2K5WA

Solution nmr structure of putative lipoprotein from bacillus cereus ordered locus bc_2438. northeast structural genomics target bcr103a.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
111
structure length
111
Chain Sequence
MERASLNRIGKDVYYMQIKGEGTIEKVDGRNLRNYTLPAYDEDGVKKQITFRSTKKENDHKLNKYAFLRLYVDQDDNSKNEISSIEVKSYEEIQKADLPEKVKDKFTIKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical Cytosolic Protein BcR103A
publication title Solution NMR Structure of Putative Lipoprotein from Bacillus cereus Ordered Locus BC_2438. Northeast Structural Genomics Target BcR103A.
rcsb
source organism Bacillus cereus atcc 14579
molecule tags Structural genomics, unknown function
total genus 15
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06486 DUF1093 Protein of unknown function (DUF1093)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.480 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k5wA00
3NPPA 2K5WA 2K5QA
chains in the Genus database with same CATH superfamily
1K0RA 4BY7G 2RHSB 3I7FA 3K7UC 4R4IA 4DK3C 1X3EA 4RKBA 3AYHB 1JE5A 1LT5D 1RIPA 5IGGA 1X3GA 4ZAIA 1HUNA 1EQVA 2BE5C 2TSSA 1IKMA 3F2UA 1EY0A 4IOCA 1VF7A 1Q46A 2J7ZA 5J3BA 1AFPA 1SXTA 3D4DA 1HQMC 1PMRA 2JXMB 2XNAC 2CH4W 2D2CC 5I4DA 2XTIA 3KBGA 4L5TA 1A0IA 1LO5D 1ZYRC 3U9OA 5IY0A 3G48A 1YJNA 3S1MB 1F2LA 3CQZH 4A3FH 3NUCA 5EGTA 2RBMA 2JK8A 2V1CC 2IHFA 1HR0L 1JB7A 2DUDA 2AHOB 1F77A 1TIID 1LTAD 3R2IA 1K73C 1HA6A 3RZDH 3ONAB 3RMHA 1Y1VB 1LTBD 2ICEC 1IKLA 1EWHA 1E2ZA 2KCMA 1WD1A 2EYLA 3HOXG 1CI3M 4A3FG 4DN4M 1OXVA 2NZHA 2PNHA 1I4XA 1IYUA 1PRTC 3EN2A 2A68C 4B9XA 4CJ2C 5FLXc 3AB9A 3M7NA 2X69A 2NB0A 5CV7A 3K0YA 3OIPA 1GD7A 4IALA 1JJ2A 1TS4A 1STHA 5M3MG 4DV6L 3NXWA 3Q8DA 4A3MH 1X32A 3VYUA 4FF4A 4ZLTF 2DN8A 2PW7A 4DA2A 4R8IA 3H94A 1FR3A 2QW7A 1L0WA 1KD1C 3UDGA 1A63A 1EY8A 3TDQA 3J80i 3HFZB 5EQ0A 2VQEL 3GTOB 4A76A 3L7ZC 2HT1A 2WACA 4HMIA 4BBRG 3PCOB 4B3ML 2YTYA 2B2YC 2RF4A 1Y8NB 4FYDA 2OF1A 3NEMA 5E4XA 2UUCL 1PTOD 2ZJPA 2MO1A 2MJ8A 1TXYA 3G6EA 4GN3B 4XQQA 3M4PA 1U9RA 5IP9H 4H7BA 4AQYQ 3LNNA 4DXGA 2DNEA 2BA1A 2YV5A 4BXXG 2QA4A 4A3GG 2WB1E 3K5LA 2AQ1B 1HNZL 5HGTA 4DV2Q 1FNUA 5T1IA 1XNQQ 1SFOH 4EX5A 4BY1G 1QVFA 1C0AA 4K8JA 2CHBD 1CUKA 2KCNA 3TSSA 1SBBB 1HNWQ 2RA4A 4GOPB 3GTLH 3E6ZX 4KJOA 4KHZA 4C2MH 1A2TA 5I2YA 1CKOA 3S1RB 3GTKB 1T5XD 4OIKA 4DV0L 1NSNS 5AFWA 4GKJQ 4RH6A 3H3VC 1STNA 2PZTA 2A6EC 2JQOA 1KL9A 1WCMB 3QR8A 1UE6A 3T4AC 5KNCA 2NYZD 4JV5Q 2JA5B 2N3SA 5GAEC 3CMAA 2ZM6Q 5D3DA 4JBMA 1Z47A 3AFPA 3VR6A 4PZ7A 4V0BA 3BZKA 2A8VA 1D6EC 2NN6H 4DR7L 1PH2A 1BQQT 5C4XH 1TWCB 1PZID 2LKVA 4U68A 1SNMA 2KHSA 2A5HA 2E5LL 1SE8A 3CKIB 3R93A 1AZQA 1HZBA 4YCVA 1FL0A 1I6VC 4POFA 3NTIA 4NXMQ 1UE5A 1XWEA 2ZTDA 5JEAH 2K33A 1LT6D 3C46A 5EBDA 4Y7NH 1N33Q 2I0QA 3HP3A 4GN5A 4N9PA 3NBHA 1QUQB 3QO2A 1XPOA 5ELCA 3C2PA 1MHWC 2UXDL 3UDXA 3W5OA 1JICA 4C3JH 5FLMH 1Y1WB 2JA7H 1YVCA 4TSSA 2R7ZB 4POGA 3PV0A 4JYAQ 2SDFA 1FJGQ 1UEBA 3S1QH 1QOHA 2D9UA 4IO9A 1EU4A 1XYIA 2XN9C 2UXBQ 3PO3G 1DONA 4CHTB 5FLXL 2EYJA 3MXGA 4DK1A 5IODA 2OEOA 2EDGA 2L5TA 1MJCA 5FLMG 1Q1BA 2Y0SB 2R3ZA 2JJQA 5CGKA 1T9HA 3F8TA 4N8X1 2JYOA 1PH9A 1STAA 2DJFC 2I5LX 4IZ8A 3NWSA 5C0XI 2RCNA 4GKKL 4OEMB 5A2QE 4DNTB 1YJWA 1QG7A 1SMXA 1PHJA 4A3BH 4NB3A 1X54A 1R4PB 4ME5A 2ZJQA 2RDGA 4MZ9A 3DMUA 3FPPA 1VQGA 2FFKB 3FKIB 1XNRL 3I4MH 1WTVA 1E1TA 3KUPA 4DR6Q 4KY7A 2JSOA 1EL0A 2L15A 3U9SA 1XJVA 1KNEA 1SSOA 3BDLA 2F0OA 4LUVA 2CVRA 2NBFA 1LTID 1L1OB 3SEBA 3VR2A 1T5EA 2AQ2B 4QJFA 4QY7A 3NQTA 2K5VA 3D6CA 3H6MA 1K0SA 1Q81C 2OT2A 4HIOA 3SK4A 4IPCA 3I4MG 1HXYD 2B2YA 4ILWA 2EY6A 3RN5A 3I8ZA 1HH2P 2FMCA 1SYCA 1PZJD 2Z1CA 4CBVA 1Y1VH 1A6XA 1TKWB 2PCFB 2SOBA 3MXUA 3PUZA 4KLKA 3ND8A 1B7YB 1X3PA 1BXTA 3HKZE 1ILQA 4ALPA 4BY7B 4XYQA 2WV6D 3BG3A 1ICWA 4K6LA 4JI7Q 4RHRA 4DV5L 3M4QA 2K03A 4KY6A 2V4DA 4LF8L 2UU9Q 2H5XA 3ULPA 1DXMA 2E2IH 1IBKQ 1F9QA 1NMFA 2WINB 2ZXOA 1DZ1A 4APVA 3K59A 5IGFA 5CR3A 3PUYA 1O7LA 4K6DA 2VZAA 3TZDA 1K8OA 1CKNB 2F03A 1PYWD 1OXUA 1A3UA 1VQ5A 1DCZA 5LMNL 4JI8L 4B3RQ 4KD4A 1CZGA 2F0QA 4DGZA 1LABA 4B3SQ 3FHWA 5FO9B 2VS1A 1D5MC 3CXCA 4E6IA 3PMFA 4QQBX 1SRUA 2B8GA 2XRSD 2PQEA 1R9TB 1NR4A 2VXWA 2JA8H 4BS9A 2BCOA 2MUYA 2RHQB 1EUJA 4JI0Q 3HOXB 1B3AA 3J81j 1YNNC 3T51B 3D8GA 2HQEA 3HGBA 2WAQE 4A3EG 3J81i 4NW2A 1JCKB 2MP1A 4JV5L 5EBCA 1JWUD 1MJEA 4FF2A 4MN3A 3S1NB 2JA8G 3JAMc 4IOAA 1UNSA 1AZPA 2OXPA 5AJ3Q 4DKAC 4JI5Q 2ATWA 1GKHA 5C4JB 1SE3A 2O4XA 4K5XA 3KJOA 4OWWB 4JPBW 4WJ3M 1J5EQ 5A35A 4DR4L 2EIFA 4P74A 1I4RA 2OTLA 3M4OB 1KNAA 1K3BC 4F7XA 4A3KH 5CV6A 1MSGA 2PO4A 4DR2Q 1KRTA 1G6ZA 2WFWA 3S1RH 2LY7A 4TVAB 4J6HA 4BBSH 4XDXA 1O7ZA 1JE4A 4ZK9B 3OMCA 4BBRB 3GTPB 4JVZA 2L1BA 1PZKD 4R4QA 3HOZG 2K32A 1N33L 2EPBA 2JA5H 2IX0A 3AEVA 5C6AA 2X6GA 1FNVA 3BDOA 4C56C 1PDQA 1Y8PB 2FMMA 4A3KG 1E22A 1PVOA 2F0MA 4PZ6A 2L11A 4OGQC 1W6JA 4X66L 4BBSG 1QILA 4JYAL 5C44H 1B2TA 1FJGL 1RTNA 1SYGA 4YY3L 2LXJA 4TQUS 5DNFA 5BN5A 5JAVA 4DR3Q 2EJGC 5KGUA 4ZUJA 2F4IA 2IW3A 3MC0B 3VYSA 3I91A 2F4VQ 3M9BA 2WAQB 1ZYRD 4IPHA 4DK0A 2QGQA 3QJYA 4BY1B 2QDLA 5KIXA 2QILA 2EE1A 4GLXA 1CSPA 1IHZA 4BWGB 1STYA 5EJWA 2J4XA 1JB3A 1VCIA 4XT3B 5C44G 4DUZQ 1IBLL 1PV4A 2VUMB 2LSSA 2WKDA 2Q2HA 3MZ5A 4X64L 1C8CA 4OXPA 3S2DB 3FPUB 2BOSA 4I65A 2R93B 5G3LF 1S5BD 4ZQ3A 2LMCB 4U673 3OWEB 2L0CA 4QL5A 2HUGA 1XMQL 1Q3LA 2KUMA 3ER0A 1ILPA 1Y1WH 3HOUG 3PIP3 5M5XB 1UUPA 4KK7A 3M85A 2E76C 1PH7A 2G9DA 1Y69U 4TKOB 1CSQA 2NVQB 1BCPC 2Z4IA 1HJPA 1EQQA 5CV9A 1I6HH 1G291 3U4VA 2JP1A 4DV4Q 2KENA 2JEAI 1H95A 4G4KA 3UDIA 2NVTH 1Z6HA 2EYMA 1FGUA 1KAAA 5HURA 4CJ1B 3CCRA 4YCWA 1QNKA 1PTOH 4YWMA 5M5YB 1E2VA 1M4VA 4HEDA 2B63B 4R4CA 5FJ8H 5C3EH 5M3FB 3W1BA 4NKLA 1HRJA 1NBWA 1R4QB 4LUOA 1C4QA 1ET6A 1K28A 5M5WH 1DD2A 2EYFA 4OX9Q 5GQOA 4HIDA 2LS01 2E75C 2PYKA 1IW7C 3A54A 2MGSA 4JBWA 3CCMA 4FDBA 5KNBA 1L0XB 3HOWH 5D14A 4KKSA 5IT9E 3BZDB 1I5FA 3OTOQ 3VR4A 5KEEA 3T53B 2A69C 4A3JG 4DAPA 1JWMD 2K50A 4R9WA 5C3EG 1G2TA 1STEA 4LFCQ 4DV3L 3MFGA 2PPBC 1U0LA 1O7IA 1XTDA 3JAME 5CYUA 3TS2A 3PO3B 4K14A 3CCQA 4QCLA 1G51A 1TY2A 4XYOA 3ZJYC 1WTHA 3R8BA 3T1YL 3EIVA 4XIGS 3I2ZA 4A93G 5I6YA 4A3DH 4B3RL 1C48A 4IFDI 5IOCA 1VDZA 3WWVA 2IX3A 3HOVH 1MBYA 3BS1A 1GHKA 1JMCA 2B39A 2E8GA 2I46A 1VQFA 2PI2E 1LLRD 4L6TB 4FXDA 2OTJA 2A1AA 3K81C 4NXNQ 4DV1Q 4JI4L 1VQLA 1VQAA 2NZ1D 1VQ8A 2MQHA 4S3SA 1WTOA 5K5PA 3K7AB 5ELFA 1BNZA 1LUZA 3J80c 1H9MA 3L3OC 4BA2I 2B2VC 2KCTA 2XWBB 1RCVD 3MA2B 2IHEA 3LGJA 1PTOF 4KMUC 1ENAA 3HEJA 1K83B 1YHAA 3IKJA 1E24A 2ZT9C 5I6WA 5KYLA 1UE1A 4M1UB 4L63B 2UUBQ 1XPRA 3J7AV 3KF8A 4ZRZA 2Z8LA 1QE6A 2XIWA 3KDFA 2JA6H 1GO3E 1EY4A 2KJXA 4UP7A 2WP8J 1ENCA 3BVZA 3P7JA 3A8IE 3PO2H 3OYYA 1PRTB 2F0DA 1XMOL 3NTHA 4KY5A 3ULLA 5IYDH 1KRSA 4X6AH 2QCPX 4C3IB 4UHVA 4K0KQ 2VQFQ 3HZXA 3S1NH 4HJ8A 1VQJA 2I07B 3CC4A 2KOLA 1EWCA 1U5KA 1VMCA 3W1GA 1E1OA 5C4JH 5HY6A 3NK9A 5ISRA 2CQAA 2QDBA 2I5MX 3P1HA 4AYBE 1AN8A 2ZXRA 4A3IH 2XVSA 3GDEA 5JJZA 1PFBA 1WTXA 2RSOA 4KHVA 1VQ4A 1RTOA 3KYHC 3DLLA 4EGVA 5LL6X 4A3MG 1HNXL 1W3SA 3Q23A 3HKZG 3DUZA 4KHPL 2E2JH 4C1NI 4OWTB 4DUZL 4LF5L 3OIQA 4K5VA 2R7FA 5C0XH 3MTSA 1YHQA 4A3IG 4C3HH 3RUZA 1H9SA 2IWHA 5H1SE 3GTGH 1STBA 1VQEA 3ZYYX 1X56A 3P75A 4A3EB 5ELBA 1N34Q 2R92H 1QVGA 1EY6A 3A8JE 1VQPA 4Q0FA 2VY3A 1WTWA 4K2KA 2YU9B 4CKBA 3BVGA 1VMPA 1CM9A 4OONA 3GTJB 2E2HH 4DU9A 1A62A 4HTHA 4C3HG 1XX8A 4PNYA 1SMYC 4LMQD 3GV3A 1WVLA 2F0EA 5IP9G 1UWVA 2ZJRA 3S2HB 2D0PA 4NP5A 2KEEA 2R92G 3H0GB 1EQTA 4P73A 5CC4A 3HOYB 1M1KC 1EWIA 1PFSA 3PQIA 2VUMH 4J8QA 4RGTA 4JC0A 2P5ZX 4N8FA 1KQSA 2HHHQ 4RAUC 2K04A 3HG9A 2UUAL 2F0JA 4WORA 3ND9A 4K8IA 5K36H 1I4GA 4CGYB 1I50H 1ZEQX 1ENFA 1PH5A 2B8FA 3HOZB 2UXCQ 4AYBB 1K8AC 2OCEA 4OX9L 3IRBA 1UE7A 1RODA 1KDBA 2Y0SE 2G5DA 1IBMQ 2LXKA 1KHIA 2SNMA 2NVQH 1DOKA 4B3TL 2AUKA 1YITA 1TWHH 1P8LA 4I7AA 1JC7A 1AE3A 3DXJC 3MWYW 5K36G 3J80E 2OWOA 1LTLA 2O2LD 2MHVA 1N36Q 4QUCA 2MO0A 1HUMA 2F3VA 5JVG3 1CHQD 1HCZA 3MHBA 1N32L 3TN2A 3SHLA 1U4LA 3V05A 4KN4C 1S4ZA 1CQFA 3Q0AA 2K4KA 4GZYC 2B63H 4LWCA 2A6HC 1VQMA 2CWPA 2NN6G 