2K5WA

Solution nmr structure of putative lipoprotein from bacillus cereus ordered locus bc_2438. northeast structural genomics target bcr103a.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
111
structure length
111
Chain Sequence
MERASLNRIGKDVYYMQIKGEGTIEKVDGRNLRNYTLPAYDEDGVKKQITFRSTKKENDHKLNKYAFLRLYVDQDDNSKNEISSIEVKSYEEIQKADLPEKVKDKFTIKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical Cytosolic Protein BcR103A
publication title Solution NMR Structure of Putative Lipoprotein from Bacillus cereus Ordered Locus BC_2438. Northeast Structural Genomics Target BcR103A.
rcsb
source organism Bacillus cereus atcc 14579
total genus 15
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06486 DUF1093 Protein of unknown function (DUF1093)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.480 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k5wA00
2K5QA 3NPPA 2K5WA
chains in the Genus database with same CATH superfamily
1S40A 4EX5A 5M3MH 1UNSA 4X6AH 5EKLA 3ULJA 2UUBL 2YTYA 1I94L 1AZPA 1A0IA 3CC4A 2QILA 4KI0A 4A76A 1O78A 3TP8A 1XNRQ 1Q1BA 2HDMA 1H9RA 1BUVT 2Y0SB 4A3IB 4B08A 3D6CA 4DV4Q 1N9WA 1B7YB 5IGEA 1X9NA 1TR5A 2ZXRA 1VQIA 4LK1C 2JA8G 2C9OA 1X54A 3T16A 5A2QL 2O5JC 3M3YB 1OXVA 1VCIA 2NUCA 5JOBA 5C4HA 2VNUD 2XTIA 3HOUB 1QVGA 1CKNA 2JA5B 2Z8LA 4R4CA 3FKIB 2ZJRA 2B63B 1YNJC 1A6XA 3JC66 5ELBA 4DNRB 1N36Q 2PYKA 4L5QA 2R7ZB 1A63A 4X66Q 2KBNA 2I07B 1HRJA 2OQ0A 5E1FA 1UWVA 2K04A 4YWKA 3I8ZA 3E6ZX 4AYBB 2F0NA 4DAVA 1MIUA 2ASBA 2JA9A 3HOVG 4A3KB 1DOMA 1I4XA 2OTLA 5LMNL 4JBMA 4DV3Q 4BY7H 4Q5VA 2R92H 2UXCL 2Z1CA 3BDOA 2TSSA 2NYZD 5GROA 1IXRA 2UUAQ 4DN4M 4PZ6A 1EUJA 4A3DB 3A8KE 2MFIA 1U4RA 4K6LA 1A3TA 3I4NB 4IALA 1S5CD 4DNIA 2JA6G 3RLOA 2I5LX 4X64L 2ZM6Q 3DMUA 1D7QA 4DUZL 1ICFB 2Z0SA 4GNXC 2XGTA 3KUPA 5IWAQ 1JJGA 2BOSA 1D2BA 4QQBX 2RCNA 4KD4A 3S1MH 4J8QA 4JI3Q 4POGA 4R8IA 1Z9FA 3RNUA 5J1ZA 1PV4A 4K2LA 3BDCA 5FOBB 2O5IC 2FINB 1SE4A 2EJGC 1V9PA 2F1MA 5IT9E 4IZ8A 2F03A 1TWFB 3S1QH 4JI7Q 4H0LC 1I6HH 3S2HH 4PG3A 1ICWA 5FLMG 3AEVA 2HQEA 2CWPA 2NTSA 2K5VA 3G7LA 3DEOA 3TQYA 2ZTDA 4KY5A 5FKAC 3O13A 4DR1L 3J7ZC 1FNVA 1C8CA 4C3JB 2KHIA 3CRLC 1STYA 2N55A 4IURA 4NW2A 5ELDA 5FJ8G 1S5ED 1PRTB 3QIAA 3Q0AA 3CXCA 2IW3A 4TKOB 4RMFA 5D14A 1TU2B 1HR0W 2KEDA 2B3GA 3PO3G 3NBIA 2NN6H 1UE7A 1EOVA 1UEBA 1STNA 3MFGA 2XRQD 2UUBQ 1EFID 3RD4A 1HFNA 2E2IB 1UE5A 1I94Q 3W1BA 2ZJQA 3AQQA 1O80A 1K8OA 4TSSA 3H6MA 4GS3A 1EWCA 3MFYA 2AUJD 4XQJA 2B2YA 1Y1VG 4LW1A 2MQHA 3EA6A 4RFBA 5CMDA 1PRTD 1YHAA 1ZYRC 1EFWA 2BH2A 3BZKA 4ALPA 4P2CB 1NMGA 2OTJA 1OXTA 1QUQB 1CQVA 1SE3A 3EIVA 1PYSB 4JI8L 3HOZH 3K58A 1F9QA 1N8RC 1WCMH 2XN9C 1NMFA 1FVIA 1TIID 2EJMA 1B2TA 2JA7H 3BS1A 3HS0C 4FF1A 3STBD 3H3VC 3OHXC 2A5HA 3T4AC 2H5XA 2LKVA 3S9WA 5EBDA 2R93B 1C48A 1ENCA 2EYFA 1SNPA 2VB3X 3S24A 1SMYD 5C44B 2VQEQ 4GNXB 4G7ZC 2EY5A 2I5HA 1RF2D 2B8GA 3H0GH 4RHSA 1BVSA 1Y14B 1NTGA 3J81E 4N9TA 5LMNQ 2X69A 4NDXA 1GO3E 1F2ZA 3VR6A 3J80E 3SDZA 2WB1E 4HIKA 4FO2A 1QVCA 5C0XI 1JE5A 5C3XA 1D5ZC 1P16A 1O7IA 3R2IA 3ERQA 4ZCKA 1DM0B 4A3IH 1E2VA 2QKIC 2L12A 3KF8A 4IUNA 1B4OA 5C3EG 2EDGA 4IQZA 1Q8IA 4IOAA 3E9HA 1JQYD 3HRZC 3GTJB 1VQEA 3X3MA 2VUMB 1FNWA 3M3YH 4X64Q 3BYYB 4QB4A 4OWTB 2SDFA 2DY8A 1N33L 3MTSA 1SNMA 4K6DA 4GOPA 4ZKBB 1TWGB 4BY7G 4DK1A 2R92G 3MXUA 2B63H 3GTGH 4J6HA 2WP8J 1Q12A 3I70A 5M3FG 1K0RA 5CV9A 1PTOF 3T1HL 2HDLA 1KIXA 3T51B 1VF7A 5IODA 3J81i 5BN3A 1VQ7A 1BXTA 1Z47A 4CKEA 3J80i 2EY2A 4A3KH 5EJWA 5I9OA 3PF5A 5JJKA 1WTRA 2E2HH 3NTKA 1GUWA 1OXXK 3A0JA 3D31A 1EQQA 3S1NB 1K8GA 5G3LF 3K0YA 4A3EB 4PQXA 1SYEA 4DR1Q 2WAQB 4A3DH 4ZK9B 1KNEA 2LXJA 1E1TA 4G4KA 2WINB 4YWMA 2A6ED 4RCOA 3W3AA 1K83B 3DWAA 4KY6A 2AWOA 3PUYA 4AYBE 1Z6HA 3LGJA 4JI6L 3SVMA 4CKBA 1PH3A 3JAME 4RKLA 4IFDG 1QWYA 1S5DD 2F4VL 2L9HA 3K57A 1M8AA 1MBYA 2L15A 4X3TA 2CH4W 2EYJA 4UAIA 1NR4A 1K28A 3E0EA 3ULLA 1UAPA 1PMRA 4K5WA 1DD2A 1WTXA 1WD1A 4O1NA 3I2ZA 2UU9L 1LYLA 2BA1A 3NENA 1TWFH 3F2DA 3KYHC 1WTWA 1A62A 1PTOC 3NK9A 4JI8Q 1S4ZA 1CTMA 3M4QA 4TQUS 4DAMA 3NBHB 4HJ7A 3C3LA 2UXDL 4WJ4A 2XWJB 3A54A 3EBEA 4AIMA 2K4KA 2NN6G 2KHJA 4LFAL 4C2MB 3TRZA 1EQRA 2D9UA 4DV0L 2Q8TA 3J81j 1V1PA 4C3IH 4RGOS 2HCIA 4QUCA 4AQYL 3TZUA 2NB0A 4RGMA 4C3JH 4POFA 1NBWA 5CORA 2NVTB 3GV3A 1HUMA 4A3JG 3JAMi 2FJ2A 1OXUA 3CW2C 3T56B 3G4SA 3I90A 2VS1A 2MO0A 2L55A 3DM3A 1T5EA 1GUNA 4GN5A 2E8GA 3HOZG 3VR4A 3FMCA 3A55A 3PIPA 2E2IH 2WB1G 4XT3B 1KLGD 4KKTA 3MAQA 3CCEA 1NJIC 3RZOB 4LUOA 5ELEA 5FO8B 2JA7G 1MGSA 3K7AB 1PLFA 4K5VA 4IPGA 4A3CH 1BKBA 3GTMB 2GVAA 2FFKB 2IHFA 5AFWA 1LTID 4ZUJA 1C4QA 2D62A 1ESRA 1V1OA 3MWYW 1WD0A 2IPKD 1GKHA 5CV8A 5LMUL 3CQZH 4A3GH 4MZ9A 4JV5Q 4CDCC 3I55A 3J7YW 1Y8PB 2RHQB 3H0GG 2L11A 2JSOA 1FNUA 1U4MA 1CUKA 4WFN3 5GAEC 2F0WA 3U4VA 3T1HQ 1EEID 2DJFC 4V190 2NWGA 3QG1A 3ERSX 3ND8A 1HA5A 4J15A 2Y0SG 3RLFA 4A3IG 3N52A 3A8JE 1JOOA 3QB3A 2EIFA 1OXSC 3KOJA 2BH8A 4XTCS 3R2TA 1WTPA 1YHBA 4HJ9A 1VQ9A 3RUZA 4DV7Q 2BE5D 3FRPB 3HOUG 5LMNW 2N78A 3UE1A 2JE6I 4CBVA 3U50C 3GD7A 1JCKB 1EY6A 1SXTA 1AFPA 2HT1A 2JA5G 1YNXA 2B2VC 2EZVA 2B63G 5KYLA 3HOWB 3NWTA 2KHSA 1KAAA 1PTOB 2DNCA 2R7ZG 4IUQA 2CW0C 1A15A 1STGA 1E3PA 3VYTA 2EE1A 4A3MH 1VQLA 1K3RA 2BDNA 3VR2A 1QNUA 2F0FA 4AYBG 3SK6A 3BG3A 4JI6Q 2VUMH 1WFQA 4A3KG 1XMQQ 2F4VQ 4RWSC 1BCPF 3QR8A 2K5WA 4QY7A 4JI0L 3BJUA 1SNCA 1TWGH 3C1FA 5D3DA 3IFTA 4ZRZA 5FLXE 3H91A 1V1QA 2F0OA 1FL0A 2RVLA 2O4XA 4NB3A 1XX8A 5IYCG 1DYQA 1ASYA 3I3CA 4A3DG 4PZ7A 1X6OA 1TWAB 3TSSA 3KBGA 4OIJA 2UU9Q 1EY0A 3N6RA 5H1SE 2HIVA 3T1YL 1S3OA 3I4NG 3KJOA 2SNSA 3BZCA 2L4NA 1TS4A 4YHHL 2UXDQ 1L1OC 5AJ3L 1LTTD 1MJCA 1DJRD 4LFAQ 2ZJPA 3X3NA 3OSOA 3UE0A 3T53B 4AQYQ 1B3QA 2JEBI 1IL8A 1V43A 5CBEE 3VR5A 1YBYA 2VL6A 3CCMA 2V4DA 1K83H 2HQLA 4UY8C 2EYHA 2XVSA 1IL2A 3PUXA 3NP8A 4HEDA 4DR6Q 2ENBA 2F0UA 2Z6KA 3PIO3 2PMZB 1D1IA 3A5ZB 2NN6I 5GADC 4QCLA 4J1MA 3Q23A 1QNKA 3Q24A 2YU9H 1Q90A 4I7ZC 4C3IG 4JI2L 2Q2UA 2G9HD 4HIOA 3GTLB 2KCCA 4C3JG 5BN4A 1M4VA 1SYBA 5LMUQ 3L3OC 5FJ8H 2LFNA 3K5OA 1VQBA 5C3WA 3FHWA 2D2CC 1LT5D 5EKIA 4DV1L 1MI2A 4JCVE 4X65Q 1WTOA 3AMUA 3HGBA 2RKSA 4ODGA 2K03A 3A7AB 4K0KL 2NVTH 4Y7NB 3CCVA 1S5BD 2YV5A 5IGFA 1WOCA 2RHSB 2BA0A 3CP0A 5I6WA 1KLUD 2AQ2B 4BXXG 1D5MC 4HMIA 1STEA 2IJ0A 4RGTA 2QW7A 5C0XJ 1DXMA 2D0PA 2PCFB 2WV6D 4LF9L 1IBML 3KDFA 4DK3C 1Y1WB 1PZID 2N8NA 4K5XA 5J22A 2KECA 4HSVA 3GTMH 1B53A 4LJZC 2LMCB 4NP5A 1XPRA 1LM0A 4XXEA 2R93G 1L1OB 4LUZA 4RCNA 3KF6B 3TN2A 4XT1B 3HKZG 3E5SA 3GTOH 1YNNC 1H9SB 3F8TA 4P72A 5I4DA 4DV2Q 1EY7A 1NAPA 2J4XA 2OCEA 1I4PA 1E0BA 4JI0Q 4HTHA 4X62L 2NVYB 4B9WA 4CJ0B 3NPPA 4DUYL 1TWCB 3PQIA 3A74A 1VQHA 1K8MA 2RDGA 1STBA 1WYDA 2KOLA 5EGTA 2DN8A 2KJXA 1BNZA 4HR7B 3P20A 5C3EH 5A2QE 4CDDC 2EYOA 4A3MG 1PFNA 2B2WA 4P75A 3T1YQ 1QUQA 2NZOA 1IYJB 2VUMG 4B3RL 3M4OB 3S15B 5AJ3Q 3VA5A 1NCVA 1BCPB 3J7A5 4O0AA 4F8MA 1Q81C 5FO9B 5M3FH 1IHZA 5TSSA 2L0CA 3OWFA 2HHHQ 1PTOH 4OL7A 1O7LA 1RDPD 4HMJA 4YCWA 3STBC 2R7FA 2DGYA 2H1EA 4A93B 1R9TB 4HN7A 2KUMA 2EYLA 2Z4HA 3I72A 1BR9A 1SROA 1SMYC 1XXGA 2E2DC 3CCRA 4FF4A 5CGKA 3E0JA 3FDTA 1RTOA 2Q8IB 1I50H 1JICA 4LF6Q 3SK8A 1DOLA 2D5DA 1S5FD 2ID0A 1DCZA 2E74C 4A3EG 4JI2Q 1HNZQ 1SE8A 2Z9HA 1JMCA 1KD1C 2NZHA 2WAQG 3GTPB 4S3SA 4R8NA 3IKJA 5E7NA 1GVPA 1TWAH 5EKKA 2B29A 3SE0A 1X56A 4UP7A 3PIOA 1ASZA 4GKJQ 3NELA 1EU3A 2G9DA 2YTXA 4XQNA 4JYAQ 3PSIA 4R1JA 1F2MA 5J39A 1SYCA 5IGDA 1WTVA 3S17B 4UP9A 1V8QA 2WKDA 5GAGC 4DV1Q 4DV5L 4IFDH 1I5FA 2JK8A 2IHEA 1A2TA 2H4OA 3A7LA 4HIDA 2F3WA 2R6GA 5JJIA 4QIWB 3OW7A 4YWLA 3EQLC 1GM5A 4K0KQ 1VQMA 2A68D 1TS5A 3ZJYC 3F2CA 3NE5B 4ZAIA 2B39A 4DXFA 2EOTA 4G57A 4IO9A 4FXKC 4RAUC 2F0MA 3UDIA 2NVXH 1HCZA 2F0LA 3QOLA 2K28A 5EPLA 2ZTEA 1ZEQX 4XDXA 1ONLA 1IBMQ 4BBRB 1VQ8A 4BY1B 1KQSA 3VA7A 1HA6A 5M5WH 3ICEA 5I2XA 1B8AA 2EJFC 3FPPA 4MTNA 4GKKL 4A3JH 1HNXL 3F1ZA 4X3SA 1GUSA 4XYQA 3P75A 5CV6A 1B50A 3HOYB 3HOXB 1TWHB 2F0PA 4WJWA 1SE2A 1VQCA 1W2BA 1YNJD 5JVG3 4KN7C 2E2JH 1ESFA 3ZYYX 1GD7A 2A69C 4X62Q 4LF7L 1KC8C 1CKNB 4HCSA 2PMZE 3BVZA 4DUYQ 1HZCA 5DM73 3H09A 2B2TC 3SHLA 3F2BA 