1F2MA

Simplification of a protein loop in staphylococcal nuclease
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYAYAPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Simplification of a Protein Loop in Staphylococcal Nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f2mA00
3R3OA 2M00A 2SNMA 5C3XA 1EY6A 2EYMA 3EJIA 4ZQ3A 4K2LA 1F2YA 1SYEA 1SYFA 2F0FA 2OF1A 2RBMA 3V2TA 4KY6A 4ID6A 4NP5A 5C5MA 5CGKA 5KYLA 1EY0A 2F0OA 3HEJA 5HGTA 5C4ZA 3NQTA 2PZUA 1SYGA 3MXPA 1EYDA 2F0EA 3SK4A 4F8MA 4I65A 5JOBA 1U9RA 1F2MA 1SYCA 1KDBA 1STAA 2F0LA 2SNSA 2F0KA 2HQEA 2PZTA 2F0VA 3DMUA 2F0IA 1STYA 3D4WA 5CV5A 3T16A 3D8GA 4KV6A 3ITPA 4QMGA 5CC4A 4ODGA 2EYJA 4MIUA 3EVQA 1KDCA 4EVOA 3LX0A 4KTAA 1EY8A 4HMIA 1TT2A 4KD4A 5E1FA 5CV9A 1JOOA 3TP6A 1KDAA 2O4XA 3SXHA 2EYLA 3SHLA 4DF7A 1TR5A 3SK5A 2EY5A 1NSNS 3C1EA 1EY4A 3OMCA 4RKLA 5ISRA 1EZ6A 4DFAA 5F2DA 3MVVA 1EZ8A 2PW5A 4J6HA 4NMZA 4PMCA 4F7XA 1JOKA 3SR1A 3BDCA 5KRUA 5M9OA 1SNOA 1SYBA 2PW7A 3D6CA 5KIXA 2F0QA 5EKLA 3C1FA 1ENAA 3ERQA 3P1HA 3D4DA 1A2TA 3NP8A 3PMFA 3SK6A 4DU9A 2PZWA 2F0NA 2OEOA 5IOCA 4WRDA 1STGA 4HMJA 4KY7A 4K8JA 4G57A 4R8NA 5HURA 5J1ZA 2F0DA 1NUCA 3QOLA 1KAAA 4TRDA 5EGTA 1F2ZA 5IIFA 5IGEA 5IODA 4LAAA 4PNYA 5J39A 2OXPA 3VA5A 5CV7A 3EROA 2KHSA 4KJOA 2EY6A 1A3VA 4OL7A 5C3WA 4IALA 1SNDA 3S9WA 2SOBA 3MHBA 5EKKA 4ZUJA 4H7BA 1EY9A 4K5XA 4EQNA 5I6WA 5IGDA 2F3WA 3BDLA 4ZUIA 4IZ8A 5KEEA 1EY5A 1STHA 3NUCA 1SNMA 1SYDA 4KY5A 3TP5A 5J22A 1STBA 1SNCA 3TP8A 2WACA 5JAVA 5CV6A 3H6MA 2EYHA 4B9WA 1EY7A 3OMGA 2ENBA 3QB3A 4K5WA 4KJNA 5NUCA 1KABA 1A3TA 2QDBA 3MEHA 5DAUA 2F0HA 3DHQA 5IGFA 3U9OA 3T13A 4KHVA 4HTHA 1TQOA 4K5VA 4S3SA 5KGUA 4PMBA 4KD3A 4RKBA 3NK9A 1A2UA 5I6YA 3OSOA 2EY2A 3MZ5A 5E3FA 3TP7A 1EYCA 3HZXA 5C4HA 2F0MA 4NKLA 1ENCA 5IGCA 1SNQA 5I9PA 5C5LA 4IUNA 4WORA 4E6IA 4K6DA 5I9OA 5IGGA 2EYOA 4YIJA 1JORA 2F0PA 2RKSA 4J1MA 4QF4A 5K5PA 4B9XA 3P75A 5DEHA 3OWFA 2LKVA 1EQVA 2EYPA 5CV4A 3SK8A 4DGZA 2EYFA 1SNPA 4EQOA 1A3UA 1II3A 3E5SA 2F3VA 2RDFA 1JOQA 3QOJA 2F0WA 4K8IA 1STNA 2F0TA 4N9TA 2EY1A 5CR3A 5IGBA 2PQEA 1EYAA 4K2KA 2EXZA 4QB4A 4EQPA 1AEXA 1RKNA 2F0UA 3NXWA 4ME5A 2KQ3A 5CV8A 3NHHA 1IHZA 3RUZA 5C6AA 3TMEA 5KYIA 2F0JA 4N9PA 4K14A 4NDXA 2F0SA 2PYKA 2F0GA 2NUCA
chains in the Genus database with same CATH superfamily
1DOKA 1H9RA 3EJIA 2F0FA 1SYEA 4HSPA 1VQOA 5LL6X 2ZTDA 3K6OA 3KLRA 1S5BD 3I4NG 1UEBA 1KDBA 4A3JG 1Y1VG 1E0BA 3HOXH 2AUJD 4BBSB 3TS0A 1STYA 1S5CD 1ET6A 1PFSA 2PNRC 4RAUC 5FLXL 4A76A 1S3OA 5D65A 1VQLA 2BA1A 3CQZB 4JBMA 4QQBX 4DF7A 5C0XJ 3RZOH 4R4QA 1EEID 1LABA 2PW7A 3E9HA 4HIKA 2JYOA 2LS01 4JW0A 4LF4L 2RDGA 3GTPH 1WD0A 2E2JH 1SR3A 3J80c 2ZM6L 1WCMG 4LAAA 1BCPB 4DPGA 1SROA 4YCWA 1EQQA 1KTKA 3TN2A 2XRSD 1LV9A 2VNUD 4ZUIA 3KF6A 3F2CA 1VF7A 4KY5A 2G9DA 4JI1Q 4X3UA 2UU9L 5C3EH 5M3MB 4IPDA 1WJJA 2QEJC 3HOVB 2DJGC 4XDXA 3ULJA 2F0HA 3DHQA 4B3SQ 3T13A 2FHTA 2OT2A 3KDFB 4JOIA 3T53B 1M1KC 3E0EA 3DWQA 4R9WA 1JR0D 5E3FA 1N36Q 1HZ9A 4IPHA 1VQDA 3HOZB 3MC0B 3K58A 1O7LA 1A63A 1TXYA 1YNXA 4WORA 4KK7A 1JORA 4V0BA 4A3JH 1Y1VH 2VUMG 1TS2A 2EOTA 4HIMA 3P75A 4BBRG 2LKVA 3FVQA 1KLGD 1DOMA 1II3A 3A74A 2F0WA 4LF7Q 4LFCL 5IWAL 2NVQH 3FPUB 4GOPB 3EA6A 1VS0A 4H44C 1S4ZA 3NENA 5KYIA 1R9TH 2WAQB 1GM5A 2EVBA 2F0GA 5EPKA 3J7YW 3MXUA 4DV1Q 3O13A 4WJ3M 2N55A 1SMYC 3SE0A 1F77A 1PTOH 1SMYD 1H9KA 3NWTA 2ZTEA 1B9NA 3S14H 3KF8B 1ILPA 3CCRA 3A55A 2NZOA 1FVIA 2DNCA 3AFQA 1CUKA 4GKKQ 4C2MH 1EQRA 1HZCA 2K75A 1VQNA 1VQHA 3F1ZA 1WCMH 4OIJA 1D5XC 3SGIA 3OOCA 3M9BA 1H9SB 1T5EA 2F4VQ 5BR8Q 3H09A 2K14A 3M4OH 4IUTA 5ISRA 1S5FD 1YJWA 4POGA 2VB2X 1SNOA 3I4MG 4A3BG 1HZAA 4LFBL 2GN5A 3GTLB 1BUVT 1PH4A 4A3FG 4DU9A 4IFDJ 3W2DA 1MD2D 5EPJA 4JI8L 2HCIA 2UUAL 4G57A 5M5YB 2ALYB 4EGVA 5EGTA 3CP0A 3T4AC 2VUMH 3B6YA 3S9WA 2JA6G 2B2YC 2SOBA 5EKKA 2IPKD 3I72A 3J80i 2A69D 1XNQL 2K5HA 3RD4A 3CCLA 4F87A 3PO2B 3VR4A 3HOWH 1TKWB 2X6LA 3H6MA 1QNKA 1AN8A 2EYHA 4BY7B 4ZAIA 2ENBA 1PFNA 2CH4A 1RTNA 2E75C 2K28A 1IYVA 2B8GA 3FHWA 4A3MB 3ULLA 2EJMA 4P71A 1PTOC 4JI0L 4DR4L 1XMOQ 1PTOD 5K5PA 4JBWA 4UHVA 4PMWA 1UWVA 1YIJA 3K59A 4G7OC 2KEDA 3U58A 3C3LA 4K8IA 5CR3A 2Q2HA 2CWPA 2V4DA 2YU9H 1D1KA 4NW2A 1B3QA 2KCNA 3L9AX 3J81j 3I90A 5C6AA 1HFGA 4K0KL 4XT1B 1Q90A 1N32L 4N9PA 4HIOA 4OX9L 4QL5A 3IFDA 3H3VH 3HS0C 4ZQ3A 1ICFB 1N33L 5DNFA 3I4MH 1BBUA 4M8AA 2UUCQ 3ERSX 4JI2L 4O2DA 1G2SA 5FK9C 3TREA 4A3FH 4F8MA 4I65A 2IX3A 2EIFA 3M3YH 3CCJA 1PFMA 4RCNA 4JPBW 4BY1B 2SDFA 3D4WA 2KBNA 3CCUA 2JQOA 2JA6H 2J7ZA 3NE5B 1SSOA 5IWAQ 4HIDA 3QO2A 3PO3G 3W3AA 1QG7A 2R6GA 4KI0A 1CQVA 4BBSH 4F7XA 4C3IB 2JK8A 2EJFC 1NR2A 1NCVA 3J81c 1I50B 3P1HA 3C46A 3PMFA 3UE1A 3I73A 1XMQL 1Q82C 5BN3A 3JAML 3GO5A 1GO3E 4X62Q 1CKMA 2XNAC 5GAEC 5I2YA 1I4RA 2NZHA 3VA5A 3SVMA 2R92G 4KN7C 4GN5A 3OTOQ 5GQOA 5M5XH 4DR2L 1BOSA 4XQJA 4K6LA 2O5IC 1Z7TA 1EY5A 2LXJA 1SJED 4XTCS 3PIO3 2JA9A 1AH9A 1ASZA 3S2DB 1E1OA 3A54A 1C7YA 5J22A 1D5ZC 1WTOA 1J5EQ 5JVH3 2YTVA 4A75A 1DGSA 1KHIA 2TSSA 1CSPA 2QA4A 4DK6C 4LF9Q 2NVYH 3H3VC 4A3IH 1LT4D 1OXVA 1IXRA 2K03A 4ZYSA 4LFBQ 1I6HB 2Z1CA 1VQMA 4CDDC 3CXCA 4C1NK 4YHHL 1C48A 1GUTA 4BXXH 1H95A 3UDIA 2EYOA 3S17B 2F0PA 2K50A 2RKSA 5DEHA 3CCEA 1PVOA 2UUBL 1ZYRC 1A3UA 4R8IA 2CW0C 3HGBA 1GOZA 1ZYRD 3T1HL 1TS4A 3HG9A 1X3PA 2CW0D 1PLFA 4H02A 4CKBA 1X55A 3PUVA 2KQ3A 1XNQQ 2WB1B 1AZPA 4RGMA 5JEAG 2N78A 2PYKA 1B70B 3TZUA 2DJFC 3I56A 1KD1C 1CI3M 5FJ8G 3V2TA 1NAPA 1V1OA 1VQ9A 3AMUA 5CGKA 1VQ6A 4OIKA 2D0OA 4ME3A 2KJXA 4NXML 4OWWB 3DM3A 5IT9L 4A93B 3PGZA 3SK4A 3MXNB 1G291 1TWHH 3GV6A 1CKNB 3GTMH 1PH6A 4DR4Q 1TY0A 5T1GA 1ONLA 4FXGC 2R92H 2H1EA 1U5KA 2DNEA 1WTHA 2B3GA 1KC8C 2A6HC 1CHPD 2QEXA 4K0KQ 2A6HD 3C1EA 1N32Q 1C0AA 1QE6A 3GTJB 3L7ZC 3OIPA 3MVVA 4J6HA 1SFOH 2R7ZB 4C3JG 5A35A 1YJNA 2B2UA 2L1BA 2RCNA 5EKLA 3E6ZX 4R4OA 4L6TB 1N33Q 3NP8A 3WDNA 1RHPA 5T1IA 4JI2Q 2AQ2B 3KFUA 4WRDA 2PO4A 3NBHA 2P5ZX 3MTSA 3HOYH 1QCBD 2PNHA 3VR3A 4QUFA 4OO1G 1F2ZA 3J81i 2XGTA 5FO9B 1P16A 1FGBD 3LNNA 4DV4Q 1EIFA 1G6ZA 1X32A 2HUGA 2JA7G 5I2XA 3BJUA 3F2DA 4QCLA 1YI2A 1Q86C 2CHBD 1Z6HA 2B2UC 2Q2UA 4MNOA 1CK1A 3M4PA 4LFAQ 1STBA 3LGJA 1I4GA 1EY7A 4QUCA 5JJIA 3QJYA 1D1IA 2QDBA 5CORA 3VYTA 1DM0B 1A6XA 4S3SA 1RL2A 5FJ8H 4DR5Q 4IUNA 1XMQQ 4K6DA 3HP3A 5IGGA 1PH9A 2K5QA 2XSCA 1OXXK 1ESFA 1EWHA 1YNJC 1LTSD 2WKDA 4EQOA 1YNJD 2Y0SB 1K8OA 1D8LA 2ICIA 4AYBE 3N6RA 2K04A 4DR2Q 2K32A 4A3CH 2AWOA 5E4XA 3K8AA 3U50C 2OTLA 3H15A 2QDLA 5C44B 1V1QA 5FOBB 4LF8L 4U68A 3FEWX 2E2IB 2PMZE 4C3JH 1HHVA 2JA5B 1IKLA 1LTBD 4NP5A 4JV5L 1A8VA 4L63B 3I4NB 1SYGA 2Q8TA 5ELOA 1ENFA 5GADC 3J7AF 4YCUA 3DLLA 4YHHQ 4DAYA 3MA2B 4OO1H 3DMUA 2LSSA 1HTPA 4GNXA 4ABNA 1C9OA 1D5MC 3A8KE 3T1HQ 1EY8A 3S16H 4KD4A 4QIWE 4X3KA 2A19A 3PIOA 2JA7H 2UXCL 4BA1I 1PYSB 4YY3Q 3KYHC 3PUYA 2HQLA 4ZRZA 1T5XD 1BDOA 4DFAA 1O78A 3D4RA 1JOKA 3BDCA 2GVBA 1ENAA 1F9QA 5CYUA 1IL2A 4ZKBB 2N88A 2PZWA 4NXMQ 1Q81C 1DCZA 2XIWA 2BCOA 3UE0A 1E24A 2JXMB 4O0AA 1HQMC 4QJFA 1GD7A 1AP0A 1NUCA 3PQIA 3CMAA 2A8VA 4DV2Q 3OW2A 3PUZA 3E3XA 3S1MB 3EIVA 3JC66 3CW2C 2NYZD 1A3VA 5ELEA 4Q5VA 4IALA 4A4IA 3IKJA 3M4QA 4ZUJA 4JI4Q 5C4XH 1STHA 3E0JA 3HOUH 1TY2A 2K4KA 1E22A 1H9JA 3EBEA 2I07B 3UDFA 4K5WA 5CBAE 4JYAL 5CBEE 1MIUA 1VQCA 3HOXG 3ND9A 3G71A 2N8NA 5FO7B 1LT3D 1ZEQX 3H0GG 4NXNQ 3R2IA 3S2DH 5I9OA 4XT3B 3WOEA 2D5DA 4L5QA 4BBRB 3D0FA 4P72A 4ZCKA 2R61A 2CKZB 5CV4A 3SDZA 2EYFA 3SK8A 3T51B 1JB7A 3K0YA 4FYDA 4DV0Q 1HR0L 1TWCH 2EY1A 3IFTA 4CGYB 3H3VI 4JI7L 1JCKB 1E1TA 4K14A 3J80E 2O2LD 1XPOA 1ILQA 4R4CA 4AQYQ 2R3ZA 4Q0FA 5EKIA 2MHVA 3FMCA 1DJRD 4POFA 2HT1A 1AE2A 1R4PB 2R7DA 2OCEA 4XQQA 1XPRA 1WVLA 2F0LA 4A3GH 4LF6L 3GTGH 1CM9A 4R4IA 4GKJL 3QIAA 5CV5A 3BYYB 4QMGA 1CSQA 3M85A 1EWCA 1IBLL 2B2VA 1UEAB 2O4XA 2XRQD 4DNTB 3CCVA 3I7FA 3L2PA 3VA7A 5D14A 1JB3A 1EZ8A 4A3BB 3MXGA 1K28A 1V9PA 3BVZA 3BDOA 3C1FA 1VQEA 1U4RA 2Z4HA 1HRJA 1RCVD 4JV5Q 2F0NA 1PTOF 3H0GH 2MQHA 2OWOA 1EYGA 2PPBC 3G7LA 1HH2P 4GZYC 3WOFA 2L11A 2OQ0A 4KKTA 1Y1WG 2HIVA 1LTTD 5G3LF 1LT5D 3RZDH 1VQIA 2MO0A 4DV5L 4A3KH 4GLVB 4C56C 2NTTA 1KABA 4APVA 1L0WA 1HXYD 5LMUL 3U9OA 2PQAB 2TMPA 5AJ3L 4PMBA 4DUZL 3MAQA 4AYBG 1WTWA 4O1NA 5M3FG 5IGCA 3I55A 3IAYA 1NJIC 3K7AB 1CTMA 5C4JH 2R93B 3K5OA 1UE7A 1Y8OB 3R8BA 3TDQA 4JI3Q 1B3AA 1VMPA 3I2ZA 4B3RQ 3CRLC 2F0TA 1CHQD 2WAQE 4CBVA 1EYAA 4K2KA 3BG3A 1JQYD 4ME5A 3L0OA 4PG3A 2KENA 5LMNL 1K83H 5L37A 1KRTA 2QGQA 3PF5A 3GDEA 2L12A 1U0LA 4KY6A 4ID6A 3URYA 4LK1C 2I0QA 4BWGB 1HNXQ 1O80A 1K8AC 4X64L 1SAPA 3GTOB 4UPAA 4DR1L 5DM63 3HOWG 4X66L 4JOIC 4KTAA 1Y1WH 3PUXA 4RA8A 3PO3B 2XN9C 1NMGA 1Q46A 4DNIA 4JI7Q 1EL0A 3OMCA 5A2QE 