3CRKC

Crystal structure of the pdhk2-l2 complex.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
87
structure length
86
Chain Sequence
SYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional insights into the molecular mechanisms responsible for the regulation of pyruvate dehydrogenase kinase 2.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Pyruvate dehydrogenase [lipoamide] kinase isozyme 2, mitocho
total genus 12
structure length 86
sequence length 87
chains with identical sequence D
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2008-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3crkC00
3SDZA 1V43A 3MFYA 2IT1A 4L8JA 5BN4A 3A7LA 1OXVA 1IW7C 5C0XH 1K8MA 4TQUS 3DXJC 3BG3A 2EJFC 3MXUA 4DK1A 3VR2A 4DNTB 4TKOB 1Y69U 4IFDG 1HTPA 1VDZA 2BE5C 3AB9A 4OO1G 1TKWB 4BA1I 2JXMB 2D5DA 2NN6I 2KA7A 1GJXA 5KNDA 3D4RA 1DD2A 2E74C 3PUZA 5BN5A 1HCZA 2B8FA 3OW7A 1V8QA 1H9SB 1OXXK 2L5TA 3KLRA 2V4DA 2DNEA 3VR5A 2BDOA 2EJMA 1DXMA 1HQMC 3P20A 2A6EC 2DNCA 1IYVA 1VF7A 2A6HD 4JBWA 2EDGA 4G7ZC 1HPCA 4IFDH 2O5JC 1E2ZA 1G291 3T51B 1OXSC 3EQLC 2EJGC 2CW0C 1VF5C 2KCCA 2BA1A 3QG1A 4PV1C 2Q8IB 1Y8OB 3D31A 3I72A 1SMYC 1IW7D 1GHKA 5K36G 2NN6H 2YYZA 1GUGA 2PCFB 3LWUA 3N6RA 3VR4A 3A8KE 2A68D 4GZYC 3I73A 1PMRA 1IYUA 4HR7B 2PPBC 5K36H 3A7AB 3IFTA 2B8GA 3PUXA 3H94A 4KI0A 3SE0A 1VCIA 2D62A 2QF7A 2O5IC 3CRKC 1E2WA 3OPOA 3U9SA 1CTMA 1T5EA 2A69D 2E76C 3HGBA 1YNNC 2JEAI 3L7ZC 2EVBA 1Z7TA 5A35A 3ND9A 3LNNA 1ZKOA 3VR6A 3CRLC 1Y8NB 1E2VA 1B9MA 4DNRB 1LACA 1CFMA 3I4LA 3OOCA 3NE5B 3WDNA 1B9NA 2LMCB 1K8OA 1H9SA 4I7ZC 1Q1BA 3PV0A 4KKTA 3T53B 3M85A 1OXTA 2ZT9C 4OGQC 4RCNA 1H9MA 4KN7C 5JEAH 3BDOA 3A8IE 4G7HC 3W3AA 1YNJC 3M4YA 1H9JA 3T56B 3QIAA 4XTCS 1Q90A 3PUYA 1QJOA 2K32A 4XIGS 2BA0A 4KHZA 2BE5D 4KKSA 3ND8A 4H44C 2AWOA 1H9KA 1GUTA 3M7NA 1Y8PB 2F1MA 4KMUC 4BA2I 2JE6I 1DCZA 2A68C 1LABA 2PNRC 3PUWA 4LJZC 4IQZA 3IKJA 2A6HC 2D2CC 1FYCA 1CI3M 1Q12A 1O7LA 2AUJD 3QJYA 1H9RA 5BN3A 1ONLA 5JEAG 4JK1C 4DK0A 5KNBA 5KNCA 4KN4C 1BDOA 3TZUA 3FMCA 2DN8A 2K33A 4G7OC 1Z6HA 2A69C 2A6ED 3GD7A 4KKUA 3RLFA 1EWHA 1GHJA 1GUSA 1GUOA 1O78A 2AUKA 3A8JE 4LK1C 3FPPA 3VR3A 4OO1H 1I6VC 1ZYRC 2JEBI 4H0LC 2NN6G 3VA7A 1GUNA 2E75C 3GQBA 4H13C 2K7VA 1TU2B 1Q1EA 3PUVA 1A6XA 5C0XG 2R6GA 1OXUA 1FR3A
chains in the Genus database with same CATH superfamily
3MFYA 1VQLA 3A7LA 3HKZG 1WTXA 1D1KA 1NMFA 5H1SE 3VR2A 1JMCA 2PNHA 1K83B 2Q8TA 1HFGA 1CHQD 4JYAL 2JXMB 5LMNL 3MXGA 3GTOB 4A3DH 1KABA 4XT1B 2OQ0A 1N32Q 2B8FA 4DAYB 4NXMQ 3HOZB 3CC2A 3WWVA 2FMCA 1PLFA 4DR4L 2O5JC 3J80i 1X32A 2JA6B 2MP1A 2R7ZH 4H02A 2EJGC 4XYQA 4JI6Q 2J7ZA 1LTGD 1L1OA 1W3SA 2UXDL 4XYOA 1TWFH 2CFMA 2GVAA 4A75A 3I7FA 2KOLA 4JVZA 1PDQA 5K36G 4KTAA 3J81L 1K9MC 3JAMi 1CM9A 3PF5A 3J81c 3BVMA 3PCOB 4X3TA 4B3ML 2VUMG 2PZTA 3NBHB 1NR2A 3H91A 3S14B 3QO2A 1AFPA 3SE0A 2B3GA 4MTKA 1K73C 1HH2P 2QA4A 3K6OA 5GROA 1PYSB 4FF3A 3M9BA 3OPOA 5FKAC 1YNNC 3E3XA 2JA7B 1JJ2A 4EQ5A 3CCEA 2MO0A 1E1TA 1I4HA 4AYBG 1PTOC 4RCNA 1D2BA 1F2LA 5JEAH 3BDOA 1X9NA 3W3AA 1UE1A 4X3KA 4AYBB 3QIAA 3TSSA 3OTOQ 1EOVA 4GNXA 1K0SA 3VYTA 4A3GB 5C4XB 4IUTA 1XWEA 1GUTA 1HNXL 2BH2A 4ZYSA 1I3QH 4UDUC 5ELOA 4A3EB 1D5XC 1R4PB 1FYCA 4HSPA 4DV0Q 4LFBL 2UXBQ 2H1EA 2R92B 3FMCA 1HJPA 2IY5B 5EQ0A 3GD7A 2L0CA 4HN7A 2RF4A 4AQYL 4DV1L 4DUZL 1PHJA 4IOAA 1XMQL 3FKIB 4LFCL 2IX3A 1B4OA 2MO1A 4KHPQ 3SDZA 1I4XA 4L8JA 3TS2A 1BCPD 2ICEC 3RZOH 2LY7A 1N36Q 1X65A 1QVFA 5IGBA 4GNXC 2VB2X 2D5DA 5I6YA 3CCMA 2OT2A 2MHVA 4CDDC 1LYLA 1C9OA 2ENBA 5BN5A 1HCZA 3OMCA 5IP9H 2WFWA 1X55A 3H15A 1IKMA 3TQYA 2X6GA 4DR4Q 1EWIA 3GP7A 5JVG3 3K5NA 2BH8A 2IJ0A 2LXKA 1YEZA 3HOWH 2F52A 1TY0A 2B2WC 1L1OB 1B70B 3HKZB 4POFA 3MEHA 3CU7A 5LMUQ 1UNSA 4N8FA 3ZYYX 2CWAA 3CQZH 3I2ZA 1IW7D 2NN6H 3PSIA 2K28A 2PQAA 1EZ6A 4KY6A 1N33L 2WAQG 2K6AA 3GTQB 4DAVA 1FNWA 1ET9A 2B2YC 1C48A 1CKOA 4UP7A 1E7ZA 1UAPA 1T5EA 1G6PA 5LHY1 2JJQA 1MHWC 1EZ8A 2PQEA 3HOYH 4B3TL 3LNNA 4BY1B 1XNRQ 1VQNA 3T53B 1LTRD 1KDAA 1ASYA 1RDPD 3A8IE 1RF2D 4C1NI 4Y7NB 2NZ1D 4C3HH 2F0IA 3KF8B 1JORA 5EPKA 4XQNA 3PO3H 5D3DA 4B08A 4R8NA 3OWEB 1YVCA 4OWWB 1EU4A 3UDFA 4GLVB 3JAML 4DV3Q 4DK0A 4BY1G 1SNOA 3TZUA 5E3FA 1Z6HA 2A69C 3CF5A 1WTWA 1E3PA 2Y0SB 2VL6A 1WD0A 1G2SA 1STEA 2PMZB 1HR0W 2Z9HA 3VA7A 4DU9A 4JBMA 4RKLA 3CCRA 1STGA 4IZ8A 2KCMA 1VQ6A 5JJLA 4JI3Q 5EPJA 2F0LA 4ZKCB 4TQUS 5C4JH 2VQEL 1SNCA 3KF8A 2MJ8A 2LXJA 4QL5A 4OELB 4DV6L 3H0GH 2CH4W 4A93G 3D4RA 4DUYL 1QVGA 1ENAA 1KAAA 1II3A 4RWSC 1TWCH 4PZ6A 1DXMA 1GM5A 2UUBQ 3W1GA 1JCKB 4J1MA 4WFN3 4B3RL 4IJHA 4G7ZC 5IODA 5GAGC 1P8LA 1K3BC 3EN2A 3TP5A 1X3GA 2WB1B 3NEMA 1GXDC 5IY0A 3CCLA 5LMUL 2K01A 4C1NK 4ILWA 4QQBX 2C35B 3HOVB 3PO2H 4DR2L 1Y8OB 4KK7A 3U4VA 1ET6A 3D0FA 1SAPA 1VQJA 4CKCA 4A3KB 2EYFA 2YYZA 4MZ9A 4O42A 3O13A 2KVMA 3A8KE 3UDIA 3HKZE 2BDNA 4JOIA 1XNQQ 2X6LA 3R8BA 3CXCA 3I4MB 1YNXA 3MTSA 2N88A 5M3FG 1BNZA 4DUZQ 1QZHA 1EL0A 1UUPA 4JW0A 1W6KA 4Q5VA 1UWVA 4DR1L 3HOVG 1TWHB 2CHBD 4NP5A 3NP8A 5JVH3 3FHWA 3CRLC 4F7XA 2K5HA 1LACA 1LTID 5KYLA 1N36L 4DR3Q 1QNKA 5EKLA 3EIVA 4JCVE 3G4SA 2NWGA 3CPWA 1PH9A 1QZGA 4DR3L 5DEHA 4K14A 4ABNA 1LT6D 2E2JB 1EU3A 1G2TA 2B2YA 4KHZA 4C56C 3NQIA 3J7YW 3ND8A 3NTHA 1VQAA 3R2IA 4IO9A 5KIXA 2J0TD 4HJ5A 1CKMA 2RCNA 4CDEC 4OX9Q 2MNAA 3T1HQ 1CT1D 2F0JA 1Q12A 1A15A 3UE0A 3NELA 4JBJA 1BDOA 5CBEE 2L55A 3X3MA 1YJWA 2A6ED 5DM73 1BVSA 5JJKA 4KKUA 4HJ7A 1FGUA 5G3LF 2JSOA 2WAQE 1QCBD 5C4HA 5FLXE 5I2XA 4XT3B 1G91A 2E2HB 3HKSA 1DONA 3BZCA 1A3VA 2EZVA 4X3UA 4JI5Q 3PIPA 1IW7C 2V1CC 1OO9B 3PO3B 2VB3X 3RLNA 2NN6I 4C3IG 2H5XA 1Q82C 2NTSA 1DJRD 1I4QA 2WKCA 4ZAIA 2RA4A 2NUCA 3H0GB 3KLRA 2K5VA 1KAWA 3BU2A 1VF7A 2JA7H 1PFSA 1WOCA 1GD7A 1OTCA 1CSPA 5C6AA 4A3GG 2PZUA 3GTLB 5EKKA 1BQQT 5I9OA 3MFGA 4FXGC 1HR0L 1H95A 4DAMA 2JYOA 4C3IB 4NW2A 1TQOA 5BR8L 1AN8A 5C3WA 2NB0A 2I07B 1BF4A 4GZYC 1X3FA 2R3ZA 1PRTD 3E0EA 5C3EB 2R7DA 1SFOB 2D62A 1SRUA 1BOSA 2BCOA 1F9SA 4DAYA 3K5LA 3SHLA 2I0QA 2K03A 5LMNQ 3TS0A 2NVTB 5GQOA 2F0DA 4DKAC 5JAVA 4P72A 2EY2A 1MSHA 3GV6A 3NENA 4DNRB 5HURA 4K0KL 1KDBA 2AQ1B 2X69A 3IL8A 3UDXA 3H09A 1RODA 3MZ5A 3D6CA 1I6HB 3PIP3 3HEJA 4P75A 4GKJL 3D4WA 4X62L 3M7NA 1EIHA 1Y8PB 4MIUA 4X62Q 2A68C 1UE5A 1HNXQ 1YHBA 1SR3A 2KEEA 3BDLA 2UUBL 3RD4A 1SYCA 3AEVA 1VQHA 4JG2A 2UXBL 4G7OC 4JI8L 1NTGA 2B39A 2EIFA 1CZGA 1MKHA 1SE3A 1TWGH 1Y1WB 1QOHA 4X65Q 2SNMA 1LO5D 4LK1C 3T1YQ 1TWAB 2K75A 4LF7Q 1ZYRC 1VQBA 1QUQB 4X65L 5I2YA 3G71A 3GTLH 1IBLQ 2Y0SG 2OWOA 1HZCA 2YTYA 3QB3A 4DA2A 1BCPB 1EIGA 2HUGA 1HTPA 1K28A 1PH1A 4DV4Q 1AEXA 5I9PA 4JPBW 1YNND 4LF5Q 5KNDA 4JYAQ 3DEPA 2ZJQA 5C44H 1MBYA 1PRTF 4NB3A 4A3FG 1EUJA 2ZM6Q 1PFBA 2EXZA 1VQMA 4MTNA 4LF4L 4A3GH 5T1GA 2EYJA 4RGMA 1BBUA 2KHSA 2N49A 1FNVA 4L5TA 1KNAA 4K5XA 4R8IA 1J6QA 3CC7A 2F4VQ 3CQZB 1FD7D 4QY7A 3STBD 2QDLA 2RDHA 1ZEQX 1PZKD 1E22A 2RSNA 3I72A 1MI2A 1XMQQ 1Y1VB 5A2QL 4AH6A 3EBEA 5JJZA 1MJCA 1IYUA 5FLMG 3GTMB 4HJAA 4P74A 4DV5Q 4JI8Q 2EYLA 1I50H 2B8GA 2Q8RE 3A54A 3I4NG 1VCIA 2K4KA 5IGFA 4A3IB 5L37A 4R4CA 2E2IH 2RHSB 5M3MG 5CR3A 4C2MH 1KC8C 2E76C 3I4MG 3HOWG 3CCSA 1IBLL 3NSWA 2WB1E 4LF8Q 3GTGB 2JEAI 4UPAA 5A35A 1CA5A 2IWHA 4A3JH 4K2KA 4LF8L 1Y8NB 3ULLA 3I8ZA 4HJ8A 4I7ZC 4ZKBB 1Q1BA 4JI0Q 1SEBD 2MQHA 4LF9Q 3C1EA 3MAQA 2BE5D 2M2LA 4A3JG 3DWAA 2HQLA 3LGJA 3G48A 4BA2I 2RSOA 1K3RA 1HNZL 1TXYA 4YCVA 4GN5A 5IGDA 2IL8A 4BY7H 4MN3A 2HQEA 1EEID 2ZTEA 3GTKB 1CI3M 1PZJD 1JT8A 4JK1C 5KNBA 3D4DA 4R4TA 3KBXA 2UXCQ 3FKIG 3W5OA 1PH8A 4FYDA 1F9PA 1U9RA 1NNXA 1L0YB 1SMXA 1NSNS 3GQBA 3DEOA 1Q1EA 5E4XA 3EJIA 3MHBA 4ME3A 5FO9B 1PXUA 2I5HA 4FXDA 5CC4A 1ENCA 2NVYB 1TWFB 3HFZB 4XQJA 1O7ZA 1Y1VH 4DV4L 1F2YA 3CMEA 3HG9A 1A0IA 4DV2Q 3GTMH 4XQQA 3J81j 2JA6H 4NXML 3OW7A 5HGQA 3IRBA 1ZXTA 1EY9A 1GKHA 1OXXK 5C44G 3GTOH 4A3DB 3NQTA 5IGCA 3S1MB 1VMCA 2A6EC 3Q6SA 4RA8A 3K80C 3DHQA 2PI2E 4B3RQ 1UEBA 3KLSX 3EQLC 4K8JA 3RR5A 4HCSA 1LTLA 3SVMA 3OYYA 4HTHA 4IUVA 4DV5L 3GDEA 2C5CA 3I73A 1KXLA 1RL2A 5K36H 4NKLA 5M5YB 3M4OB 1STBA 4RMFA 4JI1L 1ICWA 2EQSA 2O5IC 3HOZH 3T16A 3TMEA 1JOKA 1LLRD 4TVAB 1WTHA 4X6AH 5C4JB 3RNUA 4F8MA 2VXWA 2NVXH 5IP7H 5M5WH 1CFMA 3E9IA 4K8IA 3RMHA 4EQNA 2UU9Q 4G7HC 5FO8B 5J3BA 4A3MH 5C0XJ 3S17H 4A3DG 1BCPF 5KEEA 4GNXB 1RTOA 4L5QA 2JE6I 4G4KA 5BR8Q 1X3QA 1U4MA 1FVIA 4GOPC 1LM0A 3C1FA 5BN3A 3OWFA 1ASZA 5M3MB 1U0LA 2DN8A 1WCMG 1L0WA 1JQYD 4DAPA 3E0JA 4JI7L 3DMUA 3K7AH 2A74C 2F4IA 3M4OH 3I4MH 3LWEA 5C0XG 1TS2A 2M00A 2R6GA 1OXUA 1LUZA 1V43A 5EJWA 3HOUH 2F3VA 3I90A 4JI2L 1YJ9A 5C0XH 3AU7A 3DM3A 4JV5Q 1Y69U 5CV8A 1SE2A 2PI2A 