X3MA 4DK3C 3G4SA 1SNOA 2AMCB 2EZVA 3Q8DA 4FDBA 2YU9H 3KBGA 2O5IC 4OONA 5CV5A 4UAIA 1SYCA 1I94L 2DGYA 2IHEA 4BBSB 1TWFB 3I3CA 4HIMA 4LW1A 5A35A 2UU9L 1EIHA 1OXSC 3ER0A 3BDOA 1O7ZA 3LWUA 4EQ5A 5EPLA 3GTPH 1G291 1I4RA 3J7AF 1MHWC 3QR8A 5E1FA 3J81E 1TY2A 3MXUA 3MWYW 3CQZH 2HQLA 2ZTCA 1D5XC 3U50C 2RDGA 4AIMA 5E4WC 1P16A 1MJEA 5JAVA 5I2XA 3LNNA 2E2DC 4FP5D 3JC66 5E4XA 1QWYA 1UWVA 2A6EC 1PV4A 5IYCG 2A8VA 5HY6A 4DV5L 4DR4L 2P5ZX 2A73B 4TQUS 1GJXA 5EKIA 5K5PA 1Q90A 2NVTB 5FK9C 4GNXC 4LFAQ 1P8LA 2JA7B 3J81j 2R7ZB 2IHFA 3TS2A 4TKOB 4OO1I 5I9PA 1HXYD 2K1BA 4OL7A 1Y14B 3K5NA 2F0UA 2EPBA 1AZQA 1UUPA 1F77A 4DK1A 4A3KB 1KHIA 4JI2Q 1WTWA 3PO3G 3SDZA 2WAQG 1E3PA 2SDFA 4DUYL 4UP9A 4DV1L 4DV6Q 2HHHL 1PLFA 1PH4A 2F0EA 2DJFC 3PGZA 2L9HA 3S1QH 5JEAJ 4OX9Q 1SAPA 4LWCA 4ULLA 3OIQA 2BH8A 4YCUA 5T1GA 2K5HA 3D4DA 4B3RL 1S72A 3QOLA 3OOCA 1CT1D 1S5FD 3TEHB 5JJLA 1CKNB 1UNSA 1ZXTA 2A68D 5FO7B 1K0SA 5LL6X 1SDFA 3C46A 1E1TA 3KDFB 3OW7A 4UP7A 4KKTA 1I4HA 3RZOH 1LTSD 2EDGA 5DM63 1B7YB 3IFTA 3S1NH 1VQNA 3FKIH 4NW2A 4K0KQ 3VR4A 1SNPA 1VQMA 1QILA 4A3MG 1SSOA 1STHA 3L3OC 2RCNA 3CP0A 4LUZA 4OO1H 4Y7NH 2IPKD 2K01A 1EWCA 3K7UC 1QVGA 4JV5Q 1ZYRC 4DAMA 2KEEA 3VYTA 4V0BA 4HIKA 4JI7Q 2WV6D 2F52A 4JI3L 1STGA 2L4NA 4A3CG 3DM1A 3I72A 3P1HA 1EL0A 5EPKA 3H94A 2Q2TA 1XWEA 3HOYG 2B2UC 1JWSD 1X3FA 1D1IA 3AFPA 1HPCA 1A0IA 2PZTA 2R92H 1ASYA 1SLJA 5C4JB 2EXDA 5A2QE 5CORA 3ZYYX 5LMNW 3BDLA 5JOBA 1FD7D 4PMBA 2RHSB 4H02A 3GTGB 1PH5A 2C9OA 2D2CC 3LWEA 4JI8L 4IUPA 1PYSB 2PZUA 3UI2A 2UXDQ 1JOQA 2MP1A 3KDFA 3J81L 4OEMB 3NPPA 2DNCA 3I8ZA 1H9JA 2JA8G 1VF7A 1EU3A 5IGBA 1LABA 2B2VA 2ZXPA 2FMCA 3CW2C 1PYBA 5M3MG 4BY1G 2EVBA 4DR5L 1HTPA 1WTPA 3V05A 2D62A 5C3EB 4B3TL 3BYTB 3L0OA 5GAGC 3I4MG 2B8GA 1NSNS 2R3ZA 3M9BA 3UDXA 2HDMA 2E2JH 2VZAA 1G51A 3E3XA 4A93G 1EY9A 3W2DA 2JP1A 4JI1L
chains in the Genus database with same CATH topology
1CFMA 1U4PA 2CVRA 1V8QA 3D4WA 2J7ZA 5C3WA 4ILWA 2QILA 4Q0FA 1EOTA 3MEHA 1MI2A 2PO4A 2EY2A 1QNUA 2XIWA 4N9TA 3GO5A 1W6JA 5DEHA 3TSSA 1SEBD 2DY8A 3K5OA 1OXVA 4ZQ3A 5C44B 4Y7NB 2KEDA 2AUJD 3BG3A 1TWHB 2EYJA 3K0YA 5DNFA 3GTLB 1H9KA 1UEAB 1FNVA 2K03A 5IOCA 2Z4IA 4DGZA 3BYYB 5KEEA 5JVH3 2L12A 2F0MA 3IL8A 4XT1B 3S2DB 3SEBA 1RCVD 1TS4A 2NWGA 1TKWB 1H9SA 3A7AB 4KTAA 2QDBA 4XT3B 3SHLA 2H4OA 1A3TA 3EROA 4HSVA 3RZDB 4PV1C 4RGNA 2B39A 3SK6A 2I46A 3AU7A 1G2TA 5A2QL 4KJNA 1KABA 3E6ZX 4KK7A 1SYEA 5JPMC 2E2IB 4K14A 2CW0D 1V1OA 1GHJA 4B9XA 2AQ1B 4HTHA 4ME5A 3M4YA 2ENBA 4C3HG 1LTAD 1JB3A 4HN7A 3JAME 1SNDA 2NZ1D 4L8JA 2NBFA 2AQ2B 2DN8A 1TS2A 4A3BB 1U4LA 2R6GA 2XWBB 4C1NI 4KN4C 5CV7A 5G3LF 4C3IB 3VR3A 1R4PB 4IUQA 1DOMA 3PV0A 1KDAA 1SE3A 3NWSA 4WJWA 1KNEA 3NTKA 2XNAC 2X6LA 4KJOA 1EEFD 2NB0A 1CHPD 1S4ZA 3T51B 2EYFA 4A3IB 3S15B 2HCIA 1I4GA 2NUCA 4RWSC 3HKZB 2FMMA 1J9OA 3HGBA 5K36G 4QF4A 2NVXB 1E2VA 4P2CB 2B2YC 1TY0A 2N88A 3MXPA 1TIID 3GTMB 4AYBB 5JJZA 2PPBC 1BCPB 1VMPA 3KK7A 1Z7TA 5IT9E 1DONA 1STBA 1BF4A 5FOBB 1BCPD 1DZ1A 4RHRA 1EYAA 2RSNA 1CI3M 1R4QB 2YYZA 4Z9CB 2K5DA 3SK5A 4FYDA 4TSSA 1MGSA 5HGTA 1IYVA 1T5XD 1MSGA 3A54A 2OEOA 1SYDA 2JEAI 3GTQB 3HOZB 2PMZB 1TT2A 1RF2D 2IWHA 4EVOA 1TWAB 1QB5D 4ZYSA 1WVLA 1Y8NB 1EZ8A 3TZDA 2ZXOA 3T53B 3A55A 1FNUA 1PRTB 1IKLA 1CA6A 1BQQT 3GTKB 1PRTD 4X3SA 4NKLA 3RMHA 4K2LA 1Y8OB 2RA4A 3HP3A 5TSSA 4HCEA 2J4XA 5CGKA 4DNRB 3U9SA 4OIJA 3AMUA 1FNWA 4KY6A 4LJZC 5C4XB 1K8MA 2OF1A 4CKCA 2C5CA 1ENAA 1JCKB 2B2TC 1FR3A 4MIUA 4FF3A 3HOVB 3KLSA 5C5LA 1IW7D 5CR3A 4IQZA 3W3AA 1SBBB 4U68A 4KV6A 1H9MA 1BXTA 3D6WA 1Y1VB 2F0TA 3GD7A 2Q8IB 3NP8A 1R9TB 2XWJB 1OXXK 1PTOF 3AB9A 4BA2I 1SJED 3NBHA 4ZUIA 1DJRD 4J1MA 4B9WA 4MN3A 1G6ZA 1QNKA 2A6HC 5IT9L 3PIO3 2IX1A 3P7JA 3HOUB 1BUVT 3C3LA 4O42A 4M8AA 4XXEA 4BA1I 3BZDB 1IKMA 1M8AA 5LL6S 1UAPA 5AFWA 1G91A 3EQLC 2JA5B 2F4IA 2VNUD 4RGTA 3HEJA 1YNND 4RKBA 4QCLA 1HFGA 3EA6A 1CTMA 4H13C 3HOXB 3J7AV 1A3VA 1Y1WB 3K59A 4BBRB 2NN6G 2HUGA 4F8MA 1U4MA 1F2MA 2ICEC 4KHZA 4O1NA 3QG1A 4MHEA 3M7NA 4IFDG 4JK1C 3PUXA 4C2MB 1SMYC 1DXMA 2LFNA 3VR6A 4G7HC 1A3UA 2A74C 1JWMD 3S9WA 3SR1A 3TP5A 1VMCA 4OIKA 3GV3A 2VB2X 1B53A 2EYOA 3HZXA 2FHTA 4RCOA 4IN3A 4CJ0B 1GUGA 2XVSA 2RBMA 2NTTA 3T16A 5I4DA 4HCSA 1SE4A 2GA4B 5ELDA 1EEID 1LT4D 2RQXA 1LTRD 4QUCA 2EJGC 1HA5A 5D3IB 4RA8A 4ZUJA 1EIGA 4WRDA 3OMCA 3K58A 2NN6I 4XIGS 3TDQA 4KD3A 4XDXA 4IFDI 1GUTA 2YU9B 4L63B 2JXMB 3OIPA 2BCOA 1SNCA 3M7GA 1PRTF 2AWNA 2EXZA 4RHSA 5JVG3 4FXDA 4K5XA 1Q8IA 1C48A 4EQNA 2G9HD 2KJXA 4PNYA 3DHQA 3GTPB 2X6GA 2EE1A 2BA1A 2HQEA 2F0GA 1BNZA 3CQZB 4K5WA 5M5WB 2PCFB 2F0OA 2A69D 2XSCA 1F2YA 2KQ3A 1WTQA 2DNEA 2E75C 1LT3D 2XRQD 5KYLA 4KKUA 4ZLTF 2BE5C 4PQXA 4KMUC 4KY5A 2MJ8A 2O2LD 4K2KA 3FEWX 3H6MA 3Q22A 1J8IA 1JQYD 2B2WA 3Q23A 1D5ZC 1GOZA 1H9RA 1AZPA 2PZWA 5KYIA 3OMGA 3L7ZC 1SJHD 1Z47A 3TN2A 1XYIA 5IIFA 2QCPX 3S1QB 1KTKA 1OXUA 5KIXA 4DFAA 3TZUA 2MHVA 3A8KE 3A56A 1YNJC 2AUKA 1OXTA 1LO5D 4I7ZC 4ZKBB 2N55A 1VDZA 3RZOB 2KUMA 1DOLA 3S1NB 2A6HD 3FKIB 3VR5A 3VA5A 1HQRD 5IODA 3QJYA 1ML0D 4ZAIA 1Y8PB 3DWQA 1CA5A 3ERQA 1D6EC 1G8ZD 3NTHA 1X3PA 1SXTA 1IL8A 2Z4HA 2SEBD 1CZWA 3TBIB 3NBIA 2D9UA 4H0LC 4K5VA 3FPUB 1Q3LA 4Q5VA 2R92B 5C3XA 3VYSA 1ENCA 1KNAA 4FF4A 1JR0D 4HSPA 2OXPA 4LMQD 3K5MA 2F0SA 2EYHA 2K7VA 3FVQA 1JOOA 4NMZA 1WTOA 2K04A 5BN3A 1K8OA 2M9VA 2Z1CA 1SMYD 2D5DA 2LY7A 4XYOA 5J22A 1W6KA 4R9WA 3VYUA 1RKNA 2A6ED 4ID6A 2E2JB 1DD2A 1PZID 2IJ0A 4KD4A 2EJMA 5FO9B 1I4QA 3NSWA 3DUZA 5FO8B 4C3JB 2JSOA 1ZEQX 4K8IA 1DOKA 1GUSA 2F0WA 1WD1A 3PO3B 4FF1A 5C4HA 1F9PA 1D5MC 4QIWB 1E2ZA 4ZRZA 3OPOA 5CBAE 1VCIA 3DEOA 3BVGA 5EBCA 1B9MA 4XYQA 2K5WA 1RD9D 5LHY1 1NR2A 4XQJA 1HHVA 4G4KA 4DA2A 3LX0A 4CJ2C 1AN8A 3NTIA 2JEBI 5ELBA 2E2HB 1MD2D 4R8IA 1EY5A 1EY0A 5I9OA 2X69A 2EYLA 4DK0A 3RUZA 2R93B 5F2DA 1E0BA 1O7LA 5E3FA 2K5QA 2AWOA 2SNMA 3SXHA 2PQEA 3IKJA 4RGOS 5IGDA 4IUTA 5COYA 5D14A 2KCCA 1ZYRD 3D6CA 1XTCD 2L11A 3PUYA 2L1BA 3A8JE 2BOSA 1PZKD 3S1MB 3TP8A 3SK8A 2K32A 3OWFA 3HOYB 2KA7A 1EFID 1STEA 1HRJA 2B63B 1Q1EA 3VA7A 1T5EA 1KDCA 3C1FA 3MTSA 2BE5D 3ONAB 3E0JA 5IGFA 2VXWA 2EJFC 1PYWD 3GTOB 4FNFA 1WTVA 2IW3A 1DCZA 1EQVA 2MPMA 2JA8B 1F9SA 3ND8A 1AFPA 5M3MB 5ELFA 4BY1B 4TRDA 1Q12A 4H44C 2MGSA 1O7YA 5KRUA 3I4MB 4NDXA 2RSOA 3CRKC 4XQQA 1TVXA 3D31A 4UDUC 4A93B 1EZ6A 4OHJA 4HMIA 1D2BA 3R93A 2TMPA 2B2UA 2B2VC 2F0IA 2ZT9C 3MC0B 3CHBD 4IUNA 4C1NK 5CV4A 3S2HB 1QOHA 4M1UB 1JWUD 2PNRC 3DWAA 4F88A 1C8CA 3QWNA 3D4RA 4KI0A 1RHPA 1O78A 4QB4A 1B3AA 1EY8A 1G2SA 4S3SA 1ICWA 4K6LA 2F3VA 2WKDA 2V4DA 1HQMC 2VB3X 