1F2MA

Simplification of a protein loop in staphylococcal nuclease
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYAYAPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Simplification of a Protein Loop in Staphylococcal Nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f2mA00
2SNSA 4G57A 2PZTA 4PNYA 5DEHA 3OMGA 3QB3A 3TP8A 2EYHA 2PYKA 1SNMA 2PZWA 1SYBA 3SK6A 3TMEA 1EY7A 1SNQA 4K8IA 1SYEA 4EQPA 2RKSA 1F2YA 1ENCA 1STNA 2F0EA 3ITPA 4B9XA 1JORA 3MEHA 1TT2A 4RKLA 4KHVA 4I65A 1EZ8A 2LKVA 1SYDA 4K5WA 2F0VA 2F0SA 5JAVA 3EJIA 5K5PA 2EY1A 5EKLA 5KRUA 2EY2A 3TP5A 5J39A 1JOOA 4K5XA 1SNOA 1SNCA 2SNMA 4K6DA 3V2TA 3BDCA 2RDFA 2F3WA 3T16A 3T13A 3R3OA 1EY4A 3C1FA 1IHZA 3TP6A 4DGZA 5IGGA 1U9RA 3NP8A 5C3XA 1A2UA 2F0QA 4EQNA 3P75A 1STBA 3SR1A 2RBMA 3SHLA 3H6MA 3NK9A 3SK4A 2F0IA 4PMCA 3P1HA 3SXHA 4LAAA 1JOQA 3EROA 1A3TA 4K2LA 4N9TA 4NKLA 4DFAA 3DHQA 1NUCA 3OSOA 2F0GA 1SYCA 2EYLA 5EKKA 4HMJA 4OL7A 4TRDA 4ZUJA 5C4ZA 4J1MA 2EY6A 1SYGA 4EQOA 1F2MA 5IGEA 3VA5A 3NQTA 4B9WA 1STAA 2EYPA 1ENAA 3MHBA 5F2DA 2WACA 3D6CA 3PMFA 2F0OA 1KDCA 3S9WA 4ME5A 4YIJA 5CGKA 2KHSA 4WORA 5C6AA 4IALA 5ISRA 4HMIA 5CV9A 3NUCA 2PQEA 3TP7A 1STYA 1KABA 5IGCA 1II3A 5CR3A 5J22A 2SOBA 4WRDA 4KJNA 1F2ZA 5J1ZA 4QF4A 3SK5A 5KYLA 2F0LA 5M9OA 3NXWA 2F0FA 5IIFA 4K8JA 1EY5A 4N9PA 3MVVA 3HEJA 1STHA 2EYJA 2HQEA 5C4HA 4J6HA 4KJOA 2O4XA 2OXPA 1TR5A 2F0MA 1JOKA 2KQ3A 1KDAA 4HTHA 2OEOA 3C1EA 4KY6A 3D4DA 1SYFA 4KY5A 2QDBA 3DMUA 3EVQA 5E1FA 3RUZA 1EY8A 4MIUA 4F7XA 1EYCA 4H7BA 2NUCA 3HZXA 5HURA 5I6WA 5I6YA 2PW5A 5KYIA 1EY0A 5JOBA 3OMCA 5C5MA 4K2KA 5IGFA 5E3FA 4PMBA 1EY9A 2PW7A 4R8NA 1EQVA 3D4WA 3OWFA 3MXPA 4ID6A 5DAUA 5CC4A 5NUCA 4ZUIA 2EYOA 2OF1A 4KD4A 1TQOA 1KDBA 1RKNA 2ENBA 3LX0A 2F0KA 4KY7A 1NSNS 4NDXA 1EYDA 4NMZA 5IOCA 2EY5A 5IODA 5KEEA 4KTAA 3MZ5A 1SNDA 1STGA 3E5SA 1A3VA 2EYMA 5CV7A 2EYFA 2F0UA 1KAAA 3D8GA 2F0JA 5HGTA 4K14A 5I9PA 5EGTA 5CV8A 4EVOA 4IUNA 2EXZA 5IGBA 2F0NA 1A2TA 2F0DA 2M00A 1EZ6A 2F0PA 4E6IA 2PZUA 3U9OA 1EY6A 4NP5A 5KGUA 1SNPA 3ERQA 4F8MA 3QOLA 4DF7A 4KD3A 4DU9A 2F0TA 4K5VA 4ZQ3A 4RKBA 2F0HA 4S3SA 3QOJA 1A3UA 3NHHA 5I9OA 5CV4A 5CV5A 4IZ8A 1EYAA 5C5LA 5CV6A 5C3WA 4ODGA 4KV6A 4QB4A 2F3VA 5KIXA 4QMGA 3BDLA 1AEXA 2F0WA 5IGDA 3SK8A
chains in the Genus database with same CATH superfamily
1JE5A 4FF4A 2PZTA 4PNYA 5DEHA 3S24A 1L0YB 1D5XC 1YJNA 5FLMG 3S17H 4BXXH 4A3FH 1IYUA 2RHSB 4BBRG 5FJ8G 2TMPA 5A2QL 3R2IA 4M8AA 3L2PA 1K9MC 4RWSC 5K5PA 1EU4A 2EY2A 4A93H 4BY1G 1VQOA 2JA6B 3J80c 1CSPA 1EY4A 2X6LA 4XT3B 2RDGA 2F0QA 5LMUL 3HOZH 4C3JG 1GXDC 4P71A 3EROA 4BS9A 2Z6KC 3T51B 4NB3A 4EQ5A 5GAHC 5C4XH 5IGEA 2UUAL 4J1MA 3AYHB 5IWAQ 3A7AB 4B9WA 4CBVA 4HSVA 4JI5L 3AEVA 2N88A 1EU3A 1PTOF 5ELBA 4CJ0B 4ME5A 3J7AF 1HHVA 1YNND 1VQ6A 5EBCA 1STYA 5DNFA 3TS2A 1PDQA 2M2LA 1AP0A 3K80C 1GUSA 2Q8TA 5LMNW 2E75C 3U58A 4IURA 4A3LG 1JOKA 3C1EA 1B1ZA 3FRPB 3J81c 4A3DH 1NCVA 1CI3M 2O5IC 1XX8A 2B2TA 1Y69U 1BQQT 4MTNA 1IXRA 2XN9C 3NE5B 4ZK9B 4HIDA 2AMCB 1UEBA 3D4WA 3QR8A 2RVLA 2XRSD 5FKAC 4C3HB 1LTGD 3H0GG 2JN4A 5C44G 4WJ3M 1VQBA 4A3CG 3PIPA 4DR3L 2A1AA 1ASYA 3NELA 3M3YB 4IPGA 1E2WA 4KKSA 4IPCA 1BCPB 5C4JB 4OXPA 1CSQA 2K14A 2F0PA 3T1YL 2V4DA 1TWHH 3U9OA 4NP5A 3EIVA 1S72A 1G6PA 1WYDA 5KNCA 2IHEA 2RSOA 1SFOH 5M3FH 1X6OA 2DJGC 1QVFA 4QB4A 3H09A 3BDLA 1TWAH 4PV1C 2ZJPA 2QDLA 3HOYG 3H3VH 3CQZB 4RH6A 3ITPA 3MEHA 1X3QA 2YTYA 1Q1BA 4BXXG 4ME3A 1HZAA 4DK1A 1CK1A 5CYUA 2NVYH 3PO3B 1A63A 1G51A 1MSGA 3KOJA 4FF2A 4NXNQ 1LTID 3C2PA 4GNXC 4Q5VA 4XTCS 1SMYD 3EBEA 2K32A 3FKIB 4TRDA 5E4WC 4GKJQ 3ULPA 3FMCA 3D6CA 3NSWA 5C4XG 2VQFL 1WCMG 3FEWX 4HIOA 1PLFA 4JV5Q 2UXCL 4GKKQ 4FO2A 4QQBX 2ZM6L 3ICEA 3KLSA 1VQGA 1J8IA 4G7HC 2PPBC 1BCPC 1YBYA 2F0LA 5IIFA 1N34L 4JI2L 4ZKCB 4JI7L 1YITA 2VB2X 1KQSA 1GHKA 5FLXc 1D5ZC 1KTKA 1QCBD 4OONA 3EN2A 3STBC 4BY1B 4KKTA 1SYFA 3CMEA 3EVQA 2K5NA 1DOKA 1J6QA 2WFWA 1KLGD 3D4RA 4C3JB 5C5MA 5IGFA 1P16A 2BH8A 1ENFA 4IUVA 4GZYC 1XWEA 2E5LQ 2A69C 1CZGA 4O1NA 1XNRQ 2Z0SA 2B2VA 5JVH3 4H0LC 4OIJA 4RMFA 3KYHC 1OXTA 2MO1A 1Q46A 5EGTA 3S1MH 4AQYQ 4GN4B 3IFDA 3HS0C 5KNBA 4XT1B 2PZUA 2WAQG 1BVSA 1N9WA 4XXEA 1SNPA 5GADC 1VQAA 1TVXA 4DF7A 2BDNA 1NMGA 3CPFA 2UXDQ 3NHHA 4FDBA 4JI6L 5C5LA 1LTSD 5BN3A 3I56A 2R93B 2WAQE 1WTXA 2I46A 1EUJA 1SROA 2F1MA 3QWNA 4B3MQ 2CHBD 1RIPA 3Q0AA 1IYJB 2N49A 2EJFC 2A68D 1JORA 4J15A 1PYWD 1KL9A 1P8LA 1EZ8A 2F0SA 1YZ6A 1MKHA 3R2TA 2K75A 3S9WA 4DV5L 1VQ9A 4R4CA 1IHZA 4A75A 1K83H 4B3RL 4GLXA 3BDOA 4JYAL 3SK4A 2KHJA 4LAAA 3HP3A 2I5LX 5KNDA 3K58A 1DYQA 3TQYA 1OXSC 4UP7A 1BR9A 1DJRD 1WD1A 1NJIC 4PQXA 1B8AA 1Y1VH 1FNWA 2H1EA 2UU9Q 4IJLA 3H91A 3S14H 1NR2A 3TS0A 3MXNB 1HQRD 2PO4A 2F4IA 5LHY1 2BH2A 4IUQA 5M9OA 2L1BA 3ONAB 4DR2L 2DN8A 1DGSA 4N9PA 4OWXB 3S17B 5M5YH 3OOCA 4A3FB 2OQKA 4IUPA 4RA8A 4R4QA 1XMOQ 1PH1A 4JI1Q 4DV2Q 3MXGA 4A93B 2PW5A 4RGNA 4QCLA 1EY0A 1YHBA 3OIPA 3I55A 2HD3A 3PGZA 3CPWA 1RJTA 1EY9A 3KDFB 2JYOA 3M7GA 1DXMA 4B08A 1HUNA 1OTCA 3HOZB 4A3JH 2BA0A 5IOCA 5KEEA 3RR5A 3ND9A 1L2FA 2FJ2A 4M1UB 2UXBL 2A6HD 1SNDA 2XWBB 5C4XB 4GOPC 1V1PB 1Q1EA 3GTQH 1XXGA 4JI3Q 4DR6L 1A2TA 3KBGA 2R92H 1YHAA 4UHVA 1HTLD 4LFCL 4F8MA 3HOVH 4GLAC 1Q81C 3C3LA 1WFQA 4IN3A 5C3WA 3F2DA 4IFDI 1AEXA 3ND8A 3I4MH 4DXGA 4DR4L 2PZWA 2ZJQA 4A3DB 1K8AC 1EY7A 1SNQA 5M5WH 1VQJA 4R4OA 3EFXD 2JA8H 4DNRB 5I2YA 2Q8IB 5D65A 3JAML 1HXYD 1YNJC 2NVXH 1SNOA 4LNQA 5IYBH 4B3SQ 4LFAQ 4LF7L 2K03A 1TS5A 3E0JA 4EQNA 4PMCA 1LO5D 4A3BG 2WAQB 4OX9Q 1I6HH 2NVQH 1UAPA 1SRUA 2ASBA 2Q2IA 4CKEA 1NTGA 1TWHB 4WJWA 1BCPF 3RLOA 2WACA 4A3GH 3GTKH 2MO0A 1SFOB 5M3FB 1GOZA 2VUMH 1TS3A 2JJQA 1G2TA 1JJGA 2ZT9C 3PUWA 1VQLA 2KCNA 2K05A 1Y1VG 2FMCA 2L55A 1TWAB 3M9BA 4JI0L 1OXUA 4WRDA 1HNXQ 1VMPA 3ZYYX 2B2YA 2BE5C 3OHXC 4DAVA 4DV4L 5J3BA 2IX0A 1VQ7A 5ELFA 3NBHA 4NXMQ 5A2QE 4K0KQ 3UE0A 3DMUA 4XYOA 5E1FA 1XPUA 3M4OH 4MIUA 4LF8Q 5DLQE 4LUOA 1MJEA 1Q90A 1EOVA 2NVYB 1QUQB 1VQCA 2KCTA 4Y7NH 1VQFA 1CKNB 3S2HH 3E0EA 1CQVA 1U5KA 1I4GA 1GUWA 1HA5A 4A3EG 1TQOA 2L9HA 4KHPL 3I7FA 2BA1A 2ZTDA 1D6EC 1I94Q 4QUFA 3CC7A 2H5XA 4JOIC 2WV6D 2LXKA 5I9PA 3M4QA 3BZCA 5LMUQ 3OTOL 4JBWA 4IFDH 3A5ZB 3J7YW 4RG1A 1H9SB 1S3OA 2B2WA 2MPMA 4DU9A 1PYSB 4F88A 4HJ5A 1LABA 4S3SA 1WTOA 1Q8KA 4ODGA 3BVZA 1EWHA 5KIXA 4A3IH 4RCNA 4JI5Q 3HOVG 1L1OA 4CJ1B 1T5XD 2JA5H 4UAIA 4PMWA 3TP8A 4IOAA 1EIHA 1VQNA 1D7QA 3KBXA 3HKZB 3GO5A 4KHVA 4X64L 3K7UC 4P72A 4AIMA 3Q6SA 3K5OA 3TSSA 1OXVA 4L5QA 3P20A 3VR4A 1TY0A 4B3TQ 3K7AH 3OYYA 5J39A 1JOOA 2UUCQ 3H3VC 5IGGA 4BA2I 5EPKA 3AFPA 5BN5A 1DONA 3AQQA 2RBMA 1X3FA 3FVQA 3GTPH 1DOLA 1SJED 2KA7A 2Z4IA 3S1MB 4DAYB 3AB9A 4FXDA 3IL8A 3I91A 4KK7A 2E2JH 4HIMA 1C48A 3PUYA 3O13A 2VNUD 5CGKA 3J7ZC 2JE6I 1HR0W 5CV9A 1S5CD 3TP7A 2QEXA 1YJWA 1ML0D 1A6XA 1GUTA 5JEAH 3KF6B 3S1NH 2RDHA 4QF4A 1GVPA 1X32A 2YYZA 1M4VA 4ILWA 3CRKC 3SE0A 4C3HG 1SDFA 1PRTD 2HCCA 1CA5A 2AHOB 4QY7A 2HHHL 2L12A 2PCFB 2Z1CA 3I8ZA 5E3FA 2Z6KA 4QUCA 1EQVA 1K83B 1K0SA 5JPMC 1CT1D 3FHWA 4NMZA 4Q0FA 5G3LF 1S5DD 4OO1I 4IUTA 3MZ5A 5AJ3Q 3KF8A 1CFMA 2B63H 2F0UA 1Q8IA 3PO2H 4DV3Q 2QILA 3J81i 4HCEA 4IUNA 1D5MC 3Q8DA 1PHJA 1Y1VB 3S14B 5H1SE 3NTHA 3MFGA 3TEHB 1JR0D 2VW9A 3QOJA 3F2CA 4IFDG 4DKAC 4P2CB 4LF5Q 4DUYQ 4WJ4A 1ICWA 5IYDG 3HKSA 1WTVA 2JA7H 5M5YB 3OW7A 4JCVE 2VQFQ 1HQMC 1SSOA 4ALPA 1HPCA 1K3BC 1SEBD 1O7YA 4JI8Q 2BCOA 3W1BA 2ZM6Q 1F2YA 5FO9B 1KNAA 2HUGA 4RKLA 1CHQD 2B2UC 1HNZL 1PVOA 2K04A 1E1TA 4HSPA 2VY3A 4DV7L 3I4NH 1YNNC 2G5DA 2NN6G 5KYLA 1WD0A 4A3JB 3CP0A 2RDFA 3WWVA 1D1KA 1DCZA 1R4PB 1BUVT 1E1OA 1JICA 4PZ7A 1A15A 2F0IA 4V0BA 4DFAA 3GTQB 5C0XG 1NE3A 2IW3A 2RCNA 3NQIA 2R92B 3EQLC 1U4MA 4LFBQ 5F2DA 3E9IA 3UDFA 1BNZA 3HOVB 1E3PA 2DY7A 1H9JA 3H3VI 4CDDC 1CTMA 2J4XA 1VQMA 3DM3A 1JMCA 3HFZB 3I4MB 4N8X1 1VCIA 2V1CC 4X66Q 5LMNL 4DAMA 2QGQA 1SBBB 1UEAB 5IYCG 3I90A 3HEJA 1FR3A 3TN2A 1X56A 4GN5A 5M5WB 4JI6Q 1C4QA 1KHIA 4DNIA 5JEAG 2JA8B 1Z7TA 3BYYB 3RMHA 5IP9H 2KHIA 1V8QA 1QOHA 2ICIA 3HOWH 1CZWA 2CH4A 1C0AA 4OO1H 2NVXB 4YHHL 3I4LA 1BXTA 1MSHA 1UNSA 2VQEQ 1JT8A 2L15A 3QG1A 4FXKC 5FK9C 1NSNS 1R4QB 1I6HB 2NVQB 4H44C 4A3MH 4RGOS 4ZAIA 1TWCH 2N3SA 3G6JB 2EPBA 1D8LA 3E5SA 5CV7A 3RD4A 3TREA 5HGTA 1H95A 4EVOA 4A3GB 1SAPA 4B3RQ 2R93G 2AWNA 3GTKB 5DM73 4BWGB 4GNXB 4GLVB 4POFA 2VUMB 2D5DA 3M7NA 2NTTA 2KUMA 1HZBA 2UUBQ 2K7VA 4XYQA 1PH9A 4R9WA 2K01A 2I5HA 1XYIA 1MI2A 4HAEA 1IL8A 4BBSH 1PMRA 3SK8A 1FNVA 2ZXOA 1FJGQ 1SMYC 1XNQL 1SYBA 2CWAA 3M4OB 4RHSA 1YJ9A 4X62L 3RZDH 1I3QH 4YCVA 3A5UA 1N32Q 1WTHA 4DR1L 4Y7NB 4DR2Q 3S2HB 3J80L 5A35A 2PI2A 1YHQA 2EQSA 4MZ9A 2SNMA 1D2BA 4QL5A 5HGQA 3M4YA 1STBA 2XWJB 3K57A 1VS0A 