1PTOD 1STAA 1TKWB 4BBSH 3R3OA 1KIXA 3ERSX 5JOBA 4GKJQ 3CKIB 2FJ2A 3VDYA 3I91A 2V4DA 3VR5A 3NTIA 1VQ4A 4C3IH 5IT9c 5AFWA 5IIFA 3TZDA 2DUDA 5E1FA 1JE5A 4C3JB 2LKVA 3I4OA 3KDFA 1ILPA 2L9HA 4DPGA 1EYAA 3S9WA 2BA1A 3S15H 2XVSA 2FINB 3TDQA 1HNZQ 3PF4A 3F2CA 3ER0A 1GHKA 3C46A 1BR9A 2Z4IA 3HRZC 1STHA 1N33Q 1IXRA 1XPRA 4HR7B 3I70A 3M4PA 5EAYA 2PPBC 4B9WA 1V1PB 2XIWA 4A3KG 2E2HH 3PUXA 3H94A 2F0NA 3R93A 2CCZA 1T5XD 2B2WA 3UI2A 5M9OA 4DF7A 5IYBG 3S17B 3H3VH 1BBWA 5GAHC 3IFDA 4O2DA 4DR6Q 2OTJA 4DGZA 1NBWA 4GN3B 4A3MG 3KDFB 1H9SA 1CUKA 2KBNA 5M5WB 4A3FH 3T56B 4Y52H 1I5FA 4XIGS 2BA0A 1VMPA 4RHSA 2CW0D 2QW7A 3SK5A 1F9RA 2G9HD 2F1MA 3BZDB 1HFNA 4R4QA 2N8NA 2DJFC 2RCFA 5C3EH 3TREA 5T1IA 1DGSA 3ZJYC 3HOZG 3H3VI 5JEAG 5EBDA 3T1HL 5KNCA 1K0RA 1EQVA 1U4PA 2EY6A 4LAAA 1PYBA 4CBVA 1MSGA 1O78A 1AZPA 2JA5H 5J22A 2JA5B 4H0LC 3KF6A 1Y1VG 4LF7L 1NY4A 4KD4A 4JI2Q 1XTCD 2SNSA 1YJNA 1STNA 1JJCB 1S4ZA 1PRTC 1YI2A 3QWNA 3RLOA 3OIPA 1Y1WG 1X54A 4A3BG 2F0WA 2JK8A 1HA5A 4OIKA 1CQFA 1SSOA 1C4QA 2XRQD 4PMBA 3NUCA 2Z6BA 2Q2UA 1B44D 3PUZA 1T9HA 1V8QA 5FO7B 2EE1A 1KLGD 1PH4A 3QOJA 3Q23A 1FJGQ 3S2DH 4LFBQ 1HPCA 4OO1I 1E2ZA 4J15A 5C44B 4K2LA 4DR7L 2ZJRA 3ICEA 3BZKA 4DFAA 1UEAB 1ILQA 1EY7A 1R4QB 3I4NB 2VQFL 1JB3A 3U4ZA 3CCUA 3DWQA 4YY3Q 2VQFQ 4JI4L 4BWGB 5EGTA 2WAQB 1PVOA 2B2UC 1I94L 4OL7A 4N9TA 4ODGA 3FKIH 5FOBB 3IFTA 4BY7B 4O1NA 1M4VA 1EY6A 4WORA 3GTGH 2B2TC 4ULLA 3GTPB 2NVYH 1LTTD 2A69D 1EY4A 4BBRG 2ICIA 5HY6A 2H4OA 2NVQH 1K83H 5EPLA 1EY8A 1KNEA 1SNPA 1ZKOA 2KHIA 4C3HG 5IWAQ 3Q0AA 1B9MA 1F77A 1P16A 2EYHA 4XDXA 4X64L 1ICFB 3RN2A 3CC4A 4OGQC 1JB7A 4I7AA 1H9MA 1YNJC 4U673 3HOXH 4LWCA 2K32A 1B50A 4WRDA 1XMOQ 4IPDA 2EPBA 4ZCKA 4FF1A 1B1ZA 3NWTA 3SK4A 4C3JH 4GKKQ 4JBKA 1J8IA 2TSSA 3TEHB 2AUJD 3HOXG 3I4NH 3CCJA 3U9OA 3K5OA 2MFIA 3OIQA 5C5MA 2AQ3B 4A3BB 1NCVA 4IALA 2HD3A 3FPPA 4LMQD 4OO1H 5ELDA 2E75C 3P75A 2EY5A 1LTSD 4BXXH 4YY3L 4BBRH 2R61A 4LUOA 2JA8B 2A8VA 4G57A 1M90C 3S1RB 5BN4A 2YU9H 4C2MB 2CH4A 3E5SA 1VQIA 3SGIA 1JICA 2PO4A 3E9HA 3M7GA 3L9AX 4HAEA 2DJGC 4UP8A 4BA1I 1HXYD 5IYCH 3TP8A 3N52A 3PIOA 2F0MA 2K04A 1D8LA 2PW7A 5D14A 2K14A 1TS5A 1CSQA 1AW7A 3PO2G 5FK9C 1WTQA 5CV4A 1CZWA 4X64Q 2BDOA 1XPUA 2ZM6L 2RQXA 1F2ZA 2DNCA 2A73B 4JBWA 3NTKA 4DR7Q 1KL9A 3J7AF 1G291 3Q8DA 3BS1A 2Z8LA 1QVCA 1OXSC 1N34L 3CP0A 1B53A 1ML0D 1R9TH 1J5EQ 5M3FH 4EQOA 3D8GA 3ULPA 1A3TA 1VQ9A 1RKNA 3D31A 3TN2A 2L12A 4J6HA 3FVQA 4LFCQ 2WP8J 1M8AA 3HP3A 3K57A 3J80L 2Y0SE 1K8AC 1AE3A 2KCTA 1V1QA 1A2UA 3S1RH 2YU9B 3BJUA 2WKDA 2K5WA 3RZOB 1JWMD 2A5HA 1SBBB 2Z6KC 2VUMH 2Z6KA 2E2DC 3S24A 3S2HH 3L7ZC 1SNDA 5ELBA 1SDFA 2EVBA 1BCPC 1SYGA 3ND9A 3OMGA 4YWKA 2XNAC 2NZHA 4F87A 1NE3A 3NE5B 4JOIC 3HOXB 1SYEA 1OXTA 2ZT9C 4BY1H 2ASBA 1NJIC 1V9PA 3GTJB 3EFXD 2NTTA 2AWOA 1XYIA 1L0XB 1LABA 1HNWQ 4LF4Q 2ZXRA 4KJOA 2UXCL 4A93B 4BBRB 2IPKD 5EBCA 4A3LG 2DGYA 4DV3L 1E24A 1GVPA 3K5MA 1EYGA 1GUOA 2WINB 5IYCG 1Q3LA 1HA6A 2JEBI 2OQKA 2VY3A 1GUNA 3KLSA 4AQYQ 1GO3E 3J7ZC 3K0XA 3NWSA 1EFWA 2K5NA 3DLLA 3DXJC 1IBML 4KLKA 4P71A 4DK1A 4A3KH 3GV3A 5J1ZA 4FVMA 4CJ1B 2EYMA 1VDZA 1SNQA 2VQEQ 2A1AA 4AIMA 3M3YB 3ERQA 1QUQA 4RAUC 2F0SA 1CHPD 1AE2A 2ID0A 2Q2HA 3BVZA 5C0XI 4DXGA 4NXNL 2D9UA 2GN5A 2E2IB 2DNEA 1RIPA 4A3MB 5DM63 4OX9L 3CMAA 3F2BA 1DOMA 3A5UA 1K8GA 2KECA 3T51B 3AMUA 2HDLA 2FXQA 4ZRZA 3LX0A 1G51A 4EX5A 1GOZA 5IP9G 3C3LA 2I5LX 2PQAB 1SE8A 2IHFA 4DV0L 4LUVA 4B3MQ 1BXTA 3S2HB 3A7AB 1X56A 1SYFA 3HOVH 3ITPA 3SK6A 4A76A 2ZJPA 4EVOA 4DN4M 1IYJB 3FEWX 1YBYA 3U9SA 4ZQ3A 3TP6A 1N8RC 3L2PA 2ALYB 2VW9A 5GAEC 4RGNA 3M3YH 1I50B 3VR6A 2RBMA 4Z9CB 4FF4A 3WDNA 1JR0D 2KJXA 5IGGA 4TSSA 4LF9L 1RJTA 3J81E 5C3XA 3MXPA 4DV2L 2G5DA 1TWHH 1WD1A 1Q90A 1X3PA 4H44C 1H9KA 2B63G 3WOEA 5CBAE 4CHTB 1Q86C 2SEBD 2Z0SA 4R1JA 1YITA 4EGVA 1IHZA 1LT4D 1CKNA 4OONA 1I3QB 2XWBB 3F2DA 5JJIA 1HHVA 1ONLA 5FJ8H 4QMGA 3MA2B 3ONAB 1W6JA 4DNIA 2RDFA 4JI7Q 1TS4A 4XXEA 1PH7A 1GHJA 2D0OA 2AUKA 4OIJA 1YIJA 3S2DB 5GADC 4B9XA 1SN8A 2VS1A 1LTAD 3PUVA 2R93H 4A3LH 4JI3L 3STBC 3EA6A 4GS3A 1EEFD 1FR3A 4B3SQ 1OXVA 2AWNA 1K8MA 3MXUA 1SJHD 2JN4A 5HGTA 2NBFA 3QR8A 1G6ZA 3KF6B 2XWJB 5FLXc 5IYDH 1CA6A 2IX0A 1SJED 4RGTA 1XMOL 4PNYA 4WJ3M 2WV6D 2FHTA 4ZK9B 4HMJA 2Z4HA 1C7YA 2QCPX 5IYDG 2FFKB 1QE6A 4V190 5JEAJ 2NVTH 4DXFA 3VYSA 1D5ZC 3MEFA 1EIFA 2HIVA 1E1OA 3PO3G 3OSOA 1I4RA 4RKBA 4P73A 2F0UA 1QILA 2CW0C 1VF5C 1A62A 3NBHA 3SEBA 1PZID 2F0QA 3T1YL 1Q7YC 4EQPA 2SDFA 4PG3A 3MXNB 3W2DA 2K05A 4A3IG 1GUGA 1FL0A 3TRZA 2A68D 1MD2D 3K81C 2F0OA 2NVQB 1B2TA 1VQOA 1WTRA 2I46A 4IPCA 2HHHQ 1I4PA 2QF7A 2K52A 3CRKC 4OWTB 1SROA 1F2MA 1EFID 2DY8A 3K0YA 3FRPB 3T13A 1CTMA 1HZBA 2EXDA 2R7ZG 1PA6A 4BXXG 2XN9C 4NPSA 2K50A 3IAYA 5M5YH 2JP1A 1YZ6A 4MHEA 2SOBA 3AFQA 3HOYB 5CV5A 5LL6X 1HTLD 4J8QA 2RDGA 1QG7A 3JC66 1EY0A 1RCVD 1F9QA 1RD9D 1H9JA 3VYRA 3S1MH 2NVXB 4QJFA 4LNQA 4KMUC 4YIJA 1NR4A 2PNRC 3PUWA 4R4OA 1VQ8A 2CQOA 3GTQH 1C0AA 2A6HC 5D65A 3S15B 4KJNA 1HUNA 1A63A 1G8ZD 2F0PA 3V2TA 1JJGA 3E6ZX 3K8AA 2FMMA 1I6VC 1GUWA 4K6LA 3S14H 4B3SL 4YHHQ 2YTXA 1BBXC 1WJJA 2IT1A 3G6EA 4JV5L 4QGUA 4AYBE 4TKOB 4UAIA 3U58A 4IPHA 5J39A 3AB9A 5FLMH 1IBKQ 2WB1G 1KRSA 4DUYQ 1UE7A 2KA7A 1M1KC 2E74C 1S5FD 3NPPA 4QIWE 4CJ0B 1JOQA 5IE8A 1HQMC 2Q2IA 1HZAA 1A8VA 4IOCA 3D3RA 1KD1C 3I55A 4IFDH 4DK3C 2F0KA 1EQTA 2B2VC 1KDCA 1A2TA 2K1BA 1XJVA 5F2DA 4APVA 4A3FB 4FO2A 5FLXL 1EQRA 4IUPA 2CKZB 4DR5Q 3L3OC 3LWUA 2F0FA 2IHEA 2ZXOA 3F8TA 5IP7G 2WACA 4A3IH 4OEMB 1PMRA 1WCMH 1VQCA 1XTDA 1X3EA 4N8X1 3VYUA 2F0EA 3ULJA 4A3EH 4KI0A 4LFAL 4PZ8A 2B2TA 1TWCB 3RN5A 1AZQA 4LFAQ 3HOUB 4H7BA 3W1BA 2KEDA 2IX1A 2WIIB 4X3SA 4ZLTF 2PW5A 5IWAL 4DR6L 1S5ED 4NXNQ 2L15A 3J80E 4HMIA 3KYHC 4M8AA 1ESRA 4HEDA 5IGEA 4K5VA 3I56A 3OW2A 3M85A 1EQQA 3PV0A 2EYOA 4E6IA 4LF6Q 3SXHA 2A19A 4QUCA 3VA5A 3M4YA 3H0GG 4IURA 2QKIC 4A93H 4IUUA 4KHVA 4A3JB 3SK8A 2EY1A 1L2FA 4CDFC 2D2CC 4ME5A 2RHQB 2ZXPA 1EOTA 4ZUIA 2HDMA 3CHBD 5M3FB 1BO0A 1EYCA 4CKBA 3KUPA 5IT9E 3I3CA 2JA5G 1EWHA 2OTLA 2O4XA 4N9PA 1U5KA 1PH6A 3K59A 1A6XA 1PTOB 3P7JA 2R92G 3RZDB 5D3IB 4RHRA 1I94Q 4YWMA 1DOLA 2YV5A 4OO1G 1KLUD 1TT2A 3KFUA 1SYBA 2E5LQ 1D5MC 1CKNB 4P2CB 2JA6G 2L5TA 5AJ3L 1FJGL 3S1NH 3AFPA 3C2PA 2EJMA 3M4QA 2Z1CA 4C3JG 2A6HD 2EDGA 2ATWA 1QB5D 3FP9A 4OHJA 1PTOF 4JI6L 2C9OA 3L0OA 4O0AA 1S40A 4X66Q 2MPMA 2ZTDA 4L5RC 3EROA 2Q8IB 2QEJC 4DV1Q 3MVVA 2JA8G 4M1UB 4Y7NH 4QF4A 1EYDA 2HCIA 1B8AA 5NUCA 3VR4A 4A4IA 3URYA 4BBSG 5LL6S 1SFOH 3MC0B 3BYYB 3Q22A 1IBMQ 1IL2A 1MJEA 3HGBA 5CYUA 3PQIA 3DWPA 5CORA 1SXTA 1D7QA 1SYDA 1JWUD 1XXGA 1LT3D 5CV9A 3WOFA 1JOOA 3SR1A 2I5MX 2LMCB 3GTPH 4KN7C 1VQEA 4XTCS 4U68A 3KBGA 4CJ2C 1JC7A 1HZ9A 5CV7A 1BKBA 2IW3A 1XPOA 4YCWA 1WVLA 1SNMA 4DR2Q 3CAMA 5C5LA 1C8CA 3HOWB 1ENFA 3IKJA 5M3MH 3HOUG 1O7LA 1Z9FA 3A74A 5ISRA 3KJPA 3AQQA 3S16H 2HIXA 3JAMc 4RG1A 3S1NB 3RLFA 3V05A 3K58A 4S3SA 4JI1Q 1WTVA 1KQSA 2UXDQ 3D6WA 1PH5A 2VZAA 3RUZA 1VS0A 4A3BH 5M5XH 1NAPA 5K5PA 2K7VA 4L5SA 2M9VA 1MIUA 1R9TB 1TIID 1WI5A 4HJ9A 3BG3A 1SLJA 2E8GA 3S1QB 4NDXA 4WJ4A 3CCVA 1VQPA 4CDCC 2UU9L 3JAME 4JC0A 1PTOH 2QDBA 4A3CH 1YNJD 1GJXA 1DD2A 5AJ3Q 4FF2A 1H9SB 3H3VC 2AKWB 5EKIA 4GOPA 3P20A 1MGSA 1FNUA 4QUFA 4JI0L 1V1OA 1IYVA 4R4IA 1TWAH 4FNFA 1HQRD 3KK7A 2KHJA 3TBIB 2XTIA 3H6MA 3J80c 4PMCA 3QG1A 2R92H 2B29A 3GO5A 4UHVA 4LW1A 4GKKL 4GOPB 1IL8A 3F2UA 1DZ1A 1NUCA 2R7ZB 1EY5A 4BBSB 4ZUJA 1S3OA 5ELNA 2UUAL 1TR5A 2KCNA 3GTKH 3J7AV 5LMNW 5C3EG 1S5CD 2R93G 1VQFA 4B3TQ 4KHPL 2GA4B 4QB4A 3U50C 4IJLA 1AH9A 1E0BA 2XGTA 1NMGA 1E2VA 1IZ6A 3I4LA 1VQDA 3G7LA 2F0VA 3OOCA 5G3LD 4DV7L 2B2UA 4KY5A 2BOSA 4KKTA 5M5XB 1D1IA 1LTBD 2Q2TA 2VNUD 5ELFA 4DV7Q 4ALPA 4DK6C 2KQ3A 2F03A 5DLQE 4IPGA 4I65A 4L6TB 1D6EC 1S5BD 2RKSA 2CQAA 4POGA 1U4RA 1HR0Q 3MWYW 2AMCB 5IYBH 2P5ZX 2KUMA 4IQZA 3J7A5 2E2JH 2EOTA 1VQ5A 4YCUA 4PZ7A 5ELCA 4KN4C 3FDTA 1PRTB 1QNUA 2VUMB 4X66L 4HSVA 2LS01 1DYQA 4FP5D 3TP7A 4WJWA 2F3WA 5ELEA 3VR3A 1JE4A 2UUCQ 2UUAQ 4K0KQ 4HCEA 1LV9A 2EJFC 4DNTB 4FXKC 4JI5L 4IFDG 1TY2A 2BE5C 1S5DD 1STYA 1X6OA 1FGBD 1KHIA 1PFNA 1Q8IA 1WCMB 2NYZD 2B63B 2N78A 1L1OC 2G9DA 4IFDI 3PMFA 2LFNA 3HZXA 5C4XG 5CV6A 2MUYA 5IT9L 4ID6A 2J4XA 1SE4A 4QCLA 1LT5D 1XNRL 2N55A 3GTJH 1ESFA 3A55A 3UE1A 2OCEA 1PFMA 3PGZA 3AYHB 2AHOB 2HCCA 3FPUB 3BDCA 4R9WA 4IFDJ 1QWYA 4F88A 4RCOA 3S1QH 1DM0B 2PCFB 4FDBA 4QIWB 4HIDA 2PYKA 4RGOS 1J9OA 2HHHL 2ZTCA 2JA8H 1AP0A 2F0GA 4OWXB 1VQKA 3KJOA 1U4LA 1ZYRD 3A5ZB 4MNOA 1PYWD 1IBKL 3BYTB 4CKEA 5CGKA 4DR1Q 3MXNA 3Q24A 1E2WA 1CQVA 5TSSA 2E5LL 3EVQA 1N9WA 2F3IA 1Z7TA 2ES2A 2OEOA 3CW2C 2JA9A 4HIMA 