1F2MA

Simplification of a protein loop in staphylococcal nuclease
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYAYAPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Simplification of a Protein Loop in Staphylococcal Nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f2mA00
2EYHA 5CV4A 5EKKA 1F2ZA 3MXPA 2PW7A 1KDBA 1JORA 3H6MA 1EY5A 3NQTA 3NP8A 4KHVA 4E6IA 2SNSA 4IALA 4HMJA 2EY5A 2EY1A 5EGTA 3NHHA 4H7BA 4KY7A 2F0TA 4TRDA 3SXHA 3D8GA 1SNMA 2PYKA 2F3WA 2EY2A 2LKVA 3MHBA 3OSOA 1SNDA 3P75A 5E3FA 2EYFA 2EYOA 3S9WA 2F0OA 3TP6A 4R8NA 5M9OA 5C5MA 4HMIA 4RKLA 4QB4A 5JOBA 3RUZA 4N9PA 3C1FA 4DGZA 2F0IA 3BDCA 4K5XA 1SYFA 2F3VA 4LAAA 5KRUA 1TT2A 2ENBA 5C4HA 1EY4A 4IUNA 3TP7A 5C6AA 4IZ8A 4ODGA 4WORA 1A3VA 1SNPA 5EKLA 4B9XA 3SK5A 3MVVA 4EQPA 5K5PA 3R3OA 5IOCA 3MZ5A 1EYDA 5J1ZA 1EY0A 4KJNA 4NDXA 1KAAA 2F0PA 2PQEA 2PZWA 3EROA 5KGUA 1A2UA 4PMCA 3NUCA 5IGBA 3BDLA 2PZTA 5CV7A 3D4DA 4NKLA 4KTAA 4QF4A 4F7XA 4EQNA 2OEOA 2O4XA 4RKBA 3EJIA 3ERQA 4HTHA 1SYDA 5CGKA 3V2TA 5IGFA 5IODA 3OMGA 4MIUA 4KY6A 1A3TA 1SNQA 2RDFA 5I6WA 3OWFA 5CC4A 5IGEA 3QOLA 2F0FA 3NK9A 3HZXA 3LX0A 2EYMA 4EQOA 5C3XA 1EZ6A 3SR1A 1II3A 5IGDA 4PMBA 4KD4A 2M00A 5C3WA 4YIJA 1KDCA 1SYGA 4K2LA 4K2KA 2EYJA 4K8JA 2F0EA 5DEHA 3SK6A 1KABA 4PNYA 2OF1A 3ITPA 3QB3A 5C4ZA 1F2YA 1STBA 2HQEA 1EYCA 1KDAA 3OMCA 4F8MA 1NSNS 5JAVA 1STAA 4K14A 1TR5A 2PW5A 4K5VA 4K6DA 3EVQA 3P1HA 4DU9A 4ZUJA 3DMUA 4N9TA 1SYEA 1EY7A 1A3UA 4I65A 5CR3A 4KV6A 2KHSA 2QDBA 3HEJA 3MEHA 2F0QA 5J22A 5HGTA 3TP5A 3SK8A 1EY6A 1EY8A 4J6HA 2F0UA 3NXWA 5F2DA 1JOQA 5IIFA 3T16A 1JOOA 4OL7A 5ISRA 3E5SA 4S3SA 2SOBA 5CV9A 2EXZA 1JOKA 4KD3A 2F0SA 2OXPA 4G57A 5I9PA 2SNMA 3QOJA 1U9RA 2F0VA 1A2TA 5NUCA 5HURA 2F0MA 2EYPA 3TP8A 3D6CA 2F0NA 5I9OA 2F0DA 2F0HA 1SYCA 1ENAA 1STHA 2RBMA 3PMFA 5CV8A 2F0GA 1EQVA 5IGCA 5KEEA 4K5WA 1SNOA 5DAUA 2WACA 4J1MA 3D4WA 1EY9A 5CV6A 2NUCA 3SHLA 1SNCA 4DF7A 4NMZA 5KYLA 4B9WA 1TQOA 3SK4A 3VA5A 1SYBA 4KJOA 1STYA 4KY5A 2PZUA 4ZUIA 1STGA 1RKNA 5KIXA 3U9OA 3TMEA 2EYLA 1AEXA 1ENCA 4EVOA 2F0KA 5C5LA 4DFAA 5KYIA 1EZ8A 2F0LA 4ME5A 1F2MA 1NUCA 2F0WA 4ID6A 5E1FA 4NP5A 3T13A 5I6YA 3C1EA 1EYAA 2KQ3A 4ZQ3A 5IGGA 5J39A 4QMGA 5CV5A 1STNA 4K8IA 3DHQA 2EY6A 4WRDA 2RKSA 1IHZA 2F0JA
chains in the Genus database with same CATH superfamily
2EYHA 4DR2L 1A0IA 2A6ED 1GO3E 3PUWA 4CKBA 1IYJB 1ASYA 1STEA 5EGTA 3NBHA 5JEAG 2LKVA 3T1YL 1GUTA 1L2FA 5DLQE 4DR7L 3G48A 2I46A 4ZAIA 5C5MA 4RKLA 1GHKA 1XX8A 3CKIB 2ZXOA 2Q2HA 2N78A 3BDCA 3KK7A 3J81i 2VNUD 4GN4B 3K59A 1EY4A 1OXSC 4AYBE 2R6GA 4A3CG 2JA6H 1HNWL 5EKIA 4WORA 2A6HC 2UXCL 5K5PA 4JK1C 3HOVH 1ILQA 1PRTF 1QWYA 2PZWA 3S1QH 4TKOB 3KF8B 3GTLH 3CCSA 2OEOA 4A4IA 2WKCA 1O7LA 3ERQA 2JN4A 1CQVA 1K3RA 5FO9B 3MEFA 1MSGA 1HUNA 3PV0A 2AWOA 4POGA 1DZ1A 4UP9A 2EYMA 3I4OA 3SGIA 2NVTH 1RL2A 2B3GA 1DOMA 4PNYA 4IFDH 2HQEA 2BOSA 2MP1A 1XNQQ 3KLSA 5JAVA 2YTXA 1JWSD 4K6DA 4K5VA 1QVCA 4DU9A 3DMUA 4XT3B 1X65A 3OTOL 4I65A 3GTMH 3S1MH 2FMCA 4CDFC 4B08A 1Q7YC 4WJ3M 3E9IA 4A3KH 4JI8Q 1PH8A 4XQNA 3CCUA 1EIHA 5HURA 3HOYH 2XWBB 1SROA 1I3QH 2KA7A 3CCEA 4JBMA 5KNCA 3JC66 1WTOA 4DV7L 5CV6A 2I5LX 5A2QE 1BVSA 1YEZA 4HCSA 2B63B 4A3IG 1HNXL 1ZXTA 1IBML 4C3HH 3M9BA 1AEXA 4C56C 1NR4A 4EVOA 4IJLA 3S1NB 4OO1I 5I6YA 5ELDA 3DXJC 1ML0D 3I2ZA 5J39A 2OTJA 1STNA 2EVBA 2K28A 4O1NA 2RHSB 1RDPD 2E2JH 2E2HB 1J8IA 4IURA 4RHSA 3VA7A 1BBXC 1N34L 3H6MA 4KMUC 1EY5A 4UAIA 1B9NA 5JVH3 4A3JG 1CKNB 5T1IA 5C44G 1RTOA 1NY4A 2CWAA 1EWIA 2F3WA 2A6HD 3GTQH 2UUCL 4K0KL 3FPUB 1H9SB 1HJPA 4GNXB 3T1HQ 1P8LA 4I7AA 2VXWA 5BR8L 1C9OA 5DNFA 2NTSA 2A5HA 5KNDA 3Q24A 3S15H 3A7AB 2Z9HA 1PH1A 5D3IB 1U4RA 1CA5A 1D1IA 5LMNL 2BDNA 4DN4M 4PMCA 3NUCA 4NXMQ 4JYAQ 3DM3A 1R4QB 1PFBA 2EE1A 5C0XH 3CCRA 1V1QA 3WWVA 4TVAB 3M4OH 2FXQA 2SEBD 1Q1BA 3AFPA 2NZOA 2C35B 1PTOH 2XNAC 3TZUA 5IWAL 1EZ6A 1N33Q 4KD4A 4A93B 4K2LA 2L5TA 2R93H 2L0CA 4EX5A 4DR6Q 1RF2D 4WJWA 2X69A 1PZKD 5G3LD 1XYIA 1BCPD 1D7QA 2VQFQ 3P7JA 2DJGC 3CHBD 2NBFA 3RZDB 1TR5A 2PW5A 2NWGA 3FPPA 3KF6B 3NBIA 4MN3A 4XDXA 2QGQA 1VQ6A 5CBEE 4OWXB 3B6YA 1VF7A 2VZAA 2ZTEA 3NSWA 2ATWA 1V1PA 4A3GH 1O7ZA 1IL2A 3NTKA 2NN6H 1KTKA 1CUKA 1N8RC 1A2TA 4JI7L 1YNJC 1VQ7A 1HR0L 1G8ZD 2Q2TA 1SFOB 5M5WB 1GUWA 1SNOA 2Q2IA 1T5EA 4UP8A 5KYLA 1JC7A 3V05A 1I5FA 1EOTA 3TMEA 3C3LA 5KYIA 4NP5A 1GOZA 2E74C 2A19A 4QIWB 1PH3A 4A3IB 5LMUQ 5EKKA 3NTHA 4LF6Q 3OPOA 4X66L 1D5XC 5FO8B 4B3RL 1H9JA 1N36L 1LYLA 3QG1A 3RZOB 1BBUA 3Q6SA 1EYGA 3S2DB 2PYKA 3P75A 1ICFB 3GTPB 4C2MB 5GADC 4YCVA 1E1OA 3BDOA 4B3SQ 4APVA 4A3JB 4A3KG 2F3VA 5KRUA 5C44B 1LM0A 4IUNA 3DEOA 3HOYG 1HNZL 4ODGA 2K6AA 2NZHA 4KJNA 1KAAA 2E5LQ 4R1JA 3DM1A 4QF4A 4RH6A 1WTVA 2I5HA 2B2VA 3TRZA 2EZVA 4MIUA 4C3HG 5M5XH 1LTAD 4DR1Q 1G51A 5ELNA 1MBYA 2A68C 3H0GH 5GAEC 3W1GA 1KDCA 2CKZB 4YCUA 1LTGD 1VQIA 1LT5D 5C4ZA 1KC8C 1STBA 3KDFA 5AJ3L 4IOCA 2GN5A 4GNXC 3C46A 1TVXA 2XSCA 1XMOQ 4BA2I 2Z6BA 3A8KE 4L63B 4DAYA 3Q23A 2K5DA 3HOWG 1A3UA 3WOFA 2TSSA 3BZCA 5HGTA 2O5IC 5HY6A 1K28A 1SE3A 4GKKQ 1W2BA 2SOBA 4HSVA 2F0SA 2UUAQ 5GAHC 4WFN3 2X6GA 5A2QL 2A1AA 2AMCB 4IPGA 1X9NA 3J7YW 3K5NA 5IGCA 3M7NA 3S1RH 4DV6Q 1GKHA 2HD3A 2JA6B 3GTJH 2KEDA 4MHEA 4ZUIA 3H15A 2IHFA 3Q8DA 3HOVB 3HS0C 3S14H 3MXGA 5C5LA 2CQOA 5FLMG 4ME5A 2F0LA 2DN8A 4PG3A 3S1QB 1B2TA 1J9OA 4HJAA 3GTLB 1HTPA 1YBYA 4HCEA 2BA1A 2R93G 4DNTB 2PW7A 4QY7A 1O78A 3NPPA 4DV4L 1B53A 3CCJA 5EAYA 1MIUA 3KYHC 4E6IA 1C48A 3GTOH 2XWJB 4H7BA 1EL0A 1GJXA 2NVTB 1SRUA 2AWNA 3OIPA 4DV0L 2EYFA 4JI0Q 3S9WA 4R8NA 2HIXA 4A3GG 3AFQA 2D9UA 3C1FA 2NN6G 3I4MH 1WOCA 2MO0A 1EQRA 1SAPA 2G5DA 3KOJA 3GTMB 1VQ5A 1PMRA 1O7YA 2JE6I 4LF9L 1XXGA 4X3TA 4DV5Q 2MJ8A 3HOUH 1WTXA 2HHHL 2WINB 3TEHB 4A3DH 4A3KB 1U4MA 2B2TC 1I4GA 4NKLA 2Y0SE 3HOYB 4F7XA 3RN2A 2QKIC 1I3QB 2GVBA 2IHEA 3J7A5 2IL8A 4DAVA 4HJ8A 2X6LA 1VQMA 2F0FA 2A73B 1UE7A 2NZ1D 5IGDA 2M00A 4KN7C 2ASBA 3ND8A 1SYGA 5ELOA 1G6PA 1F9RA 1UNSA 3W3AA 4C3HB 2LFNA 1TKWB 2QILA 4FO2A 1JJCB 3CMAA 2IX0A 4NXNQ 1KRTA 5FJ8H 4JI7Q 1G2TA 3U58A 3QWNA 1BR9A 1FYCA 2JA9A 2E2JB 1RODA 4ZRZA 1KAWA 1JOQA 3TQYA 4A3MG 2LXKA 1ONLA 3HOWB 4EQ5A 2CW0D 4UHVA 5ELEA 3VYUA 1HFNA 2LMCB 1ENAA 1EIFA 5D3DA 3O13A 3MXUA 4K5WA 3HGBA 1YJ9A 1XTCD 2WIIB 2K52A 4J1MA 1LACA 4G7OC 4NMZA 1VF5C 4OHJA 1QVGA 5JEAH 1SSOA 1HFGA 3S15B 2F3IA 4JPBW 3G71A 2PO4A 1IKMA 3EQLC 1K0SA 4OWWB 3DWPA 1I4PA 3FMCA 3PQIA 4PZ8A 1BQQT 3MXPA 3M4OB 2BE5C 3J7AV 1BNZA 1PTOB 4DNIA 3HKZE 3NQTA 4MTKA 4YHHQ 3D0FA 4JI8L 3D8GA 1GM5A 1DOLA 2R93B 3TP6A 1SR3A 3A5UA 2Z6KC 4GKJQ 2F03A 4DGZA 2NYZD 3LNNA 1MSHA 4ZLTF 4B9XA 1TWGH 3K5MA 4F88A 2J7ZA 4Q0FA 2EJFC 1ASZA 4A3GB 1PV4A 2L55A 4AQYQ 4IFDJ 1CTMA 1K73C 1F2LA 2C9OA 2R7FA 4CJ2C 4KKUA 1S5ED 1VQEA 5I2YA 2NVQH 4X3UA 1RD9D 2V1CC 1PVOA 1JICA 3BZKA 3IAYA 3BU2A 1LTID 1O80A 4OIKA 4YWMA 1GUOA 4Y7NH 1TY0A 2QF7A 3EN2A 1BBWA 3ITPA 1NSNS 2EIFA 2WP8J 2K32A 4CJ0B 3QO2A 3T1HL 2RVLA 1H95A 4LFAQ 1IKLA 2PQAA 2M2LA 4A3IH 1PRTB 3LWUA 2F0UA 1VCIA 1I50H 4OL7A 3HRZC 1QZHA 2G9HD 4A3LH 1S5CD 1N9WA 1EWHA 3I4MG 3QIAA 1NAPA 3CQZB 5NUCA 4NXML 2EYPA 4JYAL 4CJ1B 2ZTDA 2KCNA 3KFUA 4RCOA 5KEEA 4JOIA 3GTPH 1U5KA 2BA0A 1EQVA 3HOUG 3TREA 2LS01 3D4WA 3Q22A 4A3MB 3GTGH 4A3DG 1B3AA 1L0YB 4R4TA 4JI6Q 1DCZA 1DXMA 3CD6A 4B9WA 1N33L 3RNUA 3IRBA 4LF5Q 2PZUA 1BOSA 4N8X1 4XT1B 2F0KA 1GHJA 1XJVA 5E4WC 4V190 1CM9A 2VQFL 3C1EA 4QMGA 4BBSG 2NN6I 2WV6D 1G291 4DV0Q 3JAME 3RN5A 3S16H 2DY7A 4IQZA 5CORA 4ULLA 5FJ8G 2RHQB 4KY7A 4TRDA 1AN8A 2WAQE 4G4KA 4JBWA 2RSNA 1YHBA 2C5CA 1LT6D 5LMNW 1MD2D 3I90A 4UP7A 5C0XJ 4O0AA 2F4IA 4HJ9A 4K5XA 3KJPA 3K80C 4MTNA 1CZWA 3E0JA 4QQBX 1HCZA 4RGNA 2K5QA 1QG7A 4P75A 4RGMA 1CKOA 2IWHA 4FF4A 2ZXRA 1GUGA 1KLGD 5CV7A 1DD2A 4EQNA 3VR4A 1SLJA 3E0EA 4DV3Q 4X3SA 3URYA 1EIYB 4KY6A 5LMUL 1PTOC 4LF6L 1JB7A 1HQMC 3CPWA 3S1RB 5K36H 5EQ0A 1BKBA 4ZYSA 3GTJB 4K8JA 3CRLC 4HIDA 3S14B 1RTNA 2XIWA 1VQCA 1MGSA 4ZUJA 4IUPA 4B3SL 1EY7A 1K8AC 1LABA 3NWSA 4KV6A 4HJ7A 4AYBG 1DGSA 1WYDA 3TP5A 1EY6A 3OWEB 1SE8A 5CMDA 1HZBA 1UEAB 5G3LF 1BCPF 3GTOB 1VQFA 4LNQA 1XMQQ 2E5LL 2PI2A 2D0PA 3TP8A 4L5QA 2F0NA 5I9OA 1E1TA 3MFYA 3I56A 1SYCA 2D0OA 5JPNC 1IYVA 2PNHA 1QUQA 2A74C 2K5VA 3OOCA 2B2UA 4X65Q 3HOXH 3I4MB 3SHLA 4DR1L 1ET6A 1E2VA 3SK4A 3MXNA 5M5YH 3VA5A 1XPRA 2WB1G 1HPCA 1SBBB 2B2YA 2TMPA 1TS5A 3HOUB 2KBNA 2KECA 1QNUA 4A3DB 1PYWD 2PI2E 1XMOL 3FEWX 1G6ZA 1PRTC 2JEBI 1EIGA 1Q46A 2QEXA 1WFQA 1FNUA 1I6HH 2K01A 2EXDA 4GKKL 1N32L 2FFKB 3CC7A 4BBSB 3IKJA 2UUAL 2CVRA 2CFMA 4RGTA 1SNDA 2ES2A 4JW0A 3PIPA 1R4PB 1IBKQ 1PDQA 4QB4A 4OIJA 2F0IA 4A3LG 2IX1A 4QIWE 4DV6L 5FO7B 4IZ8A 2UUBQ 2HDMA 3CF5A 4KHZA 1EU4A 2B29A 