3H6MA 2KVMA 3NK9A 3SXHA 3T1HL 1IKMA 4DR5L 4K2LA 4NKLA 3IKJA 3Q23A 3QJYA 3DHQA 2EOTA 5EKKA 1N33L 1BO0A 1D1IA 4HMJA 1LTBD 4HJ7A 1AE2A 3PUZA 1TIID 2IX1A 1UE6A 2OTJA 4A3FG 5JVG3 1TS4A 4LF6L 4DR7L 1Y14B 4HMIA 4A3IB 1KABA 1YI2A 1TXYA 1BBUA 2JA5B 4A93G 1JJ2A 3BVMA 1QZGA 3I70A 1I5FA 4KJOA 2OXPA 4HTHA 1TR5A 5D14A 1KDAA 2D2CC 4OWWB 1HNWQ 3HOZG 2D9UA 2QDBA 3GTMH 2N78A 3JAME 2KCMA 1W6KA 3S15H 4A3KH 1PFNA 3K7AB 3HGBA 1ZKOA 2R3ZA 1M90C 1HZCA 2B8GA 3OWFA 3I2ZA 1VQPA 4ZUIA 2EYOA 4A76A 4RGMA 1IBKL 2E2IH 1E0BA 3GTPB 1EYDA 3F1ZA 3TDQA 2A8VA 2EYMA 1KAAA 3J7AV 3K6OA 2F0JA 2E2JB 2A68C 4A3MG 3A54A 1RTOA 5I2XA 3LGJA 3K5NA 3DWAA 1AZQA 5KGUA 1LLRD 4TSSA 4DV0L 3FPUB 4A3DG 5BN4A 1FGBD 2Z8LA 4F87A 4HEDA 5CV6A 4YY3L 3FP9A 3S1NB 3E6ZX 2B2TC 4LF9Q 2EYHA 2PYKA 1SNMA 2K5DA 1GUOA 4BBSG 1ENCA 3DEPA 1LT5D 3Q24A 4FYDA 2E8GA 2I5MX 1XTCD 3SEBA 5IT9L 3CCLA 5T1GA 3G4SA 3V2TA 2EXDA 1J9OA 4O0AA 3VYTA 2ALYB 5CORA 2DNEA 1U9RA 2MUYA 1B9NA 1ESRA 4CKBA 4DK6C 1RHPA 2B63B 3MC0B 2MFIA 3PO2B 5M3FG 4CHTB 1U0LA 1PH7A 1L0WA 1EIGA 4X3UA 1NUCA 2MQHA 5I4DA 2JP1A 1JB3A 4EQOA 3WOEA 1HFNA 1CQFA 1L0XB 4GOPB 4HN7A 2K5WA 2FXQA 4BA1I 1LACA 2PQAB 4TKOB 1ZYRD 3NUCA 3E9HA 2JA7B 4AH6A 3MXNA 1PYBA 5IWAL 1XMQL 4ULLA 1F2ZA 2HQLA 3R93A 5FLXL 1WTWA 1G2SA 2A6HC 2F0FA 3WDNA 4K8JA 2EJMA 1GD7A 1V1OA 5C4HA 2B8FA 2O4XA 3UDGA 1K8OA 1VQIA 2D62A 4C2MH 1PA6A 5HURA 3I4NB 2R6GA 1SE8A 4IQZA 4MNOA 4X65Q 2ES2A 4PG3A 1EIFA 1F9PA 3L9AX 3MWYW 4R8NA 1JC7A 4C56C 3D6WA 3MXPA 3URYA 3GTJH 4KD4A 4L63B 2XSCA 3KDFA 1UE1A 2QW7A 3UDXA 3VYSA 3J81j 2QEJC 3L3OC 3TZDA 2MJ8A 5EKIA 1EEID 5CV8A 4AYBB 1J5EQ 1V1PA 2JEBI 3SVMA 1VQHA 3T4AC 2DNCA 1AZPA 4KD3A 2PNHA 4P75A 3PUVA 5CV4A 5JJZA 1IKLA 3GV3A 4L8JA 4JK1C 5C0XJ 3HKZG 5M3MH 3GTOH 2CQAA 2F3VA 4Z9CB 4C3IH 1ZEQX 1B3AA 3DUZA 4RFBA 1B3QA 3CAMA 1NBWA 2JXMB 2RCFA 1F9SA 3HKZE 2A6ED 1STNA 3HOWB 1S5BD 1RL2A 1GO3E 1EFWA 1SYDA 4K5WA 1G91A 3QO2A 3K59A 2CWPA 1YNXA 1SNCA 1K8GA 1WI5A 4LK1C 3W2DA 1WTPA 1X55A 2HHHQ 4A3MB 1TWCB 2SEBD 4OELB 4RAUC 3VR6A 2YU9H 1LT3D 3D31A 2WINB 3OPOA 1MJCA 2QKIC 3TZUA 1JOQA 3W3AA 4MHEA 1EYGA 2JA9A 3I73A 2EYLA 5C4ZA 2EY6A 1IBLQ 3GQBA 3MHBA 1VDZA 4NXNL 2X69A 1O7ZA 4LF4L 2EJGC 4WORA 1JQYD 2XTIA 1PFBA 2A19A 1W2BA 4GKJL 4BBSB 2CW0C 4G7OC 4LUZA 1PH2A 4BY7H 3S2DH 3I3CA 1EY5A 5JJKA 3ERSX 3RZDB 1RF2D 4J6HA 2C5CA 1I3QB 5IP7H 3M85A 1H9KA 2F0MA 1DZ1A 3S16H 5I6YA 1SLJA 2K28A 1C8CA 3KLRA 1IBML 4H7BA 2NUCA 2F4VQ 1F9QA 2QF7A 1IW7D 1QNUA 3CMAA 2Q2UA 2K4KA 1KRTA 1Z9FA 4OIKA 1PRTB 4G4KA 4H13C 4DUZQ 3SDZA 1QUQA 3U50C 2IT1A 3MTSA 3KJOA 1CKNA 1W3SA 1DM0B 1Z6HA 3ER0A 3BVGA 1U4PA 4DV7Q 1B70B 1LV9A 2C35B 3D3RA 1X9NA 3CCVA 1PFSA 1QE6A 1QJOA 2B3GA 3PV0A 2E5LL 1S5FD 1H9MA 1ASZA 1BKBA 1XNRL 4E6IA 3G71A 3DM1A 4PZ6A 1N36Q 1GJXA 4RGTA 4JBJA 2F0TA 1N8RC 3CCEA 4A4IA 2VZAA 4MTKA 1H9SA 4OWTB 5L37A 1EOTA 4LW1A 5D3IB 1NAPA 1ESFA 1LM0A 1LTAD 3A8IE 1PH4A 3GP7A 1B9MA 4KN4C 1BBXC 5M3MG 3GTLH 4A3JG 3GTMB 2UXDL 4K8IA 1SYEA 1STEA 2EE1A 4RHRA 4EQPA 3S15B 1FL0A 2F0EA 4A3KB 1RD9D 1B7YB 1UE7A 4B3ML 3HOXH 5C3EH 2OT2A 1GKHA 1SN8A 4K5XA 2E2IB 3BDCA 2CFMA 2F3WA 4UP8A 5D3DA 3R3OA 2R92G 2UUAQ 1I50H 3M4PA 2ZTEA 4NW2A 2AUJD 4KHZA 4YHHQ 2WP8J 4R8IA 1A3TA 4IO9A 1JWMD 1SR3A 1SYCA 3H15A 4OL7A 1PRTC 5GAGC 4DAYA 3I4MG 2KJXA 1TY2A 1G6ZA 1I4QA 1Q7YC 5M5XH 1HR0L 5ELCA 4HR7B 1LT6D 1PXUA 4IALA 2JA8G 1B44D 2HIVA 2MNAA 3F8TA 1UUPA 2QCPX 3PCOB 2I0QA 5CBAE 2FHTA 5IYBG 2UU9L 3KF6A 3VYUA 2EYJA 2ICEC 4BY7G 1JCKB 4RCOA 3D4DA 3AU7A 4POGA 4JVZA 2YTXA 3PQIA 1T9HA 3J80E 5IP7G 4DR3Q 2K5QA 1BBWA 2PW7A 3A56A 4HJAA 2K6AA 2PNRC 3GD7A 1L1OB 1ET6A 2LFNA 1EFID 4A3GG 1GUNA 2OWOA 1RKNA 4KY7A 5FLMH 3T1YQ 1XMOL 1X54A 3F2UA 2CQOA 4YWKA 2VUMG 5FJ8H 4BBRH 3EA6A 1QB5D 2EYFA 5EPJA 1PTOD 4L6TB 2L5TA 4U68A 2BOSA 4JG2A 1TWGH 1G8ZD 2GN5A 4X3KA 5E4XA 5ELNA 3CF5A 2RA4A 4L5TA 3T1HQ 1EY6A 1H9RA 4QJFA 1LUZA 3PF4A 1DOMA 1GHJA 5EQ0A 4KMUC 3S1RH 2B29A 5TSSA 2G9DA 4JI3L 3KFUA 2L0CA 2YV5A 2LMCB 3OMGA 1PZKD 1LT4D 1Q82C 3J7A5 2WKDA 4C2MB 3MFYA 2VB3X 3IRBA 1HRJA 3HOUH 2K5HA 2XVSA 1O7LA 4O2DA 4FP5D 3GTJB 3K0XA 4YWLA 1X65A 4UP9A 3HOXG 3A8JE 5C3XA 1U4RA 4CDFC 3P75A 2KENA 1IZ6A 3MXUA 4LUVA 4IOCA 3CCUA 2UXCQ 4HJ8A 2B2WC 1SE3A 2WB1B 3CC2A 1PH3A 2WIIB 4A3IG 1QWYA 1IBKQ 4LFAL 1QG7A 4J8QA 2JA5G 5ELDA 1STAA 2EYPA 2H4OA 1L1OC 4ZRZA 1O7IA 3H0GH 4JI2Q 1N34Q 4JI7Q 5C44H 3UE1A 4OX9L 5BR8L 4A3CH 4XIGS 1GUGA 5M3MB 3GTOB 3RN2A 2A74C 1LTLA 4C3IB 2OTLA 1ET9A 5CR3A 3TRZA 1A0IA 4APVA 5J22A 3OWEB 3CCSA 1X3PA 2F52A 4DV0Q 3LWEA 1HFGA 3CU7A 4V190 1Y8NB 4KY6A 4YY3Q 5JJIA 1XPOA 2NVTH 1HJPA 1F2LA 1C7YA 2IJ0A 4F7XA 1HNXL 2NB0A 4H02A 4CDEC 5IT9E 2AWOA 2IX3A 5LL6S 3V96A 3OMCA 4OGQC 2KEEA 2R7FA 4NXML 2O5JC 1RDPD 2IL8A 1KDBA 4R1JA 3VR2A 2YU9B 3HOYH 1KNEA 4LF8L 2EY5A 1VQKA 1PZJD 4CJ2C 4FXGC 3S1QH 2NWGA 2A5HA 1E22A 1Y1WH 1V43A 1WJJA 1EEFD 2EXZA 5GQOA 3MAQA 1Q12A 1TU2B 2M9VA 5CBEE 3CCJA 5HY6A 3CKIB 1Z47A 4GNXA 1I94L 4QIWB 1ONLA 3BU2A 3RZOH 4BY7B 3S2DB 4KV6A 5FLXE 1AFPA 2IPKD 4XQNA 2R7ZH 2N55A 3NTKA 3P1HA 1HCZA 1EL0A 4EGVA 2MHVA 3S16B 2K1BA 4DV5Q 4HJ9A 2LSSA 1WCMH 1JWUD 2FMMA 2HIXA 2K5VA 1XMQQ 4JBKA 1TKWB 1MBYA 2B63G 4JYAQ 1B4OA 3DWPA 3EJIA 3PF5A 3PO2G 3UDIA 2EY1A 2IWHA 2J0TD 3A0JA 3L7ZC 1PRTF 4K6DA 3NPPA 1MD2D 3HOUG 2WKCA 4DV6L 4FF3A 3TP6A 1EIYB 1TS2A 1CA6A 4ZYSA 3SHLA 3X3NA 4N9TA 4B3TL 2SDFA 1RODA 2UUCL 2VS1A 2Y0SB 3NEMA 2A73B 4ZUJA 2JA7G 2GVAA 4NPSA 1SYGA 1F2MA 3GTGH 3KJPA 3JC66 1VQ8A 1KDCA 2K50A 1WVLA 1PTOH 1S4ZA 1BOSA 4C1NI 1K73C 3CRLC 2RHQB 1II3A 3I4NG 1K0RA 3GTLB 1JE4A 2L4NA 2AUKA 2KBNA 5EBDA 5COYA 4ZKBB 1E24A 5EJWA 2EVBA 3HOXB 3NBIA 5C3EB 3A7LA 2UXBQ 4K2KA 1I50B 2ATWA 1KAWA 4AYBG 2E74C 2O2LD 4DA2A 4DR6Q 3LX0A 4CKCA 1MHWC 2RF4A 4LFCQ 1TWFH 2D0OA 5JPNC 3W5OA 4AYBE 2I07B 2Z9HA 2VXWA 3D8GA 3J81L 5IGBA 5M5XB 1Y1WG 1JB7A 4DR4Q 3ERQA 1R9TH 5AJ3L 5IP9G 1XJVA 5IT9c 4DV3L 3UI2A 3HOWG 1EYAA 3KLSX 1MGSA 1IYVA 4OO1G 2TSSA 3CHBD 3Q22A 4QMGA 3V05A 3K5LA 1LYLA 2N8NA 3F2BA 4LF4Q 2SNSA 3QB3A 1ICFB 1QZHA 4UPAA 2R7ZG 3SK6A 3TMEA 2RKSA 4IUUA 4LF7Q 4LF5L 4DUYL 2DGYA 1W6JA 2CH4W 1F77A 1T5EA 1KXLA 3JAMi 3OW2A 2HCIA 4P74A 4JI8L 1ZYRC 2E2HH 1AN8A 3T13A 3C1FA 2MGSA 1IBMQ 3K0YA 2E76C 4BBRB 3CXCA 1I4RA 4JI4L 3SR1A 4DV1L 3A55A 3L0OA 1NNXA 1HA6A 1TWGB 3K8AA 2F0GA 3DXJC 3NENA 1PFMA 4JI0Q 3VA5A 3AFQA 4CDCC 4YCWA 3K5MA 1E2ZA 2KCCA 2F0OA 3KLWA 4DV4Q 3S1RB 1DD2A 2KHSA 5C6AA 4GOPA 1C9OA 5ISRA 3CCRA 4LFBL 2NYZD 2PQAA 4C1NK 2SOBA 4YCUA 4KJNA 2JK8A 3VYRA 3LWUA 2HQEA 1FD7D 5KRUA 3RLFA 2LS01 2OEOA 4KHPQ 3HOUB 3T53B 3PIO3 3C46A 5EPLA 1E2VA 3HG9A 4X66L 4LWCA 3U9SA 3DLLA 2HDLA 1JJCB 1OO9B 4TVAB 3SGIA 5DAUA 1LTRD 2AQ2B 2ZXPA 2QA4A 3OTOQ 2NTSA 1BCPD 4KTAA 2R61A 1K28A 2RSNA 4K6LA 3RLNA 2A6EC 1WTQA 2VQEL 1PV4A 4O42A 1ZXTA 3STBD 4Y52H 2J7ZA 1S5ED 3H0GB 2F0NA 2F0DA 5FO8B 5C44B 2NBFA 4IFDJ 1I6VC 2XRQD 5IE8A 2ZTCA 3N52A 2NZHA 3QIAA 3QOLA 4R4TA 2IHFA 2K52A 2LXJA 3VR5A 4RKBA 1MIUA 2KOLA 4A3BH 4A3KG 1A8VA 4X64Q 2A69D 4KKUA 4L5RC 4G7ZC 2F0WA 4X3SA 1HR0Q 4L5SA 2XGTA 1PH8A 2NVTB 1KIXA 2UUBL 1B2TA 1CUKA 3BG3A 2KECA 4B9XA 3U4VA 2ZXRA 3MEFA 3NWTA 3KUPA 5JAVA 1YVCA 4MN3A 1VQ5A 5EKLA 2BDOA 3CC4A 1FJGL 3JAMc 3ULLA 3HOYB 3T16A 3NWSA 4X3TA 5E7NA 4EX5A 4DGZA 1CKOA 1N32L 1A2UA 3S1QB 1M1KC 1XTDA 3GV6A 1Y1WB 1KLUD 4P73A 3AMUA 1I4HA 1G291 2B39A 1ILQA 2JSOA 5LL6X 3PIP3 1IW7C 4A3EH 2AKWB 2DJFC 3PMFA 4HCSA 2B2VC 4IPHA 1FNUA 1EWCA 3RZOB 3GDEA 1SJHD 4JOIA 2ZJRA 2F03A 1QVGA 3FDTA 2R7ZB 2D0PA 1BF4A 4LMQD 1CKMA 1NMFA 5JEAJ 2HDMA 3NXWA 1NR4A 4DN4M 1WCMB 1SE2A 3ZJYC 2NZOA 5DM63 1O80A 2DUDA 2KQ3A 3IFTA 4KY5A 3BYTB 3RUZA 4X6AH 2Q2TA 5FOBB 5KYIA 1A62A 1BDOA 2CVRA 3CCQA 3X3MA 5JOBA 4PMBA 1AH9A 5K36H 1HH2P 4ID6A 5NUCA 2OF1A 1HNWL 3NTIA 3R8BA 2JA6H 4HIKA 4NDXA 4FF1A 3G48A 1A3VA 4JV5L 4XQJA 4GKKL 3GTGB 3ULJA 5GAEC 2M00A 3IAYA 2PMZE 1PTOB 1VQEA 3HRZC 4R4IA 2NZ1D 2RQXA 3G7LA 1VQ4A 2F0HA 4DXFA 2GA4B 1A3UA 4I7ZC 2NN6I 1NY4A 2YTVA 4ZCKA 2AQ1B 2CCZA 5GROA 1Q86C 1YIJA 4XDXA 4TQUS 1HNZQ 2C9OA 2P5ZX 5BR8Q 4I7AA 1V9PA 1WTRA 1F9RA 2IY5B 2OQ0A 5C0XI 1KD1C 4KN7C 4UY8C 2XIWA 3BJUA 4JW0A 2F0VA 1X3GA 2E2DC 5G3LD 4LF9L 1HTPA 2KEDA 2WB1G 1WOCA 4LJZC 2MP1A 1FYCA 2K33A 5CMDA 1ILPA 3VDYA 4ABNA 1SXTA 1RCVD 3A8KE 3NP8A 1TWFB 4AQYL 4C3HH 3FPPA 3G6EA 2WB1E 2EZVA 4FVMA 3WOFA 1PZID 2Z4HA 3OSOA 3M3YH 3U4ZA 5IY0A 4U673 2FINB 4C3IG 1PH5A 5LMNQ 3NQTA 1R9TB 5EAYA 5C4JH 1UWVA 2VL6A 3P7JA 4OHJA 4JBMA 1YNJD 2FFKB 2PQEA 3VR3A 5IGCA 2CW0D 3N6RA 4DNTB 4DK0A 3MVVA 3NBHB 1STHA 1PTOC 2Q8RE 3OIQA 1B50A 3CQZH 1EYCA 5I6WA 3DWQA 2E2HB 5IYDH 2JEAI 1V1QA 2ENBA 3PO3H 2F0KA 5IODA 1SMXA 1EWIA 1QNKA 2B2UA 5K36G 1K3RA 2BE5D 4X65L 3E3XA 3CCMA 3MA2B 1STGA 2XNAC 2JA6G 1RTNA 4DV6Q 1M8AA 1KC8C 2NN6H 4PZ8A 3FKIH 2Q2HA 4DAPA 2OCEA 3W1GA 1VF7A 2G9HD 4QIWE 4OEMB 5ELOA 4CGYB 4K5VA 4KLKA 1GM5A 1XNQQ 4GS3A 1Y8PB 5CV5A 4IZ8A 1FGUA 4X62Q 5C0XH 4WFN3 5ELEA 3H94A 1J5EL 4DR1Q 4JI1L 4DV2L 4G57A 3B6YA 3A74A 1LTTD 1HZ9A 3TBIB 4IJHA 2DY8A 3D0FA 1TT2A 3I72A 3KK7A 4BY1H 2F3IA 4I65A 2LKVA 4IPDA 2B2YC 3RN5A 4DR5Q 3TP5A 2PMZB 3J80i 5JJLA 5T1IA 2JQOA 4C3JH 2Y0SG 1X3EA 5IYCH 1VF5C 1N33Q 3I4OA 1B53A 1CHPD 1OXXK 3BZDB 1HUMA 3DEOA 2X6GA 1AE3A 1IL2A 4XQQA 3PSIA 3J81E 2Y0SE 4LF6Q 4DR7Q 1QVCA 1VMCA 1O78A 2EIFA 1SE4A 4KI0A 1ENAA 3CD6A 2CKZB 4A3BB 2L11A 4YIJA 3BS1A 2EDGA 1EQQA 4UDUC 4ZLTF 1IBLL 2GVBA 5C3EG 4JC0A 2HT1A 3T56B 4A3LH 5J1ZA 3SK5A 2R93H 1YEZA 4QGUA 1S40A 4JPBW 1XPRA 2ID0A 1EQTA 3CW2C 4B3SL 3VA7A 2LY7A 3RNUA 1EY8A 5FO7B 3HZXA 1I4XA 1E7ZA 1AW7A 1EQRA 4GN3B 4DPGA 1UE5A 1K8MA 5CC4A 4FNFA 1CM9A 4N8FA 1KRSA 1QILA 3KF8B 5AFWA 2F4VL 4DUZL 1FVIA 1Y8OB 3PO3G 2R7DA 2Z6BA 4K14A 4DK3C 2PI2E 1Q3LA 1JWSD 1VQDA 4A3EB 1EZ6A 4JI4Q 4DV1Q 3BZKA 2AQ3B 1I4PA 3PUXA 1U4LA 4ZQ3A 3FKIG 5I9OA 3K81C 3PIOA 4YWMA 4K0KL 3LNNA 1PH6A 5IGDA 1N36L
