4GOPA

Structure and conformational change of a replication protein a heterotrimer bound to ssdna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
112
structure length
108
Chain Sequence
b'MEKPTPLINSSMLGQYVGQTVRIVGKVHKVTGNTLLMQTSDLGNVEIAMTPDSDVSSSTFVEVTGKVSDAGSSFQANQIREFTTVDVDLTLVENVVQISAAFPNLFSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structure and conformational change of a replication protein A heterotrimer bound to ssDNA.
pubmed doi rcsb
source organism Ustilago maydis
molecule tags Dna binding protein/dna
total genus 22
structure length 108
sequence length 112
chains with identical sequence X
ec nomenclature
pdb deposition date 2012-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gopA00
4LF9L 2KHJA 3GTJH 2VZAA 3K0XA 1NMFA 1OTCA 5IYCG 1YIJA 4A3LG 4B3SQ 1HNWL 3A74A 1PH9A 4P73A 4MNOA 1UWVA 2VUMG 3RNUA 2HT1A 5IP9G 4DV5Q 4DR6Q 3PO3H 2Z6KA 3I56A 4A3IH 1X3EA 4KHZA 4JI0Q 4DR1Q 5C0XJ 1RL2A 1QVCA 4UP8A 3FKIG 2K5NA 4OWTB 2EQSA 4YY3Q 2I0QA 4JI1L 1I3QH 1PV4A 4BXXH 4LF6L 2Q2HA 1PA6A 3NELA 1NTGA 1Y1VG 4A3CH 3GTPH 1EOVA 5GAHC 1VQGA 4JC0A 5H1SE 1VQNA 1H95A 3J81c 3Q8DA 4K0KQ 3J80i 2OWOA 2UUBL 4B3SL 3M3YH 2JA7H 4JBKA 1E1TA 1P8LA 3HOXH 1WYDA 1KAWA 1MKHA 1NBWA 4DV0Q 4R4TA 3I7FA 5DLQE 4JBWA 1A63A 2JEBI 1MJEA 5LMNQ 5C4XG 5IP7G 1G51A 5K36G 1K8AC 1OXVA 3I55A 1LUZA 3DM3A 1MIUA 1AH9A 1WCMH 1EYGA 2C35B 4YY3L 4PZ6A 1YBYA 4YWKA 5FLMG 1PVOA 1J5EQ 1XMOL 2NVYH 3JC66 4JI2Q 2NVQH 4JI5L 1GM5A 4GOPC 4A93H 4K0KL 2UU9Q 4HIMA 1GVPA 1VQAA 1T9HA 2I5MX 2WAQE 4LUOA 4DNIA 1PH1A 1MJCA 2F4VQ 2UXCQ 1Q82C 4H02A 3BJUA 4BY7G 4DV0L 1JJGA 3HFZB 4O0AA 4DK6C 4GLXA 2OTJA 3CCMA 3HOWH 1BBUA 1XTDA 2LXKA 2OQ0A 4P71A 1L0WA 3CXCA 5FJ8H 1VQOA 1FJGL 1O7IA 1Q8KA 5IYDG 1VQJA 2GN5A 3B6YA 2N49A 3KYHC 2QGQA 3KF6A 4X64Q 1A62A 1PH6A 1PYSB 2HIXA 4LUZA 5GROA 5GADC 1Q7YC 1EUJA 4HJ8A 2B3GA 4C3HH 2JA8H 1K83H 4QL5A 4DR3Q 1VQ9A 2UU9L 3ICEA 2F4VL 1X3GA 5C3EG 3J80c 1R9TH 3KOJA 1VQPA 2UXCL 2JEAI 2VY3A 1KRSA 2HQLA 1D8LA 4YCUA 1VQMA 4JI3L 3GO5A 1YITA 3M9BA 1ASYA 4LF4Q 2E8GA 2N3SA 1KD1C 3CP0A 4BA2I 2ASBA 1HJPA 4POFA 1U0LA 2WB1E 4GKKQ 1SFOH 3K8AA 4MTNA 3HOZH 4LF5Q 3KDFB 2HHHQ 3EN2A 5IYCH 4A3LH 2UXDQ 4OO1G 2VUMH 5IYBG 2MNAA 4DK3C 1I94Q 4OX9Q 3PUXA 2VQFQ 1VQ4A 3F1ZA 2CKZB 2VQEQ 1Q46A 2KBNA 2RHSB 3U50C 2GVBA 3EBEA 3H0GG 3NENA 5BR8Q 5EAYA 3M4QA 3FKIH 3PIPA 4X65Q 1XJVA 4GNXB 1CUKA 2UXBQ 1IBMQ 3GTOH 4WJ3M 2ZM6L 1C7YA 1VQLA 5C0XG 1K0RA 1Y1VH 4R4QA 5ELNA 3AQQA 3S17H 4LFBQ 1S3OA 3M85A 2OCEA 2PQAA 1LTLA 4GLVB 4GS3A 2HHHL 4LF5L 4YHHL 4LF9Q 1BVSA 3K80C 4R4IA 4DPGA 4LFAQ 3CCEA 4JBMA 4AYBG 3I4OA 1I94L 4JI8L 1HNWQ 1VQ6A 3RZOH 5HGQA 4A3JG 2R92G 1N9WA 3AFPA 1QZGA 5C4XH 4O2DA 5IP7H 4A75A 3TRZA 4BBRG 3K7UC 2HIVA 3E9IA 1E3PA 3S16H 1AE2A 1CSQA 1L1OA 3LGJA 4A3KG 2UXBL 1IBML 2CCZA 5FLMH 1LM0A 3E9HA 3U58A 2JJQA 4DUZQ 1N33L 3D31A 4L5RC 1B70B 3STBC 4JI1Q 3CD6A 3PUZA 1EFWA 4LF8Q 2CQOA 1X55A 4J15A 1S40A 1Q86C 2ES2A 1I6HH 4DAMA 4LFAL 2R6GA 1NJIC 1QUQB 2BA0A 4YWMA 1NE3A 2UUBQ 4BY7H 3M4PA 1I5FA 4RG1A 2MFIA 4JG2A 1X56A 2ID0A 5IY0A 4AQYL 3L2PA 3UDGA 1JB7A 3F2DA 1EIFA 1OXSC 1P16A 4MZ9A 4QQBX 4JV5L 3TREA 3RN5A 5C4JH 2EXDA 1KXLA 2FXQA 2ZTEA 5M5XH 1IL2A 4DUZL 4L5SA 2Z6KC 1XMQL 1XPOA 2JE6I 1UE5A 5HY6A 1WJJA 3CCRA 4A3MG 1L2FA 4RMFA 1WI5A 4POGA 2K52A 2WFWA 3WWVA 5IWAL 1SLJA 1PFSA 1XMOQ 5M5YH 3F2BA 1Q81C 4JI5Q 3HOYG 1C0AA 3IRBA 5C3EH 2NVTH 2F52A 4ALPA 1KIXA 1TWFH 3RN2A 1CKMA 4GOPB 1PYBA 4BBSG 1V1QA 4DV6Q 4PZ8A 4NXML 1E1OA 3MXNB 3A0JA 2B29A 4JOIA 1CKNB 3PUVA 4P75A 3PSIA 4C2MH 1K73C 3RLFA 1VQCA 3L0OA 1FJGQ 3NEMA 2NN6I 2VL6A 4NPSA 4P72A 5IYBH 2WP8J 4UP7A 2GVAA 2UUCQ 1VQEA 3PCOB 4LF7L 2JA5G 4GLAC 2A1AA 2NZHA 4DV7L 3I2ZA 1VQDA 3STBD 3PV0A 1SROA 3CQZH 5JEAJ 3TEHB 4IJLA 4DV6L 1WOCA 3HKZE 1WFQA 4IPDA 4DV3Q 1QVGA 4DR7L 4JI3Q 1EQRA 3PUWA 4HJ7A 2AKWB 1N8RC 1KQSA 3I4MG 1N32Q 3PGZA 5IE8A 1IZ6A 2Y0SG 2YTYA 2KENA 3PUYA 2LXJA 2UUCL 1IBKL 1XNRQ 3TS2A 1TXYA 5GQOA 2A8VA 2N8NA 1K3RA 4A3JH 2R92H 2AWNA 4A3DG 3HKZG 4DAYB 1PH2A 1N34Q 2E5LQ 4KHPL 1A0IA 4BBRH 1TWCH 3CMAA 2UUAL 4A76A 2RHQB 4NB3A 4WJ4A 3VDYA 1V43A 1XPRA 3TQYA 1BBWA 1E22A 1LYLA 4DV3L 4A3BG 4C3IH 4X62L 2I5LX 5M3MG 5GAEC 3CCLA 1VQ5A 5ELOA 3E0EA 2R7ZH 2ZM6Q 1OXXK 3OW2A 3S15H 1HNZL 3ER0A 3GTLH 1N32L 2F3IA 1JT8A 3F8TA 4IJHA 1XNRL 2IT1A 3PF5A 3S2HH 2AHOB 4YHHQ 1TWHH 2R7DA 1A8VA 1EIYB 1YVCA 1HZCA 3CAMA 1N34L 1GO3E 3CCVA 4JI8Q 3RLOA 3T1YL 1JJ2A 2E5LL 4AIMA 2D62A 5IP9H 3F2CA 4Y7NH 2E2HH 3S2DH 3CC4A 1VQIA 