3CRKC

Crystal structure of the pdhk2-l2 complex.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
87
structure length
86
Chain Sequence
SYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pyruvate dehydrogenase [lipoamide] kinase isozyme 2, mitocho
publication title Structural and functional insights into the molecular mechanisms responsible for the regulation of pyruvate dehydrogenase kinase 2.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 12
structure length 86
sequence length 87
chains with identical sequence D
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2008-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3crkC00
1HTPA 3HGBA 2JEAI 1K8OA 1Q90A 3U9SA 1HCZA 2A68D 1IYVA 3A8KE 1DXMA 2E76C 3QIAA 1OXXK 4KKSA 4L8JA 1OXTA 2BE5D 3M4YA 3PUVA 5C0XG 2AUKA 2E75C 1H9MA 3VR3A 1E2ZA 1Q1BA 3QJYA 2D62A 3IKJA 5K36G 3FMCA 3WDNA 3EQLC 4DK1A 4JK1C 3DXJC 5JEAG 3PUZA 3RLFA 1Y8OB 2BA0A 3M85A 4BA1I 1BDOA 5BN5A 1SMYC 1YNJC 5KNDA 1H9SA 2L5TA 1HQMC 1FYCA 1GUNA 3PUXA 5BN3A 2QF7A 3MFYA 2JXMB 1VF5C 2O5JC 1OXSC 3CRLC 1B9NA 4DNRB 1K8MA 1O78A 3GQBA 4DNTB 4H44C 1OXUA 1ZKOA 1Z6HA 1HPCA 1TKWB 4HR7B 1H9JA 3PUWA 3SE0A 4KN7C 5JEAH 3CRKC 2AWOA 2ZT9C 1GUGA 1CTMA 1O7LA 2BDOA 2DN8A 3A7AB 3I72A 1QJOA 3ND9A 2A6ED 2NN6I 1LABA 2A6HD 3MXUA 4KN4C 1Q1EA 4I7ZC 2DNEA 3M7NA 1H9RA 4H13C 1DCZA 2E74C 2PCFB 1FR3A 2KCCA 3PUYA 3SDZA 2EJFC 1IW7C 3A8IE 1PMRA 4KKTA 4PV1C 3VR5A 3H94A 4G7OC 1GHKA 3I4LA 1T5EA 1IYUA 1Y69U 1OXVA 5KNCA 1GUSA 2PPBC 4JBWA 4OO1H 1Y8NB 2Q8IB 1I6VC 4KI0A 1GUTA 1ONLA 4G7ZC 1GHJA 2JEBI 3L7ZC 3GD7A 4IQZA 1CFMA 2EJMA 4KKUA 3BG3A 1VDZA 3FPPA 5BN4A 4LK1C 3T51B 2NN6H 3TZUA 4OO1G 2K7VA 1TU2B 2A69C 2D5DA 1Q12A 2EJGC 2F1MA 2JE6I 3VR6A 3VR4A 2B8GA 4DK0A 1YNNC 2KA7A 1Y8PB 4IFDG 1E2VA 2DNCA 3VR2A 1GJXA 3I73A 2O5IC 1H9KA 3QG1A 4G7HC 2K32A 2NN6G 3D31A 1A6XA 2LMCB 3P20A 4RCNA 1VCIA 2A69D 2K33A 3A8JE 2AUJD 3VA7A 1EWHA 3AB9A 3IFTA 1ZYRC 2IT1A 1LACA 3LNNA 4TQUS 1CI3M 3W3AA 4IFDH 2B8FA 3LWUA 1IW7D 4XTCS 2D2CC 3OW7A 2YYZA 1B9MA 4LJZC 3T56B 3N6RA 1V8QA 4OGQC 1GUOA 2PNRC 4XIGS 1V43A 1G291 4KHZA 1VF7A 3BDOA 1H9SB 1DD2A 3NE5B 4TKOB 2A68C 2CW0C 5A35A 3PV0A 3OPOA 3KLRA 2BE5C 2A6EC 1Z7TA 3A7LA 2A6HC 4GZYC 2V4DA 3D4RA 3ND8A 4H0LC 2EVBA 3T53B 1E2WA 5C0XH 4BA2I 3OOCA 2R6GA 5KNBA 4KMUC 2EDGA 5K36H 2BA1A
chains in the Genus database with same CATH superfamily
3HGBA 4DF7A 2Q8TA 2NTTA 2MUYA 3G6JB 3H0GG 1TT2A 3S15B 3U58A 2E75C 1Q1BA 3QJYA 1RHPA 5IGCA 2I5LX 1TWAB 1RIPA 3GTLH 3J81L 3S14B 4A3FG 3EN2A 1UWVA 3MAQA 4L63B 4F87A 5CGKA 1JOKA 4DR5Q 1XMOQ 2GVAA 4YCVA 3D8GA 1G6PA 1MSHA 4KN4C 3VYRA 4Q0FA 1NAPA 4J8QA 2Z1CA 3SK5A 1NCVA 4PZ8A 4PQXA 1F2YA 2L4NA 4P73A 5IP9H 2PYKA 1MGSA 4IPHA 2K5WA 3ITPA 5DLQE 2KECA 1TWHH 3AEVA 2K4KA 5JVG3 3EA6A 4BS9A 2JEBI 2BCOA 1JT8A 2KBNA 5ELFA 3E0JA 3RN2A 2F0PA 4JPBW 1XNRL 3GTPB 5IYCG 1I4PA 1Q12A 4LF7Q 2Z4HA 4WRDA 1PHJA 2NB0A 3M4OH 1IL8A 2XWJB 5C3EB 3GTMH 4LMQD 4RCNA 4B08A 1SYEA 3EBEA 2K33A 1X3QA 3SK4A 1LTTD 1PZID 3BYYB 4Z9CB 4DR7L 1XPOA 5M3MH 1NUCA 1BOSA 4K5VA 2L9HA 2F0QA 3K7AH 4DUZL 4LNQA 4QIWB 3JAME 2HCIA 2Y0SG 5D3DA 1SFOB 1C0AA 2WAQE 1S5FD 1SYGA 1RF2D 1A15A 3PO3H 3RZDB 1YJWA 4K0KL 4WJ4A 1TS3A 3K58A 3NE5B 4TKOB 4LF5Q 4NXMQ 3F2UA 1EY5A 1KRTA 3HOZH 1KDAA 3FHWA 4QB4A 2BE5C 1Z7TA 4A3BG 3TREA 1X54A 5JJLA 2E2IB 2VUMH 4DR1L 1PFBA 3HEJA 2KCMA 4GS3A 1U4LA 2NBFA 5C5MA 2F0FA 2XIWA 4PZ6A 1OXXK 1SDFA 1CKMA 1BNZA 4GOPB 3S9WA 2LKVA 1HNWQ 2LXKA 4E6IA 3FMCA 5IT9L 4I65A 3KLWA 4JK1C 4IUQA 3T13A 1Y8OB 4BA1I 1BDOA 2JSOA 3QOJA 1YNJC 3F8TA 1H9SA 3I4OA 1ZEQX 4G57A 4HTHA 3R93A 2RHQB 3LX0A 2HDMA 4AYBG 1TWCB 4DAVA 2EY2A 2E8GA 5IP7H 1WI5A 2MFIA 3ULJA 5M3FG 2EYHA 1FNUA 3PF5A 3I8ZA 3BVZA 3PUWA 4DR2Q 3HOWG 3KYHC 4KK7A 1STAA 3STBC 3VYTA 2CCZA 3CPWA 2DY8A 4A3CG 4R4IA 4LFAL 4NB3A 2LY7A 3T1YQ 3A56A 4IPGA 4DUYL 1VQ8A 1X65A 1HNXQ 5KNCA 4JV5L 2YTYA 3S2DH 2Q8IB 1WCMG 1A0IA 4C2MH 1DONA 2CWAA 3FEWX 1WYDA 3OYYA 3BG3A 1O7YA 2EYMA 3CPFA 4EQNA 4PMBA 4KV6A 4X65Q 5E3FA 4I7AA 1MD2D 2K7VA 1S4ZA 1KTKA 1PTOH 3VR6A 1W2BA 4BBSG 3TP7A 1K73C 2EY5A 3HOUG 1MIUA 4UP9A 1J5EL 2F4VQ 5EPLA 1STYA 2NUCA 2GVBA 2OXPA 1YHBA 1HA6A 1M8AA 1YNND 3CW2C 2M00A 1GUWA 4YY3L 3VA5A 4HIMA 2DGYA 2B63B 1KNEA 1SYDA 1VS0A 4O1NA 4DKAC 2K5QA 2B2VC 5LL6S 2RHSB 3IRBA 3JAMi 1N32Q 3U4ZA 2CH4W 5F2DA 2TSSA 1B3AA 3X3MA 1V43A 2LSSA 2RDFA 3O13A 1G291 3HKZB 3C46A 3BVGA 2KCNA 1VF7A 3D4DA 1VMCA 2MQHA 1D7QA 1BCPD 4WJWA 4A3IB 3HOYH 5BR8Q 5A35A 4GNXA 2H4OA 2CHBD 3PMFA 5EBDA 1AH9A 2VW9A 1EYDA 1KNAA 4A3GH 4NP5A 4DR5L 1Z9FA 1L1OA 1XMOL 5ISRA 2VL6A 1DXMA 3UE1A 4L8JA 4BY7G 1IZ6A 2AUKA 4RWSC 3GTQH 2Y0SE 1A3UA 2DUDA 5C4XG 1R4PB 4JC0A 2KQ3A 4A3KB 2HQEA 1GUNA 5FOBB 1JB7A 2JXMB 3BS1A 4C3IG 2NZHA 1WTWA 2CQOA 1PRTB 1I4XA 2NVTH 1V1OA 2KVMA 3MTSA 2MGSA 4HR7B 5TSSA 4FXKC 3CCMA 5IGEA 4LF7L 1IBKQ 1A3TA 1KAAA 1HFNA 1M4VA 2SNMA 2Q2UA 3RZOB 1Q1EA 3RN5A 1S40A 4HJAA 1LM0A 2X6LA 2VY3A 1PH4A 3CC2A 4F8MA 3A8IE 4M1UB 3GTOB 1T5EA 1IYUA 5KGUA 2HT1A 4ODGA 5IGFA 2NVYH 1PH6A 1QUQB 3PCOB 4AYBE 5KEEA 1SNPA 2F0KA 2XTIA 3HOVH 1I3QH 4A3DH 4CGYB 3I4MB 2ICIA 3GTKH 2CVRA 3LWEA 3OWEB 5K5PA 3VR4A 2MJ8A 2UXBQ 3CXCA 4K2LA 5EGTA 1YJNA 4LF5L 4NXML 3KF8A 3ONAB 1LTGD 2YTXA 1B44D 2E2JH 4JI7Q 4C1NK 4L5SA 4QQBX 1PH2A 5CV6A 2N55A 4LFBQ 2ZJQA 3U50C 1UEAB 4JG2A 2HIVA 4WJ3M 2IW3A 3MXNA 1MJEA 4QUFA 2VNUD 4TQUS 3W3AA 2NVQB 2F0MA 2D9UA 5IY0A 4X6AH 4JI0Q 4DAPA 1MJCA 3S1RH 2K01A 1HNWL 3I4NH 4FF4A 5CV5A 2YV5A 5FO9B 1JB3A 5FLXE 2IPKD 1RL2A 4WORA 4BBRH 3TRZA 1QNUA 2IX1A 3P7JA 1G6ZA 3HKSA 3I3CA 3KLRA 2H1EA 2Z6KC 5E4XA 5LL6X 3NP8A 2EVBA 1AZPA 4BY1G 4BA2I 4A3JH 2BA1A 5KRUA 1Q90A 3M4QA 3Q0AA 5IGDA 1TY2A 2IWHA 4UP7A 1HHVA 3T1YL 2D62A 3TQYA 2KENA 5CORA 1SSOA 2CKZB 2GN5A 1HNXL 1K3BC 3CU7A 5EKIA 1PH5A 1F2MA 1ZXTA 1R9TB 3J80i 5CV4A 1ZKOA 1HPCA 4X65L 1SBBB 1I5FA 2R7FA 1CTMA 2WIIB 1HFGA 2JA8H 5NUCA 4C1NI 2F0LA 2F4VL 1QVCA 1IW7C 2B3GA 4C3HB 5J3BA 3I7FA 4Y52H 1RTNA 1GXDC 3DM3A 4DXFA 3I55A 1PH1A 1G91A 1C8CA 1PZKD 3L7ZC 1CFMA 1N32L 3KDFA 2A69C 2EJGC 3F1ZA 2YTVA 3DWQA 4EQOA 1E0BA 2DNCA 5E7NA 3I73A 4IURA 4DU9A 2IY5B 1EY9A 5I9PA 5BR8L 2RQXA 2NN6G 1BBXC 3S15H 1CT1D 3FKIG 3TP8A 2F0UA 2FFKB 2I46A 4GN5A 4QGUA 4ZRZA 1TWAH 3PO2B 4KJNA 1TS2A 1ESFA 3PF4A 1BBUA 1P16A 2FXQA 4IOAA 2WFWA 3S14H 4CDEC 1V8QA 1SR3A 4KY7A 4AQYQ 2BDNA 1FD7D 1SJHD 3BDOA 1W3SA 4L5TA 2ZXOA 4RHSA 4KHPQ 1QILA 4ZYSA 5IODA 2Z0SA 1VQHA 1ASYA 3NTIA 2ATWA 4LW1A 2RCNA 4RAUC 1F77A 2R6GA 4KMUC 4DV3Q 4R8NA 1HTPA 3J7AV 1IBKL 4R4QA 4HJ7A 1NMFA 3J7AF 2QEXA 1AE3A 4O42A 1B50A 3ICEA 1E24A 5I4DA 1PXUA 4LF9Q 5JOBA 5IYBH 4L6TB 2K04A 3MVVA 1EUJA 3GTPH 1JWMD 1HZ9A 2K52A 4OIJA 2KCTA 3SEBA 2L5TA 5J39A 1VF5C 4JI1Q 3L0OA 5C3EH 2F0HA 3EFXD 3CMEA 1X3PA 1OXUA 1P8LA 1V9PA 4EGVA 1TWGB 1QE6A 3AU7A 3R3OA 3J81j 3MEHA 2UXBL 1Y1VG 2BDOA 4DUZQ 3HG9A 1GVPA 2KHIA 5M5XB 1PTOD 1Z47A 3J7YW 1UE7A 2K75A 3L3OC 4JI7L 4X3KA 1E1OA 2EQSA 4LFBL 5J22A 1SFOH 3S17H 3MZ5A 1HXYD 1S3OA 4N8X1 3RZDH 1KLGD 2JA7G 2F0WA 5JAVA 2UUAQ 3A5ZB 1NMGA 4PZ7A 3RD4A 1DGSA 4KKUA 4AYBB 4JI0L 3JAMc 3W2DA 2F0SA 5DM73 1SJED 4WFN3 3TZUA 5M3FB 1K0SA 5M3MG 2E2IH 2L1BA 2KA7A 1B3QA 3HOWB 4GNXC 5GAEC 1QG7A 2C35B 3P20A 1VCIA 3JC66 3PO3G 1LYLA 2R61A 4QY7A 2A74C 3URYA 1ZYRC 1L1OC 3H09A 1C4QA 3QWNA 4J1MA 3HOZG 1L0YB 5M5WB 1TWCH 5EPJA 2N88A 4JOIA 5ELBA 3TN2A 5KIXA 1JR0D 4CDDC 2Z8LA 4MHEA 4U68A 4DGZA 1LUZA 1DD2A 5FLMH 5FJ8H 2G9DA 4JBMA 3DM1A 5ELOA 1EWIA 3NENA 1I4GA 2QKIC 2RDHA 3KLSA 2MO1A 5H1SE 1FNWA 5IP7G 1LT4D 2JJQA 4A93B 2XN9C 3NQTA 4ZLTF 3KBGA 1DYQA 1WOCA 2AHOB 3K59A 1V1PB 2QILA 3RLFA 4H7BA 4YCUA 1SEBD 5BN5A 2EE1A 1CZGA 1FYCA 1RDPD 3KF6A 2JA6G 2SEBD 4X66Q 2EYPA 3G4SA 1YEZA 1G51A 4PMCA 2N3SA 4K5WA 1O7LA 4KD4A 2B63H 2A6HD 1B2TA 2UUBQ 2E74C 2NTSA 1UEBA 4EQPA 1X9NA 4HSPA 1EY8A 2WKCA 1KD1C 1EOVA 4PG3A 3VR5A 1SYBA 5G3LD 1SAPA 1VQOA 4P2CB 2B2UC 1HR0W 1C9OA 2AMCB 4A3IH 3GD7A 3S2HB 1EY4A 5A2QE 4C3IB 1N9WA 1HA5A 3SXHA 2PZWA 4RHRA 3K5MA 4AQYL 2O4XA 2ZXPA 3NXWA 2QGQA 3UI2A 4C3JG 5JVH3 5COYA 3F2CA 4B3RL 2IJ0A 3HOXB 2D0PA 5C44G 1C48A 3GTGB 1GM5A 3TMEA 4KHPL 4NPSA 4P71A 1VQMA 1RTOA 2OF1A 1II3A 3K57A 2DJGC 4DV3L 1F9QA 2K5DA 3OHXC 5CBEE 1BUVT 4FYDA 4A3KH 4K5XA 3N52A 1CHPD 3FP9A 3NTKA 5C4HA 1PYWD 1VQPA 4LF9L 2A8VA 5EJWA 5DNFA 1PH8A 2I0QA 4A3GG 2PNRC 4N8FA 2ZM6L 2YU9B 4LF8Q 1K3RA 1YI2A 2C5CA 4A3EB 4HIDA 2R93B 1BO0A 1O7ZA 1PFNA 4NXNQ 4DK3C 4JI1L 1SXTA 4P75A 3OTOQ 4MIUA 4JI5Q 1L0WA 1QOHA 3T1HQ 3UDXA 4B9XA 1WTPA 3GTOH 3CCEA 1W6JA 1D1IA 4R4TA 5ELCA 3J7A5 3AYHB 1OXTA 3M4YA 1WD1A 4LF4Q 1E2ZA 4ZAIA 