3PIP3 3BZDB 1VQ5A 3KLWA 4LF5L 1A3VA 1OO9B 2N49A 5EQ0A 5M5YH 2B2YC 1F2YA 3HZXA 3NBHA 3D8GA 4B3RQ 3NTHA 2F0VA 2RDFA 2Q2HA 1LTLA 2ATWA 2IL8A 2UXCQ 1VF5C 2DY7A 4IUPA 3M85A 1G91A 1D8LA 1CM9A 4JI4L 4IUUA 1SEBD 4KK7A 1NE3A 3AFPA 4G7OC 4N9PA 1E24A 4QMGA 3VYRA 2JA8B 4LWCA 3G71A 4HJ5A 2K14A 3CCLA 4KKSA 3CMAA 3L2PA 1PFBA 5A35A 1SNQA 3AYHB 3I4MB 5CYUA 3GQBA 5JEAH 3RLNA 3HOUH 4DUZQ 1K9MC 1AP0A 2HCCA 1LACA 1X3PA 3TP7A 4JOIA 1HJPA 1LUZA 3DXJC 3MC0B 2JA5H 3FKIH 1PH5A 1QZHA 3G48A 1MD2D 5J3BA 1L0YB 3VDYA 2R7ZH 3J7AF 1QG7A 1ML0D 4FNFA 2PNHA 4KHZA 4FXGC 2MO1A 3GO5A 4GN3B 2SOBA 3WWVA 1SFOB 1WTHA 5C4XB 1A2UA 1BO0A 2AWNA 4DV5Q 4B3ML 1TY0A 5F2DA 3M4OH 3S15H 3MXPA 4DAPA 5HGQA 2PO4A 1YHQA 2K05A 5IE8A 1A8VA 1LV9A 4ZQ3A 2MPMA 1RD9D 1HUNA 4KKUA 3I73A 4GOPC 3ITPA 5IYCH 2OQKA 4JK1C 4KTAA 3CCUA 4ZLTF 1HTPA 1HQRD 3RZDB 4FF3A 4L5RC 1YI2A 4TRDA 4OIKA 4KHVA 2XNAC 3I4NH 3DUZA 4EVOA 2LS01 3TREA 3CU7A 4ILWA 4ZKCB 2AKWB 3WOEA 1ZYRD 2I46A 1PH6A 3CPFA 1TXYA 2IT1A 3GTPH 5DEHA 2ICEC 4GKKQ 1QILA 3V05A 1HNXQ 1YJ9A 4LAAA 1PH8A 5IYBH 3EROA 3SEBA 5FLXc 1C9OA 4K14A 2B8FA 2MGSA 3K7UC 2YTVA 2B2UA 3MXNA 1JORA 2E5LL 1JWSD 1U9RA 2K7VA 1B9MA 1IKMA 4LF7Q 5EPKA 1ZKOA 4Q0FA 1ET6A 5IGBA 2UXBL 1L0XB 4E6IA 2GVBA 2CQOA 3FPUB 2CKZB 3S14B 1MKHA 1DONA 3GTQB 4DR7L 3PF4A 3LWEA 4LF5Q 4A3BB 1HH2P 1EIGA 4APVA 4OWWB 4O2DA 4P74A 5LHY1 1AE2A 4OX9L 4OXPA 5K36H 2C5CA 5LL6S 2RA4A 3OW2A 4M8AA 4FF2A 3CCJA 2WACA 3CCQA 2NBFA 2WFWA 4BY1H 2KA7A 1EY9A 1STHA 4LFBL 1IW7C 4GLVB 4QIWE 3U4ZA 4LF4L 1IBKL 4JI4Q 2KENA 2EQSA 1FYCA 1SYGA 3SR1A 2A6HC 3KF8B 1K73C 1B70B 1QB5D 2QA4A 1EYAA 3OIPA 1BDOA 1TWHH 3HOXH 3HOYH 1LT3D 1I4QA 4L8JA 2PW7A 4NKLA 2VQFL 4BXXH 4K2KA 5D65A 4A75A 5M3MB 1GUOA 4C1NK 4EQPA 4A3FB 1M90C 1SRUA 4GOPB 1N33Q 5KGUA 4KMUC 1IBLL 4B3SL 2IX3A 3I4LA 4F87A 3P1HA 1IYVA 4K8IA 1PFMA 1YIJA 2Q2IA 1EU4A 2KCNA 4OO1H 1F77A 2R93H 4FVMA 1QCBD 4KHPL 3TBIB 1RHPA 5E3FA 3GTKB 1RODA 1G2TA 5C44H 1WVLA 4N8FA 3KK7A 2GN5A 1ET9A 4B3MQ 1TY2A 1E2WA 2M2LA 1HPCA 3IL8A 1EY8A 1PH4A 3PUVA 1G6PA 2A74C 3MXGA 5JEAG 3TS0A 3IFDA 4IJLA 1XNQL 1LT4D 1B9NA 3S1RB 2R7DA 1N34L 4N8X1 3FKIG 2HD3A 4KJNA 2MHVA 4XIGS 3EJIA 5EPJA 4EQOA 1CFMA 5CV5A 1X3FA 1K8AC 4OEMB 1QE6A 4YY3L 5CV4A 3KLSA 3GTJH 1NNXA 2DNEA 2X6GA 3CC2A 4Y52H 4YCUA 2R92B 4ZUIA 4BWGB 3PO2B 1EEFD 2J7ZA 1F9SA 1CHQD 3DWPA 4YCVA 4IOCA 5FO7B 2JEAI 2A19A 4PMWA 1PTOD 3K59A 1CSPA 1L1OA 3AB9A 1E1OA 4MHEA 1WI5A 1Q86C 5C4XH 3OWEB 4A93G 3IRBA 3RR5A 1XTCD 4EQ5A 3BVMA 1EQTA 1LTGD 4IFDI 1EL0A 3QOJA 1SSOA 4L63B 1RCVD 3M9BA 3S1NH 1T5XD 1V1PB 4DV0Q 4DGZA 1N36L 3BU2A 3QO2A 5DLQE 4A3EH 3S1MB 3NEMA 5G3LD 1XYIA 3K6OA 2LXKA 4LFCL 4DA2A 2KVMA 2Z6BA 1TS3A 3RZDH 3M4YA 4HCEA 5IYBG 3H15A 3KBXA 2NZ1D 5CBAE 4PNYA 3S1QB 3ONAB 1UEAB 3C46A 5I9PA 1JWUD 2LSSA 1WTQA 4PMBA 3H3VH 3Q6SA 5HURA 4JI5L 4OWXB 3BVGA 1RTNA 1LTRD 2XIWA 3VR3A 4LFBQ 1W3SA 4DAYB 1PZKD 3OMCA 5C6AA 4QGUA 1IBKQ 1SAPA 3TP5A 3PMFA 5M9OA 1HQMC 1SJED 1VQPA 2UUCL 1VQ4A 3DWQA 3U58A 1E22A 3NSWA 1KRTA 3S16B 1VQGA 2BDOA 1H9JA 4CJ1B 1KDCA 1MJEA 2RSNA 2J0TD 1CT1D 1G8ZD 1BF4A 2F0JA 1RL2A 2VY3A 4I7AA 1EYGA 1MSHA 1U4PA 2QEJC 3MZ5A 5IIFA 3A8IE 1Q46A 5K36G 3NQIA 3SXHA 1IBLQ 2CHBD 4QJFA 2PQAB 4C2MH 5IT9c 1A3UA 2E76C 4BY1G 3S14H 4BBSB 1VQ6A 1HZ9A 1R4QB 2Z6KC 1KRSA 5T1IA 3V2TA 4IPDA 1GXDC 3GTQH 1KDAA 2M9VA 2G5DA 1CZGA 3K0XA 2K1BA 4GZYC 3L0OA 2L1BA 1FGUA 2OEOA 5HGTA 4H13C 3HOYG 3HOXG 1N32L 1SDFA 4A3LH 3HP3A 4IN3A 3KJPA 1S72A 3LWUA 3DM1A 1WCMB 3NQTA 4DR2L 3PGZA 4DKAC 2CW0D 2ES2A 4DR3L 1J5EL 4EQNA 3RZOH 1F9RA 3BDLA 3K7AH 1SYFA 1MSGA 4JPBW 1N34Q 5CC4A 5ELNA 1BBWA 4H02A 4OGQC 4P73A 2GA4B 1GHJA 4OO1G 1SNOA 3GV6A 4YY3Q 4KN4C 2F3IA 1LTBD 5C44G 4DR5L 3TZDA 2AUKA 3GDEA 1EWHA 4A3FH 5L37A 4IUVA 2Z4IA 4RHRA 4FYDA 2FHTA 2PI2E 1GHKA 4HSPA 4RGNA 5C5MA 1MHWC 1RIPA 3CAMA 4IJHA 1IKLA 2DUDA 1H9KA 1QJOA 1JOKA 5IYDH 3OIQA 3ULPA 3L7ZC 1BOSA 1JC7A 3GTKH 5M5XB 3TS2A 1GOZA 4L5TA 3T13A 2OWOA 5I6YA 2F0IA 4DF7A 4GN4B 3FVQA 3I4MG 1PRTC 4YHHQ 1FD7D 5C0XG 4L5SA 1ILPA 1HNWL 3GTGB 1X3QA 3S1RH 2Q8RE 2WIIB 1EZ6A 1IZ6A 3M7NA 1SBBB 1Y8NB 3J81c 4LFCQ 3HOWH 1RKNA 1UE1A 4DNTB 4UP8A 1VQJA 2JQOA 2PQEA 3D6WA 2VQEL 4NXNL 3J80c 1QZGA 2NTTA 4GNXA 3I7FA 2K5DA 3HEJA 2E2HB 5C4XG 1E7ZA 1UUPA 2F0SA 4JI5Q 2KQ3A 1I4HA 4BA1I 4U68A 3PO2H 2B2WC 3F2UA 1BCPD 3MEFA 1PXUA 3DLLA 3URYA 1CQFA 3EFXD 4UDUC 1U4LA 2AQ3B 2PPBC 2UUCQ 2MJ8A 5KIXA 1U5KA 4LNQA 2SNMA 3I4OA 4OONA 5FK9C 4WRDA 1I3QB 5C4JB 2YYZA 1XPOA 1J8IA 1ENAA 1KHIA 5IT9L 4M1UB 3KLSX 3PV0A 1II3A 3TMEA 3KFUA 4DR4L 3M4PA 2PZUA 4O42A 3J7AV 1AZQA 4MIUA 4ME3A 1VS0A 2RDHA 2F0TA 1TS2A 1LTSD 1R4PB 4X3KA 5IP7G 1NSNS 1CHPD 4FXDA 1G51A 5LL6X 2ZXOA 5JPNC 3W2DA 3D4WA 1N32Q 3MEHA 3CRKC 1X32A 3KLRA 1RJTA 1SN8A 4DR2Q 1LT6D 1STAA 4LF9Q 3KDFB 4DR3Q 2F52A 1E2ZA 2K5NA 4C3IB 1J5EQ 2K5QA 2FMCA 4ABNA 4ULLA 2AQ1B 1H95A 3JAMc 1YNND 3PUWA 2KEEA 3S16H 1X3GA 3GTLH 3K81C 2L5TA 3D4RA 1AH9A 1KNAA 2CVRA 3P7JA 1GJXA 2E75C 2CH4A 4A3BG 2P5ZX 4DR5Q 1TQOA 4WORA 3EVQA 2K75A 1X3EA 5IP9H 2B2TA 2FMMA 4A3LG 3U9SA 2QCPX 2A6EC 3OMGA 4DFAA 1JWMD 4BBSH 3E9IA 2CQAA 1DOKA 2F0EA 4RH6A 2F0HA 2F0DA 1JT8A 2K32A 4LUVA 4Y7NH 2PZTA 1VQKA 4C3HB 5KNBA 1K3BC 2EYPA 4ID6A 3CQZB 4OO1I 4A3GB 1O7YA 3Q22A 1SNDA 2PW5A 5IGGA 5E4WC 2PNRC 4NPSA 3DEPA 3U9OA 2JYOA 3D0FA 5M3MG 4B3TL 3C1EA 4A3FG 1XMOL 1HNWQ 5CR3A 3HFZB 2VZAA 3J81L 1Y1WH 2RSOA 1EWIA 3GP7A 1SJHD 5C5LA 3R8BA 3PCOB 4JI1L 3J80L 1XWEA 3AU7A 3CMEA 3B6YA 1QOHA 5IYDG 5I2YA 4NXNQ 3HKZB 1EIHA 2LY7A 1I4GA 1EYDA 4CGYB 4JBJA 2N88A 2N3SA 2PI2A 1PHJA 1YEZA 1FGBD 2X6LA 4K8JA 2NVYH 2EXZA 2ZT9C 5IGCA 4JG2A 1OTCA 1TWCH 2DJGC 2K5HA 4P71A 2QGQA 1PZJD 1B44D 4QUFA 2K33A 5ISRA 4JBKA 4DPGA 4R4QA 1O7ZA 2HUGA 3NWSA 3HOWG 5JPMC 5M5XH 4A3MB 3S2DB 1EYCA 1VQDA 2QDBA 2NVQB 2PZWA 4JV5L 5KNCA 3HOVB 3CD6A 5IY0A 2IX1A 4HJ8A 4IFDJ 1I6VC 1Q3LA 2ZTCA 4R4OA 2CFMA 4G7HC 1PH9A 4LF8L 4DR4Q 3LX0A 4QF4A 3PO2G 1CKOA 4PV1C 2OF1A 3K80C 4IUTA 1NUCA 2SEBD 4KLKA 4H7BA 5E4XA 1EOTA 4F7XA 1PYWD 5ELOA 2ICIA 2Y0SE 1D1KA 3DHQA 4JOIC 1Q7YC 1TVXA 3R93A 1IYUA 1TKWB 5KEEA 2HIXA 3MA2B 2IWHA 2JA6B 1R9TH 4DV7L 4A93H 1YVCA 2RCFA 1CA6A 4L6TB 3ND9A 1B1ZA 1KL9A 3H3VI 2JXMB 1UE6A 1KXLA 3SK5A 3JAML 1J9OA 3NTIA 2TMPA 1VQFA 1HZAA 2BE5C 2MUYA 3LNNA 4I65A 3I56A 2XSCA 5K5PA 1DZ1A 1G291 4DV6L 3A5UA 1P8LA 4OHJA 1PA6A 2Q2TA 2CWAA 3CF5A 2A69D 1EIYB 1I3QH 4RG1A 5C4JH 2KCMA 4CJ2C 4C56C 2R61A 4QL5A 4V0BA 4OELB 1D6EC 1PDQA 1YZ6A 2BCOA 3WDNA 1XMQL 4NXML 3S17H 4C1NI 1GUTA 3Q8DA 1F9PA 2K6AA 5T1GA 3W5OA 5KYIA 1H9MA 4UHVA 1JR0D 1CI3M 2YU9B 2A73B 1Y69U 4RKBA 1JB7A 1DGSA 2RF4A 5BR8L 2A1AA 1BQQT 5JAVA 1I4RA 3I91A 3AFQA 3MHBA 3SK4A 4CDFC 2RQXA 1JB3A 2F4IA 3QJYA 4GLAC 5COYA 4HAEA 2EY6A 1Y8OB 3OTOL 3OPOA 3PO3B 1EIFA 5JVH3 4ZYSA 3R3OA 1PYBA 4B3TQ 1L2FA 1SLJA 5IP9G 1VQAA 1XMOQ 1X65A 2O2LD 3PUZA 1XTDA 2QEXA 1NR2A 4BBRH 2B2UC 2F3VA 3FEWX 3CCSA 4BBSG 4JI1Q 1ENFA 1EQVA 2XWBB 4KV6A 1M1KC 1Y1VB 4UPAA 3SGIA 3FP9A 2I0QA 1CZWA 2IX0A 3UDFA 2D0OA 4MN3A 2VB2X 1HR0L 4LMQD 4DR6L 4U673 4JW0A 4A4IA 5JEAJ 3D3RA 1CA5A 1KABA 5ELCA 4F88A 1EZ8A 2JN4A 1WCMG 1HFGA 4KY7A 2VXWA 1HHVA 3CPWA 4Z9CB 2ALYB 4DAYA 3D4DA 2MNAA 5EAYA 2A8VA 1YJWA 5DM63 1Y1WG 3UI2A 4HJAA 4C3HH 1FJGL 3CKIB 1PH7A 3K5MA 2F0QA 4MNOA 2EPBA 2AMCB 1ZXTA 2JJQA 4KJOA 3RN5A 3GTOB 1LABA 5DNFA 5KNDA 1X55A 1VDZA 4NMZA 4R4IA 1HTLD 2B2VA 2FXQA 4X65L 3H94A 1VQOA 3RN2A 2PQAA 2V1CC 4LF8Q 1SR3A 1KDBA 4B9XA 1Q8KA 1K0SA 1CKMA 2EYMA 3L9AX 2ZXPA 1YJNA 1GUGA 3BYTB 4PZ8A 5D3IB 1PH1A 1NY4A 1J6QA 3ER0A 1EY4A 2QDLA 3E3XA 3MVVA 5C3EB 1KTKA 2KCTA 3EN2A 4CKCA 5HY6A 2CCZA 1XPUA 2JA8H 3VYUA 4JC0A 3G6EA 4FDBA 4X3UA 3OYYA 3I4MH 1PFSA 4BY7B 5C0XH 5CV7A 3NXWA 5GQOA 1KAWA 1WJJA 5M3FB 4BS9A 1PH2A 2IY5B 1XNRL 3NHHA 1CK1A 4DV6Q 4FP5D 1XJVA 5FLXL 4DV4L 3S2DH 1L0WA 1JE4A 2NVQH 3UDXA 3KF6A 3HOVH 3HKZE 1LLRD 1AW7A 4RA8A 1H9SA 2R3ZA 4DV2L 5DAUA 1SFOH 4NXMQ 3MXNB 5GAHC 2EXDA 1VMPA 4PMCA 4DU9A 2E5LQ 1SYDA 5NUCA 3CC7A 5IOCA 1BBXC 1HZBA 1I50B 3UDGA 2UXBQ 1AE3A 2QF7A 5JJZA 1FR3A 1QVFA 1G2SA 4MTKA 4CDEC 1Q82C 3IAYA 5BR8Q 4DR7Q 4X66L 2K50A 4BA2I 2C35B 4GLXA 1F2LA 4EGVA 4IPCA 4XQQA 3OTOQ 4TVAB 1LO5D 2JA6H 4R4TA 1VQNA 4WJ3M 5ELFA 4DK0A 1T9HA 1IW7D 3TDQA 4OX9Q 3V96A 2EVBA 1U0LA 1I6HB 2K52A 3A56A 4JBWA 3S2HB 4DV3L 2F0KA 2A6HD 4R9WA 1TT2A 2K01A 2VW9A 1PVOA 1ILQA 5JJLA 2OXPA 2RBMA 4AH6A 2UUAL 4LF4Q 2HHHL 5BN5A 5C4ZA 2JP1A 1B3AA 4YIJA 5IP7H 1JOQA 3K5LA 1HR0Q 1Q1EA 2NVXB 2MP1A 2WKCA 3CHBD 3M7GA 2VQFQ 5FLMH 3VYSA 2ZM6L 1AEXA 3TEHB 1VMCA 5IWAL 1SMXA 4LF6L 4H44C 1YITA 5M5WB 4B3SQ 2XRSD 1HNZL 5EBCA 4BBRG 1CSQA 3HKSA 4JI3L 2M00A 2WAQE 1JJ2A 3C2PA 1BCPC 4DXGA 4A3JB 1FJGQ 3G6JB 3NUCA 4GKJL 1PRTF 4IPHA 3TP6A 2OT2A 4JYAL 4KHPQ 3K5NA 4A3BH 2AHOB 1C0AA 3PO3H 1D5XC 2EY1A 2E2JB 3HOZB 4JI7L 3W1GA 3RMHA 2I5MX 1G6ZA 2WB1B 5KRUA 1BBUA 1W6JA 2JA7B 1JJCB 1AN8A 4ME5A 3OOCA 3QWNA 1HXYD 4JVZA 1XNQQ 4DK6C 1Y1VH 4A3CG 3WOFA 1W6KA 4XYOA 4KD3A 1C7YA 4C3HG 1Z7TA 1EY5A 1LTAD 2F0GA 4A3GG 4HIMA 3HG9A 5M5YB 4CHTB 2A68C 3H0GB 3K8AA