4ME3A 1YJWA 4DV2Q 2K5VA 1Y1WG 4AYBE 1PH8A 4YCWA 4QY7A 4A3MH 4JI7L 2NZOA 1VQFA 5M5WH 5M3FG 1N33Q 5LMNW 4KI0A 3DLLA 2K4KA 2D0PA 1X3FA 2IX1A 3HOYH 3CCUA 1YHQA 1VQBA 3CW2C 3ZJYC 1NY4A 5LMUQ 2R93G 1Y14B 4UP9A 4BBSH 4IFDI 3FP9A 3GTQH 3J7A5 3BZKA 1YI2A 1KRTA 4LFBL 4HJ5A 4AQYQ 4QIWE 2IHEA 2OTLA 2MO1A 4HJAA 1XNQQ 2K50A 4DV2L 4JV5Q 4XIGS 3RLNA 4JI4Q 3OTOL 2YTXA 3KDFA 1YHAA 3HOUG 1HZAA 1Z47A 1UE7A 1VQHA 1Q1BA 5GAGC 2ZTDA 2I5HA 1L1OC 2KCMA 2XTIA 1XMQQ 1K9MC 2E2IH 2KCTA 5J3BA 3A5UA 4B3MQ 5IT9c 3UDFA 5IWAQ 4A3GG 4R4OA 5E7NA 4QGUA 5LMUL 1TWGH 4GNXA 4IO9A 3G4SA 1HNXL 2AMCB 1S72A 3HOVG 1GKHA 1EQQA 1Z9FA 5JEAG 4NXMQ 4GN5A 1XNQL 4LW1A 4A4IA 1JMCA 4JI4L 4OXPA 3RZDH 2K5HA 3I4MH 3M4OH 5IYDH 2Q2UA 4DV4L 1SR3A 4B3TQ 1J6QA 4JYAL 4OWXB 1VQ8A 2VNUD 3KJOA 1M90C 2ATWA 4TVAB 1HR0W 4A3DH 2PI2A 3W1BA 4A3FG 2Q2TA 3T1HL 1NMGA 4B3ML 4LF8L 2OQKA 4YCVA 1CSPA 4IPCA 3A5ZB 4BY1G 2EIFA 4PZ7A 4LF7Q 4IFDJ 1G291 1VCIA 1XPUA 1M1KC 3HOZG 1Q1EA 2QEXA 4DV7Q 4A3BH 1FGUA 2B63G 2A19A 5JJLA 3D0FA 5M3MH 4DR5Q 3CC2A 3G71A 4IOCA 2QA4A 1N36Q 1W2BA 3I4NG 4IPHA 1GD7A 3U4ZA 4DR7Q 3CC7A 3H15A 4DR4L 3ERSX 4B3RQ 2IX0A 1QZHA 4UY8C 4B3TL 4JOIC 1YJ9A 1SN8A 2L15A 3RR5A 1QUQA 3GDEA 3AFQA 2NVXH 1KHIA 2V1CC 1IBKQ 2PNHA 5JJIA 3G6EA 1HZ9A 1UE6A 4C3JH 1D7QA 2XGTA 4L5QA 3UDIA 1SMXA 3H0GH 3CMEA 4KHPQ 2Y0SE 2AWOA 2UUAQ 1Y1WH 3ULLA 3KF6B 1IBLQ 3H3VH 4TQUS 4A3EG 4DR5L 1Q12A 4HIDA 3AEVA 3PO2G 1N36L 4DR2Q 5M3FH 3BZCA 4DV5L 4DR6L 4X62Q 4B3RL 1X6OA 2YU9H 4JI0L 2Z0SA 3EIVA 4DR1L 1E24A 1UEBA 1HNZQ 2JA6G 2NN6G 1X65A 1KC8C 2R93H 4JCVE 4HIOA 3W5OA 3JAMi 5C44G 1YEZA 1C9OA 4GOPA 4EX5A 4PMWA 1VS0A 1CKOA 2ZJPA 1CKNA 1V9PA 3GD7A 1OXUA 3KFUA 1B8AA 3L7ZC 3T1YQ 3PF4A 3ULPA 1IYJB 1ASZA 2RCNA 3CPWA 3ULJA 5AJ3Q 1IBLL 3HOUH 4A3KH 2K75A 4DR2L 1EWIA 1JE5A 4X66Q 2MQHA 4GKJQ 4IPGA 4OWWB 1JJCB 4R1JA 5LMNL 4JI7Q 3M7NA 1YZ6A 2Q2IA 2YYZA 1KL9A 1SRUA 3HKSA 4R4CA 4A3GH 1I50H 2KHIA 4L5TA 3SGIA 3GTGH 4A3IG 2CWAA 3PO3G 4FDBA 4YWLA 3S1MH 3GTMH 1TWAH 2WAQG 3KLWA 4LWCA 2CWPA 1PH3A 1J5EL 4JI2L 2ZJQA 2CFMA 3S24A 1BKBA 4APVA 3J81j 1X9NA 3HOVH 3UDXA 3BU2A 3J7ZC 2N78A 4BXXG 4LFCQ 4IOAA 4OO1I 3CPFA 3OYYA 1PH7A 4A3CG 2H5XA 2E2JH 2PQAB 5AJ3L 4HJ9A 2IY5B 3K7AH 4OONA 3W1GA 1W3SA 2DUDA 3OTOQ 4UPAA 4X66L 4GKJL 2JA7G 3CF5A 2IHFA 3H3VI 3FHWA 3HOXG 4A3FH 4P74A 1HR0Q 1DGSA 1IXRA 4AH6A 5C0XI 2PMZE 1B7YB 1VQ7A 4BY1H 3UE0A 2BH8A 4QJFA 2BA1A 2JK8A 4X64L 1L1OB 1WCMG 4NXNQ 3JAMc 2B63H 4JI6Q 3G48A 4IFDG 4DUYQ 3AYHB 2K14A 3KJPA 2BH2A 4LFCL 3I4NH 4DKAC 4XTCS 1HNXQ 1PH5A 2YV5A 3CCQA 1VQKA 1YNXA 4EQ5A 4DR3L 1K8GA 2R7FA 4X6AH 4A93G 2WB1G 2ZJRA 3CCSA 1U5KA 1FL0A 3PIOA 3GTKH 1FVIA 1QVFA 3KF8B 4JBJA 4DV4Q 4LF4L 1G6PA 2VW9A 4JYAQ 4KLKA 2ZTCA 1HR0L 3TS0A 1UE1A 3S1RH 2JA9A 4DV1Q 4GKKL 1HH2P 2MO0A 3HOWG 4HIKA 1PH4A 3T1HQ 2JA5H 3S1QH 2VS1A 5FJ8G 4GN3B 2RF4A 2JQOA 4LUVA 3U4VA 3MEFA 3NBHB 1AE3A 4GN4B 4NXNL 3J81i 2UXDL 1X54A 4A3EH 4JI6L 4DUYL 3PO2H 3S1NH 1YHBA 4OX9L 2DGYA 2VQFL 1HZBA 2VQEL 3S14H 1YJNA 2PI2E 2D0OA 4GNXC 5BR8L 3CCJA 2JA6H 4DR4Q 2JA8G 5FLXc 4X65L 4Y52H 4BA1I 1SE8A 5C44H 1PHJA 2ALYB 3K81C 4LNQA 2LSSA 1RIPA 4DV1L 2YTVA 1OXTA 2R7ZG 4PG3A 3UE1A 4LF6Q 5JJKA 1E7ZA
chains in the Genus database with same CATH superfamily
1E2ZA 2EPBA 4LF9L 4CBVA 2VZAA 4HEDA 1YIJA 1HNWL 2E2IB 1XXGA 4UDUC 4MNOA 2JA5B 3RNUA 4DR6Q 1DZ1A 4A3EB 4A3IH 4DR1Q 2RDHA 1RL2A 3FKIG 2I0QA 2F0FA 1PLFA 5LL6S 4JI1L 5CR3A 1Y8PB 3VYSA 2PO4A 3M4OB 2E2DC 5C44B 5H1SE 1H95A 3J81c 3Q8DA 2L11A 4B3SL 4XXEA 3MEHA 3HOXH 2F0UA 1KAWA 2B2YA 4DV0Q 2IWHA 3I7FA 1WTWA 4JBWA 2Q8RE 5IP7G 1G51A 4A3BB 3N6RA 1LTBD 4K6DA 1LUZA 2KCCA 2C35B 1YBYA 1G91A 2I07B 3JC66 4JI2Q 4JI5L 3NTKA 4K0KL 2NVXB 1I3QB 1GVPA 2WAQE 4HIMA 1TY2A 2UXCQ 4BY7G 4GLXA 4NW2A 3J80L 1DOKA 3C46A 5KRUA 1FJGL 1O7IA 4R9WA 2JA7B 5CV8A 2H1EA 2GN5A 4DXGA 3KYHC 5M3FB 2F0WA 1F9QA 2M00A 2HIXA 1M8AA 5GROA 1ILPA 3BDOA 1EWHA 1HA5A 2JA8H 1K83H 3ICEA 2UU9L 3P7JA 4CJ1B 5C3XA 2JEAI 1B9NA 3GO5A 3QG1A 5D14A 4WORA 3MHBA 4BA2I 2ASBA 5CMDA 1WTQA 4POFA 4G7HC 2WB1E 4GKKQ 3OOCA 3HOZH 3KDFB 2D2CC 2BOSA 2HHHQ 2IX3A 4L63B 1PYWD 5IYBG 2VQFQ 1SJED 2VQEQ 1X32A 4NKLA 4NP5A 3H0GG 5K5PA 3M4QA 3FKIH 4GNXB 2UXBQ 1IBMQ 2ZM6L 2F3WA 4RCOA 4C3HB 1JWSD 1YNNC 3EVQA 3AQQA 3S17H 1SNQA 1AZPA 3OHXC 2K7VA 4GLVB 1STNA 4LF9Q 1T5EA 4DPGA 3CCEA 3K57A 2KA7A 1HNWQ 5HGQA 4CDFC 4A75A 5IP7H 3TRZA 2K6AA 2HIVA 4B9XA 3PIO3 3NE5B 4XT3B 1F77A 1JWUD 3AMUA 1LM0A 3U58A 1N33L 2JJQA 4DUZQ 3D31A 4L5RC 1F2MA 1B70B 4JI1Q 3A8IE 3I8ZA 3PUZA 