1IBMQ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ibmQ00
4EX5A 3CP0A 1PH7A 1E7ZA 1IBKL 2JA8G 3HOWG 4JI3Q 1K0RA 4LF4L 3KDFB 2ZJRA 4GN3B 2IHFA 5M3FH 3RN5A 1E1OA 4DAMA 4OO1I 1WCMH 2Z6KA 3I55A 1U5KA 3CCRA 4C2MH 1UE5A 2A8VA 4LF7Q 4DV5Q 2WFWA 2AHOB 4A76A 4DV4Q 1H95A 4APVA 2R7DA 1O7IA 4DR7Q 1HNXL 4UP7A 3OTOL 4LF6L 1HZ9A 3BJUA 1CKMA 4YHHQ 4HIKA 1XPUA 1GM5A 1YBYA 5IY0A 1L1OC 2RHQB 4IPGA 2QEXA 3S14H 2N78A 1OXXK 4POGA 1SN8A 3TQYA 4C3IH 3I4NH 4TVAB 1Q7YC 3HOUG 4BA2I 5EAYA 3UDIA 3J80i 1YEZA 2CKZB 4BBRG 5M5YH 2XTIA 4GOPC 5BR8Q 4GNXA 1X6OA 4A3DH 4X65L 3CCEA 4GN4B 1FVIA 1IBKQ 1Z47A 2C35B 4BXXH 4LF4Q 1BVSA 1JE5A 3GTKH 3FP9A 5DLQE 2UU9L 1K3RA 3GD7A 4GNXB 3G71A 3PO3H 4WJ4A 4HJAA 1X54A 5M3MH 4A3IH 2VW9A 1B70B 4JCVE 5IYDG 4C3HH 5C3EG 1HNXQ 3OTOQ 4LF6Q 4P72A 4UP8A 3J7ZC 1VQJA 3BZCA 1SFOH 2WAQG 3A74A 4AQYL 2GVBA 1XPOA 4A3EG 1K8AC 2Q2TA 4DR6L 1HNWQ 1MIUA 1IYJB 2L15A 4DR3Q 2PI2A 4NPSA 4DKAC 3HOYG 1EOVA 1Z9FA 2UXDQ 2KCTA 2E8GA 2I5HA 1NMFA 4A3FH 3E9HA 1YZ6A 2Z0SA 3I2ZA 4X65Q 1KC8C 1PH2A 2VS1A 2JEBI 4R4IA 1WI5A 2PQAA 4YWLA 4LFCL 1EQRA 3W1GA 1RIPA 4DR5L 4GN5A 4A3KG 1YJNA 5C0XI 2AWNA 1YNXA 2UU9Q 4GLVB 1I6HH 2A1AA 3CC4A 1JJGA 2PQAB 4IPCA 1TWCH 1AE2A 3H0GG 3PUWA 1VS0A 1A8VA 2HQLA 4KHPL 2JA6G 1VQKA 1GVPA 2JK8A 4BBSH 4A93H 3M3YH 5IP7G 1KRTA 1EIFA 5M5XH 4AQYQ 3ULLA 1R9TH 2K75A 3HKZE 4NXNL 4JI8Q 2IT1A 3NENA 4B3SL 3GTPH 4A3GG 3S1MH 4DR6Q 5GAEC 4LF9L 2Z6KC 2UUCQ 1BBUA 2K52A 3GTJH 2MFIA 3KF6B 1X9NA 4JC0A 4XTCS 1Q86C 2LSSA 4R4CA 4WJ3M 3EIVA 1LYLA 1FJGL 3PGZA 4LFCQ 1VQIA 2YTVA 2YTXA 2DGYA 4DR5Q 3PF5A 5ELNA 1WOCA 3S24A 4BA1I 4A3BG 2VQFL 1W2BA 4YCWA 2CCZA 4LUVA 2OTJA 2AWOA 2A19A 1UEBA 1UE7A 4DV6L 4KHPQ 3M4PA 5C4XG 4YWMA 4GNXC 1UE6A 4A4IA 2IX1A 5IP9H 3T1YL 1XJVA 3CMAA 4BBRH 4B3SQ 4IPDA 5IE8A 4NXNQ 3FHWA 4IFDG 2PMZE 4DV7L 1S72A 2ATWA 2NZHA 1X55A 4A3LH 4YCVA 4LF5L 2VZAA 1A63A 2Q2HA 2MO0A 4DUZL 3UE0A 4IOCA 1N32L 3M9BA 1FGUA 2K5HA 4DV0Q 4PZ7A 3EN2A 4L5QA 1J5EL 3CMEA 4AYBG 5C3EH 2VUMG 3K80C 1HNZL 4DV3Q 1N36L 3G48A 3CCVA 2Y0SG 3J7A5 5JJLA 1PH5A 1VQ5A 1OTCA 3I4OA 3KOJA 4A3EH 1I94L 4DV6Q 1N34L 1SROA 1ASZA 3TRZA 1A62A 2K50A 2JA7G 1OXVA 1QZHA 1N8RC 4GKJL 3T1YQ 3I56A 4GKJQ 1OXTA 2CWPA 3K81C 4A3CG 3U50C 4DR4L 1Y1WG 4OWTB 4PG3A 1GO3E 4YCUA 4LF5Q 4JBMA 4A3KH 3GTQH 1VQHA 1WYDA 3TREA 2NN6G 2Q2UA 1NY4A 2N8NA 1PFSA 4A3JG 1PA6A 3E9IA 1HH2P 2OCEA 4DK6C 4OX9L 2BH2A 4B3MQ 1J5EQ 3KFUA 3L0OA 1V1QA 2ZTCA 1G291 1G51A 4UPAA 1PH4A 1X3GA 1HNZQ 2E2JH 2JA6H 4X62Q 3RLFA 4B3TQ 3RLNA 1YHQA 2B63H 2VL6A 4RG1A 1I94Q 4KLKA 4A3GH 1W3SA 3EBEA 3DM3A 2Q2IA 3S16H 4JI2L 3AEVA 5JJIA 5IYCH 4LFAL 1Q12A 3I7FA 1XNRL 3JC66 1VQBA 4DNIA 1KAWA 1KIXA 3M4OH 2HIVA 3F8TA 4NB3A 5HGQA 3D0FA 2R93G 1Y1VG 2MO1A 4A3BH 1B8AA 3STBC 1QVGA 2N49A 1E3PA 2R6GA 4R1JA 3NBHB 4X66L 4L5SA 4QQBX 1PH1A 2VNUD 2NVYH 4JYAL 4BY7G 2RF4A 1C7YA 1YHBA 3PO2G 2K5VA 2OWOA 4IFDJ 4OX9Q 2HT1A 4JI5L 1VQ6A 5FLMG 2B3GA 2ASBA 3K0XA 3TS2A 1GD7A 5C4XH 5IWAL 1ASYA 2IY5B 1Q82C 1IXRA 4YWKA 3FKIG 1YHAA 2RHSB 1DGSA 3CCQA 3T1HL 3GTOH 2JJQA 1FL0A 2YYZA 2JA5G 1S3OA 3J81i 2AKWB 2KHIA 1V9PA 2WAQE 4JI2Q 3GTGH 4BY1G 2WP8J 1CKNA 3K8AA 4MNOA 4PZ8A 4LFAQ 2R92G 1XNRQ 4FDBA 2LXJA 3E0EA 3PUVA 1J6QA 2ZJQA 2N3SA 3NEMA 2VY3A 4GS3A 3I4MG 1D7QA 3JAMi 4DR1Q 1JT8A 4RMFA 3S2DH 4DR2L 1CKNB 4DUYL 1M1KC 5GADC 5ELOA 3ULPA 2VQEL 3GO5A 2VUMH 3AYHB 2E2HH 4X66Q 2YU9H 1U0LA 1IBLL 1X3EA 3J81c 3WWVA 1SMXA 4P74A 4AIMA 2HHHL 3CCLA 4JYAQ 1JJ2A 3BZKA 4UY8C 1HR0W 2MNAA 1Q81C 2EQSA 1PYBA 4JI1L 1GKHA 3KF6A 5IWAQ 1XTDA 2JA7H 3HOVG 2R7ZG 5AJ3L 3JAMc 3H15A 1IBML 4EQ5A 1S40A 2JA8H 4X64L 3HOWH 4P71A 5JEAG 4A3CH 1WCMG 1MKHA 3KLWA 1Y1WH 4HIOA 1VQ9A 1SRUA 5E7NA 3ULJA 3IRBA 2B29A 1SR3A 3M85A 3S1NH 2D0OA 3RLOA 4O2DA 1HZAA 5LMNL 3TEHB 4HIDA 3RR5A 2PI2E 2K5NA 3U4ZA 1XMQL 3RZOH 2JA9A 3W5OA 4AH6A 4DV1L 3AFPA 4DUYQ 3KJPA 4DR2Q 4IJLA 4NXML 1JB7A 2VQEQ 3UE1A 1NMGA 2NZOA 1VCIA 1EIYB 4JI0Q 1IBLQ 4QY7A 4HJ8A 2HHHQ 3H3VH 3W1BA 3HKSA 4QIWE 1P16A 3HOUH 3F2BA 3G4SA 2I5MX 3PUYA 4JI1Q 1PVOA 1I3QH 4OO1G 4LF9Q 5LMUL 2MQHA 4OXPA 3PO3G 1VQFA 1BKBA 3CCUA 2CQOA 2R93H 1X56A 3F2DA 1NJIC 4R4OA 3ERSX 2E5LL 4IJHA 1P8LA 5LMNQ 1FJGQ 4HJ7A 1Q1EA 3M7NA 5IYDH 2FXQA 4QJFA 4BY7H 5IT9c 2VQFQ 4JV5L 3HOXG 4DV1Q 2PNHA 4JOIA 1VQDA 4NXMQ 1YJ9A 3PSIA 4UP9A 2JQOA 2F4VL 3U58A 5J3BA 1NTGA 4AYBE 3A5UA 1PH8A 3HOYH 4HJ9A 1LTLA 1VQ8A 1AE3A 1N9WA 2Y0SE 2JE6I 2JA5H 4GLAC 4DK3C 2RCNA 1YITA 2ID0A 4DV7Q 2R92H 3SGIA 1EQQA 1N33L 5LMUQ 4JI6L 2CWAA 1PV4A 3ZJYC 4QL5A 1D8LA 1WFQA 3I4MH 4DR7L 1EYGA 1Q46A 1CUKA 4KHZA 5FJ8G 2UUAL 3PUZA 4Y52H 4DUZQ 3F2CA 3PV0A 1K9MC 1UWVA 2E5LQ 1N32Q 3H0GH 2ES2A 4BBSG 4MZ9A 2ZTDA 4QGUA 4JV5Q 5JEAJ 1N36Q 1VQAA 3Q8DA 1X65A 2K14A 2KHJA 3F1ZA 1QUQA 1KHIA 5IP7H 5IYBG 3PIOA 2OQKA 3GTMH 4HIMA 3HOVH 1LM0A 1N34Q 2R7ZH 3B6YA 1WJJA 1E1TA 1SE8A 2F4VQ 2BA0A 1MJCA 3G6EA 4IFDI 1QUQB 1VQNA 2QA4A 4JI4L 4O0AA 4B3RL 4Y7NH 2UXBL 1XPRA 1K73C 5C0XG 1HZCA 1A0IA 1B7YB 1TWGH 1UE1A 3BU2A 3K7UC 1N33Q 2JEAI 2HIXA 4DR4Q 4X6AH 1HZBA 1NE3A 4JI6Q 4DPGA 3RN2A 3A5ZB 4OONA 4LUOA 4LW1A 3CPWA 2UUAQ 2EIFA 2ZM6L 2ZJPA 1KD1C 1HNWL 3CW2C 3KF8B 4LUZA 1VQOA 4DV2L 4DR3L 4GLXA 3TS0A 1PH3A 1IZ6A 2UXDL 4LWCA 2I0QA 1RL2A 4YY3L 5M5WH 5IP9G 3MEFA 4GKKL 4POFA 5JJKA 5HY6A 3CF5A 3MXNB 1K83H 5H1SE 2D0PA 1HR0L 3CD6A 1K8GA 3S17H 4A3LG 1YI2A 4A3MG 1EFWA 1KRSA 3J81j 4R4TA 4JG2A 1JMCA 4JI4Q 2OTLA 1C0AA 4B3RQ 1TWHH 4PMWA 2UXBQ 1JJCB 1VQEA 3J80c 1I50H 2NN6I 1M90C 3PUXA 3HOZG 4JOIC 1XNQL 4IOAA 1QZGA 4JBKA 1OXSC 2H5XA 2ZTEA 4JBWA 3HOXH 4JI8L 2ZM6Q 2IX0A 2UXCL 5GAGC 1KXLA 5C44G 2GVAA 1E24A 1TXYA 3PIPA 3S2HH 4DV2Q 4JI5Q 4JBJA 3DLLA 5GAHC 2UUCL 3H3VI 1KQSA 2OQ0A 3NELA 2NVXH 4YY3Q 3S1QH 4GKKQ 3U4VA 1Y14B 1PYSB 1MJEA 3STBD 4P73A 3UDFA 3GDEA 4J15A 5M3FG 3T1HQ 1LUZA 1HR0Q 2GN5A 2K4KA 4JI0L 3ER0A 3AFQA 2YTYA 4A75A 2V1CC 3PCOB 2NVQH 2CFMA 1YIJA 1PHJA 1VQ7A 1CKOA 3A0JA 5K36G 2NVTH 1AH9A 3HKZG 5FJ8H 1TWAH 2I5LX 4A3JH 5FLXc 2D62A 3ICEA 5GROA 1OXUA 1G6PA 2BA1A 1XNQQ 3KYHC 3OW2A 3AQQA 4IPHA 2YV5A 2B63G 2KCMA 3PF4A 2AMCB 3M4QA 3I4NG 1XMOL 1L1OA 5IYBH 5GQOA 2UXCQ 1VQGA 2BH8A 5C0XJ 4LFBL 3CCJA 1CSPA 2ALYB 3L7ZC 4LF8L 2KENA 1PH6A 3CXCA 5IYCG 1C9OA 1EUJA 2DUDA 2EXDA 3CAMA 3D31A 1L1OB 3OYYA 4A3DG 3UDXA 4C3JH 5AJ3Q 4L5TA 3CCSA 1NBWA 1IBMQ 4BXXG 2F3IA 1L2FA 1Q8KA 3LGJA 4X64Q 4GOPA 4OWWB 4DV0L 1IL2A 2XGTA 1X3FA 5M3MG 4A3IG 4JI7L 3L2PA 4DV3L 3CPFA 1Y1VH 2E2IH 4GOPB 3RNUA 3S15H 4HJ5A 3K7AH 3GTLH 4ALPA 4LNQA 1Q1BA 1HJPA 4KI0A 1XMQQ 3PO2H 4K0KL 4PZ6A 2UUBL 5FLMH 1YVCA 1VQ4A 4P75A 4DR1L 4OWXB 3CC7A 4L5RC 1VQMA 1T9HA 4H02A 2WB1G 4JI3L 1EWIA 3FKIH 1XMOQ 1VQLA 1BBWA 4LFBQ 4TQUS 5LMNW 4A3FG 3VDYA 3CC2A 4LF8Q 1CSQA 1QVFA 1KL9A 4A3MH 5C4JH 3CCMA 3HFZB 4LF7L 4DV5L 4BY1H 4DV4L 2WB1E 1V43A 1I5FA 1L0WA 3UDGA 1TWFH 4B3ML 2LXKA 4YHHL 4XIGS 3RZDH 4R4QA 2F52A 3HOZH 4JI7Q 4ME3A 4X62L 2QGQA 1E22A 3KJOA 4B3TL 3S1RH 4MTNA 2R7FA 1YJWA 3CQZH 2KBNA 4A93G 1VQPA 5C44H 2IHEA 1PH9A 1SLJA 4K0KQ 3KDFA 2UUBQ 1QVCA 1VQCA 4DAYB 5BR8L 4IO9A
chains in the Genus database with same CATH superfamily
3C1EA 4RGMA 2JN4A 1E7ZA 1IBKL 2JA8G 4JI3Q 1K0RA 4LF4L 2PCFB 2ZJRA 2IHFA 1AFPA 1E1OA 1I3QB 2D5DA 4L6TB 5KIXA 3CCRA 1UE5A 4DV5Q 3E0JA 1H95A 4DV4Q 4RH6A 4APVA 3DWAA 1Y1VB 4DR7Q 1HNXL 4UP7A 3OTOL 1E2VA 3NQIA 2Z8LA 2QKIC 2RBMA 5IY0A 4ZQ3A 4IPGA 3SEBA 1KAAA 1PTOF 3S14H 1OXXK 4MIUA 4C3IH 2D2CC 3A8IE 3J80i 1YEZA 2XTIA 4X3TA 5BR8Q 5KNBA 4X65L 1FVIA 1Z47A 4BXXH 2M2LA 3LWEA 1BVSA 4UDUC 1EOTA 1D6EC 1K3RA 5CV6A 4HMIA 4A3IH 4QMGA 2VW9A 3FPUB 5IYDG 4C3HH 1ZYRC 5DM63 4LF6Q 3A8JE 1O7ZA 4P72A 3J7ZC 1VQJA 3BZCA 1G2TA 4AQYL 2GVBA 1SXTA 1K3BC 4F87A 4DR3Q 2PI2A 5A35A 4U68A 1YZ6A 1PH2A 2PQAA 1EQRA 4Y7NB 1RIPA 2K5QA 4DR5L 1YJNA 5C0XI 3J80E 4KHVA 4GLVB 3J81L 3H3VC 1X3QA 2PQAB 2QF7A 4XT3B 1A8VA 4HN7A 1FYCA 1PRTC 2JA6G 3NWSA 2FMMA 4B3SL 3NENA 3Q23A 1LTGD 5GAEC 5M5YB 1DONA 2Z6KC 4I7ZC 2K52A 4RAUC 1X9NA 1L0YB 3S17B 4JC0A 2LSSA 3NHHA 3PO3B 1RF2D 4WJ3M 1FJGL 5DEHA 4LFCQ 2JSOA 4CKBA 1W2BA 2KHSA 4ZYSA 5CV9A 1BXTA 5C5MA 1UE7A 2Y0SB 3A7AB 4GNXC 3S2HB 1UE6A 4XDXA 1IW7D 1XJVA 3QG1A 4BBRH 4IPDA 5IGEA 3LX0A 4G4KA 1AZPA 3T4AC 2NZHA 2XVSA 2VZAA 4IOCA 1N32L 2P5ZX 3MA2B 2O5IC 1J5EL 2NVTB 3PQIA 3CMEA 1GHKA 4AYBG 1CQFA 3SVMA 1N36L 1T5XD 1WVLA 2Y0SG 3J7A5 3N6RA 1VQ5A 3TSSA 1OTCA 3I4OA 1I94L 4A3EH 4DV6Q 1N34L 1SROA 3TRZA 1A62A 4G7ZC 1CT1D 4RWSC 1N8RC 1HHVA 3T1YQ 4HCEA 2K5DA 4LF5Q 2B2VA 2Q2UA 4A3JG 3E9IA 3S15B 4B3MQ 1B50A 1KNAA 1SBBB 3A54A 4LAAA 4PQXA 2GA4B 4B3TQ 1YHQA 2TMPA 4EQPA 4J6HA 1HQMC 3FDTA 3DM3A 3S16H 3FKIB 4JI2L 2DJGC 1XNRL 2Z1CA 3M4OH 2R93G 3WOEA 3NBIA 1UNSA 4A3BH 2X6GA 2VNUD 1PH1A 2NVYH 4JYAL 1YHBA 3PO2G 4IFDJ 4U673 1SMYC 3S1RB 3BDOA 5FLMG 2B3GA 4R8NA 2ASBA 3OWFA 5C4XH 5C44B 1ASYA 2IY5B 4YWKA 3FKIG 4XXEA 1IHZA 4IFDH 4K2KA 2YYZA 2JA5G 2AKWB 4DXFA 3BYTB 2R92G 4MNOA 3KBGA 3RUZA 3PUVA 3NEMA 2EJGC 2B2WA 4RMFA 3VA7A 5GADC 1EZ6A 3OW7A 2VUMH 2NTTA 1MSHA 2E2HH 4CJ2C 1IBLL 2HHHL 2O2LD 3BZKA 3S14B 1HR0W 2MNAA 1PYBA 2F0PA 4HEDA 1JOKA 1GKHA 3KF6A 4JI1L 5IWAQ 2JA7H 1HTLD 4RGOS 4A3CH 2RDGA 3KLWA 4FF1A 1KABA 1Y1WH 3ULJA 3M85A 3S1NH 2D0OA 2NN6H 1B3AA 3TEHB 4HIDA 4A3IB 1QCBD 2L5TA 4AH6A 1D5MC 4C3HB 4DUYQ 4NXML 4IQZA 2PMZB 1NR2A 4C3IG 4HJ8A 3IFDA 3DMUA 3GTOB 3BS1A 2EYPA 4L63B 2LY7A 3F2DA 4CJ1B 4R4OA 3SK8A 2IL8A 1F9PA 5KNCA 4C3HG 3LWUA 1DJRD 5LMNQ 4OHJA 3M7NA 1Q1EA 2F0GA 4IUPA 4N9PA 4DV1Q 1WTPA 4XQJA 3IKJA 