4ME3A 3OOCA 1UEAB 4LF6L 5C4XG 2EXDA 4GNXC 1VQKA 2NUCA 2QEJC 3S15B 4FVMA 1WYDA 2Q8RE 4GS3A 1XTCD 2F0HA 4I7ZC 4A3CH 4DUYQ 1JJCB 4YHHQ 2B2VA 2CKZB 2Q2UA 3DWPA 2QEXA 3KJPA 3TP5A 1PH6A 1EIGA 1IYVA 4QUFA 5JEAG 1RL2A 4NXNL 4IURA 1DM0B 4JOIC 4DFAA 1B1ZA 3NTKA 4L5RC 5CV8A 3KOJA 3LX0A 2AKWB 4IN3A 1CFMA 3GTQH 3S16B 1X55A 5IP7H 1Y8OB 3I73A 1VQ9A 3OHXC 1ZKOA 3I4NH 4C3JG 2JA7G 1NNXA 2F0LA 4ID6A 1F9PA 4RFBA 3N52A 1X65A 4IPGA 3A5ZB 5EAYA 4CDDC 3A5UA 3PUVA 4IUVA 3ULJA 3I55A 2C5CA 1J8IA 1OXSC 4OL7A 1KXLA 1L2FA 1FNWA 1EY7A 4KKTA 1IYJB 4O1NA 5A2QL 5JPNC 1A2UA 1W2BA 1SE2A 1LTTD 5E1FA 2XWJB 3DEOA 1U4RA 2K75A 4K5WA 3K7AH 5KRUA 3PIOA 3STBD 1WOCA 3T13A 5J1ZA 3EJIA 3B6YA 3I4LA 3PIO3 2I5HA 1PTOC 4K0KL 3S1MH 4A3BG 4DNRB 1TWAB 2HD3A 1SNQA 1TVXA 2B2WC 1LTGD 3I70A 1DOLA 2YTVA 1QJOA 5EKLA 2AQ3B 2GVAA 4H13C 4YCUA 3QOJA 4LNQA 4A93B 3I3CA 5LMUQ 4V190 3K58A 1TWFB 4OO1I 5E3FA 1RKNA 2KA7A 2HCIA 2L4NA 4FO2A 2Q8TA 2O5JC 5EKKA 3LWUA 2ALYB 1PH1A 1V1PA 1Q7YC 2PMZE 4DV7Q 2A19A 4NDXA 5LHY1 1A15A 3M3YB 5DAUA 1JR0D 1SAPA 1RDPD 2ZTEA 1JWSD 2BA0A 4DK6C 3IAYA 1PXUA 2HCCA 4C3IH 2D5DA 5FKAC 1O7YA 4DR5Q 1Y1VG 1PH3A 1QZGA 1SN8A 5I9OA 4A3LH 2Z4HA 5ELOA 4X3SA 2VB2X 4AQYL 3QOLA 2K01A 3RZOB 2RSNA 3UDFA 3NWTA 5C0XJ 3CD6A 1BBXC 1BBWA 1B3QA 3KLSA 1BCPD 3H09A 1NR2A 3EQLC 4G57A 4KN7C 4PQXA 5IIFA 4DV2L 1V43A 5T1GA 1G8ZD 2BDNA 4HMJA 1XNQL 1QCBD 3WOEA 3GTOH 3K57A 4UAIA 4JI1Q 1N8RC 2WIIB 1HNWL 3KK7A 1AP0A 3NHHA 4DAVA 4A3FB 5IE8A 1VQHA 1VQNA 4CKCA 2M9VA 5IT9c 3J7A5 3BYYB 4HSVA 4GKJL 2F3IA 2JA9A 5JOBA 4DR1Q 1Z7TA 2UXCL 1LACA 1JORA 5C5MA 1RD9D 4XQNA 4LAAA 3E9IA 5IGDA 1JOKA 4F88A 1IBML 3RZDB 4IQZA 4JK1C 2NVYB 2ZM6L 2EQSA 5M3MB 2RCFA 4IJLA 3A56A 2PMZB 4X62Q 1CZWA 2A69D 2M2LA 4RCOA 2NWGA 3F2BA 4LF9Q 3MVVA 4PV1C 4DXFA 5NUCA 3S2HH 1EOVA 4GNXA 5JVH3 4GN4B 3H0GH 4PG3A 3A74A 1NE3A 2K52A 1EYDA 3DHQA 3OPOA 1W6KA 3K5OA 4EQNA 2KCCA 4FXKC 1STGA 1GUTA 4HJ5A 1K3RA 2IY5B 4NXML 3D4RA 3GTKH 4A3MB 4RMFA 1JQYD 1B44D 1HR0Q 3J7AF 2FXQA 1Z9FA 3CCJA 1BKBA 4PMBA 4NMZA 4IFDH 3LWEA 1WCMH 4JOIA 1HHVA 3OSOA 2F1MA 4F8MA 4EVOA 1SE4A 4IUTA 1TQOA 1KABA 3MXNA 2B2UC 3Q24A 3E5SA 5JEAJ 2K7VA 2VB3X 1Q12A 5C4ZA 4IUPA 5C4HA 1TWCH 1YNXA 3D4WA 5CV4A 4IFDG 4A3GB 2BE5D 1F2YA 1H9JA 1WCMG 1H9RA 4CDCC 2MNAA 1HZCA 2UXBL 2JA5G 5DEHA 4PMCA 1D2BA 5IYBH 1EY5A 4DV6Q 4DF7A 4LJZC 4MHEA 4X65Q 2AMCB 1MSHA 4CDEC 4YWKA 2HIXA 4G7ZC 3J81E 4XQJA 2L12A 3S15H 1HTLD 5GAHC 4HJAA 1TU2B 2FHTA 3GD7A 1HR0W 1CK1A 4KD3A 1B9NA 4WJWA 5JPMC 1X3FA 4XT1B 2CH4A 1G91A 3F2DA 3HKSA 3VR5A 1A3TA 1KAWA 3FVQA 5LL6S 1A8VA 1SFOB 2PQAA 2RDHA 2XRQD 2R7ZH 1J6QA 3SE0A 2VQEQ 1B9MA 1SNDA 2VL6A 3I90A 2B2WA 2R6GA 1BCPB 1PRTD 3TZUA 4QB4A 2WB1G 2M00A 1H9SB 2A68D 3GTLB 4DR6L 1GUSA 4C2MB 3H15A 2NTTA 2OQ0A 3KF6A 2C9OA 4RGOS 4WJ4A 1WTPA 3A0JA 2EOTA 2HQLA 4KKUA 3CCLA 1Y1WG 1D5ZC 3E9HA 4ZYSA 4HCEA 1L1OA 2YTXA 1RJTA 1RF2D 4GLAC 5ELDA 3X3MA 3RNUA 3GTMB 3AFQA 3FRPB 1HNZQ 1F2ZA 3I4OA 2EVBA 2FJ2A 5D3IB 2Z0SA 4J1MA 4P72A 1Q86C 1DYQA 2CW0C 2EY5A 3QG1A 3ICEA 2N49A 2R7DA 5CV5A 1ZXTA 2E74C 3FKIH 3SR1A 4R4OA 4JI7L 4WRDA 1P16A 2CWAA 1EQRA 3ITPA 1E0BA 1TS3A 5M9OA 1MD2D 1HZ9A 2F3WA 4M8AA 2UU9L 2A73B 4RCNA 2JEBI 1PLFA 5FJ8G 2WKCA 3CC7A 1IBKL 1DJRD 3AU7A 3S17B 1TWAH 4HN7A 4Y7NB 1SJED 4L8JA 2MFIA 5IT9L 5FO7B 4PZ8A 3S24A 2EY1A 4FXGC 3TRZA 3G7LA 2J0TD 3SVMA 1CA6A 2K14A 3HOWG 3D31A 2B2TC 1M8AA 3H3VI 4O2DA 4DR7Q 1F9RA 3C1FA 4P71A 3UE0A 4AH6A 2C35B 4C1NK 3JAML 4B3SL 3ERSX 4LUZA 2HDLA 4RKLA 3S1QB 2KEDA 4HCSA 2E5LQ 2K28A 2IL8A 2KVMA 1QB5D 1SJHD 1VS0A 4JCVE 2B3GA 3TBIB 4LF7Q 4BY7H 4R8NA 1IL8A 1NTGA 3R2TA 3NENA 1IXRA 3CCSA 3CC2A 3AMUA 2K5HA 3A7LA 3DWQA 4F87A 3K8AA 3SDZA 4X3UA 1WJJA 4JI0L 1SYEA 1KIXA 2PZWA 3J7ZC 1CQVA 4A3DG 1D7QA 2X6LA 3R3OA 2F0SA 1CTMA 3C1EA 3NBHB 4JW0A 4ZKCB 4JI3Q 2A6ED 3V96A 1HTPA 1I94Q 3NSWA 2ES2A 1WTQA 3HOVG 1EEFD 1K8MA 1X3QA 3PUXA 2NZOA 3HS0C 3RZOH 3RD4A 3EVQA 4A3BB 3OWFA 2UXDQ 1JJGA 4B9WA 2ID0A 1JOQA 4L5QA 3SK8A 5AJ3L 1EYAA 4JI5L 4X62L 4AIMA 2LFNA 2PW5A 3PF5A 4QMGA 3I4MB 3DEPA 1PYSB 4HSPA 1UAPA 4G7HC 4LF9L 1YZ6A 1J5EL 2Q2IA 2XGTA 2NVXB 2DNCA 1R9TH 1LM0A 1YJ9A 3I72A 3MAQA 4RGMA 4DR2L 1JOOA 3L0OA 3HOXH 2B2UA 4EQOA 2A6HD 5CBEE 1KLGD 3TP8A 3UE1A 5D65A 3VR3A 3DWAA 4MIUA 2GA4B 4RA8A 1B4OA 1PH4A 4GKKQ 2OQKA 2JA6G 1QNUA 2NVYH 1BO0A 1WD0A 3AQQA 3CHBD 5EKIA 5M3MH 2CFMA 3PGZA 1VQOA 3CCVA 1PFMA 5DM63 1TS5A 3KLWA 5IWAQ 4B08A 3PO2G 4IFDJ 1EYGA 5CBAE 1XNRQ 2VNUD 3MXPA 1GVPA 1II3A 1X9NA 4LFAQ 2AWNA 1VF5C 4GLVB 1PFNA 5IYDG 3WDNA 4DR3L 1V9PA 2IJ0A 3M4OH 2A74C 2F52A 1CT1D 4H44C 3PF4A 1ONLA 2F4VL 2E2IB 4RHSA 4DNIA 4X65L 3Q22A 1OTCA 1D5XC 1BVSA 3C3LA 4BBRH 1VQCA 3GTPH 2K5WA 3MEHA 2ZXPA 3K80C 1O78A 1A3VA 1V1PB 1J9OA 3K6OA 1VQIA 2F0FA 2O5IC 1LTRD 1EFID 4DAYA 4P2CB 4K2LA 4DAMA 2F0PA 5HGQA 2PNRC 4OWXB 4BXXH 4EQPA 4DV5Q 2JA8B 4A3GH 4JI6Q 5KNDA 4LF8Q 1YNJC 5C0XG 4CJ0B 2Z9HA 3T16A 1EIHA 2K5QA 1FGBD 2ENBA 2DY7A 4BY1H 4UP9A 4DV4L 2E2DC 1I4HA 3TREA 1XPUA 1H9KA 2BH2A 3TEHB 4J15A 2Z6BA 5TSSA 3S2DH 5LMNQ 2R93H 1ET9A 4JI8Q 4EQ5A 3BJUA 2RQXA 2D0OA 3JC66 2WAQG 4YWLA 4OO1H 1U4MA 5M5XH 1AH9A 3UI2A 1BBUA 1YI2A 3VA7A 2H1EA 1L0YB 2EZVA 3W3AA 4A3KB 2VUMG 5KYIA 2N55A 3NBIA 2B2TA 4OIJA 4GOPC 1FD7D 3OTOL 2R93G 4BBSB 3S14B 3T56B 2F0UA 1SROA 3S9WA 2QKIC 4RG1A 1PA6A 1C7YA 1F9SA 5DLQE 1S40A 4OO1G 4LFCL 1TWGB 1WFQA 1K8GA 3V2TA 4FF1A 5I9PA 1D1IA 3GTMH 3QB3A 4RGNA 2HDMA 3J80L 5I2XA 1QZHA 5IGEA 3IFDA 5M5YH 2L9HA 4IJHA 4JBKA 2F0IA 2R61A 3M4YA 5BR8Q 4GNXB 2Q8IB 1FYCA 1WI5A 2F0NA 1AEXA 2RKSA 4H02A 5M3FH 3T1HQ 5C44B 1B8AA 1HPCA 5IYCH 1NJIC 3U58A 4DR4Q 5LMNW 5C3XA 3CMEA 4Z9CB 1EZ6A 5JJIA 2F0GA 2H4OA 1AE2A 4LF7L 1E7ZA 4KTAA 1PH8A 3J7YW 1EEID 4LFBQ 2K05A 3HOUB 5E4WC 5EPLA 2B63G 1YNND 3OW2A 1S3OA 4DV1L 1D8LA 3FDTA 5M3FG 2KQ3A 3S17H 2WB1B 1SYBA 4JI3L 4JBJA 3MXNB 5BN4A 5IYCG 1I94L 5FOBB 3PO3H 1B50A 2EY2A 3HRZC 1SNOA 4A3CG 4OHJA 3GV6A 1D1KA 4XTCS 2KHIA 2Z6KC 3FEWX 4H0LC 2B29A 3K5MA 3RN2A 1CA5A 4X66Q 2K1BA 1V1QA 4ZKBB 5FLXE 3U4ZA 4YY3Q 1GM5A 2UUBL 2F0KA 1OXTA 2AUJD 2AWOA 1BCPF 4JI2Q 1GHJA 1I6HB 1VQDA 3D6WA 5IP7G 4LK1C 3E0EA 4ZUIA 5ELEA 3I4NG 1DGSA 4LW1A 4IUUA 3VA5A 3OMGA 2NVTB 3L9AX 5EPKA 2K5DA 1WTRA 1IBLQ 3KLSX 3D3RA 1HFNA 4CKEA 4X64Q 1BOSA 1PTOB 4MTKA 2PQAB 1E3PA 3L2PA 3PUWA 4A3JB 2JE6I 2VQFL 1XMQQ 3VYRA 5C3EB 5L37A 1K83H 1IL2A 4HIKA 3CRLC 5M5WB 4G7OC 1SNPA 1N9WA 5IWAL 1V1OA 2RDFA 2RVLA 3PSIA 5FK9C 1EZ8A 3A7AB 1M90C 3HOWB 4XXEA 1I3QB 3K0XA 3KF6B 4LFAL 1ESFA 3CP0A 3J81c 2NVXH 3E3XA 3D0FA 2PI2A 2QF7A 3H91A 2IX1A 4KI0A 3EFXD 1ML0D 3RR5A 4HIMA 1TT2A 1JT8A 2L55A 3TP6A 4ODGA 1GUGA 1L1OC 1HFGA 5COYA 3OW7A 2F0WA 3IFTA 1ICFB 1YBYA 4FNFA 1ESRA 4A3DB 4WFN3 1DOMA 1HZAA 2KECA 1X6OA 3BU2A 3MEFA 1EIFA 1N34L 3CPFA 2MPMA 3HOVB 1EOTA 1QWYA 1OXXK 2IPKD 3BVMA 2VW9A 2NTSA 2ICIA 2NN6I 3DM1A 3GO5A 4JI6L 1PYBA 2HIVA 4C3IG 5GAGC 2IT1A 4FP5D 4X3KA 4QGUA 4UY8C 1BF4A 3VYTA 4DV3Q 3P20A 3CW2C 4A3LG 3NQIA 3F2CA 3EBEA 4ZCKA 4HR7B 3T1YQ 2CQOA 1CHPD 3NPPA 3NELA 3CQZB 3CF5A 2HHHL 4X3TA 4GOPA 5DM73 4LF4Q 1GUWA 1NY4A 1B70B 4A3EH 4KV6A 2CW0D 2EYOA 3IL8A 4UPAA 1GOZA 2N88A 5CMDA 5EPJA 1IW7D 4FF3A 1TR5A 2JA6B 4MNOA 1KLUD 4OELB 2YU9H 1HQRD 4DPGA 3CPWA 4P75A 3GTJH 1AW7A 5GADC 3EA6A 1NMGA 3Q6SA 4MTNA 3URYA 1Q82C 3PO2B 4JI4Q 1EIYB 5JJLA 1QVCA 1SNCA 3F1ZA 1PRTF 1RHPA 2SEBD 1GUNA 3CU7A 1N36L 2KBNA 2ZTCA 3HOYH 1GJXA 1YHBA 3EROA 2EXZA 1I4PA 1Q8KA 4BA1I 1KDAA 3KLRA 1SR3A 3CCUA 4O0AA 1XXGA 3TQYA 1SDFA 1IZ6A 3H3VH 1BDOA 3KF8B 3HKZB 3NE5B 4NPSA 5BR8L 3T1HL 4QIWE 3KDFB 3HOZH 2Q2TA 1VQ6A 3RLFA 2EYHA 4RWSC 1VQBA 2DGYA 1S5CD 3CAMA 4A3IB 3H0GG 1BUVT 3HOYG 1KC8C 4QF4A 1NUCA 2K5NA 1EY9A 4LFBL 2N78A 4DUYL 4YHHL 4Q5VA 2DJGC 4A75A 4O42A 1QUQA 3W2DA 5JJKA 3S14H 2SNSA 2Z6KA 4N9TA 1XMOQ 1KTKA 1B53A 2E2JB 1K9MC 3I56A 1I4QA 1E2WA 1S5FD 2JN4A 3X3NA 3STBC 1TWGH 2N8NA 4R4TA 3G6JB 4AYBG 3G71A 5BN3A 1EYCA 5E7NA 1SEBD 4C3HB 1MI2A 3GTGB 4IUQA 5J39A 2DY8A 2R92B 3GQBA 5FO8B 4HJ7A 1TS2A 1U4PA 4JG2A 3TP7A 4L5SA 3TMEA 2BDOA 3E0JA 4TRDA 2EJFC 1SYDA 4A4IA 2E2HB 1S5ED 4JI2L 2CCZA 3J81L 3HOUH 4CDFC 5IYBG 3TS0A 1C9OA 3FP9A 1HNXQ 2K6AA 2BH8A 3KFUA 4KHPQ 1G6PA 1NCVA 3DM3A 4B3MQ 1O80A 4LF5Q 1NAPA 4IPDA 1Q8IA 3JAMi 2EYPA 4YIJA 3S16H 4KJNA 3BDCA 1CKMA 2KHJA 2EJMA 2UUCQ 1LT4D 1Q1EA 4QIWB 3KBXA 4DAYB 2F0VA 3PIPA 1I50B 4HAEA 3SGIA 2R7ZG 1S5DD 3QIAA 4IUNA 3WOFA 1LV9A 2GN5A 1V8QA 1VQ7A 2TMPA 3CRKC 1TWHB 2PZUA 1Q90A 5LMUL 2ASBA 2F0TA 3BYTB 3ERQA 5C4XB 5IGBA 3U50C 3MFYA 1SYFA 2Y0SG 1LYLA 4DV7L 1LT3D 1ASZA 5GROA 1TY0A 5IGCA 1KDCA 1MIUA 3A8KE 5C3WA 2XSCA 2UUAQ 5CORA 4A3JH 4DV0Q 3RLNA 1SLJA 4R1JA 4DR5L 1Y14B 3NP8A 1MGSA 4ULLA 1FVIA 2FINB 5J22A 1YIJA 1S72A 3O13A 2D62A 3GP7A 4HJ9A 4Y52H 3FKIG 3RLOA 4ABNA 4B3TQ 1I3QH 3FMCA 1ASYA 3VDYA 4A93H 2G9HD 1EFWA 2YYZA 4C3JB 1YNJD 1GXDC 2JA7B 1BR9A 1CKNA 1TWFH 1G2SA 3K5NA 3SXHA 1OO9B 1SMYD 3N6RA 3SK5A 3QWNA 3BZCA 3GTQB 3M3YH 4JI1L 1N32Q 1MKHA 4UP8A 1F2MA 1LTSD 5ELNA 1HA5A 5G3LD 4UDUC 3I4NB 1GUOA 5F2DA 3CCEA 3A55A 2GVBA 3G4SA 4LF6Q 4LF4L 4PMWA 3M7GA 3SK6A 1EU3A 1YEZA 4DR1L 5C5LA