4DAYA 1MSHA 1DYQA 1CM9A 1RTNA 3MAQA 1F2LA 3J7YW 3D3RA 1TQOA 3BVMA 3J80L 3PIP3 3M85A 1BR9A 5IGEA 5K36H 2HDLA 3GP7A 4CJ1B 1EY7A 3WOFA 2HCCA 3P75A 1ET6A 3H0GB 3NQTA 3QIAA 4HAEA 3O13A 3FPPA 1BO0A 1HUMA 1PFNA 5DAUA 4X3UA 2F0VA 1S5CD 1EYDA 1RJTA 3M4OB 3N52A 3BS1A 2JYOA 2Y0SB 3VYRA 3R3OA 3C2PA 2Q8TA 3EJIA 1L0YB 3FMCA 1GXDC 1PZJD 2IX3A 1QCBD 4OO1G 2E74C 3DMUA 1CK1A 2I07B 4DXFA 4G7ZC 3NUCA 1LLRD 4PMCA 4OGQC 5KNBA 1PDQA 1TS5A 5M3FB 1Y69U 1AP0A 5EQ0A 1IHZA 3NHHA 5I6WA 1A15A 2XRSD 4LAAA 1GHKA 2F0KA 2FJ2A 2Q8RE 2BDOA 2F03A 2KOLA 1JOKA 3MHBA 1E2WA 4XQNA 4WFN3 3G7LA 3MXGA 1A2TA 3NXWA 3QOJA 1BOSA 4IALA 1BCPF 1I3QB 3HS0C 2WIIB 4DAVA 3TP7A 5M9OA 4X3KA 4A3DB 1S5BD 1ILPA 1B2TA 2KECA 1TWCB 3DXJC 5CV6A 3PUWA 1SE2A 1PTOC 2CW0C 2XN9C 5KGUA 4DU9A 5HURA 1LTID 1KAAA 2F0FA 5ISRA 5C0XG 1GUNA 4KHVA 1O80A 4EQPA 4C3JG 1EYCA 1BBXC 2R61A 3I90A 2KHSA 3ITPA 3R2TA 3K6OA 3IAYA 2O4XA 4WORA 3I91A 1LTTD 4KY7A 5EPJA 3URYA 2JA6B 3V2TA 4C3IG 1WTRA 4RKLA 5FLXL 1PMRA 4J6HA 1STAA 1M4VA 1TU2B 3E5SA 4HMJA 1JICA 4CKEA 2B2YA 4ABNA 3KBXA 3BVZA 3D8GA 1STNA 3S14B 1AW7A 2Z8LA 5BN4A 1LTGD 2IX0A 5G3LD 4IURA 1ENFA 1HCZA 5I2YA 4KKSA 1VF5C 4YIJA 4HR7B 2SNSA 4I65A 5KNCA 4XTCS 1ZKOA 3V96A 3S1RB 2F0QA 3K5LA 3HG9A 4A3GB 4RFBA 3I73A 5KNDA 2PW7A 1BCPC 5C0XI 4GZYC 1Z6HA 1I4PA 2NN6H 3CU7A 1MBYA 4IFDH 1SNQA 3RD4A 4BY7B 4U673 3N6RA 1NAPA 1CZGA 3G6JB 2F0NA 4C56C 1RTOA 1V43A 4IZ8A 3BDCA 4HEDA 1FGBD 1CQFA 1HUNA 3HRZC 1F2ZA 1QJOA 1HTLD 2L5TA 1IYUA 1EY6A 3MA2B 1WD0A 1XX8A 2QEJC 2VUMB 1PTOH 3NWTA 1PXUA 1JE4A 1ET9A 1STYA 3P20A 4H7BA 4RH6A 4BWGB 5J1ZA 2EY5A 4DAPA 3K7AB 4QUFA 1LACA 3H09A 2F0JA 2IT1A 1LV9A 1NUCA 4KN7C 4ZK9B 5C0XH 5JPNC 3KUPA 3DEPA 1I6VC 1PRTC 4N9PA 5DM73 3GQBA 2B2TA 1H9SB 1X3QA 2LMCB 3A7LA 3ND9A 3MVVA 3HOWB 3TP6A 3EVQA 2EYPA 2F3WA 2L55A 5BN5A 4FO2A 3I4NB 2M2LA 4PMWA 3T4AC 1SYBA 4DN4M 1V1PB 3GV6A 1QG7A 5I6YA 3U9OA 1RODA 4FXGC 1HA6A 4R8NA 5CV9A 4EQOA 1IW7C 1PFMA 2CQAA 3NK9A 2F0HA 1II3A 4NP5A 1WCMB 3Q24A 1EWHA 2K28A 2WB1B 4RCNA 2PW5A 1ESRA 4K8JA 3PUZA 2RDFA 1I6HB 4IFDJ 5EBDA 1HFNA 3X3NA 4DXGA 4B08A 2RDHA 3FRPB 2G9DA 2ID0A 4RGMA 5EKLA 2SOBA 2QKIC 5NUCA 1D1KA 1PTOB 2K33A 1LTBD 2QF7A 1PTOD 1U9RA 1V1PA 1YNNC 2WAQB 1WTXA 2NVYB 2BA0A 5IGCA 4FF2A 2J0TD 2EY6A 2EOTA 1KLUD 1U4RA 4RAUC 5ELEA 5C0XJ 2LS01 3R8BA 3H3VC 3NQIA 3M3YB 5C4ZA 5CC4A 1ONLA 1FYCA 5EGTA 4LK1C 2E76C 1X32A 3C1EA 3RLFA 3J80E 4CGYB 2RKSA 3SVMA 2M00A 4A3MB 2WINB 5D65A 3K57A 5CBEE 2F0PA 4EGVA 1RDPD 1GUWA 1DM0B 3I4LA 3L9AX 4CBVA 1CHQD 2LKVA 3T56B 1CQVA 2AQ3B 2PYKA 1XXGA 2O5JC 5ELCA 1S5ED 2WKCA 3PO2B 2K6AA 3OSOA 2FFKB 2KVMA 4BS9A 4A3FB 1B1ZA 4G57A 3MZ5A 3KLRA 5IGGA 1TWGB 2K05A 1Q1BA 1ILQA 5CV8A 2TSSA 5JEAG 3T13A 4DNTB 4G7OC 1JORA 4ODGA 2EY1A 2MUYA 3S16B 4FVMA 1TS3A 2NYZD 3SK4A 2A68C 5EJWA 1SNMA 3OHXC 2NVQB 2F0DA 2H1EA 2DY7A 2WACA 4E6IA 2ZXRA 4DF7A 3MFYA 3TMEA 1A2UA 2B2WC 1B4OA 3SE0A 4IUUA 1KLGD 2A5HA 1B9NA 5EKKA 3QB3A 2JE6I 3EFXD 4CKBA 1YNJD 3WDNA 1NR4A 2L0CA 3MFGA 1QE6A 3F2UA 3KF8A 1L0XB 2A69C 3KLSX 2F0LA 4K6DA 2RVLA 5M5XB 3IFDA 3Q6SA 1F9RA 4V190 2EYMA 4ZKCB 3JAML 3Q0AA 1AEXA 3R2IA 4A3JB 1OO9B 1EQTA 3I70A 2WP8J 1LT5D 5CYUA 5T1IA 4FXKC 3PMFA 4X3TA 2ICIA 2NTSA 5C5MA 5FKAC 3H91A 3VR2A 4JBWA 2B8FA 3FDTA 1BDOA 1LT6D 3S17B 1F9QA 3NE5B 3CKIB 2BDNA 5C6AA 5M5YB 2CHBD 1SYGA 5FLXE 3MXNA 1K83B 1B50A 3A8IE 5CMDA 3CRLC 1KDBA 1B44D 2IL8A 1SYFA 3GTJB 1NCVA 1SFOB 3OWEB 5JEAH 5J39A 4QMGA 3WOEA 3PUVA 1EU4A 1S5DD 2OT2A 1JC7A 1ESFA 4A3EB 4C3HB 2FINB 1I50B 4L6TB 1EY4A 1I4XA 2F1MA 1A6XA 3DWPA 5D3DA 4F7XA 4CHTB 2KCNA 1C4QA 4IUVA 1TR5A 3QO2A 4J8QA 1GUOA 1PFBA 4F87A 3X3MA 1SNOA 2EZVA 2O5IC 3KBGA 5CV5A 4UAIA 1SYCA 4BBSB 1TWFB 3I3CA 5A35A 1EIHA 1OXSC 3BDOA 1O7ZA 3LWUA 5EPLA 1G291 1I4RA 3J7AF 5E1FA 3J81E 1TY2A 3MXUA 3MWYW 1D5XC 2RDGA 5E4WC 5JAVA 5I2XA 3LNNA 2E2DC 4FP5D 5E4XA 1QWYA 2A6EC 4TQUS 2A73B 1GJXA 5EKIA 5K5PA 1Q90A 2NVTB 5FK9C 2JA7B 2R7ZB 4OO1I 4TKOB 5I9PA 1HXYD 2K1BA 4OL7A 3K5NA 2F0UA 2EPBA 1AZQA 1UUPA 1F77A 4DK1A 4A3KB 1WTWA 3SDZA 2SDFA 1PLFA 2F0EA 2L9HA 5JEAJ 1SAPA 4ULLA 3OIQA 5T1GA 3D4DA 3QOLA 3OOCA 1CT1D 1S5FD 1UNSA 1ZXTA 2A68D 5FO7B 5LL6X 1SDFA 3C46A 3OW7A 4KKTA 1I4HA 1LTSD 2EDGA 5DM63 3IFTA 4NW2A 3VR4A 1SNPA 1QILA 1SSOA 1STHA 3L3OC 4OO1H 2IPKD 2K01A 1EWCA 1ZYRC 2KEEA 3VYTA 4V0BA 2WV6D 1STGA 2L4NA 3DM1A 3I72A 3P1HA 1EL0A 5EPKA 3H94A 1XWEA 2B2UC 1JWSD 1D1IA 1HPCA 2PZTA 5C4JB 5A2QE 5CORA 3ZYYX 3BDLA 5JOBA 1FD7D 4PMBA 3GTGB 2C9OA 2D2CC 3LWEA 4IUPA 2PZUA 3UI2A 1JOQA 2MP1A 3J81L 3NPPA 2DNCA 3I8ZA 1H9JA 1VF7A 1EU3A 5IGBA 1LABA 2B2VA 2ZXPA 2FMCA 2EVBA 1HTPA 1WTPA 3V05A 2D62A 5C3EB 3BYTB 2B8GA 1NSNS 2R3ZA 2HDMA 1EY9A 3W2DA 2JP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X32 A;  1MGS A;  1MSH A;  1QE6 A;  1WTO A;  3F2U A;  3G7L A;  2K04 A;  2M2L A;  1CM9 A;  1RTN A;  1ZXT A;  1AZP A;  1U4P A;  1MSG A;  1F2L A;  2CVR A;  4MN3 A;  1G6Z A;  4IUV A;  2J7Z A;  1QNK A;  3QO2 A;  1SDF A;  1PFB A;  2NZ1 D;  1EOT A;  3SVM A;  4DN4 M;  2RVL A;  1MI2 A;  3GV6 A;  3IFD A;  1QG7 A;  3Q6S A;  5D65 A;  1F9R A;  4HCS A;  1ROD A;  3P7J A;  5CBE E;  2XIW A;  4UAI A;  4R9W A;  3TN2 A;  4ZKC B;  1U4L A;  1HA6 A;  4O42 A;  1HRJ A;  4X3K A;  2HDL A;  1XYI A;  1GUW A;  1PFM A;  4CJ1 B;  4NW2 A;  1WVL A;  2HCC A;  1ILP A;  3I3C A;  1B2T A;  2KEC A;  1SSO A;  1IKM A;  3TZD A;  1EIH A;  1EQT A;  3MTS A;  1M8A A;  2DY8 A;  3ONA B;  4HAE A;  1O7Z A;  5AFW A;  4QUC A;  2K28 A;  1G91 A;  2VXW A;  4IUQ A;  1BO0 A;  1HUM A;  2K01 A;  1PFN A;  5EPL A;  1DOM A;  1NAP A;  4RA8 A;  2KED A;  1ESR A;  2KEE A;  5T1I A;  1RTO A;  1EIG A;  1WTV A;  2FFK B;  4X3U A;  2KVM A;  4X3T A;  2MPM A;  4ZKB B;  2N55 A;  3MWY W;  1HFG A;  4HED A;  1KNE A;  1F9S A;  1IKL A;  2K05 A;  2L4N A;  1DOK A;  1CA6 A;  2X6L A;  4XDX A;  1HFN A;  1HUN A;  3DM1 A;  1RJT A;  1WD1 A;  1ILQ A;  3H91 A;  3N52 A;  5DNF A;  2KUM A;  1O80 A;  5E4W C;  5EPK A;  1EL0 A;  1DOL A;  1S4Z A;  1F9P A;  2JYO A;  3FDT A;  4X3S A;  2B2U C;  1BBX C;  2MGS A;  3I90 A;  2HCI A;  2RA4 A;  2K03 A;  1O7Y A;  3HP3 A;  2Q8T A;  1WD0 A;  5CBA E;  1F9Q A;  1XX8 A;  5E4X A;  4RWS C;  1ML0 D;  2RSO A;  3DEO A;  4ZAI A;  2BDN A;  1TVX A;  1JE4 A;  5COR A;  2FMM A;  1J9O A;  3I91 A;  2L12 A;  4OIJ A;  1NR2 A;  5EPJ A;  3R93 A;  1HHV A;  5EKI A;  3IL8 A;  1CA5 A;  1B50 A;  2B2U A;  2B2Y C;  4XT1 B;  1WTR A;  2HUG A;  2X6G A;  2B2V C;  3LWE A;  2N88 A;  2NYZ D;  1U4M A;  4IUP A;  4CJ2 C;  5CMD A;  2EE1 A;  3UI2 A;  4QUF A;  2IL8 A;  4MHE A;  5EJW A;  2MP1 A;  1X3P A;  1BNZ A;  2NWG A;  2H1E A;  5JJZ A;  1WTX A;  1LV9 A;  1VMP A;  2B2T C;  4R8I A;  1IL8 A;  2K1B A;  1JIC A;  3I8Z A;  4ZK9 B;  2X69 A;  1NCV A;  2DY7 A;  2B2Y A;  1DON A;  4XT3 B;  2D9U A;  1BF4 A;  1C8C A;  2B2V A;  2EPB A;  3KUP A;  1AZQ A;  3DEP A;  4HSV A;  1WTQ A;  1E0B A;  1RHP A;  1PDQ A;  3FPU B;  3KBX A;  1Q3L A;  1WTW A;  2EOT A;  1DZ1 A;  1VMC A;  2B2W C;  2SDF A;  4OIK A;  3GV3 A;  1B53 A;  1U4R A;  1B4O A;  1PLF A;  1B3A A;  4RAU C;  4IUU A;  2B2T A;  1KNA A;  4ZLT F;  1AP0 A;  5EQ0 A;  1G2S A;  1X3Q A;  1WTP A;  2L9H A;  1G2T A;  2FHT A;  1A15 A;  1ICW A;  2RSN A;  4U68 A;  4CJ0 B;  2FJ2 A;  2R3Z A;  3D6W A;  1SAP A;  2Q8R E;  2HDM A;  2FIN B;  4LMQ D;  4IUT A;  5COY A;  2MJ8 A;  4IUR A;  5D14 A;  2KOL A;  1NR4 A;  5T1G A;  1J8I A;  2L11 A;  2L1B A;  2JP1 A;  2B2W A; 
