1F2MA

Simplification of a protein loop in staphylococcal nuclease
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYAYAPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Simplification of a Protein Loop in Staphylococcal Nuclease
rcsb
source organism Staphylococcus aureus
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f2mA00
1KABA 4DFAA 5KYLA 1SYBA 2EYMA 3ITPA 1EY7A 3MXPA 4QMGA 5CV7A 1EZ8A 5ISRA 5CGKA 2OEOA 4K5VA 3OMGA 3SK4A 1TQOA 2KQ3A 4KTAA 3SXHA 1A3TA 2SOBA 5C4HA 1EQVA 3MHBA 3VA5A 3D4DA 2NUCA 3SK8A 4E6IA 2F0GA 5KIXA 4KHVA 4QF4A 3H6MA 5CV6A 1ENAA 4S3SA 4KY5A 1SNCA 4IUNA 4NDXA 3OWFA 4ID6A 4KD3A 4B9WA 5CR3A 1STYA 5IGGA 1SYFA 4KD4A 5CV9A 5E3FA 3T16A 4HMIA 1F2ZA 3C1FA 4F8MA 1EY5A 4J1MA 1JOQA 3QB3A 4DF7A 5JAVA 2F0LA 2EYLA 3TP8A 4ZUJA 1SNOA 3QOJA 5IGBA 2QDBA 2F0DA 1EY0A 5C3WA 3P1HA 1AEXA 1A3UA 3MVVA 2RKSA 4EQPA 4EQOA 5C5LA 2OF1A 2OXPA 5JOBA 2WACA 4RKLA 3S9WA 1KDCA 2ENBA 5EKKA 1EY4A 1F2MA 5J22A 2EYPA 1KDAA 3HEJA 5CV4A 4KY7A 2F0TA 4DU9A 1EY6A 2F0HA 5C5MA 3BDCA 3V2TA 1JORA 4KJNA 4K5WA 1SNQA 3P75A 4K2KA 2KHSA 5EKLA 5C4ZA 2EY6A 4KV6A 1KDBA 4DGZA 1TT2A 2F0NA 1STHA 5C3XA 1EYDA 3D6CA 2EYJA 3EROA 4OL7A 1A2TA 2EYHA 2EY5A 2EXZA 2PQEA 2F0KA 4WORA 2F0MA 2F0QA 3RUZA 2F3WA 2PW7A 4PMBA 3NK9A 2RBMA 4EVOA 3MZ5A 5IGDA 5IGCA 1EZ6A 1STBA 1IHZA 3SK5A 3PMFA 4LAAA 4MIUA 5CV5A 1EYAA 4I65A 3T13A 4K8IA 4PNYA 2F0EA 1F2YA 5I6YA 5KEEA 1JOOA 2PZUA 3EVQA 2HQEA 4WRDA 4NMZA 5HGTA 1SNMA 5M9OA 2PW5A 5IIFA 1SYCA 5I9PA 5J1ZA 5KGUA 4NP5A 3QOLA 3TMEA 5CV8A 1TR5A 2EYFA 3NUCA 4K14A 1SYGA 2F0IA 3EJIA 2F0PA 3BDLA 1STAA 4H7BA 1A3VA 3C1EA 3NXWA 4N9TA 3TP7A 2SNSA 2PZWA 4K8JA 1NUCA 2O4XA 1II3A 3D8GA 4NKLA 5IGFA 4ODGA 1EYCA 5C6AA 2M00A 5CC4A 4K6DA 4N9PA 2F0OA 2F0WA 1NSNS 1STNA 2PYKA 2RDFA 3LX0A 3NP8A 4YIJA 3DHQA 2PZTA 3DMUA 3OSOA 5EGTA 1EY9A 1KAAA 2LKVA 1EY8A 5E1FA 3OMCA 2F0VA 3MEHA 4RKBA 2F0UA 4PMCA 3HZXA 4KY6A 4TRDA 5NUCA 3SK6A 5IGEA 2EY2A 5IODA 1SNPA 4ME5A 1SNDA 3TP5A 5I9OA 4KJOA 5KYIA 4HTHA 4R8NA 5F2DA 4J6HA 4B9XA 2SNMA 4QB4A 2F0SA 2EY1A 3R3OA 5K5PA 3TP6A 2F0FA 4G57A 4ZQ3A 3SR1A 3NHHA 4IALA 5DAUA 2EYOA 4HMJA 3SHLA 5I6WA 1JOKA 2F0JA 3ERQA 5J39A 4ZUIA 4K5XA 5IOCA 1ENCA 4K2LA 4F7XA 5KRUA 2F3VA 3NQTA 5DEHA 1STGA 4IZ8A 1RKNA 3U9OA 5HURA 4EQNA 3E5SA 1SYDA 1U9RA 3D4WA 1A2UA 1SYEA
chains in the Genus database with same CATH superfamily
1KTKA 2CKZB 2HUGA 4CDEC 3AFQA 3PUVA 5IP9H 2M9VA 4TKOB 3GV3A 3TZDA 5M5YB 1O7LA 1TWAB 2YYZA 3CQZH 3TBIB 1TQOA 2A1AA 1M1KC 4OO1I 3BYYB 2X6GA 1DOKA 4F88A 4IURA 5KIXA 4QF4A 3NWSA 4KY5A 2UXCL 1E24A 4TVAB 4XYQA 2R93G 2IX1A 1QVCA 3RN2A 3VA7A 4NB3A 3GTQH 1PRTC 4Q0FA 5EKKA 4C3JH 4X65L 3FVQA 2F4IA 1LLRD 3M4YA 1D8LA 4J15A 2Z0SA 4B3TQ 2A6EC 2CW0C 4DV7Q 1PA6A 2B2TC 1MJCA 3PUZA 1TWFB 4PV1C 4HJ5A 4X6AH 5C3XA 3I4NB 2EYJA 4A3JH 3PF4A 2NN6H 3I56A 4LF4Q 2B2WC 2F0QA 4FNFA 1VQ5A 1PH6A 5JJIA 2WB1B 2VZAA 1N36Q 1N33Q 3PMFA 3OTOL 2ICEC 3SE0A 5I6YA 5IP7G 4L5SA 1HNZQ 4JI0L 2D0OA 1SYCA 1B3QA 2BH8A 3UE1A 1TWCB 2JP1A 1B1ZA 1Z6HA 3AQQA 4JBKA 4BY1H 2JA7B 2AHOB 4NXML 2ZTEA 4K14A 4ZLTF 4ZRZA 3DLLA 3I4OA 3C1EA 2K33A 1L0XB 1KAWA 4HIMA 1V8QA 2E5LL 4C3HB 1B7YB 2OT2A 1LO5D 5GAHC 1IXRA 1AZPA 3DHQA 3HP3A 5JVG3 1HQRD 2QF7A 4ZYSA 1L0WA 1EY9A 3KDFA 1KAAA 3PO3H 5KNDA 2MNAA 2IJ0A 1SNDA 4ME5A 3G71A 4PQXA 3QO2A 2PMZE 3NWTA 2EQSA 4DR6Q 3D0FA 5DNFA 4IUQA 2B2TA 4JBMA 2R92B 1HFNA 3QR8A 4X3KA 2K5QA 5AJ3L 5KRUA 4KN4C 1EWIA 3ONAB 1IKLA 3TREA 5HURA 5M5WB 2EOTA 1AP0A 4JI7Q 1PDQA 3KLSA 4AYBB 1KRSA 4MHEA 1CA5A 4K5VA 4U673 2HCCA 2RDHA 1X56A 5C4XB 5FO8B 2A69C 4X3TA 1LTTD 4E6IA 4JI1L 3PF5A 2DJGC 3PCOB 1YIJA 1STYA 2K05A 3MXNB 5LHY1 1X3PA 3HOWH 3QB3A 4MNOA 3QOJA 2F0DA 3PV0A 2HIVA 3MVVA 3PUWA 1JC7A 3GQBA 1KDCA 3HEJA 1YNNC 4A3CG 4KJNA 1SNQA 4G7HC 4A3GB 4KV6A 1STHA 5ELOA 3GTKB 3J81j 3A56A 1S40A 2QDLA 3TRZA 2Y0SE 2OTLA 3T56B 4X3UA 1DGSA 4WFN3 3BDOA 3W1GA 2R7ZG 5I4DA 1QZHA 3PIOA 4MIUA 1PH5A 4CDFC 3L0OA 4H44C 1UAPA 3BG3A 4DNIA 1PVOA 3EVQA 5JVH3 1B9NA 1VQFA 4R1JA 2KA7A 1EOTA 3CMAA 4UP8A 3VYSA 3HOVH 2EYFA 2JE6I 1I4XA 3U4ZA 3WOFA 1RCVD 1J5EL 3GV6A 3OPOA 4PZ6A 3A5UA 3NBIA 4N9PA 2KJXA 5C3EG 4DK6C 1LT3D 3MXUA 1HR0L 2JA7G 3R2TA 1PFBA 2JN4A 3AU7A 1CKNA 4KY6A 5CBEE 5FLXL 4IPGA 3E0EA 2G9HD 2EY2A 2VS1A 1FR3A 2EVBA 3TEHB 3PO2B 4C3HG 1K3RA 3JC66 1F9SA 2PQAA 5F2DA 3CQZB 1ET9A 1Y1VB 4LJZC 4B9XA 2JA6H 3A7LA 1U4RA 3Q8DA 2QEXA 3TP6A 2NWGA 5BN4A 1SFOB 1PFNA 4YWLA 4A93B 3L3OC 4DV1Q 4CBVA 5IOCA 4LF9Q 2DY8A 2GN5A 1PH8A 3KLWA 1WTOA 1GKHA 4EQNA 2QA4A 3H0GH 1PTOD 1CZWA 4RG1A 1I4GA 4Q5VA 1XYIA 1PFSA 5GAEC 2KVMA 4H02A 2R92G 1EWCA 2DGYA 4G4KA 3GTQB 1GXDC 1QNKA 4C3JB 4WJ3M 1CHPD 1D6EC 1HPCA 4G7ZC 3CF5A 1B50A 4LUVA 1U0LA 4IUNA 2M2LA 5BR8Q 4AYBG 2IHEA 2Q8RE 2G9DA 1VQ8A 2E2JB 2IX3A 1MHWC 2F3IA 2IPKD 3VR5A 1D7QA 3VDYA 4A3LH 3S2DH 2K04A 4RFBA 1LT5D 4JYAL 2H1EA 2UXCQ 2XN9C 1IBML 3UDFA 2B2UC 5IYDG 4A3IH 1KDAA 2DNCA 1X9NA 1KNEA 1SR3A 1CTMA 2VL6A 1OXUA 1VQEA 4IUTA 1V43A 3AMUA 1V9PA 3L9AX 2PQEA 4BA1I 1ESFA 1NY4A 2Z6KA 4LUZA 5HY6A 2BDOA 2EDGA 3RR5A 2JA8B 1EEID 3IFDA 2V1CC 1EUJA 3AB9A 5EPJA 5ELBA 1U4MA 5HGQA 3OTOQ 2E2DC 2KOLA 3T53B 1I4RA 2JJQA 4O1NA 3NXWA 4DR1Q 2D9UA 1MSHA 2AUJD 3K0XA 5E3FA 1XNRL 4LFBQ 1UE7A 3G6JB 4JI8L 2LXJA 2XSCA 1MI2A 3HZXA 4TRDA 1PV4A 2E5LQ 2JSOA 4OX9L 2Z4HA 4GNXB 2Q2HA 1M8AA 1I4QA 2A8VA 2UXDQ 1H9MA 4DUYL 3IFTA 4G57A 4I7AA 5IP7H 1Y69U 4UHVA 3Q0AA 1K28A 2F4VQ 5GAGC 3I91A 1BVSA 3PO2G 1X55A 1Y1VG 2XWJB 4K8IA 4DV2Q 3HOWB 4JCVE 3KBGA 2IHFA 4FXGC 1QVFA 3BJUA 3WWVA 1R4PB 1EFID 1YZ6A 2IT1A 5IYBG 1I3QH 5M3MH 3S16B 4UDUC 5CV9A 2QEJC 3A5ZB 1ILQA 4OGQC 4J1MA 2K14A 1RODA 4KKSA 2QDBA 2RSOA 1Y8NB 1IL8A 5GQOA 4QY7A 1SROA 3MTSA 1VQAA 2FFKB 2NVQH 4K0KQ 4LK1C 4KY7A 2CFMA 3BDCA 4DR5Q 3X3MA 2K6AA 2R7FA 1VQIA 1JCKB 3J7YW 1H9SB 3K5OA 1CI3M 1J6QA 3M7GA 3SGIA 3D6CA 3HOVB 3VYTA 2DY7A 5KNBA 1KIXA 5IGCA 1EZ6A 1Q8KA 5C0XI 4B3TL 5M5YH 5JAVA 1TWAH 3Q6SA 4PNYA 4UP7A 1FNVA 2NZHA 1JOOA 2O5JC 4M8AA 2E8GA 5IIFA 4FO2A 4LF4L 3L2PA 1T5XD 3S1MH 2TMPA 1YJNA 1FD7D 4TSSA 1N33L 2JA6B 2JA8G 2F0PA 1WJJA 1RIPA 3D8GA 2A68D 3STBC 4B3SQ 3S1NH 2J0TD 4A3CH 1HNZL 4ZKCB 2DNEA 4LW1A 5ELDA 3IL8A 3H0GB 1J5EQ 5G3LF 1SE8A 2QKIC 5CYUA 5D3IB 4Y7NH 1UE1A 2C5CA 2E75C 1YNXA 4XYOA 5C4JB 1TY2A 2R7ZH 1TWFH 2MO1A 3R3OA 1FGUA 5H1SE 2D2CC 2CH4W 1F9RA 2PNHA 3NHHA 1TXYA 2WKDA 3BYTB 2F0JA 3DM3A 1VQ7A 1T5EA 2HT1A 3MFGA 1G51A 1EU4A 5ELNA 3S2DB 2NN6I 4DR6L 5EPKA 1FYCA 3UDXA 1GUOA 4QIWB 1YI2A 3GTLH 4X64Q 2ZT9C 4IO9A 1G291 4YCVA 5C3EH 2JA7H 2HHHQ 2RVLA 2RA4A 3SK8A 3T1YQ 4C3IB 4A3IB 4KHVA 2B2YA 1JJ2A 1Y8PB 1BDOA 3CMEA 5IT9E 1DXMA 4JI7L 1F9PA 4R4IA 4C3HH 2ZM6Q 5LL6X 1AZQA 3CPWA 2AQ3B 4IFDJ 1S5DD 4JI6Q 5DLQE 1WOCA 2A6ED 2CW0D 4P75A 2LSSA 3GD7A 1AEXA 1D5MC 1YNJC 3A7AB 1TKWB 4RKLA 4DUZQ 1F2MA 1Q90A 2R93B 3Q22A 3MWYW 1SE2A 1L1OC 4RMFA 4N8X1 3E9HA 4GOPB 1X3QA 3CXCA 4DGZA 2R92H 1BF4A 1VQNA 3CCVA 3S14B 4KHPQ 4OL7A 5KNCA 2UUBQ 2EXZA 2IW3A 3RMHA 2F0MA 3SEBA 1GUTA 2AKWB 5M5WH 4GN3B 1DYQA 1IW7C 1SE4A 3Q23A 4QGUA 2FHTA 3T51B 1AN8A 1P8LA 1CSPA 5J3BA 4XQNA 1E2WA 3W5OA 4JI2Q 5KGUA 1XTDA 3J7AF 1PYSB 1QG7A 2Q8TA 4LFCQ 5T1IA 3F1ZA 4JVZA 3PIP3 5IYDH 1JWUD 3FPPA 3F2DA 1EOVA 1ESRA 2UUAQ 3CCEA 5IGFA 3BU2A 5AFWA 3KOJA 3NE5B 3K7UC 4HEDA 3S2HB 4JI4Q 3M7NA 3DMUA 1HNWQ 3KJOA 5E1FA 3OMCA 4KKTA 4LF8Q 2BOSA 4X66Q 4XIGS 3QG1A 4M1UB 4H13C 4QB4A 5FLMG 3KDFB 4ZQ3A 2V4DA 3EN2A 3CCQA 1S5BD 1LM0A 1RJTA 2ZTCA 1JE4A 4F7XA 1I3QB 2EE1A 2A69D 5IYCH 1YJWA 1I6VC 5G3LD 1S72A 4IPDA 1BBWA 3OOCA 4JBWA 3SXHA 4DV1L 1BXTA 2SOBA 4LF9L 2J4XA 3FDTA 1E3PA 3MHBA 2NVQB 3RN5A 1CKMA 1SYFA 1CA6A 4IUVA 4R4OA 1QB5D 4HMIA 2EXDA 3C1FA 2E76C 2FMCA 1ASYA 3F2UA 1N8RC 1E1TA 1SDFA 4ZUJA 4CKCA 2L55A 4C3IG 4ZKBB 4DR3Q 1BOSA 4EQOA 5LMNQ 5C5LA 2OF1A 5JOBA 2K5NA 3PO2H 3G7LA 1F9QA 5BR8L 2EYPA 1Y1VH 1F77A 1NBWA 1QUQB 2BCOA 1XPUA 4OIKA 1SFOH 1GUNA 4A93H 3VYUA 2ZTDA 2Z8LA 4OEMB 2XWBB 3S1MB 3K7AH 1A2TA 4ILWA 1HZBA 3A54A 4JOIA 3RUZA 2LFNA 3S17H 2HQLA 2Y0SG 3S1NB 4F87A 5IYBH 2X6LA 3LNNA 4DK3C 1EYAA 4I65A 1VQCA 3TZUA 3J80i 2BE5C 5M9OA 2PW5A 1AW7A 4IJLA 3G6EA 4Y7NB 5GADC 3LWEA 1LT4D 5FKAC 3TMEA 2Q2UA 2E2JH 3O13A 2R7ZB 2L1BA 3X3NA 5FO9B 1EYCA 1SN8A 4K6DA 2PYKA 1DJRD 3A8JE 4CKEA 1KC8C 1NR2A 1WCMG 1LTSD 1VQDA 3M4PA 1XMQQ 2F0VA 3ULJA 2EZVA 5IGEA 3KF8A 1Y1WG 1MKHA 4HN7A 4DR1L 3GTLB 3G48A 4LFBL 5C3EB 1X6OA 2VY3A 1CKNB 1BO0A 3K8AA 4HMJA 2YU9B 3CCMA 1TIID 2VXWA 5CMDA 3ND8A 3S1RH 3FPUB 1SBBB 4RGNA 1HA5A 3D4WA 4IFDG 2JA8H 2UXDL 3JAMc 2EPBA 1EZ8A 1BCPC 5FOBB 1PH2A 1PTOF 4A4IA 2F4VL 1A3TA 3I90A 3FRPB 2WAQE 1QOHA 3EBEA 4A3FG 5LL6S 4DV2L 1MBYA 4G7OC 4KHZA 1HRJA 1OXTA 1EQRA 3KK7A 