chains in the Genus database with same CATH topology
4RKBA 1LT5D 5IGGA 4ZAIA 1HUNA 1EQVA 2BE5C 2TSSA 1IKMA 3F2UA 1EY0A 1VF7A 2J7ZA 1AFPA 1SXTA 3D4DA 1HQMC 1PMRA 2JXMB 2XNAC 2D2CC 5I4DA 3KBGA 1ZYRC 1LO5D 3U9OA 3S1MB 1F2LA 3NUCA 5EGTA 2RBMA 1F77A 1TIID 1LTAD 3R2IA 1HA6A 3ONAB 3RMHA 1Y1VB 1LTBD 2ICEC 1IKLA 1EWHA 1E2ZA 1WD1A 2EYLA 1CI3M 4DN4M 1OXVA 1I4XA 1IYUA 1PRTC 2A68C 4B9XA 4CJ2C 3AB9A 3M7NA 2X69A 2NB0A 5CV7A 3K0YA 3OIPA 4IALA 1TS4A 1STHA 3NXWA 1X32A 3VYUA 4FF4A 4ZLTF 2DN8A 2PW7A 4DA2A 4R8IA 3H94A 1FR3A 1EY8A 3TDQA 5EQ0A 3GTOB 3L7ZC 2WACA 4HMIA 2B2YC 1Y8NB 4FYDA 2OF1A 5E4XA 1PTOD 2MJ8A 4XQQA 1U9RA 4H7BA 3LNNA 4DXGA 2DNEA 2BA1A 3K5LA 2AQ1B 5HGTA 1FNUA 5T1IA 4K8JA 2CHBD 2KCNA 3TSSA 1SBBB 2RA4A 3E6ZX 4KJOA 4KHZA 5I2YA 1A2TA 3S1RB 3GTKB 1T5XD 4OIKA 1NSNS 5AFWA 4RH6A 3H3VC 1STNA 2PZTA 2A6EC 1WCMB 3T4AC 5KNCA 2NYZD 2JA5B 5D3DA 1Z47A 3VR6A 4V0BA 1D6EC 2NN6H 1BQQT 1TWCB 1PZID 2LKVA 4U68A 1SNMA 2KHSA 2A5HA 3CKIB 3R93A 1AZQA 1I6VC 3NTIA 1XWEA 5JEAH 2K33A 1LT6D 3C46A 5EBDA 3HP3A 4N9PA 3NBHA 3QO2A 5ELCA 3C2PA 1Y1WB 1JICA 4TSSA 2R7ZB 3PV0A 2SDFA 1QOHA 2D9UA 1EU4A 1XYIA 2XN9C 1DONA 4CHTB 5FLXL 2EYJA 3MXGA 4DK1A 5IODA 2OEOA 2EDGA 2L5TA 1Q1BA 2Y0SB 2R3ZA 5CGKA 2JYOA 1STAA 4IZ8A 3NWSA 5C0XI 5A2QE 4DNTB 1QG7A 1R4PB 4ME5A 2RDGA 3DMUA 3FPPA 3FKIB 2FFKB 1WTVA 3KUPA 4KY7A 2JSOA 1EL0A 3U9SA 1KNEA 1SSOA 3BDLA 2F0OA 2CVRA 2NBFA 1LTID 3SEBA 3VR2A 1T5EA 2AQ2B 3NQTA 3D6CA 3H6MA 2OT2A 3SK4A 1HXYD 2B2YA 4ILWA 2EY6A 3I8ZA 2FMCA 1SYCA 1PZJD 2Z1CA 4CBVA 1A6XA 1TKWB 2PCFB 2SOBA 3MXUA 3PUZA 3ND8A 1X3PA 1BXTA 1ILQA 4BY7B 4XYQA 2WV6D 3BG3A 1ICWA 4K6LA 4RHRA 2K03A 4KY6A 2V4DA 1DXMA 1F9QA 2WINB 2ZXOA 1DZ1A 3K59A 5IGFA 5CR3A 3PUYA 1O7LA 4K6DA 3TZDA 1K8OA 2F03A 1PYWD 1OXUA 1A3UA 1DCZA 4KD4A 1CZGA 2F0QA 4DGZA 1LABA 5FO9B 1D5MC 4E6IA 3PMFA 2B8GA 2XRSD 2PQEA 1R9TB 1NR4A 2VXWA 4BS9A 2BCOA 2MUYA 3HOXB 1B3AA 1YNNC 3T51B 3D8GA 2HQEA 3HGBA 4NW2A 1JCKB 2MP1A 5EBCA 1JWUD 4FF2A 4MN3A 3S1NB 1UNSA 1AZPA 2OXPA 5C4JB 1SE3A 2O4XA 4K5XA 5A35A 1I4RA 3M4OB 1KNAA 4F7XA 5CV6A 1MSGA 2PO4A 1G6ZA 2LY7A 4J6HA 4XDXA 1O7ZA 1JE4A 4ZK9B 3OMCA 4BBRB 3GTPB 2L1BA 1PZKD 2K32A 2EPBA 2IX0A 5C6AA 2X6GA 1FNVA 4C56C 3BDOA 1PDQA 1Y8PB 2FMMA 2F0MA 2L11A 4OGQC 1W6JA 1QILA 1B2TA 1RTNA 1SYGA 4TQUS 5DNFA 5BN5A 5JAVA 2EJGC 5KGUA 4ZUJA 2F4IA 2IW3A 3MC0B 3VYSA 3I91A 2WAQB 1ZYRD 4DK0A 3QJYA 4BY1B 5KIXA 2QILA 2EE1A 1IHZA 4BWGB 1STYA 5EJWA 2J4XA 1JB3A 1VCIA 4XT3B 2VUMB 2WKDA 3MZ5A 1C8CA 3S2DB 3FPUB 2BOSA 4I65A 2R93B 5G3LF 1S5BD 4ZQ3A 2LMCB 4U673 3OWEB 2L0CA 2HUGA 1Q3LA 2KUMA 1ILPA 3PIP3 5M5XB 1UUPA 4KK7A 3M85A 2E76C 2G9DA 1Y69U 4TKOB 2NVQB 1BCPC 2Z4IA 5CV9A 1G291 2JP1A 2JEAI 4G4KA 1Z6HA 2EYMA 1KAAA 5HURA 4CJ1B 1QNKA 1PTOH 5M5YB 1E2VA 1M4VA 4HEDA 2B63B 5M3FB 1HRJA 4NKLA 1R4QB 1DD2A 1C4QA 1ET6A 2EYFA 2LS01 2E75C 2PYKA 1IW7C 3A54A 2MGSA 4JBWA 5KNBA 1L0XB 5D14A 4KKSA 5IT9E 3BZDB 3VR4A 5KEEA 3T53B 2A69C 4DAPA 1JWMD 4R9WA 1G2TA 1STEA 2PPBC 3MFGA 3JAME 5CYUA 3PO3B 4K14A 4QCLA 1TY2A 4XYOA 3R8BA 4XIGS 5I6YA 1C48A 4IFDI 5IOCA 1VDZA 2IX3A 1MBYA 3BS1A 1GHKA 2B39A 2I46A 1LLRD 4L6TB 4FXDA 2NZ1D 4S3SA 1WTOA 5K5PA 3K7AB 5ELFA 1BNZA 1H9MA 3L3OC 4BA2I 2B2VC 2XWBB 1RCVD 3MA2B 4KMUC 1PTOF 1ENAA 3HEJA 1K83B 3IKJA 2ZT9C 5I6WA 5KYLA 4M1UB 4L63B 3J7AV 3KF8A 4ZRZA 2Z8LA 1QE6A 2XIWA 1EY4A 2KJXA 2WP8J 1ENCA 3BVZA 3P7JA 3A8IE 1PRTB 2F0DA 3NTHA 4KY5A 2QCPX 4C3IB 3HZXA 2I07B 2KOLA 1EWCA 1VMCA 3NK9A 5ISRA 2CQAA 2QDBA 3P1HA 1AN8A 2ZXRA 2XVSA 5JJZA 1PFBA 1WTXA 2RSOA 4KHVA 1RTOA 4EGVA 5LL6X 3Q23A 3DUZA 4C1NI 3OIQA 4K5VA 5C0XH 3MTSA 3RUZA 1H9SA 2IWHA 1STBA 3ZYYX 3P75A 4A3EB 5ELBA 1EY6A 3A8JE 4Q0FA 1WTWA 4K2KA 2YU9B 4CKBA 3BVGA 1VMPA 1CM9A 3GTJB 4DU9A 4HTHA 4C3HG 1XX8A 4PNYA 1SMYC 4LMQD 3GV3A 1WVLA 2F0EA 3S2HB 4NP5A 2KEEA 3H0GB 1EQTA 5CC4A 3HOYB 4J8QA 4RGTA 4RAUC 2K04A 3HG9A 2F0JA 4WORA 3ND9A 4K8IA 5K36H 1I4GA 4CGYB 1ZEQX 1ENFA 2B8FA 3HOZB 4AYBB 1RODA 1KDBA 2SNMA 1DOKA 2AUKA 1JC7A 3DXJC 3MWYW 5K36G 3J80E 2O2LD 2MHVA 4QUCA 1HUMA 2F3VA 5JVG3 1CHQD 1HCZA 3MHBA 3TN2A 3SHLA 1U4LA 3V05A 4KN4C 1S4ZA 1CQFA 3Q0AA 4GZYC 2A6HC 2NN6G 3OOCA 1UEAB 2NUCA 2QEJC 3S15B 4FVMA 2Q8RE 1XTCD 2F0HA 4I7ZC 2B2VA 3DWPA 3TP5A 1EIGA 1IYVA 4QUFA 5JEAG 4IURA 1DM0B 4DFAA 1B1ZA 3NTKA 5CV8A 3LX0A 3S16B 4IN3A 1CFMA 1Y8OB 3I73A 3OHXC 1ZKOA 4C3JG 2F0LA 4ID6A 1F9PA 4RFBA 3N52A 3PUVA 4IUVA 2C5CA 1J8IA 1OXSC 4OL7A 1FNWA 1EY7A 4KKTA 4O1NA 5A2QL 5JPNC 1A2UA 1SE2A 1LTTD 5E1FA 2XWJB 3DEOA 1U4RA 5KRUA 4K5WA 3T13A 5J1ZA 3EJIA 3I4LA 3PIO3 1PTOC 4DNRB 1TWAB 1SNQA 1TVXA 2B2WC 1LTGD 3I70A 1DOLA 1QJOA 5EKLA 2AQ3B 4H13C 3QOJA 4A93B 3I3CA 4V190 3K58A 1TWFB 4OO1I 5E3FA 1RKNA 2KA7A 2HCIA 2L4NA 4FO2A 2Q8TA 2O5JC 5EKKA 3LWUA 1V1PA 4NDXA 5LHY1 1A15A 3M3YB 5DAUA 1JR0D 1SAPA 1RDPD 1JWSD 2BA0A 3IAYA 1PXUA 2HCCA 2D5DA 5FKAC 1O7YA 5I9OA 2Z4HA 4X3SA 2VB2X 3QOLA 2K01A 3RZOB 2RSNA 3NWTA 5C0XJ 1BBXC 3KLSA 1BCPD 3H09A 1NR2A 3EQLC 4G57A 4KN7C 4PQXA 5IIFA 1V43A 5T1GA 1G8ZD 2BDNA 4HMJA 1QCBD 3WOEA 3K57A 4UAIA 2WIIB 3KK7A 1AP0A 3NHHA 4DAVA 4A3FB 4CKCA 2M9VA 3BYYB 4HSVA 5JOBA 1Z7TA 1LACA 1JORA 5C5MA 1RD9D 4XQNA 4LAAA 5IGDA 1JOKA 4F88A 3RZDB 4IQZA 4JK1C 2NVYB 5M3MB 3A56A 2PMZB 1CZWA 2A69D 2M2LA 4RCOA 2NWGA 3MVVA 4PV1C 4DXFA 5NUCA 5JVH3 1EYDA 3DHQA 3OPOA 1W6KA 3K5OA 4EQNA 2KCCA 4FXKC 1STGA 1GUTA 3D4RA 4A3MB 1JQYD 1B44D 3J7AF 4PMBA 4NMZA 4IFDH 3LWEA 1HHVA 3OSOA 2F1MA 4F8MA 4EVOA 1SE4A 4IUTA 1TQOA 1KABA 3MXNA 2B2UC 3Q24A 3E5SA 5JEAJ 2K7VA 2VB3X 1Q12A 5C4ZA 4IUPA 5C4HA 3D4WA 5CV4A 4IFDG 4A3GB 2BE5D 1F2YA 1H9JA 1H9RA 5DEHA 4PMCA 1D2BA 1EY5A 4DF7A 4LJZC 4MHEA 1MSHA 4G7ZC 3J81E 4XQJA 2L12A 1HTLD 1TU2B 2FHTA 3GD7A 1CK1A 4KD3A 1B9NA 4WJWA 5JPMC 4XT1B 1G91A 3VR5A 1A3TA 3FVQA 5LL6S 1SFOB 2RDHA 2XRQD 3SE0A 1B9MA 1SNDA 3I90A 2B2WA 2R6GA 1BCPB 1PRTD 3TZUA 4QB4A 2M00A 1H9SB 2A68D 3GTLB 1GUSA 4C2MB 2NTTA 2C9OA 4RGOS 1WTPA 2EOTA 4KKUA 1D5ZC 4ZYSA 4HCEA 1RJTA 1RF2D 3X3MA 5ELDA 3GTMB 3FRPB 1F2ZA 2EVBA 2FJ2A 5D3IB 4J1MA 1DYQA 2CW0C 2EY5A 3QG1A 5CV5A 1ZXTA 2E74C 3SR1A 4WRDA 3ITPA 1E0BA 1TS3A 5M9OA 1MD2D 2F3WA 4M8AA 2A73B 4RCNA 2JEBI 1PLFA 2WKCA 1DJRD 3AU7A 3S17B 4HN7A 4Y7NB 1SJED 4L8JA 5IT9L 5FO7B 2EY1A 4FXGC 3G7LA 2J0TD 3SVMA 1CA6A 3D31A 2B2TC 1M8AA 1F9RA 3C1FA 4C1NK 3JAML 3S1QB 2HDLA 4RKLA 2KEDA 4HCSA 2K28A 2IL8A 2KVMA 1QB5D 1SJHD 3TBIB 4R8NA 1IL8A 3R2TA 3AMUA 3A7LA 4F87A 3DWQA 3SDZA 4X3UA 1SYEA 2PZWA 1CQVA 2X6LA 3R3OA 2F0SA 1CTMA 3C1EA 4ZKCB 2A6ED 3V96A 1HTPA 3NSWA 1WTQA 1EEFD 1K8MA 1X3QA 3PUXA 3HS0C 3RD4A 3EVQA 4A3BB 3OWFA 4B9WA 2ID0A 1JOQA 3SK8A 1EYAA 2LFNA 2PW5A 4QMGA 3I4MB 3DEPA 4HSPA 4G7HC 1UAPA 2NVXB 2DNCA 3I72A 3MAQA 4RGMA 1JOOA 2B2UA 4EQOA 2A6HD 5CBEE 1KLGD 3TP8A 5D65A 3VR3A 3DWAA 4MIUA 2GA4B 4RA8A 1B4OA 1QNUA 1WD0A 1BO0A 3CHBD 5EKIA 1PFMA 5DM63 1TS5A 4B08A 4IFDJ 5CBAE 2VNUD 3MXPA 1II3A 2AWNA 1VF5C 1PFNA 3WDNA 2IJ0A 2A74C 1CT1D 4H44C 1ONLA 2E2IB 4RHSA 3Q22A 1D5XC 3C3LA 2K5WA 3MEHA 2ZXPA 1O78A 1A3VA 1V1PB 1J9OA 3K6OA 2F0FA 2O5IC 1LTRD 1EFID 4DAYA 4P2CB 4K2LA 2F0PA 2PNRC 4EQPA 2JA8B 5KNDA 1YNJC 5C0XG 4CJ0B 3T16A 1EIHA 2K5QA 1FGBD 2ENBA 2DY7A 2E2DC 1I4HA 1H9KA 5TSSA 