1IBMQ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ibmQ00
1OXVA 1K0RA 2F4VQ 2R92G 4A3JH 2EIFA 3FKIH 3CCRA 1L1OB 3PO2H 3VDYA 1OXUA 4LFAL 3G4SA 2BH2A 1N34Q 2ES2A 5J3BA 1X3FA 4UPAA 2Z6KC 2CKZB 4DR6Q 3OTOL 4DV1Q 2K4KA 3RLOA 1L1OC 1TWHH 1JB7A 1JT8A 4R4TA 1X56A 1W2BA 4NXNL 3Q8DA 1HR0W 2PQAB 2IT1A 1KXLA 4PZ6A 1YBYA 3EBEA 3LGJA 1V1QA 4DUZL 3D0FA 4JC0A 3H0GH 3HOZG 2JA9A 4PG3A 4AYBE 2YV5A 3HOUH 3IRBA 4DR1Q 4AH6A 1BKBA 1HNWQ 2K52A 3G48A 5C0XG 1J5EL 4GKJL 5LMNW 3K7UC 5AJ3Q 1SROA 4DR2L 1JE5A 2L15A 2E5LL 2F3IA 2VQFL 4JBJA 2UU9L 4B3RQ 1XPRA 1D8LA 2FXQA 1O7IA 1VQ9A 2UUCQ 3RZDH 4DR5L 4A3CG 4TVAB 3GTQH 1YVCA 4DK3C 1X6OA 2EXDA 4YY3L 1R9TH 4JV5Q 3M85A 4BY1H 4KLKA 4IPHA 4LF4L 1HZCA 1WFQA 1ASYA 2MNAA 1PH5A 1NBWA 4JG2A 1HNXL 1UEBA 4OO1G 4ALPA 1JMCA 4P72A 3AEVA 1WOCA 5JJIA 4DV3L 1K8AC 2XGTA 1I94L 5K36G 3E0EA 3I55A 5GADC 4LFBQ 4A3GH 1XMOQ 4YCUA 5M5XH 1N36L 1LUZA 3S15H 1NMGA 2CWAA 5M3MH 5IT9c 4A3JG 4P75A 4JBMA 3FKIG 2YTXA 4A3KH 1N33Q 2HT1A 3PO2G 1E1TA 2QEXA 3WWVA 1WCMH 1Q1EA 4JI5L 1VQ8A 3S17H 1EYGA 5C3EH 2B29A 1EQQA 4UP7A 4EX5A 1HNZL 4LFAQ 3HOXH 2HHHQ 3OTOQ 4GLVB 2JA6H 2Z6KA 1CUKA 2MQHA 1N8RC 2OTJA 1IYJB 1N32L 3GDEA 1L1OA 1FVIA 1EIFA 4NXNQ 3GO5A 1H95A 2AHOB 3AQQA 3H0GG 3HOUG 2JA5G 5HGQA 4DUZQ 4LUZA 3I56A 1PA6A 3PGZA 4AIMA 4C2MH 1K73C 3L7ZC 2PQAA 4O0AA 1J5EQ 4LF5L 4GKJQ 4TQUS 3K80C 5HY6A 3CPWA 4AQYL 2JA8H 2VNUD 4R4CA 4DR2Q 4MZ9A 4JI4L 1VQIA 3STBC 1CSPA 4L5TA 1CKNB 1S40A 2VQFQ 2E5LQ 2UU9Q 4DR4L 3JC66 4BA2I 4GN5A 1A0IA 4DR5Q 4X62L 1Q1BA 1VQCA 2RHQB 3RN2A 4KHZA 2K75A 3K8AA 2R93H 1VQ7A 1VQDA 3EN2A 2B63H 1EQRA 3PUYA 2D0OA 3RLNA 4YY3Q 3STBD 4OXPA 2VUMH 4A3BH 1SR3A 5IYDH 1IXRA 1OXTA 3CP0A 1Y1VH 5BR8L 3ER0A 4LWCA 4A3IH 4LF4Q 3S2DH 1HZAA 1HNXQ 3AYHB 1KQSA 1WJJA 3OYYA 1UE7A 4A3EH 1FGUA 1UE1A 1V9PA 2Y0SG 3I2ZA 1PH6A 1RIPA 2B3GA 2KCTA 5EAYA 2UUAQ 4LF9L 3PF4A 4DV3Q 2PNHA 1YI2A 4X64L 2D62A 2ZTEA 2K50A 4DV0L 4A3FH 1VQOA 4JI8Q 1I94Q 1YJ9A 1QZHA 3E9IA 4A3KG 1N36Q 4GOPB 1P16A 3W1GA 1WCMG 2KHIA 3U4ZA 1C9OA 5FJ8H 4OX9L 4WJ4A 5ELNA 1XJVA 4YCWA 1GVPA 3A5UA 1CSQA 1Y14B 4PMWA 5C3EG 1DGSA 3HOXG 2JEAI 3EIVA 1AE3A 3H15A 4GOPC 3AFPA 3TEHB 3DLLA 5JEAJ 1HNZQ 5ELOA 2IX0A 4RMFA 2ZJQA 3CAMA 1MIUA 1Y1WH 4UP9A 3A74A 4IOAA 4OWXB 1N32Q 1HR0L 1L0WA 2EQSA 3NBHB 2ZM6L 4BXXH 3W1BA 3J7A5 3UDXA 3TREA 4DAMA 4BBSH 1Q8KA 1PFSA 2C35B 4IFDJ 2KCMA 2NVQH 3S16H 1VQAA 4LUOA 1VQ5A 3I7FA 1IZ6A 3T1HL 2JA8G 3PIPA 5LMNL 1PH2A 4LF5Q 4JI1Q 1BBUA 1VQPA 1UE6A 3BZKA 4AQYQ 4JI4Q 5DLQE 2I0QA 4JI0L 2CCZA 3W5OA 1PYSB 3T1YL 4DR4Q 1B7YB 1KHIA 1PH1A 4OONA 2Y0SE 4R4OA 4X62Q 2B63G 1QUQA 1A8VA 2VUMG 1K83H 1PV4A 1PYBA 5IYDG 3S1NH 1CKNA 1TWCH 2IY5B 1OTCA 3I4MG 1Y1VG 4A3IG 4PZ8A 4GS3A 3HFZB 4MTNA 1HJPA 1ASZA 5BR8Q 3A5ZB 2E2HH 2MO1A 4QQBX 4A3EG 3M4OH 4LF9Q 1YITA 2D0PA 1VQFA 2K5HA 5IYBH 4HIOA 2UXBL 4APVA 3A0JA 4X64Q 4DV0Q 4LF7L 4IPGA 3U58A 2JA7H 3TQYA 3I4NH 5GROA 1E1OA 1TXYA 4LW1A 1A63A 3GTPH 1VQGA 1EUJA 1E3PA 2I5LX 3PF5A 4OX9Q 3RN5A 4UY8C 4A93H 4QJFA 3KF8B 3KF6B 3CCJA 3HOYH 2PMZE 1GM5A 2A8VA 4POFA 1XPUA 3HOVG 4KHPL 2I5HA 1NMFA 1Y1WG 4GOPA 3KDFB 3G6EA 4QGUA 3UDGA 1X55A 2A19A 1PVOA 4X6AH 4GN3B 3B6YA 3UDFA 1NY4A 1WI5A 4UP8A 3E9HA 1HR0Q 2N78A 1VQ6A 3PUZA 4R4QA 4JI6L 4LF8L 1MJEA 1E24A 5GAGC 2ZM6Q 1JJCB 4BBSG 1VQNA 3GTJH 5FLMH 4DV4L 1X9NA 3BJUA 5C0XI 1CKMA 1E7ZA 4QIWE 3L2PA 2H5XA 3H3VI 3J7ZC 2OWOA 4K0KL 3HOWH 1SRUA 1VQHA 3AFQA 4DAYB 3T1HQ 5LMNQ 1GD7A 2E2JH 1QVCA 2AKWB 1D7QA 4P73A 4P71A 4DR7L 3BZCA 3UE1A 1PH9A 4JI0Q 4BY7H 1V43A 2LSSA 3MEFA 4HIKA 3T1YQ 4YWKA 2BH8A 3J81c 4WJ3M 2QA4A 4DUYL 2CWPA 3UE0A 1YIJA 1A62A 2N49A 2V1CC 1QUQB 1FJGL 4A3LH 5LMUL 3ICEA 5IP7H 2VQEL 1EFWA 3S14H 2GN5A 3JAMc 4IFDI 5M5YH 4JI3L 4R4IA 2R92H 1X54A 3S24A 3KFUA 5M5WH 1UE5A 2IHEA 1JJGA 2AWOA 1G6PA 2N8NA 2NZHA 1PHJA 1KIXA 4BY1G 1AE2A 1MJCA 2ID0A 4B3TL 4A4IA 4DPGA 1Q7YC 3CPFA 1G51A 3PSIA 3I4NG 1NTGA 2UXBQ 4LF7Q 1YZ6A 1P8LA 2KENA 2Q2HA 3GTKH 4BBRH 4YCVA 2JJQA 4JBKA 2HIXA 4DNIA 3UDIA 4A93G 3PO3H 2K14A 3HOYG 3PIOA 1YJNA 3GTLH 4XTCS 2WAQG 4A3GG 2UXCL 1IBML 1PH4A 4Y52H 2OQ0A 4X65L 1I3QH 3F8TA 5M3MG 3J81i 3H3VH 4C3HH 4DKAC 2OCEA 2R7FA 3CCUA 1X3EA 3CCVA 4B3ML 1QVGA 1CKOA 1N9WA 2CQOA 5IE8A 5C0XJ 3F2BA 2VZAA 4JI5Q 4JI7L 5JJKA 3KF6A 3PUXA 4DV5L 4DK6C 2NVXH 2HQLA 1HZBA 4DV6L 4JI6Q 4ME3A 1SE8A 1OXXK 3CXCA 3KDFA 4A76A 4LF8Q 5IWAL 4BA1I 4A75A 1YJWA 3G71A 4DV4Q 4HJ9A 1HZ9A 3SGIA 1XMQL 1I50H 2VW9A 2E8GA 4K0KQ 1LTLA 4L5QA 2JK8A 1NE3A 1G291 1AH9A 4JI2L 3F2DA 1S3OA 2PI2A 3ULJA 1Q81C 4DR7Q 1XPOA 1GO3E 2OTLA 2NVTH 1KC8C 4LF6L 1XNRL 4RG1A 5IP9H 5C4JH 1VS0A 4GLXA 1RL2A 1J6QA 3NENA 1Z47A 3PCOB 4DUYQ 2YTYA 3GD7A 4JCVE 1Q46A 3BU2A 2K5NA 3HKZG 1X3GA 5IP7G 1QVFA 1SN8A 1FJGQ 2Q2IA 3RR5A 2E2IH 5LMUQ 4LNQA 1TWFH 2RCNA 2VQEQ 4JBWA 2ZTDA 5C4XH 4NPSA 4JI3Q 1U5KA 3KYHC 2A1AA 1I5FA 4IOCA 4NXML 2R93G 2UXDL 5IY0A 4Y7NH 2HHHL 2NN6I 2WAQE 2NVYH 2ZJRA 1IBKL 4P74A 1C0AA 4A3BG 3L0OA 3TS2A 3S1RH 2UUBL 3S2HH 3M3YH 4B3TQ 4JYAL 1Z9FA 2RHSB 3HKSA 1K3RA 1KD1C 3RNUA 3CCMA 4J15A 4BBRG 3RLFA 3CCEA 1E22A 1BBWA 4DR3L 3PO3G 1PH3A 3F2CA 1W3SA 1BVSA 4HJ7A 2JA5H 3DM3A 4YHHL 4JOIC 2MFIA 2YYZA 4A3FG 4OWWB 1EOVA 2IX1A 2UXCQ 1IBMQ 1U0LA 2NZOA 2KBNA 4X65Q 1UWVA 1IBLL 2DGYA 1YNXA 2ASBA 4XIGS 5FJ8G 1T9HA 1QZGA 5JEAG 2Q2TA 3I4OA 3TRZA 4IPCA 4B3MQ 3FHWA 1X65A 4A3MH 1C7YA 1VQEA 1HH2P 4JI7Q 4DV5Q 4LFCL 2ATWA 2OQKA 3FP9A 1XTDA 4DV6Q 1VQKA 3CMAA 3CC7A 3HKZE 2XTIA 5IWAQ 5M3FH 1S72A 4IPDA 5FLXc 2R7ZH 4IFDG 2GVBA 4B3SL 2AWNA 2HIVA 3CQZH 3KLWA 3PV0A 1VCIA 4PZ7A 1XMQQ 3K0XA 3CC4A 1XNQL 4BXXG 2RF4A 3MXNB 3CCLA 3ERSX 3K7AH 4JI2Q 3U4VA 4OWTB 2IHFA 5IP9G 2N3SA 4GNXB 3ULPA 2UUAL 1VQBA 2WB1G 2CFMA 4LF6Q 1XNRQ 3D31A 1LYLA 4POGA 2LXJA 4JI8L 4GKKL 2YU9H 2K5VA 2WP8J 4DV2L 2Q2UA 5JJLA 4KHPQ 1FL0A 4DV7L 2BA0A 4GLAC 4GNXC 2AMCB 2VL6A 1YHQA 1KRTA 1WYDA 5C4XG 1YHBA 5IYCH 1VQLA 2VS1A 3J80c 4X66L 4L5RC 1I6HH 3M7NA 4NXMQ 3ULLA 1PH7A 5GAHC 5GQOA 2UXDQ 2GVAA 4O2DA 2ALYB 4HJ5A 1GKHA 1K9MC 4A3DH 1KL9A 1IBKQ 4IJLA 4YWLA 2F4VL 5C44H 3S1MH 3NEMA 2UUBQ 3CD6A 3S1QH 1L2FA 1M90C 1M1KC 4JYAQ 3TS0A 1N34L 5H1SE 1JJ2A 4OO1I 1IL2A 3PUWA 4DR6L 1TWGH 3CCQA 4DV1L 4DR3Q 3GTMH 1Q12A 5IYBG 4LUVA 2LXKA 4YHHQ 1K8GA 4C3IH 5E7NA 2JA7G 1B8AA 4JOIA 1TWAH 4HJ8A 4JI1L 3M9BA 1YEZA 1KAWA 4FDBA 1IBLQ 3M4QA 1KRSA 4A3MG 2F52A 4A3LG 4DR1L 2KHJA 4QY7A 3GTGH 3HOZH 1EWIA 1PH8A 2YTVA 1HNWL 4IO9A 1OXSC 2R6GA 5AJ3L 2WB1E 3CMEA 3F1ZA 1MKHA 2MO0A 2JEBI 4YWMA 3J80i 3CCSA 3CF5A 3M4PA 3CW2C 3KJOA 5M3FG 1SFOH 1Q82C 1EIYB 4LFCQ 3HOVH 4B3RL 4KI0A 1SLJA 3KOJA 2R7ZG 1VQJA 2JA6G 2BA1A 2PI2E 3KJPA 2UUCL 1VQMA 2R7DA 3JAMi 4B3SQ 3I4MH 2I5MX 4MNOA 4AYBG 4NB3A 3CC2A 1XNQQ 4HIDA 4A3CH 5FLMG 2NN6G 1YHAA 2VY3A 2ZTCA 3U50C 4JV5L 2JE6I 4C3JH 3HOWG 4GN4B 4H02A 5GAEC 2QGQA 1SMXA 1VQ4A 1Q86C 4DV2Q 4GKKQ 4BY7G 2JQOA 4DV7Q 4L5SA 5IYCG 4GNXA 4R1JA 3K81C 4HIMA 2DUDA 4QL5A 4HJAA 2Z0SA 4LFBL 1B70B 4EQ5A 4IJHA 3PUVA 4X66Q 3NELA 1XMOL 3RZOH 3J81j 3ZJYC 4A3DG 1LM0A 2ZJPA 2WFWA 5C44G 1N33L 3OW2A 1NJIC 3GTOH
chains in the Genus database with same CATH superfamily
2MHVA 2F4VQ 1SJHD 1TWAB 4UHVA 3VDYA 2Q8IB 1X3FA 4ZUJA 3OTOL 2XRQD 4CKEA 4HN7A 1M8AA 1Y8PB 3VR2A 1ILQA 1KNEA 1X56A 3SK5A 3SEBA 1KXLA 2R93B 4G4KA 1U4PA 3MXGA 2BE5C 4RCOA 4JC0A 2EYPA 4JVZA 4AYBE 3HOUH 3IRBA 2DN8A 1Y1VB 4A3IB 2VB3X 2K52A 3G48A 4GKJL 2AQ2B 5AJ3Q 4A3EB 1JE5A 4L6TB 4C3JB 1PXUA 4B3RQ 1T5XD 3MAQA 1O7IA 1STGA 4A3FB 1VQ9A 4A3CG 1TR5A 4DK3C 2EXDA 3TP8A 3IAYA 3M85A 4BY1H 2PZWA 2RA4A 1UEBA 4FP5D 3RUZA 3CRLC 2Q8TA 1JMCA 3HGBA 4FYDA 1XTCD 1I94L 2M00A 4LFBQ 1XMOQ 4YCUA 5M5XH 1LUZA 3OW7A 1NMGA 5M3MH 2ZXPA 2YTXA 3FKIG 2HT1A 1YNNC 1E1TA 2QEXA 4JI5L 1Q1EA 1VQ8A 1WVLA 1R4QB 1EQQA 3K5MA 1GHKA 1O78A 2KCCA 1IYJB 1L1OA 4KN4C 4NXNQ 1H95A 2AHOB 5ELDA 5EKKA 1NUCA 3QO2A 1PA6A 2RDHA 2RBMA 3TP5A 3RZDB 1BDOA 3H91A 2N88A 5CV5A 1J5EQ 3PQIA 5HY6A 4DR2Q 1CSPA 2EE1A 2VQFQ 4GN5A 1QNKA 4ZQ3A 5M9OA 3I4NB 1PFNA 1S5FD 4HCSA 2RHQB 4DR5Q 3RN2A 1TIID 2JXMB 2B63H 1EQRA 2Z6BA 1HFGA 3STBD 4G7ZC 2IJ0A 4LWCA 1FNWA 1B44D 1LTRD 1FGUA 4LF9L 2UUAQ 2B3GA 2SDFA 5D14A 3ZYYX 3E9IA 1K8OA 4A3KG 2F0DA 3C1EA 3GTJB 1HPCA 3VR5A 2KHIA 3NPPA 1C9OA 1TS3A 4P2CB 3U4ZA 4WJ4A 4K8IA 4YCWA 1GVPA 3A5UA 4PMWA 1WD1A 3HOWB 2F3VA 3HOXG 3AFPA 3TMEA 1DXMA 4OL7A 3CAMA 1IYVA 1ML0D 5EBCA 4ZAIA 4OWXB 1J9OA 4C56C 1L0WA 1N32Q 1V1PB 3NBHB 1ICFB 1I4PA 3J7A5 2M2LA 3G6JB 4HSVA 5M5WB 1M4VA 3PIPA 2QEJC 3FDTA 1W6JA 3MEHA 5ISRA 1K28A 2F0MA 3BZKA 4AQYQ 4H44C 2I0QA 2HDLA 3VA5A 1C8CA 1KHIA 3OSOA 4YIJA 4J1MA 3TBIB 3R8BA 1PYBA 2EYFA 2FHTA 3MFYA 2IY5B 1OTCA 1Y1VG 4A3IG 4GS3A 1HJPA 1BCPC 1BNZA 5BR8Q 3OWFA 1DD2A 4QQBX 4A3EG 4C3JG 4CJ1B 2F0UA 4CJ2C 1SYEA 1E2WA 5JVH3 1YITA 1GUWA 2UXBL 3A0JA 2K03A 4IPGA 3TQYA 5GROA 1E1OA 4LW1A 1Q8IA 2HDMA 1E3PA 4OX9Q 4EQNA 5ELCA 2KCNA 1I50B 4A93H 3KF8B 3KF6B 3ONAB 2A8VA 1VDZA 2EJGC 1XPUA 2L12A 2I5HA 4GOPA 1CI3M 2EY1A 4X6AH 2F0QA 1STNA 3UDFA 3CRKC 2N78A 4LK1C 3PUZA 4DAPA 4R4QA 4KY5A 5GAGC 3WOFA 4DV4L 1X9NA 5C4XB 3L2PA 4XYQA 3R3OA 2F0WA 3J7ZC 1I6VC 2EJMA 3G7LA 2WKDA 2NVYB 4DAYB 5LMNQ 5IGGA 1WTVA 4KKTA 3S1RB 4P71A 4FXKC 3BZCA 3UE1A 4JI0Q 4BY7H 2EY5A 2QDLA 3T1YQ 4WJ3M 2BH8A 3J81c 4MHEA 1SXTA 4F8MA 2CWPA 3UE0A 1YIJA 4FF1A 1FJGL 5CORA 2VQEL 3VYTA 1PTOC 4JI3L 1Y8NB 1H9RA 2ZXOA 2IHEA 2LS01 1UAPA 5C6AA 4Q5VA 2EY2A 4A3MB 1AE2A 4B3TL 1S4ZA 5IOCA 3I4NG 4QMGA 5JAVA 2F0SA 1IL8A 1H9JA 3D3RA 2EYHA 3GTKH 1TS5A 1STEA 2JJQA 