chains in the Genus database with same CATH topology
1UNSA 5EKLA 1AZPA 2QILA 4KI0A 1O78A 3TP8A 1Q1BA 2HDMA 1H9RA 1BUVT 2Y0SB 4A3IB 4B08A 3D6CA 5IGEA 1TR5A 2ZXRA 4LK1C 2C9OA 3T16A 5A2QL 2O5JC 3M3YB 1OXVA 1VCIA 2NUCA 5JOBA 5C4HA 2VNUD 3HOUB 2JA5B 2Z8LA 3FKIB 2B63B 1YNJC 1A6XA 5ELBA 4DNRB 2PYKA 2R7ZB 2I07B 1HRJA 5E1FA 2K04A 3I8ZA 3E6ZX 4AYBB 2F0NA 4DAVA 4A3KB 1DOMA 1I4XA 4Q5VA 2Z1CA 3BDOA 2TSSA 2NYZD 4DN4M 4A3DB 3A8KE 1U4RA 4K6LA 1A3TA 3I4NB 4IALA 1S5CD 3DMUA 3KUPA 2BOSA 1D2BA 4KD4A 4J8QA 4R8IA 5J1ZA 4K2LA 3BDCA 5FOBB 2O5IC 2FINB 1SE4A 2EJGC 2F1MA 5IT9E 4IZ8A 2F03A 1TWFB 4H0LC 1ICWA 2HQEA 2NTSA 3G7LA 3DEOA 4KY5A 5FKAC 3O13A 1FNVA 1C8CA 4C3JB 3CRLC 1STYA 2N55A 4IURA 4NW2A 5ELDA 1S5ED 1PRTB 3QIAA 3Q0AA 2IW3A 4TKOB 5D14A 1TU2B 2KEDA 3NBIA 2NN6H 3MFGA 1STNA 2XRQD 1EFID 3RD4A 1HFNA 2E2IB 1O80A 1K8OA 4TSSA 3H6MA 1EWCA 3MFYA 2AUJD 4XQJA 2B2YA 3EA6A 4RFBA 5CMDA 1PRTD 1ZYRC 4P2CB 1OXTA 1CQVA 1SE3A 3K58A 1F9QA 2XN9C 1B2TA 1TIID 2EJMA 3BS1A 3HS0C 4FF1A 3H3VC 3OHXC 2A5HA 3T4AC 2LKVA 3S9WA 5EBDA 2R93B 1C48A 1ENCA 2EYFA 1SNPA 2VB3X 5C44B 1SMYD 4G7ZC 2EY5A 1RF2D 2B8GA 4RHSA 3J81E 4N9TA 2X69A 4NDXA 1F2ZA 3VR6A 3J80E 3SDZA 4FO2A 5C0XI 5C3XA 1D5ZC 3R2IA 3ERQA 1DM0B 1E2VA 2QKIC 2L12A 3KF8A 4IUNA 1B4OA 2EDGA 4IQZA 1Q8IA 1JQYD 3HRZC 3GTJB 3X3MA 2VUMB 1FNWA 3BYYB 4QB4A 2SDFA 2DY8A 3MTSA 1SNMA 4K6DA 4ZKBB 1TWGB 4DK1A 3MXUA 4J6HA 2WP8J 1Q12A 3I70A 5CV9A 1PTOF 2HDLA 3T51B 1VF7A 5IODA 5BN3A 1BXTA 1Z47A 4CKEA 2EY2A 5EJWA 5I9OA 1WTRA 3NTKA 1GUWA 1OXXK 3D31A 3S1NB 5G3LF 3K0YA 4A3EB 4PQXA 1SYEA 2WAQB 4ZK9B 1KNEA 4G4KA 2WINB 2A6ED 4RCOA 3W3AA 1K83B 3DWAA 4KY6A 2AWOA 3PUYA 1Z6HA 3SVMA 4CKBA 3JAME 4RKLA 4IFDG 1QWYA 1S5DD 2L9HA 3K57A 1M8AA 1MBYA 4X3TA 2EYJA 4UAIA 1NR4A 1UAPA 1PMRA 4K5WA 1DD2A 1WTXA 1WD1A 4O1NA 2BA1A 1WTWA 1PTOC 3NK9A 1S4ZA 1CTMA 4TQUS 3C3LA 2XWJB 3A54A 2NN6G 4C2MB 2D9UA 2Q8TA 1V1PA 4RGOS 2HCIA 4QUCA 3TZUA 2NB0A 4RGMA 5CORA 2NVTB 3GV3A 1HUMA 2FJ2A 1OXUA 3T56B 3I90A 2L55A 1T5EA 1GUNA 3VR4A 3FMCA 3A55A 4XT3B 1KLGD 4KKTA 3MAQA 3RZOB 5ELEA 5FO8B 1MGSA 3K7AB 1PLFA 4K5VA 3GTMB 2FFKB 5AFWA 1LTID 4ZUJA 1C4QA 2D62A 1ESRA 1V1OA 3MWYW 1WD0A 2IPKD 5CV8A 3J7YW 1Y8PB 2L11A 2JSOA 1FNUA 1U4MA 4WFN3 2F0WA 1EEID 4V190 2NWGA 3QG1A 3ND8A 1HA5A 3RLFA 3N52A 3A8JE 1JOOA 3QB3A 1OXSC 4XTCS 3R2TA 1WTPA 3RUZA 2BE5D 3FRPB 2JE6I 4CBVA 3GD7A 1JCKB 1EY6A 1SXTA 1AFPA 2EZVA 2B2VC 5KYLA 3HOWB 3NWTA 2KHSA 1KAAA 1PTOB 2DNCA 4IUQA 2CW0C 1A15A 1STGA 3VYTA 2EE1A 2BDNA 3VR2A 1QNUA 2F0FA 3SK6A 3BG3A 4RWSC 1BCPF 2K5WA 1SNCA 3C1FA 5D3DA 3IFTA 4ZRZA 5FLXE 3H91A 2F0OA 2RVLA 2O4XA 1XX8A 1DYQA 3I3CA 1TWAB 3TSSA 3KBGA 4OIJA 1EY0A 3N6RA 2SNSA 2L4NA 1TS4A 1LTTD 1DJRD 3X3NA 3OSOA 3T53B 2JEBI 1IL8A 1V43A 5CBEE 3VR5A 2V4DA 2EYHA 2XVSA 3PUXA 3NP8A 4HEDA 2ENBA 2F0UA 3PIO3 2PMZB 1D1IA 2NN6I 4QCLA 4J1MA 3Q23A 1QNKA 3Q24A 1Q90A 4I7ZC 4C3IG 2G9HD 3GTLB 2KCCA 4C3JG 5BN4A 1M4VA 1SYBA 3L3OC 2LFNA 3K5OA 5C3WA 2D2CC 1LT5D 5EKIA 1MI2A 3AMUA 1WTOA 3HGBA 2RKSA 4ODGA 2K03A 3A7AB 4Y7NB 1S5BD 5IGFA 2BA0A 5I6WA 1KLUD 2AQ2B 1D5MC 4HMIA 1STEA 2IJ0A 4RGTA 5C0XJ 1DXMA 2PCFB 2WV6D 1Y1WB 1PZID 4K5XA 5J22A 2KECA 4HSVA 1B53A 4LJZC 2LMCB 4NP5A 4XXEA 4RCNA 3TN2A 4XT1B 3E5SA 1YNNC 1H9SB 5I4DA 1EY7A 1NAPA 2J4XA 1I4PA 1E0BA 4HTHA 2NVYB 4B9WA 4CJ0B 3NPPA 1TWCB 1K8MA 2RDGA 1STBA 2KOLA 5EGTA 2DN8A 2KJXA 1BNZA 4HR7B 3P20A 5A2QE 2EYOA 1PFNA 2B2WA 3M4OB 3S15B 3VA5A 1NCVA 1BCPB 4F8MA 5FO9B 1IHZA 5TSSA 2L0CA 3OWFA 1PTOH 4OL7A 1O7LA 1RDPD 4HMJA 2H1EA 4A93B 1R9TB 4HN7A 2KUMA 2EYLA 2Z4HA 3I72A 1BR9A 1SMYC 4FF4A 1XXGA 2E2DC 5CGKA 3E0JA 3FDTA 1RTOA 2Q8IB 1JICA 3SK8A 1DOLA 2D5DA 1S5FD 2ID0A 1DCZA 2E74C 3GTPB 4S3SA 4R8NA 3IKJA 5EKKA 3SE0A 1EU3A 2G9DA 4XQNA 1F2MA 5J39A 1SYCA 5IGDA 1WTVA 3S17B 1V8QA 2WKDA 4IFDH 1A2TA 2H4OA 3A7LA 2F3WA 2R6GA 4QIWB 3OW7A 3EQLC 2A68D 1TS5A 3NE5B 4ZAIA 2B39A 4DXFA 2EOTA 4G57A 4FXKC 4RAUC 2F0MA 1HCZA 2F0LA 3QOLA 2K28A 5EPLA 1ZEQX 4XDXA 1ONLA 4BBRB 4BY1B 3VA7A 1HA6A 5I2XA 2EJFC 3FPPA 4X3SA 1GUSA 4XYQA 3P75A 5CV6A 1B50A 3HOYB 3HOXB 1TWHB 2F0PA 4WJWA 1SE2A 1YNJD 5JVG3 4KN7C 1ESFA 3ZYYX 2A69C 4HCSA 3BVZA 5DM73 3H09A 2B2TC 3SHLA 3PIP3 3BZDB 1A3VA 1OO9B 5EQ0A 2B2YC 1F2YA 3HZXA 3NBHA 3D8GA 3NTHA 2F0VA 2RDFA 2IL8A 1VF5C 2DY7A 4IUPA 3M85A 1G91A 1CM9A 4IUUA 1SEBD 4KK7A 4G7OC 4N9PA 4QMGA 3VYRA 2JA8B 4KKSA 1PFBA 5A35A 1SNQA 3I4MB 5CYUA 3GQBA 5JEAH 1AP0A 2HCCA 1LACA 1X3PA 3TP7A 3DXJC 3MC0B 1MD2D 1L0YB 3J7AF 1QG7A 1ML0D 4FNFA 4KHZA 4FXGC 3GO5A 2SOBA 1SFOB 5C4XB 1A2UA 1BO0A 2AWNA 1TY0A 5F2DA 3MXPA 4DAPA 2PO4A 2K05A 1LV9A 4ZQ3A 2MPMA 1RD9D 1HUNA 4KKUA 3I73A 3ITPA 4JK1C 4KTAA 4ZLTF 1HTPA 1HQRD 3RZDB 4FF3A 4TRDA 4OIKA 4KHVA 2XNAC 3DUZA 4EVOA 2LS01 3CU7A 4ILWA 4ZKCB 3WOEA 1ZYRD 2I46A 2IT1A 5DEHA 2ICEC 1QILA 3V05A 4LAAA 3EROA 3SEBA 4K14A 2B8FA 2MGSA 2B2UA 3MXNA 1JORA 1JWSD 1U9RA 2K7VA 1B9MA 1IKMA 5EPKA 1ZKOA 4Q0FA 1ET6A 5IGBA 1L0XB 4E6IA 3FPUB 3S14B 1DONA 3GTQB 3LWEA 4A3BB 1EIGA 5LHY1 5K36H 2C5CA 5LL6S 2RA4A 4M8AA 4FF2A 2WACA 2NBFA 2KA7A 1EY9A 1STHA 1IW7C 1FYCA 1SYGA 3SR1A 2A6HC 1QB5D 1EYAA 3OIPA 1BDOA 1LT3D 1I4QA 4L8JA 2PW7A 4NKLA 4K2KA 5D65A 5M3MB 1GUOA 4C1NK 4EQPA 4A3FB 5KGUA 4KMUC 2IX3A 3I4LA 4F87A 3P1HA 1IYVA 4K8IA 1PFMA 1EU4A 2KCNA 4OO1H 1F77A 4FVMA 1QCBD 3TBIB 1RHPA 5E3FA 3GTKB 1RODA 1G2TA 1WVLA 3KK7A 1ET9A 1TY2A 1E2WA 2M2LA 1HPCA 3IL8A 1EY8A 3PUVA 2A74C 3MXGA 5JEAG 3IFDA 1LT4D 1B9NA 3S1RB 4KJNA 2MHVA 4XIGS 3EJIA 5EPJA 4EQOA 1CFMA 5CV5A 1QE6A 5CV4A 3KLSA 2DNEA 2X6GA 2R92B 4ZUIA 4BWGB 3PO2B 1EEFD 2J7ZA 1F9SA 1CHQD 3DWPA 5FO7B 2JEAI 4PMWA 1PTOD 3K59A 3AB9A 4MHEA 3OWEB 1XTCD 3BVMA 1EQTA 1LTGD 4IFDI 1EL0A 3QOJA 1SSOA 4L63B 1RCVD 1T5XD 1V1PB 4DGZA 3S1MB 3QO2A 5G3LD 1XYIA 3K6OA 4DA2A 2KVMA 1TS3A 3M4YA 4HCEA 3KBXA 2NZ1D 5CBAE 4PNYA 3S1QB 3ONAB 1UEAB 3C46A 5I9PA 1JWUD 1WTQA 4PMBA 3Q6SA 5HURA 3BVGA 1RTNA 1LTRD 2XIWA 3VR3A 1PZKD 3OMCA 5C6AA 1SAPA 3TP5A 3PMFA 5M9OA 1HQMC 1SJED 3DWQA 3S16B 3NSWA 2BDOA 1H9JA 4CJ1B 1KDCA 2RSNA 2J0TD 1CT1D 1G8ZD 1BF4A 2F0JA 1MSHA 1U4PA 2QEJC 3MZ5A 5IIFA 3A8IE 5K36G 3NQIA 3SXHA 2CHBD 1A3UA 2E76C 4BBSB 1R4QB 3V2TA 5T1IA 1GXDC 1KDAA 2M9VA 1CZGA 2K1BA 4GZYC 2L1BA 2OEOA 5HGTA 4H13C 1SDFA 3HP3A 4IN3A 3LWUA 3DM1A 1WCMB 3NQTA 2CW0D 4EQNA 1F9RA 3BDLA 1SYFA 1MSGA 5CC4A 4OGQC 2GA4B 1GHJA 4OO1G 1SNOA 3GV6A 4KN4C 1LTBD 3TZDA 2AUKA 1EWHA 4IUVA 2Z4IA 4RHRA 4FYDA 2FHTA 1GHKA 4HSPA 5C5MA 4RGNA 1IKLA 1H9KA 1QJOA 1JOKA 3OIQA 3L7ZC 1BOSA 1JC7A 5M5XB 1GOZA 3T13A 5I6YA 2F0IA 4DF7A 3FVQA 1PRTC 1FD7D 5C0XG 1ILPA 3GTGB 1X3QA 2Q8RE 2WIIB 1EZ6A 3M7NA 1SBBB 1Y8NB 1RKNA 4DNTB 2PQEA 3D6WA 2NTTA 2K5DA 3HEJA 2E2HB 1UUPA 2F0SA 2KQ3A 1I4HA 4BA1I 4U68A 2B2WC 3F2UA 1BCPD 1PXUA 3URYA 1CQFA 3EFXD 4UDUC 1U4LA 2AQ3B 2PPBC 2MJ8A 5KIXA 2SNMA 5FK9C 4WRDA 1I3QB 5C4JB 2YYZA 1J8IA 1ENAA 5IT9L 4M1UB 3KLSX 3PV0A 1II3A 3TMEA 2PZUA 4O42A 3J7AV 1AZQA 4MIUA 2RDHA 2F0TA 1TS2A 1LTSD 1R4PB 4X3KA 1NSNS 1CHPD 4FXDA 5LL6X 5JPNC 2ZXOA 3W2DA 3D4WA 3MEHA 3CRKC 1X32A 3KLRA 1RJTA 1LT6D 1STAA 3H0GB 1E2ZA 4C3IB 2K5QA 2FMCA 4ABNA 4ULLA 2AQ1B 1YNND 3PUWA 2KEEA 2L5TA 3D4RA 1KNAA 2CVRA 3P7JA 1GJXA 2E75C 1TQOA 4WORA 3EVQA 2B2TA 2FMMA 3U9SA 