3CRKC

Crystal structure of the pdhk2-l2 complex.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
87
structure length
86
Chain Sequence
SYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pyruvate dehydrogenase [lipoamide] kinase isozyme 2, mitocho
publication title Structural and functional insights into the molecular mechanisms responsible for the regulation of pyruvate dehydrogenase kinase 2.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 12
structure length 86
sequence length 87
chains with identical sequence D
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2008-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3crkC00
1PMRA 1DXMA 1OXXK 1Q1EA 1OXVA 5JEAH 5KNDA 1K8OA 4DK0A 4BA2I 4TKOB 2EDGA 2R6GA 4IQZA 5C0XH 1H9SB 1I6VC 3ND8A 1OXSC 3T56B 1H9RA 1Q1BA 2BE5C 3QIAA 2YYZA 2PCFB 2CW0C 1BDOA 1ZKOA 3OW7A 3VR3A 3VR6A 2A68D 3NE5B 1YNJC 1GUGA 3A8JE 1Z7TA 4OGQC 1GJXA 1E2VA 1IYUA 2E74C 3OOCA 3IKJA 2B8GA 3M4YA 2D5DA 2O5JC 1H9SA 3A8IE 4KI0A 3QJYA 2A68C 3I73A 4OO1H 1TKWB 2D62A 3QG1A 1OXUA 1GUOA 1TU2B 1ZYRC 2KCCA 3A7LA 1E2ZA 3VR5A 4H13C 1E2WA 2BE5D 3T51B 2JXMB 3PV0A 1O7LA 2V4DA 3HGBA 3I4LA 4TQUS 3D4RA 3AB9A 1HPCA 4XTCS 1H9KA 2E76C 2EJMA 3OPOA 5K36G 3DXJC 4G7HC 1VF5C 4BA1I 4G7ZC 4JK1C 2O5IC 4KKTA 3TZUA 2AUJD 3CRKC 1GUTA 2F1MA 3BDOA 2L5TA 5BN5A 1G291 1CFMA 3SE0A 3T53B 1B9MA 4L8JA 1DD2A 2A6EC 2DNCA 3RLFA 4KN7C 2NN6G 1V8QA 1IW7C 3H94A 4IFDG 1OXTA 1HQMC 4KN4C 2ZT9C 4KKUA 4XIGS 1GHJA 3CRLC 3FPPA 1QJOA 2K32A 4LJZC 2K7VA 2BDOA 2E75C 3PUVA 3GQBA 3P20A 5BN3A 4G7OC 3M85A 1LABA 4DK1A 3FMCA 4PV1C 5KNBA 1Y8OB 2PNRC 3MXUA 3ND9A 4HR7B 2EJFC 1Y8PB 5JEAG 1FYCA 2AUKA 3VR2A 2AWOA 3SDZA 4JBWA 2A6ED 3PUXA 2A69D 1O78A 3LWUA 1YNNC 1VCIA 3L7ZC 5C0XG 1IW7D 3A8KE 1CTMA 4H0LC 4KKSA 1H9MA 4RCNA 3IFTA 3W3AA 2NN6I 4H44C 3M7NA 2A69C 2BA1A 2LMCB 2PPBC 2EVBA 2QF7A 1GHKA 1DCZA 1VDZA 1GUSA 1GUNA 2B8FA 2DNEA 4KHZA 1Y69U 2A6HC 5KNCA 5K36H 3LNNA 1FR3A 1Q12A 2D2CC 3MFYA 3U9SA 3PUYA 1CI3M 1ONLA 1SMYC 1Z6HA 4DNRB 2IT1A 2JEAI 1V43A 5BN4A 1T5EA 4KMUC 3D31A 4OO1G 2EJGC 3A7AB 2JEBI 1HCZA 1Q90A 1LACA 3I72A 1K8MA 3N6RA 1VF7A 2Q8IB 5A35A 1Y8NB 4DNTB 2KA7A 2NN6H 1B9NA 2DN8A 1EWHA 3BG3A 4GZYC 1HTPA 3GD7A 2JE6I 4IFDH 3PUZA 3VA7A 3VR4A 3WDNA 1A6XA 3EQLC 2A6HD 1H9JA 3PUWA 4LK1C 2K33A 3KLRA 4I7ZC 1IYVA 2BA0A
chains in the Genus database with same CATH superfamily
4J8QA 1XNRQ 2ZTDA 1R9TB 1XNRL 2WV6D 2B63B 4A3KG 2Q8RE 1U4RA 4O0AA 2F52A 1PH7A 5IP9G 2MPMA 4OX9Q 1LM0A 4OX9L 1GJXA 4K6DA 5J22A 4NXNQ 4X65Q 2B2VA 3NWSA 4NXNL 1QZHA 3I4NG 2B8GA 1V1OA 4N9TA 3I73A 4HJ7A 1FD7D 1E3PA 3K5OA 1NE3A 4QUCA 4PG3A 2PMZE 1LTID 4LMQD 2ZXPA 4PZ8A 3D4RA 3D6CA 3M4PA 1X9NA 4Y7NH 3HG9A 1MHWC 2F0SA 4RG1A 3Q8DA 1EQRA 1WTPA 1JJ2A 2F1MA 3TS2A 1A63A 1G291 3H09A 2DNCA 3V2TA 4GN4B 4AH6A 5I9OA 1OXTA 5JJKA 5GAHC 4R8NA 1QJOA 2JA5H 4FDBA 5TSSA 4ILWA 1LT5D 4K2KA 3G4SA 4DR2Q 5KNBA 4DR2L 1XJVA 5KYIA 4FXDA 4OWXB 3ULJA 4DR4Q 1EIYB 2AWOA 4BBSB 4DR4L 4HTHA 3G7LA 3PQIA 2ENBA 5CV4A 5H1SE 4C2MB 1MJCA 4RHSA 3HOYH 1HUMA 4ZUIA 3PIOA 4K14A 1SDFA 3GTMH 4I7AA 3M7NA 3UDIA 5E4WC 3UDXA 1Y69U 2NVQH 2EY5A 1N8RC 1BBXC 5I9PA 4C3JH 1L0XB 1EEID 2IT1A 2LKVA 3A5UA 5BN4A 2IHFA 2EJGC 1K83B 3CCQA 1JICA 1K73C 2PQAB 3JAML 3T16A 2PZTA 1WTQA 1XTDA 4JBKA 1LO5D 1A2TA 3E9HA 5C0XI 3K8AA 2AQ2B 1ICWA 1DONA 1PTOH 3KLRA 1CKNA 4JYAQ 1KLGD 4JYAL 1A0IA 2BCOA 5IGEA 2F3IA 4HCEA 5M9OA 2VQFL 1UE7A 3C46A 1VQIA 2HIVA 4QUFA 4MTNA 1AE2A 4A3JH 4DFAA 2PCFB 1QB5D 4UP7A 1X3QA 5IGFA 4JI4Q 1DM0B 3OIQA 3RLOA 4JI4L 3PO3G 2M2LA 3PMFA 3GTLH 1TY2A 3HOUG 2EY2A 5JAVA 5M5WB 2OEOA 4H7BA 2D5DA 2VS1A 1U9RA 4A3IB 5ELFA 4F88A 3VR5A 1FGBD 2HUGA 2HQLA 1VQPA 3S2DH 3HKZG 4TQUS 5AJ3Q 1QE6A 5AJ3L 2NZHA 1AEXA 1WTWA 1KRTA 4G7HC 4G7ZC 1CZGA 2UXCQ 1IXRA 1J9OA 3GV6A 1KIXA 2UXCL 3CF5A 3SHLA 3BDOA 3TP7A 5M5YB 5I6YA 3SE0A 2B2TC 3T53B 3OWFA 5GQOA 3R2IA 4KN7C 3MVVA 5G3LF 4QMGA 1A15A 2NVTB 3S14B 2KCTA 3ZJYC 3FMCA 3HS0C 1G2TA 1LTTD 2HQEA 1RHPA 2KUMA 3STBD 2B2WC 2F0FA 2A6ED 3PUXA 1GD7A 1Q8KA 2JA8B 1ZXTA 4JC0A 2L12A 4A3LH 5JPNC 2R7ZG 2R93H 3Q6SA 4A76A 4KY6A 3NXWA 5J1ZA 4WORA 3HOVH 3J80i 3AYHB 1EU4A 1RTNA 4DV2Q 2KCNA 4OL7A 2F0EA 1EQVA 4DV2L 5A35A 4CDDC 3KLSX 3AQQA 2L0CA 3SK5A 3TSSA 3J81E 2ZJPA 3GD7A 4BY1H 3I4MG 1VQJA 2EYHA 2VZAA 5K5PA 4IOAA 4DF7A 1Z9FA 2A6HD 3OYYA 1WD1A 1QILA 3BZCA 2AQ1B 3EROA 1GM5A 3TRZA 1Q8IA 5FLMH 1A3TA 1OXVA 3K7AH 4JI6Q 4JI6L 1KAWA 1I4PA 2BOSA 3OMGA 2F0KA 4XT3B 5C3EG 4YHHQ 1EOVA 2B2UC 4YHHL 4IUPA 1I3QB 3CW2C 3QOLA 5EKLA 4FF2A 1IKMA 4DV5Q 1EUJA 4DV5L 1UWVA 4HMIA 3IFDA 2JA7H 2D0PA 1CKOA 2RF4A 1ZKOA 2I07B 5C3XA 3OW7A 2AHOB 2A68D 2KOLA 1VQ6A 1ML0D 1IYUA 1NTGA 1BR9A 3NELA 4A3MG 4A3GB 2I0QA 2XNAC 5JVG3 1PH5A 5IYBH 1TKWB 1GUOA 3URYA 4KK7A 1LLRD 1UNSA 1SYBA 4UHVA 2V4DA 3I4LA 1SROA 5A2QE 1QCBD 1PYSB 3S15B 2EJMA 3E9IA 2P5ZX 2EYMA 1BVSA 3FP9A 4KKTA 2RSOA 3I4OA 1XPRA 3J7AV 5IGCA 2Z6KC 2IY5B 4A3KB 4JV5Q 4EVOA 1SE8A 4JV5L 1G91A 1UUPA 1D6EC 4YWKA 2VW9A 4DK3C 2ZT9C 4DXFA 3I56A 1K3BC 1XPUA 3BVZA 1C8CA 1U5KA 1X3EA 2FINB 3M85A 5C44H 2VUMH 3PF5A 4RH6A 1PTOD 1XWEA 3DWQA 3GTQH 1YNXA 5COYA 4N8X1 1EZ8A 1VQLA 4QB4A 1O80A 1A2UA 2Y0SE 4POGA 1PH1A 2PZUA 4WJ4A 3MEHA 2Y0SG 5C0XG 3OMCA 4RKLA 2HDLA 1FJGQ 1FJGL 4CKBA 3S1RH 2XIWA 2AWNA 4ZRZA 2UU9Q 2UU9L 1Z6HA 1SMYC 2QEXA 3D31A 4FF1A 2XWBB 2KCMA 4O42A 1KLUD 1W3SA 3MFGA 1S4ZA 2OTLA 1AE3A 1K0SA 1I4GA 2J7ZA 2NN6H 2O4XA 2B63G 1BXTA 2E2DC 2K5WA 4QGUA 4HIKA 1SYDA 3P7JA 5IODA 1L1OC 4J15A 3PUWA 1JJGA 2J0TD 1PMRA 4IUVA 2ZJQA 5HY6A 4YWMA 3HOWH 3SVMA 4ZAIA 1R9TH 3GTPH 1SE3A 1E7ZA 3S1NB 4DK0A 2Z9HA 3I55A 1PRTF 4JI3Q 3NBIA 4JI3L 4P74A 2K6AA 5IWAQ 5IWAL 1SE2A 3BVMA 1WTHA 3NHHA 1DYQA 3CAMA 2M9VA 3S1QB 1PVOA 2H4OA 4IJHA 5DEHA 3T1YL 1H9SA 1L1OB 4ALPA 3CCRA 3QG1A 5CV8A 2UUAQ 2UUAL 3D3RA 2EYOA 4NB3A 1VQOA 1E2WA 3T51B 1K28A 3PV0A 3ULLA 3HGBA 3GTJB 4LF6Q 1A62A 4LF6L 1SRUA 1AN8A 1EU3A 4A3EH 3J80c 3TZUA 1XMQQ 5BN5A 1SFOH 1XMQL 3M4OH 4DAMA 3DWAA 2ZXRA 5JJZA 2QDLA 4KKUA 4FYDA 1VQ4A 1YJ9A 5AFWA 1X6OA 1YHBA 3I2ZA 3OWEB 1U4MA 2Q2TA 3HOUB 3TMEA 1D5XC 4BBSH 3TDQA 1IW7D 5FO7B 1P8LA 3HKZB 2BA1A 2EYJA 2MHVA 2EVBA 1KC8C 3PCOB 4IFDI 1J8IA 1GHKA 2K01A 4CHTB 5K36H 3VYSA 4DV6L 2D9UA 3MXGA 3KYHC 4JVZA 3PIP3 1EY6A 2JN4A 4OEMB 4PMCA 3E0JA 4DAYA 4P72A 2F0OA 3CCVA 3MTSA 3D4DA 3CC4A 3I3CA 1EWHA 5M3MG 1C9OA 1WTOA 1SNOA 3NTIA 3K81C 4I7ZC 2BA0A 2OF1A 3H0GH 1Q86C 1E22A 5C4JB 3RZDH 1G6PA 1TWGB 2XRSD 2NBFA 3GTOH 4OO1I 3G71A 4BXXG 1YNJD 3CKIB 2F0WA 3W2DA 5IGDA 4A3IG 1DZ1A 2V1CC 3U50C 1ZEQX 2EYPA 3OW2A 1MKHA 1QWYA 2CQAA 3GTKH 1CA5A 1RCVD 3TP8A 5M5WH 1UE1A 3G48A 3QJYA 2F4IA 2GVBA 3VDYA 2Q8TA 1SNCA 5I4DA 1EFID 1CA6A 2TMPA 3H91A 4ZKBB 1EQQA 1F2YA 4RAUC 3CQZH 2K5QA 2C5CA 2KENA 2QCPX 2K50A 2OTJA 5J3BA 1TR5A 4K0KQ 4K0KL 3K5MA 3S2HH 5C4HA 4RGOS 3R2TA 1FL0A 1W6KA 3DM3A 5M5YH 2VQEQ 4B3SQ 2VQEL 4B3SL 3NBHB 1WYDA 1PH8A 4EQPA 4A3DG 2B2VC 2RA4A 2JA6H 1GHJA 2LXJA 3BDLA 1IKLA 5BN3A 4P73A 1D7QA 2X69A 2WFWA 3S14H 2MNAA 4A93H 5C4ZA 1EIGA 1WTVA 1QVCA 1CT1D 1FYCA 3CXCA 1JWMD 3HZXA 5HURA 5LMNW 4DUYQ 1TVXA 3NK9A 4DUYL 1AP0A 2JA8H 4PZ6A 3W3AA 4MZ9A 1Z47A 4QIWB 5I2XA 1Y1VG 3UE1A 2HCCA 1CM9A 1KNEA 4DNRB 4GKJQ 1T5EA 1S3OA 4GKJL 1UAPA 1PFNA 1BCPC 1B4OA 1YNND 5IYCH 2YU9H 3N6RA 2BH8A 1HXYD 3IRBA 2H1EA 3OSOA 4MN3A 4DU9A 5M3FG 4FO2A 1STYA 2DY7A 1PRTC 4X3SA 4Y52H 2L1BA 3K5LA 4LF4Q 4NPSA 4LF4L 2YV5A 4DV7Q 1EWIA 2RCNA 3GTGH 4DV7L 3KBGA 4TRDA 4RHRA 2FJ2A 3TN2A 1BF4A 1SJHD 3Q23A 3EA6A 4TKOB 5FLXc 1NAPA 3S16H 4UP8A 1I3QH 3H3VC 4ZLTF 1Q1BA 1BCPB 2NTTA 4KD3A 2RBMA 5D3IB 2F3VA 5IGGA 2K5VA 4DR6Q 4DR6L 4DA2A 5FK9C 1PRTB 1HNWQ 2NUCA 1HNWL 1JE5A 1G2SA 4A3GH 5LMNQ 3KF8A 5LMNL 2PW5A 2QA4A 3C3LA 3GO5A 4HMJA 3MXNA 4DUZQ 2WACA 4N9PA 1EWCA 4DUZL 4B3TL 4B3TQ 4GN3B 4EQOA 4X64L 2WAQB 4LFCQ 1KDBA 4P2CB 4LFCL 5EGTA 3CCLA 2E76C 2XN9C 3DXJC 4CDEC 1VF5C 3F2DA 4DR5Q 4DR5L 4B3MQ 4B3ML 4LUOA 2K14A 3UE0A 1WOCA 4BS9A 1CFMA 1YHAA 4A3KH 2WKCA 3VYTA 4L5QA 2GA4B 4IFDG 2E2JB 1STHA 4IPCA 3FPPA 2K04A 5IP9H 4BY7G 3CCMA 1HNZQ 3DHQA 1CKNB 4LFAQ 1HNZL 1RF2D 5JJLA 2B2YA 4LFAL 3S17H 2R7FA 4GN5A 2EIFA 2DJGC 3I4NH 3L7ZC 3U58A 4RFBA 4JBJA 4R9WA 3BYTB 1K3RA 2L15A 2JYOA 1S5CD 3BDCA 1TWFH 3CMEA 4V190 1KAAA 4X6AH 3BU2A 4UP9A 1X55A 3KLSA 2OQKA 5IGBA 3LNNA 3AFPA 2ZM6Q 4K5WA 2ZM6L 3HOZB 2K03A 2Z1CA 5KEEA 4OO1G 1WI5A 2OWOA 4OIJA 1TXYA 1D1KA 4A3FB 2DN8A 4GZYC 1Q82C 2RVLA 1C48A 3WDNA 3UI2A 1MGSA 1A6XA 2K33A 1VQKA 2R92G 1WCMG 3GP7A 4AYBB 3J7A5 1IHZA 4A3CG 2WB1B 4HIDA 1CK1A 3J80E 1JT8A 1EY0A 3I70A 1A3UA 2CQOA 3QIAA 3VR3A 3VR6A 3QOJA 