4QGUA

Protein domain complex with ssdna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
191
structure length
191
Chain Sequence
VLQKRPVIVKVLSTTKPFEYETPEMEKKIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIPCEEGDKLQLFCFRLRKKNQMSKLISEMHSFIQIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title New insights into the structural basis of DNA recognition by HINa and HINb domains of IFI16.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords Gamma-interferon-inducible protein 16
total genus 40
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02760 HIN HIN-200/IF120x domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qguA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qguA01
4AIMA 4YCWA 1HR0L 4LF7L 3CC7A 3S2HH 3OTOL 4LF6Q 1XPUA 3PO3H 4DR4Q 3DM3A 4NPSA 1LUZA 2R93G 3U4ZA 1X3FA 4DR1Q 1VQNA 1EQRA 1Q1EA 2UU9Q 5IP7H 2YTYA 1SROA 4UP8A 2VZAA 1IXRA 1L0WA 2UXCQ 1KQSA 1XPRA 3FKIH 3RR5A 4L5SA 4JI7L 2ZJPA 1E1OA 2ID0A 3KDFB 1BKBA 2AWOA 1B70B 5GQOA 2F4VQ 4WJ3M 4JOIC 2CKZB 2I5HA 3E9HA 4JI2Q 5BR8L 1KC8C 1VQJA 2HHHQ 4JI6L 4JYAL 3I2ZA 3ER0A 1N36L 4X62Q 1G51A 3GTPH 4A3EH 1O7IA 3ZJYC 4DK3C 1XJVA 4DV5Q 1QUQB 4IFDI 2R7ZH 4YWKA 3KJPA 4DV2L 5DLQE 2UU9L 4P73A 4IPDA 3RLFA 2WAQG 5HY6A 3H3VH 4JCVE 4DV1Q 4KLKA 1EQQA 3G71A 4IPGA 2F4VL 4Y7NH 4DR5L 3S24A 4DV4L 3RZDH 4UY8C 4GOPB 4B3ML 1IZ6A 3KF8B 1WYDA 1HZAA 3KYHC 1LYLA 2VQEQ 1Q8KA 2N49A 1VQ6A 2H5XA 1YJNA 3PUYA 1JB7A 4BA2I 4B3RQ 1KRTA 3A74A 2RHQB 2JJQA 1AE2A 1SR3A 4A4IA 4X64L 1QZHA 1PA6A 1PH3A 3M7NA 4BBSH 3K7AH 1PH1A 1XNRL 4JV5L 3G48A 3KDFA 4L5QA 1V9PA 2JA7H 1WFQA 3PF4A 1GO3E 5M5YH 2E2JH 4YWLA 1K0RA 2IHFA 4OXPA 4DR4L 4JYAQ 4B3RL 4A93H 2OCEA 3CCLA 2KHIA 1XMQQ 1IBLL 4LWCA 4A3IH 1Y1WG 4LNQA 2VUMG 2HT1A 4BY7H 1QVCA 3T1HQ 3HKZE 1U5KA 4YCUA 1I50H 1IBMQ 1OXXK 1JJGA 1VCIA 1EWIA 2PQAB 2VY3A 2KENA 4GNXC 3CCEA 1A8VA 2PNHA 5C44G 3I4MG 4AQYQ 2UUBQ 1YJ9A 3UE0A 1E1TA 2YTXA 2NN6I 4LFCQ 1FJGL 1SE8A 1XNRQ 5K36G 1PFSA 4HIKA 1WJJA 3HOVG 3CCRA 1AH9A 2RHSB 4AYBG 4MZ9A 3PF5A 1VQPA 4DR7Q 4LF7Q 2F3IA 2NZHA 3MXNB 3S1RH 3U58A 3M9BA 1EFWA 4A3FG 1J6QA 1UE7A 3ULJA 4RG1A 3KJOA 4EX5A 4IO9A 1VQMA 5M5XH 4A3DH 4HIMA 1OXTA 2IX1A 1HZBA 4X62L 4WJ4A 4A76A 3S1MH 2BA0A 2HIVA 5AJ3L 4JI1Q 1JJCB 1FVIA 4HIOA 1VQLA 2D0OA 2JA7G 3K80C 3ICEA 3HOYG 4K0KL 2ZTEA 3CXCA 4C3IH 3W1GA 3AYHB 4R4TA 5GAEC 4LF8L 4GKKQ 4A3GH 1N9WA 2E8GA 1VQ9A 1K73C 1UWVA 2OQ0A 4NB3A 2WAQE 1XMOQ 4LUVA 1YBYA 1VQFA 1VQEA 1WCMH 5E7NA 1NMGA 2Q2HA 5C4XH 3E0EA 4DV6L 1FJGQ 4JI1L 3WWVA 5JJKA 4LFAQ 2K75A 5IP9G 2I5LX 3K0XA 3UDFA 1SLJA 1P16A 4DR2Q 1PYBA 4A3GG 3STBC 4JI2L 1E7ZA 1PH2A 2I5MX 4DR3L 2I0QA 4LUZA 5C4XG 3I4NG 4KHPQ 2QA4A 4LFBQ 3K7UC 4DPGA 4BY7G 3EIVA 3HKSA 1PH8A 2UUAQ 3GTLH 2VL6A 1DGSA 3H0GH 2ZJQA 3RZOH 1V43A 3BJUA 1MIUA 2BH2A 3HOYH 3PIOA 2XTIA 1CKNB 3GTOH 2Q2IA 2B63G 4A3FH 1XPOA 4JI5Q 2KCMA 1T9HA 4IFDJ 1QUQA 1KL9A 1W2BA 1HNWQ 4QY7A 2VW9A 3FHWA 4LF6L 4IJHA 5IYDG 2LXKA 5IT9c 2Q2TA 4NXNL 4GKKL 1HNZL 3ERSX 4LFBL 3GD7A 3F1ZA 3UE1A 1IBLQ 2B63H 3NENA 1VQCA 3CCQA 3RLNA 3RN5A 1KIXA 3GTQH 3I4MH 3CCSA 1GVPA 1AE3A 1HZCA 4HJ5A 2ZM6L 1C7YA 3PIPA 1HNZQ 3HOWH 2EXDA 3T1YQ 1XNQL 4O0AA 4X64Q 5JJLA 5JEAJ 1B8AA 3I55A 4L5TA 3U50C 1CKOA 3PGZA 1N33Q 2Y0SE 2R7FA 4J15A 1XTDA 3PSIA 4JV5Q 1L1OA 2N78A 3I4OA 4HJAA 4AQYL 2UUBL 3S15H 3J7A5 2NVTH 4X65Q 1VQ5A 4DR3Q 1K8GA 2LXJA 3SGIA 1YJWA 5ELNA 4O2DA 2NN6G 4JI8L 2MNAA 1YHQA 3A0JA 1Q7YC 4K0KQ 1LTLA 1X65A 4QIWE 4LF4Q 4IOCA 2AMCB 1E22A 3L0OA 4NXMQ 1M90C 3M4OH 3CCMA 1TWFH 2GVAA 3J81j 3UDGA 3NEMA 4P74A 1EYGA 3BZKA 3AFQA 4POFA 3HOXH 3J80i 1PH7A 1JMCA 4R4OA 3M85A 4DAYB 1X6OA 2V1CC 2GN5A 3JAMi 3L2PA 5LMNQ 4JBKA 3T1YL 4QGUA 1XNQQ 4HIDA 1LM0A 1N34L 2YV5A 4P75A 3Q8DA 3GTKH 4UP9A 4A3IG 1Y1WH 3PO2G 1Y1VH 5JJIA 4JI4Q 4GKJQ 1K9MC 2PQAA 3CP0A 2CFMA 3S1NH 1E24A 5IWAL 4DV0L 1A0IA 2VQEL 1A62A 4C2MH 1VS0A 1L1OC 1VQ7A 4A3KG 3ULPA 1IBML 2UXCL 1WOCA 2AWNA 4UPAA 2NZOA 2A8VA 1I6HH 2R7DA 1I3QH 1YZ6A 5ELOA 1NTGA 1X55A 2CWPA 5J3BA 4B3TQ 1UE6A 2MFIA 4LUOA 1L1OB 4PZ7A 2R92G 1Y14B 4X6AH 3HFZB 2R6GA 3S17H 2ATWA 4DAMA 4B3TL 3PUZA 5H1SE 3F2CA 4A3CH 4DV3Q 5GROA 4DV2Q 2ASBA 4ME3A 1B7YB 1MJCA 1Q46A 1EIYB 2XGTA 2JA6G 1EIFA 4DR6Q 3TREA 5C0XJ 5IYBG 2JE6I 4UP7A 1NJIC 2JA8G 4BXXH 1I94Q 3HOWG 2WB1G 5EAYA 5GADC 5AJ3Q 1TXYA 3PCOB 4GLXA 2D62A 4B3SL 1I94L 1M1KC 3I4NH 1WCMG 4JI0Q 4OONA 4JI3Q 4X65L 3KF6B 4OWWB 5LMNL 4MTNA 5LMUQ 4OX9Q 1PYSB 3CQZH 1J5EQ 3HOXG 4PMWA 1YNXA 2MO0A 4HJ7A 3PV0A 1WI5A 1XMOL 4GNXB 4HJ8A 3GTGH 1OXVA 5M3MH 5LMUL 1K3RA 2JA9A 4YY3L 1PH5A 4P71A 3S2DH 1Q82C 4RMFA 1QVGA 4LF4L 2OTJA 2E5LL 2OTLA 2VNUD 4Y52H 3K81C 1X54A 4PZ6A 1KHIA 4B3MQ 4KI0A 1D7QA 1YVCA 4YHHQ 1VQ8A 1BBWA 3S1QH 3J80c 3CMEA 5IYCH 1EOVA 1NMFA 4JOIA 2K52A 1S3OA 1I5FA 2WB1E 2MO1A 1P8LA 1GKHA 1S72A 1X56A 3D31A 1HR0W 2KCTA 4BBSG 3PUXA 4APVA 4LF5Q 3F8TA 2CWAA 2OQKA 3AQQA 1GD7A 1E3PA 4P72A 3RN2A 4DUZL 1Q81C 1CSQA 1N34Q 4QQBX 3PO2H 3CW2C 4LFCL 4C3JH 4QL5A 4OX9L 3IRBA 5IP7G 1SMXA 3CCUA 3AEVA 4DUZQ 3TEHB 2E2IH 3UDXA 3GTMH 4H02A 1KAWA 3F2DA 3I56A 2VS1A 1VQGA 1Q12A 4YWMA 1XMQL 4ALPA 1X9NA 1GM5A 1HR0Q 4A75A 4KHPL 1PH4A 1VQ4A 2ZJRA 2ZTCA 3NELA 2MQHA 4BY1H 1K83H 1TWGH 4JI8Q 2VQFL 3TS2A 4DV4Q 4YHHL 1SFOH 2YU9H 2YTVA 1C0AA 2PI2A 4DR2L 1CKMA 1JT8A 3DLLA 4DV3L 4PZ8A 1ASYA 3BU2A 2C35B 2CQOA 1CUKA 3K8AA 4DV1L 4DV6Q 4GOPA 3STBD 1NE3A 1QZGA 1IBKL 3A5UA 1H95A 5FLMG 2JA5G 1Z47A 1RL2A 2JEBI 4IFDG 1G6PA 4FDBA 3HOVH 5M3MG 4IJLA 4DV5L 4GLVB 1J5EL 1PVOA 4BBRH 4GOPC 4AH6A 3NBHB 1PH6A 2KBNA 3EN2A 4OWXB 2Z6KC 3KFUA 2HQLA 3W1BA 2IT1A 2QEXA 1S40A 4JI0L 3E9IA 4AYBE 5C0XG 3GTJH 1IL2A 4NXML 1G291 1KRSA 2NVXH 2RF4A 2JK8A 2E5LQ 4GKJL 5C3EG 3CC4A 1R9TH 4OO1I 2PI2E 4DV7L 3A5ZB 4OWTB 2JA8H 4HJ9A 3L7ZC 3CC2A 1OTCA 4LF9Q 4A93G 4A3LH 1VQKA 3BZCA 5GAGC 2A1AA 4NXNQ 4LF8Q 4JBMA 1TWCH 4DR6L 3CAMA 4GS3A 1MJEA 1HH2P 2EIFA 3M4QA 3MEFA 2UXDQ 2AKWB 1VQDA 4QJFA 1RIPA 4IPHA 4BY1G 1YEZA 4JI3L 1HNXL 3HOZH 3KOJA 3UDIA 4LW1A 4A3JH 1U0LA 3W5OA 1C9OA 3KLWA 3M4PA 1L2FA 4R1JA 2ALYB 1TWHH 3H3VI 1PH9A 2B29A 1MKHA 1HZ9A 3PUVA 4JC0A 3GDEA 2WP8J 2ZM6Q 4A3JG 4A3MG 1YI2A 1A63A 2CCZA 3HKZG 3J81i 4JI7Q 2D0PA 4DKAC 1OXUA 4DK6C 5IWAQ 4DV0Q 1FGUA 1PHJA 3RLOA 1W3SA 3GO5A 4X66Q 1N33L 4LFAL 4A3LG 4JI5L 4JI4L 3HOUH 4BBRG 3CMAA 4JG2A 5C44H 2DGYA 3TS0A 1VQOA 1QVFA 1Y1VG 4X66L 2AHOB 4IPCA 1UE5A 2F52A 1YHBA 5FLXc 2JEAI 1NY4A 1X3GA 1X3EA 4R4IA 2LSSA 3J7ZC 3OTOQ 5FLMH 3F2BA 4DUYQ 3FP9A 1N8RC 1CSPA 1PV4A 3TQYA 2HIXA 2K5VA 4LF5L 2NVQH 1N32L 3CPFA 5HGQA 3G4SA 2R93H 1UEBA 3KF6A 4A3MH 3HOUG 2N3SA 2A19A 3ULLA 4A3EG 2ES2A 4BA1I 5IYBH 4KHZA 2OWOA 4GNXA 2UUCQ 2JA6H 1VQIA 1VQBA 4PG3A 3CF5A 2KHJA 2QGQA 2K5HA 3I7FA 5GAHC 4DR5Q 3PUWA 4OO1G 2FXQA 4DUYL 2IX0A 2N8NA 4JBWA 1UE1A 2K14A 5JEAG 5C0XI 3RNUA 4A3BH 4DR7L 3CCVA 2K4KA 1SRUA 5FJ8H 1K8AC 1HNXQ 3VDYA 4GLAC 2K50A 3TRZA 1JE5A 4TVAB 5C4JH 2DUDA 1Q1BA 1OXSC 1TWAH 4XIGS 3B6YA 1BVSA 4DV7Q 1Q86C 3M3YH 2B3GA 2K5NA 1FL0A 3LGJA 5M3FH 4LF9L 1D8LA 2BH8A 4DNIA 3PO3G 2L15A 5IY0A 1KXLA 3EBEA 2BA1A 1N36Q 4C3HH 2Q2UA 4R4QA 2Z6KA 3J81c 5IP9H 5M3FG 4MNOA 4R4CA 2IHEA 2RCNA 4YCVA 4B3SQ 3S16H 4EQ5A 2NVYH 1V1QA 2EQSA 2VUMH 2Y0SG 1YIJA 5IYCG 2UUCL 2IY5B 2ZTDA 1KD1C 4XTCS 4YY3Q 3CCJA 5LMNW 1ASZA 4IOAA 3S14H 1IBKQ 1Z9FA 5FJ8G 3CD6A 2R7ZG 4BXXG 1YHAA 2UXDL 3AFPA 4GN3B 1EUJA 1N32Q 1NBWA 5IE8A 3JC66 4TQUS 3U4VA 4L5RC 1JJ2A 3G6EA 2WFWA 4GN5A 4DR1L 1HJPA 2JA5H 3HOZG 1SN8A 4POGA 1HNWL 1YITA 5IYDH 1BBUA 1CKNA 5M5WH 2YYZA 3T1HL 2Z0SA 4A3KH 4A3CG 2UXBL 3OW2A 2HHHL 4JI6Q 3CPWA 4GN4B 1IYJB 3OYYA 5BR8Q 2E2HH 4A3DG 3JAMc 3H15A 4A3BG 2JQOA 2PMZE 2R92H 2GVBA 3D0FA 3FKIG 2UUAL 4JBJA 3H0GG 2UXBQ 2VQFQ 1VQAA 5C3EH 1VQHA
chains in the Genus database with same CATH superfamily
3DMUA 3WOEA 3TP5A 3CC7A 3S2HH 3OTOL 4OHJA 4DR4Q 5IOCA 1BBXC 1K0SA 1EQRA 2FMCA 4F8MA 3NWTA 5IP7H 5KYIA 1PFMA 1UUPA 1SFOB 1KQSA 3FKIH 4L5SA 1PTOF 1CHPD 4WJ3M 2AWOA 2P5ZX 3E9HA 1KC8C 4JI6L 4JYAL 2JA8B 5JAVA 1G51A 4MTKA 2EYJA 3GTPH 5EPJA 4DK3C 1FR3A 4G57A 1QUQB 4YWKA 3KJPA 5DLQE 5C3WA 2F3VA 1CA5A 3OSOA 5TSSA 2WAQG 4WRDA 3H3VH 4JCVE 4KLKA 2RBMA 4L8JA 3HOVB 3S24A 3A56A 4DV4L 3FMCA 3KF8B 3ND8A 1VF7A 1Y1VB 1WTQA 4RHRA 1YJNA 1WD1A 1B9NA 1JB7A 1MHWC 2RHQB 1RF2D 1IKLA 1O7ZA 4X64L 1PH3A 1XNRL 4JV5L 3K5LA 1GO3E 5M5YH 2F1MA 2XRQD 5KGUA 1HTLD 4A3KB 4JYAQ 3V05A 3CCLA 4JW0A 5KYLA 2KHIA 4LNQA 1GJXA 3DWPA 4ZUIA 4A3IH 2HCIA 2NTSA 1EZ8A 4K8IA 1JJGA 1OXXK 2PQAB 2K6AA 3OW7A 4K8JA 1V8QA 4JK1C 1E1TA 4LFCQ 1FJGL 1QJOA 3J7YW 1K3BC 2RHSB 5M3FB 1T5XD 3X3MA 1JR0D 5KEEA 2MGSA 2JYOA 1IW7D 4RG1A 2RCFA 4CDDC 1VQMA 1F2LA 1OXTA 3DEOA 3RMHA 1Y8PB 2HIVA 5AJ3L 2JA7G 3K80C 3ICEA 4Y7NB 2NN6H 3IL8A 1SAPA 3W1GA 5GAEC 2E8GA 3DHQA 1VQ9A 2QEJC 3J7AV 4NB3A 2E74C 3OIPA 4NP5A 1YBYA 1VQFA 1NMGA 4XYQA 4HCSA 5IP9G 2I5LX 1P16A 2WV6D 1TWAB 3H91A 4DR2Q 1WTXA 4XT3B 4QMGA 1HA5A 1LTGD 2F03A 1E7ZA 3MHBA 3P75A 2L11A 1PH2A 4LUZA 3I4NG 4TRDA 1PH8A 3RZOH 2ZJQA 3K5OA 3FPPA 1V43A 1I4GA 1MIUA 1TS3A 3PIOA 2WINB 3VA5A 2B63G 1XPOA 2KCMA 2O2LD 1XWEA 2RSNA 4IJHA 2LXKA 5IT9c 4CGYB 3ERSX 1HNZL 5JVG3 3F1ZA 2JA7B 2KA7A 3R8BA 3NENA 1VQCA 3GTQH 3CCSA 1GVPA 4HJ5A 2A6HD 2C5CA 1C7YA 3PIPA 5C0XH 5E1FA 1HNZQ 1C8CA 1KLUD 3T1YQ 4X64Q 1D6EC 3I70A 4KJNA 4X3UA 1BOSA 1ZKOA 2A6EC 2N78A 3SGIA 2L4NA 3JAML 2MNAA 3HOYG 3MXGA 5AFWA 3A0JA 1LTLA 4LF4Q 4IOCA 2AMCB 2VB3X 1E22A 4DF7A 3L0OA 2Z9HA 4U68A 3C1EA 2GVAA 2OF1A 1TS4A 3J81j 5E4XA 2EYMA 3UDGA 4HSVA 2LMCB 3J80i 1PH7A 1V1OA 2V1CC 3GV3A 2H4OA 