4QGUA

Protein domain complex with ssdna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
191
structure length
191
Chain Sequence
b'VLQKRPVIVKVLSTTKPFEYETPEMEKKIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIPCEEGDKLQLFCFRLRKKNQMSKLISEMHSFIQIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Gamma-interferon-inducible protein 16
publication title New insights into the structural basis of DNA recognition by HINa and HINb domains of IFI16.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 40
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02760 HIN HIN-200/IF120x domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qguA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qguA01
3FKIG 3K0XA 3PO2G 2VZAA 1YJ9A 4GS3A 3S1RH 2VS1A 5LMNQ 4GOPC 1Z9FA 3UE0A 5IWAL 4JI8L 2CWAA 1FGUA 1VQFA 1V1QA 3KLWA 4OO1G 3I4MG 1KL9A 1JJGA 1Q12A 1W3SA 1GD7A 1U5KA 2LSSA 1S3OA 5IYBH 1VQ5A 1SMXA 3CC2A 2IY5B 5LMNL 2LXKA 5IP7G 3KJOA 3J7ZC 2ZJPA 3PO3G 5IYDH 2I0QA 2JJQA 1Q81C 3JAMc 4A3JH 1RIPA 4DV5Q 1VCIA 2AHOB 3T1YQ 2B3GA 4JOIC 4LUVA 2E2HH 2VUMG 2KHJA 1FVIA 4AYBE 1KD1C 4JV5Q 1A63A 3U50C 1PH6A 2BA1A 3M4QA 5LMUL 4JBJA 4TQUS 3S2HH 3JC66 4JI2Q 1XPUA 3M3YH 2R93G 3K8AA 4LF5Q 5M3MH 4DV5L 4DV6Q 5IT9c 3T1YL 3CC7A 4UP7A 1PHJA 4QQBX 1L2FA 3M85A 1D8LA 4R4TA 4A93G 2AMCB 2BH8A 3KF8B 1VQDA 4JI2L 2JA6G 3S2DH 3A0JA 3TQYA 4LF5L 1HR0W 4LUZA 2IX1A 4GN3B 4DV6L 4R4IA 4OO1I 1GM5A 3ER0A 3CCLA 1TWHH 2ASBA 2Y0SE 3U4ZA 4KI0A 5AJ3L 2R7FA 3AFQA 1MKHA 4MNOA 1EIFA 4POFA 3PV0A 3U58A 1SRUA 4R4CA 5HGQA 4DR2Q 4OX9Q 3EBEA 3HOUH 1KIXA 5BR8Q 3GTQH 1K0RA 2WFWA 2NVQH 3MEFA 1EOVA 1T9HA 3G6EA 3HOZG 3AQQA 2KENA 4DR2L 1KRTA 1EFWA 2QA4A 1HNWQ 4A4IA 1YVCA 5BR8L 2HIVA 5ELNA 2YU9H 4IFDG 4GLVB 4AIMA 3OTOL 3PF4A 4KHPQ 3J81c 4JYAQ 3HOVG 3RNUA 3HOYG 3NELA 4JBWA 3RLNA 2GVAA 2ZTEA 3K7AH 2NVXH 1HNWL 4YCVA 1M90C 4DV0Q 1LUZA 2ZJQA 3RN2A 4JBKA 1N36Q 1U0LA 1WCMG 3HFZB 2BH2A 4B3SL 2VY3A 2ZJRA 2FXQA 1UE6A 4DV0L 1R9TH 3GTGH 3AYHB 1N36L 1K83H 1VQHA 2JA8H 4UY8C 3S15H 1G51A 4HIKA 4A3FH 3TRZA 3BJUA 4JI4Q 4LF6Q 2NZOA 4NXMQ 4JI6Q 2KCMA 3KDFB 3U4VA 2ES2A 4JC0A 1UEBA 4X65L 1IBMQ 1O7IA 2CKZB 1VQ4A 1E3PA 4BBRG 2AWOA 3GTPH 1YZ6A 2UXCQ 4LWCA 4LF6L 4NXML 3M9BA 1OXXK 4RMFA 2N3SA 3BZKA 3FP9A 1C9OA 4A3EG 2F4VQ 5M5WH 4P71A 5FJ8G 5ELOA 3W5OA 1VQ7A 3UDGA 2GVBA 3FKIH 2R92G 1PH3A 2LXJA 3CW2C 2JK8A 2JA7G 4A3GG 1H95A 1QZGA 3UDIA 5M5XH 4A3CG 1WJJA 2F4VL 1E1OA 2K52A 1OTCA 2D0PA 1VQOA 1ASZA 3I55A 1BKBA 1HZAA 3GTOH 3I4MH 4BBSG 5JJLA 4A3LH 2HT1A 3B6YA 3RR5A 3PUWA 3STBC 3PSIA 1BBUA 1PV4A 4UP8A 5IP9G 3HKZG 2MO1A 2EIFA 1VS0A 3NBHB 4IO9A 3ULPA 2K5VA 1FL0A 3DLLA 1X3EA 2VUMH 4O2DA 5M3FG 3ICEA 3PUVA 1N34Q 1JE5A 4APVA 3KYHC 2EXDA 2JA5G 1SROA 1JB7A 2RHSB 2R93H 1HNXQ 3GDEA 5C3EG 1HNZQ 1QUQB 4LF9Q 1VQPA 2V1CC 4DUYQ 1KHIA 2JE6I 1CSPA 3H0GG 1V43A 2E8GA 1Q1EA 1N9WA 4YWLA 1NJIC 1N34L 1K9MC 1QZHA 4R1JA 2UU9L 2K75A 2JA6H 2WB1E 1B70B 4X66Q 1HNXL 4PG3A 4HIMA 1L1OA 3G71A 1HNZL 1OXTA 4LF9L 4NXNQ 3CF5A 1Y1VG 4DR1Q 4DUYL 2VNUD 1YHQA 4YWMA 3KJPA 2ALYB 1SN8A 3A74A 3FHWA 3M4OH 4DR6L 3TS0A 2YYZA 5FLMH 5LMUQ 4BY7H 1VQGA 2OQKA 4X66L 4NXNL 4GNXA 4QIWE 2GN5A 3BZCA 4ALPA 4DR1L 3H3VI 1YHAA 4IPCA 1X55A 2OQ0A 4A3MH 1XPOA 3J7A5 2Z6KA 1KAWA 4GLXA 1VQBA 1HR0L 2Q2HA 2H5XA 3L2PA 3G4SA 1VQLA 5FLXc 2UUBQ 3RZOH 4HJ9A 3CAMA 1TWGH 1X6OA 2CFMA 1EQRA 4A3BG 4MZ9A 1C0AA 1P16A 4NPSA 4BY1G 5AJ3Q 2EQSA 2CCZA 2RCNA 2B63H 4OXPA 1G6PA 4YCUA 5JEAG 2UUBL 4L5TA 4GOPA 1KC8C 2R7ZH 2MQHA 3GTMH 2R7DA 3CD6A 5M5YH 4B3TQ 4QJFA 1QVCA 4PZ7A 1OXVA 1K8GA 1EYGA 5LMNW 3I4NG 3SGIA 1IBKL 5IYCH 4HJ5A 5H1SE 4UPAA 1RL2A 4DV1Q 4DR3Q 3KF6A 2PI2E 2CWPA 4QL5A 4Y7NH 3S1MH 2UUAQ 4B3TL 2ZTCA 4JOIA 3OTOQ 1IXRA 2OTLA 3S16H 3A5ZB 3W1BA 1NTGA 2IHEA 3ERSX 1YBYA 3CCUA 4JI7Q 5GAEC 4L5RC 3F8TA 4DV1L 4IFDJ 4DR3L 3GTKH 3NENA 1N32Q 1UE5A 3H15A 2UUAL 3D0FA 2MFIA 1AE3A 4QY7A 5IYDG 1K3RA 1E1TA 4HIDA 1PYSB 2ZM6Q 3CCSA 4B3MQ 4JI7L 4B3SQ 4A3JG 4JI3L 4A3IH 4DV3Q 1A8VA 4XTCS 3I7FA 1TWAH 1YI2A 3OYYA 4A3EH 2QEXA 1N32L 4GN4B 2A8VA 2UXDQ 4R4QA 3S1QH 3UE1A 4B3RL 1M1KC 3PIPA 3PUXA 3WWVA 2HQLA 3BU2A 1E7ZA 2ZM6L 2E5LL 4B3ML 2JA7H 5EAYA 2WAQE 4AH6A 4DV3L 4A3DG 2JA9A 1PFSA 4LF4L 2OTJA 1IZ6A 4YY3Q 1AE2A 1B7YB 2PMZE 4PZ8A 4X65Q 5C44G 3EN2A 2K5HA 3RN5A 2KCTA 4IOAA 1S40A 3J80i 2I5LX 4DAYB 4C3JH 3CMAA 5IP9H 3ZJYC 3L0OA 1SFOH 1JMCA 1KQSA 5C0XG 1BVSA 4YY3L 3H3VH 4P73A 4UP9A 4DKAC 1X3GA 5M3FH 4IFDI 4IPDA 4DPGA 2N49A 4C3IH 1TWCH 1K73C 4WJ3M 1MIUA 3CCQA 1PH2A 5C4XH 1VQNA 1JJ2A 2JA5H 1WYDA 3ULJA 4K0KQ 4LNQA 3HKSA 1D7QA 3HOUG 3CPWA 4C3HH 1XMOL 1ASYA 1CUKA 3PO2H 4DR7Q 2K50A 4LFCL 1C7YA 4RG1A 4A75A 2PQAB 3DM3A 4K0KL 2YTXA 4HJ8A 1PH5A 4X64Q 4JI5L 4LW1A 1CKMA 1VQKA 1SLJA 1Y1VH 1L0WA 2N78A 2Z0SA 3GTLH 2NN6G 2YV5A 4DR7L 5IP7H 1VQMA 3PO3H 4X62Q 2UXDL 5J3BA 4BXXG 3E0EA 4X64L 2K5NA 1YEZA 5C0XI 2E2IH 3CMEA 1I3QH 1NY4A 4OWXB 4GKKL 4A3KG 2ATWA 1UE7A 4X6AH 3G48A 4YHHL 1YNXA 4OWWB 5JJKA 2Q2TA 4KHZA 4X62L 2UU9Q 5GAGC 1A62A 3W1GA 2VQFQ 2A19A 3RLOA 3PUZA 1CKOA 1PVOA 4IOCA 2F3IA 1A0IA 2DUDA 1GVPA 1YJWA 3JAMi 1UWVA 4A3BH 4OWTB 2JA8G 4DR6Q 3HKZE 4BY1H 4A93H 1Y1WG 1VQCA 2AWNA 5GROA 1VQIA 2VQFL 4A76A 4YWKA 4TVAB 4DAMA 4GNXC 4A3FG 2D62A 3PF5A 4MTNA 3S1NH 5DLQE 5IY0A 2RHQB 1X3FA 1HZCA 2IT1A 2N8NA 2WB1G 3AEVA 3F2DA 3RLFA 2NZHA 2NN6I 4JI0Q 1BBWA 4JG2A 1XJVA 1HR0Q 2IX0A 1I5FA 5E7NA 3TREA 1KXLA 1DGSA 2IHFA 4KLKA 4LUOA 3F1ZA 3CCMA 4LFAL 1WI5A 2JQOA 1IBLQ 4JI0L 1TWFH 4DR4Q 1PH8A 4AYBG 3D31A 1HZ9A 2K4KA 1XPRA 2UUCQ 1TXYA 3HOZH 1S72A 1KRSA 1UE1A 2RF4A 4Y52H 4DV7Q 1MJEA 2DGYA 1X9NA 1IBLL 4A3LG 4DR4L 2OCEA 2XTIA 3UDXA 1YHBA 5JEAJ 2UUCL 4DK6C 3PGZA 1VQ6A 3HOVH 3HOXG 4LF8Q 3HOYH 2Q2IA 3HOWG 1IBKQ 1NE3A 2KBNA 1X56A 3S24A 5K36G 4C2MH 2VW9A 1B8AA 3GO5A 1E24A 4EX5A 1SR3A 3CXCA 4DV7L 1CKNB 3RZDH 4GKJQ 4DK3C 1VQ8A 4PMWA 3KFUA 1X54A 1EUJA 1WCMH 3UDFA 1LTLA 2Y0SG 4LF8L 2C35B 4L5QA 3J81i 1VQAA 1XMQQ 2ZTDA 3KDFA 4R4OA 4IPHA 1Q7YC 4A3DH 1XNRQ 3F2CA 3S17H 1HH2P 4JV5L 1GO3E 1LM0A 4GKJL 1PH4A 3IRBA 4DR5Q 5C44H 4JBMA 4JCVE 3I4OA 5HY6A 4DUZQ 4IJLA 1PH7A 3E9IA 4OONA 1XMQL 2E2JH 3LGJA 2HHHQ 3EIVA 4JI3Q 3CQZH 4HIOA 3OW2A 1XNRL 1X65A 5IE8A 4L5SA 1P8LA 1JJCB 1E22A 5IYBG 4DR5L 1I50H 1SE8A 4B3RQ 2JEBI 5FLMG 4BY7G 4BBRH 4DUZL 2B29A 1G291 2PQAA 2E5LQ 4IJHA 2CQOA 1WOCA 4QGUA 2HHHL 1FJGQ 3VDYA 4IPGA 4LF4Q 1L1OB 2L15A 2WP8J 3PUYA 5FJ8H 3PIOA 3TEHB 1JT8A 2R92H 4A3MG 2PI2A 4A3GH 4NB3A 5M3MG 3KOJA 2Q2UA 2K14A 1FJGL 4A3CH 1CSQA 4OX9L 4GNXB 3K7UC 2WAQG 5GQOA 4HJAA 4POGA 1WFQA 4BBSH 3GD7A 1N8RC 1QVGA 2B63G 3L7ZC 4H02A 3TS2A 5C0XJ 3J81j 1HJPA 1EWIA 4BXXH 3T1HQ 1QUQA 1VQJA 2R7ZG 2UXBQ 2NVYH 2BA0A 1XMOQ 5GAHC 5JJIA 4DV4Q 4KHPL 4A3KH 4GN5A 4LFCQ 4JYAL 1IYJB 2I5MX 1EIYB 4AQYQ 1OXUA 5IYCG 4WJ4A 1NMFA 3T1HL 2UXBL 4GOPB 5C3EH 1NBWA 4JI5Q 4PZ6A 4P74A 1LYLA 4O0AA 1J5EQ 1AH9A 3H0GH 3M7NA 4DV4L 3CCEA 1IL2A 2ID0A 2I5HA 3CP0A 1XTDA 3NEMA 4AQYL 3CCVA 2AKWB 3I56A 4DV2Q 1Y1WH 3S14H 3AFPA 2PNHA 3K80C 1I6HH 3CC4A 1N33Q 2D0OA 1MJCA 1J6QA 2F52A 1EQQA 2MO0A 2HIXA 1J5EL 3KF6B 1V9PA 3I2ZA 3A5UA 4P72A 4BA2I 4GKKQ 1Z47A 4DNIA 4YHHQ 2R6GA 1PA6A 4DV2L 4JI4L 2VQEQ 1Y14B 2YTVA 4HJ7A 4A3IG 4EQ5A 1N33L 3ULLA 4JI6L 2QGQA 2XGTA 3J80c 1IBML 2A1AA 4P75A 1Q1BA 4LF7Q 2KHIA 1Q86C 1L1OC 3CCRA 3Q8DA 4GLAC 3CCJA 1YITA 2MNAA 3STBD 2VQEL 1YIJA 1PYBA 1I94Q 1VQ9A 2UXCL 1PH9A 4ME3A 1Q82C 1HZBA 2VL6A 1CKNA 1XNQQ 2NVTH 1NMGA 1VQEA 1OXSC 3CPFA 1QVFA 5GADC 3E9HA 4LF7L 4YCWA 1Q8KA 2YTYA 3HOXH 3F2BA 1I94L 3HOWH 1GKHA 3MXNB 4JI1Q 1W2BA 3GTJH 4LFBQ 4XIGS 1XNQL 4LFAQ 2OWOA 1Q46A 2Z6KC 3K81C 4J15A 4FDBA 5C4XG 4BA1I 3I4NH 3PCOB 5IWAQ 4JI8Q 4JI1L 1YJNA 4LFBL 1K8AC 3M4PA 1PH1A 2JEAI 5C4JH
chains in the Genus database with same CATH superfamily
2E2HB 1YJ9A 4GS3A 3S1RH 3GV6A 1HHVA 1Z9FA 4JI8L 2EYHA 2XNAC 3KLWA 4OO1G 3I4MG 1MSGA 1Q12A 1U9RA 1U4LA 2LSSA 4J6HA 3R2IA 2RCFA 5LMNL 5DM73 2KEEA 1FNWA 3J7ZC 3PO3G 2B63B 2I0QA 1Q81C 3JAMc 1GOZA 4LUVA 4ZQ3A 2KHJA 1A63A 1M8AA 3U50C 1PH6A 2B2YA 3OWEB 2K5DA 2R93G 3M3YH 1LACA 5IODA 1GUWA 3CC7A 3J81E 1HPCA 3S1MB 2LFNA 2RDHA 2X69A 3VA7A 2GA4B 3A0JA 4R4IA 1L0XB 1TWHH 1RDPD 4M1UB 2YU9B 1WTRA 4POFA 3SDZA 1K28A 3HOUH 1TWAB 3MVVA 3FEWX 1GXDC 3S1QB 2NVQH 1EOVA 1T9HA 2SEBD 3OOCA 3MZ5A 2A69C 4RGOS 3QB3A 1I4QA 4AIMA 1R9TB 2NN6H 5ELFA 3GTGB 3PF4A 3MFYA 2XN9C 4JBWA 5CV8A 2GVAA 2ZTEA 4YCVA 5J39A 1LUZA 5EPKA 2BH2A 3HFZB 1ZEQX 2VY3A 2ZJRA 4H13C 1BQQT 1TS4A 2EJMA 3CKIB 2KHSA 5M5WB 1N36L 1G2SA 2F0SA 4B08A 4UY8C 4UDUC 2L12A 2RVLA 4N8X1 4PMCA 4G4KA 2BCOA 4JI6Q 3KDFB 2ES2A 4JW0A 4X65L 1AEXA 3I4MB 3C1FA 2CKZB 1PXUA 3PO3B 4RMFA 1C9OA 3X3NA 3K5MA 1VQ7A 1JB3A 4FF4A 3FKIH 1UUPA 3CW2C 2EY5A 2JA7G 3IAYA 2R93B 5NUCA 1OTCA 2B8GA 1VQOA 3I55A 1BKBA 1HZAA 2Q8IB 2HT1A 3B6YA 1NR2A 3RR5A 1CK1A 2EIFA 2KJXA 1PZKD 1ZYRD 1IHZA 3DLLA 5K36H 2VUMH 3TBIB 4IUVA 4C3IG 3ICEA 1K0SA 1H9MA 1Y8PB 4APVA 2EXDA 5FLXE 1SROA 1BCPD 2RHSB 2V4DA 1EZ6A 3R2TA 2H1EA 1JB7A 3GDEA 1HNZQ 2V1CC 3H0GG 1Q1EA 1NJIC 4R1JA 2K75A 1HNXL 4NXNQ 1SE3A 1Y1VG 2O5IC 3G6JB 2RA4A 5F2DA 1EWCA 4X66L 1WTXA 3H3VI 1K3BC 4I7AA 4E6IA 1X55A 2OQ0A 2DN8A 3D6CA 1VQBA 2WKCA 3D4RA 5KEEA 2BE5C 4N8FA 1TWGH 4A3BG 4MZ9A 1P16A 2XIWA 4L5TA 2MQHA 2R7DA 3JAML 4B3TQ 2EYLA 2FHTA 1Y8OB 4QF4A 1SSOA 5LMNW 2C9OA 5IYCH 1IBKL 4UPAA 2L1BA 4DR3Q 4QL5A 5ELCA 2RKSA 1TQOA 2OTLA 3W1BA 2B39A 3I8ZA 4JI7Q 3A8JE 5GAEC 2SNMA 4L5RC 2JA7B 1D5ZC 4IFDJ 3GTKH 3M4YA 5BN4A 3NUCA 3T4AC 2SOBA 4XTCS 3I7FA 1SNQA 3MC0B 1N32L 2NVYB 3UE1A 