3VR3A 1RCVD 1PZJD 1UE6A 4KK7A 1A2UA 1QB5D 4R4QA 2J0TD 3HOWH 1H9MA 2MO1A 3A54A 2R3ZA 3K6OA 1WTRA 5IGFA 1AP0A 3K0XA 1C0AA 3VYTA 3GP7A 2RDFA 5I6WA 3LX0A 1II3A 2F4VL 4GOPA 2VS1A 2QA4A 1OXVA 4JI0L 1E24A 1CFMA 1SYEA 1Q82C 3L9AX 2VB2X 3GO5A 3RLFA 5JVG3 3SK8A 2EOTA 1EY8A 2K5NA 4HN7A 4RGOS 1M8AA 4DV5L 2K04A 5FLMH 1PLFA 1NJIC 1FD7D 1NTGA 1P16A 1SEBD 1E22A 3JAMc 1Q3LA 4AYBB 2HQLA 1VQOA 3PMFA 3JAMi 2F0GA 1TWFH 3L0OA 4ME3A 1TU2B 1Y69U 2AQ3B 3NBHB 4G7ZC 1PFSA 1HZ9A 3GQBA 1I6VC 1TWGB 3A8JE 4DR3Q 1J5EL 1QOHA 3JAML 1Y1WG 2F0WA 2SDFA 4M8AA 5K36G 3X3NA 3NWTA 4NXNL 2WB1B 1OXXK 4ILWA 2NVQB 2EJGC 2FINB 2FMMA 4HR7B 4YY3Q 3A0JA 4JBJA 1AZPA 2LY7A 1JJ2A 3OSOA 4Y7NB 3STBC 3MHBA 2F0OA 3DWQA 5CBAE 2MHVA 4OELB 2D62A 5EBDA 1HRJA 4X6AH 4N9PA 1SYFA 2L15A 3BYYB 5D65A 1QNKA 2HCCA 1I50B 1E2WA 3OHXC 4NDXA 3PCOB 1X3PA 2F0PA 4WJ4A 3HOXG 1L1OA 3CQZH 3GV6A 5CGKA 4RG1A 2EQSA 1IW7C 4C3JG 4DAMA 4BY7H 3U4ZA 4L8JA 3GTGB 5C3XA 5COYA 3NQIA 4A3MH 3KLRA 2B2WC 4YHHL 3F2BA 4KKTA 3SK6A 1YNXA 1AE2A 5C3EH 1M90C 1KDAA 1XWEA 1CKMA 1W6JA 1B8AA 3EVQA 4GKJL 1JCKB 2CH4A 3U50C 1R9TH 3CRKC 3HEJA 4PZ6A 1VDZA 2K5HA 4JI5Q 3S16B 3E5SA 5JEAJ 1PYBA 1YHAA 1JJGA 4J8QA 4AQYL 1WCMH 2VQEQ 3EA6A 1ET9A 2N49A 3UE0A 1D5ZC 1LTLA 5CV8A 2RBMA 1L0XB 4OXPA 1HUMA 3G7LA 3HOZH 3UDGA 5LL6X 1SDFA 4IN3A 4DKAC 3K8AA 1G2SA 2O2LD 5D14A 1YNJD 3EIVA 3HKSA 4RHRA 2GVAA 1N32Q 1NMFA 1D8LA 1T9HA 2JK8A 4X3KA 1FVIA 3N52A 1SE2A 3DHQA 1K0RA 4BY1G 4CDDC 1JMCA 4V0BA 4MZ9A 2F0JA 3STBD 1ESFA 5CV4A 4XYQA 2ZJPA 4LFAL 1F2ZA 2A69C 4LFBQ 4QUFA 3PIOA 2OQ0A 3I55A 4UPAA 1C8CA 2NVXB 3NP8A 2JYOA 2EY1A 1B9MA 2F0TA 2Z1CA 5M9OA 5BN3A 3RUZA 1U4LA 4RFBA 1TT2A 1OO9B 3A55A 4JI6L 5IYCG 1AZQA 5FOBB 1SNPA 5I2XA 5LHY1 2AUKA 1IW7D 3R3OA 4LF5L 2HIVA 2CH4W 1EYDA 3ICEA 2LXJA 1CT1D 3N6RA 2PQEA 2F4VQ 5DM63 3OW2A 3D4DA 2KCCA 3I4NH 1SJED 4DUZQ 1EU3A 1B4OA 3EJIA 2B8GA 3I3CA 2VUMH 4FXKC 3GV3A 5CYUA 4DR5Q 3OWFA 1L0WA 4U673 2JEAI 1I4HA 1QZGA 4BXXG 3A8IE 1V1PB 4GLXA 3HOXB 4H13C 2YU9H 5M5YB 2L4NA 4J15A 2EYJA 1TWHB 4A3FH 1A6XA 4C3JB 1F2YA 4L5RC 1Y14B 2DGYA 1U4PA 4K14A 4IPDA 2K50A 1Y8PB 3KUPA 2A68D 1A15A 3I72A 3J81j 3PIP3 3F2DA 1FJGQ 2Q8RE 3D4RA 2BDOA 2VL6A 3GDEA 1I6HB 2EXZA 3TS2A 1B70B 2E8GA 3MA2B 2K4KA 2JJQA 4BBSH 3F8TA 1J5EQ 1S5BD 1HZAA 4RAUC 4DV3L 5LL6S 1J6QA 4X64Q 3F1ZA 2LSSA 2JXMB 4IJHA 2EDGA 1ESRA 1Q8IA 1SNCA 2R7ZG 1STGA 1F9PA 3HP3A 2A69D 1Z47A 4GLAC 2JP1A 3U9OA 5IY0A 5KIXA 4BY7G 3HFZB 1F2MA 4DV1L 4QCLA 4NPSA 5ELBA 5IP9H 1BO0A 4JI2Q 4YWLA 1Q86C 2EY6A 1TXYA 3AEVA 3RD4A 1YITA 2I07B 5C3EG 4JV5Q 1K8OA 3I7FA 5ELFA 3VDYA 4HIKA 2M9VA 4DXGA 4BY1B 3DLLA 1BF4A 3K7UC 3FRPB 1XMQL 4ZK9B 3U4VA 4O42A 3A5ZB 3K0YA 4N8FA 1U0LA 3WOEA 3CXCA 4B3ML 1D6EC 2UU9Q 2AHOB 3F2CA 1SXTA 2WFWA 4I7ZC 4X65L 1WCMG 2XN9C 4QGUA 2XRQD 1YNNC 3KDFB 1K3BC 1EY0A 3HOZG 1QVFA 4DAYB 3P20A 3HG9A 4FXDA 2O4XA 1WTPA 2GA4B 1GVPA 1DJRD 4C1NK 4PMWA 1TWFB 1WD1A 1D2BA 3HKZG 4EQOA 2V4DA 1EEFD 1I4XA 2R92G 3KLWA 5DEHA 3NE5B 1D1KA 3TBIB 3D3RA 2XTIA 3NENA 3OMCA 4CBVA 3H3VI 4LUZA 1KNAA 1LO5D 1IBKL 3KF8A 5ELCA 3BZDB 2KHSA 5IYBG 3QJYA 3MC0B 3UE1A 2UUBL 2KUMA 3K81C 4DR4Q 1EWCA 4JI4L 3A74A 4YWKA 1S4ZA 4GLVB 4IPHA 1VQJA 1HH2P 4OX9Q 1NNXA 1WD0A 4UY8C 1DYQA 2WACA 4KI0A 3G6EA 2KHIA 1SN8A 3I4NG 2VUMG 2RDHA 3PUXA 2A6EC 3IFDA 2MNAA 4IUQA 2R7ZB 4DK3C 4LK1C 4P74A 2D5DA 5M3FH 5IT9c 1MI2A 2B39A 3GD7A 4RA8A 4A3FG 1KDBA 1UAPA 1JQYD 1JORA 1BCPB 4A3EG 4BY7B 4PZ7A 5JPMC 1A62A 3CC2A 2Z0SA 2SNSA 4IALA 2KVMA 4HMJA 1KL9A 3NHHA 2ZM6L 5C3EB 2AKWB 2BE5D 4BS9A 4CKCA 2ZJQA 5IT9L 1UWVA 1R9TB 3L2PA 1JE4A 1Z6HA 4LWCA 3SVMA 1PA6A 4JI3L 1A3VA 3FHWA 3SK5A 3MVVA 1CK1A 2ZXPA 1Q12A 4DR3L 3D31A 1Q90A 5EBCA 3PO3H 4BBRH 3M3YH 4JC0A 1CKNA 4P72A 1ILPA 3TS0A 1Z7TA 4LFCL 3FP9A 1WCMB 4RKBA 3J80c 2KCMA 2MFIA 2UXBQ 5JJLA 4XXEA 4ZCKA 2BH8A 3W1BA 1H9SA 5CC4A 5T1GA 3NK9A 3HOZB 4DK0A 3VYSA 1NMGA 1TWAH 5IP9G 1PH6A 3ULJA 5C3WA 1RIPA 2B2VC 5GROA 1VQAA 2Z4IA 4YY3L 4A75A 2NVYB 1W3SA 2RQXA 2WAQG 1GD7A 1EYCA 5E4XA 5L37A 1NCVA 3K57A 1STAA 3HKZB 3J80L 2IY5B 2KENA 1NR2A 4DA2A 5FLXc 4FF3A 2R92B 3MEHA 4XQJA 1O7IA 1PFMA 1S5FD 4J6HA 1TS3A 5F2DA 3D6WA 1I4QA 1LTSD 4S3SA 1Y1WH 2NVXH 3RMHA 4BWGB 1B50A 3AB9A 2F0VA 4KHPL 3ER0A 4FYDA 1VMPA 3BVMA 4R4CA 4DUYQ 4MNOA 1EQQA 2IJ0A 1YHQA 1QILA 4DV1Q 4LJZC 3A56A 1XTDA 5FLXL 2AQ1B 1EY9A 3MTSA 4IUVA 3KF6A 2OCEA 1HR0W 2PCFB 1VQ4A 2RA4A 1SE4A 3J81c 1RKNA 2EYLA 1YJWA 4XTCS 1VQ9A 1SJHD 1XNRQ 1WTQA 1EZ8A 4ID6A 5JJIA 2ICEC 5AFWA 1LTRD 1HTLD 1X6OA 3I4NB 3NTIA 2VUMB 1KLUD 2Q8IB 3A7LA 1PFNA 3L3OC 1ZKOA 4B3MQ 2YTVA 3H09A 4KHVA 5EPLA 4JI5L 3H94A 1X3GA 3MAQA 1WI5A 1HA5A 3J81L 1WTWA 2YU9B 4A93G 3UDXA 1SNMA 2H4OA 4JI1Q 2VQEL 1TWHH 4A3FB 1LLRD 4A3EB 4C3JH 3I91A 2DNCA 2L11A 4IOAA 2E2IB 4QUCA 2ICIA 2WB1E 2B2TA 3I70A 3R93A 1X54A 2PMZB 2A8VA 2QEJC 4KKSA 1F9QA 2N8NA 4CHTB 1QCBD 3EROA 3FDTA 5IGBA 1E7ZA 3M4YA 5GQOA 3CCQA 2N88A 3PGZA 4OONA 1SYDA 1X3FA 2PQAB 3S24A 5BN4A 5IODA 4LW1A 1BCPC 2DUDA 1SNQA 3E3XA 2JA5H 5IGEA 2K05A 3QOLA 4RCNA 4LFBL 1UEBA 2DNEA 1TS2A 2PPBC 3SDZA 4G7HC 4PMBA 3NEMA 1CSQA 5M3FG 3NELA 1KABA 1KIXA 2OF1A 3H3VH 5BN5A 2J4XA 3K7AB 4F8MA 4JI4Q 2Z4HA 1PTOD 3KBXA 3P1HA 1MJEA 4OGQC 1WTHA 3CCVA 4JCVE 2WAQB 4FXGC 2JQOA 3TSSA 2RCNA 3I73A 3NXWA 4AIMA 3T16A 5IIFA 1OXUA 3GTKH 4KD3A 1D5MC 3T4AC 2SNMA 3QOJA 1ENFA 4R8IA 2OWOA 4ZKBB 4BY1H 2N3SA 1VS0A 3S2HH 4DUZL 2UXDQ 3PO3G 2OQKA 4BBRG 4DR5L 2AQ2B 1V8QA 1CHPD 1UUPA 2KEEA 2BH2A 1STYA 1K83H 1YIJA 5IP7H 1IBLQ 5EPKA 2KJXA 3UDFA 1VMCA 5E1FA 4LF7L 1Z9FA 3T13A 2IPKD 2KQ3A 4AH6A 4UDUC 2ZM6Q 2RKSA 3J7ZC 3MFGA 1KQSA 5IYCH 3UDIA 2L1BA 2K1BA 3BS1A 1E2ZA 1T5XD 1FJGL 2Z6KA 3EBEA 4L6TB 2L12A 1LV9A 1TWCH 4DK6C 1C4QA 4HSPA 2Z8LA 4JI3Q 1GUSA 4H0LC 2CWPA 1PRTD 3PO2H 3FVQA 4H02A 1YI2A 1A63A 1C7YA 1JE5A 2K33A 1K9MC 1K8GA 4HMIA 4BXXH 3KBGA 3CU7A 4LFCQ 4IUUA 4TQUS 4X64L 2XGTA 2ENBA 5C6AA 1VQNA 4R9WA 1RJTA 1LTBD 3S17H 1FL0A 1KHIA 2ALYB 2DY8A 4LF4Q 3M85A 3DEPA 3UI2A 1BXTA 3E6ZX 1Y8OB 3OYYA 4OWTB 3R8BA 4JI2L 5M3MH 4B3TQ 2JA8H 1JWMD 4RWSC 1CHQD 3H91A 3C2PA 4JV5L 4L5TA 1KNEA 2JA6G 4YIJA 4RMFA 5HGQA 2VY3A 1PH9A 1GUNA 4TSSA 3HOVG 4KN4C 1H9RA 1IXRA 1QUQB 2D2CC 1GXDC 3LGJA 4KHPQ 4N9TA 5CR3A 2BCOA 1JWUD 2UU9L 4DR2Q 4EGVA 2R7ZH 5M3FB 2F0QA 3FKIH 3MXNB 4XQQA 2OT2A 3V96A 2EPBA 3R2IA 4KLKA 1MJCA 1FNVA 4JG2A 3T51B 2CCZA 1FR3A 1XPUA 3LWEA 4Z9CB 4HIMA 2VB3X 3T1YQ 4DR7Q 4IFDG 1S40A 2JA7H 3IL8A 1STHA 4DNRB 1HNWQ 1M4VA 2CHBD 4FNFA 2CQAA 2UXCQ 1BDOA 1EFWA 1EEID 1FNWA 1CI3M 2E2DC 4JOIC 5IYDH 1HHVA 4FF1A 1Y1VH 4GN5A 2JA5G 1HZCA 3SE0A 3PO3B 2E76C 1NUCA 4BBRB 3M3YB 3VR5A 3W2DA 4C3IH 3W5OA 2RF4A 5CV5A 2XRSD 4K8IA 1CZGA 4O2DA 4BA1I 1IHZA 1LTTD 2OTLA 2B8FA 5TSSA 2KCTA 1OXTA 1PH4A 4DR4L 5EPJA 1TWAB 3KLSX 1G91A 1VQLA 3SXHA 3WDNA 1PH2A 4PV1C 3IFTA 4OX9L 4DV2L 1FGBD 2NVYH 3CW2C 5E7NA 1TY2A 4OEMB 2PNRC 3BVGA 3OTOQ 4LMQD 3I8ZA 2L9HA 1KD1C 5C4HA 2R92H 2VW9A 4GOPB 1AE3A 4GZYC 3MZ5A 3TN2A 1AW7A 3BYTB 5J1ZA 4Q5VA 1VQPA 1H9KA 1DOKA 1Y1WB 1HXYD 3BG3A 5C4JH 4A3BH 3ULPA 1SMXA 1DM0B 4POFA 5C4XH 2WKDA 5IYBH 3OMGA 2XVSA 5IP7G 1I94L 4DV7Q 2KOLA 1VQBA 4A76A 1HQRD 1HNXQ 2HUGA 1IBMQ 1KRSA 3BVZA 2O5JC 2F0EA 1VQHA 1TIID 2NB0A 4YCWA 4P2CB 5KNBA 4LUOA 1HA6A 1YVCA 5IT9E 2CW0C 3OIQA 1NBWA 5C0XG 5GAGC 1E0BA 1CSPA 4ZKCB 2EJMA 1N34Q 3PO2G 1JB3A 4OO1H 1JOOA 2HT1A 3K5OA 5CV9A 4LUVA 5I9PA 4DK1A 1MKHA 3ND9A 3I4LA 1B44D 1EUJA 1QE6A 3K58A 2UUCQ 4K0KQ 4M1UB 3D6CA 1E3PA 1AH9A 1I4RA 5FKAC 4LF7Q 5A35A 1AFPA 4A3EH 2UXBL 1K8MA 5J3BA 2E2IH 5BR8Q 4DF7A 1PH5A 1X3QA 3T53B 4LF8L 1S3OA 1B1ZA 1VQDA 4KJOA 3PF5A 2IW3A 3CMEA 5M3MG 1WVLA 2JA8G 1WJJA 3E9HA 5LMNQ 4L5SA 4DPGA 2B2UC 5I4DA 3J80E 1EYAA 4ZQ3A 1XPOA 1VQKA 4WRDA 2K14A 4X62L 2MQHA 2Y0SG 4U68A 3S1MB 2B2YC 1VQ8A 2JSOA 1S72A 2JA5B 5IWAQ 4HJ5A 2Q2UA 4K6LA 4ALPA 4R4IA 4CKEA 1L1OB 1ICWA 2HCIA 1IL8A 4CDCC 2MUYA 1SMYC 3FKIG 1EQTA 2EY2A 1KXLA 2DJFC 3QR8A 3J7AF 4DUYL 3K7AH 5JOBA 2QCPX 2FHTA 5FLXE 3TDQA 1LT4D 2HDLA 3RR5A 4LAAA 4GN3B 2YYZA 2B63H 4HAEA 5EKLA 4P73A 2JA7G 4Y52H 5IOCA 3CAMA 2ZTCA 3GTKB 5KGUA 3S1NH 1XNRL 3DWAA 1HR0Q 4IO9A 1ZEQX 2NTTA 4QJFA 3AQQA 1QJOA 2QDLA 2E2HH 3S2HB 4F87A 3VR2A 3M4QA 5IYDG 1A3TA 1Y1VG 4FF2A 4FP5D 1EOVA 3X3MA 2RCFA 1ZYRC 4C3IG 3J81E 1LUZA 1K83B 3GTQB 2F1MA 3QB3A 5DM73 4IUTA 4IFDI 4JI1L 3AYHB 3Q0AA 2N55A 3CCLA 2F52A 3PUYA 2H5XA 5J22A 2QDBA 1V1OA 4GOPC 4X66Q 3CCMA 4B3RQ 5EJWA 1B7YB 1N36Q 3PSIA 1V9PA 5JJKA 2IT1A 1XNQL 3OW7A 2P5ZX 3H0GG 4G57A 1U9RA 4HEDA 1TWCB 1B3QA 5JJZA 4A3CH 1Q81C 3CPFA 1F77A 3PO2B 3M4PA 1BUVT 4XIGS 1Y8NB 1CA6A 3U9SA 3CP0A 1F9SA 2NUCA 1HNZQ 4A3BG 3AMUA 1TQOA 3PF4A 4A93H 1YZ6A 2ID0A 1SYBA 5C4XG 1Q1EA 1OTCA 3S17B 1M1KC 3AU7A 1Q8KA 1JR0D 1UE5A 2YTYA 4DFAA 3RZDH 5IE8A 1UE1A 3EFXD 2E75C 1S5DD 1SMYD 2H1EA 4DV2Q 5M3MB 3VYRA 3R2TA 2JA8B 2AUJD 1EFID 4GS3A 3G4SA 2I0QA 2EY5A 3PUVA 1JT8A 2KHJA 2RSOA 2Y0SB 5E3FA 3RLOA 4XYOA 5AJ3Q 4FVMA 1SFOH 2EYOA 5M5WH 1YJNA 4OO1G 1PYSB 5H1SE 4NB3A 4DXFA 1X32A 3CC4A 2UXDL 1PHJA 1PXUA 3RLNA 1IZ6A 3TP7A 1W6KA 3FKIB 1X56A 4EQPA 1I94Q 3MWYW 3BJUA 1CQFA 1IBLL 4FDBA 4ABNA 1NE3A 1ZYRD 3BDLA 2PZTA 4IPCA 1X55A 4NW2A 4KTAA 2B2WA 4PQXA 4HTHA 1LT3D 5C0XI 3V2TA 2JA7B 4HIOA 3TZDA 1TS4A 1PH7A 1YNND 2IX3A 3PUZA 1X3EA 3HZXA 2K75A 2QW7A 1FGUA 1L1OC 4DAPA 3SR1A 3RZOH 2FJ2A 2R61A 2PMZE 4K2KA 1A8VA 3H3VC 3S2DH 1RHPA 3ERSX 4C2MH 1Y1VB 4A3JH 3VR6A 3ZYYX 4C3IB 5C44H 3T56B 3ONAB 3DUZA 4DV4Q 1VQGA 4R4OA 4P71A 4H44C 1V43A 4DR6L 5ISRA 2I5MX 1PZID 3SEBA 4C1NI 3J80i 1JOKA 1PTOF 2OXPA 3M7GA 4GNXA 4LF4L 4LF8Q 2K7VA 3ZJYC 2Q8TA 2F0MA 3ULLA 2B63G 1MHWC 2RDGA 4JVZA 2F0DA 2F0HA 3PIO3 5M5XB 2K5WA 3F2UA 3KJOA 4B3TL 5DAUA 2K03A 3H0GB 4CGYB 4LF9Q 4X62Q 4KY5A 3K5LA 2G9DA 4JBKA 2MPMA 2HHHQ 2MGSA 3L7ZC 2ZJRA 1ENCA 1IYUA 5FK9C 2ZT9C 5C4JB 5IGGA 4A3BB 4CDEC 2YV5A 2R7DA 4QL5A 3G6JB 5C4XB 1DONA
