2K5WA

Solution nmr structure of putative lipoprotein from bacillus cereus ordered locus bc_2438. northeast structural genomics target bcr103a.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
111
structure length
111
Chain Sequence
b'MERASLNRIGKDVYYMQIKGEGTIEKVDGRNLRNYTLPAYDEDGVKKQITFRSTKKENDHKLNKYAFLRLYVDQDDNSKNEISSIEVKSYEEIQKADLPEKVKDKFTIKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical Cytosolic Protein BcR103A
publication title Solution NMR Structure of Putative Lipoprotein from Bacillus cereus Ordered Locus BC_2438. Northeast Structural Genomics Target BcR103A.
rcsb
source organism Bacillus cereus atcc 14579
molecule tags Structural genomics, unknown function
total genus 15
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06486 DUF1093 Protein of unknown function (DUF1093)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.480 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k5wA00
3NPPA 2K5WA 2K5QA
chains in the Genus database with same CATH superfamily
1SMYD 3MVVA 1I94L 3M4YA 1SDFA 1VQGA 2Z8LA 5IWAL 1QUQB 3T4AC 4UAIA 1JWMD 1L2FA 3RN5A 1OXTA 3H94A 3M4PA 4JI8Q 2AMCB 1K0RA 3K80C 3R2TA 5GQOA 1HZCA 1HJPA 3GP7A 5FLXL 4LF4Q 5EAYA 1WTXA 2RDHA 4BBRB 2E2HB 5M3FH 2BOSA 4JI3L 2KA7A 1N36Q 1VQ4A 4C3JG 3A55A 2KVMA 2JYOA 3ZYYX 4XT1B 5G3LF 1KAWA 4F87A 1YJNA 5NUCA 1HFGA 4DV5L 1VQPA 4QGUA 3H3VI 3M3YB 1SSOA 4CKCA 2K5HA 3R8BA 5J3BA 1XPOA 3D6CA 2HT1A 3S16H 3U9SA 4V190 1J9OA 5C0XG 2BCOA 2NVYH 3KF6A 1F9QA 1JICA 1V43A 5C44B 4B3SQ 3W1GA 3MHBA 4A93G 2JJQA 2R93B 5HY6A 1YVCA 4DXFA 4ZUIA 2Q2UA 1SFOH 2AWNA 1R9TB 2EYPA 2B2WC 1LACA 4WJ3M 1FR3A 1WTRA 3HOVH 1SE8A 4HCSA 1I4HA 1PH7A 1XTCD 2L0CA 2Z1CA 3DHQA 4IJLA 2HCIA 4IUTA 2R92H 4IPHA 1VQLA 3GTGB 1A3UA 1VQHA 4DUYL 1MD2D 4B3RL 1CKNA 3TN2A 1XMQL 4KKTA 1S5BD 1MI2A 2R7FA 1HUMA 2PNRC 1HFNA 1VF7A 1E1OA 3KJPA 2B2TA 5M9OA 2OWOA 4K2KA 3S2DH 3HOWH 5M5WB 4DV6L 1C0AA 4LK1C 5JVH3 2F3WA 2RSOA 3J81j 1B50A 3A8KE 1BCPF 5BN4A 1FNWA 3IFTA 1YJWA 4R4CA 3K58A 2XWBB 2I46A 3N6RA 4L5TA 1UNSA 1PZJD 3E3XA 2K52A 2F3VA 2FXQA 3OIQA 3DLLA 4X3UA 2AQ3B 2F0WA 2WINB 1GUSA 2BA0A 4V0BA 2XRQD 4NMZA 4X6AH 1X56A 3HGBA 2O2LD 2PI2E 4AQYL 3I8ZA 1SR3A 2F0NA 1I50H 1VF5C 4A3GH 2KCNA 4IOAA 1VS0A 1TY2A 4LUZA 1D2BA 3L7ZC 1ET6A 3K57A 1SYFA 1EY5A 2KHIA 5M3MH 3ITPA 3K5MA 1B44D 4IJHA 2B63G 4R4IA 1FNUA 1JB7A 2RF4A 2PZTA 3HEJA 2EQSA 4IALA 3JAML 3NEMA 1DOKA 4HSVA 1RF2D 3C2PA 1TWGB 4HCEA 5E7NA 2YTXA 1U5KA 2XVSA 1E2WA 3M7GA 1NNXA 4DR7Q 1D5XC 1B9NA 3S1MB 1PRTB 2EVBA 4J1MA 3I70A 1VQCA 3DM1A 5IYBH 3D4RA 3UDFA 1E7ZA 4RAUC 2VUMG 1W3SA 4C3HH 2NVXB 3NBHB 1UE5A 3UE1A 1EY4A 3S1NB 2E75C 3MAQA 4AH6A 2Y0SB 4XT3B 1U4MA 1B3QA 4NKLA 3D0FA 1YNXA 1U4LA 3TZDA 2L1BA 3K5OA 2F0PA 4HJ8A 1MSGA 3NE5B 4HAEA 2ZXPA 1KDAA 2ZM6L 1YIJA 4IFDG 1IYUA 1WCMB 1P8LA 5EQ0A 5M3FG 1SMYC 4IURA 4L63B 2IWHA 2CW0D 1HNZL 2PW5A 2WB1E 1C4QA 4BA1I 5ELNA 4LF6Q 3K6OA 3M9BA 4G7HC 5CBAE 1TWFH 3PCOB 4JOIA 3Q24A 1LTGD 1DONA 4KY5A 2KBNA 3K59A 4I7ZC 2DGYA 5I6WA 3HOVB 2X6LA 3K7AH 4X62L 1XMOQ 3OWEB 4RCOA 2F0KA 2EE1A 3MWYW 1KC8C 2B2VC 3T53B 1SYBA 3FKIB 1BBWA 5LHY1 5KEEA 2L5TA 4Z9CB 1X65A 1UAPA 4B3MQ 2NN6H 1RHPA 3I55A 4C2MB 2K5VA 1HQRD 3WDNA 1MHWC 2CH4W 3S2DB 3HOVG 2NBFA 1PYBA 4M1UB 1AH9A 1EEFD 2R92G 4P71A 4XQNA 4G7ZC 2N88A 3HKZB 1K83B 3J81E 2P5ZX 3AB9A 1CM9A 1W2BA 5FLXE 1PH3A 4ZCKA 4DV3L 1Q81C 4YCWA 4X3KA 1XPRA 4JVZA 2K32A 3KF8A 3D4WA 2XSCA 2R61A 1YITA 4JI1Q 1LLRD 3HOWG 1GHKA 2F0GA 2WAQB 1EY0A 1KXLA 4L5QA 1IBLL 4HIOA 3DWQA 3CCRA 1EL0A 1I50B 1CFMA 4TVAB 5KNDA 4A3GB 5IYCH 4NB3A 5C4XB 5ELOA 2OF1A 3CCQA 2K4KA 4OX9L 3GTMB 4LF9L 5C4HA 1K3RA 3CCVA 4YY3Q 2DJFC 2QKIC 3K8AA 4K8IA 2RDGA 1HR0Q 3MEHA 1N9WA 1W6JA 2JA5H 1HA6A 3ULPA 1XNQQ 3BYYB 4K0KQ 2JEAI 4JI8L 2E2DC 4FXKC 5IGGA 4LF4L 4POFA 5M3MG 3HG9A 3E0EA 3U4VA 4A3JG 3OTOQ 2G9DA 3A5UA 1N36L 4JW0A 2K50A 4F7XA 4IO9A 1Y1WB 3TS0A 1LYLA 2B2YC 1VQOA 3ULLA 5C3EB 2SEBD 1QVFA 3GTQB 3PSIA 4LFAQ 4LF8Q 2KECA 3S1RH 1KQSA 4JI2Q 4GN3B 1LTID 1ML0D 2PQAA 1SNMA 2MHVA 3AU7A 5LMNW 4I65A 3EN2A 3AEVA 3KK7A 4A4IA 5JJKA 4A3KB 4C3HB 4ZLTF 1FGBD 3M85A 3CU7A 4Y7NB 4MTNA 4IUPA 4DV0Q 3UDXA 4RWSC 1E3PA 4B3SL 2XRSD 3KBXA 1NR2A 3C3LA 4HEDA 1I4QA 1EY7A 3A56A 4CDDC 3PF5A 5IYBG 3QWNA 1WTVA 1HA5A 4R4OA 3R93A 2R3ZA 3PO3H 4APVA 3HOZH 4KTAA 5FK9C 4DAYA 4WORA 1D1KA 3PF4A 2JA7B 1WYDA 1TWFB 1TQOA 5I9PA 1TKWB 2J7ZA 3PMFA 1BR9A 1PTOD 2BE5D 2M9VA 2KEDA 1Q1EA 3WWVA 2NVQH 2EY6A 5JEAJ 2EYFA 4QCLA 1BXTA 1DGSA 3TP7A 3LWUA 1HHVA 5A2QE 2DN8A 1EWIA 2NUCA 3GD7A 2WKCA 3QG1A 4K8JA 1HTLD 1I3QH 1J5EQ 2QF7A 3JAME 1JE4A 1PMRA 1QVCA 2RHSB 2GVAA 2RCFA 3IL8A 4YWLA 2Q2TA 5I6YA 4C56C 4A3BH 1ICWA 1Y69U 1QCBD 1DM0B 1QG7A 4N9TA 1SMXA 2L11A 2J0TD 4C3IH 2CW0C 2QDBA 1CSQA 3NWSA 3EVQA 3T13A 1T5EA 1PV4A 2AHOB 4YWMA 4OO1I 1PFBA 2NN6G 1NCVA 4WJ4A 5DAUA 4H02A 2IX0A 2BH2A 3OMCA 4IN3A 2ZTEA 1TWAB 3NTIA 4DK1A 2IX3A 1A15A 1BQQT 4RHSA 3SVMA 5T1IA 2EY1A 4JBWA 3A7AB 3RLFA 5CV5A 5JPNC 3RZDH 2MFIA 2PQEA 4LUOA 4N8FA 2X6GA 3CCUA 1SROA 1DXMA 5T1GA 2PQAB 3U58A 5HGQA 3VR4A 1SNQA 5DM73 5IP7H 2K5DA 2EPBA 3KUPA 3J7ZC 1FYCA 2A5HA 3VR3A 4GOPC 1A62A 1OXXK 4ULLA 4ABNA 4DNIA 3AFQA 2B39A 2I07B 1X3QA 1NE3A 3OIPA 1B70B 1L1OC 2NTTA 3GV3A 3LGJA 4BBRH 4RGOS 2E2HH 4DR7L 3D4DA 3GV6A 1H9SB 2QEXA 1HNWQ 3PV0A 2BDOA 1BCPB 2F0FA 2ATWA 1DOLA 1II3A 5M5YB 2B2UC 4XIGS 1AE3A 5J22A 3M3YH 3EQLC 1A2TA 1DOMA 3SK6A 1PH4A 3BG3A 2JA5G 4DR3Q 3D6WA 2Q2HA 1Y8NB 2MQHA 2K28A 5C44H 1TR5A 3MZ5A 3VYRA 1U0LA 1QUQA 2R93H 2EJGC 4KMUC 4P75A 1F77A 4OXPA 3HOUB 3SE0A 1OTCA 2Z6KA 1MSHA 4ILWA 1R9TH 4LF5Q 4QB4A 1SBBB 4LF6L 4DXGA 1BF4A 3TMEA 1EFWA 3GTGH 1J6QA 2KENA 3U9OA 3B6YA 2LXKA 4AYBB 2L15A 4MZ9A 1EZ8A 4HN7A 4KN4C 2EYHA 3S17B 3NTKA 2EZVA 3I4MB 1UEAB 4PMBA 1XMOL 1K0SA 4KKSA 1SNCA 3HOZB 2V4DA 4DV4L 3NWTA 1X3FA 5M5WH 4P72A 1VQNA 1N32Q 4HTHA 1BKBA 4R1JA 5IIFA 3T1YQ 3SHLA 3FP9A 4B3ML 1IYVA 3Q6SA 1MKHA 4M8AA 1YJ9A 4KV6A 4L5RC 5J1ZA 4A75A 4DPGA 5AJ3Q 3PO3G 1S72A 1EFID 3PQIA 4ZKCB 3NP8A 4GOPB 1JR0D 4HJ7A 3CRKC 3BVZA 2HDLA 2N49A 4J6HA 2L12A 4UHVA 2IJ0A 3VDYA 2C35B 2FJ2A 4DV7Q 4IPCA 2KOLA 1P16A 4JI1L 4H7BA 5E4XA 1UWVA 4X64Q 1SEBD 2EYMA 1T9HA 4PZ6A 2PZUA 4HJAA 4BA2I 1WTWA 2X69A 2BDNA 3MC0B 3K7UC 3J81c 3CMAA 3PUWA 5FLXc 3X3NA 1HUNA 1F2MA 3FDTA 2LXJA 4OIJA 4DV2Q 4HIDA 1VQEA 2CQOA 4RH6A 1PTOC 2BE5C 3R2IA 3NENA 4EGVA 1KLGD 2IHEA 3L0OA 1QILA 4A3BG 1EUJA 1A6XA 4YY3L 5CV7A 2JA8B 5EPLA 4HJ5A 1HR0L 2WKDA 1TU2B 1YNJD 2HCCA 4C3IG 4JV5Q 2MGSA 2MO1A 4DR4L 1Q1BA 1TWGH 2WB1G 4RKLA 5D3DA 1LT4D 2DY8A 4XTCS 4K0KL 3KOJA 5GAEC 1VCIA 3C46A 2ZJRA 3RUZA 4YIJA 1X6OA 1VMPA 3QJYA 3TSSA 1STHA 3S1MH 1HPCA 2WACA 1Q82C 3J81L 1I5FA 2A8VA 4L5SA 3OTOL 1EYCA 3RZOB 1HH2P 1PA6A 1AP0A 4KJOA 5JPMC 1JE5A 3F1ZA 3L2PA 2NVXH 4QUCA 3S1NH 3ULJA 5IYDH 4LFAL 4LF8L 1CQFA 3DWPA 1U4PA 4P74A 4JI2L 1UE1A 1M8AA 5IP7G 3TEHB 4IQZA 1VQ8A 4JI5Q 3ICEA 1XWEA 5ELBA 4BY1B 2MNAA 4FDBA 5GAGC 3NPPA 3H3VH 2JXMB 3KLRA 4F88A 4DV0L 1JCKB 2ZXRA 4LAAA 4TQUS 4DK3C 1WCMH 4BBRG 1A3TA 1KABA 5EKLA 1XNRQ 1LUZA 4J15A 4K6LA 2PO4A 5KIXA 1O7LA 2VB3X 3HFZB 2JSOA 4A3EB 4OWTB 3DEOA 4FF2A 3BVGA 3A8IE 1IZ6A 4HIMA 1VQIA 1FL0A 2AUKA 3NQIA 4PMWA 3NBHA 4ODGA 2YYZA 2SNSA 1OXVA 5C44G 5FJ8H 2ES2A 1LTBD 3SR1A 1PXUA 3FKIH 2RVLA 2UXBQ 4DR6Q 2R93G 1ENCA 2VQEQ 3NHHA 3TRZA 2K14A 2CHBD 2CVRA 4C2MH 2GN5A 1STNA 3J81i 2SNMA 4GLVB 5BN5A 1J5EL 3S15B 1K83H 2QCPX 2PCFB 4QL5A 1I4GA 4QY7A 4GKJQ 1CT1D 2M00A 1K9MC 1A3VA 1S3OA 1HRJA 3ER0A 4FVMA 2CWPA 4PQXA 1PFNA 1N33Q 2KCCA 3JAMc 1GXDC 5G3LD 4OHJA 1EIHA 2M2LA 2Q8TA 1TS5A 4UP8A 2OTLA 1YI2A 3GTLH 5CV6A 3MXPA 4K2LA 3I72A 1C8CA 2AQ2B 4NXMQ 5C4XH 3A0JA 2HUGA 4X3TA 3DXJC 2F3IA 3GTMH 2D5DA 5IODA 1NUCA 1CHQD 1SJED 4NW2A 2F4VQ 3K81C 3A8JE 5CYUA 2K7VA 4RFBA 3I7FA 4KLKA 1Z7TA 1IBMQ 3PUYA 5A2QL 4K5XA 4DF7A 1ONLA 2E2JB 3CPFA 1IKMA 2F0EA 3CC4A 3A54A 5ELCA 3W2DA 2PW7A 5L37A 3RLNA 1JWSD 4DN4M 3J80L 1QVGA 3Q23A 1Y1WH 2FFKB 1JC7A 4Q0FA 1HNWL 5C3EH 4LFBQ 4IUQA 3GTQH 1YHQA 1K8AC 3VYTA 2K5NA 4KHZA 2B29A 3ZJYC 4A3KH 3OMGA 1PDQA 2EY2A 4A3CH 4DR3L 2DNEA 4Y7NH 2Q2IA 2EJMA 1PH8A 