2WKCA 3PSIA 1EL0A 4ID6A 2ZT9C 1NTGA 3QJYA 3A5UA 3HOYH 1EY7A 2A74C 1CA6A 2ID0A 2NTSA 5LMUQ 2CWAA 2NUCA 3ZJYC 4QL5A 1WFQA 3I4MH 4DR7L 1EYGA 1CUKA 1V8QA 1MSGA 3F2CA 1DOKA 1NNXA 3H0GH 2EJMA 4JV5Q 4KN7C 1LLRD 2ENBA 3F1ZA 3OMCA 3HOUB 1PZID 1LM0A 2A73B 2R7ZH 1E1TA 1PFNA 1SE8A 3VR6A 4BBRB 1S5FD 1VQNA 4C3JG 1SYCA 1F2MA 3G7LA 3I70A 1XPRA 4IALA 4X6AH 3FMCA 1SDFA 5EPJA 1SAPA 3KF8A 2WACA 4DPGA 3RN2A 4IUVA 1A3UA 1WTRA 1H9KA 3CW2C 3KF8B 2A6HC 4DR3L 1IZ6A 2WAQB 4A3EB 1TQOA 4YY3L 5CR3A 1QJOA 4DF7A 3I3CA 1H9RA 1HFNA 5HY6A 3CF5A 4RGNA 2D0PA 1HR0L 3CD6A 1YNJC 4A3MG 3DUZA 5D14A 1KRSA 1JB3A 2KECA 4R4TA 4JG2A 4JI4Q 4B3RQ 1JJCB 2TSSA 2EY2A 1M8AA 3W3AA 4JOIC 1XYIA 5F2DA 1XNQL 1QZGA 3DWPA 4OEMB 2B2TC 1JQYD 3HOXH 4C1NK 4H13C 3VYUA 1KXLA 1E24A 1TXYA 3DLLA 1JWSD 1PFBA 4ZRZA 1KQSA 3S1QH 1JWMD 3U4VA 5JVG3 3QR8A 4BS9A 1PYSB 3S16B 1NAPA 3STBD 4P73A 5C6AA 1LUZA 2K4KA 2KA7A 3TDQA 1X32A 2CFMA 1YIJA 4M8AA 1AH9A 5FJ8H 4A3BB 4RA8A 1IYUA 2F0QA 1DZ1A 1HFGA 5E1FA 1G6PA 1BCPF 2NVYB 2EYMA 2M9VA 4V190 3A7LA 2DY8A 1PFMA 3AQQA 4R9WA 2YV5A 4JVZA 3I4NG 3BDCA 4QCLA 2Q8RE 5IYBH 5C4XB 5C0XJ 3L7ZC 4LF8L 2DUDA 2EXDA 3VR3A 3CAMA 1CM9A 3D31A 5AJ3Q 4L5TA 3CCSA 1NBWA 1CHQD 1Q8KA 3LGJA 4X64Q 4GOPA 5C0XH 1CQVA 2K1BA 1X3FA 1EY5A 5M3MG 4JI7L 3CPFA 1Y1VH 2E2IH 4GOPB 1DOLA 4LNQA 1F9QA 4RCOA 2VUMB 2E2HB 4TRDA 4PZ6A 1VQ4A 4DR1L 3CC7A 2A68D 4H02A 3T56B 2WB1G 4XQQA 2OEOA 4WFN3 1JR0D 2JA7B 5L37A 4TQUS 5LMNW 4A3FG 3WOFA 1KL9A 4ZCKA 5LHY1 2NWGA 1NCVA 4LF7L 2WB1E 1HQRD 1Y1WB 2IPKD 1I5FA 1L0WA 3Q6SA 4B3ML 4TSSA 4XIGS 1CHPD 3HOZH 3EROA 1E22A 4LMQD 4B3TL 3HGBA 1GUTA 1A3TA 2QEJC 1MD2D 2B2YA 2DY7A 1S5DD 2KCNA 2IHEA 1WTWA 2F0KA 4K0KQ 1B3QA 3MFGA 4EX5A 1STGA 1PH7A 1JC7A 1PZJD 3SHLA 2SNMA 5IGCA 1K0SA 4JW0A 4GN3B 4OIJA 5M3FH 5EPKA 2EYLA 3RN5A 1WTVA 4DAMA 5D65A 1U5KA 3PIP3 2WFWA 2AHOB 3Q24A 1O7IA 2A69C 1HZ9A 2EYFA 1CKMA 1XPUA 1GM5A 3KLSA 1EFID 1CZGA 3MC0B 1LTBD 1STNA 4BA2I 5DM73 4TVAB 1QNUA 4IZ8A 1Q7YC 1STEA 2LS01 2B8GA 5CBAE 4Z9CB 5M5YH 3R3OA 4A3DH 1O80A 1SNDA 2C35B 2F0VA 4OO1H 1IYVA 2BDNA 3PO3H 2O4XA 3G71A 3VYTA 3I4MB 1J9OA 1BUVT 2R3ZA 4JCVE 2E76C 4KMUC 5C3EG 1LABA 3CQZB 5DNFA 5FO8B 1SFOH 4Q5VA 2RSOA 1MIUA 1HNWQ 3EFXD 3V96A 4QUFA 1D2BA 3HOYG 5BN3A 1EOVA 1Z9FA 2L12A 3SK5A 2R7ZB 2KCTA 2E8GA 1SJED 1AW7A 1GUWA 4F88A 2Z0SA 5EBCA 2VS1A 2JEBI 3W1GA 4C2MB 2EJFC 2F0SA 4A3KG 5D3DA 2UU9Q 2PW5A 2F0FA 3MTSA 1I6HH 2A1AA 3CC4A 1BR9A 3H0GG 2F3WA 3HRZC 4QIWB 1E2ZA 2EOTA 1GVPA 2JK8A 2F03A 4A93H 1TR5A 3M3YH 1EIFA 3HKZE 4JI8Q 4DR6Q 2IT1A 1MI2A 4R8IA 3GTJH 1ZYRD 2B2UA 2EXZA 1Q86C 3X3NA 4R4CA 1YNNC 1WTXA 1VQIA 2YTVA 2YTXA 5ELNA 5C4HA 1RTNA 2ICEC 1TKWB 4YCWA 3TP6A 4LUVA 1BNZA 2CCZA 4CKCA 2OTJA 1XX8A 3BVZA 5ELDA 3QOLA 1UEBA 3HOXB 1QG7A 4KHPQ 1STYA 4RHSA 3A56A 2F0JA 3T51B 4A4IA 1JICA 2QDBA 4QUCA 4NXNQ 5IE8A 3S1QB 4H44C 1ICWA 4DA2A 3S9WA 4YCVA 1PRTD 4CDFC 3UI2A 1B4OA 3UE0A 3H6MA 3M9BA 3WDNA 4L5QA 2BE5D 5J1ZA 4K5VA 4OL7A 3TBIB 5JJLA 5NUCA 2KQ3A 2PPBC 5FO9B 2HCCA 2SDFA 2K50A 1OXVA 1QZHA 2E74C 3NTHA 4GKJQ 4HSPA 2HQEA 2CWPA 1K8MA 1GO3E 1EY4A 1ENCA 4JBMA 1ILPA 1RD9D 3TREA 4PNYA 2VXWA 5K36H 1ZXTA 2E2IB 4DK6C 2VB2X 3L0OA 1V1QA 2ZTCA 1G51A 3K5MA 1PH4A 2E2JH 1HNZQ 2ZXOA 4X62Q 1SE4A 3D4RA 3P75A 3RLNA 1STBA 4JPBW 1H9SA 4A3GH 3EBEA 1BCPC 1H9SB 3I7FA 1KIXA 2HIVA 3F8TA 3ONAB 4NB3A 5HGQA 1BQQT 1GJXA 4PMBA 4OIKA 1Y1VG 3OIPA 1I4PA 5COYA 4KY7A 1QB5D 4YIJA 4RHRA 3HOZB 1C7YA 2K5VA 4OX9Q 1VQ6A 1Q82C 3CCQA 3GTOH 1B1ZA 2SOBA 3RMHA 1KTKA 2V4DA 5M3FB 2WP8J 1C4QA 4LFAQ 2RCFA 4KD4A 2LXJA 3E0EA 1VF7A 2FMCA 3JAMi 3T16A 3S2DH 4DR2L 1M1KC 3OOCA 3GO5A 1A6XA 1GXDC 5IGDA 4X66Q 1B44D 1U0LA 4JI0L 1TY2A 3CCLA 4FF3A 1JJ2A 2NZ1D 2Q8IB 4IURA 2B63B 2EQSA 3I4LA 4I7AA 2L11A 5AJ3L 2MUYA 3JAMc 4EQ5A 2K01A 5A2QE 1S40A 4X64L 1RODA 3NSWA 3HOWH 2B2VC 4A3DB 3M4YA 4DNTB 1SMYD 5E7NA 3IRBA 1SR3A 3RLOA 1HZAA 2R61A 3RR5A 2PI2E 2EYHA 2JA9A 1G2SA 4IJLA 2VQEQ 1FGBD 1NMGA 5M9OA 5C3WA 1VCIA 1SFOB 3D4WA 3PMFA 3JAME 3HOUH 1ZKOA 1PVOA 4OO1G 3F2UA 1LTTD 3PO3G 1VQFA 1BKBA 2QCPX 3PIO3 1NJIC 1SJHD 1EY8A 4FP5D 2LFNA 2AQ1B 4IJHA 3SDZA 1I6HB 4BY7H 5IT9c 1PDQA 2PNHA 4I65A 3HG9A 1Y69U 5G3LF 1YJ9A 4A93B 3M3YB 2F4VL 3U58A 1DM0B 5J3BA 4LJZC 4AYBE 4HJ9A 1VQ8A 1N9WA 2Y0SE 2JE6I 4DK3C 4KJNA 4WORA 3GTJB 2B2WC 2LKVA 4DV7Q 2F3VA 3SGIA 2PNRC 1N33L 5I4DA 1CFMA 3R93A 1Q46A 2CW0D 1SE2A 5KYIA 1PTOH 1DXMA 2RVLA 2E5LQ 3EVQA 2ES2A 5JEAJ 1VQAA 1PTOD 2K14A 3PIOA 5IP7H 1LT5D 3GTMH 3HOVH 1PRTB 1MJCA 3G6EA 2L0CA 4ZAIA 1IKMA 5ELBA 2PZUA 4XT1B 1K73C 3BU2A 1HZCA 1B7YB 4CDEC 1S5ED 1HZBA 1RTOA 4JI6Q 4OONA 3AB9A 4LW1A 1G8ZD 3MZ5A 3CPWA 2UUAQ 2EIFA 3BDLA 2ZJPA 2FJ2A 1HNWL 1U4PA 4LUZA 2RDHA 1VQOA 4GLXA 1PH3A 1SNCA 4KY6A 4LWCA 2I0QA 1RL2A 5M5WH 4GKKL 3D6CA 1AP0A 3SXHA 5I9PA 4EVOA 3DHQA 1MHWC 1QE6A 1EFWA 1S5BD 1I4GA 3TP5A 2UXBQ 1TWHH 4PMWA 1VQEA 3MWYW 1M90C 2IJ0A 4IOAA 2I07B 4X3SA 4JBKA 4M1UB 1TS5A 4JI8L 2EYJA 3TN2A 2ZM6Q 2UXCL 2E2JB 2IW3A 3OWEB 5C44G 2J7ZA 5I6YA 4DV2Q 4JI5Q 5IOCA 3VYSA 5TSSA 3H3VI 1WTHA 2OF1A 3I8ZA 4A3GB 3BG3A 1EIHA 2L55A 3UDFA 1U4LA 1D1IA 1K28A 3MXUA 3AFQA 3H09A 5EQ0A 4A75A 2A6HD 3PCOB 2AQ3B 1PHJA 1UUPA 3EJIA 3A0JA 5K36G 4KK7A 2I5LX 2BCOA 4K14A 5FOBB 3R8BA 4E6IA 2EPBA 3OW2A 1V1PA 4IPHA 1YNJD 3G6JB 3M4QA 1L1OA 4HSVA 5E4WC 1ESRA 2KUMA 2JYOA 2QW7A 4OELB 1V1PB 1I4XA 3CXCA 3X3MA 3K5NA 3I73A 2JP1A 3OYYA 1L1OB 2PZTA 3GP7A 3K58A 4BXXG 1IBMQ 4DAPA 2JXMB 4LK1C 1KLUD 1TT2A 3NQTA 1M4VA 4A3IG 3DEOA 4HJ5A 3S2DB 3LNNA 3GTLH 3VA5A 1ONLA 4KI0A 1XMQQ 2KOLA 2UUBL 1FNUA 1EIGA 4OWXB 1JOQA 1T9HA 3MXPA 4JI3L 1XMOQ 2DNEA 1VQLA 3TP8A 4LFBQ 3VDYA 1CSQA 1QVFA 3HOWB 3CCMA 1GUSA 4DV5L 1EQTA 4DV4L 3ND9A 1V43A 2G9HD 3UDGA 1SE3A 2LXKA 4IUQA 4ME3A 2H4OA 4X62L 2QGQA 3D4DA 2J0TD 3KJOA 3P1HA 2QILA 2R7FA 4NP5A 3CQZH 4DAYA 2MHVA 1YJWA 1PMRA 2FHTA 1SLJA 2F0MA 2EY5A 3KDFA 1QVCA 4ULLA 1Y8OB 1VQCA 4DAYB 1ESFA 5BR8L 4IO9A 1BO0A 3HOWG 2CHBD 3CRLC 3KDFB 2KJXA 1XTCD 1WCMH 3I55A 4C2MH 2A8VA 4N8FA 3OPOA 3TZUA 4A76A 2F0DA 4FXDA 1EYAA 4LF6L 2LMCB 4YHHQ 4HIKA 1JWUD 1YBYA 4CDCC 2RHQB 3W2DA 4BY7B 2QEXA 2N78A 2Z6BA 1SN8A 3HOUG 1MGSA 1C48A 3UDIA 4BBRG 4GOPC 2WIIB 4GN4B 3CCEA 1IBKQ 3URYA 4LF4Q 1JE5A 3GTKH 3FP9A 5DLQE 4BY1B 4P2CB 1D5ZC 1W6KA 3GD7A 4FNFA 4HJAA 1B70B 2FFKB 1PTOB 3Q22A 1HNXQ 3OTOQ 5KYLA 1SYGA 2Q2TA 2WAQG 3A74A 1XPOA 4A3EG 3R2TA 2A6EC 2Z4HA 4DFAA 5A2QL 1H9JA 5EKLA 3GTMB 5CGKA 3HOVB 1U9RA 2A69D 1NMFA 4WRDA 3E9HA 4IUUA 3I2ZA 4X65Q 4R4IA 3OIQA 1WI5A 4LFCL 2AWNA 1YNXA 3NWTA 1JJGA 2B2YC 1TWCH 1VS0A 3J7AF 3JAML 5FO7B 5IP7G 1KRTA 5M5XH 5K5PA 5JVH3 5IGBA 4AQYQ 2K75A 3QWNA 5M5WB 5CV7A 1VF5C 1V1OA 2UUCQ 1BBUA 2MFIA 3K0YA 1ZEQX 1LYLA 2RKSA 3PGZA 1TWHB 4DR5Q 4A3BG 3PF5A 4BA1I 4RGTA 4N8X1 1VMPA 2AWOA 1A3VA 4DV6L 3M4PA 4Q0FA 5C4XG 2H1EA 1NUCA 2IX1A 3T1YL 4B3SQ 4IFDG 4DV7L 1S72A 2EVBA 1X55A 3U9SA 1LT4D 3SK6A 4LF5L 1A63A 4NKLA 5IT9L 3MXGA 3NTKA 4KKSA 1SYBA 2K05A 4DV0Q 4PZ7A 3EN2A 1EU3A 2VUMG 4DV3Q 3G48A 1PH5A 3DM1A 5CC4A 5ELCA 2X69A 3KOJA 1IKLA 4DK0A 1ASZA 1R9TB 2WINB 3VR4A 2JA7G 3S1MB 4K6DA 5CV4A 1PZKD 4B9WA 1OXTA 4A3CG 1GUGA 1RDPD 1IL8A 1Y1WG 5E4XA 4OWTB 4PG3A 4YCUA 3GTQH 1WYDA 2I46A 2NN6G 1PFSA 4FXGC 1SNMA 2BH2A 1J5EQ 3GTLB 3KFUA 2JA6H 4UPAA 1X3GA 3RLFA 2B63H 2KVMA 2VL6A 4RG1A 5BN4A 1I94Q 2B8FA 1W3SA 2B2UC 5ELEA 2NB0A 3QIAA 5JJIA 5IYCH 2MPMA 1STAA 1Q12A 3JC66 4DNIA 1KAWA 3NBHA 3HP3A 3D0FA 4MTKA 2MO1A 1U4MA 3STBC 2N49A 1E3PA 2R6GA 4QQBX 3NBHB 4RFBA 4L5SA 3T13A 1O7LA 2RF4A 4UAIA 3CKIB 4JI5L 2F0HA 3K0XA 3TS2A 1GD7A 5IWAL 4QB4A 1IXRA 2RHSB 2JJQA 2C5CA 4F8MA 1FL0A 2KHIA 4JI2Q 1V9PA 3GTGH 3AU7A 3K8AA 3BYYB 4PZ8A 1STHA 1XNRQ 1WCMB 4FDBA 4G57A 2ZJQA 3I4MG 2N3SA 5KRUA 2VY3A 3E5SA 5EJWA 4DUYL 3HKZB 5ELOA 3ULPA 4FF2A 3AYHB 2L4NA 2YU9H 4JYAQ 5D3IB 1SMXA 4P74A 1BCPD 3WWVA 4AIMA 1ILQA 4UY8C 3E3XA 2N88A 5IGFA 1Q81C 5KGUA 2QDLA 3CU7A 2R7ZG 1IBML 1B9MA 5EKIA 4ABNA 1WD0A 4P71A 5CMDA 1EWHA 1TIID 1WCMG 2ICIA 1KLGD 2A68C 1VQ9A 1SRUA 3GTKB 1G6ZA 5JJZA 4O2DA 5LMNL 1T5EA 3U4ZA 1LTID 1XMQL 3C3LA 3W5OA 4DV1L 2RA4A 4B9XA 3KJPA 1JB7A 4EQOA 3K5OA 3UE1A 4C1NI 4G7HC 2NZOA 3DWQA 4KN4C 1IBLQ 4QY7A 5JOBA 5KEEA 2HHHQ 3H3VH 2DJFC 4QIWE 1P16A 3G4SA 2I5MX 3PUYA 4JI1Q 5BN5A 4LF9Q 2KEEA 5LMUL 2MQHA 4OXPA 4DK1A 1BOSA 1Z6HA 2CQOA 2R93H 3ERSX 1NSNS 2HDMA 1P8LA 4HJ7A 1SYEA 3OSOA 2FXQA 4QJFA 1TWCB 4ZLTF 1Z7TA 2VQFQ 4JV5L 3HOXG 4NXMQ 3KBXA 1DOMA 5E3FA 4UP9A 2JQOA 5M5XB 3A8KE 1AE3A 3C46A 1NR4A 4KJOA 2JA5H 1GHJA 2SNSA 1HA6A 2AUJD 2R92H 1EQQA 1F2YA 3NXWA 2Z4IA 4EGVA 5IODA 1D8LA 4KHZA 1X3PA 4DU9A 5FJ8G 3PUZA 4Y52H 2C9OA 4DUZQ 1UWVA 3NE5B 4X3UA 3MVVA 2ZTDA 1CZWA 3I90A 3DEPA 3Q8DA 1X65A 5IYBG 4XYOA 1QUQA 1KHIA 3EA6A 5LL6X 3B6YA 1WJJA 2BA0A 1QUQB 3ITPA 2QA4A 4JI4L 4B3RL 2RDFA 1HUNA 5C0XG 1A0IA 2XNAC 4H0LC 2JEAI 4DR4Q 1F9RA 1EEID 1NE3A 1TY0A 3A5ZB 4LUOA 3NK9A 1JOOA 4HR7B 1FNWA 3J7YW 3MXNA 3TS0A 4CDDC 4FF4A 1CI3M 1EYDA 3MXNB 1K83H 1K8GA 4KV6A 2KCCA 1CK1A 3J81j 2OTLA 2SEBD 1TS3A 4L8JA 3GTQB 1EQVA 1FD7D 1LV9A 1I50H 1SYDA 2F0IA 3J80c 3HOZG 2OT2A 5CYUA 5C5LA 3HS0C 3ZYYX 2F4IA 1GOZA 5C3XA 4B08A 2JA6B 4XYQA 2GVAA 1BDOA 5GAHC 2UUCL 3D8GA 2NVXH 2XIWA 4YY3Q 1MJEA 1HXYD 4NMZA 5M3FG 1GUNA 4FVMA 3U9OA 3T1HQ 1HR0Q 3GQBA 3ER0A 2YTYA 4PV1C 2V1CC 2NVQH 1TWGB 1VQ7A 1CKOA 2K28A 5EPLA 3D3RA 3R2IA 5I2YA 1TVXA 1HPCA 2D62A 5GROA 1OXUA 1XNQQ 3KYHC 2XWBB 1ICFB 2B63G 2MGSA 3PF4A 5GQOA 2BE5C 1VQGA 2BH8A 5FK9C 3P7JA 5IYCG 1C9OA 4A3DG 