2VL6A 4X3KA 1JR0D 1Z7TA 1E2VA 1YZ6A 2E74C 2Q2HA 3NQIA 3OOCA 3S1QH 1SYEA 2O5JC 4L63B 3A8IE 1CSPA 2D62A 4K6LA 2K5NA 4CKCA 4Q0FA 1JQYD 1LT6D 4WFN3 5M3MB 2BE5D 1II3A 2VQFQ 3KBXA 4GLAC 3K0YA 3GTJH 5FO8B 1N33Q 2ICEC 4BA1I 2AQ3B 1VS0A 2ICIA 1N33L 3DEPA 1LTGD 1VQ7A 3KF6B 1PYBA 5E3FA 2EOTA 1B9MA 2E2IH 3QO2A 3FKIB 3F2BA 1YIJA 3K57A 3LX0A 4BBRB 5IP7G 3H3VI 5C6AA 4JI8Q 4JI8L 4IUUA 1PTOF 1LABA 1MD2D 3HKZE 4A75A 1WTXA 3PO3H 2DJFC 1IYJB 2RHQB 4PV1C 2PNRC 2KBNA 3HOUH 1PA6A 2EYLA 4JBWA 1DJRD 2UUBQ 4LFBQ 2UUBL 5C0XJ 4LFBL 1BBUA 1VCIA 1RDPD 2KVMA 2F0HA 2YTVA 3FHWA 4OONA 1YEZA 2CKZB 3A55A 5LL6S 1YHQA 5IE8A 2A69C 2NVXH 5IYDH 1EY9A 3D6WA 1CZWA 1G8ZD 3DMUA 2K5HA 4M8AA 2CFMA 3RN2A 2F0VA 2E2HB 1WFQA 1MSHA 1HRJA 3PIO3 3I72A 3EJIA 5GROA 1Y8NB 1Q81C 4A3DB 1A3VA 4F7XA 2A73B 1I6HH 4YWLA 2EYFA 5EQ0A 2C9OA 1U4LA 3DLLA 2F0IA 5CV9A 2PQAA 5ELOA 5DM73 3K58A 2XRQD 1XX8A 3RR5A 1Y1WH 1F9QA 1F2ZA 4IJLA 3JAMi 1K8OA 1I4XA 1I4RA 2F0NA 2R6GA 3MC0B 4ME5A 1ASZA 2MFIA 4UPAA 2R93G 3T56B 5ELEA 1ASYA 5E4XA 3A54A 1Y1VB 1JB3A 3CD6A 3LGJA 1STBA 2ES2A 2BDNA 2JQOA 2R7ZH 2B3GA 5HGQA 5C5LA 1V1PA 1PV4A 4IUTA 1M1KC 5EPLA 2HHHQ 2HHHL 4B9XA 2KCCA 1M8AA 3F1ZA 2IPKD 2Z4IA 5M3FB 2G5DA 3M3YB 3I4MH 3AB9A 3OIPA 2MP1A 1X56A 1D2BA 1YVCA 2B29A 3OPOA 4APVA 2A1AA 2RDFA 1SE4A 2NB0A 2PZWA 4G4KA 3J81L 3STBC 1KDCA 1DD2A 2A6EC 5C3EH 3OHXC 2X6LA 3BYYB 1F9PA 1KQSA 2E75C 3PUVA 1TWAH 3ITPA 5D3DA 4LF7Q 3DWPA 4LF7L 5EPKA 4GOPA 4DK1A 4QIWE 2DUDA 5FJ8H 4PMWA 4A3MH 1RL2A 1Y8PB 2AUKA 2E5LQ 2QEJC 2E5LL 3C1EA 4IPDA 1BNZA 2F0GA 1VQMA 4DKAC 4EQ5A 1NY4A 4K2LA 5ELDA 1SMYD 4LWCA 3UDGA 1GUSA 5FLXE 2A6HC 5KNCA 3MFYA 2D2CC 3F2UA 3FDTA 1LT4D 3OTOQ 1N36Q 3OTOL 1N36L 2JEAI 3CCSA 1FGUA 4WRDA 3NWTA 3HFZB 3P1HA 4L5TA 3T1HQ 1LACA 4U68A 4CJ0B 3T1HL 4IALA 2B2TA 5EKIA 5KIXA 5A2QL 2XTIA 3D0FA 1LT3D 3J7ZC 4NW2A 1PH4A 1QVGA 3F2CA 1TWCB 3PUZA 1LTAD 4NKLA 1S5BD 2FXQA 1TWHH 3RNUA 4LK1C 4BY7B 2Q2UA 1YBYA 3PGZA 2EQSA 4K5XA 1FNWA 1TS5A 4J6HA 3RN5A 1O7ZA 1R4QB 3RLNA 4FXKC 2R3ZA 5KNDA 1JORA 2B2WA 4Y7NB 3S1MH 1QNKA 1XTCD 3SK6A 5C0XH 5I6WA 1OXSC 3HOXG 2CW0C 5CV6A 3NQTA 2WAQE 5CBAE 3NE5B 4P71A 2WAQG 3BJUA 5GADC 1D8LA 1B7YB 4DV4Q 4BWGB 4DV4L 4KI0A 3G6EA 2JA5B 4AIMA 1ESFA 2FHTA 1QOHA 2PI2A 2KQ3A 3MA2B 3EIVA 2B63H 3L2PA 5M5XB 4ZCKA 1GO3E 3J81i 2R92B 1HA6A 1PTOC 4HSPA 2O5IC 1WCMB 4CDCC 1X3FA 1L0YB 3CRKC 3NP8A 2L55A 3NTKA 3GTMB 2L4NA 4IPHA 4C56C 1ET9A 2CWPA 4DAYB 1DOMA 4YCVA 4C3HG 2IWHA 3T1YQ 4R1JA 5C4XG 2N8NA 3CRLC 4QF4A 3HEJA 4LF5Q 4LF5L 3GQBA 1HR0Q 4C3IG 1JB7A 1HR0L 3U4ZA 2E8GA 1PFMA 3W1BA 2IHEA 1R4PB 2K4KA 3HKSA 5CC4A 4MIUA 1PH2A 4ZYSA 5JPMC 3VR2A 2ZXOA 2XSCA 3JAMc 2ALYB 4LNQA 2ASBA 2FMCA 4ZQ3A 3HOZG 1GUWA 2SNMA 4RCNA 1GVPA 3WOEA 1PH6A 1DCZA 1B3QA 1GUNA 4A3FG 2MJ8A 2Z0SA 4LW1A 1DGSA 4KMUC 1G6ZA 5DNFA 1MJEA 2JEBI 4AYBE 1LTBD 2WB1E 1U0LA 4AYBG 3GTLB 2WB1G 4AQYQ 4AQYL 1HJPA 5DM63 3TREA 4C2MH 1TT2A 3I7FA 2A8VA 1Y14B 1WJJA 2PYKA 3FRPB 4KHPQ 4KHPL 3QR8A 3S2DB 2SNSA 1O7YA 1QUQB 4R4TA 4UY8C 4CBVA 4DV6Q 1VQFA 1EOTA 1PLFA 3FPUB 4UAIA 3L0OA 1I6VC 3EN2A 5IIFA 2ZJRA 1K83H 1C0AA 2F0MA 1ESRA 1BDOA 1TS4A 4RKBA 3NPPA 1GUGA 1V1QA 3BVGA 3IKJA 2KHJA 2L11A 3G6JB 1SMXA 4YCUA 1I94Q 1D1IA 5FOBB 1I94L 1PFSA 1ZYRC 4EGVA 1V9PA 3H15A 5DLQE 5KRUA 2A74C 2SEBD 4R4QA 4ABNA 1WVLA 2I5HA 1C7YA 1SYFA 3FKIG 3SXHA 4BBRG 1SN8A 1VQ8A 1T5XD 3KDFB 5CORA 1LYLA 4GNXC 1JCKB 3CC7A 4R4OA 3J7YW 4F87A 1Q7YC 3B6YA 1JOOA 3C1FA 4IFDJ 1MBYA 2R93B 1IW7C 1A8VA 4BXXH 1RIPA 4C1NI 2F0PA 2CVRA 1HZCA 4LJZC 3HOVB 3P20A 3W1GA 4A3IH 1JJCB 2K28A 1GOZA 3J81j 3JC66 3CP0A 1PDQA 4HR7B 5JEAG 4BY1B 1VQBA 1EY7A 4GNXB 3N52A 3EVQA 4OHJA 4KKSA 1QVFA 1B1ZA 1IL8A 2DGYA 3K7AB 1J5EQ 1BCPD 4TSSA 1J5EL 1NR4A 1EFWA 3R3OA 2B39A 4TVAB 4CDFC 1STGA 2NVTH 1B8AA 2NVYB 4HJ9A 4K8JA 4OIKA 1B53A 4HJAA 3RMHA 1HCZA 1Q90A 2E2HH 3KF8B 2IX3A 2RQXA 2Q8IB 1IL2A 4IUNA 3PO2G 1PYWD 4XQNA 2B2YC 4A3DH 5F2DA 2K52A 1IYVA 2MUYA 1E0BA 1SYCA 4JOIA 1YJWA 3TS0A 2EY6A 3TP5A 5J39A 5CYUA 1IBMQ 1IBML 2JK8A 3BZDB 4JI1Q 4OWTB 4JI1L 4KTAA 4HCSA 1E1OA 1C4QA 1Y1VH 1PFBA 5DAUA 4PZ7A 1BBWA 2F03A 5C5MA 4DK6C 4RWSC 1SNQA 1UEBA 4FP5D 1GKHA 1VQGA 3RZOB 4IURA 2VUMB 2SDFA 3M7GA 5C44B 1KNAA 2JXMB 5M3FH 1YI2A 2N3SA 4CJ1B 2JP1A 1SEBD 1S72A 1TS3A 2F0TA 5FO9B 1CUKA 1S5FD 4JK1C 2PQEA 4JI5Q 5ELNA 4JI5L 1HTLD 1J6QA 4L6TB 5CGKA 2KEDA 1SJED 3MZ5A 3E5SA 3HOXB 5T1GA 1QNUA 1AZQA 4X64Q 1CQVA 1RTOA 2QGQA 2A5HA 1SAPA 2WIIB 4A3BH 1BQQT 3NBHA 4JI7L 1X32A 3MXUA 3ND9A 3X3NA 1I50B 1VQHA 3CPFA 1VQ9A 4FXGC 4P75A 3S15H 3A5ZB 2F0LA 1YNNC 1M4VA 1MI2A 2NZOA 2XGTA 2N78A 4H44C 3HOWB 2LMCB 3I90A 2QF7A 3KJOA 4HJ5A 2DNEA 2BH2A 3GTPB 1EYDA 4WJ3M 1AZPA 2M00A 4LUVA 4DXGA 5IOCA 1DOKA 3ZYYX 4DR1Q 3A7AB 2I5LX 4DR1L 1K8MA 2EXDA 4C3HB 3SK4A 1ENCA 5C4XB 1NR2A 3I8ZA 2VB3X 1K9MC 2IW3A 2JE6I 4IFDH 3KFUA 3K59A 4PNYA 4X65L 1OTCA 4X66Q 1TWCH 4C3IB 4X66L 1VQEA 1N9WA 1RD9D 4XT1B 1PZID 3EFXD 5LL6X 1XNQQ 4BY7H 1XNQL 2A19A 3TZDA 1FNUA 4UDUC 1HZ9A 1KRSA 5IT9c 3ERQA 2O2LD 3ND8A 1JMCA 2I5MX 4A3EB 1TQOA 1VQDA 1NJIC 2JA5G 2YYZA 2VNUD 5HGTA 1SFOB 3Q22A 2PW7A 4X3UA 2FFKB 4J1MA 3M4OB 4L5RC 5EPJA 1O7IA 5LMUQ 5LMUL 2KECA 1HA5A 1NCVA 4XYQA 4OO1H 1L2FA 1OXUA 1TY0A 4KHVA 1B70B 3HOYG 1E2ZA 4HSVA 2AMCB 2X6GA 3IAYA 1SSOA 2KJXA 3JAME 1KD1C 2EE1A 3SGIA 3S1NH 3I91A 3BZKA 4C3JG 5KYLA 4OELB 4YY3Q 5M5XH 1HFNA 4YY3L 5KGUA 2R92H 4CJ2C 2HIXA 1WCMH 4RCOA 3U4VA 3X3MA 2L5TA 2L9HA 2Z6BA 4A3CH 4L8JA 1SNPA 4PMBA 3DM1A 2WP8J 1ILQA 4DAPA 1HQMC 2LS01 1SR3A 2N49A 4POFA 3Q0AA 4G7OC 5FKAC 3CHBD 4Z9CB 4E6IA 1EEFD 1XXGA 3LWEA 1ILPA 1U4PA 5BR8Q 2ZTCA 5BR8L 4HAEA 4JPBW 5GAGC 3SDZA 3J80L 2A69D 3A8KE 1HHVA 3M4QA 1T9HA 2UXBQ 3H0GB 4A3JG 2UXBL 2NN6I 1IBKQ 1IBKL 4B9WA 1HZBA 3RZDB 2YTYA 1LV9A 3A56A 4DR3Q 4IPGA 3GTOB 4DR3L 1V1PB 2SOBA 5T1IA 4GLVB 2K05A 4MTKA 4GOPC 3GTKB 4RMFA 2WINB 5IP7H 5CMDA 2VB2X 3E0EA 3C2PA 1F77A 1RJTA 3VR4A 2K75A 3EQLC 3P75A 1EL0A 3FVQA 2HDMA 4IUQA 1PH3A 1VQNA 4X3TA 1B44D 4K5VA 3ONAB 4CGYB 1QZGA 2Z4HA 3CQZB 3AMUA 5IYDG 2EY1A 3KUPA 4JG2A 1H9RA 2BE5C 3ULPA 2PO4A 1UE5A 1X3GA 1VQAA 5D14A 3S2HB 2HD3A 2YTXA 1XPOA 3A8JE 4OGQC 2QW7A 4GOPB 1PHJA 4N8FA 1H95A 1W6JA 3H6MA 3MWYW 4JI2Q 2JA6B 1RODA 4JI2L 5NUCA 5L37A 2ID0A 1CHQD 3A7LA 3SK8A 1BKBA 4A3LG 3PO2B 5C4JH 2K5DA 4A93B 3GV3A 1B3AA 3TP6A 1TWGH 1Y1WG 3A74A 4HJ8A 3K80C 4RGMA 2NYZD 3VA5A 1MIUA 2IX1A 3HOVG 2AUJD 3NUCA 1GUTA 1YITA 2N55A 2N88A 3NSWA 2JSOA 4CKEA 1PXUA 1P16A 3O13A 3RLFA 1V8QA 2KHSA 3MEFA 4BY1G 5JVH3 5EKKA 1EQTA 4KN4C 4XIGS 1BOSA 1HUNA 3E3XA 5IY0A 3KF6A 4EQNA 2HCIA 2YU9B 3AEVA 1Y8OB 3K0XA 5FLMG 5E1FA 4ID6A 2EPBA 4IZ8A 5EAYA 1EIHA 1X3PA 3DEOA 1SLJA 5CR3A 3GTGB 1H9MA 2JA7G 3IFTA 3VYUA 2PPBC 4U673 4L5SA 3E6ZX 1SBBB 1XYIA 4KHZA 3U9OA 2JA9A 2R61A 4QY7A 3PF4A 3S9WA 1CI3M 1HNXQ 4MNOA 1HNXL 4FNFA 1CQFA 4RGNA 2NVYH 5IYBG 4DR7Q 4DR7L 1M90C 2MGSA 4QJFA 1BO0A 4IOCA 1ENAA 4LAAA 4XYOA 1W2BA 5FJ8G 2GVAA 3S24A 4KLKA 2RHSB 2WKDA 4QQBX 3K5NA 3NENA 2OQ0A 4MHEA 2VXWA 3S16B 4A3BB 1QG7A 1F2MA 2C35B 2NWGA 4V0BA 3ER0A 2CW0D 5EBDA 2EDGA 3L3OC 1H9SB 3D4WA 3T4AC 2QKIC 4YIJA 2GN5A 4O1NA 2CHBD 2VUMG 5C44G 1Q46A 5CV7A 4OWWB 4GS3A 2Z8LA 5I2YA 1HR0W 3M4YA 4JCVE 4X62Q 3WOFA 4X62L 1PH9A 2A68C 4KY7A 1TU2B 3RZOH 1JE4A 1PZKD 4O2DA 5FLXL 3S17B 3PSIA 3I4NB 4ULLA 1KL9A 2KHIA 4ME3A 1UE6A 1TWFB 1CKMA 3CCEA 2UXDQ 3K7UC 2Q2IA 2UXDL 2PMZB 4I65A 2NN6G 5JJIA 2HT1A 3TQYA 3H94A 5G3LD 2F0JA 2F4VQ 1ICFB 1JWSD 4ZK9B 2F4VL 3HOXH 2K7VA 2BDOA 2LXKA 4H02A 2KEEA 5EJWA 1JOQA 1AW7A 5JEAJ 3R8BA 3HOWG 3DUZA 5ELCA 1I50H 1STNA 1TS2A 1O78A 3LWUA 3HOYB 1X54A 3PIPA 4HIMA 3H3VH 2RDGA 4FF4A 1JWUD 4FVMA 2F0DA 4OXPA 2MQHA 1K8GA 4NDXA 1TIID 1NMFA 2F0QA 2NVQB 2B2UA 1BCPF 1EYGA 1RKNA 5E7NA 4C3JB 2CH4A 5IT9E 1Q12A 2NTSA 1B50A 2IJ0A 2E2JH 3PUYA 3CCUA 4LUZA 1B2TA 4G57A 5JOBA 1S40A 4K8IA 1YJNA 1D5MC 1F9SA 4C3HH 3W5OA 3NEMA 5C4XH 1HH2P 2CWAA 1PTOB 3VA7A 3CC2A 2IX0A 2ZTEA 1X65A 4ODGA 4C3IH 1GXDC 1KTKA 1STAA 2PNHA 4A3EG 4DN4M 1HZAA 4YCWA 1SNMA 1DXMA 3M9BA 1UEAB 1K0RA 4KJNA 1Q1EA 1LUZA 5IT9L 3HOZH 4IQZA 2RCFA 3BS1A 2Z6KA 4A3JB 1EY4A 1NUCA 2XWJB 4ZKCB 3ICEA 1IZ6A 1FVIA 1HQRD 2R7DA 2E2IB 4ZUJA 4A3FH 1ZYRD 4QCLA 1JC7A 2EXZA 1EZ6A 4BBSG 3KLWA 4R8IA 4DNIA 2EZVA 3PO3B 5ELBA 4B3RQ 4H13C 4JW0A 4KY5A 2I46A 5EBCA 4WJWA 4B3RL 1G51A 4JOIC 3V05A 1SNDA 1LTRD 2J4XA 3EBEA 4DAVA 1K8AC 5K36G 5CV5A 2FMMA 2RSNA 2VY3A 3MXPA 3TBIB 1S5ED 4NP5A 2F3WA 2UUCQ 2NVXB 2UUCL 5D65A 1CSQA 3KJPA 3CPWA 4XXEA 1LTSD 2LFNA 2K32A 1SXTA 1SYGA 4KV6A 1WD0A 3MAQA 3A0JA 3H0GG 5M3MH 3L9AX 2ATWA 4GKKQ 4GKKL 1I6HB 2EJFC 1L1OA 3QB3A 4IN3A 1NSNS 3V96A 