4GOPA

Structure and conformational change of a replication protein a heterotrimer bound to ssdna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
112
structure length
108
Chain Sequence
MEKPTPLINSSMLGQYVGQTVRIVGKVHKVTGNTLLMQTSDLGNVEIAMTPDSDVSSSTFVEVTGKVSDAGSSFQANQIREFTTVDVDLTLVENVVQISAAFPNLFSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and conformational change of a replication protein A heterotrimer bound to ssDNA.
pubmed doi rcsb
source organism Ustilago maydis
molecule tags Dna binding protein/dna
molecule keywords Putative uncharacterized protein
total genus 22
structure length 108
sequence length 112
chains with identical sequence X
ec nomenclature
pdb deposition date 2012-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gopA00
2PI2A 4R1JA 1EUJA 1CKNB 2NZHA 4YHHL 3OTOL 5LMNW 3E0EA 4YWMA 1X54A 3JAMi 3T1YL 1FJGL 2UXBL 2UXDL 4LF9L 5FLXc 4GN4B 2WAQG 1YJNA 1VQEA 1X6OA 2ZJQA 5IT9c 4A3IG 1FGUA 2C35B 4LF7L 4GKKQ 4YWKA 3RR5A 1PV4A 4QL5A 4DV1Q 4UPAA 1QZHA 3BZCA 1G51A 4UP8A 4B3SL 3PF5A 3CMAA 1PH7A 4A3EH 1VQBA 3KF6A 4BY1H 3GTPH 1N33Q 2JJQA 4OXPA 4X62L 2VQFQ 3HOYH 1UE7A 2B3GA 2ZJRA 1I6HH 1K73C 2F3IA 4A3EG 2IHEA 3PIPA 1IBKQ 4JI2L 2CCZA 1FL0A 2PI2E 3L0OA 1K3RA 4DAMA 2JA7G 4K0KQ 3PUZA 3IRBA 2N49A 3STBC 3I55A 3TEHB 3U58A 3A0JA 1YHQA 1IL2A 2GVAA 5M5XH 3HOXG 1WOCA 4X64L 3PF4A 4BBSH 3S2HH 4IJLA 4X62Q 5GQOA 1EYGA 1D7QA 1CSPA 3CC4A 5C3EG 1E1OA 1EQRA 2VQEQ 2UXCL 2A8VA 1XPOA 4A3LG 5JJKA 4GKJQ 3NELA 4R4TA 3U4VA 4JOIC 1EOVA 4DR4Q 4LF7Q 3S1QH 4JI5L 3HKZG 4KHPQ 2HIVA 2F4VL 4DV0Q 3F2DA 4J15A 1XPRA 2JA5G 3AEVA 4LFAL 1E3PA 3Q8DA 1K8GA 2B63H 2EXDA 4H02A 2VUMG 1HNWL 3K81C 1VQHA 3I4MH 1W2BA 1YVCA 1N36Q 4ME3A 1M90C 4B3MQ 4LW1A 2UUCL 5IWAQ 1JT8A 2AHOB 1VQFA 2F4VQ 1V1QA 4OO1G 1N33L 2EIFA 2LXKA 3RLFA 1G291 1OXSC 3L7ZC 4JG2A 4YY3Q 2UXCQ 3LGJA 3S2DH 1LUZA 3M3YH 1WCMG 3VDYA 4QJFA 4NB3A 1DGSA 1X55A 4UP9A 4BY7H 1PA6A 3KLWA 4YWLA 3EIVA 3JC66 3TS0A 3FKIH 3ICEA 1PH4A 1BVSA 1E22A 5M3FH 2K5HA 1SN8A 2NVYH 1PH5A 2Q2HA 4R4IA 5C0XI 4LWCA 4DAYB 4DV6L 4GOPA 2ES2A 4X66Q 4A3CG 4HIMA 5IYBH 2OQKA 3J7ZC 1X3FA 2K52A 4JI2Q 4DR1L 3T1HL 2OTLA 4AH6A 5M5YH 3HOZG 5C4XG 2CFMA 5LMNQ 1X3EA 5GADC 5GAEC 1YJ9A 4LF5Q 3GTQH 1VQ9A 1V9PA 1UE1A 1B8AA 1Y1VG 1CKNA 4BY1G 4HJ8A 4DNIA 5C4JH 4HIOA 4UY8C 3HOZH 5J3BA 1HR0Q 2ALYB 1PH2A 3HOVH 4AQYL 4A3CH 3U50C 2CQOA 2WB1E 3SGIA 2Y0SG 2UXBQ 2K14A 4PMWA 4JI3Q 4JI6Q 2JA6G 2R92G 1AH9A 4AYBG 3J81i 3ULLA 2ATWA 3F2CA 1NE3A 2YTXA 2QA4A 5LMUL 4DV7L 4IO9A 2KCMA 2B63G 1VQ6A 2PQAB 4GNXA 3W1GA 3J81c 2Q2UA 1D8LA 5C44G 1YZ6A 4DV6Q 1BKBA 4A76A 4A3JG 1E1TA 2NN6I 1SE8A 5GAGC 4TVAB 4X65L 2RF4A 4DV5L 1N36L 4B3ML 5C3EH 2NN6G 4LF5L 3MXNB 5AJ3L 1JE5A 3KDFB 3M9BA 5LMNL 3S1MH 4DUYQ 1VQMA 1N8RC 4JBMA 4JI5Q 3RNUA 3KJPA 4JI7Q 3PO3H 1SFOH 2Q2TA 4B3RQ 1MIUA 2Z6KA 3PGZA 2E2IH 4GN3B 1LYLA 4BA1I 1Y14B 3W1BA 3K7AH 1EIYB 3H3VI 2JQOA 1TWGH 3T1YQ 1RL2A 1QUQB 2IX0A 2Y0SE 1L1OB 1YBYA 3WWVA 3RN5A 2DUDA 4JI6L 4QIWE 1MKHA 4HIDA 5IYCH 2ASBA 1ASYA 3GDEA 3NBHB 4KHZA 1HJPA 1HZAA 1L1OC 4LUZA 4JI8L 5C4XH 1YI2A 2OWOA 4B3TQ 2PMZE 4L5RC 5BR8L 3F1ZA 3DM3A 1NMFA 3B6YA 1KRTA 3D31A 4HJAA 1KD1C 2IHFA 2VZAA 5IYDH 1OXTA 2N8NA 2UUBL 5JJIA 1KAWA 2MQHA 3CCQA 5M3MG 3CXCA 2MFIA 5GAHC 4GOPC 4DUZL 2NZOA 4FDBA 2YTVA 1IBKL 4WJ3M 3G4SA 4DR6Q 4A3DG 4LFBQ 1IBLQ 3S1NH 4GLXA 1N32Q 3RN2A 2UUCQ 3PV0A 4JI1Q 4LUOA 1KC8C 1VQCA 1U0LA 4NXML 1YEZA 4A3BH 1BBWA 4LNQA 1UE6A 2JK8A 4JBWA 2IT1A 4XTCS 1UEBA 3EBEA 1T9HA 3HOXH 1UWVA 4JI4L 1LM0A 2OQ0A 1PHJA 2WAQE 2AWNA 1L1OA 1AE3A 3HKSA 4O2DA 1RIPA 1X9NA 1NY4A 1XMQL 2E5LQ 4A3LH 3CP0A 4DR2Q 2JA8G 3AFPA 4P75A 3PUXA 4JI1L 4POGA 1I94L 1K0RA 3CPWA 1AE2A 2MO0A 3GO5A 4YY3L 3G6EA 3I4OA 1XNQL 3H3VH 4A3MG 3FP9A 4JI0Q 3G48A 2VNUD 1VQKA 4PZ7A 4TQUS 1FVIA 4AIMA 2VW9A 3HOWG 2R7ZG 3HFZB 1KL9A 3I4NH 2ZM6L 3PO2H 2IY5B 4IFDI 4DV5Q 2NVQH 4RMFA 1SLJA 1SROA 1Q81C 4LF6Q 3K0XA 3D0FA 4UP7A 4BXXG 1VQJA 1EWIA 2XGTA 4QY7A 3M7NA 2F52A 3CD6A 2DGYA 2R93H 3F2BA 1MJCA 4DV7Q 2MO1A 2R6GA 2GVBA 3CC2A 3M4QA 1YIJA 1PVOA 2N78A 1XTDA 2I5HA 1GD7A 1VQIA 4QGUA 5EAYA 1NTGA 2OTJA 2XTIA 3UE0A 4EQ5A 5IE8A 2LXJA 1ASZA 3S15H 3H0GH 4JBJA 4JBKA 5AJ3Q 3CCMA 3HOUG 1PYSB 4GKKL 4IPCA 4BXXH 1N32L 2K5VA 4X64Q 1OXVA 4P74A 1Q46A 3TQYA 4A3FH 1WFQA 4DR3Q 1VQ7A 4JV5L 1TWAH 5C0XG 1Z9FA 1X56A 2RCNA 4C2MH 4JCVE 4A3BG 3GTGH 3BZKA 3F8TA 1Q82C 1HNWQ 2UUAQ 1IYJB 4A3FG 1MJEA 4EX5A 3CCJA 4R4QA 3JAMc 4DR6L 4LFBL 1LTLA 3AYHB 5FLMH 3ULPA 1VQDA 1E24A 4JI8Q 4B3TL 1TWHH 4KHPL 4P72A 5IYCG 3U4ZA 1K8AC 3E9IA 1C9OA 1IZ6A 2KENA 2Z0SA 3PO2G 2UU9L 1R9TH 2CKZB 3CCSA 2A1AA 4L5QA 4C3HH 1HZ9A 2D62A 3DLLA 5H1SE 1KQSA 4GLAC 3TS2A 4DV4L 1SRUA 1I50H 1L2FA 5C44H 1NBWA 4IPDA 3RLOA 4DV2L 4BA2I 3G71A 4DV3L 4IOAA 1PH8A 4JYAQ 1NJIC 3K80C 2AKWB 2BA0A 2CWAA 4YCWA 3GTOH 2D0OA 1WI5A 4A93H 4Y52H 1VQLA 1X65A 1PH3A 3CPFA 2D0PA 2ZJPA 1C0AA 4GKJL 4OO1I 1YJWA 4A3KH 1A63A 2RHSB 3J80i 3S16H 5LMUQ 2BA1A 1VQGA 3BU2A 1TWCH 4JYAL 1HR0L 4P73A 1XMOQ 2UU9Q 4X66L 1KIXA 2YU9H 5HGQA 4AQYQ 2RHQB 2Z6KC 1Q1BA 4GOPB 1L0WA 1Q8KA 2JE6I 5FJ8G 1JJ2A 1SR3A 4L5SA 1FJGQ 1VQPA 4LF4L 1YHBA 2GN5A 3FKIG 4JI3L 4X6AH 2KBNA 1JMCA 4JI4Q 1OTCA 1CKMA 3K7UC 4AYBE 1CSQA 4DV4Q 3ER0A 3I2ZA 2KCTA 2E2HH 3PCOB 4HJ9A 4BBSG 3CMEA 4JOIA 4B3RL 4IFDJ 3CCLA 4C3IH 4DR3L 1OXXK 4IPHA 3CCEA 4GNXC 3KOJA 4LFAQ 4HIKA 4L5TA 2R7DA 3UDIA 3H0GG 3K8AA 3PUYA 1S40A 3CAMA 4LF8Q 4GS3A 3TREA 3UDFA 2KHJA 1GVPA 3J7A5 5C0XJ 1IBML 1G6PA 3PIOA 1EFWA 4HJ7A 3HOYG 2ZM6Q 2R7FA 4O0AA 3T1HQ 1WCMH 3HKZE 4IJHA 3M4PA 2LSSA 2B29A 2JEBI 5GROA 5IYBG 2OCEA 1XNRL 4R4CA 2VQEL 4A3IH 1S3OA 3S14H 1EQQA 1YNXA 2A19A 1EIFA 4A3JH 1N34L 1Q86C 4R4OA 4A3KG 4LF6L 1P8LA 1N9WA 1PYBA 3KDFA 4BBRH 5JEAG 1A8VA 1BBUA 1XMQQ 4K0KL 4DR4L 5IWAL 2CWPA 2V1CC 1B7YB 3S24A 3J80c 1YITA 1K9MC 4A3GH 1VCIA 1XNRQ 3CCUA 4OWTB 4DPGA 4JI7L 3HOVG 4KLKA 3A74A 3GTKH 2ZTEA 4DK6C 4YCUA 4DV0L 2PQAA 1PH6A 1XPUA 4GN5A 3CF5A 3AQQA 3KJOA 2ZTDA 3GTLH 2WP8J 1W3SA 3PUVA 1WYDA 3I7FA 2HHHQ 4JV5Q 2R92H 3GTJH 4BY7G 2E2JH 3CW2C 5FJ8H 4HJ5A 4MTNA 4DR7Q 3NENA 1QZGA 2N3SA 2ID0A 4BBRG 1WJJA 3EN2A 3OYYA 3KYHC 5M3FG 1GM5A 4DR5L 4OX9Q 2KHIA 5BR8Q 1HZBA 1SMXA 2JA6H 3MEFA 3ZJYC 1Y1WH 4POFA 1KRSA 4DKAC 4A93G 1Y1VH 1N34Q 1QVCA 3PUWA 2H5XA 1VQNA 2L15A 5M3MH 1OXUA 3L2PA 1HZCA 1Q1EA 4DV1L 1IBLL 1CKOA 4OX9L 3S17H 4A3GG 3PO3G 2YTYA 2VL6A 2JA7H 1I5FA 1B70B 1QVFA 1Q12A 1PFSA 2VQFL 1QUQA 2JA9A 3M4OH 3I4MG 4NXMQ 4QQBX 5E7NA 4PZ8A 1J5EQ 4LFCQ 1P16A 3AFQA 2QEXA 4IFDG 4X65Q 2UUBQ 3STBD 2AWOA 4Y7NH 4DR7L 1PH9A 1Q7YC 2HHHL 3I56A 4OWWB 3A5ZB 2E5LL 1VQ5A 3CQZH 1Z47A 1O7IA 2MNAA 2K4KA 4DV2Q 4YCVA 5IP7G 2I5LX 4GLVB 4NPSA 2EQSA 2QGQA 5ELOA 2JEAI 4DR2L 3UDGA 3GTMH 3KFUA 1XNQQ 2YV5A 2FXQA 1E7ZA 4JC0A 1I94Q 4NXNQ 2HIXA 3M85A 2YYZA 2AMCB 1JJGA 1C7YA 4KI0A 4P71A 3OTOQ 5JJLA 1XMOL 1VQ8A 4LF9Q 1QVGA 3CCRA 3UDXA 1S72A 2WB1G 2NVXH 1A62A 1IXRA 1VQOA 1V43A 2NVTH 3BJUA 1HH2P 3KF8B 3ERSX 4DR5Q 4NXNL 2JA5H 4XIGS 1J6QA 2R7ZH 1I3QH 1H95A 3NEMA 4IOCA 3OW2A 1TWFH 4GNXB 5K36G 5FLMG 1VQAA 4APVA 2K75A 2VY3A 1HR0W 3GD7A 2I0QA 2JA8H 2IX1A 3UE1A 2UUAL 1X3GA 1HNXL 4IPGA 1VS0A 1GKHA 1IBMQ 3I4NG 2BH2A 1KXLA 1U5KA 3PSIA 1K83H 1GO3E 3RLNA 5IYDG 4ALPA 2BH8A 2VUMH 2I5MX 5IP9H 1VQ4A 2R93G 4WJ4A 2HQLA 1TXYA 4YHHQ 5IY0A 4LF4Q 4MZ9A 3TRZA 5M5WH 3ULJA 4OONA 2UXDQ 3CCVA 3HOWH 3RZOH 2K50A 2ZTCA 5ELNA 1M1KC 1KHIA 4DR1Q 3E9HA 4LUVA 4DUYL 1Y1WG 1HNZQ 5DLQE 5JEAJ 3H15A 1JJCB 4A4IA 2WFWA 3KF6B 4MNOA 2PNHA 4OWXB 1UE5A 5IP9G 4DUZQ 1J5EL 4A3MH 1A0IA 2HT1A 4LF8L 4RG1A 3FHWA 4PG3A 2Q2IA 1YHAA 4C3JH 3CC7A 1JB7A 5IP7H 1HNXQ 2E8GA 3HOUH 2K5NA 1NMGA 4DK3C 3S1RH 2VS1A 1PH1A 1HNZL 4A75A 4A3DH 4JI0L 5HY6A 4PZ6A 3W5OA 4B3SQ 1XJVA 1CUKA 3RZDH 3J81j 4DV3Q 3A5UA 4LFCL
chains in the Genus database with same CATH superfamily
2PI2A 1U4LA 1CKNB 3JAMi 2F0JA 2UXDL 5FLXc 2K5QA 2Z6BA 5J22A 1FGUA 1KLGD 4YWKA 2AQ3B 3C3LA 1QZHA 2SOBA 1LT6D 4A3EH 3OHXC 3GTPH 5NUCA 1ESRA 1FNWA 2B3GA 1K73C 2R7ZB 4JI2L 2J0TD 2F0IA 3PIPA 1FL0A 2PI2E 3L0OA 2JA7G 2TSSA 1QCBD 1SNDA 3IRBA 1YHQA 3M4OB 2GVAA 3PF4A 1WOCA 4BBSH 1SE4A 4IJLA 4X62Q 5HURA 1E1OA 4Q0FA 4X3TA 3T51B 2VQEQ 2A8VA 4R4TA 5CV6A 3U4VA 4JOIC 1EOVA 4DR4Q 1Y1VB 3ERQA 2RSOA 3HKZG 2PMZB 3U9OA 3P7JA 3EQLC 3F2DA 2OT2A 3AEVA 1A6XA 2EXDA 1TQOA 1HNWL 4ME3A 4LW1A 4IUUA 3NQTA 4ZKBB 1IYUA 1Y8PB 3HOUB 3RUZA 2EIFA 3RLFA 1EEID 1ZEQX 4DA2A 3C2PA 1LUZA 2HCIA 4G7HC 1WTOA 1OO9B 4QJFA 2A6ED 1DGSA 4C3HG 5ELFA 1PH4A 1BVSA 4Z9CB 1S4ZA 2NVYH 4K2LA 1PH5A 2Q2HA 4BBRB 3GTJB 3NXWA 4JVZA 4XDXA 4XQJA 4A3CG 4X66Q 2FHTA 4YIJA 2K52A 4JI2Q 5D3IB 2HDMA 4AH6A 2OTLA 3HOZG 2HDLA 5LMNQ 3GTQH 1VQ9A 5M5XB 4C3IB 4N9TA 1Y1VG 4UY8C 2G5DA 4HIOA 2E75C 1WTXA 1NUCA 5J3BA 1HR0Q 3GV3A 1PH2A 3U50C 1TS4A 2CQOA 1LO5D 1K8OA 2LKVA 2WB1E 3SGIA 4DNRB 4JI6Q 2B2YA 1K3BC 1AH9A 3URYA 3VA7A 1XTCD 2NB0A 3ULLA 3CU7A 3F2CA 3GTQB 4IO9A 2XN9C 1VQ6A 4I7AA 3J81c 1YZ6A 1EEFD 4DV6Q 1VF5C 1B2TA 4X65L 4ABNA 4DV5L 1CA6A 2M9VA 4ZRZA 1CK1A 4EQNA 4LF5L 1PMRA 3M9BA 3S1MH 4JI5Q 3RNUA 4A3MB 4JI7Q 2Q2TA 3PGZA 3J80L 5I6WA 4GN3B 1EY4A 4RCOA 2L1BA 2E76C 3W1BA 1EIYB 5BN3A 1I3QB 4AYBB 3MAQA 3H3VI 5AFWA 1GUSA 1DJRD 1SYEA 1JR0D 3T16A 3WWVA 1A2TA 2L5TA 5IYCH 5C3XA 3K0YA 2ASBA 1HRJA 3HP3A 4KHZA 1HJPA 1YNJD 2NVYB 5C4XH 1YI2A 4K5XA 1RODA 3DM3A 4Y7NB 2BE5D 1OXTA 3SK5A 1KAWA 2MFIA 1Y8OB 1H9RA 4DUZL 1IBKL 2YTVA 4K2KA 3G4SA 1MSGA 4DR6Q 4A3DG 2MPMA 1N32Q 4BS9A 3N52A 2K7VA 3A8JE 4A3BH 1DOLA 4JBWA 1UEBA 1D6EC 4L63B 2OQ0A 1L1OA 3ITPA 1SE3A 1X9NA 