2L5TA 1NMGA 1DM0B 5M5XB 4OONA 4C2MB 1EY0A 1W6KA 1PTOH 2B2WA 1DCZA 1NTGA 4EX5A 1WTPA 5IY0A 1E22A 2F0TA 5C5MA 5A2QL 4ALPA 4JI5Q 4K5WA 3D4RA 2CHBD 4IN3A 1HJPA 4POFA 3C2PA 2KCTA 5CORA 4NW2A 1N9WA 4WORA 2A74C 3T1HQ 2I5MX 2WIIB 4K0KL 1HCZA 2A19A 2N88A 4FXDA 4DR5L 5C0XJ 3H15A 3NENA 2ZJRA 1CQFA 1LTBD 3CCLA 2IWHA 1RDPD 4IUUA 5J1ZA 2RDGA 3V05A 3S16H 1LTLA 4CDDC 1B70B 4IOCA 3EJIA 3BDLA 3TP7A 2PZWA 4K8JA 2O4XA 5TSSA 2N49A 5D65A 2F0OA 1STNA 2N3SA 2NZ1D 1TVXA 3LX0A 3M3YB 1IL2A 1EY8A 4RGTA 1C0AA 1WTRA 3GTGH 2UUCQ 1IBKQ 1OO9B 4QJFA 3K80C 4XQQA 3KFUA 4B3SL 4J6HA 4PMWA 2EY1A 4CDCC 3FMCA 4UAIA 4HCEA 4BBRB 4BWGB 2K50A 2BA1A 5EKIA 1OXVA 1K8GA 1SYDA 2MFIA 3U9SA 1SJED 4DFAA 1K73C 2D0PA 2OEOA 3MA2B 4A3MG 4DV3Q 2AMCB 5E4XA 1I6HH 2ZXPA 2RQXA 2L9HA 5K36H 4XXEA 2F0GA 1AFPA 3H94A 3H6MA 1ENAA 1JICA 1E7ZA 4RHSA 1KHIA 4KD3A 3BZDB 3NEMA 1DOMA 1G8ZD 2A6HC 1AH9A 3K7AB 4X64L 5FLMH 2XIWA 1GJXA 2HHHL 3S17B 3T1YL 1JB3A 1V1OA 2Q2IA 2L4NA 1CK1A 1Q82C 5C4JH 2ZM6L 1S4ZA 3F8TA 1VQBA 1SAPA 1O7IA 4MTNA 4JI6L 1A62A 1ICFB 1ZEQX 2XGTA 5EKLA 3MAQA 1KDBA 2F0NA 4GLXA 1SE3A 1EL0A 4DUZL 2ZJPA 1QWYA 1FGBD 3PUYA 2VQEQ 3LWUA 5FLXE 3CCUA 4X3SA 3J81E 5CV5A 5KEEA 3Q24A 3STBD 1XJVA 2EJGC 3J80c 4KHPL 1ENFA 4YHHQ 1TS3A 2HQEA 2WINB 4NMZA 4C3IH 1SNMA 2N78A 2UUBL 4EQ5A 3HOYG 2XNAC 5I9PA 2KBNA 4R9WA 1FJGL 4XQJA 1GOZA 4KK7A 3D3RA 3HFZB 1X65A 1K8AC 4NKLA 1P16A 1NMFA 2ATWA 1W2BA 3S1RB 1MD2D 4N8FA 2HDLA 4JI2L 2B29A 2LKVA 2RSNA 1ASZA 4PMCA 4LFCL 3ZJYC 2HCIA 2R93H 2CVRA 1PYWD 3MXNA 4UPAA 1SNPA 1XWEA 4TQUS 3A0JA 4U68A 2UUAL 1LACA 3H3VH 2SNMA 3M4OB 3S14H 3UDIA 1GUSA 4JI4L 3S1QB 2EYOA 5JEAJ 1HNWL 2CWAA 1ZYRC 4LF8L 1WTHA 4X66L 2B3GA 2K75A 1A2UA 1KABA 1KD1C 2L15A 2LMCB 4GKJQ 3DEOA 4BBRG 2K52A 1I5FA 1PTOB 4L8JA 1G6PA 1NJIC 2KEDA 4ABNA 1WTQA 3I4MG 3TN2A 5C4HA 1WCMH 3VA5A 3D4DA 5IE8A 2KCCA 4LF5Q 1EU3A 1SMYC 2B2UA 1GM5A 5LMNW 1YNJD 1D2BA 2B2VC 4B9WA 5IGGA 4IUPA 4KMUC 1Y1WH 5EJWA 4DR7Q 1TWHH 4MZ9A 3DWPA 1EY5A 3HOUG 4P71A 4J8QA 1PRTF 3CPFA 4C1NK 3S2HH 2G5DA 3BZCA 4OWTB 1BBUA 3GO5A 1PH4A 1A3UA 4DK0A 1VQMA 4A3KG 2ENBA 4HIKA 2WB1E 1EY6A 2VQFQ 4IFDH 5T1GA 2YTXA 3JAML 2YTVA 1TT2A 4DR3L 1OXXK 3L7ZC 2R3ZA 5LMNL 1WYDA 4LUOA 5EBCA 1HHVA 2F3WA 3S15H 4Z9CB 3N6RA 3HKSA 4A3FH 1SMXA 4ZK9B 2KECA 1SSOA 4LF6Q 4HJ7A 3H09A 2B8FA 4JC0A 1WTXA 2PZUA 4FDBA 1K0SA 3GTGB 2N8NA 3GTPB 4NP5A 3I8ZA 1JT8A 1A8VA 1G2TA 4LWCA 1TR5A 2KUMA 1A3VA 5JJZA 1BCPF 2HIXA 5C6AA 5CC4A 2NVXH 2RDFA 1VF5C 1TS5A 2AQ2B 3FP9A 4RGOS 4BA2I 4JW0A 3NELA 2CCZA 4A3JG 2Q8IB 1XPOA 1FNWA 1C48A 2MGSA 4KJOA 3U50C 4A3EG 3KLRA 1GHKA 2NVTH 4OELB 1I6HB 3FHWA 4RWSC 1Y14B 4P73A 4FVMA 4RH6A 4GNXC 1XMQL 2O2LD 3DM1A 1V1PA 3E6ZX 1STGA 1RKNA 2EJFC 1K8MA 3E5SA 4DV0Q 3W1BA 4RA8A 2PO4A 1SYBA 3ITPA 5C44G 1GVPA 1M90C 3MXPA 5CV7A 2PMZB 1I94Q 4JV5Q 1U4LA 4A75A 3W3AA 4FF4A 3HOZB 3ICEA 4GLVB 1PH7A 3OWFA 1GHJA 4ID6A 3SVMA 1X3GA 5JPNC 3HG9A 4KD4A 1LTGD 5M3FG 3R93A 4FP5D 1Y8OB 4DF7A 3CRLC 3E3XA 5E4WC 1Q46A 1SLJA 1JR0D 2X69A 4B08A 2C9OA 4EQPA 3JAMi 2I5LX 1EEFD 1OXSC 1HTLD 5I2YA 3T4AC 1CT1D 1DD2A 1YHQA 1X54A 1JORA 2C35B 1SJHD 2YU9H 2B39A 4A3MH 5FJ8G 1PRTD 4RCOA 1R9TB 1B8AA 1JWSD 2R61A 4PMBA 1S5ED 1KNAA 4DXFA 1JE5A 5LMUQ 2NZOA 4JI5L 1HNXL 2K01A 2BDNA 1WVLA 2GA4B 2K5WA 1JMCA 1K0RA 1KLGD 4BBSG 3ND9A 3T1HL 4GKKQ 2Y0SB 4B3RQ 3CCJA 1I50H 2F52A 4DV4Q 2GVBA 1HZ9A 5JEAG 5M5XH 1Q12A 4C2MH 1LYLA 3TS0A 4ULLA 4A76A 2KHIA 2OCEA 1FJGQ 3VR6A 2B63G 4HJ9A 5ELEA 2K32A 3C46A 3KJPA 3DXJC 1S5FD 1C8CA 1RHPA 4FF2A 2O5IC 4UP9A 4YWMA 1WCMB 3OHXC 1BCPD 1FL0A 5FK9C 5J39A 3G4SA 1DONA 4QCLA 3J80L 3HOYH 3DWAA 2F3VA 1Y1WB 2UUCL 1IBKL 1TWHB 3F2CA 2DJFC 1H9RA 3ERSX 5JJKA 2I07B 1XNQQ 2TSSA 4CHTB 5IWAQ 1AE3A 1VDZA 1FVIA 1NAPA 3P7JA 1O7YA 1BBXC 5GROA 3CC2A 4L5QA 4APVA 1SRUA 4DPGA 4OO1G 2WAQG 1L1OA 1WD0A 2XTIA 2VB2X 3E0JA 1JOQA 1PRTB 3NTIA 4DV3L 3M3YH 3HOZG 3J7A5 4WJ4A 4O2DA 5C3WA 2JEAI 3S15B 1D5XC 1PYBA 2IX0A 2OQ0A 4A3FB 4P72A 4L5TA 5DM73 1EY4A 1U4PA 1CHQD 4DU9A 3WOEA 3P75A 3W2DA 3PIO3 3CAMA 4BBRH 1Q3LA 1HA6A 1PFMA 2CQOA 3VYRA 1C7YA 4LF7Q 1F2LA 4A3DG 2EYHA 1Z7TA 4GOPC 2RCNA 4YWKA 3NPPA 1YNND 1X3FA 4EVOA 5IGDA 2GVAA 1N32Q 4IQZA 2NVXB 3HOUH 2VUMG 1K8OA 3HRZC 2L11A 1EIFA 4HSVA 2K1BA 1DOLA 4WRDA 1LABA 2XVSA 1J9OA 5A35A 1VQ6A 4A3LG 1X3EA 3VR3A 1U5KA 4A3KH 3V96A 2EIFA 2NVTB 2VQEL 1SYGA 1B4OA 1H9KA 1S5CD 1BCPB 1II3A 2H5XA 4YHHL 4JBJA 2ID0A 1PMRA 4DXGA 5I2XA 5IODA 3FKIB 1XTCD 4A3BB 4JPBW 4XT1B 4BXXG 3RD4A 2BH2A 2E2IB 3K5NA 4Y52H 2VW9A 3U4VA 3K59A 4ZUIA 1GUGA 1VMCA 2FMMA 3NBHA 3RZDB 1SXTA 1U9RA 4QL5A 5EQ0A 4AH6A 3M85A 4GOPA 4K6LA 4YY3Q 1EY7A 1VQLA 3ZYYX 1VMPA 5CGKA 3GTOH 4CKBA 1LT6D 2A6HD 3MFYA 3GTMB 1HZAA 1KL9A 2AWOA 4S3SA 1SNCA 4BY7G 5CR3A 1XPRA 1L2FA 4GKJL 1DZ1A 2AQ1B 2JXMB 4A3EH 4A3MB 2K4KA 3K58A 2PQAB 1B2TA 1X32A 3CKIB 3HOXG 1O80A 2A5HA 2KHJA 2WKCA 4LF5L 4DNRB 1WTWA 3CP0A 2OXPA 3TSSA 2OTJA 3S9WA 1ML0D 1JJGA 3I73A 4DR7L 1GD7A 3CC7A 4BS9A 3M4OH 1G2SA 5C44H 4K2KA 3CC4A 2D5DA 3S1QH 2NVYH 2EY6A 1Q8IA 2H4OA 4DAYA 1VQHA 3UDGA 1N34Q 1JQYD 2PNRC 1WFQA 2NB0A 3NTKA 1I50B 3QWNA 3H3VI 3MC0B 4HIOA 1M4VA 3I2ZA 1W6JA 1STBA 3PSIA 3SK5A 2VQFL 1W3SA 2R7DA 4LAAA 3RZOH 5M3FH 1WTVA 1T9HA 3BVMA 3OW7A 5M3MG 3BZKA 2MP1A 4HJAA 2PI2A 1EIYB 1HNXQ 4B3ML 3RLOA 4DNTB 4LFAQ 2ZXOA 1NNXA 1STAA 2AWNA 4LMQD 4N9TA 3GP7A 1C9OA 4DR2Q 4LF6L 2UXBL 2QILA 1WI5A 1VCIA 3KF6A 3I72A 3HOYB 2JA5G 1VQKA 1G91A 5FJ8H 1XMOQ 3MEFA 2NTSA 2HDMA 3KUPA 3K5LA 1ZYRD 3PIPA 4I7ZC 3OW2A 1PZKD 3QIAA 2F0SA 1OTCA 4QIWE 3J7AV 4ME3A 3FKIG 4BBSH 4IFDI 4A3BG 2B8GA 1XX8A 1S3OA 3HKZE 1EYGA 1EIGA 1QUQA 1KRTA 4DAMA 1SMYD 1SYEA 1VS0A 4OXPA 1UEBA 4X62Q 1EQTA 5JEAH 4CJ2C 5IT9c 3OMGA 5A2QE 2N55A 3GTPH 4GZYC 1J8IA 1EQVA 2B63H 2FXQA 4ZCKA 4DV0L 1E2ZA 3OIPA 4NDXA 1CM9A 1PLFA 1ZXTA 2SDFA 1I94L 1HR0W 1F2ZA 4JV5L 2WP8J 3D31A 4F8MA 4IPCA 2F0LA 3I4MB 2K5HA 2RKSA 3I4NG 3QJYA 4V190 2K03A 1A15A 4DR4Q 1KQSA 1TWGB 2WB1G 3HOUB 3V2TA 1K9MC 1PHJA 1QVGA 2KHSA 2MJ8A 3NTHA 1IBLQ 1B9MA 5EBDA 2F03A 3EROA 4A3KB 1YVCA 4OHJA 2VB3X 2F0KA 4IPHA 1VQGA 3EQLC 4CJ1B 3DUZA 1IKMA 2RBMA 1FNUA 3MZ5A 2YTYA 3IKJA 3RLFA 4QUCA 1HUMA 4MN3A 4OO1H 3CU7A 1B44D 1SEBD 2CWPA 5KYLA 1VQJA 2UU9Q 1F2YA 3J81L 3FEWX 4IOAA 3HOZH 2HD3A 3I7FA 1EFWA 3C3LA 5HGTA 1IYVA 1IYUA 4FYDA 5CV8A 1MSGA 4DN4M 5LMUL 2I5HA 1VQ9A 3D6WA 4AQYQ 2Z6KC 3A55A 3LGJA 2JQOA 4JI3Q 3CD6A 3NP8A 2Z6BA 4DV6L 1IYJB 1HQMC 1UE5A 3VR4A 3URYA 4A3DH 2WV6D 4RAUC 4GKKL 4NXNQ 2F0UA 3RLNA 4B3RL 3KBXA 2DUDA 3TQYA 3KLSX 2PI2E 5CBAE 3AYHB 3PQIA 4RGMA 4DV4L 3GTOB 1EQQA 4NPSA 1E0BA 2F0FA 2LS01 2VUMH 1R9TH 2RF4A 3SHLA 3EFXD 2OQKA 2VNUD 4ZAIA 1ENCA 3WDNA 4A3JB 5C4XG 1ET6A 3I4LA 3R2IA 1BKBA 1VQOA 4A3EB 4P74A 1GO3E 2XRQD 1H9JA 1ILPA 1PXUA 2RCFA 1V1PB 4PG3A 2OWOA 2NUCA 2I46A 4DA2A 4R4QA 4JG2A 5CV6A 4HIDA 4X65Q 5C44B 4BY1B 2K5DA 2NVYB 4CGYB 2MHVA 1XNQL 4BXXH 5E7NA 1A63A 4HR7B 5IWAL 4AIMA 1G6ZA 3TP8A 1SNOA 4R4TA 1UUPA 5IGBA 2ZJQA 4CJ0B 4A3GG 4JK1C 1KXLA 4P2CB 4WJWA 3F2BA 3RZOB 5M3FB 3PO3B 4POGA 4R4CA 2F0HA 2JEBI 2SEBD 1Q81C 5IYCG 1CFMA 1RTOA 4RHRA 5ELCA 1YHAA 3SDZA 1HFGA 2PPBC 1R4QB 3J81i 1KLUD 2EY5A 4JI0Q 1QJOA 4DAVA 2PW7A 1ZKOA 3ULLA 4NXMQ 4BY7H 1IHZA 3GTJH 4OIJA 1QE6A 4GN5A 1Q1EA 1RTNA 1RL2A 2F0EA 4LF7L 5C0XG 3HOXH 1QZGA 3PUXA 1RD9D 1LV9A 2LY7A 1YITA 3CHBD 3QOLA 4MTKA 1IW7D 4HSPA 5JPMC 3I70A 1BQQT 3NUCA 2L0CA 2ASBA 4H7BA 1UE6A 1N32L 5IP9G 1XXGA 1K83H 4ODGA 2E74C 2XRSD 1NSNS 4YIJA 4BBSB 1UWVA 4QUFA 4B3MQ 2I0QA 3OSOA 3AFPA 3TDQA 4A93G 3MEHA 4RKBA 2Q2TA 4EGVA 5AJ3Q 2WFWA 2LXKA 5NUCA 1RF2D 2UXBQ 1CKOA 3M9BA 2E2HH 5I9OA 5KYIA 4R8NA 1IZ6A 4GLAC 3EIVA 5ELFA 2KEEA 4DV5L 1TY0A 2B63B 3SR1A 3VR2A 5BN5A 3BVGA 1CSQA 1LTRD 3K5MA 3ERQA 3RNUA 2JK8A 2J7ZA 4K5XA 1JJCB 3N52A 1BUVT 2B2VA 2K7VA 5DEHA 2CH4A 4C3JG 4JI1Q 3NSWA 2CQAA 3R8BA 1C4QA 1PH1A 1D1KA 1I4PA 2EYMA 2K5VA 1PZID 2KCMA 4XTCS 4OWXB 2KQ3A 1Q86C 1VF7A 2NN6G 2JA5H 1NE3A 3JAME 2RHSB 1D5ZC 4KI0A 4L5RC 4AYBE 1PTOC 2IY5B 3J7ZC 4O42A 4YY3L 3I55A 1Q7YC 1WD1A 2JYOA 3AEVA 3DEPA 3GDEA 2YV5A 1PH9A 3I3CA 3CCSA 2ZXRA 4DV7L 1JB7A 1L1OB 1Z9FA 3IRBA 3FKIH 4RCNA 4BY1G 4HJ8A 4A3BH 1HH2P 2WAQB 1TS2A 4C1NI 2B2YC 1HTPA 3HS0C 2E2IH 1MJEA 5JJLA 1YJ9A 1N36L 1UNSA 2K28A 2IL8A 4O0AA 1HUNA 1EYDA 2PCFB 5IT9L 3CW2C 3CCRA 3RZDH 3PO3G 4IJHA 2JA9A 3S24A 3NK9A 3EA6A 2QGQA 4OWWB 4PZ7A 2MPMA 3GTMH 1N34L 1K3BC 4A3DB 2FJ2A 5DM63 4L63B 1HR0Q 4UY8C 4FXKC 4DKAC 3I4NH 1BNZA 1QCBD 3A8KE 1ONLA 1NCVA 2BA0A 3IAYA 1NUCA 2VUMB 3HGBA 1L0YB 3TS2A 2M00A 2BE5D 4GNXA 1QILA 1I4HA 4H0LC 2A73B 1CZGA 1TS4A 2MQHA 2R6GA 1MIUA 2KENA 1H95A 4LFAL 1TWCH 2KCNA 3K6OA 4HTHA 4LNQA 1ICWA 4DR2L 4DV6Q 3HKZB 3HOWG 3UI2A 5K5PA 4IALA 2F1MA 1LTAD 5D3DA 4R8IA 3DWQA 3NQIA 1XMOL 4K2LA 2MO0A 1TU2B 3NQTA 3B6YA 1HXYD 1O78A 3U58A 4FF3A 3UE0A 1STEA 2FINB 4QMGA 4DAPA 5ISRA 1JWMD 5D14A 3H91A 4HAEA 3SK4A 4KTAA 3NBHB 2QW7A 4YCUA 4JYAQ 1E1OA 2ALYB 4QQBX 5COYA 1IBMQ 2P5ZX 4X62L 3T16A 1YHBA 3KF8B 3ER0A 3A8IE 2EYLA 3OYYA 1YEZA 1YBYA 2NYZD 1A0IA 3P1HA 1H9SA 3K81C 4YCWA 4BY7B 3HOVG 2WACA 1UEAB 5C4XH 3GTJB 1AE2A 3M4QA 5J22A 5CV4A 2MUYA 2EJMA 4XDXA 2DN8A 2QCPX 3HOXB 5C4ZA 2Z1CA 3P20A 1V1QA 4KN7C 1GUWA 3ULPA 1HZCA 1MGSA 5FLXc 1Q1BA 3OWEB 3J81c 4GN4B 5BN3A 1VQ4A 4DR4L 1LUZA 5K36G 1K83B 4DAYB 1BR9A 4V0BA 5EAYA 2JA6G 2Z9HA 1CQVA 2NTTA 3T13A 1IBLL 4XT3B 1CUKA 3BVZA 1EIHA 2AUKA 1XNRQ 4JI8Q 4A3GH 5L37A 3OIQA 2E2HB 3GTKH 2ES2A 5FO7B 1O7ZA 2D62A 4JOIC 3H0GG 2F0IA 3J80E 4OX9Q 2ICIA 2SNSA 2UU9L 5M3MB 4GS3A 1EWHA 3I4MH 3CRKC 1B3AA 4DUYQ 1E2VA 2F0WA 3H3VC 2PZTA 1NR4A 2NBFA 5EGTA 3KYHC 4C56C 1QNUA 1TWGH 4KLKA 3SK6A 2L12A 1LTID 2A68C 3TP5A 3A74A 5EPLA 2Z4IA 3KF6B 4AQYL 3BS1A 2RHQB 1PZJD 1VQPA 4DK1A 4FF1A 4JI3L 1D1IA 3MXGA 3E9IA 2JA5B 5I6WA 5DAUA 1Z47A 1JOKA 4L6TB 5C0XH 3PGZA 4PZ8A 4NXNL 1A6XA 1PH3A 4IZ8A 3U9OA 3K57A 4A3IG 3HKZG 4DV5Q 1B53A 4HCSA 4KKUA 3K0YA
