1F2MA

Simplification of a protein loop in staphylococcal nuclease
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYAYAPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Simplification of a Protein Loop in Staphylococcal Nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f2mA00
2F0TA 4IZ8A 1SYDA 5I9OA 3EROA 4K8IA 1EY8A 2PZWA 1SNQA 2F0GA 3P1HA 4I65A 2SOBA 4EQPA 5I6WA 4K14A 4HMJA 2PQEA 3T16A 2F0FA 4LAAA 2KQ3A 3TP7A 4PNYA 1EY6A 5I6YA 4K5XA 4QB4A 4KV6A 2KHSA 4YIJA 5J39A 3D6CA 5NUCA 1RKNA 1STAA 2PZUA 1KDCA 4S3SA 1STYA 5KRUA 5C5LA 2EYFA 2WACA 3C1EA 3D4DA 3DHQA 5IGCA 4KJOA 1II3A 2EYPA 4N9PA 5JAVA 3MVVA 2PW7A 1A3TA 2SNSA 3TP8A 1TQOA 2F0UA 3D8GA 3NUCA 3SXHA 5HURA 5KIXA 1SNOA 1SNPA 4R8NA 5DAUA 1KAAA 2OEOA 5CR3A 3TP6A 3HZXA 4K6DA 4PMCA 5I9PA 2PZTA 5CV7A 1ENCA 5EKKA 5E3FA 2EYMA 2QDBA 2F0SA 5IGGA 1JOOA 1STGA 1EYAA 4TRDA 1SYFA 4EVOA 4EQOA 1EYDA 5KYLA 4ZUIA 3NK9A 5C4ZA 1A3UA 1NSNS 1EY5A 1EZ6A 2F0IA 4QMGA 4KD3A 1A2TA 1EZ8A 1TT2A 3TP5A 5K5PA 2RDFA 5ISRA 2M00A 1KDAA 2F0NA 1F2ZA 1A2UA 5CV5A 5CV9A 3MXPA 4ZUJA 5C3XA 4NMZA 2OF1A 4MIUA 4NKLA 2EYHA 4KTAA 5IOCA 3P75A 2PYKA 5KYIA 4NDXA 5J1ZA 2F0MA 5CGKA 2RBMA 2F0OA 3SR1A 5CV6A 3H6MA 3DMUA 2F0WA 1EY9A 2EYLA 4IUNA 4J6HA 1STBA 4ZQ3A 5KGUA 2EYJA 4RKBA 3MZ5A 2F0HA 1EY7A 5EKLA 3VA5A 1SNCA 3SK4A 2EXZA 2SNMA 1KABA 5IGDA 1TR5A 3ERQA 3R3OA 2F0EA 4B9WA 5IGFA 3QOLA 4EQNA 4KY6A 4KJNA 5C4HA 4KD4A 4DGZA 3E5SA 4H7BA 3MEHA 4PMBA 5C6AA 2NUCA 5CV4A 3T13A 5M9OA 3SHLA 2F0JA 5CV8A 2O4XA 2PW5A 2RKSA 3NP8A 5F2DA 5JOBA 5C5MA 3PMFA 4HTHA 1SYCA 2EY6A 2EY1A 3OSOA 4ID6A 5KEEA 1JOQA 1F2YA 3V2TA 5DEHA 2F0DA 3TMEA 3D4WA 3LX0A 1EQVA 2OXPA 4WRDA 3OMGA 4KY7A 1NUCA 4K2KA 2LKVA 5EGTA 1EYCA 1SYBA 1JOKA 2F3WA 4K5VA 4K8JA 4HMIA 1A3VA 4ME5A 1STNA 1IHZA 3SK8A 5E1FA 3SK5A 3ITPA 1EY0A 4RKLA 1SNMA 4F7XA 1SNDA 4OL7A 4ODGA 3NXWA 4NP5A 1JORA 3HEJA 5HGTA 2EY2A 4DFAA 4QF4A 2F0LA 1STHA 3QOJA 2F0KA 4F8MA 1KDBA 1SYEA 3MHBA 3QB3A 2EY5A 4K5WA 1F2MA 1AEXA 4G57A 4KY5A 4DF7A 1SYGA 3EJIA 3S9WA 1U9RA 3OMCA 5IGBA 1EY4A 3NQTA 4J1MA 3U9OA 3BDCA 3OWFA 4N9TA 5J22A 5IGEA 2F0VA 5C3WA 3SK6A 2ENBA 4DU9A 3RUZA 5CC4A 5IIFA 4KHVA 2F0QA 2EYOA 4K2LA 4E6IA 5IODA 2F3VA 2HQEA 4IALA 4WORA 4B9XA 3EVQA 1ENAA 3NHHA 2F0PA 3BDLA 3C1FA
chains in the Genus database with same CATH superfamily
2A1AA 1C48A 1S4ZA 2A68C 2VQEQ 4AIMA 3J7A5 4EQPA 1SRUA 4A3MB 1YNND 3HOWG 1N32L 3E9HA 4DR1L 1IKMA 4X66Q 2KHSA 5I2XA 4DV4L 1PVOA 1RKNA 4Y7NH 5C44G 4HCEA 4JI6Q 1EQRA 3I72A 1PRTB 2Q2UA 2BA0A 4A3IG 4BY7G 1TQOA 2F0UA 5GQOA 1I6VC 1Q86C 5L37A 5CR3A 1J5EQ 3AYHB 1QNKA 5EKKA 1RTOA 4IUVA 3IAYA 3P7JA 2D0PA 1WTOA 1RHPA 1WFQA 3MA2B 3M85A 4LW1A 1NSNS 1Y1WG 2JK8A 3G6JB 5G3LF 3NPPA 2RDFA 5COYA 1YIJA 2WKCA 4CBVA 1HQMC 4JW0A 4BY7H 1W6JA 1HNXQ 2NVQH 4DK1A 3KF6A 3CCVA 1DOMA 3MZ5A 1Y1WH 1EIYB 4LUZA 1JQYD 4OHJA 2Y0SB 5C44H 1YEZA 4JC0A 2E8GA 4IPDA 3HP3A 1LTLA 1ASZA 4FP5D 1W3SA 3NWTA 5EPKA 2QDLA 3IFTA 4A3GH 1VQKA 2B2UC 4APVA 1ZXTA 4B3RL 5C44B 3VDYA 4CKBA 2KBNA 4WJ3M 1GKHA 1VQOA 2IY5B 4DR6L 2YTXA 1A3VA 3PUVA 2NBFA 3ULPA 1H9KA 3QOJA 4KI0A 1TWHB 2N55A 1I5FA 4O1NA 2B39A 2DY8A 3U50C 1JJCB 4QY7A 4DV7L 3UE0A 1I50H 1YNNC 1PH4A 4KHVA 3UDGA 4RGTA 3EVQA 3FMCA 5JJIA 4C2MH 3J7YW 4CJ1B 2CHBD 4YHHL 1SNQA 1YNXA 3P1HA 1QNUA 2AUKA 1VQMA 1K73C 1XPRA 3RN2A 1SFOH 1BDOA 4MN3A 1PYBA 3GTGH 3HOWB 1PTOB 1E2VA 4YY3Q 2XN9C 4KV6A 5J39A 1U5KA 2NN6H 4S3SA 2WB1B 3E6ZX 3S16H 2EYFA 3LGJA 3EA6A 3PV0A 3AEVA 4KJOA 2UXDL 1Y1VB 2NVTB 4IFDI 4X62Q 3OYYA 5IP9H 4GOPC 2PPBC 5CV7A 1L0XB 1ILPA 2CVRA 2FFKB 3L9AX 1STGA 3MC0B 2R7ZH 4BBSB 4EVOA 3K7AH 4PZ8A 2OTLA 1X32A 2LXKA 2B3GA 3L7ZC 5D14A 4LNQA 2F0IA 3J81c 4KHPL 1A2TA 1EZ8A 4QQBX 3TP5A 3J80E 3C3LA 1XNRL 3HFZB 2LFNA 1EIFA 4G7HC 3P75A 2GVAA 3PIO3 2JA5H 1RJTA 4L5TA 3VR4A 4HIKA 3S2DB 1HZCA 2K5QA 3CQZH 4JOIA 5GAHC 3TSSA 4LF6L 4BY1B 4POGA 3U58A 3DM3A 1BR9A 3E9IA 4H7BA 1HNWL 2YU9B 5CV4A 2VUMH 3K81C 1AZQA 2I07B 1LT6D 2RKSA 3FDTA 5G3LD 4JI5Q 4DNRB 3GTKB 1NAPA 4UP9A 3S1MH 1CHQD 4OX9Q 4XIGS 2R93B 1WTHA 2F0DA 4LF9L 4JYAQ 4C3JB 3HKSA 2JN4A 3SE0A 1Y1VG 3D31A 1SYBA 4K8JA 2ZXOA 1G6ZA 1OTCA 1I4GA 2I5LX 3OOCA 5JEAG 4NP5A 4A3FG 1V8QA 1Y8OB 2EY2A 1IBMQ 2F0LA 2K75A 1AE2A 3TREA 2BE5C 5EJWA 4DF7A 4KY5A 4LMQD 2L15A 2H1EA 5IGBA 1X3GA 3ULLA 4DR5L 2QEJC 2QEXA 2JA7G 2UXBQ 1XX8A 2ZTEA 4DR2Q 2JA5G 4LF8L 3BJUA 4E6IA 5K36G 3RZOB 4DAYA 3FRPB 1K8AC 5TSSA 2QILA 4BBRB 1MHWC 3L3OC 4I7AA 3I4NH 2PZWA 1SMXA 5LMNL 4OIKA 3M7GA 3T16A 4A3KG 2MQHA 3KBXA 1EY6A 2ZTCA 4L5QA 1VCIA 3KLSX 4OGQC 3K6OA 4A3DG 1ESRA 4GOPA 4I7ZC 4IUPA 1TWCH 3TP8A 1VQ9A 2WAQB 2JEBI 4HJ7A 2OEOA 4A93G 4JPBW 3NEMA 2YTYA 4DV1Q 3QO2A 3GTMH 1HUMA 2X6LA 4AQYL 1X55A 5EQ0A 5K5PA 3MXPA 3W1GA 4DUZQ 1A0IA 2PYKA 4A3KH 2R3ZA 5BN3A 4NDXA 1PFNA 3G7LA 2CH4A 3TN2A 5IYBG 1NTGA 4C3JG 3VR6A 2QF7A 3D6WA 2UXCQ 5JJKA 4DV3L 4BA1I 2R93H 1I4XA 2A8VA 3ULJA 4EQNA 5A2QL 4KMUC 5ELCA 1EU3A 5C4XB 1HZBA 3GTLH 1L1OB 4CDDC 1S5CD 3CRLC 3T13A 2VL6A 5IE8A 2YU9H 4R4CA 3GDEA 4ID6A 2RA4A 1GM5A 1E2WA 3HOUH 1F2YA 3V2TA 3CQZB 5A2QE 4DV2L 1S72A 2ZM6Q 1L1OA 1VQPA 1JOKA 1U4LA 4WFN3 1A15A 1Q8IA 1CI3M 1CKNA 1FJGL 1IBLQ 4X3SA 3M4OB 1VS0A 1I3QB 4Q0FA 1CUKA 2EPBA 3UDIA 3K5NA 1YNJD 4P2CB 4A3GG 2EY5A 2TSSA 4GZYC 1EFID 1ICWA 1VQAA 4A3CH 3BDCA 3W2DA 5C0XH 1QZHA 1XMOL 2BH8A 3TDQA 1PRTF 3SVMA 1CT1D 1E0BA 1EOTA 3CCSA 3I55A 4LF4Q 1ET9A 2VXWA 1X6OA 4X6AH 1IBKL 2BH2A 1HR0Q 4IZ8A 2L12A 1DOKA 4JBKA 1HHVA 4B3RQ 1RDPD 2MO1A 2KQ3A 3BZDB 1JWUD 4LJZC 2MHVA 3S15H 4N8FA 5M5XH 5KRUA 2HQLA 3KBGA 3HOZG 4EQ5A 2LMCB 4IOCA 4ABNA 3F2BA 1NY4A 4RMFA 2EOTA 5HY6A 4GKJQ 2MGSA 3S1NH 4GKKQ 4R4OA 4IPCA 3PIOA 2K6AA 3HZXA 4ZRZA 1CQVA 1MD2D 4DV2Q 2QDBA 1BXTA 1OXVA 1HA5A 3K57A 1D1IA 3GTPH 1C0AA 3A7LA 1S5DD 4KTAA 2WB1G 1JB7A 3KDFA 5IP9G 3FKIH 3LWEA 2PNHA 1IYJB 2C5CA 2HT1A 2EYJA 3BDOA 1WYDA 3BVZA 4EGVA 3VA5A 3S15B 3I4OA 5LL6X 2B2TC 1IBKQ 3EQLC 3GV3A 2O4XA 2NVYH 2C35B 2GN5A 4JI4Q 4DN4M 1YNJC 2WKDA 2JA6B 4L5RC 3TS0A 2UUAL 2I0QA 2WIIB 2Z6BA 2AQ2B 3CC4A 2JXMB 2L5TA 2V1CC 4JBJA 1S5BD 1ZYRC 2E2DC 1EY0A 4RKLA 4KK7A 3G71A 2E74C 1RL2A 5E7NA 2MO0A 1SE8A 1AE3A 2B2UA 1XNRQ 5J3BA 4MNOA 2MJ8A 2RHQB 3IL8A 4KKTA 1Q81C 5I4DA 2RCNA 2E2HB 3U9OA 1WCMG 3R2IA 1HPCA 5J22A 3WOEA 1U4MA 3M7NA 4IUTA 3BZKA 1JE5A 2IHEA 3VA7A 4A3CG 4JI2L 4B9XA 1TWFB 4RCNA 5CBEE 1SYDA 3VYUA 4FF1A 3CXCA 4CJ2C 1H9JA 3GTLB 4JBWA 4LFAL 1KLUD 2ZXRA 4PNYA 5JPNC 2ZT9C 2P5ZX 1D6EC 3KF8A 2VUMB 4A3MH 1HJPA 4RG1A 4LF7Q 3PUZA 1HXYD 3QWNA 2EYPA 2HIVA 3S24A 1SE2A 5HURA 1B4OA 1HZ9A 4RGOS 1KIXA 2EJGC 2JA9A 1SMYC 2E2IH 4JBMA 1EYAA 4A3IH 1ICFB 3CMEA 2PQAA 5M3FH 2JA8H 2YYZA 2OTJA 4RGNA 1WVLA 2VQEL 5IYBH 5FO9B 1I6HB 3X3MA 2I5MX 4DAVA 1I3QH 2UUBQ 4P74A 4YCVA 1MGSA 4B08A 1SN8A 1PFSA 2FXQA 3J7AV 4FO2A 4M8AA 4DR6Q 1Z9FA 1A6XA 1UEBA 2F0HA 3GO5A 3A5UA 2D2CC 3I8ZA 4R4TA 1XYIA 2I5HA 4C3HG 4JI2Q 2ATWA 3A74A 4ZAIA 3PO3H 1XNQL 1VMCA 2NYZD 1G2SA 3HOWH 2DNCA 3TZDA 3UDFA 4A76A 1YHQA 2K5NA 1CQFA 4LFAQ 1U4PA 2K52A 4RCOA 1SFOB 2OQ0A 1TS4A 4X3KA 3PUXA 3CW2C 3FKIB 4MTKA 1EQVA 1KC8C 3OMGA 2PI2E 3MTSA 1E2ZA 3FHWA 1NCVA 4RAUC 1PH3A 4DA2A 5M5WB 4IURA 3HG9A 1P16A 3IFDA 3I73A 4O42A 1W2BA 3MHBA 2K5HA 4G57A 1AEXA 2XRSD 1PH5A 2A6EC 3GP7A 3OMCA 1TWHH 1IL2A 2CKZB 1WCMB 5D3IB 4CHTB 1QUQB 2JA7H 3Q6SA 1AP0A 4X3TA 4DU9A 1MKHA 2IHFA 5IIFA 2UXCL 1KAWA 3S1RH 1YBYA 3A5ZB 2VB3X 4A3BG 1EWHA 4DGZA 1VQ4A 1G6PA 3C1FA 3JAML 3MAQA 2E2JB 2FMCA 5I9OA 3K5LA 2F03A 4YCUA 3MFGA 1B53A 3RZDB 3AMUA 4JI3L 3I90A 3DWAA 3MVVA 1Y1WB 4DR4L 4ZKCB 1MBYA 4XDXA 3T51B 4PMCA 4NXNQ 1K9MC 1F9RA 2E5LQ 3VR5A 2PO4A 4TRDA 5C3EH 2HD3A 1YJ9A 1SYFA 3NTIA 3ER0A 1VDZA 1JCKB 2CWAA 4ZUIA 3NK9A 5EBDA 1K28A 4DK0A 4NXMQ 1BNZA 2E76C 1J8IA 1TT2A 2M00A 2XGTA 3TZUA 1N34L 1E22A 5CV5A 3ONAB 3KLSA 5CV9A 1X3EA 2OF1A 2F4VQ 1X3PA 5FLMH 4GNXC 2ZJPA 2RBMA 4XXEA 5LL6S 4A3MG 3KDFB 1QVFA 4TSSA 4DXGA 2A5HA 2CCZA 2A6ED 2O5JC 4C3IB 1NJIC 4IQZA 1MIUA 1SAPA 4XYQA 5C5MA 4A3DB 1SYCA 1BQQT 3KK7A 1T9HA 4RA8A 4BY1H 1JJGA 3BVGA 2IX3A 1E1TA 5LMUL 1YI2A 1CZWA 1DD2A 1UE1A 1XWEA 2F3IA 3C46A 1EQQA 3PGZA 3T1YQ 3NBHA 1WOCA 2NZOA 1HTLD 3CCQA 1HNZQ 4B3ML 2NTTA 4F8MA 2F4IA 1CA6A 4HIDA 1F77A 4K5WA 3S9WA 1STEA 1RCVD 3EJIA 3ZJYC 1YHAA 2NZ1D 3NELA 1FNUA 2K33A 3K7AB 4HR7B 4H0LC 2PCFB 4FF4A 3HKZB 4GN5A 3R93A 3SK6A 2N88A 4BA2I 1TWCB 3DEOA 3S2HH 1Q8KA 3PO2B 3UDXA 5CMDA 4UAIA 1OXTA 5JPMC 3K58A 1PYSB 2NVYB 3A8JE 4CDCC 1JWSD 3HOXB 4L63B 1B44D 1D5ZC 2CH4W 1ML0D 1FL0A 1PTOH 2WB1E 3M3YH 2UUAQ 3PCOB 2FMMA 4G7ZC 1EUJA 2WACA 1PLFA 3DHQA 4OEMB 2ZTDA 3H0GG 2BDNA 2ZJRA 1CKMA 2LXJA 3PF4A 1JB3A 1JC7A 5LMUQ 1E3PA 4IJLA 4MZ9A 4JV5Q 5IGGA 3T1YL 3CAMA 