5LL6S 2A19A 3BZDB 1FJGQ 4BBSB 1IYJB 1KIXA 2EOTA 1JJCB 3H09A 4LF5L 3NK9A 1Z6HA 3IFDA 3CC2A 3EBEA 1BO0A 1YNJC 1QOHA 1Q46A 3IKJA 2FMCA 2Y0SG 4OL7A 1CSPA 1WOCA 4BY7B 5IT9L 2R7ZB 2ALYB 5DLQE 2CCZA 2JA7H 1KRTA 2MP1A 4RGNA 4ZUJA 2E2IB 5C3XA 3PO2H 3S1QB 2B2VA 1G2TA 4JI6Q 3STBD 3TP5A 1JMCA 2H1EA 4ZAIA 1GOZA 3S2HB 1WCMG 1EU3A 2DJGC 2D9UA 3IRBA 1VQKA 1N32L 4GNXC 4Y52H 5EKKA 5JAVA 3JAMi 1TS4A 3T1YL 2K6AA 3W3AA 1VQBA 2VB2X 2AKWB 2WIIB 1EQQA 4KHPQ 3S24A 1S5DD 1WJJA 5LMUQ 2VZAA 5AJ3L 4GN5A 4H0LC 5IE8A 1STGA 5I2YA 4BXXH 3OYYA 1I4PA 3A7LA 5CR3A 3CC7A 5FJ8G 1AZQA 4EQPA 3FKIG 3T51B 3FEWX 5D65A 4DV7L 1U9RA 1Q7YC 5LL6X 2K03A 2FMMA 4X64L 2CWAA 2N3SA 4H13C 1JB3A 4G4KA 4CDCC 4B08A 1JJ2A 4FXDA 4UP9A 5TSSA 1TWAH 1PZID 4JI4Q 5I9OA 5JOBA 1NR4A 2ICIA 4DV2L 1Q86C 3HKZG 2CQAA 3J7AV 2UXDQ 1NAPA 1LTLA 5JJIA 2GVBA 3SXHA 5C4JB 1O78A 2O4XA 4KY6A 1QZHA 3GTLB 1JT8A 3RR5A 2A6ED 4DR5Q 1G291 1STYA 1AFPA 4JV5L 2DNCA 4G57A 2EXDA 2RSNA 3Q8DA 5DEHA 1TIID 3I2ZA 2WP8J 2WAQG 3PUVA 1S5CD 2UUCQ 1GJXA 5EPJA 1GKHA 4I7AA 4XXEA 2JA6H 5HGTA 1D5MC 4A3GG 1CA5A 1F9PA 3GQBA 5C4XG 2OQ0A 1TY0A 4K14A 4DUZQ 2I5HA 1PTOF 4DGZA 5M5YH 3G6JB 2K75A 4MNOA 1I4RA 1QE6A 4RHRA 3NTHA 3CQZB 5LMNQ 5CGKA 1B7YB 4IZ8A 1KL9A 1SNDA 2V1CC 2SDFA 1B53A 4JI5L 3H15A 2PMZB 1STAA 4MHEA 4P2CB 1HR0W 2QILA 2EYOA 4J8QA 2VQFQ 1QZGA 3HOUH 1LTTD 4K5WA 4U68A 3P75A 2EYLA 3BJUA 2PYKA 5JJLA 1Y1WG 4EQNA 3MTSA 4KJNA 5C3EG 1XNRL 4ZKBB 2JEBI 1V1QA 3CW2C 1SYGA 4B9XA 3VR2A 1H9SA 1G6PA 4CJ1B 4CJ0B 3GTJB 3S17H 5IGCA 5K36H 1RODA 4O42A 2VW9A 1L0YB 4C3HG 4A3KG 3I4MH 4A3CG 4A3FB 3CD6A 1JOQA 1K3BC 2UXBL 4DR6L 1B9MA 5D3IB 3HOXB 2F1MA 3AMUA 1X3GA 3PO2B 2VQEL 2YU9B 4DK0A 2G9HD 5D14A 3VYSA 1OO9B 2KCMA 3WOEA 3I56A 3BDLA 3GTKB 4L6TB 5IGBA 2A6HD 3C1FA 5F2DA 4GKJL 2JA7G 3RN2A 5IOCA 3J80E 3E0JA 2RKSA 3EIVA 1EQTA 3H0GB 1Q8KA 1ET9A 1N33L 3QOLA 4X65Q 2UU9Q 4A3IB 4OWWB 2N78A 2F52A 3G6EA 3EJIA 4GLAC 4O1NA 4DR2Q 1XJVA 1EOTA 1VQDA 2Y0SE 2ID0A 4OO1H 1NY4A 2RBMA 1IL8A 2R6GA 3ND9A 4NXML 4ZQ3A 2LSSA 3STBC 5FKAC 3TDQA 3VYUA 2N55A 3MXNB 4A3MB 2JA8H 2CH4A 3H6MA 2F4IA 5K5PA 4JC0A 2F4VL 5COYA 2DY7A 2AWOA 5JVG3 1GUGA 3E6ZX 2HD3A 2XIWA 1IBML 4GOPA 3G7LA 3HOYB 4UPAA 3S9WA 1TWCB 5KGUA 3C1EA 3KJOA 3MEFA 1QNUA 4IUNA 2PNHA 1H9JA 4XQJA 5IT9E 4HIKA 1V1OA 4X66Q 1T5XD 4GZYC 2Z0SA 3RZOH 3VA5A 3F2CA 5KYLA 1XXGA 3TBIB 1PYWD 1HZAA 1ZKOA 4P73A 1H95A 4LFBL 2EY5A 5C5MA 1B3AA 1SNPA 5KNBA 2JA6B 1G2SA 5FO7B 4LF7Q 1UUPA 5C4ZA 2KQ3A 4CDEC 5IYCG 2GA4B 3BS1A 3OW2A 2H4OA 3T1HQ 1IBKQ 1I6HB 4BY1H 1PH1A 2LKVA 1G51A 1PH6A 4KN7C 4QMGA 4C1NI 4NXNQ 1O7ZA 1A8VA 1G91A 3HKZE 1AEXA 2HIXA 1PRTD 1ESRA 1LO5D 1FJGL 1WVLA 3U4ZA 5JEAH 3CCEA 5KNCA 2A6EC 5I2XA 1LABA 4PNYA 3I4NB 3NUCA 4QJFA 5FO9B 1SNOA 1F2LA 4A3EH 2WAQE 4DA2A 1F9RA 5C3WA 3P20A 3VA7A 4R4TA 5M5XB 2A1AA 2OCEA 4JBMA 2AQ1B 2RHQB 5ELFA 3SK4A 1YEZA 4JI6L 2JN4A 1IHZA 3HOUG 4KK7A 3V96A 1GUOA 3U50C 3QO2A 4DR1Q 1FD7D 4EQ5A 1IW7D 3GTOH 2F0LA 1JJGA 2Z6KC 4IFDJ 2O5JC 2HIVA 3KDFA 3S15H 4KHPL 5LMUL 2L4NA 4AYBG 1GUNA 4TRDA 1NMGA 3N52A 3CXCA 1JWUD 3TP6A 3PIPA 3RNUA 5K36G 1EY9A 1LT6D 3I4MG 2B8GA 3T56B 5EBCA 4NPSA 2QA4A 2IY5B 1A2UA 3HOZG 1IXRA 1ENAA 2IPKD 4NP5A 4E6IA 2KJXA 3M4OB 1I4XA 5IP9H 1L1OB 4RGTA 1EQVA 1G6ZA 4B3TQ 1DJRD 3BDOA 4LMQD 1BNZA 1GO3E 4JI4L 2D0PA 3OOCA 4LUVA 2UUBQ 1CKOA 1H9MA 1Q12A 4N8X1 3SGIA 5I4DA 4HJ9A 2UXDL 4A3DB 1H9KA 3NBIA 1RL2A 1VQ9A 5BR8Q 2Z4HA 2NVTH 4O0AA 4OELB 1KD1C 2D0OA 1SYEA 3G4SA 4DR5L 4DU9A 4G7OC 5ISRA 1D8LA 4DAMA 1BDOA 3T16A 1B4OA 1SE3A 1D5ZC 3FRPB 2E2JH 1C9OA 2RA4A 1YNND 3EROA 1Z9FA 2KEEA 1AN8A 1R4PB 1JOKA 2UUCL 1KRSA 4DAVA 1I6VC 1EU4A 1N8RC 1SLJA 2A6HC 1XNQL 1V1PB 1ENFA 3X3MA 2VL6A 4OO1G 1LT3D 2A68D 4DAPA 1UE6A 1QWYA 2VY3A 1X32A 1ZXTA 5EBDA 1DCZA 4TKOB 4DUZL 4LNQA 2CFMA 2JA8G 4GS3A 3FHWA 1K73C 4ZYSA 3BYTB 2Z4IA 3Q22A 4DV1Q 3E9IA 1CUKA 5LMNL 3V05A 1ILPA 1AW7A 2C5CA 1QJOA 2ASBA 4C3JB 4CDFC 3H91A 4JI0Q 4OEMB 3KLWA 2VQFL 3KBGA 1S40A 3MFGA 4BBSH 1EYAA 1CI3M 4H44C 3GTPB 1J8IA 1HTPA 3HP3A 5ELEA 4LWCA 3FPPA 4PZ8A 3J7AF 2EDGA 4CBVA 3KDFB 4IFDI 4IFDH 2UXCQ 2NZHA 4IPDA 1RJTA 4R8IA 4DK6C 4JCVE 1SN8A 2B2WA 4LJZC 3I90A 4OGQC 4ID6A 4BY7H 4A93B 2R7ZH 4OIKA 4BY1G 3AYHB 2E2IH 1PH2A 4RGMA 3PUXA 3S1QH 3CMEA 1GM5A 1RD9D 1ESFA 2I5LX 1BUVT 3S2HH 3JC66 2F0MA 1X3PA 4EX5A 3CPWA 2XWJB 3OPOA 5JEAG 1X54A 3I73A 1B1ZA 3QB3A 4RCNA 3HZXA 4FNFA 4FYDA 1CHPD 3FMCA 3I4OA 1PTOB 3MFYA 1XPUA 3FVQA 4S3SA 4A3EG 2HHHQ 2QDLA 2F0OA 3K5LA 3GTOB 2F0UA 4IUUA 3LX0A 3VR6A 5AFWA 1KDBA 4JBJA 5GROA 1PRTC 3V2TA 1Y8OB 2JA9A 4CJ2C 1WD0A 1VQFA 4PV1C 1D6EC 2KHJA 1TWHB 1Y1VH 4X65L 2UU9L 1Q90A 2IL8A 2B8FA 3RLOA 4DR2L 4KD4A 1Q3LA 1F2ZA 4XYQA 1VQ7A 4FO2A 3J80c 2F0VA 3H3VC 4CKEA 2IHFA 2OQKA 2B2TC 5C4JH 1BBXC 2UUAQ 4JYAQ 2F0SA 2Z6BA 4DNRB 3NQTA 3UDIA 4FF4A 4XDXA 3KFUA 3J7YW 4WFN3 1RKNA 1HZ9A 1TVXA 1PVOA 2NVTB 1IW7C 4GKKQ 2TMPA 2XN9C 5IP9G 4GLXA 2F0TA 4EQOA 4O2DA 4AYBE 1YZ6A 4LFCQ 2B63B 1VQ5A 3S14B 1FNVA 1M4VA 5FLMH 1B8AA 4X66L 1PLFA 4JBKA 4GN4B 2B3GA 3TP8A 1O80A 4HR7B 1KHIA 4A3JH 2ZJPA 4QF4A 4LF7L 3CQZH 5GAHC 1M90C 2WFWA 4ME3A 1X3EA 3T1HL 4JG2A 4QIWB 1IBKL 3ERSX 5IT9c 4WJWA 4NXNL 1EQRA 1XTDA 2VUMB 3KF6B 1NMFA 1RIPA 2WV6D 3HKSA 1MBYA 3DM3A 1BCPD 3D31A 4FP5D 3I4LA 2A74C 2JP1A 3KYHC 1WD1A 2YTYA 4N9PA 2K1BA 4R4QA 5FOBB 3GTJH 1YNNC 2F0HA 3J7A5 3CP0A 2LY7A 5JJZA 1CTMA 1MJEA 4A3FH 5M3FB 1CKNB 3W1BA 5IYDG 5E4WC 4L8JA 1SRUA 5DM63 1F9SA 1AZPA 1GHJA 2A68C 1GUTA 1HZBA 2ZT9C 1KNEA 3HOXH 4POGA 4BBSG 3OWFA 2F03A 4GNXA 1HNXQ 2QW7A 2YU9H 4KI0A 2D62A 4DR1L 3TS2A 2VXWA 1N34Q 3S16B 2E5LQ 3DWAA 2EIFA 2NVYB 3GTKH 4FF1A 4BY7G 3J80i 2EXZA 4YHHQ 1HQMC 3SEBA 2R7ZG 2F0DA 3PIO3 5IGEA 5EGTA 1GVPA 1SE2A 1WI5A 1Q8IA 5EKIA 1SFOB 3CHBD 2KCTA 5KYIA 4JI7Q 1JORA 2VS1A 3H0GH 4U673 3CKIB 1D7QA 3K0XA 4JOIC 1CA6A 1VMCA 1EYGA 2R92B 2K33A 2MPMA 2R7DA 5EPKA 3A74A 1L0WA 3NSWA 4A3IH 1MJCA 4DV4Q 1MIUA 3CCSA 1Z47A 3BU2A 3PIOA 4KHVA 4Q5VA 3F2BA 1MGSA 2F0JA 4B3TL 2K5QA 4JPBW 1V8QA 2K5WA 2NN6I 1Y1VB 2NZOA 2FINB 2UUBL 4UDUC 2A69D 1VDZA 1EWCA 3IAYA 4XYOA 1K28A 1C7YA 3HOWB 4DKAC 4A3MH 5BR8L 3MXGA 1K8MA 1RTNA 3NELA 1PFMA 4DFAA 1FGUA 4R9WA 3HOYH 1TWCH 3QIAA 2OXPA 1ICFB 2OT2A 3SK8A 1Y1VG 3QOJA 3SDZA 1Y14B 3EFXD 3K5NA 5ELDA 5C6AA 1TS2A 1UE7A 2BH8A 1SAPA 4HSPA 4MTKA 2O5IC 3CCJA 1HCZA 2B2YA 3HRZC 2LMCB 2PPBC 1UEBA 1I6HH 4DV1L 1WTHA 3ND8A 1PH5A 5M3MB 4A3JB 1EIYB 3BZKA 3MXNA 1AE2A 4KD3A 4OONA 4JI0L 4PZ7A 4DR4Q 1I94Q 3TZUA 5IWAQ 3DUZA 4GNXB 1LTRD 1ASZA 2A73B 5FLMG 4HMIA 2RQXA 1A63A 2JQOA 3I4NH 1TXYA 2IW3A 1EEID 1W6KA 2UXCL 2F0IA 3R3OA 1O7YA 3WOFA 1TT2A 2ENBA 5M5XH 4JI3Q 5CV8A 3PGZA 5KRUA 1PZKD 3O13A 3BVMA 2K04A 4DV5Q 1E2ZA 1EY8A 1BOSA 2NB0A 1A0IA 1SYDA 2L9HA 1OXUA 4TSSA 1K8GA 4KY7A 2MJ8A 1HXYD 5IGFA 5C5LA 3D3RA 3DEPA 5C0XJ 2Q8IB 4EVOA 3SK5A 1E2VA 4YCUA 2JK8A 3F2UA 2HHHL 1PH9A 3L3OC 2SOBA 3F8TA 3MXUA 1RTOA 3RD4A 4A3FG 2D2CC 2EYJA 1VQJA 5H1SE 1SE4A 1XYIA 1BCPC 1KTKA 1DYQA 3EA6A 1E0BA 3HOXG 1EIFA 1H9RA 3M4OH 4BS9A 3BZCA 2I0QA 2Z9HA 4IPGA 4MIUA 4DUYQ 3PO2G 4B3RQ 1JOOA 3KF8B 1XMQQ 2QEJC 4QIWE 2ZTCA 2PI2A 2NTSA 2ZTDA 5A35A 2ZXOA 1E22A 3K7AB 1SXTA 1ZYRD 5CV4A 2ZJQA 4FXGC 2VNUD 2XTIA 1V9PA 2H5XA 2KHSA 4A3DH 3GO5A 4LW1A 4AIMA 4DV6Q 3L9AX 2UUAL 2IT1A 5DNFA 4JYAL 4A76A 1YHAA 4MN3A 3URYA 3P7JA 1C48A 4A3LH 4F8MA 3BDCA 1EOVA 1PRTF 5E1FA 1S5FD 1SJHD 2E8GA 1STBA 5IGDA 3H0GG 1R4QB 4BXXG 1DZ1A 1K8OA 1B2TA 4IUVA 3UI2A 1XX8A 1M1KC 4GKKL 1KLUD 2E76C 4A3IG 1EYDA 2NWGA 4ZRZA 3LNNA 1NTGA 5CORA 4C1NK 3MA2B 3I3CA 1FVIA 2YV5A 4LFCL 2YTVA 1ASYA 1PFSA 2LFNA 2LS01 4QQBX 3UDGA 1GD7A 4AQYQ 1CZWA 2NZ1D 3W5OA 1L1OA 1KDCA 2N8NA 3KLSA 3E9HA 1NBWA 1LTAD 4A3MG 2RCNA 1X55A 3D8GA 3OHXC 2BA1A 1QNKA 3QR8A 4X3SA 4RA8A 4ALPA 2B2UA 1KAAA 2OEOA 3HOYG 4C3JH 1LT5D 1O7IA 1PHJA 1VQ6A 1NSNS 3CCLA 1ZEQX 1F2YA 2A69C 2QGQA 3E5SA 1CQVA 3GTPH 5J39A 1WTPA 2E74C 5HURA 2JA5B 1EY6A 3Q0AA 1WFQA 5C0XH 2JA6G 5C0XI 2XGTA 2TSSA 5CBEE 1V1PA 5IY0A 4A93H 3CF5A 2K05A 1JQYD 3TQYA 2K01A 3ERQA 3NXWA 5CV9A 4PMCA 1RDPD 3M7NA 3AQQA 4DAYB 1X9NA 2I5MX 2PZWA 3LWEA 4JK1C 3G71A 1Y8PB 5CMDA 1BBUA 5CC4A 1GUWA 2HQLA 4FF3A 4ME5A 4RKBA 3F2DA 3S1RB 4R8NA 2F0QA 1HNXL 1NJIC 1CK1A 3HS0C 4YCVA 3PIP3 3I4NG 4PG3A 5BN3A 1PYSB 3I91A 1CZGA 1N34L 1PTOH 2ZM6Q 2E5LL 5FO8B 3ONAB 2HQEA 1IL2A 4XQQA 3OSOA 2IX1A 1VQAA 4UY8C 1VQMA 3TREA 4YHHL 1EZ6A 1L0XB 1HNZQ 2L55A 1WTQA 4K6DA 1U4RA 2CKZB 4K5VA 1KNAA 3RMHA 4RG1A 4JI7L 4ZK9B 3M4QA 1SYCA 3FPUB 3K0YA 4NDXA 3AFPA 1BVSA 1TWHH 3KLSX 1S4ZA 3G48A 2EJFC 1RCVD 1WTOA 1S5ED 3PO3B 4X62Q 4CKBA 1OXSC 5GADC 1TS3A 3PUZA 4YWKA 3P1HA 3CCMA 1G8ZD 4OWXB 1EWHA 1LV9A 3A5ZB 2PMZE 4KKUA 2DUDA 1YHBA 3UE0A 2NVQB 2MUYA 2NYZD 4CHTB 1IKLA 1D1IA 4HMJA 2XNAC 2RDFA 3CRLC 1DD2A 1QB5D 2HDMA 1I3QB 2KUMA 3CAMA 1E1TA 3DMUA 2Q8RE 2FHTA 4CGYB 4RMFA 4IOCA 2J4XA 4A3BB 5EJWA 2MO0A 2B63H 4DV3Q 2OTJA 5E3FA 4B9WA 1E24A 4DNTB 3S14H 1LM0A 2AUJD 4C3IB 4BWGB 4A3DG 2ICEC 2WB1B 3VR5A 4UP7A 1IBLQ 1CKMA 4A3LG 3GDEA 4WRDA 2G5DA 1EIGA 1YBYA 1STEA 3OW7A 1ZYRC 1LTSD 4QUFA 1ILQA 2C9OA 2JE6I 4OX9Q 4LF9Q 2VUMH 3RZDB