2HIXA 4DNIA 3PO3H 1JQYD 4X3TA 2JA6B 3GTLH 2A68C 1IBML 2EYJA 1PH4A 1YNJC 4KKUA 4AYBB 1BO0A 3H3VH 3TDQA 1Q90A 5DEHA 2R7FA 3CCUA 3CCVA 1F2MA 1CKOA 1ZYRD 4KTAA 3PUXA 2YU9B 5FK9C 1PMRA 2HQLA 1HZBA 1LT3D 1SE8A 3CXCA 4A76A 2F0PA 3KDFA 4ZKBB 4A75A 4IUQA 1YJWA 3SGIA 1XMQL 3PIP3 1MD2D 1GUOA 1LTLA 2MPMA 4B08A 3F2DA 2Z4HA 1IW7C 4DR7Q 1GO3E 2MUYA 1XNRL 1G91A 3MWYW 2CW0D 2K05A 4XQNA 2YTYA 2K5NA 1KABA 2E2IH 5LMUQ 1EZ8A 3V05A 1U5KA 3NP8A 4IOCA 2UXDL 1MBYA 2NN6I 2WAQE 3JAME 3TS2A 3BDLA 1Z9FA 2RHSB 3FEWX 1VMPA 4QUCA 3Q23A 1Q3LA 3CCMA 4J15A 3H94A 2SNMA 3RLFA 4DR3L 1BVSA 3DM3A 1SEBD 1ET6A 1V1OA 4KJNA 2MFIA 2YYZA 1CA5A 4OWWB 4HMIA 2UXCQ 3MA2B 1U0LA 2KBNA 1YNXA 1T9HA 1QZGA 3TRZA 4IPCA 3FHWA 1X65A 1E0BA 3FP9A 4G7HC 3CC7A 5M3FH 4UAIA 1BQQT 3KLWA 3PV0A 3CC4A 1XNQL 4BXXG 3TSSA 1WTOA 2B2UC 1TWFB 1JOKA 3D6CA 5E4XA 1CM9A 2UUAL 3KLRA 1QE6A 1HUMA 2WP8J 2Q2UA 4OHJA 4KHPQ 4GNXC 5HURA 4GLAC 5C4XG 1TWHB 1C48A 5IYCH 4L5RC 1I6HH 3M7NA 5GQOA 4HJ5A 1K9MC 1KL9A 2F0FA 1L2FA 1RHPA 1GUNA 1N34L 1JJ2A 3EVQA 4DR6L 4ZLTF 3QR8A 1IHZA 1PDQA 2SEBD 2LXKA 1K8GA 1FNUA 4L63B 4C3IH 2JA7G 1B8AA 1B53A 1TWAH 1HA6A 4XT3B 1SYCA 2AUJD 1IBLQ 3RMHA 1JOQA 3M4QA 1HA5A 1R9TB 4A3MG 4K2KA 3K5NA 2ZXRA 2ZT9C 1KNAA 3J81L 2MO0A 1RD9D 1SFOH 3KJOA 1D1IA 4KI0A 3KOJA 2JA6G 2C9OA 2PI2E 3T53B 4A3GB 1AFPA 4AYBG 4NB3A 3CC2A 1XYIA 2FJ2A 1YHAA 4MIUA 3OOCA 4C3JH 3S17B 4H02A 5JVG3 4DV2Q 4L5SA 4HIMA 4NW2A 1X32A 4EQ5A 3L3OC 5ELEA 5I4DA 2DY7A 4XXEA 3OW2A 2ES2A 3GTOH 4S3SA 1OXVA 4C2MB 1K0RA 4KKSA 4A3JH 1RJTA 2EIFA 4BWGB 3PO2H 1DCZA 2WINB 1I4HA 4OGQC 3G4SA 2JA8B 3E5SA 3A56A 4UPAA 2CKZB 2VXWA 1CFMA 1Y8OB 4K14A 1L1OC 3SK8A 2O4XA 2L9HA 1RF2D 4FF2A 3Q8DA 2OT2A 1F9PA 5K5PA 3MVVA 3S9WA 3LGJA 1EY0A 3H0GH 2JA9A 4PG3A 4V190 2EOTA 4J6HA 4A3BB 4DR1Q 3KLSX 1BKBA 3S2DB 4C3HG 2HCIA 4FO2A 1PFMA 3D6WA 2E5LL 1NSNS 1FNVA 4RA8A 1D8LA 3U9OA 3RZDH 1EYCA 2F3WA 3V96A 4JV5Q 4LF4L 1WFQA 2L0CA 2MNAA 2PZUA 1JR0D 1KDBA 1UNSA 3HOVB 4OO1G 2EJFC 1ICWA 1F2LA 1MGSA 1PRTF 1AEXA 3A7LA 4HEDA 4DV3L 2XGTA 5FO8B 5K36G 2QF7A 3QOJA 5DM63 2X69A 1N36L 1I4QA 1CT1D 2CWAA 4BBSB 4P75A 3DUZA 2A6ED 5J22A 4C1NI 1WCMH 2PO4A 1LT6D 5C3EH 2E75C 4XYOA 1HNZL 4LFAQ 1FR3A 1SSOA 4GLVB 2Z6KA 1I4RA 5COYA 1EIFA 2PYKA 3V2TA 5KIXA 4DUZQ 5LL6X 1Y69U 3P1HA 4Q0FA 3PIO3 1KTKA 1LABA 2H1EA 3L7ZC 3Q22A 2PQAA 2E2HB 3EA6A 3I70A 1CHQD 4WJWA 1HQMC 5CV4A 1SYGA 3CPWA 3M4OB 2C5CA 3STBC 4L5TA 1CKNB 1QILA 5IT9L 2UU9Q 3H09A 2B2WA 3OHXC 1HHVA 4BA2I 1A0IA 1Q1BA 4JK1C 1LTTD 3K0YA 4C1NK 1VQDA 3PUYA 3RLNA 4YY3Q 2VUMH 4OXPA 1QJOA 3HOYB 2EYMA 2WAQB 5I6YA 1HZAA 1HNXQ 1AP0A 1WJJA 1ZKOA 2KQ3A 4RKBA 1V9PA 1PH6A 4U673 2NB0A 2MJ8A 5BN3A 4X64L 4DV0L 1K3BC 4HAEA 4F87A 3W1GA 1EFID 3K5LA 1K0SA 4HCEA 1CSQA 2F0JA 3EIVA 5ELFA 4GOPC 2E2JB 5JOBA 3TEHB 3BS1A 3AMUA 5ELOA 4RMFA 2ZJQA 1Y1WH 3A74A 2PMZB 3C1FA 3NSWA 1HR0L 5KNDA 3MZ5A 2PPBC 1I4XA 2FMCA 3VYSA 4BXXH 3W1BA 1U4MA 5M5YB 1Q8KA 4IFDJ 2E74C 2NVQH 2OXPA 4LUOA 3VA7A 3T1HL 2JA8G 3C2PA 1L0XB 4LF5Q 5JPMC 1BBUA 1QOHA 1UE6A 4JI4Q 1SNPA 2CCZA 4DR4Q 1B7YB 5CV7A 1K8MA 2Y0SE 4R4OA 4X62Q 4BBRB 1BCPB 1G8ZD 1K83H 1PV4A 5IYDG 1TWCH 1ZXTA 4PZ8A 2EDGA 2K5QA 3A5ZB 1JICA 2F0LA 4NDXA 1EIGA 2D0PA 1VQFA 3H3VC 4HIOA 2NVXB 4FXGC 4LF7L 2JA7H 2BDNA 1TXYA 3GTPH 1VQGA 3VR4A 3RN5A 4UY8C 2PCFB 4QJFA 1MSHA 4POFA 3HOVG 1B3AA 1PZID 1NMFA 2FINB 2A19A 1B3QA 4FXDA 2PW5A 1NY4A 3E9HA 3A54A 4LF8L 3T56B 1MJEA 2ZM6Q 4BBSG 1VQNA 1E7ZA 3H3VI 5C5MA 4K0KL 4IN3A 3NWTA 1KDCA 3M3YB 1V43A 1J8IA 4M8AA 5BN5A 1PTOB 1TT2A 4DUYL 2V1CC 4KV6A 1QUQB 3ICEA 2JA5B 2VB2X 3S14H 4I7AA 2EZVA 3WOEA 3S24A 1PLFA 1LTGD 1F77A 4CGYB 5D3DA 2N8NA 2WV6D 3PMFA 1MJCA 2ID0A 2J4XA 2OF1A 3MC0B 3BYTB 2FMMA 1Q7YC 5KNCA 1NTGA 1YZ6A 1P8LA 2KENA 2Q2HA 4HMJA 5EJWA 3K58A 3L9AX 1ZYRC 2R7ZB 3HOYG 1YJNA 3CQZB 1D1KA 2WAQG 1RODA 2KVMA 1I3QH 2D5DA 4C3HH 1JORA 1GHJA 4B3ML 1QVGA 2B2YC 2CQOA 4JI7L 1SNMA 1NR2A 1STBA 4JI6Q 1OXXK 1H9SB 5IWAL 4BA1I 3G71A 2CW0C 2K28A 1NAPA 4IFDH 4FF4A 1STYA 4A3DB 2AUKA 4JI2L 1S3OA 3ULJA 4N9PA 3S1MB 3S1QB 2NVTH 1CHPD 4RG1A 5C4JH 1PRTD 1T5EA 1Q46A 3BU2A 5IP7G 2Q2IA 1D5ZC 2B2VA 1TWFH 2DNEA 4IUNA 3J81E 3KYHC 1I5FA 1STHA 2R93G 1SYFA 1C0AA 2ZJRA 5CV8A 1SDFA 2KEEA 3EJIA 4P74A 5CV9A 2F0TA 3HOZB 3GTGB 2UUBL 1EY6A 4JYAL 1WTWA 2SOBA 2G5DA 2EYOA 2V4DA 3S16B 4BBRG 2DY8A 4K5WA 1E22A 1BBWA 3J7AV 2XIWA 3F2CA 1W3SA 2SNSA 3F2UA 4HJ7A 4YHHL 1O7LA 4A3FG 1EOVA 5FKAC 4N9TA 2Z1CA 4X65Q 1WD0A 1UWVA 3FMCA 3LNNA 2ASBA 5JEAG 2Q2TA 3I4OA 4OEMB 1CA6A 2EY6A 1GJXA 4DV5Q 4LFCL 2ATWA 2OQKA 4DV6Q 4K6LA 3HKZE 2XTIA 1S72A 2F0NA 4IPDA 3SK6A 2RSOA 5FLXc 4GZYC 3RZOB 4B3SL 1R4PB 4PZ7A 3NTIA 3X3NA 4ZK9B 2E76C 3NTKA 3T51B 3K7AH 1II3A 4DU9A 4GNXB 5IP9G 4KD4A 2CFMA 2E2DC 4LF6Q 3D31A 5AFWA 4Y7NB 4POGA 4DAVA 2LXJA 4GKKL 4DV7L 2BA0A 1A3VA 1YHQA 3E3XA 1WYDA 1KRTA 2WACA 1VQLA 3J80c 1TVXA 1TS2A 4IURA 2QW7A 4NXMQ 3DXJC 3ULLA 1JWSD 5GAHC 2GVAA 4O2DA 3HOUB 1IBKQ 4IJLA 5IGFA 1BR9A 2F4VL 5EPLA 4NP5A 5C44H 4CHTB 1QCBD 5H1SE 3GTMH 1Q12A 1D2BA 2KJXA 3CU7A 5E7NA 2QKIC 2ICEC 4HJ8A 4IQZA 4FDBA 4DFAA 2A5HA 2KHJA 4BY1B 1PH8A 2YTVA 4IO9A 1JOOA 1OO9B 5AJ3L 2WB1E 1TU2B 3CW2C 4B3RL 5DAUA 1SLJA 1VF5C 2R7ZG 1VQJA 2Y0SB 3QWNA 1VQMA 1SNDA 5M5XB 2WIIB 5I9OA 2EPBA 1EEID 4A3CH 5FLMG 2NN6G 4ZCKA 1SMYD 2ZTCA 4X3UA 2JE6I 3HOWG 2F0KA 4GN4B 3FPPA 4L8JA 5GAEC 3DWPA 1SMXA 3MXNA 1LTBD 3DM1A 5JPNC 4JPBW 4R1JA 2DUDA 4QL5A 4HJAA 1D5XC 4LFBL 4X66Q 4IJHA 1XMOL 4A3DG 3ZJYC 1IKMA 2WFWA 5IT9E 3HOVH 3W2DA 3NBIA 4V0BA 3FKIH 1L1OB 1EY7A 1KDAA 1OXUA 1KLGD 5T1IA 5IGDA 5J3BA 1F9QA 2Z6KC 3SHLA 4DV1Q 2K4KA 3RLOA 1RCVD 4DF7A 1JB7A 1JT8A 1ESRA 1HR0W 4NXNL 4DNTB 1CK1A 1YBYA 3EBEA 1AZPA 2B63B 3D0FA 3HOZG 3MXPA 2Q8RE 2YV5A 1JWUD 2K6AA 3VYUA 4AH6A 2Z4IA 3KLSA 3T16A 5C0XG 1J5EL 1HNWQ 5C4HA 1SNQA 2CH4A 1SROA 4DR2L 1A6XA 3OPOA 1HRJA 2B2WC 2L15A 2X6LA 3HG9A 2VQFL 4JBJA 3URYA 3HOWH 4KHVA 1U4RA 4ZRZA 2UUCQ 4DR5L 4RWSC 3BVZA 3GTQH 1TQOA 4HTHA 1X6OA 2L1BA 3QB3A 2L5TA 1EY8A 1DM0B 3MHBA 2IPKD 4R8NA 1PH5A 1NBWA 4JG2A 1DZ1A 4RAUC 2NZ1D 4LAAA 2A6EC 2PQEA 1WOCA 4WFN3 5JJIA 4PNYA 4RHSA 3I55A 3Q6SA 2MP1A 3CHBD 3FPUB 3S15H 4CDFC 2EVBA 5C3XA 5IT9c 1N33Q 1LTID 2F0VA 4A3KH 2NWGA 1MSGA 3HOXH 3C46A 1EY4A 1ESFA 3K6OA 3QIAA 3A8IE 3OTOQ 3E6ZX 1CUKA 5KYLA 1N32L 3GDEA 1VMCA 2PW7A 3HZXA 5FLXL 3GO5A 4KY6A 1EYDA 4B9WA 3AQQA 2F0GA 3HOUG 3DHQA 2RVLA 4LUZA 3I56A 4DXFA 1EIHA 1LTSD 5FO9B 4GKJQ 4TQUS 3K80C 2QCPX 4ID6A 4AQYL 2VNUD 3R2IA 1VQIA 3O13A 5CC4A 1S40A 3HP3A 3JC66 1CQVA 4TKOB 2RCFA 3J80L 2L11A 3P7JA 2K75A 1AZQA 2R93H 1VQ7A 3EN2A 2D0OA 3IFDA 1WTQA 4A93B 1ZEQX 4M1UB 4XDXA 1W6KA 1OXTA 3TZDA 1Y1VH 5BR8L 3ER0A 4A3IH 1CTMA 3OIPA 1WTRA 1KQSA 4A3EH 2K5DA 2Y0SG 3I2ZA 1RIPA 5EAYA 2KCTA 2PNHA 1LT5D 4A3FH 1I94Q 2K50A 4JI8Q 4FNFA 1PFBA 2RDGA 1YJ9A 4EQPA 1SBBB 1JCKB 4GOPB 3SDZA 4RH6A 2DJFC 4IALA 4OX9L 3M4YA 5ELNA 1FD7D 1C4QA 3DLLA 2LKVA 4LMQD 2IX0A 4UP9A 3D4WA 4PV1C 5EGTA 5KEEA 2A69D 3HKZB 1NNXA 4CDCC 3TREA 1EU4A 1H9KA 4DAMA 3SVMA 1UUPA 1PFSA 3D4RA 1X3QA 5CMDA 2IL8A 1AN8A 1GUTA 1VQ5A 3C3LA 5LMNL 3I90A 4JI1Q 3QJYA 5KGUA 4RKLA 4JI0L 5CV6A 3W5OA 1PYSB 4DXGA 3T1YL 4OONA 3GTKB 2B63G 1QUQA 2GA4B 1A3UA 3K5OA 2X6GA 3PO3B 1QWYA 2CQAA 3HFZB 4MTNA 3BG3A 4Z9CB 2MO1A 4LF9Q 2K5HA 1B9MA 2I07B 3HEJA 1A63A 3I4NH 2F03A 4R9WA 1B2TA 4JW0A 2F4IA 5D3IB 2I5LX 3HS0C 5EKIA 1SNCA 1LTAD 1EQTA 2N55A 4CDDC 1GM5A 1GUGA 4EVOA 2RKSA 3KDFB 3G6EA 1QG7A 4QGUA 1LV9A 2B2TA 2K33A 2WB1B 1RTOA 3B6YA 4XQQA 3QG1A 2E2IB 3GTJH 4CKBA 5FLMH 3BJUA 4RGTA 1CKMA 4G7OC 4QIWE 2OWOA 1O7YA 1V1PA 1JE4A 1SRUA 1VQHA 3AFQA 3NK9A 3NQTA 3NBHA 4CDEC 1GD7A 1SJED 1QVCA 2AKWB 1SE4A 3S1NB 4DR7L 1TKWB 1PH9A 3MEFA 5J1ZA 3IL8A 4YWKA 4RCNA 3MTSA 2O5JC 3T13A 2B2VC 5LMUL 5KRUA 2A6HD 1EFWA 2GN5A 4IFDI 1X54A 3KFUA 1SYBA 1CZWA 5M5WH 1NCVA 2AWOA 1G6PA 2NZHA 3R2TA 1A2TA 5EPKA 1KIXA 3H6MA 1G2SA 2I46A 2NTTA 2RSNA 4A4IA 3CPFA 2UXBQ 3PSIA 5LHY1 4WRDA 1XX8A 1ENAA 5M3FB 1EEFD 4JBKA 4A93G 2UXCL 4A3GG 2AQ3B 4XTCS 1B9NA 2OQ0A 3P20A 5C0XH 1TY0A 3J81i 1MI2A 4DKAC 4F7XA 2OCEA 1X3EA 2PNRC 3A55A 1N9WA 3F2BA 1BBXC 2VZAA 3KF8A 5JJKA 3KF6A 4K6DA 3SE0A 5E1FA 2IX3A 4H13C 1CZGA 1HQRD 3NUCA 4DV4Q 1PRTC 1I6HB 1HZ9A 2HUGA 2D2CC 1I50H 2E8GA 1WTPA 2M9VA 2JK8A 1O80A 1XPOA 3NWSA 3VR3A 2R92B 1EZ6A 1Z6HA 1EU3A 3NENA 3PCOB 1Z47A 4DAYA 4KHPL 2K1BA 3HKZG 4O42A 1SN8A 1FJGQ 4PQXA 3RR5A 2KA7A 3OMGA 4KN7C 2RCNA 4C3IB 4JBWA 2VQEQ 5C4XH 4NPSA 4JI3Q 2DNCA 2NBFA 1S5BD 5IY0A 4Y7NH 2NVYH 5G3LF 4A3BG 2QDBA 1KAAA 3S1RH 4B3TQ 3HKSA 1K3RA 1TS4A 3LWEA 3EROA 4RFBA 1SE3A 1SFOB 3GV6A 5IGBA 3PO3G 1PH3A 1HUNA 3P75A 3KBGA 1EY9A 5F2DA 1IBMQ 4K8JA 1IBLL 2DGYA 1IYUA 4XIGS 5FJ8G 4PMCA 2K32A 4A3MH 3CKIB 2P5ZX 3NHHA 4RGOS 1VQEA 1C7YA 1S5DD 1HFNA 3MXUA 1AW7A 3J7AF 1DJRD 1XTDA 1VQKA 4ULLA 5A2QL 1B1ZA 2AWNA 2HIVA 1XMQQ 2JA6H 1VCIA 5BN4A 3K0XA 5E3FA 2RF4A 3CCLA 1XXGA 4ME5A 3GTOB 3ERSX 4TRDA 4QCLA 4A3JB 4OWTB 3ULPA 2IW3A 3PO2B 2WB1G 1D5MC 1XNRQ 1LYLA 4JI8L 2KHSA 4DV2L 2YU9H 2AMCB 2VL6A 4DGZA 3S2HB 3SXHA 3AU7A 3TN2A 4ODGA 4IUTA 1PH7A 2UXDQ 3H0GB 1NR4A 2K04A 4YWLA 3BVMA 3AB9A 1WTHA 3CD6A 1M90C 1M1KC 1E2ZA 5CGKA 4NMZA 2K5WA 3I72A 3ND8A 4OELB 3PUWA 2O2LD 3CCQA 4DR3Q 4MN3A 4LUVA 5IYBG 1BCPF 4JOIA 3WDNA 2J7ZA 4JI1L 3M9BA 2XWBB 1KRSA 2F52A 4IUPA 4DR1L 4QY7A 1EWIA 1F9RA 3I8ZA 1BF4A 2R6GA 4I65A 3CMEA 1MKHA 3CCSA 2JEBI 4YWMA 3CF5A 1EIYB 1SMYC 5M3FG 3I91A 1HTLD 3FVQA 3KJPA 5A35A 3JAMi 1QB5D 4MNOA 1XNQQ 1UEAB 