chains in the Genus database with same CATH topology
1KTKA 2HUGA 3PUVA 2M9VA 4TKOB 3GV3A 3TZDA 5M5YB 1O7LA 1TWAB 2YYZA 3TBIB 1TQOA 4OO1I 3BYYB 2X6GA 1DOKA 4F88A 4IURA 5KIXA 4QF4A 3NWSA 4KY5A 4XYQA 2IX1A 3VA7A 1PRTC 4Q0FA 5EKKA 3FVQA 2F4IA 1LLRD 3M4YA 2A6EC 2CW0C 2B2TC 3PUZA 1TWFB 4PV1C 5C3XA 3I4NB 2EYJA 2NN6H 2B2WC 2F0QA 4FNFA 2WB1B 3PMFA 2ICEC 3SE0A 5I6YA 1SYCA 1TWCB 2JP1A 1B1ZA 1Z6HA 2JA7B 4K14A 4ZLTF 4ZRZA 3C1EA 2K33A 1L0XB 1V8QA 4C3HB 2OT2A 1LO5D 1AZPA 3DHQA 3HP3A 5JVG3 1HQRD 2QF7A 4ZYSA 1EY9A 1KAAA 5KNDA 2IJ0A 1SNDA 4ME5A 4PQXA 3QO2A 3NWTA 5DNFA 4IUQA 2B2TA 2R92B 1HFNA 4X3KA 2K5QA 5KRUA 4KN4C 3ONAB 1IKLA 5HURA 5M5WB 2EOTA 1AP0A 1PDQA 3KLSA 4AYBB 4MHEA 1CA5A 4K5VA 4U673 2HCCA 2RDHA 5C4XB 5FO8B 2A69C 4X3TA 1LTTD 4E6IA 1STYA 2K05A 5LHY1 1X3PA 3QB3A 3QOJA 2F0DA 3PV0A 3MVVA 3PUWA 1JC7A 3GQBA 1KDCA 3HEJA 1YNNC 4KJNA 1SNQA 4G7HC 4A3GB 4KV6A 1STHA 3GTKB 3A56A 3T56B 4X3UA 4WFN3 3BDOA 5I4DA 4MIUA 4H44C 1UAPA 3BG3A 3EVQA 5JVH3 1B9NA 2KA7A 1EOTA 3VYSA 2EYFA 2JE6I 1I4XA 3WOFA 1RCVD 3GV6A 3OPOA 3NBIA 4N9PA 2KJXA 1LT3D 3MXUA 3R2TA 1PFBA 3AU7A 5CBEE 4KY6A 5FLXL 2G9HD 2EY2A 1FR3A 2EVBA 3PO2B 4C3HG 1F9SA 5F2DA 3CQZB 1ET9A 1Y1VB 4LJZC 4B9XA 3A7LA 1U4RA 3TP6A 2NWGA 5BN4A 1SFOB 1PFNA 4A93B 3L3OC 4CBVA 5IOCA 2DY8A 1WTOA 4EQNA 1PTOD 1CZWA 4Q5VA 1I4GA 1XYIA 2KVMA 1EWCA 4G4KA 3GTQB 1GXDC 1QNKA 4C3JB 1CHPD 1D6EC 1HPCA 4G7ZC 1B50A 4IUNA 2M2LA 2Q8RE 2G9DA 2E2JB 2IX3A 2IPKD 3VR5A 2K04A 4RFBA 1LT5D 2H1EA 2XN9C 2B2UC 1KDAA 2DNCA 1KNEA 1CTMA 1OXUA 4IUTA 1V43A 3AMUA 3L9AX 2PQEA 4BA1I 1ESFA 2BDOA 2EDGA 2JA8B 1EEID 3IFDA 3AB9A 5EPJA 5ELBA 1U4MA 2E2DC 2KOLA 3T53B 1I4RA 4O1NA 3NXWA 2D9UA 1MSHA 2AUJD 5E3FA 3G6JB 2XSCA 1MI2A 3HZXA 4TRDA 2JSOA 2Z4HA 1M8AA 1I4QA 1H9MA 3IFTA 4G57A 1Y69U 3Q0AA 3I91A 2XWJB 4K8IA 3HOWB 3KBGA 4FXGC 1R4PB 1EFID 2IT1A 3S16B 4UDUC 5CV9A 2QEJC 4OGQC 1ILQA 4J1MA 1RODA 4KKSA 2QDBA 2RSOA 1Y8NB 1IL8A 3MTSA 2FFKB 4LK1C 4KY7A 3BDCA 3X3MA 2K6AA 1JCKB 3J7YW 1H9SB 3K5OA 1CI3M 3M7GA 3D6CA 3HOVB 3VYTA 2DY7A 5KNBA 5IGCA 1EZ6A 5C0XI 5JAVA 3Q6SA 4PNYA 1FNVA 1JOOA 2O5JC 4M8AA 5IIFA 4FO2A 1T5XD 2TMPA 1FD7D 4TSSA 2JA6B 2F0PA 3D8GA 2A68D 2J0TD 4ZKCB 2DNEA 5ELDA 3IL8A 3H0GB 5G3LF 2QKIC 5CYUA 5D3IB 2C5CA 2E75C 4XYOA 5C4JB 1TY2A 3R3OA 2D2CC 1F9RA 3NHHA 2WKDA 3BYTB 2F0JA 1T5EA 3MFGA 1EU4A 3S2DB 2NN6I 5EPKA 1FYCA 1GUOA 4QIWB 2ZT9C 1G291 2RVLA 2RA4A 3SK8A 4A3IB 4C3IB 4KHVA 2B2YA 1Y8PB 1BDOA 5IT9E 1DXMA 1F9PA 5LL6X 1AZQA 2AQ3B 4IFDJ 1S5DD 2A6ED 2CW0D 3GD7A 1AEXA 1D5MC 1YNJC 3A7AB 1TKWB 4RKLA 1F2MA 1Q90A 2R93B 3Q22A 3MWYW 1SE2A 1X3QA 4DGZA 1BF4A 3S14B 4OL7A 5KNCA 2EXZA 2IW3A 3RMHA 2F0MA 3SEBA 1GUTA 1DYQA 1IW7C 1SE4A 3Q23A 2FHTA 3T51B 1AN8A 4XQNA 1E2WA 5KGUA 3J7AF 1QG7A 2Q8TA 5T1IA 3PIP3 1JWUD 3FPPA 1ESRA 5IGFA 5AFWA 3NE5B 4HEDA 3S2HB 3M7NA 3DMUA 5E1FA 3OMCA 4KKTA 2BOSA 4XIGS 3QG1A 4M1UB 4H13C 4QB4A 4ZQ3A 2V4DA 1S5BD 1RJTA 1JE4A 4F7XA 1I3QB 2EE1A 2A69D 1I6VC 5G3LD 3OOCA 4JBWA 3SXHA 1BXTA 2SOBA 2J4XA 3FDTA 3MHBA 2NVQB 1SYFA 1CA6A 4IUVA 1QB5D 4HMIA 3C1FA 2E76C 2FMCA 3F2UA 1SDFA 4ZUJA 4CKCA 2L55A 4C3IG 4ZKBB 1BOSA 4EQOA 5C5LA 2OF1A 5JOBA 3G7LA 1F9QA 2EYPA 1F77A 2BCOA 4OIKA 1GUNA 3VYUA 2Z8LA 3S1MB 2XWBB 1A2TA 4ILWA 3A54A 3RUZA 2LFNA 3S1NB 4F87A 2X6LA 3LNNA 1EYAA 4I65A 3TZUA 2BE5C 5M9OA 2PW5A 1AW7A 4Y7NB 3LWEA 1LT4D 5FKAC 3TMEA 3O13A 2R7ZB 2L1BA 3X3NA 5FO9B 1EYCA 4K6DA 2PYKA 1DJRD 3A8JE 4CKEA 1NR2A 1LTSD 2F0VA 2EZVA 5IGEA 3KF8A 4HN7A 3GTLB 5C3EB 1BO0A 4HMJA 2YU9B 1TIID 2VXWA 5CMDA 3ND8A 3FPUB 1SBBB 4RGNA 1HA5A 3D4WA 4IFDG 2EPBA 1EZ8A 1BCPC 5FOBB 1PTOF 1A3TA 3I90A 3FRPB 1QOHA 5LL6S 1MBYA 4G7OC 4KHZA 1HRJA 1OXTA 3KK7A 2L5TA 1DM0B 5M5XB 4C2MB 1EY0A 1W6KA 1PTOH 2B2WA 1DCZA 1WTPA 2F0TA 5C5MA 5A2QL 4K5WA 3D4RA 2CHBD 4IN3A 3C2PA 5CORA 4NW2A 4WORA 2A74C 2WIIB 1HCZA 2N88A 4FXDA 5C0XJ 1CQFA 1LTBD 2IWHA 1RDPD 4IUUA 5J1ZA 2RDGA 3V05A 3EJIA 3BDLA 3TP7A 2PZWA 4K8JA 2O4XA 5TSSA 5D65A 2F0OA 1STNA 3LX0A 2NZ1D 1TVXA 3M3YB 1EY8A 4RGTA 1WTRA 1OO9B 4XQQA 4J6HA 4PMWA 2EY1A 3FMCA 4UAIA 4HCEA 4BBRB 4BWGB 2BA1A 5EKIA 1OXVA 1SYDA 3U9SA 1SJED 4DFAA 2OEOA 3MA2B 5E4XA 2ZXPA 2RQXA 2L9HA 5K36H 4XXEA 2F0GA 1AFPA 3H94A 3H6MA 1ENAA 1JICA 4RHSA 4KD3A 3BZDB 1DOMA 1G8ZD 2A6HC 3K7AB 2XIWA 1GJXA 3S17B 1JB3A 1V1OA 2L4NA 1CK1A 1S4ZA 1SAPA 1ZEQX 5EKLA 3MAQA 1KDBA 2F0NA 1SE3A 1EL0A 1QWYA 1FGBD 3PUYA 3LWUA 5FLXE 4X3SA 3J81E 5CV5A 5KEEA 3Q24A 2EJGC 1ENFA 1TS3A 2HQEA 2WINB 4NMZA 1SNMA 2XNAC 5I9PA 4R9WA 4XQJA 1GOZA 4KK7A 3D3RA 4NKLA 3S1RB 1MD2D 2HDLA 2LKVA 2RSNA 4PMCA 2HCIA 2CVRA 1PYWD 3MXNA 1SNPA 1XWEA 4TQUS 4U68A 1LACA 2SNMA 3M4OB 1GUSA 3S1QB 2EYOA 5JEAJ 1ZYRC 1A2UA 1KABA 2LMCB 3DEOA 1PTOB 4L8JA 2KEDA 4ABNA 1WTQA 3TN2A 5C4HA 3VA5A 3D4DA 2KCCA 1EU3A 1SMYC 2B2UA 1YNJD 1D2BA 2B2VC 4B9WA 5IGGA 4IUPA 4KMUC 5EJWA 3DWPA 1EY5A 4J8QA 1PRTF 4C1NK 3GO5A 1A3UA 4DK0A 2ENBA 1EY6A 4IFDH 5T1GA 3JAML 1TT2A 1OXXK 3L7ZC 2R3ZA 5EBCA 1HHVA 2F3WA 4Z9CB 3N6RA 4ZK9B 2KECA 1SSOA 3H09A 2B8FA 1WTXA 2PZUA 3GTGB 3GTPB 4NP5A 3I8ZA 1G2TA 1TR5A 2KUMA 1A3VA 5JJZA 1BCPF 5C6AA 5CC4A 2RDFA 1VF5C 1TS5A 2AQ2B 4RGOS 4BA2I 2Q8IB 1FNWA 1C48A 2MGSA 4KJOA 3KLRA 1GHKA 1I6HB 4RWSC 4FVMA 4RH6A 2O2LD 3DM1A 1V1PA 3E6ZX 1STGA 1RKNA 2EJFC 1K8MA 3E5SA 4RA8A 2PO4A 1SYBA 3ITPA 3MXPA 5CV7A 2PMZB 1U4LA 3W3AA 4FF4A 3HOZB 3OWFA 1GHJA 4ID6A 3SVMA 5JPNC 3HG9A 4KD4A 1LTGD 3R93A 4FP5D 1Y8OB 4DF7A 3CRLC 5E4WC 1JR0D 2X69A 4B08A 2C9OA 4EQPA 1EEFD 1HTLD 1OXSC 5I2YA 3T4AC 1CT1D 1DD2A 1JORA 1SJHD 2B39A 1PRTD 4RCOA 1R9TB 1JWSD 2R61A 4PMBA 1S5ED 1KNAA 4DXFA 2K01A 2BDNA 1WVLA 2GA4B 2K5WA 1KLGD 3ND9A 2Y0SB 5JEAG 1Q12A 4ULLA 3VR6A 5ELEA 2K32A 3C46A 3DXJC 1S5FD 1C8CA 1RHPA 4FF2A 2O5IC 1WCMB 3OHXC 1BCPD 5J39A 5FK9C 1DONA 4QCLA 3J80L 3DWAA 2F3VA 1Y1WB 1TWHB 1H9RA 2I07B 2TSSA 4CHTB 1VDZA 1NAPA 3P7JA 1O7YA 1BBXC 4OO1G 1WD0A 2VB2X 3E0JA 1JOQA 1PRTB 3NTIA 5C3WA 2JEAI 3S15B 1D5XC 2IX0A 4A3FB 5DM73 1EY4A 1U4PA 1CHQD 4DU9A 3WOEA 3P75A 3W2DA 3PIO3 1Q3LA 1HA6A 1PFMA 3VYRA 1F2LA 2EYHA 1Z7TA 3NPPA 1YNND 4EVOA 5IGDA 4IQZA 2NVXB 1K8OA 3HRZC 2L11A 4HSVA 2K1BA 1DOLA 4WRDA 1LABA 2XVSA 1J9OA 5A35A 3VR3A 3V96A 2NVTB 1SYGA 1B4OA 1H9KA 1S5CD 1BCPB 1II3A 2ID0A 1PMRA 4DXGA 5I2XA 5IODA 3FKIB 1XTCD 4A3BB 4XT1B 3RD4A 2E2IB 3K5NA 3K59A 4ZUIA 1GUGA 1VMCA 2FMMA 3NBHA 3RZDB 1SXTA 1U9RA 5EQ0A 3M85A 4K6LA 1EY7A 3ZYYX 1VMPA 5CGKA 4CKBA 1LT6D 2A6HD 3MFYA 3GTMB 2AWOA 4S3SA 1SNCA 5CR3A 1DZ1A 2AQ1B 2JXMB 4A3MB 3K58A 1B2TA 1X32A 3CKIB 1O80A 2A5HA 2WKCA 4DNRB 1WTWA 2OXPA 3TSSA 3S9WA 1ML0D 3I73A 4BS9A 1G2SA 4K2KA 2D5DA 4DAYA 2EY6A 1Q8IA 2H4OA 1JQYD 2PNRC 2NB0A 3NTKA 1I50B 3QWNA 3MC0B 1M4VA 1W6JA 1STBA 3SK5A 4LAAA 1WTVA 3BVMA 3OW7A 2MP1A 4DNTB 2ZXOA 1STAA 2AWNA 4LMQD 4N9TA 3GP7A 2QILA 1VCIA 3I72A 3HOYB 1G91A 2NTSA 2HDMA 3KUPA 3K5LA 1ZYRD 4I7ZC 1PZKD 3QIAA 2F0SA 3J7AV 4IFDI 2B8GA 1XX8A 1EIGA 1SMYD 1SYEA 1EQTA 5JEAH 4CJ2C 3OMGA 5A2QE 2N55A 4GZYC 1J8IA 1EQVA 1E2ZA 3OIPA 4NDXA 1CM9A 1PLFA 1ZXTA 2SDFA 1F2ZA 2WP8J 3D31A 4F8MA 2F0LA 3I4MB 2RKSA 3QJYA 4V190 2K03A 1A15A 1TWGB 3HOUB 3V2TA 2KHSA 2MJ8A 3NTHA 1B9MA 5EBDA 2F03A 3EROA 4A3KB 4OHJA 2VB3X 2F0KA 3EQLC 4CJ1B 3DUZA 1IKMA 2RBMA 1FNUA 3MZ5A 3IKJA 3RLFA 4QUCA 1HUMA 4MN3A 4OO1H 3CU7A 1B44D 1SEBD 5KYLA 1F2YA 3J81L 3FEWX 3C3LA 5HGTA 1IYVA 1IYUA 4FYDA 5CV8A 1MSGA 4DN4M 3D6WA 3A55A 3NP8A 1HQMC 3VR4A 3URYA 2WV6D 4RAUC 2F0UA 3KBXA 3KLSX 5CBAE 4RGMA 3GTOB 1E0BA 