4QGUA

Protein domain complex with ssdna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
191
structure length
191
Chain Sequence
VLQKRPVIVKVLSTTKPFEYETPEMEKKIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIPCEEGDKLQLFCFRLRKKNQMSKLISEMHSFIQIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords Gamma-interferon-inducible protein 16
publication title New insights into the structural basis of DNA recognition by HINa and HINb domains of IFI16.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02760 HIN HIN-200/IF120x domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qguA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qguA01
4P73A 2R6GA 4X65L 1HR0W 4LF8L 1JE5A 2Y0SE 1Q46A 3I2ZA 3K81C 4GN3B 3W1BA 5GROA 3S1RH 3H0GH 4B3SQ 4A3JH 2CFMA 3RZDH 5JJIA 1MJCA 3F8TA 1FJGQ 1TWCH 3GTLH 3BZKA 4KI0A 4HJ7A 1YNXA 3A74A 4GN4B 3OW2A 1D8LA 2K75A 3B6YA 3CC2A 1KIXA 1DGSA 3M4QA 2JA7G 1R9TH 1QUQA 4B3TL 4LF7Q 1HNWQ 3K80C 2UXCL 1BBWA 3KYHC 1XPUA 1I5FA 1KL9A 1Z47A 4A3EH 1GVPA 4A3DG 4RG1A 3L7ZC 2I5HA 2WB1G 4JI8Q 4R4OA 4A93G 3M85A 1J5EQ 4KHPQ 1OXUA 1VQDA 2JA5G 1PA6A 5H1SE 3GTGH 5IWAQ 5M3MH 1WFQA 2HHHQ 4B3SL 2YU9H 1A8VA 1JT8A 3GDEA 1HR0Q 5AJ3Q 4B3RQ 2LXKA 3CCEA 1WCMH 1SFOH 2PMZE 3K7AH 4QL5A 4YCWA 4DR3Q 1FJGL 3NENA 1NMGA 2NZOA 3PV0A 1EWIA 1FVIA 3E9HA 4IFDG 4LF7L 4JOIA 1CSQA 1HNWL 1N32Q 3RN2A 2HT1A 2RHSB 1YJWA 5JJKA 5ELOA 4DAYB 3U58A 1Y1VH 5ELNA 3TEHB 4K0KQ 1VQHA 2V1CC 4JG2A 1U0LA 5GAGC 3HOWG 1JJGA 2XGTA 1M90C 4DV0Q 4PMWA 4JI8L 3OTOQ 1B8AA 1J5EL 4JI1Q 4KHPL 2IHEA 5IT9c 2YTXA 2BA0A 2K14A 3W5OA 4A3FG 1VQ7A 2ZJQA 2IHFA 2KCTA 5IWAL 2OTJA 4QY7A 4FDBA 2HHHL 1B70B 3PO2H 2NVYH 3H0GG 5JEAG 2NN6G 4A3JG 1VQPA 5AJ3L 4HJ9A 1HR0L 1TWHH 1LUZA 1LTLA 1Q82C 4MNOA 3HOVG 4DR3L 1VCIA 4IFDI 3PGZA 3K0XA 3Q8DA 3GTMH 2A1AA 5C4XH 5JJLA 3DM3A 3J80i 1N32L 3CCLA 3EIVA 4BA1I 5IYBG 4EQ5A 4A3LG 1QVGA 4QIWE 4DV4Q 4K0KL 3AQQA 4DV0L 5FLMG 2R92H 3PSIA 3OTOL 4JI1L 4XTCS 3M7NA 1VQMA 4GOPC 1LM0A 2VQEQ 4DV5Q 2NN6I 1RIPA 3H3VH 4GNXA 4P72A 5HGQA 2JA9A 3UDGA 3PUVA 4A3IH 4O2DA 4BY1G 4DUYQ 3AEVA 1PFSA 1HNZQ 2WP8J 1GKHA 2PI2E 1YIJA 3M3YH 1UE5A 4JI5Q 4OO1G 2VW9A 1CSPA 2WAQE 5DLQE 1L2FA 3J81i 4JBMA 2ZM6Q 3T1HQ 4IOAA 2LXJA 1KQSA 2JEAI 3HFZB 4X6AH 2N3SA 1T9HA 2OCEA 2Q2HA 4DV4L 1UE6A 4DR5Q 4LF4Q 1BKBA 4YWLA 4H02A 2F4VQ 3G71A 2XTIA 5C0XJ 3KJPA 1E3PA 4JI0Q 1EFWA 3ZJYC 4QGUA 2VQEL 4DV5L 3CD6A 2KENA 4GN5A 2ATWA 3EBEA 1E22A 3M4PA 4DUYL 2A8VA 1TWFH 4C3HH 2OQKA 1L0WA 1N8RC 1HNZL 3NBHB 3J80c 1VQEA 3MEFA 4JI5L 1UE1A 2DUDA 2ALYB 4YWKA 2WFWA 2ZM6L 1MIUA 4UP9A 3T1HL 1XMQQ 4BY7H 2UXDQ 1S40A 1IBKQ 1AE3A 3PF5A 4DV7Q 3RLNA 1X65A 2PNHA 3CPWA 2JQOA 4DR5L 2E2HH 4LF4L 5GAHC 1YJNA 4R4CA 2F4VL 3GTQH 2B29A 3HKSA 1ASZA 1I94Q 5M3FH 4JI0L 3RLOA 1OTCA 3EN2A 2AHOB 3PUXA 2MO0A 3KF6B 3UDFA 4DR1Q 2E5LQ 4DNIA 2ZTEA 3KDFA 1YI2A 4IOCA 5C3EH 4OWTB 3J81c 3G6EA 5IY0A 1QZGA 5IE8A 4L5SA 3I56A 5BR8Q 2VY3A 1YEZA 1Z9FA 3ULPA 5K36G 2YYZA 2PQAB 1KRSA 1L1OB 4A3MH 2VQFQ 1BVSA 1XMQL 4BXXG 2UXDL 1IBKL 1CKNB 4IO9A 1L1OC 2B63H 4DV7L 4BBRG 4X62Q 1X3GA 4JBKA 2MO1A 1EIYB 2R7ZG 3A0JA 4L5TA 3CF5A 1KXLA 4Y7NH 2JA8G 4A3CH 4L5QA 1GO3E 3HOXH 3RN5A 1I94L 4A3GH 2UXBQ 2R93H 1AH9A 2K50A 3STBD 3HOZH 4QQBX 1OXXK 3IRBA 1I50H 4DR1L 4UPAA 2VUMH 4LUZA 5C44H 4IJHA 2E5LL 1VQNA 1I3QH 2OQ0A 4GLAC 2KBNA 1OXSC 4IPCA 1Y14B 2UUCQ 1CUKA 5BR8L 3CCRA 2PI2A 4BBSH 1X6OA 1JJCB 1W2BA 4DK6C 4X64Q 1Q81C 2IX1A 1PYBA 4LF9Q 2R7DA 4WJ3M 3UE0A 2VQFL 3WWVA 4GKKQ 4MZ9A 3I4OA 4GOPA 1K3RA 1S3OA 2Z6KA 4X62L 1CKMA 1WJJA 4DKAC 1PH2A 1PH7A 4JCVE 4DPGA 1PH5A 2Q2TA 5IP7G 3CCMA 4KLKA 4C3IH 2UXBL 1PVOA 5IP9G 4PZ7A 2N49A 4APVA 1SLJA 3HKZG 4A75A 4C3JH 1YHQA 1YHAA 1TXYA 3LGJA 2UUCL 1NBWA 3D31A 1UWVA 2JK8A 1QVCA 4ME3A 4X64L 3FKIH 2QEXA 4JYAQ 4LF9L 4DV1Q 1RL2A 2HIVA 4B3RL 2F52A 4A3KH 1ASYA 3S16H 3K8AA 5GAEC 2UU9Q 1YITA 3F2CA 1LYLA 4GKKL 2MQHA 3CCQA 1K9MC 2RCNA 3CCVA 1IZ6A 4NB3A 5E7NA 3UDIA 1MJEA 3HOYH 3NELA 3M9BA 4PG3A 3T1YQ 4LUOA 1PH8A 2OTLA 4LFBQ 2Q2IA 3FHWA 1P8LA 1Y1WH 1GM5A 2ASBA 4JI6Q 4YCVA 1KRTA 1HZAA 4NXNQ 3I4MH 4A3EG 2BH8A 2CWPA 3ULJA 3CCJA 3JAMi 2CWAA 5C44G 1E1TA 1A0IA 3CCSA 1SR3A 5J3BA 5M3MG 3GTPH 4JBWA 4GKJQ 3S1MH 2BA1A 4ALPA 5IYDH 1SN8A 4JYAL 4LFAQ 3HOUH 4YCUA 4DV1L 1K8AC 1UEBA 1WCMG 2K4KA 4GS3A 4JI2Q 4DV3Q 2UU9L 1UE7A 1VQLA 4PZ8A 1K0RA 3J7A5 2VNUD 1NJIC 2D62A 4GLVB 1PYSB 4JI4Q 1WI5A 4YWMA 3KOJA 2L15A 3PUZA 3T1YL 2N8NA 4LFBL 2IX0A 5FJ8H 1Y1VG 4B3MQ 4JI6L 2D0OA 3RR5A 4NXNL 2JA6H 1X55A 2R7FA 3JC66 4JV5Q 1TWAH 1XPOA 3DLLA 2E2JH 2N78A 1X9NA 1EYGA 1L1OA 4GKJL 2KHJA 2D0PA 3GO5A 3PO2G 5GQOA 5LMNW 2I0QA 4YY3Q 3AFQA 1CKNA 2RHQB 1PH3A 4DR2Q 4R4QA 4LFAL 3FKIG 4IPDA 1KC8C 3CXCA 4JI2L 1SROA 4DV3L 1YZ6A 1IL2A 2JA7H 1PH4A 3PO3H 4BA2I 5C4XG 4JI3Q 1G6PA 1Q1BA 1D7QA 4JI4L 1EIFA 2WAQG 2C35B 4TQUS 5FLXc 1E1OA 3CC4A 3KF8B 3NEMA 4A76A 1V9PA 1NTGA 4B3ML 3JAMc 3ICEA 2Z0SA 1Q8KA 4HIDA 1JJ2A 3FP9A 4A3DH 5IYCH 1YVCA 4GLXA 2R92G 1S72A 2JA5H 3S2DH 3S17H 4LUVA 4JV5L 1PH6A 4YHHQ 4LNQA 3I4NH 2GN5A 1N33Q 4A3IG 2CCZA 2AWNA 1N9WA 1HH2P 2EIFA 4OONA 4YY3L 2UUBQ 4DR2L 4GNXB 1VQCA 3TREA 5LMNQ 3MXNB 4JI3L 2JEBI 4KHZA 1PHJA 4HJ8A 3AYHB 2K52A 2E2IH 3S1QH 4UY8C 5M5WH 2QA4A 2WB1E 2H5XA 3PIOA 2JE6I 5FJ8G 3H15A 1N34Q 1HNXQ 3HOWH 2I5LX 4POFA 4JI7Q 2ZJRA 3CMEA 3PF4A 3CW2C 2JA6G 1VQFA 1VQ5A 3STBC 4DV6Q 1XJVA 4AYBG 4A3FH 1EQQA 1OXTA 2YV5A 4NPSA 1K73C 2NVXH 3H3VI 4YHHL 2UUAQ 3RZOH 2B3GA 2VZAA 3A5UA 3K7UC 2NZHA 1N33L 1KAWA 1NMFA 1EOVA 3CAMA 4DAMA 4HIOA 3KFUA 3U4VA 1G51A 4X66Q 2UUBL 2NVTH 3HOVH 1VQ8A 2JJQA 1X54A 1OXVA 1VQIA 4RMFA 2QGQA 1XTDA 5LMNL 2Y0SG 3PO3G 4C2MH 1WYDA 3F2BA 1E24A 4DK3C 4POGA 3GTOH 4BY7G 4JC0A 5C0XG 4A3BH 3VDYA 2HQLA 3CPFA 5LMUQ 1XMOQ 2CKZB 5IYBH 1FGUA 3CCUA 1SE8A 1PH1A 4A3LH 4Y52H 3HKZE 4AH6A 2A19A 4LW1A 1N34L 2HIXA 3L0OA 1HNXL 3S14H 2AWOA 1IYJB 5FLMH 1VQ9A 4A4IA 4JI7L 3CQZH 5IYCG 3RLFA 4IPHA 4DV6L 1M1KC 3SGIA 5M3FG 4DR6Q 1WOCA 2OWOA 3ER0A 5GADC 2UUAL 4WJ4A 1NE3A 3D0FA 2NVQH 3I4NG 1VQKA 2E8GA 4BY1H 2GVBA 3TS2A 1MKHA 1VQ4A 4J15A 4P74A 4LFCQ 4X66L 2ID0A 1H95A 5C3EG 4UP7A 1VS0A 3RNUA 1JMCA 3AFPA 1P16A 3KDFB 5C4JH 1BBUA 3KJOA 5EAYA 4LF6Q 5C0XI 1TWGH 2I5MX 4R4TA 4AIMA 4A3MG 3TRZA 3CMAA 4IPGA 1VQAA 1SMXA 5LMUL 2B63G 1XMOL 4UP8A 3S2HH 2Q2UA 1O7IA 4XIGS 2KHIA 4DR7Q 1KHIA 2ES2A 4A3CG 1QUQB 3HOXG 4A3GG 2R93G 2F3IA 4DR6L 2RF4A 3HOZG 4MTNA 1KD1C 2K5HA 2VUMG 1Q7YC 1X3EA 1X56A 4OX9Q 1N36Q 4LFCL 4R4IA 1VQJA 1HZ9A 1YHBA 4QJFA 1K83H 3F1ZA 4BBSG 3ERSX 1W3SA 5HY6A 2MNAA 4LF6L 1V43A 2ZTDA 1C0AA 1PV4A 5M5XH 4LF5Q 2AKWB 1Q86C 4A3BG 3TQYA 1A63A 1EUJA 3PUWA 2DGYA 3GD7A 3J81j 1SRUA 1C9OA 2YTYA 4R1JA 4DV2Q 4DR7L 3S1NH 3KF6A 4GOPB 3S15H 2GVAA 2VS1A 1IXRA 1HZBA 2Z6KC 4JOIC 1V1QA 4HIKA 4HJAA 1PH9A 3L2PA 4TVAB 2KCMA 1XPRA 4OX9L 1N36L 4P71A 1JB7A 1C7YA 2PQAA 1QVFA 2IY5B 1EQRA 3F2DA 3A5ZB 4DUZQ 3S24A 3GTJH 1XNQQ 3PUYA 3BU2A 3OYYA 1IBMQ 3GTKH 3ULLA 4BXXH 4JBJA 4A3KG 3M4OH 4P75A 4LF5L 2ZTCA 1IBLQ 3U4ZA 3TS0A 4BBRH 1AE2A 3BZCA 4L5RC 4AQYQ 2EQSA 4NXMQ 1X3FA 4PZ6A 3UDXA 2R7ZH 1U5KA 2LSSA 3HOYG 2JA8H 3U50C 4DV2L 1VQ6A 2YTVA 3G48A 3E9IA 1HJPA 1Y1WG 1CKOA 1XNRQ 4IFDJ 2K5NA 4A93H 3I4MG 2BH2A 3BJUA 1YJ9A 4OWXB 2VL6A 4DR4Q 4LWCA 4X65Q 4OWWB 1Q12A 4LF8Q 5M5YH 1VQOA 1FL0A 4OO1I 3CP0A 3I55A 3E0EA 2IT1A 1K8GA 3UE1A 1B7YB 1HZCA 1G291 5IYDG 1E7ZA 4DUZL 2AMCB 2EXDA 1XNQL 3HOUG 1IBML 4OXPA 1VQBA 4HJ5A 2MFIA 1GD7A 3J7ZC 1NY4A 5JEAJ 4GNXC 1IBLL 4B3TQ 3CC7A 2ZJPA 4NXML 4AQYL 3I7FA 1YBYA 4AYBE 1Q1EA 3PIPA 5IP7H 1J6QA 2UXCQ 1A62A 3W1GA 2CQOA 4O0AA 2K5VA 5IP9H 3PCOB 1VQGA 3G4SA 4HIMA 4IJLA 2FXQA 1QZHA 3KLWA 1XNRL 4EX5A 4DR4L 1I6HH
chains in the Genus database with same CATH superfamily
5CV9A 2R6GA 4X65L 2J4XA 5IGFA 1HR0W 1XWEA 4LF8L 1GUWA 5ELCA 1JE5A 3I4NB 1PRTF 1Q46A 3I90A 3H94A 2NN6H 5JJIA 1FJGQ 3GTLH 3NK9A 3BZKA 4KI0A 1YNXA 3CC2A 3CRLC 1HTPA 5CR3A 2JA7G 2EY1A 2SOBA 1F9SA 1R9TH 4B3TL 1G91A 1FR3A 2F0TA 3KLSA 4X3TA 1JQYD 2A68D 5D3DA 1GVPA 3BYTB 4RG1A 4A3DG 2I5HA 2IPKD 4HAEA 5H1SE 1EZ6A 3D4WA 3X3NA 4B3RQ 3MXGA 2FMMA 4NDXA 1FJGL 4YCWA 4DR3Q 1QWYA 4HN7A 1EFID 1SEBD 1EWIA 1FVIA 3E9HA 1CSQA 4FF4A 4KN7C 4A3BB 2NBFA 5ELOA 3U58A 1Y1VH 1PLFA 4V190 2XGTA 3LWEA 3OTOQ 1HXYD 4A3FG 2K14A 4KMUC 3W5OA 1TY0A 1WTRA 4C3JB 5ELEA 1KNEA 2NN6G 1Y69U 4B3RL 1Q82C 4DR3L 1VCIA 4IFDI 4LK1C 3K0XA 3SE0A 2F3WA 1QOHA 3DM3A 1TWGB 3KF8A 4QB4A 3J80i 4OL7A 5D65A 1HHVA 1UEAB 5IYBG 3S2HB 1K3BC 1QVGA 4QIWE 4DV4Q 2R92H 3OTOL 2VQEQ 4DV5Q 1PRTB 1TY2A 1RIPA 2F0WA 5HGQA 3BDLA 3UDGA 4A3IH 1AZQA 2WP8J 3Q23A 1PRTD 1JOQA 1UE5A 3D6CA 1TQOA 2VW9A 3MXPA 1FD7D 4MHEA 2ZM6Q 3T1HQ 4IOAA 1RDPD 2DY8A 4ZLTF 1T9HA 2Q2HA 4DV4L 4LF4Q 4DXFA 4FVMA 3G71A 4K2LA 1A2UA 1DYQA 2VQEL 2B8GA 3OMCA 4DV5L 3R2TA 2KENA 3CD6A 3EBEA 3M4PA 3FRPB 1D6EC 4CDEC 1N8RC 5KNDA 5CV8A 2EJMA 1DOMA 4G57A 1IW7C 1STEA 1VQEA 1K8OA 1UE1A 2ALYB 1JICA 3KBXA 2ZM6L 2JN4A 1NUCA 3T1HL 5IGGA 5JOBA 1LT3D 2E2HH 4LF4L 1YJNA 4R4CA 1HA5A 3HKSA 1ASZA 5DM73 1I94Q 2K05A 3PUXA 3CRKC 3HEJA 4KJOA 1R4QB 2F0MA 2JA5B 5M5YB 2PO4A 2RSNA 4OWTB 4L5SA 3I56A 2Z1CA 3HRZC 3ULPA 2WKCA 2PQAB 1L1OB 4DAYA 2MHVA 1BDOA 2XNAC 2B63H 4ZCKA 2MO1A 2A74C 1EIYB 4ZYSA 3A0JA 2R7ZG 1KXLA 4A3CH 1LLRD 3D8GA 1I94L 1BF4A 4A3GH 2R93H 2VXWA 2K50A 4U68A 3HOZH 1OXXK 3IRBA 3SXHA 2L9HA 1JOOA 1BBXC 4LUZA 1CQVA 5EPKA 3X3MA 1JE4A 1Y14B 5D3IB 3N6RA 3CCRA 4ID6A 1RHPA 3NQIA 1X6OA 1JJCB 2A6HC 1W2BA 1Q81C 2IX1A 4WJ3M 3UE0A 1L0YB 3WWVA 2JXMB 4RKBA 4ZRZA 5EKLA 1PH2A 1CKMA 5CMDA 1PH7A 