3CRKC

Crystal structure of the pdhk2-l2 complex.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
87
structure length
86
Chain Sequence
SYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Pyruvate dehydrogenase [lipoamide] kinase isozyme 2, mitocho
publication title Structural and functional insights into the molecular mechanisms responsible for the regulation of pyruvate dehydrogenase kinase 2.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 12
structure length 86
sequence length 87
chains with identical sequence D
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2008-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3crkC00
2ZT9C 1GUSA 4TQUS 3IFTA 3MFYA 1Z6HA 3LNNA 3PUXA 4OGQC 1O78A 4TKOB 5C0XG 2V4DA 1Q1EA 4H0LC 2YYZA 4G7OC 2AUKA 2JXMB 2A69C 3QJYA 3BDOA 1O7LA 1OXVA 5BN4A 1IW7C 3A7LA 2A6ED 1IYVA 5C0XH 1GUNA 4DK0A 3T53B 1Y8OB 1LACA 3VA7A 3M85A 4H44C 3SE0A 3VR2A 2PNRC 3ND8A 3ND9A 1FYCA 4KN7C 1CTMA 1GHJA 2O5IC 2A68D 2AWOA 2BE5D 3MXUA 4IFDG 3A8JE 1GUTA 3KLRA 1EWHA 2AUJD 2D62A 2A6HC 1VF5C 4LK1C 1Q1BA 1QJOA 3VR5A 4I7ZC 3WDNA 1H9MA 1GUOA 4KI0A 1ZYRC 5JEAH 1TU2B 3VR3A 1DD2A 3D31A 4IFDH 1SMYC 2F1MA 1H9RA 1CFMA 2NN6G 2E75C 1G291 2L5TA 4KKTA 3PUYA 4RCNA 2BA0A 1OXXK 1A6XA 1YNJC 5KNBA 1YNNC 1GUGA 1DXMA 1CI3M 1H9SA 4G7ZC 1Y8PB 1Z7TA 3GQBA 4LJZC 3IKJA 1T5EA 1V8QA 4DK1A 1GJXA 3H94A 3DXJC 3GD7A 1E2VA 2EDGA 5K36G 3HGBA 3RLFA 1V43A 3NE5B 1B9NA 1HCZA 4BA1I 1K8MA 3D4RA 3TZUA 4OO1G 3PUZA 1HTPA 2B8GA 5A35A 5BN3A 2R6GA 3A8IE 4DNTB 1HQMC 2LMCB 1Y69U 4KN4C 4G7HC 2PCFB 1I6VC 1PMRA 2B8FA 3CRLC 5KNCA 4BA2I 2QF7A 4KMUC 3M7NA 1B9MA 3U9SA 2A6EC 2K7VA 2EJGC 1OXUA 1H9JA 3T56B 2DNCA 3OPOA 2NN6I 2KCCA 1K8OA 3BG3A 2A69D 1Y8NB 1OXTA 2K32A 1VDZA 2K33A 3I4LA 3W3AA 2BA1A 4PV1C 3T51B 5BN5A 1Q12A 1IW7D 2A68C 2BE5C 3P20A 1ZKOA 3EQLC 3I72A 1OXSC 1FR3A 4IQZA 2JEAI 2NN6H 3AB9A 3PUWA 2CW0C 2O5JC 3LWUA 1HPCA 4JBWA 2DNEA 1GHKA 1ONLA 4KKSA 4JK1C 2KA7A 3N6RA 4H13C 2E74C 3QIAA 2JEBI 1VCIA 2EVBA 3A8KE 3OOCA 1VF7A 3SDZA 5KNDA 1H9KA 5K36H 3VR6A 3CRKC 3I73A 3PUVA 4XIGS 2JE6I 2A6HD 4GZYC 4KHZA 3L7ZC 1H9SB 1BDOA 2BDOA 2DN8A 3A7AB 4XTCS 4OO1H 4KKUA 1E2ZA 4HR7B 3OW7A 3PV0A 2EJFC 3VR4A 1DCZA 3FPPA 1Q90A 1TKWB 2PPBC 3QG1A 2Q8IB 1E2WA 1IYUA 2D5DA 3M4YA 1LABA 4L8JA 2D2CC 3FMCA 2EJMA 5JEAG 2E76C 2IT1A 4DNRB
chains in the Genus database with same CATH superfamily
1C48A 3SK8A 2X6LA 3MXGA 1I4XA 2KEEA 1LTAD 4CDDC 1EQTA 1U4LA 3VYRA 4O2DA 4R8NA 4JI6L 1SYBA 3D0FA 4R1JA 1Q3LA 2JXMB 4C2MB 3OMGA 1SFOH 4QL5A 1QZHA 1LTTD 4L6TB 4K0KL 3GTQH 3KDFA 1VQGA 1XMOQ 2KQ3A 2JQOA 2NUCA 4KN7C 5IYDG 3KBXA 2DJFC 1YJNA 1ILPA 2XTIA 1Q81C 2VW9A 1G6ZA 1PH3A 1YHAA 4JCVE 1GUOA 3PIOA 4YIJA 5IE8A 3J80c 5JEAH 5KIXA 4A3FB 3ERSX 3RR5A 1IKLA 1LM0A 4A3EB 1OXXK 1XMQQ 2M9VA 2K6AA 5IGBA 4XT1B 3RNUA 1I4PA 4XQJA 2EQSA 3RLFA 1HA5A 4FP5D 5AJ3L 4Q5VA 1YZ6A 3S1NB 4DAYA 1BR9A 3S2DB 5BN3A 2AHOB 4QIWE 4IJHA 3MEFA 3TP5A 5LL6X 2PQAA 4B3MQ 3NHHA 3PO3H 5KNCA 4L5SA 1S4ZA 3GTPB 2RQXA 2F0GA 3J81E 2F0NA 3FHWA 1F9QA 4RGMA 3EIVA 2QW7A 5A2QL 5FLMG 2WACA 4AQYL 4QB4A 4APVA 2UXDL 4RH6A 2B2VC 2MO0A 1M8AA 3NELA 1PTOF 2ZJQA 4WJ3M 1NMGA 3GTLB 4B3RL 2EVBA 1QG7A 4X66L 4B08A 2B2YA 3K8AA 4PNYA 5IT9c 3A0JA 4PZ7A 5G3LF 4DXFA 5M5XH 3OW7A 3S17H 4DV3Q 1I50H 3K5NA 2BCOA 1BKBA 2NYZD 4IALA 2UU9L 2R7ZH 3OSOA 5M3FG 4FXKC 4PZ6A 2RCFA 1QZGA 2ICEC 4C3JH 1VQDA 2F0MA 1K8GA 3FMCA 1JB7A 1PZJD 4DR4Q 4YCUA 2R93H 4KY7A 5JOBA 1T9HA 1N32Q 4J1MA 1YHBA 2P5ZX 1ENFA 3KF8B 4UP9A 4CKEA 3UE0A 4LF5L 1WTPA 4BY1H 4X62Q 1A63A 2AUKA 4E6IA 2VQFQ 3K59A 3PF5A 5J1ZA 1VQ7A 4HJ8A 2JA6B 1RTOA 3E5SA 3SR1A 5FOBB 3BS1A 4LF9L 3SE0A 1IKMA 1I3QB 4GNXC 3CHBD 4H7BA 3V96A 3F8TA 3J81L 4DR5L 1EOVA 1JWSD 4UP8A 4IFDG 3A8JE 1GUTA 2CVRA 2AUJD 2RDGA 2JA7H 4I7ZC 1OO9B 4FF3A 1CQFA 3K81C 3J7YW 1KLUD 1VQMA 3D6CA 1NUCA 1KIXA 2B63B 4XXEA 1ESFA 1LT5D 3A55A 5FO9B 3M3YB 3SK4A 4A3IG 1V8QA 1I4GA 1GJXA 3DXJC 3L2PA 1EQRA 3TZUA 3Q22A 4ILWA 2KBNA 4A3JH 4FXDA 4KN4C 1HTLD 3JAMc 1BO0A 5FLXc 1LT4D 1VQIA 4P71A 3SK5A 3I4NB 1E1OA 1M90C 2EOTA 1B7YB 2EJGC 4YCVA 4BBSB 1STHA 1S5DD 4C3IB 2DNCA 3GV3A 3F2CA 4Q0FA 1R9TB 4ZUIA 1IL2A 2VB3X 1K83H 2H1EA 2MQHA 1QB5D 5CV9A 5LMUL 1IBKQ 4IUPA 3SGIA 2XNAC 4DV7L 2NZOA 1EIGA 4DUYQ 2EXZA 2OQ0A 2WAQE 5DNFA 1MBYA 5C4ZA 2F0JA 1ZEQX 2EZVA 1VCIA 3NPPA 3X3MA 1RIPA 4LAAA 5K36H 3DWPA 3PUVA 5DLQE 1VQOA 1RD9D 5M3MB 4YHHQ 1B50A 3A7AB 1B3AA 1LYLA 4TRDA 3KDFB 2K14A 3ULPA 3OMCA 3TP8A 3QG1A 4LF8L 1QILA 5IP7G 3MEHA 4A93B 1F9RA 5KYLA 3X3NA 3TDQA 1MJCA 4QIWB 4NXNL 1G2TA 2CW0D 1Z6HA 3LNNA 2VUMG 5E4WC 3TQYA 3E9IA 4DAPA 1GKHA 1LUZA 1I6HH 5C0XJ 5CMDA 3D4WA 1O7LA 1I94L 3KFUA 1JJ2A 2JN4A 4MZ9A 3T53B 4H44C 1SR3A 4DAYB 1ICFB 2Z6KC 4LW1A 1SNQA 4F88A 2V1CC 1SFOB 1H95A 4XYQA 4HIMA 3VR5A 4TVAB 1NR2A 3GTQB 2SEBD 3SK6A 2KUMA 1DD2A 4N8X1 5LL6S 3S1RB 1H9RA 3KUPA 3GTKH 1L0XB 3AMUA 1EOTA 2E2HH 5E7NA 1L0YB 3BYYB 1Z7TA 1E1TA 1UE7A 1T5EA 1C8CA 1XPUA 2EY2A 3HGBA 1V43A 4B3SQ 5CGKA 4RHRA 5A35A 2FXQA 2PI2E 5COYA 1KQSA 1RTNA 1SYDA 2RVLA 3KJPA 5F2DA 3MXPA 3PO2H 2Q2IA 4JI4Q 2QCPX 1DGSA 2B2TC 4HJ9A 4LUZA 4OX9Q 1XYIA 2BA1A 3T51B 4RGNA 2PW7A 3PO3B 4CDCC 2KECA 1V1PB 1F2LA 3DLLA 2L0CA 1L1OB 1STYA 1UE5A 1U4PA 4XIGS 1HZBA 1NR4A 4ZK9B 4MTKA 4A3FG 2WKCA 1XXGA 2BDOA 2AQ2B 5C4XH 3DM3A 4FVMA 2ASBA 5G3LD 1VQ8A 1I4HA 4HAEA 3PIO3 5JPNC 4O0AA 1HUNA 4XQQA 4DNRB 1D1KA 1XNRQ 5M5XB 2ZTCA 3S17B 5I6WA 1I50B 4R8IA 1LO5D 5J22A 4JBMA 2R7ZB 1PRTC 2YTYA 3I8ZA 3PCOB 4C3JB 5J39A 4DPGA 1A3TA 1UE1A 3S9WA 1SNMA 2HHHQ 4ALPA 1VQBA 1C4QA 2E2DC 4HJAA 3RZOH 2PNRC 4NKLA 4C1NK 2WAQB 1HZAA 2XWBB 4BY1B 2B2UC 4X64Q 3K5LA 2E5LL 1G8ZD 4FO2A 1Q1BA 1VMPA 3UDIA 4KI0A 3VR3A 3T1YQ 1NAPA 4BWGB 4DR7Q 2WV6D 3AU7A 3NBIA 2C5CA 4CBVA 3T16A 3F2DA 1GUGA 1E3PA 1EWCA 2JA7B 1E2VA 5IGFA 2F0QA 3CW2C 3NE5B 2E2IH 2K05A 2DY8A 5I2YA 1XMOL 4ODGA 1LTGD 4MHEA 1NJIC 4ZLTF 2XWJB 2PQEA 4DV6L 1VQ4A 3J80E 1PH4A 1NMFA 4LF4Q 2L55A 4JV5L 4GN5A 3RZDH 4BY7H 2B2WA 4A75A 4A3JB 2ID0A 3DHQA 3RLOA 2PMZE 3M9BA 3MHBA 3K58A 4JBKA 1XMQL 2J4XA 1AW7A 5ISRA 3FP9A 4R4CA 1B8AA 1B3QA 1J5EL 4DGZA 1YITA 1D1IA 1U5KA 2FJ2A 1K83B 4HCSA 3HOXH 3CRKC 3E0EA 1CUKA 2RHQB 3D4DA 4U673 4GZYC 3S15H 2B63G 1GM5A 1ZYRD 1DONA 4KK7A 1X3FA 3HEJA 4A3DH 2IL8A 1SRUA 4JI2Q 1LTID 2KHIA 3NWTA 4YWMA 1X55A 3UDGA 1DOLA 2Q2TA 1HR0W 1TWGH 5C3EG 4DAMA 4UPAA 1EY9A 1DJRD 2VL6A 1Q1EA 1MIUA 1W3SA 3I4NG 3SEBA 5IT9E 4RGOS 4C3IG 3Q23A 1CA5A 2N49A 1WTXA 5ELEA 2UUCQ 1C7YA 4GKKQ 4NPSA 1EZ6A 1I6HB 2C9OA 4R4QA 2WIIB 3DM1A 3MXUA 4XYOA 5T1GA 1EWHA 5C6AA 2MFIA 2N78A 4DR4L 3RD4A 2RDHA 1JOOA 2I0QA 4G57A 3TS0A 1TU2B 5JJZA 2F1MA 2NN6G 1AZQA 1KDAA 3QOLA 4RCNA 5IYCG 2CKZB 3P7JA 2WFWA 3IKJA 2CQAA 2VQFL 4A93G 3TMEA 3RN5A 1EFWA 4JBJA 4DV2Q 1F2ZA 3H91A 5CYUA 5M5YH 1PH1A 4LNQA 3GTKB 4OWWB 4FF2A 3E9HA 1CKMA 1HQMC 2FMMA 2E2HB 3CF5A 2CQOA 3QB3A 3I70A 1ESRA 1X6OA 3KF8A 2UUBQ 5FO8B 3STBD 3CQZH 4CDFC 5CBAE 1TR5A 4GLXA 1XNQQ 1VQ5A 3KF6A 3KLSX 3T4AC 5TSSA 1BCPD 2K33A 4JOIC 2RA4A 2F0HA 4Y52H 3OW2A 4RA8A 2B2TA 1ZKOA 3P20A 4XDXA 3PO2B 5IT9L 4BBSH 3HOWH 1EIHA 5CV6A 5IGEA 1N9WA 4OO1I 3N6RA 2JEBI 3CPFA 2L1BA 3JAME 4M1UB 5FLXE 4FYDA 3VYSA 3IL8A 4KHZA 3L7ZC 1QWYA 4LFCL 2K75A 1IL8A 1RKNA 1PXUA 1TS5A 3L0OA 4RWSC 4CJ1B 1KHIA 2Q8IB 4AYBB 2FFKB 5E3FA 1IBLL 1SE2A 4C1NI 3W2DA 1HXYD 2EJMA 5JEAG 4GOPC 1EIFA 4GNXB 2UUAQ 1SE8A 1IBKL 3HOUG 1O78A 5C4XB 1DOKA 3VYUA 2Q2HA 4DUYL 4K5VA 3NEMA 5D3IB 4DAVA 3T13A 2F0LA 1JE5A 5C3WA 2VQEQ 4OWXB 2CH4W 3K57A 5ELBA 2PMZB 1KDBA 1X3PA 4HTHA 4DXGA 3PO3G 4KD4A 3VA5A 2F0SA 1RHPA 2JA8H 3IAYA 2A68D 5ELOA 3RN2A 4IFDI 2MNAA 1V1QA 3QOJA 1FGBD 4XT3B 1SYFA 3MC0B 1EYAA 2B2UA 3MWYW 4A3LH 3RZOB 1SMYC 1PH9A 3CCUA 2K50A 5T1IA 4XQNA 1PZID 2UXBQ 4OL7A 5IP9H 3NQTA 4LF6Q 1SYGA 4IZ8A 2RHSB 1S72A 3S1RH 1A0IA 1B9NA 4BA1I 3TSSA 3JC66 1K8MA 1EYDA 5EAYA 4IPGA 3PIP3 2PCFB 1JWUD 3NTHA 2OTLA 2R7ZG 2QILA 3M7NA 2LXKA 4F87A 4C3JG 2I5LX 4BXXH 4DR1Q 3NP8A 2E2IB 1V1OA 5E1FA 4I65A 2PO4A 2KCCA 2R93G 1WTWA 1EYCA 3BG3A 3WWVA 2R7FA 2FINB 3HKSA 5HURA 4KHVA 2GA4B 3HOZH 3I4MG 1CKOA 2EY6A 2WAQG 3C1FA 3I72A 4QQBX 4BY1G 2Y0SG 3AFQA 3Q24A 4JBWA 1VQEA 2J7ZA 2Z6BA 3EA6A 3FRPB 2A1AA 2KJXA 4OWTB 3RZDB 2HDLA 4BY7B 4RMFA 2AWNA 1D5XC 2JJQA 4JI0Q 4R4OA 2ICIA 1FL0A 1KC8C 4DA2A 2HD3A 4JI3Q 4MNOA 3H15A 2HCCA 2JA7G 4A76A 1B1ZA 4IURA 1O7IA 3H6MA 1WCMG 2D2CC 1IBML 3HOXB 4LF7Q 3DUZA 2L15A 1CZGA 3TP6A 3S15B 1R4QB 1AFPA 1JR0D 4A3DB 2HCIA 2V4DA 1NTGA 1FJGL 4ULLA 4LFAQ 4HSPA 3QJYA 2LY7A 1W6JA 2HIXA 1F9SA 5C3XA 4A3JG 4EQ5A 2RBMA 1N34L 3H0GH 3K6OA 4Y7NH 1TWGB 1E0BA 3LWEA 