2F0FA 2LS01 3SHLA 3EFXD 2VNUD 4ZAIA 1ENCA 3WDNA 4A3JB 1ET6A 3I4LA 3R2IA 4A3EB 2XRQD 1H9JA 1ILPA 1PXUA 1V1PB 2NUCA 2I46A 4DA2A 5CV6A 5C44B 4BY1B 2K5DA 2NVYB 4CGYB 2MHVA 4HR7B 1G6ZA 3TP8A 1SNOA 5IGBA 1UUPA 4CJ0B 4JK1C 4P2CB 4WJWA 3RZOB 5M3FB 3PO3B 2F0HA 2JEBI 2SEBD 1CFMA 1RTOA 4RHRA 5ELCA 3SDZA 1HFGA 2PPBC 1R4QB 1KLUD 2EY5A 1QJOA 4DAVA 2PW7A 1ZKOA 1IHZA 4OIJA 1QE6A 1Q1EA 1RTNA 2F0EA 5C0XG 3PUXA 1RD9D 1LV9A 2LY7A 3CHBD 3QOLA 1IW7D 4HSPA 5JPMC 3I70A 1BQQT 3NUCA 2L0CA 4H7BA 1XXGA 4ODGA 2E74C 2XRSD 1NSNS 4YIJA 4BBSB 4QUFA 3OSOA 3TDQA 3MEHA 4RKBA 4EGVA 5NUCA 1RF2D 5I9OA 5KYIA 4R8NA 5ELFA 2KEEA 1TY0A 2B63B 3SR1A 3VR2A 5BN5A 3BVGA 1LTRD 3K5MA 3ERQA 4K5XA 2J7ZA 3N52A 1BUVT 2B2VA 2K7VA 5DEHA 4C3JG 3NSWA 2CQAA 3R8BA 1C4QA 1D1KA 1I4PA 2EYMA 1PZID 4XTCS 2KQ3A 1VF7A 2NN6G 3JAME 1D5ZC 4KI0A 1PTOC 4O42A 1WD1A 2JYOA 3DEPA 3I3CA 2ZXRA 4RCNA 2WAQB 1TS2A 4C1NI 2B2YC 1HTPA 3HS0C 1UNSA 2K28A 2IL8A 1HUNA 1EYDA 2PCFB 5IT9L 3NK9A 3EA6A 2MPMA 4A3DB 2FJ2A 5DM63 4L63B 4FXKC 1BNZA 1QCBD 3A8KE 1ONLA 1NCVA 2BA0A 3IAYA 1NUCA 2VUMB 3HGBA 1L0YB 2M00A 2BE5D 1QILA 1I4HA 4H0LC 2A73B 1CZGA 1TS4A 2R6GA 2KCNA 3K6OA 4HTHA 1ICWA 3HKZB 3UI2A 5K5PA 4IALA 2F1MA 1LTAD 5D3DA 4R8IA 3DWQA 3NQIA 4K2LA 1TU2B 3NQTA 1HXYD 1O78A 4FF3A 1STEA 2FINB 4QMGA 4DAPA 5ISRA 1JWMD 5D14A 3H91A 4HAEA 3SK4A 4KTAA 5COYA 3T16A 3A8IE 2EYLA 2NYZD 3P1HA 1H9SA 4BY7B 2WACA 1UEAB 3GTJB 5J22A 5CV4A 2MUYA 2EJMA 4XDXA 2DN8A 2QCPX 3HOXB 5C4ZA 4KN7C 2Z1CA 3P20A 1GUWA 1MGSA 1Q1BA 3OWEB 5BN3A 5K36G 1K83B 1BR9A 4V0BA 1CQVA 2NTTA 3T13A 4XT3B 3BVZA 1EIHA 2AUKA 2E2HB 3OIQA 5FO7B 1O7ZA 2D62A 2F0IA 3J80E 2ICIA 2SNSA 5M3MB 1EWHA 3CRKC 1B3AA 1E2VA 2F0WA 3H3VC 2PZTA 1NR4A 2NBFA 5EGTA 4C56C 1QNUA 3SK6A 2L12A 1LTID 2A68C 3TP5A 5EPLA 2Z4IA 3BS1A 1PZJD 4DK1A 4FF1A 1D1IA 3MXGA 2JA5B 5I6WA 5DAUA 1Z47A 1JOKA 4L6TB 5C0XH 1A6XA 4IZ8A 3U9OA 3K57A 1B53A 4HCSA 4KKUA 3K0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KAB A;  4DFA A;  5KYL A;  1SYB A;  2EYM A;  3ITP A;  1EY7 A;  3MXP A;  4QMG A;  5CV7 A;  1EZ8 A;  5ISR A;  5CGK A;  2OEO A;  4K5V A;  3OMG A;  3SK4 A;  1TQO A;  2KQ3 A;  4KTA A;  3SXH A;  1A3T A;  2SOB A;  5C4H A;  1EQV A;  3MHB A;  3VA5 A;  3D4D A;  2NUC A;  3SK8 A;  4E6I A;  2F0G A;  5KIX A;  4KHV A;  4QF4 A;  3H6M A;  5CV6 A;  1ENA A;  4S3S A;  4KY5 A;  1SNC A;  4IUN A;  4NDX A;  3OWF A;  4ID6 A;  4KD3 A;  4B9W A;  5CR3 A;  1STY A;  5IGG A;  1SYF A;  4KD4 A;  5CV9 A;  5E3F A;  3T16 A;  4HMI A;  1F2Z A;  3C1F A;  4F8M A;  1EY5 A;  4J1M A;  1JOQ A;  3QB3 A;  4DF7 A;  5JAV A;  2F0L A;  2EYL A;  3TP8 A;  4ZUJ A;  1SNO A;  3QOJ A;  5IGB A;  2QDB A;  2F0D A;  1EY0 A;  5C3W A;  3P1H A;  1AEX A;  1A3U A;  3MVV A;  2RKS A;  4EQP A;  4EQO A;  5C5L A;  2OF1 A;  2OXP A;  5JOB A;  2WAC A;  4RKL A;  3S9W A;  1KDC A;  2ENB A;  5EKK A;  1EY4 A;  1F2M A;  5J22 A;  2EYP A;  1KDA A;  3HEJ A;  5CV4 A;  4KY7 A;  2F0T A;  4DU9 A;  1EY6 A;  2F0H A;  5C5M A;  3BDC A;  3V2T A;  1JOR A;  4KJN A;  4K5W A;  1SNQ A;  3P75 A;  4K2K A;  2KHS A;  5EKL A;  5C4Z A;  2EY6 A;  4KV6 A;  1KDB A;  4DGZ A;  1TT2 A;  2F0N A;  1STH A;  5C3X A;  1EYD A;  3D6C A;  2EYJ A;  3ERO A;  4OL7 A;  1A2T A;  2EYH A;  2EY5 A;  2EXZ A;  2PQE A;  2F0K A;  4WOR A;  2F0M A;  2F0Q A;  3RUZ A;  2F3W A;  2PW7 A;  4PMB A;  3NK9 A;  2RBM A;  4EVO A;  3MZ5 A;  5IGD A;  5IGC A;  1EZ6 A;  1STB A;  1IHZ A;  3SK5 A;  3PMF A;  4LAA A;  4MIU A;  5CV5 A;  1EYA A;  4I65 A;  3T13 A;  4K8I A;  4PNY A;  2F0E A;  1F2Y A;  5I6Y A;  5KEE A;  1JOO A;  2PZU A;  3EVQ A;  2HQE A;  4WRD A;  4NMZ A;  5HGT A;  1SNM A;  5M9O A;  2PW5 A;  5IIF A;  1SYC A;  5I9P A;  5J1Z A;  5KGU A;  4NP5 A;  3QOL A;  3TME A;  5CV8 A;  1TR5 A;  2EYF A;  3NUC A;  4K14 A;  1SYG A;  2F0I A;  3EJI A;  2F0P A;  3BDL A;  1STA A;  4H7B A;  1A3V A;  3C1E A;  3NXW A;  4N9T A;  3TP7 A;  2SNS A;  2PZW A;  4K8J A;  1NUC A;  2O4X A;  1II3 A;  3D8G A;  4NKL A;  5IGF A;  4ODG A;  1EYC A;  5C6A A;  2M00 A;  5CC4 A;  4K6D A;  4N9P A;  2F0O A;  2F0W A;  1NSN S;  1STN A;  2PYK A;  2RDF A;  3LX0 A;  3NP8 A;  4YIJ A;  3DHQ A;  2PZT A;  3DMU A;  3OSO A;  5EGT A;  1EY9 A;  1KAA A;  2LKV A;  1EY8 A;  5E1F A;  3OMC A;  2F0V A;  3MEH A;  4RKB A;  2F0U A;  4PMC A;  3HZX A;  4KY6 A;  4TRD A;  5NUC A;  3SK6 A;  5IGE A;  2EY2 A;  5IOD A;  1SNP A;  4ME5 A;  1SND A;  3TP5 A;  5I9O A;  4KJO A;  5KYI A;  4HTH A;  4R8N A;  5F2D A;  4J6H A;  4B9X A;  2SNM A;  4QB4 A;  2F0S A;  2EY1 A;  3R3O A;  5K5P A;  3TP6 A;  2F0F A;  4G57 A;  4ZQ3 A;  3SR1 A;  3NHH A;  4IAL A;  5DAU A;  2EYO A;  4HMJ A;  3SHL A;  5I6W A;  1JOK A;  2F0J A;  3ERQ A;  5J39 A;  4ZUI A;  4K5X A;  5IOC A;  1ENC A;  4K2L A;  4F7X A;  5KRU A;  2F3V A;  3NQT A;  5DEH A;  1STG A;  4IZ8 A;  1RKN A;  3U9O A;  5HUR A;  4EQN A;  3E5S A;  1SYD A;  1U9R A;  3D4W A;  1A2U A;  1SYE A; 
#chains in the Genus database with same CATH topology
 1KTK A;  2CKZ B;  2HUG A;  4CDE C;  3AFQ A;  3PUV A;  5IP9 H;  2M9V A;  4TKO B;  3GV3 A;  3TZD A;  5M5Y B;  1O7L A;  1TWA B;  2YYZ A;  3CQZ H;  3TBI B;  1TQO A;  2A1A A;  1M1K C;  4OO1 I;  3BYY B;  2X6G A;  1DOK A;  4F88 A;  4IUR A;  5KIX A;  4QF4 A;  3NWS A;  4KY5 A;  2UXC L;  1E24 A;  4TVA B;  4XYQ A;  2R93 G;  2IX1 A;  1QVC A;  3RN2 A;  3VA7 A;  4NB3 A;  3GTQ H;  1PRT C;  4Q0F A;  5EKK A;  4C3J H;  4X65 L;  3FVQ A;  2F4I A;  1LLR D;  3M4Y A;  1D8L A;  4J15 A;  2Z0S A;  4B3T Q;  2A6E C;  2CW0 C;  4DV7 Q;  1PA6 A;  2B2T C;  1MJC A;  3PUZ A;  1TWF B;  4PV1 C;  4HJ5 A;  4X6A H;  5C3X A;  3I4N B;  2EYJ A;  4A3J H;  3PF4 A;  2NN6 H;  3I56 A;  4LF4 Q;  2B2W C;  2F0Q A;  4FNF A;  1VQ5 A;  1PH6 A;  5JJI A;  2WB1 B;  2VZA A;  1N36 Q;  1N33 Q;  3PMF A;  3OTO L;  2ICE C;  3SE0 A;  5I6Y A;  5IP7 G;  4L5S A;  1HNZ Q;  4JI0 L;  2D0O A;  1SYC A;  1B3Q A;  2BH8 A;  3UE1 A;  1TWC B;  2JP1 A;  1B1Z A;  1Z6H A;  3AQQ A;  4JBK A;  4BY1 H;  2JA7 B;  2AHO B;  4NXM L;  2ZTE A;  4K14 A;  4ZLT F;  4ZRZ A;  3DLL A;  3I4O A;  3C1E A;  2K33 A;  1L0X B;  1KAW A;  4HIM A;  1V8Q A;  2E5L L;  4C3H B;  1B7Y B;  2OT2 A;  1LO5 D;  5GAH C;  1IXR A;  1AZP A;  3DHQ A;  3HP3 A;  5JVG 3;  1HQR D;  2QF7 A;  4ZYS A;  1L0W A;  1EY9 A;  3KDF A;  1KAA A;  3PO3 H;  5KND A;  2MNA A;  2IJ0 A;  1SND A;  4ME5 A;  3G71 A;  4PQX A;  3QO2 A;  2PMZ E;  3NWT A;  2EQS A;  4DR6 Q;  3D0F A;  5DNF A;  4IUQ A;  2B2T A;  4JBM A;  2R92 B;  1HFN A;  3QR8 A;  4X3K A;  2K5Q A;  5AJ3 L;  5KRU A;  4KN4 C;  1EWI A;  3ONA B;  1IKL A;  3TRE A;  5HUR A;  5M5W B;  2EOT A;  1AP0 A;  4JI7 Q;  1PDQ A;  3KLS A;  4AYB B;  1KRS A;  4MHE A;  1CA5 A;  4K5V A;  4U67 3;  2HCC A;  2RDH A;  1X56 A;  5C4X B;  5FO8 B;  2A69 C;  4X3T A;  1LTT D;  4E6I A;  4JI1 L;  3PF5 A;  2DJG C;  3PCO B;  1YIJ A;  1STY A;  2K05 A;  3MXN B;  5LHY 1;  1X3P A;  3HOW H;  3QB3 A;  4MNO A;  3QOJ A;  2F0D A;  3PV0 A;  2HIV A;  3MVV A;  3PUW A;  1JC7 A;  3GQB A;  1KDC A;  3HEJ A;  1YNN C;  4A3C G;  4KJN A;  1SNQ A;  4G7H C;  4A3G B;  4KV6 A;  1STH A;  5ELO A;  3GTK B;  3J81 j;  3A56 A;  1S40 A;  2QDL A;  3TRZ A;  2Y0S E;  2OTL A;  3T56 B;  4X3U A;  1DGS A;  4WFN 3;  3BDO A;  3W1G A;  2R7Z G;  5I4D A;  1QZH A;  3PIO A;  4MIU A;  1PH5 A;  4CDF C;  3L0O A;  4H44 C;  1UAP A;  3BG3 A;  4DNI A;  1PVO A;  3EVQ A;  5JVH 3;  1B9N A;  1VQF A;  4R1J A;  2KA7 A;  1EOT A;  3CMA A;  4UP8 A;  3VYS A;  3HOV H;  2EYF A;  2JE6 I;  1I4X A;  3U4Z A;  3WOF A;  1RCV D;  1J5E L;  3GV6 A;  3OPO A;  4PZ6 A;  3A5U A;  3NBI A;  4N9P A;  2KJX A;  5C3E G;  4DK6 C;  1LT3 D;  3MXU A;  1HR0 L;  2JA7 G;  3R2T A;  1PFB A;  2JN4 A;  3AU7 A;  1CKN A;  4KY6 A;  5CBE E;  5FLX L;  4IPG A;  3E0E A;  2G9H D;  2EY2 A;  2VS1 A;  1FR3 A;  2EVB A;  3TEH B;  3PO2 B;  4C3H G;  1K3R A;  3JC6 6;  1F9S A;  2PQA A;  5F2D A;  3CQZ B;  1ET9 A;  1Y1V B;  4LJZ C;  4B9X A;  2JA6 H;  3A7L A;  1U4R A;  3Q8D A;  2QEX A;  3TP6 A;  2NWG A;  5BN4 A;  1SFO B;  1PFN A;  4YWL A;  4A93 B;  3L3O C;  4DV1 Q;  4CBV A;  5IOC A;  4LF9 Q;  2DY8 A;  2GN5 A;  1PH8 A;  3KLW A;  1WTO A;  1GKH A;  4EQN A;  2QA4 A;  3H0G H;  1PTO D;  1CZW A;  4RG1 A;  1I4G A;  4Q5V A;  1XYI A;  1PFS A;  5GAE C;  2KVM A;  4H02 A;  2R92 G;  1EWC A;  2DGY A;  4G4K A;  3GTQ B;  1GXD C;  1QNK A;  4C3J B;  4WJ3 M;  1CHP D;  1D6E C;  1HPC A;  4G7Z C;  3CF5 A;  1B50 A;  4LUV A;  1U0L A;  4IUN A;  2M2L A;  5BR8 Q;  4AYB G;  2IHE A;  2Q8R E;  2G9D A;  1VQ8 A;  2E2J B;  2IX3 A;  1MHW C;  2F3I A;  2IPK D;  3VR5 A;  1D7Q A;  3VDY A;  4A3L H;  3S2D H;  