4IZ8A 5ELEA 4RCNA 2JA8G 3PQIA 1BDOA 1I94L 1AE2A 2R93H 1EY7A 5FLXE 1WD0A 3H3VH 4A3MG 4JI0Q 2O4XA 3G48A 2VNUD 1L0YB 3AB9A 4TQUS 4KTAA 3QWNA 4FO2A 4DV5Q 2F0WA 4K6DA 2WV6D 3K0XA 4QY7A 2F52A 3C1EA 3VR4A 1SNCA 1D5XC 3CC2A 2GVBA 4KY6A 3CQZB 3J7AF 2N78A 1GD7A 4QGUA 5K5PA 2Y0SB 4EQ5A 3S15H 4KY5A 2F0KA 1ILQA 5JPNC 2PYKA 3CCMA 3HOUG 1PYSB 3OWEB 1N32L 3NSWA 5IGEA 2EJFC 4NP5A 3AMUA 2QEJC 2SEBD 1Z9FA 2OEOA 4NDXA 3GTGH 4N8FA 4EX5A 1CFMA 1X3QA 1IKLA 5IGBA 1VQDA 4HAEA 4A93B 3ND8A 1SNMA 3E9IA 4K6LA 3Q23A 2CKZB 5G3LD 4C3HH 3TP8A 2Z8LA 2WB1B 4KHVA 2WAQB 4KK7A 5H1SE 1KQSA 1L2FA 1S5ED 5C44H 4Q5VA 1D2BA 3RLOA 4CKCA 1UAPA 2CWAA 1WI5A 4H13C 1GJXA 5C44B 2SNSA 3CPFA 2BDOA 4LAAA 4V190 1ML0D 2LMCB 1C0AA 1GHKA 1RHPA 1A63A 2RHSB 3J80i 2BA1A 1VQGA 3BU2A 1XMOQ 2QDLA 2YU9H 5HGQA 2G9HD 1Q1BA 4M8AA 4QUCA 2JE6I 5FJ8G 5FK9C 1JJ2A 4NKLA 1XWEA 2NZ1D 3R93A 2B2VC 1ESFA 1F2YA 2OF1A 1OTCA 1CSQA 1Y8NB 2E2HH 4BBSG 2NYZD 5JEAH 4DR3L 4HIKA 2CH4A 3K8AA 3PUYA 4LF8Q 4GS3A 3QOLA 3UDFA 1GVPA 1BBXC 2Z4IA 1EFWA 3T1HQ 1WCMH 1RDPD 4IJHA 2D5DA 4RGNA 4HMJA 4H44C 2LSSA 1SYCA 5IIFA 5IYBG 2KOLA 1XNRL 4R4CA 2A69C 4XYQA 1VF7A 4CDCC 1YNXA 1LTID 4RAUC 1Q86C 1P8LA 1LTBD 3KDFA 5JEAG 3GQBA 4K0KL 1SYFA 4C3IG 5IWAL 3J80c 2V1CC 4OWTB 4DPGA 4KLKA 4YCUA 4DV0L 2IW3A 2EOTA 4R8IA 3KJOA 2WP8J 4HEDA 2HHHQ 2Q8RE 3NQIA 3SR1A 2BDNA 4A3JB 2N3SA 2VUMB 2ID0A 3AU7A 4BBRG 1KDAA 4DR5L 2RSNA 5C3WA 4MHEA 4X3UA 1KRSA 1R9TB 1QVCA 2L9HA 5M3MH 3H91A 4X3KA 5C6AA 3S17H 1CKOA 4A3GG 3PO3G 2C9OA 3O13A 3SE0A 2DN8A 3HGBA 1B70B 1QVFA 3SXHA 4NXMQ 4QQBX 1P16A 3AFQA 4RKBA 4XQQA 4IFDG 2AWOA 3QO2A 4DR7L 4FF3A 1Q7YC 1AN8A 5DM63 2B2TC 1Z47A 3L9AX 3R8BA 2JEAI 2I5LX 3J7YW 1A2UA 4BBSB 4DR2L 4J1MA 3UDGA 1PRTD 1XNQQ 4JC0A 1UNSA 3E0JA 4IUPA 1DM0B 2AMCB 1ENFA 4KI0A 5JJLA 3PMFA 1XMOL 1VQ8A 4F7XA 5DNFA 4LF9Q 3J80E 3F2UA 1B1ZA 1IXRA 2JN4A 1HH2P 2XWJB 2B2WA 4XIGS 1I3QH 4HN7A 3I3CA 2P5ZX 3NEMA 4IOCA 4X3SA 3GTOB 5K36G 3DM1A 3WDNA 3HOWB 1EOTA 2I0QA 4DNTB 5I2YA 2Z9HA 5I9PA 2UUAL 1FD7D 4IUTA 3I72A 3QB3A 1K83H 4WORA 1GO3E 3RLNA 3T4AC 5IP9H 1TR5A 1QNKA 1STHA 4WJ4A 1M8AA 1LTRD 4B08A 3S1MB 1F2LA 4MZ9A 3ULJA 5EGTA 3HOWH 5ELNA 4QMGA 4DR1Q 4LUVA 4DUYL 2K1BA 2RA4A 1SBBB 1TU2B 2PNHA 5IP9G 3FHWA 3IFTA 1AW7A 2Q2IA 2E8GA 2K5NA 3SDZA 2JSOA 3R2IA 4A3DH 3W5OA 4B3SQ 1XJVA 1DONA 4OGQC 2F0OA 3J81j 4O1NA 4R1JA 3I4NG 3OTOL 4YHHL 2NZHA 2NVTB 3OIPA 4YWMA 1X54A 5EKLA 2EYFA 4GN4B 2HQEA 2WAQG 3K58A 4GKJL 1VQEA 1X6OA 2F0FA 4C3JG 5IT9c 4G7ZC 4GKKQ 3RR5A 2FMCA 1TVXA 2CVRA 2PW7A 1PH7A 4BY1H 2NTSA 1N33Q 2EY6A 1UE7A 1I6HH 4PMBA 2F3IA 2CCZA 4DU9A 3ND9A 4K0KQ 2H4OA 3PUZA 2O2LD 1IL2A 3I55A 3TEHB 2RDHA 3SEBA 2JA8B 2XNAC 4X64L 2SDFA 4RWSC 2F4IA 4LMQD 2Q8TA 1EQRA 1F77A 3V2TA 4GKJQ 3NELA 1G91A 3A8KE 3CHBD 3VR5A 4JI5L 4IFDH 3EROA 3V96A 1FNVA 1SNPA 3J81E 4I7ZC 3TBIB 1B3AA 4IN3A 2B63H 1S5DD 3K81C 1VQHA 1M90C 1SXTA 2RKSA 1Q8IA 3J81L 3TSSA 1JT8A 1VQFA 2NWGA 1NAPA 2F4VQ 3LWEA 4OO1G 1R4PB 4PQXA 3K5NA 5C4JB 4JG2A 3LGJA 3M3YH 3L3OC 4NB3A 4CDFC 1PA6A 3KLWA 2QILA 3OMGA 3FKIH 4G57A 1ET6A 2KECA 2PCFB 3MEHA 2K5HA 1SE2A 4R4IA 5C0XI 4BY1B 4LWCA 1BOSA 3T56B 2ES2A 5IYBH 2M2LA 1EY8A 1B9MA 1X3FA 4QB4A 4IURA 3A55A 5C4XG 1X3EA 5F2DA 5GADC 5GAEC 4ZKCB 1V9PA 3BDOA 1B8AA 4BY1G 4HJ8A 4DNIA 4RGMA 2ALYB 4DK1A 1MI2A 5C4ZA 5IGGA 1HQMC 1FYCA 1TWCB 1J9OA 4PMWA 4AYBG 3J81i 4RFBA 1PZKD 1GUWA 3D3RA 4DV7L 5EPKA 4GNXA 3W1GA 5J39A 3BYYB 4A3EB 5BN4A 1KNEA 3H94A 5GAGC 4TVAB 2RF4A 5C5LA 1EU4A 5E3FA 2KCCA 3I70A 2NN6G 2XIWA 3NP8A 3GTMB 3KDFB 5LMNL 1N8RC 4HMIA 4RKLA 3GTLB 2K5DA 5EBDA 1Y14B 3I4LA 5FLXL 1RL2A 3T1YQ 1HCZA 1XXGA 1YBYA 1NR4A 1GUNA 2DUDA 4JI6L 4HIDA 2L55A 2NBFA 2QF7A 1U4MA 3GDEA 1KAAA 5ELBA 4TKOB 5BR8L 3F1ZA 4ZYSA 1CHPD 1NMFA 2K03A 4O42A 4HJAA 3FRPB 5JJIA 5M3MG 2EJMA 3CXCA 1LT5D 4FF4A 1EYCA 4A3FB 4WJ3M 5FO8B 1IBLQ 1TY2A 4K5WA 1HA6A 3DMUA 2UUCQ 4JI1Q 1ZKOA 1VQCA 1U0LA 1VMCA 5G3LF 1BBWA 2JK8A 4CDEC 1T9HA 3HOXH 1LM0A 2WAQE 2I46A 1TT2A 1C4QA 1AE3A 4O2DA 2A6HC 4UHVA 1NY4A 1XMQL 2E5LQ 3CP0A 3CPWA 2MO0A 4YY3L 3I4OA 3C46A 5D14A 1VQKA 1MD2D 1PZID 4HR7B 3BYTB 3WOFA 1KL9A 1BF4A 1STNA 2HUGA 2KHSA 1GHJA 1SROA 1Q81C 5A2QL 5JVH3 3CD6A 2D2CC 2F0SA 4H0LC 2X6GA 3F2BA 4DV7Q 1TKWB 1BCPD 1EU3A 3M4QA 1XTDA 2B8GA 5EAYA 5IE8A 2F0GA 2ENBA 4DGZA 5IGFA 1SMYC 3E3XA 2DJFC 3DEOA 3QJYA 1TS3A 2K5VA 4X64Q 4P74A 1A3UA 1Q46A 4ID6A 3TQYA 1WFQA 3T53B 1VQ7A 1DOKA 1TWAH 2EY2A 5C0XG 4A3BG 1PRTB 4JCVE 4JPBW 3S2DB 1WTWA 2CQAA 3CCJA 4R4QA 4K14A 3JAMc 4DR6L 3AYHB 5FLMH 1EWHA 4MIUA 3ULPA 1E24A 1TWHH 1RJTA 4IUVA 1IZ6A 2Z0SA 2UU9L 1R9TH 3CCSA 5L37A 1NNXA 2MHVA 4L5QA 2X6LA 2KJXA 2R93B 1H9SA 1UEAB 4DV2L 2F3WA 1NR2A 5KGUA 4JYAQ 1KDBA 2AKWB 2BA0A 3FDTA 3JAML 2V4DA 5ELCA 2EYMA 3SHLA 3W2DA 3HG9A 3RMHA 3A7AB 4FF2A 2J7ZA 1HR0L 2K05A 4X66L 1QJOA 5I6YA 1KIXA 4AQYQ 3IFDA 4CBVA 4GOPB 1L0WA 3D6CA 3P75A 1S5CD 3S1RB 4WFN3 1FJGQ 4FNFA 4KKUA 4LF4L 5I4DA 1O7ZA 1ENAA 1CKMA 1CM9A 4AYBE 3I2ZA 2DJGC 1GUOA 1Z7TA 3VYUA 4K8IA 3CCLA 2I07B 2R7DA 2R61A 2A73B 5KEEA 1II3A 3TREA 2KHJA 1JWUD 1B50A 5C0XJ 1IBML 3DHQA 4HJ7A 2YU9B 1V1PB 4O0AA 1SDFA 1EY5A 1G2SA 2XRSD 4ULLA 1IYVA 1H9MA 4A3IH 1S3OA 1F2MA 3I90A 1EIFA 1N34L 2F0PA 1CZGA 1BBUA 3IKJA 3NTKA 3K5MA 4DR4L 2CWPA 1YITA 4ILWA 4A3GH 5DM73 1XNRQ 2NUCA 3GTKH 3CF5A 4CHTB 3K59A 4XT1B 1W3SA 1WYDA 4XQNA 2R92H 1PRTC 2E2JH 3CW2C 3T13A 4HJ5A 4MTNA 4OX9Q 3OYYA 1WJJA 3KF8A 1GM5A 3KLSA 2KHIA 5BR8Q 2FFKB 1ICFB 3ZJYC 3D8GA 1Y1WH 1PTOF 4POFA 4KD3A 4A93G 3S1QB 1FR3A 3PUWA 3BVGA 2EXZA 1VQNA 1OXUA 2QKIC 1HZCA 4ZCKA 2ICEC 2YTYA 2L4NA 1WVLA 1I5FA 2NN6H 3BDCA 2QW7A 4IALA 2VQFL 2JA9A 4LFCQ 4PZ8A 3TDQA 2E2HB 3PIP3 3KBGA 2HHHL 3A5ZB 2E5LL 1VQ5A 3CQZH 1O7IA 3V05A 5IP7G 4GLVB 5EPJA 3GTOH 2EQSA 3KFUA 3NE5B 2NVXB 5CC4A 5KRUA 1I94Q 2YYZA 1BCPF 3D4RA 3NBIA 1IW7D 3MC0B 4P71A 4ZK9B 1QVGA 1GUGA 4FXGC 2WB1G 1V43A 2EY1A 2JA5H 2E2DC 1BO0A 1J6QA 1H9KA 1H95A 1UUPA 5FLMG 4APVA 4KN7C 1HR0W 2JA8H 2CW0D 4DN4M 2IX1A 1X3GA 5D65A 4IPGA 1HNXL 1GKHA 1IBMQ 4MN3A 1TS5A 2BH2A 3PSIA 1Y1WB 3Q22A 3RZOB 2BH8A 2I5MX 2MUYA 2RBMA 1EY6A 3RD4A 1MSHA 5C0XH 4OONA 1AFPA 3RZOH 2K50A 1EYAA 4B9XA 1TWFB 1SNOA 3BVZA 1AEXA 3H15A 1TY0A 4MNOA 4R8NA 4LF8L 5M9OA 2OXPA 5IP7H 1HNXQ 1I4GA 4I65A 1K83B 2Z4HA 2EY5A 4JW0A 3GTKB 4JI0L 4FXDA 3D6WA 3P20A 1CUKA 4DV3Q 3A5UA 1JQYD 1F9PA 4LFCL 1E2VA 5CBEE 1EUJA 3E0EA 2F0TA 2UXBL 4LF9L 2LFNA 1KABA 4LF7L 2CW0C 4QL5A 4EGVA 4UPAA 1CA5A 3BZCA 1W6KA 1G51A 4CGYB 4B3SL 5EKKA 3DWAA 3SK6A 3KF6A 1CZWA 2JJQA 4OXPA 4X62L 4KD4A 2VQFQ 3HOYH 1JOOA 3A56A 4A3DB 2IHEA 1IBKQ 5CORA 1K3RA 4DAMA 3MXPA 3I73A 2R3ZA 3STBC 3A0JA 5M5XH 3HOXG 3S2HH 1PZJD 1R4QB 1EYGA 2MGSA 4A3KB 1CT1D 1TWHB 5C3EG 1HFNA 3OPOA 4RHRA 2UXCL 4A3LG 1XPOA 1WTRA 1F9SA 5LL6X 3BS1A 3NUCA 4LF7Q 3S1QH 2F3VA 2HCCA 1PYWD 1QE6A 4J15A 1XPRA 3NPPA 2JA5G 1RCVD 3CRLC 4ZQ3A 5T1IA 1E3PA 1K8GA 3I4MH 1N36Q 2B8FA 4B3MQ 1JOKA 2UUCL 5IWAQ 1V1PA 2AHOB 1EYDA 5JVG3 1PTOD 1G291 3HZXA 4YY3Q 3H09A 2C5CA 5IGDA 2EZVA 1WCMG 1O7LA 1X55A 4UP9A 1EY0A 4KJNA 3IAYA 4BY7H 4YWLA 3EIVA 3JC66 1XX8A 3GTPB 4FP5D 4DAYB 4GOPA 4OL7A 1QNUA 2EE1A 1LTGD 3QR8A 2JA5B 5M5YH 2VB3X 2CFMA 1YJ9A 1GUTA 5CV8A 1EWCA 4CJ0B 1QOHA 1ZXTA 1C48A 5C4JH 1I4RA 1HTLD 5T1GA 1LACA 4M1UB 5M5YB 3HOVH 5EPLA 1WTQA 2Y0SG 2UXBQ 4JI3Q 2JA6G 2R92G 2K5WA 3HOXB 4QF4A 2ATWA 3R3OA 4OIJA 4OO1H 3S14B 2K04A 4JK1C 5C44G 3TP6A 1BKBA 4A76A 4A3JG 1XYIA 2NN6I 1JC7A 1SE8A 5ELDA 5A35A 5C5MA 1DZ1A 1N36L 3QOJA 4B3ML 5C3EH 2PZUA 4RHSA 2ZXOA 1M4VA 3KLRA 4DUYQ 3PO3H 2F0QA 3KJPA 1SFOH 4B3RQ 3EA6A 2Z6KA 2E2IH 4QCLA 3K7AH 2O5IC 2DY7A 2JQOA 1TWGH 3A8IE 5KYLA 2Y0SE 2IX0A 5KYIA 1BCPB 5K36H 3RN5A 1ASYA 3NBHB 4JI8L 4LUZA 1HZAA 1L1OC 2OWOA 4B3TQ 1JICA 2PMZE 1F9QA 1KRTA 4S3SA 2UUBL 2WACA 3CCQA 2MP1A 1QILA 5GAHC 2NZOA 1QB5D 4LFBQ 3VR2A 1LLRD 4XXEA 2B2UC 1PFNA 1SJHD 4GLXA 2CH4W 3RN2A 3PV0A 5CV4A 2R92B 1KTKA 5EJWA 4LNQA 1E2WA 1UE6A 2IT1A 4XTCS 1UWVA 2IX3A 3GV6A 2AWNA 4EQOA 5DEHA 3HKSA 1F9RA 1RIPA 3PO2B 1I6HB 4DR2Q 3NTHA 3AFPA 2HD3A 3KLSX 1E0BA 4C1NI 3FP9A 4PZ7A 4AIMA 3PO2H 3I4NH 3Q6SA 2VB2X 4BY7B 4IFDI 2B2UA 4RGTA 1ONLA 4RMFA 2NVQH 1SLJA 4RA8A 4RH6A 4BXXG 3D0FA 4UP7A 1VQJA 5E4XA 3M7NA 2DGYA 2XVSA 4HSPA 4A3IB 1BUVT 3LNNA 1KLUD 1X32A 5CR3A 1YIJA 1LTTD 1VQIA 1ZYRD 2A68D 3NHHA 5KNDA 3UE0A 3W3AA 5IODA 1PXUA 1KDCA 3I4NB 4JBJA 4KY7A 4JBKA 3G7LA 4F8MA 5AJ3Q 4GKKL 4IPCA 1I4QA 1OXVA 3S15B 1EFID 4A3FH 1HNWQ 3BZKA 3F8TA 2BOSA 1IYJB 4A3FG 1JE4A 2AQ2B 1MJEA 2AUKA 1FGBD 4JI8Q 2F0NA 4C56C 4B3TL 4P72A 3U4ZA 1STGA 3PO2G 1B4OA 2NTTA 5CV7A 3X3MA 2A1AA 4F88A 3FKIB 2KEEA 5C3EB 4KV6A 2D62A 3DLLA 3QIAA 5IT9E 2K32A 3TS2A 4DV4L 1SRUA 1NBWA 1ET9A 2DY8A 3DWQA 4DAVA 1PH8A 4IOAA 1NJIC 3K80C 1SYBA 4YCWA 1RF2D 4Y52H 1X65A 1PH3A 2CHBD 2B2TA 3S2HB 1JORA 2F0DA 2K6AA 4A3KH 3C1FA 3I8ZA 3S16H 1TWCH 4JYAL 4FVMA 4H7BA 2UU9Q 1DOMA 2A74C 2RHQB 2Z6KC 4UDUC 1J8IA 1CQFA 1Q8KA 1G6ZA 4PMCA 1BNZA 1F2ZA 1YHBA 3EJIA 2GN5A 3FKIG 1ICWA 3ZYYX 4X6AH 3K7UC 2RCFA 4DV4Q 2KCTA 1GXDC 4UAIA 5KNBA 2FMMA 3PCOB 3R2TA 3K57A 3CMEA 4HJ9A 3VR3A 2EPBA 4IPHA 2G9DA 4LFAQ 4L5TA 3UDIA 5ISRA 2JA7B 3H0GG 3MXUA 3J7A5 2QCPX 5EKIA 3HOYG 2ZM6Q 1YNND 3HKZE 2RDFA 3IL8A 3M4PA 1B9NA 2B29A 1EQTA 2JEBI 5GROA 2BE5C 1FNUA 3GP7A 2MJ8A 3FPPA 1EQQA 2A19A 2K33A 4A3JH 4LF6L 4R4OA 1STBA 4KKTA 4BBRH 3MXNA 1SEBD 4J6HA 2KQ3A 1XMQQ 3S24A 2EYLA 1K9MC 1VCIA 3CCUA 5M3FB 4JI7L 3HOVG 3A74A 2ZTEA 2PQAA 1TIID 1PH6A 1XPUA 3GTLH 1IHZA 5A2QE 4DK0A 3GTJH 5BN5A 1QZGA 1WTHA 3EN2A 5M3FG 2PO4A 2L12A 3LWUA 1HZBA 4B9WA 2JA6H 