4QGUA

Protein domain complex with ssdna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
191
structure length
191
Chain Sequence
VLQKRPVIVKVLSTTKPFEYETPEMEKKIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIPCEEGDKLQLFCFRLRKKNQMSKLISEMHSFIQIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Gamma-interferon-inducible protein 16
publication title New insights into the structural basis of DNA recognition by HINa and HINb domains of IFI16.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 40
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02760 HIN HIN-200/IF120x domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qguA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qguA01
4X6AH 3PSIA 1L2FA 4PZ6A 2GVBA 2HHHQ 4LF6Q 4GKKL 5M5XH 1T9HA 3FKIG 4GLVB 4A76A 1Q12A 2N78A 3JC66 5M5WH 3AYHB 2HT1A 1B70B 1N34L 2UU9L 3S1MH 1AH9A 3OTOL 4C3IH 1VS0A 4YCUA 4LF8L 1VQAA 2IHEA 4B3RL 1JJCB 2UXCQ 1K9MC 1X65A 5C3EG 2IT1A 2RCNA 3RLNA 1VQIA 5IP7G 3PUXA 4UP9A 2ASBA 1KIXA 4Y52H 1PH3A 1SRUA 2KCMA 4JI0L 3OW2A 2VY3A 4DR3Q 3H3VH 3M9BA 2D62A 4IOCA 4GOPA 4DR7L 1IBKL 1CUKA 3CCSA 2UUBQ 1OXUA 4APVA 2HIXA 4HIOA 2LXKA 1IBLQ 2C35B 2R7ZH 3I4NG 4H02A 1WCMH 3PV0A 3PO3H 4A3KG 1XNQQ 1FGUA 1UE6A 2JQOA 2PI2E 1N36Q 3PF5A 3PUVA 2E5LL 1L1OC 2B63H 1XJVA 4IPCA 3E0EA 3CC7A 1NE3A 5IYDG 2VQEQ 3NBHB 3S1RH 4RG1A 4XIGS 5M5YH 5M3FG 1VQ7A 3GTMH 4IJLA 3AFPA 4JI6L 2R92H 3L0OA 1SROA 4L5TA 3E9IA 2K50A 2YTVA 4GN4B 5IYCH 3BZKA 3G6EA 4GKKQ 1U0LA 3HOXG 2ALYB 3W1GA 1MJEA 1TWFH 1YHAA 1N34Q 2UU9Q 1E22A 3OTOQ 2JA7H 4QQBX 4JI1Q 4DR4L 4A3DG 3A74A 3A5ZB 2ZJQA 4B3RQ 4JV5L 1Y1WH 4TVAB 1QVFA 1IZ6A 4OO1I 3L2PA 4A3BH 1NBWA 1VQKA 1MKHA 1V43A 5IE8A 1KAWA 4DV7Q 1UWVA 1PH8A 4HJAA 2IY5B 2K14A 2EIFA 1EIFA 3G71A 2I5HA 4GOPB 1J6QA 4HJ7A 1TWAH 3S24A 4JI0Q 2JJQA 4JI7L 3J81j 3VDYA 4DR2L 1YIJA 2PQAA 4YY3Q 4P74A 1IBKQ 1OTCA 4HJ9A 4DR5Q 3PF4A 4BA2I 3FHWA 1E1TA 4LW1A 3PO2H 3S14H 3CPWA 1SE8A 2F52A 4C3HH 1I50H 3M4PA 5GADC 3U58A 4JBKA 3K80C 2HQLA 4PMWA 2I5LX 1K8GA 2E5LQ 1HNWL 3ULPA 3CMEA 1CKNA 1WI5A 3KJOA 1VQ8A 5H1SE 1AE3A 1YZ6A 5C44H 1VQ9A 4NXMQ 1MIUA 3TS2A 3ZJYC 3M3YH 5GQOA 4AYBE 2VQFL 2BA1A 3RNUA 4NXNQ 2IX1A 1BBWA 1CKOA 3TQYA 4IO9A 4JC0A 1I6HH 1WYDA 4B3TQ 5JJIA 4P71A 2CWPA 2R7ZG 4YHHL 1C9OA 1W3SA 1K3RA 1WCMG 1JE5A 4MTNA 3PO3G 1S72A 3KYHC 4LFCL 2AMCB 5FLXc 4DK6C 3HOWH 4DR4Q 5IP9H 1XMQQ 3J81i 3CPFA 1SLJA 3RLOA 2B63G 3CQZH 2JE6I 4GNXA 3E9HA 3CC4A 2WP8J 2K75A 3HKZE 3W1BA 4DV0Q 3PUWA 5IYBG 4HIMA 1YJ9A 1HNXQ 2E2IH 4LF7Q 1IYJB 2K5HA 1L1OB 1Q81C 4DKAC 1X55A 4JI5Q 5IYCG 4JI7Q 2R92G 1A63A 3J80c 4B3SL 3S17H 1U5KA 4JBWA 1EUJA 3U50C 3S2HH 1A62A 1KRSA 2ID0A 2JA7G 4EX5A 4JI8L 5LMUL 1D8LA 2VZAA 1CKNB 2PMZE 2VW9A 1XPUA 1Y1WG 1VQJA 1EFWA 4DV4L 4L5QA 4A3BG 4IFDI 1HNWQ 1C0AA 1KC8C 3LGJA 4HIDA 4GOPC 1YITA 1R9TH 1M90C 1VQNA 2N3SA 1DGSA 5GAHC 4WJ3M 2QGQA 4OWXB 3F1ZA 2JA8G 1PFSA 2Y0SE 1YJWA 1HR0W 2E2JH 2Q2IA 1VQHA 3NELA 2UUCL 2VL6A 4L5RC 4YCWA 1BBUA 4HJ5A 2JEAI 2NVXH 3PO2G 4R4IA 2QEXA 3AEVA 2RF4A 4PZ8A 3GDEA 1Q8KA 4UPAA 1VQBA 3K8AA 3PUZA 4LFCQ 1UEBA 1VQPA 1RIPA 2OTJA 3KJPA 4JYAL 2R7DA 3DM3A 5M3MH 4GNXB 4LFAL 2BH2A 4LF4L 5C44G 4DAMA 5GAGC 4L5SA 1YI2A 2NZHA 4LWCA 3AFQA 4QGUA 2F4VL 1GKHA 1OXXK 1VQMA 3J7A5 4LNQA 4A3MH 1IXRA 2JA5G 3S15H 5J3BA 4FDBA 2BH8A 3RZDH 1SN8A 4LUZA 4GN5A 4BBRH 2I5MX 1V1QA 3GTOH 3BZCA 3DLLA 3H0GH 3J7ZC 1PH2A 1FJGQ 4A4IA 3GTPH 2ZM6Q 4JI8Q 2K4KA 3HOWG 3UDFA 2VNUD 5IP9G 3HOZH 1QVGA 2UXDL 4DV4Q 4JI2Q 1HJPA 1EQRA 3CCLA 4AQYL 3ULLA 2GVAA 4A3JH 1HZAA 1Y1VG 4MZ9A 4DPGA 4LF5L 3F2DA 2NZOA 1VQ5A 1PV4A 4X65L 1G51A 4OWTB 1NTGA 5IWAL 3S16H 3CC2A 1JB7A 2DUDA 4A3EH 4LFBL 4DAYB 1M1KC 4BBSH 4IOAA 4TQUS 1OXVA 3RR5A 4P73A 3I55A 3UDIA 1IBML 2UUAL 4JYAQ 4LFAQ 3UE1A 4A3GG 3KDFA 4DR1L 1B8AA 1GM5A 2F3IA 3U4VA 4LF4Q 5C0XJ 4LF8Q 4XTCS 2KCTA 3MEFA 4YWLA 2F4VQ 4BY7H 4POGA 5C4XG 1JT8A 1I94L 4A3IH 4A3LH 2JK8A 3JAMc 3T1HL 3NEMA 3S1QH 4DUYL 4J15A 1E3PA 1N33L 1Q82C 2L15A 1XMOL 2OWOA 1YEZA 1Y14B 3UDGA 4DR7Q 4DV3L 1N9WA 2NVQH 4GNXC 1GO3E 5DLQE 3GO5A 5BR8L 3ERSX 1KQSA 1O7IA 2Z6KA 3RZOH 5GAEC 1QZGA 4X62L 1JJ2A 5M3MG 2E2HH 3I2ZA 2XTIA 5HY6A 1X56A 3BU2A 4AQYQ 2I0QA 5GROA 3CD6A 4JOIA 1TWGH 4AYBG 3TREA 2WB1E 4A3MG 3H3VI 3PIPA 2YV5A 4P72A 4ALPA 4ME3A 4LF5Q 1LM0A 1HZ9A 1RL2A 3AQQA 3K7UC 2H5XA 5AJ3L 2WAQE 3GD7A 4BBRG 5C0XG 2Q2UA 4JI6Q 4UP8A 3H0GG 1EQQA 2AWNA 1MJCA 3OYYA 3A0JA 1HR0L 2LSSA 2CFMA 3MXNB 4BXXH 1E7ZA 1LYLA 1YHBA 4LUOA 3CCUA 3HOZG 2UXBL 3G4SA 4LF9L 1A0IA 3CP0A 1X3EA 1J5EL 1ASZA 4R4QA 4JV5Q 4PZ7A 3CW2C 3HKZG 4A3JG 4X64L 1YBYA 1PYSB 1VQDA 3CMAA 1I94Q 3CCJA 1C7YA 1XTDA 4P75A 1Q46A 1VCIA 4UP7A 3UDXA 2PQAB 1XMOQ 2IX0A 4OX9L 5LMNW 4DR2Q 4DV3Q 3D31A 4A3EG 4BBSG 2A8VA 3A5UA 4AH6A 2VUMH 2QA4A 5IY0A 2AKWB 3EIVA 3K81C 2HHHL 4A3FH 1PH6A 4K0KL 1VQCA 1Q1EA 2D0OA 1K8AC 5FLMH 3PCOB 1SR3A 5K36G 1UE5A 2K5NA 3L7ZC 1QZHA 4BY7G 2KBNA 4HJ8A 1KRTA 4A3KH 5E7NA 4A3LG 1K0RA 2R7FA 1CSPA 2PI2A 2JA6H 2JEBI 2VQFQ 1S40A 1YNXA 2Y0SG 2K5VA 1QUQA 1WFQA 2NN6G 3ULJA 3J81c 4OXPA 4NB3A 1IL2A 1N32L 1HZBA 1HH2P 2HIVA 4O2DA 3CXCA 3FP9A 1Q1BA 1XNRL 4YHHQ 2E8GA 4R4TA 3S2DH 3I4OA 2IHFA 3H15A 5ELOA 2ZJPA 2DGYA 4RMFA 4DV6L 2XGTA 3RLFA 3GTGH 4A3DH 1UE1A 1BKBA 5C4JH 1VQ4A 1Q86C 5JJKA 3WWVA 5JEAG 2Z0SA 3PIOA 3STBC 1GVPA 4R4OA 4JBJA 1BVSA 3NENA 2VQEL 2ZTCA 4QY7A 2OQKA 2OQ0A 4R1JA 4X66L 4B3SQ 2OCEA 2VS1A 4IJHA 2MNAA 4JG2A 1L0WA 1X54A 4A93H 4K0KQ 5LMUQ 2EXDA 3KOJA 4NPSA 3CCRA 2OTLA 1KL9A 4A75A 1EIYB 4JBMA 1NMGA 3F2CA 4DUZL 1Q7YC 2RHQB 4DV2L 4JI1L 1NMFA 4QJFA 3HOYH 1PH4A 1QUQB 5EAYA 4B3ML 1EOVA 4DV1L 4DV7L 1V9PA 3K0XA 1EYGA 3TRZA 2YU9H 2Z6KC 1PHJA 1FL0A 4POFA 1SMXA 3D0FA 1N32Q 1LTLA 1P16A 1X9NA 1PH1A 4JI4L 2UUCQ 2VUMG 1JJGA 2PNHA 4DV5L 1KHIA 4KHZA 4JOIC 4YY3L 3T1YL 4A3FG 4BY1H 1XNRQ 1Z47A 2JA9A 3W5OA 3RN5A 4DR5L 3M4OH 2MQHA 5FLMG 1XPRA 5FJ8H 1TWCH 3JAMi 2B29A 4QL5A 4YCVA 4O0AA 1N8RC 2K52A 1K73C 3B6YA 5HGQA 4DV6Q 4IPDA 4GKJL 1UE7A 4YWKA 4C3JH 2JA6G 3Q8DA 4GS3A 5ELNA 1FVIA 2ES2A 1B7YB 2KHIA 4NXML 3G48A 3PGZA 3HOUH 1XPOA 4KLKA 2ZJRA 4NXNL 2LXJA 5IYBH 3CCQA 1K83H 3GTQH 4X66Q 2R6GA 1VQEA 5LMNL 1VQFA 2R93H 2YYZA 4B3TL 1PH5A 3I4MH 1NY4A 3KF6A 3RN2A 3GTKH 3KFUA 1H95A 2CCZA 3CCVA 2ATWA 2UXDQ 1KXLA 1I5FA 4R4CA 3BJUA 3EN2A 4DUZQ 1A8VA 4DV2Q 4A3CH 2WB1G 1X6OA 4WJ4A 1XMQL 3HKSA 2N49A 4GN3B 1YJNA 4B3MQ 5C0XI 4DV1Q 4DR6L 2GN5A 3ICEA 2WAQG 2ZTDA 1HNXL 4DV0L 4LF7L 2WFWA 4OO1G 4X65Q 1AE2A 5IT9c 4JI4Q 5IWAQ 4IPGA 3HFZB 2BA0A 4JI5L 4DV5Q 4HIKA 5JJLA 3T1YQ 4A93G 2JA8H 1W2BA 3HOVH 4DK3C 1E24A 1L1OA 4LFBQ 4JI3L 1S3OA 3M85A 4MNOA 2MO1A 3KDFB 1ASYA 1IBMQ 2UUAQ 3M7NA 1TWHH 3I7FA 2NVTH 4GKJQ 3KF8B 4DR1Q 1EWIA 3FKIH 3K7AH 3HOYG 3UE0A 1HNZL 4EQ5A 3M4QA 3CCEA 1JMCA 4OWWB 3J80i 4LUVA 2Q2TA 3T1HQ 1VQLA 3CF5A 2YTXA 2AWOA 2NVYH 2AHOB 4DUYQ 5C3EH 2RHSB 1N33Q 5IP7H 2JA5H 1CKMA 1WOCA 3IRBA 3KF6B 5LMNQ 2KENA 4BY1G 4C2MH 1YVCA 2CWAA 1PH9A 5FJ8G 5BR8Q 4KI0A 4KHPL 3F8TA 4LF6L 4X62Q 5JEAJ 2A19A 4IFDJ 1VQOA 4GLAC 1HZCA 2Q2HA 3I4NH 1LUZA 1QVCA 2NN6I 4DR6Q 4A3IG 2EQSA 2N8NA 3GTJH 1VQ6A 4QIWE 3HOUG 1CSQA 4JCVE 2UXCL 1PA6A 5AJ3Q 2MFIA 1YHQA 1VQGA 1Y1VH 4YWMA 2A1AA 4PG3A 4AIMA 1G291 3EBEA 2R93G 4IPHA 5IYDH 1P8LA 1X3FA 1GD7A 1TXYA 1HR0Q 3I4MG 2D0PA 1I3QH 5M3FH 4DR3L 4JI3Q 1E1OA 1PVOA 1WJJA 2UXBQ 2UUBL 1FJGL 1KD1C 2MO0A 4LF9Q 2ZM6L 1X3GA 1J5EQ 4A3CG 1IBLL 2V1CC 3HOXH 3SGIA 1HNZQ 1D7QA 4GLXA 1XNQL 4A3GH 4X64Q 1PYBA 3STBD 4JI2L 1SFOH 2ZTEA 4DNIA 1N36L 4BA1I 1NJIC 2CKZB 1OXTA 3GTLH 3CCMA 4Y7NH 2CQOA 4IFDG 3KLWA 2KHJA 3U4ZA 2YTYA 5C4XH 2B3GA 3TS0A 1G6PA 4OX9Q 3CAMA 4UY8C 3S1NH 1OXSC 3ER0A 3HOVG 1PH7A 4BXXG 1Z9FA 3PUYA 3F2BA 3I56A 2FXQA 4OONA 3TEHB 4KHPQ
chains in the Genus database with same CATH superfamily
4PZ6A 1JC7A 5M5XH 3BYYB 4GLVB 1MSHA 4DAYA 3AYHB 1B70B 1N34L 3ZYYX 1SSOA 2CQAA 1NCVA 2IHEA 1O7ZA 1E2WA 1JJCB 2UXCQ 1K9MC 5FLXL 2RCNA 1B2TA 3CKIB 1PH3A 4XQNA 1AZPA 1SRUA 4JI0L 3OW2A 4DR3Q 4IOCA 2D62A 5CV5A 4GOPA 3S2HB 4B9XA 2UUBQ 2VB2X 3CCSA 1OXUA 1SNMA 2QKIC 2Z1CA 2LXKA 1IBLQ 1E2VA 1SEBD 4H02A 1V8QA 2ZXPA 3NXWA 3PO3H 4A3KG 1FGUA 1YNND 1N36Q 3E0EA 3CC7A 1NE3A 1GUGA 5IYDG 2RVLA 3NBHB 4KD4A 4MIUA 3S1RH 4RG1A 5M5YH 3FPPA 5KEEA 1WTVA 1VQ7A 2E2JB 3AFPA 3D4WA 3M7GA 5BN4A 3E9IA 2YTVA 3BZKA 2UU9Q 1E22A 4QQBX 4B3RQ 4G57A 1QVFA 4TVAB 1IZ6A 4E6IA 1NBWA 3NWTA 4ZAIA 4AYBB 5IE8A 2K32A 4DV7Q 4KHVA 4GZYC 1G91A 2CVRA 2EIFA 3G71A 1CHQD 5JOBA 4HJ7A 1TWAH 1ZEQX 3P7JA 1Q90A 3J81j 2EY1A 5EJWA 4UAIA 2CH4W 4HJ9A 1D5MC 3NQTA 4R9WA 3GTPB 3FHWA 1E1TA 4LW1A 4MTKA 3CPWA 4C3HH 3M4PA 4FXGC 2HQLA 4PMWA 2E5LQ 3CMEA 1CKNA 1WI5A 3I4LA 3IKJA 5C44H 4KK7A 1SMYD 5GQOA 1TT2A 2BA1A 4NXNQ 2F0LA 2F0QA 2B2TA 4RKBA 4HTHA 1I6HH 2K5DA 4B3TQ 2DJFC 1ONLA 4A3EB 2QEJC 2B2YA 4HCEA 5JVH3 4KY7A 1K3RA 1JE5A 3PO3G 1D1KA 1S72A 2AMCB 3OPOA 5J39A 1NR2A 3CPFA 1SLJA 1TKWB 1CK1A 3E9HA 3HKZE 4DV0Q 3J7AF 2EJMA 1A63A 3J80c 3S2HH 1KRSA 2OEOA 3NPPA 2DN8A 2PMZE 2Z4IA 2Z4HA 2CW0C 1VQJA 4XYOA 1HNWQ 1V1PA 1TWGB 1RKNA 3WOEA 1A2TA 1YITA 3GQBA 1EQVA 4WJ3M 3V2TA 1PFSA 1VF5C 2E2JH 3NELA 3W3AA 4L5RC 3PQIA 4PZ8A 1Q8KA 1AEXA 1PFNA 3K8AA 4OL7A 5C44G 3LWUA 5GAGC 4CDFC 1X3PA 3J7A5 4RCOA 4LNQA 1MHWC 1D5ZC 5FOBB 5EKKA 5HGTA 2BH8A 5C0XH 3DLLA 1ILQA 2WKCA 2Z8LA 4A4IA 3GTPH 2ZM6Q 4A3FB 2K4KA 2VNUD 1PRTB 4CJ0B 4CHTB 1JB3A 1HJPA 1SNDA 5JVG3 3FMCA 4EQOA 2CHBD 3F2DA 4JPBW 1PV4A 4TKOB 4X65L 1G51A 3TMEA 1JOKA 1JB7A 3IAYA 2NVXB 4A3EH 4DAYB 1OXVA 1DOLA 3UDIA 5KGUA 5I2YA 3NTIA 4LF4Q 2F3IA 2IX3A 4MN3A 