2K04 A;  4RFB A;  1LT5 D;  4JYA L;  2H1E A;  2UXC Q;  2XN9 C;  1IBM L;  3UDF A;  2B2U C;  5IYD G;  4A3I H;  1KDA A;  2DNC A;  1X9N A;  1KNE A;  1SR3 A;  1CTM A;  2VL6 A;  1OXU A;  1VQE A;  4IUT A;  1V43 A;  3AMU A;  1V9P A;  3L9A X;  2PQE A;  4BA1 I;  1ESF A;  1NY4 A;  2Z6K A;  4LUZ A;  5HY6 A;  2BDO A;  2EDG A;  3RR5 A;  2JA8 B;  1EEI D;  3IFD A;  2V1C C;  1EUJ A;  3AB9 A;  5EPJ A;  5ELB A;  1U4M A;  5HGQ A;  3OTO Q;  2E2D C;  2KOL A;  3T53 B;  1I4R A;  2JJQ A;  4O1N A;  3NXW A;  4DR1 Q;  2D9U A;  1MSH A;  2AUJ D;  3K0X A;  5E3F A;  1XNR L;  4LFB Q;  1UE7 A;  3G6J B;  4JI8 L;  2LXJ A;  2XSC A;  1MI2 A;  3HZX A;  4TRD A;  1PV4 A;  2E5L Q;  2JSO A;  4OX9 L;  2Z4H A;  4GNX B;  2Q2H A;  1M8A A;  1I4Q A;  2A8V A;  2UXD Q;  1H9M A;  4DUY L;  3IFT A;  4G57 A;  4I7A A;  5IP7 H;  1Y69 U;  4UHV A;  3Q0A A;  1K28 A;  2F4V Q;  5GAG C;  3I91 A;  1BVS A;  3PO2 G;  1X55 A;  1Y1V G;  2XWJ B;  4K8I A;  4DV2 Q;  3HOW B;  4JCV E;  3KBG A;  2IHF A;  4FXG C;  1QVF A;  3BJU A;  3WWV A;  1R4P B;  1EFI D;  1YZ6 A;  2IT1 A;  5IYB G;  1I3Q H;  5M3M H;  3S16 B;  4UDU C;  5CV9 A;  2QEJ C;  3A5Z B;  1ILQ A;  4OGQ C;  4J1M A;  2K14 A;  1ROD A;  4KKS A;  2QDB A;  2RSO A;  1Y8N B;  1IL8 A;  5GQO A;  4QY7 A;  1SRO A;  3MTS A;  1VQA A;  2FFK B;  2NVQ H;  4K0K Q;  4LK1 C;  4KY7 A;  2CFM A;  3BDC A;  4DR5 Q;  3X3M A;  2K6A A;  2R7F A;  1VQI A;  1JCK B;  3J7Y W;  1H9S B;  3K5O A;  1CI3 M;  1J6Q A;  3M7G A;  3SGI A;  3D6C A;  3HOV B;  3VYT A;  2DY7 A;  5KNB A;  1KIX A;  5IGC A;  1EZ6 A;  1Q8K A;  5C0X I;  4B3T L;  5M5Y H;  5JAV A;  1TWA H;  3Q6S A;  4PNY A;  4UP7 A;  1FNV A;  2NZH A;  1JOO A;  2O5J C;  4M8A A;  2E8G A;  5IIF A;  4FO2 A;  4LF4 L;  3L2P A;  1T5X D;  3S1M H;  2TMP A;  1YJN A;  1FD7 D;  4TSS A;  1N33 L;  2JA6 B;  2JA8 G;  2F0P A;  1WJJ A;  1RIP A;  3D8G A;  2A68 D;  3STB C;  4B3S Q;  3S1N H;  2J0T D;  4A3C H;  1HNZ L;  4ZKC B;  2DNE A;  4LW1 A;  5ELD A;  3IL8 A;  3H0G B;  1J5E Q;  5G3L F;  1SE8 A;  2QKI C;  5CYU A;  5D3I B;  4Y7N H;  1UE1 A;  2C5C A;  2E75 C;  1YNX A;  4XYO A;  5C4J B;  1TY2 A;  2R7Z H;  1TWF H;  2MO1 A;  3R3O A;  1FGU A;  5H1S E;  2D2C C;  2CH4 W;  1F9R A;  2PNH A;  3NHH A;  1TXY A;  2WKD A;  3BYT B;  2F0J A;  3DM3 A;  1VQ7 A;  1T5E A;  2HT1 A;  3MFG A;  1G51 A;  1EU4 A;  5ELN A;  3S2D B;  2NN6 I;  4DR6 L;  5EPK A;  1FYC A;  3UDX A;  1GUO A;  4QIW B;  1YI2 A;  3GTL H;  4X64 Q;  2ZT9 C;  4IO9 A;  1G29 1;  4YCV A;  5C3E H;  2JA7 H;  2HHH Q;  2RVL A;  2RA4 A;  3SK8 A;  3T1Y Q;  4C3I B;  4A3I B;  4KHV A;  2B2Y A;  1JJ2 A;  1Y8P B;  1BDO A;  3CME A;  5IT9 E;  1DXM A;  4JI7 L;  1F9P A;  4R4I A;  4C3H H;  2ZM6 Q;  5LL6 X;  1AZQ A;  3CPW A;  2AQ3 B;  4IFD J;  1S5D D;  4JI6 Q;  5DLQ E;  1WOC A;  2A6E D;  2CW0 D;  4P75 A;  2LSS A;  3GD7 A;  1AEX A;  1D5M C;  1YNJ C;  3A7A B;  1TKW B;  4RKL A;  4DUZ Q;  1F2M A;  1Q90 A;  2R93 B;  3Q22 A;  3MWY W;  1SE2 A;  1L1O C;  4RMF A;  4N8X 1;  3E9H A;  4GOP B;  1X3Q A;  3CXC A;  4DGZ A;  2R92 H;  1BF4 A;  1VQN A;  3CCV A;  3S14 B;  4KHP Q;  4OL7 A;  5KNC A;  2UUB Q;  2EXZ A;  2IW3 A;  3RMH A;  2F0M A;  3SEB A;  1GUT A;  2AKW B;  5M5W H;  4GN3 B;  1DYQ A;  1IW7 C;  1SE4 A;  3Q23 A;  4QGU A;  2FHT A;  3T51 B;  1AN8 A;  1P8L A;  1CSP A;  5J3B A;  4XQN A;  1E2W A;  3W5O A;  4JI2 Q;  5KGU A;  1XTD A;  3J7A F;  1PYS B;  1QG7 A;  2Q8T A;  4LFC Q;  5T1I A;  3F1Z A;  4JVZ A;  3PIP 3;  5IYD H;  1JWU D;  3FPP A;  3F2D A;  1EOV A;  1ESR A;  2UUA Q;  3CCE A;  5IGF A;  3BU2 A;  5AFW A;  3KOJ A;  3NE5 B;  3K7U C;  4HED A;  3S2H B;  4JI4 Q;  3M7N A;  3DMU A;  1HNW Q;  3KJO A;  5E1F A;  3OMC A;  4KKT A;  4LF8 Q;  2BOS A;  4X66 Q;  4XIG S;  3QG1 A;  4M1U B;  4H13 C;  4QB4 A;  5FLM G;  3KDF B;  4ZQ3 A;  2V4D A;  3EN2 A;  3CCQ A;  1S5B D;  1LM0 A;  1RJT A;  2ZTC A;  1JE4 A;  4F7X A;  1I3Q B;  2EE1 A;  2A69 D;  5IYC H;  1YJW A;  1I6V C;  5G3L D;  1S72 A;  4IPD A;  1BBW A;  3OOC A;  4JBW A;  3SXH A;  4DV1 L;  1BXT A;  2SOB A;  4LF9 L;  2J4X A;  3FDT A;  1E3P A;  3MHB A;  2NVQ B;  3RN5 A;  1CKM A;  1SYF A;  1CA6 A;  4IUV A;  4R4O A;  1QB5 D;  4HMI A;  2EXD A;  3C1F A;  2E76 C;  2FMC A;  1ASY A;  3F2U A;  1N8R C;  1E1T A;  1SDF A;  4ZUJ A;  4CKC A;  2L55 A;  4C3I G;  4ZKB B;  4DR3 Q;  1BOS A;  4EQO A;  5LMN Q;  5C5L A;  2OF1 A;  5JOB A;  2K5N A;  3PO2 H;  3G7L A;  1F9Q A;  5BR8 L;  2EYP A;  1Y1V H;  1F77 A;  1NBW A;  1QUQ B;  2BCO A;  1XPU A;  4OIK A;  1SFO H;  1GUN A;  4A93 H;  3VYU A;  2ZTD A;  2Z8L A;  4OEM B;  2XWB B;  3S1M B;  3K7A H;  1A2T A;  4ILW A;  1HZB A;  3A54 A;  4JOI A;  3RUZ A;  2LFN A;  3S17 H;  2HQL A;  2Y0S G;  3S1N B;  4F87 A;  5IYB H;  2X6L A;  3LNN A;  4DK3 C;  1EYA A;  4I65 A;  1VQC A;  3TZU A;  3J80 i;  2BE5 C;  5M9O A;  2PW5 A;  1AW7 A;  4IJL A;  3G6E A;  4Y7N B;  5GAD C;  3LWE A;  1LT4 D;  5FKA C;  3TME A;  2Q2U A;  2E2J H;  3O13 A;  2R7Z B;  2L1B A;  3X3N A;  5FO9 B;  1EYC A;  1SN8 A;  4K6D A;  2PYK A;  1DJR D;  3A8J E;  4CKE A;  1KC8 C;  1NR2 A;  1WCM G;  1LTS D;  1VQD A;  3M4P A;  1XMQ Q;  2F0V A;  3ULJ A;  2EZV A;  5IGE A;  3KF8 A;  1Y1W G;  1MKH A;  4HN7 A;  4DR1 L;  3GTL B;  3G48 A;  4LFB L;  5C3E B;  1X6O A;  2VY3 A;  1CKN B;  1BO0 A;  3K8A A;  4HMJ A;  2YU9 B;  3CCM A;  1TII D;  2VXW A;  5CMD A;  3ND8 A;  3S1R H;  3FPU B;  1SBB B;  4RGN A;  1HA5 A;  3D4W A;  4IFD G;  2JA8 H;  2UXD L;  3JAM c;  2EPB A;  1EZ8 A;  1BCP C;  5FOB B;  1PH2 A;  1PTO F;  4A4I A;  2F4V L;  1A3T A;  3I90 A;  3FRP B;  2WAQ E;  1QOH A;  3EBE A;  4A3F G;  5LL6 S;  4DV2 L;  1MBY A;  4G7O C;  4KHZ A;  1HRJ A;  1OXT A;  1EQR A;  3KK7 A;  2L5T A;  1NMG A;  1DM0 B;  5M5X B;  4OON A;  4C2M B;  1EY0 A;  1W6K A;  1PTO H;  2B2W A;  1DCZ A;  1NTG A;  4EX5 A;  1WTP A;  5IY0 A;  1E22 A;  2F0T A;  5C5M A;  5A2Q L;  4ALP A;  4JI5 Q;  4K5W A;  3D4R A;  2CHB D;  4IN3 A;  1HJP A;  4POF A;  3C2P A;  2KCT A;  5COR A;  4NW2 A;  1N9W A;  4WOR A;  2A74 C;  3T1H Q;  2I5M X;  2WII B;  4K0K L;  1HCZ A;  2A19 A;  2N88 A;  4FXD A;  4DR5 L;  5C0X J;  3H15 A;  3NEN A;  2ZJR A;  1CQF A;  1LTB D;  3CCL A;  2IWH A;  1RDP D;  4IUU A;  5J1Z A;  2RDG A;  3V05 A;  3S16 H;  1LTL A;  4CDD C;  1B70 B;  4IOC A;  3EJI A;  3BDL A;  3TP7 A;  2PZW A;  4K8J A;  2O4X A;  5TSS A;  2N49 A;  5D65 A;  2F0O A;  1STN A;  2N3S A;  2NZ1 D;  1TVX A;  3LX0 A;  3M3Y B;  1IL2 A;  1EY8 A;  4RGT A;  1C0A A;  1WTR A;  3GTG H;  2UUC Q;  1IBK Q;  1OO9 B;  4QJF A;  3K80 C;  4XQQ A;  3KFU A;  4B3S L;  4J6H A;  4PMW A;  2EY1 A;  4CDC C;  3FMC A;  4UAI A;  4HCE A;  4BBR B;  4BWG B;  2K50 A;  2BA1 A;  5EKI A;  1OXV A;  1K8G A;  1SYD A;  2MFI A;  3U9S A;  1SJE D;  4DFA A;  1K73 C;  2D0P A;  2OEO A;  3MA2 B;  4A3M G;  4DV3 Q;  2AMC B;  5E4X A;  1I6H H;  2ZXP A;  2RQX A;  2L9H A;  5K36 H;  4XXE A;  2F0G A;  1AFP A;  3H94 A;  3H6M A;  1ENA A;  1JIC A;  1E7Z A;  4RHS A;  1KHI A;  4KD3 A;  3BZD B;  3NEM A;  1DOM A;  1G8Z D;  2A6H C;  1AH9 A;  3K7A B;  4X64 L;  5FLM H;  2XIW A;  1GJX A;  2HHH L;  3S17 B;  3T1Y L;  1JB3 A;  1V1O A;  2Q2I A;  2L4N A;  1CK1 A;  1Q82 C;  5C4J H;  2ZM6 L;  1S4Z A;  3F8T A;  1VQB A;  1SAP A;  1O7I A;  4MTN A;  4JI6 L;  1A62 A;  1ICF B;  1ZEQ X;  2XGT A;  5EKL A;  3MAQ A;  1KDB A;  2F0N A;  4GLX A;  1SE3 A;  1EL0 A;  4DUZ L;  2ZJP A;  1QWY A;  1FGB D;  3PUY A;  2VQE Q;  3LWU A;  5FLX E;  3CCU A;  4X3S A;  3J81 E;  5CV5 A;  5KEE A;  3Q24 A;  3STB D;  1XJV A;  2EJG C;  3J80 c;  4KHP L;  1ENF A;  4YHH Q;  1TS3 A;  2HQE A;  2WIN B;  4NMZ A;  4C3I H;  1SNM A;  2N78 A;  2UUB L;  4EQ5 A;  3HOY G;  2XNA C;  5I9P A;  2KBN A;  4R9W A;  1FJG L;  4XQJ A;  1GOZ A;  4KK7 A;  3D3R A;  3HFZ B;  1X65 A;  1K8A C;  4NKL A;  1P16 A;  1NMF A;  2ATW A;  1W2B A;  3S1R B;  1MD2 D;  4N8F A;  2HDL A;  4JI2 L;  2B29 A;  2LKV A;  2RSN A;  1ASZ A;  4PMC A;  4LFC L;  3ZJY C;  2HCI A;  2R93 H;  2CVR A;  1PYW D;  3MXN A;  4UPA A;  1SNP A;  1XWE A;  4TQU S;  3A0J A;  4U68 A;  2UUA L;  1LAC A;  3H3V H;  2SNM A;  3M4O B;  3S14 H;  3UDI A;  1GUS A;  4JI4 L;  3S1Q B;  2EYO A;  5JEA J;  1HNW L;  2CWA A;  1ZYR C;  4LF8 L;  1WTH A;  4X66 L;  2B3G A;  2K75 A;  1A2U A;  1KAB A;  1KD1 C;  2L15 A;  2LMC B;  4GKJ Q;  3DEO A;  4BBR G;  2K52 A;  1I5F A;  1PTO B;  4L8J A;  1G6P A;  1NJI C;  2KED A;  4ABN A;  1WTQ A;  3I4M G;  3TN2 A;  5C4H A;  1WCM H;  3VA5 A;  3D4D A;  5IE8 A;  2KCC A;  4LF5 Q;  1EU3 A;  1SMY C;  2B2U A;  1GM5 A;  5LMN W;  1YNJ D;  1D2B A;  2B2V C;  4B9W A;  5IGG A;  4IUP A;  