4ZQ3A 1RKNA 4V190 3I56A 3I4MH 1CKNA 3NWTA 3KFUA 5GQOA 2L55A 4B3MQ 3E5SA 1B1ZA 5JJKA 4HEDA 1XMQQ 4QJFA 2UUAL 1LV9A 2Z6BA 1UNSA 3OMCA 4DNTB 3PIO3 1DOKA 3HP3A 1NNXA 2PW5A 2I5MX 1YHAA 5JEAH 5C3WA 4B3TQ 4BY1B 5DM63 2FINB 2DN8A 3ND9A 1NBWA 4TVAB 2NVQH 5IWAQ 1MBYA 1A8VA 3PUYA 1TXYA 2F0VA 5C4JB 4YWLA 2G5DA 2XNAC 1KL9A 1VQBA 2UXDQ 1I4RA 2Z9HA 2J4XA 2IHEA 5IT9E 3MEFA 3PGZA 5LMNL 5D3IB 4G7ZC 1FVIA 4QF4A 3J81i 1DOMA 1SNMA 2B2YC 1VDZA 1IHZA 1XTDA 1D2BA 3V96A 1LLRD 4A3LH 3KBXA 3HFZB 1AEXA 3VR2A 5FLXc 1R4QB 2P5ZX 2EYJA 4H02A 3C1EA 3I4NG 1MKHA 2EXZA 3AB9A 3E9IA 3ULLA 2QDLA 2VQFQ 5GADC 1R9TH 4RFBA 2EXDA 3S1NB 3V05A 4KY5A 2NYZD 4GLAC 4YWKA 4R9WA 1D1KA 3GDEA 5CBAE 4A3JG 2Q2HA 1KIXA 2NZ1D 3Q24A 3U4VA 4IPDA 5E1FA 1HUMA 3QO2A 4DV1Q 3MXGA 4X66L 1SNOA 4ZCKA 4LUOA 5IE8A 1WTVA 1EL0A 1IXRA 3CKIB 3FKIB 2AQ1B 4C3HH 3SR1A 1LTRD 2RCFA 5CV8A 4B3SQ 2B2TA 2JEAI 1HCZA 2E76C 1E1TA 2B29A 1MI2A 2X69A 3DWPA 2UUBL 2BE5D 1EY0A 3VR3A 1C7YA 3WDNA 2LFNA 4CDCC 2OQKA 3TP5A 3BJUA 4XQQA 1SMYC 2JA8G 4N9PA 3MFYA 4KTAA 4APVA 4DXGA 4OHJA 1I50B 5AJ3Q 1UAPA 1BQQT 1YNJD 2EIFA 1FGBD 1KABA 1KAWA 2M2LA 4KN7C 3PO2H 1HUNA 1JMCA 1VQFA 4UHVA 4XXEA 4O0AA 3H3VC 2EYFA 3DEOA 1H9RA 4H13C 4DV0Q 1DCZA 1WTHA 1UE1A 1U5KA 1EIFA 4KJOA 1GHKA 1EWCA 5IIFA 1OXVA 2MNAA 1CQVA 1U4PA 1VQJA 1B7YB 3ZJYC 5IYCH 1X56A 5ELEA 4CKEA 4KI0A 3J80E 1XYIA 1YITA 2ID0A 1YIJA 4ILWA 4LK1C 1A63A 3T51B 1VQ6A 1VQLA 2RBMA 4OO1G 1WTXA 3I70A 2D5DA 4LF6Q 4LF8L 1BCPF 5EBCA 3SHLA 1BVSA 1FJGL 5E4WC 4FP5D 4NXNL 1DJRD 1Y1VB 3OTOL 4YIJA 4JI5L 2LMCB 3T1HL 4FO2A 3VA7A 3I90A 3IFTA 2L12A 1VQ5A 4B9WA 2N8NA 2XVSA 1F9RA 3QB3A 3LWUA 4XTCS 2JA7B 3CCRA 5ELDA 4LF4L 2BH2A 3H15A 4OGQC 1TWGH 1YZ6A 4LUZA 4ULLA 2K6AA 2PQAA 2JQOA 1PH9A 4OL7A 4B3ML 4KY6A 2A68C 5LHY1 4R1JA 1KRSA 1XMQL 4BXXG 1JE4A 1QCBD 3PV0A 5IYBG 4OWWB 1IYJB 3A5UA 5M5XH 1AE2A 1BBWA 4JI4Q 2R7ZB 3T4AC 2R3ZA 4CKBA 3D3RA 2O5JC 2EDGA 1SROA 5FO8B 4B3TL 3VYSA 3A8KE 2JA5B 1STBA 5JPNC 5IWAL 1I94Q 5K36G 4POFA 1XNQQ 3BDCA 2WAQB 4DA2A 1CA6A 2UXDL 5M3FH 1AZQA 5IYDH 4K8JA 2PI2A 1SNQA 5FO7B 3HOWH 1S5CD 4H44C 4OIKA 3LGJA 4A3CH 1TKWB 5GAHC 1F2LA 1GO3E 1TR5A 3CC7A 3C1FA 2K28A 2ZT9C 2PO4A 1S5ED 1Q82C 1WVLA 1LABA 3RMHA 1IBMQ 1Y1WG 5M5WH 4GLXA 4ME3A 2L15A 1JJCB 1PH7A 5ELNA 2ALYB 4RGMA 1X3GA 4N9TA 4MZ9A 3TSSA 3BDLA 3E3XA 3IAYA 4A3MH 4JI6Q 1I6VC 1TWFB 1GUTA 1ONLA 2VQFL 2QA4A 2ASBA 4DV7Q 1GD7A 3DMUA 2JA6B 5M5YB 4IFDI 1STEA 2JE6I 4FF1A 2ES2A 1JQYD 1D5MC 2OT2A 4HCSA 3S16B 2RVLA 1HZBA 1EQTA 1PRTD 4DV1L 1E7ZA 1EIYB 4XQNA 4GN3B 3H0GB 2PI2E 2DJFC 2UXCQ 3K81C 4A93H 1A6XA 3A0JA 4FF2A 3W1BA 4OWXB 2CWPA 4B3SL 2PQEA 5FLMG 1LACA 3R8BA 5FJ8G 3PIPA 1CI3M 1VQ9A 3D4WA 1FGUA 3FRPB 4A3FB 1B9MA 1U9RA 3QR8A 3N6RA 5C0XJ 3UDIA 2R92H 2PMZE 1SN8A 3TS0A 1EEFD 5C3XA 1ASZA 2A5HA 5EQ0A 1J6QA 1N36Q 4KHZA 2HHHQ 1H9SB 4JI8Q 3NTHA 4C3JB 3CAMA 3OPOA 3ER0A 4QCLA 1KC8C 4DN4M 5C44B 5AJ3L 4H0LC 1PV4A 3CRLC 1EYAA 1KDCA 3MC0B 1K8AC 4MN3A 1LTSD 3M3YB 5C0XG 4DV0L 1JOOA 3S1QB 3S2HH 4C3IH 5D65A 3NELA 3CD6A 3G7LA 4B3RQ 2B63G 3C3LA 1HQMC 4JW0A 1B9NA 1CUKA 3HOXH 3GTGH 4OXPA 1VMPA 2IX3A 4ZKCB 4G4KA 4LF6L 1KQSA 4I7ZC 4A3IG 2NN6I 2ZJRA 4GOPA 3ERQA 4FXDA 2ZM6Q 4YWMA 3TEHB 2EY1A 3KK7A 1PMRA 4G7OC 2Y0SB 4AIMA 4ZK9B 4RGTA 2H5XA 2YU9H 3BZCA 4X3UA 2J0TD 3SK8A 4A4IA 4A3EH 2R93H 2WP8J 5IP9G 2WB1G 4CDFC 1XX8A 3FPPA 3F2DA 4A3BB 2F1MA 5M9OA 2N78A 4ALPA 4ZUIA 4IPCA 5I6WA 4CJ1B 1ILPA 2JK8A 1B8AA 4XYQA 4GNXB 4IN3A 5HURA 1PFSA 1Q86C 1DZ1A 1X3FA 2A69D 2OQ0A 4K2KA 4DR3Q 4JI4L 1ET6A 2XRQD 1A2TA 1W6KA 2B2TC 2IT1A 2JP1A 1L1OB 4GKKQ 4IFDH 3CP0A 4EQ5A 2AWNA 3WWVA 4L5RC 1CM9A 1RODA 1S5BD 2B2VA 2WINB 1F9PA 4FNFA 3H91A 3K7UC 2KHSA 4X64Q 1I94L 1GUOA 3K80C 2OTLA 1XNQL 3D6WA 5JEAJ 2KEDA 1LTBD 4PNYA 2FHTA 4BY1H 3VDYA 3CCQA 1T9HA 2E5LQ 4JVZA 2UUCQ 3GV6A 1QVFA 1XXGA 4GZYC 1EU4A 1QWYA 2A6HC 5C4JH 3GO5A 4DV2Q 1CSPA 1K0RA 2Z4IA 3TDQA 2SDFA 5LMNQ 1VQIA 1PZJD 1PTOF 1WCMB 4Q5VA 1IBML 4CBVA 2VUMG 2ZTEA 2KEEA 3AFQA 1N34L 4RCOA 4LFCQ 4NW2A 4RMFA 5JEAG 3PUZA 3NQIA 5CMDA 2NVXB 4U673 1OO9B 4BBSB 3SK6A 5IT9c 4JI6L 3G71A 3HOUB 1OXSC 1HR0Q 4IZ8A 2J7ZA 4DV7L 1PFMA 1SNDA 2XWBB 2PNHA 4C56C 2N49A 3RNUA 3GP7A 2CW0D 2KOLA 4DR4Q 3CRKC 2F0IA 1GUGA 3K5LA 2A6ED 1KDBA 2RDGA 3EVQA 2UXCL 2ENBA 3KF8B 3S1NH 1SMXA 1ML0D 4DV4L 3BU2A 1EZ6A 3V2TA 4K6DA 1BXTA 2L0CA 2E2HB 2K5VA 4QL5A 3MXNB 1J9OA 2JA8B 4EX5A 4IQZA 5CV7A 2EJMA 4JI3L 1STNA 3W1GA 2NN6H 2BH8A 4IUVA 1JWSD 3FKIH 1D5XC 1PVOA 1EQVA 1N36L 2HHHL 1NTGA 2HCCA 4R4CA 3EJIA 4JI8L 4HSVA 3KJPA 1EEID 1V1QA 1IL2A 4BY7B 1ILQA 4DNIA 4HN7A 3D31A 4R4OA 1QZHA 2K50A 3A55A 5C4XB 3UE0A 4P72A 4DV6Q 1CHQD 1QUQA 3J81E 2V1CC 1STHA 2L11A 4HIKA 2JA9A 2YYZA 1PYBA 2Q2IA 1X6OA 2WB1E 4LJZC 3T56B 4HJ9A 4JYAQ 4C3HG 4IO9A 1I50H 2PMZB 3PIOA 1ZYRD 2ZTDA 1K83B 1LTID 4XYOA 4J6HA 5A2QL 4ME5A 1J8IA 4ID6A 1ICWA 1I6HB 1PDQA 3DEPA 5HY6A 3ND8A 2F0JA 3D4RA 2Z6KA 2VQEQ 1NSNS 4DV5L 1E2WA 1EIGA 4XDXA 4R8IA 5KNBA 2F3VA 3HOYG 2X6GA 5JJZA 3U9SA 3QIAA 4ZKBB 4QMGA 5G3LF 3S1MB 1SE4A 1HH2P 2IHFA 3EQLC 3PO2G 3E6ZX 3KLSX 1FJGQ 2WKDA 1GKHA 4JBJA 3AMUA 3D0FA 3PUXA 3RZOH 1U4RA 2EYOA 3J80c 1EYCA 1SLJA 1Y1VH 1K8MA 3IL8A 1U4MA 3GQBA 3MHBA 2VZAA 3FVQA 3MWYW 3KDFB 2K5HA 4DAMA 4F88A 2FJ2A 1O7IA 1H9JA 4YCWA 3SE0A 3RLOA 5IGGA 2AWOA 3A7AB 4Y7NB 3CQZB 3MXUA 1EOTA 5EPKA 1LT6D 4S3SA 2JYOA 2JA7H 3F2BA 2CFMA 1VQKA 4KKTA 4DR3L 3I4LA 1LT5D 3E0EA 1GUSA 1L0XB 4FXGC 1UE6A 3JAML 4MTKA 3UDGA 1SE3A 1VQCA 4GKKL 1KLUD 1D6EC 3E9HA 3CCLA 1T5XD 1BCPB 2EPBA 2OCEA 3G48A 5BN4A 4X64L 1HZCA 4F7XA 1TS4A 2R7ZH 2F03A 1YNNC 4DR6Q 3S17B 3J7ZC 3HOVG 4A3DG 1H9KA 2F52A 3QG1A 5JJIA 2E5LL 2UUCL 1SYCA 3CCSA 4J15A 2JA5H 3WOEA 1AFPA 4IUPA 1Y1WB 4OX9Q 1QNKA 4PMWA 5I6YA 1VQ7A 4DV2L 4DAYB 2EZVA 1Q81C 4KLKA 2SOBA 1JORA 3LNNA 3R2TA 2B8FA 1BCPC 4RGOS 1HRJA 4HIOA 1XWEA 3WOFA 3CCJA 2PZUA 1U0LA 3NPPA 4LFCL 5CR3A 1EZ8A 2VB2X 3AFPA 2R7DA 4X62Q 2ZJPA 3GTJB 1O80A 1B70B 3RLNA 2I5HA 2VB3X 1ET9A 2IL8A 3T16A 4BWGB 1JJGA 1HR0L 3A7LA 1XPUA 1LTLA 4ABNA 3I2ZA 4KD3A 3MXPA 4BBRG 1KHIA 5IYDG 1MSGA 5FKAC 2JN4A 4DR4L 4K6LA 3BVMA 3DHQA 2B2WA 1EY7A 1ICFB 1TWFH 4RKBA 3PUVA 4UDUC 1CQFA 4GOPC 2VS1A 1ENFA 5M5YH 2JA6H 1JWUD 5EKKA 1E3PA 1A62A 3MA2B 3HRZC 4P74A 1EYGA 5I2YA 3S16H 2BOSA 1AP0A 1CKOA 2WV6D 1UE5A 4XT1B 3H0GH 1N8RC 1Q3LA 3PQIA 4A3MG 2QW7A 3M9BA 4X3TA 1K9MC 3M7GA 3TS2A 1F2ZA 4UP8A 2DNEA 3B6YA 3R2IA 3SDZA 1XJVA 2KCCA 4A3FH 1G2SA 1L2FA 1QVGA 1Q46A 3H94A 2F0GA 3TP6A 3BZKA 1VQGA 4DV6L 4YHHQ 4A93G 2K05A 5CC4A 1GHJA 4GN4B 4C3JH 3QOLA 4HJ5A 1H95A 1Q8KA 4JYAL 1BR9A 1A2UA 2AKWB 2QEJC 5C44H 5HGQA 3GTLB 4HAEA 2B8GA 2FMMA 1Y8PB 1E2VA 3CHBD 4HMIA 5JPMC 3P75A 1M1KC 4G7HC 4QUCA 1QB5D 2K32A 2GA4B 5CYUA 2R92G 3M3YH 3BZDB 2K5NA 5I2XA 4V0BA 1ENCA 2VQEL 1JCKB 3S1QH 2VXWA 3STBD 1LT3D 4OELB 1B4OA 1A3VA 3DLLA 1YBYA 1EU3A 1AN8A 1X55A 3VYUA 2D2CC 3ZYYX 4JOIC 3NBHB 3NBIA 1WTOA 1SE2A 3U9OA 1WD0A 2F0TA 5EAYA 1NE3A 1STGA 1WJJA 2WB1B 3FPUB 4XIGS 1K28A 1TWHB 5AFWA 3J80L 1BF4A 3TBIB 1SRUA 1RD9D 1AW7A 1NR2A 3KF6B 3SVMA 1OTCA 3Q22A 2TMPA 4IUUA 3T53B 2F0OA 2QDBA 1DOLA 3M4OB 3NSWA 5LMUQ 3KOJA 3HOXG 3GTMB 3EIVA 1VQDA 3D6CA 5C6AA 3HZXA 1MHWC 4DFAA 4DK6C 2QCPX 4X3SA 4JI2Q 1HNZQ 4A3BH 2B39A 1G8ZD 3HS0C 3FDTA 1X3EA 1WFQA 3K8AA 5M3MB 3RR5A 2EY6A 5KNDA 4FDBA 5BN3A 2EYLA 2CH4A 3K7AB 1JE5A 1PRTC 1O78A 2OWOA 4OO1I 4TSSA 1F9SA 2AQ3B 1GOZA 1PYSB 2KUMA 4IOCA 3PO3B 1SMYD 2RA4A 4A3EG 4DR6L 2R93G 5C3EG 1IKMA 4JCVE 1QJOA 3SGIA 4IFDJ 3HOZB 1RCVD 3M7NA 2MHVA 2PCFB 5GROA 3G6EA 4NMZA 2F3WA 1V1PA 4DPGA 1NY4A 4OX9L 2VUMB 3OIQA 1SNCA 2HUGA 4JBWA 5L37A 2B2UA 3P1HA 1YNXA 4CJ2C 1EQQA 1Q7YC 1IKLA 5GAGC 5FLXL 4GKJQ 4RG1A 1HTLD 3CCUA 1JJ2A 1IBLQ 3OIPA 4IJLA 4X62L 4A75A 4IFDG 4MNOA 1EIHA 2AQ2B 1I4HA 1WCMH 1N34Q 1CZWA 1JC7A 3OW2A 4LAAA 3W5OA 3OSOA 2PW7A 2NWGA 2AUJD 1PH3A 4FF3A 3K0XA 1HQRD 2NVXH 1PA6A 1Y14B 4BBSH 2UU9Q 4DR2L 4KHVA 1N33Q 3HOUH 1SYFA 5J1ZA 3S24A 2KHJA 1EFWA 4OONA 2K14A 3S2DB 1CKNB 4TRDA 3I91A 5T1IA 4C2MB 1EFID 3CCVA 1PLFA 4DV4Q 2ZXRA 3ULPA 1TY0A 3UDFA 3IFDA 1PTOB 4POGA 1K8OA 4NDXA 1JICA 2E2HH 2A68D 3NEMA 1S72A 4OEMB 4JI3Q 4KKSA 3NUCA 1S5DD 2E2DC 3OMGA 3Q8DA 1RJTA 5HGTA 3KUPA 2LS01 2G9HD 2BA0A 3M85A 2C9OA 2RKSA 1YJ9A 2QF7A 4YHHL 5IGBA 2F0NA 2F4IA 4DNRB 4BY7H 1PTOC 4FVMA 3Q23A 3K5OA 1PRTF 4CHTB 1CSQA 5C4XH 4K8IA 4A76A 3HOYB 3CF5A 1HJPA 4IUNA 1FR3A 1E22A 1CA5A 2EJFC 4PV1C 4A3GB 1Y69U 1SE8A 1K83H 1QZGA 4OO1H 1Y8NB 4CJ0B 3J81c 1VQAA 3GTQB 4DV5Q 1TS5A 3A74A 5C4ZA 1I6HH 2B2YA 3C2PA 2Q2TA 1ENAA 3HKZG 1ESRA 4HCEA 3H6MA 4DK0A 2RSNA 2XGTA 1XTCD 1GJXA 4IUTA 1YHQA 2F0EA 4AH6A 2NVTB 