2KCTA 4A3DB 2F4VQ 1STBA 1G6ZA 1I94L 3T1HL 4IZ8A 3NEMA 4ODGA 4L6TB 4J15A 3H91A 4DNRB 3RZDB 1YEZA 1Y14B 1UNSA 4L8JA 4TSSA 1N9WA 1JJ2A 3R93A 3I2ZA 4NDXA 2IJ0A 5NUCA 5GROA 1TWGH 4AYBG 3PIPA 4ALPA 1LM0A 2YU9B 1RL2A 3AQQA 2H5XA 5C0XG 1HUMA 1LTGD 1EFID 4FYDA 3CRKC 1PRTC 2LSSA 2CFMA 4BXXH 3M4OB 3OOCA 4DN4M 4KN7C 1XWEA 2OXPA 3I8ZA 1S5FD 2F0MA 2HDLA 2NUCA 3CCJA 4P75A 1Q46A 5FO9B 1G2TA 5LMNW 4DV3Q 3D31A 4A3EG 1B1ZA 1ESFA 4RGOS 1RCVD 3OIQA 1ENAA 2QA4A 5IY0A 5C5MA 2HHHL 4A3FH 4K0KL 2KCNA 2A6ED 1QZHA 4H13C 1KDCA 3FRPB 3ND8A 3VR4A 1K0RA 5KNCA 2JEBI 3O13A 5E4XA 5AFWA 3J81c 1IL2A 1LTTD 3CXCA 5CORA 3FP9A 5EPJA 4UHVA 1TWHB 3I4OA 3H15A 4FNFA 5IGDA 5IGGA 4ULLA 1JORA 3IL8A 1YNJC 5L37A 4A3DH 2F3WA 1VQ4A 1Q86C 1Y69U 2SNMA 1STEA 3DUZA 5A2QE 1EY4A 1GVPA 1IW7D 2JA5B 1RTNA 2OCEA 1I4RA 4ZUIA 2EXDA 4WORA 3F2CA 4PV1C 4QJFA 4WJWA 5C6AA 1EOVA 4KTAA 3EVQA 3L3OC 4K5XA 1EYGA 2YU9H 1B9MA 1PHJA 4POFA 2LFNA 3A7AB 1LTLA 1O7YA 4ME5A 1JJGA 4R8IA 2PNHA 4A3FG 4K8IA 2F0KA 3RN5A 3M4OH 2MQHA 1JE4A 4QL5A 4YCVA 1N8RC 4GKJL 2EYLA 3OMGA 5HGQA 4DV6Q 4MHEA 4X3UA 5C5LA 1DD2A 1WTXA 1LACA 3Q8DA 5ELNA 2BOSA 4NXML 2KHIA 3G48A 3PGZA 1YNNC 5C4XB 2ZJRA 5IYBH 1XTCD 1EU4A 4DXGA 1FNUA 2N88A 1PH5A 3KFUA 3ND9A 3EA6A 3CCVA 2ATWA 4JVZA 3GV6A 4V0BA 5M5WB 2F0HA 1I5FA 2H4OA 4DUZQ 2EYOA 4K6LA 5JJZA 4A3CH 4C3IB 5J1ZA 1X6OA 4C1NK 2F0OA 3HKSA 1U4PA 4K2LA 4DR6L 1HNXL 2L11A 4X65Q 5CV7A 4CDCC 4UDUC 4OEMB 5T1GA 4DV5Q 2KCCA 3MHBA 4DK3C 3TDQA 2QDLA 4JI3L 3TN2A 4MNOA 1GUWA 2R7ZB 1TWHH 3I7FA 1KDBA 3KF8B 1TR5A 3M4QA 1S5CD 2B63B 1EWHA 3T1HQ 1PZJD 3NWSA 2AWOA 2AHOB 3MA2B 3GTMB 2JA5H 4CKEA 1SMYC 3IRBA 3KF6B 5LMNQ 1EY9A 2R92B 1SYBA 4J1MA 4OIJA 1DJRD 2NB0A 2AQ1B 2A19A 2JA7B 4IFDJ 2HDMA 1VQOA 1SNCA 4GLAC 1LUZA 3H09A 1QVCA 1PTOF 3I72A 2J7ZA 4JCVE 2UXCL 4EQNA 4IUVA 1YHQA 2K04A 1PMRA 1VQGA 3J7AV 1EY8A 4FXKC 2D0PA 4DR3L 1AZQA 1WJJA 2UUBL 1KD1C 1IYUA 2MO0A 4A3CG 1FD7D 2RDFA 1IBLL 2Z9HA 1D7QA 2ICIA 1EEFD 4ZK9B 4DNIA 1N36L 4BA1I 2CKZB 1KNAA 3KLWA 2KHJA 4XQQA 5C4XH 4I65A 5COYA 4C2MB 1PH7A 3PUYA 3NBHA 3F2BA 2FXQA 3PSIA 2HHHQ 2GVBA 3U9OA 4A76A 3JC66 5M5WH 3HOWB 1PRTF 2UU9L 4C3IH 1VS0A 3MEHA 2QW7A 3CQZB 4LF8L 4B3RL 3A7LA 3V05A 1X65A 4ZKCB 2IT1A 4K14A 2WIIB 4RWSC 3SXHA 3PUXA 4UP9A 2E76C 1PTOD 2A74C 1SE2A 1KIXA 4Y52H 1LV9A 2VY3A 4K2KA 1PLFA 2K1BA 1Z7TA 4HIOA 2C35B 2R7ZH 2L9HA 2EYJA 1MI2A 2JQOA 3C1EA 5C4ZA 1I4GA 1M8AA 2E5LL 4ID6A 2B63H 4IPCA 3Q0AA 3ERQA 3DEOA 3T56B 3C46A 1GUNA 4XIGS 2PYKA 3GTMH 5I4DA 2R92H 4G7ZC 3L0OA 4GKKQ 1ML0D 4G4KA 1U0LA 2ALYB 3W1GA 1MJEA 1YHAA 2BE5D 3OTOQ 2JA7H 5M3MB 5K36H 2ZJQA 4JV5L 2XWJB 3L2PA 5DNFA 1MKHA 2QCPX 1U4MA 3BZDB 1EYDA 3A8KE 1UWVA 4IN3A 2IY5B 2K14A 3Q6SA 1J6QA 3S24A 2NN6H 2JJQA 4BBRB 5ELDA 3N6RA 2EOTA 3H0GB 3FEWX 1OTCA 4BA2I 3PF4A 4NKLA 2L4NA 4IURA 4C3IG 3U58A 1EZ6A 3VR2A 3SE0A 1HNWL 3ULPA 4NXMQ 1ENFA 3HKZB 5H1SE 1YZ6A 1VQ9A 1SBBB 4KMUC 3SDZA 3NQIA 4BWGB 2OT2A 1WYDA 1AFPA 1K0SA 2F0DA 4P71A 1CQVA 5EGTA 2CWPA 2R7ZG 4YHHL 2PMZB 3HOWH 5IP9H 1GUTA 4KKSA 3RLOA 2B63G 3BVGA 3C1FA 3CQZH 3MVVA 5CBAE 1WTOA 3CC4A 2F4IA 1HNXQ 1JOQA 1YJ9A 4HIMA 3VR3A 1IYJB 5KYLA 1Q81C 4DKAC 1X55A 2R92G 1KAAA 1U5KA 4JBWA 3T4AC 1EUJA 1A62A 2RSNA 3RZOB 2JA7G 4KKTA 3JAME 4F87A 1XPUA 2L0CA 1QNKA 1C0AA 1KC8C 5EBDA 2A6EC 3G7LA 1VQNA 1B3QA 5DEHA 3BDCA 4OWXB 2JA8G 5FO7B 4HJ5A 2QEXA 4JK1C 3GDEA 1VQBA 2R61A 2OTJA 5M9OA 4HMJA 1SYDA 5CV6A 3DXJC 5M3MH 2BH2A 4LF4L 3E6ZX 4L5SA 1YI2A 1LT4D 2F0IA 2F0EA 3E5SA 4LWCA 4QGUA 2F4VL 5KYIA 2F03A 1EU3A 2PCFB 3S15H 3HZXA 5J3BA 4H44C 4LUZA 4BBRH 4H7BA 3D4DA 2PW5A 1V1QA 3H0GH 2Q8TA 1IW7C 3HOWG 4N9PA 5IP9G 1QE6A 2KUMA 3LNNA 1EQRA 1WVLA 3K59A 1PFBA 5ELEA 4OWTB 1NTGA 5IWAL 4RAUC 3CC2A 1J8IA 1GUSA 2WKDA 4ILWA 4I7AA 2PZUA 4P73A 3J81L 1HTPA 4JYAQ 1MGSA 4A3GG 1B8AA 4LF8Q 4XTCS 3GTGB 1HA5A 4RGMA 5C4JB 4YWLA 1QILA 1RJTA 3URYA 2OWOA 4DV3L 4FXDA 2K03A 4RCNA 3K5LA 1GO3E 2RA4A 3GO5A 4KV6A 5DLQE 5EKLA 3RZOH 5GAEC 1QZGA 5M3MG 4DA2A 1TS4A 2RQXA 1BR9A 1ICFB 1X56A 3BU2A 4AQYQ 2I0QA 5IGBA 2RDGA 4M1UB 3H3VI 3NBIA 4KY5A 4LF5Q 3DM1A 1HFNA 4RHRA 1TY2A 5AJ3L 2WAQE 2K7VA 4BBRG 5FKAC 3KLRA 1PYWD 1F2ZA 3H0GG 3E3XA 1L0XB 3TBIB 4V190 5D14A 5G3LD 1W6KA 1E7ZA 4FVMA 2K28A 3CCUA 1C48A 3G4SA 2HQEA 3CP0A 2K01A 4HR7B 4JV5Q 4PZ7A 4C3JB 3HKZG 1YBYA 4IUNA 1PYSB 3OWEB 1VQDA 3QG1A 3CMAA 1C7YA 2O5JC 4DGZA 1TS5A 1XMOQ 3DWAA 4CJ1B 3GTQB 4IUTA 2IX0A 4OX9L 2BDNA 3D8GA 3OMCA 3A5UA 2AKWB 3EIVA 1EEID 3C2PA 2D0OA 1SR3A 2K5NA 3L7ZC 1QJOA 1PTOB 4RFBA 1R4PB 5E7NA 1K28A 2MJ8A 1WFQA 4NB3A 2X69A 3TP5A 4O2DA 3MWYW 1UEAB 1Q1BA 5DAUA 4YHHQ 2E8GA 4C3HG 1SNOA 3VA5A 2IHFA 2A68D 3FKIB 3SK5A 5KIXA 4DV6L 5IT9E 2O5IC 2XGTA 3RLFA 2EYPA 3GTGH 1CI3M 1GHJA 5C4JH 1PZID 3WWVA 5IOCA 4XQJA 2K05A 2NVYB 1D5XC 2Z0SA 3GV3A 5C3EB 3HS0C 4JBJA 2JSOA 2VQEL 1HHVA 4R1JA 2OQ0A 1SJED 1X54A 2I46A 3KOJA 3DMUA 1KL9A 4A75A 4JBMA 4DUZL 1BDOA 2RHQB 1CT1D 4QCLA 1PH4A 3QWNA 3N52A 3A8JE 2A6HD 1V9PA 2F0UA 3TP8A 3TRZA 1Y1VB 2Z6KC 4QUFA 1BOSA 1SMXA 1N32Q 2DNCA 5M3FB 4DV5L 4J6HA 1KHIA 4KD3A 4KHZA 1XNRQ 5KNDA 1PTOC 4DU9A 5JPMC 3HOXB 1DZ1A 2K52A 1K73C 3B6YA 4IPDA 1JOOA 1UE7A 4DXFA 3MFYA 1FGBD 1WTRA 3KF8A 4C3JH 1STHA 5EPLA 3I91A 2BCOA 1B7YB 1A3VA 4Y7NB 1D1IA 4OGQC 2NYZD 1XPOA 3CCQA 1BUVT 2HD3A 2RCFA 3GTQH 2E2DC 4ABNA 2FFKB 2R6GA 5LMNL 4ZRZA 4IUUA 3KF6A 3RN2A 1CA6A 3BJUA 3S1MB 2QILA 4DV2Q 1DOKA 1PTOH 4WJ4A 3NP8A 4GN3B 2EVBA 4DV1Q 4HEDA 3VYTA 2BE5C 4CDEC 2ZTDA 4LF7L 2WFWA 3DHQA 4JI4Q 1STNA 5IWAQ 4K5WA 4JI5L 5JJLA 1LTSD 1W2BA 1STYA 1F9PA 1S3OA 3OWFA 5EBCA 1ASYA 1LT6D 1WCMB 2EE1A 2DY7A 3FKIH 4EQ5A 3CCEA 3J80i 3SK4A 1VDZA 2Q2TA 4K5VA 1VQLA 3CF5A 2JP1A 2NVYH 2YTXA 5C3EH 2RHSB 4IALA 5IP7H 4Q0FA 2KENA 1PH9A 1F2MA 2KEEA 5JEAJ 1JWSD 4C3JG 1HZCA 2NN6I 4FF2A 1HA6A 2N8NA 4QIWE 5AJ3Q 2M2LA 2J4XA 1Y1VH 4PG3A 1F2YA 1ZXTA 3PIO3 1BQQT 1GD7A 2O2LD 1VMPA 5LHY1 1JQYD 1EYAA 5M3FH 1PVOA 1FJGL 3WDNA 2SOBA 1TS3A 2V1CC 2KOLA 3HOXH 1E0BA 1HNZQ 2ZXRA 1F2LA 1B53A 1GHKA 3RUZA 3M3YB 5I6WA 3I73A 3CCMA 3H3VC 4Y7NH 3U4ZA 3MAQA 3SR1A 3TS0A 4OX9Q 2ZXOA 3CAMA 3MC0B 4QUCA 4UY8C 1OXSC 5C4HA 3ER0A 2J0TD 3Q22A 4BXXG 1Z9FA 2FINB 3I56A 1X32A 2WINB 4GKKL 2RKSA 3FKIG 1Q12A 2HT1A 3S1MH 2X6LA 3OTOL 2WACA 3NHHA 1O80A 1AW7A 1II3A 4XT1B 5C3EG 4QMGA 3RLNA 5IP7G 2TSSA 2LMCB 4LK1C 5FLXE 2IWHA 3H3VH 3Q23A 3P75A 3FDTA 3QR8A 4APVA 1CZGA 1WCMH 2KA7A 1XNQQ 1UE6A 5EPKA 3VYSA 2PPBC 3PUVA 1BCPF 1L1OC 1I4PA 1IYVA 5CV8A 2AQ2B 3MTSA 3M4YA 2VQEQ 1HFGA 2R3ZA 5M3FG 4HSVA 4JI6L 3G6EA 4L5TA 1LTID 2K50A 4GN4B 4KY6A 4F8MA 5C3WA 3HOXG 4DFAA 2JXMB 4LMQD 4A3DG 2A69D 1X3QA 4A3MB 4HJAA 3NSWA 3WOFA 1EIFA 1KABA 2D2CC 2F0VA 2I5HA 3PMFA 4RHSA 1DYQA 3MXPA 2MGSA 1YIJA 3GTOB 4P74A 1IBKQ 2F0FA 2EXZA 2XN9C 5J22A 2F52A 1EY6A 5BN5A 5GADC 1SYFA 3K80C 5FO8B 1JCKB 1QG7A 1TU2B 1L0YB 2DJGC 2M9VA 1B3AA 5DM73 3KJOA 1VQ8A 4A3JB 1AE3A 3TS2A 1MIUA 3ZJYC 3M3YH 4LJZC 4DAPA 3UI2A 3AB9A 1H9MA 1E2ZA 1V1OA 2IX1A 1WTWA 4JC0A 1BCPD 5JJIA 4BBSB 1C9OA 1WCMG 4MTNA 3AMUA 3KYHC 4DR4Q 4DK6C 2MPMA 3J81i 2XSCA 5IODA 4EGVA 4BY7B 3Q24A 3BVZA 2WP8J 2XRSD 4LF7Q 3PUWA 5IYBG 4OHJA 3S1QB 1BXTA 1T5EA 4JI5Q 4JI7Q 4CGYB 4HN7A 4B3SL 2NVQB 3U50C 1D8LA 2VZAA 2VW9A 4L5QA 2ICEC 4IFDI 2NTSA 3CRLC 3K58A 5ISRA 3LGJA 4HIDA 3D3RA 2MHVA 1M90C 2O4XA 2N3SA 3NTKA 5GAHC 2QGQA 3F1ZA 2Y0SE 1YJWA 2OF1A 1HR0W 2HCCA 1VQHA 2A73B 3H94A 3V96A 2VL6A 2UUCL 4YCWA 1BBUA 2JEAI 5ELBA 3A54A 3AEVA 2RF4A 4UPAA 4LFCQ 3QB3A 3KJPA 2B8FA 3TZUA 1FYCA 4JYAL 4GNXB 1GUOA 2F0SA 2NZHA 2A68C 1OXXK 4A3MH 1SYGA 5IIFA 2JA5G 1W6JA 1QWYA 4FDBA 1SN8A 2L5TA 2I5MX 3GTOH 3BZCA 2VUMB 3J7ZC 1FJGQ 4NP5A 4JI8Q 3UDFA 4DV4Q 3J80L 2FJ2A 4A3KB 3CCLA 4AQYL 3ULLA 1B50A 1XXGA 2JA6B 4A3JH 4MZ9A 3I3CA 1TVXA 3AU7A 4DPGA 4LF5L 2NZOA 2EYHA 1FNWA 2A6HC 2DY8A 5E3FA 2F0TA 1CFMA 2F0GA 4LFBL 4BBSH 3S2DB 5I6YA 3RR5A 1BF4A 1CTMA 2UUAL 1D6EC 1I6VC 1EZ8A 4LFAQ 3UE1A 4PMBA 1DONA 3U4VA 5C0XJ 1WD0A 3MEFA 4BY7H 3D6CA 5C4XG 4A3LH 4A3IH 2LS01 3JAMc 3S15B 2WAQB 1C8CA 3PIP3 3S1QH 4YIJA 1E3PA 2L15A 2XWBB 1XMOL 3UDGA 3X3MA 4Q5VA 1HTLD 2NVQH 1EIHA 3K5OA 4A93B 2XRQD 4GNXC 5BR8L 2N55A 3ERSX 1KQSA 1O7IA 2Z6KA 2RDHA 4X3SA 3BDLA 2XTIA 5KNBA 3CD6A 3HOYB 3TREA 2WB1E 4A3MG 1SXTA 4RKLA 1EWCA 4P72A 3K7UC 5JEAH 3GD7A 2L12A 5CMDA 1EYCA 4JI6Q 1EQQA 2AWNA 3MXNB 1YHBA 4LUOA 3ITPA 1TWCB 1Y8NB 1B4OA 4LF9L 1A0IA 1ASZA 1MSGA 1SAPA 4R4QA 4A3JG 4ZCKA 1XTDA 1BNZA 1S5DD 1VCIA 1ENCA 2X6GA 3KK7A 5HURA 4BBSG 2A8VA 1LT3D 2VUMH 3GTKB 3QOLA 4XT3B 2JYOA 5LL6S 5JPNC 3C3LA 1PH6A 1Q1EA 1IKMA 4DK0A 5K36G 1UE5A 2Q8RE 3T53B 4BY7G 2KBNA 4RGNA 1KRTA 4A3KH 2CH4A 5JAVA 5D3IB 4A3LG 2R7FA 3L9AX 1CSPA 2F0PA 2JA6H 2K5VA 2NN6G 4OXPA 3GP7A 4CDDC 1N32L 1XNRL 4R4TA 3S2DH 3OIPA 3K7AB 3TZDA 1DM0B 1BBXC 3RD4A 5A2QL 1BKBA 3VR5A 1WTQA 3BDOA 2PQEA 4HMIA 5JEAG 3PIOA 4R4OA 4CBVA 1JICA 2ZTCA 4QY7A 2OQKA 4B3SQ 3R2TA 4S3SA 1EQTA 4JG2A 1B44D 4A93H 2BDOA 3I70A 3I4NB 1Q7YC 4DV2L 4JI1L 3HOYH 1QUQB 3NK9A 5G3LF 4DV1L 1KDAA 3BYTB 1JR0D 2LY7A 1P16A 1PH1A 4JI4L 2UUCQ 2VUMG 3SVMA 3SK6A 3R3OA 4JOIC 4YY3L 4C56C 1G8ZD 1Z47A 2JA9A 4DR5L 1XPRA 4G7HC 1TWCH 4X3KA 2B29A 3JAMi 4O0AA 2SNSA 4YWKA 2PZTA 1BCPB 2JA6G 4KJNA 1AP0A 1PZKD 3VYRA 1O78A 3H6MA 2TMPA 4KLKA 3VA7A 4WRDA 2LXJA 4HSPA 2D9UA 4X66Q 1VQEA 4U68A 2IPKD 4DAVA 1NY4A 3GTKH 2A5HA 4R4CA 4FO2A 1HXYD 2NBFA 1XYIA 1A8VA 4O42A 1JWMD 2EYMA 1XMQL 4C1NI 2N49A 1YJNA 4B3MQ 4Z9CB 3A8IE 2GN5A 4NW2A 2WAQG 3K0YA 3BG3A 2KQ3A 3S9WA 3P1HA 3ONAB 2A69C 2FMCA 1FR3A 5IT9c 4IFDH 5LL6X 3D6WA 3HFZB 4HIKA 3T1YQ 4A93G 