chains in the Genus database with same CATH topology
2EYHA 2A6ED 3PUWA 4CKBA 1STEA 5EGTA 3NBHA 5JEAG 2LKVA 1GUTA 2I46A 4ZAIA 5C5MA 4RKLA 1GHKA 1XX8A 3CKIB 2ZXOA 3BDCA 2VNUD 3KK7A 3K59A 1EY4A 1OXSC 2R6GA 5EKIA 4WORA 2A6HC 5K5PA 4JK1C 1ILQA 1PRTF 1QWYA 2PZWA 4TKOB 2OEOA 2WKCA 1O7LA 3ERQA 1CQVA 5FO9B 1MSGA 1HUNA 3PV0A 2AWOA 1DZ1A 2EYMA 1DOMA 4PNYA 4IFDH 2HQEA 2BOSA 2MP1A 3KLSA 5JAVA 1JWSD 4K6DA 4K5VA 4DU9A 3DMUA 4XT3B 4I65A 2FMCA 4B08A 4XQNA 1EIHA 5HURA 2XWBB 2KA7A 5KNCA 1WTOA 5CV6A 5A2QE 4HCSA 2B63B 1ZXTA 1AEXA 4C56C 1NR4A 4EVOA 3S1NB 4OO1I 5I6YA 5ELDA 3DXJC 1ML0D 5J39A 1STNA 2EVBA 2K28A 4O1NA 1RDPD 2E2HB 1J8IA 4IURA 4RHSA 3VA7A 1BBXC 3H6MA 4KMUC 1EY5A 4UAIA 1B9NA 5JVH3 5T1IA 1RTOA 2F3WA 2A6HD 3FPUB 1H9SB 2VXWA 5DNFA 2NTSA 2A5HA 5KNDA 3Q24A 3A7AB 5D3IB 1U4RA 1CA5A 1D1IA 2BDNA 4DN4M 4PMCA 3NUCA 1R4QB 1PFBA 2EE1A 5C0XH 2SEBD 1Q1BA 1PTOH 2XNAC 3TZUA 1EZ6A 4KD4A 4A93B 4K2LA 2L5TA 2L0CA 1RF2D 4WJWA 2X69A 1PZKD 5G3LD 1XYIA 1BCPD 3P7JA 3CHBD 2NBFA 3RZDB 1TR5A 2PW5A 2NWGA 3FPPA 3NBIA 4MN3A 4XDXA 5CBEE 1VF7A 3NSWA 1V1PA 1O7ZA 3NTKA 2NN6H 1KTKA 1A2TA 1YNJC 1G8ZD 1SFOB 5M5WB 1GUWA 1SNOA 1T5EA 5KYLA 1JC7A 3V05A 1EOTA 3TMEA 3C3LA 5KYIA 4NP5A 1GOZA 2E74C 4QIWB 4A3IB 5EKKA 3NTHA 3OPOA 1D5XC 5FO8B 1H9JA 3QG1A 3RZOB 3Q6SA 3S2DB 2PYKA 3P75A 3GTPB 4C2MB 3BDOA 4A3JB 2F3VA 5KRUA 5C44B 4IUNA 3DEOA 4ODGA 2K6AA 4KJNA 1KAAA 3DM1A 4QF4A 4RH6A 1WTVA 2B2VA 2EZVA 4MIUA 4C3HG 1LTAD 1MBYA 2A68C 1KDCA 1LTGD 1LT5D 5C4ZA 1STBA 3C46A 1TVXA 2XSCA 4BA2I 3A8KE 4L63B 4DAYA 3Q23A 2K5DA 1A3UA 3WOFA 2TSSA 5HGTA 2O5IC 1SE3A 2SOBA 4HSVA 2F0SA 4WFN3 2X6GA 5A2QL 3J7YW 3K5NA 5IGCA 3M7NA 2JA6B 2KEDA 4MHEA 4ZUIA 3HOVB 3HS0C 3MXGA 5C5LA 4ME5A 2F0LA 2DN8A 1B2TA 3S1QB 1J9OA 3GTLB 1HTPA 4HCEA 2BA1A 4DNTB 2PW7A 1O78A 3NPPA 1B53A 4E6IA 1C48A 2XWJB 4H7BA 1EL0A 1GJXA 2NVTB 2AWNA 3OIPA 2EYFA 3S9WA 4R8NA 2D9UA 3C1FA 2NN6G 1SAPA 3GTMB 1PMRA 1O7YA 2JE6I 1XXGA 4X3TA 2MJ8A 1WTXA 2WINB 4A3KB 1U4MA 2B2TC 1I4GA 4NKLA 3HOYB 4F7XA 2QKIC 1I3QB 2IL8A 4DAVA 2X6LA 2F0FA 2A73B 2NZ1D 5IGDA 2M00A 4KN7C 3ND8A 1SYGA 1F9RA 1UNSA 3W3AA 4C3HB 2LFNA 1TKWB 2QILA 4FO2A 2IX0A 1G2TA 3QWNA 1BR9A 1FYCA 2E2JB 1RODA 4ZRZA 1JOQA 1ONLA 3HOWB 2CW0D 5ELEA 3VYUA 1HFNA 2LMCB 1ENAA 5D3DA 3O13A 3MXUA 4K5WA 3HGBA 1XTCD 2WIIB 4J1MA 1LACA 4G7OC 4NMZA 1VF5C 4OHJA 5JEAH 1SSOA 1HFGA 3S15B 2PO4A 1IKMA 3EQLC 3DWPA 1I4PA 3FMCA 1BQQT 3MXPA 3M4OB 2BE5C 3J7AV 1BNZA 1PTOB 3NQTA 3D8GA 1DOLA 2R93B 3TP6A 2F03A 4DGZA 2NYZD 3LNNA 1MSHA 4ZLTF 4B9XA 3K5MA 4F88A 2J7ZA 4Q0FA 2EJFC 4A3GB 2L55A 4IFDJ 1CTMA 1F2LA 2C9OA 4CJ2C 4KKUA 1S5ED 5I2YA 4X3UA 1RD9D 1JICA 3IAYA 1LTID 1O80A 4OIKA 1GUOA 1TY0A 2QF7A 3ITPA 1NSNS 2WP8J 2K32A 4CJ0B 3QO2A 2RVLA 1IKLA 2M2LA 1PRTB 3LWUA 2F0UA 1VCIA 4OL7A 3HRZC 2G9HD 1S5CD 1EWHA 3QIAA 1NAPA 3CQZB 5NUCA 2EYPA 4CJ1B 2KCNA 4RCOA 5KEEA 2BA0A 1EQVA 2LS01 3D4WA 3Q22A 4A3MB 1B3AA 1L0YB 1DCZA 1DXMA 4B9WA 2PZUA 1BOSA 4XT1B 2F0KA 1GHJA 5E4WC 4V190 1CM9A 3C1EA 4QMGA 2NN6I 2WV6D 1G291 3JAME 2DY7A 4IQZA 5CORA 4ULLA 4KY7A 4TRDA 1AN8A 4G4KA 4JBWA 2RSNA 2C5CA 1LT6D 1MD2D 3I90A 5C0XJ 2F4IA 4K5XA 1CZWA 3E0JA 1HCZA 4RGNA 2K5QA 1QG7A 4RGMA 2IWHA 4FF4A 2ZXRA 1GUGA 1KLGD 5CV7A 1DD2A 4EQNA 3VR4A 4X3SA 3URYA 4KY6A 1PTOC 1HQMC 3S1RB 5K36H 5EQ0A 4ZYSA 3GTJB 4K8JA 3CRLC 3S14B 1RTNA 2XIWA 1MGSA 4ZUJA 4IUPA 1EY7A 1LABA 3NWSA 4KV6A 3TP5A 1EY6A 3OWEB 5CMDA 1UEAB 5G3LF 1BCPF 3GTOB 3TP8A 2F0NA 5I9OA 3MFYA 1SYCA 5JPNC 1IYVA 2A74C 3OOCA 2B2UA 3I4MB 3SHLA 1ET6A 1E2VA 3SK4A 3MXNA 3VA5A 1HPCA 1SBBB 2B2YA 2TMPA 1TS5A 3HOUB 2KECA 1QNUA 4A3DB 1PYWD 3FEWX 1G6ZA 1PRTC 2JEBI 1EIGA 1FNUA 2K01A 2FFKB 4BBSB 3IKJA 2CVRA 4RGTA 1SNDA 1R4PB 1PDQA 4QB4A 4OIJA 2F0IA 2IX1A 5FO7B 4IZ8A 2HDMA 4KHZA 1EU4A 3VR3A 1RCVD 1PZJD 4KK7A 1A2UA 1QB5D 2J0TD 1H9MA 3A54A 2R3ZA 3K6OA 1WTRA 5IGFA 1AP0A 3VYTA 3GP7A 2RDFA 5I6WA 3LX0A 1II3A 1OXVA 1CFMA 1SYEA 3L9AX 2VB2X 3GO5A 3RLFA 5JVG3 3SK8A 2EOTA 1EY8A 4HN7A 4RGOS 1M8AA 2K04A 1PLFA 1FD7D 1SEBD 1Q3LA 4AYBB 3PMFA 2F0GA 1TU2B 1Y69U 2AQ3B 4G7ZC 3GQBA 1I6VC 1TWGB 3A8JE 1QOHA 3JAML 2F0WA 2SDFA 4M8AA 5K36G 3X3NA 3NWTA 2WB1B 1OXXK 4ILWA 2NVQB 2EJGC 2FINB 2FMMA 4HR7B 1AZPA 2LY7A 3OSOA 4Y7NB 3MHBA 2F0OA 3DWQA 5CBAE 2MHVA 5EBDA 2D62A 1HRJA 4N9PA 1SYFA 3BYYB 5D65A 1QNKA 2HCCA 1I50B 1E2WA 3OHXC 4NDXA 1X3PA 2F0PA 3GV6A 5CGKA 1IW7C 4C3JG 4L8JA 3GTGB 5C3XA 5COYA 3NQIA 3KLRA 2B2WC 4KKTA 3SK6A 1KDAA 1XWEA 1W6JA 3EVQA 1JCKB 3CRKC 3HEJA 1VDZA 3S16B 3E5SA 5JEAJ 4J8QA 3EA6A 1ET9A 1D5ZC 5CV8A 2RBMA 1L0XB 1HUMA 3G7LA 5LL6X 1SDFA 4IN3A 1G2SA 2O2LD 5D14A 1YNJD 4RHRA 4X3KA 3N52A 1SE2A 3DHQA 4V0BA 2F0JA 1ESFA 5CV4A 4XYQA 1F2ZA 2A69C 4QUFA 1C8CA 2NVXB 3NP8A 2JYOA 2EY1A 1B9MA 2F0TA 2Z1CA 5M9OA 5BN3A 3RUZA 1U4LA 4RFBA 1TT2A 1OO9B 3A55A 1AZQA 5FOBB 1SNPA 5I2XA 5LHY1 2AUKA 1IW7D 3R3OA 1EYDA 1CT1D 3N6RA 2PQEA 5DM63 3D4DA 2KCCA 1SJED 1EU3A 1B4OA 3EJIA 2B8GA 3I3CA 4FXKC 3GV3A 5CYUA 3OWFA 4U673 2JEAI 1I4HA 3A8IE 1V1PB 3HOXB 4H13C 5M5YB 2L4NA 2EYJA 1TWHB 1A6XA 4C3JB 1F2YA 1U4PA 4K14A 1Y8PB 3KUPA 2A68D 1A15A 3I72A 3PIP3 2Q8RE 3D4RA 2BDOA 1I6HB 2EXZA 3MA2B 1S5BD 4RAUC 5LL6S 2JXMB 2EDGA 1ESRA 1Q8IA 1SNCA 1STGA 1F9PA 3HP3A 2A69D 1Z47A 3U9OA 2JP1A 5KIXA 1F2MA 4QCLA 5ELBA 1BO0A 2EY6A 3RD4A 2I07B 1K8OA 5ELFA 2M9VA 4DXGA 4BY1B 1BF4A 3FRPB 4ZK9B 4O42A 3K0YA 3WOEA 1D6EC 1SXTA 4I7ZC 2XN9C 2XRQD 1YNNC 1EY0A 3P20A 3HG9A 4FXDA 2O4XA 1WTPA 2GA4B 1DJRD 4C1NK 4PMWA 1TWFB 1WD1A 1D2BA 4EQOA 2V4DA 1EEFD 1I4XA 5DEHA 3NE5B 1D1KA 3TBIB 3D3RA 4CBVA 3OMCA 1KNAA 1LO5D 3KF8A 5ELCA 3BZDB 2KHSA 3QJYA 3MC0B 2KUMA 1EWCA 1S4ZA 1WD0A 1DYQA 2WACA 4KI0A 2RDHA 3PUXA 2A6EC 3IFDA 4IUQA 2R7ZB 4LK1C 2D5DA 1MI2A 2B39A 3GD7A 4RA8A 1KDBA 1UAPA 1JQYD 1JORA 1BCPB 4BY7B 5JPMC 2SNSA 4IALA 2KVMA 4HMJA 3NHHA 5C3EB 2BE5D 4BS9A 4CKCA 5IT9L 1R9TB 1JE4A 1Z6HA 3SVMA 1A3VA 3SK5A 3MVVA 1CK1A 2ZXPA 1Q12A 3D31A 1Q90A 5EBCA 1ILPA 1Z7TA 1WCMB 4RKBA 4XXEA 1H9SA 5CC4A 5T1GA 3NK9A 3HOZB 4DK0A 3VYSA 5C3WA 2B2VC 2Z4IA 2NVYB 2RQXA 1EYCA 5E4XA 1NCVA 3K57A 1STAA 3HKZB 3J80L 1NR2A 4DA2A 4FF3A 2R92B 3MEHA 4XQJA 1PFMA 1S5FD 4J6HA 1TS3A 5F2DA 3D6WA 1I4QA 1LTSD 4S3SA 3RMHA 4BWGB 1B50A 3AB9A 2F0VA 4FYDA 1VMPA 3BVMA 2IJ0A 1QILA 4LJZC 3A56A 5FLXL 2AQ1B 1EY9A 3MTSA 4IUVA 2PCFB 2RA4A 1SE4A 1RKNA 2EYLA 4XTCS 1SJHD 1WTQA 1EZ8A 4ID6A 2ICEC 5AFWA 1LTRD 1HTLD 3I4NB 3NTIA 2VUMB 1KLUD 2Q8IB 3A7LA 1PFNA 3L3OC 1ZKOA 3H09A 4KHVA 5EPLA 3MAQA 3H94A 1HA5A 3J81L 1WTWA 2YU9B 1SNMA 2H4OA 4A3FB 1LLRD 4A3EB 3I91A 2DNCA 2L11A 2E2IB 4QUCA 2ICIA 2B2TA 3I70A 3R93A 2PMZB 2QEJC 4KKSA 1F9QA 4CHTB 1QCBD 3EROA 3FDTA 5IGBA 3M4YA 2N88A 1SYDA 5BN4A 5IODA 1BCPC 1SNQA 5IGEA 2K05A 3QOLA 4RCNA 2DNEA 1TS2A 2PPBC 3SDZA 4G7HC 4PMBA 1KABA 2OF1A 5BN5A 2J4XA 3K7AB 4F8MA 2Z4HA 1PTOD 3KBXA 3P1HA 4OGQC 2WAQB 4FXGC 3TSSA 3NXWA 3I73A 5IIFA 3T16A 1OXUA 4KD3A 1D5MC 3T4AC 2SNMA 3QOJA 1ENFA 4R8IA 4ZKBB 2AQ2B 1V8QA 1CHPD 1UUPA 2KEEA 1STYA 5EPKA 2KJXA 1VMCA 5E1FA 3T13A 2IPKD 2KQ3A 4UDUC 2RKSA 3MFGA 2L1BA 2K1BA 3BS1A 1E2ZA 1T5XD 4L6TB 2L12A 1LV9A 1C4QA 4HSPA 2Z8LA 1GUSA 4H0LC 1PRTD 3FVQA 2K33A 4HMIA 3KBGA 3CU7A 4IUUA 4TQUS 2ENBA 5C6AA 4R9WA 1RJTA 1LTBD 2DY8A 3M85A 3DEPA 3UI2A 1BXTA 3E6ZX 1Y8OB 3R8BA 1JWMD 4RWSC 1CHQD 3H91A 3C2PA 1KNEA 4YIJA 1GUNA 4TSSA 4KN4C 1H9RA 2D2CC 1GXDC 4N9TA 5CR3A 2BCOA 1JWUD 4EGVA 5M3FB 2F0QA 4XQQA 2OT2A 3V96A 2EPBA 3R2IA 3T51B 1FNVA 1FR3A 3LWEA 4Z9CB 2VB3X 4IFDG 3IL8A 1STHA 4DNRB 1M4VA 