5DEHA 4JBKA 3M4PA 5I9OA 5KYIA 5FK9C 1I4QA 2HIXA 3S1MH 3A8JE 1EWHA 1LTAD 4M8AA 4DAYA 3H3VI 4HMJA 5LMUL 4NKLA 5C0XI 3K5NA 1IW7D 2B2WC 3EROA 4QIWE 3OW7A 3X3NA 1VQ4A 1XNRQ 1D5ZC 4LUVA 4BXXH 3L9AX 1VQEA 3MFGA 1HNZL 4JI2L 2O2LD 3OWFA 4A3KG 4XQJA 2A73B 5D14A 3PIP3 2A19A 4RGNA 2NVYB 2K03A 2MP1A 4Y7NH 2CW0C 3CQZH 3PSIA 3HOVB 1I3QB 4A3DB 3TZDA 3K6OA 3L2PA 2A6EC 3RUZA 3NK9A 2RSOA 3GTKB 4MTNA 3AQQA 3OOCA 2A1AA 5K36H 4DR7Q 1IYVA 2KJXA 1LO5D 2K1BA 2E2JB 1H9MA 2MPMA 3IKJA 4ZUJA 4DK1A 3DXJC 2SNSA 4IJHA 4XT3B 4K0KQ 2OTJA 2M9VA 5KYLA 2MO0A 1X32A 1JOQA 4K14A 3S1RB 3I4MG 2Q8RE 3I4NB 1Z6HA 3Q6SA 5IOCA 4GKJL 1Y1WH 4DR1Q 1IBLL 1D8LA 4BBRB 2LXJA 1VQNA 2ICEC 3I72A 1UUPA 5EKLA 1K8GA 3GV3A 2CQAA 4OWTB 1B53A 2F3IA 1EY6A 4CKCA 5CV9A 2EOTA 2R7ZG 4L5QA 4A3JB 1CK1A 2DY7A 2RF4A 2FMCA 4LWCA 2PPBC 4UY8C 2D0OA 3CC4A 4UPAA 3GTJH 2XRSD 2UU9L 2OEOA 3K0YA 1BKBA 2JA5G 1Q8IA 1N33L 2F0DA 2WAQG 4RA8A 5T1GA 4HJ8A 1TU2B 1TQOA 5C5LA 4A3MB 2PQAB 2HDLA 2O5IC 4LFAQ 4A3LG 3DUZA 3BYTB 4DUYQ 5DAUA 4EVOA 1FNVA 1TIID 4JV5Q 1NR4A 3NWSA 3DWAA 4RH6A 4O2DA 4RKLA 1M90C 1HZAA 1XPRA 4UAIA 3NHHA 2HD3A 3NBHA 2HQLA 1TVXA 3HKZE 4IALA 1G2TA 2ZTCA 1DM0B 1EQRA 2NZOA 1KXLA 1J5EQ 3KJOA 1WTRA 2WACA 3H3VH 4GLVB 2R92B 3ERSX 2V4DA 1NJIC 1FL0A 2I07B 1WTQA 5C0XH 1YVCA 2PZTA 3A54A 2XSCA 5LMNW 4YY3Q 3CMAA 2IX0A
chains in the Genus database with same CATH topology
3HGBA 4DF7A 2Q8TA 2NTTA 2MUYA 3G6JB 1TT2A 3S15B 2E75C 1Q1BA 3QJYA 1RHPA 5IGCA 1TWAB 3J81L 3S14B 3MAQA 4L63B 4F87A 5CGKA 1JOKA 3D8GA 1MSHA 4KN4C 3VYRA 4Q0FA 1NAPA 4J8QA 2Z1CA 3SK5A 1NCVA 4PQXA 1F2YA 2L4NA 2PYKA 1MGSA 2K5WA 3ITPA 2KECA 5JVG3 3EA6A 4BS9A 2JEBI 2BCOA 5ELFA 3E0JA 2F0PA 3GTPB 1I4PA 1Q12A 2Z4HA 4WRDA 2NB0A 1IL8A 2XWJB 5C3EB 4LMQD 4RCNA 4B08A 1SYEA 2K33A 1X3QA 3SK4A 1LTTD 1PZID 3BYYB 4Z9CB 1NUCA 1BOSA 4K5VA 2L9HA 2F0QA 4QIWB 3JAME 2HCIA 5D3DA 1SFOB 1S5FD 1SYGA 1RF2D 1A15A 3RZDB 1TS3A 3K58A 3NE5B 4TKOB 3F2UA 1EY5A 1KDAA 4QB4A 2BE5C 1Z7TA 2E2IB 1PFBA 3HEJA 1U4LA 2NBFA 5C5MA 2F0FA 2XIWA 1OXXK 1SDFA 1BNZA 3S9WA 2LKVA 4E6IA 3FMCA 5IT9L 4I65A 4JK1C 4IUQA 3T13A 1Y8OB 4BA1I 1BDOA 2JSOA 3QOJA 1YNJC 1H9SA 1ZEQX 4G57A 4HTHA 3R93A 3LX0A 2HDMA 1TWCB 4DAVA 2EY2A 2EYHA 1FNUA 3I8ZA 3BVZA 3PUWA 4KK7A 1STAA 3VYTA 2DY8A 2LY7A 3A56A 5KNCA 2Q8IB 1DONA 3FEWX 3BG3A 1O7YA 2EYMA 4EQNA 4PMBA 4KV6A 5E3FA 1MD2D 2K7VA 1S4ZA 1KTKA 1PTOH 3VR6A 3TP7A 2EY5A 5EPLA 1STYA 2NUCA 2OXPA 1HA6A 1M8AA 1YNND 2M00A 1GUWA 3VA5A 2B63B 1KNEA 1SYDA 4O1NA 2K5QA 2B2VC 5LL6S 5F2DA 2TSSA 1B3AA 3X3MA 1V43A 2RDFA 3O13A 1G291 3HKZB 3C46A 3BVGA 2KCNA 1VF7A 3D4DA 1VMCA 1BCPD 4WJWA 4A3IB 5A35A 2H4OA 2CHBD 3PMFA 5EBDA 1EYDA 1KNAA 4NP5A 5ISRA 1DXMA 4L8JA 2AUKA 4RWSC 1A3UA 1R4PB 2KQ3A 4A3KB 2HQEA 1GUNA 5FOBB 2JXMB 3BS1A 4C3IG 1WTWA 1PRTB 1I4XA 1V1OA 2KVMA 3MTSA 2MGSA 4HR7B 5TSSA 4FXKC 5IGEA 1A3TA 1KAAA 1HFNA 1M4VA 2SNMA 3RZOB 1Q1EA 2X6LA 4F8MA 3A8IE 4M1UB 3GTOB 1T5EA 1IYUA 5KGUA 4ODGA 5IGFA 5KEEA 1SNPA 2F0KA 4CGYB 3I4MB 2ICIA 2CVRA 3LWEA 3OWEB 5K5PA 3VR4A 2MJ8A 4K2LA 5EGTA 3KF8A 3ONAB 1LTGD 1B44D 4C1NK 5CV6A 2N55A 1UEAB 2IW3A 3MXNA 4QUFA 2VNUD 4TQUS 3W3AA 2NVQB 2F0MA 2D9UA 4DAPA 2K01A 4FF4A 5CV5A 5FO9B 1JB3A 5FLXE 2IPKD 4WORA 1QNUA 2IX1A 3P7JA 1G6ZA 3I3CA 3KLRA 2H1EA 5E4XA 5LL6X 3NP8A 2EVBA 1AZPA 4BA2I 2BA1A 5KRUA 1Q90A 3Q0AA 5IGDA 1TY2A 2IWHA 1HHVA 2D62A 5CORA 1SSOA 3CU7A 5EKIA 1F2MA 1ZXTA 1R9TB 5CV4A 1ZKOA 1HPCA 1SBBB 1CTMA 2WIIB 1HFGA 4C1NI 5NUCA 2F0LA 1IW7C 4C3HB 1RTNA 1GXDC 4DXFA 1G91A 1C8CA 1PZKD 3L7ZC 1CFMA 2A69C 2EJGC 3DWQA 4EQOA 1E0BA 2DNCA 3I73A 4IURA 4DU9A 1EY9A 5I9PA 2RQXA 2NN6G 1BBXC 1CT1D 3TP8A 2F0UA 2FFKB 2I46A 3PO2B 4ZRZA 4KJNA 1TS2A 1ESFA 1V8QA 4KY7A 2BDNA 1FD7D 1SJHD 3BDOA 2ZXOA 4RHSA 1QILA 4ZYSA 5IODA 3NTIA 4RAUC 1F77A 2R6GA 4KMUC 4R8NA 1HTPA 3J7AV 3J7AF 4O42A 1B50A 5I4DA 1PXUA 5JOBA 4L6TB 2K04A 3MVVA 1JWMD 4OIJA 3SEBA 2L5TA 5J39A 1VF5C 2F0HA 3EFXD 1X3PA 1OXUA 4EGVA 1TWGB 1QE6A 3AU7A 3R3OA 3MEHA 2BDOA 3HG9A 5M5XB 1PTOD 1Z47A 3J7YW 3L3OC 4X3KA 5J22A 3MZ5A 1HXYD 1KLGD 2F0WA 5JAVA 3RD4A 4KKUA 4AYBB 3W2DA 2F0SA 5DM73 1SJED 4WFN3 3TZUA 5M3FB 2L1BA 2KA7A 3HOWB 1QG7A 3P20A 1VCIA 2R61A 2A74C 3URYA 1ZYRC 3H09A 1C4QA 3QWNA 4J1MA 1L0YB 5M5WB 5EPJA 2N88A 5ELBA 3TN2A 5KIXA 1JR0D 2Z8LA 4MHEA 4U68A 4DGZA 1DD2A 2G9DA 3DM1A 1I4GA 2QKIC 2RDHA 3KLSA 1FNWA 1LT4D 4A93B 2XN9C 3NQTA 4ZLTF 3KBGA 1DYQA 3K59A 1V1PB 2QILA 3RLFA 4H7BA 1SEBD 5BN5A 2EE1A 1CZGA 1FYCA 1RDPD 2SEBD 2EYPA 4PMCA 4K5WA 1O7LA 4KD4A 2A6HD 1B2TA 2E74C 2NTSA 4EQPA 4HSPA 1EY8A 2WKCA 3VR5A 1SYBA 5G3LD 1SAPA 4P2CB 2B2UC 3GD7A 3S2HB 1EY4A 5A2QE 4C3IB 1HA5A 3SXHA 2PZWA 4RHRA 3K5MA 2O4XA 2ZXPA 3NXWA 3UI2A 4C3JG 5JVH3 5COYA 2IJ0A 3HOXB 3GTGB 1C48A 3TMEA 1RTOA 2OF1A 1II3A 3K57A 1F9QA 2K5DA 3OHXC 5CBEE 1BUVT 4FYDA 4K5XA 3N52A 1CHPD 3NTKA 5C4HA 1PYWD 5EJWA 5DNFA 2PNRC 2YU9B 2C5CA 4A3EB 2R93B 1BO0A 1O7ZA 1PFNA 1SXTA 4MIUA 1QOHA 4B9XA 1WTPA 1W6JA 1D1IA 5ELCA 1OXTA 3M4YA 1WD1A 1E2ZA 4ZAIA 4ZQ3A 1RKNA 4V190 3NWTA 2L55A 3E5SA 1B1ZA 4HEDA 1LV9A 1UNSA 3OMCA 4DNTB 3PIO3 1DOKA 3HP3A 2PW5A 5JEAH 5C3WA 4BY1B 5DM63 2FINB 2DN8A 3ND9A 1MBYA 2F0VA 3PUYA 5C4JB 2XNAC 1I4RA 2J4XA 5IT9E 5D3IB 4G7ZC 4QF4A 1DOMA 1SNMA 2B2YC 1VDZA 1IHZA 1D2BA 3V96A 1LLRD 3KBXA 1AEXA 3VR2A 1R4QB 2EYJA 3C1EA 2EXZA 3AB9A 4RFBA 3S1NB 3V05A 4KY5A 2NYZD 4R9WA 1D1KA 5CBAE 2NZ1D 3Q24A 5E1FA 1HUMA 3QO2A 3MXGA 1SNOA 1WTVA 1EL0A 3CKIB 3FKIB 2AQ1B 3SR1A 1LTRD 5CV8A 2B2TA 2JEAI 1HCZA 2E76C 1MI2A 2X69A 3DWPA 2BE5D 1EY0A 3VR3A 3WDNA 2LFNA 3TP5A 4XQQA 1SMYC 4N9PA 3MFYA 4KTAA 4DXGA 4OHJA 1I50B 1UAPA 1BQQT 1YNJD 1HUNA 1FGBD 1KABA 2M2LA 4KN7C 4XXEA 3H3VC 2EYFA 3DEOA 1H9RA 4H13C 1DCZA 4KJOA 1GHKA 1EWCA 5IIFA 1OXVA 1CQVA 1U4PA 5ELEA 4CKEA 4KI0A 3J80E 1XYIA 2ID0A 4ILWA 4LK1C 3T51B 2RBMA 4OO1G 1WTXA 3I70A 2D5DA 1BCPF 5EBCA 3SHLA 5E4WC 4FP5D 1DJRD 1Y1VB 4YIJA 2LMCB 4FO2A 3VA7A 3I90A 3IFTA 2L12A 4B9WA 2XVSA 1F9RA 3QB3A 3LWUA 4XTCS 2JA7B 5ELDA 4OGQC 4ULLA 2K6AA 4OL7A 4KY6A 2A68C 5LHY1 1JE4A 1QCBD 3PV0A 2R7ZB 3T4AC 2R3ZA 4CKBA 3D3RA 2O5JC 2EDGA 5FO8B 3VYSA 3A8KE 2JA5B 1STBA 5JPNC 5K36G 3BDCA 2WAQB 4DA2A 1CA6A 1AZQA 4K8JA 1SNQA 5FO7B 1S5CD 4H44C 4OIKA 1TKWB 1F2LA 1TR5A 3C1FA 2K28A 2ZT9C 2PO4A 1S5ED 1WVLA 1LABA 3RMHA 4RGMA 4N9TA 3TSSA 3BDLA 3IAYA 1I6VC 1TWFB 1GUTA 1ONLA 3DMUA 2JA6B 5M5YB 4IFDI 1STEA 2JE6I 4FF1A 1JQYD 1D5MC 2OT2A 4HCSA 3S16B 2RVLA 1PRTD 1EQTA 4XQNA 3H0GB 1A6XA 4FF2A 2PQEA 1LACA 3R8BA 1CI3M 3D4WA 3FRPB 4A3FB 1B9MA 1U9RA 3N6RA 5C0XJ 1EEFD 5C3XA 2A5HA 5EQ0A 4KHZA 1H9SB 3NTHA 4C3JB 3OPOA 4QCLA 4DN4M 5C44B 4H0LC 3CRLC 1EYAA 1KDCA 3MC0B 4MN3A 1LTSD 3M3YB 5C0XG 1JOOA 3S1QB 5D65A 3G7LA 3C3LA 1HQMC 1B9NA 1VMPA 2IX3A 4ZKCB 4G4KA 4I7ZC 2NN6I 3ERQA 4FXDA 2EY1A 3KK7A 1PMRA 4G7OC 2Y0SB 4ZK9B 4RGTA 4X3UA 2J0TD 3SK8A 2WP8J 1XX8A 3FPPA 4A3BB 2F1MA 5M9OA 4ZUIA 5I6WA 1ILPA 4CJ1B 4XYQA 4IN3A 5HURA 1DZ1A 2A69D 4K2KA 1ET6A 2XRQD 1A2TA 1W6KA 2B2TC 2IT1A 2JP1A 4IFDH 2AWNA 1CM9A 1RODA 1S5BD 2B2VA 2WINB 1F9PA 4FNFA 3H91A 2KHSA 1GUOA 3D6WA 5JEAJ 2KEDA 1LTBD 4PNYA 2FHTA 3GV6A 1XXGA 4GZYC 1EU4A 1QWYA 2A6HC 3GO5A 2Z4IA 3TDQA 2SDFA 1PZJD 1PTOF 1WCMB 4Q5VA 4CBVA 2KEEA 4RCOA 4NW2A 5JEAG 3PUZA 3NQIA 5CMDA 2NVXB 4U673 1OO9B 4BBSB 3SK6A 3HOUB 1OXSC 4IZ8A 2J7ZA 1PFMA 1SNDA 2XWBB 4C56C 3GP7A 2CW0D 2KOLA 3CRKC 2F0IA 1GUGA 3K5LA 2A6ED 1KDBA 2RDGA 3EVQA 2ENBA 1ML0D 1EZ6A 3V2TA 4K6DA 1BXTA 2L0CA 2E2HB 1J9OA 2JA8B 4IQZA 5CV7A 2EJMA 1STNA 2NN6H 4IUVA 1JWSD 1D5XC 1EQVA 2HCCA 3EJIA 4HSVA 1EEID 4BY7B 1ILQA 4HN7A 3D31A 3A55A 5C4XB 1CHQD 3J81E 1STHA 2L11A 2YYZA 4LJZC 3T56B 4C3HG 2PMZB 1ZYRD 1K83B 1LTID 4XYOA 4J6HA 5A2QL 4ME5A 1J8IA 4ID6A 1ICWA 1I6HB 1PDQA 3DEPA 2F0JA 3D4RA 3ND8A 1NSNS 1E2WA 1EIGA 4XDXA 4R8IA 5KNBA 2F3VA 2X6GA 5JJZA 3U9SA 3QIAA 4ZKBB 4QMGA 5G3LF 3S1MB 1SE4A 3EQLC 3E6ZX 3KLSX 2WKDA 3AMUA 3PUXA 1U4RA 2EYOA 1EYCA 1K8MA 3IL8A 1U4MA 3GQBA 3MHBA 3FVQA 3MWYW 4F88A 2FJ2A 1H9JA 3SE0A 5IGGA 2AWOA 3A7AB 4Y7NB 3CQZB 3MXUA 1EOTA 5EPKA 1LT6D 4S3SA 2JYOA 4KKTA 3I4LA 1LT5D 1GUSA 1L0XB 4FXGC 3JAML 1SE3A 1KLUD 1D6EC 1T5XD 1BCPB 2EPBA 5BN4A 4F7XA 1TS4A 2F03A 1YNNC 3S17B 1H9KA 3QG1A 1SYCA 3WOEA 1AFPA 4IUPA 1Y1WB 1QNKA 4PMWA 5I6YA 2EZVA 2SOBA 1JORA 3LNNA 3R2TA 2B8FA 1BCPC 4RGOS 1HRJA 1XWEA 3WOFA 2PZUA 3NPPA 5CR3A 1EZ8A 2VB2X 3GTJB 1O80A 2VB3X 1ET9A 2IL8A 3T16A 4BWGB 3A7LA 4ABNA 4KD3A 3MXPA 1MSGA 5FKAC 4K6LA 3BVMA 3DHQA 2B2WA 1EY7A 4RKBA 3PUVA 4UDUC 1CQFA 1ENFA 1JWUD 5EKKA 3MA2B 3HRZC 5I2YA 2BOSA 1AP0A 2WV6D 4XT1B 1Q3LA 4X3TA 3M7GA 1F2ZA 2DNEA 3R2IA 3SDZA 2KCCA 1G2SA 3H94A 2F0GA 