4IN3A 3DM1A 4KLKA 3HP3A 1S5ED 1DOKA 4F88A 3EVQA 1CK1A 3C1FA 3NQTA 1WTWA 3HKZG 4C3JH 3O13A 3LGJA 1C48A 1D5XC 1YNJD 4KKSA 1MBYA 5M3MB 4BY1B 3D31A 1JCKB 1QVCA 3FKIH 1H9JA 1I6VC 1ASYA 4A3KH 2UU9Q 5GAEC 2PW7A 4TSSA 1YITA 3CCQA 1H9SB 5C3XA 1J8IA 4PG3A 3FHWA 1P8LA 1GM5A 3KK7A 2ASBA 2K33A 4OIKA 4K2KA 5FKAC 1EY9A 1SR3A 3GTPH 4JBWA 3P7JA 1SNMA 2NVYB 1F2MA 4LFAQ 2G5DA 1WCMG 5LHY1 5BN5A 2UU9L 5ELFA 3VA5A 2VNUD 1HPCA 1L0XB 4JI4Q 4XQJA 4XQQA 2G9HD 4B3MQ 3RR5A 2CW0C 4CJ0B 2ZT9C 1ENCA 3ONAB 4J6HA 3GP7A 2L55A 2B2YA 1ICWA 3GO5A 4IUUA 2I0QA 1SAPA 3PO2G 2HCCA 1CKNA 1RTOA 4DR2Q 5C4ZA 4LFAL 3FKIG 4IPDA 3SHLA 3CXCA 1SROA 4BA2I 1VDZA 1AEXA 4H13C 1G6PA 1Y8NB 4EX5A 1EIFA 2WAQG 2C35B 3QIAA 4JI4L 5FLXc 4NW2A 4BBRB 3RUZA 3CC4A 4C1NK 4B3ML 1D1KA 2Z0SA 2PZWA 1JJ2A 4GLXA 1STHA 1S72A 2JA5H 3S17H 4LUVA 1B50A 4FO2A 2AQ3B 4EQOA 1MSGA 1ZKOA 4TRDA 2EIFA 1EZ8A 3VYUA 2BE5D 4DR2L 5KRUA 1BR9A 2VB2X 1STAA 4UY8C 5M5WH 2JE6I 5J39A 2N88A 3I70A 3H15A 3HOWH 2F1MA 3PF4A 1VQ5A 1K73C 4DV6Q 4AYBG 1OXTA 1S4ZA 5HURA 3RZOH 4JPBW 2JYOA 5JEAH 1NMFA 4X66Q 4C3HG 1XX8A 4OELB 2F0IA 1OXVA 1VQIA 3VR4A 4DK3C 3DHQA 5FLXL 1T5EA 5CC4A 2CKZB 4DNRB 3SK5A 1PH1A 1B53A 1KDBA 3MXUA 3S14H 2HIXA 2AWOA 1CZGA 1VQ9A 4KY5A 2DJFC 4IPHA 4DV6L 3SGIA 1M1KC 2OWOA 1WTQA 2NVQH 3P1HA 4BY1H 2GVBA 3TS2A 3PIP3 4LFCQ 4X66L 3PIO3 1H95A 5C3EG 3E0JA 1ZYRC 4BBSB 5C4JH 1X3QA 1CA5A 2I5MX 4AIMA 5F2DA 4DAVA 2SDFA 3C46A 4FXGC 1XTCD 4UP8A 4XIGS 2BDOA 2CHBD 1KHIA 4CKCA 3T56B 3TZUA 2RF4A 2EJFC 3IFTA 1V1PB 3A7LA 2O5JC 1HFNA 1N36Q 4LFCL 2EDGA 4L8JA 4PQXA 3URYA 3F1ZA 3M7GA 1TWHB 1I6HB 2MNAA 1V43A 1PTOH 1PV4A 3S16B 4EVOA 2AKWB 1B9MA 2DGYA 3GD7A 1C9OA 3OMGA 3R3OA 4L63B 3ITPA 4C3IG 2VS1A 1IXRA 3I4MB 4G7OC 1HZBA 1N36L 4P71A 5L37A 1C7YA 2B2UA 3S1MB 5K36H 4DUZQ 3AU7A 4RH6A 3PUYA 3BU2A 1V8QA 3NTIA 3ULLA 3M4OH 4P75A 4BBRH 1AE2A 4L5RC 4AQYQ 1X3FA 1YNNC 2HQEA 3UDXA 2G9DA 1CFMA 2WKDA 3HOYG 4R8NA 2JA8H 1G6ZA 2RDGA 1XNRQ 4UDUC 3NPPA 2BH2A 1SNCA 4DR4Q 1TWAB 1VQOA 2K01A 3I55A 1I4RA 5KNCA 1IW7D 5JJZA 1BQQT 5IYDG 4DUZL 5FO8B 4OXPA 4HJ5A 2JA7B 2I07B 1GD7A 5JEAJ 2HD3A 4AQYL 4WORA 4X3KA 1A6XA 1Q1EA 1W6JA 2UXCQ 1A62A 5CYUA 3W1GA 3PCOB 1XNRL 2M00A 4IJLA 5CV5A 3KLWA 4A3DB 4DR4L 1II3A 4P73A 5M3FB 4QCLA 4KHVA 3NBIA 3H0GH 1LTBD 4A3JH 2F03A 2LFNA 1TWCH 3A74A 4G7HC 1KIXA 3I91A 2K1BA 2IWHA 1HNWQ 3C3LA 2L0CA 1I4HA 2UXCL 3KYHC 1XPUA 2Q8TA 1I5FA 1KL9A 3K58A 1GJXA 4A3EH 3OW7A 1JOKA 5I9PA 1VQDA 1PFMA 1I4XA 4A3FB 1PA6A 2NVXB 5FK9C 5C4HA 3TP8A 1JB3A 2YU9H 1A8VA 3W2DA 2RKSA 1JT8A 2C9OA 1HR0Q 2NVTB 2LXKA 3BVGA 1BCPF 4K5VA 2A5HA 3NENA 3SK8A 2NZOA 4ZQ3A 4C2MB 1FNWA 3IAYA 4IFDG 1HNWL 5FO7B 1E2WA 4HMJA 3TEHB 4K0KQ 3MC0B 1B8AA 1S5CD 2ZJQA 2YTXA 2QILA 2IHFA 2KCTA 3MFYA 4RKLA 1B70B 3H0GG 2D5DA 4ZKCB 4A3JG 1HR0L 1EY7A 3GQBA 1TWHH 4HCSA 1LTLA 4LAAA 4HJ9A 3HOVG 2Z8LA 2NB0A 2EOTA 5C4XH 5DM63 2P5ZX 1BXTA 4ABNA 4BA1I 4EQ5A 2MUYA 4A3LG 4K0KL 3J7AF 2QDBA 3PSIA 4N9PA 5E3FA 2MGSA 1WTPA 1VQMA 3M7NA 1LM0A 3KUPA 1EWCA 4GNXA 3Q24A 4KD4A 4DUYQ 2HUGA 2PI2E 2A6EC 4IUQA 2QEJC 4MN3A 2N55A 4QF4A 4OO1G 1K83B 2SNSA 3J81i 3ERQA 5I9OA 1KQSA 5JAVA 2PPBC 5M5XB 1HQMC 2XWBB 1UE6A 1BKBA 1UNSA 3S1NB 5C0XJ 2CW0D 3S15B 3KJPA 4ME5A 4GN5A 5KIXA 4IQZA 4DUYL 5EKIA 1TWFH 1L0WA 3NBHB 4KV6A 3J80c 2K6AA 3Q0AA 3T53B 1STBA 3MEFA 4IUTA 2DUDA 1B2TA 1TIID 3GTJB 2WFWA 1UAPA 4UP9A 1XMQQ 3GTKB 2AQ2B 3H09A 1IBKQ 1AE3A 3PF5A 1ILQA 1A3TA 2PNHA 3CPWA 2JQOA 4KD3A 1I4QA 2F0LA 2XSCA 1TS4A 5M3FH 2FMCA 1OTCA 3EN2A 2WB1B 4A93B 2MO0A 4FF1A 5M9OA 4DNIA 3DWQA 3S2DB 4IOCA 2A69C 3G6EA 5IY0A 5IE8A 1IYVA 1R4PB 1YEZA 3E5SA 1Z9FA 4A3MH 3R2IA 1XMQL 1VMCA 1FGBD 1IBKL 4XDXA 1D1IA 5FLXE 2B2YC 1S5DD 1IHZA 2EYHA 4L5TA 1W6KA 3CF5A 4HTHA 1C4QA 1GO3E 3N52A 3HOXH 3RN5A 2ENBA 1EIHA 2UXBQ 1AH9A 2NTTA 4QQBX 3HKZB 4ZK9B 4E6IA 5C44H 4IJHA 1VQNA 3J80L 4GLAC 4CDFC 4IPCA 1GUOA 3F2UA 3RZDB 4DK6C 1PYBA 5IGBA 4MZ9A 2AUKA 3BDCA 4IUNA 3CU7A 1K3RA 2H4OA 4DPGA 1Y8PB 2UXBL 5IP9G 5EPLA 3AMUA 2N49A 3CQZB 3GTGB 4K8IA 1UWVA 2JK8A 2FJ2A 1ZYRD 4ME3A 3TSSA 1WCMB 1SFOB 3K7AB 4RHSA 4DK0A 3F2CA 1LYLA 1K9MC 3OIQA 3A7AB 1IZ6A 1JC7A 3T1YQ 4LUOA 1PH8A 4LFBQ 1PXUA 1MHWC 4J1MA 2C5CA 4JI6Q 1AFPA 4K5XA 3ULJA 2CWAA 2M9VA 1E1TA 5C44G 1EYAA 1EQVA 2E75C 2NTSA 2TSSA 5J3BA 4GKJQ 3PO2B 5EJWA 4DU9A 3HOUH 4YCUA 4GS3A 1BNZA 4DV3Q 1SNQA 1UE7A 1VQLA 4PZ8A 3GTMB 1K0RA 1SNPA 5TSSA 2D62A 4GLVB 5A35A 3KOJA 3PUZA 3T1YL 2N8NA 4LFBL 2EYFA 2RCFA 2RVLA 3K57A 3C2PA 1Y1VG 1LABA 3NXWA 4JI6L 3Q22A 5IT9E 3L9AX 1NSNS 5EGTA 1MGSA 3DLLA 4GKJL 1L1OA 1VF7A 2KHJA 5GQOA 5LMNW 2WIIB 1QJOA 3M3YB 3BZDB 4DV3L 1U4PA 1YZ6A 3PO3H 5CV7A 1Q1BA 2RA4A 5AFWA 4B08A 1YNND 1Q8IA 4MTKA 4TQUS 2KVMA 3KF8B 2O2LD 2F0DA 1NTGA 4F7XA 4IUVA 2QCPX 5KYLA 1Q8KA 3SVMA 3FP9A 1RF2D 2R92G 1EEID 4AYBB 3S2DH 1EY5A 3Q6SA 1PH6A 3I4NH 5IGCA 2GN5A 1WVLA 5C6AA 4A3IG 2CCZA 1HH2P 4OONA 4C3HB 2KJXA 3AB9A 2UUBQ 3BS1A 2L12A 1VQCA 2K5DA 3LWUA 3I8ZA 2PZTA 3D6WA 3AYHB 2B2UC 1XYIA 2WB1E 5ELDA 5KEEA 3GTQB 4POFA 4JI7Q 2LKVA 2NUCA 3ND8A 1H9RA 1EQQA 1U4RA 3A5UA 1EOVA 2QKIC 4HIOA 3U4VA 2UUBL 2DY7A 5C3EB 3S1RB 2JJQA 3E6ZX 2HDMA 1X54A 4X3SA 4UHVA 4RMFA 2Y0SG 3PO3G 1WYDA 1E24A 5IGDA 1SE4A 5E4WC 1PTOF 2WACA 4A3BH 3VDYA 3CPFA 1XMOQ 1FGUA 1ESRA 1LTGD 3CCUA 2CH4A 3HKZE 3NUCA 4LW1A 3L0OA 4Y7NB 5FLMH 4JI7L 3CQZH 1WOCA 3M4YA 5GADC 3D0FA 4K6LA 1I50B 3I4NG 2E8GA 3K59A 4QUFA 1VQ4A 1I3QB 3RD4A 4FF3A 3MZ5A 3AFPA 3CHBD 3KJOA 2CH4W 1DONA 5EAYA 1TWGH 3BYYB 3OHXC 3GV3A 3TRZA 3CMAA 1VQAA 1SMXA 2KCNA 3EQLC 4YIJA 1XMOL 2MJ8A 2B63G 3S2HH 2Q2UA 4PNYA 1TVXA 2FFKB 1HRJA 3OWEB 4A3CG 1QUQB 2O5IC 4C3IB 4A3GG 2R93G 1Z6HA 1U4LA 3HOZG 3OIPA 1KD1C 2K5HA 2Z4IA 1Q7YC 1X56A 4OX9Q 1BO0A 1PZKD 3MTSA 1EOTA 4XT3B 1W3SA 3QB3A 4CBVA 1IYUA 1LTTD 1C0AA 1AZPA 4LF5Q 4A3BG 3TQYA 5CBEE 2XRQD 1SRUA 4BS9A 3HOYB 4I7ZC 3KF6A 3DWAA 3GV6A 2PYKA 4XT1B 2EY5A 3BVMA 3NTHA 2Z6KC 1V1QA 4C3JG 3KBGA 2KCMA 4TVAB 4OX9L 1S5BD 2HDLA 1NNXA 2A6ED 2RSOA 1GUNA 3S24A 4G4KA 1XNQQ 4NMZA 5J22A 1IBMQ 4BXXH 2MPMA 4A3KG 1BCPC 4LF5L 2ZTCA 2EQSA 5C5MA 4CGYB 1U5KA 2LSSA 4EGVA 3G48A 5JVG3 1QCBD 4DK1A 1QB5D 2K5NA 2JA6B 2F0EA 2VL6A 4OWXB 1PZID 2X6LA 5M5YH 1FL0A 2E2JB 1F77A 2IT1A 3QOLA 3DUZA 1F2LA 2IX3A 3QOJA 1XNQL 3D4DA 2B8FA 1IBML 1VQBA 5G3LF 3J7ZC 1NY4A 1X3PA 4GNXC 1PYWD 4BY7B 1YBYA 4AYBE 1LTSD 5IP7H 1QNKA 2CQOA 1D2BA 1QZHA 4KY7A 1CHPD 3BDOA 3S1RH 4GN3B 2A69D 1AN8A 1ZEQX 3J80E 2CFMA 2IL8A 1MJCA 2ICIA 3F8TA 1CQFA 3OW2A 3U9SA 1D8LA 2F0PA 1TU2B 2EPBA 4LF7Q 4QMGA 2E2IB 3K80C 3S1QB 2KUMA 3FVQA 1O7LA 1Z47A 3I4LA 3K0YA 3L7ZC 4XYQA 3M85A 1J5EQ 1OXUA 3NWTA 2JA5G 4XXEA 3K5LA 5IWAQ 5M3MH 2VUMB 1TR5A 3P75A 5AJ3Q 3HOVB 4N8X1 4OHJA 1SJHD 4DN4M 5EPJA 1RKNA 3PV0A 3GTOB 4LF7L 4JOIA 3NSWA 3RN2A 3IL8A 2RHSB 1YJWA 1G2TA 3P20A 2V1CC 1ENAA 3I72A 5GAGC 3HOWG 2E74C 1JJGA 1M90C 3WOEA 4DXGA 4DV0Q 3FDTA 4PMWA 1J5EL 4JI1Q 2IHEA 5IT9c 2BA0A 5IWAL 2OTJA 4QY7A 1RJTA 1GOZA 2NVYH 5JEAG 1B1ZA 5AJ3L 4HR7B 3WDNA 1NAPA 3SEBA 3Q8DA 4Q5VA 2A1AA 3FEWX 3V2TA 2R3ZA 1SYGA 3CCLA 3EIVA 1EQTA 1WD1A 4RWSC 3AQQA 4DV0L 1Y1WB 1O78A 4JI1L 2F0KA 1X32A 4MIUA 4BY1G 3AEVA 1PFSA 3MXNA 1YIJA 5BN4A 2SNMA 4JI5Q 3IFDA 5DLQE 4JBMA 1L2FA 1PFNA 1F2ZA 2WV6D 2LXJA 2NWGA 3DXJC 2K5QA 2JEAI 5K5PA 2PZUA 2N3SA 2OCEA 1CHQD 4U673 4H02A 4H7BA 2EYOA 5IT9L 5IODA 1E3PA 4JI0Q 4IURA 1EFWA 2LMCB 4QGUA 4DFAA 2ATWA 2A8VA 1E2ZA 4JI5L 1UUPA 3NE5B 4YWKA 2CQAA 1MIUA 4FXKC 4BY7H 2UXDQ 2X6GA 5C0XH 2DJGC 4KTAA 4DV7Q 3RLNA 1X65A 4ZAIA 4DGZA 1LTRD 1JWSD 3TP5A 3PMFA 4JI0L 4OEMB 3RMHA 4DR1Q 3EA6A 2ZTEA 3KDFA 1YI2A 3J81c 5BR8Q 2IW3A 2VY3A 1CM9A 1H9MA 2K7VA 2KHSA 2YYZA 5K36G 3U9OA 2XN9C 4XQNA 1BVSA 3TBIB 2UXDL 4IO9A 1L1OC 2K5WA 4EQPA 4DV7L 4CKBA 4BBRG 4FXDA 4JBKA 1F9RA 5FOBB 2JA8G 5D14A 5C5LA 1GUSA 4DR1L 4HSVA 2VUMH 1ET9A 1HUMA 2UUCQ 3KLSX 5BR8L 4BBSH 4X64Q 2A6HD 2B39A 2R7DA 3GTLB 1PZJD 4I65A 4GOPA 4JW0A 1R9TB 4X3UA 2Z6KA 3L3OC 4DKAC 1WJJA 2V4DA 4JCVE 1PH5A 2Q2TA 3CCMA 4KKUA 3J7AV 1TS2A 1KDAA 4H44C 5T1GA 2Z4HA 3A56A 4A75A 1YHQA 3J81L 1SDFA 4F87A 1O80A 2Z9HA 2UUCL 1NBWA 1EY0A 1WTXA 3QJYA 2E2DC 1LACA 4X64L 3T13A 2QEXA 1I6HH 4DV1Q 2HIVA 2B2TC 3S16H 3BG3A 3T16A 3K8AA 3QWNA 3FPPA 2KOLA 3G7LA 4CHTB 5E7NA 1MJEA 3NELA 4RCNA 2OTLA 2HCIA 1Y1WH 1A2TA 1Y1VB 3OPOA 2K28A 1TKWB 5E4XA 2AUJD 3I4MH 4A3EG 4B9XA 2BH8A 2CWPA 3K6OA 3JAMi 1A0IA 1T5XD 3S1MH 1HQRD 4N8FA 1SN8A 1EYCA 4DV1L 1K8AC 4JI2Q 3J7A5 1GUTA 1NJIC 1PYSB 3HS0C 1PTOC 3UI2A 4LMQD 4Z9CB 2JP1A 1X55A 2R92B 3MWYW 2R7FA 1RTNA 1TWAH 3TN2A 1XPOA 4RFBA 2RBMA 3LX0A 1ET6A 3W3AA 1NCVA 4A3IB 1IL8A 2D0PA 5I2XA 2RHQB 1BCPB 1LTAD 2EY2A 2B2WA 4JI2L 4WFN3 2JA7H 2F4IA 1PH4A 5C4XG 1BCPD 4JI3Q 1U4MA 3NWSA 2F0JA 1E1OA 2R7ZB 3NEMA 1V9PA 4BWGB 4A3DH 1YVCA 4RAUC 3SK6A 2J7ZA 4ODGA 4YHHQ 3DMUA 4LNQA 3VA7A 1N9WA 1SE3A 1S5FD 4GNXB 4K6DA 4PV1C 2Y0SB 5LMNQ 4DNTB 4JI3L 4K8JA 2JEBI 1PHJA 4HJ8A 4B9WA 2QF7A 3K5NA 2NZ1D 3SR1A 2QA4A 3R93A 3PIOA 5C3WA 4DA2A 2E2HB 3DEOA 3CMEA 5FO9B 3STBC 2KEDA 1IKMA 4A3FH 2NVXH 1QE6A 2YV5A 4NPSA 4R9WA 4YHHL 2UUAQ 2B3GA 2VZAA 2EYPA 3K7UC 3KFUA 4CJ1B 1G51A 2NVTH 2PQEA 1FNVA 1VQ8A 1K8MA 4LJZC 2A73B 3K5OA 1B44D 1XTDA 2QGQA 5LMNL 4C2MH 1O7ZA 4POGA 4IZ8A 1ESFA 4RHRA 5LMUQ 2B63B 2PMZB 5IYBH 4Y52H 2A19A 2EJGC 1B4OA 4A3GB 2R93B 5M3FG 4DR6Q 3ER0A 3HOZB 3QR8A 2UUAL 4WJ4A 5IGEA 5CBAE 1MKHA 4J15A 4P74A 2ID0A 3RNUA 1JMCA 4EQNA 5C0XI 4LF6Q 5T1IA 4A3MG 1EEFD 4FP5D 5CGKA 4K5WA 4P2CB 4CKEA 2XWJB 1G8ZD 1EYDA 2K03A 4IPGA 2LS01 3EJIA 4RGNA 1VF5C 4CDCC 5LMUL 4FF2A 2K04A 2KHIA 4DR7Q 