3CRKC

Crystal structure of the pdhk2-l2 complex.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
87
structure length
86
Chain Sequence
SYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional insights into the molecular mechanisms responsible for the regulation of pyruvate dehydrogenase kinase 2.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Pyruvate dehydrogenase [lipoamide] kinase isozyme 2, mitocho
total genus 12
structure length 86
sequence length 87
chains with identical sequence D
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2008-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3crkC00
2A69D 3GD7A 2O5IC 1H9SB 2LMCB 2BE5D 3LNNA 2BA0A 2F1MA 5KNBA 3N6RA 3OW7A 1GUSA 3U9SA 4G7HC 3OOCA 1OXVA 3NE5B 3M7NA 2A6HC 1GUNA 3I73A 4KKTA 2CW0C 1QJOA 2EJMA 1IYVA 3VR4A 2K32A 3D4RA 4H44C 5KNCA 3FPPA 3M85A 1B9MA 4KKUA 3IKJA 2R6GA 4TQUS 1GUGA 4LK1C 2JEBI 1OXSC 4DNRB 1TKWB 5JEAH 5C0XH 1FR3A 1H9JA 1DCZA 1Z7TA 5JEAG 2JE6I 5BN5A 2A68D 5C0XG 3QJYA 1YNNC 1T5EA 1IYUA 1H9KA 3BG3A 3CRKC 1ONLA 3MFYA 2NN6G 2NN6I 4I7ZC 3AB9A 1LABA 3A7AB 3VR6A 3I4LA 4LJZC 3WDNA 1EWHA 1E2ZA 2ZT9C 3IFTA 4KKSA 4XIGS 3A8JE 1BDOA 3TZUA 4DK1A 1V8QA 1Y8OB 2A68C 2K7VA 3H94A 3PUVA 3ND9A 5BN4A 2DN8A 2QF7A 1H9SA 1VDZA 3A8KE 4OGQC 1GHKA 1Y8NB 2B8GA 4KI0A 2A6ED 2KCCA 1Y8PB 1CTMA 2EVBA 4BA1I 2BDOA 4GZYC 4OO1H 1A6XA 5K36G 2JXMB 4IFDH 4KMUC 3T53B 2DNCA 4KHZA 3DXJC 1VF7A 2AUJD 1TU2B 3A7LA 3PUZA 1H9MA 1OXTA 3LWUA 1Q12A 3W3AA 2DNEA 3VR5A 5BN3A 3HGBA 5KNDA 5K36H 1K8OA 1IW7D 1I6VC 1Z6HA 3A8IE 1E2WA 2PCFB 2V4DA 4IQZA 3ND8A 3QIAA 1SMYC 3MXUA 3I72A 4KN4C 1Q1BA 3T51B 1OXXK 3PUYA 2EDGA 1H9RA 3EQLC 3VR3A 2A69C 1Q1EA 4OO1G 2JEAI 4DNTB 1G291 1V43A 4JBWA 1CI3M 2EJGC 1HCZA 3QG1A 2D62A 4DK0A 3PUXA 3PV0A 2B8FA 1GJXA 1DXMA 1ZYRC 1K8MA 1O78A 1HPCA 1GUOA 3T56B 1ZKOA 1Y69U 2K33A 1O7LA 1GHJA 3BDOA 1IW7C 2L5TA 2KA7A 3D31A 4HR7B 4JK1C 4L8JA 4XTCS 4KN7C 3VR2A 2BE5C 3M4YA 2E76C 2AWOA 2A6EC 3P20A 3KLRA 3SDZA 1E2VA 4G7ZC 2E74C 1DD2A 3GQBA 2BA1A 1CFMA 4H13C 4BA2I 1LACA 1B9NA 1OXUA 1Q90A 4PV1C 1VF5C 3OPOA 2E75C 2YYZA 3RLFA 3L7ZC 5A35A 4G7OC 2NN6H 2EJFC 2PNRC 3PUWA 2IT1A 1VCIA 2PPBC 1YNJC 4RCNA 3FMCA 3VA7A 1FYCA 4H0LC 3SE0A 4IFDG 1GUTA 2O5JC 3CRLC 2AUKA 2A6HD 1HTPA 2D5DA 1HQMC 4TKOB 2D2CC 2Q8IB 1PMRA
chains in the Genus database with same CATH superfamily
2X6LA 1PHJA 1K8AC 2N8NA 4UY8C 4LF6L 4C3JG 2F0IA 2K4KA 1E22A 4DR1Q 2F0JA 4IALA 1N34Q 2JP1A 3I7FA 1ET6A 4KTAA 4A75A 2ZTEA 5C4XG 3T4AC 2R6GA 2E8GA 4GN4B 4KY7A 4LFBQ 4LK1C 1E1OA 1DCZA 1SNCA 4QF4A 4QUFA 4BBSG 3MEHA 3BZKA 4FF1A 4C1NK 1N8RC 2WP8J 2VUMG 3VR6A 2EOTA 2PI2E 2VZAA 4JI8L 5JJLA 1PTOC 3W5OA 4ULLA 2KOLA 1IKMA 3ICEA 3FKIG 4A93H 1D7QA 3V96A 3HRZC 1N36L 1LTRD 4O0AA 3MXNB 1I4XA 1CHPD 4IO9A 1A6XA 2WFWA 2AUJD 2JA6B 4MZ9A 2HHHQ 2CH4A 1D1IA 5CGKA 1L1OA 2NYZD 3OYYA 4OIKA 1B4OA 4YWMA 4HMIA 2WKCA 1Y1WG 5ELCA 2F3VA 3RLNA 4POFA 1BBXC 1RODA 1PYWD 5C0XI 4YWLA 4DNTB 3AMUA 5C3XA 1RDPD 4I65A 3R2IA 3CMAA 5HURA 4WRDA 2YTVA 4OXPA 1CHQD 3NBHA 1DXMA 3BVZA 4DR5L 4A3MB 2E2IB 1GUOA 1EY5A 4A3MH 5M5WH 5T1IA 4KN7C 2A74C 5M5WB 1I50B 4P74A 2WACA 1JMCA 2XRQD 3BZCA 3FPUB 1EYGA 1WTXA 3HOZH 2IY5B 4XYQA 4DR7L 3CU7A 4M8AA 1DOMA 2EYJA 5NUCA 4DR2Q 1ASZA 3GTJH 2WINB 1HA5A 3KJOA 5I6YA 2K5QA 1BCPF 1GUTA 4K0KL 2PW5A 4ZCKA 3SE0A 5C44B 3F2BA 1V1OA 4FP5D 4MHEA 1Y1VB 1IL2A 1SRUA 3DM3A 1XJVA 3HOZG 5IE8A 4KKTA 5J3BA 4GLVB 3ULPA 4H44C 3J7ZC 3HOYG 1JWSD 4CBVA 4MN3A 3RN2A 2LY7A 4LF5Q 1C0AA 4P2CB 1SE8A 2RDGA 1T9HA 1KL9A 2F0EA 2WB1E 2K50A 1EU3A 4RG1A 2NVQH 3KUPA 1JWMD 1F77A 2VQFQ 2HCCA 2EZVA 2MUYA 1BDOA 3KBGA 3PIPA 3FRPB 4DR5Q 4QIWE 2N55A 1S5CD 3A5ZB 4UHVA 4LF6Q 3S1QB 2VL6A 2KENA 1VF7A 5JPNC 4LF8L 4IPHA 4IURA 2Z6KC 5BN3A 4QCLA 3R93A 1K8OA 1HTLD 3I90A 1Z6HA 3ZYYX 2R92H 2PCFB 2OTJA 4H7BA 5IGFA 5IWAQ 1TWHB 4DV2Q 2AKWB 2MO1A 2BDNA 2NVXH 4Z9CB 4FO2A 2JK8A 1TVXA 4OIJA 2XNAC 1GKHA 1D5ZC 3PO2H 3CQZB 1XTCD 2M00A 3G7LA 4LF7Q 2K5WA 1TY0A 3HOVG 1YEZA 2B8FA 4IUQA 4UDUC 4NDXA 4X3UA 4FXKC 3VYRA 4DUZL 4ZUJA 4FF4A 2UUBL 3BDOA 1S5FD 3D31A 1IBLL 2OT2A 5KEEA 4BY1G 2UUAL 4V0BA 4G7ZC 3A54A 4OX9Q 3S1NB 4JI4L 4RKLA 3I91A 5E3FA 1B9NA 5EKIA 1XX8A 5M3MH 1C48A 1SYDA 4P71A 3OWFA 3C2PA 1EY7A 3OW2A 2ID0A 5FLXE 3PQIA 1SNQA 2R92B 2NZ1D 3MC0B 1TWHH 4CJ0B 4A3BG 1SFOH 4JI2L 1NUCA 4XT3B 1HXYD 4C3HG 5IT9E 1PZKD 3NXWA 1SDFA 1B50A 2C5CA 4QIWB 1YZ6A 2C9OA 3OIPA 3RN5A 4GKJL 5J22A 4QGUA 2B2VC 4O2DA 2VQFL 4X3TA 3CD6A 1BQQT 1B8AA 1WD0A 4GOPA 3W1BA 2XGTA 2Z1CA 4GNXA 5C0XH 1VQ8A 2HDLA 2F0TA 3WOEA 1VQPA 2B2YA 1KIXA 3KOJA 4NPSA 1A8VA 1NBWA 2K1BA 1LABA 4A3CH 2AQ3B 5ELEA 5IP7G 1LV9A 3CPWA 2ZT9C 4KKSA 5M3MB 3L2PA 3A8JE 1K0RA 2CCZA 4HJAA 5FLMH 2MJ8A 2F0FA 3S16H 3K80C 4JBJA 2WAQE 1S3OA 2A6ED 2KCCA 1CTMA 4GZYC 3GTQH 2BH2A 4L5RC 1Q3LA 2EY5A 1VS0A 2F0WA 3TN2A 1D5XC 1PDQA 2JA7H 3A7LA 1VQ6A 2PZUA 2IX3A 4Y52H 2L12A 1KXLA 3VA5A 1I94L 4IOCA 2WB1G 3K0YA 4G4KA 4KV6A 2UUCQ 3C46A 2R7FA 1UE1A 1Q1EA 2VUMH 2B2TC 4JI2Q 1TT2A 4HJ5A 3FP9A 4BBRH 1KNAA 1HCZA 3PO3B 2F0GA 4GN5A 4C3IB 1SNPA 1ILPA 4ZLTF 1DJRD 3DHQA 1MJCA 3ULJA 1EYAA 5M3FH 1IW7C 2QCPX 4PMWA 2X69A 1RL2A 3UE0A 3NHHA 4FDBA 3G6JB 3DWAA 1DD2A 4FNFA 1CA6A 1Q90A 1S5ED 3U50C 4L5TA 3U4VA 1PH4A 2E75C 3CCEA 5A35A 3HOWG 1SSOA 1WCMB 2PPBC 3MTSA 3VYSA 1RCVD 4A76A 2R93G 5C5LA 2ICIA 3T13A 5FO8B 2V1CC 1XMQQ 2RHSB 3QOJA 3ERSX 1RTOA 3TP7A 4LF9Q 1FJGL 5KNBA 1ENCA 2H5XA 1IBKQ 1A63A 1KNEA 1NSNS 5C3EG 1IYVA 4ME3A 1SE4A 1SYCA 1I50H 1S72A 4RWSC 4GNXB 2YTXA 5F2DA 1STNA 1L1OC 1E3PA 1GUGA 1II3A 4DR3Q 1PH5A 2ZTCA 4DR1L 5AJ3Q 3E6ZX 1JOQA 4AQYL 1UE7A 2QDBA 4RGOS 1SMXA 1X3FA 4ZAIA 1QNUA 4A3MG 2AWNA 1XNRL 2A68C 3OIQA 3KLSA 2RF4A 2I0QA 5C4XH 3RNUA 5K5PA 4JG2A 4B08A 2JA6H 5CBAE 4YCVA 5ELFA 3PUZA 3KF8A 1TS2A 3WOFA 4IJLA 2HIXA 4Y7NB 4TRDA 1XPOA 2L55A 1E2WA 4LUZA 3JAML 2OWOA 1MSHA 4LF7L 3GTKH 2HT1A 4B9WA 3VR3A 1X32A 5FO7B 5IYCG 2RHQB 4B3RL 4KK7A 1JWUD 1HJPA 1X9NA 4U68A 3OMCA 2KHJA 4DK0A 2DY8A 3DEOA 3E5SA 1LT6D 3I4NH 1VQ7A 4DV1Q 4JOIC 3T56B 4YHHQ 1J5EL 1FNVA 3OTOL 2K33A 4LF4L 3I4MG 5GAGC 3K59A 5BR8L 2A6EC 1S5BD 3K5LA 3S1RB 1M1KC 3GTLB 1Y1WH 4IUNA 4DR3L 3CW2C 4IFDJ 4O1NA 4HCEA 2I07B 3D6WA 1DGSA 5HY6A 4Q0FA 2EJFC 3S9WA 1YBYA 4KD4A 1SFOB 1HA6A 2D0PA 3SK8A 2F0PA 3CAMA 4FVMA 2BH8A 1PYBA 1DOLA 1FD7D 1F2YA 2O5IC 4IZ8A 3MAQA 4KHVA 4C2MB 4DU9A 1N33L 3A74A 5CV7A 1KAAA 4TVAB 3UE1A 1LT3D 3LWEA 4LUVA 1LTBD 4JI1L 3D4RA 5C4JH 3MEFA 1IKLA 2XTIA 4QY7A 5IP9H 1MD2D 2VXWA 1B9MA 2VB2X 3T1HQ 1EEFD 1OXSC 3QR8A 1TKWB 3GTMH 2JA5H 5A2QL 2HUGA 1EWCA 4ILWA 1UWVA 1H9KA 1KLUD 3D8GA 1QVFA 1WTHA 2CQAA 4CDDC 2J4XA 3GTGH 1R9TH 1GOZA 5D14A 4DV5Q 2ZJRA 1YHAA 2K14A 5EPJA 4R9WA 4A3DH 4DF7A 1VQNA 5EBDA 4GKKL 2MHVA 3K57A 1VQCA 1K83B 2N49A 1EYDA 1JJ2A 1I4PA 3KF6B 2L4NA 3T53B 4N9TA 5BR8Q 4LFBL 4K8IA 5M5YB 1ENAA 1CKNA 2K5VA 4DPGA 3BVGA 2B2WC 4DV0L 2EYLA 1F9RA 2JA6G 2IX0A 1PH1A 3VYTA 1IBKL 2QILA 4XDXA 3QIAA 4IJHA 3I72A 4LF9L 4JI0Q 1FJGQ 3S2DH 1EZ6A 1STHA 3MFGA 4HN7A 4DN4M 4JI4Q 4B3RQ 3H09A 1B2TA 1V43A 5EBCA 2EJGC 3HOVB 4LAAA 1EY9A 2EPBA 5I6WA 3HOZB 4JPBW 3RZOH 3GDEA 1EY6A 4ZRZA 4XXEA 3NBIA 3EJIA 4R1JA 2ES2A 3HFZB 4JK1C 2P5ZX 1BXTA 4RGNA 1AZPA 1VQOA 2AWOA 4J1MA 1TIID 1LYLA 1CFMA 1L0XB 3S1MB 3HOXG 3NQIA 2CKZB 2N88A 2I46A 4BBSB 4J15A 1ICWA 2B2YC 4IPGA 4PNYA 1A0IA 3BJUA 5CV4A 2UXBQ 4IUPA 2NN6H 1PFBA 4B3ML 4NW2A 5GAHC 5DM73 3H0GG 2RDHA 2D2CC 1RIPA 3P75A 3NENA 2QEJC 1LT5D 3EFXD 1GUSA 2RBMA 3U9SA 2E5LL 1IL8A 2F0SA 1KAWA 4A3FB 3DMUA 4NXNL 3NSWA 3S17B 1SMYD 3NPPA 1HNZL 4IUUA 3CCQA 4N8X1 2H1EA 1JOKA 4GLAC 5FLXL 5JOBA 2L9HA 1FGBD 2EYFA 5IGDA 1ESRA 4HEDA 3R2TA 4OWXB 4NXMQ 1LLRD 3T1HL 3E0EA 1EWHA 1EY4A 3NTIA 4BY7G 3EVQA 1PRTB 3GTQB 2TSSA 2QF7A 3A8KE 2IW3A 3H0GB 3A56A 2EVBA 4AYBG 1AW7A 1U4PA 1PZJD 4CGYB 1K73C 1X3EA 4WJWA 3DXJC 3ONAB 3CQZH 4K0KQ 3KK7A 4HIMA 3S14B 2DNEA 3V05A 4LW1A 3HGBA 1PVOA 4J8QA 1X3GA 3TDQA 3ND8A 3BYYB 2K04A 3C1FA 3HP3A 1O80A 4NP5A 1VMPA 4K14A 2ZJPA 3T1YQ 4C3IG 3I4MB 2YV5A 2F03A 5M3FG 1I94Q 4XQQA 1N34L 1ML0D 1I4RA 2AQ2B 2KHSA 3S1RH 1X6OA 2EE1A 1O7LA 3SHLA 4U673 3CF5A 3GTLH 4ZUIA 2E76C 3NWSA 3K58A 1EQVA 2OQ0A 2OTLA 2JJQA 2UUBQ 3J80c 3QWNA 3I4OA 2NVYB 4C3HH 4KHPL 3S14H 5LL6S 5E4WC 4F87A 1KABA 3J7AV 1I3QB 1R4QB 3HOXB 2FMMA 5LMUL 2F0VA 1I3QH 5C4HA 5HGQA 4TKOB 3I4NB 2HQEA 5GADC 3KFUA 1AEXA 2NZOA 3K7UC 3VYUA 3K81C 5C3EB 2EY2A 1MSGA 3D4DA 3IL8A 1OO9B 3HEJA 3DUZA 1GUNA 3S1NH 3NP8A 3BS1A 1U4RA 3PO2B 1NMFA 2K5HA 4PG3A 1FNWA 4JBKA 1YNND 4DXGA 4R4QA 2JA5B 2Z4IA 3HOWH 4K6DA 5FLMG 2JA5G 2PO4A 4X3SA 3SEBA 1F9SA 4AH6A 