chains in the Genus database with same CATH topology
1SMYD 3MVVA 3M4YA 1SDFA 2Z8LA 3T4AC 4UAIA 1JWMD 1OXTA 3H94A 3R2TA 3GP7A 5FLXL 1WTXA 2RDHA 4BBRB 2E2HB 2BOSA 2KA7A 4C3JG 3A55A 2KVMA 2JYOA 3ZYYX 4XT1B 5G3LF 4F87A 5NUCA 1HFGA 3M3YB 1SSOA 4CKCA 3R8BA 3D6CA 3U9SA 4V190 1J9OA 5C0XG 2BCOA 1F9QA 1JICA 1V43A 5C44B 3MHBA 2R93B 4DXFA 4ZUIA 2AWNA 1R9TB 2EYPA 2B2WC 1LACA 1FR3A 1WTRA 4HCSA 1I4HA 1XTCD 2L0CA 2Z1CA 3DHQA 2HCIA 4IUTA 3GTGB 1A3UA 1MD2D 3TN2A 4KKTA 1S5BD 1MI2A 1HUMA 2PNRC 1HFNA 1VF7A 2B2TA 5M9OA 4K2KA 5M5WB 4LK1C 5JVH3 2F3WA 2RSOA 1B50A 3A8KE 1BCPF 5BN4A 1FNWA 3IFTA 3K58A 2XWBB 2I46A 3N6RA 1UNSA 1PZJD 2F3VA 3OIQA 4X3UA 2AQ3B 2F0WA 2WINB 1GUSA 2BA0A 4V0BA 2XRQD 4NMZA 3HGBA 2O2LD 3I8ZA 2F0NA 1VF5C 2KCNA 1TY2A 1D2BA 3L7ZC 1ET6A 3K57A 1SYFA 1EY5A 3ITPA 3K5MA 1B44D 1FNUA 2PZTA 3HEJA 4IALA 3JAML 1DOKA 4HSVA 1RF2D 3C2PA 1TWGB 4HCEA 2XVSA 1E2WA 3M7GA 1D5XC 1B9NA 3S1MB 1PRTB 2EVBA 4J1MA 3I70A 3DM1A 3D4RA 4RAUC 2NVXB 1EY4A 3S1NB 2E75C 3MAQA 2Y0SB 4XT3B 1U4MA 4NKLA 1U4LA 3TZDA 2L1BA 3K5OA 2F0PA 1MSGA 3NE5B 4HAEA 2ZXPA 1KDAA 4IFDG 1IYUA 1WCMB 5EQ0A 1SMYC 4IURA 4L63B 2IWHA 2CW0D 2PW5A 1C4QA 4BA1I 3K6OA 4G7HC 5CBAE 3Q24A 1LTGD 1DONA 4KY5A 3K59A 4I7ZC 5I6WA 3HOVB 2X6LA 3OWEB 4RCOA 2F0KA 2EE1A 3MWYW 2B2VC 3T53B 1SYBA 3FKIB 5LHY1 5KEEA 2L5TA 4Z9CB 1UAPA 2NN6H 1RHPA 4C2MB 1HQRD 3WDNA 3S2DB 2NBFA 4M1UB 1EEFD 4XQNA 4G7ZC 2N88A 3HKZB 1K83B 3J81E 3AB9A 1CM9A 5FLXE 4X3KA 2K32A 3KF8A 3D4WA 2XSCA 2R61A 1LLRD 1GHKA 2F0GA 2WAQB 1EY0A 3DWQA 1EL0A 1I50B 1CFMA 5KNDA 4A3GB 5C4XB 2OF1A 3GTMB 5C4HA 4K8IA 2QKIC 2RDGA 3MEHA 1W6JA 1HA6A 3BYYB 2JEAI 2E2DC 4FXKC 5IGGA 3HG9A 2G9DA 1Y1WB 4F7XA 2B2YC 5C3EB 2SEBD 3GTQB 2KECA 1LTID 1ML0D 1SNMA 2MHVA 3AU7A 4I65A 3KK7A 4A3KB 4C3HB 4ZLTF 1FGBD 3M85A 3CU7A 4Y7NB 4IUPA 4RWSC 2XRSD 3KBXA 1NR2A 3C3LA 4HEDA 1I4QA 1EY7A 3A56A 3QWNA 1WTVA 1HA5A 3R93A 2R3ZA 4KTAA 5FK9C 4DAYA 4WORA 1D1KA 2JA7B 1TWFB 1TQOA 5I9PA 1TKWB 2J7ZA 1BR9A 1PTOD 3PMFA 2BE5D 2M9VA 2KEDA 1Q1EA 2EY6A 5JEAJ 2EYFA 4QCLA 1BXTA 3TP7A 3LWUA 1HHVA 5A2QE 2DN8A 2NUCA 3GD7A 2WKCA 3QG1A 4K8JA 1HTLD 2QF7A 3JAME 1JE4A 1PMRA 3IL8A 5I6YA 4C56C 1ICWA 1Y69U 1QCBD 1DM0B 1QG7A 4N9TA 2L11A 2J0TD 2CW0C 2QDBA 3NWSA 3EVQA 3T13A 1T5EA 4OO1I 1PFBA 2NN6G 1NCVA 5DAUA 2IX0A 3OMCA 4IN3A 1TWAB 3NTIA 4DK1A 2IX3A 1A15A 1BQQT 4RHSA 3SVMA 5T1IA 2EY1A 4JBWA 3A7AB 3RLFA 5CV5A 5JPNC 2PQEA 2X6GA 1DXMA 5T1GA 3VR4A 1SNQA 5DM73 2K5DA 2EPBA 3KUPA 1FYCA 2A5HA 3VR3A 1OXXK 4ULLA 4ABNA 2B39A 2I07B 1X3QA 3OIPA 2NTTA 3GV3A 4RGOS 3D4DA 3GV6A 1H9SB 3PV0A 2BDOA 1BCPB 2F0FA 1DOLA 1II3A 5M5YB 2B2UC 4XIGS 5J22A 3EQLC 1A2TA 1DOMA 3SK6A 3BG3A 3D6WA 1Y8NB 2K28A 1TR5A 3MZ5A 3VYRA 2EJGC 4KMUC 1F77A 3HOUB 3SE0A 1MSHA 4ILWA 4QB4A 1SBBB 4DXGA 1BF4A 3TMEA 3U9OA 4AYBB 1EZ8A 4HN7A 4KN4C 2EYHA 3S17B 3NTKA 2EZVA 3I4MB 1UEAB 4PMBA 4KKSA 1SNCA 3HOZB 2V4DA 3NWTA 4HTHA 5IIFA 3SHLA 1IYVA 3Q6SA 4M8AA 4KV6A 5J1ZA 1EFID 4ZKCB 3NP8A 1JR0D 3CRKC 3BVZA 2HDLA 4J6HA 2L12A 2IJ0A 2FJ2A 2KOLA 4H7BA 5E4XA 1SEBD 2EYMA 2PZUA 4BA2I 1WTWA 2X69A 2BDNA 3MC0B 3PUWA 3X3NA 1HUNA 1F2MA 3FDTA 4OIJA 4RH6A 1PTOC 2BE5C 3R2IA 4EGVA 1KLGD 1QILA 1A6XA 5CV7A 2JA8B 5EPLA 2WKDA 1TU2B 1YNJD 2HCCA 4C3IG 2MGSA 1Q1BA 4RKLA 5D3DA 1LT4D 2DY8A 4XTCS 1VCIA 3C46A 3RUZA 4YIJA 1VMPA 3QJYA 3TSSA 1STHA 1HPCA 2WACA 3J81L 1EYCA 3RZOB 1AP0A 4KJOA 5JPMC 4QUCA 1CQFA 3DWPA 1U4PA 1M8AA 4IQZA 1XWEA 5ELBA 4BY1B 3NPPA 2JXMB 3KLRA 4F88A 1JCKB 2ZXRA 4LAAA 4TQUS 1A3TA 1KABA 5EKLA 4K6LA 2PO4A 5KIXA 1O7LA 2VB3X 2JSOA 4A3EB 3DEOA 4FF2A 3BVGA 3A8IE 2AUKA 3NQIA 4PMWA 3NBHA 4ODGA 2YYZA 2SNSA 1OXVA 1LTBD 3SR1A 1PXUA 2RVLA 1ENCA 3NHHA 2CHBD 2CVRA 1STNA 2SNMA 5BN5A 3S15B 2QCPX 2PCFB 1I4GA 1CT1D 2M00A 1A3VA 1HRJA 4FVMA 4PQXA 1PFNA 2KCCA 1GXDC 5G3LD 4OHJA 1EIHA 2M2LA 2Q8TA 1TS5A 5CV6A 3MXPA 4K2LA 3I72A 1C8CA 2AQ2B 2HUGA 4X3TA 3DXJC 2D5DA 5IODA 1NUCA 1CHQD 1SJED 4NW2A 3A8JE 5CYUA 2K7VA 4RFBA 1Z7TA 3PUYA 5A2QL 4K5XA 4DF7A 1ONLA 2E2JB 1IKMA 2F0EA 3A54A 5ELCA 3W2DA 2PW7A 1JWSD 4DN4M 3J80L 3Q23A 2FFKB 1JC7A 4Q0FA 4IUQA 3VYTA 4KHZA 3OMGA 1PDQA 2EY2A 2DNEA 2EJMA 5LL6S 3BZDB 4BBSB 2EOTA 3H09A 3NK9A 1Z6HA 3IFDA 1BO0A 1YNJC 1QOHA 3IKJA 2FMCA 4OL7A 4BY7B 5IT9L 2R7ZB 2MP1A 4RGNA 4ZUJA 2E2IB 5C3XA 3S1QB 2B2VA 1G2TA 3TP5A 2H1EA 4ZAIA 1GOZA 3S2HB 1EU3A 2D9UA 5EKKA 5JAVA 1TS4A 2K6AA 3W3AA 2VB2X 2WIIB 1S5DD 4H0LC 1STGA 5I2YA 1I4PA 3A7LA 5CR3A 1AZQA 4EQPA 3T51B 3FEWX 5D65A 1U9RA 5LL6X 2K03A 2FMMA 4H13C 1JB3A 4G4KA 4B08A 4FXDA 5TSSA 1PZID 5I9OA 5JOBA 1NR4A 2ICIA 2CQAA 3J7AV 1NAPA 3SXHA 5C4JB 1O78A 2O4XA 4KY6A 3GTLB 2A6ED 1G291 1STYA 1AFPA 2DNCA 4G57A 2RSNA 5DEHA 1TIID 2WP8J 3PUVA 1S5CD 1GJXA 5EPJA 4XXEA 5HGTA 1D5MC 1CA5A 1F9PA 3GQBA 1TY0A 4K14A 1PTOF 4DGZA 3G6JB 1I4RA 1QE6A 4RHRA 3NTHA 3CQZB 5CGKA 4IZ8A 1SNDA 2SDFA 1B53A 2PMZB 1STAA 4MHEA 4P2CB 2QILA 2EYOA 4J8QA 1LTTD 4K5WA 4U68A 3P75A 2EYLA 2PYKA 4EQNA 3MTSA 4KJNA 4ZKBB 2JEBI 1SYGA 4B9XA 3VR2A 1H9SA 4CJ1B 4CJ0B 3GTJB 5IGCA 5K36H 1RODA 4O42A 1L0YB 4C3HG 4A3FB 1JOQA 1B9MA 5D3IB 3HOXB 2F1MA 3AMUA 3PO2B 2YU9B 4DK0A 2G9HD 5D14A 3VYSA 1OO9B 3WOEA 3BDLA 3GTKB 4L6TB 5IGBA 2A6HD 3C1FA 5F2DA 5IOCA 3J80E 3E0JA 2RKSA 1EQTA 3H0GB 1ET9A 3QOLA 4A3IB 3EJIA 4O1NA 1EOTA 2ID0A 4OO1H 2RBMA 1IL8A 2R6GA 3ND9A 4ZQ3A 5FKAC 3TDQA 3VYUA 2N55A 4A3MB 3H6MA 2F4IA 5K5PA 5COYA 2DY7A 2AWOA 5JVG3 1GUGA 3E6ZX 2XIWA 3G7LA 3HOYB 3S9WA 1TWCB 5KGUA 3C1EA 1QNUA 4IUNA 1H9JA 4XQJA 5IT9E 1V1OA 1T5XD 4GZYC 3VA5A 5KYLA 1XXGA 3TBIB 1PYWD 1ZKOA 2EY5A 5C5MA 1B3AA 1SNPA 5KNBA 2JA6B 1G2SA 5FO7B 1UUPA 5C4ZA 2KQ3A 2GA4B 3BS1A 2H4OA 1I6HB 2LKVA 4KN7C 4QMGA 4C1NI 1O7ZA 1G91A 1AEXA 1PRTD 1ESRA 1LO5D 1WVLA 5JEAH 5KNCA 2A6EC 5I2XA 1LABA 4PNYA 3I4NB 3NUCA 5FO9B 1SNOA 1F2LA 4DA2A 1F9RA 5C3WA 3P20A 3VA7A 5M5XB 2AQ1B 5ELFA 3SK4A 1IHZA 4KK7A 3V96A 1GUOA 3QO2A 1FD7D 1IW7D 2F0LA 4IFDJ 2O5JC 2L4NA 1GUNA 4TRDA 3N52A 1JWUD 3TP6A 5K36G 1EY9A 1LT6D 2B8GA 3T56B 5EBCA 1A2UA 1ENAA 2IPKD 4NP5A 4E6IA 2KJXA 3M4OB 1I4XA 4RGTA 1EQVA 1G6ZA 1DJRD 3BDOA 4LMQD 1BNZA 3OOCA 1H9MA 1Q12A 5I4DA 4A3DB 1H9KA 3NBIA 2Z4HA 1SYEA 4DU9A 4G7OC 5ISRA 1BDOA 3T16A 1B4OA 1SE3A 1D5ZC 3FRPB 2RA4A 1YNND 3EROA 2KEEA 1AN8A 1R4PB 1JOKA 4DAVA 1I6VC 1EU4A 2A6HC 1V1PB 1ENFA 3X3MA 4OO1G 1LT3D 2A68D 4DAPA 1QWYA 1X32A 1ZXTA 5EBDA 1DCZA 4TKOB 4ZYSA 3BYTB 2Z4IA 3Q22A 3V05A 1ILPA 1AW7A 2C5CA 1QJOA 4C3JB 3H91A 3KBGA 3MFGA 1EYAA 1CI3M 4H44C 3GTPB 1J8IA 1HTPA 3HP3A 5ELEA 3FPPA 3J7AF 2EDGA 4CBVA 4IFDH 4IFDI 1RJTA 4R8IA 2B2WA 4LJZC 3I90A 4OGQC 4ID6A 4A93B 4OIKA 4RGMA 3PUXA 1RD9D 1ESFA 1BUVT 2F0MA 1X3PA 2XWJB 3OPOA 5JEAG 3I73A 1B1ZA 3QB3A 4RCNA 3HZXA 4FNFA 4FYDA 1CHPD 3FMCA 1PTOB 3MFYA 3FVQA 4S3SA 2F0OA 3K5LA 3GTOB 2F0UA 4IUUA 3LX0A 3VR6A 5AFWA 1KDBA 1PRTC 3V2TA 1Y8OB 4CJ2C 1WD0A 4PV1C 1D6EC 1TWHB 1Q90A 2IL8A 2B8FA 4KD4A 1Q3LA 1F2ZA 4XYQA 4FO2A 2F0VA 3H3VC 4CKEA 2B2TC 1BBXC 2F0SA 4DNRB 3NQTA 4FF4A 4XDXA 3J7YW 4WFN3 1RKNA 1TVXA 2NVTB 1IW7C 2TMPA 2XN9C 2F0TA 4EQOA 2B63B 3S14B 1FNVA 1M4VA 1PLFA 3TP8A 1O80A 4HR7B 4QF4A 4QIWB 4WJWA 2VUMB 2WV6D 1MBYA 1BCPD 3D31A 4FP5D 3I4LA 2A74C 2JP1A 1WD1A 4N9PA 2K1BA 5FOBB 1YNNC 