4DUYQ 2VZAA 4A3DB 1GUGA 1UE1A 1JT8A 4C1NI 1JMCA 1SMXA 1FNVA 3W1GA 1RF2D 4DV3Q 1WTRA 5M3FH 1LTGD 2K52A 1TWFH 1XJVA 2NBFA 2NZ1D 5IYDH 1LTID 4PNYA 3N52A 4GKJQ 2NTSA 1AE3A 3PF4A 3P20A 3STBC 4EX5A 2RVLA 4OL7A 5C3WA 3Q0AA 4A3EH 3STBD 1VQKA 2KECA 2EDGA 2X6GA 3NUCA 1IBLQ 4JC0A 1ZKOA 4XIGS 2WP8J 4Z9CB 4UP7A 5CV6A 1QUQA 4TVAB 2KA7A 5DAUA 3T1YL 4HTHA 1E7ZA 5KGUA 2B8FA 5AFWA 3FKIG 2B2TA 1Q1BA 2BA0A 3HZXA 4KKUA 3S15H 1SNQA 1PH2A 3S2HH 1SJHD 5GROA 2L55A 1PZID 4YIJA 3X3MA 2JA8B 3RMHA 1VQAA 4I7AA 2N49A 2NVTH 3S1RB 4OONA 1SNPA 1O7YA 2CQAA 4C3HB 2MNAA 3TQYA 1STNA 3J81E 4BBSG 4H0LC 4HJAA 4HJ9A 1W2BA 2A6EC 4EQPA 2I46A 1AEXA 4G7ZC 4RH6A 1N34L 5FKAC 3L3OC 4UP8A 2NN6G 3CC7A 3H94A 2M00A 3GP7A 3HFZB 3GTQH 1XTCD 5K36H 4LF4Q 5C5MA 5AJ3Q 4LUVA 1LTAD 1JWUD 1VQPA 4DUZQ 3VDYA 3KOJA 1PRTC 1T9HA 1EYDA 2BDOA 1PRTD 2ZM6Q 4OO1I 3CCSA 4DR7L 4FF2A 3S1NH 2F0IA 3IRBA 2LFNA 1HPCA 5M5WH 4Y7NH 5G3LD 1HQRD 1KDCA 1LTRD 3TS2A 4NB3A 1TT2A 2UU9Q 1XWEA 3AEVA 4FXKC 1B8AA 1PZKD 2K5DA 4A3IG 4KN4C 1V1PA 1WD1A 3A5UA 2QILA 2L5TA 1B9MA 4J8QA 5KRUA 4BXXG 2ZTCA 1A2TA 1TWGB 3NBIA 1U4MA 5TSSA 1J9OA 5M3MG 3FKIH 2OEOA 5EBCA 3VYRA 2VS1A 1VQJA 2HHHL 1STGA 2K7VA 4JI5L 4P2CB 1GUWA 2C35B 3NQIA 3QOLA 1G6PA 4O42A 3F8TA 4HJ8A 4DR1Q 3HOZG 1I4QA 2QKIC 4KJOA 2EY6A 4CKEA 4LFCQ 1V8QA 4ILWA 4X66Q 2BE5C 1EY9A 2XTIA 2XWBB 2F3WA 4KHPL 4G7HC 1MHWC 2BE5D 3A0JA 2A73B 3HKZB 2BH8A 1I94L 2B63B 2A1AA 1L1OA 2E2HB 2MUYA 2NN6H 1A15A 4DR3L 1I3QB 2Z6KA 4AH6A 2F4IA 2CCZA 3CQZH 4B3TL 2WAQG 3TP7A 3H91A 1RODA 3D6WA 1ENCA 4MN3A 1EOVA 3PV0A 1KNEA 4DR6L 1RDPD 3CHBD 1F9PA 4RG1A 3U4ZA 1VQ7A 1EQVA 4PV1C 2RHSB 2WB1E 4GN4B 3DWPA 1L1OC 2Z6BA 1RJTA 2ICEC 2Z6KC 4QB4A 5FLMG 4DXGA 4YCVA 2JEBI 3GTKB 1GXDC 1PDQA 5JPMC 5BN4A 2VQFL 3S1QB 4XYOA 2NVXB 5C3XA 1X3EA 3MFGA 1PXUA 3PCOB 5EJWA 1F2YA 1SYFA 1KL9A 1VCIA 4IN3A 4OEMB 3HOYG 4JI8Q 3T1YQ 5KYLA 2E74C 2UUAQ 1EY0A 2A68C 2X69A 3CCQA 1X6OA 1TWAB 2PZUA 1L0XB 5M3MH 4DAPA 1S5DD 1LUZA 3HOVH 4FXDA 4DV7L 2HQEA 4JCVE 1E3PA 4DKAC 4ZLTF 2CH4W 1DD2A 3HOZH 2IW3A 3K80C 1MJEA 4F88A 5HY6A 1JWSD 3LX0A 4X6AH 1FYCA 3S24A 5IP7G 1CT1D 2AQ1B 3A5ZB 1CZGA 1STEA 3J80L 1TVXA 3KBGA 4YWLA 1MBYA 1PA6A 1S40A 1PH1A 1SYBA 3PO2G 4OWXB 5FLXc 3GQBA 1I4XA 2Z0SA 3MWYW 4RFBA 2RCFA 4XXEA 4JI0Q 2Q2TA 3RNUA 1BNZA 4K8JA 1SE4A 4RGOS 1SDFA 2F0DA 4DR7Q 4A3CG 5IODA 4M1UB 4KKSA 1W6KA 4A3MG 4JBKA 3NELA 2K33A 1SXTA 3ICEA 1K9MC 4OX9Q 1SNMA 2IY5B 4LNQA 1QNUA 2KOLA 5FLMH 5JAVA 3KDFA 3ZYYX 1KQSA 1NMFA 4B9WA 3K7UC 3KF6B 1EU4A 1A3TA 5KNDA 1GHKA 1HUMA 1BCPC 3HOXB 4JG2A 1BCPD 2WIIB 4KD3A 3OSOA 4G4KA 3EN2A 2M9VA 1KXLA 5I9PA 2HHHQ 2QCPX 3C2PA 2Y0SE 2AUKA 4B3ML 2I5HA 3Q22A 4B9XA 2MPMA 1E2WA 3RLOA 4GOPA 3GTLH 2FJ2A 2F1MA 3RZOB 4N9TA 5KNCA 4DXFA 5M5YH 2MGSA 1RKNA 4IUUA 4CJ0B 1K3RA 3QG1A 2L9HA 5IP7H 3KJOA 3GTPB 2E2JB 4IOCA 3R3OA 4DR3Q 3KF8A 3I4OA 1AW7A 4IOAA 4LUZA 3K5LA 4QGUA 2Q2IA 4IJHA 3PO2H 5C4ZA 3NQTA 4BY7H 1NTGA 3HKSA 4GOPC 1K8MA 2R7FA 4N8X1 4DN4M 4LMQD 5C4XG 1H9SA 1JWMD 4L8JA 1QVFA 3CRKC 3HOUG 2M2LA 5C3EB 2YYZA 1Q3LA 4A3MH 2ATWA 2EYJA 3EVQA 2K5NA 1UE5A 4IPGA 2BDNA 3SHLA 1TR5A 3ZJYC 2K1BA 3OIQA 2VQFQ 5COYA 4LJZC 2RSNA 2Q8IB 4A3JB 1A62A 1Y1VB 3G6JB 1XNRL 1F9SA 3SK6A 1R4QB 4UDUC 1OO9B 4ULLA 1U4LA 2WINB 4HMJA 1S5ED 2NVQB 2UUBQ 4HEDA 1Z9FA 1UAPA 5IIFA 1FL0A 2L4NA 1O7IA 2CFMA 3EROA 1R9TB 3AQQA 3RN2A 1K0SA 2KHIA 4TSSA 3BVGA 5IGDA 2MP1A 5ELBA 5KEEA 5JEAJ 1S72A 1OTCA 4ZK9B 4IPCA 1PTOB 1JICA 2C5CA 4BY1H 2LMCB 2WACA 3TP8A 3S14B 4P74A 2ZXPA 1SRUA 1EQTA 5JJKA 5A2QL 5KNBA 1YVCA 4YWMA 4C2MB 1TIID 4A3GG 2WB1G 4AYBB 1WTXA 4GNXC 5C0XG 3GV3A 1Q8IA 3MZ5A 3K5MA 3VYSA 1WCMB 4H13C 5C5LA 4C3IH 1JJ2A 2YTYA 1YHQA 3DXJC 2EPBA 2PMZB 3M4OB 1I50H 2JN4A 5CMDA 1LACA 1GVPA 3CPWA 1SE2A 1LO5D 3E5SA 1D2BA 2PQEA 2EXZA 5LL6S 2F0UA 2HCCA 3Q24A 2XVSA 2NB0A 2F0JA 3EFXD 4JI1L 2HDMA 2SNMA 3RLFA 2EE1A 2IJ0A 2OF1A 4IQZA 1PYBA 5E4WC 2VUMB 4NPSA 2R7ZG 1J8IA 3M7NA 5JOBA 1GJXA 1SYCA 1N36L 1STAA 1BKBA 1PH8A 1BF4A 4B3MQ 3HOWB 4CKCA 4A3KG 5HGQA 1UNSA 1I6HH 2KCTA 4FO2A 3J81L 1I4PA 2HDLA 2N3SA 3S17H 2ZJRA 3TP6A 2UXDL 1VQGA 3A56A 3U4VA 4RKLA 1RD9D 2KHJA 2KCCA 3UI2A 2PW5A 1MSHA 5DM73 5M9OA 5KIXA 1ZXTA 3TZDA 2VB3X 4CHTB 5C0XH 3A8IE 1SEBD 2BH2A 1K8GA 3K57A 4HJ5A 2YU9B 2CVRA 3V96A 2MO1A 2Z4IA 1KIXA 1OXSC 1Q12A 2EXDA 4EQ5A 1WFQA 4A93H 1I6VC 3KLSX 4UY8C 1ASYA 1Y8PB 4IZ8A 5FO8B 4LF8Q 2NN6I 1V43A 3JAMc 3I4MB 1K73C 1SNCA 2F4VL 2Y0SG 4XQNA 5D3IB 4A3FB 1H9MA 2G5DA 4L5RC 2JE6I 3KLSA 3M3YB 1TQOA 4K5VA 1PRTF 5C44G 1PHJA 2V1CC 1Q1EA 1XNRQ 2F0MA 3GTJH 2JA6B 2B2VC 4MZ9A 2R7ZH 2LY7A 4CJ2C 2JA5G 4IFDG 2CWAA 3NTKA 4WJWA 2KEEA 3K5NA 1HCZA 3E9IA 1IZ6A 3KUPA 3ONAB 4GLAC 1B4OA 1YBYA 4BA2I 2YTXA 2UXCQ 2B29A 3VR2A 4GN3B 3TBIB 1VQ5A 3M4YA 3NXWA 1A0IA 1IBML 1MGSA 2F0SA 2I5LX 3T56B 2DY8A 5J3BA 3UDGA 5IYCH 1I5FA 1VQFA 1SBBB 3BU2A 2GA4B 3MXNA 1XX8A 1BBXC 1FD7D 1NE3A 3HEJA 3I3CA 5IYDG 1CKNA 1HR0W 1BR9A 3MXPA 5M5XB 4A3EG 2A5HA 4KLKA 1NBWA 1F2MA 1U9RA 3J7ZC 1CKOA 3NWSA 4GS3A 4N8FA 2F0KA 3R93A 4RWSC 1XMOL 1XTDA 4JVZA 1X3FA 4HCSA 5CC4A 1E2VA 4LW1A 2VQEL 5IT9c 4HMIA 5E1FA 1JOOA 1YITA 1Y69U 1HFNA 1KDAA 2NVYB 4A3IB 2KVMA 1Q7YC 1LYLA 4JYAQ 1W6JA 2PCFB 5GAGC 1HZBA 4P73A 1PH5A 1DYQA 3SR1A 1SE3A 3D6CA 5EAYA 1KRSA 1TU2B 3D4DA 2DGYA 5C44H 2IX0A 4WFN3 2UUCL 4HSVA 1MKHA 1QVCA 4OXPA 1EFID 2E2IH 2D62A 4TRDA 1B50A 2JA5H 4IFDH 1X54A 1HR0Q 3NBHB 2OXPA 3I4NH 1SNDA 3VR5A 3NEMA 5DLQE 3BDLA 4IUPA 3G6EA 2WFWA 1PFBA 4CDCC 1NY4A 5K36G 1JE5A 5D3DA 2UXDQ 1D6EC 3K0XA 5NUCA 1B2TA 1L0YB 3NTIA 5IGFA 1TWHB 1EOTA 5IY0A 3GTMB 3JAMi 4X3SA 5EBDA 4LF6Q 4NKLA 1O7ZA 1YEZA 2R92B 1MJCA 2I5MX 2KUMA 4CDFC 3I8ZA 1GUNA 1CZWA 2A74C 3OWFA 2EYPA 5JJLA 1XXGA 4X62L 1VQ8A 3MFYA 1EEFD 2F3VA 1SFOB 3QOJA 4HAEA 5IGBA 3OTOL 1VMCA 2D2CC 1ET9A 5CV8A 1IHZA 2H4OA 3S1MH 4NDXA 2DN8A 3AB9A 4V190 3KLWA 1JE4A 1YHAA 4DK3C 3ER0A 5IYBG 4FVMA 3HOYB 2QW7A 2RBMA 2B2YA 1J5EL 2ES2A 3DEOA 4CJ1B 3Q8DA 1F2LA 2F0OA 2OTJA 4DAMA 5EQ0A 5HGTA 2YV5A 4R4TA 1HNZL 1VDZA 4LF9L 1VQBA 2PZTA 1QILA 2F3IA 3U9SA 5LMNW 1RIPA 3T16A 3PIP3 3W5OA 2A6ED 1SLJA 3ITPA 4KV6A 4DAYB 4ODGA 4DV5Q 4MIUA 2B2TC 5IE8A 1LT6D 4L5TA 1G2TA 2FXQA 4BBRH 4GNXB 2A69C 5LMUQ 3SK5A 2RF4A 1IBMQ 4RHSA 2FFKB 1RTOA 2PI2A 1BCPF 3NSWA 4U673 4Y52H 3V05A 4NMZA 4PMCA 1G8ZD 1J6QA 2RQXA 1HA5A 3RN5A 3PUWA 4IO9A 4BS9A 3ULPA 3J7AV 1TS3A 1VF5C 1IYJB 4DK0A 1C4QA 4KY7A 1PH7A 4GLXA 5J1ZA 3F2BA 2E5LL 1EUJA 3VR6A 1M8AA 4DNRB 5IGEA 2UXBL 5J39A 2D0PA 4DK1A 3BVMA 3HKZE 2KHSA 2ASBA 3BS1A 3BYTB 4I7ZC 1MI2A 4EQNA 4IJLA 4K5XA 4MTKA 2R93G 2VQEQ 1SE8A 4C3JB 4DV6L 2ZJQA 2VW9A 2IX1A 5LMNQ 1QZHA 3TP5A 4RMFA 3QR8A 2K5WA 3OMGA 3R2TA 4X65L 3W1BA 2CQOA 2Q8RE 3HOVG 4LUOA 5IYBH 5JJZA 1BQQT 3NTHA 2ID0A 4X64Q 1WYDA 3F2UA 1JC7A 1ML0D 4A3BH 3S16B 1FR3A 2JA7B 5JVG3 2AMCB 2WV6D 3CMEA 1MSGA 3KBXA 4DGZA 1E2ZA 1Z47A 2HD3A 2RDFA 4JK1C 1JOQA 3IL8A 3CC4A 4TKOB 5FLXE 1WTVA 2Z9HA 4DV4L 4B08A 4ZKCB 1OXUA 4RGNA 3NPPA 3EQLC 2NUCA 4LFAL 3D3RA 4HN7A 1QWYA 1EY6A 2SEBD 2ZXOA 1JJCB 1N8RC 1EU3A 3BZKA 4A3DG 2H5XA 2F0EA 1L2FA 3ND8A 4P75A 2ZT9C 2SNSA 4DR5L 5C4XB 1EIHA 2VY3A 3HOUB 2IT1A 3UDXA 2WKCA 2LXKA 4JBJA 1HNWL 4CDEC 3M7GA 3KJPA 3K7AH 1XYIA 2R93H 1IW7C 3WWVA 1GKHA 1IW7D 2FINB 2K6AA 1EY4A 1EZ6A 1X3GA 3AFPA 2C9OA 1IBKL 2A68D 3G4SA 5C0XI 3LWEA 1WTPA 2F0QA 4PZ7A 3ERQA 3FRPB 1Q8KA 4IUVA 4MTNA 1KAWA 4KHZA 5EPLA 1FNWA 1CA5A 2XWJB 1HNZQ 1AFPA 4QY7A 4RHRA 1TWCB 4PQXA 4R8NA 1PZJD 1HTLD 1AZQA 2DUDA 1IL8A 4DA2A 5I6WA 1D7QA 1N34Q 1KNAA 2JA8G 3DUZA 5BN5A 3GTOH 3A7AB 1TS5A 2PQAA 4C3HG 3QB3A 4KJNA 4YY3L 1WTQA 4BY7G 4A3GB 3GTGB 1B7YB 4KHVA 3OWEB 3PO3H 3OHXC 3NK9A 1A2UA 1YNNC 3P7JA 3Q6SA 4X3TA 2IHFA 4A3LG 1EYCA 2B2WA 1YNND 3HRZC 2RA4A 4A3DH 3I4LA 2E5LQ 2JJQA 2VXWA 4J1MA 1UUPA 3TRZA 2UXBQ 3PIPA 1FJGL 4DV2L 2L0CA 4FP5D 1P8LA 4AIMA 1K3BC 3CD6A 4DV6Q 3NHHA 3RUZA 2ZJPA 4JI4L 3GD7A 2MFIA 4IURA 2B2WC 1PH3A 4X65Q 3AYHB 3H0GB 5LHY1 4K2LA 1U4PA 2L15A 4JI5Q 4PZ6A 1QB5D 3I91A 2E76C 1CQFA 4OGQC 2J0TD 4JI6L 1JJGA 2MJ8A 1ICWA 3K81C 1B44D 1LLRD 3RZDB 2FMMA 4A3KB 4NXNL 3G48A 1NR4A 1VQ4A 3DWAA 1EFWA 4KHPQ 5ELDA 3D8GA 1N9WA 2Z8LA 4BY1G 2K05A 3QWNA 2ZXRA 1DZ1A 2KCMA 4HCEA 4EVOA 1I94Q 1YHBA 2HIXA 2JA8H 4DV0L 1B1ZA 5H1SE 3S1RH 2EY5A 1NSNS 1PV4A 4C3HH 1X3QA 4TQUS 4B3TQ 3HKZG 3KK7A 3BZDB 4C3IG 5C4JB 2B39A 3D31A 4AQYL 2B63G 2IWHA 4L5SA 4LF5L 5JEAH 4DR6Q 3DM1A 4A3LH 5ELFA 4IFDI 1ESRA 1F9RA 2F03A 1BBWA 3TEHB 1X9NA 1G51A 3CF5A 3OPOA 1HNWQ 2J4XA 1FNUA 3MHBA 1BXTA 4H7BA 3TSSA 1M90C 2JEAI 1K83B 2RDHA 2PI2E 4UAIA 1HUNA 3DEPA 5I4DA 4OHJA 5GAHC 5IP9G 1CFMA 1Y14B 2D9UA 4FDBA 2AWNA 3Q23A 2VL6A 4HR7B 3OYYA 1OXTA 3X3NA 3A8JE 1WOCA 1IBKQ 1QUQB 2F52A 2EJGC 4DV7Q 5C4HA 3OW7A 4OWTB 4KMUC 4YWKA 1Y1WB 4E6IA 5JPNC 2OQKA 4QF4A 1WI5A 3CKIB 1TWGH 1QOHA 1EIYB 1B53A 4IUQA 4OELB 1PRTB 1NNXA 4FF1A 1DOLA 1PYWD 2RHQB 1FGUA 1SN8A 3AU7A 1GUOA 4MHEA 1IYUA 5M3FB 1XPUA 4DAVA 2EYMA 2EQSA 1TWFB 4FNFA 3J7A5 2B63H 1QJOA 1K0RA 2QF7A 4A3EB 2E2HH 4XYQA 1I3QH 1C8CA 1M4VA 3JAME 4FF3A 4A93G 3CCMA 5E7NA 3PSIA 2F0VA 4WJ4A 1X65A 5ELNA 3CPFA 4RGTA 1GUSA 3CU7A 4ALPA 4JI3L 1FJGQ 4LWCA 1EIGA 5CV9A 1LTLA 4B3RL 5ELCA 3SXHA 3SEBA 2EYLA 3I70A 1QZGA 5IP9H 3S15B 3CAMA 1KLUD 4QIWB 5F2DA 4B3SL 2JSOA 3S2HB 2DY7A 1G91A 1YJ9A 3FPPA 1DXMA 1W3SA 2K01A 2O5JC 4PZ8A 1V1PB 2AHOB 2NVTB 3GTKH 2GVAA 1Y8NB 5IOCA 2IL8A 3S1QH 2E8GA 1QVGA 1YZ6A 2NVXH 4FF4A 1DONA 4JI6Q 2G9HD 1KAAA 2RSOA 4R1JA 1HNXL 1BVSA 5CV7A 2K5VA 1EWIA 1TWAH 1CA6A 4LF7L 3VYUA 5IYCG 1GHJA 3GTQB 1BO0A 2EZVA 1SYDA 2E2DC 4HJ7A 5I6YA 4DV1L 2JP1A 3MEHA 3S1NB 1PMRA 2IHEA 3MEFA 1L1OB 2AQ3B 4J15A 4RKBA 4DUYL 2FMCA 2EY2A 4LF5Q 2BOSA 5IT9E 4Y7NB 5M5WB 3LWUA 2AKWB 4GKKL 3RR5A 4UP9A 3BZCA 2NWGA 1HA6A 1LM0A 4DV3L 3CC2A 1X56A 3A7LA 3FDTA 3RLNA 5BR8L 5C3EG 3TMEA 3FP9A 4RCOA 1UE6A 3FKIB 1HJPA 1I4HA 1IKMA 5HURA