5T1GA 4DK1A 1O7ZA 2VY3A 4KJOA 3U50C 4JV5L 1WCMB 3DWQA 4KD3A 4QB4A 5FLXE 2XRSD 5C3EB 4X3SA 5J39A 3KK7A 3ITPA 1VQ4A 4KK7A 2JQOA 5IIFA 5IYCG 4OO1H 3ND9A 2Z0SA 1B70B 4A3LG 3NELA 1TWGB 3J81j 1I4GA 5K36H 1LM0A 4HSPA 2ICIA 1RTNA 2XSCA 2B8FA 5I2XA 2R92G 3J80E 3CCRA 4LFAL 2BH2A 4QUFA 1N34Q 4KMUC 1F2ZA 4DR6Q 1PTOF 4H7BA 4C3IG 4O1NA 1TWHH 3DEPA 4R4TA 4NKLA 1W2BA 2PQAB 2IT1A 4PZ6A 3U9SA 1V1QA 4DUZL 2XVSA 4R8IA 1TY2A 4QIWB 2VUMB 4KY7A 3I4MB 3SR1A 5L37A 2RQXA 5LMNW 3K7UC 1IKLA 1JB3A 2QILA 1U9RA 2BE5D 3QOLA 1BOSA 2F3IA 2UU9L 1XPRA 2LY7A 2FXQA 4EQOA 4FVMA 4TVAB 3IFTA 1YVCA 4XQJA 4U68A 3BDOA 4YY3L 1R9TH 1G6ZA 1A2UA 4KLKA 4IPHA 2EXZA 1HZCA 1ASYA 1JWMD 3BZDB 1HNXL 4RGNA 4ALPA 1Y1WB 1FGBD 4P72A 3AEVA 4N8X1 5KNBA 1K8AC 4K5VA 3Q24A 3E0EA 5GADC 4A3GH 1ENCA 3DWAA 4LJZC 1WTXA 4A3JG 1U4LA 4JBMA 2NVQB 3PO2G 3WWVA 2TMPA 3S17H 3R93A 1BUVT 1EYGA 2B29A 5IODA 4UP7A 4EX5A 4H0LC 2HHHQ 1EL0A 3NE5B 5HGTA 2MQHA 1N8RC 2OTJA 5I2YA 1YNND 2KEDA 1FVIA 3H0GG 4K5XA 2JA5G 1K83B 5HGQA 2L4NA 2Z9HA 1TWCB 3PGZA 4OIJA 4AIMA 4C2MH 3E0JA 1K73C 5LL6S 4O0AA 3Q0AA 1Z7TA 4LF5L 1LT4D 2JA8H 4R4CA 4JI4L 4MZ9A 1E2VA 2HQEA 4DR4L 2E5LQ 3X3MA 4J8QA 2BOSA 2JA7B 4X62L 1VQCA 1SYDA 4ABNA 3GTPB 4KHZA 2HCCA 3K8AA 3EFXD 3OWEB 5G3LD 3I3CA 4A3BH 1SR3A 5IYDH 1IXRA 3CP0A 3TP6A 4LF4Q 3OIQA 3S2DH 5M3MB 3AYHB 3OYYA 1UE7A 3I4LA 1UE1A 2CH4W 3PF4A 1HCZA 4DV3Q 1YI2A 2D62A 2ZTEA 1VQOA 1QZHA 2RDFA 1N36Q 1P16A 1WCMG 5FJ8H 1XJVA 1B4OA 5C3EG 1Y14B 1DGSA 2JEAI 1AE3A 3H15A 2A69C 2BCOA 3FRPB 5JEAJ 1HNZQ 2B2TC 2KUMA 3D8GA 2R3ZA 2J0TD 1MIUA 4IOAA 2XN9C 2EQSA 1BXTA 2ZM6L 3K59A 1S5ED 3S14B 3UDXA 1ONLA 2OEOA 4BBSH 3DEOA 4RHRA 2C35B 2KCMA 4IUUA 1VQAA 3KBXA 3I7FA 1IZ6A 5EBDA 4DK0A 1PH2A 1VQPA 5DLQE 3VYRA 1PH1A 2A74C 2XNAC 2AQ1B 3BDCA 1RDPD 1A8VA 2VUMG 3S1NH 1CKNA 3I4MG 1S5CD 1I3QB 1ASZA 2E2HH 4C3HB 2MGSA 1XWEA 2KOLA 3M4OH 3SK4A 3KUPA 2HD3A 1SNOA 4RGMA 4IUVA 5IYBH 4APVA 3DMUA 4X64Q 4DV0Q 3U58A 1EWHA 1BCPD 5FOBB 3GQBA 3LWUA 2TSSA 1EUJA 3W3AA 2IWHA 3TZUA 3PF5A 2JP1A 2L55A 2F0HA 1DONA 3CCJA 4FF3A 3HOYH 2B2YA 2PMZE 2XWJB 1Y1WG 3LX0A 2NVTB 3UDGA 1X55A 1PVOA 5C4JB 4GN3B 3GP7A 1GXDC 1WI5A 4UP8A 1HR0Q 1VQ6A 1DOLA 5JJZA 1G2TA 4JI6L 1E24A 1JJCB 3BYYB 2F0IA 5C0XI 5CBAE 2H5XA 1ILPA 1GOZA 4MTKA 3T1HQ 5I6WA 2E2JH 2A6HC 1D7QA 3D4DA 4P73A 5I9PA 2O5IC 2F0EA 2LSSA 4HIKA 1HXYD 4HR7B 1RKNA 2QA4A 4UDUC 1A62A 2N49A 3N6RA 4A3LH 1PYWD 5IP7H 3BVGA 3GV3A 3JAMc 1FYCA 3NQIA 4G57A 5M5YH 2PZTA 4R4IA 2R92H 5KYIA 4DNRB 1UE5A 1JJGA 5A2QE 5C5LA 1PHJA 1DYQA 2D9UA 4BY1G 5CR3A 1PTOD 4DPGA 2R61A 2KECA 1G51A 1CQFA 4LF7Q 3I73A 4BS9A 4BBRH 3NTHA 4YCVA 4DA2A 2CVRA 2JSOA 3UDIA 1EY5A 2K14A 3PIOA 4Y52H 4X65L 3F8TA 5M3MG 4PMBA 5EQ0A 2BDOA 3K7AB 2F1MA 5JEAH 4X3KA 5FO7B 5IE8A 5IGEA 5C0XJ 4JI5Q 1A3TA 4DV5L 2WKCA 5E4WC 4DK6C 2NYZD 2A68D 1PRTB 2NVXH 1YNJD 4DV6L 4ME3A 4LF8Q 4BY7B 4TSSA 4HJ9A 5D65A 5C4ZA 5ELBA 2VW9A 3UI2A 4K0KQ 4L5QA 1H9MA 4IZ8A 1LO5D 1G291 1NE3A 1V8QA 2B39A 2NUCA 5C44B 1AH9A 2PI2A 1Q81C 3A7AB 2OTLA 1STAA 1KC8C 4LF6L 4DN4M 5IP9H 1VS0A 4GLXA 1PZKD 1J6QA 1RL2A 4DUYQ 3GD7A 4JCVE 4K2LA 1X3GA 1QVFA 3GTMB 5TSSA 4LNQA 1IW7D 2ZTDA 4NXML 2A1AA 4OIKA 3T4AC 2HHHL 1PZJD 1IBKL 4CBVA 3L0OA 3GTLB 3S2HH 3M3YH 1EWCA 2JYOA 2G9DA 1KD1C 3RNUA 2F0OA 1PTOH 1SAPA 2NTSA 3CCEA 4ILWA 4I7ZC 3J7YW 3K57A 5CYUA 2JA5H 4JOIC 3RD4A 2IX1A 2LMCB 2NZOA 4CKCA 4XT1B 5CBEE 1B50A 4B9XA 2DJGC 1L0YB 1JC7A 4B3MQ 1HH2P 2A73B 4JI7Q 2FFKB 3HRZC 2CHBD 2ENBA 3EQLC 4QF4A 3CMAA 4ZYSA 3A8JE 1HTPA 5IWAQ 1MHWC 2R7ZH 4IFDG 2GVBA 3CQZH 2G9HD 3MFGA 3MXNB 1H9SA 4JI2Q 3U4VA 1VF7A 2IHFA 2K7VA 2N3SA 2NN6H 3FKIB 3TP7A 1VQBA 5JJLA 3NXWA 2K5VA 2H4OA 1FL0A 3A8KE 3VR6A 1EYAA 1D6EC 1YHBA 2VS1A 4X66L 3N52A 1EQVA 2ALYB 1GKHA 4A3DH 1F9SA 3S1MH 3NEMA 2UUBQ 4EGVA 1DOKA 3S1QH 4JYAQ 5C3WA 3TS0A 4OO1I 1IL2A 1TWGH 4F88A 4DV1L 5DNFA 2Z8LA 4YHHQ 5IGCA 1SE2A 3ERQA 1F2YA 3GTQB 3OMCA 1GUSA 1YEZA 1ENFA 1KAWA 2K01A 5DM73 3HOZH 3GTGH 1HNWL 1ET9A 1OXSC 3F1ZA 3S16H 3IKJA 3J80i 4E6IA 4LFCQ 3M4PA 1Q82C 4WORA 1KLUD 2BA1A 1QNUA 4ZKCB 3JAML 2UUCL 2R7DA 4B3SQ 3I4MH 2I5MX 2EYLA 3S15B 4HIDA 4ZUIA 4A3KB 3M7GA 5NUCA 2B2UA 1X3PA 5EPJA 1EOTA 2QGQA 3HOXB 1Q86C 4GKKQ 4CJ0B 4BY7G 1A15A 4N8FA 4DV7Q 5EKLA 4GNXA 1LLRD 3K81C 2JN4A 2B8GA 3RZOH 3PUVA 1DOMA 2LFNA 1LACA 2ZJPA 5C44G 1N33L 1NJIC
chains in the Genus database with same CATH topology
1OXVA 1K0RA 2F4VQ 2R92G 4A3JH 2EIFA 3FKIH 3CCRA 1L1OB 3PO2H 3VDYA 1OXUA 4LFAL 3G4SA 2BH2A 1N34Q 2ES2A 5J3BA 1X3FA 4UPAA 2Z6KC 2CKZB 4DR6Q 3OTOL 4DV1Q 2K4KA 3RLOA 1L1OC 1TWHH 1JB7A 1JT8A 4R4TA 1X56A 1W2BA 4NXNL 3Q8DA 1HR0W 2PQAB 2IT1A 1KXLA 4PZ6A 1YBYA 3EBEA 3LGJA 1V1QA 4DUZL 3D0FA 4JC0A 3H0GH 3HOZG 2JA9A 4PG3A 4AYBE 2YV5A 3HOUH 3IRBA 4DR1Q 4AH6A 1BKBA 1HNWQ 2K52A 3G48A 5C0XG 1J5EL 4GKJL 5LMNW 3K7UC 5AJ3Q 1SROA 4DR2L 1JE5A 2L15A 2E5LL 2F3IA 2VQFL 4JBJA 2UU9L 4B3RQ 1XPRA 1D8LA 2FXQA 1O7IA 1VQ9A 2UUCQ 3RZDH 4DR5L 4A3CG 4TVAB 3GTQH 1YVCA 4DK3C 1X6OA 2EXDA 4YY3L 1R9TH 4JV5Q 3M85A 4BY1H 4KLKA 4IPHA 4LF4L 1HZCA 1WFQA 1ASYA 2MNAA 1PH5A 1NBWA 4JG2A 1HNXL 1UEBA 4OO1G 4ALPA 1JMCA 4P72A 3AEVA 1WOCA 5JJIA 4DV3L 1K8AC 2XGTA 1I94L 5K36G 3E0EA 3I55A 5GADC 4LFBQ 4A3GH 1XMOQ 4YCUA 5M5XH 1N36L 1LUZA 3S15H 1NMGA 2CWAA 5M3MH 5IT9c 4A3JG 4P75A 4JBMA 3FKIG 2YTXA 4A3KH 1N33Q 2HT1A 3PO2G 1E1TA 2QEXA 3WWVA 1WCMH 1Q1EA 4JI5L 1VQ8A 3S17H 1EYGA 5C3EH 2B29A 1EQQA 4UP7A 4EX5A 1HNZL 4LFAQ 3HOXH 2HHHQ 3OTOQ 4GLVB 2JA6H 2Z6KA 1CUKA 2MQHA 1N8RC 2OTJA 1IYJB 1N32L 3GDEA 1L1OA 1FVIA 1EIFA 4NXNQ 3GO5A 1H95A 2AHOB 3AQQA 3H0GG 3HOUG 2JA5G 5HGQA 4DUZQ 4LUZA 3I56A 1PA6A 3PGZA 4AIMA 4C2MH 1K73C 3L7ZC 2PQAA 4O0AA 1J5EQ 4LF5L 4GKJQ 4TQUS 3K80C 5HY6A 3CPWA 4AQYL 2JA8H 2VNUD 4R4CA 4DR2Q 4MZ9A 4JI4L 1VQIA 3STBC 1CSPA 4L5TA 1CKNB 1S40A 2VQFQ 2E5LQ 2UU9Q 4DR4L 3JC66 4BA2I 4GN5A 1A0IA 4DR5Q 4X62L 1Q1BA 1VQCA 2RHQB 3RN2A 4KHZA 2K75A 3K8AA 2R93H 1VQ7A 1VQDA 3EN2A 2B63H 1EQRA 3PUYA 2D0OA 3RLNA 4YY3Q 3STBD 4OXPA 2VUMH 4A3BH 1SR3A 5IYDH 1IXRA 1OXTA 3CP0A 1Y1VH 5BR8L 3ER0A 4LWCA 4A3IH 4LF4Q 3S2DH 1HZAA 1HNXQ 3AYHB 1KQSA 1WJJA 3OYYA 1UE7A 4A3EH 1FGUA 1UE1A 1V9PA 2Y0SG 3I2ZA 1PH6A 1RIPA 2B3GA 2KCTA 5EAYA 2UUAQ 4LF9L 3PF4A 4DV3Q 2PNHA 1YI2A 4X64L 2D62A 2ZTEA 2K50A 4DV0L 4A3FH 1VQOA 4JI8Q 1I94Q 1YJ9A 1QZHA 3E9IA 4A3KG 1N36Q 4GOPB 1P16A 3W1GA 1WCMG 2KHIA 3U4ZA 1C9OA 5FJ8H 4OX9L 4WJ4A 5ELNA 1XJVA 4YCWA 1GVPA 3A5UA 1CSQA 1Y14B 4PMWA 5C3EG 1DGSA 3HOXG 2JEAI 3EIVA 1AE3A 3H15A 4GOPC 3AFPA 3TEHB 3DLLA 5JEAJ 1HNZQ 5ELOA 2IX0A 4RMFA 2ZJQA 3CAMA 1MIUA 1Y1WH 4UP9A 3A74A 4IOAA 4OWXB 1N32Q 1HR0L 1L0WA 2EQSA 3NBHB 2ZM6L 4BXXH 3W1BA 3J7A5 3UDXA 3TREA 4DAMA 4BBSH 1Q8KA 1PFSA 2C35B 4IFDJ 2KCMA 2NVQH 3S16H 1VQAA 4LUOA 1VQ5A 3I7FA 1IZ6A 3T1HL 2JA8G 3PIPA 5LMNL 1PH2A 4LF5Q 4JI1Q 1BBUA 1VQPA 1UE6A 3BZKA 4AQYQ 4JI4Q 5DLQE 2I0QA 4JI0L 2CCZA 3W5OA 1PYSB 3T1YL 4DR4Q 1B7YB 1KHIA 1PH1A 4OONA 2Y0SE 4R4OA 4X62Q 2B63G 1QUQA 1A8VA 2VUMG 1K83H 1PV4A 1PYBA 5IYDG 3S1NH 1CKNA 1TWCH 2IY5B 1OTCA 3I4MG 1Y1VG 4A3IG 4PZ8A 4GS3A 3HFZB 4MTNA 1HJPA 1ASZA 5BR8Q 3A5ZB 2E2HH 2MO1A 4QQBX 4A3EG 3M4OH 4LF9Q 1YITA 2D0PA 1VQFA 2K5HA 5IYBH 4HIOA 2UXBL 4APVA 3A0JA 4X64Q 4DV0Q 4LF7L 4IPGA 3U58A 2JA7H 3TQYA 3I4NH 5GROA 1E1OA 1TXYA 4LW1A 1A63A 3GTPH 1VQGA 1EUJA 1E3PA 2I5LX 3PF5A 4OX9Q 3RN5A 4UY8C 4A93H 4QJFA 3KF8B 3KF6B 3CCJA 3HOYH 2PMZE 1GM5A 2A8VA 4POFA 1XPUA 3HOVG 4KHPL 2I5HA 1NMFA 1Y1WG 4GOPA 3KDFB 3G6EA 4QGUA 3UDGA 1X55A 2A19A 1PVOA 4X6AH 4GN3B 3B6YA 3UDFA 1NY4A 1WI5A 4UP8A 3E9HA 1HR0Q 2N78A 1VQ6A 3PUZA 4R4QA 4JI6L 4LF8L 1MJEA 1E24A 5GAGC 2ZM6Q 1JJCB 4BBSG 1VQNA 3GTJH 5FLMH 4DV4L 1X9NA 3BJUA 5C0XI 1CKMA 1E7ZA 4QIWE 3L2PA 2H5XA 3H3VI 3J7ZC 2OWOA 4K0KL 3HOWH 1SRUA 1VQHA 3AFQA 4DAYB 3T1HQ 5LMNQ 1GD7A 2E2JH 1QVCA 2AKWB 1D7QA 4P73A 4P71A 4DR7L 3BZCA 3UE1A 1PH9A 4JI0Q 4BY7H 1V43A 2LSSA 3MEFA 4HIKA 3T1YQ 4YWKA 2BH8A 3J81c 4WJ3M 2QA4A 4DUYL 2CWPA 3UE0A 1YIJA 1A62A 2N49A 2V1CC 1QUQB 1FJGL 4A3LH 5LMUL 3ICEA 5IP7H 2VQEL 1EFWA 3S14H 2GN5A 3JAMc 4IFDI 5M5YH 4JI3L 4R4IA 2R92H 1X54A 3S24A 3KFUA 5M5WH 1UE5A 2IHEA 1JJGA 2AWOA 1G6PA 2N8NA 2NZHA 1PHJA 1KIXA 4BY1G 1AE2A 1MJCA 2ID0A 4B3TL 4A4IA 4DPGA 1Q7YC 3CPFA 1G51A 3PSIA 3I4NG 1NTGA 2UXBQ 4LF7Q 1YZ6A 1P8LA 2KENA 2Q2HA 3GTKH 4BBRH 4YCVA 2JJQA 4JBKA 2HIXA 4DNIA 3UDIA 4A93G 3PO3H 2K14A 3HOYG 3PIOA 1YJNA 3GTLH 4XTCS 2WAQG 4A3GG 2UXCL 1IBML 1PH4A 4Y52H 2OQ0A 4X65L 1I3QH 3F8TA 5M3MG 3J81i 3H3VH 4C3HH 4DKAC 2OCEA 2R7FA 3CCUA 1X3EA 3CCVA 4B3ML 1QVGA 1CKOA 1N9WA 2CQOA 5IE8A 5C0XJ 3F2BA 2VZAA 4JI5Q 4JI7L 5JJKA 3KF6A 3PUXA 4DV5L 4DK6C 2NVXH 2HQLA 1HZBA 4DV6L 4JI6Q 4ME3A 1SE8A 1OXXK 3CXCA 3KDFA 4A76A 4LF8Q 5IWAL 4BA1I 4A75A 1YJWA 3G71A 4DV4Q 4HJ9A 1HZ9A 3SGIA 1XMQL 1I50H 2VW9A 2E8GA 4K0KQ 1LTLA 4L5QA 2JK8A 1NE3A 1G291 1AH9A 4JI2L 3F2DA 1S3OA 2PI2A 3ULJA 1Q81C 4DR7Q 1XPOA 1GO3E 2OTLA 2NVTH 1KC8C 4LF6L 1XNRL 4RG1A 5IP9H 5C4JH 1VS0A 4GLXA 1RL2A 1J6QA 3NENA 1Z47A 3PCOB 4DUYQ 2YTYA 3GD7A 4JCVE 1Q46A 3BU2A 2K5NA 3HKZG 1X3GA 5IP7G 1QVFA 1SN8A 1FJGQ 2Q2IA 3RR5A 2E2IH 5LMUQ 4LNQA 1TWFH 2RCNA 2VQEQ 4JBWA 2ZTDA 5C4XH 4NPSA 4JI3Q 1U5KA 3KYHC 2A1AA 1I5FA 4IOCA 4NXML 2R93G 2UXDL 5IY0A 4Y7NH 2HHHL 2NN6I 2WAQE 2NVYH 2ZJRA 1IBKL 4P74A 1C0AA 4A3BG 3L0OA 3TS2A 3S1RH 2UUBL 3S2HH 3M3YH 4B3TQ 4JYAL 1Z9FA 2RHSB 3HKSA 1K3RA 1KD1C 3RNUA 3CCMA 4J15A 4BBRG 3RLFA 3CCEA 1E22A 1BBWA 4DR3L 3PO3G 1PH3A 3F2CA 1W3SA 1BVSA 4HJ7A 