3JAMi 4KTAA 1XNQQ 3NHHA 2YV5A 5IIFA 1LT5D 1Y1VH 1B3QA 3EFXD 1JICA 1A0IA 4KK7A 2HQEA 3ULPA 1IBML 4UPAA 5M9OA 1I3QH 2L0CA 1X55A 1LACA 5J3BA 4IUNA 2MFIA 2R92G 1L1OB 2SDFA 4PZ7A 3KBGA 4X6AH 3VR4A 3HFZB 3S17H 2ATWA 3HOYB 2IJ0A 3PUZA 3F2CA 5GROA 3MZ5A 5IGEA 1M4VA 1EIYB 2I46A 1EIFA 2EPBA 4K6DA 4FXDA 1NJIC 2E2IB 1XXGA 3HOWG 1PZID 1TXYA 3NTIA 4GLXA 4ODGA 2PW5A 4DN4M 1M1KC 3I4NH 1F2ZA 2D5DA 1DCZA 1SE4A 5FLXL 1B50A 2KECA 4OX9Q 1G2TA 2TSSA 4HR7B 3HOXG 1YNXA 4GNXB 2MP1A 2WAQB 1FNVA 4V0BA 2K5QA 4YY3L 4IUUA 4TKOB 5I9OA 3ERQA 2D9UA 2OTJA 3T56B 2BDOA 3K81C 4PZ6A 1D7QA 1EQTA 1BBWA 3S1QH 2QILA 4JOIA 2K52A 2EYPA 5E3FA 3SVMA 1I5FA 1P8LA 1GKHA 2IL8A 1X56A 4CKBA 2KCTA 3PUXA 3F8TA 5IT9E 1Z6HA 4QQBX 2PYKA 4X3SA 1CSQA 3PO2H 1SYGA 5EGTA 5CV5A 1X3PA 2ZT9C 5J39A 5IP7G 1TY2A 1SMXA 3CCUA 1LT3D 2FFKB 5CV7A 3TEHB 3U9OA 1F77A 3GTMH 4H02A 4ZQ3A 4A93B 4G7OC 1KDBA 1VQGA 1Q12A 2BE5D 2ZTCA 3NELA 1EY6A 1TWGH 2VQFL 3CQZB 1GUWA 4DV4Q 2YU9H 2YTVA 4DR2L 3DLLA 2FHTA 2CQOA 4DV1L 4GOPA 3I4MB 1IBKL 5A35A 4FDBA 1PVOA 4BBRH 1T5EA 4BS9A 3NBHB 1PH6A 3EN2A 1Z7TA 2RDHA 1EEID 2IT1A 2Q8TA 1U4MA 1S40A 4AYBE 1IL2A 4NXML 2DY8A 1G291 2E5LQ 3GTJB 3BYYB 1EWCA 4C3JG 3A5ZB 2DN8A 2L55A 2M00A 1J8IA 2JA8H 4HJ9A 3L7ZC 3KUPA 2F0HA 1VQKA 2G5DA 1JC7A 1HH2P 3M4QA 2UXDQ 4FXGC 4CJ0B 4QJFA 4BY1G 3M4OB 3UDIA 3J80L 3W5OA 1C9OA 1E2ZA 3KLWA 3M4PA 3LX0A 4KHVA 1PA6A 1HZ9A 1K8AC 3GDEA 1YI2A 2CCZA 1EZ6A 1OXUA 4B9XA 5IWAQ 2E2JB 1W3SA 3GO5A 5C4XB 4X66Q 1N33L 4RCOA 3U9SA 1EY4A 4JG2A 4F7XA 4LJZC 2AQ3B 1VMCA 1X3GA 3J7ZC 5FLMH 3D6CA 1N8RC 2L9HA 1BXTA 1ICWA 4CKCA 1PV4A 4A3MH 1LV9A 2N3SA 1TT2A 4C3IG 5IYBH 4KHZA 4OIKA 1AEXA 1GHJA 1VQIA 2FINB 3QB3A 1NR4A 4PG3A 3CF5A 1CTMA 1NR2A 2FMMA 2FXQA 4DUYL 5E4WC 4RKLA 1UE1A 2K14A 1BCPD 3HZXA 1F9QA 1HNXQ 4O1NA 1XTCD 3EROA 2DUDA 4DV7Q 3B6YA 2K5NA 5DM63 5M3FH 3C3LA 4L63B 3GV6A 2L15A 5IY0A 2BA1A 1GUGA 4U673 1VF5C 5C6AA 3Q22A 2RDFA 3IFTA 1H95A 2IY5B 5IYCG 2UUCL 1H9KA 4M8AA 3S14H 2N88A 1TWHB 2EYLA 5FJ8G 4DU9A 2J4XA 3AFPA 4GN3B 1EUJA 1N32Q 1ESRA 1SEBD 3JC66 1PXUA 5IODA 3G6EA 1HJPA 2JA5H 4POGA 5M5WH 4X3KA 2HHHL 1ILQA 3QWNA 2G9HD 3H15A 3FKIG 3H0GG 3A54A 1VQAA 1PRTF 4YCWA 2LKVA 2JP1A 2SNSA 4JPBW 2JA5B 2E76C 5M5WB 1XPUA 3DM3A 3K57A 4QF4A 1DD2A 3U4ZA 1X3FA 2JA6B 2JXMB 2VXWA 2PZWA 4V190 3UI2A 4GZYC 2HDLA 1NNXA 2VZAA 1XX8A 2K33A 2UXCQ 3BVZA 1XPRA 3RR5A 2AQ1B 1BKBA 1HRJA 2F4VQ 3NTHA 3ER0A 3HOXB 4X62Q 4HEDA 2RKSA 2J0TD 5KNCA 1Y8NB 1AN8A 1O7IA 1XJVA 4F87A 4DV5Q 2XN9C 5HURA 2TMPA 2R7ZH 1BUVT 4M1UB 1D2BA 1UEAB 2UU9L 3KLSX 2B2UA 3AB9A 3RUZA 3RLFA 4XQJA 3X3NA 1NAPA 1I4XA 1SDFA 3Q24A 4Z9CB 1PRTB 3Q23A 4DR5L 5CBEE 3RZDH 4GOPB 4AYBB 4B3ML 1IZ6A 1WYDA 2F0MA 4KY6A 1LYLA 2EY5A 3KYHC 2VQEQ 2N49A 5D3IB 2XNAC 2NVXB 4BA2I 4B3RQ 1B9MA 1RCVD 1R9TB 5I2XA 2JJQA 1QZHA 1EY0A 1HUNA 3K7AH 3VA7A 1PH1A 2JA7H 3PF4A 1E0BA 3DEPA 4YWLA 1K0RA 4P2CB 3T51B 4OXPA 2KEDA 4DR4L 1TQOA 4B3RL 1EYDA 2Z1CA 4IN3A 2A68D 1Y8OB 3OWFA 1IBLL 1Y1WG 4RH6A 4H7BA 2VUMG 1I4RA 1EWIA 1NUCA 3I4MG 5C44G 1O7LA 4ZCKA 3S2HB 2YTXA 2NN6I 3S9WA 3HOVG 3CCRA 4ZKBB 2NTTA 4AYBG 1SYEA 4LF7Q 2F3IA 4I7AA 4DR7Q 2NZHA 3BDOA 3FEWX 4KY7A 2WB1B 3VR2A 3I4LA 1J6QA 1TVXA 1UE7A 3ULJA 3CHBD 3KJOA 4EX5A 5M5XH 2Z8LA 3HGBA 1HZBA 4X62L 4ULLA 4A76A 3PIP3 1PTOD 4RHSA 2BA0A 4LAAA 4HSPA 1WVLA 3S14B 4K0KL 3FPUB 4WJWA 3CXCA 2WKDA 4C3IH 3AYHB 4R4TA 5ELFA 4GKKQ 1N9WA 1K73C 1UWVA 2OQ0A 1B44D 1VQEA 2HD3A 2Q2HA 5IGGA 1FJGQ 1LO5D 3AMUA 2KOLA 1K83B 4NKLA 3E5SA 4DR3L 4IZ8A 2SEBD 5C4XG 4KHPQ 5A2QE 2B2TA 4LFBQ 4BY7G 1DGSA 3H0GH 5EKLA 2F0FA 3HOYH 1B1ZA 1J9OA 5G3LD 2XTIA 1CKNB 2Q2IA 1FNWA 4IFDJ 3FHWA 2CW0C 2Q2TA 1SE2A 1PTOB 4BBSB 3DXJC 4LFBL 5M5YB 4HN7A 3URYA 1R4PB 1Q90A 1IBLQ 1F2MA 1EU3A 4R8IA 2IPKD 3HOUB 1NSNS 1MD2D 5L37A 1OO9B 3QOJA 3R3OA 3I55A 1WTRA 1N33Q 3PGZA 5CGKA 4J15A 1A3VA 3PSIA 1MI2A 1YNNC 3S15H 3J7A5 2NVTH 1ONLA 3D4DA 4DR3Q 1TS2A 4JI8L 4ZRZA 1VDZA 3VR6A 2B39A 4C3HB 2R7ZB 1M90C 1ZYRD 4P74A 3BZKA 4BWGB 3AFQA 4POFA 1CA6A 1X6OA 3GTMB 3T1YL 3JAME 1DZ1A 3PO2G 5JJIA 5LL6X 1SNCA 2IW3A 2KVMA 1CQFA 2CFMA 1I4HA 2VQEL 1B2TA 4A3KG 3FDTA 1WOCA 2A8VA 1E2VA 1HPCA 1NTGA 2J7ZA 2CWPA 4CJ2C 1AP0A 4LUOA 1ET9A 2XRSD 3MVVA 1Y14B 2E75C 2EYFA 2X6LA 1WTOA 2OT2A 1B53A 3H3VC 2E2HB 1GUOA 4DAMA 2EY6A 4B3TL 2K03A 4DV3Q 4DV2Q 1FYCA 1Q46A 2JA6G 4DR6Q 2K5DA 1BQQT 1O7YA 2K1BA 1D5ZC 2D62A 1ML0D 1I94L 3SK6A 1HXYD 4JI0Q 2KCCA 3M7GA 4X65L 3KF6B 4KD4A 4MTNA 1XMOL 2PQEA 4HJ8A 1OXVA 3MAQA 4RCNA 5LMUL 1I4QA 5EBCA 1PH5A 1V1PB 2ZXPA 2BDNA 4IURA 1DONA 3BYTB 2E5LL 2OTLA 4Y52H 3MXPA 3DUZA 1KHIA 4B3MQ 4YHHQ 3C1FA 1I3QB 5IGBA 3QR8A 4FF3A 4O42A 3J80c 1EOVA 4OIJA 4KJOA 1G8ZD 1S5FD 3KLRA 3QOLA 1S3OA 1HR0W 1S72A 4KKUA 1SJHD 4C2MB 2B2VC 4LF5Q 3AQQA 4P72A 1Q81C 4LFCL 2BOSA 4J6HA 4OX9L 3AEVA 4RGTA 1ET6A 2E2IH 4NMZA 4QUFA 2EOTA 1KAWA 3F2DA 4YWMA 1XMQL 4ALPA 1PYWD 1HR0Q 3P20A 4KHPL 5IT9L 4BY1H 5C44B 1TU2B 1Y69U 3TS2A 1HQRD 1SFOH 1CKMA 3D6WA 4A3BB 3E0JA 1BCPB 4DA2A 1ASYA 1X32A 1CUKA 1STEA 3STBD 3Q0AA 1A2UA 1QZGA 1DM0B 2JA5G 1Z47A 2JEBI 5CYUA 4IALA 4DV5L 1RD9D 4GLVB 4TSSA 3NQIA 4AH6A 1CK1A 2KBNA 3EA6A 2Z6KC 3S1MB 2HQLA 1QOHA 4XT1B 3SEBA 2B2YC 5C0XG 3GTJH 1U4RA 1RODA 1KRSA 2KQ3A 2QCPX 2CH4A 2A6ED 5C3EG 1JWMD 2ZXOA 4QCLA 4OWTB 2Z4HA 4A93G 4A3LH 2A1AA 4JBMA 1RJTA 3CAMA 1MJEA 2XSCA 4IFDH 1VQDA 4G7HC 3GTGB 3HOZH 3G7LA 5C5MA 5JPMC 3KOJA 2A73B 4LW1A 1TWHH 2MPMA 5BN5A 3H3VI 3TP6A 5C4HA 1PH9A 4BY7B 2B29A 4A3MG 4RGNA 4A3GB 3GQBA 4DKAC 3GTLB 4DAYA 5JPNC 4HAEA 5IGDA 4YIJA 1IKMA 4A3LG 2O4XA 1VQOA 2DGYA 3J80E 3TSSA 3HP3A 1Y1VG 2PZTA 5FLXc 1YHBA 1L0XB 2R92B 1NY4A 4R4IA 1SNOA 2EYHA 2LSSA 3OTOQ 3F2BA 3NBIA 3FP9A 2A5HA 2XIWA 2HIXA 4LF5L 5C3EB 2JSOA 3CPFA 4C3JB 2R93H 3MWYW 3HOUG 4UHVA 4DK0A 4L6TB 4BA1I 5EPLA 5D3DA 4GNXA 2UUCQ 2JA6H 2QGQA 5GAHC 2K5HA 3I8ZA 3PUWA 4A3DB 1ENAA 1PMRA 2N8NA 5JEAG 5C0XI 3DWAA 3N6RA 5FJ8H 3NSWA 3CU7A 1X3QA 2K50A 3TRZA 5C4JH 1Q86C 1Q1BA 1OXSC 4PMBA 3M3YH 1FL0A 1D8LA 1EIHA 4R4QA 2Z6BA 5M3FG 3F2UA 2R3ZA 4MNOA 2IHEA 3S16H 1HA6A 1LTBD 2K28A 2Y0SG 1YIJA 3VR3A 1MSGA 2ZTDA 4XTCS 1KD1C 5C4JB 3CCJA 4IOAA 1RKNA 4MN3A 2EYOA 1Z9FA 4EQPA 1ZEQX 1IBKQ 2R7ZG 4BXXG 5KIXA 3I73A 4L5RC 4C3IB 3HOZG 1SN8A 5I2YA 1CKNA 4A3CG 1EEFD 2UXBL 3OW2A 4GN4B 3OYYA 3JAMc 2PMZE 1KNAA 3D0FA 2UUAL 4AIMA 2B63B 4ZK9B 1TIID 4LF6Q 1H9JA 4CKEA 3PO3H 5ISRA 4NPSA 1LUZA 2F0OA 4B9WA 4DR1Q 3I4NB 1ILPA 2WKCA 1Q1EA 2UU9Q 2YTYA 1SROA 3MC0B 4JI7L 4FP5D 4ZUJA 2ZJPA 5GQOA 1YNND 1AW7A 4QIWB 2CKZB 2I5HA 5J22A 5BR8L 1VQJA 3O13A 3P1HA 2HHHQ 5IGFA 3I2ZA 1N36L 3NP8A 5FK9C 2A74C 2R61A 3ZJYC 4IFDI 3QJYA 2XVSA 1EYCA 4P73A 4KN7C 3NBHA 4N9PA 1BCPF 5ELCA 3WDNA 4A3JB 3SK5A 1B4OA 4IPDA 5LL6S 2AUKA 3S1NB 4DXGA 4DV1Q 2C9OA 3RZDB 1JWUD 4CDCC 4Y7NH 1I6HB 4HCEA 1AZQA 4UY8C 1QILA 4BBRB 2NZ1D 4KV6A 3M4YA 1LTTD 1VQ6A 2H5XA 3PUYA 3I90A 1W6JA 3RD4A 3A74A 2EVBA 2EZVA 1SR3A 3M7NA 1QNKA 1PTOH 4RGMA 2KHSA 4BBSH 4RA8A 3G48A 1V9PA 3I3CA 1F9PA 3MXUA 3BS1A 2E2JH 1IHZA 2IHFA 4A93H 1EOTA 1DOKA 3BDCA 1XMQQ 2L5TA 2NB0A 4LWCA 2HT1A 2UXBQ 1QVCA 3T1HQ 3HKZE 1U5KA 1U4PA 1I50H 4YCUA 1IBMQ 1VCIA 1TWGB 1S5ED 1LTID 1V1PA 2KENA 4GNXC 3MFYA 4FXKC 1KDCA 2PNHA 3CCEA 2YU9B 4AQYQ 2NYZD 1YJ9A 2UUBQ 2EJFC 1XNRQ 4IQZA 1FGBD 3NE5B 4HIKA 3M3YB 2F0QA 3PF5A 1FNUA 4J8QA 3V96A 3MXNB 3K5NA 3S1RH 3OMGA 4CJ1B 1SYDA 4A3DH 4MHEA 3TMEA 4WJ4A 3VR5A 4OO1H 1TY0A 4HIOA 4JI1Q 1JJCB 3IAYA 1KTKA 2ZTEA 4IUPA 2F0JA 1XMOQ 2NWGA 5I6WA 4FF4A 1WCMH 2QDLA 3MA2B 1Y1WB 2F4IA 3MTSA 5C4XH 4S3SA 5FO8B 4JI1L 3WWVA 4LFAQ 4K6LA 1SLJA 4A3GG 2RA4A 2ICEC 1LLRD 1KLGD 3STBC 4K14A 2I5MX 5EKKA 2I0QA 3BVGA 4DPGA 4DGZA 3EIVA 2F0WA 2EJGC 5FO9B 2UUAQ 2VL6A 1QG7A 3BJUA 3NQTA 3LWUA 3GTOH 3OIQA 4A3FH 1KL9A 3K0YA 1W2BA 4OL7A 4QY7A 4LF6L 2E2DC 5IYDG 3HS0C 1GHKA 3GD7A 1D5MC 3UE1A 1A15A 5ELEA 4FF1A 2B63H 5T1IA 3RN5A 3BZDB 3I4MH 1S5CD 2Q8RE 4A3EB 5FOBB 1SNPA 1IW7C 3S1RB 2EXDA 5K36H 2NVQB 5CMDA 5JJLA 1GUTA 4FNFA 1PFBA 4L5TA 5CR3A 3T13A 2I07B 3U50C 1CKOA 2H1EA 4Q0FA 2R7FA 3KLSA 3QO2A 4ZYSA 1XTDA 2NVTB 1L1OA 2B2VA 4AQYL 2UUBL 2QDBA 4N9TA 1VQ5A 2ZXRA 3GTPB 2RQXA 2LXJA 3R2TA 1YJWA 5ELNA 1YHQA 1QWYA 2NN6G 1K8GA 2NVYB 2F0LA 4NXMQ 1GUSA 2DJGC 3MEHA 3M4OH 1TWFH 1XYIA 1GXDC 3NEMA 2K04A 2LFNA 4FVMA 3HOXH 2Y0SB 4R4OA 3M85A 1HTPA 1STBA 4CDEC 4DAYB 1IYUA 5LMNQ 4JBKA 2G9DA 4QGUA 1LM0A 1MGSA 3Q8DA 4UP9A 3GTKH 4A3IG 3A7AB 1S5DD 1EIGA 1STNA 2L1BA 4I7ZC 1DOMA 1K9MC 2PQAA 1WTPA 2PCFB 4DV0L 1VS0A 1JWSD 1PZKD 2NZOA 2R7DA 1YNJD 5DNFA 3EQLC 1R4QB 1UE6A 4IUTA 2EDGA 2IX3A 3C46A 3D3RA 4H13C 4A3CH 3I91A 4ME3A 1B7YB 1HCZA 1MJCA 3KBXA 2F0TA 5COYA 3TREA 1I50B 5IYBG 2JE6I 4N8X1 1PZJD 4UP7A 1JORA 4BXXH 4KKSA 5AJ3Q 3PCOB 1WCMG 4PNYA 4WORA 1BNZA 4OONA 5T1GA 4MIUA 4ZLTF 5LMNL 5LMUQ 1PYSB 1J5EQ 4PMWA 2MO0A 1WI5A 3GTGH 5M3MH 1K3RA 2F0GA 1H9SB 4RMFA 1QVGA 4LF4L 4ABNA 3K7AB 1WTHA 1SBBB 1X54A 1LT6D 4KI0A 3SHLA 1YVCA 5IGCA 1VQ8A 3HEJA 3CMEA 5IYCH 3K6OA 5M3MB 1MSHA 2WB1E 2MO1A 2CWAA 3G6JB 1I6VC 4LK1C 1E3PA 4DUZL 3MFGA 3CW2C 5JJZA 2O5JC 4C3JH 4QL5A 3IRBA 3L3OC 4KKTA 1VMPA 2MJ8A 3UDXA 1NCVA 2PW7A 3DWQA 1VQ4A 1K83H 2F0KA 4YHHL 1JT8A 5EKIA 2PI2A 5F2DA 3ND9A 4DV3L 3FKIB 4PZ8A 5CV8A 3BU2A 2C35B 3K8AA 4DAVA 3OWEB 1NE3A 4X3TA 3GTQB 3A5UA 5FLMG 4H44C 1CI3M 4IFDG 1G6PA 3HOVH 3HRZC 3W3AA 1B3AA 4GOPC 4OWXB 1ZYRC 4JI0L 4KMUC 3E9IA 2XWBB 5DAUA 1PRTC 5M5XB 1IYVA 4OGQC 2M2LA 4IUQA 2RF4A 3ITPA 4GKJL 2PI2E 1SNQA 2OEOA 3L9AX 4LF9Q 3W2DA 4KY5A 4OEMB 3BZCA 5GAGC 2O5IC 4DR6L 3OHXC 3MEFA 2GA4B 2N55A 2D2CC 2AKWB 1E2WA 2CHBD 