1NNXA 2NTSA 1LABA 1QUQB 3S1RB 4K8JA 4BY7H 4MTKA 2N88A 4H44C 3S1QB 1PZID 4RHRA 1P16A 1SNCA 1JICA 2ZTEA 1IL2A 1JWMD 2AUKA 3Q23A 3C3LA 3HEJA 4X3KA 1DD2A 3S16B 1WI5A 4POGA 3WWVA 4JI5Q 1O7YA 2PW5A 2NVTH 2F52A 1KIXA 1BCPF 1MI2A 5EJWA 1FYCA 1K8MA 3MXNB 5JVG3 4CKBA 1SNMA 3PUVA 2NYZD 4P75A 3PSIA 4C2MH 1K73C 2DY8A 1AZQA 2B2YC 1FJGQ 1EL0A 1LTTD 2KEEA 4NPSA 5IYBH 2GVAA 1VQEA 1KNEA 3U9SA 3I2ZA 3DWQA 3A8KE 3DWAA 1SROA 3MXPA 3RD4A 4DV6L 2FMCA 4DR7L 1UEAB 1ESFA 5C3EB 1IW7C 4HJ7A 1EIHA 1N8RC 3I4MG 2QCPX 5KIXA 1IZ6A 2K05A 1B1ZA 4KN4C 1IBKL 3TS2A 3W3AA 5GQOA 3DHQA 1K3RA 4ZLTF 1V1OA 2E5LQ 1A0IA 1LTSD 4A76A 2RHQB 4WJ4A 5D3DA 1V43A 1XPRA 1CI3M 2L55A 3TQYA 4DV3L 4C3IH 4X62L 2I5LX 1QOHA 4RHSA 4A93B 2R7ZH 2ZM6Q 3S15H 3ER0A 1N32L 1HFNA 3K5MA 3F8TA 1O7ZA 2QDLA 3C2PA 4V190 1XNRL 3S2HH 2F0IA 1EIYB 1YVCA 1HZCA 4ME5A 4N9PA 1E2VA 3OMCA 4AIMA 2D62A 1EQVA 3HGBA 4C3JG 1VQIA 1ET9A 4AYBB 1YJWA 4AYBE 2PPBC 3H3VC 4YCWA 3NPPA 1D5XC 4QY7A 1VQFA 1N33Q 5LMNW 1SNDA 5G3LF 3DLLA 3GP7A 1V1PA 1UUPA 4IURA 1IW7D 1NY4A 5LMUQ 1NSNS 2ZXRA 2OTLA 2O4XA 1TQOA 3DEOA 4F7XA 1TWHB 2SDFA 2E76C 2EYLA 1HZAA 3LX0A 4UHVA 2XTIA 5FO8B 1B4OA 4A3MB 5M5WB 1VF5C 1TS3A 1SBBB 2AMCB 3MZ5A 1GKHA 1Z9FA 1XNQL 4DGZA 4JI4L 2K5DA 2K5HA 3I4MH 4B3TQ 1STEA 1VQ8A 1HHVA 4FP5D 2C5CA 1M90C 2ATWA 1HR0W 4A3FG 4B9WA 2OQKA 1SYEA 1ONLA 4IPCA 2DNEA 2K5QA 2EIFA 2V4DA 1XPUA 1PRTC 2HCCA 2BDNA 3D0FA 5A2QL 5EKIA 3NSWA 3TSSA 4IPHA 4DR7Q 3U4ZA 2L4NA 3ERSX 4EQOA 4EVOA 5IGCA 3D6CA 1SN8A 4I7AA 1B50A 2PNRC 2F0LA 4JPBW 1U4PA 1QCBD 3GDEA 1IBKQ 2PNHA 5C4JB 4C3JH 5M5XB 4L5QA 5CBAE 3ULLA 1HTPA 1Q12A 4HIDA 3GV3A 5D3IB 5C0XH 2XWJB 4DV5L 4X62Q 3VYUA 4B3RL 5NUCA 3VR6A 4JI0L 2Z0SA 2GA4B 3EIVA 1WD0A 2NN6G 4FXKC 5M3MB 1CM9A 3W5OA 4FNFA 1F9PA 1JORA 1CKNA 1OXUA 2K5WA 3A56A 2MPMA 1HFGA 3A7AB 4F8MA 3H94A 1JE5A 4DF7A 1LT5D 1TS2A 5LMNL 1YZ6A 1SRUA 1I50H 2KHIA 5CV7A 3GTGH 1LTRD 4YWLA 3V2TA 1Q3LA 5IGDA 3S1MH 2CVRA 2NWGA 4LWCA 2CWPA 3ITPA 3TP6A 4KD4A 2YU9B 2ZJQA 1BKBA 4BXXG 4OO1I 1PTOH 2N78A 3KLSA 4LFCQ 3OYYA 1G8ZD 1PH7A 5JPNC 1ESRA 4JW0A 4LK1C 4CHTB 5JPMC 1ICFB 1WTOA 3CF5A 2IHFA 3H3VI 3FHWA 4A3FH 1SNPA 2G9DA 4L6TB 1IXRA 4DAYA 1B7YB 1CTMA 3UE0A 4A3KB 2BH8A 3N52A 4KD3A 1JB3A 3JAMc 4HMJA 4DK1A 4JI6Q 1VF7A 2BH2A 4DKAC 2MJ8A 5BN3A 1VQKA 3BDCA 2R7FA 3GTMB 1TWAB 3GTKH 4JBJA 2EXZA 3HOVB 1RD9D 4LF4L 2VW9A 4KLKA 4R8IA 1EYDA 2E2HB 1HR0L 2EY1A 2JA9A 1HH2P 3ND9A 2VS1A 4GN3B 3D4DA 3MEFA 4X3UA 4GN4B 2JP1A 2UXDL 3TZDA 1KABA 4OX9L 4FF3A 3HOYB 3S14H 1PRTB 2PI2E 2NN6H 4BBSB 4Y52H 3GTQB 4M8AA 1SE8A 2LSSA 4G57A 2Z1CA 2YTVA 1OXTA 2RCFA 3MC0B 1Z7TA 1ZYRC 1OTCA 4A3LG 1I6VC 1Y8NB 1PH9A 4ZRZA 1UWVA 1ET6A 5FLXE 4CDEC 1TT2A 5IP9G 4DV5Q 1SYBA 1B3AA 2Z6KA 1F2YA 3PO2B 4JI0Q 1QVCA 1S5BD 1XTCD 2ENBA 4OWTB 5I9PA 3NK9A 1PV4A 4BXXH 4LF6L 1NTGA 1Y1VG 3GTPH 2Y0SB 5GAHC 2BCOA 4KY5A 1KTKA 1VQGA 1YNJC 3J80i 3H91A 4QCLA 4K5VA 3NHHA 1P8LA 2SNSA 3V96A 1GUGA 2OXPA 4IALA 2BDOA 1A63A 2JEBI 1MJEA 5LMNQ 1K8AC 1OXVA 2BE5C 3DM3A 2XVSA 3VR3A 5D65A 5FLMG 3VR2A 4A3IB 5JVH3 2NB0A 4U68A 1G2SA 1T9HA 5J22A 4DNIA 4H02A 1JJGA 4KHVA 4DV0L 1SE3A 5E3FA 2OTJA 3CCMA 2OF1A 2ZXOA 2LXKA 2OQ0A 4P71A 3CXCA 1VQOA 5IYDG 2E75C 3KF6A 3E5SA 1C48A 2VXWA 3K59A 1PYSB 1C4QA 1HUNA 3TZUA 5GADC 1RCVD 4HJ8A 2B3GA 2R93B 4QL5A 2TMPA 3VR4A 1O7LA 3T16A 2UXCL 1KRSA 2HQLA 3DWPA 2MUYA 3SK4A 3M9BA 4LF4Q 2N3SA 1YNJD 3E0JA 1HJPA 3I90A 1U0LA 2J4XA 1A2UA 1SFOH 4A3LH 2UXDQ 3SXHA 2BE5D 4DK3C 4OX9Q 1VQ4A 1Q46A 2KBNA 3U50C 3U9OA 1A3UA 4K6LA 3GTOH 5EQ0A 3DM1A 4WJ3M 2JA8B 4GZYC 2PZWA 1SYGA 1UNSA 1Y1VH 2E2JB 5ELNA 3K7AB 2EDGA 2TSSA 5EPLA 2PQAA 1LTLA 1EEID 2HHHL 2J0TD 1WTVA 2PZTA 3K80C 1WD1A 4LFAQ 2AQ3B 3NQIA 1STHA 4JI8L 2XRQD 2F03A 4A3JG 1STGA 2R92G 3AFPA 1QZGA 3HOZB 4O2DA 4BBRG 2L1BA 2HQEA 3E9IA 4OL7A 2B63B 2OEOA 5J1ZA 1GUOA 3IFDA 4NDXA 2UXBL 1IBML 5FLMH 2A69D 3M4YA 1I4GA 2M9VA 2WV6D 1A2TA 1AFPA 3FKIB 2CQOA 4J15A 1I6HH 4DAMA 4OELB 2R6GA 4KK7A 4YWMA 3HZXA 4C1NK 3S17B 4J6HA 5IY0A 1GUSA 1X56A 4AQYL 3K5OA 1JB7A 4QQBX 2VB3X 4DK0A 3RN5A 1KXLA 2EXDA 2FXQA 1C8CA 1EY9A 4DUZL 2Z6KC 2F0VA 1UE5A 5HY6A 2EZVA 1WJJA 3CCRA 2JA6B 4FF4A 2K52A 5IWAL 1SLJA 1PFSA 3SR1A 4I7ZC 2EE1A 3IRBA 2QKIC 4HN7A 5T1IA 1IKLA 1V1QA 1E1OA 2B29A 1CKNB 1K3BC 4J1MA 3GTJB 3L0OA 5C4ZA 3NEMA 2X6LA 5IIFA 4V0BA 4CJ2C 3KBXA 4H0LC 2JA5G 3FVQA 3OIPA 2NZHA 2WAQB 1RKNA 5EKLA 2JYOA 5EKKA 3CQZH 5CV5A 3HKZE 3MVVA 2NVTB 3NP8A 2AKWB 3BS1A 2KENA 1B3QA 3QOLA 5CV6A 3QWNA 1IL8A 1TXYA 1JC7A 4C2MB 2A8VA 2DY7A 4A3JH 2R92H 