3MEFA 4NMZA 1PLFA 2H1EA 3MFGA 3CKIB 4KKSA 3OOCA 1STAA 2QDBA 1N34Q 5CBAE 1U4RA 4EVOA 3L2PA 2ICIA 1IBLL 1Q1EA 1BQQT 4OHJA 4DV1L 3J7AV 2VL6A 2B2VA 1I4HA 2KVMA 1W6JA 1HFGA 1Q12A 1QUQA 1SAPA 1J5EQ 2FJ2A 2QEXA 4X65Q 2UUBQ 3G6JB 4OELB 1CHQD 1PH9A 5M3MB 2K4KA 4YCVA 4NPSA 4P2CB 3GTMH 2QGQA 3TP7A 2YV5A 1E7ZA 3MFYA 4NXNQ 1JJGA 1C7YA 1U9RA 3KK7A 2WINB 1E2ZA 2PQEA 3CCRA 3UDXA 1S72A 4G7OC 3SK4A 3NTIA 3Q24A 3S16B 3OMCA 1HPCA 3TN2A 1Z6HA 3BDLA 1EY9A 1VMPA 4U673 1GOZA 4KMUC 2R7ZH 3OW2A 5FOBB 1TWFH 2WKCA 1JCKB 3GD7A 1VS0A 3H0GB 4A3BB 4CKEA 1RD9D 5IYDG 1VQ4A 3K5OA 5CYUA 1WD1A 1I50B 1G8ZD 2HQLA 2M00A 1TXYA 3U9SA 4HTHA 2ZT9C 3FEWX 5IY0A 4LF4Q 3TRZA 2WIIB 4DFAA 4IUNA 4PV1C 5M5WH 3CCVA 3VYSA 3K5LA 1O78A 4KN4C 1KHIA 3E9HA 5HGTA 1B44D 4C2MB 1Y1WG 1TWGB 1HNZQ 5DLQE 5JEAJ 1ENCA 1JJCB 4A4IA 4DAPA 3SVMA 2WFWA 2HT1A 1J5EL 2VXWA 1UE5A 3NWTA 1HQRD 1A0IA 4QIWB 4L6TB 4QUFA 1YHAA 4C3JH 3CC7A 3HOUH 4F87A 5IOCA 1NMGA 3S1RH 4A75A 3DUZA 3RZDH 1RTNA 1JB3A 1ZYRC 1WCMB 4WRDA 5LMNW 1FJGL 5E1FA 3T1YL 1A15A 3S1NB 1YJNA 2ZJQA 4A3IG 2C35B 3VYTA 1PV4A 5EQ0A 4DV1Q 2D9UA 5JPMC 1VDZA 4UP8A 3PF5A 3CMAA 1PFMA 1VQBA 3FVQA 2ZJRA 1HXYD 2WKDA 1YNJC 4A3EG 1BXTA 4PNYA 2F0UA 1D1KA 2N49A 3U58A 1PFBA 2EYHA 1D7QA 5GQOA 1CSPA 3BVMA 3CC4A 5JJKA 3MVVA 2AQ1B 4TSSA 2TMPA 3OWFA 4ME5A 5KNCA 4CJ2C 4KHPQ 1KNAA 1HA5A 2HIVA 2F4VL 4DV0Q 4EQPA 5CMDA 3HOYB 1SSOA 4LFAL 3Q8DA 2VUMG 4H02A 4HCSA 1W2BA 1YVCA 3MHBA 5CV5A 1JOQA 1BR9A 1V1QA 2B63B 1N33L 1IKMA 2LXKA 3H6MA 4K5VA 3A7LA 1K8MA 5JAVA 1OXSC 3L7ZC 2UXCQ 3S2DH 4N8X1 3VDYA 2N55A 3TS0A 3ICEA 1E22A 5M3FH 1DXMA 1SN8A 1AZPA 1EIHA 2XSCA 1T5EA 4DV6L 1DD2A 1S5FD 1RKNA 4HIMA 3OIQA 3N6RA 2OQKA 3J7ZC 3FMCA 4DR1L 3K6OA 1YNNC 3T1HL 1EZ6A 2EDGA 4FYDA 4LF5Q 1UE1A 3NWSA 1MGSA 1CKNA 3HOZH 4DAYA 3HKZB 1LABA 2PZWA 3TMEA 1QG7A 4AQYL 4A3CH 1MHWC 1TWAB 3EVQA 2K14A 3E5SA 4K8JA 2JP1A 3KBXA 2A6EC 1NE3A 2YTXA 3MA2B 2QA4A 5LMUL 2KCMA 2B63G 2PQAB 3HOZB 2Q2UA 1D8LA 3ONAB 4CKBA 5C4XB 5JJZA 3I91A 1E1TA 3VR6A 3EFXD 2F1MA 3BG3A 3X3NA 3MXNB 3D4WA 5AJ3L 1JE5A 1I4XA 1VQMA 4JBMA 1STYA 3NBHA 1O80A 1MIUA 1LYLA 4BA1I 1BCPC 3M3YB 4R9WA 2RDGA 1QUQB 1L1OB 4QIWE 1MKHA 2KEDA 1AP0A 4L5RC 2DNCA 2JYOA 3B6YA 3D31A 2F0VA 1KD1C 2IHFA 2VZAA 5IYDH 2N8NA 2F0MA 2MQHA 5LL6S 2E74C 2B2WC 4GOPC 4FDBA 2EJGC 3I4MB 3S1NH 3QG1A 5JOBA 1SFOB 2EYPA 4LUOA 1KC8C 4NXML 1YEZA 2KCNA 3TZUA 3DEPA 1CTMA 3MWYW 4WJWA 3EBEA 2DNEA 4JI4L 1D1IA 1PHJA 2Z1CA 3S9WA 1D5ZC 4LK1C 4A3LH 1S5BD 4P75A 3PUXA 4JI1L 1HUMA 2A68C 5CV9A 4POGA 1K0RA 3GO5A 1PTOB 3G6EA 1XNQL 3P1HA 1SYGA 5D3DA 2R7ZG 1FVIA 2VW9A 1LV9A 3HOWG 3HFZB 2IY5B 2ZM6L 1Q3LA 2PNRC 2E2IB 1PTOH 2K01A 4LF6Q 2XGTA 1EWIA 3RZDB 1MJCA 1EQVA 1D5MC 5EBCA 4BWGB 2MO1A 2R6GA 1PVOA 4OEMB 2I5HA 1NTGA 2OTJA 2XTIA 1ASZA 4L8JA 2LXJA 3H0GH 3HS0C 2E2JB 2IL8A 3MTSA 4BXXH 1X3PA 3OSOA 4C1NK 1Y69U 4DR3Q 4KJOA 3HRZC 4JV5L 1X56A 2RCNA 4C2MH 1A3VA 4N9PA 4XT3B 1HTPA 1Q82C 2UUAQ 2GA4B 3CRKC 2J4XA 1RTOA 4LFBL 1LTLA 2F0LA 2L0CA 2XRQD 4KHPL 1DCZA 5IYCG 2L11A 3E6ZX 1K8AC 1C9OA 2KENA 3PO3B 2B39A 1O7YA 3KUPA 1LT4D 2PPBC 1HZ9A 1WTVA 1JWMD 4GLAC 2IWHA 1LTSD 1B3QA 3VA5A 5FO9B 1I50H 2X69A 4IPDA 1WTPA 4GZYC 1LT3D 3UI2A 3G71A 4DV3L 2Q8IB 4BA2I 3GTGB 2D0OA 4CDDC 4A93H 4FF1A 5DAUA 1VQLA 1HHVA 2D0PA 4ZAIA 2ZJPA 3HOVB 4IUQA 5TSSA 4OO1I 1B53A 1YJWA 2EVBA 5LMUQ 3H3VC 4P73A 4C3HB 1IW7C 2JA6B 2A69D 1SR3A 2SNMA 4L5SA 1VQPA 2A6HD 4JI3L 3WOEA 2KBNA 1JMCA 4JI4Q 1STEA 4TRDA 1A3TA 3ER0A 1EIGA 4JOIA 4B3RL 4IFDJ 3M4YA 4C3IH 1OXXK 3CCEA 3VYRA 4GNXC 2IJ0A 3KOJA 1S40A 3CAMA 2LY7A 4IQZA 4ZLTF 2N88A 1G6PA 3PIOA 2R7FA 1V1OA 1PRTF 3A54A 4J8QA 2OCEA 2F03A 1MBYA 2XWBB 2VQEL 4FXKC 2F0HA 5IT9L 4A3GB 3S14H 4A3KG 5CGKA 1PYBA 1N9WA 2RQXA 1Q90A 1V8QA 5E4WC 1HUNA 1A8VA 1T5XD 3DWPA 1B7YB 1EZ8A 4ZUJA 2EYOA 2PZTA 4DK6C 3MZ5A 4GN5A 3AQQA 1K0SA 2ZTDA 3DXJC 4E6IA 3PUVA 3I7FA 4JV5Q 3TP5A 4BY7G 4DR7Q 5FJ8H 3PIO3 5IGCA 3NENA 4HCEA 4HSVA 3KYHC 2KUMA 1NSNS 4V0BA 1SMXA 5M5WB 4DKAC 1Y1VH 1I6VC 3MXGA 2K28A 2H5XA 2L15A 5I9OA 4OX9L 3M7GA 4G4KA 3HEJA 2LS01 2JA7H 4U68A 1PFSA 2B2YC 3M4OH 3I4MG 3SK8A 5E7NA 3D4DA 2EYJA 2O5JC 1H9JA 3STBD 4Y7NH 2JXMB 3BZDB 3I56A 4OWWB 5LHY1 2MNAA 4DV2Q 5C4HA 1I4PA 5ELOA 1SYDA 2FXQA 2HIXA 3M85A 2AUJD 3LX0A 1K28A 1H9SB 2ZXRA 2IPKD 3OTOQ 1IL8A 1C8CA 4XYOA 1JWSD 4DF7A 4DXFA 3NK9A 2NVXH 1A62A 1VQOA 2NVTH 2RVLA 2BCOA 3BJUA 4ZUIA 4MTKA 1TS2A 5KIXA 3KF8B 3ERSX 3JAME 4DR5Q 4NXNL 3OW7A 3TZDA 4OIKA 3Q0AA 1EL0A 2ZXPA 2F0EA 4GNXB 1U4PA 1VQAA 2PW5A 2FINB 2K75A 1AZQA 2VY3A 1QWYA 1SNQA 3UE1A 3FPUB 1G2TA 4DXGA 1L0XB 4NW2A 5I2XA 1KXLA 1U5KA 1CI3M 4ALPA 1PDQA 2VUMH 4C3JB 4LJZC 2R93G 1CQVA 1PTOC 4YHHQ 2UXDQ 2ZTCA 1M1KC 5J1ZA 1SMYD 5FKAC 1SJED 3S17B 3KF6B 4OWXB 1ILPA 4DUZQ 4A3MH 4RG1A 4PG3A 1JB7A 1NCVA 4CJ1B 3K7AB 4ODGA 4RGOS 2NVQB 4DK3C 1PH1A 1LTAD 2VS1A 1HNZL 5COYA 2KA7A 5HY6A 4PZ6A 1DYQA 5FO7B 2A5HA
chains in the Genus database with same CATH topology
2PI2A 4R1JA 1EUJA 1CKNB 2NZHA 4YHHL 3OTOL 5LMNW 3E0EA 4YWMA 1X54A 3JAMi 3T1YL 1FJGL 2UXBL 2UXDL 4LF9L 5FLXc 4GN4B 2WAQG 1YJNA 1VQEA 1X6OA 2ZJQA 5IT9c 4A3IG 1FGUA 2C35B 4LF7L 4GKKQ 4YWKA 3RR5A 1PV4A 4QL5A 4DV1Q 4UPAA 1QZHA 3BZCA 1G51A 4UP8A 4B3SL 3PF5A 3CMAA 1PH7A 4A3EH 1VQBA 3KF6A 4BY1H 3GTPH 1N33Q 2JJQA 4OXPA 4X62L 2VQFQ 3HOYH 1UE7A 2B3GA 2ZJRA 1I6HH 1K73C 2F3IA 4A3EG 2IHEA 3PIPA 1IBKQ 4JI2L 2CCZA 1FL0A 2PI2E 3L0OA 1K3RA 4DAMA 2JA7G 4K0KQ 3PUZA 3IRBA 2N49A 3STBC 3I55A 3TEHB 3U58A 3A0JA 1YHQA 1IL2A 2GVAA 5M5XH 3HOXG 1WOCA 4X64L 3PF4A 4BBSH 3S2HH 4IJLA 4X62Q 5GQOA 1EYGA 1D7QA 1CSPA 3CC4A 5C3EG 1E1OA 1EQRA 2VQEQ 2UXCL 2A8VA 1XPOA 4A3LG 5JJKA 4GKJQ 3NELA 4R4TA 3U4VA 4JOIC 1EOVA 4DR4Q 4LF7Q 3S1QH 4JI5L 3HKZG 4KHPQ 2HIVA 2F4VL 4DV0Q 3F2DA 4J15A 1XPRA 2JA5G 3AEVA 4LFAL 1E3PA 3Q8DA 1K8GA 2B63H 2EXDA 4H02A 2VUMG 1HNWL 3K81C 1VQHA 3I4MH 1W2BA 1YVCA 1N36Q 4ME3A 1M90C 4B3MQ 4LW1A 2UUCL 5IWAQ 1JT8A 2AHOB 1VQFA 2F4VQ 1V1QA 4OO1G 1N33L 2EIFA 2LXKA 3RLFA 1G291 1OXSC 3L7ZC 4JG2A 4YY3Q 2UXCQ 3LGJA 3S2DH 1LUZA 3M3YH 1WCMG 3VDYA 4QJFA 4NB3A 1DGSA 1X55A 4UP9A 4BY7H 1PA6A 3KLWA 4YWLA 3EIVA 3JC66 3TS0A 3FKIH 3ICEA 1PH4A 1BVSA 1E22A 5M3FH 2K5HA 1SN8A 2NVYH 1PH5A 2Q2HA 4R4IA 5C0XI 4LWCA 4DAYB 4DV6L 4GOPA 2ES2A 4X66Q 4A3CG 4HIMA 5IYBH 2OQKA 3J7ZC 1X3FA 2K52A 4JI2Q 4DR1L 3T1HL 2OTLA 4AH6A 5M5YH 3HOZG 5C4XG 2CFMA 5LMNQ 1X3EA 5GADC 5GAEC 1YJ9A 4LF5Q 3GTQH 1VQ9A 1V9PA 1UE1A 1B8AA 1Y1VG 1CKNA 4BY1G 4HJ8A 4DNIA 5C4JH 4HIOA 4UY8C 3HOZH 5J3BA 1HR0Q 2ALYB 1PH2A 3HOVH 4AQYL 4A3CH 3U50C 2CQOA 2WB1E 3SGIA 2Y0SG 2UXBQ 2K14A 4PMWA 4JI3Q 4JI6Q 2JA6G 2R92G 1AH9A 4AYBG 3J81i 3ULLA 2ATWA 3F2CA 1NE3A 2YTXA 2QA4A 5LMUL 4DV7L 4IO9A 2KCMA 2B63G 1VQ6A 2PQAB 4GNXA 3W1GA 3J81c 2Q2UA 1D8LA 5C44G 1YZ6A 4DV6Q 1BKBA 4A76A 4A3JG 1E1TA 2NN6I 1SE8A 5GAGC 4TVAB 4X65L 2RF4A 4DV5L 1N36L 4B3ML 5C3EH 2NN6G 4LF5L 3MXNB 5AJ3L 1JE5A 3KDFB 3M9BA 5LMNL 3S1MH 4DUYQ 1VQMA 1N8RC 4JBMA 4JI5Q 3RNUA 3KJPA 4JI7Q 3PO3H 1SFOH 2Q2TA 4B3RQ 1MIUA 2Z6KA 3PGZA 2E2IH 4GN3B 1LYLA 4BA1I 1Y14B 3W1BA 3K7AH 1EIYB 3H3VI 2JQOA 1TWGH 3T1YQ 1RL2A 1QUQB 2IX0A 2Y0SE 1L1OB 1YBYA 3WWVA 3RN5A 2DUDA 4JI6L 4QIWE 1MKHA 4HIDA 5IYCH 2ASBA 1ASYA 3GDEA 3NBHB 4KHZA 1HJPA 1HZAA 1L1OC 4LUZA 4JI8L 5C4XH 1YI2A 2OWOA 4B3TQ 2PMZE 4L5RC 5BR8L 3F1ZA 3DM3A 1NMFA 3B6YA 1KRTA 3D31A 4HJAA 1KD1C 2IHFA 2VZAA 5IYDH 1OXTA 2N8NA 2UUBL 5JJIA 1KAWA 2MQHA 3CCQA 5M3MG 3CXCA 2MFIA 5GAHC 4GOPC 4DUZL 2NZOA 4FDBA 2YTVA 1IBKL 4WJ3M 3G4SA 4DR6Q 4A3DG 4LFBQ 1IBLQ 3S1NH 4GLXA 1N32Q 3RN2A 2UUCQ 3PV0A 4JI1Q 4LUOA 1KC8C 1VQCA 1U0LA 4NXML 1YEZA 4A3BH 1BBWA 4LNQA 1UE6A 2JK8A 4JBWA 2IT1A 4XTCS 1UEBA 3EBEA 1T9HA 3HOXH 1UWVA 4JI4L 1LM0A 2OQ0A 1PHJA 2WAQE 2AWNA 1L1OA 1AE3A 3HKSA 4O2DA 1RIPA 1X9NA 1NY4A 1XMQL 2E5LQ 4A3LH 3CP0A 4DR2Q 2JA8G 3AFPA 4P75A 3PUXA 4JI1L 4POGA 1I94L 1K0RA 3CPWA 1AE2A 2MO0A 3GO5A 4YY3L 3G6EA 3I4OA 1XNQL 3H3VH 4A3MG 3FP9A 4JI0Q 3G48A 2VNUD 1VQKA 4PZ7A 4TQUS 1FVIA 4AIMA 2VW9A 3HOWG 2R7ZG 3HFZB 1KL9A 3I4NH 2ZM6L 3PO2H 2IY5B 4IFDI 4DV5Q 2NVQH 4RMFA 1SLJA 1SROA 1Q81C 4LF6Q 3K0XA 3D0FA 4UP7A 4BXXG 1VQJA 1EWIA 2XGTA 4QY7A 3M7NA 2F52A 3CD6A 2DGYA 2R93H 3F2BA 1MJCA 4DV7Q 2MO1A 2R6GA 2GVBA 3CC2A 3M4QA 1YIJA 1PVOA 2N78A 1XTDA 2I5HA 1GD7A 1VQIA 4QGUA 5EAYA 1NTGA 2OTJA 2XTIA 3UE0A 4EQ5A 5IE8A 2LXJA 1ASZA 3S15H 3H0GH 4JBJA 4JBKA 5AJ3Q 3CCMA 3HOUG 1PYSB 4GKKL 4IPCA 4BXXH 1N32L 2K5VA 4X64Q 1OXVA 4P74A 1Q46A 3TQYA 4A3FH 1WFQA 4DR3Q 1VQ7A 4JV5L 1TWAH 5C0XG 1Z9FA 1X56A 2RCNA 4C2MH 4JCVE 4A3BG 3GTGH 3BZKA 3F8TA 1Q82C 1HNWQ 2UUAQ 1IYJB 4A3FG 1MJEA 4EX5A 3CCJA 4R4QA 3JAMc 4DR6L 4LFBL 1LTLA 3AYHB 5FLMH 3ULPA 1VQDA 1E24A 4JI8Q 4B3TL 1TWHH 4KHPL 4P72A 5IYCG 3U4ZA 1K8AC 3E9IA 1C9OA 1IZ6A 2KENA 2Z0SA 3PO2G 2UU9L 1R9TH 2CKZB 3CCSA 2A1AA 4L5QA 4C3HH 1HZ9A 2D62A 3DLLA 5H1SE 1KQSA 4GLAC 3TS2A 4DV4L 1SRUA 1I50H 1L2FA 5C44H 1NBWA 4IPDA 3RLOA 4DV2L 4BA2I 3G71A 4DV3L 4IOAA 1PH8A 4JYAQ 1NJIC 3K80C 2AKWB 2BA0A 2CWAA 4YCWA 3GTOH 2D0OA 1WI5A 4A93H 4Y52H 1VQLA 1X65A 1PH3A 3CPFA 2D0PA 2ZJPA 1C0AA 4GKJL 4OO1I 1YJWA 4A3KH 1A63A 2RHSB 3J80i 3S16H 5LMUQ 2BA1A 1VQGA 3BU2A 1TWCH 4JYAL 1HR0L 4P73A 1XMOQ 2UU9Q 4X66L 1KIXA 2YU9H 5HGQA 4AQYQ 2RHQB 2Z6KC 1Q1BA 4GOPB 1L0WA 1Q8KA 2JE6I 5FJ8G 1JJ2A 1SR3A 4L5SA 1FJGQ 1VQPA 4LF4L 1YHBA 2GN5A 3FKIG 4JI3L 4X6AH 2KBNA 1JMCA 4JI4Q 1OTCA 1CKMA 3K7UC 4AYBE 1CSQA 4DV4Q 3ER0A 3I2ZA 2KCTA 2E2HH 3PCOB 4HJ9A 4BBSG 3CMEA 4JOIA 4B3RL 4IFDJ 3CCLA 4C3IH 4DR3L 1OXXK 4IPHA 3CCEA 4GNXC 3KOJA 4LFAQ 4HIKA 4L5TA 2R7DA 3UDIA 