chains in the Genus database with same CATH topology
1DOKA 1H9RA 3EJIA 2F0FA 1SYEA 4HSPA 5LL6X 3K6OA 3KLRA 1S5BD 1KDBA 1E0BA 4BBSB 2AUJD 1STYA 1S5CD 1ET6A 2PNRC 4RAUC 5FLXL 5D65A 2BA1A 3CQZB 4DF7A 5C0XJ 1EEID 1LABA 2PW7A 2JYOA 2LS01 2RDGA 1WD0A 4LAAA 1BCPB 1KTKA 3TN2A 2XRSD 1LV9A 2VNUD 4ZUIA 1VF7A 4KY5A 2G9DA 4X3UA 5M3MB 2QEJC 3HOVB 4XDXA 2F0HA 3DHQA 3T13A 2FHTA 2OT2A 3T53B 3DWQA 4R9WA 1JR0D 5E3FA 3HOZB 3MC0B 3K58A 1O7LA 4WORA 4KK7A 1JORA 4V0BA 1TS2A 2EOTA 3P75A 2LKVA 3FVQA 1KLGD 1DOMA 1II3A 2F0WA 3FPUB 3EA6A 4H44C 1S4ZA 5KYIA 2WAQB 2EVBA 2F0GA 5EPKA 3J7YW 3MXUA 3O13A 2N55A 1SMYC 3SE0A 1F77A 1PTOH 1SMYD 1H9KA 3NWTA 1ILPA 1B9NA 3A55A 2DNCA 4OIJA 1D5XC 3OOCA 1H9SB 1T5EA 3H09A 4IUTA 5ISRA 1S5FD 2VB2X 1SNOA 3GTLB 1BUVT 4IFDJ 4DU9A 3W2DA 1MD2D 2HCIA 4G57A 5M5YB 4EGVA 5EGTA 3T4AC 3S9WA 2B2YC 2SOBA 5EKKA 2IPKD 3I72A 2A69D 3RD4A 4F87A 3PO2B 3VR4A 1TKWB 2X6LA 3H6MA 1QNKA 1AN8A 2EYHA 4BY7B 4ZAIA 2ENBA 1PFNA 1RTNA 2E75C 2K28A 1IYVA 2B8GA 4A3MB 2EJMA 1PTOC 1PTOD 5K5PA 4JBWA 4PMWA 3K59A 4G7OC 2KEDA 3C3LA 4K8IA 5CR3A 2V4DA 1D1KA 4NW2A 2KCNA 3L9AX 3I90A 5C6AA 1HFGA 4XT1B 1Q90A 4N9PA 3IFDA 3HS0C 4ZQ3A 5DNFA 4M8AA 1G2SA 5FK9C 4F8MA 4I65A 2IX3A 1PFMA 4RCNA 4BY1B 2SDFA 3D4WA 2J7ZA 3NE5B 1SSOA 3QO2A 3W3AA 1QG7A 2R6GA 4KI0A 1CQVA 4F7XA 4C3IB 2EJFC 1NR2A 1NCVA 1I50B 3P1HA 3C46A 3PMFA 3I73A 5BN3A 3JAML 3GO5A 2XNAC 5I2YA 1I4RA 3VA5A 3SVMA 4KN7C 1BOSA 4XQJA 4K6LA 2O5IC 1Z7TA 1EY5A 1SJED 4XTCS 3PIO3 3S2DB 3A54A 5J22A 1D5ZC 1WTOA 5JVH3 2TSSA 3H3VC 1LT4D 1OXVA 2K03A 4ZYSA 1I6HB 2Z1CA 4C1NK 1C48A 1GUTA 2EYOA 3S17B 2F0PA 2RKSA 5DEHA 1ZYRC 1A3UA 4R8IA 2CW0C 3HGBA 1GOZA 1ZYRD 1TS4A 3HG9A 1X3PA 2CW0D 1PLFA 4CKBA 3PUVA 2KQ3A 2WB1B 1AZPA 4RGMA 5JEAG 2PYKA 3TZUA 1CI3M 3V2TA 1NAPA 1V1OA 3AMUA 5CGKA 4OIKA 2KJXA 5IT9L 4A93B 3SK4A 1G291 3GV6A 1TY0A 5T1GA 1ONLA 4FXGC 2H1EA 2DNEA 2A6HC 1CHPD 2A6HD 3C1EA 1QE6A 3GTJB 3L7ZC 3OIPA 3MVVA 4J6HA 2R7ZB 4C3JG 5A35A 2B2UA 2L1BA 5EKLA 3E6ZX 4L6TB 3NP8A 3WDNA 1RHPA 5T1IA 2AQ2B 4WRDA 2PO4A 3NBHA 3MTSA 1QCBD 3VR3A 4QUFA 4OO1G 1F2ZA 5FO9B 1FGBD 3LNNA 1G6ZA 1X32A 2HUGA 5I2XA 4QCLA 2CHBD 1Z6HA 2B2UC 1CK1A 1STBA 1I4GA 1EY7A 4QUCA 3QJYA 1D1IA 2QDBA 5CORA 3VYTA 1DM0B 1A6XA 4S3SA 4IUNA 4K6DA 3HP3A 5IGGA 2K5QA 2XSCA 1OXXK 1ESFA 1EWHA 1YNJC 1LTSD 2WKDA 4EQOA 1YNJD 2Y0SB 1K8OA 2ICIA 3N6RA 2K04A 2K32A 2AWOA 5E4XA 5C44B 5FOBB 4U68A 3FEWX 2E2IB 1HHVA 2JA5B 1IKLA 1LTBD 4NP5A 4L63B 3I4NB 1SYGA 2Q8TA 1ENFA 3J7AF 4DAYA 3MA2B 4OO1H 3DMUA 1HTPA 4ABNA 1D5MC 3A8KE 1EY8A 4KD4A 4X3KA 4BA1I 3PUYA 4ZRZA 1T5XD 1BDOA 4DFAA 1O78A 3D4RA 1JOKA 3BDCA 1ENAA 1F9QA 5CYUA 4ZKBB 2N88A 2PZWA 1DCZA 2XIWA 2BCOA 2JXMB 1HQMC 1AP0A 1NUCA 3PUZA 3S1MB 2NYZD 1A3VA 5ELEA 4Q5VA 4IALA 3IKJA 4ZUJA 1STHA 3E0JA 1TY2A 1H9JA 2I07B 4K5WA 5CBAE 5CBEE 3ND9A 5FO7B 1LT3D 1ZEQX 3R2IA 5I9OA 4XT3B 3WOEA 2D5DA 4BBRB 2R61A 5CV4A 3SDZA 3SK8A 2EYFA 3T51B 3K0YA 4FYDA 2EY1A 3IFTA 4CGYB 1JCKB 4K14A 3J80E 2O2LD 1ILQA 2R3ZA 4Q0FA 5EKIA 2MHVA 3FMCA 1DJRD 1R4PB 4XQQA 1WVLA 2F0LA 1CM9A 3QIAA 5CV5A 3BYYB 4QMGA 3M85A 1EWCA 2B2VA 1UEAB 2O4XA 2XRQD 4DNTB 3VA7A 5D14A 1JB3A 1EZ8A 4A3BB 3MXGA 3BVZA 3BDOA 3C1FA 1U4RA 2Z4HA 1HRJA 1RCVD 2F0NA 1PTOF 2PPBC 3G7LA 4GZYC 3WOFA 2L11A 4KKTA 1LTTD 5G3LF 1LT5D 4C56C 2NTTA 1KABA 1HXYD 3U9OA 2TMPA 4PMBA 3MAQA 1WTWA 4O1NA 5IGCA 3IAYA 3K7AB 1CTMA 2R93B 3K5OA 1Y8OB 3R8BA 3TDQA 1B3AA 1VMPA 3CRLC 2F0TA 1CHQD 4CBVA 1EYAA 4K2KA 3BG3A 1JQYD 4ME5A 2L12A 4KY6A 4ID6A 3URYA 4LK1C 4BWGB 1O80A 1SAPA 3GTOB 5DM63 4KTAA 3PUXA 4RA8A 3PO3B 2XN9C 1EL0A 3OMCA 5A2QE 4A3DB 1GUGA 4C1NI 1FNVA 1RF2D 1WTRA 1LTGD 2NBFA 2NZ1D 1LTID 4PNYA 3N52A 2NTSA 3P20A 5C3WA 2RVLA 4OL7A 3Q0AA 2KECA 2EDGA 2X6GA 3NUCA 1ZKOA 4XIGS 2WP8J 4Z9CB 5CV6A 2KA7A 5DAUA 4HTHA 5KGUA 2B8FA 5AFWA 2B2TA 1Q1BA 2BA0A 3HZXA 4KKUA 1SNQA 1SJHD 2L55A 1PZID 4YIJA 3X3MA 2JA8B 3RMHA 3S1RB 1SNPA 1O7YA 2CQAA 4C3HB 1STNA 3J81E 4H0LC 2A6EC 4EQPA 2I46A 1AEXA 4G7ZC 4RH6A 5FKAC 3L3OC 2NN6G 3H94A 2M00A 3GP7A 1XTCD 5K36H 5C5MA 1LTAD 1JWUD 1PRTC 1EYDA 2BDOA 1PRTD 4OO1I 4FF2A 2F0IA 2LFNA 1HPCA 5G3LD 1HQRD 1KDCA 1LTRD 1TT2A 1XWEA 4FXKC 1PZKD 2K5DA 4KN4C 1V1PA 1WD1A 2QILA 2L5TA 1B9MA 4J8QA 5KRUA 1A2TA 1TWGB 3NBIA 1U4MA 5TSSA 1J9OA 3VYRA 2OEOA 5EBCA 1STGA 2K7VA 1GUWA 4P2CB 3NQIA 3QOLA 4O42A 1I4QA 2QKIC 4KJOA 2EY6A 4CKEA 1V8QA 4ILWA 2BE5C 1EY9A 2XWBB 2F3WA 4G7HC 2BE5D 2A73B 3HKZB 2B63B 2E2HB 2MUYA 2NN6H 1A15A 1I3QB 2F4IA 3TP7A 3H91A 1RODA 3D6WA 1ENCA 4MN3A 3PV0A 1KNEA 1RDPD 3CHBD 1F9PA 1EQVA 4PV1C 3DWPA 1RJTA 2ICEC 4QB4A 4DXGA 2JEBI 3GTKB 1GXDC 1PDQA 5JPMC 5BN4A 3S1QB 4XYOA 2NVXB 5C3XA 3MFGA 1PXUA 5EJWA 1F2YA 1SYFA 1VCIA 4IN3A 5KYLA 2E74C 1EY0A 2A68C 2X69A 1TWAB 2PZUA 1L0XB 4DAPA 1S5DD 4FXDA 2HQEA 4ZLTF 1DD2A 2IW3A 4F88A 1JWSD 3LX0A 1FYCA 1CT1D 2AQ1B 1CZGA 1STEA 3J80L 1TVXA 3KBGA 1MBYA 1SYBA 3GQBA 1I4XA 3MWYW 4RFBA 4XXEA 1BNZA 4K8JA 1SE4A 4RGOS 1SDFA 2F0DA 5IODA 4M1UB 4KKSA 1W6KA 2K33A 1SXTA 1SNMA 1QNUA 2KOLA 5JAVA 3ZYYX 4B9WA 1EU4A 1A3TA 5KNDA 1GHKA 1HUMA 1BCPC 3HOXB 1BCPD 2WIIB 4KD3A 3OSOA 4G4KA 2M9VA 5I9PA 2QCPX 3C2PA 2AUKA 3Q22A 4B9XA 2MPMA 1E2WA 2FJ2A 2F1MA 3RZOB 4N9TA 5KNCA 4DXFA 2MGSA 1RKNA 4IUUA 4CJ0B 3QG1A 2L9HA 3GTPB 2E2JB 3R3OA 3KF8A 1AW7A 3K5LA 5C4ZA 3NQTA 1K8MA 4DN4M 4LMQD 1H9SA 1JWMD 4L8JA 3CRKC 2M2LA 5C3EB 2YYZA 1Q3LA 2EYJA 3EVQA 2BDNA 3SHLA 1TR5A 2K1BA 3OIQA 5COYA 4LJZC 2RSNA 2Q8IB 4A3JB 1Y1VB 3G6JB 1F9SA 3SK6A 1R4QB 4UDUC 1OO9B 4ULLA 1U4LA 2WINB 4HMJA 1S5ED 2NVQB 4HEDA 5IIFA 1UAPA 2L4NA 3EROA 1R9TB 4TSSA 3BVGA 5IGDA 2MP1A 5ELBA 5KEEA 5JEAJ 4ZK9B 1PTOB 1JICA 2C5CA 2LMCB 2WACA 3TP8A 3S14B 2ZXPA 1EQTA 5A2QL 5KNBA 4C2MB 1TIID 4AYBB 1WTXA 5C0XG 3GV3A 1Q8IA 3MZ5A 3K5MA 3VYSA 1WCMB 4H13C 5C5LA 3DXJC 2EPBA 2PMZB 3M4OB 5CMDA 1LACA 1SE2A 1LO5D 3E5SA 1D2BA 2PQEA 2EXZA 5LL6S 2F0UA 2HCCA 3Q24A 2XVSA 2NB0A 2F0JA 3EFXD 2HDMA 2SNMA 3RLFA 2EE1A 2IJ0A 2OF1A 4IQZA 5E4WC 2VUMB 1J8IA 3M7NA 5JOBA 1GJXA 1SYCA 1STAA 1BF4A 3HOWB 4CKCA 1UNSA 4FO2A 3J81L 1I4PA 2HDLA 3TP6A 3A56A 4RKLA 1RD9D 2KCCA 3UI2A 2PW5A 1MSHA 5DM73 5M9OA 5KIXA 1ZXTA 3TZDA 2VB3X 4CHTB 5C0XH 3A8IE 1SEBD 3K57A 2YU9B 2CVRA 3V96A 2Z4IA 1OXSC 1Q12A 1I6VC 3KLSX 1Y8PB 4IZ8A 5FO8B 2NN6I 1V43A 3I4MB 1SNCA 4XQNA 5D3IB 4A3FB 1H9MA 2JE6I 3KLSA 3M3YB 1TQOA 4K5VA 1PRTF 1Q1EA 2F0MA 2JA6B 2B2VC 2LY7A 4CJ2C 4IFDG 3NTKA 4WJWA 2KEEA 3K5NA 1HCZA 3KUPA 3ONAB 1B4OA 4BA2I 3VR2A 3TBIB 3M4YA 3NXWA 1MGSA 2F0SA 3T56B 2DY8A 1SBBB 2GA4B 3MXNA 1XX8A 1BBXC 1FD7D 3I3CA 3HEJA 1BR9A 3MXPA 5M5XB 2A5HA 1U9RA 1F2MA 3NWSA 2F0KA 3R93A 4RWSC 4HCSA 5CC4A 1E2VA 4HMIA 5E1FA 1JOOA 1Y69U 1HFNA 1KDAA 2NVYB 4A3IB 2KVMA 1W6JA 2PCFB 1DYQA 3SR1A 1SE3A 3D6CA 1TU2B 3D4DA 2IX0A 4WFN3 4HSVA 1EFID 2D62A 4TRDA 1B50A 4IFDH 2OXPA 1SNDA 3VR5A 3BDLA 4IUPA 1PFBA 5K36G 5D3DA 1D6EC 5NUCA 1B2TA 1L0YB 3NTIA 5IGFA 1TWHB 1EOTA 3GTMB 4X3SA 5EBDA 4NKLA 1O7ZA 2R92B 2KUMA 3I8ZA 1GUNA 1CZWA 2A74C 3OWFA 2EYPA 1XXGA 3MFYA 1EEFD 2F3VA 1SFOB 3QOJA 4HAEA 5IGBA 1VMCA 2D2CC 1ET9A 5CV8A 1IHZA 2H4OA 4NDXA 2DN8A 3AB9A 4V190 1JE4A 4FVMA 3HOYB 2RBMA 2B2YA 3DEOA 4CJ1B 1F2LA 2F0OA 5EQ0A 5HGTA 1VDZA 2PZTA 1QILA 3U9SA 3T16A 3PIP3 2A6ED 4KV6A 3ITPA 4ODGA 4MIUA 2B2TC 1LT6D 1G2TA 2A69C 3SK5A 4RHSA 2FFKB 1RTOA 3NSWA 1BCPF 4U673 3V05A 4NMZA 4PMCA 1G8ZD 2RQXA 1HA5A 3PUWA 4BS9A 3J7AV 1TS3A 1I4HA 1VF5C 4DK0A 1C4QA 4KY7A 5J1ZA 3VR6A 4DNRB 1M8AA 5IGEA 5J39A 4DK1A 3BVMA 2KHSA 3BS1A 3BYTB 4I7ZC 1MI2A 