2QCPX 2A6EC 3OMGA 4DFAA 1JWMD 2CQAA 1DOKA 2F0EA 4RH6A 2F0HA 2F0DA 2K32A 2PZTA 4C3HB 5KNBA 2EYPA 4ID6A 3CQZB 4OO1I 4A3GB 1O7YA 3Q22A 1SNDA 2PW5A 5IGGA 5E4WC 2PNRC 3DEPA 3U9OA 2JYOA 3C1EA 5CR3A 3J81L 2RSOA 3GP7A 1SJHD 5C5LA 3R8BA 3J80L 1XWEA 3AU7A 1QOHA 5I2YA 3HKZB 1EIHA 2LY7A 1I4GA 1EYDA 4CGYB 2N88A 1FGBD 2X6LA 4K8JA 2EXZA 2ZT9C 5IGCA 1PZJD 1B44D 4QUFA 2K33A 5ISRA 1O7ZA 2HUGA 3NWSA 5JPMC 4A3MB 3S2DB 1EYCA 2QDBA 2NVQB 2PZWA 5KNCA 3HOVB 2IX1A 4IFDJ 1I6VC 1Q3LA 4G7HC 3LX0A 4QF4A 4PV1C 2OF1A 4IUTA 1NUCA 2SEBD 4H7BA 5E4XA 1EOTA 4F7XA 1PYWD 2ICIA 1D1KA 3DHQA 1TVXA 3R93A 1IYUA 1TKWB 5KEEA 3MA2B 2IWHA 2JA6B 1CA6A 4L6TB 3ND9A 1B1ZA 2JXMB 3SK5A 3JAML 1J9OA 3NTIA 2TMPA 2MUYA 2BE5C 3LNNA 4I65A 2XSCA 5K5PA 1DZ1A 1G291 4OHJA 2A69D 4CJ2C 4C56C 2R61A 4V0BA 1D6EC 1PDQA 2BCOA 3WDNA 4C1NI 1GUTA 1F9PA 2K6AA 5T1GA 5KYIA 1H9MA 1JR0D 1CI3M 2YU9B 2A73B 1Y69U 4RKBA 1BQQT 5JAVA 1I4RA 3I91A 3MHBA 3SK4A 2RQXA 1JB3A 2F4IA 3QJYA 5COYA 4HAEA 2EY6A 1Y8OB 3OPOA 3PO3B 5JVH3 4ZYSA 3R3OA 2O2LD 3PUZA 1NR2A 2B2UC 2F3VA 3FEWX 1ENFA 1EQVA 2XWBB 4KV6A 1Y1VB 1CZWA 2IX0A 4MN3A 2VB2X 4LMQD 4U673 5JEAJ 3D3RA 1CA5A 1KABA 5ELCA 4F88A 1EZ8A 1HFGA 4KY7A 2VXWA 1HHVA 4Z9CB 4DAYA 3D4DA 5DM63 3UI2A 3CKIB 3K5MA 2F0QA 2EPBA 1ZXTA 4KJOA 3GTOB 1LABA 5DNFA 5KNDA 1VDZA 4NMZA 1HTLD 2B2VA 3H94A 1KDBA 2EYMA 3L9AX 2ZXPA 1GUGA 3BYTB 5D3IB 1EY4A 3MVVA 5C3EB 1KTKA 4CKCA 3VYUA 4X3UA 4BY7B 5C0XH 5CV7A 3NXWA 5M3FB 4BS9A 3NHHA 1CK1A 4FP5D 5FLXL 1JE4A 1LLRD 1AW7A 4RA8A 1H9SA 2R3ZA 5DAUA 4PMCA 1VMPA 4DU9A 1SYDA 5NUCA 5IOCA 1BBXC 1I50B 2QF7A 5JJZA 1FR3A 1G2SA 3IAYA 4BA2I 1F2LA 4EGVA 4XQQA 1LO5D 5ELFA 4DK0A 1IW7D 3TDQA 3V96A 2EVBA 1I6HB 4JBWA 3A56A 3S2HB 2F0KA 2A6HD 4R9WA 1TT2A 2K01A 1ILQA 2OXPA 2RBMA 5BN5A 5C4ZA 2JP1A 1B3AA 4YIJA 1JOQA 3K5LA 1Q1EA 2NVXB 2MP1A 2WKCA 3CHBD 3M7GA 3VYSA 1AEXA 1VMCA 4H44C 5M5WB 2XRSD 5EBCA 2M00A 3C2PA 1BCPC 4DXGA 4A3JB 3G6JB 3NUCA 1PRTF 3TP6A 2OT2A 3K5NA 1D5XC 2EY1A 2E2JB 3HOZB 3RMHA 1G6ZA 2WB1B 5KRUA 1W6JA 2JA7B 1AN8A 4ME5A 3OOCA 3QWNA 1HXYD 3WOFA 1W6KA 4XYOA 4KD3A 4C3HG 1Z7TA 1EY5A 1LTAD 2F0GA 3HG9A 5M5YB 4CHTB 2A68C 4B9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5Q A;  3NPP A;  2K5W A; 
#chains in the Genus database with same CATH topology
 1S40 A;  4EX5 A;  5M3M H;  1UNS A;  4X6A H;  5EKL A;  3ULJ A;  2UUB L;  2YTY A;  1I94 L;  1AZP A;  1A0I A;  3CC4 A;  2QIL A;  4KI0 A;  4A76 A;  1O78 A;  3TP8 A;  1XNR Q;  1Q1B A;  2HDM A;  1H9R A;  1BUV T;  2Y0S B;  4A3I B;  4B08 A;  3D6C A;  4DV4 Q;  1N9W A;  1B7Y B;  5IGE A;  1X9N A;  1TR5 A;  2ZXR A;  1VQI A;  4LK1 C;  2JA8 G;  2C9O A;  1X54 A;  3T16 A;  5A2Q L;  2O5J C;  3M3Y B;  1OXV A;  1VCI A;  2NUC A;  5JOB A;  5C4H A;  2VNU D;  2XTI A;  3HOU B;  1QVG A;  1CKN A;  2JA5 B;  2Z8L A;  4R4C A;  3FKI B;  2ZJR A;  2B63 B;  1YNJ C;  1A6X A;  3JC6 6;  5ELB A;  4DNR B;  1N36 Q;  2PYK A;  4L5Q A;  2R7Z B;  1A63 A;  4X66 Q;  2KBN A;  2I07 B;  1HRJ A;  2OQ0 A;  5E1F A;  1UWV A;  2K04 A;  4YWK A;  3I8Z A;  3E6Z X;  4AYB B;  2F0N A;  4DAV A;  1MIU A;  2ASB A;  2JA9 A;  3HOV G;  4A3K B;  1DOM A;  1I4X A;  2OTL A;  5LMN L;  4JBM A;  4DV3 Q;  4BY7 H;  4Q5V A;  2R92 H;  2UXC L;  2Z1C A;  3BDO A;  2TSS A;  2NYZ D;  5GRO A;  1IXR A;  2UUA Q;  4DN4 M;  4PZ6 A;  1EUJ A;  4A3D B;  3A8K E;  2MFI A;  1U4R A;  4K6L A;  1A3T A;  3I4N B;  4IAL A;  1S5C D;  4DNI A;  2JA6 G;  3RLO A;  2I5L X;  4X64 L;  2ZM6 Q;  3DMU A;  1D7Q A;  4DUZ L;  1ICF B;  2Z0S A;  4GNX C;  2XGT A;  3KUP A;  5IWA Q;  1JJG A;  2BOS A;  1D2B A;  4QQB X;  2RCN A;  4KD4 A;  3S1M H;  4J8Q A;  4JI3 Q;  4POG A;  4R8I A;  1Z9F A;  3RNU A;  5J1Z A;  1PV4 A;  4K2L A;  3BDC A;  5FOB B;  2O5I C;  2FIN B;  1SE4 A;  2EJG C;  1V9P A;  2F1M A;  5IT9 E;  4IZ8 A;  2F03 A;  1TWF B;  3S1Q H;  4JI7 Q;  4H0L C;  1I6H H;  3S2H H;  4PG3 A;  1ICW A;  5FLM G;  3AEV A;  2HQE A;  2CWP A;  2NTS A;  2K5V A;  3G7L A;  3DEO A;  3TQY A;  2ZTD A;  4KY5 A;  5FKA C;  3O13 A;  4DR1 L;  3J7Z C;  1FNV A;  1C8C A;  4C3J B;  2KHI A;  3CRL C;  1STY A;  2N55 A;  4IUR A;  4NW2 A;  5ELD A;  5FJ8 G;  1S5E D;  1PRT B;  3QIA A;  3Q0A A;  3CXC A;  2IW3 A;  4TKO B;  4RMF A;  5D14 A;  1TU2 B;  1HR0 W;  2KED A;  2B3G A;  3PO3 G;  3NBI A;  2NN6 H;  1UE7 A;  1EOV A;  1UEB A;  1STN A;  3MFG A;  2XRQ D;  2UUB Q;  1EFI D;  3RD4 A;  1HFN A;  2E2I B;  1UE5 A;  1I94 Q;  3W1B A;  2ZJQ A;  3AQQ A;  1O80 A;  1K8O A;  4TSS A;  3H6M A;  4GS3 A;  1EWC A;  3MFY A;  2AUJ D;  4XQJ A;  2B2Y A;  1Y1V G;  4LW1 A;  2MQH A;  3EA6 A;  4RFB A;  5CMD A;  1PRT D;  1YHA A;  1ZYR C;  1EFW A;  2BH2 A;  3BZK A;  4ALP A;  4P2C B;  1NMG A;  2OTJ A;  1OXT A;  1QUQ B;  1CQV A;  1SE3 A;  3EIV A;  1PYS B;  4JI8 L;  3HOZ H;  3K58 A;  1F9Q A;  1N8R C;  1WCM H;  2XN9 C;  1NMF A;  1FVI A;  1TII D;  2EJM A;  1B2T A;  2JA7 H;  3BS1 A;  3HS0 C;  4FF1 A;  3STB D;  3H3V C;  3OHX C;  2A5H A;  3T4A C;  2H5X A;  2LKV A;  3S9W A;  5EBD A;  2R93 B;  1C48 A;  1ENC A;  2EYF A;  1SNP A;  2VB3 X;  3S24 A;  1SMY D;  5C44 B;  2VQE Q;  4GNX B;  4G7Z C;  2EY5 A;  2I5H A;  1RF2 D;  2B8G A;  3H0G H;  4RHS A;  1BVS A;  1Y14 B;  1NTG A;  3J81 E;  4N9T A;  5LMN Q;  2X69 A;  4NDX A;  1GO3 E;  1F2Z A;  3VR6 A;  3J80 E;  3SDZ A;  2WB1 E;  4HIK A;  4FO2 A;  1QVC A;  5C0X I;  1JE5 A;  5C3X A;  1D5Z C;  1P16 A;  1O7I A;  3R2I A;  3ERQ A;  4ZCK A;  1DM0 B;  4A3I H;  1E2V A;  2QKI C;  2L12 A;  3KF8 A;  4IUN A;  1B4O A;  5C3E G;  2EDG A;  4IQZ A;  1Q8I A;  4IOA A;  3E9H A;  1JQY D;  3HRZ C;  3GTJ B;  1VQE A;  3X3M A;  2VUM B;  1FNW A;  3M3Y H;  4X64 Q;  3BYY B;  4QB4 A;  4OWT B;  2SDF A;  2DY8 A;  1N33 L;  3MTS A;  1SNM A;  4K6D A;  4GOP A;  4ZKB B;  1TWG B;  4BY7 G;  4DK1 A;  2R92 G;  3MXU A;  2B63 H;  3GTG H;  4J6H A;  2WP8 J;  1Q12 A;  3I70 A;  5M3F G;  1K0R A;  5CV9 A;  1PTO F;  3T1H L;  2HDL A;  1KIX A;  3T51 B;  1VF7 A;  5IOD A;  3J81 i;  5BN3 A;  1VQ7 A;  1BXT A;  1Z47 A;  4CKE A;  3J80 i;  2EY2 A;  4A3K H;  5EJW A;  5I9O A;  3PF5 A;  5JJK A;  1WTR A;  2E2H H;  3NTK A;  1GUW A;  1OXX K;  3A0J A;  3D31 A;  1EQQ A;  3S1N B;  1K8G A;  5G3L F;  3K0Y A;  4A3E B;  4PQX A;  1SYE A;  4DR1 Q;  2WAQ B;  4A3D H;  4ZK9 B;  1KNE A;  2LXJ A;  1E1T A;  4G4K A;  2WIN B;  4YWM A;  2A6E D;  4RCO A;  3W3A A;  1K83 B;  3DWA A;  4KY6 A;  2AWO A;  3PUY A;  4AYB E;  1Z6H A;  3LGJ A;  4JI6 L;  3SVM A;  4CKB A;  1PH3 A;  3JAM E;  4RKL A;  4IFD G;  1QWY A;  1S5D D;  2F4V L;  2L9H A;  3K57 A;  1M8A A;  1MBY A;  2L15 A;  4X3T A;  2CH4 W;  2EYJ A;  4UAI A;  1NR4 A;  1K28 A;  3E0E A;  3ULL A;  1UAP A;  1PMR A;  4K5W A;  1DD2 A;  1WTX A;  1WD1 A;  4O1N A;  3I2Z A;  2UU9 L;  1LYL A;  2BA1 A;  3NEN A;  1TWF H;  3F2D A;  3KYH C;  1WTW A;  1A62 A;  1PTO C;  3NK9 A;  4JI8 Q;  1S4Z A;  1CTM A;  3M4Q A;  4TQU S;  4DAM A;  3NBH B;  4HJ7 A;  3C3L A;  2UXD L;  4WJ4 A;  2XWJ B;  3A54 A;  3EBE A;  4AIM A;  2K4K A;  2NN6 G;  2KHJ A;  4LFA L;  4C2M B;  3TRZ A;  1EQR A;  2D9U A;  4DV0 L;  2Q8T A;  3J81 j;  1V1P A;  4C3I H;  4RGO S;  2HCI A;  4QUC A;  4AQY L;  3TZU A;  2NB0 A;  4RGM A;  4C3J H;  4POF A;  1NBW A;  5COR A;  2NVT B;  3GV3 A;  1HUM A;  4A3J G;  3JAM i;  2FJ2 A;  1OXU A;  3CW2 C;  3T56 B;  3G4S A;  3I90 A;  2VS1 A;  2MO0 A;  2L55 A;  3DM3 A;  1T5E A;  1GUN A;  4GN5 A;  2E8G A;  3HOZ G;  3VR4 A;  3FMC A;  3A55 A;  3PIP A;  2E2I H;  2WB1 G;  4XT3 B;  1KLG D;  4KKT A;  3MAQ A;  3CCE A;  1NJI C;  3RZO B;  4LUO A;  5ELE A;  5FO8 B;  2JA7 G;  1MGS A;  3K7A B;  1PLF A;  4K5V A;  4IPG A;  4A3C H;  1BKB A;  3GTM B;  2GVA A;  2FFK B;  2IHF A;  5AFW A;  1LTI D;  4ZUJ A;  1C4Q A;  2D62 A;  1ESR A;  1V1O A;  3MWY W;  1WD0 A;  2IPK D;  1GKH A;  5CV8 A;  5LMU L;  3CQZ H;  4A3G H;  4MZ9 A;  4JV5 Q;  4CDC C;  3I55 A;  3J7Y W;  1Y8P B;  2RHQ B;  3H0G G;  2L11 A;  2JSO A;  1FNU A;  1U4M A;  1CUK A;  4WFN 3;  5GAE C;  2F0W A;  3U4V A;  3T1H Q;  1EEI D;  2DJF C;  4V19 0;  2NWG A;  3QG1 A;  3ERS X;  3ND8 A;  1HA5 A;  4J15 A;  