2CHBD 4FNFA 2CQAA 1BDOA 1EEID 1FNWA 1CI3M 2E2DC 1HHVA 4FF1A 3SE0A 3PO3B 2E76C 1NUCA 4BBRB 3M3YB 3VR5A 3W2DA 5CV5A 2XRSD 4K8IA 1CZGA 4BA1I 1IHZA 1LTTD 2B8FA 5TSSA 1OXTA 5EPJA 1TWAB 3KLSX 1G91A 3SXHA 3WDNA 4PV1C 3IFTA 1FGBD 1TY2A 2PNRC 3BVGA 4LMQD 3I8ZA 2L9HA 5C4HA 4GZYC 3MZ5A 3TN2A 1AW7A 3BYTB 5J1ZA 4Q5VA 1H9KA 1DOKA 1Y1WB 1HXYD 3BG3A 1DM0B 2WKDA 3OMGA 2XVSA 1HQRD 2HUGA 3BVZA 2O5JC 2F0EA 1TIID 2NB0A 4P2CB 5KNBA 1HA6A 5IT9E 2CW0C 3OIQA 5C0XG 1E0BA 4ZKCB 2EJMA 1JB3A 4OO1H 1JOOA 3K5OA 5CV9A 5I9PA 4DK1A 3ND9A 3I4LA 1B44D 1QE6A 3K58A 4M1UB 3D6CA 1I4RA 5FKAC 5A35A 1AFPA 1K8MA 4DF7A 1X3QA 3T53B 1B1ZA 4KJOA 2IW3A 1WVLA 2B2UC 5I4DA 3J80E 1EYAA 4ZQ3A 4WRDA 4U68A 3S1MB 2B2YC 2JSOA 2JA5B 4K6LA 4CKEA 1ICWA 2HCIA 1IL8A 2MUYA 1SMYC 1EQTA 2EY2A 3J7AF 5JOBA 2QCPX 2FHTA 5FLXE 3TDQA 1LT4D 2HDLA 4LAAA 2YYZA 4HAEA 5EKLA 5IOCA 3GTKB 5KGUA 3DWAA 1ZEQX 2NTTA 1QJOA 3S2HB 4F87A 3VR2A 1A3TA 4FF2A 4FP5D 3X3MA 1ZYRC 4C3IG 3J81E 1K83B 3GTQB 2F1MA 3QB3A 5DM73 4IUTA 4IFDI 3Q0AA 2N55A 3PUYA 5J22A 2QDBA 1V1OA 5EJWA 2IT1A 3OW7A 4G57A 1U9RA 4HEDA 1TWCB 5JJZA 1F77A 3PO2B 1BUVT 4XIGS 1Y8NB 1CA6A 3U9SA 1F9SA 2NUCA 3AMUA 1TQOA 2ID0A 1SYBA 1Q1EA 3S17B 3AU7A 1JR0D 4DFAA 3EFXD 2E75C 1S5DD 1SMYD 2H1EA 5M3MB 3VYRA 3R2TA 2JA8B 2AUJD 1EFID 2EY5A 3PUVA 2RSOA 2Y0SB 5E3FA 4XYOA 4FVMA 2EYOA 4OO1G 4DXFA 1X32A 1PXUA 3TP7A 1W6KA 3FKIB 4EQPA 3MWYW 1CQFA 4ABNA 1ZYRD 3BDLA 2PZTA 4NW2A 4KTAA 2B2WA 4PQXA 4HTHA 1LT3D 5C0XI 3V2TA 2JA7B 3TZDA 1TS4A 1YNND 2IX3A 3PUZA 3HZXA 4DAPA 3SR1A 2FJ2A 2R61A 4K2KA 3H3VC 1RHPA 1Y1VB 3VR6A 3ZYYX 4C3IB 3T56B 3ONAB 3DUZA 4H44C 1V43A 5ISRA 1PZID 3SEBA 4C1NI 1JOKA 1PTOF 2OXPA 3M7GA 2K7VA 2Q8TA 2F0MA 2RDGA 2F0DA 2F0HA 3PIO3 5M5XB 2K5WA 3F2UA 5DAUA 2K03A 3H0GB 4CGYB 4KY5A 3K5LA 2G9DA 2MPMA 2MGSA 3L7ZC 1ENCA 1IYUA 5FK9C 2ZT9C 5C4JB 5IGGA 4A3BB 2KOLA 3G6JB 5C4XB 1DONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYH A;  5CV4 A;  5EKK A;  1F2Z A;  3MXP A;  2PW7 A;  1KDB A;  1JOR A;  3H6M A;  1EY5 A;  3NQT A;  3NP8 A;  4KHV A;  4E6I A;  2SNS A;  4IAL A;  4HMJ A;  2EY5 A;  2EY1 A;  5EGT A;  3NHH A;  4H7B A;  4KY7 A;  2F0T A;  4TRD A;  3SXH A;  3D8G A;  1SNM A;  2PYK A;  2F3W A;  2EY2 A;  2LKV A;  3MHB A;  3OSO A;  1SND A;  3P75 A;  5E3F A;  2EYF A;  2EYO A;  3S9W A;  2F0O A;  3TP6 A;  4R8N A;  5M9O A;  5C5M A;  4HMI A;  4RKL A;  4QB4 A;  5JOB A;  3RUZ A;  4N9P A;  3C1F A;  4DGZ A;  2F0I A;  3BDC A;  4K5X A;  1SYF A;  2F3V A;  4LAA A;  5KRU A;  1TT2 A;  2ENB A;  5C4H A;  1EY4 A;  4IUN A;  3TP7 A;  5C6A A;  4IZ8 A;  4ODG A;  4WOR A;  1A3V A;  1SNP A;  5EKL A;  4B9X A;  3SK5 A;  3MVV A;  4EQP A;  5K5P A;  3R3O A;  5IOC A;  3MZ5 A;  1EYD A;  5J1Z A;  1EY0 A;  4KJN A;  4NDX A;  1KAA A;  2F0P A;  2PQE A;  2PZW A;  3ERO A;  5KGU A;  1A2U A;  4PMC A;  3NUC A;  5IGB A;  3BDL A;  2PZT A;  5CV7 A;  3D4D A;  4NKL A;  4KTA A;  4QF4 A;  4F7X A;  4EQN A;  2OEO A;  2O4X A;  4RKB A;  3EJI A;  3ERQ A;  4HTH A;  1SYD A;  5CGK A;  3V2T A;  5IGF A;  5IOD A;  3OMG A;  4MIU A;  4KY6 A;  1A3T A;  1SNQ A;  2RDF A;  5I6W A;  3OWF A;  5CC4 A;  5IGE A;  3QOL A;  2F0F A;  3NK9 A;  3HZX A;  3LX0 A;  2EYM A;  4EQO A;  5C3X A;  1EZ6 A;  3SR1 A;  1II3 A;  5IGD A;  4PMB A;  4KD4 A;  2M00 A;  5C3W A;  4YIJ A;  1KDC A;  1SYG A;  4K2L A;  4K2K A;  2EYJ A;  4K8J A;  2F0E A;  5DEH A;  3SK6 A;  1KAB A;  4PNY A;  2OF1 A;  3ITP A;  3QB3 A;  5C4Z A;  1F2Y A;  1STB A;  2HQE A;  1EYC A;  1KDA A;  3OMC A;  4F8M A;  1NSN S;  5JAV A;  1STA A;  4K14 A;  1TR5 A;  2PW5 A;  4K5V A;  4K6D A;  3EVQ A;  3P1H A;  4DU9 A;  4ZUJ A;  3DMU A;  4N9T A;  1SYE A;  1EY7 A;  1A3U A;  4I65 A;  5CR3 A;  4KV6 A;  2KHS A;  2QDB A;  3HEJ A;  3MEH A;  2F0Q A;  5J22 A;  5HGT A;  3TP5 A;  3SK8 A;  1EY6 A;  1EY8 A;  4J6H A;  2F0U A;  3NXW A;  5F2D A;  1JOQ A;  5IIF A;  3T16 A;  1JOO A;  4OL7 A;  5ISR A;  3E5S A;  4S3S A;  2SOB A;  5CV9 A;  2EXZ A;  1JOK A;  4KD3 A;  2F0S A;  2OXP A;  4G57 A;  5I9P A;  2SNM A;  3QOJ A;  1U9R A;  2F0V A;  1A2T A;  5NUC A;  5HUR A;  2F0M A;  2EYP A;  3TP8 A;  3D6C A;  2F0N A;  5I9O A;  2F0D A;  2F0H A;  1SYC A;  1ENA A;  1STH A;  2RBM A;  3PMF A;  5CV8 A;  2F0G A;  1EQV A;  5IGC A;  5KEE A;  4K5W A;  1SNO A;  5DAU A;  2WAC A;  4J1M A;  3D4W A;  1EY9 A;  5CV6 A;  2NUC A;  3SHL A;  1SNC A;  4DF7 A;  4NMZ A;  5KYL A;  4B9W A;  1TQO A;  3SK4 A;  3VA5 A;  1SYB A;  4KJO A;  1STY A;  4KY5 A;  2PZU A;  4ZUI A;  1STG A;  1RKN A;  5KIX A;  3U9O A;  3TME A;  2EYL A;  1AEX A;  1ENC A;  4EVO A;  2F0K A;  5C5L A;  4DFA A;  5KYI A;  1EZ8 A;  2F0L A;  4ME5 A;  1F2M A;  1NUC A;  2F0W A;  4ID6 A;  5E1F A;  4NP5 A;  3T13 A;  5I6Y A;  3C1E A;  1EYA A;  2KQ3 A;  4ZQ3 A;  5IGG A;  5J39 A;  4QMG A;  5CV5 A;  1STN A;  4K8I A;  3DHQ A;  2EY6 A;  4WRD A;  2RKS A;  1IHZ A;  2F0J A; 
#chains in the Genus database with same CATH topology
 2EYH A;  4DR2 L;  1A0I A;  2A6E D;  1GO3 E;  3PUW A;  4CKB A;  1IYJ B;  1ASY A;  1STE A;  5EGT A;  3NBH A;  5JEA G;  2LKV A;  3T1Y L;  1GUT A;  1L2F A;  5DLQ E;  4DR7 L;  3G48 A;  2I46 A;  4ZAI A;  5C5M A;  4RKL A;  1GHK A;  1XX8 A;  3CKI B;  2ZXO A;  2Q2H A;  2N78 A;  3BDC A;  3KK7 A;  3J81 i;  2VNU D;  4GN4 B;  3K59 A;  1EY4 A;  1OXS C;  4AYB E;  2R6G A;  4A3C G;  2JA6 H;  1HNW L;  5EKI A;  4WOR A;  2A6H C;  2UXC L;  5K5P A;  4JK1 C;  3HOV H;  1ILQ A;  1PRT F;  1QWY A;  2PZW A;  3S1Q H;  4TKO B;  3KF8 B;  3GTL H;  3CCS A;  2OEO A;  4A4I A;  2WKC A;  1O7L A;  3ERQ A;  2JN4 A;  1CQV A;  1K3R A;  5FO9 B;  3MEF A;  1MSG A;  1HUN A;  3PV0 A;  2AWO A;  4POG A;  1DZ1 A;  4UP9 A;  2EYM A;  3I4O A;  3SGI A;  2NVT H;  1RL2 A;  2B3G A;  1DOM A;  4PNY A;  4IFD H;  2HQE A;  2BOS A;  2MP1 A;  1XNQ Q;  3KLS A;  5JAV A;  2YTX A;  1JWS D;  4K6D A;  4K5V A;  1QVC A;  4DU9 A;  3DMU A;  4XT3 B;  1X65 A;  3OTO L;  4I65 A;  3GTM H;  3S1M H;  2FMC A;  4CDF C;  4B08 A;  1Q7Y C;  4WJ3 M;  3E9I A;  4A3K H;  4JI8 Q;  1PH8 A;  4XQN A;  3CCU A;  1EIH A;  5HUR A;  3HOY H;  2XWB B;  1SRO A;  1I3Q H;  2KA7 A;  3CCE A;  4JBM A;  5KNC A;  3JC6 6;  1WTO A;  4DV7 L;  5CV6 A;  2I5L X;  5A2Q E;  1BVS A;  1YEZ A;  4HCS A;  2B63 B;  4A3I G;  1HNX L;  1ZXT A;  1IBM L;  4C3H H;  3M9B A;  1AEX A;  4C56 C;  1NR4 A;  4EVO A;  4IJL A;  3S1N B;  4OO1 I;  5I6Y A;  5ELD A;  3DXJ C;  1ML0 D;  3I2Z A;  5J39 A;  2OTJ A;  1STN A;  2EVB A;  2K28 A;  4O1N A;  2RHS B;  1RDP D;  2E2J H;  2E2H B;  1J8I A;  4IUR A;  4RHS A;  3VA7 A;  1BBX C;  1N34 L;  3H6M A;  4KMU C;  1EY5 A;  4UAI A;  1B9N A;  5JVH 3;  4A3J G;  1CKN B;  5T1I A;  5C44 G;  1RTO A;  1NY4 A;  2CWA A;  1EWI A;  2F3W A;  2A6H D;  3GTQ H;  2UUC L;  4K0K L;  3FPU B;  1H9S B;  1HJP A;  4GNX B;  3T1H Q;  1P8L A;  4I7A A;  2VXW A;  5BR8 L;  1C9O A;  5DNF A;  2NTS A;  2A5H A;  5KND A;  3Q24 A;  3S15 H;  3A7A B;  2Z9H A;  1PH1 A;  5D3I B;  1U4R A;  1CA5 A;  1D1I A;  5LMN L;  2BDN A;  4DN4 M;  4PMC A;  3NUC A;  4NXM Q;  4JYA Q;  3DM3 A;  1R4Q B;  1PFB A;  2EE1 A;  5C0X H;  3CCR A;  1V1Q A;  3WWV A;  4TVA B;  3M4O H;  2FXQ A;  2SEB D;  1Q1B A;  3AFP A;  2NZO A;  2C35 B;  1PTO H;  2XNA C;  3TZU A;  5IWA L;  1EZ6 A;  1N33 Q;  4KD4 A;  4A93 B;  4K2L A;  2L5T A;  2R93 H;  2L0C A;  4EX5 A;  4DR6 Q;  1RF2 D;  4WJW A;  2X69 A;  1PZK D;  5G3L D;  1XYI A;  1BCP D;  1D7Q A;  2VQF Q;  3P7J A;  2DJG C;  3CHB D;  2NBF A;  3RZD B;  1TR5 A;  2PW5 A;  2NWG A;  3FPP A;  3KF6 B;  3NBI A;  4MN3 A;  4XDX A;  2QGQ A;  1VQ6 A;  5CBE E;  4OWX B;  3B6Y A;  1VF7 A;  2VZA A;  2ZTE A;  3NSW A;  2ATW A;  1V1P A;  4A3G H;  1O7Z A;  1IL2 A;  3NTK A;  2NN6 H;  1KTK A;  1CUK A;  1N8R C;  1A2T A;  4JI7 L;  1YNJ C;  1VQ7 A;  1HR0 L;  1G8Z D;  2Q2T A;  1SFO B;  5M5W B;  1GUW A;  1SNO A;  2Q2I A;  1T5E A;  4UP8 A;  5KYL A;  1JC7 A;  3V05 A;  1I5F A;  1EOT A;  3TME A;  3C3L A;  5KYI A;  4NP5 A;  1GOZ A;  2E74 C;  2A19 A;  4QIW B;  1PH3 A;  4A3I B;  5LMU Q;  5EKK A;  3NTH A;  4LF6 Q;  3OPO A;  4X66 L;  1D5X C;  5FO8 B;  4B3R L;  1H9J A;  1N36 L;  1LYL A;  3QG1 A;  3RZO B;  1BBU A;  3Q6S A;  1EYG A;  3S2D B;  2PYK A;  3P75 A;  1ICF B;  3GTP B;  4C2M B;  5GAD C;  4YCV A;  1E1O A;  3BDO A;  4B3S Q;  4APV A;  4A3J B;  4A3K G;  2F3V A;  5KRU A;  5C44 B;  1LM0 A;  4IUN A;  3DEO A;  3HOY G;  1HNZ L;  4ODG A;  2K6A A;  2NZH A;  4KJN A;  1KAA A;  2E5L Q;  4R1J A;  3DM1 A;  4QF4 A;  4RH6 A;  1WTV A;  2I5H A;  2B2V A;  3TRZ A;  2EZV A;  4MIU A;  4C3H G;  5M5X H;  1LTA D;  4DR1 Q;  1G51 A;  5ELN A;  1MBY A;  2A68 