3TP6A 2K05A 5CC4A 1GHJA 3QOLA 1BR9A 1A2UA 2QEJC 3GTLB 4HAEA 2B8GA 2FMMA 1Y8PB 1E2VA 3CHBD 4HMIA 5JPMC 3P75A 4G7HC 4QUCA 1QB5D 2K32A 2GA4B 5CYUA 3BZDB 5I2XA 4V0BA 1ENCA 1JCKB 2VXWA 1LT3D 1B4OA 1A3VA 1EU3A 1AN8A 3VYUA 2D2CC 3ZYYX 3NBIA 1WTOA 1SE2A 3U9OA 1WD0A 2F0TA 1STGA 2WB1B 3FPUB 4XIGS 1TWHB 5AFWA 3J80L 1BF4A 3TBIB 1RD9D 1AW7A 1NR2A 3SVMA 3Q22A 2TMPA 4IUUA 3T53B 2F0OA 2QDBA 1DOLA 3M4OB 3NSWA 3GTMB 3D6CA 5C6AA 3HZXA 4DFAA 2QCPX 4X3SA 2B39A 1G8ZD 3FDTA 3HS0C 5M3MB 5KNDA 2EY6A 5BN3A 2EYLA 3K7AB 1PRTC 1O78A 4OO1I 4TSSA 1F9SA 2AQ3B 1GOZA 2KUMA 3PO3B 1SMYD 2RA4A 1IKMA 1QJOA 4IFDJ 3HOZB 1RCVD 3M7NA 2MHVA 2PCFB 4NMZA 2F3WA 1V1PA 2VUMB 3OIQA 1SNCA 2HUGA 4JBWA 2B2UA 3P1HA 4CJ2C 1IKLA 5FLXL 1HTLD 3OIPA 4IFDG 1EIHA 2AQ2B 1I4HA 1CZWA 1JC7A 4LAAA 3OSOA 2PW7A 2NWGA 2AUJD 4FF3A 1HQRD 4KHVA 1SYFA 5J1ZA 3S2DB 4TRDA 3I91A 5T1IA 4C2MB 1EFID 1PLFA 2ZXRA 1TY0A 3IFDA 1PTOB 1K8OA 4NDXA 1JICA 2A68D 4KKSA 3NUCA 1S5DD 2E2DC 3OMGA 1RJTA 5HGTA 3KUPA 2LS01 2G9HD 2BA0A 3M85A 2C9OA 2RKSA 2QF7A 5IGBA 2F0NA 2F4IA 4DNRB 1PTOC 4FVMA 3Q23A 3K5OA 1PRTF 4CHTB 4K8IA 3HOYB 4IUNA 1FR3A 1CA5A 2EJFC 4PV1C 4A3GB 1Y69U 4OO1H 1Y8NB 4CJ0B 3GTQB 1TS5A 5C4ZA 2B2YA 3C2PA 1ENAA 1ESRA 4HCEA 3H6MA 4DK0A 2RSNA 1XTCD 1GJXA 4IUTA 2F0EA 2NVTB 5DEHA 5I9OA 5KYIA 5FK9C 1I4QA 3A8JE 1EWHA 1LTAD 4M8AA 4DAYA 4HMJA 4NKLA 5C0XI 3K5NA 1IW7D 2B2WC 3EROA 3OW7A 3X3NA 1D5ZC 3L9AX 3MFGA 2O2LD 3OWFA 4XQJA 2A73B 5D14A 3PIP3 4RGNA 2NVYB 2K03A 2MP1A 2CW0C 3HOVB 1I3QB 4A3DB 3TZDA 3K6OA 2A6EC 3RUZA 3NK9A 2RSOA 3GTKB 3OOCA 5K36H 1IYVA 2KJXA 1LO5D 2K1BA 2E2JB 1H9MA 2MPMA 3IKJA 4ZUJA 4DK1A 3DXJC 2SNSA 4XT3B 2M9VA 5KYLA 1X32A 1JOQA 4K14A 3S1RB 2Q8RE 3I4NB 1Z6HA 3Q6SA 5IOCA 4BBRB 2ICEC 3I72A 1UUPA 5EKLA 3GV3A 2CQAA 1B53A 1EY6A 4CKCA 5CV9A 2EOTA 4A3JB 1CK1A 2DY7A 2FMCA 2PPBC 2XRSD 2OEOA 3K0YA 1Q8IA 2F0DA 4RA8A 5T1GA 1TU2B 1TQOA 5C5LA 4A3MB 2HDLA 2O5IC 3DUZA 3BYTB 5DAUA 4EVOA 1FNVA 1TIID 1NR4A 3NWSA 3DWAA 4RH6A 4RKLA 4UAIA 3NHHA 3NBHA 1TVXA 4IALA 1G2TA 1DM0B 1WTRA 2WACA 2R92B 2V4DA 1WTQA 2I07B 5C0XH 2PZTA 3A54A 2XSCA 2IX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HTP A;  3HGB A;  2JEA I;  1K8O A;  1Q90 A;  3U9S A;  1HCZ A;  2A68 D;  1IYV A;  3A8K E;  1DXM A;  2E76 C;  3QIA A;  1OXX K;  4KKS A;  4L8J A;  1OXT A;  2BE5 D;  3M4Y A;  3PUV A;  5C0X G;  2AUK A;  2E75 C;  1H9M A;  3VR3 A;  1E2Z A;  1Q1B A;  3QJY A;  2D62 A;  3IKJ A;  5K36 G;  3FMC A;  3WDN A;  3EQL C;  4DK1 A;  4JK1 C;  3DXJ C;  5JEA G;  3PUZ A;  3RLF A;  1Y8O B;  2BA0 A;  3M85 A;  4BA1 I;  1BDO A;  5BN5 A;  1SMY C;  1YNJ C;  5KND A;  1H9S A;  2L5T A;  1HQM C;  1FYC A;  1GUN A;  3PUX A;  5BN3 A;  2QF7 A;  3MFY A;  2JXM B;  1VF5 C;  2O5J C;  1OXS C;  3CRL C;  1B9N A;  4DNR B;  1K8M A;  1O78 A;  3GQB A;  4DNT B;  4H44 C;  1OXU A;  1ZKO A;  1Z6H A;  1HPC A;  1TKW B;  4HR7 B;  1H9J A;  3PUW A;  3SE0 A;  4KN7 C;  5JEA H;  3CRK C;  2AWO A;  2ZT9 C;  1GUG A;  1CTM A;  1O7L A;  2BDO A;  2DN8 A;  3A7A B;  3I72 A;  1QJO A;  3ND9 A;  2A6E D;  2NN6 I;  1LAB A;  2A6H D;  3MXU A;  4KN4 C;  1Q1E A;  4I7Z C;  2DNE A;  3M7N A;  1H9R A;  4H13 C;  1DCZ A;  2E74 C;  2PCF B;  1FR3 A;  2KCC A;  3PUY A;  3SDZ A;  2EJF C;  1IW7 C;  3A8I E;  1PMR A;  4KKT A;  4PV1 C;  3VR5 A;  3H94 A;  4G7O C;  1GHK A;  3I4L A;  1T5E A;  1IYU A;  1Y69 U;  1OXV A;  5KNC A;  1GUS A;  2PPB C;  4JBW A;  4OO1 H;  1Y8N B;  2Q8I B;  1I6V C;  4KI0 A;  1GUT A;  1ONL A;  4G7Z C;  1GHJ A;  2JEB I;  3L7Z C;  3GD7 A;  4IQZ A;  1CFM A;  2EJM A;  4KKU A;  3BG3 A;  1VDZ A;  3FPP A;  5BN4 A;  4LK1 C;  3T51 B;  2NN6 H;  3TZU A;  4OO1 G;  2K7V A;  1TU2 B;  2A69 C;  2D5D A;  1Q12 A;  2EJG C;  2F1M A;  2JE6 I;  3VR6 A;  3VR4 A;  2B8G A;  4DK0 A;  1YNN C;  2KA7 A;  1Y8P B;  4IFD G;  1E2V A;  2DNC A;  3VR2 A;  1GJX A;  3I73 A;  2O5I C;  1H9K A;  3QG1 A;  4G7H C;  2K32 A;  2NN6 G;  3D31 A;  1A6X A;  2LMC B;  3P20 A;  4RCN A;  1VCI A;  2A69 D;  2K33 A;  3A8J E;  2AUJ D;  3VA7 A;  1EWH A;  3AB9 A;  3IFT A;  1ZYR C;  2IT1 A;  1LAC A;  3LNN A;  4TQU S;  1CI3 M;  3W3A A;  4IFD H;  2B8F A;  3LWU A;  1IW7 D;  4XTC S;  2D2C C;  3OW7 A;  2YYZ A;  1B9M A;  4LJZ C;  3T56 B;  3N6R A;  1V8Q A;  4OGQ C;  1GUO A;  2PNR C;  4XIG S;  1V43 A;  1G29 1;  4KHZ A;  1VF7 A;  3BDO A;  1H9S B;  1DD2 A;  3NE5 B;  4TKO B;  2A68 C;  2CW0 C;  5A35 A;  3PV0 A;  3OPO A;  3KLR A;  2BE5 C;  2A6E C;  1Z7T A;  3A7L A;  2A6H C;  4GZY C;  2V4D A;  3D4R A;  3ND8 A;  4H0L C;  2EVB A;  3T53 B;  1E2W A;  5C0X H;  4BA2 I;  3OOC A;  2R6G A;  5KNB A;  4KMU C;  2EDG A;  5K36 H;  2BA1 A; 
#chains in the Genus database with same CATH topology
 3HGB A;  4DF7 A;  2Q8T A;  2NTT A;  2MUY A;  3G6J B;  3H0G G;  1TT2 A;  3S15 B;  3U58 A;  2E75 C;  1Q1B A;  3QJY A;  1RHP A;  5IGC A;  2I5L X;  1TWA B;  1RIP A;  3GTL H;  3J81 L;  3S14 B;  4A3F G;  3EN2 A;  1UWV A;  3MAQ A;  4L63 B;  4F87 A;  5CGK A;  1JOK A;  4DR5 Q;  1XMO Q;  2GVA A;  4YCV A;  3D8G A;  1G6P A;  1MSH A;  4KN4 C;  3VYR A;  4Q0F A;  1NAP A;  4J8Q A;  2Z1C A;  3SK5 A;  1NCV A;  4PZ8 A;  4PQX A;  1F2Y A;  2L4N A;  4P73 A;  5IP9 H;  2PYK A;  1MGS A;  4IPH A;  2K5W A;  3ITP A;  5DLQ E;  2KEC A;  1TWH H;  3AEV A;  2K4K A;  5JVG 3;  3EA6 A;  4BS9 A;  2JEB I;  2BCO A;  1JT8 A;  2KBN A;  5ELF A;  3E0J A;  3RN2 A;  2F0P A;  4JPB W;  1XNR L;  3GTP B;  5IYC G;  1I4P A;  1Q12 A;  4LF7 Q;  2Z4H A;  4WRD A;  1PHJ A;  2NB0 A;  3M4O H;  1IL8 A;  2XWJ B;  5C3E B;  3GTM H;  4LMQ D;  4RCN A;  4B08 A;  1SYE A;  3EBE A;  2K33 A;  1X3Q A;  3SK4 A;  1LTT D;  1PZI D;  3BYY B;  4Z9C B;  4DR7 L;  1XPO A;  5M3M H;  1NUC A;  1BOS A;  4K5V A;  2L9H A;  2F0Q A;  3K7A H;  4DUZ L;  4LNQ A;  4QIW B;  3JAM E;  2HCI A;  2Y0S G;  5D3D A;  1SFO B;  1C0A A;  2WAQ E;  1S5F D;  1SYG A;  1RF2 D;  1A15 A;  3PO3 H;  3RZD B;  1YJW A;  4K0K L;  4WJ4 A;  1TS3 A;  3K58 A;  3NE5 B;  4TKO B;  4LF5 Q;  4NXM Q;  3F2U A;  1EY5 A;  1KRT A;  3HOZ H;  1KDA A;  3FHW A;  4QB4 A;  2BE5 C;  1Z7T A;  4A3B G;  3TRE A;  1X54 A;  5JJL A;  2E2I B;  2VUM H;  4DR1 L;  1PFB A;  3HEJ A;  2KCM A;  4GS3 A;  1U4L A;  2NBF A;  5C5M A;  2F0F A;  2XIW A;  4PZ6 A;  1OXX K;  1SDF A;  1CKM A;  1BNZ A;  4GOP B;  3S9W A;  2LKV A;  1HNW Q;  2LXK A;  4E6I A;  3FMC A;  5IT9 L;  4I65 A;  3KLW A;  4JK1 C;  4IUQ A;  3T13 A;  1Y8O B;  4BA1 I;  1BDO A;  2JSO A;  3QOJ A;  1YNJ C;  3F8T A;  1H9S A;  3I4O A;  1ZEQ X;  4G57 A;  4HTH A;  3R93 A;  2RHQ B;  3LX0 A;  2HDM A;  4AYB G;  1TWC B;  4DAV A;  2EY2 A;  2E8G A;  5IP7 H;  1WI5 A;  2MFI A;  3ULJ A;  5M3F G;  2EYH A;  1FNU A;  3PF5 A;  3I8Z A;  3BVZ A;  3PUW A;  4DR2 Q;  3HOW G;  3KYH C;  4KK7 A;  1STA A;  3STB C;  3VYT A;  2CCZ A;  3CPW A;  2DY8 A;  4A3C G;  4R4I A;  4LFA L;  4NB3 A;  2LY7 A;  3T1Y Q;  3A56 A;  4IPG A;  4DUY L;  1VQ8 A;  1X65 A;  1HNX Q;  5KNC A;  4JV5 L;  2YTY A;  3S2D H;  2Q8I B;  1WCM G;  1A0I A;  4C2M H;  1DON A;  2CWA A;  3FEW X;  1WYD A;  3OYY A;  3BG3 A;  1O7Y A;  2EYM A;  3CPF A;  4EQN A;  4PMB A;  4KV6 A;  4X65 Q;  5E3F A;  4I7A A;  1MD2 D;  2K7V A;  1S4Z A;  1KTK A;  1PTO H;  3VR6 A;  1W2B A;  4BBS G;  3TP7 A;  1K73 C;  2EY5 A;  3HOU G;  1MIU A;  4UP9 A;  1J5E L;  2F4V Q;  5EPL A;  1STY A;  2NUC A;  2GVB A;  2OXP A;  1YHB A;  1HA6 A;  1M8A A;  1YNN D;  3CW2 C;  2M00 A;  1GUW A;  4YY3 L;  3VA5 A;  4HIM A;  2DGY A;  2B63 B;  1KNE A;  1SYD A;  1VS0 A;  4O1N A;  4DKA C;  2K5Q A;  2B2V C;  5LL6 S;  2RHS B;  3IRB A;  3JAM i;  1N32 Q;  3U4Z A;  2CH4 W;  5F2D A;  2TSS A;  1B3A A;  3X3M A;  1V43 A;  2LSS A;  2RDF A;  3O13 A;  1G29 1;  3HKZ B;  3C46 A;  3BVG A;  2KCN A;  1VF7 A;  3D4D A;  1VMC A;  2MQH A;  1D7Q A;  1BCP D;  4WJW A;  4A3I B;  3HOY H;  5BR8 Q;  5A35 A;  4GNX A;  2H4O A;  2CHB D;  3PMF A;  5EBD A;  1AH9 A;  2VW9 A;  1EYD A;  1KNA A;  4A3G H;  4NP5 A;  4DR5 L;  1Z9F A;  1L1O A;  1XMO L;  5ISR A;  2VL6 A;  1DXM A;  3UE1 A;  4L8J A;  4BY7 G;  1IZ6 A;  2AUK A;  4RWS C;  3GTQ H;  2Y0S E;  1A3U A;  2DUD A;  5C4X G;  1R4P B;  4JC0 A;  2KQ3 A;  4A3K B;  2HQE A;  1GUN A;  5FOB B;  1JB7 A;  2JXM B;  3BS1 A;  4C3I G;  2NZH A;  1WTW A;  2CQO A;  1PRT B;  1I4X A;  2NVT H;  1V1O A;  2KVM A;  3MTS A;  2MGS A;  4HR7 B;  5TSS A;  4FXK C;  3CCM A;  5IGE A;  4LF7 L;  1IBK Q;  1A3T A;  1KAA A;  1HFN A;  1M4V A;  2SNM A;  2Q2U A;  3RZO B;  1Q1E A;  3RN5 A;  1S40 A;  4HJA A;  1LM0 A;  2X6L A;  2VY3 A;  1PH4 A;  3CC2 A;  4F8M A;  3A8I E;  4M1U B;  3GTO