5IGGA 3UDXA 3Q0AA 4C3JH 3A55A 3FRPB 2A5HA 2F3IA 3GTGB 3BVMA 3K59A 4OWWB 4DV0L 1IL2A 2XGTA 4BWGB 1A2UA 1JCKB 3L2PA 4DV3L 3RNUA 1BCPB 2B39A 3V2TA 2HUGA 5KNDA 1Q1BA 1ET9A 4CGYB 4AYBB 1KDCA 2YU9B 3C1FA 4K0KL 5I2XA 4GZYC 4P75A 2PO4A 1Y8PB 1EWIA 1BBWA 4F7XA 3CC2A 4LF8Q 3IFTA 4A3MH 5C4JH 3HFZB 4BY1H 1FR3A 2XWJB 1UAPA 2O5JC 3RZDH 4R4QA 4HAEA 1TWAB 2F52A 4A3JB 4JI7Q 1TU2B 5IT9E 3MFYA 1D5XC 4MTNA 3BVGA 3HEJA 3IAYA 2K33A 4A93G 1VQPA 1L0XB 4DXGA 1F2ZA 2F0TA 4DR1Q 3CP0A 3L9AX 4RKLA 4IUTA 1LT3D 2E75C 1B2TA 2K03A 3NPPA 5JEAH 4OO1I 2Z6KA 3T53B 4K8IA 4LF7Q 3KLSX 1KNEA 2R93B 2R7DA 2K04A 3BJUA 3K7AB 1Q8IA 5CBEE 3MAQA 1L1OC 1F9SA 1AZQA 3PO2B 4POGA 4JK1C 1LO5D 3TQYA 3I4NH 5EAYA 2CKZB 3D6WA 2BDOA 4GNXA 1X6OA 2JA5B 2NBFA 2EE1A 1Q3LA 5T1GA 2UU9L 2R92B 4GNXB 1RCVD 1RJTA 4WJ4A 1X54A 1TWFB 3FVQA 5M3MH 2EY1A 5DAUA 4RKBA 3FEWX 4UP8A 1K8AC 4DR6L 4H7BA 1IYJB 2L15A 4NPSA 4DKAC 3SE0A 3C2PA 1SSOA 2K32A 3MHBA 2UXDQ 3GV6A 2I5HA 4A3FH 1KDBA 2DN8A 3NP8A 1KC8C 2OXPA 4YWLA 2L1BA 2CVRA 2AUKA 4ZK9B 4GN5A 1IW7C 1U4RA 4J8QA 1TS2A 3E6ZX 2IWHA 4IPCA 1AE2A 3PUWA 2HQLA 4KHPL 1VQKA 1SYFA 3DXJC 5I9OA 4BBSH 1FNVA 3OMGA 5AFWA 2HDLA 2IX3A 4C3IB 3ULLA 3I72A 1R9TH 3GTPH 4NXNL 1I6VC 4A3GG 3S1MH 2AQ2B 1E0BA 4LF9L 1K83B 1QILA 3KF6B 1KDAA 2XRSD 1JORA 4XTCS 5FLXL 4DGZA 5J22A 2EDGA 3EIVA 3QO2A 2DGYA 2A6ED 1WOCA 3S24A 1LTSD 1I4HA 1RHPA 2VQFL 4NDXA 1I50B 2CH4A 1BBXC 1S4ZA 2A19A 2VB3X 2HD3A 2CW0C 5G3LD 4YWMA 3H94A 1CA5A 1BF4A 2XN9C 3VR2A 5IP9H 4GKJL 3CMAA 2NVXB 1LACA 3FHWA 1PYWD 2PMZE 2ATWA 2F1MA 3VR5A 1DD2A 1PTOC 4A3LH 2WV6D 1EWCA 2Q2HA 2MO0A 4DUZL 2NVQB 1FGUA 2K5HA 3SK4A 5C3EH 3V05A 1EY0A 3K80C 1HNZL 3CCVA 1VMCA 2E2DC 2MP1A 5CV5A 2F0WA 5ELFA 1J8IA 3H91A 3I56A 5EGTA 4K8JA 3K81C 1S5CD 3RD4A 3U50C 4C3JB 4DR4L 2HCIA 1H9MA 2G5DA 4A3KH 1VQHA 4QF4A 1NY4A 1R4PB 2N8NA 1PA6A 1HH2P 2OCEA 4OX9L 3K57A 2ZXRA 1O78A 1G291 1EEFD 4CHTB 4K2LA 2EYOA 3I91A 4ZKBB 1SNOA 5EKKA 1ENAA 1A2TA 5FKAC 2J4XA 4KLKA 4O42A 2Q2IA 4DAVA 3AEVA 2RSNA 4LFAL 3J7AV 1AN8A 4ILWA 1VQBA 4A3MB 5C4JB 4FXKC 3OHXC 2F0UA 4ZKCB 1B8AA 4O1NA 5CV8A 4R1JA 1QVGA 4X66L 3RZDB 4BY7G 3TP7A 2OWOA 4S3SA 2HT1A 3QB3A 1YHAA 1DGSA 3T1HL 5T1IA 1WD1A 1S3OA 5CORA 3J81i 2WAQE 4BY1G 3J80L 1CKNA 1XXGA 1A15A 4TKOB 1J6QA 1D7QA 4GS3A 1JT8A 1QOHA 1CKNB 2NYZD 4HMJA 4IUNA 3BZDB 2VQEL 2MJ8A 4ZUIA 1X3EA 3J81c 2K6AA 1WTQA 3M7GA 2PZWA 2XRQD 1ET6A 4K6LA 1K8OA 3I4NB 3HOVG 3QOJA 1XTDA 1SEBD 2RQXA 3H15A 4EQNA 2X6LA 4KKTA 2JA8H 1HCZA 4FO2A 1II3A 5JEAG 1MKHA 3O13A 1DCZA 1LT6D 4HIOA 3M4OB 2N55A 2B29A 4G7OC 2D9UA 2K5NA 5HURA 3RZOH 5M3MB 1G91A 1HTPA 3J81E 3AFPA 4NW2A 4HCSA 4DR2Q 1O7YA 1EIYB 4CBVA 4PMCA 4JI0Q 5JAVA 3W1BA 2EZVA 3HKSA 1EY6A 3CRKC 4MHEA 5JPMC 3F2BA 4C56C 1HUMA 2WB1B 1B9NA 5LL6S 1I3QH 4A3FB 4KKUA 4ODGA 4UHVA 1JE4A 3CCUA 1X56A 2E5LL 2F0OA 1FJGQ 5IYDH 1QWYA 3CHBD 4JOIA 1VQDA 5I6WA 4BBSB 4OGQC 1E2WA 2B2TA 1I4QA 3GTPB 1PH8A 1YNND 1LTLA 4DN4M 4KY5A 4GLAC 2RCNA 5J39A 3P20A 1PRTF 1YITA 3ERQA 1D1KA 2BOSA 4JI6L 1VDZA 1PV4A 1EZ8A 3IL8A 3S1NB 2UUAL 3PV0A 3TZDA 1K9MC 1N32Q 2CH4W 4KD3A 4BBSG 1R4QB 4MZ9A 4QGUA 3ND8A 3KLRA 1N36Q 5C4ZA 2KHJA 1EY9A 2OQKA 4HIMA 4J1MA 5EBDA 1XWEA 3NTIA 1N34Q 2F4VQ 1RKNA 4DNRB 4IFDI 1MBYA 4O0AA 2UXBL 4Y7NH 2K5WA 3K6OA 1TWGH 1UE1A 2F0EA 3K7UC 2F0NA 1N33Q 2HIXA 3EQLC 2ZXPA 3NUCA 5IIFA 5C3EB 2ZM6L 1KD1C 1DYQA 4DV2L 2WKDA 4FYDA 1F77A 2UXDL 1PXUA 5IP9G 3MEFA 4POFA 5JJKA 4N9TA 3HOYB 5H1SE 3VYRA 3HZXA 3S17H 4A3LG 1YI2A 1GUOA 1C8CA 1JMCA 1C0AA 2PQEA 4A3KB 4MN3A 2NN6I 3PUXA 1Q90A 4RCNA 1UEAB 1ENFA 3L3OC 2DNCA 3N52A 4K5WA 1OXSC 2H5XA 3H0GB 2ZTEA 4JBWA 2IX0A 1WTOA 2CQAA 5GAGC 1LTAD 3PIPA 5ISRA 3S2HH 4K5XA 4JBJA 3SR1A 2OQ0A 3NELA 4KTAA 1ML0D 2L9HA 4GKKQ 1Y14B 3GDEA 4J15A 3FPPA 1Y8NB 2GN5A 3MEHA 5JPNC 1EU4A 2M00A 3TMEA 2FINB 4HTHA 3GV3A 2NVTH 3HKZG 1TWAH 4A3JH 5FLXc 3ICEA 2BA1A 2PW7A 5HGTA 1EYCA 1SNPA 1CTMA 2KCMA 2AMCB 1XMOL 2UXCQ 4LFBL 1SNQA 3CCJA 1CSPA 2ALYB 2K7VA 2KENA 1W6JA 1PH6A 1HA5A 1EUJA 4X3KA 3K5LA 1L2FA 4IN3A 1TS4A 5FLXE 1HRJA 3S15H 4ME5A 3K7AH 2Q8TA 4ALPA 1HJPA 3PO2H 2F0LA 1OO9B 5FLMH 1YVCA 4L5RC 1VQMA 3FKIH 2Z9HA 2G9DA 3KUPA 4V0BA 2KEDA 2JA8B 2PYKA 1I4RA 1AEXA 1LTRD 1TWFH 4XQNA 4WJWA 4YHHL 3AMUA 3RZOB 1B53A 1PLFA 2XSCA 4CJ0B 3S1RH 2KBNA 2EY6A 5C44H 4ZUJA 1PH9A 1F2LA 3KK7A 1QNKA 4CKEA 2UUBQ
chains in the Genus database with same CATH topology
4EX5A 3CP0A 1PH7A 1E7ZA 1IBKL 2JA8G 3HOWG 4JI3Q 1K0RA 4LF4L 3KDFB 2ZJRA 4GN3B 2IHFA 5M3FH 3RN5A 1E1OA 4DAMA 4OO1I 1WCMH 2Z6KA 3I55A 1U5KA 3CCRA 4C2MH 1UE5A 2A8VA 4LF7Q 4DV5Q 2WFWA 2AHOB 4A76A 4DV4Q 1H95A 4APVA 2R7DA 1O7IA 4DR7Q 1HNXL 4UP7A 3OTOL 4LF6L 1HZ9A 3BJUA 1CKMA 4YHHQ 4HIKA 1XPUA 1GM5A 1YBYA 5IY0A 1L1OC 2RHQB 4IPGA 2QEXA 3S14H 2N78A 1OXXK 4POGA 1SN8A 3TQYA 4C3IH 3I4NH 4TVAB 1Q7YC 3HOUG 4BA2I 5EAYA 3UDIA 3J80i 1YEZA 2CKZB 4BBRG 5M5YH 2XTIA 4GOPC 5BR8Q 4GNXA 1X6OA 4A3DH 4X65L 3CCEA 4GN4B 1FVIA 1IBKQ 1Z47A 2C35B 4BXXH 4LF4Q 1BVSA 1JE5A 3GTKH 3FP9A 5DLQE 2UU9L 1K3RA 3GD7A 4GNXB 3G71A 3PO3H 4WJ4A 4HJAA 1X54A 5M3MH 4A3IH 2VW9A 1B70B 4JCVE 5IYDG 4C3HH 5C3EG 1HNXQ 3OTOQ 4LF6Q 4P72A 4UP8A 3J7ZC 1VQJA 3BZCA 1SFOH 2WAQG 3A74A 4AQYL 2GVBA 1XPOA 4A3EG 1K8AC 2Q2TA 4DR6L 1HNWQ 1MIUA 1IYJB 2L15A 4DR3Q 2PI2A 4NPSA 4DKAC 3HOYG 1EOVA 1Z9FA 2UXDQ 2KCTA 2E8GA 2I5HA 1NMFA 4A3FH 3E9HA 1YZ6A 2Z0SA 3I2ZA 4X65Q 1KC8C 1PH2A 2VS1A 2JEBI 4R4IA 1WI5A 2PQAA 4YWLA 4LFCL 1EQRA 3W1GA 1RIPA 4DR5L 4GN5A 4A3KG 1YJNA 5C0XI 2AWNA 1YNXA 2UU9Q 4GLVB 1I6HH 2A1AA 3CC4A 1JJGA 2PQAB 4IPCA 1TWCH 1AE2A 3H0GG 3PUWA 1VS0A 1A8VA 2HQLA 4KHPL 2JA6G 1VQKA 1GVPA 2JK8A 4BBSH 4A93H 3M3YH 5IP7G 1KRTA 1EIFA 5M5XH 4AQYQ 3ULLA 1R9TH 2K75A 3HKZE 4NXNL 4JI8Q 2IT1A 3NENA 4B3SL 3GTPH 4A3GG 3S1MH 4DR6Q 5GAEC 4LF9L 2Z6KC 2UUCQ 1BBUA 2K52A 3GTJH 2MFIA 3KF6B 1X9NA 4JC0A 4XTCS 1Q86C 2LSSA 4R4CA 4WJ3M 3EIVA 1LYLA 1FJGL 3PGZA 4LFCQ 1VQIA 2YTVA 2YTXA 2DGYA 4DR5Q 3PF5A 5ELNA 1WOCA 3S24A 4BA1I 4A3BG 2VQFL 1W2BA 4YCWA 2CCZA 4LUVA 2OTJA 2AWOA 2A19A 1UEBA 1UE7A 4DV6L 4KHPQ 3M4PA 5C4XG 4YWMA 4GNXC 1UE6A 4A4IA 2IX1A 5IP9H 3T1YL 1XJVA 3CMAA 4BBRH 4B3SQ 4IPDA 5IE8A 4NXNQ 3FHWA 4IFDG 2PMZE 4DV7L 1S72A 2ATWA 2NZHA 1X55A 4A3LH 4YCVA 4LF5L 2VZAA 1A63A 2Q2HA 2MO0A 4DUZL 3UE0A 4IOCA 1N32L 3M9BA 1FGUA 2K5HA 4DV0Q 4PZ7A 3EN2A 4L5QA 1J5EL 3CMEA 4AYBG 5C3EH 2VUMG 3K80C 1HNZL 4DV3Q 1N36L 3G48A 3CCVA 2Y0SG 3J7A5 5JJLA 1PH5A 1VQ5A 1OTCA 3I4OA 3KOJA 4A3EH 1I94L 4DV6Q 1N34L 1SROA 1ASZA 3TRZA 1A62A 2K50A 2JA7G 1OXVA 1QZHA 1N8RC 4GKJL 3T1YQ 3I56A 4GKJQ 1OXTA 2CWPA 3K81C 4A3CG 3U50C 4DR4L 1Y1WG 4OWTB 4PG3A 1GO3E 4YCUA 4LF5Q 4JBMA 4A3KH 3GTQH 1VQHA 1WYDA 3TREA 2NN6G 2Q2UA 1NY4A 2N8NA 1PFSA 4A3JG 1PA6A 3E9IA 1HH2P 2OCEA 4DK6C 4OX9L 2BH2A 4B3MQ 1J5EQ 3KFUA 3L0OA 1V1QA 2ZTCA 1G291 1G51A 4UPAA 1PH4A 1X3GA 1HNZQ 2E2JH 2JA6H 4X62Q 3RLFA 4B3TQ 3RLNA 1YHQA 2B63H 2VL6A 4RG1A 1I94Q 4KLKA 4A3GH 1W3SA 3EBEA 3DM3A 2Q2IA 3S16H 4JI2L 3AEVA 5JJIA 5IYCH 4LFAL 1Q12A 3I7FA 1XNRL 3JC66 1VQBA 4DNIA 1KAWA 1KIXA 3M4OH 2HIVA 3F8TA 4NB3A 5HGQA 3D0FA 2R93G 1Y1VG 2MO1A 4A3BH 1B8AA 3STBC 1QVGA 2N49A 1E3PA 2R6GA 4R1JA 3NBHB 4X66L 4L5SA 4QQBX 1PH1A 2VNUD 2NVYH 4JYAL 4BY7G 2RF4A 1C7YA 1YHBA 3PO2G 2K5VA 2OWOA 4IFDJ 4OX9Q 2HT1A 4JI5L 1VQ6A 5FLMG 2B3GA 2ASBA 3K0XA 3TS2A 1GD7A 5C4XH 5IWAL 1ASYA 2IY5B 1Q82C 1IXRA 4YWKA 3FKIG 1YHAA 2RHSB 1DGSA 3CCQA 3T1HL 3GTOH 2JJQA 1FL0A 2YYZA 2JA5G 1S3OA 3J81i 2AKWB 2KHIA 1V9PA 2WAQE 4JI2Q 3GTGH 4BY1G 2WP8J 1CKNA 3K8AA 4MNOA 4PZ8A 4LFAQ 2R92G 1XNRQ 4FDBA 2LXJA 3E0EA 3PUVA 1J6QA 2ZJQA 2N3SA 3NEMA 2VY3A 4GS3A 3I4MG 1D7QA 3JAMi 4DR1Q 1JT8A 4RMFA 3S2DH 4DR2L 1CKNB 4DUYL 1M1KC 5GADC 5ELOA 3ULPA 2VQEL 3GO5A 2VUMH 3AYHB 2E2HH 4X66Q 2YU9H 1U0LA 1IBLL 1X3EA 3J81c 3WWVA 1SMXA 4P74A 4AIMA 2HHHL 3CCLA 4JYAQ 1JJ2A 3BZKA 4UY8C 1HR0W 2MNAA 1Q81C 2EQSA 1PYBA 4JI1L 1GKHA 3KF6A 5IWAQ 1XTDA 2JA7H 3HOVG 2R7ZG 5AJ3L 3JAMc 3H15A 1IBML 4EQ5A 1S40A 2JA8H 4X64L 3HOWH 4P71A 5JEAG 4A3CH 1WCMG 1MKHA 3KLWA 1Y1WH 4HIOA 1VQ9A 1SRUA 5E7NA 3ULJA 3IRBA 2B29A 1SR3A 3M85A 3S1NH 2D0OA 3RLOA 4O2DA 1HZAA 5LMNL 3TEHB 4HIDA 3RR5A 2PI2E 2K5NA 3U4ZA 1XMQL 3RZOH 2JA9A 3W5OA 4AH6A 4DV1L 3AFPA 4DUYQ 3KJPA 4DR2Q 4IJLA 4NXML 1JB7A 2VQEQ 3UE1A 1NMGA 2NZOA 1VCIA 1EIYB 4JI0Q 1IBLQ 4QY7A 4HJ8A 2HHHQ 3H3VH 3W1BA 3HKSA 4QIWE 1P16A 3HOUH 3F2BA 3G4SA 2I5MX 3PUYA 4JI1Q 1PVOA 1I3QH 4OO1G 4LF9Q 5LMUL 2MQHA 4OXPA 3PO3G 1VQFA 1BKBA 3CCUA 2CQOA 2R93H 1X56A 3F2DA 1NJIC 4R4OA 3ERSX 2E5LL 4IJHA 1P8LA 5LMNQ 1FJGQ 4HJ7A 1Q1EA 3M7NA 5IYDH 2FXQA 4QJFA 4BY7H 5IT9c 2VQFQ 4JV5L 3HOXG 4DV1Q 2PNHA 4JOIA 1VQDA 4NXMQ 1YJ9A 3PSIA 4UP9A 2JQOA 2F4VL 3U58A 5J3BA 1NTGA 4AYBE 3A5UA 1PH8A 3HOYH 4HJ9A 1LTLA 1VQ8A 1AE3A 1N9WA 2Y0SE 2JE6I 2JA5H 4GLAC 4DK3C 2RCNA 1YITA 2ID0A 4DV7Q 2R92H 3SGIA 1EQQA 1N33L 5LMUQ 4JI6L 2CWAA 1PV4A 3ZJYC 4QL5A 1D8LA 1WFQA 3I4MH 4DR7L 1EYGA 1Q46A 1CUKA 4KHZA 5FJ8G 2UUAL 3PUZA 4Y52H 4DUZQ 3F2CA 3PV0A 1K9MC 1UWVA 2E5LQ 1N32Q 3H0GH 2ES2A 4BBSG 4MZ9A 2ZTDA 4QGUA 4JV5Q 5JEAJ 1N36Q 1VQAA 3Q8DA 1X65A 2K14A 2KHJA 3F1ZA 1QUQA 1KHIA 5IP7H 5IYBG 3PIOA 2OQKA 3GTMH 4HIMA 3HOVH 1LM0A 1N34Q 2R7ZH 3B6YA 1WJJA 1E1TA 1SE8A 2F4VQ 2BA0A 1MJCA 3G6EA 4IFDI 1QUQB 1VQNA 2QA4A 4JI4L 4O0AA 4B3RL 4Y7NH 2UXBL 1XPRA 1K73C 5C0XG 1HZCA 1A0IA 1B7YB 1TWGH 1UE1A 3BU2A 3K7UC 1N33Q 2JEAI 2HIXA 4DR4Q 4X6AH 1HZBA 1NE3A 4JI6Q 4DPGA 3RN2A 3A5ZB 4OONA 4LUOA 4LW1A 3CPWA 2UUAQ 2EIFA 2ZM6L 2ZJPA 