1EU3A 1YNXA 3TRZA 1R4PB 2XRSD 1Z9FA 1BUVT 4OONA 1W6KA 1UEAB 4EQOA 1Q82C 4ZKBB 1PH6A 1V1PA 4KTAA 1ZYRC 2SNMA 1L1OA 1JQYD 3KF6B 2XN9C 3HKZG 2K01A 1GXDC 1YNJC 4K8IA 1SSOA 3J81i 4DK1A 1VQ6A 3N52A 2CFMA 5K36G 4KHPL 2HHHL 4B3TL 2NVTB 4JI5L 3PUZA 2NB0A 5C44H 1A3VA 4A3KH 3CCEA 3A8IE 5EGTA 1B53A 1HR0L 3J7ZC 1CKNB 3K7UC 4HMJA 1EWIA 4ME5A 3MAQA 3VDYA 5M5YB 3W5OA 3OYYA 2L4NA 1KD1C 2A69D 1VQ9A 1VDZA 3I4LA 5BN5A 4DV1L 5IWAQ 3K80C 2RF4A 4DV4L 1DZ1A 2O5JC 4IO9A 3LWUA 1JMCA 2KENA 3CQZB 2O4XA 1STEA 2BDNA 3Q8DA 3RMHA 4J6HA 2E74C 4X3TA 3OOCA 2HIVA 3S1MH 1WI5A 3I73A 2EXDA 1U9RA 2PW5A 1N33L 4OO1H 1PRTB 3PV0A 3UDXA 3HOWB 3R2TA 1TKWB 4YWLA 4O42A 3G4SA 1YI2A 3BZKA 1IYUA 2EYMA 2LKVA 1YNND 2MP1A 3I90A 1EQVA 2L11A 1Y1VH 2G9DA 3BJUA 2MJ8A 2K52A 1ML0D 2EIFA 5GQOA 4DR3Q 4X65Q 5C0XG 3M4PA 3STBC 1STAA 2DGYA 4QJFA 4GOPA 5EBCA 4H0LC 1II3A 1BCPC 2JA5H 3SXHA 1LT6D 2LXJA 1XJVA 2FMCA 1GVPA 2WKDA 4RAUC 5C5MA 5I4DA 4WJ4A 1MKHA 4K5XA 3PO2G 5EKLA 4POGA 2HQEA 3DWQA 2ZTEA 3ZYYX 2I07B 5IGDA 2D9UA 1C0AA 5GAGC 3GTOH 4QUCA 1JWMD 4C3HH 3AQQA 4IFDH 1UWVA 3E6ZX 2JA8B 2Z0SA 2DY7A 2HQLA 1PYWD 2RKSA 2HT1A 4AYBG 3R8BA 4QCLA 5IGGA 5IYBH 4CDEC 1JE4A 2EDGA 3EROA 1JB3A 4QGUA 3U9OA 4BBRH 4A4IA 5I9PA 2ZM6Q 4DNIA 1WOCA 4QUFA 5C4XG 1BBUA 2KCTA 2Z4IA 2PI2A 3AEVA 2VNUD 1VQJA 4K0KQ 1B9MA 4JI8L 2JK8A 2K5DA 3T56B 1EY0A 2EY5A 2NVQH 1CHPD 2IPKD 2ENBA 3NTIA 4UDUC 1DM0B 2RSOA 3C46A 3KYHC 1X9NA 2A68C 3DEOA 2PNHA 1KNAA 3CCRA 3AB9A 1IXRA 2OWOA 4HMIA 1VQFA 4DUZL 3IRBA 4KKSA 4H13C 2D0OA 2A5HA 3HP3A 3A8KE 3SDZA 1LLRD 3HOZB 2A6HD 5M9OA 4XTCS 3MXNB 3CCJA 1TS2A 3SHLA 3VR4A 5AJ3Q 4GLAC 1BOSA 2PPBC 2XVSA 4NMZA 4L8JA 1AE3A 3WOFA 1NSNS 3CCMA 4L5TA 2G5DA 3NXWA 4NP5A 3IFTA 2YTVA 3TBIB 3PUXA 3E3XA 2C35B 2BH8A 1TWFH 2K04A 1LTSD 5HGTA 2RSNA 2B2VA 3KK7A 5EBDA 2F0OA 1PTOD 4AQYQ 2CWAA 3TP7A 2UXDQ 3BDOA 4A3BH 2EYFA 1Q8KA 2A6ED 2OXPA 4IPHA 3PIPA 4A3EG 1DYQA 1LACA 4B3RQ 3LX0A 2BOSA 4CJ2C 4L5RC 1CTMA 4X66Q 3NENA 1XTCD 1GHJA 3Q6SA 1KAAA 1SJHD 2QDLA 3NBHB 4EQNA 4A3MH 4BY7G 4MTNA 3DWAA 1HNZQ 4B9WA 2K5VA 1G91A 3H0GB 4Y7NB 5M5WH 1Q86C 1P8LA 3RLNA 1SE4A 3EVQA 3SVMA 4KKTA 3B6YA 1K73C 2I5MX 2F4IA 1BXTA 2B39A 1PV4A 1EY5A 3I56A 4LF5Q 1D7QA 1PYBA 2F3VA 3J7AF 1HNXL 1YJWA 1Y69U 2A8VA 4A3CH 5JAVA 4G7HC 4GNXA 1EY6A 4A3DG 1J8IA 5DM63 3T1HQ 4A3GH 4H02A 1EFID 4LF9Q 2K7VA 4OIKA 4DR5Q 1B44D 3W3AA 1PFBA 3CKIB 5HY6A 5C44B 4A3KB 2CCZA 1D5MC 3I3CA 1KRSA 2ZXOA 3U58A 1SN8A 4IQZA 1I4QA 3GTJH 1ONLA 3A74A 4JK1C 2R7DA 2ZXRA 4LF6L 2Z8LA 2NVXH 4GOPB 1WD1A 3DMUA 4N9TA 1HFNA 1ENCA 2JE6I 2X6GA 2F3IA 1H9SB 1GO3E 1IYJB 1WTVA 3TEHB 1Q90A 1KLGD 2JA6G 3C2PA 3O13A 1TVXA 4DK3C 3D3RA 1SAPA 3I91A 3S1MB 3HRZC 4X3UA 2XRQD 3CCLA 5I6YA 4CKBA 2Z4HA 2M00A 1T5XD 1FD7D 1PDQA 3OTOQ 1NNXA 1WD0A 4ZQ3A 1QVFA 1EQQA 1E7ZA 2YYZA 4DR6Q 5LMUQ 3HOYH 2A69C 3HOVH 1Y1VB 2SDFA 4DV7Q 4B3ML 1K0SA 4DK0A 1Y8OB 2PYKA 3BZDB 1TS3A 3VR2A 2MPMA 5J3BA 5EPKA 1HRJA 2RDFA 2HUGA 5KRUA 1E22A 2JA5B 1FNUA 2D62A 4PG3A 5ELNA 1JCKB 1STNA 4ZCKA 1CZWA 3KBGA 1PRTF 1QJOA 1H9MA 2IX3A 1DOMA 5I2XA 3D31A 2OEOA 5JJKA 1MSHA 4BBSG 2E75C 3GTGH 2WINB 2BA0A 3F1ZA 1EIYB 4NXNQ 2YTXA 1A6XA 1YNNC 1DXMA 1X54A 1Y8PB 3GQBA 3ULJA 2IWHA 3DEPA 3GTOB 3H94A 2E8GA 2IW3A 2B2YC 3J80L 3LGJA 4DV3L 4C3HB 1WTRA 1VQNA 1O80A 3FKIH 1JOQA 1Y1WH 2R6GA 1NBWA 2NZ1D 2K5WA 4K8JA 4POFA 4P2CB 2B8FA 1NE3A 4P73A 3W1BA 2N88A 2QF7A 2Z6KA 2KCMA 4GLVB 1N32L 5M3MG 2NVTH 2IY5B 1EY7A 4BBRB 3ONAB 5CV5A 1OXTA 2KVMA 4X62L 5IY0A 1PH8A 1O7YA 5K5PA 1VQLA 4ZAIA 1FR3A 3M4OH 5C4JH 3F2UA 2CW0C 2FHTA 4HIOA 1TXYA 4RGTA 2NVQB 3G71A 3QIAA 4V0BA 2KEDA 2F4VQ 1VF7A 4NB3A 1HNWQ 3R3OA 1FNVA 2TMPA 5FK9C 2JA8G 3G7LA 2K5NA 2VXWA 1IZ6A 4LUOA 4N9PA 3FPPA 4OEMB 3F2BA 2F0UA 3M4QA 1PLFA 4KJOA 2JP1A 3CAMA 1D2BA 2F0IA 1L2FA 5IWAL 3U4VA 1MD2D 4R4IA 2H4OA 1X3EA 3URYA 4RFBA 5IP9G 5FO7B 5ELDA 1G2SA 1KAWA 4G7OC 1BF4A 2OT2A 4LFBQ 2Z9HA 3MA2B 1JICA 1IYVA 1CKNA 4KD3A 2F0EA 1FGUA 4HJ7A 1SYEA 3K5OA 3OIQA 3GV6A 3VA7A 1TWFB 4CGYB 2B3GA 3ND8A 3NWSA 4K2LA 4DR2Q 4BXXG 3W1GA 2BE5D 3MVVA 3KLRA 1VQKA 1S5CD 1EYGA 4A3BB 1LT3D 1UAPA 2A6HC 2KCNA 2LS01 3WDNA 1BNZA 5LHY1 4EQPA 3HOZG 5LMNQ 1XPOA 3BVGA 3V2TA 4ID6A 3CC4A 1PFNA 1Q7YC 2ZTDA 3HG9A 5CC4A 2XIWA 2ATWA 3CCQA 4JC0A 4A3MB 4YHHL 1F9PA 2EYLA 3I2ZA 4GKJQ 3D6WA 4DFAA 3CC2A 5BR8Q 5KGUA 1HCZA 1ET6A 5M5WB 4FNFA 4RCOA 3J81j 4KJNA 5EKKA 3CMAA 2LMCB 3ER0A 1PTOC 4WORA 1QUQB 1I6VC 4J15A 5IOCA 4IOAA 2J0TD 1G6PA 2A6EC 3UE1A 4WRDA 1RODA 2AKWB 2OTJA 5D3DA 4HIDA 3OPOA 1X65A 1ASZA 4DV0Q 3J7AV 4FXGC 3JAML 4FF4A 4OIJA 5FLXL 1W2BA 3BDCA 3EQLC 1OXSC 3FEWX 4A3GB 2K1BA 1WTOA 4PMWA 2CHBD 5KYIA 2IHEA 4TSSA 5A2QE 1K9MC 1H9KA 3H0GG 3K7AH 1RJTA 2ZM6L 3I4OA 2ALYB 3CC7A 1X3QA 3ERQA 2NVYH 2NWGA 3GTJB 2NBFA 1B4OA 1BCPB 2EPBA 2TSSA 4JYAQ 1CSPA 1S40A 2NVXB 1J6QA 1E2WA 1KL9A 1UEBA 5C5LA 1JJGA 2DJGC 1CT1D 1HH2P 4JI7Q 4DV6Q 5JVH3 2R92H 1GUSA 4YWKA 4JV5Q 3G6JB 1WJJA 5C0XI 1U0LA 4HJ5A 1RDPD 3Q0AA 4B3SL 3PQIA 1PH5A 1JT8A 3HOUH 1HZCA 5BN4A 5LMNW 3BZCA 3NTKA 1TQOA 2VS1A 2B29A 2OQKA 5EPJA 5C44G 4A3KG 1J5EQ 4IJLA 1D6EC 5CBEE 3HFZB 4JI4L 5GROA 4LWCA 3ND9A 2F0WA 2ZJPA 3MZ5A 2O5IC 2QEJC 1PZKD 4OX9L 3HOYB 4YY3Q 3HOVB 1XPRA 5DAUA 4NDXA 1VF5C 1YHQA 5FKAC 4JG2A 5FJ8H 2YV5A 1MI2A 1D8LA 1I4RA 1PRTD 3CD6A 1M1KC 1EUJA 3MXNA 3CMEA 2QA4A 4YCWA 1N36Q 1P16A 1TY2A 1KRTA 3D8GA 1K0RA 1SEBD 5CV4A 1MJEA 2Q8TA 5ELFA 4OO1G 4QF4A 3GTGB 3PMFA 1B70B 1Q46A 1SNDA 3CRLC 1VQHA 3C1EA 1HHVA 3KLSA 4CJ0B 5IYDH 1LTBD 1XX8A 1XNRL 4BS9A 1PYSB 4IN3A 1Y1VG 1EEFD 3GDEA 1WFQA 2QKIC 2GN5A 3CP0A 1HNZL 3OWEB 3OHXC 2MUYA 1Y8NB 3FKIB 3NSWA 1UE6A 2WB1E 1Y1WB 1AP0A 1PA6A 1IW7D 5EQ0A 1MGSA 2OCEA 2NTTA 5HGQA 3KOJA 1V9PA 2F0DA 4GS3A 2JA5G 1X56A 1GHKA 1VQCA 3I4MH 2MGSA 5D14A 1BVSA 2PZUA 4X64L 3NBHA 1JJCB 4ZRZA 2LSSA 4FF1A 4KKUA 5C4JB 3M4OB 4HR7B 1TY0A 4O1NA 3UI2A 2ZXPA 1DCZA 3A54A 4HEDA 4IUTA 4N8FA 4P74A 3T1HL 4NXMQ 2VB2X 2QGQA 3T1YL 1LTLA 4DR7L 1B2TA 2E76C 5DM73 4C3HG 5DEHA 1Z47A 2PZWA 1E24A 3ZJYC 4JOIA 1Y14B 1HUMA 5FLMH 1WCMH 3S14H 1SNCA 2CH4A 3K0XA 1QE6A 3V05A 2UXCQ 5JPMC 5IYBG 1U4MA 2D0PA 1K3BC 1TWHH 1UNSA 2WP8J 3HZXA 4BBRG 3A7LA 1GUNA 4ZYSA 2N8NA 4X3SA 3KLWA 1PTOH 4WJWA 4IUNA 3A56A 4LF4L 2AWOA 1VQAA 1KABA 3EFXD 4IFDJ 1C9OA 1EU4A 4LFCQ 5C3EB 4V190 5M3FH 2DUDA 4CHTB 1KNEA 2B2WC 1WYDA 1VMCA 1STGA 3OTOL 5JJIA 4ME3A 1IBLQ 1G291 3ITPA 4HCEA 1TIID 3A5ZB 1CI3M 1H9SA 1SXTA 2KOLA 4DR6L 1RF2D 5EJWA 3MFGA 4JI1Q 4UY8C 3S1QH 4I7AA 3FPUB 4R4TA 1PFSA 1CK1A 1SDFA 2AQ3B 4HN7A 4K14A 4K5WA 4P75A 2B8GA 2Z1CA 1K3RA 2Y0SE 4RG1A 2KHSA 4JI2L 5EPLA 1XTDA 2HDMA 2ES2A 4DV5Q 4IPCA 4KMUC 3GTMH 2F03A 5CV7A 3U9SA 3S16B 3I7FA 3FDTA 1H9JA 3BYTB 3G6EA 1EY4A 4M8AA 1CQVA 2K32A 4OXPA 1A3UA 1TWCH 2BE5C 2N55A 5C4HA 1TWAH 1SYCA 2QDBA 1TT2A 2UUCL 4LUVA 2R61A 4GKKL 4JI6Q 1NY4A 4A3BG 2KA7A 1SLJA 4A3IH 4MN3A 3PGZA 5KNDA 2GVBA 1YEZA 4JVZA 4DKAC 3U4ZA 1E2ZA 1ZXTA 1A2UA 2CWPA 1VQPA 3NK9A 4A3MG 1PH2A 2E2JH 1LABA 3MTSA 3K7AB 1IHZA 1YJ9A 4IOCA 1S5FD 2PQAB 5KEEA 4DK6C 3MFYA 2NVYB 1HA6A 4DU9A 5GAHC 2MHVA 2G9HD 4DV2L 3CU7A 1SBBB 4JPBW 3EN2A 2I5HA 3CCSA 2F4VL 1HZ9A 2WB1B 2EYHA 3E0JA 1HNWL 1PVOA 5C0XH 2R92B 2IJ0A 1NCVA 3QR8A 1S3OA 3HKZE 3OIPA 2UUBL 4A3CG 5AFWA 1XNQL 4A3GG 1ASYA 1HFGA 4PMCA 2X69A 4U68A 2K03A 2GVAA 5H1SE 3HOUB 2EYOA 1PHJA 5IP7H 2YU9H 2EY1A 4S3SA 3UDFA 1BCPF 3S2HH 1UUPA 3J81c 1PH7A 1LTRD 1CSQA 4P72A 5EKIA 4X3KA 1IBMQ 3VYTA 4EGVA 2VUMH 1AZPA 2QEXA 5KNBA 4IPDA 1AE2A 4LFBL 4LJZC 3GD7A 1SJED 4AH6A 4GN3B 1FJGQ 3D4RA 5GAEC 4GN4B 2F0TA 4K2KA 2K28A 4IUUA 2NTSA 1RCVD 4DR2L 4BA2I 4QY7A 1N34Q 2L9HA 1N8RC 3H3VI 2KHJA 4DN4M 2UU9Q 3U50C 2UUAL 1OXUA 2NZHA 4IUVA 4RKLA 2NN6I 3NUCA 1SMYD 1X3GA 2N3SA 1ILQA 5LMNL 1F2YA 1M4VA 4ZKCB 1BBXC 1EL0A 4DF7A 1ICWA 2VQEL 3HOXG 3PUWA 4OHJA 1QVCA 1HPCA 1SMXA 3HOYG 1XWEA 3HOVG 2K5HA 3GO5A 1K8AC 1AEXA 3QWNA 4GKJL 1SNPA 4EVOA 1SE3A 5BR8L 2F0VA 3VR6A 3BU2A 4KY5A 5CV8A 1WVLA 2XSCA 1BDOA 2DN8A 4KHPQ 1I5FA 2R93B 1GUWA 4B3TQ 1STBA 3HS0C 4JI5Q 1EZ8A 3PSIA 4K6LA 1S5ED 3I4MB 4WFN3 3M4YA 4C2MH 2F52A 3TN2A 2O2LD 3GP7A 1F2MA 2Y0SB 4DV0L 1HR0Q 2UXBL 5I9OA 4TQUS 2R3ZA 1O7ZA 3AYHB 1G51A 4OGQC 4CKCA 3H3VC 1KTKA 4TKOB 2M2LA 4F7XA 4DV1Q 1QUQA 4FDBA 1A15A 4DV4Q 1OXVA 1YBYA 1IW7C 1ET9A 2IX1A 3FKIG 1Y1WG 2JSOA 3M85A 4DR1L 4A3FH 1WCMB 4AYBE 3S14B 2Q2UA 2K5QA 4JYAL 2MO1A 4A3EH 2SOBA 5CORA 1TWHB 2A19A 1YIJA 1N33Q 1KXLA 3CCVA 4JI7L 2AQ1B 5NUCA 2EYPA 1PTOB 3EJIA 3S1NH 1CFMA 3AFPA 3P75A 3S2DH 4R9WA 4UP7A 1RL2A 4IUQA 4F8MA 4PZ8A 1WTHA 4UHVA 2ZJRA 1QNUA 5GADC 4G7ZC 3L9AX 3GTPH 4KY6A 4JI0L 5M3FB 4L5QA 1MHWC 4JI3L 2K4KA 1MSGA 