3H0GG 3K8AA 3PUYA 1S40A 3CAMA 4LF8Q 4GS3A 3TREA 3UDFA 2KHJA 1GVPA 3J7A5 5C0XJ 1IBML 1G6PA 3PIOA 1EFWA 4HJ7A 3HOYG 2ZM6Q 2R7FA 4O0AA 3T1HQ 1WCMH 3HKZE 4IJHA 3M4PA 2LSSA 2B29A 2JEBI 5GROA 5IYBG 2OCEA 1XNRL 4R4CA 2VQEL 4A3IH 1S3OA 3S14H 1EQQA 1YNXA 2A19A 1EIFA 4A3JH 1N34L 1Q86C 4R4OA 4A3KG 4LF6L 1P8LA 1N9WA 1PYBA 3KDFA 4BBRH 5JEAG 1A8VA 1BBUA 1XMQQ 4K0KL 4DR4L 5IWAL 2CWPA 2V1CC 1B7YB 3S24A 3J80c 1YITA 1K9MC 4A3GH 1VCIA 1XNRQ 3CCUA 4OWTB 4DPGA 4JI7L 3HOVG 4KLKA 3A74A 3GTKH 2ZTEA 4DK6C 4YCUA 4DV0L 2PQAA 1PH6A 1XPUA 4GN5A 3CF5A 3AQQA 3KJOA 2ZTDA 3GTLH 2WP8J 1W3SA 3PUVA 1WYDA 3I7FA 2HHHQ 4JV5Q 2R92H 3GTJH 4BY7G 2E2JH 3CW2C 5FJ8H 4HJ5A 4MTNA 4DR7Q 3NENA 1QZGA 2N3SA 2ID0A 4BBRG 1WJJA 3EN2A 3OYYA 3KYHC 5M3FG 1GM5A 4DR5L 4OX9Q 2KHIA 5BR8Q 1HZBA 1SMXA 2JA6H 3MEFA 3ZJYC 1Y1WH 4POFA 1KRSA 4DKAC 4A93G 1Y1VH 1N34Q 1QVCA 3PUWA 2H5XA 1VQNA 2L15A 5M3MH 1OXUA 3L2PA 1HZCA 1Q1EA 4DV1L 1IBLL 1CKOA 4OX9L 3S17H 4A3GG 3PO3G 2YTYA 2VL6A 2JA7H 1I5FA 1B70B 1QVFA 1Q12A 1PFSA 2VQFL 1QUQA 2JA9A 3M4OH 3I4MG 4NXMQ 4QQBX 5E7NA 4PZ8A 1J5EQ 4LFCQ 1P16A 3AFQA 2QEXA 4IFDG 4X65Q 2UUBQ 3STBD 2AWOA 4Y7NH 4DR7L 1PH9A 1Q7YC 2HHHL 3I56A 4OWWB 3A5ZB 2E5LL 1VQ5A 3CQZH 1Z47A 1O7IA 2MNAA 2K4KA 4DV2Q 4YCVA 5IP7G 2I5LX 4GLVB 4NPSA 2EQSA 2QGQA 5ELOA 2JEAI 4DR2L 3UDGA 3GTMH 3KFUA 1XNQQ 2YV5A 2FXQA 1E7ZA 4JC0A 1I94Q 4NXNQ 2HIXA 3M85A 2YYZA 2AMCB 1JJGA 1C7YA 4KI0A 4P71A 3OTOQ 5JJLA 1XMOL 1VQ8A 4LF9Q 1QVGA 3CCRA 3UDXA 1S72A 2WB1G 2NVXH 1A62A 1IXRA 1VQOA 1V43A 2NVTH 3BJUA 1HH2P 3KF8B 3ERSX 4DR5Q 4NXNL 2JA5H 4XIGS 1J6QA 2R7ZH 1I3QH 1H95A 3NEMA 4IOCA 3OW2A 1TWFH 4GNXB 5K36G 5FLMG 1VQAA 4APVA 2K75A 2VY3A 1HR0W 3GD7A 2I0QA 2JA8H 2IX1A 3UE1A 2UUAL 1X3GA 1HNXL 4IPGA 1VS0A 1GKHA 1IBMQ 3I4NG 2BH2A 1KXLA 1U5KA 3PSIA 1K83H 1GO3E 3RLNA 5IYDG 4ALPA 2BH8A 2VUMH 2I5MX 5IP9H 1VQ4A 2R93G 4WJ4A 2HQLA 1TXYA 4YHHQ 5IY0A 4LF4Q 4MZ9A 3TRZA 5M5WH 3ULJA 4OONA 2UXDQ 3CCVA 3HOWH 3RZOH 2K50A 2ZTCA 5ELNA 1M1KC 1KHIA 4DR1Q 3E9HA 4LUVA 4DUYL 1Y1WG 1HNZQ 5DLQE 5JEAJ 3H15A 1JJCB 4A4IA 2WFWA 3KF6B 4MNOA 2PNHA 4OWXB 1UE5A 5IP9G 4DUZQ 1J5EL 4A3MH 1A0IA 2HT1A 4LF8L 4RG1A 3FHWA 4PG3A 2Q2IA 1YHAA 4C3JH 3CC7A 1JB7A 5IP7H 1HNXQ 2E8GA 3HOUH 2K5NA 1NMGA 4DK3C 3S1RH 2VS1A 1PH1A 1HNZL 4A75A 4A3DH 4JI0L 5HY6A 4PZ6A 3W5OA 4B3SQ 1XJVA 1CUKA 3RZDH 3J81j 4DV3Q 3A5UA 4LFCL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PI2 A;  4R1J A;  1EUJ A;  1CKN B;  2NZH A;  4YHH L;  3OTO L;  5LMN W;  3E0E A;  4YWM A;  1X54 A;  3JAM i;  3T1Y L;  1FJG L;  2UXB L;  2UXD L;  4LF9 L;  5FLX c;  4GN4 B;  2WAQ G;  1YJN A;  1VQE A;  1X6O A;  2ZJQ A;  5IT9 c;  4A3I G;  1FGU A;  2C35 B;  4LF7 L;  4GKK Q;  4YWK A;  3RR5 A;  1PV4 A;  4QL5 A;  4DV1 Q;  4UPA A;  1QZH A;  3BZC A;  1G51 A;  4UP8 A;  4B3S L;  3PF5 A;  3CMA A;  1PH7 A;  4A3E H;  1VQB A;  3KF6 A;  4BY1 H;  3GTP H;  1N33 Q;  2JJQ A;  4OXP A;  4X62 L;  2VQF Q;  3HOY H;  1UE7 A;  2B3G A;  2ZJR A;  1I6H H;  1K73 C;  2F3I A;  4A3E G;  2IHE A;  3PIP A;  1IBK Q;  4JI2 L;  2CCZ A;  1FL0 A;  2PI2 E;  3L0O A;  1K3R A;  4DAM A;  2JA7 G;  4K0K Q;  3PUZ A;  3IRB A;  2N49 A;  3STB C;  3I55 A;  3TEH B;  3U58 A;  3A0J A;  1YHQ A;  1IL2 A;  2GVA A;  5M5X H;  3HOX G;  1WOC A;  4X64 L;  3PF4 A;  4BBS H;  3S2H H;  4IJL A;  4X62 Q;  5GQO A;  1EYG A;  1D7Q A;  1CSP A;  3CC4 A;  5C3E G;  1E1O A;  1EQR A;  2VQE Q;  2UXC L;  2A8V A;  1XPO A;  4A3L G;  5JJK A;  4GKJ Q;  3NEL A;  4R4T A;  3U4V A;  4JOI C;  1EOV A;  4DR4 Q;  4LF7 Q;  3S1Q H;  4JI5 L;  3HKZ G;  4KHP Q;  2HIV A;  2F4V L;  4DV0 Q;  3F2D A;  4J15 A;  1XPR A;  2JA5 G;  3AEV A;  4LFA L;  1E3P A;  3Q8D A;  1K8G A;  2B63 H;  2EXD A;  4H02 A;  2VUM G;  1HNW L;  3K81 C;  1VQH A;  3I4M H;  1W2B A;  1YVC A;  1N36 Q;  4ME3 A;  1M90 C;  4B3M Q;  4LW1 A;  2UUC L;  5IWA Q;  1JT8 A;  2AHO B;  1VQF A;  2F4V Q;  1V1Q A;  4OO1 G;  1N33 L;  2EIF A;  2LXK A;  3RLF A;  1G29 1;  1OXS C;  3L7Z C;  4JG2 A;  4YY3 Q;  2UXC Q;  3LGJ A;  3S2D H;  1LUZ A;  3M3Y H;  1WCM G;  3VDY A;  4QJF A;  4NB3 A;  1DGS A;  1X55 A;  4UP9 A;  4BY7 H;  1PA6 A;  3KLW A;  4YWL A;  3EIV A;  3JC6 6;  3TS0 A;  3FKI H;  3ICE A;  1PH4 A;  1BVS A;  1E22 A;  5M3F H;  2K5H A;  1SN8 A;  2NVY H;  1PH5 A;  2Q2H A;  4R4I A;  5C0X I;  4LWC A;  4DAY B;  4DV6 L;  4GOP A;  2ES2 A;  4X66 Q;  4A3C G;  4HIM A;  5IYB H;  2OQK A;  3J7Z C;  1X3F A;  2K52 A;  4JI2 Q;  4DR1 L;  3T1H L;  2OTL A;  4AH6 A;  5M5Y H;  3HOZ G;  5C4X G;  2CFM A;  5LMN Q;  1X3E A;  5GAD C;  5GAE C;  1YJ9 A;  4LF5 Q;  3GTQ H;  1VQ9 A;  1V9P A;  1UE1 A;  1B8A A;  1Y1V G;  1CKN A;  4BY1 G;  4HJ8 A;  4DNI A;  5C4J H;  4HIO A;  4UY8 C;  3HOZ H;  5J3B A;  1HR0 Q;  2ALY B;  1PH2 A;  3HOV H;  4AQY L;  4A3C H;  3U50 C;  2CQO A;  2WB1 E;  3SGI A;  2Y0S G;  2UXB Q;  2K14 A;  4PMW A;  4JI3 Q;  4JI6 Q;  2JA6 G;  2R92 G;  1AH9 A;  4AYB G;  3J81 i;  3ULL A;  2ATW A;  3F2C A;  1NE3 A;  2YTX A;  2QA4 A;  5LMU L;  4DV7 L;  4IO9 A;  2KCM A;  2B63 G;  1VQ6 A;  2PQA B;  4GNX A;  3W1G A;  3J81 c;  2Q2U A;  1D8L A;  5C44 G;  1YZ6 A;  4DV6 Q;  1BKB A;  4A76 A;  4A3J G;  1E1T A;  2NN6 I;  1SE8 A;  5GAG C;  4TVA B;  4X65 L;  2RF4 A;  4DV5 L;  1N36 L;  4B3M L;  5C3E H;  2NN6 G;  4LF5 L;  3MXN B;  5AJ3 L;  1JE5 A;  3KDF B;  3M9B A;  5LMN L;  3S1M H;  4DUY Q;  1VQM A;  1N8R C;  4JBM A;  4JI5 Q;  3RNU A;  3KJP A;  4JI7 Q;  3PO3 H;  1SFO H;  2Q2T A;  4B3R Q;  1MIU A;  2Z6K A;  3PGZ A;  2E2I H;  4GN3 B;  1LYL A;  4BA1 I;  1Y14 B;  3W1B A;  3K7A H;  1EIY B;  3H3V I;  2JQO A;  1TWG H;  3T1Y Q;  1RL2 A;  1QUQ B;  2IX0 A;  2Y0S E;  1L1O B;  1YBY A;  3WWV A;  3RN5 A;  2DUD A;  4JI6 L;  4QIW E;  1MKH A;  4HID A;  5IYC H;  2ASB A;  1ASY A;  3GDE A;  3NBH B;  4KHZ A;  1HJP A;  1HZA A;  1L1O C;  4LUZ A;  4JI8 L;  5C4X H;  1YI2 A;  2OWO A;  4B3T Q;  2PMZ E;  4L5R C;  5BR8 L;  3F1Z A;  3DM3 A;  1NMF A;  3B6Y A;  1KRT A;  3D31 A;  4HJA A;  1KD1 C;  2IHF A;  2VZA A;  5IYD H;  1OXT A;  2N8N A;  2UUB L;  5JJI A;  1KAW A;  2MQH A;  3CCQ A;  5M3M G;  3CXC A;  2MFI A;  5GAH C;  4GOP C;  4DUZ L;  2NZO A;  4FDB A;  2YTV A;  1IBK L;  4WJ3 M;  3G4S A;  4DR6 Q;  4A3D G;  4LFB Q;  1IBL Q;  3S1N H;  4GLX A;  1N32 Q;  3RN2 A;  2UUC Q;  3PV0 A;  4JI1 Q;  4LUO A;  1KC8 C;  1VQC A;  1U0L A;  4NXM L;  1YEZ A;  4A3B H;  1BBW A;  4LNQ A;  1UE6 A;  2JK8 A;  4JBW A;  2IT1 A;  4XTC S;  1UEB A;  3EBE A;  1T9H A;  3HOX H;  1UWV A;  4JI4 L;  1LM0 A;  2OQ0 A;  1PHJ A;  2WAQ E;  2AWN A;  1L1O A;  1AE3 A;  3HKS A;  4O2D A;  1RIP A;  1X9N A;  1NY4 A;  1XMQ L;  2E5L Q;  4A3L H;  3CP0 A;  4DR2 Q;  2JA8 G;  3AFP A;  4P75 A;  3PUX A;  4JI1 L;  4POG A;  1I94 L;  1K0R A;  3CPW A;  1AE2 A;  2MO0 A;  3GO5 A;  4YY3 L;  3G6E A;  3I4O A;  1XNQ L;  3H3V H;  4A3M G;  3FP9 A;  4JI0 Q;  3G48 A;  2VNU D;  1VQK A;  4PZ7 A;  4TQU S;  1FVI A;  4AIM A;  2VW9 A;  3HOW G;  2R7Z G;  3HFZ B;  1KL9 A;  3I4N H;  2ZM6 L;  3PO2 H;  2IY5 B;  4IFD I;  4DV5 Q;  2NVQ H;  4RMF A;  1SLJ A;  1SRO A;  1Q81 C;  4LF6 Q;  3K0X A;  3D0F A;  4UP7 A;  4BXX G;  1VQJ A;  1EWI A;  2XGT A;  4QY7 A;  3M7N A;  2F52 A;  3CD6 A;  2DGY A;  2R93 H;  3F2B A;  1MJC A;  4DV7 Q;  2MO1 A;  2R6G A;  2GVB A;  3CC2 A;  3M4Q A;  1YIJ A;  1PVO A;  2N78 A;  1XTD A;  2I5H A;  1GD7 A;  1VQI A;  4QGU A;  5EAY A;  1NTG A;  2OTJ A;  2XTI A;  3UE0 A;  4EQ5 A;  5IE8 A;  2LXJ A;  1ASZ A;  3S15 H;  3H0G H;  4JBJ A;  4JBK A;  5AJ3 Q;  3CCM A;  3HOU G;  1PYS B;  4GKK L;  4IPC A;  4BXX H;  1N32 L;  2K5V A;  4X64 Q;  1OXV A;  4P74 A;  1Q46 A;  3TQY A;  4A3F H;  1WFQ A;  4DR3 Q;  1VQ7 A;  4JV5 L;  1TWA H;  5C0X G;  1Z9F A;  1X56 A;  2RCN A;  4C2M H;  4JCV E;  4A3B G;  3GTG H;  3BZK A;  3F8T A;  1Q82 C;  1HNW Q;  2UUA Q;  1IYJ B;  4A3F G;  1MJE A;  4EX5 A;  3CCJ A;  4R4Q A;  3JAM c;  4DR6 L;  4LFB L;  1LTL A;  3AYH B;  5FLM H;  3ULP A;  1VQD A;  1E24 A;  4JI8 Q;  4B3T L;  1TWH H;  4KHP L;  4P72 A;  5IYC G;  3U4Z A;  1K8A C;  3E9I A;  1C9O A;  1IZ6 A;  2KEN A;  2Z0S A;  3PO2 G;  2UU9 L;  1R9T H;  2CKZ B;  3CCS A;  2A1A A;  4L5Q A;  4C3H H;  1HZ9 A;  2D62 A;  3DLL A;  5H1S E;  1KQS A;  4GLA C;  3TS2 A;  4DV4 L;  1SRU A;  1I50 H;  1L2F A;  5C44 H;  1NBW A;  4IPD A;  3RLO A;  4DV2 L;  4BA2 I;  3G71 A;  4DV3 L;  4IOA A;  1PH8 A;  4JYA Q;  1NJI C;  3K80 C;  2AKW B;  2BA0 A;  2CWA A;  4YCW A;  3GTO H;  2D0O A;  1WI5 A;  4A93 H;  4Y52 H;  1VQL A;  1X65 A;  1PH3 A;  3CPF A;  2D0P A;  2ZJP A;  1C0A A;  4GKJ L;  4OO1 I;  1YJW A;  4A3K H;  1A63 A;  2RHS B;  3J80 i;  3S16 H;  5LMU Q;  2BA1 A;  1VQG A;  3BU2 A;  1TWC H;  4JYA L;  1HR0 L;  4P73 A;  1XMO Q;  2UU9 Q;  4X66 L;  1KIX A;  2YU9 H;  5HGQ A;  4AQY Q;  2RHQ B;  2Z6K C;  1Q1B A;  4GOP B;  1L0W A;  1Q8K A;  2JE6 I;  5FJ8 G;  1JJ2 A;  1SR3 A;  4L5S A;  1FJG Q;  1VQP A;  4LF4 L;  1YHB A;  2GN5 A;  3FKI G;  4JI3 L;  4X6A H;  2KBN A;  1JMC A;  4JI4 Q;  1OTC A;  1CKM A;  3K7U C;  4AYB E;  1CSQ A;  4DV4 Q;  3ER0 A;  3I2Z A;  2KCT A;  2E2H H;  3PCO B;  4HJ9 A;  4BBS G;  3CME A;  4JOI A;  4B3R L;  4IFD J;  3CCL A;  4C3I H;  4DR3 L;  1OXX K;  4IPH A;  3CCE A;  4GNX C;  3KOJ A;  4LFA Q;  4HIK A;  4L5T A;  2R7D A;  3UDI A;  3H0G G;  3K8A A;  3PUY A;  1S40 A;  3CAM A;  4LF8 Q;  4GS3 A;  3TRE A;  3UDF A;  2KHJ A;  1GVP A;  3J7A 5;  5C0X J;  1IBM L;  1G6P A;  3PIO A;  1EFW A;  4HJ7 A;  3HOY G;  2ZM6 Q;  2R7F A;  4O0A A;  3T1H Q;  1WCM H;  