4EQNA 4K5XA 4C3JB 2IX1A 3TP5A 2K5WA 3OMGA 3R2TA 2Q8RE 5JJZA 1BQQT 3NTHA 2ID0A 3F2UA 1JC7A 1ML0D 3S16B 1FR3A 2JA7B 5JVG3 2WV6D 1MSGA 3KBXA 4DGZA 1E2ZA 1Z47A 2RDFA 4JK1C 1JOQA 3IL8A 4TKOB 5FLXE 1WTVA 4B08A 4ZKCB 1OXUA 4RGNA 3NPPA 3EQLC 2NUCA 3D3RA 4HN7A 1QWYA 1EY6A 2SEBD 2ZXOA 1EU3A 2F0EA 3ND8A 2ZT9C 2SNSA 5C4XB 1EIHA 3HOUB 2IT1A 2WKCA 3M7GA 1XYIA 1IW7C 1IW7D 2FINB 2K6AA 1EY4A 1EZ6A 2C9OA 2A68D 5C0XI 3LWEA 1WTPA 2F0QA 3ERQA 3FRPB 4IUVA 4KHZA 5EPLA 1FNWA 1CA5A 2XWJB 1AFPA 4RHRA 1TWCB 4PQXA 4R8NA 1PZJD 1HTLD 1AZQA 1IL8A 4DA2A 5I6WA 1KNAA 3DUZA 5BN5A 3A7AB 1TS5A 4C3HG 3QB3A 4KJNA 1WTQA 4A3GB 3GTGB 4KHVA 3OWEB 3OHXC 3NK9A 1A2UA 1YNNC 3P7JA 3Q6SA 4X3TA 1EYCA 2B2WA 1YNND 3HRZC 2RA4A 3I4LA 2VXWA 4J1MA 1UUPA 2L0CA 4FP5D 3NHHA 3RUZA 3GD7A 4IURA 2B2WC 3H0GB 5LHY1 4K2LA 1U4PA 1QB5D 3I91A 2E76C 1CQFA 4OGQC 2J0TD 2MJ8A 1ICWA 1B44D 1LLRD 3RZDB 2FMMA 4A3KB 1NR4A 3DWAA 5ELDA 3D8GA 2Z8LA 2K05A 3QWNA 2ZXRA 1DZ1A 4HCEA 4EVOA 1B1ZA 2EY5A 1NSNS 1X3QA 4TQUS 3KK7A 3BZDB 4C3IG 5C4JB 2B39A 3D31A 2IWHA 5JEAH 3DM1A 5ELFA 4IFDI 1ESRA 1F9RA 2F03A 3OPOA 2J4XA 1FNUA 3MHBA 1BXTA 4H7BA 3TSSA 2JEAI 1K83B 2RDHA 4UAIA 1HUNA 3DEPA 5I4DA 4OHJA 1CFMA 2D9UA 2AWNA 3Q23A 4HR7B 1OXTA 3X3NA 3A8JE 2EJGC 5C4HA 3OW7A 4KMUC 1Y1WB 4E6IA 5JPNC 4QF4A 3CKIB 1QOHA 1B53A 4IUQA 1PRTB 4FF1A 1DOLA 1PYWD 3AU7A 1GUOA 4MHEA 1IYUA 5M3FB 4DAVA 2EYMA 1TWFB 4FNFA 1QJOA 4A3EB 2QF7A 4XYQA 1C8CA 4FF3A 1M4VA 3JAME 2F0VA 4RGTA 1GUSA 3CU7A 1EIGA 5CV9A 5ELCA 3SXHA 3SEBA 2EYLA 3I70A 3S15B 1KLUD 4QIWB 5F2DA 2JSOA 3S2HB 2DY7A 1G91A 3FPPA 1DXMA 2K01A 2O5JC 1V1PB 2NVTB 1Y8NB 5IOCA 2IL8A 4FF4A 1DONA 2G9HD 1KAAA 2RSOA 5CV7A 1CA6A 3VYUA 1GHJA 3GTQB 1BO0A 2EZVA 1SYDA 2E2DC 5I6YA 2JP1A 3MEHA 3S1NB 1PMRA 2AQ3B 4RKBA 2FMCA 2EY2A 2BOSA 5IT9E 4Y7NB 5M5WB 3LWUA 1HA6A 2NWGA 3A7LA 3FDTA 3TMEA 4RCOA 3FKIB 5EPJA 1IKMA 5HURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R3O A;  2M00 A;  2SNM A;  5C3X A;  1EY6 A;  2EYM A;  3EJI A;  4ZQ3 A;  4K2L A;  1F2Y A;  1SYE A;  1SYF A;  2F0F A;  2OF1 A;  2RBM A;  3V2T A;  4KY6 A;  4ID6 A;  4NP5 A;  5C5M A;  5CGK A;  5KYL A;  1EY0 A;  2F0O A;  3HEJ A;  5HGT A;  5C4Z A;  3NQT A;  2PZU A;  1SYG A;  3MXP A;  1EYD A;  2F0E A;  3SK4 A;  4F8M A;  4I65 A;  5JOB A;  1U9R A;  1F2M A;  1SYC A;  1KDB A;  1STA A;  2F0L A;  2SNS A;  2F0K A;  2HQE A;  2PZT A;  2F0V A;  3DMU A;  2F0I A;  1STY A;  3D4W A;  5CV5 A;  3T16 A;  3D8G A;  4KV6 A;  3ITP A;  4QMG A;  5CC4 A;  4ODG A;  2EYJ A;  4MIU A;  3EVQ A;  1KDC A;  4EVO A;  3LX0 A;  4KTA A;  1EY8 A;  4HMI A;  1TT2 A;  4KD4 A;  5E1F A;  5CV9 A;  1JOO A;  3TP6 A;  1KDA A;  2O4X A;  3SXH A;  2EYL A;  3SHL A;  4DF7 A;  1TR5 A;  3SK5 A;  2EY5 A;  1NSN S;  3C1E A;  1EY4 A;  3OMC A;  4RKL A;  5ISR A;  1EZ6 A;  4DFA A;  5F2D A;  3MVV A;  1EZ8 A;  2PW5 A;  4J6H A;  4NMZ A;  4PMC A;  4F7X A;  1JOK A;  3SR1 A;  3BDC A;  5KRU A;  5M9O A;  1SNO A;  1SYB A;  2PW7 A;  3D6C A;  5KIX A;  2F0Q A;  5EKL A;  3C1F A;  1ENA A;  3ERQ A;  3P1H A;  3D4D A;  1A2T A;  3NP8 A;  3PMF A;  3SK6 A;  4DU9 A;  2PZW A;  2F0N A;  2OEO A;  5IOC A;  4WRD A;  1STG A;  4HMJ A;  4KY7 A;  4K8J A;  4G57 A;  4R8N A;  5HUR A;  5J1Z A;  2F0D A;  1NUC A;  3QOL A;  1KAA A;  4TRD A;  5EGT A;  1F2Z A;  5IIF A;  5IGE A;  5IOD A;  4LAA A;  4PNY A;  5J39 A;  2OXP A;  3VA5 A;  5CV7 A;  3ERO A;  2KHS A;  4KJO A;  2EY6 A;  1A3V A;  4OL7 A;  5C3W A;  4IAL A;  1SND A;  3S9W A;  2SOB A;  3MHB A;  5EKK A;  4ZUJ A;  4H7B A;  1EY9 A;  4K5X A;  4EQN A;  5I6W A;  5IGD A;  2F3W A;  3BDL A;  4ZUI A;  4IZ8 A;  5KEE A;  1EY5 A;  1STH A;  3NUC A;  1SNM A;  1SYD A;  4KY5 A;  3TP5 A;  5J22 A;  1STB A;  1SNC A;  3TP8 A;  2WAC A;  5JAV A;  5CV6 A;  3H6M A;  2EYH A;  4B9W A;  1EY7 A;  3OMG A;  2ENB A;  3QB3 A;  4K5W A;  4KJN A;  5NUC A;  1KAB A;  1A3T A;  2QDB A;  3MEH A;  5DAU A;  2F0H A;  3DHQ A;  5IGF A;  3U9O A;  3T13 A;  4KHV A;  4HTH A;  1TQO A;  4K5V A;  4S3S A;  5KGU A;  4PMB A;  4KD3 A;  4RKB A;  3NK9 A;  1A2U A;  5I6Y A;  3OSO A;  2EY2 A;  3MZ5 A;  5E3F A;  3TP7 A;  1EYC A;  3HZX A;  5C4H A;  2F0M A;  4NKL A;  1ENC A;  5IGC A;  1SNQ A;  5I9P A;  5C5L A;  4IUN A;  4WOR A;  4E6I A;  4K6D A;  5I9O A;  5IGG A;  2EYO A;  4YIJ A;  1JOR A;  2F0P A;  2RKS A;  4J1M A;  4QF4 A;  5K5P A;  4B9X A;  3P75 A;  5DEH A;  3OWF A;  2LKV A;  1EQV A;  2EYP A;  5CV4 A;  3SK8 A;  4DGZ A;  2EYF A;  1SNP A;  4EQO A;  1A3U A;  1II3 A;  3E5S A;  2F3V A;  2RDF A;  1JOQ A;  3QOJ A;  2F0W A;  4K8I A;  1STN A;  2F0T A;  4N9T A;  2EY1 A;  5CR3 A;  5IGB A;  2PQE A;  1EYA A;  4K2K A;  2EXZ A;  4QB4 A;  4EQP A;  1AEX A;  1RKN A;  2F0U A;  3NXW A;  4ME5 A;  2KQ3 A;  5CV8 A;  3NHH A;  1IHZ A;  3RUZ A;  5C6A A;  3TME A;  5KYI A;  2F0J A;  4N9P A;  4K14 A;  4NDX A;  2F0S A;  2PYK A;  2F0G A;  2NUC A; 
#chains in the Genus database with same CATH topology
 1DOK A;  1H9R A;  3EJI A;  2F0F A;  1SYE A;  4HSP A;  1VQO A;  5LL6 X;  2ZTD A;  3K6O A;  3KLR A;  1S5B D;  3I4N G;  1UEB A;  1KDB A;  4A3J G;  1Y1V G;  1E0B A;  3HOX H;  2AUJ D;  4BBS B;  3TS0 A;  1STY A;  1S5C D;  1ET6 A;  1PFS A;  2PNR C;  4RAU C;  5FLX L;  4A76 A;  1S3O A;  5D65 A;  1VQL A;  2BA1 A;  3CQZ B;  4JBM A;  4QQB X;  4DF7 A;  5C0X J;  3RZO H;  4R4Q A;  1EEI D;  1LAB A;  2PW7 A;  3E9H A;  4HIK A;  2JYO A;  2LS0 1;  4JW0 A;  4LF4 L;  2RDG A;  3GTP H;  1WD0 A;  2E2J H;  1SR3 A;  3J80 c;  2ZM6 L;  1WCM G;  4LAA A;  1BCP B;  4DPG A;  1SRO A;  4YCW A;  1EQQ A;  1KTK A;  3TN2 A;  2XRS D;  1LV9 A;  2VNU D;  4ZUI A;  3KF6 A;  3F2C A;  1VF7 A;  4KY5 A;  2G9D A;  4JI1 Q;  4X3U A;  2UU9 L;  5C3E H;  5M3M B;  4IPD A;  1WJJ A;  2QEJ C;  3HOV B;  2DJG C;  4XDX A;  3ULJ A;  2F0H A;  3DHQ A;  4B3S Q;  3T13 A;  2FHT A;  2OT2 A;  3KDF B;  4JOI A;  3T53 B;  1M1K C;  3E0E A;  3DWQ A;  4R9W A;  1JR0 D;  5E3F A;  1N36 Q;  1HZ9 A;  4IPH A;  1VQD A;  3HOZ B;  3MC0 B;  3K58 A;  1O7L A;  1A63 A;  1TXY A;  1YNX A;  4WOR A;  4KK7 A;  1JOR A;  4V0B A;  4A3J H;  1Y1V H;  2VUM G;  1TS2 A;  2EOT A;  4HIM A;  3P75 A;  4BBR G;  2LKV A;  3FVQ A;  1KLG D;  1DOM A;  1II3 A;  3A74 A;  2F0W A;  4LF7 Q;  4LFC L;  5IWA L;  2NVQ H;  3FPU B;  4GOP B;  3EA6 A;  1VS0 A;  4H44 C;  1S4Z A;  3NEN A;  5KYI A;  1R9T H;  2WAQ B;  1GM5 A;  2EVB A;  2F0G A;  5EPK A;  3J7Y W;  3MXU A;  4DV1 Q;  3O13 A;  4WJ3 M;  2N55 A;  1SMY C;  3SE0 A;  1F77 A;  1PTO H;  1SMY D;  1H9K A;  3NWT A;  2ZTE A;  1B9N A;  3S14 H;  3KF8 B;  1ILP A;  3CCR A;  3A55 A;  2NZO A;  1FVI A;  2DNC A;  3AFQ A;  1CUK A;  4GKK Q;  4C2M H;  1EQR A;  1HZC A;  2K75 A;  1VQN A;  1VQH A;  3F1Z A;  1WCM H;  4OIJ A;  1D5X C;  3SGI A;  3OOC A;  3M9B A;  1H9S B;  1T5E A;  2F4V Q;  5BR8 Q;  3H09 A;  2K14 A;  3M4O H;  4IUT A;  5ISR A;  1S5F D;  1YJW A;  4POG A;  2VB2 X;  1SNO A;  3I4M G;  4A3B G;  1HZA A;  4LFB L;  2GN5 A;  3GTL B;  1BUV T;  1PH4 A;  4A3F G;  4DU9 A;  4IFD J;  3W2D A;  1MD2 D;  5EPJ A;  4JI8 L;  2HCI A;  2UUA L;  4G57 A;  5M5Y B;  2ALY B;  4EGV A;  5EGT A;  3CP0 A;  3T4A C;  2VUM H;  3B6Y A;  3S9W A;  2JA6 G;  2B2Y C;  2SOB A;  5EKK A;  2IPK D;  3I72 A;  3J80 i;  2A69 D;  1XNQ L;  2K5H A;  3RD4 A;  3CCL A;  4F87 A;  3PO2 B;  3VR4 A;  3HOW H;  1TKW B;  2X6L A;  3H6M A;  1QNK A;  1AN8 A;  2EYH A;  4BY7 B;  4ZAI A;  2ENB A;  1PFN A;  2CH4 A;  1RTN A;  2E75 C;  2K28 A;  1IYV A;  2B8G A;  3FHW A;  4A3M B;  3ULL A;  2EJM A;  4P71 A;  1PTO C;  4JI0 L;  4DR4 L;  1XMO Q;  1PTO D;  5K5P A;  4JBW A;  4UHV A;  4PMW A;  1UWV A;  1YIJ A;  3K59 A;  4G7O C;  2KED A;  3U58 A;  3C3L A;  4K8I A;  5CR3 A;  2Q2H A;  2CWP A;  2V4D A;  2YU9 H;  1D1K A;  4NW2 A;  1B3Q A;  2KCN A;  3L9A X;  3J81 j;  3I90 A;  5C6A A;  1HFG A;  4K0K L;  4XT1 B;  1Q90 A;  1N32 L;  4N9P A;  4HIO A;  4OX9 L;  4QL5 A;  3IFD A;  3H3V H;  3HS0 C;  4ZQ3 A;  1ICF B;  1N33 L;  5DNF A;  3I4M H;  1BBU A;  4M8A A;  2UUC Q;  3ERS X;  4JI2 L;  4O2D A;  1G2S A;  5FK9 C;  3TRE A;  4A3F H;  4F8M A;  4I65 A;  2IX3 A;  2EIF A;  3M3Y H;  3CCJ A;  1PFM A;  4RCN A;  4JPB W;  4BY1 B;  2SDF A;  3D4W A;  2KBN A;  3CCU A;  2JQO A;  2JA6 H;  2J7Z A;  3NE5 B;  1SSO A;  5IWA Q;  4HID A;  3QO2 A;  3PO3 G;  3W3A A;  1QG7 A;  2R6G A;  4KI0 A;  1CQV A;  4BBS H;  4F7X A;  4C3I B;  2JK8 A;  2EJF C;  1NR2 A;  1NCV A;  3J81 c;  1I50 B;  3P1H A;  3C46 A;  3PMF A;  3UE1 A;  3I73 A;  1XMQ L;  1Q82 C;  5BN3 A;  3JAM L;  3GO5 A;  1GO3 E;  4X62 Q;  1CKM A;  2XNA C;  5GAE C;  5I2Y A;  1I4R A;  2NZH A;  3VA5 A;  3SVM