4IPHA 4JI3L 1YEZA 4ILWA 4A3JH 4R1JA 3NPPA 1AFPA 1MKHA 3EVQA 5EBDA 4A3JG 1ZXTA 3HKZG 4RFBA 3RZOB 1SYFA 3BG3A 2B2WC 2AQ2B 4FYDA 1PHJA 1A2TA 3PMFA 4K5WA 1MBYA 4LFAL 4JI5L 4JI4L 1BR9A 3HOUH 4BBRG 3CMAA 4EVOA 3TS0A 3R93A 3SR1A 2AHOB 3J7AF 2F52A 1UE5A 2QW7A 5FLXE 4JV5Q 1X3EA 1K28A 2K5WA 2K5VA 2B2WA 2KUMA 5HGQA 3G4SA 3KF6A 3T4AC 5I6YA 2ES2A 4A3EG 2OWOA 1VQBA 1JOOA 4R8NA 4XXEA 4H0LC 5D14A 2IX0A 4CHTB 4A3BH 3TP7A 3OOCA 2K4KA 3CCVA 3A8IE 2VUMB 3VDYA 4GLAC 4TVAB 3D4WA 5LHY1 4Q5VA 1TWAH 3ONAB 3LNNA 3LGJA 1TKWB 4DNIA 1KXLA 3EBEA 3CKIB 1N36Q 2Q2UA 4KN4C 4K5XA 5IP9H 3J81c 1TS5A 4YCVA 3TN2A 1D1KA 4EQ5A 2K32A 1V1QA 5CV4A 2VUMH 4JVZA 3MXNA 4UDUC 3D8GA 1YHAA 5CBAE 3ZYYX 1LTAD 1F9RA 5DM73 3U4VA 4E6IA 1H9RA 4GN5A 4DR1L 5CORA 1A3TA 1HNWL 1YITA 4A3KH 2FJ2A 4PQXA 3T16A 2PPBC 4JI6Q 3V2TA 2CQAA 1IYJB 5BR8Q 2E2HH 4A3DG 5HGTA 4JBJA 1EFID 1QCBD 5ELDA 1EY9A 2BH2A 2L12A 1VQHA 4I65A 1TR5A 1CHQD 1HR0L 3GP7A 4LF7L 1QNUA 3SDZA 2IWHA 2R93G 4QB4A 1VQNA 3NWSA 4UP8A 1IXRA 1L0WA 3QG1A 3E3XA 5A2QL 2F3WA 1E1OA 2ID0A 3KDFB 1B70B 2F0EA 4JOIC 2K05A 4JI2Q 1EY7A 3S17B 2CH4W 1ENFA 1AZPA 2M9VA 1M8AA 4BY1B 4A3EH 1WCMB 1PLFA 4DV2L 1SJED 2QF7A 4C56C 3KK7A 2QKIC 1LTRD 5HY6A 1EQQA 3QIAA 4C3HG 2OXPA 3G71A 1EY8A 1KABA 4IPGA 2F4VL 4OELB 1JOQA 1D5XC 1RHPA 3K5MA 5ELBA 1HZAA 2DNCA 1LABA 1Q8KA 3SXHA 4HMIA 1SMYD 1CFMA 5KNBA 4A3FB 1KRTA 1QB5D 5DEHA 3WOFA 1AE2A 3H09A 4A4IA 3A8KE 4LMQD 3KDFA 4L5QA 1WFQA 4IUVA 3TBIB 1WTVA 4HTHA 3CRKC 3K58A 2HUGA 1CM9A 2OCEA 3GTOB 1QE6A 1RDPD 3BVMA 2V4DA 5EJWA 3AU7A 1EL0A 4BY7H 4A3IB 3BDLA 1SNDA 2VY3A 1ENCA 1A8VA 4ZAIA 1CQVA 3UE0A 1KDAA 3PIO3 3EJIA 3I72A 3E6ZX 5K36G 1SE8A 2EJMA 3PO3B 1PFSA 1WJJA 1AH9A 4MZ9A 1VQPA 2DNEA 4HMJA 3HOWB 3U58A 3M9BA 1EFWA 4A3FG 2B8FA 3OPOA 3T53B 1KAAA 4IO9A 5C4ZA 4HIMA 2IX1A 2SOBA 3S1MH 1SNMA 1CZGA 5CV6A 1FVIA 1VQLA 2D0OA 3D4RA 1PFNA 2XWJB 3VYSA 1HUMA 4LF8L 4A3GH 1CT1D 2F0UA 3VYRA 2WAQE 3CRLC 4LUVA 3S1QB 1C48A 4NDXA 2F0PA 5E7NA 4DV6L 3E0EA 1LT4D 3A7LA 4J1MA 1U9RA 5JJKA 1JE4A 2K75A 2X69A 3UDFA 3K0XA 3HOZB 3FVQA 1PYBA 2NUCA 3HKZB 2ICIA 4C1NK 4JI2L 2B8GA 3TDQA 2QA4A 2MUYA 3K7UC 3HKSA 3NUCA 1DJRD 5JOBA 3GTLH 1O80A 4WFN3 5JEAH 4JI5Q 2K01A 1ICFB 2BE5C 1T9HA 1QUQA 1HNWQ 2VW9A 4G4KA 2SNMA 2EXZA 1EY5A 4NXNL 4GKKL 5CV9A 2B2UC 4RGOS 2BCOA 4UAIA 3CCQA 3RLNA 1KIXA 2PNRC 1JQYD 1AE3A 1S5BD 1HZCA 1BO0A 3H94A 1IL8A 2ZM6L 3K59A 4C1NI 4EQOA 5CC4A 3HOWH 2CW0D 1XNQL 1UNSA 4O0AA 5JEAJ 1B8AA 2F0NA 1JCKB 1JOKA 5C5LA 2Y0SE 2RDGA 3I4OA 4HJAA 3HG9A 4K2KA 4X65Q 3Q6SA 4F88A 1F2YA 4K0KQ 4O2DA 3IFDA 1Q7YC 3J81E 1X65A 4QIWE 4KD3A 4EQNA 3CCMA 2A69C 1BF4A 1GUNA 4XQNA 1EYGA 4RKBA 4FO2A 1JMCA 1STAA 1C4QA 2GN5A 3SK4A 5FKAC 3L2PA 1G6ZA 1TWCB 4HIDA 1WTWA 1N34L 1YNJC 4P75A 4CBVA 1Y1WH 2VB2X 4NW2A 5J1ZA 3SE0A 4JI4Q 4GKJQ 4EGVA 1SMYC 3CP0A 3S1NH 5BN4A 1E24A 4PMCA 5IWAL 1VQ7A 2WACA 1A62A 4C2MH 1L1OC 2JN4A 2PMZB 2UXCL 1I6HH 1STGA 2AWNA 1H9MA 1W6KA 1YZ6A 5ELOA 5FO7B 2R93B 4B3TQ 4A3MB 2K7VA 2R6GA 5H1SE 2ASBA 4XYOA 1SSOA 2XGTA 3LWEA 1BDOA 5C0XJ 4K5VA 5C3XA 2JA8G 1I94Q 2WB1G 5EAYA 5GADC 4B3SL 4JI3Q 4OWWB 3C2PA 1PTOC 3CQZH 4HJ7A 4QUCA 2PZUA 3PV0A 3S16B 1L0YB 2F0VA 2JA9A 4P71A 3S2DH 1Q82C 5JVH3 2EE1A 1PDQA 4ZKCB 2VNUD 2F0DA 1A3UA 2X6GA 2HDMA 1S4ZA 1SE3A 1NMFA 4DNTB 3OMCA 3TZUA 2NBFA 1DOLA 1D1IA 3D31A 4BBSG 4APVA 2LS01 4DAPA 2OQKA 2A68C 1GD7A 1N34Q 2AUJD 3RN2A 1CZWA 4PV1C 5K5PA 4DUZQ 5KRUA 3H0GB 2KJXA 3I56A 2VS1A 1X9NA 1GM5A 4G7ZC 4A75A 1PH4A 2ZJRA 2MQHA 3PQIA 4JI8Q 4RWSC 2PO4A 3TZDA 1C0AA 1SXTA 2DY7A 5NUCA 3VYTA 4DV6Q 2F0SA 1K8OA 5I9PA 1SYBA 1O78A 1HFNA 2DJFC 1RL2A 1STYA 5M3MG 4IJLA 3N52A 1J5EL 4FF2A 3TP8A 5I4DA 3KFUA 3IKJA 3W1BA 2QEXA 2B2TC 2KCNA 1STHA 5EQ0A 2NVXH 1GOZA 2JK8A 2CVRA 3CC4A 1R9TH 4OO1I 4DV7L 1HQMC 1LTSD 4DFAA 3CC2A 1Q8IA 4ID6A 1ESFA 1OTCA 3FRPB 4NXNQ 1G91A 4LF8Q 1TWCH 1A6XA 5EPKA 4GS3A 2EIFA 1RIPA 2A6HC 1EYAA 1HNXL 1U0LA 3A8JE 1L2FA 2ALYB 4B08A 4JC0A 3PUVA 2ZM6Q 3PO2B 2WP8J 1A63A 4JI7Q 3J81i 2D0PA 1HFGA 4DK6C 2EY1A 4DV0Q 1FGUA 1HHVA 3P7JA 1FD7D 3RLOA 4R9WA 4K2LA 4XQQA 4XDXA 1WD0A 1TWFB 3KF8A 5C44H 3NXWA 1QVFA 1SYCA 4X66L 4IPCA 1EWHA 1EU4A 2JEAI 2F0IA 4DUYQ 2EY2A 1CSPA 2NVQH 3TQYA 1N32L 2RSOA 4DNRB 1H9SA 1UEBA 1Q3LA 2A19A 3ULLA 2KEEA 2RVLA 2MHVA 1EQVA 4N8FA 2KHJA 3I7FA 4DR5Q 4OO1G 3J81L 3RNUA 4JBWA 2LY7A 2ENBA 4DR7L 2A69D 1SRUA 4DK1A 3S2DB 3A55A 1JE5A 3DM1A 4XIGS 1BVSA 4ME5A 2B3GA 3H6MA 1RTNA 4LF9L 2BH8A 2Z4IA 3PO3G 2B2YA 4CDFC 1KNEA 4C3HH 1UAPA 1BCPC 2Z6KA 4B3SQ 4R4CA 2Q8IB 2RCNA 4DXFA 2NVYH 1U4LA 2EQSA 2HCCA 1II3A 3R2IA 3SK8A 1I4PA 4YY3Q 5LMNW 3VYUA 1G2SA 1ASZA 3CD6A 2WIIB 2UXDL 1JB3A 4RAUC 3S15B 1NBWA 5IE8A 4TQUS 1DXMA 1JJ2A 2WFWA 5G3LF 1K8MA 5IYDH 1DYQA 5BN3A 1BBUA 3NTKA 2YYZA 3T1HL 2Z0SA 1F9SA 1RTOA 3GTKB 3CPWA 1PRTD 3NK9A 4A3BG 2JQOA 2R92H 2GVBA 5KNDA 2VQFQ 5D65A 5C3EH
chains in the Genus database with same CATH topology
4AIMA 4YCWA 1HR0L 4LF7L 3CC7A 3S2HH 3OTOL 4LF6Q 1XPUA 3PO3H 4DR4Q 3DM3A 4NPSA 1LUZA 2R93G 3U4ZA 1X3FA 4DR1Q 1VQNA 1EQRA 1Q1EA 2UU9Q 5IP7H 2YTYA 1SROA 4UP8A 2VZAA 1IXRA 1L0WA 2UXCQ 1KQSA 1XPRA 3FKIH 3RR5A 4L5SA 4JI7L 2ZJPA 1E1OA 2ID0A 3KDFB 1BKBA 2AWOA 1B70B 5GQOA 2F4VQ 4WJ3M 4JOIC 2CKZB 2I5HA 3E9HA 4JI2Q 5BR8L 1KC8C 1VQJA 2HHHQ 4JI6L 4JYAL 3I2ZA 3ER0A 1N36L 4X62Q 1G51A 3GTPH 4A3EH 1O7IA 3ZJYC 4DK3C 1XJVA 4DV5Q 1QUQB 4IFDI 2R7ZH 4YWKA 3KJPA 4DV2L 5DLQE 2UU9L 4P73A 4IPDA 3RLFA 2WAQG 5HY6A 3H3VH 4JCVE 4DV1Q 4KLKA 1EQQA 3G71A 4IPGA 2F4VL 4Y7NH 4DR5L 3S24A 4DV4L 3RZDH 4UY8C 4GOPB 4B3ML 1IZ6A 3KF8B 1WYDA 1HZAA 3KYHC 1LYLA 2VQEQ 1Q8KA 2N49A 1VQ6A 2H5XA 1YJNA 3PUYA 1JB7A 4BA2I 4B3RQ 1KRTA 3A74A 2RHQB 2JJQA 1AE2A 1SR3A 4A4IA 4X64L 1QZHA 1PA6A 1PH3A 3M7NA 4BBSH 3K7AH 1PH1A 1XNRL 4JV5L 3G48A 3KDFA 4L5QA 1V9PA 2JA7H 1WFQA 3PF4A 1GO3E 5M5YH 2E2JH 4YWLA 1K0RA 2IHFA 4OXPA 4DR4L 4JYAQ 4B3RL 4A93H 2OCEA 3CCLA 2KHIA 1XMQQ 1IBLL 4LWCA 4A3IH 1Y1WG 4LNQA 2VUMG 2HT1A 4BY7H 1QVCA 3T1HQ 3HKZE 1U5KA 4YCUA 1I50H 1IBMQ 1OXXK 1JJGA 1VCIA 1EWIA 2PQAB 2VY3A 2KENA 4GNXC 3CCEA 1A8VA 2PNHA 5C44G 3I4MG 4AQYQ 2UUBQ 1YJ9A 3UE0A 1E1TA 2YTXA 2NN6I 4LFCQ 1FJGL 1SE8A 1XNRQ 5K36G 1PFSA 4HIKA 1WJJA 3HOVG 3CCRA 1AH9A 2RHSB 4AYBG 4MZ9A 3PF5A 1VQPA 4DR7Q 4LF7Q 2F3IA 2NZHA 3MXNB 3S1RH 3U58A 3M9BA 1EFWA 4A3FG 1J6QA 1UE7A 3ULJA 4RG1A 3KJOA 4EX5A 4IO9A 1VQMA 5M5XH 4A3DH 4HIMA 1OXTA 2IX1A 1HZBA 4X62L 4WJ4A 4A76A 3S1MH 2BA0A 2HIVA 5AJ3L 4JI1Q 1JJCB 1FVIA 4HIOA 1VQLA 2D0OA 2JA7G 3K80C 3ICEA 3HOYG 4K0KL 2ZTEA 3CXCA 4C3IH 3W1GA 3AYHB 4R4TA 5GAEC 4LF8L 4GKKQ 4A3GH 1N9WA 2E8GA 1VQ9A 1K73C 1UWVA 2OQ0A 4NB3A 2WAQE 1XMOQ 4LUVA 1YBYA 1VQFA 1VQEA 1WCMH 5E7NA 1NMGA 2Q2HA 5C4XH 3E0EA 4DV6L 1FJGQ 4JI1L 3WWVA 5JJKA 4LFAQ 2K75A 5IP9G 2I5LX 3K0XA 3UDFA 1SLJA 1P16A 4DR2Q 1PYBA 4A3GG 3STBC 4JI2L 1E7ZA 1PH2A 2I5MX 4DR3L 2I0QA 4LUZA 5C4XG 3I4NG 4KHPQ 2QA4A 4LFBQ 3K7UC 4DPGA 4BY7G 3EIVA 3HKSA 1PH8A 2UUAQ 3GTLH 2VL6A 1DGSA 3H0GH 2ZJQA 3RZOH 1V43A 3BJUA 1MIUA 2BH2A 3HOYH 3PIOA 2XTIA 1CKNB 3GTOH 2Q2IA 2B63G 4A3FH 1XPOA 4JI5Q 2KCMA 1T9HA 4IFDJ 1QUQA 1KL9A 1W2BA 1HNWQ 4QY7A 2VW9A 3FHWA 4LF6L 4IJHA 5IYDG 2LXKA 5IT9c 2Q2TA 4NXNL 4GKKL 1HNZL 3ERSX 4LFBL 3GD7A 3F1ZA 3UE1A 1IBLQ 2B63H 3NENA 1VQCA 3CCQA 3RLNA 3RN5A 1KIXA 3GTQH 3I4MH 3CCSA 1GVPA 1AE3A 1HZCA 4HJ5A 2ZM6L 1C7YA 3PIPA 1HNZQ 3HOWH 2EXDA 3T1YQ 1XNQL 4O0AA 4X64Q 5JJLA 5JEAJ 1B8AA 3I55A 4L5TA 3U50C 1CKOA 3PGZA 1N33Q 2Y0SE 2R7FA 4J15A 1XTDA 3PSIA 4JV5Q 1L1OA 2N78A 3I4OA 4HJAA 4AQYL 2UUBL 3S15H 3J7A5 2NVTH 4X65Q 1VQ5A 4DR3Q 1K8GA 2LXJA 3SGIA 1YJWA 5ELNA 4O2DA 2NN6G 4JI8L 2MNAA 1YHQA 3A0JA 1Q7YC 4K0KQ 1LTLA 1X65A 4QIWE 4LF4Q 4IOCA 2AMCB 1E22A 3L0OA 4NXMQ 1M90C 3M4OH 3CCMA 1TWFH 2GVAA 3J81j 3UDGA 3NEMA 4P74A 1EYGA 3BZKA 3AFQA 4POFA 3HOXH 3J80i 1PH7A 1JMCA 4R4OA 3M85A 4DAYB 1X6OA 2V1CC 2GN5A 3JAMi 3L2PA 5LMNQ 4JBKA 3T1YL 4QGUA 1XNQQ 4HIDA 1LM0A 1N34L 2YV5A 4P75A 3Q8DA 3GTKH 4UP9A 4A3IG 1Y1WH 3PO2G 1Y1VH 5JJIA 4JI4Q 4GKJQ 1K9MC 2PQAA 3CP0A 2CFMA 3S1NH 1E24A 5IWAL 4DV0L 1A0IA 2VQEL 1A62A 4C2MH 1VS0A 1L1OC 1VQ7A 4A3KG 3ULPA 1IBML 2UXCL 1WOCA 2AWNA 4UPAA 2NZOA 2A8VA 1I6HH 2R7DA 1I3QH 1YZ6A 5ELOA 1NTGA 1X55A 2CWPA 5J3BA 4B3TQ 1UE6A 2MFIA 4LUOA 1L1OB 4PZ7A 2R92G 1Y14B 4X6AH 3HFZB 2R6GA 3S17H 2ATWA 4DAMA 4B3TL 3PUZA 5H1SE 3F2CA 4A3CH 4DV3Q 5GROA 4DV2Q 2ASBA 4ME3A 1B7YB 1MJCA 1Q46A 1EIYB 2XGTA 2JA6G 1EIFA 4DR6Q 3TREA 5C0XJ 5IYBG 2JE6I 4UP7A 1NJIC 2JA8G 4BXXH 1I94Q 3HOWG 2WB1G 5EAYA 5GADC 5AJ3Q 1TXYA 3PCOB 4GLXA 2D62A 4B3SL 1I94L 1M1KC 3I4NH 1WCMG 4JI0Q 4OONA 4JI3Q 4X65L 3KF6B 4OWWB 5LMNL 4MTNA 5LMUQ 4OX9Q 1PYSB 3CQZH 1J5EQ 3HOXG 4PMWA 1YNXA 2MO0A 4HJ7A 3PV0A 1WI5A 1XMOL 4GNXB 4HJ8A 3GTGH 1OXVA 5M3MH 5LMUL 1K3RA 2JA9A 4YY3L 1PH5A 4P71A 3S2DH 1Q82C 4RMFA 1QVGA 4LF4L 2OTJA 2E5LL 2OTLA 2VNUD 4Y52H 3K81C 1X54A 4PZ6A 1KHIA 4B3MQ 4KI0A 1D7QA 1YVCA 4YHHQ 1VQ8A 1BBWA 3S1QH 3J80c 3CMEA 5IYCH 1EOVA 1NMFA 4JOIA 2K52A 1S3OA 1I5FA 2WB1E 2MO1A 1P8LA 1GKHA 1S72A 1X56A 3D31A 1HR0W 2KCTA 4BBSG 3PUXA 4APVA 4LF5Q 3F8TA 2CWAA 2OQKA 3AQQA 1GD7A 1E3PA 4P72A 3RN2A 4DUZL 1Q81C 1CSQA 1N34Q 4QQBX 3PO2H 3CW2C 4LFCL 4C3JH 4QL5A 4OX9L 3IRBA 5IP7G 1SMXA 3CCUA 3AEVA 4DUZQ 3TEHB 2E2IH 3UDXA 3GTMH 4H02A 1KAWA 3F2DA 3I56A 2VS1A 1VQGA 1Q12A 4YWMA 1XMQL 4ALPA 1X9NA 1GM5A 1HR0Q 4A75A 4KHPL 1PH4A 1VQ4A 2ZJRA 2ZTCA 3NELA 2MQHA 4BY1H 1K83H 1TWGH 4JI8Q 2VQFL 3TS2A 4DV4Q 4YHHL 1SFOH 2YU9H 2YTVA 1C0AA 2PI2A 4DR2L 1CKMA 1JT8A 3DLLA 4DV3L 4PZ8A 1ASYA 3BU2A 2C35B 2CQOA 1CUKA 3K8AA 4DV1L 4DV6Q 