3HKZ E;  4IJH A;  3M4P A;  2LSS A;  2B29 A;  2JEB I;  5GRO A;  5IYB G;  2OCE A;  1XNR L;  4R4C A;  2VQE L;  4A3I H;  1S3O A;  3S14 H;  1EQQ A;  1YNX A;  2A19 A;  1EIF A;  4A3J H;  1N34 L;  1Q86 C;  4R4O A;  4A3K G;  4LF6 L;  1P8L A;  1N9W A;  1PYB A;  3KDF A;  4BBR H;  5JEA G;  1A8V A;  1BBU A;  1XMQ Q;  4K0K L;  4DR4 L;  5IWA L;  2CWP A;  2V1C C;  1B7Y B;  3S24 A;  3J80 c;  1YIT A;  1K9M C;  4A3G H;  1VCI A;  1XNR Q;  3CCU A;  4OWT B;  4DPG A;  4JI7 L;  3HOV G;  4KLK A;  3A74 A;  3GTK H;  2ZTE A;  4DK6 C;  4YCU A;  4DV0 L;  2PQA A;  1PH6 A;  1XPU A;  4GN5 A;  3CF5 A;  3AQQ A;  3KJO A;  2ZTD A;  3GTL H;  2WP8 J;  1W3S A;  3PUV A;  1WYD A;  3I7F A;  2HHH Q;  4JV5 Q;  2R92 H;  3GTJ H;  4BY7 G;  2E2J H;  3CW2 C;  5FJ8 H;  4HJ5 A;  4MTN A;  4DR7 Q;  3NEN A;  1QZG A;  2N3S A;  2ID0 A;  4BBR G;  1WJJ A;  3EN2 A;  3OYY A;  3KYH C;  5M3F G;  1GM5 A;  4DR5 L;  4OX9 Q;  2KHI A;  5BR8 Q;  1HZB A;  1SMX A;  2JA6 H;  3MEF A;  3ZJY C;  1Y1W H;  4POF A;  1KRS A;  4DKA C;  4A93 G;  1Y1V H;  1N34 Q;  1QVC A;  3PUW A;  2H5X A;  1VQN A;  2L15 A;  5M3M H;  1OXU A;  3L2P A;  1HZC A;  1Q1E A;  4DV1 L;  1IBL L;  1CKO A;  4OX9 L;  3S17 H;  4A3G G;  3PO3 G;  2YTY A;  2VL6 A;  2JA7 H;  1I5F A;  1B70 B;  1QVF A;  1Q12 A;  1PFS A;  2VQF L;  1QUQ A;  2JA9 A;  3M4O H;  3I4M G;  4NXM Q;  4QQB X;  5E7N A;  4PZ8 A;  1J5E Q;  4LFC Q;  1P16 A;  3AFQ A;  2QEX A;  4IFD G;  4X65 Q;  2UUB Q;  3STB D;  2AWO A;  4Y7N H;  4DR7 L;  1PH9 A;  1Q7Y C;  2HHH L;  3I56 A;  4OWW B;  3A5Z B;  2E5L L;  1VQ5 A;  3CQZ H;  1Z47 A;  1O7I A;  2MNA A;  2K4K A;  4DV2 Q;  4YCV A;  5IP7 G;  2I5L X;  4GLV B;  4NPS A;  2EQS A;  2QGQ A;  5ELO A;  2JEA I;  4DR2 L;  3UDG A;  3GTM H;  3KFU A;  1XNQ Q;  2YV5 A;  2FXQ A;  1E7Z A;  4JC0 A;  1I94 Q;  4NXN Q;  2HIX A;  3M85 A;  2YYZ A;  2AMC B;  1JJG A;  1C7Y A;  4KI0 A;  4P71 A;  3OTO Q;  5JJL A;  1XMO L;  1VQ8 A;  4LF9 Q;  1QVG A;  3CCR A;  3UDX A;  1S72 A;  2WB1 G;  2NVX H;  1A62 A;  1IXR A;  1VQO A;  1V43 A;  2NVT H;  3BJU A;  1HH2 P;  3KF8 B;  3ERS X;  4DR5 Q;  4NXN L;  2JA5 H;  4XIG S;  1J6Q A;  2R7Z H;  1I3Q H;  1H95 A;  3NEM A;  4IOC A;  3OW2 A;  1TWF H;  4GNX B;  5K36 G;  5FLM G;  1VQA A;  4APV A;  2K75 A;  2VY3 A;  1HR0 W;  3GD7 A;  2I0Q A;  2JA8 H;  2IX1 A;  3UE1 A;  2UUA L;  1X3G A;  1HNX L;  4IPG A;  1VS0 A;  1GKH A;  1IBM Q;  3I4N G;  2BH2 A;  1KXL A;  1U5K A;  3PSI A;  1K83 H;  1GO3 E;  3RLN A;  5IYD G;  4ALP A;  2BH8 A;  2VUM H;  2I5M X;  5IP9 H;  1VQ4 A;  2R93 G;  4WJ4 A;  2HQL A;  1TXY A;  4YHH Q;  5IY0 A;  4LF4 Q;  4MZ9 A;  3TRZ A;  5M5W H;  3ULJ A;  4OON A;  2UXD Q;  3CCV A;  3HOW H;  3RZO H;  2K50 A;  2ZTC A;  5ELN A;  1M1K C;  1KHI A;  4DR1 Q;  3E9H A;  4LUV A;  4DUY L;  1Y1W G;  1HNZ Q;  5DLQ E;  5JEA J;  3H15 A;  1JJC B;  4A4I A;  2WFW A;  3KF6 B;  4MNO A;  2PNH A;  4OWX B;  1UE5 A;  5IP9 G;  4DUZ Q;  1J5E L;  4A3M H;  1A0I A;  2HT1 A;  4LF8 L;  4RG1 A;  3FHW A;  4PG3 A;  2Q2I A;  1YHA A;  4C3J H;  3CC7 A;  1JB7 A;  5IP7 H;  1HNX Q;  2E8G A;  3HOU H;  2K5N A;  1NMG A;  4DK3 C;  3S1R H;  2VS1 A;  1PH1 A;  1HNZ L;  4A75 A;  4A3D H;  4JI0 L;  5HY6 A;  4PZ6 A;  3W5O A;  4B3S Q;  1XJV A;  1CUK A;  3RZD H;  3J81 j;  4DV3 Q;  3A5U A;  4LFC L; 
#chains in the Genus database with same CATH topology
 2PI2 A;  1U4L A;  1CKN B;  3JAM i;  2F0J A;  2UXD L;  5FLX c;  2K5Q A;  2Z6B A;  5J22 A;  1FGU A;  1KLG D;  4YWK A;  2AQ3 B;  3C3L A;  1QZH A;  2SOB A;  1LT6 D;  4A3E H;  3OHX C;  3GTP H;  5NUC A;  1ESR A;  1FNW A;  2B3G A;  1K73 C;  2R7Z B;  4JI2 L;  2J0T D;  2F0I A;  3PIP A;  1FL0 A;  2PI2 E;  3L0O A;  2JA7 G;  2TSS A;  1QCB D;  1SND A;  3IRB A;  1YHQ A;  3M4O B;  2GVA A;  3PF4 A;  1WOC A;  4BBS H;  1SE4 A;  4IJL A;  4X62 Q;  5HUR A;  1E1O A;  4Q0F A;  4X3T A;  3T51 B;  2VQE Q;  2A8V A;  4R4T A;  5CV6 A;  3U4V A;  4JOI C;  1EOV A;  4DR4 Q;  1Y1V B;  3ERQ A;  2RSO A;  3HKZ G;  2PMZ B;  3U9O A;  3P7J A;  3EQL C;  3F2D A;  2OT2 A;  3AEV A;  1A6X A;  2EXD A;  1TQO A;  1HNW L;  4ME3 A;  4LW1 A;  4IUU A;  3NQT A;  4ZKB B;  1IYU A;  1Y8P B;  3HOU B;  3RUZ A;  2EIF A;  3RLF A;  1EEI D;  1ZEQ X;  4DA2 A;  3C2P A;  1LUZ A;  2HCI A;  4G7H C;  1WTO A;  1OO9 B;  4QJF A;  2A6E D;  1DGS A;  4C3H G;  5ELF A;  1PH4 A;  1BVS A;  4Z9C B;  1S4Z A;  2NVY H;  4K2L A;  1PH5 A;  2Q2H A;  4BBR B;  3GTJ B;  3NXW A;  4JVZ A;  4XDX A;  4XQJ A;  4A3C G;  4X66 Q;  2FHT A;  4YIJ A;  2K52 A;  4JI2 Q;  5D3I B;  2HDM A;  4AH6 A;  2OTL A;  3HOZ G;  2HDL A;  5LMN Q;  3GTQ H;  1VQ9 A;  5M5X B;  4C3I B;  4N9T A;  1Y1V G;  4UY8 C;  2G5D A;  4HIO A;  2E75 C;  1WTX A;  1NUC A;  5J3B A;  1HR0 Q;  3GV3 A;  1PH2 A;  3U50 C;  1TS4 A;  2CQO A;  1LO5 D;  1K8O A;  2LKV A;  2WB1 E;  3SGI A;  4DNR B;  4JI6 Q;  2B2Y A;  1K3B C;  1AH9 A;  3URY A;  3VA7 A;  1XTC D;  2NB0 A;  3ULL A;  3CU7 A;  3F2C A;  3GTQ B;  4IO9 A;  2XN9 C;  1VQ6 A;  4I7A A;  3J81 c;  1YZ6 A;  1EEF D;  4DV6 Q;  1VF5 C;  1B2T A;  4X65 L;  4ABN A;  4DV5 L;  1CA6 A;  2M9V A;  4ZRZ A;  1CK1 A;  4EQN A;  4LF5 L;  1PMR A;  3M9B A;  3S1M H;  4JI5 Q;  3RNU A;  4A3M B;  4JI7 Q;  2Q2T A;  3PGZ A;  3J80 L;  5I6W A;  4GN3 B;  1EY4 A;  4RCO A;  2L1B A;  2E76 C;  3W1B A;  1EIY B;  5BN3 A;  1I3Q B;  4AYB B;  3MAQ A;  3H3V I;  5AFW A;  1GUS A;  1DJR D;  1SYE A;  1JR0 D;  3T16 A;  3WWV A;  1A2T A;  2L5T A;  5IYC H;  5C3X A;  3K0Y A;  2ASB A;  1HRJ A;  3HP3 A;  4KHZ A;  1HJP A;  1YNJ D;  2NVY B;  5C4X H;  1YI2 A;  4K5X A;  1ROD A;  3DM3 A;  4Y7N B;  2BE5 D;  1OXT A;  3SK5 A;  1KAW A;  2MFI A;  1Y8O B;  1H9R A;  4DUZ L;  1IBK L;  2YTV A;  4K2K A;  3G4S A;  1MSG A;  4DR6 Q;  4A3D G;  2MPM A;  1N32 Q;  4BS9 A;  3N52 A;  2K7V A;  3A8J E;  4A3B H;  1DOL A;  4JBW A;  1UEB A;  1D6E C;  4L63 B;  2OQ0 A;  1L1O A;  3ITP A;  1SE3 A;  1X9N A;  4IZ8 A;  5ELE A;  4RCN A;  2JA8 G;  3PQI A;  1BDO A;  1I94 L;  1AE2 A;  2R93 H;  1EY7 A;  5FLX E;  1WD0 A;  3H3V H;  4A3M G;  4JI0 Q;  2O4X A;  3G48 A;  2VNU D;  1L0Y B;  3AB9 A;  4TQU S;  4KTA A;  3QWN A;  4FO2 A;  4DV5 Q;  2F0W A;  4K6D A;  2WV6 D;  3K0X A;  4QY7 A;  2F52 A;  3C1E A;  3VR4 A;  1SNC A;  1D5X C;  3CC2 A;  2GVB A;  4KY6 A;  3CQZ B;  3J7A F;  2N78 A;  1GD7 A;  4QGU A;  5K5P A;  2Y0S B;  4EQ5 A;  3S15 H;  4KY5 A;  2F0K A;  1ILQ A;  5JPN C;  2PYK A;  3CCM A;  3HOU G;  1PYS B;  3OWE B;  1N32 L;  3NSW A;  5IGE A;  2EJF C;  4NP5 A;  3AMU A;  2QEJ C;  2SEB D;  1Z9F A;  2OEO A;  4NDX A;  3GTG H;  4N8F A;  4EX5 A;  1CFM A;  1X3Q A;  1IKL A;  5IGB A;  1VQD A;  4HAE A;  4A93 B;  3ND8 A;  1SNM A;  3E9I A;  4K6L A;  3Q23 A;  2CKZ B;  5G3L D;  4C3H H;  3TP8 A;  2Z8L A;  2WB1 B;  4KHV A;  2WAQ B;  4KK7 A;  5H1S E;  1KQS A;  1L2F A;  1S5E D;  5C44 H;  4Q5V A;  1D2B A;  3RLO A;  4CKC A;  1UAP A;  2CWA A;  1WI5 A;  4H13 C;  1GJX A;  5C44 B;  2SNS A;  3CPF A;  2BDO A;  4LAA A;  4V19 0;  1ML0 D;  2LMC B;  1C0A A;  1GHK A;  1RHP A;  1A63 A;  2RHS B;  3J80 i;  2BA1 A;  1VQG A;  3BU2 A;  1XMO Q;  2QDL A;  2YU9 H;  5HGQ A;  2G9H D;  1Q1B A;  4M8A A;  4QUC A;  2JE6 I;  5FJ8 G;  5FK9 C;  1JJ2 A;  4NKL A;  1XWE A;  2NZ1 D;  3R93 A;  2B2V C;  1ESF A;  1F2Y A;  2OF1 A;  1OTC A;  1CSQ A;  1Y8N B;  2E2H H;  4BBS G;  2NYZ D;  5JEA H;  4DR3 L;  4HIK A;  2CH4 A;  3K8A A;  3PUY A;  4LF8 Q;  4GS3 A;  3QOL A;  3UDF A;  1GVP A;  1BBX C;  2Z4I A;  1EFW A;  3T1H Q;  1WCM H;  1RDP D;  4IJH A;  2D5D A;  4RGN A;  4HMJ A;  4H44 C;  2LSS A;  1SYC A;  5IIF A;  5IYB G;  2KOL A;  1XNR L;  4R4C A;  2A69 C;  4XYQ A;  1VF7 A;  4CDC C;  1YNX A;  1LTI D;  4RAU C;  1Q86 C;  1P8L A;  1LTB D;  3KDF A;  5JEA G;  3GQB A;  4K0K L;  1SYF A;  4C3I G;  5IWA L;  3J80 c;  2V1C C;  4OWT B;  4DPG A;  4KLK A;  4YCU A;  4DV0 L;  2IW3 A;  2EOT A;  4R8I A;  3KJO A;  2WP8 J;  4HED A;  2HHH Q;  2Q8R E;  3NQI A;  3SR1 A;  2BDN A;  4A3J B;  2N3S A;  2VUM B;  2ID0 A;  3AU7 A;  4BBR G;  1KDA A;  4DR5 L;  2RSN A;  5C3W A;  4MHE A;  4X3U A;  1KRS A;  1R9T B;  1QVC A;  2L9H A;  5M3M H;  3H91 A;  4X3K A;  5C6A A;  3S17 H;  1CKO A;  4A3G G;  3PO3 G;  2C9O A;  3O13 A;  3SE0 A;  2DN8 A;  3HGB A;  1B70 B;  1QVF A;  3SXH A;  4NXM Q;  4QQB X;  1P16 A;  3AFQ A;  4RKB A;  4XQQ A;  4IFD G;  2AWO A;  3QO2 A;  4DR7 L;  4FF3 A;  1Q7Y C;  1AN8 A;  5DM6 3;  2B2T C;  1Z47 A;  3L9A X;  3R8B A;  2JEA I;  2I5L X;  3J7Y W;  1A2U A;  4BBS B;  4DR2 L;  4J1M A;  3UDG A;  1PRT D;  1XNQ Q;  4JC0 A;  1UNS A;  3E0J A;  4IUP A;  1DM0 B;  2AMC B;  1ENF A;  4KI0 A;  5JJL A;  3PMF A;  1XMO L;  1VQ8 A;  4F7X A;  5DNF A;  4LF9 Q;  3J80 E;  3F2U A;  1B1Z A;  1IXR A;  2JN4 A;  1HH2 P;  2XWJ B;  2B2W A;  4XIG S;  1I3Q H;  4HN7 A;  3I3C A;  2P5Z X;  3NEM A;  4IOC A;  4X3S A;  3GTO B;  5K36 G;  3DM1 A;  3WDN A;  3HOW B;  1EOT A;  2I0Q A;  4DNT B;  5I2Y A;  2Z9H A;  5I9P A;  2UUA L;  1FD7 D;  4IUT A;  3I72 A;  3QB3 A;  1K83 H;  4WOR A;  1GO3 E;  3RLN A;  3T4A C;  5IP9 H;  1TR5 A;  1QNK A;  1STH A;  4WJ4 A;  1M8A A;  1LTR D;  4B08 A;  3S1M B;  1F2L A;  4MZ9 A;  3ULJ A;  5EGT A;  3HOW H;  5ELN A;  4QMG A;  4DR1 Q;  4LUV A;  4DUY L;  2K1B A;  2RA4 A;  1SBB B;  1TU2 B;  2PNH A;  5IP9 G;  3FHW A;  3IFT A;  1AW7 A;  2Q2I A;  2E8G A;  2K5N A;  3SDZ A;  2JSO A;  3R2I A;  4A3D H;  3W5O A;  4B3S Q;  1XJV A;  1DON A;  4OGQ C;  2F0O A;  3J81 j;  4O1N A;  4R1J A;  3I4N G;  3OTO L;  4YHH L;  