3K7AB 2AQ2B 2NZOA 2MGSA 4GLAC 1I6HH 2R7FA 1B9NA 1S72A 4OXPA 3CPFA 4PMWA 5A2QE 4NMZA 1B3AA 2B2VA 4DV6Q 3PUYA 1RHPA 1Q81C 1N34Q 2K5DA 4KKSA 1PH3A 3NXWA 1J5EL 1DCZA 1Y1WH 1TWGB 4C3HB 4DR5L 1H9RA 3PO2B 2QILA 2K33A 1YHAA 3B6YA 4Q0FA 5E7NA 2QGQA 2OXPA 1TS3A 1GUSA 3NHHA 5E4WC 3A8JE 1SMYD 4V0BA 4H13C 3PIO3 4L63B 1JWSD 1UE6A 4PQXA 2UUCL 2XSCA 3J81i 3CD6A 5I4DA 3F1ZA 1XX8A 3NK9A 5DNFA 3KOJA 5CMDA 1XNQL 5DAUA 4RH6A 4A3EG 2K5QA 3RZDH 1HUMA 1B3QA 2DY7A 5COYA 2L1BA 2OF1A 1WFQA 1HRJA 1EWCA 1O7YA 2YTVA 3OTOL 1O7IA 3HS0C 3DM1A 1YHQA 1WTOA 1RTNA 1N32L 1KTKA 3KLWA 2RVLA 3T4AC 1EIYB 2HT1A 4A3CG 4BS9A 3UDGA 3R2TA 2L4NA 2CVRA 2B63H 4KY7A 2JA7G 4GLXA 1PV4A 2EYPA 2D0PA 2R93B 3QOLA 2KCCA 2LSSA 4K5WA 4PV1C 5KGUA 2F4VL 3S16B 5IOCA 3P1HA 1O80A 5JPNC 1SMYC 5I6WA 3X3NA 2F0TA 3BVGA 1KRTA 4K6DA 5C4ZA 1VQGA 3A56A 3N6RA 3NBIA 4LUZA 4JI4Q 3G6JB 1BUVT 1B7YB 1IKLA 3A0JA 1Y14B 1DOKA 2N3SA 2XRSD 4GN4B 3DUZA 5FJ8G 1PH2A 4UP9A 4YWLA 5KRUA 1WTPA 4BY7G 4LF5L 4UY8C 1WYDA 2L11A 4HIOA 2JQOA 1K8OA 2F0HA 3CCQA 4LF6L 5C4XH 2PMZE 3OHXC 4IUNA 4TRDA 2KENA 2O2LD 5JPMC 1QJOA 4KV6A 4HIKA 4KD3A 4CGYB 1TVXA 3HOYG 1Q8KA 3K7UC 1VQ7A 1W2BA 4LJZC 2CWPA 1HNWL 1Q46A 5KYIA 3QJYA 2GVBA 2QEXA 1A3UA 4IUQA 1Z47A 2PZWA 4IN3A 3V96A 4YHHL 1CK1A 2NN6G 4RFBA 1TU2B 1I4GA 1V1PA 2TMPA
chains in the Genus database with same CATH topology
3MFYA 3A7LA 1WTXA 1D1KA 3VR2A 1K83B 2Q8TA 1HFGA 1CHQD 2JXMB 3MXGA 3GTOB 1KABA 4XT1B 2B8FA 3HOZB 2FMCA 1PLFA 2O5JC 1X32A 2JA6B 2MP1A 2EJGC 4XYQA 2J7ZA 1LTGD 4XYOA 2KOLA 5K36G 1PDQA 4KTAA 3J81L 1CM9A 3BVMA 4X3TA 2PZTA 1NR2A 3H91A 3S14B 3QO2A 1AFPA 3SE0A 3K6OA 4FF3A 3OPOA 5FKAC 1YNNC 2JA7B 1I4HA 1PTOC 4RCNA 1D2BA 1F2LA 5JEAH 3BDOA 3W3AA 4X3KA 4AYBB 3QIAA 3TSSA 3VYTA 4A3GB 5C4XB 4IUTA 1XWEA 1GUTA 4ZYSA 4UDUC 4A3EB 1D5XC 1R4PB 1FYCA 4HSPA 2H1EA 2R92B 3FMCA 5EQ0A 3GD7A 2L0CA 4HN7A 3FKIB 2IX3A 1B4OA 3SDZA 1I4XA 4L8JA 1BCPD 2ICEC 2LY7A 5IGBA 2VB2X 2D5DA 5I6YA 2OT2A 2MHVA 2ENBA 5BN5A 1HCZA 3OMCA 1IKMA 2X6GA 3GP7A 5JVG3 3K5NA 2IJ0A 1TY0A 2B2WC 3HKZB 3MEHA 3CU7A 1UNSA 3ZYYX 1IW7D 2NN6H 2K28A 1EZ6A 4KY6A 2K6AA 3GTQB 4DAVA 1FNWA 1ET9A 2B2YC 1C48A 1UAPA 1T5EA 5LHY1 1EZ8A 2PQEA 3LNNA 4BY1B 3T53B 1LTRD 1KDAA 1RDPD 3A8IE 1RF2D 4C1NI 4Y7NB 2NZ1D 2F0IA 1JORA 5EPKA 4XQNA 5D3DA 4B08A 4R8NA 3OWEB 1EU4A 3JAML 4DK0A 1SNOA 3TZUA 5E3FA 1Z6HA 2A69C 1WTWA 2Y0SB 1WD0A 1G2SA 1STEA 2PMZB 3VA7A 4DU9A 4RKLA 1STGA 4IZ8A 5EPJA 2F0LA 4ZKCB 4TQUS 1SNCA 3KF8A 2MJ8A 3D4RA 1ENAA 1KAAA 1II3A 4RWSC 1DXMA 1JCKB 4J1MA 4WFN3 4G7ZC 5IODA 3TP5A 2WB1B 1GXDC 2K01A 4C1NK 4ILWA 3HOVB 1Y8OB 4KK7A 1ET6A 1SAPA 4CKCA 4A3KB 2EYFA 2YYZA 4O42A 3O13A 2KVMA 3A8KE 2BDNA 2X6LA 3R8BA 3I4MB 3MTSA 2N88A 1BNZA 1EL0A 1UUPA 1W6KA 4Q5VA 1TWHB 2CHBD 4NP5A 3NP8A 5JVH3 3CRLC 4F7XA 1LACA 1LTID 5KYLA 1QNKA 5EKLA 2NWGA 5DEHA 4K14A 4ABNA 1LT6D 2E2JB 1EU3A 1G2TA 2B2YA 4KHZA 4C56C 3NQIA 3J7YW 3ND8A 3NTHA 3R2IA 5KIXA 2J0TD 1CT1D 2F0JA 1Q12A 1A15A 1BDOA 5CBEE 2L55A 3X3MA 2A6ED 5DM73 4KKUA 5G3LF 2JSOA 1QCBD 5C4HA 5FLXE 5I2XA 4XT3B 1G91A 2E2HB 1DONA 1A3VA 2EZVA 4X3UA 1IW7C 1OO9B 3PO3B 2VB3X 2NN6I 4C3IG 2NTSA 1DJRD 1I4QA 2WKCA 4ZAIA 2RA4A 2NUCA 3H0GB 3KLRA 1VF7A 5C6AA 2PZUA 3GTLB 5EKKA 1BQQT 5I9OA 3MFGA 4FXGC 2JYOA 4C3IB 4NW2A 1TQOA 1AN8A 5C3WA 2NB0A 2I07B 1BF4A 4GZYC 2R3ZA 1PRTD 5C3EB 1SFOB 2D62A 1BOSA 2BCOA 1F9SA 4DAYA 3K5LA 3SHLA 2K03A 2NVTB 2F0DA 5JAVA 2EY2A 1MSHA 3GV6A 4DNRB 5HURA 1KDBA 2AQ1B 2X69A 3IL8A 3H09A 1RODA 3MZ5A 3D6CA 1I6HB 3PIP3 3HEJA 3D4WA 3M7NA 1EIHA 1Y8PB 4MIUA 2A68C 2KEEA 3BDLA 3RD4A 1SYCA 4G7OC 2B39A 1CZGA 1SE3A 1Y1WB 1QOHA 2SNMA 1LO5D 4LK1C 1TWAB 1ZYRC 5I2YA 3QB3A 4DA2A 1BCPB 1EIGA 2HUGA 1HTPA 1AEXA 5I9PA 1YNND 5KNDA 3DEPA 1MBYA 1PRTF 1PFBA 2EXZA 5T1GA 2EYJA 4RGMA 2KHSA 1FNVA 1KNAA 4K5XA 4R8IA 3CQZB 1FD7D 2RDHA 1ZEQX 1PZKD 2RSNA 3I72A 1MI2A 1Y1VB 5A2QL 5JJZA 1IYUA 3GTMB 2EYLA 2B8GA 2Q8RE 3A54A 1VCIA 4A3IB 5IGFA 5CR3A 2E76C 3NSWA 3GTGB 2JEAI 5A35A 1CA5A 2IWHA 4K2KA 1Y8NB 3I8ZA 4I7ZC 4ZKBB 1Q1BA 1SEBD 3C1EA 3MAQA 2BE5D 2M2LA 3DWAA 4BA2I 2RSOA 5IGDA 2IL8A 4MN3A 2HQEA 1EEID 3GTKB 1CI3M 1PZJD 4JK1C 5KNBA 3D4DA 3KBXA 4FYDA 1F9PA 1U9RA 1L0YB 1NSNS 3GQBA 3DEOA 1Q1EA 5E4XA 3EJIA 3MHBA 5FO9B 1PXUA 4FXDA 5CC4A 1ENCA 2NVYB 1TWFB 4XQJA 1O7ZA 1F2YA 3HG9A 4XQQA 3OW7A 1ZXTA 1EY9A 1OXXK 4A3DB 3NQTA 5IGCA 3S1MB 1VMCA 2A6EC 3Q6SA 4RA8A 3DHQA 3KLSX 3EQLC 4K8JA 4HCSA 3SVMA 4HTHA 4IUVA 2C5CA 3I73A 5K36H 4NKLA 5M5YB 3M4OB 1STBA 1ICWA 2O5IC 3T16A 3TMEA 1JOKA 1LLRD 5C4JB 4F8MA 2VXWA 1CFMA 4K8IA 3RMHA 4EQNA 4G7HC 5FO8B 5C0XJ 1BCPF 5KEEA 1RTOA 2JE6I 4G4KA 1X3QA 1U4MA 3C1FA 5BN3A 3OWFA 5M3MB 2DN8A 1JQYD 4DAPA 3E0JA 3DMUA 2A74C 2F4IA 3LWEA 5C0XG 1TS2A 2M00A 2R6GA 1OXUA 1V43A 5EJWA 2F3VA 3I90A 5C0XH 3AU7A 1Y69U 5CV8A 1SE2A 1PTOD 1STAA 1TKWB 3R3OA 5JOBA 3CKIB 2FJ2A 3I91A 2V4DA 3VR5A 3NTIA 5AFWA 5IIFA 3TZDA 5E1FA 4C3JB 2LKVA 1ILPA 2L9HA 3S9WA 1EYAA 2BA1A 2XVSA 2FINB 3TDQA 1GHKA 3C46A 1BR9A 2Z4IA 3HRZC 1STHA 4HR7B 3I70A 2PPBC 4B9WA 1V1PB 2XIWA 3PUXA 3H94A 2F0NA 3R93A 1T5XD 2B2WA 3UI2A 5M9OA 4DF7A 3S17B 3IFDA 4DGZA 1H9SA 5M5WB 3T56B 4XIGS 2BA0A 1VMPA 4RHSA 2CW0D 3SK5A 1HFNA 1F9RA 2G9HD 2F1MA 3BZDB 5T1IA 5JEAG 5EBDA 5KNCA 1EQVA 1U4PA 2EY6A 4LAAA 4CBVA 1MSGA 1O78A 1AZPA 5J22A 2JA5B 4H0LC 4KD4A 1XTCD 2SNSA 1STNA 1S4ZA 1PRTC 3QWNA 3OIPA 2F0WA 1HA5A 4OIKA 1CQFA 1SSOA 1C4QA 2XRQD 4PMBA 3NUCA 1B44D 3PUZA 1V8QA 5FO7B 2EE1A 1KLGD 3QOJA 3Q23A 1HPCA 4OO1I 1E2ZA 5C44B 4K2LA 4DFAA 1UEAB 1ILQA 1EY7A 1R4QB 3I4NB 1JB3A 3DWQA 4BWGB 5EGTA 2WAQB 2B2UC 4OL7A 4N9TA 4ODGA 5FOBB 3IFTA 4BY7B 4O1NA 1M4VA 1EY6A 4WORA 2B2TC 4ULLA 3GTPB 1LTTD 2A69D 1EY4A 2ICIA 2H4OA 5EPLA 1EY8A 1KNEA 1SNPA 1ZKOA 4C3HG 3Q0AA 1B9MA 1F77A 2EYHA 4XDXA 4OGQC 1H9MA 1YNJC 4U673 2K32A 1B50A 4WRDA 2EPBA 4FF1A 1B1ZA 3NWTA 3SK4A 1J8IA 2TSSA 2AUJD 3U9OA 3K5OA 3OIQA 5C5MA 2AQ3B 4A3BB 1NCVA 4IALA 4LMQD 3FPPA 4OO1H 5ELDA 2E75C 3P75A 2EY5A 1LTSD 2R61A 2JA8B 4G57A 3S1RB 5BN4A 4C2MB 3E5SA 1JICA 2PO4A 3M7GA 3L9AX 4HAEA 4BA1I 1HXYD 3TP8A 3N52A 2F0MA 2K04A 2PW7A 5D14A 1TS5A 1AW7A 5FK9C 1WTQA 5CV4A 1CZWA 2BDOA 2RQXA 1F2ZA 2DNCA 2A73B 4JBWA 3NTKA 3J7AF 1G291 3BS1A 2Z8LA 1OXSC 1B53A 1ML0D 4EQOA 3D8GA 1A3TA 1RKNA 3D31A 3TN2A 2L12A 4J6HA 3FVQA 2WP8J 1M8AA 3HP3A 3K57A 3J80L 1A2UA 2YU9B 2WKDA 2K5WA 3RZOB 1JWMD 2A5HA 1SBBB 2E2DC 3L7ZC 1SNDA 5ELBA 1SDFA 2EVBA 1BCPC 1SYGA 3ND9A 3OMGA 2XNAC 4F87A 3NE5B 3HOXB 1SYEA 1OXTA 2ZT9C 3GTJB 3EFXD 2NTTA 2AWOA 1XYIA 1L0XB 1LABA 2ZXRA 4KJOA 4A93B 4BBRB 2IPKD 5EBCA 3K5MA 1GUOA 2WINB 1Q3LA 1HA6A 2JEBI 1GUNA 3KLSA 3NWSA 3DXJC 4DK1A 3GV3A 5J1ZA 4FVMA 4CJ1B 2EYMA 1VDZA 1SNQA 3M3YB 3ERQA 4RAUC 2F0SA 1CHPD 2ID0A 3BVZA 5C0XI 4DXGA 2D9UA 2E2IB 2DNEA 4A3MB 5DM63 1DOMA 2KECA 3T51B 3AMUA 2HDLA 4ZRZA 3LX0A 1GOZA 3C3LA 1BXTA 3S2HB 3A7AB 1SYFA 3ITPA 3SK6A 4EVOA 4DN4M 3FEWX 3U9SA 4ZQ3A 3TP6A 4RGNA 1I50B 3VR6A 2RBMA 4Z9CB 4FF4A 3WDNA 1JR0D 2KJXA 5IGGA 4TSSA 1RJTA 3J81E 5C3XA 3MXPA 1WD1A 1Q90A 1X3PA 4H44C 1H9KA 3WOEA 5CBAE 4CHTB 2SEBD 4EGVA 1IHZA 1LT4D 1I3QB 2XWBB 1HHVA 1ONLA 4QMGA 3MA2B 3ONAB 1W6JA 2RDFA 1TS4A 4XXEA 1GHJA 2AUKA 4OIJA 3S2DB 4B9XA 1LTAD 3PUVA 3EA6A 1EEFD 1FR3A 1OXVA 2AWNA 1K8MA 3MXUA 1SJHD 5HGTA 2NBFA 1G6ZA 2XWJB 1CA6A 2IX0A 1SJED 4RGTA 4PNYA 2WV6D 2FHTA 4ZK9B 4HMJA 2Z4HA 2QCPX 2FFKB 1QE6A 4V190 5JEAJ 4DXFA 3VYSA 1D5ZC 3OSOA 1I4RA 4RKBA 2F0UA 1QILA 2CW0C 1VF5C 3NBHA 3SEBA 1PZID 2F0QA 4EQPA 2SDFA 3W2DA 2K05A 1GUGA 2A68D 1MD2D 2F0OA 2NVQB 1B2TA 1WTRA 2I46A 1I4PA 2QF7A 3CRKC 1F2MA 1EFID 2DY8A 3K0YA 3FRPB 3T13A 1CTMA 2XN9C 3IAYA 2JP1A 4MHEA 2SOBA 3HOYB 5CV5A 5LL6X 1HTLD 4J8QA 2RDGA 1QG7A 1EY0A 1RCVD 1F9QA 1RD9D 1H9JA 3VYRA 2NVXB 4KMUC 4YIJA 1NR4A 2PNRC 3PUWA 2A6HC 5D65A 3S15B 4KJNA 1HUNA 1G8ZD 2F0PA 3V2TA 3E6ZX 2FMMA 1I6VC 1GUWA 4K6LA 1BBXC 2IT1A 4TKOB 4UAIA 5J39A 3AB9A 2KA7A 2E74C 1S5FD 3NPPA 4CJ0B 1JOQA 1HQMC 3D3RA 4IFDH 2F0KA 1EQTA 2B2VC 1KDCA 1A2TA 2K1BA 5F2DA 4A3FB 5FLXL 4FO2A 4IUPA 3L3OC 3LWUA 2F0FA 2ZXOA 2WACA 1PMRA 3VYUA 2F0EA 4KI0A 2B2TA 1TWCB 1AZQA 3HOUB 4H7BA 2KEDA 2IX1A 2WIIB 4X3SA 4ZLTF 2PW5A 1S5ED 3J80E 4HMIA 4M8AA 1ESRA 4HEDA 5IGEA 4K5VA 3M85A 3PV0A 2EYOA 4E6IA 3SXHA 4QUCA 3VA5A 3M4YA 4IURA 2QKIC 4IUUA 4KHVA 4A3JB 3SK8A 2EY1A 2D2CC 4ME5A 2ZXPA 1EOTA 4ZUIA 2HDMA 3CHBD 5M3FB 1BO0A 1EYCA 4CKBA 3KUPA 5IT9E 3I3CA 1EWHA 2O4XA 4N9PA 3K59A 1A6XA 1PTOB 3P7JA 3RZDB 5D3IB 4RHRA 1DOLA 4OO1G 1KLUD 1TT2A 1SYBA 1D5MC 4P2CB 2L5TA 3C2PA 2EJMA 2Z1CA 4C3JG 2A6HD 2EDGA 1QB5D 4OHJA 1PTOF 2C9OA 2MPMA 3EROA 2Q8IB 2QEJC 3MVVA 4M1UB 4QF4A 