2Y0S G;  3RLF A;  4A3I G;  3N52 A;  3A8J E;  1JOO A;  3QB3 A;  2EIF A;  1OXS C;  3KOJ A;  2BH8 A;  4XTC S;  3R2T A;  1WTP A;  1YHB A;  4HJ9 A;  1VQ9 A;  3RUZ A;  4DV7 Q;  2BE5 D;  3FRP B;  3HOU G;  5LMN W;  2N78 A;  3UE1 A;  2JE6 I;  4CBV A;  3U50 C;  3GD7 A;  1JCK B;  1EY6 A;  1SXT A;  1AFP A;  2HT1 A;  2JA5 G;  1YNX A;  2B2V C;  2EZV A;  2B63 G;  5KYL A;  3HOW B;  3NWT A;  2KHS A;  1KAA A;  1PTO B;  2DNC A;  2R7Z G;  4IUQ A;  2CW0 C;  1A15 A;  1STG A;  1E3P A;  3VYT A;  2EE1 A;  4A3M H;  1VQL A;  1K3R A;  2BDN A;  3VR2 A;  1QNU A;  2F0F A;  4AYB G;  3SK6 A;  3BG3 A;  4JI6 Q;  2VUM H;  1WFQ A;  4A3K G;  1XMQ Q;  2F4V Q;  4RWS C;  1BCP F;  3QR8 A;  2K5W A;  4QY7 A;  4JI0 L;  3BJU A;  1SNC A;  1TWG H;  3C1F A;  5D3D A;  3IFT A;  4ZRZ A;  5FLX E;  3H91 A;  1V1Q A;  2F0O A;  1FL0 A;  2RVL A;  2O4X A;  4NB3 A;  1XX8 A;  5IYC G;  1DYQ A;  1ASY A;  3I3C A;  4A3D G;  4PZ7 A;  1X6O A;  1TWA B;  3TSS A;  3KBG A;  4OIJ A;  2UU9 Q;  1EY0 A;  3N6R A;  5H1S E;  2HIV A;  3T1Y L;  1S3O A;  3I4N G;  3KJO A;  2SNS A;  3BZC A;  2L4N A;  1TS4 A;  4YHH L;  2UXD Q;  1L1O C;  5AJ3 L;  1LTT D;  1MJC A;  1DJR D;  4LFA Q;  2ZJP A;  3X3N A;  3OSO A;  3UE0 A;  3T53 B;  4AQY Q;  1B3Q A;  2JEB I;  1IL8 A;  1V43 A;  5CBE E;  3VR5 A;  1YBY A;  2VL6 A;  3CCM A;  2V4D A;  1K83 H;  2HQL A;  4UY8 C;  2EYH A;  2XVS A;  1IL2 A;  3PUX A;  3NP8 A;  4HED A;  4DR6 Q;  2ENB A;  2F0U A;  2Z6K A;  3PIO 3;  2PMZ B;  1D1I A;  3A5Z B;  2NN6 I;  5GAD C;  4QCL A;  4J1M A;  3Q23 A;  1QNK A;  3Q24 A;  2YU9 H;  1Q90 A;  4I7Z C;  4C3I G;  4JI2 L;  2Q2U A;  2G9H D;  4HIO A;  3GTL B;  2KCC A;  4C3J G;  5BN4 A;  1M4V A;  1SYB A;  5LMU Q;  3L3O C;  5FJ8 H;  2LFN A;  3K5O A;  1VQB A;  5C3W A;  3FHW A;  2D2C C;  1LT5 D;  5EKI A;  4DV1 L;  1MI2 A;  4JCV E;  4X65 Q;  1WTO A;  3AMU A;  3HGB A;  2RKS A;  4ODG A;  2K03 A;  3A7A B;  4K0K L;  2NVT H;  4Y7N B;  3CCV A;  1S5B D;  2YV5 A;  5IGF A;  1WOC A;  2RHS B;  2BA0 A;  3CP0 A;  5I6W A;  1KLU D;  2AQ2 B;  4BXX G;  1D5M C;  4HMI A;  1STE A;  2IJ0 A;  4RGT A;  2QW7 A;  5C0X J;  1DXM A;  2D0P A;  2PCF B;  2WV6 D;  4LF9 L;  1IBM L;  3KDF A;  4DK3 C;  1Y1W B;  1PZI D;  2N8N A;  4K5X A;  5J22 A;  2KEC A;  4HSV A;  3GTM H;  1B53 A;  4LJZ C;  2LMC B;  4NP5 A;  1XPR A;  1LM0 A;  4XXE A;  2R93 G;  1L1O B;  4LUZ A;  4RCN A;  3KF6 B;  3TN2 A;  4XT1 B;  3HKZ G;  3E5S A;  3GTO H;  1YNN C;  1H9S B;  3F8T A;  4P72 A;  5I4D A;  4DV2 Q;  1EY7 A;  1NAP A;  2J4X A;  2OCE A;  1I4P A;  1E0B A;  4JI0 Q;  4HTH A;  4X62 L;  2NVY B;  4B9W A;  4CJ0 B;  3NPP A;  4DUY L;  1TWC B;  3PQI A;  3A74 A;  1VQH A;  1K8M A;  2RDG A;  1STB A;  1WYD A;  2KOL A;  5EGT A;  2DN8 A;  2KJX A;  1BNZ A;  4HR7 B;  3P20 A;  5C3E H;  5A2Q E;  4CDD C;  2EYO A;  4A3M G;  1PFN A;  2B2W A;  4P75 A;  3T1Y Q;  1QUQ A;  2NZO A;  1IYJ B;  2VUM G;  4B3R L;  3M4O B;  3S15 B;  5AJ3 Q;  3VA5 A;  1NCV A;  1BCP B;  3J7A 5;  4O0A A;  4F8M A;  1Q81 C;  5FO9 B;  5M3F H;  1IHZ A;  5TSS A;  2L0C A;  3OWF A;  2HHH Q;  1PTO H;  4OL7 A;  1O7L A;  1RDP D;  4HMJ A;  4YCW A;  3STB C;  2R7F A;  2DGY A;  2H1E A;  4A93 B;  1R9T B;  4HN7 A;  2KUM A;  2EYL A;  2Z4H A;  3I72 A;  1BR9 A;  1SRO A;  1SMY C;  1XXG A;  2E2D C;  3CCR A;  4FF4 A;  5CGK A;  3E0J A;  3FDT A;  1RTO A;  2Q8I B;  1I50 H;  1JIC A;  4LF6 Q;  3SK8 A;  1DOL A;  2D5D A;  1S5F D;  2ID0 A;  1DCZ A;  2E74 C;  4A3E G;  4JI2 Q;  1HNZ Q;  1SE8 A;  2Z9H A;  1JMC A;  1KD1 C;  2NZH A;  2WAQ G;  3GTP B;  4S3S A;  4R8N A;  3IKJ A;  5E7N A;  1GVP A;  1TWA H;  5EKK A;  2B29 A;  3SE0 A;  1X56 A;  4UP7 A;  3PIO A;  1ASZ A;  4GKJ Q;  3NEL A;  1EU3 A;  2G9D A;  2YTX A;  4XQN A;  4JYA Q;  3PSI A;  4R1J A;  1F2M A;  5J39 A;  1SYC A;  5IGD A;  1WTV A;  3S17 B;  4UP9 A;  1V8Q A;  2WKD A;  5GAG C;  4DV1 Q;  4DV5 L;  4IFD H;  1I5F A;  2JK8 A;  2IHE A;  1A2T A;  2H4O A;  3A7L A;  4HID A;  2F3W A;  2R6G A;  5JJI A;  4QIW B;  3OW7 A;  4YWL A;  3EQL C;  1GM5 A;  4K0K Q;  1VQM A;  2A68 D;  1TS5 A;  3ZJY C;  3F2C A;  3NE5 B;  4ZAI A;  2B39 A;  4DXF A;  2EOT A;  4G57 A;  4IO9 A;  4FXK C;  4RAU C;  2F0M A;  3UDI A;  2NVX H;  1HCZ A;  2F0L A;  3QOL A;  2K28 A;  5EPL A;  2ZTE A;  1ZEQ X;  4XDX A;  1ONL A;  1IBM Q;  4BBR B;  1VQ8 A;  4BY1 B;  1KQS A;  3VA7 A;  1HA6 A;  5M5W H;  3ICE A;  5I2X A;  1B8A A;  2EJF C;  3FPP A;  4MTN A;  4GKK L;  4A3J H;  1HNX L;  3F1Z A;  4X3S A;  1GUS A;  4XYQ A;  3P75 A;  5CV6 A;  1B50 A;  3HOY B;  3HOX B;  1TWH B;  2F0P A;  4WJW A;  1SE2 A;  1VQC A;  1W2B A;  1YNJ D;  5JVG 3;  4KN7 C;  2E2J H;  1ESF A;  3ZYY X;  1GD7 A;  2A69 C;  4X62 Q;  4LF7 L;  1KC8 C;  1CKN B;  4HCS A;  2PMZ E;  3BVZ A;  4DUY Q;  1HZC A;  5DM7 3;  3H09 A;  2B2T C;  3SHL A;  3F2B A;  3PIP 3;  3BZD B;  1VQ5 A;  3KLW A;  4LF5 L;  1A3V A;  1OO9 B;  2N49 A;  5EQ0 A;  5M5Y H;  2B2Y C;  1F2Y A;  3HZX A;  3NBH A;  3D8G A;  4B3R Q;  3NTH A;  2F0V A;  2RDF A;  2Q2H A;  1LTL A;  2ATW A;  2IL8 A;  2UXC Q;  1VF5 C;  2DY7 A;  4IUP A;  3M85 A;  1G91 A;  1D8L A;  1CM9 A;  4JI4 L;  4IUU A;  1SEB D;  4KK7 A;  1NE3 A;  3AFP A;  4G7O C;  4N9P A;  1E24 A;  4QMG A;  3VYR A;  2JA8 B;  4LWC A;  3G71 A;  4HJ5 A;  2K14 A;  3CCL A;  4KKS A;  3CMA A;  3L2P A;  1PFB A;  5A35 A;  1SNQ A;  3AYH B;  3I4M B;  5CYU A;  3GQB A;  5JEA H;  3RLN A;  3HOU H;  4DUZ Q;  1K9M C;  1AP0 A;  2HCC A;  1LAC A;  1X3P A;  3TP7 A;  4JOI A;  1HJP A;  1LUZ A;  3DXJ C;  3MC0 B;  2JA5 H;  3FKI H;  1PH5 A;  1QZH A;  3G48 A;  1MD2 D;  5J3B A;  1L0Y B;  3VDY A;  2R7Z H;  3J7A F;  1QG7 A;  1ML0 D;  4FNF A;  2PNH A;  4KHZ A;  4FXG C;  2MO1 A;  3GO5 A;  4GN3 B;  2SOB A;  3WWV A;  1SFO B;  1WTH A;  5C4X B;  1A2U A;  1BO0 A;  2AWN A;  4DV5 Q;  4B3M L;  1TY0 A;  5F2D A;  3M4O H;  3S15 H;  3MXP A;  4DAP A;  5HGQ A;  2PO4 A;  1YHQ A;  2K05 A;  5IE8 A;  1A8V A;  1LV9 A;  4ZQ3 A;  2MPM A;  1RD9 D;  1HUN A;  4KKU A;  3I73 A;  4GOP C;  3ITP A;  5IYC H;  2OQK A;  4JK1 C;  4KTA A;  3CCU A;  4ZLT F;  1HTP A;  1HQR D;  3RZD B;  4FF3 A;  4L5R C;  1YI2 A;  4TRD A;  4OIK A;  4KHV A;  2XNA C;  3I4N H;  3DUZ A;  4EVO A;  2LS0 1;  3TRE A;  3CU7 A;  4ILW A;  4ZKC B;  2AKW B;  3WOE A;  1ZYR D;  2I46 A;  1PH6 A;  3CPF A;  1TXY A;  2IT1 A;  3GTP H;  5DEH A;  2ICE C;  4GKK Q;  1QIL A;  3V05 A;  1HNX Q;  1YJ9 A;  4LAA A;  1PH8 A;  5IYB H;  3ERO A;  3SEB A;  5FLX c;  1C9O A;  4K14 A;  2B8F A;  2MGS A;  3K7U C;  2YTV A;  2B2U A;  3MXN A;  1JOR A;  2E5L L;  1JWS D;  1U9R A;  2K7V A;  1B9M A;  1IKM A;  4LF7 Q;  5EPK A;  1ZKO A;  4Q0F A;  1ET6 A;  5IGB A;  2UXB L;  1L0X B;  4E6I A;  2GVB A;  2CQO A;  3FPU B;  2CKZ B;  3S14 B;  1MKH A;  1DON A;  3GTQ B;  4DR7 L;  3PF4 A;  3LWE A;  4LF5 Q;  4A3B B;  1HH2 P;  1EIG A;  4APV A;  4OWW B;  4O2D A;  4P74 A;  5LHY 1;  1AE2 A;  4OX9 L;  4OXP A;  5K36 H;  2C5C A;  5LL6 S;  2RA4 A;  3OW2 A;  4M8A A;  4FF2 A;  3CCJ A;  2WAC A;  3CCQ A;  2NBF A;  2WFW A;  4BY1 H;  2KA7 A;  1EY9 A;  1STH A;  4LFB L;  1IW7 C;  4GLV B;  4QIW E;  3U4Z A;  4LF4 L;  1IBK L;  4JI4 Q;  2KEN A;  2EQS A;  1FYC A;  1SYG A;  3SR1 A;  2A6H C;  3KF8 B;  1K73 C;  1B70 B;  1QB5 D;  2QA4 A;  1EYA A;  3OIP A;  1BDO A;  1TWH H;  3HOX H;  3HOY H;  1LT3 D;  1I4Q A;  4L8J A;  2PW7 A;  4NKL A;  2VQF L;  4BXX H;  4K2K A;  5D65 A;  4A75 A;  5M3M B;  1GUO A;  4C1N K;  4EQP A;  4A3F B;  1M90 C;  1SRU A;  4GOP B;  1N33 Q;  5KGU A;  4KMU C;  1IBL L;  4B3S L;  2IX3 A;  3I4L A;  4F87 A;  3P1H A;  1IYV A;  4K8I A;  1PFM A;  1YIJ A;  2Q2I A;  1EU4 A;  2KCN A;  4OO1 H;  1F77 A;  2R93 H;  4FVM A;  1QCB D;  4KHP L;  3TBI B;  1RHP A;  5E3F A;  3GTK B;  1ROD A;  1G2T A;  5C44 H;  1WVL A;  4N8F A;  3KK7 A;  2GN5 A;  1ET9 A;  4B3M Q;  1TY2 A;  1E2W A;  2M2L A;  1HPC A;  3IL8 A;  1EY8 A;  1PH4 A;  3PUV A;  1G6P A;  2A74 C;  3MXG A;  5JEA G;  3TS0 A;  3IFD A;  4IJL A;  1XNQ L;  1LT4 D;  1B9N A;  3S1R B;  2R7D A;  1N34 L;  4N8X 1;  3FKI G;  2HD3 A;  4KJN A;  2MHV A;  4XIG S;  3EJI