C;  3H0G H;  5GAE C;  3W1G A;  1KDC A;  2CKZ B;  4YCU A;  1LTG D;  1VQI A;  1LT5 D;  5C4Z A;  1KC8 C;  1STB A;  3KDF A;  5AJ3 L;  4IOC A;  2GN5 A;  4GNX C;  3C46 A;  1TVX A;  2XSC A;  1XMO Q;  4BA2 I;  2Z6B A;  3A8K E;  4L63 B;  4DAY A;  3Q23 A;  2K5D A;  3HOW G;  1A3U A;  3WOF A;  2TSS A;  3BZC A;  5HGT A;  2O5I C;  5HY6 A;  1K28 A;  1SE3 A;  4GKK Q;  1W2B A;  2SOB A;  4HSV A;  2F0S A;  2UUA Q;  5GAH C;  4WFN 3;  2X6G A;  5A2Q L;  2A1A A;  2AMC B;  4IPG A;  1X9N A;  3J7Y W;  3K5N A;  5IGC A;  3M7N A;  3S1R H;  4DV6 Q;  1GKH A;  2HD3 A;  2JA6 B;  3GTJ H;  2KED A;  4MHE A;  4ZUI A;  3H15 A;  2IHF A;  3Q8D A;  3HOV B;  3HS0 C;  3S14 H;  3MXG A;  5C5L A;  2CQO A;  5FLM G;  4ME5 A;  2F0L A;  2DN8 A;  4PG3 A;  3S1Q B;  1B2T A;  1J9O A;  4HJA A;  3GTL B;  1HTP A;  1YBY A;  4HCE A;  2BA1 A;  2R93 G;  4DNT B;  2PW7 A;  4QY7 A;  1O78 A;  3NPP A;  4DV4 L;  1B53 A;  3CCJ A;  5EAY A;  1MIU A;  3KYH C;  4E6I A;  1C48 A;  3GTO H;  2XWJ B;  4H7B A;  1EL0 A;  1GJX A;  2NVT B;  1SRU A;  2AWN A;  3OIP A;  4DV0 L;  2EYF A;  4JI0 Q;  3S9W A;  4R8N A;  2HIX A;  4A3G G;  3AFQ A;  2D9U A;  3C1F A;  2NN6 G;  3I4M H;  1WOC A;  2MO0 A;  1EQR A;  1SAP A;  2G5D A;  3KOJ A;  3GTM B;  1VQ5 A;  1PMR A;  1O7Y A;  2JE6 I;  4LF9 L;  1XXG A;  4X3T A;  4DV5 Q;  2MJ8 A;  3HOU H;  1WTX A;  2HHH L;  2WIN B;  3TEH B;  4A3D H;  4A3K B;  1U4M A;  2B2T C;  1I4G A;  4NKL A;  2Y0S E;  3HOY B;  4F7X A;  3RN2 A;  2QKI C;  1I3Q B;  2GVB A;  2IHE A;  3J7A 5;  2IL8 A;  4DAV A;  4HJ8 A;  2X6L A;  1VQM A;  2F0F A;  2A73 B;  1UE7 A;  2NZ1 D;  5IGD A;  2M00 A;  4KN7 C;  2ASB A;  3ND8 A;  1SYG A;  5ELO A;  1G6P A;  1F9R A;  1UNS A;  3W3A A;  4C3H B;  2LFN A;  1TKW B;  2QIL A;  4FO2 A;  1JJC B;  3CMA A;  2IX0 A;  4NXN Q;  1KRT A;  5FJ8 H;  4JI7 Q;  1G2T A;  3U58 A;  3QWN A;  1BR9 A;  1FYC A;  2JA9 A;  2E2J B;  1ROD A;  4ZRZ A;  1KAW A;  1JOQ A;  3TQY A;  4A3M G;  2LXK A;  1ONL A;  3HOW B;  4EQ5 A;  2CW0 D;  4UHV A;  5ELE A;  3VYU A;  1HFN A;  2LMC B;  1ENA A;  1EIF A;  5D3D A;  3O13 A;  3MXU A;  4K5W A;  3HGB A;  1YJ9 A;  1XTC D;  2WII B;  2K52 A;  4J1M A;  1LAC A;  4G7O C;  4NMZ A;  1VF5 C;  4OHJ A;  1QVG A;  5JEA H;  1SSO A;  1HFG A;  3S15 B;  2F3I A;  4JPB W;  3G71 A;  2PO4 A;  1IKM A;  3EQL C;  1K0S A;  4OWW B;  3DWP A;  1I4P A;  3FMC A;  3PQI A;  4PZ8 A;  1BQQ T;  3MXP A;  3M4O B;  2BE5 C;  3J7A V;  1BNZ A;  1PTO B;  4DNI A;  3HKZ E;  3NQT A;  4MTK A;  4YHH Q;  3D0F A;  4JI8 L;  3D8G A;  1GM5 A;  1DOL A;  2R93 B;  3TP6 A;  1SR3 A;  3A5U A;  2Z6K C;  4GKJ Q;  2F03 A;  4DGZ A;  2NYZ D;  3LNN A;  1MSH A;  4ZLT F;  4B9X A;  1TWG H;  3K5M A;  4F88 A;  2J7Z A;  4Q0F A;  2EJF C;  1ASZ A;  4A3G B;  1PV4 A;  2L55 A;  4AQY Q;  4IFD J;  1CTM A;  1K73 C;  1F2L A;  2C9O A;  2R7F A;  4CJ2 C;  4KKU A;  1S5E D;  1VQE A;  5I2Y A;  2NVQ H;  4X3U A;  1RD9 D;  2V1C C;  1PVO A;  1JIC A;  3BZK A;  3IAY A;  3BU2 A;  1LTI D;  1O80 A;  4OIK A;  4YWM A;  1GUO A;  4Y7N H;  1TY0 A;  2QF7 A;  3EN2 A;  1BBW A;  3ITP A;  1NSN S;  2EIF A;  2WP8 J;  2K32 A;  4CJ0 B;  3QO2 A;  3T1H L;  2RVL A;  1H95 A;  4LFA Q;  1IKL A;  2PQA A;  2M2L A;  4A3I H;  1PRT B;  3LWU A;  2F0U A;  1VCI A;  1I50 H;  4OL7 A;  3HRZ C;  1QZH A;  2G9H D;  4A3L H;  1S5C D;  1N9W A;  1EWH A;  3I4M G;  3QIA A;  1NAP A;  3CQZ B;  5NUC A;  4NXM L;  2EYP A;  4JYA L;  4CJ1 B;  2ZTD A;  2KCN A;  3KFU A;  4RCO A;  5KEE A;  4JOI A;  3GTP H;  1U5K A;  2BA0 A;  1EQV A;  3HOU G;  3TRE A;  2LS0 1;  3D4W A;  3Q22 A;  4A3M B;  3GTG H;  4A3D G;  1B3A A;  1L0Y B;  4R4T A;  4JI6 Q;  1DCZ A;  1DXM A;  3CD6 A;  4B9W A;  1N33 L;  3RNU A;  3IRB A;  4LF5 Q;  2PZU A;  1BOS A;  4N8X 1;  4XT1 B;  2F0K A;  1GHJ A;  1XJV A;  5E4W C;  4V19 0;  1CM9 A;  2VQF L;  3C1E A;  4QMG A;  4BBS G;  2NN6 I;  2WV6 D;  1G29 1;  4DV0 Q;  3JAM E;  3RN5 A;  3S16 H;  2DY7 A;  4IQZ A;  5COR A;  4ULL A;  5FJ8 G;  2RHQ B;  4KY7 A;  4TRD A;  1AN8 A;  2WAQ E;  4G4K A;  4JBW A;  2RSN A;  1YHB A;  2C5C A;  1LT6 D;  5LMN W;  1MD2 D;  3I90 A;  4UP7 A;  5C0X J;  4O0A A;  2F4I A;  4HJ9 A;  4K5X A;  3KJP A;  3K80 C;  4MTN A;  1CZW A;  3E0J A;  4QQB X;  1HCZ A;  4RGN A;  2K5Q A;  1QG7 A;  4P75 A;  4RGM A;  1CKO A;  2IWH A;  4FF4 A;  2ZXR A;  1GUG A;  1KLG D;  5CV7 A;  1DD2 A;  4EQN A;  3VR4 A;  1SLJ A;  3E0E A;  4DV3 Q;  4X3S A;  3URY A;  1EIY B;  4KY6 A;  5LMU L;  1PTO C;  4LF6 L;  1JB7 A;  1HQM C;  3CPW A;  3S1R B;  5K36 H;  5EQ0 A;  1BKB A;  4ZYS A;  3GTJ B;  4K8J A;  3CRL C;  4HID A;  3S14 B;  1RTN A;  2XIW A;  1VQC A;  1MGS A;  4ZUJ A;  4IUP A;  4B3S L;  1EY7 A;  1K8A C;  1LAB A;  3NWS A;  4KV6 A;  4HJ7 A;  4AYB G;  1DGS A;  1WYD A;  3TP5 A;  1EY6 A;  3OWE B;  1SE8 A;  5CMD A;  1HZB A;  1UEA B;  5G3L F;  1BCP F;  3GTO B;  1VQF A;  4LNQ A;  1XMQ Q;  2E5L L;  2PI2 A;  2D0P A;  3TP8 A;  4L5Q A;  2F0N A;  5I9O A;  1E1T A;  3MFY A;  3I56 A;  1SYC A;  2D0O A;  5JPN C;  1IYV A;  2PNH A;  1QUQ A;  2A74 C;  2K5V A;  3OOC A;  2B2U A;  4X65 Q;  3HOX H;  3I4M B;  3SHL A;  4DR1 L;  1ET6 A;  1E2V A;  3SK4 A;  3MXN A;  5M5Y H;  3VA5 A;  1XPR A;  2WB1 G;  1HPC A;  1SBB B;  2B2Y A;  2TMP A;  1TS5 A;  3HOU B;  2KBN A;  2KEC A;  1QNU A;  4A3D B;  1PYW D;  2PI2 E;  1XMO L;  3FEW X;  1G6Z A;  1PRT C;  2JEB I;  1EIG A;  1Q46 A;  2QEX A;  1WFQ A;  1FNU A;  1I6H H;  2K01 A;  2EXD A;  4GKK L;  1N32 L;  2FFK B;  3CC7 A;  4BBS B;  3IKJ A;  2UUA L;  2CVR A;  2CFM A;  4RGT A;  1SND A;  2ES2 A;  4JW0 A;  3PIP A;  1R4P B;  1IBK Q;  1PDQ A;  4QB4 A;  4OIJ A;  2F0I A;  4A3L G;  2IX1 A;  4QIW E;  4DV6 L;  5FO7 B;  4IZ8 A;  2UUB Q;  2HDM A;  3CF5 A;  4KHZ A;  1EU4 A;  2B29 A;  3VR3 A;  1RCV D;  1PZJ D;  1UE6 A;  4KK7 A;  1A2U A;  1QB5 D;  4R4Q A;  2J0T D;  3HOW H;  1H9M A;  2MO1 A;  3A54 A;  2R3Z A;  3K6O A;  1WTR A;  5IGF A;  1AP0 A;  3K0X A;  1C0A A;  3VYT A;  3GP7 A;  2RDF A;  5I6W A;  3LX0 A;  1II3 A;  2F4V L;  4GOP A;  2VS1 A;  2QA4 A;  1OXV A;  4JI0 L;  1E24 A;  1CFM A;  1SYE A;  1Q82 C;  3L9A X;  2VB2 X;  3GO5 A;  3RLF A;  5JVG 3;  3SK8 A;  2EOT A;  1EY8 A;  2K5N A;  4HN7 A;  4RGO S;  1M8A A;  4DV5 L;  2K04 A;  5FLM H;  1PLF A;  1NJI C;  1FD7 D;  1NTG A;  1P16 A;  1SEB D;  1E22 A;  3JAM c;  1Q3L A;  4AYB B;  2HQL A;  1VQO A;  3PMF A;  3JAM i;  2F0G A;  1TWF H;  3L0O A;  4ME3 A;  1TU2 B;  1Y69 U;  2AQ3 B;  3NBH B;  4G7Z C;  1PFS A;  1HZ9 A;  3GQB A;  1I6V C;  1TWG B;  3A8J E;  4DR3 Q;  1J5E L;  1QOH A;  3JAM L;  1Y1W G;  2F0W A;  2SDF A;  4M8A A;  5K36 G;  3X3N A;  3NWT A;  4NXN L;  2WB1 B;  1OXX K;  4ILW A;  2NVQ B;  2EJG C;  2FIN B;  2FMM A;  4HR7 B;  4YY3 Q;  3A0J A;  4JBJ A;  1AZP A;  2LY7 A;  1JJ2 A;  3OSO A;  4Y7N B;  3STB C;  3MHB A;  2F0O A;  3DWQ A;  5CBA E;  2MHV A;  4OEL B;  2D62 A;  5EBD A;  1HRJ A;  4X6A H;  4N9P A;  1SYF A;  2L15 A;  3BYY B;  5D65 A;  1QNK A;  2HCC A;  1I50 B;  1E2W A;  3OHX C;  4NDX A;  3PCO B;  1X3P A;  2F0P A;  4WJ4 A;  3HOX G;  1L1O A;  3CQZ H;  3GV6 A;  5CGK A;  4RG1 A;  2EQS A;  1IW7 C;  4C3J G;  4DAM A;  4BY7 H;  3U4Z A;  4L8J A;  3GTG B;  5C3X A;  5COY A;  3NQI A;  4A3M H;  3KLR A;  2B2W C;  4YHH L;  3F2B A;  4KKT A;  3SK6 A;  1YNX A;  1AE2 A;  5C3E H;  1M90 C;  1KDA A;  1XWE A;  1CKM A;  1W6J A;  1B8A A;  3EVQ A;  4GKJ L;  1JCK B;  2CH4 A;  3U50 C;  1R9T H;  3CRK C;  3HEJ A;  4PZ6 A;  1VDZ A;  2K5H A;  4JI5 Q;  3S16 B;  3E5S A;  5JEA J;  1PYB A;  1YHA A;  1JJG A;  4J8Q A;  4AQY L;  1WCM H;  2VQE Q;  3EA6 A;  1ET9 A;  2N49 A;  3UE0 A;  1D5Z C;  1LTL A;  5CV8 A;  2RBM A;  1L0X B;  4OXP A;  1HUM A;  3G7L A;  3HOZ H;  3UDG A;  5LL6 X;  1SDF A;  4IN3 A;  4DKA C;  3K8A A;  1G2S A;  2O2L D;  5D14 A;  1YNJ D;  3EIV A;  3HKS A;  4RHR A;  2GVA A;  1N32 Q;  1NMF A;  1D8L A;  1T9H A;  2JK8 A;  4X3K A;  1FVI A;  3N52 A;  1SE2 A;  3DHQ A;  1K0R A;  4BY1 G;  4CDD C;  1JMC A;  4V0B A;  4MZ9 A;  2F0J A;  3STB D;  1ESF A;  5CV4 A;  4XYQ A;  2ZJP A;  4LFA L;  1F2Z A;  2A69 C;  4LFB Q;  4QUF A;  3PIO A;  2OQ0 A;  3I55 A;  4UPA A;  1C8C A;  2NVX B;  3NP8 A;  2JYO A;  2EY1 A;  1B9M A;  2F0T A;  2Z1C A;  5M9O A;  5BN3 A;  3RUZ A;  1U4L A;  4RFB A;  1TT2 A;  1OO9 B;  3A55 A;  4JI6 L;  5IYC G;  1AZQ A;  5FOB B;  1SNP A;  5I2X A;  5LHY 1;  2AUK A;  1IW7 D;  3R3O A;  4LF5 L;  2HIV A;  2CH4 W;  1EYD A;  3ICE A;  2LXJ A;  1CT1 D;  3N6R A;  2PQE A;  2F4V Q;  5DM6 3;  3OW2 A;  3D4D A;  2KCC A;  3I4N H;  1SJE D;  4DUZ Q;  1EU3 A;  1B4O A;  3EJI A;  2B8G A;  3I3C A;  2VUM H;  4FXK C;  