1EYDA 2HCIA 5NUCA 3VR4A 3URYA 5LL6S 3MC0B 3BYYB 3Q22A 3HGBA 5CYUA 3DWPA 5CORA 1SXTA 1SYDA 1JWUD 1XXGA 1LT3D 5CV9A 3WOFA 1JOOA 3SR1A 2LMCB 4KN7C 4XTCS 4U68A 3KBGA 4CJ2C 1JC7A 5CV7A 2IW3A 1WVLA 1SNMA 3HOWB 5C5LA 1C8CA 1ENFA 3IKJA 1O7LA 5ISRA 3S1NB 3RLFA 3V05A 3K58A 4S3SA 1WTVA 3D6WA 3RUZA 1NAPA 5K5PA 2K7VA 2M9VA 1R9TB 1TIID 3BG3A 3S1QB 4NDXA 3JAME 1PTOH 2QDBA 1YNJD 1GJXA 1DD2A 4FF2A 1H9SB 3H3VC 5EKIA 3P20A 1MGSA 1FNUA 4QUFA 1V1OA 1IYVA 4FNFA 1HQRD 3KK7A 3TBIB 3H6MA 4PMCA 3QG1A 3GO5A 1IL8A 3F2UA 1DZ1A 1NUCA 2R7ZB 1EY5A 4BBSB 4ZUJA 1TR5A 2KCNA 3J7AV 1S5CD 2GA4B 4QB4A 1E0BA 1E2VA 3I4LA 3G7LA 3OOCA 2F0VA 5G3LD 5M5XB 2B2UA 4KY5A 2BOSA 4KKTA 1D1IA 1LTBD 2VNUD 5ELFA 2KQ3A 2F03A 4I65A 4L6TB 1D6EC 1S5BD 2RKSA 2CQAA 1U4RA 3MWYW 2KUMA 4IQZA 2EOTA 5ELCA 4KN4C 3FDTA 1PRTB 1QNUA 2VUMB 4HSVA 2LS01 1DYQA 4FP5D 3TP7A 4WJWA 2F3WA 5ELEA 3VR3A 1JE4A 4HCEA 1LV9A 2EJFC 4DNTB 4FXKC 4IFDG 1TY2A 2BE5C 1S5DD 1STYA 1FGBD 1Q8IA 1PFNA 1WCMB 2NYZD 2B63B 2G9DA 4IFDI 3PMFA 2LFNA 3HZXA 5CV6A 2MUYA 5IT9L 4ID6A 2J4XA 1SE4A 4QCLA 1LT5D 2N55A 1ESFA 3A55A 1PFMA 2HCCA 3FPUB 3BDCA 4R9WA 4IFDJ 1QWYA 4F88A 4RCOA 1DM0B 2PCFB 4QIWB 2PYKA 4RGOS 1J9OA 1AP0A 2F0GA 1U4LA 1ZYRD 1PYWD 3BYTB 4CKEA 5CGKA 3MXNA 3Q24A 1E2WA 1CQVA 5TSSA 3EVQA 1Z7TA 2OEOA 3K7AB 2AQ2B 2MGSA 1B9NA 4PMWA 5A2QE 4NMZA 1B3AA 2B2VA 3PUYA 1RHPA 2K5DA 4KKSA 3NXWA 1DCZA 1TWGB 4C3HB 1H9RA 3PO2B 2QILA 2K33A 4Q0FA 2OXPA 1TS3A 1GUSA 3NHHA 5E4WC 3A8JE 1SMYD 4V0BA 4H13C 3PIO3 4L63B 1JWSD 4PQXA 2XSCA 5I4DA 1XX8A 3NK9A 5DNFA 5CMDA 5DAUA 4RH6A 2K5QA 1HUMA 2DY7A 5COYA 2L1BA 2OF1A 1HRJA 1EWCA 1O7YA 3HS0C 3DM1A 1WTOA 1RTNA 1KTKA 2RVLA 3T4AC 4BS9A 3R2TA 2L4NA 2CVRA 4KY7A 2EYPA 2R93B 3QOLA 2KCCA 4K5WA 4PV1C 5KGUA 3S16B 5IOCA 3P1HA 1O80A 5JPNC 1SMYC 5I6WA 3X3NA 2F0TA 3BVGA 4K6DA 5C4ZA 3A56A 3N6RA 3NBIA 3G6JB 1BUVT 1IKLA 1DOKA 2XRSD 3DUZA 5KRUA 1WTPA 2L11A 1K8OA 2F0HA 3OHXC 4IUNA 4TRDA 2O2LD 5JPMC 1QJOA 4KV6A 4KD3A 4CGYB 1TVXA 4LJZC 5KYIA 3QJYA 1A3UA 4IUQA 1Z47A 2PZWA 4IN3A 3V96A 1CK1A 2NN6G 4RFBA 1TU2B 1I4GA 1V1PA 2TMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SDZ A;  1V43 A;  3MFY A;  2IT1 A;  4L8J A;  5BN4 A;  3A7L A;  1OXV A;  1IW7 C;  5C0X H;  1K8M A;  4TQU S;  3DXJ C;  3BG3 A;  2EJF C;  3MXU A;  4DK1 A;  3VR2 A;  4DNT B;  4TKO B;  1Y69 U;  4IFD G;  1HTP A;  1VDZ A;  2BE5 C;  3AB9 A;  4OO1 G;  1TKW B;  4BA1 I;  2JXM B;  2D5D A;  2NN6 I;  2KA7 A;  1GJX A;  5KND A;  3D4R A;  1DD2 A;  2E74 C;  3PUZ A;  5BN5 A;  1HCZ A;  2B8F A;  3OW7 A;  1V8Q A;  1H9S B;  1OXX K;  2L5T A;  3KLR A;  2V4D A;  2DNE A;  3VR5 A;  2BDO A;  2EJM A;  1DXM A;  1HQM C;  3P20 A;  2A6E C;  2DNC A;  1IYV A;  1VF7 A;  2A6H D;  4JBW A;  2EDG A;  4G7Z C;  1HPC A;  4IFD H;  2O5J C;  1E2Z A;  1G29 1;  3T51 B;  1OXS C;  3EQL C;  2EJG C;  2CW0 C;  1VF5 C;  2KCC A;  2BA1 A;  3QG1 A;  4PV1 C;  2Q8I B;  1Y8O B;  3D31 A;  3I72 A;  1SMY C;  1IW7 D;  1GHK A;  5K36 G;  2NN6 H;  2YYZ A;  1GUG A;  2PCF B;  3LWU A;  3N6R A;  3VR4 A;  3A8K E;  2A68 D;  4GZY C;  3I73 A;  1PMR A;  1IYU A;  4HR7 B;  2PPB C;  5K36 H;  3A7A B;  3IFT A;  2B8G A;  3PUX A;  3H94 A;  4KI0 A;  3SE0 A;  1VCI A;  2D62 A;  2QF7 A;  2O5I C;  3CRK C;  1E2W A;  3OPO A;  3U9S A;  1CTM A;  1T5E A;  2A69 D;  2E76 C;  3HGB A;  1YNN C;  2JEA I;  3L7Z C;  2EVB A;  1Z7T A;  5A35 A;  3ND9 A;  3LNN A;  1ZKO A;  3VR6 A;  3CRL C;  1Y8N B;  1E2V A;  1B9M A;  4DNR B;  1LAC A;  1CFM A;  3I4L A;  3OOC A;  3NE5 B;  3WDN A;  1B9N A;  2LMC B;  1K8O A;  1H9S A;  4I7Z C;  1Q1B A;  3PV0 A;  4KKT A;  3T53 B;  3M85 A;  1OXT A;  2ZT9 C;  4OGQ C;  4RCN A;  1H9M A;  4KN7 C;  5JEA H;  3BDO A;  3A8I E;  4G7H C;  3W3A A;  1YNJ C;  3M4Y A;  1H9J A;  3T56 B;  3QIA A;  4XTC S;  1Q90 A;  3PUY A;  1QJO A;  2K32 A;  4XIG S;  2BA0 A;  4KHZ A;  2BE5 D;  4KKS A;  3ND8 A;  4H44 C;  2AWO A;  1H9K A;  1GUT A;  3M7N A;  1Y8P B;  2F1M A;  4KMU C;  4BA2 I;  2JE6 I;  1DCZ A;  2A68 C;  1LAB A;  2PNR C;  3PUW A;  4LJZ C;  4IQZ A;  3IKJ A;  2A6H C;  2D2C C;  1FYC A;  1CI3 M;  1Q12 A;  1O7L A;  2AUJ D;  3QJY A;  1H9R A;  5BN3 A;  1ONL A;  5JEA G;  4JK1 C;  4DK0 A;  5KNB A;  5KNC A;  4KN4 C;  1BDO A;  3TZU A;  3FMC A;  2DN8 A;  2K33 A;  4G7O C;  1Z6H A;  2A69 C;  2A6E D;  3GD7 A;  4KKU A;  3RLF A;  1EWH A;  1GHJ A;  1GUS A;  1GUO A;  1O78 A;  2AUK A;  3A8J E;  4LK1 C;  3FPP A;  3VR3 A;  4OO1 H;  1I6V C;  1ZYR C;  2JEB I;  4H0L C;  2NN6 G;  3VA7 A;  1GUN A;  2E75 C;  3GQB A;  4H13 C;  2K7V A;  1TU2 B;  1Q1E A;  3PUV A;  1A6X A;  5C0X G;  2R6G A;  1OXU A;  1FR3 A; 
#chains in the Genus database with same CATH topology
 3MFY A;  1VQL A;  3A7L A;  3HKZ G;  1WTX A;  1D1K A;  1NMF A;  5H1S E;  3VR2 A;  1JMC A;  2PNH A;  1K83 B;  2Q8T A;  1HFG A;  1CHQ D;  4JYA L;  2JXM B;  5LMN L;  3MXG A;  3GTO B;  4A3D H;  1KAB A;  4XT1 B;  2OQ0 A;  1N32 Q;  2B8F A;  4DAY B;  4NXM Q;  3HOZ B;  3CC2 A;  3WWV A;  2FMC A;  1PLF A;  4DR4 L;  2O5J C;  3J80 i;  1X32 A;  2JA6 B;  2MP1 A;  2R7Z H;  4H02 A;  2EJG C;  4XYQ A;  4JI6 Q;  2J7Z A;  1LTG D;  1L1O A;  1W3S A;  2UXD L;  4XYO A;  1TWF H;  2CFM A;  2GVA A;  4A75 A;  3I7F A;  2KOL A;  4JVZ A;  1PDQ A;  5K36 G;  4KTA A;  3J81 L;  1K9M C;  3JAM i;  1CM9 A;  3PF5 A;  3J81 c;  3BVM A;  3PCO B;  4X3T A;  4B3M L;  2VUM G;  2PZT A;  3NBH B;  1NR2 A;  3H91 A;  3S14 B;  3QO2 A;  1AFP A;  3SE0 A;  2B3G A;  4MTK A;  1K73 C;  1HH2 P;  2QA4 A;  3K6O A;  5GRO A;  1PYS B;  4FF3 A;  3M9B A;  3OPO A;  5FKA C;  1YNN C;  3E3X A;  2JA7 B;  1JJ2 A;  4EQ5 A;  3CCE A;  2MO0 A;  1E1T A;  1I4H A;  4AYB G;  1PTO C;  4RCN A;  1D2B A;  1F2L A;  5JEA H;  3BDO A;  1X9N A;  3W3A A;  1UE1 A;  4X3K A;  4AYB B;  3QIA A;  3TSS A;  3OTO Q;  1EOV A;  4GNX A;  1K0S A;  3VYT A;  4A3G B;  5C4X B;  4IUT A;  1XWE A;  1GUT A;  1HNX L;  2BH2 A;  4ZYS A;  1I3Q H;  4UDU C;  5ELO A;  4A3E B;  1D5X C;  1R4P B;  1FYC A;  4HSP A;  4DV0 Q;  4LFB L;  2UXB Q;  2H1E A;  2R92 B;  3FMC A;  1HJP A;  2IY5 B;  5EQ0 A;  3GD7 A;  2L0C A;  4HN7 A;  2RF4 A;  4AQY L;  4DV1 L;  4DUZ L;  1PHJ A;  4IOA A;  1XMQ L;  3FKI B;  4LFC L;  2IX3 A;  1B4O A;  2MO1 A;  4KHP Q;  3SDZ A;  1I4X A;  4L8J A;  3TS2 A;  1BCP D;  2ICE C;  3RZO H;  2LY7 A;  1N36 Q;  1X65 A;  1QVF A;  5IGB A;  4GNX C;  2VB2 X;  2D5D A;  5I6Y A;  3CCM A;  2OT2 A;  2MHV A;  4CDD C;  1LYL A;  1C9O A;  2ENB A;  5BN5 A;  1HCZ A;  3OMC A;  5IP9 H;  2WFW A;  1X55 A;  3H15 A;  1IKM A;  3TQY A;  2X6G A;  4DR4 Q;  1EWI A;  3GP7 A;  5JVG 3;  3K5N A;  2BH8 A;  2IJ0 A;  2LXK A;  1YEZ A;  3HOW H;  2F52 A;  1TY0 A;  2B2W C;  1L1O B;  1B70 B;  3HKZ B;  4POF A;  3MEH A;  3CU7 A;  5LMU Q;  1UNS A;  4N8F A;  3ZYY X;  2CWA A;  3CQZ H;  3I2Z A;  1IW7 D;  2NN6 H;  3PSI A;  2K28 A;  2PQA A;  1EZ6 A;  4KY6 A;  1N33 L;  2WAQ G;  2K6A A;  3GTQ B;  4DAV A;  1FNW A;  1ET9 A;  2B2Y C;  1C48 A;  1CKO A;  4UP7 A;  1E7Z A;  1UAP A;  1T5E A;  1G6P A;  5LHY 1;  2JJQ A;  1MHW C;  1EZ8 A;  2PQE A;  3HOY H;  4B3T L;  3LNN A;  4BY1 B;  1XNR Q;  1VQN A;  3T53 B;  1LTR D;  1KDA A;  1ASY A;  1RDP D;  3A8I E;  1RF2 D;  4C1N I;  4Y7N B;  2NZ1 D;  4C3H H;  2F0I A;  3KF8 B;  1JOR A;  5EPK A;  4XQN A;  3PO3 H;  5D3D A;  4B08 A;  4R8N A;  3OWE B;  1YVC A;  4OWW B;  1EU4 A;  3UDF A;  4GLV B;  3JAM L;  4DV3 Q;  4DK0 A;  4BY1 G;  1SNO A;  3TZU A;  5E3F A;  1Z6H A;  2A69 C;  3CF5 A;  1WTW A;  1E3P A;  2Y0S B;  2VL6 A;  1WD0 A;  1G2S A;  1STE A;  2PMZ B;  1HR0 W;  2Z9H A;  3VA7 A;  4DU9 A;  4JBM A;  4RKL A;  3CCR A;  1STG A;  4IZ8 A;  2KCM A;  1VQ6 A;  5JJL A;  4JI3 Q;  5EPJ A;  2F0L A;  4ZKC B;  4TQU S;  5C4J H;  2VQE L;  1SNC A;  3KF8 A;  2MJ8 A;  2LXJ A;  4QL5 A;  4OEL B;  4DV6 L;  3H0G H;  2CH4 W;  4A93 G;  3D4R A;  4DUY L;  1QVG A;  1ENA A;  1KAA A;  1II3 A;  4RWS C;  1TWC H;  4PZ6 A;  1DXM A;  1GM5 A;  2UUB Q;  3W1G A;  1JCK B;  4J1M A;  4WFN 3;  4B3R L;  4IJH A;  4G7Z C;  5IOD A;  5GAG C;  1P8L A;  1K3B C;  3EN2 A;  3TP5 A;  1X3G A;  2WB1 B;  3NEM A;  1GXD C;  5IY0 A;  3CCL A;  5LMU L;  2K01 A;  4C1N K;  4ILW A;  4QQB X;  2C35 B;  3HOV B;  3PO2 H;  4DR2 L;  1Y8O B;  4KK7 A;  3U4V A;  1ET6 A;  3D0F A;  1SAP A;  1VQJ A;  4CKC A;  4A3K B;  2EYF A;  2YYZ A;  4MZ9 A;  4O42 A;  3O13 A;  2KVM A;  3A8K E;  3UDI A;  3HKZ E;  2BDN A;  4JOI A;  1XNQ Q;  2X6L A;  3R8B A;  3CXC A;  3I4M B;  1YNX A;  3MTS A;  2N88 A;  5M3F G;  1BNZ A;  4DUZ Q;  1QZH A;  1EL0 A;  1UUP A;  4JW0 A;  1W6K A;  4Q5V A;  