1H95A 2XSCA 4DAYB 2JE6I 3GTGB 3UDXA 1IYUA 3CRKC 5AJ3L 1LO5D 1EIGA 2LXJA 3I4LA 2KVMA 2O4XA 4DK1A 1J6QA 1K3BC 1Y8OB 1HNWL 4DV1L 3J80E 2CW0D 2J7ZA 2DN8A 5C4XB 4DXFA 1WCMH 1AH9A 4CKEA 1HRJA 4QMGA 3TRZA 4AYBE 1I5FA 1KQSA 2WAQB 4XQJA 4H02A 1E7ZA 3I70A 3M4OH 1LTAD 2XWJB 1LTID 2Z4HA 2EY1A 3W3AA 4AYBB 1I6VC 4N9PA 3A8IE 3K7AH 1KC8C 3L0OA 4AIMA 4A3EB 3E3XA 3PUYA 2G5DA 2UXCQ 1W6KA 2K5NA 1JOOA 2DY7A 3M9BA 3D6CA 4PQXA 4V190 4DV4Q 5FKAC 1EY8A 2AHOB 3SVMA 3NELA 2RQXA 3E9IA 1YJ9A 4X65Q 1EL0A 3OHXC 1ESFA 1HZCA 1D1KA 4BA1I 1XPUA 2L5TA 2N3SA 4A3GG 2FHTA 1SYFA 5IT9c 5KIXA 1FGUA 3TP5A 4RHRA 2PQAB 3B6YA 3DWPA 4L6TB 1D5MC 2E2JB 2WIIB 1S5DD 2HIVA 1BBWA 4NXNQ 4JI6L 2O2LD 3HKZE 3CHBD 2MGSA 4APVA 5FO9B 1NJIC 1KDAA 3CRLC 1KDBA 1M90C 1EIFA 1A2TA 2PYKA 1V1PB 3CCVA 1XYIA 2L15A 4A3GH 1JORA 2Q8IB 3IRBA 3RZOB 1JT8A 2LMCB 1VQEA 3ZJYC 1W6JA 4X62L 4R4OA 2EYMA 4G7HC 3OOCA 1OXVA 2VQEL 4DV5L 4MTKA 4HIOA 1WTOA 2CW0C 1VQKA 2ATWA 4OHJA 3G48A 2L1BA 3VR4A 2SOBA 1TY2A 2NZHA 4X65L 3CCLA 1JICA 4PZ6A 3D3RA 3S1MH 4JI7Q 1XNQL 3GTMB 2NWGA 2PZWA 4A93B 4DNRB 2G9DA 5JEAG 4UP8A 2Z9HA 3BG3A 1VQ5A 2NN6G 2JQOA 3AB9A 3A7AB 3MWYW 3CC4A 2AMCB 3IFTA 3AEVA 1V8QA 3CXCA 1UEBA 1X3QA 1PFMA 3DWQA 3ND9A 4CJ2C 1K83H 2VQEQ 3CCJA 4DV6L 3GTKB 1GHKA 2KCMA 1D8LA 2UU9L 4FYDA 2R7ZG 1YIJA 3HOXH 4KHZA 3OSOA 3C3LA 4X66L 3VR5A 2RDFA 4RCOA 2QKIC 3F2DA 1PTOH 4ID6A 4EVOA 2JA8G 1SMYC 1ENFA 2WV6D 1EOVA 2GA4B 2LXKA 2L0CA 3UI2A 1HUNA 2GVBA 1MBYA 2JYOA 3KBXA 2JEAI 3P7JA 1G291 1VQBA 4HSPA 4POGA 1F9PA 2UU9Q 1SNDA 5JPMC 1Q8KA 1Y14B 2G9HD 5A2QE 1L0WA 2I5HA 1S40A 1CA5A 3H3VC 2ZXRA 4NKLA 2HDMA 4DK6C 1GHJA 3K5NA 1DYQA 5EJWA 1YJWA 2Z6BA 3M4YA 2OEOA 1SNOA 3J80L 3SDZA 1TWCH 1E2VA 4R4IA 5I2YA 2PZTA 4C3HB 4LUOA 4KY5A 3PSIA 2UXCL 5TSSA 4RKBA 1N36Q 4QL5A 1JJGA 2WAQG 2EYHA 1SYGA 3L7ZC 4LFCL 2VUMB 2IT1A 3GP7A 2B63B 4DV7Q 1GVPA 5CV6A 1HR0L 3J81L 4QQBX 1H9JA 2YTYA 1XXGA 2A69D 3HOYH 3LNNA 1M4VA 4QB4A 2BA0A 5IYDH 4A4IA 3HOUG 4IPDA 3P1HA 3CCRA 2QGQA 2B2UA 2VW9A 2R93B 3T1YL 3TBIB 4A3IG 1M8AA 1ILQA 4JW0A 1O7YA 3M85A 1KRTA 1WI5A 4KKUA 4LWCA 1NMGA 1PLFA 5JJZA 1Q46A 4DAVA 1SYEA 1EOTA 3SK4A 4P73A 5BN5A 3HKZG 3ULLA 4YIJA 2PMZE 5G3LD 2IWHA 1PH7A 1LM0A 1C8CA 3ER0A 2UXBL 1A2UA 3RZDB 2K7VA 2MQHA 3PF5A 1G6ZA 3STBD 4FF3A 4IOAA 2NVXB 2CVRA 4HTHA 5T1GA 2B29A 4OO1H 1CZGA 3DEPA 5I4DA 3CCSA 1F9QA 3FEWX 4CDEC 4BBRB 4DR4L 1PV4A 3AQQA 5KNDA 3EROA 4QJFA 5IWAL 3FKIH 1FL0A 3S15H 1CZWA 4XT1B 1EFWA 5CC4A 3A0JA 4HIDA 4BY7H 1B3AA 1N33Q 3S17H 1W3SA 2F0NA 4LNQA 1H9RA 3UDIA 3BDCA 4A3LH 2DGYA 1A3TA 1SLJA 4F8MA 3D0FA 1HZBA 3TZDA 5EGTA 2HQLA 5EQ0A 1CSQA 1WFQA 3RR5A 2XRSD 4C56C 2Q8TA 5E7NA 3NEMA 3SGIA 1QUQB 2BA1A 2R61A 4H13C 2OF1A 1JR0D 2K03A 1J8IA 3GTOH 4LF4Q 3DM1A 1KDCA 4LFAQ 3H3VI 1CK1A 3HKZB 1N32L 1Q7YC 2NTSA 2B2TA 3RLFA 4F88A 4RAUC 1PH3A 5LMNL 5ELOA 1VCIA 4A3GB 3FMCA 3A55A 1VQDA 1E0BA 3X3NA 2HHHL 4R8IA 5LL6X 4QUCA 5ISRA 4KJNA 1PH6A 1PRTF 2F1MA 1SE3A 3N6RA 5EPLA 3MXPA 5JJIA 2QDLA 1DM0B 4UP7A 3OMGA 3PIO3 3K6OA 2CQOA 5IYDG 1JB7A 3HOWB 5J1ZA 1HH2P 3IKJA 2I5LX 3JAMi 3S16B 5JEAH 1GO3E 2J0TD 2KUMA 1AE3A 2NTTA 1R9TB 4FXDA 1HNZQ 1N32Q 5GQOA 4RHSA 1YHQA 1BUVT 1WOCA 2IHFA 4JCVE 2A1AA 3BVMA 3Q23A 1STBA 1VDZA 1F2LA 2D9UA 5CBEE 4JV5Q 1NTGA 4K2KA 4K6LA 5JAVA 4IFDH 4K8JA 5C4JB 1HNXQ 1XMOL 2MO0A 1TWFH 3OTOQ 3QO2A 3LWUA 1GUWA 3TSSA 1WTPA 3HOYB 3GTPB 4DV3L 1LUZA 3PMFA 3S2DB 3JAME 4B3SL 3TP8A 2DUDA 1DOKA 1WJJA 3HG9A 5IP7H 3F2CA 4LFCQ 3MXUA 4NB3A 1Q1BA 1OXXK 1KRSA 3PGZA 1U0LA 4TSSA 2F3WA 3QG1A 4A3LG 3J81i 1MI2A 2JA7G 4DR4Q 4JI1Q 1JCKB 3EIVA 4L5QA 5M9OA 1G2SA 4L8JA 2LS01 1I4HA 4DV3Q 4A3IH 3KDFA 4YCUA 1UE5A 2EYOA 5IOCA 2RKSA 3S24A 2YU9B 1XMOQ 4A3BH 1LACA 1LT4D 4DAMA 1EY0A 1A15A 1TWFB 1G51A 4BBRG 1FVIA 1TWAB 4DR6L 4JI6Q 1EU4A 4LF8Q 1VQJA 3Q0AA 1K8GA 2M2LA 2F0DA 3URYA 1B7YB 3FHWA 3IAYA 3S15B 5M3MG 5I9OA 3N52A 3ERQA 2BE5D 4WJ3M 1SE2A 3J81E 3OW7A 1RHPA 1NR4A 1S4ZA 1SROA 3NE5B 2A6HC 3I73A 1NE3A 1RJTA 4DV7L 3KLSX 2UXDL 4A3CG 2C35B 4YHHL 2L11A 4DV6Q 1J5EQ 2DJGC 5KNCA 3OWEB 1AE2A 1YI2A 4J6HA 3TS2A 1CKNB 2UUAQ 3D4WA 3CC2A 1EYCA 1FR3A 3STBC 1ZYRD 1CKMA 1VQIA 2F0MA 5KYLA 1T5EA 1IXRA 4YCWA 2LFNA 1W2BA 4HJ7A 1TS5A 4NMZA 1QZGA 2KECA 2Y0SE 1YJNA 3C1EA 3IFDA 1X55A 3PCOB 1CM9A 3SK6A 3MVVA 1UEAB 1MIUA 1Y8NB 2B8GA 4X6AH 4KI0A 2A8VA 3PO2G 1ICFB 4A93G 4RGMA 5CMDA 1AN8A 4DV2L 2TMPA 2EXZA 3NTKA 1O7ZA 1QVCA 1OXTA 3H3VH 1XWEA 3VDYA 1LTTD 3WWVA 1HUMA 4GLXA 2E5LQ 5DLQE 4HSVA 4PZ7A 1HHVA 2K05A 4K5WA 2EDGA 3CC7A 3EQLC 5JVH3 3HKSA 5IYBH 3UDFA 1BNZA 2E2DC 1BO0A 2E2JH 2D0OA 2D62A 4GS3A 2XIWA 3CCMA 1BF4A 2F0UA 4EQOA 1CSPA 1EFID 4KY6A 1I6HH 2IX1A 1K8MA 1HPCA 5M5XH 4XTCS 4F7XA 5CYUA 5M5XB 1XMQL 2MFIA 2F0OA 4LF5L 4P75A 2DJFC 4HJ9A 1BOSA 2ALYB 2FMCA 3CCUA 4KLKA 3TS0A 4ZKBB 3J80i 2CH4W 1SAPA 3MHBA 4A3DG 3PUWA 3M4OB 1UE6A 1A3VA 5ELDA 2XN9C 3SK5A 3RD4A 4X64Q 2R7ZB 1EQTA 2D5DA 3PF4A 2A73B 4DA2A 1B44D 1Q81C 3MA2B 3M4PA 2FXQA 3GD7A 1IBML 1P16A 3HOUB 4A3JH 3S2HH 3NUCA 4EQPA 4HIKA 1SNMA 4ME5A 1QOHA 2BCOA 1C9OA 2RCNA 4YY3L 1XNRQ 1PTOF 1QNKA 4GKJQ 1SBBB 1R4PB 3M3YB 4UPAA 1U4MA 3TP6A 2B63G 3O13A 5GROA 2IJ0A 2QA4A 1NAPA 3QOLA 1QVGA 4P72A 2Q2TA 2BOSA 4FXGC 2JA7B 1Y1VG 5M5YH 4DR6Q 3WDNA 2EYPA 4DNIA 3CKIB 4RA8A 1BBUA 3PUVA 4LMQD 1H9SA 1HFGA 1HR0Q 2EY6A 3CMEA 2JXMB 1MGSA 5KRUA 4JYAQ 2IL8A 3QB3A 1TU2B 3K7AB 3DLLA 1B1ZA 2OQKA 2SEBD 1AZQA 4A3EH 5IODA 1KHIA 3EN2A 3KLWA 4DAPA 4A3DB 1SXTA 2A69C 1HR0W 3KJPA 1GM5A 3GTJB 1EQRA 1SEBD 3KF8B 4OEMB 3HS0C 2NVYH 4ALPA 1PFSA 1TXYA 3V2TA 4JI0L 5LMNQ 1GJXA 1E24A 4K2LA 3KF6A 4A3IB 3EA6A 2VY3A 4LFAL 2NVTH 3CPFA 2F52A 4HR7B 2B2WA 2JA8H 2Q2UA 2Q2HA 2MNAA 3J7YW 2EIFA 1A3UA 1HFNA 3KLRA 1YNJD 1B53A 1L2FA 3GQBA 3FDTA 1TWGH 3PO3H 1WYDA 1TWGB 2JA9A 3OPOA 5FJ8H 5ELBA 4B3MQ 2PNRC 4R4TA 5IGCA 2CWAA 2B39A 1DZ1A 1PH2A 1U5KA 1QUQA 1H9SB 4OX9L 2GVAA 2RVLA 4MIUA 4JBMA 1F2ZA 1LTGD 5LMUQ 3K0XA 5AFWA 5CV8A 3L3OC 3FPPA 5COYA 4KHPQ 2VB3X 2RA4A 5IIFA 5LHY1 2NVTB 2QEXA 1I6HB 1LTSD 2H4OA 3KYHC 2LSSA 2Q8RE 2B63H 5C0XG 1EZ8A 2RCFA 1Q86C 4OL7A 2PQEA 3BU2A 1ONLA 5C3WA 1RKNA 1TWCB 1PYSB 4DR2L 5IYBG 1X56A 1GXDC 1VQAA 4JI5L 2GN5A 3H94A 3G6EA 1YITA 4ZYSA 4A3KH 2SNSA 3RMHA 1N9WA 5DAUA 4AQYQ 4A3FH 2VS1A 1NY4A 4UP9A 3JC66 2WB1B 4CHTB 4CKBA 2R93H 1NCVA 2DNCA 2FINB 4EGVA 2UUCL 1STGA 1H9MA 1GD7A 4EX5A 1BCPB 3S1QH 1IW7D 2ZM6L 4HJ8A 5CR3A 4KD3A 1EIHA 2KCTA 1Y1WB 1LTLA 2F4VL 1QWYA 3G4SA 2MPMA 3W2DA 3M3YH 2IPKD 2K28A 5CV5A 4OO1G 1DONA 5FOBB 5CORA 1JQYD 1MHWC 2CHBD 3H6MA 1STEA 1ZYRC 5CV9A 5C44G 5IT9L 1ZKOA 3TEHB 4JC0A 1CQVA 4B9XA 3RZDH 3Q22A 3R8BA 3E0JA 1IHZA 1K0SA 1EQQA 4BA2I 4S3SA 2NUCA 3GO5A 2Y0SG 4IUVA 3I4MH 2PNHA 2K75A 2SNMA 1WD1A 4B3SQ 4JI8Q 2IHEA 3M4QA 3I3CA 1B3QA 1YNJC 5IGEA 3VA7A 1HNWQ 2AQ1B 1RTNA 5M3FB 4DV0Q 2O5JC 5C4ZA 4PMBA 3KDFB 1B70B 1OTCA 5EAYA 1Q8IA 3U9OA 5D3IB 1TQOA 1T5XD 5IYCH 2KCNA 4GNXC 1QJOA 1ZEQX 3MZ5A 1XPRA 4CDCC 1VQ9A 4RMFA 2B3GA 1QB5D 4A3EG 4TQUS 1K28A 1NR2A 3NQTA 3SXHA 1U9RA 2B2UC 3PIOA 3QJYA 4C2MH 3F2UA 3MFYA 4I7ZC 1IYJB 4A3BB 4LJZC 4ZKCB 1TS3A 2R92G 1BKBA 4IPCA 5L37A 1STAA 4OGQC 1TWAH 1PRTC 3NBHB 2EQSA 2XVSA 1Y8PB 3J81j 2ZTDA 3Q6SA 1EUJA 1BCPC 5I9PA 5JVG3 4GN3B 1KLGD 1Q12A 4DK3C 2HCIA 2UXDQ 1WVLA 5JJKA 3PO3G 2E2HB 4IQZA 1V1QA 2QW7A 1CUKA 1AP0A 2ICEC 2A5HA 1V9PA 2ENBA 4A3JG 3AFPA 4R8NA 5D3DA 2YU9H 3M7GA 4HCSA 4JV5L 5J39A 4B3TL 4BBSH 4M1UB 2F3IA 1CKOA 2JA8B 1CQFA 4C3JH 2KEDA 1O7IA 3I4NG 3HZXA 3E9HA 1VQLA 1PZID 5HGTA 2CWPA 1VQMA 4O42A 4IN3A 1RD9D 1RF2D 2XWBB 5DEHA 3NTHA 1X54A 1IBMQ 1FNUA 5IY0A 3P20A 2X6GA 4L5SA 4A3KB 4XYOA 4PMCA 3FKIB 2JSOA 5C5MA 4G57A 1PTOD 2K5DA 2YYZA 5H1SE 3GV6A 4JVZA 1XTDA 3LX0A 3Q24A 2R7ZH 2Z8LA 3J81c 2Y0SB 4YWKA 1F2MA 3GTPH 4CKCA 2AUKA 1QILA 4N8FA 1PA6A 2VNUD 4JYAL 4DUYL 1E1TA 3UDGA 5LMNW 3ITPA 4RGTA 1A62A 2Q2IA 2F0KA 4R4CA 1Q82C 3H0GH 2K32A 2ZXOA 3EBEA 3BYTB 1L1OB 1HZAA 4IUTA 3I56A 1EEID 4C1NI 3A5UA 4X62Q 5I2XA 1CT1D 4MTNA 1BCPD 1ET9A 2JEBI 1WTRA 4KJOA 4Y7NH 1WCMG 2PMZB 4I7AA 5DM63 1JE5A 4K5VA 4X3KA 1YNNC 3MXNA 5FK9C 4E6IA 2NN6I 4EQ5A 1SR3A 3NWTA 5GAEC 1G91A 3K8AA 4XIGS 1V1PA 2ZXPA 3L9AX 4X66Q 2R7DA 1BVSA 4DGZA 4HMJA 4ODGA 1PTOB 5BN4A 4XQNA 1PH8A 4OO1I 1ASYA 3Q8DA 3H91A 4WORA 2R3ZA 3F1ZA 4C3IH 5K36G 4K5XA 3H15A 2K6AA 1EIYB 4OELB 1VQ4A 4GOPB 2HD3A 1L0YB 3S2HB 1IBLQ 1WTQA 1KTKA 1UNSA 2CFMA 2KJXA 4BY1H 3J7AF 4RH6A 2KHIA 3T51B 3I2ZA 4BY1B 1JJCB 4UAIA 3JAMc 2OCEA 3I55A 4DAYA 1TR5A 4JOIA 1XNQQ 2RSNA 5IGGA 4ABNA 4Q5VA 5DNFA 1EWIA 3PV0A 4BWGB 5C44H 1C7YA 1SJED 2KA7A 1HQRD 3VR2A 1MKHA 3AFQA 2K52A 1HNXL 5EPKA 2K01A 2Z6KA 1MJEA 1OXUA 1PH9A 