1CTMA 2QDBA 4H0LC 4DGZA 3KOJA 5C3WA 1Y1WB 1MSGA 3KK7A 3F8TA 1VDZA 1N34Q 2B8FA 3FKIH 1N34L 3SR1A 1FR3A 3MHBA 4BBRH 1WTRA 4HIOA 2OXPA 1D5ZC 2LSSA 3GDEA 3HRZC 1VMPA 3CMAA 3CCJA 1VF7A 3WWVA 4Q5VA 2TSSA 2R7ZB 1E24A 4NXMQ 4NXML 2QILA 1EYCA 1S5DD 2MO0A 1KHIA 1KXLA 4F8MA 3SEBA 1ET6A 3CU7A 1VQ5A 3D8GA 2NZ1D 1CHPD 1OXXK 2DY8A 4FF3A 1AH9A 5JEAH 4XDXA 3I4MB 4BA2I 1STEA 1PRTD 3AU7A 2JA6G 2JA7B 1F9RA 4LF8Q 4LF8L 4HN7A 4LF9Q 4LF9L 5CBEE 3MXNB 1QUQA 4DV3Q 3VYRA 1YNJC 4DPGA 4DV3L 4A93G 4R4IA 5C3EB 1E1TA 4S3SA 3K6OA 3QWNA 1NNXA 3UDFA 2LY7A 3J81c 3RUZA 3NTHA 1TWAB 2K1BA 3FEWX 1N32Q 1I5FA 1I4HA 2JA8G 1NMGA 1N32L 4PQXA 1O7LA 4A4IA 3PO2H 2IL8A 4A3MB 1EIFA 1HPCA 4XTCS 1H9KA 1OO9B 1EY5A 4JI0Q 4KJOA 1EYAA 4JI0L 2CCZA 4HEDA 4EX5A 3IL8A 2CH4W 5IYCG 1VMCA 2AKWB 1PZJD 3Q24A 4XQJA 4R4CA 1BUVT 2RKSA 4NMZA 2G9HD 3KDFA 4XQQA 4GLXA 1EY8A 1LTLA 4DV1Q 1HFGA 4DV1L 4QL5A 3GTQB 1XMOQ 1Q3LA 1FNVA 1ENFA 4M1UB 1XMOL 1KABA 2XVSA 2MO1A 3M3YH 1F2LA 1NBWA 1KDAA 1TWHB 5GAEC 4IO9A 5ISRA 3TEHB 1I4QA 4DV0Q 1DOLA 3HP3A 4DV0L 3S1RB 2PI2E 4B08A 4C1NK 3S1MB 3U9SA 3R93A 2Y0SB 1ONLA 4KD4A 1V43A 4A3GG 3T13A 4GNXA 2H5XA 2D0OA 5LHY1 4JI7Q 4A3BG 1JOKA 2OCEA 3ERSX 2OT2A 4RGTA 4DNTB 2RDHA 4RA8A 2KA7A 3AFQA 1B9NA 3BG3A 1L0WA 2JJQA 2F0UA 1HTPA 4JBMA 1VQCA 1AFPA 2G9DA 3RD4A 1IBLQ 1H9JA 3J7AF 1IBLL
chains in the Genus database with same CATH topology
4J8QA 1R9TB 2WV6D 2B63B 2Q8RE 1U4RA 2MPMA 1GJXA 4K6DA 5J22A 2B2VA 3NWSA 2B8GA 1V1OA 4N9TA 3I73A 1FD7D 3K5OA 4QUCA 1LTID 4LMQD 2ZXPA 3D4RA 3D6CA 3HG9A 2F0SA 1WTPA 2F1MA 1G291 3H09A 2DNCA 3V2TA 5I9OA 1OXTA 4R8NA 1QJOA 5TSSA 4ILWA 1LT5D 4K2KA 5KNBA 5KYIA 4FXDA 2AWOA 4BBSB 4HTHA 3G7LA 5CV4A 2ENBA 4C2MB 4RHSA 1HUMA 4ZUIA 4K14A 1SDFA 3M7NA 5E4WC 1Y69U 2EY5A 1BBXC 5I9PA 1L0XB 1EEID 2IT1A 2LKVA 5BN4A 2EJGC 1K83B 1JICA 3JAML 3T16A 2PZTA 1WTQA 1LO5D 1A2TA 5C0XI 2AQ2B 1ICWA 1DONA 1PTOH 3KLRA 1KLGD 2BCOA 5IGEA 4HCEA 5M9OA 3C46A 4QUFA 4DFAA 2PCFB 1QB5D 5IGFA 1X3QA 1DM0B 3OIQA 2M2LA 3PMFA 1TY2A 2EY2A 5JAVA 5M5WB 2OEOA 4H7BA 2D5DA 1U9RA 4A3IB 5ELFA 4F88A 3VR5A 1FGBD 2HUGA 4TQUS 1QE6A 1AEXA 1WTWA 4G7HC 4G7ZC 1CZGA 1J9OA 3GV6A 3SHLA 3BDOA 3TP7A 5M5YB 5I6YA 3SE0A 2B2TC 3T53B 3OWFA 3R2IA 4KN7C 3MVVA 5G3LF 4QMGA 1A15A 2NVTB 3S14B 3FMCA 3HS0C 1G2TA 1LTTD 2HQEA 1RHPA 2KUMA 2B2WC 2F0FA 2A6ED 3PUXA 2JA8B 1ZXTA 2L12A 5JPNC 3Q6SA 4KY6A 3NXWA 5J1ZA 4WORA 1EU4A 1RTNA 2KCNA 4OL7A 2F0EA 1EQVA 5A35A 3KLSX 2L0CA 3SK5A 3TSSA 3J81E 3GD7A 2EYHA 5K5PA 4DF7A 2A6HD 1WD1A 1QILA 2AQ1B 3EROA 1Q8IA 1A3TA 1OXVA 2BOSA 1I4PA 3OMGA 4XT3B 2F0KA 2B2UC 4IUPA 1I3QB 3QOLA 5EKLA 4FF2A 1IKMA 4HMIA 3IFDA 1ZKOA 2I07B 5C3XA 3OW7A 2A68D 2KOLA 1ML0D 1IYUA 1BR9A 4A3GB 2XNAC 5JVG3 1TKWB 1GUOA 3URYA 4KK7A 1LLRD 1UNSA 1SYBA 2V4DA 3I4LA 5A2QE 1QCBD 3S15B 2EJMA 2EYMA 4KKTA 2RSOA 3J7AV 5IGCA 4A3KB 4EVOA 1G91A 1UUPA 1D6EC 2ZT9C 4DXFA 3BVZA 1C8CA 2FINB 3M85A 4RH6A 1PTOD 1XWEA 3DWQA 5COYA 1EZ8A 4QB4A 1O80A 1A2UA 2PZUA 3MEHA 5C0XG 3OMCA 4RKLA 2HDLA 4CKBA 2XIWA 2AWNA 4ZRZA 1Z6HA 1SMYC 3D31A 4FF1A 2XWBB 4O42A 1KLUD 3MFGA 1S4ZA 1I4GA 2J7ZA 2NN6H 2O4XA 1BXTA 2E2DC 2K5WA 1SYDA 3P7JA 5IODA 3PUWA 2J0TD 1PMRA 4IUVA 3SVMA 4ZAIA 1SE3A 3S1NB 4DK0A 1PRTF 3NBIA 2K6AA 1SE2A 3BVMA 3NHHA 1DYQA 3S1QB 2M9VA 2H4OA 5DEHA 1H9SA 3QG1A 5CV8A 3D3RA 2EYOA 1E2WA 3T51B 3PV0A 3HGBA 3GTJB 1AN8A 1EU3A 3TZUA 5BN5A 3DWAA 2ZXRA 5JJZA 4KKUA 4FYDA 5AFWA 3OWEB 1U4MA 3HOUB 3TMEA 1D5XC 3TDQA 1IW7D 5FO7B 3HKZB 2BA1A 2EYJA 2MHVA 2EVBA 1GHKA 4IFDI 1J8IA 2K01A 4CHTB 5K36H 3VYSA 2D9UA 3MXGA 3PIP3 1EY6A 4PMCA 3E0JA 4DAYA 2F0OA 3D4DA 3MTSA 3I3CA 1EWHA 1WTOA 1SNOA 3NTIA 4I7ZC 2BA0A 2OF1A 5C4JB 1TWGB 2XRSD 2NBFA 4OO1I 1YNJD 3CKIB 2F0WA 3W2DA 5IGDA 1DZ1A 1ZEQX 2EYPA 1QWYA 2CQAA 1CA5A 1RCVD 3TP8A 3QJYA 2F4IA 2Q8TA 1SNCA 5I4DA 1EFID 1CA6A 2TMPA 3H91A 4ZKBB 1F2YA 4RAUC 2K5QA 2C5CA 2QCPX 1TR5A 3K5MA 5C4HA 4RGOS 3R2TA 1W6KA 4EQPA 2B2VC 2RA4A 1GHJA 3BDLA 1IKLA 5BN3A 2X69A 5C4ZA 1EIGA 1WTVA 1CT1D 1FYCA 1JWMD 3HZXA 5HURA 1TVXA 3NK9A 1AP0A 3W3AA 1Z47A 4QIWB 5I2XA 2HCCA 1CM9A 1KNEA 4DNRB 1T5EA 1UAPA 1PFNA 1BCPC 1B4OA 1YNND 3N6RA 1HXYD 4MN3A 2H1EA 3OSOA 4DU9A 4FO2A 1STYA 2DY7A 1PRTC 4X3SA 2L1BA 3K5LA 3KBGA 4TRDA 4RHRA 2FJ2A 3TN2A 1BF4A 1SJHD 3Q23A 3EA6A 4TKOB 1NAPA 3H3VC 4ZLTF 1Q1BA 1BCPB 2NTTA 4KD3A 2RBMA 5D3IB 2F3VA 5IGGA 4DA2A 5FK9C 1PRTB 2NUCA 1G2SA 3KF8A 2PW5A 3C3LA 3GO5A 4HMJA 3MXNA 2WACA 4N9PA 1EWCA 4EQOA 2WAQB 1KDBA 4P2CB 5EGTA 2E76C 2XN9C 3DXJC 1VF5C 4BS9A 1CFMA 2WKCA 3VYTA 2GA4B 4IFDG 2E2JB 1STHA 3FPPA 2K04A 3DHQA 1RF2D 2B2YA 3L7ZC 4RFBA 4R9WA 3BYTB 2JYOA 1S5CD 3BDCA 4V190 1KAAA 3KLSA 5IGBA 3LNNA 4K5WA 3HOZB 2K03A 2Z1CA 5KEEA 4OO1G 4OIJA 1D1KA 4A3FB 2DN8A 4GZYC 2RVLA 1C48A 3WDNA 3UI2A 1MGSA 1A6XA 2K33A 3GP7A 4AYBB 1IHZA 2WB1B 1CK1A 3J80E 1EY0A 3I70A 1A3UA 3QIAA 3VR3A 3VR6A 3QOJA 4X3KA 1JR0D 1Z7TA 1E2VA 2E74C 3NQIA 3OOCA 1SYEA 2O5JC 4L63B 3A8IE 2D62A 4K6LA 4CKCA 4Q0FA 1JQYD 1LT6D 4WFN3 5M3MB 2BE5D 1II3A 3KBXA 3K0YA 5FO8B 2ICEC 4BA1I 2AQ3B 2ICIA 3DEPA 1LTGD 5E3FA 2EOTA 1B9MA 3QO2A 3FKIB 3K57A 3LX0A 4BBRB 5C6AA 4IUUA 1PTOF 1LABA 1MD2D 1WTXA 4PV1C 2PNRC 2EYLA 4JBWA 1DJRD 5C0XJ 1VCIA 1RDPD 2KVMA 2F0HA 3A55A 5LL6S 2A69C 1EY9A 3D6WA 1CZWA 1G8ZD 3DMUA 4M8AA 2F0VA 2E2HB 1MSHA 1HRJA 3PIO3 3I72A 3EJIA 1Y8NB 4A3DB 1A3VA 4F7XA 2A73B 2EYFA 5EQ0A 2C9OA 1U4LA 2F0IA 5CV9A 5DM73 3K58A 2XRQD 1XX8A 1F9QA 1F2ZA 1K8OA 1I4XA 1I4RA 2F0NA 2R6GA 3MC0B 4ME5A 3T56B 5ELEA 5E4XA 3A54A 1Y1VB 1JB3A 1STBA 2BDNA 5C5LA 1V1PA 4IUTA 5EPLA 4B9XA 2KCCA 1M8AA 2Z4IA 2IPKD 5M3FB 3M3YB 3AB9A 3OIPA 2MP1A 1D2BA 3OPOA 2RDFA 1SE4A 2NB0A 2PZWA 4G4KA 3J81L 1KDCA 1DD2A 2A6EC 3OHXC 2X6LA 3BYYB 1F9PA 2E75C 3PUVA 3ITPA 5D3DA 3DWPA 5EPKA 4DK1A 4PMWA 1Y8PB 2AUKA 2QEJC 3C1EA 1BNZA 2F0GA 4K2LA 5ELDA 1SMYD 1GUSA 5FLXE 2A6HC 5KNCA 3MFYA 2D2CC 3F2UA 3FDTA 1LT4D 2JEAI 4WRDA 3NWTA 3P1HA 1LACA 4U68A 4CJ0B 4IALA 2B2TA 5EKIA 5KIXA 5A2QL 1LT3D 4NW2A 1TWCB 3PUZA 1LTAD 4NKLA 1S5BD 4LK1C 4BY7B 4K5XA 1FNWA 1TS5A 4J6HA 1O7ZA 1R4QB 4FXKC 2R3ZA 5KNDA 1JORA 2B2WA 4Y7NB 1QNKA 1XTCD 3SK6A 5C0XH 5I6WA 1OXSC 2CW0C 5CV6A 3NQTA 5CBAE 3NE5B 4BWGB 4KI0A 2JA5B 1ESFA 2FHTA 1QOHA 2KQ3A 3MA2B 5M5XB 2R92B 1HA6A 1PTOC 4HSPA 2O5IC 1WCMB 1L0YB 3CRKC 3NP8A 2L55A 3NTKA 3GTMB 2L4NA 4C56C 1ET9A 1DOMA 4C3HG 2IWHA 3CRLC 4QF4A 3HEJA 3GQBA 4C3IG 1PFMA 1R4PB 5CC4A 4MIUA 4ZYSA 5JPMC 3VR2A 2ZXOA 2XSCA 2FMCA 4ZQ3A 1GUWA 2SNMA 4RCNA 3WOEA 1DCZA 1GUNA 2MJ8A 4KMUC 1G6ZA 5DNFA 2JEBI 1LTBD 3GTLB 5DM63 1TT2A 2PYKA 3FRPB 3S2DB 2SNSA 1O7YA 4CBVA 1EOTA 1PLFA 3FPUB 4UAIA 1I6VC 5IIFA 2F0MA 1ESRA 1BDOA 1TS4A 4RKBA 3NPPA 1GUGA 3BVGA 3IKJA 2L11A 3G6JB 1D1IA 5FOBB 1ZYRC 4EGVA 5KRUA 2A74C 2SEBD 4ABNA 1WVLA 1SYFA 3SXHA 1T5XD 5CORA 1JCKB 3J7YW 4F87A 1JOOA 3C1FA 4IFDJ 1MBYA 2R93B 1IW7C 4C1NI 2F0PA 2CVRA 4LJZC 3HOVB 3P20A 2K28A 1GOZA 1PDQA 4HR7B 5JEAG 4BY1B 1EY7A 3N52A 3EVQA 4OHJA 4KKSA 1B1ZA 1IL8A 3K7AB 1BCPD 4TSSA 1NR4A 3R3OA 2B39A 1STGA 2NVYB 4K8JA 4OIKA 1B53A 3RMHA 1HCZA 1Q90A 2IX3A 2RQXA 2Q8IB 4IUNA 1PYWD 4XQNA 2B2YC 5F2DA 1IYVA 2MUYA 1SYCA 1E0BA 2EY6A 3TP5A 5J39A 5CYUA 3BZDB 4KTAA 4HCSA 1C4QA 1PFBA 5DAUA 2F03A 5C5MA 4RWSC 1SNQA 4FP5D 3RZOB 4IURA 2VUMB 2SDFA 3M7GA 5C44B 1KNAA 2JXMB 4CJ1B 2JP1A 1SEBD 1TS3A 2F0TA 5FO9B 1S5FD 4JK1C 2PQEA 1HTLD 4L6TB 5CGKA 2KEDA 1SJED 3MZ5A 3E5SA 3HOXB 5T1GA 1QNUA 1AZQA 1CQVA 1RTOA 2A5HA 1SAPA 2WIIB 1BQQT 3NBHA 1X32A 3MXUA 3ND9A 3X3NA 1I50B 4FXGC 2F0LA 1YNNC 1M4VA 1MI2A 4H44C 3HOWB 2LMCB 3I90A 2QF7A 2DNEA 3GTPB 1EYDA 1AZPA 2M00A 4DXGA 5IOCA 1DOKA 3ZYYX 3A7AB 1K8MA 4C3HB 3SK4A 1ENCA 5C4XB 1NR2A 3I8ZA 2VB3X 2IW3A 2JE6I 4IFDH 3K59A 4PNYA 4C3IB 1RD9D 4XT1B 1PZID 3EFXD 5LL6X 3TZDA 1FNUA 4UDUC 3ERQA 2O2LD 3ND8A 4A3EB 1TQOA 2YYZA 2VNUD 5HGTA 1SFOB 3Q22A 2PW7A 4X3UA 2FFKB 4J1MA 3M4OB 5EPJA 2KECA 1HA5A 1NCVA 4XYQA 4OO1H 1OXUA 1TY0A 4KHVA 1E2ZA 4HSVA 2X6GA 3IAYA 1SSOA 2KJXA 3JAME 2EE1A 3I91A 4C3JG 5KYLA 1HFNA 5KGUA 4CJ2C 4RCOA 3X3MA 2L5TA 2L9HA 4L8JA 1SNPA 4PMBA 3DM1A 2WP8J 1ILQA 4DAPA 1HQMC 2LS01 3Q0AA 4G7OC 5FKAC 3CHBD 4Z9CB 4E6IA 1EEFD 1XXGA 3LWEA 1ILPA 1U4PA 4HAEA 3SDZA 3J80L 2A69D 3A8KE 1HHVA 3H0GB 2NN6I 4B9WA 3RZDB 1LV9A 3A56A 3GTOB 1V1PB 2SOBA 5T1IA 2K05A 3GTKB 2WINB 5CMDA 2VB2X 3C2PA 1F77A 1RJTA 3VR4A 3EQLC 3P75A 1EL0A 3FVQA 2HDMA 4IUQA 4X3TA 1B44D 4K5VA 3ONAB 4CGYB 2Z4HA 3CQZB 3AMUA 2EY1A 3KUPA 1H9RA 2BE5C 2PO4A 5D14A 3S2HB 3A8JE 4OGQC 1W6JA 3H6MA 3MWYW 2JA6B 1RODA 5NUCA 2ID0A 1CHQD 3A7LA 3SK8A 3PO2B 2K5DA 4A93B 3GV3A 1B3AA 3TP6A 4RGMA 2NYZD 3VA5A 2IX1A 2AUJD 3NUCA 1GUTA 2N55A 