1KD1C 1HNWL 3CW2C 3KF8B 4LUZA 1VQOA 4DV2L 4DR3L 4GLXA 3TS0A 1PH3A 1IZ6A 2UXDL 4LWCA 2I0QA 1RL2A 4YY3L 5M5WH 5IP9G 3MEFA 4GKKL 4POFA 5JJKA 5HY6A 3CF5A 3MXNB 1K83H 5H1SE 2D0PA 1HR0L 3CD6A 1K8GA 3S17H 4A3LG 1YI2A 4A3MG 1EFWA 1KRSA 3J81j 4R4TA 4JG2A 1JMCA 4JI4Q 2OTLA 1C0AA 4B3RQ 1TWHH 4PMWA 2UXBQ 1JJCB 1VQEA 3J80c 1I50H 2NN6I 1M90C 3PUXA 3HOZG 4JOIC 1XNQL 4IOAA 1QZGA 4JBKA 1OXSC 2H5XA 2ZTEA 4JBWA 3HOXH 4JI8L 2ZM6Q 2IX0A 2UXCL 5GAGC 1KXLA 5C44G 2GVAA 1E24A 1TXYA 3PIPA 3S2HH 4DV2Q 4JI5Q 4JBJA 3DLLA 5GAHC 2UUCL 3H3VI 1KQSA 2OQ0A 3NELA 2NVXH 4YY3Q 3S1QH 4GKKQ 3U4VA 1Y14B 1PYSB 1MJEA 3STBD 4P73A 3UDFA 3GDEA 4J15A 5M3FG 3T1HQ 1LUZA 1HR0Q 2GN5A 2K4KA 4JI0L 3ER0A 3AFQA 2YTYA 4A75A 2V1CC 3PCOB 2NVQH 2CFMA 1YIJA 1PHJA 1VQ7A 1CKOA 3A0JA 5K36G 2NVTH 1AH9A 3HKZG 5FJ8H 1TWAH 2I5LX 4A3JH 5FLXc 2D62A 3ICEA 5GROA 1OXUA 1G6PA 2BA1A 1XNQQ 3KYHC 3OW2A 3AQQA 4IPHA 2YV5A 2B63G 2KCMA 3PF4A 2AMCB 3M4QA 3I4NG 1XMOL 1L1OA 5IYBH 5GQOA 2UXCQ 1VQGA 2BH8A 5C0XJ 4LFBL 3CCJA 1CSPA 2ALYB 3L7ZC 4LF8L 2KENA 1PH6A 3CXCA 5IYCG 1C9OA 1EUJA 2DUDA 2EXDA 3CAMA 3D31A 1L1OB 3OYYA 4A3DG 3UDXA 4C3JH 5AJ3Q 4L5TA 3CCSA 1NBWA 1IBMQ 4BXXG 2F3IA 1L2FA 1Q8KA 3LGJA 4X64Q 4GOPA 4OWWB 4DV0L 1IL2A 2XGTA 1X3FA 5M3MG 4A3IG 4JI7L 3L2PA 4DV3L 3CPFA 1Y1VH 2E2IH 4GOPB 3RNUA 3S15H 4HJ5A 3K7AH 3GTLH 4ALPA 4LNQA 1Q1BA 1HJPA 4KI0A 1XMQQ 3PO2H 4K0KL 4PZ6A 2UUBL 5FLMH 1YVCA 1VQ4A 4P75A 4DR1L 4OWXB 3CC7A 4L5RC 1VQMA 1T9HA 4H02A 2WB1G 4JI3L 1EWIA 3FKIH 1XMOQ 1VQLA 1BBWA 4LFBQ 4TQUS 5LMNW 4A3FG 3VDYA 3CC2A 4LF8Q 1CSQA 1QVFA 1KL9A 4A3MH 5C4JH 3CCMA 3HFZB 4LF7L 4DV5L 4BY1H 4DV4L 2WB1E 1V43A 1I5FA 1L0WA 3UDGA 1TWFH 4B3ML 2LXKA 4YHHL 4XIGS 3RZDH 4R4QA 2F52A 3HOZH 4JI7Q 4ME3A 4X62L 2QGQA 1E22A 3KJOA 4B3TL 3S1RH 4MTNA 2R7FA 1YJWA 3CQZH 2KBNA 4A93G 1VQPA 5C44H 2IHEA 1PH9A 1SLJA 4K0KQ 3KDFA 2UUBQ 1QVCA 1VQCA 4DAYB 5BR8L 4IO9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EX5 A;  3CP0 A;  1PH7 A;  1E7Z A;  1IBK L;  2JA8 G;  3HOW G;  4JI3 Q;  1K0R A;  4LF4 L;  3KDF B;  2ZJR A;  4GN3 B;  2IHF A;  5M3F H;  3RN5 A;  1E1O A;  4DAM A;  4OO1 I;  1WCM H;  2Z6K A;  3I55 A;  1U5K A;  3CCR A;  4C2M H;  1UE5 A;  2A8V A;  4LF7 Q;  4DV5 Q;  2WFW A;  2AHO B;  4A76 A;  4DV4 Q;  1H95 A;  4APV A;  2R7D A;  1O7I A;  4DR7 Q;  1HNX L;  4UP7 A;  3OTO L;  4LF6 L;  1HZ9 A;  3BJU A;  1CKM A;  4YHH Q;  4HIK A;  1XPU A;  1GM5 A;  1YBY A;  5IY0 A;  1L1O C;  2RHQ B;  4IPG A;  2QEX A;  3S14 H;  2N78 A;  1OXX K;  4POG A;  1SN8 A;  3TQY A;  4C3I H;  3I4N H;  4TVA B;  1Q7Y C;  3HOU G;  4BA2 I;  5EAY A;  3UDI A;  3J80 i;  1YEZ A;  2CKZ B;  4BBR G;  5M5Y H;  2XTI A;  4GOP C;  5BR8 Q;  4GNX A;  1X6O A;  4A3D H;  4X65 L;  3CCE A;  4GN4 B;  1FVI A;  1IBK Q;  1Z47 A;  2C35 B;  4BXX H;  4LF4 Q;  1BVS A;  1JE5 A;  3GTK H;  3FP9 A;  5DLQ E;  2UU9 L;  1K3R A;  3GD7 A;  4GNX B;  3G71 A;  3PO3 H;  4WJ4 A;  4HJA A;  1X54 A;  5M3M H;  4A3I H;  2VW9 A;  1B70 B;  4JCV E;  5IYD G;  4C3H H;  5C3E G;  1HNX Q;  3OTO Q;  4LF6 Q;  4P72 A;  4UP8 A;  3J7Z C;  1VQJ A;  3BZC A;  1SFO H;  2WAQ G;  3A74 A;  4AQY L;  2GVB A;  1XPO A;  4A3E G;  1K8A C;  2Q2T A;  4DR6 L;  1HNW Q;  1MIU A;  1IYJ B;  2L15 A;  4DR3 Q;  2PI2 A;  4NPS A;  4DKA C;  3HOY G;  1EOV A;  1Z9F A;  2UXD Q;  2KCT A;  2E8G A;  2I5H A;  1NMF A;  4A3F H;  3E9H A;  1YZ6 A;  2Z0S A;  3I2Z A;  4X65 Q;  1KC8 C;  1PH2 A;  2VS1 A;  2JEB I;  4R4I A;  1WI5 A;  2PQA A;  4YWL A;  4LFC L;  1EQR A;  3W1G A;  1RIP A;  4DR5 L;  4GN5 A;  4A3K G;  1YJN A;  5C0X I;  2AWN A;  1YNX A;  2UU9 Q;  4GLV B;  1I6H H;  2A1A A;  3CC4 A;  1JJG A;  2PQA B;  4IPC A;  1TWC H;  1AE2 A;  3H0G G;  3PUW A;  1VS0 A;  1A8V A;  2HQL A;  4KHP L;  2JA6 G;  1VQK A;  1GVP A;  2JK8 A;  4BBS H;  4A93 H;  3M3Y H;  5IP7 G;  1KRT A;  1EIF A;  5M5X H;  4AQY Q;  3ULL A;  1R9T H;  2K75 A;  3HKZ E;  4NXN L;  4JI8 Q;  2IT1 A;  3NEN A;  4B3S L;  3GTP H;  4A3G G;  3S1M H;  4DR6 Q;  5GAE C;  4LF9 L;  2Z6K C;  2UUC Q;  1BBU A;  2K52 A;  3GTJ H;  2MFI A;  3KF6 B;  1X9N A;  4JC0 A;  4XTC S;  1Q86 C;  2LSS A;  4R4C A;  4WJ3 M;  3EIV A;  1LYL A;  1FJG L;  3PGZ A;  4LFC Q;  1VQI A;  2YTV A;  2YTX A;  2DGY A;  4DR5 Q;  3PF5 A;  5ELN A;  1WOC A;  3S24 A;  4BA1 I;  4A3B G;  2VQF L;  1W2B A;  4YCW A;  2CCZ A;  4LUV A;  2OTJ A;  2AWO A;  2A19 A;  1UEB A;  1UE7 A;  4DV6 L;  4KHP Q;  3M4P A;  5C4X G;  4YWM A;  4GNX C;  1UE6 A;  4A4I A;  2IX1 A;  5IP9 H;  3T1Y L;  1XJV A;  3CMA A;  4BBR H;  4B3S Q;  4IPD A;  5IE8 A;  4NXN Q;  3FHW A;  4IFD G;  2PMZ E;  4DV7 L;  1S72 A;  2ATW A;  2NZH A;  1X55 A;  4A3L H;  4YCV A;  4LF5 L;  2VZA A;  1A63 A;  2Q2H A;  2MO0 A;  4DUZ L;  3UE0 A;  4IOC A;  1N32 L;  3M9B A;  1FGU A;  2K5H A;  4DV0 Q;  4PZ7 A;  3EN2 A;  4L5Q A;  1J5E L;  3CME A;  4AYB G;  5C3E H;  2VUM G;  3K80 C;  1HNZ L;  4DV3 Q;  1N36 L;  3G48 A;  3CCV A;  2Y0S G;  3J7A 5;  5JJL A;  1PH5 A;  1VQ5 A;  1OTC A;  3I4O A;  3KOJ A;  4A3E H;  1I94 L;  4DV6 Q;  1N34 L;  1SRO A;  1ASZ A;  3TRZ A;  1A62 A;  2K50 A;  2JA7 G;  1OXV A;  1QZH A;  1N8R C;  4GKJ L;  3T1Y Q;  3I56 A;  4GKJ Q;  1OXT A;  2CWP A;  3K81 C;  4A3C G;  3U50 C;  4DR4 L;  1Y1W G;  4OWT B;  4PG3 A;  1GO3 E;  4YCU A;  4LF5 Q;  4JBM A;  4A3K H;  3GTQ H;  1VQH A;  1WYD A;  3TRE A;  2NN6 G;  2Q2U A;  1NY4 A;  2N8N A;  1PFS A;  4A3J G;  1PA6 A;  3E9I A;  1HH2 P;  2OCE A;  4DK6 C;  4OX9 L;  2BH2 A;  4B3M Q;  1J5E Q;  3KFU A;  3L0O A;  1V1Q A;  2ZTC A;  1G29 1;  1G51 A;  4UPA A;  1PH4 A;  1X3G A;  1HNZ Q;  2E2J H;  2JA6 H;  4X62 Q;  3RLF A;  4B3T Q;  3RLN A;  1YHQ A;  2B63 H;  2VL6 A;  4RG1 A;  1I94 Q;  4KLK A;  4A3G H;  1W3S A;  3EBE A;  3DM3 A;  2Q2I A;  3S16 H;  4JI2 L;  3AEV A;  5JJI A;  5IYC H;  4LFA L;  1Q12 A;  3I7F A;  1XNR L;  3JC6 6;  1VQB A;  4DNI A;  1KAW A;  1KIX A;  3M4O H;  2HIV A;  3F8T A;  4NB3 A;  5HGQ A;  3D0F A;  2R93 G;  1Y1V G;  2MO1 A;  4A3B H;  1B8A A;  3STB C;  1QVG A;  2N49 A;  1E3P A;  2R6G A;  4R1J A;  3NBH B;  4X66 L;  4L5S A;  4QQB X;  1PH1 A;  2VNU D;  2NVY H;  4JYA L;  4BY7 G;  2RF4 A;  1C7Y A;  1YHB A;  3PO2 G;  2K5V A;  2OWO A;  4IFD J;  4OX9 Q;  2HT1 A;  4JI5 L;  1VQ6 A;  5FLM G;  2B3G A;  2ASB A;  3K0X A;  3TS2 A;  1GD7 A;  5C4X H;  5IWA L;  1ASY A;  2IY5 B;  1Q82 C;  1IXR A;  4YWK A;  3FKI G;  1YHA A;  2RHS B;  1DGS A;  3CCQ A;  3T1H L;  3GTO H;  2JJQ A;  1FL0 A;  2YYZ A;  2JA5 G;  1S3O A;  3J81 i;  2AKW B;  2KHI A;  1V9P A;  2WAQ E;  4JI2 Q;  3GTG H;  4BY1 G;  2WP8 J;  1CKN A;  3K8A A;  4MNO A;  4PZ8 A;  4LFA Q;  2R92 G;  1XNR Q;  4FDB A;  2LXJ A;  3E0E A;  3PUV A;  1J6Q A;  2ZJQ A;  2N3S A;  3NEM A;  2VY3 A;  4GS3 A;  3I4M G;  1D7Q A;  3JAM i;  4DR1 Q;  1JT8 A;  4RMF A;  3S2D H;  4DR2 L;  1CKN B;  4DUY L;  1M1K C;  5GAD C;  5ELO A;  3ULP A;  2VQE L;  3GO5 A;  2VUM H;  3AYH B;  2E2H H;  4X66 Q;  2YU9 H;  1U0L A;  1IBL L;  1X3E A;  3J81 c;  3WWV A;  1SMX A;  4P74 A;  4AIM A;  2HHH L;  3CCL A;  4JYA Q;  1JJ2 A;  3BZK A;  4UY8 C;  1HR0 W;  2MNA A;  1Q81 C;  2EQS A;  1PYB A;  4JI1 L;  1GKH A;  3KF6 A;  5IWA Q;  1XTD A;  2JA7 H;  3HOV G;  2R7Z G;  5AJ3 L;  3JAM c;  3H15 A;  1IBM L;  4EQ5 A;  1S40 A;  2JA8 H;  4X64 L;  3HOW H;  4P71 A;  5JEA G;  4A3C H;  1WCM G;  1MKH A;  3KLW A;  1Y1W H;  4HIO A;  1VQ9 A;  1SRU A;  5E7N A;  3ULJ A;  3IRB A;  2B29 A;  1SR3 A;  3M85 A;  3S1N H;  2D0O A;  3RLO A;  4O2D A;  1HZA A;  5LMN L;  3TEH B;  4HID A;  3RR5 A;  2PI2 E;  2K5N A;  3U4Z A;  1XMQ L;  3RZO H;  2JA9 A;  3W5O A;  4AH6 A;  4DV1 L;  3AFP A;  4DUY Q;  3KJP A;  4DR2 Q;  4IJL A;  4NXM L;  1JB7 A;  2VQE Q;  3UE1 A;  1NMG A;  2NZO A;  1VCI A;  1EIY B;  4JI0 Q;  1IBL Q;  4QY7 A;  4HJ8 A;  2HHH Q;  3H3V H;  3W1B A;  3HKS A;  4QIW E;  1P16 A;  3HOU H;  3F2B A;  3G4S A;  2I5M X;  3PUY A;  4JI1 Q;  1PVO A;  1I3Q H;  4OO1 G;  4LF9 Q;  5LMU L;  2MQH A;  4OXP A;  3PO3 G;  1VQF A;  1BKB A;  3CCU A;  2CQO A;  2R93 H;  1X56 A;  3F2D A;  1NJI C;  4R4O A;  3ERS X;  2E5L L;  4IJH A;  1P8L A;  5LMN Q;  1FJG Q;  4HJ7 A;  1Q1E A;  3M7N A;  5IYD H;  2FXQ A;  4QJF A;  4BY7 H;  5IT9 c;  2VQF Q;  4JV5 L;  3HOX G;  4DV1 Q;  2PNH A;  4JOI A;  1VQD A;  4NXM Q;  1YJ9 A;  3PSI A;  4UP9 A;  2JQO A;  2F4V L;  3U58 A;  5J3B A;  1NTG A;  4AYB E;  3A5U A;  1PH8 A;  3HOY H;  4HJ9 A;  1LTL A;  1VQ8 A;  1AE3 A;  1N9W A;  2Y0S E;  2JE6 I;  2JA5 H;  4GLA C;  4DK3 C;  2RCN A;  1YIT A;  2ID0 A;  4DV7 Q;  2R92 H;  3SGI A;  1EQQ A;  1N33 L;  5LMU Q;  4JI6 L;  2CWA A;  1PV4 A;  3ZJY C;  4QL5 A;  1D8L A;  1WFQ A;  3I4M H;  4DR7 L;  1EYG A;  1Q46 A;  1CUK A;  4KHZ A;  5FJ8 G;  2UUA L;  3PUZ A;  4Y52 H;  4DUZ Q;  3F2C A;  3PV0 A;  1K9M C;  1UWV A;  2E5L Q;  1N32 Q;  3H0G H;  2ES2 A;  4BBS G;  4MZ9 A;  2ZTD A;  4QGU A;  4JV5 Q;  5JEA J;  1N36 Q;  1VQA A;  3Q8D A;  1X65 A;  2K14 A;  2KHJ A;  3F1Z A;  1QUQ A;  1KHI A;  5IP7 H;  5IYB G;  3PIO A;  2OQK A;  3GTM H;  4HIM A;  3HOV H;  1LM0 A;  1N34 Q;  2R7Z H;  3B6Y A;  1WJJ A;  1E1T A;  1SE8 A;  2F4V Q;  2BA0 A;  1MJC A;  3G6E A;  4IFD I;  1QUQ B;  1VQN A;  2QA4 A;  4JI4 L;  4O0A A;  4B3R L;  4Y7N H;  2UXB L;  1XPR A;  1K73 C;  5C0X G;  1HZC A;  1A0I A;  1B7Y B;  1TWG H;  1UE1 A;  3BU2 A;  3K7U C;  1N33 Q;  2JEA I;  2HIX A;  4DR4 Q;  4X6A H;  1HZB A;  1NE3 A;  4JI6 Q;  4DPG A;  3RN2 