4C3IB 3PUXA 2ZM6L 2HQLA 4QMGA 5C4XB 3MXNA 3PIP3 4QUCA 2BDOA 2OTJA 2JA9A 5CBAE 4LF4L 1IZ6A 1DOLA 1E0BA 1LTID 4KTAA 4XQJA 2PMZE 4X65Q 4LAAA 2K5HA 2KCTA 3H0GB 3NE5B 4C3JH 3D4DA 5IP9H 4F7XA 5CV5A 3L0OA 1I4PA 3OMGA 4KD4A 1MSHA 1J8IA 1O80A 1Y1VB 1TWCH 1K73C 4WJ3M 1NNXA 5A2QE 2JA5H 1OO9B 1WYDA 3HKSA 3URYA 1H9JA 1XTCD 3HOUG 1I3QB 1LT3D 1CUKA 4ID6A 1KNEA 1C7YA 4RG1A 1KLGD 5IGCA 3RUZA 1PTOF 1X3PA 1ICWA 4X64Q 3GTLH 2N78A 3P20A 2NN6G 2YV5A 4A3BB 4HMIA 4IQZA 1VQMA 1Q3LA 4XT1B 2PNRC 3CU7A 5J3BA 4X62Q 1YEZA 2FINB 2QDLA 4GKKL 1EY8A 2N55A 3KLSX 3H3VC 3RLOA 1CKOA 4IOCA 2F3IA 1ESFA 2DUDA 1GVPA 3JAMi 4OWTB 3KBXA 2Z6BA 1VQCA 4OWWB 1EU4A 1VQIA 3Q0AA 2G5DA 1V8QA 4MTNA 5DM63 2AQ2B 1IW7C 2IT1A 3AEVA 3F2DA 4JI0Q 3V2TA 4X3TA 1PMRA 1MHWC 3FDTA 5E7NA 3Q24A 4KY6A 1PTOC 2EYJA 3F2UA 1H9RA 2A5HA 3F1ZA 4LFAL 1TWFH 2RBMA 4MN3A 4N9TA 2HCCA 2PPBC 3HOZH 1H9KA 3M3YB 1FD7D 2RF4A 2VB2X 4H7BA 4DV7Q 2DGYA 4IFDH 4DR4L 3I4LA 2XTIA 2UUCL 1YHBA 2NTTA 5E1FA 1B44D 1VQ6A 3NP8A 3HOVH 1B9MA 1IBKQ 1NE3A 1X56A 5K36G 2E2JB 3CQZB 4GKJQ 1TWHB 2RDFA 4PMWA 2ENBA 2Y0SG 5EPLA 1ILQA 1VQAA 3KK7A 1XMQQ 2EE1A 4JV5L 3S17H 1LM0A 3IRBA 4EQPA 4JBMA 2PCFB 2LMCB 3P7JA 5KGUA 2EOTA 5IGEA 1X65A 1IYUA 4L5SA 1JJCB 1E22A 2AUJD 1I50H 2JSOA 4KMUC 2B29A 1G291 4CDDC 4IJHA 4CKBA 4LF4Q 4FXKC 3T16A 3PUYA 5A35A 1S5ED 5FOBB 1F9SA 3G7LA 2HQEA 4L6TB 1J9OA 1D1KA 4NKLA 1QILA 1O7YA 2EY2A 3NBHA 2Q2UA 5CYUA 1FJGL 4B9WA 5C3EB 4ZKBB 2ZXOA 4HJAA 1EOTA 4POGA 2SNSA 3J7YW 3L7ZC 3OHXC 2AUKA 2UXBQ 3S14B 1V1PA 4CHTB 1PRTF 4GN5A 2EYFA 2F4IA 2I5MX 1EIYB 2OT2A 2M9VA 5IYCG 4WJ4A 4DK0A 3KLSA 4FNFA 2KCNA 4ZYSA 3QOLA 4P74A 1J5EQ 4DA2A 4DV4L 1IL2A 5LL6X 2X6GA 4CBVA 1Y1WH 2AKWB 3I56A 3AFPA 3K80C 2K01A 3S1NH 2F52A 4K14A 4GKKQ 2F0EA 4KJOA 4KY7A 3IFDA 1D2BA 5D3IB 2VQEQ 2YTVA 4HJ7A 3D8GA 2F0FA 1EY4A 3GTJB 5LHY1 3ITPA 2A1AA 1QNUA 1VMCA 1PZJD 2F0OA 1YITA 1I6VC 1LO5D 1VQ9A 1YIJA 1I94Q 2Y0SB 1EZ8A 3H91A 1NMGA 5GADC 1PRTC 1GUSA 3HOWH 3MHBA 1GKHA 3MXNB 4NDXA 1JCKB 4X3UA 3VR2A 2F0HA 4LFAQ 1Y69U 4BA1I 5IT9E 3PCOB 4JI1L 2PZUA 1DONA 5C5MA 4LFBL 3QO2A 3M4PA 2JEAI 5C4JH 2E2DC 3K6OA 2VS1A 4OIKA 4GOPC 3UE0A 5IWAL 1JJGA 1U5KA 1EY0A 1TWGB 5ISRA 1STEA 4A3JH 1RIPA 3T1YQ 3I90A 4JV5Q 1FVIA 2R3ZA 1SMYC 5CV6A 4JBJA 4RHRA 3S2HH 5KNDA 2J4XA 3K8AA 5M3MH 4DV6Q 1LT4D 4UP7A 2A73B 1L2FA 1D8LA 3GTQB 3FPPA 1SEBD 2AMCB 2BH8A 1QJOA 4LUZA 2IX1A 3OSOA 1STBA 2B2UA 3MFGA 3R93A 5AJ3L 2R7FA 1EIFA 1SRUA 4R4CA 4KV6A 3BVMA 3U9SA 4DR2Q 3K5OA 3I3CA 3K7AB 5BR8Q 2SDFA 1S5CD 2WFWA 4X3SA 3HOZG 3AQQA 2KQ3A 1EFWA 3CRLC 1YVCA 1ENAA 3O13A 2HIVA 5ELNA 4IFDG 3OTOL 1HRJA 2JA8B 3HOVG 3T13A 3E6ZX 3RNUA 3S15B 5FO8B 2WACA 3RLNA 4KK7A 4A3FB 4J8QA 1TS3A 1GHJA 1IYVA 4DV0Q 2WB1B 3SK8A 3RN2A 3WOFA 1U0LA 1TWCB 1O7LA 1SE2A 1E2ZA 4H44C 1CA5A 3AYHB 2A68D 1VQHA 1G51A 4XQNA 3OW7A 2K5WA 3BJUA 3J81L 4LF6Q 2NZOA 1LLRD 2KCMA 3KUPA 4JC0A 3GTOB 1BCPF 4I7ZC 4OL7A 2AWOA 3GTPH 1YZ6A 1QE6A 1I4HA 1YNND 4TRDA 2RDGA 2N3SA 4A3EG 1CTMA 2KUMA 4HSPA 4P71A 1RTOA 3QG1A 1KTKA 3Q22A 1H95A 4K2KA 3UDIA 5M5XH 1JWSD 4CDCC 1WJJA 1E1OA 3FRPB 1D5MC 5JJLA 3SK5A 2F0DA 4A3LH 2E76C 3STBC 1VF7A 3PSIA 4UP8A 1KDBA 3DWAA 4DNTB 1VS0A 2M2LA 3NBHB 1CI3M 3MAQA 4O2DA 5M3FG 4R8NA 3PUVA 1A3UA 1TS2A 1N34Q 4RGNA 4ULLA 1S4ZA 1S5DD 1PDQA 1KHIA 1ONLA 1A3VA 1AZPA 1V1PB 1T5XD 3SE0A 3HGBA 1BCPC 1K9MC 3OIPA 4CDFC 1TWFB 2JA6H 1KDCA 4G57A 5EQ0A 2HCIA 3G71A 1HNZL 3HOZB 3CF5A 4DR1Q 1HXYD 2RQXA 1B2TA 1YHQA 5BN3A 2YYZA 1VQGA 1CT1D 1F2YA 3HOVB 4NXNL 4QIWE 3NWTA 2B2WC 3NQIA 1RF2D 4A3MH 3J7A5 1KAWA 2A74C 4GLXA 1HR0L 1HQMC 1VQLA 2UUBQ 3RZOH 1HTLD 4JVZA 4HJ9A 3CAMA 1LTGD 1EQRA 3S17B 5AJ3Q 2EQSA 5DNFA 4YCUA 4GOPA 1KC8C 2Z1CA 2R7ZH 3GTMH 3CD6A 1A3TA 2KVMA 5M5YH 1QVCA 1OXVA 3MWYW 3Q23A 3QJYA 5H1SE 4DV1Q 5I6WA 3DWPA 2CWPA 4Y7NH 5FLXL 4A3EB 4B3TL 3BDOA 3OTOQ 1GJXA 4KN4C 3S16H 1NTGA 1YBYA 4RA8A 3UI2A 4V190 3F8TA 4FF3A 4IN3A 1GUTA 2WKDA 3IL8A 4DR3L 2CW0D 4K6DA 3H15A 1AE3A 5COYA 1JOKA 1PYSB 4JI7L 4A3JG 1CQVA 4A3IH 2HDLA 3RD4A 5C4ZA 2EYOA 4GN4B 2NB0A 1ZXTA 5M3FB 2KOLA 3N52A 3PIPA 3BU2A 1E7ZA 1RCVD 3IKJA 2E75C 5HURA 4PZ8A 5C44G 3EN2A 2MPMA 4IOAA 1S40A 2BOSA 4DFAA 5HGTA 1SFOH 1JMCA 1BVSA 1EYCA 4IFDI 1W6KA 4IPDA 1PTOB 2N49A 3BYYB 3S1NB 1MIUA 3CCQA 1PH2A 1JJ2A 3SVMA 4K0KQ 4ZLTF 1D7QA 1Y8NB 3CPWA 4C3HH 1XMOL 1D1IA 2E2IB 1F9QA 3OMCA 2NWGA 2CH4W 4L63B 2PQAB 3GV3A 1HUMA 2YTXA 1ML0D 4WFN3 1WD0A 1SLJA 1L0WA 3ND9A 1YNJC 4BXXG 3E0EA 4RGTA 4KKSA 4X64L 5FKAC 5KNBA 3VR4A 1NY4A 5I4DA 5J1ZA 3A54A 1RKNA 1MGSA 5KIXA 4X6AH 3G48A 4YHHL 1YNXA 3LWEA 4KHZA 4X62L 3W1GA 2A19A 1JQYD 1ZKOA 3PUZA 1STAA 4ME5A 5D65A 1UWVA 5C4JB 3HKZE 4BY1H 4A93H 4IUQA 4GNXC 3V05A 1BOSA 5IY0A 2RHQB 1X3FA 2N8NA 2KA7A 3RLFA 2QEJC 4JG2A 1XJVA 1HR0Q 1TY2A 3VR6A 4KLKA 4A3JB 4HR7B 1WI5A 1IBLQ 4JI0L 1AZQA 3D31A 1SYGA 2I46A 3QOJA 1S72A 1KRSA 1LTAD 4KHVA 1UE1A 2XWJB 1MJEA 4A3LG 1SBBB 4Q0FA 3UDXA 5JEAJ 5C44B 3S9WA 4DK6C 3PGZA 2Q2IA 4NW2A 3DUZA 1SXTA 4C2MH 1E24A 2B2VC 4DV7L 3RZDH 3KFUA 1X54A 1EUJA 1F2MA 4WORA 3NHHA 1FGBD 4FO2A 4L5QA 2ZTDA 4B9XA 4A3DH 3F2CA 4GKJL 4DR5Q 2B2WA 2K03A 1HA6A 1B4OA 1U4MA 5HY6A 4DUZQ 2AQ3B 3E9IA 1XMQL 3LGJA 2HHHQ 1DD2A 3OW2A 4F88A 1P8LA 5E4WC 1SE8A 4BBRH 4KKUA 2P5ZX 2CQOA 1WD1A 2IPKD 3MXPA 1K8MA 4IPGA 1TS5A 1LT5D 4A3MG 5IIFA 3KOJA 2EPBA 2K14A 1Q90A 2O2LD 1CSQA 2IWHA 1PRTB 2F03A 4OX9L 3AU7A 3SEBA 3K7UC 5GQOA 4BBSH 1T5EA 1N8RC 5JPMC 1WTHA 4H02A 3TS2A 3J81j 1HJPA 5IOCA 4OIJA 3T1HQ 1QUQA 1VQJA 2R7ZG 4CGYB 1QOHA 2BA0A 1XMOQ 5JJIA 1JICA 4JK1C 4A3KH 1O7ZA 1SNPA 4AQYQ 2WV6D 3GTPB 1NMFA 3H6MA 2UXBL 1SDFA 4GOPB 2IL8A 1LYLA 4O0AA 3MA2B 3M7NA 1JOOA 1BR9A 1JWUD 3GQBA 1XTDA 3NTIA 4DV2Q 1I6HH 5I2XA 1N33Q 2D0OA 1EQQA 1J5EL 2MO0A 3HZXA 2J0TD 3I2ZA 4F87A 4P72A 1Z47A 4DNIA 5L37A 4YHHQ 2R6GA 3ND8A 3R3OA 4JI4L 4A3IG 2Z4HA 5G3LD 2XGTA 1ENCA 3RMHA 1NCVA 1Q1BA 4LF7Q 2FJ2A 1L1OC 1Z7TA 3MTSA 4GLAC 3TMEA 3CCJA 2MNAA 4FF1A 2VQEL 1PH9A 1XNQQ 1CKNA 3W2DA 3E9HA 2FMMA 3JAME 4YCWA 3S1RB 1G8ZD 3HOXH 4L8JA 3F2BA 1I94L 5JEAH 4FVMA 2EDGA 4XIGS 5CMDA 2KECA 2EZVA 1Q46A 2L55A 1AW7A 5T1IA 3J80L 3I4NH 5EBCA 1B1ZA 1Q8IA 1EL0A 1II3A 3X3MA 3FKIG 2VZAA 4G7HC 3P1HA 1FGUA 1HCZA 1VQFA 4RWSC 3TZUA 4ILWA 3K58A 1GD7A 1S3OA 5IYBH 1VQ5A 1SMXA 3KJOA 5IYDH 3TN2A 4PNYA 2JJQA 1FNVA 1LV9A 3DXJC 4DV5Q 1VCIA 2AHOB 2VUMG 2B3GA 4JOIC 5M9OA 2E2HH 2R7ZB 4AYBE 1KD1C 2BE5D 1WTOA 4IURA 4RCOA 4DAYA 2BA1A 2OF1A 1EYDA 2RSOA 2IW3A 4DNRB 3JC66 4JI2Q 2EY1A 1XPUA 4LF5Q 5T1GA 5CV7A 3T1YL 4ZRZA 2CVRA 1STHA 3HOUB 4Y7NB 1V1OA 4R4TA 3BVZA 4A93G 5IGFA 2EYMA 2PW7A 3S2DH 1F2LA 3S16B 2NVQB 2L5TA 3FMCA 4IALA 4DV6L 1TIID 3CCLA 1EWHA 2ASBA 2L9HA 1RHPA 3AFQA 1TKWB 1MKHA 4OX9Q 3EBEA 4A3IB 2B2VA 3BVGA 3J7AF 3MEFA 2K05A 2K5QA 4DR2L 2WINB 2F0PA 3EQLC 4K5VA 3DEOA 2EJGC 2QA4A 1HNWQ 4A4IA 5BR8L 4KN7C 2YU9H 1C4QA 3J81c 1M4VA 5ELDA 2NVXH 4K5XA 1SFOB 1CHQD 2ZJQA 2OXPA 4EGVA 4JBKA 3K59A 2K32A 5KYLA 4FP5D 1UE6A 2PZTA 4DV0L 1R9TH 3GTGH 1GHKA 3FKIB 2F3VA 4HIKA 3TRZA 4JI4Q 4KY5A 3VR3A 4NXMQ 1ENFA 3U4VA 2A68C 1UEBA 2KEDA 5JVG3 1O7IA 1FR3A 1VQ4A 4BBRG 4RAUC 3J7AV 1EQTA 4LWCA 4LF6L 3M9BA 3BZKA 1CFMA 3FP9A 2F4VQ 5M5WH 5ELOA 3W5OA 1E2WA 2VUMB 2IJ0A 4BS9A 1PH3A 2LXJA 2WIIB 4XYOA 5FK9C 1YNNC 4YIJA 1KLUD 1PFMA 4OO1H 2K52A 3I4MH 2D0PA 1ASZA 4P2CB 4BBSG 1XX8A 3P75A 4C3JG 3PUWA 4NMZA 1BBUA 2F0KA 5IP9G 3A8KE 4Q5VA 4A93B 2MO1A 3ULPA 2K5VA 1FL0A 2TMPA 1X3EA 4PV1C 2LY7A 3KYHC 2JA5G 3VYRA 2R93H 3ZYYX 1MBYA 4G7OC 1QUQB 3D6WA 1VQPA 1EEID 4LF9Q 3EJIA 4DUYQ 2K7VA 1CSPA 2XVSA 3BYTB 1HA5A 1N34L 4YWLA 4RFBA 1QZHA 1B70B 4PG3A 1L1OA 1C48A 1WTPA 1PTOD 2VNUD 3A74A 3FHWA 3M4OH 4DR6L 4XT3B 3TS0A 1DOKA 4BY7H 2OQKA 2PMZB 1B53A 5D14A 1TT2A 2GN5A 3BZCA 4ALPA 4DR1L 2MUYA 1B50A 1YHAA 3RZDB 1XPOA 1SYFA 4ZAIA 4HMJA 2Q2HA 3L2PA 5FLXc 1JC7A 1X6OA 2CFMA 4MHEA 2LKVA 4DAPA 2CCZA 1G6PA 5JEAG 2UUBL 3QWNA 2FMCA 1BDOA 1B3QA 1DJRD 4IUTA 3GTKB 2C5CA 2NYZD 1K8GA 3I4NG 4BBRB 1SNOA 1RL2A 5BN5A 3KF6A 2PI2E 2UUAQ 4JOIA 1IXRA 3A5ZB 3FVQA 2IHEA 1H9SA 3TP5A 4CJ1B 4DV1L 4XYQA 3VA5A 4MTKA 5KNCA 3D0FA 2QDBA 4LMQD 5I6YA 4BBSB 5IYDG 1K3RA 4HIDA 3CCSA 4B3MQ 2I07B 4C3JB 2XRQD 2CW0C 4DV3Q 2JYOA 4KKTA 2QEXA 1BNZA 5CORA 1M1KC 3WWVA 2E5LL 2JA7H 3NPPA 5EAYA 2WAQE 2G9HD 4AH6A 2JA5B 4DK1A 4ODGA 3BZDB 2MHVA 4K2LA 1AE2A 4YY3Q 3EFXD 5C3XA 5IGGA 3RN5A 3TP8A 4DAYB 1SE4A 1ET6A 5JAVA 1DYQA 3ZJYC 5JVH3 1KQSA 1X3GA 4RH6A 4DPGA 3GTLB 4C3IH 3PQIA 3D3RA 1I4GA 2DJGC 1NR4A 1GUOA 1SYCA 5C4XH 3ULJA 1E2VA 4LNQA 4R9WA 2VXWA 1TY0A 2F1MA 3PO2H 1STGA 3ERQA 2K50A 4DR7Q 2EJFC 4K5WA 4A75A 4FF2A 1G91A 4WRDA 4K0KL 2MP1A 3H94A 4DXGA 4HJ8A 2A6HD 3EROA 4JI5L 1LTTD 1CKMA 1Y1VH 3HS0C 1EEFD 4V0BA 5IP7H 3HG9A 5C0XI 1I3QH 4OWXB 3TP6A 3KBGA 3KF8A 5CV9A 5JJKA 2Q2TA 1K8OA 2R61A 3MXGA 4ZUIA 1ZYRC 2VQFQ 3VYUA 1PRTD 4G7ZC 1BUVT 1A0IA 1STNA 5EJWA 3AMUA 4A3BH 4DR6Q 1Y1WG 2AWNA 5GROA 3PF5A 4N9PA 4YWKA 2D62A 5DLQE 3L3OC 3NQTA 1X3QA 2PZWA 2F0LA 5KRUA 2NZHA 1SYDA 1EY9A 1BBWA 1IKLA 3QIAA 2IX0A 1DGSA 3L9AX 5D3DA 1HTPA 3EVQA 5I2YA 2K4KA 4CJ2C 2B2TC 4Y52H 1ILPA 3TZDA 1IBLL 1IKMA 1G6ZA 2OCEA 4LF8Q 3HOYH 3HOWG 1SMYD 3S2DB 4QUFA 2VW9A 3GO5A 4EX5A 1SR3A 1NSNS 3CXCA 1EY6A 2N88A 3PMFA 3T51B 1I50B 1WCMH 2C35B 5IGDA 3J81i 1O78A 1Q7YC 1MD2D 2L4NA 1XNRQ 1HH2P 2EVBA 3AB9A 1PH4A 1JWMD 1EFID 2M00A 3I4OA 5K5PA 2K28A 1PH7A 2E2JH 3EIVA 3CQZH 3I70A 1U4PA 2KCCA 4DR5L 2CH4A 3MEHA 1DCZA 3ONAB 4BY7G 4DUZL 2E5LQ 2HHHL 3DEPA 3VDYA 1L1OB 5FJ8H 4QB4A 2NVXB 1KAAA 1ET9A 2R92H 3PIO3 1F2ZA 4A3GH 4NB3A 5M3MG 4FXGC 4A3CH 3TDQA 