2F0HA 2LY7A 5JJZA 1CTMA 5M3FB 5E4WC 4L8JA 5DM63 1F9SA 1AZPA 1GHJA 2A68C 1GUTA 2ZT9C 1KNEA 3OWFA 2F03A 4KI0A 2D62A 2VXWA 3S16B 3DWAA 2NVYB 4FF1A 2EXZA 1HQMC 3SEBA 2F0DA 3PIO3 5IGEA 5EGTA 1SE2A 1Q8IA 5EKIA 1SFOB 3CHBD 5KYIA 1JORA 4U673 3CKIB 1CA6A 1VMCA 2R92B 2K33A 2MPMA 5EPKA 3NSWA 1Z47A 4KHVA 4Q5VA 1MGSA 2F0JA 2K5QA 1V8QA 2K5WA 2NN6I 1Y1VB 2FINB 4UDUC 2A69D 1VDZA 1EWCA 3IAYA 4XYOA 3HOWB 3MXGA 1K8MA 1RTNA 1PFMA 4DFAA 4R9WA 3QIAA 2OXPA 2OT2A 3SK8A 3QOJA 3SDZA 3EFXD 3K5NA 5ELDA 5C6AA 1TS2A 1SAPA 4HSPA 2O5IC 1HCZA 2B2YA 3HRZC 2LMCB 2PPBC 3ND8A 5M3MB 4A3JB 3MXNA 4KD3A 3TZUA 3DUZA 1LTRD 2A73B 4HMIA 2RQXA 2IW3A 1EEID 1W6KA 2F0IA 3R3OA 1O7YA 3WOFA 1TT2A 2ENBA 5CV8A 5KRUA 1PZKD 3O13A 3BVMA 2K04A 1E2ZA 1EY8A 1BOSA 2NB0A 1SYDA 2L9HA 1OXUA 4TSSA 4KY7A 2MJ8A 1HXYD 5IGFA 5C5LA 3D3RA 3DEPA 5C0XJ 2Q8IB 4EVOA 3SK5A 1E2VA 3F2UA 3L3OC 2SOBA 3MXUA 1RTOA 3RD4A 2D2CC 2EYJA 1SE4A 1XYIA 1BCPC 1KTKA 1DYQA 3EA6A 1E0BA 1H9RA 4BS9A 4MIUA 1JOOA 2QEJC 2NTSA 5A35A 2ZXOA 1SXTA 1ZYRD 3K7AB 5CV4A 2VNUD 4FXGC 2KHSA 3GO5A 3L9AX 2IT1A 5DNFA 4MN3A 3URYA 3P7JA 1C48A 4F8MA 3BDCA 1PRTF 5E1FA 1S5FD 1SJHD 1STBA 5IGDA 1R4QB 1DZ1A 1K8OA 1B2TA 4IUVA 3UI2A 1XX8A 1KLUD 2E76C 1EYDA 2NWGA 4ZRZA 3LNNA 5CORA 4C1NK 3MA2B 3I3CA 2LFNA 2LS01 1CZWA 2NZ1D 1KDCA 3KLSA 1LTAD 3D8GA 3OHXC 2BA1A 1QNKA 4X3SA 4RA8A 2B2UA 1KAAA 2OEOA 1LT5D 1NSNS 1ZEQX 1F2YA 2A69C 3E5SA 1CQVA 5J39A 1WTPA 2E74C 5HURA 2JA5B 1EY6A 3Q0AA 5C0XH 5C0XI 2TSSA 5CBEE 1V1PA 2K05A 1JQYD 2K01A 3ERQA 3NXWA 5CV9A 4PMCA 1RDPD 3M7NA 2PZWA 4JK1C 3LWEA 1Y8PB 5CMDA 5CC4A 1GUWA 4FF3A 4ME5A 4RKBA 3S1RB 4R8NA 2F0QA 1CK1A 3HS0C 3PIP3 5BN3A 3I91A 1CZGA 1PTOH 5FO8B 3ONAB 2HQEA 4XQQA 3OSOA 2IX1A 1EZ6A 1L0XB 2L55A 1WTQA 4K6DA 1U4RA 4K5VA 1KNAA 3RMHA 4ZK9B 3K0YA 4NDXA 1SYCA 3FPUB 3KLSX 1S4ZA 2EJFC 1RCVD 1WTOA 1S5ED 3PO3B 4CKBA 1OXSC 1TS3A 3PUZA 3P1HA 1G8ZD 1EWHA 1LV9A 4KKUA 2NVQB 2MUYA 2NYZD 4CHTB 1IKLA 1D1IA 4HMJA 2XNAC 2RDFA 3CRLC 1DD2A 1QB5D 2HDMA 1I3QB 2KUMA 3DMUA 2Q8RE 2FHTA 4CGYB 2J4XA 4A3BB 5EJWA 5E3FA 4B9WA 4DNTB 2AUJD 4C3IB 4BWGB 2ICEC 2WB1B 3VR5A 4WRDA 1EIGA 1STEA 3OW7A 1ZYRC 1LTSD 4QUFA 1ILQA 2C9OA 2JE6I 3RZDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NPP A;  2K5W A;  2K5Q A; 
#chains in the Genus database with same CATH topology
 1SMY D;  3MVV A;  1I94 L;  3M4Y A;  1SDF A;  1VQG A;  2Z8L A;  5IWA L;  1QUQ B;  3T4A C;  4UAI A;  1JWM D;  1L2F A;  3RN5 A;  1OXT A;  3H94 A;  3M4P A;  4JI8 Q;  2AMC B;  1K0R A;  3K80 C;  3R2T A;  5GQO A;  1HZC A;  1HJP A;  3GP7 A;  5FLX L;  4LF4 Q;  5EAY A;  1WTX A;  2RDH A;  4BBR B;  2E2H B;  5M3F H;  2BOS A;  4JI3 L;  2KA7 A;  1N36 Q;  1VQ4 A;  4C3J G;  3A55 A;  2KVM A;  2JYO A;  3ZYY X;  4XT1 B;  5G3L F;  1KAW A;  4F87 A;  1YJN A;  5NUC A;  1HFG A;  4DV5 L;  1VQP A;  4QGU A;  3H3V I;  3M3Y B;  1SSO A;  4CKC A;  2K5H A;  3R8B A;  5J3B A;  1XPO A;  3D6C A;  2HT1 A;  3S16 H;  3U9S A;  4V19 0;  1J9O A;  5C0X G;  2BCO A;  2NVY H;  3KF6 A;  1F9Q A;  1JIC A;  1V43 A;  5C44 B;  4B3S Q;  3W1G A;  3MHB A;  4A93 G;  2JJQ A;  2R93 B;  5HY6 A;  1YVC A;  4DXF A;  4ZUI A;  2Q2U A;  1SFO H;  2AWN A;  1R9T B;  2EYP A;  2B2W C;  1LAC A;  4WJ3 M;  1FR3 A;  1WTR A;  3HOV H;  1SE8 A;  4HCS A;  1I4H A;  1PH7 A;  1XTC D;  2L0C A;  2Z1C A;  3DHQ A;  4IJL A;  2HCI A;  4IUT A;  2R92 H;  4IPH A;  1VQL A;  3GTG B;  1A3U A;  1VQH A;  4DUY L;  1MD2 D;  4B3R L;  1CKN A;  3TN2 A;  1XMQ L;  4KKT A;  1S5B D;  1MI2 A;  2R7F A;  1HUM A;  2PNR C;  1HFN A;  1VF7 A;  1E1O A;  3KJP A;  2B2T A;  5M9O A;  2OWO A;  4K2K A;  3S2D H;  3HOW H;  5M5W B;  4DV6 L;  1C0A A;  4LK1 C;  5JVH 3;  2F3W A;  2RSO A;  3J81 j;  1B50 A;  3A8K E;  1BCP F;  5BN4 A;  1FNW A;  3IFT A;  1YJW A;  4R4C A;  3K58 A;  2XWB B;  2I46 A;  3N6R A;  4L5T A;  1UNS A;  1PZJ D;  3E3X A;  2K52 A;  2F3V A;  2FXQ A;  3OIQ A;  3DLL A;  4X3U A;  2AQ3 B;  2F0W A;  2WIN B;  1GUS A;  2BA0 A;  4V0B A;  2XRQ D;  4NMZ A;  4X6A H;  1X56 A;  3HGB A;  2O2L D;  2PI2 E;  4AQY L;  3I8Z A;  1SR3 A;  2F0N A;  1I50 H;  1VF5 C;  4A3G H;  2KCN A;  4IOA A;  1VS0 A;  1TY2 A;  4LUZ A;  1D2B A;  3L7Z C;  1ET6 A;  3K57 A;  1SYF A;  1EY5 A;  2KHI A;  5M3M H;  3ITP A;  3K5M A;  1B44 D;  4IJH A;  2B63 G;  4R4I A;  1FNU A;  1JB7 A;  2RF4 A;  2PZT A;  3HEJ A;  2EQS A;  4IAL A;  3JAM L;  3NEM A;  1DOK A;  4HSV A;  1RF2 D;  3C2P A;  1TWG B;  4HCE A;  5E7N A;  2YTX A;  1U5K A;  2XVS A;  1E2W A;  3M7G A;  1NNX A;  4DR7 Q;  1D5X C;  1B9N A;  3S1M B;  1PRT B;  2EVB A;  4J1M A;  3I70 A;  1VQC A;  3DM1 A;  5IYB H;  3D4R A;  3UDF A;  1E7Z A;  4RAU C;  2VUM G;  1W3S A;  4C3H H;  2NVX B;  3NBH B;  1UE5 A;  3UE1 A;  1EY4 A;  3S1N B;  2E75 C;  3MAQ A;  4AH6 A;  2Y0S B;  4XT3 B;  1U4M A;  1B3Q A;  4NKL A;  3D0F A;  1YNX A;  1U4L A;  3TZD A;  2L1B A;  3K5O A;  2F0P A;  4HJ8 A;  1MSG A;  3NE5 B;  4HAE A;  2ZXP A;  1KDA A;  2ZM6 L;  1YIJ A;  4IFD G;  1IYU A;  1WCM B;  1P8L A;  5EQ0 A;  5M3F G;  1SMY C;  4IUR A;  4L63 B;  2IWH A;  2CW0 D;  1HNZ L;  2PW5 A;  2WB1 E;  1C4Q A;  4BA1 I;  5ELN A;  4LF6 Q;  3K6O A;  3M9B A;  4G7H C;  5CBA E;  1TWF H;  3PCO B;  4JOI A;  3Q24 A;  1LTG D;  1DON A;  4KY5 A;  2KBN A;  3K59 A;  4I7Z C;  2DGY A;  5I6W A;  3HOV B;  2X6L A;  3K7A H;  4X62 L;  1XMO Q;  3OWE B;  4RCO A;  2F0K A;  2EE1 A;  3MWY W;  1KC8 C;  2B2V C;  3T53 B;  1SYB A;  3FKI B;  1BBW A;  5LHY 1;  5KEE A;  2L5T A;  4Z9C B;  1X65 A;  1UAP A;  4B3M Q;  2NN6 H;  1RHP A;  3I55 A;  4C2M B;  2K5V A;  1HQR D;  3WDN A;  1MHW C;  2CH4 W;  3S2D B;  3HOV G;  2NBF A;  1PYB A;  4M1U B;  1AH9 A;  1EEF D;  2R92 G;  4P71 A;  4XQN A;  4G7Z C;  2N88 A;  3HKZ B;  1K83 B;  3J81 E;  2P5Z X;  3AB9 A;  1CM9 A;  1W2B A;  5FLX E;  1PH3 A;  4ZCK A;  4DV3 L;  1Q81 C;  4YCW A;  4X3K A;  1XPR A;  4JVZ A;  2K32 A;  3KF8 A;  3D4W A;  2XSC A;  2R61 A;  1YIT A;  4JI1 Q;  1LLR D;  3HOW G;  1GHK A;  2F0G A;  2WAQ B;  1EY0 A;  1KXL A;  4L5Q A;  1IBL L;  4HIO A;  3DWQ A;  3CCR A;  1EL0 A;  1I50 B;  1CFM A;  4TVA B;  5KND A;  4A3G B;  5IYC H;  4NB3 A;  5C4X B;  5ELO A;  2OF1 A;  3CCQ A;  2K4K A;  4OX9 L;  3GTM B;  4LF9 L;  5C4H A;  1K3R A;  3CCV A;  4YY3 Q;  2DJF C;  2QKI C;  3K8A A;  4K8I A;  2RDG A;  1HR0 Q;  3MEH A;  1N9W A;  1W6J A;  2JA5 H;  1HA6 A;  3ULP A;  1XNQ Q;  3BYY B;  4K0K Q;  2JEA I;  4JI8 L;  2E2D C;  4FXK C;  5IGG A;  4LF4 L;  4POF A;  5M3M G;  3HG9 A;  3E0E A;  3U4V A;  4A3J G;  3OTO Q;  2G9D A;  3A5U A;  1N36 L;  4JW0 A;  2K50 A;  4F7X A;  4IO9 A;  1Y1W B;  3TS0 A;  1LYL A;  2B2Y C;  1VQO A;  3ULL A;  5C3E B;  2SEB D;  1QVF A;  3GTQ B;  3PSI A;  4LFA Q;  4LF8 Q;  2KEC A;  3S1R H;  1KQS A;  4JI2 Q;  4GN3 B;  1LTI D;  1ML0 D;  2PQA A;  1SNM A;  2MHV A;  3AU7 A;  5LMN W;  4I65 A;  3EN2 A;  3AEV A;  3KK7 A;  4A4I A;  5JJK A;  4A3K B;  4C3H B;  4ZLT F;  1FGB D;  3M85 A;  3CU7 A;  4Y7N B;  4MTN A;  4IUP A;  4DV0 Q;  3UDX A;  4RWS C;  1E3P A;  4B3S L;  2XRS D;  3KBX A;  1NR2 A;  3C3L A;  4HED A;  1I4Q A;  1EY7 A;  3A56 A;  4CDD C;  3PF5 A;  5IYB G;  3QWN A;  1WTV A;  1HA5 A;  4R4O A;  3R93 A;  2R3Z A;  3PO3 H;  4APV A;  3HOZ H;  4KTA A;  5FK9 C;  4DAY A;  4WOR A;  1D1K A;  3PF4 A;  2JA7 B;  1WYD A;  1TWF B;  1TQO A;  5I9P A;  1TKW B;  2J7Z A;  3PMF A;  1BR9 A;  1PTO D;  2BE5 D;  2M9V A;  2KED A;  1Q1E A;  3WWV A;  2NVQ H;  2EY6 A;  5JEA J;  2EYF A;  4QCL A;  1BXT A;  1DGS A;  3TP7 A;  3LWU A;  1HHV A;  5A2Q E;  2DN8 A;  1EWI A;  2NUC A;  3GD7 A;  2WKC A;  3QG1 A;  4K8J A;  1HTL D;  1I3Q H;  1J5E Q;  2QF7 A;  3JAM E;  1JE4 A;  1PMR A;  1QVC A;  2RHS B;  2GVA A;  2RCF A;  3IL8 A;  4YWL A;  2Q2T A;  5I6Y A;  4C56 C;  4A3B H;  1ICW A;  1Y69 U;  1QCB D;  1DM0 B;  1QG7 A;  4N9T A;  1SMX A;  2L11 A;  2J0T D;  4C3I H;  2CW0 C;  2QDB A;  1CSQ A;  3NWS A;  3EVQ A;  3T13 A;  1T5E A;  1PV4 A;  2AHO B;  4YWM A;  4OO1 I;  1PFB A;  2NN6 G;  1NCV A;  4WJ4 A;  5DAU A;  4H02 A;  2IX0 A;  2BH2 A;  3OMC A;  4IN3 A;  2ZTE A;  1TWA B;  3NTI A;  4DK1 A;  