3GV3 A;  5CYU A;  4DR5 Q;  3OWF A;  1L0W A;  4U67 3;  2JEA I;  1I4H A;  1QZG A;  4BXX G;  3A8I E;  1V1P B;  4GLX A;  3HOX B;  4H13 C;  2YU9 H;  5M5Y B;  2L4N A;  4J15 A;  2EYJ A;  1TWH B;  4A3F H;  1A6X A;  4C3J B;  1F2Y A;  4L5R C;  1Y14 B;  2DGY A;  1U4P A;  4K14 A;  4IPD A;  2K50 A;  1Y8P B;  3KUP A;  2A68 D;  1A15 A;  3I72 A;  3J81 j;  3PIP 3;  3F2D A;  1FJG Q;  2Q8R E;  3D4R A;  2BDO A;  2VL6 A;  3GDE A;  1I6H B;  2EXZ A;  3TS2 A;  1B70 B;  2E8G A;  3MA2 B;  2K4K A;  2JJQ A;  4BBS H;  3F8T A;  1J5E Q;  1S5B D;  1HZA A;  4RAU C;  4DV3 L;  5LL6 S;  1J6Q A;  4X64 Q;  3F1Z A;  2LSS A;  2JXM B;  4IJH A;  2EDG A;  1ESR A;  1Q8I A;  1SNC A;  2R7Z G;  1STG A;  1F9P A;  3HP3 A;  2A69 D;  1Z47 A;  4GLA C;  2JP1 A;  3U9O A;  5IY0 A;  5KIX A;  4BY7 G;  3HFZ B;  1F2M A;  4DV1 L;  4QCL A;  4NPS A;  5ELB A;  5IP9 H;  1BO0 A;  4JI2 Q;  4YWL A;  1Q86 C;  2EY6 A;  1TXY A;  3AEV A;  3RD4 A;  1YIT A;  2I07 B;  5C3E G;  4JV5 Q;  1K8O A;  3I7F A;  5ELF A;  3VDY A;  4HIK A;  2M9V A;  4DXG A;  4BY1 B;  3DLL A;  1BF4 A;  3K7U C;  3FRP B;  1XMQ L;  4ZK9 B;  3U4V A;  4O42 A;  3A5Z B;  3K0Y A;  4N8F A;  1U0L A;  3WOE A;  3CXC A;  4B3M L;  1D6E C;  2UU9 Q;  2AHO B;  3F2C A;  1SXT A;  2WFW A;  4I7Z C;  4X65 L;  1WCM G;  2XN9 C;  4QGU A;  2XRQ D;  1YNN C;  3KDF B;  1K3B C;  1EY0 A;  3HOZ G;  1QVF A;  4DAY B;  3P20 A;  3HG9 A;  4FXD A;  2O4X A;  1WTP A;  2GA4 B;  1GVP A;  1DJR D;  4C1N K;  4PMW A;  1TWF B;  1WD1 A;  1D2B A;  3HKZ G;  4EQO A;  2V4D A;  1EEF D;  1I4X A;  2R92 G;  3KLW A;  5DEH A;  3NE5 B;  1D1K A;  3TBI B;  3D3R A;  2XTI A;  3NEN A;  3OMC A;  4CBV A;  3H3V I;  4LUZ A;  1KNA A;  1LO5 D;  1IBK L;  3KF8 A;  5ELC A;  3BZD B;  2KHS A;  5IYB G;  3QJY A;  3MC0 B;  3UE1 A;  2UUB L;  2KUM A;  3K81 C;  4DR4 Q;  1EWC A;  4JI4 L;  3A74 A;  4YWK A;  1S4Z A;  4GLV B;  4IPH A;  1VQJ A;  1HH2 P;  4OX9 Q;  1NNX A;  1WD0 A;  4UY8 C;  1DYQ A;  2WAC A;  4KI0 A;  3G6E A;  2KHI A;  1SN8 A;  3I4N G;  2VUM G;  2RDH A;  3PUX A;  2A6E C;  3IFD A;  2MNA A;  4IUQ A;  2R7Z B;  4DK3 C;  4LK1 C;  4P74 A;  2D5D A;  5M3F H;  5IT9 c;  1MI2 A;  2B39 A;  3GD7 A;  4RA8 A;  4A3F G;  1KDB A;  1UAP A;  1JQY D;  1JOR A;  1BCP B;  4A3E G;  4BY7 B;  4PZ7 A;  5JPM C;  1A62 A;  3CC2 A;  2Z0S A;  2SNS A;  4IAL A;  2KVM A;  4HMJ A;  1KL9 A;  3NHH A;  2ZM6 L;  5C3E B;  2AKW B;  2BE5 D;  4BS9 A;  4CKC A;  2ZJQ A;  5IT9 L;  1UWV A;  1R9T B;  3L2P A;  1JE4 A;  1Z6H A;  4LWC A;  3SVM A;  1PA6 A;  4JI3 L;  1A3V A;  3FHW A;  3SK5 A;  3MVV A;  1CK1 A;  2ZXP A;  1Q12 A;  4DR3 L;  3D31 A;  1Q90 A;  5EBC A;  3PO3 H;  4BBR H;  3M3Y H;  4JC0 A;  1CKN A;  4P72 A;  1ILP A;  3TS0 A;  1Z7T A;  4LFC L;  3FP9 A;  1WCM B;  4RKB A;  3J80 c;  2KCM A;  2MFI A;  2UXB Q;  5JJL A;  4XXE A;  4ZCK A;  2BH8 A;  3W1B A;  1H9S A;  5CC4 A;  5T1G A;  3NK9 A;  3HOZ B;  4DK0 A;  3VYS A;  1NMG A;  1TWA H;  5IP9 G;  1PH6 A;  3ULJ A;  5C3W A;  1RIP A;  2B2V C;  5GRO A;  1VQA A;  2Z4I A;  4YY3 L;  4A75 A;  2NVY B;  1W3S A;  2RQX A;  2WAQ G;  1GD7 A;  1EYC A;  5E4X A;  5L37 A;  1NCV A;  3K57 A;  1STA A;  3HKZ B;  3J80 L;  2IY5 B;  2KEN A;  1NR2 A;  4DA2 A;  5FLX c;  4FF3 A;  2R92 B;  3MEH A;  4XQJ A;  1O7I A;  1PFM A;  1S5F D;  4J6H A;  1TS3 A;  5F2D A;  3D6W A;  1I4Q A;  1LTS D;  4S3S A;  1Y1W H;  2NVX H;  3RMH A;  4BWG B;  1B50 A;  3AB9 A;  2F0V A;  4KHP L;  3ER0 A;  4FYD A;  1VMP A;  3BVM A;  4R4C A;  4DUY Q;  4MNO A;  1EQQ A;  2IJ0 A;  1YHQ A;  1QIL A;  4DV1 Q;  4LJZ C;  3A56 A;  1XTD A;  5FLX L;  2AQ1 B;  1EY9 A;  3MTS A;  4IUV A;  3KF6 A;  2OCE A;  1HR0 W;  2PCF B;  1VQ4 A;  2RA4 A;  1SE4 A;  3J81 c;  1RKN A;  2EYL A;  1YJW A;  4XTC S;  1VQ9 A;  1SJH D;  1XNR Q;  1WTQ A;  1EZ8 A;  4ID6 A;  5JJI A;  2ICE C;  5AFW A;  1LTR D;  1HTL D;  1X6O A;  3I4N B;  3NTI A;  2VUM B;  1KLU D;  2Q8I B;  3A7L A;  1PFN A;  3L3O C;  1ZKO A;  4B3M Q;  2YTV A;  3H09 A;  4KHV A;  5EPL A;  4JI5 L;  3H94 A;  1X3G A;  3MAQ A;  1WI5 A;  1HA5 A;  3J81 L;  1WTW A;  2YU9 B;  4A93 G;  3UDX A;  1SNM A;  2H4O A;  4JI1 Q;  2VQE L;  1TWH H;  4A3F B;  1LLR D;  4A3E B;  4C3J H;  3I91 A;  2DNC A;  2L11 A;  4IOA A;  2E2I B;  4QUC A;  2ICI A;  2WB1 E;  2B2T A;  3I70 A;  3R93 A;  1X54 A;  2PMZ B;  2A8V A;  2QEJ C;  4KKS A;  1F9Q A;  2N8N A;  4CHT B;  1QCB D;  3ERO A;  3FDT A;  5IGB A;  1E7Z A;  3M4Y A;  5GQO A;  3CCQ A;  2N88 A;  3PGZ A;  4OON A;  1SYD A;  1X3F A;  2PQA B;  3S24 A;  5BN4 A;  5IOD A;  4LW1 A;  1BCP C;  2DUD A;  1SNQ A;  3E3X A;  2JA5 H;  5IGE A;  2K05 A;  3QOL A;  4RCN A;  4LFB L;  1UEB A;  2DNE A;  1TS2 A;  2PPB C;  3SDZ A;  4G7H C;  4PMB A;  3NEM A;  1CSQ A;  5M3F G;  3NEL A;  1KAB A;  1KIX A;  2OF1 A;  3H3V H;  5BN5 A;  2J4X A;  3K7A B;  4F8M A;  4JI4 Q;  2Z4H A;  1PTO D;  3KBX A;  3P1H A;  1MJE A;  4OGQ C;  1WTH A;  3CCV A;  4JCV E;  2WAQ B;  4FXG C;  2JQO A;  3TSS A;  2RCN A;  3I73 A;  3NXW A;  4AIM A;  3T16 A;  5IIF A;  1OXU A;  3GTK H;  4KD3 A;  1D5M C;  3T4A C;  2SNM A;  3QOJ A;  1ENF A;  4R8I A;  2OWO A;  4ZKB B;  4BY1 H;  2N3S A;  1VS0 A;  3S2H H;  4DUZ L;  2UXD Q;  3PO3 G;  2OQK A;  4BBR G;  4DR5 L;  2AQ2 B;  1V8Q A;  1CHP D;  1UUP A;  2KEE A;  2BH2 A;  1STY A;  1K83 H;  1YIJ A;  5IP7 H;  1IBL Q;  5EPK A;  2KJX A;  3UDF A;  1VMC A;  5E1F A;  4LF7 L;  1Z9F A;  3T13 A;  2IPK D;  2KQ3 A;  4AH6 A;  4UDU C;  2ZM6 Q;  2RKS A;  3J7Z C;  3MFG A;  1KQS A;  5IYC H;  3UDI A;  2L1B A;  2K1B A;  3BS1 A;  1E2Z A;  1T5X D;  1FJG L;  2Z6K A;  3EBE A;  4L6T B;  2L12 A;  1LV9 A;  1TWC H;  4DK6 C;  1C4Q A;  4HSP A;  2Z8L A;  4JI3 Q;  1GUS A;  4H0L C;  2CWP A;  1PRT D;  3PO2 H;  3FVQ A;  4H02 A;  1YI2 A;  1A63 A;  1C7Y A;  1JE5 A;  2K33 A;  1K9M C;  1K8G A;  4HMI A;  4BXX H;  3KBG A;  3CU7 A;  4LFC Q;  4IUU A;  4TQU S;  4X64 L;  2XGT A;  2ENB A;  5C6A A;  1VQN A;  4R9W A;  1RJT A;  1LTB D;  3S17 H;  1FL0 A;  1KHI A;  2ALY B;  2DY8 A;  4LF4 Q;  3M85 A;  3DEP A;  3UI2 A;  1BXT A;  3E6Z X;  1Y8O B;  3OYY A;  4OWT B;  3R8B A;  4JI2 L;  5M3M H;  4B3T Q;  2JA8 H;  1JWM D;  4RWS C;  1CHQ D;  3H91 A;  3C2P A;  4JV5 L;  4L5T A;  1KNE A;  2JA6 G;  4YIJ A;  4RMF A;  5HGQ A;  2VY3 A;  1PH9 A;  1GUN A;  4TSS A;  3HOV G;  4KN4 C;  1H9R A;  1IXR A;  1QUQ B;  2D2C C;  1GXD C;  3LGJ A;  4KHP Q;  4N9T A;  5CR3 A;  2BCO A;  1JWU D;  2UU9 L;  4DR2 Q;  4EGV A;  2R7Z H;  5M3F B;  2F0Q A;  3FKI H;  3MXN B;  4XQQ A;  2OT2 A;  3V96 A;  2EPB A;  3R2I A;  4KLK A;  1MJC A;  1FNV A;  4JG2 A;  3T51 B;  2CCZ A;  1FR3 A;  1XPU A;  3LWE A;  4Z9C B;  4HIM A;  2VB3 X;  3T1Y Q;  4DR7 Q;  4IFD G;  1S40 A;  2JA7 H;  3IL8 A;  1STH A;  4DNR B;  1HNW Q;  1M4V A;  2CHB D;  4FNF A;  2CQA A;  2UXC Q;  1BDO A;  1EFW A;  1EEI D;  1FNW A;  1CI3 M;  2E2D C;  4JOI C;  5IYD H;  1HHV A;  4FF1 A;  1Y1V H;  4GN5 A;  2JA5 G;  1HZC A;  3SE0 A;  3PO3 B;  2E76 C;  1NUC A;  4BBR B;  3M3Y B;  3VR5 A;  3W2D A;  4C3I H;  3W5O A;  2RF4 A;  5CV5 A;  2XRS D;  4K8I A;  1CZG A;  4O2D A;  4BA1 I;  1IHZ A;  1LTT D;  2OTL A;  2B8F A;  5TSS A;  2KCT A;  1OXT A;  1PH4 A;  4DR4 L;  5EPJ A;  1TWA B;  3KLS X;  1G91 A;  1VQL A;  3SXH A;  3WDN A;  1PH2 A;  4PV1 C;  3IFT A;  4OX9 L;  4DV2 L;  1FGB D;  2NVY H;  3CW2 C;  5E7N A;  1TY2 A;  4OEM B;  2PNR C;  3BVG A;  3OTO Q;  4LMQ D;  3I8Z A;  2L9H A;  1KD1 C;  5C4H A;  2R92 H;  2VW9 A;  4GOP B;  1AE3 A;  4GZY C;  3MZ5 A;  3TN2 A;  1AW7 A;  3BYT B;  5J1Z A;  4Q5V A;  1VQP A;  1H9K A;  1DOK A;  1Y1W B;  1HXY D;  3BG3 A;  5C4J H;  4A3B H;  3ULP A;  1SMX A;  1DM0 B;  4POF A;  5C4X H;  2WKD A;  5IYB H;  3OMG A;  2XVS A;  5IP7 G;  1I94 L;  4DV7 Q;  2KOL A;  1VQB A;  4A76 A;  1HQR D;  1HNX Q;  2HUG A;  1IBM Q;  1KRS A;  3BVZ A;  2O5J C;  2F0E A;  1VQH A;  1TII D;  2NB0 A;  4YCW A;  4P2C B;  5KNB A;  4LUO A;  1HA6 A;  1YVC A;  5IT9 E;  2CW0 C;  3OIQ A;  1NBW A;  5C0X G;  5GAG C;  1E0B A;  1CSP A;  4ZKC B;  2EJM A;  1N34 Q;  3PO2 G;  1JB3 A;  4OO1 H;  1JOO A;  2HT1 A;  3K5O A;  5CV9 A;  4LUV A;  5I9P A;  4DK1 A;  1MKH A;  3ND9 A;  3I4L A;  1B44 D;  1EUJ A;  1QE6 A;  3K58 A;  2UUC Q;  4K0K Q;  4M1U B;  3D6C A;  1E3P A;  1AH9 A;  1I4R A;  5FKA C;  4LF7 Q;  5A35 A;  1AFP A;  4A3E H;  2UXB L;  1K8M A;  5J3B A;  2E2I H;  5BR8 Q;  4DF7 A;  1PH5 A;  1X3Q A;  3T53 B;  4LF8 L;  1S3O A;  1B1Z A;  1VQD A;  4KJO A;  3PF5 A;  2IW3 A;  3CME A;  5M3M G;  1WVL A;  2JA8 G;  1WJJ A;  3E9H A;  5LMN Q;  4L5S A;  4DPG A;  2B2U C;  5I4D A;  3J80 E;  1EYA A;  4ZQ3 A;  1XPO A;  1VQK