1D2BA 2ASBA 4PV1C 5KGUA 4RFBA 4ZQ3A 4BXXG 2F0HA 1QCBD 5E4XA 5KYIA 4A3FG 4RCNA 1VQHA 1UAPA 2OXPA 4H0LC 4YY3Q 1K9MC 1UUPA 2A6HD 1HQMC 2SDFA 4OONA 1J9OA 1PMRA 1PRTD 5C0XJ 1YVCA 2I5MX 4OWTB 3NK9A 3K5MA 1Z9FA 3PIP3 2Z0SA 4WFN3 2A19A 4JI5Q 3M7NA 4X64L 3K5OA 2EJMA 1PFNA 4DUZQ 1Y1VH 5ELNA 1WTWA 2F0QA 1D6EC 4ZK9B 3AU7A 1WTVA 3T16A 4DUYQ 5EKLA 3BDLA 4OWWB 1SN8A 3J7A5 4DV4L 4L63B 3U58A 1Z7TA 2NBFA 2A68D 5C3EH 2E2IH 4EQNA 5G3LF 3R3OA 4A3KG 5IGBA 1X3PA 1E2ZA 2NVQB 3GV3A 3TZUA 3HOUH 1VQFA 1G8ZD 3LGJA 1TS4A 2M9VA 2KQ3A 4DR7Q 2FFKB 2LKVA 3RUZA 4HAEA 3MXGA 2BDOA 2F4VQ 1C4QA 4KMUC 1I4GA 4FF2A 5D65A 4IFDI 2B2VA 3W1GA 2JN4A 1X65A 1HZ9A 5K36H 2ZM6Q 1SYBA 4WJ4A 2PQAA 3TREA 4GOPC 4DFAA 4A3JB 2ZJQA 2N78A 2KEEA 2V4DA 4B3TQ 3X3MA 3I8ZA 4DKAC 4KN4C 1PXUA 4MNOA 4GKKQ 2PW7A 2KBNA 1U4LA 3G71A 2RSOA 4JBWA 1CI3M 4CJ1B 2F4IA 5FLXc 4C3JB 1IZ6A 3GTOB 2EXDA 3CP0A 3PUXA 3F8TA 3SR1A 3BZDB 3HOVH 2FJ2A 1I4QA 1O78A 2NB0A 5FJ8G 1JE4A 3TQYA 1Y69U 1KD1C 2MP1A 2F0LA 4JI3Q 4BS9A 4CDFC 1ZXTA 2BE5C 3U4ZA 1VQGA 4BY7B 2WKDA 1YHBA 1QG7A 2E74C 1AFPA 3RLOA 2E2HH 1G2TA 1K3RA 1NNXA 5C6AA 1G6PA 4JI7L 1VF5C 1QZHA 1VMCA 4JI3L 1Z47A 4G7OC 1JB3A 1SJHD 4NXML 5IP9G 5E1FA 1BR9A 1STYA 2PI2A 4BXXH 1FYCA 1JC7A 3TMEA 3AYHB 4IFDG 1HTPA 1YNXA 3FVQA 1P8LA 4PZ8A 5EKKA 5JEAJ 1QE6A
chains in the Genus database with same CATH topology
2X6LA 4C3JG 2F0IA 2F0JA 4IALA 2JP1A 1ET6A 4KTAA 3T4AC 2R6GA 4KY7A 4LK1C 1DCZA 1SNCA 4QF4A 4QUFA 3MEHA 4FF1A 4C1NK 2WP8J 3VR6A 2EOTA 1PTOC 4ULLA 2KOLA 1IKMA 3V96A 3HRZC 1LTRD 1I4XA 1CHPD 1A6XA 2AUJD 2JA6B 1D1IA 5CGKA 2NYZD 4OIKA 1B4OA 4HMIA 2WKCA 5ELCA 2F3VA 1BBXC 1RODA 1PYWD 5C0XI 4DNTB 3AMUA 5C3XA 1RDPD 4I65A 3R2IA 5HURA 4WRDA 1CHQD 3NBHA 1DXMA 3BVZA 4A3MB 2E2IB 1GUOA 1EY5A 5T1IA 4KN7C 2A74C 5M5WB 1I50B 2WACA 2XRQD 3FPUB 1WTXA 4XYQA 3CU7A 4M8AA 1DOMA 2EYJA 5NUCA 2WINB 1HA5A 5I6YA 2K5QA 1BCPF 1GUTA 2PW5A 3SE0A 5C44B 1V1OA 4FP5D 4MHEA 1Y1VB 4KKTA 4H44C 1JWSD 4CBVA 4MN3A 2LY7A 4P2CB 2RDGA 2F0EA 1EU3A 3KUPA 1JWMD 1F77A 2HCCA 2EZVA 2MUYA 1BDOA 3KBGA 3FRPB 2N55A 1S5CD 3S1QB 5JPNC 1VF7A 4IURA 5BN3A 4QCLA 3R93A 1K8OA 1HTLD 3I90A 1Z6HA 3ZYYX 2PCFB 4H7BA 5IGFA 1TWHB 2BDNA 4Z9CB 4FO2A 1TVXA 4OIJA 2XNAC 1D5ZC 3CQZB 1XTCD 2M00A 3G7LA 2K5WA 1TY0A 2B8FA 4IUQA 4UDUC 4NDXA 4X3UA 4FXKC 3VYRA 4ZUJA 4FF4A 3BDOA 1S5FD 3D31A 2OT2A 5KEEA 3S1NB 4V0BA 4G7ZC 3A54A 4RKLA 3I91A 5E3FA 1B9NA 5EKIA 1XX8A 1C48A 1SYDA 3OWFA 3C2PA 1EY7A 2ID0A 5FLXE 1SNQA 2R92B 2NZ1D 3MC0B 4CJ0B 1NUCA 4XT3B 1HXYD 4C3HG 5IT9E 1PZKD 3NXWA 1SDFA 1B50A 2C5CA 4QIWB 2C9OA 3OIPA 5J22A 2B2VC 4X3TA 1BQQT 1WD0A 2Z1CA 5C0XH 2HDLA 2F0TA 3WOEA 2B2YA 2K1BA 1LABA 2AQ3B 5ELEA 1LV9A 2ZT9C 4KKSA 5M3MB 3A8JE 2MJ8A 2F0FA 2A6ED 2KCCA 4GZYC 1CTMA 1Q3LA 2EY5A 2F0WA 3TN2A 1D5XC 1PDQA 3A7LA 2PZUA 2IX3A 2L12A 3VA5A 3K0YA 4G4KA 4KV6A 3C46A 1Q1EA 2B2TC 1TT2A 1KNAA 1HCZA 3PO3B 2F0GA 4C3IB 1SNPA 1ILPA 4ZLTF 1DJRD 3DHQA 1EYAA 1IW7C 2QCPX 4PMWA 2X69A 3NHHA 3G6JB 3DWAA 1DD2A 4FNFA 1CA6A 1Q90A 1S5ED 2E75C 5A35A 1SSOA 1WCMB 2PPBC 3MTSA 3VYSA 1RCVD 5C5LA 2ICIA 3T13A 5FO8B 3QOJA 1RTOA 3TP7A 5KNBA 1ENCA 1KNEA 1NSNS 1IYVA 1SE4A 1SYCA 4RWSC 5F2DA 1STNA 1GUGA 1II3A 3E6ZX 1JOQA 2QDBA 4RGOS 4ZAIA 1QNUA 2AWNA 2A68C 3OIQA 3KLSA 5K5PA 4B08A 5CBAE 5ELFA 3PUZA 3KF8A 1TS2A 3WOFA 4Y7NB 4TRDA 2L55A 1E2WA 3JAML 1MSHA 4B9WA 3VR3A 1X32A 5FO7B 4KK7A 1JWUD 4U68A 3OMCA 4DK0A 2DY8A 3DEOA 3E5SA 1LT6D 3T56B 1FNVA 2K33A 3K59A 3GTLB 3K5LA 3S1RB 2A6EC 1S5BD 4IUNA 4IFDJ 4O1NA 4HCEA 2I07B 3D6WA 4Q0FA 2EJFC 3S9WA 1HA6A 4KD4A 1SFOB 3SK8A 2F0PA 4FVMA 1DOLA 1FD7D 1F2YA 2O5IC 4IZ8A 3MAQA 4KHVA 4C2MB 4DU9A 5CV7A 1KAAA 1LT3D 3LWEA 1LTBD 3D4RA 1IKLA 1MD2D 2VXWA 1B9MA 2VB2X 1EEFD 1OXSC 1TKWB 5A2QL 2HUGA 1EWCA 4ILWA 1H9KA 1KLUD 3D8GA 2CQAA 2J4XA 1GOZA 5D14A 5EPJA 4R9WA 4DF7A 5EBDA 2MHVA 3K57A 1K83B 1EYDA 1I4PA 2L4NA 3T53B 4N9TA 4K8IA 5M5YB 1ENAA 3BVGA 2B2WC 2EYLA 1F9RA 2IX0A 3VYTA 2QILA 4XDXA 3QIAA 3I72A 1EZ6A 1STHA 3MFGA 4HN7A 4DN4M 3H09A 1B2TA 1V43A 5EBCA 2EJGC 3HOVB 4LAAA 1EY9A 2EPBA 5I6WA 3HOZB 1EY6A 4ZRZA 4XXEA 3NBIA 3EJIA 4JK1C 1BXTA 4RGNA 1AZPA 2AWOA 4J1MA 1TIID 1CFMA 1L0XB 3S1MB 3NQIA 2N88A 4BBSB 2I46A 1ICWA 2B2YC 4PNYA 5CV4A 4IUPA 2NN6H 1PFBA 4NW2A 5DM73 2RDHA 2D2CC 3P75A 2QEJC 1LT5D 3EFXD 1GUSA 2RBMA 3U9SA 1IL8A 2F0SA 4A3FB 3DMUA 3NSWA 3S17B 1SMYD 3NPPA 4IUUA 2H1EA 1JOKA 5FLXL 5JOBA 2L9HA 1FGBD 2EYFA 5IGDA 1ESRA 4HEDA 3R2TA 1LLRD 1EWHA 1EY4A 3NTIA 3EVQA 1PRTB 2TSSA 2QF7A 3A8KE 2IW3A 3H0GB 3A56A 2EVBA 1AW7A 1U4PA 1PZJD 4CGYB 4WJWA 3DXJC 3ONAB 3KK7A 3S14B 2DNEA 3V05A 3HGBA 4J8QA 3TDQA 3ND8A 3BYYB 2K04A 3C1FA 3HP3A 1O80A 4NP5A 1VMPA 4K14A 4C3IG 3I4MB 2F03A 4XQQA 1ML0D 1I4RA 2AQ2B 2KHSA 2EE1A 1O7LA 3SHLA 4U673 4ZUIA 2E76C 3NWSA 3K58A 1EQVA 3QWNA 2NVYB 5LL6S 5E4WC 4F87A 1KABA 3J7AV 1I3QB 1R4QB 3HOXB 2FMMA 2F0VA 5C4HA 4TKOB 3I4NB 2HQEA 1AEXA 3VYUA 5C3EB 2EY2A 1MSGA 3IL8A 1OO9B 3D4DA 3HEJA 3DUZA 1GUNA 3NP8A 3BS1A 1U4RA 3PO2B 1FNWA 1YNND 4DXGA 2JA5B 2Z4IA 4K6DA 2PO4A 4X3SA 3SEBA 1F9SA 2XSCA 2JE6I 3GTGB 1IYUA 3CRKC 1LO5D 1EIGA 3I4LA 2KVMA 2O4XA 4DK1A 1Y8OB 3J80E 2CW0D 2J7ZA 2DN8A 5C4XB 4DXFA 4CKEA 1HRJA 4QMGA 2WAQB 4XQJA 3I70A 1LTAD 2XWJB 1LTID 2Z4HA 2EY1A 3W3AA 4AYBB 1I6VC 4N9PA 3A8IE 4A3EB 3PUYA 1W6KA 1JOOA 2DY7A 3D6CA 4PQXA 4V190 5FKAC 1EY8A 3SVMA 2RQXA 1EL0A 3OHXC 1ESFA 1D1KA 4BA1I 2L5TA 2FHTA 1SYFA 5KIXA 3TP5A 4RHRA 3DWPA 4L6TB 1D5MC 2E2JB 2WIIB 1S5DD 2O2LD 3CHBD 2MGSA 5FO9B 1KDAA 3CRLC 1KDBA 1A2TA 2PYKA 1V1PB 1XYIA 1JORA 2Q8IB 3RZOB 2LMCB 1W6JA 2EYMA 4G7HC 3OOCA 1OXVA 1WTOA 2CW0C 4OHJA 2L1BA 3VR4A 2SOBA 1TY2A 1JICA 3D3RA 3GTMB 2NWGA 2PZWA 4A93B 4DNRB 2G9DA 5JEAG 3BG3A 2NN6G 3AB9A 3A7AB 3MWYW 3IFTA 1V8QA 3GTQB 1X3QA 1PFMA 3DWQA 3ND9A 4CJ2C 1GHKA 3GTKB 4FYDA 4KHZA 3OSOA 3C3LA 3VR5A 2RDFA 4RCOA 2QKIC 1PTOH 4ID6A 4EVOA 1SMYC 1ENFA 2WV6D 2GA4B 2L0CA 3UI2A 1HUNA 1MBYA 2JYOA 3KBXA 2JEAI 1G291 3P7JA 4HSPA 1F9PA 1SNDA 5JPMC 2G9HD 5A2QE 1CA5A 3H3VC 2ZXRA 4NKLA 2HDMA 1GHJA 3K5NA 1DYQA 5EJWA 3M4YA 2OEOA 1SNOA 3J80L 3SDZA 1E2VA 5I2YA 2PZTA 4C3HB 4KY5A 5TSSA 4RKBA 2EYHA 1SYGA 3L7ZC 2VUMB 2IT1A 3GP7A 2B63B 5CV6A 3J81L 1H9JA 1XXGA 2A69D 3LNNA 1M4VA 4QB4A 2BA0A 3P1HA 2B2UA 2R93B 3TBIB 1M8AA 1ILQA 1O7YA 3M85A 4KKUA 1PLFA 5JJZA 4DAVA 1SYEA 1EOTA 3SK4A 5BN5A 4YIJA 5G3LD 2IWHA 1C8CA 1A2UA 3RZDB 2K7VA 1G6ZA 4FF3A 2NVXB 2CVRA 4HTHA 5T1GA 4OO1H 1CZGA 3DEPA 5I4DA 1F9QA 3FEWX 4BBRB 5KNDA 3EROA 1CZWA 4XT1B 5CC4A 1B3AA 2F0NA 1H9RA 3BDCA 1A3TA 4F8MA 3TZDA 5EGTA 5EQ0A 2XRSD 4C56C 2Q8TA 2BA1A 2R61A 4H13C 2OF1A 1JR0D 2K03A 1J8IA 3DM1A 1KDCA 1CK1A 3HKZB 2NTSA 2B2TA 3RLFA 4F88A 4RAUC 4A3GB 1VCIA 3FMCA 3A55A 1E0BA 3X3NA 4R8IA 5LL6X 4QUCA 5ISRA 4KJNA 1PRTF 2F1MA 1SE3A 3N6RA 5EPLA 3MXPA 1DM0B 3OMGA 3PIO3 3K6OA 3HOWB 5J1ZA 3IKJA 3S16B 5JEAH 2J0TD 2KUMA 2NTTA 1R9TB 4FXDA 4RHSA 1BUVT 3BVMA 3Q23A 1STBA 1VDZA 1F2LA 2D9UA 5CBEE 4K2KA 4K6LA 5JAVA 4IFDH 4K8JA 5C4JB 3QO2A 3LWUA 1GUWA 3TSSA 1WTPA 3HOYB 3GTPB 3PMFA 3S2DB 3JAME 3TP8A 3HG9A 1DOKA 3MXUA 1Q1BA 1OXXK 4TSSA 2F3WA 3QG1A 1MI2A 1JCKB 5M9OA 1G2SA 4L8JA 2LS01 1I4HA 2EYOA 5IOCA 2RKSA 2YU9B 1LACA 1LT4D 1EY0A 1A15A 1TWFB 1TWAB 1EU4A 3Q0AA 2M2LA 2F0DA 3URYA 3IAYA 3S15B 5I9OA 3N52A 3ERQA 2BE5D 1SE2A 3J81E 3OW7A 1RHPA 1NR4A 1S4ZA 3NE5B 2A6HC 3I73A 1RJTA 3KLSX 2L11A 5KNCA 3OWEB 4J6HA 3D4WA 1EYCA 1FR3A 1ZYRD 2F0MA 5KYLA 1T5EA 2LFNA 1TS5A 4NMZA 2KECA 3C1EA 3IFDA 1CM9A 3SK6A 3MVVA 1UEAB 1Y8NB 2B8GA 4KI0A 4RGMA 5CMDA 1AN8A 2TMPA 2EXZA 3NTKA 1O7ZA 1OXTA 1XWEA 1LTTD 1HUMA 4HSVA 1HHVA 2K05A 4K5WA 2EDGA 3EQLC 5JVH3 1BNZA 2E2DC 1BO0A 2D62A 2XIWA 1BF4A 2F0UA 4EQOA 1EFID 4KY6A 2IX1A 1K8MA 1HPCA 4XTCS 4F7XA 5CYUA 5M5XB 2F0OA 1BOSA 2FMCA 4ZKBB 1SAPA 3MHBA 3M4OB 3PUWA 1A3VA 5ELDA 2XN9C 3SK5A 3RD4A 2R7ZB 1EQTA 2D5DA 2A73B 4DA2A 1B44D 3MA2B 3GD7A 3HOUB 3NUCA 4EQPA 1SNMA 4ME5A 1QOHA 2BCOA 1PTOF 1QNKA 1SBBB 1R4PB 3M3YB 1U4MA 3TP6A 3O13A 2IJ0A 1NAPA 3QOLA 2BOSA 4FXGC 2JA7B 3WDNA 2EYPA 3CKIB 4RA8A 3PUVA 4LMQD 1H9SA 1HFGA 2EY6A 2JXMB 1MGSA 5KRUA 2IL8A 3QB3A 1TU2B 3K7AB 1B1ZA 2SEBD 1AZQA 5IODA 4DAPA 4A3DB 1SXTA 2A69C 3GTJB 1SEBD 3HS0C 3V2TA 1GJXA 4K2LA 4A3IB 3EA6A 4HR7B 2B2WA 3J7YW 1A3UA 1HFNA 3KLRA 1YNJD 1B53A 3GQBA 3FDTA 1TWGB 3OPOA 5ELBA 2PNRC 5IGCA 2B39A 1DZ1A 1H9SB 2RVLA 4MIUA 1F2ZA 1LTGD 5AFWA 5CV8A 3L3OC 3FPPA 5COYA 2VB3X 2RA4A 5IIFA 5LHY1 2NVTB 1I6HB 1LTSD 2H4OA 2Q8RE 5C0XG 1EZ8A 4OL7A 2PQEA 1ONLA 5C3WA 1RKNA 1TWCB 1GXDC 3H94A 4ZYSA 2SNSA 3RMHA 5DAUA 2WB1B 4CHTB 4CKBA 1NCVA 2DNCA 2FINB 4EGVA 1STGA 1H9MA 1BCPB 1IW7D 5CR3A 