3TSSA 2QCPX 2WAQG 3GD7A 2F0MA 5CGKA 5G3LF 5C0XJ 1EWIA 1Y1WB 3MXUA 3HRZC 4UHVA 2A6ED 5GAHC 1BO0A 4WJWA 2QILA 4KHPL 1EYAA 4JYAL 3CHBD 1IYJB 1OXUA 3T1HL 5C3EH 1NBWA 4JI5Q 5EKKA 5EKIA 2K33A 3CCEA 2I5HA 4AQYL 3NEMA 3CCVA 3S14H 4QCLA 2PNHA 3CC4A 5DAUA 2ICEC 1MJCA 1J6QA 5E4XA 4BA2I 3KF6B 3A55A 2F0WA 1PA6A 4DV2L 2XSCA 1Y14B 1H9SB 5EPJA 3HOWB 1N33L 1A2UA 1EY7A 1QB5D 3J80c 1RODA 1IBML 2DJFC 2KHIA 1Q86C 4FXDA 3CCRA 3Q8DA 1UAPA 2UXCL 3STBD 3SXHA 3DMUA 4ME3A 3SR1A 1Q82C 1HZBA 2VL6A 5FO9B 2NVTH 3CPFA 1OXSC 3CRKC 5C5LA 4LF7L 1FNUA 3VR5A 1SYEA 1W2BA 3GTJH 1BXTA 1XNQL 2OWOA 3K0YA 2Z6KC 3BG3A 1JR0D 3K81C 5C4XG 3M4OB 4ABNA 4JI8Q 4BY7B 1YJNA 2X6LA 2F0GA 1PH1A 3K0XA 5A2QL 3PO2G 4LK1C 5ELBA 5LMNQ 1SNMA 2CWAA 3S2HB 1V1QA 1A6XA 1F77A 2PW5A 5M3MB 4XDXA 1KL9A 2QF7A 1W3SA 4PMBA 3CC2A 2IY5B 2WAQB 2LXKA 3NWSA 5IP7G 2ZJPA 2ZT9C 2B8FA 4HCSA 1U4RA 4OEMB 5C4HA 4IUNA 1JORA 3D4WA 3M4QA 5LMUL 4TQUS 2Z8LA 3BDCA 5FO7B 4DV5L 5IT9c 3C1EA 1PHJA 1A15A 4QQBX 1WVLA 3C2PA 3M85A 1W6JA 2JA6G 3KF8B 1VQDA 4JI2L 3U9OA 2Q8TA 3TQYA 1HR0W 4LF5L 4GN3B 1Z6HA 4OO1I 1GM5A 5C0XH 3ER0A 2Y0SE 1NUCA 3U4ZA 4KI0A 2B2TA 4MNOA 1NAPA 1LT6D 3PV0A 3U58A 5HGQA 3NK9A 4XXEA 1KIXA 2D5DA 3GTQH 2A69D 4CKEA 1DM0B 1K0RA 3G6EA 2AQ1B 2CHBD 2KENA 3NSWA 1GUNA 1KRTA 5CC4A 3K5LA 1JOQA 4NP5A 5CBEE 1PYWD 1SAPA 4GLVB 4KHPQ 4EVOA 4JYAQ 2NTSA 4K8IA 3HOYG 1D5XC 3NELA 1IL8A 2LS01 2TSSA 3K7AH 4HCEA 1HNWL 1M90C 2ZXRA 1N36Q 4C56C 1WCMG 3BS1A 4B3SL 2JXMB 2FXQA 2EY6A 2F3WA 4IUUA 1K83H 2JA8H 3S15H 2PQEA 2PO4A 1PLFA 4QIWB 3PO2B 4A3FH 3M7GA 3NBIA 1D6EC 5M5XB 2BDNA 2F0TA 1IBMQ 2NUCA 1E3PA 1AN8A 2UXCQ 4DN4M 4NXML 4DXFA 1JE4A 1OXXK 1FYCA 2HD3A 4OHJA 3VYTA 5FJ8G 3K57A 3UDGA 2GVBA 2R92G 3E3XA 2JK8A 4A3GG 1YNJD 1QZGA 4A3CG 5I9OA 2F4VL 1KNAA 3GTOH 4DF7A 3DM1A 2D2CC 1PV4A 2K1BA 3HKZG 5C3WA 4IO9A 2JA6B 4RHSA 2MJ8A 1XYIA 4MIUA 1JE5A 1CQFA 4HN7A 2O5JC 1HNXQ 3NXWA 1TVXA 5C3EG 4C3HG 4ZCKA 5J22A 2JE6I 1V43A 2E8GA 1SJED 1N9WA 4ZUJA 4M8AA 2UU9L 2DY7A 2WB1E 4X66Q 4A3MB 4HIMA 1OXTA 5EKLA 4LF9L 3RZOB 5IGBA 4FYDA 4DUYL 2F0IA 4YWMA 3KJPA 2ALYB 1SN8A 5FLMH 5LMUQ 3HOYB 4GNXA 3GTMB 1QCBD 2DY8A 4IPCA 5M5YB 2Z6KA 1F9RA 1DOMA 3DWQA 1HQRD 1WCMB 1LABA 2H5XA 3G4SA 2B2UC 2VB3X 3R8BA 1KDAA 1C0AA 4HAEA 1HFGA 4NPSA 4BY1G 2HDMA 2RCNA 2B63H 1A2TA 4OXPA 2CQAA 4DGZA 2L0CA 5CR3A 3EA6A 4I65A 4QJFA 1EYGA 4PZ7A 5E3FA 3VYSA 3SGIA 1LTRD 3V96A 4HJ5A 3A7LA 4RKBA 2OEOA 5IT9L 3S1MH 2ZTCA 3CCUA 4XQQA 2R92B 3ERSX 1CM9A 4A3GB 2Q8RE 3NENA 5AFWA 1N32Q 1UE5A 2XRSD 2UUAL 1VF5C 2MFIA 4UAIA 4QY7A 3SHLA 1E1TA 2ZM6Q 4B3SQ 1TU2B 4JI3L 1A8VA 2XWBB 3HKZB 1TWAH 1YI2A 3OYYA 4A3EH 2A8VA 4DU9A 4R4QA 3S1QH 4B3RL 2E74C 1PFNA 3KLRA 1TR5A 3FPUB 4B3ML 3BDLA 1BCPB 4C1NI 4DV3L 4A3DG 1EY5A 1PFSA 4K6LA 2O4XA 4RGMA 1B7YB 1PFBA 2NBFA 1LTBD 2Z9HA 4C3HB 4EQNA 2JN4A 3J80i 2I5LX 3CMAA 3HEJA 1EU3A 3QR8A 3J80E 1EQVA 5C0XG 4YY3L 3K5NA 3H3VH 4P73A 4UP9A 4DKAC 4CJ0B 5M3FH 2QKIC 3WDNA 3LNNA 4KD3A 1VQNA 3SK6A 1AP0A 4ZK9B 1I4RA 4DAVA 3LWUA 2IX3A 1ASYA 4LFCL 3DM3A 4JPBW 1SYBA 3W3AA 1PH5A 2L11A 4LW1A 2F0UA 1VQKA 1PTOH 2Z0SA 3A8IE 4DR7L 1PZID 2K6AA 3I72A 3Q6SA 2NVTB 4BY1B 3PO3H 2UXDL 1QWYA 3WOEA 2A6HC 1B3AA 1BF4A 2NZ1D 2K5NA 2E2IH 3CMEA 1GUGA 4KJNA 1QG7A 4A3KG 2ATWA 1UE7A 1RD9D 1EIHA 5LL6S 4CDEC 4PQXA 2UU9Q 5GAGC 1A62A 1SJHD 1HUNA 2JP1A 4HSVA 1PVOA 2F0VA 4HTHA 4TSSA 1YJWA 1IW7D 2JA8G 4A3FG 2VQFL 4A76A 4DAMA 4TVAB 1QNKA 1R4PB 3H09A 1HZCA 2B2YC 2WB1G 4U68A 1L0YB 2NN6I 1X32A 2F0NA 1I5FA 3IFTA 3TREA 1KXLA 2IHFA 4LUOA 2RSNA 4C2MB 3CCMA 2PYKA 2JQOA 4F8MA 4DR4Q 2K04A 1PH8A 2DNCA 4AYBG 2UUCQ 1HZ9A 1XPRA 1HFNA 1TXYA 5TSSA 3OIQA 5EBDA 2F0JA 4A3DB 4GZYC 3GP7A 1X9NA 5CV4A 4ZKCB 2DNEA 3HOXG 2KBNA 4X3KA 2MGSA 3S24A 1B8AA 4Z9CB 3C46A 2G9DA 1CKNB 4DK3C 1VQ8A 3UDFA 1LTLA 4LF8L 2J7ZA 1C8CA 1CZGA 3KDFA 4R4OA 4IPHA 4EQOA 1ICFB 1GO3E 3T53B 4O42A 5C44H 4JCVE 2D9UA 1VDZA 4IJLA 4OONA 4JI3Q 5JJZA 1WTWA 4HIOA 1XNRL 5IE8A 3I91A 4OELB 1RJTA 5IYBG 4OGQC 4B3RQ 2JEBI 5FLMG 2PQAA 1MI2A 4QGUA 1WOCA 1SNDA 5KYIA 1FJGQ 4R8IA 3DHQA 2EXZA 2L15A 2WP8J 3PIOA 3TEHB 1XXGA 1JT8A 4RKLA 1I4XA 2PI2A 4A3KB 1WTQA 1S5FD 4RCNA 1CZWA 3TP7A 3OPOA 4GNXB 1CA6A 1WFQA 1QVGA 2B63G 5C6AA 1CHPD 1K83B 2F0QA 2ICIA 5DEHA 4U673 1SNCA 3C3LA 1ESRA 4BXXH 1I6HB 2NVYH 5JPNC 1WTVA 4DV4Q 1F9PA 1VMPA 1XWEA 4LFCQ 4C1NK 3A56A 1BBXC 3E5SA 3NTKA 2A6EC 4PZ6A 3HP3A 1AH9A 3H0GH 1S5BD 2HUGA 2ID0A 3CP0A 4TKOB 4BWGB 2UXDQ 4AYBB 1G2TA 2Z4IA 3LX0A 4K8JA 5EGTA 5JOBA 3E0JA 4O1NA 1EIGA 3NTHA 4IZ8A 4H0LC 2HIXA 1B9NA 1V9PA 3A5UA 2H4OA 1UNSA 3HOXB 4LJZC 4EQ5A 3ULLA 4JI6L 3I73A 2QGQA 1KABA 4P75A 1STYA 1AFPA 3I4NB 1PYBA 4HEDA 2FFKB 3T56B 1VQEA 1QVFA 1DZ1A 1Q8KA 3A7AB 2QW7A 2YTYA 2ZXPA 4IUPA 1RTNA 2EYPA 4JI1Q 3SK4A 1UEAB 3OWFA 4CKCA 4LFBQ 1DXMA 3N6RA 4J15A 4FDBA 5I9PA 1R4QB 5IWAQ 5ELEA 4J1MA 1K8AC 1LTSD 4S3SA
chains in the Genus database with same CATH topology
3FKIG 3K0XA 3PO2G 2VZAA 1YJ9A 4GS3A 3S1RH 2VS1A 5LMNQ 4GOPC 1Z9FA 3UE0A 5IWAL 4JI8L 2CWAA 1FGUA 1VQFA 1V1QA 3KLWA 4OO1G 3I4MG 1KL9A 1JJGA 1Q12A 1W3SA 1GD7A 1U5KA 2LSSA 1S3OA 5IYBH 1VQ5A 1SMXA 3CC2A 2IY5B 5LMNL 2LXKA 5IP7G 3KJOA 3J7ZC 2ZJPA 3PO3G 5IYDH 2I0QA 2JJQA 1Q81C 3JAMc 4A3JH 1RIPA 4DV5Q 1VCIA 2AHOB 3T1YQ 2B3GA 4JOIC 4LUVA 2E2HH 2VUMG 2KHJA 1FVIA 4AYBE 1KD1C 4JV5Q 1A63A 3U50C 1PH6A 2BA1A 3M4QA 5LMUL 4JBJA 4TQUS 3S2HH 3JC66 4JI2Q 1XPUA 3M3YH 2R93G 3K8AA 4LF5Q 5M3MH 4DV5L 4DV6Q 5IT9c 3T1YL 3CC7A 4UP7A 1PHJA 4QQBX 1L2FA 3M85A 1D8LA 4R4TA 4A93G 2AMCB 2BH8A 3KF8B 1VQDA 4JI2L 2JA6G 3S2DH 3A0JA 3TQYA 4LF5L 1HR0W 4LUZA 2IX1A 4GN3B 4DV6L 4R4IA 4OO1I 1GM5A 3ER0A 3CCLA 1TWHH 2ASBA 2Y0SE 3U4ZA 4KI0A 5AJ3L 2R7FA 3AFQA 1MKHA 4MNOA 1EIFA 4POFA 3PV0A 3U58A 1SRUA 4R4CA 5HGQA 4DR2Q 4OX9Q 3EBEA 3HOUH 1KIXA 5BR8Q 3GTQH 1K0RA 2WFWA 2NVQH 3MEFA 1EOVA 1T9HA 3G6EA 3HOZG 3AQQA 2KENA 4DR2L 1KRTA 1EFWA 2QA4A 1HNWQ 4A4IA 1YVCA 5BR8L 2HIVA 5ELNA 2YU9H 4IFDG 4GLVB 4AIMA 3OTOL 3PF4A 4KHPQ 3J81c 4JYAQ 3HOVG 3RNUA 3HOYG 3NELA 4JBWA 3RLNA 2GVAA 2ZTEA 3K7AH 2NVXH 1HNWL 4YCVA 1M90C 4DV0Q 1LUZA 2ZJQA 3RN2A 4JBKA 1N36Q 1U0LA 1WCMG 3HFZB 2BH2A 4B3SL 2VY3A 2ZJRA 2FXQA 1UE6A 4DV0L 1R9TH 3GTGH 3AYHB 1N36L 1K83H 1VQHA 2JA8H 4UY8C 3S15H 1G51A 4HIKA 4A3FH 3TRZA 3BJUA 4JI4Q 4LF6Q 2NZOA 4NXMQ 4JI6Q 2KCMA 3KDFB 3U4VA 2ES2A 4JC0A 1UEBA 4X65L 1IBMQ 1O7IA 2CKZB 1VQ4A 1E3PA 4BBRG 2AWOA 3GTPH 1YZ6A 2UXCQ 4LWCA 4LF6L 4NXML 3M9BA 1OXXK 4RMFA 2N3SA 3BZKA 3FP9A 1C9OA 4A3EG 2F4VQ 5M5WH 4P71A 5FJ8G 5ELOA 3W5OA 1VQ7A 3UDGA 2GVBA 3FKIH 2R92G 1PH3A 2LXJA 3CW2C 2JK8A 2JA7G 4A3GG 1H95A 1QZGA 3UDIA 5M5XH 4A3CG 1WJJA 2F4VL 1E1OA 2K52A 1OTCA 2D0PA 1VQOA 1ASZA 3I55A 1BKBA 1HZAA 3GTOH 3I4MH 4BBSG 5JJLA 4A3LH 2HT1A 3B6YA 3RR5A 3PUWA 3STBC 3PSIA 1BBUA 1PV4A 4UP8A 5IP9G 3HKZG 2MO1A 2EIFA 1VS0A 3NBHB 4IO9A 3ULPA 2K5VA 1FL0A 3DLLA 1X3EA 2VUMH 4O2DA 5M3FG 3ICEA 3PUVA 1N34Q 1JE5A 4APVA 3KYHC 2EXDA 2JA5G 1SROA 1JB7A 2RHSB 2R93H 1HNXQ 3GDEA 5C3EG 1HNZQ 1QUQB 4LF9Q 1VQPA 2V1CC 4DUYQ 1KHIA 2JE6I 1CSPA 3H0GG 1V43A 2E8GA 1Q1EA 1N9WA 4YWLA 1NJIC 1N34L 1K9MC 1QZHA 4R1JA 2UU9L 2K75A 2JA6H 2WB1E 1B70B 4X66Q 1HNXL 4PG3A 4HIMA 1L1OA 3G71A 1HNZL 1OXTA 4LF9L 4NXNQ 3CF5A 1Y1VG 4DR1Q 4DUYL 2VNUD 1YHQA 4YWMA 3KJPA 2ALYB 1SN8A 3A74A 3FHWA 3M4OH 4DR6L 3TS0A 2YYZA 5FLMH 5LMUQ 4BY7H 1VQGA 2OQKA 4X66L 4NXNL 4GNXA 4QIWE 2GN5A 3BZCA 4ALPA 4DR1L 3H3VI 1YHAA 4IPCA 1X55A 2OQ0A 4A3MH 1XPOA 3J7A5 2Z6KA 1KAWA 4GLXA 1VQBA 1HR0L 2Q2HA 2H5XA 3L2PA 3G4SA 1VQLA 5FLXc 2UUBQ 3RZOH 4HJ9A 3CAMA 1TWGH 1X6OA 2CFMA 1EQRA 4A3BG 4MZ9A 1C0AA 1P16A 4NPSA 4BY1G 5AJ3Q 2EQSA 2CCZA 2RCNA 2B63H 4OXPA 1G6PA 4YCUA 5JEAG 2UUBL 4L5TA 4GOPA 1KC8C 2R7ZH 2MQHA 3GTMH 2R7DA 3CD6A 5M5YH 4B3TQ 4QJFA 1QVCA 4PZ7A 1OXVA 1K8GA 1EYGA 5LMNW 3I4NG 3SGIA 1IBKL 5IYCH 4HJ5A 5H1SE 4UPAA 1RL2A 4DV1Q 4DR3Q 3KF6A 2PI2E 2CWPA 4QL5A 4Y7NH 3S1MH 2UUAQ 4B3TL 2ZTCA 4JOIA 3OTOQ 1IXRA 2OTLA 3S16H 3A5ZB 3W1BA 1NTGA 2IHEA 3ERSX 1YBYA 3CCUA 4JI7Q 5GAEC 4L5RC 3F8TA 4DV1L 4IFDJ 4DR3L 3GTKH 3NENA 1N32Q 1UE5A 3H15A 2UUAL 3D0FA 2MFIA 1AE3A 4QY7A 5IYDG 1K3RA 1E1TA 4HIDA 1PYSB 2ZM6Q 3CCSA 4B3MQ 4JI7L 4B3SQ 4A3JG 4JI3L 4A3IH 4DV3Q 1A8VA 4XTCS 3I7FA 1TWAH 1YI2A 3OYYA 4A3EH 2QEXA 1N32L 4GN4B 2A8VA 2UXDQ 4R4QA 3S1QH 3UE1A 4B3RL 1M1KC 3PIPA 3PUXA 3WWVA 2HQLA 3BU2A 1E7ZA 2ZM6L 2E5LL 4B3ML 2JA7H 5EAYA 2WAQE 4AH6A 4DV3L 4A3DG 2JA9A 1PFSA 4LF4L 2OTJA 1IZ6A 4YY3Q 1AE2A 1B7YB 2PMZE 4PZ8A 4X65Q 5C44G 3EN2A 2K5HA 3RN5A 2KCTA 4IOAA 1S40A 3J80i 2I5LX 4DAYB 4C3JH 3CMAA 5IP9H 3ZJYC 3L0OA 1SFOH 1JMCA 1KQSA 5C0XG 1BVSA 4YY3L 3H3VH 4P73A 4UP9A 4DKAC 1X3GA 5M3FH 4IFDI 4IPDA 4DPGA 2N49A 4C3IH 1TWCH 1K73C 4WJ3M 1MIUA 3CCQA 1PH2A 5C4XH 1VQNA 1JJ2A 2JA5H 1WYDA 3ULJA 4K0KQ 4LNQA 3HKSA 1D7QA 3HOUG 3CPWA 4C3HH 1XMOL 1ASYA 1CUKA 3PO2H 4DR7Q 2K50A 4LFCL 1C7YA 4RG1A 4A75A 2PQAB 3DM3A 4K0KL 2YTXA 4HJ8A 1PH5A 4X64Q 4JI5L 4LW1A 1CKMA 1VQKA 1SLJA 1Y1VH 1L0WA 2N78A 2Z0SA 3GTLH 2NN6G 2YV5A 4DR7L 5IP7H 1VQMA 3PO3H 4X62Q 2UXDL 5J3BA 4BXXG 3E0EA 4X64L 2K5NA 1YEZA 5C0XI 2E2IH 3CMEA 1I3QH 1NY4A 4OWXB 4GKKL 4A3KG 2ATWA 1UE7A 4X6AH 3G48A 4YHHL 1YNXA 4OWWB 5JJKA 2Q2TA 4KHZA 4X62L 2UU9Q 5GAGC 1A62A 3W1GA 2VQFQ 2A19A 3RLOA 3PUZA 1CKOA 1PVOA 4IOCA 2F3IA 1A0IA 2DUDA 1GVPA 1YJWA 3JAMi 1UWVA 4A3BH 4OWTB 2JA8G 4DR6Q 3HKZE 4BY1H 4A93H 1Y1WG 1VQCA 2AWNA 5GROA 1VQIA 2VQFL 4A76A 4YWKA 4TVAB 4DAMA 4GNXC 4A3FG 2D62A 3PF5A 4MTNA 3S1NH 5DLQE 5IY0A 2RHQB 1X3FA 1HZCA 2IT1A 2N8NA 2WB1G 3AEVA 3F2DA 3RLFA 2NZHA 2NN6I 4JI0Q 1BBWA 4JG2A 