1WTVA 3HOXG 1WTHA 1KNAA 2RDHA 3MFGA 4DR6L 3TDQA 4MTNA 3LNNA 1Q3LA 1X3EA 4R4IA 1VQJA 1HZ9A 1M8AA 4O42A 4QJFA 1K83H 5CV4A 3ERSX 4ILWA 5HY6A 3FKIB 1AW7A 4LF6L 1Q90A 4A3KB 5M5XH 1A63A 1JWMD 4RCOA 1EUJA 3PUWA 3J81j 2WAQB 1SNOA 2YTYA 4R1JA 5JPMC 4DV2Q 4DR7L 3S1NH 3OOCA 4R8IA 3S15H 4L6TB 2GVAA 1TS3A 1EL0A 4HIKA 4JOIC 1SXTA 1B3QA 3L2PA 1XPRA 2PQAA 2H1EA 3GTPB 2IY5B 5EBDA 3GTJH 1NR4A 3GTKH 3I73A 4NKLA 1GHJA 3TS0A 3MVVA 3BZCA 4NXMQ 2R7ZH 4PZ6A 4PMBA 2L11A 4V0BA 3U50C 1SYEA 4DV2L 1VQ6A 1K0SA 2YTVA 4TKOB 2GA4B 1F9PA 1EU3A 2J0TD 1CT1D 4A93H 2KA7A 3BJUA 1LT5D 4OWWB 1Q12A 4OO1I 1VMPA 2TMPA 3CP0A 4H0LC 1K8GA 5EBCA 2JSOA 1B7YB 1F9QA 3BVZA 1E7ZA 1SBBB 3KLRA 1CTMA 3HOUG 5CORA 2MFIA 3G6JB 4F8MA 3CC7A 4NXML 3I7FA 3VYSA 1XXGA 1I4GA 1LV9A 1VQGA 2RQXA 4NP5A 3G4SA 3OWFA 3D3RA 3S17B 2B2TA 2KQ3A 2Y0SE 3I2ZA 3K81C 3W1BA 4B3SQ 1E2VA 5GROA 3RZDH 4WJWA 4XYOA 1H9SA 3QG1A 2XIWA 4HJ7A 4GN4B 3B6YA 2K75A 1DGSA 3M4QA 3MAQA 1QUQA 4OGQC 1D5MC 1JWUD 3JAME 5M5WB 1BBWA 2DN8A 3MEHA 4Q0FA 3HOWB 2F0SA 2WB1G 4A93G 4JI8Q 2OT2A 4R4OA 2K32A 4KHPQ 2F0NA 3GTGH 3RZOB 1WFQA 3J81E 2HHHQ 4B3SL 1DZ1A 1G2SA 3GDEA 4N9TA 3CCEA 1WCMH 1SFOH 2PMZE 3K7AH 4QL5A 1NMGA 2QDLA 1N32Q 2HT1A 5JJKA 2ZXRA 4DAYB 1V1OA 1EY4A 1A15A 5ELNA 1VQHA 1FNUA 4JG2A 1U0LA 3S14B 3PQIA 4JI8L 4KHPL 1VQ7A 1HA6A 2NVQB 4FDBA 2HHHL 3PO2H 1HTLD 1LTID 1ONLA 1VQPA 1LUZA 4MNOA 3TMEA 3PGZA 2PCFB 3VR3A 3EFXD 5C4JB 3GTMH 1B3AA 5JJLA 3FPUB 2KEEA 5I6WA 1N32L 4I7AA 3HZXA 1Z7TA 2XRSD 4S3SA 5FLMG 2B2VA 4XTCS 2EY6A 4GOPC 3SDZA 2NN6I 3H3VH 4P72A 1A3VA 2JA9A 3PUVA 4JK1C 1EY6A 4O2DA 1HNZQ 1GKHA 2PNRC 2F0VA 3M3YH 4DAPA 1TS5A 1CSPA 2WAQE 4HEDA 1PTOB 5J1ZA 3K5MA 3HFZB 4X6AH 4DR5Q 1PTOD 2ZXPA 2F4VQ 4YWLA 1EU4A 4KK7A 5A2QL 1KABA 2XTIA 2XVSA 1MI2A 1SMYC 3ZJYC 1ILPA 3C1EA 1E22A 4C3HH 2OQKA 1HNZL 4RGMA 1SYFA 2F0QA 1S40A 3HG9A 3M4OB 3E3XA 4DR5L 5GAHC 2F4VL 3GTQH 2JA8B 2B29A 1STGA 3I3CA 3RLOA 2MP1A 1SE2A 2AHOB 1JR0D 3KF6B 3UDFA 1NR2A 1OO9B 2E5LQ 1GHKA 5JPNC 3CKIB 2R61A 5C3EH 1QZGA 2LY7A 3H91A 5HGTA 1KRSA 2X69A 1KTKA 2VQFQ 3R8BA 1ICFB 4BXXG 3HGBA 1CKNB 3D4RA 1EIGA 1PDQA 4JVZA 4X62Q 1X3GA 1DM0B 2BCOA 4Y7NH 2KCCA 4C56C 4L5QA 2B2WC 1V1PA 2A68C 5EQ0A 1J9OA 3STBD 1I50H 5JVH3 4UPAA 2E5LL 4CJ2C 3MA2B 1I3QH 2OQ0A 3VR6A 2KBNA 1PFBA 1OXSC 4HCEA 1CUKA 3H0GB 2PI2A 4A3JB 4LF9Q 1TWCB 2VQFL 4GKKQ 3I4OA 5LL6S 1S3OA 4X62L 1B9NA 3QO2A 1KLUD 2FHTA 1DXMA 1FYCA 5IP7G 1DCZA 2AQ1B 4C3IH 2NYZD 1PVOA 4PZ7A 4A3EB 1A3UA 4APVA 1SLJA 1QG7A 1PMRA 1YHAA 1TXYA 1ZXTA 2SEBD 3DEPA 3ND9A 2YU9B 2PW5A 3VR5A 4JYAQ 4LF9L 1RL2A 1RD9D 4WRDA 2F52A 4GKKL 2MQHA 2RCNA 3CCVA 3NHHA 4NB3A 3UDIA 5G3LD 3HOYH 3M9BA 2VB3X 4HMIA 3A55A 2Q2IA 1RCVD 5KYIA 1TT2A 1STNA 1SYDA 3VR2A 4YCVA 1KRTA 1HZAA 4NXNQ 3EROA 4UAIA 2F0HA 1SJED 5COYA 3IKJA 3CCJA 3CCSA 5M3MG 1QNUA 2BA1A 4ALPA 1PRTC 5IYDH 1MD2D 5EKKA 4JYAL 1UEBA 2K4KA 5NUCA 2QW7A 3MHBA 5C4XB 5IIFA 2D9UA 1DOLA 1U9RA 2DNCA 1WI5A 4YWMA 2L15A 2IX0A 1O7YA 5FJ8H 2D0OA 4NXNL 2JA6H 2M2LA 4PMCA 4RGOS 1HUNA 3JC66 1KLGD 4JV5Q 1CZWA 4M8AA 2N78A 1X9NA 1EYGA 2E2JH 4YY3Q 3AFQA 1PH3A 2OEOA 3H3VC 4R4QA 1KC8C 1IL2A 1IKLA 1D7QA 2L4NA 1I4PA 2L5TA 4A76A 1DJRD 2F0OA 4KY6A 3JAMc 3ICEA 4HIDA 1F2YA 2IJ0A 4ZUJA 5IYCH 4JV5L 4GZYC 1N33Q 1STYA 2AWNA 1HCZA 1TWFB 4YY3L 1M4VA 3FMCA 1AP0A 3DWPA 3V96A 4FNFA 5I6YA 3TREA 3MXNB 3SK4A 4IFDH 4KHZA 2K52A 3NTKA 2E2IH 3S1QH 4DF7A 2E76C 2H5XA 4O1NA 4CDDC 5FJ8G 4KKTA 1HNXQ 1N34Q 2ICEC 2I5LX 4KN4C 2ZJRA 3CW2C 3WOFA 2JA6G 1VQFA 1XJVA 3H3VI 2O4XA 2NZHA 1N33L 1CI3M 1KAWA 4DAMA 3CAMA 4K14A 5CV6A 1LO5D 4RGTA 3HOVH 2Q8RE 4ULLA 1KDCA 5I2YA 3NP8A 1RODA 1EWHA 3F2BA 3GTOH 4A3MB 3T4AC 3TP7A 4BY7G 4JC0A 5DNFA 5C0XG 2HQLA 5E1FA 3JAML 1SE8A 4A3LH 2WINB 4AH6A 1HNXL 1N34L 1SSOA 5DAUA 1IYJB 4A4IA 3HOXB 4C1NI 5IYCG 3RLFA 1NE3A 1LT6D 1VQKA 1E0BA 5C44B 3TP6A 4HSPA 1YNJC 1HFGA 4UP7A 1VS0A 4OO1H 1JORA 3KDFB 1P16A 1BBUA 3TZDA 1MSHA 4M1UB 4R4TA 2BOSA 2ZXOA 2CVRA 2EXZA 4FYDA 1C8CA 1O7IA 2KECA 4IUPA 2F0FA 5ELBA 2ES2A 1EY8A 2L1BA 2F3IA 2F3VA 3NBHA 4QIWB 2VUMG 2EYJA 1K28A 2EYMA 1H9KA 1YHBA 2Q8IB 1LT4D 4BBSG 3A8IE 2F0GA 3VYRA 3A8JE 2ZTDA 4IALA 1Q86C 2EVBA 1WD0A 3J7YW 2RDFA 1BUVT 1WTOA 4OIJA 5IOCA 5ISRA 1D5ZC 4G7ZC 4GOPB 5KGUA 5A2QE 3A8KE 2EYLA 5BN3A 1DD2A 2D2CC 4HJAA 1PH9A 3V05A 1SNDA 1JB7A 4J8QA 1QVFA 5KNBA 1EQRA 3F2DA 3A5ZB 2FINB 3OYYA 3HOUB 4JBJA 1SYCA 1IBLQ 3U4ZA 3T51B 5LL6X 2EZVA 1GUGA 1SYBA 3E9IA 1HJPA 1Y1WG 1CKOA 5I4DA 4IFDJ 4QUCA 3I4MG 1SMYD 1YJ9A 3A54A 1QILA 1Y8OB 4LWCA 4X65Q 1ML0D 2BDNA 4LF8Q 2Z6BA 4ZUIA 3H6MA 3E0EA 2I46A 1KAAA 2F0UA 3UE1A 1BOSA 1HZCA 1G291 2BE5C 4ZKBB 2AMCB 2EXDA 2B2VC 1CA6A 3ZYYX 3PO3B 1IBLL 4B3TQ 4KJNA 2ZJPA 1GXDC 3VYTA 5DEHA 3PIPA 1ENFA 4RA8A 1J6QA 2DNEA 2OF1A 2OXPA 4O0AA 2K5VA 5IP9H 4HIMA 3OSOA 2FXQA 3S9WA 2EE1A
chains in the Genus database with same CATH topology
4P73A 2R6GA 4X65L 1HR0W 4LF8L 1JE5A 2Y0SE 1Q46A 3I2ZA 3K81C 4GN3B 3W1BA 5GROA 3S1RH 3H0GH 4B3SQ 4A3JH 2CFMA 3RZDH 5JJIA 1MJCA 3F8TA 1FJGQ 1TWCH 3GTLH 3BZKA 4KI0A 4HJ7A 1YNXA 3A74A 4GN4B 3OW2A 1D8LA 2K75A 3B6YA 3CC2A 1KIXA 1DGSA 3M4QA 2JA7G 1R9TH 1QUQA 4B3TL 4LF7Q 1HNWQ 3K80C 2UXCL 1BBWA 3KYHC 1XPUA 1I5FA 1KL9A 1Z47A 4A3EH 1GVPA 4A3DG 4RG1A 3L7ZC 2I5HA 2WB1G 4JI8Q 4R4OA 4A93G 3M85A 1J5EQ 4KHPQ 1OXUA 1VQDA 2JA5G 1PA6A 5H1SE 3GTGH 5IWAQ 5M3MH 1WFQA 2HHHQ 4B3SL 2YU9H 1A8VA 1JT8A 3GDEA 1HR0Q 5AJ3Q 4B3RQ 2LXKA 3CCEA 1WCMH 1SFOH 2PMZE 3K7AH 4QL5A 4YCWA 4DR3Q 1FJGL 3NENA 1NMGA 2NZOA 3PV0A 1EWIA 1FVIA 3E9HA 4IFDG 4LF7L 4JOIA 1CSQA 1HNWL 1N32Q 3RN2A 2HT1A 2RHSB 1YJWA 5JJKA 5ELOA 4DAYB 3U58A 1Y1VH 5ELNA 3TEHB 4K0KQ 1VQHA 2V1CC 4JG2A 1U0LA 5GAGC 3HOWG 1JJGA 2XGTA 1M90C 4DV0Q 4PMWA 4JI8L 3OTOQ 1B8AA 1J5EL 4JI1Q 4KHPL 2IHEA 5IT9c 2YTXA 2BA0A 2K14A 3W5OA 4A3FG 1VQ7A 2ZJQA 2IHFA 2KCTA 5IWAL 2OTJA 4QY7A 4FDBA 2HHHL 1B70B 3PO2H 2NVYH 3H0GG 5JEAG 2NN6G 4A3JG 1VQPA 5AJ3L 4HJ9A 1HR0L 1TWHH 1LUZA 1LTLA 1Q82C 4MNOA 3HOVG 4DR3L 1VCIA 4IFDI 3PGZA 3K0XA 3Q8DA 3GTMH 2A1AA 5C4XH 5JJLA 3DM3A 3J80i 1N32L 3CCLA 3EIVA 4BA1I 5IYBG 4EQ5A 4A3LG 1QVGA 4QIWE 4DV4Q 4K0KL 3AQQA 4DV0L 5FLMG 2R92H 3PSIA 3OTOL 4JI1L 4XTCS 3M7NA 1VQMA 4GOPC 1LM0A 2VQEQ 4DV5Q 2NN6I 1RIPA 3H3VH 4GNXA 4P72A 5HGQA 2JA9A 3UDGA 3PUVA 4A3IH 4O2DA 4BY1G 4DUYQ 3AEVA 1PFSA 1HNZQ 2WP8J 1GKHA 2PI2E 1YIJA 3M3YH 1UE5A 4JI5Q 4OO1G 2VW9A 1CSPA 2WAQE 5DLQE 1L2FA 3J81i 4JBMA 2ZM6Q 3T1HQ 4IOAA 2LXJA 1KQSA 2JEAI 3HFZB 4X6AH 2N3SA 1T9HA 2OCEA 2Q2HA 4DV4L 1UE6A 4DR5Q 4LF4Q 1BKBA 4YWLA 4H02A 2F4VQ 3G71A 2XTIA 5C0XJ 3KJPA 1E3PA 4JI0Q 1EFWA 3ZJYC 4QGUA 2VQEL 4DV5L 3CD6A 2KENA 4GN5A 2ATWA 3EBEA 1E22A 3M4PA 4DUYL 2A8VA 1TWFH 4C3HH 2OQKA 1L0WA 1N8RC 1HNZL 3NBHB 3J80c 1VQEA 3MEFA 4JI5L 1UE1A 2DUDA 2ALYB 4YWKA 2WFWA 2ZM6L 1MIUA 4UP9A 3T1HL 1XMQQ 4BY7H 2UXDQ 1S40A 1IBKQ 1AE3A 3PF5A 4DV7Q 3RLNA 1X65A 2PNHA 3CPWA 2JQOA 4DR5L 2E2HH 4LF4L 5GAHC 1YJNA 4R4CA 2F4VL 3GTQH 2B29A 3HKSA 1ASZA 1I94Q 5M3FH 4JI0L 3RLOA 1OTCA 3EN2A 2AHOB 3PUXA 2MO0A 3KF6B 3UDFA 4DR1Q 2E5LQ 4DNIA 2ZTEA 3KDFA 1YI2A 4IOCA 5C3EH 4OWTB 3J81c 3G6EA 5IY0A 1QZGA 5IE8A 4L5SA 3I56A 5BR8Q 2VY3A 1YEZA 1Z9FA 3ULPA 5K36G 2YYZA 2PQAB 1KRSA 1L1OB 4A3MH 2VQFQ 1BVSA 1XMQL 4BXXG 2UXDL 1IBKL 1CKNB 4IO9A 1L1OC 2B63H 4DV7L 4BBRG 4X62Q 1X3GA 4JBKA 2MO1A 1EIYB 2R7ZG 3A0JA 4L5TA 3CF5A 1KXLA 4Y7NH 2JA8G 4A3CH 4L5QA 1GO3E 3HOXH 3RN5A 1I94L 4A3GH 2UXBQ 2R93H 1AH9A 2K50A 3STBD 3HOZH 4QQBX 1OXXK 3IRBA 1I50H 4DR1L 4UPAA 2VUMH 4LUZA 5C44H 4IJHA 2E5LL 1VQNA 1I3QH 2OQ0A 4GLAC 2KBNA 1OXSC 4IPCA 1Y14B 2UUCQ 1CUKA 5BR8L 3CCRA 2PI2A 4BBSH 1X6OA 1JJCB 1W2BA 4DK6C 4X64Q 1Q81C 2IX1A 1PYBA 4LF9Q 2R7DA 4WJ3M 3UE0A 2VQFL 3WWVA 4GKKQ 4MZ9A 3I4OA 4GOPA 1K3RA 1S3OA 2Z6KA 4X62L 1CKMA 1WJJA 4DKAC 1PH2A 1PH7A 4JCVE 4DPGA 1PH5A 2Q2TA 5IP7G 3CCMA 4KLKA 4C3IH 2UXBL 1PVOA 5IP9G 4PZ7A 2N49A 4APVA 1SLJA 3HKZG 4A75A 4C3JH 1YHQA 1YHAA 1TXYA 3LGJA 2UUCL 1NBWA 3D31A 1UWVA 2JK8A 1QVCA 4ME3A 4X64L 3FKIH 2QEXA 4JYAQ 4LF9L 4DV1Q 1RL2A 2HIVA 4B3RL 2F52A 4A3KH 1ASYA 3S16H 3K8AA 5GAEC 2UU9Q 1YITA 3F2CA 1LYLA 4GKKL 2MQHA 3CCQA 1K9MC 2RCNA 3CCVA 1IZ6A 4NB3A 5E7NA 3UDIA 1MJEA 3HOYH 3NELA 3M9BA 4PG3A 3T1YQ 4LUOA 1PH8A 2OTLA 4LFBQ 2Q2IA 3FHWA 1P8LA 1Y1WH 1GM5A 2ASBA 4JI6Q 4YCVA 1KRTA 1HZAA 4NXNQ 3I4MH 4A3EG 2BH8A 2CWPA 3ULJA 3CCJA 3JAMi 2CWAA 5C44G 1E1TA 1A0IA 3CCSA 1SR3A 5J3BA 5M3MG 3GTPH 4JBWA 4GKJQ 3S1MH 2BA1A 4ALPA 5IYDH 1SN8A 4JYAL 4LFAQ 3HOUH 4YCUA 4DV1L 1K8AC 1UEBA 1WCMG 2K4KA 4GS3A 4JI2Q 4DV3Q 2UU9L 1UE7A 1VQLA 4PZ8A 1K0RA 3J7A5 2VNUD 1NJIC 2D62A 4GLVB 1PYSB 4JI4Q 1WI5A 4YWMA 3KOJA 2L15A 3PUZA 3T1YL 2N8NA 4LFBL 2IX0A 5FJ8H 1Y1VG 4B3MQ 4JI6L 2D0OA 3RR5A 4NXNL 2JA6H 1X55A 2R7FA 3JC66 4JV5Q 1TWAH 1XPOA 3DLLA 2E2JH 2N78A 1X9NA 1EYGA 1L1OA 4GKJL 2KHJA 2D0PA 3GO5A 3PO2G 5GQOA 5LMNW 2I0QA 4YY3Q 3AFQA 1CKNA 2RHQB 1PH3A 4DR2Q 4R4QA 4LFAL 3FKIG 4IPDA 1KC8C 3CXCA 4JI2L 1SROA 4DV3L 1YZ6A 1IL2A 2JA7H 1PH4A 3PO3H 4BA2I 5C4XG 4JI3Q 1G6PA 1Q1BA 1D7QA 4JI4L 1EIFA 2WAQG 2C35B 4TQUS 5FLXc 1E1OA 3CC4A 3KF8B 3NEMA 4A76A 1V9PA 1NTGA 4B3ML 3JAMc 3ICEA 2Z0SA 1Q8KA 4HIDA 1JJ2A 3FP9A 4A3DH 5IYCH 1YVCA 4GLXA 2R92G 1S72A 2JA5H 3S2DH 3S17H 4LUVA 4JV5L 1PH6A 4YHHQ 4LNQA 3I4NH 2GN5A 1N33Q 4A3IG 2CCZA 2AWNA 1N9WA 1HH2P 2EIFA 4OONA 4YY3L 2UUBQ 4DR2L 4GNXB 1VQCA 3TREA 5LMNQ 3MXNB 4JI3L 2JEBI 4KHZA 1PHJA 4HJ8A 3AYHB 2K52A 2E2IH 3S1QH 4UY8C 5M5WH 2QA4A 2WB1E 2H5XA 3PIOA 2JE6I 5FJ8G 3H15A 1N34Q 1HNXQ 3HOWH 2I5LX 4POFA 4JI7Q 2ZJRA 3CMEA 3PF4A 3CW2C 2JA6G 1VQFA 1VQ5A 