1MJCA 5KYLA 2E2HH 3J80c 1FYCA 3IKJA 4UP7A 2KCMA 4DR3L 1EY5A 1EEFD 1VQDA 4DV7Q 3TBIB 1F2LA 3L0OA 3ND8A 4DV5L 1KD1C 5IOCA 1FNVA 1JICA 1NE3A 1SJHD 5J1ZA 2XNAC 5CV6A 2QCPX 1PA6A 5KGUA 4FXDA 1MSGA 5EKLA 5EPLA 3GTJH 2Z6KA 3M3YB 1LACA 4QUCA 4KY6A 2VW9A 2YTVA 3HOXH 1LV9A 5M3MG 2K01A 4RWSC 3RLNA 1NMFA 1M1KC 4B3SQ 3E0JA 4RGMA 5E4WC 4LFCQ 2X69A 4JVZA 2A73B 5C3EG 3S2DH 1L2FA 3LNNA 3F1ZA 4LF5Q 2EVBA 4PZ7A 2CWPA 1K3BC 5BR8Q 1BCPB 1GD7A 3PF5A 4LWCA 1PH6A 1F9PA 1HR0L 3NXWA 3F2DA 3HEJA 2H4OA 1WCMH 4ME3A 2FJ2A 4FVMA 4C56C 4QIWB 5FKAC 1K0RA 1LT3D 4DR1Q 3C2PA 3KJPA 1NR2A 2A68D 2UUBL 1D1KA 3MXNA 3QIAA 1PZJD 1UNSA 3MXUA 4G7OC 1BO0A 5DM73 1GUSA 3OIPA 1K8GA 4WJWA 2B2TA 2IX1A 1DCZA 2K1BA 4DNIA 4A3EG 4DKAC 3S16B 2IWHA 4YWMA 3MXNB 4K8IA 1VQ8A 1B9MA 4HMJA 4A3LG 1SLJA 4JI5L 3J81L 3S1QB 4JYAL 4A3JH 1O78A 4QIWE 1HUNA 1QVCA 1OXXK 3N6RA 5JAVA 1OO9B 1A3TA 2BCOA 1TY0A 5KIXA 3J81j 3D8GA 5IYCG 4B3TL 2ASBA 4R8NA 2JA5B 3PSIA 3TP6A 1ENCA 5E3FA 4ZLTF 1D7QA 1V1PA 2EYMA 2F0SA 5CBAE 4NPSA 1BBWA 1ONLA 4EQOA 2N8NA 2IX0A 3KF6B 3A8KE 1K8OA 4K6LA 1V1QA 1PTOF 2R7DA 4A93H 2RQXA 3CC2A 1SDFA 1B3AA 2JP1A 3NWSA 4YWLA 1NMGA 4DR5Q 2RCFA 2K7VA 4GS3A 5C3XA 2JYOA 1W6KA 4FYDA 1TS5A 2L9HA 1IL8A 1B9NA 3KOJA 4JCVE 5IP7G 1IYUA 3SGIA 2MP1A 1QZGA 1YZ6A 2A69C 2R61A 2IJ0A 3NBIA 2OT2A 2UUCQ 1EY7A 3RZDH 1SNCA 2K04A 5IGFA 3HOZH 3ERQA 1FGBD 1LTID 4ZCKA 5ELEA 4GKKL 1LTBD 4A3GB 1J5EL 3EBEA 3V05A 3DUZA 2K05A 3PIP3 1O7IA 1BCPC 4HTHA 4XQJA 3I4NB 2EY6A 2KCNA 2HCCA 2B63B 3VYRA 1ZEQX 4NXNL 4R4IA 4F88A 2FINB 4ZK9B 4K5VA 1EQTA 2LS01 1IHZA 1V9PA 2Z4HA 2RDGA 4IN3A 1RTNA 4CDFC 1HR0W 2R7FA 1GUTA 4A3FH 4HJ5A 3QB3A 1EU4A 3EIVA 4CKCA 4X64L 1HTPA 1CHPD 2A19A 2EZVA 1PH8A 2F4VL 2N49A 3GTQH 2ENBA 3HOVB 1VQLA 1SE4A 2PI2A 2Z0SA 1X9NA 1ENAA 5ELOA 3BDLA 4GN3B 5ELNA 4JOIC 3S1MB 3K8AA 4DUYL 3HOUG 5GAGC 2KEEA 4M1UB 1BKBA 5ELDA 3STBC 1SROA 4GLVB 1U0LA 3UE1A 1EEID 4DV6L 5NUCA 2R93G 4HJ8A 2QA4A 3PO2H 2DJGC 1WTQA 3W5OA 5IGCA 4OELB 4IJHA 1EIHA 1X3FA 1LM0A 1RIPA 3S1RB 1FGUA 1T5EA 4H44C 4K6DA 3H15A 1UEAB 5KNCA 2JA8B 3PIPA 3LWUA 1Y14B 4OIJA 2RSNA 1HNWQ 2WAQE 4LUVA 1EZ6A 2Q2TA 2CQAA 5C4XG 4ZKBB 4IO9A 4P73A 2MFIA 3P20A 1FVIA 4DR7L 1PRTD 2F0MA 2MPMA 2DNEA 5BN5A 2EYLA 1LTAD 4ZQ3A 3FKIG 2NB0A 4R1JA 3CCJA 3K80C 2R92B 1VF5C 1ENFA 2CFMA 1D2BA 4A3DH 2XSCA 4A3LH 2Y0SE 1DYQA 3QOLA 3ICEA 4Y7NB 5C4HA 2CW0D 2WAQG 4XT1B 4X62L 1VQEA 5ELFA 2I46A 4MTNA 3BYYB 2EY1A 3NTKA 2SEBD 1XTDA 4JI8Q 3PO3B 1QB5D 1GOZA 5M5YB 4GKJL 4MHEA 3D4WA 1UUPA 4P72A 4ALPA 3Q8DA 2Q2IA 1N32Q 1Q82C 1CA5A 1EOVA 4QJFA 1WD0A 2E75C 3I56A 4Q5VA 3IRBA 5JVH3 1ASYA 1LTTD 1LTGD 4HSVA 5GAEC 3J7ZC 2UU9Q 1O7ZA 4LF6Q 4JI3Q 3A56A 2EJFC 2KA7A 2GA4B 5C3WA 3Q24A 2E2IB 2EYOA 1XMQQ 2EXDA 2KCTA 1Y1VH 1C4QA 1TU2B 5FO8B 4OX9L 2HUGA 5C4JB 1B1ZA 4DR7Q 1DJRD 4HSPA 4GLXA 2KCCA 3AFPA 4I65A 5BN4A 1L0WA 1HH2P 3TS2A 2VUMG 3GQBA 3CPFA 3KYHC 2RF4A 3TP7A 3CHBD 3MXGA 3A55A 4AH6A 3WWVA 4IOAA 2QGQA 4HJAA 3M4QA 4J8QA 4N9PA 5LHY1 1FR3A 4QL5A 1QOHA 2SDFA 2EDGA 5FJ8G 1DM0B 1PH9A 2O5IC 3GTQB 2JA7B 3HKZE 2OQKA 1GO3E 1JOOA 1Y8PB 2Z6KC 1WTPA 4L6TB 1XPUA 1GUOA 3K5MA 3I70A 2D9UA 4K0KQ 4C1NI 4X66L 4QMGA 2Q8RE 3HOYG 1RF2D 1BCPF 1VF7A 5LMNQ 4V190 3MWYW 3KLWA 4TQUS 3KF8B 5KYIA 3SR1A 4DAYB 3NENA 2AHOB 1TKWB 4J6HA 1UWVA 2AKWB 2B2WA 2IT1A 2FHTA 3J80L 2JA6H 5GADC 4B9WA 1K3RA 4JK1C 1QJOA 3U4VA 4JI7Q 3SHLA 1SMYD 1TWAH 5JOBA 3HOZB 1IW7C 3PMFA 5FK9C 3OSOA 3E0EA 3S17H 3BG3A 1XMOQ 1HA6A 3F2CA 1NR4A 4YHHQ 1R9TB 4AYBE 4RFBA 4HAEA 1TS2A 4HMIA 1STNA 5HGQA 3ITPA 4X3UA 4X65Q 3TRZA 4OL7A 1CM9A 3DM1A 3PO2G 1N8RC 1STHA 1E7ZA 3GTPB 4A3BB 4FXKC 5FOBB 4DXFA 2VB2X 1X54A 4ZYSA 4A3EH 3AQQA 3E3XA 3NQTA 1BBUA 1M8AA 3OWFA 2UXDQ 3S14H 4RH6A 3CCLA 1UAPA 2PMZE 3I4NG 5M5WH 2UUCL 5ELBA 5T1IA 2HDMA 2VQFL 2F0PA 4A3JB 2X6GA 4FF3A 5IY0A 3A8IE 3MFYA 2SOBA 2LY7A 1A63A 4XTCS 1PXUA 2Q8TA 3EN2A 1E24A 3HOXG 2JSOA 3WDNA 5I6YA 3DWPA 1WTRA 3MEFA 4BBRG 1CKNB 3RR5A 3B6YA 1EFWA 5DAUA 4L5SA 5I9PA 2D0OA 1XPOA 2Y0SG 3NTHA 2XWJB 5C0XI 1IW7D 3J80i 4IUQA 3ND9A 3S14B 1UE6A 4LF4L 5E4XA 2B8FA 1WJJA 5LMNW 5AJ3Q 1DXMA 2HHHQ 1I6HH 2B2VC 4O2DA 1WD1A 3FVQA 2Z8LA 4YY3L 5M3MB 4R4QA 3GTMB 2C9OA 2ES2A 1PZKD 1KDAA 4UPAA 3BZCA 3RLOA 1AH9A 4NMZA 4GLAC 2J4XA 5T1GA 1I4QA 2CQOA 2NVTH 4IFDG 3GD7A 4L8JA 1F9QA 2OWOA 1KABA 5IGDA 1Z6HA 3URYA 3HOUB 2RDHA 3W3AA 5C6AA 1Y69U 2NUCA 1MI2A 1RODA 1ZYRD 2Q2HA 1LLRD 5H1SE 1Q1EA 4AYBB 3NBHB 1X65A 5EKIA 1KRTA 3SDZA 4DR4Q 2NVQB 4A4IA 5E1FA 3OHXC 3M9BA 4XT3B 1V43A 3DWQA 2YV5A 4P75A 4A3JG 4QF4A 1D5MC 1EL0A 1F9SA 2F0KA 2KENA 3GV6A 4UY8C 1I94L 3HOVG 2EIFA 1EY4A 1FNWA 1VQFA 5IYDG 4BXXG 3S1NB 1VQIA 4K2LA 3ZYYX 4FXGC 3VYTA 1ZKOA 1HNXL 2BE5D 3F2UA 1S3OA 3GTOB 3EROA 2K5VA 5M5XB 4OO1G 1IZ6A 3CU7A 4K14A 5BR8L 4NW2A 2F0FA 1NBWA 3I3CA 3PQIA 3RLFA 1QWYA 1SJED 4HEDA 1UE5A 4N8X1 5JVG3 5C5LA 4R8IA 2DY7A 4DV3Q 4XYOA 4YWKA 5KNDA 5FLMG 2JA8G 5M3FG 1N36L 1BUVT 2B8GA 3AFQA 3K0YA 4OWWB 3HOYH 5M3FB 2G9HD 4OXPA 1XNQQ 1SR3A 2K5DA 4A3IB 3R2TA 4GOPB 5IWAQ 3PUYA 1MJEA 5KNBA 2N78A 2F0NA 1HCZA 1GHKA 4NKLA 1TS3A 1K0SA 3CF5A 5DM63 1Q90A 1L1OC 3T1HL 2NVXH 1B2TA 3N52A 4RKBA 1JJ2A 4LF7L 1QUQA 4R9WA 5M5YH 1JWMD 2F0EA 3CCRA 1L0YB 1XTCD 1CSPA 2DJFC 3H0GB 4X64Q 4AQYQ 2F0JA 1PYWD 1KTKA 2Z1CA 3HS0C 2WINB 5KEEA 1JE4A 2MNAA 2XVSA 1TWFH 1WTWA 1K8MA 2R92H 1AN8A 4WRDA 2ZXPA 4KY7A 1NUCA 1KQSA 1QVGA 4ME5A 1QILA 3A7AB 2KECA 2AQ3B 1PFBA 3SK8A 2VNUD 4WJ4A 1E1OA 1O80A 5GROA 5C0XJ 4JG2A 2O2LD 2B2YC 4NB3A 5DLQE 4DAPA 1J9OA 1VQ7A 1U9RA 3G4SA 1EIGA 4J1MA 2AQ1B 4A3BH 4N9TA 2KHIA 2F0VA 5IT9c 4BXXH 5IWAL 3J7AF 3I91A 5CC4A 2WV6D 4UP8A 3I4MB 1M90C 1VQ6A 3R8BA 4IALA 2HQEA 1I4PA 4G4KA 3DXJC 4C3IG 1IBLL 1G91A 1MSHA 1OXUA 1EY8A 2F0GA 4JI1Q 2NN6I 2PQEA 4JI7L 4OWXB 3OTOQ 5EAYA 1TWGH 3FP9A 1G8ZD 4FDBA 1VQJA 4NXML 4K5XA 4PG3A 3F8TA 4AYBG 1PH2A 3PO3G 5C4XH 2R6GA 2XTIA 2E2JH 3W1BA 4BWGB 4P71A 2K03A 4UHVA 2IW3A 4IPGA 1LTSD 3GTOH 4C2MB 4X65L 4BY7B 4YCWA 3OWEB 1LT5D 1C7YA 1I50B 2HCIA 1Q3LA 4XQNA 2WFWA 3RN5A 3HGBA 2K4KA 2QKIC 2EE1A 4LK1C 5C4ZA 5IT9L 3X3NA 1HFGA 1GVPA 4GNXA 4A3FB 3CMAA 3BU2A 1F2ZA 1KXLA 2BOSA 4JI8L 2VY3A 5CGKA 4KLKA 2Z4IA 5JJZA 3D0FA 3I2ZA 4DV6Q 3JAMi 1PV4A 2K14A 2NWGA 3SK4A 3GTKH 2B63H 1TR5A 3OW7A 1BBXC 1HNZL 3NE5B 4GNXB 4KJNA 4KD4A 3E5SA 4PMBA 3VYSA 3NSWA 5FO7B 4DK3C 3BYTB 1GJXA 1EYGA 5CV8A 4JI1L 2E5LL 3VR3A 5I2YA 2K28A 3FPPA 4CDEC 1JOQA 1A62A 3Q23A 3I7FA 3NQIA 3TMEA 4B3TQ 4BBRH 1JMCA 1D8LA 2OXPA 4CGYB 3CRKC 1XMQL 2D5DA 1Q12A 5JEAH 2QW7A 1FD7D 4XQQA 1HRJA 5AJ3L 3QG1A 4ODGA 2KVMA 1R4PB 4H02A 4TKOB 4UDUC 4HN7A 5M3MH 2A69D 4HCSA 1CFMA 2M9VA 3M4OH 4BBSH 2R7ZB 2ICEC 4EX5A 1WTXA 4GN4B 1O7LA 5IGEA 2L11A 2K5WA 3DEPA 3G6EA 4V0BA 5FLXE 3EFXD 1BCPD 1R9TH 2AWNA 4U68A 4OWTB 2A74C 3CC7A 3NHHA 1GUWA 5CYUA 2RSOA 2F0TA 3CP0A 4FF2A 5JEAJ 5IP7H 5I6WA 1H9RA 3S1QH 2DUDA 3H09A 2DGYA 4LAAA 1H9MA 2B2VA 2JJQA 1B70B 1ET6A 3K5OA 4QB4A 2G5DA 4KN7C 3D6CA 1WTVA 2A6HC 1J6QA 4DV5Q 3D4DA 1KL9A 1II3A 1Q1BA 2K50A 2F52A 1TIID 1SSOA 2PW7A 2F1MA 2UU9L 1PHJA 1CZGA 3SXHA 2G9DA 1SNOA 1SNPA 2JQOA 5AFWA 4LFBQ 3U9SA 3L2PA 3CKIB 2KHJA 2V4DA 1RD9D 1PH1A 1CKOA 4LUOA 4KKSA 3HRZC 4LF9Q 1A3UA 4B3SL 1Y8NB 3I4LA 3HOYB 4C3HH 1JT8A 2N3SA 1A2UA 1YJNA 1K83B 2EQSA 5EBCA 4HIMA 4MIUA 3JC66 3STBD 4JI0L 3RNUA 2F0OA 2L0CA 4Z9CB 2B29A 4HJ9A 3DMUA 2RVLA 1IBML 1QE6A 1VQBA 1PDQA 3D4RA 3T56B 1ILQA 2XIWA 2B2WC 1SBBB 4FNFA 1TWAB 2XRQD 3NP8A 3VR2A 1I4HA 5FJ8H 4QUFA 1CK1A 1KHIA 2JEAI 3HKZG 5C4JH 3H3VH 3KUPA 4JI6L 4K0KL 3RZOH 1PH7A 1WI5A 3I4MH 5IT9E 4K2KA 5EGTA 2RHSB 2VQFQ 1VQGA 5JJLA 1K83H 2K32A 3SK5A 4F7XA 1SNMA 5C0XG 5FLXc 5CORA 2LSSA 2A6HD 3KFUA 4LFBL 1KDBA 1SYEA 2MUYA 1KNEA 4TVAB 1N9WA 1ESFA 1SYGA 3H94A 1LT4D 2M2LA 1HFNA 1JR0D 1SEBD 5D65A 2R92G 1LO5D 3FEWX 3OPOA 4RHRA 2F0QA 1CTMA 1YVCA 5IODA 2Z9HA 2ZJQA 3J81i 2PNRC 3V96A 1TXYA 4DV0L 1B3QA 4JI0Q 1AW7A 4KN4C 1A8VA 4DK6C 3U4ZA 4F87A 3CCEA 1V1OA 2HHHL 1H9SA 1O7YA 1NNXA 4YIJA 4QCLA 2B63G 1P8LA 1STYA 1U4RA 1Q7YC 3PUWA 1BOSA 2PMZB 4LF8Q 1DGSA 1KNAA 1VQCA 2SNSA 3NUCA 4DNTB 1AZPA 2WP8J 3I4MG 1KAAA 1XJVA 4IFDJ 3TQYA 1Z7TA 2KOLA 2PZTA 3OW2A 3JAMc 2AWOA 2KJXA 2IL8A 1M4VA 2H5XA 2R7ZG 1AFPA 5FLXL 4IPHA 1EYDA 1Z47A 4A93B 1IXRA 1KRSA 3JAME 2ZM6L 4ILWA 4DAMA 2HIXA 4CKEA 5ISRA 1CSQA 2ID0A 1G51A 3Q0AA 2EYHA 1GHJA 1GXDC 3H6MA 1IYVA 4IUNA 1EY9A 2NN6G 1PMRA 2NTSA 3S17B 3O13A 3TEHB 2EXZA 2SNMA 3DLLA 3R3OA 1TVXA 1SXTA 4OO1H 3GTGB 4DV0Q 3MEHA 2NZHA 1VMPA 1S40A 5M9OA 2PW5A 4OO1I 3D3RA 2L1BA 1V1PB 4C3IH 3K59A 1XXGA 3BVMA 4DUZL 3SEBA 1G291 1VQHA 2DN8A 2XWBB 3CCMA 2IPKD 2AMCB 4A3KB 1EYCA 1S5ED 4ULLA 3HOVH 3AU7A 1D5XC 2TMPA 3K7UC 1SNDA 3KJOA 2ICIA 1HQRD 5HGTA 1UE7A 2AUJD 4IUUA 3T4AC 3CPWA 4PV1C 3K0XA 1DZ1A 4BBSG 4KHPQ 3RMHA 5C3EB 4A75A 2L55A 2KEDA 1N33L 4PZ6A 4JV5L 4IFDH 5A35A 4PMWA 3RD4A 4O0AA 2F3VA 4WORA 1PTOC 1QCBD 3OIQA 1FJGQ 1N36Q 5EPJA 1LUZA 1VQ5A 4BY1G 4B3MQ 4U673 1YJWA 1DONA 3H91A 1GUGA 1TWGB 4J15A 1BVSA 3Q22A 1STAA 1R4QB 2PZUA 1KDCA 2BDOA 3QJYA 1T5XD 1GUNA 1S5FD 3C1EA 3GTJB 1OXSC 3G48A 4H13C 1I94Q 1Q46A 4BS9A 3T1HQ 1QG7A 2HDLA 4C3HB 1C8CA 3J81E 1DOLA 1LABA 3AB9A 1PRTC 3KLRA 4POFA 2ALYB 2L4NA 1LYLA 2VZAA 1TY2A 3A0JA 4LF5L 1YITA 4DUYQ 4KD3A 2JE6I 4HIOA 4ZUJA 1HZAA 2CW0C 1LTRD 2EJMA 4CJ0B 2Q8IB 3UI2A 4OONA 3A54A 2J0TD 4C3JH 2BA1A 2F0WA 2PQAB 1STBA 2GVBA 1N33Q 3BS1A 3M4YA 5DNFA 2UXBL 4DR2L 3H3VI 4C1NK 4RHSA 3WOFA 1B50A 4DV4Q 2KUMA 3ERSX 3H0GH 1SE3A 2VS1A 4DR3Q 1C9OA 1PFMA 4Y52H 1PZID 5F2DA 3FPUB 5IYCH 1PTOD 1YHBA 5D3DA 5DEHA 2NVXB 3LX0A 1H95A 2LKVA 1EWCA 2F3WA 3CD6A 3S2HB 1G2TA 2D62A 5IYDH 2OCEA 4DPGA 1VQNA 1JORA 4A3EB 4PQXA 4DV1L 4QGUA 4DFAA 3OTOL 1H9SB 1X56A 1F2MA 3T53B 2B2YA 4KHZA 3H3VC 4LFCL 1BF4A 2JA6G 4JI4L 3M4PA 1B8AA 1IKLA 1X3QA 1EWIA 1N34Q 1I4RA 3RUZA 4KKUA 1KLGD 3CCUA 2J7ZA 1B7YB 5K36H 3QR8A