1UWV A;  4DR1 L;  3HOV G;  1TWH B;  2CHB D;  4NP5 A;  3NP8 A;  5JVH 3;  3FHW A;  3CRL C;  4F7X A;  2K5H A;  1LAC A;  1LTI D;  5KYL A;  1N36 L;  4DR3 Q;  1QNK A;  5EKL A;  3EIV A;  4JCV E;  3G4S A;  2NWG A;  3CPW A;  1PH9 A;  1QZG A;  4DR3 L;  5DEH A;  4K14 A;  4ABN A;  1LT6 D;  2E2J B;  1EU3 A;  1G2T A;  2B2Y A;  4KHZ A;  4C56 C;  3NQI A;  3J7Y W;  3ND8 A;  3NTH A;  1VQA A;  3R2I A;  4IO9 A;  5KIX A;  2J0T D;  4HJ5 A;  1CKM A;  2RCN A;  4CDE C;  4OX9 Q;  2MNA A;  3T1H Q;  1CT1 D;  2F0J A;  1Q12 A;  1A15 A;  3UE0 A;  3NEL A;  4JBJ A;  1BDO A;  5CBE E;  2L55 A;  3X3M A;  1YJW A;  2A6E D;  5DM7 3;  1BVS A;  5JJK A;  4KKU A;  4HJ7 A;  1FGU A;  5G3L F;  2JSO A;  2WAQ E;  1QCB D;  5C4H A;  5FLX E;  5I2X A;  4XT3 B;  1G91 A;  2E2H B;  3HKS A;  1DON A;  3BZC A;  1A3V A;  2EZV A;  4X3U A;  4JI5 Q;  3PIP A;  1IW7 C;  2V1C C;  1OO9 B;  3PO3 B;  2VB3 X;  3RLN A;  2NN6 I;  4C3I G;  2H5X A;  1Q82 C;  2NTS A;  1DJR D;  1I4Q A;  2WKC A;  4ZAI A;  2RA4 A;  2NUC A;  3H0G B;  3KLR A;  2K5V A;  1KAW A;  3BU2 A;  1VF7 A;  2JA7 H;  1PFS A;  1WOC A;  1GD7 A;  1OTC A;  1CSP A;  5C6A A;  4A3G G;  2PZU A;  3GTL B;  5EKK A;  1BQQ T;  5I9O A;  3MFG A;  4FXG C;  1HR0 L;  1H95 A;  4DAM A;  2JYO A;  4C3I B;  4NW2 A;  1TQO A;  5BR8 L;  1AN8 A;  5C3W A;  2NB0 A;  2I07 B;  1BF4 A;  4GZY C;  1X3F A;  2R3Z A;  1PRT D;  3E0E A;  5C3E B;  2R7D A;  1SFO B;  2D62 A;  1SRU A;  1BOS A;  2BCO A;  1F9S A;  4DAY A;  3K5L A;  3SHL A;  2I0Q A;  2K03 A;  5LMN Q;  3TS0 A;  2NVT B;  5GQO A;  2F0D A;  4DKA C;  5JAV A;  4P72 A;  2EY2 A;  1MSH A;  3GV6 A;  3NEN A;  4DNR B;  5HUR A;  4K0K L;  1KDB A;  2AQ1 B;  2X69 A;  3IL8 A;  3UDX A;  3H09 A;  1ROD A;  3MZ5 A;  3D6C A;  1I6H B;  3PIP 3;  3HEJ A;  4P75 A;  4GKJ L;  3D4W A;  4X62 L;  3M7N A;  1EIH A;  1Y8P B;  4MIU A;  4X62 Q;  2A68 C;  1UE5 A;  1HNX Q;  1YHB A;  1SR3 A;  2KEE A;  3BDL A;  2UUB L;  3RD4 A;  1SYC A;  3AEV A;  1VQH A;  4JG2 A;  2UXB L;  4G7O C;  4JI8 L;  1NTG A;  2B39 A;  2EIF A;  1CZG A;  1MKH A;  1SE3 A;  1TWG H;  1Y1W B;  1QOH A;  4X65 Q;  2SNM A;  1LO5 D;  4LK1 C;  3T1Y Q;  1TWA B;  2K75 A;  4LF7 Q;  1ZYR C;  1VQB A;  1QUQ B;  4X65 L;  5I2Y A;  3G71 A;  3GTL H;  1IBL Q;  2Y0S G;  2OWO A;  1HZC A;  2YTY A;  3QB3 A;  4DA2 A;  1BCP B;  1EIG A;  2HUG A;  1HTP A;  1K28 A;  1PH1 A;  4DV4 Q;  1AEX A;  5I9P A;  4JPB W;  1YNN D;  4LF5 Q;  5KND A;  4JYA Q;  3DEP A;  2ZJQ A;  5C44 H;  1MBY A;  1PRT F;  4NB3 A;  4A3F G;  1EUJ A;  2ZM6 Q;  1PFB A;  2EXZ A;  1VQM A;  4MTN A;  4LF4 L;  4A3G H;  5T1G A;  2EYJ A;  4RGM A;  1BBU A;  2KHS A;  2N49 A;  1FNV A;  4L5T A;  1KNA A;  4K5X A;  4R8I A;  1J6Q A;  3CC7 A;  2F4V Q;  3CQZ B;  1FD7 D;  4QY7 A;  3STB D;  2QDL A;  2RDH A;  1ZEQ X;  1PZK D;  1E22 A;  2RSN A;  3I72 A;  1MI2 A;  1XMQ Q;  1Y1V B;  5A2Q L;  4AH6 A;  3EBE A;  5JJZ A;  1MJC A;  1IYU A;  5FLM G;  3GTM B;  4HJA A;  4P74 A;  4DV5 Q;  4JI8 Q;  2EYL A;  1I50 H;  2B8G A;  2Q8R E;  3A54 A;  3I4N G;  1VCI A;  2K4K A;  5IGF A;  4A3I B;  5L37 A;  4R4C A;  2E2I H;  2RHS B;  5M3M G;  5CR3 A;  4C2M H;  1KC8 C;  2E76 C;  3I4M G;  3HOW G;  3CCS A;  1IBL L;  3NSW A;  2WB1 E;  4LF8 Q;  3GTG B;  2JEA I;  4UPA A;  5A35 A;  1CA5 A;  2IWH A;  4A3J H;  4K2K A;  4LF8 L;  1Y8N B;  3ULL A;  3I8Z A;  4HJ8 A;  4I7Z C;  4ZKB B;  1Q1B A;  4JI0 Q;  1SEB D;  2MQH A;  4LF9 Q;  3C1E A;  3MAQ A;  2BE5 D;  2M2L A;  4A3J G;  3DWA A;  2HQL A;  3LGJ A;  3G48 A;  4BA2 I;  2RSO A;  1K3R A;  1HNZ L;  1TXY A;  4YCV A;  4GN5 A;  5IGD A;  2IL8 A;  4BY7 H;  4MN3 A;  2HQE A;  1EEI D;  2ZTE A;  3GTK B;  1CI3 M;  1PZJ D;  1JT8 A;  4JK1 C;  5KNB A;  3D4D A;  4R4T A;  3KBX A;  2UXC Q;  3FKI G;  3W5O A;  1PH8 A;  4FYD A;  1F9P A;  1U9R A;  1NNX A;  1L0Y B;  1SMX A;  1NSN S;  3GQB A;  3DEO A;  1Q1E A;  5E4X A;  3EJI A;  3MHB A;  4ME3 A;  5FO9 B;  1PXU A;  2I5H A;  4FXD A;  5CC4 A;  1ENC A;  2NVY B;  1TWF B;  3HFZ B;  4XQJ A;  1O7Z A;  1Y1V H;  4DV4 L;  1F2Y A;  3CME A;  3HG9 A;  1A0I A;  4DV2 Q;  3GTM H;  4XQQ A;  3J81 j;  2JA6 H;  4NXM L;  3OW7 A;  5HGQ A;  3IRB A;  1ZXT A;  1EY9 A;  1GKH A;  1OXX K;  5C44 G;  3GTO H;  4A3D B;  3NQT A;  5IGC A;  3S1M B;  1VMC A;  2A6E C;  3Q6S A;  4RA8 A;  3K80 C;  3DHQ A;  2PI2 E;  4B3R Q;  1UEB A;  3KLS X;  3EQL C;  4K8J A;  3RR5 A;  4HCS A;  1LTL A;  3SVM A;  3OYY A;  4HTH A;  4IUV A;  4DV5 L;  3GDE A;  2C5C A;  3I73 A;  1KXL A;  1RL2 A;  5K36 H;  4NKL A;  5M5Y B;  3M4O B;  1STB A;  4RMF A;  4JI1 L;  1ICW A;  2EQS A;  2O5I C;  3HOZ H;  3T16 A;  3TME A;  1JOK A;  1LLR D;  4TVA B;  1WTH A;  4X6A H;  5C4J B;  3RNU A;  4F8M A;  2VXW A;  2NVX H;  5IP7 H;  5M5W H;  1CFM A;  3E9I A;  4K8I A;  3RMH A;  4EQN A;  2UU9 Q;  4G7H C;  5FO8 B;  5J3B A;  4A3M H;  5C0X J;  3S17 H;  4A3D G;  1BCP F;  5KEE A;  4GNX B;  1RTO A;  4L5Q A;  2JE6 I;  4G4K A;  5BR8 Q;  1X3Q A;  1U4M A;  1FVI A;  4GOP C;  1LM0 A;  3C1F A;  5BN3 A;  3OWF A;  1ASZ A;  5M3M B;  1U0L A;  2DN8 A;  1WCM G;  1L0W A;  1JQY D;  4DAP A;  3E0J A;  4JI7 L;  3DMU A;  3K7A H;  2A74 C;  2F4I A;  3M4O H;  3I4M H;  3LWE A;  5C0X G;  1TS2 A;  2M00 A;  2R6G A;  1OXU A;  1LUZ A;  1V43 A;  5EJW A;  3HOU H;  2F3V A;  3I90 A;  4JI2 L;  1YJ9 A;  5C0X H;  3AU7 A;  3DM3 A;  4JV5 Q;  1Y69 U;  5CV8 A;  1SE2 A;  2PI2 A;  1PTO D;  1STA A;  1TKW B;  4BBS H;  3R3O A;  1KIX A;  3ERS X;  5JOB A;  4GKJ Q;  3CKI B;  2FJ2 A;  3VDY A;  3I91 A;  2V4D A;  3VR5 A;  3NTI A;  1VQ4 A;  4C3I H;  5IT9 c;  5AFW A;  5IIF A;  3TZD A;  2DUD A;  5E1F A;  1JE5 A;  4C3J B;  2LKV A;  3I4O A;  3KDF A;  1ILP A;  2L9H A;  4DPG A;  1EYA A;  3S9W A;  2BA1 A;  3S15 H;  2XVS A;  2FIN B;  3TDQ A;  1HNZ Q;  3PF4 A;  3F2C A;  3ER0 A;  1GHK A;  3C46 A;  1BR9 A;  2Z4I A;  3HRZ C;  1STH A;  1N33 Q;  1IXR A;  1XPR A;  4HR7 B;  3I70 A;  3M4P A;  5EAY A;  2PPB C;  4B9W A;  1V1P B;  2XIW A;  4A3K G;  2E2H H;  3PUX A;  3H94 A;  2F0N A;  3R93 A;  2CCZ A;  1T5X D;  2B2W A;  3UI2 A;  5M9O A;  4DF7 A;  5IYB G;  3S17 B;  3H3V H;  1BBW A;  5GAH C;  3IFD A;  4O2D A;  4DR6 Q;  2OTJ A;  4DGZ A;  1NBW A;  4GN3 B;  4A3M G;  3KDF B;  1H9S A;  1CUK A;  2KBN A;  5M5W B;  4A3F H;  3T56 B;  4Y52 H;  1I5F A;  4XIG S;  2BA0 A;  1VMP A;  4RHS A;  2CW0 D;  2QW7 A;  3SK5 A;  1F9R A;  2G9H D;  2F1M A;  3BZD B;  1HFN A;  4R4Q A;  2N8N A;  2DJF C;  2RCF A;  5C3E H;  3TRE A;  5T1I A;  1DGS A;  3ZJY C;  3HOZ G;  3H3V I;  5JEA G;  5EBD A;  3T1H L;  5KNC A;  1K0R A;  1EQV A;  1U4P A;  2EY6 A;  4LAA A;  1PYB A;  4CBV A;  1MSG A;  1O78 A;  1AZP A;  2JA5 H;  5J22 A;  2JA5 B;  4H0L C;  3KF6 A;  1Y1V G;  4LF7 L;  1NY4 A;  4KD4 A;  4JI2 Q;  1XTC D;  2SNS A;  1YJN A;  1STN A;  1JJC B;  1S4Z A;  1PRT C;  1YI2 A;  3QWN A;  3RLO A;  3OIP A;  1Y1W G;  1X54 A;  4A3B G;  2F0W A;  2JK8 A;  1HA5 A;  4OIK A;  1CQF A;  1SSO A;  1C4Q A;  2XRQ D;  4PMB A;  3NUC A;  2Z6B A;  2Q2U A;  1B44 D;  3PUZ A;  1T9H A;  1V8Q A;  5FO7 B;  2EE1 A;  1KLG D;  1PH4 A;  3QOJ A;  3Q23 A;  1FJG Q;  3S2D H;  4LFB Q;  1HPC A;  4OO1 I;  1E2Z A;  4J15 A;  5C44 B;  4K2L A;  4DR7 L;  2ZJR A;  3ICE A;  3BZK A;  4DFA A;  1UEA B;  1ILQ A;  1EY7 A;  1R4Q B;  3I4N B;  2VQF L;  1JB3 A;  3U4Z A;  3CCU A;  3DWQ A;  4YY3 Q;  2VQF Q;  4JI4 L;  4BWG B;  5EGT A;  2WAQ B;  1PVO A;  2B2U C;  1I94 L;  4OL7 A;  4N9T A;  4ODG A;  3FKI H;  5FOB B;  3IFT A;  4BY7 B;  4O1N A;  1M4V A;  1EY6 A;  4WOR A;  3GTG H;  2B2T C;  4ULL A;  3GTP B;  2NVY H;  1LTT D;  2A69 D;  1EY4 A;  4BBR G;  2ICI A;  5HY6 A;  2H4O A;  2NVQ H;  1K83 H;  5EPL A;  1EY8 A;  1KNE A;  1SNP A;  1ZKO A;  2KHI A;  4C3H G;  5IWA Q;  3Q0A A;  1B9M A;  1F77 A;  1P16 A;  2EYH A;  4XDX A;  4X64 L;  1ICF B;  3RN2 A;  3CC4 A;  4OGQ C;  1JB7 A;  4I7A A;  1H9M A;  1YNJ C;  4U67 3;  3HOX H;  4LWC A;  2K32 A;  1B50 A;  4WRD A;  1XMO Q;  4IPD A;  2EPB A;  4ZCK A;  4FF1 A;  1B1Z A;  3NWT A;  3SK4 A;  4C3J H;  4GKK Q;  4JBK A;  1J8I A;  2TSS A;  3TEH B;  2AUJ D;  3HOX G;  3I4N H;  3CCJ A;  3U9O A;  3K5O A;  2MFI A;  3OIQ A;  5C5M A;  2AQ3 B;  4A3B B;  1NCV A;  4IAL A;  2HD3 A;  3FPP A;  4LMQ D;  4OO1 H;  5ELD A;  2E75 C;  3P75 A;  2EY5 A;  1LTS D;  4BXX H;  4YY3 L;  4BBR H;  2R61 A;  4LUO A;  2JA8 B;  2A8V A;  4G57 A;  1M90 C;  3S1R B;  5BN4 A;  2YU9 H;  4C2M B;  2CH4 A;  3E5S A;  1VQI A;  3SGI A;  1JIC A;  2PO4 A;  3E9H A;  3M7G A;  3L9A X;  4HAE A;  2DJG C;  4UP8 A;  4BA1 I;  1HXY D;  5IYC H;  3TP8 A;  