4KD3A 1EIHA 1Y1WB 1QWYA 2MPMA 3W2DA 2IPKD 2K28A 5CV5A 4OO1G 1DONA 5FOBB 5CORA 1JQYD 2CHBD 3H6MA 1STEA 1ZYRC 5CV9A 5IT9L 1ZKOA 1CQVA 4B9XA 3Q22A 3R8BA 3E0JA 1IHZA 4BA2I 4S3SA 2NUCA 3GO5A 4IUVA 2SNMA 1WD1A 3I3CA 1YNJC 5IGEA 3VA7A 2AQ1B 1RTNA 5M3FB 2O5JC 5C4ZA 4PMBA 1Q8IA 3U9OA 5D3IB 1TQOA 1T5XD 2KCNA 1QJOA 1ZEQX 3MZ5A 1QB5D 4TQUS 1NR2A 3NQTA 3SXHA 1U9RA 2B2UC 3QJYA 3F2UA 3MFYA 4I7ZC 4A3BB 4LJZC 4ZKCB 1TS3A 1STAA 4OGQC 1PRTC 2XVSA 1Y8PB 3Q6SA 1BCPC 5I9PA 5JVG3 1KLGD 1Q12A 2HCIA 1WVLA 2E2HB 4IQZA 1AP0A 2ICEC 2A5HA 2ENBA 4R8NA 5D3DA 3M7GA 4HCSA 5J39A 4M1UB 2JA8B 1CQFA 2KEDA 3HZXA 1PZID 5HGTA 4O42A 4IN3A 1RD9D 1RF2D 2XWBB 5DEHA 3NTHA 1FNUA 3P20A 2X6GA 4A3KB 4XYOA 4PMCA 3FKIB 2JSOA 5C5MA 4G57A 1PTOD 2K5DA 2YYZA 3GV6A 3LX0A 3Q24A 2Z8LA 2Y0SB 1F2MA 4CKCA 2AUKA 1QILA 2VNUD 4RGTA 3ITPA 2F0KA 2K32A 2ZXOA 3BYTB 4IUTA 1EEID 4C1NI 5I2XA 1CT1D 1BCPD 1ET9A 2JEBI 1WTRA 4KJOA 2PMZB 5DM63 4K5VA 4X3KA 1YNNC 3MXNA 5FK9C 4E6IA 2NN6I 3NWTA 1G91A 4XIGS 1V1PA 2ZXPA 3L9AX 5BN4A 4DGZA 4HMJA 4ODGA 1PTOB 4XQNA 4OO1I 3H91A 4WORA 2R3ZA 5K36G 4K5XA 2K6AA 1L0YB 3S2HB 1WTQA 1KTKA 1UNSA 2KJXA 3J7AF 4RH6A 3T51B 4BY1B 4UAIA 4DAYA 1TR5A 2RSNA 5IGGA 4ABNA 4Q5VA 5DNFA 3PV0A 4BWGB 1SJED 2KA7A 1HQRD 3VR2A 5EPKA 2K01A 1OXUA 1D2BA 4PV1C 5KGUA 4RFBA 4ZQ3A 2F0HA 1QCBD 5E4XA 5KYIA 4RCNA 1UAPA 2OXPA 4H0LC 1UUPA 2A6HD 1HQMC 2SDFA 1J9OA 1PMRA 1PRTD 5C0XJ 3NK9A 3K5MA 3PIP3 4WFN3 3M7NA 3K5OA 2EJMA 1PFNA 1WTWA 2F0QA 1D6EC 4ZK9B 3AU7A 1WTVA 3T16A 5EKLA 3BDLA 4L63B 1Z7TA 2NBFA 2A68D 4EQNA 5G3LF 3R3OA 5IGBA 1X3PA 1E2ZA 2NVQB 3GV3A 3TZUA 1G8ZD 1TS4A 2M9VA 2KQ3A 2FFKB 2LKVA 3RUZA 4HAEA 3MXGA 2BDOA 1C4QA 4KMUC 1I4GA 4FF2A 5D65A 4IFDI 2B2VA 5K36H 1SYBA 4A3JB 4DFAA 2KEEA 2V4DA 3X3MA 3I8ZA 4KN4C 1PXUA 2PW7A 1U4LA 2RSOA 4JBWA 1CI3M 4CJ1B 2F4IA 4C3JB 3GTOB 3PUXA 3SR1A 3BZDB 2FJ2A 1I4QA 1O78A 2NB0A 1Y69U 1JE4A 2MP1A 2F0LA 4BS9A 1ZXTA 2BE5C 4BY7B 2WKDA 1QG7A 2E74C 1AFPA 1G2TA 5C6AA 1VF5C 1VMCA 1Z47A 4G7OC 1JB3A 1SJHD 5E1FA 1BR9A 1STYA 1FYCA 1JC7A 3TMEA 4IFDG 1HTPA 3FVQA 5EKKA 5JEAJ 1QE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A69 D;  3GD7 A;  2O5I C;  1H9S B;  2LMC B;  2BE5 D;  3LNN A;  2BA0 A;  2F1M A;  5KNB A;  3N6R A;  3OW7 A;  1GUS A;  3U9S A;  4G7H C;  3OOC A;  1OXV A;  3NE5 B;  3M7N A;  2A6H C;  1GUN A;  3I73 A;  4KKT A;  2CW0 C;  1QJO A;  2EJM A;  1IYV A;  3VR4 A;  2K32 A;  3D4R A;  4H44 C;  5KNC A;  3FPP A;  3M85 A;  1B9M A;  4KKU A;  3IKJ A;  2R6G A;  4TQU S;  1GUG A;  4LK1 C;  2JEB I;  1OXS C;  4DNR B;  1TKW B;  5JEA H;  5C0X H;  1FR3 A;  1H9J A;  1DCZ A;  1Z7T A;  5JEA G;  2JE6 I;  5BN5 A;  2A68 D;  5C0X G;  3QJY A;  1YNN C;  1T5E A;  1IYU A;  1H9K A;  3BG3 A;  3CRK C;  1ONL A;  3MFY A;  2NN6 G;  2NN6 I;  4I7Z C;  3AB9 A;  1LAB A;  3A7A B;  3VR6 A;  3I4L A;  4LJZ C;  3WDN A;  1EWH A;  1E2Z A;  2ZT9 C;  3IFT A;  4KKS A;  4XIG S;  3A8J E;  1BDO A;  3TZU A;  4DK1 A;  1V8Q A;  1Y8O B;  2A68 C;  2K7V A;  3H94 A;  3PUV A;  3ND9 A;  5BN4 A;  2DN8 A;  2QF7 A;  1H9S A;  1VDZ A;  3A8K E;  4OGQ C;  1GHK A;  1Y8N B;  2B8G A;  4KI0 A;  2A6E D;  2KCC A;  1Y8P B;  1CTM A;  2EVB A;  4BA1 I;  2BDO A;  4GZY C;  4OO1 H;  1A6X A;  5K36 G;  2JXM B;  4IFD H;  4KMU C;  3T53 B;  2DNC A;  4KHZ A;  3DXJ C;  1VF7 A;  2AUJ D;  1TU2 B;  3A7L A;  3PUZ A;  1H9M A;  1OXT A;  3LWU A;  1Q12 A;  3W3A A;  2DNE A;  3VR5 A;  5BN3 A;  3HGB A;  5KND A;  5K36 H;  1K8O A;  1IW7 D;  1I6V C;  1Z6H A;  3A8I E;  1E2W A;  2PCF B;  2V4D A;  4IQZ A;  3ND8 A;  3QIA A;  1SMY C;  3MXU A;  3I72 A;  4KN4 C;  1Q1B A;  3T51 B;  1OXX K;  3PUY A;  2EDG A;  1H9R A;  3EQL C;  3VR3 A;  2A69 C;  1Q1E A;  4OO1 G;  2JEA I;  4DNT B;  1G29 1;  1V43 A;  4JBW A;  1CI3 M;  2EJG C;  1HCZ A;  3QG1 A;  2D62 A;  4DK0 A;  3PUX A;  3PV0 A;  2B8F A;  1GJX A;  1DXM A;  1ZYR C;  1K8M A;  1O78 A;  1HPC A;  1GUO A;  3T56 B;  1ZKO A;  1Y69 U;  2K33 A;  1O7L A;  1GHJ A;  3BDO A;  1IW7 C;  2L5T A;  2KA7 A;  3D31 A;  4HR7 B;  4JK1 C;  4L8J A;  4XTC S;  4KN7 C;  3VR2 A;  2BE5 C;  3M4Y A;  2E76 C;  2AWO A;  2A6E C;  3P20 A;  3KLR A;  3SDZ A;  1E2V A;  4G7Z C;  2E74 C;  1DD2 A;  3GQB A;  2BA1 A;  1CFM A;  4H13 C;  4BA2 I;  1LAC A;  1B9N A;  1OXU A;  1Q90 A;  4PV1 C;  1VF5 C;  3OPO A;  2E75 C;  2YYZ A;  3RLF A;  3L7Z C;  5A35 A;  4G7O C;  2NN6 H;  2EJF C;  2PNR C;  3PUW A;  2IT1 A;  1VCI A;  2PPB C;  1YNJ C;  4RCN A;  3FMC A;  3VA7 A;  1FYC A;  4H0L C;  3SE0 A;  4IFD G;  1GUT A;  2O5J C;  3CRL C;  2AUK A;  2A6H D;  1HTP A;  2D5D A;  1HQM C;  4TKO B;  2D2C C;  2Q8I B;  1PMR A; 
#chains in the Genus database with same CATH topology
 2X6L A;  1PHJ A;  1K8A C;  2N8N A;  4UY8 C;  4LF6 L;  4C3J G;  2F0I A;  2K4K A;  1E22 A;  4DR1 Q;  2F0J A;  4IAL A;  1N34 Q;  2JP1 A;  3I7F A;  1ET6 A;  4KTA A;  4A75 A;  2ZTE A;  5C4X G;  3T4A C;  2R6G A;  2E8G A;  4GN4 B;  4KY7 A;  4LFB Q;  4LK1 C;  1E1O A;  1DCZ A;  1SNC A;  4QF4 A;  4QUF A;  4BBS G;  3MEH A;  3BZK A;  4FF1 A;  4C1N K;  1N8R C;  2WP8 J;  2VUM G;  3VR6 A;  2EOT A;  2PI2 E;  2VZA A;  4JI8 L;  5JJL A;  1PTO C;  3W5O A;  4ULL A;  2KOL A;  1IKM A;  3ICE A;  3FKI G;  4A93 H;  1D7Q A;  3V96 A;  3HRZ C;  1N36 L;  1LTR D;  4O0A A;  3MXN B;  1I4X A;  1CHP D;  4IO9 A;  1A6X A;  2WFW A;  2AUJ D;  2JA6 B;  4MZ9 A;  2HHH Q;  2CH4 A;  1D1I A;  5CGK A;  1L1O A;  2NYZ D;  3OYY A;  4OIK A;  1B4O A;  4YWM A;  4HMI A;  2WKC A;  1Y1W G;  5ELC A;  2F3V A;  3RLN A;  4POF A;  1BBX C;  1ROD A;  1PYW D;  5C0X I;  4YWL A;  4DNT B;  3AMU A;  5C3X A;  1RDP D;  4I65 A;  3R2I A;  3CMA A;  5HUR A;  4WRD A;  2YTV A;  4OXP A;  1CHQ D;  3NBH A;  1DXM A;  3BVZ A;  4DR5 L;  4A3M B;  2E2I B;  1GUO A;  1EY5 A;  4A3M H;  5M5W H;  5T1I A;  4KN7 C;  2A74 C;  5M5W B;  1I50 B;  4P74 A;  2WAC A;  1JMC A;  2XRQ D;  3BZC A;  3FPU B;  1EYG A;  1WTX A;  3HOZ H;  2IY5 B;  4XYQ A;  4DR7 L;  3CU7 A;  4M8A A;  1DOM A;  2EYJ A;  5NUC A;  4DR2 Q;  1ASZ A;  3GTJ H;  2WIN B;  1HA5 A;  3KJO A;  5I6Y A;  2K5Q A;  1BCP F;  1GUT A;  4K0K L;  2PW5 A;  4ZCK A;  3SE0 A;  5C44 B;  3F2B A;  1V1O A;  4FP5 D;  4MHE A;  1Y1V B;  1IL2 A;  1SRU A;  3DM3 A;  1XJV A;  3HOZ G;  5IE8 A;  4KKT A;  5J3B A;  4GLV B;  3ULP A;  4H44 C;  3J7Z C;  3HOY G;  1JWS D;  4CBV A;  4MN3 A;  3RN2 A;  2LY7 A;  4LF5 Q;  1C0A A;  4P2C B;  1SE8 A;  2RDG A;  1T9H A;  1KL9 A;  2F0E A;  2WB1 E;  2K50 A;  1EU3 A;  4RG1 A;  2NVQ H;  3KUP A;  1JWM D;  1F77 A;  2VQF Q;  2HCC A;  2EZV A;  2MUY A;  1BDO A;  3KBG A;  3PIP A;  3FRP B;  4DR5 Q;  4QIW E;  2N55 A;  1S5C D;  3A5Z B;  4UHV A;  4LF6 Q;  3S1Q B;  2VL6 A;  2KEN A;  1VF7 A;  5JPN C;  4LF8 L;  4IPH A;  4IUR A;  2Z6K C;  5BN3 A;  4QCL A;  3R93 A;  1K8O A;  1HTL D;  3I90 A;  1Z6H A;  3ZYY X;  2R92 H;  2PCF B;  2OTJ A;  4H7B A;  5IGF A;  5IWA Q;  1TWH B;  4DV2 Q;  2AKW B;  2MO1 A;  2BDN A;  2NVX H;  4Z9C B;  4FO2 A;  2JK8 A;  1TVX A;  4OIJ A;  2XNA C;  1GKH A;  1D5Z C;  3PO2 H;  3CQZ B;  1XTC D;  2M00 A;  3G7L A;  4LF7 Q;  2K5W A;  1TY0 A;  3HOV G;  1YEZ A;  2B8F A;  4IUQ A;  4UDU C;  4NDX A;  4X3U A;  4FXK C;  3VYR A;  4DUZ L;  4ZUJ A;  4FF4 A;  2UUB L;  3BDO A;  1S5F D;  3D31 A;  1IBL L;  2OT2 A;  5KEE A;  4BY1 G;  2UUA L;  4V0B A;  4G7Z C;  3A54 A;  4OX9 Q;  3S1N B;  4JI4 L;  4RKL A;  3I91 A;  5E3F A;  1B9N A;  5EKI A;  1XX8 A;  5M3M H;  1C48 A;  1SYD A;  4P71 A;  3OWF A;  3C2P A;  1EY7 A;  3OW2 A;  2ID0 A;  5FLX E;  3PQI A;  1SNQ A;  2R92 B;  2NZ1 D;  3MC0 B;  1TWH H;  4CJ0 B;  4A3B G;  1SFO H;  4JI2 L;  1NUC A;  4XT3 B;  1HXY D;  4C3H G;  5IT9 E;  1PZK D;  3NXW A;  1SDF A;  1B50 A;  2C5C A;  4QIW B;  1YZ6 A;  2C9O A;  3OIP A;  3RN5 A;  4GKJ L;  5J22 A;  4QGU A;  2B2V C;  4O2D A;  2VQF L;  4X3T A;  3CD6 A;  1BQQ T;  1B8A A;  1WD0 A;  4GOP A;  3W1B A;  2XGT A;  2Z1C A;  4GNX A;  5C0X H;  1VQ8 A;  2HDL A;  2F0T A;  3WOE A;  1VQP A;  2B2Y A;  1KIX A;  3KOJ A;  4NPS A;  1A8V A;  1NBW A;  2K1B A;  1LAB A;  4A3C H;  2AQ3 B;  5ELE A;  5IP7 G;  1LV9 A;  3CPW A;  2ZT9 C;  4KKS A;  5M3M B;  3L2P A;  3A8J E;  1K0R A;  2CCZ A;  4HJA A;  5FLM H;  2MJ8 A;  2F0F A;  3S16 H;  3K80 C;  4JBJ A;  2WAQ E;  1S3O A;  2A6E D;  2KCC A;  1CTM A;  4GZY C;  3GTQ H;  2BH2 A;  4L5R C;  1Q3L A;  2EY5 A;  1VS0 A;  2F0W A;  3TN2 A;  1D5X C;  1PDQ A;  2JA7 H;  3A7L A;  1VQ6 A;  2PZU A;  2IX3 A;  4Y52 H;  2L12 A;  1KXL A;  3VA5 A;  1I94 L;  4IOC A;  2WB1 G;  3K0Y A;  4G4K A;  4KV6 A;  2UUC Q;  3C46 A;  2R7F A;  