2NZH A;  2NVT B;  3OIP A;  4YWM A;  1X54 A;  5EKL A;  2EYF A;  4GN4 B;  2HQE A;  2WAQ G;  3K58 A;  4GKJ L;  1VQE A;  1X6O A;  2F0F A;  4C3J G;  5IT9 c;  4G7Z C;  4GKK Q;  3RR5 A;  2FMC A;  1TVX A;  2CVR A;  2PW7 A;  1PH7 A;  4BY1 H;  2NTS A;  1N33 Q;  2EY6 A;  1UE7 A;  1I6H H;  4PMB A;  2F3I A;  2CCZ A;  4DU9 A;  3ND9 A;  4K0K Q;  2H4O A;  3PUZ A;  2O2L D;  1IL2 A;  3I55 A;  3TEH B;  2RDH A;  3SEB A;  2JA8 B;  2XNA C;  4X64 L;  2SDF A;  4RWS C;  2F4I A;  4LMQ D;  2Q8T A;  1EQR A;  1F77 A;  3V2T A;  4GKJ Q;  3NEL A;  1G91 A;  3A8K E;  3CHB D;  3VR5 A;  4JI5 L;  4IFD H;  3ERO A;  3V96 A;  1FNV A;  1SNP A;  3J81 E;  4I7Z C;  3TBI B;  1B3A A;  4IN3 A;  2B63 H;  1S5D D;  3K81 C;  1VQH A;  1M90 C;  1SXT A;  2RKS A;  1Q8I A;  3J81 L;  3TSS A;  1JT8 A;  1VQF A;  2NWG A;  1NAP A;  2F4V Q;  3LWE A;  4OO1 G;  1R4P B;  4PQX A;  3K5N A;  5C4J B;  4JG2 A;  3LGJ A;  3M3Y H;  3L3O C;  4NB3 A;  4CDF C;  1PA6 A;  3KLW A;  2QIL A;  3OMG A;  3FKI H;  4G57 A;  1ET6 A;  2KEC A;  2PCF B;  3MEH A;  2K5H A;  1SE2 A;  4R4I A;  5C0X I;  4BY1 B;  4LWC A;  1BOS A;  3T56 B;  2ES2 A;  5IYB H;  2M2L A;  1EY8 A;  1B9M A;  1X3F A;  4QB4 A;  4IUR A;  3A55 A;  5C4X G;  1X3E A;  5F2D A;  5GAD C;  5GAE C;  4ZKC B;  1V9P A;  3BDO A;  1B8A A;  4BY1 G;  4HJ8 A;  4DNI A;  4RGM A;  2ALY B;  4DK1 A;  1MI2 A;  5C4Z A;  5IGG A;  1HQM C;  1FYC A;  1TWC B;  1J9O A;  4PMW A;  4AYB G;  3J81 i;  4RFB A;  1PZK D;  1GUW A;  3D3R A;  4DV7 L;  5EPK A;  4GNX A;  3W1G A;  5J39 A;  3BYY B;  4A3E B;  5BN4 A;  1KNE A;  3H94 A;  5GAG C;  4TVA B;  2RF4 A;  5C5L A;  1EU4 A;  5E3F A;  2KCC A;  3I70 A;  2NN6 G;  2XIW A;  3NP8 A;  3GTM B;  3KDF B;  5LMN L;  1N8R C;  4HMI A;  4RKL A;  3GTL B;  2K5D A;  5EBD A;  1Y14 B;  3I4L A;  5FLX L;  1RL2 A;  3T1Y Q;  1HCZ A;  1XXG A;  1YBY A;  1NR4 A;  1GUN A;  2DUD A;  4JI6 L;  4HID A;  2L55 A;  2NBF A;  2QF7 A;  1U4M A;  3GDE A;  1KAA A;  5ELB A;  4TKO B;  5BR8 L;  3F1Z A;  4ZYS A;  1CHP D;  1NMF A;  2K03 A;  4O42 A;  4HJA A;  3FRP B;  5JJI A;  5M3M G;  2EJM A;  3CXC A;  1LT5 D;  4FF4 A;  1EYC A;  4A3F B;  4WJ3 M;  5FO8 B;  1IBL Q;  1TY2 A;  4K5W A;  1HA6 A;  3DMU A;  2UUC Q;  4JI1 Q;  1ZKO A;  1VQC A;  1U0L A;  1VMC A;  5G3L F;  1BBW A;  2JK8 A;  4CDE C;  1T9H A;  3HOX H;  1LM0 A;  2WAQ E;  2I46 A;  1TT2 A;  1C4Q A;  1AE3 A;  4O2D A;  2A6H C;  4UHV A;  1NY4 A;  1XMQ L;  2E5L Q;  3CP0 A;  3CPW A;  2MO0 A;  4YY3 L;  3I4O A;  3C46 A;  5D14 A;  1VQK A;  1MD2 D;  1PZI D;  4HR7 B;  3BYT B;  3WOF A;  1KL9 A;  1BF4 A;  1STN A;  2HUG A;  2KHS A;  1GHJ A;  1SRO A;  1Q81 C;  5A2Q L;  5JVH 3;  3CD6 A;  2D2C C;  2F0S A;  4H0L C;  2X6G A;  3F2B A;  4DV7 Q;  1TKW B;  1BCP D;  1EU3 A;  3M4Q A;  1XTD A;  2B8G A;  5EAY A;  5IE8 A;  2F0G A;  2ENB A;  4DGZ A;  5IGF A;  1SMY C;  3E3X A;  2DJF C;  3DEO A;  3QJY A;  1TS3 A;  2K5V A;  4X64 Q;  4P74 A;  1A3U A;  1Q46 A;  4ID6 A;  3TQY A;  1WFQ A;  3T53 B;  1VQ7 A;  1DOK A;  1TWA H;  2EY2 A;  5C0X G;  4A3B G;  1PRT B;  4JCV E;  4JPB W;  3S2D B;  1WTW A;  2CQA A;  3CCJ A;  4R4Q A;  4K14 A;  3JAM c;  4DR6 L;  3AYH B;  5FLM H;  1EWH A;  4MIU A;  3ULP A;  1E24 A;  1TWH H;  1RJT A;  4IUV A;  1IZ6 A;  2Z0S A;  2UU9 L;  1R9T H;  3CCS A;  5L37 A;  1NNX A;  2MHV A;  4L5Q A;  2X6L A;  2KJX A;  2R93 B;  1H9S A;  1UEA B;  4DV2 L;  2F3W A;  1NR2 A;  5KGU A;  4JYA Q;  1KDB A;  2AKW B;  2BA0 A;  3FDT A;  3JAM L;  2V4D A;  5ELC A;  2EYM A;  3SHL A;  3W2D A;  3HG9 A;  3RMH A;  3A7A B;  4FF2 A;  2J7Z A;  1HR0 L;  2K05 A;  4X66 L;  1QJO A;  5I6Y A;  1KIX A;  4AQY Q;  3IFD A;  4CBV A;  4GOP B;  1L0W A;  3D6C A;  3P75 A;  1S5C D;  3S1R B;  4WFN 3;  1FJG Q;  4FNF A;  4KKU A;  4LF4 L;  5I4D A;  1O7Z A;  1ENA A;  1CKM A;  1CM9 A;  4AYB E;  3I2Z A;  2DJG C;  1GUO A;  1Z7T A;  3VYU A;  4K8I A;  3CCL A;  2I07 B;  2R7D A;  2R61 A;  2A73 B;  5KEE A;  1II3 A;  3TRE A;  2KHJ A;  1JWU D;  1B50 A;  5C0X J;  1IBM L;  3DHQ A;  4HJ7 A;  2YU9 B;  1V1P B;  4O0A A;  1SDF A;  1EY5 A;  1G2S A;  2XRS D;  4ULL A;  1IYV A;  1H9M A;  4A3I H;  1S3O A;  1F2M A;  3I90 A;  1EIF A;  1N34 L;  2F0P A;  1CZG A;  1BBU A;  3IKJ A;  3NTK A;  3K5M A;  4DR4 L;  2CWP A;  1YIT A;  4ILW A;  4A3G H;  5DM7 3;  1XNR Q;  2NUC A;  3GTK H;  3CF5 A;  4CHT B;  3K59 A;  4XT1 B;  1W3S A;  1WYD A;  4XQN A;  2R92 H;  1PRT C;  2E2J H;  3CW2 C;  3T13 A;  4HJ5 A;  4MTN A;  4OX9 Q;  3OYY A;  1WJJ A;  3KF8 A;  1GM5 A;  3KLS A;  2KHI A;  5BR8 Q;  2FFK B;  1ICF B;  3ZJY C;  3D8G A;  1Y1W H;  1PTO F;  4POF A;  4KD3 A;  4A93 G;  3S1Q B;  1FR3 A;  3PUW A;  3BVG A;  2EXZ A;  1VQN A;  1OXU A;  2QKI C;  1HZC A;  4ZCK A;  2ICE C;  2YTY A;  2L4N A;  1WVL A;  1I5F A;  2NN6 H;  3BDC A;  2QW7 A;  4IAL A;  2VQF L;  2JA9 A;  4LFC Q;  4PZ8 A;  3TDQ A;  2E2H B;  3PIP 3;  3KBG A;  2HHH L;  3A5Z B;  2E5L L;  1VQ5 A;  3CQZ H;  1O7I A;  3V05 A;  5IP7 G;  4GLV B;  5EPJ A;  3GTO H;  2EQS A;  3KFU A;  3NE5 B;  2NVX B;  5CC4 A;  5KRU A;  1I94 Q;  2YYZ A;  1BCP F;  3D4R A;  3NBI A;  1IW7 D;  3MC0 B;  4P71 A;  4ZK9 B;  1QVG A;  1GUG A;  4FXG C;  2WB1 G;  1V43 A;  2EY1 A;  2JA5 H;  2E2D C;  1BO0 A;  1J6Q A;  1H9K A;  1H95 A;  1UUP A;  5FLM G;  4APV A;  4KN7 C;  1HR0 W;  2JA8 H;  2CW0 D;  4DN4 M;  2IX1 A;  1X3G A;  5D65 A;  4IPG A;  1HNX L;  1GKH A;  1IBM Q;  4MN3 A;  1TS5 A;  2BH2 A;  3PSI A;  1Y1W B;  3Q22 A;  3RZO B;  2BH8 A;  2I5M X;  2MUY A;  2RBM A;  1EY6 A;  3RD4 A;  1MSH A;  5C0X H;  4OON A;  1AFP A;  3RZO H;  2K50 A;  1EYA A;  4B9X A;  1TWF B;  1SNO A;  3BVZ A;  1AEX A;  3H15 A;  1TY0 A;  4MNO A;  4R8N A;  4LF8 L;  5M9O A;  2OXP A;  5IP7 H;  1HNX Q;  1I4G A;  4I65 A;  1K83 B;  2Z4H A;  2EY5 A;  4JW0 A;  3GTK B;  4JI0 L;  4FXD A;  3D6W A;  3P20 A;  1CUK A;  4DV3 Q;  3A5U A;  1JQY D;  1F9P A;  4LFC L;  1E2V A;  5CBE E;  1EUJ A;  3E0E A;  2F0T A;  2UXB L;  4LF9 L;  2LFN A;  1KAB A;  4LF7 L;  2CW0 C;  4QL5 A;  4EGV A;  4UPA A;  1CA5 A;  3BZC A;  1W6K A;  1G51 A;  4CGY B;  4B3S L;  5EKK A;  3DWA A;  3SK6 A;  3KF6 A;  1CZW A;  2JJQ A;  4OXP A;  4X62 L;  4KD4 A;  2VQF Q;  3HOY H;  1JOO A;  3A56 A;  4A3D B;  2IHE A;  1IBK Q;  5COR A;  1K3R A;  4DAM A;  3MXP A;  3I73 A;  2R3Z A;  3STB C;  3A0J A;  5M5X H;  3HOX G;  3S2H H;  1PZJ D;  1R4Q B;  1EYG A;  2MGS A;  4A3K B;  1CT1 D;  1TWH B;  5C3E G;  1HFN A;  3OPO A;  4RHR A;  2UXC L;  4A3L G;  1XPO A;  1WTR A;  1F9S A;  5LL6 X;  3BS1 A;  3NUC A;  4LF7 Q;  3S1Q H;  2F3V A;  2HCC A;  1PYW D;  1QE6 A;  4J15 A;  1XPR A;  3NPP A;  2JA5 G;  1RCV D;  3CRL C;  4ZQ3 A;  5T1I A;  1E3P A;  1K8G A;  3I4M H;  1N36 Q;  2B8F A;  4B3M Q;  1JOK A;  2UUC L;  5IWA Q;  1V1P A;  2AHO B;  1EYD A;  5JVG 3;  1PTO D;  1G29 1;  3HZX A;  4YY3 Q;  3H09 A;  2C5C A;  5IGD A;  2EZV A;  1WCM G;  1O7L A;  1X55 A;  4UP9 A;  1EY0 A;  4KJN A;  3IAY A;  4BY7 H;  4YWL A;  3EIV A;  3JC6 6;  1XX8 A;  3GTP B;  4FP5 D;  4DAY B;  4GOP A;  4OL7 A;  1QNU A;  2EE1 A;  1LTG D;  3QR8 A;  2JA5 B;  5M5Y H;  2VB3 X;  2CFM A;  1YJ9 A;  1GUT A;  5CV8 A;  1EWC A;  4CJ0 B;  1QOH A;  1ZXT A;  1C48 A;  5C4J H;  1I4R A;  1HTL D;  5T1G A;  1LAC A;  4M1U B;  5M5Y B;  3HOV H;  5EPL A;  1WTQ A;  2Y0S G;  2UXB Q;  4JI3 Q;  2JA6 G;  2R92 G;  2K5W A;  3HOX B;  4QF4 A;  2ATW A;  3R3O A;  4OIJ A;  4OO1 H;  3S14 B;  2K04 A;  4JK1 C;  5C44 G;  3TP6 A;  1BKB A;  4A76 A;  4A3J G;  1XYI A;  2NN6 I;  1JC7 A;  1SE8 A;  5ELD A;  5A35 A;  5C5M A;  1DZ1 A;  1N36 L;  3QOJ A;  4B3M L;  5C3E H;  2PZU A;  4RHS A;  2ZXO A;  1M4V A;  3KLR A;  4DUY Q;  3PO3 H;  2F0Q A;  3KJP A;  1SFO H;  4B3R Q;  3EA6 A;  2Z6K A;  2E2I H;  4QCL A;  3K7A H;  2O5I C;  2DY7 A;  2JQO A;  1TWG H;  3A8I E;  5KYL A;  2Y0S E;  2IX0 A;  5KYI A;  1BCP B;  5K36 H;  3RN5 A;  1ASY A;  3NBH B;  4JI8 L;  4LUZ A;  1HZA A;  1L1O C;  2OWO A;  4B3T Q;  1JIC A;  2PMZ E;  1F9Q A;  1KRT A;  4S3S A;  2UUB L;  2WAC A;  3CCQ A;  2MP1 A;  1QIL A;  5GAH C;  2NZO A;  1QB5 D;  4LFB Q;  3VR2 A;  1LLR D;  4XXE A;  2B2U C;  1PFN A;  1SJH D;  4GLX A;  2CH4 W;  3RN2 A;  3PV0 A;  5CV4 A;  2R92 B;  1KTK A;  5EJW A;  4LNQ A;  1E2W A;  1UE6 A;  2IT1 A;  4XTC S;  1UWV A;  2IX3 A;  3GV6 A;  2AWN A;  4EQO A;  5DEH A;  3HKS A;  1F9R A;  1RIP A;  3PO2 B;  1I6H B;  4DR2 Q;  3NTH A;  3AFP A;  2HD3 A;  3KLS X;  1E0B A;  4C1N I;  3FP9 A;  4PZ7 A;  4AIM A;  3PO2 H;  3I4N H;  3Q6S A;  2VB2 X;  4BY7 B;  4IFD I;  2B2U A;  4RGT A;  1ONL A;  4RMF A;  2NVQ H;  1SLJ A;  4RA8 A;  4RH6 A;  4BXX G;  3D0F A;  4UP7 A;  1VQJ A;  5E4X A;  3M7N A;  2DGY A;  2XVS A;  4HSP A;  4A3I B;  1BUV T;  3LNN A;  1KLU D;  1X32 A;  5CR3 A;  1YIJ A;  1LTT D;  1VQI A;  1ZYR D;  2A68 D;  3NHH A;  5KND A;  3UE0 A;  3W3A A;  5IOD A;  1PXU A;  1KDC A;  3I4N B;  4JBJ A;  4KY7 A;  4JBK A;  3G7L A;  4F8M A;  5AJ3 Q;  4GKK L;  4IPC A;  1I4Q A;  1OXV A;  3S15 B;  1EFI D;  4A3F H;  1HNW Q;  3BZK A;  3F8T A;  2BOS A;  1IYJ B;  4A3F G;  1JE4 A;  2AQ2 B;  1MJE A;  2AUK A;  1FGB D;  4JI8 Q;  2F0N A;  4C56 C;  4B3T L;  4P72 A;  3U4Z A;  1STG A;  3PO2 G;  1B4O A;  2NTT A;  5CV7 A;  3X3M A;  2A1A A;  4F88 A;  3FKI B;  2KEE A;  5C3E B;  4KV6 A;  2D62 A;  3DLL A;  3QIA A;  5IT9 E;  2K32 A;  3TS2 A;  4DV4 L;  1SRU A;  1NBW A;  1ET9 A;  2DY8 A;  3DWQ A;  4DAV A;  1PH8 A;  4IOA A;  1NJI C;  3K80 C;  1SYB A;  4YCW A;  1RF2 D;  4Y52 H;  1X65 A;  1PH3 A;  2CHB