A;  5EPJ A;  4EQO A;  1CFM A;  5CV5 A;  1X3F A;  1K8A C;  4OEM B;  1QE6 A;  4YY3 L;  5CV4 A;  3KLS A;  3GTJ H;  1NNX A;  2DNE A;  2X6G A;  3CC2 A;  4Y52 H;  4YCU A;  2R92 B;  4ZUI A;  4BWG B;  3PO2 B;  1EEF D;  2J7Z A;  1F9S A;  1CHQ D;  3DWP A;  4YCV A;  4IOC A;  5FO7 B;  2JEA I;  2A19 A;  4PMW A;  1PTO D;  3K59 A;  1CSP A;  1L1O A;  3AB9 A;  1E1O A;  4MHE A;  1WI5 A;  1Q86 C;  5C4X H;  3OWE B;  4A93 G;  3IRB A;  3RR5 A;  1XTC D;  4EQ5 A;  3BVM A;  1EQT A;  1LTG D;  4IFD I;  1EL0 A;  3QOJ A;  1SSO A;  4L63 B;  1RCV D;  3M9B A;  3S1N H;  1T5X D;  1V1P B;  4DV0 Q;  4DGZ A;  1N36 L;  3BU2 A;  3QO2 A;  5DLQ E;  4A3E H;  3S1M B;  3NEM A;  5G3L D;  1XYI A;  3K6O A;  2LXK A;  4LFC L;  4DA2 A;  2KVM A;  2Z6B A;  1TS3 A;  3RZD H;  3M4Y A;  4HCE A;  5IYB G;  3H15 A;  3KBX A;  2NZ1 D;  5CBA E;  4PNY A;  3S1Q B;  3ONA B;  1UEA B;  3C46 A;  5I9P A;  1JWU D;  2LSS A;  1WTQ A;  4PMB A;  3H3V H;  3Q6S A;  5HUR A;  4JI5 L;  4OWX B;  3BVG A;  1RTN A;  1LTR D;  2XIW A;  3VR3 A;  4LFB Q;  1W3S A;  4DAY B;  1PZK D;  3OMC A;  5C6A A;  4QGU A;  1IBK Q;  1SAP A;  3TP5 A;  3PMF A;  5M9O A;  1HQM C;  1SJE D;  1VQP A;  2UUC L;  1VQ4 A;  3DWQ A;  3U58 A;  1E22 A;  3NSW A;  1KRT A;  3S16 B;  1VQG A;  2BDO A;  1H9J A;  4CJ1 B;  1KDC A;  1MJE A;  2RSN A;  2J0T D;  1CT1 D;  1G8Z D;  1BF4 A;  2F0J A;  1RL2 A;  2VY3 A;  4I7A A;  1EYG A;  1MSH A;  1U4P A;  2QEJ C;  3MZ5 A;  5IIF A;  3A8I E;  1Q46 A;  5K36 G;  3NQI A;  3SXH A;  1IBL Q;  2CHB D;  4QJF A;  2PQA B;  4C2M H;  5IT9 c;  1A3U A;  2E76 C;  4BY1 G;  3S14 H;  4BBS B;  1VQ6 A;  1HZ9 A;  1R4Q B;  2Z6K C;  1KRS A;  5T1I A;  3V2T A;  4IPD A;  1GXD C;  3GTQ H;  1KDA A;  2M9V A;  2G5D A;  1CZG A;  3K0X A;  2K1B A;  4GZY C;  3L0O A;  2L1B A;  1FGU A;  2OEO A;  5HGT A;  4H13 C;  3HOY G;  3HOX G;  1N32 L;  1SDF A;  4A3L H;  3HP3 A;  4IN3 A;  3KJP A;  1S72 A;  3LWU A;  3DM1 A;  1WCM B;  3NQT A;  4DR2 L;  3PGZ A;  4DKA C;  2CW0 D;  2ES2 A;  4DR3 L;  1J5E L;  4EQN A;  3RZO H;  1F9R A;  3BDL A;  3K7A H;  1SYF A;  1MSG A;  4JPB W;  1N34 Q;  5CC4 A;  5ELN A;  1BBW A;  4H02 A;  4OGQ C;  4P73 A;  2GA4 B;  1GHJ A;  4OO1 G;  1SNO A;  3GV6 A;  4YY3 Q;  4KN4 C;  2F3I A;  1LTB D;  5C44 G;  4DR5 L;  3TZD A;  2AUK A;  3GDE A;  1EWH A;  4A3F H;  5L37 A;  4IUV A;  2Z4I A;  4RHR A;  4FYD A;  2FHT A;  2PI2 E;  1GHK A;  4HSP A;  4RGN A;  5C5M A;  1MHW C;  1RIP A;  3CAM A;  4IJH A;  1IKL A;  2DUD A;  1H9K A;  1QJO A;  1JOK A;  5IYD H;  3OIQ A;  3ULP A;  3L7Z C;  1BOS A;  1JC7 A;  3GTK H;  5M5X B;  3TS2 A;  1GOZ A;  4L5T A;  3T13 A;  2OWO A;  5I6Y A;  2F0I A;  4DF7 A;  4GN4 B;  3FVQ A;  3I4M G;  1PRT C;  4YHH Q;  1FD7 D;  5C0X G;  4L5S A;  1ILP A;  1HNW L;  3GTG B;  1X3Q A;  3S1R H;  2Q8R E;  2WII B;  1EZ6 A;  1IZ6 A;  3M7N A;  1SBB B;  1Y8N B;  3J81 c;  4LFC Q;  3HOW H;  1RKN A;  1UE1 A;  4DNT B;  4UP8 A;  1VQJ A;  2JQO A;  2PQE A;  3D6W A;  2VQE L;  4NXN L;  3J80 c;  1QZG A;  2NTT A;  4GNX A;  3I7F A;  2K5D A;  3HEJ A;  2E2H B;  5C4X G;  1E7Z A;  1UUP A;  2F0S A;  4JI5 Q;  2KQ3 A;  1I4H A;  4BA1 I;  4U68 A;  3PO2 H;  2B2W C;  3F2U A;  1BCP D;  3MEF A;  1PXU A;  3DLL A;  3URY A;  1CQF A;  3EFX D;  4UDU C;  1U4L A;  2AQ3 B;  2PPB C;  2UUC Q;  2MJ8 A;  5KIX A;  1U5K A;  4LNQ A;  2SNM A;  3I4O A;  4OON A;  5FK9 C;  4WRD A;  1I3Q B;  5C4J B;  2YYZ A;  1XPO A;  1J8I A;  1ENA A;  1KHI A;  5IT9 L;  4M1U B;  3KLS X;  3PV0 A;  1II3 A;  3TME A;  3KFU A;  4DR4 L;  3M4P A;  2PZU A;  4O42 A;  3J7A V;  1AZQ A;  4MIU A;  4ME3 A;  1VS0 A;  2RDH A;  2F0T A;  1TS2 A;  1LTS D;  1R4P B;  4X3K A;  5IP7 G;  1NSN S;  1CHP D;  4FXD A;  1G51 A;  5LL6 X;  2ZXO A;  5JPN C;  3W2D A;  3D4W A;  1N32 Q;  3MEH A;  3CRK C;  1X32 A;  3KLR A;  1RJT A;  1SN8 A;  4DR2 Q;  1LT6 D;  1STA A;  4LF9 Q;  3KDF B;  4DR3 Q;  2F52 A;  1E2Z A;  2K5N A;  4C3I B;  1J5E Q;  2K5Q A;  2FMC A;  4ABN A;  4ULL A;  2AQ1 B;  1H95 A;  3JAM c;  1YNN D;  3PUW A;  2KEE A;  3S16 H;  1X3G A;  3GTL H;  3K81 C;  2L5T A;  3D4R A;  1AH9 A;  1KNA A;  2CVR A;  3P7J A;  1GJX A;  2E75 C;  2CH4 A;  4A3B G;  2P5Z X;  4DR5 Q;  1TQO A;  4WOR A;  3EVQ A;  2K75 A;  1X3E A;  5IP9 H;  2B2T A;  2FMM A;  4A3L G;  3U9S A;  2QCP X;  2A6E C;  3OMG A;  4DFA A;  1JWM D;  4BBS H;  3E9I A;  2CQA A;  1DOK A;  2F0E A;  4RH6 A;  2F0H A;  2F0D A;  1JT8 A;  2K32 A;  4LUV A;  4Y7N H;  2PZT A;  1VQK A;  4C3H B;  5KNB A;  1K3B C;  2EYP A;  4ID6 A;  3CQZ B;  4OO1 I;  4A3G B;  1O7Y A;  3Q22 A;  1SND A;  2PW5 A;  5IGG A;  5E4W C;  2PNR C;  4NPS A;  3DEP A;  3U9O A;  2JYO A;  3D0F A;  5M3M G;  4B3T L;  3C1E A;  4A3F G;  1XMO L;  1HNW Q;  5CR3 A;  3HFZ B;  2VZA A;  3J81 L;  1Y1W H;  2RSO A;  1EWI A;  3GP7 A;  1SJH D;  5C5L A;  3R8B A;  3PCO B;  4JI1 L;  3J80 L;  1XWE A;  3AU7 A;  3CME A;  3B6Y A;  1QOH A;  5IYD G;  5I2Y A;  4NXN Q;  3HKZ B;  1EIH A;  2LY7 A;  1I4G A;  1EYD A;  4CGY B;  4JBJ A;  2N88 A;  2N3S A;  2PI2 A;  1PHJ A;  1YEZ A;  1FGB D;  2X6L A;  4K8J A;  2NVY H;  2EXZ A;  2ZT9 C;  5IGC A;  4JG2 A;  1OTC A;  1TWC H;  2DJG C;  2K5H A;  4P71 A;  2QGQ A;  1PZJ D;  1B44 D;  4QUF A;  2K33 A;  5ISR A;  4JBK A;  4DPG A;  4R4Q A;  1O7Z A;  2HUG A;  3NWS A;  3HOW G;  5JPM C;  5M5X H;  4A3M B;  3S2D B;  1EYC A;  1VQD A;  2QDB A;  2NVQ B;  2PZW A;  4JV5 L;  5KNC A;  3HOV B;  3CD6 A;  5IY0 A;  2IX1 A;  4HJ8 A;  4IFD J;  1I6V C;  1Q3L A;  2ZTC A;  4R4O A;  2CFM A;  4G7H C;  1PH9 A;  4LF8 L;  4DR4 Q;  3LX0 A;  4QF4 A;  3PO2 G;  1CKO A;  4PV1 C;  2OF1 A;  3K80 C;  4IUT A;  1NUC A;  2SEB D;  4KLK A;  4H7B A;  5E4X A;  1EOT A;  4F7X A;  1PYW D;  5ELO A;  2ICI A;  2Y0S E;  1D1K A;  3DHQ A;  4JOI C;  1Q7Y C;  1TVX A;  3R93 A;  1IYU A;  1TKW B;  5KEE A;  2HIX A;  3MA2 B;  2IWH A;  2JA6 B;  1R9T H;  4DV7 L;  4A93 H;  1YVC A;  2RCF A;  1CA6 A;  4L6T B;  3ND9 A;  1B1Z A;  1KL9 A;  3H3V I;  2JXM B;  1UE6 A;  1KXL A;  3SK5 A;  3JAM L;  1J9O A;  3NTI A;  2TMP A;  1VQF A;  1HZA A;  2BE5 C;  2MUY A;  3LNN A;  4I65 A;  3I56 A;  2XSC A;  5K5P A;  1DZ1 A;  1G29 1;  4DV6 L;  3A5U A;  1P8L A;  4OHJ A;  1PA6 A;  2Q2T A;  2CWA A;  3CF5 A;  2A69 D;  1EIY B;  1I3Q H;  4RG1 A;  5C4J H;  2KCM A;  4CJ2 C;  4C56 C;  2R61 A;  4QL5 A;  4V0B A;  4OEL B;  1D6E C;  1PDQ A;  1YZ6 A;  2BCO A;  3WDN A;  1XMQ L;  4NXM L;  3S17 H;  4C1N I;  1GUT A;  3Q8D A;  1F9P A;  2K6A A;  5T1G A;  3W5O A;  5KYI A;  1H9M A;  4UHV A;  1JR0 D;  1CI3 M;  2YU9 B;  2A73 B;  1Y69 U;  4RKB A;  1JB7 A;  1DGS A;  2RF4 A;  5BR8 L;  2A1A A;  1BQQ T;  5JAV A;  1I4R A;  3I91 A;  3AFQ A;  3MHB A;  3SK4 A;  4CDF C;  2RQX A;  1JB3 A;  2F4I A;  3QJY A;  4GLA C;  5COY A;  4HAE A;  2EY6 A;  1Y8O B;  3OTO L;  3OPO A;  3PO3 B;  1EIF A;  5JVH 3;  4ZYS A;  3R3O A;  1PYB A;  4B3T Q;  1L2F A;  1SLJ A;  5IP9 G;  1VQA A;  1XMO Q;  1X65 A;  2O2L D;  3PUZ A;  1XTD A;  2QEX A;  1NR2 A;  4BBR H;  2B2U C;  2F3V A;  3FEW X;  3CCS A;  4BBS G;  4JI1 Q;  1ENF A;  1EQV A;  2XWB B;  4KV6 A;  1M1K C;  1Y1V B;  4UPA A;  3SGI A;  3FP9 A;  2I0Q A;  1CZW A;  2IX0 A;  3UDF A;  2D0O A;  4MN3 A;  2VB2 X;  1HR0 L;  4LMQ D;  4DR6 L;  4U67 3;  4JW0 A;  4A4I A;  5JEA J;  3D3R A;  1CA5 A;  1KAB A;  5ELC A;  4F88 A;  1EZ8 A;  2JN4 A;  1WCM G;  1HFG A;  4KY7 A;  2VXW A;  1HHV A;  3CPW A;  4Z9C B;  2ALY B;  4DAY A;  3D4D A;  2MNA A;  5EAY A;  2A8V A;  1YJW A;  5DM6 3;  1Y1W G;  3UI2 A;  4HJA A;  4C3H H;  1FJG L;  3CKI B;  1PH7 A;  3K5M A;  2F0Q A;  4MNO A;  2EPB A;  2AMC B;  1ZXT A;  2JJQ A;  4KJO A;  3RN5 A;  3GTO B;  1LAB A;  5DNF A;  5KND A;  1X55 A;  1VDZ A;  4NMZ A;  4R4I A;  1HTL D;  2B2V A;  2FXQ A;  4X65 L;  3H94 A;  1VQO A;  3RN2 A;  2PQA A;  2V1C C;  4LF8 Q;  1SR3 A;  1KDB A;  4B9X A;  1Q8K A;  1K0S A;  1CKM A;  2EYM A;  3L9A X;  2ZXP A;  1YJN A;  1GUG A;  3BYT B;  4PZ8 A;  5D3I B;  1PH1 A;  1NY4 A;  1J6Q A;  3ER0 A;  1EY4 A;  2QDL A;  3E3X A;  3MVV A;  5C3E B;  1KTK A;  2KCT A;  3EN2 A;  4CKC A;  5HY6 A;  2CCZ A;  