chains in the Genus database with same CATH topology
1C48A 1S4ZA 2A68C 4EQPA 4A3MB 1YNND 1IKMA 2KHSA 5I2XA 1RKNA 4HCEA 3I72A 1PRTB 2BA0A 1TQOA 2F0UA 1I6VC 5CR3A 1QNKA 5EKKA 1RTOA 4IUVA 3IAYA 3P7JA 1WTOA 1RHPA 3MA2B 3M85A 1NSNS 3G6JB 5G3LF 3NPPA 2RDFA 5COYA 2WKCA 4CBVA 1HQMC 1W6JA 4DK1A 1DOMA 3MZ5A 1JQYD 4OHJA 2Y0SB 3HP3A 4FP5D 3NWTA 5EPKA 3IFTA 2B2UC 1ZXTA 5C44B 4CKBA 1A3VA 3PUVA 2NBFA 1H9KA 3QOJA 4KI0A 1TWHB 2N55A 4O1NA 2B39A 2DY8A 1YNNC 4KHVA 4RGTA 3EVQA 3FMCA 3J7YW 4CJ1B 2CHBD 1SNQA 3P1HA 1QNUA 2AUKA 1BDOA 4MN3A 3HOWB 1E2VA 1PTOB 2XN9C 4KV6A 5J39A 2NN6H 4S3SA 2WB1B 3E6ZX 2EYFA 3EA6A 3PV0A 4KJOA 1Y1VB 2NVTB 4IFDI 2PPBC 5CV7A 1L0XB 1ILPA 2CVRA 2FFKB 3L9AX 1STGA 3MC0B 4BBSB 4EVOA 1X32A 3L7ZC 5D14A 2F0IA 1A2TA 1EZ8A 3TP5A 3J80E 3C3LA 2LFNA 4G7HC 3P75A 3PIO3 1RJTA 3VR4A 3S2DB 2K5QA 3TSSA 4BY1B 1BR9A 4H7BA 2YU9B 5CV4A 1AZQA 2I07B 1LT6D 2RKSA 3FDTA 5G3LD 4DNRB 3GTKB 1NAPA 1CHQD 4XIGS 2R93B 2F0DA 4C3JB 3SE0A 3D31A 1SYBA 4K8JA 2ZXOA 1G6ZA 1I4GA 3OOCA 5JEAG 4NP5A 1V8QA 1Y8OB 2EY2A 2F0LA 2BE5C 5EJWA 4DF7A 4KY5A 4LMQD 2H1EA 5IGBA 2QEJC 1XX8A 4E6IA 5K36G 3RZOB 4DAYA 3FRPB 5TSSA 2QILA 4BBRB 3L3OC 2PZWA 4OIKA 3M7GA 3T16A 3KBXA 1EY6A 1VCIA 3KLSX 4OGQC 3K6OA 1ESRA 4I7ZC 4IUPA 3TP8A 2WAQB 2JEBI 2OEOA 3QO2A 1HUMA 2X6LA 5EQ0A 5K5PA 3MXPA 2PYKA 2R3ZA 5BN3A 4NDXA 1PFNA 3G7LA 3TN2A 4C3JG 3VR6A 2QF7A 3D6WA 4BA1I 1I4XA 4EQNA 5A2QL 4KMUC 5ELCA 1EU3A 5C4XB 1S5CD 3CRLC 3T13A 4ID6A 2RA4A 1E2WA 1F2YA 3V2TA 3CQZB 5A2QE 1JOKA 1U4LA 4WFN3 1A15A 1Q8IA 1CI3M 4X3SA 3M4OB 1I3QB 4Q0FA 2EPBA 3K5NA 1YNJD 4P2CB 2EY5A 2TSSA 4GZYC 1EFID 1ICWA 3BDCA 3W2DA 5C0XH 3TDQA 1PRTF 3SVMA 1CT1D 1E0BA 1EOTA 1ET9A 2VXWA 4IZ8A 2L12A 1DOKA 1HHVA 1RDPD 2KQ3A 3BZDB 1JWUD 4LJZC 2MHVA 5KRUA 3KBGA 2LMCB 4ABNA 2EOTA 2MGSA 2K6AA 3HZXA 4ZRZA 1CQVA 1MD2D 2QDBA 1BXTA 1OXVA 1HA5A 3K57A 1D1IA 3A7LA 1S5DD 4KTAA 3LWEA 2C5CA 2EYJA 3BDOA 4EGVA 3BVZA 3VA5A 3S15B 5LL6X 2B2TC 3EQLC 3GV3A 2O4XA 4DN4M 1YNJC 2WKDA 2JA6B 2WIIB 2AQ2B 2JXMB 2L5TA 1S5BD 1ZYRC 2E2DC 1EY0A 4RKLA 4KK7A 2E74C 2B2UA 2MJ8A 3IL8A 4KKTA 5I4DA 2E2HB 3U9OA 3R2IA 1HPCA 5J22A 3WOEA 1U4MA 3M7NA 4IUTA 3VA7A 4B9XA 4RCNA 1TWFB 5CBEE 1SYDA 3VYUA 4FF1A 4CJ2C 1H9JA 3GTLB 4JBWA 1KLUD 2ZXRA 4PNYA 5JPNC 2ZT9C 3KF8A 1D6EC 2VUMB 3PUZA 1HXYD 3QWNA 2EYPA 1SE2A 5HURA 1B4OA 4RGOS 2EJGC 1SMYC 1EYAA 2YYZA 4RGNA 1WVLA 1I6HB 5FO9B 3X3MA 4DAVA 1MGSA 4B08A 3J7AV 4FO2A 4M8AA 1A6XA 2F0HA 3GO5A 2D2CC 3I8ZA 1XYIA 4C3HG 4ZAIA 1VMCA 2NYZD 1G2SA 2DNCA 3TZDA 1CQFA 1U4PA 1SFOB 4RCOA 1TS4A 4X3KA 3PUXA 3FKIB 1EQVA 3OMGA 3MTSA 1E2ZA 1NCVA 4RAUC 4DA2A 5M5WB 4IURA 3HG9A 3IFDA 3I73A 4O42A 3MHBA 4G57A 1AEXA 2XRSD 2A6EC 3GP7A 3OMCA 5D3IB 1WCMB 4CHTB 1AP0A 3Q6SA 4X3TA 4DU9A 5IIFA 2VB3X 1EWHA 4DGZA 3C1FA 3JAML 3MAQA 2E2JB 2FMCA 5I9OA 3K5LA 2F03A 3MFGA 1B53A 3RZDB 3AMUA 3I90A 3DWAA 3MVVA 1Y1WB 4ZKCB 1MBYA 4XDXA 3T51B 4PMCA 1F9RA 3VR5A 2PO4A 4TRDA 1SYFA 3NTIA 1VDZA 1JCKB 4ZUIA 3NK9A 5EBDA 4DK0A 1BNZA 2E76C 1J8IA 1TT2A 2M00A 3TZUA 5CV5A 5CV9A 3ONAB 3KLSA 2OF1A 1X3PA 2RBMA 4XXEA 5LL6S 4TSSA 4DXGA 2A5HA 2A6ED 2O5JC 4C3IB 4IQZA 1SAPA 4XYQA 5C5MA 4A3DB 1SYCA 1BQQT 3KK7A 4RA8A 3BVGA 2IX3A 1CZWA 1DD2A 1XWEA 3C46A 3NBHA 1HTLD 2NTTA 4F8MA 2F4IA 1CA6A 1F77A 4K5WA 3S9WA 1STEA 1RCVD 3EJIA 2NZ1D 1FNUA 2K33A 3K7AB 4HR7B 4H0LC 2PCFB 4FF4A 3HKZB 3R93A 3SK6A 2N88A 4BA2I 1TWCB 3DEOA 3PO2B 5CMDA 4UAIA 1OXTA 5JPMC 3K58A 2NVYB 3A8JE 1JWSD 3HOXB 4L63B 1B44D 1D5ZC 1ML0D 1PTOH 2FMMA 4G7ZC 2WACA 1PLFA 3DHQA 2BDNA 1JB3A 1JC7A 5IGGA 5KYLA 1FYCA 3IKJA 1EY5A 1EEFD 3TBIB 1F2LA 3ND8A 5IOCA 1FNVA 1JICA 1SJHD 5J1ZA 2XNAC 5CV6A 2QCPX 5KGUA 4FXDA 1MSGA 5EKLA 5EPLA 3M3YB 1LACA 4QUCA 4KY6A 1LV9A 2K01A 4RWSC 3E0JA 4RGMA 5E4WC 2X69A 2A73B 3LNNA 2EVBA 1BCPB 1F9PA 3NXWA 3HEJA 2H4OA 2FJ2A 4C56C 4FVMA 4QIWB 5FKAC 1LT3D 3C2PA 1NR2A 2A68D 1D1KA 3MXNA 3QIAA 1PZJD 1UNSA 3MXUA 4G7OC 1BO0A 5DM73 1GUSA 3OIPA 4WJWA 2B2TA 2IX1A 1DCZA 2K1BA 3S16B 2IWHA 4K8IA 1B9MA 4HMJA 3J81L 3S1QB 1O78A 1HUNA 1OXXK 3N6RA 5JAVA 1OO9B 1A3TA 2BCOA 1TY0A 5KIXA 3D8GA 4R8NA 2JA5B 3TP6A 1ENCA 5E3FA 4ZLTF 1V1PA 2EYMA 2F0SA 5CBAE 1ONLA 4EQOA 2IX0A 3A8KE 1K8OA 4K6LA 1PTOF 2RQXA 1SDFA 1B3AA 2JP1A 3NWSA 2K7VA 5C3XA 2JYOA 1W6KA 4FYDA 1TS5A 2L9HA 1B9NA 1IL8A 1IYUA 2MP1A 2A69C 2R61A 2IJ0A 3NBIA 2OT2A 1EY7A 1SNCA 2K04A 5IGFA 3ERQA 1FGBD 1LTID 5ELEA 1LTBD 4A3GB 3V05A 3DUZA 2K05A 3PIP3 1BCPC 4HTHA 4XQJA 3I4NB 2EY6A 2KCNA 2HCCA 2B63B 3VYRA 1ZEQX 4F88A 2FINB 4ZK9B 4K5VA 1EQTA 2LS01 1IHZA 2Z4HA 2RDGA 4IN3A 1RTNA 1GUTA 3QB3A 1EU4A 4CKCA 1HTPA 1CHPD 2EZVA 2ENBA 3HOVB 1SE4A 1ENAA 3BDLA 3S1MB 2KEEA 4M1UB 5ELDA 1EEID 5NUCA 1WTQA 5IGCA 1EIHA 3S1RB 4K6DA 1T5EA 4H44C 1UEAB 5KNCA 2JA8B 3LWUA 4OIJA 2RSNA 1EZ6A 2CQAA 4ZKBB 3P20A 1PRTD 2F0MA 2MPMA 2DNEA 5BN5A 2EYLA 1LTAD 4ZQ3A 2NB0A 2R92B 1VF5C 1ENFA 1D2BA 2XSCA 1DYQA 3QOLA 4Y7NB 5C4HA 2CW0D 4XT1B 5ELFA 2I46A 3BYYB 2EY1A 3NTKA 2SEBD 3PO3B 1QB5D 1GOZA 5M5YB 4MHEA 3D4WA 1UUPA 1CA5A 1WD0A 2E75C 4Q5VA 5JVH3 1LTTD 1LTGD 4HSVA 1O7ZA 3A56A 2EJFC 2KA7A 2GA4B 5C3WA 3Q24A 2E2IB 2EYOA 1C4QA 1TU2B 5FO8B 2HUGA 5C4JB 1B1ZA 1DJRD 4HSPA 2KCCA 4I65A 5BN4A 3GQBA 3TP7A 3CHBD 3MXGA 3A55A 4J8QA 4N9PA 5LHY1 1FR3A 1QOHA 2SDFA 2EDGA 1DM0B 2O5IC 3GTQB 2JA7B 1JOOA 1Y8PB 1WTPA 4L6TB 1GUOA 3K5MA 3I70A 2D9UA 4C1NI 4QMGA 2Q8RE 1RF2D 1BCPF 1VF7A 4V190 3MWYW 4TQUS 5KYIA 3SR1A 4J6HA 1TKWB 2B2WA 2IT1A 2FHTA 3J80L 4B9WA 4JK1C 1QJOA 3SHLA 1SMYD 5JOBA 3HOZB 1IW7C 3PMFA 5FK9C 3OSOA 3BG3A 1HA6A 1NR4A 1R9TB 4RFBA 4HAEA 1TS2A 4HMIA 1STNA 3ITPA 4X3UA 4OL7A 1CM9A 3DM1A 1STHA 3GTPB 4A3BB 4FXKC 5FOBB 4DXFA 2VB2X 4ZYSA 1M8AA 3NQTA 3OWFA 4RH6A 1UAPA 5ELBA 5T1IA 2HDMA 2F0PA 4A3JB 2X6GA 4FF3A 3A8IE 3MFYA 2SOBA 2LY7A 4XTCS 1PXUA 2Q8TA 2JSOA 3WDNA 5I6YA 3DWPA 1WTRA 5DAUA 5I9PA 3NTHA 2XWJB 5C0XI 1IW7D 4IUQA 3ND9A 3S14B 5E4XA 2B8FA 1DXMA 2B2VC 1WD1A 3FVQA 2Z8LA 5M3MB 3GTMB 2C9OA 1PZKD 1KDAA 4NMZA 2J4XA 5T1GA 1I4QA 4IFDG 3GD7A 4L8JA 1F9QA 1KABA 5IGDA 1Z6HA 3URYA 3HOUB 2RDHA 3W3AA 5C6AA 1Y69U 2NUCA 1MI2A 1RODA 1ZYRD 1LLRD 1Q1EA 4AYBB 5EKIA 3SDZA 2NVQB 5E1FA 3OHXC 4XT3B 1V43A 3DWQA 4QF4A 1D5MC 1EL0A 1F9SA 2F0KA 3GV6A 1EY4A 1FNWA 3S1NB 4K2LA 3ZYYX 4FXGC 3VYTA 1ZKOA 2BE5D 3F2UA 3GTOB 3EROA 5M5XB 4OO1G 3CU7A 4K14A 2F0FA 3I3CA 4NW2A 3RLFA 1QWYA 1SJED 4HEDA 5JVG3 5C5LA 4R8IA 2DY7A 4XYOA 5KNDA 1BUVT 2B8GA 3K0YA 5M3FB 2G9HD 2K5DA 4A3IB 3R2TA 3PUYA 5KNBA 2F0NA 1HCZA 1GHKA 4NKLA 1TS3A 5DM63 1Q90A 1B2TA 3N52A 4RKBA 4R9WA 1JWMD 2F0EA 1L0YB 1XTCD 3H0GB 2F0JA 1PYWD 1KTKA 2Z1CA 3HS0C 2WINB 5KEEA 1JE4A 2XVSA 1WTWA 1K8MA 1AN8A 4WRDA 2ZXPA 4KY7A 1NUCA 4ME5A 1QILA 3A7AB 2KECA 2AQ3B 1PFBA 3SK8A 2VNUD 1O80A 5C0XJ 2O2LD 2B2YC 4DAPA 1J9OA 1U9RA 1EIGA 4J1MA 2AQ1B 4N9TA 2F0VA 3J7AF 3I91A 5CC4A 2WV6D 3I4MB 3R8BA 4IALA 2HQEA 1I4PA 4G4KA 3DXJC 4C3IG 1G91A 1MSHA 1OXUA 1EY8A 2F0GA 2NN6I 2PQEA 1G8ZD 4K5XA 2R6GA 4BWGB 2K03A 2IW3A 1LTSD 4C2MB 4BY7B 3OWEB 1LT5D 1I50B 2HCIA 1Q3LA 4XQNA 3HGBA 2QKIC 2EE1A 4LK1C 5C4ZA 5IT9L 3X3NA 1HFGA 4A3FB 1F2ZA 2BOSA 5CGKA 5JJZA 2Z4IA 2NWGA 3SK4A 1TR5A 3OW7A 1BBXC 3NE5B 4KJNA 4KD4A 3E5SA 4PMBA 3VYSA 3NSWA 5FO7B 3BYTB 1GJXA 5CV8A 3VR3A 5I2YA 2K28A 3FPPA 1JOQA 3Q23A 3NQIA 3TMEA 2OXPA 4CGYB 3CRKC 2D5DA 1Q12A 5JEAH 1FD7D 4XQQA 1HRJA 3QG1A 4ODGA 2KVMA 1R4PB 4TKOB 4UDUC 4HN7A 2A69D 4HCSA 1CFMA 2M9VA 2R7ZB 2ICEC 1WTXA 1O7LA 5IGEA 2L11A 2K5WA 3DEPA 4V0BA 5FLXE 3EFXD 1BCPD 2AWNA 4U68A 2A74C 3NHHA 