A;  2R92 G;  4KN7 C;  4GN5 A;  3OTO Q;  5GQO A;  5M5X H;  4DR2 L;  1BOS A;  4XQJ A;  4K6L A;  2O5I C;  1Z7T A;  1EY5 A;  2LXJ A;  1SJE D;  4XTC S;  3PIO 3;  2JA9 A;  1AH9 A;  1ASZ A;  3S2D B;  1E1O A;  3A54 A;  1C7Y A;  5J22 A;  1D5Z C;  1WTO A;  1J5E Q;  5JVH 3;  2YTV A;  4A75 A;  1DGS A;  1KHI A;  2TSS A;  1CSP A;  2QA4 A;  4DK6 C;  4LF9 Q;  2NVY H;  3H3V C;  4A3I H;  1LT4 D;  1OXV A;  1IXR A;  2K03 A;  4ZYS A;  4LFB Q;  1I6H B;  2Z1C A;  1VQM A;  4CDD C;  3CXC A;  4C1N K;  4YHH L;  1C48 A;  1GUT A;  4BXX H;  1H95 A;  3UDI A;  2EYO A;  3S17 B;  2F0P A;  2K50 A;  2RKS A;  5DEH A;  3CCE A;  1PVO A;  2UUB L;  1ZYR C;  1A3U A;  4R8I A;  2CW0 C;  3HGB A;  1GOZ A;  1ZYR D;  3T1H L;  1TS4 A;  3HG9 A;  1X3P A;  2CW0 D;  1PLF A;  4H02 A;  4CKB A;  1X55 A;  3PUV A;  2KQ3 A;  1XNQ Q;  2WB1 B;  1AZP A;  4RGM A;  5JEA G;  2N78 A;  2PYK A;  1B70 B;  3TZU A;  2DJF C;  3I56 A;  1KD1 C;  1CI3 M;  5FJ8 G;  3V2T A;  1NAP A;  1V1O A;  1VQ9 A;  3AMU A;  5CGK A;  1VQ6 A;  4OIK A;  2D0O A;  4ME3 A;  2KJX A;  4NXM L;  4OWW B;  3DM3 A;  5IT9 L;  4A93 B;  3PGZ A;  3SK4 A;  3MXN B;  1G29 1;  1TWH H;  3GV6 A;  1CKN B;  3GTM H;  1PH6 A;  4DR4 Q;  1TY0 A;  5T1G A;  1ONL A;  4FXG C;  2R92 H;  2H1E A;  1U5K A;  2DNE A;  1WTH A;  2B3G A;  1KC8 C;  2A6H C;  1CHP D;  2QEX A;  4K0K Q;  2A6H D;  3C1E A;  1N32 Q;  1C0A A;  1QE6 A;  3GTJ B;  3L7Z C;  3OIP A;  3MVV A;  4J6H A;  1SFO H;  2R7Z B;  4C3J G;  5A35 A;  1YJN A;  2B2U A;  2L1B A;  2RCN A;  5EKL A;  3E6Z X;  4R4O A;  4L6T B;  1N33 Q;  3NP8 A;  3WDN A;  1RHP A;  5T1I A;  4JI2 Q;  2AQ2 B;  3KFU A;  4WRD A;  2PO4 A;  3NBH A;  2P5Z X;  3MTS A;  3HOY H;  1QCB D;  2PNH A;  3VR3 A;  4QUF A;  4OO1 G;  1F2Z A;  3J81 i;  2XGT A;  5FO9 B;  1P16 A;  1FGB D;  3LNN A;  4DV4 Q;  1EIF A;  1G6Z A;  1X32 A;  2HUG A;  2JA7 G;  5I2X A;  3BJU A;  3F2D A;  4QCL A;  1YI2 A;  1Q86 C;  2CHB D;  1Z6H A;  2B2U C;  2Q2U A;  4MNO A;  1CK1 A;  3M4P A;  4LFA Q;  1STB A;  3LGJ A;  1I4G A;  1EY7 A;  4QUC A;  5JJI A;  3QJY A;  1D1I A;  2QDB A;  5COR A;  3VYT A;  1DM0 B;  1A6X A;  4S3S A;  1RL2 A;  5FJ8 H;  4DR5 Q;  4IUN A;  1XMQ Q;  4K6D A;  3HP3 A;  5IGG A;  1PH9 A;  2K5Q A;  2XSC A;  1OXX K;  1ESF A;  1EWH A;  1YNJ C;  1LTS D;  2WKD A;  4EQO A;  1YNJ D;  2Y0S B;  1K8O A;  1D8L A;  2ICI A;  4AYB E;  3N6R A;  2K04 A;  4DR2 Q;  2K32 A;  4A3C H;  2AWO A;  5E4X A;  3K8A A;  3U50 C;  2OTL A;  3H15 A;  2QDL A;  5C44 B;  1V1Q A;  5FOB B;  4LF8 L;  4U68 A;  3FEW X;  2E2I B;  2PMZ E;  4C3J H;  1HHV A;  2JA5 B;  1IKL A;  1LTB D;  4NP5 A;  4JV5 L;  1A8V A;  4L63 B;  3I4N B;  1SYG A;  2Q8T A;  5ELO A;  1ENF A;  5GAD C;  3J7A F;  4YCU A;  3DLL A;  4YHH Q;  4DAY A;  3MA2 B;  4OO1 H;  3DMU A;  2LSS A;  1HTP A;  4GNX A;  4ABN A;  1C9O A;  1D5M C;  3A8K E;  3T1H Q;  1EY8 A;  3S16 H;  4KD4 A;  4QIW E;  4X3K A;  2A19 A;  3PIO A;  2JA7 H;  2UXC L;  4BA1 I;  1PYS B;  4YY3 Q;  3KYH C;  3PUY A;  2HQL A;  4ZRZ A;  1T5X D;  1BDO A;  4DFA A;  1O78 A;  3D4R A;  1JOK A;  3BDC A;  2GVB A;  1ENA A;  1F9Q A;  5CYU A;  1IL2 A;  4ZKB B;  2N88 A;  2PZW A;  4NXM Q;  1Q81 C;  1DCZ A;  2XIW A;  2BCO A;  3UE0 A;  1E24 A;  2JXM B;  4O0A A;  1HQM C;  4QJF A;  1GD7 A;  1AP0 A;  1NUC A;  3PQI A;  3CMA A;  2A8V A;  4DV2 Q;  3OW2 A;  3PUZ A;  3E3X A;  3S1M B;  3EIV A;  3JC6 6;  3CW2 C;  2NYZ D;  1A3V A;  5ELE A;  4Q5V A;  4IAL A;  4A4I A;  3IKJ A;  3M4Q A;  4ZUJ A;  4JI4 Q;  5C4X H;  1STH A;  3E0J A;  3HOU H;  1TY2 A;  2K4K A;  1E22 A;  1H9J A;  3EBE A;  2I07 B;  3UDF A;  4K5W A;  5CBA E;  4JYA L;  5CBE E;  1MIU A;  1VQC A;  3HOX G;  3ND9 A;  3G71 A;  2N8N A;  5FO7 B;  1LT3 D;  1ZEQ X;  3H0G G;  4NXN Q;  3R2I A;  3S2D H;  5I9O A;  4XT3 B;  3WOE A;  2D5D A;  4L5Q A;  4BBR B;  3D0F A;  4P72 A;  4ZCK A;  2R61 A;  2CKZ B;  5CV4 A;  3SDZ A;  2EYF A;  3SK8 A;  3T51 B;  1JB7 A;  3K0Y A;  4FYD A;  4DV0 Q;  1HR0 L;  1TWC H;  2EY1 A;  3IFT A;  4CGY B;  3H3V I;  4JI7 L;  1JCK B;  1E1T A;  4K14 A;  3J80 E;  2O2L D;  1XPO A;  1ILQ A;  4R4C A;  4AQY Q;  2R3Z A;  4Q0F A;  5EKI A;  2MHV A;  3FMC A;  1DJR D;  4POF A;  2HT1 A;  1AE2 A;  1R4P B;  2R7D A;  2OCE A;  4XQQ A;  1XPR A;  1WVL A;  2F0L A;  4A3G H;  4LF6 L;  3GTG H;  1CM9 A;  4R4I A;  4GKJ L;  3QIA A;  5CV5 A;  3BYY B;  4QMG A;  1CSQ A;  3M85 A;  1EWC A;  1IBL L;  2B2V A;  1UEA B;  2O4X A;  2XRQ D;  4DNT B;  3CCV A;  3I7F A;  3L2P A;  3VA7 A;  5D14 A;  1JB3 A;  1EZ8 A;  4A3B B;  3MXG A;  1K28 A;  1V9P A;  3BVZ A;  3BDO A;  3C1F A;  1VQE A;  1U4R A;  2Z4H A;  1HRJ A;  1RCV D;  4JV5 Q;  2F0N A;  1PTO F;  3H0G H;  2MQH A;  2OWO A;  1EYG A;  2PPB C;  3G7L A;  1HH2 P;  4GZY C;  3WOF A;  2L11 A;  2OQ0 A;  4KKT A;  1Y1W G;  2HIV A;  1LTT D;  5G3L F;  1LT5 D;  3RZD H;  1VQI A;  2MO0 A;  4DV5 L;  4A3K H;  4GLV B;  4C56 C;  2NTT A;  1KAB A;  4APV A;  1L0W A;  1HXY D;  5LMU L;  3U9O A;  2PQA B;  2TMP A;  5AJ3 L;  4PMB A;  4DUZ L;  3MAQ A;  4AYB G;  1WTW A;  4O1N A;  5M3F G;  5IGC A;  3I55 A;  3IAY A;  1NJI C;  3K7A B;  1CTM A;  5C4J H;  2R93 B;  3K5O A;  1UE7 A;  1Y8O B;  3R8B A;  3TDQ A;  4JI3 Q;  1B3A A;  1VMP A;  3I2Z A;  4B3R Q;  3CRL C;  2F0T A;  1CHQ D;  2WAQ E;  4CBV A;  1EYA A;  4K2K A;  3BG3 A;  1JQY D;  4ME5 A;  3L0O A;  4PG3 A;  2KEN A;  5LMN L;  1K83 H;  5L37 A;  1KRT A;  2QGQ A;  3PF5 A;  3GDE A;  2L12 A;  1U0L A;  4KY6 A;  4ID6 A;  3URY A;  4LK1 C;  2I0Q A;  4BWG B;  1HNX Q;  1O80 A;  1K8A C;  4X64 L;  1SAP A;  3GTO B;  4UPA A;  4DR1 L;  5DM6 3;  3HOW G;  4X66 L;  4JOI C;  4KTA A;  1Y1W H;  3PUX A;  4RA8 A;  3PO3 B;  2XN9 C;  1NMG A;  1Q46 A;  4DNI A;  4JI7 Q;  1EL0 A;  3OMC A;  5A2Q E;  4DUY Q;  2VZA A;  4A3D B;  1GUG A;  1UE1 A;  1JT8 A;  4C1N I;  1JMC A;  1SMX A;  1FNV A;  3W1G A;  1RF2 D;  4DV3 Q;  1WTR A;  5M3F H;  1LTG D;  2K52 A;  1TWF H;  1XJV A;  2NBF A;  2NZ1 D;  5IYD H;  1LTI D;  4PNY A;  3N52 A;  4GKJ Q;  2NTS A;  1AE3 A;  3PF4 A;  3P20 A;  3STB C;  4EX5 A;  2RVL A;  4OL7 A;  5C3W A;  3Q0A A;  4A3E H;  3STB D;  1VQK A;  2KEC A;  2EDG A;  2X6G A;  3NUC A;  1IBL Q;  4JC0 A;  1ZKO A;  4XIG S;  2WP8 J;  4Z9C B;  4UP7 A;  5CV6 A;  1QUQ A;  4TVA B;  2KA7 A;  5DAU A;  3T1Y L;  4HTH A;  1E7Z A;  5KGU A;  2B8F A;  5AFW A;  3FKI G;  2B2T A;  1Q1B A;  2BA0 A;  3HZX A;  4KKU A;  3S15 H;  1SNQ A;  1PH2 A;  3S2H H;  1SJH D;  5GRO A;  2L55 A;  1PZI D;  4YIJ A;  3X3M A;  2JA8 B;  3RMH A;  1VQA A;  4I7A A;  2N49 A;  2NVT H;  3S1R B;  4OON A;  1SNP A;  1O7Y A;  2CQA A;  4C3H B;  2MNA A;  3TQY A;  1STN A;  3J81 E;  4BBS G;  4H0L C;  4HJA A;  4HJ9 A;  1W2B A;  2A6E C;  4EQP A;  2I46 A;  1AEX A;  4G7Z C;  4RH6 A;  1N34 L;  5FKA C;  3L3O C;  4UP8 A;  2NN6 G;  3CC7 A;  3H94 A;  2M00 A;  3GP7 A;  3HFZ B;  3GTQ H;  1XTC D;  5K36 H;  4LF4 Q;  5C5M A;  5AJ3 Q;  4LUV A;  1LTA D;  1JWU D;  1VQP A;  4DUZ Q;  3VDY A;  3KOJ A;  1PRT C;  1T9H A;  1EYD A;  2BDO A;  1PRT D;  2ZM6 Q;  4OO1 I;  3CCS A;  4DR7 L;  4FF2 A;  3S1N H;  2F0I A;  3IRB A;  2LFN A;  1HPC A;  5M5W H;  4Y7N H;  5G3L D;  1HQR D;  1KDC A;  1LTR D;  3TS2 A;  4NB3 A;  1TT2 A;  2UU9 Q;  1XWE A;  3AEV A;  4FXK C;  1B8A A;  1PZK D;  2K5D A;  4A3I G;  4KN4 C;  1V1P A;  1WD1 A;  3A5U A;  2QIL A;  2L5T A;  1B9M A;  4J8Q A;  5KRU A;  4BXX G;  2ZTC A;  1A2T A;  1TWG B;  3NBI A;  1U4M A;  5TSS A;  1J9O A;  5M3M G;  3FKI H;  2OEO A;  5EBC A;  3VYR A;  2VS1 A;  1VQJ A;  2HHH L;  1STG A;  2K7V A;  4JI5 L;  4P2C B;  1GUW A;  2C35 B;  3NQI A;  3QOL A;  1G6P A;  4O42 A;  3F8T A;  4HJ8 A;  4DR1 Q;  3HOZ G;  1I4Q A;  2QKI C;  4KJO A;  2EY6 A;  4CKE A;  4LFC Q;  1V8Q A;  4ILW A;  4X66 Q;  2BE5 C;  1EY9 A;  2XTI A;  2XWB B;  2F3W A;  4KHP L;  4G7H C;  1MHW C;  2BE5 D;  3A0J A;  2A73 B;  3HKZ B;  2BH8 A;  1I94 L;  2B63 B;  2A1A A;  1L1O A;  2E2H B;  2MUY A;  2NN6 H;  1A15 A;  4DR3 L;  1I3Q B;  2Z6K A;  4AH6 A;  2F4I A;  2CCZ A;  3CQZ H;  4B3T L;  2WAQ G;  3TP7 A;  3H91 A;  1ROD A;  3D6W A;  1ENC A;  4MN3 A;  1EOV A;  3PV0 A;  1KNE A;  4DR6 L;  1RDP D;  3CHB D;  1F9P A;  4RG1 A;  3U4Z A;  1VQ7 A;  1EQV A;  4PV1 C;  2RHS B;  2WB1 E;  4GN4 B;  3DWP A;  1L1O C;  2Z6B A;  1RJT A;  2ICE C;  2Z6K C;  4QB4 A;  5FLM G;  4DXG A;  4YCV A;  2JEB I;  3GTK B;  1GXD C;  1PDQ A;  5JPM C;  5BN4 A;  2VQF L;  3S1Q B;  4XYO A;  2NVX B;  5C3X A;  1X3E A;  3MFG A;  1PXU A;  3PCO B;  5EJW A;  1F2Y A;  1SYF A;  1KL9 A;  1VCI A;  4IN3 A;  4OEM B;  3HOY G;  4JI8 Q;  3T1Y Q;  5KYL A;  2E74 C;  2UUA Q;  1EY0 A;  