1XPU A;  2JA8 H;  3VYU A;  4JC0 A;  3G6E A;  4FDB A;  4X3U A;  3OYY A;  3I4M H;  1PFS A;  4BY7 B;  5C0X H;  5CV7 A;  3NXW A;  5GQO A;  1KAW A;  1WJJ A;  5M3F B;  4BS9 A;  1PH2 A;  2IY5 B;  1XNR L;  3NHH A;  1CK1 A;  4DV6 Q;  4FP5 D;  1XJV A;  5FLX L;  4DV4 L;  3S2D H;  1L0W A;  1JE4 A;  2NVQ H;  3UDX A;  3KF6 A;  3HOV H;  3HKZ E;  1LLR D;  1AW7 A;  4RA8 A;  1H9S A;  2R3Z A;  4DV2 L;  5DAU A;  1SFO H;  4NXM Q;  3MXN B;  5GAH C;  2EXD A;  1VMP A;  4PMC A;  4DU9 A;  2E5L Q;  1SYD A;  5NUC A;  3CC7 A;  5IOC A;  1BBX C;  1HZB A;  1I50 B;  3UDG A;  2UXB Q;  1AE3 A;  2QF7 A;  5JJZ A;  1FR3 A;  1QVF A;  1G2S A;  4MTK A;  4CDE C;  1Q82 C;  3IAY A;  5BR8 Q;  4DR7 Q;  4X66 L;  2K50 A;  4BA2 I;  2C35 B;  4GLX A;  1F2L A;  4EGV A;  4IPC A;  4XQQ A;  3OTO Q;  4TVA B;  1LO5 D;  2JA6 H;  4R4T A;  1VQN A;  4WJ3 M;  5ELF A;  4DK0 A;  1T9H A;  1IW7 D;  3TDQ A;  4OX9 Q;  3V96 A;  2EVB A;  1U0L A;  1I6H B;  2K52 A;  3A56 A;  4JBW A;  3S2H B;  4DV3 L;  2F0K A;  2A6H D;  4R9W A;  1TT2 A;  2K01 A;  2VW9 A;  1PVO A;  1ILQ A;  5JJL A;  2OXP A;  2RBM A;  4AH6 A;  2UUA L;  4LF4 Q;  2HHH L;  5BN5 A;  5C4Z A;  2JP1 A;  1B3A A;  4YIJ A;  5IP7 H;  1JOQ A;  3K5L A;  1HR0 Q;  1Q1E A;  2NVX B;  2MP1 A;  2WKC A;  3CHB D;  3M7G A;  2VQF Q;  5FLM H;  3VYS A;  2ZM6 L;  1AEX A;  3TEH B;  1VMC A;  5IWA L;  1SMX A;  4LF6 L;  4H44 C;  1YIT A;  5M5W B;  4B3S Q;  2XRS D;  1HNZ L;  5EBC A;  4BBR G;  1CSQ A;  3HKS A;  4JI3 L;  2M00 A;  2WAQ E;  1JJ2 A;  3C2P A;  1BCP C;  4DXG A;  4A3J B;  1FJG Q;  3G6J B;  3NUC A;  4GKJ L;  1PRT F;  4IPH A;  3TP6 A;  2OT2 A;  4JYA L;  4KHP Q;  3K5N A;  4A3B H;  2AHO B;  1C0A A;  3PO3 H;  1D5X C;  2EY1 A;  2E2J B;  3HOZ B;  4JI7 L;  3W1G A;  3RMH A;  2I5M X;  1G6Z A;  2WB1 B;  5KRU A;  1BBU A;  1W6J A;  2JA7 B;  1JJC B;  1AN8 A;  4ME5 A;  3OOC A;  3QWN A;  1HXY D;  4JVZ A;  1XNQ Q;  4DK6 C;  1Y1V H;  4A3C G;  3WOF A;  1W6K A;  4XYO A;  4KD3 A;  1C7Y A;  4C3H G;  1Z7T A;  1EY5 A;  1LTA D;  2F0G A;  4A3G G;  4HIM A;  3HG9 A;  5M5Y B;  4CHT B;  2A68 C;  3H0G B;  3K8A A; 
#chains in the Genus database with same CATH homology
 1UNS A;  5EKL A;  1AZP A;  2QIL A;  4KI0 A;  1O78 A;  3TP8 A;  1Q1B A;  2HDM A;  1H9R A;  1BUV T;  2Y0S B;  4A3I B;  4B08 A;  3D6C A;  5IGE A;  1TR5 A;  2ZXR A;  4LK1 C;  2C9O A;  3T16 A;  5A2Q L;  2O5J C;  3M3Y B;  1OXV A;  1VCI A;  2NUC A;  5JOB A;  5C4H A;  2VNU D;  3HOU B;  2JA5 B;  2Z8L A;  3FKI B;  2B63 B;  1YNJ C;  1A6X A;  5ELB A;  4DNR B;  2PYK A;  2R7Z B;  2I07 B;  1HRJ A;  5E1F A;  2K04 A;  3I8Z A;  3E6Z X;  4AYB B;  2F0N A;  4DAV A;  4A3K B;  1DOM A;  1I4X A;  4Q5V A;  2Z1C A;  3BDO A;  2TSS A;  2NYZ D;  4DN4 M;  4A3D B;  3A8K E;  1U4R A;  4K6L A;  1A3T A;  3I4N B;  4IAL A;  1S5C D;  3DMU A;  3KUP A;  2BOS A;  1D2B A;  4KD4 A;  4J8Q A;  4R8I A;  5J1Z A;  4K2L A;  3BDC A;  5FOB B;  2O5I C;  2FIN B;  1SE4 A;  2EJG C;  2F1M A;  5IT9 E;  4IZ8 A;  2F03 A;  1TWF B;  4H0L C;  1ICW A;  2HQE A;  2NTS A;  3G7L A;  3DEO A;  4KY5 A;  5FKA C;  3O13 A;  1FNV A;  1C8C A;  4C3J B;  3CRL C;  1STY A;  2N55 A;  4IUR A;  4NW2 A;  5ELD A;  1S5E D;  1PRT B;  3QIA A;  3Q0A A;  2IW3 A;  4TKO B;  5D14 A;  1TU2 B;  2KED A;  3NBI A;  2NN6 H;  3MFG A;  1STN A;  2XRQ D;  1EFI D;  3RD4 A;  1HFN A;  2E2I B;  1O80 A;  1K8O A;  4TSS A;  3H6M A;  1EWC A;  3MFY A;  2AUJ D;  4XQJ A;  2B2Y A;  3EA6 A;  4RFB A;  5CMD A;  1PRT D;  1ZYR C;  4P2C B;  1OXT A;  1CQV A;  1SE3 A;  3K58 A;  1F9Q A;  2XN9 C;  1B2T A;  1TII D;  2EJM A;  3BS1 A;  3HS0 C;  4FF1 A;  3H3V C;  3OHX C;  2A5H A;  3T4A C;  2LKV A;  3S9W A;  5EBD A;  2R93 B;  1C48 A;  1ENC A;  2EYF A;  1SNP A;  2VB3 X;  5C44 B;  1SMY D;  4G7Z C;  2EY5 A;  1RF2 D;  2B8G A;  4RHS A;  3J81 E;  4N9T A;  2X69 A;  4NDX A;  1F2Z A;  3VR6 A;  3J80 E;  3SDZ A;  4FO2 A;  5C0X I;  5C3X A;  1D5Z C;  3R2I A;  3ERQ A;  1DM0 B;  1E2V A;  2QKI C;  2L12 A;  3KF8 A;  4IUN A;  1B4O A;  2EDG A;  4IQZ A;  1Q8I A;  1JQY D;  3HRZ C;  3GTJ B;  3X3M A;  2VUM B;  1FNW A;  3BYY B;  4QB4 A;  2SDF A;  2DY8 A;  3MTS A;  1SNM A;  4K6D A;  4ZKB B;  1TWG B;  4DK1 A;  3MXU A;  4J6H A;  2WP8 J;  1Q12 A;  3I70 A;  5CV9 A;  1PTO F;  2HDL A;  3T51 B;  1VF7 A;  5IOD A;  5BN3 A;  1BXT A;  1Z47 A;  4CKE A;  2EY2 A;  5EJW A;  5I9O A;  1WTR A;  3NTK A;  1GUW A;  1OXX K;  3D31 A;  3S1N B;  5G3L F;  3K0Y A;  4A3E B;  4PQX A;  1SYE A;  2WAQ B;  4ZK9 B;  1KNE A;  4G4K A;  2WIN B;  2A6E D;  4RCO A;  3W3A A;  1K83 B;  3DWA A;  4KY6 A;  2AWO A;  3PUY A;  1Z6H A;  3SVM A;  4CKB A;  3JAM E;  4RKL A;  4IFD G;  1QWY A;  1S5D D;  2L9H A;  3K57 A;  1M8A A;  1MBY A;  4X3T A;  2EYJ A;  4UAI A;  1NR4 A;  1UAP A;  1PMR A;  4K5W A;  1DD2 A;  1WTX A;  1WD1 A;  4O1N A;  2BA1 A;  1WTW A;  1PTO C;  3NK9 A;  1S4Z A;  1CTM A;  4TQU S;  3C3L A;  2XWJ B;  3A54 A;  2NN6 G;  4C2M B;  2D9U A;  2Q8T A;  1V1P A;  4RGO S;  2HCI A;  4QUC A;  3TZU A;  2NB0 A;  4RGM A;  5COR A;  2NVT B;  3GV3 A;  1HUM A;  2FJ2 A;  1OXU A;  3T56 B;  3I90 A;  2L55 A;  1T5E A;  1GUN A;  3VR4 A;  3FMC A;  3A55 A;  4XT3 B;  1KLG D;  4KKT A;  3MAQ A;  3RZO B;  5ELE A;  5FO8 B;  1MGS A;  3K7A B;  1PLF A;  4K5V A;  3GTM B;  2FFK B;  5AFW A;  1LTI D;  4ZUJ A;  1C4Q A;  2D62 A;  1ESR A;  1V1O A;  3MWY W;  1WD0 A;  2IPK D;  5CV8 A;  3J7Y W;  1Y8P B;  2L11 A;  2JSO A;  1FNU A;  1U4M A;  4WFN 3;  2F0W A;  1EEI D;  4V19 0;  2NWG A;  3QG1 A;  3ND8 A;  1HA5 A;  3RLF A;  3N52 A;  3A8J E;  1JOO A;  3QB3 A;  1OXS C;  4XTC S;  3R2T A;  1WTP A;  3RUZ A;  2BE5 D;  3FRP B;  2JE6 I;  4CBV A;  3GD7 A;  1JCK B;  1EY6 A;  1SXT A;  1AFP A;  2EZV A;  2B2V C;  5KYL A;  3HOW B;  3NWT A;  2KHS A;  1KAA A;  1PTO B;  2DNC A;  4IUQ A;  2CW0 C;  1A15 A;  1STG A;  3VYT A;  2EE1 A;  2BDN A;  3VR2 A;  1QNU A;  2F0F A;  3SK6 A;  3BG3 A;  4RWS C;  1BCP F;  2K5W A;  1SNC A;  3C1F A;  5D3D A;  3IFT A;  4ZRZ A;  5FLX E;  3H91 A;  2F0O A;  2RVL A;  2O4X A;  1XX8 A;  1DYQ A;  3I3C A;  1TWA B;  3TSS A;  3KBG A;  4OIJ A;  1EY0 A;  3N6R A;  2SNS A;  2L4N A;  1TS4 A;  1LTT D;  1DJR D;  3X3N A;  3OSO A;  3T53 B;  2JEB I;  1IL8 A;  1V43 A;  5CBE E;  3VR5 A;  2V4D A;  2EYH A;  2XVS A;  3PUX A;  3NP8 A;  4HED A;  2ENB A;  2F0U A;  3PIO 3;  2PMZ B;  1D1I A;  2NN6 I;  4QCL A;  4J1M A;  3Q23 A;  1QNK A;  3Q24 A;  1Q90 A;  4I7Z C;  4C3I G;  2G9H D;  3GTL B;  2KCC A;  4C3J G;  5BN4 A;  1M4V A;  1SYB A;  3L3O C;  2LFN A;  3K5O A;  5C3W A;  2D2C C;  1LT5 D;  5EKI A;  1MI2 A;  3AMU A;  1WTO A;  3HGB A;  2RKS A;  4ODG A;  2K03 A;  3A7A B;  4Y7N B;  1S5B D;  5IGF A;  2BA0 A;  5I6W A;  1KLU D;  2AQ2 B;  1D5M C;  4HMI A;  1STE A;  2IJ0 A;  4RGT A;  5C0X J;  1DXM A;  2PCF B;  2WV6 D;  1Y1W B;  1PZI D;  4K5X A;  5J22 A;  2KEC A;  4HSV A;  1B53 A;  4LJZ C;  2LMC B;  4NP5 A;  4XXE A;  4RCN A;  3TN2 A;  4XT1 B;  3E5S A;  1YNN C;  1H9S B;  5I4D A;  1EY7 A;  1NAP A;  2J4X A;  1I4P A;  1E0B A;  4HTH A;  2NVY B;  4B9W A;  4CJ0 B;  3NPP A;  1TWC B;  1K8M A;  2RDG A;  1STB A;  2KOL A;  5EGT A;  2DN8 A;  2KJX A;  1BNZ A;  4HR7 B;  3P20 A;  5A2Q E;  2EYO A;  1PFN A;  2B2W A;  3M4O B;  3S15 B;  3VA5 A;  1NCV A;  1BCP B;  4F8M A;  5FO9 B;  1IHZ A;  5TSS A;  2L0C A;  3OWF A;  1PTO H;  4OL7 A;  1O7L A;  1RDP D;  4HMJ A;  2H1E A;  4A93 B;  1R9T B;  4HN7 A;  2KUM A;  2EYL A;  2Z4H A;  3I72 A;  1BR9 A;  1SMY C;  4FF4 A;  1XXG A;  2E2D C;  5CGK A;  3E0J A;  3FDT A;  1RTO A;  2Q8I B;  1JIC A;  3SK8 A;  1DOL A;  2D5D A;  1S5F D;  2ID0 A;  1DCZ A;  2E74 C;  3GTP B;  4S3S A;  4R8N A;  3IKJ A;  5EKK A;  3SE0 A;  1EU3 A;  2G9D A;  4XQN A;  1F2M A;  5J39 A;  1SYC A;  5IGD A;  1WTV A;  3S17 B;  1V8Q A;  2WKD A;  4IFD H;  1A2T A;  2H4O A;  3A7L A;  2F3W A;  2R6G A;  4QIW B;  3OW7 A;  3EQL C;  2A68 D;  1TS5 A;  3NE5 B;  4ZAI A;  2B39 A;  4DXF A;  2EOT A;  4G57 A;  4FXK C;  4RAU C;  2F0M A;  1HCZ A;  2F0L A;  3QOL A;  2K28 A;  5EPL A;  1ZEQ X;  4XDX A;  1ONL A;  4BBR B;  