4KMU C;  1Y1W H;  5EJW A;  4DR7 Q;  1TWH H;  4MZ9 A;  3DWP A;  1EY5 A;  3HOU G;  4P71 A;  4J8Q A;  1PRT F;  3CPF A;  4C1N K;  3S2H H;  2G5D A;  3BZC A;  4OWT B;  1BBU A;  3GO5 A;  1PH4 A;  1A3U A;  4DK0 A;  1VQM A;  4A3K G;  2ENB A;  4HIK A;  2WB1 E;  1EY6 A;  2VQF Q;  4IFD H;  5T1G A;  2YTX A;  3JAM L;  2YTV A;  1TT2 A;  4DR3 L;  1OXX K;  3L7Z C;  2R3Z A;  5LMN L;  1WYD A;  4LUO A;  5EBC A;  1HHV A;  2F3W A;  3S15 H;  4Z9C B;  3N6R A;  3HKS A;  4A3F H;  1SMX A;  4ZK9 B;  2KEC A;  1SSO A;  4LF6 Q;  4HJ7 A;  3H09 A;  2B8F A;  4JC0 A;  1WTX A;  2PZU A;  4FDB A;  1K0S A;  3GTG B;  2N8N A;  3GTP B;  4NP5 A;  3I8Z A;  1JT8 A;  1A8V A;  1G2T A;  4LWC A;  1TR5 A;  2KUM A;  1A3V A;  5JJZ A;  1BCP F;  2HIX A;  5C6A A;  5CC4 A;  2NVX H;  2RDF A;  1VF5 C;  1TS5 A;  2AQ2 B;  3FP9 A;  4RGO S;  4BA2 I;  4JW0 A;  3NEL A;  2CCZ A;  4A3J G;  2Q8I B;  1XPO A;  1FNW A;  1C48 A;  2MGS A;  4KJO A;  3U50 C;  4A3E G;  3KLR A;  1GHK A;  2NVT H;  4OEL B;  1I6H B;  3FHW A;  4RWS C;  1Y14 B;  4P73 A;  4FVM A;  4RH6 A;  4GNX C;  1XMQ L;  2O2L D;  3DM1 A;  1V1P A;  3E6Z X;  1STG A;  1RKN A;  2EJF C;  1K8M A;  3E5S A;  4DV0 Q;  3W1B A;  4RA8 A;  2PO4 A;  1SYB A;  3ITP A;  5C44 G;  1GVP A;  1M90 C;  3MXP A;  5CV7 A;  2PMZ B;  1I94 Q;  4JV5 Q;  1U4L A;  4A75 A;  3W3A A;  4FF4 A;  3HOZ B;  3ICE A;  4GLV B;  1PH7 A;  3OWF A;  1GHJ A;  4ID6 A;  3SVM A;  1X3G A;  5JPN C;  3HG9 A;  4KD4 A;  1LTG D;  5M3F G;  3R93 A;  4FP5 D;  1Y8O B;  4DF7 A;  3CRL C;  3E3X A;  5E4W C;  1Q46 A;  1SLJ A;  1JR0 D;  2X69 A;  4B08 A;  2C9O A;  4EQP A;  3JAM i;  2I5L X;  1EEF D;  1OXS C;  1HTL D;  5I2Y A;  3T4A C;  1CT1 D;  1DD2 A;  1YHQ A;  1X54 A;  1JOR A;  2C35 B;  1SJH D;  2YU9 H;  2B39 A;  4A3M H;  5FJ8 G;  1PRT D;  4RCO A;  1R9T B;  1B8A A;  1JWS D;  2R61 A;  4PMB A;  1S5E D;  1KNA A;  4DXF A;  1JE5 A;  5LMU Q;  2NZO A;  4JI5 L;  1HNX L;  2K01 A;  2BDN A;  1WVL A;  2GA4 B;  2K5W A;  1JMC A;  1K0R A;  1KLG D;  4BBS G;  3ND9 A;  3T1H L;  4GKK Q;  2Y0S B;  4B3R Q;  3CCJ A;  1I50 H;  2F52 A;  4DV4 Q;  2GVB A;  1HZ9 A;  5JEA G;  5M5X H;  1Q12 A;  4C2M H;  1LYL A;  3TS0 A;  4ULL A;  4A76 A;  2KHI A;  2OCE A;  1FJG Q;  3VR6 A;  2B63 G;  4HJ9 A;  5ELE A;  2K32 A;  3C46 A;  3KJP A;  3DXJ C;  1S5F D;  1C8C A;  1RHP A;  4FF2 A;  2O5I C;  4UP9 A;  4YWM A;  1WCM B;  3OHX C;  1BCP D;  1FL0 A;  5FK9 C;  5J39 A;  3G4S A;  1DON A;  4QCL A;  3J80 L;  3HOY H;  3DWA A;  2F3V A;  1Y1W B;  2UUC L;  1IBK L;  1TWH B;  3F2C A;  2DJF C;  1H9R A;  3ERS X;  5JJK A;  2I07 B;  1XNQ Q;  2TSS A;  4CHT B;  5IWA Q;  1AE3 A;  1VDZ A;  1FVI A;  1NAP A;  3P7J A;  1O7Y A;  1BBX C;  5GRO A;  3CC2 A;  4L5Q A;  4APV A;  1SRU A;  4DPG A;  4OO1 G;  2WAQ G;  1L1O A;  1WD0 A;  2XTI A;  2VB2 X;  3E0J A;  1JOQ A;  1PRT B;  3NTI A;  4DV3 L;  3M3Y H;  3HOZ G;  3J7A 5;  4WJ4 A;  4O2D A;  5C3W A;  2JEA I;  3S15 B;  1D5X C;  1PYB A;  2IX0 A;  2OQ0 A;  4A3F B;  4P72 A;  4L5T A;  5DM7 3;  1EY4 A;  1U4P A;  1CHQ D;  4DU9 A;  3WOE A;  3P75 A;  3W2D A;  3PIO 3;  3CAM A;  4BBR H;  1Q3L A;  1HA6 A;  1PFM A;  2CQO A;  3VYR A;  1C7Y A;  4LF7 Q;  1F2L A;  4A3D G;  2EYH A;  1Z7T A;  4GOP C;  2RCN A;  4YWK A;  3NPP A;  1YNN D;  1X3F A;  4EVO A;  5IGD A;  2GVA A;  1N32 Q;  4IQZ A;  2NVX B;  3HOU H;  2VUM G;  1K8O A;  3HRZ C;  2L11 A;  1EIF A;  4HSV A;  2K1B A;  1DOL A;  4WRD A;  1LAB A;  2XVS A;  1J9O A;  5A35 A;  1VQ6 A;  4A3L G;  1X3E A;  3VR3 A;  1U5K A;  4A3K H;  3V96 A;  2EIF A;  2NVT B;  2VQE L;  1SYG A;  1B4O A;  1H9K A;  1S5C D;  1BCP B;  1II3 A;  2H5X A;  4YHH L;  4JBJ A;  2ID0 A;  1PMR A;  4DXG A;  5I2X A;  5IOD A;  3FKI B;  1XTC D;  4A3B B;  4JPB W;  4XT1 B;  4BXX G;  3RD4 A;  2BH2 A;  2E2I B;  3K5N A;  4Y52 H;  2VW9 A;  3U4V A;  3K59 A;  4ZUI A;  1GUG A;  1VMC A;  2FMM A;  3NBH A;  3RZD B;  1SXT A;  1U9R A;  4QL5 A;  5EQ0 A;  4AH6 A;  3M85 A;  4GOP A;  4K6L A;  4YY3 Q;  1EY7 A;  1VQL A;  3ZYY X;  1VMP A;  5CGK A;  3GTO H;  4CKB A;  1LT6 D;  2A6H D;  3MFY A;  3GTM B;  1HZA A;  1KL9 A;  2AWO A;  4S3S A;  1SNC A;  4BY7 G;  5CR3 A;  1XPR A;  1L2F A;  4GKJ L;  1DZ1 A;  2AQ1 B;  2JXM B;  4A3E H;  4A3M B;  2K4K A;  3K58 A;  2PQA B;  1B2T A;  1X32 A;  3CKI B;  3HOX G;  1O80 A;  2A5H A;  2KHJ A;  2WKC A;  4LF5 L;  4DNR B;  1WTW A;  3CP0 A;  2OXP A;  3TSS A;  2OTJ A;  3S9W A;  1ML0 D;  1JJG A;  3I73 A;  4DR7 L;  1GD7 A;  3CC7 A;  4BS9 A;  3M4O H;  1G2S A;  5C44 H;  4K2K A;  3CC4 A;  2D5D A;  3S1Q H;  2NVY H;  2EY6 A;  1Q8I A;  2H4O A;  4DAY A;  1VQH A;  3UDG A;  1N34 Q;  1JQY D;  2PNR C;  1WFQ A;  2NB0 A;  3NTK A;  1I50 B;  3QWN A;  3H3V I;  3MC0 B;  4HIO A;  1M4V A;  3I2Z A;  1W6J A;  1STB A;  3PSI A;  3SK5 A;  2VQF L;  1W3S A;  2R7D A;  4LAA A;  3RZO H;  5M3F H;  1WTV A;  1T9H A;  3BVM A;  3OW7 A;  5M3M G;  3BZK A;  2MP1 A;  4HJA A;  2PI2 A;  1EIY B;  1HNX Q;  4B3M L;  3RLO A;  4DNT B;  4LFA Q;  2ZXO A;  1NNX A;  1STA A;  2AWN A;  4LMQ D;  4N9T A;  3GP7 A;  1C9O A;  4DR2 Q;  4LF6 L;  2UXB L;  2QIL A;  1WI5 A;  1VCI A;  3KF6 A;  3I72 A;  3HOY B;  2JA5 G;  1VQK A;  1G91 A;  5FJ8 H;  1XMO Q;  3MEF A;  2NTS A;  2HDM A;  3KUP A;  3K5L A;  1ZYR D;  3PIP A;  4I7Z C;  3OW2 A;  1PZK D;  3QIA A;  2F0S A;  1OTC A;  4QIW E;  3J7A V;  4ME3 A;  3FKI G;  4BBS H;  4IFD I;  4A3B G;  2B8G A;  1XX8 A;  1S3O A;  3HKZ E;  1EYG A;  1EIG A;  1QUQ A;  1KRT A;  4DAM A;  1SMY D;  1SYE A;  1VS0 A;  4OXP A;  1UEB A;  4X62 Q;  1EQT A;  5JEA H;  4CJ2 C;  5IT9 c;  3OMG A;  5A2Q E;  2N55 A;  3GTP H;  4GZY C;  1J8I A;  1EQV A;  2B63 H;  2FXQ A;  4ZCK A;  4DV0 L;  1E2Z A;  3OIP A;  4NDX A;  1CM9 A;  1PLF A;  1ZXT A;  2SDF A;  1I94 L;  1HR0 W;  1F2Z A;  4JV5 L;  2WP8 J;  3D31 A;  4F8M A;  4IPC A;  2F0L A;  3I4M B;  2K5H A;  2RKS A;  3I4N G;  3QJY A;  4V19 0;  2K03 A;  1A15 A;  4DR4 Q;  1KQS A;  1TWG B;  2WB1 G;  3HOU B;  3V2T A;  1K9M C;  1PHJ A;  1QVG A;  2KHS A;  2MJ8 A;  3NTH A;  1IBL Q;  1B9M A;  5EBD A;  2F03 A;  3ERO A;  4A3K B;  1YVC A;  4OHJ A;  2VB3 X;  2F0K A;  4IPH A;  1VQG A;  3EQL C;  4CJ1 B;  3DUZ A;  1IKM A;  2RBM A;  1FNU A;  3MZ5 A;  2YTY A;  3IKJ A;  3RLF A;  4QUC A;  1HUM A;  4MN3 A;  4OO1 H;  3CU7 A;  1B44 D;  1SEB D;  2CWP A;  5KYL A;  1VQJ A;  2UU9 Q;  1F2Y A;  3J81 L;  3FEW X;  4IOA A;  3HOZ H;  2HD3 A;  3I7F A;  1EFW A;  3C3L A;  5HGT A;  1IYV A;  1IYU A;  4FYD A;  5CV8 A;  1MSG A;  4DN4 M;  5LMU L;  2I5H A;  1VQ9 A;  3D6W A;  4AQY Q;  2Z6K C;  3A55 A;  3LGJ A;  2JQO A;  4JI3 Q;  3CD6 A;  3NP8 A;  2Z6B A;  4DV6 L;  1IYJ B;  1HQM C;  1UE5 A;  3VR4 A;  3URY A;  4A3D H;  2WV6 D;  4RAU C;  4GKK L;  4NXN Q;  2F0U A;  3RLN A;  4B3R L;  3KBX A;  2DUD A;  3TQY A;  3KLS X;  2PI2 E;  5CBA E;  3AYH B;  3PQI A;  4RGM A;  4DV4 L;  3GTO B;  1EQQ A;  4NPS A;  1E0B A;  2F0F A;  2LS0 1;  2VUM H;  1R9T H;  2RF4 A;  3SHL A;  3EFX D;  2OQK A;  2VNU D;  4ZAI A;  1ENC A;  3WDN A;  4A3J B;  5C4X G;  1ET6 A;  3I4L A;  3R2I A;  1BKB A;  1VQO A;  4A3E B;  4P74 A;  1GO3 E;  2XRQ D;  1H9J A;  1ILP A;  1PXU A;  2RCF A;  1V1P B;  4PG3 A;  2OWO A;  2NUC A;  2I46 A;  4DA2 A;  4R4Q A;  4JG2 A;  5CV6 A;  4HID A;  4X65 Q;  5C44 B;  4BY1 B;  2K5D A;  2NVY B;  4CGY B;  2MHV A;  1XNQ L;  4BXX H;  5E7N A;  1A63 A;  4HR7 B;  5IWA L;  4AIM A;  1G6Z A;  3TP8 A;  1SNO A;  4R4T A;  1UUP A;  5IGB A;  2ZJQ A;  4CJ0 B;  4A3G G;  4JK1 C;  1KXL A;  4P2C B;  4WJW A;  3F2B A;  3RZO B;  5M3F B;  3PO3 B;  4POG A;  4R4C A;  2F0H A;  2JEB I;  2SEB D;  1Q81 C;  5IYC G;  1CFM A;  1RTO A;  4RHR A;  5ELC A;  1YHA A;  3SDZ A;  1HFG A;  2PPB C;  1R4Q B;  3J81 i;  1KLU D;  2EY5 A;  4JI0 Q;  1QJO A;  4DAV A;  2PW7 A;  1ZKO A;  3ULL A;  4NXM Q;  4BY7 H;  1IHZ A;  3GTJ H;  4OIJ A;  1QE6 A;  4GN5 A;  1Q1E A;  1RTN A;  1RL2 A;  2F0E A;  4LF7 L;  5C0X G;  3HOX H;  1QZG A;  3PUX A;  1RD9 D;  1LV9 A;  2LY7 A;  1YIT A;  3CHB D;  3QOL A;  4MTK A;  1IW7 D;  4HSP A;  5JPM C;  3I70 A;  1BQQ T;  3NUC A;  2L0C A;  2ASB A;  4H7B A;  1UE6 A;  1N32 L;  5IP9 G;  1XXG A;  1K83 H;  4ODG A;  2E74 C;  2XRS D;  1NSN S;  4YIJ A;  4BBS B;  1UWV A;  4QUF A;  4B3M Q;  2I0Q A;  3OSO A;  3AFP A;  3TDQ A;  4A93 G;  3MEH A;  4RKB A;  2Q2T A;  4EGV A;  5AJ3 Q;  2WFW A;  2LXK A;  5NUC A;  1RF2 D;  2UXB Q;  1CKO A;  3M9B A;  2E2H H;  5I9O A;  5KYI A;  4R8N A;  1IZ6 A;  4GLA C;  3EIV A;  5ELF A;  2KEE A;  4DV5 L;  1TY0 A;  2B63 B;  3SR1 A;  3VR2 A;  5BN5 A;  3BVG A;  1CSQ A;  1LTR D;  3K5M A;  3ERQ A;  3RNU A;  2JK8 A;  