chains in the Genus database with same CATH topology
4FF4A 2PZTA 4PNYA 5DEHA 1L0YB 1D5XC 1IYUA 2TMPA 5A2QL 3R2IA 4M8AA 4RWSC 5K5PA 1EU4A 2EY2A 2JA6B 1EY4A 2X6LA 4XT3B 2RDGA 2F0QA 4C3JG 1GXDC 3EROA 4BS9A 3T51B 5IGEA 4J1MA 3A7AB 4B9WA 4CBVA 4HSVA 2N88A 1EU3A 1PTOF 5ELBA 4CJ0B 4ME5A 3J7AF 1HHVA 1YNND 5EBCA 1STYA 5DNFA 1PDQA 2M2LA 1AP0A 1GUSA 2Q8TA 2E75C 4IURA 1JOKA 3C1EA 1B1ZA 3FRPB 1NCVA 1CI3M 2O5IC 1XX8A 2B2TA 1Y69U 1BQQT 2XN9C 3NE5B 4ZK9B 3D4WA 2RVLA 2XRSD 5FKAC 4C3HB 1LTGD 3M3YB 1E2WA 4KKSA 1BCPB 5C4JB 2F0PA 2V4DA 3U9OA 4NP5A 5KNCA 2RSOA 4QB4A 3H09A 3BDLA 4PV1C 3CQZB 4RH6A 3ITPA 3MEHA 1X3QA 1Q1BA 4DK1A 1CK1A 5CYUA 3PO3B 1MSGA 4FF2A 1LTID 3C2PA 4Q5VA 4XTCS 1SMYD 2K32A 3FKIB 4TRDA 5E4WC 3FMCA 3D6CA 3NSWA 3FEWX 1PLFA 4FO2A 3KLSA 1J8IA 4G7HC 2PPBC 1BCPC 2F0LA 5IIFA 4ZKCB 2VB2X 1GHKA 1D5ZC 1KTKA 1QCBD 4BY1B 4KKTA 1SYFA 3EVQA 1DOKA 1KLGD 3D4RA 4C3JB 5C5MA 5IGFA 1ENFA 4IUVA 4GZYC 1XWEA 2A69C 1CZGA 4O1NA 2B2VA 5JVH3 4H0LC 4OIJA 1OXTA 5EGTA 3IFDA 3HS0C 5KNBA 4XT1B 2PZUA 4XXEA 1SNPA 1TVXA 4DF7A 2BDNA 3NHHA 5C5LA 1LTSD 5BN3A 2R93B 1WTXA 2I46A 2F1MA 3QWNA 2CHBD 3Q0AA 2EJFC 2A68D 1JORA 1PYWD 1EZ8A 2F0SA 3R2TA 3S9WA 1IHZA 3BDOA 3SK4A 4LAAA 3HP3A 5KNDA 3K58A 1DYQA 1OXSC 1BR9A 1DJRD 1WD1A 4PQXA 1FNWA 2H1EA 3H91A 1NR2A 1HQRD 2PO4A 2F4IA 5LHY1 4IUQA 5M9OA 2L1BA 3ONAB 2DN8A 4N9PA 3S17B 3OOCA 4A3FB 4IUPA 4RA8A 3MXGA 4A93B 2PW5A 4RGNA 4QCLA 1EY0A 3OIPA 1RJTA 1EY9A 3M7GA 2JYOA 1DXMA 4B08A 1HUNA 3HOZB 2BA0A 5IOCA 5KEEA 3ND9A 2FJ2A 4M1UB 2A6HD 1SNDA 2XWBB 5C4XB 1V1PB 1Q1EA 1XXGA 1A2TA 3KBGA 1HTLD 4F8MA 3C3LA 4IN3A 5C3WA 4IFDI 1AEXA 3ND8A 4DXGA 2PZWA 4A3DB 1EY7A 1SNQA 3EFXD 4DNRB 5I2YA 2Q8IB 5D65A 3JAML 1HXYD 1YNJC 1SNOA 2K03A 1TS5A 3E0JA 4EQNA 4PMCA 1LO5D 2WAQB 1UAPA 4CKEA 1TWHB 4WJWA 1BCPF 2WACA 1SFOB 5M3FB 1GOZA 1TS3A 1G2TA 2ZT9C 3PUWA 2KCNA 2K05A 2L55A 2FMCA 1TWAB 1OXUA 4WRDA 1VMPA 3ZYYX 2B2YA 2BE5C 3OHXC 4DAVA 2IX0A 5ELFA 3NBHA 5A2QE 3DMUA 4XYOA 5E1FA 4MIUA 1Q90A 2NVYB 1CQVA 1I4GA 1GUWA 1HA5A 1TQOA 2L9HA 2BA1A 1D6EC 4QUFA 2WV6D 5I9PA 4JBWA 4IFDH 3J7YW 1H9SB 2B2WA 2MPMA 4DU9A 4F88A 1LABA 4S3SA 1WTOA 4ODGA 3BVZA 1EWHA 5KIXA 4RCNA 4CJ1B 1T5XD 4UAIA 4PMWA 3TP8A 1EIHA 3KBXA 3HKZB 3GO5A 4KHVA 3Q6SA 3K5OA 3TSSA 1OXVA 3P20A 3VR4A 1TY0A 5J39A 1JOOA 3H3VC 5IGGA 4BA2I 5EPKA 5BN5A 1DONA 2RBMA 3FVQA 1DOLA 1SJED 2KA7A 2Z4IA 3S1MB 3AB9A 4FXDA 3IL8A 3I91A 4KK7A 1C48A 3PUYA 3O13A 2VNUD 5CGKA 2JE6I 5CV9A 1S5CD 3TP7A 1ML0D 1A6XA 1GUTA 5JEAH 2RDHA 4QF4A 1X32A 2YYZA 1M4VA 4ILWA 3CRKC 3SE0A 4C3HG 1SDFA 1PRTD 2HCCA 1CA5A 2L12A 2PCFB 2Z1CA 3I8ZA 5E3FA 4QUCA 1EQVA 1K83B 5JPMC 1CT1D 4NMZA 4Q0FA 5G3LF 1S5DD 4OO1I 4IUTA 3MZ5A 3KF8A 1CFMA 2F0UA 1Q8IA 2QILA 4HCEA 4IUNA 1D5MC 1Y1VB 3S14B 3NTHA 3MFGA 1JR0D 3QOJA 4IFDG 4P2CB 1ICWA 1WTVA 5M5YB 3OW7A 1HQMC 1SSOA 1HPCA 1SEBD 1O7YA 2BCOA 1F2YA 5FO9B 1KNAA 2HUGA 4RKLA 1CHQD 2B2UC 2K04A 4HSPA 1YNNC 1WD0A 2NN6G 5KYLA 4A3JB 2RDFA 1D1KA 1DCZA 1R4PB 1BUVT 1JICA 1A15A 2F0IA 4V0BA 4DFAA 3GTQB 5C0XG 2IW3A 3NQIA 2R92B 3EQLC 1U4MA 5F2DA 1BNZA 3HOVB 2DY7A 1H9JA 1CTMA 2J4XA 3I4MB 1VCIA 1SBBB 1UEAB 3I90A 3HEJA 1FR3A 3TN2A 5M5WB 1C4QA 5JEAG 2JA8B 3RMHA 1Z7TA 3BYYB 1V8QA 1QOHA 2ICIA 1CZWA 4OO1H 2NVXB 3I4LA 1BXTA 1MSHA 1UNSA 3QG1A 4FXKC 5FK9C 1NSNS 1R4QB 1I6HB 2NVQB 4H44C 4RGOS 4ZAIA 3G6JB 2EPBA 3E5SA 5CV7A 3RD4A 5HGTA 4EVOA 4A3GB 1SAPA 2AWNA 3GTKB 5DM73 4BWGB 2VUMB 2D5DA 3M7NA 2NTTA 2KUMA 2K7VA 4XYQA 4R9WA 2K01A 1XYIA 1MI2A 4HAEA 1IL8A 1PMRA 3SK8A 1FNVA 2ZXOA 1SMYC 1SYBA 3M4OB 4RHSA 4Y7NB 3S2HB 3J80L 5A35A 2SNMA 1D2BA 3M4YA 1STBA 2XWJB 3K57A 3H6MA 3NK9A 2KVMA 3SXHA 1IKMA 4K2LA 4NKLA 3IKJA 3Q23A 3QJYA 3DHQA 2EOTA 5EKKA 1BO0A 1D1IA 4HMJA 1LTBD 3PUZA 1TIID 2IX1A 5JVG3 1TS4A 4HMIA 4A3IB 1KABA 2JA5B 3BVMA 3I70A 4KJOA 2OXPA 4HTHA 1TR5A 5D14A 1KDAA 2D2CC 2D9UA 2QDBA 3JAME 1W6KA 1PFNA 3K7AB 3HGBA 1ZKOA 2R3ZA 2B8GA 3OWFA 4ZUIA 2EYOA 4RGMA 1E0BA 3GTPB 1EYDA 3TDQA 2EYMA 1KAAA 3J7AV 3K6OA 2F0JA 2E2JB 2A68C 3A54A 1RTOA 5I2XA 3K5NA 3DWAA 1AZQA 5KGUA 1LLRD 4TSSA 3FPUB 5BN4A 1FGBD 2Z8LA 4F87A 4HEDA 5CV6A 3S1NB 3E6ZX 2B2TC 2EYHA 2PYKA 1SNMA 2K5DA 1GUOA 1ENCA 3DEPA 1LT5D 3Q24A 4FYDA 1XTCD 3SEBA 5IT9L 5T1GA 3V2TA 1J9OA 3VYTA 5CORA 2DNEA 1U9RA 2MUYA 1B9NA 1ESRA 4CKBA 1RHPA 2B63B 3MC0B 3PO2B 4CHTB 1EIGA 4X3UA 1NUCA 5I4DA 2JP1A 1JB3A 4EQOA 3WOEA 1HFNA 1CQFA 1L0XB 4HN7A 2K5WA 4BA1I 1LACA 4TKOB 1ZYRD 3NUCA 2JA7B 3MXNA 4ULLA 1F2ZA 3R93A 5FLXL 1WTWA 1G2SA 2A6HC 2F0FA 3WDNA 4K8JA 2EJMA 5C4HA 1V1OA 2B8FA 2O4XA 1K8OA 2D62A 5HURA 3I4NB 2R6GA 4IQZA 1F9PA 3L9AX 3MWYW 4R8NA 1JC7A 4C56C 3D6WA 3MXPA 3URYA 4KD4A 4L63B 2XSCA 3VYSA 2QEJC 3L3OC 3TZDA 2MJ8A 5EKIA 1EEID 5CV8A 4AYBB 1V1PA 2JEBI 3SVMA 3T4AC 2DNCA 1AZPA 4KD3A 5JJZA 3PUVA 5CV4A 1IKLA 3GV3A 4L8JA 4JK1C 5C0XJ 2CQAA 2F3VA 4Z9CB 1ZEQX 1B3AA 3DUZA 4RFBA 2JXMB 1F9SA 2A6ED 1STNA 3HOWB 1S5BD 1SYDA 4K5WA 1G91A 3QO2A 3K59A 1SNCA 4LK1C 3W2DA 1WTPA 4A3MB 1TWCB 2SEBD 4RAUC 3VR6A 1LT3D 3D31A 2WINB 3OPOA 2QKIC 3TZUA 1JOQA 3W3AA 4MHEA 3I73A 2EYLA 5C4ZA 2EY6A 3GQBA 3MHBA 1VDZA 2X69A 1O7ZA 2EJGC 4WORA 1JQYD 1PFBA 4BBSB 2CW0C 4G7OC 3I3CA 1EY5A 3RZDB 1RF2D 4J6HA 2C5CA 1I3QB 3M85A 1H9KA 2F0MA 1DZ1A 5I6YA 2K28A 1C8CA 3KLRA 4H7BA 2NUCA 1F9QA 2QF7A 1IW7D 1QNUA 4OIKA 1PRTB 4G4KA 4H13C 3SDZA 2IT1A 3MTSA 1DM0B 1Z6HA 3BVGA 1U4PA 1LV9A 3D3RA 1QE6A 1QJOA 3PV0A 1S5FD 1H9MA 4E6IA 3DM1A 1GJXA 4RGTA 2F0TA 1H9SA 1EOTA 5D3IB 1NAPA 1ESFA 1LTAD 3A8IE 3GP7A 1B9MA 4KN4C 1BBXC 3GTMB 4K8IA 4EQPA 1SYEA 1STEA 2EE1A 4RHRA 3S15B 4A3KB 2F0EA 1RD9D 2OT2A 4K5XA 2E2IB 3BDCA 5D3DA 2F3WA 3R3OA 4NW2A 2AUJD 4KHZA 2WP8J 4R8IA 1A3TA 1JWMD 1SYCA 4OL7A 1PRTC 4DAYA 2KJXA 1TY2A 1G6ZA 1I4QA 5ELCA 4HR7B 1LT6D 1PXUA 4IALA 1B44D 1UUPA 2QCPX 5CBAE 2FHTA 3VYUA 2EYJA 2ICEC 1JCKB 4RCOA 3D4DA 3AU7A 3J80E 2K5QA 2PW7A 3A56A 2K6AA 2PNRC 3GD7A 2LFNA 1ET6A 1EFID 1GUNA 1RKNA 4KY7A 3F2UA 3EA6A 1QB5D 2EYFA 5EPJA 1PTOD 4L6TB 2L5TA 4U68A 2BOSA 1G8ZD 4X3KA 5E4XA 2RA4A 1EY6A 1H9RA 1DOMA 1GHJA 5EQ0A 4KMUC 5TSSA 2G9DA 2L0CA 2LMCB 3OMGA 1PZKD 1LT4D 2WKDA 4C2MB 3MFYA 2VB3X 1HRJA 2XVSA 1O7LA 4FP5D 3GTJB 3A8JE 5C3XA 1U4RA 3P75A 3MXUA 2B2WC 1SE3A 2WB1B 2WIIB 1QWYA 1QG7A 4J8QA 5ELDA 1STAA 2EYPA 2H4OA 4ZRZA 4XIGS 1GUGA 5M3MB 3GTOB 2A74C 4C3IB 1ET9A 5CR3A 5J22A 3OWEB 1X3PA 3LWEA 1HFGA 3CU7A 4V190 1Y8NB 4KY6A 1F2LA 2IJ0A 4F7XA 2NB0A 5IT9E 2AWOA 2IX3A 5LL6S 3V96A 3OMCA 4OGQC 2KEEA 2O5JC 1RDPD 2IL8A 1KDBA 2YU9B 3VR2A 1KNEA 2EY5A 1PZJD 4CJ2C 4FXGC 2NWGA 2A5HA 1V43A 1EEFD 2EXZA 3MAQA 1Q12A 1TU2B 2M9VA 5CBEE 3CKIB 1Z47A 4QIWB 1ONLA 4BY7B 3S2DB 4KV6A 5FLXE 1AFPA 2IPKD 4XQNA 2N55A 3NTKA 3P1HA 1HCZA 1EL0A 4EGVA 2MHVA 3S16B 2K1BA 2FMMA 1JWUD 1TKWB 1MBYA 1B4OA 3DWPA 3EJIA 2EY1A 2IWHA 2J0TD 3L7ZC 1PRTF 4K6DA 3NPPA 1MD2D 2WKCA 4FF3A 3TP6A 1TS2A 1CA6A 4ZYSA 3SHLA 3X3NA 4N9TA 2SDFA 1RODA 2Y0SB 2A73B 4ZUJA 1SYGA 1F2MA 1KDCA 1WVLA 1PTOH 1S4ZA 1BOSA 4C1NI 3CRLC 1II3A 3GTLB 1JE4A 2L4NA 2AUKA 5EBDA 5COYA 4ZKBB 3HOXB 5EJWA 2EVBA 3NBIA 5C3EB 3A7LA 4K2KA 1I50B 2E74C 2O2LD 4DA2A 3LX0A 4CKCA 5JPNC 2I07B 3D8GA 2VXWA 3J81L 5IGBA 5M5XB 3ERQA 3UI2A 1EYAA 3KLSX 1MGSA 1IYVA 4OO1G 2TSSA 3CHBD 3Q22A 4QMGA 3V05A 3K5LA 2SNSA 3QB3A 3SK6A 3TMEA 2RKSA 4IUUA 1W6JA 1F77A 1T5EA 2HCIA 1ZYRC 1AN8A 3T13A 3C1FA 2MGSA 3K0YA 2E76C 4BBRB 1I4RA 3SR1A 3A55A 1HA6A 1TWGB 2F0GA 3DXJC 1PFMA 3VA5A 3K5MA 1E2ZA 2KCCA 2F0OA 3S1RB 1DD2A 2KHSA 5C6AA 5ISRA 2NYZD 4C1NK 2SOBA 4KJNA 