1Q8IA 1E24A 1L1OA 4LFBQ 1I4XA 2MO1A 2UUAQ 3M7NA 1IL8A 1HUNA 1PXUA 1LT5D 3K7AH 1Y8PB 3HOYG 2SDFA 3UE0A 1HNZL 1UUPA 4ZUJA 1JMCA 4QIWB 1A6XA 1JWUD 5TSSA 2FHTA 2KECA 1T5XD 3TP7A 1WOCA 1HCZA 1DOMA 3NTHA 3OHXC 1LTRD 5CBEE 5DM63 5BR8Q 1S4ZA 4KI0A 3KBXA 1TS2A 1TWFB 1BCPC 5CC4A 3K57A 2Q2HA 3I4NH 4BS9A 2KJXA 1Y1WB 4A3BB 1M4VA 1CSQA 1PA6A 2GA4B 2MFIA 3EFXD 2B2VC 4N8FA 2A1AA 4YWMA 4AIMA 1G291 4N8X1 3EBEA 5D3DA 1P8LA 3DEPA 1TXYA 1RD9D 3U9SA 1F9SA 4IUQA 3G6JB 4LF9Q 3S14B 3PO2B 1X3GA 4PQXA 1I50B 3HGBA 3SGIA 4O1NA 3MFGA 1XNQL 3STBD 4JI2L 4KKUA 1NJIC 5C3XA 1OXTA 1LABA 5EQ0A 4IFDG 4OIKA 3VR6A 4P2CB 2XIWA 3E0JA 2B2WA 4OELB 1RDPD 1RF2D 4OONA 3QO2A 3TEHB 4KHPQ 4X6AH 1L2FA 4LF6Q 2G5DA 5CV9A 1T9HA 2WV6D 5EKIA 2N78A 3NUCA 1AH9A 5F2DA 4YCUA 4DNTB 1VQAA 3EROA 1NAPA 2NWGA 2E2IB 1J9OA 5K5PA 1VQIA 1A2UA 2F0JA 1HQRD 2ASBA 1R4QB 2KCMA 3S17B 4XYQA 3M9BA 4DR7L 2F3VA 1IBKL 1CUKA 2HIXA 3A55A 3I4NG 3PV0A 1H9SA 3KLSA 1EY0A 2PI2E 2MP1A 1A15A 3PF5A 1R9TB 4B9WA 3J80E 1XJVA 4M8AA 3VYUA 1A3TA 4IJLA 1VF7A 4FF3A 3EJIA 4ZLTF 1SROA 2IL8A 1ZYRD 4K6DA 5IYCH 4FP5D 1TWFH 1N34Q 2HCIA 4JI1Q 4DR4L 3A74A 1TQOA 3A5ZB 3MXGA 1Y1WH 4OO1I 2PO4A 5ELFA 4A3BH 3CU7A 2B2UC 1VQKA 1V43A 2HUGA 1KAWA 1ESRA 1PH8A 3BS1A 5IGEA 4GOPB 4JI0Q 4JI7L 4KJOA 4DR2L 3VDYA 1DCZA 2PQAA 4YY3Q 4DR5Q 2G9DA 2QF7A 1QNUA 1G2SA 1KLGD 3PO2H 3S14H 1SE8A 3HOZB 5I9PA 1I50H 4JBKA 2EJGC 2KEDA 2I5LX 1K8GA 2D5DA 1CQFA 1CZWA 2SEBD 3SK8A 1NUCA 5CYUA 1K8MA 1ICWA 4AYBE 2VQFL 1ET6A 3RNUA 1BBWA 1SYCA 1CKOA 3TQYA 4IO9A 1OO9B 3S16B 1KNEA 3QIAA 4RH6A 1CA5A 4R8NA 3IFDA 1SNQA 3K5NA 1W3SA 4LFCL 5FLXc 1XMQQ 3KBGA 3SHLA 4CKBA 2JE6I 4GNXA 1GXDC 2K75A 4RGTA 3W1BA 2E2IH 2EY5A 5D65A 1QOHA 2K5HA 2Y0SB 1L1OB 4TRDA 3FPUB 5IYCG 3S17H 1K3BC 3JAML 4FF4A 1DXMA 2ID0A 4EX5A 4JI8L 5LMUL 2E2HB 1S5BD 1CKNB 1Y1WG 1EFWA 4DV4L 4A3BG 2F1MA 2C9OA 4GOPC 1R9TH 1DGSA 3HRZC 2IW3A 2Z6BA 3OW7A 2Q2IA 2F0NA 3K6OA 2NVXH 4R4IA 3PO2G 3PUZA 1UEBA 1VQPA 1RIPA 1ILPA 2ENBA 2P5ZX 2R7DA 3CHBD 3DM3A 4LFAL 4DAMA 5FK9C 1STAA 3AFQA 1GKHA 1VQMA 2LKVA 1RTOA 2B8GA 3T13A 1IXRA 2DNEA 2EY6A 1U9RA 4IUPA 4F88A 3T51B 3OSOA 3RZDH 4GN5A 3KLSX 1A3UA 1PH2A 1V1PB 1U4RA 3HOZH 3I90A 1QVGA 2UXDL 2G9HD 4JI2Q 4EQPA 3TP6A 1LTAD 2GVAA 2AUKA 4CKCA 1NNXA 1HZAA 1Y1VG 2V4DA 1VQ5A 5I2XA 3F2UA 1STGA 1CM9A 3S16H 2DUDA 5ELCA 1M1KC 4IOAA 4TQUS 5BN3A 3I55A 3MXNA 1O7LA 1SDFA 1IBML 3IFTA 1U4LA 4HCSA 2JN4A 3KDFA 4DR1L 1GM5A 2B2TC 2WB1B 3J81E 4POGA 2B2YC 2E74C 1JT8A 2JK8A 1ZKOA 4DUYL 1C4QA 1N33L 2C5CA 1KTKA 1Q82C 2EJFC 1MBYA 4WFN3 4DR7Q 4ZQ3A 4HAEA 1H9SB 1H9JA 2NZ1D 4X62L 2NTTA 2E2HH 5HY6A 1HPCA 4JOIA 2FMMA 3R2IA 2YV5A 2RBMA 4ME3A 1SE4A 1HZ9A 4LAAA 2VXWA 5IGFA 1WTPA 4CJ2C 2Q2UA 4UP8A 3J7YW 1MJCA 3OYYA 1Y8OB 3A0JA 1HR0L 1EIGA 4BY1B 5IGCA 1LYLA 3QOJA 3HOZG 1TY0A 2UXBL 2QDBA 2K33A 1X3EA 4L63B 1J5EL 2AUJD 2B2WC 1D2BA 1QCBD 2AQ3B 3CW2C 1EY7A 2MUYA 4EVOA 4X64L 3K5MA 1I94Q 4A3IB 3HOUB 1NSNS 4UP7A 4XDXA 3UDXA 2PQAB 1K83B 2M00A 4DR2Q 2XVSA 1SE3A 4QB4A 2R93B 3FVQA 4AH6A 1GOZA 3I4MB 2CW0D 1IKLA 3K81C 1VQCA 1K8AC 5FLMH 3PCOB 4HJ8A 1SJHD 2B39A 2PI2A 2VQFQ 1IHZA 1PDQA 1S40A 1YNXA 1WTHA 2Y0SG 1QUQA 3ULJA 5E4WC 2EYFA 3QJYA 5CV4A 1HZBA 1HH2P 2HIVA 2JA8B 4G7OC 3HOVB 4ZYSA 2H1EA 3W2DA 1F77A 2NVTB 5IT9L 5ELOA 2ZJPA 2DGYA 4RMFA 1HRJA 4PNYA 3X3NA 4QF4A 4B08A 1I4HA 1PFMA 1UE1A 5I9OA 4F7XA 5JJKA 1UAPA 5CGKA 3STBC 1BVSA 3NENA 4OO1H 4X66L 2VS1A 4IJHA 1TIID 2MNAA 4J8QA 2K5WA 3TSSA 1SNPA 1L0WA 1H9RA 2RSOA 4K0KQ 5LMUQ 4NPSA 1EY5A 2B2VA 3MZ5A 1H9KA 4H0LC 3CCRA 2OTLA 1EIYB 3DWQA 1NMGA 1NMFA 1RHPA 3GTJB 5EAYA 1MD2D 1SYEA 3R8BA 1F9QA 4B3ML 4DV7L 3K0XA 3LX0A 1FL0A 1HQMC 3D0FA 1X9NA 1I3QB 1KLUD 3T1YL 4BY1H 3W5OA 5FLMG 2L1BA 2E75C 1VMCA 5FJ8H 2KVMA 2I07B 4A3GB 1SFOB 4GS3A 2Q8IB 2ZT9C 2PW7A 1FVIA 2ES2A 3GTLB 3HOUH 3D4RA 4NXNL 3S1NB 1K83H 3DWPA 1AN8A 1VQFA 3HEJA 3T16A 2R93H 2YYZA 1S5ED 4B3TL 1WD1A 1XX8A 1I4QA 3I4MH 2EDGA 5M5XB 1H95A 1B9NA 2CCZA 5T1IA 1KXLA 5KRUA 2UXDQ 3EN2A 1ZYRC 4N9TA 2WB1G 4K8JA 5C0XI 3ICEA 3NE5B 1PRTD 4DV0L 4ZKBB 4OO1G 1AE2A 2L55A 1BO0A 1FNVA 4DK1A 3KUPA 5A35A 4IPGA 3BVMA 2BA0A 4U673 2JA8H 3HOVH 1LO5D 3M85A 2VB3X 3KDFB 1Z6HA 1IBMQ 2NVTH 4GKJQ 4DR1Q 3PO3B 1EWIA 2K6AA 4OWWB 2KHSA 3P20A 4LUVA 1EL0A 4DUYQ 1N33Q 3LWEA 3S1RB 5M5YB 1CKMA 2EZVA 3A56A 4BY1G 4C2MH 1ET9A 1YVCA 2B2UA 2CWAA 5FJ8G 4KHPL 1Q3LA 3F8TA 4LF6L 4X62Q 4NMZA 4JW0A 1RODA 2EY2A 1QB5D 1K8OA 2PNRC 4DR6Q 4KN4C 4A3IG 2EQSA 1VQ6A 3GTJH 3HOUG 3MXUA 2F0WA 4FF1A 1EOTA 4XXEA 2EPBA 1TWAB 4IQZA 3RMHA 2R93G 4IPHA 3EQLC 1F9RA 1X3FA 5IYDH 3I4MG 1HR0Q 1I3QH 1GJXA 1LTBD 1E1OA 4JI3Q 2PZWA 2UXBQ 1YNJD 2ZM6L 4C3HB 1J5EQ 4RA8A 3HP3A 3SEBA 4GLXA 4A3GH 4X64Q 1PYBA 2XNAC 1SFOH 2K5QA 5C44B 2ZTEA 4I7ZC 4X3TA 5CR3A 3GTLH 4PMCA 2CQOA 5E1FA 2YTYA 2B3GA 1G6PA 3S1NH 4DF7A 1I6HB 1NR4A 3HOVG 1LLRD 1CHPD 3HG9A
chains in the Genus database with same CATH topology
4X6AH 3PSIA 1L2FA 4PZ6A 2GVBA 2HHHQ 4LF6Q 4GKKL 5M5XH 1T9HA 3FKIG 4GLVB 4A76A 1Q12A 2N78A 3JC66 5M5WH 3AYHB 2HT1A 1B70B 1N34L 2UU9L 3S1MH 1AH9A 3OTOL 4C3IH 1VS0A 4YCUA 4LF8L 1VQAA 2IHEA 4B3RL 1JJCB 2UXCQ 1K9MC 1X65A 5C3EG 2IT1A 2RCNA 3RLNA 1VQIA 5IP7G 3PUXA 4UP9A 2ASBA 1KIXA 4Y52H 1PH3A 1SRUA 2KCMA 4JI0L 3OW2A 2VY3A 4DR3Q 3H3VH 3M9BA 2D62A 4IOCA 4GOPA 4DR7L 1IBKL 1CUKA 3CCSA 2UUBQ 1OXUA 4APVA 2HIXA 4HIOA 2LXKA 1IBLQ 2C35B 2R7ZH 3I4NG 4H02A 1WCMH 3PV0A 3PO3H 4A3KG 1XNQQ 1FGUA 1UE6A 2JQOA 2PI2E 1N36Q 3PF5A 3PUVA 2E5LL 1L1OC 2B63H 1XJVA 4IPCA 3E0EA 3CC7A 1NE3A 5IYDG 2VQEQ 3NBHB 3S1RH 4RG1A 4XIGS 5M5YH 5M3FG 1VQ7A 3GTMH 4IJLA 3AFPA 4JI6L 2R92H 3L0OA 1SROA 4L5TA 3E9IA 2K50A 2YTVA 4GN4B 5IYCH 3BZKA 3G6EA 4GKKQ 1U0LA 3HOXG 2ALYB 3W1GA 1MJEA 1TWFH 1YHAA 1N34Q 2UU9Q 1E22A 3OTOQ 2JA7H 4QQBX 4JI1Q 4DR4L 4A3DG 3A74A 3A5ZB 2ZJQA 4B3RQ 4JV5L 1Y1WH 4TVAB 1QVFA 1IZ6A 4OO1I 3L2PA 4A3BH 1NBWA 1VQKA 1MKHA 1V43A 5IE8A 1KAWA 4DV7Q 1UWVA 1PH8A 4HJAA 2IY5B 2K14A 2EIFA 1EIFA 3G71A 2I5HA 4GOPB 1J6QA 4HJ7A 1TWAH 3S24A 4JI0Q 2JJQA 4JI7L 3J81j 3VDYA 4DR2L 1YIJA 2PQAA 4YY3Q 4P74A 1IBKQ 1OTCA 4HJ9A 4DR5Q 3PF4A 4BA2I 3FHWA 1E1TA 4LW1A 3PO2H 3S14H 3CPWA 1SE8A 2F52A 4C3HH 1I50H 3M4PA 5GADC 3U58A 4JBKA 3K80C 2HQLA 4PMWA 2I5LX 1K8GA 2E5LQ 1HNWL 3ULPA 3CMEA 1CKNA 1WI5A 3KJOA 1VQ8A 5H1SE 1AE3A 1YZ6A 5C44H 1VQ9A 4NXMQ 1MIUA 3TS2A 3ZJYC 3M3YH 5GQOA 4AYBE 2VQFL 2BA1A 3RNUA 4NXNQ 2IX1A 1BBWA 1CKOA 3TQYA 4IO9A 4JC0A 1I6HH 1WYDA 4B3TQ 5JJIA 4P71A 2CWPA 2R7ZG 4YHHL 1C9OA 1W3SA 1K3RA 1WCMG 1JE5A 4MTNA 3PO3G 1S72A 3KYHC 4LFCL 2AMCB 5FLXc 4DK6C 3HOWH 4DR4Q 5IP9H 1XMQQ 3J81i 3CPFA 1SLJA 3RLOA 2B63G 3CQZH 2JE6I 4GNXA 3E9HA 3CC4A 2WP8J 2K75A 3HKZE 3W1BA 4DV0Q 3PUWA 5IYBG 4HIMA 1YJ9A 1HNXQ 2E2IH 4LF7Q 1IYJB 2K5HA 1L1OB 1Q81C 4DKAC 1X55A 4JI5Q 5IYCG 4JI7Q 2R92G 1A63A 3J80c 4B3SL 3S17H 1U5KA 4JBWA 1EUJA 3U50C 3S2HH 1A62A 1KRSA 2ID0A 2JA7G 4EX5A 4JI8L 5LMUL 1D8LA 2VZAA 1CKNB 2PMZE 2VW9A 1XPUA 1Y1WG 1VQJA 1EFWA 4DV4L 4L5QA 4A3BG 4IFDI 1HNWQ 1C0AA 1KC8C 3LGJA 4HIDA 4GOPC 1YITA 1R9TH 1M90C 1VQNA 2N3SA 1DGSA 5GAHC 4WJ3M 2QGQA 4OWXB 3F1ZA 2JA8G 1PFSA 2Y0SE 1YJWA 1HR0W 2E2JH 2Q2IA 1VQHA 3NELA 2UUCL 2VL6A 4L5RC 4YCWA 1BBUA 4HJ5A 2JEAI 2NVXH 3PO2G 4R4IA 2QEXA 3AEVA 2RF4A 4PZ8A 3GDEA 1Q8KA 4UPAA 1VQBA 3K8AA 3PUZA 4LFCQ 1UEBA 1VQPA 1RIPA 2OTJA 3KJPA 4JYAL 2R7DA 3DM3A 5M3MH 4GNXB 4LFAL 2BH2A 4LF4L 5C44G 4DAMA 5GAGC 4L5SA 1YI2A 2NZHA 4LWCA 3AFQA 4QGUA 2F4VL 1GKHA 1OXXK 1VQMA 3J7A5 4LNQA 4A3MH 1IXRA 2JA5G 3S15H 5J3BA 4FDBA 2BH8A 3RZDH 1SN8A 4LUZA 4GN5A 4BBRH 2I5MX 1V1QA 3GTOH 3BZCA 3DLLA 3H0GH 3J7ZC 1PH2A 1FJGQ 4A4IA 3GTPH 2ZM6Q 4JI8Q 2K4KA 3HOWG 3UDFA 2VNUD 5IP9G 3HOZH 1QVGA 2UXDL 4DV4Q 4JI2Q 1HJPA 1EQRA 3CCLA 4AQYL 3ULLA 2GVAA 4A3JH 1HZAA 1Y1VG 4MZ9A 4DPGA 4LF5L 3F2DA 2NZOA 1VQ5A 1PV4A 4X65L 1G51A 4OWTB 1NTGA 5IWAL 3S16H 3CC2A 1JB7A 2DUDA 4A3EH 4LFBL 4DAYB 1M1KC 4BBSH 4IOAA 4TQUS 1OXVA 3RR5A 4P73A 3I55A 3UDIA 1IBML 2UUAL 4JYAQ 4LFAQ 3UE1A 4A3GG 3KDFA 4DR1L 1B8AA 1GM5A 2F3IA 3U4VA 4LF4Q 5C0XJ 4LF8Q 4XTCS 2KCTA 3MEFA 4YWLA 2F4VQ 4BY7H 4POGA 5C4XG 1JT8A 1I94L 4A3IH 4A3LH 2JK8A 3JAMc 3T1HL 3NEMA 3S1QH 4DUYL 4J15A 1E3PA 1N33L 1Q82C 2L15A 1XMOL 2OWOA 1YEZA 1Y14B 3UDGA 4DR7Q 4DV3L 1N9WA 2NVQH 4GNXC 1GO3E 5DLQE 3GO5A 5BR8L 3ERSX 1KQSA 1O7IA 2Z6KA 3RZOH 5GAEC 1QZGA 4X62L 1JJ2A 5M3MG 2E2HH 3I2ZA 2XTIA 5HY6A 1X56A 3BU2A 4AQYQ 2I0QA 5GROA 3CD6A 4JOIA 1TWGH 4AYBG 3TREA 2WB1E 4A3MG 3H3VI 3PIPA 2YV5A 4P72A 4ALPA 4ME3A 4LF5Q 1LM0A 1HZ9A 1RL2A 3AQQA 3K7UC 2H5XA 5AJ3L 2WAQE 3GD7A 4BBRG 5C0XG 2Q2UA 4JI6Q 4UP8A 3H0GG 1EQQA 2AWNA 1MJCA 3OYYA 3A0JA 1HR0L 2LSSA 2CFMA 3MXNB 4BXXH 1E7ZA 1LYLA 1YHBA 4LUOA 3CCUA 3HOZG 2UXBL 3G4SA 4LF9L 1A0IA 3CP0A 1X3EA 1J5EL 1ASZA 4R4QA 4JV5Q 4PZ7A 3CW2C 3HKZG 4A3JG 4X64L 1YBYA 1PYSB 1VQDA 3CMAA 1I94Q 3CCJA 1C7YA 1XTDA 4P75A 1Q46A 1VCIA 4UP7A 3UDXA 2PQAB 1XMOQ 2IX0A 4OX9L 5LMNW 4DR2Q 4DV3Q 3D31A 4A3EG 4BBSG 2A8VA 3A5UA 4AH6A 2VUMH 2QA4A 5IY0A 2AKWB 3EIVA 3K81C 2HHHL 4A3FH 1PH6A 4K0KL 1VQCA 1Q1EA 2D0OA 1K8AC 5FLMH 3PCOB 1SR3A 5K36G 1UE5A 2K5NA 3L7ZC 1QZHA 4BY7G 2KBNA 4HJ8A 1KRTA 4A3KH 5E7NA 4A3LG 1K0RA 2R7FA 1CSPA 2PI2A 2JA6H 2JEBI 2VQFQ 1S40A 1YNXA 2Y0SG 2K5VA 1QUQA 1WFQA 2NN6G 3ULJA 3J81c 4OXPA 4NB3A 1IL2A 1N32L 1HZBA 1HH2P 2HIVA 4O2DA 3CXCA 3FP9A 1Q1BA 1XNRL 4YHHQ 2E8GA 4R4TA 3S2DH 3I4OA 2IHFA 3H15A 5ELOA 2ZJPA 2DGYA 4RMFA 4DV6L 2XGTA 3RLFA 3GTGH 4A3DH 1UE1A 1BKBA 5C4JH 1VQ4A 1Q86C 5JJKA 3WWVA 5JEAG 2Z0SA 3PIOA 3STBC 1GVPA 4R4OA 4JBJA 1BVSA 3NENA 2VQEL 2ZTCA 4QY7A 