B;  1T5E A;  1IYU A;  5KGU A;  2HT1 A;  4ODG A;  5IGF A;  2NVY H;  1PH6 A;  1QUQ B;  3PCO B;  4AYB E;  5KEE A;  1SNP A;  2F0K A;  2XTI A;  3HOV H;  1I3Q H;  4A3D H;  4CGY B;  3I4M B;  2ICI A;  3GTK H;  2CVR A;  3LWE A;  3OWE B;  5K5P A;  3VR4 A;  2MJ8 A;  2UXB Q;  3CXC A;  4K2L A;  5EGT A;  1YJN A;  4LF5 L;  4NXM L;  3KF8 A;  3ONA B;  1LTG D;  2YTX A;  1B44 D;  2E2J H;  4JI7 Q;  4C1N K;  4L5S A;  4QQB X;  1PH2 A;  5CV6 A;  2N55 A;  4LFB Q;  2ZJQ A;  3U50 C;  1UEA B;  4JG2 A;  2HIV A;  4WJ3 M;  2IW3 A;  3MXN A;  1MJE A;  4QUF A;  2VNU D;  4TQU S;  3W3A A;  2NVQ B;  2F0M A;  2D9U A;  5IY0 A;  4X6A H;  4JI0 Q;  4DAP A;  1MJC A;  3S1R H;  2K01 A;  1HNW L;  3I4N H;  4FF4 A;  5CV5 A;  2YV5 A;  5FO9 B;  1JB3 A;  5FLX E;  2IPK D;  1RL2 A;  4WOR A;  4BBR H;  3TRZ A;  1QNU A;  2IX1 A;  3P7J A;  1G6Z A;  3HKS A;  3I3C A;  3KLR A;  2H1E A;  2Z6K C;  5E4X A;  5LL6 X;  3NP8 A;  2EVB A;  1AZP A;  4BY1 G;  4BA2 I;  4A3J H;  2BA1 A;  5KRU A;  1Q90 A;  3M4Q A;  3Q0A A;  5IGD A;  1TY2 A;  2IWH A;  4UP7 A;  1HHV A;  3T1Y L;  2D62 A;  3TQY A;  2KEN A;  5COR A;  1SSO A;  2CKZ B;  2GN5 A;  1HNX L;  1K3B C;  3CU7 A;  5EKI A;  1PH5 A;  1F2M A;  1ZXT A;  1R9T B;  3J80 i;  5CV4 A;  1ZKO A;  1HPC A;  4X65 L;  1SBB B;  1I5F A;  2R7F A;  1CTM A;  2WII B;  1HFG A;  2JA8 H;  5NUC A;  4C1N I;  2F0L A;  2F4V L;  1QVC A;  1IW7 C;  2B3G A;  4C3H B;  5J3B A;  3I7F A;  4Y52 H;  1RTN A;  1GXD C;  3DM3 A;  4DXF A;  3I55 A;  1PH1 A;  1G91 A;  1C8C A;  1PZK D;  3L7Z C;  1CFM A;  1N32 L;  3KDF A;  2A69 C;  2EJG C;  3F1Z A;  2YTV A;  3DWQ A;  4EQO A;  1E0B A;  2DNC A;  5E7N A;  3I73 A;  4IUR A;  4DU9 A;  2IY5 B;  1EY9 A;  5I9P A;  5BR8 L;  2RQX A;  2NN6 G;  1BBX C;  3S15 H;  1CT1 D;  3FKI G;  3TP8 A;  2F0U A;  2FFK B;  2I46 A;  4GN5 A;  4QGU A;  4ZRZ A;  1TWA H;  3PO2 B;  4KJN A;  1TS2 A;  1ESF A;  3PF4 A;  1BBU A;  1P16 A;  2FXQ A;  4IOA A;  2WFW A;  3S14 H;  4CDE C;  1V8Q A;  1SR3 A;  4KY7 A;  4AQY Q;  2BDN A;  1FD7 D;  1SJH D;  3BDO A;  1W3S A;  4L5T A;  2ZXO A;  4RHS A;  4KHP Q;  1QIL A;  4ZYS A;  5IOD A;  2Z0S A;  1VQH A;  1ASY A;  3NTI A;  2ATW A;  4LW1 A;  2RCN A;  4RAU C;  1F77 A;  2R6G A;  4KMU C;  4DV3 Q;  4R8N A;  1HTP A;  3J7A V;  1IBK L;  4R4Q A;  4HJ7 A;  1NMF A;  3J7A F;  2QEX A;  1AE3 A;  4O42 A;  1B50 A;  3ICE A;  1E24 A;  5I4D A;  1PXU A;  4LF9 Q;  5JOB A;  5IYB H;  4L6T B;  2K04 A;  3MVV A;  1EUJ A;  3GTP H;  1JWM D;  1HZ9 A;  2K52 A;  4OIJ A;  2KCT A;  3SEB A;  2L5T A;  5J39 A;  1VF5 C;  4JI1 Q;  3L0O A;  5C3E H;  2F0H A;  3EFX D;  3CME A;  1X3P A;  1OXU A;  1P8L A;  1V9P A;  4EGV A;  1TWG B;  1QE6 A;  3AU7 A;  3R3O A;  3J81 j;  3MEH A;  2UXB L;  1Y1V G;  2BDO A;  4DUZ Q;  3HG9 A;  1GVP A;  2KHI A;  5M5X B;  1PTO D;  1Z47 A;  3J7Y W;  1UE7 A;  2K75 A;  3L3O C;  4JI7 L;  4X3K A;  1E1O A;  2EQS A;  4LFB L;  5J22 A;  1SFO H;  3S17 H;  3MZ5 A;  1HXY D;  1S3O A;  4N8X 1;  3RZD H;  1KLG D;  2JA7 G;  2F0W A;  5JAV A;  2UUA Q;  3A5Z B;  1NMG A;  4PZ7 A;  3RD4 A;  1DGS A;  4KKU A;  4AYB B;  4JI0 L;  3JAM c;  3W2D A;  2F0S A;  5DM7 3;  1SJE D;  4WFN 3;  3TZU A;  5M3F B;  1K0S A;  5M3M G;  2E2I H;  2L1B A;  2KA7 A;  1B3Q A;  3HOW B;  4GNX C;  5GAE C;  1QG7 A;  2C35 B;  3P20 A;  1VCI A;  3JC6 6;  3PO3 G;  1LYL A;  2R61 A;  4QY7 A;  2A74 C;  3URY A;  1ZYR C;  1L1O C;  3H09 A;  1C4Q A;  3QWN A;  4J1M A;  3HOZ G;  1L0Y B;  5M5W B;  1TWC H;  5EPJ A;  2N88 A;  4JOI A;  5ELB A;  3TN2 A;  5KIX A;  1JR0 D;  4CDD C;  2Z8L A;  4MHE A;  4U68 A;  4DGZ A;  1LUZ A;  1DD2 A;  5FLM H;  5FJ8 H;  2G9D A;  4JBM A;  3DM1 A;  5ELO A;  1EWI A;  3NEN A;  1I4G A;  2QKI C;  2RDH A;  3KLS A;  2MO1 A;  5H1S E;  1FNW A;  5IP7 G;  1LT4 D;  2JJQ A;  4A93 B;  2XN9 C;  3NQT A;  4ZLT F;  3KBG A;  1DYQ A;  1WOC A;  2AHO B;  3K59 A;  1V1P B;  2QIL A;  3RLF A;  4H7B A;  4YCU A;  1SEB D;  5BN5 A;  2EE1 A;  1CZG A;  1FYC A;  1RDP D;  3KF6 A;  2JA6 G;  2SEB D;  4X66 Q;  2EYP A;  3G4S A;  1YEZ A;  1G51 A;  4PMC A;  2N3S A;  4K5W A;  1O7L A;  4KD4 A;  2B63 H;  2A6H D;  1B2T A;  2UUB Q;  2E74 C;  2NTS A;  1UEB A;  4EQP A;  1X9N A;  4HSP A;  1EY8 A;  2WKC A;  1KD1 C;  1EOV A;  4PG3 A;  3VR5 A;  1SYB A;  5G3L D;  1SAP A;  1VQO A;  4P2C B;  2B2U C;  1HR0 W;  1C9O A;  2AMC B;  4A3I H;  3GD7 A;  3S2H B;  1EY4 A;  5A2Q E;  4C3I B;  1N9W A;  1HA5 A;  3SXH A;  2PZW A;  4RHR A;  3K5M A;  4AQY L;  2O4X A;  2ZXP A;  3NXW A;  2QGQ A;  3UI2 A;  4C3J G;  5JVH 3;  5COY A;  3F2C A;  4B3R L;  2IJ0 A;  3HOX B;  2D0P A;  5C44 G;  1C48 A;  3GTG B;  1GM5 A;  3TME A;  4KHP L;  4NPS A;  4P71 A;  1VQM A;  1RTO A;  2OF1 A;  1II3 A;  3K57 A;  2DJG C;  4DV3 L;  1F9Q A;  2K5D A;  3OHX C;  5CBE E;  1BUV T;  4FYD A;  4A3K H;  4K5X A;  3N52 A;  1CHP D;  3FP9 A;  3NTK A;  5C4H A;  1PYW D;  1VQP A;  4LF9 L;  2A8V A;  5EJW A;  5DNF A;  1PH8 A;  2I0Q A;  4A3G G;  2PNR C;  4N8F A;  2ZM6 L;  2YU9 B;  4LF8 Q;  1K3R A;  1YI2 A;  2C5C A;  4A3E B;  4HID A;  2R93 B;  1BO0 A;  1O7Z A;  1PFN A;  4NXN Q;  4DK3 C;  4JI1 L;  1SXT A;  4P75 A;  3OTO Q;  4MIU A;  4JI5 Q;  1L0W A;  1QOH A;  3T1H Q;  3UDX A;  4B9X A;  1WTP A;  3GTO H;  3CCE A;  1W6J A;  1D1I A;  4R4T A;  5ELC A;  3J7A 5;  3AYH B;  1OXT A;  3M4Y A;  1WD1 A;  4LF4 Q;  1E2Z A;  4ZAI A;  4ZQ3 A;  1RKN A;  4V19 0;  3I56 A;  3I4M H;  1CKN A;  3NWT A;  3KFU A;  5GQO A;  2L55 A;  4B3M Q;  3E5S A;  1B1Z A;  5JJK A;  4HED A;  1XMQ Q;  4QJF A;  2UUA L;  1LV9 A;  2Z6B A;  1UNS A;  3OMC A;  4DNT B;  3PIO 3;  1DOK A;  3HP3 A;  1NNX A;  2PW5 A;  2I5M X;  1YHA A;  5JEA H;  5C3W A;  4B3T Q;  4BY1 B;  5DM6 3;  2FIN B;  2DN8 A;  3ND9 A;  1NBW A;  4TVA B;  2NVQ H;  5IWA Q;  1MBY A;  1A8V A;  3PUY A;  1TXY A;  2F0V A;  5C4J B;  4YWL A;  2G5D A;  2XNA C;  1KL9 A;  1VQB A;  2UXD Q;  1I4R A;  2Z9H A;  2J4X A;  2IHE A;  5IT9 E;  3MEF A;  3PGZ A;  5LMN L;  5D3I B;  4G7Z C;  1FVI A;  4QF4 A;  3J81 i;  1DOM A;  1SNM A;  2B2Y C;  1VDZ A;  1IHZ A;  1XTD A;  1D2B A;  3V96 A;  1LLR D;  4A3L H;  3KBX A;  3HFZ B;  1AEX A;  3VR2 A;  5FLX c;  1R4Q B;  2P5Z X;  2EYJ A;  4H02 A;  3C1E A;  3I4N G;  1MKH A;  2EXZ A;  3AB9 A;  3E9I A;  3ULL A;  2QDL A;  2VQF Q;  5GAD C;  1R9T H;  4RFB A;  2EXD A;  3S1N B;  3V05 A;  4KY5 A;  2NYZ D;  4GLA C;  4YWK A;  4R9W A;  1D1K A;  3GDE A;  5CBA E;  4A3J G;  2Q2H A;  1KIX A;  2NZ1 D;  3Q24 A;  3U4V A;  4IPD A;  5E1F A;  1HUM A;  3QO2 A;  4DV1 Q;  3MXG A;  4X66 L;  1SNO A;  4ZCK A;  4LUO A;  5IE8 A;  1WTV A;  1EL0 A;  1IXR A;  3CKI B;  3FKI B;  2AQ1 B;  4C3H H;  3SR1 A;  1LTR D;  2RCF A;  5CV8 A;  4B3S Q;  2B2T A;  2JEA I;  1HCZ A;  2E76 C;  1E1T A;  2B29 A;  1MI2 A;  2X69 A;  3DWP A;  2UUB L;  2BE5 D;  1EY0 A;  3VR3 A;  1C7Y A;  3WDN A;  2LFN A;  4CDC C;  2OQK A;  3TP5 A;  3BJU A;  4XQQ A;  1SMY C;  2JA8 G;  4N9P A;  3MFY A;  4KTA A;  4APV A;  4DXG A;  4OHJ A;  1I50 B;  5AJ3 Q;  1UAP A;  1BQQ T;  1YNJ D;  2EIF A;  1FGB D;  1KAB A;  1KAW A;  2M2L A;  4KN7 C;  3PO2 H;  1HUN A;  1JMC A;  1VQF A;  4UHV A;  4XXE A;  4O0A A;  3H3V C;  2EYF A;  3DEO A;  1H9R A;  4H13 C;  4DV0 Q;  1DCZ A;  1WTH A;  1UE1 A;  1U5K A;  1EIF A;  4KJO A;  1GHK A;  1EWC A;  5IIF A;  1OXV A;  2MNA A;  1CQV A;  1U4P A;  1VQJ A;  1B7Y B;  3ZJY C;  5IYC H;  1X56 A;  5ELE A;  4CKE A;  4KI0 A;  3J80 E;  1XYI A;  1YIT A;  2ID0 A;  1YIJ A;  4ILW A;  4LK1 C;  1A63 A;  3T51 B;  1VQ6 A;  1VQL A;  2RBM A;  4OO1 G;  1WTX A;  3I70 A;  2D5D A;  4LF6 Q;  4LF8 L;  1BCP F;  5EBC A;  3SHL A;  1BVS A;  1FJG L;  5E4W C;  4FP5 D;  4NXN L;  1DJR D;  1Y1V B;  3OTO L;  4YIJ A;  4JI5 L;  2LMC B;  3T1H L;  4FO2 A;  3VA7 A;  3I90 A;  3IFT A;  2L12 A;  1VQ5 A;  4B9W A;  2N8N A;  2XVS A;  1F9R A;  3QB3 A;  3LWU A;  4XTC S;  2JA7 B;  3CCR A;  5ELD A;  4LF4 L;  2BH2 A;  3H15 A;  4OGQ C;  1TWG H;  1YZ6 A;  4LUZ A;  4ULL A;  2K6A A;  2PQA A;  2JQO A;  1PH9 A;  4OL7 A;  4B3M L;  4KY6 A;  2A68 C;  5LHY 1;  4R1J A;  1KRS A;  1XMQ L;  4BXX G;  1JE4 A;  1QCB D;  3PV0 A;  5IYB G;  4OWW B;  1IYJ B;  3A5U A;  5M5X H;  1AE2 A;  1BBW A;  4JI4 Q;  2R7Z B;  3T4A C;  2R3Z A;  4CKB A;  3D3R A;  2O5J C;  2EDG A;  1SRO A;  5FO8 B;  4B3T L;  3VYS A;  3A8K E;  2JA5 B;  1STB A;  5JPN C;  5IWA L;  1I94 Q;  5K36 G;  4POF A;  1XNQ Q;  3BDC A;  2WAQ B;  4DA2 A;  1CA6 A;  2UXD L;  5M3F H;  1AZQ A;  5IYD H;  4K8J A;  2PI2 A;  1SNQ A;  5FO7 B;  3HOW H;  1S5C D;  4H44 C;  4OIK A;  3LGJ A;  4A3C H;  1TKW B;  