3VYRA 3LWUA 2HQEA 1FD7D 5KRUA 3RLFA 2LS01 2OEOA 3HOUB 3T53B 3PIO3 3C46A 5EPLA 1E2VA 3HG9A 3U9SA 2HDLA 1OO9B 5DAUA 1LTRD 2AQ2B 2ZXPA 2NTSA 1BCPD 4KTAA 2R61A 2RSNA 4K6LA 2A6EC 1WTQA 4O42A 1ZXTA 2J7ZA 1S5ED 3H0GB 2F0NA 2F0DA 5FO8B 5C44B 2NBFA 4IFDJ 1I6VC 2XRQD 3N52A 3QIAA 3QOLA 3VR5A 4RKBA 2KOLA 2A69D 4KKUA 4G7ZC 2F0WA 4X3SA 2NVTB 1B2TA 3BG3A 2KECA 4B9XA 2ZXRA 3NWTA 3KUPA 5JAVA 4MN3A 5EKLA 2BDOA 3HOYB 3T16A 3NWSA 4X3TA 4DGZA 1A2UA 3S1QB 3GV6A 1Y1WB 1KLUD 3AMUA 1I4HA 1G291 2B39A 1ILQA 2JSOA 5LL6X 3PIP3 1IW7C 3PMFA 4HCSA 2B2VC 1FNUA 1EWCA 3RZOB 1SJHD 2F03A 3FDTA 2R7ZB 1BF4A 4LMQD 5JEAJ 2HDMA 3NXWA 1NR4A 4DN4M 1WCMB 1SE2A 5DM63 1O80A 2KQ3A 3IFTA 4KY5A 3BYTB 3RUZA 5FOBB 5KYIA 1BDOA 2CVRA 3X3MA 5JOBA 4PMBA 5K36H 4ID6A 5NUCA 2OF1A 3NTIA 3R8BA 4NDXA 4FF1A 1A3VA 4XQJA 3GTGB 2M00A 3IAYA 1PTOB 3HRZC 2NZ1D 2RQXA 3G7LA 2F0HA 4DXFA 2GA4B 1A3UA 4I7ZC 2NN6I 2AQ1B 4XDXA 4TQUS 2C9OA 1WTRA 1F9RA 5C0XI 4KN7C 2XIWA 2F0VA 2E2DC 5G3LD 1HTPA 2KEDA 1ILPA 4LJZC 2MP1A 1FYCA 2K33A 5CMDA 4ABNA 1SXTA 1RCVD 3A8KE 3NP8A 1TWFB 3FPPA 2EZVA 4FVMA 3WOFA 1PZID 2Z4HA 3OSOA 4U673 2FINB 4C3IG 3NQTA 1R9TB 3P7JA 4OHJA 1YNJD 2FFKB 2PQEA 3VR3A 5IGCA 2CW0D 3N6RA 4DNTB 4DK0A 3MVVA 1STHA 1PTOC 2Q8RE 3OIQA 1B50A 1EYCA 5I6WA 3DWQA 2E2HB 2JEAI 2ENBA 2F0KA 5IODA 1QNKA 2B2UA 5K36G 2BE5D 3MA2B 1STGA 2XNAC 1RTNA 1M8AA 2NN6H 4DAPA 1VF7A 2G9HD 4CGYB 4K5VA 1Y8PB 5CV5A 4IZ8A 5C0XH 4WFN3 5ELEA 3H94A 4G57A 1LTTD 3TBIB 2DY8A 1TT2A 3I72A 3KK7A 4I65A 2LKVA 2B2YC 3TP5A 2PMZB 5T1IA 1VF5C 1B53A 1CHPD 1OXXK 3BZDB 1HUMA 3DEOA 2X6GA 4XQQA 3J81E 1VMCA 1O78A 1SE4A 4KI0A 1ENAA 4A3BB 2L11A 4YIJA 3BS1A 2EDGA 4UDUC 4ZLTF 3T56B 5J1ZA 3SK5A 2ID0A 1EQTA 3VA7A 2LY7A 1EY8A 5FO7B 3HZXA 1I4XA 1AW7A 1K8MA 5CC4A 4FNFA 1CM9A 1QILA 5AFWA 1Y8OB 4K14A 1Q3LA 1JWSD 4A3EB 1EZ6A 2AQ3B 1I4PA 3PUXA 1U4LA 4ZQ3A 5I9OA 3LNNA 5IGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SNS A;  4G57 A;  2PZT A;  4PNY A;  5DEH A;  3OMG A;  3QB3 A;  3TP8 A;  2EYH A;  2PYK A;  1SNM A;  2PZW A;  1SYB A;  3SK6 A;  3TME A;  1EY7 A;  1SNQ A;  4K8I A;  1SYE A;  4EQP A;  2RKS A;  1F2Y A;  1ENC A;  1STN A;  2F0E A;  3ITP A;  4B9X A;  1JOR A;  3MEH A;  1TT2 A;  4RKL A;  4KHV A;  4I65 A;  1EZ8 A;  2LKV A;  1SYD A;  4K5W A;  2F0V A;  2F0S A;  5JAV A;  3EJI A;  5K5P A;  2EY1 A;  5EKL A;  5KRU A;  2EY2 A;  3TP5 A;  5J39 A;  1JOO A;  4K5X A;  1SNO A;  1SNC A;  2SNM A;  4K6D A;  3V2T A;  3BDC A;  2RDF A;  2F3W A;  3T16 A;  3T13 A;  3R3O A;  1EY4 A;  3C1F A;  1IHZ A;  3TP6 A;  4DGZ A;  5IGG A;  1U9R A;  3NP8 A;  5C3X A;  1A2U A;  2F0Q A;  4EQN A;  3P75 A;  1STB A;  3SR1 A;  2RBM A;  3SHL A;  3H6M A;  3NK9 A;  3SK4 A;  2F0I A;  4PMC A;  3P1H A;  3SXH A;  4LAA A;  1JOQ A;  3ERO A;  1A3T A;  4K2L A;  4N9T A;  4NKL A;  4DFA A;  3DHQ A;  1NUC A;  3OSO A;  2F0G A;  1SYC A;  2EYL A;  5EKK A;  4HMJ A;  4OL7 A;  4TRD A;  4ZUJ A;  5C4Z A;  4J1M A;  2EY6 A;  1SYG A;  4EQO A;  1F2M A;  5IGE A;  3VA5 A;  3NQT A;  4B9W A;  1STA A;  2EYP A;  1ENA A;  3MHB A;  5F2D A;  2WAC A;  3D6C A;  3PMF A;  2F0O A;  1KDC A;  3S9W A;  4ME5 A;  4YIJ A;  5CGK A;  2KHS A;  4WOR A;  5C6A A;  4IAL A;  5ISR A;  4HMI A;  5CV9 A;  3NUC A;  2PQE A;  3TP7 A;  1STY A;  1KAB A;  5IGC A;  1II3 A;  5CR3 A;  5J22 A;  2SOB A;  4WRD A;  4KJN A;  1F2Z A;  5J1Z A;  4QF4 A;  3SK5 A;  5KYL A;  2F0L A;  5M9O A;  3NXW A;  2F0F A;  5IIF A;  4K8J A;  1EY5 A;  4N9P A;  3MVV A;  3HEJ A;  1STH A;  2EYJ A;  2HQE A;  5C4H A;  4J6H A;  4KJO A;  2O4X A;  2OXP A;  1TR5 A;  2F0M A;  1JOK A;  2KQ3 A;  1KDA A;  4HTH A;  2OEO A;  3C1E A;  4KY6 A;  3D4D A;  1SYF A;  4KY5 A;  2QDB A;  3DMU A;  3EVQ A;  5E1F A;  3RUZ A;  1EY8 A;  4MIU A;  4F7X A;  1EYC A;  4H7B A;  2NUC A;  3HZX A;  5HUR A;  5I6W A;  5I6Y A;  2PW5 A;  5KYI A;  1EY0 A;  5JOB A;  3OMC A;  5C5M A;  4K2K A;  5IGF A;  5E3F A;  4PMB A;  1EY9 A;  2PW7 A;  4R8N A;  1EQV A;  3D4W A;  3OWF A;  3MXP A;  4ID6 A;  5DAU A;  5CC4 A;  5NUC A;  4ZUI A;  2EYO A;  2OF1 A;  4KD4 A;  1TQO A;  1KDB A;  1RKN A;  2ENB A;  3LX0 A;  2F0K A;  4KY7 A;  1NSN S;  4NDX A;  1EYD A;  4NMZ A;  5IOC A;  2EY5 A;  5IOD A;  5KEE A;  4KTA A;  3MZ5 A;  1SND A;  1STG A;  3E5S A;  1A3V A;  2EYM A;  5CV7 A;  2EYF A;  2F0U A;  1KAA A;  3D8G A;  2F0J A;  5HGT A;  4K14 A;  5I9P A;  5EGT A;  5CV8 A;  4EVO A;  4IUN A;  2EXZ A;  5IGB A;  2F0N A;  1A2T A;  2F0D A;  2M00 A;  1EZ6 A;  2F0P A;  4E6I A;  2PZU A;  3U9O A;  1EY6 A;  4NP5 A;  5KGU A;  1SNP A;  3ERQ A;  4F8M A;  3QOL A;  4DF7 A;  4KD3 A;  4DU9 A;  2F0T A;  4K5V A;  4ZQ3 A;  4RKB A;  2F0H A;  4S3S A;  3QOJ A;  1A3U A;  3NHH A;  5I9O A;  5CV4 A;  5CV5 A;  4IZ8 A;  1EYA A;  5C5L A;  5CV6 A;  5C3W A;  4ODG A;  4KV6 A;  4QB4 A;  2F3V A;  5KIX A;  4QMG A;  3BDL A;  1AEX A;  2F0W A;  5IGD A;  3SK8 A; 
#chains in the Genus database with same CATH topology
 1JE5 A;  4FF4 A;  2PZT A;  4PNY A;  5DEH A;  3S24 A;  1L0Y B;  1D5X C;  1YJN A;  5FLM G;  3S17 H;  4BXX H;  4A3F H;  1IYU A;  2RHS B;  4BBR G;  5FJ8 G;  2TMP A;  5A2Q L;  3R2I A;  4M8A A;  3L2P A;  1K9M C;  4RWS C;  5K5P A;  1EU4 A;  2EY2 A;  4A93 H;  4BY1 G;  1VQO A;  2JA6 B;  3J80 c;  1CSP A;  1EY4 A;  2X6L A;  4XT3 B;  2RDG A;  2F0Q A;  5LMU L;  3HOZ H;  4C3J G;  1GXD C;  4P71 A;  3ERO A;  4BS9 A;  2Z6K C;  3T51 B;  4NB3 A;  4EQ5 A;  5GAH C;  5C4X H;  5IGE A;  2UUA L;  4J1M A;  3AYH B;  5IWA Q;  3A7A B;  4B9W A;  4CBV A;  4HSV A;  4JI5 L;  3AEV A;  2N88 A;  1EU3 A;  1PTO F;  5ELB A;  4CJ0 B;  4ME5 A;  3J7A F;  1HHV A;  1YNN D;  1VQ6 A;  5EBC A;  1STY A;  5DNF A;  3TS2 A;  1PDQ A;  2M2L A;  1AP0 A;  3K80 C;  1GUS A;  2Q8T A;  5LMN W;  2E75 C;  3U58 A;  4IUR A;  4A3L G;  1JOK A;  3C1E A;  1B1Z A;  3FRP B;  3J81 c;  4A3D H;  1NCV A;  1CI3 M;  2O5I C;  1XX8 A;  2B2T A;  1Y69 U;  1BQQ T;  4MTN A;  1IXR A;  2XN9 C;  3NE5 B;  4ZK9 B;  4HID A;  2AMC B;  1UEB A;  3D4W A;  3QR8 A;  2RVL A;  2XRS D;  5FKA C;  4C3H B;  1LTG D;  3H0G G;  2JN4 A;  5C44 G;  4WJ3 M;  1VQB A;  4A3C G;  3PIP A;  4DR3 L;  2A1A A;  1ASY A;  3NEL A;  3M3Y B;  4IPG A;  1E2W A;  4KKS A;  4IPC A;  1BCP B;  5C4J B;  4OXP A;  1CSQ A;  2K14 A;  2F0P A;  3T1Y L;  2V4D A;  1TWH H;  3U9O A;  4NP5 A;  3EIV A;  1S72 A;  1G6P A;  1WYD A;  5KNC A;  2IHE A;  2RSO A;  1SFO H;  5M3F H;  1X6O A;  2DJG C;  1QVF A;  4QB4 A;  3H09 A;  3BDL A;  1TWA H;  4PV1 C;  2ZJP A;  2QDL A;  3HOY G;  3H3V H;  3CQZ B;  4RH6 A;  3ITP A;  3MEH A;  1X3Q A;  2YTY A;  1Q1B A;  4BXX G;  4ME3 A;  1HZA A;  4DK1 A;  1CK1 A;  5CYU A;  2NVY H;  3PO3 B;  1A63 A;  1G51 A;  1MSG A;  3KOJ A;  4FF2 A;  4NXN Q;  1LTI D;  3C2P A;  4GNX C;  4Q5V A;  4XTC S;  1SMY D;  3EBE A;  2K32 A;  3FKI B;  4TRD A;  5E4W C;  4GKJ Q;  3ULP A;  3FMC A;  3D6C A;  3NSW A;  5C4X G;  2VQF L;  1WCM G;  3FEW X;  4HIO A;  1PLF A;  4JV5 Q;  2UXC L;  4GKK Q;  4FO2 A;  4QQB X;  2ZM6 L;  3ICE A;  3KLS A;  1VQG A;  1J8I A;  4G7H C;  2PPB C;  1BCP C;  1YBY A;  2F0L A;  5IIF A;  1N34 L;  4JI2 L;  4ZKC B;  4JI7 L;  1YIT A;  2VB2 X;  1KQS A;  1GHK A;  5FLX c;  1D5Z C;  1KTK A;  1QCB D;  4OON A;  3EN2 A;  3STB C;  4BY1 B;  4KKT A;  1SYF A;  3CME A;  3EVQ A;  2K5N A;  1DOK A;  1J6Q A;  2WFW A;  1KLG D;  3D4R A;  4C3J B;  5C5M A;  5IGF A;  1P16 A;  2BH8 A;  1ENF A;  4IUV A;  4GZY C;  1XWE A;  2E5L Q;  2A69 C;  1CZG A;  4O1N A;  1XNR Q;  2Z0S A;  2B2V A;  5JVH 3;  4H0L C;  4OIJ A;  4RMF A;  3KYH C;  1OXT A;  2MO1 A;  1Q46 A;  5EGT A;  3S1M H;  4AQY Q;  4GN4 B;  3IFD A;  3HS0 C;  5KNB A;  4XT1 B;  2PZU A;  2WAQ G;  1BVS A;  1N9W A;  4XXE A;  1SNP A;  5GAD C;  1VQA A;  1TVX A;  4DF7 A;  2BDN A;  1NMG A;  3CPF A;  2UXD Q;  3NHH A;  4FDB A;  4JI6 L;  5C5L A;  1LTS D;  5BN3 A;  3I56 A;  2R93 B;  2WAQ E;  1WTX A;  2I46 A;  1EUJ A;  1SRO A;  2F1M A;  3QWN A;  4B3M Q;  2CHB D;  1RIP A;  3Q0A A;  1IYJ B;  2N49 A;  2EJF C;  2A68 D;  1JOR A;  4J15 A;  1PYW D;  1KL9 A;  1P8L A;  1EZ8 A;  2F0S A;  1YZ6 A;  1MKH A;  3R2T A;  2K75 A;  3S9W A;  4DV5 L;  1VQ9 A;  4R4C A;  1IHZ A;  4A75 A;  1K83 H;  4B3R L;  4GLX A;  3BDO A;  4JYA L;  3SK4 A;  2KHJ A;  4LAA A;  3HP3 A;  2I5L X;  5KND A;  3K58 A;  1DYQ A;  3TQY A;  1OXS C;  4UP7 A;  1BR9 A;  1DJR D;  1WD1 A;  1NJI C;  4PQX A;  1B8A A;  1Y1V H;  1FNW A;  2H1E A;  2UU9 Q;  4IJL A;  3H91 A;  3S14 H;  1NR2 A;  3TS0 A;  3MXN B;  1HQR D;  2PO4 A;  2F4I A;  5LHY 1;  2BH2 A;  4IUQ A;  5M9O A;  2L1B A;  3ONA B;  4DR2 L;  2DN8 A;  1DGS A;  4N9P A;  4OWX B;  3S17 