1A62A 4X6AH 1PMRA 4G4KA 4C56C 3I55A 4LF7L 3PF4A 1SROA 3A5UA 4YY3L 1K28A 1PFMA 3BVMA 4LF8Q 3S1QB 1EY8A 3HKZB 3GTLH 1K8OA 3HOWG 2VY3A 3KJOA 4PV1C 4ABNA 3J80i 1Q12A 4LFAL 1YNJD 4JW0A 1S5BD 1JC7A 1F77A 5JJLA 3GTMB 3TZDA 3BVZA 4EX5A 4RKBA 3K5MA 3J7A5 1N36L 3OWFA 1I94Q 3C3LA 1BQQT 1TWCB 4PQXA 2A74C 1TWAB 1X32A 2LFNA 4AIMA 1KDCA 2F0PA 5ELCA 5D65A 4A3IB 4OELB 2D5DA 2IT1A 2JYOA 3M7GA 3RUZA 2JA9A 4JI8Q 1L1OC 2ZT9C 2JA6H 2L12A 2SNSA 2A73B 3R93A 1I3QH 3H09A 4ZUJA 3K0YA 2IHFA 2E2JB 4QMGA 3NQIA 1CM9A 1WTQA 3IFDA 4DUZQ 1JORA 1SNOA 3CPWA 4J8QA 1FYCA 1JOKA 5L37A 1L0WA 2B63H 1J9OA 2OF1A 4NXML 4A3LG 2F0FA 4L63B 2IX0A 3CXCA 3M3YH 3G48A 1TS4A 2RCNA 4LK1C 5IIFA 4PMBA 3S24A 4NW2A 2F0KA 1QOHA 3P1HA 4B9XA 2L5TA 1U4RA 3PUYA 1FNWA 3WOEA 4HIKA 3TS2A 5C3EH 2UXCL 2EE1A 3L3OC 3I4NH 1BBWA 1QNKA 2I46A 4UAIA 2YU9B 4C3IH 3BDLA 2Q8RE 1R9TH 3S2HB 2AMCB 5JVG3 5CR3A 1HTPA 1LV9A 4DNTB 1AN8A 2EYJA 4Z9CB 2VUMB 3R2IA 2BH2A 1A8VA 1OTCA 1CHQD 1Q8IA 2WB1G 1YVCA 5IGCA 4DR3L 4X65L 2R92G 1QVGA 1FVIA 1A2TA 1D5ZC 3H3VH 5M3MH 3S16H 1QCBD 2NN6H 2JEAI 1AH9A 1GOZA 1CA6A 5IYCH 3QO2A 2DNEA 4MIUA 1HQRD 1EEID 5E4XA 4JI1L 3TREA 4A93H 4HSVA 2H5XA 4LMQD 2XGTA 3ULLA 5IODA 1GD7A 2PZTA 3JAMi 3EBEA 2EJFC 4DV5L 1ENAA 1VS0A 4RHSA 4KLKA 1HNXQ 4K6DA 2E5LQ 3FVQA 4KV6A 2F3WA 1HJPA 2VZAA 5FJ8G 3ICEA 5JEAJ
chains in the Genus database with same CATH topology
1C48A 3SK8A 2X6LA 3MXGA 1I4XA 2KEEA 1LTAD 1EQTA 1U4LA 3VYRA 4R8NA 1SYBA 1Q3LA 2JXMB 4C2MB 3OMGA 1LTTD 4L6TB 2KQ3A 2NUCA 4KN7C 3KBXA 1ILPA 1G6ZA 1GUOA 4YIJA 5JEAH 5KIXA 4A3FB 1IKLA 4A3EB 1OXXK 2M9VA 2K6AA 5IGBA 4XT1B 1I4PA 4XQJA 3RLFA 1HA5A 4FP5D 4Q5VA 3S1NB 4DAYA 1BR9A 3S2DB 5BN3A 3TP5A 5LL6X 3NHHA 5KNCA 1S4ZA 3GTPB 2RQXA 2F0GA 3J81E 2F0NA 1F9QA 4RGMA 5A2QL 2WACA 4QB4A 4RH6A 2B2VC 1M8AA 1PTOF 3GTLB 2EVBA 1QG7A 4B08A 2B2YA 4PNYA 5G3LF 4DXFA 3OW7A 3K5NA 2BCOA 2NYZD 4IALA 3OSOA 4FXKC 2ICEC 2F0MA 3FMCA 1PZJD 4KY7A 5JOBA 4J1MA 1ENFA 4CKEA 1WTPA 2AUKA 4E6IA 3K59A 5J1ZA 2JA6B 1RTOA 5FOBB 3E5SA 3SR1A 3BS1A 1IKMA 3SE0A 1I3QB 3CHBD 4H7BA 3V96A 3J81L 1JWSD 4IFDG 3A8JE 1GUTA 2CVRA 2AUJD 2RDGA 4I7ZC 1OO9B 4FF3A 1CQFA 3J7YW 1KLUD 3D6CA 1NUCA 2B63B 4XXEA 1ESFA 1LT5D 3A55A 5FO9B 3M3YB 3SK4A 1V8QA 1I4GA 1GJXA 3DXJC 3TZUA 3Q22A 4ILWA 4FXDA 4KN4C 1HTLD 1BO0A 1LT4D 3SK5A 3I4NB 2EOTA 2EJGC 4BBSB 1STHA 1S5DD 4C3IB 2DNCA 3GV3A 4Q0FA 1R9TB 4ZUIA 2VB3X 2H1EA 1QB5D 5CV9A 4IUPA 2XNAC 1EIGA 2EXZA 5DNFA 5C4ZA 1MBYA 2F0JA 1ZEQX 2EZVA 1VCIA 3NPPA 3X3MA 4LAAA 5K36H 3DWPA 3PUVA 1RD9D 5M3MB 1B50A 3A7AB 1B3AA 4TRDA 3OMCA 3TP8A 3QG1A 1QILA 3MEHA 4A93B 1F9RA 5KYLA 3X3NA 3TDQA 4QIWB 1G2TA 2CW0D 1Z6HA 3LNNA 5E4WC 4DAPA 5C0XJ 5CMDA 3D4WA 1O7LA 3T53B 4H44C 1SNQA 4F88A 1SFOB 4XYQA 3VR5A 1NR2A 3GTQB 2SEBD 3SK6A 2KUMA 1DD2A 5LL6S 3S1RB 1H9RA 3KUPA 1L0XB 3AMUA 1EOTA 1L0YB 3BYYB 1Z7TA 1T5EA 1C8CA 2EY2A 3HGBA 1V43A 5CGKA 4RHRA 5A35A 5COYA 1RTNA 1SYDA 2RVLA 5F2DA 3MXPA 2QCPX 2B2TC 1XYIA 2BA1A 3T51B 4RGNA 2PW7A 3PO3B 2KECA 1V1PB 1F2LA 2L0CA 1STYA 1U4PA 4XIGS 1NR4A 4ZK9B 2WKCA 1XXGA 2BDOA 2AQ2B 4FVMA 5G3LD 1I4HA 4HAEA 3PIO3 5JPNC 1HUNA 4XQQA 4DNRB 1D1KA 5M5XB 3S17B 5I6WA 1I50B 4R8IA 1LO5D 5J22A 2R7ZB 1PRTC 3I8ZA 4C3JB 5J39A 1A3TA 3S9WA 1SNMA 1C4QA 2E2DC 2PNRC 4NKLA 4C1NK 2WAQB 2XWBB 4BY1B 2B2UC 3K5LA 1G8ZD 4FO2A 1Q1BA 1VMPA 4KI0A 3VR3A 1NAPA 4BWGB 2WV6D 3AU7A 3NBIA 2C5CA 4CBVA 3T16A 1GUGA 1EWCA 2JA7B 1E2VA 5IGFA 2F0QA 3NE5B 2K05A 2DY8A 5I2YA 4ODGA 1LTGD 4MHEA 4ZLTF 2XWJB 2PQEA 3J80E 2L55A 2B2WA 4A3JB 2ID0A 3DHQA 3MHBA 3K58A 2J4XA 1AW7A 5ISRA 4DGZA 1D1IA 2FJ2A 1K83B 4HCSA 3CRKC 4GZYC 3D4DA 4U673 1ZYRD 1DONA 4KK7A 3HEJA 2IL8A 1LTID 3NWTA 1DOLA 1EY9A 1DJRD 1Q1EA 3SEBA 5IT9E 4RGOS 4C3IG 3Q23A 1CA5A 1WTXA 5ELEA 1EZ6A 1I6HB 2C9OA 2WIIB 3DM1A 3MXUA 4XYOA 5T1GA 1EWHA 5C6AA 3RD4A 2RDHA 1JOOA 4G57A 1TU2B 5JJZA 2F1MA 2NN6G 1AZQA 1KDAA 3QOLA 4RCNA 3P7JA 3IKJA 2CQAA 3TMEA 1F2ZA 3H91A 5CYUA 3GTKB 4FF2A 1HQMC 2FMMA 2E2HB 3QB3A 3I70A 1ESRA 3KF8A 5FO8B 5CBAE 1TR5A 3KLSX 3T4AC 5TSSA 1BCPD 2K33A 2RA4A 2F0HA 4RA8A 4XDXA 1ZKOA 2B2TA 3P20A 3PO2B 5IT9L 1EIHA 5CV6A 5IGEA 4OO1I 3N6RA 2JEBI 2L1BA 3JAME 4M1UB 5FLXE 4FYDA 3VYSA 3IL8A 4KHZA 3L7ZC 1QWYA 1IL8A 1RKNA 1PXUA 1TS5A 4RWSC 4CJ1B 2Q8IB 4AYBB 2FFKB 5E3FA 1SE2A 4C1NI 3W2DA 1HXYD 2EJMA 5JEAG 1O78A 5C4XB 1DOKA 3VYUA 4K5VA 5D3IB 4DAVA 3T13A 2F0LA 5C3WA 3K57A 5ELBA 2PMZB 1KDBA 1X3PA 4HTHA 4DXGA 4KD4A 3VA5A 2F0SA 1RHPA 3IAYA 2A68D 4IFDI 3QOJA 1FGBD 4XT3B 1SYFA 3MC0B 1EYAA 2B2UA 3MWYW 3RZOB 1SMYC 5T1IA 4XQNA 1PZID 4OL7A 3NQTA 1SYGA 4IZ8A 1B9NA 4BA1I 3TSSA 1K8MA 1EYDA 3PIP3 2PCFB 1JWUD 3NTHA 2QILA 3M7NA 4F87A 4C3JG 3NP8A 2E2IB 1V1OA 5E1FA 4I65A 2PO4A 2KCCA 1WTWA 1EYCA 3BG3A 2FINB 5HURA 4KHVA 2GA4B 2EY6A 3C1FA 3I72A 3Q24A 4JBWA 2J7ZA 3FRPB 3EA6A 2KJXA 3RZDB 4BY7B 2HDLA 2AWNA 1D5XC 2ICIA 4DA2A 2HCCA 1B1ZA 4IURA 3H6MA 2D2CC 3HOXB 3DUZA 1CZGA 3TP6A 3S15B 1R4QB 1AFPA 1JR0D 4A3DB 2HCIA 2V4DA 4ULLA 4HSPA 3QJYA 2LY7A 1W6JA 1F9SA 5C3XA 2RBMA 3K6OA 1TWGB 1E0BA 3LWEA 1EU3A 1R4PB 2XRSD 1BUVT 1W6KA 1UEAB 4EQOA 4ZKBB 1V1PA 4KTAA 1ZYRC 2SNMA 1JQYD 2XN9C 2K01A 1GXDC 1YNJC 4K8IA 1SSOA 4DK1A 3N52A 5K36G 2NVTB 3PUZA 2NB0A 1A3VA 3A8IE 5EGTA 1B53A 4HMJA 4ME5A 3MAQA 5M5YB 2L4NA 2A69D 1VDZA 3I4LA 5BN5A 1DZ1A 2O5JC 3LWUA 3CQZB 2O4XA 1STEA 2BDNA 3RMHA 4J6HA 2E74C 4X3TA 3OOCA 3I73A 1U9RA 2PW5A 4OO1H 1PRTB 3PV0A 3HOWB 3R2TA 1TKWB 4O42A 1IYUA 2EYMA 2LKVA 1YNND 2MP1A 3I90A 1EQVA 2L11A 2G9DA 2MJ8A 1ML0D 5C0XG 1STAA 5EBCA 4H0LC 1II3A 1BCPC 3SXHA 1LT6D 2FMCA 2WKDA 4RAUC 5C5MA 5I4DA 4K5XA 5EKLA 2HQEA 3DWQA 3ZYYX 2I07B 5IGDA 2D9UA 4QUCA 1JWMD 4IFDH 3E6ZX 2JA8B 2DY7A 1PYWD 2RKSA 3R8BA 4QCLA 5IGGA 1JE4A 2EDGA 3EROA 1JB3A 3U9OA 5I9PA 4QUFA 2Z4IA 2VNUD 1B9MA 2K5DA 3T56B 1EY0A 2EY5A 1CHPD 2IPKD 2ENBA 3NTIA 4UDUC 1DM0B 2RSOA 3C46A 2A68C 3DEOA 1KNAA 3AB9A 4HMIA 4KKSA 4H13C 2A5HA 3HP3A 3A8KE 3SDZA 1LLRD 3HOZB 2A6HD 5M9OA 4XTCS 1TS2A 3SHLA 3VR4A 1BOSA 2PPBC 2XVSA 4NMZA 4L8JA 3WOFA 1NSNS 3NXWA 4NP5A 3IFTA 3TBIB 3PUXA 2K04A 1LTSD 5HGTA 2RSNA 2B2VA 3KK7A 5EBDA 2F0OA 1PTOD 3TP7A 3BDOA 2EYFA 2A6ED 2OXPA 1DYQA 1LACA 3LX0A 2BOSA 4CJ2C 1CTMA 1XTCD 1GHJA 3Q6SA 1KAAA 1SJHD 4EQNA 3DWAA 4B9WA 1G91A 3H0GB 4Y7NB 1SE4A 3EVQA 3SVMA 4KKTA 2F4IA 1BXTA 2B39A 1EY5A 2F3VA 3J7AF 1Y69U 5JAVA 4G7HC 1EY6A 1J8IA 5DM63 1EFID 2K7VA 4OIKA 1B44D 3W3AA 1PFBA 3CKIB 5C44B 4A3KB 1D5MC 3I3CA 2ZXOA 4IQZA 1I4QA 1ONLA 4JK1C 2ZXRA 2Z8LA 1WD1A 3DMUA 4N9TA 1HFNA 1ENCA 2JE6I 2X6GA 1H9SB 1WTVA 1Q90A 1KLGD 3C2PA 3O13A 1TVXA 3D3RA 1SAPA 3I91A 3S1MB 3HRZC 4X3UA 2XRQD 5I6YA 4CKBA 2Z4HA 2M00A 1T5XD 1FD7D 1PDQA 1WD0A 4ZQ3A 2YYZA 2A69C 1Y1VB 2SDFA 4DK0A 1Y8OB 2PYKA 3BZDB 1TS3A 3VR2A 2MPMA 5EPKA 1HRJA 2RDFA 2HUGA 5KRUA 2JA5B 1FNUA 2D62A 1JCKB 1STNA 1CZWA 3KBGA 1PRTF 1QJOA 1H9MA 2IX3A 1DOMA 5I2XA 3D31A 2OEOA 1MSHA 2E75C 2WINB 2BA0A 1A6XA 1YNNC 1DXMA 1Y8PB 3GQBA 2IWHA 3DEPA 3GTOB 3H94A 2IW3A 2B2YC 3J80L 4C3HB 1WTRA 1O80A 1JOQA 2R6GA 2NZ1D 2K5WA 4K8JA 4P2CB 2B8FA 2N88A 2QF7A 1EY7A 4BBRB 3ONAB 5CV5A 1OXTA 2KVMA 1O7YA 5K5PA 4ZAIA 1FR3A 3F2UA 2CW0C 2FHTA 4RGTA 2NVQB 3QIAA 4V0BA 2KEDA 1VF7A 3R3OA 1FNVA 2TMPA 5FK9C 3G7LA 2VXWA 4N9PA 3FPPA 2F0UA 1PLFA 4KJOA 2JP1A 1D2BA 2F0IA 1MD2D 2H4OA 3URYA 4RFBA 5FO7B 5ELDA 1G2SA 4G7OC 1BF4A 2OT2A 3MA2B 1JICA 1IYVA 4KD3A 2F0EA 1SYEA 3K5OA 3OIQA 3GV6A 3VA7A 1TWFB 4CGYB 3ND8A 3NWSA 4K2LA 2BE5D 3MVVA 3KLRA 1S5CD 4A3BB 1LT3D 1UAPA 2A6HC 2KCNA 2LS01 3WDNA 1BNZA 5LHY1 4EQPA 3BVGA 3V2TA 4ID6A 1PFNA 5CC4A 3HG9A 2XIWA 4A3MB 1F9PA 2EYLA 3D6WA 4DFAA 5KGUA 1HCZA 1ET6A 5M5WB 4FNFA 4RCOA 4KJNA 5EKKA 2LMCB 1PTOC 4WORA 1I6VC 5IOCA 2J0TD 2A6EC 4WRDA 1RODA 5D3DA 3OPOA 3J7AV 4FXGC 3JAML 4FF4A 4OIJA 5FLXL 3BDCA 3EQLC 1OXSC 3FEWX 4A3GB 2K1BA 1WTOA 4PMWA 2CHBD 5KYIA 4TSSA 5A2QE 1H9KA 1RJTA 1X3QA 3ERQA 2NWGA 3GTJB 2NBFA 1B4OA 1BCPB 2EPBA 2TSSA 2NVXB 1E2WA 5C5LA 1CT1D 5JVH3 1GUSA 3G6JB 5C0XI 1RDPD 3Q0AA 5BN4A 3NTKA 1TQOA 5EPJA 1D6EC 5CBEE 3ND9A 2F0WA 3MZ5A 2O5IC 2QEJC 1PZKD 3HOYB 3HOVB 5DAUA 4NDXA 1VF5C 5FKAC 1MI2A 1I4RA 1PRTD 3MXNA 1TY2A 3D8GA 1SEBD 5CV4A 2Q8TA 5ELFA 4OO1G 4QF4A 3GTGB 3PMFA 1SNDA 3CRLC 3C1EA 1HHVA 3KLSA 4CJ0B 1LTBD 1XX8A 4BS9A 4IN3A 1EEFD 2QKIC 3OWEB 3OHXC 2MUYA 1Y8NB 3FKIB 3NSWA 1Y1WB 1AP0A 1IW7D 5EQ0A 1MGSA 2NTTA 2F0DA 1GHKA 2MGSA 5D14A 2PZUA 3NBHA 4ZRZA 4FF1A 4KKUA 5C4JB 3M4OB 4HR7B 3UI2A 1TY0A 4O1NA 2ZXPA 1DCZA 3A54A 4HEDA 4IUTA 2VB2X 1B2TA 2E76C 5DM73 4C3HG 5DEHA 1Z47A 2PZWA 1HUMA 1SNCA 1QE6A 3V05A 5JPMC 1U4MA 1UNSA 2WP8J 3HZXA 3A7LA 1GUNA 4ZYSA 4X3SA 1PTOH 4WJWA 4IUNA 