3STBC 4DV6Q 1XJVA 4AYBG 4A3FH 1EQQA 1OXTA 2YV5A 4NPSA 1K73C 2NVXH 3H3VI 4YHHL 2UUAQ 3RZOH 2B3GA 2VZAA 3A5UA 3K7UC 2NZHA 1N33L 1KAWA 1NMFA 1EOVA 3CAMA 4DAMA 4HIOA 3KFUA 3U4VA 1G51A 4X66Q 2UUBL 2NVTH 3HOVH 1VQ8A 2JJQA 1X54A 1OXVA 1VQIA 4RMFA 2QGQA 1XTDA 5LMNL 2Y0SG 3PO3G 4C2MH 1WYDA 3F2BA 1E24A 4DK3C 4POGA 3GTOH 4BY7G 4JC0A 5C0XG 4A3BH 3VDYA 2HQLA 3CPFA 5LMUQ 1XMOQ 2CKZB 5IYBH 1FGUA 3CCUA 1SE8A 1PH1A 4A3LH 4Y52H 3HKZE 4AH6A 2A19A 4LW1A 1N34L 2HIXA 3L0OA 1HNXL 3S14H 2AWOA 1IYJB 5FLMH 1VQ9A 4A4IA 4JI7L 3CQZH 5IYCG 3RLFA 4IPHA 4DV6L 1M1KC 3SGIA 5M3FG 4DR6Q 1WOCA 2OWOA 3ER0A 5GADC 2UUAL 4WJ4A 1NE3A 3D0FA 2NVQH 3I4NG 1VQKA 2E8GA 4BY1H 2GVBA 3TS2A 1MKHA 1VQ4A 4J15A 4P74A 4LFCQ 4X66L 2ID0A 1H95A 5C3EG 4UP7A 1VS0A 3RNUA 1JMCA 3AFPA 1P16A 3KDFB 5C4JH 1BBUA 3KJOA 5EAYA 4LF6Q 5C0XI 1TWGH 2I5MX 4R4TA 4AIMA 4A3MG 3TRZA 3CMAA 4IPGA 1VQAA 1SMXA 5LMUL 2B63G 1XMOL 4UP8A 3S2HH 2Q2UA 1O7IA 4XIGS 2KHIA 4DR7Q 1KHIA 2ES2A 4A3CG 1QUQB 3HOXG 4A3GG 2R93G 2F3IA 4DR6L 2RF4A 3HOZG 4MTNA 1KD1C 2K5HA 2VUMG 1Q7YC 1X3EA 1X56A 4OX9Q 1N36Q 4LFCL 4R4IA 1VQJA 1HZ9A 1YHBA 4QJFA 1K83H 3F1ZA 4BBSG 3ERSX 1W3SA 5HY6A 2MNAA 4LF6L 1V43A 2ZTDA 1C0AA 1PV4A 5M5XH 4LF5Q 2AKWB 1Q86C 4A3BG 3TQYA 1A63A 1EUJA 3PUWA 2DGYA 3GD7A 3J81j 1SRUA 1C9OA 2YTYA 4R1JA 4DV2Q 4DR7L 3S1NH 3KF6A 4GOPB 3S15H 2GVAA 2VS1A 1IXRA 1HZBA 2Z6KC 4JOIC 1V1QA 4HIKA 4HJAA 1PH9A 3L2PA 4TVAB 2KCMA 1XPRA 4OX9L 1N36L 4P71A 1JB7A 1C7YA 2PQAA 1QVFA 2IY5B 1EQRA 3F2DA 3A5ZB 4DUZQ 3S24A 3GTJH 1XNQQ 3PUYA 3BU2A 3OYYA 1IBMQ 3GTKH 3ULLA 4BXXH 4JBJA 4A3KG 3M4OH 4P75A 4LF5L 2ZTCA 1IBLQ 3U4ZA 3TS0A 4BBRH 1AE2A 3BZCA 4L5RC 4AQYQ 2EQSA 4NXMQ 1X3FA 4PZ6A 3UDXA 2R7ZH 1U5KA 2LSSA 3HOYG 2JA8H 3U50C 4DV2L 1VQ6A 2YTVA 3G48A 3E9IA 1HJPA 1Y1WG 1CKOA 1XNRQ 4IFDJ 2K5NA 4A93H 3I4MG 2BH2A 3BJUA 1YJ9A 4OWXB 2VL6A 4DR4Q 4LWCA 4X65Q 4OWWB 1Q12A 4LF8Q 5M5YH 1VQOA 1FL0A 4OO1I 3CP0A 3I55A 3E0EA 2IT1A 1K8GA 3UE1A 1B7YB 1HZCA 1G291 5IYDG 1E7ZA 4DUZL 2AMCB 2EXDA 1XNQL 3HOUG 1IBML 4OXPA 1VQBA 4HJ5A 2MFIA 1GD7A 3J7ZC 1NY4A 5JEAJ 4GNXC 1IBLL 4B3TQ 3CC7A 2ZJPA 4NXML 4AQYL 3I7FA 1YBYA 4AYBE 1Q1EA 3PIPA 5IP7H 1J6QA 2UXCQ 1A62A 3W1GA 2CQOA 4O0AA 2K5VA 5IP9H 3PCOB 1VQGA 3G4SA 4HIMA 4IJLA 2FXQA 1QZHA 3KLWA 1XNRL 4EX5A 4DR4L 1I6HH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P73 A;  2R6G A;  4X65 L;  1HR0 W;  4LF8 L;  1JE5 A;  2Y0S E;  1Q46 A;  3I2Z A;  3K81 C;  4GN3 B;  3W1B A;  5GRO A;  3S1R H;  3H0G H;  4B3S Q;  4A3J H;  2CFM A;  3RZD H;  5JJI A;  1MJC A;  3F8T A;  1FJG Q;  1TWC H;  3GTL H;  3BZK A;  4KI0 A;  4HJ7 A;  1YNX A;  3A74 A;  4GN4 B;  3OW2 A;  1D8L A;  2K75 A;  3B6Y A;  3CC2 A;  1KIX A;  1DGS A;  3M4Q A;  2JA7 G;  1R9T H;  1QUQ A;  4B3T L;  4LF7 Q;  1HNW Q;  3K80 C;  2UXC L;  1BBW A;  3KYH C;  1XPU A;  1I5F A;  1KL9 A;  1Z47 A;  4A3E H;  1GVP A;  4A3D G;  4RG1 A;  3L7Z C;  2I5H A;  2WB1 G;  4JI8 Q;  4R4O A;  4A93 G;  3M85 A;  1J5E Q;  4KHP Q;  1OXU A;  1VQD A;  2JA5 G;  1PA6 A;  5H1S E;  3GTG H;  5IWA Q;  5M3M H;  1WFQ A;  2HHH Q;  4B3S L;  2YU9 H;  1A8V A;  1JT8 A;  3GDE A;  1HR0 Q;  5AJ3 Q;  4B3R Q;  2LXK A;  3CCE A;  1WCM H;  1SFO H;  2PMZ E;  3K7A H;  4QL5 A;  4YCW A;  4DR3 Q;  1FJG L;  3NEN A;  1NMG A;  2NZO A;  3PV0 A;  1EWI A;  1FVI A;  3E9H A;  4IFD G;  4LF7 L;  4JOI A;  1CSQ A;  1HNW L;  1N32 Q;  3RN2 A;  2HT1 A;  2RHS B;  1YJW A;  5JJK A;  5ELO A;  4DAY B;  3U58 A;  1Y1V H;  5ELN A;  3TEH B;  4K0K Q;  1VQH A;  2V1C C;  4JG2 A;  1U0L A;  5GAG C;  3HOW G;  1JJG A;  2XGT A;  1M90 C;  4DV0 Q;  4PMW A;  4JI8 L;  3OTO Q;  1B8A A;  1J5E L;  4JI1 Q;  4KHP L;  2IHE A;  5IT9 c;  2YTX A;  2BA0 A;  2K14 A;  3W5O A;  4A3F G;  1VQ7 A;  2ZJQ A;  2IHF A;  2KCT A;  5IWA L;  2OTJ A;  4QY7 A;  4FDB A;  2HHH L;  1B70 B;  3PO2 H;  2NVY H;  3H0G G;  5JEA G;  2NN6 G;  4A3J G;  1VQP A;  5AJ3 L;  4HJ9 A;  1HR0 L;  1TWH H;  1LUZ A;  1LTL A;  1Q82 C;  4MNO A;  3HOV G;  4DR3 L;  1VCI A;  4IFD I;  3PGZ A;  3K0X A;  3Q8D A;  3GTM H;  2A1A A;  5C4X H;  5JJL A;  3DM3 A;  3J80 i;  1N32 L;  3CCL A;  3EIV A;  4BA1 I;  5IYB G;  4EQ5 A;  4A3L G;  1QVG A;  4QIW E;  4DV4 Q;  4K0K L;  3AQQ A;  4DV0 L;  5FLM G;  2R92 H;  3PSI A;  3OTO L;  4JI1 L;  4XTC S;  3M7N A;  1VQM A;  4GOP C;  1LM0 A;  2VQE Q;  4DV5 Q;  2NN6 I;  1RIP A;  3H3V H;  4GNX A;  4P72 A;  5HGQ A;  2JA9 A;  3UDG A;  3PUV A;  4A3I H;  4O2D A;  4BY1 G;  4DUY Q;  3AEV A;  1PFS A;  1HNZ Q;  2WP8 J;  1GKH A;  2PI2 E;  1YIJ A;  3M3Y H;  1UE5 A;  4JI5 Q;  4OO1 G;  2VW9 A;  1CSP A;  2WAQ E;  5DLQ E;  1L2F A;  3J81 i;  4JBM A;  2ZM6 Q;  3T1H Q;  4IOA A;  2LXJ A;  1KQS A;  2JEA I;  3HFZ B;  4X6A H;  2N3S A;  1T9H A;  2OCE A;  2Q2H A;  4DV4 L;  1UE6 A;  4DR5 Q;  4LF4 Q;  1BKB A;  4YWL A;  4H02 A;  2F4V Q;  3G71 A;  2XTI A;  5C0X J;  3KJP A;  1E3P A;  4JI0 Q;  1EFW A;  3ZJY C;  4QGU A;  2VQE L;  4DV5 L;  3CD6 A;  2KEN A;  4GN5 A;  2ATW A;  3EBE A;  1E22 A;  3M4P A;  4DUY L;  2A8V A;  1TWF H;  4C3H H;  2OQK A;  1L0W A;  1N8R C;  1HNZ L;  3NBH B;  3J80 c;  1VQE A;  3MEF A;  4JI5 L;  1UE1 A;  2DUD A;  2ALY B;  4YWK A;  2WFW A;  2ZM6 L;  1MIU A;  4UP9 A;  3T1H L;  1XMQ Q;  4BY7 H;  2UXD Q;  1S40 A;  1IBK Q;  1AE3 A;  3PF5 A;  4DV7 Q;  3RLN A;  1X65 A;  2PNH A;  3CPW A;  2JQO A;  4DR5 L;  2E2H H;  4LF4 L;  5GAH C;  1YJN A;  4R4C A;  2F4V L;  3GTQ H;  2B29 A;  3HKS A;  1ASZ A;  1I94 Q;  5M3F H;  4JI0 L;  3RLO A;  1OTC A;  3EN2 A;  2AHO B;  3PUX A;  2MO0 A;  3KF6 B;  3UDF A;  4DR1 Q;  2E5L Q;  4DNI A;  2ZTE A;  3KDF A;  1YI2 A;  4IOC A;  5C3E H;  4OWT B;  3J81 c;  3G6E A;  5IY0 A;  1QZG A;  5IE8 A;  4L5S A;  3I56 A;  5BR8 Q;  2VY3 A;  1YEZ A;  1Z9F A;  3ULP A;  5K36 G;  2YYZ A;  2PQA B;  1KRS A;  1L1O B;  4A3M H;  2VQF Q;  1BVS A;  1XMQ L;  4BXX G;  2UXD L;  1IBK L;  1CKN B;  4IO9 A;  1L1O C;  2B63 H;  4DV7 L;  4BBR G;  4X62 Q;  1X3G A;  4JBK A;  2MO1 A;  1EIY B;  2R7Z G;  3A0J A;  4L5T A;  3CF5 A;  1KXL A;  4Y7N H;  2JA8 G;  4A3C H;  4L5Q A;  1GO3 E;  3HOX H;  3RN5 A;  1I94 L;  4A3G H;  2UXB Q;  2R93 H;  1AH9 A;  2K50 A;  3STB D;  3HOZ H;  4QQB X;  1OXX K;  3IRB A;  1I50 H;  4DR1 L;  4UPA A;  2VUM H;  4LUZ A;  5C44 H;  4IJH A;  2E5L L;  1VQN A;  1I3Q H;  2OQ0 A;  4GLA C;  2KBN A;  1OXS C;  4IPC A;  1Y14 B;  2UUC Q;  1CUK A;  5BR8 L;  3CCR A;  2PI2 A;  4BBS H;  1X6O A;  1JJC B;  1W2B A;  4DK6 C;  4X64 Q;  1Q81 C;  2IX1 A;  1PYB A;  4LF9 Q;  2R7D A;  4WJ3 M;  3UE0 A;  2VQF L;  3WWV A;  4GKK Q;  4MZ9 A;  3I4O A;  4GOP A;  1K3R A;  1S3O A;  2Z6K A;  4X62 L;  1CKM A;  1WJJ A;  4DKA C;  1PH2 A;  1PH7 A;  4JCV E;  4DPG A;  1PH5 A;  2Q2T A;  5IP7 G;  3CCM A;  4KLK A;  4C3I H;  2UXB L;  1PVO A;  5IP9 G;  4PZ7 A;  2N49 A;  4APV A;  1SLJ A;  3HKZ G;  4A75 A;  4C3J H;  1YHQ A;  1YHA A;  1TXY A;  3LGJ A;  2UUC L;  1NBW A;  3D31 A;  1UWV A;  2JK8 A;  1QVC A;  4ME3 A;  4X64 L;  3FKI H;  2QEX A;  4JYA Q;  4LF9 L;  4DV1 Q;  1RL2 A;  2HIV A;  4B3R L;  2F52 A;  4A3K H;  1ASY A;  3S16 H;  3K8A A;  5GAE C;  2UU9 Q;  1YIT A;  3F2C A;  1LYL A;  4GKK L;  2MQH A;  3CCQ A;  1K9M C;  2RCN A;  3CCV A;  1IZ6 A;  4NB3 A;  5E7N A;  3UDI A;  1MJE A;  3HOY H;  3NEL A;  3M9B A;  4PG3 A;  3T1Y Q;  4LUO A;  1PH8 A;  2OTL A;  4LFB Q;  2Q2I A;  3FHW A;  1P8L A;  1Y1W H;  1GM5 A;  2ASB A;  4JI6 Q;  4YCV A;  1KRT A;  1HZA A;  4NXN Q;  3I4M H;  4A3E G;  2BH8 A;  2CWP A;  3ULJ A;  3CCJ A;  3JAM i;  2CWA A;  5C44 G;  1E1T A;  1A0I A;  3CCS A;  1SR3 A;  5J3B A;  5M3M G;  3GTP H;  4JBW A;  4GKJ Q;  3S1M H;  2BA1 A;  4ALP A;  5IYD H;  1SN8 A;  4JYA L;  4LFA Q;  3HOU H;  4YCU A;  4DV1 L;  1K8A C;  1UEB A;  1WCM G;  2K4K A;  4GS3 A;  4JI2 Q;  4DV3 Q;  2UU9 L;  1UE7 A;  1VQL A;  4PZ8 A;  1K0R A;  3J7A 5;  2VNU D;  1NJI C;  2D62 A;  4GLV B;  1PYS B;  4JI4 Q;  1WI5 A;  4YWM A;  3KOJ A;  2L15 A;  3PUZ A;  3T1Y L;  2N8N A;  4LFB L;  2IX0 A;  5FJ8 H;  1Y1V G;  4B3M Q;  4JI6 L;  2D0O A;  3RR5 A;  4NXN L;  2JA6 H;  1X55 A;  2R7F A;  3JC6 6;  4JV5 Q;  1TWA H;  1XPO A;  3DLL A;  2E2J H;  2N78 A;  1X9N A;  1EYG A;  1L1O A;  4GKJ L;  2KHJ A;  2D0P A;  3GO5 A;  3PO2 G;  5GQO A;  5LMN W;  2I0Q A;  4YY3 Q;  3AFQ A;  1CKN A;  2RHQ B;  1PH3 A;  4DR2 Q;  4R4Q A;  4LFA L;  3FKI G;  4IPD A;  1KC8 C;  3CXC A;  4JI2 L;  1SRO A;  4DV3 L;  1YZ6 A;  1IL2 A;  2JA7 H;  1PH4 A;  3PO3 H;  4BA2 I;  5C4X G;  4JI3 Q;  1G6P A;  1Q1B A;  1D7Q A;  4JI4 L;  1EIF A;  2WAQ G;  2C35 B;  4TQU S;  5FLX c;  1E1O A;  3CC4 A;  3KF8 B;  3NEM A;  4A76 A;  1V9P A;  1NTG A;  4B3M L;  3JAM c;  3ICE A;  2Z0S A;  1Q8K A;  4HID A;  1JJ2 A;  3FP9 A;  4A3D H;  5IYC H;  1YVC A;  4GLX A;  2R92 G;  1S72 A;  2JA5 H;  3S2D H;  3S17 H;  4LUV A;  4JV5 L;  1PH6 A;  4YHH Q;  4LNQ A;  3I4N H;  2GN5 A;  1N33 Q;  4A3I G;  2CCZ A;  2AWN A;  1N9W A;  1HH2 P;  2EIF A;  4OON A;  4YY3 L;  2UUB Q;  4DR2 L;  4GNX B;  1VQC A;  3TRE A;  5LMN Q;  3MXN B;  4JI3 L;  2JEB I;  4KHZ A;  1PHJ A;  4HJ8 A;  3AYH B;  2K52 A;  2E2I H;  3S1Q H;  4UY8 C;  5M5W H;  2QA4 A;  2WB1 E;  2H5X A;  3PIO A;  2JE6 I;  5FJ8 G;  3H15 A;  1N34 Q;  1HNX Q;  3HOW H;  2I5L X;  4POF A;  4JI7 Q;  2ZJR A;  3CME A;  3PF4 A;  3CW2 C;  2JA6 G;  1VQF A;  1VQ5 A;  3STB C;  4DV6 Q;  1XJV A;  4AYB G;  4A3F H;  1EQQ A;  1OXT A;  2YV5 A;  4NPS A;  1K73 C;  2NVX H;  3H3V I;  4YHH L;  2UUA Q;  3RZO H;  2B3G A;  2VZA A;  3A5U A;  3K7U C;  