1GUWA 5CYUA 2RSOA 2F0TA 4FF2A 5JEAJ 5I6WA 1H9RA 3H09A 4LAAA 1H9MA 2B2VA 1ET6A 3K5OA 4QB4A 4KN7C 3D6CA 1WTVA 2A6HC 3D4DA 1Q1BA 1II3A 1TIID 1SSOA 2PW7A 2F1MA 1CZGA 3SXHA 2G9DA 1SNOA 1SNPA 5AFWA 3U9SA 3CKIB 2V4DA 1RD9D 4KKSA 3HRZC 1A3UA 1Y8NB 3I4LA 3HOYB 1A2UA 1K83B 5EBCA 4MIUA 2F0OA 2L0CA 4Z9CB 3DMUA 2RVLA 1QE6A 1PDQA 3D4RA 3T56B 1ILQA 2XIWA 2B2WC 1SBBB 4FNFA 1TWAB 2XRQD 3NP8A 3VR2A 1I4HA 4QUFA 1CK1A 2JEAI 3KUPA 5IT9E 4K2KA 5EGTA 2K32A 3SK5A 4F7XA 1SNMA 5C0XG 5CORA 2A6HD 1KDBA 1SYEA 2MUYA 1KNEA 1SYGA 1ESFA 3H94A 1LT4D 2M2LA 1HFNA 1JR0D 1SEBD 5D65A 1LO5D 3FEWX 3OPOA 4RHRA 2F0QA 1CTMA 5IODA 2PNRC 3V96A 1AW7A 4KN4C 4F87A 1V1OA 1H9SA 1O7YA 4YIJA 4QCLA 1STYA 1U4RA 3PUWA 1BOSA 2PMZB 2SNSA 1KNAA 3NUCA 4DNTB 1AZPA 2WP8J 1KAAA 4IFDJ 1Z7TA 2KOLA 2PZTA 2AWOA 2KJXA 2IL8A 1M4VA 1AFPA 5FLXL 1EYDA 1Z47A 4A93B 3JAME 4ILWA 4CKEA 5ISRA 2ID0A 3Q0AA 2EYHA 1GHJA 1GXDC 3H6MA 1IYVA 4IUNA 1EY9A 2NN6G 1PMRA 2NTSA 3S17B 3O13A 2EXZA 2SNMA 3R3OA 1TVXA 1SXTA 4OO1H 3GTGB 3MEHA 1VMPA 5M9OA 2PW5A 4OO1I 3D3RA 2L1BA 1V1PB 3K59A 1XXGA 3BVMA 3SEBA 1G291 2DN8A 2XWBB 4A3KB 2IPKD 1EYCA 1S5ED 4ULLA 3AU7A 1D5XC 2TMPA 1SNDA 2ICIA 1HQRD 5HGTA 2AUJD 4IUUA 3T4AC 4PV1C 1DZ1A 3RMHA 5C3EB 2L55A 2KEDA 4IFDH 5A35A 4PMWA 3RD4A 2F3VA 4WORA 1PTOC 1QCBD 3OIQA 5EPJA 4U673 1DONA 3H91A 1GUGA 1TWGB 3Q22A 1STAA 1R4QB 2PZUA 1KDCA 2BDOA 3QJYA 1T5XD 1GUNA 1S5FD 3C1EA 3GTJB 1OXSC 4H13C 4BS9A 1QG7A 2HDLA 4C3HB 1C8CA 3J81E 1DOLA 1LABA 3AB9A 1PRTC 3KLRA 2L4NA 1TY2A 4KD3A 2JE6I 4ZUJA 2CW0C 1LTRD 4CJ0B 2EJMA 2Q8IB 3UI2A 3A54A 2J0TD 2BA1A 2F0WA 1STBA 3BS1A 3M4YA 5DNFA 4C1NK 4RHSA 3WOFA 1B50A 2KUMA 1SE3A 1PFMA 1PZID 5F2DA 3FPUB 1PTOD 5D3DA 5DEHA 2NVXB 3LX0A 2LKVA 1EWCA 2F3WA 3S2HB 1G2TA 2D62A 1JORA 4A3EB 4PQXA 4DFAA 1H9SB 1F2MA 3T53B 2B2YA 4KHZA 3H3VC 1BF4A 1IKLA 1X3QA 1I4RA 3RUZA 4KKUA 1KLGD 2J7ZA 5K36H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0T A;  4IZ8 A;  1SYD A;  5I9O A;  3ERO A;  4K8I A;  1EY8 A;  2PZW A;  1SNQ A;  2F0G A;  3P1H A;  4I65 A;  2SOB A;  4EQP A;  5I6W A;  4K14 A;  4HMJ A;  2PQE A;  3T16 A;  2F0F A;  4LAA A;  2KQ3 A;  3TP7 A;  4PNY A;  1EY6 A;  5I6Y A;  4K5X A;  4QB4 A;  4KV6 A;  2KHS A;  4YIJ A;  5J39 A;  3D6C A;  5NUC A;  1RKN A;  1STA A;  2PZU A;  1KDC A;  4S3S A;  1STY A;  5KRU A;  5C5L A;  2EYF A;  2WAC A;  3C1E A;  3D4D A;  3DHQ A;  5IGC A;  4KJO A;  1II3 A;  2EYP A;  4N9P A;  5JAV A;  3MVV A;  2PW7 A;  1A3T A;  2SNS A;  3TP8 A;  1TQO A;  2F0U A;  3D8G A;  3NUC A;  3SXH A;  5HUR A;  5KIX A;  1SNO A;  1SNP A;  4R8N A;  5DAU A;  1KAA A;  2OEO A;  5CR3 A;  3TP6 A;  3HZX A;  4K6D A;  4PMC A;  5I9P A;  2PZT A;  5CV7 A;  1ENC A;  5EKK A;  5E3F A;  2EYM A;  2QDB A;  2F0S A;  5IGG A;  1JOO A;  1STG A;  1EYA A;  4TRD A;  1SYF A;  4EVO A;  4EQO A;  1EYD A;  5KYL A;  4ZUI A;  3NK9 A;  5C4Z A;  1A3U A;  1NSN S;  1EY5 A;  1EZ6 A;  2F0I A;  4QMG A;  4KD3 A;  1A2T A;  1EZ8 A;  1TT2 A;  3TP5 A;  5K5P A;  2RDF A;  5ISR A;  2M00 A;  1KDA A;  2F0N A;  1F2Z A;  1A2U A;  5CV5 A;  5CV9 A;  3MXP A;  4ZUJ A;  5C3X A;  4NMZ A;  2OF1 A;  4MIU A;  4NKL A;  2EYH A;  4KTA A;  5IOC A;  3P75 A;  2PYK A;  5KYI A;  4NDX A;  5J1Z A;  2F0M A;  5CGK A;  2RBM A;  2F0O A;  3SR1 A;  5CV6 A;  3H6M A;  3DMU A;  2F0W A;  1EY9 A;  2EYL A;  4IUN A;  4J6H A;  1STB A;  4ZQ3 A;  5KGU A;  2EYJ A;  4RKB A;  3MZ5 A;  2F0H A;  1EY7 A;  5EKL A;  3VA5 A;  1SNC A;  3SK4 A;  2EXZ A;  2SNM A;  1KAB A;  5IGD A;  1TR5 A;  3ERQ A;  3R3O A;  2F0E A;  4B9W A;  5IGF A;  3QOL A;  4EQN A;  4KY6 A;  4KJN A;  5C4H A;  4KD4 A;  4DGZ A;  3E5S A;  4H7B A;  3MEH A;  4PMB A;  5C6A A;  2NUC A;  5CV4 A;  3T13 A;  5M9O A;  3SHL A;  2F0J A;  5CV8 A;  2O4X A;  2PW5 A;  2RKS A;  3NP8 A;  5F2D A;  5JOB A;  5C5M A;  3PMF A;  4HTH A;  1SYC A;  2EY6 A;  2EY1 A;  3OSO A;  4ID6 A;  5KEE A;  1JOQ A;  1F2Y A;  3V2T A;  5DEH A;  2F0D A;  3TME A;  3D4W A;  3LX0 A;  1EQV A;  2OXP A;  4WRD A;  3OMG A;  4KY7 A;  1NUC A;  4K2K A;  2LKV A;  5EGT A;  1EYC A;  1SYB A;  1JOK A;  2F3W A;  4K5V A;  4K8J A;  4HMI A;  1A3V A;  4ME5 A;  1STN A;  1IHZ A;  3SK8 A;  5E1F A;  3SK5 A;  3ITP A;  1EY0 A;  4RKL A;  1SNM A;  4F7X A;  1SND A;  4OL7 A;  4ODG A;  3NXW A;  4NP5 A;  1JOR A;  3HEJ A;  5HGT A;  2EY2 A;  4DFA A;  4QF4 A;  2F0L A;  1STH A;  3QOJ A;  2F0K A;  4F8M A;  1KDB A;  1SYE A;  3MHB A;  3QB3 A;  2EY5 A;  4K5W A;  1F2M A;  1AEX A;  4G57 A;  4KY5 A;  4DF7 A;  1SYG A;  3EJI A;  3S9W A;  1U9R A;  3OMC A;  5IGB A;  1EY4 A;  3NQT A;  4J1M A;  3U9O A;  3BDC A;  3OWF A;  4N9T A;  5J22 A;  5IGE A;  2F0V A;  5C3W A;  3SK6 A;  2ENB A;  4DU9 A;  3RUZ A;  5CC4 A;  5IIF A;  4KHV A;  2F0Q A;  2EYO A;  4K2L A;  4E6I A;  5IOD A;  2F3V A;  2HQE A;  4IAL A;  4WOR A;  4B9X A;  3EVQ A;  1ENA A;  3NHH A;  2F0P A;  3BDL A;  3C1F A; 
#chains in the Genus database with same CATH topology
 2A1A A;  1C48 A;  1S4Z A;  2A68 C;  2VQE Q;  4AIM A;  3J7A 5;  4EQP A;  1SRU A;  4A3M B;  1YNN D;  3HOW G;  1N32 L;  3E9H A;  4DR1 L;  1IKM A;  4X66 Q;  2KHS A;  5I2X A;  4DV4 L;  1PVO A;  1RKN A;  4Y7N H;  5C44 G;  4HCE A;  4JI6 Q;  1EQR A;  3I72 A;  1PRT B;  2Q2U A;  2BA0 A;  4A3I G;  4BY7 G;  1TQO A;  2F0U A;  5GQO A;  1I6V C;  1Q86 C;  5L37 A;  5CR3 A;  1J5E Q;  3AYH B;  1QNK A;  5EKK A;  1RTO A;  4IUV A;  3IAY A;  3P7J A;  2D0P A;  1WTO A;  1RHP A;  1WFQ A;  3MA2 B;  3M85 A;  4LW1 A;  1NSN S;  1Y1W G;  2JK8 A;  3G6J B;  5G3L F;  3NPP A;  2RDF A;  5COY A;  1YIJ A;  2WKC A;  4CBV A;  1HQM C;  4JW0 A;  4BY7 H;  1W6J A;  1HNX Q;  2NVQ H;  4DK1 A;  3KF6 A;  3CCV A;  1DOM A;  3MZ5 A;  1Y1W H;  1EIY B;  4LUZ A;  1JQY D;  4OHJ A;  2Y0S B;  5C44 H;  1YEZ A;  4JC0 A;  2E8G A;  4IPD A;  3HP3 A;  1LTL A;  1ASZ A;  4FP5 D;  1W3S A;  3NWT A;  5EPK A;  2QDL A;  3IFT A;  4A3G H;  1VQK A;  2B2U C;  4APV A;  1ZXT A;  4B3R L;  5C44 B;  3VDY A;  4CKB A;  2KBN A;  4WJ3 M;  1GKH A;  1VQO A;  2IY5 B;  4DR6 L;  2YTX A;  1A3V A;  3PUV A;  2NBF A;  3ULP A;  1H9K A;  3QOJ A;  4KI0 A;  1TWH B;  2N55 A;  1I5F A;  4O1N A;  2B39 A;  2DY8 A;  3U50 C;  1JJC B;  4QY7 A;  4DV7 L;  3UE0 A;  1I50 H;  1YNN C;  1PH4 A;  4KHV A;  3UDG A;  4RGT A;  3EVQ A;  3FMC A;  5JJI A;  4C2M H;  3J7Y W;  4CJ1 B;  2CHB D;  4YHH L;  1SNQ A;  1YNX A;  3P1H A;  1QNU A;  2AUK A;  1VQM A;  1K73 C;  1XPR A;  3RN2 A;  1SFO H;  1BDO A;  4MN3 A;  1PYB A;  3GTG H;  3HOW B;  1PTO B;  1E2V A;  4YY3 Q;  2XN9 C;  4KV6 A;  5J39 A;  1U5K A;  2NN6 H;  4S3S A;  2WB1 B;  3E6Z X;  3S16 H;  2EYF A;  3LGJ A;  3EA6 A;  3PV0 A;  3AEV A;  4KJO A;  2UXD L;  1Y1V B;  2NVT B;  4IFD I;  4X62 Q;  3OYY A;  5IP9 H;  4GOP C;  2PPB C;  5CV7 A;  1L0X B;  1ILP A;  2CVR A;  2FFK B;  3L9A X;  1STG A;  3MC0 B;  2R7Z H;  4BBS B;  4EVO A;  3K7A H;  4PZ8 A;  2OTL A;  1X32 A;  2LXK A;  2B3G A;  3L7Z C;  5D14 A;  4LNQ A;  2F0I A;  3J81 c;  4KHP L;  1A2T A;  1EZ8 A;  4QQB X;  3TP5 A;  3J80 E;  3C3L A;  1XNR L;  3HFZ B;  2LFN A;  1EIF A;  4G7H C;  3P75 A;  2GVA A;  3PIO 3;  2JA5 H;  1RJT A;  4L5T A;  3VR4 A;  4HIK A;  3S2D B;  1HZC A;  2K5Q A;  3CQZ H;  4JOI A;  5GAH C;  3TSS A;  4LF6 L;  4BY1 B;  4POG A;  3U58 A;  3DM3 A;  1BR9 A;  3E9I A;  4H7B A;  1HNW L;  2YU9 B;  5CV4 A;  2VUM H;  3K81 C;  1AZQ A;  2I07 B;  1LT6 D;  2RKS A;  3FDT A;  5G3L D;  4JI5 Q;  4DNR B;  3GTK B;  1NAP A;  4UP9 A;  3S1M H;  1CHQ D;  4OX9 Q;  4XIG S;  2R93 B;  1WTH A;  2F0D A;  4LF9 L;  4JYA Q;  4C3J B;  3HKS A;  2JN4 A;  3SE0 A;  1Y1V G;  3D31 A;  1SYB A;  4K8J A;  2ZXO A;  1G6Z A;  1OTC A;  1I4G A;  2I5L X;  3OOC A;  5JEA G;  4NP5 A;  4A3F G;  1V8Q A;  1Y8O B;  2EY2 A;  1IBM Q;  2F0L A;  2K75 A;  1AE2 A;  3TRE A;  2BE5 C;  5EJW A;  4DF7 A;  4KY5 A;  4LMQ D;  2L15 A;  2H1E A;  5IGB A;  1X3G A;  3ULL A;  4DR5 L;  2QEJ C;  2QEX A;  2JA7 G;  2UXB Q;  1XX8 A;  2ZTE A;  4DR2 Q;  2JA5 G;  4LF8 L;  3BJU A;  4E6I A;  5K36 G;  3RZO B;  4DAY A;  3FRP B;  1K8A C;  5TSS A;  2QIL A;  4BBR B;  1MHW C;  3L3O C;  4I7A A;  3I4N H;  2PZW A;  1SMX A;  5LMN L;  4OIK A;  3M7G A;  3T16 A;  4A3K G;  2MQH A;  3KBX A;  1EY6 A;  2ZTC A;  4L5Q A;  1VCI A;  3KLS X;  4OGQ C;  3K6O A;  4A3D G;  1ESR A;  4GOP A;  4I7Z C;  4IUP A;  1TWC H;  3TP8 A;  1VQ9 A;  2WAQ B;  2JEB I;  4HJ7 A;  2OEO A;  4A93 G;  4JPB W;  3NEM A;  2YTY A;  4DV1 Q;  3QO2 A;  3GTM H;  1HUM A;  2X6L A;  4AQY L;  1X55 A;  5EQ0 A;  5K5P A;  3MXP A;  3W1G A;  4DUZ Q;  1A0I A;  2PYK A;  4A3K H;  2R3Z A;  5BN3 A;  4NDX A;  1PFN A;  3G7L A;  2CH4 