4GOPA 3STBD 1NE3A 1QZGA 1IBKL 3A5UA 1H95A 5FLMG 2JA5G 1Z47A 1RL2A 2JEBI 4IFDG 1G6PA 4FDBA 3HOVH 5M3MG 4IJLA 4DV5L 4GLVB 1J5EL 1PVOA 4BBRH 4GOPC 4AH6A 3NBHB 1PH6A 2KBNA 3EN2A 4OWXB 2Z6KC 3KFUA 2HQLA 3W1BA 2IT1A 2QEXA 1S40A 4JI0L 3E9IA 4AYBE 5C0XG 3GTJH 1IL2A 4NXML 1G291 1KRSA 2NVXH 2RF4A 2JK8A 2E5LQ 4GKJL 5C3EG 3CC4A 1R9TH 4OO1I 2PI2E 4DV7L 3A5ZB 4OWTB 2JA8H 4HJ9A 3L7ZC 3CC2A 1OTCA 4LF9Q 4A93G 4A3LH 1VQKA 3BZCA 5GAGC 2A1AA 4NXNQ 4LF8Q 4JBMA 1TWCH 4DR6L 3CAMA 4GS3A 1MJEA 1HH2P 2EIFA 3M4QA 3MEFA 2UXDQ 2AKWB 1VQDA 4QJFA 1RIPA 4IPHA 4BY1G 1YEZA 4JI3L 1HNXL 3HOZH 3KOJA 3UDIA 4LW1A 4A3JH 1U0LA 3W5OA 1C9OA 3KLWA 3M4PA 1L2FA 4R1JA 2ALYB 1TWHH 3H3VI 1PH9A 2B29A 1MKHA 1HZ9A 3PUVA 4JC0A 3GDEA 2WP8J 2ZM6Q 4A3JG 4A3MG 1YI2A 1A63A 2CCZA 3HKZG 3J81i 4JI7Q 2D0PA 4DKAC 1OXUA 4DK6C 5IWAQ 4DV0Q 1FGUA 1PHJA 3RLOA 1W3SA 3GO5A 4X66Q 1N33L 4LFAL 4A3LG 4JI5L 4JI4L 3HOUH 4BBRG 3CMAA 4JG2A 5C44H 2DGYA 3TS0A 1VQOA 1QVFA 1Y1VG 4X66L 2AHOB 4IPCA 1UE5A 2F52A 1YHBA 5FLXc 2JEAI 1NY4A 1X3GA 1X3EA 4R4IA 2LSSA 3J7ZC 3OTOQ 5FLMH 3F2BA 4DUYQ 3FP9A 1N8RC 1CSPA 1PV4A 3TQYA 2HIXA 2K5VA 4LF5L 2NVQH 1N32L 3CPFA 5HGQA 3G4SA 2R93H 1UEBA 3KF6A 4A3MH 3HOUG 2N3SA 2A19A 3ULLA 4A3EG 2ES2A 4BA1I 5IYBH 4KHZA 2OWOA 4GNXA 2UUCQ 2JA6H 1VQIA 1VQBA 4PG3A 3CF5A 2KHJA 2QGQA 2K5HA 3I7FA 5GAHC 4DR5Q 3PUWA 4OO1G 2FXQA 4DUYL 2IX0A 2N8NA 4JBWA 1UE1A 2K14A 5JEAG 5C0XI 3RNUA 4A3BH 4DR7L 3CCVA 2K4KA 1SRUA 5FJ8H 1K8AC 1HNXQ 3VDYA 4GLAC 2K50A 3TRZA 1JE5A 4TVAB 5C4JH 2DUDA 1Q1BA 1OXSC 1TWAH 4XIGS 3B6YA 1BVSA 4DV7Q 1Q86C 3M3YH 2B3GA 2K5NA 1FL0A 3LGJA 5M3FH 4LF9L 1D8LA 2BH8A 4DNIA 3PO3G 2L15A 5IY0A 1KXLA 3EBEA 2BA1A 1N36Q 4C3HH 2Q2UA 4R4QA 2Z6KA 3J81c 5IP9H 5M3FG 4MNOA 4R4CA 2IHEA 2RCNA 4YCVA 4B3SQ 3S16H 4EQ5A 2NVYH 1V1QA 2EQSA 2VUMH 2Y0SG 1YIJA 5IYCG 2UUCL 2IY5B 2ZTDA 1KD1C 4XTCS 4YY3Q 3CCJA 5LMNW 1ASZA 4IOAA 3S14H 1IBKQ 1Z9FA 5FJ8G 3CD6A 2R7ZG 4BXXG 1YHAA 2UXDL 3AFPA 4GN3B 1EUJA 1N32Q 1NBWA 5IE8A 3JC66 4TQUS 3U4VA 4L5RC 1JJ2A 3G6EA 2WFWA 4GN5A 4DR1L 1HJPA 2JA5H 3HOZG 1SN8A 4POGA 1HNWL 1YITA 5IYDH 1BBUA 1CKNA 5M5WH 2YYZA 3T1HL 2Z0SA 4A3KH 4A3CG 2UXBL 3OW2A 2HHHL 4JI6Q 3CPWA 4GN4B 1IYJB 3OYYA 5BR8Q 2E2HH 4A3DG 3JAMc 3H15A 4A3BG 2JQOA 2PMZE 2R92H 2GVBA 3D0FA 3FKIG 2UUAL 4JBJA 3H0GG 2UXBQ 2VQFQ 1VQAA 5C3EH 1VQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AIM A;  4YCW A;  1HR0 L;  4LF7 L;  3CC7 A;  3S2H H;  3OTO L;  4LF6 Q;  1XPU A;  3PO3 H;  4DR4 Q;  3DM3 A;  4NPS A;  1LUZ A;  2R93 G;  3U4Z A;  1X3F A;  4DR1 Q;  1VQN A;  1EQR A;  1Q1E A;  2UU9 Q;  5IP7 H;  2YTY A;  1SRO A;  4UP8 A;  2VZA A;  1IXR A;  1L0W A;  2UXC Q;  1KQS A;  1XPR A;  3FKI H;  3RR5 A;  4L5S A;  4JI7 L;  2ZJP A;  1E1O A;  2ID0 A;  3KDF B;  1BKB A;  2AWO A;  1B70 B;  5GQO A;  2F4V Q;  4WJ3 M;  4JOI C;  2CKZ B;  2I5H A;  3E9H A;  4JI2 Q;  5BR8 L;  1KC8 C;  1VQJ A;  2HHH Q;  4JI6 L;  4JYA L;  3I2Z A;  3ER0 A;  1N36 L;  4X62 Q;  1G51 A;  3GTP H;  4A3E H;  1O7I A;  3ZJY C;  4DK3 C;  1XJV A;  4DV5 Q;  1QUQ B;  4IFD I;  2R7Z H;  4YWK A;  3KJP A;  4DV2 L;  5DLQ E;  2UU9 L;  4P73 A;  4IPD A;  3RLF A;  2WAQ G;  5HY6 A;  3H3V H;  4JCV E;  4DV1 Q;  4KLK A;  1EQQ A;  3G71 A;  4IPG A;  2F4V L;  4Y7N H;  4DR5 L;  3S24 A;  4DV4 L;  3RZD H;  4UY8 C;  4GOP B;  4B3M L;  1IZ6 A;  3KF8 B;  1WYD A;  1HZA A;  3KYH C;  1LYL A;  2VQE Q;  1Q8K A;  2N49 A;  1VQ6 A;  2H5X A;  1YJN A;  3PUY A;  1JB7 A;  4BA2 I;  4B3R Q;  1KRT A;  3A74 A;  2RHQ B;  2JJQ A;  1AE2 A;  1SR3 A;  4A4I A;  4X64 L;  1QZH A;  1PA6 A;  1PH3 A;  3M7N A;  4BBS H;  3K7A H;  1PH1 A;  1XNR L;  4JV5 L;  3G48 A;  3KDF A;  4L5Q A;  1V9P A;  2JA7 H;  1WFQ A;  3PF4 A;  1GO3 E;  5M5Y H;  2E2J H;  4YWL A;  1K0R A;  2IHF A;  4OXP A;  4DR4 L;  4JYA Q;  4B3R L;  4A93 H;  2OCE A;  3CCL A;  2KHI A;  1XMQ Q;  1IBL L;  4LWC A;  4A3I H;  1Y1W G;  4LNQ A;  2VUM G;  2HT1 A;  4BY7 H;  1QVC A;  3T1H Q;  3HKZ E;  1U5K A;  4YCU A;  1I50 H;  1IBM Q;  1OXX K;  1JJG A;  1VCI A;  1EWI A;  2PQA B;  2VY3 A;  2KEN A;  4GNX C;  3CCE A;  1A8V A;  2PNH A;  5C44 G;  3I4M G;  4AQY Q;  2UUB Q;  1YJ9 A;  3UE0 A;  1E1T A;  2YTX A;  2NN6 I;  4LFC Q;  1FJG L;  1SE8 A;  1XNR Q;  5K36 G;  1PFS A;  4HIK A;  1WJJ A;  3HOV G;  3CCR A;  1AH9 A;  2RHS B;  4AYB G;  4MZ9 A;  3PF5 A;  1VQP A;  4DR7 Q;  4LF7 Q;  2F3I A;  2NZH A;  3MXN B;  3S1R H;  3U58 A;  3M9B A;  1EFW A;  4A3F G;  1J6Q A;  1UE7 A;  3ULJ A;  4RG1 A;  3KJO A;  4EX5 A;  4IO9 A;  1VQM A;  5M5X H;  4A3D H;  4HIM A;  1OXT A;  2IX1 A;  1HZB A;  4X62 L;  4WJ4 A;  4A76 A;  3S1M H;  2BA0 A;  2HIV A;  5AJ3 L;  4JI1 Q;  1JJC B;  1FVI A;  4HIO A;  1VQL A;  2D0O A;  2JA7 G;  3K80 C;  3ICE A;  3HOY G;  4K0K L;  2ZTE A;  3CXC A;  4C3I H;  3W1G A;  3AYH B;  4R4T A;  5GAE C;  4LF8 L;  4GKK Q;  4A3G H;  1N9W A;  2E8G A;  1VQ9 A;  1K73 C;  1UWV A;  2OQ0 A;  4NB3 A;  2WAQ E;  1XMO Q;  4LUV A;  1YBY A;  1VQF A;  1VQE A;  1WCM H;  5E7N A;  1NMG A;  2Q2H A;  5C4X H;  3E0E A;  4DV6 L;  1FJG Q;  4JI1 L;  3WWV A;  5JJK A;  4LFA Q;  2K75 A;  5IP9 G;  2I5L X;  3K0X A;  3UDF A;  1SLJ A;  1P16 A;  4DR2 Q;  1PYB A;  4A3G G;  3STB C;  4JI2 L;  1E7Z A;  1PH2 A;  2I5M X;  4DR3 L;  2I0Q A;  4LUZ A;  5C4X G;  3I4N G;  4KHP Q;  2QA4 A;  4LFB Q;  3K7U C;  4DPG A;  4BY7 G;  3EIV A;  3HKS A;  1PH8 A;  2UUA Q;  3GTL H;  2VL6 A;  1DGS A;  3H0G H;  2ZJQ A;  3RZO H;  1V43 A;  3BJU A;  1MIU A;  2BH2 A;  3HOY H;  3PIO A;  2XTI A;  1CKN B;  3GTO H;  2Q2I A;  2B63 G;  4A3F H;  1XPO A;  4JI5 Q;  2KCM A;  1T9H A;  4IFD J;  1QUQ A;  1KL9 A;  1W2B A;  1HNW Q;  4QY7 A;  2VW9 A;  3FHW A;  4LF6 L;  4IJH A;  5IYD G;  2LXK A;  5IT9 c;  2Q2T A;  4NXN L;  4GKK L;  1HNZ L;  3ERS X;  4LFB L;  3GD7 A;  3F1Z A;  3UE1 A;  1IBL Q;  2B63 H;  3NEN A;  1VQC A;  3CCQ A;  3RLN A;  3RN5 A;  1KIX A;  3GTQ H;  3I4M H;  3CCS A;  1GVP A;  1AE3 A;  1HZC A;  4HJ5 A;  2ZM6 L;  1C7Y A;  3PIP A;  1HNZ Q;  3HOW H;  2EXD A;  3T1Y Q;  1XNQ L;  4O0A A;  4X64 Q;  5JJL A;  5JEA J;  1B8A A;  3I55 A;  4L5T A;  3U50 C;  1CKO A;  3PGZ A;  1N33 Q;  2Y0S E;  2R7F A;  4J15 A;  1XTD A;  3PSI A;  4JV5 Q;  1L1O A;  2N78 A;  3I4O A;  4HJA A;  4AQY L;  2UUB L;  3S15 H;  3J7A 5;  2NVT H;  4X65 Q;  1VQ5 A;  4DR3 Q;  1K8G A;  2LXJ A;  3SGI A;  1YJW A;  5ELN A;  4O2D A;  2NN6 G;  4JI8 L;  2MNA A;  1YHQ A;  3A0J A;  1Q7Y C;  4K0K Q;  1LTL A;  1X65 A;  4QIW E;  4LF4 Q;  4IOC A;  2AMC B;  1E22 A;  3L0O A;  4NXM Q;  1M90 C;  3M4O H;  3CCM A;  1TWF H;  2GVA A;  3J81 j;  3UDG A;  3NEM A;  4P74 A;  1EYG A;  3BZK A;  3AFQ A;  4POF A;  3HOX H;  3J80 i;  1PH7 A;  1JMC A;  4R4O A;  3M85 A;  4DAY B;  1X6O A;  2V1C C;  2GN5 A;  3JAM i;  3L2P A;  5LMN Q;  4JBK A;  3T1Y L;  4QGU A;  1XNQ Q;  4HID A;  1LM0 A;  1N34 L;  2YV5 A;  4P75 A;  3Q8D A;  3GTK H;  4UP9 A;  4A3I G;  1Y1W H;  3PO2 G;  1Y1V H;  5JJI A;  4JI4 Q;  4GKJ Q;  1K9M C;  2PQA A;  3CP0 A;  2CFM A;  3S1N H;  1E24 A;  5IWA L;  4DV0 L;  1A0I A;  2VQE L;  1A62 A;  4C2M H;  1VS0 A;  1L1O C;  1VQ7 A;  4A3K G;  3ULP A;  1IBM L;  2UXC L;  1WOC A;  2AWN A;  4UPA A;  2NZO A;  2A8V A;  1I6H H;  2R7D A;  1I3Q H;  1YZ6 A;  5ELO A;  1NTG A;  1X55 A;  2CWP A;  5J3B A;  4B3T Q;  1UE6 A;  2MFI A;  4LUO A;  1L1O B;  4PZ7 A;  2R92 G;  1Y14 B;  4X6A H;  3HFZ B;  2R6G A;  3S17 H;  2ATW A;  4DAM A;  4B3T L;  3PUZ A;  5H1S E;  3F2C A;  4A3C H;  4DV3 Q;  5GRO A;  4DV2 Q;  2ASB A;  4ME3 A;  1B7Y B;  1MJC A;  1Q46 A;  1EIY B;  2XGT A;  2JA6 G;  1EIF A;  4DR6 Q;  3TRE A;  5C0X J;  5IYB G;  2JE6 I;  4UP7 A;  1NJI C;  2JA8 G;  4BXX H;  1I94 Q;  3HOW G;  2WB1 G;  5EAY A;  5GAD C;  5AJ3 Q;  1TXY A;  3PCO B;  4GLX A;  2D62 A;  4B3S L;  1I94 L;  1M1K C;  3I4N H;  1WCM G;  4JI0 Q;  4OON A;  4JI3 Q;  4X65 L;  3KF6 B;  4OWW B;  5LMN L;  4MTN A;  5LMU Q;  4OX9 Q;  1PYS B;  3CQZ H;  1J5E Q;  3HOX G;  4PMW A;  1YNX A;  2MO0 A;  4HJ7 A;  3PV0 A;  1WI5 A;  1XMO L;  4GNX B;  4HJ8 A;  3GTG H;  1OXV A;  5M3M H;  5LMU L;  1K3R A;  2JA9 A;  4YY3 L;  1PH5 A;  4P71 A;  3S2D H;  1Q82 C;  4RMF A;  1QVG A;  4LF4 L;  2OTJ A;  2E5L L;  2OTL A;  2VNU D;  4Y52 H;  3K81 C;  1X54 A;  4PZ6 A;  1KHI A;  4B3M Q;  4KI0 A;  1D7Q A;  1YVC A;  4YHH Q;  1VQ8 A;  1BBW A;  3S1Q H;  3J80 c;  3CME A;  5IYC H;  1EOV A;  1NMF A;  4JOI A;  2K52 A;  1S3O A;  1I5F A;  2WB1 E;  2MO1 A;  1P8L A;  1GKH A;  1S72 A;  1X56 A;  3D31 A;  1HR0 W;  2KCT A;  4BBS G;  3PUX A;  4APV A;  4LF5 Q;  3F8T A;  2CWA A;  2OQK A;  3AQQ A;  1GD7 A;  1E3P A;  4P72 A;  3RN2 A;  4DUZ L;  1Q81 C;  1CSQ A;  1N34 Q;  4QQB X;  3PO2 H;  3CW2 C;  4LFC L;  4C3J H;  4QL5 A;  4OX9 L;  3IRB A;  5IP7 G;  1SMX A;  3CCU A;  3AEV A;  4DUZ Q;  3TEH B;  2E2I H;  3UDX A;  3GTM H;  4H02 A;  1KAW A;  3F2D A;  3I56 A;  2VS1 A;  1VQG A;  1Q12 A;  4YWM A;  1XMQ L;  4ALP A;  1X9N A;  1GM5 A;  1HR0 Q;  4A75 A;  4KHP L;  1PH4 A;  1VQ4 A;  2ZJR A;  2ZTC A;  3NEL A;  2MQH A;  4BY1 H;  1K83 H;  1TWG H;  4JI8 Q;  2VQF L;  3TS2 A;  4DV4 Q;  4YHH L;  1SFO H;  2YU9 H;  2YTV A;  1C0A A;  2PI2 A;  4DR2 L;  1CKM A;  1JT8 A;  3DLL A;  4DV3 L;  4PZ8 A;  1ASY A;  3BU2 A;  2C35 B;  2CQO A;  1CUK A;  3K8A A;  4DV1 L;  4DV6 Q;  4GOP A;  3STB D;  1NE3 A;  1QZG A;  1IBK L;  3A5U A;  1H95 A;  5FLM G;  2JA5 G;  1Z47 A;  1RL2 A;  2JEB I;  4IFD G;  1G6P A;  4FDB A;  3HOV H;  5M3M G;  4IJL A;  4DV5 L;  4GLV B;  1J5E L;  1PVO