B;  5M5Y H;  3OOC A;  4A3F B;  2OQK A;  4IUP A;  4RA8 A;  4R4Q A;  1XMO Q;  1PH1 A;  4JI1 Q;  4DV2 Q;  3MXG A;  4A93 B;  2PW5 A;  4RGN A;  4QCL A;  1EY0 A;  1YHB A;  3OIP A;  3I55 A;  2HD3 A;  3PGZ A;  3CPW A;  1RJT A;  1EY9 A;  3KDF B;  2JYO A;  3M7G A;  1DXM A;  4B08 A;  1HUN A;  1OTC A;  3HOZ B;  4A3J H;  2BA0 A;  5IOC A;  5KEE A;  3RR5 A;  3ND9 A;  1L2F A;  2FJ2 A;  4M1U B;  2UXB L;  2A6H D;  1SND A;  2XWB B;  5C4X B;  4GOP C;  1V1P B;  1Q1E A;  3GTQ H;  1XXG A;  4JI3 Q;  4DR6 L;  1A2T A;  3KBG A;  2R92 H;  1YHA A;  4UHV A;  1HTL D;  4LFC L;  4F8M A;  3HOV H;  4GLA C;  1Q81 C;  3C3L A;  1WFQ A;  4IN3 A;  5C3W A;  3F2D A;  4IFD I;  1AEX A;  3ND8 A;  3I4M H;  4DXG A;  4DR4 L;  2PZW A;  2ZJQ A;  4A3D B;  1K8A C;  1EY7 A;  1SNQ A;  5M5W H;  1VQJ A;  4R4O A;  3EFX D;  2JA8 H;  4DNR B;  5I2Y A;  2Q8I B;  5D65 A;  3JAM L;  1HXY D;  1YNJ C;  2NVX H;  1SNO A;  4LNQ A;  5IYB H;  4B3S Q;  4LFA Q;  4LF7 L;  2K03 A;  1TS5 A;  3E0J A;  4EQN A;  4PMC A;  1LO5 D;  4A3B G;  2WAQ B;  4OX9 Q;  1I6H H;  2NVQ H;  1UAP A;  1SRU A;  2ASB A;  2Q2I A;  4CKE A;  1NTG A;  1TWH B;  4WJW A;  1BCP F;  3RLO A;  2WAC A;  4A3G H;  3GTK H;  2MO0 A;  1SFO B;  5M3F B;  1GOZ A;  2VUM H;  1TS3 A;  2JJQ A;  1G2T A;  1JJG A;  2ZT9 C;  3PUW A;  1VQL A;  2KCN A;  2K05 A;  1Y1V G;  2FMC A;  2L55 A;  1TWA B;  3M9B A;  4JI0 L;  1OXU A;  4WRD A;  1HNX Q;  1VMP A;  3ZYY X;  2B2Y A;  2BE5 C;  3OHX C;  4DAV A;  4DV4 L;  5J3B A;  2IX0 A;  1VQ7 A;  5ELF A;  3NBH A;  4NXM Q;  5A2Q E;  4K0K Q;  3UE0 A;  3DMU A;  4XYO A;  5E1F A;  1XPU A;  3M4O H;  4MIU A;  4LF8 Q;  5DLQ E;  4LUO A;  1MJE A;  1Q90 A;  1EOV A;  2NVY B;  1QUQ B;  1VQC A;  2KCT A;  4Y7N H;  1VQF A;  1CKN B;  3S2H H;  3E0E A;  1CQV A;  1U5K A;  1I4G A;  1GUW A;  1HA5 A;  4A3E G;  1TQO A;  2L9H A;  4KHP L;  3I7F A;  2BA1 A;  2ZTD A;  1D6E C;  1I94 Q;  4QUF A;  3CC7 A;  2H5X A;  4JOI C;  2WV6 D;  2LXK A;  5I9P A;  3M4Q A;  3BZC A;  5LMU Q;  3OTO L;  4JBW A;  4IFD H;  3A5Z B;  3J7Y W;  4RG1 A;  1H9S B;  1S3O A;  2B2W A;  2MPM A;  4DU9 A;  1PYS B;  4F88 A;  4HJ5 A;  1LAB A;  4S3S A;  1WTO A;  1Q8K A;  4ODG A;  3BVZ A;  1EWH A;  5KIX A;  4A3I H;  4RCN A;  4JI5 Q;  3HOV G;  1L1O A;  4CJ1 B;  1T5X D;  2JA5 H;  4UAI A;  4PMW A;  3TP8 A;  4IOA A;  1EIH A;  1VQN A;  1D7Q A;  3KBX A;  3HKZ B;  3GO5 A;  4KHV A;  4X64 L;  3K7U C;  4P72 A;  4AIM A;  3Q6S A;  3K5O A;  3TSS A;  1OXV A;  4L5Q A;  3P20 A;  3VR4 A;  1TY0 A;  4B3T Q;  3K7A H;  3OYY A;  5J39 A;  1JOO A;  2UUC Q;  3H3V C;  5IGG A;  4BA2 I;  5EPK A;  3AFP A;  5BN5 A;  1DON A;  3AQQ A;  2RBM A;  1X3F A;  3FVQ A;  3GTP H;  1DOL A;  1SJE D;  2KA7 A;  2Z4I A;  3S1M B;  4DAY B;  3AB9 A;  4FXD A;  3IL8 A;  3I91 A;  4KK7 A;  2E2J H;  4HIM A;  1C48 A;  3PUY A;  3O13 A;  2VNU D;  5CGK A;  3J7Z C;  2JE6 I;  1HR0 W;  5CV9 A;  1S5C D;  3TP7 A;  2QEX A;  1YJW A;  1ML0 D;  1A6X A;  1GUT A;  5JEA H;  3KF6 B;  3S1N H;  2RDH A;  4QF4 A;  1GVP A;  1X32 A;  2YYZ A;  1M4V A;  4ILW A;  3CRK C;  3SE0 A;  4C3H G;  1SDF A;  1PRT D;  2HCC A;  1CA5 A;  2AHO B;  4QY7 A;  2HHH L;  2L12 A;  2PCF B;  2Z1C A;  3I8Z A;  5E3F A;  2Z6K A;  4QUC A;  1EQV A;  1K83 B;  1K0S A;  5JPM C;  1CT1 D;  3FHW A;  4NMZ A;  4Q0F A;  5G3L F;  1S5D D;  4OO1 I;  4IUT A;  3MZ5 A;  5AJ3 Q;  3KF8 A;  1CFM A;  2B63 H;  2F0U A;  1Q8I A;  3PO2 H;  4DV3 Q;  2QIL A;  3J81 i;  4HCE A;  4IUN A;  1D5M C;  3Q8D A;  1PHJ A;  1Y1V B;  3S14 B;  5H1S E;  3NTH A;  3MFG A;  3TEH B;  1JR0 D;  2VW9 A;  3QOJ A;  3F2C A;  4IFD G;  4DKA C;  4P2C B;  4LF5 Q;  4DUY Q;  4WJ4 A;  1ICW A;  5IYD G;  3HKS A;  1WTV A;  2JA7 H;  5M5Y B;  3OW7 A;  4JCV E;  2VQF Q;  1HQM C;  1SSO A;  4ALP A;  1HPC A;  1K3B C;  1SEB D;  1O7Y A;  4JI8 Q;  2BCO A;  3W1B A;  2ZM6 Q;  1F2Y A;  5FO9 B;  1KNA A;  2HUG A;  4RKL A;  1CHQ D;  2B2U C;  1HNZ L;  1PVO A;  2K04 A;  1E1T A;  4HSP A;  2VY3 A;  4DV7 L;  3I4N H;  1YNN C;  2G5D A;  2NN6 G;  5KYL A;  1WD0 A;  4A3J B;  3CP0 A;  2RDF A;  3WWV A;  1D1K A;  1DCZ A;  1R4P B;  1BUV T;  1E1O A;  1JIC A;  4PZ7 A;  1A15 A;  2F0I A;  4V0B A;  4DFA A;  3GTQ B;  5C0X G;  1NE3 A;  2IW3 A;  2RCN A;  3NQI A;  2R92 B;  3EQL C;  1U4M A;  4LFB Q;  5F2D A;  3E9I A;  3UDF A;  1BNZ A;  3HOV B;  1E3P A;  2DY7 A;  1H9J A;  3H3V I;  4CDD C;  1CTM A;  2J4X A;  1VQM A;  3DM3 A;  1JMC A;  3HFZ B;  3I4M B;  4N8X 1;  1VCI A;  2V1C C;  4X66 Q;  5LMN L;  4DAM A;  2QGQ A;  1SBB B;  1UEA B;  5IYC G;  3I90 A;  3HEJ A;  1FR3 A;  3TN2 A;  1X56 A;  4GN5 A;  5M5W B;  4JI6 Q;  1C4Q A;  1KHI A;  4DNI A;  5JEA G;  2JA8 B;  1Z7T A;  3BYY B;  3RMH A;  5IP9 H;  2KHI A;  1V8Q A;  1QOH A;  2ICI A;  3HOW H;  1CZW A;  2CH4 A;  1C0A A;  4OO1 H;  2NVX B;  4YHH L;  3I4L A;  1BXT A;  1MSH A;  1UNS A;  2VQE Q;  1JT8 A;  2L15 A;  3QG1 A;  4FXK C;  5FK9 C;  1NSN S;  1R4Q B;  1I6H B;  2NVQ B;  4H44 C;  4A3M H;  4RGO S;  4ZAI A;  1TWC H;  2N3S A;  3G6J B;  2EPB A;  1D8L A;  3E5S A;  5CV7 A;  3RD4 A;  3TRE A;  5HGT A;  1H95 A;  4EVO A;  4A3G B;  1SAP A;  4B3R Q;  2R93 G;  2AWN A;  3GTK B;  5DM7 3;  4BWG B;  4GNX B;  4GLV B;  4POF A;  2VUM B;  2D5D A;  3M7N A;  2NTT A;  2KUM A;  1HZB A;  2UUB Q;  2K7V A;  4XYQ A;  1PH9 A;  4R9W A;  2K01 A;  2I5H A;  1XYI A;  1MI2 A;  4HAE A;  1IL8 A;  4BBS H;  1PMR A;  3SK8 A;  1FNV A;  2ZXO A;  1FJG Q;  1SMY C;  1XNQ L;  1SYB A;  2CWA A;  3M4O B;  4RHS A;  1YJ9 A;  4X62 L;  3RZD H;  1I3Q H;  4YCV A;  3A5U A;  1N32 Q;  1WTH A;  4DR1 L;  4Y7N B;  4DR2 Q;  3S2H B;  3J80 L;  5A35 A;  2PI2 A;  1YHQ A;  2EQS A;  4MZ9 A;  2SNM A;  1D2B A;  4QL5 A;  5HGQ A;  3M4Y A;  1STB A;  2XWJ B;  3K57 A;  1VS0 A;  3H6M A;  2KVM A;  3NK9 A;  3SXH A;  3T1H L;  1IKM A;  4DR5 L;  4K2L A;  4NKL A;  3IKJ A;  3Q23 A;  3QJY A;  3DHQ A;  2EOT A;  5EKK A;  1N33 L;  1BO0 A;  1D1I A;  4HMJ A;  1LTB D;  4HJ7 A;  1AE2 A;  3PUZ A;  1TII D;  2IX1 A;  1UE6 A;  2OTJ A;  4A3F G;  5JVG 3;  1TS4 A;  4LF6 L;  4DR7 L;  1Y14 B;  4HMI A;  4A3I B;  1KAB A;  1YI2 A;  1TXY A;  1BBU A;  2JA5 B;  4A93 G;  1JJ2 A;  3BVM A;  1QZG A;  3I70 A;  1I5F A;  4KJO A;  2OXP A;  4HTH A;  1TR5 A;  5D14 A;  1KDA A;  2D2C C;  4OWW B;  1HNW Q;  3HOZ G;  2D9U A;  2QDB A;  3GTM H;  2N78 A;  3JAM E;  2KCM A;  1W6K A;  3S15 H;  4A3K H;  1PFN A;  3K7A B;  3HGB A;  1ZKO A;  2R3Z A;  1M90 C;  1HZC A;  2B8G A;  3OWF A;  3I2Z A;  1VQP A;  4ZUI A;  2EYO A;  4A76 A;  4RGM A;  1IBK L;  2E2I H;  1E0B A;  3GTP B;  1EYD A;  3F1Z A;  3TDQ A;  2A8V A;  2EYM A;  1KAA A;  3J7A V;  3K6O A;  2F0J A;  2E2J B;  2A68 C;  4A3M G;  3A54 A;  1RTO A;  5I2X A;  3LGJ A;  3K5N A;  3DWA A;  1AZQ A;  5KGU A;  1LLR D;  4TSS A;  4DV0 L;  3FPU B;  4A3D G;  5BN4 A;  1FGB D;  2Z8L A;  4F87 A;  4HED A;  5CV6 A;  4YY3 L;  3FP9 A;  3S1N B;  3E6Z X;  2B2T C;  4LF9 Q;  2EYH A;  2PYK A;  1SNM A;  2K5D A;  1GUO A;  4BBS G;  1ENC A;  3DEP A;  1LT5 D;  3Q24 A;  4FYD A;  2E8G A;  2I5M X;  1XTC D;  3SEB A;  5IT9 L;  3CCL A;  5T1G A;  3G4S A;  3V2T A;  2EXD A;  1J9O A;  4O0A A;  3VYT A;  2ALY B;  5COR A;  2DNE A;  1U9R A;  2MUY A;  1B9N A;  1ESR A;  4CKB A;  4DK6 C;  1RHP A;  2B63 B;  3MC0 B;  2MFI A;  3PO2 B;  5M3F G;  4CHT B;  1U0L A;  1PH7 A;  1L0W A;  1EIG A;  4X3U A;  1NUC A;  2MQH A;  5I4D A;  2JP1 A;  1JB3 A;  4EQO A;  3WOE A;  1HFN A;  1CQF A;  1L0X B;  4GOP B;  4HN7 A;  2K5W A;  2FXQ A;  4BA1 I;  1LAC A;  2PQA B;  4TKO B;  1ZYR D;  3NUC A;  3E9H A;  2JA7 B;  4AH6 A;  3MXN A;  1PYB A;  5IWA L;  1XMQ L;  4ULL A;  1F2Z A;  2HQL A;  3R93 A;  5FLX L;  1WTW A;  1G2S A;  2A6H C;  2F0F A;  3WDN A;  4K8J A;  2EJM A;  1GD7 A;  1V1O A;  5C4H A;  2B8F A;  2O4X A;  3UDG A;  1K8O A;  1VQI A;  2D62 A;  4C2M H;  1PA6 A;  5HUR A;  3I4N B;  2R6G A;  1SE8 A;  4IQZ A;  4MNO A;  4X65 Q;  2ES2 A;  4PG3 A;  1EIF A;  1F9P A;  3L9A X;  3MWY W;  4R8N A;  1JC7 A;  4C56 C;  3D6W A;  3MXP A;  3URY A;  3GTJ H;  4KD4 A;  4L63 B;  2XSC A;  3KDF A;  1UE1 A;  2QW7 A;  3UDX A;  3VYS A;  3J81 j;  2QEJ C;  3L3O C;  3TZD A;  2MJ8 A;  5EKI A;  1EEI D;  5CV8 A;  4AYB B;  1J5E Q;  1V1P A;  2JEB I;  3SVM A;  1VQH A;  3T4A C;  2DNC A;  1AZP A;  4KD3 A;  2PNH A;  4P75 A;  3PUV A;  5CV4 A;  5JJZ A;  1IKL A;  3GV3 A;  4L8J A;  4JK1 C;  5C0X J;  3HKZ G;  5M3M H;  3GTO H;  2CQA A;  2F3V A;  4Z9C B;  4C3I H;  1ZEQ X;  1B3A A;  3DUZ A;  4RFB A;  1B3Q A;  3CAM A;  1NBW A;  2JXM B;  2RCF A;  1F9S A;  3HKZ E;  2A6E D;  1STN A;  3HOW B;  1S5B D;  1RL2 A;  1GO3 E;  1EFW A;  