1XJVA 1HR0Q 2IX0A 1I5FA 5E7NA 3TREA 1KXLA 1DGSA 2IHFA 4KLKA 4LUOA 3F1ZA 3CCMA 4LFAL 1WI5A 2JQOA 1IBLQ 4JI0L 1TWFH 4DR4Q 1PH8A 4AYBG 3D31A 1HZ9A 2K4KA 1XPRA 2UUCQ 1TXYA 3HOZH 1S72A 1KRSA 1UE1A 2RF4A 4Y52H 4DV7Q 1MJEA 2DGYA 1X9NA 1IBLL 4A3LG 4DR4L 2OCEA 2XTIA 3UDXA 1YHBA 5JEAJ 2UUCL 4DK6C 3PGZA 1VQ6A 3HOVH 3HOXG 4LF8Q 3HOYH 2Q2IA 3HOWG 1IBKQ 1NE3A 2KBNA 1X56A 3S24A 5K36G 4C2MH 2VW9A 1B8AA 3GO5A 1E24A 4EX5A 1SR3A 3CXCA 4DV7L 1CKNB 3RZDH 4GKJQ 4DK3C 1VQ8A 4PMWA 3KFUA 1X54A 1EUJA 1WCMH 3UDFA 1LTLA 2Y0SG 4LF8L 2C35B 4L5QA 3J81i 1VQAA 1XMQQ 2ZTDA 3KDFA 4R4OA 4IPHA 1Q7YC 4A3DH 1XNRQ 3F2CA 3S17H 1HH2P 4JV5L 1GO3E 1LM0A 4GKJL 1PH4A 3IRBA 4DR5Q 5C44H 4JBMA 4JCVE 3I4OA 5HY6A 4DUZQ 4IJLA 1PH7A 3E9IA 4OONA 1XMQL 2E2JH 3LGJA 2HHHQ 3EIVA 4JI3Q 3CQZH 4HIOA 3OW2A 1XNRL 1X65A 5IE8A 4L5SA 1P8LA 1JJCB 1E22A 5IYBG 4DR5L 1I50H 1SE8A 4B3RQ 2JEBI 5FLMG 4BY7G 4BBRH 4DUZL 2B29A 1G291 2PQAA 2E5LQ 4IJHA 2CQOA 1WOCA 4QGUA 2HHHL 1FJGQ 3VDYA 4IPGA 4LF4Q 1L1OB 2L15A 2WP8J 3PUYA 5FJ8H 3PIOA 3TEHB 1JT8A 2R92H 4A3MG 2PI2A 4A3GH 4NB3A 5M3MG 3KOJA 2Q2UA 2K14A 1FJGL 4A3CH 1CSQA 4OX9L 4GNXB 3K7UC 2WAQG 5GQOA 4HJAA 4POGA 1WFQA 4BBSH 3GD7A 1N8RC 1QVGA 2B63G 3L7ZC 4H02A 3TS2A 5C0XJ 3J81j 1HJPA 1EWIA 4BXXH 3T1HQ 1QUQA 1VQJA 2R7ZG 2UXBQ 2NVYH 2BA0A 1XMOQ 5GAHC 5JJIA 4DV4Q 4KHPL 4A3KH 4GN5A 4LFCQ 4JYAL 1IYJB 2I5MX 1EIYB 4AQYQ 1OXUA 5IYCG 4WJ4A 1NMFA 3T1HL 2UXBL 4GOPB 5C3EH 1NBWA 4JI5Q 4PZ6A 4P74A 1LYLA 4O0AA 1J5EQ 1AH9A 3H0GH 3M7NA 4DV4L 3CCEA 1IL2A 2ID0A 2I5HA 3CP0A 1XTDA 3NEMA 4AQYL 3CCVA 2AKWB 3I56A 4DV2Q 1Y1WH 3S14H 3AFPA 2PNHA 3K80C 1I6HH 3CC4A 1N33Q 2D0OA 1MJCA 1J6QA 2F52A 1EQQA 2MO0A 2HIXA 1J5EL 3KF6B 1V9PA 3I2ZA 3A5UA 4P72A 4BA2I 4GKKQ 1Z47A 4DNIA 4YHHQ 2R6GA 1PA6A 4DV2L 4JI4L 2VQEQ 1Y14B 2YTVA 4HJ7A 4A3IG 4EQ5A 1N33L 3ULLA 4JI6L 2QGQA 2XGTA 3J80c 1IBML 2A1AA 4P75A 1Q1BA 4LF7Q 2KHIA 1Q86C 1L1OC 3CCRA 3Q8DA 4GLAC 3CCJA 1YITA 2MNAA 3STBD 2VQEL 1YIJA 1PYBA 1I94Q 1VQ9A 2UXCL 1PH9A 4ME3A 1Q82C 1HZBA 2VL6A 1CKNA 1XNQQ 2NVTH 1NMGA 1VQEA 1OXSC 3CPFA 1QVFA 5GADC 3E9HA 4LF7L 4YCWA 1Q8KA 2YTYA 3HOXH 3F2BA 1I94L 3HOWH 1GKHA 3MXNB 4JI1Q 1W2BA 3GTJH 4LFBQ 4XIGS 1XNQL 4LFAQ 2OWOA 1Q46A 2Z6KC 3K81C 4J15A 4FDBA 5C4XG 4BA1I 3I4NH 3PCOB 5IWAQ 4JI8Q 4JI1L 1YJNA 4LFBL 1K8AC 3M4PA 1PH1A 2JEAI 5C4JH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKI G;  3K0X A;  3PO2 G;  2VZA A;  1YJ9 A;  4GS3 A;  3S1R H;  2VS1 A;  5LMN Q;  4GOP C;  1Z9F A;  3UE0 A;  5IWA L;  4JI8 L;  2CWA A;  1FGU A;  1VQF A;  1V1Q A;  3KLW A;  4OO1 G;  3I4M G;  1KL9 A;  1JJG A;  1Q12 A;  1W3S A;  1GD7 A;  1U5K A;  2LSS A;  1S3O A;  5IYB H;  1VQ5 A;  1SMX A;  3CC2 A;  2IY5 B;  5LMN L;  2LXK A;  5IP7 G;  3KJO A;  3J7Z C;  2ZJP A;  3PO3 G;  5IYD H;  2I0Q A;  2JJQ A;  1Q81 C;  3JAM c;  4A3J H;  1RIP A;  4DV5 Q;  1VCI A;  2AHO B;  3T1Y Q;  2B3G A;  4JOI C;  4LUV A;  2E2H H;  2VUM G;  2KHJ A;  1FVI A;  4AYB E;  1KD1 C;  4JV5 Q;  1A63 A;  3U50 C;  1PH6 A;  2BA1 A;  3M4Q A;  5LMU L;  4JBJ A;  4TQU S;  3S2H H;  3JC6 6;  4JI2 Q;  1XPU A;  3M3Y H;  2R93 G;  3K8A A;  4LF5 Q;  5M3M H;  4DV5 L;  4DV6 Q;  5IT9 c;  3T1Y L;  3CC7 A;  4UP7 A;  1PHJ A;  4QQB X;  1L2F A;  3M85 A;  1D8L A;  4R4T A;  4A93 G;  2AMC B;  2BH8 A;  3KF8 B;  1VQD A;  4JI2 L;  2JA6 G;  3S2D H;  3A0J A;  3TQY A;  4LF5 L;  1HR0 W;  4LUZ A;  2IX1 A;  4GN3 B;  4DV6 L;  4R4I A;  4OO1 I;  1GM5 A;  3ER0 A;  3CCL A;  1TWH H;  2ASB A;  2Y0S E;  3U4Z A;  4KI0 A;  5AJ3 L;  2R7F A;  3AFQ A;  1MKH A;  4MNO A;  1EIF A;  4POF A;  3PV0 A;  3U58 A;  1SRU A;  4R4C A;  5HGQ A;  4DR2 Q;  4OX9 Q;  3EBE A;  3HOU H;  1KIX A;  5BR8 Q;  3GTQ H;  1K0R A;  2WFW A;  2NVQ H;  3MEF A;  1EOV A;  1T9H A;  3G6E A;  3HOZ G;  3AQQ A;  2KEN A;  4DR2 L;  1KRT A;  1EFW A;  2QA4 A;  1HNW Q;  4A4I A;  1YVC A;  5BR8 L;  2HIV A;  5ELN A;  2YU9 H;  4IFD G;  4GLV B;  4AIM A;  3OTO L;  3PF4 A;  4KHP Q;  3J81 c;  4JYA Q;  3HOV G;  3RNU A;  3HOY G;  3NEL A;  4JBW A;  3RLN A;  2GVA A;  2ZTE A;  3K7A H;  2NVX H;  1HNW L;  4YCV A;  1M90 C;  4DV0 Q;  1LUZ A;  2ZJQ A;  3RN2 A;  4JBK A;  1N36 Q;  1U0L A;  1WCM G;  3HFZ B;  2BH2 A;  4B3S L;  2VY3 A;  2ZJR A;  2FXQ A;  1UE6 A;  4DV0 L;  1R9T H;  3GTG H;  3AYH B;  1N36 L;  1K83 H;  1VQH A;  2JA8 H;  4UY8 C;  3S15 H;  1G51 A;  4HIK A;  4A3F H;  3TRZ A;  3BJU A;  4JI4 Q;  4LF6 Q;  2NZO A;  4NXM Q;  4JI6 Q;  2KCM A;  3KDF B;  3U4V A;  2ES2 A;  4JC0 A;  1UEB A;  4X65 L;  1IBM Q;  1O7I A;  2CKZ B;  1VQ4 A;  1E3P A;  4BBR G;  2AWO A;  3GTP H;  1YZ6 A;  2UXC Q;  4LWC A;  4LF6 L;  4NXM L;  3M9B A;  1OXX K;  4RMF A;  2N3S A;  3BZK A;  3FP9 A;  1C9O A;  4A3E G;  2F4V Q;  5M5W H;  4P71 A;  5FJ8 G;  5ELO A;  3W5O A;  1VQ7 A;  3UDG A;  2GVB A;  3FKI H;  2R92 G;  1PH3 A;  2LXJ A;  3CW2 C;  2JK8 A;  2JA7 G;  4A3G G;  1H95 A;  1QZG A;  3UDI A;  5M5X H;  4A3C G;  1WJJ A;  2F4V L;  1E1O A;  2K52 A;  1OTC A;  2D0P A;  1VQO A;  1ASZ A;  3I55 A;  1BKB A;  1HZA A;  3GTO H;  3I4M H;  4BBS G;  5JJL A;  4A3L H;  2HT1 A;  3B6Y A;  3RR5 A;  3PUW A;  3STB C;  3PSI A;  1BBU A;  1PV4 A;  4UP8 A;  5IP9 G;  3HKZ G;  2MO1 A;  2EIF A;  1VS0 A;  3NBH B;  4IO9 A;  3ULP A;  2K5V A;  1FL0 A;  3DLL A;  1X3E A;  2VUM H;  4O2D A;  5M3F G;  3ICE A;  3PUV A;  1N34 Q;  1JE5 A;  4APV A;  3KYH C;  2EXD A;  2JA5 G;  1SRO A;  1JB7 A;  2RHS B;  2R93 H;  1HNX Q;  3GDE A;  5C3E G;  1HNZ Q;  1QUQ B;  4LF9 Q;  1VQP A;  2V1C C;  4DUY Q;  1KHI A;  2JE6 I;  1CSP A;  3H0G G;  1V43 A;  2E8G A;  1Q1E A;  1N9W A;  4YWL A;  1NJI C;  1N34 L;  1K9M C;  1QZH A;  4R1J A;  2UU9 L;  2K75 A;  2JA6 H;  2WB1 E;  1B70 B;  4X66 Q;  1HNX L;  4PG3 A;  4HIM A;  1L1O A;  3G71 A;  1HNZ L;  1OXT A;  4LF9 L;  4NXN Q;  3CF5 A;  1Y1V G;  4DR1 Q;  4DUY L;  2VNU D;  1YHQ A;  4YWM A;  3KJP A;  2ALY B;  1SN8 A;  3A74 A;  3FHW A;  3M4O H;  4DR6 L;  3TS0 A;  2YYZ A;  5FLM H;  5LMU Q;  4BY7 H;  1VQG A;  2OQK A;  4X66 L;  4NXN L;  4GNX A;  4QIW E;  2GN5 A;  3BZC A;  4ALP A;  4DR1 L;  3H3V I;  1YHA A;  4IPC A;  1X55 A;  2OQ0 A;  4A3M H;  1XPO A;  3J7A 5;  2Z6K A;  1KAW A;  4GLX A;  1VQB A;  1HR0 L;  2Q2H A;  2H5X A;  3L2P A;  3G4S A;  1VQL A;  5FLX c;  2UUB Q;  3RZO H;  4HJ9 A;  3CAM A;  1TWG H;  1X6O A;  2CFM A;  1EQR A;  4A3B G;  4MZ9 A;  1C0A A;  1P16 A;  4NPS A;  4BY1 G;  5AJ3 Q;  2EQS A;  2CCZ A;  2RCN A;  2B63 H;  4OXP A;  1G6P A;  4YCU A;  5JEA G;  2UUB L;  4L5T A;  4GOP A;  1KC8 C;  2R7Z H;  2MQH A;  3GTM H;  2R7D A;  3CD6 A;  5M5Y H;  4B3T Q;  4QJF A;  1QVC A;  4PZ7 A;  1OXV A;  1K8G A;  1EYG A;  5LMN W;  3I4N G;  3SGI A;  1IBK L;  5IYC H;  4HJ5 A;  5H1S E;  4UPA A;  1RL2 A;  4DV1 Q;  4DR3 Q;  3KF6 A;  2PI2 E;  2CWP A;  4QL5 A;  4Y7N H;  3S1M H;  2UUA Q;  4B3T L;  2ZTC A;  4JOI A;  3OTO Q;  1IXR A;  2OTL A;  3S16 H;  3A5Z B;  3W1B A;  1NTG A;  2IHE A;  3ERS X;  1YBY A;  3CCU A;  4JI7 Q;  5GAE C;  4L5R C;  3F8T A;  4DV1 L;  4IFD J;  4DR3 L;  3GTK H;  3NEN A;  1N32 Q;  1UE5 A;  3H15 A;  2UUA L;  3D0F A;  2MFI A;  1AE3 A;  4QY7 A;  5IYD G;  1K3R A;  1E1T A;  4HID A;  1PYS B;  2ZM6 Q;  3CCS A;  4B3M Q;  4JI7 L;  4B3S Q;  4A3J G;  4JI3 L;  4A3I H;  4DV3 Q;  1A8V A;  4XTC S;  3I7F A;  1TWA H;  1YI2 A;  3OYY A;  4A3E H;  2QEX A;  1N32 L;  4GN4 B;  2A8V A;  2UXD Q;  4R4Q A;  3S1Q H;  3UE1 A;  4B3R L;  1M1K C;  3PIP A;  3PUX A;  3WWV A;  2HQL A;  3BU2 A;  1E7Z A;  2ZM6 L;  2E5L L;  4B3M L;  2JA7 H;  5EAY A;  2WAQ E;  4AH6 A;  4DV3 L;  4A3D G;  2JA9 A;  1PFS A;  4LF4 L;  2OTJ A;  1IZ6 A;  4YY3 Q;  1AE2 A;  1B7Y B;  2PMZ E;  4PZ8 A;  4X65 Q;  5C44 G;  3EN2 A;  2K5H A;  3RN5 A;  2KCT A;  4IOA A;  1S40 A;  3J80 i;  2I5L X;  4DAY B;  4C3J H;  3CMA A;  5IP9 H;  3ZJY C;  3L0O A;  1SFO H;  1JMC A;  1KQS A;  5C0X G;  1BVS A;  4YY3 L;  3H3V H;  4P73 A;  4UP9 A;  4DKA C;  1X3G A;  5M3F H;  4IFD I;  4IPD A;  4DPG A;  2N49 A;  4C3I H;  1TWC H;  1K73 C;  4WJ3 M;  1MIU A;  3CCQ A;  1PH2 A;  5C4X H;  1VQN A;  1JJ2 A;  2JA5 H;  1WYD A;  3ULJ A;  4K0K Q;  4LNQ A;  3HKS A;  1D7Q A;  3HOU G;  3CPW A;  4C3H H;  1XMO L;  1ASY A;  1CUK A;  3PO2 H;  4DR7 Q;  2K50 A;  4LFC L;  1C7Y A;  4RG1 A;  4A75 A;  2PQA B;  3DM3 A;  4K0K L;  2YTX A;  4HJ8 A;  1PH5 A;  4X64 Q;  4JI5 L;  4LW1 A;  1CKM A;  1VQK A;  1SLJ A;  1Y1V H;  1L0W A;  2N78 A;  2Z0S A;  3GTL H;  2NN6 G;  2YV5 A;  4DR7 L;  5IP7 H;  1VQM A;  3PO3 H;  4X62 Q;  2UXD L;  5J3B A;  4BXX G;  3E0E A;  4X64 L;  2K5N A;  1YEZ A;  5C0X I;  2E2I H;  3CME A;  1I3Q H;  1NY4 A;  4OWX B;  4GKK L;  4A3K G;  2ATW A;  1UE7 A;  4X6A H;  3G48 A;  4YHH L;  1YNX A;  4OWW B;  5JJK A;  2Q2T A;  4KHZ A;  4X62 L;  2UU9 Q;  5GAG C;  1A62 A;  3W1G A;  2VQF Q;  2A19 A;  3RLO A;  3PUZ A;  1CKO A;  1PVO A;  4IOC A;  2F3I A;  1A0I A;  2DUD A;  1GVP A;  1YJW A;  3JAM i;  1UWV A;  4A3B H;  4OWT B;  2JA8 G;  4DR6 Q;  3HKZ E;  4BY1 H;  4A93 H;  1Y1W G;  1VQC A;  2AWN A;  5GRO A;  1VQI A;  2VQF L;  4A76 A;  4YWK A;  4TVA B;  4DAM A;  4GNX C;  4A3F G;  2D62 A;  3PF5 A;  4MTN A;  3S1N H;  5DLQ E;  5IY0 A;  2RHQ B;  1X3F A;  1HZC A;  2IT1 A;  2N8N A;  2WB1 G;  3AEV A;  3F2D A;  3RLF A;  2NZH A;  2NN6 I;  4JI0 Q;  1BBW A;  4JG2 A;  1XJV A;  1HR0 Q;  2IX0 A;  1I5F A;  5E7N A;  3TRE A;  1KXL A;  1DGS A;  2IHF A;  4KLK A;  4LUO A;  3F1Z A;  3CCM A;  4LFA L;  1WI5 A;  2JQO A;  1IBL Q;  4JI0 L;  1TWF H;  4DR4 Q;  1PH8 A;  4AYB G;  