1UE1 A;  1Q1E A;  2VUM H;  2B2T C;  4JI2 Q;  1TT2 A;  4HJ5 A;  3FP9 A;  4BBR H;  1KNA A;  1HCZ A;  3PO3 B;  2F0G A;  4GN5 A;  4C3I B;  1SNP A;  1ILP A;  4ZLT F;  1DJR D;  3DHQ A;  1MJC A;  3ULJ A;  1EYA A;  5M3F H;  1IW7 C;  2QCP X;  4PMW A;  2X69 A;  1RL2 A;  3UE0 A;  3NHH A;  4FDB A;  3G6J B;  3DWA A;  1DD2 A;  4FNF A;  1CA6 A;  1Q90 A;  1S5E D;  3U50 C;  4L5T A;  3U4V A;  1PH4 A;  2E75 C;  3CCE A;  5A35 A;  3HOW G;  1SSO A;  1WCM B;  2PPB C;  3MTS A;  3VYS A;  1RCV D;  4A76 A;  2R93 G;  5C5L A;  2ICI A;  3T13 A;  5FO8 B;  2V1C C;  1XMQ Q;  2RHS B;  3QOJ A;  3ERS X;  1RTO A;  3TP7 A;  4LF9 Q;  1FJG L;  5KNB A;  1ENC A;  2H5X A;  1IBK Q;  1A63 A;  1KNE A;  1NSN S;  5C3E G;  1IYV A;  4ME3 A;  1SE4 A;  1SYC A;  1I50 H;  1S72 A;  4RWS C;  4GNX B;  2YTX A;  5F2D A;  1STN A;  1L1O C;  1E3P A;  1GUG A;  1II3 A;  4DR3 Q;  1PH5 A;  2ZTC A;  4DR1 L;  5AJ3 Q;  3E6Z X;  1JOQ A;  4AQY L;  1UE7 A;  2QDB A;  4RGO S;  1SMX A;  1X3F A;  4ZAI A;  1QNU A;  4A3M G;  2AWN A;  1XNR L;  2A68 C;  3OIQ A;  3KLS A;  2RF4 A;  2I0Q A;  5C4X H;  3RNU A;  5K5P A;  4JG2 A;  4B08 A;  2JA6 H;  5CBA E;  4YCV A;  5ELF A;  3PUZ A;  3KF8 A;  1TS2 A;  3WOF A;  4IJL A;  2HIX A;  4Y7N B;  4TRD A;  1XPO A;  2L55 A;  1E2W A;  4LUZ A;  3JAM L;  2OWO A;  1MSH A;  4LF7 L;  3GTK H;  2HT1 A;  4B9W A;  3VR3 A;  1X32 A;  5FO7 B;  5IYC G;  2RHQ B;  4B3R L;  4KK7 A;  1JWU D;  1HJP A;  1X9N A;  4U68 A;  3OMC A;  2KHJ A;  4DK0 A;  2DY8 A;  3DEO A;  3E5S A;  1LT6 D;  3I4N H;  1VQ7 A;  4DV1 Q;  4JOI C;  3T56 B;  4YHH Q;  1J5E L;  1FNV A;  3OTO L;  2K33 A;  4LF4 L;  3I4M G;  5GAG C;  3K59 A;  5BR8 L;  2A6E C;  1S5B D;  3K5L A;  3S1R B;  1M1K C;  3GTL B;  1Y1W H;  4IUN A;  4DR3 L;  3CW2 C;  4IFD J;  4O1N A;  4HCE A;  2I07 B;  3D6W A;  1DGS A;  5HY6 A;  4Q0F A;  2EJF C;  3S9W A;  1YBY A;  4KD4 A;  1SFO B;  1HA6 A;  2D0P A;  3SK8 A;  2F0P A;  3CAM A;  4FVM A;  2BH8 A;  1PYB A;  1DOL A;  1FD7 D;  1F2Y A;  2O5I C;  4IZ8 A;  3MAQ A;  4KHV A;  4C2M B;  4DU9 A;  1N33 L;  3A74 A;  5CV7 A;  1KAA A;  4TVA B;  3UE1 A;  1LT3 D;  3LWE A;  4LUV A;  1LTB D;  4JI1 L;  3D4R A;  5C4J H;  3MEF A;  1IKL A;  2XTI A;  4QY7 A;  5IP9 H;  1MD2 D;  2VXW A;  1B9M A;  2VB2 X;  3T1H Q;  1EEF D;  1OXS C;  3QR8 A;  1TKW B;  3GTM H;  2JA5 H;  5A2Q L;  2HUG A;  1EWC A;  4ILW A;  1UWV A;  1H9K A;  1KLU D;  3D8G A;  1QVF A;  1WTH A;  2CQA A;  4CDD C;  2J4X A;  3GTG H;  1R9T H;  1GOZ A;  5D14 A;  4DV5 Q;  2ZJR A;  1YHA A;  2K14 A;  5EPJ A;  4R9W A;  4A3D H;  4DF7 A;  1VQN A;  5EBD A;  4GKK L;  2MHV A;  3K57 A;  1VQC A;  1K83 B;  2N49 A;  1EYD A;  1JJ2 A;  1I4P A;  3KF6 B;  2L4N A;  3T53 B;  4N9T A;  5BR8 Q;  4LFB L;  4K8I A;  5M5Y B;  1ENA A;  1CKN A;  2K5V A;  4DPG A;  3BVG A;  2B2W C;  4DV0 L;  2EYL A;  1F9R A;  2JA6 G;  2IX0 A;  1PH1 A;  3VYT A;  1IBK L;  2QIL A;  4XDX A;  3QIA A;  4IJH A;  3I72 A;  4LF9 L;  4JI0 Q;  1FJG Q;  3S2D H;  1EZ6 A;  1STH A;  3MFG A;  4HN7 A;  4DN4 M;  4JI4 Q;  4B3R Q;  3H09 A;  1B2T A;  1V43 A;  5EBC A;  2EJG C;  3HOV B;  4LAA A;  1EY9 A;  2EPB A;  5I6W A;  3HOZ B;  4JPB W;  3RZO H;  3GDE A;  1EY6 A;  4ZRZ A;  4XXE A;  3NBI A;  3EJI A;  4R1J A;  2ES2 A;  3HFZ B;  4JK1 C;  2P5Z X;  1BXT A;  4RGN A;  1AZP A;  1VQO A;  2AWO A;  4J1M A;  1TII D;  1LYL A;  1CFM A;  1L0X B;  3S1M B;  3HOX G;  3NQI A;  2CKZ B;  2N88 A;  2I46 A;  4BBS B;  4J15 A;  1ICW A;  2B2Y C;  4IPG A;  4PNY A;  1A0I A;  3BJU A;  5CV4 A;  2UXB Q;  4IUP A;  2NN6 H;  1PFB A;  4B3M L;  4NW2 A;  5GAH C;  5DM7 3;  3H0G G;  2RDH A;  2D2C C;  1RIP A;  3P75 A;  3NEN A;  2QEJ C;  1LT5 D;  3EFX D;  1GUS A;  2RBM A;  3U9S A;  2E5L L;  1IL8 A;  2F0S A;  1KAW A;  4A3F B;  3DMU A;  4NXN L;  3NSW A;  3S17 B;  1SMY D;  3NPP A;  1HNZ L;  4IUU A;  3CCQ A;  4N8X 1;  2H1E A;  1JOK A;  4GLA C;  5FLX L;  5JOB A;  2L9H A;  1FGB D;  2EYF A;  5IGD A;  1ESR A;  4HED A;  3R2T A;  4OWX B;  4NXM Q;  1LLR D;  3T1H L;  3E0E A;  1EWH A;  1EY4 A;  3NTI A;  4BY7 G;  3EVQ A;  1PRT B;  3GTQ B;  2TSS A;  2QF7 A;  3A8K E;  2IW3 A;  3H0G B;  3A56 A;  2EVB A;  4AYB G;  1AW7 A;  1U4P A;  1PZJ D;  4CGY B;  1K73 C;  1X3E A;  4WJW A;  3DXJ C;  3ONA B;  3CQZ H;  4K0K Q;  3KK7 A;  4HIM A;  3S14 B;  2DNE A;  3V05 A;  4LW1 A;  3HGB A;  1PVO A;  4J8Q A;  1X3G A;  3TDQ A;  3ND8 A;  3BYY B;  2K04 A;  3C1F A;  3HP3 A;  1O80 A;  4NP5 A;  1VMP A;  4K14 A;  2ZJP A;  3T1Y Q;  4C3I G;  3I4M B;  2YV5 A;  2F03 A;  5M3F G;  1I94 Q;  4XQQ A;  1N34 L;  1ML0 D;  1I4R A;  2AQ2 B;  2KHS A;  3S1R H;  1X6O A;  2EE1 A;  1O7L A;  3SHL A;  4U67 3;  3CF5 A;  3GTL H;  4ZUI A;  2E76 C;  3NWS A;  3K58 A;  1EQV A;  2OQ0 A;  2OTL A;  2JJQ A;  2UUB Q;  3J80 c;  3QWN A;  3I4O A;  2NVY B;  4C3H H;  4KHP L;  3S14 H;  5LL6 S;  5E4W C;  4F87 A;  1KAB A;  3J7A V;  1I3Q B;  1R4Q B;  3HOX B;  2FMM A;  5LMU L;  2F0V A;  1I3Q H;  5C4H A;  5HGQ A;  4TKO B;  3I4N B;  2HQE A;  5GAD C;  3KFU A;  1AEX A;  2NZO A;  3K7U C;  3VYU A;  3K81 C;  5C3E B;  2EY2 A;  1MSG A;  3D4D A;  3IL8 A;  1OO9 B;  3HEJ A;  3DUZ A;  1GUN A;  3S1N H;  3NP8 A;  3BS1 A;  1U4R A;  3PO2 B;  1NMF A;  2K5H A;  4PG3 A;  1FNW A;  4JBK A;  1YNN D;  4DXG A;  4R4Q A;  2JA5 B;  2Z4I A;  3HOW H;  4K6D A;  5FLM G;  2JA5 G;  2PO4 A;  4X3S A;  3SEB A;  1F9S A;  4AH6 A;  1H95 A;  2XSC A;  4DAY B;  2JE6 I;  3GTG B;  3UDX A;  1IYU A;  3CRK C;  5AJ3 L;  1LO5 D;  1EIG A;  2LXJ A;  3I4L A;  2KVM A;  2O4X A;  4DK1 A;  1J6Q A;  1K3B C;  1Y8O B;  1HNW L;  4DV1 L;  3J80 E;  2CW0 D;  2J7Z A;  2DN8 A;  5C4X B;  4DXF A;  1WCM H;  1AH9 A;  4CKE A;  1HRJ A;  4QMG A;  3TRZ A;  4AYB E;  1I5F A;  1KQS A;  2WAQ B;  4XQJ A;  4H02 A;  1E7Z A;  3I70 A;  3M4O H;  1LTA D;  2XWJ B;  1LTI D;  2Z4H A;  2EY1 A;  3W3A A;  4AYB B;  1I6V C;  4N9P A;  3A8I E;  3K7A H;  1KC8 C;  3L0O A;  4AIM A;  4A3E B;  3E3X A;  3PUY A;  2G5D A;  2UXC Q;  1W6K A;  2K5N A;  1JOO A;  2DY7 A;  3M9B A;  3D6C A;  4PQX A;  4V19 0;  4DV4 Q;  5FKA C;  1EY8 A;  2AHO B;  3SVM A;  3NEL A;  2RQX A;  3E9I A;  1YJ9 A;  4X65 Q;  1EL0 A;  3OHX C;  1ESF A;  1HZC A;  1D1K A;  4BA1 I;  1XPU A;  2L5T A;  2N3S A;  4A3G G;  2FHT A;  1SYF A;  5IT9 c;  5KIX A;  1FGU A;  3TP5 A;  4RHR A;  2PQA B;  3B6Y A;  3DWP A;  4L6T B;  1D5M C;  2E2J B;  2WII B;  1S5D D;  2HIV A;  1BBW A;  4NXN Q;  4JI6 L;  2O2L D;  3HKZ E;  3CHB D;  2MGS A;  4APV A;  5FO9 B;  1NJI C;  1KDA A;  3CRL C;  1KDB A;  1M90 C;  1EIF A;  1A2T A;  2PYK A;  1V1P B;  3CCV A;  1XYI A;  2L15 A;  4A3G H;  1JOR A;  2Q8I B;  3IRB A;  3RZO B;  1JT8 A;  2LMC B;  1VQE A;  3ZJY C;  1W6J A;  4X62 L;  4R4O A;  2EYM A;  4G7H C;  3OOC A;  1OXV A;  2VQE L;  4DV5 L;  4MTK A;  4HIO A;  1WTO A;  2CW0 C;  1VQK A;  2ATW A;  4OHJ A;  3G48 A;  2L1B A;  3VR4 A;  2SOB A;  1TY2 A;  2NZH A;  4X65 L;  3CCL A;  1JIC A;  4PZ6 A;  3D3R A;  3S1M H;  4JI7 Q;  1XNQ L;  3GTM B;  2NWG A;  2PZW A;  4A93 B;  4DNR B;  2G9D A;  5JEA G;  4UP8 A;  2Z9H A;  3BG3 A;  1VQ5 A;  2NN6 G;  2JQO A;  3AB9 A;  3A7A B;  3MWY W;  3CC4 A;  2AMC B;  3IFT A;  3AEV A;  1V8Q A;  3CXC A;  1UEB A;  1X3Q A;  1PFM A;  3DWQ A;  3ND9 A;  4CJ2 C;  1K83 H;  2VQE Q;  3CCJ A;  4DV6 L;  3GTK B;  1GHK A;  2KCM A;  1D8L A;  2UU9 L;  4FYD A;  2R7Z G;  1YIJ A;  3HOX H;  4KHZ A;  3OSO A;  3C3L A;  4X66 L;  3VR5 A;  2RDF A;  4RCO A;  2QKI C;  3F2D A;  1PTO H;  4ID6 A;  4EVO A;  2JA8 G;  1SMY C;  1ENF A;  2WV6 D;  1EOV A;  2GA4 B;  2LXK A;  2L0C A;  3UI2 A;  1HUN A;  2GVB A;  1MBY A;  2JYO A;  3KBX A;  2JEA I;  3P7J A;  1G29 1;  1VQB A;  4HSP A;  4POG A;  1F9P A;  2UU9 Q;  1SND A;  5JPM C;  1Q8K A;  1Y14 B;  2G9H D;  5A2Q E;  1L0W A;  2I5H A;  1S40 A;  1CA5 A;  3H3V C;  2ZXR A;  4NKL A;  2HDM A;  4DK6 C;  1GHJ A;  3K5N A;  1DYQ A;  5EJW A;  1YJW A;  2Z6B A;  3M4Y A;  2OEO A;  1SNO A;  3J80 L;  3SDZ A;  1TWC H;  1E2V A;  4R4I A;  5I2Y A;  2PZT A;  4C3H B;  4LUO A;  4KY5 A;  3PSI A;  2UXC L;  5TSS A;  4RKB A;  1N36 Q;  4QL5 A;  1JJG A;  2WAQ G;  2EYH A;  1SYG A;  3L7Z C;  4LFC L;  2VUM B;  2IT1 A;  3GP7 A;  2B63 B;  4DV7 Q;  1GVP A;  5CV6 A;  1HR0 L;  3J81 L;  4QQB X;  1H9J A;  2YTY A;  1XXG A;  2A69 D;  3HOY H;  3LNN A;  1M4V A;  4QB4 A;  2BA0 A;  5IYD H;  4A4I A;  3HOU G;  4IPD A;  3P1H A;  3CCR A;  2QGQ A;  2B2U A;  2VW9 A;  2R93 B;  3T1Y L;  3TBI B;  4A3I G;  1M8A A;  1ILQ A;  4JW0 A;  1O7Y A;  3M85 A;  1KRT A;  1WI5 A;  4KKU A;  4LWC A;  1NMG A;  1PLF A;  