3N52 A;  3PIO A;  2F0M A;  2K04 A;  1D8L A;  2PW7 A;  5D14 A;  2K14 A;  1TS5 A;  1CSQ A;  1AW7 A;  3PO2 G;  5FK9 C;  1WTQ A;  5CV4 A;  1CZW A;  4X64 Q;  2BDO A;  1XPU A;  2ZM6 L;  2RQX A;  1F2Z A;  2DNC A;  2A73 B;  4JBW A;  3NTK A;  4DR7 Q;  1KL9 A;  3J7A F;  1G29 1;  3Q8D A;  3BS1 A;  2Z8L A;  1QVC A;  1OXS C;  1N34 L;  3CP0 A;  1B53 A;  1ML0 D;  1R9T H;  1J5E Q;  5M3F H;  4EQO A;  3D8G A;  3ULP A;  1A3T A;  1VQ9 A;  1RKN A;  3D31 A;  3TN2 A;  2L12 A;  4J6H A;  3FVQ A;  4LFC Q;  2WP8 J;  1M8A A;  3HP3 A;  3K57 A;  3J80 L;  2Y0S E;  1K8A C;  1AE3 A;  2KCT A;  1V1Q A;  1A2U A;  3S1R H;  2YU9 B;  3BJU A;  2WKD A;  2K5W A;  3RZO B;  1JWM D;  2A5H A;  1SBB B;  2Z6K C;  2VUM H;  2Z6K A;  2E2D C;  3S24 A;  3S2H H;  3L7Z C;  1SND A;  5ELB A;  1SDF A;  2EVB A;  1BCP C;  1SYG A;  3ND9 A;  3OMG A;  4YWK A;  2XNA C;  2NZH A;  4F87 A;  1NE3 A;  3NE5 B;  4JOI C;  3HOX B;  1SYE A;  1OXT A;  2ZT9 C;  4BY1 H;  2ASB A;  1NJI C;  1V9P A;  3GTJ B;  3EFX D;  2NTT A;  2AWO A;  1XYI A;  1L0X B;  1LAB A;  1HNW Q;  4LF4 Q;  2ZXR A;  4KJO A;  2UXC L;  4A93 B;  4BBR B;  2IPK D;  5EBC A;  4A3L G;  2DGY A;  4DV3 L;  1E24 A;  1GVP A;  3K5M A;  1EYG A;  1GUO A;  2WIN B;  5IYC G;  1Q3L A;  1HA6 A;  2JEB I;  2OQK A;  2VY3 A;  1GUN A;  3KLS A;  4AQY Q;  1GO3 E;  3J7Z C;  3K0X A;  3NWS A;  1EFW A;  2K5N A;  3DLL A;  3DXJ C;  1IBM L;  4KLK A;  4P71 A;  4DK1 A;  4A3K H;  3GV3 A;  5J1Z A;  4FVM A;  4CJ1 B;  2EYM A;  1VDZ A;  1SNQ A;  2VQE Q;  2A1A A;  4AIM A;  3M3Y B;  3ERQ A;  1QUQ A;  4RAU C;  2F0S A;  1CHP D;  1AE2 A;  2ID0 A;  2Q2H A;  3BVZ A;  5C0X I;  4DXG A;  4NXN L;  2D9U A;  2GN5 A;  2E2I B;  2DNE A;  1RIP A;  4A3M B;  5DM6 3;  4OX9 L;  3CMA A;  3F2B A;  1DOM A;  3A5U A;  1K8G A;  2KEC A;  3T51 B;  3AMU A;  2HDL A;  2FXQ A;  4ZRZ A;  3LX0 A;  1G51 A;  4EX5 A;  1GOZ A;  5IP9 G;  3C3L A;  2I5L X;  2PQA B;  1SE8 A;  2IHF A;  4DV0 L;  4LUV A;  4B3M Q;  1BXT A;  3S2H B;  3A7A B;  1X56 A;  1SYF A;  3HOV H;  3ITP A;  3SK6 A;  4A76 A;  2ZJP A;  4EVO A;  4DN4 M;  1IYJ B;  3FEW X;  1YBY A;  3U9S A;  4ZQ3 A;  3TP6 A;  1N8R C;  3L2P A;  2ALY B;  2VW9 A;  5GAE C;  4RGN A;  3M3Y H;  1I50 B;  3VR6 A;  2RBM A;  4Z9C B;  4FF4 A;  3WDN A;  1JR0 D;  2KJX A;  5IGG A;  4TSS A;  4LF9 L;  1RJT A;  3J81 E;  5C3X A;  3MXP A;  4DV2 L;  2G5D A;  1TWH H;  1WD1 A;  1Q90 A;  1X3P A;  4H44 C;  1H9K A;  2B63 G;  3WOE A;  5CBA E;  4CHT B;  1Q86 C;  2SEB D;  2Z0S A;  4R1J A;  1YIT A;  4EGV A;  1IHZ A;  1LT4 D;  1CKN A;  4OON A;  1I3Q B;  2XWB B;  3F2D A;  5JJI A;  1HHV A;  1ONL A;  5FJ8 H;  4QMG A;  3MA2 B;  3ONA B;  1W6J A;  4DNI A;  2RDF A;  4JI7 Q;  1TS4 A;  4XXE A;  1PH7 A;  1GHJ A;  2D0O A;  2AUK A;  4OIJ A;  1YIJ A;  3S2D B;  5GAD C;  4B9X A;  1SN8 A;  2VS1 A;  1LTA D;  3PUV A;  2R93 H;  4A3L H;  4JI3 L;  3STB C;  3EA6 A;  4GS3 A;  1EEF D;  1FR3 A;  4B3S Q;  1OXV A;  2AWN A;  1K8M A;  3MXU A;  1SJH D;  2JN4 A;  5HGT A;  2NBF A;  3QR8 A;  1G6Z A;  3KF6 B;  2XWJ B;  5FLX c;  5IYD H;  1CA6 A;  2IX0 A;  1SJE D;  4RGT A;  1XMO L;  4PNY A;  4WJ3 M;  2WV6 D;  2FHT A;  4ZK9 B;  4HMJ A;  2Z4H A;  1C7Y A;  2QCP X;  5IYD G;  2FFK B;  1QE6 A;  4V19 0;  5JEA J;  2NVT H;  4DXF A;  3VYS A;  1D5Z C;  3MEF A;  1EIF A;  2HIV A;  1E1O A;  3PO3 G;  3OSO A;  1I4R A;  4RKB A;  4P73 A;  2F0U A;  1QIL A;  2CW0 C;  1VF5 C;  1A62 A;  3NBH A;  3SEB A;  1PZI D;  2F0Q A;  3T1Y L;  1Q7Y C;  4EQP A;  2SDF A;  4PG3 A;  3MXN B;  3W2D A;  2K05 A;  4A3I G;  1GUG A;  1FL0 A;  3TRZ A;  2A68 D;  1MD2 D;  3K81 C;  2F0O A;  2NVQ B;  1B2T A;  1VQO A;  1WTR A;  2I46 A;  4IPC A;  2HHH Q;  1I4P A;  2QF7 A;  2K52 A;  3CRK C;  4OWT B;  1SRO A;  1F2M A;  1EFI D;  2DY8 A;  3K0Y A;  3FRP B;  3T13 A;  1CTM A;  1HZB A;  2EXD A;  2R7Z G;  1PA6 A;  4BXX G;  2XN9 C;  4NPS A;  2K50 A;  3IAY A;  5M5Y H;  2JP1 A;  1YZ6 A;  4MHE A;  2SOB A;  3AFQ A;  3HOY B;  5CV5 A;  5LL6 X;  1HTL D;  4J8Q A;  2RDG A;  1QG7 A;  3JC6 6;  1EY0 A;  1RCV D;  1F9Q A;  1RD9 D;  1H9J A;  3VYR A;  3S1M H;  2NVX B;  4QJF A;  4LNQ A;  4KMU C;  4YIJ A;  1NR4 A;  2PNR C;  3PUW A;  4R4O A;  1VQ8 A;  2CQO A;  3GTQ H;  1C0A A;  2A6H C;  5D65 A;  3S15 B;  4KJN A;  1HUN A;  1A63 A;  1G8Z D;  2F0P A;  3V2T A;  1JJG A;  3E6Z X;  3K8A A;  2FMM A;  1I6V C;  1GUW A;  4K6L A;  3S14 H;  4B3S L;  4YHH Q;  2YTX A;  1BBX C;  1WJJ A;  2IT1 A;  3G6E A;  4JV5 L;  4QGU A;  4AYB E;  4TKO B;  4UAI A;  3U58 A;  4IPH A;  5J39 A;  3AB9 A;  5FLM H;  1IBK Q;  2WB1 G;  1KRS A;  4DUY Q;  1UE7 A;  2KA7 A;  1M1K C;  2E74 C;  1S5F D;  3NPP A;  4QIW E;  4CJ0 B;  1JOQ A;  5IE8 A;  1HQM C;  2Q2I A;  1HZA A;  1A8V A;  4IOC A;  3D3R A;  1KD1 C;  3I55 A;  4IFD H;  4DK3 C;  2F0K A;  1EQT A;  2B2V C;  1KDC A;  1A2T A;  2K1B A;  1XJV A;  5F2D A;  4APV A;  4A3F B;  4FO2 A;  5FLX L;  1EQR A;  4IUP A;  2CKZ B;  4DR5 Q;  3L3O C;  3LWU A;  2F0F A;  2IHE A;  2ZXO A;  3F8T A;  5IP7 G;  2WAC A;  4A3I H;  4OEM B;  1PMR A;  1WCM H;  1VQC A;  1XTD A;  1X3E A;  4N8X 1;  3VYU A;  2F0E A;  3ULJ A;  4A3E H;  4KI0 A;  4LFA L;  4PZ8 A;  2B2T A;  1TWC B;  3RN5 A;  1AZQ A;  4LFA Q;  3HOU B;  4H7B A;  3W1B A;  2KED A;  2IX1 A;  2WII B;  4X3S A;  4ZLT F;  2PW5 A;  5IWA L;  4DR6 L;  1S5E D;  4NXN Q;  2L15 A;  3J80 E;  4HMI A;  3KYH C;  4M8A A;  1ESR A;  4HED A;  5IGE A;  4K5V A;  3I56 A;  3OW2 A;  3M85 A;  1EQQ A;  3PV0 A;  2EYO A;  4E6I A;  4LF6 Q;  3SXH A;  2A19 A;  4QUC A;  3VA5 A;  3M4Y A;  3H0G G;  4IUR A;  2QKI C;  4A93 H;  4IUU A;  4KHV A;  4A3J B;  3SK8 A;  2EY1 A;  1L2F A;  4CDF C;  2D2C C;  4ME5 A;  2RHQ B;  2ZXP A;  1EOT A;  4ZUI A;  2HDM A;  3CHB D;  5M3F B;  1BO0 A;  1EYC A;  4CKB A;  3KUP A;  5IT9 E;  3I3C A;  2JA5 G;  1EWH A;  2OTL A;  2O4X A;  4N9P A;  1U5K A;  1PH6 A;  3K59 A;  1A6X A;  1PTO B;  3P7J A;  2R92 G;  3RZD B;  5D3I B;  4RHR A;  1I94 Q;  4YWM A;  1DOL A;  2YV5 A;  4OO1 G;  1KLU D;  1TT2 A;  3KFU A;  1SYB A;  2E5L Q;  1D5M C;  1CKN B;  4P2C B;  2JA6 G;  2L5T A;  5AJ3 L;  1FJG L;  3S1N H;  3AFP A;  3C2P A;  2EJM A;  3M4Q A;  2Z1C A;  4C3J G;  2A6H D;  2EDG A;  2ATW A;  1QB5 D;  3FP9 A;  4OHJ A;  1PTO F;  4JI6 L;  2C9O A;  3L0O A;  4O0A A;  1S40 A;  4X66 Q;  2MPM A;  2ZTD A;  4L5R C;  3ERO A;  2Q8I B;  2QEJ C;  4DV1 Q;  3MVV A;  2JA8 G;  4M1U B;  4Y7N H;  4QF4 A;  1EYD A;  2HCI A;  1B8A A;  5NUC A;  3VR4 A;  4A4I A;  3URY A;  4BBS G;  5LL6 S;  1SFO H;  3MC0 B;  3BYY B;  3Q22 A;  1IBM Q;  1IL2 A;  1MJE A;  3HGB A;  5CYU A;  3PQI A;  3DWP A;  5COR A;  1SXT A;  1D7Q A;  1SYD A;  1JWU D;  1XXG A;  1LT3 D;  5CV9 A;  3WOF A;  1JOO A;  3SR1 A;  2I5M X;  2LMC B;  3GTP H;  4KN7 C;  1VQE A;  4XTC S;  4U68 A;  3KBG A;  4CJ2 C;  1JC7 A;  1HZ9 A;  5CV7 A;  1BKB A;  2IW3 A;  1XPO A;  4YCW A;  1WVL A;  1SNM A;  4DR2 Q;  3CAM A;  5C5L A;  1C8C A;  3HOW B;  1ENF A;  3IKJ A;  5M3M H;  3HOU G;  1O7L A;  1Z9F A;  3A74 A;  5ISR A;  3KJP A;  3AQQ A;  3S16 H;  2HIX A;  3JAM c;  4RG1 A;  3S1N B;  3RLF A;  3V05 A;  3K58 A;  4S3S A;  4JI1 Q;  1WTV A;  1KQS A;  2UXD Q;  3D6W A;  1PH5 A;  2VZA A;  3RUZ A;  1VS0 A;  4A3B H;  5M5X H;  1NAP A;  5K5P A;  2K7V A;  4L5S A;  2M9V A;  1MIU A;  1R9T B;  1TII D;  1WI5 A;  4HJ9 A;  3BG3 A;  1SLJ A;  2E8G A;  3S1Q B;  4NDX A;  4WJ4 A;  3CCV A;  1VQP A;  4CDC C;  2UU9 L;  3JAM E;  4JC0 A;  1PTO H;  2QDB A;  4A3C H;  1YNJ D;  1GJX A;  1DD2 A;  5AJ3 Q;  4FF2 A;  1H9S B;  3H3V C;  2AKW B;  5EKI A;  4GOP A;  3P20 A;  1MGS A;  1FNU A;  4QUF A;  4JI0 L;  1V1O A;  1IYV A;  4R4I A;  1TWA H;  4FNF A;  1HQR D;  3KK7 A;  2KHJ A;  3TBI B;  2XTI A;  3H6M A;  3J80 c;  4PMC A;  3QG1 A;  2R92 H;  2B29 A;  3GO5 A;  4UHV A;  4LW1 A;  4GKK L;  4GOP B;  1IL8 A;  3F2U A;  1DZ1 A;  1NUC A;  2R7Z B;  1EY5 A;  4BBS B;  4ZUJ A;  1S3O A;  5ELN A;  2UUA L;  1TR5 A;  2KCN A;  3GTK H;  3J7A V;  5LMN W;  5C3E G;  1S5C D;  2R93 G;  1VQF A;  4B3T Q;  4KHP L;  2GA4 B;  4QB4 A;  3U50 C;  4IJL A;  1AH9 A;  1E0B A;  2XGT A;  1NMG A;  1E2V A;  1IZ6 A;  3I4L A;  1VQD A;  3G7L A;  2F0V A;  3OOC A;  5G3L D;  4DV7 L;  2B2U A;  4KY5 A;  2BOS A;  4KKT A;  5M5X B;  1D1I A;  1LTB D;  2Q2T A;  2VNU D;  5ELF A;  4DV7 Q;  4ALP A;  4DK6 C;  2KQ3 A;  2F03 A;  5DLQ E;  4IPG A;  4I65 A;  4L6T B;  1D6E C;  1S5B D;  2RKS A;  2CQA A;  4POG A;  1U4R A;  1HR0 Q;  3MWY W;  2AMC B;  5IYB H;  2P5Z X;  2KUM A;  4IQZ A;  3J7A 5;  2E2J H;  2EOT A;  1VQ5 A;  4YCU A;  4PZ7 A;  5ELC