2NZH A;  1N33 L;  1KAW A;  1NMF A;  1EOV A;  3CAM A;  4DAM A;  4HIO A;  3KFU A;  3U4V A;  1G51 A;  4X66 Q;  2UUB L;  2NVT H;  3HOV H;  1VQ8 A;  2JJQ A;  1X54 A;  1OXV A;  1VQI A;  4RMF A;  2QGQ A;  1XTD A;  5LMN L;  2Y0S G;  3PO3 G;  4C2M H;  1WYD A;  3F2B A;  1E24 A;  4DK3 C;  4POG A;  3GTO H;  4BY7 G;  4JC0 A;  5C0X G;  4A3B H;  3VDY A;  2HQL A;  3CPF A;  5LMU Q;  1XMO Q;  2CKZ B;  5IYB H;  1FGU A;  3CCU A;  1SE8 A;  1PH1 A;  4A3L H;  4Y52 H;  3HKZ E;  4AH6 A;  2A19 A;  4LW1 A;  1N34 L;  2HIX A;  3L0O A;  1HNX L;  3S14 H;  2AWO A;  1IYJ B;  5FLM H;  1VQ9 A;  4A4I A;  4JI7 L;  3CQZ H;  5IYC G;  3RLF A;  4IPH A;  4DV6 L;  1M1K C;  3SGI A;  5M3F G;  4DR6 Q;  1WOC A;  2OWO A;  3ER0 A;  5GAD C;  2UUA L;  4WJ4 A;  1NE3 A;  3D0F A;  2NVQ H;  3I4N G;  1VQK A;  2E8G A;  4BY1 H;  2GVB A;  3TS2 A;  1MKH A;  1VQ4 A;  4J15 A;  4P74 A;  4LFC Q;  4X66 L;  2ID0 A;  1H95 A;  5C3E G;  4UP7 A;  1VS0 A;  3RNU A;  1JMC A;  3AFP A;  1P16 A;  3KDF B;  5C4J H;  1BBU A;  3KJO A;  5EAY A;  4LF6 Q;  5C0X I;  1TWG H;  2I5M X;  4R4T A;  4AIM A;  4A3M G;  3TRZ A;  3CMA A;  4IPG A;  1VQA A;  1SMX A;  5LMU L;  2B63 G;  1XMO L;  4UP8 A;  3S2H H;  2Q2U A;  1O7I A;  4XIG S;  2KHI A;  4DR7 Q;  1KHI A;  2ES2 A;  4A3C G;  1QUQ B;  3HOX G;  4A3G G;  2R93 G;  2F3I A;  4DR6 L;  2RF4 A;  3HOZ G;  4MTN A;  1KD1 C;  2K5H A;  2VUM G;  1Q7Y C;  1X3E A;  1X56 A;  4OX9 Q;  1N36 Q;  4LFC L;  4R4I A;  1VQJ A;  1HZ9 A;  1YHB A;  4QJF A;  1K83 H;  3F1Z A;  4BBS G;  3ERS X;  1W3S A;  5HY6 A;  2MNA A;  4LF6 L;  1V43 A;  2ZTD A;  1C0A A;  1PV4 A;  5M5X H;  4LF5 Q;  2AKW B;  1Q86 C;  4A3B G;  3TQY A;  1A63 A;  1EUJ A;  3PUW A;  2DGY A;  3GD7 A;  3J81 j;  1SRU A;  1C9O A;  2YTY A;  4R1J A;  4DV2 Q;  4DR7 L;  3S1N H;  3KF6 A;  4GOP B;  3S15 H;  2GVA A;  2VS1 A;  1IXR A;  1HZB A;  2Z6K C;  4JOI C;  1V1Q A;  4HIK A;  4HJA A;  1PH9 A;  3L2P A;  4TVA B;  2KCM A;  1XPR A;  4OX9 L;  1N36 L;  4P71 A;  1JB7 A;  1C7Y A;  2PQA A;  1QVF A;  2IY5 B;  1EQR A;  3F2D A;  3A5Z B;  4DUZ Q;  3S24 A;  3GTJ H;  1XNQ Q;  3PUY A;  3BU2 A;  3OYY A;  1IBM Q;  3GTK H;  3ULL A;  4BXX H;  4JBJ A;  4A3K G;  3M4O H;  4P75 A;  4LF5 L;  2ZTC A;  1IBL Q;  3U4Z A;  3TS0 A;  4BBR H;  1AE2 A;  3BZC A;  4L5R C;  4AQY Q;  2EQS A;  4NXM Q;  1X3F A;  4PZ6 A;  3UDX A;  2R7Z H;  1U5K A;  2LSS A;  3HOY G;  2JA8 H;  3U50 C;  4DV2 L;  1VQ6 A;  2YTV A;  3G48 A;  3E9I A;  1HJP A;  1Y1W G;  1CKO A;  1XNR Q;  4IFD J;  2K5N A;  4A93 H;  3I4M G;  2BH2 A;  3BJU A;  1YJ9 A;  4OWX B;  2VL6 A;  4DR4 Q;  4LWC A;  4X65 Q;  4OWW B;  1Q12 A;  4LF8 Q;  5M5Y H;  1VQO A;  1FL0 A;  4OO1 I;  3CP0 A;  3I55 A;  3E0E A;  2IT1 A;  1K8G A;  3UE1 A;  1B7Y B;  1HZC A;  1G29 1;  5IYD G;  1E7Z A;  4DUZ L;  2AMC B;  2EXD A;  1XNQ L;  3HOU G;  1IBM L;  4OXP A;  1VQB A;  4HJ5 A;  2MFI A;  1GD7 A;  3J7Z C;  1NY4 A;  5JEA J;  4GNX C;  1IBL L;  4B3T Q;  3CC7 A;  2ZJP A;  4NXM L;  4AQY L;  3I7F A;  1YBY A;  4AYB E;  1Q1E A;  3PIP A;  5IP7 H;  1J6Q A;  2UXC Q;  1A62 A;  3W1G A;  2CQO A;  4O0A A;  2K5V A;  5IP9 H;  3PCO B;  1VQG A;  3G4S A;  4HIM A;  4IJL A;  2FXQ A;  1QZH A;  3KLW A;  1XNR L;  4EX5 A;  4DR4 L;  1I6H H; 
#chains in the Genus database with same CATH topology
 5CV9 A;  2R6G A;  4X65 L;  2J4X A;  5IGF A;  1HR0 W;  1XWE A;  4LF8 L;  1GUW A;  5ELC A;  1JE5 A;  3I4N B;  1PRT F;  1Q46 A;  3I90 A;  3H94 A;  2NN6 H;  5JJI A;  1FJG Q;  3GTL H;  3NK9 A;  3BZK A;  4KI0 A;  1YNX A;  3CC2 A;  3CRL C;  1HTP A;  5CR3 A;  2JA7 G;  2EY1 A;  2SOB A;  1F9S A;  1R9T H;  4B3T L;  1G91 A;  1FR3 A;  2F0T A;  3KLS A;  4X3T A;  1JQY D;  2A68 D;  5D3D A;  1GVP A;  3BYT B;  4RG1 A;  4A3D G;  2I5H A;  2IPK D;  4HAE A;  5H1S E;  1EZ6 A;  3D4W A;  3X3N A;  4B3R Q;  3MXG A;  2FMM A;  4NDX A;  1FJG L;  4YCW A;  4DR3 Q;  1QWY A;  4HN7 A;  1EFI D;  1SEB D;  1EWI A;  1FVI A;  3E9H A;  1CSQ A;  4FF4 A;  4KN7 C;  4A3B B;  2NBF A;  5ELO A;  3U58 A;  1Y1V H;  1PLF A;  4V19 0;  2XGT A;  3LWE A;  3OTO Q;  1HXY D;  4A3F G;  2K14 A;  4KMU C;  3W5O A;  1TY0 A;  1WTR A;  4C3J B;  5ELE A;  1KNE A;  2NN6 G;  1Y69 U;  4B3R L;  1Q82 C;  4DR3 L;  1VCI A;  4IFD I;  4LK1 C;  3K0X A;  3SE0 A;  2F3W A;  1QOH A;  3DM3 A;  1TWG B;  3KF8 A;  4QB4 A;  3J80 i;  4OL7 A;  5D65 A;  1HHV A;  1UEA B;  5IYB G;  3S2H B;  1K3B C;  1QVG A;  4QIW E;  4DV4 Q;  2R92 H;  3OTO L;  2VQE Q;  4DV5 Q;  1PRT B;  1TY2 A;  1RIP A;  2F0W A;  5HGQ A;  3BDL A;  3UDG A;  4A3I H;  1AZQ A;  2WP8 J;  3Q23 A;  1PRT D;  1JOQ A;  1UE5 A;  3D6C A;  1TQO A;  2VW9 A;  3MXP A;  1FD7 D;  4MHE A;  2ZM6 Q;  3T1H Q;  4IOA A;  1RDP D;  2DY8 A;  4ZLT F;  1T9H A;  2Q2H A;  4DV4 L;  4LF4 Q;  4DXF A;  4FVM A;  3G71 A;  4K2L A;  1A2U A;  1DYQ A;  2VQE L;  2B8G A;  3OMC A;  4DV5 L;  3R2T A;  2KEN A;  3CD6 A;  3EBE A;  3M4P A;  3FRP B;  1D6E C;  4CDE C;  1N8R C;  5KND A;  5CV8 A;  2EJM A;  1DOM A;  4G57 A;  1IW7 C;  1STE A;  1VQE A;  1K8O A;  1UE1 A;  2ALY B;  1JIC A;  3KBX A;  2ZM6 L;  2JN4 A;  1NUC A;  3T1H L;  5IGG A;  5JOB A;  1LT3 D;  2E2H H;  4LF4 L;  1YJN A;  4R4C A;  1HA5 A;  3HKS A;  1ASZ A;  5DM7 3;  1I94 Q;  2K05 A;  3PUX A;  3CRK C;  3HEJ A;  4KJO A;  1R4Q B;  2F0M A;  2JA5 B;  5M5Y B;  2PO4 A;  2RSN A;  4OWT B;  4L5S A;  3I56 A;  2Z1C A;  3HRZ C;  3ULP A;  2WKC A;  2PQA B;  1L1O B;  4DAY A;  2MHV A;  1BDO A;  2XNA C;  2B63 H;  4ZCK A;  2MO1 A;  2A74 C;  1EIY B;  4ZYS A;  3A0J A;  2R7Z G;  1KXL A;  4A3C H;  1LLR D;  3D8G A;  1I94 L;  1BF4 A;  4A3G H;  2R93 H;  2VXW A;  2K50 A;  4U68 A;  3HOZ H;  1OXX K;  3IRB A;  3SXH A;  2L9H A;  1JOO A;  1BBX C;  4LUZ A;  1CQV A;  5EPK A;  3X3M A;  1JE4 A;  1Y14 B;  5D3I B;  3N6R A;  3CCR A;  4ID6 A;  1RHP A;  3NQI A;  1X6O A;  1JJC B;  2A6H C;  1W2B A;  1Q81 C;  2IX1 A;  4WJ3 M;  3UE0 A;  1L0Y B;  3WWV A;  2JXM B;  4RKB A;  4ZRZ A;  5EKL A;  1PH2 A;  1CKM A;  5CMD A;  1PH7 A;  4IN3 A;  3DM1 A;  4KLK A;  3HP3 A;  1S5E D;  1DOK A;  4F88 A;  3EVQ A;  1CK1 A;  3C1F A;  3NQT A;  1WTW A;  3HKZ G;  4C3J H;  3O13 A;  3LGJ A;  1C48 A;  1D5X C;  1YNJ D;  4KKS A;  1MBY A;  5M3M B;  4BY1 B;  3D31 A;  1JCK B;  1QVC A;  3FKI H;  1H9J A;  1I6V C;  1ASY A;  4A3K H;  2UU9 Q;  5GAE C;  2PW7 A;  4TSS A;  1YIT A;  3CCQ A;  1H9S B;  5C3X A;  1J8I A;  4PG3 A;  3FHW A;  1P8L A;  1GM5 A;  3KK7 A;  2ASB A;  2K33 A;  4OIK A;  4K2K A;  5FKA C;  1EY9 A;  1SR3 A;  3GTP H;  4JBW A;  3P7J A;  1SNM A;  2NVY B;  1F2M A;  4LFA Q;  2G5D A;  1WCM G;  5LHY 1;  5BN5 A;  2UU9 L;  5ELF A;  3VA5 A;  2VNU D;  1HPC A;  1L0X B;  4JI4 Q;  4XQJ A;  4XQQ A;  2G9H D;  4B3M Q;  3RR5 A;  2CW0 C;  4CJ0 B;  2ZT9 C;  1ENC A;  3ONA B;  4J6H A;  3GP7 A;  2L55 A;  2B2Y A;  1ICW A;  3GO5 A;  4IUU A;  2I0Q A;  1SAP A;  3PO2 G;  2HCC A;  1CKN A;  1RTO A;  4DR2 Q;  5C4Z A;  4LFA L;  3FKI G;  4IPD A;  3SHL A;  3CXC A;  1SRO A;  4BA2 I;  1VDZ A;  1AEX A;  4H13 C;  1G6P A;  1Y8N B;  4EX5 A;  1EIF A;  2WAQ G;  2C35 B;  3QIA A;  4JI4 L;  5FLX c;  4NW2 A;  4BBR B;  3RUZ A;  3CC4 A;  4C1N K;  4B3M L;  1D1K A;  2Z0S A;  2PZW A;  1JJ2 A;  4GLX A;  1STH A;  1S72 A;  2JA5 H;  3S17 H;  4LUV A;  1B50 A;  4FO2 A;  2AQ3 B;  4EQO A;  1MSG A;  1ZKO A;  4TRD A;  2EIF A;  1EZ8 A;  3VYU A;  2BE5 D;  4DR2 L;  5KRU A;  1BR9 A;  2VB2 X;  1STA A;  4UY8 C;  5M5W H;  2JE6 I;  5J39 A;  2N88 A;  3I70 A;  3H15 A;  3HOW H;  2F1M A;  3PF4 A;  1VQ5 A;  1K73 C;  4DV6 Q;  4AYB G;  1OXT A;  1S4Z A;  5HUR A;  3RZO H;  4JPB W;  2JYO A;  5JEA H;  1NMF A;  4X66 Q;  4C3H G;  1XX8 A;  4OEL B;  2F0I A;  1OXV A;  1VQI A;  3VR4 A;  4DK3 C;  3DHQ A;  5FLX L;  1T5E A;  5CC4 A;  2CKZ B;  4DNR B;  3SK5 A;  1PH1 A;  1B53 A;  1KDB A;  3MXU A;  3S14 H;  2HIX A;  2AWO A;  1CZG A;  1VQ9 A;  4KY5 A;  2DJF C;  4IPH A;  4DV6 L;  3SGI A;  1M1K C;  2OWO A;  1WTQ A;  2NVQ H;  3P1H A;  4BY1 H;  2GVB A;  3TS2 A;  3PIP 3;  4LFC Q;  4X66 L;  3PIO 3;  1H95 A;  5C3E G;  3E0J A;  1ZYR C;  4BBS B;  5C4J H;  1X3Q A;  1CA5 A;  2I5M X;  4AIM A;  5F2D A;  4DAV A;  2SDF A;  3C46 A;  4FXG C;  1XTC D;  4UP8 A;  4XIG S;  2BDO A;  2CHB D;  1KHI A;  4CKC A;  3T56 B;  3TZU A;  2RF4 A;  2EJF C;  3IFT A;  1V1P B;  3A7L A;  2O5J C;  1HFN A;  1N36 Q;  4LFC L;  2EDG A;  4L8J A;  4PQX A;  3URY A;  3F1Z A;  3M7G A;  1TWH B;  1I6H B;  2MNA A;  1V43 A;  1PTO H;  1PV4 A;  3S16 B;  4EVO A;  2AKW B;  1B9M A;  2DGY A;  3GD7 A;  1C9O A;  3OMG A;  3R3O A;  4L63 B;  3ITP A;  4C3I G;  2VS1 A;  1IXR A;  3I4M B;  4G7O C;  1HZB A;  1N36 L;  4P71 A;  5L37 A;  1C7Y A;  2B2U A;  3S1M B;  5K36 H;  4DUZ Q;  3AU7 A;  4RH6 A;  3PUY A;  3BU2 A;  1V8Q A;  3NTI A;  3ULL A;  3M4O H;  4P75 A;  4BBR H;  1AE2 A;  4L5R C;  4AQY Q;  1X3F A;  1YNN C;  2HQE A;  3UDX A;  2G9D A;  1CFM A;  2WKD A;  3HOY G;  4R8N A;  2JA8 H;  1G6Z A;  2RDG A;  1XNR Q;  4UDU C;  3NPP A;  2BH2 A;  1SNC A;  4DR4 Q;  1TWA B;  1VQO A;  2K01 A;  3I55 A;  1I4R A;  5KNC A;  1IW7 D;  5JJZ A;  1BQQ T;  5IYD G;  4DUZ L;  5FO8 B;  4OXP A;  4HJ5 A;  2JA7 B;  2I07 B;  1GD7 A;  5JEA J;  2HD3 A;  4AQY L;  4WOR A;  4X3K A;  1A6X A;  1Q1E A;  1W6J A;  2UXC Q;  1A62 A;  5CYU A;  3W1G A;  3PCO B;  1XNR L;  2M00 A;  4IJL A;  5CV5 A;  3KLW A;  4A3D B;  4DR4 L;  1II3 A;  4P73 A;  5M3F B;  4QCL A;  4KHV A;  3NBI A;  3H0G H;  1LTB D;  4A3J H;  2F03 A;  2LFN A;  1TWC H;  3A74 