1ET9A 2RQXA 4OO1H 1U4MA 3UI2A 3VA7A 2H1EA 1L0YB 2EZVA 3W3AA 4A3KB 5KYIA 2N55A 3NBIA 2B2TA 4OIJA 1FD7D 4BBSB 3S14B 3T56B 2F0UA 3S9WA 2QKIC 1F9SA 4OO1G 1TWGB 3V2TA 4FF1A 5I9PA 1D1IA 3QB3A 4RGNA 2HDMA 3J80L 5I2XA 5IGEA 3IFDA 2L9HA 2F0IA 2R61A 3M4YA 2Q8IB 1FYCA 2RKSA 2F0NA 1AEXA 5C44B 1HPCA 5C3XA 4Z9CB 1EZ6A 2F0GA 2H4OA 4KTAA 3J7YW 1EEID 2K05A 3HOUB 5E4WC 5EPLA 1YNND 3FDTA 2KQ3A 2WB1B 1SYBA 5BN4A 5FOBB 1B50A 2EY2A 3HRZC 1SNOA 4OHJA 3GV6A 1D1KA 4XTCS 3FEWX 4H0LC 1CA5A 3K5MA 2K1BA 4ZKBB 5FLXE 2F0KA 1OXTA 2AUJD 2AWOA 1BCPF 1GHJA 1I6HB 3D6WA 4LK1C 4ZUIA 5ELEA 4IUUA 3VA5A 3OMGA 2NVTB 3L9AX 5EPKA 2K5DA 1WTRA 3KLSX 3D3RA 1HFNA 4CKEA 1BOSA 1PTOB 3PUWA 4A3JB 2JE6I 3VYRA 5C3EB 3CRLC 5M5WB 4G7OC 1SNPA 1V1OA 2RDFA 2RVLA 5FK9C 1EZ8A 3A7AB 3HOWB 4XXEA 1I3QB 1ESFA 2QF7A 3H91A 2IX1A 4KI0A 3EFXD 1ML0D 1TT2A 2L55A 3TP6A 4ODGA 1GUGA 1HFGA 5COYA 3OW7A 2F0WA 3IFTA 4FNFA 1ESRA 4A3DB 4WFN3 1DOMA 2KECA 2MPMA 3HOVB 1EOTA 1QWYA 1OXXK 2IPKD 3BVMA 2NTSA 2ICIA 2NN6I 3DM1A 3GO5A 4C3IG 2IT1A 4FP5D 4X3KA 1BF4A 3VYTA 3P20A 3NQIA 4HR7B 1CHPD 3NPPA 3CQZB 4X3TA 5DM73 1GUWA 4KV6A 2CW0D 2EYOA 3IL8A 1GOZA 2N88A 5CMDA 5EPJA 1IW7D 4FF3A 1TR5A 2JA6B 1KLUD 1HQRD 1AW7A 3EA6A 3Q6SA 3URYA 3PO2B 1SNCA 1PRTF 1RHPA 2SEBD 1GUNA 3CU7A 1GJXA 3EROA 2EXZA 1I4PA 4BA1I 1KDAA 3KLRA 1XXGA 1SDFA 1BDOA 3HKZB 3NE5B 3RLFA 2EYHA 4RWSC 1S5CD 4A3IB 1BUVT 4QF4A 1NUCA 1EY9A 4Q5VA 4O42A 3W2DA 2SNSA 4N9TA 1KTKA 1B53A 2E2JB 1I4QA 1E2WA 1S5FD 3X3NA 3G6JB 5BN3A 1EYCA 1SEBD 4C3HB 1MI2A 3GTGB 4IUQA 5J39A 2DY8A 2R92B 3GQBA 5FO8B 1TS2A 1U4PA 3TP7A 3TMEA 2BDOA 3E0JA 4TRDA 2EJFC 1SYDA 2E2HB 1S5ED 3J81L 2K6AA 1NCVA 1O80A 1NAPA 1Q8IA 2EYPA 4YIJA 4KJNA 3BDCA 2EJMA 1LT4D 1Q1EA 4QIWB 3KBXA 2F0VA 1I50B 4HAEA 1S5DD 3QIAA 4IUNA 3WOFA 1LV9A 1V8QA 2TMPA 3CRKC 1TWHB 2PZUA 1Q90A 2F0TA 3BYTB 3ERQA 5C4XB 5IGBA 3MFYA 1SYFA 1LT3D 1TY0A 5IGCA 1KDCA 5C3WA 3A8KE 2XSCA 5CORA 3NP8A 4ULLA 1MGSA 2FINB 5J22A 3O13A 2D62A 3GP7A 4ABNA 3FMCA 2G9HD 4C3JB 2YYZA 1YNJD 1GXDC 2JA7B 1BR9A 3K5NA 1G2SA 3SXHA 1OO9B 1SMYD 3N6RA 3SK5A 3QWNA 3GTQB 1F2MA 1LTSD 1HA5A 5G3LD 4UDUC 3I4NB 1GUOA 5F2DA 3A55A 4PMWA 3M7GA 3SK6A 1EU3A 5C5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NPP A;  2K5W A;  2K5Q A; 
#chains in the Genus database with same CATH topology
 1K0R A;  4BY7 G;  2RHS B;  3I7F A;  3K7U C;  4R4I A;  4DK3 C;  1X3E A;  4RKB A;  3AYH B;  1JE5 A;  1LT5 D;  1RIP A;  5IGG A;  1X3G A;  4ZAI A;  1HUN A;  1EQV A;  2BE5 C;  2TSS A;  1IKM A;  3F2U A;  1EY0 A;  4IOC A;  1VF7 A;  1Q46 A;  2J7Z A;  5J3B A;  1AFP A;  1SXT A;  3D4D A;  1HQM C;  1PMR A;  2JXM B;  2XNA C;  2CH4 W;  2D2C C;  5I4D A;  2XTI A;  3KBG A;  4L5T A;  1A0I A;  1LO5 D;  1ZYR C;  3U9O A;  5IY0 A;  3G48 A;  1YJN A;  3S1M B;  1F2L A;  3CQZ H;  4A3F H;  3NUC A;  5EGT A;  2RBM A;  2JK8 A;  2V1C C;  2IHF A;  1HR0 L;  1JB7 A;  2DUD A;  2AHO B;  1F77 A;  1TII D;  1LTA D;  3R2I A;  1K73 C;  1HA6 A;  3RZD H;  3ONA B;  3RMH A;  1Y1V B;  1LTB D;  2ICE C;  1IKL A;  1EWH A;  1E2Z A;  2KCM A;  1WD1 A;  2EYL A;  3HOX G;  1CI3 M;  4A3F G;  4DN4 M;  1OXV A;  2NZH A;  2PNH A;  1I4X A;  1IYU A;  1PRT C;  3EN2 A;  2A68 C;  4B9X A;  4CJ2 C;  5FLX c;  3AB9 A;  3M7N A;  2X69 A;  2NB0 A;  5CV7 A;  3K0Y A;  3OIP A;  1GD7 A;  4IAL A;  1JJ2 A;  1TS4 A;  1STH A;  5M3M G;  4DV6 L;  3NXW A;  3Q8D A;  4A3M H;  1X32 A;  3VYU A;  4FF4 A;  4ZLT F;  2DN8 A;  2PW7 A;  4DA2 A;  4R8I A;  3H94 A;  1FR3 A;  2QW7 A;  1L0W A;  1KD1 C;  3UDG A;  1A63 A;  1EY8 A;  3TDQ A;  3J80 i;  3HFZ B;  5EQ0 A;  2VQE L;  3GTO B;  4A76 A;  3L7Z C;  2HT1 A;  2WAC A;  4HMI A;  4BBR G;  3PCO B;  4B3M L;  2YTY A;  2B2Y C;  2RF4 A;  1Y8N B;  4FYD A;  2OF1 A;  3NEM A;  5E4X A;  2UUC L;  1PTO D;  2ZJP A;  2MO1 A;  2MJ8 A;  1TXY A;  3G6E A;  4GN3 B;  4XQQ A;  3M4P A;  1U9R A;  5IP9 H;  4H7B A;  4AQY Q;  3LNN A;  4DXG A;  2DNE A;  2BA1 A;  2YV5 A;  4BXX G;  2QA4 A;  4A3G G;  2WB1 E;  3K5L A;  2AQ1 B;  1HNZ L;  5HGT A;  4DV2 Q;  1FNU A;  5T1I A;  1XNQ Q;  1SFO H;  4EX5 A;  4BY1 G;  1QVF A;  1C0A A;  4K8J A;  2CHB D;  1CUK A;  2KCN A;  3TSS A;  1SBB B;  1HNW Q;  2RA4 A;  4GOP B;  3GTL H;  3E6Z X;  4KJO A;  4KHZ A;  4C2M H;  1A2T A;  5I2Y A;  1CKO A;  3S1R B;  3GTK B;  1T5X D;  4OIK A;  4DV0 L;  1NSN S;  5AFW A;  4GKJ Q;  4RH6 A;  3H3V C;  1STN A;  2PZT A;  2A6E C;  2JQO A;  1KL9 A;  1WCM B;  3QR8 A;  1UE6 A;  3T4A C;  5KNC A;  2NYZ D;  4JV5 Q;  2JA5 B;  2N3S A;  5GAE C;  3CMA A;  2ZM6 Q;  5D3D A;  4JBM A;  1Z47 A;  3AFP A;  3VR6 A;  4PZ7 A;  4V0B A;  3BZK A;  2A8V A;  1D6E C;  2NN6 H;  4DR7 L;  1PH2 A;  1BQQ T;  5C4X H;  1TWC B;  1PZI D;  2LKV A;  4U68 A;  1SNM A;  2KHS A;  2A5H A;  2E5L L;  1SE8 A;  3CKI B;  3R93 A;  1AZQ A;  1HZB A;  4YCV A;  1FL0 A;  1I6V C;  4POF A;  3NTI A;  4NXM Q;  1UE5 A;  1XWE A;  2ZTD A;  5JEA H;  2K33 A;  1LT6 D;  3C46 A;  5EBD A;  4Y7N H;  1N33 Q;  2I0Q A;  3HP3 A;  4GN5 A;  4N9P A;  3NBH A;  1QUQ B;  3QO2 A;  1XPO A;  5ELC A;  3C2P A;  1MHW C;  2UXD L;  3UDX A;  3W5O A;  1JIC A;  4C3J H;  5FLM H;  1Y1W B;  2JA7 H;  1YVC A;  4TSS A;  2R7Z B;  4POG A;  3PV0 A;  4JYA Q;  2SDF A;  1FJG Q;  1UEB A;  3S1Q H;  1QOH A;  2D9U A;  4IO9 A;  1EU4 A;  1XYI A;  2XN9 C;  2UXB Q;  3PO3 G;  1DON A;  4CHT B;  5FLX L;  2EYJ A;  3MXG A;  4DK1 A;  5IOD A;  2OEO A;  2EDG A;  2L5T A;  1MJC A;  5FLM G;  1Q1B A;  2Y0S B;  2R3Z A;  2JJQ A;  5CGK A;  1T9H A;  3F8T A;  4N8X 1;  2JYO A;  1PH9 A;  1STA A;  2DJF C;  2I5L X;  4IZ8 A;  3NWS A;  5C0X I;  2RCN A;  4GKK L;  4OEM B;  5A2Q E;  4DNT B;  1YJW A;  1QG7 A;  1SMX A;  1PHJ A;  4A3B H;  4NB3 A;  1X54 A;  1R4P B;  4ME5 A;  2ZJQ A;  2RDG A;  4MZ9 A;  3DMU A;  3FPP A;  1VQG A;  2FFK B;  3FKI B;  1XNR L;  3I4M H;  1WTV A;  1E1T A;  3KUP A;  4DR6 Q;  4KY7 A;  2JSO A;  1EL0 A;  2L15 A;  3U9S A;  1XJV A;  1KNE A;  1SSO A;  3BDL A;  2F0O A;  4LUV A;  2CVR A;  2NBF A;  1LTI D;  1L1O B;  3SEB A;  3VR2 A;  1T5E A;  2AQ2 B;  4QJF A;  4QY7 A;  3NQT A;  2K5V A;  3D6C A;  3H6M A;  1K0S A;  1Q81 C;  2OT2 A;  4HIO A;  3SK4 A;  4IPC A;  3I4M G;  1HXY D;  2B2Y A;  4ILW A;  2EY6 A;  3RN5 A;  3I8Z A;  1HH2 P;  2FMC A;  1SYC A;  1PZJ D;  2Z1C A;  4CBV A;  1Y1V H;  1A6X A;  1TKW B;  2PCF B;  2SOB A;  3MXU A;  3PUZ A;  4KLK A;  3ND8 A;  1B7Y B;  1X3P A;  1BXT A;  3HKZ E;  1ILQ A;  4ALP A;  4BY7 B;  4XYQ A;  2WV6 D;  3BG3 A;  1ICW A;  4K6L A;  4JI7 Q;  4RHR A;  4DV5 L;  3M4Q A;  2K03 A;  4KY6 A;  2V4D A;  4LF8 L;  2UU9 Q;  2H5X A;  3ULP A;  1DXM A;  2E2I H;  1IBK Q;  1F9Q A;  1NMF A;  2WIN B;  2ZXO A;  1DZ1 A;  4APV A;  3K59 A;  5IGF A;  5CR3 A;  3PUY A;  1O7L A;  4K6D A;  2VZA A;  3TZD A;  1K8O A;  1CKN B;  2F03 A;  1PYW D;  1OXU A;  1A3U A;  1VQ5 A;  1DCZ A;  5LMN L;  4JI8 L;  4B3R Q;  4KD4 A;  1CZG A;  2F0Q A;  4DGZ A;  1LAB A;  4B3S Q;  3FHW A;  5FO9 B;  2VS1 A;  1D5M C;  3CXC A;  4E6I A;  3PMF A;  4QQB X;  1SRU A;  2B8G A;  2XRS D;  2PQE A;  1R9T B;  1NR4 A;  2VXW A;  2JA8 H;  4BS9 A;  2BCO A;  2MUY A;  2RHQ B;  1EUJ A;  4JI0 Q;  3HOX B;  1B3A A;  3J81 j;  1YNN C;  3T51 B;  3D8G A;  2HQE A;  3HGB A;  2WAQ E;  4A3E G;  3J81 i;  4NW2 A;  1JCK B;  2MP1 A;  4JV5 L;  5EBC A;  1JWU D;  1MJE A;  4FF2 A;  4MN3 A;  3S1N B;  2JA8 G;  3JAM c;  4IOA A;  1UNS A;  1AZP A;  2OXP A;  5AJ3 Q;  4DKA C;  4JI5 Q;  2ATW A;  1GKH A;  5C4J B;  1SE3 A;  2O4X A;  4K5X A;  3KJO A;  4OWW B;  4JPB W;  4WJ3 M;  1J5E Q;  5A35 A;  4DR4 L;  2EIF A;  4P74 A;  1I4R A;  2OTL A;  3M4O B;  1KNA A;  1K3B C;  4F7X A;  4A3K H;  5CV6 A;  1MSG A;  2PO4 A;  4DR2 Q;  1KRT A;  1G6Z A;  2WFW A;  3S1R H;  2LY7 A;  4TVA B;  4J6H A;  4BBS H;  4XDX A;  1O7Z A;  1JE4 A;  4ZK9 B;  3OMC A;  4BBR B;  3GTP B;  4JVZ A;  2L1B A;  1PZK D;  4R4Q A;  3HOZ G;  2K32 A;  1N33 L;  2EPB A;  2JA5 H;  2IX0 A;  3AEV A;  5C6A A;  2X6G A;  1FNV A;  3BDO A;  4C56 C;  1PDQ A;  1Y8P B;  2FMM A;  4A3K G;  1E22 A;  1PVO A;  2F0M A;  4PZ6 A;  2L11 A;  4OGQ C;  1W6J A;  4X66 L;  