5JJZ A;  1Q46 A;  4DAV A;  1SYE A;  1EOT A;  3SK4 A;  4P73 A;  5BN5 A;  3HKZ G;  3ULL A;  4YIJ A;  2PMZ E;  5G3L D;  2IWH A;  1PH7 A;  1LM0 A;  1C8C A;  3ER0 A;  2UXB L;  1A2U A;  3RZD B;  2K7V A;  2MQH A;  3PF5 A;  1G6Z A;  3STB D;  4FF3 A;  4IOA A;  2NVX B;  2CVR A;  4HTH A;  5T1G A;  2B29 A;  4OO1 H;  1CZG A;  3DEP A;  5I4D A;  3CCS A;  1F9Q A;  3FEW X;  4CDE C;  4BBR B;  4DR4 L;  1PV4 A;  3AQQ A;  5KND A;  3ERO A;  4QJF A;  5IWA L;  3FKI H;  1FL0 A;  3S15 H;  1CZW A;  4XT1 B;  1EFW A;  5CC4 A;  3A0J A;  4HID A;  4BY7 H;  1B3A A;  1N33 Q;  3S17 H;  1W3S A;  2F0N A;  4LNQ A;  1H9R A;  3UDI A;  3BDC A;  4A3L H;  2DGY A;  1A3T A;  1SLJ A;  4F8M A;  3D0F A;  1HZB A;  3TZD A;  5EGT A;  2HQL A;  5EQ0 A;  1CSQ A;  1WFQ A;  3RR5 A;  2XRS D;  4C56 C;  2Q8T A;  5E7N A;  3NEM A;  3SGI A;  1QUQ B;  2BA1 A;  2R61 A;  4H13 C;  2OF1 A;  1JR0 D;  2K03 A;  1J8I A;  3GTO H;  4LF4 Q;  3DM1 A;  1KDC A;  4LFA Q;  3H3V I;  1CK1 A;  3HKZ B;  1N32 L;  1Q7Y C;  2NTS A;  2B2T A;  3RLF A;  4F88 A;  4RAU C;  1PH3 A;  5LMN L;  5ELO A;  1VCI A;  4A3G B;  3FMC A;  3A55 A;  1VQD A;  1E0B A;  3X3N A;  2HHH L;  4R8I A;  5LL6 X;  4QUC A;  5ISR A;  4KJN A;  1PH6 A;  1PRT F;  2F1M A;  1SE3 A;  3N6R A;  5EPL A;  3MXP A;  5JJI A;  2QDL A;  1DM0 B;  4UP7 A;  3OMG A;  3PIO 3;  3K6O A;  2CQO A;  5IYD G;  1JB7 A;  3HOW B;  5J1Z A;  1HH2 P;  3IKJ A;  2I5L X;  3JAM i;  3S16 B;  5JEA H;  1GO3 E;  2J0T D;  2KUM A;  1AE3 A;  2NTT A;  1R9T B;  4FXD A;  1HNZ Q;  1N32 Q;  5GQO A;  4RHS A;  1YHQ A;  1BUV T;  1WOC A;  2IHF A;  4JCV E;  2A1A A;  3BVM A;  3Q23 A;  1STB A;  1VDZ A;  1F2L A;  2D9U A;  5CBE E;  4JV5 Q;  1NTG A;  4K2K A;  4K6L A;  5JAV A;  4IFD H;  4K8J A;  5C4J B;  1HNX Q;  1XMO L;  2MO0 A;  1TWF H;  3OTO Q;  3QO2 A;  3LWU A;  1GUW A;  3TSS A;  1WTP A;  3HOY B;  3GTP B;  4DV3 L;  1LUZ A;  3PMF A;  3S2D B;  3JAM E;  4B3S L;  3TP8 A;  2DUD A;  1DOK A;  1WJJ A;  3HG9 A;  5IP7 H;  3F2C A;  4LFC Q;  3MXU A;  4NB3 A;  1Q1B A;  1OXX K;  1KRS A;  3PGZ A;  1U0L A;  4TSS A;  2F3W A;  3QG1 A;  4A3L G;  3J81 i;  1MI2 A;  2JA7 G;  4DR4 Q;  4JI1 Q;  1JCK B;  3EIV A;  4L5Q A;  5M9O A;  1G2S A;  4L8J A;  2LS0 1;  1I4H A;  4DV3 Q;  4A3I H;  3KDF A;  4YCU A;  1UE5 A;  2EYO A;  5IOC A;  2RKS A;  3S24 A;  2YU9 B;  1XMO Q;  4A3B H;  1LAC A;  1LT4 D;  4DAM A;  1EY0 A;  1A15 A;  1TWF B;  1G51 A;  4BBR G;  1FVI A;  1TWA B;  4DR6 L;  4JI6 Q;  1EU4 A;  4LF8 Q;  1VQJ A;  3Q0A A;  1K8G A;  2M2L A;  2F0D A;  3URY A;  1B7Y B;  3FHW A;  3IAY A;  3S15 B;  5M3M G;  5I9O A;  3N52 A;  3ERQ A;  2BE5 D;  4WJ3 M;  1SE2 A;  3J81 E;  3OW7 A;  1RHP A;  1NR4 A;  1S4Z A;  1SRO A;  3NE5 B;  2A6H C;  3I73 A;  1NE3 A;  1RJT A;  4DV7 L;  3KLS X;  2UXD L;  4A3C G;  2C35 B;  4YHH L;  2L11 A;  4DV6 Q;  1J5E Q;  2DJG C;  5KNC A;  3OWE B;  1AE2 A;  1YI2 A;  4J6H A;  3TS2 A;  1CKN B;  2UUA Q;  3D4W A;  3CC2 A;  1EYC A;  1FR3 A;  3STB C;  1ZYR D;  1CKM A;  1VQI A;  2F0M A;  5KYL A;  1T5E A;  1IXR A;  4YCW A;  2LFN A;  1W2B A;  4HJ7 A;  1TS5 A;  4NMZ A;  1QZG A;  2KEC A;  2Y0S E;  1YJN A;  3C1E A;  3IFD A;  1X55 A;  3PCO B;  1CM9 A;  3SK6 A;  3MVV A;  1UEA B;  1MIU A;  1Y8N B;  2B8G A;  4X6A H;  4KI0 A;  2A8V A;  3PO2 G;  1ICF B;  4A93 G;  4RGM A;  5CMD A;  1AN8 A;  4DV2 L;  2TMP A;  2EXZ A;  3NTK A;  1O7Z A;  1QVC A;  1OXT A;  3H3V H;  1XWE A;  3VDY A;  1LTT D;  3WWV A;  1HUM A;  4GLX A;  2E5L Q;  5DLQ E;  4HSV A;  4PZ7 A;  1HHV A;  2K05 A;  4K5W A;  2EDG A;  3CC7 A;  3EQL C;  5JVH 3;  3HKS A;  5IYB H;  3UDF A;  1BNZ A;  2E2D C;  1BO0 A;  2E2J H;  2D0O A;  2D62 A;  4GS3 A;  2XIW A;  3CCM A;  1BF4 A;  2F0U A;  4EQO A;  1CSP A;  1EFI D;  4KY6 A;  1I6H H;  2IX1 A;  1K8M A;  1HPC A;  5M5X H;  4XTC S;  4F7X A;  5CYU A;  5M5X B;  1XMQ L;  2MFI A;  2F0O A;  4LF5 L;  4P75 A;  2DJF C;  4HJ9 A;  1BOS A;  2ALY B;  2FMC A;  3CCU A;  4KLK A;  3TS0 A;  4ZKB B;  3J80 i;  2CH4 W;  1SAP A;  3MHB A;  4A3D G;  3PUW A;  3M4O B;  1UE6 A;  1A3V A;  5ELD A;  2XN9 C;  3SK5 A;  3RD4 A;  4X64 Q;  2R7Z B;  1EQT A;  2D5D A;  3PF4 A;  2A73 B;  4DA2 A;  1B44 D;  1Q81 C;  3MA2 B;  3M4P A;  2FXQ A;  3GD7 A;  1IBM L;  1P16 A;  3HOU B;  4A3J H;  3S2H H;  3NUC A;  4EQP A;  4HIK A;  1SNM A;  4ME5 A;  1QOH A;  2BCO A;  1C9O A;  2RCN A;  4YY3 L;  1XNR Q;  1PTO F;  1QNK A;  4GKJ Q;  1SBB B;  1R4P B;  3M3Y B;  4UPA A;  1U4M A;  3TP6 A;  2B63 G;  3O13 A;  5GRO A;  2IJ0 A;  2QA4 A;  1NAP A;  3QOL A;  1QVG A;  4P72 A;  2Q2T A;  2BOS A;  4FXG C;  2JA7 B;  1Y1V G;  5M5Y H;  4DR6 Q;  3WDN A;  2EYP A;  4DNI A;  3CKI B;  4RA8 A;  1BBU A;  3PUV A;  4LMQ D;  1H9S A;  1HFG A;  1HR0 Q;  2EY6 A;  3CME A;  2JXM B;  1MGS A;  5KRU A;  4JYA Q;  2IL8 A;  3QB3 A;  1TU2 B;  3K7A B;  3DLL A;  1B1Z A;  2OQK A;  2SEB D;  1AZQ A;  4A3E H;  5IOD A;  1KHI A;  3EN2 A;  3KLW A;  4DAP A;  4A3D B;  1SXT A;  2A69 C;  1HR0 W;  3KJP A;  1GM5 A;  3GTJ B;  1EQR A;  1SEB D;  3KF8 B;  4OEM B;  3HS0 C;  2NVY H;  4ALP A;  1PFS A;  1TXY A;  3V2T A;  4JI0 L;  5LMN Q;  1GJX A;  1E24 A;  4K2L A;  3KF6 A;  4A3I B;  3EA6 A;  2VY3 A;  4LFA L;  2NVT H;  3CPF A;  2F52 A;  4HR7 B;  2B2W A;  2JA8 H;  2Q2U A;  2Q2H A;  2MNA A;  3J7Y W;  2EIF A;  1A3U A;  1HFN A;  3KLR A;  1YNJ D;  1B53 A;  1L2F A;  3GQB A;  3FDT A;  1TWG H;  3PO3 H;  1WYD A;  1TWG B;  2JA9 A;  3OPO A;  5FJ8 H;  5ELB A;  4B3M Q;  2PNR C;  4R4T A;  5IGC A;  2CWA A;  2B39 A;  1DZ1 A;  1PH2 A;  1U5K A;  1QUQ A;  1H9S B;  4OX9 L;  2GVA A;  2RVL A;  4MIU A;  4JBM A;  1F2Z A;  1LTG D;  5LMU Q;  3K0X A;  5AFW A;  5CV8 A;  3L3O C;  3FPP A;  5COY A;  4KHP Q;  2VB3 X;  2RA4 A;  5IIF A;  5LHY 1;  2NVT B;  2QEX A;  1I6H B;  1LTS D;  2H4O A;  3KYH C;  2LSS A;  2Q8R E;  2B63 H;  5C0X G;  1EZ8 A;  2RCF A;  1Q86 C;  4OL7 A;  2PQE A;  3BU2 A;  1ONL A;  5C3W A;  1RKN A;  1TWC B;  1PYS B;  4DR2 L;  5IYB G;  1X56 A;  1GXD C;  1VQA A;  4JI5 L;  2GN5 A;  3H94 A;  3G6E A;  1YIT A;  4ZYS A;  4A3K H;  2SNS A;  3RMH A;  1N9W A;  5DAU A;  4AQY Q;  4A3F H;  2VS1 A;  1NY4 A;  4UP9 A;  3JC6 6;  2WB1 B;  4CHT B;  4CKB A;  2R93 H;  1NCV A;  2DNC A;  2FIN B;  4EGV A;  2UUC L;  1STG A;  1H9M A;  1GD7 A;  4EX5 A;  1BCP B;  3S1Q H;  1IW7 D;  2ZM6 L;  4HJ8 A;  5CR3 A;  4KD3 A;  1EIH A;  2KCT A;  1Y1W B;  1LTL A;  2F4V L;  1QWY A;  3G4S A;  2MPM A;  3W2D A;  3M3Y H;  2IPK D;  2K28 A;  5CV5 A;  4OO1 G;  1DON A;  5FOB B;  5COR A;  1JQY D;  1MHW C;  2CHB D;  3H6M A;  1STE A;  1ZYR C;  5CV9 A;  5C44 G;  5IT9 L;  1ZKO A;  3TEH B;  4JC0 A;  1CQV A;  4B9X A;  3RZD H;  3Q22 A;  3R8B A;  3E0J A;  1IHZ A;  1K0S A;  1EQQ A;  4BA2 I;  4S3S A;  2NUC A;  3GO5 A;  2Y0S G;  4IUV A;  3I4M H;  2PNH A;  2K75 A;  2SNM A;  1WD1 A;  4B3S Q;  4JI8 Q;  2IHE A;  3M4Q A;  3I3C A;  1B3Q A;  1YNJ C;  5IGE A;  3VA7 A;  1HNW Q;  2AQ1 B;  1RTN A;  5M3F B;  4DV0 Q;  2O5J C;  5C4Z A;  4PMB A;  3KDF B;  1B70 B;  1OTC A;  5EAY A;  1Q8I A;  3U9O A;  5D3I B;  1TQO A;  1T5X D;  5IYC H;  2KCN A;  4GNX C;  1QJO A;  1ZEQ X;  3MZ5 A;  1XPR A;  4CDC C;  1VQ9 A;  4RMF A;  2B3G A;  1QB5 D;  4A3E G;  4TQU S;  1K28 A;  1NR2 A;  3NQT A;  3SXH A;  1U9R A;  2B2U C;  3PIO A;  3QJY A;  4C2M H;  3F2U A;  3MFY A;  4I7Z C;  1IYJ B;  4A3B B;  4LJZ C;  4ZKC B;  1TS3 A;  2R92 G;  1BKB A;  4IPC A;  5L37 A;  1STA A;  4OGQ C;  1TWA H;  1PRT C;  3NBH B;  2EQS A;  2XVS A;  1Y8P B;  3J81 j;  2ZTD A;  3Q6S A;  1EUJ A;  1BCP C;  5I9P A;  5JVG 3;  4GN3 B;  1KLG D;  1Q12 A;  4DK3 C;  2HCI A;  2UXD Q;  1WVL A;  5JJK A;  3PO3 G;  2E2H B;  4IQZ A;  1V1Q A;  2QW7 A;  1CUK A;  1AP0 A;  2ICE C;  2A5H A;  1V9P A;  2ENB A;  4A3J G;  3AFP A;  4R8N A;  5D3D A;  2YU9 H;  3M7G A;  4HCS A;  4JV5 L;  5J39 A;  4B3T L;  4BBS H;  4M1U B;  2F3I A;  1CKO A;  2JA8 B;  1CQF A;  4C3J H;  2KED A;  1O7I A;  3I4N G;  3HZX A;  3E9H A;  1VQL A;  1PZI D;  5HGT A;  2CWP A;  1VQM A;  4O42 A;  4IN3 A;  1RD9 D;  1RF2 D;  2XWB B;  5DEH A;  3NTH A;  1X54 A;  1IBM Q;  1FNU A;  5IY0 A;  3P20 A;  2X6G A;  4L5S A;  4A3K B;  4XYO A;  4PMC A;  3FKI B;  2JSO A;  5C5M A;  4G57 A;  1PTO D;  2K5D A;  2YYZ A;  5H1S E;  3GV6 A;  4JVZ A;  1XTD A;  3LX0 A;  3Q24 A;  2R7Z H;  2Z8L A;  3J81 c;  2Y0S B;  4YWK A;  1F2M A;  3GTP H;  4CKC A;  2AUK A;  1QIL A;  4N8F A;  1PA6 A;  2VNU D;  4JYA L;  4DUY L;  1E1T A;  3UDG A;  5LMN W;  3ITP A;  4RGT A;  1A62 A;  2Q2I A;  2F0K A;  4R4C A;  1Q82 C;  3H0G H;  2K32 A;  2ZXO A;  3EBE