2JA5H 3DM3A 4YHHL 4JOIC 2MFIA 2YYZA 4A3FG 4OWWB 1EOVA 2IX1A 2UXCQ 1IBMQ 1U0LA 2NZOA 2KBNA 4X65Q 1UWVA 1IBLL 2DGYA 1YNXA 2ASBA 4XIGS 5FJ8G 1T9HA 1QZGA 5JEAG 2Q2TA 3I4OA 3TRZA 4IPCA 4B3MQ 3FHWA 1X65A 4A3MH 1C7YA 1VQEA 1HH2P 4JI7Q 4DV5Q 4LFCL 2ATWA 2OQKA 3FP9A 1XTDA 4DV6Q 1VQKA 3CMAA 3CC7A 3HKZE 2XTIA 5IWAQ 5M3FH 1S72A 4IPDA 5FLXc 2R7ZH 4IFDG 2GVBA 4B3SL 2AWNA 2HIVA 3CQZH 3KLWA 3PV0A 1VCIA 4PZ7A 1XMQQ 3K0XA 3CC4A 1XNQL 4BXXG 2RF4A 3MXNB 3CCLA 3ERSX 3K7AH 4JI2Q 3U4VA 4OWTB 2IHFA 5IP9G 2N3SA 4GNXB 3ULPA 2UUAL 1VQBA 2WB1G 2CFMA 4LF6Q 1XNRQ 3D31A 1LYLA 4POGA 2LXJA 4JI8L 4GKKL 2YU9H 2K5VA 2WP8J 4DV2L 2Q2UA 5JJLA 4KHPQ 1FL0A 4DV7L 2BA0A 4GLAC 4GNXC 2AMCB 2VL6A 1YHQA 1KRTA 1WYDA 5C4XG 1YHBA 5IYCH 1VQLA 2VS1A 3J80c 4X66L 4L5RC 1I6HH 3M7NA 4NXMQ 3ULLA 1PH7A 5GAHC 5GQOA 2UXDQ 2GVAA 4O2DA 2ALYB 4HJ5A 1GKHA 1K9MC 4A3DH 1KL9A 1IBKQ 4IJLA 4YWLA 2F4VL 5C44H 3S1MH 3NEMA 2UUBQ 3CD6A 3S1QH 1L2FA 1M90C 1M1KC 4JYAQ 3TS0A 1N34L 5H1SE 1JJ2A 4OO1I 1IL2A 3PUWA 4DR6L 1TWGH 3CCQA 4DV1L 4DR3Q 3GTMH 1Q12A 5IYBG 4LUVA 2LXKA 4YHHQ 1K8GA 4C3IH 5E7NA 2JA7G 1B8AA 4JOIA 1TWAH 4HJ8A 4JI1L 3M9BA 1YEZA 1KAWA 4FDBA 1IBLQ 3M4QA 1KRSA 4A3MG 2F52A 4A3LG 4DR1L 2KHJA 4QY7A 3GTGH 3HOZH 1EWIA 1PH8A 2YTVA 1HNWL 4IO9A 1OXSC 2R6GA 5AJ3L 2WB1E 3CMEA 3F1ZA 1MKHA 2MO0A 2JEBI 4YWMA 3J80i 3CCSA 3CF5A 3M4PA 3CW2C 3KJOA 5M3FG 1SFOH 1Q82C 1EIYB 4LFCQ 3HOVH 4B3RL 4KI0A 1SLJA 3KOJA 2R7ZG 1VQJA 2JA6G 2BA1A 2PI2E 3KJPA 2UUCL 1VQMA 2R7DA 3JAMi 4B3SQ 3I4MH 2I5MX 4MNOA 4AYBG 4NB3A 3CC2A 1XNQQ 4HIDA 4A3CH 5FLMG 2NN6G 1YHAA 2VY3A 2ZTCA 3U50C 4JV5L 2JE6I 4C3JH 3HOWG 4GN4B 4H02A 5GAEC 2QGQA 1SMXA 1VQ4A 1Q86C 4DV2Q 4GKKQ 4BY7G 2JQOA 4DV7Q 4L5SA 5IYCG 4GNXA 4R1JA 3K81C 4HIMA 2DUDA 4QL5A 4HJAA 2Z0SA 4LFBL 1B70B 4EQ5A 4IJHA 3PUVA 4X66Q 3NELA 1XMOL 3RZOH 3J81j 3ZJYC 4A3DG 1LM0A 2ZJPA 2WFWA 5C44G 1N33L 3OW2A 1NJIC 3GTOH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXV A;  1K0R A;  2F4V Q;  2R92 G;  4A3J H;  2EIF A;  3FKI H;  3CCR A;  1L1O B;  3PO2 H;  3VDY A;  1OXU A;  4LFA L;  3G4S A;  2BH2 A;  1N34 Q;  2ES2 A;  5J3B A;  1X3F A;  4UPA A;  2Z6K C;  2CKZ B;  4DR6 Q;  3OTO L;  4DV1 Q;  2K4K A;  3RLO A;  1L1O C;  1TWH H;  1JB7 A;  1JT8 A;  4R4T A;  1X56 A;  1W2B A;  4NXN L;  3Q8D A;  1HR0 W;  2PQA B;  2IT1 A;  1KXL A;  4PZ6 A;  1YBY A;  3EBE A;  3LGJ A;  1V1Q A;  4DUZ L;  3D0F A;  4JC0 A;  3H0G H;  3HOZ G;  2JA9 A;  4PG3 A;  4AYB E;  2YV5 A;  3HOU H;  3IRB A;  4DR1 Q;  4AH6 A;  1BKB A;  1HNW Q;  2K52 A;  3G48 A;  5C0X G;  1J5E L;  4GKJ L;  5LMN W;  3K7U C;  5AJ3 Q;  1SRO A;  4DR2 L;  1JE5 A;  2L15 A;  2E5L L;  2F3I A;  2VQF L;  4JBJ A;  2UU9 L;  4B3R Q;  1XPR A;  1D8L A;  2FXQ A;  1O7I A;  1VQ9 A;  2UUC Q;  3RZD H;  4DR5 L;  4A3C G;  4TVA B;  3GTQ H;  1YVC A;  4DK3 C;  1X6O A;  2EXD A;  4YY3 L;  1R9T H;  4JV5 Q;  3M85 A;  4BY1 H;  4KLK A;  4IPH A;  4LF4 L;  1HZC A;  1WFQ A;  1ASY A;  2MNA A;  1PH5 A;  1NBW A;  4JG2 A;  1HNX L;  1UEB A;  4OO1 G;  4ALP A;  1JMC A;  4P72 A;  3AEV A;  1WOC A;  5JJI A;  4DV3 L;  1K8A C;  2XGT A;  1I94 L;  5K36 G;  3E0E A;  3I55 A;  5GAD C;  4LFB Q;  4A3G H;  1XMO Q;  4YCU A;  5M5X H;  1N36 L;  1LUZ A;  3S15 H;  1NMG A;  2CWA A;  5M3M H;  5IT9 c;  4A3J G;  4P75 A;  4JBM A;  3FKI G;  2YTX A;  4A3K H;  1N33 Q;  2HT1 A;  3PO2 G;  1E1T A;  2QEX A;  3WWV A;  1WCM H;  1Q1E A;  4JI5 L;  1VQ8 A;  3S17 H;  1EYG A;  5C3E H;  2B29 A;  1EQQ A;  4UP7 A;  4EX5 A;  1HNZ L;  4LFA Q;  3HOX H;  2HHH Q;  3OTO Q;  4GLV B;  2JA6 H;  2Z6K A;  1CUK A;  2MQH A;  1N8R C;  2OTJ A;  1IYJ B;  1N32 L;  3GDE A;  1L1O A;  1FVI A;  1EIF A;  4NXN Q;  3GO5 A;  1H95 A;  2AHO B;  3AQQ A;  3H0G G;  3HOU G;  2JA5 G;  5HGQ A;  4DUZ Q;  4LUZ A;  3I56 A;  1PA6 A;  3PGZ A;  4AIM A;  4C2M H;  1K73 C;  3L7Z C;  2PQA A;  4O0A A;  1J5E Q;  4LF5 L;  4GKJ Q;  4TQU S;  3K80 C;  5HY6 A;  3CPW A;  4AQY L;  2JA8 H;  2VNU D;  4R4C A;  4DR2 Q;  4MZ9 A;  4JI4 L;  1VQI A;  3STB C;  1CSP A;  4L5T A;  1CKN B;  1S40 A;  2VQF Q;  2E5L Q;  2UU9 Q;  4DR4 L;  3JC6 6;  4BA2 I;  4GN5 A;  1A0I A;  4DR5 Q;  4X62 L;  1Q1B A;  1VQC A;  2RHQ B;  3RN2 A;  4KHZ A;  2K75 A;  3K8A A;  2R93 H;  1VQ7 A;  1VQD A;  3EN2 A;  2B63 H;  1EQR A;  3PUY A;  2D0O A;  3RLN A;  4YY3 Q;  3STB D;  4OXP A;  2VUM H;  4A3B H;  1SR3 A;  5IYD H;  1IXR A;  1OXT A;  3CP0 A;  1Y1V H;  5BR8 L;  3ER0 A;  4LWC A;  4A3I H;  4LF4 Q;  3S2D H;  1HZA A;  1HNX Q;  3AYH B;  1KQS A;  1WJJ A;  3OYY A;  1UE7 A;  4A3E H;  1FGU A;  1UE1 A;  1V9P A;  2Y0S G;  3I2Z A;  1PH6 A;  1RIP A;  2B3G A;  2KCT A;  5EAY A;  2UUA Q;  4LF9 L;  3PF4 A;  4DV3 Q;  2PNH A;  1YI2 A;  4X64 L;  2D62 A;  2ZTE A;  2K50 A;  4DV0 L;  4A3F H;  1VQO A;  4JI8 Q;  1I94 Q;  1YJ9 A;  1QZH A;  3E9I A;  4A3K G;  1N36 Q;  4GOP B;  1P16 A;  3W1G A;  1WCM G;  2KHI A;  3U4Z A;  1C9O A;  5FJ8 H;  4OX9 L;  4WJ4 A;  5ELN A;  1XJV A;  4YCW A;  1GVP A;  3A5U A;  1CSQ A;  1Y14 B;  4PMW A;  5C3E G;  1DGS A;  3HOX G;  2JEA I;  3EIV A;  1AE3 A;  3H15 A;  4GOP C;  3AFP A;  3TEH B;  3DLL A;  5JEA J;  1HNZ Q;  5ELO A;  2IX0 A;  4RMF A;  2ZJQ A;  3CAM A;  1MIU A;  1Y1W H;  4UP9 A;  3A74 A;  4IOA A;  4OWX B;  1N32 Q;  1HR0 L;  1L0W A;  2EQS A;  3NBH B;  2ZM6 L;  4BXX H;  3W1B A;  3J7A 5;  3UDX A;  3TRE A;  4DAM A;  4BBS H;  1Q8K A;  1PFS A;  2C35 B;  4IFD J;  2KCM A;  2NVQ H;  3S16 H;  1VQA A;  4LUO A;  1VQ5 A;  3I7F A;  1IZ6 A;  3T1H L;  2JA8 G;  3PIP A;  5LMN L;  1PH2 A;  4LF5 Q;  4JI1 Q;  1BBU A;  1VQP A;  1UE6 A;  3BZK A;  4AQY Q;  4JI4 Q;  5DLQ E;  2I0Q A;  4JI0 L;  2CCZ A;  3W5O A;  1PYS B;  3T1Y L;  4DR4 Q;  1B7Y B;  1KHI A;  1PH1 A;  4OON A;  2Y0S E;  4R4O A;  4X62 Q;  2B63 G;  1QUQ A;  1A8V A;  2VUM G;  1K83 H;  1PV4 A;  1PYB A;  5IYD G;  3S1N H;  1CKN A;  1TWC H;  2IY5 B;  1OTC A;  3I4M G;  1Y1V G;  4A3I G;  4PZ8 A;  4GS3 A;  3HFZ B;  4MTN A;  1HJP A;  1ASZ A;  5BR8 Q;  3A5Z B;  2E2H H;  2MO1 A;  4QQB X;  4A3E G;  3M4O H;  4LF9 Q;  1YIT A;  2D0P A;  1VQF A;  2K5H A;  5IYB H;  4HIO A;  2UXB L;  4APV A;  3A0J A;  4X64 Q;  4DV0 Q;  4LF7 L;  4IPG A;  3U58 A;  2JA7 H;  3TQY A;  3I4N H;  5GRO A;  1E1O A;  1TXY A;  4LW1 A;  1A63 A;  3GTP H;  1VQG A;  1EUJ A;  1E3P A;  2I5L X;  3PF5 A;  4OX9 Q;  3RN5 A;  4UY8 C;  4A93 H;  4QJF A;  3KF8 B;  3KF6 B;  3CCJ A;  3HOY H;  2PMZ E;  1GM5 A;  2A8V A;  4POF A;  1XPU A;  3HOV G;  4KHP L;  2I5H A;  1NMF A;  1Y1W G;  4GOP A;  3KDF B;  3G6E A;  4QGU A;  3UDG A;  1X55 A;  2A19 A;  1PVO A;  4X6A H;  4GN3 B;  3B6Y A;  3UDF A;  1NY4 A;  1WI5 A;  4UP8 A;  3E9H A;  1HR0 Q;  2N78 A;  1VQ6 A;  3PUZ A;  4R4Q A;  4JI6 L;  4LF8 L;  1MJE A;  1E24 A;  5GAG C;  2ZM6 Q;  1JJC B;  4BBS G;  1VQN A;  3GTJ H;  5FLM H;  4DV4 L;  1X9N A;  3BJU A;  5C0X I;  1CKM A;  1E7Z A;  4QIW E;  3L2P A;  2H5X A;  3H3V I;  3J7Z C;  2OWO A;  4K0K L;  3HOW H;  1SRU A;  1VQH A;  3AFQ A;  4DAY B;  3T1H Q;  5LMN Q;  1GD7 A;  2E2J H;  1QVC A;  2AKW B;  1D7Q A;  4P73 A;  4P71 A;  4DR7 L;  3BZC A;  3UE1 A;  1PH9 A;  4JI0 Q;  4BY7 H;  1V43 A;  2LSS A;  3MEF A;  4HIK A;  3T1Y Q;  4YWK A;  2BH8 A;  3J81 c;  4WJ3 M;  2QA4 A;  4DUY L;  2CWP A;  3UE0 A;  1YIJ A;  1A62 A;  2N49 A;  2V1C C;  1QUQ B;  1FJG L;  4A3L H;  5LMU L;  3ICE A;  5IP7 H;  2VQE L;  1EFW A;  3S14 H;  2GN5 A;  3JAM c;  4IFD I;  5M5Y H;  4JI3 L;  4R4I A;  2R92 H;  1X54 A;  3S24 A;  3KFU A;  5M5W H;  1UE5 A;  2IHE A;  1JJG A;  2AWO A;  1G6P A;  2N8N A;  2NZH A;  1PHJ A;  1KIX A;  4BY1 G;  1AE2 A;  1MJC A;  2ID0 A;  4B3T L;  4A4I A;  4DPG A;  1Q7Y C;  3CPF A;  1G51 A;  3PSI A;  3I4N G;  1NTG A;  2UXB Q;  4LF7 Q;  1YZ6 A;  1P8L A;  2KEN A;  2Q2H A;  3GTK H;  4BBR H;  4YCV A;  2JJQ A;  4JBK A;  2HIX A;  4DNI A;  3UDI A;  4A93 G;  3PO3 H;  2K14 A;  3HOY G;  3PIO A;  1YJN A;  3GTL H;  4XTC S;  2WAQ G;  4A3G G;  2UXC L;  1IBM L;  1PH4 A;  4Y52 H;  2OQ0 A;  4X65 L;  1I3Q H;  3F8T A;  5M3M G;  3J81 i;  3H3V H;  4C3H H;  4DKA C;  2OCE A;  2R7F A;  3CCU A;  1X3E A;  3CCV A;  4B3M L;  1QVG A;  1CKO A;  1N9W A;  2CQO A;  5IE8 A;  5C0X J;  3F2B A;  2VZA A;  4JI5 Q;  4JI7 L;  5JJK A;  3KF6 A;  3PUX A;  4DV5 L;  4DK6 C;  2NVX H;  2HQL A;  1HZB A;  4DV6 L;  4JI6 Q;  4ME3 A;  1SE8 A;  1OXX K;  3CXC A;  3KDF A;  4A76 A;  4LF8 Q;  5IWA L;  4BA1 I;  4A75 A;  1YJW A;  3G71 A;  4DV4 Q;  4HJ9 A;  1HZ9 A;  3SGI A;  1XMQ L;  1I50 H;  2VW9 A;  2E8G A;  4K0K Q;  1LTL A;  4L5Q A;  2JK8 A;  1NE3 A;  1G29 1;  1AH9 A;  4JI2 L;  3F2D A;  1S3O A;  2PI2 A;  3ULJ A;  1Q81 C;  4DR7 Q;  1XPO A;  1GO3 E;  2OTL A;  2NVT H;  1KC8 C;  4LF6 L;  1XNR L;  4RG1 A;  5IP9 H;  5C4J H;  1VS0 A;  4GLX A;  1RL2 A;  1J6Q A;  3NEN A;  1Z47 A;  3PCO B;  4DUY Q;  2YTY A;  3GD7 A;  4JCV E;  1Q46 A;  3BU2 A;  2K5N A;  3HKZ G;  1X3G A;  5IP7 G;  1QVF A;  1SN8 A;  1FJG Q;  2Q2I A;  3RR5 A;  2E2I H;  5LMU Q;  4LNQ A;  1TWF H;  2RCN A;  2VQE Q;  4JBW A;  2ZTD A;  5C4X H;  4NPS A;  4JI3 Q;  1U5K A;  3KYH C;  2A1A A;  1I5F A;  4IOC A;  4NXM L;  2R93 G;  2UXD L;  5IY0 A;  4Y7N H;  2HHH L;  2NN6 I;  2WAQ E;  2NVY H;  2ZJR A;  1IBK L;  4P74 A;  1C0A A;  4A3B G;  3L0O A;  3TS2 A;  3S1R H;  2UUB L;  3S2H H;  3M3Y H;  4B3T Q;  4JYA L;  1Z9F A;  2RHS B;  3HKS A;  1K3R A;  1KD1 C;  3RNU A;  3CCM A;  4J15 A;  4BBR G;  3RLF A;  3CCE