4BBS G;  1QIL A;  4JYA L;  5C44 H;  1B2T A;  1FJG L;  1RTN A;  1SYG A;  4YY3 L;  2LXJ A;  4TQU S;  5DNF A;  5BN5 A;  5JAV A;  4DR3 Q;  2EJG C;  5KGU A;  4ZUJ A;  2F4I A;  2IW3 A;  3MC0 B;  3VYS A;  3I91 A;  2F4V Q;  3M9B A;  2WAQ B;  1ZYR D;  4IPH A;  4DK0 A;  2QGQ A;  3QJY A;  4BY1 B;  2QDL A;  5KIX A;  2QIL A;  2EE1 A;  4GLX A;  1CSP A;  1IHZ A;  4BWG B;  1STY A;  5EJW A;  2J4X A;  1JB3 A;  1VCI A;  4XT3 B;  5C44 G;  4DUZ Q;  1IBL L;  1PV4 A;  2VUM B;  2LSS A;  2WKD A;  2Q2H A;  3MZ5 A;  4X64 L;  1C8C A;  4OXP A;  3S2D B;  3FPU B;  2BOS A;  4I65 A;  2R93 B;  5G3L F;  1S5B D;  4ZQ3 A;  2LMC B;  4U67 3;  3OWE B;  2L0C A;  4QL5 A;  2HUG A;  1XMQ L;  1Q3L A;  2KUM A;  3ER0 A;  1ILP A;  1Y1W H;  3HOU G;  3PIP 3;  5M5X B;  1UUP A;  4KK7 A;  3M85 A;  2E76 C;  1PH7 A;  2G9D A;  1Y69 U;  4TKO B;  1CSQ A;  2NVQ B;  1BCP C;  2Z4I A;  1HJP A;  1EQQ A;  5CV9 A;  1I6H H;  1G29 1;  3U4V A;  2JP1 A;  4DV4 Q;  2KEN A;  2JEA I;  1H95 A;  4G4K A;  3UDI A;  2NVT H;  1Z6H A;  2EYM A;  1FGU A;  1KAA A;  5HUR A;  4CJ1 B;  3CCR A;  4YCW A;  1QNK A;  1PTO H;  4YWM A;  5M5Y B;  1E2V A;  1M4V A;  4HED A;  2B63 B;  4R4C A;  5FJ8 H;  5C3E H;  5M3F B;  3W1B A;  4NKL A;  1HRJ A;  1NBW A;  1R4Q B;  4LUO A;  1C4Q A;  1ET6 A;  1K28 A;  5M5W H;  1DD2 A;  2EYF A;  4OX9 Q;  5GQO A;  4HID A;  2LS0 1;  2E75 C;  2PYK A;  1IW7 C;  3A54 A;  2MGS A;  4JBW A;  3CCM A;  4FDB A;  5KNB A;  1L0X B;  3HOW H;  5D14 A;  4KKS A;  5IT9 E;  3BZD B;  1I5F A;  3OTO Q;  3VR4 A;  5KEE A;  3T53 B;  2A69 C;  4A3J G;  4DAP A;  1JWM D;  2K50 A;  4R9W A;  5C3E G;  1G2T A;  1STE A;  4LFC Q;  4DV3 L;  3MFG A;  2PPB C;  1U0L A;  1O7I A;  1XTD A;  3JAM E;  5CYU A;  3TS2 A;  3PO3 B;  4K14 A;  3CCQ A;  4QCL A;  1G51 A;  1TY2 A;  4XYO A;  3ZJY C;  1WTH A;  3R8B A;  3T1Y L;  3EIV A;  4XIG S;  3I2Z A;  4A93 G;  5I6Y A;  4A3D H;  4B3R L;  1C48 A;  4IFD I;  5IOC A;  1VDZ A;  3WWV A;  2IX3 A;  3HOV H;  1MBY A;  3BS1 A;  1GHK A;  1JMC A;  2B39 A;  2E8G A;  2I46 A;  1VQF A;  2PI2 E;  1LLR D;  4L6T B;  4FXD A;  2OTJ A;  2A1A A;  3K81 C;  4NXN Q;  4DV1 Q;  4JI4 L;  1VQL A;  1VQA A;  2NZ1 D;  1VQ8 A;  2MQH A;  4S3S A;  1WTO A;  5K5P A;  3K7A B;  5ELF A;  1BNZ A;  1LUZ A;  3J80 c;  1H9M A;  3L3O C;  4BA2 I;  2B2V C;  2KCT A;  2XWB B;  1RCV D;  3MA2 B;  2IHE A;  3LGJ A;  1PTO F;  4KMU C;  1ENA A;  3HEJ A;  1K83 B;  1YHA A;  3IKJ A;  1E24 A;  2ZT9 C;  5I6W A;  5KYL A;  1UE1 A;  4M1U B;  4L63 B;  2UUB Q;  1XPR A;  3J7A V;  3KF8 A;  4ZRZ A;  2Z8L A;  1QE6 A;  2XIW A;  3KDF A;  2JA6 H;  1GO3 E;  1EY4 A;  2KJX A;  4UP7 A;  2WP8 J;  1ENC A;  3BVZ A;  3P7J A;  3A8I E;  3PO2 H;  3OYY A;  1PRT B;  2F0D A;  1XMO L;  3NTH A;  4KY5 A;  3ULL A;  5IYD H;  1KRS A;  4X6A H;  2QCP X;  4C3I B;  4UHV A;  4K0K Q;  2VQF Q;  3HZX A;  3S1N H;  4HJ8 A;  1VQJ A;  2I07 B;  3CC4 A;  2KOL A;  1EWC A;  1U5K A;  1VMC A;  3W1G A;  1E1O A;  5C4J H;  5HY6 A;  3NK9 A;  5ISR A;  2CQA A;  2QDB A;  2I5M X;  3P1H A;  4AYB E;  1AN8 A;  2ZXR A;  4A3I H;  2XVS A;  3GDE A;  5JJZ A;  1PFB A;  1WTX A;  2RSO A;  4KHV A;  1VQ4 A;  1RTO A;  3KYH C;  3DLL A;  4EGV A;  5LL6 X;  4A3M G;  1HNX L;  1W3S A;  3Q23 A;  3HKZ G;  3DUZ A;  4KHP L;  2E2J H;  4C1N I;  4OWT B;  4DUZ L;  4LF5 L;  3OIQ A;  4K5V A;  2R7F A;  5C0X H;  3MTS A;  1YHQ A;  4A3I G;  4C3H H;  3RUZ A;  1H9S A;  2IWH A;  5H1S E;  3GTG H;  1STB A;  1VQE A;  3ZYY X;  1X56 A;  3P75 A;  4A3E B;  5ELB A;  1N34 Q;  2R92 H;  1QVG A;  1EY6 A;  3A8J E;  1VQP A;  4Q0F A;  2VY3 A;  1WTW A;  4K2K A;  2YU9 B;  4CKB A;  3BVG A;  1VMP A;  1CM9 A;  4OON A;  3GTJ B;  2E2H H;  4DU9 A;  1A62 A;  4HTH A;  4C3H G;  1XX8 A;  4PNY A;  1SMY C;  4LMQ D;  3GV3 A;  1WVL A;  2F0E A;  5IP9 G;  1UWV A;  2ZJR A;  3S2H B;  2D0P A;  4NP5 A;  2KEE A;  2R92 G;  3H0G B;  1EQT A;  4P73 A;  5CC4 A;  3HOY B;  1M1K C;  1EWI A;  1PFS A;  3PQI A;  2VUM H;  4J8Q A;  4RGT A;  4JC0 A;  2P5Z X;  4N8F A;  1KQS A;  2HHH Q;  4RAU C;  2K04 A;  3HG9 A;  2UUA L;  2F0J A;  4WOR A;  3ND9 A;  4K8I A;  5K36 H;  1I4G A;  4CGY B;  1I50 H;  1ZEQ X;  1ENF A;  1PH5 A;  2B8F A;  3HOZ B;  2UXC Q;  4AYB B;  1K8A C;  2OCE A;  4OX9 L;  3IRB A;  1UE7 A;  1ROD A;  1KDB A;  2Y0S E;  2G5D A;  1IBM Q;  2LXK A;  1KHI A;  2SNM A;  2NVQ H;  1DOK A;  4B3T L;  2AUK A;  1YIT A;  1TWH H;  1P8L A;  4I7A A;  1JC7 A;  1AE3 A;  3DXJ C;  3MWY W;  5K36 G;  3J80 E;  2OWO A;  1LTL A;  2O2L D;  2MHV A;  1N36 Q;  4QUC A;  2MO0 A;  1HUM A;  2F3V A;  5JVG 3;  1CHQ D;  1HCZ A;  3MHB A;  1N32 L;  3TN2 A;  3SHL A;  1U4L A;  3V05 A;  4KN4 C;  1S4Z A;  1CQF A;  3Q0A A;  2K4K A;  4GZY C;  2B63 H;  4LWC A;  2A6H C;  1VQM A;  2CWP A;  2NN6 G;  4ME3 A;  3OOC A;  1UEA B;  4LF6 L;  5C4X G;  2EXD A;  4GNX C;  1VQK A;  2NUC A;  2QEJ C;  3S15 B;  4FVM A;  1WYD A;  2Q8R E;  4GS3 A;  1XTC D;  2F0H A;  4I7Z C;  4A3C H;  4DUY Q;  1JJC B;  4YHH Q;  2B2V A;  2CKZ B;  2Q2U A;  3DWP A;  2QEX A;  3KJP A;  3TP5 A;  1PH6 A;  1EIG A;  1IYV A;  4QUF A;  5JEA G;  1RL2 A;  4NXN L;  4IUR A;  1DM0 B;  4JOI C;  4DFA A;  1B1Z A;  3NTK A;  4L5R C;  5CV8 A;  3KOJ A;  3LX0 A;  2AKW B;  4IN3 A;  1CFM A;  3GTQ H;  3S16 B;  1X55 A;  5IP7 H;  1Y8O B;  3I73 A;  1VQ9 A;  3OHX C;  1ZKO A;  3I4N H;  4C3J G;  2JA7 G;  1NNX A;  2F0L A;  4ID6 A;  1F9P A;  4RFB A;  3N52 A;  1X65 A;  4IPG A;  3A5Z B;  5EAY A;  4CDD C;  3A5U A;  3PUV A;  4IUV A;  3ULJ A;  3I55 A;  2C5C A;  1J8I A;  1OXS C;  4OL7 A;  1KXL A;  1L2F A;  1FNW A;  1EY7 A;  4KKT A;  1IYJ B;  4O1N A;  5A2Q L;  5JPN C;  1A2U A;  1W2B A;  1SE2 A;  1LTT D;  5E1F A;  2XWJ B;  3DEO A;  1U4R A;  2K75 A;  4K5W A;  3K7A H;  5KRU A;  3PIO A;  3STB D;  1WOC A;  3T13 A;  5J1Z A;  3EJI A;  3B6Y A;  3I4L A;  3PIO 3;  2I5H A;  1PTO C;  4K0K L;  3S1M H;  4A3B G;  4DNR B;  1TWA B;  2HD3 A;  1SNQ A;  1TVX A;  2B2W C;  1LTG D;  3I70 A;  1DOL A;  2YTV A;  1QJO A;  5EKL A;  2AQ3 B;  2GVA A;  4H13 C;  4YCU A;  3QOJ A;  4LNQ A;  4A93 B;  3I3C A;  5LMU Q;  4V19 0;  3K58 A;  1TWF B;  4OO1 I;  5E3F A;  1RKN A;  2KA7 A;  2HCI A;  2L4N A;  4FO2 A;  2Q8T A;  2O5J C;  5EKK A;  3LWU A;  2ALY B;  1PH1 A;  1V1P A;  1Q7Y C;  2PMZ E;  4DV7 Q;  2A19 A;  4NDX A;  5LHY 1;  1A15 A;  3M3Y B;  5DAU A;  1JR0 D;  1SAP A;  1RDP D;  2ZTE A;  1JWS D;  2BA0 A;  4DK6 C;  3IAY A;  1PXU A;  2HCC A;  4C3I H;  2D5D A;  5FKA C;  1O7Y A;  4DR5 Q;  1Y1V G;  1PH3 A;  1QZG A;  1SN8 A;  5I9O A;  4A3L H;  2Z4H A;  5ELO A;  4X3S A;  2VB2 X;  4AQY L;  3QOL A;  2K01 A;  3RZO B;  2RSN A;  3UDF A;  3NWT A;  5C0X J;  3CD6 A;  1BBX C;  1BBW A;  1B3Q A;  3KLS A;  1BCP D;  3H09 A;  1NR2 A;  3EQL C;  4G57 A;  4KN7 C;  4PQX A;  5IIF A;  4DV2 L;  1V43 A;  5T1G A;  1G8Z D;  2BDN A;  4HMJ A;  1XNQ L;  1QCB D;  3WOE A;  3GTO H;  3K57 A;  4UAI A;  4JI1 Q;  1N8R C;  2WII B;  1HNW L;  3KK7 A;  1AP0 A;  3NHH A;  4DAV A;  4A3F B;  5IE8 A;  1VQH A;  1VQN A;  4CKC A;  2M9V A;  5IT9 c;  3J7A 5;  3BYY B;  4HSV A;  4GKJ L;  2F3I A;  2JA9 A;  5JOB A;  4DR1 Q;  1Z7T A;  2UXC L;  1LAC A;  1JOR A;  5C5M A;  1RD9 D;  4XQN A;  4LAA A;  3E9I A;  5IGD A;  1JOK A;  4F88 A;  1IBM L;  3RZD B;  4IQZ A;  4JK1 C;  2NVY B;  2ZM6 L;  2EQS A;  5M3M B;  2RCF A;  4IJL A;  3A56 A;  2PMZ B;  4X62 Q;  1CZW A;  2A69 D;  2M2L A;  4RCO A;  2NWG A;  3F2B A;  4LF9 Q;  3MVV A;  4PV1 C;  4DXF A;  5NUC A;  3S2H H;  1EOV A;  4GNX A;  5JVH 3;  4GN4 B;  3H0G H;  4PG3 A;  3A74 A;  1NE3 A;  2K52 A;  1EYD A;  3DHQ A;  3OPO A;  1W6K A;  3K5O A;  4EQN A;  2KCC A;  4FXK C;  1STG A;  1GUT A;  4HJ5 A;  1K3R A;  2IY5 B;  4NXM L;  3D4R A;  3GTK H;  4A3M B;  4RMF A;  1JQY D;  1B44 D;  1HR0 Q;  3J7A F;  2FXQ A;  1Z9F A;  3CCJ A;  1BKB A;  4PMB A;  4NMZ A;  4IFD H;  3LWE A;  1WCM H;  4JOI A;  1HHV A;  3OSO A;  2F1M A;  4F8M A;  4EVO A;  1SE4 A;  4IUT A;  1TQO A;  1KAB A;  3MXN A;  2B2U C;  3Q24 A;  3E5S A;  5JEA J;  2K7V A;  2VB3 X;  1Q12 A;  5C4Z A;  4IUP A;  5C4H A;  1TWC H;  1YNX A;  