5GAH C;  1F2L A;  1GO3 E;  1TR5 A;  3CC7 A;  3C1F A;  2K28 A;  2ZT9 C;  2PO4 A;  1S5E D;  1Q82 C;  1WVL A;  1LAB A;  3RMH A;  1IBM Q;  1Y1W G;  5M5W H;  4GLX A;  4ME3 A;  2L15 A;  1JJC B;  1PH7 A;  5ELN A;  2ALY B;  4RGM A;  1X3G A;  4N9T A;  4MZ9 A;  3TSS A;  3BDL A;  3E3X A;  3IAY A;  4A3M H;  4JI6 Q;  1I6V C;  1TWF B;  1GUT A;  1ONL A;  2VQF L;  2QA4 A;  2ASB A;  4DV7 Q;  1GD7 A;  3DMU A;  2JA6 B;  5M5Y B;  4IFD I;  1STE A;  2JE6 I;  4FF1 A;  2ES2 A;  1JQY D;  1D5M C;  2OT2 A;  4HCS A;  3S16 B;  2RVL A;  1HZB A;  1EQT A;  1PRT D;  4DV1 L;  1E7Z A;  1EIY B;  4XQN A;  4GN3 B;  3H0G B;  2PI2 E;  2DJF C;  2UXC Q;  3K81 C;  4A93 H;  1A6X A;  3A0J A;  4FF2 A;  3W1B A;  4OWX B;  2CWP A;  4B3S L;  2PQE A;  5FLM G;  1LAC A;  3R8B A;  5FJ8 G;  3PIP A;  1CI3 M;  1VQ9 A;  3D4W A;  1FGU A;  3FRP B;  4A3F B;  1B9M A;  1U9R A;  3QR8 A;  3N6R A;  5C0X J;  3UDI A;  2R92 H;  2PMZ E;  1SN8 A;  3TS0 A;  1EEF D;  5C3X A;  1ASZ A;  2A5H A;  5EQ0 A;  1J6Q A;  1N36 Q;  4KHZ A;  2HHH Q;  1H9S B;  4JI8 Q;  3NTH A;  4C3J B;  3CAM A;  3OPO A;  3ER0 A;  4QCL A;  1KC8 C;  4DN4 M;  5C44 B;  5AJ3 L;  4H0L C;  1PV4 A;  3CRL C;  1EYA A;  1KDC A;  3MC0 B;  1K8A C;  4MN3 A;  1LTS D;  3M3Y B;  5C0X G;  4DV0 L;  1JOO A;  3S1Q B;  3S2H H;  4C3I H;  5D65 A;  3NEL A;  3CD6 A;  3G7L A;  4B3R Q;  2B63 G;  3C3L A;  1HQM C;  4JW0 A;  1B9N A;  1CUK A;  3HOX H;  3GTG H;  4OXP A;  1VMP A;  2IX3 A;  4ZKC B;  4G4K A;  4LF6 L;  1KQS A;  4I7Z C;  4A3I G;  2NN6 I;  2ZJR A;  4GOP A;  3ERQ A;  4FXD A;  2ZM6 Q;  4YWM A;  3TEH B;  2EY1 A;  3KK7 A;  1PMR A;  4G7O C;  2Y0S B;  4AIM A;  4ZK9 B;  4RGT A;  2H5X A;  2YU9 H;  3BZC A;  4X3U A;  2J0T D;  3SK8 A;  4A4I A;  4A3E H;  2R93 H;  2WP8 J;  5IP9 G;  2WB1 G;  4CDF C;  1XX8 A;  3FPP A;  3F2D A;  4A3B B;  2F1M A;  5M9O A;  2N78 A;  4ALP A;  4ZUI A;  4IPC A;  5I6W A;  4CJ1 B;  1ILP A;  2JK8 A;  1B8A A;  4XYQ A;  4GNX B;  4IN3 A;  5HUR A;  1PFS A;  1Q86 C;  1DZ1 A;  1X3F A;  2A69 D;  2OQ0 A;  4K2K A;  4DR3 Q;  4JI4 L;  1ET6 A;  2XRQ D;  1A2T A;  1W6K A;  2B2T C;  2IT1 A;  2JP1 A;  1L1O B;  4GKK Q;  4IFD H;  3CP0 A;  4EQ5 A;  2AWN A;  3WWV A;  4L5R C;  1CM9 A;  1ROD A;  1S5B D;  2B2V A;  2WIN B;  1F9P A;  4FNF A;  3H91 A;  3K7U C;  2KHS A;  4X64 Q;  1I94 L;  1GUO A;  3K80 C;  2OTL A;  1XNQ L;  3D6W A;  5JEA J;  2KED A;  1LTB D;  4PNY A;  2FHT A;  4BY1 H;  3VDY A;  3CCQ A;  1T9H A;  2E5L Q;  4JVZ A;  2UUC Q;  3GV6 A;  1QVF A;  1XXG A;  4GZY C;  1EU4 A;  1QWY A;  2A6H C;  5C4J H;  3GO5 A;  4DV2 Q;  1CSP A;  1K0R A;  2Z4I A;  3TDQ A;  2SDF A;  5LMN Q;  1VQI A;  1PZJ D;  1PTO F;  1WCM B;  4Q5V A;  1IBM L;  4CBV A;  2VUM G;  2ZTE A;  2KEE A;  3AFQ A;  1N34 L;  4RCO A;  4LFC Q;  4NW2 A;  4RMF A;  5JEA G;  3PUZ A;  3NQI A;  5CMD A;  2NVX B;  4U67 3;  1OO9 B;  4BBS B;  3SK6 A;  5IT9 c;  4JI6 L;  3G71 A;  3HOU B;  1OXS C;  1HR0 Q;  4IZ8 A;  2J7Z A;  4DV7 L;  1PFM A;  1SND A;  2XWB B;  2PNH A;  4C56 C;  2N49 A;  3RNU A;  3GP7 A;  2CW0 D;  2KOL A;  4DR4 Q;  3CRK C;  2F0I A;  1GUG A;  3K5L A;  2A6E D;  1KDB A;  2RDG A;  3EVQ A;  2UXC L;  2ENB A;  3KF8 B;  3S1N H;  1SMX A;  1ML0 D;  4DV4 L;  3BU2 A;  1EZ6 A;  3V2T A;  4K6D A;  1BXT A;  2L0C A;  2E2H B;  2K5V A;  4QL5 A;  3MXN B;  1J9O A;  2JA8 B;  4EX5 A;  4IQZ A;  5CV7 A;  2EJM A;  4JI3 L;  1STN A;  3W1G A;  2NN6 H;  2BH8 A;  4IUV A;  1JWS D;  3FKI H;  1D5X C;  1PVO A;  1EQV A;  1N36 L;  2HHH L;  1NTG A;  2HCC A;  4R4C A;  3EJI A;  4JI8 L;  4HSV A;  3KJP A;  1EEI D;  1V1Q A;  1IL2 A;  4BY7 B;  1ILQ A;  4DNI A;  4HN7 A;  3D31 A;  4R4O A;  1QZH A;  2K50 A;  3A55 A;  5C4X B;  3UE0 A;  4P72 A;  4DV6 Q;  1CHQ D;  1QUQ A;  3J81 E;  2V1C C;  1STH A;  2L11 A;  4HIK A;  2JA9 A;  2YYZ A;  1PYB A;  2Q2I A;  1X6O A;  2WB1 E;  4LJZ C;  3T56 B;  4HJ9 A;  4JYA Q;  4C3H G;  4IO9 A;  1I50 H;  2PMZ B;  3PIO A;  1ZYR D;  2ZTD A;  1K83 B;  1LTI D;  4XYO A;  4J6H A;  5A2Q L;  4ME5 A;  1J8I A;  4ID6 A;  1ICW A;  1I6H B;  1PDQ A;  3DEP A;  5HY6 A;  3ND8 A;  2F0J A;  3D4R A;  2Z6K A;  2VQE Q;  1NSN S;  4DV5 L;  1E2W A;  1EIG A;  4XDX A;  4R8I A;  5KNB A;  2F3V A;  3HOY G;  2X6G A;  5JJZ A;  3U9S A;  3QIA A;  4ZKB B;  4QMG A;  5G3L F;  3S1M B;  1SE4 A;  1HH2 P;  2IHF A;  3EQL C;  3PO2 G;  3E6Z X;  3KLS X;  1FJG Q;  2WKD A;  1GKH A;  4JBJ A;  3AMU A;  3D0F A;  3PUX A;  3RZO H;  1U4R A;  2EYO A;  3J80 c;  1EYC A;  1SLJ A;  1Y1V H;  1K8M A;  3IL8 A;  1U4M A;  3GQB A;  3MHB A;  2VZA A;  3FVQ A;  3MWY W;  3KDF B;  2K5H A;  4DAM A;  4F88 A;  2FJ2 A;  1O7I A;  1H9J A;  4YCW A;  3SE0 A;  3RLO A;  5IGG A;  2AWO A;  3A7A B;  4Y7N B;  3CQZ B;  3MXU A;  1EOT A;  5EPK A;  1LT6 D;  4S3S A;  2JYO A;  2JA7 H;  3F2B A;  2CFM A;  1VQK A;  4KKT A;  4DR3 L;  3I4L A;  1LT5 D;  3E0E A;  1GUS A;  1L0X B;  4FXG C;  1UE6 A;  3JAM L;  4MTK A;  3UDG A;  1SE3 A;  1VQC A;  4GKK L;  1KLU D;  1D6E C;  3E9H A;  3CCL A;  1T5X D;  1BCP B;  2EPB A;  2OCE A;  3G48 A;  5BN4 A;  4X64 L;  1HZC A;  4F7X A;  1TS4 A;  2R7Z H;  2F03 A;  1YNN C;  4DR6 Q;  3S17 B;  3J7Z C;  3HOV G;  4A3D G;  1H9K A;  2F52 A;  3QG1 A;  5JJI A;  2E5L L;  2UUC L;  1SYC A;  3CCS A;  4J15 A;  2JA5 H;  3WOE A;  1AFP A;  4IUP A;  1Y1W B;  4OX9 Q;  1QNK A;  4PMW A;  5I6Y A;  1VQ7 A;  4DV2 L;  4DAY B;  2EZV A;  1Q81 C;  4KLK A;  2SOB A;  1JOR A;  3LNN A;  3R2T A;  2B8F A;  1BCP C;  4RGO S;  1HRJ A;  4HIO A;  1XWE A;  3WOF A;  3CCJ A;  2PZU A;  1U0L A;  3NPP A;  4LFC L;  5CR3 A;  1EZ8 A;  2VB2 X;  3AFP A;  2R7D A;  4X62 Q;  2ZJP A;  3GTJ B;  1O80 A;  1B70 B;  3RLN A;  2I5H A;  2VB3 X;  1ET9 A;  2IL8 A;  3T16 A;  4BWG B;  1JJG A;  1HR0 L;  3A7L A;  1XPU A;  1LTL A;  4ABN A;  3I2Z A;  4KD3 A;  3MXP A;  4BBR G;  1KHI A;  5IYD G;  1MSG A;  5FKA C;  2JN4 A;  4DR4 L;  4K6L A;  3BVM A;  3DHQ A;  2B2W A;  1EY7 A;  1ICF B;  1TWF H;  4RKB A;  3PUV A;  4UDU C;  1CQF A;  4GOP C;  2VS1 A;  1ENF A;  5M5Y H;  2JA6 H;  1JWU D;  5EKK A;  1E3P A;  1A62 A;  3MA2 B;  3HRZ C;  4P74 A;  1EYG A;  5I2Y A;  3S16 H;  2BOS A;  1AP0 A;  1CKO A;  2WV6 D;  1UE5 A;  4XT1 B;  3H0G H;  1N8R C;  1Q3L A;  3PQI A;  4A3M G;  2QW7 A;  3M9B A;  4X3T A;  1K9M C;  3M7G A;  3TS2 A;  1F2Z A;  4UP8 A;  2DNE A;  3B6Y A;  3R2I A;  3SDZ A;  1XJV A;  2KCC A;  4A3F H;  1G2S A;  1L2F A;  1QVG A;  1Q46 A;  3H94 A;  2F0G A;  3TP6 A;  3BZK A;  1VQG A;  4DV6 L;  4YHH Q;  4A93 G;  2K05 A;  5CC4 A;  1GHJ A;  4GN4 B;  4C3J H;  3QOL A;  4HJ5 A;  1H95 A;  1Q8K A;  4JYA L;  1BR9 A;  1A2U A;  2AKW B;  2QEJ C;  5C44 H;  5HGQ A;  3GTL B;  4HAE A;  2B8G A;  2FMM A;  1Y8P B;  1E2V A;  3CHB D;  4HMI A;  5JPM C;  3P75 A;  1M1K C;  4G7H C;  4QUC A;  1QB5 D;  2K32 A;  2GA4 B;  5CYU A;  2R92 G;  3M3Y H;  3BZD B;  2K5N A;  5I2X A;  4V0B A;  1ENC A;  2VQE L;  1JCK B;  3S1Q H;  2VXW A;  3STB D;  1LT3 D;  4OEL B;  1B4O A;  1A3V A;  3DLL A;  1YBY A;  1EU3 A;  1AN8 A;  1X55 A;  3VYU A;  2D2C C;  3ZYY X;  4JOI C;  3NBH B;  3NBI A;  1WTO A;  1SE2 A;  3U9O A;  1WD0 A;  2F0T A;  5EAY A;  1NE3 A;  1STG A;  1WJJ A;  2WB1 B;  3FPU B;  4XIG S;  1K28 A;  1TWH B;  5AFW A;  3J80 L;  1BF4 A;  3TBI B;  1SRU A;  1RD9 D;  1AW7 A;  1NR2 A;  3KF6 B;  3SVM A;  1OTC A;  3Q22 A;  2TMP A;  4IUU A;  3T53 B;  2F0O A;  2QDB A;  1DOL A;  3M4O B;  3NSW A;  5LMU Q;  3KOJ A;  3HOX G;  3GTM B;  3EIV A;  1VQD A;  3D6C A;  5C6A A;  3HZX A;  1MHW C;  4DFA A;  4DK6 C;  2QCP X;  4X3S A;  4JI2 Q;  1HNZ Q;  4A3B H;  2B39 A;  1G8Z D;  3HS0 C;  3FDT A;  1X3E A;  1WFQ A;  3K8A A;  5M3M B;  3RR5 A;  2EY6 A;  5KND A;  4FDB A;  5BN3 A;  2EYL A;  2CH4 A;  3K7A B;  1JE5 A;  1PRT C;  1O78 A;  2OWO A;  4OO1 I;  4TSS A;  1F9S A;  2AQ3 B;  1GOZ A;  1PYS B;  2KUM A;  4IOC A;  3PO3 B;  1SMY D;  2RA4 A;  4A3E G;  4DR6 L;  2R93 G;  5C3E G;  1IKM A;  4JCV E;  1QJO A;  3SGI A;  4IFD J;  3HOZ B;  1RCV D;  3M7N A;  2MHV A;  2PCF B;  5GRO A;  3G6E A;  4NMZ A;  2F3W A;  1V1P A;  4DPG A;  1NY4 A;  4OX9 L;  2VUM B;  3OIQ A;  1SNC A;  2HUG A;  4JBW A;  5L37 A;  2B2U A;  3P1H A;  1YNX A;  4CJ2 C;  1EQQ A;  1Q7Y C;  1IKL A;  5GAG C;  5FLX L;  4GKJ Q;  4RG1 A;  1HTL D;  3CCU A;  1JJ2 A;  1IBL Q;  3OIP A;  4IJL A;  4X62 L;  4A75 A;  4IFD G;  4MNO A;  1EIH A;  2AQ2 B;  1I4H A;  1WCM H;  1N34 Q;  1CZW A;  1JC7 A;  3OW2 A;  4LAA A;  3W5O A;  3OSO A;  2PW7 A;  2NWG A;  2AUJ D;  1PH3 A;  4FF3 A;  3K0X A;  1HQR D;  2NVX H;  1PA6 A;  1Y14 B;  4BBS H;  2UU9 Q;  4DR2 