A;  4BBR H;  4GOP C;  4AH6 A;  3NBH B;  1PH6 A;  2KBN A;  3EN2 A;  4OWX B;  2Z6K C;  3KFU A;  2HQL A;  3W1B A;  2IT1 A;  2QEX A;  1S40 A;  4JI0 L;  3E9I A;  4AYB E;  5C0X G;  3GTJ H;  1IL2 A;  4NXM L;  1G29 1;  1KRS A;  2NVX H;  2RF4 A;  2JK8 A;  2E5L Q;  4GKJ L;  5C3E G;  3CC4 A;  1R9T H;  4OO1 I;  2PI2 E;  4DV7 L;  3A5Z B;  4OWT B;  2JA8 H;  4HJ9 A;  3L7Z C;  3CC2 A;  1OTC A;  4LF9 Q;  4A93 G;  4A3L H;  1VQK A;  3BZC A;  5GAG C;  2A1A A;  4NXN Q;  4LF8 Q;  4JBM A;  1TWC H;  4DR6 L;  3CAM A;  4GS3 A;  1MJE A;  1HH2 P;  2EIF A;  3M4Q A;  3MEF A;  2UXD Q;  2AKW B;  1VQD A;  4QJF A;  1RIP A;  4IPH A;  4BY1 G;  1YEZ A;  4JI3 L;  1HNX L;  3HOZ H;  3KOJ A;  3UDI A;  4LW1 A;  4A3J H;  1U0L A;  3W5O A;  1C9O A;  3KLW A;  3M4P A;  1L2F A;  4R1J A;  2ALY B;  1TWH H;  3H3V I;  1PH9 A;  2B29 A;  1MKH A;  1HZ9 A;  3PUV A;  4JC0 A;  3GDE A;  2WP8 J;  2ZM6 Q;  4A3J G;  4A3M G;  1YI2 A;  1A63 A;  2CCZ A;  3HKZ G;  3J81 i;  4JI7 Q;  2D0P A;  4DKA C;  1OXU A;  4DK6 C;  5IWA Q;  4DV0 Q;  1FGU A;  1PHJ A;  3RLO A;  1W3S A;  3GO5 A;  4X66 Q;  1N33 L;  4LFA L;  4A3L G;  4JI5 L;  4JI4 L;  3HOU H;  4BBR G;  3CMA A;  4JG2 A;  5C44 H;  2DGY A;  3TS0 A;  1VQO A;  1QVF A;  1Y1V G;  4X66 L;  2AHO B;  4IPC A;  1UE5 A;  2F52 A;  1YHB A;  5FLX c;  2JEA I;  1NY4 A;  1X3G A;  1X3E A;  4R4I A;  2LSS A;  3J7Z C;  3OTO Q;  5FLM H;  3F2B A;  4DUY Q;  3FP9 A;  1N8R C;  1CSP A;  1PV4 A;  3TQY A;  2HIX A;  2K5V A;  4LF5 L;  2NVQ H;  1N32 L;  3CPF A;  5HGQ A;  3G4S A;  2R93 H;  1UEB A;  3KF6 A;  4A3M H;  3HOU G;  2N3S A;  2A19 A;  3ULL A;  4A3E G;  2ES2 A;  4BA1 I;  5IYB H;  4KHZ A;  2OWO A;  4GNX A;  2UUC Q;  2JA6 H;  1VQI A;  1VQB A;  4PG3 A;  3CF5 A;  2KHJ A;  2QGQ A;  2K5H A;  3I7F A;  5GAH C;  4DR5 Q;  3PUW A;  4OO1 G;  2FXQ A;  4DUY L;  2IX0 A;  2N8N A;  4JBW A;  1UE1 A;  2K14 A;  5JEA G;  5C0X I;  3RNU A;  4A3B H;  4DR7 L;  3CCV A;  2K4K A;  1SRU A;  5FJ8 H;  1K8A C;  1HNX Q;  3VDY A;  4GLA C;  2K50 A;  3TRZ A;  1JE5 A;  4TVA B;  5C4J H;  2DUD A;  1Q1B A;  1OXS C;  1TWA H;  4XIG S;  3B6Y A;  1BVS A;  4DV7 Q;  1Q86 C;  3M3Y H;  2B3G A;  2K5N A;  1FL0 A;  3LGJ A;  5M3F H;  4LF9 L;  1D8L A;  2BH8 A;  4DNI A;  3PO3 G;  2L15 A;  5IY0 A;  1KXL A;  3EBE A;  2BA1 A;  1N36 Q;  4C3H H;  2Q2U A;  4R4Q A;  2Z6K A;  3J81 c;  5IP9 H;  5M3F G;  4MNO A;  4R4C A;  2IHE A;  2RCN A;  4YCV A;  4B3S Q;  3S16 H;  4EQ5 A;  2NVY H;  1V1Q A;  2EQS A;  2VUM H;  2Y0S G;  1YIJ A;  5IYC G;  2UUC L;  2IY5 B;  2ZTD A;  1KD1 C;  4XTC S;  4YY3 Q;  3CCJ A;  5LMN W;  1ASZ A;  4IOA A;  3S14 H;  1IBK Q;  1Z9F A;  5FJ8 G;  3CD6 A;  2R7Z G;  4BXX G;  1YHA A;  2UXD L;  3AFP A;  4GN3 B;  1EUJ A;  1N32 Q;  1NBW A;  5IE8 A;  3JC6 6;  4TQU S;  3U4V A;  4L5R C;  1JJ2 A;  3G6E A;  2WFW A;  4GN5 A;  4DR1 L;  1HJP A;  2JA5 H;  3HOZ G;  1SN8 A;  4POG A;  1HNW L;  1YIT A;  5IYD H;  1BBU A;  1CKN A;  5M5W H;  2YYZ A;  3T1H L;  2Z0S A;  4A3K H;  4A3C G;  2UXB L;  3OW2 A;  2HHH L;  4JI6 Q;  3CPW A;  4GN4 B;  1IYJ B;  3OYY A;  5BR8 Q;  2E2H H;  4A3D G;  3JAM c;  3H15 A;  4A3B G;  2JQO A;  2PMZ E;  2R92 H;  2GVB A;  3D0F A;  3FKI G;  2UUA L;  4JBJ A;  3H0G G;  2UXB Q;  2VQF Q;  1VQA A;  5C3E H;  1VQH A; 
#chains in the Genus database with same CATH topology
 3DMU A;  3WOE A;  3TP5 A;  3CC7 A;  3S2H H;  3OTO L;  4OHJ A;  4DR4 Q;  5IOC A;  1BBX C;  1K0S A;  1EQR A;  2FMC A;  4F8M A;  3NWT A;  5IP7 H;  5KYI A;  1PFM A;  1UUP A;  1SFO B;  1KQS A;  3FKI H;  4L5S A;  1PTO F;  1CHP D;  4WJ3 M;  2AWO A;  2P5Z X;  3E9H A;  1KC8 C;  4JI6 L;  4JYA L;  2JA8 B;  5JAV A;  1G51 A;  4MTK A;  2EYJ A;  3GTP H;  5EPJ A;  4DK3 C;  1FR3 A;  4G57 A;  1QUQ B;  4YWK A;  3KJP A;  5DLQ E;  5C3W A;  2F3V A;  1CA5 A;  3OSO A;  5TSS A;  2WAQ G;  4WRD A;  3H3V H;  4JCV E;  4KLK A;  2RBM A;  4L8J A;  3HOV B;  3S24 A;  3A56 A;  4DV4 L;  3FMC A;  3KF8 B;  3ND8 A;  1VF7 A;  1Y1V B;  1WTQ A;  4RHR A;  1YJN A;  1WD1 A;  1B9N A;  1JB7 A;  1MHW C;  2RHQ B;  1RF2 D;  1IKL A;  1O7Z A;  4X64 L;  1PH3 A;  1XNR L;  4JV5 L;  3K5L A;  1GO3 E;  5M5Y H;  2F1M A;  2XRQ D;  5KGU A;  1HTL D;  4A3K B;  4JYA Q;  3V05 A;  3CCL A;  4JW0 A;  5KYL A;  2KHI A;  4LNQ A;  1GJX A;  3DWP A;  4ZUI A;  4A3I H;  2HCI A;  2NTS A;  1EZ8 A;  4K8I A;  1JJG A;  1OXX K;  2PQA B;  2K6A A;  3OW7 A;  4K8J A;  1V8Q A;  4JK1 C;  1E1T A;  4LFC Q;  1FJG L;  1QJO A;  3J7Y W;  1K3B C;  2RHS B;  5M3F B;  1T5X D;  3X3M A;  1JR0 D;  5KEE A;  2MGS A;  2JYO A;  1IW7 D;  4RG1 A;  2RCF A;  4CDD C;  1VQM A;  1F2L A;  1OXT A;  3DEO A;  3RMH A;  1Y8P B;  2HIV A;  5AJ3 L;  2JA7 G;  3K80 C;  3ICE A;  4Y7N B;  2NN6 H;  3IL8 A;  1SAP A;  3W1G A;  5GAE C;  2E8G A;  3DHQ A;  1VQ9 A;  2QEJ C;  3J7A V;  4NB3 A;  2E74 C;  3OIP A;  4NP5 A;  1YBY A;  1VQF A;  1NMG A;  4XYQ A;  4HCS A;  5IP9 G;  2I5L X;  1P16 A;  2WV6 D;  1TWA B;  3H91 A;  4DR2 Q;  1WTX A;  4XT3 B;  4QMG A;  1HA5 A;  1LTG D;  2F03 A;  1E7Z A;  3MHB A;  3P75 A;  2L11 A;  1PH2 A;  4LUZ A;  3I4N G;  4TRD A;  1PH8 A;  3RZO H;  2ZJQ A;  3K5O A;  3FPP A;  1V43 A;  1I4G A;  1MIU A;  1TS3 A;  3PIO A;  2WIN B;  3VA5 A;  2B63 G;  1XPO A;  2KCM A;  2O2L D;  1XWE A;  2RSN A;  4IJH A;  2LXK A;  5IT9 c;  4CGY B;  3ERS X;  1HNZ L;  5JVG 3;  3F1Z A;  2JA7 B;  2KA7 A;  3R8B A;  3NEN A;  1VQC A;  3GTQ H;  3CCS A;  1GVP A;  4HJ5 A;  2A6H D;  2C5C A;  1C7Y A;  3PIP A;  5C0X H;  5E1F A;  1HNZ Q;  1C8C A;  1KLU D;  3T1Y Q;  4X64 Q;  1D6E C;  3I70 A;  4KJN A;  4X3U A;  1BOS A;  1ZKO A;  2A6E C;  2N78 A;  3SGI A;  2L4N A;  3JAM L;  2MNA A;  3HOY G;  3MXG A;  5AFW A;  3A0J A;  1LTL A;  4LF4 Q;  4IOC A;  2AMC B;  2VB3 X;  1E22 A;  4DF7 A;  3L0O A;  2Z9H A;  4U68 A;  3C1E A;  2GVA A;  2OF1 A;  1TS4 A;  3J81 j;  5E4X A;  2EYM A;  3UDG A;  4HSV A;  2LMC B;  3J80 i;  1PH7 A;  1V1O A;  2V1C C;  3GV3 A;  2H4O A;  3JAM i;  4KTA A;  1XNQ Q;  3NHH A;  2YV5 A;  5IIF A;  1LT5 D;  1Y1V H;  1B3Q A;  3EFX D;  1JIC A;  1A0I A;  4KK7 A;  2HQE A;  3ULP A;  1IBM L;  4UPA A;  5M9O A;  1I3Q H;  2L0C A;  1X55 A;  1LAC A;  5J3B A;  4IUN A;  2MFI A;  2R92 G;  1L1O B;  2SDF A;  4PZ7 A;  3KBG A;  4X6A H;  3VR4 A;  3HFZ B;  3S17 H;  2ATW A;  3HOY B;  2IJ0 A;  3PUZ A;  3F2C A;  5GRO A;  3MZ5 A;  5IGE A;  1M4V A;  1EIY B;  2I46 A;  1EIF A;  2EPB A;  4K6D A;  4FXD A;  1NJI C;  2E2I B;  1XXG A;  3HOW G;  1PZI D;  1TXY A;  3NTI A;  4GLX A;  4ODG A;  2PW5 A;  4DN4 M;  1M1K C;  3I4N H;  1F2Z A;  2D5D A;  1DCZ A;  1SE4 A;  5FLX L;  1B50 A;  2KEC A;  4OX9 Q;  1G2T A;  2TSS A;  4HR7 B;  3HOX G;  1YNX A;  4GNX B;  2MP1 A;  2WAQ B;  1FNV A;  4V0B A;  2K5Q A;  4YY3 L;  4IUU A;  4TKO B;  5I9O A;  3ERQ A;  2D9U A;  2OTJ A;  3T56 B;  2BDO A;  3K81 C;  4PZ6 A;  1D7Q A;  1EQT A;  1BBW A;  3S1Q H;  2QIL A;  4JOI A;  2K52 A;  2EYP A;  5E3F A;  3SVM A;  1I5F A;  1P8L A;  1GKH A;  2IL8 A;  1X56 A;  4CKB A;  2KCT A;  3PUX A;  3F8T A;  5IT9 E;  1Z6H A;  4QQB X;  2PYK A;  4X3S A;  1CSQ A;  3PO2 H;  1SYG A;  5EGT A;  5CV5 A;  1X3P A;  2ZT9 C;  5J39 A;  5IP7 G;  1TY2 A;  1SMX A;  3CCU A;  1LT3 D;  2FFK B;  5CV7 A;  3TEH B;  3U9O A;  1F77 A;  3GTM H;  4H02 A;  4ZQ3 A;  4A93 B;  4G7O C;  1KDB A;  1VQG A;  1Q12 A;  2BE5 D;  2ZTC A;  3NEL A;  1EY6 A;  1TWG H;  2VQF L;  3CQZ B;  1GUW A;  4DV4 Q;  2YU9 H;  2YTV A;  4DR2 L;  3DLL A;  2FHT A;  2CQO A;  4DV1 L;  4GOP A;  3I4M B;  1IBK L;  5A35 A;  4FDB A;  1PVO A;  4BBR H;  1T5E A;  4BS9 A;  3NBH B;  1PH6 A;  3EN2 A;  1Z7T A;  2RDH A;  1EEI D;  2IT1 A;  2Q8T A;  1U4M A;  1S40 A;  4AYB E;  1IL2 A;  4NXM L;  2DY8 A;  1G29 1;  2E5L Q;  3GTJ B;  3BYY B;  1EWC A;  4C3J G;  3A5Z B;  2DN8 A;  2L55 A;  2M00 A;  1J8I A;  2JA8 H;  4HJ9 A;  3L7Z C;  3KUP A;  2F0H A;  1VQK A;  2G5D A;  1JC7 A;  1HH2 P;  3M4Q A;  2UXD Q;  4FXG C;  4CJ0 B;  4QJF A;  4BY1 G;  3M4O B;  3UDI A;  3J80 L;  3W5O A;  1C9O A;  1E2Z A;  3KLW A;  3M4P A;  3LX0 A;  4KHV A;  1PA6 A;  1HZ9 A;  1K8A C;  3GDE A;  1YI2 A;  2CCZ A;  1EZ6 A;  1OXU A;  4B9X A;  5IWA Q;  2E2J B;  1W3S A;  3GO5 A;  5C4X B;  4X66 Q;  1N33 L;  4RCO A;  3U9S A;  1EY4 A;  4JG2 A;  4F7X A;  4LJZ C;  2AQ3 B;  1VMC A;  1X3G A;  3J7Z C;  5FLM H;  3D6C A;  1N8R C;  2L9H A;  1BXT A;  1ICW A;  4CKC A;  1PV4 A;  4A3M H;  1LV9 A;  2N3S A;  1TT2 A;  4C3I G;  5IYB H;  4KHZ A;  4OIK A;  1AEX A;  1GHJ A;  1VQI A;  2FIN B;  3QB3 A;  1NR4 A;  4PG3 A;  3CF5 A;  1CTM A;  1NR2 A;  2FMM A;  2FXQ A;  4DUY L;  5E4W C;  4RKL A;  1UE1 A;  2K14 A;  1BCP D;  3HZX A;  1F9Q A;  1HNX Q;  4O1N A;  1XTC D;  3ERO A;  2DUD A;  4DV7 Q;  3B6Y A;  2K5N A;  5DM6 3;  5M3F H;  3C3L A;  4L63 B;  3GV6 A;  2L15 A;  5IY0 A;  2BA1 A;  1GUG A;  4U67 3;  1VF5 C;  5C6A A;  3Q22 A;  2RDF A;  3IFT A;  1H95 A;  2IY5 B;  5IYC G;  2UUC L;  1H9K A;  4M8A A;  3S14 H;  2N88 A;  1TWH B;  2EYL A;  5FJ8 G;  4DU9 A;  2J4X A;  3AFP A;  4GN3 B;  1EUJ A;  1N32 Q;  1ESR A;  1SEB D;  3JC6 6;  1PXU A;  5IOD A;  3G6E A;  1HJP A;  2JA5 H;  4POG A;  5M5W H;  4X3K A;  2HHH L;  1ILQ A;  3QWN A;  2G9H D;  3H15 A;  3FKI G;  3H0G G;  3A54 A;  1VQA A;  1PRT F;  4YCW A;  2LKV A;  2JP1 A;  2SNS A;  4JPB W;  2JA5 B;  2E76 C;  5M5W B;  1XPU A;  3DM3 A;  3K57 A;  4QF4 A;  1DD2 A;  3U4Z A;  1X3F A;  2JA6 B;  2JXM B;  2VXW A;  2PZW A;  4V19 0;  3UI2 A;  4GZY C;  2HDL A;  1NNX A;  2VZA A;  1XX8 A;  