2AWNA 2QF7A 3HKZG 4DAYB 4A3DG 1O78A 3MWYW 4BBRH 2UUAL 3MFYA 3ZYYX 3SK5A 4A3BG 1E22A 1LYLA 2K03A 4X3SA 3CCLA 2O2LD 3SE0A 1W6KA 2WB1B 2NBFA 3E0EA 5ELOA 1OXXK 5KEEA 5I9OA 1HNZL 3GTLH 2XRSD 2B2VA 4IJHA 1QB5D 2IT1A 3PF5A 2AHOB 1FNUA 4IFDI 4ZK9B 5FO7B 1EY5A 4JI8Q 3RLOA 2E5LL 2JN4A 4Y7NH 1EU3A 3CC4A 4TSSA 1PH8A 5M3FG 4M1UB 2K4KA 1U4RA 1X3FA 2EY6A 1F9RA 3VYRA 1MSHA 4HTHA 4C3IB 1STAA 3CW2C 4QF4A 4ILWA 2R7ZB 3S15B 5IT9L 1BOSA 1LT4D 2MP1A 3BZKA 3IKJA 4QIWE 3J7YW 4AQYQ 2K50A 3RLNA 2B8FA 3OTOL 1KLGD 2YTXA 2FINB 3HOUG 1Z47A 1QJOA 1GXDC 3D4WA 2E2IH 3FMCA 4B3MQ 3UDFA 4MN3A 5IWAQ 3IAYA 4DFAA 3I72A 4C1NI 5LMUL 4QGUA 3G4SA 1S72A 1EQQA 1PTOC 2A74C 4LW1A 1TKWB 1EQTA 5ELBA 1LO5D 3RZDH 3TDQA 3M4OH 1QG7A 2Q2UA 4DV4L 1A3TA 1SR3A 2VNUD 4OWXB 3KJOA 1TIID 4TVAB 4ABNA 3DUZA 4A3DH 5C4XB 2PI2A 2DJFC 1NMGA 1Q8IA 1H9JA 3A5ZB 3VA7A 1G291 2KVMA 4F88A 1TY0A 1B53A 1AW7A 1YNND 3L9AX 4A3BH 3LWEA 1QILA 1FGUA 2WIIB 2A19A 5IGGA 3CC2A 3I4NG 1GD7A 3H15A 4FVMA 4B3TL 3RR5A 5JOBA 3SDZA 2NVXH 3AFQA 4ODGA 4RGTA 4S3SA 3RMHA 3I4MB 5A35A 3EFXD 1ZEQX 1HZ9A 1UE6A 1LT6D 1SMXA 3H0GH 2UUAQ 3KF6B 2LFNA 2QILA 3ERQA 5M3FH 3BZCA 1CA6A 4WFN3 1X6OA 1UEBA 1HNZQ 2IJ0A 1KC8C 4DNTB 4JCVE 1B9MA 1C9OA 3T4AC 4GOPA 4C56C 4EX5A 4IUQA 1V9PA 3GD7A 3KFUA 1B8AA 4ZKBB 3DXJC 1IYJB 2RCNA 3CPWA 2K01A 3ULJA 1PXUA 3HOUH 2K75A 1EWIA 4KY6A 4GKJQ 3H6MA 3CU7A 4G4KA 3M7NA 2YYZA 1KL9A 3SGIA 3PO3G 2XN9C 4F87A 4FDBA 3OW7A 4HCEA 3D4RA 1U4MA 2F0TA 1PH3A 1J5EL 2B2VC 2CFMA 3S24A 3J81j 5F2DA 2QDBA 4K14A 2F0NA 1BF4A 2H5XA 2PQAB 3C1FA 1CZGA 4HAEA 3OTOQ 1ENFA 4IUVA 1VMPA 3OWEB 5DM63 1DGSA 5C0XI 2PMZE 1Y69U 2IW3A 4N9TA 2BA1A 1SYFA 4HSPA 3VA5A 5M9OA 1WCMG 5E1FA 4CJ0B 2SOBA 1OO9B 1RF2D 3AYHB 2K14A 3KJPA 3I4NH 4LFCL 3GTGB 4XTCS 3A8JE 3AB9A 1YNXA 4DR3L 3S1MB 4H7BA 4A93G 3J7AV 2CW0C 1FL0A 1S5CD 4DV4Q 4RGNA 1PTOB 1G6PA 3TS0A 3S1RH 5FLXL 1I4QA 3JAME 3HOWG 4HIKA 1KDCA 2QEJC 1PH4A 3S1QH 3U4VA 2EYMA 1PZJD 1SSOA 1SYDA 4JI6L 4FXGC 1B2TA 2JXMB 2DN8A 2SEBD 4BWGB 4KMUC 1CZWA 2D0OA 3CCJA 4RFBA 2EYPA 3KBGA 1U4LA 5KNDA 4PV1C 3K81C 1RIPA 4DNRB 2AQ2B 3UE1A 4ZYSA 1AEXA 2NTTA 4KJNA 1E7ZA 1PDQA 1NAPA 2KJXA 2D9UA 3MXUA 3A74A 3GV6A 4P73A 2VUMG 5ELCA 2F0HA 3J81L 1D1KA 1R4PB 1EYCA 3PO3H 3I56A 1X3EA 4TRDA 1EWCA 3S14B 4YY3Q 2EQSA 4LJZC 2Q2HA 3NELA 4XQNA 1FGBD 1EOVA 2B2WA 2WKDA 3M3YH 2KEDA 4JBKA 3E6ZX 1E1TA 4O1NA 1WYDA 2RSOA 4R4TA 1NR4A 3I55A 1WCMH 1EYGA 2A6EC 4PZ6A 4YWKA 4KKUA 4H13C 1J5EQ 2NVYH 3CRKC 2NVQH 1GM5A 4GOPC 3O13A 4A93H 4RKLA 5IODA 3MXGA 5FKAC 4NMZA 2J7ZA 2F4VQ 1VQAA 2I5MX 4LUOA 1Q82C 3BJUA 3GTPB 3HFZB 4O0AA 1CQVA 4DK6C 3HOWH 1AH9A 1SEBD 1KAAA 1PRTD 1L0WA 3TP8A 1Q8KA 4XYQA 2N49A 1DOMA 2QGQA 1PH6A 4LUZA 1Q7YC 2EJGC 2ICEC 3I4LA 3OSOA 3RUZA 4DR3Q 1VQ9A 1X3GA 3J80c 3P75A 4OHJA 1R9TH 2PQEA 2VY3A 1D8LA 4JI3L 1YITA 1JCKB 3SHLA 3F2UA 3CP0A 2F0DA 2K04A 1GHKA 3L3OC 4PMCA 2LKVA 3K8AA 4LF5Q 3EN2A 1S5DD 2ICIA 1MD2D 4OO1G 1D1IA 2VUMH 2MNAA 3I73A 1I94Q 3PUXA 2G9HD 4A3GB 2A6ED 3BZDB 3GQBA 1BNZA 4K5WA 1PRTF 3X3MA 3NENA 3PIPA 1CUKA 5BN4A 1VQLA 1C7YA 1SAPA 1K0RA 4R4QA 2EOTA 1S3OA 3M85A 4GS3A 4XQJA 1PFMA 3I4OA 5EBDA 4PMBA 1VQ6A 3RZOH 3K7UC 1A3VA 1E3PA 1AE2A 1CSQA 3LGJA 4A3KG 1BUVT 2HDLA 3CD6A 3X3NA 4LF8Q 1J9OA 1S40A 3A7LA 4ZUJA 2ES2A 1X3QA 3PQIA 4LFAL 1IYVA 1NJIC 1Y1VB 4YIJA 1NE3A 3QO2A 3FDTA 3UDGA 1RDPD 2ID0A 1PVOA 4MZ9A 3TREA 2K28A 5C4JH 2F0SA 1XWEA 2F0QA 3NWSA 5KNBA 5M5XH 3S1NB 1NCVA 4RWSC 1ZXTA 4L5SA 1KDBA 3I91A 4QB4A 1A15A 5LHY1 1XMQL 2JE6I 3P1HA 1L2FA 4RMFA 3J7AF 2WFWA 1Q81C 3SEBA 5M5YH 3F2BA 3HOYG 3WOFA 1EIGA 1TWFH 3RN2A 1CKMA 4XYOA 4GOPB 1PYBA 5I2YA 4BBSG 4QUFA 2B2WC 2F0PA 1WTXA 4NXML 4PZ8A 4IUUA 4JOIA 1TR5A 2D5DA 3RLFA 1VQCA 2HUGA 2Q8TA 4OO1H 4P72A 5C6AA 2FHTA 2WP8J 4UP7A 2UUCQ 5CORA 3PCOB 1HXYD 2L12A 1L0YB 4IUNA 1CA5A 4LF7L 2A1AA 1RJTA 2KUMA 1VQDA 1DONA 3PV0A 3TEHB 5EGTA 3EROA 1WOCA 3LWUA 4IPDA 1QVGA 3R2TA 1F2ZA 4JI3Q 1EY7A 1ZYRD 3PUWA 1H9MA 1EY4A 1J8IA 2Y0SG 3HOXB 2YTYA 3OPOA 1ILQA 4OGQC 3PUYA 3MXNA 2N8NA 5FOBB 3P20A 1N34Q 4QUCA 1TWCH 3CMAA 4N8FA 1BR9A 1V1PB 4NB3A 1S5FD 3NUCA 1BBWA 5GAEC 1MSGA 1MHWC 3OW2A 1MBYA 2RDGA 3T13A 1IYUA 1HA6A 3CQZB 2F3IA 3K5LA 1D5MC 3CKIB 1WTPA 2B2UA 4ZUIA 4OEMB 1GHJA 3CAMA 5IOCA 1C0AA 1BO0A 2VB2X 3T1YL 4LFBQ 3S2DH 5IP9H 2E2HH 1WTRA 1LTGD 3CRLC 2IL8A 2I46A 3I70A 4DV2Q 4HMIA 1Y1WG 2B39A 4A3JB 2R92B 5I2XA 1QNUA 3R93A 2NZOA 4JI7L 2CH4W 2XNAC 1K83B 5DNFA 2D0PA 3HOYH 3CCUA 3DEPA 1VQBA 3TP5A 1JOOA 1LACA 3ZJYC 1BXTA 3T51B 2R93G 1SNOA 4UP9A 