A;  1E22 A;  1BBW A;  4DR3 L;  3PO3 G;  1PH3 A;  3F2C A;  1W3S A;  1BVS A;  4HJ7 A;  2JA5 H;  3DM3 A;  4YHH L;  4JOI C;  2MFI A;  2YYZ A;  4A3F G;  4OWW B;  1EOV A;  2IX1 A;  2UXC Q;  1IBM Q;  1U0L A;  2NZO A;  2KBN A;  4X65 Q;  1UWV A;  1IBL L;  2DGY A;  1YNX A;  2ASB A;  4XIG S;  5FJ8 G;  1T9H A;  1QZG A;  5JEA G;  2Q2T A;  3I4O A;  3TRZ A;  4IPC A;  4B3M Q;  3FHW A;  1X65 A;  4A3M H;  1C7Y A;  1VQE A;  1HH2 P;  4JI7 Q;  4DV5 Q;  4LFC L;  2ATW A;  2OQK A;  3FP9 A;  1XTD A;  4DV6 Q;  1VQK A;  3CMA A;  3CC7 A;  3HKZ E;  2XTI A;  5IWA Q;  5M3F H;  1S72 A;  4IPD A;  5FLX c;  2R7Z H;  4IFD G;  2GVB A;  4B3S L;  2AWN A;  2HIV A;  3CQZ H;  3KLW A;  3PV0 A;  1VCI A;  4PZ7 A;  1XMQ Q;  3K0X A;  3CC4 A;  1XNQ L;  4BXX G;  2RF4 A;  3MXN B;  3CCL A;  3ERS X;  3K7A H;  4JI2 Q;  3U4V A;  4OWT B;  2IHF A;  5IP9 G;  2N3S A;  4GNX B;  3ULP A;  2UUA L;  1VQB A;  2WB1 G;  2CFM A;  4LF6 Q;  1XNR Q;  3D31 A;  1LYL A;  4POG A;  2LXJ A;  4JI8 L;  4GKK L;  2YU9 H;  2K5V A;  2WP8 J;  4DV2 L;  2Q2U A;  5JJL A;  4KHP Q;  1FL0 A;  4DV7 L;  2BA0 A;  4GLA C;  4GNX C;  2AMC B;  2VL6 A;  1YHQ A;  1KRT A;  1WYD A;  5C4X G;  1YHB A;  5IYC H;  1VQL A;  2VS1 A;  3J80 c;  4X66 L;  4L5R C;  1I6H H;  3M7N A;  4NXM Q;  3ULL A;  1PH7 A;  5GAH C;  5GQO A;  2UXD Q;  2GVA A;  4O2D A;  2ALY B;  4HJ5 A;  1GKH A;  1K9M C;  4A3D H;  1KL9 A;  1IBK Q;  4IJL A;  4YWL A;  2F4V L;  5C44 H;  3S1M H;  3NEM A;  2UUB Q;  3CD6 A;  3S1Q H;  1L2F A;  1M90 C;  1M1K C;  4JYA Q;  3TS0 A;  1N34 L;  5H1S E;  1JJ2 A;  4OO1 I;  1IL2 A;  3PUW A;  4DR6 L;  1TWG H;  3CCQ A;  4DV1 L;  4DR3 Q;  3GTM H;  1Q12 A;  5IYB G;  4LUV A;  2LXK A;  4YHH Q;  1K8G A;  4C3I H;  5E7N A;  2JA7 G;  1B8A A;  4JOI A;  1TWA H;  4HJ8 A;  4JI1 L;  3M9B A;  1YEZ A;  1KAW A;  4FDB A;  1IBL Q;  3M4Q A;  1KRS A;  4A3M G;  2F52 A;  4A3L G;  4DR1 L;  2KHJ A;  4QY7 A;  3GTG H;  3HOZ H;  1EWI A;  1PH8 A;  2YTV A;  1HNW L;  4IO9 A;  1OXS C;  2R6G A;  5AJ3 L;  2WB1 E;  3CME A;  3F1Z A;  1MKH A;  2MO0 A;  2JEB I;  4YWM A;  3J80 i;  3CCS A;  3CF5 A;  3M4P A;  3CW2 C;  3KJO A;  5M3F G;  1SFO H;  1Q82 C;  1EIY B;  4LFC Q;  3HOV H;  4B3R L;  4KI0 A;  1SLJ A;  3KOJ A;  2R7Z G;  1VQJ A;  2JA6 G;  2BA1 A;  2PI2 E;  3KJP A;  2UUC L;  1VQM A;  2R7D A;  3JAM i;  4B3S Q;  3I4M H;  2I5M X;  4MNO A;  4AYB G;  4NB3 A;  3CC2 A;  1XNQ Q;  4HID A;  4A3C H;  5FLM G;  2NN6 G;  1YHA A;  2VY3 A;  2ZTC A;  3U50 C;  4JV5 L;  2JE6 I;  4C3J H;  3HOW G;  4GN4 B;  4H02 A;  5GAE C;  2QGQ A;  1SMX A;  1VQ4 A;  1Q86 C;  4DV2 Q;  4GKK Q;  4BY7 G;  2JQO A;  4DV7 Q;  4L5S A;  5IYC G;  4GNX A;  4R1J A;  3K81 C;  4HIM A;  2DUD A;  4QL5 A;  4HJA A;  2Z0S A;  4LFB L;  1B70 B;  4EQ5 A;  4IJH A;  3PUV A;  4X66 Q;  3NEL A;  1XMO L;  3RZO H;  3J81 j;  3ZJY C;  4A3D G;  1LM0 A;  2ZJP A;  2WFW A;  5C44 G;  1N33 L;  3OW2 A;  1NJI C;  3GTO H; 
#chains in the Genus database with same CATH topology
 2MHV A;  2F4V Q;  1SJH D;  1TWA B;  4UHV A;  3VDY A;  2Q8I B;  1X3F A;  4ZUJ A;  3OTO L;  2XRQ D;  4CKE A;  4HN7 A;  1M8A A;  1Y8P B;  3VR2 A;  1ILQ A;  1KNE A;  1X56 A;  3SK5 A;  3SEB A;  1KXL A;  2R93 B;  4G4K A;  1U4P A;  3MXG A;  2BE5 C;  4RCO A;  4JC0 A;  2EYP A;  4JVZ A;  4AYB E;  3HOU H;  3IRB A;  2DN8 A;  1Y1V B;  4A3I B;  2VB3 X;  2K52 A;  3G48 A;  4GKJ L;  2AQ2 B;  5AJ3 Q;  4A3E B;  1JE5 A;  4L6T B;  4C3J B;  1PXU A;  4B3R Q;  1T5X D;  3MAQ A;  1O7I A;  1STG A;  4A3F B;  1VQ9 A;  4A3C G;  1TR5 A;  4DK3 C;  2EXD A;  3TP8 A;  3IAY A;  3M85 A;  4BY1 H;  2PZW A;  2RA4 A;  1UEB A;  4FP5 D;  3RUZ A;  3CRL C;  2Q8T A;  1JMC A;  3HGB A;  4FYD A;  1XTC D;  1I94 L;  2M00 A;  4LFB Q;  1XMO Q;  4YCU A;  5M5X H;  1LUZ A;  3OW7 A;  1NMG A;  5M3M H;  2ZXP A;  2YTX A;  3FKI G;  2HT1 A;  1YNN C;  1E1T A;  2QEX A;  4JI5 L;  1Q1E A;  1VQ8 A;  1WVL A;  1R4Q B;  1EQQ A;  3K5M A;  1GHK A;  1O78 A;  2KCC A;  1IYJ B;  1L1O A;  4KN4 C;  4NXN Q;  1H95 A;  2AHO B;  5ELD A;  5EKK A;  1NUC A;  3QO2 A;  1PA6 A;  2RDH A;  2RBM A;  3TP5 A;  3RZD B;  1BDO A;  3H91 A;  2N88 A;  5CV5 A;  1J5E Q;  3PQI A;  5HY6 A;  4DR2 Q;  1CSP A;  2EE1 A;  2VQF Q;  4GN5 A;  1QNK A;  4ZQ3 A;  5M9O A;  3I4N B;  1PFN A;  1S5F D;  4HCS A;  2RHQ B;  4DR5 Q;  3RN2 A;  1TII D;  2JXM B;  2B63 H;  1EQR A;  2Z6B A;  1HFG A;  3STB D;  4G7Z C;  2IJ0 A;  4LWC A;  1FNW A;  1B44 D;  1LTR D;  1FGU A;  4LF9 L;  2UUA Q;  2B3G A;  2SDF A;  5D14 A;  3ZYY X;  3E9I A;  1K8O A;  4A3K G;  2F0D A;  3C1E A;  3GTJ B;  1HPC A;  3VR5 A;  2KHI A;  3NPP A;  1C9O A;  1TS3 A;  4P2C B;  3U4Z A;  4WJ4 A;  4K8I A;  4YCW A;  1GVP A;  3A5U A;  4PMW A;  1WD1 A;  3HOW B;  2F3V A;  3HOX G;  3AFP A;  3TME A;  1DXM A;  4OL7 A;  3CAM A;  1IYV A;  1ML0 D;  5EBC A;  4ZAI A;  4OWX B;  1J9O A;  4C56 C;  1L0W A;  1N32 Q;  1V1P B;  3NBH B;  1ICF B;  1I4P A;  3J7A 5;  2M2L A;  3G6J B;  4HSV A;  5M5W B;  1M4V A;  3PIP A;  2QEJ C;  3FDT A;  1W6J A;  3MEH A;  5ISR A;  1K28 A;  2F0M A;  3BZK A;  4AQY Q;  4H44 C;  2I0Q A;  2HDL A;  3VA5 A;  1C8C A;  1KHI A;  3OSO A;  4YIJ A;  4J1M A;  3TBI B;  3R8B A;  1PYB A;  2EYF A;  2FHT A;  3MFY A;  2IY5 B;  1OTC A;  1Y1V G;  4A3I G;  4GS3 A;  1HJP A;  1BCP C;  1BNZ A;  5BR8 Q;  3OWF A;  1DD2 A;  4QQB X;  4A3E G;  4C3J G;  4CJ1 B;  2F0U A;  4CJ2 C;  1SYE A;  1E2W A;  5JVH 3;  1YIT A;  1GUW A;  2UXB L;  3A0J A;  2K03 A;  4IPG A;  3TQY A;  5GRO A;  1E1O A;  4LW1 A;  1Q8I A;  2HDM A;  1E3P A;  4OX9 Q;  4EQN A;  5ELC A;  2KCN A;  1I50 B;  4A93 H;  3KF8 B;  3KF6 B;  3ONA B;  2A8V A;  1VDZ A;  2EJG C;  1XPU A;  2L12 A;  2I5H A;  4GOP A;  1CI3 M;  2EY1 A;  4X6A H;  2F0Q A;  1STN A;  3UDF A;  3CRK C;  2N78 A;  4LK1 C;  3PUZ A;  4DAP A;  4R4Q A;  4KY5 A;  5GAG C;  3WOF A;  4DV4 L;  1X9N A;  5C4X B;  3L2P A;  4XYQ A;  3R3O A;  2F0W A;  3J7Z C;  1I6V C;  2EJM A;  3G7L A;  2WKD A;  2NVY B;  4DAY B;  5LMN Q;  5IGG A;  1WTV A;  4KKT A;  3S1R B;  4P71 A;  4FXK C;  3BZC A;  3UE1 A;  4JI0 Q;  4BY7 H;  2EY5 A;  2QDL A;  3T1Y Q;  4WJ3 M;  2BH8 A;  3J81 c;  4MHE A;  1SXT A;  4F8M A;  2CWP A;  3UE0 A;  1YIJ A;  4FF1 A;  1FJG L;  5COR A;  2VQE L;  3VYT A;  1PTO C;  4JI3 L;  1Y8N B;  1H9R A;  2ZXO A;  2IHE A;  2LS0 1;  1UAP A;  5C6A A;  4Q5V A;  2EY2 A;  4A3M B;  1AE2 A;  4B3T L;  1S4Z A;  5IOC A;  3I4N G;  4QMG A;  5JAV A;  2F0S A;  1IL8 A;  1H9J A;  3D3R A;  2EYH A;  3GTK H;  1TS5 A;  1STE A;  2JJQ A;  2HIX A;  4DNI A;  3PO3 H;  1JQY D;  4X3T A;  2JA6 B;  3GTL H;  2A68 C;  1IBM L;  2EYJ A;  1PH4 A;  1YNJ C;  4KKU A;  4AYB B;  1BO0 A;  3H3V H;  3TDQ A;  1Q90 A;  5DEH A;  2R7F A;  3CCU A;  3CCV A;  1F2M A;  1CKO A;  1ZYR D;  4KTA A;  3PUX A;  2YU9 B;  5FK9 C;  1PMR A;  2HQL A;  1HZB A;  1LT3 D;  1SE8 A;  3CXC A;  4A76 A;  2F0P A;  3KDF A;  4ZKB B;  4A75 A;  4IUQ A;  1YJW A;  3SGI A;  1XMQ L;  3PIP 3;  1MD2 D;  1GUO A;  1LTL A;  2MPM A;  4B08 A;  3F2D A;  2Z4H A;  1IW7 C;  4DR7 Q;  1GO3 E;  2MUY A;  1XNR L;  1G91 A;  3MWY W;  2CW0 D;  2K05 A;  4XQN A;  2YTY A;  2K5N A;  1KAB A;  2E2I H;  5LMU Q;  1EZ8 A;  3V05 A;  1U5K A;  3NP8 A;  4IOC A;  2UXD L;  1MBY A;  2NN6 I;  2WAQ E;  3JAM E;  3TS2 A;  3BDL A;  1Z9F A;  2RHS B;  3FEW X;  1VMP A;  4QUC A;  3Q23 A;  1Q3L A;  3CCM A;  4J15 A;  3H94 A;  2SNM A;  3RLF A;  4DR3 L;  1BVS A;  3DM3 A;  1SEB D;  1ET6 A;  1V1O A;  4KJN A;  2MFI A;  2YYZ A;  1CA5 A;  4OWW B;  4HMI A;  2UXC Q;  3MA2 B;  1U0L A;  2KBN A;  1YNX A;  1T9H A;  1QZG A;  3TRZ A;  4IPC A;  3FHW A;  1X65 A;  1E0B A;  3FP9 A;  4G7H C;  3CC7 A;  5M3F H;  4UAI A;  1BQQ T;  3KLW A;  3PV0 A;  3CC4 A;  1XNQ L;  4BXX G;  3TSS A;  1WTO A;  2B2U C;  1TWF B;  1JOK A;  3D6C A;  5E4X A;  1CM9 A;  2UUA L;  3KLR A;  1QE6 A;  1HUM A;  2WP8 J;  2Q2U A;  4OHJ A;  4KHP Q;  4GNX C;  5HUR A;  4GLA C;  5C4X G;  1TWH B;  1C48 A;  5IYC H;  4L5R C;  1I6H H;  3M7N A;  5GQO A;  4HJ5 A;  1K9M C;  1KL9 A;  2F0F A;  1L2F A;  1RHP A;  1GUN A;  1N34 L;  1JJ2 A;  3EVQ A;  4DR6 L;  4ZLT F;  3QR8 A;  1IHZ A;  1PDQ A;  2SEB D;  2LXK A;  1K8G A;  1FNU A;  4L63 B;  4C3I H;  2JA7 G;  1B8A A;  1B53 A;  1TWA H;  1HA6 A;  4XT3 B;  1SYC A;  2AUJ D;  1IBL Q;  3RMH A;  1JOQ A;  3M4Q A;  1HA5 A;  1R9T B;  4A3M G;  4K2K A;  3K5N A;  2ZXR A;  2ZT9 C;  1KNA A;  3J81 L;  2MO0 A;  1RD9 D;  1SFO H;  3KJO A;  1D1I A;  4KI0 A;  3KOJ A;  2JA6 G;  2C9O A;  2PI2 E;  3T53 B;  4A3G B;  1AFP A;  4AYB G;  4NB3 A;  3CC2 A;  1XYI A;  2FJ2 A;  1YHA A;  4MIU A;  3OOC A;  4C3J H;  3S17 B;  4H02 A;  5JVG 3;  4DV2 Q;  4L5S A;  4HIM A;  4NW2 A;  1X32 A;  4EQ5 A;  3L3O C;  5ELE A;  5I4D A;  2DY7 A;  4XXE A;  3OW2 A;  2ES2 A;  3GTO H;  4S3S A;  1OXV A;  4C2M B;  1K0R A;  4KKS A;  4A3J H;  1RJT A;  2EIF A;  4BWG B;  3PO2 H;  1DCZ A;  2WIN B;  1I4H A;  4OGQ C;  3G4S A;  2JA8 B;  3E5S A;  3A56 A;  4UPA A;  2CKZ B;  2VXW A;  1CFM A;  1Y8O B;  4K14 A;  1L1O C;  3SK8 A;  2O4X A;  2L9H A;  1RF2 D;  4FF2 A;  3Q8D A;  2OT2 A;  1F9P A;  5K5P A;  3MVV A;  3S9W A;  3LGJ A;  1EY0 A;  3H0G H;  2JA9 A;  4PG3 A;  4V19 0;  2EOT A;  4J6H A;  4A3B B;  4DR1 Q;  3KLS X;  1BKB A;  3S2D B;  4C3H G;  2HCI A;  4FO2 A;  1PFM A;  3D6W A;  2E5L L;  1NSN S;  1FNV A;  4RA8 A;  1D8L A;  3U9O A;  3RZD H;  1EYC A;  2F3W A;  3V96 A;  4JV5 Q;  