2K33 A;  2UXC Q;  3BVZ A;  1XPR A;  3RR5 A;  2AQ1 B;  1BKB A;  1HRJ A;  2F4V Q;  3NTH A;  3ER0 A;  3HOX B;  4X62 Q;  4HED A;  2RKS A;  2J0T D;  5KNC A;  1Y8N B;  1AN8 A;  1O7I A;  1XJV A;  4F87 A;  4DV5 Q;  2XN9 C;  5HUR A;  2TMP A;  2R7Z H;  1BUV T;  4M1U B;  1D2B A;  1UEA B;  2UU9 L;  3KLS X;  2B2U A;  3AB9 A;  3RUZ A;  3RLF A;  4XQJ A;  3X3N A;  1NAP A;  1I4X A;  1SDF A;  3Q24 A;  4Z9C B;  1PRT B;  3Q23 A;  4DR5 L;  5CBE E;  3RZD H;  4GOP B;  4AYB B;  4B3M L;  1IZ6 A;  1WYD A;  2F0M A;  4KY6 A;  1LYL A;  2EY5 A;  3KYH C;  2VQE Q;  2N49 A;  5D3I B;  2XNA C;  2NVX B;  4BA2 I;  4B3R Q;  1B9M A;  1RCV D;  1R9T B;  5I2X A;  2JJQ A;  1QZH A;  1EY0 A;  1HUN A;  3K7A H;  3VA7 A;  1PH1 A;  2JA7 H;  3PF4 A;  1E0B A;  3DEP A;  4YWL A;  1K0R A;  4P2C B;  3T51 B;  4OXP A;  2KED A;  4DR4 L;  1TQO A;  4B3R L;  1EYD A;  2Z1C A;  4IN3 A;  2A68 D;  1Y8O B;  3OWF A;  1IBL L;  1Y1W G;  4RH6 A;  4H7B A;  2VUM G;  1I4R A;  1EWI A;  1NUC A;  3I4M G;  5C44 G;  1O7L A;  4ZCK A;  3S2H B;  2YTX A;  2NN6 I;  3S9W A;  3HOV G;  3CCR A;  4ZKB B;  2NTT A;  4AYB G;  1SYE A;  4LF7 Q;  2F3I A;  4I7A A;  4DR7 Q;  2NZH A;  3BDO A;  3FEW X;  4KY7 A;  2WB1 B;  3VR2 A;  3I4L A;  1J6Q A;  1TVX A;  1UE7 A;  3ULJ A;  3CHB D;  3KJO A;  4EX5 A;  5M5X H;  2Z8L A;  3HGB A;  1HZB A;  4X62 L;  4ULL A;  4A76 A;  3PIP 3;  1PTO D;  4RHS A;  2BA0 A;  4LAA A;  4HSP A;  1WVL A;  3S14 B;  4K0K L;  3FPU B;  4WJW A;  3CXC A;  2WKD A;  4C3I H;  3AYH B;  4R4T A;  5ELF A;  4GKK Q;  1N9W A;  1K73 C;  1UWV A;  2OQ0 A;  1B44 D;  1VQE A;  2HD3 A;  2Q2H A;  5IGG A;  1FJG Q;  1LO5 D;  3AMU A;  2KOL A;  1K83 B;  4NKL A;  3E5S A;  4DR3 L;  4IZ8 A;  2SEB D;  5C4X G;  4KHP Q;  5A2Q E;  2B2T A;  4LFB Q;  4BY7 G;  1DGS A;  3H0G H;  5EKL A;  2F0F A;  3HOY H;  1B1Z A;  1J9O A;  5G3L D;  2XTI A;  1CKN B;  2Q2I A;  1FNW A;  4IFD J;  3FHW A;  2CW0 C;  2Q2T A;  1SE2 A;  1PTO B;  4BBS B;  3DXJ C;  4LFB L;  5M5Y B;  4HN7 A;  3URY A;  1R4P B;  1Q90 A;  1IBL Q;  1F2M A;  1EU3 A;  4R8I A;  2IPK D;  3HOU B;  1NSN S;  1MD2 D;  5L37 A;  1OO9 B;  3QOJ A;  3R3O A;  3I55 A;  1WTR A;  1N33 Q;  3PGZ A;  5CGK A;  4J15 A;  1A3V A;  3PSI A;  1MI2 A;  1YNN C;  3S15 H;  3J7A 5;  2NVT H;  1ONL A;  3D4D A;  4DR3 Q;  1TS2 A;  4JI8 L;  4ZRZ A;  1VDZ A;  3VR6 A;  2B39 A;  4C3H B;  2R7Z B;  1M90 C;  1ZYR D;  4P74 A;  3BZK A;  4BWG B;  3AFQ A;  4POF A;  1CA6 A;  1X6O A;  3GTM B;  3T1Y L;  3JAM E;  1DZ1 A;  3PO2 G;  5JJI A;  5LL6 X;  1SNC A;  2IW3 A;  2KVM A;  1CQF A;  2CFM A;  1I4H A;  2VQE L;  1B2T A;  4A3K G;  3FDT A;  1WOC A;  2A8V A;  1E2V A;  1HPC A;  1NTG A;  2J7Z A;  2CWP A;  4CJ2 C;  1AP0 A;  4LUO A;  1ET9 A;  2XRS D;  3MVV A;  1Y14 B;  2E75 C;  2EYF A;  2X6L A;  1WTO A;  2OT2 A;  1B53 A;  3H3V C;  2E2H B;  1GUO A;  4DAM A;  2EY6 A;  4B3T L;  2K03 A;  4DV3 Q;  4DV2 Q;  1FYC A;  1Q46 A;  2JA6 G;  4DR6 Q;  2K5D A;  1BQQ T;  1O7Y A;  2K1B A;  1D5Z C;  2D62 A;  1ML0 D;  1I94 L;  3SK6 A;  1HXY D;  4JI0 Q;  2KCC A;  3M7G A;  4X65 L;  3KF6 B;  4KD4 A;  4MTN A;  1XMO L;  2PQE A;  4HJ8 A;  1OXV A;  3MAQ A;  4RCN A;  5LMU L;  1I4Q A;  5EBC A;  1PH5 A;  1V1P B;  2ZXP A;  2BDN A;  4IUR A;  1DON A;  3BYT B;  2E5L L;  2OTL A;  4Y52 H;  3MXP A;  3DUZ A;  1KHI A;  4B3M Q;  4YHH Q;  3C1F A;  1I3Q B;  5IGB A;  3QR8 A;  4FF3 A;  4O42 A;  3J80 c;  1EOV A;  4OIJ A;  4KJO A;  1G8Z D;  1S5F D;  3KLR A;  3QOL A;  1S3O A;  1HR0 W;  1S72 A;  4KKU A;  1SJH D;  4C2M B;  2B2V C;  4LF5 Q;  3AQQ A;  4P72 A;  1Q81 C;  4LFC L;  2BOS A;  4J6H A;  4OX9 L;  3AEV A;  4RGT A;  1ET6 A;  2E2I H;  4NMZ A;  4QUF A;  2EOT A;  1KAW A;  3F2D A;  4YWM A;  1XMQ L;  4ALP A;  1PYW D;  1HR0 Q;  3P20 A;  4KHP L;  5IT9 L;  4BY1 H;  5C44 B;  1TU2 B;  1Y69 U;  3TS2 A;  1HQR D;  1SFO H;  1CKM A;  3D6W A;  4A3B B;  3E0J A;  1BCP B;  4DA2 A;  1ASY A;  1X32 A;  1CUK A;  1STE A;  3STB D;  3Q0A A;  1A2U A;  1QZG A;  1DM0 B;  2JA5 G;  1Z47 A;  2JEB I;  5CYU A;  4IAL A;  4DV5 L;  1RD9 D;  4GLV B;  4TSS A;  3NQI A;  4AH6 A;  1CK1 A;  2KBN A;  3EA6 A;  2Z6K C;  3S1M B;  2HQL A;  1QOH A;  4XT1 B;  3SEB A;  2B2Y C;  5C0X G;  3GTJ H;  1U4R A;  1ROD A;  1KRS A;  2KQ3 A;  2QCP X;  2CH4 A;  2A6E D;  5C3E G;  1JWM D;  2ZXO A;  4QCL A;  4OWT B;  2Z4H A;  4A93 G;  4A3L H;  2A1A A;  4JBM A;  1RJT A;  3CAM A;  1MJE A;  2XSC A;  4IFD H;  1VQD A;  4G7H C;  3GTG B;  3HOZ H;  3G7L A;  5C5M A;  5JPM C;  3KOJ A;  2A73 B;  4LW1 A;  1TWH H;  2MPM A;  5BN5 A;  3H3V I;  3TP6 A;  5C4H A;  1PH9 A;  4BY7 B;  2B29 A;  4A3M G;  4RGN A;  4A3G B;  3GQB A;  4DKA C;  3GTL B;  4DAY A;  5JPN C;  4HAE A;  5IGD A;  4YIJ A;  1IKM A;  4A3L G;  2O4X A;  1VQO A;  2DGY A;  3J80 E;  3TSS A;  3HP3 A;  1Y1V G;  2PZT A;  5FLX c;  1YHB A;  1L0X B;  2R92 B;  1NY4 A;  4R4I A;  1SNO A;  2EYH A;  2LSS A;  3OTO Q;  3F2B A;  3NBI A;  3FP9 A;  2A5H A;  2XIW A;  2HIX A;  4LF5 L;  5C3E B;  2JSO A;  3CPF A;  4C3J B;  2R93 H;  3MWY W;  3HOU G;  4UHV A;  4DK0 A;  4L6T B;  4BA1 I;  5EPL A;  5D3D A;  4GNX A;  2UUC Q;  2JA6 H;  2QGQ A;  5GAH C;  2K5H A;  3I8Z A;  3PUW A;  4A3D B;  1ENA A;  1PMR A;  2N8N A;  5JEA G;  5C0X I;  3DWA A;  3N6R A;  5FJ8 H;  3NSW A;  3CU7 A;  1X3Q A;  2K50 A;  3TRZ A;  5C4J H;  1Q86 C;  1Q1B A;  1OXS C;  4PMB A;  3M3Y H;  1FL0 A;  1D8L A;  1EIH A;  4R4Q A;  2Z6B A;  5M3F G;  3F2U A;  2R3Z A;  4MNO A;  2IHE A;  3S16 H;  1HA6 A;  1LTB D;  2K28 A;  2Y0S G;  1YIJ A;  3VR3 A;  1MSG A;  2ZTD A;  4XTC S;  1KD1 C;  5C4J B;  3CCJ A;  4IOA A;  1RKN A;  4MN3 A;  2EYO A;  1Z9F A;  4EQP A;  1ZEQ X;  1IBK Q;  2R7Z G;  4BXX G;  5KIX A;  3I73 A;  4L5R C;  4C3I B;  3HOZ G;  1SN8 A;  5I2Y A;  1CKN A;  4A3C G;  1EEF D;  2UXB L;  3OW2 A;  4GN4 B;  3OYY A;  3JAM c;  2PMZ E;  1KNA A;  3D0F A;  2UUA L;  4AIM A;  2B63 B;  4ZK9 B;  1TII D;  4LF6 Q;  1H9J A;  4CKE A;  3PO3 H;  5ISR A;  4NPS A;  1LUZ A;  2F0O A;  4B9W A;  4DR1 Q;  3I4N B;  1ILP A;  2WKC A;  1Q1E A;  2UU9 Q;  2YTY A;  1SRO A;  3MC0 B;  4JI7 L;  4FP5 D;  4ZUJ A;  2ZJP A;  5GQO A;  1YNN D;  1AW7 A;  4QIW B;  2CKZ B;  2I5H A;  5J22 A;  5BR8 L;  1VQJ A;  3O13 A;  3P1H A;  2HHH Q;  5IGF A;  3I2Z A;  1N36 L;  3NP8 A;  5FK9 C;  2A74 C;  2R61 A;  3ZJY C;  4IFD I;  3QJY A;  2XVS A;  1EYC A;  4P73 A;  4KN7 C;  3NBH A;  4N9P A;  1BCP F;  5ELC A;  3WDN A;  4A3J B;  3SK5 A;  1B4O A;  4IPD A;  5LL6 S;  2AUK A;  3S1N B;  4DXG A;  4DV1 Q;  2C9O A;  3RZD B;  1JWU D;  4CDC C;  4Y7N H;  1I6H B;  4HCE A;  1AZQ A;  4UY8 C;  1QIL A;  4BBR B;  2NZ1 D;  4KV6 A;  3M4Y A;  1LTT D;  1VQ6 A;  2H5X A;  3PUY A;  3I90 A;  1W6J A;  3RD4 A;  3A74 A;  2EVB A;  2EZV A;  1SR3 A;  3M7N A;  1QNK A;  1PTO H;  4RGM A;  2KHS A;  4BBS H;  4RA8 A;  3G48 A;  1V9P A;  3I3C A;  1F9P A;  3MXU A;  3BS1 A;  2E2J H;  1IHZ A;  2IHF A;  4A93 H;  1EOT A;  1DOK A;  3BDC A;  1XMQ Q;  2L5T A;  2NB0 A;  4LWC A;  2HT1 A;  2UXB Q;  1QVC A;  3T1H Q;  3HKZ E;  1U5K A;  1U4P A;  1I50 H;  4YCU A;  1IBM Q;  1VCI A;  1TWG B;  1S5E D;  1LTI D;  1V1P A;  2KEN A;  4GNX C;  3MFY A;  4FXK C;  1KDC A;  2PNH A;  3CCE A;  2YU9 B;  4AQY Q;  2NYZ D;  1YJ9 A;  2UUB Q;  2EJF C;  1XNR Q;  4IQZ A;  1FGB D;  3NE5 B;  4HIK A;  3M3Y B;  2F0Q A;  3PF5 A;  1FNU A;  4J8Q A;  3V96 A;  3MXN B;  3K5N A;  3S1R H;  3OMG A;  4CJ1 B;  1SYD A;  4A3D H;  4MHE A;  3TME A;  4WJ4 A;  3VR5 A;  4OO1 H;  1TY0 A;  4HIO A;  4JI1 Q;  1JJC B;  3IAY A;  1KTK A;  2ZTE A;  4IUP A;  2F0J A;  1XMO Q;  2NWG A;  5I6W A;  4FF4 A;  1WCM H;  2QDL A;  3MA2 B;  1Y1W B;  2F4I A;  3MTS A;  5C4X H;  4S3S A;  5FO8 B;  4JI1 L;  3WWV A;  4LFA Q;  4K6L A;  1SLJ A;  4A3G G;  2RA4 A;  2ICE C;  1LLR D;  1KLG D;  3STB C;  4K14 A;  2I5M X;  5EKK A;  2I0Q A;  3BVG A;  4DPG A;  4DGZ A;  3EIV A;  2F0W A;  2EJG C;  5FO9 B;  2UUA Q;  2VL6 A;  1QG7 A;  3BJU A;  3NQT A;  3LWU A;  3GTO H;  3OIQ A;  4A3F H;  1KL9 A;  3K0Y A;  1W2B A;  4OL7 A;  4QY7 A;  4LF6 L;  2E2D C;  5IYD G;  3HS0 C;  1GHK A;  3GD7 A;  1D5M C;  3UE1 A;  1A15 A;  5ELE A;  4FF1 A;  2B63 H;  5T1I A;  3RN5 A;  3BZD B;  3I4M H;  1S5C D;  2Q8R E;  4A3E B;  5FOB B;  1SNP A;  1IW7 C;  3S1R B;  2EXD A;  5K36 H;  2NVQ B;  5CMD A;  5JJL A;  1GUT A;  4FNF A;  1PFB A;  4L5T A;  5CR3 A;  3T13 A;  2I07 B;  3U50 C;  1CKO A;  2H1E A;  4Q0F A;  2R7F A;  3KLS A;  3QO2 A;  4ZYS A;  1XTD A;  2NVT B;  1L1O A;  2B2V A;  4AQY L;  2UUB L;  2QDB A;  4N9T A;  1VQ5 A;  2ZXR A;  3GTP B;  2RQX A;  2LXJ A;  3R2T A;  1YJW A;  5ELN A;  1YHQ A;  1QWY A;  2NN6 G;  1K8G A;  2NVY B;  2F0L A;  4NXM Q;  1GUS A;  2DJG C;  3MEH A;  3M4O H;  1TWF H;  1XYI A;  1GXD C;  3NEM A;  2K04 A;  2LFN A;  4FVM A;  3HOX H;  2Y0S B;  4R4O A;  3M85 A;  1HTP A;  1STB A;  4CDE C;  4DAY B;  1IYU A;  5LMN Q;  4JBK A;  2G9D A;  4QGU A;  1LM0 A;  1MGS A;  3Q8D A;  4UP9 A;  3GTK H;  4A3I G;  3A7A B;  1S5D D;  1EIG A;  1STN A;  2L1B A;  4I7Z C;  1DOM A;  1K9M C;  2PQA A;  1WTP A;  2PCF B;  4DV0 L;  1VS0 A;  1JWS D;  1PZK D;  2NZO A;  2R7D A;  1YNJ D;  5DNF A;  3EQL C;  1R4Q B;  1UE6 A;  4IUT A;  2EDG A;  2IX3 A;  3C46 A;  3D3R A;  4H13 C;  4A3C H;  3I91 A;  4ME3 A;  1B7Y B;  1HCZ A;  1MJC A;  3KBX A;  2F0T A;  5COY A;  3TRE A;  1I50 B;  5IYB G;  2JE6 I;  4N8X 1;  1PZJ D;  4UP7 A;  1JOR A;  4BXX H;  4KKS A;  5AJ3 Q;  3PCO B;  1WCM G;  4PNY A;  4WOR A;  1BNZ A;  4OON