L;  4KHV A;  1N33 Q;  3HOU H;  1SYF A;  5J1Z A;  3S24 A;  2KHJ A;  1EFW A;  4OON A;  2K14 A;  3S2D B;  1CKN B;  4TRD A;  3I91 A;  5T1I A;  4C2M B;  1EFI D;  3CCV A;  1PLF A;  4DV4 Q;  2ZXR A;  3ULP A;  1TY0 A;  3UDF A;  3IFD A;  1PTO B;  4POG A;  1K8O A;  4NDX A;  1JIC A;  2E2H H;  2A68 D;  3NEM A;  1S72 A;  4OEM B;  4JI3 Q;  4KKS A;  3NUC A;  1S5D D;  2E2D C;  3OMG A;  3Q8D A;  1RJT A;  5HGT A;  3KUP A;  2LS0 1;  2G9H D;  2BA0 A;  3M85 A;  2C9O A;  2RKS A;  1YJ9 A;  2QF7 A;  4YHH L;  5IGB A;  2F0N A;  2F4I A;  4DNR B;  4BY7 H;  1PTO C;  4FVM A;  3Q23 A;  3K5O A;  1PRT F;  4CHT B;  1CSQ A;  5C4X H;  4K8I A;  4A76 A;  3HOY B;  3CF5 A;  1HJP A;  4IUN A;  1FR3 A;  1E22 A;  1CA5 A;  2EJF C;  4PV1 C;  4A3G B;  1Y69 U;  1SE8 A;  1K83 H;  1QZG A;  4OO1 H;  1Y8N B;  4CJ0 B;  3J81 c;  1VQA A;  3GTQ B;  4DV5 Q;  1TS5 A;  3A74 A;  5C4Z A;  1I6H H;  2B2Y A;  3C2P A;  2Q2T A;  1ENA A;  3HKZ G;  1ESR A;  4HCE A;  3H6M A;  4DK0 A;  2RSN A;  2XGT A;  1XTC D;  1GJX A;  4IUT A;  1YHQ A;  2F0E A;  4AH6 A;  2NVT B;  5DEH A;  4JBK A;  3M4P A;  5I9O A;  5KYI A;  5FK9 C;  1I4Q A;  2HIX A;  3S1M H;  3A8J E;  1EWH A;  1LTA D;  4M8A A;  4DAY A;  3H3V I;  4HMJ A;  5LMU L;  4NKL A;  5C0X I;  3K5N A;  1IW7 D;  2B2W C;  3ERO A;  4QIW E;  3OW7 A;  3X3N A;  1VQ4 A;  1XNR Q;  1D5Z C;  4LUV A;  4BXX H;  3L9A X;  1VQE A;  3MFG A;  1HNZ L;  4JI2 L;  2O2L D;  3OWF A;  4A3K G;  4XQJ A;  2A73 B;  5D14 A;  3PIP 3;  2A19 A;  4RGN A;  2NVY B;  2K03 A;  2MP1 A;  4Y7N H;  2CW0 C;  3CQZ H;  3PSI A;  3HOV B;  1I3Q B;  4A3D B;  3TZD A;  3K6O A;  3L2P A;  2A6E C;  3RUZ A;  3NK9 A;  2RSO A;  3GTK B;  4MTN A;  3AQQ A;  3OOC A;  2A1A A;  5K36 H;  4DR7 Q;  1IYV A;  2KJX A;  1LO5 D;  2K1B A;  2E2J B;  1H9M A;  2MPM A;  3IKJ A;  4ZUJ A;  4DK1 A;  3DXJ C;  2SNS A;  4IJH A;  4XT3 B;  4K0K Q;  2OTJ A;  2M9V A;  5KYL A;  2MO0 A;  1X32 A;  1JOQ A;  4K14 A;  3S1R B;  3I4M G;  2Q8R E;  3I4N B;  1Z6H A;  3Q6S A;  5IOC A;  4GKJ L;  1Y1W H;  4DR1 Q;  1IBL L;  1D8L A;  4BBR B;  2LXJ A;  1VQN A;  2ICE C;  3I72 A;  1UUP A;  5EKL A;  1K8G A;  3GV3 A;  2CQA A;  4OWT B;  1B53 A;  2F3I A;  1EY6 A;  4CKC A;  5CV9 A;  2EOT A;  2R7Z G;  4L5Q A;  4A3J B;  1CK1 A;  2DY7 A;  2RF4 A;  2FMC A;  4LWC A;  2PPB C;  4UY8 C;  2D0O A;  3CC4 A;  4UPA A;  3GTJ H;  2XRS D;  2UU9 L;  2OEO A;  3K0Y A;  1BKB A;  2JA5 G;  1Q8I A;  1N33 L;  2F0D A;  2WAQ G;  4RA8 A;  5T1G A;  4HJ8 A;  1TU2 B;  1TQO A;  5C5L A;  4A3M B;  2PQA B;  2HDL A;  2O5I C;  4LFA Q;  4A3L G;  3DUZ A;  3BYT B;  4DUY Q;  5DAU A;  4EVO A;  1FNV A;  1TII D;  4JV5 Q;  1NR4 A;  3NWS A;  3DWA A;  4RH6 A;  4O2D A;  4RKL A;  1M90 C;  1HZA A;  1XPR A;  4UAI A;  3NHH A;  2HD3 A;  3NBH A;  2HQL A;  1TVX A;  3HKZ E;  4IAL A;  1G2T A;  2ZTC A;  1DM0 B;  1EQR A;  2NZO A;  1KXL A;  1J5E Q;  3KJO A;  1WTR A;  2WAC A;  3H3V H;  4GLV B;  2R92 B;  3ERS X;  2V4D A;  1NJI C;  1FL0 A;  2I07 B;  1WTQ A;  5C0X H;  1YVC A;  2PZT A;  3A54 A;  2XSC A;  5LMN W;  4YY3 Q;  3CMA A;  2IX0 A; 
#chains in the Genus database with same CATH homology
 3HGB A;  4DF7 A;  2Q8T A;  2NTT A;  2MUY A;  3G6J B;  1TT2 A;  3S15 B;  2E75 C;  1Q1B A;  3QJY A;  1RHP A;  5IGC A;  1TWA B;  3J81 L;  3S14 B;  3MAQ A;  4L63 B;  4F87 A;  5CGK A;  1JOK A;  3D8G A;  1MSH A;  4KN4 C;  3VYR A;  4Q0F A;  1NAP A;  4J8Q A;  2Z1C A;  3SK5 A;  1NCV A;  4PQX A;  1F2Y A;  2L4N A;  2PYK A;  1MGS A;  2K5W A;  3ITP A;  2KEC A;  5JVG 3;  3EA6 A;  4BS9 A;  2JEB I;  2BCO A;  5ELF A;  3E0J A;  2F0P A;  3GTP B;  1I4P A;  1Q12 A;  2Z4H A;  4WRD A;  2NB0 A;  1IL8 A;  2XWJ B;  5C3E B;  4LMQ D;  4RCN A;  4B08 A;  1SYE A;  2K33 A;  1X3Q A;  3SK4 A;  1LTT D;  1PZI D;  3BYY B;  4Z9C B;  1NUC A;  1BOS A;  4K5V A;  2L9H A;  2F0Q A;  4QIW B;  3JAM E;  2HCI A;  5D3D A;  1SFO B;  1S5F D;  1SYG A;  1RF2 D;  1A15 A;  3RZD B;  1TS3 A;  3K58 A;  3NE5 B;  4TKO B;  3F2U A;  1EY5 A;  1KDA A;  4QB4 A;  2BE5 C;  1Z7T A;  2E2I B;  1PFB A;  3HEJ A;  1U4L A;  2NBF A;  5C5M A;  2F0F A;  2XIW A;  1OXX K;  1SDF A;  1BNZ A;  3S9W A;  2LKV A;  4E6I A;  3FMC A;  5IT9 L;  4I65 A;  4JK1 C;  4IUQ A;  3T13 A;  1Y8O B;  4BA1 I;  1BDO A;  2JSO A;  3QOJ A;  1YNJ C;  1H9S A;  1ZEQ X;  4G57 A;  4HTH A;  3R93 A;  3LX0 A;  2HDM A;  1TWC B;  4DAV A;  2EY2 A;  2EYH A;  1FNU A;  3I8Z A;  3BVZ A;  3PUW A;  4KK7 A;  1STA A;  3VYT A;  2DY8 A;  2LY7 A;  3A56 A;  5KNC A;  2Q8I B;  1DON A;  3FEW X;  3BG3 A;  1O7Y A;  2EYM A;  4EQN A;  4PMB A;  4KV6 A;  5E3F A;  1MD2 D;  2K7V A;  1S4Z A;  1KTK A;  1PTO H;  3VR6 A;  3TP7 A;  2EY5 A;  5EPL A;  1STY A;  2NUC A;  2OXP A;  1HA6 A;  1M8A A;  1YNN D;  2M00 A;  1GUW A;  3VA5 A;  2B63 B;  1KNE A;  1SYD A;  4O1N A;  2K5Q A;  2B2V C;  5LL6 S;  5F2D A;  2TSS A;  1B3A A;  3X3M A;  1V43 A;  2RDF A;  3O13 A;  1G29 1;  3HKZ B;  3C46 A;  3BVG A;  2KCN A;  1VF7 A;  3D4D A;  1VMC A;  1BCP D;  4WJW A;  4A3I B;  5A35 A;  2H4O A;  2CHB D;  3PMF A;  5EBD A;  1EYD A;  1KNA A;  4NP5 A;  5ISR A;  1DXM A;  4L8J A;  2AUK A;  4RWS C;  1A3U A;  1R4P B;  2KQ3 A;  4A3K B;  2HQE A;  1GUN A;  5FOB B;  2JXM B;  3BS1 A;  4C3I G;  1WTW A;  1PRT B;  1I4X A;  1V1O A;  2KVM A;  3MTS A;  2MGS A;  4HR7 B;  5TSS A;  4FXK C;  5IGE A;  1A3T A;  1KAA A;  1HFN A;  1M4V A;  2SNM A;  3RZO B;  1Q1E A;  2X6L A;  4F8M A;  3A8I E;  4M1U B;  3GTO B;  1T5E A;  1IYU A;  5KGU A;  4ODG A;  5IGF A;  5KEE A;  1SNP A;  2F0K A;  4CGY B;  3I4M B;  2ICI A;  2CVR A;  3LWE A;  3OWE B;  5K5P A;  3VR4 A;  2MJ8 A;  4K2L A;  5EGT A;  3KF8 A;  3ONA B;  1LTG D;  1B44 D;  4C1N K;  5CV6 A;  2N55 A;  1UEA B;  2IW3 A;  3MXN A;  4QUF A;  2VNU D;  4TQU S;  3W3A A;  2NVQ B;  2F0M A;  2D9U A;  4DAP A;  2K01 A;  4FF4 A;  5CV5 A;  5FO9 B;  1JB3 A;  5FLX E;  2IPK D;  4WOR A;  1QNU A;  2IX1 A;  3P7J A;  1G6Z A;  3I3C A;  3KLR A;  2H1E A;  5E4X A;  5LL6 X;  3NP8 A;  2EVB A;  1AZP A;  4BA2 I;  2BA1 A;  5KRU A;  1Q90 A;  3Q0A A;  5IGD A;  1TY2 A;  2IWH A;  1HHV A;  2D62 A;  5COR A;  1SSO A;  3CU7 A;  5EKI A;  1F2M A;  1ZXT A;  1R9T B;  5CV4 A;  1ZKO A;  1HPC A;  1SBB B;  1CTM A;  2WII B;  1HFG A;  4C1N I;  5NUC A;  2F0L A;  1IW7 C;  4C3H B;  1RTN A;  1GXD C;  4DXF A;  1G91 A;  1C8C A;  1PZK D;  3L7Z C;  1CFM A;  2A69 C;  2EJG C;  3DWQ A;  4EQO A;  1E0B A;  2DNC A;  3I73 A;  4IUR A;  4DU9 A;  1EY9 A;  5I9P A;  2RQX A;  2NN6 G;  1BBX C;  1CT1 D;  3TP8 A;  2F0U A;  2FFK B;  2I46 A;  3PO2 B;  4ZRZ A;  4KJN A;  1TS2 A;  1ESF A;  1V8Q A;  4KY7 A;  2BDN A;  1FD7 D;  1SJH D;  3BDO A;  2ZXO A;  4RHS A;  1QIL A;  4ZYS A;  5IOD A;  3NTI A;  4RAU C;  1F77 A;  2R6G A;  4KMU C;  4R8N A;  1HTP A;  3J7A V;  3J7A F;  4O42 A;  1B50 A;  5I4D A;  1PXU A;  5JOB A;  4L6T B;  2K04 A;  3MVV A;  1JWM D;  4OIJ A;  3SEB A;  2L5T A;  5J39 A;  1VF5 C;  2F0H A;  3EFX D;  1X3P A;  1OXU A;  4EGV A;  1TWG B;  1QE6 A;  3AU7 A;  3R3O A;  3MEH A;  2BDO A;  3HG9 A;  5M5X B;  1PTO D;  1Z47 A;  3J7Y W;  3L3O C;  4X3K A;  5J22 A;  3MZ5 A;  1HXY D;  1KLG D;  2F0W A;  5JAV A;  3RD4 A;  4KKU A;  4AYB B;  3W2D A;  2F0S A;  5DM7 3;  1SJE D;  4WFN 3;  3TZU A;  5M3F B;  2L1B A;  2KA7 A;  3HOW B;  1QG7 A;  3P20 A;  1VCI A;  2R61 A;  2A74 C;  3URY A;  1ZYR C;  3H09 A;  1C4Q A;  3QWN A;  4J1M A;  1L0Y B;  5M5W B;  5EPJ A;  2N88 A;  5ELB A;  3TN2 A;  5KIX A;  1JR0 D;  2Z8L A;  4MHE A;  4U68 A;  4DGZ A;  1DD2 A;  2G9D A;  3DM1 A;  1I4G A;  2QKI C;  2RDH A;  3KLS A;  1FNW A;  1LT4 D;  4A93 B;  2XN9 C;  3NQT A;  4ZLT F;  3KBG A;  1DYQ A;  3K59 A;  1V1P B;  2QIL A;  3RLF A;  4H7B A;  1SEB D;  5BN5 A;  2EE1 A;  1CZG A;  1FYC A;  1RDP D;  2SEB D;  2EYP A;  4PMC A;  4K5W A;  1O7L A;  4KD4 A;  2A6H D;  1B2T A;  2E74 C;  2NTS A;  4EQP A;  4HSP A;  1EY8 A;  2WKC A;  3VR5 A;  1SYB A;  5G3L D;  1SAP A;  4P2C B;  2B2U C;  3GD7 A;  3S2H B;  1EY4 A;  5A2Q E;  4C3I B;  1HA5 A;  3SXH A;  2PZW A;  4RHR A;  3K5M A;  2O4X A;  2ZXP A;  3NXW A;  3UI2 A;  4C3J G;  5JVH 3;  5COY A;  2IJ0 A;  3HOX B;  3GTG B;  1C48 A;  3TME A;  1RTO A;  2OF1 A;  1II3 A;  3K57 A;  1F9Q A;  2K5D A;  3OHX C;  5CBE E;  1BUV T;  4FYD A;  4K5X A;  3N52 A;  1CHP D;  3NTK A;  5C4H A;  1PYW D;  5EJW A;  5DNF A;  2PNR C;  2YU9 B;  2C5C A;  4A3E B;  2R93 B;  1BO0 A;  1O7Z A;  1PFN A;  1SXT A;  4MIU A;  1QOH A;  4B9X A;  1WTP A;  1W6J A;  1D1I A;  5ELC A;  1OXT A;  3M4Y A;  1WD1 A;  1E2Z A;  4ZAI A;  4ZQ3 A;  1RKN A;  4V19 0;  3NWT A;  