A;  3TN2 A;  5IYB G;  1NTG A;  4C3J G;  3VR6 A;  2QF7 A;  3D6W A;  2UXC Q;  5JJK A;  4DV3 L;  4BA1 I;  2R93 H;  1I4X A;  2A8V A;  3ULJ A;  4EQN A;  5A2Q L;  4KMU C;  5ELC A;  1EU3 A;  5C4X B;  1HZB A;  3GTL H;  1L1O B;  4CDD C;  1S5C D;  3CRL C;  3T13 A;  2VL6 A;  5IE8 A;  2YU9 H;  4R4C A;  3GDE A;  4ID6 A;  2RA4 A;  1GM5 A;  1E2W A;  3HOU H;  1F2Y A;  3V2T A;  3CQZ B;  5A2Q E;  4DV2 L;  1S72 A;  2ZM6 Q;  1L1O A;  1VQP A;  1JOK A;  1U4L A;  4WFN 3;  1A15 A;  1Q8I A;  1CI3 M;  1CKN A;  1FJG L;  1IBL Q;  4X3S A;  3M4O B;  1VS0 A;  1I3Q B;  4Q0F A;  1CUK A;  2EPB A;  3UDI A;  3K5N A;  1YNJ D;  4P2C B;  4A3G G;  2EY5 A;  2TSS A;  4GZY C;  1EFI D;  1ICW A;  1VQA A;  4A3C H;  3BDC A;  3W2D A;  5C0X H;  1QZH A;  1XMO L;  2BH8 A;  3TDQ A;  1PRT F;  3SVM A;  1CT1 D;  1E0B A;  1EOT A;  3CCS A;  3I55 A;  4LF4 Q;  1ET9 A;  2VXW A;  1X6O A;  4X6A H;  1IBK L;  2BH2 A;  1HR0 Q;  4IZ8 A;  2L12 A;  1DOK A;  4JBK A;  1HHV A;  4B3R Q;  1RDP D;  2MO1 A;  2KQ3 A;  3BZD B;  1JWU D;  4LJZ C;  2MHV A;  3S15 H;  4N8F A;  5M5X H;  5KRU A;  2HQL A;  3KBG A;  3HOZ G;  4EQ5 A;  2LMC B;  4IOC A;  4ABN A;  3F2B A;  1NY4 A;  4RMF A;  2EOT A;  5HY6 A;  4GKJ Q;  2MGS A;  3S1N H;  4GKK Q;  4R4O A;  4IPC A;  3PIO A;  2K6A A;  3HZX A;  4ZRZ A;  1CQV A;  1MD2 D;  4DV2 Q;  2QDB A;  1BXT A;  1OXV A;  1HA5 A;  3K57 A;  1D1I A;  3GTP H;  1C0A A;  3A7L A;  1S5D D;  4KTA A;  2WB1 G;  1JB7 A;  3KDF A;  5IP9 G;  3FKI H;  3LWE A;  2PNH A;  1IYJ B;  2C5C A;  2HT1 A;  2EYJ A;  3BDO A;  1WYD A;  3BVZ A;  4EGV A;  3VA5 A;  3S15 B;  3I4O A;  5LL6 X;  2B2T C;  1IBK Q;  3EQL C;  3GV3 A;  2O4X A;  2NVY H;  2C35 B;  2GN5 A;  4JI4 Q;  4DN4 M;  1YNJ C;  2WKD A;  2JA6 B;  4L5R C;  3TS0 A;  2UUA L;  2I0Q A;  2WII B;  2Z6B A;  2AQ2 B;  3CC4 A;  2JXM B;  2L5T A;  2V1C C;  4JBJ A;  1S5B D;  1ZYR C;  2E2D C;  1EY0 A;  4RKL A;  4KK7 A;  3G71 A;  2E74 C;  1RL2 A;  5E7N A;  2MO0 A;  1SE8 A;  1AE3 A;  2B2U A;  1XNR Q;  5J3B A;  4MNO A;  2MJ8 A;  2RHQ B;  3IL8 A;  4KKT A;  1Q81 C;  5I4D A;  2RCN A;  2E2H B;  3U9O A;  1WCM G;  3R2I A;  1HPC A;  5J22 A;  3WOE A;  1U4M A;  3M7N A;  4IUT A;  3BZK A;  1JE5 A;  2IHE A;  3VA7 A;  4A3C G;  4JI2 L;  4B9X A;  1TWF B;  4RCN A;  5CBE E;  1SYD A;  3VYU A;  4FF1 A;  3CXC A;  4CJ2 C;  1H9J A;  3GTL B;  4JBW A;  4LFA L;  1KLU D;  2ZXR A;  4PNY A;  5JPN C;  2ZT9 C;  2P5Z X;  1D6E C;  3KF8 A;  2VUM B;  4A3M H;  1HJP A;  4RG1 A;  4LF7 Q;  3PUZ A;  1HXY D;  3QWN A;  2EYP A;  2HIV A;  3S24 A;  1SE2 A;  5HUR A;  1B4O A;  1HZ9 A;  4RGO S;  1KIX A;  2EJG C;  2JA9 A;  1SMY C;  2E2I H;  4JBM A;  1EYA A;  4A3I H;  1ICF B;  3CME A;  2PQA A;  5M3F H;  2JA8 H;  2YYZ A;  2OTJ A;  4RGN A;  1WVL A;  2VQE L;  5IYB H;  5FO9 B;  1I6H B;  3X3M A;  2I5M X;  4DAV A;  1I3Q H;  2UUB Q;  4P74 A;  4YCV A;  1MGS A;  4B08 A;  1SN8 A;  1PFS A;  2FXQ A;  3J7A V;  4FO2 A;  4M8A A;  4DR6 Q;  1Z9F A;  1A6X A;  1UEB A;  2F0H A;  3GO5 A;  3A5U A;  2D2C C;  3I8Z A;  4R4T A;  1XYI A;  2I5H A;  4C3H G;  4JI2 Q;  2ATW A;  3A74 A;  4ZAI A;  3PO3 H;  1XNQ L;  1VMC A;  2NYZ D;  1G2S A;  3HOW H;  2DNC A;  3TZD A;  3UDF A;  4A76 A;  1YHQ A;  2K5N A;  1CQF A;  4LFA Q;  1U4P A;  2K52 A;  4RCO A;  1SFO B;  2OQ0 A;  1TS4 A;  4X3K A;  3PUX A;  3CW2 C;  3FKI B;  4MTK A;  1EQV A;  1KC8 C;  3OMG A;  2PI2 E;  3MTS A;  1E2Z A;  3FHW A;  1NCV A;  4RAU C;  1PH3 A;  4DA2 A;  5M5W B;  4IUR A;  3HG9 A;  1P16 A;  3IFD A;  3I73 A;  4O42 A;  1W2B A;  3MHB A;  2K5H A;  4G57 A;  1AEX A;  2XRS D;  1PH5 A;  2A6E C;  3GP7 A;  3OMC A;  1TWH H;  1IL2 A;  2CKZ B;  1WCM B;  5D3I B;  4CHT B;  1QUQ B;  2JA7 H;  3Q6S A;  1AP0 A;  4X3T A;  4DU9 A;  1MKH A;  2IHF A;  5IIF A;  2UXC L;  1KAW A;  3S1R H;  1YBY A;  3A5Z B;  2VB3 X;  4A3B G;  1EWH A;  4DGZ A;  1VQ4 A;  1G6P A;  3C1F A;  3JAM L;  3MAQ A;  2E2J B;  2FMC A;  5I9O A;  3K5L A;  2F03 A;  4YCU A;  3MFG A;  1B53 A;  3RZD B;  3AMU A;  4JI3 L;  3I90 A;  3DWA A;  3MVV A;  1Y1W B;  4DR4 L;  4ZKC B;  1MBY A;  4XDX A;  3T51 B;  4PMC A;  4NXN Q;  1K9M C;  1F9R A;  2E5L Q;  3VR5 A;  2PO4 A;  4TRD A;  5C3E H;  2HD3 A;  1YJ9 A;  1SYF A;  3NTI A;  3ER0 A;  1VDZ A;  1JCK B;  2CWA A;  4ZUI A;  3NK9 A;  5EBD A;  1K28 A;  4DK0 A;  4NXM Q;  1BNZ A;  2E76 C;  1J8I A;  1TT2 A;  2M00 A;  2XGT A;  3TZU A;  1N34 L;  1E22 A;  5CV5 A;  3ONA B;  3KLS A;  5CV9 A;  1X3E A;  2OF1 A;  2F4V Q;  1X3P A;  5FLM H;  4GNX C;  2ZJP A;  2RBM A;  4XXE A;  5LL6 S;  4A3M G;  3KDF B;  1QVF A;  4TSS A;  4DXG A;  2A5H A;  2CCZ A;  2A6E D;  2O5J C;  4C3I B;  1NJI C;  4IQZ A;  1MIU A;  1SAP A;  4XYQ A;  5C5M A;  4A3D B;  1SYC A;  1BQQ T;  3KK7 A;  1T9H A;  4RA8 A;  4BY1 H;  1JJG A;  3BVG A;  2IX3 A;  1E1T A;  5LMU L;  1YI2 A;  1CZW A;  1DD2 A;  1UE1 A;  1XWE A;  2F3I A;  3C46 A;  1EQQ A;  3PGZ A;  3T1Y Q;  3NBH A;  1WOC A;  2NZO A;  1HTL D;  3CCQ A;  1HNZ Q;  4B3M L;  2NTT A;  4F8M A;  2F4I A;  1CA6 A;  4HID A;  1F77 A;  4K5W A;  3S9W A;  1STE A;  1RCV D;  3EJI A;  3ZJY C;  1YHA A;  2NZ1 D;  3NEL A;  1FNU A;  2K33 A;  3K7A B;  4HR7 B;  4H0L C;  2PCF B;  4FF4 A;  3HKZ B;  4GN5 A;  3R93 A;  3SK6 A;  2N88 A;  4BA2 I;  1TWC B;  3DEO A;  3S2H H;  1Q8K A;  3PO2 B;  3UDX A;  5CMD A;  4UAI A;  1OXT A;  5JPM C;  3K58 A;  1PYS B;  2NVY B;  3A8J E;  4CDC C;  1JWS D;  3HOX B;  4L63 B;  1B44 D;  1D5Z C;  2CH4 W;  1ML0 D;  1FL0 A;  1PTO H;  2WB1 E;  3M3Y H;  2UUA Q;  3PCO B;  2FMM A;  4G7Z C;  1EUJ A;  2WAC A;  1PLF A;  3DHQ A;  4OEM B;  2ZTD A;  3H0G G;  2BDN A;  2ZJR A;  1CKM A;  2LXJ A;  3PF4 A;  1JB3 A;  1JC7 A;  5LMU Q;  1E3P A;  4IJL A;  4MZ9 A;  4JV5 Q;  5IGG A;  3T1Y L;  3CAM A;  1MJC A;  5KYL A;  2E2H H;  3J80 c;  1FYC A;  3IKJ A;  4UP7 A;  2KCM A;  4DR3 L;  1EY5 A;  1EEF D;  1VQD A;  4DV7 Q;  3TBI B;  1F2L A;  3L0O A;  3ND8 A;  4DV5 L;  1KD1 C;  5IOC A;  1FNV A;  1JIC A;  1NE3 A;  1SJH D;  5J1Z A;  2XNA C;  5CV6 A;  2QCP X;  1PA6 A;  5KGU A;  4FXD A;  1MSG A;  5EKL A;  5EPL A;  3GTJ H;  2Z6K A;  3M3Y B;  1LAC A;  4QUC A;  4KY6 A;  2VW9 A;  2YTV A;  3HOX H;  1LV9 A;  5M3M G;  2K01 A;  4RWS C;  3RLN A;  1NMF A;  1M1K C;  4B3S Q;  3E0J A;  4RGM A;  5E4W C;  4LFC Q;  2X69 A;  4JVZ A;  2A73 B;  5C3E G;  3S2D H;  1L2F A;  3LNN A;  3F1Z A;  4LF5 Q;  2EVB A;  4PZ7 A;  2CWP A;  1K3B C;  5BR8 Q;  1BCP B;  1GD7 A;  3PF5 A;  4LWC A;  1PH6 A;  1F9P A;  1HR0 L;  3NXW A;  3F2D A;  3HEJ A;  2H4O A;  1WCM H;  4ME3 A;  2FJ2 A;  4FVM A;  4C56 C;  4QIW B;  5FKA C;  1K0R A;  1LT3 D;  4DR1 Q;  3C2P A;  3KJP A;  1NR2 A;  2A68 D;  2UUB L;  1D1K A;  3MXN A;  3QIA A;  1PZJ D;  1UNS A;  3MXU A;  4G7O C;  1BO0 A;  5DM7 3;  1GUS A;  3OIP A;  1K8G A;  4WJW A;  2B2T A;  2IX1 A;  1DCZ A;  2K1B A;  4DNI A;  4A3E G;  4DKA C;  3S16 B;  2IWH A;  4YWM A;  3MXN B;  4K8I A;  1VQ8 A;  1B9M A;  4HMJ A;  4A3L G;  1SLJ A;  4JI5 L;  3J81 L;  3S1Q B;  4JYA L;  4A3J H;  1O78 A;  4QIW E;  1HUN A;  1QVC A;  1OXX K;  3N6R A;  5JAV A;  1OO9 B;  1A3T A;  2BCO A;  1TY0 A;  5KIX A;  3J81 j;  3D8G A;  5IYC G;  4B3T L;  2ASB A;  4R8N A;  2JA5 B;  3PSI A;  3TP6 A;  1ENC A;  5E3F A;  4ZLT F;  1D7Q A;  1V1P A;  2EYM A;  2F0S A;  5CBA E;  4NPS A;  1BBW A;  1ONL A;  4EQO A;  2N8N A;  2IX0 A;  3KF6 B;  3A8K E;  1K8O A;  4K6L A;  1V1Q A;  1PTO F;  2R7D A;  4A93 H;  2RQX A;  3CC2 A;  1SDF A;  1B3A A;  2JP1 A;  3NWS A;  4YWL A;  1NMG A;  4DR5 Q;  2RCF A;  2K7V A;  4GS3 A;  5C3X A;  2JYO A;  1W6K A;  4FYD A;  1TS5 A;  2L9H A;  1IL8 A;  1B9N A;  3KOJ A;  4JCV E;  5IP7 G;  1IYU A;  3SGI A;  2MP1 A;  1QZG A;  1YZ6 A;  2A69 C;  2R61 A;  2IJ0 A;  3NBI A;  2OT2 A;  2UUC Q;  1EY7 A;  3RZD H;  1SNC A;  2K04 A;  5IGF A;  3HOZ H;  3ERQ A;  1FGB D;  1LTI D;  4ZCK A;  5ELE A;  4GKK L;  1LTB D;  4A3G B;  1J5E L;  3EBE A;  3V05 A;  3DUZ A;  2K05 A;  3PIP 3;  1O7I A;  1BCP C;  4HTH A;  4XQJ A;  3I4N B;  2EY6 A;  2KCN A;  2HCC A;  2B63 B;  3VYR A;  1ZEQ X;  4NXN L;  4R4I A;  4F88 A;  2FIN B;  4ZK9 B;  4K5V A;  1EQT A;  2LS0 1;  1IHZ A;  1V9P A;  2Z4H A;  2RDG A;  4IN3 A;  1RTN A;  4CDF C;  1HR0 W;  2R7F A;  1GUT A;  4A3F H;  4HJ5 A;  3QB3 A;  1EU4 A;  3EIV A;  4CKC A;  4X64 L;  1HTP A;  1CHP D;  2A19 A;  2EZV A;  1PH8 A;  2F4V L;  2N49 A;  3GTQ H;  2ENB A;  3HOV B;  1VQL A;  1SE4 A;  2PI2 A;  2Z0S A;  1X9N A;  1ENA A;  5ELO A;  3BDL A;  4GN3 B;  5ELN A;  4JOI C;  3S1M B;  3K8A A;  4DUY L;  3HOU G;  5GAG C;  2KEE A;  4M1U B;  1BKB A;  5ELD A;  3STB C;  1SRO A;  4GLV B;  1U0L A;  3UE1 