4BBSH 3GTQH 2WINB 4FO2A 1KRTA 4KN7C 3K6OA 2L5TA 2MO1A 4HJAA 2R61A 3C1EA 5DM73 1VQHA 1CT1D 1LTAD 1Q1BA 2LMCB 1XMQQ 1RODA 2F1MA 5J3BA 3A5UA 1KDAA 4WRDA 4R4OA 1HCZA 5E7NA 4ID6A 1TWGH 3TBIB 3K0YA 1HNXL 2FFKB 4NXMQ 1TU2B 4GN5A 4DN4M 1H9SA 1GOZA 4OXPA 1JMCA 5IYDH 1EOTA 5IGBA 3QR8A 2Q8IB 3T1HL 4B3ML 4YCVA 1CSPA 5IGFA 4BY1G 2F0KA 4IFDJ 4LF7Q 1VCIA 2RQXA 1H9RA 3HOZG 2B63G 4DR5Q 3G71A 4DA2A 1N36Q 4Z9CB 1W2BA 4DAPA 4DR4L 4CKEA 3MTSA 3Q24A 5KYLA 1QZHA 2DJGC 4JOIC 4BY7B 1NUCA 2CHBD 3BVZA 4XDXA 3D6WA 3RZDB 5JJIA 4RA8A 3G6EA 2EVBA 1PMRA 2XGTA 1QNKA 1K0SA 2AWOA 1Y1WH 2RKSA 4A3DB 1IBLQ 3HKZB 4TQUS 4A3EG 3NXWA 4DR2Q 2N55A 4MIUA 5IGEA 1DCZA 1E24A 2JA6G 1M4VA 1TVXA 1X65A 3FPUB 2DNCA 2PW7A 4HIOA 2R93H 5C44G 1YEZA 2KQ3A 2ZJPA 1ENAA 3PF4A 3T1YQ 3ULPA 1ASZA 1EY6A 5AJ3Q 3OIQA 3A55A 4X66Q 1HTLD 4IPGA 4OWWB 3H0GB 2HCIA 4R1JA 4JI7Q 2Q2IA 2EY2A 5JJZA 4L5TA 2CWAA 2F0EA 5EPKA 5CBEE 2PZUA 2XIWA 3KLWA 3KK7A 1EY0A 2WAQG 3QOJA 5C5MA 2KOLA 1X9NA 1BCPC 2B2UC 2IPKD 1LT3D 4A3CG 3JAML 1TS4A 2E2JH 2RBMA 2IY5B 3K7AH 3W1GA 1KLUD 4UPAA 4GKJL 2JA7G 1AN8A 5CC4A 2A73B 5L37A 4EGVA 3HOUB 4BY1H 4XT1B 2PYKA 4X64L 3R2IA 4IZ8A 4NXNQ 4RCNA 2B63H 4IFDG 4ZQ3A 4DUYQ 2ZXPA 4QIWB 4E6IA 1HNXQ 1PH5A 1X3PA 1K8GA 4EQ5A 4X6AH 3M7GA 2WB1G 2ZJRA 3S2HB 1U5KA 3PIOA 1FVIA 2K1BA 1UE1A 4DV1Q 1F9SA 1O80A 3T1HQ 2JA5H 5FJ8G 2JQOA 1GUNA 1SE2A 2XSCA 3J81i 2LY7A 1X54A 4A3EH 5CYUA 5JAVA 1YHBA 4JVZA 3A54A 1HZBA 2A6HC 2WKCA 1IKMA 1G6ZA 2F0MA 4KY7A 5BR8L 2JA6H 4DR4Q 4C3HG 4X65L 1BCPD 4BA1I 3I4NB 1BDOA 5C44H 4C3IG 3VR5A 2R7ZG 4TKOB 5JJKA 3F2DA 2KHJA 3GTJH 3K0XA 1NMFA 5IYCG 4B3SQ 3SK8A 2QW7A 1JQYD 3KLRA 5C3WA 2HT1A 1Z6HA 3K5NA 4KHZA 3BYYB 5C0XJ 1DJRD 3NQTA 4UP8A 2Z9HA 2K5NA 1I3QH 3ND8A 1PA6A 5ELFA 1DOLA 4A3CH 3FPPA 3OWFA 4JC0A 1VQNA 1H9KA 4K0KQ 3IL8A 2OWOA 2UUBL 2X6GA 2JA7H 3ONAB 4LMQD 4BS9A 1MKHA 1NBWA 2A68C 3NBIA 2PCFB 5DLQE 3KLSX 4XQQA 4CDCC 5C4XG 5K36G 1R4QB 2A6HD 1JE4A 1MIUA 4R8NA 4YY3L 1PTOD 1QE6A 4Q5VA 4IFDH 2KHSA 1XMOL 3PO3B 1EU4A 1MGSA 1GUTA 2UU9Q 4EQPA 1BCPB 2WACA 1PH1A 1MJCA 4C3JB 5DAUA 3HG9A 1BBUA 1XTDA 1UAPA 5FJ8H 3M3YB 1PZKD 1SJHD 1VQJA 3B6YA 3QIAA 2MGSA 4X64Q 1A62A 5G3LD 1EY8A 2L0CA 1B44D 1EUJA 1PFNA 1WCMB 4C3HH 4FF1A 2F4VL 5EPJA 5C3EG 1LLRD 4IUPA 3KOJA 1VQPA 2NVYB 4I65A 2NVQB 4YCUA 1VQMA 1PTOF 4L8JA 1ASYA 2E8GA 1KD1C 2PMZB 2F0JA 5KYIA 2A5HA 2E74C 2A68D 4MTNA 5IYCH 3HOWB 5HGTA 3J80E 1I50B 3F1ZA 2CKZB 3DMUA 2RHSB 2EYHA 5EBCA 2GVBA 3EBEA 5BR8Q 5EAYA 1I4PA 2HDMA 4X65Q 1XJVA 2G5DA 5C0XG 2P5ZX 2F3VA 1R9TB 1H9SB 1D6EC 1DXMA 2NUCA 2OCEA 4LF5L 1L0XB 1BQQT 1TS5A 4YHHL 1BVSA 4R4IA 4JBMA 2EYOA 4DU9A 3Q0AA 4A3FB 4AYBG 5DEHA 2MHVA 3HP3A 1I94L 4MHEA 3R3OA 1JR0D 1N9WA 5C4XH 3FRPB 5K36H 4ZCKA 3S16H 2B2TA 1T5XD 2F0OA 2VUMB 2XWBB 1L1OA 3D8GA 1EZ6A 2CCZA 1FNWA 3E9HA 1JOQA 3WDNA 3T53B 3FEWX 3STBC 1EFWA 1II3A 2Z6BA 3GTKB 1Q86C 1X55A 2JSOA 3VYTA 5E4WC 1LTID 1G2TA 2L9HA 3KF8A 2BA0A 2UUBQ 3M4PA 1I5FA 4RG1A 2MFIA 4JG2A 3EJIA 3L2PA 1ENCA 1EIFA 1OXSC 1SXTA 4JV5L 1CFMA 3SK6A 5BN5A 3NBHA 3BYTB 4QMGA 4JK1C 5IT9E 3RZOB 1XPOA 4KKTA 2CW0D 4A3MG 1XMOQ 4LF8L 4IQZA 1I4RA 3G6JB 4OIKA 5C3EH 5AFWA 4ALPA 5I6YA 4HCSA 4DV6Q 4CDDC 3A0JA 3OMGA 2F4IA 5J39A 5FK9C 1AP0A 1ICWA 3TP7A 1NR2A 2NN6I 2O5JC 2VL6A 5ELEA 5CV9A 4GLAC 2RA4A 5HURA 4DV7L 3STBD 5JEAJ 2H4OA 4IJLA 5ISRA 3KUPA 4DV3Q 1WFQA 3NTIA 5M5YB 1HQMC 3I3CA 1STBA 3MFGA 1EQRA 1TWFB 1RHPA 1RTNA 1KQSA 1N32Q 3PGZA 5IE8A 5ELDA 4ULLA 1XNRQ 2LXJA 2K32A 3CHBD 4G7ZC 2UUCL 4FXDA 3W2DA 4PQXA 1PH2A 4KHPL 1CQFA 1I4XA 1A6XA 4RGOS 1SDFA 4P2CB 2FJ2A 4K5XA 3VDYA 3E3XA 1SMYC 5M3MG 5TSSA 1VQ5A 4UAIA 1Y8OB 3K58A 1JT8A 4YHHQ 1TWHH 2R7DA 1A8VA 4KTAA 1N34L 1GO3E 2AQ1B 2KCNA 4LAAA 3CCVA 1JJ2A 3F2CA 4ME3A 2K5VA 2EJFC 4CGYB 4FF2A 1V8QA 1LV9A 4A3MH 4X3TA 5M5WH 1TWCB 4KI0A 2O5IC 2IX1A 2B8GA 2KECA 3LNNA 1YHQA 4U673 1Y14B 3FP9A 3J7A5 1YI2A 4LFBL 2RVLA 4HJ5A 1GUWA 3WOEA 1S4ZA 2IHEA 3BG3A 4ZAIA 1SFOB 2NZ1D 1XNQQ 4DV2L 4N8X1 4JV5Q 4XIGS 4JI4Q 3URYA 3PIP3 3KDFA 1YHAA 2X69A 5COYA 5CV4A 4CKCA 1UE7A 5GAGC 3S2DB 3HS0C 2B2TC 2ZTDA 1PFBA 2I5HA 1L1OC 2KCMA 2Z4HA 4DAVA 5KNCA 1K9MC 2KCTA 2LS01 5IT9c 1SMYD 4A3GG 3HRZC 3GTOB 1DM0B 2Z8LA 4GNXA 2HD3A 4IO9A 3HOVG 4B08A 5JEAG 4A4IA 1J6QA 4JYAL 1HRJA 1RTOA 3EA6A 4FYDA 3W1BA 2Q2TA 4WJWA 5C5LA 2OT2A 4PZ7A 1EFID 3NTHA 4PNYA 2EY5A 4K8IA 1Q1EA 1STYA 1U9RA 4DXFA 5I4DA 2QEXA 4DV7Q 1M1KC 1SYCA 1WTHA 5JJLA 1XYIA 5M3MH 4IOCA 3TMEA 2QA4A 1HPCA 4RKBA 3CC7A 1I6HB 4B3RQ 2Z4IA 1TWGB 2IX0A 4UY8C 1EYAA 1K8OA 