2OQKA 2OQ0A 4R1JA 4X66L 4B3SQ 2OCEA 2VS1A 4IJHA 2MNAA 4JG2A 1L0WA 1X54A 4A93H 4K0KQ 5LMUQ 2EXDA 3KOJA 4NPSA 3CCRA 2OTLA 1KL9A 4A75A 1EIYB 4JBMA 1NMGA 3F2CA 4DUZL 1Q7YC 2RHQB 4DV2L 4JI1L 1NMFA 4QJFA 3HOYH 1PH4A 1QUQB 5EAYA 4B3ML 1EOVA 4DV1L 4DV7L 1V9PA 3K0XA 1EYGA 3TRZA 2YU9H 2Z6KC 1PHJA 1FL0A 4POFA 1SMXA 3D0FA 1N32Q 1LTLA 1P16A 1X9NA 1PH1A 4JI4L 2UUCQ 2VUMG 1JJGA 2PNHA 4DV5L 1KHIA 4KHZA 4JOIC 4YY3L 3T1YL 4A3FG 4BY1H 1XNRQ 1Z47A 2JA9A 3W5OA 3RN5A 4DR5L 3M4OH 2MQHA 5FLMG 1XPRA 5FJ8H 1TWCH 3JAMi 2B29A 4QL5A 4YCVA 4O0AA 1N8RC 2K52A 1K73C 3B6YA 5HGQA 4DV6Q 4IPDA 4GKJL 1UE7A 4YWKA 4C3JH 2JA6G 3Q8DA 4GS3A 5ELNA 1FVIA 2ES2A 1B7YB 2KHIA 4NXML 3G48A 3PGZA 3HOUH 1XPOA 4KLKA 2ZJRA 4NXNL 2LXJA 5IYBH 3CCQA 1K83H 3GTQH 4X66Q 2R6GA 1VQEA 5LMNL 1VQFA 2R93H 2YYZA 4B3TL 1PH5A 3I4MH 1NY4A 3KF6A 3RN2A 3GTKH 3KFUA 1H95A 2CCZA 3CCVA 2ATWA 2UXDQ 1KXLA 1I5FA 4R4CA 3BJUA 3EN2A 4DUZQ 1A8VA 4DV2Q 4A3CH 2WB1G 1X6OA 4WJ4A 1XMQL 3HKSA 2N49A 4GN3B 1YJNA 4B3MQ 5C0XI 4DV1Q 4DR6L 2GN5A 3ICEA 2WAQG 2ZTDA 1HNXL 4DV0L 4LF7L 2WFWA 4OO1G 4X65Q 1AE2A 5IT9c 4JI4Q 5IWAQ 4IPGA 3HFZB 2BA0A 4JI5L 4DV5Q 4HIKA 5JJLA 3T1YQ 4A93G 2JA8H 1W2BA 3HOVH 4DK3C 1E24A 1L1OA 4LFBQ 4JI3L 1S3OA 3M85A 4MNOA 2MO1A 3KDFB 1ASYA 1IBMQ 2UUAQ 3M7NA 1TWHH 3I7FA 2NVTH 4GKJQ 3KF8B 4DR1Q 1EWIA 3FKIH 3K7AH 3HOYG 3UE0A 1HNZL 4EQ5A 3M4QA 3CCEA 1JMCA 4OWWB 3J80i 4LUVA 2Q2TA 3T1HQ 1VQLA 3CF5A 2YTXA 2AWOA 2NVYH 2AHOB 4DUYQ 5C3EH 2RHSB 1N33Q 5IP7H 2JA5H 1CKMA 1WOCA 3IRBA 3KF6B 5LMNQ 2KENA 4BY1G 4C2MH 1YVCA 2CWAA 1PH9A 5FJ8G 5BR8Q 4KI0A 4KHPL 3F8TA 4LF6L 4X62Q 5JEAJ 2A19A 4IFDJ 1VQOA 4GLAC 1HZCA 2Q2HA 3I4NH 1LUZA 1QVCA 2NN6I 4DR6Q 4A3IG 2EQSA 2N8NA 3GTJH 1VQ6A 4QIWE 3HOUG 1CSQA 4JCVE 2UXCL 1PA6A 5AJ3Q 2MFIA 1YHQA 1VQGA 1Y1VH 4YWMA 2A1AA 4PG3A 4AIMA 1G291 3EBEA 2R93G 4IPHA 5IYDH 1P8LA 1X3FA 1GD7A 1TXYA 1HR0Q 3I4MG 2D0PA 1I3QH 5M3FH 4DR3L 4JI3Q 1E1OA 1PVOA 1WJJA 2UXBQ 2UUBL 1FJGL 1KD1C 2MO0A 4LF9Q 2ZM6L 1X3GA 1J5EQ 4A3CG 1IBLL 2V1CC 3HOXH 3SGIA 1HNZQ 1D7QA 4GLXA 1XNQL 4A3GH 4X64Q 1PYBA 3STBD 4JI2L 1SFOH 2ZTEA 4DNIA 1N36L 4BA1I 1NJIC 2CKZB 1OXTA 3GTLH 3CCMA 4Y7NH 2CQOA 4IFDG 3KLWA 2KHJA 3U4ZA 2YTYA 5C4XH 2B3GA 3TS0A 1G6PA 4OX9Q 3CAMA 4UY8C 3S1NH 1OXSC 3ER0A 3HOVG 1PH7A 4BXXG 1Z9FA 3PUYA 3F2BA 3I56A 2FXQA 4OONA 3TEHB 4KHPQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X6A H;  3PSI A;  1L2F A;  4PZ6 A;  2GVB A;  2HHH Q;  4LF6 Q;  4GKK L;  5M5X H;  1T9H A;  3FKI G;  4GLV B;  4A76 A;  1Q12 A;  2N78 A;  3JC6 6;  5M5W H;  3AYH B;  2HT1 A;  1B70 B;  1N34 L;  2UU9 L;  3S1M H;  1AH9 A;  3OTO L;  4C3I H;  1VS0 A;  4YCU A;  4LF8 L;  1VQA A;  2IHE A;  4B3R L;  1JJC B;  2UXC Q;  1K9M C;  1X65 A;  5C3E G;  2IT1 A;  2RCN A;  3RLN A;  1VQI A;  5IP7 G;  3PUX A;  4UP9 A;  2ASB A;  1KIX A;  4Y52 H;  1PH3 A;  1SRU A;  2KCM A;  4JI0 L;  3OW2 A;  2VY3 A;  4DR3 Q;  3H3V H;  3M9B A;  2D62 A;  4IOC A;  4GOP A;  4DR7 L;  1IBK L;  1CUK A;  3CCS A;  2UUB Q;  1OXU A;  4APV A;  2HIX A;  4HIO A;  2LXK A;  1IBL Q;  2C35 B;  2R7Z H;  3I4N G;  4H02 A;  1WCM H;  3PV0 A;  3PO3 H;  4A3K G;  1XNQ Q;  1FGU A;  1UE6 A;  2JQO A;  2PI2 E;  1N36 Q;  3PF5 A;  3PUV A;  2E5L L;  1L1O C;  2B63 H;  1XJV A;  4IPC A;  3E0E A;  3CC7 A;  1NE3 A;  5IYD G;  2VQE Q;  3NBH B;  3S1R H;  4RG1 A;  4XIG S;  5M5Y H;  5M3F G;  1VQ7 A;  3GTM H;  4IJL A;  3AFP A;  4JI6 L;  2R92 H;  3L0O A;  1SRO A;  4L5T A;  3E9I A;  2K50 A;  2YTV A;  4GN4 B;  5IYC H;  3BZK A;  3G6E A;  4GKK Q;  1U0L A;  3HOX G;  2ALY B;  3W1G A;  1MJE A;  1TWF H;  1YHA A;  1N34 Q;  2UU9 Q;  1E22 A;  3OTO Q;  2JA7 H;  4QQB X;  4JI1 Q;  4DR4 L;  4A3D G;  3A74 A;  3A5Z B;  2ZJQ A;  4B3R Q;  4JV5 L;  1Y1W H;  4TVA B;  1QVF A;  1IZ6 A;  4OO1 I;  3L2P A;  4A3B H;  1NBW A;  1VQK A;  1MKH A;  1V43 A;  5IE8 A;  1KAW A;  4DV7 Q;  1UWV A;  1PH8 A;  4HJA A;  2IY5 B;  2K14 A;  2EIF A;  1EIF A;  3G71 A;  2I5H A;  4GOP B;  1J6Q A;  4HJ7 A;  1TWA H;  3S24 A;  4JI0 Q;  2JJQ A;  4JI7 L;  3J81 j;  3VDY A;  4DR2 L;  1YIJ A;  2PQA A;  4YY3 Q;  4P74 A;  1IBK Q;  1OTC A;  4HJ9 A;  4DR5 Q;  3PF4 A;  4BA2 I;  3FHW A;  1E1T A;  4LW1 A;  3PO2 H;  3S14 H;  3CPW A;  1SE8 A;  2F52 A;  4C3H H;  1I50 H;  3M4P A;  5GAD C;  3U58 A;  4JBK A;  3K80 C;  2HQL A;  4PMW A;  2I5L X;  1K8G A;  2E5L Q;  1HNW L;  3ULP A;  3CME A;  1CKN A;  1WI5 A;  3KJO A;  1VQ8 A;  5H1S E;  1AE3 A;  1YZ6 A;  5C44 H;  1VQ9 A;  4NXM Q;  1MIU A;  3TS2 A;  3ZJY C;  3M3Y H;  5GQO A;  4AYB E;  2VQF L;  2BA1 A;  3RNU A;  4NXN Q;  2IX1 A;  1BBW A;  1CKO A;  3TQY A;  4IO9 A;  4JC0 A;  1I6H H;  1WYD A;  4B3T Q;  5JJI A;  4P71 A;  2CWP A;  2R7Z G;  4YHH L;  1C9O A;  1W3S A;  1K3R A;  1WCM G;  1JE5 A;  4MTN A;  3PO3 G;  1S72 A;  3KYH C;  4LFC L;  2AMC B;  5FLX c;  4DK6 C;  3HOW H;  4DR4 Q;  5IP9 H;  1XMQ Q;  3J81 i;  3CPF A;  1SLJ A;  3RLO A;  2B63 G;  3CQZ H;  2JE6 I;  4GNX A;  3E9H A;  3CC4 A;  2WP8 J;  2K75 A;  3HKZ E;  3W1B A;  4DV0 Q;  3PUW A;  5IYB G;  4HIM A;  1YJ9 A;  1HNX Q;  2E2I H;  4LF7 Q;  1IYJ B;  2K5H A;  1L1O B;  1Q81 C;  4DKA C;  1X55 A;  4JI5 Q;  5IYC G;  4JI7 Q;  2R92 G;  1A63 A;  3J80 c;  4B3S L;  3S17 H;  1U5K A;  4JBW A;  1EUJ A;  3U50 C;  3S2H H;  1A62 A;  1KRS A;  2ID0 A;  2JA7 G;  4EX5 A;  4JI8 L;  5LMU L;  1D8L A;  2VZA A;  1CKN B;  2PMZ E;  2VW9 A;  1XPU A;  1Y1W G;  1VQJ A;  1EFW A;  4DV4 L;  4L5Q A;  4A3B G;  4IFD I;  1HNW Q;  1C0A A;  1KC8 C;  3LGJ A;  4HID A;  4GOP C;  1YIT A;  1R9T H;  1M90 C;  1VQN A;  2N3S A;  1DGS A;  5GAH C;  4WJ3 M;  2QGQ A;  4OWX B;  3F1Z A;  2JA8 G;  1PFS A;  2Y0S E;  1YJW A;  1HR0 W;  2E2J H;  2Q2I A;  1VQH A;  3NEL A;  2UUC L;  2VL6 A;  4L5R C;  4YCW A;  1BBU A;  4HJ5 A;  2JEA I;  2NVX H;  3PO2 G;  4R4I A;  2QEX A;  3AEV A;  2RF4 A;  4PZ8 A;  3GDE A;  1Q8K A;  4UPA A;  1VQB A;  3K8A A;  3PUZ A;  4LFC Q;  1UEB A;  1VQP A;  1RIP A;  2OTJ A;  3KJP A;  4JYA L;  2R7D A;  3DM3 A;  5M3M H;  4GNX B;  4LFA L;  2BH2 A;  4LF4 L;  5C44 G;  4DAM A;  5GAG C;  4L5S A;  1YI2 A;  2NZH A;  4LWC A;  3AFQ A;  4QGU A;  2F4V L;  1GKH A;  1OXX K;  1VQM A;  3J7A 5;  4LNQ A;  4A3M H;  1IXR A;  2JA5 G;  3S15 H;  5J3B A;  4FDB A;  2BH8 A;  3RZD H;  1SN8 A;  4LUZ A;  4GN5 A;  4BBR H;  2I5M X;  1V1Q A;  3GTO H;  3BZC A;  3DLL A;  3H0G H;  3J7Z C;  1PH2 A;  1FJG Q;  4A4I A;  3GTP H;  2ZM6 Q;  4JI8 Q;  2K4K A;  3HOW G;  3UDF A;  2VNU D;  5IP9 G;  3HOZ H;  1QVG A;  2UXD L;  4DV4 Q;  4JI2 Q;  1HJP A;  1EQR A;  3CCL A;  4AQY L;  3ULL A;  2GVA A;  4A3J H;  1HZA A;  1Y1V G;  4MZ9 A;  4DPG A;  4LF5 L;  3F2D A;  2NZO A;  1VQ5 A;  1PV4 A;  4X65 L;  1G51 A;  4OWT B;  1NTG A;  5IWA L;  3S16 H;  3CC2 A;  1JB7 A;  2DUD A;  4A3E H;  4LFB L;  4DAY B;  1M1K C;  4BBS H;  4IOA A;  4TQU S;  1OXV A;  3RR5 A;  4P73 A;  3I55 A;  3UDI A;  1IBM L;  2UUA L;  4JYA Q;  4LFA Q;  3UE1 A;  4A3G G;  3KDF A;  4DR1 L;  1B8A A;  1GM5 A;  2F3I A;  3U4V A;  4LF4 Q;  5C0X J;  4LF8 Q;  4XTC S;  2KCT A;  3MEF A;  4YWL A;  2F4V Q;  4BY7 H;  4POG A;  5C4X G;  1JT8 A;  1I94 L;  4A3I H;  4A3L H;  2JK8 A;  3JAM c;  3T1H L;  3NEM A;  3S1Q H;  4DUY L;  4J15 A;  1E3P A;  1N33 L;  1Q82 C;  2L15 A;  1XMO L;  2OWO A;  1YEZ A;  1Y14 B;  3UDG A;  4DR7 Q;  4DV3 L;  1N9W A;  2NVQ H;  4GNX C;  1GO3 E;  5DLQ E;  3GO5 A;  5BR8 L;  3ERS X;  1KQS A;  1O7I A;  2Z6K A;  3RZO H;  5GAE C;  1QZG A;  4X62 L;  1JJ2 A;  5M3M G;  2E2H H;  3I2Z A;  2XTI A;  5HY6 A;  1X56 A;  3BU2 A;  4AQY Q;  2I0Q A;  5GRO A;  3CD6 A;  4JOI A;  1TWG H;  4AYB G;  3TRE A;  2WB1 E;  4A3M G;  3H3V I;  3PIP A;  2YV5 A;  4P72 A;  4ALP A;  4ME3 A;  4LF5 Q;  1LM0 A;  1HZ9 A;  1RL2 A;  3AQQ A;  3K7U C;  2H5X A;  5AJ3 L;  2WAQ E;  3GD7 A;  4BBR G;  5C0X G;  2Q2U A;  4JI6 Q;  4UP8 A;  3H0G G;  1EQQ A;  2AWN A;  1MJC A;  3OYY A;  3A0J A;  1HR0 L;  2LSS A;  2CFM A;  3MXN B;  4BXX H;  1E7Z A;  1LYL A;  1YHB A;  4LUO A;  3CCU A;  3HOZ G;  2UXB L;  3G4S A;  4LF9 L;  1A0I A;  3CP0 A;  1X3E A;  1J5E L;  1ASZ A;  4R4Q A;  4JV5 Q;  4PZ7 A;  3CW2 C;  3HKZ G;  4A3J G;  4X64 L;  1YBY A;  1PYS B;  1VQD A;  3CMA A;  1I94 Q;  3CCJ A;  1C7Y A;  1XTD A;  4P75 A;  1Q46 A;  1VCI A;  4UP7 A;  3UDX A;  2PQA B;  1XMO Q;  2IX0 A;  4OX9 L;  5LMN W;  4DR2 Q;  4DV3 Q;  3D31 A;  4A3E G;  4BBS G;  2A8V A;  3A5U A;  4AH6 A;  2VUM H;  2QA4 A;  5IY0 A;  2AKW B;  3EIV A;  3K81 C;  2HHH L;  4A3F H;  1PH6 A;  4K0K L;  1VQC A;  1Q1E A;  2D0O A;  1K8A C;  5FLM H;  3PCO B;  1SR3 A;  5K36 G;  1UE5 A;  2K5N A;  3L7Z C;  1QZH A;  4BY7 G;  2KBN A;  4HJ8 A;  1KRT A;  4A3K H;  5E7N A;  4A3L G;  1K0R A;  2R7F A;  1CSP A;  2PI2 A;  2JA6 H;  2JEB I;  2VQF Q;  1S40 A;  1YNX A;  2Y0S G;  2K5V A;  1QUQ A;  1WFQ A;  2NN6 G;  3ULJ A;  3J81 c;  4OXP A;  4NB3 A;  1IL2 A;  1N32 L;  1HZB A;  1HH2 P;  2HIV A;  4O2D A;  3CXC A;  3FP9 A;  1Q1B A;  1XNR L;  4YHH Q;  2E8G A;  4R4T A;  3S2D H;  3I4O A;  2IHF A;  3H15 A;  5ELO A;  2ZJP A;  2DGY A;  4RMF A;  4DV6 L;  2XGT A;  3RLF A;  3GTG H;  4A3D H;  1UE1 A;  1BKB A;  5C4J H;  1VQ4 A;  1Q86 C;  5JJK A;  3WWV A;  5JEA G;  2Z0S A;  3PIO A;  3STB C;  1GVP A;  4R4O A;  4JBJ A;  1BVS A;  3NEN A;  2VQE L;  2ZTC A;  4QY7 A;  2OQK A;  2OQ0 A;  4R1J A;  4X66 L;  4B3S Q;  2OCE A;  2VS1 A;  4IJH A;  2MNA A;  4JG2 A;  1L0W A;  1X54 A;  4A93 H;  4K0K Q;  5LMU Q;  2EXD A;  3KOJ A;  4NPS A;  3CCR A;  2OTL A;  1KL9 A;  4A75 A;  