3D31 A;  1HZ9 A;  2K4K A;  1XPR A;  2UUC Q;  1TXY A;  3HOZ H;  1S72 A;  1KRS A;  1UE1 A;  2RF4 A;  4Y52 H;  4DV7 Q;  1MJE A;  2DGY A;  1X9N A;  1IBL L;  4A3L G;  4DR4 L;  2OCE A;  2XTI A;  3UDX A;  1YHB A;  5JEA J;  2UUC L;  4DK6 C;  3PGZ A;  1VQ6 A;  3HOV H;  3HOX G;  4LF8 Q;  3HOY H;  2Q2I A;  3HOW G;  1IBK Q;  1NE3 A;  2KBN A;  1X56 A;  3S24 A;  5K36 G;  4C2M H;  2VW9 A;  1B8A A;  3GO5 A;  1E24 A;  4EX5 A;  1SR3 A;  3CXC A;  4DV7 L;  1CKN B;  3RZD H;  4GKJ Q;  4DK3 C;  1VQ8 A;  4PMW A;  3KFU A;  1X54 A;  1EUJ A;  1WCM H;  3UDF A;  1LTL A;  2Y0S G;  4LF8 L;  2C35 B;  4L5Q A;  3J81 i;  1VQA A;  1XMQ Q;  2ZTD A;  3KDF A;  4R4O A;  4IPH A;  1Q7Y C;  4A3D H;  1XNR Q;  3F2C A;  3S17 H;  1HH2 P;  4JV5 L;  1GO3 E;  1LM0 A;  4GKJ L;  1PH4 A;  3IRB A;  4DR5 Q;  5C44 H;  4JBM A;  4JCV E;  3I4O A;  5HY6 A;  4DUZ Q;  4IJL A;  1PH7 A;  3E9I A;  4OON A;  1XMQ L;  2E2J H;  3LGJ A;  2HHH Q;  3EIV A;  4JI3 Q;  3CQZ H;  4HIO A;  3OW2 A;  1XNR L;  1X65 A;  5IE8 A;  4L5S A;  1P8L A;  1JJC B;  1E22 A;  5IYB G;  4DR5 L;  1I50 H;  1SE8 A;  4B3R Q;  2JEB I;  5FLM G;  4BY7 G;  4BBR H;  4DUZ L;  2B29 A;  1G29 1;  2PQA A;  2E5L Q;  4IJH A;  2CQO A;  1WOC A;  4QGU A;  2HHH L;  1FJG Q;  3VDY A;  4IPG A;  4LF4 Q;  1L1O B;  2L15 A;  2WP8 J;  3PUY A;  5FJ8 H;  3PIO A;  3TEH B;  1JT8 A;  2R92 H;  4A3M G;  2PI2 A;  4A3G H;  4NB3 A;  5M3M G;  3KOJ A;  2Q2U A;  2K14 A;  1FJG L;  4A3C H;  1CSQ A;  4OX9 L;  4GNX B;  3K7U C;  2WAQ G;  5GQO A;  4HJA A;  4POG A;  1WFQ A;  4BBS H;  3GD7 A;  1N8R C;  1QVG A;  2B63 G;  3L7Z C;  4H02 A;  3TS2 A;  5C0X J;  3J81 j;  1HJP A;  1EWI A;  4BXX H;  3T1H Q;  1QUQ A;  1VQJ A;  2R7Z G;  2UXB Q;  2NVY H;  2BA0 A;  1XMO Q;  5GAH C;  5JJI A;  4DV4 Q;  4KHP L;  4A3K H;  4GN5 A;  4LFC Q;  4JYA L;  1IYJ B;  2I5M X;  1EIY B;  4AQY Q;  1OXU A;  5IYC G;  4WJ4 A;  1NMF A;  3T1H L;  2UXB L;  4GOP B;  5C3E H;  1NBW A;  4JI5 Q;  4PZ6 A;  4P74 A;  1LYL A;  4O0A A;  1J5E Q;  1AH9 A;  3H0G H;  3M7N A;  4DV4 L;  3CCE A;  1IL2 A;  2ID0 A;  2I5H A;  3CP0 A;  1XTD A;  3NEM A;  4AQY L;  3CCV A;  2AKW B;  3I56 A;  4DV2 Q;  1Y1W H;  3S14 H;  3AFP A;  2PNH A;  3K80 C;  1I6H H;  3CC4 A;  1N33 Q;  2D0O A;  1MJC A;  1J6Q A;  2F52 A;  1EQQ A;  2MO0 A;  2HIX A;  1J5E L;  3KF6 B;  1V9P A;  3I2Z A;  3A5U A;  4P72 A;  4BA2 I;  4GKK Q;  1Z47 A;  4DNI A;  4YHH Q;  2R6G A;  1PA6 A;  4DV2 L;  4JI4 L;  2VQE Q;  1Y14 B;  2YTV A;  4HJ7 A;  4A3I G;  4EQ5 A;  1N33 L;  3ULL A;  4JI6 L;  2QGQ A;  2XGT A;  3J80 c;  1IBM L;  2A1A A;  4P75 A;  1Q1B A;  4LF7 Q;  2KHI A;  1Q86 C;  1L1O C;  3CCR A;  3Q8D A;  4GLA C;  3CCJ A;  1YIT A;  2MNA A;  3STB D;  2VQE L;  1YIJ A;  1PYB A;  1I94 Q;  1VQ9 A;  2UXC L;  1PH9 A;  4ME3 A;  1Q82 C;  1HZB A;  2VL6 A;  1CKN A;  1XNQ Q;  2NVT H;  1NMG A;  1VQE A;  1OXS C;  3CPF A;  1QVF A;  5GAD C;  3E9H A;  4LF7 L;  4YCW A;  1Q8K A;  2YTY A;  3HOX H;  3F2B A;  1I94 L;  3HOW H;  1GKH A;  3MXN B;  4JI1 Q;  1W2B A;  3GTJ H;  4LFB Q;  4XIG S;  1XNQ L;  4LFA Q;  2OWO A;  1Q46 A;  2Z6K C;  3K81 C;  4J15 A;  4FDB A;  5C4X G;  4BA1 I;  3I4N H;  3PCO B;  5IWA Q;  4JI8 Q;  4JI1 L;  1YJN A;  4LFB L;  1K8A C;  3M4P A;  1PH1 A;  2JEA I;  5C4J H; 
#chains in the Genus database with same CATH topology
 2E2H B;  1YJ9 A;  4GS3 A;  3S1R H;  3GV6 A;  1HHV A;  1Z9F A;  4JI8 L;  2EYH A;  2XNA C;  3KLW A;  4OO1 G;  3I4M G;  1MSG A;  1Q12 A;  1U9R A;  1U4L A;  2LSS A;  4J6H A;  3R2I A;  2RCF A;  5LMN L;  5DM7 3;  2KEE A;  1FNW A;  3J7Z C;  3PO3 G;  2B63 B;  2I0Q A;  1Q81 C;  3JAM c;  1GOZ A;  4LUV A;  4ZQ3 A;  2KHJ A;  1A63 A;  1M8A A;  3U50 C;  1PH6 A;  2B2Y A;  3OWE B;  2K5D A;  2R93 G;  3M3Y H;  1LAC A;  5IOD A;  1GUW A;  3CC7 A;  3J81 E;  1HPC A;  3S1M B;  2LFN A;  2RDH A;  2X69 A;  3VA7 A;  2GA4 B;  3A0J A;  4R4I A;  1L0X B;  1TWH H;  1RDP D;  4M1U B;  2YU9 B;  1WTR A;  4POF A;  3SDZ A;  1K28 A;  3HOU H;  1TWA B;  3MVV A;  3FEW X;  1GXD C;  3S1Q B;  2NVQ H;  1EOV A;  1T9H A;  2SEB D;  3OOC A;  3MZ5 A;  2A69 C;  4RGO S;  3QB3 A;  1I4Q A;  4AIM A;  1R9T B;  2NN6 H;  5ELF A;  3GTG B;  3PF4 A;  3MFY A;  2XN9 C;  4JBW A;  5CV8 A;  2GVA A;  2ZTE A;  4YCV A;  5J39 A;  1LUZ A;  5EPK A;  2BH2 A;  3HFZ B;  1ZEQ X;  2VY3 A;  2ZJR A;  4H13 C;  1BQQ T;  1TS4 A;  2EJM A;  3CKI B;  2KHS A;  5M5W B;  1N36 L;  1G2S A;  2F0S A;  4B08 A;  4UY8 C;  4UDU C;  2L12 A;  2RVL A;  4N8X 1;  4PMC A;  4G4K A;  2BCO A;  4JI6 Q;  3KDF B;  2ES2 A;  4JW0 A;  4X65 L;  1AEX A;  3I4M B;  3C1F A;  2CKZ B;  1PXU A;  3PO3 B;  4RMF A;  1C9O A;  3X3N A;  3K5M A;  1VQ7 A;  1JB3 A;  4FF4 A;  3FKI H;  1UUP A;  3CW2 C;  2EY5 A;  2JA7 G;  3IAY A;  2R93 B;  5NUC A;  1OTC A;  2B8G A;  1VQO A;  3I55 A;  1BKB A;  1HZA A;  2Q8I B;  2HT1 A;  3B6Y A;  1NR2 A;  3RR5 A;  1CK1 A;  2EIF A;  2KJX A;  1PZK D;  1ZYR D;  1IHZ A;  3DLL A;  5K36 H;  2VUM H;  3TBI B;  4IUV A;  4C3I G;  3ICE A;  1K0S A;  1H9M A;  1Y8P B;  4APV A;  2EXD A;  5FLX E;  1SRO A;  1BCP D;  2RHS B;  2V4D A;  1EZ6 A;  3R2T A;  2H1E A;  1JB7 A;  3GDE A;  1HNZ Q;  2V1C C;  3H0G G;  1Q1E A;  1NJI C;  4R1J A;  2K75 A;  1HNX L;  4NXN Q;  1SE3 A;  1Y1V G;  2O5I C;  3G6J B;  2RA4 A;  5F2D A;  1EWC A;  4X66 L;  1WTX A;  3H3V I;  1K3B C;  4I7A A;  4E6I A;  1X55 A;  2OQ0 A;  2DN8 A;  3D6C A;  1VQB A;  2WKC A;  3D4R A;  5KEE A;  2BE5 C;  4N8F A;  1TWG H;  4A3B G;  4MZ9 A;  1P16 A;  2XIW A;  4L5T A;  2MQH A;  2R7D A;  3JAM L;  4B3T Q;  2EYL A;  2FHT A;  1Y8O B;  4QF4 A;  1SSO A;  5LMN W;  2C9O A;  5IYC H;  1IBK L;  4UPA A;  2L1B A;  4DR3 Q;  4QL5 A;  5ELC A;  2RKS A;  1TQO A;  2OTL A;  3W1B A;  2B39 A;  3I8Z A;  4JI7 Q;  3A8J E;  5GAE C;  2SNM A;  4L5R C;  2JA7 B;  1D5Z C;  4IFD J;  3GTK H;  3M4Y A;  5BN4 A;  3NUC A;  3T4A C;  2SOB A;  4XTC S;  3I7F A;  1SNQ A;  3MC0 B;  1N32 L;  2NVY B;  3UE1 A;  4C3I B;  3PUX A;  2ZM6 L;  2HQL A;  4QMG A;  5C4X B;  3MXN A;  3PIP 3;  4QUC A;  2BDO A;  2OTJ A;  2JA9 A;  5CBA E;  4LF4 L;  1IZ6 A;  1DOL A;  1E0B A;  1LTI D;  4KTA A;  4XQJ A;  2PMZ E;  4X65 Q;  4LAA A;  2K5H A;  2KCT A;  3H0G B;  3NE5 B;  4C3J H;  3D4D A;  5IP9 H;  4F7X A;  5CV5 A;  3L0O A;  1I4P A;  3OMG A;  4KD4 A;  1MSH A;  1J8I A;  1O80 A;  1Y1V B;  1TWC H;  1K73 C;  4WJ3 M;  1NNX A;  5A2Q E;  2JA5 H;  1OO9 B;  1WYD A;  3HKS A;  3URY A;  1H9J A;  1XTC D;  3HOU G;  1I3Q B;  1LT3 D;  1CUK A;  4ID6 A;  1KNE A;  1C7Y A;  4RG1 A;  1KLG D;  5IGC A;  3RUZ A;  1PTO F;  1X3P A;  1ICW A;  4X64 Q;  3GTL H;  2N78 A;  3P20 A;  2NN6 G;  2YV5 A;  4A3B B;  4HMI A;  4IQZ A;  1VQM A;  1Q3L A;  4XT1 B;  2PNR C;  3CU7 A;  5J3B A;  4X62 Q;  1YEZ A;  2FIN B;  2QDL A;  4GKK L;  1EY8 A;  2N55 A;  3KLS X;  3H3V C;  3RLO A;  1CKO A;  4IOC A;  2F3I A;  1ESF A;  2DUD A;  1GVP A;  3JAM i;  4OWT B;  3KBX A;  2Z6B A;  1VQC A;  4OWW B;  1EU4 A;  1VQI A;  3Q0A A;  2G5D A;  1V8Q A;  4MTN A;  5DM6 3;  2AQ2 B;  1IW7 C;  2IT1 A;  3AEV A;  3F2D A;  4JI0 Q;  3V2T A;  4X3T A;  1PMR A;  1MHW C;  3FDT A;  5E7N A;  3Q24 A;  4KY6 A;  1PTO C;  2EYJ A;  3F2U A;  1H9R A;  2A5H A;  3F1Z A;  4LFA L;  1TWF H;  2RBM A;  4MN3 A;  4N9T A;  2HCC A;  2PPB C;  3HOZ H;  1H9K A;  3M3Y B;  1FD7 D;  2RF4 A;  2VB2 X;  4H7B A;  4DV7 Q;  2DGY A;  4IFD H;  4DR4 L;  3I4L A;  2XTI A;  2UUC L;  1YHB A;  2NTT A;  5E1F A;  1B44 D;  1VQ6 A;  3NP8 A;  3HOV H;  1B9M A;  1IBK Q;  1NE3 A;  1X56 A;  5K36 G;  2E2J B;  3CQZ B;  4GKJ Q;  1TWH B;  2RDF A;  4PMW A;  2ENB A;  2Y0S G;  5EPL A;  1ILQ A;  1VQA A;  3KK7 A;  1XMQ Q;  2EE1 A;  4JV5 L;  3S17 H;  1LM0 A;  3IRB A;  4EQP A;  4JBM A;  2PCF B;  2LMC B;  3P7J A;  5KGU A;  2EOT A;  5IGE A;  1X65 A;  1IYU A;  4L5S A;  1JJC B;  1E22 A;  2AUJ D;  1I50 H;  2JSO A;  4KMU C;  2B29 A;  1G29 1;  4CDD C;  4IJH A;  4CKB A;  4LF4 Q;  4FXK C;  3T16 A;  3PUY A;  5A35 A;  1S5E D;  5FOB B;  1F9S A;  3G7L A;  2HQE A;  4L6T B;  1J9O A;  1D1K A;  4NKL A;  1QIL A;  1O7Y A;  2EY2 A;  3NBH A;  2Q2U A;  5CYU A;  1FJG L;  4B9W A;  5C3E B;  4ZKB B;  2ZXO A;  4HJA A;  1EOT A;  4POG A;  2SNS A;  3J7Y W;  3L7Z C;  3OHX C;  2AUK A;  2UXB Q;  3S14 B;  1V1P A;  4CHT B;  1PRT F;  4GN5 A;  2EYF A;  2F4I A;  2I5M X;  1EIY B;  2OT2 A;  2M9V A;  5IYC G;  4WJ4 A;  4DK0 A;  3KLS A;  4FNF A;  2KCN A;  4ZYS A;  3QOL A;  4P74 A;  1J5E Q;  4DA2 A;  4DV4 L;  1IL2 A;  5LL6 X;  2X6G A;  4CBV A;  1Y1W H;  2AKW B;  3I56 A;  3AFP A;  3K80 C;  2K01 A;  3S1N H;  2F52 A;  4K14 A;  4GKK Q;  2F0E A;  4KJO A;  4KY7 A;  3IFD A;  1D2B A;  5D3I B;  2VQE Q;  2YTV A;  4HJ7 A;  3D8G A;  2F0F A;  1EY4 A;  3GTJ B;  5LHY 1;  3ITP A;  2A1A A;  1QNU A;  1VMC A;  1PZJ D;  2F0O A;  1YIT A;  1I6V C;  1LO5 D;  1VQ9 A;  1YIJ A;  1I94 Q;  2Y0S B;  1EZ8 A;  3H91 A;  1NMG A;  5GAD C;  1PRT C;  1GUS A;  3HOW H;  3MHB A;  1GKH A;  3MXN B;  4NDX A;  1JCK B;  4X3U A;  3VR2 A;  2F0H A;  4LFA Q;  1Y69 U;  4BA1 I;  5IT9 E;  3PCO B;  4JI1 L;  2PZU A;  1DON A;  5C5M A;  4LFB L;  3QO2 A;  3M4P A;  2JEA I;  5C4J H;  2E2D C;  3K6O A;  2VS1 A;  4OIK A;  4GOP C;  3UE0 A;  5IWA L;  1JJG A;  1U5K A;  1EY0 A;  1TWG B;  5ISR A;  1STE A;  4A3J H;  1RIP A;  3T1Y Q;  3I90 A;  4JV5 Q;  1FVI A;  2R3Z A;  1SMY C;  5CV6 A;  4JBJ A;  4RHR A;  3S2H H;  5KND A;  2J4X A;  3K8A A;  5M3M H;  4DV6 Q;  1LT4 D;  4UP7 A;  2A73 B;  1L2F A;  1D8L A;  3GTQ B;  3FPP