A;  3BYT B;  1L1O B;  1HZA A;  4IUT A;  3I56 A;  1EEI D;  4C1N I;  3A5U A;  4X62 Q;  5I2X A;  1CT1 D;  4MTN A;  1BCP D;  1ET9 A;  2JEB I;  1WTR A;  4KJO A;  4Y7N H;  1WCM G;  2PMZ B;  4I7A A;  5DM6 3;  1JE5 A;  4K5V A;  4X3K A;  1YNN C;  3MXN A;  5FK9 C;  4E6I A;  2NN6 I;  4EQ5 A;  1SR3 A;  3NWT A;  5GAE C;  1G91 A;  3K8A A;  4XIG S;  1V1P A;  2ZXP A;  3L9A X;  4X66 Q;  2R7D A;  1BVS A;  4DGZ A;  4HMJ A;  4ODG A;  1PTO B;  5BN4 A;  4XQN A;  1PH8 A;  4OO1 I;  1ASY A;  3Q8D A;  3H91 A;  4WOR A;  2R3Z A;  3F1Z A;  4C3I H;  5K36 G;  4K5X A;  3H15 A;  2K6A A;  1EIY B;  4OEL B;  1VQ4 A;  4GOP B;  2HD3 A;  1L0Y B;  3S2H B;  1IBL Q;  1WTQ A;  1KTK A;  1UNS A;  2CFM A;  2KJX A;  4BY1 H;  3J7A F;  4RH6 A;  2KHI A;  3T51 B;  3I2Z A;  4BY1 B;  1JJC B;  4UAI A;  3JAM c;  2OCE A;  3I55 A;  4DAY A;  1TR5 A;  4JOI A;  1XNQ Q;  2RSN A;  5IGG A;  4ABN A;  4Q5V A;  5DNF A;  1EWI A;  3PV0 A;  4BWG B;  5C44 H;  1C7Y A;  1SJE D;  2KA7 A;  1HQR D;  3VR2 A;  1MKH A;  3AFQ A;  2K52 A;  1HNX L;  5EPK A;  2K01 A;  2Z6K A;  1MJE A;  1OXU A;  1PH9 A;  1D2B A;  2ASB A;  4PV1 C;  5KGU A;  4RFB A;  4ZQ3 A;  4BXX G;  2F0H A;  1QCB D;  5E4X A;  5KYI A;  4A3F G;  4RCN A;  1VQH A;  1UAP A;  2OXP A;  4H0L C;  4YY3 Q;  1K9M C;  1UUP A;  2A6H D;  1HQM C;  2SDF A;  4OON A;  1J9O A;  1PMR A;  1PRT D;  5C0X J;  1YVC A;  2I5M X;  4OWT B;  3NK9 A;  3K5M A;  1Z9F A;  3PIP 3;  2Z0S A;  4WFN 3;  2A19 A;  4JI5 Q;  3M7N A;  4X64 L;  3K5O A;  2EJM A;  1PFN A;  4DUZ Q;  1Y1V H;  5ELN A;  1WTW A;  2F0Q A;  1D6E C;  4ZK9 B;  3AU7 A;  1WTV A;  3T16 A;  4DUY Q;  5EKL A;  3BDL A;  4OWW B;  1SN8 A;  3J7A 5;  4DV4 L;  4L63 B;  3U58 A;  1Z7T A;  2NBF A;  2A68 D;  5C3E H;  2E2I H;  4EQN A;  5G3L F;  3R3O A;  4A3K G;  5IGB A;  1X3P A;  1E2Z A;  2NVQ B;  3GV3 A;  3TZU A;  3HOU H;  1VQF A;  1G8Z D;  3LGJ A;  1TS4 A;  2M9V A;  2KQ3 A;  4DR7 Q;  2FFK B;  2LKV A;  3RUZ A;  4HAE A;  3MXG A;  2BDO A;  2F4V Q;  1C4Q A;  4KMU C;  1I4G A;  4FF2 A;  5D65 A;  4IFD I;  2B2V A;  3W1G A;  2JN4 A;  1X65 A;  1HZ9 A;  5K36 H;  2ZM6 Q;  1SYB A;  4WJ4 A;  2PQA A;  3TRE A;  4GOP C;  4DFA A;  4A3J B;  2ZJQ A;  2N78 A;  2KEE A;  2V4D A;  4B3T Q;  3X3M A;  3I8Z A;  4DKA C;  4KN4 C;  1PXU A;  4MNO A;  4GKK Q;  2PW7 A;  2KBN A;  1U4L A;  3G71 A;  2RSO A;  4JBW A;  1CI3 M;  4CJ1 B;  2F4I A;  5FLX c;  4C3J B;  1IZ6 A;  3GTO B;  2EXD A;  3CP0 A;  3PUX A;  3F8T A;  3SR1 A;  3BZD B;  3HOV H;  2FJ2 A;  1I4Q A;  1O78 A;  2NB0 A;  5FJ8 G;  1JE4 A;  3TQY A;  1Y69 U;  1KD1 C;  2MP1 A;  2F0L A;  4JI3 Q;  4BS9 A;  4CDF C;  1ZXT A;  2BE5 C;  3U4Z A;  1VQG A;  4BY7 B;  2WKD A;  1YHB A;  1QG7 A;  2E74 C;  1AFP A;  3RLO A;  2E2H H;  1G2T A;  1K3R A;  1NNX A;  5C6A A;  1G6P A;  4JI7 L;  1VF5 C;  1QZH A;  1VMC A;  4JI3 L;  1Z47 A;  4G7O C;  1JB3 A;  1SJH D;  4NXM L;  5IP9 G;  5E1F A;  1BR9 A;  1STY A;  2PI2 A;  4BXX H;  1FYC A;  1JC7 A;  3TME A;  3AYH B;  4IFD G;  1HTP A;  1YNX A;  3FVQ A;  1P8L A;  4PZ8 A;  5EKK A;  5JEA J;  1QE6 A; 
#chains in the Genus database with same CATH homology
 2X6L A;  4C3J G;  2F0I A;  2F0J A;  4IAL A;  2JP1 A;  1ET6 A;  4KTA A;  3T4A C;  2R6G A;  4KY7 A;  4LK1 C;  1DCZ A;  1SNC A;  4QF4 A;  4QUF A;  3MEH A;  4FF1 A;  4C1N K;  2WP8 J;  3VR6 A;  2EOT A;  1PTO C;  4ULL A;  2KOL A;  1IKM A;  3V96 A;  3HRZ C;  1LTR D;  1I4X A;  1CHP D;  1A6X A;  2AUJ D;  2JA6 B;  1D1I A;  5CGK A;  2NYZ D;  4OIK A;  1B4O A;  4HMI A;  2WKC A;  5ELC A;  2F3V A;  1BBX C;  1ROD A;  1PYW D;  5C0X I;  4DNT B;  3AMU A;  5C3X A;  1RDP D;  4I65 A;  3R2I A;  5HUR A;  4WRD A;  1CHQ D;  3NBH A;  1DXM A;  3BVZ A;  4A3M B;  2E2I B;  1GUO A;  1EY5 A;  5T1I A;  4KN7 C;  2A74 C;  5M5W B;  1I50 B;  2WAC A;  2XRQ D;  3FPU B;  1WTX A;  4XYQ A;  3CU7 A;  4M8A A;  1DOM A;  2EYJ A;  5NUC A;  2WIN B;  1HA5 A;  5I6Y A;  2K5Q A;  1BCP F;  1GUT A;  2PW5 A;  3SE0 A;  5C44 B;  1V1O A;  4FP5 D;  4MHE A;  1Y1V B;  4KKT A;  4H44 C;  1JWS D;  4CBV A;  4MN3 A;  2LY7 A;  4P2C B;  2RDG A;  2F0E A;  1EU3 A;  3KUP A;  1JWM D;  1F77 A;  2HCC A;  2EZV A;  2MUY A;  1BDO A;  3KBG A;  3FRP B;  2N55 A;  1S5C D;  3S1Q B;  5JPN C;  1VF7 A;  4IUR A;  5BN3 A;  4QCL A;  3R93 A;  1K8O A;  1HTL D;  3I90 A;  1Z6H A;  3ZYY X;  2PCF B;  4H7B A;  5IGF A;  1TWH B;  2BDN A;  4Z9C B;  4FO2 A;  1TVX A;  4OIJ A;  2XNA C;  1D5Z C;  3CQZ B;  1XTC D;  2M00 A;  3G7L A;  2K5W A;  1TY0 A;  2B8F A;  4IUQ A;  4UDU C;  4NDX A;  4X3U A;  4FXK C;  3VYR A;  4ZUJ A;  4FF4 A;  3BDO A;  1S5F D;  3D31 A;  2OT2 A;  5KEE A;  3S1N B;  4V0B A;  4G7Z C;  3A54 A;  4RKL A;  3I91 A;  5E3F A;  1B9N A;  5EKI A;  1XX8 A;  1C48 A;  1SYD A;  3OWF A;  3C2P A;  1EY7 A;  2ID0 A;  5FLX E;  1SNQ A;  2R92 B;  2NZ1 D;  3MC0 B;  4CJ0 B;  1NUC A;  4XT3 B;  1HXY D;  4C3H G;  5IT9 E;  1PZK D;  3NXW A;  1SDF A;  1B50 A;  2C5C A;  4QIW B;  2C9O A;  3OIP A;  5J22 A;  2B2V C;  4X3T A;  1BQQ T;  1WD0 A;  2Z1C A;  5C0X H;  2HDL A;  2F0T A;  3WOE A;  2B2Y A;  2K1B A;  1LAB A;  2AQ3 B;  5ELE A;  1LV9 A;  2ZT9 C;  4KKS A;  5M3M B;  3A8J E;  2MJ8 A;  2F0F A;  2A6E D;  2KCC A;  4GZY C;  1CTM A;  1Q3L A;  2EY5 A;  2F0W A;  3TN2 A;  1D5X C;  1PDQ A;  3A7L A;  2PZU A;  2IX3 A;  2L12 A;  3VA5 A;  3K0Y A;  4G4K A;  4KV6 A;  3C46 A;  1Q1E A;  2B2T C;  1TT2 A;  1KNA A;  1HCZ A;  3PO3 B;  2F0G A;  4C3I B;  1SNP A;  1ILP A;  4ZLT F;  1DJR D;  3DHQ A;  1EYA A;  1IW7 C;  2QCP X;  4PMW A;  2X69 A;  3NHH A;  3G6J B;  3DWA A;  1DD2 A;  4FNF A;  1CA6 A;  1Q90 A;  1S5E D;  2E75 C;  5A35 A;  1SSO A;  1WCM B;  2PPB C;  3MTS A;  3VYS A;  1RCV D;  5C5L A;  2ICI A;  3T13 A;  5FO8 B;  3QOJ A;  1RTO A;  3TP7 A;  5KNB A;  1ENC A;  1KNE A;  1NSN S;  1IYV A;  1SE4 A;  1SYC A;  4RWS C;  5F2D A;  1STN A;  1GUG A;  1II3 A;  3E6Z X;  1JOQ A;  2QDB A;  4RGO S;  4ZAI A;  1QNU A;  2AWN A;  2A68 C;  3OIQ A;  3KLS A;  5K5P A;  4B08 A;  5CBA E;  5ELF A;  3PUZ A;  3KF8 A;  1TS2 A;  3WOF A;  4Y7N B;  4TRD A;  2L55 A;  1E2W A;  3JAM L;  1MSH A;  4B9W A;  3VR3 A;  1X32 A;  5FO7 B;  4KK7 A;  1JWU D;  4U68 A;  3OMC A;  4DK0 A;  2DY8 A;  3DEO A;  3E5S A;  1LT6 D;  3T56 B;  1FNV A;  2K33 A;  3K59 A;  3GTL B;  3K5L A;  3S1R B;  2A6E C;  1S5B D;  4IUN A;  4IFD J;  4O1N A;  4HCE A;  2I07 B;  3D6W A;  4Q0F A;  2EJF C;  3S9W A;  1HA6 A;  4KD4 A;  1SFO B;  3SK8 A;  2F0P A;  4FVM A;  1DOL A;  1FD7 D;  1F2Y A;  2O5I C;  4IZ8 A;  3MAQ A;  4KHV A;  4C2M B;  4DU9 A;  5CV7 A;  1KAA A;  1LT3 D;  3LWE A;  1LTB D;  3D4R A;  1IKL A;  1MD2 D;  2VXW A;  1B9M A;  2VB2 X;  1EEF D;  1OXS C;  1TKW B;  5A2Q L;  2HUG A;  1EWC A;  4ILW A;  1H9K A;  1KLU D;  3D8G A;  2CQA A;  2J4X A;  1GOZ A;  5D14 A;  5EPJ A;  4R9W A;  4DF7 A;  5EBD A;  2MHV A;  3K57 A;  1K83 B;  1EYD A;  1I4P A;  2L4N A;  3T53 B;  4N9T A;  4K8I A;  5M5Y B;  1ENA A;  3BVG A;  2B2W C;  2EYL A;  1F9R A;  2IX0 A;  3VYT A;  2QIL A;  4XDX A;  3QIA A;  3I72 A;  1EZ6 A;  1STH A;  3MFG A;  4HN7 A;  4DN4 M;  3H09 A;  1B2T A;  1V43 A;  5EBC A;  2EJG C;  3HOV B;  4LAA A;  1EY9 A;  2EPB A;  5I6W A;  3HOZ B;  1EY6 A;  4ZRZ A;  4XXE A;  3NBI A;  3EJI A;  4JK1 C;  1BXT A;  4RGN A;  1AZP A;  2AWO A;  4J1M A;  1TII D;  1CFM A;  1L0X B;  3S1M B;  3NQI A;  2N88 A;  4BBS B;  2I46 A;  1ICW A;  2B2Y C;  4PNY A;  5CV4 A;  4IUP A;  2NN6 H;  1PFB A;  4NW2 A;  5DM7 3;  2RDH A;  2D2C C;  3P75 A;  2QEJ C;  1LT5 D;  3EFX D;  1GUS A;  2RBM A;  3U9S A;  1IL8 A;  2F0S A;  4A3F B;  3DMU A;  3NSW A;  3S17 B;  1SMY D;  3NPP A;  4IUU A;  2H1E A;  1JOK A;  5FLX L;  5JOB A;  2L9H A;  1FGB D;  2EYF A;  5IGD A;  1ESR A;  4HED A;  3R2T A;  1LLR D;  1EWH A;  1EY4 A;  3NTI A;  3EVQ A;  1PRT B;  2TSS A;  2QF7 A;  3A8K E;  2IW3 A;  3H0G B;  3A56 A;  2EVB A;  1AW7 A;  1U4P A;  1PZJ D;  4CGY B;  4WJW A;  3DXJ C;  3ONA B;  3KK7 A;  3S14 B;  2DNE A;  3V05 A;  3HGB A;  4J8Q A;  3TDQ A;  3ND8 A;  3BYY B;  2K04 A;  3C1F A;  3HP3 A;  1O80 A;  4NP5 A;  1VMP A;  4K14 A;  4C3I G;  3I4M B;  2F03 A;  4XQQ A;  1ML0 D;  1I4R A;  2AQ2 B;  2KHS A;  2EE1 A;  1O7L A;  3SHL A;  4U67 3;  4ZUI A;  2E76 C;  3NWS A;  3K58 A;  1EQV A;  3QWN A;  2NVY B;  5LL6 S;  5E4W C;  4F87 A;  1KAB A;  3J7A V;  1I3Q B;  1R4Q B;  3HOX B;  2FMM A;  2F0V A;  5C4H A;  4TKO B;  3I4N B;  2HQE A;  1AEX A;  3VYU A;  5C3E B;  2EY2 A;  1MSG A;  3IL8 A;  1OO9 B;  3D4D A;  3HEJ A;  3DUZ A;  1GUN A;  3NP8 A;  3BS1 A;  1U4R A;  3PO2 B;  1FNW A;  1YNN