5KGUA 1YJ9A 2L15A 1VDZA 1QUQA 4HR7B 4EQNA 1KHIA 4RAUC 2V1CC 3S9WA 3MAQA 1ZKOA 1IHZA 2RDFA 3BVGA 1D7QA 2EYJA 3UDIA 4KHPQ 3CMEA 4HSVA 1FR3A 2Y0SE 1JOKA 3H3VH 4DR5L 3AEVA 1CHQD 3PO2G 1N36L 2EJMA 4DR6L 4Q0FA 2YU9H 2F0GA 4DR1L 3T56B 3PMFA 3BVMA 1HUMA 5FO9B 3JAMi 5A2QE 3NWTA 4IUTA 4PMWA 1VS0A 3J81E 1I4HA 2CQAA 1CKOA 3H09A 1EZ8A 3IFTA 3L7ZC 3SVMA 4G7OC 2K33A 1D5ZC 4K2LA 1IBLL 4A3KH 3V05A 4J8QA 4DR2L 2MQHA 1JJCB 5C4HA 4K2KA 1Y1WB 3HKSA 4R4CA 4A3GH 1KNAA 1Q90A 1GJXA 1FD7D 4A3IG 5E4XA 3GTMH 1E2WA 1TWAH 1W6JA 4JI2L 4APVA 3QJYA 1K28A 3HOVH 4IOAA 3UDXA 3BU2A 5JEAH 3J7ZC 3CPFA 2A69C 2EYFA 5AJ3L 4HJ9A 4OONA 4RH6A 1W3SA 2DUDA 1XX8A 4IN3A 4X66L 1F2LA 1QWYA 1S5ED 1DYQA 3HOXG 2R3ZA 4P74A 4BBRB 1HR0Q 4AH6A 2ZT9C 1VQ7A 1D2BA 3MA2B 3Q6SA 1EEFD 4QJFA 2RSNA 2JK8A 1L1OB 5CGKA 2M2LA 4KKSA 3G48A 3G7LA 3GTLB 1HQRD 2YV5A 3CCQA 1SE4A 4ZKCB 3CCSA 3D3RA 1BBXC 1QVFA 3KF8B 1CHPD 4JYAQ 1E0BA 3R8BA 2ZTCA 4Y7NB 4OIJA 4GKKL 2MO0A 5I6WA 4O42A 2RF4A 4LUVA 3TN2A 3NBHB 1AE3A 4NXNL 2FMMA 4KJOA 1CK1A 4DUYL 3PO2H 3S1NH 3EQLC 2DGYA 3BDLA 2VQFL 4BY1B 2SNMA 2VQEL 2AUJD 1WVLA 5LL6X 1YJNA 3QB3A 4GNXC 3AU7A 1FNVA 2JA8G 1VMCA 5FLXc 2CH4A 1PHJA 4RGMA 2ALYB 4LNQA 1ML0D 3Q22A 2C9OA 5T1GA 4KV6A 4DV1L 3UI2A 4PG3A 4LF6Q
chains in the Genus database with same CATH topology
4LF9L 2KHJA 3GTJH 2VZAA 3K0XA 1NMFA 1OTCA 5IYCG 1YIJA 4A3LG 4B3SQ 1HNWL 3A74A 1PH9A 4P73A 4MNOA 1UWVA 2VUMG 3RNUA 2HT1A 5IP9G 4DV5Q 4DR6Q 3PO3H 2Z6KA 3I56A 4A3IH 1X3EA 4KHZA 4JI0Q 4DR1Q 5C0XJ 1RL2A 1QVCA 4UP8A 3FKIG 2K5NA 4OWTB 2EQSA 4YY3Q 2I0QA 4JI1L 1I3QH 1PV4A 4BXXH 4LF6L 2Q2HA 1PA6A 3NELA 1NTGA 1Y1VG 4A3CH 3GTPH 1EOVA 5GAHC 1VQGA 4JC0A 5H1SE 1VQNA 1H95A 3J81c 3Q8DA 4K0KQ 3J80i 2OWOA 2UUBL 4B3SL 3M3YH 2JA7H 4JBKA 1E1TA 1P8LA 3HOXH 1WYDA 1KAWA 1MKHA 1NBWA 4DV0Q 4R4TA 3I7FA 5DLQE 4JBWA 1A63A 2JEBI 1MJEA 5LMNQ 5C4XG 5IP7G 1G51A 5K36G 1K8AC 1OXVA 3I55A 1LUZA 3DM3A 1MIUA 1AH9A 1WCMH 1EYGA 2C35B 4YY3L 4PZ6A 1YBYA 4YWKA 5FLMG 1PVOA 1J5EQ 1XMOL 2NVYH 3JC66 4JI2Q 2NVQH 4JI5L 1GM5A 4GOPC 4A93H 4K0KL 2UU9Q 4HIMA 1GVPA 1VQAA 1T9HA 2I5MX 2WAQE 4LUOA 4DNIA 1PH1A 1MJCA 2F4VQ 2UXCQ 1Q82C 4H02A 3BJUA 4BY7G 4DV0L 1JJGA 3HFZB 4O0AA 4DK6C 4GLXA 2OTJA 3CCMA 3HOWH 1BBUA 1XTDA 2LXKA 2OQ0A 4P71A 1L0WA 3CXCA 5FJ8H 1VQOA 1FJGL 1O7IA 1Q8KA 5IYDG 1VQJA 2GN5A 3B6YA 2N49A 3KYHC 2QGQA 3KF6A 4X64Q 1A62A 1PH6A 1PYSB 2HIXA 4LUZA 5GROA 5GADC 1Q7YC 1EUJA 4HJ8A 2B3GA 4C3HH 2JA8H 1K83H 4QL5A 4DR3Q 1VQ9A 2UU9L 3ICEA 2F4VL 1X3GA 5C3EG 3J80c 1R9TH 3KOJA 1VQPA 2UXCL 2JEAI 2VY3A 1KRSA 2HQLA 1D8LA 4YCUA 1VQMA 4JI3L 3GO5A 1YITA 3M9BA 1ASYA 4LF4Q 2E8GA 2N3SA 1KD1C 3CP0A 4BA2I 2ASBA 1HJPA 4POFA 1U0LA 2WB1E 4GKKQ 1SFOH 3K8AA 4MTNA 3HOZH 4LF5Q 3KDFB 2HHHQ 3EN2A 5IYCH 4A3LH 2UXDQ 4OO1G 2VUMH 5IYBG 2MNAA 4DK3C 1I94Q 4OX9Q 3PUXA 2VQFQ 1VQ4A 3F1ZA 2CKZB 2VQEQ 1Q46A 2KBNA 2RHSB 3U50C 2GVBA 3EBEA 3H0GG 3NENA 5BR8Q 5EAYA 3M4QA 3FKIH 3PIPA 4X65Q 1XJVA 4GNXB 1CUKA 2UXBQ 1IBMQ 3GTOH 4WJ3M 2ZM6L 1C7YA 1VQLA 5C0XG 1K0RA 1Y1VH 4R4QA 5ELNA 3AQQA 3S17H 4LFBQ 1S3OA 3M85A 2OCEA 2PQAA 1LTLA 4GLVB 4GS3A 2HHHL 4LF5L 4YHHL 4LF9Q 1BVSA 3K80C 4R4IA 4DPGA 4LFAQ 3CCEA 4JBMA 4AYBG 3I4OA 1I94L 4JI8L 1HNWQ 1VQ6A 3RZOH 5HGQA 4A3JG 2R92G 1N9WA 3AFPA 1QZGA 5C4XH 4O2DA 5IP7H 4A75A 3TRZA 4BBRG 3K7UC 2HIVA 3E9IA 1E3PA 3S16H 1AE2A 1CSQA 1L1OA 3LGJA 4A3KG 2UXBL 1IBML 2CCZA 5FLMH 1LM0A 3E9HA 3U58A 2JJQA 4DUZQ 1N33L 3D31A 4L5RC 1B70B 3STBC 4JI1Q 3CD6A 3PUZA 1EFWA 4LF8Q 2CQOA 1X55A 4J15A 1S40A 1Q86C 2ES2A 1I6HH 4DAMA 4LFAL 2R6GA 1NJIC 1QUQB 2BA0A 4YWMA 1NE3A 2UUBQ 4BY7H 3M4PA 1I5FA 4RG1A 2MFIA 4JG2A 1X56A 2ID0A 5IY0A 4AQYL 3L2PA 3UDGA 1JB7A 3F2DA 1EIFA 1OXSC 1P16A 4MZ9A 4QQBX 4JV5L 3TREA 3RN5A 5C4JH 2EXDA 1KXLA 2FXQA 2ZTEA 5M5XH 1IL2A 4DUZL 4L5SA 2Z6KC 1XMQL 1XPOA 2JE6I 1UE5A 5HY6A 1WJJA 3CCRA 4A3MG 1L2FA 4RMFA 1WI5A 4POGA 2K52A 2WFWA 3WWVA 5IWAL 1SLJA 1PFSA 1XMOQ 5M5YH 3F2BA 1Q81C 4JI5Q 3HOYG 1C0AA 3IRBA 5C3EH 2NVTH 2F52A 4ALPA 1KIXA 1TWFH 3RN2A 1CKMA 4GOPB 1PYBA 4BBSG 1V1QA 4DV6Q 4PZ8A 4NXML 1E1OA 3MXNB 3A0JA 2B29A 4JOIA 1CKNB 3PUVA 4P75A 3PSIA 4C2MH 1K73C 3RLFA 1VQCA 3L0OA 1FJGQ 3NEMA 2NN6I 2VL6A 4NPSA 4P72A 5IYBH 2WP8J 4UP7A 2GVAA 2UUCQ 1VQEA 3PCOB 4LF7L 2JA5G 4GLAC 2A1AA 2NZHA 4DV7L 3I2ZA 1VQDA 3STBD 3PV0A 1SROA 3CQZH 5JEAJ 3TEHB 4IJLA 4DV6L 1WOCA 3HKZE 1WFQA 4IPDA 4DV3Q 1QVGA 4DR7L 4JI3Q 1EQRA 3PUWA 4HJ7A 2AKWB 1N8RC 1KQSA 3I4MG 1N32Q 3PGZA 5IE8A 1IZ6A 2Y0SG 2YTYA 2KENA 3PUYA 2LXJA 2UUCL 1IBKL 1XNRQ 3TS2A 