A;  1SEB D;  2AMC B;  2BH8 A;  1QJO A;  4LUZ A;  2IX1 A;  3OSO A;  1STB A;  2B2U A;  3MFG A;  3R93 A;  5AJ3 L;  2R7F A;  1EIF A;  1SRU A;  4R4C A;  4KV6 A;  3BVM A;  3U9S A;  4DR2 Q;  3K5O A;  3I3C A;  3K7A B;  5BR8 Q;  2SDF A;  1S5C D;  2WFW A;  4X3S A;  3HOZ G;  3AQQ A;  2KQ3 A;  1EFW A;  3CRL C;  1YVC A;  1ENA A;  3O13 A;  2HIV A;  5ELN A;  4IFD G;  3OTO L;  1HRJ A;  2JA8 B;  3HOV G;  3T13 A;  3E6Z X;  3RNU A;  3S15 B;  5FO8 B;  2WAC A;  3RLN A;  4KK7 A;  4A3F B;  4J8Q A;  1TS3 A;  1GHJ A;  1IYV A;  4DV0 Q;  2WB1 B;  3SK8 A;  3RN2 A;  3WOF A;  1U0L A;  1TWC B;  1O7L A;  1SE2 A;  1E2Z A;  4H44 C;  1CA5 A;  3AYH B;  2A68 D;  1VQH A;  1G51 A;  4XQN A;  3OW7 A;  2K5W A;  3BJU A;  3J81 L;  4LF6 Q;  2NZO A;  1LLR D;  2KCM A;  3KUP A;  4JC0 A;  3GTO B;  1BCP F;  4I7Z C;  4OL7 A;  2AWO A;  3GTP H;  1YZ6 A;  1QE6 A;  1I4H A;  1YNN D;  4TRD A;  2RDG A;  2N3S A;  4A3E G;  1CTM A;  2KUM A;  4HSP A;  4P71 A;  1RTO A;  3QG1 A;  1KTK A;  3Q22 A;  1H95 A;  4K2K A;  3UDI A;  5M5X H;  1JWS D;  4CDC C;  1WJJ A;  1E1O A;  3FRP B;  1D5M C;  5JJL A;  3SK5 A;  2F0D A;  4A3L H;  2E76 C;  3STB C;  1VF7 A;  3PSI A;  4UP8 A;  1KDB A;  3DWA A;  4DNT B;  1VS0 A;  2M2L A;  3NBH B;  1CI3 M;  3MAQ A;  4O2D A;  5M3F G;  4R8N A;  3PUV A;  1A3U A;  1TS2 A;  1N34 Q;  4RGN A;  4ULL A;  1S4Z A;  1S5D D;  1PDQ A;  1KHI A;  1ONL A;  1A3V A;  1AZP A;  1V1P B;  1T5X D;  3SE0 A;  3HGB A;  1BCP C;  1K9M C;  3OIP A;  4CDF C;  1TWF B;  2JA6 H;  1KDC A;  4G57 A;  5EQ0 A;  2HCI A;  3G71 A;  1HNZ L;  3HOZ B;  3CF5 A;  4DR1 Q;  1HXY D;  2RQX A;  1B2T A;  1YHQ A;  5BN3 A;  2YYZ A;  1VQG A;  1CT1 D;  1F2Y A;  3HOV B;  4NXN L;  4QIW E;  3NWT A;  2B2W C;  3NQI A;  1RF2 D;  4A3M H;  3J7A 5;  1KAW A;  2A74 C;  4GLX A;  1HR0 L;  1HQM C;  1VQL A;  2UUB Q;  3RZO H;  1HTL D;  4JVZ A;  4HJ9 A;  3CAM A;  1LTG D;  1EQR A;  3S17 B;  5AJ3 Q;  2EQS A;  5DNF A;  4YCU A;  4GOP A;  1KC8 C;  2Z1C A;  2R7Z H;  3GTM H;  3CD6 A;  1A3T A;  2KVM A;  5M5Y H;  1QVC A;  1OXV A;  3MWY W;  3Q23 A;  3QJY A;  5H1S E;  4DV1 Q;  5I6W A;  3DWP A;  2CWP A;  4Y7N H;  5FLX L;  4A3E B;  4B3T L;  3BDO A;  3OTO Q;  1GJX A;  4KN4 C;  3S16 H;  1NTG A;  1YBY A;  4RA8 A;  3UI2 A;  4V19 0;  3F8T A;  4FF3 A;  4IN3 A;  1GUT A;  2WKD A;  3IL8 A;  4DR3 L;  2CW0 D;  4K6D A;  3H15 A;  1AE3 A;  5COY A;  1JOK A;  1PYS B;  4JI7 L;  4A3J G;  1CQV A;  4A3I H;  2HDL A;  3RD4 A;  5C4Z A;  2EYO A;  4GN4 B;  2NB0 A;  1ZXT A;  5M3F B;  2KOL A;  3N52 A;  3PIP A;  3BU2 A;  1E7Z A;  1RCV D;  3IKJ A;  2E75 C;  5HUR A;  4PZ8 A;  5C44 G;  3EN2 A;  2MPM A;  4IOA A;  1S40 A;  2BOS A;  4DFA A;  5HGT A;  1SFO H;  1JMC A;  1BVS A;  1EYC A;  4IFD I;  1W6K A;  4IPD A;  1PTO B;  2N49 A;  3BYY B;  3S1N B;  1MIU A;  3CCQ A;  1PH2 A;  1JJ2 A;  3SVM A;  4K0K Q;  4ZLT F;  1D7Q A;  1Y8N B;  3CPW A;  4C3H H;  1XMO L;  1D1I A;  2E2I B;  1F9Q A;  3OMC A;  2NWG A;  2CH4 W;  4L63 B;  2PQA B;  3GV3 A;  1HUM A;  2YTX A;  1ML0 D;  4WFN 3;  1WD0 A;  1SLJ A;  1L0W A;  3ND9 A;  1YNJ C;  4BXX G;  3E0E A;  4RGT A;  4KKS A;  4X64 L;  5FKA C;  5KNB A;  3VR4 A;  1NY4 A;  5I4D A;  5J1Z A;  3A54 A;  1RKN A;  1MGS A;  5KIX A;  4X6A H;  3G48 A;  4YHH L;  1YNX A;  3LWE A;  4KHZ A;  4X62 L;  3W1G A;  2A19 A;  1JQY D;  1ZKO A;  3PUZ A;  1STA A;  4ME5 A;  5D65 A;  1UWV A;  5C4J B;  3HKZ E;  4BY1 H;  4A93 H;  4IUQ A;  4GNX C;  3V05 A;  1BOS A;  5IY0 A;  2RHQ B;  1X3F A;  2N8N A;  2KA7 A;  3RLF A;  2QEJ C;  4JG2 A;  1XJV A;  1HR0 Q;  1TY2 A;  3VR6 A;  4KLK A;  4A3J B;  4HR7 B;  1WI5 A;  1IBL Q;  4JI0 L;  1AZQ A;  3D31 A;  1SYG A;  2I46 A;  3QOJ A;  1S72 A;  1KRS A;  1LTA D;  4KHV A;  1UE1 A;  2XWJ B;  1MJE A;  4A3L G;  1SBB B;  4Q0F A;  3UDX A;  5JEA J;  5C44 B;  3S9W A;  4DK6 C;  3PGZ A;  2Q2I A;  4NW2 A;  3DUZ A;  1SXT A;  4C2M H;  1E24 A;  2B2V C;  4DV7 L;  3RZD H;  3KFU A;  1X54 A;  1EUJ A;  1F2M A;  4WOR A;  3NHH A;  1FGB D;  4FO2 A;  4L5Q A;  2ZTD A;  4B9X A;  4A3D H;  3F2C A;  4GKJ L;  4DR5 Q;  2B2W A;  2K03 A;  1HA6 A;  1B4O A;  1U4M A;  5HY6 A;  4DUZ Q;  2AQ3 B;  3E9I A;  1XMQ L;  3LGJ A;  2HHH Q;  1DD2 A;  3OW2 A;  4F88 A;  1P8L A;  5E4W C;  1SE8 A;  4BBR H;  4KKU A;  2P5Z X;  2CQO A;  1WD1 A;  2IPK D;  3MXP A;  1K8M A;  4IPG A;  1TS5 A;  1LT5 D;  4A3M G;  5IIF A;  3KOJ A;  2EPB A;  2K14 A;  1Q90 A;  2O2L D;  1CSQ A;  2IWH A;  1PRT B;  2F03 A;  4OX9 L;  3AU7 A;  3SEB A;  3K7U C;  5GQO A;  4BBS H;  1T5E A;  1N8R C;  5JPM C;  1WTH A;  4H02 A;  3TS2 A;  3J81 j;  1HJP A;  5IOC A;  4OIJ A;  3T1H Q;  1QUQ A;  1VQJ A;  2R7Z G;  4CGY B;  1QOH A;  2BA0 A;  1XMO Q;  5JJI A;  1JIC A;  4JK1 C;  4A3K H;  1O7Z A;  1SNP A;  4AQY Q;  2WV6 D;  3GTP B;  1NMF A;  3H6M A;  2UXB L;  1SDF A;  4GOP B;  2IL8 A;  1LYL A;  4O0A A;  3MA2 B;  3M7N A;  1JOO A;  1BR9 A;  1JWU D;  3GQB A;  1XTD A;  3NTI A;  4DV2 Q;  1I6H H;  5I2X A;  1N33 Q;  2D0O A;  1EQQ A;  1J5E L;  2MO0 A;  3HZX A;  2J0T D;  3I2Z A;  4F87 A;  4P72 A;  1Z47 A;  4DNI A;  5L37 A;  4YHH Q;  2R6G A;  3ND8 A;  3R3O A;  4JI4 L;  4A3I G;  2Z4H A;  5G3L D;  2XGT A;  1ENC A;  3RMH A;  1NCV A;  1Q1B A;  4LF7 Q;  2FJ2 A;  1L1O C;  1Z7T A;  3MTS A;  4GLA C;  3TME A;  3CCJ A;  2MNA A;  4FF1 A;  2VQE L;  1PH9 A;  1XNQ Q;  1CKN A;  3W2D A;  3E9H A;  2FMM A;  3JAM E;  4YCW A;  3S1R B;  1G8Z D;  3HOX H;  4L8J A;  3F2B A;  1I94 L;  5JEA H;  4FVM A;  2EDG A;  4XIG S;  5CMD A;  2KEC A;  2EZV A;  1Q46 A;  2L55 A;  1AW7 A;  5T1I A;  3J80 L;  3I4N H;  5EBC A;  1B1Z A;  1Q8I A;  1EL0 A;  1II3 A;  3X3M A;  3FKI G;  2VZA A;  4G7H C;  3P1H A;  1FGU A;  1HCZ A;  1VQF A;  4RWS C;  3TZU A;  4ILW A;  3K58 A;  1GD7 A;  1S3O A;  5IYB H;  1VQ5 A;  1SMX A;  3KJO A;  5IYD H;  3TN2 A;  4PNY A;  2JJQ A;  1FNV A;  1LV9 A;  3DXJ C;  4DV5 Q;  1VCI A;  2AHO B;  2VUM G;  2B3G A;  4JOI C;  5M9O A;  2E2H H;  2R7Z B;  4AYB E;  1KD1 C;  2BE5 D;  1WTO A;  4IUR A;  4RCO A;  4DAY A;  2BA1 A;  2OF1 A;  1EYD A;  2RSO A;  2IW3 A;  4DNR B;  3JC6 6;  4JI2 Q;  2EY1 A;  1XPU A;  4LF5 Q;  5T1G A;  5CV7 A;  3T1Y L;  4ZRZ A;  2CVR A;  1STH A;  3HOU B;  4Y7N B;  1V1O A;  4R4T A;  3BVZ A;  4A93 G;  5IGF A;  2EYM A;  2PW7 A;  3S2D H;  1F2L A;  3S16 B;  2NVQ B;  2L5T A;  3FMC A;  4IAL A;  4DV6 L;  1TII D;  3CCL A;  1EWH A;  2ASB A;  2L9H A;  1RHP A;  3AFQ A;  1TKW B;  1MKH A;  4OX9 Q;  3EBE A;  4A3I B;  2B2V A;  3BVG A;  3J7A F;  3MEF A;  2K05 A;  2K5Q A;  4DR2 L;  2WIN B;  2F0P A;  3EQL C;  4K5V A;  3DEO A;  2EJG C;  2QA4 A;  1HNW Q;  4A4I A;  5BR8 L;  4KN7 C;  2YU9 H;  1C4Q A;  3J81 c;  1M4V A;  5ELD A;  2NVX H;  4K5X A;  1SFO B;  1CHQ D;  2ZJQ A;  2OXP A;  4EGV A;  4JBK A;  3K59 A;  2K32 A;  5KYL A;  4FP5 D;  1UE6 A;  2PZT A;  4DV0 L;  1R9T H;  3GTG H;  1GHK A;  3FKI B;  2F3V A;  4HIK A;  3TRZ A;  4JI4 Q;  4KY5 A;  3VR3 A;  4NXM Q;  1ENF A;  3U4V A;  2A68 C;  1UEB A;  2KED A;  5JVG 3;  1O7I A;  1FR3 A;  1VQ4 A;  4BBR G;  4RAU C;  3J7A V;  1EQT A;  4LWC A;  4LF6 L;  3M9B A;  3BZK A;  1CFM A;  3FP9 A;  2F4V Q;  5M5W H;  5ELO A;  3W5O A;  1E2W A;  2VUM B;  2IJ0 A;  4BS9 A;  1PH3 A;  2LXJ A;  2WII B;  4XYO A;  5FK9 C;  1YNN C;  4YIJ A;  1KLU D;  1PFM A;  4OO1 H;  2K52 A;  3I4M H;  2D0P A;  1ASZ A;  4P2C B;  4BBS G;  1XX8 A;  3P75 A;  4C3J G;  3PUW A;  4NMZ A;  1BBU A;  2F0K A;  5IP9 G;  3A8K E;  4Q5V A;  4A93 B;  2MO1 A;  3ULP A;  2K5V A;  1FL0 A;  2TMP A;  1X3E A;  4PV1 C;  2LY7 A;  3KYH C;  2JA5 G;  3VYR A;  2R93 H;  3ZYY X;  1MBY A;  4G7O C;  1QUQ B;  3D6W A;  1VQP A;  1EEI D;  4LF9 Q;  3EJI A;  4DUY Q;  2K7V A;  1CSP A;  2XVS A;  3BYT B;  1HA5 A;  1N34 L;  4YWL A;  4RFB A;  1QZH A;  1B70 B;  4PG3 A;  1L1O A;  1C48 A;  1WTP A;  1PTO D;  2VNU D;  3A74 A;  3FHW A;  3M4O H;  4DR6 L;  4XT3 B;  3TS0 A;  1DOK A;  4BY7 H;  2OQK A;  2PMZ B;  1B53 A;  5D14 A;  1TT2 A;  2GN5 A;  3BZC A;  4ALP A;  4DR1 L;  2MUY A;  1B50 A;  1YHA A;  3RZD B;  1XPO A;  1SYF A;  4ZAI A;  4HMJ A;  2Q2H A;  3L2P A;  5FLX c;  1JC7 A;  1X6O A;  2CFM A;  4MHE A;  2LKV A;  4DAP A;  2CCZ A;  1G6P A;  5JEA G;  2UUB L;  3QWN A;  2FMC A;  1BDO A;  1B3Q A;  1DJR D;  4IUT A;  3GTK B;  2C5C A;  2NYZ D;  1K8G A;  3I4N G;  4BBR B;  1SNO A;  1RL2 A;  5BN5 A;  3KF6 A;  2PI2 E;  2UUA Q;  4JOI A;  1IXR A;  3A5Z B;  3FVQ A;  2IHE A;  1H9S A;  3TP5 A;  4CJ1 B;  4DV1 L;  4XYQ A;  3VA5 A;  4MTK A;  5KNC A;  3D0F A;  2QDB A;  4LMQ D;  5I6Y A;  4BBS B;  5IYD G;  1K3R A;  4HID A;  3CCS A;  4B3M Q;  2I07 B;  4C3J B;  2XRQ D;  2CW0 C;  4DV3 Q;  2JYO A;  4KKT A;  2QEX A;  1BNZ A;  5COR A;  1M1K C;  3WWV A;  2E5L L;  2JA7 H;  3NPP A;  5EAY A;  2WAQ E;  2G9H D;  4AH6 A;  2JA5 B;  4DK1 A;  4ODG A;  3BZD B;  2MHV A;  4K2L A;  1AE2 A;  4YY3 Q;  3EFX D;  5C3X A;  5IGG A;  3RN5 A;  3TP8 A;  4DAY B;  1SE4 A;  1ET6 A;  5JAV A;  1DYQ A;  3ZJY C;  5JVH 3;  1KQS A;  1X3G A;  4RH6 A;  4DPG A;  3GTL B;  4C3I H;  3PQI A;  3D3R A;  1I4G A;  2DJG C;  1NR4 A;  1GUO A;  1SYC A;  5C4X H;  3ULJ A;  1E2V A;  4LNQ A;  4R9W A;  2VXW A;  1TY0 A;  2F1M A;  3PO2 H;  1STG A;  3ERQ A;  2K50 A;  4DR7 Q;  2EJF C;  4K5W A;  4A75 A;  4FF2 A;  1G91 A;  4WRD A;  4K0K L;  2MP1 A;  3H94 A;  4DXG A;  4HJ8 A;  2A6H D;  3ERO A;  4JI5 L;  1LTT D;  1CKM A;  1Y1V H;  3HS0 C;  1EEF D;  4V0B A;  5IP7 H;  3HG9 A;  5C0X I;  1I3Q H;  4OWX B;  3TP6 A;  3KBG A;  