A;  4G7H C;  1KIX A;  3I91 A;  2K1B A;  2IWH A;  1HNW Q;  3C3L A;  2L0C A;  1I4H A;  2UXC L;  3KYH C;  1XPU A;  2Q8T A;  1I5F A;  1KL9 A;  3K58 A;  1GJX A;  4A3E H;  3OW7 A;  1JOK A;  5I9P A;  1VQD A;  1PFM A;  1I4X A;  4A3F B;  1PA6 A;  2NVX B;  5FK9 C;  5C4H A;  3TP8 A;  1JB3 A;  2YU9 H;  1A8V A;  3W2D A;  2RKS A;  1JT8 A;  2C9O A;  1HR0 Q;  2NVT B;  2LXK A;  3BVG A;  1BCP F;  4K5V A;  2A5H A;  3NEN A;  3SK8 A;  2NZO A;  4ZQ3 A;  4C2M B;  1FNW A;  3IAY A;  4IFD G;  1HNW L;  5FO7 B;  1E2W A;  4HMJ A;  3TEH B;  4K0K Q;  3MC0 B;  1B8A A;  1S5C D;  2ZJQ A;  2YTX A;  2QIL A;  2IHF A;  2KCT A;  3MFY A;  4RKL A;  1B70 B;  3H0G G;  2D5D A;  4ZKC B;  4A3J G;  1HR0 L;  1EY7 A;  3GQB A;  1TWH H;  4HCS A;  1LTL A;  4LAA A;  4HJ9 A;  3HOV G;  2Z8L A;  2NB0 A;  2EOT A;  5C4X H;  5DM6 3;  2P5Z X;  1BXT A;  4ABN A;  4BA1 I;  4EQ5 A;  2MUY A;  4A3L G;  4K0K L;  3J7A F;  2QDB A;  3PSI A;  4N9P A;  5E3F A;  2MGS A;  1WTP A;  1VQM A;  3M7N A;  1LM0 A;  3KUP A;  1EWC A;  4GNX A;  3Q24 A;  4KD4 A;  4DUY Q;  2HUG A;  2PI2 E;  2A6E C;  4IUQ A;  2QEJ C;  4MN3 A;  2N55 A;  4QF4 A;  4OO1 G;  1K83 B;  2SNS A;  3J81 i;  3ERQ A;  5I9O A;  1KQS A;  5JAV A;  2PPB C;  5M5X B;  1HQM C;  2XWB B;  1UE6 A;  1BKB A;  1UNS A;  3S1N B;  5C0X J;  2CW0 D;  3S15 B;  3KJP A;  4ME5 A;  4GN5 A;  5KIX A;  4IQZ A;  4DUY L;  5EKI A;  1TWF H;  1L0W A;  3NBH B;  4KV6 A;  3J80 c;  2K6A A;  3Q0A A;  3T53 B;  1STB A;  3MEF A;  4IUT A;  2DUD A;  1B2T A;  1TII D;  3GTJ B;  2WFW A;  1UAP A;  4UP9 A;  1XMQ Q;  3GTK B;  2AQ2 B;  3H09 A;  1IBK Q;  1AE3 A;  3PF5 A;  1ILQ A;  1A3T A;  2PNH A;  3CPW A;  2JQO A;  4KD3 A;  1I4Q A;  2F0L A;  2XSC A;  1TS4 A;  5M3F H;  2FMC A;  1OTC A;  3EN2 A;  2WB1 B;  4A93 B;  2MO0 A;  4FF1 A;  5M9O A;  4DNI A;  3DWQ A;  3S2D B;  4IOC A;  2A69 C;  3G6E A;  5IY0 A;  5IE8 A;  1IYV A;  1R4P B;  1YEZ A;  3E5S A;  1Z9F A;  4A3M H;  3R2I A;  1XMQ L;  1VMC A;  1FGB D;  1IBK L;  4XDX A;  1D1I A;  5FLX E;  2B2Y C;  1S5D D;  1IHZ A;  2EYH A;  4L5T A;  1W6K A;  3CF5 A;  4HTH A;  1C4Q A;  1GO3 E;  3N52 A;  3HOX H;  3RN5 A;  2ENB A;  1EIH A;  2UXB Q;  1AH9 A;  2NTT A;  4QQB X;  3HKZ B;  4ZK9 B;  4E6I A;  5C44 H;  4IJH A;  1VQN A;  3J80 L;  4GLA C;  4CDF C;  4IPC A;  1GUO A;  3F2U A;  3RZD B;  4DK6 C;  1PYB A;  5IGB A;  4MZ9 A;  2AUK A;  3BDC A;  4IUN A;  3CU7 A;  1K3R A;  2H4O A;  4DPG A;  1Y8P B;  2UXB L;  5IP9 G;  5EPL A;  3AMU A;  2N49 A;  3CQZ B;  3GTG B;  4K8I A;  1UWV A;  2JK8 A;  2FJ2 A;  1ZYR D;  4ME3 A;  3TSS A;  1WCM B;  1SFO B;  3K7A B;  4RHS A;  4DK0 A;  3F2C A;  1LYL A;  1K9M C;  3OIQ A;  3A7A B;  1IZ6 A;  1JC7 A;  3T1Y Q;  4LUO A;  1PH8 A;  4LFB Q;  1PXU A;  1MHW C;  4J1M A;  2C5C A;  4JI6 Q;  1AFP A;  4K5X A;  3ULJ A;  2CWA A;  2M9V A;  1E1T A;  5C44 G;  1EYA A;  1EQV A;  2E75 C;  2NTS A;  2TSS A;  5J3B A;  4GKJ Q;  3PO2 B;  5EJW A;  4DU9 A;  3HOU H;  4YCU A;  4GS3 A;  1BNZ A;  4DV3 Q;  1SNQ A;  1UE7 A;  1VQL A;  4PZ8 A;  3GTM B;  1K0R A;  1SNP A;  5TSS A;  2D62 A;  4GLV B;  5A35 A;  3KOJ A;  3PUZ A;  3T1Y L;  2N8N A;  4LFB L;  2EYF A;  2RCF A;  2RVL A;  3K57 A;  3C2P A;  1Y1V G;  1LAB A;  3NXW A;  4JI6 L;  3Q22 A;  5IT9 E;  3L9A X;  1NSN S;  5EGT A;  1MGS A;  3DLL A;  4GKJ L;  1L1O A;  1VF7 A;  2KHJ A;  5GQO A;  5LMN W;  2WII B;  1QJO A;  3M3Y B;  3BZD B;  4DV3 L;  1U4P A;  1YZ6 A;  3PO3 H;  5CV7 A;  1Q1B A;  2RA4 A;  5AFW A;  4B08 A;  1YNN D;  1Q8I A;  4MTK A;  4TQU S;  2KVM A;  3KF8 B;  2O2L D;  2F0D A;  1NTG A;  4F7X A;  4IUV A;  2QCP X;  5KYL A;  1Q8K A;  3SVM A;  3FP9 A;  1RF2 D;  2R92 G;  1EEI D;  4AYB B;  3S2D H;  1EY5 A;  3Q6S A;  1PH6 A;  3I4N H;  5IGC A;  2GN5 A;  1WVL A;  5C6A A;  4A3I G;  2CCZ A;  1HH2 P;  4OON A;  4C3H B;  2KJX A;  3AB9 A;  2UUB Q;  3BS1 A;  2L12 A;  1VQC A;  2K5D A;  3LWU A;  3I8Z A;  2PZT A;  3D6W A;  3AYH B;  2B2U C;  1XYI A;  2WB1 E;  5ELD A;  5KEE A;  3GTQ B;  4POF A;  4JI7 Q;  2LKV A;  2NUC A;  3ND8 A;  1H9R A;  1EQQ A;  1U4R A;  3A5U A;  1EOV A;  2QKI C;  4HIO A;  3U4V A;  2UUB L;  2DY7 A;  5C3E B;  3S1R B;  2JJQ A;  3E6Z X;  2HDM A;  1X54 A;  4X3S A;  4UHV A;  4RMF A;  2Y0S G;  3PO3 G;  1WYD A;  1E24 A;  5IGD A;  1SE4 A;  5E4W C;  1PTO F;  2WAC A;  4A3B H;  3VDY A;  3CPF A;  1XMO Q;  1FGU A;  1ESR A;  1LTG D;  3CCU A;  2CH4 A;  3HKZ E;  3NUC A;  4LW1 A;  3L0O A;  4Y7N B;  5FLM H;  4JI7 L;  3CQZ H;  1WOC A;  3M4Y A;  5GAD C;  3D0F A;  4K6L A;  1I50 B;  3I4N G;  2E8G A;  3K59 A;  4QUF A;  1VQ4 A;  1I3Q B;  3RD4 A;  4FF3 A;  3MZ5 A;  3AFP A;  3CHB D;  3KJO A;  2CH4 W;  1DON A;  5EAY A;  1TWG H;  3BYY B;  3OHX C;  3GV3 A;  3TRZ A;  3CMA A;  1VQA A;  1SMX A;  2KCN A;  3EQL C;  4YIJ A;  1XMO L;  2MJ8 A;  2B63 G;  3S2H H;  2Q2U A;  4PNY A;  1TVX A;  2FFK B;  1HRJ A;  3OWE B;  4A3C G;  1QUQ B;  2O5I C;  4C3I B;  4A3G G;  2R93 G;  1Z6H A;  1U4L A;  3HOZ G;  3OIP A;  1KD1 C;  2K5H A;  2Z4I A;  1Q7Y C;  1X56 A;  4OX9 Q;  1BO0 A;  1PZK D;  3MTS A;  1EOT A;  4XT3 B;  1W3S A;  3QB3 A;  4CBV A;  1IYU A;  1LTT D;  1C0A A;  1AZP A;  4LF5 Q;  4A3B G;  3TQY A;  5CBE E;  2XRQ D;  1SRU A;  4BS9 A;  3HOY B;  4I7Z C;  3KF6 A;  3DWA A;  3GV6 A;  2PYK A;  4XT1 B;  2EY5 A;  3BVM A;  3NTH A;  2Z6K C;  1V1Q A;  4C3J G;  3KBG A;  2KCM A;  4TVA B;  4OX9 L;  1S5B D;  2HDL A;  1NNX A;  2A6E D;  2RSO A;  1GUN A;  3S24 A;  4G4K A;  1XNQ Q;  4NMZ A;  5J22 A;  1IBM Q;  4BXX H;  2MPM A;  4A3K G;  1BCP C;  4LF5 L;  2ZTC A;  2EQS A;  5C5M A;  4CGY B;  1U5K A;  2LSS A;  4EGV A;  3G48 A;  5JVG 3;  1QCB D;  4DK1 A;  1QB5 D;  2K5N A;  2JA6 B;  2F0E A;  2VL6 A;  4OWX B;  1PZI D;  2X6L A;  5M5Y H;  1FL0 A;  2E2J B;  1F77 A;  2IT1 A;  3QOL A;  3DUZ A;  1F2L A;  2IX3 A;  3QOJ A;  1XNQ L;  3D4D A;  2B8F A;  1IBM L;  1VQB A;  5G3L F;  3J7Z C;  1NY4 A;  1X3P A;  4GNX C;  1PYW D;  4BY7 B;  1YBY A;  4AYB E;  1LTS D;  5IP7 H;  1QNK A;  2CQO A;  1D2B A;  1QZH A;  4KY7 A;  1CHP D;  3BDO A;  3S1R H;  4GN3 B;  2A69 D;  1AN8 A;  1ZEQ X;  3J80 E;  2CFM A;  2IL8 A;  1MJC A;  2ICI A;  3F8T A;  1CQF A;  3OW2 A;  3U9S A;  1D8L A;  2F0P A;  1TU2 B;  2EPB A;  4LF7 Q;  4QMG A;  2E2I B;  3K80 C;  3S1Q B;  2KUM A;  3FVQ A;  1O7L A;  1Z47 A;  3I4L A;  3K0Y A;  3L7Z C;  4XYQ A;  3M85 A;  1J5E Q;  1OXU A;  3NWT A;  2JA5 G;  4XXE A;  3K5L A;  5IWA Q;  5M3M H;  2VUM B;  1TR5 A;  3P75 A;  5AJ3 Q;  3HOV B;  4N8X 1;  4OHJ A;  1SJH D;  4DN4 M;  5EPJ A;  1RKN A;  3PV0 A;  3GTO B;  4LF7 L;  4JOI A;  3NSW A;  3RN2 A;  3IL8 A;  2RHS B;  1YJW A;  1G2T A;  3P20 A;  2V1C C;  1ENA A;  3I72 A;  5GAG C;  3HOW G;  2E74 C;  1JJG A;  1M90 C;  3WOE A;  4DXG A;  4DV0 Q;  3FDT A;  4PMW A;  1J5E L;  4JI1 Q;  2IHE A;  5IT9 c;  2BA0 A;  5IWA L;  2OTJ A;  4QY7 A;  1RJT A;  1GOZ A;  2NVY H;  5JEA G;  1B1Z A;  5AJ3 L;  4HR7 B;  3WDN A;  1NAP A;  3SEB A;  3Q8D A;  4Q5V A;  2A1A A;  3FEW X;  3V2T A;  2R3Z A;  1SYG A;  3CCL A;  3EIV A;  1EQT A;  1WD1 A;  4RWS C;  3AQQ A;  4DV0 L;  1Y1W B;  1O78 A;  4JI1 L;  2F0K A;  1X32 A;  4MIU A;  4BY1 G;  3AEV A;  1PFS A;  3MXN A;  1YIJ A;  5BN4 A;  2SNM A;  4JI5 Q;  3IFD A;  5DLQ E;  4JBM A;  1L2F A;  1PFN A;  1F2Z A;  2WV6 D;  2LXJ A;  2NWG A;  3DXJ C;  2K5Q A;  2JEA I;  5K5P A;  2PZU A;  2N3S A;  2OCE A;  1CHQ D;  4U67 3;  4H02 A;  4H7B A;  2EYO A;  5IT9 L;  5IOD A;  1E3P A;  4JI0 Q;  4IUR A;  1EFW A;  2LMC B;  4QGU A;  4DFA A;  2ATW A;  2A8V A;  1E2Z A;  4JI5 L;  1UUP A;  3NE5 B;  4YWK A;  2CQA A;  1MIU A;  4FXK C;  4BY7 H;  2UXD Q;  2X6G A;  5C0X H;  2DJG C;  4KTA A;  4DV7 Q;  3RLN A;  1X65 A;  4ZAI A;  4DGZ A;  1LTR D;  1JWS D;  3TP5 A;  3PMF A;  4JI0 L;  4OEM B;  3RMH A;  4DR1 Q;  3EA6 A;  2ZTE A;  3KDF A;  1YI2 A;  3J81 c;  5BR8 Q;  2IW3 A;  2VY3 A;  1CM9 A;  1H9M A;  2K7V A;  2KHS A;  2YYZ A;  5K36 G;  3U9O A;  2XN9 C;  4XQN A;  1BVS A;  3TBI B;  2UXD L;  4IO9 A;  1L1O C;  2K5W A;  4EQP A;  4DV7 L;  4CKB A;  4BBR G;  4FXD A;  4JBK A;  1F9R A;  5FOB B;  2JA8 G;  5D14 A;  5C5L A;  1GUS A;  4DR1 L;  4HSV A;  2VUM H;  1ET9 A;  1HUM A;  2UUC Q;  3KLS X;  5BR8 L;  4BBS H;  4X64 Q;  2A6H D;  2B39 A;  2R7D A;  3GTL B;  1PZJ D;  4I65 A;  4GOP A;  4JW0 A;  1R9T B;  4X3U A;  2Z6K A;  3L3O C;  4DKA C;  1WJJ A;  2V4D A;  4JCV E;  1PH5 A;  2Q2T A;  3CCM A;  4KKU A;  3J7A V;  1TS2 A;  1KDA A;  4H44 C;  5T1G A;  2Z4H A;  3A56 A;  4A75 A;  1YHQ A;  3J81 L;  1SDF A;  4F87 A;  1O80 A;  2Z9H A;  2UUC L;  1NBW A;  1EY0 A;  1WTX A;  3QJY A;  2E2D C;  1LAC A;  4X64 L;  3T13 A;  2QEX A;  1I6H H;  4DV1 Q;  2HIV A;  2B2T C;  3S16 H;  3BG3 A;  3T16 A;  3K8A A;  3QWN A;  3FPP A;  2KOL A;  3G7L A;  4CHT B;  5E7N A;  1MJE A;  3NEL A;  4RCN A;  2OTL A;  2HCI A;  1Y1W H;  1A2T A;  1Y1V B;  3OPO A;  2K28 A;  1TKW B;  5E4X A;  2AUJ D;  3I4M H;  4A3E G;  4B9X A;  2BH8 A;  2CWP A;  3K6O A;  3JAM i;  1A0I A;  1T5X D;  3S1M H;  1HQR D;  4N8F A;  1SN8 A;  1EYC A;  4DV1 L;  1K8A C;  4JI2 Q;  3J7A 5;  1GUT A;  1NJI C;  1PYS B;  3HS0 C;  1PTO C;  3UI2 A;  4LMQ D;  4Z9C B;  2JP1 A;  1X55 A;  2R92 B;  3MWY W;  2R7F A;  1RTN A;  1TWA H;  3TN2 A;  1XPO A;  4RFB A;  2RBM A;  3LX0 A;  1ET6 A;  3W3A A;  1NCV A;  4A3I B;  1IL8 A;  2D0P A;  5I2X A;  2RHQ B;  1BCP B;  1LTA D;  2EY2 A;  2B2W A;  4JI2 L;  4WFN 3;  2JA7 H;  2F4I A;  1PH4 A;  5C4X G;  1BCP D;  4JI3 Q;  1U4M A;  3NWS