A;  3A5Z B;  4OON A;  4LUO A;  4LW1 A;  3CPW A;  2UUA Q;  2EIF A;  2ZM6 L;  2ZJP A;  1KD1 C;  1HNW L;  3CW2 C;  3KF8 B;  4LUZ A;  1VQO A;  4DV2 L;  4DR3 L;  4GLX A;  3TS0 A;  1PH3 A;  1IZ6 A;  2UXD L;  4LWC A;  2I0Q A;  1RL2 A;  4YY3 L;  5M5W H;  5IP9 G;  3MEF A;  4GKK L;  4POF A;  5JJK A;  5HY6 A;  3CF5 A;  3MXN B;  1K83 H;  5H1S E;  2D0P A;  1HR0 L;  3CD6 A;  1K8G A;  3S17 H;  4A3L G;  1YI2 A;  4A3M G;  1EFW A;  1KRS A;  3J81 j;  4R4T A;  4JG2 A;  1JMC A;  4JI4 Q;  2OTL A;  1C0A A;  4B3R Q;  1TWH H;  4PMW A;  2UXB Q;  1JJC B;  1VQE A;  3J80 c;  1I50 H;  2NN6 I;  1M90 C;  3PUX A;  3HOZ G;  4JOI C;  1XNQ L;  4IOA A;  1QZG A;  4JBK A;  1OXS C;  2H5X A;  2ZTE A;  4JBW A;  3HOX H;  4JI8 L;  2ZM6 Q;  2IX0 A;  2UXC L;  5GAG C;  1KXL A;  5C44 G;  2GVA A;  1E24 A;  1TXY A;  3PIP A;  3S2H H;  4DV2 Q;  4JI5 Q;  4JBJ A;  3DLL A;  5GAH C;  2UUC L;  3H3V I;  1KQS A;  2OQ0 A;  3NEL A;  2NVX H;  4YY3 Q;  3S1Q H;  4GKK Q;  3U4V A;  1Y14 B;  1PYS B;  1MJE A;  3STB D;  4P73 A;  3UDF A;  3GDE A;  4J15 A;  5M3F G;  3T1H Q;  1LUZ A;  1HR0 Q;  2GN5 A;  2K4K A;  4JI0 L;  3ER0 A;  3AFQ A;  2YTY A;  4A75 A;  2V1C C;  3PCO B;  2NVQ H;  2CFM A;  1YIJ A;  1PHJ A;  1VQ7 A;  1CKO A;  3A0J A;  5K36 G;  2NVT H;  1AH9 A;  3HKZ G;  5FJ8 H;  1TWA H;  2I5L X;  4A3J H;  5FLX c;  2D62 A;  3ICE A;  5GRO A;  1OXU A;  1G6P A;  2BA1 A;  1XNQ Q;  3KYH C;  3OW2 A;  3AQQ A;  4IPH A;  2YV5 A;  2B63 G;  2KCM A;  3PF4 A;  2AMC B;  3M4Q A;  3I4N G;  1XMO L;  1L1O A;  5IYB H;  5GQO A;  2UXC Q;  1VQG A;  2BH8 A;  5C0X J;  4LFB L;  3CCJ A;  1CSP A;  2ALY B;  3L7Z C;  4LF8 L;  2KEN A;  1PH6 A;  3CXC A;  5IYC G;  1C9O A;  1EUJ A;  2DUD A;  2EXD A;  3CAM A;  3D31 A;  1L1O B;  3OYY A;  4A3D G;  3UDX A;  4C3J H;  5AJ3 Q;  4L5T A;  3CCS A;  1NBW A;  1IBM Q;  4BXX G;  2F3I A;  1L2F A;  1Q8K A;  3LGJ A;  4X64 Q;  4GOP A;  4OWW B;  4DV0 L;  1IL2 A;  2XGT A;  1X3F A;  5M3M G;  4A3I G;  4JI7 L;  3L2P A;  4DV3 L;  3CPF A;  1Y1V H;  2E2I H;  4GOP B;  3RNU A;  3S15 H;  4HJ5 A;  3K7A H;  3GTL H;  4ALP A;  4LNQ A;  1Q1B A;  1HJP A;  4KI0 A;  1XMQ Q;  3PO2 H;  4K0K L;  4PZ6 A;  2UUB L;  5FLM H;  1YVC A;  1VQ4 A;  4P75 A;  4DR1 L;  4OWX B;  3CC7 A;  4L5R C;  1VQM A;  1T9H A;  4H02 A;  2WB1 G;  4JI3 L;  1EWI A;  3FKI H;  1XMO Q;  1VQL A;  1BBW A;  4LFB Q;  4TQU S;  5LMN W;  4A3F G;  3VDY A;  3CC2 A;  4LF8 Q;  1CSQ A;  1QVF A;  1KL9 A;  4A3M H;  5C4J H;  3CCM A;  3HFZ B;  4LF7 L;  4DV5 L;  4BY1 H;  4DV4 L;  2WB1 E;  1V43 A;  1I5F A;  1L0W A;  3UDG A;  1TWF H;  4B3M L;  2LXK A;  4YHH L;  4XIG S;  3RZD H;  4R4Q A;  2F52 A;  3HOZ H;  4JI7 Q;  4ME3 A;  4X62 L;  2QGQ A;  1E22 A;  3KJO A;  4B3T L;  3S1R H;  4MTN A;  2R7F A;  1YJW A;  3CQZ H;  2KBN A;  4A93 G;  1VQP A;  5C44 H;  2IHE A;  1PH9 A;  1SLJ A;  4K0K Q;  3KDF A;  2UUB Q;  1QVC A;  1VQC A;  4DAY B;  5BR8 L;  4IO9 A; 
#chains in the Genus database with same CATH topology
 3C1E A;  4RGM A;  2JN4 A;  1E7Z A;  1IBK L;  2JA8 G;  4JI3 Q;  1K0R A;  4LF4 L;  2PCF B;  2ZJR A;  2IHF A;  1AFP A;  1E1O A;  1I3Q B;  2D5D A;  4L6T B;  5KIX A;  3CCR A;  1UE5 A;  4DV5 Q;  3E0J A;  1H95 A;  4DV4 Q;  4RH6 A;  4APV A;  3DWA A;  1Y1V B;  4DR7 Q;  1HNX L;  4UP7 A;  3OTO L;  1E2V A;  3NQI A;  2Z8L A;  2QKI C;  2RBM A;  5IY0 A;  4ZQ3 A;  4IPG A;  3SEB A;  1KAA A;  1PTO F;  3S14 H;  1OXX K;  4MIU A;  4C3I H;  2D2C C;  3A8I E;  3J80 i;  1YEZ A;  2XTI A;  4X3T A;  5BR8 Q;  5KNB A;  4X65 L;  1FVI A;  1Z47 A;  4BXX H;  2M2L A;  3LWE A;  1BVS A;  4UDU C;  1EOT A;  1D6E C;  1K3R A;  5CV6 A;  4HMI A;  4A3I H;  4QMG A;  2VW9 A;  3FPU B;  5IYD G;  4C3H H;  1ZYR C;  5DM6 3;  4LF6 Q;  3A8J E;  1O7Z A;  4P72 A;  3J7Z C;  1VQJ A;  3BZC A;  1G2T A;  4AQY L;  2GVB A;  1SXT A;  1K3B C;  4F87 A;  4DR3 Q;  2PI2 A;  5A35 A;  4U68 A;  1YZ6 A;  1PH2 A;  2PQA A;  1EQR A;  4Y7N B;  1RIP A;  2K5Q A;  4DR5 L;  1YJN A;  5C0X I;  3J80 E;  4KHV A;  4GLV B;  3J81 L;  3H3V C;  1X3Q A;  2PQA B;  2QF7 A;  4XT3 B;  1A8V A;  4HN7 A;  1FYC A;  1PRT C;  2JA6 G;  3NWS A;  2FMM A;  4B3S L;  3NEN A;  3Q23 A;  1LTG D;  5GAE C;  5M5Y B;  1DON A;  2Z6K C;  4I7Z C;  2K52 A;  4RAU C;  1X9N A;  1L0Y B;  3S17 B;  4JC0 A;  2LSS A;  3NHH A;  3PO3 B;  1RF2 D;  4WJ3 M;  1FJG L;  5DEH A;  4LFC Q;  2JSO A;  4CKB A;  1W2B A;  2KHS A;  4ZYS A;  5CV9 A;  1BXT A;  5C5M A;  1UE7 A;  2Y0S B;  3A7A B;  4GNX C;  3S2H B;  1UE6 A;  4XDX A;  1IW7 D;  1XJV A;  3QG1 A;  4BBR H;  4IPD A;  5IGE A;  3LX0 A;  4G4K A;  1AZP A;  3T4A C;  2NZH A;  2XVS A;  2VZA A;  4IOC A;  1N32 L;  2P5Z X;  3MA2 B;  2O5I C;  1J5E L;  2NVT B;  3PQI A;  3CME A;  1GHK A;  4AYB G;  1CQF A;  3SVM A;  1N36 L;  1T5X D;  1WVL A;  2Y0S G;  3J7A 5;  3N6R A;  1VQ5 A;  3TSS A;  1OTC A;  3I4O A;  1I94 L;  4A3E H;  4DV6 Q;  1N34 L;  1SRO A;  3TRZ A;  1A62 A;  4G7Z C;  1CT1 D;  4RWS C;  1N8R C;  1HHV A;  3T1Y Q;  4HCE A;  2K5D A;  4LF5 Q;  2B2V A;  2Q2U A;  4A3J G;  3E9I A;  3S15 B;  4B3M Q;  1B50 A;  1KNA A;  1SBB B;  3A54 A;  4LAA A;  4PQX A;  2GA4 B;  4B3T Q;  1YHQ A;  2TMP A;  4EQP A;  4J6H A;  1HQM C;  3FDT A;  3DM3 A;  3S16 H;  3FKI B;  4JI2 L;  2DJG C;  1XNR L;  2Z1C A;  3M4O H;  2R93 G;  3WOE A;  3NBI A;  1UNS A;  4A3B H;  2X6G A;  2VNU D;  1PH1 A;  2NVY H;  4JYA L;  1YHB A;  3PO2 G;  4IFD J;  4U67 3;  1SMY C;  3S1R B;  3BDO A;  5FLM G;  2B3G A;  4R8N A;  2ASB A;  3OWF A;  5C4X H;  5C44 B;  1ASY A;  2IY5 B;  4YWK A;  3FKI G;  4XXE A;  1IHZ A;  4IFD H;  4K2K A;  2YYZ A;  2JA5 G;  2AKW B;  4DXF A;  3BYT B;  2R92 G;  4MNO A;  3KBG A;  3RUZ A;  3PUV A;  3NEM A;  2EJG C;  2B2W A;  4RMF A;  3VA7 A;  5GAD C;  1EZ6 A;  3OW7 A;  2VUM H;  2NTT A;  1MSH A;  2E2H H;  4CJ2 C;  1IBL L;  2HHH L;  2O2L D;  3BZK A;  3S14 B;  1HR0 W;  2MNA A;  1PYB A;  2F0P A;  4HED A;  1JOK A;  1GKH A;  3KF6 A;  4JI1 L;  5IWA Q;  2JA7 H;  1HTL D;  4RGO S;  4A3C H;  2RDG A;  3KLW A;  4FF1 A;  1KAB A;  1Y1W H;  3ULJ A;  3M85 A;  3S1N H;  2D0O A;  2NN6 H;  1B3A A;  3TEH B;  4HID A;  4A3I B;  1QCB D;  2L5T A;  4AH6 A;  1D5M C;  4C3H B;  4DUY Q;  4NXM L;  4IQZ A;  2PMZ B;  1NR2 A;  4C3I G;  4HJ8 A;  3IFD A;  3DMU A;  3GTO B;  3BS1 A;  2EYP A;  4L63 B;  2LY7 A;  3F2D A;  4CJ1 B;  4R4O A;  3SK8 A;  2IL8 A;  1F9P A;  5KNC A;  4C3H G;  3LWU A;  1DJR D;  5LMN Q;  4OHJ A;  3M7N A;  1Q1E A;  2F0G A;  4IUP A;  4N9P A;  4DV1 Q;  1WTP A;  4XQJ A;  3IKJ A;  2WKC A;  3PSI A;  1EL0 A;  4ID6 A;  2ZT9 C;  1NTG A;  3QJY A;  3A5U A;  3HOY H;  1EY7 A;  2A74 C;  1CA6 A;  2ID0 A;  2NTS A;  5LMU Q;  2CWA A;  2NUC A;  3ZJY C;  4QL5 A;  1WFQ A;  3I4M H;  4DR7 L;  1EYG A;  1CUK A;  1V8Q A;  1MSG A;  3F2C A;  1DOK A;  1NNX A;  3H0G H;  2EJM A;  4JV5 Q;  4KN7 C;  1LLR D;  2ENB A;  3F1Z A;  3OMC A;  3HOU B;  1PZI D;  1LM0 A;  2A73 B;  2R7Z H;  1E1T A;  1PFN A;  1SE8 A;  3VR6 A;  4BBR B;  1S5F D;  1VQN A;  4C3J G;  1SYC A;  1F2M A;  3G7L A;  3I70 A;  1XPR A;  4IAL A;  4X6A H;  3FMC A;  1SDF A;  5EPJ A;  1SAP A;  3KF8 A;  2WAC A;  4DPG A;  3RN2 A;  4IUV A;  1A3U A;  1WTR A;  1H9K A;  3CW2 C;  3KF8 B;  2A6H C;  4DR3 L;  1IZ6 A;  2WAQ B;  4A3E B;  1TQO A;  4YY3 L;  5CR3 A;  1QJO A;  4DF7 A;  3I3C A;  1H9R A;  1HFN A;  5HY6 A;  3CF5 A;  4RGN A;  2D0P A;  1HR0 L;  3CD6 A;  1YNJ C;  4A3M G;  3DUZ A;  5D14 A;  1KRS A;  1JB3 A;  2KEC A;  4R4T A;  4JG2 A;  4JI4 Q;  4B3R Q;  1JJC B;  2TSS A;  2EY2 A;  1M8A A;  3W3A A;  4JOI C;  1XYI A;  5F2D A;  1XNQ L;  1QZG A;  3DWP A;  4OEM B;  2B2T C;  1JQY D;  3HOX H;  4C1N K;  4H13 C;  3VYU A;  1KXL A;  1E24 A;  1TXY A;  3DLL A;  1JWS D;  1PFB A;  4ZRZ A;  1KQS A;  3S1Q H;  1JWM D;  3U4V A;  5JVG 3;  3QR8 A;  4BS9 A;  1PYS B;  3S16 B;  1NAP A;  3STB D;  4P73 A;  5C6A A;  1LUZ A;  2K4K A;  2KA7 A;  3TDQ A;  1X32 A;  2CFM A;  1YIJ A;  4M8A A;  1AH9 A;  5FJ8 H;  4A3B B;  4RA8 A;  1IYU A;  2F0Q A;  1DZ1 A;  1HFG A;  5E1F A;  1G6P A;  1BCP F;  2NVY B;  2EYM A;  2M9V A;  4V19 0;  3A7L A;  2DY8 A;  1PFM A;  3AQQ A;  4R9W A;  2YV5 A;  4JVZ A;  3I4N G;  3BDC A;  4QCL A;  2Q8R E;  5IYB H;  5C4X B;  5C0X J;  3L7Z C;  4LF8 L;  2DUD A;  2EXD A;  3VR3 A;  3CAM A;  1CM9 A;  3D31 A;  5AJ3 Q;  4L5T A;  3CCS A;  1NBW A;  1CHQ D;  1Q8K A;  3LGJ A;  4X64 Q;  4GOP A;  5C0X H;  1CQV A;  2K1B A;  1X3F A;  1EY5 A;  5M3M G;  4JI7 L;  3CPF A;  1Y1V H;  2E2I H;  4GOP B;  1DOL A;  4LNQ A;  1F9Q A;  4RCO A;  2VUM B;  2E2H B;  4TRD A;  4PZ6 A;  1VQ4 A;  4DR1 L;  3CC7 A;  2A68 D;  4H02 A;  3T56 B;  2WB1 G;  4XQQ A;  2OEO A;  4WFN 3;  1JR0 D;  2JA7 B;  5L37 A;  4TQU S;  5LMN W;  4A3F G;  3WOF A;  1KL9 A;  4ZCK A;  5LHY 1;  2NWG A;  1NCV A;  4LF7 L;  2WB1 E;  1HQR D;  1Y1W B;  2IPK D;  1I5F A;  1L0W A;  3Q6S A;  4B3M L;  4TSS A;  4XIG S;  1CHP D;  3HOZ H;  3ERO A;  1E22 A;  4LMQ D;  4B3T L;  3HGB A;  1GUT A;  1A3T A;  2QEJ C;  1MD2 D;  2B2Y A;  2DY7 A;  1S5D D;  2KCN A;  2IHE A;  1WTW A;  2F0K A;  4K0K Q;  1B3Q A;  3MFG A;  4EX5 A;  1STG A;  1PH7 A;  1JC7 A;  1PZJ D;  3SHL A;  2SNM A;  5IGC A;  1K0S A;  4JW0 A;  4GN3 B;  4OIJ A;  5M3F H;  5EPK A;  2EYL A;  3RN5 A;  1WTV A;  4DAM A;  5D65 A;  1U5K A;  3PIP 3;  2WFW A;  2AHO B;  3Q24 A;  1O7I A;  2A69 C;  1HZ9 A;  2EYF A;  1CKM A;  1XPU A;  1GM5 A;  3KLS A;  1EFI D;  