#chains in the Genus database with same CATH topology
 3BU2 A;  1CFM A;  1Q7Y C;  4Y52 H;  1U4P A;  2CVR A;  4C3J H;  1CKM A;  1V8Q A;  3D4W A;  1WYD A;  2J7Z A;  4JW0 A;  5C3W A;  1NE3 A;  2QIL A;  4ILW A;  4Q0F A;  1EOT A;  1W3S A;  3MEH A;  1MI2 A;  2PO4 A;  2EY2 A;  3PO3 H;  1XPR A;  1QNU A;  2XIW A;  4N9T A;  3J80 c;  3GO5 A;  1W6J A;  4X64 Q;  4DR2 L;  1K8A C;  5DEH A;  3TSS A;  5BR8 L;  1SEB D;  2DY8 A;  3K5O A;  1OXV A;  1IZ6 A;  1UE7 A;  3F8T A;  4ZQ3 A;  5C44 B;  4JYA L;  3BZK A;  5GAD C;  4Y7N B;  2KED A;  3F2B A;  1XNR Q;  2AUJ D;  3BG3 A;  1TWH B;  1EUJ A;  2EYJ A;  2L15 A;  3K0Y A;  5DNF A;  3GTL B;  5AJ3 Q;  4O0A A;  4APV A;  2R93 H;  1H9K A;  1UEA B;  1FNV A;  1KL9 A;  1K3R A;  2K03 A;  4RMF A;  5IOC A;  3CCS A;  2Z4I A;  4DGZ A;  2K52 A;  3BYY B;  5KEE A;  5JVH 3;  1K8G A;  2L12 A;  2F0M A;  4IJH A;  3IL8 A;  2MFI A;  4XT1 B;  4YWK A;  3S2D B;  3SEB A;  1RCV D;  1WOC A;  1TS4 A;  1VQ7 A;  2NWG A;  1HR0 Q;  4DNI A;  1TKW B;  1H9S A;  4A3C H;  3A7A B;  4KTA A;  2QDB A;  4HJ9 A;  4XT3 B;  4P73 A;  3SHL A;  3HOY H;  2H4O A;  1A3T A;  3ERO A;  4HSV A;  1VQ4 A;  3RZD B;  1BVS A;  4PV1 C;  3T1H L;  4RGN A;  2B63 H;  1FJG L;  4EX5 A;  2Y0S G;  2B39 A;  3SK6 A;  2I46 A;  3AU7 A;  1G2T A;  3PCO B;  5A2Q L;  4KJN A;  1KAB A;  3E6Z X;  3FP9 A;  4KK7 A;  2OWO A;  1SYE A;  2R7F A;  5JPM C;  4GNX B;  2E2I B;  4K14 A;  1EIF A;  1V1O A;  1GHJ A;  2CW0 D;  4B9X A;  2GN5 A;  3F2C A;  2AQ1 B;  4HTH A;  4R4Q A;  4ME5 A;  3M4Y A;  3GTO H;  2ENB A;  4C3H G;  1HZC A;  1LTA D;  1JB3 A;  4HN7 A;  3M4Q A;  2JA8 H;  1E22 A;  3JAM E;  1SND A;  4LF6 Q;  2NZ1 D;  1IBK Q;  4L8J A;  2NBF A;  2AQ2 B;  2DN8 A;  1TS2 A;  4X66 Q;  4A3B B;  2AHO B;  5M3M H;  4BY1 H;  1U4L A;  2KEN A;  2R6G A;  3L2P A;  2XWB B;  4C1N I;  3I4M H;  4KN4 C;  5M3F G;  4JI6 Q;  5CV7 A;  5G3L F;  4C3I B;  3I7F A;  3VR3 A;  4A93 H;  1R4P B;  4IUQ A;  1IBL L;  4GN3 B;  1DOM A;  4QY7 A;  3PV0 A;  1KDA A;  3W1B A;  1SE3 A;  3NWS A;  1M1K C;  4WJW A;  2UXB Q;  1BBW A;  1KNE A;  3NTK A;  2XNA C;  3S2H H;  2X6L A;  4A4I A;  4LNQ A;  4OWW B;  4KJO A;  4KLK A;  1A63 A;  1EEF D;  1LTL A;  2NB0 A;  4JBM A;  1CHP D;  1S4Z A;  3T51 B;  2EYF A;  4A3I B;  3S15 B;  2HCI A;  4DV2 Q;  1I4G A;  2NUC A;  4RWS C;  3HKZ B;  2QW7 A;  4A3D G;  2FMM A;  1J9O A;  3HGB A;  5K36 G;  2DUD A;  1WI5 A;  4QF4 A;  2NVX B;  1E2V A;  4P2C B;  2B2Y C;  1RIP A;  1TY0 A;  2N88 A;  1JE5 A;  3MXP A;  1TII D;  4LF9 L;  3GTM B;  4AYB B;  5JJK A;  5FLX c;  5JJZ A;  2PPB C;  1BCP B;  1VMP A;  3KK7 A;  1Z7T A;  4LF8 L;  2EQS A;  1KC8 C;  4HIO A;  4DR3 Q;  2WFW A;  5IT9 E;  1N32 Q;  1DON A;  1STB A;  1BF4 A;  4YHH L;  2JA7 G;  4DPG A;  5FOB B;  1BCP D;  1DZ1 A;  3J7A 5;  3S24 A;  1Y1V H;  4RHR A;  2VQF L;  4QL5 A;  1OTC A;  1EYA A;  2RSN A;  3H0G H;  1CI3 M;  1R4Q B;  2YYZ A;  4Z9C B;  2K5D A;  3SK5 A;  4FYD A;  4KHP Q;  4TSS A;  4LF5 L;  2JA6 G;  1MGS A;  1HNX L;  1K3B C;  5HGT A;  4HJ8 A;  2UUC L;  1T5X D;  3KF6 B;  1IYV A;  1UE1 A;  1MSG A;  3A54 A;  2OEO A;  1SYD A;  2JEA I;  3GTQ B;  3HOZ B;  4GLV B;  2PMZ B;  4HJA A;  1TT2 A;  1RF2 D;  4ALP A;  1BBU A;  3M4O H;  2IWH A;  4EVO A;  1TWA B;  2VQE L;  3G48 A;  1QB5 D;  4ZYS A;  1B3Q A;  1WVL A;  3TRE A;  1Y8N B;  3A5U A;  1EZ8 A;  3TZD A;  1Q8K A;  1H95 A;  3CCE A;  2ZXO A;  4GN4 B;  4DUZ Q;  3T53 B;  4HJ7 A;  3A55 A;  2QA4 A;  1VQF A;  1FNU A;  1PRT B;  1IKL A;  2Z6K A;  1CA6 A;  1BQQ T;  4WJ3 M;  3GTK B;  5ELO A;  1PRT D;  4X3S A;  4A3G G;  4NKL A;  3RMH A;  4K2L A;  1Y8O B;  2RA4 A;  3HP3 A;  5TSS A;  1X54 A;  1UEB A;  4HCE A;  3AYH B;  1S3O A;  4BBR H;  2J4X A;  5CGK A;  4DNR B;  3U9S A;  4OIJ A;  3AMU A;  2PNH A;  3KF6 A;  1FNW A;  4KY6 A;  4LJZ C;  1VQB A;  5C4X B;  4QIW E;  1K8M A;  2OF1 A;  4CKC A;  4BY7 G;  2C5C A;  1ENA A;  1JCK B;  1C7Y A;  3RLN A;  1YJ9 A;  2B2T C;  1FR3 A;  4MIU A;  4FF3 A;  3CF5 A;  3HOV B;  1CUK A;  3KLS A;  5C5L A;  1IW7 D;  1I3Q H;  4IPC A;  5CR3 A;  4IQZ A;  1PH9 A;  3W3A A;  1VQ6 A;  1SBB B;  4A3D H;  4U68 A;  4KV6 A;  1H9M A;  1BXT A;  3D6W A;  1Y1V B;  2F0T A;  2VUM G;  2IY5 B;  1TWC H;  3GD7 A;  2Q8I B;  3NP8 A;  3ERS X;  5IYD H;  1X65 A;  1R9T B;  4A76 A;  3HKZ E;  4DV4 L;  1IBM L;  2XWJ B;  4P71 A;  1OXX K;  1PTO F;  3AB9 A;  4IO9 A;  1N34 L;  1SJE D;  3NBH A;  4BA2 I;  2F4V L;  1VQA A;  4ZUI A;  1DJR D;  4J1M A;  3UE1 A;  2ES2 A;  4B9W A;  4MN3 A;  1JMC A;  1G6Z A;  1QNK A;  2A6H C;  5IT9 L;  4MTK A;  2NZO A;  1S40 A;  4AYB E;  3PIO 3;  4X6A H;  1SE8 A;  2IX1 A;  3P7J A;  3HOU B;  1BUV T;  3C3L A;  4O42 A;  4M8A A;  4GOP B;  2OQK A;  4XXE A;  4BA1 I;  4LFB Q;  3ULP A;  4LF7 Q;  3BZD B;  3WWV A;  1IKM A;  1M8A A;  5LL6 S;  2UUB Q;  1UAP A;  5AFW A;  1G91 A;  4LF4 L;  3EQL C;  2JA5 B;  2F4I A;  2N3S A;  3HOW G;  2JA6 H;  1XNQ L;  1V1Q A;  3CD6 A;  2OQ0 A;  2VNU D;  4RGT A;  3HEJ A;  1YNN D;  4RKB A;  2ZTD A;  4QCL A;  4UP8 A;  1HFG A;  3I4N G;  2K5V A;  1L0W A;  3F2D A;  3EA6 A;  1CTM A;  4H13 C;  3HOX B;  3J7A V;  1A3V A;  1NMG A;  1VQJ A;  1Q46 A;  2EIF A;  2RF4 A;  2PMZ E;  4B3R Q;  1Y1W B;  4JOI A;  3S14 H;  3K59 A;  4BBR B;  1WCM G;  2NN6 G;  4JI4 Q;  3PF5 A;  2HUG A;  2CH4 A;  4F8M A;  1U4M A;  1F2M A;  2WB1 G;  2ICE C;  4KHZ A;  4O1N A;  5LMU L;  3QG1 A;  4MHE A;  3M7N A;  5M5W H;  2ALY B;  2GVA A;  4IFD G;  3E0E A;  4JK1 C;  1J5E Q;  3PUX A;  4DR6 Q;  2Q2I A;  4C2M B;  1SMY C;  1DXM A;  2LFN A;  3VR6 A;  5ELN A;  4G7H