1EIY B;  4JBM A;  1NMG A;  3F2C A;  4DUZ L;  1Q7Y C;  2RHQ B;  4DV2 L;  4JI1 L;  1NMF A;  4QJF A;  3HOY H;  1PH4 A;  1QUQ B;  5EAY A;  4B3M L;  1EOV A;  4DV1 L;  4DV7 L;  1V9P A;  3K0X A;  1EYG A;  3TRZ A;  2YU9 H;  2Z6K C;  1PHJ A;  1FL0 A;  4POF A;  1SMX A;  3D0F A;  1N32 Q;  1LTL A;  1P16 A;  1X9N A;  1PH1 A;  4JI4 L;  2UUC Q;  2VUM G;  1JJG A;  2PNH A;  4DV5 L;  1KHI A;  4KHZ A;  4JOI C;  4YY3 L;  3T1Y L;  4A3F G;  4BY1 H;  1XNR Q;  1Z47 A;  2JA9 A;  3W5O A;  3RN5 A;  4DR5 L;  3M4O H;  2MQH A;  5FLM G;  1XPR A;  5FJ8 H;  1TWC H;  3JAM i;  2B29 A;  4QL5 A;  4YCV A;  4O0A A;  1N8R C;  2K52 A;  1K73 C;  3B6Y A;  5HGQ A;  4DV6 Q;  4IPD A;  4GKJ L;  1UE7 A;  4YWK A;  4C3J H;  2JA6 G;  3Q8D A;  4GS3 A;  5ELN A;  1FVI A;  2ES2 A;  1B7Y B;  2KHI A;  4NXM L;  3G48 A;  3PGZ A;  3HOU H;  1XPO A;  4KLK A;  2ZJR A;  4NXN L;  2LXJ A;  5IYB H;  3CCQ A;  1K83 H;  3GTQ H;  4X66 Q;  2R6G A;  1VQE A;  5LMN L;  1VQF A;  2R93 H;  2YYZ A;  4B3T L;  1PH5 A;  3I4M H;  1NY4 A;  3KF6 A;  3RN2 A;  3GTK H;  3KFU A;  1H95 A;  2CCZ A;  3CCV A;  2ATW A;  2UXD Q;  1KXL A;  1I5F A;  4R4C A;  3BJU A;  3EN2 A;  4DUZ Q;  1A8V A;  4DV2 Q;  4A3C H;  2WB1 G;  1X6O A;  4WJ4 A;  1XMQ L;  3HKS A;  2N49 A;  4GN3 B;  1YJN A;  4B3M Q;  5C0X I;  4DV1 Q;  4DR6 L;  2GN5 A;  3ICE A;  2WAQ G;  2ZTD A;  1HNX L;  4DV0 L;  4LF7 L;  2WFW A;  4OO1 G;  4X65 Q;  1AE2 A;  5IT9 c;  4JI4 Q;  5IWA Q;  4IPG A;  3HFZ B;  2BA0 A;  4JI5 L;  4DV5 Q;  4HIK A;  5JJL A;  3T1Y Q;  4A93 G;  2JA8 H;  1W2B A;  3HOV H;  4DK3 C;  1E24 A;  1L1O A;  4LFB Q;  4JI3 L;  1S3O A;  3M85 A;  4MNO A;  2MO1 A;  3KDF B;  1ASY A;  1IBM Q;  2UUA Q;  3M7N A;  1TWH H;  3I7F A;  2NVT H;  4GKJ Q;  3KF8 B;  4DR1 Q;  1EWI A;  3FKI H;  3K7A H;  3HOY G;  3UE0 A;  1HNZ L;  4EQ5 A;  3M4Q A;  3CCE A;  1JMC A;  4OWW B;  3J80 i;  4LUV A;  2Q2T A;  3T1H Q;  1VQL A;  3CF5 A;  2YTX A;  2AWO A;  2NVY H;  2AHO B;  4DUY Q;  5C3E H;  2RHS B;  1N33 Q;  5IP7 H;  2JA5 H;  1CKM A;  1WOC A;  3IRB A;  3KF6 B;  5LMN Q;  2KEN A;  4BY1 G;  4C2M H;  1YVC A;  2CWA A;  1PH9 A;  5FJ8 G;  5BR8 Q;  4KI0 A;  4KHP L;  3F8T A;  4LF6 L;  4X62 Q;  5JEA J;  2A19 A;  4IFD J;  1VQO A;  4GLA C;  1HZC A;  2Q2H A;  3I4N H;  1LUZ A;  1QVC A;  2NN6 I;  4DR6 Q;  4A3I G;  2EQS A;  2N8N A;  3GTJ H;  1VQ6 A;  4QIW E;  3HOU G;  1CSQ A;  4JCV E;  2UXC L;  1PA6 A;  5AJ3 Q;  2MFI A;  1YHQ A;  1VQG A;  1Y1V H;  4YWM A;  2A1A A;  4PG3 A;  4AIM A;  1G29 1;  3EBE A;  2R93 G;  4IPH A;  5IYD H;  1P8L A;  1X3F A;  1GD7 A;  1TXY A;  1HR0 Q;  3I4M G;  2D0P A;  1I3Q H;  5M3F H;  4DR3 L;  4JI3 Q;  1E1O A;  1PVO A;  1WJJ A;  2UXB Q;  2UUB L;  1FJG L;  1KD1 C;  2MO0 A;  4LF9 Q;  2ZM6 L;  1X3G A;  1J5E Q;  4A3C G;  1IBL L;  2V1C C;  3HOX H;  3SGI A;  1HNZ Q;  1D7Q A;  4GLX A;  1XNQ L;  4A3G H;  4X64 Q;  1PYB A;  3STB D;  4JI2 L;  1SFO H;  2ZTE A;  4DNI A;  1N36 L;  4BA1 I;  1NJI C;  2CKZ B;  1OXT A;  3GTL H;  3CCM A;  4Y7N H;  2CQO A;  4IFD G;  3KLW A;  2KHJ A;  3U4Z A;  2YTY A;  5C4X H;  2B3G A;  3TS0 A;  1G6P A;  4OX9 Q;  3CAM A;  4UY8 C;  3S1N H;  1OXS C;  3ER0 A;  3HOV G;  1PH7 A;  4BXX G;  1Z9F A;  3PUY A;  3F2B A;  3I56 A;  2FXQ A;  4OON A;  3TEH B;  4KHP Q; 
#chains in the Genus database with same CATH topology
 4PZ6 A;  1JC7 A;  5M5X H;  3BYY B;  4GLV B;  1MSH A;  4DAY A;  3AYH B;  1B70 B;  1N34 L;  3ZYY X;  1SSO A;  2CQA A;  1NCV A;  2IHE A;  1O7Z A;  1E2W A;  1JJC B;  2UXC Q;  1K9M C;  5FLX L;  2RCN A;  1B2T A;  3CKI B;  1PH3 A;  4XQN A;  1AZP A;  1SRU A;  4JI0 L;  3OW2 A;  4DR3 Q;  4IOC A;  2D62 A;  5CV5 A;  4GOP A;  3S2H B;  4B9X A;  2UUB Q;  2VB2 X;  3CCS A;  1OXU A;  1SNM A;  2QKI C;  2Z1C A;  2LXK A;  1IBL Q;  1E2V A;  1SEB D;  4H02 A;  1V8Q A;  2ZXP A;  3NXW A;  3PO3 H;  4A3K G;  1FGU A;  1YNN D;  1N36 Q;  3E0E A;  3CC7 A;  1NE3 A;  1GUG A;  5IYD G;  2RVL A;  3NBH B;  4KD4 A;  4MIU A;  3S1R H;  4RG1 A;  5M5Y H;  3FPP A;  5KEE A;  1WTV A;  1VQ7 A;  2E2J B;  3AFP A;  3D4W A;  3M7G A;  5BN4 A;  3E9I A;  2YTV A;  3BZK A;  2UU9 Q;  1E22 A;  4QQB X;  4B3R Q;  4G57 A;  1QVF A;  4TVA B;  1IZ6 A;  4E6I A;  1NBW A;  3NWT A;  4ZAI A;  4AYB B;  5IE8 A;  2K32 A;  4DV7 Q;  4KHV A;  4GZY C;  1G91 A;  2CVR A;  2EIF A;  3G71 A;  1CHQ D;  5JOB A;  4HJ7 A;  1TWA H;  1ZEQ X;  3P7J A;  1Q90 A;  3J81 j;  2EY1 A;  5EJW A;  4UAI A;  2CH4 W;  4HJ9 A;  1D5M C;  3NQT A;  4R9W A;  3GTP B;  3FHW A;  1E1T A;  4LW1 A;  4MTK A;  3CPW A;  4C3H H;  3M4P A;  4FXG C;  2HQL A;  4PMW A;  2E5L Q;  3CME A;  1CKN A;  1WI5 A;  3I4L A;  3IKJ A;  5C44 H;  4KK7 A;  1SMY D;  5GQO A;  1TT2 A;  2BA1 A;  4NXN Q;  2F0L A;  2F0Q A;  2B2T A;  4RKB A;  4HTH A;  1I6H H;  2K5D A;  4B3T Q;  2DJF C;  1ONL A;  4A3E B;  2QEJ C;  2B2Y A;  4HCE A;  5JVH 3;  4KY7 A;  1K3R A;  1JE5 A;  3PO3 G;  1D1K A;  1S72 A;  2AMC B;  3OPO A;  5J39 A;  1NR2 A;  3CPF A;  1SLJ A;  1TKW B;  1CK1 A;  3E9H A;  3HKZ E;  4DV0 Q;  3J7A F;  2EJM A;  1A63 A;  3J80 c;  3S2H H;  1KRS A;  2OEO A;  3NPP A;  2DN8 A;  2PMZ E;  2Z4I A;  2Z4H A;  2CW0 C;  1VQJ A;  4XYO A;  1HNW Q;  1V1P A;  1TWG B;  1RKN A;  3WOE A;  1A2T A;  1YIT A;  3GQB A;  1EQV A;  4WJ3 M;  3V2T A;  1PFS A;  1VF5 C;  2E2J H;  3NEL A;  3W3A A;  4L5R C;  3PQI A;  4PZ8 A;  1Q8K A;  1AEX A;  1PFN A;  3K8A A;  4OL7 A;  5C44 G;  3LWU A;  5GAG C;  4CDF C;  1X3P A;  3J7A 5;  4RCO A;  4LNQ A;  1MHW C;  1D5Z C;  5FOB B;  5EKK A;  5HGT A;  2BH8 A;  5C0X H;  3DLL A;  1ILQ A;  2WKC A;  2Z8L A;  4A4I A;  3GTP H;  2ZM6 Q;  4A3F B;  2K4K A;  2VNU D;  1PRT B;  4CJ0 B;  4CHT B;  1JB3 A;  1HJP A;  1SND A;  5JVG 3;  3FMC A;  4EQO A;  2CHB D;  3F2D A;  4JPB W;  1PV4 A;  4TKO B;  4X65 L;  1G51 A;  3TME A;  1JOK A;  1JB7 A;  3IAY A;  2NVX B;  4A3E H;  4DAY B;  1OXV A;  1DOL A;  3UDI A;  5KGU A;  5I2Y A;  3NTI A;  4LF4 Q;  2F3I A;  2IX3 A;  4MN3 A;  2KCT A;  4A3D B;  2F4V Q;  1STB A;  1G6Z A;  1I94 L;  3T1H L;  4IZ8 A;  3NEM A;  4ODG A;  4L6T B;  4J15 A;  3H91 A;  4DNR B;  3RZD B;  1YEZ A;  1Y14 B;  1UNS A;  4L8J A;  4TSS A;  1N9W A;  1JJ2 A;  3R93 A;  3I2Z A;  4NDX A;  2IJ0 A;  5NUC A;  5GRO A;  1TWG H;  4AYB G;  3PIP A;  4ALP A;  1LM0 A;  2YU9 B;  1RL2 A;  3AQQ A;  2H5X A;  5C0X G;  1HUM A;  1LTG D;  1EFI D;  4FYD A;  3CRK C;  1PRT C;  2LSS A;  2CFM A;  4BXX H;  3M4O B;  3OOC A;  4DN4 M;  4KN7 C;  1XWE A;  2OXP A;  3I8Z A;  1S5F D;  2F0M A;  2HDL A;  2NUC A;  3CCJ A;  4P75 A;  1Q46 A;  5FO9 B;  1G2T A;  5LMN W;  4DV3 Q;  3D31 A;  4A3E G;  1B1Z A;  1ESF A;  4RGO S;  1RCV D;  3OIQ A;  1ENA A;  2QA4 A;  5IY0 A;  5C5M A;  2HHH L;  4A3F H;  4K0K L;  2KCN A;  2A6E D;  1QZH A;  4H13 C;  1KDC A;  3FRP B;  3ND8 A;  3VR4 A;  1K0R A;  5KNC A;  2JEB I;  3O13 A;  5E4X A;  5AFW A;  3J81 c;  1IL2 A;  1LTT D;  3CXC A;  5COR A;  3FP9 A;  5EPJ A;  4UHV A;  1TWH B;  3I4O A;  3H15 A;  4FNF A;  5IGD A;  5IGG A;  4ULL A;  1JOR A;  3IL8 A;  1YNJ C;  5L37 A;  4A3D H;  2F3W A;  1VQ4 A;  1Q86 C;  1Y69 U;  2SNM A;  1STE A;  3DUZ A;  5A2Q E;  1EY4 A;  1GVP A;  1IW7 D;  2JA5 B;  1RTN A;  2OCE A;  1I4R A;  4ZUI A;  2EXD A;  4WOR A;  3F2C A;  4PV1 C;  4QJF A;  4WJW A;  5C6A A;  1EOV A;  4KTA A;  3EVQ A;  3L3O C;  4K5X A;  1EYG A;  2YU9 H;  1B9M A;  1PHJ A;  4POF A;  2LFN A;  3A7A B;  1LTL A;  1O7Y A;  4ME5 A;  1JJG A;  4R8I A;  2PNH A;  4A3F G;  4K8I A;  2F0K A;  3RN5 A;  3M4O H;  2MQH A;  1JE4 A;  4QL5 A;  4YCV A;  1N8R C;  4GKJ L;  2EYL A;  3OMG A;  5HGQ A;  4DV6 Q;  4MHE A;  4X3U A;  5C5L A;  1DD2 A;  1WTX A;  1LAC A;  3Q8D A;  5ELN A;  2BOS A;  4NXM L;  2KHI A;  3G48 A;  3PGZ A;  1YNN C;  5C4X B;  2ZJR A;  5IYB H;  1XTC D;  1EU4 A;  4DXG A;  1FNU A;  2N88 A;  1PH5 A;  3KFU A;  3ND9 A;  3EA6 A;  3CCV A;  2ATW A;  4JVZ A;  3GV6 A;  4V0B A;  5M5W B;  2F0H A;  1I5F A;  2H4O A;  4DUZ Q;  2EYO A;  4K6L A;  5JJZ A;  4A3C H;  4C3I B;  5J1Z A;  1X6O A;  4C1N K;  2F0O A;  3HKS A;  1U4P A;  4K2L A;  4DR6 L;  1HNX L;  2L11 A;  4X65 Q;  5CV7 A;  4CDC C;  4UDU C;  4OEM B;  5T1G A;  4DV5 Q;  2KCC A;  3MHB A;  4DK3 C;  3TDQ A;  2QDL A;  4JI3 L;  3TN2 A;  4MNO A;  1GUW A;  2R7Z B;  1TWH H;  3I7F A;  1KDB A;  3KF8 B;  1TR5 A;  3M4Q A;  1S5C D;  2B63 B;  1EWH A;  3T1H Q;  1PZJ D;  3NWS A;  2AWO A;  2AHO B;  3MA2 B;  3GTM B;  2JA5 H;  4CKE A;  1SMY C;  3IRB A;  3KF6 B;  5LMN Q;  1EY9 A;  2R92 B;  1SYB A;  4J1M A;  4OIJ A;  1DJR D;  2NB0 A;  2AQ1 B;  2A19 A;  2JA7 B;  4IFD J;  2HDM A;  1VQO A;  1SNC A;  4GLA C;  1LUZ A;  3H09 A;  1QVC A;  1PTO F;  3I72 A;  2J7Z A;  4JCV E;  2UXC L;  4EQN A;  4IUV A;  1YHQ A;  2K04 A;  1PMR A;  1VQG A;  3J7A V;  1EY8 A;  4FXK C;  2D0P A;  4DR3 L;  1AZQ A;  1WJJ A;  2UUB L;  1KD1 C;  1IYU A;  2MO0 A;  4A3C G;  1FD7 D;  2RDF A;  1IBL L;  2Z9H A;  1D7Q A;  2ICI A;  1EEF D;  4ZK9 B;  4DNI A;  1N36 L;  4BA1 I;  2CKZ B;  1KNA A;  3KLW A;  2KHJ A;  4XQQ A;  5C4X H;  4I65 A;  5COY A;  4C2M B;  1PH7 A;  3PUY A;  3NBH A;  3F2B A;  2FXQ A;  3PSI A;  2HHH Q;  2GVB A;  3U9O A;  4A76 A;  3JC6 6;  5M5W H;  3HOW B;  1PRT F;  2UU9 L;  4C3I H;  1VS0 A;  3MEH A;  2QW7 A;  3CQZ B;  4LF8 L;  4B3R L;  3A7L A;  3V05 A;  1X65 A;  4ZKC B;  2IT1 A;  4K14 A;  2WII B;  4RWS C;  3SXH A;  3PUX A;  4UP9 A;  2E76 C;  1PTO D;  2A74 C;  1SE2 A;  1KIX A;  4Y52 H;  1LV9 A;  2VY3 A;  4K2K A;  1PLF A;  2K1B A;  1Z7T A;  4HIO