D;  2B2T A;  3S2H B;  1JOR A;  2F0D A;  2K6A A;  4A3K H;  3C1F A;  3I8Z A;  3S16 H;  1TWC H;  4JYA L;  4FVM A;  4H7B A;  2UU9 Q;  1DOM A;  2A74 C;  2RHQ B;  2Z6K C;  4UDU C;  1J8I A;  1CQF A;  1Q8K A;  1G6Z A;  4PMC A;  1BNZ A;  1F2Z A;  1YHB A;  3EJI A;  2GN5 A;  3FKI G;  1ICW A;  3ZYY X;  4X6A H;  3K7U C;  2RCF A;  4DV4 Q;  2KCT A;  1GXD C;  4UAI A;  5KNB A;  2FMM A;  3PCO B;  3R2T A;  3K57 A;  3CME A;  4HJ9 A;  3VR3 A;  2EPB A;  4IPH A;  2G9D A;  4LFA Q;  4L5T A;  3UDI A;  5ISR A;  2JA7 B;  3H0G G;  3MXU A;  3J7A 5;  2QCP X;  5EKI A;  3HOY G;  2ZM6 Q;  1YNN D;  3HKZ E;  2RDF A;  3IL8 A;  3M4P A;  1B9N A;  2B29 A;  1EQT A;  2JEB I;  5GRO A;  2BE5 C;  1FNU A;  3GP7 A;  2MJ8 A;  3FPP A;  1EQQ A;  2A19 A;  2K33 A;  4A3J H;  4LF6 L;  4R4O A;  1STB A;  4KKT A;  4BBR H;  3MXN A;  1SEB D;  4J6H A;  2KQ3 A;  1XMQ Q;  3S24 A;  2EYL A;  1K9M C;  1VCI A;  3CCU A;  5M3F B;  4JI7 L;  3HOV G;  3A74 A;  2ZTE A;  2PQA A;  1TII D;  1PH6 A;  1XPU A;  3GTL H;  1IHZ A;  5A2Q E;  4DK0 A;  3GTJ H;  5BN5 A;  1QZG A;  1WTH A;  3EN2 A;  5M3F G;  2PO4 A;  2L12 A;  3LWU A;  1HZB A;  4B9W A;  2JA6 H;  3MEF A;  4NMZ A;  1PLF A;  2H1E A;  3MFG A;  3CKI B;  4KKS A;  3OOC A;  1STA A;  2QDB A;  1N34 Q;  5CBA E;  1U4R A;  4EVO A;  3L2P A;  2ICI A;  1IBL L;  1Q1E A;  1BQQ T;  4OHJ A;  4DV1 L;  3J7A V;  2VL6 A;  2B2V A;  1I4H A;  2KVM A;  1W6J A;  1HFG A;  1Q12 A;  1QUQ A;  1SAP A;  1J5E Q;  2FJ2 A;  2QEX A;  4X65 Q;  2UUB Q;  3G6J B;  4OEL B;  1CHQ D;  1PH9 A;  5M3M B;  2K4K A;  4YCV A;  4NPS A;  4P2C B;  3GTM H;  2QGQ A;  3TP7 A;  2YV5 A;  1E7Z A;  3MFY A;  4NXN Q;  1JJG A;  1C7Y A;  1U9R A;  3KK7 A;  2WIN B;  1E2Z A;  2PQE A;  3CCR A;  3UDX A;  1S72 A;  4G7O C;  3SK4 A;  3NTI A;  3Q24 A;  3S16 B;  3OMC A;  1HPC A;  3TN2 A;  1Z6H A;  3BDL A;  1EY9 A;  1VMP A;  4U67 3;  1GOZ A;  4KMU C;  2R7Z H;  3OW2 A;  5FOB B;  1TWF H;  2WKC A;  1JCK B;  3GD7 A;  1VS0 A;  3H0G B;  4A3B B;  4CKE A;  1RD9 D;  5IYD G;  1VQ4 A;  3K5O A;  5CYU A;  1WD1 A;  1I50 B;  1G8Z D;  2HQL A;  2M00 A;  1TXY A;  3U9S A;  4HTH A;  2ZT9 C;  3FEW X;  5IY0 A;  4LF4 Q;  3TRZ A;  2WII B;  4DFA A;  4IUN A;  4PV1 C;  5M5W H;  3CCV A;  3VYS A;  3K5L A;  1O78 A;  4KN4 C;  1KHI A;  3E9H A;  5HGT A;  1B44 D;  4C2M B;  1Y1W G;  1TWG B;  1HNZ Q;  5DLQ E;  5JEA J;  1ENC A;  1JJC B;  4A4I A;  4DAP A;  3SVM A;  2WFW A;  2HT1 A;  1J5E L;  2VXW A;  1UE5 A;  3NWT A;  1HQR D;  1A0I A;  4QIW B;  4L6T B;  4QUF A;  1YHA A;  4C3J H;  3CC7 A;  3HOU H;  4F87 A;  5IOC A;  1NMG A;  3S1R H;  4A75 A;  3DUZ A;  3RZD H;  1RTN A;  1JB3 A;  1ZYR C;  1WCM B;  4WRD A;  5LMN W;  1FJG L;  5E1F A;  3T1Y L;  1A15 A;  3S1N B;  1YJN A;  2ZJQ A;  4A3I G;  2C35 B;  3VYT A;  1PV4 A;  5EQ0 A;  4DV1 Q;  2D9U A;  5JPM C;  1VDZ A;  4UP8 A;  3PF5 A;  3CMA A;  1PFM A;  1VQB A;  3FVQ A;  2ZJR A;  1HXY D;  2WKD A;  1YNJ C;  4A3E G;  1BXT A;  4PNY A;  2F0U A;  1D1K A;  2N49 A;  3U58 A;  1PFB A;  2EYH A;  1D7Q A;  5GQO A;  1CSP A;  3BVM A;  3CC4 A;  5JJK A;  3MVV A;  2AQ1 B;  4TSS A;  2TMP A;  3OWF A;  4ME5 A;  5KNC A;  4CJ2 C;  4KHP Q;  1KNA A;  1HA5 A;  2HIV A;  2F4V L;  4DV0 Q;  4EQP A;  5CMD A;  3HOY B;  1SSO A;  4LFA L;  3Q8D A;  2VUM G;  4H02 A;  4HCS A;  1W2B A;  1YVC A;  3MHB A;  5CV5 A;  1JOQ A;  1BR9 A;  1V1Q A;  2B63 B;  1N33 L;  1IKM A;  2LXK A;  3H6M A;  4K5V A;  3A7L A;  1K8M A;  5JAV A;  1OXS C;  3L7Z C;  2UXC Q;  3S2D H;  4N8X 1;  3VDY A;  2N55 A;  3TS0 A;  3ICE A;  1E22 A;  5M3F H;  1DXM A;  1SN8 A;  1AZP A;  1EIH A;  2XSC A;  1T5E A;  4DV6 L;  1DD2 A;  1S5F D;  1RKN A;  4HIM A;  3OIQ A;  3N6R A;  2OQK A;  3J7Z C;  3FMC A;  4DR1 L;  3K6O A;  1YNN C;  3T1H L;  1EZ6 A;  2EDG A;  4FYD A;  4LF5 Q;  1UE1 A;  3NWS A;  1MGS A;  1CKN A;  3HOZ H;  4DAY A;  3HKZ B;  1LAB A;  2PZW A;  3TME A;  1QG7 A;  4AQY L;  4A3C H;  1MHW C;  1TWA B;  3EVQ A;  2K14 A;  3E5S A;  4K8J A;  2JP1 A;  3KBX A;  2A6E C;  1NE3 A;  2YTX A;  3MA2 B;  2QA4 A;  5LMU L;  2KCM A;  2B63 G;  2PQA B;  3HOZ B;  2Q2U A;  1D8L A;  3ONA B;  4CKB A;  5C4X B;  5JJZ A;  3I91 A;  1E1T A;  3VR6 A;  3EFX D;  2F1M A;  3BG3 A;  3X3N A;  3MXN B;  3D4W A;  5AJ3 L;  1JE5 A;  1I4X A;  1VQM A;  4JBM A;  1STY A;  3NBH A;  1O80 A;  1MIU A;  1LYL A;  4BA1 I;  1BCP C;  3M3Y B;  4R9W A;  2RDG A;  1QUQ B;  1L1O B;  4QIW E;  1MKH A;  2KED A;  1AP0 A;  4L5R C;  2DNC A;  2JYO A;  3B6Y A;  3D31 A;  2F0V A;  1KD1 C;  2IHF A;  2VZA A;  5IYD H;  2N8N A;  2F0M A;  2MQH A;  5LL6 S;  2E74 C;  2B2W C;  4GOP C;  4FDB A;  2EJG C;  3I4M B;  3S1N H;  3QG1 A;  5JOB A;  1SFO B;  2EYP A;  4LUO A;  1KC8 C;  4NXM L;  1YEZ A;  2KCN A;  3TZU A;  3DEP A;  1CTM A;  3MWY W;  4WJW A;  3EBE A;  2DNE A;  4JI4 L;  1D1I A;  1PHJ A;  2Z1C A;  3S9W A;  1D5Z C;  4LK1 C;  4A3L H;  1S5B D;  4P75 A;  3PUX A;  4JI1 L;  1HUM A;  2A68 C;  5CV9 A;  4POG A;  1K0R A;  3GO5 A;  1PTO B;  3G6E A;  1XNQ L;  3P1H A;  1SYG A;  5D3D A;  2R7Z G;  1FVI A;  2VW9 A;  1LV9 A;  3HOW G;  3HFZ B;  2IY5 B;  2ZM6 L;  1Q3L A;  2PNR C;  2E2I B;  1PTO H;  2K01 A;  4LF6 Q;  2XGT A;  1EWI A;  3RZD B;  1MJC A;  1EQV A;  1D5M C;  5EBC A;  4BWG B;  2MO1 A;  2R6G A;  1PVO A;  4OEM B;  2I5H A;  1NTG A;  2OTJ A;  2XTI A;  1ASZ A;  4L8J A;  2LXJ A;  3H0G H;  3HS0 C;  2E2J B;  2IL8 A;  3MTS A;  4BXX H;  1X3P A;  3OSO A;  4C1N K;  1Y69 U;  4DR3 Q;  4KJO A;  3HRZ C;  4JV5 L;  1X56 A;  2RCN A;  4C2M H;  1A3V A;  4N9P A;  4XT3 B;  1HTP A;  1Q82 C;  2UUA Q;  2GA4 B;  3CRK C;  2J4X A;  1RTO A;  4LFB L;  1LTL A;  2F0L A;  2L0C A;  2XRQ D;  4KHP L;  1DCZ A;  5IYC G;  2L11 A;  3E6Z X;  1K8A C;  1C9O A;  2KEN A;  3PO3 B;  2B39 A;  1O7Y A;  3KUP A;  1LT4 D;  2PPB C;  1HZ9 A;  1WTV A;  1JWM D;  4GLA C;  2IWH A;  1LTS D;  1B3Q A;  3VA5 A;  5FO9 B;  1I50 H;  2X69 A;  4IPD A;  1WTP A;  4GZY C;  1LT3 D;  3UI2 A;  3G71 A;  4DV3 L;  2Q8I B;  4BA2 I;  3GTG B;  2D0O A;  4CDD C;  4A93 H;  4FF1 A;  5DAU A;  1VQL A;  1HHV A;  2D0P A;  4ZAI A;  2ZJP A;  3HOV B;  4IUQ A;  5TSS A;  4OO1 I;  1B53 A;  1YJW A;  2EVB A;  5LMU Q;  3H3V C;  4P73 A;  4C3H B;  1IW7 C;  2JA6 B;  2A69 D;  1SR3 A;  2SNM A;  4L5S A;  1VQP A;  2A6H D;  4JI3 L;  3WOE A;  2KBN A;  1JMC A;  4JI4 Q;  1STE A;  4TRD A;  1A3T A;  3ER0 A;  1EIG A;  4JOI A;  4B3R L;  4IFD J;  3M4Y A;  4C3I H;  1OXX K;  3CCE A;  3VYR A;  4GNX C;  2IJ0 A;  3KOJ A;  1S40 A;  3CAM A;  2LY7 A;  4IQZ A;  4ZLT F;  2N88 A;  1G6P A;  3PIO A;  2R7F A;  1V1O A;  1PRT F;  3A54 A;  4J8Q A;  2OCE A;  2F03 A;  1MBY A;  2XWB B;  2VQE L;  4FXK C;  2F0H A;  5IT9 L;  4A3G B;  3S14 H;  4A3K G;  5CGK A;  1PYB A;  1N9W A;  2RQX A;  1Q90 A;  1V8Q A;  5E4W C;  1HUN A;  1A8V A;  1T5X D;  3DWP A;  1B7Y B;  1EZ8 A;  4ZUJ A;  2EYO A;  2PZT A;  4DK6 C;  3MZ5 A;  4GN5 A;  3AQQ A;  1K0S A;  2ZTD A;  3DXJ C;  4E6I A;  3PUV A;  3I7F A;  4JV5 Q;  3TP5 A;  4BY7 G;  4DR7 Q;  5FJ8 H;  3PIO 3;  5IGC A;  3NEN A;  4HCE A;  4HSV A;  3KYH C;  2KUM A;  1NSN S;  4V0B A;  1SMX A;  5M5W B;  4DKA C;  1Y1V H;  1I6V C;  3MXG A;  2K28 A;  2H5X A;  2L15 A;  5I9O A;  4OX9 L;  3M7G A;  4G4K A;  3HEJ A;  2LS0 1;  2JA7 H;  4U68 A;  1PFS A;  2B2Y C;  3M4O H;  3I4M G;  3SK8 A;  5E7N A;  3D4D A;  2EYJ A;  2O5J C;  1H9J A;  3STB D;  4Y7N H;  2JXM B;  3BZD B;  3I56 A;  4OWW B;  5LHY 1;  2MNA A;  4DV2 Q;  5C4H A;  1I4P A;  5ELO A;  1SYD A;  2FXQ A;  2HIX A;  3M85 A;  2AUJ D;  3LX0 A;  1K28 A;  1H9S B;  2ZXR A;  2IPK D;  3OTO Q;  1IL8 A;  1C8C A;  4XYO A;  1JWS D;  4DF7 A;  4DXF A;  3NK9 A;  2NVX H;  1A62 A;  1VQO A;  2NVT H;  2RVL A;  2BCO A;  3BJU A;  4ZUI A;  4MTK A;  1TS2 A;  5KIX A;  3KF8 B;  3ERS X;  3JAM E;  4DR5 Q;  4NXN L;  3OW7 A;  3TZD A;  4OIK A;  3Q0A A;  1EL0 A;  2ZXP A;  2F0E A;  4GNX B;  1U4P A;  1VQA A;  2PW5 A;  2FIN B;  2K75 A;  1AZQ A;  2VY3 A;  1QWY A;  1SNQ A;  3UE1 A;  3FPU B;  1G2T A;  4DXG A;  1L0X B;  4NW2 A;  5I2X A;  1KXL A;  1U5K A;  1CI3 M;  4ALP A;  1PDQ A;  2VUM H;  4C3J B;  4LJZ C;  2R93 G;  1CQV A;  1PTO C;  4YHH Q;  2UXD Q;  2ZTC A;  1M1K C;  5J1Z A;  1SMY D;  5FKA C;  1SJE D;  3S17 B;  3KF6 B;  4OWX B;  1ILP A;  4DUZ Q;  4A3M H;  4RG1 A;  4PG3 A;  1JB7 A;  1NCV A;  4CJ1 B;  3K7A B;  4ODG A;  4RGO S;  2NVQ B;  4DK3 C;  1PH1 A;  1LTA D;  2VS1 A;  1HNZ L;  5COY A;  2KA7 A;  5HY6 A;  4PZ6 A;  1DYQ A;  5FO7 B;  2A5H A; 
#chains in the Genus database with same CATH homology