2A68 C;  2X69 A;  3CCQ A;  1X6O A;  1TWA B;  2PZU A;  1L0X B;  5M3M H;  4DAP A;  1S5D D;  1LUZ A;  3HOV H;  4FXD A;  4DV7 L;  2HQE A;  4JCV E;  1E3P A;  4DKA C;  4ZLT F;  2CH4 W;  1DD2 A;  3HOZ H;  2IW3 A;  3K80 C;  1MJE A;  4F88 A;  5HY6 A;  1JWS D;  3LX0 A;  4X6A H;  1FYC A;  3S24 A;  5IP7 G;  1CT1 D;  2AQ1 B;  3A5Z B;  1CZG A;  1STE A;  3J80 L;  1TVX A;  3KBG A;  4YWL A;  1MBY A;  1PA6 A;  1S40 A;  1PH1 A;  1SYB A;  3PO2 G;  4OWX B;  5FLX c;  3GQB A;  1I4X A;  2Z0S A;  3MWY W;  4RFB A;  2RCF A;  4XXE A;  4JI0 Q;  2Q2T A;  3RNU A;  1BNZ A;  4K8J A;  1SE4 A;  4RGO S;  1SDF A;  2F0D A;  4DR7 Q;  4A3C G;  5IOD A;  4M1U B;  4KKS A;  1W6K A;  4A3M G;  4JBK A;  3NEL A;  2K33 A;  1SXT A;  3ICE A;  1K9M C;  4OX9 Q;  1SNM A;  2IY5 B;  4LNQ A;  1QNU A;  2KOL A;  5FLM H;  5JAV A;  3KDF A;  3ZYY X;  1KQS A;  1NMF A;  4B9W A;  3K7U C;  3KF6 B;  1EU4 A;  1A3T A;  5KND A;  1GHK A;  1HUM A;  1BCP C;  3HOX B;  4JG2 A;  1BCP D;  2WII B;  4KD3 A;  3OSO A;  4G4K A;  3EN2 A;  2M9V A;  1KXL A;  5I9P A;  2HHH Q;  2QCP X;  3C2P A;  2Y0S E;  2AUK A;  4B3M L;  2I5H A;  3Q22 A;  4B9X A;  2MPM A;  1E2W A;  3RLO A;  4GOP A;  3GTL H;  2FJ2 A;  2F1M A;  3RZO B;  4N9T A;  5KNC A;  4DXF A;  5M5Y H;  2MGS A;  1RKN A;  4IUU A;  4CJ0 B;  1K3R A;  3QG1 A;  2L9H A;  5IP7 H;  3KJO A;  3GTP B;  2E2J B;  4IOC A;  3R3O A;  4DR3 Q;  3KF8 A;  3I4O A;  1AW7 A;  4IOA A;  4LUZ A;  3K5L A;  4QGU A;  2Q2I A;  4IJH A;  3PO2 H;  5C4Z A;  3NQT A;  4BY7 H;  1NTG A;  3HKS A;  4GOP C;  1K8M A;  2R7F A;  4N8X 1;  4DN4 M;  4LMQ D;  5C4X G;  1H9S A;  1JWM D;  4L8J A;  1QVF A;  3CRK C;  3HOU G;  2M2L A;  5C3E B;  2YYZ A;  1Q3L A;  4A3M H;  2ATW A;  2EYJ A;  3EVQ A;  2K5N A;  1UE5 A;  4IPG A;  2BDN A;  3SHL A;  1TR5 A;  3ZJY C;  2K1B A;  3OIQ A;  2VQF Q;  5COY A;  4LJZ C;  2RSN A;  2Q8I B;  4A3J B;  1A62 A;  1Y1V B;  3G6J B;  1XNR L;  1F9S A;  3SK6 A;  1R4Q B;  4UDU C;  1OO9 B;  4ULL A;  1U4L A;  2WIN B;  4HMJ A;  1S5E D;  2NVQ B;  2UUB Q;  4HED A;  1Z9F A;  1UAP A;  5IIF A;  1FL0 A;  2L4N A;  1O7I A;  2CFM A;  3ERO A;  1R9T B;  3AQQ A;  3RN2 A;  1K0S A;  2KHI A;  4TSS A;  3BVG A;  5IGD A;  2MP1 A;  5ELB A;  5KEE A;  5JEA J;  1S72 A;  1OTC A;  4ZK9 B;  4IPC A;  1PTO B;  1JIC A;  2C5C A;  4BY1 H;  2LMC B;  2WAC A;  3TP8 A;  3S14 B;  4P74 A;  2ZXP A;  1SRU A;  1EQT A;  5JJK A;  5A2Q L;  5KNB A;  1YVC A;  4YWM A;  4C2M B;  1TII D;  4A3G G;  2WB1 G;  4AYB B;  1WTX A;  4GNX C;  5C0X G;  3GV3 A;  1Q8I A;  3MZ5 A;  3K5M A;  3VYS A;  1WCM B;  4H13 C;  5C5L A;  4C3I H;  1JJ2 A;  2YTY A;  1YHQ A;  3DXJ C;  2EPB A;  2PMZ B;  3M4O B;  1I50 H;  2JN4 A;  5CMD A;  1LAC A;  1GVP A;  3CPW A;  1SE2 A;  1LO5 D;  3E5S A;  1D2B A;  2PQE A;  2EXZ A;  5LL6 S;  2F0U A;  2HCC A;  3Q24 A;  2XVS A;  2NB0 A;  2F0J A;  3EFX D;  4JI1 L;  2HDM A;  2SNM A;  3RLF A;  2EE1 A;  2IJ0 A;  2OF1 A;  4IQZ A;  1PYB A;  5E4W C;  2VUM B;  4NPS A;  2R7Z G;  1J8I A;  3M7N A;  5JOB A;  1GJX A;  1SYC A;  1N36 L;  1STA A;  1BKB A;  1PH8 A;  1BF4 A;  4B3M Q;  3HOW B;  4CKC A;  4A3K G;  5HGQ A;  1UNS A;  1I6H H;  2KCT A;  4FO2 A;  3J81 L;  1I4P A;  2HDL A;  2N3S A;  3S17 H;  2ZJR A;  3TP6 A;  2UXD L;  1VQG A;  3A56 A;  3U4V A;  4RKL A;  1RD9 D;  2KHJ A;  2KCC A;  3UI2 A;  2PW5 A;  1MSH A;  5DM7 3;  5M9O A;  5KIX A;  1ZXT A;  3TZD A;  2VB3 X;  4CHT B;  5C0X H;  3A8I E;  1SEB D;  2BH2 A;  1K8G A;  3K57 A;  4HJ5 A;  2YU9 B;  2CVR A;  3V96 A;  2MO1 A;  2Z4I A;  1KIX A;  1OXS C;  1Q12 A;  2EXD A;  4EQ5 A;  1WFQ A;  4A93 H;  1I6V C;  3KLS X;  4UY8 C;  1ASY A;  1Y8P B;  4IZ8 A;  5FO8 B;  4LF8 Q;  2NN6 I;  1V43 A;  3JAM c;  3I4M B;  1K73 C;  1SNC A;  2F4V L;  2Y0S G;  4XQN A;  5D3I B;  4A3F B;  1H9M A;  2G5D A;  4L5R C;  2JE6 I;  3KLS A;  3M3Y B;  1TQO A;  4K5V A;  1PRT F;  5C44 G;  1PHJ A;  2V1C C;  1Q1E A;  1XNR Q;  2F0M A;  3GTJ H;  2JA6 B;  2B2V C;  4MZ9 A;  2R7Z H;  2LY7 A;  4CJ2 C;  2JA5 G;  4IFD G;  2CWA A;  3NTK A;  4WJW A;  2KEE A;  3K5N A;  1HCZ A;  3E9I A;  1IZ6 A;  3KUP A;  3ONA B;  4GLA C;  1B4O A;  1YBY A;  4BA2 I;  2YTX A;  2UXC Q;  2B29 A;  3VR2 A;  4GN3 B;  3TBI B;  1VQ5 A;  3M4Y A;  3NXW A;  1A0I A;  1IBM L;  1MGS A;  2F0S A;  2I5L X;  3T56 B;  2DY8 A;  5J3B A;  3UDG A;  5IYC H;  1I5F A;  1VQF A;  1SBB B;  3BU2 A;  2GA4 B;  3MXN A;  1XX8 A;  1BBX C;  1FD7 D;  1NE3 A;  3HEJ A;  3I3C A;  5IYD G;  1CKN A;  1HR0 W;  1BR9 A;  3MXP A;  5M5X B;  4A3E G;  2A5H A;  4KLK A;  1NBW A;  1F2M A;  1U9R A;  3J7Z C;  1CKO A;  3NWS A;  4GS3 A;  4N8F A;  2F0K A;  3R93 A;  4RWS C;  1XMO L;  1XTD A;  4JVZ A;  1X3F A;  4HCS A;  5CC4 A;  1E2V A;  4LW1 A;  2VQE L;  5IT9 c;  4HMI A;  5E1F A;  1JOO A;  1YIT A;  1Y69 U;  1HFN A;  1KDA A;  2NVY B;  4A3I B;  2KVM A;  1Q7Y C;  1LYL A;  4JYA Q;  1W6J A;  2PCF B;  5GAG C;  1HZB A;  4P73 A;  1PH5 A;  1DYQ A;  3SR1 A;  1SE3 A;  3D6C A;  5EAY A;  1KRS A;  1TU2 B;  3D4D A;  2DGY A;  5C44 H;  2IX0 A;  4WFN 3;  2UUC L;  4HSV A;  1MKH A;  1QVC A;  4OXP A;  1EFI D;  2E2I H;  2D62 A;  4TRD A;  1B50 A;  2JA5 H;  4IFD H;  1X54 A;  1HR0 Q;  3NBH B;  2OXP A;  3I4N H;  1SND A;  3VR5 A;  3NEM A;  5DLQ E;  3BDL A;  4IUP A;  3G6E A;  2WFW A;  1PFB A;  4CDC C;  1NY4 A;  5K36 G;  1JE5 A;  5D3D A;  2UXD Q;  1D6E C;  3K0X A;  5NUC A;  1B2T A;  1L0Y B;  3NTI A;  5IGF A;  1TWH B;  1EOT A;  5IY0 A;  3GTM B;  3JAM i;  4X3S A;  5EBD A;  4LF6 Q;  4NKL A;  1O7Z A;  1YEZ A;  2R92 B;  1MJC A;  2I5M X;  2KUM A;  4CDF C;  3I8Z A;  1GUN A;  1CZW A;  2A74 C;  3OWF A;  2EYP A;  5JJL A;  1XXG A;  4X62 L;  1VQ8 A;  3MFY A;  1EEF D;  2F3V A;  1SFO B;  3QOJ A;  4HAE A;  5IGB A;  3OTO L;  1VMC A;  2D2C C;  1ET9 A;  5CV8 A;  1IHZ A;  2H4O A;  3S1M H;  4NDX A;  2DN8 A;  3AB9 A;  4V19 0;  3KLW A;  1JE4 A;  1YHA A;  4DK3 C;  3ER0 A;  5IYB G;  4FVM A;  3HOY B;  2QW7 A;  2RBM A;  2B2Y A;  1J5E L;  2ES2 A;  3DEO A;  4CJ1 B;  3Q8D A;  1F2L A;  2F0O A;  2OTJ A;  4DAM A;  5EQ0 A;  5HGT A;  2YV5 A;  4R4T A;  1HNZ L;  1VDZ A;  4LF9 L;  1VQB A;  2PZT A;  1QIL A;  2F3I A;  3U9S A;  5LMN W;  1RIP A;  3T16 A;  3PIP 3;  3W5O A;  2A6E D;  1SLJ A;  3ITP A;  4KV6 A;  4DAY B;  4ODG A;  4DV5 Q;  4MIU A;  2B2T C;  5IE8 A;  1LT6 D;  4L5T A;  1G2T A;  2FXQ A;  4BBR H;  4GNX B;  2A69 C;  5LMU Q;  3SK5 A;  2RF4 A;  1IBM Q;  4RHS A;  2FFK B;  1RTO A;  2PI2 A;  1BCP F;  3NSW A;  4U67 3;  4Y52 H;  3V05 A;  4NMZ A;  4PMC A;  1G8Z D;  1J6Q A;  2RQX A;  1HA5 A;  3RN5 A;  3PUW A;  4IO9 A;  4BS9 A;  3ULP A;  3J7A V;  1TS3 A;  1VF5 C;  1IYJ B;  4DK0 A;  1C4Q A;  4KY7 A;  1PH7 A;  4GLX A;  5J1Z A;  3F2B A;  2E5L L;  1EUJ A;  3VR6 A;  1M8A A;  4DNR B;  5IGE A;  2UXB L;  5J39 A;  2D0P A;  4DK1 A;  3BVM A;  3HKZ E;  2KHS A;  2ASB A;  3BS1 A;  3BYT B;  4I7Z C;  1MI2 A;  4EQN A;  4IJL A;  4K5X A;  4MTK A;  2R93 G;  2VQE Q;  1SE8 A;  4C3J B;  4DV6 L;  2ZJQ A;  2VW9 A;  2IX1 A;  5LMN Q;  1QZH A;  3TP5 A;  4RMF A;  3QR8 A;  2K5W A;  3OMG A;  3R2T A;  4X65 L;  3W1B A;  2CQO A;  2Q8R E;  3HOV G;  4LUO A;  5IYB H;  5JJZ A;  1BQQ T;  3NTH A;  2ID0 A;  4X64 Q;  1WYD A;  3F2U A;  1JC7 A;  1ML0 D;  4A3B H;  3S16 B;  1FR3 A;  2JA7 B;  5JVG 3;  2AMC B;  2WV6 D;  3CME A;  1MSG A;  3KBX A;  4DGZ A;  1E2Z A;  1Z47 A;  2HD3 A;  2RDF A;  4JK1 C;  1JOQ A;  3IL8 A;  3CC4 A;  4TKO B;  5FLX E;  1WTV A;  2Z9H A;  4DV4 L;  4B08 A;  4ZKC B;  1OXU A;  4RGN A;  3NPP A;  3EQL C;  2NUC A;  4LFA L;  3D3R A;  4HN7 A;  1QWY A;  1EY6 A;  2SEB D;  2ZXO A;  1JJC B;  1N8R C;  1EU3 A;  3BZK A;  4A3D G;  2H5X A;  2F0E A;  1L2F A;  3ND8 A;  4P75 A;  2ZT9 C;  2SNS A;  4DR5 L;  5C4X B;  1EIH A;  2VY3 A;  3HOU B;  2IT1 A;  3UDX A;  2WKC A;  2LXK A;  4JBJ A;  1HNW L;  4CDE C;  3M7G A;  3KJP A;  3K7A H;  1XYI A;  2R93 H;  1IW7 C;  3WWV A;  1GKH A;  1IW7 D;  2FIN B;  2K6A A;  1EY4 A;  1EZ6 A;  1X3G A;  3AFP A;  2C9O A;  1IBK L;  2A68 D;  3G4S A;  5C0X I;  3LWE A;  1WTP A;  2F0Q A;  4PZ7 A;  3ERQ A;  3FRP B;  1Q8K A;  4IUV A;  4MTN A;  1KAW A;  4KHZ A;  5EPL A;  1FNW A;  1CA5 A;  2XWJ B;  1HNZ Q;  1AFP A;  4QY7 A;  4RHR A;  1TWC B;  4PQX A;  4R8N A;  1PZJ D;  1HTL D;  1AZQ A;  2DUD A;  1IL8 A;  4DA2 A;  5I6W A;  1D7Q A;  1N34 Q;  1KNA A;  2JA8 G;  3DUZ A;  5BN5 A;  3GTO H;  3A7A B;  1TS5 A;  2PQA A;  4C3H G;  3QB3 A;  4KJN A;  4YY3 L;  1WTQ A;  4BY7 G;  4A3G B;  3GTG B;  1B7Y B;  4KHV A;  3OWE B;  3PO3 H;  3OHX C;  3NK9 A;  1A2U A;  1YNN C;  3P7J A;  3Q6S A;  4X3T A;  2IHF A;  4A3L G;  1EYC A;  2B2W