4LF4 L;  1WFQ A;  2L0C A;  2MNA A;  2PZU A;  1JR0 D;  1KDB A;  1UNS A;  3HOV B;  4OO1 G;  2EJF C;  1ICW A;  1F2L A;  1MGS A;  1PRT F;  1AEX A;  3A7L A;  4HED A;  4DV3 L;  2XGT A;  5FO8 B;  5K36 G;  2QF7 A;  3QOJ A;  5DM6 3;  2X69 A;  1N36 L;  1I4Q A;  1CT1 D;  2CWA A;  4BBS B;  4P75 A;  3DUZ A;  2A6E D;  5J22 A;  4C1N I;  1WCM H;  2PO4 A;  1LT6 D;  5C3E H;  2E75 C;  4XYO A;  1HNZ L;  4LFA Q;  1FR3 A;  1SSO A;  4GLV B;  2Z6K A;  1I4R A;  5COY A;  1EIF A;  2PYK A;  3V2T A;  5KIX A;  4DUZ Q;  5LL6 X;  1Y69 U;  3P1H A;  4Q0F A;  3PIO 3;  1KTK A;  1LAB A;  2H1E A;  3L7Z C;  3Q22 A;  2PQA A;  2E2H B;  3EA6 A;  3I70 A;  1CHQ D;  4WJW A;  1HQM C;  5CV4 A;  1SYG A;  3CPW A;  3M4O B;  2C5C A;  3STB C;  4L5T A;  1CKN B;  1QIL A;  5IT9 L;  2UU9 Q;  3H09 A;  2B2W A;  3OHX C;  1HHV A;  4BA2 I;  1A0I A;  1Q1B A;  4JK1 C;  1LTT D;  3K0Y A;  4C1N K;  1VQD A;  3PUY A;  3RLN A;  4YY3 Q;  2VUM H;  4OXP A;  1QJO A;  3HOY B;  2EYM A;  2WAQ B;  5I6Y A;  1HZA A;  1HNX Q;  1AP0 A;  1WJJ A;  1ZKO A;  2KQ3 A;  4RKB A;  1V9P A;  1PH6 A;  4U67 3;  2NB0 A;  2MJ8 A;  5BN3 A;  4X64 L;  4DV0 L;  1K3B C;  4HAE A;  4F87 A;  3W1G A;  1EFI D;  3K5L A;  1K0S A;  4HCE A;  1CSQ A;  2F0J A;  3EIV A;  5ELF A;  4GOP C;  2E2J B;  5JOB A;  3TEH B;  3BS1 A;  3AMU A;  5ELO A;  4RMF A;  2ZJQ A;  1Y1W H;  3A74 A;  2PMZ B;  3C1F A;  3NSW A;  1HR0 L;  5KND A;  3MZ5 A;  2PPB C;  1I4X A;  2FMC A;  3VYS A;  4BXX H;  3W1B A;  1U4M A;  5M5Y B;  1Q8K A;  4IFD J;  2E74 C;  2NVQ H;  2OXP A;  4LUO A;  3VA7 A;  3T1H L;  2JA8 G;  3C2P A;  1L0X B;  4LF5 Q;  5JPM C;  1BBU A;  1QOH A;  1UE6 A;  4JI4 Q;  1SNP A;  2CCZ A;  4DR4 Q;  1B7Y B;  5CV7 A;  1K8M A;  2Y0S E;  4R4O A;  4X62 Q;  4BBR B;  1BCP B;  1G8Z D;  1K83 H;  1PV4 A;  5IYD G;  1TWC H;  1ZXT A;  4PZ8 A;  2EDG A;  2K5Q A;  3A5Z B;  1JIC A;  2F0L A;  4NDX A;  1EIG A;  2D0P A;  1VQF A;  3H3V C;  4HIO A;  2NVX B;  4FXG C;  4LF7 L;  2JA7 H;  2BDN A;  1TXY A;  3GTP H;  1VQG A;  3VR4 A;  3RN5 A;  4UY8 C;  2PCF B;  4QJF A;  1MSH A;  4POF A;  3HOV G;  1B3A A;  1PZI D;  1NMF A;  2FIN B;  2A19 A;  1B3Q A;  4FXD A;  2PW5 A;  1NY4 A;  3E9H A;  3A54 A;  4LF8 L;  3T56 B;  1MJE A;  2ZM6 Q;  4BBS G;  1VQN A;  1E7Z A;  3H3V I;  5C5M A;  4K0K L;  4IN3 A;  3NWT A;  1KDC A;  3M3Y B;  1V43 A;  1J8I A;  4M8A A;  5BN5 A;  1PTO B;  1TT2 A;  4DUY L;  2V1C C;  4KV6 A;  1QUQ B;  3ICE A;  2JA5 B;  2VB2 X;  3S14 H;  4I7A A;  2EZV A;  3WOE A;  3S24 A;  1PLF A;  1LTG D;  1F77 A;  4CGY B;  5D3D A;  2N8N A;  2WV6 D;  3PMF A;  1MJC A;  2ID0 A;  2J4X A;  2OF1 A;  3MC0 B;  3BYT B;  2FMM A;  1Q7Y C;  5KNC A;  1NTG A;  1YZ6 A;  1P8L A;  2KEN A;  2Q2H A;  4HMJ A;  5EJW A;  3K58 A;  3L9A X;  1ZYR C;  2R7Z B;  3HOY G;  1YJN A;  3CQZ B;  1D1K A;  2WAQ G;  1ROD A;  2KVM A;  1I3Q H;  2D5D A;  4C3H H;  1JOR A;  1GHJ A;  4B3M L;  1QVG A;  2B2Y C;  2CQO A;  4JI7 L;  1SNM A;  1NR2 A;  1STB A;  4JI6 Q;  1OXX K;  1H9S B;  5IWA L;  4BA1 I;  3G71 A;  2CW0 C;  2K28 A;  1NAP A;  4IFD H;  4FF4 A;  1STY A;  4A3D B;  2AUK A;  4JI2 L;  1S3O A;  3ULJ A;  4N9P A;  3S1M B;  3S1Q B;  2NVT H;  1CHP D;  4RG1 A;  5C4J H;  1PRT D;  1T5E A;  1Q46 A;  3BU2 A;  5IP7 G;  2Q2I A;  1D5Z C;  2B2V A;  1TWF H;  2DNE A;  4IUN A;  3J81 E;  3KYH C;  1I5F A;  1STH A;  2R93 G;  1SYF A;  1C0A A;  2ZJR A;  5CV8 A;  1SDF A;  2KEE A;  3EJI A;  4P74 A;  5CV9 A;  2F0T A;  3HOZ B;  3GTG B;  2UUB L;  1EY6 A;  4JYA L;  1WTW A;  2SOB A;  2G5D A;  2EYO A;  2V4D A;  3S16 B;  4BBR G;  2DY8 A;  4K5W A;  1E22 A;  1BBW A;  3J7A V;  2XIW A;  3F2C A;  1W3S A;  2SNS A;  3F2U A;  4HJ7 A;  4YHH L;  1O7L A;  4A3F G;  1EOV A;  5FKA C;  4N9T A;  2Z1C A;  4X65 Q;  1WD0 A;  1UWV A;  3FMC A;  3LNN A;  2ASB A;  5JEA G;  2Q2T A;  3I4O A;  4OEM B;  1CA6 A;  2EY6 A;  1GJX A;  4DV5 Q;  4LFC L;  2ATW A;  2OQK A;  4DV6 Q;  4K6L A;  3HKZ E;  2XTI A;  1S72 A;  2F0N A;  4IPD A;  3SK6 A;  2RSO A;  5FLX c;  4GZY C;  3RZO B;  4B3S L;  1R4P B;  4PZ7 A;  3NTI A;  3X3N A;  4ZK9 B;  2E76 C;  3NTK A;  3T51 B;  3K7A H;  1II3 A;  4DU9 A;  4GNX B;  5IP9 G;  4KD4 A;  2CFM A;  2E2D C;  4LF6 Q;  3D31 A;  5AFW A;  4Y7N B;  4POG A;  4DAV A;  2LXJ A;  4GKK L;  4DV7 L;  2BA0 A;  1A3V A;  1YHQ A;  3E3X A;  1WYD A;  1KRT A;  2WAC A;  1VQL A;  3J80 c;  1TVX A;  1TS2 A;  4IUR A;  2QW7 A;  4NXM Q;  3DXJ C;  3ULL A;  1JWS D;  5GAH C;  2GVA A;  4O2D A;  3HOU B;  1IBK Q;  4IJL A;  5IGF A;  1BR9 A;  2F4V L;  5EPL A;  4NP5 A;  5C44 H;  4CHT B;  1QCB D;  5H1S E;  3GTM H;  1Q12 A;  1D2B A;  2KJX A;  3CU7 A;  5E7N A;  2QKI C;  2ICE C;  4HJ8 A;  4IQZ A;  4FDB A;  4DFA A;  2A5H A;  2KHJ A;  4BY1 B;  1PH8 A;  2YTV A;  4IO9 A;  1JOO A;  1OO9 B;  5AJ3 L;  2WB1 E;  1TU2 B;  3CW2 C;  4B3R L;  5DAU A;  1SLJ A;  1VF5 C;  2R7Z G;  1VQJ A;  2Y0S B;  3QWN A;  1VQM A;  1SND A;  5M5X B;  2WII B;  5I9O A;  2EPB A;  1EEI D;  4A3C H;  5FLM G;  2NN6 G;  4ZCK A;  1SMY D;  2ZTC A;  4X3U A;  2JE6 I;  3HOW G;  2F0K A;  4GN4 B;  3FPP A;  4L8J A;  5GAE C;  3DWP A;  1SMX A;  3MXN A;  1LTB D;  3DM1 A;  5JPN C;  4JPB W;  4R1J A;  2DUD A;  4QL5 A;  4HJA A;  1D5X C;  4LFB L;  4X66 Q;  4IJH A;  1XMO L;  4A3D G;  3ZJY C;  1IKM A;  2WFW A;  5IT9 E;  3HOV H;  3W2D A;  3NBI A;  4V0B A;  3FKI H;  1L1O B;  1EY7 A;  1KDA A;  1OXU A;  1KLG D;  5T1I A;  5IGD A;  5J3B A;  1F9Q A;  2Z6K C;  3SHL A;  4DV1 Q;  2K4K A;  3RLO A;  1RCV D;  4DF7 A;  1JB7 A;  1JT8 A;  1ESR A;  1HR0 W;  4NXN L;  4DNT B;  1CK1 A;  1YBY A;  3EBE A;  1AZP A;  2B63 B;  3D0F A;  3HOZ G;  3MXP A;  2Q8R E;  2YV5 A;  1JWU D;  2K6A A;  3VYU A;  4AH6 A;  2Z4I A;  3KLS A;  3T16 A;  5C0X G;  1J5E L;  1HNW Q;  5C4H A;  1SNQ A;  2CH4 A;  1SRO A;  4DR2 L;  1A6X A;  3OPO A;  1HRJ A;  2B2W C;  2L15 A;  2X6L A;  3HG9 A;  2VQF L;  4JBJ A;  3URY A;  3HOW H;  4KHV A;  1U4R A;  4ZRZ A;  2UUC Q;  4DR5 L;  4RWS C;  3BVZ A;  3GTQ H;  1TQO A;  4HTH A;  1X6O A;  2L1B A;  3QB3 A;  2L5T A;  1EY8 A;  1DM0 B;  3MHB A;  2IPK D;  4R8N A;  1PH5 A;  1NBW A;  4JG2 A;  1DZ1 A;  4RAU C;  2NZ1 D;  4LAA A;  2A6E C;  2PQE A;  1WOC A;  4WFN 3;  5JJI A;  4PNY A;  4RHS A;  3I55 A;  3Q6S A;  2MP1 A;  3CHB D;  3FPU B;  3S15 H;  4CDF C;  2EVB A;  5C3X A;  5IT9 c;  1N33 Q;  1LTI D;  2F0V A;  4A3K H;  2NWG A;  1MSG A;  3HOX H;  3C46 A;  1EY4 A;  1ESF A;  3K6O A;  3QIA A;  3A8I E;  3OTO Q;  3E6Z X;  1CUK A;  5KYL A;  1N32 L;  3GDE A;  1VMC A;  2PW7 A;  3HZX A;  5FLX L;  3GO5 A;  4KY6 A;  1EYD A;  4B9W A;  3AQQ A;  2F0G A;  3HOU G;  3DHQ A;  2RVL A;  4LUZ A;  3I56 A;  4DXF A;  1EIH A;  1LTS D;  5FO9 B;  4GKJ Q;  4TQU S;  3K80 C;  2QCP X;  4ID6 A;  4AQY L;  2VNU D;  3R2I A;  1VQI A;  3O13 A;  5CC4 A;  1S40 A;  3HP3 A;  3JC6 6;  1CQV A;  4TKO B;  2RCF A;  3J80 L;  2L11 A;  3P7J A;  2K75 A;  1AZQ A;  2R93 H;  1VQ7 A;  3EN2 A;  2D0O A;  3IFD A;  1WTQ A;  4A93 B;  1ZEQ X;  4M1U B;  4XDX A;  1W6K A;  1OXT A;  3TZD A;  1Y1V H;  5BR8 L;  3ER0 A;  4A3I H;  1CTM A;  3OIP A;  1WTR A;  1KQS A;  4A3E H;  2K5D A;  2Y0S G;  3I2Z A;  1RIP A;  5EAY A;  2KCT A;  2PNH A;  1LT5 D;  4A3F H;  1I94 Q;  2K50 A;  4JI8 Q;  4FNF A;  1PFB A;  2RDG A;  1YJ9 A;  4EQP A;  1SBB B;  1JCK B;  4GOP B;  3SDZ A;  4RH6 A;  2DJF C;  4IAL A;  4OX9 L;  3M4Y A;  5ELN A;  1FD7 D;  1C4Q A;  3DLL A;  2LKV A;  4LMQ D;  2IX0 A;  4UP9 A;  3D4W A;  4PV1 C;  5EGT A;  5KEE A;  2A69 D;  3HKZ B;  1NNX A;  4CDC C;  3TRE A;  1EU4 A;  1H9K A;  4DAM A;  3SVM A;  1UUP A;  1PFS A;  3D4R A;  1X3Q A;  5CMD A;  2IL8 A;  1AN8 A;  1GUT A;  1VQ5 A;  3C3L A;  5LMN L;  3I90 A;  4JI1 Q;  3QJY A;  5KGU A;  4RKL A;  4JI0 L;  5CV6 A;  3W5O A;  1PYS B;  4DXG A;  3T1Y L;  4OON A;  3GTK B;  2B63 G;  1QUQ A;  2GA4 B;  1A3U A;  3K5O A;  2X6G A;  3PO3 B;  1QWY A;  2CQA A;  3HFZ B;  4MTN A;  3BG3 A;  4Z9C B;  2MO1 A;  4LF9 Q;  2K5H A;  1B9M A;  2I07 B;  3HEJ A;  1A63 A;  3I4N H;  2F03 A;  4R9W A;  1B2T A;  4JW0 A;  2F4I A;  5D3I B;  2I5L X;  3HS0 C;  5EKI A;  1SNC A;  1LTA D;  1EQT A;  2N55 A;  4CDD C;  1GM5 A;  1GUG A;  4EVO A;  2RKS A;  3KDF B;  3G6E A;  1QG7 A;  4QGU A;  1LV9 A;  2B2T A;  2K33 A;  2WB1 B;  1RTO A;  3B6Y A;  4XQQ A;  3QG1 A;  2E2I B;  3GTJ H;  4CKB A;  5FLM H;  3BJU A;  4RGT A;  1CKM A;  4G7O C;  4QIW E;  2OWO A;  1O7Y A;  1V1P A;  1JE4 A;  1SRU A;  1VQH A;  3AFQ A;  3NK9 A;  3NQT A;  3NBH A;  4CDE C;  1GD7 A;  1SJE D;  1QVC A;  2AKW B;  1SE4 A;  3S1N B;  4DR7 L;  1TKW B;  1PH9 A;  3MEF A;  5J1Z A;  3IL8 A;  4YWK A;  4RCN A;  3MTS A;  2O5J C;  3T13 A;  2B2V C;  5LMU L;  5KRU A;  2A6H D;  1EFW A;  2GN5 A;  4IFD I;  1X54 A;  3KFU A;  1SYB A;  1CZW A;  5M5W H;  1NCV A;  2AWO A;  1G6P A;  2NZH A;  3R2T A;  1A2T A;  5EPK A;  1KIX A;  3H6M A;  1G2S A;  2I46 A;  2NTT A;  2RSN A;  4A4I A;  3CPF A;  2UXB Q;  3PSI A;  5LHY 1;  4WRD A;  1XX8 A;  1ENA A;  5M3F B;  1EEF D;  4JBK A;  4A93 G;  2UXC L;  4A3G G;  2AQ3 B;  4XTC S;  1B9N A;  2OQ0 A;  3P20 A;  5C0X H;  1TY0 A;  3J81 i;  1MI2 A;  4DKA C;  4F7X A;  2OCE A;  1X3E A;  2PNR C;  3A55 A;  1N9W A;  3F2B A;  1BBX C;  2VZA A;  3KF8 A;  5JJK A;  3KF6 A;  4K6D A;  3SE0 A;  5E1F A;  2IX3 A;  4H13 C;  1CZG A;  1HQR D;  3NUC A;  4DV4 Q;  1PRT C;  1I6H B;  1HZ9 A;  2HUG A;  2D2C C;  1I50 H;  2E8G A;  1WTP A;  