2J7Z A;  4K5X A;  1JJC B;  3N52 A;  1BUV T;  2B2V A;  2K7V A;  5DEH A;  2CH4 A;  4C3J G;  4JI1 Q;  3NSW A;  2CQA A;  3R8B A;  1C4Q A;  1PH1 A;  1D1K A;  1I4P A;  2EYM A;  2K5V A;  1PZI D;  2KCM A;  4XTC S;  4OWX B;  2KQ3 A;  1Q86 C;  1VF7 A;  2NN6 G;  2JA5 H;  1NE3 A;  3JAM E;  2RHS B;  1D5Z C;  4KI0 A;  4L5R C;  4AYB E;  1PTO C;  2IY5 B;  3J7Z C;  4O42 A;  4YY3 L;  3I55 A;  1Q7Y C;  1WD1 A;  2JYO A;  3AEV A;  3DEP A;  3GDE A;  2YV5 A;  1PH9 A;  3I3C A;  3CCS A;  2ZXR A;  4DV7 L;  1JB7 A;  1L1O B;  1Z9F A;  3IRB A;  3FKI H;  4RCN A;  4BY1 G;  4HJ8 A;  4A3B H;  1HH2 P;  2WAQ B;  1TS2 A;  4C1N I;  2B2Y C;  1HTP A;  3HS0 C;  2E2I H;  1MJE A;  5JJL A;  1YJ9 A;  1N36 L;  1UNS A;  2K28 A;  2IL8 A;  4O0A A;  1HUN A;  1EYD A;  2PCF B;  5IT9 L;  3CW2 C;  3CCR A;  3RZD H;  3PO3 G;  4IJH A;  2JA9 A;  3S24 A;  3NK9 A;  3EA6 A;  2QGQ A;  4OWW B;  4PZ7 A;  2MPM A;  3GTM H;  1N34 L;  1K3B C;  4A3D B;  2FJ2 A;  5DM6 3;  4L63 B;  1HR0 Q;  4UY8 C;  4FXK C;  4DKA C;  3I4N H;  1BNZ A;  1QCB D;  3A8K E;  1ONL A;  1NCV A;  2BA0 A;  3IAY A;  1NUC A;  2VUM B;  3HGB A;  1L0Y B;  3TS2 A;  2M00 A;  2BE5 D;  4GNX A;  1QIL A;  1I4H A;  4H0L C;  2A73 B;  1CZG A;  1TS4 A;  2MQH A;  2R6G A;  1MIU A;  2KEN A;  1H95 A;  4LFA L;  1TWC H;  2KCN A;  3K6O A;  4HTH A;  4LNQ A;  1ICW A;  4DR2 L;  4DV6 Q;  3HKZ B;  3HOW G;  3UI2 A;  5K5P A;  4IAL A;  2F1M A;  1LTA D;  5D3D A;  4R8I A;  3DWQ A;  3NQI A;  1XMO L;  4K2L A;  2MO0 A;  1TU2 B;  3NQT A;  3B6Y A;  1HXY D;  1O78 A;  3U58 A;  4FF3 A;  3UE0 A;  1STE A;  2FIN B;  4QMG A;  4DAP A;  5ISR A;  1JWM D;  5D14 A;  3H91 A;  4HAE A;  3SK4 A;  4KTA A;  3NBH B;  2QW7 A;  4YCU A;  4JYA Q;  1E1O A;  2ALY B;  4QQB X;  5COY A;  1IBM Q;  2P5Z X;  4X62 L;  3T16 A;  1YHB A;  3KF8 B;  3ER0 A;  3A8I E;  2EYL A;  3OYY A;  1YEZ A;  1YBY A;  2NYZ D;  1A0I A;  3P1H A;  1H9S A;  3K81 C;  4YCW A;  4BY7 B;  3HOV G;  2WAC A;  1UEA B;  5C4X H;  3GTJ B;  1AE2 A;  3M4Q A;  5J22 A;  5CV4 A;  2MUY A;  2EJM A;  4XDX A;  2DN8 A;  2QCP X;  3HOX B;  5C4Z A;  2Z1C A;  3P20 A;  1V1Q A;  4KN7 C;  1GUW A;  3ULP A;  1HZC A;  1MGS A;  5FLX c;  1Q1B A;  3OWE B;  3J81 c;  4GN4 B;  5BN3 A;  1VQ4 A;  4DR4 L;  1LUZ A;  5K36 G;  1K83 B;  4DAY B;  1BR9 A;  4V0B A;  5EAY A;  2JA6 G;  2Z9H A;  1CQV A;  2NTT A;  3T13 A;  1IBL L;  4XT3 B;  1CUK A;  3BVZ A;  1EIH A;  2AUK A;  1XNR Q;  4JI8 Q;  4A3G H;  5L37 A;  3OIQ A;  2E2H B;  3GTK H;  2ES2 A;  5FO7 B;  1O7Z A;  2D62 A;  4JOI C;  3H0G G;  2F0I A;  3J80 E;  4OX9 Q;  2ICI A;  2SNS A;  2UU9 L;  5M3M B;  4GS3 A;  1EWH A;  3I4M H;  3CRK C;  1B3A A;  4DUY Q;  1E2V A;  2F0W A;  3H3V C;  2PZT A;  1NR4 A;  2NBF A;  5EGT A;  3KYH C;  4C56 C;  1QNU A;  1TWG H;  4KLK A;  3SK6 A;  2L12 A;  1LTI D;  2A68 C;  3TP5 A;  3A74 A;  5EPL A;  2Z4I A;  3KF6 B;  4AQY L;  3BS1 A;  2RHQ B;  1PZJ D;  1VQP A;  4DK1 A;  4FF1 A;  4JI3 L;  1D1I A;  3MXG A;  3E9I A;  2JA5 B;  5I6W A;  5DAU A;  1Z47 A;  1JOK A;  4L6T B;  5C0X H;  3PGZ A;  4PZ8 A;  4NXN L;  1A6X A;  1PH3 A;  4IZ8 A;  3U9O A;  3K57 A;  4A3I G;  3HKZ G;  4DV5 Q;  1B53 A;  4HCS A;  4KKU A;  3K0Y A; 
#chains in the Genus database with same CATH homology
 1KTK A;  2HUG A;  3PUV A;  2M9V A;  4TKO B;  3GV3 A;  3TZD A;  5M5Y B;  1O7L A;  1TWA B;  2YYZ A;  3TBI B;  1TQO A;  4OO1 I;  3BYY B;  2X6G A;  1DOK A;  4F88 A;  4IUR A;  5KIX A;  4QF4 A;  3NWS A;  4KY5 A;  4XYQ A;  2IX1 A;  3VA7 A;  1PRT C;  4Q0F A;  5EKK A;  3FVQ A;  2F4I A;  1LLR D;  3M4Y A;  2A6E C;  2CW0 C;  2B2T C;  3PUZ A;  1TWF B;  4PV1 C;  5C3X A;  3I4N B;  2EYJ A;  2NN6 H;  2B2W C;  2F0Q A;  4FNF A;  2WB1 B;  3PMF A;  2ICE C;  3SE0 A;  5I6Y A;  1SYC A;  1TWC B;  2JP1 A;  1B1Z A;  1Z6H A;  2JA7 B;  4K14 A;  4ZLT F;  4ZRZ A;  3C1E A;  2K33 A;  1L0X B;  1V8Q A;  4C3H B;  2OT2 A;  1LO5 D;  1AZP A;  3DHQ A;  3HP3 A;  5JVG 3;  1HQR D;  2QF7 A;  4ZYS A;  1EY9 A;  1KAA A;  5KND A;  2IJ0 A;  1SND A;  4ME5 A;  4PQX A;  3QO2 A;  3NWT A;  5DNF A;  4IUQ A;  2B2T A;  2R92 B;  1HFN A;  4X3K A;  2K5Q A;  5KRU A;  4KN4 C;  3ONA B;  1IKL A;  5HUR A;  5M5W B;  2EOT A;  1AP0 A;  1PDQ A;  3KLS A;  4AYB B;  4MHE A;  1CA5 A;  4K5V A;  4U67 3;  2HCC A;  2RDH A;  5C4X B;  5FO8 B;  2A69 C;  4X3T A;  1LTT D;  4E6I A;  1STY A;  2K05 A;  5LHY 1;  1X3P A;  3QB3 A;  3QOJ A;  2F0D A;  3PV0 A;  3MVV A;  3PUW A;  1JC7 A;  3GQB A;  1KDC A;  3HEJ A;  1YNN C;  4KJN A;  1SNQ A;  4G7H C;  4A3G B;  4KV6 A;  1STH A;  3GTK B;  3A56 A;  3T56 B;  4X3U A;  4WFN 3;  3BDO A;  5I4D A;  4MIU A;  4H44 C;  1UAP A;  3BG3 A;  3EVQ A;  5JVH 3;  1B9N A;  2KA7 A;  1EOT A;  3VYS A;  2EYF A;  2JE6 I;  1I4X A;  3WOF A;  1RCV D;  3GV6 A;  3OPO A;  3NBI A;  4N9P A;  2KJX A;  1LT3 D;  3MXU A;  3R2T A;  1PFB A;  3AU7 A;  5CBE E;  4KY6 A;  5FLX L;  2G9H D;  2EY2 A;  1FR3 A;  2EVB A;  3PO2 B;  4C3H G;  1F9S A;  5F2D A;  3CQZ B;  1ET9 A;  1Y1V B;  4LJZ C;  4B9X A;  3A7L A;  1U4R A;  3TP6 A;  2NWG A;  5BN4 A;  1SFO B;  1PFN A;  4A93 B;  3L3O C;  4CBV A;  5IOC A;  2DY8 A;  1WTO A;  4EQN A;  1PTO D;  1CZW A;  4Q5V A;  1I4G A;  1XYI A;  2KVM A;  1EWC A;  4G4K A;  3GTQ B;  1GXD C;  1QNK A;  4C3J B;  1CHP D;  1D6E C;  1HPC A;  4G7Z C;  1B50 A;  4IUN A;  2M2L A;  2Q8R E;  2G9D A;  2E2J B;  2IX3 A;  2IPK D;  3VR5 A;  2K04 A;  4RFB A;  1LT5 D;  2H1E A;  2XN9 C;  2B2U C;  1KDA A;  2DNC A;  1KNE A;  1CTM A;  1OXU A;  4IUT A;  1V43 A;  3AMU A;  3L9A X;  2PQE A;  4BA1 I;  1ESF A;  2BDO A;  2EDG A;  2JA8 B;  1EEI D;  3IFD A;  3AB9 A;  5EPJ A;  5ELB A;  1U4M A;  2E2D C;  2KOL A;  3T53 B;  1I4R A;  4O1N A;  3NXW A;  2D9U A;  1MSH A;  2AUJ D;  5E3F A;  3G6J B;  2XSC A;  1MI2 A;  3HZX A;  4TRD A;  2JSO A;  2Z4H A;  1M8A A;  1I4Q A;  1H9M A;  3IFT A;  4G57 A;  1Y69 U;  3Q0A A;  3I91 A;  2XWJ B;  4K8I A;  3HOW B;  3KBG A;  4FXG C;  1R4P B;  1EFI D;  2IT1 A;  3S16 B;  4UDU C;  5CV9 A;  2QEJ C;  4OGQ C;  1ILQ A;  4J1M A;  1ROD A;  4KKS A;  2QDB A;  2RSO A;  1Y8N B;  1IL8 A;  3MTS A;  2FFK B;  4LK1 C;  4KY7 A;  3BDC A;  3X3M A;  2K6A A;  1JCK B;  3J7Y W;  1H9S B;  3K5O A;  1CI3 M;  3M7G A;  3D6C A;  3HOV B;  3VYT A;  2DY7 A;  5KNB A;  5IGC A;  1EZ6 A;  5C0X I;  5JAV A;  3Q6S A;  4PNY A;  1FNV A;  1JOO A;  2O5J C;  4M8A A;  5IIF A;  4FO2 A;  1T5X D;  2TMP A;  1FD7 D;  4TSS A;  2JA6 B;  2F0P A;  3D8G A;  2A68 D;  2J0T D;  4ZKC B;  2DNE A;  5ELD A;  3IL8 A;  3H0G B;  5G3L F;  2QKI C;  5CYU A;  5D3I B;  2C5C A;  2E75 C;  4XYO A;  5C4J B;  1TY2 A;  3R3O A;  2D2C C;  1F9R A;  3NHH A;  2WKD A;  3BYT B;  2F0J A;  1T5E A;  3MFG A;  1EU4 A;  3S2D B;  2NN6 I;  5EPK A;  1FYC A;  1GUO A;  4QIW B;  2ZT9 C;  1G29 1;  2RVL A;  2RA4 A;  3SK8 A;  4A3I B;  4C3I B;  4KHV A;  2B2Y A;  1Y8P B;  1BDO A;  5IT9 E;  1DXM A;  1F9P A;  5LL6 X;  1AZQ A;  2AQ3 B;  4IFD J;  1S5D D;  2A6E D;  2CW0 D;  3GD7 A;  1AEX A;  1D5M C;  1YNJ C;  3A7A B;  1TKW B;  4RKL A;  1F2M A;  1Q90 A;  2R93 B;  3Q22 A;  3MWY W;  1SE2 A;  1X3Q A;  4DGZ A;  1BF4 A;  3S14 B;  4OL7 A;  5KNC A;  2EXZ A;  2IW3 A;  3RMH A;  2F0M A;  3SEB A;  1GUT A;  1DYQ A;  1IW7 C;  1SE4 A;  3Q23 A;  2FHT A;  3T51 B;  1AN8 A;  4XQN A;  1E2W A;  5KGU A;  3J7A F;  1QG7 A;  2Q8T A;  5T1I A;  3PIP 3;  1JWU D;  3FPP A;  1ESR A;  5IGF A;  5AFW A;  3NE5 B;  4HED A;  3S2H B;  3M7N A;  3DMU A;  5E1F A;  3OMC A;  4KKT A;  2BOS A;  4XIG S;  3QG1 A;  4M1U B;  4H13 C;  4QB4 A;  4ZQ3 A;  2V4D A;  1S5B D;  1RJT A;  1JE4 A;  4F7X A;  1I3Q B;  2EE1 A;  2A69 D;  1I6V C;  5G3L D;  3OOC A;  4JBW A;  3SXH A;  1BXT A;  2SOB A;  2J4X A;  3FDT A;  3MHB A;  2NVQ B;  1SYF A;  1CA6 A;  4IUV A;  1QB5 D;  4HMI A;  3C1F A;  2E76 C;  2FMC A;  3F2U A;  1SDF A;  4ZUJ A;  4CKC A;  2L55 A;  4C3I G;  4ZKB B;  1BOS A;  4EQO A;  5C5L A;  2OF1 A;  5JOB A;  3G7L A;  1F9Q A;  2EYP A;  1F77 A;  2BCO A;  4OIK A;  1GUN A;  3VYU A;  2Z8L A;  3S1M B;  2XWB B;  1A2T A;  4ILW A;  3A54 A;  3RUZ A;  2LFN A;  3S1N B;  4F87 A;  2X6L A;  3LNN A;  1EYA A;  4I65 A;  3TZU A;  2BE5 C;  5M9O A;  2PW5 A;  1AW7 A;  4Y7N B;  3LWE A;  1LT4 D;  5FKA C;  3TME A;  3O13 A;  2R7Z B;  2L1B A;  3X3N A;  5FO9 B;  1EYC A;  4K6D A;  2PYK A;  1DJR D;  3A8J E;  4CKE A;  1NR2 A;  1LTS D;  2F0V A;  2EZV A;  5IGE A;  3KF8 A;  4HN7 A;  3GTL B;  5C3E B;  1BO0 A;  4HMJ A;  2YU9 B;  1TII D;  2VXW A;  5CMD A;  3ND8 A;  3FPU B;  1SBB B;  4RGN A;  1HA5 A;  3D4W A;  4IFD G;  2EPB A;  1EZ8 A;  1BCP C;  5FOB B;  1PTO F;  1A3T A;  3I90 A;  3FRP B;  1QOH