2IX3 A;  1A15 A;  1BQQ T;  4RHS A;  3SVM A;  5T1I A;  2EY1 A;  4JBW A;  3A7A B;  3RLF A;  5CV5 A;  5JPN C;  3RZD H;  2MFI A;  2PQE A;  4LUO A;  4N8F A;  2X6G A;  3CCU A;  1SRO A;  1DXM A;  5T1G A;  2PQA B;  3U58 A;  5HGQ A;  3VR4 A;  1SNQ A;  5DM7 3;  5IP7 H;  2K5D A;  2EPB A;  3KUP A;  3J7Z C;  1FYC A;  2A5H A;  3VR3 A;  4GOP C;  1A62 A;  1OXX K;  4ULL A;  4ABN A;  4DNI A;  3AFQ A;  2B39 A;  2I07 B;  1X3Q A;  1NE3 A;  3OIP A;  1B70 B;  1L1O C;  2NTT A;  3GV3 A;  3LGJ A;  4BBR H;  4RGO S;  2E2H H;  4DR7 L;  3D4D A;  3GV6 A;  1H9S B;  2QEX A;  1HNW Q;  3PV0 A;  2BDO A;  1BCP B;  2F0F A;  2ATW A;  1DOL A;  1II3 A;  5M5Y B;  2B2U C;  4XIG S;  1AE3 A;  5J22 A;  3M3Y H;  3EQL C;  1A2T A;  1DOM A;  3SK6 A;  1PH4 A;  3BG3 A;  2JA5 G;  4DR3 Q;  3D6W A;  2Q2H A;  1Y8N B;  2MQH A;  2K28 A;  5C44 H;  1TR5 A;  3MZ5 A;  3VYR A;  1U0L A;  1QUQ A;  2R93 H;  2EJG C;  4KMU C;  4P75 A;  1F77 A;  4OXP A;  3HOU B;  3SE0 A;  1OTC A;  2Z6K A;  1MSH A;  4ILW A;  1R9T H;  4LF5 Q;  4QB4 A;  1SBB B;  4LF6 L;  4DXG A;  1BF4 A;  3TME A;  1EFW A;  3GTG H;  1J6Q A;  2KEN A;  3U9O A;  3B6Y A;  2LXK A;  4AYB B;  2L15 A;  4MZ9 A;  1EZ8 A;  4HN7 A;  4KN4 C;  2EYH A;  3S17 B;  3NTK A;  2EZV A;  3I4M B;  1UEA B;  4PMB A;  1XMO L;  1K0S A;  4KKS A;  1SNC A;  3HOZ B;  2V4D A;  4DV4 L;  3NWT A;  1X3F A;  5M5W H;  4P72 A;  1VQN A;  1N32 Q;  4HTH A;  1BKB A;  4R1J A;  5IIF A;  3T1Y Q;  3SHL A;  3FP9 A;  4B3M L;  1IYV A;  3Q6S A;  1MKH A;  4M8A A;  1YJ9 A;  4KV6 A;  4L5R C;  5J1Z A;  4A75 A;  4DPG A;  5AJ3 Q;  3PO3 G;  1S72 A;  1EFI D;  3PQI A;  4ZKC B;  3NP8 A;  4GOP B;  1JR0 D;  4HJ7 A;  3CRK C;  3BVZ A;  2HDL A;  2N49 A;  4J6H A;  2L12 A;  4UHV A;  2IJ0 A;  3VDY A;  2C35 B;  2FJ2 A;  4DV7 Q;  4IPC A;  2KOL A;  1P16 A;  4JI1 L;  4H7B A;  5E4X A;  1UWV A;  4X64 Q;  1SEB D;  2EYM A;  1T9H A;  4PZ6 A;  2PZU A;  4HJA A;  4BA2 I;  1WTW A;  2X69 A;  2BDN A;  3MC0 B;  3K7U C;  3J81 c;  3CMA A;  3PUW A;  5FLX c;  3X3N A;  1HUN A;  1F2M A;  3FDT A;  2LXJ A;  4OIJ A;  4DV2 Q;  4HID A;  1VQE A;  2CQO A;  4RH6 A;  1PTO C;  2BE5 C;  3R2I A;  3NEN A;  4EGV A;  1KLG D;  2IHE A;  3L0O A;  1QIL A;  4A3B G;  1EUJ A;  1A6X A;  4YY3 L;  5CV7 A;  2JA8 B;  5EPL A;  4HJ5 A;  1HR0 L;  2WKD A;  1TU2 B;  1YNJ D;  2HCC A;  4C3I G;  4JV5 Q;  2MGS A;  2MO1 A;  4DR4 L;  1Q1B A;  1TWG H;  2WB1 G;  4RKL A;  5D3D A;  1LT4 D;  2DY8 A;  4XTC S;  4K0K L;  3KOJ A;  5GAE C;  1VCI A;  3C46 A;  2ZJR A;  3RUZ A;  4YIJ A;  1X6O A;  1VMP A;  3QJY A;  3TSS A;  1STH A;  3S1M H;  1HPC A;  2WAC A;  1Q82 C;  3J81 L;  1I5F A;  2A8V A;  4L5S A;  3OTO L;  1EYC A;  3RZO B;  1HH2 P;  1PA6 A;  1AP0 A;  4KJO A;  5JPM C;  1JE5 A;  3F1Z A;  3L2P A;  2NVX H;  4QUC A;  3S1N H;  3ULJ A;  5IYD H;  4LFA L;  4LF8 L;  1CQF A;  3DWP A;  1U4P A;  4P74 A;  4JI2 L;  1UE1 A;  1M8A A;  5IP7 G;  3TEH B;  4IQZ A;  1VQ8 A;  4JI5 Q;  3ICE A;  1XWE A;  5ELB A;  4BY1 B;  2MNA A;  4FDB A;  5GAG C;  3NPP A;  3H3V H;  2JXM B;  3KLR A;  4F88 A;  4DV0 L;  1JCK B;  2ZXR A;  4LAA A;  4TQU S;  4DK3 C;  1WCM H;  4BBR G;  1A3T A;  1KAB A;  5EKL A;  1XNR Q;  1LUZ A;  4J15 A;  4K6L A;  2PO4 A;  5KIX A;  1O7L A;  2VB3 X;  3HFZ B;  2JSO A;  4A3E B;  4OWT B;  3DEO A;  4FF2 A;  3BVG A;  3A8I E;  1IZ6 A;  4HIM A;  1VQI A;  1FL0 A;  2AUK A;  3NQI A;  4PMW A;  3NBH A;  4ODG A;  2YYZ A;  2SNS A;  1OXV A;  5C44 G;  5FJ8 H;  2ES2 A;  1LTB D;  3SR1 A;  1PXU A;  3FKI H;  2RVL A;  2UXB Q;  4DR6 Q;  2R93 G;  1ENC A;  2VQE Q;  3NHH A;  3TRZ A;  2K14 A;  2CHB D;  2CVR A;  4C2M H;  2GN5 A;  1STN A;  3J81 i;  2SNM A;  4GLV B;  5BN5 A;  1J5E L;  3S15 B;  1K83 H;  2QCP X;  2PCF B;  4QL5 A;  1I4G A;  4QY7 A;  4GKJ Q;  1CT1 D;  2M00 A;  1K9M C;  1A3V A;  1S3O A;  1HRJ A;  3ER0 A;  4FVM A;  2CWP A;  4PQX A;  1PFN A;  1N33 Q;  2KCC A;  3JAM c;  1GXD C;  5G3L D;  4OHJ A;  1EIH A;  2M2L A;  2Q8T A;  1TS5 A;  4UP8 A;  2OTL A;  1YI2 A;  3GTL H;  5CV6 A;  3MXP A;  4K2L A;  3I72 A;  1C8C A;  2AQ2 B;  4NXM Q;  5C4X H;  3A0J A;  2HUG A;  4X3T A;  3DXJ C;  2F3I A;  3GTM H;  2D5D A;  5IOD A;  1NUC A;  1CHQ D;  1SJE D;  4NW2 A;  2F4V Q;  3K81 C;  3A8J E;  5CYU A;  2K7V A;  4RFB A;  3I7F A;  4KLK A;  1Z7T A;  1IBM Q;  3PUY A;  5A2Q L;  4K5X A;  4DF7 A;  1ONL A;  2E2J B;  3CPF A;  1IKM A;  2F0E A;  3CC4 A;  3A54 A;  5ELC A;  3W2D A;  2PW7 A;  5L37 A;  3RLN A;  1JWS D;  4DN4 M;  3J80 L;  1QVG A;  3Q23 A;  1Y1W H;  2FFK B;  1JC7 A;  4Q0F A;  1HNW L;  5C3E H;  4LFB Q;  4IUQ A;  3GTQ H;  1YHQ A;  1K8A C;  3VYT A;  2K5N A;  4KHZ A;  2B29 A;  3ZJY C;  4A3K H;  3OMG A;  1PDQ A;  2EY2 A;  4A3C H;  4DR3 L;  2DNE A;  4Y7N H;  2Q2I A;  2EJM A;  1PH8 A;  5LL6 S;  2A19 A;  3BZD B;  1FJG Q;  4BBS B;  1IYJ B;  1KIX A;  2EOT A;  1JJC B;  3H09 A;  4LF5 L;  3NK9 A;  1Z6H A;  3IFD A;  3CC2 A;  3EBE A;  1BO0 A;  1YNJ C;  1QOH A;  1Q46 A;  3IKJ A;  2FMC A;  2Y0S G;  4OL7 A;  1CSP A;  1WOC A;  4BY7 B;  5IT9 L;  2R7Z B;  2ALY B;  5DLQ E;  2CCZ A;  2JA7 H;  1KRT A;  2MP1 A;  4RGN A;  4ZUJ A;  2E2I B;  5C3X A;  3PO2 H;  3S1Q B;  2B2V A;  1G2T A;  4JI6 Q;  3STB D;  3TP5 A;  1JMC A;  2H1E A;  4ZAI A;  1GOZ A;  3S2H B;  1WCM G;  1EU3 A;  2DJG C;  2D9U A;  3IRB A;  1VQK A;  1N32 L;  4GNX C;  4Y52 H;  5EKK A;  5JAV A;  3JAM i;  1TS4 A;  3T1Y L;  2K6A A;  3W3A A;  1VQB A;  2VB2 X;  2AKW B;  2WII B;  1EQQ A;  4KHP Q;  3S24 A;  1S5D D;  1WJJ A;  5LMU Q;  2VZA A;  5AJ3 L;  4GN5 A;  4H0L C;  5IE8 A;  1STG A;  5I2Y A;  4BXX H;  3OYY A;  1I4P A;  3A7L A;  5CR3 A;  3CC7 A;  5FJ8 G;  1AZQ A;  4EQP A;  3FKI G;  3T51 B;  3FEW X;  5D65 A;  4DV7 L;  1U9R A;  1Q7Y C;  5LL6 X;  2K03 A;  2FMM A;  4X64 L;  2CWA A;  2N3S A;  4H13 C;  1JB3 A;  4G4K A;  4CDC C;  4B08 A;  1JJ2 A;  4FXD A;  4UP9 A;  5TSS A;  1TWA H;  1PZI D;  4JI4 Q;  5I9O A;  5JOB A;  1NR4 A;  2ICI A;  4DV2 L;  1Q86 C;  3HKZ G;  2CQA A;  3J7A V;  2UXD Q;  1NAP A;  1LTL A;  5JJI A;  2GVB A;  3SXH A;  5C4J B;  1O78 A;  2O4X A;  4KY6 A;  1QZH A;  3GTL B;  1JT8 A;  3RR5 A;  2A6E D;  4DR5 Q;  1G29 1;  1STY A;  1AFP A;  4JV5 L;  2DNC A;  4G57 A;  2EXD A;  2RSN A;  3Q8D A;  5DEH A;  1TII D;  3I2Z A;  2WP8 J;  2WAQ G;  3PUV A;  1S5C D;  2UUC Q;  1GJX A;  5EPJ A;  1GKH A;  4I7A A;  4XXE A;  2JA6 H;  5HGT A;  1D5M C;  4A3G G;  1CA5 A;  1F9P A;  3GQB A;  5C4X G;  2OQ0 A;  1TY0 A;  4K14 A;  4DUZ Q;  2I5H A;  1PTO F;  4DGZ A;  5M5Y H;  3G6J B;  2K75 A;  4MNO A;  1I4R A;  1QE6 A;  4RHR A;  3NTH A;  3CQZ B;  5LMN Q;  5CGK A;  1B7Y B;  4IZ8 A;  1KL9 A;  1SND A;  2V1C C;  2SDF A;  1B53 A;  4JI5 L;  3H15 A;  2PMZ B;  1STA A;  4MHE A;  4P2C B;  1HR0 W;  2QIL A;  2EYO A;  4J8Q A;  2VQF Q;  1QZG A;  3HOU H;  1LTT D;  4K5W A;  4U68 A;  3P75 A;  2EYL A;  3BJU A;  2PYK A;  5JJL A;  1Y1W G;  4EQN A;  3MTS A;  4KJN A;  5C3E G;  1XNR L;  4ZKB B;  2JEB I;  1V1Q A;  3CW2 C;  1SYG A;  4B9X A;  3VR2 A;  1H9S A;  1G6P A;  4CJ1 B;  4CJ0 B;  3GTJ B;  3S17 H;  5IGC A;  5K36 H;  1ROD A;  4O42 A;  2VW9 A;  1L0Y B;  4C3H G;  4A3K G;  3I4M H;  4A3C G;  4A3F B;  3CD6 A;  1JOQ A;  1K3B C;  2UXB L;  4DR6 L;  1B9M A;  5D3I B;  3HOX B;  2F1M A;  3AMU A;  1X3G A;  3PO2 B;  2VQE L;  2YU9 B;  4DK0 A;  2G9H D;  5D14 A;  3VYS A;  1OO9 B;  2KCM A;  3WOE A;  3I56 A;  3BDL A;  3GTK B;  4L6T B;  5IGB A;  2A6H D;  3C1F A;  5F2D A;  4GKJ L;  2JA7 G;  3RN2 A;  5IOC A;  3J80 E;  3E0J A;  2RKS A;  3EIV A;  1EQT A;  3H0G B;  1Q8K A;  1ET9 A;  1N33 L;  3QOL A;  4X65 Q;  2UU9 Q;  4A3I B;  4OWW B;  2N78 A;  2F52 A;  3G6E A;  3EJI A;  4GLA C;  4O1N A;  4DR2 Q;  1XJV A;  1EOT A;  1VQD A;  2Y0S E;  2ID0 A;  4OO1 H;  1NY4 A;  2RBM A;  1IL8 A;  2R6G A;  3ND9 A;  4NXM L;  4ZQ3 A;  2LSS A;  3STB C;  5FKA C;  3TDQ A;  3VYU A;  2N55 A;  3MXN B;  4A3M B;  2JA8 H;  2CH4 A;  3H6M A;  2F4I A;  5K5P A;  4JC0 A;  2F4V L;  5COY A;  2DY7 A;  2AWO A;  5JVG 3;  1GUG A;  3E6Z X;  2HD3 A;  2XIW A;  1IBM L;  4GOP A;  3G7L A;  3HOY B;  4UPA A;  