3KF8 A;  5CV9 A;  5JJK A;  2Q2T A;  1K8O A;  2R61 A;  3MXG A;  4ZUI A;  1ZYR C;  2VQF Q;  3VYU A;  1PRT D;  4G7Z C;  1BUV T;  1A0I A;  1STN A;  5EJW A;  3AMU A;  4A3B H;  4DR6 Q;  1Y1W G;  2AWN A;  5GRO A;  3PF5 A;  4N9P A;  4YWK A;  2D62 A;  5DLQ E;  3L3O C;  3NQT A;  1X3Q A;  2PZW A;  2F0L A;  5KRU A;  2NZH A;  1SYD A;  1EY9 A;  1BBW A;  1IKL A;  3QIA A;  2IX0 A;  1DGS A;  3L9A X;  5D3D A;  1HTP A;  3EVQ A;  5I2Y A;  2K4K A;  4CJ2 C;  2B2T C;  4Y52 H;  1ILP A;  3TZD A;  1IBL L;  1IKM A;  1G6Z A;  2OCE A;  4LF8 Q;  3HOY H;  3HOW G;  1SMY D;  3S2D B;  4QUF A;  2VW9 A;  3GO5 A;  4EX5 A;  1SR3 A;  1NSN S;  3CXC A;  1EY6 A;  2N88 A;  3PMF A;  3T51 B;  1I50 B;  1WCM H;  2C35 B;  5IGD A;  3J81 i;  1O78 A;  1Q7Y C;  1MD2 D;  2L4N A;  1XNR Q;  1HH2 P;  2EVB A;  3AB9 A;  1PH4 A;  1JWM D;  1EFI D;  2M00 A;  3I4O A;  5K5P A;  2K28 A;  1PH7 A;  2E2J H;  3EIV A;  3CQZ H;  3I70 A;  1U4P A;  2KCC A;  4DR5 L;  2CH4 A;  3MEH A;  1DCZ A;  3ONA B;  4BY7 G;  4DUZ L;  2E5L Q;  2HHH L;  3DEP A;  3VDY A;  1L1O B;  5FJ8 H;  4QB4 A;  2NVX B;  1KAA A;  1ET9 A;  2R92 H;  3PIO 3;  1F2Z A;  4A3G H;  4NB3 A;  5M3M G;  4FXG C;  4A3C H;  3TDQ A;  3TSS A;  2QCP X;  2WAQ G;  3GD7 A;  2F0M A;  5CGK A;  5G3L F;  5C0X J;  1EWI A;  1Y1W B;  3MXU A;  3HRZ C;  4UHV A;  2A6E D;  5GAH C;  1BO0 A;  4WJW A;  2QIL A;  4KHP L;  1EYA A;  4JYA L;  3CHB D;  1IYJ B;  1OXU A;  3T1H L;  5C3E H;  1NBW A;  4JI5 Q;  5EKK A;  5EKI A;  2K33 A;  3CCE A;  2I5H A;  4AQY L;  3NEM A;  3CCV A;  3S14 H;  4QCL A;  2PNH A;  3CC4 A;  5DAU A;  2ICE C;  1MJC A;  1J6Q A;  5E4X A;  4BA2 I;  3KF6 B;  3A55 A;  2F0W A;  1PA6 A;  4DV2 L;  2XSC A;  1Y14 B;  1H9S B;  5EPJ A;  3HOW B;  1N33 L;  1A2U A;  1EY7 A;  1QB5 D;  3J80 c;  1ROD A;  1IBM L;  2DJF C;  2KHI A;  1Q86 C;  4FXD A;  3CCR A;  3Q8D A;  1UAP A;  2UXC L;  3STB D;  3SXH A;  3DMU A;  4ME3 A;  3SR1 A;  1Q82 C;  1HZB A;  2VL6 A;  5FO9 B;  2NVT H;  3CPF A;  1OXS C;  3CRK C;  5C5L A;  4LF7 L;  1FNU A;  3VR5 A;  1SYE A;  1W2B A;  3GTJ H;  1BXT A;  1XNQ L;  2OWO A;  3K0Y A;  2Z6K C;  3BG3 A;  1JR0 D;  3K81 C;  5C4X G;  3M4O B;  4ABN A;  4JI8 Q;  4BY7 B;  1YJN A;  2X6L A;  2F0G A;  1PH1 A;  3K0X A;  5A2Q L;  3PO2 G;  4LK1 C;  5ELB A;  5LMN Q;  1SNM A;  2CWA A;  3S2H B;  1V1Q A;  1A6X A;  1F77 A;  2PW5 A;  5M3M B;  4XDX A;  1KL9 A;  2QF7 A;  1W3S A;  4PMB A;  3CC2 A;  2IY5 B;  2WAQ B;  2LXK A;  3NWS A;  5IP7 G;  2ZJP A;  2ZT9 C;  2B8F A;  4HCS A;  1U4R A;  4OEM B;  5C4H A;  4IUN A;  1JOR A;  3D4W A;  3M4Q A;  5LMU L;  4TQU S;  2Z8L A;  3BDC A;  5FO7 B;  4DV5 L;  5IT9 c;  3C1E A;  1PHJ A;  1A15 A;  4QQB X;  1WVL A;  3C2P A;  3M85 A;  1W6J A;  2JA6 G;  3KF8 B;  1VQD A;  4JI2 L;  3U9O A;  2Q8T A;  3TQY A;  1HR0 W;  4LF5 L;  4GN3 B;  1Z6H A;  4OO1 I;  1GM5 A;  5C0X H;  3ER0 A;  2Y0S E;  1NUC A;  3U4Z A;  4KI0 A;  2B2T A;  4MNO A;  1NAP A;  1LT6 D;  3PV0 A;  3U58 A;  5HGQ A;  3NK9 A;  4XXE A;  1KIX A;  2D5D A;  3GTQ H;  2A69 D;  4CKE A;  1DM0 B;  1K0R A;  3G6E A;  2AQ1 B;  2CHB D;  2KEN A;  3NSW A;  1GUN A;  1KRT A;  5CC4 A;  3K5L A;  1JOQ A;  4NP5 A;  5CBE E;  1PYW D;  1SAP A;  4GLV B;  4KHP Q;  4EVO A;  4JYA Q;  2NTS A;  4K8I A;  3HOY G;  1D5X C;  3NEL A;  1IL8 A;  2LS0 1;  2TSS A;  3K7A H;  4HCE A;  1HNW L;  1M90 C;  2ZXR A;  1N36 Q;  4C56 C;  1WCM G;  3BS1 A;  4B3S L;  2JXM B;  2FXQ A;  2EY6 A;  2F3W A;  4IUU A;  1K83 H;  2JA8 H;  3S15 H;  2PQE A;  2PO4 A;  1PLF A;  4QIW B;  3PO2 B;  4A3F H;  3M7G A;  3NBI A;  1D6E C;  5M5X B;  2BDN A;  2F0T A;  1IBM Q;  2NUC A;  1E3P A;  1AN8 A;  2UXC Q;  4DN4 M;  4NXM L;  4DXF A;  1JE4 A;  1OXX K;  1FYC A;  2HD3 A;  4OHJ A;  3VYT A;  5FJ8 G;  3K57 A;  3UDG A;  2GVB A;  2R92 G;  3E3X A;  2JK8 A;  4A3G G;  1YNJ D;  1QZG A;  4A3C G;  5I9O A;  2F4V L;  1KNA A;  3GTO H;  4DF7 A;  3DM1 A;  2D2C C;  1PV4 A;  2K1B A;  3HKZ G;  5C3W A;  4IO9 A;  2JA6 B;  4RHS A;  2MJ8 A;  1XYI A;  4MIU A;  1JE5 A;  1CQF A;  4HN7 A;  2O5J C;  1HNX Q;  3NXW A;  1TVX A;  5C3E G;  4C3H G;  4ZCK A;  5J22 A;  2JE6 I;  1V43 A;  2E8G A;  1SJE D;  1N9W A;  4ZUJ A;  4M8A A;  2UU9 L;  2DY7 A;  2WB1 E;  4X66 Q;  4A3M B;  4HIM A;  1OXT A;  5EKL A;  4LF9 L;  3RZO B;  5IGB A;  4FYD A;  4DUY L;  2F0I A;  4YWM A;  3KJP A;  2ALY B;  1SN8 A;  5FLM H;  5LMU Q;  3HOY B;  4GNX A;  3GTM B;  1QCB D;  2DY8 A;  4IPC A;  5M5Y B;  2Z6K A;  1F9R A;  1DOM A;  3DWQ A;  1HQR D;  1WCM B;  1LAB A;  2H5X A;  3G4S A;  2B2U C;  2VB3 X;  3R8B A;  1KDA A;  1C0A A;  4HAE A;  1HFG A;  4NPS A;  4BY1 G;  2HDM A;  2RCN A;  2B63 H;  1A2T A;  4OXP A;  2CQA A;  4DGZ A;  2L0C A;  5CR3 A;  3EA6 A;  4I65 A;  4QJF A;  1EYG A;  4PZ7 A;  5E3F A;  3VYS A;  3SGI A;  1LTR D;  3V96 A;  4HJ5 A;  3A7L A;  4RKB A;  2OEO A;  5IT9 L;  3S1M H;  2ZTC A;  3CCU A;  4XQQ A;  2R92 B;  3ERS X;  1CM9 A;  4A3G B;  2Q8R E;  3NEN A;  5AFW A;  1N32 Q;  1UE5 A;  2XRS D;  2UUA L;  1VF5 C;  2MFI A;  4UAI A;  4QY7 A;  3SHL A;  1E1T A;  2ZM6 Q;  4B3S Q;  1TU2 B;  4JI3 L;  1A8V A;  2XWB B;  3HKZ B;  1TWA H;  1YI2 A;  3OYY A;  4A3E H;  2A8V A;  4DU9 A;  4R4Q A;  3S1Q H;  4B3R L;  2E74 C;  1PFN A;  3KLR A;  1TR5 A;  3FPU B;  4B3M L;  3BDL A;  1BCP B;  4C1N I;  4DV3 L;  4A3D G;  1EY5 A;  1PFS A;  4K6L A;  2O4X A;  4RGM A;  1B7Y B;  1PFB A;  2NBF A;  1LTB D;  2Z9H A;  4C3H B;  4EQN A;  2JN4 A;  3J80 i;  2I5L X;  3CMA A;  3HEJ A;  1EU3 A;  3QR8 A;  3J80 E;  1EQV A;  5C0X G;  4YY3 L;  3K5N A;  3H3V H;  4P73 A;  4UP9 A;  4DKA C;  4CJ0 B;  5M3F H;  2QKI C;  3WDN A;  3LNN A;  4KD3 A;  1VQN A;  3SK6 A;  1AP0 A;  4ZK9 B;  1I4R A;  4DAV A;  3LWU A;  2IX3 A;  1ASY A;  4LFC L;  3DM3 A;  4JPB W;  1SYB A;  3W3A A;  1PH5 A;  2L11 A;  4LW1 A;  2F0U A;  1VQK A;  1PTO H;  2Z0S A;  3A8I E;  4DR7 L;  1PZI D;  2K6A A;  3I72 A;  3Q6S A;  2NVT B;  4BY1 B;  3PO3 H;  2UXD L;  1QWY A;  3WOE A;  2A6H C;  1B3A A;  1BF4 A;  2NZ1 D;  2K5N A;  2E2I H;  3CME A;  1GUG A;  4KJN A;  1QG7 A;  4A3K G;  2ATW A;  1UE7 A;  1RD9 D;  1EIH A;  5LL6 S;  4CDE C;  4PQX A;  2UU9 Q;  5GAG C;  1A62 A;  1SJH D;  1HUN A;  2JP1 A;  4HSV A;  1PVO A;  2F0V A;  4HTH A;  4TSS A;  1YJW A;  1IW7 D;  2JA8 G;  4A3F G;  2VQF L;  4A76 A;  4DAM A;  4TVA B;  1QNK A;  1R4P B;  3H09 A;  1HZC A;  2B2Y C;  2WB1 G;  4U68 A;  1L0Y B;  2NN6 I;  1X32 A;  2F0N A;  1I5F A;  3IFT A;  3TRE A;  1KXL A;  2IHF A;  4LUO A;  2RSN A;  4C2M B;  3CCM A;  2PYK A;  2JQO A;  4F8M A;  4DR4 Q;  2K04 A;  1PH8 A;  2DNC A;  4AYB G;  2UUC Q;  1HZ9 A;  1XPR A;  1HFN A;  1TXY A;  5TSS A;  3OIQ A;  5EBD A;  2F0J A;  4A3D B;  4GZY C;  3GP7 A;  1X9N A;  5CV4 A;  4ZKC B;  2DNE A;  3HOX G;  2KBN A;  4X3K A;  2MGS A;  3S24 A;  1B8A A;  4Z9C B;  3C46 A;  2G9D A;  1CKN B;  4DK3 C;  1VQ8 A;  3UDF A;  1LTL A;  4LF8 L;  2J7Z A;  1C8C A;  1CZG A;  3KDF A;  4R4O A;  4IPH A;  4EQO A;  1ICF B;  1GO3 E;  3T53 B;  4O42 A;  5C44 H;  4JCV E;  2D9U A;  1VDZ A;  4IJL A;  4OON A;  4JI3 Q;  5JJZ A;  1WTW A;  4HIO A;  1XNR L;  5IE8 A;  3I91 A;  4OEL B;  1RJT A;  5IYB G;  4OGQ C;  4B3R Q;  2JEB I;  5FLM G;  2PQA A;  1MI2 A;  4QGU A;  1WOC A;  1SND A;  5KYI A;  1FJG Q;  4R8I A;  3DHQ A;  2EXZ A;  2L15 A;  2WP8 J;  3PIO A;  3TEH B;  1XXG A;  1JT8 A;  4RKL A;  1I4X A;  2PI2 A;  4A3K B;  1WTQ A;  1S5F D;  4RCN A;  1CZW A;  3TP7 A;  3OPO A;  4GNX B;  1CA6 A;  1WFQ A;  1QVG A;  2B63 G;  5C6A A;  1CHP D;  1K83 B;  2F0Q A;  2ICI A;  5DEH A;  4U67 3;  1SNC A;  3C3L A;  1ESR A;  4BXX H;  1I6H B;  2NVY H;  5JPN C;  1WTV A;  4DV4 Q;  1F9P A;  1VMP A;  1XWE A;  4LFC Q;  4C1N K;  3A56 A;  1BBX C;  3E5S A;  3NTK A;  2A6E C;  4PZ6 A;  3HP3 A;  1AH9 A;  3H0G H;  1S5B D;  2HUG A;  2ID0 A;  3CP0 A;  4TKO B;  4BWG B;  2UXD Q;  4AYB B;  1G2T A;  2Z4I A;  3LX0 A;  4K8J A;  5EGT A;  5JOB A;  3E0J A;  4O1N A;  1EIG A;  3NTH A;  4IZ8 A;  4H0L C;  2HIX A;  1B9N A;  1V9P A;  3A5U A;  2H4O A;  1UNS A;  3HOX B;  4LJZ C;  4EQ5 A;  3ULL A;  4JI6 L;  3I73 A;  2QGQ A;  1KAB A;  4P75 A;  1STY A;  1AFP A;  3I4N B;  1PYB A;  4HED A;  2FFK B;  3T56 B;  1VQE A;  1QVF A;  1DZ1 A;  1Q8K A;  3A7A B;  2QW7 A;  2YTY A;  2ZXP A;  4IUP A;  1RTN A;  2EYP A;  4JI1 Q;  3SK4 A;  1UEA B;  3OWF A;  4CKC A;  4LFB Q;  1DXM A;  3N6R A;  4J15 A;  4FDB A;  5I9P A;  1R4Q B;  5IWA Q;  5ELE A;  4J1M A;  1K8A C;  1LTS D;  4S3S A; 
#chains in the Genus database with same CATH homology