3D4W A;  5CV4 A;  4IFD G;  4A3G B;  2BE5 D;  1F2Y A;  1H9J A;  1WCM G;  1H9R A;  4CDC C;  2MNA A;  1HZC A;  2UXB L;  2JA5 G;  5DEH A;  4PMC A;  1D2B A;  5IYB H;  1EY5 A;  4DV6 Q;  4DF7 A;  4LJZ C;  4MHE A;  4X65 Q;  2AMC B;  1MSH A;  4CDE C;  4YWK A;  2HIX A;  4G7Z C;  3J81 E;  4XQJ A;  2L12 A;  3S15 H;  1HTL D;  5GAH C;  4HJA A;  1TU2 B;  2FHT A;  3GD7 A;  1HR0 W;  1CK1 A;  4KD3 A;  1B9N A;  4WJW A;  5JPM C;  1X3F A;  4XT1 B;  2CH4 A;  1G91 A;  3F2D A;  3HKS A;  3VR5 A;  1A3T A;  1KAW A;  3FVQ A;  5LL6 S;  1A8V A;  1SFO B;  2PQA A;  2RDH A;  2XRQ D;  2R7Z H;  1J6Q A;  3SE0 A;  2VQE Q;  1B9M A;  1SND A;  2VL6 A;  3I90 A;  2B2W A;  2R6G A;  1BCP B;  1PRT D;  3TZU A;  4QB4 A;  2WB1 G;  2M00 A;  1H9S B;  2A68 D;  3GTL B;  4DR6 L;  1GUS A;  4C2M B;  3H15 A;  2NTT A;  2OQ0 A;  3KF6 A;  2C9O A;  4RGO S;  4WJ4 A;  1WTP A;  3A0J A;  2EOT A;  2HQL A;  4KKU A;  3CCL A;  1Y1W G;  1D5Z C;  3E9H A;  4ZYS A;  4HCE A;  1L1O A;  2YTX A;  1RJT A;  1RF2 D;  4GLA C;  5ELD A;  3X3M A;  3RNU A;  3GTM B;  3AFQ A;  3FRP B;  1HNZ Q;  1F2Z A;  3I4O A;  2EVB A;  2FJ2 A;  5D3I B;  2Z0S A;  4J1M A;  4P72 A;  1Q86 C;  1DYQ A;  2CW0 C;  2EY5 A;  3QG1 A;  3ICE A;  2N49 A;  2R7D A;  5CV5 A;  1ZXT A;  2E74 C;  3FKI H;  3SR1 A;  4R4O A;  4JI7 L;  4WRD A;  1P16 A;  2CWA A;  1EQR A;  3ITP A;  1E0B A;  1TS3 A;  5M9O A;  1MD2 D;  1HZ9 A;  2F3W A;  4M8A A;  2UU9 L;  2A73 B;  4RCN A;  2JEB I;  1PLF A;  5FJ8 G;  2WKC A;  3CC7 A;  1IBK L;  1DJR D;  3AU7 A;  3S17 B;  1TWA H;  4HN7 A;  4Y7N B;  1SJE D;  4L8J A;  2MFI A;  5IT9 L;  5FO7 B;  4PZ8 A;  3S24 A;  2EY1 A;  4FXG C;  3TRZ A;  3G7L A;  2J0T D;  3SVM A;  1CA6 A;  2K14 A;  3HOW G;  3D31 A;  2B2T C;  1M8A A;  3H3V I;  4O2D A;  4DR7 Q;  1F9R A;  3C1F A;  4P71 A;  3UE0 A;  4AH6 A;  2C35 B;  4C1N K;  3JAM L;  4B3S L;  3ERS X;  4LUZ A;  2HDL A;  4RKL A;  3S1Q B;  2KED A;  4HCS A;  2E5L Q;  2K28 A;  2IL8 A;  2KVM A;  1QB5 D;  1SJH D;  1VS0 A;  4JCV E;  2B3G A;  3TBI B;  4LF7 Q;  4BY7 H;  4R8N A;  1IL8 A;  1NTG A;  3R2T A;  3NEN A;  1IXR A;  3CCS A;  3CC2 A;  3AMU A;  2K5H A;  3A7L A;  3DWQ A;  4F87 A;  3K8A A;  3SDZ A;  4X3U A;  1WJJ A;  4JI0 L;  1SYE A;  1KIX A;  2PZW A;  3J7Z C;  1CQV A;  4A3D G;  1D7Q A;  2X6L A;  3R3O A;  2F0S A;  1CTM A;  3C1E A;  3NBH B;  4JW0 A;  4ZKC B;  4JI3 Q;  2A6E D;  3V96 A;  1HTP A;  1I94 Q;  3NSW A;  2ES2 A;  1WTQ A;  3HOV G;  1EEF D;  1K8M A;  1X3Q A;  3PUX A;  2NZO A;  3HS0 C;  3RZO H;  3RD4 A;  3EVQ A;  4A3B B;  3OWF A;  2UXD Q;  1JJG A;  4B9W A;  2ID0 A;  1JOQ A;  4L5Q A;  3SK8 A;  5AJ3 L;  1EYA A;  4JI5 L;  4X62 L;  4AIM A;  2LFN A;  2PW5 A;  3PF5 A;  4QMG A;  3I4M B;  3DEP A;  1PYS B;  4HSP A;  1UAP A;  4G7H C;  4LF9 L;  1YZ6 A;  1J5E L;  2Q2I A;  2XGT A;  2NVX B;  2DNC A;  1R9T H;  1LM0 A;  1YJ9 A;  3I72 A;  3MAQ A;  4RGM A;  4DR2 L;  1JOO A;  3L0O A;  3HOX H;  2B2U A;  4EQO A;  2A6H D;  5CBE E;  1KLG D;  3TP8 A;  3UE1 A;  5D65 A;  3VR3 A;  3DWA A;  4MIU A;  2GA4 B;  4RA8 A;  1B4O A;  1PH4 A;  4GKK Q;  2OQK A;  2JA6 G;  1QNU A;  2NVY H;  1BO0 A;  1WD0 A;  3AQQ A;  3CHB D;  5EKI A;  5M3M H;  2CFM A;  3PGZ A;  1VQO A;  3CCV A;  1PFM A;  5DM6 3;  1TS5 A;  3KLW A;  5IWA Q;  4B08 A;  3PO2 G;  4IFD J;  1EYG A;  5CBA E;  1XNR Q;  2VNU D;  3MXP A;  1GVP A;  1II3 A;  1X9N A;  4LFA Q;  2AWN A;  1VF5 C;  4GLV B;  1PFN A;  5IYD G;  3WDN A;  4DR3 L;  1V9P A;  2IJ0 A;  3M4O H;  2A74 C;  2F52 A;  1CT1 D;  4H44 C;  3PF4 A;  1ONL A;  2F4V L;  2E2I B;  4RHS A;  4DNI A;  4X65 L;  3Q22 A;  1OTC A;  1D5X C;  1BVS A;  3C3L A;  4BBR H;  1VQC A;  3GTP H;  2K5W A;  3MEH A;  2ZXP A;  3K80 C;  1O78 A;  1A3V A;  1V1P B;  1J9O A;  3K6O A;  1VQI A;  2F0F A;  2O5I C;  1LTR D;  1EFI D;  4DAY A;  4P2C B;  4K2L A;  4DAM A;  2F0P A;  5HGQ A;  2PNR C;  4OWX B;  4BXX H;  4EQP A;  4DV5 Q;  2JA8 B;  4A3G H;  4JI6 Q;  5KND A;  4LF8 Q;  1YNJ C;  5C0X G;  4CJ0 B;  2Z9H A;  3T16 A;  1EIH A;  2K5Q A;  1FGB D;  2ENB A;  2DY7 A;  4BY1 H;  4UP9 A;  4DV4 L;  2E2D C;  1I4H A;  3TRE A;  1XPU A;  1H9K A;  2BH2 A;  3TEH B;  4J15 A;  2Z6B A;  5TSS A;  3S2D H;  5LMN Q;  2R93 H;  1ET9 A;  4JI8 Q;  4EQ5 A;  3BJU A;  2RQX A;  2D0O A;  3JC6 6;  2WAQ G;  4YWL A;  4OO1 H;  1U4M A;  5M5X H;  1AH9 A;  3UI2 A;  1BBU A;  1YI2 A;  3VA7 A;  2H1E A;  1L0Y B;  2EZV A;  3W3A A;  4A3K B;  2VUM G;  5KYI A;  2N55 A;  3NBI A;  2B2T A;  4OIJ A;  4GOP C;  1FD7 D;  3OTO L;  2R93 G;  4BBS B;  3S14 B;  3T56 B;  2F0U A;  1SRO A;  3S9W A;  2QKI C;  4RG1 A;  1PA6 A;  1C7Y A;  1F9S A;  5DLQ E;  1S40 A;  4OO1 G;  4LFC L;  1TWG B;  1WFQ A;  1K8G A;  3V2T A;  4FF1 A;  5I9P A;  1D1I A;  3GTM H;  3QB3 A;  4RGN A;  2HDM A;  3J80 L;  5I2X A;  1QZH A;  5IGE A;  3IFD A;  5M5Y H;  2L9H A;  4IJH A;  4JBK A;  2F0I A;  2R61 A;  3M4Y A;  5BR8 Q;  4GNX B;  2Q8I B;  1FYC A;  1WI5 A;  2F0N A;  1AEX A;  2RKS A;  4H02 A;  5M3F H;  3T1H Q;  5C44 B;  1B8A A;  1HPC A;  5IYC H;  1NJI C;  3U58 A;  4DR4 Q;  5LMN W;  5C3X A;  3CME A;  4Z9C B;  1EZ6 A;  5JJI A;  2F0G A;  2H4O A;  1AE2 A;  4LF7 L;  1E7Z A;  4KTA A;  1PH8 A;  3J7Y W;  1EEI D;  4LFB Q;  2K05 A;  3HOU B;  5E4W C;  5EPL A;  2B63 G;  1YNN D;  3OW2 A;  1S3O A;  4DV1 L;  1D8L A;  3FDT A;  5M3F G;  2KQ3 A;  3S17 H;  2WB1 B;  1SYB A;  4JI3 L;  4JBJ A;  3MXN B;  5BN4 A;  5IYC G;  1I94 L;  5FOB B;  3PO3 H;  1B50 A;  2EY2 A;  3HRZ C;  1SNO A;  4A3C G;  4OHJ A;  3GV6 A;  1D1K A;  4XTC S;  2KHI A;  2Z6K C;  3FEW X;  4H0L C;  2B29 A;  3K5M A;  3RN2 A;  1CA5 A;  4X66 Q;  2K1B A;  1V1Q A;  4ZKB B;  5FLX E;  3U4Z A;  4YY3 Q;  1GM5 A;  2UUB L;  2F0K A;  1OXT A;  2AUJ D;  2AWO A;  1BCP F;  4JI2 Q;  1GHJ A;  1I6H B;  1VQD A;  3D6W A;  5IP7 G;  4LK1 C;  3E0E A;  4ZUI A;  5ELE A;  3I4N G;  1DGS A;  4LW1 A;  4IUU A;  3VA5 A;  3OMG A;  2NVT B;  3L9A X;  5EPK A;  2K5D A;  1WTR A;  1IBL Q;  3KLS X;  3D3R A;  1HFN A;  4CKE A;  4X64 Q;  1BOS A;  1PTO B;  4MTK A;  2PQA B;  1E3P A;  3L2P A;  3PUW A;  4A3J B;  2JE6 I;  2VQF L;  1XMQ Q;  3VYR A;  5C3E B;  5L37 A;  1K83 H;  1IL2 A;  4HIK A;  3CRL C;  5M5W B;  4G7O C;  1SNP A;  1N9W A;  5IWA L;  1V1O A;  2RDF A;  2RVL A;  3PSI A;  5FK9 C;  1EZ8 A;  3A7A B;  1M90 C;  3HOW B;  4XXE A;  1I3Q B;  3K0X A;  3KF6 B;  4LFA L;  1ESF A;  3CP0 A;  3J81 c;  2NVX H;  3E3X A;  3D0F A;  2PI2 A;  2QF7 A;  3H91 A;  2IX1 A;  4KI0 A;  3EFX D;  1ML0 D;  3RR5 A;  4HIM A;  1TT2 A;  1JT8 A;  2L55 A;  3TP6 A;  4ODG A;  1GUG A;  1L1O C;  1HFG A;  5COY A;  3OW7 A;  2F0W A;  3IFT A;  1ICF B;  1YBY A;  4FNF A;  1ESR A;  4A3D B;  4WFN 3;  1DOM A;  1HZA A;  2KEC A;  1X6O A;  3BU2 A;  3MEF A;  1EIF A;  1N34 L;  3CPF A;  2MPM A;  3HOV B;  1EOT A;  1QWY A;  1OXX K;  2IPK D;  3BVM A;  2VW9 A;  2NTS A;  2ICI A;  2NN6 I;  3DM1 A;  3GO5 A;  4JI6 L;  1PYB A;  2HIV A;  4C3I G;  5GAG C;  2IT1 A;  4FP5 D;  4X3K A;  4QGU A;  4UY8 C;  1BF4 A;  3VYT A;  4DV3 Q;  3P20 A;  3CW2 C;  4A3L G;  3NQI A;  3F2C A;  3EBE A;  4ZCK A;  4HR7 B;  3T1Y Q;  2CQO A;  1CHP D;  3NPP A;  3NEL A;  3CQZ B;  3CF5 A;  2HHH L;  4X3T A;  4GOP A;  5DM7 3;  4LF4 Q;  1GUW A;  1NY4 A;  1B70 B;  4A3E H;  4KV6 A;  2CW0 D;  2EYO A;  3IL8 A;  4UPA A;  1GOZ A;  2N88 A;  5CMD A;  5EPJ A;  1IW7 D;  4FF3 A;  1TR5 A;  2JA6 B;  4MNO A;  1KLU D;  4OEL B;  2YU9 H;  1HQR D;  4DPG A;  3CPW A;  4P75 A;  3GTJ H;  1AW7 A;  5GAD C;  3EA6 A;  1NMG A;  3Q6S A;  4MTN A;  3URY A;  1Q82 C;  3PO2 B;  4JI4 Q;  1EIY B;  5JJL A;  1QVC A;  1SNC A;  3F1Z A;  1PRT F;  1RHP A;  2SEB D;  1GUN A;  3CU7 A;  1N36 L;  2KBN A;  2ZTC A;  3HOY H;  1GJX A;  1YHB A;  3ERO A;  2EXZ A;  1I4P A;  1Q8K A;  4BA1 I;  1KDA A;  3KLR A;  1SR3 A;  3CCU A;  4O0A A;  1XXG A;  3TQY A;  1SDF A;  1IZ6 A;  3H3V H;  1BDO A;  3KF8 B;  3HKZ B;  3NE5 B;  4NPS A;  5BR8 L;  3T1H L;  4QIW E;  3KDF B;  3HOZ H;  2Q2T A;  1VQ6 A;  3RLF A;  2EYH A;  4RWS C;  1VQB A;  2DGY A;  1S5C D;  3CAM A;  4A3I B;  3H0G G;  1BUV T;  3HOY G;  1KC8 C;  4QF4 