3S9W A;  1TWC B;  5KGU A;  3C1E A;  3KJO A;  3MEF A;  1QNU A;  4IUN A;  2PNH A;  1H9J A;  4XQJ A;  5IT9 E;  4HIK A;  1V1O A;  4X66 Q;  1T5X D;  4GZY C;  2Z0S A;  3RZO H;  3VA5 A;  3F2C A;  5KYL A;  1XXG A;  3TBI B;  1PYW D;  1HZA A;  1ZKO A;  4P73 A;  1H95 A;  4LFB L;  2EY5 A;  5C5M A;  1B3A A;  1SNP A;  5KNB A;  2JA6 B;  1G2S A;  5FO7 B;  4LF7 Q;  1UUP A;  5C4Z A;  2KQ3 A;  4CDE C;  5IYC G;  2GA4 B;  3BS1 A;  3OW2 A;  2H4O A;  3T1H Q;  1IBK Q;  1I6H B;  4BY1 H;  1PH1 A;  2LKV A;  1G51 A;  1PH6 A;  4KN7 C;  4QMG A;  4C1N I;  4NXN Q;  1O7Z A;  1A8V A;  1G91 A;  3HKZ E;  1AEX A;  2HIX A;  1PRT D;  1ESR A;  1LO5 D;  1FJG L;  1WVL A;  3U4Z A;  5JEA H;  3CCE A;  5KNC A;  2A6E C;  5I2X A;  1LAB A;  4PNY A;  3I4N B;  3NUC A;  4QJF A;  5FO9 B;  1SNO A;  1F2L A;  4A3E H;  2WAQ E;  4DA2 A;  1F9R A;  5C3W A;  3P20 A;  3VA7 A;  4R4T A;  5M5X B;  2A1A A;  2OCE A;  4JBM A;  2AQ1 B;  2RHQ B;  5ELF A;  3SK4 A;  1YEZ A;  4JI6 L;  2JN4 A;  1IHZ A;  3HOU G;  4KK7 A;  3V96 A;  1GUO A;  3U50 C;  3QO2 A;  4DR1 Q;  1FD7 D;  4EQ5 A;  1IW7 D;  3GTO H;  2F0L A;  1JJG A;  2Z6K C;  4IFD J;  2O5J C;  2HIV A;  3KDF A;  3S15 H;  4KHP L;  5LMU L;  2L4N A;  4AYB G;  1GUN A;  4TRD A;  1NMG A;  3N52 A;  3CXC A;  1JWU D;  3TP6 A;  3PIP A;  3RNU A;  5K36 G;  1EY9 A;  1LT6 D;  3I4M G;  2B8G A;  3T56 B;  5EBC A;  4NPS A;  2QA4 A;  2IY5 B;  1A2U A;  3HOZ G;  1IXR A;  1ENA A;  2IPK D;  4NP5 A;  4E6I A;  2KJX A;  3M4O B;  1I4X A;  5IP9 H;  1L1O B;  4RGT A;  1EQV A;  1G6Z A;  4B3T Q;  1DJR D;  3BDO A;  4LMQ D;  1BNZ A;  1GO3 E;  4JI4 L;  2D0P A;  3OOC A;  4LUV A;  2UUB Q;  1CKO A;  1H9M A;  1Q12 A;  4N8X 1;  3SGI A;  5I4D A;  4HJ9 A;  2UXD L;  4A3D B;  1H9K A;  3NBI A;  1RL2 A;  1VQ9 A;  5BR8 Q;  2Z4H A;  2NVT H;  4O0A A;  4OEL B;  1KD1 C;  2D0O A;  1SYE A;  3G4S A;  4DR5 L;  4DU9 A;  4G7O C;  5ISR A;  1D8L A;  4DAM A;  1BDO A;  3T16 A;  1B4O A;  1SE3 A;  1D5Z C;  3FRP B;  2E2J H;  1C9O A;  2RA4 A;  1YNN D;  3ERO A;  1Z9F A;  2KEE A;  1AN8 A;  1R4P B;  1JOK A;  2UUC L;  1KRS A;  4DAV A;  1I6V C;  1EU4 A;  1N8R C;  1SLJ A;  2A6H C;  1XNQ L;  1V1P B;  1ENF A;  3X3M A;  2VL6 A;  4OO1 G;  1LT3 D;  2A68 D;  4DAP A;  1UE6 A;  1QWY A;  2VY3 A;  1X32 A;  1ZXT A;  5EBD A;  1DCZ A;  4TKO B;  4DUZ L;  4LNQ A;  2CFM A;  2JA8 G;  4GS3 A;  3FHW A;  1K73 C;  4ZYS A;  3BYT B;  2Z4I A;  3Q22 A;  4DV1 Q;  3E9I A;  1CUK A;  5LMN L;  3V05 A;  1ILP A;  1AW7 A;  2C5C A;  1QJO A;  2ASB A;  4C3J B;  4CDF C;  3H91 A;  4JI0 Q;  4OEM B;  3KLW A;  2VQF L;  3KBG A;  1S40 A;  3MFG A;  4BBS H;  1EYA A;  1CI3 M;  4H44 C;  3GTP B;  1J8I A;  1HTP A;  3HP3 A;  5ELE A;  4LWC A;  3FPP A;  4PZ8 A;  3J7A F;  2EDG A;  4CBV A;  3KDF B;  4IFD I;  4IFD H;  2UXC Q;  2NZH A;  4IPD A;  1RJT A;  4R8I A;  4DK6 C;  4JCV E;  1SN8 A;  2B2W A;  4LJZ C;  3I90 A;  4OGQ C;  4ID6 A;  4BY7 H;  4A93 B;  2R7Z H;  4OIK A;  4BY1 G;  3AYH B;  2E2I H;  1PH2 A;  4RGM A;  3PUX A;  3S1Q H;  3CME A;  1GM5 A;  1RD9 D;  1ESF A;  2I5L X;  1BUV T;  3S2H H;  3JC6 6;  2F0M A;  1X3P A;  4EX5 A;  3CPW A;  2XWJ B;  3OPO A;  5JEA G;  1X54 A;  3I73 A;  1B1Z A;  3QB3 A;  4RCN A;  3HZX A;  4FNF A;  4FYD A;  1CHP D;  3FMC A;  3I4O A;  1PTO B;  3MFY A;  1XPU A;  3FVQ A;  4S3S A;  4A3E G;  2HHH Q;  2QDL A;  2F0O A;  3K5L A;  3GTO B;  2F0U A;  4IUU A;  3LX0 A;  3VR6 A;  5AFW A;  1KDB A;  4JBJ A;  5GRO A;  1PRT C;  3V2T A;  1Y8O B;  2JA9 A;  4CJ2 C;  1WD0 A;  1VQF A;  4PV1 C;  1D6E C;  2KHJ A;  1TWH B;  1Y1V H;  4X65 L;  2UU9 L;  1Q90 A;  2IL8 A;  2B8F A;  3RLO A;  4DR2 L;  4KD4 A;  1Q3L A;  1F2Z A;  4XYQ A;  1VQ7 A;  4FO2 A;  3J80 c;  2F0V A;  3H3V C;  4CKE A;  2IHF A;  2OQK A;  2B2T C;  5C4J H;  1BBX C;  2UUA Q;  4JYA Q;  2F0S A;  2Z6B A;  4DNR B;  3NQT A;  3UDI A;  4FF4 A;  4XDX A;  3KFU A;  3J7Y W;  4WFN 3;  1RKN A;  1HZ9 A;  1TVX A;  1PVO A;  2NVT B;  1IW7 C;  4GKK Q;  2TMP A;  2XN9 C;  5IP9 G;  4GLX A;  2F0T A;  4EQO A;  4O2D A;  4AYB E;  1YZ6 A;  4LFC Q;  2B63 B;  1VQ5 A;  3S14 B;  1FNV A;  1M4V A;  5FLM H;  1B8A A;  4X66 L;  1PLF A;  4JBK A;  4GN4 B;  2B3G A;  3TP8 A;  1O80 A;  4HR7 B;  1KHI A;  4A3J H;  2ZJP A;  4QF4 A;  4LF7 L;  3CQZ H;  5GAH C;  1M90 C;  2WFW A;  4ME3 A;  1X3E A;  3T1H L;  4JG2 A;  4QIW B;  1IBK L;  3ERS X;  5IT9 c;  4WJW A;  4NXN L;  1EQR A;  1XTD A;  2VUM B;  3KF6 B;  1NMF A;  1RIP A;  2WV6 D;  3HKS A;  1MBY A;  3DM3 A;  1BCP D;  3D31 A;  4FP5 D;  3I4L A;  2A74 C;  2JP1 A;  3KYH C;  1WD1 A;  2YTY A;  4N9P A;  2K1B A;  4R4Q A;  5FOB B;  3GTJ H;  1YNN C;  2F0H A;  3J7A 5;  3CP0 A;  2LY7 A;  5JJZ A;  1CTM A;  1MJE A;  4A3F H;  5M3F B;  1CKN B;  3W1B A;  5IYD G;  5E4W C;  4L8J A;  1SRU A;  5DM6 3;  1F9S A;  1AZP A;  1GHJ A;  2A68 C;  1GUT A;  1HZB A;  2ZT9 C;  1KNE A;  3HOX H;  4POG A;  4BBS G;  3OWF A;  2F03 A;  4GNX A;  1HNX Q;  2QW7 A;  2YU9 H;  4KI0 A;  2D62 A;  4DR1 L;  3TS2 A;  2VXW A;  1N34 Q;  3S16 B;  2E5L Q;  3DWA A;  2EIF A;  2NVY B;  3GTK H;  4FF1 A;  4BY7 G;  3J80 i;  2EXZ A;  4YHH Q;  1HQM C;  3SEB A;  2R7Z G;  2F0D A;  3PIO 3;  5IGE A;  5EGT A;  1GVP A;  1SE2 A;  1WI5 A;  1Q8I A;  5EKI A;  1SFO B;  3CHB D;  2KCT A;  5KYI A;  4JI7 Q;  1JOR A;  2VS1 A;  3H0G H;  4U67 3;  3CKI B;  1D7Q A;  3K0X A;  4JOI C;  1CA6 A;  1VMC A;  1EYG A;  2R92 B;  2K33 A;  2MPM A;  2R7D A;  5EPK A;  3A74 A;  1L0W A;  3NSW A;  4A3I H;  1MJC A;  4DV4 Q;  1MIU A;  3CCS A;  1Z47 A;  3BU2 A;  3PIO A;  4KHV A;  4Q5V A;  3F2B A;  1MGS A;  2F0J A;  4B3T L;  2K5Q A;  4JPB W;  1V8Q A;  2K5W A;  2NN6 I;  1Y1V B;  2NZO A;  2FIN B;  2UUB L;  4UDU C;  2A69 D;  1VDZ A;  1EWC A;  3IAY A;  4XYO A;  1K28 A;  1C7Y A;  3HOW B;  4DKA C;  4A3M H;  5BR8 L;  3MXG A;  1K8M A;  1RTN A;  3NEL A;  1PFM A;  4DFA A;  1FGU A;  4R9W A;  3HOY H;  1TWC H;  3QIA A;  2OXP A;  1ICF B;  2OT2 A;  3SK8 A;  1Y1V G;  3QOJ A;  3SDZ A;  1Y14 B;  3EFX D;  3K5N A;  5ELD A;  5C6A A;  1TS2 A;  1UE7 A;  2BH8 A;  1SAP A;  4HSP A;  4MTK A;  2O5I C;  3CCJ A;  1HCZ A;  2B2Y A;  3HRZ C;  2LMC B;  2PPB C;  1UEB A;  1I6H H;  4DV1 L;  1WTH A;  3ND8 A;  1PH5 A;  5M3M B;  4A3J B;  1EIY B;  3BZK A;  3MXN A;  1AE2 A;  4KD3 A;  4OON A;  4JI0 L;  4PZ7 A;  4DR4 Q;  1I94 Q;  3TZU A;  5IWA Q;  3DUZ A;  4GNX B;  1LTR D;  1ASZ A;  2A73 B;  5FLM G;  4HMI A;  2RQX A;  1A63 A;  2JQO A;  3I4N H;  1TXY A;  2IW3 A;  1EEI D;  1W6K A;  2UXC L;  2F0I A;  3R3O A;  1O7Y A;  3WOF A;  1TT2 A;  2ENB A;  5M5X H;  4JI3 Q;  5CV8 A;  3PGZ A;  5KRU A;  1PZK D;  3O13 A;  3BVM A;  2K04 A;  4DV5 Q;  1E2Z A;  1EY8 A;  1BOS A;  2NB0 A;  1A0I A;  1SYD A;  2L9H A;  1OXU A;  4TSS A;  1K8G A;  4KY7 A;  2MJ8 A;  1HXY D;  5IGF A;  5C5L A;  3D3R A;  3DEP A;  5C0X J;  2Q8I B;  4EVO A;  3SK5 A;  1E2V A;  4YCU A;  2JK8 A;  3F2U A;  2HHH L;  1PH9 A;  3L3O C;  2SOB A;  3F8T A;  3MXU A;  1RTO A;  3RD4 A;  4A3F G;  2D2C C;  2EYJ A;  1VQJ A;  5H1S E;  1SE4 A;  1XYI A;  1BCP C;  1KTK A;  1DYQ A;  3EA6 A;  1E0B A;  3HOX G;  1EIF A;  1H9R A;  3M4O H;  4BS9 A;  3BZC A;  2I0Q A;  2Z9H A;  4IPG A;  4MIU A;  4DUY Q;  3PO2 G;  4B3R Q;  1JOO A;  3KF8 B;  1XMQ Q;  2QEJ C;  4QIW E;  2ZTC A;  2PI2 A;  2NTS A;  2ZTD A;  5A35 A;  2ZXO A;  1E22 A;  3K7A B;  1SXT A;  1ZYR D;  5CV4 A;  2ZJQ A;  4FXG C;  2VNU D;  2XTI A;  1V9P A;  2H5X A;  2KHS A;  4A3D H;  3GO5 A;  4LW1 A;  4AIM A;  4DV6 Q;  3L9A X;  2UUA L;  2IT1 A;  5DNF A;  4JYA L;  4A76 A;  1YHA A;  4MN3 A;  3URY A;  3P7J A;  1C48 A;  4A3L H;  4F8M A;  3BDC A;  1EOV A;  1PRT F;  5E1F A;  1S5F D;  1SJH D;  2E8G A;  1STB A;  5IGD A;  3H0G G;  1R4Q B;  4BXX G;  1DZ1 A;  1K8O A;  1B2T A;  4IUV A;  3UI2 A;  1XX8 A;  1M1K C;  4GKK L;  1KLU D;  2E76 C;  4A3I G;  1EYD A;  2NWG A;  4ZRZ A;  3LNN A;  1NTG A;  5COR A;  4C1N K;  3MA2 B;  3I3C A;  1FVI A;  2YV5 A;  4LFC L;  2YTV A;  1ASY A;  1PFS A;  2LFN A;  2LS0 1;  4QQB X;  3UDG A;  1GD7 A;  4AQY Q;  1CZW A;  2NZ1 D;  3W5O A;  1L1O A;  1KDC A;  2N8N A;  3KLS