1CZG A;  3MC0 B;  1LTB D;  1STN A;  4BA2 I;  5DM7 3;  4TVA B;  1QNU A;  4IZ8 A;  1Q7Y C;  1STE A;  2LS0 1;  2B8G A;  5CBA E;  4Z9C B;  5M5Y H;  3R3O A;  4A3D H;  1O80 A;  1SND A;  2C35 B;  2F0V A;  4OO1 H;  1IYV A;  2BDN A;  3PO3 H;  2O4X A;  3G71 A;  3VYT A;  3I4M B;  1J9O A;  1BUV T;  2R3Z A;  4JCV E;  2E76 C;  4KMU C;  5C3E G;  1LAB A;  3CQZ B;  5DNF A;  5FO8 B;  1SFO H;  4Q5V A;  2RSO A;  1MIU A;  1HNW Q;  3EFX D;  3V96 A;  4QUF A;  1D2B A;  3HOY G;  5BN3 A;  1EOV A;  1Z9F A;  2L12 A;  3SK5 A;  2R7Z B;  2KCT A;  2E8G A;  1SJE D;  1AW7 A;  1GUW A;  4F88 A;  2Z0S A;  5EBC A;  2VS1 A;  2JEB I;  3W1G A;  4C2M B;  2EJF C;  2F0S A;  4A3K G;  5D3D A;  2UU9 Q;  2PW5 A;  2F0F A;  3MTS A;  1I6H H;  2A1A A;  3CC4 A;  1BR9 A;  3H0G G;  2F3W A;  3HRZ C;  4QIW B;  1E2Z A;  2EOT A;  1GVP A;  2JK8 A;  2F03 A;  4A93 H;  1TR5 A;  3M3Y H;  1EIF A;  3HKZ E;  4JI8 Q;  4DR6 Q;  2IT1 A;  1MI2 A;  4R8I A;  3GTJ H;  1ZYR D;  2B2U A;  2EXZ A;  1Q86 C;  3X3N A;  4R4C A;  1YNN C;  1WTX A;  1VQI A;  2YTV A;  2YTX A;  5ELN A;  5C4H A;  1RTN A;  2ICE C;  1TKW B;  4YCW A;  3TP6 A;  4LUV A;  1BNZ A;  2CCZ A;  4CKC A;  2OTJ A;  1XX8 A;  3BVZ A;  5ELD A;  3QOL A;  1UEB A;  3HOX B;  1QG7 A;  4KHP Q;  1STY A;  4RHS A;  3A56 A;  2F0J A;  3T51 B;  4A4I A;  1JIC A;  2QDB A;  4QUC A;  4NXN Q;  5IE8 A;  3S1Q B;  4H44 C;  1ICW A;  4DA2 A;  3S9W A;  4YCV A;  1PRT D;  4CDF C;  3UI2 A;  1B4O A;  3UE0 A;  3H6M A;  3M9B A;  3WDN A;  4L5Q A;  2BE5 D;  5J1Z A;  4K5V A;  4OL7 A;  3TBI B;  5JJL A;  5NUC A;  2KQ3 A;  2PPB C;  5FO9 B;  2HCC A;  2SDF A;  2K50 A;  1OXV A;  1QZH A;  2E74 C;  3NTH A;  4GKJ Q;  4HSP A;  2HQE A;  2CWP A;  1K8M A;  1GO3 E;  1EY4 A;  1ENC A;  4JBM A;  1ILP A;  1RD9 D;  3TRE A;  4PNY A;  2VXW A;  5K36 H;  1ZXT A;  2E2I B;  4DK6 C;  2VB2 X;  3L0O A;  1V1Q A;  2ZTC A;  1G51 A;  3K5M A;  1PH4 A;  2E2J H;  1HNZ Q;  2ZXO A;  4X62 Q;  1SE4 A;  3D4R A;  3P75 A;  3RLN A;  1STB A;  4JPB W;  1H9S A;  4A3G H;  3EBE A;  1BCP C;  1H9S B;  3I7F A;  1KIX A;  2HIV A;  3F8T A;  3ONA B;  4NB3 A;  5HGQ A;  1BQQ T;  1GJX A;  4PMB A;  4OIK A;  1Y1V G;  3OIP A;  1I4P A;  5COY A;  4KY7 A;  1QB5 D;  4YIJ A;  4RHR A;  3HOZ B;  1C7Y A;  2K5V A;  4OX9 Q;  1VQ6 A;  1Q82 C;  3CCQ A;  3GTO H;  1B1Z A;  2SOB A;  3RMH A;  1KTK A;  2V4D A;  5M3F B;  2WP8 J;  1C4Q A;  4LFA Q;  2RCF A;  4KD4 A;  2LXJ A;  3E0E A;  1VF7 A;  2FMC A;  3JAM i;  3T16 A;  3S2D H;  4DR2 L;  1M1K C;  3OOC A;  3GO5 A;  1A6X A;  1GXD C;  5IGD A;  4X66 Q;  1B44 D;  1U0L A;  4JI0 L;  1TY2 A;  3CCL A;  4FF3 A;  1JJ2 A;  2NZ1 D;  2Q8I B;  4IUR A;  2B63 B;  2EQS A;  3I4L A;  4I7A A;  2L11 A;  5AJ3 L;  2MUY A;  3JAM c;  4EQ5 A;  2K01 A;  5A2Q E;  1S40 A;  4X64 L;  1ROD A;  3NSW A;  3HOW H;  2B2V C;  4A3D B;  3M4Y A;  4DNT B;  1SMY D;  5E7N A;  3IRB A;  1SR3 A;  3RLO A;  1HZA A;  2R61 A;  3RR5 A;  2PI2 E;  2EYH A;  2JA9 A;  1G2S A;  4IJL A;  2VQE Q;  1FGB D;  1NMG A;  5M9O A;  5C3W A;  1VCI A;  1SFO B;  3D4W A;  3PMF A;  3JAM E;  3HOU H;  1ZKO A;  1PVO A;  4OO1 G;  3F2U A;  1LTT D;  3PO3 G;  1VQF A;  1BKB A;  2QCP X;  3PIO 3;  1NJI C;  1SJH D;  1EY8 A;  4FP5 D;  2LFN A;  2AQ1 B;  4IJH A;  3SDZ A;  1I6H B;  4BY7 H;  5IT9 c;  1PDQ A;  2PNH A;  4I65 A;  3HG9 A;  1Y69 U;  5G3L F;  1YJ9 A;  4A93 B;  3M3Y B;  2F4V L;  3U58 A;  1DM0 B;  5J3B A;  4LJZ C;  4AYB E;  4HJ9 A;  1VQ8 A;  1N9W A;  2Y0S E;  2JE6 I;  4DK3 C;  4KJN A;  4WOR A;  3GTJ B;  2B2W C;  2LKV A;  4DV7 Q;  2F3V A;  3SGI A;  2PNR C;  1N33 L;  5I4D A;  1CFM A;  3R93 A;  1Q46 A;  2CW0 D;  1SE2 A;  5KYI A;  1PTO H;  1DXM A;  2RVL A;  2E5L Q;  3EVQ A;  2ES2 A;  5JEA J;  1VQA A;  1PTO D;  2K14 A;  3PIO A;  5IP7 H;  1LT5 D;  3GTM H;  3HOV H;  1PRT B;  1MJC A;  3G6E A;  2L0C A;  4ZAI A;  1IKM A;  5ELB A;  2PZU A;  4XT1 B;  1K73 C;  3BU2 A;  1HZC A;  1B7Y B;  4CDE C;  1S5E D;  1HZB A;  1RTO A;  4JI6 Q;  4OON A;  3AB9 A;  4LW1 A;  1G8Z D;  3MZ5 A;  3CPW A;  2UUA Q;  2EIF A;  3BDL A;  2ZJP A;  2FJ2 A;  1HNW L;  1U4P A;  4LUZ A;  2RDH A;  1VQO A;  4GLX A;  1PH3 A;  1SNC A;  4KY6 A;  4LWC A;  2I0Q A;  1RL2 A;  5M5W H;  4GKK L;  3D6C A;  1AP0 A;  3SXH A;  5I9P A;  4EVO A;  3DHQ A;  1MHW C;  1QE6 A;  1EFW A;  1S5B D;  1I4G A;  3TP5 A;  2UXB Q;  1TWH H;  4PMW A;  1VQE A;  3MWY W;  1M90 C;  2IJ0 A;  4IOA A;  2I07 B;  4X3S A;  4JBK A;  4M1U B;  1TS5 A;  4JI8 L;  2EYJ A;  3TN2 A;  2ZM6 Q;  2UXC L;  2E2J B;  2IW3 A;  3OWE B;  5C44 G;  2J7Z A;  5I6Y A;  4DV2 Q;  4JI5 Q;  5IOC A;  3VYS A;  5TSS A;  3H3V I;  1WTH A;  2OF1 A;  3I8Z A;  4A3G B;  3BG3 A;  1EIH A;  2L55 A;  3UDF A;  1U4L A;  1D1I A;  1K28 A;  3MXU A;  3AFQ A;  3H09 A;  5EQ0 A;  4A75 A;  2A6H D;  3PCO B;  2AQ3 B;  1PHJ A;  1UUP A;  3EJI A;  3A0J A;  5K36 G;  4KK7 A;  2I5L X;  2BCO A;  4K14 A;  5FOB B;  3R8B A;  4E6I A;  2EPB A;  3OW2 A;  1V1P A;  4IPH A;  1YNJ D;  3G6J B;  3M4Q A;  1L1O A;  4HSV A;  5E4W C;  1ESR A;  2KUM A;  2JYO A;  2QW7 A;  4OEL B;  1V1P B;  1I4X A;  3CXC A;  3X3M A;  3K5N A;  3I73 A;  2JP1 A;  3OYY A;  1L1O B;  2PZT A;  3GP7 A;  3K58 A;  4BXX G;  1IBM Q;  4DAP A;  2JXM B;  4LK1 C;  1KLU D;  1TT2 A;  3NQT A;  1M4V A;  4A3I G;  3DEO A;  4HJ5 A;  3S2D B;  3LNN A;  3GTL H;  3VA5 A;  1ONL A;  4KI0 A;  1XMQ Q;  2KOL A;  2UUB L;  1FNU A;  1EIG A;  4OWX B;  1JOQ A;  1T9H A;  3MXP A;  4JI3 L;  1XMO Q;  2DNE A;  1VQL A;  3TP8 A;  4LFB Q;  3VDY A;  1CSQ A;  1QVF A;  3HOW B;  3CCM A;  1GUS A;  4DV5 L;  1EQT A;  4DV4 L;  3ND9 A;  1V43 A;  2G9H D;  3UDG A;  1SE3 A;  2LXK A;  4IUQ A;  4ME3 A;  2H4O A;  4X62 L;  2QGQ A;  3D4D A;  2J0T D;  3KJO A;  3P1H A;  2QIL A;  2R7F A;  4NP5 A;  3CQZ H;  4DAY A;  2MHV A;  1YJW A;  1PMR A;  2FHT A;  1SLJ A;  2F0M A;  2EY5 A;  3KDF A;  1QVC A;  4ULL A;  1Y8O B;  1VQC A;  4DAY B;  1ESF A;  5BR8 L;  4IO9 A;  1BO0 A;  3HOW G;  2CHB D;  3CRL C;  3KDF B;  2KJX A;  1XTC D;  1WCM H;  3I55 A;  4C2M H;  2A8V A;  4N8F A;  3OPO A;  3TZU A;  4A76 A;  2F0D A;  4FXD A;  1EYA A;  4LF6 L;  2LMC B;  4YHH Q;  4HIK A;  1JWU D;  1YBY A;  4CDC C;  2RHQ B;  3W2D A;  4BY7 B;  2QEX A;  2N78 A;  2Z6B A;  1SN8 A;  3HOU G;  1MGS A;  1C48 A;  3UDI A;  4BBR G;  4GOP C;  2WII B;  4GN4 B;  3CCE A;  1IBK Q;  3URY A;  4LF4 Q;  1JE5 A;  3GTK H;  3FP9 A;  5DLQ E;  4BY1 B;  4P2C B;  1D5Z C;  1W6K A;  3GD7 A;  4FNF A;  4HJA A;  1B70 B;  2FFK B;  1PTO B;  3Q22 A;  1HNX Q;  3OTO Q;  5KYL A;  1SYG A;  2Q2T A;  2WAQ G;  3A74 A;  1XPO A;  4A3E G;  3R2T A;  2A6E C;  2Z4H A;  4DFA A;  5A2Q L;  1H9J A;  5EKL A;  3GTM B;  5CGK A;  3HOV B;  1U9R A;  2A69 D;  1NMF A;  4WRD A;  3E9H A;  4IUU A;  3I2Z A;  4X65 Q;  4R4I A;  3OIQ A;  1WI5 A;  4LFC L;  2AWN A;  1YNX A;  3NWT A;  1JJG A;  2B2Y C;  1TWC H;  1VS0 A;  3J7A F;  3JAM L;  5FO7 B;  5IP7 G;  1KRT A;  5M5X H;  5K5P A;  5JVH 3;  5IGB A;  4AQY Q;  2K75 A;  3QWN A;  5M5W B;  5CV7 A;  1VF5 C;  1V1O A;  2UUC Q;  1BBU A;  2MFI A;  3K0Y A;  1ZEQ X;  1LYL A;  2RKS A;  3PGZ A;  1TWH B;  4DR5 Q;  4A3B G;  3PF5 A;  4BA1 I;  4RGT A;  4N8X 1;  1VMP A;  2AWO A;  1A3V A;  4DV6 L;  3M4P A;  4Q0F A;  5C4X G;  2H1E A;  1NUC A;  2IX1 A;  3T1Y L;  4B3S Q;  4IFD G;  4DV7 L;  1S72 A;  2EVB A;  1X55 A;  3U9S A;  1LT4 D;  3SK6 A;  4LF5 L;  1A63 A;  4NKL A;  5IT9 L;  3MXG A;  3NTK A;  4KKS A;  1SYB A;  2K05 A;  4DV0 Q;  4PZ7 A;  3EN2 A;  1EU3 A;  2VUM G;  4DV3 Q;  3G48 A;  1PH5 A;  3DM1 A;  5CC4 A;  5ELC A;  2X69 A;  3KOJ A;  1IKL A;  4DK0 A;  1ASZ A;  1R9T B;  2WIN B;  3VR4 A;  2JA7 G;  3S1M B;  4K6D A;  5CV4 A;  1PZK D;  4B9W A;  1OXT A;  4A3C G;  1GUG A;  1RDP D;  1IL8 A;  1Y1W G;  5E4X A;  4OWT B;  4PG3 A;  4YCU A;  3GTQ H;  1WYD A;  2I46 A;  2NN6 G;  1PFS A;  4FXG C;  1SNM A;  2BH2 A;  1J5E Q;  3GTL B;  3KFU A;  2JA6 H;  4UPA A;  1X3G A;  3RLF A;  2B63 H;  2KVM A;  2VL6 A;  4RG1 A;  5BN4 A;  1I94 Q;  2B8F A;  1W3S A;  2B2U C;  5ELE A;  2NB0 A;  3QIA A;  5JJI A;  5IYC H;  2MPM A;  1STA A;  1Q12 A;  3JC6 6;  4DNI A;  1KAW A;  3NBH A;  3HP3 A;  3D0F A;  4MTK A;  2MO1 A;  1U4M A;  3STB C;  2N49 A;  1E3P A;  2R6G A;  4QQB X;  3NBH B;  4RFB A;  4L5S A;  3T13 A;  1O7L A;  2RF4 A;  4UAI A;  3CKI B;  4JI5 L;  2F0H A;  3K0X A;  3TS2 A;  1GD7 A;  5IWA L;  4QB4 A;  1IXR A;  2RHS B;  2JJQ A;  2C5C A;  4F8M A;  1FL0 A;  2KHI A;  4JI2 Q;  1V9P A;  3GTG H;  3AU7 A;  3K8A A;  3BYY B;  4PZ8 A;  1STH A;  1XNR Q;  1WCM B;  4FDB A;  4G57 A;  2ZJQ A;  3I4M G;  2N3S A;  5KRU A;  2VY3 A;  3E5S A;  5EJW A;  4DUY L;  3HKZ B;  5ELO A;  3ULP A;  4FF2 A;  3AYH B;  2L4N A;  2YU9 H;  4JYA Q;  5D3I B;  1SMX A;  4P74 A;  1BCP D;  3WWV A;  4AIM A;  1ILQ A;  4UY8 C;  3E3X A;  2N88 A;  5IGF A;  1Q81 C;  5KGU A;  2QDL A;  3CU7 A;  2R7Z G;  1IBM L;  1B9M A;  5EKI A;  4ABN A;  1WD0 A;  4P71 A;  5CMD A;  1EWH A;  1TII D;  1WCM G;  2ICI A;  1KLG D;  2A68 C;  1VQ9 A;  1SRU A;  3GTK B;  1G6Z A;  5JJZ A;  4O2D A;  5LMN L;  1T5E A;  3U4Z A;  1LTI D;  1XMQ L;  3C3L A;  3W5O A;  4DV1 L;  2RA4 A;  4B9X A;  3KJP A;  1JB7 A;  4EQO A;  3K5O A;  3UE1 A;  4C1N I;  4G7H C;  2NZO A;  3DWQ A;  4KN4 C;  1IBL Q;  4QY7 A;  5JOB A;  5KEE A;  2HHH Q;  3H3V H;  2DJF C;  4QIW E;  1P16 A;  3G4S A;  2I5M X;  3PUY A;  4JI1 Q;  5BN5 A;  4LF9 Q;  2KEE