A;  5LL6 S;  1MBY A;  4G7O C;  4KHZ A;  1HRJ A;  1OXT A;  3KK7 A;  2L5T A;  1DM0 B;  5M5X B;  4C2M B;  1EY0 A;  1W6K A;  1PTO H;  2B2W A;  1DCZ A;  1WTP A;  2F0T A;  5C5M A;  5A2Q L;  4K5W A;  3D4R A;  2CHB D;  4IN3 A;  3C2P A;  5COR A;  4NW2 A;  4WOR A;  2A74 C;  2WII B;  1HCZ A;  2N88 A;  4FXD A;  5C0X J;  1CQF A;  1LTB D;  2IWH A;  1RDP D;  4IUU A;  5J1Z A;  2RDG A;  3V05 A;  3EJI A;  3BDL A;  3TP7 A;  2PZW A;  4K8J A;  2O4X A;  5TSS A;  5D65 A;  2F0O A;  1STN A;  3LX0 A;  2NZ1 D;  1TVX A;  3M3Y B;  1EY8 A;  4RGT A;  1WTR A;  1OO9 B;  4XQQ A;  4J6H A;  4PMW A;  2EY1 A;  3FMC A;  4UAI A;  4HCE A;  4BBR B;  4BWG B;  2BA1 A;  5EKI A;  1OXV A;  1SYD A;  3U9S A;  1SJE D;  4DFA A;  2OEO A;  3MA2 B;  5E4X A;  2ZXP A;  2RQX A;  2L9H A;  5K36 H;  4XXE A;  2F0G A;  1AFP A;  3H94 A;  3H6M A;  1ENA A;  1JIC A;  4RHS A;  4KD3 A;  3BZD B;  1DOM A;  1G8Z D;  2A6H C;  3K7A B;  2XIW A;  1GJX A;  3S17 B;  1JB3 A;  1V1O A;  2L4N A;  1CK1 A;  1S4Z A;  1SAP A;  1ZEQ X;  5EKL A;  3MAQ A;  1KDB A;  2F0N A;  1SE3 A;  1EL0 A;  1QWY A;  1FGB D;  3PUY A;  3LWU A;  5FLX E;  4X3S A;  3J81 E;  5CV5 A;  5KEE A;  3Q24 A;  2EJG C;  1ENF A;  1TS3 A;  2HQE A;  2WIN B;  4NMZ A;  1SNM A;  2XNA C;  5I9P A;  4R9W A;  4XQJ A;  1GOZ A;  4KK7 A;  3D3R A;  4NKL A;  3S1R B;  1MD2 D;  2HDL A;  2LKV A;  2RSN A;  4PMC A;  2HCI A;  2CVR A;  1PYW D;  3MXN A;  1SNP A;  1XWE A;  4TQU S;  4U68 A;  1LAC A;  2SNM A;  3M4O B;  1GUS A;  3S1Q B;  2EYO A;  5JEA J;  1ZYR C;  1A2U A;  1KAB A;  2LMC B;  3DEO A;  1PTO B;  4L8J A;  2KED A;  4ABN A;  1WTQ A;  3TN2 A;  5C4H A;  3VA5 A;  3D4D A;  2KCC A;  1EU3 A;  1SMY C;  2B2U A;  1YNJ D;  1D2B A;  2B2V C;  4B9W A;  5IGG A;  4IUP A;  4KMU C;  5EJW A;  3DWP A;  1EY5 A;  4J8Q A;  1PRT F;  4C1N K;  3GO5 A;  1A3U A;  4DK0 A;  2ENB A;  1EY6 A;  4IFD H;  5T1G A;  3JAM L;  1TT2 A;  1OXX K;  3L7Z C;  2R3Z A;  5EBC A;  1HHV A;  2F3W A;  4Z9C B;  3N6R A;  4ZK9 B;  2KEC A;  1SSO A;  3H09 A;  2B8F A;  1WTX A;  2PZU A;  3GTG B;  3GTP B;  4NP5 A;  3I8Z A;  1G2T A;  1TR5 A;  2KUM A;  1A3V A;  5JJZ A;  1BCP F;  5C6A A;  5CC4 A;  2RDF A;  1VF5 C;  1TS5 A;  2AQ2 B;  4RGO S;  4BA2 I;  2Q8I B;  1FNW A;  1C48 A;  2MGS A;  4KJO A;  3KLR A;  1GHK A;  1I6H B;  4RWS C;  4FVM A;  4RH6 A;  2O2L D;  3DM1 A;  1V1P A;  3E6Z X;  1STG A;  1RKN A;  2EJF C;  1K8M A;  3E5S A;  4RA8 A;  2PO4 A;  1SYB A;  3ITP A;  3MXP A;  5CV7 A;  2PMZ B;  1U4L A;  3W3A A;  4FF4 A;  3HOZ B;  3OWF A;  1GHJ A;  4ID6 A;  3SVM A;  5JPN C;  3HG9 A;  4KD4 A;  1LTG D;  3R93 A;  4FP5 D;  1Y8O B;  4DF7 A;  3CRL C;  5E4W C;  1JR0 D;  2X69 A;  4B08 A;  2C9O A;  4EQP A;  1EEF D;  1HTL D;  1OXS C;  5I2Y A;  3T4A C;  1CT1 D;  1DD2 A;  1JOR A;  1SJH D;  2B39 A;  1PRT D;  4RCO A;  1R9T B;  1JWS D;  2R61 A;  4PMB A;  1S5E D;  1KNA A;  4DXF A;  2K01 A;  2BDN A;  1WVL A;  2GA4 B;  2K5W A;  1KLG D;  3ND9 A;  2Y0S B;  5JEA G;  1Q12 A;  4ULL A;  3VR6 A;  5ELE A;  2K32 A;  3C46 A;  3DXJ C;  1S5F D;  1C8C A;  1RHP A;  4FF2 A;  2O5I C;  1WCM B;  3OHX C;  1BCP D;  5J39 A;  5FK9 C;  1DON A;  4QCL A;  3J80 L;  3DWA A;  2F3V A;  1Y1W B;  1TWH B;  1H9R A;  2I07 B;  2TSS A;  4CHT B;  1VDZ A;  1NAP A;  3P7J A;  1O7Y A;  1BBX C;  4OO1 G;  1WD0 A;  2VB2 X;  3E0J A;  1JOQ A;  1PRT B;  3NTI A;  5C3W A;  2JEA I;  3S15 B;  1D5X C;  2IX0 A;  4A3F B;  5DM7 3;  1EY4 A;  1U4P A;  1CHQ D;  4DU9 A;  3WOE A;  3P75 A;  3W2D A;  3PIO 3;  1Q3L A;  1HA6 A;  1PFM A;  3VYR A;  1F2L A;  2EYH A;  1Z7T A;  3NPP A;  1YNN D;  4EVO A;  5IGD A;  4IQZ A;  2NVX B;  1K8O A;  3HRZ C;  2L11 A;  4HSV A;  2K1B A;  1DOL A;  4WRD A;  1LAB A;  2XVS A;  1J9O A;  5A35 A;  3VR3 A;  3V96 A;  2NVT B;  1SYG A;  1B4O A;  1H9K A;  1S5C D;  1BCP B;  1II3 A;  2ID0 A;  1PMR A;  4DXG A;  5I2X A;  5IOD A;  3FKI B;  1XTC D;  4A3B B;  4XT1 B;  3RD4 A;  2E2I B;  3K5N A;  3K59 A;  4ZUI A;  1GUG A;  1VMC A;  2FMM A;  3NBH A;  3RZD B;  1SXT A;  1U9R A;  5EQ0 A;  3M85 A;  4K6L A;  1EY7 A;  3ZYY X;  1VMP A;  5CGK A;  4CKB A;  1LT6 D;  2A6H D;  3MFY A;  3GTM B;  2AWO A;  4S3S A;  1SNC A;  5CR3 A;  1DZ1 A;  2AQ1 B;  2JXM B;  4A3M B;  3K58 A;  1B2T A;  1X32 A;  3CKI B;  1O80 A;  2A5H A;  2WKC A;  4DNR B;  1WTW A;  2OXP A;  3TSS A;  3S9W A;  1ML0 D;  3I73 A;  4BS9 A;  1G2S A;  4K2K A;  2D5D A;  4DAY A;  2EY6 A;  1Q8I A;  2H4O A;  1JQY D;  2PNR C;  2NB0 A;  3NTK A;  1I50 B;  3QWN A;  3MC0 B;  1M4V A;  1W6J A;  1STB A;  3SK5 A;  4LAA A;  1WTV A;  3BVM A;  3OW7 A;  2MP1 A;  4DNT B;  2ZXO A;  1STA A;  2AWN A;  4LMQ D;  4N9T A;  3GP7 A;  2QIL A;  1VCI A;  3I72 A;  3HOY B;  1G91 A;  2NTS A;  2HDM A;  3KUP A;  3K5L A;  1ZYR D;  4I7Z C;  1PZK D;  3QIA A;  2F0S A;  3J7A V;  4IFD I;  2B8G A;  1XX8 A;  1EIG A;  1SMY D;  1SYE A;  1EQT A;  5JEA H;  4CJ2 C;  3OMG A;  5A2Q E;  2N55 A;  4GZY C;  1J8I A;  1EQV A;  1E2Z A;  3OIP A;  4NDX A;  1CM9 A;  1PLF A;  1ZXT A;  2SDF A;  1F2Z A;  2WP8 J;  3D31 A;  4F8M A;  2F0L A;  3I4M B;  2RKS A;  3QJY A;  4V19 0;  2K03 A;  1A15 A;  1TWG B;  3HOU B;  3V2T A;  2KHS A;  2MJ8 A;  3NTH A;  1B9M A;  5EBD A;  2F03 A;  3ERO A;  4A3K B;  4OHJ A;  2VB3 X;  2F0K A;  3EQL C;  4CJ1 B;  3DUZ A;  1IKM A;  2RBM A;  1FNU A;  3MZ5 A;  3IKJ A;  3RLF A;  4QUC A;  1HUM A;  4MN3 A;  4OO1 H;  3CU7 A;  1B44 D;  1SEB D;  5KYL A;  1F2Y A;  3J81 L;  3FEW X;  3C3L A;  5HGT A;  1IYV A;  1IYU A;  4FYD A;  5CV8 A;  1MSG A;  4DN4 M;  3D6W A;  3A55 A;  3NP8 A;  1HQM C;  3VR4 A;  3URY A;  2WV6 D;  4RAU C;  2F0U A;  3KBX A;  3KLS X;  5CBA E;  4RGM A;  3GTO B;  1E0B A;  2F0F A;  2LS0 1;  3SHL A;  3EFX D;  2VNU D;  4ZAI A;  1ENC A;  3WDN A;  4A3J B;  1ET6 A;  3I4L A;  3R2I A;  4A3E B;  2XRQ D;  1H9J A;  1ILP A;  1PXU A;  1V1P B;  2NUC A;  2I46 A;  4DA2 A;  5CV6 A;  5C44 B;  4BY1 B;  2K5D A;  2NVY B;  4CGY B;  2MHV A;  4HR7 B;  1G6Z A;  3TP8 A;  1SNO A;  5IGB A;  1UUP A;  4CJ0 B;  4JK1 C;  4P2C B;  4WJW A;  3RZO B;  5M3F B;  3PO3 B;  2F0H A;  2JEB I;  2SEB D;  1CFM A;  1RTO A;  4RHR A;  5ELC A;  3SDZ A;  1HFG A;  2PPB C;  1R4Q B;  1KLU D;  2EY5 A;  1QJO A;  4DAV A;  2PW7 A;  1ZKO A;  1IHZ A;  4OIJ A;  1QE6 A;  1Q1E A;  1RTN A;  2F0E A;  5C0X G;  3PUX A;  1RD9 D;  1LV9 A;  2LY7 A;  3CHB D;  3QOL A;  1IW7 D;  4HSP A;  5JPM C;  3I70 A;  1BQQ T;  3NUC A;  2L0C A;  4H7B A;  1XXG A;  4ODG A;  2E74 C;  2XRS D;  1NSN S;  4YIJ A;  4BBS B;  4QUF A;  3OSO A;  3TDQ A;  3MEH A;  4RKB A;  4EGV A;  5NUC A;  1RF2 D;  5I9O A;  5KYI A;  4R8N A;  5ELF A;  2KEE A;  1TY0 A;  2B63 B;  3SR1 A;  3VR2 A;  5BN5 A;  3BVG A;  1LTR D;  3K5M A;  3ERQ A;  4K5X A;  2J7Z A;  3N52 A;  1BUV T;  2B2V A;  2K7V A;  5DEH A;  4C3J G;  3NSW A;  2CQA A;  3R8B A;  1C4Q A;  1D1K A;  1I4P A;  2EYM A;  1PZI D;  4XTC S;  2KQ3 A;  1VF7 A;  2NN6 G;  3JAM E;  1D5Z C;  4KI0 A;  1PTO C;  4O42 A;  1WD1 A;  2JYO A;  3DEP A;  3I3C A;  2ZXR A;  4RCN A;  2WAQ B;  1TS2 A;  4C1N I;  2B2Y C;  1HTP A;  3HS0 C;  1UNS A;  2K28 A;  2IL8 A;  1HUN A;  1EYD A;  2PCF B;  5IT9 L;  3NK9 A;  3EA6 A;  2MPM A;  4A3D B;  2FJ2 A;  5DM6 3;  4L63 B;  4FXK C;  1BNZ A;  1QCB D;  3A8K E;  1ONL A;  1NCV A;  2BA0 A;  3IAY A;  1NUC A;  2VUM B;  3HGB A;  1L0Y B;  2M00 A;  2BE5 D;  1QIL A;  1I4H A;  4H0L C;  2A73 B;  1CZG A;  1TS4 A;  2R6G A;  2KCN A;  3K6O A;  4HTH A;  1ICW A;  3HKZ B;  3UI2 A;  5K5P A;  4IAL A;  2F1M A;  1LTA D;  5D3D A;  4R8I A;  3DWQ A;  3NQI A;  4K2L A;  1TU2 B;  3NQT A;  1HXY D;  1O78 A;  4FF3 A;  1STE A;  2FIN B;  4QMG A;  4DAP A;  5ISR A;  1JWM D;  5D14 A;  3H91 A;  4HAE A;  3SK4 A;  4KTA A;  5COY A;  3T16 A;  3A8I E;  2EYL A;  2NYZ D;  3P1H A;  1H9S A;  4BY7 B;  2WAC A;  1UEA B;  3GTJ B;  5J22 A;  5CV4 A;  2MUY A;  2EJM A;  4XDX A;  2DN8 A;  2QCP X;  3HOX B;  5C4Z A;  4KN7 C;  2Z1C A;  3P20 A;  1GUW A;  1MGS A;  1Q1B A;  3OWE B;  5BN3 A;  5K36 G;  1K83 B;  1BR9 A;  4V0B A;  1CQV A;  2NTT A;  3T13 A;  4XT3 B;  3BVZ A;  1EIH A;  2AUK A;  2E2H B;  3OIQ A;  5FO7 B;  1O7Z A;  2D62 A;  2F0I A;  3J80 E;  2ICI A;  2SNS A;  5M3M B;  1EWH A;  3CRK C;  1B3A A;  1E2V A;  2F0W A;  3H3V C;  2PZT A;  1NR4 A;  2NBF A;  5EGT A;  4C56 C;  1QNU A;  3SK6 A;  2L12 A;  1LTI D;  2A68 C;  3TP5 A;  5EPL A;  2Z4I A;  3BS1 A;  1PZJ D;  4DK1 A;  4FF1 A;  1D1I A;  3MXG A;  2JA5 B;  5I6W A;  5DAU A;  1Z47 A;  1JOK A;  4L6T B;  5C0X H;  1A6X A;  4IZ8 A;  3U9O A;  3K57 A;  1B53 A;  4HCS A;  4KKU A;  3K0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...