A;  1YNN D;  3HRZ C;  2RA4 A;  4A3D H;  3I4L A;  2E5L Q;  2JJQ A;  2VXW A;  4J1M A;  1UUP A;  3TRZ A;  2UXB Q;  3PIP A;  1FJG L;  4DV2 L;  2L0C A;  4FP5 D;  1P8L A;  4AIM A;  1K3B C;  3CD6 A;  4DV6 Q;  3NHH A;  3RUZ A;  2ZJP A;  4JI4 L;  3GD7 A;  2MFI A;  4IUR A;  2B2W C;  1PH3 A;  4X65 Q;  3AYH B;  3H0G B;  5LHY 1;  4K2L A;  1U4P A;  2L15 A;  4JI5 Q;  4PZ6 A;  1QB5 D;  3I91 A;  2E76 C;  1CQF A;  4OGQ C;  2J0T D;  4JI6 L;  1JJG A;  2MJ8 A;  1ICW A;  3K81 C;  1B44 D;  1LLR D;  3RZD B;  2FMM A;  4A3K B;  4NXN L;  3G48 A;  1NR4 A;  1VQ4 A;  3DWA A;  1EFW A;  4KHP Q;  5ELD A;  3D8G A;  1N9W A;  2Z8L A;  4BY1 G;  2K05 A;  3QWN A;  2ZXR A;  1DZ1 A;  2KCM A;  4HCE A;  4EVO A;  1I94 Q;  1YHB A;  2HIX A;  2JA8 H;  4DV0 L;  1B1Z A;  5H1S E;  3S1R H;  2EY5 A;  1NSN S;  1PV4 A;  4C3H H;  1X3Q A;  4TQU S;  4B3T Q;  3HKZ G;  3KK7 A;  3BZD B;  4C3I G;  5C4J B;  2B39 A;  3D31 A;  4AQY L;  2B63 G;  2IWH A;  4L5S A;  4LF5 L;  5JEA H;  4DR6 Q;  3DM1 A;  4A3L H;  5ELF A;  4IFD I;  1ESR A;  1F9R A;  2F03 A;  1BBW A;  3TEH B;  1X9N A;  1G51 A;  3CF5 A;  3OPO A;  1HNW Q;  2J4X A;  1FNU A;  3MHB A;  1BXT A;  4H7B A;  3TSS A;  1M90 C;  2JEA I;  1K83 B;  2RDH A;  2PI2 E;  4UAI A;  1HUN A;  3DEP A;  5I4D A;  4OHJ A;  5GAH C;  5IP9 G;  1CFM A;  1Y14 B;  2D9U A;  4FDB A;  2AWN A;  3Q23 A;  2VL6 A;  4HR7 B;  3OYY A;  1OXT A;  3X3N A;  3A8J E;  1WOC A;  1IBK Q;  1QUQ B;  2F52 A;  2EJG C;  4DV7 Q;  5C4H A;  3OW7 A;  4OWT B;  4KMU C;  4YWK A;  1Y1W B;  4E6I A;  5JPN C;  2OQK A;  4QF4 A;  1WI5 A;  3CKI B;  1TWG H;  1QOH A;  1EIY B;  1B53 A;  4IUQ A;  4OEL B;  1PRT B;  1NNX A;  4FF1 A;  1DOL A;  1PYW D;  2RHQ B;  1FGU A;  1SN8 A;  3AU7 A;  1GUO A;  4MHE A;  1IYU A;  5M3F B;  1XPU A;  4DAV A;  2EYM A;  2EQS A;  1TWF B;  4FNF A;  3J7A 5;  2B63 H;  1QJO A;  1K0R A;  2QF7 A;  4A3E B;  2E2H H;  4XYQ A;  1I3Q H;  1C8C A;  1M4V A;  3JAM E;  4FF3 A;  4A93 G;  3CCM A;  5E7N A;  3PSI A;  2F0V A;  4WJ4 A;  1X65 A;  5ELN A;  3CPF A;  4RGT A;  1GUS A;  3CU7 A;  4ALP A;  4JI3 L;  1FJG Q;  4LWC A;  1EIG A;  5CV9 A;  1LTL A;  4B3R L;  5ELC A;  3SXH A;  3SEB A;  2EYL A;  3I70 A;  1QZG A;  5IP9 H;  3S15 B;  3CAM A;  1KLU D;  4QIW B;  5F2D A;  4B3S L;  2JSO A;  3S2H B;  2DY7 A;  1G91 A;  1YJ9 A;  3FPP A;  1DXM A;  1W3S A;  2K01 A;  2O5J C;  4PZ8 A;  1V1P B;  2AHO B;  2NVT B;  3GTK H;  2GVA A;  1Y8N B;  5IOC A;  2IL8 A;  3S1Q H;  2E8G A;  1QVG A;  1YZ6 A;  2NVX H;  4FF4 A;  1DON A;  4JI6 Q;  2G9H D;  1KAA A;  2RSO A;  4R1J A;  1HNX L;  1BVS A;  5CV7 A;  2K5V A;  1EWI A;  1TWA H;  1CA6 A;  4LF7 L;  3VYU A;  5IYC G;  1GHJ A;  3GTQ B;  1BO0 A;  2EZV A;  1SYD A;  2E2D C;  4HJ7 A;  5I6Y A;  4DV1 L;  2JP1 A;  3MEH A;  3S1N B;  1PMR A;  2IHE A;  3MEF A;  1L1O B;  2AQ3 B;  4J15 A;  4RKB A;  4DUY L;  2FMC A;  2EY2 A;  4LF5 Q;  2BOS A;  5IT9 E;  4Y7N B;  5M5W B;  3LWU A;  2AKW B;  4GKK L;  3RR5 A;  4UP9 A;  3BZC A;  2NWG A;  1HA6 A;  1LM0 A;  4DV3 L;  3CC2 A;  1X56 A;  3A7L A;  3FDT A;  3RLN A;  5BR8 L;  5C3E G;  3TME A;  3FP9 A;  4RCO A;  1UE6 A;  3FKI B;  1HJP A;  1I4H A;  1IKM A;  5HUR A; 
#chains in the Genus database with same CATH homology
 1DOK A;  1H9R A;  3EJI A;  2F0F A;  1SYE A;  4HSP A;  5LL6 X;  3K6O A;  3KLR A;  1S5B D;  1KDB A;  1E0B A;  4BBS B;  2AUJ D;  1STY A;  1S5C D;  1ET6 A;  2PNR C;  4RAU C;  5FLX L;  5D65 A;  2BA1 A;  3CQZ B;  4DF7 A;  5C0X J;  1EEI D;  1LAB A;  2PW7 A;  2JYO A;  2LS0 1;  2RDG A;  1WD0 A;  4LAA A;  1BCP B;  1KTK A;  3TN2 A;  2XRS D;  1LV9 A;  2VNU D;  4ZUI A;  1VF7 A;  4KY5 A;  2G9D A;  4X3U A;  5M3M B;  2QEJ C;  3HOV B;  4XDX A;  2F0H A;  3DHQ A;  3T13 A;  2FHT A;  2OT2 A;  3T53 B;  3DWQ A;  4R9W A;  1JR0 D;  5E3F A;  3HOZ B;  3MC0 B;  3K58 A;  1O7L A;  4WOR A;  4KK7 A;  1JOR A;  4V0B A;  1TS2 A;  2EOT A;  3P75 A;  2LKV A;  3FVQ A;  1KLG D;  1DOM A;  1II3 A;  2F0W A;  3FPU B;  3EA6 A;  4H44 C;  1S4Z A;  5KYI A;  2WAQ B;  2EVB A;  2F0G A;  5EPK A;  3J7Y W;  3MXU A;  3O13 A;  2N55 A;  1SMY C;  3SE0 A;  1F77 A;  1PTO H;  1SMY D;  1H9K A;  3NWT A;  1ILP A;  1B9N A;  3A55 A;  2DNC A;  4OIJ A;  1D5X C;  3OOC A;  1H9S B;  1T5E A;  3H09 A;  4IUT A;  5ISR A;  1S5F D;  2VB2 X;  1SNO A;  3GTL B;  1BUV T;  4IFD J;  4DU9 A;  3W2D A;  1MD2 D;  2HCI A;  4G57 A;  5M5Y B;  4EGV A;  5EGT A;  3T4A C;  3S9W A;  2B2Y C;  2SOB A;  5EKK A;  2IPK D;  3I72 A;  2A69 D;  3RD4 A;  4F87 A;  3PO2 B;  3VR4 A;  1TKW B;  2X6L A;  3H6M A;  1QNK A;  1AN8 A;  2EYH A;  4BY7 B;  4ZAI A;  2ENB A;  1PFN A;  1RTN A;  2E75 C;  2K28 A;  1IYV A;  2B8G A;  4A3M B;  2EJM A;  1PTO C;  1PTO D;  5K5P A;  4JBW A;  4PMW A;  3K59 A;  4G7O C;  2KED A;  3C3L A;  4K8I A;  5CR3 A;  2V4D A;  1D1K A;  4NW2 A;  2KCN A;  3L9A X;  3I90 A;  5C6A A;  1HFG A;  4XT1 B;  1Q90 A;  4N9P A;  3IFD A;  3HS0 C;  4ZQ3 A;  5DNF A;  4M8A A;  1G2S A;  5FK9 C;  4F8M A;  4I65 A;  2IX3 A;  1PFM A;  4RCN A;  4BY1 B;  2SDF A;  3D4W A;  2J7Z A;  3NE5 B;  1SSO A;  3QO2 A;  3W3A A;  1QG7 A;  2R6G A;  4KI0 A;  1CQV A;  4F7X A;  4C3I B;  2EJF C;  1NR2 A;  1NCV A;  1I50 B;  3P1H A;  3C46 A;  3PMF A;  3I73 A;  5BN3 A;  3JAM L;  3GO5 A;  2XNA C;  5I2Y A;  1I4R A;  3VA5 A;  3SVM A;  4KN7 C;  1BOS A;  4XQJ A;  4K6L A;  2O5I C;  1Z7T A;  1EY5 A;  1SJE D;  4XTC S;  3PIO 3;  3S2D B;  3A54 A;  5J22 A;  1D5Z C;  1WTO A;  5JVH 3;  2TSS A;  3H3V C;  1LT4 D;  1OXV A;  2K03 A;  4ZYS A;  1I6H B;  2Z1C A;  4C1N K;  1C48 A;  1GUT A;  2EYO A;  3S17 B;  2F0P A;  2RKS A;  5DEH A;  1ZYR C;  1A3U A;  4R8I A;  2CW0 C;  3HGB A;  1GOZ A;  1ZYR D;  1TS4 A;  3HG9 A;  1X3P A;  2CW0 D;  1PLF A;  4CKB A;  3PUV A;  2KQ3 A;  2WB1 B;  1AZP A;  4RGM A;  5JEA G;  2PYK A;  3TZU A;  1CI3 M;  3V2T A;  1NAP A;  1V1O A;  3AMU A;  5CGK A;  4OIK A;  2KJX A;  5IT9 L;  4A93 B;  3SK4 A;  1G29 1;  3GV6 A;  1TY0 A;  5T1G A;  1ONL A;  4FXG C;  2H1E A;  2DNE A;  2A6H C;  1CHP D;  2A6H D;  3C1E A;  1QE6 A;  3GTJ B;  3L7Z C;  3OIP A;  3MVV A;  4J6H A;  2R7Z B;  4C3J G;  5A35 A;  2B2U A;  2L1B A;  5EKL A;  3E6Z X;  4L6T B;  3NP8 A;  3WDN A;  1RHP A;  5T1I A;  2AQ2 B;  4WRD A;  2PO4 A;  3NBH A;  3MTS A;  1QCB D;  3VR3 A;  4QUF A;  4OO1 G;  1F2Z A;  5FO9 B;  1FGB D;  3LNN A;  1G6Z A;  1X32 A;  2HUG A;  5I2X A;  4QCL A;  2CHB D;  1Z6H A;  2B2U C;  1CK1 A;  1STB A;  1I4G A;  1EY7 A;  4QUC A;  3QJY A;  1D1I A;  2QDB A;  5COR A;  3VYT A;  1DM0 B;  1A6X A;  4S3S A;  4IUN A;  4K6D A;  3HP3 A;  5IGG A;  2K5Q A;  2XSC A;  1OXX K;  1ESF A;  1EWH A;  1YNJ C;  1LTS D;  2WKD A;  4EQO A;  1YNJ D;  2Y0S B;  1K8O A;  2ICI A;  3N6R A;  2K04 A;  2K32 A;  2AWO A;  5E4X A;  5C44 B;  5FOB B;  4U68 A;  3FEW X;  2E2I B;  1HHV A;  2JA5 B;  1IKL A;  1LTB D;  4NP5 A;  4L63 B;  3I4N B;  1SYG A;  2Q8T A;  1ENF A;  3J7A F;  4DAY A;  3MA2 B;  4OO1 H;  3DMU A;  1HTP A;  4ABN A;  1D5M C;  3A8K E;  1EY8 A;  4KD4 A;  4X3K A;  4BA1 I;  3PUY A;  4ZRZ A;  1T5X D;  1BDO A;  4DFA A;  1O78 A;  3D4R A;  1JOK A;  3BDC A;  1ENA A;  1F9Q A;  5CYU A;  4ZKB B;  2N88 A;  2PZW A;  1DCZ A;  2XIW A;  2BCO A;  2JXM B;  1HQM C;  1AP0 A;  1NUC A;  3PUZ A;  3S1M B;  2NYZ D;  1A3V A;  5ELE A;  4Q5V A;  4IAL A;  3IKJ A;  4ZUJ A;  1STH A;  3E0J A;  1TY2 A;  1H9J A;  2I07 B;  4K5W A;  5CBA E;  5CBE E;  3ND9 A;  5FO7 B;  1LT3 D;  1ZEQ X;  3R2I A;  5I9O A;  4XT3 B;  3WOE A;  2D5D A;  4BBR B;  2R61 A;  5CV4 A;  3SDZ A;  3SK8 A;  2EYF A;  3T51 B;  3K0Y A;  4FYD A;  2EY1 A;  3IFT A;  4CGY B;  1JCK B;  4K14 A;  3J80 E;  2O2L D;  1ILQ A;  2R3Z A;  4Q0F A;  5EKI A;  2MHV A;  3FMC A;  1DJR D;  1R4P B;  4XQQ A;  1WVL A;  2F0L A;  1CM9 A;  3QIA A;  5CV5 A;  3BYY B;  4QMG A;  3M85 A;  1EWC A;  2B2V A;  1UEA B;  2O4X A;  2XRQ D;  4DNT B;  3VA7 A;  5D14 A;  1JB3 A;  1EZ8 A;  4A3B B;  3MXG A;  3BVZ A;  3BDO A;  3C1F A;  1U4R A;  2Z4H A;  1HRJ A;  1RCV D;  2F0N A;  1PTO F;  2PPB C;  3G7L A;  4GZY C;  3WOF A;  2L11 A;  4KKT A;  1LTT D;  5G3L F;  1LT5 D;  4C56 C;  2NTT A;  1KAB A;  1HXY D;  3U9O A;  2TMP A;  4PMB A;  3MAQ A;  1WTW A;  4O1N A;  5IGC A;  3IAY A;  3K7A B;  1CTM A;  2R93 B;  3K5O A;  1Y8O B;  3R8B A;  3TDQ A;  1B3A A;  1VMP A;  3CRL C;  2F0T A;  1CHQ D;  4CBV A;  1EYA A;  4K2K A;  3BG3 A;  1JQY D;  4ME5 A;  2L12 A;  4KY6 A;  4ID6 A;  3URY A;  4LK1 C;  4BWG B;  1O80 A;  1SAP A;  3GTO B;  5DM6 3;  4KTA A;  3PUX A;  4RA8 A;  3PO3 B;  2XN9 C;  1EL0 A;  3OMC A;  5A2Q E;  4A3D B;  1GUG A;  4C1N I;  1FNV A;  1RF2 D;  1WTR A;  