3A56A 2AWOA 1KABA 3EFXD 4IFDJ 1EU4A 5C3EB 4V190 4CHTB 1KNEA 2B2WC 1VMCA 1STGA 1G291 3ITPA 4HCEA 1TIID 1CI3M 1H9SA 1SXTA 2KOLA 1RF2D 5EJWA 3MFGA 3FPUB 1SDFA 1CK1A 2AQ3B 4HN7A 4K14A 4K5WA 2B8GA 2Z1CA 2KHSA 5EPLA 2HDMA 4KMUC 2F03A 5CV7A 3U9SA 3S16B 3FDTA 1H9JA 3BYTB 1EY4A 4M8AA 1CQVA 2K32A 1A3UA 2BE5C 2N55A 5C4HA 1SYCA 2QDBA 1TT2A 2R61A 2KA7A 4MN3A 5KNDA 1E2ZA 1ZXTA 1A2UA 3NK9A 1LABA 3MTSA 3K7AB 1IHZA 1S5FD 5KEEA 3MFYA 2NVYB 1HA6A 4DU9A 2MHVA 2G9HD 3CU7A 1SBBB 2WB1B 2EYHA 3E0JA 5C0XH 2R92B 2IJ0A 1NCVA 3OIPA 5AFWA 1HFGA 4PMCA 2X69A 4U68A 2K03A 3HOUB 2EYOA 2EY1A 4S3SA 1BCPF 1UUPA 1LTRD 5EKIA 4X3KA 3VYTA 4EGVA 1AZPA 5KNBA 4LJZC 3GD7A 1SJED 3D4RA 2F0TA 4K2KA 2K28A 4IUUA 2NTSA 1RCVD 4BA2I 2L9HA 4DN4M 1OXUA 4RKLA 4IUVA 2NN6I 3NUCA 1SMYD 1ILQA 1F2YA 1M4VA 4ZKCB 1BBXC 1EL0A 4DF7A 1ICWA 3PUWA 4OHJA 1HPCA 1XWEA 3GO5A 1AEXA 3QWNA 1SNPA 4EVOA 1SE3A 2F0VA 3VR6A 5CV8A 4KY5A 1WVLA 2XSCA 1BDOA 2DN8A 2R93B 1GUWA 1STBA 3HS0C 1EZ8A 4K6LA 1S5ED 3I4MB 4WFN3 3M4YA 3TN2A 2O2LD 3GP7A 1F2MA 2Y0SB 5I9OA 4TQUS 2R3ZA 1O7ZA 4OGQC 4CKCA 3H3VC 1KTKA 4TKOB 2M2LA 4F7XA 1A15A 1OXVA 1IW7C 1ET9A 2IX1A 2JSOA 3M85A 1WCMB 3S14B 2K5QA 2SOBA 5CORA 1TWHB 2AQ1B 5NUCA 2EYPA 1PTOB 3EJIA 1CFMA 3P75A 4R9WA 4IUQA 4F8MA 1QNUA 4G7ZC 3L9AX 4KY6A 5M3FB 1MSGA 1PMRA 4G4KA 4C56C 1PFMA 3BVMA 3S1QB 1EY8A 3HKZB 1K8OA 4PV1C 4ABNA 1Q12A 1YNJD 1S5BD 1JC7A 1F77A 3GTMB 3TZDA 3BVZA 4RKBA 3K5MA 3OWFA 3C3LA 1BQQT 1TWCB 4PQXA 2A74C 1TWAB 1X32A 2LFNA 1KDCA 2F0PA 5ELCA 5D65A 4A3IB 2D5DA 2IT1A 2JYOA 3M7GA 3RUZA 2ZT9C 2L12A 2SNSA 2A73B 3R93A 3H09A 4ZUJA 3K0YA 2E2JB 4QMGA 3NQIA 1CM9A 1WTQA 3IFDA 1JORA 1SNOA 4J8QA 1FYCA 1JOKA 1J9OA 2OF1A 2F0FA 4L63B 2IX0A 1TS4A 4LK1C 5IIFA 4PMBA 4NW2A 2F0KA 1QOHA 3P1HA 4B9XA 2L5TA 1U4RA 3PUYA 1FNWA 3WOEA 2EE1A 3L3OC 1QNKA 2I46A 4UAIA 2YU9B 3BDLA 2Q8RE 3S2HB 5JVG3 5CR3A 1HTPA 1LV9A 4DNTB 1AN8A 2EYJA 4Z9CB 2VUMB 3R2IA 1CHQD 1Q8IA 5IGCA 1A2TA 1D5ZC 1QCBD 2NN6H 2JEAI 1GOZA 1CA6A 3QO2A 2DNEA 4MIUA 1HQRD 1EEID 5E4XA 4HSVA 4LMQD 5IODA 2PZTA 2EJFC 1ENAA 4RHSA 4K6DA 3FVQA 4KV6A 2F3WA 5JEAJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZT9 C;  1GUS A;  4TQU S;  3IFT A;  3MFY A;  1Z6H A;  3LNN A;  3PUX A;  4OGQ C;  1O78 A;  4TKO B;  5C0X G;  2V4D A;  1Q1E A;  4H0L C;  2YYZ A;  4G7O C;  2AUK A;  2JXM B;  2A69 C;  3QJY A;  3BDO A;  1O7L A;  1OXV A;  5BN4 A;  1IW7 C;  3A7L A;  2A6E D;  1IYV A;  5C0X H;  1GUN A;  4DK0 A;  3T53 B;  1Y8O B;  1LAC A;  3VA7 A;  3M85 A;  4H44 C;  3SE0 A;  3VR2 A;  2PNR C;  3ND8 A;  3ND9 A;  1FYC A;  4KN7 C;  1CTM A;  1GHJ A;  2O5I C;  2A68 D;  2AWO A;  2BE5 D;  3MXU A;  4IFD G;  3A8J E;  1GUT A;  3KLR A;  1EWH A;  2AUJ D;  2D62 A;  2A6H C;  1VF5 C;  4LK1 C;  1Q1B A;  1QJO A;  3VR5 A;  4I7Z C;  3WDN A;  1H9M A;  1GUO A;  4KI0 A;  1ZYR C;  5JEA H;  1TU2 B;  3VR3 A;  1DD2 A;  3D31 A;  4IFD H;  1SMY C;  2F1M A;  1H9R A;  1CFM A;  2NN6 G;  2E75 C;  1G29 1;  2L5T A;  4KKT A;  3PUY A;  4RCN A;  2BA0 A;  1OXX K;  1A6X A;  1YNJ C;  5KNB A;  1YNN C;  1GUG A;  1DXM A;  1CI3 M;  1H9S A;  4G7Z C;  1Y8P B;  1Z7T A;  3GQB A;  4LJZ C;  3IKJ A;  1T5E A;  1V8Q A;  4DK1 A;  1GJX A;  3H94 A;  3DXJ C;  3GD7 A;  1E2V A;  2EDG A;  5K36 G;  3HGB A;  3RLF A;  1V43 A;  3NE5 B;  1B9N A;  1HCZ A;  4BA1 I;  1K8M A;  3D4R A;  3TZU A;  4OO1 G;  3PUZ A;  1HTP A;  2B8G A;  5A35 A;  5BN3 A;  2R6G A;  3A8I E;  4DNT B;  1HQM C;  2LMC B;  1Y69 U;  4KN4 C;  4G7H C;  2PCF B;  1I6V C;  1PMR A;  2B8F A;  3CRL C;  5KNC A;  4BA2 I;  2QF7 A;  4KMU C;  3M7N A;  1B9M A;  3U9S A;  2A6E C;  2K7V A;  2EJG C;  1OXU A;  1H9J A;  3T56 B;  2DNC A;  3OPO A;  2NN6 I;  2KCC A;  1K8O A;  3BG3 A;  2A69 D;  1Y8N B;  1OXT A;  2K32 A;  1VDZ A;  2K33 A;  3I4L A;  3W3A A;  2BA1 A;  4PV1 C;  3T51 B;  5BN5 A;  1Q12 A;  1IW7 D;  2A68 C;  2BE5 C;  3P20 A;  1ZKO A;  3EQL C;  3I72 A;  1OXS C;  1FR3 A;  4IQZ A;  2JEA I;  2NN6 H;  3AB9 A;  3PUW A;  2CW0 C;  2O5J C;  3LWU A;  1HPC A;  4JBW A;  2DNE A;  1GHK A;  1ONL A;  4KKS A;  4JK1 C;  2KA7 A;  3N6R A;  4H13 C;  2E74 C;  3QIA A;  2JEB I;  1VCI A;  2EVB A;  3A8K E;  3OOC A;  1VF7 A;  3SDZ A;  5KND A;  1H9K A;  5K36 H;  3VR6 A;  3CRK C;  3I73 A;  3PUV A;  4XIG S;  2JE6 I;  2A6H D;  4GZY C;  4KHZ A;  3L7Z C;  1H9S B;  1BDO A;  2BDO A;  2DN8 A;  3A7A B;  4XTC S;  4OO1 H;  4KKU A;  1E2Z A;  4HR7 B;  3OW7 A;  3PV0 A;  2EJF C;  3VR4 A;  1DCZ A;  3FPP A;  1Q90 A;  1TKW B;  2PPB C;  3QG1 A;  2Q8I B;  1E2W A;  1IYU A;  2D5D A;  3M4Y A;  1LAB A;  4L8J A;  2D2C C;  3FMC A;  2EJM A;  5JEA G;  2E76 C;  2IT1 A;  4DNR B; 
#chains in the Genus database with same CATH topology
 1C48 A;  3SK8 A;  2X6L A;  3MXG A;  1I4X A;  2KEE A;  1LTA D;  4CDD C;  1EQT A;  1U4L A;  3VYR A;  4O2D A;  4R8N A;  4JI6 L;  1SYB A;  3D0F A;  4R1J A;  1Q3L A;  2JXM B;  4C2M B;  3OMG A;  1SFO H;  4QL5 A;  1QZH A;  1LTT D;  4L6T B;  4K0K L;  3GTQ H;  3KDF A;  1VQG A;  1XMO Q;  2KQ3 A;  2JQO A;  2NUC A;  4KN7 C;  5IYD G;  3KBX A;  2DJF C;  1YJN A;  1ILP A;  2XTI A;  1Q81 C;  2VW9 A;  1G6Z A;  1PH3 A;  1YHA A;  4JCV E;  1GUO A;  3PIO A;  4YIJ A;  5IE8 A;  3J80 c;  5JEA H;  5KIX A;  4A3F B;  3ERS X;  3RR5 A;  1IKL A;  1LM0 A;  4A3E B;  1OXX K;  1XMQ Q;  2M9V A;  2K6A A;  5IGB A;  4XT1 B;  3RNU A;  1I4P A;  4XQJ A;  2EQS A;  3RLF A;  1HA5 A;  4FP5 D;  5AJ3 L;  4Q5V A;  1YZ6 A;  3S1N B;  4DAY A;  1BR9 A;  3S2D B;  5BN3 A;  2AHO B;  4QIW E;  4IJH A;  3MEF A;  3TP5 A;  5LL6 X;  2PQA A;  4B3M Q;  3NHH A;  3PO3 H;  5KNC A;  4L5S A;  1S4Z A;  3GTP B;  2RQX A;  2F0G A;  3J81 E;  2F0N A;  3FHW A;  1F9Q A;  4RGM A;  3EIV A;  2QW7 A;  5A2Q L;  5FLM G;  2WAC A;  4AQY L;  4QB4 A;  4APV A;  2UXD L;  4RH6 A;  2B2V C;  2MO0 A;  1M8A A;  3NEL A;  1PTO F;  2ZJQ A;  4WJ3 M;  1NMG A;  3GTL B;  4B3R L;  2EVB A;  1QG7 A;  4X66 L;  4B08 A;  2B2Y A;  3K8A A;  4PNY A;  5IT9 c;  3A0J A;  4PZ7 A;  5G3L F;  4DXF A;  5M5X H;  3OW7 A;  3S17 H;  4DV3 Q;  1I50 H;  3K5N A;  2BCO A;  1BKB A;  2NYZ D;  4IAL A;  2UU9 L;  2R7Z H;  3OSO A;  5M3F G;  4FXK C;  4PZ6 A;  2RCF A;  1QZG A;  2ICE C;  4C3J H;  1VQD A;  2F0M A;  1K8G A;  3FMC A;  1JB7 A;  1PZJ D;  4DR4 Q;  4YCU A;  2R93 H;  4KY7 A;  5JOB A;  1T9H A;  1N32 Q;  4J1M A;  1YHB A;  2P5Z X;  1ENF A;  3KF8 B;  4UP9 A;  4CKE A;  3UE0 A;  4LF5 L;  1WTP A;  4BY1 H;  4X62 Q;  1A63 A;  2AUK A;  4E6I A;  2VQF Q;  3K59 A;  3PF5 A;  5J1Z A;  1VQ7 A;  4HJ8 A;  2JA6 B;  1RTO A;  3E5S A;  3SR1 A;  5FOB B;  3BS1 A;  4LF9 L;  3SE0 A;  1IKM A;  1I3Q B;  4GNX C;  3CHB D;  4H7B A;  3V96 A;  3F8T A;  3J81 L;  4DR5 L;  1EOV A;  1JWS D;  4UP8 A;  4IFD G;  3A8J E;  1GUT A;  2CVR A;  2AUJ D;  2RDG A;  2JA7 H;  4I7Z C;  1OO9 B;  4FF3 A;  1CQF A;  3K81 C;  3J7Y W;  1KLU D;  1VQM A;  3D6C A;  1NUC A;  1KIX A;  2B63 B;  4XXE A;  1ESF A;  1LT5 D;  3A55 A;  5FO9 B;  3M3Y B;  3SK4 A;  4A3I G;  1V8Q A;  1I4G A;  1GJX A;  3DXJ C;  3L2P A;  1EQR A;  3TZU A;  3Q22 A;  4ILW A;  2KBN A;  4A3J H;  4FXD A;  4KN4 C;  1HTL D;  3JAM c;  1BO0 A;  5FLX c;  1LT4 D;  1VQI A;  4P71 A;  3SK5 A;  3I4N B;  1E1O A;  1M90 C;  2EOT A;  1B7Y B;  2EJG C;  4YCV A;  4BBS B;  1STH A;  1S5D D;  4C3I B;  2DNC A;  3GV3 A;  3F2C A;  4Q0F A;  1R9T B;  4ZUI A;  1IL2 A;  2VB3 X;  1K83 H;  2H1E A;  2MQH A;  1QB5 D;  5CV9 A;  5LMU L;  1IBK Q;  4IUP A;  3SGI A;  2XNA C;  4DV7 L;  2NZO A;  1EIG A;  4DUY Q;  2EXZ A;  2OQ0 A;  2WAQ E;  5DNF A;  1MBY A;  5C4Z A;  2F0J A;  1ZEQ X;  2EZV A;  1VCI A;  3NPP A;  3X3M A;  1RIP A;  4LAA A;  5K36 H;  3DWP A;  3PUV A;  5DLQ E;  1VQO A;  1RD9 D;  5M3M B;  4YHH Q;  1B50 A;  3A7A B;  1B3A A;  1LYL A;  4TRD A;  3KDF B;  2K14 A;  3ULP A;  3OMC A;  3TP8 A;  3QG1 A;  4LF8 L;  1QIL A;  5IP7 G;  3MEH A;  4A93 B;  1F9R A;  5KYL A;  3X3N A;  3TDQ A;  1MJC A;  4QIW B;  4NXN L;  1G2T A;  2CW0 D;  1Z6H A;  3LNN A;  2VUM G;  5E4W C;  3TQY A;  3E9I A;  4DAP A;  1GKH A;  1LUZ A;  1I6H H;  5C0X J;  5CMD A;  3D4W A;  1O7L A;  1I94 L;  3KFU A;  1JJ2 A;  2JN4 A;  4MZ9 A;  3T53 B;  4H44 C;  1SR3 A;  4DAY B;  1ICF B;  2Z6K C;  4LW1 A;  1SNQ A;  4F88 A;  2V1C C;  1SFO B;  1H95 A;  4XYQ A;  4HIM A;  3VR5 A;  4TVA B;  1NR2 A;  3GTQ B;  2SEB D;  3SK6 A;  2KUM A;  1DD2 A;  4N8X 1;  5LL6 S;  3S1R B;  1H9R A;  3KUP A;  3GTK H;  1L0X B;  3AMU A;  1EOT A;  2E2H H;  5E7N A;  1L0Y B;  3BYY B;  1Z7T A;  1E1T A;  1UE7 A;  1T5E A;  1C8C A;  1XPU A;  2EY2 A;  3HGB A;  1V43 A;  4B3S Q;  5CGK