 3FKI G;  3K0X A;  3PO2 G;  2VZA A;  1YJ9 A;  4GS3 A;  3S1R H;  2VS1 A;  5LMN Q;  4GOP C;  1Z9F A;  3UE0 A;  5IWA L;  4JI8 L;  2CWA A;  1FGU A;  1VQF A;  1V1Q A;  3KLW A;  4OO1 G;  3I4M G;  1KL9 A;  1JJG A;  1Q12 A;  1W3S A;  1GD7 A;  1U5K A;  2LSS A;  1S3O A;  5IYB H;  1VQ5 A;  1SMX A;  3CC2 A;  2IY5 B;  5LMN L;  2LXK A;  5IP7 G;  3KJO A;  3J7Z C;  2ZJP A;  3PO3 G;  5IYD H;  2I0Q A;  2JJQ A;  1Q81 C;  3JAM c;  4A3J H;  1RIP A;  4DV5 Q;  1VCI A;  2AHO B;  3T1Y Q;  2B3G A;  4JOI C;  4LUV A;  2E2H H;  2VUM G;  2KHJ A;  1FVI A;  4AYB E;  1KD1 C;  4JV5 Q;  1A63 A;  3U50 C;  1PH6 A;  2BA1 A;  3M4Q A;  5LMU L;  4JBJ A;  4TQU S;  3S2H H;  3JC6 6;  4JI2 Q;  1XPU A;  3M3Y H;  2R93 G;  3K8A A;  4LF5 Q;  5M3M H;  4DV5 L;  4DV6 Q;  5IT9 c;  3T1Y L;  3CC7 A;  4UP7 A;  1PHJ A;  4QQB X;  1L2F A;  3M85 A;  1D8L A;  4R4T A;  4A93 G;  2AMC B;  2BH8 A;  3KF8 B;  1VQD A;  4JI2 L;  2JA6 G;  3S2D H;  3A0J A;  3TQY A;  4LF5 L;  1HR0 W;  4LUZ A;  2IX1 A;  4GN3 B;  4DV6 L;  4R4I A;  4OO1 I;  1GM5 A;  3ER0 A;  3CCL A;  1TWH H;  2ASB A;  2Y0S E;  3U4Z A;  4KI0 A;  5AJ3 L;  2R7F A;  3AFQ A;  1MKH A;  4MNO A;  1EIF A;  4POF A;  3PV0 A;  3U58 A;  1SRU A;  4R4C A;  5HGQ A;  4DR2 Q;  4OX9 Q;  3EBE A;  3HOU H;  1KIX A;  5BR8 Q;  3GTQ H;  1K0R A;  2WFW A;  2NVQ H;  3MEF A;  1EOV A;  1T9H A;  3G6E A;  3HOZ G;  3AQQ A;  2KEN A;  4DR2 L;  1KRT A;  1EFW A;  2QA4 A;  1HNW Q;  4A4I A;  1YVC A;  5BR8 L;  2HIV A;  5ELN A;  2YU9 H;  4IFD G;  4GLV B;  4AIM A;  3OTO L;  3PF4 A;  4KHP Q;  3J81 c;  4JYA Q;  3HOV G;  3RNU A;  3HOY G;  3NEL A;  4JBW A;  3RLN A;  2GVA A;  2ZTE A;  3K7A H;  2NVX H;  1HNW L;  4YCV A;  1M90 C;  4DV0 Q;  1LUZ A;  2ZJQ A;  3RN2 A;  4JBK A;  1N36 Q;  1U0L A;  1WCM G;  3HFZ B;  2BH2 A;  4B3S L;  2VY3 A;  2ZJR A;  2FXQ A;  1UE6 A;  4DV0 L;  1R9T H;  3GTG H;  3AYH B;  1N36 L;  1K83 H;  1VQH A;  2JA8 H;  4UY8 C;  3S15 H;  1G51 A;  4HIK A;  4A3F H;  3TRZ A;  3BJU A;  4JI4 Q;  4LF6 Q;  2NZO A;  4NXM Q;  4JI6 Q;  2KCM A;  3KDF B;  3U4V A;  2ES2 A;  4JC0 A;  1UEB A;  4X65 L;  1IBM Q;  1O7I A;  2CKZ B;  1VQ4 A;  1E3P A;  4BBR G;  2AWO A;  3GTP H;  1YZ6 A;  2UXC Q;  4LWC A;  4LF6 L;  4NXM L;  3M9B A;  1OXX K;  4RMF A;  2N3S A;  3BZK A;  3FP9 A;  1C9O A;  4A3E G;  2F4V Q;  5M5W H;  4P71 A;  5FJ8 G;  5ELO A;  3W5O A;  1VQ7 A;  3UDG A;  2GVB A;  3FKI H;  2R92 G;  1PH3 A;  2LXJ A;  3CW2 C;  2JK8 A;  2JA7 G;  4A3G G;  1H95 A;  1QZG A;  3UDI A;  5M5X H;  4A3C G;  1WJJ A;  2F4V L;  1E1O A;  2K52 A;  1OTC A;  2D0P A;  1VQO A;  1ASZ A;  3I55 A;  1BKB A;  1HZA A;  3GTO H;  3I4M H;  4BBS G;  5JJL A;  4A3L H;  2HT1 A;  3B6Y A;  3RR5 A;  3PUW A;  3STB C;  3PSI A;  1BBU A;  1PV4 A;  4UP8 A;  5IP9 G;  3HKZ G;  2MO1 A;  2EIF A;  1VS0 A;  3NBH B;  4IO9 A;  3ULP A;  2K5V A;  1FL0 A;  3DLL A;  1X3E A;  2VUM H;  4O2D A;  5M3F G;  3ICE A;  3PUV A;  1N34 Q;  1JE5 A;  4APV A;  3KYH C;  2EXD A;  2JA5 G;  1SRO A;  1JB7 A;  2RHS B;  2R93 H;  1HNX Q;  3GDE A;  5C3E G;  1HNZ Q;  1QUQ B;  4LF9 Q;  1VQP A;  2V1C C;  4DUY Q;  1KHI A;  2JE6 I;  1CSP A;  3H0G G;  1V43 A;  2E8G A;  1Q1E A;  1N9W A;  4YWL A;  1NJI C;  1N34 L;  1K9M C;  1QZH A;  4R1J A;  2UU9 L;  2K75 A;  2JA6 H;  2WB1 E;  1B70 B;  4X66 Q;  1HNX L;  4PG3 A;  4HIM A;  1L1O A;  3G71 A;  1HNZ L;  1OXT A;  4LF9 L;  4NXN Q;  3CF5 A;  1Y1V G;  4DR1 Q;  4DUY L;  2VNU D;  1YHQ A;  4YWM A;  3KJP A;  2ALY B;  1SN8 A;  3A74 A;  3FHW A;  3M4O H;  4DR6 L;  3TS0 A;  2YYZ A;  5FLM H;  5LMU Q;  4BY7 H;  1VQG A;  2OQK A;  4X66 L;  4NXN L;  4GNX A;  4QIW E;  2GN5 A;  3BZC A;  4ALP A;  4DR1 L;  3H3V I;  1YHA A;  4IPC A;  1X55 A;  2OQ0 A;  4A3M H;  1XPO A;  3J7A 5;  2Z6K A;  1KAW A;  4GLX A;  1VQB A;  1HR0 L;  2Q2H A;  2H5X A;  3L2P A;  3G4S A;  1VQL A;  5FLX c;  2UUB Q;  3RZO H;  4HJ9 A;  3CAM A;  1TWG H;  1X6O A;  2CFM A;  1EQR A;  4A3B G;  4MZ9 A;  1C0A A;  1P16 A;  4NPS A;  4BY1 G;  5AJ3 Q;  2EQS A;  2CCZ A;  2RCN A;  2B63 H;  4OXP A;  1G6P A;  4YCU A;  5JEA G;  2UUB L;  4L5T A;  4GOP A;  1KC8 C;  2R7Z H;  2MQH A;  3GTM H;  2R7D A;  3CD6 A;  5M5Y H;  4B3T Q;  4QJF A;  1QVC A;  4PZ7 A;  1OXV A;  1K8G A;  1EYG A;  5LMN W;  3I4N G;  3SGI A;  1IBK L;  5IYC H;  4HJ5 A;  5H1S E;  4UPA A;  1RL2 A;  4DV1 Q;  4DR3 Q;  3KF6 A;  2PI2 E;  2CWP A;  4QL5 A;  4Y7N H;  3S1M H;  2UUA Q;  4B3T L;  2ZTC A;  4JOI A;  3OTO Q;  1IXR A;  2OTL A;  3S16 H;  3A5Z B;  3W1B A;  1NTG A;  2IHE A;  3ERS X;  1YBY A;  3CCU A;  4JI7 Q;  5GAE C;  4L5R C;  3F8T A;  4DV1 L;  4IFD J;  4DR3 L;  3GTK H;  3NEN A;  1N32 Q;  1UE5 A;  3H15 A;  2UUA L;  3D0F A;  2MFI A;  1AE3 A;  4QY7 A;  5IYD G;  1K3R A;  1E1T A;  4HID A;  1PYS B;  2ZM6 Q;  3CCS A;  4B3M Q;  4JI7 L;  4B3S Q;  4A3J G;  4JI3 L;  4A3I H;  4DV3 Q;  1A8V A;  4XTC S;  3I7F A;  1TWA H;  1YI2 A;  3OYY A;  4A3E H;  2QEX A;  1N32 L;  4GN4 B;  2A8V A;  2UXD Q;  4R4Q A;  3S1Q H;  3UE1 A;  4B3R L;  1M1K C;  3PIP A;  3PUX A;  3WWV A;  2HQL A;  3BU2 A;  1E7Z A;  2ZM6 L;  2E5L L;  4B3M L;  2JA7 H;  5EAY A;  2WAQ E;  4AH6 A;  4DV3 L;  4A3D G;  2JA9 A;  1PFS A;  4LF4 L;  2OTJ A;  1IZ6 A;  4YY3 Q;  1AE2 A;  1B7Y B;  2PMZ E;  4PZ8 A;  4X65 Q;  5C44 G;  3EN2 A;  2K5H A;  3RN5 A;  2KCT A;  4IOA A;  1S40 A;  3J80 i;  2I5L X;  4DAY B;  4C3J H;  3CMA A;  5IP9 H;  3ZJY C;  3L0O A;  1SFO H;  1JMC A;  1KQS A;  5C0X G;  1BVS A;  4YY3 L;  3H3V H;  4P73 A;  4UP9 A;  4DKA C;  1X3G A;  5M3F H;  4IFD I;  4IPD A;  4DPG A;  2N49 A;  4C3I H;  1TWC H;  1K73 C;  4WJ3 M;  1MIU A;  3CCQ A;  1PH2 A;  5C4X H;  1VQN A;  1JJ2 A;  2JA5 H;  1WYD A;  3ULJ A;  4K0K Q;  4LNQ A;  3HKS A;  1D7Q A;  3HOU G;  3CPW A;  4C3H H;  1XMO L;  1ASY A;  1CUK A;  3PO2 H;  4DR7 Q;  2K50 A;  4LFC L;  1C7Y A;  4RG1 A;  4A75 A;  2PQA B;  3DM3 A;  4K0K L;  2YTX A;  4HJ8 A;  1PH5 A;  4X64 Q;  4JI5 L;  4LW1 A;  1CKM A;  1VQK A;  1SLJ A;  1Y1V H;  1L0W A;  2N78 A;  2Z0S A;  3GTL H;  2NN6 G;  2YV5 A;  4DR7 L;  5IP7 H;  1VQM A;  3PO3 H;  4X62 Q;  2UXD L;  5J3B A;  4BXX G;  3E0E A;  4X64 L;  2K5N A;  1YEZ A;  5C0X I;  2E2I H;  3CME A;  1I3Q H;  1NY4 A;  4OWX B;  4GKK L;  4A3K G;  2ATW A;  1UE7 A;  4X6A H;  3G48 A;  4YHH L;  1YNX A;  4OWW B;  5JJK A;  2Q2T A;  4KHZ A;  4X62 L;  2UU9 Q;  5GAG C;  1A62 A;  3W1G A;  2VQF Q;  2A19 A;  3RLO A;  3PUZ A;  1CKO A;  1PVO A;  4IOC A;  2F3I A;  1A0I A;  2DUD A;  1GVP A;  1YJW A;  3JAM i;  1UWV A;  4A3B H;  4OWT B;  2JA8 G;  4DR6 Q;  3HKZ E;  4BY1 H;  4A93 H;  1Y1W G;  1VQC A;  2AWN A;  5GRO A;  1VQI A;  2VQF L;  4A76 A;  4YWK A;  4TVA B;  4DAM A;  4GNX C;  4A3F G;  2D62 A;  3PF5 A;  4MTN A;  3S1N H;  5DLQ E;  5IY0 A;  2RHQ B;  1X3F A;  1HZC A;  2IT1 A;  2N8N A;  2WB1 G;  3AEV A;  3F2D A;  3RLF A;  2NZH A;  2NN6 I;  4JI0 Q;  1BBW A;  4JG2 A;  1XJV A;  1HR0 Q;  2IX0 A;  1I5F A;  5E7N A;  3TRE A;  1KXL A;  1DGS A;  2IHF A;  4KLK A;  4LUO A;  3F1Z A;  3CCM A;  4LFA L;  1WI5 A;  2JQO A;  1IBL Q;  4JI0 L;  1TWF H;  4DR4 Q;  1PH8 A;  4AYB G;  3D31 A;  1HZ9 A;  2K4K A;  1XPR A;  2UUC Q;  1TXY A;  3HOZ H;  1S72 A;  1KRS A;  1UE1 A;  2RF4 A;  4Y52 H;  4DV7 Q;  1MJE A;  2DGY A;  1X9N A;  1IBL L;  4A3L G;  4DR4 L;  2OCE A;  2XTI A;  3UDX A;  1YHB A;  5JEA J;  2UUC L;  4DK6 C;  3PGZ A;  1VQ6 A;  3HOV H;  3HOX G;  4LF8 Q;  3HOY H;  2Q2I A;  3HOW G;  1IBK Q;  1NE3 A;  2KBN A;  1X56 A;  3S24 A;  5K36 G;  4C2M H;  2VW9 A;  1B8A A;  3GO5 A;  1E24 A;  4EX5 A;  1SR3 A;  3CXC A;  4DV7 L;  1CKN B;  3RZD H;  4GKJ Q;  4DK3 C;  1VQ8 A;  4PMW A;  3KFU A;  1X54 A;  1EUJ A;  1WCM H;  3UDF A;  1LTL A;  2Y0S G;  4LF8 L;  2C35 B;  4L5Q A;  3J81 i;  1VQA A;  1XMQ Q;  2ZTD A;  3KDF A;  4R4O A;  4IPH A;  1Q7Y C;  4A3D H;  1XNR Q;  3F2C A;  3S17 H;  1HH2 P;  4JV5 L;  1GO3 E;  1LM0 A;  4GKJ L;  1PH4 A;  3IRB A;  4DR5 Q;  5C44 H;  4JBM A;  4JCV E;  3I4O A;  5HY6 A;  4DUZ Q;  4IJL A;  1PH7 A;  3E9I A;  4OON A;  1XMQ L;  2E2J H;  3LGJ A;  2HHH Q;  3EIV A;  4JI3 Q;  3CQZ H;  4HIO A;  3OW2 A;  1XNR L;  1X65 A;  5IE8 A;  4L5S A;  1P8L A;  1JJC B;  1E22 A;  5IYB G;  4DR5 L;  1I50 H;  1SE8 A;  4B3R Q;  2JEB I;  5FLM G;  4BY7 G;  4BBR H;  4DUZ L;  2B29 A;  1G29 1;  2PQA A;  2E5L Q;  4IJH A;  2CQO A;  1WOC A;  4QGU A;  2HHH L;  1FJG Q;  3VDY A;  4IPG A;  4LF4 Q;  1L1O B;  2L15 A;  2WP8 J;  3PUY A;  5FJ8 H;  3PIO A;  3TEH B;  1JT8 A;  2R92 H;  4A3M G;  2PI2 A;  4A3G H;  4NB3 A;  5M3M G;  3KOJ A;  2Q2U A;  2K14 A;  1FJG L;  4A3C H;  1CSQ A;  4OX9 L;  4GNX B;  3K7U C;  2WAQ G;  5GQO A;  4HJA A;  4POG A;  1WFQ A;  4BBS H;  3GD7 A;  1N8R C;  1QVG A;  2B63 G;  3L7Z C;  4H02 A;  3TS2 A;  5C0X J;  3J81 j;  1HJP A;  1EWI A;  4BXX H;  3T1H Q;  1QUQ A;  1VQJ A;  2R7Z G;  2UXB Q;  2NVY H;  2BA0 A;  1XMO Q;  5GAH C;  5JJI A;  4DV4 Q;  4KHP L;  4A3K H;  4GN5 A;  4LFC Q;  4JYA L;  1IYJ B;  2I5M X;  1EIY B;  4AQY Q;  1OXU A;  5IYC G;  4WJ4 A;  1NMF A;  3T1H L;  2UXB L;  4GOP B;  5C3E H;  1NBW A;  4JI5 Q;  4PZ6 A;  4P74 A;  1LYL A;  4O0A A;  1J5E Q;  1AH9 A;  3H0G H;  3M7N A;  4DV4 L;  3CCE A;  1IL2 A;  2ID0 A;  2I5H A;  3CP0 A;  1XTD A;  3NEM A;  4AQY L;  3CCV A;  2AKW B;  3I56 A;  4DV2 Q;  1Y1W H;  3S14 H;  3AFP A;  2PNH A;  3K80 C;  1I6H H;  3CC4 A;  1N33 Q;  2D0O A;  1MJC A;  1J6Q A;  2F52 A;  1EQQ A;  2MO0 A;  2HIX A;  1J5E L;  3KF6 B;  1V9P A;  3I2Z A;  3A5U A;  4P72 A;  4BA2 I;  4GKK Q;  1Z47 A;  4DNI A;  4YHH Q;  2R6G A;  1PA6 A;  4DV2 L;  4JI4 L;  2VQE Q;  1Y14 B;  2YTV A;  4HJ7 A;  4A3I G;  4EQ5 A;  1N33 L;  3ULL A;  4JI6 L;  2QGQ A;  2XGT A;  3J80 c;  1IBM L;  2A1A A;  4P75 A;  1Q1B A;  4LF7 Q;  2KHI A;  1Q86 C;  1L1O C;  3CCR A;  3Q8D A;  4GLA C;  3CCJ A;  1YIT A;  2MNA A;  3STB D;  2VQE L;  1YIJ A;  1PYB A;  1I94 Q;  1VQ9 A;  2UXC L;  1PH9 A;  4ME3 A;  1Q82 C;  1HZB A;  2VL6 A;  1CKN A;  1XNQ Q;  2NVT H;  1NMG A;  1VQE A;  1OXS C;  3CPF A;  1QVF A;  5GAD C;  3E9H A;  4LF7 L;  4YCW A;  1Q8K A;  2YTY A;  3HOX H;  3F2B A;  1I94 L;  3HOW H;  1GKH A;  3MXN B;  4JI1 Q;  1W2B A;  3GTJ H;  4LFB Q;  4XIG S;  1XNQ L;  4LFA Q;  2OWO A;  1Q46 A;  2Z6K C;  3K81 C;  4J15 A;  4FDB A;  5C4X G;  4BA1 I;  3I4N H;  3PCO B;  5IWA Q;  4JI8 Q;  4JI1 L;  1YJN A;  4LFB L;  1K8A C;  3M4P A;  1PH1 A;  2JEA I;  5C4J H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...