 2PI2 A;  4R1J A;  1EUJ A;  1CKN B;  2NZH A;  4YHH L;  3OTO L;  5LMN W;  3E0E A;  4YWM A;  1X54 A;  3JAM i;  3T1Y L;  1FJG L;  2UXB L;  2UXD L;  4LF9 L;  5FLX c;  4GN4 B;  2WAQ G;  1YJN A;  1VQE A;  1X6O A;  2ZJQ A;  5IT9 c;  4A3I G;  1FGU A;  2C35 B;  4LF7 L;  4GKK Q;  4YWK A;  3RR5 A;  1PV4 A;  4QL5 A;  4DV1 Q;  4UPA A;  1QZH A;  3BZC A;  1G51 A;  4UP8 A;  4B3S L;  3PF5 A;  3CMA A;  1PH7 A;  4A3E H;  1VQB A;  3KF6 A;  4BY1 H;  3GTP H;  1N33 Q;  2JJQ A;  4OXP A;  4X62 L;  2VQF Q;  3HOY H;  1UE7 A;  2B3G A;  2ZJR A;  1I6H H;  1K73 C;  2F3I A;  4A3E G;  2IHE A;  3PIP A;  1IBK Q;  4JI2 L;  2CCZ A;  1FL0 A;  2PI2 E;  3L0O A;  1K3R A;  4DAM A;  2JA7 G;  4K0K Q;  3PUZ A;  3IRB A;  2N49 A;  3STB C;  3I55 A;  3TEH B;  3U58 A;  3A0J A;  1YHQ A;  1IL2 A;  2GVA A;  5M5X H;  3HOX G;  1WOC A;  4X64 L;  3PF4 A;  4BBS H;  3S2H H;  4IJL A;  4X62 Q;  5GQO A;  1EYG A;  1D7Q A;  1CSP A;  3CC4 A;  5C3E G;  1E1O A;  1EQR A;  2VQE Q;  2UXC L;  2A8V A;  1XPO A;  4A3L G;  5JJK A;  4GKJ Q;  3NEL A;  4R4T A;  3U4V A;  4JOI C;  1EOV A;  4DR4 Q;  4LF7 Q;  3S1Q H;  4JI5 L;  3HKZ G;  4KHP Q;  2HIV A;  2F4V L;  4DV0 Q;  3F2D A;  4J15 A;  1XPR A;  2JA5 G;  3AEV A;  4LFA L;  1E3P A;  3Q8D A;  1K8G A;  2B63 H;  2EXD A;  4H02 A;  2VUM G;  1HNW L;  3K81 C;  1VQH A;  3I4M H;  1W2B A;  1YVC A;  1N36 Q;  4ME3 A;  1M90 C;  4B3M Q;  4LW1 A;  2UUC L;  5IWA Q;  1JT8 A;  2AHO B;  1VQF A;  2F4V Q;  1V1Q A;  4OO1 G;  1N33 L;  2EIF A;  2LXK A;  3RLF A;  1G29 1;  1OXS C;  3L7Z C;  4JG2 A;  4YY3 Q;  2UXC Q;  3LGJ A;  3S2D H;  1LUZ A;  3M3Y H;  1WCM G;  3VDY A;  4QJF A;  4NB3 A;  1DGS A;  1X55 A;  4UP9 A;  4BY7 H;  1PA6 A;  3KLW A;  4YWL A;  3EIV A;  3JC6 6;  3TS0 A;  3FKI H;  3ICE A;  1PH4 A;  1BVS A;  1E22 A;  5M3F H;  2K5H A;  1SN8 A;  2NVY H;  1PH5 A;  2Q2H A;  4R4I A;  5C0X I;  4LWC A;  4DAY B;  4DV6 L;  4GOP A;  2ES2 A;  4X66 Q;  4A3C G;  4HIM A;  5IYB H;  2OQK A;  3J7Z C;  1X3F A;  2K52 A;  4JI2 Q;  4DR1 L;  3T1H L;  2OTL A;  4AH6 A;  5M5Y H;  3HOZ G;  5C4X G;  2CFM A;  5LMN Q;  1X3E A;  5GAD C;  5GAE C;  1YJ9 A;  4LF5 Q;  3GTQ H;  1VQ9 A;  1V9P A;  1UE1 A;  1B8A A;  1Y1V G;  1CKN A;  4BY1 G;  4HJ8 A;  4DNI A;  5C4J H;  4HIO A;  4UY8 C;  3HOZ H;  5J3B A;  1HR0 Q;  2ALY B;  1PH2 A;  3HOV H;  4AQY L;  4A3C H;  3U50 C;  2CQO A;  2WB1 E;  3SGI A;  2Y0S G;  2UXB Q;  2K14 A;  4PMW A;  4JI3 Q;  4JI6 Q;  2JA6 G;  2R92 G;  1AH9 A;  4AYB G;  3J81 i;  3ULL A;  2ATW A;  3F2C A;  1NE3 A;  2YTX A;  2QA4 A;  5LMU L;  4DV7 L;  4IO9 A;  2KCM A;  2B63 G;  1VQ6 A;  2PQA B;  4GNX A;  3W1G A;  3J81 c;  2Q2U A;  1D8L A;  5C44 G;  1YZ6 A;  4DV6 Q;  1BKB A;  4A76 A;  4A3J G;  1E1T A;  2NN6 I;  1SE8 A;  5GAG C;  4TVA B;  4X65 L;  2RF4 A;  4DV5 L;  1N36 L;  4B3M L;  5C3E H;  2NN6 G;  4LF5 L;  3MXN B;  5AJ3 L;  1JE5 A;  3KDF B;  3M9B A;  5LMN L;  3S1M H;  4DUY Q;  1VQM A;  1N8R C;  4JBM A;  4JI5 Q;  3RNU A;  3KJP A;  4JI7 Q;  3PO3 H;  1SFO H;  2Q2T A;  4B3R Q;  1MIU A;  2Z6K A;  3PGZ A;  2E2I H;  4GN3 B;  1LYL A;  4BA1 I;  1Y14 B;  3W1B A;  3K7A H;  1EIY B;  3H3V I;  2JQO A;  1TWG H;  3T1Y Q;  1RL2 A;  1QUQ B;  2IX0 A;  2Y0S E;  1L1O B;  1YBY A;  3WWV A;  3RN5 A;  2DUD A;  4JI6 L;  4QIW E;  1MKH A;  4HID A;  5IYC H;  2ASB A;  1ASY A;  3GDE A;  3NBH B;  4KHZ A;  1HJP A;  1HZA A;  1L1O C;  4LUZ A;  4JI8 L;  5C4X H;  1YI2 A;  2OWO A;  4B3T Q;  2PMZ E;  4L5R C;  5BR8 L;  3F1Z A;  3DM3 A;  1NMF A;  3B6Y A;  1KRT A;  3D31 A;  4HJA A;  1KD1 C;  2IHF A;  2VZA A;  5IYD H;  1OXT A;  2N8N A;  2UUB L;  5JJI A;  1KAW A;  2MQH A;  3CCQ A;  5M3M G;  3CXC A;  2MFI A;  5GAH C;  4GOP C;  4DUZ L;  2NZO A;  4FDB A;  2YTV A;  1IBK L;  4WJ3 M;  3G4S A;  4DR6 Q;  4A3D G;  4LFB Q;  1IBL Q;  3S1N H;  4GLX A;  1N32 Q;  3RN2 A;  2UUC Q;  3PV0 A;  4JI1 Q;  4LUO A;  1KC8 C;  1VQC A;  1U0L A;  4NXM L;  1YEZ A;  4A3B H;  1BBW A;  4LNQ A;  1UE6 A;  2JK8 A;  4JBW A;  2IT1 A;  4XTC S;  1UEB A;  3EBE A;  1T9H A;  3HOX H;  1UWV A;  4JI4 L;  1LM0 A;  2OQ0 A;  1PHJ A;  2WAQ E;  2AWN A;  1L1O A;  1AE3 A;  3HKS A;  4O2D A;  1RIP A;  1X9N A;  1NY4 A;  1XMQ L;  2E5L Q;  4A3L H;  3CP0 A;  4DR2 Q;  2JA8 G;  3AFP A;  4P75 A;  3PUX A;  4JI1 L;  4POG A;  1I94 L;  1K0R A;  3CPW A;  1AE2 A;  2MO0 A;  3GO5 A;  4YY3 L;  3G6E A;  3I4O A;  1XNQ L;  3H3V H;  4A3M G;  3FP9 A;  4JI0 Q;  3G48 A;  2VNU D;  1VQK A;  4PZ7 A;  4TQU S;  1FVI A;  4AIM A;  2VW9 A;  3HOW G;  2R7Z G;  3HFZ B;  1KL9 A;  3I4N H;  2ZM6 L;  3PO2 H;  2IY5 B;  4IFD I;  4DV5 Q;  2NVQ H;  4RMF A;  1SLJ A;  1SRO A;  1Q81 C;  4LF6 Q;  3K0X A;  3D0F A;  4UP7 A;  4BXX G;  1VQJ A;  1EWI A;  2XGT A;  4QY7 A;  3M7N A;  2F52 A;  3CD6 A;  2DGY A;  2R93 H;  3F2B A;  1MJC A;  4DV7 Q;  2MO1 A;  2R6G A;  2GVB A;  3CC2 A;  3M4Q A;  1YIJ A;  1PVO A;  2N78 A;  1XTD A;  2I5H A;  1GD7 A;  1VQI A;  4QGU A;  5EAY A;  1NTG A;  2OTJ A;  2XTI A;  3UE0 A;  4EQ5 A;  5IE8 A;  2LXJ A;  1ASZ A;  3S15 H;  3H0G H;  4JBJ A;  4JBK A;  5AJ3 Q;  3CCM A;  3HOU G;  1PYS B;  4GKK L;  4IPC A;  4BXX H;  1N32 L;  2K5V A;  4X64 Q;  1OXV A;  4P74 A;  1Q46 A;  3TQY A;  4A3F H;  1WFQ A;  4DR3 Q;  1VQ7 A;  4JV5 L;  1TWA H;  5C0X G;  1Z9F A;  1X56 A;  2RCN A;  4C2M H;  4JCV E;  4A3B G;  3GTG H;  3BZK A;  3F8T A;  1Q82 C;  1HNW Q;  2UUA Q;  1IYJ B;  4A3F G;  1MJE A;  4EX5 A;  3CCJ A;  4R4Q A;  3JAM c;  4DR6 L;  4LFB L;  1LTL A;  3AYH B;  5FLM H;  3ULP A;  1VQD A;  1E24 A;  4JI8 Q;  4B3T L;  1TWH H;  4KHP L;  4P72 A;  5IYC G;  3U4Z A;  1K8A C;  3E9I A;  1C9O A;  1IZ6 A;  2KEN A;  2Z0S A;  3PO2 G;  2UU9 L;  1R9T H;  2CKZ B;  3CCS A;  2A1A A;  4L5Q A;  4C3H H;  1HZ9 A;  2D62 A;  3DLL A;  5H1S E;  1KQS A;  4GLA C;  3TS2 A;  4DV4 L;  1SRU A;  1I50 H;  1L2F A;  5C44 H;  1NBW A;  4IPD A;  3RLO A;  4DV2 L;  4BA2 I;  3G71 A;  4DV3 L;  4IOA A;  1PH8 A;  4JYA Q;  1NJI C;  3K80 C;  2AKW B;  2BA0 A;  2CWA A;  4YCW A;  3GTO H;  2D0O A;  1WI5 A;  4A93 H;  4Y52 H;  1VQL A;  1X65 A;  1PH3 A;  3CPF A;  2D0P A;  2ZJP A;  1C0A A;  4GKJ L;  4OO1 I;  1YJW A;  4A3K H;  1A63 A;  2RHS B;  3J80 i;  3S16 H;  5LMU Q;  2BA1 A;  1VQG A;  3BU2 A;  1TWC H;  4JYA L;  1HR0 L;  4P73 A;  1XMO Q;  2UU9 Q;  4X66 L;  1KIX A;  2YU9 H;  5HGQ A;  4AQY Q;  2RHQ B;  2Z6K C;  1Q1B A;  4GOP B;  1L0W A;  1Q8K A;  2JE6 I;  5FJ8 G;  1JJ2 A;  1SR3 A;  4L5S A;  1FJG Q;  1VQP A;  4LF4 L;  1YHB A;  2GN5 A;  3FKI G;  4JI3 L;  4X6A H;  2KBN A;  1JMC A;  4JI4 Q;  1OTC A;  1CKM A;  3K7U C;  4AYB E;  1CSQ A;  4DV4 Q;  3ER0 A;  3I2Z A;  2KCT A;  2E2H H;  3PCO B;  4HJ9 A;  4BBS G;  3CME A;  4JOI A;  4B3R L;  4IFD J;  3CCL A;  4C3I H;  4DR3 L;  1OXX K;  4IPH A;  3CCE A;  4GNX C;  3KOJ A;  4LFA Q;  4HIK A;  4L5T A;  2R7D A;  3UDI A;  3H0G G;  3K8A A;  3PUY A;  1S40 A;  3CAM A;  4LF8 Q;  4GS3 A;  3TRE A;  3UDF A;  2KHJ A;  1GVP A;  3J7A 5;  5C0X J;  1IBM L;  1G6P A;  3PIO A;  1EFW A;  4HJ7 A;  3HOY G;  2ZM6 Q;  2R7F A;  4O0A A;  3T1H Q;  1WCM H;  3HKZ E;  4IJH A;  3M4P A;  2LSS A;  2B29 A;  2JEB I;  5GRO A;  5IYB G;  2OCE A;  1XNR L;  4R4C A;  2VQE L;  4A3I H;  1S3O A;  3S14 H;  1EQQ A;  1YNX A;  2A19 A;  1EIF A;  4A3J H;  1N34 L;  1Q86 C;  4R4O A;  4A3K G;  4LF6 L;  1P8L A;  1N9W A;  1PYB A;  3KDF A;  4BBR H;  5JEA G;  1A8V A;  1BBU A;  1XMQ Q;  4K0K L;  4DR4 L;  5IWA L;  2CWP A;  2V1C C;  1B7Y B;  3S24 A;  3J80 c;  1YIT A;  1K9M C;  4A3G H;  1VCI A;  1XNR Q;  3CCU A;  4OWT B;  4DPG A;  4JI7 L;  3HOV G;  4KLK A;  3A74 A;  3GTK H;  2ZTE A;  4DK6 C;  4YCU A;  4DV0 L;  2PQA A;  1PH6 A;  1XPU A;  4GN5 A;  3CF5 A;  3AQQ A;  3KJO A;  2ZTD A;  3GTL H;  2WP8 J;  1W3S A;  3PUV A;  1WYD A;  3I7F A;  2HHH Q;  4JV5 Q;  2R92 H;  3GTJ H;  4BY7 G;  2E2J H;  3CW2 C;  5FJ8 H;  4HJ5 A;  4MTN A;  4DR7 Q;  3NEN A;  1QZG A;  2N3S A;  2ID0 A;  4BBR G;  1WJJ A;  3EN2 A;  3OYY A;  3KYH C;  5M3F G;  1GM5 A;  4DR5 L;  4OX9 Q;  2KHI A;  5BR8 Q;  1HZB A;  1SMX A;  2JA6 H;  3MEF A;  3ZJY C;  1Y1W H;  4POF A;  1KRS A;  4DKA C;  4A93 G;  1Y1V H;  1N34 Q;  1QVC A;  3PUW A;  2H5X A;  1VQN A;  2L15 A;  5M3M H;  1OXU A;  3L2P A;  1HZC A;  1Q1E A;  4DV1 L;  1IBL L;  1CKO A;  4OX9 L;  3S17 H;  4A3G G;  3PO3 G;  2YTY A;  2VL6 A;  2JA7 H;  1I5F A;  1B70 B;  1QVF A;  1Q12 A;  1PFS A;  2VQF L;  1QUQ A;  2JA9 A;  3M4O H;  3I4M G;  4NXM Q;  4QQB X;  5E7N A;  4PZ8 A;  1J5E Q;  4LFC Q;  1P16 A;  3AFQ A;  2QEX A;  4IFD G;  4X65 Q;  2UUB Q;  3STB D;  2AWO A;  4Y7N H;  4DR7 L;  1PH9 A;  1Q7Y C;  2HHH L;  3I56 A;  4OWW B;  3A5Z B;  2E5L L;  1VQ5 A;  3CQZ H;  1Z47 A;  1O7I A;  2MNA A;  2K4K A;  4DV2 Q;  4YCV A;  5IP7 G;  2I5L X;  4GLV B;  4NPS A;  2EQS A;  2QGQ A;  5ELO A;  2JEA I;  4DR2 L;  3UDG A;  3GTM H;  3KFU A;  1XNQ Q;  2YV5 A;  2FXQ A;  1E7Z A;  4JC0 A;  1I94 Q;  4NXN Q;  2HIX A;  3M85 A;  2YYZ A;  2AMC B;  1JJG A;  1C7Y A;  4KI0 A;  4P71 A;  3OTO Q;  5JJL A;  1XMO L;  1VQ8 A;  4LF9 Q;  1QVG A;  3CCR A;  3UDX A;  1S72 A;  2WB1 G;  2NVX H;  1A62 A;  1IXR A;  1VQO A;  1V43 A;  2NVT H;  3BJU A;  1HH2 P;  3KF8 B;  3ERS X;  4DR5 Q;  4NXN L;  2JA5 H;  4XIG S;  1J6Q A;  2R7Z H;  1I3Q H;  1H95 A;  3NEM A;  4IOC A;  3OW2 A;  1TWF H;  4GNX B;  5K36 G;  5FLM G;  1VQA A;  4APV A;  2K75 A;  2VY3 A;  1HR0 W;  3GD7 A;  2I0Q A;  2JA8 H;  2IX1 A;  3UE1 A;  2UUA L;  1X3G A;  1HNX L;  4IPG A;  1VS0 A;  1GKH A;  1IBM Q;  3I4N G;  2BH2 A;  1KXL A;  1U5K A;  3PSI A;  1K83 H;  1GO3 E;  3RLN A;  5IYD G;  4ALP A;  2BH8 A;  2VUM H;  2I5M X;  5IP9 H;  1VQ4 A;  2R93 G;  4WJ4 A;  2HQL A;  1TXY A;  4YHH Q;  5IY0 A;  4LF4 Q;  4MZ9 A;  3TRZ A;  5M5W H;  3ULJ A;  4OON A;  2UXD Q;  3CCV A;  3HOW H;  3RZO H;  2K50 A;  2ZTC A;  5ELN A;  1M1K C;  1KHI A;  4DR1 Q;  3E9H A;  4LUV A;  4DUY L;  1Y1W G;  1HNZ Q;  5DLQ E;  5JEA J;  3H15 A;  1JJC B;  4A4I A;  2WFW A;  3KF6 B;  4MNO A;  2PNH A;  4OWX B;  1UE5 A;  5IP9 G;  4DUZ Q;  1J5E L;  4A3M H;  1A0I A;  2HT1 A;  4LF8 L;  4RG1 A;  3FHW A;  4PG3 A;  2Q2I A;  1YHA A;  4C3J H;  3CC7 A;  1JB7 A;  5IP7 H;  1HNX Q;  2E8G A;  3HOU H;  2K5N A;  1NMG A;  4DK3 C;  3S1R H;  2VS1 A;  1PH1 A;  1HNZ L;  4A75 A;  4A3D H;  4JI0 L;  5HY6 A;  4PZ6 A;  3W5O A;  4B3S Q;  1XJV A;  1CUK A;  3RZD H;  3J81 j;  4DV3 Q;  3A5U A;  4LFC L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...