A;  4RHR A;  5A35 A;  2FXQ A;  2PI2 E;  5COY A;  1KQS A;  1RTN A;  1SYD A;  2RVL A;  3KJP A;  5F2D A;  3MXP A;  3PO2 H;  2Q2I A;  4JI4 Q;  2QCP X;  1DGS A;  2B2T C;  4HJ9 A;  4LUZ A;  4OX9 Q;  1XYI A;  2BA1 A;  3T51 B;  4RGN A;  2PW7 A;  3PO3 B;  4CDC C;  2KEC A;  1V1P B;  1F2L A;  3DLL A;  2L0C A;  1L1O B;  1STY A;  1UE5 A;  1U4P A;  4XIG S;  1HZB A;  1NR4 A;  4ZK9 B;  4MTK A;  4A3F G;  2WKC A;  1XXG A;  2BDO A;  2AQ2 B;  5C4X H;  3DM3 A;  4FVM A;  2ASB A;  5G3L D;  1VQ8 A;  1I4H A;  4HAE A;  3PIO 3;  5JPN C;  4O0A A;  1HUN A;  4XQQ A;  4DNR B;  1D1K A;  1XNR Q;  5M5X B;  2ZTC A;  3S17 B;  5I6W A;  1I50 B;  4R8I A;  1LO5 D;  5J22 A;  4JBM A;  2R7Z B;  1PRT C;  2YTY A;  3I8Z A;  3PCO B;  4C3J B;  5J39 A;  4DPG A;  1A3T A;  1UE1 A;  3S9W A;  1SNM A;  2HHH Q;  4ALP A;  1VQB A;  1C4Q A;  2E2D C;  4HJA A;  3RZO H;  2PNR C;  4NKL A;  4C1N K;  2WAQ B;  1HZA A;  2XWB B;  4BY1 B;  2B2U C;  4X64 Q;  3K5L A;  2E5L L;  1G8Z D;  4FO2 A;  1Q1B A;  1VMP A;  3UDI A;  4KI0 A;  3VR3 A;  3T1Y Q;  1NAP A;  4BWG B;  4DR7 Q;  2WV6 D;  3AU7 A;  3NBI A;  2C5C A;  4CBV A;  3T16 A;  3F2D A;  1GUG A;  1E3P A;  1EWC A;  2JA7 B;  1E2V A;  5IGF A;  2F0Q A;  3CW2 C;  3NE5 B;  2E2I H;  2K05 A;  2DY8 A;  5I2Y A;  1XMO L;  4ODG A;  1LTG D;  4MHE A;  1NJI C;  4ZLT F;  2XWJ B;  2PQE A;  4DV6 L;  1VQ4 A;  3J80 E;  1PH4 A;  1NMF A;  4LF4 Q;  2L55 A;  4JV5 L;  4GN5 A;  3RZD H;  4BY7 H;  2B2W A;  4A75 A;  4A3J B;  2ID0 A;  3DHQ A;  3RLO A;  2PMZ E;  3M9B A;  3MHB A;  3K58 A;  4JBK A;  1XMQ L;  2J4X A;  1AW7 A;  5ISR A;  3FP9 A;  4R4C A;  1B8A A;  1B3Q A;  1J5E L;  4DGZ A;  1YIT A;  1D1I A;  1U5K A;  2FJ2 A;  1K83 B;  4HCS A;  3HOX H;  3CRK C;  3E0E A;  1CUK A;  2RHQ B;  3D4D A;  4U67 3;  4GZY C;  3S15 H;  2B63 G;  1GM5 A;  1ZYR D;  1DON A;  4KK7 A;  1X3F A;  3HEJ A;  4A3D H;  2IL8 A;  1SRU A;  4JI2 Q;  1LTI D;  2KHI A;  3NWT A;  4YWM A;  1X55 A;  3UDG A;  1DOL A;  2Q2T A;  1HR0 W;  1TWG H;  5C3E G;  4DAM A;  4UPA A;  1EY9 A;  1DJR D;  2VL6 A;  1Q1E A;  1MIU A;  1W3S A;  3I4N G;  3SEB A;  5IT9 E;  4RGO S;  4C3I G;  3Q23 A;  1CA5 A;  2N49 A;  1WTX A;  5ELE A;  2UUC Q;  1C7Y A;  4GKK Q;  4NPS A;  1EZ6 A;  1I6H B;  2C9O A;  4R4Q A;  2WII B;  3DM1 A;  3MXU A;  4XYO A;  5T1G A;  1EWH A;  5C6A A;  2MFI A;  2N78 A;  4DR4 L;  3RD4 A;  2RDH A;  1JOO A;  2I0Q A;  4G57 A;  3TS0 A;  1TU2 B;  5JJZ A;  2F1M A;  2NN6 G;  1AZQ A;  1KDA A;  3QOL A;  4RCN A;  5IYC G;  2CKZ B;  3P7J A;  2WFW A;  3IKJ A;  2CQA A;  2VQF L;  4A93 G;  3TME A;  3RN5 A;  1EFW A;  4JBJ A;  4DV2 Q;  1F2Z A;  3H91 A;  5CYU A;  5M5Y H;  1PH1 A;  4LNQ A;  3GTK B;  4OWW B;  4FF2 A;  3E9H A;  1CKM A;  1HQM C;  2FMM A;  2E2H B;  3CF5 A;  2CQO A;  3QB3 A;  3I70 A;  1ESR A;  1X6O A;  3KF8 A;  2UUB Q;  5FO8 B;  3STB D;  3CQZ H;  4CDF C;  5CBA E;  1TR5 A;  4GLX A;  1XNQ Q;  1VQ5 A;  3KF6 A;  3KLS X;  3T4A C;  5TSS A;  1BCP D;  2K33 A;  4JOI C;  2RA4 A;  2F0H A;  4Y52 H;  3OW2 A;  4RA8 A;  2B2T A;  1ZKO A;  3P20 A;  4XDX A;  3PO2 B;  5IT9 L;  4BBS H;  3HOW H;  1EIH A;  5CV6 A;  5IGE A;  1N9W A;  4OO1 I;  3N6R A;  2JEB I;  3CPF A;  2L1B A;  3JAM E;  4M1U B;  5FLX E;  4FYD A;  3VYS A;  3IL8 A;  4KHZ A;  3L7Z C;  1QWY A;  4LFC L;  2K75 A;  1IL8 A;  1RKN A;  1PXU A;  1TS5 A;  3L0O A;  4RWS C;  4CJ1 B;  1KHI A;  2Q8I B;  4AYB B;  2FFK B;  5E3F A;  1IBL L;  1SE2 A;  4C1N I;  3W2D A;  1HXY D;  2EJM A;  5JEA G;  4GOP C;  1EIF A;  4GNX B;  2UUA Q;  1SE8 A;  1IBK L;  3HOU G;  1O78 A;  5C4X B;  1DOK A;  3VYU A;  2Q2H A;  4DUY L;  4K5V A;  3NEM A;  5D3I B;  4DAV A;  3T13 A;  2F0L A;  1JE5 A;  5C3W A;  2VQE Q;  4OWX B;  2CH4 W;  3K57 A;  5ELB A;  2PMZ B;  1KDB A;  1X3P A;  4HTH A;  4DXG A;  3PO3 G;  4KD4 A;  3VA5 A;  2F0S A;  1RHP A;  2JA8 H;  3IAY A;  2A68 D;  5ELO A;  3RN2 A;  4IFD I;  2MNA A;  1V1Q A;  3QOJ A;  1FGB D;  4XT3 B;  1SYF A;  3MC0 B;  1EYA A;  2B2U A;  3MWY W;  4A3L H;  3RZO B;  1SMY C;  1PH9 A;  3CCU A;  2K50 A;  5T1I A;  4XQN A;  1PZI D;  2UXB Q;  4OL7 A;  5IP9 H;  3NQT A;  4LF6 Q;  1SYG A;  4IZ8 A;  2RHS B;  1S72 A;  3S1R H;  1A0I A;  1B9N A;  4BA1 I;  3TSS A;  3JC6 6;  1K8M A;  1EYD A;  5EAY A;  4IPG A;  3PIP 3;  2PCF B;  1JWU D;  3NTH A;  2OTL A;  2R7Z G;  2QIL A;  3M7N A;  2LXK A;  4F87 A;  4C3J G;  2I5L X;  4BXX H;  4DR1 Q;  3NP8 A;  2E2I B;  1V1O A;  5E1F A;  4I65 A;  2PO4 A;  2KCC A;  2R93 G;  1WTW A;  1EYC A;  3BG3 A;  3WWV A;  2R7F A;  2FIN B;  3HKS A;  5HUR A;  4KHV A;  2GA4 B;  3HOZ H;  3I4M G;  1CKO A;  2EY6 A;  2WAQ G;  3C1F A;  3I72 A;  4QQB X;  4BY1 G;  2Y0S G;  3AFQ A;  3Q24 A;  4JBW A;  1VQE A;  2J7Z A;  2Z6B A;  3EA6 A;  3FRP B;  2A1A A;  2KJX A;  4OWT B;  3RZD B;  2HDL A;  4BY7 B;  4RMF A;  2AWN A;  1D5X C;  2JJQ A;  4JI0 Q;  4R4O A;  2ICI A;  1FL0 A;  1KC8 C;  4DA2 A;  2HD3 A;  4JI3 Q;  4MNO A;  3H15 A;  2HCC A;  2JA7 G;  4A76 A;  1B1Z A;  4IUR A;  1O7I A;  3H6M A;  1WCM G;  2D2C C;  1IBM L;  3HOX B;  4LF7 Q;  3DUZ A;  2L15 A;  1CZG A;  3TP6 A;  3S15 B;  1R4Q B;  1AFP A;  1JR0 D;  4A3D B;  2HCI A;  2V4D A;  1NTG A;  1FJG L;  4ULL A;  4LFA Q;  4HSP A;  3QJY A;  2LY7 A;  1W6J A;  2HIX A;  1F9S A;  5C3X A;  4A3J G;  4EQ5 A;  2RBM A;  1N34 L;  3H0G H;  3K6O A;  4Y7N H;  1TWG B;  1E0B A;  3LWE A;  1EU3 A;  1YNX A;  3TRZ A;  1R4P B;  2XRS D;  1Z9F A;  1BUV T;  4OON A;  1W6K A;  1UEA B;  4EQO A;  1Q82 C;  4ZKB B;  1PH6 A;  1V1P A;  4KTA A;  1ZYR C;  2SNM A;  1L1O A;  1JQY D;  3KF6 B;  2XN9 C;  3HKZ G;  2K01 A;  1GXD C;  1YNJ C;  4K8I A;  1SSO A;  3J81 i;  4DK1 A;  1VQ6 A;  3N52 A;  2CFM A;  5K36 G;  4KHP L;  2HHH L;  4B3T L;  2NVT B;  4JI5 L;  3PUZ A;  2NB0 A;  5C44 H;  1A3V A;  4A3K H;  3CCE A;  3A8I E;  5EGT A;  1B53 A;  1HR0 L;  3J7Z C;  1CKN B;  3K7U C;  4HMJ A;  1EWI A;  4ME5 A;  3MAQ A;  3VDY A;  5M5Y B;  3W5O A;  3OYY A;  2L4N A;  1KD1 C;  2A69 D;  1VQ9 A;  1VDZ A;  3I4L A;  5BN5 A;  4DV1 L;  5IWA Q;  3K80 C;  2RF4 A;  4DV4 L;  1DZ1 A;  2O5J C;  4IO9 A;  3LWU A;  1JMC A;  2KEN A;  3CQZ B;  2O4X A;  1STE A;  2BDN A;  3Q8D A;  3RMH A;  4J6H A;  2E74 C;  4X3T A;  3OOC A;  2HIV A;  3S1M H;  1WI5 A;  3I73 A;  2EXD A;  1U9R A;  2PW5 A;  1N33 L;  4OO1 H;  1PRT B;  3PV0 A;  3UDX A;  3HOW B;  3R2T A;  1TKW B;  4YWL A;  4O42 A;  3G4S A;  1YI2 A;  3BZK A;  1IYU A;  2EYM A;  2LKV A;  1YNN D;  2MP1 A;  3I90 A;  1EQV A;  2L11 A;  1Y1V H;  2G9D A;  3BJU A;  2MJ8 A;  2K52 A;  1ML0 D;  2EIF A;  5GQO A;  4DR3 Q;  4X65 Q;  5C0X G;  3M4P A;  3STB C;  1STA A;  2DGY A;  4QJF A;  4GOP A;  5EBC A;  4H0L C;  1II3 A;  1BCP C;  2JA5 H;  3SXH A;  1LT6 D;  2LXJ A;  1XJV A;  2FMC A;  1GVP A;  2WKD A;  4RAU C;  5C5M A;  5I4D A;  4WJ4 A;  1MKH A;  4K5X A;  3PO2 G;  5EKL A;  4POG A;  2HQE A;  3DWQ A;  2ZTE A;  3ZYY X;  2I07 B;  5IGD A;  2D9U A;  1C0A A;  5GAG C;  3GTO H;  4QUC A;  1JWM D;  4C3H H;  3AQQ A;  4IFD H;  1UWV A;  3E6Z X;  2JA8 B;  2Z0S A;  2DY7 A;  2HQL A;  1PYW D;  2RKS A;  2HT1 A;  4AYB G;  3R8B A;  4QCL A;  5IGG A;  5IYB H;  4CDE C;  1JE4 A;  2EDG A;  3ERO A;  1JB3 A;  4QGU A;  3U9O A;  4BBR H;  4A4I A;  5I9P A;  2ZM6 Q;  4DNI A;  1WOC A;  4QUF A;  5C4X G;  1BBU A;  2KCT A;  2Z4I A;  2PI2 A;  3AEV A;  2VNU D;  1VQJ A;  4K0K Q;  1B9M A;  4JI8 L;  2JK8 A;  2K5D A;  3T56 B;  1EY0 A;  2EY5 A;  2NVQ H;  1CHP D;  2IPK D;  2ENB A;  3NTI A;  4UDU C;  1DM0 B;  2RSO A;  3C46 A;  3KYH C;  1X9N A;  2A68 C;  3DEO A;  2PNH A;  1KNA A;  3CCR A;  3AB9 A;  1IXR A;  2OWO A;  4HMI A;  1VQF A;  4DUZ L;  3IRB A;  4KKS A;  4H13 C;  2D0O A;  2A5H A;  3HP3 A;  3A8K E;  3SDZ A;  1LLR D;  3HOZ B;  2A6H D;  5M9O A;  4XTC S;  3MXN B;  3CCJ A;  1TS2 A;  3SHL A;  3VR4 A;  5AJ3 Q;  4GLA C;  1BOS A;  2PPB C;  2XVS A;  4NMZ A;  4L8J A;  1AE3 A;  3WOF A;  1NSN S;  3CCM A;  4L5T A;  2G5D A;  3NXW A;  4NP5 A;  3IFT A;  2YTV A;  3TBI B;  3PUX A;  3E3X A;  2C35 B;  2BH8 A;  1TWF H;  2K04 A;  1LTS D;  5HGT A;  2RSN A;  2B2V A;  3KK7 A;  5EBD A;  2F0O A;  1PTO D;  4AQY Q;  2CWA A;  3TP7 A;  2UXD Q;  3BDO A;  4A3B H;  2EYF A;  1Q8K A;  2A6E D;  2OXP A;  4IPH A;  3PIP A;  4A3E G;  1DYQ A;  1LAC A;  4B3R Q;  3LX0 A;  2BOS A;  4CJ2 C;  4L5R C;  1CTM A;  4X66 Q;  3NEN A;  1XTC D;  1GHJ A;  3Q6S A;  1KAA A;  1SJH D;  2QDL A;  3NBH B;  4EQN A;  4A3M H;  4BY7 G;  4MTN A;  3DWA A;  1HNZ Q;  4B9W A;  2K5V A;  1G91 A;  3H0G B;  4Y7N B;  5M5W H;  1Q86 C;  1P8L A;  3RLN A;  1SE4 A;  3EVQ A;  