C;  1A3U A;  2A74 C;  3ZJY C;  3S1R H;  1JWM D;  1AE2 A;  4GOP A;  4A3G H;  5FLM G;  3S9W A;  1N36 L;  4BXX H;  3SR1 A;  3TP5 A;  1VMC A;  4OIK A;  3GV3 A;  3G71 A;  2VB2 X;  1B53 A;  1XMO L;  5IYB G;  5H1S E;  2EYO A;  2VL6 A;  3HZX A;  2FHT A;  4RCO A;  5IWA Q;  3NEM A;  4IN3 A;  4CJ0 B;  1KAW A;  1GUG A;  1E7Z A;  2XVS A;  3K8A A;  1PH7 A;  3TRZ A;  2RBM A;  2MNA A;  4YCV A;  4JVZ A;  2NTT A;  1JT8 A;  3T16 A;  4JPB W;  4DR1 L;  5I4D A;  4NPS A;  4HCS A;  1SE4 A;  3LGJ A;  1L1O C;  3KOJ A;  1K0R A;  4JG2 A;  2GA4 B;  5ELD A;  1EEI D;  1VQE A;  4A3B G;  1VQ5 A;  2VUM H;  1LT4 D;  2RQX A;  1LTR D;  4QUC A;  2EJG C;  4NXM Q;  1HA5 A;  4GKJ Q;  5D3I B;  4RA8 A;  4ZUJ A;  1EIG A;  4WRD A;  3K7A H;  3OMC A;  3EN2 A;  3K58 A;  2NN6 I;  5GAE C;  1PH1 A;  2HIX A;  2Z0S A;  4XIG S;  3TDQ A;  2ZM6 Q;  4KD3 A;  2K50 A;  4XDX A;  5HGQ A;  1GUT A;  4IFD I;  2YU9 B;  4L63 B;  2JXM B;  3OIP A;  2BCO A;  1SNC A;  1PH8 A;  1YBY A;  2N49 A;  3M7G A;  1JJ2 A;  1PRT F;  2AWN A;  2EXZ A;  4PZ7 A;  4RHS A;  1EIY B;  5IP7 H;  5L37 A;  5JVG 3;  4FXD A;  4K5X A;  5IP9 H;  1Q8I A;  1C48 A;  4EQN A;  4JI1 Q;  2G9H D;  1WFQ A;  2KJX A;  4PNY A;  3DHQ A;  3J80 i;  1A8V A;  3HOW H;  3GTP B;  1IXR A;  4B3M Q;  2X6G A;  4PZ8 A;  1MJC A;  2EE1 A;  2BA1 A;  2HQE A;  2F0G A;  1BNZ A;  3K0X A;  3CQZ B;  3PO2 G;  4K5W A;  5M5W B;  2PCF B;  4CDF C;  1XJV A;  2F0O A;  2A69 D;  2XSC A;  4A3F G;  1F2Y A;  2LXJ A;  2KQ3 A;  1XMQ Q;  1EQR A;  1WTQ A;  2DNE A;  2E75 C;  1LT3 D;  2I5H A;  2XRQ D;  3PF4 A;  5KYL A;  4KKU A;  4PZ6 A;  4ZLT F;  2BE5 C;  4PQX A;  3K81 C;  1CKN A;  4JYA Q;  4KMU C;  2N8N A;  3OTO Q;  4OXP A;  3U4V A;  3CME A;  4KY5 A;  2MJ8 A;  2O2L D;  4R4I A;  4K2K A;  2CH4 W;  3FEW X;  3H6M A;  4JI2 L;  3Q22 A;  1J8I A;  1JQY D;  2B2W A;  3Q23 A;  4DV6 L;  1D5Z C;  5LMN Q;  4DR7 Q;  1GOZ A;  1H9R A;  1AZP A;  4QGU A;  4OX9 L;  1I6H H;  1EFW A;  2PZW A;  5KYI A;  1SMX A;  3OMG A;  3L7Z C;  1SJH D;  1Z47 A;  2LXK A;  4GN5 A;  1KD1 C;  5IYC H;  3DLL A;  1EWI A;  3TN2 A;  1GO3 E;  1XYI A;  3D0F A;  5IIF A;  2QCP X;  3S1Q B;  1KTK A;  3JAM c;  1OXU A;  5KIX A;  4DFA A;  4J15 A;  3TZU A;  2MHV A;  3SGI A;  4MTN A;  3A8K E;  3A56 A;  1YNJ C;  2AUK A;  1OXT A;  1LO5 D;  4K0K L;  4I7Z C;  1N33 Q;  2LSS A;  3UDF A;  4ZKB B;  2N55 A;  1VDZ A;  2NVY H;  3RZO B;  4JV5 L;  2KUM A;  1DOL A;  3S1N B;  2A6H D;  3FKI B;  3VR5 A;  3CCU A;  3VA5 A;  1HQR D;  5IOD A;  3QJY A;  1ML0 D;  4ZAI A;  1Y8P B;  4A3J G;  3U4Z A;  3DWQ A;  1NNX A;  2E2H H;  3M3Y H;  1CA5 A;  1MKH A;  3ERQ A;  1D6E C;  2MO0 A;  1G8Z D;  3NTH A;  1YHB A;  1X3P A;  1SXT A;  1IL8 A;  2Z4H A;  3ULL A;  2SEB D;  3CCM A;  1CZW A;  4UPA A;  3TBI B;  3NBI A;  2D9U A;  4H0L C;  4K5V A;  4A3M H;  3FPU B;  2UXD L;  1Q3L A;  4Q5V A;  2R92 B;  5C3X A;  2UXC Q;  3VYS A;  1ENC A;  1KNA A;  4FF4 A;  1JR0 D;  2K75 A;  4HSP A;  4A3L G;  2OXP A;  4LMQ D;  2JN4 A;  3K5M A;  2F0S A;  2ZJP A;  2EYH A;  2K7V A;  3FVQ A;  1JOO A;  4QQB X;  2VS1 A;  4NMZ A;  1VQD A;  3S1M H;  1WTO A;  2CFM A;  1SN8 A;  3PO2 H;  2K04 A;  5BN3 A;  3CC7 A;  4IPD A;  1K8O A;  4A3F H;  1NBW A;  2M9V A;  2Z1C A;  1TWG H;  4YY3 Q;  1YHQ A;  1SMY D;  2D5D A;  2LY7 A;  4XYO A;  5J22 A;  2B3G A;  1W6K A;  4R9W A;  4DV7 Q;  3VYU A;  3E9I A;  4WJ4 A;  3GDE A;  1RKN A;  2A6E D;  4ID6 A;  2I5L X;  1GM5 A;  4DV0 Q;  2E2J B;  1DD2 A;  1PZI D;  2IJ0 A;  4A3E G;  3CCR A;  4KD4 A;  1HNW L;  1C0A A;  2F3I A;  2EJM A;  5FO9 B;  2XTI A;  3S16 H;  1I4Q A;  3NSW A;  4CDD C;  4DV3 L;  3DUZ A;  4X64 L;  2UUA Q;  4R4C A;  5FO8 B;  4C3J B;  1D7Q A;  1YJW A;  2NVQ H;  2JSO A;  1ZEQ X;  3A5Z B;  1TXY A;  4K8I A;  1DOK A;  1GUS A;  3T1Y Q;  1U5K A;  2F0W A;  1WD1 A;  3PO3 B;  1VQG A;  2B29 A;  4FF1 A;  1L1O B;  5C4H A;  1F9P A;  1D5M C;  4QIW B;  1E2Z A;  1XNR L;  2OTJ A;  1K73 C;  4ZRZ A;  1HNZ L;  4AQY Q;  3OPO A;  5CBA E;  2YTV A;  4MZ9 A;  1VCI A;  1AH9 A;  3DEO A;  1KQS A;  4JBJ A;  3BVG A;  5EBC A;  1B9M A;  4XYQ A;  4BBS G;  2K5W A;  1RD9 D;  3HOX G;  2E5L Q;  5LHY 1;  5AJ3 L;  1NR2 A;  4XQJ A;  1HHV A;  4LUV A;  4G4K A;  4DA2 A;  1VQ9 A;  3LX0 A;  4CJ2 C;  4L5T A;  1AN8 A;  3NTI A;  2JEB I;  5ELB A;  1MIU A;  2E2H B;  1MD2 D;  1Y1W G;  3PSI A;  1QZH A;  4R8I A;  4YWM A;  1EY5 A;  1EY0 A;  5I9O A;  2X69 A;  2EYL A;  4DK0 A;  3RUZ A;  2R93 B;  5F2D A;  4GNX A;  5M5X H;  1E0B A;  1O7L A;  3CAM A;  4GKK Q;  5E3F A;  3OYY A;  1HR0 L;  2K5Q A;  4QJF A;  2AWO A;  2SNM A;  3SXH A;  2PQE A;  3IKJ A;  4RGO S;  5IGD A;  3J81 i;  4IUT A;  5COY A;  5D14 A;  3D6C A;  2KCC A;  1ZYR D;  1XTC D;  2L11 A;  3PUY A;  2L1B A;  3A8J E;  1FGU A;  5GAH C;  2BOS A;  1PZK D;  3PIO A;  3CC4 A;  3S1M B;  3TP8 A;  3SK8 A;  1FVI A;  2R7Z G;  2K32 A;  3OWF A;  4X62 Q;  3HOY B;  3FHW A;  2MQH A;  2KA7 A;  1EYG A;  3MEF A;  1EFI D;  1STE A;  1HRJ A;  2B63 B;  1Q1E A;  2G5D A;  4A3K G;  5E7N A;  1VQO A;  1FL0 A;  3VA7 A;  3S17 H;  3KJP A;  1T5E A;  1KDC A;  3C1F A;  4LF6 L;  1IBK L;  3MTS A;  5M5Y H;  2BE5 D;  3ONA B;  3E0J A;  5IGF A;  2VXW A;  1K83 H;  2EJF C;  2OTL A;  1PYW D;  1VQL A;  3H3V I;  3GTO B;  4FNF A;  4A75 A;  1WTV A;  4N8X 1;  2IW3 A;  1DCZ A;  1EQV A;  3BZC A;  4JI6 L;  2MPM A;  2JA8 B;  4DAY B;  1F9S A;  3ND8 A;  1AFP A;  3GTJ H;  5M3M B;  5ELF A;  4BY1 B;  1SFO H;  4JI0 Q;  2QDL A;  1Q12 A;  4TRD A;  1QVC A;  4H44 C;  2MGS A;  4X65 Q;  5FJ8 G;  1O7Y A;  1CKO A;  5KRU A;  1KRT A;  3I4M B;  4NDX A;  2UXB L;  2RSO A;  3CRK C;  4XQQ A;  2E8G A;  1TVX A;  3D31 A;  4UDU C;  4A93 B;  1EZ6 A;  2K14 A;  4A3E H;  4OHJ A;  1N34 Q;  4C3H H;  2KHJ A;  4HMI A;  1D2B A;  3R93 A;  2TMP A;  2B2U A;  1Q82 C;  1I50 H;  2B2V C;  3CXC A;  2F0I A;  2ZT9 C;  3MC0 B;  3CHB D;  4IUN A;  4C1N K;  3RNU A;  2ZJR A;  5EAY A;  5CV4 A;  4CDC C;  3BJU A;  3S2H B;  1QOH A;  4M1U B;  1JWU D;  2PNR C;  3J81 c;  2D0P A;  4IOC A;  3DWA A;  4F88 A;  1VQP A;  1C8C A;  4B3S Q;  3QWN A;  3D4R A;  5M3F H;  4KI0 A;  4JI5 Q;  1RHP A;  1O78 A;  4QB4 A;  1PA6 A;  1K28 A;  1B3A A;  2WAQ E;  1EY8 A;  1VQI A;  1G2S A;  1GD7 A;  3H3V H;  4S3S A;  4BBS H;  1ICW A;  1TWF H;  4K6L A;  2F3V A;  2WKD A;  4DR3 L;  3J7Z C;  1YI2 A;  1N32 L;  2V4D A;  3DM3 A;  1HQM C;  2VB3 X;  4DAY A;  1MSH A;  1DYQ A;  1CM9 A;  1RTN A;  1I94 Q;  2HT1 A;  2CWP A;  3MAQ A;  2I0Q A;  1F2L A;  3J7Y W;  3D3R