A;  4WRD A;  2K14 A;  4X62 L;  2MQH A;  2Y0S G;  4U68 A;  3S1M B;  2B2Y C;  1VQ8 A;  2JSO A;  1S72 A;  2JA5 B;  5IWA Q;  4HJ5 A;  2Q2U A;  4K6L A;  4ALP A;  4R4I A;  4CKE A;  1L1O B;  1ICW A;  2HCI A;  1IL8 A;  4CDC C;  2MUY A;  1SMY C;  3FKI G;  1EQT A;  2EY2 A;  1KXL A;  2DJF C;  3QR8 A;  3J7A F;  4DUY L;  3K7A H;  5JOB A;  2QCP X;  2FHT A;  5FLX E;  3TDQ A;  1LT4 D;  2HDL A;  3RR5 A;  4LAA A;  4GN3 B;  2YYZ A;  2B63 H;  4HAE A;  5EKL A;  4P73 A;  2JA7 G;  4Y52 H;  5IOC A;  3CAM A;  2ZTC A;  3GTK B;  5KGU A;  3S1N H;  1XNR L;  3DWA A;  1HR0 Q;  4IO9 A;  1ZEQ X;  2NTT A;  4QJF A;  3AQQ A;  1QJO A;  2QDL A;  2E2H H;  3S2H B;  4F87 A;  3VR2 A;  3M4Q A;  5IYD G;  1A3T A;  1Y1V G;  4FF2 A;  4FP5 D;  1EOV A;  3X3M A;  2RCF A;  1ZYR C;  4C3I G;  3J81 E;  1LUZ A;  1K83 B;  3GTQ B;  2F1M A;  3QB3 A;  5DM7 3;  4IUT A;  4IFD I;  4JI1 L;  3AYH B;  3Q0A A;  2N55 A;  3CCL A;  2F52 A;  3PUY A;  2H5X A;  5J22 A;  2QDB A;  1V1O A;  4GOP C;  4X66 Q;  3CCM A;  4B3R Q;  5EJW A;  1B7Y B;  1N36 Q;  3PSI A;  1V9P A;  5JJK A;  2IT1 A;  1XNQ L;  3OW7 A;  2P5Z X;  3H0G G;  4G57 A;  1U9R A;  4HED A;  1TWC B;  1B3Q A;  5JJZ A;  4A3C H;  1Q81 C;  3CPF A;  1F77 A;  3PO2 B;  3M4P A;  1BUV T;  4XIG S;  1Y8N B;  1CA6 A;  3U9S A;  3CP0 A;  1F9S A;  2NUC A;  1HNZ Q;  4A3B G;  3AMU A;  1TQO A;  3PF4 A;  4A93 H;  1YZ6 A;  2ID0 A;  1SYB A;  5C4X G;  1Q1E A;  1OTC A;  3S17 B;  1M1K C;  3AU7 A;  1Q8K A;  1JR0 D;  1UE5 A;  2YTY A;  4DFA A;  3RZD H;  5IE8 A;  1UE1 A;  3EFX D;  2E75 C;  1S5D D;  1SMY D;  2H1E A;  4DV2 Q;  5M3M B;  3VYR A;  3R2T A;  2JA8 B;  2AUJ D;  1EFI D;  4GS3 A;  3G4S A;  2I0Q A;  2EY5 A;  3PUV A;  1JT8 A;  2KHJ A;  2RSO A;  2Y0S B;  5E3F A;  3RLO A;  4XYO A;  5AJ3 Q;  4FVM A;  1SFO H;  2EYO A;  5M5W H;  1YJN A;  4OO1 G;  1PYS B;  5H1S E;  4NB3 A;  4DXF A;  1X32 A;  3CC4 A;  2UXD L;  1PHJ A;  1PXU A;  3RLN A;  1IZ6 A;  3TP7 A;  1W6K A;  3FKI B;  1X56 A;  4EQP A;  1I94 Q;  3MWY W;  3BJU A;  1CQF A;  1IBL L;  4FDB A;  4ABN A;  1NE3 A;  1ZYR D;  3BDL A;  2PZT A;  4IPC A;  1X55 A;  4NW2 A;  4KTA A;  2B2W A;  4PQX A;  4HTH A;  1LT3 D;  5C0X I;  3V2T A;  2JA7 B;  4HIO A;  3TZD A;  1TS4 A;  1PH7 A;  1YNN D;  2IX3 A;  3PUZ A;  1X3E A;  3HZX A;  2K75 A;  2QW7 A;  1FGU A;  1L1O C;  4DAP A;  3SR1 A;  3RZO H;  2FJ2 A;  2R61 A;  2PMZ E;  4K2K A;  1A8V A;  3H3V C;  3S2D H;  1RHP A;  3ERS X;  4C2M H;  1Y1V B;  4A3J H;  3VR6 A;  3ZYY X;  4C3I B;  5C44 H;  3T56 B;  3ONA B;  3DUZ A;  4DV4 Q;  1VQG A;  4R4O A;  4P71 A;  4H44 C;  1V43 A;  4DR6 L;  5ISR A;  2I5M X;  1PZI D;  3SEB A;  4C1N I;  3J80 i;  1JOK A;  1PTO F;  2OXP A;  3M7G A;  4GNX A;  4LF4 L;  4LF8 Q;  2K7V A;  3ZJY C;  2Q8T A;  2F0M A;  3ULL A;  2B63 G;  1MHW C;  2RDG A;  4JVZ A;  2F0D A;  2F0H A;  3PIO 3;  5M5X B;  2K5W A;  3F2U A;  3KJO A;  4B3T L;  5DAU A;  2K03 A;  3H0G B;  4CGY B;  4LF9 Q;  4X62 Q;  4KY5 A;  3K5L A;  2G9D A;  4JBK A;  2MPM A;  2HHH Q;  2MGS A;  3L7Z C;  2ZJR A;  1ENC A;  1IYU A;  5FK9 C;  2ZT9 C;  5C4J B;  5IGG A;  4A3B B;  4CDE C;  2YV5 A;  2R7D A;  4QL5 A;  3G6J B;  5C4X B;  1DON A; 
#chains in the Genus database with same CATH homology
 2EYH A;  2A6E D;  3PUW A;  4CKB A;  1STE A;  5EGT A;  3NBH A;  5JEA G;  2LKV A;  1GUT A;  2I46 A;  4ZAI A;  5C5M A;  4RKL A;  1GHK A;  1XX8 A;  3CKI B;  2ZXO A;  3BDC A;  2VNU D;  3KK7 A;  3K59 A;  1EY4 A;  1OXS C;  2R6G A;  5EKI A;  4WOR A;  2A6H C;  5K5P A;  4JK1 C;  1ILQ A;  1PRT F;  1QWY A;  2PZW A;  4TKO B;  2OEO A;  2WKC A;  1O7L A;  3ERQ A;  1CQV A;  5FO9 B;  1MSG A;  1HUN A;  3PV0 A;  2AWO A;  1DZ1 A;  2EYM A;  1DOM A;  4PNY A;  4IFD H;  2HQE A;  2BOS A;  2MP1 A;  3KLS A;  5JAV A;  1JWS D;  4K6D A;  4K5V A;  4DU9 A;  3DMU A;  4XT3 B;  4I65 A;  2FMC A;  4B08 A;  4XQN A;  1EIH A;  5HUR A;  2XWB B;  2KA7 A;  5KNC A;  1WTO A;  5CV6 A;  5A2Q E;  4HCS A;  2B63 B;  1ZXT A;  1AEX A;  4C56 C;  1NR4 A;  4EVO A;  3S1N B;  4OO1 I;  5I6Y A;  5ELD A;  3DXJ C;  1ML0 D;  5J39 A;  1STN A;  2EVB A;  2K28 A;  4O1N A;  1RDP D;  2E2H B;  1J8I A;  4IUR A;  4RHS A;  3VA7 A;  1BBX C;  3H6M A;  4KMU C;  1EY5 A;  4UAI A;  1B9N A;  5JVH 3;  5T1I A;  1RTO A;  2F3W A;  2A6H D;  3FPU B;  1H9S B;  2VXW A;  5DNF A;  2NTS A;  2A5H A;  5KND A;  3Q24 A;  3A7A B;  5D3I B;  1U4R A;  1CA5 A;  1D1I A;  2BDN A;  4DN4 M;  4PMC A;  3NUC A;  1R4Q B;  1PFB A;  2EE1 A;  5C0X H;  2SEB D;  1Q1B A;  1PTO H;  2XNA C;  3TZU A;  1EZ6 A;  4KD4 A;  4A93 B;  4K2L A;  2L5T A;  2L0C A;  1RF2 D;  4WJW A;  2X69 A;  1PZK D;  5G3L D;  1XYI A;  1BCP D;  3P7J A;  3CHB D;  2NBF A;  3RZD B;  1TR5 A;  2PW5 A;  2NWG A;  3FPP A;  3NBI A;  4MN3 A;  4XDX A;  5CBE E;  1VF7 A;  3NSW A;  1V1P A;  1O7Z A;  3NTK A;  2NN6 H;  1KTK A;  1A2T A;  1YNJ C;  1G8Z D;  1SFO B;  5M5W B;  1GUW A;  1SNO A;  1T5E A;  5KYL A;  1JC7 A;  3V05 A;  1EOT A;  3TME A;  3C3L A;  5KYI A;  4NP5 A;  1GOZ A;  2E74 C;  4QIW B;  4A3I B;  5EKK A;  3NTH A;  3OPO A;  1D5X C;  5FO8 B;  1H9J A;  3QG1 A;  3RZO B;  3Q6S A;  3S2D B;  2PYK A;  3P75 A;  3GTP B;  4C2M B;  3BDO A;  4A3J B;  2F3V A;  5KRU A;  5C44 B;  4IUN A;  3DEO A;  4ODG A;  2K6A A;  4KJN A;  1KAA A;  3DM1 A;  4QF4 A;  4RH6 A;  1WTV A;  2B2V A;  2EZV A;  4MIU A;  4C3H G;  1LTA D;  1MBY A;  2A68 C;  1KDC A;  1LTG D;  1LT5 D;  5C4Z A;  1STB A;  3C46 A;  1TVX A;  2XSC A;  4BA2 I;  3A8K E;  4L63 B;  4DAY A;  3Q23 A;  2K5D A;  1A3U A;  3WOF A;  2TSS A;  5HGT A;  2O5I C;  1SE3 A;  2SOB A;  4HSV A;  2F0S A;  4WFN 3;  2X6G A;  5A2Q L;  3J7Y W;  3K5N A;  5IGC A;  3M7N A;  2JA6 B;  2KED A;  4MHE A;  4ZUI A;  3HOV B;  3HS0 C;  3MXG A;  5C5L A;  4ME5 A;  2F0L A;  2DN8 A;  1B2T A;  3S1Q B;  1J9O A;  3GTL B;  1HTP A;  4HCE A;  2BA1 A;  4DNT B;  2PW7 A;  1O78 A;  3NPP A;  1B53 A;  4E6I A;  1C48 A;  2XWJ B;  4H7B A;  1EL0 A;  1GJX A;  2NVT B;  2AWN A;  3OIP A;  2EYF A;  3S9W A;  4R8N A;  2D9U A;  3C1F A;  2NN6 G;  1SAP A;  3GTM B;  1PMR A;  1O7Y A;  2JE6 I;  1XXG A;  4X3T A;  2MJ8 A;  1WTX A;  2WIN B;  4A3K B;  1U4M A;  2B2T C;  1I4G A;  4NKL A;  3HOY B;  4F7X A;  2QKI C;  1I3Q B;  2IL8 A;  4DAV A;  2X6L A;  2F0F A;  2A73 B;  2NZ1 D;  5IGD A;  2M00 A;  4KN7 C;  3ND8 A;  1SYG A;  1F9R A;  1UNS A;  3W3A A;  4C3H B;  2LFN A;  1TKW B;  2QIL A;  4FO2 A;  2IX0 A;  1G2T A;  3QWN A;  1BR9 A;  1FYC A;  2E2J B;  1ROD A;  4ZRZ A;  1JOQ A;  1ONL A;  3HOW B;  2CW0 D;  5ELE A;  3VYU A;  1HFN A;  2LMC B;  1ENA A;  5D3D A;  3O13 A;  3MXU A;  4K5W A;  3HGB A;  1XTC D;  2WII B;  4J1M A;  1LAC A;  4G7O C;  4NMZ A;  1VF5 C;  4OHJ A;  5JEA H;  1SSO A;  1HFG A;  3S15 B;  2PO4 A;  1IKM A;  3EQL C;  3DWP A;  1I4P A;  3FMC A;  1BQQ T;  3MXP A;  3M4O B;  2BE5 C;  3J7A V;  1BNZ A;  1PTO B;  3NQT A;  3D8G A;  1DOL A;  2R93 B;  3TP6 A;  2F03 A;  4DGZ A;  2NYZ D;  3LNN A;  1MSH A;  4ZLT F;  4B9X A;  3K5M A;  4F88 A;  2J7Z A;  4Q0F A;  2EJF C;  4A3G B;  2L55 A;  4IFD J;  1CTM A;  1F2L A;  2C9O A;  4CJ2 C;  4KKU A;  1S5E D;  5I2Y A;  4X3U A;  1RD9 D;  1JIC A;  3IAY A;  1LTI D;  1O80 A;  4OIK A;  1GUO A;  1TY0 A;  2QF7 A;  3ITP A;  1NSN S;  2WP8 J;  2K32 A;  4CJ0 B;  3QO2 A;  2RVL A;  1IKL A;  2M2L A;  1PRT B;  3LWU A;  2F0U A;  1VCI A;  4OL7 A;  3HRZ C;  2G9H D;  1S5C D;  1EWH A;  3QIA A;  1NAP A;  3CQZ B;  5NUC A;  2EYP A;  4CJ1 B;  2KCN A;  4RCO A;  5KEE A;  2BA0 A;  1EQV A;  2LS0 1;  3D4W A;  3Q22 A;  4A3M B;  1B3A A;  1L0Y B;  1DCZ A;  1DXM A;  4B9W A;  2PZU A;  1BOS A;  4XT1 B;  2F0K A;  1GHJ A;  5E4W C;  4V19 0;  1CM9 A;  3C1E A;  4QMG A;  2NN6 I;  2WV6 D;  1G29 1;  3JAM E;  2DY7 A;  4IQZ A;  5COR A;  4ULL A;  4KY7 A;  4TRD A;  1AN8 A;  4G4K A;  4JBW A;  2RSN A;  2C5C A;  1LT6 D;  1MD2 D;  3I90 A;  5C0X J;  2F4I A;  4K5X A;  1CZW A;  3E0J A;  1HCZ A;  4RGN A;  2K5Q A;  1QG7 A;  4RGM A;  2IWH A;  4FF4 A;  2ZXR A;  1GUG A;  1KLG D;  5CV7 A;  1DD2 A;  4EQN A;  3VR4 A;  4X3S A;  3URY A;  4KY6 A;  1PTO C;  1HQM C;  3S1R B;  5K36 H;  5EQ0 A;  4ZYS A;  3GTJ B;  4K8J A;  3CRL C;  3S14 B;  1RTN A;  2XIW A;  1MGS A;  4ZUJ A;  4IUP A;  1EY7 A;  1LAB A;  3NWS A;  4KV6 A;  3TP5 A;  1EY6 A;  3OWE B;  5CMD A;  1UEA B;  5G3L F;  1BCP F;  3GTO B;  3TP8 A;  2F0N A;  5I9O A;  3MFY A;  1SYC A;  5JPN C;  1IYV A;  2A74 C;  3OOC A;  2B2U A;  3I4M B;  3SHL A;  1ET6 A;  1E2V A;  3SK4 A;  3MXN A;  3VA5 A;  1HPC A;  1SBB B;  2B2Y A;  2TMP A;  1TS5 A;  3HOU B;  2KEC A;  1QNU A;  4A3D B;  1PYW D;  3FEW X;  1G6Z A;  1PRT C;  