2L55 A;  3E5S A;  1B1Z A;  4HED A;  1LV9 A;  1UNS A;  3OMC A;  4DNT B;  3PIO 3;  1DOK A;  3HP3 A;  2PW5 A;  5JEA H;  5C3W A;  4BY1 B;  5DM6 3;  2FIN B;  2DN8 A;  3ND9 A;  1MBY A;  2F0V A;  3PUY A;  5C4J B;  2XNA C;  1I4R A;  2J4X A;  5IT9 E;  5D3I B;  4G7Z C;  4QF4 A;  1DOM A;  1SNM A;  2B2Y C;  1VDZ A;  1IHZ A;  1D2B A;  3V96 A;  1LLR D;  3KBX A;  1AEX A;  3VR2 A;  1R4Q B;  2EYJ A;  3C1E A;  2EXZ A;  3AB9 A;  4RFB A;  3S1N B;  3V05 A;  4KY5 A;  2NYZ D;  4R9W A;  1D1K A;  5CBA E;  2NZ1 D;  3Q24 A;  5E1F A;  1HUM A;  3QO2 A;  3MXG A;  1SNO A;  1WTV A;  1EL0 A;  3CKI B;  3FKI B;  2AQ1 B;  3SR1 A;  1LTR D;  5CV8 A;  2B2T A;  2JEA I;  1HCZ A;  2E76 C;  1MI2 A;  2X69 A;  3DWP A;  2BE5 D;  1EY0 A;  3VR3 A;  3WDN A;  2LFN A;  3TP5 A;  4XQQ A;  1SMY C;  4N9P A;  3MFY A;  4KTA A;  4DXG A;  4OHJ A;  1I50 B;  1UAP A;  1BQQ T;  1YNJ D;  1HUN A;  1FGB D;  1KAB A;  2M2L A;  4KN7 C;  4XXE A;  3H3V C;  2EYF A;  3DEO A;  1H9R A;  4H13 C;  1DCZ A;  4KJO A;  1GHK A;  1EWC A;  5IIF A;  1OXV A;  1CQV A;  1U4P A;  5ELE A;  4CKE A;  4KI0 A;  3J80 E;  1XYI A;  2ID0 A;  4ILW A;  4LK1 C;  3T51 B;  2RBM A;  4OO1 G;  1WTX A;  3I70 A;  2D5D A;  1BCP F;  5EBC A;  3SHL A;  5E4W C;  4FP5 D;  1DJR D;  1Y1V B;  4YIJ A;  2LMC B;  4FO2 A;  3VA7 A;  3I90 A;  3IFT A;  2L12 A;  4B9W A;  2XVS A;  1F9R A;  3QB3 A;  3LWU A;  4XTC S;  2JA7 B;  5ELD A;  4OGQ C;  4ULL A;  2K6A A;  4OL7 A;  4KY6 A;  2A68 C;  5LHY 1;  1JE4 A;  1QCB D;  3PV0 A;  2R7Z B;  3T4A C;  2R3Z A;  4CKB A;  3D3R A;  2O5J C;  2EDG A;  5FO8 B;  3VYS A;  3A8K E;  2JA5 B;  1STB A;  5JPN C;  5K36 G;  3BDC A;  2WAQ B;  4DA2 A;  1CA6 A;  1AZQ A;  4K8J A;  1SNQ A;  5FO7 B;  1S5C D;  4H44 C;  4OIK A;  1TKW B;  1F2L A;  1TR5 A;  3C1F A;  2K28 A;  2ZT9 C;  2PO4 A;  1S5E D;  1WVL A;  1LAB A;  3RMH A;  4RGM A;  4N9T A;  3TSS A;  3BDL A;  3IAY A;  1I6V C;  1TWF B;  1GUT A;  1ONL A;  3DMU A;  2JA6 B;  5M5Y B;  4IFD I;  1STE A;  2JE6 I;  4FF1 A;  1JQY D;  1D5M C;  2OT2 A;  4HCS A;  3S16 B;  2RVL A;  1PRT D;  1EQT A;  4XQN A;  3H0G B;  1A6X A;  4FF2 A;  2PQE A;  1LAC A;  3R8B A;  1CI3 M;  3D4W A;  3FRP B;  4A3F B;  1B9M A;  1U9R A;  3N6R A;  5C0X J;  1EEF D;  5C3X A;  2A5H A;  5EQ0 A;  4KHZ A;  1H9S B;  3NTH A;  4C3J B;  3OPO A;  4QCL A;  4DN4 M;  5C44 B;  4H0L C;  3CRL C;  1EYA A;  1KDC A;  3MC0 B;  4MN3 A;  1LTS D;  3M3Y B;  5C0X G;  1JOO A;  3S1Q B;  5D65 A;  3G7L A;  3C3L A;  1HQM C;  1B9N A;  1VMP A;  2IX3 A;  4ZKC B;  4G4K A;  4I7Z C;  2NN6 I;  3ERQ A;  4FXD A;  2EY1 A;  3KK7 A;  1PMR A;  4G7O C;  2Y0S B;  4ZK9 B;  4RGT A;  4X3U A;  2J0T D;  3SK8 A;  2WP8 J;  1XX8 A;  3FPP A;  4A3B B;  2F1M A;  5M9O A;  4ZUI A;  5I6W A;  1ILP A;  4CJ1 B;  4XYQ A;  4IN3 A;  5HUR A;  1DZ1 A;  2A69 D;  4K2K A;  1ET6 A;  2XRQ D;  1A2T A;  1W6K A;  2B2T C;  2IT1 A;  2JP1 A;  4IFD H;  2AWN A;  1CM9 A;  1ROD A;  1S5B D;  2B2V A;  2WIN B;  1F9P A;  4FNF A;  3H91 A;  2KHS A;  1GUO A;  3D6W A;  5JEA J;  2KED A;  1LTB D;  4PNY A;  2FHT A;  3GV6 A;  1XXG A;  4GZY C;  1EU4 A;  1QWY A;  2A6H C;  3GO5 A;  2Z4I A;  3TDQ A;  2SDF A;  1PZJ D;  1PTO F;  1WCM B;  4Q5V A;  4CBV A;  2KEE A;  4RCO A;  4NW2 A;  5JEA G;  3PUZ A;  3NQI A;  5CMD A;  2NVX B;  4U67 3;  1OO9 B;  4BBS B;  3SK6 A;  3HOU B;  1OXS C;  4IZ8 A;  2J7Z A;  1PFM A;  1SND A;  2XWB B;  4C56 C;  3GP7 A;  2CW0 D;  2KOL A;  3CRK C;  2F0I A;  1GUG A;  3K5L A;  2A6E D;  1KDB A;  2RDG A;  3EVQ A;  2ENB A;  1ML0 D;  1EZ6 A;  3V2T A;  4K6D A;  1BXT A;  2L0C A;  2E2H B;  1J9O A;  2JA8 B;  4IQZ A;  5CV7 A;  2EJM A;  1STN A;  2NN6 H;  4IUV A;  1JWS D;  1D5X C;  1EQV A;  2HCC A;  3EJI A;  4HSV A;  1EEI D;  4BY7 B;  1ILQ A;  4HN7 A;  3D31 A;  3A55 A;  5C4X B;  1CHQ D;  3J81 E;  1STH A;  2L11 A;  2YYZ A;  4LJZ C;  3T56 B;  4C3H G;  2PMZ B;  1ZYR D;  1K83 B;  1LTI D;  4XYO A;  4J6H A;  5A2Q L;  4ME5 A;  1J8I A;  4ID6 A;  1ICW A;  1I6H B;  1PDQ A;  3DEP A;  2F0J A;  3D4R A;  3ND8 A;  1NSN S;  1E2W A;  1EIG A;  4XDX A;  4R8I A;  5KNB A;  2F3V A;  2X6G A;  5JJZ A;  3U9S A;  3QIA A;  4ZKB B;  4QMG A;  5G3L F;  3S1M B;  1SE4 A;  3EQL C;  3E6Z X;  3KLS X;  2WKD A;  3AMU A;  3PUX A;  1U4R A;  2EYO A;  1EYC A;  1K8M A;  3IL8 A;  1U4M A;  3GQB A;  3MHB A;  3FVQ A;  3MWY W;  4F88 A;  2FJ2 A;  1H9J A;  3SE0 A;  5IGG A;  2AWO A;  3A7A B;  4Y7N B;  3CQZ B;  3MXU A;  1EOT A;  5EPK A;  1LT6 D;  4S3S A;  2JYO A;  4KKT A;  3I4L A;  1LT5 D;  1GUS A;  1L0X B;  4FXG C;  3JAM L;  1SE3 A;  1KLU D;  1D6E C;  1T5X D;  1BCP B;  2EPB A;  5BN4 A;  4F7X A;  1TS4 A;  2F03 A;  1YNN C;  3S17 B;  1H9K A;  3QG1 A;  1SYC A;  3WOE A;  1AFP A;  4IUP A;  1Y1W B;  1QNK A;  4PMW A;  5I6Y A;  2EZV A;  2SOB A;  1JOR A;  3LNN A;  3R2T A;  2B8F A;  1BCP C;  4RGO S;  1HRJ A;  1XWE A;  3WOF A;  2PZU A;  3NPP A;  5CR3 A;  1EZ8 A;  2VB2 X;  3GTJ B;  1O80 A;  2VB3 X;  1ET9 A;  2IL8 A;  3T16 A;  4BWG B;  3A7L A;  4ABN A;  4KD3 A;  3MXP A;  1MSG A;  5FKA C;  4K6L A;  3BVM A;  3DHQ A;  2B2W A;  1EY7 A;  4RKB A;  3PUV A;  4UDU C;  1CQF A;  1ENF A;  1JWU D;  5EKK A;  3MA2 B;  3HRZ C;  5I2Y A;  2BOS A;  1AP0 A;  2WV6 D;  4XT1 B;  1Q3L A;  4X3T A;  3M7G A;  1F2Z A;  2DNE A;  3R2I A;  3SDZ A;  2KCC A;  1G2S A;  3H94 A;  2F0G A;  3TP6 A;  2K05 A;  5CC4 A;  1GHJ A;  3QOL A;  1BR9 A;  1A2U A;  2QEJ C;  3GTL B;  4HAE A;  2B8G A;  2FMM A;  1Y8P B;  1E2V A;  3CHB D;  4HMI A;  5JPM C;  3P75 A;  4G7H C;  4QUC A;  1QB5 D;  2K32 A;  2GA4 B;  5CYU A;  3BZD B;  5I2X A;  4V0B A;  1ENC A;  1JCK B;  2VXW A;  1LT3 D;  1B4O A;  1A3V A;  1EU3 A;  1AN8 A;  3VYU A;  2D2C C;  3ZYY X;  3NBI A;  1WTO A;  1SE2 A;  3U9O A;  1WD0 A;  2F0T A;  1STG A;  2WB1 B;  3FPU B;  4XIG S;  1TWH B;  5AFW A;  3J80 L;  1BF4 A;  3TBI B;  1RD9 D;  1AW7 A;  1NR2 A;  3SVM A;  3Q22 A;  2TMP A;  4IUU A;  3T53 B;  2F0O A;  2QDB A;  1DOL A;  3M4O B;  3NSW A;  3GTM B;  3D6C A;  5C6A A;  3HZX A;  4DFA A;  2QCP X;  4X3S A;  2B39 A;  1G8Z D;  3FDT A;  3HS0 C;  5M3M B;  5KND A;  2EY6 A;  5BN3 A;  2EYL A;  3K7A B;  1PRT C;  1O78 A;  4OO1 I;  4TSS A;  1F9S A;  2AQ3 B;  1GOZ A;  2KUM A;  3PO3 B;  1SMY D;  2RA4 A;  1IKM A;  1QJO A;  4IFD J;  3HOZ B;  1RCV D;  3M7N A;  2MHV A;  2PCF B;  4NMZ A;  2F3W A;  1V1P A;  2VUM B;  3OIQ A;  1SNC A;  2HUG A;  4JBW A;  2B2U A;  3P1H A;  4CJ2 C;  1IKL A;  5FLX L;  1HTL D;  3OIP A;  4IFD G;  1EIH A;  2AQ2 B;  1I4H A;  1CZW A;  1JC7 A;  4LAA A;  3OSO A;  2PW7 A;  2NWG A;  2AUJ D;  4FF3 A;  1HQR D;  4KHV A;  1SYF A;  5J1Z A;  3S2D B;  4TRD A;  3I91 A;  5T1I A;  4C2M B;  1EFI D;  1PLF A;  2ZXR A;  1TY0 A;  3IFD A;  1PTO B;  1K8O A;  4NDX A;  1JIC A;  2A68 D;  4KKS A;  3NUC A;  1S5D D;  2E2D C;  3OMG A;  1RJT A;  5HGT A;  3KUP A;  2LS0 1;  2G9H D;  2BA0 A;  3M85 A;  2C9O A;  2RKS A;  2QF7 A;  5IGB A;  2F0N A;  2F4I A;  4DNR B;  1PTO C;  4FVM A;  3Q23 A;  3K5O A;  1PRT F;  4CHT B;  4K8I A;  3HOY B;  4IUN A;  1FR3 A;  1CA5 A;  2EJF C;  4PV1 C;  4A3G B;  1Y69 U;  4OO1 H;  1Y8N B;  4CJ0 B;  3GTQ B;  1TS5 A;  5C4Z A;  2B2Y A;  3C2P A;  1ENA A;  1ESR A;  4HCE A;  3H6M A;  4DK0 A;  2RSN A;  1XTC D;  1GJX A;  4IUT A;  2F0E A;  2NVT B;  5DEH A;  5I9O A;  5KYI A;  5FK9 C;  1I4Q A;  3A8J E;  1EWH A;  1LTA D;  4M8A A;  4DAY A;  4HMJ A;  4NKL A;  5C0X I;  3K5N A;  1IW7 D;  2B2W C;  3ERO A;  3OW7 A;  3X3N A;  1D5Z C;  3L9A X;  3MFG A;  2O2L D;  3OWF A;  4XQJ A;  2A73 B;  5D14 A;  3PIP 3;  4RGN A;  2NVY B;  2K03 A;  2MP1 A;  2CW0 C;  3HOV B;  1I3Q B;  4A3D B;  3TZD A;  3K6O A;  2A6E C;  3RUZ A;  3NK9 A;  2RSO A;  3GTK B;  3OOC A;  5K36 H;  1IYV A;  2KJX A;  1LO5 D;  2K1B A;  2E2J B;  1H9M A;  2MPM A;  3IKJ A;  4ZUJ A;  4DK1 A;  3DXJ C;  2SNS A;  4XT3 B;  2M9V A;  5KYL A;  1X32 A;  1JOQ A;  4K14 A;  3S1R B;  2Q8R E;  3I4N B;  1Z6H A;  3Q6S A;  5IOC A;  4BBR B;  2ICE C;  3I72 A;  1UUP A;  5EKL A;  3GV3 A;  2CQA A;  1B53 A;  1EY6 A;  4CKC A;  5CV9 A;  2EOT A;  4A3J B;  1CK1 A;  2DY7 A;  2FMC A;  2PPB C;  2XRS D;  2OEO A;  3K0Y A;  1Q8I A;  2F0D A;  4RA8 A;  5T1G A;  1TU2 B;  1TQO A;  5C5L A;  4A3M B;  2HDL A;  2O5I C;  3DUZ A;  3BYT B;  5DAU A;  4EVO A;  1FNV A;  1TII D;  1NR4 A;  3NWS A;  3DWA A;  4RH6 A;  4RKL A;  4UAI A;  3NHH A;  3NBH A;  1TVX A;  4IAL A;  1G2T A;  1DM0 B;  1WTR A;  2WAC A;  2R92 B;  2V4D A;  1WTQ A;  2I07 B;  5C0X H;  2PZT A;  3A54 A;  2XSC A;  2IX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...