A;  1TQO A;  3OW2 A;  3BVM A;  2UU9 Q;  2KBN A;  3J80 L;  4KHP L;  2YV5 A;  2C35 B;  1HH2 P;  3PIP 3;  1BR9 A;  3M85 A;  2BH2 A;  3CC2 A;  1C9O A;  5IGE A;  5K36 H;  2HDL A;  3GP7 A;  4CJ1 B;  1EY7 A;  4NXN L;  3WOF A;  2HCC A;  3P75 A;  1ET6 A;  3H0G B;  3NQT A;  3QIA A;  5C3E G;  4HAE A;  3O13 A;  3FPP A;  1BO0 A;  1HUM A;  1PFN A;  5DAU A;  1QVF A;  2NVT H;  3CCV A;  4X3U A;  2F0V A;  2JA7 H;  1S5C D;  2R7Z H;  1PVO A;  2GVB A;  3I55 A;  1EYD A;  1RJT A;  4DV5 Q;  4DR4 Q;  3M4O B;  3N52 A;  4DUZ L;  3BS1 A;  1LUZ A;  2JYO A;  3AQQ A;  3HKS A;  2Y0S B;  3VYR A;  3R3O A;  4A3K H;  3C2P A;  1CSQ A;  2Q8T A;  3EJI A;  1KIX A;  1L0Y B;  3FMC A;  1VQC A;  1B70 B;  4LUO A;  3FKI G;  1GXD C;  1PZJ D;  4GLA C;  2IX3 A;  1QCB D;  5C44 G;  4OO1 G;  4DUY Q;  4DV1 Q;  2E74 C;  2HHH Q;  3DMU A;  1CK1 A;  2I07 B;  4DXF A;  3ICE A;  4G7Z C;  3NUC A;  1LLR D;  4PMC A;  4L5S A;  4OGQ C;  5KNB A;  1K9M C;  1LM0 A;  1QZG A;  5FJ8 H;  1V9P A;  1PDQ A;  1TS5 A;  3TQY A;  1HZ9 A;  5M3F B;  1PH3 A;  4R4O A;  1Y69 U;  2KCT A;  1AP0 A;  4P75 A;  5EQ0 A;  1IHZ A;  3NHH A;  1WJJ A;  5I6W A;  1A15 A;  1HZA A;  2XRS D;  4LAA A;  1GHK A;  2F0K A;  2FJ2 A;  1YJN A;  2Q8R E;  1T9H A;  3STB C;  2BDO A;  2R92 G;  2F03 A;  2KOL A;  1JOK A;  3MHB A;  1NMF A;  2PI2 A;  1E2W A;  4XQN A;  4WFN 3;  3G7L A;  1VQ8 A;  3MXG A;  1A2T A;  2K4K A;  3NXW A;  1HJP A;  3QOJ A;  1BOS A;  4IAL A;  4UHV A;  1UE6 A;  3E9H A;  1JB7 A;  1BCP F;  1I3Q B;  2HD3 A;  3HS0 C;  5J3B A;  2WII B;  4DAV A;  3TP7 A;  5M9O A;  4X3K A;  1SRU A;  4A3D B;  1S5B D;  1ILP A;  1B2T A;  1NY4 A;  5C4J H;  2KEC A;  3TS0 A;  4BY7 H;  1TWC B;  3DXJ C;  4JI3 Q;  5CV6 A;  3I56 A;  5GRO A;  3PUW A;  1SE2 A;  1PTO C;  4L5Q A;  2CW0 C;  3GTG H;  2XN9 C;  5KGU A;  4DU9 A;  5HUR A;  4LFB L;  1LTI D;  3I2Z A;  4LF7 L;  1KAA A;  2F0F A;  2ATW A;  4LFC L;  2UUB L;  1CSP A;  5ISR A;  3NEL A;  5C0X G;  1GUN A;  4KHV A;  1O80 A;  4YWL A;  4EQP A;  4C3J G;  1X3E A;  1EYC A;  1BBX C;  2R61 A;  4JI8 Q;  3I90 A;  2KHS A;  2V1C C;  3ITP A;  3R2T A;  2K5N A;  3K6O A;  3IAY A;  5C3E H;  2O4X A;  4WOR A;  3I91 A;  1LTT D;  4KY7 A;  4N8F A;  5EPJ A;  3URY A;  2JA6 B;  3V2T A;  1PH2 A;  4C3I G;  1WTR A;  4RKL A;  5FLX L;  3JAM i;  1PMR A;  4J6H A;  1STA A;  1M4V A;  1TU2 B;  4DR5 Q;  3E5S A;  2XGT A;  5GQO A;  4P74 A;  4HMJ A;  4B3T Q;  1JIC A;  4CKE A;  3RR5 A;  2B2Y A;  4JI4 L;  4ABN A;  2PI2 E;  3KBX A;  3BVZ A;  3D8G A;  1B8A A;  1STN A;  2KCM A;  4A3I G;  3S14 B;  1AW7 A;  1NJI C;  1J5E L;  4DR6 L;  2Z8L A;  5BN4 A;  2R93 G;  2Y0S E;  1LTG D;  2IX0 A;  3HKZ G;  5G3L D;  4IUR A;  1ENF A;  1HCZ A;  1VS0 A;  5I2Y A;  4KKS A;  1VF5 C;  2CQO A;  4YIJ A;  3I4N H;  4HR7 B;  5C44 H;  2SNS A;  4I65 A;  2VW9 A;  5KNC A;  4XTC S;  1ZKO A;  5IWA L;  4DR2 Q;  1TWH H;  3V96 A;  4AYB G;  3S1R B;  2F0Q A;  5BR8 Q;  3K5L A;  1DGS A;  1BKB A;  4LFA L;  3HG9 A;  1PFS A;  4A3G B;  4RFB A;  1IL2 A;  3I73 A;  3GTL H;  2I5M X;  4YCW A;  5KND A;  2PW7 A;  1BCP C;  1WCM H;  5C0X I;  4GZY C;  1Z6H A;  1I4P A;  2NN6 H;  4AH6 A;  3CU7 A;  1MBY A;  4IFD H;  2Z6K C;  1SNQ A;  2B63 G;  3RD4 A;  4BY7 B;  2JJQ A;  3N6R A;  4U67 3;  1IYJ B;  1XTD A;  1NAP A;  1CZG A;  3G6J B;  2F0N A;  4C56 C;  1RTO A;  3S2D H;  1V43 A;  3F1Z A;  4IZ8 A;  3BDC A;  5FLM H;  2CCZ A;  1W2B A;  4HED A;  1E1O A;  1FGB D;  1CQF A;  1HUN A;  3HRZ C;  1F2Z A;  4NXM L;  1QJO A;  5IYB H;  1HTL D;  4GKJ L;  2JA9 A;  3HOZ G;  2L5T A;  1IYU A;  1EY6 A;  3MA2 B;  3AEV A;  2VY3 A;  3RZD H;  1WD0 A;  1XX8 A;  2ZM6 L;  2QGQ A;  2QEJ C;  2VUM B;  1PTO H;  1SRO A;  3NWT A;  3EBE A;  1PXU A;  3VDY A;  1JE4 A;  1ET9 A;  1STY A;  3P20 A;  4PG3 A;  4H7B A;  4RH6 A;  4OWX B;  3UDI A;  4BWG B;  2RHQ B;  5J1Z A;  2EY5 A;  1SR3 A;  4DAP A;  2E2I H;  3K7A B;  2JK8 A;  3IRB A;  4QUF A;  1LAC A;  3H09 A;  3T1H Q;  2F0J A;  2IT1 A;  1FJG Q;  1LV9 A;  2Q2H A;  1NUC A;  4KN7 C;  1N9W A;  4ZK9 B;  5C0X H;  5JPN C;  4B3M L;  4JI7 L;  4HID A;  3KUP A;  3DEP A;  1I6V C;  4A3B H;  1PRT C;  4R4T A;  4N9P A;  5DM7 3;  3GQB A;  2B2T A;  1HNW Q;  4DKA C;  1H9S B;  1X3Q A;  2LMC B;  3A7L A;  4DV3 Q;  3ND9 A;  3MVV A;  3HOW B;  1XMQ L;  3TP6 A;  3EVQ A;  3CMA A;  2KHI A;  4C3I H;  2EYP A;  2F3W A;  4IOA A;  2L55 A;  5BN5 A;  4FO2 A;  3I4N B;  5C4X G;  2M2L A;  3OTO L;  3KLW A;  4PMW A;  1YHA A;  3T4A C;  1PHJ A;  1SYB A;  1HNZ Q;  4DN4 M;  1V1P B;  3GV6 A;  1QG7 A;  5I6Y A;  3U9O A;  1ROD A;  1IBL Q;  4FXG C;  5DLQ E;  1HA6 A;  1X55 A;  4R8N A;  5CV9 A;  4EQO A;  5IT9 c;  5LMN L;  3HOV G;  1EOV A;  1IW7 C;  4DR7 L;  1PFM A;  4A3I H;  2CQA A;  3S15 H;  3NK9 A;  2F0H A;  4IPG A;  1II3 A;  4NP5 A;  1LYL A;  1WCM B;  4RG1 A;  3Q24 A;  1HR0 W;  1EWH A;  2K28 A;  2WB1 B;  4RCN A;  2PW5 A;  1YEZ A;  1Y1V G;  2NVX H;  3CPF A;  1ESR A;  3B6Y A;  3STB D;  4K8J A;  3H0G G;  3PUZ A;  3H15 A;  2RDF A;  1I6H B;  3GTM H;  4IFD J;  4GLX A;  3KYH C;  5EBD A;  4UY8 C;  4JOI C;  4JCV E;  1HFN A;  3X3N A;  4DXG A;  2FXQ A;  4B08 A;  2RDH A;  2DJG C;  1KXL A;  3FRP B;  1A62 A;  4O2D A;  2G9D A;  2ID0 A;  3NEN A;  1N33 L;  4RGM A;  4JC0 A;  3HOU G;  4LF9 Q;  2R7D A;  5EKL A;  2SOB A;  1X9N A;  2QKI C;  5NUC A;  1XPO A;  1D1K A;  4LF8 Q;  1PTO B;  1Z9F A;  2K33 A;  1LTB D;  2AKW B;  4YHH Q;  2QF7 A;  4GOP C;  1ICF B;  2JA5 G;  4CDE C;  1ASZ A;  1PTO D;  1U9R A;  1VQH A;  1V1P A;  3ULJ A;  1YNN C;  2WAQ B;  1WTX A;  1D8L A;  2NVY B;  3RN5 A;  2BA0 A;  2VQF Q;  3CPW A;  5IGC A;  4DK6 C;  3PQI A;  3GTQ H;  1X6O A;  3HOZ H;  1VQK A;  4FF2 A;  2J0T D;  3RLO A;  2EY6 A;  2EOT A;  1O7I A;  4LF5 Q;  1KLU D;  3M4P A;  1TWA H;  1U4R A;  4RAU C;  1HNX Q;  2UUC Q;  5ELE A;  5C0X J;  2LS0 1;  3R8B A;  4MNO A;  1M90 C;  3H3V C;  2NZH A;  3NQI A;  1WTH A;  1Q81 C;  3M3Y B;  5C4Z A;  5CC4 A;  1ONL A;  1FYC A;  1YIT A;  5EGT A;  4LK1 C;  4BBR G;  3AFQ A;  2E76 C;  2A1A A;  1X56 A;  1X32 A;  2UXC L;  3C1E A;  3KFU A;  1JJC B;  3PIP A;  2VQE Q;  3RLF A;  3J80 E;  4CGY B;  2RKS A;  4ME3 A;  3SVM A;  2M00 A;  4A3M B;  2WIN B;  5D65 A;  3K57 A;  2D0O A;  4A3J H;  5CBE E;  3GTK H;  1YIJ A;  2F0P A;  4GS3 A;  4EGV A;  1RDP D;  1GUW A;  2JQO A;  2OCE A;  1DM0 B;  4P72 A;  3I4L A;  3L9A X;  4CBV A;  1CHQ D;  2LKV A;  3T56 B;  2YTY A;  3CCJ A;  1CQV A;  2AQ3 B;  2H5X A;  2PYK A;  4YY3 L;  1XXG A;  2O5J C;  5ELC