A;  2F0J A;  1E1O A;  2R7Z B;  3NEM A;  1V9P A;  4BWG B;  4A3D H;  1YVC A;  4RAU C;  3SK6 A;  2J7Z A;  4ODG A;  4YHH Q;  3DMU A;  4LNQ A;  3VA7 A;  1N9W A;  1SE3 A;  1S5F D;  4GNX B;  4K6D A;  4PV1 C;  2Y0S B;  5LMN Q;  4DNT B;  4JI3 L;  4K8J A;  2JEB I;  1PHJ A;  4HJ8 A;  4B9W A;  2QF7 A;  3K5N A;  2NZ1 D;  3SR1 A;  2QA4 A;  3R93 A;  3PIO A;  5C3W A;  4DA2 A;  2E2H B;  3DEO A;  3CME A;  5FO9 B;  3STB C;  2KED A;  1IKM A;  4A3F H;  2NVX H;  1QE6 A;  2YV5 A;  4NPS A;  4R9W A;  4YHH L;  2UUA Q;  2B3G A;  2VZA A;  2EYP A;  3K7U C;  3KFU A;  4CJ1 B;  1G51 A;  2NVT H;  2PQE A;  1FNV A;  1VQ8 A;  1K8M A;  4LJZ C;  2A73 B;  3K5O A;  1B44 D;  1XTD A;  2QGQ A;  5LMN L;  4C2M H;  1O7Z A;  4POG A;  4IZ8 A;  1ESF A;  4RHR A;  5LMU Q;  2B63 B;  2PMZ B;  5IYB H;  4Y52 H;  2A19 A;  2EJG C;  1B4O A;  4A3G B;  2R93 B;  5M3F G;  4DR6 Q;  3ER0 A;  3HOZ B;  3QR8 A;  2UUA L;  4WJ4 A;  5IGE A;  5CBA E;  1MKH A;  4J15 A;  4P74 A;  2ID0 A;  3RNU A;  1JMC A;  4EQN A;  5C0X I;  4LF6 Q;  5T1I A;  4A3M G;  1EEF D;  4FP5 D;  5CGK A;  4K5W A;  4P2C B;  4CKE A;  2XWJ B;  1G8Z D;  1EYD A;  2K03 A;  4IPG A;  2LS0 1;  3EJI A;  4RGN A;  1VF5 C;  4CDC C;  5LMU L;  4FF2 A;  2K04 A;  2KHI A;  4DR7 Q;  1WTV A;  3HOX G;  1WTH A;  1KNA A;  2RDH A;  3MFG A;  4DR6 L;  3TDQ A;  4MTN A;  3LNN A;  1Q3L A;  1X3E A;  4R4I A;  1VQJ A;  1HZ9 A;  1M8A A;  4O42 A;  4QJF A;  1K83 H;  5CV4 A;  3ERS X;  4ILW A;  5HY6 A;  3FKI B;  1AW7 A;  4LF6 L;  1Q90 A;  4A3K B;  5M5X H;  1A63 A;  1JWM D;  4RCO A;  1EUJ A;  3PUW A;  3J81 j;  2WAQ B;  1SNO A;  2YTY A;  4R1J A;  5JPM C;  4DV2 Q;  4DR7 L;  3S1N H;  3OOC A;  4R8I A;  3S15 H;  4L6T B;  2GVA A;  1TS3 A;  1EL0 A;  4HIK A;  4JOI C;  1SXT A;  1B3Q A;  3L2P A;  1XPR A;  2PQA A;  2H1E A;  3GTP B;  2IY5 B;  5EBD A;  3GTJ H;  1NR4 A;  3GTK H;  3I73 A;  4NKL A;  1GHJ A;  3TS0 A;  3MVV A;  3BZC A;  4NXM Q;  2R7Z H;  4PZ6 A;  4PMB A;  2L11 A;  4V0B A;  3U50 C;  1SYE A;  4DV2 L;  1VQ6 A;  1K0S A;  2YTV A;  4TKO B;  2GA4 B;  1F9P A;  1EU3 A;  2J0T D;  1CT1 D;  4A93 H;  2KA7 A;  3BJU A;  1LT5 D;  4OWW B;  1Q12 A;  4OO1 I;  1VMP A;  2TMP A;  3CP0 A;  4H0L C;  1K8G A;  5EBC A;  2JSO A;  1B7Y B;  1F9Q A;  3BVZ A;  1E7Z A;  1SBB B;  3KLR A;  1CTM A;  3HOU G;  5COR A;  2MFI A;  3G6J B;  4F8M A;  3CC7 A;  4NXM L;  3I7F A;  3VYS A;  1XXG A;  1I4G A;  1LV9 A;  1VQG A;  2RQX A;  4NP5 A;  3G4S A;  3OWF A;  3D3R A;  3S17 B;  2B2T A;  2KQ3 A;  2Y0S E;  3I2Z A;  3K81 C;  3W1B A;  4B3S Q;  1E2V A;  5GRO A;  3RZD H;  4WJW A;  4XYO A;  1H9S A;  3QG1 A;  2XIW A;  4HJ7 A;  4GN4 B;  3B6Y A;  2K75 A;  1DGS A;  3M4Q A;  3MAQ A;  1QUQ A;  4OGQ C;  1D5M C;  1JWU D;  3JAM E;  5M5W B;  1BBW A;  2DN8 A;  3MEH A;  4Q0F A;  3HOW B;  2F0S A;  2WB1 G;  4A93 G;  4JI8 Q;  2OT2 A;  4R4O A;  2K32 A;  4KHP Q;  2F0N A;  3GTG H;  3RZO B;  1WFQ A;  3J81 E;  2HHH Q;  4B3S L;  1DZ1 A;  1G2S A;  3GDE A;  4N9T A;  3CCE A;  1WCM H;  1SFO H;  2PMZ E;  3K7A H;  4QL5 A;  1NMG A;  2QDL A;  1N32 Q;  2HT1 A;  5JJK A;  2ZXR A;  4DAY B;  1V1O A;  1EY4 A;  1A15 A;  5ELN A;  1VQH A;  1FNU A;  4JG2 A;  1U0L A;  3S14 B;  3PQI A;  4JI8 L;  4KHP L;  1VQ7 A;  1HA6 A;  2NVQ B;  4FDB A;  2HHH L;  3PO2 H;  1HTL D;  1LTI D;  1ONL A;  1VQP A;  1LUZ A;  4MNO A;  3TME A;  3PGZ A;  2PCF B;  3VR3 A;  3EFX D;  5C4J B;  3GTM H;  1B3A A;  5JJL A;  3FPU B;  2KEE A;  5I6W A;  1N32 L;  4I7A A;  3HZX A;  1Z7T A;  2XRS D;  4S3S A;  5FLM G;  2B2V A;  4XTC S;  2EY6 A;  4GOP C;  3SDZ A;  2NN6 I;  3H3V H;  4P72 A;  1A3V A;  2JA9 A;  3PUV A;  4JK1 C;  1EY6 A;  4O2D A;  1HNZ Q;  1GKH A;  2PNR C;  2F0V A;  3M3Y H;  4DAP A;  1TS5 A;  1CSP A;  2WAQ E;  4HED A;  1PTO B;  5J1Z A;  3K5M A;  3HFZ B;  4X6A H;  4DR5 Q;  1PTO D;  2ZXP A;  2F4V Q;  4YWL A;  1EU4 A;  4KK7 A;  5A2Q L;  1KAB A;  2XTI A;  2XVS A;  1MI2 A;  1SMY C;  3ZJY C;  1ILP A;  3C1E A;  1E22 A;  4C3H H;  2OQK A;  1HNZ L;  4RGM A;  1SYF A;  2F0Q A;  1S40 A;  3HG9 A;  3M4O B;  3E3X A;  4DR5 L;  5GAH C;  2F4V L;  3GTQ H;  2JA8 B;  2B29 A;  1STG A;  3I3C A;  3RLO A;  2MP1 A;  1SE2 A;  2AHO B;  1JR0 D;  3KF6 B;  3UDF A;  1NR2 A;  1OO9 B;  2E5L Q;  1GHK A;  5JPN C;  3CKI B;  2R61 A;  5C3E H;  1QZG A;  2LY7 A;  3H91 A;  5HGT A;  1KRS A;  2X69 A;  1KTK A;  2VQF Q;  3R8B A;  1ICF B;  4BXX G;  3HGB A;  1CKN B;  3D4R A;  1EIG A;  1PDQ A;  4JVZ A;  4X62 Q;  1X3G A;  1DM0 B;  2BCO A;  4Y7N H;  2KCC A;  4C56 C;  4L5Q A;  2B2W C;  1V1P A;  2A68 C;  5EQ0 A;  1J9O A;  3STB D;  1I50 H;  5JVH 3;  4UPA A;  2E5L L;  4CJ2 C;  3MA2 B;  1I3Q H;  2OQ0 A;  3VR6 A;  2KBN A;  1PFB A;  1OXS C;  4HCE A;  1CUK A;  3H0G B;  2PI2 A;  4A3J B;  4LF9 Q;  1TWC B;  2VQF L;  4GKK Q;  3I4O A;  5LL6 S;  1S3O A;  4X62 L;  1B9N A;  3QO2 A;  1KLU D;  2FHT A;  1DXM A;  1FYC A;  5IP7 G;  1DCZ A;  2AQ1 B;  4C3I H;  2NYZ D;  1PVO A;  4PZ7 A;  4A3E B;  1A3U A;  4APV A;  1SLJ A;  1QG7 A;  1PMR A;  1YHA A;  1TXY A;  1ZXT A;  2SEB D;  3DEP A;  3ND9 A;  2YU9 B;  2PW5 A;  3VR5 A;  4JYA Q;  4LF9 L;  1RL2 A;  1RD9 D;  4WRD A;  2F52 A;  4GKK L;  2MQH A;  2RCN A;  3CCV A;  3NHH A;  4NB3 A;  3UDI A;  5G3L D;  3HOY H;  3M9B A;  2VB3 X;  4HMI A;  3A55 A;  2Q2I A;  1RCV D;  5KYI A;  1TT2 A;  1STN A;  1SYD A;  3VR2 A;  4YCV A;  1KRT A;  1HZA A;  4NXN Q;  3ERO A;  4UAI A;  2F0H A;  1SJE D;  5COY A;  3IKJ A;  3CCJ A;  3CCS A;  5M3M G;  1QNU A;  2BA1 A;  4ALP A;  1PRT C;  5IYD H;  1MD2 D;  5EKK A;  4JYA L;  1UEB A;  2K4K A;  5NUC A;  2QW7 A;  3MHB A;  5C4X B;  5IIF A;  2D9U A;  1DOL A;  1U9R A;  2DNC A;  1WI5 A;  4YWM A;  2L15 A;  2IX0 A;  1O7Y A;  5FJ8 H;  2D0O A;  4NXN L;  2JA6 H;  2M2L A;  4PMC A;  4RGO S;  1HUN A;  3JC6 6;  1KLG D;  4JV5 Q;  1CZW A;  4M8A A;  2N78 A;  1X9N A;  1EYG A;  2E2J H;  4YY3 Q;  3AFQ A;  1PH3 A;  2OEO A;  3H3V C;  4R4Q A;  1KC8 C;  1IL2 A;  1IKL A;  1D7Q A;  2L4N A;  1I4P A;  2L5T A;  4A76 A;  1DJR D;  2F0O A;  4KY6 A;  3JAM c;  3ICE A;  4HID A;  1F2Y A;  2IJ0 A;  4ZUJ A;  5IYC H;  4JV5 L;  4GZY C;  1N33 Q;  1STY A;  2AWN A;  1HCZ A;  1TWF B;  4YY3 L;  1M4V A;  3FMC A;  1AP0 A;  3DWP A;  3V96 A;  4FNF A;  5I6Y A;  3TRE A;  3MXN B;  3SK4 A;  4IFD H;  4KHZ A;  2K52 A;  3NTK A;  2E2I H;  3S1Q H;  4DF7 A;  2E76 C;  2H5X A;  4O1N A;  4CDD C;  5FJ8 G;  4KKT A;  1HNX Q;  1N34 Q;  2ICE C;  2I5L X;  4KN4 C;  2ZJR A;  3CW2 C;  3WOF A;  2JA6 G;  1VQF A;  1XJV A;  3H3V I;  2O4X A;  2NZH A;  1N33 L;  1CI3 M;  1KAW A;  4DAM A;  3CAM A;  4K14 A;  5CV6 A;  1LO5 D;  4RGT A;  3HOV H;  2Q8R E;  4ULL A;  1KDC A;  5I2Y A;  3NP8 A;  1ROD A;  1EWH A;  3F2B A;  3GTO H;  4A3M B;  3T4A C;  3TP7 A;  4BY7 G;  4JC0 A;  5DNF A;  5C0X G;  2HQL A;  5E1F A;  3JAM L;  1SE8 A;  4A3L H;  2WIN B;  4AH6 A;  1HNX L;  1N34 L;  1SSO A;  5DAU A;  1IYJ B;  4A4I A;  3HOX B;  4C1N I;  5IYC G;  3RLF A;  1NE3 A;  1LT6 D;  1VQK A;  1E0B A;  5C44 B;  3TP6 A;  4HSP A;  1YNJ C;  1HFG A;  4UP7 A;  1VS0 A;  4OO1 H;  1JOR A;  3KDF B;  1P16 A;  1BBU A;  3TZD A;  1MSH A;  4M1U B;  4R4T A;  2BOS A;  2ZXO A;  2CVR A;  2EXZ A;  4FYD A;  1C8C A;  1O7I A;  2KEC A;  4IUP A;  2F0F A;  5ELB A;  2ES2 A;  1EY8 A;  2L1B A;  2F3I A;  2F3V A;  3NBH A;  4QIW B;  2VUM G;  2EYJ A;  1K28 A;  2EYM A;  1H9K A;  1YHB A;  2Q8I B;  1LT4 D;  4BBS G;  3A8I E;  2F0G A;  3VYR A;  3A8J E;  2ZTD A;  4IAL A;  1Q86 C;  2EVB A;  1WD0 A;  3J7Y W;  2RDF A;  1BUV T;  1WTO A;  4OIJ A;  5IOC A;  5ISR A;  1D5Z C;  4G7Z C;  4GOP B;  5KGU A;  5A2Q E;  3A8K E;  2EYL A;  5BN3 A;  1DD2 A;  2D2C C;  4HJA A;  1PH9 A;  3V05 A;  1SND A;  1JB7 A;  4J8Q A;  1QVF A;  5KNB A;  1EQR A;  3F2D A;  3A5Z B;  2FIN B;  3OYY A;  3HOU B;  4JBJ A;  1SYC A;  1IBL Q;  3U4Z A;  3T51 B;  5LL6 X;  2EZV A;  1GUG A;  1SYB A;  3E9I A;  1HJP A;  1Y1W G;  1CKO A;  5I4D A;  4IFD J;  4QUC A;  3I4M G;  1SMY D;  1YJ9 A;  3A54 A;  1QIL A;  1Y8O B;  4LWC A;  4X65 Q;  1ML0 D;  2BDN A;  4LF8 Q;  2Z6B A;  4ZUI A;  3H6M A;  3E0E A;  2I46 A;  1KAA A;  2F0U A;  3UE1 A;  1BOS A;  1HZC A;  1G29 1;  2BE5 C;  4ZKB B;  2AMC B;  2EXD A;  2B2V C;  1CA6 A;  3ZYY X;  3PO3 B;  1IBL L;  4B3T Q;  4KJN A;  2ZJP A;  1GXD C;  3VYT A;  5DEH A;  3PIP A;  1ENF A;  4RA8 A;  1J6Q A;  2DNE A;  2OF1 A;  2OXP A;  4O0A A;  2K5V A;  5IP9 H;  4HIM A;  3OSO A;  2FXQ A;  3S9W A;  2EE1 A; 
#chains in the Genus database with same CATH homology