2N88A 3NSWA 2JSOA 4CKEA 1PXUA 3O13A 3RLFA 1V8QA 2KHSA 5JVH3 5EKKA 1EQTA 4KN4C 4XIGS 1BOSA 1HUNA 4EQNA 2HCIA 2YU9B 1Y8OB 5E1FA 4ID6A 2EPBA 4IZ8A 1EIHA 1X3PA 3DEOA 5CR3A 3GTGB 1H9MA 3IFTA 3VYUA 2PPBC 4U673 3E6ZX 1SBBB 1XYIA 4KHZA 3U9OA 2R61A 3S9WA 1CI3M 4FNFA 1CQFA 4RGNA 2MGSA 1BO0A 1ENAA 4LAAA 4XYOA 2WKDA 3K5NA 4MHEA 2VXWA 3S16B 4A3BB 1QG7A 1F2MA 2NWGA 4V0BA 2CW0D 5EBDA 2EDGA 3L3OC 1H9SB 3D4WA 3T4AC 2QKIC 4YIJA 4O1NA 2CHBD 5CV7A 2Z8LA 5I2YA 3M4YA 3WOFA 2A68C 4KY7A 1TU2B 1JE4A 1PZKD 3S17B 5FLXL 3I4NB 4ULLA 1TWFB 2PMZB 4I65A 2NN6G 3H94A 5G3LD 2F0JA 1JWSD 4ZK9B 2K7VA 2BDOA 2KEEA 5EJWA 1JOQA 1AW7A 5JEAJ 3R8BA 3DUZA 5ELCA 1STNA 1TS2A 1O78A 3LWUA 3HOYB 2RDGA 4FF4A 1JWUD 4FVMA 2F0DA 4NDXA 1TIID 2F0QA 2NVQB 2B2UA 1BCPF 1RKNA 4C3JB 5IT9E 1Q12A 2NTSA 1B50A 2IJ0A 3PUYA 1B2TA 4G57A 5JOBA 4K8IA 1D5MC 1F9SA 1PTOB 3VA7A 2IX0A 4ODGA 1GXDC 1STAA 1KTKA 4DN4M 1SNMA 1DXMA 1UEAB 4KJNA 1Q1EA 5IT9L 4IQZA 3BS1A 4A3JB 1EY4A 1NUCA 2XWJB 4ZKCB 1HQRD 2E2IB 4ZUJA 1ZYRD 4QCLA 1JC7A 2EXZA 1EZ6A 4R8IA 2EZVA 3PO3B 5ELBA 4H13C 4KY5A 2I46A 5EBCA 4WJWA 3V05A 1SNDA 1LTRD 2J4XA 4DAVA 5K36G 5CV5A 2FMMA 2RSNA 3MXPA 3TBIB 1S5ED 4NP5A 2F3WA 2NVXB 5D65A 4XXEA 1LTSD 2LFNA 2K32A 1SXTA 1SYGA 4KV6A 1WD0A 3MAQA 3L9AX 1I6HB 2EJFC 3QB3A 4IN3A 1NSNS 3V96A 1CTMA 2QDBA 4H0LC 4DGZA 5C3WA 1Y1WB 1MSGA 3KK7A 1VDZA 2B8FA 3SR1A 1FR3A 3MHBA 1WTRA 2OXPA 1D5ZC 3HRZC 1VMPA 1VF7A 4Q5VA 2TSSA 2R7ZB 2QILA 1EYCA 1S5DD 4F8MA 3SEBA 1ET6A 3CU7A 3D8GA 2NZ1D 1CHPD 1OXXK 2DY8A 4FF3A 5JEAH 4XDXA 3I4MB 4BA2I 1STEA 1PRTD 3AU7A 2JA7B 1F9RA 4HN7A 5CBEE 3VYRA 1YNJC 5C3EB 4S3SA 3K6OA 3QWNA 2LY7A 3RUZA 3NTHA 1TWAB 2K1BA 3FEWX 1I4HA 4PQXA 1O7LA 2IL8A 4A3MB 1HPCA 4XTCS 1H9KA 1OO9B 1EY5A 4KJOA 1EYAA 4HEDA 3IL8A 1VMCA 1PZJD 3Q24A 4XQJA 1BUVT 2RKSA 4NMZA 2G9HD 4XQQA 1EY8A 1HFGA 3GTQB 1Q3LA 1FNVA 1ENFA 4M1UB 1KABA 2XVSA 1F2LA 1KDAA 1TWHB 5ISRA 1I4QA 1DOLA 3HP3A 3S1RB 4B08A 4C1NK 3S1MB 3U9SA 3R93A 2Y0SB 1ONLA 4KD4A 1V43A 3T13A 5LHY1 1JOKA 2OT2A 4RGTA 4DNTB 2RDHA 4RA8A 2KA7A 1B9NA 3BG3A 2F0UA 1HTPA 1AFPA 2G9DA 3RD4A 1H9JA 3J7AF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PMR A;  1DXM A;  1OXX K;  1Q1E A;  1OXV A;  5JEA H;  5KND A;  1K8O A;  4DK0 A;  4BA2 I;  4TKO B;  2EDG A;  2R6G A;  4IQZ A;  5C0X H;  1H9S B;  1I6V C;  3ND8 A;  1OXS C;  3T56 B;  1H9R A;  1Q1B A;  2BE5 C;  3QIA A;  2YYZ A;  2PCF B;  2CW0 C;  1BDO A;  1ZKO A;  3OW7 A;  3VR3 A;  3VR6 A;  2A68 D;  3NE5 B;  1YNJ C;  1GUG A;  3A8J E;  1Z7T A;  4OGQ C;  1GJX A;  1E2V A;  1IYU A;  2E74 C;  3OOC A;  3IKJ A;  2B8G A;  3M4Y A;  2D5D A;  2O5J C;  1H9S A;  3A8I E;  4KI0 A;  3QJY A;  2A68 C;  3I73 A;  4OO1 H;  1TKW B;  2D62 A;  3QG1 A;  1OXU A;  1GUO A;  1TU2 B;  1ZYR C;  2KCC A;  3A7L A;  1E2Z A;  3VR5 A;  4H13 C;  1E2W A;  2BE5 D;  3T51 B;  2JXM B;  3PV0 A;  1O7L A;  2V4D A;  3HGB A;  3I4L A;  4TQU S;  3D4R A;  3AB9 A;  1HPC A;  4XTC S;  1H9K A;  2E76 C;  2EJM A;  3OPO A;  5K36 G;  3DXJ C;  4G7H C;  1VF5 C;  4BA1 I;  4G7Z C;  4JK1 C;  2O5I C;  4KKT A;  3TZU A;  2AUJ D;  3CRK C;  1GUT A;  2F1M A;  3BDO A;  2L5T A;  5BN5 A;  1G29 1;  1CFM A;  3SE0 A;  3T53 B;  1B9M A;  4L8J A;  1DD2 A;  2A6E C;  2DNC A;  3RLF A;  4KN7 C;  2NN6 G;  1V8Q A;  1IW7 C;  3H94 A;  4IFD G;  1OXT A;  1HQM C;  4KN4 C;  2ZT9 C;  4KKU A;  4XIG S;  1GHJ A;  3CRL C;  3FPP A;  1QJO A;  2K32 A;  4LJZ C;  2K7V A;  2BDO A;  2E75 C;  3PUV A;  3GQB A;  3P20 A;  5BN3 A;  4G7O C;  3M85 A;  1LAB A;  4DK1 A;  3FMC A;  4PV1 C;  5KNB A;  1Y8O B;  2PNR C;  3MXU A;  3ND9 A;  4HR7 B;  2EJF C;  1Y8P B;  5JEA G;  1FYC A;  2AUK A;  3VR2 A;  2AWO A;  3SDZ A;  4JBW A;  2A6E D;  3PUX A;  2A69 D;  1O78 A;  3LWU A;  1YNN C;  1VCI A;  3L7Z C;  5C0X G;  1IW7 D;  3A8K E;  1CTM A;  4H0L C;  4KKS A;  1H9M A;  4RCN A;  3IFT A;  3W3A A;  2NN6 I;  4H44 C;  3M7N A;  2A69 C;  2BA1 A;  2LMC B;  2PPB C;  2EVB A;  2QF7 A;  1GHK A;  1DCZ A;  1VDZ A;  1GUS A;  1GUN A;  2B8F A;  2DNE A;  4KHZ A;  1Y69 U;  2A6H C;  5KNC A;  5K36 H;  3LNN A;  1FR3 A;  1Q12 A;  2D2C C;  3MFY A;  3U9S A;  3PUY A;  1CI3 M;  1ONL A;  1SMY C;  1Z6H A;  4DNR B;  2IT1 A;  2JEA I;  1V43 A;  5BN4 A;  1T5E A;  4KMU C;  3D31 A;  4OO1 G;  2EJG C;  3A7A B;  2JEB I;  1HCZ A;  1Q90 A;  1LAC A;  3I72 A;  1K8M A;  3N6R A;  1VF7 A;  2Q8I B;  5A35 A;  1Y8N B;  4DNT B;  2KA7 A;  2NN6 H;  1B9N A;  2DN8 A;  1EWH A;  3BG3 A;  4GZY C;  1HTP A;  3GD7 A;  2JE6 I;  4IFD H;  3PUZ A;  3VA7 A;  3VR4 A;  3WDN A;  1A6X A;  3EQL C;  2A6H D;  1H9J A;  3PUW A;  4LK1 C;  2K33 A;  3KLR A;  4I7Z C;  1IYV A;  2BA0 A; 
#chains in the Genus database with same CATH topology
 4J8Q A;  1XNR Q;  2ZTD A;  1R9T B;  1XNR L;  2WV6 D;  2B63 B;  4A3K G;  2Q8R E;  1U4R A;  4O0A A;  2F52 A;  1PH7 A;  5IP9 G;  2MPM A;  4OX9 Q;  1LM0 A;  4OX9 L;  1GJX A;  4K6D A;  5J22 A;  4NXN Q;  4X65 Q;  2B2V A;  3NWS A;  4NXN L;  1QZH A;  3I4N G;  2B8G A;  1V1O A;  4N9T A;  3I73 A;  4HJ7 A;  1FD7 D;  1E3P A;  3K5O A;  1NE3 A;  4QUC A;  4PG3 A;  2PMZ E;  1LTI D;  4LMQ D;  2ZXP A;  4PZ8 A;  3D4R A;  3D6C A;  3M4P A;  1X9N A;  4Y7N H;  3HG9 A;  1MHW C;  2F0S A;  4RG1 A;  3Q8D A;  1EQR A;  1WTP A;  1JJ2 A;  2F1M A;  3TS2 A;  1A63 A;  1G29 1;  3H09 A;  2DNC A;  3V2T A;  4GN4 B;  4AH6 A;  5I9O A;  1OXT A;  5JJK A;  5GAH C;  4R8N A;  1QJO A;  2JA5 H;  4FDB A;  5TSS A;  4ILW A;  1LT5 D;  4K2K A;  3G4S A;  4DR2 Q;  5KNB A;  4DR2 L;  1XJV A;  5KYI A;  4FXD A;  4OWX B;  3ULJ A;  4DR4 Q;  1EIY B;  2AWO A;  4BBS B;  4DR4 L;  4HTH A;  3G7L A;  3PQI A;  2ENB A;  5CV4 A;  5H1S E;  4C2M B;  1MJC A;  4RHS A;  3HOY H;  1HUM A;  4ZUI A;  3PIO A;  4K14 A;  1SDF A;  3GTM H;  4I7A A;  3M7N A;  3UDI A;  5E4W C;  3UDX A;  1Y69 U;  2NVQ H;  2EY5 A;  1N8R C;  1BBX C;  5I9P A;  4C3J H;  1L0X B;  1EEI D;  2IT1 A;  2LKV A;  3A5U A;  5BN4 A;  2IHF A;  2EJG C;  1K83 B;  3CCQ A;  1JIC A;  1K73 C;  2PQA B;  3JAM L;  3T16 A;  2PZT A;  1WTQ A;  1XTD A;  4JBK A;  1LO5 D;  1A2T A;  3E9H A;  5C0X I;  3K8A A;  2AQ2 B;  1ICW A;  1DON A;  1PTO H;  3KLR A;  1CKN A;  4JYA Q;  1KLG D;  4JYA L;  1A0I A;  2BCO A;  5IGE A;  2F3I A;  4HCE A;  5M9O A;  2VQF L;  1UE7 A;  3C46 A;  1VQI A;  2HIV A;  4QUF A;  4MTN A;  1AE2 A;  4A3J H;  4DFA A;  2PCF B;  1QB5 D;  4UP7 A;  1X3Q A;  5IGF A;  4JI4 Q;  1DM0 B;  3OIQ A;  3RLO A;  4JI4 L;  3PO3 G;  2M2L A;  3PMF A;  3GTL H;  1TY2 A;  3HOU G;  2EY2 A;  5JAV A;  5M5W B;  2OEO A;  4H7B A;  2D5D A;  2VS1 A;  1U9R A;  4A3I B;  5ELF A;  4F88 A;  3VR5 A;  1FGB D;  2HUG A;  2HQL A;  1VQP A;  3S2D H;  3HKZ G;  4TQU S;  5AJ3 Q;  1QE6 A;  5AJ3 L;  2NZH A;  1AEX A;  1WTW A;  1KRT A;  4G7H C;  4G7Z C;  1CZG A;  2UXC Q;  1IXR A;  1J9O A;  3GV6 A;  1KIX A;  2UXC L;  3CF5 A;  3SHL A;  3BDO A;  3TP7 A;  5M5Y B;  5I6Y A;  3SE0 A;  2B2T C;  3T53 B;  3OWF A;  5GQO A;  3R2I A;  4KN7 C;  3MVV A;  5G3L F;  4QMG A;  1A15 A;  2NVT B;  3S14 B;  2KCT A;  3ZJY C;  3FMC A;  3HS0 C;  1G2T A;  1LTT D;  2HQE A;  1RHP A;  2KUM A;  3STB D;  2B2W C;  2F0F A;  2A6E D;  3PUX A;  1GD7 A;  1Q8K A;  2JA8 B;  1ZXT A;  4JC0 A;  2L12 A;  4A3L H;  5JPN C;  2R7Z G;  2R93 H;  3Q6S A;  4A76 A;  4KY6 A;  3NXW A;  5J1Z A;  4WOR A;  3HOV H;  3J80 i;  3AYH B;  1EU4 A;  1RTN A;  4DV2 Q;  2KCN A;  4OL7 A;  2F0E A;  1EQV A;  4DV2 L;  5A35 A;  4CDD C;  3KLS X;  3AQQ A;  2L0C A;  3SK5 A;  3TSS A;  3J81 E;  2ZJP A;  3GD7 A;  4BY1 H;  3I4M G;  1VQJ A;  2EYH A;  2VZA A;  5K5P A;  4IOA A;  4DF7 A;  1Z9F A;  2A6H D;  3OYY A;  1WD1 A;  1QIL A;  3BZC A;  2AQ1 B;  3ERO A;  1GM5 A;  3TRZ A;  1Q8I A;  5FLM H;  1A3T A;  1OXV A;  3K7A H;  4JI6 Q;  4JI6 L;  1KAW A;  1I4P A;  2BOS A;  3OMG A;  2F0K A;  4XT3 B;  5C3E G;  4YHH Q;  1EOV A;  2B2U C;  4YHH L;  4IUP A;  1I3Q B;  3CW2 C;  3QOL A;  5EKL A;  4FF2 A;  1IKM A;  4DV5 Q;  1EUJ A;  4DV5 L;  1UWV A;  4HMI A;  3IFD A;  2JA7 H;  2D0P A;  1CKO A;  2RF4 A;  1ZKO A;  2I07 B;  5C3X A;  3OW7 A;  2AHO B;  2A68 D;  2KOL A;  1VQ6 A;  1ML0 D;  1IYU A;  1NTG A;  1BR9 A;  3NEL A;  4A3M G;  4A3G B;  2I0Q A;  2XNA C;  5JVG 3;  1PH5 A;  5IYB H;  1TKW B;  1GUO A;  3URY A;  4KK7 A;  1LLR D;  1UNS A;  1SYB A;  4UHV A;  2V4D A;  3I4L A;  1SRO A;  5A2Q E;  1QCB D;  1PYS B;  3S15 B;  2EJM A;  3E9I A;  2P5Z X;  2EYM A;  1BVS A;  3FP9 A;  4KKT A;  2RSO A;  3I4O A;  1XPR A;  3J7A V;  5IGC A;  2Z6K C;  2IY5 B;  4A3K B;  4JV5 Q;  4EVO A;  1SE8 A;  4JV5 L;  1G91 A;  1UUP A;  1D6E C;  4YWK