A;  4KN4 C;  3FDT A;  1PRT B;  1QNU A;  2VUM B;  4X66 L;  4HSV A;  2LS0 1;  1DYQ A;  4FP5 D;  3TP7 A;  4WJW A;  2F3W A;  5ELE A;  3VR3 A;  1JE4 A;  2UUC Q;  2UUA Q;  4K0K Q;  4HCE A;  1LV9 A;  2EJF C;  4DNT B;  4FXK C;  4JI5 L;  4IFD G;  1TY2 A;  2BE5 C;  1S5D D;  1STY A;  1X6O A;  1FGB D;  1KHI A;  1PFN A;  1Q8I A;  1WCM B;  2NYZ D;  2B63 B;  2N78 A;  1L1O C;  2G9D A;  4IFD I;  3PMF A;  2LFN A;  3HZX A;  5C4X G;  5CV6 A;  2MUY A;  5IT9 L;  4ID6 A;  2J4X A;  1SE4 A;  4QCL A;  1LT5 D;  1XNR L;  2N55 A;  3GTJ H;  1ESF A;  3A55 A;  3UE1 A;  2OCE A;  1PFM A;  3PGZ A;  3AYH B;  2AHO B;  2HCC A;  3FPU B;  3BDC A;  4R9W A;  4IFD J;  1QWY A;  4F88 A;  4RCO A;  3S1Q H;  1DM0 B;  2PCF B;  4FDB A;  4QIW B;  4HID A;  2PYK A;  4RGO S;  1J9O A;  2HHH L;  2ZTC A;  2JA8 H;  1AP0 A;  2F0G A;  4OWX B;  1VQK A;  3KJO A;  1U4L A;  1ZYR D;  3A5Z B;  4MNO A;  1PYW D;  1IBK L;  3BYT B;  4CKE A;  5CGK A;  4DR1 Q;  3MXN A;  3Q24 A;  1E2W A;  1CQV A;  5TSS A;  2E5L L;  3EVQ A;  1N9W A;  2F3I A;  1Z7T A;  2ES2 A;  2OEO A;  3CW2 C;  2JA9 A;  4HIM A;  3K7A B;  2AQ2 B;  2NZO A;  2MGS A;  4GLA C;  1I6H H;  2R7F A;  1B9N A;  1S72 A;  4OXP A;  3CPF A;  4PMW A;  5A2Q E;  4NMZ A;  1B3A A;  2B2V A;  4DV6 Q;  3PUY A;  1RHP A;  1Q81 C;  1N34 Q;  2K5D A;  4KKS A;  1PH3 A;  3NXW A;  1J5E L;  1DCZ A;  1Y1W H;  1TWG B;  4C3H B;  4DR5 L;  1H9R A;  3PO2 B;  2QIL A;  2K33 A;  1YHA A;  3B6Y A;  4Q0F A;  5E7N A;  2QGQ A;  2OXP A;  1TS3 A;  1GUS A;  3NHH A;  5E4W C;  3A8J E;  1SMY D;  4V0B A;  4H13 C;  3PIO 3;  4L63 B;  1JWS D;  1UE6 A;  4PQX A;  2UUC L;  2XSC A;  3J81 i;  3CD6 A;  5I4D A;  3F1Z A;  1XX8 A;  3NK9 A;  5DNF A;  3KOJ A;  5CMD A;  1XNQ L;  5DAU A;  4RH6 A;  4A3E G;  2K5Q A;  3RZD H;  1HUM A;  1B3Q A;  2DY7 A;  5COY A;  2L1B A;  2OF1 A;  1WFQ A;  1HRJ A;  1EWC A;  1O7Y A;  2YTV A;  3OTO L;  1O7I A;  3HS0 C;  3DM1 A;  1YHQ A;  1WTO A;  1RTN A;  1N32 L;  1KTK A;  3KLW A;  2RVL A;  3T4A C;  1EIY B;  2HT1 A;  4A3C G;  4BS9 A;  3UDG A;  3R2T A;  2L4N A;  2CVR A;  2B63 H;  4KY7 A;  2JA7 G;  4GLX A;  1PV4 A;  2EYP A;  2D0P A;  2R93 B;  3QOL A;  2KCC A;  2LSS A;  4K5W A;  4PV1 C;  5KGU A;  2F4V L;  3S16 B;  5IOC A;  3P1H A;  1O80 A;  5JPN C;  1SMY C;  5I6W A;  3X3N A;  2F0T A;  3BVG A;  1KRT A;  4K6D A;  5C4Z A;  1VQG A;  3A56 A;  3N6R A;  3NBI A;  4LUZ A;  4JI4 Q;  3G6J B;  1BUV T;  1B7Y B;  1IKL A;  3A0J A;  1Y14 B;  1DOK A;  2N3S A;  2XRS D;  4GN4 B;  3DUZ A;  5FJ8 G;  1PH2 A;  4UP9 A;  4YWL A;  5KRU A;  1WTP A;  4BY7 G;  4LF5 L;  4UY8 C;  1WYD A;  2L11 A;  4HIO A;  2JQO A;  1K8O A;  2F0H A;  3CCQ A;  4LF6 L;  5C4X H;  2PMZ E;  3OHX C;  4IUN A;  4TRD A;  2KEN A;  2O2L D;  5JPM C;  1QJO A;  4KV6 A;  4HIK A;  4KD3 A;  4CGY B;  1TVX A;  3HOY G;  1Q8K A;  3K7U C;  1VQ7 A;  1W2B A;  4LJZ C;  2CWP A;  1HNW L;  1Q46 A;  5KYI A;  3QJY A;  2GVB A;  2QEX A;  1A3U A;  4IUQ A;  1Z47 A;  2PZW A;  4IN3 A;  3V96 A;  4YHH L;  1CK1 A;  2NN6 G;  4RFB A;  1TU2 B;  1I4G A;  1V1P A;  2TMP A; 
#chains in the Genus database with same CATH homology
 3MFY A;  3A7L A;  1WTX A;  1D1K A;  3VR2 A;  1K83 B;  2Q8T A;  1HFG A;  1CHQ D;  2JXM B;  3MXG A;  3GTO B;  1KAB A;  4XT1 B;  2B8F A;  3HOZ B;  2FMC A;  1PLF A;  2O5J C;  1X32 A;  2JA6 B;  2MP1 A;  2EJG C;  4XYQ A;  2J7Z A;  1LTG D;  4XYO A;  2KOL A;  5K36 G;  1PDQ A;  4KTA A;  3J81 L;  1CM9 A;  3BVM A;  4X3T A;  2PZT A;  1NR2 A;  3H91 A;  3S14 B;  3QO2 A;  1AFP A;  3SE0 A;  3K6O A;  4FF3 A;  3OPO A;  5FKA C;  1YNN C;  2JA7 B;  1I4H A;  1PTO C;  4RCN A;  1D2B A;  1F2L A;  5JEA H;  3BDO A;  3W3A A;  4X3K A;  4AYB B;  3QIA A;  3TSS A;  3VYT A;  4A3G B;  5C4X B;  4IUT A;  1XWE A;  1GUT A;  4ZYS A;  4UDU C;  4A3E B;  1D5X C;  1R4P B;  1FYC A;  4HSP A;  2H1E A;  2R92 B;  3FMC A;  5EQ0 A;  3GD7 A;  2L0C A;  4HN7 A;  3FKI B;  2IX3 A;  1B4O A;  3SDZ A;  1I4X A;  4L8J A;  1BCP D;  2ICE C;  2LY7 A;  5IGB A;  2VB2 X;  2D5D A;  5I6Y A;  2OT2 A;  2MHV A;  2ENB A;  5BN5 A;  1HCZ A;  3OMC A;  1IKM A;  2X6G A;  3GP7 A;  5JVG 3;  3K5N A;  2IJ0 A;  1TY0 A;  2B2W C;  3HKZ B;  3MEH A;  3CU7 A;  1UNS A;  3ZYY X;  1IW7 D;  2NN6 H;  2K28 A;  1EZ6 A;  4KY6 A;  2K6A A;  3GTQ B;  4DAV A;  1FNW A;  1ET9 A;  2B2Y C;  1C48 A;  1UAP A;  1T5E A;  5LHY 1;  1EZ8 A;  2PQE A;  3LNN A;  4BY1 B;  3T53 B;  1LTR D;  1KDA A;  1RDP D;  3A8I E;  1RF2 D;  4C1N I;  4Y7N B;  2NZ1 D;  2F0I A;  1JOR A;  5EPK A;  4XQN A;  5D3D A;  4B08 A;  4R8N A;  3OWE B;  1EU4 A;  3JAM L;  4DK0 A;  1SNO A;  3TZU A;  5E3F A;  1Z6H A;  2A69 C;  1WTW A;  2Y0S B;  1WD0 A;  1G2S A;  1STE A;  2PMZ B;  3VA7 A;  4DU9 A;  4RKL A;  1STG A;  4IZ8 A;  5EPJ A;  2F0L A;  4ZKC B;  4TQU S;  1SNC A;  3KF8 A;  2MJ8 A;  3D4R A;  1ENA A;  1KAA A;  1II3 A;  4RWS C;  1DXM A;  1JCK B;  4J1M A;  4WFN 3;  4G7Z C;  5IOD A;  3TP5 A;  2WB1 B;  1GXD C;  2K01 A;  4C1N K;  4ILW A;  3HOV B;  1Y8O B;  4KK7 A;  1ET6 A;  1SAP A;  4CKC A;  4A3K B;  2EYF A;  2YYZ A;  4O42 A;  3O13 A;  2KVM A;  3A8K E;  2BDN A;  2X6L A;  3R8B A;  3I4M B;  3MTS A;  2N88 A;  1BNZ A;  1EL0 A;  1UUP A;  1W6K A;  4Q5V A;  1TWH B;  2CHB D;  4NP5 A;  3NP8 A;  5JVH 3;  3CRL C;  4F7X A;  1LAC A;  1LTI D;  5KYL A;  1QNK A;  5EKL A;  2NWG A;  5DEH A;  4K14 A;  4ABN A;  1LT6 D;  2E2J B;  1EU3 A;  1G2T A;  2B2Y A;  4KHZ A;  4C56 C;  3NQI A;  3J7Y W;  3ND8 A;  3NTH A;  3R2I A;  5KIX A;  2J0T D;  1CT1 D;  2F0J A;  1Q12 A;  1A15 A;  1BDO A;  5CBE E;  2L55 A;  3X3M A;  2A6E D;  5DM7 3;  4KKU A;  5G3L F;  2JSO A;  1QCB D;  5C4H A;  5FLX E;  5I2X A;  4XT3 B;  1G91 A;  2E2H B;  1DON A;  1A3V A;  2EZV A;  4X3U A;  1IW7 C;  1OO9 B;  3PO3 B;  2VB3 X;  2NN6 I;  4C3I G;  2NTS A;  1DJR D;  1I4Q A;  2WKC A;  4ZAI A;  2RA4 A;  2NUC A;  3H0G B;  3KLR A;  1VF7 A;  5C6A A;  2PZU A;  3GTL B;  5EKK A;  1BQQ T;  5I9O A;  3MFG A;  4FXG C;  2JYO A;  4C3I B;  4NW2 A;  1TQO A;  1AN8 A;  5C3W A;  2NB0 A;  2I07 B;  1BF4 A;  4GZY C;  2R3Z A;  1PRT D;  5C3E B;  1SFO B;  2D62 A;  1BOS A;  2BCO A;  1F9S A;  4DAY A;  3K5L A;  3SHL A;  2K03 A;  2NVT B;  2F0D A;  5JAV A;  2EY2 A;  1MSH A;  3GV6 A;  4DNR B;  5HUR A;  1KDB A;  2AQ1 B;  2X69 A;  3IL8 A;  3H09 A;  1ROD A;  3MZ5 A;  3D6C A;  1I6H B;  3PIP 3;  3HEJ A;  3D4W A;  3M7N A;  1EIH A;  1Y8P B;  4MIU A;  2A68 C;  2KEE A;  3BDL A;  3RD4 A;  1SYC A;  4G7O C;  2B39 A;  1CZG A;  1SE3 A;  1Y1W B;  1QOH A;  2SNM A;  1LO5 D;  4LK1 C;  1TWA B;  1ZYR C;  5I2Y A;  3QB3 A;  4DA2 A;  1BCP B;  1EIG A;  2HUG A;  1HTP A;  1AEX A;  5I9P A;  1YNN D;  5KND A;  3DEP A;  1MBY A;  1PRT F;  1PFB A;  2EXZ A;  5T1G A;  2EYJ A;  4RGM A;  2KHS A;  1FNV A;  1KNA A;  4K5X A;  4R8I A;  3CQZ B;  1FD7 D;  2RDH A;  1ZEQ X;  1PZK D;  2RSN A;  3I72 A;  1MI2 A;  1Y1V B;  5A2Q L;  5JJZ A;  1IYU A;  3GTM B;  2EYL A;  2B8G A;  2Q8R E;  3A54 A;  1VCI A;  4A3I B;  5IGF A;  5CR3 A;  2E76 C;  3NSW A;  3GTG B;  2JEA I;  5A35 A;  1CA5 A;  2IWH A;  4K2K A;  1Y8N B;  3I8Z A;  4I7Z C;  4ZKB B;  1Q1B A;  1SEB D;  3C1E A;  3MAQ A;  2BE5 D;  2M2L A;  3DWA A;  4BA2 I;  2RSO A;  5IGD A;  2IL8 A;  4MN3 A;  2HQE A;  1EEI D;  3GTK B;  1CI3 M;  1PZJ D;  4JK1 C;  5KNB A;  3D4D A;  3KBX A;  4FYD A;  1F9P A;  1U9R A;  1L0Y B;  1NSN S;  3GQB A;  3DEO A;  1Q1E A;  5E4X A;  3EJI A;  3MHB A;  5FO9 B;  1PXU A;  4FXD A;  5CC4 A;  1ENC A;  2NVY B;  1TWF B;  4XQJ A;  1O7Z A;  1F2Y A;  3HG9 A;  4XQQ A;  3OW7 A;  1ZXT A;  1EY9 A;  1OXX K;  4A3D B;  3NQT A;  5IGC A;  3S1M B;  1VMC A;  2A6E C;  3Q6S A;  4RA8 A;  3DHQ A;  3KLS X;  3EQL C;  4K8J A;  4HCS A;  3SVM A;  4HTH A;  4IUV A;  2C5C A;  3I73 A;  5K36 H;  4NKL A;  5M5Y B;  3M4O B;  1STB A;  1ICW A;  2O5I C;  3T16 A;  3TME A;  1JOK A;  1LLR D;  5C4J B;  4F8M A;  2VXW A;  1CFM A;  4K8I A;  3RMH A;  4EQN A;  4G7H C;  5FO8 B;  5C0X J;  1BCP F;  5KEE A;  1RTO A;  2JE6 I;  4G4K A;  1X3Q A;  1U4M A;  3C1F A;  5BN3 A;  3OWF A;  5M3M B;  2DN8 A;  1JQY D;  4DAP A;  3E0J A;  3DMU A;  2A74 C;  2F4I A;  3LWE A;  5C0X G;  1TS2 A;  2M00 A;  2R6G A;  1OXU A;  1V43 A;  5EJW A;  2F3V A;  3I90 A;  5C0X H;  3AU7 A;  1Y69 U;  5CV8 A;  1SE2 A;  1PTO D;  1STA A;  1TKW B;  3R3O A;  5JOB A;  3CKI B;  2FJ2 A;  3I91 A;  2V4D A;  3VR5 A;  3NTI A;  5AFW A;  5IIF A;  3TZD A;  5E1F A;  4C3J B;  2LKV A;  1ILP A;  2L9H A;  3S9W A;  1EYA A;  2BA1 A;  2XVS A;  2FIN B;  3TDQ A;  1GHK A;  3C46 A;  1BR9 A;  2Z4I A;  3HRZ C;  1STH