A;  1NUC A;  2K5N A;  1EY9 A;  4LFB L;  2N78 A;  4DUY L;  4YHH L;  4Q5V A;  2DJG C;  4A75 A;  4O42 A;  1QUQ A;  3W2D A;  5JJK A;  3S14 H;  2SNS A;  2Z6K A;  4N9T A;  1XMO Q;  1KTK A;  1B53 A;  2E2J B;  1K9M C;  3I56 A;  1I4Q A;  1E2W A;  1S5F D;  2JN4 A;  3X3N A;  3STB C;  1TWG H;  2N8N A;  4R4T A;  3G6J B;  4AYB G;  3G71 A;  5BN3 A;  1EYC A;  5E7N A;  1SEB D;  4C3H B;  1MI2 A;  3GTG B;  4IUQ A;  5J39 A;  2DY8 A;  2R92 B;  3GQB A;  5FO8 B;  4HJ7 A;  1TS2 A;  1U4P A;  4JG2 A;  3TP7 A;  4L5S A;  3TME A;  2BDO A;  3E0J A;  4TRD A;  2EJF C;  1SYD A;  4A4I A;  2E2H B;  1S5E D;  4JI2 L;  2CCZ A;  3J81 L;  3HOU H;  4CDF C;  5IYB G;  3TS0 A;  1C9O A;  3FP9 A;  1HNX Q;  2K6A A;  2BH8 A;  3KFU A;  4KHP Q;  1G6P A;  1NCV A;  3DM3 A;  4B3M Q;  1O80 A;  4LF5 Q;  1NAP A;  4IPD A;  1Q8I A;  3JAM i;  2EYP A;  4YIJ A;  3S16 H;  4KJN A;  3BDC A;  1CKM A;  2KHJ A;  2EJM A;  2UUC Q;  1LT4 D;  1Q1E A;  4QIW B;  3KBX A;  4DAY B;  2F0V A;  3PIP A;  1I50 B;  4HAE A;  3SGI A;  2R7Z G;  1S5D D;  3QIA A;  4IUN A;  3WOF A;  1LV9 A;  2GN5 A;  1V8Q A;  1VQ7 A;  2TMP A;  3CRK C;  1TWH B;  2PZU A;  1Q90 A;  5LMU L;  2ASB A;  2F0T A;  3BYT B;  3ERQ A;  5C4X B;  5IGB A;  3U50 C;  3MFY A;  1SYF A;  2Y0S G;  1LYL A;  4DV7 L;  1LT3 D;  1ASZ A;  5GRO A;  1TY0 A;  5IGC A;  1KDC A;  1MIU A;  3A8K E;  5C3W A;  2XSC A;  2UUA Q;  5COR A;  4A3J H;  4DV0 Q;  3RLN A;  1SLJ A;  4R1J A;  4DR5 L;  1Y14 B;  3NP8 A;  1MGS A;  4ULL A;  1FVI A;  2FIN B;  5J22 A;  1YIJ A;  1S72 A;  3O13 A;  2D62 A;  3GP7 A;  4HJ9 A;  4Y52 H;  3FKI G;  3RLO A;  4ABN A;  4B3T Q;  1I3Q H;  3FMC A;  1ASY A;  3VDY A;  4A93 H;  2G9H D;  1EFW A;  2YYZ A;  4C3J B;  1YNJ D;  1GXD C;  2JA7 B;  1BR9 A;  1CKN A;  1TWF H;  1G2S A;  3K5N A;  3SXH A;  1OO9 B;  1SMY D;  3N6R A;  3SK5 A;  3QWN A;  3BZC A;  3GTQ B;  3M3Y H;  4JI1 L;  1N32 Q;  1MKH A;  4UP8 A;  1F2M A;  1LTS D;  5ELN A;  1HA5 A;  5G3L D;  4UDU C;  3I4N B;  1GUO A;  5F2D A;  3CCE A;  3A55 A;  2GVB A;  3G4S A;  4LF6 Q;  4LF4 L;  4PMW A;  3M7G A;  3SK6 A;  1EU3 A;  1YEZ A;  4DR1 L;  5C5L A; 
#chains in the Genus database with same CATH homology
 4RKB A;  1LT5 D;  5IGG A;  4ZAI A;  1HUN A;  1EQV A;  2BE5 C;  2TSS A;  1IKM A;  3F2U A;  1EY0 A;  1VF7 A;  2J7Z A;  1AFP A;  1SXT A;  3D4D A;  1HQM C;  1PMR A;  2JXM B;  2XNA C;  2D2C C;  5I4D A;  3KBG A;  1ZYR C;  1LO5 D;  3U9O A;  3S1M B;  1F2L A;  3NUC A;  5EGT A;  2RBM A;  1F77 A;  1TII D;  1LTA D;  3R2I A;  1HA6 A;  3ONA B;  3RMH A;  1Y1V B;  1LTB D;  2ICE C;  1IKL A;  1EWH A;  1E2Z A;  1WD1 A;  2EYL A;  1CI3 M;  4DN4 M;  1OXV A;  1I4X A;  1IYU A;  1PRT C;  2A68 C;  4B9X A;  4CJ2 C;  3AB9 A;  3M7N A;  2X69 A;  2NB0 A;  5CV7 A;  3K0Y A;  3OIP A;  4IAL A;  1TS4 A;  1STH A;  3NXW A;  1X32 A;  3VYU A;  4FF4 A;  4ZLT F;  2DN8 A;  2PW7 A;  4DA2 A;  4R8I A;  3H94 A;  1FR3 A;  1EY8 A;  3TDQ A;  5EQ0 A;  3GTO B;  3L7Z C;  2WAC A;  4HMI A;  2B2Y C;  1Y8N B;  4FYD A;  2OF1 A;  5E4X A;  1PTO D;  2MJ8 A;  4XQQ A;  1U9R A;  4H7B A;  3LNN A;  4DXG A;  2DNE A;  2BA1 A;  3K5L A;  2AQ1 B;  5HGT A;  1FNU A;  5T1I A;  4K8J A;  2CHB D;  2KCN A;  3TSS A;  1SBB B;  2RA4 A;  3E6Z X;  4KJO A;  4KHZ A;  5I2Y A;  1A2T A;  3S1R B;  3GTK B;  1T5X D;  4OIK A;  1NSN S;  5AFW A;  4RH6 A;  3H3V C;  1STN A;  2PZT A;  2A6E C;  1WCM B;  3T4A C;  5KNC A;  2NYZ D;  2JA5 B;  5D3D A;  1Z47 A;  3VR6 A;  4V0B A;  1D6E C;  2NN6 H;  1BQQ T;  1TWC B;  1PZI D;  2LKV A;  4U68 A;  1SNM A;  2KHS A;  2A5H A;  3CKI B;  3R93 A;  1AZQ A;  1I6V C;  3NTI A;  1XWE A;  5JEA H;  2K33 A;  1LT6 D;  3C46 A;  5EBD A;  3HP3 A;  4N9P A;  3NBH A;  3QO2 A;  5ELC A;  3C2P A;  1Y1W B;  1JIC A;  4TSS A;  2R7Z B;  3PV0 A;  2SDF A;  1QOH A;  2D9U A;  1EU4 A;  1XYI A;  2XN9 C;  1DON A;  4CHT B;  5FLX L;  2EYJ A;  3MXG A;  4DK1 A;  5IOD A;  2OEO A;  2EDG A;  2L5T A;  1Q1B A;  2Y0S B;  2R3Z A;  5CGK A;  2JYO A;  1STA A;  4IZ8 A;  3NWS A;  5C0X I;  5A2Q E;  4DNT B;  1QG7 A;  1R4P B;  4ME5 A;  2RDG A;  3DMU A;  3FPP A;  3FKI B;  2FFK B;  1WTV A;  3KUP A;  4KY7 A;  2JSO A;  1EL0 A;  3U9S A;  1KNE A;  1SSO A;  3BDL A;  2F0O A;  2CVR A;  2NBF A;  1LTI D;  3SEB A;  3VR2 A;  1T5E A;  2AQ2 B;  3NQT A;  3D6C A;  3H6M A;  2OT2 A;  3SK4 A;  1HXY D;  2B2Y A;  4ILW A;  2EY6 A;  3I8Z A;  2FMC A;  1SYC A;  1PZJ D;  2Z1C A;  4CBV A;  1A6X A;  1TKW B;  2PCF B;  2SOB A;  3MXU A;  3PUZ A;  3ND8 A;  1X3P A;  1BXT A;  1ILQ A;  4BY7 B;  4XYQ A;  2WV6 D;  3BG3 A;  1ICW A;  4K6L A;  4RHR A;  2K03 A;  4KY6 A;  2V4D A;  1DXM A;  1F9Q A;  2WIN B;  2ZXO A;  1DZ1 A;  3K59 A;  5IGF A;  5CR3 A;  3PUY A;  1O7L A;  4K6D A;  3TZD A;  1K8O A;  2F03 A;  1PYW D;  1OXU A;  1A3U A;  1DCZ A;  4KD4 A;  1CZG A;  2F0Q A;  4DGZ A;  1LAB A;  5FO9 B;  1D5M C;  4E6I A;  3PMF A;  2B8G A;  2XRS D;  2PQE A;  1R9T B;  1NR4 A;  2VXW A;  4BS9 A;  2BCO A;  2MUY A;  3HOX B;  1B3A A;  1YNN C;  3T51 B;  3D8G A;  2HQE A;  3HGB A;  4NW2 A;  1JCK B;  2MP1 A;  5EBC A;  1JWU D;  4FF2 A;  4MN3 A;  3S1N B;  1UNS A;  1AZP A;  2OXP A;  5C4J B;  1SE3 A;  2O4X A;  4K5X A;  5A35 A;  1I4R A;  3M4O B;  1KNA A;  4F7X A;  5CV6 A;  1MSG A;  2PO4 A;  1G6Z A;  2LY7 A;  4J6H A;  4XDX A;  1O7Z A;  1JE4 A;  4ZK9 B;  3OMC A;  4BBR B;  3GTP B;  2L1B A;  1PZK D;  2K32 A;  2EPB A;  2IX0 A;  5C6A A;  2X6G A;  1FNV A;  4C56 C;  3BDO A;  1PDQ A;  1Y8P B;  2FMM A;  2F0M A;  2L11 A;  4OGQ C;  1W6J A;  1QIL A;  1B2T A;  1RTN A;  1SYG A;  4TQU S;  5DNF A;  5BN5 A;  5JAV A;  2EJG C;  5KGU A;  4ZUJ A;  2F4I A;  2IW3 A;  3MC0 B;  3VYS A;  3I91 A;  2WAQ B;  1ZYR D;  4DK0 A;  3QJY A;  4BY1 B;  5KIX A;  2QIL A;  2EE1 A;  1IHZ A;  4BWG B;  1STY A;  5EJW A;  2J4X A;  1JB3 A;  1VCI A;  4XT3 B;  2VUM B;  2WKD A;  3MZ5 A;  1C8C A;  3S2D B;  3FPU B;  2BOS A;  4I65 A;  2R93 B;  5G3L F;  1S5B D;  4ZQ3 A;  2LMC B;  4U67 3;  3OWE B;  2L0C A;  2HUG A;  1Q3L A;  2KUM A;  1ILP A;  3PIP 3;  5M5X B;  1UUP A;  4KK7 A;  3M85 A;  2E76 C;  2G9D A;  1Y69 U;  4TKO B;  2NVQ B;  1BCP C;  2Z4I A;  5CV9 A;  1G29 1;  2JP1 A;  2JEA I;  4G4K A;  1Z6H A;  2EYM A;  1KAA A;  5HUR A;  4CJ1 B;  1QNK A;  1PTO H;  5M5Y B;  1E2V A;  1M4V A;  4HED A;  2B63 B;  5M3F B;  1HRJ A;  4NKL A;  1R4Q B;  1DD2 A;  1C4Q A;  1ET6 A;  2EYF A;  2LS0 1;  2E75 C;  2PYK A;  1IW7 C;  3A54 A;  2MGS A;  4JBW A;  5KNB A;  1L0X B;  5D14 A;  4KKS A;  5IT9 E;  3BZD B;  3VR4 A;  5KEE A;  3T53 B;  2A69 C;  4DAP A;  1JWM D;  4R9W A;  1G2T A;  1STE A;  2PPB C;  3MFG A;  3JAM E;  5CYU A;  3PO3 B;  4K14 A;  4QCL A;  1TY2 A;  4XYO A;  3R8B A;  4XIG S;  5I6Y A;  1C48 A;  4IFD I;  5IOC A;  1VDZ A;  2IX3 A;  1MBY A;  3BS1 A;  1GHK A;  2B39 A;  2I46 A;  1LLR D;  4L6T B;  4FXD A;  2NZ1 D;  4S3S A;  1WTO A;  5K5P A;  3K7A B;  5ELF A;  1BNZ A;  1H9M A;  3L3O C;  4BA2 I;  2B2V C;  2XWB B;  1RCV D;  3MA2 B;  4KMU C;  1PTO F;  1ENA A;  3HEJ A;  1K83 B;  3IKJ A;  2ZT9 C;  5I6W A;  5KYL A;  4M1U B;  4L63 B;  3J7A V;  3KF8 A;  4ZRZ A;  2Z8L A;  1QE6 A;  2XIW A;  1EY4 A;  2KJX A;  2WP8 J;  1ENC A;  3BVZ A;  3P7J A;  3A8I E;  1PRT B;  2F0D A;  3NTH A;  4KY5 A;  2QCP X;  4C3I B;  3HZX A;  2I07 B;  2KOL A;  1EWC A;  1VMC A;  3NK9 A;  5ISR A;  2CQA A;  2QDB A;  3P1H A;  1AN8 A;  2ZXR A;  2XVS A;  5JJZ A;  1PFB A;  1WTX A;  2RSO A;  4KHV A;  1RTO A;  4EGV A;  5LL6 X;  3Q23 A;  3DUZ A;  4C1N I;  3OIQ A;  4K5V A;  5C0X H;  3MTS A;  3RUZ A;  1H9S A;  2IWH A;  1STB A;  3ZYY X;  3P75 A;  4A3E B;  5ELB A;  1EY6 A;  3A8J E;  4Q0F A;  1WTW A;  4K2K A;  2YU9 B;  4CKB A;  3BVG A;  1VMP A;  1CM9 A;  3GTJ B;  4DU9 A;  4HTH A;  4C3H G;  1XX8 A;  4PNY A;  1SMY C;  4LMQ D;  3GV3 A;  1WVL A;  2F0E A;  3S2H B;  4NP5 A;  2KEE A;  3H0G B;  1EQT A;  5CC4 A;  3HOY B;  4J8Q A;  4RGT A;  4RAU C;  2K04 A;  3HG9 A;  2F0J A;  4WOR A;  3ND9 A;  4K8I A;  5K36 H;  1I4G A;  4CGY B;  1ZEQ X;  1ENF A;  2B8F A;  3HOZ B;  4AYB B;  1ROD A;  1KDB A;  2SNM A;  1DOK A;  2AUK A;  1JC7 