D;  4DXG A;  2JA5 B;  2Z4I A;  4K6D A;  2PO4 A;  4X3S A;  3SEB A;  1F9S A;  2XSC A;  2JE6 I;  3GTG B;  1IYU A;  3CRK C;  1LO5 D;  1EIG A;  3I4L A;  2KVM A;  2O4X A;  4DK1 A;  1Y8O B;  3J80 E;  2CW0 D;  2J7Z A;  2DN8 A;  5C4X B;  4DXF A;  4CKE A;  1HRJ A;  4QMG A;  2WAQ B;  4XQJ A;  3I70 A;  1LTA D;  2XWJ B;  1LTI D;  2Z4H A;  2EY1 A;  3W3A A;  4AYB B;  1I6V C;  4N9P A;  3A8I E;  4A3E B;  3PUY A;  1W6K A;  1JOO A;  2DY7 A;  3D6C A;  4PQX A;  4V19 0;  5FKA C;  1EY8 A;  3SVM A;  2RQX A;  1EL0 A;  3OHX C;  1ESF A;  1D1K A;  4BA1 I;  2L5T A;  2FHT A;  1SYF A;  5KIX A;  3TP5 A;  4RHR A;  3DWP A;  4L6T B;  1D5M C;  2E2J B;  2WII B;  1S5D D;  2O2L D;  3CHB D;  2MGS A;  5FO9 B;  1KDA A;  3CRL C;  1KDB A;  1A2T A;  2PYK A;  1V1P B;  1XYI A;  1JOR A;  2Q8I B;  3RZO B;  2LMC B;  1W6J A;  2EYM A;  4G7H C;  3OOC A;  1OXV A;  1WTO A;  2CW0 C;  4OHJ A;  2L1B A;  3VR4 A;  2SOB A;  1TY2 A;  1JIC A;  3D3R A;  3GTM B;  2NWG A;  2PZW A;  4A93 B;  4DNR B;  2G9D A;  5JEA G;  3BG3 A;  2NN6 G;  3AB9 A;  3A7A B;  3MWY W;  3IFT A;  1V8Q A;  3GTQ B;  1X3Q A;  1PFM A;  3DWQ A;  3ND9 A;  4CJ2 C;  1GHK A;  3GTK B;  4FYD A;  4KHZ A;  3OSO A;  3C3L A;  3VR5 A;  2RDF A;  4RCO A;  2QKI C;  1PTO H;  4ID6 A;  4EVO A;  1SMY C;  1ENF A;  2WV6 D;  2GA4 B;  2L0C A;  3UI2 A;  1HUN A;  1MBY A;  2JYO A;  3KBX A;  2JEA I;  1G29 1;  3P7J A;  4HSP A;  1F9P A;  1SND A;  5JPM C;  2G9H D;  5A2Q E;  1CA5 A;  3H3V C;  2ZXR A;  4NKL A;  2HDM A;  1GHJ A;  3K5N A;  1DYQ A;  5EJW A;  3M4Y A;  2OEO A;  1SNO A;  3J80 L;  3SDZ A;  1E2V A;  5I2Y A;  2PZT A;  4C3H B;  4KY5 A;  5TSS A;  4RKB A;  2EYH A;  1SYG A;  3L7Z C;  2VUM B;  2IT1 A;  3GP7 A;  2B63 B;  5CV6 A;  3J81 L;  1H9J A;  1XXG A;  2A69 D;  3LNN A;  1M4V A;  4QB4 A;  2BA0 A;  3P1H A;  2B2U A;  2R93 B;  3TBI B;  1M8A A;  1ILQ A;  1O7Y A;  3M85 A;  4KKU A;  1PLF A;  5JJZ A;  4DAV A;  1SYE A;  1EOT A;  3SK4 A;  5BN5 A;  4YIJ A;  5G3L D;  2IWH A;  1C8C A;  1A2U A;  3RZD B;  2K7V A;  1G6Z A;  4FF3 A;  2NVX B;  2CVR A;  4HTH A;  5T1G A;  4OO1 H;  1CZG A;  3DEP A;  5I4D A;  1F9Q A;  3FEW X;  4BBR B;  5KND A;  3ERO A;  1CZW A;  4XT1 B;  5CC4 A;  1B3A A;  2F0N A;  1H9R A;  3BDC A;  1A3T A;  4F8M A;  3TZD A;  5EGT A;  5EQ0 A;  2XRS D;  4C56 C;  2Q8T A;  2BA1 A;  2R61 A;  4H13 C;  2OF1 A;  1JR0 D;  2K03 A;  1J8I A;  3DM1 A;  1KDC A;  1CK1 A;  3HKZ B;  2NTS A;  2B2T A;  3RLF A;  4F88 A;  4RAU C;  4A3G B;  1VCI A;  3FMC A;  3A55 A;  1E0B A;  3X3N A;  4R8I A;  5LL6 X;  4QUC A;  5ISR A;  4KJN A;  1PRT F;  2F1M A;  1SE3 A;  3N6R A;  5EPL A;  3MXP A;  1DM0 B;  3OMG A;  3PIO 3;  3K6O A;  3HOW B;  5J1Z A;  3IKJ A;  3S16 B;  5JEA H;  2J0T D;  2KUM A;  2NTT A;  1R9T B;  4FXD A;  4RHS A;  1BUV T;  3BVM A;  3Q23 A;  1STB A;  1VDZ A;  1F2L A;  2D9U A;  5CBE E;  4K2K A;  4K6L A;  5JAV A;  4IFD H;  4K8J A;  5C4J B;  3QO2 A;  3LWU A;  1GUW A;  3TSS A;  1WTP A;  3HOY B;  3GTP B;  3PMF A;  3S2D B;  3JAM E;  3TP8 A;  3HG9 A;  1DOK A;  3MXU A;  1Q1B A;  1OXX K;  4TSS A;  2F3W A;  3QG1 A;  1MI2 A;  1JCK B;  5M9O A;  1G2S A;  4L8J A;  2LS0 1;  1I4H A;  2EYO A;  5IOC A;  2RKS A;  2YU9 B;  1LAC A;  1LT4 D;  1EY0 A;  1A15 A;  1TWF B;  1TWA B;  1EU4 A;  3Q0A A;  2M2L A;  2F0D A;  3URY A;  3IAY A;  3S15 B;  5I9O A;  3N52 A;  3ERQ A;  2BE5 D;  1SE2 A;  3J81 E;  3OW7 A;  1RHP A;  1NR4 A;  1S4Z A;  3NE5 B;  2A6H C;  3I73 A;  1RJT A;  3KLS X;  2L11 A;  5KNC A;  3OWE B;  4J6H A;  3D4W A;  1EYC A;  1FR3 A;  1ZYR D;  2F0M A;  5KYL A;  1T5E A;  2LFN A;  1TS5 A;  4NMZ A;  2KEC A;  3C1E A;  3IFD A;  1CM9 A;  3SK6 A;  3MVV A;  1UEA B;  1Y8N B;  2B8G A;  4KI0 A;  4RGM A;  5CMD A;  1AN8 A;  2TMP A;  2EXZ A;  3NTK A;  1O7Z A;  1OXT A;  1XWE A;  1LTT D;  1HUM A;  4HSV A;  1HHV A;  2K05 A;  4K5W A;  2EDG A;  3EQL C;  5JVH 3;  1BNZ A;  2E2D C;  1BO0 A;  2D62 A;  2XIW A;  1BF4 A;  2F0U A;  4EQO A;  1EFI D;  4KY6 A;  2IX1 A;  1K8M A;  1HPC A;  4XTC S;  4F7X A;  5CYU A;  5M5X B;  2F0O A;  1BOS A;  2FMC A;  4ZKB B;  1SAP A;  3MHB A;  3M4O B;  3PUW A;  1A3V A;  5ELD A;  2XN9 C;  3SK5 A;  3RD4 A;  2R7Z B;  1EQT A;  2D5D A;  2A73 B;  4DA2 A;  1B44 D;  3MA2 B;  3GD7 A;  3HOU B;  3NUC A;  4EQP A;  1SNM A;  4ME5 A;  1QOH A;  2BCO A;  1PTO F;  1QNK A;  1SBB B;  1R4P B;  3M3Y B;  1U4M A;  3TP6 A;  3O13 A;  2IJ0 A;  1NAP A;  3QOL A;  2BOS A;  4FXG C;  2JA7 B;  3WDN A;  2EYP A;  3CKI B;  4RA8 A;  3PUV A;  4LMQ D;  1H9S A;  1HFG A;  2EY6 A;  2JXM B;  1MGS A;  5KRU A;  2IL8 A;  3QB3 A;  1TU2 B;  3K7A B;  1B1Z A;  2SEB D;  1AZQ A;  5IOD A;  4DAP A;  4A3D B;  1SXT A;  2A69 C;  3GTJ B;  1SEB D;  3HS0 C;  3V2T A;  1GJX A;  4K2L A;  4A3I B;  3EA6 A;  4HR7 B;  2B2W A;  3J7Y W;  1A3U A;  1HFN A;  3KLR A;  1YNJ D;  1B53 A;  3GQB A;  3FDT A;  1TWG B;  3OPO A;  5ELB A;  2PNR C;  5IGC A;  2B39 A;  1DZ1 A;  1H9S B;  2RVL A;  4MIU A;  1F2Z A;  1LTG D;  5AFW A;  5CV8 A;  3L3O C;  3FPP A;  5COY A;  2VB3 X;  2RA4 A;  5IIF A;  5LHY 1;  2NVT B;  1I6H B;  1LTS D;  2H4O A;  2Q8R E;  5C0X G;  1EZ8 A;  4OL7 A;  2PQE A;  1ONL A;  5C3W A;  1RKN A;  1TWC B;  1GXD C;  3H94 A;  4ZYS A;  2SNS A;  3RMH A;  5DAU A;  2WB1 B;  4CHT B;  4CKB A;  1NCV A;  2DNC A;  2FIN B;  4EGV A;  1STG A;  1H9M A;  1BCP B;  1IW7 D;  5CR3 A;  4KD3 A;  1EIH A;  1Y1W B;  1QWY A;  2MPM A;  3W2D A;  2IPK D;  2K28 A;  5CV5 A;  4OO1 G;  1DON A;  5FOB B;  5COR A;  1JQY D;  2CHB D;  3H6M A;  1STE A;  1ZYR C;  5CV9 A;  5IT9 L;  1ZKO A;  1CQV A;  4B9X A;  3Q22 A;  3R8B A;  3E0J A;  1IHZ A;  4BA2 I;  4S3S A;  2NUC A;  3GO5 A;  4IUV A;  2SNM A;  1WD1 A;  3I3C A;  1YNJ C;  5IGE A;  3VA7 A;  2AQ1 B;  1RTN A;  5M3F B;  2O5J C;  5C4Z A;  4PMB A;  1Q8I A;  3U9O A;  5D3I B;  1TQO A;  1T5X D;  2KCN A;  1QJO A;  1ZEQ X;  3MZ5 A;  1QB5 D;  4TQU S;  1NR2 A;  3NQT A;  3SXH A;  1U9R A;  2B2U C;  3QJY A;  3F2U A;  3MFY A;  4I7Z C;  4A3B B;  4LJZ C;  4ZKC B;  1TS3 A;  1STA A;  4OGQ C;  1PRT C;  2XVS A;  1Y8P B;  3Q6S A;  1BCP C;  5I9P A;  5JVG 3;  1KLG D;  1Q12 A;  2HCI A;  1WVL A;  2E2H B;  4IQZ A;  1AP0 A;  2ICE C;  2A5H A;  2ENB A;  4R8N A;  5D3D A;  3M7G A;  4HCS A;  5J39 A;  4M1U B;  2JA8 B;  1CQF A;  2KED A;  3HZX A;  1PZI D;  5HGT A;  4O42 A;  4IN3 A;  1RD9 D;  1RF2 D;  2XWB B;  5DEH A;  3NTH A;  1FNU A;  3P20 A;  2X6G A;  4A3K B;  4XYO A;  4PMC A;  3FKI B;  2JSO A;  5C5M A;  4G57 A;  1PTO D;  2K5D A;  2YYZ A;  3GV6 A;  3LX0 A;  3Q24 A;  2Z8L A;  2Y0S B;  1F2M A;  4CKC A;  2AUK A;  1QIL A;  2VNU D;  4RGT A;  3ITP A;  2F0K A;  2K32 A;  2ZXO A;  3BYT B;  4IUT A;  1EEI D;  4C1N I;  5I2X A;  1CT1 D;  1BCP D;  1ET9 A;  2JEB I;  1WTR A;  4KJO A;  2PMZ B;  5DM6 3;  4K5V A;  4X3K A;  1YNN C;  3MXN A;  5FK9 C;  4E6I A;  2NN6 I;  3NWT A;  1G91 A;  4XIG S;  1V1P A;  2ZXP A;  3L9A X;  5BN4 A;  4DGZ A;  4HMJ A;  4ODG A;  1PTO B;  4XQN A;  4OO1 I;  3H91 A;  4WOR A;  2R3Z A;  5K36 G;  4K5X A;  2K6A A;  1L0Y B;  3S2H B;  1WTQ A;  1KTK A;  1UNS A;  2KJX A;  3J7A F;  4RH6 A;  3T51 B;  4BY1 B;  4UAI A;  4DAY A;  1TR5 A;  2RSN A;  5IGG A;  4ABN A;  4Q5V A;  5DNF A;  3PV0 A;  4BWG B;  1SJE D;  2KA7 A;  1HQR D;  3VR2 A;  5EPK A;  2K01 A;  1OXU A;  1D2B A;  4PV1 C;  5KGU A;  4RFB A;  4ZQ3 A;  2F0H A;  1QCB D;  5E4X A;  5KYI A;  4RCN A;  1UAP A;  2OXP A;  4H0L C;  1UUP A;  2A6H D;  1HQM C;  2SDF A;  1J9O A;  1PMR A;  1PRT D;  5C0X J;  3NK9 A;  3K5M A;  3PIP 3;  4WFN 3;  3M7N A;  3K5O A;  2EJM A;  1PFN A;  1WTW A;  2F0Q A;  1D6E C;  4ZK9 B;  3AU7 A;  1WTV A;  3T16 A;  5EKL A;  3BDL A;  4L63 B;  1Z7T A;  2NBF A;  2A68 D;  4EQN A;  5G3L F;  3R3O A;  5IGB A;  1X3P A;  1E2Z A;  2NVQ B;  3GV3 A;  3TZU A;  1G8Z D;  1TS4 A;  2M9V A;  2KQ3 A;  2FFK B;  2LKV A;  3RUZ A;  4HAE A;  3MXG A;  2BDO A;  1C4Q A;  4KMU C;  1I4G A;  4FF2 A;  5D65 A;  4IFD I;  2B2V A;  5K36 H;  1SYB A;  4A3J B;  4DFA A;  2KEE A;  2V4D A;  3X3M A;  3I8Z A;  4KN4 C;  1PXU A;  2PW7 A;  1U4L A;  2RSO A;  4JBW A;  1CI3 M;  4CJ1 B;  2F4I A;  4C3J B;  3GTO B;  3PUX A;  3SR1 A;  3BZD B;  2FJ2 A;  1I4Q A;  1O78 A;  2NB0 A;  1Y69 U;  1JE4 A;  2MP1 A;  2F0L A;  4BS9 A;  1ZXT A;  2BE5 C;  4BY7 B;  2WKD A;  1QG7 A;  2E74 C;  1AFP A;  1G2T A;  5C6A A;  1VF5 C;  1VMC A;  1Z47 A;  4G7O C;  1JB3 A;  1SJH D;  5E1F A;  1BR9 A;  1STY A;  1FYC A;  1JC7 A;  3TME A;  4IFD G;  1HTP A;  3FVQ A;  5EKK A;  5JEA J;  1QE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...