A;  3E9H A;  1NBW A;  1LTA D;  4A3M G;  2RCN A;  1X55 A;  3D8G A;  3OHX C;  2BA1 A;  1QNK A;  3QR8 A;  4X3S A;  4RA8 A;  4ALP A;  2B2U A;  1KAA A;  2OEO A;  3HOY G;  4C3J H;  1LT5 D;  1O7I A;  1PHJ A;  1VQ6 A;  1NSN S;  3CCL A;  1ZEQ X;  1F2Y A;  2A69 C;  2QGQ A;  3E5S A;  1CQV A;  3GTP H;  5J39 A;  1WTP A;  2E74 C;  5HUR A;  2JA5 B;  1EY6 A;  3Q0A A;  1WFQ A;  5C0X H;  2JA6 G;  5C0X I;  2XGT A;  2TSS A;  5CBE E;  1V1P A;  5IY0 A;  4A93 H;  3CF5 A;  2K05 A;  1JQY D;  3TQY A;  2K01 A;  3ERQ A;  3NXW A;  5CV9 A;  4PMC A;  1RDP D;  3M7N A;  3AQQ A;  4DAY B;  1X9N A;  2I5M X;  2PZW A;  3LWE A;  4JK1 C;  3G71 A;  1Y8P B;  5CMD A;  1BBU A;  5CC4 A;  1GUW A;  2HQL A;  4FF3 A;  4ME5 A;  4RKB A;  3F2D A;  3S1R B;  4R8N A;  2F0Q A;  1HNX L;  1NJI C;  1CK1 A;  3HS0 C;  4YCV A;  3PIP 3;  3I4N G;  4PG3 A;  5BN3 A;  1PYS B;  3I91 A;  1CZG A;  1N34 L;  1PTO H;  2ZM6 Q;  2E5L L;  5FO8 B;  3ONA B;  2HQE A;  1IL2 A;  4XQQ A;  3OSO A;  2IX1 A;  1VQA A;  4UY8 C;  1VQM A;  3TRE A;  4YHH L;  1EZ6 A;  1L0X B;  1HNZ Q;  2L55 A;  1WTQ A;  4K6D A;  1U4R A;  2CKZ B;  4K5V A;  1KNA A;  3RMH A;  4RG1 A;  4JI7 L;  4ZK9 B;  3M4Q A;  1SYC A;  3FPU B;  3K0Y A;  4NDX A;  3AFP A;  1BVS A;  1TWH H;  3KLS X;  1S4Z A;  3G48 A;  2EJF C;  1RCV D;  1WTO A;  1S5E D;  3PO3 B;  4X62 Q;  4CKB A;  1OXS C;  5GAD C;  1TS3 A;  3PUZ A;  4YWK A;  3P1H A;  3CCM A;  1G8Z D;  4OWX B;  1EWH A;  1LV9 A;  3A5Z B;  2PMZ E;  4KKU A;  2DUD A;  1YHB A;  3UE0 A;  2NVQ B;  2MUY A;  2NYZ D;  4CHT B;  1IKL A;  1D1I A;  4HMJ A;  2XNA C;  2RDF A;  3CRL C;  1DD2 A;  1QB5 D;  2HDM A;  1I3Q B;  2KUM A;  3CAM A;  1E1T A;  3DMU A;  2Q8R E;  2FHT A;  4CGY B;  4RMF A;  4IOC A;  2J4X A;  4A3B B;  5EJW A;  2MO0 A;  2B63 H;  4DV3 Q;  2OTJ A;  5E3F A;  4B9W A;  1E24 A;  4DNT B;  3S14 H;  1LM0 A;  2AUJ D;  4C3I B;  4BWG B;  4A3D G;  2ICE C;  2WB1 B;  3VR5 A;  4UP7 A;  1IBL Q;  1CKM A;  4A3L G;  3GDE A;  4WRD A;  2G5D A;  1EIG A;  1YBY A;  1STE A;  3OW7 A;  1ZYR C;  1LTS D;  4QUF A;  1ILQ A;  2C9O A;  2JE6 I;  4OX9 Q;  4LF9 Q;  2VUM H;  3RZD B; 
#chains in the Genus database with same CATH homology
 1SMY D;  3MVV A;  3M4Y A;  1SDF A;  2Z8L A;  3T4A C;  4UAI A;  1JWM D;  1OXT A;  3H94 A;  3R2T A;  3GP7 A;  5FLX L;  1WTX A;  2RDH A;  4BBR B;  2E2H B;  2BOS A;  2KA7 A;  4C3J G;  3A55 A;  2KVM A;  2JYO A;  3ZYY X;  4XT1 B;  5G3L F;  4F87 A;  5NUC A;  1HFG A;  3M3Y B;  1SSO A;  4CKC A;  3R8B A;  3D6C A;  3U9S A;  4V19 0;  1J9O A;  5C0X G;  2BCO A;  1F9Q A;  1JIC A;  1V43 A;  5C44 B;  3MHB A;  2R93 B;  4DXF A;  4ZUI A;  2AWN A;  1R9T B;  2EYP A;  2B2W C;  1LAC A;  1FR3 A;  1WTR A;  4HCS A;  1I4H A;  1XTC D;  2L0C A;  2Z1C A;  3DHQ A;  2HCI A;  4IUT A;  3GTG B;  1A3U A;  1MD2 D;  3TN2 A;  4KKT A;  1S5B D;  1MI2 A;  1HUM A;  2PNR C;  1HFN A;  1VF7 A;  2B2T A;  5M9O A;  4K2K A;  5M5W B;  4LK1 C;  5JVH 3;  2F3W A;  2RSO A;  1B50 A;  3A8K E;  1BCP F;  5BN4 A;  1FNW A;  3IFT A;  3K58 A;  2XWB B;  2I46 A;  3N6R A;  1UNS A;  1PZJ D;  2F3V A;  3OIQ A;  4X3U A;  2AQ3 B;  2F0W A;  2WIN B;  1GUS A;  2BA0 A;  4V0B A;  2XRQ D;  4NMZ A;  3HGB A;  2O2L D;  3I8Z A;  2F0N A;  1VF5 C;  2KCN A;  1TY2 A;  1D2B A;  3L7Z C;  1ET6 A;  3K57 A;  1SYF A;  1EY5 A;  3ITP A;  3K5M A;  1B44 D;  1FNU A;  2PZT A;  3HEJ A;  4IAL A;  3JAM L;  1DOK A;  4HSV A;  1RF2 D;  3C2P A;  1TWG B;  4HCE A;  2XVS A;  1E2W A;  3M7G A;  1D5X C;  1B9N A;  3S1M B;  1PRT B;  2EVB A;  4J1M A;  3I70 A;  3DM1 A;  3D4R A;  4RAU C;  2NVX B;  1EY4 A;  3S1N B;  2E75 C;  3MAQ A;  2Y0S B;  4XT3 B;  1U4M A;  4NKL A;  1U4L A;  3TZD A;  2L1B A;  3K5O A;  2F0P A;  1MSG A;  3NE5 B;  4HAE A;  2ZXP A;  1KDA A;  4IFD G;  1IYU A;  1WCM B;  5EQ0 A;  1SMY C;  4IUR A;  4L63 B;  2IWH A;  2CW0 D;  2PW5 A;  1C4Q A;  4BA1 I;  3K6O A;  4G7H C;  5CBA E;  3Q24 A;  1LTG D;  1DON A;  4KY5 A;  3K59 A;  4I7Z C;  5I6W A;  3HOV B;  2X6L A;  3OWE B;  4RCO A;  2F0K A;  2EE1 A;  3MWY W;  2B2V C;  3T53 B;  1SYB A;  3FKI B;  5LHY 1;  5KEE A;  2L5T A;  4Z9C B;  1UAP A;  2NN6 H;  1RHP A;  4C2M B;  1HQR D;  3WDN A;  3S2D B;  2NBF A;  4M1U B;  1EEF D;  4XQN A;  4G7Z C;  2N88 A;  3HKZ B;  1K83 B;  3J81 E;  3AB9 A;  1CM9 A;  5FLX E;  4X3K A;  2K32 A;  3KF8 A;  3D4W A;  2XSC A;  2R61 A;  1LLR D;  1GHK A;  2F0G A;  2WAQ B;  1EY0 A;  3DWQ A;  1EL0 A;  1I50 B;  1CFM A;  5KND A;  4A3G B;  5C4X B;  2OF1 A;  3GTM B;  5C4H A;  4K8I A;  2QKI C;  2RDG A;  3MEH A;  1W6J A;  1HA6 A;  3BYY B;  2JEA I;  2E2D C;  4FXK C;  5IGG A;  3HG9 A;  2G9D A;  1Y1W B;  4F7X A;  2B2Y C;  5C3E B;  2SEB D;  3GTQ B;  2KEC A;  1LTI D;  1ML0 D;  1SNM A;  2MHV A;  3AU7 A;  4I65 A;  3KK7 A;  4A3K B;  4C3H B;  4ZLT F;  1FGB D;  3M85 A;  3CU7 A;  4Y7N B;  4IUP A;  4RWS C;  2XRS D;  3KBX A;  1NR2 A;  3C3L A;  4HED A;  1I4Q A;  1EY7 A;  3A56 A;  3QWN A;  1WTV A;  1HA5 A;  3R93 A;  2R3Z A;  4KTA A;  5FK9 C;  4DAY A;  4WOR A;  1D1K A;  2JA7 B;  1TWF B;  1TQO A;  5I9P A;  1TKW B;  2J7Z A;  1BR9 A;  1PTO D;  3PMF A;  2BE5 D;  2M9V A;  2KED A;  1Q1E A;  2EY6 A;  5JEA J;  2EYF A;  4QCL A;  1BXT A;  3TP7 A;  3LWU A;  1HHV A;  5A2Q E;  2DN8 A;  2NUC A;  3GD7 A;  2WKC A;  3QG1 A;  4K8J A;  1HTL D;  2QF7 A;  3JAM E;  1JE4 A;  1PMR A;  3IL8 A;  5I6Y A;  4C56 C;  1ICW A;  1Y69 U;  1QCB D;  1DM0 B;  1QG7 A;  4N9T A;  2L11 A;  2J0T D;  2CW0 C;  2QDB A;  3NWS A;  3EVQ A;  3T13 A;  1T5E A;  4OO1 I;  1PFB A;  2NN6 G;  1NCV A;  5DAU A;  2IX0 A;  3OMC A;  4IN3 A;  1TWA B;  3NTI A;  4DK1 A;  2IX3 A;  1A15 A;  1BQQ T;  4RHS A;  3SVM A;  5T1I A;  2EY1 A;  4JBW A;  3A7A B;  3RLF A;  5CV5 A;  5JPN C;  2PQE A;  2X6G A;  1DXM A;  5T1G A;  3VR4 A;  1SNQ A;  5DM7 3;  2K5D A;  2EPB A;  3KUP A;  1FYC A;  2A5H A;  3VR3 A;  1OXX K;  4ULL A;  4ABN A;  2B39 A;  2I07 B;  1X3Q A;  3OIP A;  2NTT A;  3GV3 A;  4RGO S;  3D4D A;  3GV6 A;  1H9S B;  3PV0 A;  2BDO A;  1BCP B;  2F0F A;  1DOL A;  1II3 A;  5M5Y B;  2B2U C;  4XIG S;  5J22 A;  3EQL C;  1A2T A;  1DOM A;  3SK6 A;  3BG3 A;  3D6W A;  1Y8N B;  2K28 A;  1TR5 A;  3MZ5 A;  3VYR A;  2EJG C;  4KMU C;  1F77 A;  3HOU B;  3SE0 A;  1MSH A;  4ILW A;  4QB4 A;  1SBB B;  4DXG A;  1BF4 A;  3TME A;  3U9O A;  4AYB B;  1EZ8 A;  4HN7 A;  4KN4 C;  2EYH A;  3S17 B;  3NTK A;  2EZV A;  3I4M B;  1UEA B;  4PMB A;  4KKS A;  1SNC A;  3HOZ B;  2V4D A;  3NWT A;  4HTH A;  5IIF A;  3SHL A;  1IYV A;  3Q6S A;  4M8A A;  4KV6 A;  5J1Z A;  1EFI D;  4ZKC B;  3NP8 A;  1JR0 D;  3CRK C;  3BVZ A;  2HDL A;  4J6H A;  2L12 A;  2IJ0 A;  2FJ2 A;  2KOL A;  4H7B A;  5E4X A;  1SEB D;  2EYM A;  2PZU A;  4BA2 I;  1WTW A;  2X69 A;  2BDN A;  3MC0 B;  3PUW A;  3X3N A;  1HUN A;  1F2M A;  3FDT A;  4OIJ A;  4RH6 A;  1PTO C;  2BE5 C;  3R2I A;  4EGV A;  1KLG D;  1QIL A;  1A6X A;  5CV7 A;  2JA8 B;  5EPL A;  2WKD A;  1TU2 B;  1YNJ D;  2HCC A;  4C3I G;  2MGS A;  1Q1B A;  4RKL A;  5D3D A;  1LT4 D;  2DY8 A;  4XTC S;  1VCI A;  3C46 A;  3RUZ A;  4YIJ A;  1VMP A;  3QJY A;  3TSS A;  1STH A;  1HPC A;  2WAC A;  3J81 L;  1EYC A;  3RZO B;  1AP0 A;  4KJO A;  5JPM C;  4QUC A;  1CQF A;  3DWP A;  1U4P A;  1M8A A;  4IQZ A;  1XWE A;  5ELB A;  4BY1 B;  3NPP A;  2JXM B;  3KLR A;  4F88 A;  1JCK B;  2ZXR A;  4LAA A;  4TQU S;  1A3T A;  1KAB A;  5EKL A;  4K6L A;  2PO4 A;  5KIX A;  1O7L A;  2VB3 X;  2JSO A;  4A3E B;  3DEO A;  4FF2 A;  3BVG A;  3A8I E;  2AUK A;  3NQI A;  4PMW A;  3NBH A;  4ODG A;  2YYZ A;  2SNS A;  1OXV A;  1LTB D;  3SR1 A;  1PXU A;  2RVL A;  1ENC A;  3NHH A;  2CHB D;  2CVR A;  1STN A;  2SNM A;  5BN5 A;  3S15 B;  2QCP X;  2PCF B;  1I4G A;  1CT1 D;  2M00 A;  1A3V A;  1HRJ A;  4FVM A;  4PQX A;  1PFN A;  2KCC A;  1GXD C;  5G3L D;  4OHJ A;  1EIH A;  2M2L A;  2Q8T A;  1TS5 A;  5CV6 A;  3MXP A;  4K2L A;  3I72 A;  1C8C A;  2AQ2 B;  2HUG A;  4X3T A;  3DXJ C;  2D5D A;  5IOD A;  1NUC A;  1CHQ D;  1SJE D;  4NW2 A;  3A8J E;  5CYU A;  2K7V A;  4RFB A;  1Z7T A;  3PUY A;  5A2Q L;  4K5X A;  4DF7 A;  1ONL