A;  2C35 B;  2R7Z H;  2L9H A;  2EYJ A;  1MI2 A;  2JQO A;  3C1E A;  5C4Z A;  1I4G A;  1M8A A;  2E5L L;  4ID6 A;  2B63 H;  4IPC A;  3Q0A A;  3ERQ A;  3DEO A;  3T56 B;  3C46 A;  1GUN A;  4XIG S;  2PYK A;  3GTM H;  5I4D A;  2R92 H;  4G7Z C;  3L0O A;  4GKK Q;  1ML0 D;  4G4K A;  1U0L A;  2ALY B;  3W1G A;  1MJE A;  1YHA A;  2BE5 D;  3OTO Q;  2JA7 H;  5M3M B;  5K36 H;  2ZJQ A;  4JV5 L;  2XWJ B;  3L2P A;  5DNF A;  1MKH A;  2QCP X;  1U4M A;  3BZD B;  1EYD A;  3A8K E;  1UWV A;  4IN3 A;  2IY5 B;  2K14 A;  3Q6S A;  1J6Q A;  3S24 A;  2NN6 H;  2JJQ A;  4BBR B;  5ELD A;  3N6R A;  2EOT A;  3H0G B;  3FEW X;  1OTC A;  4BA2 I;  3PF4 A;  4NKL A;  2L4N A;  4IUR A;  4C3I G;  3U58 A;  1EZ6 A;  3VR2 A;  3SE0 A;  1HNW L;  3ULP A;  4NXM Q;  1ENF A;  3HKZ B;  5H1S E;  1YZ6 A;  1VQ9 A;  1SBB B;  4KMU C;  3SDZ A;  3NQI A;  4BWG B;  2OT2 A;  1WYD A;  1AFP A;  1K0S A;  2F0D A;  4P71 A;  1CQV A;  5EGT A;  2CWP A;  2R7Z G;  4YHH L;  2PMZ B;  3HOW H;  5IP9 H;  1GUT A;  4KKS A;  3RLO A;  2B63 G;  3BVG A;  3C1F A;  3CQZ H;  3MVV A;  5CBA E;  1WTO A;  3CC4 A;  2F4I A;  1HNX Q;  1JOQ A;  1YJ9 A;  4HIM A;  3VR3 A;  1IYJ B;  5KYL A;  1Q81 C;  4DKA C;  1X55 A;  2R92 G;  1KAA A;  1U5K A;  4JBW A;  3T4A C;  1EUJ A;  1A62 A;  2RSN A;  3RZO B;  2JA7 G;  4KKT A;  3JAM E;  4F87 A;  1XPU A;  2L0C A;  1QNK A;  1C0A A;  1KC8 C;  5EBD A;  2A6E C;  3G7L A;  1VQN A;  1B3Q A;  5DEH A;  3BDC A;  4OWX B;  2JA8 G;  5FO7 B;  4HJ5 A;  2QEX A;  4JK1 C;  3GDE A;  1VQB A;  2R61 A;  2OTJ A;  5M9O A;  4HMJ A;  1SYD A;  5CV6 A;  3DXJ C;  5M3M H;  2BH2 A;  4LF4 L;  3E6Z X;  4L5S A;  1YI2 A;  1LT4 D;  2F0I A;  2F0E A;  3E5S A;  4LWC A;  4QGU A;  2F4V L;  5KYI A;  2F03 A;  1EU3 A;  2PCF B;  3S15 H;  3HZX A;  5J3B A;  4H44 C;  4LUZ A;  4BBR H;  4H7B A;  3D4D A;  2PW5 A;  1V1Q A;  3H0G H;  2Q8T A;  1IW7 C;  3HOW G;  4N9P A;  5IP9 G;  1QE6 A;  2KUM A;  3LNN A;  1EQR A;  1WVL A;  3K59 A;  1PFB A;  5ELE A;  4OWT B;  1NTG A;  5IWA L;  4RAU C;  3CC2 A;  1J8I A;  1GUS A;  2WKD A;  4ILW A;  4I7A A;  2PZU A;  4P73 A;  3J81 L;  1HTP A;  4JYA Q;  1MGS A;  4A3G G;  1B8A A;  4LF8 Q;  4XTC S;  3GTG B;  1HA5 A;  4RGM A;  5C4J B;  4YWL A;  1QIL A;  1RJT A;  3URY A;  2OWO A;  4DV3 L;  4FXD A;  2K03 A;  4RCN A;  3K5L A;  1GO3 E;  2RA4 A;  3GO5 A;  4KV6 A;  5DLQ E;  5EKL A;  3RZO H;  5GAE C;  1QZG A;  5M3M G;  4DA2 A;  1TS4 A;  2RQX A;  1BR9 A;  1ICF B;  1X56 A;  3BU2 A;  4AQY Q;  2I0Q A;  5IGB A;  2RDG A;  4M1U B;  3H3V I;  3NBI A;  4KY5 A;  4LF5 Q;  3DM1 A;  1HFN A;  4RHR A;  1TY2 A;  5AJ3 L;  2WAQ E;  2K7V A;  4BBR G;  5FKA C;  3KLR A;  1PYW D;  1F2Z A;  3H0G G;  3E3X A;  1L0X B;  3TBI B;  4V19 0;  5D14 A;  5G3L D;  1W6K A;  1E7Z A;  4FVM A;  2K28 A;  3CCU A;  1C48 A;  3G4S A;  2HQE A;  3CP0 A;  2K01 A;  4HR7 B;  4JV5 Q;  4PZ7 A;  4C3J B;  3HKZ G;  1YBY A;  4IUN A;  1PYS B;  3OWE B;  1VQD A;  3QG1 A;  3CMA A;  1C7Y A;  2O5J C;  4DGZ A;  1TS5 A;  1XMO Q;  3DWA A;  4CJ1 B;  3GTQ B;  4IUT A;  2IX0 A;  4OX9 L;  2BDN A;  3D8G A;  3OMC A;  3A5U A;  2AKW B;  3EIV A;  1EEI D;  3C2P A;  2D0O A;  1SR3 A;  2K5N A;  3L7Z C;  1QJO A;  1PTO B;  4RFB A;  1R4P B;  5E7N A;  1K28 A;  2MJ8 A;  1WFQ A;  4NB3 A;  2X69 A;  3TP5 A;  4O2D A;  3MWY W;  1UEA B;  1Q1B A;  5DAU A;  4YHH Q;  2E8G A;  4C3H G;  1SNO A;  3VA5 A;  2IHF A;  2A68 D;  3FKI B;  3SK5 A;  5KIX A;  4DV6 L;  5IT9 E;  2O5I C;  2XGT A;  3RLF A;  2EYP A;  3GTG H;  1CI3 M;  1GHJ A;  5C4J H;  1PZI D;  3WWV A;  5IOC A;  4XQJ A;  2K05 A;  2NVY B;  1D5X C;  2Z0S A;  3GV3 A;  5C3E B;  3HS0 C;  4JBJ A;  2JSO A;  2VQE L;  1HHV A;  4R1J A;  2OQ0 A;  1SJE D;  1X54 A;  2I46 A;  3KOJ A;  3DMU A;  1KL9 A;  4A75 A;  4JBM A;  4DUZ L;  1BDO A;  2RHQ B;  1CT1 D;  4QCL A;  1PH4 A;  3QWN A;  3N52 A;  3A8J E;  2A6H D;  1V9P A;  2F0U A;  3TP8 A;  3TRZ A;  1Y1V B;  2Z6K C;  4QUF A;  1BOS A;  1SMX A;  1N32 Q;  2DNC A;  5M3F B;  4DV5 L;  4J6H A;  1KHI A;  4KD3 A;  4KHZ A;  1XNR Q;  5KND A;  1PTO C;  4DU9 A;  5JPM C;  3HOX B;  1DZ1 A;  2K52 A;  1K73 C;  3B6Y A;  4IPD A;  1JOO A;  1UE7 A;  4DXF A;  3MFY A;  1FGB D;  1WTR A;  3KF8 A;  4C3J H;  1STH A;  5EPL A;  3I91 A;  2BCO A;  1B7Y B;  1A3V A;  4Y7N B;  1D1I A;  4OGQ C;  2NYZ D;  1XPO A;  3CCQ A;  1BUV T;  2HD3 A;  2RCF A;  3GTQ H;  2E2D C;  4ABN A;  2FFK B;  2R6G A;  5LMN L;  4ZRZ A;  4IUU A;  3KF6 A;  3RN2 A;  1CA6 A;  3BJU A;  3S1M B;  2QIL A;  4DV2 Q;  1DOK A;  1PTO H;  4WJ4 A;  3NP8 A;  4GN3 B;  2EVB A;  4DV1 Q;  4HED A;  3VYT A;  2BE5 C;  4CDE C;  2ZTD A;  4LF7 L;  2WFW A;  3DHQ A;  4JI4 Q;  1STN A;  5IWA Q;  4K5W A;  4JI5 L;  5JJL A;  1LTS D;  1W2B A;  1STY A;  1F9P A;  1S3O A;  3OWF A;  5EBC A;  1ASY A;  1LT6 D;  1WCM B;  2EE1 A;  2DY7 A;  3FKI H;  4EQ5 A;  3CCE A;  3J80 i;  3SK4 A;  1VDZ A;  2Q2T A;  4K5V A;  1VQL A;  3CF5 A;  2JP1 A;  2NVY H;  2YTX A;  5C3E H;  2RHS B;  4IAL A;  5IP7 H;  4Q0F A;  2KEN A;  1PH9 A;  1F2M A;  2KEE A;  5JEA J;  1JWS D;  4C3J G;  1HZC A;  2NN6 I;  4FF2 A;  1HA6 A;  2N8N A;  4QIW E;  5AJ3 Q;  2M2L A;  2J4X A;  1Y1V H;  4PG3 A;  1F2Y A;  1ZXT A;  3PIO 3;  1BQQ T;  1GD7 A;  2O2L D;  1VMP A;  5LHY 1;  1JQY D;  1EYA A;  5M3F H;  1PVO A;  1FJG L;  3WDN A;  2SOB A;  1TS3 A;  2V1C C;  2KOL A;  3HOX H;  1E0B A;  1HNZ Q;  2ZXR A;  1F2L A;  1B53 A;  1GHK A;  3RUZ A;  3M3Y B;  5I6W A;  3I73 A;  3CCM A;  3H3V C;  4Y7N H;  3U4Z A;  3MAQ A;  3SR1 A;  3TS0 A;  4OX9 Q;  2ZXO A;  3CAM A;  3MC0 B;  4QUC A;  4UY8 C;  1OXS C;  5C4H A;  3ER0 A;  2J0T D;  3Q22 A;  4BXX G;  1Z9F A;  2FIN B;  3I56 A;  1X32 A;  2WIN B;  4GKK L;  2RKS A;  3FKI G;  1Q12 A;  2HT1 A;  3S1M H;  2X6L A;  3OTO L;  2WAC A;  3NHH A;  1O80 A;  1AW7 A;  1II3 A;  4XT1 B;  5C3E G;  4QMG A;  3RLN A;  5IP7 G;  2TSS A;  2LMC B;  4LK1 C;  5FLX E;  2IWH A;  3H3V H;  3Q23 A;  3P75 A;  3FDT A;  3QR8 A;  4APV A;  1CZG A;  1WCM H;  2KA7 A;  1XNQ Q;  1UE6 A;  5EPK A;  3VYS A;  2PPB C;  3PUV A;  1BCP F;  1L1O C;  1I4P A;  1IYV A;  5CV8 A;  2AQ2 B;  3MTS A;  3M4Y A;  2VQE Q;  1HFG A;  2R3Z A;  5M3F G;  4HSV A;  4JI6 L;  3G6E A;  4L5T A;  1LTI D;  2K50 A;  4GN4 B;  4KY6 A;  4F8M A;  5C3W A;  3HOX G;  4DFA A;  2JXM B;  4LMQ D;  4A3D G;  2A69 D;  1X3Q A;  4A3M B;  4HJA A;  3NSW A;  3WOF A;  1EIF A;  1KAB A;  2D2C C;  2F0V A;  2I5H A;  3PMF A;  4RHS A;  1DYQ A;  3MXP A;  2MGS A;  1YIJ A;  3GTO B;  4P74 A;  1IBK Q;  2F0F A;  2EXZ A;  2XN9 C;  5J22 A;  2F52 A;  1EY6 A;  5BN5 A;  5GAD C;  1SYF A;  3K80 C;  5FO8 B;  1JCK B;  1QG7 A;  1TU2 B;  1L0Y B;  2DJG C;  2M9V A;  1B3A A;  5DM7 3;  3KJO A;  1VQ8 A;  4A3J B;  1AE3 A;  3TS2 A;  1MIU A;  3ZJY C;  3M3Y H;  4LJZ C;  4DAP A;  3UI2 A;  3AB9 A;  1H9M A;  1E2Z A;  1V1O A;  2IX1 A;  1WTW A;  4JC0 A;  1BCP D;  5JJI A;  4BBS B;  1C9O A;  1WCM G;  4MTN A;  3AMU A;  3KYH C;  4DR4 Q;  4DK6 C;  2MPM A;  3J81 i;  2XSC A;  5IOD A;  4EGV A;  4BY7 B;  3Q24 A;  3BVZ A;  2WP8 J;  2XRS D;  4LF7 Q;  3PUW A;  5IYB G;  4OHJ A;  3S1Q B;  1BXT A;  1T5E A;  4JI5 Q;  4JI7 Q;  4CGY B;  4HN7 A;  4B3S L;  2NVQ B;  3U50 C;  1D8L A;  2VZA A;  2VW9 A;  4L5Q A;  2ICE C;  4IFD I;  2NTS A;  3CRL C;  3K58 A;  5ISR A;  3LGJ A;  4HID A;  3D3R A;  2MHV A;  1M90 C;  2O4X A;  2N3S A;  3NTK A;  5GAH C;  2QGQ A;  3F1Z A;  2Y0S E;  1YJW A;  2OF1 A;  1HR0 W;  2HCC A;  1VQH A;  2A73 B;  3H94 A;  3V96 A;  2VL6 A;  2UUC L;  4YCW A;  1BBU A;  2JEA I;  5ELB A;  3A54 A;  3AEV A;  2RF4 A;  4UPA A;  4LFC Q;  3QB3 A;  3KJP A;  2B8F A;  3TZU A;  1FYC A;  4JYA L;  4GNX B;  1GUO A;  2F0S A;  2NZH A;  2A68 C;  1OXX K;  4A3M H;  1SYG A;  5IIF A;  2JA5 G;  1W6J A;  1QWY A;  4FDB A;  1SN8 A;  2L5T A;  2I5M X;  3GTO H;  3BZC A;  2VUM B;  3J7Z C;  1FJG Q;  4NP5 A;  4JI8 Q;  3UDF A;  4DV4 Q;  3J80 L;  2FJ2 A;  4A3K B;  3CCL A;  4AQY L;  3ULL A;  1B50 A;  1XXG A;  2JA6 B;  4A3J H;  4MZ9 A;  3I3C A;  1TVX A;  3AU7 A;  4DPG A;  4LF5 L;  2NZO A;  2EYH A;  1FNW A;  2A6H C;  2DY8 A;  5E3F A;  2F0T A;  1CFM A;  2F0G A;  4LFB L;  4BBS H;  3S2D B;  5I6Y A;  3RR5 A;  1BF4 A;  1CTM A;  2UUA L;  1D6E C;  1I6V C;  1EZ8 A;  4LFA Q;  3UE1 A;  4PMB A;  1DON A;  3U4V A;  5C0X J;  1WD0 A;  3MEF A;  4BY7 H;  3D6C A;  5C4X G;  4A3L H;  4A3I H;  2LS0 1;  3JAM c;  3S15 B;  2WAQ B;  1C8C A;  3PIP 3;  3S1Q H;  4YIJ A;  1E3P A;  2L15 A;  2XWB B;  1XMO L;  3UDG A;  3X3M A;  4Q5V A;  1HTL D;  2NVQ H;  1EIH A;  3K5O A;  4A93 B;  2XRQ D;  4GNX C;  5BR8 L;  2N55 A;  3ERS X;  1KQS A;  1O7I A;  2Z6K A;  2RDH A;  4X3S A;  3BDL A;  2XTI A;  5KNB A;  3CD6 A;  3HOY B;  3TRE A;  2WB1 E;  4A3M G;  1SXT A;  4RKL A;  1EWC A;  4P72 A;  3K7U C;  5JEA H;  3GD7 A;  2L12 A;  5CMD A;  1EYC A;  4JI6 Q;  1EQQ A;  2AWN A;  3MXN B;  1YHB A;  4LUO A;  3ITP A;  1TWC B;  1Y8N B;  1B4O A;  4LF9 L;  1A0I A;  1ASZ A;  1MSG A;  1SAP A;  4R4Q A;  4A3J G;  4ZCK A;  1XTD A;  1BNZ A;  1S5D D;  1VCI A;  1ENC A;  2X6G A;  3KK7 A;  5HUR A;  4BBS G;  2A8V A;  1LT3 D;  2VUM H;  3GTK B;  3QOL A;  4XT3 B;  2JYO A;  5LL6 S;  5JPN C;  3C3L A;  1PH6 A;  1Q1E A;  1IKM A;  4DK0 A;  5K36 G;  1UE5 A;  2Q8R E;  3T53 B;  4BY7 G;  2KBN A;  4RGN A;  1KRT A;  4A3K H;  2CH4 A;  5JAV A;  5D3I B;  4A3L G;  2R7F A;  3L9A X;  1CSP A;  2F0P A;  2JA6 H;  2K5V A;  2NN6 G;  4OXP A;  3GP7 A;  4CDD C;  1N32 L;  1XNR L;  4R4T A;  3S2D H;  3OIP A;  