A;  2VW9 A;  4DK3 C;  2ZT9 C;  4DXF A;  3I56 A;  1K3B C;  1XPU A;  3BVZ A;  1C8C A;  1U5K A;  1X3E A;  2FIN B;  3M85 A;  5C44 H;  2VUM H;  3PF5 A;  4RH6 A;  1PTO D;  1XWE A;  3DWQ A;  3GTQ H;  1YNX A;  5COY A;  4N8X 1;  1EZ8 A;  1VQL A;  4QB4 A;  1O80 A;  1A2U A;  2Y0S E;  4POG A;  1PH1 A;  2PZU A;  4WJ4 A;  3MEH A;  2Y0S G;  5C0X G;  3OMC A;  4RKL A;  2HDL A;  1FJG Q;  1FJG L;  4CKB A;  3S1R H;  2XIW A;  2AWN A;  4ZRZ A;  2UU9 Q;  2UU9 L;  1Z6H A;  1SMY C;  2QEX A;  3D31 A;  4FF1 A;  2XWB B;  2KCM A;  4O42 A;  1KLU D;  1W3S A;  3MFG A;  1S4Z A;  2OTL A;  1AE3 A;  1K0S A;  1I4G A;  2J7Z A;  2NN6 H;  2O4X A;  2B63 G;  1BXT A;  2E2D C;  2K5W A;  4QGU A;  4HIK A;  1SYD A;  3P7J A;  5IOD A;  1L1O C;  4J15 A;  3PUW A;  1JJG A;  2J0T D;  1PMR A;  4IUV A;  2ZJQ A;  5HY6 A;  4YWM A;  3HOW H;  3SVM A;  4ZAI A;  1R9T H;  3GTP H;  1SE3 A;  1E7Z A;  3S1N B;  4DK0 A;  2Z9H A;  3I55 A;  1PRT F;  4JI3 Q;  3NBI A;  4JI3 L;  4P74 A;  2K6A A;  5IWA Q;  5IWA L;  1SE2 A;  3BVM A;  1WTH A;  3NHH A;  1DYQ A;  3CAM A;  2M9V A;  3S1Q B;  1PVO A;  2H4O A;  4IJH A;  5DEH A;  3T1Y L;  1H9S A;  1L1O B;  4ALP A;  3CCR A;  3QG1 A;  5CV8 A;  2UUA Q;  2UUA L;  3D3R A;  2EYO A;  4NB3 A;  1VQO A;  1E2W A;  3T51 B;  1K28 A;  3PV0 A;  3ULL A;  3HGB A;  3GTJ B;  4LF6 Q;  1A62 A;  4LF6 L;  1SRU A;  1AN8 A;  1EU3 A;  4A3E H;  3J80 c;  3TZU A;  1XMQ Q;  5BN5 A;  1SFO H;  1XMQ L;  3M4O H;  4DAM A;  3DWA A;  2ZXR A;  5JJZ A;  2QDL A;  4KKU A;  4FYD A;  1VQ4 A;  1YJ9 A;  5AFW A;  1X6O A;  1YHB A;  3I2Z A;  3OWE B;  1U4M A;  2Q2T A;  3HOU B;  3TME A;  1D5X C;  4BBS H;  3TDQ A;  1IW7 D;  5FO7 B;  1P8L A;  3HKZ B;  2BA1 A;  2EYJ A;  2MHV A;  2EVB A;  1KC8 C;  3PCO B;  4IFD I;  1J8I A;  1GHK A;  2K01 A;  4CHT B;  5K36 H;  3VYS A;  4DV6 L;  2D9U A;  3MXG A;  3KYH C;  4JVZ A;  3PIP 3;  1EY6 A;  2JN4 A;  4OEM B;  4PMC A;  3E0J A;  4DAY A;  4P72 A;  2F0O A;  3CCV A;  3MTS A;  3D4D A;  3CC4 A;  3I3C A;  1EWH A;  5M3M G;  1C9O A;  1WTO A;  1SNO A;  3NTI A;  3K81 C;  4I7Z C;  2BA0 A;  2OF1 A;  3H0G H;  1Q86 C;  1E22 A;  5C4J B;  3RZD H;  1G6P A;  1TWG B;  2XRS D;  2NBF A;  3GTO H;  4OO1 I;  3G71 A;  4BXX G;  1YNJ D;  3CKI B;  2F0W A;  3W2D A;  5IGD A;  4A3I G;  1DZ1 A;  2V1C C;  3U50 C;  1ZEQ X;  2EYP A;  3OW2 A;  1MKH A;  1QWY A;  2CQA A;  3GTK H;  1CA5 A;  1RCV D;  3TP8 A;  5M5W H;  1UE1 A;  3G48 A;  3QJY A;  2F4I A;  2GVB A;  3VDY A;  2Q8T A;  1SNC A;  5I4D A;  1EFI D;  1CA6 A;  2TMP A;  3H91 A;  4ZKB B;  1EQQ A;  1F2Y A;  4RAU C;  3CQZ H;  2K5Q A;  2C5C A;  2KEN A;  2QCP X;  2K50 A;  2OTJ A;  5J3B A;  1TR5 A;  4K0K Q;  4K0K L;  3K5M A;  3S2H H;  5C4H A;  4RGO S;  3R2T A;  1FL0 A;  1W6K A;  3DM3 A;  5M5Y H;  2VQE Q;  4B3S Q;  2VQE L;  4B3S L;  3NBH B;  1WYD A;  1PH8 A;  4EQP A;  4A3D G;  2B2V C;  2RA4 A;  2JA6 H;  1GHJ A;  2LXJ A;  3BDL A;  1IKL A;  5BN3 A;  4P73 A;  1D7Q A;  2X69 A;  2WFW A;  3S14 H;  2MNA A;  4A93 H;  5C4Z A;  1EIG A;  1WTV A;  1QVC A;  1CT1 D;  1FYC A;  3CXC A;  1JWM D;  3HZX A;  5HUR A;  5LMN W;  4DUY Q;  1TVX A;  3NK9 A;  4DUY L;  1AP0 A;  2JA8 H;  4PZ6 A;  3W3A A;  4MZ9 A;  1Z47 A;  4QIW B;  5I2X A;  1Y1V G;  3UE1 A;  2HCC A;  1CM9 A;  1KNE A;  4DNR B;  4GKJ Q;  1T5E A;  1S3O A;  4GKJ L;  1UAP A;  1PFN A;  1BCP C;  1B4O A;  1YNN D;  5IYC H;  2YU9 H;  3N6R A;  2BH8 A;  1HXY D;  3IRB A;  2H1E A;  3OSO A;  4MN3 A;  4DU9 A;  5M3F G;  4FO2 A;  1STY A;  2DY7 A;  1PRT C;  4X3S A;  4Y52 H;  2L1B A;  3K5L A;  4LF4 Q;  4NPS A;  4LF4 L;  2YV5 A;  4DV7 Q;  1EWI A;  2RCN A;  3GTG H;  4DV7 L;  3KBG A;  4TRD A;  4RHR A;  2FJ2 A;  3TN2 A;  1BF4 A;  1SJH D;  3Q23 A;  3EA6 A;  4TKO B;  5FLX c;  1NAP A;  3S16 H;  4UP8 A;  1I3Q H;  3H3V C;  4ZLT F;  1Q1B A;  1BCP B;  2NTT A;  4KD3 A;  2RBM A;  5D3I B;  2F3V A;  5IGG A;  2K5V A;  4DR6 Q;  4DR6 L;  4DA2 A;  5FK9 C;  1PRT B;  1HNW Q;  2NUC A;  1HNW L;  1JE5 A;  1G2S A;  4A3G H;  5LMN Q;  3KF8 A;  5LMN L;  2PW5 A;  2QA4 A;  3C3L A;  3GO5 A;  4HMJ A;  3MXN A;  4DUZ Q;  2WAC A;  4N9P A;  1EWC A;  4DUZ L;  4B3T L;  4B3T Q;  4GN3 B;  4EQO A;  4X64 L;  2WAQ B;  4LFC Q;  1KDB A;  4P2C B;  4LFC L;  5EGT A;  3CCL A;  2E76 C;  2XN9 C;  3DXJ C;  4CDE C;  1VF5 C;  3F2D A;  4DR5 Q;  4DR5 L;  4B3M Q;  4B3M L;  4LUO A;  2K14 A;  3UE0 A;  1WOC A;  4BS9 A;  1CFM A;  1YHA A;  4A3K H;  2WKC A;  3VYT A;  4L5Q A;  2GA4 B;  4IFD G;  2E2J B;  1STH A;  4IPC A;  3FPP A;  2K04 A;  5IP9 H;  4BY7 G;  3CCM A;  1HNZ Q;  3DHQ A;  1CKN B;  4LFA Q;  1HNZ L;  1RF2 D;  5JJL A;  2B2Y A;  4LFA L;  3S17 H;  2R7F A;  4GN5 A;  2EIF A;  2DJG C;  3I4N H;  3L7Z C;  3U58 A;  4RFB A;  4JBJ A;  4R9W A;  3BYT B;  1K3R A;  2L15 A;  2JYO A;  1S5C D;  3BDC A;  1TWF H;  3CME A;  4V19 0;  1KAA A;  4X6A H;  3BU2 A;  4UP9 A;  1X55 A;  3KLS A;  2OQK A;  5IGB A;  3LNN A;  3AFP A;  2ZM6 Q;  4K5W A;  2ZM6 L;  3HOZ B;  2K03 A;  2Z1C A;  5KEE A;  4OO1 G;  1WI5 A;  2OWO A;  4OIJ A;  1TXY A;  1D1K A;  4A3F B;  2DN8 A;  4GZY C;  1Q82 C;  2RVL A;  1C48 A;  3WDN A;  3UI2 A;  1MGS A;  1A6X A;  2K33 A;  1VQK A;  2R92 G;  1WCM G;  3GP7 A;  4AYB B;  3J7A 5;  1IHZ A;  4A3C G;  2WB1 B;  4HID A;  1CK1 A;  3J80 E;  1JT8 A;  1EY0 A;  3I70 A;  1A3U A;  2CQO A;  3QIA A;  3VR3 A;  3VR6 A;  3QOJ A;  2VL6 A;  4X3K A;  1JR0 D;  1Z7T A;  1E2V A;  1YZ6 A;  2E74 C;  2Q2H A;  3NQI A;  3OOC A;  3S1Q H;  1SYE A;  2O5J C;  4L63 B;  3A8I E;  1CSP A;  2D62 A;  4K6L A;  2K5N A;  4CKC A;  4Q0F A;  1JQY D;  1LT6 D;  4WFN 3;  5M3M B;  2BE5 D;  1II3 A;  2VQF Q;  3KBX A;  4GLA C;  3K0Y A;  3GTJ H;  5FO8 B;  1N33 Q;  2ICE C;  4BA1 I;  2AQ3 B;  1VS0 A;  2ICI A;  1N33 L;  3DEP A;  1LTG D;  1VQ7 A;  3KF6 B;  1PYB A;  5E3F A;  2EOT A;  1B9M A;  2E2I H;  3QO2 A;  3FKI B;  3F2B A;  1YIJ A;  3K57 A;  3LX0 A;  4BBR B;  5IP7 G;  3H3V I;  5C6A A;  4JI8 Q;  4JI8 L;  4IUU A;  1PTO F;  1LAB A;  1MD2 D;  3HKZ E;  4A75 A;  1WTX A;  3PO3 H;  2DJF C;  1IYJ B;  2RHQ B;  4PV1 C;  2PNR C;  2KBN A;  3HOU H;  1PA6 A;  2EYL A;  4JBW A;  1DJR D;  2UUB Q;  4LFB Q;  2UUB L;  5C0X J;  4LFB L;  1BBU A;  1VCI A;  1RDP D;  2KVM A;  2F0H A;  2YTV A;  3FHW A;  4OON A;  1YEZ A;  2CKZ B;  3A55 A;  5LL6 S;  1YHQ A;  5IE8 A;  2A69 C;  2NVX H;  5IYD H;  1EY9 A;  3D6W A;  1CZW A;  1G8Z D;  3DMU A;  2K5H A;  4M8A A;  2CFM A;  3RN2 A;  2F0V A;  2E2H B;  1WFQ A;  1MSH A;  1HRJ A;  3PIO 3;  3I72 A;  3EJI A;  5GRO A;  1Y8N B;  1Q81 C;  4A3D B;  1A3V A;  4F7X A;  2A73 B;  1I6H H;  4YWL A;  2EYF A;  5EQ0 A;  2C9O A;  1U4L A;  3DLL A;  2F0I A;  5CV9 A;  2PQA A;  5ELO A;  5DM7 3;  3K58 A;  2XRQ D;  1XX8 A;  3RR5 A;  1Y1W H;  1F9Q A;  1F2Z A;  4IJL A;  3JAM i;  1K8O A;  1I4X A;  1I4R A;  2F0N A;  2R6G A;  3MC0 B;  4ME5 A;  1ASZ A;  2MFI A;  4UPA A;  2R93 G;  3T56 B;  5ELE A;  1ASY A;  5E4X A;  3A54 A;  1Y1V B;  1JB3 A;  3CD6 A;  3LGJ A;  1STB A;  2ES2 A;  2BDN A;  2JQO A;  2R7Z H;  2B3G A;  5HGQ A;  5C5L A;  1V1P A;  1PV4 A;  4IUT A;  1M1K C;  5EPL A;  2HHH Q;  2HHH L;  4B9X A;  2KCC A;  1M8A A;  3F1Z A;  2IPK D;  2Z4I A;  5M3F B;  2G5D A;  3M3Y B;  3I4M H;  3AB9 A;  3OIP A;  2MP1 A;  1X56 A;  1D2B A;  1YVC A;  2B29 A;  3OPO A;  4APV A;  2A1A A;  2RDF A;  1SE4 A;  2NB0 A;  2PZW A;  4G4K A;  3J81 L;  3STB C;  1KDC A;  1DD2 A;  2A6E C;  5C3E H;  3OHX C;  2X6L A;  3BYY B;  1F9P A;  1KQS A;  2E75 C;  3PUV A;  1TWA H;  3ITP A;  5D3D A;  4LF7 Q;  3DWP A;  4LF7 L;  5EPK A;  4GOP A;  4DK1 A;  4QIW E;  2DUD A;  5FJ8 H;  4PMW A;  4A3M H;  1RL2 A;  1Y8P B;  2AUK A;  2E5L Q;  2QEJ C;  2E5L L;  3C1E A;  4IPD A;  1BNZ A;  2F0G A;  1VQM A;  4DKA C;  4EQ5 A;  1NY4 A;  4K2L A;  5ELD A;  1SMY D;  4LWC A;  3UDG A;  1GUS A;  5FLX E;  2A6H C;  5KNC A;  3MFY A;  2D2C C;  3F2U A;  3FDT A;  1LT4 D;  3OTO Q;  1N36 Q;  3OTO L;  1N36 L;  2JEA I;  3CCS A;  1FGU A;  4WRD A;  3NWT A;  3HFZ B;  3P1H A;  4L5T A;  3T1H Q;  1LAC A;  4U68 A;  4CJ0 B;  3T1H L;  4IAL A;  2B2T A;  5EKI A;  5KIX A;  5A2Q L;  2XTI A;  3D0F A;  1LT3 D;  3J7Z C;  4NW2 A;  1PH4 A;  1QVG A;  3F2C A;  1TWC B;  3PUZ A;  1LTA D;  4NKL A;  1S5B D;  2FXQ A;  1TWH H;  3RNU A;  4LK1 C;  4BY7 B;  2Q2U A;  1YBY A;  3PGZ A;  2EQS A;  4K5X A;  1FNW A;  1TS5 A;  4J6H A;  3RN5 A;  1O7Z A;  1R4Q B;  3RLN A;  4FXK C;  2R3Z A;  5KND A;  1JOR A;  2B2W A;  4Y7N B;  3S1M H;  1QNK A;  1XTC D;  3SK6 A;  5C0X H;  5I6W A;  1OXS C;  3HOX G;  2CW0 C;  5CV6 A;  3NQT A;  2WAQ E;  