A;  4HR7 B;  3I70 A;  2PPB C;  4B9W A;  1V1P B;  2XIW A;  3PUX A;  3H94 A;  2F0N A;  3R93 A;  1T5X D;  2B2W A;  3UI2 A;  5M9O A;  4DF7 A;  3S17 B;  3IFD A;  4DGZ A;  1H9S A;  5M5W B;  3T56 B;  4XIG S;  2BA0 A;  1VMP A;  4RHS A;  2CW0 D;  3SK5 A;  1HFN A;  1F9R A;  2G9H D;  2F1M A;  3BZD B;  5T1I A;  5JEA G;  5EBD A;  5KNC A;  1EQV A;  1U4P A;  2EY6 A;  4LAA A;  4CBV A;  1MSG A;  1O78 A;  1AZP A;  5J22 A;  2JA5 B;  4H0L C;  4KD4 A;  1XTC D;  2SNS A;  1STN A;  1S4Z A;  1PRT C;  3QWN A;  3OIP A;  2F0W A;  1HA5 A;  4OIK A;  1CQF A;  1SSO A;  1C4Q A;  2XRQ D;  4PMB A;  3NUC A;  1B44 D;  3PUZ A;  1V8Q A;  5FO7 B;  2EE1 A;  1KLG D;  3QOJ A;  3Q23 A;  1HPC A;  4OO1 I;  1E2Z A;  5C44 B;  4K2L A;  4DFA A;  1UEA B;  1ILQ A;  1EY7 A;  1R4Q B;  3I4N B;  1JB3 A;  3DWQ A;  4BWG B;  5EGT A;  2WAQ B;  2B2U C;  4OL7 A;  4N9T A;  4ODG A;  5FOB B;  3IFT A;  4BY7 B;  4O1N A;  1M4V A;  1EY6 A;  4WOR A;  2B2T C;  4ULL A;  3GTP B;  1LTT D;  2A69 D;  1EY4 A;  2ICI A;  2H4O A;  5EPL A;  1EY8 A;  1KNE A;  1SNP A;  1ZKO A;  4C3H G;  3Q0A A;  1B9M A;  1F77 A;  2EYH A;  4XDX A;  4OGQ C;  1H9M A;  1YNJ C;  4U67 3;  2K32 A;  1B50 A;  4WRD A;  2EPB A;  4FF1 A;  1B1Z A;  3NWT A;  3SK4 A;  1J8I A;  2TSS A;  2AUJ D;  3U9O A;  3K5O A;  3OIQ A;  5C5M A;  2AQ3 B;  4A3B B;  1NCV A;  4IAL A;  4LMQ D;  3FPP A;  4OO1 H;  5ELD A;  2E75 C;  3P75 A;  2EY5 A;  1LTS D;  2R61 A;  2JA8 B;  4G57 A;  3S1R B;  5BN4 A;  4C2M B;  3E5S A;  1JIC A;  2PO4 A;  3M7G A;  3L9A X;  4HAE A;  4BA1 I;  1HXY D;  3TP8 A;  3N52 A;  2F0M A;  2K04 A;  2PW7 A;  5D14 A;  1TS5 A;  1AW7 A;  5FK9 C;  1WTQ A;  5CV4 A;  1CZW A;  2BDO A;  2RQX A;  1F2Z A;  2DNC A;  2A73 B;  4JBW A;  3NTK A;  3J7A F;  1G29 1;  3BS1 A;  2Z8L A;  1OXS C;  1B53 A;  1ML0 D;  4EQO A;  3D8G A;  1A3T A;  1RKN A;  3D31 A;  3TN2 A;  2L12 A;  4J6H A;  3FVQ A;  2WP8 J;  1M8A A;  3HP3 A;  3K57 A;  3J80 L;  1A2U A;  2YU9 B;  2WKD A;  2K5W A;  3RZO B;  1JWM D;  2A5H A;  1SBB B;  2E2D C;  3L7Z C;  1SND A;  5ELB A;  1SDF A;  2EVB A;  1BCP C;  1SYG A;  3ND9 A;  3OMG A;  2XNA C;  4F87 A;  3NE5 B;  3HOX B;  1SYE A;  1OXT A;  2ZT9 C;  3GTJ B;  3EFX D;  2NTT A;  2AWO A;  1XYI A;  1L0X B;  1LAB A;  2ZXR A;  4KJO A;  4A93 B;  4BBR B;  2IPK D;  5EBC A;  3K5M A;  1GUO A;  2WIN B;  1Q3L A;  1HA6 A;  2JEB I;  1GUN A;  3KLS A;  3NWS A;  3DXJ C;  4DK1 A;  3GV3 A;  5J1Z A;  4FVM A;  4CJ1 B;  2EYM A;  1VDZ A;  1SNQ A;  3M3Y B;  3ERQ A;  4RAU C;  2F0S A;  1CHP D;  2ID0 A;  3BVZ A;  5C0X I;  4DXG A;  2D9U A;  2E2I B;  2DNE A;  4A3M B;  5DM6 3;  1DOM A;  2KEC A;  3T51 B;  3AMU A;  2HDL A;  4ZRZ A;  3LX0 A;  1GOZ A;  3C3L A;  1BXT A;  3S2H B;  3A7A B;  1SYF A;  3ITP A;  3SK6 A;  4EVO A;  4DN4 M;  3FEW X;  3U9S A;  4ZQ3 A;  3TP6 A;  4RGN A;  1I50 B;  3VR6 A;  2RBM A;  4Z9C B;  4FF4 A;  3WDN A;  1JR0 D;  2KJX A;  5IGG A;  4TSS A;  1RJT A;  3J81 E;  5C3X A;  3MXP A;  1WD1 A;  1Q90 A;  1X3P A;  4H44 C;  1H9K A;  3WOE A;  5CBA E;  4CHT B;  2SEB D;  4EGV A;  1IHZ A;  1LT4 D;  1I3Q B;  2XWB B;  1HHV A;  1ONL A;  4QMG A;  3MA2 B;  3ONA B;  1W6J A;  2RDF A;  1TS4 A;  4XXE A;  1GHJ A;  2AUK A;  4OIJ A;  3S2D B;  4B9X A;  1LTA D;  3PUV A;  3EA6 A;  1EEF D;  1FR3 A;  1OXV A;  2AWN A;  1K8M A;  3MXU A;  1SJH D;  5HGT A;  2NBF A;  1G6Z A;  2XWJ B;  1CA6 A;  2IX0 A;  1SJE D;  4RGT A;  4PNY A;  2WV6 D;  2FHT A;  4ZK9 B;  4HMJ A;  2Z4H A;  2QCP X;  2FFK B;  1QE6 A;  4V19 0;  5JEA J;  4DXF A;  3VYS A;  1D5Z C;  3OSO A;  1I4R A;  4RKB A;  2F0U A;  1QIL A;  2CW0 C;  1VF5 C;  3NBH A;  3SEB A;  1PZI D;  2F0Q A;  4EQP A;  2SDF A;  3W2D A;  2K05 A;  1GUG A;  2A68 D;  1MD2 D;  2F0O A;  2NVQ B;  1B2T A;  1WTR A;  2I46 A;  1I4P A;  2QF7 A;  3CRK C;  1F2M A;  1EFI D;  2DY8 A;  3K0Y A;  3FRP B;  3T13 A;  1CTM A;  2XN9 C;  3IAY A;  2JP1 A;  4MHE A;  2SOB A;  3HOY B;  5CV5 A;  5LL6 X;  1HTL D;  4J8Q A;  2RDG A;  1QG7 A;  1EY0 A;  1RCV D;  1F9Q A;  1RD9 D;  1H9J A;  3VYR A;  2NVX B;  4KMU C;  4YIJ A;  1NR4 A;  2PNR C;  3PUW A;  2A6H C;  5D65 A;  3S15 B;  4KJN A;  1HUN A;  1G8Z D;  2F0P A;  3V2T A;  3E6Z X;  2FMM A;  1I6V C;  1GUW A;  4K6L A;  1BBX C;  2IT1 A;  4TKO B;  4UAI A;  5J39 A;  3AB9 A;  2KA7 A;  2E74 C;  1S5F D;  3NPP A;  4CJ0 B;  1JOQ A;  1HQM C;  3D3R A;  4IFD H;  2F0K A;  1EQT A;  2B2V C;  1KDC A;  1A2T A;  2K1B A;  5F2D A;  4A3F B;  5FLX L;  4FO2 A;  4IUP A;  3L3O C;  3LWU A;  2F0F A;  2ZXO A;  2WAC A;  1PMR A;  3VYU A;  2F0E A;  4KI0 A;  2B2T A;  1TWC B;  1AZQ A;  3HOU B;  4H7B A;  2KED A;  2IX1 A;  2WII B;  4X3S A;  4ZLT F;  2PW5 A;  1S5E D;  3J80 E;  4HMI A;  4M8A A;  1ESR A;  4HED A;  5IGE A;  4K5V A;  3M85 A;  3PV0 A;  2EYO A;  4E6I A;  3SXH A;  4QUC A;  3VA5 A;  3M4Y A;  4IUR A;  2QKI C;  4IUU A;  4KHV A;  4A3J B;  3SK8 A;  2EY1 A;  2D2C C;  4ME5 A;  2ZXP A;  1EOT A;  4ZUI A;  2HDM A;  3CHB D;  5M3F B;  1BO0 A;  1EYC A;  4CKB A;  3KUP A;  5IT9 E;  3I3C A;  1EWH A;  2O4X A;  4N9P A;  3K59 A;  1A6X A;  1PTO B;  3P7J A;  3RZD B;  5D3I B;  4RHR A;  1DOL A;  4OO1 G;  1KLU D;  1TT2 A;  1SYB A;  1D5M C;  4P2C B;  2L5T A;  3C2P A;  2EJM A;  2Z1C A;  4C3J G;  2A6H D;  2EDG A;  1QB5 D;  4OHJ A;  1PTO F;  2C9O A;  2MPM A;  3ERO A;  2Q8I B;  2QEJ C;  3MVV A;  4M1U B;  4QF4 A;  1EYD A;  2HCI A;  5NUC A;  3VR4 A;  3URY A;  5LL6 S;  3MC0 B;  3BYY B;  3Q22 A;  3HGB A;  5CYU A;  3DWP A;  5COR A;  1SXT A;  1SYD A;  1JWU D;  1XXG A;  1LT3 D;  5CV9 A;  3WOF A;  1JOO A;  3SR1 A;  2LMC B;  4KN7 C;  4XTC S;  4U68 A;  3KBG A;  4CJ2 C;  1JC7 A;  5CV7 A;  2IW3 A;  1WVL A;  1SNM A;  3HOW B;  5C5L A;  1C8C A;  1ENF A;  3IKJ A;  1O7L A;  5ISR A;  3S1N B;  3RLF A;  3V05 A;  3K58 A;  4S3S A;  1WTV A;  3D6W A;  3RUZ A;  1NAP A;  5K5P A;  2K7V A;  2M9V A;  1R9T B;  1TII D;  3BG3 A;  3S1Q B;  4NDX A;  3JAM E;  1PTO H;  2QDB A;  1YNJ D;  1GJX A;  1DD2 A;  4FF2 A;  1H9S B;  3H3V C;  5EKI A;  3P20 A;  1MGS A;  1FNU A;  4QUF A;  1V1O A;  1IYV A;  4FNF A;  1HQR D;  3KK7 A;  3TBI B;  3H6M A;  4PMC A;  3QG1 A;  3GO5 A;  1IL8 A;  3F2U A;  1DZ1 A;  1NUC A;  2R7Z B;  1EY5 A;  4BBS B;  4ZUJ A;  1TR5 A;  2KCN A;  3J7A V;  1S5C D;  2GA4 B;  4QB4 A;  1E0B A;  1E2V A;  3I4L A;  3G7L A;  3OOC A;  2F0V A;  5G3L D;  5M5X B;  2B2U A;  4KY5 A;  2BOS A;  4KKT A;  1D1I A;  1LTB D;  2VNU D;  5ELF A;  2KQ3 A;  2F03 A;  4I65 A;  4L6T B;  1D6E C;  1S5B D;  2RKS A;  2CQA A;  1U4R A;  3MWY W;  2KUM A;  4IQZ A;  2EOT A;  5ELC A;  4KN4 C;  3FDT A;  1PRT B;  1QNU A;  2VUM B;  4HSV A;  2LS0 1;  1DYQ A;  4FP5 D;  3TP7 A;  4WJW A;  2F3W A;  5ELE A;  3VR3 A;  1JE4 A;  4HCE A;  1LV9 A;  2EJF C;  4DNT B;  4FXK C;  4IFD G;  1TY2 A;  2BE5 C;  1S5D D;  1STY A;  1FGB D;  1Q8I A;  1PFN A;  1WCM B;  2NYZ D;  2B63 B;  2G9D A;  4IFD I;  3PMF A;  2LFN A;  3HZX A;  5CV6 A;  2MUY A;  5IT9 L;  4ID6 A;  2J4X A;  1SE4 A;  4QCL A;  1LT5 D;  2N55 A;  1ESF A;  3A55 A;  1PFM A;  2HCC A;  3FPU B;  3BDC A;  4R9W A;  4IFD J;  1QWY A;  4F88 A;  4RCO A;  1DM0 B;  2PCF B;  4QIW B;  2PYK A;  4RGO S;  1J9O A;  1AP0 A;  2F0G A;  1U4L A;  1ZYR D;  1PYW D;  3BYT B;  4CKE A;  5CGK A;  3MXN A;  3Q24 A;  1E2W A;  1CQV A;  5TSS A;  3EVQ A;  1Z7T A;  2OEO A;  3K7A B;  2AQ2 B;  2MGS A;  1B9N A;  4PMW A;  5A2Q E;  4NMZ A;  1B3A A;  2B2V A;  3PUY A;  1RHP A;  2K5D A;  4KKS A;  3NXW A;  1DCZ A;  1TWG B;  4C3H B;  1H9R A;  3PO2 B;  2QIL A;  2K33 A;  4Q0F A;  2OXP A;  1TS3 A;  1GUS A;  3NHH A;  5E4W C;  3A8J E;  1SMY D;  4V0B A;  4H13 C;  3PIO 3;  4L63 B;  1JWS D;  4PQX A;  2XSC A;  5I4D A;  1XX8 A;  3NK9 A;  5DNF A;  5CMD A;  5DAU A;  4RH6 A;  2K5Q A;  1HUM A;  2DY7 A;  5COY A;  2L1B A;  2OF1 A;  1HRJ A;  1EWC A;  1O7Y A;  3HS0 C;  3DM1 A;  1WTO A;  1RTN A;  1KTK A;  2RVL A;  3T4A C;  4BS9 A;  3R2T A;  2L4N A;  2CVR A;  4KY7 A;  2EYP A;  2R93 B;  3QOL A;  2KCC A;  4K5W A;  4PV1 C;  5KGU A;  3S16 B;  5IOC A;  3P1H A;  1O80 A;  5JPN C;  1SMY C;  5I6W A;  3X3N A;  2F0T A;  3BVG A;  4K6D A;  5C4Z A;  3A56 A;  3N6R A;  3NBI A;  3G6J B;  1BUV T;  1IKL A;  1DOK A;  2XRS D;  3DUZ A;  5KRU A;  1WTP A;  2L11 A;  1K8O A;  2F0H A;  3OHX C;  4IUN A;  4TRD A;  2O2L D;  5JPM C;  1QJO A;  4KV6 A;  4KD3 A;  4CGY B;  1TVX A;  4LJZ C;  5KYI A;  3QJY A;  1A3U A;  4IUQ A;  1Z47 A;  2PZW A;  4IN3 A;  3V96 A;  1CK1 A;  2NN6 G;  4RFB A;  1TU2 B;  1I4G A;  1V1P A;  2TMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...