3SVM A;  4KKT A;  3B6Y A;  1K73 C;  2I5M X;  2F4I A;  1BXT A;  2B39 A;  1PV4 A;  1EY5 A;  3I56 A;  4LF5 Q;  1D7Q A;  1PYB A;  2F3V A;  3J7A F;  1HNX L;  1YJW A;  1Y69 U;  2A8V A;  4A3C H;  5JAV A;  4G7H C;  4GNX A;  1EY6 A;  4A3D G;  1J8I A;  5DM6 3;  3T1H Q;  4A3G H;  4H02 A;  1EFI D;  4LF9 Q;  2K7V A;  4OIK A;  4DR5 Q;  1B44 D;  3W3A A;  1PFB A;  3CKI B;  5HY6 A;  5C44 B;  4A3K B;  2CCZ A;  1D5M C;  3I3C A;  1KRS A;  2ZXO A;  3U58 A;  1SN8 A;  4IQZ A;  1I4Q A;  3GTJ H;  1ONL A;  3A74 A;  4JK1 C;  2R7D A;  2ZXR A;  4LF6 L;  2Z8L A;  2NVX H;  4GOP B;  1WD1 A;  3DMU A;  4N9T A;  1HFN A;  1ENC A;  2JE6 I;  2X6G A;  2F3I A;  1H9S B;  1GO3 E;  1IYJ B;  1WTV A;  3TEH B;  1Q90 A;  1KLG D;  2JA6 G;  3C2P A;  3O13 A;  1TVX A;  4DK3 C;  3D3R A;  1SAP A;  3I91 A;  3S1M B;  3HRZ C;  4X3U A;  2XRQ D;  3CCL A;  5I6Y A;  4CKB A;  2Z4H A;  2M00 A;  1T5X D;  1FD7 D;  1PDQ A;  3OTO Q;  1NNX A;  1WD0 A;  4ZQ3 A;  1QVF A;  1EQQ A;  1E7Z A;  2YYZ A;  4DR6 Q;  5LMU Q;  3HOY H;  2A69 C;  3HOV H;  1Y1V B;  2SDF A;  4DV7 Q;  4B3M L;  1K0S A;  4DK0 A;  1Y8O B;  2PYK A;  3BZD B;  1TS3 A;  3VR2 A;  2MPM A;  5J3B A;  5EPK A;  1HRJ A;  2RDF A;  2HUG A;  5KRU A;  1E22 A;  2JA5 B;  1FNU A;  2D62 A;  4PG3 A;  5ELN A;  1JCK B;  1STN A;  4ZCK A;  1CZW A;  3KBG A;  1PRT F;  1QJO A;  1H9M A;  2IX3 A;  1DOM A;  5I2X A;  3D31 A;  2OEO A;  5JJK A;  1MSH A;  4BBS G;  2E75 C;  3GTG H;  2WIN B;  2BA0 A;  3F1Z A;  1EIY B;  4NXN Q;  2YTX A;  1A6X A;  1YNN C;  1DXM A;  1X54 A;  1Y8P B;  3GQB A;  3ULJ A;  2IWH A;  3DEP A;  3GTO B;  3H94 A;  2E8G A;  2IW3 A;  2B2Y C;  3J80 L;  3LGJ A;  4DV3 L;  4C3H B;  1WTR A;  1VQN A;  1O80 A;  3FKI H;  1JOQ A;  1Y1W H;  2R6G A;  1NBW A;  2NZ1 D;  2K5W A;  4K8J A;  4POF A;  4P2C B;  2B8F A;  1NE3 A;  4P73 A;  3W1B A;  2N88 A;  2QF7 A;  2Z6K A;  2KCM A;  4GLV B;  1N32 L;  5M3M G;  2NVT H;  2IY5 B;  1EY7 A;  4BBR B;  3ONA B;  5CV5 A;  1OXT A;  2KVM A;  4X62 L;  5IY0 A;  1PH8 A;  1O7Y A;  5K5P A;  1VQL A;  4ZAI A;  1FR3 A;  3M4O H;  5C4J H;  3F2U A;  2CW0 C;  2FHT A;  4HIO A;  1TXY A;  4RGT A;  2NVQ B;  3G71 A;  3QIA A;  4V0B A;  2KED A;  2F4V Q;  1VF7 A;  4NB3 A;  1HNW Q;  3R3O A;  1FNV A;  2TMP A;  5FK9 C;  2JA8 G;  3G7L A;  2K5N A;  2VXW A;  1IZ6 A;  4LUO A;  4N9P A;  3FPP A;  4OEM B;  3F2B A;  2F0U A;  3M4Q A;  1PLF A;  4KJO A;  2JP1 A;  3CAM A;  1D2B A;  2F0I A;  1L2F A;  5IWA L;  3U4V A;  1MD2 D;  4R4I A;  2H4O A;  1X3E A;  3URY A;  4RFB A;  5IP9 G;  5FO7 B;  5ELD A;  1G2S A;  1KAW A;  4G7O C;  1BF4 A;  2OT2 A;  4LFB Q;  2Z9H A;  3MA2 B;  1JIC A;  1IYV A;  1CKN A;  4KD3 A;  2F0E A;  1FGU A;  4HJ7 A;  1SYE A;  3K5O A;  3OIQ A;  3GV6 A;  3VA7 A;  1TWF B;  4CGY B;  2B3G A;  3ND8 A;  3NWS A;  4K2L A;  4DR2 Q;  4BXX G;  3W1G A;  2BE5 D;  3MVV A;  3KLR A;  1VQK A;  1S5C D;  1EYG A;  4A3B B;  1LT3 D;  1UAP A;  2A6H C;  2KCN A;  2LS0 1;  3WDN A;  1BNZ A;  5LHY 1;  4EQP A;  3HOZ G;  5LMN Q;  1XPO A;  3BVG A;  3V2T A;  4ID6 A;  3CC4 A;  1PFN A;  1Q7Y C;  2ZTD A;  3HG9 A;  5CC4 A;  2XIW A;  2ATW A;  3CCQ A;  4JC0 A;  4A3M B;  4YHH L;  1F9P A;  2EYL A;  3I2Z A;  4GKJ Q;  3D6W A;  4DFA A;  3CC2 A;  5BR8 Q;  5KGU A;  1HCZ A;  1ET6 A;  5M5W B;  4FNF A;  4RCO A;  3J81 j;  4KJN A;  5EKK A;  3CMA A;  2LMC B;  3ER0 A;  1PTO C;  4WOR A;  1QUQ B;  1I6V C;  4J15 A;  5IOC A;  4IOA A;  2J0T D;  1G6P A;  2A6E C;  3UE1 A;  4WRD A;  1ROD A;  2AKW B;  2OTJ A;  5D3D A;  4HID A;  3OPO A;  1X65 A;  1ASZ A;  4DV0 Q;  3J7A V;  4FXG C;  3JAM L;  4FF4 A;  4OIJ A;  5FLX L;  1W2B A;  3BDC A;  3EQL C;  1OXS C;  3FEW X;  4A3G B;  2K1B A;  1WTO A;  4PMW A;  2CHB D;  5KYI A;  2IHE A;  4TSS A;  5A2Q E;  1K9M C;  1H9K A;  3H0G G;  3K7A H;  1RJT A;  2ZM6 L;  3I4O A;  2ALY B;  3CC7 A;  1X3Q A;  3ERQ A;  2NVY H;  2NWG A;  3GTJ B;  2NBF A;  1B4O A;  1BCP B;  2EPB A;  2TSS A;  4JYA Q;  1CSP A;  1S40 A;  2NVX B;  1J6Q A;  1E2W A;  1KL9 A;  1UEB A;  5C5L A;  1JJG A;  2DJG C;  1CT1 D;  1HH2 P;  4JI7 Q;  4DV6 Q;  5JVH 3;  2R92 H;  1GUS A;  4YWK A;  4JV5 Q;  3G6J B;  1WJJ A;  5C0X I;  1U0L A;  4HJ5 A;  1RDP D;  3Q0A A;  4B3S L;  3PQI A;  1PH5 A;  1JT8 A;  3HOU H;  1HZC A;  5BN4 A;  5LMN W;  3BZC A;  3NTK A;  1TQO A;  2VS1 A;  2B29 A;  2OQK A;  5EPJ A;  5C44 G;  4A3K G;  1J5E Q;  4IJL A;  1D6E C;  5CBE E;  3HFZ B;  4JI4 L;  5GRO A;  4LWC A;  3ND9 A;  2F0W A;  2ZJP A;  3MZ5 A;  2O5I C;  2QEJ C;  1PZK D;  4OX9 L;  3HOY B;  4YY3 Q;  3HOV B;  1XPR A;  5DAU A;  4NDX A;  1VF5 C;  1YHQ A;  5FKA C;  4JG2 A;  5FJ8 H;  2YV5 A;  1MI2 A;  1D8L A;  1I4R A;  1PRT D;  3CD6 A;  1M1K C;  1EUJ A;  3MXN A;  3CME A;  2QA4 A;  4YCW A;  1N36 Q;  1P16 A;  1TY2 A;  1KRT A;  3D8G A;  1K0R A;  1SEB D;  5CV4 A;  1MJE A;  2Q8T A;  5ELF A;  4OO1 G;  4QF4 A;  3GTG B;  3PMF A;  1B70 B;  1Q46 A;  1SND A;  3CRL C;  1VQH A;  3C1E A;  1HHV A;  3KLS A;  4CJ0 B;  5IYD H;  1LTB D;  1XX8 A;  1XNR L;  4BS9 A;  1PYS B;  4IN3 A;  1Y1V G;  1EEF D;  3GDE A;  1WFQ A;  2QKI C;  2GN5 A;  3CP0 A;  1HNZ L;  3OWE B;  3OHX C;  2MUY A;  1Y8N B;  3FKI B;  3NSW A;  1UE6 A;  2WB1 E;  1Y1W B;  1AP0 A;  1PA6 A;  1IW7 D;  5EQ0 A;  1MGS A;  2OCE A;  2NTT A;  5HGQ A;  3KOJ A;  1V9P A;  2F0D A;  4GS3 A;  2JA5 G;  1X56 A;  1GHK A;  1VQC A;  3I4M H;  2MGS A;  5D14 A;  1BVS A;  2PZU A;  4X64 L;  3NBH A;  1JJC B;  4ZRZ A;  2LSS A;  4FF1 A;  4KKU A;  5C4J B;  3M4O B;  4HR7 B;  1TY0 A;  4O1N A;  3UI2 A;  2ZXP A;  1DCZ A;  3A54 A;  4HED A;  4IUT A;  4N8F A;  4P74 A;  3T1H L;  4NXM Q;  2VB2 X;  2QGQ A;  3T1Y L;  1LTL A;  4DR7 L;  1B2T A;  2E76 C;  5DM7 3;  4C3H G;  5DEH A;  1Z47 A;  2PZW A;  1E24 A;  3ZJY C;  4JOI A;  1Y14 B;  1HUM A;  5FLM H;  1WCM H;  3S14 H;  1SNC A;  2CH4 A;  3K0X A;  1QE6 A;  3V05 A;  2UXC Q;  5JPM C;  5IYB G;  1U4M A;  2D0P A;  1K3B C;  1TWH H;  1UNS A;  2WP8 J;  3HZX A;  4BBR G;  3A7L A;  1GUN A;  4ZYS A;  2N8N A;  4X3S A;  3KLW A;  1PTO H;  4WJW A;  4IUN A;  3A56 A;  4LF4 L;  2AWO A;  1VQA A;  1KAB A;  3EFX D;  4IFD J;  1C9O A;  1EU4 A;  4LFC Q;  5C3E B;  4V19 0;  5M3F H;  2DUD A;  4CHT B;  1KNE A;  2B2W C;  1WYD A;  1VMC A;  1STG A;  3OTO L;  5JJI A;  4ME3 A;  1IBL Q;  1G29 1;  3ITP A;  4HCE A;  1TII D;  3A5Z B;  1CI3 M;  1H9S A;  1SXT A;  2KOL A;  4DR6 L;  1RF2 D;  5EJW A;  3MFG A;  4JI1 Q;  4UY8 C;  3S1Q H;  4I7A A;  3FPU B;  4R4T A;  1PFS A;  1CK1 A;  1SDF A;  2AQ3 B;  4HN7 A;  4K14 A;  4K5W A;  4P75 A;  2B8G A;  2Z1C A;  1K3R A;  2Y0S E;  4RG1 A;  2KHS A;  4JI2 L;  5EPL A;  1XTD A;  2HDM A;  2ES2 A;  4DV5 Q;  4IPC A;  4KMU C;  3GTM H;  2F03 A;  5CV7 A;  3U9S A;  3S16 B;  3I7F A;  3FDT A;  1H9J A;  3BYT B;  3G6E A;  1EY4 A;  4M8A A;  1CQV A;  2K32 A;  4OXP A;  1A3U A;  1TWC H;  2BE5 C;  2N55 A;  5C4H A;  1TWA H;  1SYC A;  2QDB A;  1TT2 A;  2UUC L;  4LUV A;  2R61 A;  4GKK L;  4JI6 Q;  1NY4 A;  4A3B G;  2KA7 A;  1SLJ A;  4A3I H;  4MN3 A;  3PGZ A;  5KND A;  2GVB A;  1YEZ A;  4JVZ A;  4DKA C;  3U4Z A;  1E2Z A;  1ZXT A;  1A2U A;  2CWP A;  1VQP A;  3NK9 A;  4A3M G;  1PH2 A;  2E2J H;  1LAB A;  3MTS A;  3K7A B;  1IHZ A;  1YJ9 A;  4IOC A;  1S5F D;  2PQA B;  5KEE A;  4DK6 C;  3MFY A;  2NVY B;  1HA6 A;  4DU9 A;  5GAH C;  2MHV A;  2G9H D;  4DV2 L;  3CU7 A;  1SBB B;  4JPB W;  3EN2 A;  2I5H A;  3CCS A;  2F4V L;  1HZ9 A;  2WB1 B;  2EYH A;  3E0J A;  1HNW L;  1PVO A;  5C0X H;  2R92 B;  2IJ0 A;  1NCV A;  3QR8 A;  1S3O A;  3HKZ E;  3OIP A;  2UUB L;  4A3C G;  5AFW A;  1XNQ L;  4A3G G;  1ASY A;  1HFG A;  4PMC A;  2X69 A;  4U68 A;  2K03 A;  2GVA A;  5H1S E;  3HOU B;  2EYO A;  1PHJ A;  5IP7 H;  2YU9 H;  2EY1 A;  4S3S A;  3UDF A;  1BCP F;  3S2H H;  1UUP A;  3J81 c;  1PH7 A;  1LTR D;  1CSQ A;  4P72 A;  5EKI A;  4X3K A;  1IBM Q;  3VYT A;  4EGV A;  2VUM H;  1AZP A;  2QEX A;  5KNB A;  4IPD A;  1AE2 A;  4LFB L;  4LJZ C;  3GD7 A;  1SJE D;  4AH6 A;  4GN3 B;  1FJG Q;  3D4R A;  5GAE C;  4GN4 B;  2F0T A;  4K2K A;  2K28 A;  4IUU A;  2NTS A;  1RCV D;  4DR2 L;  4BA2 I;  4QY7 A;  1N34 Q;  2L9H A;  1N8R C;  3H3V I;  2KHJ A;  4DN4 M;  2UU9 Q;  3U50 C;  2UUA L;  1OXU A;  2NZH A;  4IUV A;  4RKL A;  2NN6 I;  3NUC A;  1SMY D;  1X3G A;  2N3S A;  1ILQ A;  5LMN L;  1F2Y A;  1M4V A;  4ZKC B;  1BBX C;  1EL0 A;  4DF7 A;  1ICW A;  2VQE L;  3HOX G;  3PUW A;  4OHJ A;  1QVC A;  1HPC A;  1SMX A;  3HOY G;  1XWE A;  3HOV G;  2K5H A;  3GO5 A;  1K8A C;  1AEX A;  3QWN A;  4GKJ L;  1SNP A;  4EVO A;  1SE3 A;  5BR8 