5CBA E;  3NE5 B;  4P71 A;  2WAQ G;  3BJU A;  5GAD C;  1D8L A;  1B7Y B;  4DV4 Q;  4BWG B;  4DV4 L;  4KI0 A;  3G6E A;  2JA5 B;  4AIM A;  1ESF A;  2FHT A;  1QOH A;  2PI2 A;  2KQ3 A;  3MA2 B;  3EIV A;  2B63 H;  3L2P A;  5M5X B;  4ZCK A;  1GO3 E;  3J81 i;  2R92 B;  1HA6 A;  1PTO C;  4HSP A;  2O5I C;  1WCM B;  4CDC C;  1X3F A;  1L0Y B;  3CRK C;  3NP8 A;  2L55 A;  3NTK A;  3GTM B;  2L4N A;  4IPH A;  4C56 C;  1ET9 A;  2CWP A;  4DAY B;  1DOM A;  4YCV A;  4C3H G;  2IWH A;  3T1Y Q;  4R1J A;  5C4X G;  2N8N A;  3CRL C;  4QF4 A;  3HEJ A;  4LF5 Q;  4LF5 L;  3GQB A;  1HR0 Q;  4C3I G;  1JB7 A;  1HR0 L;  3U4Z A;  2E8G A;  1PFM A;  3W1B A;  2IHE A;  1R4P B;  2K4K A;  3HKS A;  5CC4 A;  4MIU A;  1PH2 A;  4ZYS A;  5JPM C;  3VR2 A;  2ZXO A;  2XSC A;  3JAM c;  2ALY B;  4LNQ A;  2ASB A;  2FMC A;  4ZQ3 A;  3HOZ G;  1GUW A;  2SNM A;  4RCN A;  1GVP A;  3WOE A;  1PH6 A;  1DCZ A;  1B3Q A;  1GUN A;  4A3F G;  2MJ8 A;  2Z0S A;  4LW1 A;  1DGS A;  4KMU C;  1G6Z A;  5DNF A;  1MJE A;  2JEB I;  4AYB E;  1LTB D;  2WB1 E;  1U0L A;  4AYB G;  3GTL B;  2WB1 G;  4AQY Q;  4AQY L;  1HJP A;  5DM6 3;  3TRE A;  4C2M H;  1TT2 A;  3I7F A;  2A8V A;  1Y14 B;  1WJJ A;  2PYK A;  3FRP B;  4KHP Q;  4KHP L;  3QR8 A;  3S2D B;  2SNS A;  1O7Y A;  1QUQ B;  4R4T A;  4UY8 C;  4CBV A;  4DV6 Q;  1VQF A;  1EOT A;  1PLF A;  3FPU B;  4UAI A;  3L0O A;  1I6V C;  3EN2 A;  5IIF A;  2ZJR A;  1K83 H;  1C0A A;  2F0M A;  1ESR A;  1BDO A;  1TS4 A;  4RKB A;  3NPP A;  1GUG A;  1V1Q A;  3BVG A;  3IKJ A;  2KHJ A;  2L11 A;  3G6J B;  1SMX A;  4YCU A;  1I94 Q;  1D1I A;  5FOB B;  1I94 L;  1PFS A;  1ZYR C;  4EGV A;  1V9P A;  3H15 A;  5DLQ E;  5KRU A;  2A74 C;  2SEB D;  4R4Q A;  4ABN A;  1WVL A;  2I5H A;  1C7Y A;  1SYF A;  3FKI G;  3SXH A;  4BBR G;  1SN8 A;  1VQ8 A;  1T5X D;  3KDF B;  5COR A;  1LYL A;  4GNX C;  1JCK B;  3CC7 A;  4R4O A;  3J7Y W;  4F87 A;  1Q7Y C;  3B6Y A;  1JOO A;  3C1F A;  4IFD J;  1MBY A;  2R93 B;  1IW7 C;  1A8V A;  4BXX H;  1RIP A;  4C1N I;  2F0P A;  2CVR A;  1HZC A;  4LJZ C;  3HOV B;  3P20 A;  3W1G A;  4A3I H;  1JJC B;  2K28 A;  1GOZ A;  3J81 j;  3JC6 6;  3CP0 A;  1PDQ A;  4HR7 B;  5JEA G;  4BY1 B;  1VQB A;  1EY7 A;  4GNX B;  3N52 A;  3EVQ A;  4OHJ A;  4KKS A;  1QVF A;  1B1Z A;  1IL8 A;  2DGY A;  3K7A B;  1J5E Q;  1BCP D;  4TSS A;  1J5E L;  1NR4 A;  1EFW A;  3R3O A;  2B39 A;  4TVA B;  4CDF C;  1STG A;  2NVT H;  1B8A A;  2NVY B;  4HJ9 A;  4K8J A;  4OIK A;  1B53 A;  4HJA A;  3RMH A;  1HCZ A;  1Q90 A;  2E2H H;  3KF8 B;  2IX3 A;  2RQX A;  2Q8I B;  1IL2 A;  4IUN A;  3PO2 G;  1PYW D;  4XQN A;  2B2Y C;  4A3D H;  5F2D A;  2K52 A;  1IYV A;  2MUY A;  1E0B A;  1SYC A;  4JOI A;  1YJW A;  3TS0 A;  2EY6 A;  3TP5 A;  5J39 A;  5CYU A;  1IBM Q;  1IBM L;  2JK8 A;  3BZD B;  4JI1 Q;  4OWT B;  4JI1 L;  4KTA A;  4HCS A;  1E1O A;  1C4Q A;  1Y1V H;  1PFB A;  5DAU A;  4PZ7 A;  1BBW A;  2F03 A;  5C5M A;  4DK6 C;  4RWS C;  1SNQ A;  1UEB A;  4FP5 D;  1GKH A;  1VQG A;  3RZO B;  4IUR A;  2VUM B;  2SDF A;  3M7G A;  5C44 B;  1KNA A;  2JXM B;  5M3F H;  1YI2 A;  2N3S A;  4CJ1 B;  2JP1 A;  1SEB D;  1S72 A;  1TS3 A;  2F0T A;  5FO9 B;  1CUK A;  1S5F D;  4JK1 C;  2PQE A;  4JI5 Q;  5ELN A;  4JI5 L;  1HTL D;  1J6Q A;  4L6T B;  5CGK A;  2KED A;  1SJE D;  3MZ5 A;  3E5S A;  3HOX B;  5T1G A;  1QNU A;  1AZQ A;  4X64 Q;  1CQV A;  1RTO A;  2QGQ A;  2A5H A;  1SAP A;  2WII B;  4A3B H;  1BQQ T;  3NBH A;  4JI7 L;  1X32 A;  3MXU A;  3ND9 A;  3X3N A;  1I50 B;  1VQH A;  3CPF A;  1VQ9 A;  4FXG C;  4P75 A;  3S15 H;  3A5Z B;  2F0L A;  1YNN C;  1M4V A;  1MI2 A;  2NZO A;  2XGT A;  2N78 A;  4H44 C;  3HOW B;  2LMC B;  3I90 A;  2QF7 A;  3KJO A;  4HJ5 A;  2DNE A;  2BH2 A;  3GTP B;  1EYD A;  4WJ3 M;  1AZP A;  2M00 A;  4LUV A;  4DXG A;  5IOC A;  1DOK A;  3ZYY X;  4DR1 Q;  3A7A B;  2I5L X;  4DR1 L;  1K8M A;  2EXD A;  4C3H B;  3SK4 A;  1ENC A;  5C4X B;  1NR2 A;  3I8Z A;  2VB3 X;  1K9M C;  2IW3 A;  2JE6 I;  4IFD H;  3KFU A;  3K59 A;  4PNY A;  4X65 L;  1OTC A;  4X66 Q;  1TWC H;  4C3I B;  4X66 L;  1VQE A;  1N9W A;  1RD9 D;  4XT1 B;  1PZI D;  3EFX D;  5LL6 X;  1XNQ Q;  4BY7 H;  1XNQ L;  2A19 A;  3TZD A;  1FNU A;  4UDU C;  1HZ9 A;  1KRS A;  5IT9 c;  3ERQ A;  2O2L D;  3ND8 A;  1JMC A;  2I5M X;  4A3E B;  1TQO A;  1VQD A;  1NJI C;  2JA5 G;  2YYZ A;  2VNU D;  5HGT A;  1SFO B;  3Q22 A;  2PW7 A;  4X3U A;  2FFK B;  4J1M A;  3M4O B;  4L5R C;  5EPJ A;  1O7I A;  5LMU Q;  5LMU L;  2KEC A;  1HA5 A;  1NCV A;  4XYQ A;  4OO1 H;  1L2F A;  1OXU A;  1TY0 A;  4KHV A;  1B70 B;  3HOY G;  1E2Z A;  4HSV A;  2AMC B;  2X6G A;  3IAY A;  1SSO A;  2KJX A;  3JAM E;  1KD1 C;  2EE1 A;  3SGI A;  3S1N H;  3I91 A;  3BZK A;  4C3J G;  5KYL A;  4OEL B;  4YY3 Q;  5M5X H;  1HFN A;  4YY3 L;  5KGU A;  2R92 H;  4CJ2 C;  2HIX A;  1WCM H;  4RCO A;  3U4V A;  3X3M A;  2L5T A;  2L9H A;  2Z6B A;  4A3C H;  4L8J A;  1SNP A;  4PMB A;  3DM1 A;  2WP8 J;  1ILQ A;  4DAP A;  1HQM C;  2LS0 1;  1SR3 A;  2N49 A;  4POF A;  3Q0A A;  4G7O C;  5FKA C;  3CHB D;  4Z9C B;  4E6I A;  1EEF D;  1XXG A;  3LWE A;  1ILP A;  1U4P A;  5BR8 Q;  2ZTC A;  5BR8 L;  4HAE A;  4JPB W;  5GAG C;  3SDZ A;  3J80 L;  2A69 D;  3A8K E;  1HHV A;  3M4Q A;  1T9H A;  2UXB Q;  3H0G B;  4A3J G;  2UXB L;  2NN6 I;  1IBK Q;  1IBK L;  4B9W A;  1HZB A;  3RZD B;  2YTY A;  1LV9 A;  3A56 A;  4DR3 Q;  4IPG A;  3GTO B;  4DR3 L;  1V1P B;  2SOB A;  5T1I A;  4GLV B;  2K05 A;  4MTK A;  4GOP C;  3GTK B;  4RMF A;  2WIN B;  5IP7 H;  5CMD A;  2VB2 X;  3E0E A;  3C2P A;  1F77 A;  1RJT A;  3VR4 A;  2K75 A;  3EQL C;  3P75 A;  1EL0 A;  3FVQ A;  2HDM A;  4IUQ A;  1PH3 A;  1VQN A;  4X3T A;  1B44 D;  4K5V A;  3ONA B;  4CGY B;  1QZG A;  2Z4H A;  3CQZ B;  3AMU A;  5IYD G;  2EY1 A;  3KUP A;  4JG2 A;  1H9R A;  2BE5 C;  3ULP A;  2PO4 A;  1UE5 A;  1X3G A;  1VQA A;  5D14 A;  3S2H B;  2HD3 A;  2YTX A;  1XPO A;  3A8J E;  4OGQ C;  2QW7 A;  4GOP B;  1PHJ A;  4N8F A;  1H95 A;  1W6J A;  3H6M A;  3MWY W;  4JI2 Q;  2JA6 B;  1ROD A;  4JI2 L;  5NUC A;  5L37 A;  2ID0 A;  1CHQ D;  3A7L A;  3SK8 A;  1BKB A;  4A3L G;  3PO2 B;  5C4J H;  2K5D A;  4A93 B;  3GV3 A;  1B3A A;  3TP6 A;  1TWG H;  1Y1W G;  3A74 A;  4HJ8 A;  3K80 C;  4RGM A;  2NYZ D;  3VA5 A;  1MIU A;  2IX1 A;  3HOV G;  2AUJ D;  3NUC A;  1GUT A;  1YIT A;  2N55 A;  2N88 A;  3NSW A;  2JSO A;  4CKE A;  1PXU A;  1P16 A;  3O13 A;  3RLF A;  1V8Q A;  2KHS A;  3MEF A;  4BY1 G;  5JVH 3;  5EKK A;  1EQT A;  4KN4 C;  4XIG S;  1BOS A;  1HUN A;  3E3X A;  5IY0 A;  3KF6 A;  4EQN A;  2HCI A;  2YU9 B;  3AEV A;  1Y8O B;  3K0X A;  5FLM G;  5E1F A;  4ID6 A;  2EPB A;  4IZ8 A;  5EAY A;  1EIH A;  1X3P A;  3DEO A;  1SLJ A;  5CR3 A;  3GTG B;  1H9M A;  2JA7 G;  3IFT A;  3VYU A;  2PPB C;  4U67 3;  4L5S A;  3E6Z X;  1SBB B;  1XYI A;  4KHZ A;  3U9O A;  2JA9 A;  2R61 A;  4QY7 A;  3PF4 A;  3S9W A;  1CI3 M;  1HNX Q;  4MNO A;  1HNX L;  4FNF A;  1CQF A;  4RGN A;  2NVY H;  5IYB G;  4DR7 Q;  4DR7 L;  1M90 C;  2MGS A;  4QJF A;  1BO0 A;  4IOC A;  1ENA A;  4LAA A;  4XYO A;  1W2B A;  5FJ8 G;  2GVA A;  3S24 A;  4KLK A;  2RHS B;  2WKD A;  4QQB X;  3K5N A;  3NEN A;  2OQ0 A;  4MHE A;  2VXW A;  3S16 B;  4A3B B;  1QG7 A;  1F2M A;  2C35 B;  2NWG A;  4V0B A;  3ER0 A;  2CW0 D;  5EBD A;  2EDG A;  3L3O C;  1H9S B;  3D4W A;  3T4A C;  2QKI C;  4YIJ A;  2GN5 A;  4O1N A;  2CHB D;  2VUM G;  5C44 G;  1Q46 A;  5CV7 A;  4OWW B;  4GS3 A;  2Z8L A;  5I2Y A;  1HR0 W;  3M4Y A;  4JCV E;  4X62 Q;  3WOF A;  4X62 L;  1PH9 A;  2A68 C;  4KY7 A;  1TU2 B;  3RZO H;  1JE4 A;  1PZK D;  4O2D A;  5FLX L;  3S17 B;  3PSI A;  3I4N B;  4ULL A;  1KL9 A;  2KHI A;  4ME3 A;  1UE6 A;  1TWF B;  1CKM A;  3CCE A;  2UXD Q;  3K7U C;  2Q2I A;  2UXD L;  2PMZ B;  4I65 A;  2NN6 G;  5JJI A;  2HT1 A;  3TQY A;  3H94 A;  5G3L D;  2F0J A;  2F4V Q;  1ICF B;  1JWS D;  4ZK9 B;  2F4V L;  3HOX H;  2K7V A;  2BDO A;  2LXK A;  4H02 A;  2KEE A;  5EJW A;  1JOQ A;  1AW7 A;  5JEA J;  3R8B A;  3HOW G;  3DUZ A;  5ELC A;  1I50 H;  1STN A;  1TS2 A;  1O78 A;  3LWU A;  3HOY B;  1X54 A;  3PIP A;  4HIM A;  3H3V H;  2RDG A;  4FF4 A;  1JWU D;  4FVM A;  2F0D A;  4OXP A;  2MQH A;  1K8G A;  4NDX A;  1TII D;  1NMF A;  2F0Q A;  2NVQ B;  2B2U A;  1BCP F;  1EYG A;  1RKN A;  5E7N A;  4C3J B;  2CH4 A;  5IT9 E;  1Q12 A;  2NTS A;  1B50 A;  2IJ0 A;  2E2J H;  3PUY A;  3CCU A;  4LUZ A;  1B2T A;  4G57 A;  5JOB A;  1S40 A;  4K8I A;  1YJN A;  1D5M C;  1F9S A;  4C3H H;  3W5O A;  3NEM A;  5C4X H;  1HH2 P;  2CWA