A;  1EEI D;  4DV6 L;  5NUC A;  2R93 G;  4HJ8 A;  2QA4 A;  3PO2 H;  2DJG C;  1WTQ A;  3W5O A;  5IGC A;  4OEL B;  4IJH A;  1EIH A;  1X3F A;  1LM0 A;  1RIP A;  3S1R B;  1FGU A;  1T5E A;  4H44 C;  4K6D A;  3H15 A;  1UEA B;  5KNC A;  2JA8 B;  3PIP A;  3LWU A;  1Y14 B;  4OIJ A;  2RSN A;  1HNW Q;  2WAQ E;  4LUV A;  1EZ6 A;  2Q2T A;  2CQA A;  5C4X G;  4ZKB B;  4IO9 A;  4P73 A;  2MFI A;  3P20 A;  1FVI A;  4DR7 L;  1PRT D;  2F0M A;  2MPM A;  2DNE A;  5BN5 A;  2EYL A;  1LTA D;  4ZQ3 A;  3FKI G;  2NB0 A;  4R1J A;  3CCJ A;  3K80 C;  2R92 B;  1VF5 C;  1ENF A;  2CFM A;  1D2B A;  4A3D H;  2XSC A;  4A3L H;  2Y0S E;  1DYQ A;  3QOL A;  3ICE A;  4Y7N B;  5C4H A;  2CW0 D;  2WAQ G;  4XT1 B;  4X62 L;  1VQE A;  5ELF A;  2I46 A;  4MTN A;  3BYY B;  2EY1 A;  3NTK A;  2SEB D;  1XTD A;  4JI8 Q;  3PO3 B;  1QB5 D;  1GOZ A;  5M5Y B;  4GKJ L;  4MHE A;  3D4W A;  1UUP A;  4P72 A;  4ALP A;  3Q8D A;  2Q2I A;  1N32 Q;  1Q82 C;  1CA5 A;  1EOV A;  4QJF A;  1WD0 A;  2E75 C;  3I56 A;  4Q5V A;  3IRB A;  5JVH 3;  1ASY A;  1LTT D;  1LTG D;  4HSV A;  5GAE C;  3J7Z C;  2UU9 Q;  1O7Z A;  4LF6 Q;  4JI3 Q;  3A56 A;  2EJF C;  2KA7 A;  2GA4 B;  5C3W A;  3Q24 A;  2E2I B;  2EYO A;  1XMQ Q;  2EXD A;  2KCT A;  1Y1V H;  1C4Q A;  1TU2 B;  5FO8 B;  4OX9 L;  2HUG A;  5C4J B;  1B1Z A;  4DR7 Q;  1DJR D;  4HSP A;  4GLX A;  2KCC A;  3AFP A;  4I65 A;  5BN4 A;  1L0W A;  1HH2 P;  3TS2 A;  2VUM G;  3GQB A;  3CPF A;  3KYH C;  2RF4 A;  3TP7 A;  3CHB D;  3MXG A;  3A55 A;  4AH6 A;  3WWV A;  4IOA A;  2QGQ A;  4HJA A;  3M4Q A;  4J8Q A;  4N9P A;  5LHY 1;  1FR3 A;  4QL5 A;  1QOH A;  2SDF A;  2EDG A;  5FJ8 G;  1DM0 B;  1PH9 A;  2O5I C;  3GTQ B;  2JA7 B;  3HKZ E;  2OQK A;  1GO3 E;  1JOO A;  1Y8P B;  2Z6K C;  1WTP A;  4L6T B;  1XPU A;  1GUO A;  3K5M A;  3I70 A;  2D9U A;  4K0K Q;  4C1N I;  4X66 L;  4QMG A;  2Q8R E;  3HOY G;  1RF2 D;  1BCP F;  1VF7 A;  5LMN Q;  4V19 0;  3MWY W;  3KLW A;  4TQU S;  3KF8 B;  5KYI A;  3SR1 A;  4DAY B;  3NEN A;  2AHO B;  1TKW B;  4J6H A;  1UWV A;  2AKW B;  2B2W A;  2IT1 A;  2FHT A;  3J80 L;  2JA6 H;  5GAD C;  4B9W A;  1K3R A;  4JK1 C;  1QJO A;  3U4V A;  4JI7 Q;  3SHL A;  1SMY D;  1TWA H;  5JOB A;  3HOZ B;  1IW7 C;  3PMF A;  5FK9 C;  3OSO A;  3E0E A;  3S17 H;  3BG3 A;  1XMO Q;  1HA6 A;  3F2C A;  1NR4 A;  4YHH Q;  1R9T B;  4AYB E;  4RFB A;  4HAE A;  1TS2 A;  4HMI A;  1STN A;  5HGQ A;  3ITP A;  4X3U A;  4X65 Q;  3TRZ A;  4OL7 A;  1CM9 A;  3DM1 A;  3PO2 G;  1N8R C;  1STH A;  1E7Z A;  3GTP B;  4A3B B;  4FXK C;  5FOB B;  4DXF A;  2VB2 X;  1X54 A;  4ZYS A;  4A3E H;  3AQQ A;  3E3X A;  3NQT A;  1BBU A;  1M8A A;  3OWF A;  2UXD Q;  3S14 H;  4RH6 A;  3CCL A;  1UAP A;  2PMZ E;  3I4N G;  5M5W H;  2UUC L;  5ELB A;  5T1I A;  2HDM A;  2VQF L;  2F0P A;  4A3J B;  2X6G A;  4FF3 A;  5IY0 A;  3A8I E;  3MFY A;  2SOB A;  2LY7 A;  1A63 A;  4XTC S;  1PXU A;  2Q8T A;  3EN2 A;  1E24 A;  3HOX G;  2JSO A;  3WDN A;  5I6Y A;  3DWP A;  1WTR A;  3MEF A;  4BBR G;  1CKN B;  3RR5 A;  3B6Y A;  1EFW A;  5DAU A;  4L5S A;  5I9P A;  2D0O A;  1XPO A;  2Y0S G;  3NTH A;  2XWJ B;  5C0X I;  1IW7 D;  3J80 i;  4IUQ A;  3ND9 A;  3S14 B;  1UE6 A;  4LF4 L;  5E4X A;  2B8F A;  1WJJ A;  5LMN W;  5AJ3 Q;  1DXM A;  2HHH Q;  1I6H H;  2B2V C;  4O2D A;  1WD1 A;  3FVQ A;  2Z8L A;  4YY3 L;  5M3M B;  4R4Q A;  3GTM B;  2C9O A;  2ES2 A;  1PZK D;  1KDA A;  4UPA A;  3BZC A;  3RLO A;  1AH9 A;  4NMZ A;  4GLA C;  2J4X A;  5T1G A;  1I4Q A;  2CQO A;  2NVT H;  4IFD G;  3GD7 A;  4L8J A;  1F9Q A;  2OWO A;  1KAB A;  5IGD A;  1Z6H A;  3URY A;  3HOU B;  2RDH A;  3W3A A;  5C6A A;  1Y69 U;  2NUC A;  1MI2 A;  1ROD A;  1ZYR D;  2Q2H A;  1LLR D;  5H1S E;  1Q1E A;  4AYB B;  3NBH B;  1X65 A;  5EKI A;  1KRT A;  3SDZ A;  4DR4 Q;  2NVQ B;  4A4I A;  5E1F A;  3OHX C;  3M9B A;  4XT3 B;  1V43 A;  3DWQ A;  2YV5 A;  4P75 A;  4A3J G;  4QF4 A;  1D5M C;  1EL0 A;  1F9S A;  2F0K A;  2KEN A;  3GV6 A;  4UY8 C;  1I94 L;  3HOV G;  2EIF A;  1EY4 A;  1FNW A;  1VQF A;  5IYD G;  4BXX G;  3S1N B;  1VQI A;  4K2L A;  3ZYY X;  4FXG C;  3VYT A;  1ZKO A;  1HNX L;  2BE5 D;  3F2U A;  1S3O A;  3GTO B;  3ERO A;  2K5V A;  5M5X B;  4OO1 G;  1IZ6 A;  3CU7 A;  4K14 A;  5BR8 L;  4NW2 A;  2F0F A;  1NBW A;  3I3C A;  3PQI A;  3RLF A;  1QWY A;  1SJE D;  4HED A;  1UE5 A;  4N8X 1;  5JVG 3;  5C5L A;  4R8I A;  2DY7 A;  4DV3 Q;  4XYO A;  4YWK A;  5KND A;  5FLM G;  2JA8 G;  5M3F G;  1N36 L;  1BUV T;  2B8G A;  3AFQ A;  3K0Y A;  4OWW B;  3HOY H;  5M3F B;  2G9H D;  4OXP A;  1XNQ Q;  1SR3 A;  2K5D A;  4A3I B;  3R2T A;  4GOP B;  5IWA Q;  3PUY A;  1MJE A;  5KNB A;  2N78 A;  2F0N A;  1HCZ A;  1GHK A;  4NKL A;  1TS3 A;  1K0S A;  3CF5 A;  5DM6 3;  1Q90 A;  1L1O C;  3T1H L;  2NVX H;  1B2T A;  3N52 A;  4RKB A;  1JJ2 A;  4LF7 L;  1QUQ A;  4R9W A;  5M5Y H;  1JWM D;  2F0E A;  3CCR A;  1L0Y B;  1XTC D;  1CSP A;  2DJF C;  3H0G B;  4X64 Q;  4AQY Q;  2F0J A;  1PYW D;  1KTK A;  2Z1C A;  3HS0 C;  2WIN B;  5KEE A;  1JE4 A;  2MNA A;  2XVS A;  1TWF H;  1WTW A;  1K8M A;  2R92 H;  1AN8 A;  4WRD A;  2ZXP A;  4KY7 A;  1NUC A;  1KQS A;  1QVG A;  4ME5 A;  1QIL A;  3A7A B;  2KEC A;  2AQ3 B;  1PFB A;  3SK8 A;  2VNU D;  4WJ4 A;  1E1O A;  1O80 A;  5GRO A;  5C0X J;  4JG2 A;  2O2L D;  2B2Y C;  4NB3 A;  5DLQ E;  4DAP A;  1J9O A;  1VQ7 A;  1U9R A;  3G4S A;  1EIG A;  4J1M A;  2AQ1 B;  4A3B H;  4N9T A;  2KHI A;  2F0V A;  5IT9 c;  4BXX H;  5IWA L;  3J7A F;  3I91 A;  5CC4 A;  2WV6 D;  4UP8 A;  3I4M B;  1M90 C;  1VQ6 A;  3R8B A;  4IAL A;  2HQE A;  1I4P A;  4G4K A;  3DXJ C;  4C3I G;  1IBL L;  1G91 A;  1MSH A;  1OXU A;  1EY8 A;  2F0G A;  4JI1 Q;  2NN6 I;  2PQE A;  4JI7 L;  4OWX B;  3OTO Q;  5EAY A;  1TWG H;  3FP9 A;  1G8Z D;  4FDB A;  1VQJ A;  4NXM L;  4K5X A;  4PG3 A;  3F8T A;  4AYB G;  1PH2 A;  3PO3 G;  5C4X H;  2R6G A;  2XTI A;  2E2J H;  3W1B A;  4BWG B;  4P71 A;  2K03 A;  4UHV A;  2IW3 A;  4IPG A;  1LTS D;  3GTO H;  4C2M B;  4X65 L;  4BY7 B;  4YCW A;  3OWE B;  1LT5 D;  1C7Y A;  1I50 B;  2HCI A;  1Q3L A;  4XQN A;  2WFW A;  3RN5 A;  3HGB A;  2K4K A;  2QKI C;  2EE1 A;  4LK1 C;  5C4Z A;  5IT9 L;  3X3N A;  1HFG A;  1GVP A;  4GNX A;  4A3F B;  3CMA A;  3BU2 A;  1F2Z A;  1KXL A;  2BOS A;  4JI8 L;  2VY3 A;  5CGK A;  4KLK A;  2Z4I A;  5JJZ A;  3D0F A;  3I2Z A;  4DV6 Q;  3JAM i;  1PV4 A;  2K14 A;  2NWG A;  3SK4 A;  3GTK H;  2B63 H;  1TR5 A;  3OW7 A;  1BBX C;  1HNZ L;  3NE5 B;  4GNX B;  4KJN A;  4KD4 A;  3E5S A;  4PMB A;  3VYS A;  3NSW A;  5FO7 B;  4DK3 C;  3BYT B;  1GJX A;  1EYG A;  5CV8 A;  4JI1 L;  2E5L L;  3VR3 A;  5I2Y A;  2K28 A;  3FPP A;  4CDE C;  1JOQ A;  1A62 A;  3Q23 A;  3I7F A;  3NQI A;  3TME A;  4B3T Q;  4BBR H;  1JMC A;  1D8L A;  2OXP A;  4CGY B;  3CRK C;  1XMQ L;  2D5D A;  1Q12 A;  5JEA H;  2QW7 A;  1FD7 D;  4XQQ A;  1HRJ A;  5AJ3 L;  3QG1 A;  4ODG A;  2KVM A;  1R4P B;  4H02 A;  4TKO B;  4UDU C;  4HN7 A;  5M3M H;  2A69 D;  4HCS A;  1CFM A;  2M9V A;  3M4O H;  4BBS H;  2R7Z B;  2ICE C;  4EX5 A;  1WTX A;  4GN4 B;  1O7L A;  5IGE A;  2L11 A;  2K5W A;  3DEP A;  3G6E A;  4V0B A;  5FLX E;  3EFX D;  1BCP D;  1R9T H;  2AWN A;  4U68 A;  4OWT B;  2A74 C;  3CC7 A;  3NHH A;  1GUW A;  5CYU A;  2RSO A;  2F0T A;  3CP0 A;  4FF2 A;  5JEA J;  5IP7 H;  5I6W A;  1H9R A;  3S1Q H;  2DUD A;  3H09 A;  2DGY A;  4LAA A;  1H9M A;  2B2V A;  2JJQ A;  1B70 B;  1ET6 A;  3K5O A;  4QB4 A;  2G5D A;  4KN7 C;  3D6C A;  1WTV A;  2A6H C;  1J6Q A;  4DV5 Q;  3D4D A;  1KL9 A;  1II3 A;  1Q1B A;  2K50 A;  2F52 A;  1TII D;  1SSO A;  2PW7 A;  2F1M A;  2UU9 L;  1PHJ A;  1CZG A;  3SXH A;  2G9D A;  1SNO A;  1SNP A;  2JQO A;  5AFW A;  4LFB Q;  3U9S A;  3L2P A;  3CKI B;  2KHJ A;  2V4D A;  1RD9 D;  1PH1 A;  1CKO A;  4LUO A;  4KKS A;  3HRZ C;  4LF9 Q;  1A3U A;  4B3S L;  1Y8N B;  3I4L A;  3HOY B;  4C3H H;  1JT8 A;  2N3S A;  1A2U A;  1YJN A;  1K83 B;  2EQS A;  5EBC A;  4HIM A;  4MIU A;  3JC6 6;  3STB D;  4JI0 L;  3RNU A;  2F0O A;  2L0C A;  4Z9C B;  2B29 A;  4HJ9 A;  3DMU A;  2RVL A;  1IBM L;  1QE6 A;  1VQB A;  1PDQ A;  3D4R A;  3T56 B;  1ILQ A;  2XIW A;  2B2W C;  1SBB B;  4FNF A;  1TWA B;  2XRQ D;  3NP8 A;  3VR2 A;  1I4H A;  5FJ8 H;  4QUF A;  1CK1 A;  1KHI A;  2JEA I;  3HKZ G;  5C4J H;  3H3V H;  3KUP A;  4JI6 L;  4K0K L;  3RZO H;  1PH7 A;  1WI5 A;  3I4M H;  5IT9 E;  4K2K A;  5EGT A;  2RHS B;  2VQF Q;  1VQG A;  5JJL A;  1K83 H;  2K32 A;  3SK5 A;  4F7X A;  1SNM A;  5C0X G;  5FLX c;  5COR A;  2LSS A;  2A6H D;  3KFU A;  4LFB L;  1KDB A;  1SYE A;  2MUY A;  1KNE A;  4TVA B;  