A;  5T1G A;  4MIU A;  4ZLT F;  5LMN L;  5LMU Q;  1PYS B;  1J5E Q;  4PMW A;  2MO0 A;  1WI5 A;  3GTG H;  5M3M H;  1K3R A;  2F0G A;  1H9S B;  4RMF A;  1QVG A;  4LF4 L;  4ABN A;  3K7A B;  1WTH A;  1SBB B;  1X54 A;  1LT6 D;  4KI0 A;  3SHL A;  1YVC A;  5IGC A;  1VQ8 A;  3HEJ A;  3CME A;  5IYC H;  3K6O A;  5M3M B;  1MSH A;  2WB1 E;  2MO1 A;  2CWA A;  3G6J B;  1I6V C;  4LK1 C;  1E3P A;  4DUZ L;  3MFG A;  3CW2 C;  5JJZ A;  2O5J C;  4C3J H;  4QL5 A;  3IRB A;  3L3O C;  4KKT A;  1VMP A;  2MJ8 A;  3UDX A;  1NCV A;  2PW7 A;  3DWQ A;  1VQ4 A;  1K83 H;  2F0K A;  4YHH L;  1JT8 A;  5EKI A;  2PI2 A;  5F2D A;  3ND9 A;  4DV3 L;  3FKI B;  4PZ8 A;  5CV8 A;  3BU2 A;  2C35 B;  3K8A A;  4DAV A;  3OWE B;  1NE3 A;  4X3T A;  3GTQ B;  3A5U A;  5FLM G;  4H44 C;  1CI3 M;  4IFD G;  1G6P A;  3HOV H;  3HRZ C;  3W3A A;  1B3A A;  4GOP C;  4OWX B;  1ZYR C;  4JI0 L;  4KMU C;  3E9I A;  2XWB B;  5DAU A;  1PRT C;  5M5X B;  1IYV A;  4OGQ C;  2M2L A;  4IUQ A;  2RF4 A;  3ITP A;  4GKJ L;  2PI2 E;  1SNQ A;  2OEO A;  3L9A X;  4LF9 Q;  3W2D A;  4KY5 A;  4OEM B;  3BZC A;  5GAG C;  2O5I C;  4DR6 L;  3OHX C;  3MEF A;  2GA4 B;  2N55 A;  2D2C C;  2AKW B;  1E2W A;  2CHB D;  4IPH A;  4JI3 L;  1YEZ A;  4ILW A;  4A3J H;  4R1J A;  3NPP A;  1AFP A;  1MKH A;  3EVQ A;  5EBD A;  4A3J G;  1ZXT A;  3HKZ G;  4RFB A;  3RZO B;  1SYF A;  3BG3 A;  2B2W C;  2AQ2 B;  4FYD A;  1PHJ A;  1A2T A;  3PMF A;  4K5W A;  1MBY A;  4LFA L;  4JI5 L;  4JI4 L;  1BR9 A;  3HOU H;  4BBR G;  3CMA A;  4EVO A;  3TS0 A;  3R93 A;  3SR1 A;  2AHO B;  3J7A F;  2F52 A;  1UE5 A;  2QW7 A;  5FLX E;  4JV5 Q;  1X3E A;  1K28 A;  2K5W A;  2K5V A;  2B2W A;  2KUM A;  5HGQ A;  3G4S A;  3KF6 A;  3T4A C;  5I6Y A;  2ES2 A;  4A3E G;  2OWO A;  1VQB A;  1JOO A;  4R8N A;  4XXE A;  4H0L C;  5D14 A;  2IX0 A;  4CHT B;  4A3B H;  3TP7 A;  3OOC A;  2K4K A;  3CCV A;  3A8I E;  2VUM B;  3VDY A;  4GLA C;  4TVA B;  3D4W A;  5LHY 1;  4Q5V A;  1TWA H;  3ONA B;  3LNN A;  3LGJ A;  1TKW B;  4DNI A;  1KXL A;  3EBE A;  3CKI B;  1N36 Q;  2Q2U A;  4KN4 C;  4K5X A;  5IP9 H;  3J81 c;  1TS5 A;  4YCV A;  3TN2 A;  1D1K A;  4EQ5 A;  2K32 A;  1V1Q A;  5CV4 A;  2VUM H;  4JVZ A;  3MXN A;  4UDU C;  3D8G A;  1YHA A;  5CBA E;  3ZYY X;  1LTA D;  1F9R A;  5DM7 3;  3U4V A;  4E6I A;  1H9R A;  4GN5 A;  4DR1 L;  5COR A;  1A3T A;  1HNW L;  1YIT A;  4A3K H;  2FJ2 A;  4PQX A;  3T16 A;  2PPB C;  4JI6 Q;  3V2T A;  2CQA A;  1IYJ B;  5BR8 Q;  2E2H H;  4A3D G;  5HGT A;  4JBJ A;  1EFI D;  1QCB D;  5ELD A;  1EY9 A;  2BH2 A;  2L12 A;  1VQH A;  4I65 A;  1TR5 A;  1CHQ D;  1HR0 L;  3GP7 A;  4LF7 L;  1QNU A;  3SDZ A;  2IWH A;  2R93 G;  4QB4 A;  1VQN A;  3NWS A;  4UP8 A;  1IXR A;  1L0W A;  3QG1 A;  3E3X A;  5A2Q L;  2F3W A;  1E1O A;  2ID0 A;  3KDF B;  1B70 B;  2F0E A;  4JOI C;  2K05 A;  4JI2 Q;  1EY7 A;  3S17 B;  2CH4 W;  1ENF A;  1AZP A;  2M9V A;  1M8A A;  4BY1 B;  4A3E H;  1WCM B;  1PLF A;  4DV2 L;  1SJE D;  2QF7 A;  4C56 C;  3KK7 A;  2QKI C;  1LTR D;  5HY6 A;  1EQQ A;  3QIA A;  4C3H G;  2OXP A;  3G71 A;  1EY8 A;  1KAB A;  4IPG A;  2F4V L;  4OEL B;  1JOQ A;  1D5X C;  1RHP A;  3K5M A;  5ELB A;  1HZA A;  2DNC A;  1LAB A;  1Q8K A;  3SXH A;  4HMI A;  1SMY D;  1CFM A;  5KNB A;  4A3F B;  1KRT A;  1QB5 D;  5DEH A;  3WOF A;  1AE2 A;  3H09 A;  4A4I A;  3A8K E;  4LMQ D;  3KDF A;  4L5Q A;  1WFQ A;  4IUV A;  3TBI B;  1WTV A;  4HTH A;  3CRK C;  3K58 A;  2HUG A;  1CM9 A;  2OCE A;  3GTO B;  1QE6 A;  1RDP D;  3BVM A;  2V4D A;  5EJW A;  3AU7 A;  1EL0 A;  4BY7 H;  4A3I B;  3BDL A;  1SND A;  2VY3 A;  1ENC A;  1A8V A;  4ZAI A;  1CQV A;  3UE0 A;  1KDA A;  3PIO 3;  3EJI A;  3I72 A;  3E6Z X;  5K36 G;  1SE8 A;  2EJM A;  3PO3 B;  1PFS A;  1WJJ A;  1AH9 A;  4MZ9 A;  1VQP A;  2DNE A;  4HMJ A;  3HOW B;  3U58 A;  3M9B A;  1EFW A;  4A3F G;  2B8F A;  3OPO A;  3T53 B;  1KAA A;  4IO9 A;  5C4Z A;  4HIM A;  2IX1 A;  2SOB A;  3S1M H;  1SNM A;  1CZG A;  5CV6 A;  1FVI A;  1VQL A;  2D0O A;  3D4R A;  1PFN A;  2XWJ B;  3VYS A;  1HUM A;  4LF8 L;  4A3G H;  1CT1 D;  2F0U A;  3VYR A;  2WAQ E;  3CRL C;  4LUV A;  3S1Q B;  1C48 A;  4NDX A;  2F0P A;  5E7N A;  4DV6 L;  3E0E A;  1LT4 D;  3A7L A;  4J1M A;  1U9R A;  5JJK A;  1JE4 A;  2K75 A;  2X69 A;  3UDF A;  3K0X A;  3HOZ B;  3FVQ A;  1PYB A;  2NUC A;  3HKZ B;  2ICI A;  4C1N K;  4JI2 L;  2B8G A;  3TDQ A;  2QA4 A;  2MUY A;  3K7U C;  3HKS A;  3NUC A;  1DJR D;  5JOB A;  3GTL H;  1O80 A;  4WFN 3;  5JEA H;  4JI5 Q;  2K01 A;  1ICF B;  2BE5 C;  1T9H A;  1QUQ A;  1HNW Q;  2VW9 A;  4G4K A;  2SNM A;  2EXZ A;  1EY5 A;  4NXN L;  4GKK L;  5CV9 A;  2B2U C;  4RGO S;  2BCO A;  4UAI A;  3CCQ A;  3RLN A;  1KIX A;  2PNR C;  1JQY D;  1AE3 A;  1S5B D;  1HZC A;  1BO0 A;  3H94 A;  1IL8 A;  2ZM6 L;  3K59 A;  4C1N I;  4EQO A;  5CC4 A;  3HOW H;  2CW0 D;  1XNQ L;  1UNS A;  4O0A A;  5JEA J;  1B8A A;  2F0N A;  1JCK B;  1JOK A;  5C5L A;  2Y0S E;  2RDG A;  3I4O A;  4HJA A;  3HG9 A;  4K2K A;  4X65 Q;  3Q6S A;  4F88 A;  1F2Y A;  4K0K Q;  4O2D A;  3IFD A;  1Q7Y C;  3J81 E;  1X65 A;  4QIW E;  4KD3 A;  4EQN A;  3CCM A;  2A69 C;  1BF4 A;  1GUN A;  4XQN A;  1EYG A;  4RKB A;  4FO2 A;  1JMC A;  1STA A;  1C4Q A;  2GN5 A;  3SK4 A;  5FKA C;  3L2P A;  1G6Z A;  1TWC B;  4HID A;  1WTW A;  1N34 L;  1YNJ C;  4P75 A;  4CBV A;  1Y1W H;  2VB2 X;  4NW2 A;  5J1Z A;  3SE0 A;  4JI4 Q;  4GKJ Q;  4EGV A;  1SMY C;  3CP0 A;  3S1N H;  5BN4 A;  1E24 A;  4PMC A;  5IWA L;  1VQ7 A;  2WAC A;  1A62 A;  4C2M H;  1L1O C;  2JN4 A;  2PMZ B;  2UXC L;  1I6H H;  1STG A;  2AWN A;  1H9M A;  1W6K A;  1YZ6 A;  5ELO A;  5FO7 B;  2R93 B;  4B3T Q;  4A3M B;  2K7V A;  2R6G A;  5H1S E;  2ASB A;  4XYO A;  1SSO A;  2XGT A;  3LWE A;  1BDO A;  5C0X J;  4K5V A;  5C3X A;  2JA8 G;  1I94 Q;  2WB1 G;  5EAY A;  5GAD C;  4B3S L;  4JI3 Q;  4OWW B;  3C2P A;  1PTO C;  3CQZ H;  4HJ7 A;  4QUC A;  2PZU A;  3PV0 A;  3S16 B;  1L0Y B;  2F0V A;  2JA9 A;  4P71 A;  3S2D H;  1Q82 C;  5JVH 3;  2EE1 A;  1PDQ A;  4ZKC B;  2VNU D;  2F0D A;  1A3U A;  2X6G A;  2HDM A;  1S4Z A;  1SE3 A;  1NMF A;  4DNT B;  3OMC A;  3TZU A;  2NBF A;  1DOL A;  1D1I A;  3D31 A;  4BBS G;  4APV A;  2LS0 1;  4DAP A;  2OQK A;  2A68 C;  1GD7 A;  1N34 Q;  2AUJ D;  3RN2 A;  1CZW A;  4PV1 C;  5K5P A;  4DUZ Q;  5KRU A;  3H0G B;  2KJX A;  3I56 A;  2VS1 A;  1X9N A;  1GM5 A;  4G7Z C;  4A75 A;  1PH4 A;  2ZJR A;  2MQH A;  3PQI A;  4JI8 Q;  4RWS C;  2PO4 A;  3TZD A;  1C0A A;  1SXT A;  2DY7 A;  5NUC A;  3VYT A;  4DV6 Q;  2F0S A;  1K8O A;  5I9P A;  1SYB A;  1O78 A;  1HFN A;  2DJF C;  1RL2 A;  1STY A;  5M3M G;  4IJL A;  3N52 A;  1J5E L;  4FF2 A;  3TP8 A;  5I4D A;  3KFU A;  3IKJ A;  3W1B A;  2QEX A;  2B2T C;  2KCN A;  1STH A;  5EQ0 A;  2NVX H;  1GOZ A;  2JK8 A;  2CVR A;  3CC4 A;  1R9T H;  4OO1 I;  4DV7 L;  1HQM C;  1LTS D;  4DFA A;  3CC2 A;  1Q8I A;  4ID6 A;  1ESF A;  1OTC A;  3FRP B;  4NXN Q;  1G91 A;  4LF8 Q;  1TWC H;  1A6X A;  5EPK A;  4GS3 A;  2EIF A;  1RIP A;  2A6H C;  1EYA A;  1HNX L;  1U0L A;  3A8J E;  1L2F A;  2ALY B;  4B08 A;  4JC0 A;  3PUV A;  2ZM6 Q;  3PO2 B;  2WP8 J;  1A63 A;  4JI7 Q;  3J81 i;  2D0P A;  1HFG A;  4DK6 C;  2EY1 A;  4DV0 Q;  1FGU A;  1HHV A;  3P7J A;  1FD7 D;  3RLO A;  4R9W A;  4K2L A;  4XQQ A;  4XDX A;  1WD0 A;  1TWF B;  3KF8 A;  5C44 H;  3NXW A;  1QVF A;  1SYC A;  4X66 L;  4IPC A;  1EWH A;  1EU4 A;  2JEA I;  2F0I A;  4DUY Q;  2EY2 A;  1CSP A;  2NVQ H;  3TQY A;  1N32 L;  2RSO A;  4DNR B;  1H9S A;  1UEB A;  1Q3L A;  2A19 A;  3ULL A;  2KEE A;  2RVL A;  2MHV A;  1EQV A;  4N8F A;  2KHJ A;  3I7F A;  4DR5 Q;  4OO1 G;  3J81 L;  3RNU A;  4JBW A;  2LY7 A;  2ENB A;  4DR7 L;  2A69 D;  1SRU A;  4DK1 A;  3S2D B;  3A55 A;  1JE5 A;  3DM1 A;  4XIG S;  1BVS A;  4ME5 A;  2B3G A;  3H6M A;  1RTN A;  4LF9 L;  2BH8 A;  2Z4I A;  3PO3 G;  2B2Y A;  4CDF C;  1KNE A;  4C3H H;  1UAP A;  1BCP C;  2Z6K A;  4B3S Q;  4R4C A;  2Q8I B;  2RCN A;  4DXF A;  2NVY H;  1U4L A;  2EQS A;  2HCC A;  1II3 A;  3R2I A;  3SK8 A;  1I4P A;  4YY3 Q;  5LMN W;  3VYU A;  1G2S A;  1ASZ A;  3CD6 A;  2WII B;  2UXD L;  1JB3 A;  4RAU C;  3S15 B;  1NBW A;  5IE8 A;  4TQU S;  1DXM A;  1JJ2 A;  2WFW A;  5G3L F;  1K8M A;  5IYD H;  1DYQ A;  5BN3 A;  1BBU A;  3NTK A;  2YYZ A;  3T1H L;  2Z0S A;  1F9S A;  1RTO A;  3GTK B;  3CPW A;  1PRT D;  3NK9 A;  4A3B G;  2JQO A;  2R92 H;  2GVB A;  5KND A;  2VQF Q;  5D65 A;  5C3E H; 
#chains in the Genus database with same CATH homology