 4P73 A;  2R6G A;  4X65 L;  1HR0 W;  4LF8 L;  1JE5 A;  2Y0S E;  1Q46 A;  3I2Z A;  3K81 C;  4GN3 B;  3W1B A;  5GRO A;  3S1R H;  3H0G H;  4B3S Q;  4A3J H;  2CFM A;  3RZD H;  5JJI A;  1MJC A;  3F8T A;  1FJG Q;  1TWC H;  3GTL H;  3BZK A;  4KI0 A;  4HJ7 A;  1YNX A;  3A74 A;  4GN4 B;  3OW2 A;  1D8L A;  2K75 A;  3B6Y A;  3CC2 A;  1KIX A;  1DGS A;  3M4Q A;  2JA7 G;  1R9T H;  1QUQ A;  4B3T L;  4LF7 Q;  1HNW Q;  3K80 C;  2UXC L;  1BBW A;  3KYH C;  1XPU A;  1I5F A;  1KL9 A;  1Z47 A;  4A3E H;  1GVP A;  4A3D G;  4RG1 A;  3L7Z C;  2I5H A;  2WB1 G;  4JI8 Q;  4R4O A;  4A93 G;  3M85 A;  1J5E Q;  4KHP Q;  1OXU A;  1VQD A;  2JA5 G;  1PA6 A;  5H1S E;  3GTG H;  5IWA Q;  5M3M H;  1WFQ A;  2HHH Q;  4B3S L;  2YU9 H;  1A8V A;  1JT8 A;  3GDE A;  1HR0 Q;  5AJ3 Q;  4B3R Q;  2LXK A;  3CCE A;  1WCM H;  1SFO H;  2PMZ E;  3K7A H;  4QL5 A;  4YCW A;  4DR3 Q;  1FJG L;  3NEN A;  1NMG A;  2NZO A;  3PV0 A;  1EWI A;  1FVI A;  3E9H A;  4IFD G;  4LF7 L;  4JOI A;  1CSQ A;  1HNW L;  1N32 Q;  3RN2 A;  2HT1 A;  2RHS B;  1YJW A;  5JJK A;  5ELO A;  4DAY B;  3U58 A;  1Y1V H;  5ELN A;  3TEH B;  4K0K Q;  1VQH A;  2V1C C;  4JG2 A;  1U0L A;  5GAG C;  3HOW G;  1JJG A;  2XGT A;  1M90 C;  4DV0 Q;  4PMW A;  4JI8 L;  3OTO Q;  1B8A A;  1J5E L;  4JI1 Q;  4KHP L;  2IHE A;  5IT9 c;  2YTX A;  2BA0 A;  2K14 A;  3W5O A;  4A3F G;  1VQ7 A;  2ZJQ A;  2IHF A;  2KCT A;  5IWA L;  2OTJ A;  4QY7 A;  4FDB A;  2HHH L;  1B70 B;  3PO2 H;  2NVY H;  3H0G G;  5JEA G;  2NN6 G;  4A3J G;  1VQP A;  5AJ3 L;  4HJ9 A;  1HR0 L;  1TWH H;  1LUZ A;  1LTL A;  1Q82 C;  4MNO A;  3HOV G;  4DR3 L;  1VCI A;  4IFD I;  3PGZ A;  3K0X A;  3Q8D A;  3GTM H;  2A1A A;  5C4X H;  5JJL A;  3DM3 A;  3J80 i;  1N32 L;  3CCL A;  3EIV A;  4BA1 I;  5IYB G;  4EQ5 A;  4A3L G;  1QVG A;  4QIW E;  4DV4 Q;  4K0K L;  3AQQ A;  4DV0 L;  5FLM G;  2R92 H;  3PSI A;  3OTO L;  4JI1 L;  4XTC S;  3M7N A;  1VQM A;  4GOP C;  1LM0 A;  2VQE Q;  4DV5 Q;  2NN6 I;  1RIP A;  3H3V H;  4GNX A;  4P72 A;  5HGQ A;  2JA9 A;  3UDG A;  3PUV A;  4A3I H;  4O2D A;  4BY1 G;  4DUY Q;  3AEV A;  1PFS A;  1HNZ Q;  2WP8 J;  1GKH A;  2PI2 E;  1YIJ A;  3M3Y H;  1UE5 A;  4JI5 Q;  4OO1 G;  2VW9 A;  1CSP A;  2WAQ E;  5DLQ E;  1L2F A;  3J81 i;  4JBM A;  2ZM6 Q;  3T1H Q;  4IOA A;  2LXJ A;  1KQS A;  2JEA I;  3HFZ B;  4X6A H;  2N3S A;  1T9H A;  2OCE A;  2Q2H A;  4DV4 L;  1UE6 A;  4DR5 Q;  4LF4 Q;  1BKB A;  4YWL A;  4H02 A;  2F4V Q;  3G71 A;  2XTI A;  5C0X J;  3KJP A;  1E3P A;  4JI0 Q;  1EFW A;  3ZJY C;  4QGU A;  2VQE L;  4DV5 L;  3CD6 A;  2KEN A;  4GN5 A;  2ATW A;  3EBE A;  1E22 A;  3M4P A;  4DUY L;  2A8V A;  1TWF H;  4C3H H;  2OQK A;  1L0W A;  1N8R C;  1HNZ L;  3NBH B;  3J80 c;  1VQE A;  3MEF A;  4JI5 L;  1UE1 A;  2DUD A;  2ALY B;  4YWK A;  2WFW A;  2ZM6 L;  1MIU A;  4UP9 A;  3T1H L;  1XMQ Q;  4BY7 H;  2UXD Q;  1S40 A;  1IBK Q;  1AE3 A;  3PF5 A;  4DV7 Q;  3RLN A;  1X65 A;  2PNH A;  3CPW A;  2JQO A;  4DR5 L;  2E2H H;  4LF4 L;  5GAH C;  1YJN A;  4R4C A;  2F4V L;  3GTQ H;  2B29 A;  3HKS A;  1ASZ A;  1I94 Q;  5M3F H;  4JI0 L;  3RLO A;  1OTC A;  3EN2 A;  2AHO B;  3PUX A;  2MO0 A;  3KF6 B;  3UDF A;  4DR1 Q;  2E5L Q;  4DNI A;  2ZTE A;  3KDF A;  1YI2 A;  4IOC A;  5C3E H;  4OWT B;  3J81 c;  3G6E A;  5IY0 A;  1QZG A;  5IE8 A;  4L5S A;  3I56 A;  5BR8 Q;  2VY3 A;  1YEZ A;  1Z9F A;  3ULP A;  5K36 G;  2YYZ A;  2PQA B;  1KRS A;  1L1O B;  4A3M H;  2VQF Q;  1BVS A;  1XMQ L;  4BXX G;  2UXD L;  1IBK L;  1CKN B;  4IO9 A;  1L1O C;  2B63 H;  4DV7 L;  4BBR G;  4X62 Q;  1X3G A;  4JBK A;  2MO1 A;  1EIY B;  2R7Z G;  3A0J A;  4L5T A;  3CF5 A;  1KXL A;  4Y7N H;  2JA8 G;  4A3C H;  4L5Q A;  1GO3 E;  3HOX H;  3RN5 A;  1I94 L;  4A3G H;  2UXB Q;  2R93 H;  1AH9 A;  2K50 A;  3STB D;  3HOZ H;  4QQB X;  1OXX K;  3IRB A;  1I50 H;  4DR1 L;  4UPA A;  2VUM H;  4LUZ A;  5C44 H;  4IJH A;  2E5L L;  1VQN A;  1I3Q H;  2OQ0 A;  4GLA C;  2KBN A;  1OXS C;  4IPC A;  1Y14 B;  2UUC Q;  1CUK A;  5BR8 L;  3CCR A;  2PI2 A;  4BBS H;  1X6O A;  1JJC B;  1W2B A;  4DK6 C;  4X64 Q;  1Q81 C;  2IX1 A;  1PYB A;  4LF9 Q;  2R7D A;  4WJ3 M;  3UE0 A;  2VQF L;  3WWV A;  4GKK Q;  4MZ9 A;  3I4O A;  4GOP A;  1K3R A;  1S3O A;  2Z6K A;  4X62 L;  1CKM A;  1WJJ A;  4DKA C;  1PH2 A;  1PH7 A;  4JCV E;  4DPG A;  1PH5 A;  2Q2T A;  5IP7 G;  3CCM A;  4KLK A;  4C3I H;  2UXB L;  1PVO A;  5IP9 G;  4PZ7 A;  2N49 A;  4APV A;  1SLJ A;  3HKZ G;  4A75 A;  4C3J H;  1YHQ A;  1YHA A;  1TXY A;  3LGJ A;  2UUC L;  1NBW A;  3D31 A;  1UWV A;  2JK8 A;  1QVC A;  4ME3 A;  4X64 L;  3FKI H;  2QEX A;  4JYA Q;  4LF9 L;  4DV1 Q;  1RL2 A;  2HIV A;  4B3R L;  2F52 A;  4A3K H;  1ASY A;  3S16 H;  3K8A A;  5GAE C;  2UU9 Q;  1YIT A;  3F2C A;  1LYL A;  4GKK L;  2MQH A;  3CCQ A;  1K9M C;  2RCN A;  3CCV A;  1IZ6 A;  4NB3 A;  5E7N A;  3UDI A;  1MJE A;  3HOY H;  3NEL A;  3M9B A;  4PG3 A;  3T1Y Q;  4LUO A;  1PH8 A;  2OTL A;  4LFB Q;  2Q2I A;  3FHW A;  1P8L A;  1Y1W H;  1GM5 A;  2ASB A;  4JI6 Q;  4YCV A;  1KRT A;  1HZA A;  4NXN Q;  3I4M H;  4A3E G;  2BH8 A;  2CWP A;  3ULJ A;  3CCJ A;  3JAM i;  2CWA A;  5C44 G;  1E1T A;  1A0I A;  3CCS A;  1SR3 A;  5J3B A;  5M3M G;  3GTP H;  4JBW A;  4GKJ Q;  3S1M H;  2BA1 A;  4ALP A;  5IYD H;  1SN8 A;  4JYA L;  4LFA Q;  3HOU H;  4YCU A;  4DV1 L;  1K8A C;  1UEB A;  1WCM G;  2K4K A;  4GS3 A;  4JI2 Q;  4DV3 Q;  2UU9 L;  1UE7 A;  1VQL A;  4PZ8 A;  1K0R A;  3J7A 5;  2VNU D;  1NJI C;  2D62 A;  4GLV B;  1PYS B;  4JI4 Q;  1WI5 A;  4YWM A;  3KOJ A;  2L15 A;  3PUZ A;  3T1Y L;  2N8N A;  4LFB L;  2IX0 A;  5FJ8 H;  1Y1V G;  4B3M Q;  4JI6 L;  2D0O A;  3RR5 A;  4NXN L;  2JA6 H;  1X55 A;  2R7F A;  3JC6 6;  4JV5 Q;  1TWA H;  1XPO A;  3DLL A;  2E2J H;  2N78 A;  1X9N A;  1EYG A;  1L1O A;  4GKJ L;  2KHJ A;  2D0P A;  3GO5 A;  3PO2 G;  5GQO A;  5LMN W;  2I0Q A;  4YY3 Q;  3AFQ A;  1CKN A;  2RHQ B;  1PH3 A;  4DR2 Q;  4R4Q A;  4LFA L;  3FKI G;  4IPD A;  1KC8 C;  3CXC A;  4JI2 L;  1SRO A;  4DV3 L;  1YZ6 A;  1IL2 A;  2JA7 H;  1PH4 A;  3PO3 H;  4BA2 I;  5C4X G;  4JI3 Q;  1G6P A;  1Q1B A;  1D7Q A;  4JI4 L;  1EIF A;  2WAQ G;  2C35 B;  4TQU S;  5FLX c;  1E1O A;  3CC4 A;  3KF8 B;  3NEM A;  4A76 A;  1V9P A;  1NTG A;  4B3M L;  3JAM c;  3ICE A;  2Z0S A;  1Q8K A;  4HID A;  1JJ2 A;  3FP9 A;  4A3D H;  5IYC H;  1YVC A;  4GLX A;  2R92 G;  1S72 A;  2JA5 H;  3S2D H;  3S17 H;  4LUV A;  4JV5 L;  1PH6 A;  4YHH Q;  4LNQ A;  3I4N H;  2GN5 A;  1N33 Q;  4A3I G;  2CCZ A;  2AWN A;  1N9W A;  1HH2 P;  2EIF A;  4OON A;  4YY3 L;  2UUB Q;  4DR2 L;  4GNX B;  1VQC A;  3TRE A;  5LMN Q;  3MXN B;  4JI3 L;  2JEB I;  4KHZ A;  1PHJ A;  4HJ8 A;  3AYH B;  2K52 A;  2E2I H;  3S1Q H;  4UY8 C;  5M5W H;  2QA4 A;  2WB1 E;  2H5X A;  3PIO A;  2JE6 I;  5FJ8 G;  3H15 A;  1N34 Q;  1HNX Q;  3HOW H;  2I5L X;  4POF A;  4JI7 Q;  2ZJR A;  3CME A;  3PF4 A;  3CW2 C;  2JA6 G;  1VQF A;  1VQ5 A;  3STB C;  4DV6 Q;  1XJV A;  4AYB G;  4A3F H;  1EQQ A;  1OXT A;  2YV5 A;  4NPS A;  1K73 C;  2NVX H;  3H3V I;  4YHH L;  2UUA Q;  3RZO H;  2B3G A;  2VZA A;  3A5U A;  3K7U C;  2NZH A;  1N33 L;  1KAW A;  1NMF A;  1EOV A;  3CAM A;  4DAM A;  4HIO A;  3KFU A;  3U4V A;  1G51 A;  4X66 Q;  2UUB L;  2NVT H;  3HOV H;  1VQ8 A;  2JJQ A;  1X54 A;  1OXV A;  1VQI A;  4RMF A;  2QGQ A;  1XTD A;  5LMN L;  2Y0S G;  3PO3 G;  4C2M H;  1WYD A;  3F2B A;  1E24 A;  4DK3 C;  4POG A;  3GTO H;  4BY7 G;  4JC0 A;  5C0X G;  4A3B H;  3VDY A;  2HQL A;  3CPF A;  5LMU Q;  1XMO Q;  2CKZ B;  5IYB H;  1FGU A;  3CCU A;  1SE8 A;  1PH1 A;  4A3L H;  4Y52 H;  3HKZ E;  4AH6 A;  2A19 A;  4LW1 A;  1N34 L;  2HIX A;  3L0O A;  1HNX L;  3S14 H;  2AWO A;  1IYJ B;  5FLM H;  1VQ9 A;  4A4I A;  4JI7 L;  3CQZ H;  5IYC G;  3RLF A;  4IPH A;  4DV6 L;  1M1K C;  3SGI A;  5M3F G;  4DR6 Q;  1WOC A;  2OWO A;  3ER0 A;  5GAD C;  2UUA L;  4WJ4 A;  1NE3 A;  3D0F A;  2NVQ H;  3I4N G;  1VQK A;  2E8G A;  4BY1 H;  2GVB A;  3TS2 A;  1MKH A;  1VQ4 A;  4J15 A;  4P74 A;  4LFC Q;  4X66 L;  2ID0 A;  1H95 A;  5C3E G;  4UP7 A;  1VS0 A;  3RNU A;  1JMC A;  3AFP A;  1P16 A;  3KDF B;  5C4J H;  1BBU A;  3KJO A;  5EAY A;  4LF6 Q;  5C0X I;  1TWG H;  2I5M X;  4R4T A;  4AIM A;  4A3M G;  3TRZ A;  3CMA A;  4IPG A;  1VQA A;  1SMX A;  5LMU L;  2B63 G;  1XMO L;  4UP8 A;  3S2H H;  2Q2U A;  1O7I A;  4XIG S;  2KHI A;  4DR7 Q;  1KHI A;  2ES2 A;  4A3C G;  1QUQ B;  3HOX G;  4A3G G;  2R93 G;  2F3I A;  4DR6 L;  2RF4 A;  3HOZ G;  4MTN A;  1KD1 C;  2K5H A;  2VUM G;  1Q7Y C;  1X3E A;  1X56 A;  4OX9 Q;  1N36 Q;  4LFC L;  4R4I A;  1VQJ A;  1HZ9 A;  1YHB A;  4QJF A;  1K83 H;  3F1Z A;  4BBS G;  3ERS X;  1W3S A;  5HY6 A;  2MNA A;  4LF6 L;  1V43 A;  2ZTD A;  1C0A A;  1PV4 A;  5M5X H;  4LF5 Q;  2AKW B;  1Q86 C;  4A3B G;  3TQY A;  1A63 A;  1EUJ A;  3PUW A;  2DGY A;  3GD7 A;  3J81 j;  1SRU A;  1C9O A;  2YTY A;  4R1J A;  4DV2 Q;  4DR7 L;  3S1N H;  3KF6 A;  4GOP B;  3S15 H;  2GVA A;  2VS1 A;  1IXR A;  1HZB A;  2Z6K C;  4JOI C;  1V1Q A;  4HIK A;  4HJA A;  1PH9 A;  3L2P A;  4TVA B;  2KCM A;  1XPR A;  4OX9 L;  1N36 L;  4P71 A;  1JB7 A;  1C7Y A;  2PQA A;  1QVF A;  2IY5 B;  1EQR A;  3F2D A;  3A5Z B;  4DUZ Q;  3S24 A;  3GTJ H;  1XNQ Q;  3PUY A;  3BU2 A;  3OYY A;  1IBM Q;  3GTK H;  3ULL A;  4BXX H;  4JBJ A;  4A3K G;  3M4O H;  4P75 A;  4LF5 L;  2ZTC A;  1IBL Q;  3U4Z A;  3TS0 A;  4BBR H;  1AE2 A;  3BZC A;  4L5R C;  4AQY Q;  2EQS A;  4NXM Q;  1X3F A;  4PZ6 A;  3UDX A;  2R7Z H;  1U5K A;  2LSS A;  3HOY G;  2JA8 H;  3U50 C;  4DV2 L;  1VQ6 A;  2YTV A;  3G48 A;  3E9I A;  1HJP A;  1Y1W G;  1CKO A;  1XNR Q;  4IFD J;  2K5N A;  4A93 H;  3I4M G;  2BH2 A;  3BJU A;  1YJ9 A;  4OWX B;  2VL6 A;  4DR4 Q;  4LWC A;  4X65 Q;  4OWW B;  1Q12 A;  4LF8 Q;  5M5Y H;  1VQO A;  1FL0 A;  4OO1 I;  3CP0 A;  3I55 A;  3E0E A;  2IT1 A;  1K8G A;  3UE1 A;  1B7Y B;  1HZC A;  1G29 1;  5IYD G;  1E7Z A;  4DUZ L;  2AMC B;  2EXD A;  1XNQ L;  3HOU G;  1IBM L;  4OXP A;  1VQB A;  4HJ5 A;  2MFI A;  1GD7 A;  3J7Z C;  1NY4 A;  5JEA J;  4GNX C;  1IBL L;  4B3T Q;  3CC7 A;  2ZJP A;  4NXM L;  4AQY L;  3I7F A;  1YBY A;  4AYB E;  1Q1E A;  3PIP A;  5IP7 H;  1J6Q A;  2UXC Q;  1A62 A;  3W1G A;  2CQO A;  4O0A A;  2K5V A;  5IP9 H;  3PCO B;  1VQG A;  3G4S A;  4HIM A;  4IJL A;  2FXQ A;  1QZH A;  3KLW A;  1XNR L;  4EX5 A;  4DR4 L;  1I6H H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...