1TXYA 5GQOA 2A8VA 2N8NA 1K3RA 4A3JH 2R92H 2AWNA 4A3DG 3HKZG 4DAYB 1PH2A 1N34Q 2E5LQ 4KHPL 1A0IA 4BBRH 1TWCH 3CMAA 2UUAL 4A76A 2RHQB 4NB3A 4WJ4A 3VDYA 1V43A 1XPRA 3TQYA 1BBWA 1E22A 1LYLA 4DV3L 4A3BG 4C3IH 4X62L 2I5LX 5M3MG 5GAEC 3CCLA 1VQ5A 5ELOA 3E0EA 2R7ZH 2ZM6Q 1OXXK 3OW2A 3S15H 1HNZL 3ER0A 3GTLH 1N32L 2F3IA 1JT8A 3F8TA 4IJHA 1XNRL 2IT1A 3PF5A 3S2HH 2AHOB 4YHHQ 1TWHH 2R7DA 1A8VA 1EIYB 1YVCA 1HZCA 3CAMA 1N34L 1GO3E 3CCVA 4JI8Q 3RLOA 3T1YL 1JJ2A 2E5LL 4AIMA 2D62A 5IP9H 3F2CA 4Y7NH 2E2HH 3S2DH 3CC4A 1VQIA 4ME3A 1YJWA 4DV2Q 2K5VA 1Y1WG 4AYBE 1PH8A 4YCWA 4QY7A 4A3MH 4JI7L 2NZOA 1VQFA 5M5WH 5M3FG 1N33Q 5LMNW 4KI0A 3DLLA 2K4KA 2D0PA 1X3FA 2IX1A 3HOYH 3CCUA 1YHQA 1VQBA 3CW2C 3ZJYC 1NY4A 5LMUQ 2R93G 1Y14B 4UP9A 4BBSH 4IFDI 3FP9A 3GTQH 3J7A5 3BZKA 1YI2A 1KRTA 4LFBL 4HJ5A 4AQYQ 4QIWE 2IHEA 2OTLA 2MO1A 4HJAA 1XNQQ 2K50A 4DV2L 4JV5Q 4XIGS 3RLNA 4JI4Q 3OTOL 2YTXA 3KDFA 1YHAA 3HOUG 1HZAA 1Z47A 1UE7A 1VQHA 1Q1BA 5GAGC 2ZTDA 2I5HA 1L1OC 2KCMA 2XTIA 1XMQQ 1K9MC 2E2IH 2KCTA 5J3BA 3A5UA 4B3MQ 5IT9c 3UDFA 5IWAQ 4A3GG 4R4OA 5E7NA 4QGUA 5LMUL 1TWGH 4GNXA 4IO9A 3G4SA 1HNXL 2AMCB 1S72A 3HOVG 1GKHA 1EQQA 1Z9FA 5JEAG 4NXMQ 4GN5A 1XNQL 4LW1A 4A4IA 1JMCA 4JI4L 4OXPA 3RZDH 2K5HA 3I4MH 3M4OH 5IYDH 2Q2UA 4DV4L 1SR3A 4B3TQ 1J6QA 4JYAL 4OWXB 1VQ8A 2VNUD 3KJOA 1M90C 2ATWA 4TVAB 1HR0W 4A3DH 2PI2A 3W1BA 4A3FG 2Q2TA 3T1HL 1NMGA 4B3ML 4LF8L 2OQKA 4YCVA 1CSPA 4IPCA 3A5ZB 4BY1G 2EIFA 4PZ7A 4LF7Q 4IFDJ 1G291 1VCIA 1XPUA 1M1KC 3HOZG 1Q1EA 2QEXA 4DV7Q 4A3BH 1FGUA 2B63G 2A19A 5JJLA 3D0FA 5M3MH 4DR5Q 3CC2A 3G71A 4IOCA 2QA4A 1N36Q 1W2BA 3I4NG 4IPHA 1GD7A 3U4ZA 4DR7Q 3CC7A 3H15A 4DR4L 3ERSX 4B3RQ 2IX0A 1QZHA 4UY8C 4B3TL 4JOIC 1YJ9A 1SN8A 2L15A 3RR5A 1QUQA 3GDEA 3AFQA 2NVXH 1KHIA 2V1CC 1IBKQ 2PNHA 5JJIA 3G6EA 1HZ9A 1UE6A 4C3JH 1D7QA 2XGTA 4L5QA 3UDIA 1SMXA 3H0GH 3CMEA 4KHPQ 2Y0SE 2AWOA 2UUAQ 1Y1WH 3ULLA 3KF6B 1IBLQ 3H3VH 4TQUS 4A3EG 4DR5L 1Q12A 4HIDA 3AEVA 3PO2G 1N36L 4DR2Q 5M3FH 3BZCA 4DV5L 4DR6L 4X62Q 4B3RL 1X6OA 2YU9H 4JI0L 2Z0SA 3EIVA 4DR1L 1E24A 1UEBA 1HNZQ 2JA6G 2NN6G 1X65A 1KC8C 2R93H 4JCVE 4HIOA 3W5OA 3JAMi 5C44G 1YEZA 1C9OA 4GOPA 4EX5A 4PMWA 1VS0A 1CKOA 2ZJPA 1CKNA 1V9PA 3GD7A 1OXUA 3KFUA 1B8AA 3L7ZC 3T1YQ 3PF4A 3ULPA 1IYJB 1ASZA 2RCNA 3CPWA 3ULJA 5AJ3Q 1IBLL 3HOUH 4A3KH 2K75A 4DR2L 1EWIA 1JE5A 4X66Q 2MQHA 4GKJQ 4IPGA 4OWWB 1JJCB 4R1JA 5LMNL 4JI7Q 3M7NA 1YZ6A 2Q2IA 2YYZA 1KL9A 1SRUA 3HKSA 4R4CA 4A3GH 1I50H 2KHIA 4L5TA 3SGIA 3GTGH 4A3IG 2CWAA 3PO3G 4FDBA 4YWLA 3S1MH 3GTMH 1TWAH 2WAQG 3KLWA 4LWCA 2CWPA 1PH3A 1J5EL 4JI2L 2ZJQA 2CFMA 3S24A 1BKBA 4APVA 3J81j 1X9NA 3HOVH 3UDXA 3BU2A 3J7ZC 2N78A 4BXXG 4LFCQ 4IOAA 4OO1I 3CPFA 3OYYA 1PH7A 4A3CG 2H5XA 2E2JH 2PQAB 5AJ3L 4HJ9A 2IY5B 3K7AH 4OONA 3W1GA 1W3SA 2DUDA 3OTOQ 4UPAA 4X66L 4GKJL 2JA7G 3CF5A 2IHFA 3H3VI 3FHWA 3HOXG 4A3FH 4P74A 1HR0Q 1DGSA 1IXRA 4AH6A 5C0XI 2PMZE 1B7YB 1VQ7A 4BY1H 3UE0A 2BH8A 4QJFA 2BA1A 2JK8A 4X64L 1L1OB 1WCMG 4NXNQ 3JAMc 2B63H 4JI6Q 3G48A 4IFDG 4DUYQ 3AYHB 2K14A 3KJPA 2BH2A 4LFCL 3I4NH 4DKAC 4XTCS 1HNXQ 1PH5A 2YV5A 3CCQA 1VQKA 1YNXA 4EQ5A 4DR3L 1K8GA 2R7FA 4X6AH 4A93G 2WB1G 2ZJRA 3CCSA 1U5KA 1FL0A 3PIOA 3GTKH 1FVIA 1QVFA 3KF8B 4JBJA 4DV4Q 4LF4L 1G6PA 2VW9A 4JYAQ 4KLKA 2ZTCA 1HR0L 3TS0A 1UE1A 3S1RH 2JA9A 4DV1Q 4GKKL 1HH2P 2MO0A 3HOWG 4HIKA 1PH4A 3T1HQ 2JA5H 3S1QH 2VS1A 5FJ8G 4GN3B 2RF4A 2JQOA 4LUVA 3U4VA 3MEFA 3NBHB 1AE3A 4GN4B 4NXNL 3J81i 2UXDL 1X54A 4A3EH 4JI6L 4DUYL 3PO2H 3S1NH 1YHBA 4OX9L 2DGYA 2VQFL 1HZBA 2VQEL 3S14H 1YJNA 2PI2E 2D0OA 4GNXC 5BR8L 3CCJA 2JA6H 4DR4Q 2JA8G 5FLXc 4X65L 4Y52H 4BA1I 1SE8A 5C44H 1PHJA 2ALYB 3K81C 4LNQA 2LSSA 1RIPA 4DV1L 2YTVA 1OXTA 2R7ZG 4PG3A 3UE1A 4LF6Q 5JJKA 1E7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 L;  2KHJ A;  3GTJ H;  2VZA A;  3K0X A;  1NMF A;  1OTC A;  5IYC G;  1YIJ A;  4A3L G;  4B3S Q;  1HNW L;  3A74 A;  1PH9 A;  4P73 A;  4MNO A;  1UWV A;  2VUM G;  3RNU A;  2HT1 A;  5IP9 G;  4DV5 Q;  4DR6 Q;  3PO3 H;  2Z6K A;  3I56 A;  4A3I H;  1X3E A;  4KHZ A;  4JI0 Q;  4DR1 Q;  5C0X J;  1RL2 A;  1QVC A;  4UP8 A;  3FKI G;  2K5N A;  4OWT B;  2EQS A;  4YY3 Q;  2I0Q A;  4JI1 L;  1I3Q H;  1PV4 A;  4BXX H;  4LF6 L;  2Q2H A;  1PA6 A;  3NEL A;  1NTG A;  1Y1V G;  4A3C H;  3GTP H;  1EOV A;  5GAH C;  1VQG A;  4JC0 A;  5H1S E;  1VQN A;  1H95 A;  3J81 c;  3Q8D A;  4K0K Q;  3J80 i;  2OWO A;  2UUB L;  4B3S L;  3M3Y H;  2JA7 H;  4JBK A;  1E1T A;  1P8L A;  3HOX H;  1WYD A;  1KAW A;  1MKH