A;  1PTO B;  3VA7 A;  3CC2 A;  2IX0 A;  2ZTE A;  1X65 A;  4ODG A;  4C3I H;  1GXD C;  1KTK A;  1STA A;  2PNH A;  4A3E G;  4DN4 M;  1HZA A;  4YCW A;  1SNM A;  1DXM A;  3M9B A;  1UEA B;  1K0R A;  4KJN A;  1Q1E A;  1LUZ A;  5IT9 L;  3HOZ H;  4IQZ A;  2RCF A;  3BS1 A;  2Z6K A;  4A3J B;  1EY4 A;  1NUC A;  2XWJ B;  4ZKC B;  3ICE A;  1IZ6 A;  1FVI A;  1HQR D;  2R7D A;  2E2I B;  4ZUJ A;  4A3F H;  1ZYR D;  4QCL A;  1JC7 A;  2EXZ A;  1EZ6 A;  4BBS G;  3KLW A;  4R8I A;  4DNI A;  2EZV A;  3PO3 B;  5ELB A;  4B3R Q;  4H13 C;  4JW0 A;  4KY5 A;  2I46 A;  5EBC A;  4WJW A;  4B3R L;  1G51 A;  4JOI C;  3V05 A;  1SND A;  1LTR D;  2J4X A;  3EBE A;  4DAV A;  1K8A C;  5K36 G;  5CV5 A;  2FMM A;  2RSN A;  2VY3 A;  3MXP A;  3TBI B;  1S5E D;  4NP5 A;  2F3W A;  2UUC Q;  2NVX B;  2UUC L;  5D65 A;  1CSQ A;  3KJP A;  3CPW A;  4XXE A;  1LTS D;  2LFN A;  2K32 A;  1SXT A;  1SYG A;  4KV6 A;  1WD0 A;  3MAQ A;  3A0J A;  3H0G G;  5M3M H;  3L9A X;  2ATW A;  4GKK Q;  4GKK L;  1I6H B;  2EJF C;  1L1O A;  3QB3 A;  4IN3 A;  1NSN S;  3V96 A;  1CTM A;  2QDB A;  4H0L C;  4DGZ A;  3KOJ A;  5C3W A;  1Y1W B;  1MSG A;  3KK7 A;  3F8T A;  1VDZ A;  1N34 Q;  2B8F A;  3FKI H;  1N34 L;  3SR1 A;  1FR3 A;  3MHB A;  4BBR H;  1WTR A;  4HIO A;  2OXP A;  1D5Z C;  2LSS A;  3GDE A;  3HRZ C;  1VMP A;  3CMA A;  3CCJ A;  1VF7 A;  3WWV A;  4Q5V A;  2TSS A;  2R7Z B;  1E24 A;  4NXM Q;  4NXM L;  2QIL A;  1EYC A;  1S5D D;  2MO0 A;  1KHI A;  1KXL A;  4F8M A;  3SEB A;  1ET6 A;  3CU7 A;  1VQ5 A;  3D8G A;  2NZ1 D;  1CHP D;  1OXX K;  2DY8 A;  4FF3 A;  1AH9 A;  5JEA H;  4XDX A;  3I4M B;  4BA2 I;  1STE A;  1PRT D;  3AU7 A;  2JA6 G;  2JA7 B;  1F9R A;  4LF8 Q;  4LF8 L;  4HN7 A;  4LF9 Q;  4LF9 L;  5CBE E;  3MXN B;  1QUQ A;  4DV3 Q;  3VYR A;  1YNJ C;  4DPG A;  4DV3 L;  4A93 G;  4R4I A;  5C3E B;  1E1T A;  4S3S A;  3K6O A;  3QWN A;  1NNX A;  3UDF A;  2LY7 A;  3J81 c;  3RUZ A;  3NTH A;  1TWA B;  2K1B A;  3FEW X;  1N32 Q;  1I5F A;  1I4H A;  2JA8 G;  1NMG A;  1N32 L;  4PQX A;  1O7L A;  4A4I A;  3PO2 H;  2IL8 A;  4A3M B;  1EIF A;  1HPC A;  4XTC S;  1H9K A;  1OO9 B;  1EY5 A;  4JI0 Q;  4KJO A;  1EYA A;  4JI0 L;  2CCZ A;  4HED A;  4EX5 A;  3IL8 A;  2CH4 W;  5IYC G;  1VMC A;  2AKW B;  1PZJ D;  3Q24 A;  4XQJ A;  4R4C A;  1BUV T;  2RKS A;  4NMZ A;  2G9H D;  3KDF A;  4XQQ A;  4GLX A;  1EY8 A;  1LTL A;  4DV1 Q;  1HFG A;  4DV1 L;  4QL5 A;  3GTQ B;  1XMO Q;  1Q3L A;  1FNV A;  1ENF A;  4M1U B;  1XMO L;  1KAB A;  2XVS A;  2MO1 A;  3M3Y H;  1F2L A;  1NBW A;  1KDA A;  1TWH B;  5GAE C;  4IO9 A;  5ISR A;  3TEH B;  1I4Q A;  4DV0 Q;  1DOL A;  3HP3 A;  4DV0 L;  3S1R B;  2PI2 E;  4B08 A;  4C1N K;  3S1M B;  3U9S A;  3R93 A;  2Y0S B;  1ONL A;  4KD4 A;  1V43 A;  4A3G G;  3T13 A;  4GNX A;  2H5X A;  2D0O A;  5LHY 1;  4JI7 Q;  4A3B G;  1JOK A;  2OCE A;  3ERS X;  2OT2 A;  4RGT A;  4DNT B;  2RDH A;  4RA8 A;  2KA7 A;  3AFQ A;  1B9N A;  3BG3 A;  1L0W A;  2JJQ A;  2F0U A;  1HTP A;  4JBM A;  1VQC A;  1AFP A;  2G9D A;  3RD4 A;  1IBL Q;  1H9J A;  3J7A F;  1IBL L; 
#chains in the Genus database with same CATH homology
 4J8Q A;  1R9T B;  2WV6 D;  2B63 B;  2Q8R E;  1U4R A;  2MPM A;  1GJX A;  4K6D A;  5J22 A;  2B2V A;  3NWS A;  2B8G A;  1V1O A;  4N9T A;  3I73 A;  1FD7 D;  3K5O A;  4QUC A;  1LTI D;  4LMQ D;  2ZXP A;  3D4R A;  3D6C A;  3HG9 A;  2F0S A;  1WTP A;  2F1M A;  1G29 1;  3H09 A;  2DNC A;  3V2T A;  5I9O A;  1OXT A;  4R8N A;  1QJO A;  5TSS A;  4ILW A;  1LT5 D;  4K2K A;  5KNB A;  5KYI A;  4FXD A;  2AWO A;  4BBS B;  4HTH A;  3G7L A;  5CV4 A;  2ENB A;  4C2M B;  4RHS A;  1HUM A;  4ZUI A;  4K14 A;  1SDF A;  3M7N A;  5E4W C;  1Y69 U;  2EY5 A;  1BBX C;  5I9P A;  1L0X B;  1EEI D;  2IT1 A;  2LKV A;  5BN4 A;  2EJG C;  1K83 B;  1JIC A;  3JAM L;  3T16 A;  2PZT A;  1WTQ A;  1LO5 D;  1A2T A;  5C0X I;  2AQ2 B;  1ICW A;  1DON A;  1PTO H;  3KLR A;  1KLG D;  2BCO A;  5IGE A;  4HCE A;  5M9O A;  3C46 A;  4QUF A;  4DFA A;  2PCF B;  1QB5 D;  5IGF A;  1X3Q A;  1DM0 B;  3OIQ A;  2M2L A;  3PMF A;  1TY2 A;  2EY2 A;  5JAV A;  5M5W B;  2OEO A;  4H7B A;  2D5D A;  1U9R A;  4A3I B;  5ELF A;  4F88 A;  3VR5 A;  1FGB D;  2HUG A;  4TQU S;  1QE6 A;  1AEX A;  1WTW A;  4G7H C;  4G7Z C;  1CZG A;  1J9O A;  3GV6 A;  3SHL A;  3BDO A;  3TP7 A;  5M5Y B;  5I6Y A;  3SE0 A;  2B2T C;  3T53 B;  3OWF A;  3R2I A;  4KN7 C;  3MVV A;  5G3L F;  4QMG A;  1A15 A;  2NVT B;  3S14 B;  3FMC A;  3HS0 C;  1G2T A;  1LTT D;  2HQE A;  1RHP A;  2KUM A;  2B2W C;  2F0F A;  2A6E D;  3PUX A;  2JA8 B;  1ZXT A;  2L12 A;  5JPN C;  3Q6S A;  4KY6 A;  3NXW A;  5J1Z A;  4WOR A;  1EU4 A;  1RTN A;  2KCN A;  4OL7 A;  2F0E A;  1EQV A;  5A35 A;  3KLS X;  2L0C A;  3SK5 A;  3TSS A;  3J81 E;  3GD7 A;  2EYH A;  5K5P A;  4DF7 A;  2A6H D;  1WD1 A;  1QIL A;  2AQ1 B;  3ERO A;  1Q8I A;  1A3T A;  1OXV A;  2BOS A;  1I4P A;  3OMG A;  4XT3 B;  2F0K A;  2B2U C;  4IUP A;  1I3Q B;  3QOL A;  5EKL A;  4FF2 A;  1IKM A;  4HMI A;  3IFD A;  1ZKO A;  2I07 B;  5C3X A;  3OW7 A;  2A68 D;  2KOL A;  1ML0 D;  1IYU A;  1BR9 A;  4A3G B;  2XNA C;  5JVG 3;  1TKW B;  1GUO A;  3URY A;  4KK7 A;  1LLR D;  1UNS A;  1SYB A;  2V4D A;  3I4L A;  5A2Q E;  1QCB D;  3S15 B;  2EJM A;  2EYM A;  4KKT A;  2RSO A;  3J7A V;  5IGC A;  4A3K B;  4EVO A;  1G91 A;  1UUP A;  1D6E C;  2ZT9 C;  4DXF A;  3BVZ A;  1C8C A;  2FIN B;  3M85 A;  4RH6 A;  1PTO D;  1XWE A;  3DWQ A;  5COY A;  1EZ8 A;  4QB4 A;  1O80 A;  1A2U A;  2PZU A;  3MEH A;  5C0X G;  3OMC A;  4RKL A;  2HDL A;  4CKB A;  2XIW A;  2AWN A;  4ZRZ A;  1Z6H A;  1SMY C;  3D31 A;  4FF1 A;  2XWB B;  4O42 A;  1KLU D;  3MFG A;  1S4Z A;  1I4G A;  2J7Z A;  2NN6 H;  2O4X A;  1BXT A;  2E2D C;  2K5W A;  1SYD A;  3P7J A;  5IOD A;  3PUW A;  2J0T D;  1PMR A;  4IUV A;  3SVM A;  4ZAI A;  1SE3 A;  3S1N B;  4DK0 A;  1PRT F;  3NBI A;  2K6A A;  1SE2 A;  3BVM A;  3NHH A;  1DYQ A;  3S1Q B;  2M9V A;  2H4O A;  5DEH A;  1H9S A;  3QG1 A;  5CV8 A;  3D3R A;  2EYO A;  1E2W A;  3T51 B;  3PV0 A;  3HGB A;  3GTJ B;  1AN8 A;  1EU3 A;  3TZU A;  5BN5 A;  3DWA A;  2ZXR A;  5JJZ A;  4KKU A;  4FYD A;  5AFW A;  3OWE B;  1U4M A;  3HOU B;  3TME A;  1D5X C;  3TDQ A;  1IW7 D;  5FO7 B;  3HKZ B;  2BA1 A;  2EYJ A;  2MHV A;  2EVB A;  1GHK A;  4IFD I;  1J8I A;  2K01 A;  4CHT B;  5K36 H;  3VYS A;  2D9U A;  3MXG A;  3PIP 3;  1EY6 A;  4PMC A;  3E0J A;  4DAY A;  2F0O A;  3D4D A;  3MTS A;  3I3C A;  1EWH A;  1WTO A;  1SNO A;  3NTI A;  4I7Z C;  2BA0 A;  2OF1 A;  5C4J B;  1TWG B;  2XRS D;  2NBF A;  4OO1 I;  1YNJ D;  3CKI B;  2F0W A;  3W2D A;  5IGD A;  1DZ1 A;  1ZEQ X;  2EYP A;  1QWY A;  2CQA A;  1CA5 A;  1RCV D;  3TP8 A;  3QJY A;  2F4I A;  2Q8T A;  1SNC A;  5I4D A;  1EFI D;  1CA6 A;  2TMP A;  3H91 A;  4ZKB B;  1F2Y A;  4RAU C;  2K5Q A;  2C5C A;  2QCP X;  1TR5 A;  3K5M A;  5C4H A;  4RGO S;  3R2T A;  1W6K A;  4EQP A;  2B2V C;  2RA4 A;  1GHJ A;  3BDL A;  1IKL A;  5BN3 A;  2X69 A;  5C4Z A;  1EIG A;  1WTV A;  1CT1 D;  1FYC A;  1JWM D;  3HZX A;  5HUR A;  1TVX A;  3NK9 A;  1AP0 A;  3W3A A;  1Z47 A;  4QIW B;  5I2X A;  2HCC A;  1CM9 A;  1KNE A;  4DNR B;  1T5E A;  1UAP A;  1PFN A;  1BCP C;  1B4O A;  1YNN D;  3N6R A;  1HXY D;  4MN3 A;  2H1E A;  3OSO A;  4DU9 A;  4FO2 A;  1STY A;  2DY7 A;  1PRT C;  4X3S A;  2L1B A;  3K5L A;  3KBG A;  4TRD A;  4RHR A;  2FJ2 A;  3TN2 A;  1BF4 A;  1SJH D;  3Q23 A;  3EA6 A;  4TKO B;  1NAP A;  3H3V C;  4ZLT F;  1Q1B A;  1BCP B;  2NTT A;  4KD3 A;  2RBM A;  5D3I B;  2F3V A;  5IGG A;  4DA2 A;  5FK9 C;  1PRT B;  2NUC A;  1G2S A;  3KF8 A;  2PW5 A;  3C3L A;  3GO5 A;  4HMJ A;  3MXN A;  2WAC A;  4N9P A;  1EWC A;  4EQO A;  2WAQ B;  1KDB A;  4P2C B;  5EGT A;  2E76 C;  2XN9 C;  3DXJ C;  1VF5 C;  4BS9 A;  1CFM A;  2WKC A;  3VYT A;  2GA4 B;  4IFD G;  2E2J B;  1STH A;  3FPP A;  2K04 A;  3DHQ A;  1RF2 D;  2B2Y A;  3L7Z C;  4RFB A;  4R9W A;  3BYT B;  2JYO A;  1S5C D;  3BDC A;  4V19 0;  1KAA A;  3KLS A;  5IGB A;  3LNN A;  4K5W A;  3HOZ B;  2K03 A;  2Z1C A;  5KEE A;  4OO1 G;  4OIJ A;  1D1K A;  4A3F B;  2DN8 A;  4GZY C;  2RVL A;  1C48 A;  3WDN A;  3UI2 A;  1MGS A;  1A6X A;  2K33 A;  3GP7 A;  4AYB B;  1IHZ A;  2WB1 B;  1CK1 A;  3J80 E;  1EY0 A;  3I70 A;  1A3U A;  3QIA A;  3VR3 A;  3VR6 A;  3QOJ A;  4X3K A;  1JR0 D;  1Z7T A;  1E2V A;  2E74 C;  3NQI A;  3OOC A;  1SYE A;  2O5J C;  4L63 B;  3A8I E;  2D62 A;  4K6L A;  4CKC A;  4Q0F A;  1JQY D;  1LT6 D;  4WFN 3;  5M3M B;  2BE5 D;  1II3 A;  3KBX A;  3K0Y A;  5FO8 B;  2ICE C;  