A;  1S5E D;  2WKC A;  4HJ5 A;  4DV7 L;  1L1O A;  3PO2 B;  5C4X H;  2K6A A;  3OSO A;  2FFK B;  2KVM A;  4BS9 A;  5IYD G;  4IPH A;  4DV0 L;  1B1Z A;  4A3F B;  4G57 A;  3MZ5 A;  3KLR A;  5IGG A;  1TWG B;  2K05 A;  3EIV A;  1J6Q A;  1Q1B A;  1ILQ A;  4R1J A;  5CV8 A;  4OWT B;  2Z9H A;  3KF8 B;  2TSS A;  5JEA G;  3HOV H;  3T13 A;  4A3L H;  4DNT B;  2UUA L;  4POG A;  4L5R C;  4X66 L;  4G7O C;  1JOR A;  4ODG A;  4POF A;  2ASB A;  1NTG A;  3T1Y L;  2EY1 A;  2MUY A;  3S16 B;  1EQQ A;  4FVM A;  1TS3 A;  2NYZ D;  3SK4 A;  2A68 C;  1R9T H;  2Z6B A;  3CCL A;  4AQY L;  5EJW A;  1HZB A;  1SNM A;  3OHX C;  2NVQ B;  1N8R C;  2F0D A;  2WB1 E;  4IJL A;  2H1E A;  1QUQ B;  4ZCK A;  2RCF A;  2E5L L;  2DY7 A;  2WAC A;  4E6I A;  2ZXR A;  2CKZ B;  4DF7 A;  4NXN Q;  2HIV A;  2PQA B;  3MFY A;  5JJI A;  3TME A;  1A2U A;  2B2W C;  4DV4 Q;  1IBM Q;  1I5F A;  3HOU H;  1B4O A;  3SE0 A;  4IUU A;  1KLG D;  2F4V Q;  2A5H A;  1B9N A;  5EKK A;  3QB3 A;  1E24 A;  2JE6 I;  4DV2 L;  3EFX D;  5IE8 A;  4CKB A;  1YNJ D;  3WDN A;  3U58 A;  1NR4 A;  2L0C A;  4GKK L;  3MFG A;  2JA5 H;  3MXN B;  1QE6 A;  3HFZ B;  3F2U A;  4OEL B;  3KF8 A;  3CCQ A;  1L0X B;  3A0J A;  2A69 C;  3KLS X;  2F0L A;  4K6D A;  2RVL A;  5M5X B;  1AE3 A;  3IFD A;  3Q6S A;  3G6E A;  1F9R A;  4LF4 Q;  4V19 0;  2EYM A;  3NBH B;  4ZKC B;  3JAM L;  3Q0A A;  2CWA A;  3HOX H;  3UE0 A;  1XNQ Q;  1AEX A;  3R2I A;  1YVC A;  4A3J B;  1OO9 B;  3UDG A;  4BXX G;  4X62 L;  1EQT A;  3I70 A;  3RN2 A;  1Y1W H;  3A74 A;  1GVP A;  2WP8 J;  1YNX A;  1UE5 A;  1QUQ A;  1LT5 D;  2MO1 A;  5CYU A;  5T1I A;  4FXK C;  3PMF A;  1G6P A;  1Q86 C;  4X3T A;  2ICI A;  2PQA A;  2NTS A;  5C5M A;  5FKA C;  1RL2 A;  4C2M H;  3H91 A;  3VR2 A;  1L2F A;  3W1G A;  4JBW A;  2B8F A;  3FDT A;  1BDO A;  1LT6 D;  1U0L A;  5LMU Q;  3S17 B;  1F9Q A;  3NE5 B;  2N78 A;  3CKI B;  2QEX A;  2BDN A;  5C6A A;  5M5Y B;  2CHB D;  1SYG A;  5FLX E;  3MXN A;  4JI0 L;  1K83 B;  1B50 A;  3A8I E;  4X65 L;  1N36 Q;  5CMD A;  2ZTE A;  3CRL C;  1KDB A;  1B44 D;  2IL8 A;  1SYF A;  3W5O A;  3K80 C;  1XMO Q;  2A19 A;  3GTJ B;  1PH6 A;  1NCV A;  1SFO B;  2Q2U A;  3OWE B;  1GKH A;  4JBK A;  5IY0 A;  5JEA H;  5J39 A;  4QMG A;  3WOE A;  3PUV A;  1EU4 A;  1KRS A;  1S5D D;  2OT2 A;  3I4O A;  2ZJQ A;  1JC7 A;  1ESF A;  4A3E B;  4C3H B;  4NB3 A;  4B3S L;  2FIN B;  1I50 B;  4L6T B;  1XPU A;  4JI5 L;  1EY4 A;  5IP7 G;  1I4X A;  1YZ6 A;  2F1M A;  4DR1 Q;  3KJO A;  5IP9 G;  1A6X A;  3DWP A;  4LFC Q;  1X3G A;  5D3D A;  1JJG A;  4F7X A;  4CHT B;  2KCN A;  2YTX A;  1C4Q A;  4IUV A;  1TR5 A;  4I7A A;  3QO2 A;  4J8Q A;  1GUO A;  1PFB A;  4TVA B;  4F87 A;  3X3M A;  4DK3 C;  3G4S A;  1SNO A;  2AMC B;  2EZV A;  3Q8D A;  4FDB A;  2YU9 H;  3KBG A;  2O5I C;  4OON A;  5CV5 A;  4UAI A;  1SYC A;  1I94 L;  2DGY A;  2IHE A;  4BBS B;  1TWF B;  3I3C A;  4HIM A;  4LW1 A;  5A35 A;  2UU9 L;  1EIH A;  1OXS C;  3ER0 A;  3BDO A;  1O7Z A;  3LWU A;  4EQ5 A;  5EPL A;  3GTP H;  1G29 1;  1I4R A;  3J7A F;  1MHW C;  3QR8 A;  5E1F A;  3J81 E;  1TY2 A;  3MXU A;  3MWY W;  3CQZ H;  2HQL A;  2ZTC A;  1D5X C;  3U50 C;  2RDG A;  4AIM A;  5E4W C;  1P16 A;  1MJE A;  5JAV A;  5I2X A;  3LNN A;  2E2D C;  4FP5 D;  3JC6 6;  5E4X A;  1QWY A;  1UWV A;  2A6E C;  1PV4 A;  5IYC G;  2A8V A;  5HY6 A;  4DV5 L;  4DR4 L;  2P5Z X;  2A73 B;  4TQU S;  1GJX A;  5EKI A;  5K5P A;  1Q90 A;  2NVT B;  5FK9 C;  4GNX C;  4LFA Q;  1P8L A;  2JA7 B;  3J81 j;  2R7Z B;  2IHF A;  3TS2 A;  4TKO B;  4OO1 I;  5I9P A;  1HXY D;  2K1B A;  4OL7 A;  1Y14 B;  3K5N A;  2F0U A;  2EPB A;  1AZQ A;  1UUP A;  1F77 A;  4DK1 A;  4A3K B;  1KHI A;  4JI2 Q;  1WTW A;  3PO3 G;  3SDZ A;  2WAQ G;  1E3P A;  2SDF A;  4DUY L;  4UP9 A;  4DV1 L;  4DV6 Q;  2HHH L;  1PLF A;  1PH4 A;  2F0E A;  2DJF C;  3PGZ A;  2L9H A;  3S1Q H;  5JEA J;  4OX9 Q;  1SAP A;  4LWC A;  4ULL A;  3OIQ A;  2BH8 A;  4YCU A;  5T1G A;  2K5H A;  3D4D A;  4B3R L;  1S72 A;  3QOL A;  3OOC A;  1CT1 D;  1S5F D;  3TEH B;  5JJL A;  1CKN B;  1UNS A;  1ZXT A;  2A68 D;  5FO7 B;  1K0S A;  5LL6 X;  1SDF A;  3C46 A;  1E1T A;  3KDF B;  3OW7 A;  4UP7 A;  4KKT A;  1I4H A;  3RZO H;  1LTS D;  2EDG A;  5DM6 3;  1B7Y B;  3IFT A;  3S1N H;  1VQN A;  3FKI H;  4NW2 A;  4K0K Q;  3VR4 A;  1SNP A;  1VQM A;  1QIL A;  4A3M G;  1SSO A;  1STH A;  3L3O C;  2RCN A;  3CP0 A;  4LUZ A;  4OO1 H;  4Y7N H;  2IPK D;  2K01 A;  1EWC A;  3K7U C;  1QVG A;  4JV5 Q;  1ZYR C;  4DAM A;  2KEE A;  3VYT A;  4V0B A;  4HIK A;  4JI7 Q;  2WV6 D;  2F52 A;  4JI3 L;  1STG A;  2L4N A;  4A3C G;  3DM1 A;  3I72 A;  3P1H A;  1EL0 A;  5EPK A;  3H94 A;  2Q2T A;  1XWE A;  3HOY G;  2B2U C;  1JWS D;  1X3F A;  1D1I A;  3AFP A;  1HPC A;  1A0I A;  2PZT A;  2R92 H;  1ASY A;  1SLJ A;  5C4J B;  2EXD A;  5A2Q E;  5COR A;  3ZYY X;  5LMN W;  3BDL A;  5JOB A;  1FD7 D;  4PMB A;  2RHS B;  4H02 A;  3GTG B;  1PH5 A;  2C9O A;  2D2C C;  3LWE A;  4JI8 L;  4IUP A;  1PYS B;  2PZU A;  3UI2 A;  2UXD Q;  1JOQ A;  2MP1 A;  3KDF A;  3J81 L;  4OEM B;  3NPP A;  2DNC A;  3I8Z A;  1H9J A;  2JA8 G;  1VF7 A;  1EU3 A;  5IGB A;  1LAB A;  2B2V A;  2ZXP A;  2FMC A;  3CW2 C;  1PYB A;  5M3M G;  4BY1 G;  2EVB A;  4DR5 L;  1HTP A;  1WTP A;  3V05 A;  2D62 A;  5C3E B;  4B3T L;  3BYT B;  3L0O A;  5GAG C;  3I4M G;  2B8G A;  1NSN S;  2R3Z A;  3M9B A;  3UDX A;  2HDM A;  2E2J H;  2VZA A;  1G51 A;  3E3X A;  4A93 G;  1EY9 A;  3W2D A;  2JP1 A;  4JI1 L; 
#chains in the Genus database with same CATH homology