1SYD A;  4K5W A;  1G91 A;  3QO2 A;  3K59 A;  2CWP A;  1YNX A;  1SNC A;  1K8G A;  1WI5 A;  4LK1 C;  3W2D A;  1WTP A;  1X55 A;  2HHH Q;  4A3M B;  1TWC B;  2SEB D;  4OEL B;  4RAU C;  3VR6 A;  2YU9 H;  1LT3 D;  3D31 A;  2WIN B;  3OPO A;  1MJC A;  2QKI C;  3TZU A;  1JOQ A;  3W3A A;  4MHE A;  1EYG A;  2JA9 A;  3I73 A;  2EYL A;  5C4Z A;  2EY6 A;  1IBL Q;  3GQB A;  3MHB A;  1VDZ A;  4NXN L;  2X69 A;  1O7Z A;  4LF4 L;  2EJG C;  4WOR A;  1JQY D;  2XTI A;  1PFB A;  2A19 A;  1W2B A;  4GKJ L;  4BBS B;  2CW0 C;  4G7O C;  4LUZ A;  1PH2 A;  4BY7 H;  3S2D H;  3I3C A;  1EY5 A;  5JJK A;  3ERS X;  3RZD B;  1RF2 D;  4J6H A;  2C5C A;  1I3Q B;  5IP7 H;  3M85 A;  1H9K A;  2F0M A;  1DZ1 A;  3S16 H;  5I6Y A;  1SLJ A;  2K28 A;  1C8C A;  3KLR A;  1IBM L;  4H7B A;  2NUC A;  2F4V Q;  1F9Q A;  2QF7 A;  1IW7 D;  1QNU A;  3CMA A;  2Q2U A;  2K4K A;  1KRT A;  1Z9F A;  4OIK A;  1PRT B;  4G4K A;  4H13 C;  4DUZ Q;  3SDZ A;  1QUQ A;  3U50 C;  2IT1 A;  3MTS A;  3KJO A;  1CKN A;  1W3S A;  1DM0 B;  1Z6H A;  3ER0 A;  3BVG A;  1U4P A;  4DV7 Q;  1B70 B;  1LV9 A;  2C35 B;  3D3R A;  1X9N A;  3CCV A;  1PFS A;  1QE6 A;  1QJO A;  2B3G A;  3PV0 A;  2E5L L;  1S5F D;  1H9M A;  1ASZ A;  1BKB A;  1XNR L;  4E6I A;  3G71 A;  3DM1 A;  4PZ6 A;  1N36 Q;  1GJX A;  4RGT A;  4JBJ A;  2F0T A;  1N8R C;  3CCE A;  4A4I A;  2VZA A;  4MTK A;  1H9S A;  4OWT B;  5L37 A;  1EOT A;  4LW1 A;  5D3I B;  1NAP A;  1ESF A;  1LM0 A;  1LTA D;  3A8I E;  1PH4 A;  3GP7 A;  1B9M A;  4KN4 C;  1BBX C;  5M3M G;  3GTL H;  4A3J G;  3GTM B;  2UXD L;  4K8I A;  1SYE A;  1STE A;  2EE1 A;  4RHR A;  4EQP A;  3S15 B;  1FL0 A;  2F0E A;  4A3K B;  1RD9 D;  1B7Y B;  1UE7 A;  4B3M L;  3HOX H;  5C3E H;  2OT2 A;  1GKH A;  1SN8 A;  4K5X A;  2E2I B;  3BDC A;  2CFM A;  2F3W A;  4UP8 A;  5D3D A;  3R3O A;  2R92 G;  2UUA Q;  1I50 H;  3M4P A;  2ZTE A;  4NW2 A;  2AUJ D;  4KHZ A;  4YHH Q;  2WP8 J;  4R8I A;  1A3T A;  4IO9 A;  1JWM D;  1SR3 A;  1SYC A;  3H15 A;  4OL7 A;  1PRT C;  5GAG C;  4DAY A;  3I4M G;  2KJX A;  1TY2 A;  1G6Z A;  1I4Q A;  1Q7Y C;  5M5X H;  1HR0 L;  5ELC A;  4HR7 B;  1LT6 D;  1PXU A;  4IAL A;  2JA8 G;  1B44 D;  2HIV A;  2MNA A;  3F8T A;  1UUP A;  2QCP X;  3PCO B;  2I0Q A;  5CBA E;  2FHT A;  5IYB G;  2UU9 L;  3KF6 A;  3VYU A;  2EYJ A;  2ICE C;  4BY7 G;  1JCK B;  4RCO A;  3D4D A;  3AU7 A;  4POG A;  4JVZ A;  2YTX A;  3PQI A;  1T9H A;  3J80 E;  5IP7 G;  4DR3 Q;  2K5Q A;  1BBW A;  2PW7 A;  3A56 A;  4HJA A;  2K6A A;  2PNR C;  3GD7 A;  1L1O B;  1ET6 A;  2LFN A;  1EFI D;  4A3G G;  1GUN A;  2OWO A;  1RKN A;  4KY7 A;  5FLM H;  3T1Y Q;  1XMO L;  1X54 A;  3F2U A;  2CQO A;  4YWK A;  2VUM G;  5FJ8 H;  4BBR H;  3EA6 A;  1QB5 D;  2EYF A;  5EPJ A;  1PTO D;  4L6T B;  2L5T A;  4U68 A;  2BOS A;  4JG2 A;  1TWG H;  1G8Z D;  2GN5 A;  4X3K A;  5E4X A;  5ELN A;  3CF5 A;  2RA4 A;  4L5T A;  3T1H Q;  1EY6 A;  1H9R A;  4QJF A;  1LUZ A;  3PF4 A;  1DOM A;  1GHJ A;  5EQ0 A;  4KMU C;  3S1R H;  2B29 A;  5TSS A;  2G9D A;  4JI3 L;  3KFU A;  2L0C A;  2YV5 A;  2LMC B;  3OMG A;  1PZK D;  1LT4 D;  1Q82 C;  3J7A 5;  2WKD A;  4C2M B;  3MFY A;  2VB3 X;  3IRB A;  1HRJ A;  3HOU H;  2K5H A;  2XVS A;  1O7L A;  4O2D A;  4FP5 D;  3GTJ B;  3K0X A;  4YWL A;  1X65 A;  4UP9 A;  3HOX G;  3A8J E;  5C3X A;  1U4R A;  4CDF C;  3P75 A;  2KEN A;  1IZ6 A;  3MXU A;  4LUV A;  4IOC A;  3CCU A;  2UXC Q;  4HJ8 A;  2B2W C;  1SE3 A;  2WB1 B;  3CC2 A;  1PH3 A;  2WII B;  4A3I G;  1QWY A;  1IBK Q;  4LFA L;  1QG7 A;  4J8Q A;  2JA5 G;  5ELD A;  1STA A;  2EYP A;  2H4O A;  1L1O C;  4ZRZ A;  1O7I A;  3H0G H;  4JI2 Q;  1N34 Q;  4JI7 Q;  5C44 H;  3UE1 A;  4OX9 L;  5BR8 L;  4A3C H;  4XIG S;  1GUG A;  5M3M B;  3GTO B;  3RN2 A;  2A74 C;  1LTL A;  4C3I B;  2OTL A;  1ET9 A;  5CR3 A;  3TRZ A;  1A0I A;  4APV A;  5J22 A;  3OWE B;  3CCS A;  1X3P A;  2F52 A;  4DV0 Q;  3LWE A;  1HFG A;  3CU7 A;  4V19 0;  1Y8N B;  4KY6 A;  4YY3 Q;  5JJI A;  1XPO A;  2NVT H;  1HJP A;  1F2L A;  1C7Y A;  2IJ0 A;  4F7X A;  1HNX L;  2NB0 A;  4H02 A;  4CDE C;  5IT9 E;  2AWO A;  2IX3 A;  5LL6 S;  3V96 A;  3OMC A;  4OGQ C;  2KEE A;  2R7F A;  4NXM L;  2O5J C;  1RDP D;  2IL8 A;  1KDB A;  4R1J A;  3VR2 A;  2YU9 B;  3HOY H;  1KNE A;  4LF8 L;  2EY5 A;  1VQK A;  1PZJ D;  4CJ2 C;  4FXG C;  3S1Q H;  2NWG A;  2A5H A;  1E22 A;  1Y1W H;  1V43 A;  1WJJ A;  1EEF D;  2EXZ A;  5GQO A;  3MAQ A;  1Q12 A;  1TU2 B;  2M9V A;  5CBE E;  3CCJ A;  5HY6 A;  3CKI B;  1Z47 A;  4GNX A;  1I94 L;  4QIW B;  1ONL A;  3BU2 A;  3RZO H;  4BY7 B;  3S2D B;  4KV6 A;  5FLX E;  1AFP A;  2IPK D;  4XQN A;  2R7Z H;  2N55 A;  3NTK A;  3P1H A;  1HCZ A;  1EL0 A;  4EGV A;  2MHV A;  3S16 B;  2K1B A;  4DV5 Q;  4HJ9 A;  2LSS A;  1WCM H;  1JWU D;  2FMM A;  2HIX A;  2K5V A;  1XMQ Q;  4JBK A;  1TKW B;  1MBY A;  2B63 G;  4JYA Q;  1B4O A;  3DWP A;  3EJI A;  3PF5 A;  3PO2 G;  3UDI A;  2EY1 A;  2IWH A;  2J0T D;  3A0J A;  3L7Z C;  1PRT F;  4K6D A;  3NPP A;  1MD2 D;  3HOU G;  2WKC A;  4DV6 L;  4FF3 A;  3TP6 A;  1EIY B;  1TS2 A;  1CA6 A;  4ZYS A;  3SHL A;  3X3N A;  4N9T A;  4B3T L;  2SDF A;  1ROD A;  2UUC L;  2VS1 A;  2Y0S B;  3NEM A;  2A73 B;  4ZUJ A;  2JA7 G;  2GVA A;  4NPS A;  1SYG A;  1F2M A;  3GTG H;  3KJP A;  3JC6 6;  1VQ8 A;  1KDC A;  2K50 A;  1WVL A;  1PTO H;  1S4Z A;  1BOS A;  4C1N I;  1K73 C;  3CRL C;  2RHQ B;  1II3 A;  3I4N G;  1K0R A;  3GTL B;  1JE4 A;  2L4N A;  2AUK A;  2KBN A;  5EBD A;  5COY A;  4ZKB B;  1E24 A;  5EJW A;  2EVB A;  3HOX B;  3NBI A;  5C3E B;  3A7L A;  2UXB Q;  4K2K A;  1I50 B;  2ATW A;  1KAW A;  4AYB G;  2E74 C;  2O2L D;  4DA2 A;  4DR6 Q;  3LX0 A;  4CKC A;  1MHW C;  2RF4 A;  4LFC Q;  1TWF H;  2D0O A;  5JPN C;  3W5O A;  4AYB E;  2I07 B;  2Z9H A;  2VXW A;  3D8G A;  3J81 L;  5IGB A;  5M5X B;  1Y1W G;  1JB7 A;  4DR4 Q;  3ERQ A;  1R9T H;  5AJ3 L;  5IP9 G;  1XJV A;  5IT9 c;  4DV3 L;  3UI2 A;  3HOW G;  1EYA A;  3KLS X;  1MGS A;  1IYV A;  4OO1 G;  2TSS A;  3CHB D;  3Q22 A;  4QMG A;  3V05 A;  3K5L A;  1LYL A;  2N8N A;  3F2B A;  4LF4 Q;  2SNS A;  3QB3 A;  1ICF B;  1QZH A;  4UPA A;  2R7Z G;  3SK6 A;  3TME A;  2RKS A;  4IUU A;  4LF7 Q;  4LF5 L;  4DUY L;  2DGY A;  1W6J A;  2CH4 W;  1F77 A;  1T5E A;  1KXL A;  3JAM i;  3OW2 A;  2HCI A;  4P74 A;  4JI8 L;  1ZYR C;  2E2H H;  1AN8 A;  3T13 A;  3C1F A;  2MGS A;  1IBM Q;  3K0Y A;  2E76 C;  4BBR B;  3CXC A;  1I4R A;  4JI4 L;  3SR1 A;  4DV1 L;  3A55 A;  3L0O A;  1NNX A;  1HA6 A;  1TWG B;  3K8A A;  2F0G A;  3DXJ C;  3NEN A;  1PFM A;  4JI0 Q;  3VA5 A;  3AFQ A;  4CDC C;  4YCW A;  3K5M A;  1E2Z A;  2KCC A;  2F0O A;  3KLW A;  4DV4 Q;  3S1R B;  1DD2 A;  2KHS A;  5C6A A;  4GOP A;  1C9O A;  5ISR A;  3CCR A;  4LFB L;  2NYZ D;  2PQA A;  4C1N K;  2SOB A;  4YCU A;  4KJN A;  2JK8 A;  3VYR A;  3LWU A;  2HQE A;  1FD7 D;  5KRU A;  3RLF A;  2LS0 1;  2OEO A;  4KHP Q;  3HOU B;  3T53 B;  3PIO 3;  3C46 A;  5EPL A;  1E2V A;  3HG9 A;  4X66 L;  4LWC A;  3U9S A;  3DLL A;  2HDL A;  1JJC B;  1OO9 B;  4TVA B;  3SGI A;  5DAU A;  1LTR D;  2AQ2 B;  2ZXP A;  2QA4 A;  3OTO Q;  2NTS A;  1BCP D;  4KTA A;  2R61 A;  1K28 A;  2RSN A;  4K6L A;  3RLN A;  2A6E C;  1WTQ A;  2VQE L;  1PV4 A;  4O42 A;  1ZXT A;  3STB D;  4Y52 H;  2J7Z A;  1S5E D;  3H0G B;  2F0N A;  2F0D A;  5FO8 B;  5C44 B;  2NBF A;  4IFD J;  1I6V C;  2XRQ D;  5IE8 A;  2ZTC A;  3N52 A;  2NZH A;  3QIA A;  3QOL A;  4R4T A;  2IHF A;  2K52 A;  2LXJ A;  3VR5 A;  4RKB A;  1MIU A;  2KOL A;  4A3B H;  4A3K G;  1A8V A;  4X64 Q;  2A69 D;  4KKU A;  4L5R C;  4G7Z C;  2F0W A;  4X3S A;  1HR0 Q;  4L5S A;  2XGT A;  1PH8 A;  2NVT B;  1KIX A;  2UUB L;  1B2T A;  1CUK A;  3BG3 A;  2KEC A;  4B9X A;  3U4V A;  2ZXR A;  3MEF A;  3NWT A;  3KUP A;  5JAV A;  1YVC A;  4MN3 A;  1VQ5 A;  5EKL A;  2BDO A;  3CC4 A;  1FJG L;  3JAM c;  3ULL A;  3HOY B;  3T16 A;  3NWS A;  4X3T A;  5E7N A;  4EX5 A;  4DGZ A;  1CKO A;  1N32 L;  1A2U A;  3S1Q B;  1M1K C;  1XTD A;  3GV6 A;  1Y1W B;  1KLU D;  4P73 A;  3AMU A;  1I4H A;  1G29 1;  2B39 A;  1ILQ A;  2JSO A;  5LL6 X;  3PIP 3;  1IW7 C;  4A3E H;  2AKW B;  2DJF C;  3PMF A;  4HCS A;  2B2V C;  4IPH A;  1FNU A;  1EWC A;  3RZO B;  3GDE A;  1SJH D;  4JOI A;  2ZJR A;  2F03 A;  1QVG A;  3FDT A;  2R7Z B;  2D0P A;  1BF4 A;  4LMQ D;  1CKM A;  1NMF A;  5JEA J;  2HDM A;  3NXW A;  1NR4 A;  4DN4 M;  1WCM B;  1SE2 A;  3ZJY C;  2NZO A;  5DM6 3;  1O80 A;  2DUD A;  2KQ3 A;  3IFT A;  4KY5 A;  3BYT B;  3RUZ A;  4X6A H;  2Q2T A;  5FOB B;  5KYI A;  1A62 A;  1BDO A;  2CVR A;  3CCQ A;  3X3M A;  5JOB A;  4PMB