 4AIM A;  4YCW A;  1HR0 L;  4LF7 L;  3CC7 A;  3S2H H;  3OTO L;  4LF6 Q;  1XPU A;  3PO3 H;  4DR4 Q;  3DM3 A;  4NPS A;  1LUZ A;  2R93 G;  3U4Z A;  1X3F A;  4DR1 Q;  1VQN A;  1EQR A;  1Q1E A;  2UU9 Q;  5IP7 H;  2YTY A;  1SRO A;  4UP8 A;  2VZA A;  1IXR A;  1L0W A;  2UXC Q;  1KQS A;  1XPR A;  3FKI H;  3RR5 A;  4L5S A;  4JI7 L;  2ZJP A;  1E1O A;  2ID0 A;  3KDF B;  1BKB A;  2AWO A;  1B70 B;  5GQO A;  2F4V Q;  4WJ3 M;  4JOI C;  2CKZ B;  2I5H A;  3E9H A;  4JI2 Q;  5BR8 L;  1KC8 C;  1VQJ A;  2HHH Q;  4JI6 L;  4JYA L;  3I2Z A;  3ER0 A;  1N36 L;  4X62 Q;  1G51 A;  3GTP H;  4A3E H;  1O7I A;  3ZJY C;  4DK3 C;  1XJV A;  4DV5 Q;  1QUQ B;  4IFD I;  2R7Z H;  4YWK A;  3KJP A;  4DV2 L;  5DLQ E;  2UU9 L;  4P73 A;  4IPD A;  3RLF A;  2WAQ G;  5HY6 A;  3H3V H;  4JCV E;  4DV1 Q;  4KLK A;  1EQQ A;  3G71 A;  4IPG A;  2F4V L;  4Y7N H;  4DR5 L;  3S24 A;  4DV4 L;  3RZD H;  4UY8 C;  4GOP B;  4B3M L;  1IZ6 A;  3KF8 B;  1WYD A;  1HZA A;  3KYH C;  1LYL A;  2VQE Q;  1Q8K A;  2N49 A;  1VQ6 A;  2H5X A;  1YJN A;  3PUY A;  1JB7 A;  4BA2 I;  4B3R Q;  1KRT A;  3A74 A;  2RHQ B;  2JJQ A;  1AE2 A;  1SR3 A;  4A4I A;  4X64 L;  1QZH A;  1PA6 A;  1PH3 A;  3M7N A;  4BBS H;  3K7A H;  1PH1 A;  1XNR L;  4JV5 L;  3G48 A;  3KDF A;  4L5Q A;  1V9P A;  2JA7 H;  1WFQ A;  3PF4 A;  1GO3 E;  5M5Y H;  2E2J H;  4YWL A;  1K0R A;  2IHF A;  4OXP A;  4DR4 L;  4JYA Q;  4B3R L;  4A93 H;  2OCE A;  3CCL A;  2KHI A;  1XMQ Q;  1IBL L;  4LWC A;  4A3I H;  1Y1W G;  4LNQ A;  2VUM G;  2HT1 A;  4BY7 H;  1QVC A;  3T1H Q;  3HKZ E;  1U5K A;  4YCU A;  1I50 H;  1IBM Q;  1OXX K;  1JJG A;  1VCI A;  1EWI A;  2PQA B;  2VY3 A;  2KEN A;  4GNX C;  3CCE A;  1A8V A;  2PNH A;  5C44 G;  3I4M G;  4AQY Q;  2UUB Q;  1YJ9 A;  3UE0 A;  1E1T A;  2YTX A;  2NN6 I;  4LFC Q;  1FJG L;  1SE8 A;  1XNR Q;  5K36 G;  1PFS A;  4HIK A;  1WJJ A;  3HOV G;  3CCR A;  1AH9 A;  2RHS B;  4AYB G;  4MZ9 A;  3PF5 A;  1VQP A;  4DR7 Q;  4LF7 Q;  2F3I A;  2NZH A;  3MXN B;  3S1R H;  3U58 A;  3M9B A;  1EFW A;  4A3F G;  1J6Q A;  1UE7 A;  3ULJ A;  4RG1 A;  3KJO A;  4EX5 A;  4IO9 A;  1VQM A;  5M5X H;  4A3D H;  4HIM A;  1OXT A;  2IX1 A;  1HZB A;  4X62 L;  4WJ4 A;  4A76 A;  3S1M H;  2BA0 A;  2HIV A;  5AJ3 L;  4JI1 Q;  1JJC B;  1FVI A;  4HIO A;  1VQL A;  2D0O A;  2JA7 G;  3K80 C;  3ICE A;  3HOY G;  4K0K L;  2ZTE A;  3CXC A;  4C3I H;  3W1G A;  3AYH B;  4R4T A;  5GAE C;  4LF8 L;  4GKK Q;  4A3G H;  1N9W A;  2E8G A;  1VQ9 A;  1K73 C;  1UWV A;  2OQ0 A;  4NB3 A;  2WAQ E;  1XMO Q;  4LUV A;  1YBY A;  1VQF A;  1VQE A;  1WCM H;  5E7N A;  1NMG A;  2Q2H A;  5C4X H;  3E0E A;  4DV6 L;  1FJG Q;  4JI1 L;  3WWV A;  5JJK A;  4LFA Q;  2K75 A;  5IP9 G;  2I5L X;  3K0X A;  3UDF A;  1SLJ A;  1P16 A;  4DR2 Q;  1PYB A;  4A3G G;  3STB C;  4JI2 L;  1E7Z A;  1PH2 A;  2I5M X;  4DR3 L;  2I0Q A;  4LUZ A;  5C4X G;  3I4N G;  4KHP Q;  2QA4 A;  4LFB Q;  3K7U C;  4DPG A;  4BY7 G;  3EIV A;  3HKS A;  1PH8 A;  2UUA Q;  3GTL H;  2VL6 A;  1DGS A;  3H0G H;  2ZJQ A;  3RZO H;  1V43 A;  3BJU A;  1MIU A;  2BH2 A;  3HOY H;  3PIO A;  2XTI A;  1CKN B;  3GTO H;  2Q2I A;  2B63 G;  4A3F H;  1XPO A;  4JI5 Q;  2KCM A;  1T9H A;  4IFD J;  1QUQ A;  1KL9 A;  1W2B A;  1HNW Q;  4QY7 A;  2VW9 A;  3FHW A;  4LF6 L;  4IJH A;  5IYD G;  2LXK A;  5IT9 c;  2Q2T A;  4NXN L;  4GKK L;  1HNZ L;  3ERS X;  4LFB L;  3GD7 A;  3F1Z A;  3UE1 A;  1IBL Q;  2B63 H;  3NEN A;  1VQC A;  3CCQ A;  3RLN A;  3RN5 A;  1KIX A;  3GTQ H;  3I4M H;  3CCS A;  1GVP A;  1AE3 A;  1HZC A;  4HJ5 A;  2ZM6 L;  1C7Y A;  3PIP A;  1HNZ Q;  3HOW H;  2EXD A;  3T1Y Q;  1XNQ L;  4O0A A;  4X64 Q;  5JJL A;  5JEA J;  1B8A A;  3I55 A;  4L5T A;  3U50 C;  1CKO A;  3PGZ A;  1N33 Q;  2Y0S E;  2R7F A;  4J15 A;  1XTD A;  3PSI A;  4JV5 Q;  1L1O A;  2N78 A;  3I4O A;  4HJA A;  4AQY L;  2UUB L;  3S15 H;  3J7A 5;  2NVT H;  4X65 Q;  1VQ5 A;  4DR3 Q;  1K8G A;  2LXJ A;  3SGI A;  1YJW A;  5ELN A;  4O2D A;  2NN6 G;  4JI8 L;  2MNA A;  1YHQ A;  3A0J A;  1Q7Y C;  4K0K Q;  1LTL A;  1X65 A;  4QIW E;  4LF4 Q;  4IOC A;  2AMC B;  1E22 A;  3L0O A;  4NXM Q;  1M90 C;  3M4O H;  3CCM A;  1TWF H;  2GVA A;  3J81 j;  3UDG A;  3NEM A;  4P74 A;  1EYG A;  3BZK A;  3AFQ A;  4POF A;  3HOX H;  3J80 i;  1PH7 A;  1JMC A;  4R4O A;  3M85 A;  4DAY B;  1X6O A;  2V1C C;  2GN5 A;  3JAM i;  3L2P A;  5LMN Q;  4JBK A;  3T1Y L;  4QGU A;  1XNQ Q;  4HID A;  1LM0 A;  1N34 L;  2YV5 A;  4P75 A;  3Q8D A;  3GTK H;  4UP9 A;  4A3I G;  1Y1W H;  3PO2 G;  1Y1V H;  5JJI A;  4JI4 Q;  4GKJ Q;  1K9M C;  2PQA A;  3CP0 A;  2CFM A;  3S1N H;  1E24 A;  5IWA L;  4DV0 L;  1A0I A;  2VQE L;  1A62 A;  4C2M H;  1VS0 A;  1L1O C;  1VQ7 A;  4A3K G;  3ULP A;  1IBM L;  2UXC L;  1WOC A;  2AWN A;  4UPA A;  2NZO A;  2A8V A;  1I6H H;  2R7D A;  1I3Q H;  1YZ6 A;  5ELO A;  1NTG A;  1X55 A;  2CWP A;  5J3B A;  4B3T Q;  1UE6 A;  2MFI A;  4LUO A;  1L1O B;  4PZ7 A;  2R92 G;  1Y14 B;  4X6A H;  3HFZ B;  2R6G A;  3S17 H;  2ATW A;  4DAM A;  4B3T L;  3PUZ A;  5H1S E;  3F2C A;  4A3C H;  4DV3 Q;  5GRO A;  4DV2 Q;  2ASB A;  4ME3 A;  1B7Y B;  1MJC A;  1Q46 A;  1EIY B;  2XGT A;  2JA6 G;  1EIF A;  4DR6 Q;  3TRE A;  5C0X J;  5IYB G;  2JE6 I;  4UP7 A;  1NJI C;  2JA8 G;  4BXX H;  1I94 Q;  3HOW G;  2WB1 G;  5EAY A;  5GAD C;  5AJ3 Q;  1TXY A;  3PCO B;  4GLX A;  2D62 A;  4B3S L;  1I94 L;  1M1K C;  3I4N H;  1WCM G;  4JI0 Q;  4OON A;  4JI3 Q;  4X65 L;  3KF6 B;  4OWW B;  5LMN L;  4MTN A;  5LMU Q;  4OX9 Q;  1PYS B;  3CQZ H;  1J5E Q;  3HOX G;  4PMW A;  1YNX A;  2MO0 A;  4HJ7 A;  3PV0 A;  1WI5 A;  1XMO L;  4GNX B;  4HJ8 A;  3GTG H;  1OXV A;  5M3M H;  5LMU L;  1K3R A;  2JA9 A;  4YY3 L;  1PH5 A;  4P71 A;  3S2D H;  1Q82 C;  4RMF A;  1QVG A;  4LF4 L;  2OTJ A;  2E5L L;  2OTL A;  2VNU D;  4Y52 H;  3K81 C;  1X54 A;  4PZ6 A;  1KHI A;  4B3M Q;  4KI0 A;  1D7Q A;  1YVC A;  4YHH Q;  1VQ8 A;  1BBW A;  3S1Q H;  3J80 c;  3CME A;  5IYC H;  1EOV A;  1NMF A;  4JOI A;  2K52 A;  1S3O A;  1I5F A;  2WB1 E;  2MO1 A;  1P8L A;  1GKH A;  1S72 A;  1X56 A;  3D31 A;  1HR0 W;  2KCT A;  4BBS G;  3PUX A;  4APV A;  4LF5 Q;  3F8T A;  2CWA A;  2OQK A;  3AQQ A;  1GD7 A;  1E3P A;  4P72 A;  3RN2 A;  4DUZ L;  1Q81 C;  1CSQ A;  1N34 Q;  4QQB X;  3PO2 H;  3CW2 C;  4LFC L;  4C3J H;  4QL5 A;  4OX9 L;  3IRB A;  5IP7 G;  1SMX A;  3CCU A;  3AEV A;  4DUZ Q;  3TEH B;  2E2I H;  3UDX A;  3GTM H;  4H02 A;  1KAW A;  3F2D A;  3I56 A;  2VS1 A;  1VQG A;  1Q12 A;  4YWM A;  1XMQ L;  4ALP A;  1X9N A;  1GM5 A;  1HR0 Q;  4A75 A;  4KHP L;  1PH4 A;  1VQ4 A;  2ZJR A;  2ZTC A;  3NEL A;  2MQH A;  4BY1 H;  1K83 H;  1TWG H;  4JI8 Q;  2VQF L;  3TS2 A;  4DV4 Q;  4YHH L;  1SFO H;  2YU9 H;  2YTV A;  1C0A A;  2PI2 A;  4DR2 L;  1CKM A;  1JT8 A;  3DLL A;  4DV3 L;  4PZ8 A;  1ASY A;  3BU2 A;  2C35 B;  2CQO A;  1CUK A;  3K8A A;  4DV1 L;  4DV6 Q;  4GOP A;  3STB D;  1NE3 A;  1QZG A;  1IBK L;  3A5U A;  1H95 A;  5FLM G;  2JA5 G;  1Z47 A;  1RL2 A;  2JEB I;  4IFD G;  1G6P A;  4FDB A;  3HOV H;  5M3M G;  4IJL A;  4DV5 L;  4GLV B;  1J5E L;  1PVO A;  4BBR H;  4GOP C;  4AH6 A;  3NBH B;  1PH6 A;  2KBN A;  3EN2 A;  4OWX B;  2Z6K C;  3KFU A;  2HQL A;  3W1B A;  2IT1 A;  2QEX A;  1S40 A;  4JI0 L;  3E9I A;  4AYB E;  5C0X G;  3GTJ H;  1IL2 A;  4NXM L;  1G29 1;  1KRS A;  2NVX H;  2RF4 A;  2JK8 A;  2E5L Q;  4GKJ L;  5C3E G;  3CC4 A;  1R9T H;  4OO1 I;  2PI2 E;  4DV7 L;  3A5Z B;  4OWT B;  2JA8 H;  4HJ9 A;  3L7Z C;  3CC2 A;  1OTC A;  4LF9 Q;  4A93 G;  4A3L H;  1VQK A;  3BZC A;  5GAG C;  2A1A A;  4NXN Q;  4LF8 Q;  4JBM A;  1TWC H;  4DR6 L;  3CAM A;  4GS3 A;  1MJE A;  1HH2 P;  2EIF A;  3M4Q A;  3MEF A;  2UXD Q;  2AKW B;  1VQD A;  4QJF A;  1RIP A;  4IPH A;  4BY1 G;  1YEZ A;  4JI3 L;  1HNX L;  3HOZ H;  3KOJ A;  3UDI A;  4LW1 A;  4A3J H;  1U0L A;  3W5O A;  1C9O A;  3KLW A;  3M4P A;  1L2F A;  4R1J A;  2ALY B;  1TWH H;  3H3V I;  1PH9 A;  2B29 A;  1MKH A;  1HZ9 A;  3PUV A;  4JC0 A;  3GDE A;  2WP8 J;  2ZM6 Q;  4A3J G;  4A3M G;  1YI2 A;  1A63 A;  2CCZ A;  3HKZ G;  3J81 i;  4JI7 Q;  2D0P A;  4DKA C;  1OXU A;  4DK6 C;  5IWA Q;  4DV0 Q;  1FGU A;  1PHJ A;  3RLO A;  1W3S A;  3GO5 A;  4X66 Q;  1N33 L;  4LFA L;  4A3L G;  4JI5 L;  4JI4 L;  3HOU H;  4BBR G;  3CMA A;  4JG2 A;  5C44 H;  2DGY A;  3TS0 A;  1VQO A;  1QVF A;  1Y1V G;  4X66 L;  2AHO B;  4IPC A;  1UE5 A;  2F52 A;  1YHB A;  5FLX c;  2JEA I;  1NY4 A;  1X3G A;  1X3E A;  4R4I A;  2LSS A;  3J7Z C;  3OTO Q;  5FLM H;  3F2B A;  4DUY Q;  3FP9 A;  1N8R C;  1CSP A;  1PV4 A;  3TQY A;  2HIX A;  2K5V A;  4LF5 L;  2NVQ H;  1N32 L;  3CPF A;  5HGQ A;  3G4S A;  2R93 H;  1UEB A;  3KF6 A;  4A3M H;  3HOU G;  2N3S A;  2A19 A;  3ULL A;  4A3E G;  2ES2 A;  4BA1 I;  5IYB H;  4KHZ A;  2OWO A;  4GNX A;  2UUC Q;  2JA6 H;  1VQI A;  1VQB A;  4PG3 A;  3CF5 A;  2KHJ A;  2QGQ A;  2K5H A;  3I7F A;  5GAH C;  4DR5 Q;  3PUW A;  4OO1 G;  2FXQ A;  4DUY L;  2IX0 A;  2N8N A;  4JBW A;  1UE1 A;  2K14 A;  5JEA G;  5C0X I;  3RNU A;  4A3B H;  4DR7 L;  3CCV A;  2K4K A;  1SRU A;  5FJ8 H;  1K8A C;  1HNX Q;  3VDY A;  4GLA C;  2K50 A;  3TRZ A;  1JE5 A;  4TVA B;  5C4J H;  2DUD A;  1Q1B A;  1OXS C;  1TWA H;  4XIG S;  3B6Y A;  1BVS A;  4DV7 Q;  1Q86 C;  3M3Y H;  2B3G A;  2K5N A;  1FL0 A;  3LGJ A;  5M3F H;  4LF9 L;  1D8L A;  2BH8 A;  4DNI A;  3PO3 G;  2L15 A;  5IY0 A;  1KXL A;  3EBE A;  2BA1 A;  1N36 Q;  4C3H H;  2Q2U A;  4R4Q A;  2Z6K A;  3J81 c;  5IP9 H;  5M3F G;  4MNO A;  4R4C A;  2IHE A;  2RCN A;  4YCV A;  4B3S Q;  3S16 H;  4EQ5 A;  2NVY H;  1V1Q A;  2EQS A;  2VUM H;  2Y0S G;  1YIJ A;  5IYC G;  2UUC L;  2IY5 B;  2ZTD A;  1KD1 C;  4XTC S;  4YY3 Q;  3CCJ A;  5LMN W;  1ASZ A;  4IOA A;  3S14 H;  1IBK Q;  1Z9F A;  5FJ8 G;  3CD6 A;  2R7Z G;  4BXX G;  1YHA A;  2UXD L;  3AFP A;  4GN3 B;  1EUJ A;  1N32 Q;  1NBW A;  5IE8 A;  3JC6 6;  4TQU S;  3U4V A;  4L5R C;  1JJ2 A;  3G6E A;  2WFW A;  4GN5 A;  4DR1 L;  1HJP A;  2JA5 H;  3HOZ G;  1SN8 A;  4POG A;  1HNW L;  1YIT A;  5IYD H;  1BBU A;  1CKN A;  5M5W H;  2YYZ A;  3T1H L;  2Z0S A;  4A3K H;  4A3C G;  2UXB L;  3OW2 A;  2HHH L;  4JI6 Q;  3CPW A;  4GN4 B;  1IYJ B;  3OYY A;  5BR8 Q;  2E2H H;  4A3D G;  3JAM c;  3H15 A;  4A3B G;  2JQO A;  2PMZ E;  2R92 H;  2GVB A;  3D0F A;  3FKI G;  2UUA L;  4JBJ A;  3H0G G;  2UXB Q;  2VQF Q;  1VQA A;  5C3E H;  1VQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...