1LTG D;  2NBF A;  2NZ1 D;  1LTI D;  4PNY A;  3N52 A;  2NTS A;  3P20 A;  5C3W A;  2RVL A;  4OL7 A;  3Q0A A;  2KEC A;  2EDG A;  2X6G A;  3NUC A;  1ZKO A;  4XIG S;  2WP8 J;  4Z9C B;  5CV6 A;  2KA7 A;  5DAU A;  4HTH A;  5KGU A;  2B8F A;  5AFW A;  2B2T A;  1Q1B A;  2BA0 A;  3HZX A;  4KKU A;  1SNQ A;  1SJH D;  2L55 A;  1PZI D;  4YIJ A;  3X3M A;  2JA8 B;  3RMH A;  3S1R B;  1SNP A;  1O7Y A;  2CQA A;  4C3H B;  1STN A;  3J81 E;  4H0L C;  2A6E C;  4EQP A;  2I46 A;  1AEX A;  4G7Z C;  4RH6 A;  5FKA C;  3L3O C;  2NN6 G;  3H94 A;  2M00 A;  3GP7 A;  1XTC D;  5K36 H;  5C5M A;  1LTA D;  1JWU D;  1PRT C;  1EYD A;  2BDO A;  1PRT D;  4OO1 I;  4FF2 A;  2F0I A;  2LFN A;  1HPC A;  5G3L D;  1HQR D;  1KDC A;  1LTR D;  1TT2 A;  1XWE A;  4FXK C;  1PZK D;  2K5D A;  4KN4 C;  1V1P A;  1WD1 A;  2QIL A;  2L5T A;  1B9M A;  4J8Q A;  5KRU A;  1A2T A;  1TWG B;  3NBI A;  1U4M A;  5TSS A;  1J9O A;  3VYR A;  2OEO A;  5EBC A;  1STG A;  2K7V A;  1GUW A;  4P2C B;  3NQI A;  3QOL A;  4O42 A;  1I4Q A;  2QKI C;  4KJO A;  2EY6 A;  4CKE A;  1V8Q A;  4ILW A;  2BE5 C;  1EY9 A;  2XWB B;  2F3W A;  4G7H C;  2BE5 D;  2A73 B;  3HKZ B;  2B63 B;  2E2H B;  2MUY A;  2NN6 H;  1A15 A;  1I3Q B;  2F4I A;  3TP7 A;  3H91 A;  1ROD A;  3D6W A;  1ENC A;  4MN3 A;  3PV0 A;  1KNE A;  1RDP D;  3CHB D;  1F9P A;  1EQV A;  4PV1 C;  3DWP A;  1RJT A;  2ICE C;  4QB4 A;  4DXG A;  2JEB I;  3GTK B;  1GXD C;  1PDQ A;  5JPM C;  5BN4 A;  3S1Q B;  4XYO A;  2NVX B;  5C3X A;  3MFG A;  1PXU A;  5EJW A;  1F2Y A;  1SYF A;  1VCI A;  4IN3 A;  5KYL A;  2E74 C;  1EY0 A;  2A68 C;  2X69 A;  1TWA B;  2PZU A;  1L0X B;  4DAP A;  1S5D D;  4FXD A;  2HQE A;  4ZLT F;  1DD2 A;  2IW3 A;  4F88 A;  1JWS D;  3LX0 A;  1FYC A;  1CT1 D;  2AQ1 B;  1CZG A;  1STE A;  3J80 L;  1TVX A;  3KBG A;  1MBY A;  1SYB A;  3GQB A;  1I4X A;  3MWY W;  4RFB A;  4XXE A;  1BNZ A;  4K8J A;  1SE4 A;  4RGO S;  1SDF A;  2F0D A;  5IOD A;  4M1U B;  4KKS A;  1W6K A;  2K33 A;  1SXT A;  1SNM A;  1QNU A;  2KOL A;  5JAV A;  3ZYY X;  4B9W A;  1EU4 A;  1A3T A;  5KND A;  1GHK A;  1HUM A;  1BCP C;  3HOX B;  1BCP D;  2WII B;  4KD3 A;  3OSO A;  4G4K A;  2M9V A;  5I9P A;  2QCP X;  3C2P A;  2AUK A;  3Q22 A;  4B9X A;  2MPM A;  1E2W A;  2FJ2 A;  2F1M A;  3RZO B;  4N9T A;  5KNC A;  4DXF A;  2MGS A;  1RKN A;  4IUU A;  4CJ0 B;  3QG1 A;  2L9H A;  3GTP B;  2E2J B;  3R3O A;  3KF8 A;  1AW7 A;  3K5L A;  5C4Z A;  3NQT A;  1K8M A;  4DN4 M;  4LMQ D;  1H9S A;  1JWM D;  4L8J A;  3CRK C;  2M2L A;  5C3E B;  2YYZ A;  1Q3L A;  2EYJ A;  3EVQ A;  2BDN A;  3SHL A;  1TR5 A;  2K1B A;  3OIQ A;  5COY A;  4LJZ C;  2RSN A;  2Q8I B;  4A3J B;  1Y1V B;  3G6J B;  1F9S A;  3SK6 A;  1R4Q B;  4UDU C;  1OO9 B;  4ULL A;  1U4L A;  2WIN B;  4HMJ A;  1S5E D;  2NVQ B;  4HED A;  5IIF A;  1UAP A;  2L4N A;  3ERO A;  1R9T B;  4TSS A;  3BVG A;  5IGD A;  2MP1 A;  5ELB A;  5KEE A;  5JEA J;  4ZK9 B;  1PTO B;  1JIC A;  2C5C A;  2LMC B;  2WAC A;  3TP8 A;  3S14 B;  2ZXP A;  1EQT A;  5A2Q L;  5KNB A;  4C2M B;  1TII D;  4AYB B;  1WTX A;  5C0X G;  3GV3 A;  1Q8I A;  3MZ5 A;  3K5M A;  3VYS A;  1WCM B;  4H13 C;  5C5L A;  3DXJ C;  2EPB A;  2PMZ B;  3M4O B;  5CMD A;  1LAC A;  1SE2 A;  1LO5 D;  3E5S A;  1D2B A;  2PQE A;  2EXZ A;  5LL6 S;  2F0U A;  2HCC A;  3Q24 A;  2XVS A;  2NB0 A;  2F0J A;  3EFX D;  2HDM A;  2SNM A;  3RLF A;  2EE1 A;  2IJ0 A;  2OF1 A;  4IQZ A;  5E4W C;  2VUM B;  1J8I A;  3M7N A;  5JOB A;  1GJX A;  1SYC A;  1STA A;  1BF4 A;  3HOW B;  4CKC A;  1UNS A;  4FO2 A;  3J81 L;  1I4P A;  2HDL A;  3TP6 A;  3A56 A;  4RKL A;  1RD9 D;  2KCC A;  3UI2 A;  2PW5 A;  1MSH A;  5DM7 3;  5M9O A;  5KIX A;  1ZXT A;  3TZD A;  2VB3 X;  4CHT B;  5C0X H;  3A8I E;  1SEB D;  3K57 A;  2YU9 B;  2CVR A;  3V96 A;  2Z4I A;  1OXS C;  1Q12 A;  1I6V C;  3KLS X;  1Y8P B;  4IZ8 A;  5FO8 B;  2NN6 I;  1V43 A;  3I4M B;  1SNC A;  4XQN A;  5D3I B;  4A3F B;  1H9M A;  2JE6 I;  3KLS A;  3M3Y B;  1TQO A;  4K5V A;  1PRT F;  1Q1E A;  2F0M A;  2JA6 B;  2B2V C;  2LY7 A;  4CJ2 C;  4IFD G;  3NTK A;  4WJW A;  2KEE A;  3K5N A;  1HCZ A;  3KUP A;  3ONA B;  1B4O A;  4BA2 I;  3VR2 A;  3TBI B;  3M4Y A;  3NXW A;  1MGS A;  2F0S A;  3T56 B;  2DY8 A;  1SBB B;  2GA4 B;  3MXN A;  1XX8 A;  1BBX C;  1FD7 D;  3I3C A;  3HEJ A;  1BR9 A;  3MXP A;  5M5X B;  2A5H A;  1U9R A;  1F2M A;  3NWS A;  2F0K A;  3R93 A;  4RWS C;  4HCS A;  5CC4 A;  1E2V A;  4HMI A;  5E1F A;  1JOO A;  1Y69 U;  1HFN A;  1KDA A;  2NVY B;  4A3I B;  2KVM A;  1W6J A;  2PCF B;  1DYQ A;  3SR1 A;  1SE3 A;  3D6C A;  1TU2 B;  3D4D A;  2IX0 A;  4WFN 3;  4HSV A;  1EFI D;  2D62 A;  4TRD A;  1B50 A;  4IFD H;  2OXP A;  1SND A;  3VR5 A;  3BDL A;  4IUP A;  1PFB A;  5K36 G;  5D3D A;  1D6E C;  5NUC A;  1B2T A;  1L0Y B;  3NTI A;  5IGF A;  1TWH B;  1EOT A;  3GTM B;  4X3S A;  5EBD A;  4NKL A;  1O7Z A;  2R92 B;  2KUM A;  3I8Z A;  1GUN A;  1CZW A;  2A74 C;  3OWF A;  2EYP A;  1XXG A;  3MFY A;  1EEF D;  2F3V A;  1SFO B;  3QOJ A;  4HAE A;  5IGB A;  1VMC A;  2D2C C;  1ET9 A;  5CV8 A;  1IHZ A;  2H4O A;  4NDX A;  2DN8 A;  3AB9 A;  4V19 0;  1JE4 A;  4FVM A;  3HOY B;  2RBM A;  2B2Y A;  3DEO A;  4CJ1 B;  1F2L A;  2F0O A;  5EQ0 A;  5HGT A;  1VDZ A;  2PZT A;  1QIL A;  3U9S A;  3T16 A;  3PIP 3;  2A6E D;  4KV6 A;  3ITP A;  4ODG A;  4MIU A;  2B2T C;  1LT6 D;  1G2T A;  2A69 C;  3SK5 A;  4RHS A;  2FFK B;  1RTO A;  3NSW A;  1BCP F;  4U67 3;  3V05 A;  4NMZ A;  4PMC A;  1G8Z D;  2RQX A;  1HA5 A;  3PUW A;  4BS9 A;  3J7A V;  1TS3 A;  1I4H A;  1VF5 C;  4DK0 A;  1C4Q A;  4KY7 A;  5J1Z A;  3VR6 A;  4DNR B;  1M8A A;  5IGE A;  5J39 A;  4DK1 A;  3BVM A;  2KHS A;  3BS1 A;  3BYT B;  4I7Z C;  1MI2 A;  4EQN A;  4K5X A;  4C3J B;  2IX1 A;  3TP5 A;  2K5W A;  3OMG A;  3R2T A;  2Q8R E;  5JJZ A;  1BQQ T;  3NTH A;  2ID0 A;  3F2U A;  1JC7 A;  1ML0 D;  3S16 B;  1FR3 A;  2JA7 B;  5JVG 3;  2WV6 D;  1MSG A;  3KBX A;  4DGZ A;  1E2Z A;  1Z47 A;  2RDF A;  4JK1 C;  1JOQ A;  3IL8 A;  4TKO B;  5FLX E;  1WTV A;  4B08 A;  4ZKC B;  1OXU A;  4RGN A;  3NPP A;  3EQL C;  2NUC A;  3D3R A;  4HN7 A;  1QWY A;  1EY6 A;  2SEB D;  2ZXO A;  1EU3 A;  2F0E A;  3ND8 A;  2ZT9 C;  2SNS A;  5C4X B;  1EIH A;  3HOU B;  2IT1 A;  2WKC A;  3M7G A;  1XYI A;  1IW7 C;  1IW7 D;  2FIN B;  2K6A A;  1EY4 A;  1EZ6 A;  2C9O A;  2A68 D;  5C0X I;  3LWE A;  1WTP A;  2F0Q A;  3ERQ A;  3FRP B;  4IUV A;  4KHZ A;  5EPL A;  1FNW A;  1CA5 A;  2XWJ B;  1AFP A;  4RHR A;  1TWC B;  4PQX A;  4R8N A;  1PZJ D;  1HTL D;  1AZQ A;  1IL8 A;  4DA2 A;  5I6W A;  1KNA A;  3DUZ A;  5BN5 A;  3A7A B;  1TS5 A;  4C3H G;  3QB3 A;  4KJN A;  1WTQ A;  4A3G B;  3GTG B;  4KHV A;  3OWE B;  3OHX C;  3NK9 A;  1A2U A;  1YNN C;  3P7J A;  3Q6S A;  4X3T A;  1EYC A;  2B2W A;  1YNN D;  3HRZ C;  2RA4 A;  3I4L A;  2VXW A;  4J1M A;  1UUP A;  2L0C A;  4FP5 D;  3NHH A;  3RUZ A;  3GD7 A;  4IUR A;  2B2W C;  3H0G B;  5LHY 1;  4K2L A;  1U4P A;  1QB5 D;  3I91 A;  2E76 C;  1CQF A;  4OGQ C;  2J0T D;  2MJ8 A;  1ICW A;  1B44 D;  1LLR D;  3RZD B;  2FMM A;  4A3K B;  1NR4 A;  3DWA A;  5ELD A;  3D8G A;  2Z8L A;  2K05 A;  3QWN A;  2ZXR A;  1DZ1 A;  4HCE A;  4EVO A;  1B1Z A;  2EY5 A;  1NSN S;  1X3Q A;  4TQU S;  3KK7 A;  3BZD B;  4C3I G;  5C4J B;  2B39 A;  3D31 A;  2IWH A;  5JEA H;  3DM1 A;  5ELF A;  4IFD I;  1ESR A;  1F9R A;  2F03 A;  3OPO A;  2J4X A;  1FNU A;  3MHB A;  1BXT A;  4H7B A;  3TSS A;  2JEA I;  1K83 B;  2RDH A;  4UAI A;  1HUN A;  3DEP A;  5I4D A;  4OHJ A;  1CFM A;  2D9U A;  2AWN A;  3Q23 A;  4HR7 B;  1OXT A;  3X3N A;  3A8J E;  2EJG C;  5C4H A;  3OW7 A;  4KMU C;  1Y1W B;  4E6I A;  5JPN C;  4QF4 A;  3CKI B;  1QOH A;  1B53 A;  4IUQ A;  1PRT B;  4FF1 A;  1DOL A;  1PYW D;  3AU7 A;  1GUO A;  4MHE A;  1IYU A;  5M3F B;  4DAV A;  2EYM A;  1TWF B;  4FNF A;  1QJO A;  4A3E B;  2QF7 A;  4XYQ A;  1C8C A;  4FF3 A;  1M4V A;  3JAM E;  2F0V A;  4RGT A;  1GUS A;  3CU7 A;  1EIG A;  5CV9 A;  5ELC A;  3SXH A;  3SEB A;  2EYL A;  3I70 A;  3S15 B;  1KLU D;  4QIW B;  5F2D A;  2JSO A;  3S2H B;  2DY7 A;  1G91 A;  3FPP A;  1DXM A;  2K01 A;  2O5J C;  1V1P B;  2NVT B;  1Y8N B;  5IOC A;  2IL8 A;  4FF4 A;  1DON A;  2G9H D;  1KAA A;  2RSO A;  5CV7 A;  1CA6 A;  3VYU A;  1GHJ A;  3GTQ B;  1BO0 A;  2EZV A;  1SYD A;  2E2D C;  5I6Y A;  2JP1 A;  3MEH A;  3S1N B;  1PMR A;  2AQ3 B;  4RKB A;  2FMC A;  2EY2 A;  2BOS A;  5IT9 E;  4Y7N B;  5M5W B;  3LWU A;  1HA6 A;  2NWG A;  3A7L A;  3FDT A;  3TME A;  4RCO A;  3FKI B;  5EPJ A;  1IKM A;  5HUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...