A;  1AH9 A;  5K36 H;  1HH2 P;  4ID6 A;  5NUC A;  2OF1 A;  1HNW L;  3NTI A;  3R8B A;  2JA6 H;  4HIK A;  4NDX A;  4FF1 A;  3G48 A;  1A3V A;  4JV5 L;  4XQJ A;  4GKK L;  3GTG B;  3ULJ A;  5GAE C;  2M00 A;  3IAY A;  2PMZ E;  1PTO B;  1VQE A;  3HRZ C;  4R4I A;  2NZ1 D;  2RQX A;  3G7L A;  1VQ4 A;  2F0H A;  4DXF A;  2GA4 B;  1A3U A;  4I7Z C;  2NN6 I;  1NY4 A;  2YTV A;  4ZCK A;  2AQ1 B;  2CCZ A;  5GRO A;  1Q86 C;  1YIJ A;  4XDX A;  4TQU S;  1HNZ Q;  2C9O A;  2P5Z X;  5BR8 Q;  4I7A A;  1V9P A;  1WTR A;  1F9R A;  2IY5 B;  2OQ0 A;  5C0X I;  1KD1 C;  4KN7 C;  4UY8 C;  2XIW A;  3BJU A;  4JW0 A;  2F0V A;  1X3G A;  2E2D C;  5G3L D;  4LF9 L;  1HTP A;  2KED A;  2WB1 G;  1WOC A;  4LJZ C;  2MP1 A;  1FYC A;  2K33 A;  5CMD A;  1ILP A;  3VDY A;  4ABN A;  1SXT A;  1RCV D;  3A8K E;  3NP8 A;  1TWF B;  4AQY L;  4C3H H;  3FPP A;  3G6E A;  2WB1 E;  2EZV A;  4FVM A;  3WOF A;  1PZI D;  2Z4H A;  3OSO A;  3M3Y H;  3U4Z A;  5IY0 A;  4U67 3;  2FIN B;  4C3I G;  1PH5 A;  5LMN Q;  3NQT A;  1R9T B;  5EAY A;  5C4J H;  1UWV A;  2VL6 A;  3P7J A;  4OHJ A;  4JBM A;  1YNJ D;  2FFK B;  2PQE A;  3VR3 A;  5IGC A;  2CW0 D;  3N6R A;  4DNT B;  4DK0 A;  3MVV A;  3NBH B;  1STH A;  1PTO C;  2Q8R E;  3OIQ A;  1B50 A;  3CQZ H;  1EYC A;  5I6W A;  3DWQ A;  2E2H B;  5IYD H;  2JEA I;  1V1Q A;  2ENB A;  3PO3 H;  2F0K A;  5IOD A;  1SMX A;  1EWI A;  1QNK A;  2B2U A;  5K36 G;  1K3R A;  2BE5 D;  4X65 L;  3E3X A;  3CCM A;  3MA2 B;  1STG A;  2XNA C;  2JA6 G;  1RTN A;  4DV6 Q;  1M8A A;  1KC8 C;  2NN6 H;  4PZ8 A;  3FKI H;  2Q2H A;  4DAP A;  2OCE A;  3W1G A;  1VF7 A;  2G9H D;  4QIW E;  4OEM B;  5ELO A;  4CGY B;  4K5V A;  4KLK A;  1GM5 A;  1XNQ Q;  4GS3 A;  1Y8P B;  5CV5 A;  4IZ8 A;  1FGU A;  4X62 Q;  5C0X H;  4WFN 3;  5ELE A;  3H94 A;  1J5E L;  4DR1 Q;  4JI1 L;  4DV2 L;  4G57 A;  3B6Y A;  3A74 A;  1LTT D;  1HZ9 A;  3TBI B;  4IJH A;  2DY8 A;  3D0F A;  1TT2 A;  3I72 A;  3KK7 A;  4BY1 H;  2F3I A;  4I65 A;  2LKV A;  4IPD A;  2B2Y C;  3RN5 A;  4DR5 Q;  3TP5 A;  2PMZ B;  3J80 i;  5JJL A;  5T1I A;  2JQO A;  4C3J H;  2Y0S G;  1X3E A;  5IYC H;  1VF5 C;  1N33 Q;  3I4O A;  1B53 A;  1CHP D;  1OXX K;  3BZD B;  1HUM A;  3DEO A;  2X6G A;  1AE3 A;  1IL2 A;  4XQQ A;  3PSI A;  3J81 E;  2Y0S E;  4LF6 Q;  4DR7 Q;  1QVC A;  1VMC A;  1O78 A;  2EIF A;  1SE4 A;  4KI0 A;  1ENA A;  3CD6 A;  2CKZ B;  4A3B B;  2L11 A;  4YIJ A;  3BS1 A;  2EDG A;  1EQQ A;  4UDU C;  4ZLT F;  1IBL L;  2GVB A;  5C3E G;  4JC0 A;  2HT1 A;  3T56 B;  4A3L H;  5J1Z A;  3SK5 A;  2R93 H;  1YEZ A;  4QGU A;  1S40 A;  4JPB W;  1XPR A;  2ID0 A;  1EQT A;  3CW2 C;  4B3S L;  3VA7 A;  2LY7 A;  3RNU A;  1EY8 A;  5FO7 B;  3HZX A;  1I4X A;  1E7Z A;  1AW7 A;  1EQR A;  4GN3 B;  4DPG A;  1UE5 A;  1K8M A;  5CC4 A;  4FNF A;  1CM9 A;  4N8F A;  1KRS A;  1QIL A;  3KF8 B;  5AFW A;  2F4V L;  4DUZ L;  1FVI A;  1Y8O B;  3PO3 G;  2R7D A;  2Z6B A;  4K14 A;  4DK3 C;  2PI2 E;  1Q3L A;  1JWS D;  1VQD A;  4A3E B;  1EZ6 A;  4JI4 Q;  4DV1 Q;  3BZK A;  2AQ3 B;  1I4P A;  3PUX A;  1U4L A;  4ZQ3 A;  3FKI G;  5I9O A;  3K81 C;  3PIO A;  4YWM A;  4K0K L;  3LNN A;  1PH6 A;  5IGD A;  1N36 L; 
#chains in the Genus database with same CATH homology
 4FF4 A;  2PZT A;  4PNY A;  5DEH A;  1L0Y B;  1D5X C;  1IYU A;  2TMP A;  5A2Q L;  3R2I A;  4M8A A;  4RWS C;  5K5P A;  1EU4 A;  2EY2 A;  2JA6 B;  1EY4 A;  2X6L A;  4XT3 B;  2RDG A;  2F0Q A;  4C3J G;  1GXD C;  3ERO A;  4BS9 A;  3T51 B;  5IGE A;  4J1M A;  3A7A B;  4B9W A;  4CBV A;  4HSV A;  2N88 A;  1EU3 A;  1PTO F;  5ELB A;  4CJ0 B;  4ME5 A;  3J7A F;  1HHV A;  1YNN D;  5EBC A;  1STY A;  5DNF A;  1PDQ A;  2M2L A;  1AP0 A;  1GUS A;  2Q8T A;  2E75 C;  4IUR A;  1JOK A;  3C1E A;  1B1Z A;  3FRP B;  1NCV A;  1CI3 M;  2O5I C;  1XX8 A;  2B2T A;  1Y69 U;  1BQQ T;  2XN9 C;  3NE5 B;  4ZK9 B;  3D4W A;  2RVL A;  2XRS D;  5FKA C;  4C3H B;  1LTG D;  3M3Y B;  1E2W A;  4KKS A;  1BCP B;  5C4J B;  2F0P A;  2V4D A;  3U9O A;  4NP5 A;  5KNC A;  2RSO A;  4QB4 A;  3H09 A;  3BDL A;  4PV1 C;  3CQZ B;  4RH6 A;  3ITP A;  3MEH A;  1X3Q A;  1Q1B A;  4DK1 A;  1CK1 A;  5CYU A;  3PO3 B;  1MSG A;  4FF2 A;  1LTI D;  3C2P A;  4Q5V A;  4XTC S;  1SMY D;  2K32 A;  3FKI B;  4TRD A;  5E4W C;  3FMC A;  3D6C A;  3NSW A;  3FEW X;  1PLF A;  4FO2 A;  3KLS A;  1J8I A;  4G7H C;  2PPB C;  1BCP C;  2F0L A;  5IIF A;  4ZKC B;  2VB2 X;  1GHK A;  1D5Z C;  1KTK A;  1QCB D;  4BY1 B;  4KKT A;  1SYF A;  3EVQ A;  1DOK A;  1KLG D;  3D4R A;  4C3J B;  5C5M A;  5IGF A;  1ENF A;  4IUV A;  4GZY C;  1XWE A;  2A69 C;  1CZG A;  4O1N A;  2B2V A;  5JVH 3;  4H0L C;  4OIJ A;  1OXT A;  5EGT A;  3IFD A;  3HS0 C;  5KNB A;  4XT1 B;  2PZU A;  4XXE A;  1SNP A;  1TVX A;  4DF7 A;  2BDN A;  3NHH A;  5C5L A;  1LTS D;  5BN3 A;  2R93 B;  1WTX A;  2I46 A;  2F1M A;  3QWN A;  2CHB D;  3Q0A A;  2EJF C;  2A68 D;  1JOR A;  1PYW D;  1EZ8 A;  2F0S A;  3R2T A;  3S9W A;  1IHZ A;  3BDO A;  3SK4 A;  4LAA A;  3HP3 A;  5KND A;  3K58 A;  1DYQ A;  1OXS C;  1BR9 A;  1DJR D;  1WD1 A;  4PQX A;  1FNW A;  2H1E A;  3H91 A;  1NR2 A;  1HQR D;  2PO4 A;  2F4I A;  5LHY 1;  4IUQ A;  5M9O A;  2L1B A;  3ONA B;  2DN8 A;  4N9P A;  3S17 B;  3OOC A;  4A3F B;  4IUP A;  4RA8 A;  3MXG A;  4A93 B;  2PW5 A;  4RGN A;  4QCL A;  1EY0 A;  3OIP A;  1RJT A;  1EY9 A;  3M7G A;  2JYO A;  1DXM A;  4B08 A;  1HUN A;  3HOZ B;  2BA0 A;  5IOC A;  5KEE A;  3ND9 A;  2FJ2 A;  4M1U B;  2A6H D;  1SND A;  2XWB B;  5C4X B;  1V1P B;  1Q1E A;  1XXG A;  1A2T A;  3KBG A;  1HTL D;  4F8M A;  3C3L A;  4IN3 A;  5C3W A;  4IFD I;  1AEX A;  3ND8 A;  4DXG A;  2PZW A;  4A3D B;  1EY7 A;  1SNQ A;  3EFX D;  4DNR B;  5I2Y A;  2Q8I B;  5D65 A;  3JAM L;  1HXY D;  1YNJ C;  1SNO A;  2K03 A;  1TS5 A;  3E0J A;  4EQN A;  4PMC A;  1LO5 D;  2WAQ B;  1UAP A;  4CKE A;  1TWH B;  4WJW A;  1BCP F;  2WAC A;  1SFO B;  5M3F B;  1GOZ A;  1TS3 A;  1G2T A;  2ZT9 C;  3PUW A;  2KCN A;  2K05 A;  2L55 A;  2FMC A;  1TWA B;  1OXU A;  4WRD A;  1VMP A;  3ZYY X;  2B2Y A;  2BE5 C;  3OHX C;  4DAV A;  2IX0 A;  5ELF A;  3NBH A;  5A2Q E;  3DMU A;  4XYO A;  5E1F A;  4MIU A;  1Q90 A;  2NVY B;  1CQV A;  1I4G A;  1GUW A;  1HA5 A;  1TQO A;  2L9H A;  2BA1 A;  1D6E C;  4QUF A;  2WV6 D;  5I9P A;  4JBW A;  4IFD H;  3J7Y W;  1H9S B;  2B2W A;  2MPM A;  4DU9 A;  4F88 A;  1LAB A;  4S3S A;  1WTO A;  4ODG A;  3BVZ A;  1EWH A;  5KIX A;  4RCN A;  4CJ1 B;  1T5X D;  4UAI A;  4PMW A;  3TP8 A;  1EIH A;  3KBX A;  3HKZ B;  3GO5 A;  4KHV A;  3Q6S A;  3K5O A;  3TSS A;  1OXV A;  3P20 A;  3VR4 A;  1TY0 A;  5J39 A;  1JOO A;  3H3V C;  5IGG A;  4BA2 I;  5EPK A;  5BN5 A;  1DON A;  2RBM A;  3FVQ A;  1DOL A;  1SJE D;  2KA7 A;  2Z4I A;  3S1M B;  3AB9 A;  4FXD A;  3IL8 A;  3I91 A;  4KK7 A;  1C48 A;  3PUY A;  3O13 A;  2VNU D;  5CGK A;  2JE6 I;  5CV9 A;  1S5C D;  3TP7 A;  1ML0 D;  1A6X A;  1GUT A;  5JEA H;  2RDH A;  4QF4 A;  1X32 A;  2YYZ A;  1M4V A;  4ILW A;  3CRK C;  3SE0 A;  4C3H G;  1SDF A;  1PRT D;  2HCC A;  1CA5 A;  2L12 A;  2PCF B;  2Z1C A;  3I8Z A;  5E3F A;  4QUC A;  1EQV A;  1K83 B;  5JPM C;  1CT1 D;  4NMZ A;  4Q0F A;  5G3L F;  1S5D D;  4OO1 I;  4IUT A;  3MZ5 A;  3KF8 A;  1CFM A;  2F0U A;  1Q8I A;  2QIL A;  4HCE A;  4IUN A;  1D5M C;  1Y1V B;  3S14 B;  3NTH A;  3MFG A;  1JR0 D;  3QOJ A;  4IFD G;  4P2C B;  1ICW A;  1WTV A;  5M5Y B;  3OW7 A;  1HQM C;  1SSO A;  1HPC A;  1SEB D;  1O7Y A;  2BCO A;  1F2Y A;  5FO9 B;  1KNA A;  2HUG A;  4RKL A;  1CHQ D;  2B2U C;  2K04 A;  4HSP A;  1YNN C;  1WD0 A;  2NN6 G;  5KYL A;  4A3J B;  2RDF A;  1D1K A;  1DCZ A;  1R4P B;  1BUV T;  1JIC A;  1A15 A;  2F0I A;  4V0B A;  4DFA A;  3GTQ B;  5C0X G;  2IW3 A;  3NQI A;  2R92 B;  3EQL C;  1U4M A;  5F2D A;  1BNZ A;  3HOV B;  2DY7 A;  1H9J A;  1CTM A;  2J4X A;  3I4M B;  1VCI A;  1SBB B;  1UEA B;  3I90 A;  3HEJ A;  1FR3 A;  3TN2 A;  5M5W B;  1C4Q A;  5JEA G;  2JA8 B;  3RMH A;  1Z7T A;  3BYY B;  1V8Q A;  1QOH A;  2ICI A;  1CZW A;  4OO1 H;  2NVX B;  3I4L A;  1BXT A;  1MSH A;  1UNS A;  3QG1 A;  4FXK C;  5FK9 C;  1NSN S;  1R4Q B;  1I6H B;  2NVQ B;  4H44 C;  4RGO S;  4ZAI A;  3G6J B;  2EPB A;  3E5S A;  5CV7 A;  3RD4 A;  5HGT A;  4EVO A;  4A3G B;  1SAP A;  2AWN A;  3GTK B;  5DM7 3;  4BWG B;  2VUM B;  2D5D A;  3M7N A;  2NTT A;  2KUM A;  2K7V A;  4XYQ A;  4R9W A;  2K01 A;  1XYI A;  1MI2 A;  4HAE A;  1IL8 A;  1PMR A;  3SK8 A;  1FNV A;  2ZXO A;  1SMY C;  1SYB A;  3M4O B;  4RHS A;  4Y7N B;  3S2H B;  3J80 L;  5A35 A;  2SNM A;  1D2B A;  3M4Y A;  1STB A;  2XWJ B;  3K57 A;  3H6M A;  3NK9 A;  