 1CFM A;  1U4P A;  2CVR A;  1V8Q A;  3D4W A;  2J7Z A;  5C3W A;  4ILW A;  2QIL A;  4Q0F A;  1EOT A;  3MEH A;  1MI2 A;  2PO4 A;  2EY2 A;  1QNU A;  2XIW A;  4N9T A;  3GO5 A;  1W6J A;  5DEH A;  3TSS A;  1SEB D;  2DY8 A;  3K5O A;  1OXV A;  4ZQ3 A;  5C44 B;  4Y7N B;  2KED A;  2AUJ D;  3BG3 A;  1TWH B;  2EYJ A;  3K0Y A;  5DNF A;  3GTL B;  1H9K A;  1UEA B;  1FNV A;  2K03 A;  5IOC A;  2Z4I A;  4DGZ A;  3BYY B;  5KEE A;  5JVH 3;  2L12 A;  2F0M A;  3IL8 A;  4XT1 B;  3S2D B;  3SEB A;  1RCV D;  1TS4 A;  2NWG A;  1TKW B;  1H9S A;  3A7A B;  4KTA A;  2QDB A;  4XT3 B;  3SHL A;  2H4O A;  1A3T A;  3ERO A;  4HSV A;  3RZD B;  4PV1 C;  4RGN A;  2B39 A;  3SK6 A;  2I46 A;  3AU7 A;  1G2T A;  5A2Q L;  4KJN A;  1KAB A;  3E6Z X;  4KK7 A;  1SYE A;  5JPM C;  2E2I B;  4K14 A;  2CW0 D;  1V1O A;  1GHJ A;  4B9X A;  2AQ1 B;  4HTH A;  4ME5 A;  3M4Y A;  2ENB A;  4C3H G;  1LTA D;  1JB3 A;  4HN7 A;  3JAM E;  1SND A;  2NZ1 D;  4L8J A;  2NBF A;  2AQ2 B;  2DN8 A;  1TS2 A;  4A3B B;  1U4L A;  2R6G A;  2XWB B;  4C1N I;  4KN4 C;  5CV7 A;  5G3L F;  4C3I B;  3VR3 A;  1R4P B;  4IUQ A;  1DOM A;  3PV0 A;  1KDA A;  1SE3 A;  3NWS A;  4WJW A;  1KNE A;  3NTK A;  2XNA C;  2X6L A;  4KJO A;  1EEF D;  2NB0 A;  1CHP D;  1S4Z A;  3T51 B;  2EYF A;  4A3I B;  3S15 B;  2HCI A;  1I4G A;  2NUC A;  4RWS C;  3HKZ B;  2FMM A;  1J9O A;  3HGB A;  5K36 G;  4QF4 A;  2NVX B;  1E2V A;  4P2C B;  2B2Y C;  1TY0 A;  2N88 A;  3MXP A;  1TII D;  3GTM B;  4AYB B;  5JJZ A;  2PPB C;  1BCP B;  1VMP A;  3KK7 A;  1Z7T A;  5IT9 E;  1DON A;  1STB A;  1BF4 A;  5FOB B;  1BCP D;  1DZ1 A;  4RHR A;  1EYA A;  2RSN A;  1CI3 M;  1R4Q B;  2YYZ A;  4Z9C B;  2K5D A;  3SK5 A;  4FYD A;  4TSS A;  1MGS A;  5HGT A;  1IYV A;  1T5X D;  1MSG A;  3A54 A;  2OEO A;  1SYD A;  2JEA I;  3GTQ B;  3HOZ B;  2PMZ B;  1TT2 A;  1RF2 D;  2IWH A;  4EVO A;  1TWA B;  1QB5 D;  4ZYS A;  1WVL A;  1Y8N B;  1EZ8 A;  3TZD A;  2ZXO A;  3T53 B;  3A55 A;  1FNU A;  1PRT B;  1IKL A;  1CA6 A;  1BQQ T;  3GTK B;  1PRT D;  4X3S A;  4NKL A;  3RMH A;  4K2L A;  1Y8O B;  2RA4 A;  3HP3 A;  5TSS A;  4HCE A;  2J4X A;  5CGK A;  4DNR B;  3U9S A;  4OIJ A;  3AMU A;  1FNW A;  4KY6 A;  4LJZ C;  5C4X B;  1K8M A;  2OF1 A;  4CKC A;  2C5C A;  1ENA A;  1JCK B;  2B2T C;  1FR3 A;  4MIU A;  4FF3 A;  3HOV B;  3KLS A;  5C5L A;  1IW7 D;  5CR3 A;  4IQZ A;  3W3A A;  1SBB B;  4U68 A;  4KV6 A;  1H9M A;  1BXT A;  3D6W A;  1Y1V B;  2F0T A;  3GD7 A;  2Q8I B;  3NP8 A;  1R9T B;  2XWJ B;  1OXX K;  1PTO F;  3AB9 A;  4BA2 I;  1SJE D;  3NBH A;  4ZUI A;  1DJR D;  4J1M A;  4B9W A;  4MN3 A;  1G6Z A;  1QNK A;  2A6H C;  5IT9 L;  3PIO 3;  2IX1 A;  3P7J A;  3HOU B;  1BUV T;  3C3L A;  4O42 A;  4M8A A;  4XXE A;  4BA1 I;  3BZD B;  1IKM A;  1M8A A;  5LL6 S;  1UAP A;  5AFW A;  1G91 A;  3EQL C;  2JA5 B;  2F4I A;  2VNU D;  4RGT A;  3HEJ A;  1YNN D;  4RKB A;  4QCL A;  1HFG A;  3EA6 A;  1CTM A;  4H13 C;  3HOX B;  3J7A V;  1A3V A;  1Y1W B;  3K59 A;  4BBR B;  2NN6 G;  2HUG A;  4F8M A;  1U4M A;  1F2M A;  2ICE C;  4KHZ A;  4O1N A;  3QG1 A;  4MHE A;  3M7N A;  4IFD G;  4JK1 C;  3PUX A;  4C2M B;  1SMY C;  1DXM A;  2LFN A;  3VR6 A;  4G7H C;  1A3U A;  2A74 C;  1JWM D;  3S9W A;  3SR1 A;  3TP5 A;  1VMC A;  4OIK A;  3GV3 A;  2VB2 X;  1B53 A;  2EYO A;  3HZX A;  2FHT A;  4RCO A;  4IN3 A;  4CJ0 B;  1GUG A;  2XVS A;  2RBM A;  2NTT A;  3T16 A;  5I4D A;  4HCS A;  1SE4 A;  2GA4 B;  5ELD A;  1EEI D;  1LT4 D;  2RQX A;  1LTR D;  4QUC A;  2EJG C;  1HA5 A;  5D3I B;  4RA8 A;  4ZUJ A;  1EIG A;  4WRD A;  3OMC A;  3K58 A;  2NN6 I;  4XIG S;  3TDQ A;  4KD3 A;  4XDX A;  4IFD I;  1GUT A;  2YU9 B;  4L63 B;  2JXM B;  3OIP A;  2BCO A;  1SNC A;  3M7G A;  1PRT F;  2AWN A;  2EXZ A;  4RHS A;  5JVG 3;  4FXD A;  4K5X A;  1Q8I A;  1C48 A;  4EQN A;  2G9H D;  2KJX A;  4PNY A;  3DHQ A;  3GTP B;  2X6G A;  2EE1 A;  2BA1 A;  2HQE A;  2F0G A;  1BNZ A;  3CQZ B;  4K5W A;  5M5W B;  2PCF B;  2F0O A;  2A69 D;  2XSC A;  1F2Y A;  2KQ3 A;  1WTQ A;  2DNE A;  2E75 C;  1LT3 D;  2XRQ D;  5KYL A;  4KKU A;  4ZLT F;  2BE5 C;  4PQX A;  4KMU C;  4KY5 A;  2MJ8 A;  2O2L D;  4K2K A;  3FEW X;  3H6M A;  3Q22 A;  1J8I A;  1JQY D;  2B2W A;  3Q23 A;  1D5Z C;  1GOZ A;  1H9R A;  1AZP A;  2PZW A;  5KYI A;  3OMG A;  3L7Z C;  1SJH D;  1Z47 A;  3TN2 A;  1XYI A;  5IIF A;  2QCP X;  3S1Q B;  1KTK A;  1OXU A;  5KIX A;  4DFA A;  3TZU A;  2MHV A;  3A8K E;  3A56 A;  1YNJ C;  2AUK A;  1OXT A;  1LO5 D;  4I7Z C;  4ZKB B;  2N55 A;  1VDZ A;  3RZO B;  2KUM A;  1DOL A;  3S1N B;  2A6H D;  3FKI B;  3VR5 A;  3VA5 A;  1HQR D;  5IOD A;  3QJY A;  1ML0 D;  4ZAI A;  1Y8P B;  3DWQ A;  1CA5 A;  3ERQ A;  1D6E C;  1G8Z D;  3NTH A;  1X3P A;  1SXT A;  1IL8 A;  2Z4H A;  2SEB D;  1CZW A;  3TBI B;  3NBI A;  2D9U A;  4H0L C;  4K5V A;  3FPU B;  1Q3L A;  4Q5V A;  2R92 B;  5C3X A;  3VYS A;  1ENC A;  1KNA A;  4FF4 A;  1JR0 D;  4HSP A;  2OXP A;  4LMQ D;  3K5M A;  2F0S A;  2EYH A;  2K7V A;  3FVQ A;  1JOO A;  4NMZ A;  1WTO A;  2K04 A;  5BN3 A;  1K8O A;  2M9V A;  2Z1C A;  1SMY D;  2D5D A;  2LY7 A;  4XYO A;  5J22 A;  1W6K A;  4R9W A;  3VYU A;  1RKN A;  2A6E D;  4ID6 A;  2E2J B;  1DD2 A;  1PZI D;  2IJ0 A;  4KD4 A;  2EJM A;  5FO9 B;  1I4Q A;  3NSW A;  3DUZ A;  5FO8 B;  4C3J B;  2JSO A;  1ZEQ X;  4K8I A;  1DOK A;  1GUS A;  2F0W A;  1WD1 A;  3PO3 B;  4FF1 A;  5C4H A;  1F9P A;  1D5M C;  4QIW B;  1E2Z A;  4ZRZ A;  3OPO A;  5CBA E;  1VCI A;  3DEO A;  3BVG A;  5EBC A;  1B9M A;  4XYQ A;  2K5W A;  1RD9 D;  5LHY 1;  1NR2 A;  4XQJ A;  1HHV A;  4G4K A;  4DA2 A;  3LX0 A;  4CJ2 C;  1AN8 A;  3NTI A;  2JEB I;  5ELB A;  2E2H B;  1MD2 D;  4R8I A;  1EY5 A;  1EY0 A;  5I9O A;  2X69 A;  2EYL A;  4DK0 A;  3RUZ A;  2R93 B;  5F2D A;  1E0B A;  1O7L A;  5E3F A;  2K5Q A;  2AWO A;  2SNM A;  3SXH A;  2PQE A;  3IKJ A;  4RGO S;  5IGD A;  4IUT A;  5COY A;  5D14 A;  2KCC A;  1ZYR D;  3D6C A;  1XTC D;  2L11 A;  3PUY A;  2L1B A;  3A8J E;  2BOS A;  1PZK D;  3S1M B;  3TP8 A;  3SK8 A;  2K32 A;  3OWF A;  3HOY B;  2KA7 A;  1EFI D;  1STE A;  1HRJ A;  2B63 B;  1Q1E A;  3VA7 A;  1T5E A;  1KDC A;  3C1F A;  3MTS A;  2BE5 D;  3ONA B;  3E0J A;  5IGF A;  2VXW A;  2EJF C;  1PYW D;  3GTO B;  4FNF A;  1WTV A;  2IW3 A;  1DCZ A;  1EQV A;  2MPM A;  2JA8 B;  1F9S A;  3ND8 A;  1AFP A;  5M3M B;  5ELF A;  4BY1 B;  4TRD A;  1Q12 A;  4H44 C;  2MGS A;  1O7Y A;  5KRU A;  3I4M B;  4NDX A;  2RSO A;  3CRK C;  4XQQ A;  1TVX A;  3D31 A;  4UDU C;  4A93 B;  1EZ6 A;  4OHJ A;  4HMI A;  1D2B A;  3R93 A;  2TMP A;  2B2U A;  2B2V C;  2F0I A;  2ZT9 C;  3MC0 B;  3CHB D;  4IUN A;  4C1N K;  5CV4 A;  3S2H B;  1QOH A;  4M1U B;  1JWU D;  2PNR C;  3DWA A;  4F88 A;  1C8C A;  3QWN A;  3D4R A;  4KI0 A;  1RHP A;  1O78 A;  4QB4 A;  1B3A A;  1EY8 A;  1G2S A;  4S3S A;  1ICW A;  4K6L A;  2F3V A;  2WKD A;  2V4D A;  1HQM C;  2VB3 X;  4DAY A;  1MSH A;  1DYQ A;  1CM9 A;  1RTN A;  3MAQ A;  1F2L A;  3J7Y W;  3D3R A;  1TQO A;  3BVM A;  3J80 L;  3PIP 3;  3M85 A;  1BR9 A;  5IGE A;  5K36 H;  2HDL A;  3GP7 A;  4CJ1 B;  1EY7 A;  3WOF A;  2HCC A;  3P75 A;  1ET6 A;  3H0G B;  3NQT A;  3QIA A;  4HAE A;  3O13 A;  3FPP A;  1BO0 A;  1HUM A;  1PFN A;  5DAU A;  4X3U A;  2F0V A;  1S5C D;  1EYD A;  1RJT A;  3M4O B;  3N52 A;  3BS1 A;  2JYO A;  2Y0S B;  3VYR A;  3R3O A;  3C2P A;  2Q8T A;  3EJI A;  1L0Y B;  3FMC A;  1GXD C;  1PZJ D;  2IX3 A;  1QCB D;  4OO1 G;  2E74 