2M9V A;  2JK8 A;  1O80 A;  1XPO A;  3NWS A;  3VR3 A;  2R92 B;  1EZ6 A;  1Z6H A;  1EU3 A;  3NEN A;  3PCO B;  1Z47 A;  4DAY A;  4KHP L;  2K1B A;  3HKZ G;  4O42 A;  1SN8 A;  1FJG Q;  4PQX A;  3RR5 A;  2KA7 A;  3OMG A;  4KN7 C;  2RCN A;  4C3I B;  4JBW A;  2VQE Q;  5C4X H;  4NPS A;  4JI3 Q;  2DNC A;  2NBF A;  1S5B D;  5IY0 A;  4Y7N H;  2NVY H;  5G3L F;  4A3B G;  2QDB A;  1KAA A;  3S1R H;  4B3T Q;  3HKS A;  1K3R A;  1TS4 A;  3LWE A;  3ERO A;  4RFB A;  1SE3 A;  1SFO B;  3GV6 A;  5IGB A;  3PO3 G;  1PH3 A;  1HUN A;  3P75 A;  3KBG A;  1EY9 A;  5F2D A;  1IBM Q;  4K8J A;  1IBL L;  2DGY A;  1IYU A;  4XIG S;  5FJ8 G;  4PMC A;  2K32 A;  4A3M H;  3CKI B;  2P5Z X;  3NHH A;  4RGO S;  1VQE A;  1C7Y A;  1S5D D;  1HFN A;  3MXU A;  1AW7 A;  3J7A F;  1DJR D;  1XTD A;  1VQK A;  4ULL A;  5A2Q L;  1B1Z A;  2AWN A;  2HIV A;  1XMQ Q;  2JA6 H;  1VCI A;  5BN4 A;  3K0X A;  5E3F A;  2RF4 A;  3CCL A;  1XXG A;  4ME5 A;  3GTO B;  3ERS X;  4TRD A;  4QCL A;  4A3J B;  4OWT B;  3ULP A;  2IW3 A;  3PO2 B;  2WB1 G;  1D5M C;  1XNR Q;  1LYL A;  4JI8 L;  2KHS A;  4DV2 L;  2YU9 H;  2AMC B;  2VL6 A;  4DGZ A;  3S2H B;  3SXH A;  3AU7 A;  3TN2 A;  4ODG A;  4IUT A;  1PH7 A;  2UXD Q;  3H0G B;  1NR4 A;  2K04 A;  4YWL A;  3BVM A;  3AB9 A;  1WTH A;  3CD6 A;  1M90 C;  1M1K C;  1E2Z A;  5CGK A;  4NMZ A;  2K5W A;  3I72 A;  3ND8 A;  4OEL B;  3PUW A;  2O2L D;  3CCQ A;  4DR3 Q;  4MN3 A;  4LUV A;  5IYB G;  1BCP F;  4JOI A;  3WDN A;  2J7Z A;  4JI1 L;  3M9B A;  2XWB B;  1KRS A;  2F52 A;  4IUP A;  4DR1 L;  4QY7 A;  1EWI A;  1F9R A;  3I8Z A;  1BF4 A;  2R6G A;  4I65 A;  3CME A;  1MKH A;  3CCS A;  2JEB I;  4YWM A;  3CF5 A;  1EIY B;  1SMY C;  5M3F G;  3I91 A;  1HTL D;  3FVQ A;  3KJP A;  5A35 A;  3JAM i;  1QB5 D;  4MNO A;  1XNQ Q;  1UEA B;  5T1G A;  4DK1 A;  1O7Z A;  2VY3 A;  4KJO A;  3U50 C;  4JV5 L;  1WCM B;  3DWQ A;  4KD3 A;  4QB4 A;  5FLX E;  2XRS D;  5C3E B;  4X3S A;  5J39 A;  3KK7 A;  3ITP A;  1VQ4 A;  4KK7 A;  2JQO A;  5IIF A;  5IYC G;  4OO1 H;  3ND9 A;  2Z0S A;  1B70 B;  4A3L G;  3NEL A;  1TWG B;  3J81 j;  1I4G A;  5K36 H;  1LM0 A;  4HSP A;  2ICI A;  1RTN A;  2XSC A;  2B8F A;  5I2X A;  2R92 G;  3J80 E;  3CCR A;  4LFA L;  2BH2 A;  4QUF A;  1N34 Q;  4KMU C;  1F2Z A;  4DR6 Q;  1PTO F;  4H7B A;  4C3I G;  4O1N A;  1TWH H;  3DEP A;  4R4T A;  4NKL A;  1W2B A;  2PQA B;  2IT1 A;  4PZ6 A;  3U9S A;  1V1Q A;  4DUZ L;  2XVS A;  4R8I A;  1TY2 A;  4QIW B;  2VUM B;  4KY7 A;  3I4M B;  3SR1 A;  5L37 A;  2RQX A;  5LMN W;  3K7U C;  1IKL A;  1JB3 A;  2QIL A;  1U9R A;  2BE5 D;  3QOL A;  1BOS A;  2F3I A;  2UU9 L;  1XPR A;  2LY7 A;  2FXQ A;  4EQO A;  4FVM A;  4TVA B;  3IFT A;  1YVC A;  4XQJ A;  4U68 A;  3BDO A;  4YY3 L;  1R9T H;  1G6Z A;  1A2U A;  4KLK A;  4IPH A;  2EXZ A;  1HZC A;  1ASY A;  1JWM D;  3BZD B;  1HNX L;  4RGN A;  4ALP A;  1Y1W B;  1FGB D;  4P72 A;  3AEV A;  4N8X 1;  5KNB A;  1K8A C;  4K5V A;  3Q24 A;  3E0E A;  5GAD C;  4A3G H;  1ENC A;  3DWA A;  4LJZ C;  1WTX A;  4A3J G;  1U4L A;  4JBM A;  2NVQ B;  3PO2 G;  3WWV A;  2TMP A;  3S17 H;  3R93 A;  1BUV T;  1EYG A;  2B29 A;  5IOD A;  4UP7 A;  4EX5 A;  4H0L C;  2HHH Q;  1EL0 A;  3NE5 B;  5HGT A;  2MQH A;  1N8R C;  2OTJ A;  5I2Y A;  1YNN D;  2KED A;  1FVI A;  3H0G G;  4K5X A;  2JA5 G;  1K83 B;  5HGQ A;  2L4N A;  2Z9H A;  1TWC B;  3PGZ A;  4OIJ A;  4AIM A;  4C2M H;  3E0J A;  1K73 C;  5LL6 S;  4O0A A;  3Q0A A;  1Z7T A;  4LF5 L;  1LT4 D;  2JA8 H;  4R4C A;  4JI4 L;  4MZ9 A;  1E2V A;  2HQE A;  4DR4 L;  2E5L Q;  3X3M A;  4J8Q A;  2BOS A;  2JA7 B;  4X62 L;  1VQC A;  1SYD A;  4ABN A;  3GTP B;  4KHZ A;  2HCC A;  3K8A A;  3EFX D;  3OWE B;  5G3L D;  3I3C A;  4A3B H;  1SR3 A;  5IYD H;  1IXR A;  3CP0 A;  3TP6 A;  4LF4 Q;  3OIQ A;  3S2D H;  5M3M B;  3AYH B;  3OYY A;  1UE7 A;  3I4L A;  1UE1 A;  2CH4 W;  3PF4 A;  1HCZ A;  4DV3 Q;  1YI2 A;  2D62 A;  2ZTE A;  1VQO A;  1QZH A;  2RDF A;  1N36 Q;  1P16 A;  1WCM G;  5FJ8 H;  1XJV A;  1B4O A;  5C3E G;  1Y14 B;  1DGS A;  2JEA I;  1AE3 A;  3H15 A;  2A69 C;  2BCO A;  3FRP B;  5JEA J;  1HNZ Q;  2B2T C;  2KUM A;  3D8G A;  2R3Z A;  2J0T D;  1MIU A;  4IOA A;  2XN9 C;  2EQS A;  1BXT A;  2ZM6 L;  3K59 A;  1S5E D;  3S14 B;  3UDX A;  1ONL A;  2OEO A;  4BBS H;  3DEO A;  4RHR A;  2C35 B;  2KCM A;  4IUU A;  1VQA A;  3KBX A;  3I7F A;  1IZ6 A;  5EBD A;  4DK0 A;  1PH2 A;  1VQP A;  5DLQ E;  3VYR A;  1PH1 A;  2A74 C;  2XNA C;  2AQ1 B;  3BDC A;  1RDP D;  1A8V A;  2VUM G;  3S1N H;  1CKN A;  3I4M G;  1S5C D;  1I3Q B;  1ASZ A;  2E2H H;  4C3H B;  2MGS A;  1XWE A;  2KOL A;  3M4O H;  3SK4 A;  3KUP A;  2HD3 A;  1SNO A;  4RGM A;  4IUV A;  5IYB H;  4APV A;  3DMU A;  4X64 Q;  4DV0 Q;  3U58 A;  1EWH A;  1BCP D;  5FOB B;  3GQB A;  3LWU A;  2TSS A;  1EUJ A;  3W3A A;  2IWH A;  3TZU A;  3PF5 A;  2JP1 A;  2L55 A;  2F0H A;  1DON A;  3CCJ A;  4FF3 A;  3HOY H;  2B2Y A;  2PMZ E;  2XWJ B;  1Y1W G;  3LX0 A;  2NVT B;  3UDG A;  1X55 A;  1PVO A;  5C4J B;  4GN3 B;  3GP7 A;  1GXD C;  1WI5 A;  4UP8 A;  1HR0 Q;  1VQ6 A;  1DOL A;  5JJZ A;  1G2T A;  4JI6 L;  1E24 A;  1JJC B;  3BYY B;  2F0I A;  5C0X I;  5CBA E;  2H5X A;  1ILP A;  1GOZ A;  4MTK A;  3T1H Q;  5I6W A;  2E2J H;  2A6H C;  1D7Q A;  3D4D A;  4P73 A;  5I9P A;  2O5I C;  2F0E A;  2LSS A;  4HIK A;  1HXY D;  4HR7 B;  1RKN A;  2QA4 A;  4UDU C;  1A62 A;  2N49 A;  3N6R A;  4A3L H;  1PYW D;  5IP7 H;  3BVG A;  3GV3 A;  3JAM c;  1FYC A;  3NQI A;  4G57 A;  5M5Y H;  2PZT A;  4R4I A;  2R92 H;  5KYI A;  4DNR B;  1UE5 A;  1JJG A;  5A2Q E;  5C5L A;  1PHJ A;  1DYQ A;  2D9U A;  4BY1 G;  5CR3 A;  1PTO D;  4DPG A;  2R61 A;  2KEC A;  1G51 A;  1CQF A;  4LF7 Q;  3I73 A;  4BS9 A;  4BBR H;  3NTH A;  4YCV A;  4DA2 A;  2CVR A;  2JSO A;  3UDI A;  1EY5 A;  2K14 A;  3PIO A;  4Y52 H;  4X65 L;  3F8T A;  5M3M G;  4PMB A;  5EQ0 A;  2BDO A;  3K7A B;  2F1M A;  5JEA H;  4X3K A;  5FO7 B;  5IE8 A;  5IGE A;  5C0X J;  4JI5 Q;  1A3T A;  4DV5 L;  2WKC A;  5E4W C;  4DK6 C;  2NYZ D;  2A68 D;  1PRT B;  2NVX H;  1YNJ D;  4DV6 L;  4ME3 A;  4LF8 Q;  4BY7 B;  4TSS A;  4HJ9 A;  5D65 A;  5C4Z A;  5ELB A;  2VW9 A;  3UI2 A;  4K0K Q;  4L5Q A;  1H9M A;  4IZ8 A;  1LO5 D;  1G29 1;  1NE3 A;  1V8Q A;  2B39 A;  2NUC A;  5C44 B;  1AH9 A;  2PI2 A;  1Q81 C;  3A7A B;  2OTL A;  1STA A;  1KC8 C;  4LF6 L;  4DN4 M;  5IP9 H;  1VS0 A;  4GLX A;  1PZK D;  1J6Q A;  1RL2 A;  4DUY Q;  3GD7 A;  4JCV E;  4K2L A;  1X3G A;  1QVF A;  3GTM B;  5TSS A;  4LNQ A;  1IW7 D;  2ZTD A;  4NXM L;  2A1A A;  4OIK A;  3T4A C;  2HHH L;  1PZJ D;  1IBK L;  4CBV A;  3L0O A;  3GTL B;  3S2H H;  3M3Y H;  1EWC A;  2JYO A;  2G9D A;  1KD1 C;  3RNU A;  2F0O A;  1PTO H;  1SAP A;  2NTS A;  3CCE A;  4ILW A;  4I7Z C;  3J7Y W;  3K57 A;  5CYU A;  2JA5 H;  4JOI C;  3RD4 A;  2IX1 A;  2LMC B;  2NZO A;  4CKC A;  4XT1 B;  5CBE E;  1B50 A;  4B9X A;  2DJG C;  1L0Y B;  1JC7 A;  4B3M Q;  1HH2 P;  2A73 B;  4JI7 Q;  2FFK B;  3HRZ C;  2CHB D;  2ENB A;  3EQL C;  4QF4 A;  3CMA A;  4ZYS A;  3A8J E;  1HTP A;  5IWA Q;  1MHW C;  2R7Z H;  4IFD G;  2GVB A;  3CQZ H;  2G9H D;  3MFG A;  3MXN B;  1H9S A;  4JI2 Q;  3U4V A;  1VF7 A;  2IHF A;  2K7V A;  2N3S A;  2NN6 H;  3FKI B;  3TP7 A;  1VQB A;  5JJL A;  3NXW A;  2K5V A;  2H4O A;  1FL0 A;  3A8K E;  3VR6 A;  1EYA A;  1D6E C;  1YHB A;  2VS1 A;  4X66 L;  3N52 A;  1EQV A;  2ALY B;  1GKH A;  4A3D H;  1F9S A;  3S1M H;  3NEM A;  2UUB Q;  4EGV A;  1DOK A;  3S1Q H;  4JYA Q;  5C3W A;  3TS0 A;  4OO1 I;  1IL2 A;  1TWG H;  4F88 A;  4DV1 L;  5DNF A;  2Z8L A;  4YHH Q;  5IGC A;  1SE2 A;  3ERQ A;  1F2Y A;  3GTQ B;  3OMC A;  1GUS A;  1YEZ A;  1ENF A;  1KAW A;  2K01 A;  5DM7 3;  3HOZ H;  3GTG H;  1HNW L;  1ET9 A;  1OXS C;  3F1Z A;  3S16 H;  3IKJ A;  3J80 i;  4E6I A;  4LFC Q;  3M4P A;  1Q82 C;  4WOR A;  1KLU D;  2BA1 A;  1QNU A;  4ZKC B;  3JAM L;  2UUC L;  2R7D A;  4B3S Q;  3I4M H;  2I5M X;  2EYL A;  3S15 B;  4HID A;  4ZUI A;  4A3K B;  3M7G A;  5NUC A;  2B2U A;  1X3P A;  5EPJ A;  1EOT A;  2QGQ A;  3HOX B;  1Q86 C;  4GKK Q;  4CJ0 B;  4BY7 G;  1A15 A;  4N8F A;  4DV7 Q;  5EKL A;  4GNX A;  1LLR D;  3K81 C;  2JN4 A;  2B8G A;  3RZO H;  3PUV A;  1DOM A;  2LFN A;  1LAC A;  2ZJP A;  5C44 G;  1N33 L;  1NJI C; 
#chains in the Genus database with same CATH homology