A;  3DXJ C;  3MWY W;  5K36 G;  3J80 E;  2O2L D;  2MHV A;  4QUC A;  1HUM A;  2F3V A;  5JVG 3;  1CHQ D;  1HCZ A;  3MHB A;  3TN2 A;  3SHL A;  1U4L A;  3V05 A;  4KN4 C;  1S4Z A;  1CQF A;  3Q0A A;  4GZY C;  2A6H C;  2NN6 G;  3OOC A;  1UEA B;  2NUC A;  2QEJ C;  3S15 B;  4FVM A;  2Q8R E;  1XTC D;  2F0H A;  4I7Z C;  2B2V A;  3DWP A;  3TP5 A;  1EIG A;  1IYV A;  4QUF A;  5JEA G;  4IUR A;  1DM0 B;  4DFA A;  1B1Z A;  3NTK A;  5CV8 A;  3LX0 A;  3S16 B;  4IN3 A;  1CFM A;  1Y8O B;  3I73 A;  3OHX C;  1ZKO A;  4C3J G;  2F0L A;  4ID6 A;  1F9P A;  4RFB A;  3N52 A;  3PUV A;  4IUV A;  2C5C A;  1J8I A;  1OXS C;  4OL7 A;  1FNW A;  1EY7 A;  4KKT A;  4O1N A;  5A2Q L;  5JPN C;  1A2U A;  1SE2 A;  1LTT D;  5E1F A;  2XWJ B;  3DEO A;  1U4R A;  5KRU A;  4K5W A;  3T13 A;  5J1Z A;  3EJI A;  3I4L A;  3PIO 3;  1PTO C;  4DNR B;  1TWA B;  1SNQ A;  1TVX A;  2B2W C;  1LTG D;  3I70 A;  1DOL A;  1QJO A;  5EKL A;  2AQ3 B;  4H13 C;  3QOJ A;  4A93 B;  3I3C A;  4V19 0;  3K58 A;  1TWF B;  4OO1 I;  5E3F A;  1RKN A;  2KA7 A;  2HCI A;  2L4N A;  4FO2 A;  2Q8T A;  2O5J C;  5EKK A;  3LWU A;  1V1P A;  4NDX A;  5LHY 1;  1A15 A;  3M3Y B;  5DAU A;  1JR0 D;  1SAP A;  1RDP D;  1JWS D;  2BA0 A;  3IAY A;  1PXU A;  2HCC A;  2D5D A;  5FKA C;  1O7Y A;  5I9O A;  2Z4H A;  4X3S A;  2VB2 X;  3QOL A;  2K01 A;  3RZO B;  2RSN A;  3NWT A;  5C0X J;  1BBX C;  3KLS A;  1BCP D;  3H09 A;  1NR2 A;  3EQL C;  4G57 A;  4KN7 C;  4PQX A;  5IIF A;  1V43 A;  5T1G A;  1G8Z D;  2BDN A;  4HMJ A;  1QCB D;  3WOE A;  3K57 A;  4UAI A;  2WII B;  3KK7 A;  1AP0 A;  3NHH A;  4DAV A;  4A3F B;  4CKC A;  2M9V A;  3BYY B;  4HSV A;  5JOB A;  1Z7T A;  1LAC A;  1JOR A;  5C5M A;  1RD9 D;  4XQN A;  4LAA A;  5IGD A;  1JOK A;  4F88 A;  3RZD B;  4IQZ A;  4JK1 C;  2NVY B;  5M3M B;  3A56 A;  2PMZ B;  1CZW A;  2A69 D;  2M2L A;  4RCO A;  2NWG A;  3MVV A;  4PV1 C;  4DXF A;  5NUC A;  5JVH 3;  1EYD A;  3DHQ A;  3OPO A;  1W6K A;  3K5O A;  4EQN A;  2KCC A;  4FXK C;  1STG A;  1GUT A;  3D4R A;  4A3M B;  1JQY D;  1B44 D;  3J7A F;  4PMB A;  4NMZ A;  4IFD H;  3LWE A;  1HHV A;  3OSO A;  2F1M A;  4F8M A;  4EVO A;  1SE4 A;  4IUT A;  1TQO A;  1KAB A;  3MXN A;  2B2U C;  3Q24 A;  3E5S A;  5JEA J;  2K7V A;  2VB3 X;  1Q12 A;  5C4Z A;  4IUP A;  5C4H A;  3D4W A;  5CV4 A;  4IFD G;  4A3G B;  2BE5 D;  1F2Y A;  1H9J A;  1H9R A;  5DEH A;  4PMC A;  1D2B A;  1EY5 A;  4DF7 A;  4LJZ C;  4MHE A;  1MSH A;  4G7Z C;  3J81 E;  4XQJ A;  2L12 A;  1HTL D;  1TU2 B;  2FHT A;  3GD7 A;  1CK1 A;  4KD3 A;  1B9N A;  4WJW A;  5JPM C;  4XT1 B;  1G91 A;  3VR5 A;  1A3T A;  3FVQ A;  5LL6 S;  1SFO B;  2RDH A;  2XRQ D;  3SE0 A;  1B9M A;  1SND A;  3I90 A;  2B2W A;  2R6G A;  1BCP B;  1PRT D;  3TZU A;  4QB4 A;  2M00 A;  1H9S B;  2A68 D;  3GTL B;  1GUS A;  4C2M B;  2NTT A;  2C9O A;  4RGO S;  1WTP A;  2EOT A;  4KKU A;  1D5Z C;  4ZYS A;  4HCE A;  1RJT A;  1RF2 D;  3X3M A;  5ELD A;  3GTM B;  3FRP B;  1F2Z A;  2EVB A;  2FJ2 A;  5D3I B;  4J1M A;  1DYQ A;  2CW0 C;  2EY5 A;  3QG1 A;  5CV5 A;  1ZXT A;  2E74 C;  3SR1 A;  4WRD A;  3ITP A;  1E0B A;  1TS3 A;  5M9O A;  1MD2 D;  2F3W A;  4M8A A;  2A73 B;  4RCN A;  2JEB I;  1PLF A;  2WKC A;  1DJR D;  3AU7 A;  3S17 B;  4HN7 A;  4Y7N B;  1SJE D;  4L8J A;  5IT9 L;  5FO7 B;  2EY1 A;  4FXG C;  3G7L A;  2J0T D;  3SVM A;  1CA6 A;  3D31 A;  2B2T C;  1M8A A;  1F9R A;  3C1F A;  4C1N K;  3JAM L;  3S1Q B;  2HDL A;  4RKL A;  2KED A;  4HCS A;  2K28 A;  2IL8 A;  2KVM A;  1QB5 D;  1SJH D;  3TBI B;  4R8N A;  1IL8 A;  3R2T A;  3AMU A;  3A7L A;  4F87 A;  3DWQ A;  3SDZ A;  4X3U A;  1SYE A;  2PZW A;  1CQV A;  2X6L A;  3R3O A;  2F0S A;  1CTM A;  3C1E A;  4ZKC B;  2A6E D;  3V96 A;  1HTP A;  3NSW A;  1WTQ A;  1EEF D;  1K8M A;  1X3Q A;  3PUX A;  3HS0 C;  3RD4 A;  3EVQ A;  4A3B B;  3OWF A;  4B9W A;  2ID0 A;  1JOQ A;  3SK8 A;  1EYA A;  2LFN A;  2PW5 A;  4QMG A;  3I4M B;  3DEP A;  4HSP A;  4G7H C;  1UAP A;  2NVX B;  2DNC A;  3I72 A;  3MAQ A;  4RGM A;  1JOO A;  2B2U A;  4EQO A;  2A6H D;  5CBE E;  1KLG D;  3TP8 A;  5D65 A;  3VR3 A;  3DWA A;  4MIU A;  2GA4 B;  4RA8 A;  1B4O A;  1QNU A;  1WD0 A;  1BO0 A;  3CHB D;  5EKI A;  1PFM A;  5DM6 3;  1TS5 A;  4B08 A;  4IFD J;  5CBA E;  2VNU D;  3MXP A;  1II3 A;  2AWN A;  1VF5 C;  1PFN A;  3WDN A;  2IJ0 A;  2A74 C;  1CT1 D;  4H44 C;  1ONL A;  2E2I B;  4RHS A;  3Q22 A;  1D5X C;  3C3L A;  2K5W A;  3MEH A;  2ZXP A;  1O78 A;  1A3V A;  1V1P B;  1J9O A;  3K6O A;  2F0F A;  2O5I C;  1LTR D;  1EFI D;  4DAY A;  4P2C B;  4K2L A;  2F0P A;  2PNR C;  4EQP A;  2JA8 B;  5KND A;  1YNJ C;  5C0X G;  4CJ0 B;  3T16 A;  1EIH A;  2K5Q A;  1FGB D;  2ENB A;  2DY7 A;  2E2D C;  1I4H A;  1H9K A;  5TSS A;  1ET9 A;  2RQX A;  4OO1 H;  1U4M A;  3UI2 A;  3VA7 A;  2H1E A;  1L0Y B;  2EZV A;  3W3A A;  4A3K B;  5KYI A;  2N55 A;  3NBI A;  2B2T A;  4OIJ A;  1FD7 D;  4BBS B;  3S14 B;  3T56 B;  2F0U A;  3S9W A;  2QKI C;  1F9S A;  4OO1 G;  1TWG B;  3V2T A;  4FF1 A;  5I9P A;  1D1I A;  3QB3 A;  4RGN A;  2HDM A;  3J80 L;  5I2X A;  5IGE A;  3IFD A;  2L9H A;  2F0I A;  2R61 A;  3M4Y A;  2Q8I B;  1FYC A;  2RKS A;  2F0N A;  1AEX A;  5C44 B;  1HPC A;  5C3X A;  4Z9C B;  1EZ6 A;  2F0G A;  2H4O A;  4KTA A;  3J7Y W;  1EEI D;  2K05 A;  3HOU B;  5E4W C;  5EPL A;  1YNN D;  3FDT A;  2KQ3 A;  2WB1 B;  1SYB A;  5BN4 A;  5FOB B;  1B50 A;  2EY2 A;  3HRZ C;  1SNO A;  4OHJ A;  3GV6 A;  1D1K A;  4XTC S;  3FEW X;  4H0L C;  1CA5 A;  3K5M A;  2K1B A;  4ZKB B;  5FLX E;  2F0K A;  1OXT A;  2AUJ D;  2AWO A;  1BCP F;  1GHJ A;  1I6H B;  3D6W A;  4LK1 C;  4ZUI A;  5ELE A;  4IUU A;  3VA5 A;  3OMG A;  2NVT B;  3L9A X;  5EPK A;  2K5D A;  1WTR A;  3KLS X;  3D3R A;  1HFN A;  4CKE A;  1BOS A;  1PTO B;  3PUW A;  4A3J B;  2JE6 I;  3VYR A;  5C3E B;  3CRL C;  5M5W B;  4G7O C;  1SNP A;  1V1O A;  2RDF A;  2RVL A;  5FK9 C;  1EZ8 A;  3A7A B;  3HOW B;  4XXE A;  1I3Q B;  1ESF A;  2QF7 A;  3H91 A;  2IX1 A;  4KI0 A;  3EFX D;  1ML0 D;  1TT2 A;  2L55 A;  3TP6 A;  4ODG A;  1GUG A;  1HFG A;  5COY A;  3OW7 A;  2F0W A;  3IFT A;  4FNF A;  1ESR A;  4A3D B;  4WFN 3;  1DOM A;  2KEC A;  2MPM A;  3HOV B;  1EOT A;  1QWY A;  1OXX K;  2IPK D;  3BVM A;  2NTS A;  2ICI A;  2NN6 I;  3DM1 A;  3GO5 A;  4C3I G;  2IT1 A;  4FP5 D;  4X3K A;  1BF4 A;  3VYT A;  3P20 A;  3NQI A;  4HR7 B;  1CHP D;  3NPP A;  3CQZ B;  4X3T A;  5DM7 3;  1GUW A;  4KV6 A;  2CW0 D;  2EYO A;  3IL8 A;  1GOZ A;  2N88 A;  5CMD A;  5EPJ A;  1IW7 D;  4FF3 A;  1TR5 A;  2JA6 B;  1KLU D;  1HQR D;  1AW7 A;  3EA6 A;  3Q6S A;  3URY A;  3PO2 B;  1SNC A;  1PRT F;  1RHP A;  2SEB D;  1GUN A;  3CU7 A;  1GJX A;  3ERO A;  2EXZ A;  1I4P A;  4BA1 I;  1KDA A;  3KLR A;  1XXG A;  1SDF A;  1BDO A;  3HKZ B;  3NE5 B;  3RLF A;  2EYH A;  4RWS C;  1S5C D;  4A3I B;  1BUV T;  4QF4 A;  1NUC A;  1EY9 A;  4Q5V A;  4O42 A;  3W2D A;  2SNS A;  4N9T A;  1KTK A;  1B53 A;  2E2J B;  1I4Q A;  1E2W A;  1S5F D;  3X3N A;  3G6J B;  5BN3 A;  1EYC A;  1SEB D;  4C3H B;  1MI2 A;  3GTG B;  4IUQ A;  5J39 A;  2DY8 A;  2R92 B;  3GQB A;  5FO8 B;  1TS2 A;  1U4P A;  3TP7 A;  3TME A;  2BDO A;  3E0J A;  4TRD A;  2EJF C;  1SYD A;  2E2H B;  1S5E D;  3J81 L;  2K6A A;  1NCV A;  1O80 A;  1NAP A;  1Q8I A;  2EYP A;  4YIJ A;  4KJN A;  3BDC A;  2EJM A;  1LT4 D;  1Q1E A;  4QIW B;  3KBX A;  2F0V A;  1I50 B;  4HAE A;  1S5D D;  3QIA A;  4IUN A;  3WOF A;  1LV9 A;  1V8Q A;  2TMP A;  3CRK C;  1TWH B;  2PZU A;  1Q90 A;  2F0T A;  3BYT B;  3ERQ A;  5C4X B;  5IGB A;  3MFY A;  1SYF A;  1LT3 D;  1TY0 A;  5IGC A;  1KDC A;  5C3W A;  3A8K E;  2XSC A;  5COR A;  3NP8 A;  4ULL A;  1MGS A;  2FIN B;  5J22 A;  3O13 A;  2D62 A;  3GP7 A;  4ABN A;  3FMC A;  2G9H D;  4C3J B;  2YYZ A;  1YNJ D;  1GXD C;  2JA7 B;  1BR9 A;  3K5N A;  1G2S A;  3SXH A;  1OO9 B;  1SMY D;  3N6R A;  3SK5 A;  3QWN A;  3GTQ B;  1F2M A;  1LTS D;  1HA5 A;  5G3L D;  4UDU C;  3I4N B;  1GUO A;  5F2D A;  3A55 A;  4PMW A;  3M7G A;  3SK6 A;  1EU3 A;  5C5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...