3K7A B;  3TZD A;  1DM0 B;  1BBX C;  3RD4 A;  5A2Q L;  1BKB A;  3VR5 A;  1WTQ A;  3BDO A;  2PQE A;  4HMI A;  5JEA G;  3PIO A;  4R4O A;  4CBV A;  1JIC A;  2ZTC A;  4QY7 A;  2OQK A;  4B3S Q;  3R2T A;  4S3S A;  1EQT A;  4JG2 A;  1B44 D;  4A93 H;  2BDO A;  3I70 A;  3I4N B;  1Q7Y C;  4DV2 L;  4JI1 L;  3HOY H;  1QUQ B;  3NK9 A;  5G3L F;  4DV1 L;  1KDA A;  3BYT B;  1JR0 D;  2LY7 A;  1P16 A;  1PH1 A;  4JI4 L;  2UUC Q;  2VUM G;  3SVM A;  3SK6 A;  3R3O A;  4JOI C;  4YY3 L;  4C56 C;  1G8Z D;  1Z47 A;  2JA9 A;  4DR5 L;  1XPR A;  4G7H C;  1TWC H;  4X3K A;  2B29 A;  3JAM i;  4O0A A;  2SNS A;  4YWK A;  2PZT A;  1BCP B;  2JA6 G;  4KJN A;  1AP0 A;  1PZK D;  3VYR A;  1O78 A;  3H6M A;  2TMP A;  4KLK A;  3VA7 A;  4WRD A;  2LXJ A;  4HSP A;  2D9U A;  4X66 Q;  1VQE A;  4U68 A;  2IPK D;  4DAV A;  1NY4 A;  3GTK H;  2A5H A;  4R4C A;  4FO2 A;  1HXY D;  2NBF A;  1XYI A;  1A8V A;  4O42 A;  1JWM D;  2EYM A;  1XMQ L;  4C1N I;  2N49 A;  1YJN A;  4B3M Q;  4Z9C B;  3A8I E;  2GN5 A;  4NW2 A;  2WAQ G;  3K0Y A;  3BG3 A;  2KQ3 A;  3S9W A;  3P1H A;  3ONA B;  2A69 C;  2FMC A;  1FR3 A;  5IT9 c;  4IFD H;  5LL6 X;  3D6W A;  3HFZ B;  4HIK A;  3T1Y Q;  4A93 G;  1Q8I A;  1E24 A;  1L1O A;  4LFB Q;  1I4X A;  2MO1 A;  2UUA Q;  3M7N A;  1IL8 A;  1HUN A;  1PXU A;  1LT5 D;  3K7A H;  1Y8P B;  3HOY G;  2SDF A;  3UE0 A;  1HNZ L;  1UUP A;  4ZUJ A;  1JMC A;  4QIW B;  1A6X A;  1JWU D;  5TSS A;  2FHT A;  2KEC A;  1T5X D;  3TP7 A;  1WOC A;  1HCZ A;  1DOM A;  3NTH A;  3OHX C;  1LTR D;  5CBE E;  5DM6 3;  5BR8 Q;  1S4Z A;  4KI0 A;  3KBX A;  1TS2 A;  1TWF B;  1BCP C;  5CC4 A;  3K57 A;  2Q2H A;  3I4N H;  4BS9 A;  2KJX A;  1Y1W B;  4A3B B;  1M4V A;  1CSQ A;  1PA6 A;  2GA4 B;  2MFI A;  3EFX D;  2B2V C;  4N8F A;  2A1A A;  4YWM A;  4AIM A;  1G29 1;  4N8X 1;  3EBE A;  5D3D A;  1P8L A;  3DEP A;  1TXY A;  1RD9 D;  3U9S A;  1F9S A;  4IUQ A;  3G6J B;  4LF9 Q;  3S14 B;  3PO2 B;  1X3G A;  4PQX A;  1I50 B;  3HGB A;  3SGI A;  4O1N A;  3MFG A;  1XNQ L;  3STB D;  4JI2 L;  4KKU A;  1NJI C;  5C3X A;  1OXT A;  1LAB A;  5EQ0 A;  4IFD G;  4OIK A;  3VR6 A;  4P2C B;  2XIW A;  3E0J A;  2B2W A;  4OEL B;  1RDP D;  1RF2 D;  4OON A;  3QO2 A;  3TEH B;  4KHP Q;  4X6A H;  1L2F A;  4LF6 Q;  2G5D A;  5CV9 A;  1T9H A;  2WV6 D;  5EKI A;  2N78 A;  3NUC A;  1AH9 A;  5F2D A;  4YCU A;  4DNT B;  1VQA A;  3ERO A;  1NAP A;  2NWG A;  2E2I B;  1J9O A;  5K5P A;  1VQI A;  1A2U A;  2F0J A;  1HQR D;  2ASB A;  1R4Q B;  2KCM A;  3S17 B;  4XYQ A;  3M9B A;  4DR7 L;  2F3V A;  1IBK L;  1CUK A;  2HIX A;  3A55 A;  3I4N G;  3PV0 A;  1H9S A;  3KLS A;  1EY0 A;  2PI2 E;  2MP1 A;  1A15 A;  3PF5 A;  1R9T B;  4B9W A;  3J80 E;  1XJV A;  4M8A A;  3VYU A;  1A3T A;  4IJL A;  1VF7 A;  4FF3 A;  3EJI A;  4ZLT F;  1SRO A;  2IL8 A;  1ZYR D;  4K6D A;  5IYC H;  4FP5 D;  1TWF H;  1N34 Q;  2HCI A;  4JI1 Q;  4DR4 L;  3A74 A;  1TQO A;  3A5Z B;  3MXG A;  1Y1W H;  4OO1 I;  2PO4 A;  5ELF A;  4A3B H;  3CU7 A;  2B2U C;  1VQK A;  1V43 A;  2HUG A;  1KAW A;  1ESR A;  1PH8 A;  3BS1 A;  5IGE A;  4GOP B;  4JI0 Q;  4JI7 L;  4KJO A;  4DR2 L;  3VDY A;  1DCZ A;  2PQA A;  4YY3 Q;  4DR5 Q;  2G9D A;  2QF7 A;  1QNU A;  1G2S A;  1KLG D;  3PO2 H;  3S14 H;  1SE8 A;  3HOZ B;  5I9P A;  1I50 H;  4JBK A;  2EJG C;  2KED A;  2I5L X;  1K8G A;  2D5D A;  1CQF A;  1CZW A;  2SEB D;  3SK8 A;  1NUC A;  5CYU A;  1K8M A;  1ICW A;  4AYB E;  2VQF L;  1ET6 A;  3RNU A;  1BBW A;  1SYC A;  1CKO A;  3TQY A;  4IO9 A;  1OO9 B;  3S16 B;  1KNE A;  3QIA A;  4RH6 A;  1CA5 A;  4R8N A;  3IFD A;  1SNQ A;  3K5N A;  1W3S A;  4LFC L;  5FLX c;  1XMQ Q;  3KBG A;  3SHL A;  4CKB A;  2JE6 I;  4GNX A;  1GXD C;  2K75 A;  4RGT A;  3W1B A;  2E2I H;  2EY5 A;  5D65 A;  1QOH A;  2K5H A;  2Y0S B;  1L1O B;  4TRD A;  3FPU B;  5IYC G;  3S17 H;  1K3B C;  3JAM L;  4FF4 A;  1DXM A;  2ID0 A;  4EX5 A;  4JI8 L;  5LMU L;  2E2H B;  1S5B D;  1CKN B;  1Y1W G;  1EFW A;  4DV4 L;  4A3B G;  2F1M A;  2C9O A;  4GOP C;  1R9T H;  1DGS A;  3HRZ C;  2IW3 A;  2Z6B A;  3OW7 A;  2Q2I A;  2F0N A;  3K6O A;  2NVX H;  4R4I A;  3PO2 G;  3PUZ A;  1UEB A;  1VQP A;  1RIP A;  1ILP A;  2ENB A;  2P5Z X;  2R7D A;  3CHB D;  3DM3 A;  4LFA L;  4DAM A;  5FK9 C;  1STA A;  3AFQ A;  1GKH A;  1VQM A;  2LKV A;  1RTO A;  2B8G A;  3T13 A;  1IXR A;  2DNE A;  2EY6 A;  1U9R A;  4IUP A;  4F88 A;  3T51 B;  3OSO A;  3RZD H;  4GN5 A;  3KLS X;  1A3U A;  1PH2 A;  1V1P B;  1U4R A;  3HOZ H;  3I90 A;  1QVG A;  2UXD L;  2G9H D;  4JI2 Q;  4EQP A;  3TP6 A;  1LTA D;  2GVA A;  2AUK A;  4CKC A;  1NNX A;  1HZA A;  1Y1V G;  2V4D A;  1VQ5 A;  5I2X A;  3F2U A;  1STG A;  1CM9 A;  3S16 H;  2DUD A;  5ELC A;  1M1K C;  4IOA A;  4TQU S;  5BN3 A;  3I55 A;  3MXN A;  1O7L A;  1SDF A;  1IBM L;  3IFT A;  1U4L A;  4HCS A;  2JN4 A;  3KDF A;  4DR1 L;  1GM5 A;  2B2T C;  2WB1 B;  3J81 E;  4POG A;  2B2Y C;  2E74 C;  1JT8 A;  2JK8 A;  1ZKO A;  4DUY L;  1C4Q A;  1N33 L;  2C5C A;  1KTK A;  1Q82 C;  2EJF C;  1MBY A;  4WFN 3;  4DR7 Q;  4ZQ3 A;  4HAE A;  1H9S B;  1H9J A;  2NZ1 D;  4X62 L;  2NTT A;  2E2H H;  5HY6 A;  1HPC A;  4JOI A;  2FMM A;  3R2I A;  2YV5 A;  2RBM A;  4ME3 A;  1SE4 A;  1HZ9 A;  4LAA A;  2VXW A;  5IGF A;  1WTP A;  4CJ2 C;  2Q2U A;  4UP8 A;  3J7Y W;  1MJC A;  3OYY A;  1Y8O B;  3A0J A;  1HR0 L;  1EIG A;  4BY1 B;  5IGC A;  1LYL A;  3QOJ A;  3HOZ G;  1TY0 A;  2UXB L;  2QDB A;  2K33 A;  1X3E A;  4L63 B;  1J5E L;  2AUJ D;  2B2W C;  1D2B A;  1QCB D;  2AQ3 B;  3CW2 C;  1EY7 A;  2MUY A;  4EVO A;  4X64 L;  3K5M A;  1I94 Q;  4A3I B;  3HOU B;  1NSN S;  4UP7 A;  4XDX A;  3UDX A;  2PQA B;  1K83 B;  2M00 A;  4DR2 Q;  2XVS A;  1SE3 A;  4QB4 A;  2R93 B;  3FVQ A;  4AH6 A;  1GOZ A;  3I4M B;  2CW0 D;  1IKL A;  3K81 C;  1VQC A;  1K8A C;  5FLM H;  3PCO B;  4HJ8 A;  1SJH D;  2B39 A;  2PI2 A;  2VQF Q;  1IHZ A;  1PDQ A;  1S40 A;  1YNX A;  1WTH A;  2Y0S G;  1QUQ A;  3ULJ A;  5E4W C;  2EYF A;  3QJY A;  5CV4 A;  1HZB A;  1HH2 P;  2HIV A;  2JA8 B;  4G7O C;  3HOV B;  4ZYS A;  2H1E A;  3W2D A;  1F77 A;  2NVT B;  5IT9 L;  5ELO A;  2ZJP A;  2DGY A;  4RMF A;  1HRJ A;  4PNY A;  3X3N A;  4QF4 A;  4B08 A;  1I4H A;  1PFM A;  1UE1 A;  5I9O A;  4F7X A;  5JJK A;  1UAP A;  5CGK A;  3STB C;  1BVS A;  3NEN A;  4OO1 H;  4X66 L;  2VS1 A;  4IJH A;  1TII D;  2MNA A;  4J8Q A;  2K5W A;  3TSS A;  1SNP A;  1L0W A;  1H9R A;  2RSO A;  4K0K Q;  5LMU Q;  4NPS A;  1EY5 A;  2B2V A;  3MZ5 A;  1H9K A;  4H0L C;  3CCR A;  2OTL A;  1EIY B;  3DWQ A;  1NMG A;  1NMF A;  1RHP A;  3GTJ B;  5EAY A;  1MD2 D;  1SYE A;  3R8B A;  1F9Q A;  4B3M L;  4DV7 L;  3K0X A;  3LX0 A;  1FL0 A;  1HQM C;  3D0F A;  1X9N A;  1I3Q B;  1KLU D;  3T1Y L;  4BY1 H;  3W5O A;  5FLM G;  2L1B A;  2E75 C;  1VMC A;  5FJ8 H;  2KVM A;  2I07 B;  4A3G B;  1SFO B;  4GS3 A;  2Q8I B;  2ZT9 C;  2PW7 A;  1FVI A;  2ES2 A;  3GTL B;  3HOU H;  3D4R A;  4NXN L;  3S1N B;  1K83 H;  3DWP A;  1AN8 A;  1VQF A;  3HEJ A;  3T16 A;  2R93 H;  2YYZ A;  1S5E D;  4B3T L;  1WD1 A;  1XX8 A;  1I4Q A;  3I4M H;  2EDG A;  5M5X B;  1H95 A;  1B9N A;  2CCZ A;  5T1I A;  1KXL A;  5KRU A;  2UXD Q;  3EN2 A;  1ZYR C;  4N9T A;  2WB1 G;  4K8J A;  5C0X I;  3ICE A;  3NE5 B;  1PRT D;  4DV0 L;  4ZKB B;  4OO1 G;  1AE2 A;  2L55 A;  1BO0 A;  1FNV A;  4DK1 A;  3KUP A;  5A35 A;  4IPG A;  3BVM A;  2BA0 A;  4U67 3;  2JA8 H;  3HOV H;  1LO5 D;  3M85 A;  2VB3 X;  3KDF B;  1Z6H A;  1IBM Q;  2NVT H;  4GKJ Q;  4DR1 Q;  3PO3 B;  1EWI A;  2K6A A;  4OWW B;  2KHS A;  3P20 A;  4LUV A;  1EL0 A;  4DUY Q;  1N33 Q;  3LWE A;  3S1R B;  5M5Y B;  1CKM A;  2EZV A;  3A56 A;  4BY1 G;  4C2M H;  1ET9 A;  1YVC A;  2B2U A;  2CWA A;  5FJ8 G;  4KHP L;  1Q3L A;  3F8T A;  4LF6 L;  4X62 Q;  4NMZ A;  4JW0 A;  1ROD A;  2EY2 A;  1QB5 D;  1K8O A;  2PNR C;  4DR6 Q;  4KN4 C;  4A3I G;  2EQS A;  1VQ6 A;  3GTJ H;  3HOU G;  3MXU A;  2F0W A;  4FF1 A;  1EOT A;  4XXE A;  2EPB A;  1TWA B;  4IQZ A;  3RMH A;  2R93 G;  4IPH A;  3EQL C;  1F9R A;  1X3F A;  5IYD H;  3I4M G;  1HR0 Q;  1I3Q H;  1GJX A;  1LTB D;  1E1O A;  4JI3 Q;  2PZW A;  2UXB Q;  1YNJ D;  2ZM6 L;  4C3H B;  1J5E Q;  4RA8 A;  3HP3 A;  3SEB A;  4GLX A;  4A3G H;  4X64 Q;  1PYB A;  2XNA C;  1SFO H;  2K5Q A;  5C44 B;  2ZTE A;  4I7Z C;  4X3T A;  5CR3 A;  3GTL H;  4PMC A;  2CQO A;  5E1F A;  2YTY A;  2B3G A;  1G6P A;  3S1N H;  4DF7 A;  1I6H B;  1NR4 A;  3HOV G;  1LLR D;  1CHP D;  3HG9 A; 
#chains in the Genus database with same CATH homology