1N9W A;  1ESF A;  1SYG A;  3H94 A;  1LT4 D;  2M2L A;  1HFN A;  1JR0 D;  1SEB D;  5D65 A;  2R92 G;  1LO5 D;  3FEW X;  3OPO A;  4RHR A;  2F0Q A;  1CTM A;  1YVC A;  5IOD A;  2Z9H A;  2ZJQ A;  3J81 i;  2PNR C;  3V96 A;  1TXY A;  4DV0 L;  1B3Q A;  4JI0 Q;  1AW7 A;  4KN4 C;  1A8V A;  4DK6 C;  3U4Z A;  4F87 A;  3CCE A;  1V1O A;  2HHH L;  1H9S A;  1O7Y A;  1NNX A;  4YIJ A;  4QCL A;  2B63 G;  1P8L A;  1STY A;  1U4R A;  1Q7Y C;  3PUW A;  1BOS A;  2PMZ B;  4LF8 Q;  1DGS A;  1KNA A;  1VQC A;  2SNS A;  3NUC A;  4DNT B;  1AZP A;  2WP8 J;  3I4M G;  1KAA A;  1XJV A;  4IFD J;  3TQY A;  1Z7T A;  2KOL A;  2PZT A;  3OW2 A;  3JAM c;  2AWO A;  2KJX A;  2IL8 A;  1M4V A;  2H5X A;  2R7Z G;  1AFP A;  5FLX L;  4IPH A;  1EYD A;  1Z47 A;  4A93 B;  1IXR A;  1KRS A;  3JAM E;  2ZM6 L;  4ILW A;  4DAM A;  2HIX A;  4CKE A;  5ISR A;  1CSQ A;  2ID0 A;  1G51 A;  3Q0A A;  2EYH A;  1GHJ A;  1GXD C;  3H6M A;  1IYV A;  4IUN A;  1EY9 A;  2NN6 G;  1PMR A;  2NTS A;  3S17 B;  3O13 A;  3TEH B;  2EXZ A;  2SNM A;  3DLL A;  3R3O A;  1TVX A;  1SXT A;  4OO1 H;  3GTG B;  4DV0 Q;  3MEH A;  2NZH A;  1VMP A;  1S40 A;  5M9O A;  2PW5 A;  4OO1 I;  3D3R A;  2L1B A;  1V1P B;  4C3I H;  3K59 A;  1XXG A;  3BVM A;  4DUZ L;  3SEB A;  1G29 1;  1VQH A;  2DN8 A;  2XWB B;  3CCM A;  2IPK D;  2AMC B;  4A3K B;  1EYC A;  1S5E D;  4ULL A;  3HOV H;  3AU7 A;  1D5X C;  2TMP A;  3K7U C;  1SND A;  3KJO A;  2ICI A;  1HQR D;  5HGT A;  1UE7 A;  2AUJ D;  4IUU A;  3T4A C;  3CPW A;  4PV1 C;  3K0X A;  1DZ1 A;  4BBS G;  4KHP Q;  3RMH A;  5C3E B;  4A75 A;  2L55 A;  2KED A;  1N33 L;  4PZ6 A;  4JV5 L;  4IFD H;  5A35 A;  4PMW A;  3RD4 A;  4O0A A;  2F3V A;  4WOR A;  1PTO C;  1QCB D;  3OIQ A;  1FJG Q;  1N36 Q;  5EPJ A;  1LUZ A;  1VQ5 A;  4BY1 G;  4B3M Q;  4U67 3;  1YJW A;  1DON A;  3H91 A;  1GUG A;  1TWG B;  4J15 A;  1BVS A;  3Q22 A;  1STA A;  1R4Q B;  2PZU A;  1KDC A;  2BDO A;  3QJY A;  1T5X D;  1GUN A;  1S5F D;  3C1E A;  3GTJ B;  1OXS C;  3G48 A;  4H13 C;  1I94 Q;  1Q46 A;  4BS9 A;  3T1H Q;  1QG7 A;  2HDL A;  4C3H B;  1C8C A;  3J81 E;  1DOL A;  1LAB A;  3AB9 A;  1PRT C;  3KLR A;  4POF A;  2ALY B;  2L4N A;  1LYL A;  2VZA A;  1TY2 A;  3A0J A;  4LF5 L;  1YIT A;  4DUY Q;  4KD3 A;  2JE6 I;  4HIO A;  4ZUJ A;  1HZA A;  2CW0 C;  1LTR D;  2EJM A;  4CJ0 B;  2Q8I B;  3UI2 A;  4OON A;  3A54 A;  2J0T D;  4C3J H;  2BA1 A;  2F0W A;  2PQA B;  1STB A;  2GVB A;  1N33 Q;  3BS1 A;  3M4Y A;  5DNF A;  2UXB L;  4DR2 L;  3H3V I;  4C1N K;  4RHS A;  3WOF A;  1B50 A;  4DV4 Q;  2KUM A;  3ERS X;  3H0G H;  1SE3 A;  2VS1 A;  4DR3 Q;  1C9O A;  1PFM A;  4Y52 H;  1PZI D;  5F2D A;  3FPU B;  5IYC H;  1PTO D;  1YHB A;  5D3D A;  5DEH A;  2NVX B;  3LX0 A;  1H95 A;  2LKV A;  1EWC A;  2F3W A;  3CD6 A;  3S2H B;  1G2T A;  2D62 A;  5IYD H;  2OCE A;  4DPG A;  1VQN A;  1JOR A;  4A3E B;  4PQX A;  4DV1 L;  4QGU A;  4DFA A;  3OTO L;  1H9S B;  1X56 A;  1F2M A;  3T53 B;  2B2Y A;  4KHZ A;  3H3V C;  4LFC L;  1BF4 A;  2JA6 G;  4JI4 L;  3M4P A;  1B8A A;  1IKL A;  1X3Q A;  1EWI A;  1N34 Q;  1I4R A;  3RUZ A;  4KKU A;  1KLG D;  3CCU A;  2J7Z A;  1B7Y B;  5K36 H;  3QR8 A; 
#chains in the Genus database with same CATH homology
 1C48 A;  1S4Z A;  2A68 C;  4EQP A;  4A3M B;  1YNN D;  1IKM A;  2KHS A;  5I2X A;  1RKN A;  4HCE A;  3I72 A;  1PRT B;  2BA0 A;  1TQO A;  2F0U A;  1I6V C;  5CR3 A;  1QNK A;  5EKK A;  1RTO A;  4IUV A;  3IAY A;  3P7J A;  1WTO A;  1RHP A;  3MA2 B;  3M85 A;  1NSN S;  3G6J B;  5G3L F;  3NPP A;  2RDF A;  5COY A;  2WKC A;  4CBV A;  1HQM C;  1W6J A;  4DK1 A;  1DOM A;  3MZ5 A;  1JQY D;  4OHJ A;  2Y0S B;  3HP3 A;  4FP5 D;  3NWT A;  5EPK A;  3IFT A;  2B2U C;  1ZXT A;  5C44 B;  4CKB A;  1A3V A;  3PUV A;  2NBF A;  1H9K A;  3QOJ A;  4KI0 A;  1TWH B;  2N55 A;  4O1N A;  2B39 A;  2DY8 A;  1YNN C;  4KHV A;  4RGT A;  3EVQ A;  3FMC A;  3J7Y W;  4CJ1 B;  2CHB D;  1SNQ A;  3P1H A;  1QNU A;  2AUK A;  1BDO A;  4MN3 A;  3HOW B;  1E2V A;  1PTO B;  2XN9 C;  4KV6 A;  5J39 A;  2NN6 H;  4S3S A;  2WB1 B;  3E6Z X;  2EYF A;  3EA6 A;  3PV0 A;  4KJO A;  1Y1V B;  2NVT B;  4IFD I;  2PPB C;  5CV7 A;  1L0X B;  1ILP A;  2CVR A;  2FFK B;  3L9A X;  1STG A;  3MC0 B;  4BBS B;  4EVO A;  1X32 A;  3L7Z C;  5D14 A;  2F0I A;  1A2T A;  1EZ8 A;  3TP5 A;  3J80 E;  3C3L A;  2LFN A;  4G7H C;  3P75 A;  3PIO 3;  1RJT A;  3VR4 A;  3S2D B;  2K5Q A;  3TSS A;  4BY1 B;  1BR9 A;  4H7B A;  2YU9 B;  5CV4 A;  1AZQ A;  2I07 B;  1LT6 D;  2RKS A;  3FDT A;  5G3L D;  4DNR B;  3GTK B;  1NAP A;  1CHQ D;  4XIG S;  2R93 B;  2F0D A;  4C3J B;  3SE0 A;  3D31 A;  1SYB A;  4K8J A;  2ZXO A;  1G6Z A;  1I4G A;  3OOC A;  5JEA G;  4NP5 A;  1V8Q A;  1Y8O B;  2EY2 A;  2F0L A;  2BE5 C;  5EJW A;  4DF7 A;  4KY5 A;  4LMQ D;  2H1E A;  5IGB A;  2QEJ C;  1XX8 A;  4E6I A;  5K36 G;  3RZO B;  4DAY A;  3FRP B;  5TSS A;  2QIL A;  4BBR B;  3L3O C;  2PZW A;  4OIK A;  3M7G A;  3T16 A;  3KBX A;  1EY6 A;  1VCI A;  3KLS X;  4OGQ C;  3K6O A;  1ESR A;  4I7Z C;  4IUP A;  3TP8 A;  2WAQ B;  2JEB I;  2OEO A;  3QO2 A;  1HUM A;  2X6L A;  5EQ0 A;  5K5P A;  3MXP A;  2PYK A;  2R3Z A;  5BN3 A;  4NDX A;  1PFN A;  3G7L A;  3TN2 A;  4C3J G;  3VR6 A;  2QF7 A;  3D6W A;  4BA1 I;  1I4X A;  4EQN A;  5A2Q L;  4KMU C;  5ELC A;  1EU3 A;  5C4X B;  1S5C D;  3CRL C;  3T13 A;  4ID6 A;  2RA4 A;  1E2W A;  1F2Y A;  3V2T A;  3CQZ B;  5A2Q E;  1JOK A;  1U4L A;  4WFN 3;  1A15 A;  1Q8I A;  1CI3 M;  4X3S A;  3M4O B;  1I3Q B;  4Q0F A;  2EPB A;  3K5N A;  1YNJ D;  4P2C B;  2EY5 A;  2TSS A;  4GZY C;  1EFI D;  1ICW A;  3BDC A;  3W2D A;  5C0X H;  3TDQ A;  1PRT F;  3SVM A;  1CT1 D;  1E0B A;  1EOT A;  1ET9 A;  2VXW A;  4IZ8 A;  2L12 A;  1DOK A;  1HHV A;  1RDP D;  2KQ3 A;  3BZD B;  1JWU D;  4LJZ C;  2MHV A;  5KRU A;  3KBG A;  2LMC B;  4ABN A;  2EOT A;  2MGS A;  2K6A A;  3HZX A;  4ZRZ A;  1CQV A;  1MD2 D;  2QDB A;  1BXT A;  1OXV A;  1HA5 A;  3K57 A;  1D1I A;  3A7L A;  1S5D D;  4KTA A;  3LWE A;  2C5C A;  2EYJ A;  3BDO A;  4EGV A;  3BVZ A;  3VA5 A;  3S15 B;  5LL6 X;  2B2T C;  3EQL C;  3GV3 A;  2O4X A;  4DN4 M;  1YNJ C;  2WKD A;  2JA6 B;  2WII B;  2AQ2 B;  2JXM B;  2L5T A;  1S5B D;  1ZYR C;  2E2D C;  1EY0 A;  4RKL A;  4KK7 A;  2E74 C;  2B2U A;  2MJ8 A;  3IL8 A;  4KKT A;  5I4D A;  2E2H B;  3U9O A;  3R2I A;  1HPC A;  5J22 A;  3WOE A;  1U4M A;  3M7N A;  4IUT A;  3VA7 A;  4B9X A;  4RCN A;  1TWF B;  5CBE E;  1SYD A;  3VYU A;  4FF1 A;  4CJ2 C;  1H9J A;  3GTL B;  4JBW A;  1KLU D;  2ZXR A;  4PNY A;  5JPN C;  2ZT9 C;  3KF8 A;  1D6E C;  2VUM B;  3PUZ A;  1HXY D;  3QWN A;  2EYP A;  1SE2 A;  5HUR A;  1B4O A;  4RGO S;  2EJG C;  1SMY C;  1EYA A;  2YYZ A;  4RGN A;  1WVL A;  1I6H B;  5FO9 B;  3X3M A;  4DAV A;  1MGS A;  4B08 A;  3J7A V;  4FO2 A;  4M8A A;  1A6X A;  2F0H A;  3GO5 A;  2D2C C;  3I8Z A;  1XYI A;  4C3H G;  4ZAI A;  1VMC A;  2NYZ D;  1G2S A;  2DNC A;  3TZD A;  1CQF A;  1U4P A;  1SFO B;  4RCO A;  1TS4 A;  4X3K A;  3PUX A;  3FKI B;  1EQV A;  3OMG A;  3MTS A;  1E2Z A;  1NCV A;  4RAU C;  4DA2 A;  5M5W B;  4IUR A;  3HG9 A;  3IFD A;  3I73 A;  4O42 A;  3MHB A;  4G57 A;  1AEX A;  2XRS D;  2A6E C;  3GP7 A;  3OMC A;  5D3I B;  1WCM B;  4CHT B;  1AP0 A;  3Q6S A;  4X3T A;  4DU9 A;  5IIF A;  2VB3 X;  1EWH A;  4DGZ A;  3C1F A;  3JAM L;  3MAQ A;  2E2J B;  2FMC A;  5I9O A;  3K5L A;  2F03 A;  3MFG A;  1B53 A;  3RZD B;  3AMU A;  3I90 A;  3DWA A;  3MVV A;  1Y1W B;  4ZKC B;  1MBY A;  4XDX A;  3T51 B;  4PMC A;  1F9R A;  3VR5 A;  2PO4 A;  4TRD A;  1SYF A;  3NTI A;  1VDZ A;  1JCK B;  4ZUI A;  3NK9 A;  5EBD A;  4DK0 A;  1BNZ A;  2E76 C;  1J8I A;  1TT2 A;  2M00 A;  3TZU A;  5CV5 A;  5CV9 A;  3ONA B;  3KLS A;  2OF1 A;  1X3P A;  2RBM A;  4XXE A;  5LL6 S;  4TSS A;  4DXG A;  2A5H A;  2A6E D;  2O5J C;  4C3I B;  4IQZ A;  1SAP A;  4XYQ A;  5C5M A;  4A3D B;  1SYC A;  1BQQ T;  3KK7 A;  4RA8 A;  3BVG A;  2IX3 A;  1CZW A;  1DD2 A;  1XWE A;  3C46 A;  3NBH A;  1HTL D;  2NTT A;  4F8M A;  2F4I A;  1CA6 A;  1F77 A;  4K5W A;  3S9W A;  1STE A;  1RCV D;  3EJI A;  2NZ1 D;  1FNU A;  2K33 A;  3K7A B;  4HR7 B;  4H0L C;  2PCF B;  4FF4 A;  3HKZ B;  3R93 A;  3SK6 A;  2N88 A;  4BA2 I;  1TWC B;  3DEO A;  3PO2 B;  5CMD A;  4UAI A;  1OXT A;  5JPM C;  3K58 A;  2NVY B;  3A8J E;  1JWS D;  3HOX B;  4L63 B;  1B44 D;  1D5Z C;  1ML0 D;  1PTO H;  2FMM A;  4G7Z C;  2WAC A;  1PLF A;  3DHQ A;  2BDN A;  1JB3 A;  1JC7 A;  5IGG A;  5KYL A;  1FYC A;  3IKJ A;  1EY5 A;  1EEF D;  3TBI B;  1F2L A;  3ND8 A;  5IOC A;  1FNV A;  1JIC A;  1SJH D;  5J1Z A;  