L;  2F0V A;  3VR6 A;  3BU2 A;  4KY5 A;  5CV8 A;  1WVL A;  2XSC A;  1BDO A;  2DN8 A;  4KHP Q;  1I5F A;  2R93 B;  1GUW A;  4B3T Q;  1STB A;  3HS0 C;  4JI5 Q;  1EZ8 A;  3PSI A;  4K6L A;  1S5E D;  3I4M B;  4WFN 3;  3M4Y A;  4C2M H;  2F52 A;  3TN2 A;  2O2L D;  3GP7 A;  1F2M A;  2Y0S B;  4DV0 L;  1HR0 Q;  2UXB L;  5I9O A;  4TQU S;  2R3Z A;  1O7Z A;  3AYH B;  1G51 A;  4OGQ C;  4CKC A;  3H3V C;  1KTK A;  4TKO B;  2M2L A;  4F7X A;  4DV1 Q;  1QUQ A;  4FDB A;  1A15 A;  4DV4 Q;  1OXV A;  1YBY A;  1IW7 C;  1ET9 A;  2IX1 A;  3FKI G;  1Y1W G;  2JSO A;  3M85 A;  4DR1 L;  4A3F H;  1WCM B;  4AYB E;  3S14 B;  2Q2U A;  2K5Q A;  4JYA L;  2MO1 A;  4A3E H;  2SOB A;  5COR A;  1TWH B;  2A19 A;  1YIJ A;  1N33 Q;  1KXL A;  3CCV A;  4JI7 L;  2AQ1 B;  5NUC A;  2EYP A;  1PTO B;  3EJI A;  3S1N H;  1CFM A;  3AFP A;  3P75 A;  3S2D H;  4R9W A;  4UP7 A;  1RL2 A;  4IUQ A;  4F8M A;  4PZ8 A;  1WTH A;  4UHV A;  2ZJR A;  1QNU A;  5GAD C;  4G7Z C;  3L9A X;  3GTP H;  4KY6 A;  4JI0 L;  5M3F B;  4L5Q A;  1MHW C;  4JI3 L;  2K4K A;  1MSG A;  1A62 A;  4X6A H;  1PMR A;  4G4K A;  4C56 C;  3I55 A;  4LF7 L;  3PF4 A;  1SRO A;  3A5U A;  4YY3 L;  1K28 A;  1PFM A;  3BVM A;  4LF8 Q;  3S1Q B;  1EY8 A;  3HKZ B;  3GTL H;  1K8O A;  3HOW G;  2VY3 A;  3KJO A;  4PV1 C;  4ABN A;  3J80 i;  1Q12 A;  4LFA L;  1YNJ D;  4JW0 A;  1S5B D;  1JC7 A;  1F77 A;  5JJL A;  3GTM B;  3TZD A;  3BVZ A;  4EX5 A;  4RKB A;  3K5M A;  3J7A 5;  1N36 L;  3OWF A;  1I94 Q;  3C3L A;  1BQQ T;  1TWC B;  4PQX A;  2A74 C;  1TWA B;  1X32 A;  2LFN A;  4AIM A;  1KDC A;  2F0P A;  5ELC A;  5D65 A;  4A3I B;  4OEL B;  2D5D A;  2IT1 A;  2JYO A;  3M7G A;  3RUZ A;  2JA9 A;  4JI8 Q;  1L1O C;  2ZT9 C;  2JA6 H;  2L12 A;  2SNS A;  2A73 B;  3R93 A;  1I3Q H;  3H09 A;  4ZUJ A;  3K0Y A;  2IHF A;  2E2J B;  4QMG A;  3NQI A;  1CM9 A;  1WTQ A;  3IFD A;  4DUZ Q;  1JOR A;  1SNO A;  3CPW A;  4J8Q A;  1FYC A;  1JOK A;  5L37 A;  1L0W A;  2B63 H;  1J9O A;  2OF1 A;  4NXM L;  4A3L G;  2F0F A;  4L63 B;  2IX0 A;  3CXC A;  3M3Y H;  3G48 A;  1TS4 A;  2RCN A;  4LK1 C;  5IIF A;  4PMB A;  3S24 A;  4NW2 A;  2F0K A;  1QOH A;  3P1H A;  4B9X A;  2L5T A;  1U4R A;  3PUY A;  1FNW A;  3WOE A;  4HIK A;  3TS2 A;  5C3E H;  2UXC L;  2EE1 A;  3L3O C;  3I4N H;  1BBW A;  1QNK A;  2I46 A;  4UAI A;  2YU9 B;  4C3I H;  3BDL A;  2Q8R E;  1R9T H;  3S2H B;  2AMC B;  5JVG 3;  5CR3 A;  1HTP A;  1LV9 A;  4DNT B;  1AN8 A;  2EYJ A;  4Z9C B;  2VUM B;  3R2I A;  2BH2 A;  1A8V A;  1OTC A;  1CHQ D;  1Q8I A;  2WB1 G;  1YVC A;  5IGC A;  4DR3 L;  4X65 L;  2R92 G;  1QVG A;  1FVI A;  1A2T A;  1D5Z C;  3H3V H;  5M3M H;  3S16 H;  1QCB D;  2NN6 H;  2JEA I;  1AH9 A;  1GOZ A;  1CA6 A;  5IYC H;  3QO2 A;  2DNE A;  4MIU A;  1HQR D;  1EEI D;  5E4X A;  4JI1 L;  3TRE A;  4A93 H;  4HSV A;  2H5X A;  4LMQ D;  2XGT A;  3ULL A;  5IOD A;  1GD7 A;  2PZT A;  3JAM i;  3EBE A;  2EJF C;  4DV5 L;  1ENA A;  1VS0 A;  4RHS A;  4KLK A;  1HNX Q;  4K6D A;  2E5L Q;  3FVQ A;  4KV6 A;  2F3W A;  1HJP A;  2VZA A;  5FJ8 G;  3ICE A;  5JEA J; 
#chains in the Genus database with same CATH homology
 1C48 A;  3SK8 A;  2X6L A;  3MXG A;  1I4X A;  2KEE A;  1LTA D;  1EQT A;  1U4L A;  3VYR A;  4R8N A;  1SYB A;  1Q3L A;  2JXM B;  4C2M B;  3OMG A;  1LTT D;  4L6T B;  2KQ3 A;  2NUC A;  4KN7 C;  3KBX A;  1ILP A;  1G6Z A;  1GUO A;  4YIJ A;  5JEA H;  5KIX A;  4A3F B;  1IKL A;  4A3E B;  1OXX K;  2M9V A;  2K6A A;  5IGB A;  4XT1 B;  1I4P A;  4XQJ A;  3RLF A;  1HA5 A;  4FP5 D;  4Q5V A;  3S1N B;  4DAY A;  1BR9 A;  3S2D B;  5BN3 A;  3TP5 A;  5LL6 X;  3NHH A;  5KNC A;  1S4Z A;  3GTP B;  2RQX A;  2F0G A;  3J81 E;  2F0N A;  1F9Q A;  4RGM A;  5A2Q L;  2WAC A;  4QB4 A;  4RH6 A;  2B2V C;  1M8A A;  1PTO F;  3GTL B;  2EVB A;  1QG7 A;  4B08 A;  2B2Y A;  4PNY A;  5G3L F;  4DXF A;  3OW7 A;  3K5N A;  2BCO A;  2NYZ D;  4IAL A;  3OSO A;  4FXK C;  2ICE C;  2F0M A;  3FMC A;  1PZJ D;  4KY7 A;  5JOB A;  4J1M A;  1ENF A;  4CKE A;  1WTP A;  2AUK A;  4E6I A;  3K59 A;  5J1Z A;  2JA6 B;  1RTO A;  5FOB B;  3E5S A;  3SR1 A;  3BS1 A;  1IKM A;  3SE0 A;  1I3Q B;  3CHB D;  4H7B A;  3V96 A;  3J81 L;  1JWS D;  4IFD G;  3A8J E;  1GUT A;  2CVR A;  2AUJ D;  2RDG A;  4I7Z C;  1OO9 B;  4FF3 A;  1CQF A;  3J7Y W;  1KLU D;  3D6C A;  1NUC A;  2B63 B;  4XXE A;  1ESF A;  1LT5 D;  3A55 A;  5FO9 B;  3M3Y B;  3SK4 A;  1V8Q A;  1I4G A;  1GJX A;  3DXJ C;  3TZU A;  3Q22 A;  4ILW A;  4FXD A;  4KN4 C;  1HTL D;  1BO0 A;  1LT4 D;  3SK5 A;  3I4N B;  2EOT A;  2EJG C;  4BBS B;  1STH A;  1S5D D;  4C3I B;  2DNC A;  3GV3 A;  4Q0F A;  1R9T B;  4ZUI A;  2VB3 X;  2H1E A;  1QB5 D;  5CV9 A;  4IUP A;  2XNA C;  1EIG A;  2EXZ A;  5DNF A;  5C4Z A;  1MBY A;  2F0J A;  1ZEQ X;  2EZV A;  1VCI A;  3NPP A;  3X3M A;  4LAA A;  5K36 H;  3DWP A;  3PUV A;  1RD9 D;  5M3M B;  1B50 A;  3A7A B;  1B3A A;  4TRD A;  3OMC A;  3TP8 A;  3QG1 A;  1QIL A;  3MEH A;  4A93 B;  1F9R A;  5KYL A;  3X3N A;  3TDQ A;  4QIW B;  1G2T A;  2CW0 D;  1Z6H A;  3LNN A;  5E4W C;  4DAP A;  5C0X J;  5CMD A;  3D4W A;  1O7L A;  3T53 B;  4H44 C;  1SNQ A;  4F88 A;  1SFO B;  4XYQ A;  3VR5 A;  1NR2 A;  3GTQ B;  2SEB D;  3SK6 A;  2KUM A;  1DD2 A;  5LL6 S;  3S1R B;  1H9R A;  3KUP A;  1L0X B;  3AMU A;  1EOT A;  1L0Y B;  3BYY B;  1Z7T A;  1T5E A;  1C8C A;  2EY2 A;  3HGB A;  1V43 A;  5CGK A;  4RHR A;  5A35 A;  5COY A;  1RTN A;  1SYD A;  2RVL A;  5F2D A;  3MXP A;  2QCP X;  2B2T C;  1XYI A;  2BA1 A;  3T51 B;  4RGN A;  2PW7 A;  3PO3 B;  2KEC A;  1V1P B;  1F2L A;  2L0C A;  1STY A;  1U4P A;  4XIG S;  1NR4 A;  4ZK9 B;  2WKC A;  1XXG A;  2BDO A;  2AQ2 B;  4FVM A;  5G3L D;  1I4H A;  4HAE A;  3PIO 3;  5JPN C;  1HUN A;  4XQQ A;  4DNR B;  1D1K A;  5M5X B;  3S17 B;  5I6W A;  1I50 B;  4R8I A;  1LO5 D;  5J22 A;  2R7Z B;  1PRT C;  3I8Z A;  4C3J B;  5J39 A;  1A3T A;  3S9W A;  1SNM A;  1C4Q A;  2E2D C;  2PNR C;  4NKL A;  4C1N K;  2WAQ B;  2XWB B;  4BY1 B;  2B2U C;  3K5L A;  1G8Z D;  4FO2 A;  1Q1B A;  1VMP A;  4KI0 A;  3VR3 A;  1NAP A;  4BWG B;  2WV6 D;  3AU7 A;  3NBI A;  2C5C A;  4CBV A;  3T16 A;  1GUG A;  1EWC A;  2JA7 B;  1E2V A;  5IGF A;  2F0Q A;  3NE5 B;  2K05 A;  2DY8 A;  5I2Y A;  4ODG A;  1LTG D;  4MHE A;  4ZLT F;  2XWJ B;  2PQE A;  3J80 E;  2L55 A;  2B2W A;  4A3J B;  2ID0 A;  3DHQ A;  3MHB A;  3K58 A;  2J4X A;  1AW7 A;  5ISR A;  4DGZ A;  1D1I A;  2FJ2 A;  1K83 B;  4HCS A;  3CRK C;  4GZY C;  3D4D A;  4U67 3;  1ZYR D;  1DON A;  4KK7 A;  3HEJ A;  2IL8 A;  1LTI D;  3NWT A;  1DOL A;  1EY9 A;  1DJR D;  1Q1E A;  3SEB A;  5IT9 E;  4RGO S;  4C3I G;  3Q23 A;  1CA5 A;  1WTX A;  5ELE A;  1EZ6 A;  1I6H B;  2C9O A;  2WII B;  3DM1 A;  3MXU A;  4XYO A;  5T1G A;  1EWH A;  5C6A A;  3RD4 A;  2RDH A;  1JOO A;  4G57 A;  1TU2 B;  5JJZ A;  2F1M A;  2NN6 G;  1AZQ A;  1KDA A;  3QOL A;  4RCN A;  3P7J A;  3IKJ A;  2CQA A;  3TME A;  1F2Z A;  3H91 A;  5CYU A;  3GTK B;  4FF2 A;  1HQM C;  2FMM A;  2E2H B;  3QB3 A;  3I70 A;  1ESR A;  3KF8 A;  5FO8 B;  5CBA E;  1TR5 A;  3KLS X;  3T4A C;  5TSS A;  1BCP D;  2K33 A;  2RA4 A;  2F0H A;  4RA8 A;  4XDX A;  1ZKO A;  2B2T A;  3P20 A;  3PO2 B;  5IT9 L;  1EIH A;  5CV6 A;  5IGE A;  4OO1 I;  3N6R A;  2JEB I;  2L1B A;  3JAM E;  4M1U B;  5FLX E;  4FYD A;  3VYS A;  3IL8 A;  4KHZ A;  3L7Z C;  1QWY A;  1IL8 A;  1RKN A;  1PXU A;  1TS5 A;  4RWS C;  4CJ1 B;  2Q8I B;  4AYB B;  2FFK B;  5E3F A;  1SE2 A;  4C1N I;  3W2D A;  1HXY D;  2EJM A;  5JEA G;  1O78 A;  5C4X B;  1DOK A;  3VYU A;  4K5V A;  5D3I B;  4DAV A;  3T13 A;  2F0L A;  5C3W A;  3K57 A;  5ELB A;  2PMZ B;  1KDB A;  1X3P A;  4HTH A;  4DXG A;  4KD4 A;  3VA5 A;  2F0S A;  1RHP A;  3IAY A;  2A68 D;  4IFD I;  3QOJ A;  1FGB D;  4XT3 B;  1SYF A;  3MC0 B;  1EYA A;  2B2U A;  3MWY W;  3RZO B;  1SMY C;  5T1I A;  4XQN A;  1PZI D;  4OL7 A;  3NQT A;  1SYG A;  4IZ8 A;  1B9N A;  4BA1 I;  3TSS A;  1K8M A;  1EYD A;  3PIP 3;  2PCF B;  1JWU D;  3NTH A;  2QIL A;  3M7N A;  4F87 A;  4C3J G;  3NP8 A;  2E2I B;  1V1O A;  5E1F A;  4I65 A;  2PO4 A;  2KCC A;  1WTW A;  1EYC A;  3BG3 A;  2FIN B;  5HUR A;  4KHV A;  2GA4 B;  2EY6 A;  3C1F A;  3I72 A;  3Q24 A;  4JBW A;  2J7Z A;  3FRP B;  3EA6 A;  2KJX A;  3RZD B;  4BY7 B;  2HDL A;  2AWN A;  1D5X C;  2ICI A;  4DA2 A;  2HCC A;  1B1Z A;  4IUR A;  3H6M A;  2D2C C;  3HOX B;  3DUZ A;  1CZG A;  3TP6 A;  3S15 B;  1R4Q B;  1AFP A;  1JR0 D;  4A3D B;  2HCI A;  2V4D A;  4ULL A;  4HSP A;  3QJY A;  2LY7 A;  1W6J A;  1F9S A;  5C3X A;  2RBM A;  3K6O A;  