2KVM A;  3SXH A;  1IKM A;  4K2L A;  4NKL A;  3IKJ A;  3Q23 A;  3QJY A;  3DHQ A;  2EOT A;  5EKK A;  1BO0 A;  1D1I A;  4HMJ A;  1LTB D;  3PUZ A;  1TII D;  2IX1 A;  5JVG 3;  1TS4 A;  4HMI A;  4A3I B;  1KAB A;  2JA5 B;  3BVM A;  3I70 A;  4KJO A;  2OXP A;  4HTH A;  1TR5 A;  5D14 A;  1KDA A;  2D2C C;  2D9U A;  2QDB A;  3JAM E;  1W6K A;  1PFN A;  3K7A B;  3HGB A;  1ZKO A;  2R3Z A;  2B8G A;  3OWF A;  4ZUI A;  2EYO A;  4RGM A;  1E0B A;  3GTP B;  1EYD A;  3TDQ A;  2EYM A;  1KAA A;  3J7A V;  3K6O A;  2F0J A;  2E2J B;  2A68 C;  3A54 A;  1RTO A;  5I2X A;  3K5N A;  3DWA A;  1AZQ A;  5KGU A;  1LLR D;  4TSS A;  3FPU B;  5BN4 A;  1FGB D;  2Z8L A;  4F87 A;  4HED A;  5CV6 A;  3S1N B;  3E6Z X;  2B2T C;  2EYH A;  2PYK A;  1SNM A;  2K5D A;  1GUO A;  1ENC A;  3DEP A;  1LT5 D;  3Q24 A;  4FYD A;  1XTC D;  3SEB A;  5IT9 L;  5T1G A;  3V2T A;  1J9O A;  3VYT A;  5COR A;  2DNE A;  1U9R A;  2MUY A;  1B9N A;  1ESR A;  4CKB A;  1RHP A;  2B63 B;  3MC0 B;  3PO2 B;  4CHT B;  1EIG A;  4X3U A;  1NUC A;  5I4D A;  2JP1 A;  1JB3 A;  4EQO A;  3WOE A;  1HFN A;  1CQF A;  1L0X B;  4HN7 A;  2K5W A;  4BA1 I;  1LAC A;  4TKO B;  1ZYR D;  3NUC A;  2JA7 B;  3MXN A;  4ULL A;  1F2Z A;  3R93 A;  5FLX L;  1WTW A;  1G2S A;  2A6H C;  2F0F A;  3WDN A;  4K8J A;  2EJM A;  5C4H A;  1V1O A;  2B8F A;  2O4X A;  1K8O A;  2D62 A;  5HUR A;  3I4N B;  2R6G A;  4IQZ A;  1F9P A;  3L9A X;  3MWY W;  4R8N A;  1JC7 A;  4C56 C;  3D6W A;  3MXP A;  3URY A;  4KD4 A;  4L63 B;  2XSC A;  3VYS A;  2QEJ C;  3L3O C;  3TZD A;  2MJ8 A;  5EKI A;  1EEI D;  5CV8 A;  4AYB B;  1V1P A;  2JEB I;  3SVM A;  3T4A C;  2DNC A;  1AZP A;  4KD3 A;  5JJZ A;  3PUV A;  5CV4 A;  1IKL A;  3GV3 A;  4L8J A;  4JK1 C;  5C0X J;  2CQA A;  2F3V A;  4Z9C B;  1ZEQ X;  1B3A A;  3DUZ A;  4RFB A;  2JXM B;  1F9S A;  2A6E D;  1STN A;  3HOW B;  1S5B D;  1SYD A;  4K5W A;  1G91 A;  3QO2 A;  3K59 A;  1SNC A;  4LK1 C;  3W2D A;  1WTP A;  4A3M B;  1TWC B;  2SEB D;  4RAU C;  3VR6 A;  1LT3 D;  3D31 A;  2WIN B;  3OPO A;  2QKI C;  3TZU A;  1JOQ A;  3W3A A;  4MHE A;  3I73 A;  2EYL A;  5C4Z A;  2EY6 A;  3GQB A;  3MHB A;  1VDZ A;  2X69 A;  1O7Z A;  2EJG C;  4WOR A;  1JQY D;  1PFB A;  4BBS B;  2CW0 C;  4G7O C;  3I3C A;  1EY5 A;  3RZD B;  1RF2 D;  4J6H A;  2C5C A;  1I3Q B;  3M85 A;  1H9K A;  2F0M A;  1DZ1 A;  5I6Y A;  2K28 A;  1C8C A;  3KLR A;  4H7B A;  2NUC A;  1F9Q A;  2QF7 A;  1IW7 D;  1QNU A;  4OIK A;  1PRT B;  4G4K A;  4H13 C;  3SDZ A;  2IT1 A;  3MTS A;  1DM0 B;  1Z6H A;  3BVG A;  1U4P A;  1LV9 A;  3D3R A;  1QE6 A;  1QJO A;  3PV0 A;  1S5F D;  1H9M A;  4E6I A;  3DM1 A;  1GJX A;  4RGT A;  2F0T A;  1H9S A;  1EOT A;  5D3I B;  1NAP A;  1ESF A;  1LTA D;  3A8I E;  3GP7 A;  1B9M A;  4KN4 C;  1BBX C;  3GTM B;  4K8I A;  4EQP A;  1SYE A;  1STE A;  2EE1 A;  4RHR A;  3S15 B;  4A3K B;  2F0E A;  1RD9 D;  2OT2 A;  4K5X A;  2E2I B;  3BDC A;  5D3D A;  2F3W A;  3R3O A;  4NW2 A;  2AUJ D;  4KHZ A;  2WP8 J;  4R8I A;  1A3T A;  1JWM D;  1SYC A;  4OL7 A;  1PRT C;  4DAY A;  2KJX A;  1TY2 A;  1G6Z A;  1I4Q A;  5ELC A;  4HR7 B;  1LT6 D;  1PXU A;  4IAL A;  1B44 D;  1UUP A;  2QCP X;  5CBA E;  2FHT A;  3VYU A;  2EYJ A;  2ICE C;  1JCK B;  4RCO A;  3D4D A;  3AU7 A;  3J80 E;  2K5Q A;  2PW7 A;  3A56 A;  2K6A A;  2PNR C;  3GD7 A;  2LFN A;  1ET6 A;  1EFI D;  1GUN A;  1RKN A;  4KY7 A;  3F2U A;  3EA6 A;  1QB5 D;  2EYF A;  5EPJ A;  1PTO D;  4L6T B;  2L5T A;  4U68 A;  2BOS A;  1G8Z D;  4X3K A;  5E4X A;  2RA4 A;  1EY6 A;  1H9R A;  1DOM A;  1GHJ A;  5EQ0 A;  4KMU C;  5TSS A;  2G9D A;  2L0C A;  2LMC B;  3OMG A;  1PZK D;  1LT4 D;  2WKD A;  4C2M B;  3MFY A;  2VB3 X;  1HRJ A;  2XVS A;  1O7L A;  4FP5 D;  3GTJ B;  3A8J E;  5C3X A;  1U4R A;  3P75 A;  3MXU A;  2B2W C;  1SE3 A;  2WB1 B;  2WII B;  1QWY A;  1QG7 A;  4J8Q A;  5ELD A;  1STA A;  2EYP A;  2H4O A;  4ZRZ A;  4XIG S;  1GUG A;  5M3M B;  3GTO B;  2A74 C;  4C3I B;  1ET9 A;  5CR3 A;  5J22 A;  3OWE B;  1X3P A;  3LWE A;  1HFG A;  3CU7 A;  4V19 0;  1Y8N B;  4KY6 A;  1F2L A;  2IJ0 A;  4F7X A;  2NB0 A;  5IT9 E;  2AWO A;  2IX3 A;  5LL6 S;  3V96 A;  3OMC A;  4OGQ C;  2KEE A;  2O5J C;  1RDP D;  2IL8 A;  1KDB A;  2YU9 B;  3VR2 A;  1KNE A;  2EY5 A;  1PZJ D;  4CJ2 C;  4FXG C;  2NWG A;  2A5H A;  1V43 A;  1EEF D;  2EXZ A;  3MAQ A;  1Q12 A;  1TU2 B;  2M9V A;  5CBE E;  3CKI B;  1Z47 A;  4QIW B;  1ONL A;  4BY7 B;  3S2D B;  4KV6 A;  5FLX E;  1AFP A;  2IPK D;  4XQN A;  2N55 A;  3NTK A;  3P1H A;  1HCZ A;  1EL0 A;  4EGV A;  2MHV A;  3S16 B;  2K1B A;  2FMM A;  1JWU D;  1TKW B;  1MBY A;  1B4O A;  3DWP A;  3EJI A;  2EY1 A;  2IWH A;  2J0T D;  3L7Z C;  1PRT F;  4K6D A;  3NPP A;  1MD2 D;  2WKC A;  4FF3 A;  3TP6 A;  1TS2 A;  1CA6 A;  4ZYS A;  3SHL A;  3X3N A;  4N9T A;  2SDF A;  1ROD A;  2Y0S B;  2A73 B;  4ZUJ A;  1SYG A;  1F2M A;  1KDC A;  1WVL A;  1PTO H;  1S4Z A;  1BOS A;  4C1N I;  3CRL C;  1II3 A;  3GTL B;  1JE4 A;  2L4N A;  2AUK A;  5EBD A;  5COY A;  4ZKB B;  3HOX B;  5EJW A;  2EVB A;  3NBI A;  5C3E B;  3A7L A;  4K2K A;  1I50 B;  2E74 C;  2O2L D;  4DA2 A;  3LX0 A;  4CKC A;  5JPN C;  2I07 B;  3D8G A;  2VXW A;  3J81 L;  5IGB A;  5M5X B;  3ERQ A;  3UI2 A;  1EYA A;  3KLS X;  1MGS A;  1IYV A;  4OO1 G;  2TSS A;  3CHB D;  3Q22 A;  4QMG A;  3V05 A;  3K5L A;  2SNS A;  3QB3 A;  3SK6 A;  3TME A;  2RKS A;  4IUU A;  1W6J A;  1F77 A;  1T5E A;  2HCI A;  1ZYR C;  1AN8 A;  3T13 A;  3C1F A;  2MGS A;  3K0Y A;  2E76 C;  4BBR B;  1I4R A;  3SR1 A;  3A55 A;  1HA6 A;  1TWG B;  2F0G A;  3DXJ C;  1PFM A;  3VA5 A;  3K5M A;  1E2Z A;  2KCC A;  2F0O A;  3S1R B;  1DD2 A;  2KHS A;  5C6A A;  5ISR A;  2NYZ D;  4C1N K;  2SOB A;  4KJN A;  3VYR A;  3LWU A;  2HQE A;  1FD7 D;  5KRU A;  3RLF A;  2LS0 1;  2OEO A;  3HOU B;  3T53 B;  3PIO 3;  3C46 A;  5EPL A;  1E2V A;  3HG9 A;  3U9S A;  2HDL A;  1OO9 B;  5DAU A;  1LTR D;  2AQ2 B;  2ZXP A;  2NTS A;  1BCP D;  4KTA A;  2R61 A;  2RSN A;  4K6L A;  2A6E C;  1WTQ A;  4O42 A;  1ZXT A;  2J7Z A;  1S5E D;  3H0G B;  2F0N A;  2F0D A;  5FO8 B;  5C44 B;  2NBF A;  4IFD J;  1I6V C;  2XRQ D;  3N52 A;  3QIA A;  3QOL A;  3VR5 A;  4RKB A;  2KOL A;  2A69 D;  4KKU A;  4G7Z C;  2F0W A;  4X3S A;  2NVT B;  1B2T A;  3BG3 A;  2KEC A;  4B9X A;  2ZXR A;  3NWT A;  3KUP A;  5JAV A;  4MN3 A;  5EKL A;  2BDO A;  3HOY B;  3T16 A;  3NWS A;  4X3T A;  4DGZ A;  1A2U A;  3S1Q B;  3GV6 A;  1Y1W B;  1KLU D;  3AMU A;  1I4H A;  1G29 1;  2B39 A;  1ILQ A;  2JSO A;  5LL6 X;  3PIP 3;  1IW7 C;  3PMF A;  4HCS A;  2B2V C;  1FNU A;  1EWC A;  3RZO B;  1SJH D;  2F03 A;  3FDT A;  2R7Z B;  1BF4 A;  4LMQ D;  5JEA J;  2HDM A;  3NXW A;  1NR4 A;  4DN4 M;  1WCM B;  1SE2 A;  5DM6 3;  1O80 A;  2KQ3 A;  3IFT A;  4KY5 A;  3BYT B;  3RUZ A;  5FOB B;  5KYI A;  1BDO A;  2CVR A;  3X3M A;  5JOB A;  4PMB A;  5K36 H;  4ID6 A;  5NUC A;  2OF1 A;  3NTI A;  3R8B A;  4NDX A;  4FF1 A;  1A3V A;  4XQJ A;  3GTG B;  2M00 A;  3IAY A;  1PTO B;  3HRZ C;  2NZ1 D;  2RQX A;  3G7L A;  2F0H A;  4DXF A;  2GA4 B;  1A3U A;  4I7Z C;  2NN6 I;  2AQ1 B;  4XDX A;  4TQU S;  2C9O A;  1WTR A;  1F9R A;  5C0X I;  4KN7 C;  2XIW A;  2F0V A;  2E2D C;  5G3L D;  1HTP A;  2KED A;  1ILP A;  4LJZ C;  2MP1 A;  1FYC A;  2K33 A;  5CMD A;  4ABN A;  1SXT A;  1RCV D;  3A8K E;  3NP8 A;  1TWF B;  3FPP A;  2EZV A;  4FVM A;  3WOF A;  1PZI D;  2Z4H A;  3OSO A;  4U67 3;  2FIN B;  4C3I G;  3NQT A;  1R9T B;  3P7J A;  4OHJ A;  1YNJ D;  2FFK B;  2PQE A;  3VR3 A;  5IGC A;  2CW0 D;  3N6R A;  4DNT B;  4DK0 A;  3MVV A;  1STH A;  1PTO C;  2Q8R E;  3OIQ A;  1B50 A;  1EYC A;  5I6W A;  3DWQ A;  2E2H B;  2JEA I;  2ENB A;  2F0K A;  5IOD A;  1QNK A;  2B2U A;  5K36 G;  2BE5 D;  3MA2 B;  1STG A;  2XNA C;  1RTN A;  1M8A A;  2NN6 H;  4DAP A;  1VF7 A;  2G9H D;  4CGY B;  4K5V A;  1Y8P B;  5CV5 A;  4IZ8 A;  5C0X H;  4WFN 3;  5ELE A;  3H94 A;  4G57 A;  1LTT D;  3TBI B;  2DY8 A;  1TT2 A;  3I72 A;  3KK7 A;  4I65 A;  2LKV A;  2B2Y C;  3TP5 A;  2PMZ B;  5T1I A;  1VF5 C;  1B53 A;  1CHP D;  1OXX K;  3BZD B;  1HUM A;  3DEO A;  2X6G A;  4XQQ A;  3J81 E;  1VMC A;  1O78 A;  1SE4 A;  4KI0 A;  1ENA A;  4A3B B;  2L11 A;  4YIJ A;  3BS1 A;  2EDG A;  4UDU C;  4ZLT F;  3T56 B;  5J1Z A;  3SK5 A;  2ID0 A;  1EQT A;  3VA7 A;  2LY7 A;  1EY8 A;  5FO7 B;  3HZX A;  1I4X A;  1AW7 A;  1K8M A;  5CC4 A;  4FNF A;  1CM9 A;  1QIL A;  5AFW A;  1Y8O B;  4K14 A;  1Q3L A;  1JWS D;  4A3E B;  1EZ6 A;  2AQ3 B;  1I4P A;  3PUX A;  1U4L A;  4ZQ3 A;  5I9O A;  3LNN A;  5IGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...