C;  3DMU A;  1CK1 A;  2I07 B;  4DXF A;  4G7Z C;  3NUC A;  1LLR D;  4PMC A;  4OGQ C;  5KNB A;  1PDQ A;  1TS5 A;  5M3F B;  1Y69 U;  1AP0 A;  5EQ0 A;  1IHZ A;  3NHH A;  5I6W A;  1A15 A;  2XRS D;  4LAA A;  1GHK A;  2F0K A;  2FJ2 A;  2Q8R E;  2BDO A;  2F03 A;  2KOL A;  1JOK A;  3MHB A;  1E2W A;  4XQN A;  4WFN 3;  3G7L A;  3MXG A;  1A2T A;  3NXW A;  3QOJ A;  1BOS A;  4IAL A;  1BCP F;  1I3Q B;  3HS0 C;  2WII B;  4DAV A;  3TP7 A;  5M9O A;  4X3K A;  4A3D B;  1S5B D;  1ILP A;  1B2T A;  2KEC A;  1TWC B;  3DXJ C;  5CV6 A;  3PUW A;  1SE2 A;  1PTO C;  2CW0 C;  2XN9 C;  5KGU A;  4DU9 A;  5HUR A;  1LTI D;  1KAA A;  2F0F A;  5ISR A;  5C0X G;  1GUN A;  4KHV A;  1O80 A;  4EQP A;  4C3J G;  1EYC A;  1BBX C;  2R61 A;  3I90 A;  2KHS A;  3ITP A;  3R2T A;  3K6O A;  3IAY A;  2O4X A;  4WOR A;  3I91 A;  1LTT D;  4KY7 A;  5EPJ A;  3URY A;  2JA6 B;  3V2T A;  4C3I G;  1WTR A;  4RKL A;  5FLX L;  1PMR A;  4J6H A;  1STA A;  1M4V A;  1TU2 B;  3E5S A;  4HMJ A;  1JIC A;  4CKE A;  2B2Y A;  4ABN A;  3KBX A;  3BVZ A;  3D8G A;  1STN A;  3S14 B;  1AW7 A;  2Z8L A;  5BN4 A;  1LTG D;  2IX0 A;  5G3L D;  4IUR A;  1ENF A;  1HCZ A;  5I2Y A;  4KKS A;  1VF5 C;  4YIJ A;  4HR7 B;  2SNS A;  4I65 A;  5KNC A;  4XTC S;  1ZKO A;  3V96 A;  3S1R B;  2F0Q A;  3K5L A;  3HG9 A;  4A3G B;  4RFB A;  3I73 A;  5KND A;  2PW7 A;  1BCP C;  5C0X I;  4GZY C;  1Z6H A;  1I4P A;  2NN6 H;  3CU7 A;  1MBY A;  4IFD H;  1SNQ A;  3RD4 A;  4BY7 B;  4U67 3;  3N6R A;  1NAP A;  1CZG A;  3G6J B;  2F0N A;  4C56 C;  1RTO A;  1V43 A;  4IZ8 A;  3BDC A;  4HED A;  1FGB D;  1CQF A;  1HUN A;  3HRZ C;  1F2Z A;  1QJO A;  1HTL D;  2L5T A;  1IYU A;  1EY6 A;  3MA2 B;  1WD0 A;  1XX8 A;  2QEJ C;  2VUM B;  1PTO H;  3NWT A;  1PXU A;  1JE4 A;  1ET9 A;  1STY A;  3P20 A;  4H7B A;  4RH6 A;  4BWG B;  5J1Z A;  2EY5 A;  4DAP A;  3K7A B;  4QUF A;  1LAC A;  3H09 A;  2F0J A;  2IT1 A;  1LV9 A;  1NUC A;  4KN7 C;  4ZK9 B;  5C0X H;  5JPN C;  3KUP A;  3DEP A;  1I6V C;  1PRT C;  4N9P A;  5DM7 3;  3GQB A;  2B2T A;  1H9S B;  1X3Q A;  2LMC B;  3A7L A;  3ND9 A;  3MVV A;  3HOW B;  3TP6 A;  3EVQ A;  2EYP A;  2F3W A;  2L55 A;  5BN5 A;  4FO2 A;  3I4N B;  2M2L A;  4PMW A;  3T4A C;  1SYB A;  4DN4 M;  1V1P B;  3GV6 A;  1QG7 A;  5I6Y A;  3U9O A;  1ROD A;  4FXG C;  1HA6 A;  4R8N A;  5CV9 A;  4EQO A;  1IW7 C;  1PFM A;  2CQA A;  3NK9 A;  2F0H A;  1II3 A;  4NP5 A;  1WCM B;  3Q24 A;  1EWH A;  2K28 A;  2WB1 B;  4RCN A;  2PW5 A;  1ESR A;  4K8J A;  3PUZ A;  2RDF A;  1I6H B;  4IFD J;  5EBD A;  1HFN A;  3X3N A;  4DXG A;  4B08 A;  2RDH A;  3FRP B;  2G9D A;  2ID0 A;  4RGM A;  5EKL A;  2SOB A;  2QKI C;  5NUC A;  1D1K A;  1PTO B;  2K33 A;  1LTB D;  2QF7 A;  1PTO D;  1U9R A;  1V1P A;  1YNN C;  2WAQ B;  1WTX A;  2NVY B;  2BA0 A;  5IGC A;  4FF2 A;  2J0T D;  2EY6 A;  2EOT A;  1KLU D;  1U4R A;  4RAU C;  5ELE A;  5C0X J;  2LS0 1;  3R8B A;  3H3V C;  3NQI A;  3M3Y B;  5C4Z A;  5CC4 A;  1ONL A;  1FYC A;  5EGT A;  4LK1 C;  2E76 C;  1X32 A;  3C1E A;  3RLF A;  3J80 E;  4CGY B;  2RKS A;  3SVM A;  2M00 A;  4A3M B;  2WIN B;  5D65 A;  3K57 A;  5CBE E;  2F0P A;  4EGV A;  1RDP D;  1GUW A;  1DM0 B;  3I4L A;  3L9A X;  4CBV A;  1CHQ D;  2LKV A;  3T56 B;  1CQV A;  2AQ3 B;  2PYK A;  1XXG A;  2O5J C;  5ELC A;  1S5E D;  2WKC A;  3PO2 B;  2K6A A;  3OSO A;  2FFK B;  2KVM A;  4BS9 A;  4A3F B;  1B1Z A;  4G57 A;  3MZ5 A;  3KLR A;  5IGG A;  1TWG B;  2K05 A;  1Q1B A;  1ILQ A;  5CV8 A;  2TSS A;  5JEA G;  3T13 A;  4DNT B;  4G7O C;  1JOR A;  4ODG A;  2EY1 A;  2MUY A;  3S16 B;  4FVM A;  1TS3 A;  2NYZ D;  3SK4 A;  2A68 C;  5EJW A;  1SNM A;  3OHX C;  2NVQ B;  2F0D A;  2H1E A;  2DY7 A;  2WAC A;  4E6I A;  2ZXR A;  4DF7 A;  3MFY A;  3TME A;  1A2U A;  2B2W C;  1B4O A;  3SE0 A;  4IUU A;  1KLG D;  2A5H A;  1B9N A;  5EKK A;  3QB3 A;  2JE6 I;  3EFX D;  4CKB A;  1YNJ D;  3WDN A;  1NR4 A;  2L0C A;  3MFG A;  1QE6 A;  3F2U A;  3KF8 A;  1L0X B;  2A69 C;  3KLS X;  2F0L A;  4K6D A;  2RVL A;  5M5X B;  3IFD A;  3Q6S A;  1F9R A;  4V19 0;  2EYM A;  4ZKC B;  3JAM L;  3Q0A A;  1AEX A;  3R2I A;  4A3J B;  1OO9 B;  1EQT A;  3I70 A;  2WP8 J;  1LT5 D;  5CYU A;  5T1I A;  4FXK C;  3PMF A;  4X3T A;  2ICI A;  2NTS A;  5C5M A;  5FKA C;  3H91 A;  3VR2 A;  4JBW A;  2B8F A;  3FDT A;  1BDO A;  1LT6 D;  3S17 B;  1F9Q A;  3NE5 B;  3CKI B;  2BDN A;  5C6A A;  5M5Y B;  2CHB D;  1SYG A;  5FLX E;  3MXN A;  1K83 B;  1B50 A;  3A8I E;  5CMD A;  3CRL C;  1KDB A;  1B44 D;  2IL8 A;  1SYF A;  3GTJ B;  1NCV A;  1SFO B;  3OWE B;  5JEA H;  5J39 A;  4QMG A;  3WOE A;  3PUV A;  1EU4 A;  1S5D D;  2OT2 A;  1JC7 A;  1ESF A;  4A3E B;  4C3H B;  2FIN B;  1I50 B;  4L6T B;  1EY4 A;  1I4X A;  2F1M A;  1A6X A;  3DWP A;  5D3D A;  4F7X A;  4CHT B;  2KCN A;  1C4Q A;  4IUV A;  1TR5 A;  3QO2 A;  4J8Q A;  1GUO A;  1PFB A;  4F87 A;  3X3M A;  1SNO A;  2EZV A;  2O5I C;  3KBG A;  5CV5 A;  4UAI A;  1SYC A;  4BBS B;  1TWF B;  3I3C A;  5A35 A;  1EIH A;  1OXS C;  3BDO A;  1O7Z A;  3LWU A;  5EPL A;  1G29 1;  1I4R A;  3J7A F;  5E1F A;  3J81 E;  1TY2 A;  3MXU A;  3MWY W;  1D5X C;  2RDG A;  5E4W C;  5JAV A;  5I2X A;  3LNN A;  2E2D C;  4FP5 D;  5E4X A;  1QWY A;  2A6E C;  4TQU S;  2A73 B;  1GJX A;  5EKI A;  5K5P A;  1Q90 A;  2NVT B;  5FK9 C;  2JA7 B;  2R7Z B;  4OO1 I;  4TKO B;  5I9P A;  1HXY D;  2K1B A;  4OL7 A;  3K5N A;  2F0U A;  2EPB A;  1AZQ A;  1UUP A;  1F77 A;  4DK1 A;  4A3K B;  1WTW A;  3SDZ A;  2SDF A;  1PLF A;  2F0E A;  2L9H A;  5JEA J;  1SAP A;  4ULL A;  3OIQ A;  5T1G A;  3D4D A;  3QOL A;  3OOC A;  1CT1 D;  1S5F D;  1UNS A;  1ZXT A;  2A68 D;  5FO7 B;  5LL6 X;  1SDF A;  3C46 A;  3OW7 A;  4KKT A;  1I4H A;  1LTS D;  2EDG A;  5DM6 3;  3IFT A;  4NW2 A;  3VR4 A;  1SNP A;  1QIL A;  1SSO A;  1STH A;  3L3O C;  4OO1 H;  2IPK D;  2K01 A;  1EWC A;  1ZYR C;  2KEE A;  3VYT A;  4V0B A;  2WV6 D;  1STG A;  2L4N A;  3DM1 A;  3I72 A;  3P1H A;  1EL0 A;  5EPK A;  3H94 A;  1XWE A;  2B2U C;  1JWS D;  1D1I A;  1HPC A;  2PZT A;  5C4J B;  5A2Q E;  5COR A;  3ZYY X;  3BDL A;  5JOB A;  1FD7 D;  4PMB A;  3GTG B;  2C9O A;  2D2C C;  3LWE A;  4IUP A;  2PZU A;  3UI2 A;  1JOQ A;  2MP1 A;  3J81 L;  3NPP A;  2DNC A;  3I8Z A;  1H9J A;  1VF7 A;  1EU3 A;  5IGB A;  1LAB A;  2B2V A;  2ZXP A;  2FMC A;  2EVB A;  1HTP A;  1WTP A;  3V05 A;  2D62 A;  5C3E B;  3BYT B;  2B8G A;  1NSN S;  2R3Z A;  2HDM A;  1EY9 A;  3W2D A;  2JP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...