 4X6A H;  3PSI A;  1L2F A;  4PZ6 A;  2GVB A;  2HHH Q;  4LF6 Q;  4GKK L;  5M5X H;  1T9H A;  3FKI G;  4GLV B;  4A76 A;  1Q12 A;  2N78 A;  3JC6 6;  5M5W H;  3AYH B;  2HT1 A;  1B70 B;  1N34 L;  2UU9 L;  3S1M H;  1AH9 A;  3OTO L;  4C3I H;  1VS0 A;  4YCU A;  4LF8 L;  1VQA A;  2IHE A;  4B3R L;  1JJC B;  2UXC Q;  1K9M C;  1X65 A;  5C3E G;  2IT1 A;  2RCN A;  3RLN A;  1VQI A;  5IP7 G;  3PUX A;  4UP9 A;  2ASB A;  1KIX A;  4Y52 H;  1PH3 A;  1SRU A;  2KCM A;  4JI0 L;  3OW2 A;  2VY3 A;  4DR3 Q;  3H3V H;  3M9B A;  2D62 A;  4IOC A;  4GOP A;  4DR7 L;  1IBK L;  1CUK A;  3CCS A;  2UUB Q;  1OXU A;  4APV A;  2HIX A;  4HIO A;  2LXK A;  1IBL Q;  2C35 B;  2R7Z H;  3I4N G;  4H02 A;  1WCM H;  3PV0 A;  3PO3 H;  4A3K G;  1XNQ Q;  1FGU A;  1UE6 A;  2JQO A;  2PI2 E;  1N36 Q;  3PF5 A;  3PUV A;  2E5L L;  1L1O C;  2B63 H;  1XJV A;  4IPC A;  3E0E A;  3CC7 A;  1NE3 A;  5IYD G;  2VQE Q;  3NBH B;  3S1R H;  4RG1 A;  4XIG S;  5M5Y H;  5M3F G;  1VQ7 A;  3GTM H;  4IJL A;  3AFP A;  4JI6 L;  2R92 H;  3L0O A;  1SRO A;  4L5T A;  3E9I A;  2K50 A;  2YTV A;  4GN4 B;  5IYC H;  3BZK A;  3G6E A;  4GKK Q;  1U0L A;  3HOX G;  2ALY B;  3W1G A;  1MJE A;  1TWF H;  1YHA A;  1N34 Q;  2UU9 Q;  1E22 A;  3OTO Q;  2JA7 H;  4QQB X;  4JI1 Q;  4DR4 L;  4A3D G;  3A74 A;  3A5Z B;  2ZJQ A;  4B3R Q;  4JV5 L;  1Y1W H;  4TVA B;  1QVF A;  1IZ6 A;  4OO1 I;  3L2P A;  4A3B H;  1NBW A;  1VQK A;  1MKH A;  1V43 A;  5IE8 A;  1KAW A;  4DV7 Q;  1UWV A;  1PH8 A;  4HJA A;  2IY5 B;  2K14 A;  2EIF A;  1EIF A;  3G71 A;  2I5H A;  4GOP B;  1J6Q A;  4HJ7 A;  1TWA H;  3S24 A;  4JI0 Q;  2JJQ A;  4JI7 L;  3J81 j;  3VDY A;  4DR2 L;  1YIJ A;  2PQA A;  4YY3 Q;  4P74 A;  1IBK Q;  1OTC A;  4HJ9 A;  4DR5 Q;  3PF4 A;  4BA2 I;  3FHW A;  1E1T A;  4LW1 A;  3PO2 H;  3S14 H;  3CPW A;  1SE8 A;  2F52 A;  4C3H H;  1I50 H;  3M4P A;  5GAD C;  3U58 A;  4JBK A;  3K80 C;  2HQL A;  4PMW A;  2I5L X;  1K8G A;  2E5L Q;  1HNW L;  3ULP A;  3CME A;  1CKN A;  1WI5 A;  3KJO A;  1VQ8 A;  5H1S E;  1AE3 A;  1YZ6 A;  5C44 H;  1VQ9 A;  4NXM Q;  1MIU A;  3TS2 A;  3ZJY C;  3M3Y H;  5GQO A;  4AYB E;  2VQF L;  2BA1 A;  3RNU A;  4NXN Q;  2IX1 A;  1BBW A;  1CKO A;  3TQY A;  4IO9 A;  4JC0 A;  1I6H H;  1WYD A;  4B3T Q;  5JJI A;  4P71 A;  2CWP A;  2R7Z G;  4YHH L;  1C9O A;  1W3S A;  1K3R A;  1WCM G;  1JE5 A;  4MTN A;  3PO3 G;  1S72 A;  3KYH C;  4LFC L;  2AMC B;  5FLX c;  4DK6 C;  3HOW H;  4DR4 Q;  5IP9 H;  1XMQ Q;  3J81 i;  3CPF A;  1SLJ A;  3RLO A;  2B63 G;  3CQZ H;  2JE6 I;  4GNX A;  3E9H A;  3CC4 A;  2WP8 J;  2K75 A;  3HKZ E;  3W1B A;  4DV0 Q;  3PUW A;  5IYB G;  4HIM A;  1YJ9 A;  1HNX Q;  2E2I H;  4LF7 Q;  1IYJ B;  2K5H A;  1L1O B;  1Q81 C;  4DKA C;  1X55 A;  4JI5 Q;  5IYC G;  4JI7 Q;  2R92 G;  1A63 A;  3J80 c;  4B3S L;  3S17 H;  1U5K A;  4JBW A;  1EUJ A;  3U50 C;  3S2H H;  1A62 A;  1KRS A;  2ID0 A;  2JA7 G;  4EX5 A;  4JI8 L;  5LMU L;  1D8L A;  2VZA A;  1CKN B;  2PMZ E;  2VW9 A;  1XPU A;  1Y1W G;  1VQJ A;  1EFW A;  4DV4 L;  4L5Q A;  4A3B G;  4IFD I;  1HNW Q;  1C0A A;  1KC8 C;  3LGJ A;  4HID A;  4GOP C;  1YIT A;  1R9T H;  1M90 C;  1VQN A;  2N3S A;  1DGS A;  5GAH C;  4WJ3 M;  2QGQ A;  4OWX B;  3F1Z A;  2JA8 G;  1PFS A;  2Y0S E;  1YJW A;  1HR0 W;  2E2J H;  2Q2I A;  1VQH A;  3NEL A;  2UUC L;  2VL6 A;  4L5R C;  4YCW A;  1BBU A;  4HJ5 A;  2JEA I;  2NVX H;  3PO2 G;  4R4I A;  2QEX A;  3AEV A;  2RF4 A;  4PZ8 A;  3GDE A;  1Q8K A;  4UPA A;  1VQB A;  3K8A A;  3PUZ A;  4LFC Q;  1UEB A;  1VQP A;  1RIP A;  2OTJ A;  3KJP A;  4JYA L;  2R7D A;  3DM3 A;  5M3M H;  4GNX B;  4LFA L;  2BH2 A;  4LF4 L;  5C44 G;  4DAM A;  5GAG C;  4L5S A;  1YI2 A;  2NZH A;  4LWC A;  3AFQ A;  4QGU A;  2F4V L;  1GKH A;  1OXX K;  1VQM A;  3J7A 5;  4LNQ A;  4A3M H;  1IXR A;  2JA5 G;  3S15 H;  5J3B A;  4FDB A;  2BH8 A;  3RZD H;  1SN8 A;  4LUZ A;  4GN5 A;  4BBR H;  2I5M X;  1V1Q A;  3GTO H;  3BZC A;  3DLL A;  3H0G H;  3J7Z C;  1PH2 A;  1FJG Q;  4A4I A;  3GTP H;  2ZM6 Q;  4JI8 Q;  2K4K A;  3HOW G;  3UDF A;  2VNU D;  5IP9 G;  3HOZ H;  1QVG A;  2UXD L;  4DV4 Q;  4JI2 Q;  1HJP A;  1EQR A;  3CCL A;  4AQY L;  3ULL A;  2GVA A;  4A3J H;  1HZA A;  1Y1V G;  4MZ9 A;  4DPG A;  4LF5 L;  3F2D A;  2NZO A;  1VQ5 A;  1PV4 A;  4X65 L;  1G51 A;  4OWT B;  1NTG A;  5IWA L;  3S16 H;  3CC2 A;  1JB7 A;  2DUD A;  4A3E H;  4LFB L;  4DAY B;  1M1K C;  4BBS H;  4IOA A;  4TQU S;  1OXV A;  3RR5 A;  4P73 A;  3I55 A;  3UDI A;  1IBM L;  2UUA L;  4JYA Q;  4LFA Q;  3UE1 A;  4A3G G;  3KDF A;  4DR1 L;  1B8A A;  1GM5 A;  2F3I A;  3U4V A;  4LF4 Q;  5C0X J;  4LF8 Q;  4XTC S;  2KCT A;  3MEF A;  4YWL A;  2F4V Q;  4BY7 H;  4POG A;  5C4X G;  1JT8 A;  1I94 L;  4A3I H;  4A3L H;  2JK8 A;  3JAM c;  3T1H L;  3NEM A;  3S1Q H;  4DUY L;  4J15 A;  1E3P A;  1N33 L;  1Q82 C;  2L15 A;  1XMO L;  2OWO A;  1YEZ A;  1Y14 B;  3UDG A;  4DR7 Q;  4DV3 L;  1N9W A;  2NVQ H;  4GNX C;  1GO3 E;  5DLQ E;  3GO5 A;  5BR8 L;  3ERS X;  1KQS A;  1O7I A;  2Z6K A;  3RZO H;  5GAE C;  1QZG A;  4X62 L;  1JJ2 A;  5M3M G;  2E2H H;  3I2Z A;  2XTI A;  5HY6 A;  1X56 A;  3BU2 A;  4AQY Q;  2I0Q A;  5GRO A;  3CD6 A;  4JOI A;  1TWG H;  4AYB G;  3TRE A;  2WB1 E;  4A3M G;  3H3V I;  3PIP A;  2YV5 A;  4P72 A;  4ALP A;  4ME3 A;  4LF5 Q;  1LM0 A;  1HZ9 A;  1RL2 A;  3AQQ A;  3K7U C;  2H5X A;  5AJ3 L;  2WAQ E;  3GD7 A;  4BBR G;  5C0X G;  2Q2U A;  4JI6 Q;  4UP8 A;  3H0G G;  1EQQ A;  2AWN A;  1MJC A;  3OYY A;  3A0J A;  1HR0 L;  2LSS A;  2CFM A;  3MXN B;  4BXX H;  1E7Z A;  1LYL A;  1YHB A;  4LUO A;  3CCU A;  3HOZ G;  2UXB L;  3G4S A;  4LF9 L;  1A0I A;  3CP0 A;  1X3E A;  1J5E L;  1ASZ A;  4R4Q A;  4JV5 Q;  4PZ7 A;  3CW2 C;  3HKZ G;  4A3J G;  4X64 L;  1YBY A;  1PYS B;  1VQD A;  3CMA A;  1I94 Q;  3CCJ A;  1C7Y A;  1XTD A;  4P75 A;  1Q46 A;  1VCI A;  4UP7 A;  3UDX A;  2PQA B;  1XMO Q;  2IX0 A;  4OX9 L;  5LMN W;  4DR2 Q;  4DV3 Q;  3D31 A;  4A3E G;  4BBS G;  2A8V A;  3A5U A;  4AH6 A;  2VUM H;  2QA4 A;  5IY0 A;  2AKW B;  3EIV A;  3K81 C;  2HHH L;  4A3F H;  1PH6 A;  4K0K L;  1VQC A;  1Q1E A;  2D0O A;  1K8A C;  5FLM H;  3PCO B;  1SR3 A;  5K36 G;  1UE5 A;  2K5N A;  3L7Z C;  1QZH A;  4BY7 G;  2KBN A;  4HJ8 A;  1KRT A;  4A3K H;  5E7N A;  4A3L G;  1K0R A;  2R7F A;  1CSP A;  2PI2 A;  2JA6 H;  2JEB I;  2VQF Q;  1S40 A;  1YNX A;  2Y0S G;  2K5V A;  1QUQ A;  1WFQ A;  2NN6 G;  3ULJ A;  3J81 c;  4OXP A;  4NB3 A;  1IL2 A;  1N32 L;  1HZB A;  1HH2 P;  2HIV A;  4O2D A;  3CXC A;  3FP9 A;  1Q1B A;  1XNR L;  4YHH Q;  2E8G A;  4R4T A;  3S2D H;  3I4O A;  2IHF A;  3H15 A;  5ELO A;  2ZJP A;  2DGY A;  4RMF A;  4DV6 L;  2XGT A;  3RLF A;  3GTG H;  4A3D H;  1UE1 A;  1BKB A;  5C4J H;  1VQ4 A;  1Q86 C;  5JJK A;  3WWV A;  5JEA G;  2Z0S A;  3PIO A;  3STB C;  1GVP A;  4R4O A;  4JBJ A;  1BVS A;  3NEN A;  2VQE L;  2ZTC A;  4QY7 A;  2OQK A;  2OQ0 A;  4R1J A;  4X66 L;  4B3S Q;  2OCE A;  2VS1 A;  4IJH A;  2MNA A;  4JG2 A;  1L0W A;  1X54 A;  4A93 H;  4K0K Q;  5LMU Q;  2EXD A;  3KOJ A;  4NPS A;  3CCR A;  2OTL A;  1KL9 A;  4A75 A;  1EIY B;  4JBM A;  1NMG A;  3F2C A;  4DUZ L;  1Q7Y C;  2RHQ B;  4DV2 L;  4JI1 L;  1NMF A;  4QJF A;  3HOY H;  1PH4 A;  1QUQ B;  5EAY A;  4B3M L;  1EOV A;  4DV1 L;  4DV7 L;  1V9P A;  3K0X A;  1EYG A;  3TRZ A;  2YU9 H;  2Z6K C;  1PHJ A;  1FL0 A;  4POF A;  1SMX A;  3D0F A;  1N32 Q;  1LTL A;  1P16 A;  1X9N A;  1PH1 A;  4JI4 L;  2UUC Q;  2VUM G;  1JJG A;  2PNH A;  4DV5 L;  1KHI A;  4KHZ A;  4JOI C;  4YY3 L;  3T1Y L;  4A3F G;  4BY1 H;  1XNR Q;  1Z47 A;  2JA9 A;  3W5O A;  3RN5 A;  4DR5 L;  3M4O H;  2MQH A;  5FLM G;  1XPR A;  5FJ8 H;  1TWC H;  3JAM i;  2B29 A;  4QL5 A;  4YCV A;  4O0A A;  1N8R C;  2K52 A;  1K73 C;  3B6Y A;  5HGQ A;  4DV6 Q;  4IPD A;  4GKJ L;  1UE7 A;  4YWK A;  4C3J H;  2JA6 G;  3Q8D A;  4GS3 A;  5ELN A;  1FVI A;  2ES2 A;  1B7Y B;  2KHI A;  4NXM L;  3G48 A;  3PGZ A;  3HOU H;  1XPO A;  4KLK A;  2ZJR A;  4NXN L;  2LXJ A;  5IYB H;  3CCQ A;  1K83 H;  3GTQ H;  4X66 Q;  2R6G A;  1VQE A;  5LMN L;  1VQF A;  2R93 H;  2YYZ A;  4B3T L;  1PH5 A;  3I4M H;  1NY4 A;  3KF6 A;  3RN2 A;  3GTK H;  3KFU A;  1H95 A;  2CCZ A;  3CCV A;  2ATW A;  2UXD Q;  1KXL A;  1I5F A;  4R4C A;  3BJU A;  3EN2 A;  4DUZ Q;  1A8V A;  4DV2 Q;  4A3C H;  2WB1 G;  1X6O A;  4WJ4 A;  1XMQ L;  3HKS A;  2N49 A;  4GN3 B;  1YJN A;  4B3M Q;  5C0X I;  4DV1 Q;  4DR6 L;  2GN5 A;  3ICE A;  2WAQ G;  2ZTD A;  1HNX L;  4DV0 L;  4LF7 L;  2WFW A;  4OO1 G;  4X65 Q;  1AE2 A;  5IT9 c;  4JI4 Q;  5IWA Q;  4IPG A;  3HFZ B;  2BA0 A;  4JI5 L;  4DV5 Q;  4HIK A;  5JJL A;  3T1Y Q;  4A93 G;  2JA8 H;  1W2B A;  3HOV H;  4DK3 C;  1E24 A;  1L1O A;  4LFB Q;  4JI3 L;  1S3O A;  3M85 A;  4MNO A;  2MO1 A;  3KDF B;  1ASY A;  1IBM Q;  2UUA Q;  3M7N A;  1TWH H;  3I7F A;  2NVT H;  4GKJ Q;  3KF8 B;  4DR1 Q;  1EWI A;  3FKI H;  3K7A H;  3HOY G;  3UE0 A;  1HNZ L;  4EQ5 A;  3M4Q A;  3CCE A;  1JMC A;  4OWW B;  3J80 i;  4LUV A;  2Q2T A;  3T1H Q;  1VQL A;  3CF5 A;  2YTX A;  2AWO A;  2NVY H;  2AHO B;  4DUY Q;  5C3E H;  2RHS B;  1N33 Q;  5IP7 H;  2JA5 H;  1CKM A;  1WOC A;  3IRB A;  3KF6 B;  5LMN Q;  2KEN A;  4BY1 G;  4C2M H;  1YVC A;  2CWA A;  1PH9 A;  5FJ8 G;  5BR8 Q;  4KI0 A;  4KHP L;  3F8T A;  4LF6 L;  4X62 Q;  5JEA J;  2A19 A;  4IFD J;  1VQO A;  4GLA C;  1HZC A;  2Q2H A;  3I4N H;  1LUZ A;  1QVC A;  2NN6 I;  4DR6 Q;  4A3I G;  2EQS A;  2N8N A;  3GTJ H;  1VQ6 A;  4QIW E;  3HOU G;  1CSQ A;  4JCV E;  2UXC L;  1PA6 A;  5AJ3 Q;  2MFI A;  1YHQ A;  1VQG A;  1Y1V H;  4YWM A;  2A1A A;  4PG3 A;  4AIM A;  1G29 1;  3EBE A;  2R93 G;  4IPH A;  5IYD H;  1P8L A;  1X3F A;  1GD7 A;  1TXY A;  1HR0 Q;  3I4M G;  2D0P A;  1I3Q H;  5M3F H;  4DR3 L;  4JI3 Q;  1E1O A;  1PVO A;  1WJJ A;  2UXB Q;  2UUB L;  1FJG L;  1KD1 C;  2MO0 A;  4LF9 Q;  2ZM6 L;  1X3G A;  1J5E Q;  4A3C G;  1IBL L;  2V1C C;  3HOX H;  3SGI A;  1HNZ Q;  1D7Q A;  4GLX A;  1XNQ L;  4A3G H;  4X64 Q;  1PYB A;  3STB D;  4JI2 L;  1SFO H;  2ZTE A;  4DNI A;  1N36 L;  4BA1 I;  1NJI C;  2CKZ B;  1OXT A;  3GTL H;  3CCM A;  4Y7N H;  2CQO A;  4IFD G;  3KLW A;  2KHJ A;  3U4Z A;  2YTY A;  5C4X H;  2B3G A;  3TS0 A;  1G6P A;  4OX9 Q;  3CAM A;  4UY8 C;  3S1N H;  1OXS C;  3ER0 A;  3HOV G;  1PH7 A;  4BXX G;  1Z9F A;  3PUY A;  3F2B A;  3I56 A;  2FXQ A;  4OON A;  3TEH B;  4KHP Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...