1TWG B;  1E0B A;  3LWE A;  1EU3 A;  1R4P B;  2XRS D;  1BUV T;  1W6K A;  1UEA B;  4EQO A;  4ZKB B;  1V1P A;  4KTA A;  1ZYR C;  2SNM A;  1JQY D;  2XN9 C;  2K01 A;  1GXD C;  1YNJ C;  4K8I A;  1SSO A;  4DK1 A;  3N52 A;  5K36 G;  2NVT B;  3PUZ A;  2NB0 A;  1A3V A;  3A8I E;  5EGT A;  1B53 A;  4HMJ A;  4ME5 A;  3MAQ A;  5M5Y B;  2L4N A;  2A69 D;  1VDZ A;  3I4L A;  5BN5 A;  1DZ1 A;  2O5J C;  3LWU A;  3CQZ B;  2O4X A;  1STE A;  2BDN A;  3RMH A;  4J6H A;  2E74 C;  4X3T A;  3OOC A;  3I73 A;  1U9R A;  2PW5 A;  4OO1 H;  1PRT B;  3PV0 A;  3HOW B;  3R2T A;  1TKW B;  4O42 A;  1IYU A;  2EYM A;  2LKV A;  1YNN D;  2MP1 A;  3I90 A;  1EQV A;  2L11 A;  2G9D A;  2MJ8 A;  1ML0 D;  5C0X G;  1STA A;  5EBC A;  4H0L C;  1II3 A;  1BCP C;  3SXH A;  1LT6 D;  2FMC A;  2WKD A;  4RAU C;  5C5M A;  5I4D A;  4K5X A;  5EKL A;  2HQE A;  3DWQ A;  3ZYY X;  2I07 B;  5IGD A;  2D9U A;  4QUC A;  1JWM D;  4IFD H;  3E6Z X;  2JA8 B;  2DY7 A;  1PYW D;  2RKS A;  3R8B A;  4QCL A;  5IGG A;  1JE4 A;  2EDG A;  3ERO A;  1JB3 A;  3U9O A;  5I9P A;  4QUF A;  2Z4I A;  2VNU D;  1B9M A;  2K5D A;  3T56 B;  1EY0 A;  2EY5 A;  1CHP D;  2IPK D;  2ENB A;  3NTI A;  4UDU C;  1DM0 B;  2RSO A;  3C46 A;  2A68 C;  3DEO A;  1KNA A;  3AB9 A;  4HMI A;  4KKS A;  4H13 C;  2A5H A;  3HP3 A;  3A8K E;  3SDZ A;  1LLR D;  3HOZ B;  2A6H D;  5M9O A;  4XTC S;  1TS2 A;  3SHL A;  3VR4 A;  1BOS A;  2PPB C;  2XVS A;  4NMZ A;  4L8J A;  3WOF A;  1NSN S;  3NXW A;  4NP5 A;  3IFT A;  3TBI B;  3PUX A;  2K04 A;  1LTS D;  5HGT A;  2RSN A;  2B2V A;  3KK7 A;  5EBD A;  2F0O A;  1PTO D;  3TP7 A;  3BDO A;  2EYF A;  2A6E D;  2OXP A;  1DYQ A;  1LAC A;  3LX0 A;  2BOS A;  4CJ2 C;  1CTM A;  1XTC D;  1GHJ A;  3Q6S A;  1KAA A;  1SJH D;  4EQN A;  3DWA A;  4B9W A;  1G91 A;  3H0G B;  4Y7N B;  1SE4 A;  3EVQ A;  3SVM A;  4KKT A;  2F4I A;  1BXT A;  2B39 A;  1EY5 A;  2F3V A;  3J7A F;  1Y69 U;  5JAV A;  4G7H C;  1EY6 A;  1J8I A;  5DM6 3;  1EFI D;  2K7V A;  4OIK A;  1B44 D;  3W3A A;  1PFB A;  3CKI B;  5C44 B;  4A3K B;  1D5M C;  3I3C A;  2ZXO A;  4IQZ A;  1I4Q A;  1ONL A;  4JK1 C;  2ZXR A;  2Z8L A;  1WD1 A;  3DMU A;  4N9T A;  1HFN A;  1ENC A;  2JE6 I;  2X6G A;  1H9S B;  1WTV A;  1Q90 A;  1KLG D;  3C2P A;  3O13 A;  1TVX A;  3D3R A;  1SAP A;  3I91 A;  3S1M B;  3HRZ C;  4X3U A;  2XRQ D;  5I6Y A;  4CKB A;  2Z4H A;  2M00 A;  1T5X D;  1FD7 D;  1PDQ A;  1WD0 A;  4ZQ3 A;  2YYZ A;  2A69 C;  1Y1V B;  2SDF A;  4DK0 A;  1Y8O B;  2PYK A;  3BZD B;  1TS3 A;  3VR2 A;  2MPM A;  5EPK A;  1HRJ A;  2RDF A;  2HUG A;  5KRU A;  2JA5 B;  1FNU A;  2D62 A;  1JCK B;  1STN A;  1CZW A;  3KBG A;  1PRT F;  1QJO A;  1H9M A;  2IX3 A;  1DOM A;  5I2X A;  3D31 A;  2OEO A;  1MSH A;  2E75 C;  2WIN B;  2BA0 A;  1A6X A;  1YNN C;  1DXM A;  1Y8P B;  3GQB A;  2IWH A;  3DEP A;  3GTO B;  3H94 A;  2IW3 A;  2B2Y C;  3J80 L;  4C3H B;  1WTR A;  1O80 A;  1JOQ A;  2R6G A;  2NZ1 D;  2K5W A;  4K8J A;  4P2C B;  2B8F A;  2N88 A;  2QF7 A;  1EY7 A;  4BBR B;  3ONA B;  5CV5 A;  1OXT A;  2KVM A;  1O7Y A;  5K5P A;  4ZAI A;  1FR3 A;  3F2U A;  2CW0 C;  2FHT A;  4RGT A;  2NVQ B;  3QIA A;  4V0B A;  2KED A;  1VF7 A;  3R3O A;  1FNV A;  2TMP A;  5FK9 C;  3G7L A;  2VXW A;  4N9P A;  3FPP A;  2F0U A;  1PLF A;  4KJO A;  2JP1 A;  1D2B A;  2F0I A;  1MD2 D;  2H4O A;  3URY A;  4RFB A;  5FO7 B;  5ELD A;  1G2S A;  4G7O C;  1BF4 A;  2OT2 A;  3MA2 B;  1JIC A;  1IYV A;  4KD3 A;  2F0E A;  1SYE A;  3K5O A;  3OIQ A;  3GV6 A;  3VA7 A;  1TWF B;  4CGY B;  3ND8 A;  3NWS A;  4K2L A;  2BE5 D;  3MVV A;  3KLR A;  1S5C D;  4A3B B;  1LT3 D;  1UAP A;  2A6H C;  2KCN A;  2LS0 1;  3WDN A;  1BNZ A;  5LHY 1;  4EQP A;  3BVG A;  3V2T A;  4ID6 A;  1PFN A;  5CC4 A;  3HG9 A;  2XIW A;  4A3M B;  1F9P A;  2EYL A;  3D6W A;  4DFA A;  5KGU A;  1HCZ A;  1ET6 A;  5M5W B;  4FNF A;  4RCO A;  4KJN A;  5EKK A;  2LMC B;  1PTO C;  4WOR A;  1I6V C;  5IOC A;  2J0T D;  2A6E C;  4WRD A;  1ROD A;  5D3D A;  3OPO A;  3J7A V;  4FXG C;  3JAM L;  4FF4 A;  4OIJ A;  5FLX L;  3BDC A;  3EQL C;  1OXS C;  3FEW X;  4A3G B;  2K1B A;  1WTO A;  4PMW A;  2CHB D;  5KYI A;  4TSS A;  5A2Q E;  1H9K A;  1RJT A;  1X3Q A;  3ERQ A;  2NWG A;  3GTJ B;  2NBF A;  1B4O A;  1BCP B;  2EPB A;  2TSS A;  2NVX B;  1E2W A;  5C5L A;  1CT1 D;  5JVH 3;  1GUS A;  3G6J B;  5C0X I;  1RDP D;  3Q0A A;  5BN4 A;  3NTK A;  1TQO A;  5EPJ A;  1D6E C;  5CBE E;  3ND9 A;  2F0W A;  3MZ5 A;  2O5I C;  2QEJ C;  1PZK D;  3HOY B;  3HOV B;  5DAU A;  4NDX A;  1VF5 C;  5FKA C;  1MI2 A;  1I4R A;  1PRT D;  3MXN A;  1TY2 A;  3D8G A;  1SEB D;  5CV4 A;  2Q8T A;  5ELF A;  4OO1 G;  4QF4 A;  3GTG B;  3PMF A;  1SND A;  3CRL C;  3C1E A;  1HHV A;  3KLS A;  4CJ0 B;  1LTB D;  1XX8 A;  4BS9 A;  4IN3 A;  1EEF D;  2QKI C;  3OWE B;  3OHX C;  2MUY A;  1Y8N B;  3FKI B;  3NSW A;  1Y1W B;  1AP0 A;  1IW7 D;  5EQ0 A;  1MGS A;  2NTT A;  2F0D A;  1GHK A;  2MGS A;  5D14 A;  2PZU A;  3NBH A;  4ZRZ A;  4FF1 A;  4KKU A;  5C4J B;  3M4O B;  4HR7 B;  3UI2 A;  1TY0 A;  4O1N A;  2ZXP A;  1DCZ A;  3A54 A;  4HED A;  4IUT A;  2VB2 X;  1B2T A;  2E76 C;  5DM7 3;  4C3H G;  5DEH A;  1Z47 A;  2PZW A;  1HUM A;  1SNC A;  1QE6 A;  3V05 A;  5JPM C;  1U4M A;  1UNS A;  2WP8 J;  3HZX A;  3A7L A;  1GUN A;  4ZYS A;  4X3S A;  1PTO H;  4WJW A;  4IUN A;  3A56 A;  2AWO A;  1KAB A;  3EFX D;  4IFD J;  1EU4 A;  5C3E B;  4V19 0;  4CHT B;  1KNE A;  2B2W C;  1VMC A;  1STG A;  1G29 1;  3ITP A;  4HCE A;  1TII D;  1CI3 M;  1H9S A;  1SXT A;  2KOL A;  1RF2 D;  5EJW A;  3MFG A;  3FPU B;  1SDF A;  1CK1 A;  2AQ3 B;  4HN7 A;  4K14 A;  4K5W A;  2B8G A;  2Z1C A;  2KHS A;  5EPL A;  2HDM A;  4KMU C;  2F03 A;  5CV7 A;  3U9S A;  3S16 B;  3FDT A;  1H9J A;  3BYT B;  1EY4 A;  4M8A A;  1CQV A;  2K32 A;  1A3U A;  2BE5 C;  2N55 A;  5C4H A;  1SYC A;  2QDB A;  1TT2 A;  2R61 A;  2KA7 A;  4MN3 A;  5KND A;  1E2Z A;  1ZXT A;  1A2U A;  3NK9 A;  1LAB A;  3MTS A;  3K7A B;  1IHZ A;  1S5F D;  5KEE A;  3MFY A;  2NVY B;  1HA6 A;  4DU9 A;  2MHV A;  2G9H D;  3CU7 A;  1SBB B;  2WB1 B;  2EYH A;  3E0J A;  5C0X H;  2R92 B;  2IJ0 A;  1NCV A;  3OIP A;  5AFW A;  1HFG A;  4PMC A;  2X69 A;  4U68 A;  2K03 A;  3HOU B;  2EYO A;  2EY1 A;  4S3S A;  1BCP F;  1UUP A;  1LTR D;  5EKI A;  4X3K A;  3VYT A;  4EGV A;  1AZP A;  5KNB A;  4LJZ C;  3GD7 A;  1SJE D;  3D4R A;  2F0T A;  4K2K A;  2K28 A;  4IUU A;  2NTS A;  1RCV D;  4BA2 I;  2L9H A;  4DN4 M;  1OXU A;  4RKL A;  4IUV A;  2NN6 I;  3NUC A;  1SMY D;  1ILQ A;  1F2Y A;  1M4V A;  4ZKC B;  1BBX C;  1EL0 A;  4DF7 A;  1ICW A;  3PUW A;  4OHJ A;  1HPC A;  1XWE A;  3GO5 A;  1AEX A;  3QWN A;  1SNP A;  4EVO A;  1SE3 A;  2F0V A;  3VR6 A;  5CV8 A;  4KY5 A;  1WVL A;  2XSC A;  1BDO A;  2DN8 A;  2R93 B;  1GUW A;  1STB A;  3HS0 C;  1EZ8 A;  4K6L A;  1S5E D;  3I4M B;  4WFN 3;  3M4Y A;  3TN2 A;  2O2L D;  3GP7 A;  1F2M A;  2Y0S B;  5I9O A;  4TQU S;  2R3Z A;  1O7Z A;  4OGQ C;  4CKC A;  3H3V C;  1KTK A;  4TKO B;  2M2L A;  4F7X A;  1A15 A;  1OXV A;  1IW7 C;  1ET9 A;  2IX1 A;  2JSO A;  3M85 A;  1WCM B;  3S14 B;  2K5Q A;  2SOB A;  5COR A;  1TWH B;  2AQ1 B;  5NUC A;  2EYP A;  1PTO B;  3EJI A;  1CFM A;  3P75 A;  4R9W A;  4IUQ A;  4F8M A;  1QNU A;  4G7Z C;  3L9A X;  4KY6 A;  5M3F B;  1MSG A;  1PMR A;  4G4K A;  4C56 C;  1PFM A;  3BVM A;  3S1Q B;  1EY8 A;  3HKZ B;  1K8O A;  4PV1 C;  4ABN A;  1Q12 A;  1YNJ D;  1S5B D;  1JC7 A;  1F77 A;  3GTM B;  3TZD A;  3BVZ A;  4RKB A;  3K5M A;  3OWF A;  3C3L A;  1BQQ T;  1TWC B;  4PQX A;  2A74 C;  1TWA B;  1X32 A;  2LFN A;  1KDC A;  2F0P A;  5ELC A;  5D65 A;  4A3I B;  2D5D A;  2IT1 A;  2JYO A;  3M7G A;  3RUZ A;  2ZT9 C;  2L12 A;  2SNS A;  2A73 B;  3R93 A;  3H09 A;  4ZUJ A;  3K0Y A;  2E2J B;  4QMG A;  3NQI A;  1CM9 A;  1WTQ A;  3IFD A;  1JOR A;  1SNO A;  4J8Q A;  1FYC A;  1JOK A;  1J9O A;  2OF1 A;  2F0F A;  4L63 B;  2IX0 A;  1TS4 A;  4LK1 C;  5IIF A;  4PMB A;  4NW2 A;  2F0K A;  1QOH A;  3P1H A;  4B9X A;  2L5T A;  1U4R A;  3PUY A;  1FNW A;  3WOE A;  2EE1 A;  3L3O C;  1QNK A;  2I46 A;  4UAI A;  2YU9 B;  3BDL A;  2Q8R E;  3S2H B;  5JVG 3;  5CR3 A;  1HTP A;  1LV9 A;  4DNT B;  1AN8 A;  2EYJ A;  4Z9C B;  2VUM B;  3R2I A;  1CHQ D;  1Q8I A;  5IGC A;  1A2T A;  1D5Z C;  1QCB D;  2NN6 H;  2JEA I;  1GOZ A;  1CA6 A;  3QO2 A;  2DNE A;  4MIU A;  1HQR D;  1EEI D;  5E4X A;  4HSV A;  4LMQ D;  5IOD A;  2PZT A;  2EJF C;  1ENA A;  4RHS A;  4K6D A;  3FVQ A;  4KV6 A;  2F3W A;  5JEA J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...