4BA1 I;  2AQ3 B;  2ICI A;  3DEP A;  1LTG D;  5E3F A;  2EOT A;  1B9M A;  3QO2 A;  3FKI B;  3K57 A;  3LX0 A;  4BBR B;  5C6A A;  4IUU A;  1PTO F;  1LAB A;  1MD2 D;  1WTX A;  4PV1 C;  2PNR C;  2EYL A;  4JBW A;  1DJR D;  5C0X J;  1VCI A;  1RDP D;  2KVM A;  2F0H A;  3A55 A;  5LL6 S;  2A69 C;  1EY9 A;  3D6W A;  1CZW A;  1G8Z D;  3DMU A;  4M8A A;  2F0V A;  2E2H B;  1MSH A;  1HRJ A;  3PIO 3;  3I72 A;  3EJI A;  1Y8N B;  4A3D B;  1A3V A;  4F7X A;  2A73 B;  2EYF A;  5EQ0 A;  2C9O A;  1U4L A;  2F0I A;  5CV9 A;  5DM7 3;  3K58 A;  2XRQ D;  1XX8 A;  1F9Q A;  1F2Z A;  1K8O A;  1I4X A;  1I4R A;  2F0N A;  2R6G A;  3MC0 B;  4ME5 A;  3T56 B;  5ELE A;  5E4X A;  3A54 A;  1Y1V B;  1JB3 A;  1STB A;  2BDN A;  5C5L A;  1V1P A;  4IUT A;  5EPL A;  4B9X A;  2KCC A;  1M8A A;  2Z4I A;  2IPK D;  5M3F B;  3M3Y B;  3AB9 A;  3OIP A;  2MP1 A;  1D2B A;  3OPO A;  2RDF A;  1SE4 A;  2NB0 A;  2PZW A;  4G4K A;  3J81 L;  1KDC A;  1DD2 A;  2A6E C;  3OHX C;  2X6L A;  3BYY B;  1F9P A;  2E75 C;  3PUV A;  3ITP A;  5D3D A;  3DWP A;  5EPK A;  4DK1 A;  4PMW A;  1Y8P B;  2AUK A;  2QEJ C;  3C1E A;  1BNZ A;  2F0G A;  4K2L A;  5ELD A;  1SMY D;  1GUS A;  5FLX E;  2A6H C;  5KNC A;  3MFY A;  2D2C C;  3F2U A;  3FDT A;  1LT4 D;  2JEA I;  4WRD A;  3NWT A;  3P1H A;  1LAC A;  4U68 A;  4CJ0 B;  4IAL A;  2B2T A;  5EKI A;  5KIX A;  5A2Q L;  1LT3 D;  4NW2 A;  1TWC B;  3PUZ A;  1LTA D;  4NKL A;  1S5B D;  4LK1 C;  4BY7 B;  4K5X A;  1FNW A;  1TS5 A;  4J6H A;  1O7Z A;  1R4Q B;  4FXK C;  2R3Z A;  5KND A;  1JOR A;  2B2W A;  4Y7N B;  1QNK A;  1XTC D;  3SK6 A;  5C0X H;  5I6W A;  1OXS C;  2CW0 C;  5CV6 A;  3NQT A;  5CBA E;  3NE5 B;  4BWG B;  4KI0 A;  2JA5 B;  1ESF A;  2FHT A;  1QOH A;  2KQ3 A;  3MA2 B;  5M5X B;  2R92 B;  1HA6 A;  1PTO C;  4HSP A;  2O5I C;  1WCM B;  1L0Y B;  3CRK C;  3NP8 A;  2L55 A;  3NTK A;  3GTM B;  2L4N A;  4C56 C;  1ET9 A;  1DOM A;  4C3H G;  2IWH A;  3CRL C;  4QF4 A;  3HEJ A;  3GQB A;  4C3I G;  1PFM A;  1R4P B;  5CC4 A;  4MIU A;  4ZYS A;  5JPM C;  3VR2 A;  2ZXO A;  2XSC A;  2FMC A;  4ZQ3 A;  1GUW A;  2SNM A;  4RCN A;  3WOE A;  1DCZ A;  1GUN A;  2MJ8 A;  4KMU C;  1G6Z A;  5DNF A;  2JEB I;  1LTB D;  3GTL B;  5DM6 3;  1TT2 A;  2PYK A;  3FRP B;  3S2D B;  2SNS A;  1O7Y A;  4CBV A;  1EOT A;  1PLF A;  3FPU B;  4UAI A;  1I6V C;  5IIF A;  2F0M A;  1ESR A;  1BDO A;  1TS4 A;  4RKB A;  3NPP A;  1GUG A;  3BVG A;  3IKJ A;  2L11 A;  3G6J B;  1D1I A;  5FOB B;  1ZYR C;  4EGV A;  5KRU A;  2A74 C;  2SEB D;  4ABN A;  1WVL A;  1SYF A;  3SXH A;  1T5X D;  5COR A;  1JCK B;  3J7Y W;  4F87 A;  1JOO A;  3C1F A;  4IFD J;  1MBY A;  2R93 B;  1IW7 C;  4C1N I;  2F0P A;  2CVR A;  4LJZ C;  3HOV B;  3P20 A;  2K28 A;  1GOZ A;  1PDQ A;  4HR7 B;  5JEA G;  4BY1 B;  1EY7 A;  3N52 A;  3EVQ A;  4OHJ A;  4KKS A;  1B1Z A;  1IL8 A;  3K7A B;  1BCP D;  4TSS A;  1NR4 A;  3R3O A;  2B39 A;  1STG A;  2NVY B;  4K8J A;  4OIK A;  1B53 A;  3RMH A;  1HCZ A;  1Q90 A;  2IX3 A;  2RQX A;  2Q8I B;  4IUN A;  1PYW D;  4XQN A;  2B2Y C;  5F2D A;  1IYV A;  2MUY A;  1SYC A;  1E0B A;  2EY6 A;  3TP5 A;  5J39 A;  5CYU A;  3BZD B;  4KTA A;  4HCS A;  1C4Q A;  1PFB A;  5DAU A;  2F03 A;  5C5M A;  4RWS C;  1SNQ A;  4FP5 D;  3RZO B;  4IUR A;  2VUM B;  2SDF A;  3M7G A;  5C44 B;  1KNA A;  2JXM B;  4CJ1 B;  2JP1 A;  1SEB D;  1TS3 A;  2F0T A;  5FO9 B;  1S5F D;  4JK1 C;  2PQE A;  1HTL D;  4L6T B;  5CGK A;  2KED A;  1SJE D;  3MZ5 A;  3E5S A;  3HOX B;  5T1G A;  1QNU A;  1AZQ A;  1CQV A;  1RTO A;  2A5H A;  1SAP A;  2WII B;  1BQQ T;  3NBH A;  1X32 A;  3MXU A;  3ND9 A;  3X3N A;  1I50 B;  4FXG C;  2F0L A;  1YNN C;  1M4V A;  1MI2 A;  4H44 C;  3HOW B;  2LMC B;  3I90 A;  2QF7 A;  2DNE A;  3GTP B;  1EYD A;  1AZP A;  2M00 A;  4DXG A;  5IOC A;  1DOK A;  3ZYY X;  3A7A B;  1K8M A;  4C3H B;  3SK4 A;  1ENC A;  5C4X B;  1NR2 A;  3I8Z A;  2VB3 X;  2IW3 A;  2JE6 I;  4IFD H;  3K59 A;  4PNY A;  4C3I B;  1RD9 D;  4XT1 B;  1PZI D;  3EFX D;  5LL6 X;  3TZD A;  1FNU A;  4UDU C;  3ERQ A;  2O2L D;  3ND8 A;  4A3E B;  1TQO A;  2YYZ A;  2VNU D;  5HGT A;  1SFO B;  3Q22 A;  2PW7 A;  4X3U A;  2FFK B;  4J1M A;  3M4O B;  5EPJ A;  2KEC A;  1HA5 A;  1NCV A;  4XYQ A;  4OO1 H;  1OXU A;  1TY0 A;  4KHV A;  1E2Z A;  4HSV A;  2X6G A;  3IAY A;  1SSO A;  2KJX A;  3JAM E;  2EE1 A;  3I91 A;  4C3J G;  5KYL A;  1HFN A;  5KGU A;  4CJ2 C;  4RCO A;  3X3M A;  2L5T A;  2L9H A;  4L8J A;  1SNP A;  4PMB A;  3DM1 A;  2WP8 J;  1ILQ A;  4DAP A;  1HQM C;  2LS0 1;  3Q0A A;  4G7O C;  5FKA C;  3CHB D;  4Z9C B;  4E6I A;  1EEF D;  1XXG A;  3LWE A;  1ILP A;  1U4P A;  4HAE A;  3SDZ A;  3J80 L;  2A69 D;  3A8K E;  1HHV A;  3H0G B;  2NN6 I;  4B9W A;  3RZD B;  1LV9 A;  3A56 A;  3GTO B;  1V1P B;  2SOB A;  5T1I A;  2K05 A;  3GTK B;  2WIN B;  5CMD A;  2VB2 X;  3C2P A;  1F77 A;  1RJT A;  3VR4 A;  3EQL C;  3P75 A;  1EL0 A;  3FVQ A;  2HDM A;  4IUQ A;  4X3T A;  1B44 D;  4K5V A;  3ONA B;  4CGY B;  2Z4H A;  3CQZ B;  3AMU A;  2EY1 A;  3KUP A;  1H9R A;  2BE5 C;  2PO4 A;  5D14 A;  3S2H B;  3A8J E;  4OGQ C;  1W6J A;  3H6M A;  3MWY W;  2JA6 B;  1ROD A;  5NUC A;  2ID0 A;  1CHQ D;  3A7L A;  3SK8 A;  3PO2 B;  2K5D A;  4A93 B;  3GV3 A;  1B3A A;  3TP6 A;  4RGM A;  2NYZ D;  3VA5 A;  2IX1 A;  2AUJ D;  3NUC A;  1GUT A;  2N55 A;  2N88 A;  3NSW A;  2JSO A;  4CKE A;  1PXU A;  3O13 A;  3RLF A;  1V8Q A;  2KHS A;  5JVH 3;  5EKK A;  1EQT A;  4KN4 C;  4XIG S;  1BOS A;  1HUN A;  4EQN A;  2HCI A;  2YU9 B;  1Y8O B;  5E1F A;  4ID6 A;  2EPB A;  4IZ8 A;  1EIH A;  1X3P A;  3DEO A;  5CR3 A;  3GTG B;  1H9M A;  3IFT A;  3VYU A;  2PPB C;  4U67 3;  3E6Z X;  1SBB B;  1XYI A;  4KHZ A;  3U9O A;  2R61 A;  3S9W A;  1CI3 M;  4FNF A;  1CQF A;  4RGN A;  2MGS A;  1BO0 A;  1ENA A;  4LAA A;  4XYO A;  2WKD A;  3K5N A;  4MHE A;  2VXW A;  3S16 B;  4A3B B;  1QG7 A;  1F2M A;  2NWG A;  4V0B A;  2CW0 D;  5EBD A;  2EDG A;  3L3O C;  1H9S B;  3D4W A;  3T4A C;  2QKI C;  4YIJ A;  4O1N A;  2CHB D;  5CV7 A;  2Z8L A;  5I2Y A;  3M4Y A;  3WOF A;  2A68 C;  4KY7 A;  1TU2 B;  1JE4 A;  1PZK D;  3S17 B;  5FLX L;  3I4N B;  4ULL A;  1TWF B;  2PMZ B;  4I65 A;  2NN6 G;  3H94 A;  5G3L D;  2F0J A;  1JWS D;  4ZK9 B;  2K7V A;  2BDO A;  2KEE A;  5EJW A;  1JOQ A;  1AW7 A;  5JEA J;  3R8B A;  3DUZ A;  5ELC A;  1STN A;  1TS2 A;  1O78 A;  3LWU A;  3HOY B;  2RDG A;  4FF4 A;  1JWU D;  4FVM A;  2F0D A;  4NDX A;  1TII D;  2F0Q A;  2NVQ B;  2B2U A;  1BCP F;  1RKN A;  4C3J B;  5IT9 E;  1Q12 A;  2NTS A;  1B50 A;  2IJ0 A;  3PUY A;  1B2T A;  4G57 A;  5JOB A;  4K8I A;  1D5M C;  1F9S A;  1PTO B;  3VA7 A;  2IX0 A;  4ODG A;  1GXD C;  1STA A;  1KTK A;  4DN4 M;  1SNM A;  1DXM A;  1UEA B;  4KJN A;  1Q1E A;  5IT9 L;  4IQZ A;  3BS1 A;  4A3J B;  1EY4 A;  1NUC A;  2XWJ B;  4ZKC B;  1HQR D;  2E2I B;  4ZUJ A;  1ZYR D;  4QCL A;  1JC7 A;  2EXZ A;  1EZ6 A;  4R8I A;  2EZV A;  3PO3 B;  5ELB A;  4H13 C;  4KY5 A;  2I46 A;  5EBC A;  4WJW A;  3V05 A;  1SND A;  1LTR D;  2J4X A;  4DAV A;  5K36 G;  5CV5 A;  2FMM A;  2RSN A;  3MXP A;  3TBI B;  1S5E D;  4NP5 A;  2F3W A;  2NVX B;  5D65 A;  4XXE A;  1LTS D;  2LFN A;  2K32 A;  1SXT A;  1SYG A;  4KV6 A;  1WD0 A;  3MAQ A;  3L9A X;  1I6H B;  2EJF C;  3QB3 A;  4IN3 A;  1NSN S;  3V96 A;  1CTM A;  2QDB A;  4H0L C;  4DGZ A;  5C3W A;  1Y1W B;  1MSG A;  3KK7 A;  1VDZ A;  2B8F A;  3SR1 A;  1FR3 A;  3MHB A;  1WTR A;  2OXP A;  1D5Z C;  3HRZ C;  1VMP A;  1VF7 A;  4Q5V A;  2TSS A;  2R7Z B;  2QIL A;  1EYC A;  1S5D D;  4F8M A;  3SEB A;  1ET6 A;  3CU7 A;  3D8G A;  2NZ1 D;  1CHP D;  1OXX K;  2DY8 A;  4FF3 A;  5JEA H;  4XDX A;  3I4M B;  4BA2 I;  1STE A;  1PRT D;  3AU7 A;  2JA7 B;  1F9R A;  4HN7 A;  5CBE E;  3VYR A;  1YNJ C;  5C3E B;  4S3S A;  3K6O A;  3QWN A;  2LY7 A;  3RUZ A;  3NTH A;  1TWA B;  2K1B A;  3FEW X;  1I4H A;  4PQX A;  1O7L A;  2IL8 A;  4A3M B;  1HPC A;  4XTC S;  1H9K A;  1OO9 B;  1EY5 A;  4KJO A;  1EYA A;  4HED A;  3IL8 A;  1VMC A;  1PZJ D;  3Q24 A;  4XQJ A;  1BUV T;  2RKS A;  4NMZ A;  2G9H D;  4XQQ A;  1EY8 A;  1HFG A;  3GTQ B;  1Q3L A;  1FNV A;  1ENF A;  4M1U B;  1KAB A;  2XVS A;  1F2L A;  1KDA A;  1TWH B;  5ISR A;  1I4Q A;  1DOL A;  3HP3 A;  3S1R B;  4B08 A;  4C1N K;  3S1M B;  3U9S A;  3R93 A;  2Y0S B;  1ONL A;  4KD4 A;  1V43 A;  3T13 A;  5LHY 1;  1JOK A;  2OT2 A;  4RGT A;  4DNT B;  2RDH A;  4RA8 A;  2KA7 A;  1B9N A;  3BG3 A;  2F0U A;  1HTP A;  1AFP A;  2G9D A;  3RD4 A;  1H9J A;  3J7A F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...