4BY1 B;  3VA7 A;  1HA6 A;  5I2X A;  2EJF C;  3FPP A;  4X3S A;  1GUS A;  4XYQ A;  3P75 A;  5CV6 A;  1B50 A;  3HOY B;  3HOX B;  1TWH B;  2F0P A;  4WJW A;  1SE2 A;  1YNJ D;  5JVG 3;  4KN7 C;  1ESF A;  3ZYY X;  2A69 C;  4HCS A;  3BVZ A;  5DM7 3;  3H09 A;  2B2T C;  3SHL A;  3PIP 3;  3BZD B;  1A3V A;  1OO9 B;  5EQ0 A;  2B2Y C;  1F2Y A;  3HZX A;  3NBH A;  3D8G A;  3NTH A;  2F0V A;  2RDF A;  2IL8 A;  1VF5 C;  2DY7 A;  4IUP A;  3M85 A;  1G91 A;  1CM9 A;  4IUU A;  1SEB D;  4KK7 A;  4G7O C;  4N9P A;  4QMG A;  3VYR A;  2JA8 B;  4KKS A;  1PFB A;  5A35 A;  1SNQ A;  3I4M B;  5CYU A;  3GQB A;  5JEA H;  1AP0 A;  2HCC A;  1LAC A;  1X3P A;  3TP7 A;  3DXJ C;  3MC0 B;  1MD2 D;  1L0Y B;  3J7A F;  1QG7 A;  1ML0 D;  4FNF A;  4KHZ A;  4FXG C;  3GO5 A;  2SOB A;  1SFO B;  5C4X B;  1A2U A;  1BO0 A;  2AWN A;  1TY0 A;  5F2D A;  3MXP A;  4DAP A;  2PO4 A;  2K05 A;  1LV9 A;  4ZQ3 A;  2MPM A;  1RD9 D;  1HUN A;  4KKU A;  3I73 A;  3ITP A;  4JK1 C;  4KTA A;  4ZLT F;  1HTP A;  1HQR D;  3RZD B;  4FF3 A;  4TRD A;  4OIK A;  4KHV A;  2XNA C;  3DUZ A;  4EVO A;  2LS0 1;  3CU7 A;  4ILW A;  4ZKC B;  3WOE A;  1ZYR D;  2I46 A;  2IT1 A;  5DEH A;  2ICE C;  1QIL A;  3V05 A;  4LAA A;  3ERO A;  3SEB A;  4K14 A;  2B8F A;  2MGS A;  2B2U A;  3MXN A;  1JOR A;  1JWS D;  1U9R A;  2K7V A;  1B9M A;  1IKM A;  5EPK A;  1ZKO A;  4Q0F A;  1ET6 A;  5IGB A;  1L0X B;  4E6I A;  3FPU B;  3S14 B;  1DON A;  3GTQ B;  3LWE A;  4A3B B;  1EIG A;  5LHY 1;  5K36 H;  2C5C A;  5LL6 S;  2RA4 A;  4M8A A;  4FF2 A;  2WAC A;  2NBF A;  2KA7 A;  1EY9 A;  1STH A;  1IW7 C;  1FYC A;  1SYG A;  3SR1 A;  2A6H C;  1QB5 D;  1EYA A;  3OIP A;  1BDO A;  1LT3 D;  1I4Q A;  4L8J A;  2PW7 A;  4NKL A;  4K2K A;  5D65 A;  5M3M B;  1GUO A;  4C1N K;  4EQP A;  4A3F B;  5KGU A;  4KMU C;  2IX3 A;  3I4L A;  4F87 A;  3P1H A;  1IYV A;  4K8I A;  1PFM A;  1EU4 A;  2KCN A;  4OO1 H;  1F77 A;  4FVM A;  1QCB D;  3TBI B;  1RHP A;  5E3F A;  3GTK B;  1ROD A;  1G2T A;  1WVL A;  3KK7 A;  1ET9 A;  1TY2 A;  1E2W A;  2M2L A;  1HPC A;  3IL8 A;  1EY8 A;  3PUV A;  2A74 C;  3MXG A;  5JEA G;  3IFD A;  1LT4 D;  1B9N A;  3S1R B;  4KJN A;  2MHV A;  4XIG S;  3EJI A;  5EPJ A;  4EQO A;  1CFM A;  5CV5 A;  1QE6 A;  5CV4 A;  3KLS A;  2DNE A;  2X6G A;  2R92 B;  4ZUI A;  4BWG B;  3PO2 B;  1EEF D;  2J7Z A;  1F9S A;  1CHQ D;  3DWP A;  5FO7 B;  2JEA I;  4PMW A;  1PTO D;  3K59 A;  3AB9 A;  4MHE A;  3OWE B;  1XTC D;  3BVM A;  1EQT A;  1LTG D;  4IFD I;  1EL0 A;  3QOJ A;  1SSO A;  4L63 B;  1RCV D;  1T5X D;  1V1P B;  4DGZ A;  3S1M B;  3QO2 A;  5G3L D;  1XYI A;  3K6O A;  4DA2 A;  2KVM A;  1TS3 A;  3M4Y A;  4HCE A;  3KBX A;  2NZ1 D;  5CBA E;  4PNY A;  3S1Q B;  3ONA B;  1UEA B;  3C46 A;  5I9P A;  1JWU D;  1WTQ A;  4PMB A;  3Q6S A;  5HUR A;  3BVG A;  1RTN A;  1LTR D;  2XIW A;  3VR3 A;  1PZK D;  3OMC A;  5C6A A;  1SAP A;  3TP5 A;  3PMF A;  5M9O A;  1HQM C;  1SJE D;  3DWQ A;  3S16 B;  3NSW A;  2BDO A;  1H9J A;  4CJ1 B;  1KDC A;  2RSN A;  2J0T D;  1CT1 D;  1G8Z D;  1BF4 A;  2F0J A;  1MSH A;  1U4P A;  2QEJ C;  3MZ5 A;  5IIF A;  3A8I E;  5K36 G;  3NQI A;  3SXH A;  2CHB D;  1A3U A;  2E76 C;  4BBS B;  1R4Q B;  3V2T A;  5T1I A;  1GXD C;  1KDA A;  2M9V A;  1CZG A;  2K1B A;  4GZY C;  2L1B A;  2OEO A;  5HGT A;  4H13 C;  1SDF A;  3HP3 A;  4IN3 A;  3LWU A;  3DM1 A;  1WCM B;  3NQT A;  2CW0 D;  4EQN A;  1F9R A;  3BDL A;  1SYF A;  1MSG A;  5CC4 A;  4OGQ C;  2GA4 B;  1GHJ A;  4OO1 G;  1SNO A;  3GV6 A;  4KN4 C;  1LTB D;  3TZD A;  2AUK A;  1EWH A;  4IUV A;  2Z4I A;  4RHR A;  4FYD A;  2FHT A;  1GHK A;  4HSP A;  5C5M A;  4RGN A;  1IKL A;  1H9K A;  1QJO A;  1JOK A;  3OIQ A;  3L7Z C;  1BOS A;  1JC7 A;  5M5X B;  1GOZ A;  3T13 A;  5I6Y A;  2F0I A;  4DF7 A;  3FVQ A;  1PRT C;  1FD7 D;  5C0X G;  1ILP A;  3GTG B;  1X3Q A;  2Q8R E;  2WII B;  1EZ6 A;  3M7N A;  1SBB B;  1Y8N B;  1RKN A;  4DNT B;  2PQE A;  3D6W A;  2NTT A;  2K5D A;  3HEJ A;  2E2H B;  1UUP A;  2F0S A;  2KQ3 A;  1I4H A;  4BA1 I;  4U68 A;  2B2W C;  3F2U A;  1BCP D;  1PXU A;  3URY A;  1CQF A;  3EFX D;  4UDU C;  1U4L A;  2AQ3 B;  2PPB C;  2MJ8 A;  5KIX A;  2SNM A;  5FK9 C;  4WRD A;  1I3Q B;  5C4J B;  2YYZ A;  1J8I A;  1ENA A;  5IT9 L;  4M1U B;  3KLS X;  3PV0 A;  1II3 A;  3TME A;  2PZU A;  4O42 A;  3J7A V;  1AZQ A;  4MIU A;  2RDH A;  2F0T A;  1TS2 A;  1LTS D;  1R4P B;  4X3K A;  1NSN S;  1CHP D;  4FXD A;  5LL6 X;  5JPN C;  2ZXO A;  3W2D A;  3D4W A;  3MEH A;  3CRK C;  1X32 A;  3KLR A;  1RJT A;  1LT6 D;  1STA A;  3H0G B;  1E2Z A;  4C3I B;  2K5Q A;  2FMC A;  4ABN A;  4ULL A;  2AQ1 B;  1YNN D;  3PUW A;  2KEE A;  2L5T A;  3D4R A;  1KNA A;  2CVR A;  3P7J A;  1GJX A;  2E75 C;  1TQO A;  4WOR A;  3EVQ A;  2B2T A;  2FMM A;  3U9S A;  2QCP X;  2A6E C;  3OMG A;  4DFA A;  1JWM D;  2CQA A;  1DOK A;  2F0E A;  4RH6 A;  2F0H A;  2F0D A;  2K32 A;  2PZT A;  4C3H B;  5KNB A;  2EYP A;  4ID6 A;  3CQZ B;  4OO1 I;  4A3G B;  1O7Y A;  3Q22 A;  1SND A;  2PW5 A;  5IGG A;  5E4W C;  2PNR C;  3DEP A;  3U9O A;  2JYO A;  3C1E A;  5CR3 A;  3J81 L;  2RSO A;  3GP7 A;  1SJH D;  5C5L A;  3R8B A;  3J80 L;  1XWE A;  3AU7 A;  1QOH A;  5I2Y A;  3HKZ B;  1EIH A;  2LY7 A;  1I4G A;  1EYD A;  4CGY B;  2N88 A;  1FGB D;  2X6L A;  4K8J A;  2EXZ A;  2ZT9 C;  5IGC A;  1PZJ D;  1B44 D;  4QUF A;  2K33 A;  5ISR A;  1O7Z A;  2HUG A;  3NWS A;  5JPM C;  4A3M B;  3S2D B;  1EYC A;  2QDB A;  2NVQ B;  2PZW A;  5KNC A;  3HOV B;  2IX1 A;  4IFD J;  1I6V C;  1Q3L A;  4G7H C;  3LX0 A;  4QF4 A;  4PV1 C;  2OF1 A;  4IUT A;  1NUC A;  2SEB D;  4H7B A;  5E4X A;  1EOT A;  4F7X A;  1PYW D;  2ICI A;  1D1K A;  3DHQ A;  1TVX A;  3R93 A;  1IYU A;  1TKW B;  5KEE A;  3MA2 B;  2IWH A;  2JA6 B;  1CA6 A;  4L6T B;  3ND9 A;  1B1Z A;  2JXM B;  3SK5 A;  3JAM L;  1J9O A;  3NTI A;  2TMP A;  2MUY A;  2BE5 C;  3LNN A;  4I65 A;  2XSC A;  5K5P A;  1DZ1 A;  1G29 1;  4OHJ A;  2A69 D;  4CJ2 C;  4C56 C;  2R61 A;  4V0B A;  1D6E C;  1PDQ A;  2BCO A;  3WDN A;  4C1N I;  1GUT A;  1F9P A;  2K6A A;  5T1G A;  5KYI A;  1H9M A;  1JR0 D;  1CI3 M;  2YU9 B;  2A73 B;  1Y69 U;  4RKB A;  1BQQ T;  5JAV A;  1I4R A;  3I91 A;  3MHB A;  3SK4 A;  2RQX A;  1JB3 A;  2F4I A;  3QJY A;  5COY A;  4HAE A;  2EY6 A;  1Y8O B;  3OPO A;  3PO3 B;  5JVH 3;  4ZYS A;  3R3O A;  2O2L D;  3PUZ A;  1NR2 A;  2B2U C;  2F3V A;  3FEW X;  1ENF A;  1EQV A;  2XWB B;  4KV6 A;  1Y1V B;  1CZW A;  2IX0 A;  4MN3 A;  2VB2 X;  4LMQ D;  4U67 3;  5JEA J;  3D3R A;  1CA5 A;  1KAB A;  5ELC A;  4F88 A;  1EZ8 A;  1HFG A;  4KY7 A;  2VXW A;  1HHV A;  4Z9C B;  4DAY A;  3D4D A;  5DM6 3;  3UI2 A;  3CKI B;  3K5M A;  2F0Q A;  2EPB A;  1ZXT A;  4KJO A;  3GTO B;  1LAB A;  5DNF A;  5KND A;  1VDZ A;  4NMZ A;  1HTL D;  2B2V A;  3H94 A;  1KDB A;  2EYM A;  3L9A X;  2ZXP A;  1GUG A;  3BYT B;  5D3I B;  1EY4 A;  3MVV A;  5C3E B;  1KTK A;  4CKC A;  3VYU A;  4X3U A;  4BY7 B;  5C0X H;  5CV7 A;  3NXW A;  5M3F B;  4BS9 A;  3NHH A;  1CK1 A;  4FP5 D;  5FLX L;  1JE4 A;  1LLR D;  1AW7 A;  4RA8 A;  1H9S A;  2R3Z A;  5DAU A;  4PMC A;  1VMP A;  4DU9 A;  1SYD A;  5NUC A;  5IOC A;  1BBX C;  1I50 B;  2QF7 A;  5JJZ A;  1FR3 A;  1G2S A;  3IAY A;  4BA2 I;  1F2L A;  4EGV A;  4XQQ A;  1LO5 D;  5ELF A;  4DK0 A;  1IW7 D;  3TDQ A;  3V96 A;  2EVB A;  1I6H B;  4JBW A;  3A56 A;  3S2H B;  2F0K A;  2A6H D;  4R9W A;  1TT2 A;  2K01 A;  1ILQ A;  2OXP A;  2RBM A;  5BN5 A;  5C4Z A;  2JP1 A;  1B3A A;  4YIJ A;  1JOQ A;  3K5L A;  1Q1E A;  2NVX B;  2MP1 A;  2WKC A;  3CHB D;  3M7G A;  3VYS A;  1AEX A;  1VMC A;  4H44 C;  5M5W B;  2XRS D;  5EBC A;  2M00 A;  3C2P A;  1BCP C;  4DXG A;  4A3J B;  3G6J B;  3NUC A;  1PRT F;  3TP6 A;  2OT2 A;  3K5N A;  1D5X C;  2EY1 A;  2E2J B;  3HOZ B;  3RMH A;  1G6Z A;  2WB1 B;  5KRU A;  1W6J A;  2JA7 B;  1AN8 A;  4ME5 A;  3OOC A;  3QWN A;  1HXY D;  3WOF A;  1W6K A;  4XYO A;  4KD3 A;  4C3H G;  1Z7T A;  1EY5 A;  1LTA D;  2F0G A;  3HG9 A;  5M5Y B;  4CHT B;  2A68 C;  4B9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...