A;  5LMU L;  2MQH A;  4OXP A;  4DK1 A;  1BOS A;  1Z6H A;  2CQO A;  2R93 H;  3ERS X;  1NSN S;  2HDM A;  1P8L A;  4HJ7 A;  1SYE A;  3OSO A;  2FXQ A;  4QJF A;  1TWC B;  4ZLT F;  1Z7T A;  2VQF Q;  4JV5 L;  3HOX G;  4NXM Q;  3KBX A;  1DOM A;  5E3F A;  4UP9 A;  2JQO A;  5M5X B;  3A8K E;  1AE3 A;  3C46 A;  1NR4 A;  4KJO A;  2JA5 H;  1GHJ A;  2SNS A;  1HA6 A;  2AUJ D;  2R92 H;  1EQQ A;  1F2Y A;  3NXW A;  2Z4I A;  4EGV A;  5IOD A;  1D8L A;  4KHZ A;  1X3P A;  4DU9 A;  5FJ8 G;  3PUZ A;  4Y52 H;  2C9O A;  4DUZ Q;  1UWV A;  3NE5 B;  4X3U A;  3MVV A;  2ZTD A;  1CZW A;  3I90 A;  3DEP A;  3Q8D A;  1X65 A;  5IYB G;  4XYO A;  1QUQ A;  1KHI A;  3EA6 A;  5LL6 X;  3B6Y A;  1WJJ A;  2BA0 A;  1QUQ B;  3ITP A;  2QA4 A;  4JI4 L;  4B3R L;  2RDF A;  1HUN A;  5C0X G;  1A0I A;  2XNA C;  4H0L C;  2JEA I;  4DR4 Q;  1F9R A;  1EEI D;  1NE3 A;  1TY0 A;  3A5Z B;  4LUO A;  3NK9 A;  1JOO A;  4HR7 B;  1FNW A;  3J7Y W;  3MXN A;  3TS0 A;  4CDD C;  4FF4 A;  1CI3 M;  1EYD A;  3MXN B;  1K83 H;  1K8G A;  4KV6 A;  2KCC A;  1CK1 A;  3J81 j;  2OTL A;  2SEB D;  1TS3 A;  4L8J A;  3GTQ B;  1EQV A;  1FD7 D;  1LV9 A;  1I50 H;  1SYD A;  2F0I A;  3J80 c;  3HOZ G;  2OT2 A;  5CYU A;  5C5L A;  3HS0 C;  3ZYY X;  2F4I A;  1GOZ A;  5C3X A;  4B08 A;  2JA6 B;  4XYQ A;  2GVA A;  1BDO A;  5GAH C;  2UUC L;  3D8G A;  2NVX H;  2XIW A;  4YY3 Q;  1MJE A;  1HXY D;  4NMZ A;  5M3F G;  1GUN A;  4FVM A;  3U9O A;  3T1H Q;  1HR0 Q;  3GQB A;  3ER0 A;  2YTY A;  4PV1 C;  2V1C C;  2NVQ H;  1TWG B;  1VQ7 A;  1CKO A;  2K28 A;  5EPL A;  3D3R A;  3R2I A;  5I2Y A;  1TVX A;  1HPC A;  2D62 A;  5GRO A;  1OXU A;  1XNQ Q;  3KYH C;  2XWB B;  1ICF B;  2B63 G;  2MGS A;  3PF4 A;  5GQO A;  2BE5 C;  1VQG A;  2BH8 A;  5FK9 C;  3P7J A;  5IYC G;  1C9O A;  4A3D G;  5IGG A;  3UDX A;  3Q0A A;  4C3J H;  3A55 A;  3FRP B;  2A5H A;  2F3I A;  3GTG B;  3BVM A;  3K59 A;  4OWW B;  4DV0 L;  1IL2 A;  2XGT A;  4BWG B;  1A2U A;  1JCK B;  3L2P A;  4DV3 L;  3RNU A;  1BCP B;  2B39 A;  3V2T A;  2HUG A;  5KND A;  1Q1B A;  1ET9 A;  4CGY B;  4AYB B;  1KDC A;  2YU9 B;  3C1F A;  4K0K L;  5I2X A;  4GZY C;  4P75 A;  2PO4 A;  1Y8P B;  1EWI A;  1BBW A;  4F7X A;  3CC2 A;  4LF8 Q;  3IFT A;  4A3M H;  5C4J H;  3HFZ B;  4BY1 H;  1FR3 A;  2XWJ B;  1UAP A;  2O5J C;  3RZD H;  4R4Q A;  4HAE A;  1TWA B;  2F52 A;  4A3J B;  4JI7 Q;  1TU2 B;  5IT9 E;  3MFY A;  1D5X C;  4MTN A;  3BVG A;  3HEJ A;  3IAY A;  2K33 A;  4A93 G;  1VQP A;  1L0X B;  4DXG A;  1F2Z A;  2F0T A;  4DR1 Q;  3CP0 A;  3L9A X;  4RKL A;  4IUT A;  1LT3 D;  2E75 C;  1B2T A;  2K03 A;  3NPP A;  5JEA H;  4OO1 I;  2Z6K A;  3T53 B;  4K8I A;  4LF7 Q;  3KLS X;  1KNE A;  2R93 B;  2R7D A;  2K04 A;  3BJU A;  3K7A B;  1Q8I A;  5CBE E;  3MAQ A;  1L1O C;  1F9S A;  1AZQ A;  3PO2 B;  4POG A;  4JK1 C;  1LO5 D;  3TQY A;  3I4N H;  5EAY A;  2CKZ B;  3D6W A;  2BDO A;  4GNX A;  1X6O A;  2JA5 B;  2NBF A;  2EE1 A;  1Q3L A;  5T1G A;  2UU9 L;  2R92 B;  4GNX B;  1RCV D;  1RJT A;  4WJ4 A;  1X54 A;  1TWF B;  3FVQ A;  5M3M H;  2EY1 A;  5DAU A;  4RKB A;  3FEW X;  4UP8 A;  1K8A C;  4DR6 L;  4H7B A;  1IYJ B;  2L15 A;  4NPS A;  4DKA C;  3SE0 A;  3C2P A;  1SSO A;  2K32 A;  3MHB A;  2UXD Q;  3GV6 A;  2I5H A;  4A3F H;  1KDB A;  2DN8 A;  3NP8 A;  1KC8 C;  2OXP A;  4YWL A;  2L1B A;  2CVR A;  2AUK A;  4ZK9 B;  4GN5 A;  1IW7 C;  1U4R A;  4J8Q A;  1TS2 A;  3E6Z X;  2IWH A;  4IPC A;  1AE2 A;  3PUW A;  2HQL A;  4KHP L;  1VQK A;  1SYF A;  3DXJ C;  5I9O A;  4BBS H;  1FNV A;  3OMG A;  5AFW A;  2HDL A;  2IX3 A;  4C3I B;  3ULL A;  3I72 A;  1R9T H;  3GTP H;  4NXN L;  1I6V C;  4A3G G;  3S1M H;  2AQ2 B;  1E0B A;  4LF9 L;  1K83 B;  1QIL A;  3KF6 B;  1KDA A;  2XRS D;  1JOR A;  4XTC S;  5FLX L;  4DGZ A;  5J22 A;  2EDG A;  3EIV A;  3QO2 A;  2DGY A;  2A6E D;  1WOC A;  3S24 A;  1LTS D;  1I4H A;  1RHP A;  2VQF L;  4NDX A;  1I50 B;  2CH4 A;  1BBX C;  1S4Z A;  2A19 A;  2VB3 X;  2HD3 A;  2CW0 C;  5G3L D;  4YWM A;  3H94 A;  1CA5 A;  1BF4 A;  2XN9 C;  3VR2 A;  5IP9 H;  4GKJ L;  3CMA A;  2NVX B;  1LAC A;  3FHW A;  1PYW D;  2PMZ E;  2ATW A;  2F1M A;  3VR5 A;  1DD2 A;  1PTO C;  4A3L H;  2WV6 D;  1EWC A;  2Q2H A;  2MO0 A;  4DUZ L;  2NVQ B;  1FGU A;  2K5H A;  3SK4 A;  5C3E H;  3V05 A;  1EY0 A;  3K80 C;  1HNZ L;  3CCV A;  1VMC A;  2E2D C;  2MP1 A;  5CV5 A;  2F0W A;  5ELF A;  1J8I A;  3H91 A;  3I56 A;  5EGT A;  4K8J A;  3K81 C;  1S5C D;  3RD4 A;  3U50 C;  4C3J B;  4DR4 L;  2HCI A;  1H9M A;  2G5D A;  4A3K H;  1VQH A;  4QF4 A;  1NY4 A;  1R4P B;  2N8N A;  1PA6 A;  1HH2 P;  2OCE A;  4OX9 L;  3K57 A;  2ZXR A;  1O78 A;  1G29 1;  1EEF D;  4CHT B;  4K2L A;  2EYO A;  3I91 A;  4ZKB B;  1SNO A;  5EKK A;  1ENA A;  1A2T A;  5FKA C;  2J4X A;  4KLK A;  4O42 A;  2Q2I A;  4DAV A;  3AEV A;  2RSN A;  4LFA L;  3J7A V;  1AN8 A;  4ILW A;  1VQB A;  4A3M B;  5C4J B;  4FXK C;  3OHX C;  2F0U A;  4ZKC B;  1B8A A;  4O1N A;  5CV8 A;  4R1J A;  1QVG A;  4X66 L;  3RZD B;  4BY7 G;  3TP7 A;  2OWO A;  4S3S A;  2HT1 A;  3QB3 A;  1YHA A;  1DGS A;  3T1H L;  5T1I A;  1WD1 A;  1S3O A;  5COR A;  3J81 i;  2WAQ E;  4BY1 G;  3J80 L;  1CKN A;  1XXG A;  1A15 A;  4TKO B;  1J6Q A;  1D7Q A;  4GS3 A;  1JT8 A;  1QOH A;  1CKN B;  2NYZ D;  4HMJ A;  4IUN A;  3BZD B;  2VQE L;  2MJ8 A;  4ZUI A;  1X3E A;  3J81 c;  2K6A A;  1WTQ A;  3M7G A;  2PZW A;  2XRQ D;  1ET6 A;  4K6L A;  1K8O A;  3I4N B;  3HOV G;  3QOJ A;  1XTD A;  1SEB D;  2RQX A;  3H15 A;  4EQN A;  2X6L A;  4KKT A;  2JA8 H;  1HCZ A;  4FO2 A;  1II3 A;  5JEA G;  1MKH A;  3O13 A;  1DCZ A;  1LT6 D;  4HIO A;  3M4O B;  2N55 A;  2B29 A;  4G7O C;  2D9U A;  2K5N A;  5HUR A;  3RZO H;  5M3M B;  1G91 A;  1HTP A;  3J81 E;  3AFP A;  4NW2 A;  4HCS A;  4DR2 Q;  1O7Y A;  1EIY B;  4CBV A;  4PMC A;  4JI0 Q;  5JAV A;  3W1B A;  2EZV A;  3HKS A;  1EY6 A;  3CRK C;  4MHE A;  5JPM C;  3F2B A;  4C56 C;  1HUM A;  2WB1 B;  1B9N A;  5LL6 S;  1I3Q H;  4A3F B;  4KKU A;  4ODG A;  4UHV A;  1JE4 A;  3CCU A;  1X56 A;  2E5L L;  2F0O A;  1FJG Q;  5IYD H;  1QWY A;  3CHB D;  4JOI A;  1VQD A;  5I6W A;  4BBS B;  4OGQ C;  1E2W A;  2B2T A;  1I4Q A;  3GTP B;  1PH8 A;  1YNN D;  1LTL A;  4DN4 M;  4KY5 A;  4GLA C;  2RCN A;  5J39 A;  3P20 A;  1PRT F;  1YIT A;  3ERQ A;  1D1K A;  2BOS A;  4JI6 L;  1VDZ A;  1PV4 A;  1EZ8 A;  3IL8 A;  3S1N B;  2UUA L;  3PV0 A;  3TZD A;  1K9M C;  1N32 Q;  2CH4 W;  4KD3 A;  4BBS G;  1R4Q B;  4MZ9 A;  4QGU A;  3ND8 A;  3KLR A;  1N36 Q;  5C4Z A;  2KHJ A;  1EY9 A;  2OQK A;  4HIM A;  4J1M A;  5EBD A;  1XWE A;  3NTI A;  1N34 Q;  2F4V Q;  1RKN A;  4DNR B;  4IFD I;  1MBY A;  4O0A A;  2UXB L;  4Y7N H;  2K5W A;  3K6O A;  1TWG H;  1UE1 A;  2F0E A;  3K7U C;  2F0N A;  1N33 Q;  2HIX A;  3EQL C;  2ZXP A;  3NUC A;  5IIF A;  5C3E B;  2ZM6 L;  1KD1 C;  1DYQ A;  4DV2 L;  2WKD A;  4FYD A;  1F77 A;  2UXD L;  1PXU A;  5IP9 G;  3MEF A;  4POF A;  5JJK A;  4N9T A;  3HOY B;  5H1S E;  3VYR A;  3HZX A;  3S17 H;  4A3L G;  1YI2 A;  1GUO A;  1C8C A;  1JMC A;  1C0A A;  2PQE A;  4A3K B;  4MN3 A;  2NN6 I;  3PUX A;  1Q90 A;  4RCN A;  1UEA B;  1ENF A;  3L3O C;  2DNC A;  3N52 A;  4K5W A;  1OXS C;  2H5X A;  3H0G B;  2ZTE A;  4JBW A;  2IX0 A;  1WTO A;  2CQA A;  5GAG C;  1LTA D;  3PIP A;  5ISR A;  3S2H H;  4K5X A;  4JBJ A;  3SR1 A;  2OQ0 A;  3NEL A;  4KTA A;  1ML0 D;  2L9H A;  4GKK Q;  1Y14 B;  3GDE A;  4J15 A;  3FPP A;  1Y8N B;  2GN5 A;  3MEH A;  5JPN C;  1EU4 A;  2M00 A;  3TME A;  2FIN B;  4HTH A;  3GV3 A;  2NVT H;  3HKZ G;  1TWA H;  4A3J H;  5FLX c;  3ICE A;  2BA1 A;  2PW7 A;  5HGT A;  1EYC A;  1SNP A;  1CTM A;  2KCM A;  2AMC B;  1XMO L;  2UXC Q;  4LFB L;  1SNQ A;  3CCJ A;  1CSP A;  2ALY B;  2K7V A;  2KEN A;  1W6J A;  1PH6 A;  1HA5 A;  1EUJ A;  4X3K A;  3K5L A;  1L2F A;  4IN3 A;  1TS4 A;  5FLX E;  1HRJ A;  3S15 H;  4ME5 A;  3K7A H;  2Q8T A;  4ALP A;  1HJP A;  3PO2 H;  2F0L A;  1OO9 B;  5FLM H;  1YVC A;  4L5R C;  1VQM A;  3FKI H;  2Z9H A;  2G9D A;  3KUP A;  4V0B A;  2KED A;  2JA8 B;  2PYK A;  1I4R A;  1AEX A;  1LTR D;  1TWF H;  4XQN A;  4WJW A;  4YHH L;  3AMU A;  3RZO B;  1B53 A;  1PLF A;  2XSC A;  4CJ0 B;  3S1R H;  2KBN A;  2EY6 A;  5C44 H;  4ZUJ A;  1PH9 A;  1F2L A;  3KK7 A;  1QNK A;  4CKE A;  2UUB Q; 
#chains in the Genus database with same CATH homology