A;  2E2J B;  1IKM A;  2F0E A;  3A54 A;  5ELC A;  3W2D A;  2PW7 A;  1JWS D;  4DN4 M;  3J80 L;  3Q23 A;  2FFK B;  1JC7 A;  4Q0F A;  4IUQ A;  3VYT A;  4KHZ A;  3OMG A;  1PDQ A;  2EY2 A;  2DNE A;  2EJM A;  5LL6 S;  3BZD B;  4BBS B;  2EOT A;  3H09 A;  3NK9 A;  1Z6H A;  3IFD A;  1BO0 A;  1YNJ C;  1QOH A;  3IKJ A;  2FMC A;  4OL7 A;  4BY7 B;  5IT9 L;  2R7Z B;  2MP1 A;  4RGN A;  4ZUJ A;  2E2I B;  5C3X A;  3S1Q B;  2B2V A;  1G2T A;  3TP5 A;  2H1E A;  4ZAI A;  1GOZ A;  3S2H B;  1EU3 A;  2D9U A;  5EKK A;  5JAV A;  1TS4 A;  2K6A A;  3W3A A;  2VB2 X;  2WII B;  1S5D D;  4H0L C;  1STG A;  5I2Y A;  1I4P A;  3A7L A;  5CR3 A;  1AZQ A;  4EQP A;  3T51 B;  3FEW X;  5D65 A;  1U9R A;  5LL6 X;  2K03 A;  2FMM A;  4H13 C;  1JB3 A;  4G4K A;  4B08 A;  4FXD A;  5TSS A;  1PZI D;  5I9O A;  5JOB A;  1NR4 A;  2ICI A;  2CQA A;  3J7A V;  1NAP A;  3SXH A;  5C4J B;  1O78 A;  2O4X A;  4KY6 A;  3GTL B;  2A6E D;  1G29 1;  1STY A;  1AFP A;  2DNC A;  4G57 A;  2RSN A;  5DEH A;  1TII D;  2WP8 J;  3PUV A;  1S5C D;  1GJX A;  5EPJ A;  4XXE A;  5HGT A;  1D5M C;  1CA5 A;  1F9P A;  3GQB A;  1TY0 A;  4K14 A;  1PTO F;  4DGZ A;  3G6J B;  1I4R A;  1QE6 A;  4RHR A;  3NTH A;  3CQZ B;  5CGK A;  4IZ8 A;  1SND A;  2SDF A;  1B53 A;  2PMZ B;  1STA A;  4MHE A;  4P2C B;  2QIL A;  2EYO A;  4J8Q A;  1LTT D;  4K5W A;  4U68 A;  3P75 A;  2EYL A;  2PYK A;  4EQN A;  3MTS A;  4KJN A;  4ZKB B;  2JEB I;  1SYG A;  4B9X A;  3VR2 A;  1H9S A;  4CJ1 B;  4CJ0 B;  3GTJ B;  5IGC A;  5K36 H;  1ROD A;  4O42 A;  1L0Y B;  4C3H G;  4A3F B;  1JOQ A;  1B9M A;  5D3I B;  3HOX B;  2F1M A;  3AMU A;  3PO2 B;  2YU9 B;  4DK0 A;  2G9H D;  5D14 A;  3VYS A;  1OO9 B;  3WOE A;  3BDL A;  3GTK B;  4L6T B;  5IGB A;  2A6H D;  3C1F A;  5F2D A;  5IOC A;  3J80 E;  3E0J A;  2RKS A;  1EQT A;  3H0G B;  1ET9 A;  3QOL A;  4A3I B;  3EJI A;  4O1N A;  1EOT A;  2ID0 A;  4OO1 H;  2RBM A;  1IL8 A;  2R6G A;  3ND9 A;  4ZQ3 A;  5FKA C;  3TDQ A;  3VYU A;  2N55 A;  4A3M B;  3H6M A;  2F4I A;  5K5P A;  5COY A;  2DY7 A;  2AWO A;  5JVG 3;  1GUG A;  3E6Z X;  2XIW A;  3G7L A;  3HOY B;  3S9W A;  1TWC B;  5KGU A;  3C1E A;  1QNU A;  4IUN A;  1H9J A;  4XQJ A;  5IT9 E;  1V1O A;  1T5X D;  4GZY C;  3VA5 A;  5KYL A;  1XXG A;  3TBI B;  1PYW D;  1ZKO A;  2EY5 A;  5C5M A;  1B3A A;  1SNP A;  5KNB A;  2JA6 B;  1G2S A;  5FO7 B;  1UUP A;  5C4Z A;  2KQ3 A;  2GA4 B;  3BS1 A;  2H4O A;  1I6H B;  2LKV A;  4KN7 C;  4QMG A;  4C1N I;  1O7Z A;  1G91 A;  1AEX A;  1PRT D;  1ESR A;  1LO5 D;  1WVL A;  5JEA H;  5KNC A;  2A6E C;  5I2X A;  1LAB A;  4PNY A;  3I4N B;  3NUC A;  5FO9 B;  1SNO A;  1F2L A;  4DA2 A;  1F9R A;  5C3W A;  3P20 A;  3VA7 A;  5M5X B;  2AQ1 B;  5ELF A;  3SK4 A;  1IHZ A;  4KK7 A;  3V96 A;  1GUO A;  3QO2 A;  1FD7 D;  1IW7 D;  2F0L A;  4IFD J;  2O5J C;  2L4N A;  1GUN A;  4TRD A;  3N52 A;  1JWU D;  3TP6 A;  5K36 G;  1EY9 A;  1LT6 D;  2B8G A;  3T56 B;  5EBC A;  1A2U A;  1ENA A;  2IPK D;  4NP5 A;  4E6I A;  2KJX A;  3M4O B;  1I4X A;  4RGT A;  1EQV A;  1G6Z A;  1DJR D;  3BDO A;  4LMQ D;  1BNZ A;  3OOC A;  1H9M A;  1Q12 A;  5I4D A;  4A3D B;  1H9K A;  3NBI A;  2Z4H A;  1SYE A;  4DU9 A;  4G7O C;  5ISR A;  1BDO A;  3T16 A;  1B4O A;  1SE3 A;  1D5Z C;  3FRP B;  2RA4 A;  1YNN D;  3ERO A;  2KEE A;  1AN8 A;  1R4P B;  1JOK A;  4DAV A;  1I6V C;  1EU4 A;  2A6H C;  1V1P B;  1ENF A;  3X3M A;  4OO1 G;  1LT3 D;  2A68 D;  4DAP A;  1QWY A;  1X32 A;  1ZXT A;  5EBD A;  1DCZ A;  4TKO B;  4ZYS A;  3BYT B;  2Z4I A;  3Q22 A;  3V05 A;  1ILP A;  1AW7 A;  2C5C A;  1QJO A;  4C3J B;  3H91 A;  3KBG A;  3MFG A;  1EYA A;  1CI3 M;  4H44 C;  3GTP B;  1J8I A;  1HTP A;  3HP3 A;  5ELE A;  3FPP A;  3J7A F;  2EDG A;  4CBV A;  4IFD H;  4IFD I;  1RJT A;  4R8I A;  2B2W A;  4LJZ C;  3I90 A;  4OGQ C;  4ID6 A;  4A93 B;  4OIK A;  4RGM A;  3PUX A;  1RD9 D;  1ESF A;  1BUV T;  2F0M A;  1X3P A;  2XWJ B;  3OPO A;  5JEA G;  3I73 A;  1B1Z A;  3QB3 A;  4RCN A;  3HZX A;  4FNF A;  4FYD A;  1CHP D;  3FMC A;  1PTO B;  3MFY A;  3FVQ A;  4S3S A;  2F0O A;  3K5L A;  3GTO B;  2F0U A;  4IUU A;  3LX0 A;  3VR6 A;  5AFW A;  1KDB A;  1PRT C;  3V2T A;  1Y8O B;  4CJ2 C;  1WD0 A;  4PV1 C;  1D6E C;  1TWH B;  1Q90 A;  2IL8 A;  2B8F A;  4KD4 A;  1Q3L A;  1F2Z A;  4XYQ A;  4FO2 A;  2F0V A;  3H3V C;  4CKE A;  2B2T C;  1BBX C;  2F0S A;  4DNR B;  3NQT A;  4FF4 A;  4XDX A;  3J7Y W;  4WFN 3;  1RKN A;  1TVX A;  2NVT B;  1IW7 C;  2TMP A;  2XN9 C;  2F0T A;  4EQO A;  2B63 B;  3S14 B;  1FNV A;  1M4V A;  1PLF A;  3TP8 A;  1O80 A;  4HR7 B;  4QF4 A;  4QIW B;  4WJW A;  2VUM B;  2WV6 D;  1MBY A;  1BCP D;  3D31 A;  4FP5 D;  3I4L A;  2A74 C;  2JP1 A;  1WD1 A;  4N9P A;  2K1B A;  5FOB B;  1YNN C;  2F0H A;  2LY7 A;  5JJZ A;  1CTM A;  5M3F B;  5E4W C;  4L8J A;  5DM6 3;  1F9S A;  1AZP A;  1GHJ A;  2A68 C;  1GUT A;  2ZT9 C;  1KNE A;  3OWF A;  2F03 A;  4KI0 A;  2D62 A;  2VXW A;  3S16 B;  3DWA A;  2NVY B;  4FF1 A;  2EXZ A;  1HQM C;  3SEB A;  2F0D A;  3PIO 3;  5IGE A;  5EGT A;  1SE2 A;  1Q8I A;  5EKI A;  1SFO B;  3CHB D;  5KYI A;  1JOR A;  4U67 3;  3CKI B;  1CA6 A;  1VMC A;  2R92 B;  2K33 A;  2MPM A;  5EPK A;  3NSW A;  1Z47 A;  4KHV A;  4Q5V A;  1MGS A;  2F0J A;  2K5Q A;  1V8Q A;  2K5W A;  2NN6 I;  1Y1V B;  2FIN B;  4UDU C;  2A69 D;  1VDZ A;  1EWC A;  3IAY A;  4XYO A;  3HOW B;  3MXG A;  1K8M A;  1RTN A;  1PFM A;  4DFA A;  4R9W A;  3QIA A;  2OXP A;  2OT2 A;  3SK8 A;  3QOJ A;  3SDZ A;  3EFX D;  3K5N A;  5ELD A;  5C6A A;  1TS2 A;  1SAP A;  4HSP A;  2O5I C;  1HCZ A;  2B2Y A;  3HRZ C;  2LMC B;  2PPB C;  3ND8 A;  5M3M B;  4A3J B;  3MXN A;  4KD3 A;  3TZU A;  3DUZ A;  1LTR D;  2A73 B;  4HMI A;  2RQX A;  2IW3 A;  1EEI D;  1W6K A;  2F0I A;  3R3O A;  1O7Y A;  3WOF A;  1TT2 A;  2ENB A;  5CV8 A;  5KRU A;  1PZK D;  3O13 A;  3BVM A;  2K04 A;  1E2Z A;  1EY8 A;  1BOS A;  2NB0 A;  1SYD A;  2L9H A;  1OXU A;  4TSS A;  4KY7 A;  2MJ8 A;  1HXY D;  5IGF A;  5C5L A;  3D3R A;  3DEP A;  5C0X J;  2Q8I B;  4EVO A;  3SK5 A;  1E2V A;  3F2U A;  3L3O C;  2SOB A;  3MXU A;  1RTO A;  3RD4 A;  2D2C C;  2EYJ A;  1SE4 A;  1XYI A;  1BCP C;  1KTK A;  1DYQ A;  3EA6 A;  1E0B A;  1H9R A;  4BS9 A;  4MIU A;  1JOO A;  2QEJ C;  2NTS A;  5A35 A;  2ZXO A;  1SXT A;  1ZYR D;  3K7A B;  5CV4 A;  2VNU D;  4FXG C;  2KHS A;  3GO5 A;  3L9A X;  2IT1 A;  5DNF A;  4MN3 A;  3URY A;  3P7J A;  1C48 A;  4F8M A;  3BDC A;  1PRT F;  5E1F A;  1S5F D;  1SJH D;  1STB A;  5IGD A;  1R4Q B;  1DZ1 A;  1K8O A;  1B2T A;  4IUV A;  3UI2 A;  1XX8 A;  1KLU D;  2E76 C;  1EYD A;  2NWG A;  4ZRZ A;  3LNN A;  5COR A;  4C1N K;  3MA2 B;  3I3C A;  2LFN A;  2LS0 1;  1CZW A;  2NZ1 D;  1KDC A;  3KLS A;  1LTA D;  3D8G A;  3OHX C;  2BA1 A;  1QNK A;  4X3S A;  4RA8 A;  2B2U A;  1KAA A;  2OEO A;  1LT5 D;  1NSN S;  1ZEQ X;  1F2Y A;  2A69 C;  3E5S A;  1CQV A;  5J39 A;  1WTP A;  2E74 C;  5HUR A;  2JA5 B;  1EY6 A;  3Q0A A;  5C0X H;  5C0X I;  2TSS A;  5CBE E;  1V1P A;  2K05 A;  1JQY D;  2K01 A;  3ERQ A;  3NXW A;  5CV9 A;  4PMC A;  1RDP D;  3M7N A;  2PZW A;  4JK1 C;  3LWE A;  1Y8P B;  5CMD A;  5CC4 A;  1GUW A;  4FF3 A;  4ME5 A;  4RKB A;  3S1R B;  4R8N A;  2F0Q A;  1CK1 A;  3HS0 C;  3PIP 3;  5BN3 A;  3I91 A;  1CZG A;  1PTO H;  5FO8 B;  3ONA B;  2HQE A;  4XQQ A;  3OSO A;  2IX1 A;  1EZ6 A;  1L0X B;  2L55 A;  1WTQ A;  4K6D A;  1U4R A;  4K5V A;  1KNA A;  3RMH A;  4ZK9 B;  3K0Y A;  4NDX A;  1SYC A;  3FPU B;  3KLS X;  1S4Z A;  2EJF C;  1RCV D;  1WTO A;  1S5E D;  3PO3 B;  4CKB A;  1OXS C;  1TS3 A;  3PUZ A;  3P1H A;  1G8Z D;  1EWH A;  1LV9 A;  4KKU A;  2NVQ B;  2MUY A;  2NYZ D;  4CHT B;  1IKL A;  1D1I A;  4HMJ A;  2XNA C;  2RDF A;  3CRL C;  1DD2 A;  1QB5 D;  2HDM A;  1I3Q B;  2KUM A;  3DMU A;  2Q8R E;  2FHT A;  4CGY B;  2J4X A;  4A3B B;  5EJW A;  5E3F A;  4B9W A;  4DNT B;  2AUJ D;  4C3I B;  4BWG B;  2ICE C;  2WB1 B;  3VR5 A;  4WRD A;  1EIG A;  1STE A;  3OW7 A;  1ZYR C;  1LTS D;  4QUF A;  1ILQ A;  2C9O A;  2JE6 I;  3RZD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...