2JEB I;  1EIG A;  1FNU A;  2K01 A;  2FFK B;  4BBS B;  3IKJ A;  2CVR A;  4RGT A;  1SND A;  1R4P B;  1PDQ A;  4QB4 A;  4OIJ A;  2F0I A;  2IX1 A;  5FO7 B;  4IZ8 A;  2HDM A;  4KHZ A;  1EU4 A;  3VR3 A;  1RCV D;  1PZJ D;  4KK7 A;  1A2U A;  1QB5 D;  2J0T D;  1H9M A;  3A54 A;  2R3Z A;  3K6O A;  1WTR A;  5IGF A;  1AP0 A;  3VYT A;  3GP7 A;  2RDF A;  5I6W A;  3LX0 A;  1II3 A;  1OXV A;  1CFM A;  1SYE A;  3L9A X;  2VB2 X;  3GO5 A;  3RLF A;  5JVG 3;  3SK8 A;  2EOT A;  1EY8 A;  4HN7 A;  4RGO S;  1M8A A;  2K04 A;  1PLF A;  1FD7 D;  1SEB D;  1Q3L A;  4AYB B;  3PMF A;  2F0G A;  1TU2 B;  1Y69 U;  2AQ3 B;  4G7Z C;  3GQB A;  1I6V C;  1TWG B;  3A8J E;  1QOH A;  3JAM L;  2F0W A;  2SDF A;  4M8A A;  5K36 G;  3X3N A;  3NWT A;  2WB1 B;  1OXX K;  4ILW A;  2NVQ B;  2EJG C;  2FIN B;  2FMM A;  4HR7 B;  1AZP A;  2LY7 A;  3OSO A;  4Y7N B;  3MHB A;  2F0O A;  3DWQ A;  5CBA E;  2MHV A;  5EBD A;  2D62 A;  1HRJ A;  4N9P A;  1SYF A;  3BYY B;  5D65 A;  1QNK A;  2HCC A;  1I50 B;  1E2W A;  3OHX C;  4NDX A;  1X3P A;  2F0P A;  3GV6 A;  5CGK A;  1IW7 C;  4C3J G;  4L8J A;  3GTG B;  5C3X A;  5COY A;  3NQI A;  3KLR A;  2B2W C;  4KKT A;  3SK6 A;  1KDA A;  1XWE A;  1W6J A;  3EVQ A;  1JCK B;  3CRK C;  3HEJ A;  1VDZ A;  3S16 B;  3E5S A;  5JEA J;  4J8Q A;  3EA6 A;  1ET9 A;  1D5Z C;  5CV8 A;  2RBM A;  1L0X B;  1HUM A;  3G7L A;  5LL6 X;  1SDF A;  4IN3 A;  1G2S A;  2O2L D;  5D14 A;  1YNJ D;  4RHR A;  4X3K A;  3N52 A;  1SE2 A;  3DHQ A;  4V0B A;  2F0J A;  1ESF A;  5CV4 A;  4XYQ A;  1F2Z A;  2A69 C;  4QUF A;  1C8C A;  2NVX B;  3NP8 A;  2JYO A;  2EY1 A;  1B9M A;  2F0T A;  2Z1C A;  5M9O A;  5BN3 A;  3RUZ A;  1U4L A;  4RFB A;  1TT2 A;  1OO9 B;  3A55 A;  1AZQ A;  5FOB B;  1SNP A;  5I2X A;  5LHY 1;  2AUK A;  1IW7 D;  3R3O A;  1EYD A;  1CT1 D;  3N6R A;  2PQE A;  5DM6 3;  3D4D A;  2KCC A;  1SJE D;  1EU3 A;  1B4O A;  3EJI A;  2B8G A;  3I3C A;  4FXK C;  3GV3 A;  5CYU A;  3OWF A;  4U67 3;  2JEA I;  1I4H A;  3A8I E;  1V1P B;  3HOX B;  4H13 C;  5M5Y B;  2L4N A;  2EYJ A;  1TWH B;  1A6X A;  4C3J B;  1F2Y A;  1U4P A;  4K14 A;  1Y8P B;  3KUP A;  2A68 D;  1A15 A;  3I72 A;  3PIP 3;  2Q8R E;  3D4R A;  2BDO A;  1I6H B;  2EXZ A;  3MA2 B;  1S5B D;  4RAU C;  5LL6 S;  2JXM B;  2EDG A;  1ESR A;  1Q8I A;  1SNC A;  1STG A;  1F9P A;  3HP3 A;  2A69 D;  1Z47 A;  3U9O A;  2JP1 A;  5KIX A;  1F2M A;  4QCL A;  5ELB A;  1BO0 A;  2EY6 A;  3RD4 A;  2I07 B;  1K8O A;  5ELF A;  2M9V A;  4DXG A;  4BY1 B;  1BF4 A;  3FRP B;  4ZK9 B;  4O42 A;  3K0Y A;  3WOE A;  1D6E C;  1SXT A;  4I7Z C;  2XN9 C;  2XRQ D;  1YNN C;  1EY0 A;  3P20 A;  3HG9 A;  4FXD A;  2O4X A;  1WTP A;  2GA4 B;  1DJR D;  4C1N K;  4PMW A;  1TWF B;  1WD1 A;  1D2B A;  4EQO A;  2V4D A;  1EEF D;  1I4X A;  5DEH A;  3NE5 B;  1D1K A;  3TBI B;  3D3R A;  4CBV A;  3OMC A;  1KNA A;  1LO5 D;  3KF8 A;  5ELC A;  3BZD B;  2KHS A;  3QJY A;  3MC0 B;  2KUM A;  1EWC A;  1S4Z A;  1WD0 A;  1DYQ A;  2WAC A;  4KI0 A;  2RDH A;  3PUX A;  2A6E C;  3IFD A;  4IUQ A;  2R7Z B;  4LK1 C;  2D5D A;  1MI2 A;  2B39 A;  3GD7 A;  4RA8 A;  1KDB A;  1UAP A;  1JQY D;  1JOR A;  1BCP B;  4BY7 B;  5JPM C;  2SNS A;  4IAL A;  2KVM A;  4HMJ A;  3NHH A;  5C3E B;  2BE5 D;  4BS9 A;  4CKC A;  5IT9 L;  1R9T B;  1JE4 A;  1Z6H A;  3SVM A;  1A3V A;  3SK5 A;  3MVV A;  1CK1 A;  2ZXP A;  1Q12 A;  3D31 A;  1Q90 A;  5EBC A;  1ILP A;  1Z7T A;  1WCM B;  4RKB A;  4XXE A;  1H9S A;  5CC4 A;  5T1G A;  3NK9 A;  3HOZ B;  4DK0 A;  3VYS A;  5C3W A;  2B2V C;  2Z4I A;  2NVY B;  2RQX A;  1EYC A;  5E4X A;  1NCV A;  3K57 A;  1STA A;  3HKZ B;  3J80 L;  1NR2 A;  4DA2 A;  4FF3 A;  2R92 B;  3MEH A;  4XQJ A;  1PFM A;  1S5F D;  4J6H A;  1TS3 A;  5F2D A;  3D6W A;  1I4Q A;  1LTS D;  4S3S A;  3RMH A;  4BWG B;  1B50 A;  3AB9 A;  2F0V A;  4FYD A;  1VMP A;  3BVM A;  2IJ0 A;  1QIL A;  4LJZ C;  3A56 A;  5FLX L;  2AQ1 B;  1EY9 A;  3MTS A;  4IUV A;  2PCF B;  2RA4 A;  1SE4 A;  1RKN A;  2EYL A;  4XTC S;  1SJH D;  1WTQ A;  1EZ8 A;  4ID6 A;  2ICE C;  5AFW A;  1LTR D;  1HTL D;  3I4N B;  3NTI A;  2VUM B;  1KLU D;  2Q8I B;  3A7L A;  1PFN A;  3L3O C;  1ZKO A;  3H09 A;  4KHV A;  5EPL A;  3MAQ A;  3H94 A;  1HA5 A;  3J81 L;  1WTW A;  2YU9 B;  1SNM A;  2H4O A;  4A3F B;  1LLR D;  4A3E B;  3I91 A;  2DNC A;  2L11 A;  2E2I B;  4QUC A;  2ICI A;  2B2T A;  3I70 A;  3R93 A;  2PMZ B;  2QEJ C;  4KKS A;  1F9Q A;  4CHT B;  1QCB D;  3ERO A;  3FDT A;  5IGB A;  3M4Y A;  2N88 A;  1SYD A;  5BN4 A;  5IOD A;  1BCP C;  1SNQ A;  5IGE A;  2K05 A;  3QOL A;  4RCN A;  2DNE A;  1TS2 A;  2PPB C;  3SDZ A;  4G7H C;  4PMB A;  1KAB A;  2OF1 A;  5BN5 A;  2J4X A;  3K7A B;  4F8M A;  2Z4H A;  1PTO D;  3KBX A;  3P1H A;  4OGQ C;  2WAQ B;  4FXG C;  3TSS A;  3NXW A;  3I73 A;  5IIF A;  3T16 A;  1OXU A;  4KD3 A;  1D5M C;  3T4A C;  2SNM A;  3QOJ A;  1ENF A;  4R8I A;  4ZKB B;  2AQ2 B;  1V8Q A;  1CHP D;  1UUP A;  2KEE A;  1STY A;  5EPK A;  2KJX A;  1VMC A;  5E1F A;  3T13 A;  2IPK D;  2KQ3 A;  4UDU C;  2RKS A;  3MFG A;  2L1B A;  2K1B A;  3BS1 A;  1E2Z A;  1T5X D;  4L6T B;  2L12 A;  1LV9 A;  1C4Q A;  4HSP A;  2Z8L A;  1GUS A;  4H0L C;  1PRT D;  3FVQ A;  2K33 A;  4HMI A;  3KBG A;  3CU7 A;  4IUU A;  4TQU S;  2ENB A;  5C6A A;  4R9W A;  1RJT A;  1LTB D;  2DY8 A;  3M85 A;  3DEP A;  3UI2 A;  1BXT A;  3E6Z X;  1Y8O B;  3R8B A;  1JWM D;  4RWS C;  1CHQ D;  3H91 A;  3C2P A;  1KNE A;  4YIJ A;  1GUN A;  4TSS A;  4KN4 C;  1H9R A;  2D2C C;  1GXD C;  4N9T A;  5CR3 A;  2BCO A;  1JWU D;  4EGV A;  5M3F B;  2F0Q A;  4XQQ A;  2OT2 A;  3V96 A;  2EPB A;  3R2I A;  3T51 B;  1FNV A;  1FR3 A;  3LWE A;  4Z9C B;  2VB3 X;  4IFD G;  3IL8 A;  1STH A;  4DNR B;  1M4V A;  2CHB D;  4FNF A;  2CQA A;  1BDO A;  1EEI D;  1FNW A;  1CI3 M;  2E2D C;  1HHV A;  4FF1 A;  3SE0 A;  3PO3 B;  2E76 C;  1NUC A;  4BBR B;  3M3Y B;  3VR5 A;  3W2D A;  5CV5 A;  2XRS D;  4K8I A;  1CZG A;  4BA1 I;  1IHZ A;  1LTT D;  2B8F A;  5TSS A;  1OXT A;  5EPJ A;  1TWA B;  3KLS X;  1G91 A;  3SXH A;  3WDN A;  4PV1 C;  3IFT A;  1FGB D;  1TY2 A;  2PNR C;  3BVG A;  4LMQ D;  3I8Z A;  2L9H A;  5C4H A;  4GZY C;  3MZ5 A;  3TN2 A;  1AW7 A;  3BYT B;  5J1Z A;  4Q5V A;  1H9K A;  1DOK A;  1Y1W B;  1HXY D;  3BG3 A;  1DM0 B;  2WKD A;  3OMG A;  2XVS A;  1HQR D;  2HUG A;  3BVZ A;  2O5J C;  2F0E A;  1TII D;  2NB0 A;  4P2C B;  5KNB A;  1HA6 A;  5IT9 E;  2CW0 C;  3OIQ A;  5C0X G;  1E0B A;  4ZKC B;  2EJM A;  1JB3 A;  4OO1 H;  1JOO A;  3K5O A;  5CV9 A;  5I9P A;  4DK1 A;  3ND9 A;  3I4L A;  1B44 D;  1QE6 A;  3K58 A;  4M1U B;  3D6C A;  1I4R A;  5FKA C;  5A35 A;  1AFP A;  1K8M A;  4DF7 A;  1X3Q A;  3T53 B;  1B1Z A;  4KJO A;  2IW3 A;  1WVL A;  2B2U C;  5I4D A;  3J80 E;  1EYA A;  4ZQ3 A;  4WRD A;  4U68 A;  3S1M B;  2B2Y C;  2JSO A;  2JA5 B;  4K6L A;  4CKE A;  1ICW A;  2HCI A;  1IL8 A;  2MUY A;  1SMY C;  1EQT A;  2EY2 A;  3J7A F;  5JOB A;  2QCP X;  2FHT A;  5FLX E;  3TDQ A;  1LT4 D;  2HDL A;  4LAA A;  2YYZ A;  4HAE A;  5EKL A;  5IOC A;  3GTK B;  5KGU A;  3DWA A;  1ZEQ X;  2NTT A;  1QJO A;  3S2H B;  4F87 A;  3VR2 A;  1A3T A;  4FF2 A;  4FP5 D;  3X3M A;  1ZYR C;  4C3I G;  3J81 E;  1K83 B;  3GTQ B;  2F1M A;  3QB3 A;  5DM7 3;  4IUT A;  4IFD I;  3Q0A A;  2N55 A;  3PUY A;  5J22 A;  2QDB A;  1V1O A;  5EJW A;  2IT1 A;  3OW7 A;  4G57 A;  1U9R A;  4HED A;  1TWC B;  5JJZ A;  1F77 A;  3PO2 B;  1BUV T;  4XIG S;  1Y8N B;  1CA6 A;  3U9S A;  1F9S A;  2NUC A;  3AMU A;  1TQO A;  2ID0 A;  1SYB A;  1Q1E A;  3S17 B;  3AU7 A;  1JR0 D;  4DFA A;  3EFX D;  2E75 C;  1S5D D;  1SMY D;  2H1E A;  5M3M B;  3VYR A;  3R2T A;  2JA8 B;  2AUJ D;  1EFI D;  2EY5 A;  3PUV A;  2RSO A;  2Y0S B;  5E3F A;  4XYO A;  4FVM A;  2EYO A;  4OO1 G;  4DXF A;  1X32 A;  1PXU A;  3TP7 A;  1W6K A;  3FKI B;  4EQP A;  3MWY W;  1CQF A;  4ABN A;  1ZYR D;  3BDL A;  2PZT A;  4NW2 A;  4KTA A;  2B2W A;  4PQX A;  4HTH A;  1LT3 D;  5C0X I;  3V2T A;  2JA7 B;  3TZD A;  1TS4 A;  1YNN D;  2IX3 A;  3PUZ A;  3HZX A;  4DAP A;  3SR1 A;  2FJ2 A;  2R61 A;  4K2K A;  3H3V C;  1RHP A;  1Y1V B;  3VR6 A;  3ZYY X;  4C3I B;  3T56 B;  3ONA B;  3DUZ A;  4H44 C;  1V43 A;  5ISR A;  1PZI D;  3SEB A;  4C1N I;  1JOK A;  1PTO F;  2OXP A;  3M7G A;  2K7V A;  2Q8T A;  2F0M A;  2RDG A;  2F0D A;  2F0H A;  3PIO 3;  5M5X B;  2K5W A;  3F2U A;  5DAU A;  2K03 A;  3H0G B;  4CGY B;  4KY5 A;  3K5L A;  2G9D A;  2MPM A;  2MGS A;  3L7Z C;  1ENC A;  1IYU A;  5FK9 C;  2ZT9 C;  5C4J B;  5IGG A;  4A3B B;  2KOL A;  3G6J B;  5C4X B;  1DON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...