2XNA C;  5CV6 A;  2QCP X;  5KGU A;  4FXD A;  1MSG A;  5EKL A;  5EPL A;  3M3Y B;  1LAC A;  4QUC A;  4KY6 A;  1LV9 A;  2K01 A;  4RWS C;  3E0J A;  4RGM A;  5E4W C;  2X69 A;  2A73 B;  3LNN A;  2EVB A;  1BCP B;  1F9P A;  3NXW A;  3HEJ A;  2H4O A;  2FJ2 A;  4C56 C;  4FVM A;  4QIW B;  5FKA C;  1LT3 D;  3C2P A;  1NR2 A;  2A68 D;  1D1K A;  3MXN A;  3QIA A;  1PZJ D;  1UNS A;  3MXU A;  4G7O C;  1BO0 A;  5DM7 3;  1GUS A;  3OIP A;  4WJW A;  2B2T A;  2IX1 A;  1DCZ A;  2K1B A;  3S16 B;  2IWH A;  4K8I A;  1B9M A;  4HMJ A;  3J81 L;  3S1Q B;  1O78 A;  1HUN A;  1OXX K;  3N6R A;  5JAV A;  1OO9 B;  1A3T A;  2BCO A;  1TY0 A;  5KIX A;  3D8G A;  4R8N A;  2JA5 B;  3TP6 A;  1ENC A;  5E3F A;  4ZLT F;  1V1P A;  2EYM A;  2F0S A;  5CBA E;  1ONL A;  4EQO A;  2IX0 A;  3A8K E;  1K8O A;  4K6L A;  1PTO F;  2RQX A;  1SDF A;  1B3A A;  2JP1 A;  3NWS A;  2K7V A;  5C3X A;  2JYO A;  1W6K A;  4FYD A;  1TS5 A;  2L9H A;  1B9N A;  1IL8 A;  1IYU A;  2MP1 A;  2A69 C;  2R61 A;  2IJ0 A;  3NBI A;  2OT2 A;  1EY7 A;  1SNC A;  2K04 A;  5IGF A;  3ERQ A;  1FGB D;  1LTI D;  5ELE A;  1LTB D;  4A3G B;  3V05 A;  3DUZ A;  2K05 A;  3PIP 3;  1BCP C;  4HTH A;  4XQJ A;  3I4N B;  2EY6 A;  2KCN A;  2HCC A;  2B63 B;  3VYR A;  1ZEQ X;  4F88 A;  2FIN B;  4ZK9 B;  4K5V A;  1EQT A;  2LS0 1;  1IHZ A;  2Z4H A;  2RDG A;  4IN3 A;  1RTN A;  1GUT A;  3QB3 A;  1EU4 A;  4CKC A;  1HTP A;  1CHP D;  2EZV A;  2ENB A;  3HOV B;  1SE4 A;  1ENA A;  3BDL A;  3S1M B;  2KEE A;  4M1U B;  5ELD A;  1EEI D;  5NUC A;  1WTQ A;  5IGC A;  1EIH A;  3S1R B;  4K6D A;  1T5E A;  4H44 C;  1UEA B;  5KNC A;  2JA8 B;  3LWU A;  4OIJ A;  2RSN A;  1EZ6 A;  2CQA A;  4ZKB B;  3P20 A;  1PRT D;  2F0M A;  2MPM A;  2DNE A;  5BN5 A;  2EYL A;  1LTA D;  4ZQ3 A;  2NB0 A;  2R92 B;  1VF5 C;  1ENF A;  1D2B A;  2XSC A;  1DYQ A;  3QOL A;  4Y7N B;  5C4H A;  2CW0 D;  4XT1 B;  5ELF A;  2I46 A;  3BYY B;  2EY1 A;  3NTK A;  2SEB D;  3PO3 B;  1QB5 D;  1GOZ A;  5M5Y B;  4MHE A;  3D4W A;  1UUP A;  1CA5 A;  1WD0 A;  2E75 C;  4Q5V A;  5JVH 3;  1LTT D;  1LTG D;  4HSV A;  1O7Z A;  3A56 A;  2EJF C;  2KA7 A;  2GA4 B;  5C3W A;  3Q24 A;  2E2I B;  2EYO A;  1C4Q A;  1TU2 B;  5FO8 B;  2HUG A;  5C4J B;  1B1Z A;  1DJR D;  4HSP A;  2KCC A;  4I65 A;  5BN4 A;  3GQB A;  3TP7 A;  3CHB D;  3MXG A;  3A55 A;  4J8Q A;  4N9P A;  5LHY 1;  1FR3 A;  1QOH A;  2SDF A;  2EDG A;  1DM0 B;  2O5I C;  3GTQ B;  2JA7 B;  1JOO A;  1Y8P B;  1WTP A;  4L6T B;  1GUO A;  3K5M A;  3I70 A;  2D9U A;  4C1N I;  4QMG A;  2Q8R E;  1RF2 D;  1BCP F;  1VF7 A;  4V19 0;  3MWY W;  4TQU S;  5KYI A;  3SR1 A;  4J6H A;  1TKW B;  2B2W A;  2IT1 A;  2FHT A;  3J80 L;  4B9W A;  4JK1 C;  1QJO A;  3SHL A;  1SMY D;  5JOB A;  3HOZ B;  1IW7 C;  3PMF A;  5FK9 C;  3OSO A;  3BG3 A;  1HA6 A;  1NR4 A;  1R9T B;  4RFB A;  4HAE A;  1TS2 A;  4HMI A;  1STN A;  3ITP A;  4X3U A;  4OL7 A;  1CM9 A;  3DM1 A;  1STH A;  3GTP B;  4A3B B;  4FXK C;  5FOB B;  4DXF A;  2VB2 X;  4ZYS A;  1M8A A;  3NQT A;  3OWF A;  4RH6 A;  1UAP A;  5ELB A;  5T1I A;  2HDM A;  2F0P A;  4A3J B;  2X6G A;  4FF3 A;  3A8I E;  3MFY A;  2SOB A;  2LY7 A;  4XTC S;  1PXU A;  2Q8T A;  2JSO A;  3WDN A;  5I6Y A;  3DWP A;  1WTR A;  5DAU A;  5I9P A;  3NTH A;  2XWJ B;  5C0X I;  1IW7 D;  4IUQ A;  3ND9 A;  3S14 B;  5E4X A;  2B8F A;  1DXM A;  2B2V C;  1WD1 A;  3FVQ A;  2Z8L A;  5M3M B;  3GTM B;  2C9O A;  1PZK D;  1KDA A;  4NMZ A;  2J4X A;  5T1G A;  1I4Q A;  4IFD G;  3GD7 A;  4L8J A;  1F9Q A;  1KAB A;  5IGD A;  1Z6H A;  3URY A;  3HOU B;  2RDH A;  3W3A A;  5C6A A;  1Y69 U;  2NUC A;  1MI2 A;  1ROD A;  1ZYR D;  1LLR D;  1Q1E A;  4AYB B;  5EKI A;  3SDZ A;  2NVQ B;  5E1F A;  3OHX C;  4XT3 B;  1V43 A;  3DWQ A;  4QF4 A;  1D5M C;  1EL0 A;  1F9S A;  2F0K A;  3GV6 A;  1EY4 A;  1FNW A;  3S1N B;  4K2L A;  3ZYY X;  4FXG C;  3VYT A;  1ZKO A;  2BE5 D;  3F2U A;  3GTO B;  3ERO A;  5M5X B;  4OO1 G;  3CU7 A;  4K14 A;  2F0F A;  3I3C A;  4NW2 A;  3RLF A;  1QWY A;  1SJE D;  4HED A;  5JVG 3;  5C5L A;  4R8I A;  2DY7 A;  4XYO A;  5KND A;  1BUV T;  2B8G A;  3K0Y A;  5M3F B;  2G9H D;  2K5D A;  4A3I B;  3R2T A;  3PUY A;  5KNB A;  2F0N A;  1HCZ A;  1GHK A;  4NKL A;  1TS3 A;  5DM6 3;  1Q90 A;  1B2T A;  3N52 A;  4RKB A;  4R9W A;  1JWM D;  2F0E A;  1L0Y B;  1XTC D;  3H0G B;  2F0J A;  1PYW D;  1KTK A;  2Z1C A;  3HS0 C;  2WIN B;  5KEE A;  1JE4 A;  2XVS A;  1WTW A;  1K8M A;  1AN8 A;  4WRD A;  2ZXP A;  4KY7 A;  1NUC A;  4ME5 A;  1QIL A;  3A7A B;  2KEC A;  2AQ3 B;  1PFB A;  3SK8 A;  2VNU D;  1O80 A;  5C0X J;  2O2L D;  2B2Y C;  4DAP A;  1J9O A;  1U9R A;  1EIG A;  4J1M A;  2AQ1 B;  4N9T A;  2F0V A;  3J7A F;  3I91 A;  5CC4 A;  2WV6 D;  3I4M B;  3R8B A;  4IAL A;  2HQE A;  1I4P A;  4G4K A;  3DXJ C;  4C3I G;  1G91 A;  1MSH A;  1OXU A;  1EY8 A;  2F0G A;  2NN6 I;  2PQE A;  1G8Z D;  4K5X A;  2R6G A;  4BWG B;  2K03 A;  2IW3 A;  1LTS D;  4C2M B;  4BY7 B;  3OWE B;  1LT5 D;  1I50 B;  2HCI A;  1Q3L A;  4XQN A;  3HGB A;  2QKI C;  2EE1 A;  4LK1 C;  5C4Z A;  5IT9 L;  3X3N A;  1HFG A;  4A3F B;  1F2Z A;  2BOS A;  5CGK A;  5JJZ A;  2Z4I A;  2NWG A;  3SK4 A;  1TR5 A;  3OW7 A;  1BBX C;  3NE5 B;  4KJN A;  4KD4 A;  3E5S A;  4PMB A;  3VYS A;  3NSW A;  5FO7 B;  3BYT B;  1GJX A;  5CV8 A;  3VR3 A;  5I2Y A;  2K28 A;  3FPP A;  1JOQ A;  3Q23 A;  3NQI A;  3TME A;  2OXP A;  4CGY B;  3CRK C;  2D5D A;  1Q12 A;  5JEA H;  1FD7 D;  4XQQ A;  1HRJ A;  3QG1 A;  4ODG A;  2KVM A;  1R4P B;  4TKO B;  4UDU C;  4HN7 A;  2A69 D;  4HCS A;  1CFM A;  2M9V A;  2R7Z B;  2ICE C;  1WTX A;  1O7L A;  5IGE A;  2L11 A;  2K5W A;  3DEP A;  4V0B A;  5FLX E;  3EFX D;  1BCP D;  2AWN A;  4U68 A;  2A74 C;  3NHH A;  1GUW A;  5CYU A;  2RSO A;  2F0T A;  4FF2 A;  5JEA J;  5I6W A;  1H9R A;  3H09 A;  4LAA A;  1H9M A;  2B2V A;  1ET6 A;  3K5O A;  4QB4 A;  4KN7 C;  3D6C A;  1WTV A;  2A6H C;  3D4D A;  1Q1B A;  1II3 A;  1TII D;  1SSO A;  2PW7 A;  2F1M A;  1CZG A;  3SXH A;  2G9D A;  1SNO A;  1SNP A;  5AFW A;  3U9S A;  3CKI B;  2V4D A;  1RD9 D;  4KKS A;  3HRZ C;  1A3U A;  1Y8N B;  3I4L A;  3HOY B;  1A2U A;  1K83 B;  5EBC A;  4MIU A;  2F0O A;  2L0C A;  4Z9C B;  3DMU A;  2RVL A;  1QE6 A;  1PDQ A;  3D4R A;  3T56 B;  1ILQ A;  2XIW A;  2B2W C;  1SBB B;  4FNF A;  1TWA B;  2XRQ D;  3NP8 A;  3VR2 A;  1I4H A;  4QUF A;  1CK1 A;  2JEA I;  3KUP A;  5IT9 E;  4K2K A;  5EGT A;  2K32 A;  3SK5 A;  4F7X A;  1SNM A;  5C0X G;  5COR A;  2A6H D;  1KDB A;  1SYE A;  2MUY A;  1KNE A;  1SYG A;  1ESF A;  3H94 A;  1LT4 D;  2M2L A;  1HFN A;  1JR0 D;  1SEB D;  5D65 A;  1LO5 D;  3FEW X;  3OPO A;  4RHR A;  2F0Q A;  1CTM A;  5IOD A;  2PNR C;  3V96 A;  1AW7 A;  4KN4 C;  4F87 A;  1V1O A;  1H9S A;  1O7Y A;  4YIJ A;  4QCL A;  1STY A;  1U4R A;  3PUW A;  1BOS A;  2PMZ B;  2SNS A;  1KNA A;  3NUC A;  4DNT B;  1AZP A;  2WP8 J;  1KAA A;  4IFD J;  1Z7T A;  2KOL A;  2PZT A;  2AWO A;  2KJX A;  2IL8 A;  1M4V A;  1AFP A;  5FLX L;  1EYD A;  1Z47 A;  4A93 B;  3JAM E;  4ILW A;  4CKE A;  5ISR A;  2ID0 A;  3Q0A A;  2EYH A;  1GHJ A;  1GXD C;  3H6M A;  1IYV A;  4IUN A;  1EY9 A;  2NN6 G;  1PMR A;  2NTS A;  3S17 B;  3O13 A;  2EXZ A;  2SNM A;  3R3O A;  1TVX A;  1SXT A;  4OO1 H;  3GTG B;  3MEH A;  1VMP A;  5M9O A;  2PW5 A;  4OO1 I;  3D3R A;  2L1B A;  1V1P B;  3K59 A;  1XXG A;  3BVM A;  3SEB A;  1G29 1;  2DN8 A;  2XWB B;  4A3K B;  2IPK D;  1EYC A;  1S5E D;  4ULL A;  3AU7 A;  1D5X C;  2TMP A;  1SND A;  2ICI A;  1HQR D;  5HGT A;  2AUJ D;  4IUU A;  3T4A C;  4PV1 C;  1DZ1 A;  3RMH A;  5C3E B;  2L55 A;  2KED A;  4IFD H;  5A35 A;  4PMW A;  3RD4 A;  2F3V A;  4WOR A;  1PTO C;  1QCB D;  3OIQ A;  5EPJ A;  4U67 3;  1DON A;  3H91 A;  1GUG A;  1TWG B;  3Q22 A;  1STA A;  1R4Q B;  2PZU A;  1KDC A;  2BDO A;  3QJY A;  1T5X D;  1GUN A;  1S5F D;  3C1E A;  3GTJ B;  1OXS C;  4H13 C;  4BS9 A;  1QG7 A;  2HDL A;  4C3H B;  1C8C A;  3J81 E;  1DOL A;  1LAB A;  3AB9 A;  1PRT C;  3KLR A;  2L4N A;  1TY2 A;  4KD3 A;  2JE6 I;  4ZUJ A;  2CW0 C;  1LTR D;  4CJ0 B;  2EJM A;  2Q8I B;  3UI2 A;  3A54 A;  2J0T D;  2BA1 A;  2F0W A;  1STB A;  3BS1 A;  3M4Y A;  5DNF A;  4C1N K;  4RHS A;  3WOF A;  1B50 A;  2KUM A;  1SE3 A;  1PFM A;  1PZI D;  5F2D A;  3FPU B;  1PTO D;  5D3D A;  5DEH A;  2NVX B;  3LX0 A;  2LKV A;  1EWC A;  2F3W A;  3S2H B;  1G2T A;  2D62 A;  1JOR A;  4A3E B;  4PQX A;  4DFA A;  1H9S B;  1F2M A;  3T53 B;  2B2Y A;  4KHZ A;  3H3V C;  1BF4 A;  1IKL A;  1X3Q A;  1I4R A;  3RUZ A;  4KKU A;  1KLG D;  2J7Z A;  5K36 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...