 1OXV A;  1K0R A;  2F4V Q;  2R92 G;  4A3J H;  2EIF A;  3FKI H;  3CCR A;  1L1O B;  3PO2 H;  3VDY A;  1OXU A;  4LFA L;  3G4S A;  2BH2 A;  1N34 Q;  2ES2 A;  5J3B A;  1X3F A;  4UPA A;  2Z6K C;  2CKZ B;  4DR6 Q;  3OTO L;  4DV1 Q;  2K4K A;  3RLO A;  1L1O C;  1TWH H;  1JB7 A;  1JT8 A;  4R4T A;  1X56 A;  1W2B A;  4NXN L;  3Q8D A;  1HR0 W;  2PQA B;  2IT1 A;  1KXL A;  4PZ6 A;  1YBY A;  3EBE A;  3LGJ A;  1V1Q A;  4DUZ L;  3D0F A;  4JC0 A;  3H0G H;  3HOZ G;  2JA9 A;  4PG3 A;  4AYB E;  2YV5 A;  3HOU H;  3IRB A;  4DR1 Q;  4AH6 A;  1BKB A;  1HNW Q;  2K52 A;  3G48 A;  5C0X G;  1J5E L;  4GKJ L;  5LMN W;  3K7U C;  5AJ3 Q;  1SRO A;  4DR2 L;  1JE5 A;  2L15 A;  2E5L L;  2F3I A;  2VQF L;  4JBJ A;  2UU9 L;  4B3R Q;  1XPR A;  1D8L A;  2FXQ A;  1O7I A;  1VQ9 A;  2UUC Q;  3RZD H;  4DR5 L;  4A3C G;  4TVA B;  3GTQ H;  1YVC A;  4DK3 C;  1X6O A;  2EXD A;  4YY3 L;  1R9T H;  4JV5 Q;  3M85 A;  4BY1 H;  4KLK A;  4IPH A;  4LF4 L;  1HZC A;  1WFQ A;  1ASY A;  2MNA A;  1PH5 A;  1NBW A;  4JG2 A;  1HNX L;  1UEB A;  4OO1 G;  4ALP A;  1JMC A;  4P72 A;  3AEV A;  1WOC A;  5JJI A;  4DV3 L;  1K8A C;  2XGT A;  1I94 L;  5K36 G;  3E0E A;  3I55 A;  5GAD C;  4LFB Q;  4A3G H;  1XMO Q;  4YCU A;  5M5X H;  1N36 L;  1LUZ A;  3S15 H;  1NMG A;  2CWA A;  5M3M H;  5IT9 c;  4A3J G;  4P75 A;  4JBM A;  3FKI G;  2YTX A;  4A3K H;  1N33 Q;  2HT1 A;  3PO2 G;  1E1T A;  2QEX A;  3WWV A;  1WCM H;  1Q1E A;  4JI5 L;  1VQ8 A;  3S17 H;  1EYG A;  5C3E H;  2B29 A;  1EQQ A;  4UP7 A;  4EX5 A;  1HNZ L;  4LFA Q;  3HOX H;  2HHH Q;  3OTO Q;  4GLV B;  2JA6 H;  2Z6K A;  1CUK A;  2MQH A;  1N8R C;  2OTJ A;  1IYJ B;  1N32 L;  3GDE A;  1L1O A;  1FVI A;  1EIF A;  4NXN Q;  3GO5 A;  1H95 A;  2AHO B;  3AQQ A;  3H0G G;  3HOU G;  2JA5 G;  5HGQ A;  4DUZ Q;  4LUZ A;  3I56 A;  1PA6 A;  3PGZ A;  4AIM A;  4C2M H;  1K73 C;  3L7Z C;  2PQA A;  4O0A A;  1J5E Q;  4LF5 L;  4GKJ Q;  4TQU S;  3K80 C;  5HY6 A;  3CPW A;  4AQY L;  2JA8 H;  2VNU D;  4R4C A;  4DR2 Q;  4MZ9 A;  4JI4 L;  1VQI A;  3STB C;  1CSP A;  4L5T A;  1CKN B;  1S40 A;  2VQF Q;  2E5L Q;  2UU9 Q;  4DR4 L;  3JC6 6;  4BA2 I;  4GN5 A;  1A0I A;  4DR5 Q;  4X62 L;  1Q1B A;  1VQC A;  2RHQ B;  3RN2 A;  4KHZ A;  2K75 A;  3K8A A;  2R93 H;  1VQ7 A;  1VQD A;  3EN2 A;  2B63 H;  1EQR A;  3PUY A;  2D0O A;  3RLN A;  4YY3 Q;  3STB D;  4OXP A;  2VUM H;  4A3B H;  1SR3 A;  5IYD H;  1IXR A;  1OXT A;  3CP0 A;  1Y1V H;  5BR8 L;  3ER0 A;  4LWC A;  4A3I H;  4LF4 Q;  3S2D H;  1HZA A;  1HNX Q;  3AYH B;  1KQS A;  1WJJ A;  3OYY A;  1UE7 A;  4A3E H;  1FGU A;  1UE1 A;  1V9P A;  2Y0S G;  3I2Z A;  1PH6 A;  1RIP A;  2B3G A;  2KCT A;  5EAY A;  2UUA Q;  4LF9 L;  3PF4 A;  4DV3 Q;  2PNH A;  1YI2 A;  4X64 L;  2D62 A;  2ZTE A;  2K50 A;  4DV0 L;  4A3F H;  1VQO A;  4JI8 Q;  1I94 Q;  1YJ9 A;  1QZH A;  3E9I A;  4A3K G;  1N36 Q;  4GOP B;  1P16 A;  3W1G A;  1WCM G;  2KHI A;  3U4Z A;  1C9O A;  5FJ8 H;  4OX9 L;  4WJ4 A;  5ELN A;  1XJV A;  4YCW A;  1GVP A;  3A5U A;  1CSQ A;  1Y14 B;  4PMW A;  5C3E G;  1DGS A;  3HOX G;  2JEA I;  3EIV A;  1AE3 A;  3H15 A;  4GOP C;  3AFP A;  3TEH B;  3DLL A;  5JEA J;  1HNZ Q;  5ELO A;  2IX0 A;  4RMF A;  2ZJQ A;  3CAM A;  1MIU A;  1Y1W H;  4UP9 A;  3A74 A;  4IOA A;  4OWX B;  1N32 Q;  1HR0 L;  1L0W A;  2EQS A;  3NBH B;  2ZM6 L;  4BXX H;  3W1B A;  3J7A 5;  3UDX A;  3TRE A;  4DAM A;  4BBS H;  1Q8K A;  1PFS A;  2C35 B;  4IFD J;  2KCM A;  2NVQ H;  3S16 H;  1VQA A;  4LUO A;  1VQ5 A;  3I7F A;  1IZ6 A;  3T1H L;  2JA8 G;  3PIP A;  5LMN L;  1PH2 A;  4LF5 Q;  4JI1 Q;  1BBU A;  1VQP A;  1UE6 A;  3BZK A;  4AQY Q;  4JI4 Q;  5DLQ E;  2I0Q A;  4JI0 L;  2CCZ A;  3W5O A;  1PYS B;  3T1Y L;  4DR4 Q;  1B7Y B;  1KHI A;  1PH1 A;  4OON A;  2Y0S E;  4R4O A;  4X62 Q;  2B63 G;  1QUQ A;  1A8V A;  2VUM G;  1K83 H;  1PV4 A;  1PYB A;  5IYD G;  3S1N H;  1CKN A;  1TWC H;  2IY5 B;  1OTC A;  3I4M G;  1Y1V G;  4A3I G;  4PZ8 A;  4GS3 A;  3HFZ B;  4MTN A;  1HJP A;  1ASZ A;  5BR8 Q;  3A5Z B;  2E2H H;  2MO1 A;  4QQB X;  4A3E G;  3M4O H;  4LF9 Q;  1YIT A;  2D0P A;  1VQF A;  2K5H A;  5IYB H;  4HIO A;  2UXB L;  4APV A;  3A0J A;  4X64 Q;  4DV0 Q;  4LF7 L;  4IPG A;  3U58 A;  2JA7 H;  3TQY A;  3I4N H;  5GRO A;  1E1O A;  1TXY A;  4LW1 A;  1A63 A;  3GTP H;  1VQG A;  1EUJ A;  1E3P A;  2I5L X;  3PF5 A;  4OX9 Q;  3RN5 A;  4UY8 C;  4A93 H;  4QJF A;  3KF8 B;  3KF6 B;  3CCJ A;  3HOY H;  2PMZ E;  1GM5 A;  2A8V A;  4POF A;  1XPU A;  3HOV G;  4KHP L;  2I5H A;  1NMF A;  1Y1W G;  4GOP A;  3KDF B;  3G6E A;  4QGU A;  3UDG A;  1X55 A;  2A19 A;  1PVO A;  4X6A H;  4GN3 B;  3B6Y A;  3UDF A;  1NY4 A;  1WI5 A;  4UP8 A;  3E9H A;  1HR0 Q;  2N78 A;  1VQ6 A;  3PUZ A;  4R4Q A;  4JI6 L;  4LF8 L;  1MJE A;  1E24 A;  5GAG C;  2ZM6 Q;  1JJC B;  4BBS G;  1VQN A;  3GTJ H;  5FLM H;  4DV4 L;  1X9N A;  3BJU A;  5C0X I;  1CKM A;  1E7Z A;  4QIW E;  3L2P A;  2H5X A;  3H3V I;  3J7Z C;  2OWO A;  4K0K L;  3HOW H;  1SRU A;  1VQH A;  3AFQ A;  4DAY B;  3T1H Q;  5LMN Q;  1GD7 A;  2E2J H;  1QVC A;  2AKW B;  1D7Q A;  4P73 A;  4P71 A;  4DR7 L;  3BZC A;  3UE1 A;  1PH9 A;  4JI0 Q;  4BY7 H;  1V43 A;  2LSS A;  3MEF A;  4HIK A;  3T1Y Q;  4YWK A;  2BH8 A;  3J81 c;  4WJ3 M;  2QA4 A;  4DUY L;  2CWP A;  3UE0 A;  1YIJ A;  1A62 A;  2N49 A;  2V1C C;  1QUQ B;  1FJG L;  4A3L H;  5LMU L;  3ICE A;  5IP7 H;  2VQE L;  1EFW A;  3S14 H;  2GN5 A;  3JAM c;  4IFD I;  5M5Y H;  4JI3 L;  4R4I A;  2R92 H;  1X54 A;  3S24 A;  3KFU A;  5M5W H;  1UE5 A;  2IHE A;  1JJG A;  2AWO A;  1G6P A;  2N8N A;  2NZH A;  1PHJ A;  1KIX A;  4BY1 G;  1AE2 A;  1MJC A;  2ID0 A;  4B3T L;  4A4I A;  4DPG A;  1Q7Y C;  3CPF A;  1G51 A;  3PSI A;  3I4N G;  1NTG A;  2UXB Q;  4LF7 Q;  1YZ6 A;  1P8L A;  2KEN A;  2Q2H A;  3GTK H;  4BBR H;  4YCV A;  2JJQ A;  4JBK A;  2HIX A;  4DNI A;  3UDI A;  4A93 G;  3PO3 H;  2K14 A;  3HOY G;  3PIO A;  1YJN A;  3GTL H;  4XTC S;  2WAQ G;  4A3G G;  2UXC L;  1IBM L;  1PH4 A;  4Y52 H;  2OQ0 A;  4X65 L;  1I3Q H;  3F8T A;  5M3M G;  3J81 i;  3H3V H;  4C3H H;  4DKA C;  2OCE A;  2R7F A;  3CCU A;  1X3E A;  3CCV A;  4B3M L;  1QVG A;  1CKO A;  1N9W A;  2CQO A;  5IE8 A;  5C0X J;  3F2B A;  2VZA A;  4JI5 Q;  4JI7 L;  5JJK A;  3KF6 A;  3PUX A;  4DV5 L;  4DK6 C;  2NVX H;  2HQL A;  1HZB A;  4DV6 L;  4JI6 Q;  4ME3 A;  1SE8 A;  1OXX K;  3CXC A;  3KDF A;  4A76 A;  4LF8 Q;  5IWA L;  4BA1 I;  4A75 A;  1YJW A;  3G71 A;  4DV4 Q;  4HJ9 A;  1HZ9 A;  3SGI A;  1XMQ L;  1I50 H;  2VW9 A;  2E8G A;  4K0K Q;  1LTL A;  4L5Q A;  2JK8 A;  1NE3 A;  1G29 1;  1AH9 A;  4JI2 L;  3F2D A;  1S3O A;  2PI2 A;  3ULJ A;  1Q81 C;  4DR7 Q;  1XPO A;  1GO3 E;  2OTL A;  2NVT H;  1KC8 C;  4LF6 L;  1XNR L;  4RG1 A;  5IP9 H;  5C4J H;  1VS0 A;  4GLX A;  1RL2 A;  1J6Q A;  3NEN A;  1Z47 A;  3PCO B;  4DUY Q;  2YTY A;  3GD7 A;  4JCV E;  1Q46 A;  3BU2 A;  2K5N A;  3HKZ G;  1X3G A;  5IP7 G;  1QVF A;  1SN8 A;  1FJG Q;  2Q2I A;  3RR5 A;  2E2I H;  5LMU Q;  4LNQ A;  1TWF H;  2RCN A;  2VQE Q;  4JBW A;  2ZTD A;  5C4X H;  4NPS A;  4JI3 Q;  1U5K A;  3KYH C;  2A1A A;  1I5F A;  4IOC A;  4NXM L;  2R93 G;  2UXD L;  5IY0 A;  4Y7N H;  2HHH L;  2NN6 I;  2WAQ E;  2NVY H;  2ZJR A;  1IBK L;  4P74 A;  1C0A A;  4A3B G;  3L0O A;  3TS2 A;  3S1R H;  2UUB L;  3S2H H;  3M3Y H;  4B3T Q;  4JYA L;  1Z9F A;  2RHS B;  3HKS A;  1K3R A;  1KD1 C;  3RNU A;  3CCM A;  4J15 A;  4BBR G;  3RLF A;  3CCE A;  1E22 A;  1BBW A;  4DR3 L;  3PO3 G;  1PH3 A;  3F2C A;  1W3S A;  1BVS A;  4HJ7 A;  2JA5 H;  3DM3 A;  4YHH L;  4JOI C;  2MFI A;  2YYZ A;  4A3F G;  4OWW B;  1EOV A;  2IX1 A;  2UXC Q;  1IBM Q;  1U0L A;  2NZO A;  2KBN A;  4X65 Q;  1UWV A;  1IBL L;  2DGY A;  1YNX A;  2ASB A;  4XIG S;  5FJ8 G;  1T9H A;  1QZG A;  5JEA G;  2Q2T A;  3I4O A;  3TRZ A;  4IPC A;  4B3M Q;  3FHW A;  1X65 A;  4A3M H;  1C7Y A;  1VQE A;  1HH2 P;  4JI7 Q;  4DV5 Q;  4LFC L;  2ATW A;  2OQK A;  3FP9 A;  1XTD A;  4DV6 Q;  1VQK A;  3CMA A;  3CC7 A;  3HKZ E;  2XTI A;  5IWA Q;  5M3F H;  1S72 A;  4IPD A;  5FLX c;  2R7Z H;  4IFD G;  2GVB A;  4B3S L;  2AWN A;  2HIV A;  3CQZ H;  3KLW A;  3PV0 A;  1VCI A;  4PZ7 A;  1XMQ Q;  3K0X A;  3CC4 A;  1XNQ L;  4BXX G;  2RF4 A;  3MXN B;  3CCL A;  3ERS X;  3K7A H;  4JI2 Q;  3U4V A;  4OWT B;  2IHF A;  5IP9 G;  2N3S A;  4GNX B;  3ULP A;  2UUA L;  1VQB A;  2WB1 G;  2CFM A;  4LF6 Q;  1XNR Q;  3D31 A;  1LYL A;  4POG A;  2LXJ A;  4JI8 L;  4GKK L;  2YU9 H;  2K5V A;  2WP8 J;  4DV2 L;  2Q2U A;  5JJL A;  4KHP Q;  1FL0 A;  4DV7 L;  2BA0 A;  4GLA C;  4GNX C;  2AMC B;  2VL6 A;  1YHQ A;  1KRT A;  1WYD A;  5C4X G;  1YHB A;  5IYC H;  1VQL A;  2VS1 A;  3J80 c;  4X66 L;  4L5R C;  1I6H H;  3M7N A;  4NXM Q;  3ULL A;  1PH7 A;  5GAH C;  5GQO A;  2UXD Q;  2GVA A;  4O2D A;  2ALY B;  4HJ5 A;  1GKH A;  1K9M C;  4A3D H;  1KL9 A;  1IBK Q;  4IJL A;  4YWL A;  2F4V L;  5C44 H;  3S1M H;  3NEM A;  2UUB Q;  3CD6 A;  3S1Q H;  1L2F A;  1M90 C;  1M1K C;  4JYA Q;  3TS0 A;  1N34 L;  5H1S E;  1JJ2 A;  4OO1 I;  1IL2 A;  3PUW A;  4DR6 L;  1TWG H;  3CCQ A;  4DV1 L;  4DR3 Q;  3GTM H;  1Q12 A;  5IYB G;  4LUV A;  2LXK A;  4YHH Q;  1K8G A;  4C3I H;  5E7N A;  2JA7 G;  1B8A A;  4JOI A;  1TWA H;  4HJ8 A;  4JI1 L;  3M9B A;  1YEZ A;  1KAW A;  4FDB A;  1IBL Q;  3M4Q A;  1KRS A;  4A3M G;  2F52 A;  4A3L G;  4DR1 L;  2KHJ A;  4QY7 A;  3GTG H;  3HOZ H;  1EWI A;  1PH8 A;  2YTV A;  1HNW L;  4IO9 A;  1OXS C;  2R6G A;  5AJ3 L;  2WB1 E;  3CME A;  3F1Z A;  1MKH A;  2MO0 A;  2JEB I;  4YWM A;  3J80 i;  3CCS A;  3CF5 A;  3M4P A;  3CW2 C;  3KJO A;  5M3F G;  1SFO H;  1Q82 C;  1EIY B;  4LFC Q;  3HOV H;  4B3R L;  4KI0 A;  1SLJ A;  3KOJ A;  2R7Z G;  1VQJ A;  2JA6 G;  2BA1 A;  2PI2 E;  3KJP A;  2UUC L;  1VQM A;  2R7D A;  3JAM i;  4B3S Q;  3I4M H;  2I5M X;  4MNO A;  4AYB G;  4NB3 A;  3CC2 A;  1XNQ Q;  4HID A;  4A3C H;  5FLM G;  2NN6 G;  1YHA A;  2VY3 A;  2ZTC A;  3U50 C;  4JV5 L;  2JE6 I;  4C3J H;  3HOW G;  4GN4 B;  4H02 A;  5GAE C;  2QGQ A;  1SMX A;  1VQ4 A;  1Q86 C;  4DV2 Q;  4GKK Q;  4BY7 G;  2JQO A;  4DV7 Q;  4L5S A;  5IYC G;  4GNX A;  4R1J A;  3K81 C;  4HIM A;  2DUD A;  4QL5 A;  4HJA A;  2Z0S A;  4LFB L;  1B70 B;  4EQ5 A;  4IJH A;  3PUV A;  4X66 Q;  3NEL A;  1XMO L;  3RZO H;  3J81 j;  3ZJY C;  4A3D G;  1LM0 A;  2ZJP A;  2WFW A;  5C44 G;  1N33 L;  3OW2 A;  1NJI C;  3GTO H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...