 4EX5 A;  3CP0 A;  1PH7 A;  1E7Z A;  1IBK L;  2JA8 G;  3HOW G;  4JI3 Q;  1K0R A;  4LF4 L;  3KDF B;  2ZJR A;  4GN3 B;  2IHF A;  5M3F H;  3RN5 A;  1E1O A;  4DAM A;  4OO1 I;  1WCM H;  2Z6K A;  3I55 A;  1U5K A;  3CCR A;  4C2M H;  1UE5 A;  2A8V A;  4LF7 Q;  4DV5 Q;  2WFW A;  2AHO B;  4A76 A;  4DV4 Q;  1H95 A;  4APV A;  2R7D A;  1O7I A;  4DR7 Q;  1HNX L;  4UP7 A;  3OTO L;  4LF6 L;  1HZ9 A;  3BJU A;  1CKM A;  4YHH Q;  4HIK A;  1XPU A;  1GM5 A;  1YBY A;  5IY0 A;  1L1O C;  2RHQ B;  4IPG A;  2QEX A;  3S14 H;  2N78 A;  1OXX K;  4POG A;  1SN8 A;  3TQY A;  4C3I H;  3I4N H;  4TVA B;  1Q7Y C;  3HOU G;  4BA2 I;  5EAY A;  3UDI A;  3J80 i;  1YEZ A;  2CKZ B;  4BBR G;  5M5Y H;  2XTI A;  4GOP C;  5BR8 Q;  4GNX A;  1X6O A;  4A3D H;  4X65 L;  3CCE A;  4GN4 B;  1FVI A;  1IBK Q;  1Z47 A;  2C35 B;  4BXX H;  4LF4 Q;  1BVS A;  1JE5 A;  3GTK H;  3FP9 A;  5DLQ E;  2UU9 L;  1K3R A;  3GD7 A;  4GNX B;  3G71 A;  3PO3 H;  4WJ4 A;  4HJA A;  1X54 A;  5M3M H;  4A3I H;  2VW9 A;  1B70 B;  4JCV E;  5IYD G;  4C3H H;  5C3E G;  1HNX Q;  3OTO Q;  4LF6 Q;  4P72 A;  4UP8 A;  3J7Z C;  1VQJ A;  3BZC A;  1SFO H;  2WAQ G;  3A74 A;  4AQY L;  2GVB A;  1XPO A;  4A3E G;  1K8A C;  2Q2T A;  4DR6 L;  1HNW Q;  1MIU A;  1IYJ B;  2L15 A;  4DR3 Q;  2PI2 A;  4NPS A;  4DKA C;  3HOY G;  1EOV A;  1Z9F A;  2UXD Q;  2KCT A;  2E8G A;  2I5H A;  1NMF A;  4A3F H;  3E9H A;  1YZ6 A;  2Z0S A;  3I2Z A;  4X65 Q;  1KC8 C;  1PH2 A;  2VS1 A;  2JEB I;  4R4I A;  1WI5 A;  2PQA A;  4YWL A;  4LFC L;  1EQR A;  3W1G A;  1RIP A;  4DR5 L;  4GN5 A;  4A3K G;  1YJN A;  5C0X I;  2AWN A;  1YNX A;  2UU9 Q;  4GLV B;  1I6H H;  2A1A A;  3CC4 A;  1JJG A;  2PQA B;  4IPC A;  1TWC H;  1AE2 A;  3H0G G;  3PUW A;  1VS0 A;  1A8V A;  2HQL A;  4KHP L;  2JA6 G;  1VQK A;  1GVP A;  2JK8 A;  4BBS H;  4A93 H;  3M3Y H;  5IP7 G;  1KRT A;  1EIF A;  5M5X H;  4AQY Q;  3ULL A;  1R9T H;  2K75 A;  3HKZ E;  4NXN L;  4JI8 Q;  2IT1 A;  3NEN A;  4B3S L;  3GTP H;  4A3G G;  3S1M H;  4DR6 Q;  5GAE C;  4LF9 L;  2Z6K C;  2UUC Q;  1BBU A;  2K52 A;  3GTJ H;  2MFI A;  3KF6 B;  1X9N A;  4JC0 A;  4XTC S;  1Q86 C;  2LSS A;  4R4C A;  4WJ3 M;  3EIV A;  1LYL A;  1FJG L;  3PGZ A;  4LFC Q;  1VQI A;  2YTV A;  2YTX A;  2DGY A;  4DR5 Q;  3PF5 A;  5ELN A;  1WOC A;  3S24 A;  4BA1 I;  4A3B G;  2VQF L;  1W2B A;  4YCW A;  2CCZ A;  4LUV A;  2OTJ A;  2AWO A;  2A19 A;  1UEB A;  1UE7 A;  4DV6 L;  4KHP Q;  3M4P A;  5C4X G;  4YWM A;  4GNX C;  1UE6 A;  4A4I A;  2IX1 A;  5IP9 H;  3T1Y L;  1XJV A;  3CMA A;  4BBR H;  4B3S Q;  4IPD A;  5IE8 A;  4NXN Q;  3FHW A;  4IFD G;  2PMZ E;  4DV7 L;  1S72 A;  2ATW A;  2NZH A;  1X55 A;  4A3L H;  4YCV A;  4LF5 L;  2VZA A;  1A63 A;  2Q2H A;  2MO0 A;  4DUZ L;  3UE0 A;  4IOC A;  1N32 L;  3M9B A;  1FGU A;  2K5H A;  4DV0 Q;  4PZ7 A;  3EN2 A;  4L5Q A;  1J5E L;  3CME A;  4AYB G;  5C3E H;  2VUM G;  3K80 C;  1HNZ L;  4DV3 Q;  1N36 L;  3G48 A;  3CCV A;  2Y0S G;  3J7A 5;  5JJL A;  1PH5 A;  1VQ5 A;  1OTC A;  3I4O A;  3KOJ A;  4A3E H;  1I94 L;  4DV6 Q;  1N34 L;  1SRO A;  1ASZ A;  3TRZ A;  1A62 A;  2K50 A;  2JA7 G;  1OXV A;  1QZH A;  1N8R C;  4GKJ L;  3T1Y Q;  3I56 A;  4GKJ Q;  1OXT A;  2CWP A;  3K81 C;  4A3C G;  3U50 C;  4DR4 L;  1Y1W G;  4OWT B;  4PG3 A;  1GO3 E;  4YCU A;  4LF5 Q;  4JBM A;  4A3K H;  3GTQ H;  1VQH A;  1WYD A;  3TRE A;  2NN6 G;  2Q2U A;  1NY4 A;  2N8N A;  1PFS A;  4A3J G;  1PA6 A;  3E9I A;  1HH2 P;  2OCE A;  4DK6 C;  4OX9 L;  2BH2 A;  4B3M Q;  1J5E Q;  3KFU A;  3L0O A;  1V1Q A;  2ZTC A;  1G29 1;  1G51 A;  4UPA A;  1PH4 A;  1X3G A;  1HNZ Q;  2E2J H;  2JA6 H;  4X62 Q;  3RLF A;  4B3T Q;  3RLN A;  1YHQ A;  2B63 H;  2VL6 A;  4RG1 A;  1I94 Q;  4KLK A;  4A3G H;  1W3S A;  3EBE A;  3DM3 A;  2Q2I A;  3S16 H;  4JI2 L;  3AEV A;  5JJI A;  5IYC H;  4LFA L;  1Q12 A;  3I7F A;  1XNR L;  3JC6 6;  1VQB A;  4DNI A;  1KAW A;  1KIX A;  3M4O H;  2HIV A;  3F8T A;  4NB3 A;  5HGQ A;  3D0F A;  2R93 G;  1Y1V G;  2MO1 A;  4A3B H;  1B8A A;  3STB C;  1QVG A;  2N49 A;  1E3P A;  2R6G A;  4R1J A;  3NBH B;  4X66 L;  4L5S A;  4QQB X;  1PH1 A;  2VNU D;  2NVY H;  4JYA L;  4BY7 G;  2RF4 A;  1C7Y A;  1YHB A;  3PO2 G;  2K5V A;  2OWO A;  4IFD J;  4OX9 Q;  2HT1 A;  4JI5 L;  1VQ6 A;  5FLM G;  2B3G A;  2ASB A;  3K0X A;  3TS2 A;  1GD7 A;  5C4X H;  5IWA L;  1ASY A;  2IY5 B;  1Q82 C;  1IXR A;  4YWK A;  3FKI G;  1YHA A;  2RHS B;  1DGS A;  3CCQ A;  3T1H L;  3GTO H;  2JJQ A;  1FL0 A;  2YYZ A;  2JA5 G;  1S3O A;  3J81 i;  2AKW B;  2KHI A;  1V9P A;  2WAQ E;  4JI2 Q;  3GTG H;  4BY1 G;  2WP8 J;  1CKN A;  3K8A A;  4MNO A;  4PZ8 A;  4LFA Q;  2R92 G;  1XNR Q;  4FDB A;  2LXJ A;  3E0E A;  3PUV A;  1J6Q A;  2ZJQ A;  2N3S A;  3NEM A;  2VY3 A;  4GS3 A;  3I4M G;  1D7Q A;  3JAM i;  4DR1 Q;  1JT8 A;  4RMF A;  3S2D H;  4DR2 L;  1CKN B;  4DUY L;  1M1K C;  5GAD C;  5ELO A;  3ULP A;  2VQE L;  3GO5 A;  2VUM H;  3AYH B;  2E2H H;  4X66 Q;  2YU9 H;  1U0L A;  1IBL L;  1X3E A;  3J81 c;  3WWV A;  1SMX A;  4P74 A;  4AIM A;  2HHH L;  3CCL A;  4JYA Q;  1JJ2 A;  3BZK A;  4UY8 C;  1HR0 W;  2MNA A;  1Q81 C;  2EQS A;  1PYB A;  4JI1 L;  1GKH A;  3KF6 A;  5IWA Q;  1XTD A;  2JA7 H;  3HOV G;  2R7Z G;  5AJ3 L;  3JAM c;  3H15 A;  1IBM L;  4EQ5 A;  1S40 A;  2JA8 H;  4X64 L;  3HOW H;  4P71 A;  5JEA G;  4A3C H;  1WCM G;  1MKH A;  3KLW A;  1Y1W H;  4HIO A;  1VQ9 A;  1SRU A;  5E7N A;  3ULJ A;  3IRB A;  2B29 A;  1SR3 A;  3M85 A;  3S1N H;  2D0O A;  3RLO A;  4O2D A;  1HZA A;  5LMN L;  3TEH B;  4HID A;  3RR5 A;  2PI2 E;  2K5N A;  3U4Z A;  1XMQ L;  3RZO H;  2JA9 A;  3W5O A;  4AH6 A;  4DV1 L;  3AFP A;  4DUY Q;  3KJP A;  4DR2 Q;  4IJL A;  4NXM L;  1JB7 A;  2VQE Q;  3UE1 A;  1NMG A;  2NZO A;  1VCI A;  1EIY B;  4JI0 Q;  1IBL Q;  4QY7 A;  4HJ8 A;  2HHH Q;  3H3V H;  3W1B A;  3HKS A;  4QIW E;  1P16 A;  3HOU H;  3F2B A;  3G4S A;  2I5M X;  3PUY A;  4JI1 Q;  1PVO A;  1I3Q H;  4OO1 G;  4LF9 Q;  5LMU L;  2MQH A;  4OXP A;  3PO3 G;  1VQF A;  1BKB A;  3CCU A;  2CQO A;  2R93 H;  1X56 A;  3F2D A;  1NJI C;  4R4O A;  3ERS X;  2E5L L;  4IJH A;  1P8L A;  5LMN Q;  1FJG Q;  4HJ7 A;  1Q1E A;  3M7N A;  5IYD H;  2FXQ A;  4QJF A;  4BY7 H;  5IT9 c;  2VQF Q;  4JV5 L;  3HOX G;  4DV1 Q;  2PNH A;  4JOI A;  1VQD A;  4NXM Q;  1YJ9 A;  3PSI A;  4UP9 A;  2JQO A;  2F4V L;  3U58 A;  5J3B A;  1NTG A;  4AYB E;  3A5U A;  1PH8 A;  3HOY H;  4HJ9 A;  1LTL A;  1VQ8 A;  1AE3 A;  1N9W A;  2Y0S E;  2JE6 I;  2JA5 H;  4GLA C;  4DK3 C;  2RCN A;  1YIT A;  2ID0 A;  4DV7 Q;  2R92 H;  3SGI A;  1EQQ A;  1N33 L;  5LMU Q;  4JI6 L;  2CWA A;  1PV4 A;  3ZJY C;  4QL5 A;  1D8L A;  1WFQ A;  3I4M H;  4DR7 L;  1EYG A;  1Q46 A;  1CUK A;  4KHZ A;  5FJ8 G;  2UUA L;  3PUZ A;  4Y52 H;  4DUZ Q;  3F2C A;  3PV0 A;  1K9M C;  1UWV A;  2E5L Q;  1N32 Q;  3H0G H;  2ES2 A;  4BBS G;  4MZ9 A;  2ZTD A;  4QGU A;  4JV5 Q;  5JEA J;  1N36 Q;  1VQA A;  3Q8D A;  1X65 A;  2K14 A;  2KHJ A;  3F1Z A;  1QUQ A;  1KHI A;  5IP7 H;  5IYB G;  3PIO A;  2OQK A;  3GTM H;  4HIM A;  3HOV H;  1LM0 A;  1N34 Q;  2R7Z H;  3B6Y A;  1WJJ A;  1E1T A;  1SE8 A;  2F4V Q;  2BA0 A;  1MJC A;  3G6E A;  4IFD I;  1QUQ B;  1VQN A;  2QA4 A;  4JI4 L;  4O0A A;  4B3R L;  4Y7N H;  2UXB L;  1XPR A;  1K73 C;  5C0X G;  1HZC A;  1A0I A;  1B7Y B;  1TWG H;  1UE1 A;  3BU2 A;  3K7U C;  1N33 Q;  2JEA I;  2HIX A;  4DR4 Q;  4X6A H;  1HZB A;  1NE3 A;  4JI6 Q;  4DPG A;  3RN2 A;  3A5Z B;  4OON A;  4LUO A;  4LW1 A;  3CPW A;  2UUA Q;  2EIF A;  2ZM6 L;  2ZJP A;  1KD1 C;  1HNW L;  3CW2 C;  3KF8 B;  4LUZ A;  1VQO A;  4DV2 L;  4DR3 L;  4GLX A;  3TS0 A;  1PH3 A;  1IZ6 A;  2UXD L;  4LWC A;  2I0Q A;  1RL2 A;  4YY3 L;  5M5W H;  5IP9 G;  3MEF A;  4GKK L;  4POF A;  5JJK A;  5HY6 A;  3CF5 A;  3MXN B;  1K83 H;  5H1S E;  2D0P A;  1HR0 L;  3CD6 A;  1K8G A;  3S17 H;  4A3L G;  1YI2 A;  4A3M G;  1EFW A;  1KRS A;  3J81 j;  4R4T A;  4JG2 A;  1JMC A;  4JI4 Q;  2OTL A;  1C0A A;  4B3R Q;  1TWH H;  4PMW A;  2UXB Q;  1JJC B;  1VQE A;  3J80 c;  1I50 H;  2NN6 I;  1M90 C;  3PUX A;  3HOZ G;  4JOI C;  1XNQ L;  4IOA A;  1QZG A;  4JBK A;  1OXS C;  2H5X A;  2ZTE A;  4JBW A;  3HOX H;  4JI8 L;  2ZM6 Q;  2IX0 A;  2UXC L;  5GAG C;  1KXL A;  5C44 G;  2GVA A;  1E24 A;  1TXY A;  3PIP A;  3S2H H;  4DV2 Q;  4JI5 Q;  4JBJ A;  3DLL A;  5GAH C;  2UUC L;  3H3V I;  1KQS A;  2OQ0 A;  3NEL A;  2NVX H;  4YY3 Q;  3S1Q H;  4GKK Q;  3U4V A;  1Y14 B;  1PYS B;  1MJE A;  3STB D;  4P73 A;  3UDF A;  3GDE A;  4J15 A;  5M3F G;  3T1H Q;  1LUZ A;  1HR0 Q;  2GN5 A;  2K4K A;  4JI0 L;  3ER0 A;  3AFQ A;  2YTY A;  4A75 A;  2V1C C;  3PCO B;  2NVQ H;  2CFM A;  1YIJ A;  1PHJ A;  1VQ7 A;  1CKO A;  3A0J A;  5K36 G;  2NVT H;  1AH9 A;  3HKZ G;  5FJ8 H;  1TWA H;  2I5L X;  4A3J H;  5FLX c;  2D62 A;  3ICE A;  5GRO A;  1OXU A;  1G6P A;  2BA1 A;  1XNQ Q;  3KYH C;  3OW2 A;  3AQQ A;  4IPH A;  2YV5 A;  2B63 G;  2KCM A;  3PF4 A;  2AMC B;  3M4Q A;  3I4N G;  1XMO L;  1L1O A;  5IYB H;  5GQO A;  2UXC Q;  1VQG A;  2BH8 A;  5C0X J;  4LFB L;  3CCJ A;  1CSP A;  2ALY B;  3L7Z C;  4LF8 L;  2KEN A;  1PH6 A;  3CXC A;  5IYC G;  1C9O A;  1EUJ A;  2DUD A;  2EXD A;  3CAM A;  3D31 A;  1L1O B;  3OYY A;  4A3D G;  3UDX A;  4C3J H;  5AJ3 Q;  4L5T A;  3CCS A;  1NBW A;  1IBM Q;  4BXX G;  2F3I A;  1L2F A;  1Q8K A;  3LGJ A;  4X64 Q;  4GOP A;  4OWW B;  4DV0 L;  1IL2 A;  2XGT A;  1X3F A;  5M3M G;  4A3I G;  4JI7 L;  3L2P A;  4DV3 L;  3CPF A;  1Y1V H;  2E2I H;  4GOP B;  3RNU A;  3S15 H;  4HJ5 A;  3K7A H;  3GTL H;  4ALP A;  4LNQ A;  1Q1B A;  1HJP A;  4KI0 A;  1XMQ Q;  3PO2 H;  4K0K L;  4PZ6 A;  2UUB L;  5FLM H;  1YVC A;  1VQ4 A;  4P75 A;  4DR1 L;  4OWX B;  3CC7 A;  4L5R C;  1VQM A;  1T9H A;  4H02 A;  2WB1 G;  4JI3 L;  1EWI A;  3FKI H;  1XMO Q;  1VQL A;  1BBW A;  4LFB Q;  4TQU S;  5LMN W;  4A3F G;  3VDY A;  3CC2 A;  4LF8 Q;  1CSQ A;  1QVF A;  1KL9 A;  4A3M H;  5C4J H;  3CCM A;  3HFZ B;  4LF7 L;  4DV5 L;  4BY1 H;  4DV4 L;  2WB1 E;  1V43 A;  1I5F A;  1L0W A;  3UDG A;  1TWF H;  4B3M L;  2LXK A;  4YHH L;  4XIG S;  3RZD H;  4R4Q A;  2F52 A;  3HOZ H;  4JI7 Q;  4ME3 A;  4X62 L;  2QGQ A;  1E22 A;  3KJO A;  4B3T L;  3S1R H;  4MTN A;  2R7F A;  1YJW A;  3CQZ H;  2KBN A;  4A93 G;  1VQP A;  5C44 H;  2IHE A;  1PH9 A;  1SLJ A;  4K0K Q;  3KDF A;  2UUB Q;  1QVC A;  1VQC A;  4DAY B;  5BR8 L;  4IO9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...