A;  1NBW A;  4DV0 Q;  4R4T A;  3I7F A;  5DLQ E;  4JBW A;  1A63 A;  2JEB I;  1MJE A;  5LMN Q;  5C4X G;  5IP7 G;  1G51 A;  5K36 G;  1K8A C;  1OXV A;  3I55 A;  1LUZ A;  3DM3 A;  1MIU A;  1AH9 A;  1WCM H;  1EYG A;  2C35 B;  4YY3 L;  4PZ6 A;  1YBY A;  4YWK A;  5FLM G;  1PVO A;  1J5E Q;  1XMO L;  2NVY H;  3JC6 6;  4JI2 Q;  2NVQ H;  4JI5 L;  1GM5 A;  4GOP C;  4A93 H;  4K0K L;  2UU9 Q;  4HIM A;  1GVP A;  1VQA A;  1T9H A;  2I5M X;  2WAQ E;  4LUO A;  4DNI A;  1PH1 A;  1MJC A;  2F4V Q;  2UXC Q;  1Q82 C;  4H02 A;  3BJU A;  4BY7 G;  4DV0 L;  1JJG A;  3HFZ B;  4O0A A;  4DK6 C;  4GLX A;  2OTJ A;  3CCM A;  3HOW H;  1BBU A;  1XTD A;  2LXK A;  2OQ0 A;  4P71 A;  1L0W A;  3CXC A;  5FJ8 H;  1VQO A;  1FJG L;  1O7I A;  1Q8K A;  5IYD G;  1VQJ A;  2GN5 A;  3B6Y A;  2N49 A;  3KYH C;  2QGQ A;  3KF6 A;  4X64 Q;  1A62 A;  1PH6 A;  1PYS B;  2HIX A;  4LUZ A;  5GRO A;  5GAD C;  1Q7Y C;  1EUJ A;  4HJ8 A;  2B3G A;  4C3H H;  2JA8 H;  1K83 H;  4QL5 A;  4DR3 Q;  1VQ9 A;  2UU9 L;  3ICE A;  2F4V L;  1X3G A;  5C3E G;  3J80 c;  1R9T H;  3KOJ A;  1VQP A;  2UXC L;  2JEA I;  2VY3 A;  1KRS A;  2HQL A;  1D8L A;  4YCU A;  1VQM A;  4JI3 L;  3GO5 A;  1YIT A;  3M9B A;  1ASY A;  4LF4 Q;  2E8G A;  2N3S A;  1KD1 C;  3CP0 A;  4BA2 I;  2ASB A;  1HJP A;  4POF A;  1U0L A;  2WB1 E;  4GKK Q;  1SFO H;  3K8A A;  4MTN A;  3HOZ H;  4LF5 Q;  3KDF B;  2HHH Q;  3EN2 A;  5IYC H;  4A3L H;  2UXD Q;  4OO1 G;  2VUM H;  5IYB G;  2MNA A;  4DK3 C;  1I94 Q;  4OX9 Q;  3PUX A;  2VQF Q;  1VQ4 A;  3F1Z A;  2CKZ B;  2VQE Q;  1Q46 A;  2KBN A;  2RHS B;  3U50 C;  2GVB A;  3EBE A;  3H0G G;  3NEN A;  5BR8 Q;  5EAY A;  3M4Q A;  3FKI H;  3PIP A;  4X65 Q;  1XJV A;  4GNX B;  1CUK A;  2UXB Q;  1IBM Q;  3GTO H;  4WJ3 M;  2ZM6 L;  1C7Y A;  1VQL A;  5C0X G;  1K0R A;  1Y1V H;  4R4Q A;  5ELN A;  3AQQ A;  3S17 H;  4LFB Q;  1S3O A;  3M85 A;  2OCE A;  2PQA A;  1LTL A;  4GLV B;  4GS3 A;  2HHH L;  4LF5 L;  4YHH L;  4LF9 Q;  1BVS A;  3K80 C;  4R4I A;  4DPG A;  4LFA Q;  3CCE A;  4JBM A;  4AYB G;  3I4O A;  1I94 L;  4JI8 L;  1HNW Q;  1VQ6 A;  3RZO H;  5HGQ A;  4A3J G;  2R92 G;  1N9W A;  3AFP A;  1QZG A;  5C4X H;  4O2D A;  5IP7 H;  4A75 A;  3TRZ A;  4BBR G;  3K7U C;  2HIV A;  3E9I A;  1E3P A;  3S16 H;  1AE2 A;  1CSQ A;  1L1O A;  3LGJ A;  4A3K G;  2UXB L;  1IBM L;  2CCZ A;  5FLM H;  1LM0 A;  3E9H A;  3U58 A;  2JJQ A;  4DUZ Q;  1N33 L;  3D31 A;  4L5R C;  1B70 B;  3STB C;  4JI1 Q;  3CD6 A;  3PUZ A;  1EFW A;  4LF8 Q;  2CQO A;  1X55 A;  4J15 A;  1S40 A;  1Q86 C;  2ES2 A;  1I6H H;  4DAM A;  4LFA L;  2R6G A;  1NJI C;  1QUQ B;  2BA0 A;  4YWM A;  1NE3 A;  2UUB Q;  4BY7 H;  3M4P A;  1I5F A;  4RG1 A;  2MFI A;  4JG2 A;  1X56 A;  2ID0 A;  5IY0 A;  4AQY L;  3L2P A;  3UDG A;  1JB7 A;  3F2D A;  1EIF A;  1OXS C;  1P16 A;  4MZ9 A;  4QQB X;  4JV5 L;  3TRE A;  3RN5 A;  5C4J H;  2EXD A;  1KXL A;  2FXQ A;  2ZTE A;  5M5X H;  1IL2 A;  4DUZ L;  4L5S A;  2Z6K C;  1XMQ L;  1XPO A;  2JE6 I;  1UE5 A;  5HY6 A;  1WJJ A;  3CCR A;  4A3M G;  1L2F A;  4RMF A;  1WI5 A;  4POG A;  2K52 A;  2WFW A;  3WWV A;  5IWA L;  1SLJ A;  1PFS A;  1XMO Q;  5M5Y H;  3F2B A;  1Q81 C;  4JI5 Q;  3HOY G;  1C0A A;  3IRB A;  5C3E H;  2NVT H;  2F52 A;  4ALP A;  1KIX A;  1TWF H;  3RN2 A;  1CKM A;  4GOP B;  1PYB A;  4BBS G;  1V1Q A;  4DV6 Q;  4PZ8 A;  4NXM L;  1E1O A;  3MXN B;  3A0J A;  2B29 A;  4JOI A;  1CKN B;  3PUV A;  4P75 A;  3PSI A;  4C2M H;  1K73 C;  3RLF A;  1VQC A;  3L0O A;  1FJG Q;  3NEM A;  2NN6 I;  2VL6 A;  4NPS A;  4P72 A;  5IYB H;  2WP8 J;  4UP7 A;  2GVA A;  2UUC Q;  1VQE A;  3PCO B;  4LF7 L;  2JA5 G;  4GLA C;  2A1A A;  2NZH A;  4DV7 L;  3I2Z A;  1VQD A;  3STB D;  3PV0 A;  1SRO A;  3CQZ H;  5JEA J;  3TEH B;  4IJL A;  4DV6 L;  1WOC A;  3HKZ E;  1WFQ A;  4IPD A;  4DV3 Q;  1QVG A;  4DR7 L;  4JI3 Q;  1EQR A;  3PUW A;  4HJ7 A;  2AKW B;  1N8R C;  1KQS A;  3I4M G;  1N32 Q;  3PGZ A;  5IE8 A;  1IZ6 A;  2Y0S G;  2YTY A;  2KEN A;  3PUY A;  2LXJ A;  2UUC L;  1IBK L;  1XNR Q;  3TS2 A;  1TXY A;  5GQO A;  2A8V A;  2N8N A;  1K3R A;  4A3J H;  2R92 H;  2AWN A;  4A3D G;  3HKZ G;  4DAY B;  1PH2 A;  1N34 Q;  2E5L Q;  4KHP L;  1A0I A;  4BBR H;  1TWC H;  3CMA A;  2UUA L;  4A76 A;  2RHQ B;  4NB3 A;  4WJ4 A;  3VDY A;  1V43 A;  1XPR A;  3TQY A;  1BBW A;  1E22 A;  1LYL A;  4DV3 L;  4A3B G;  4C3I H;  4X62 L;  2I5L X;  5M3M G;  5GAE C;  3CCL A;  1VQ5 A;  5ELO A;  3E0E A;  2R7Z H;  2ZM6 Q;  1OXX K;  3OW2 A;  3S15 H;  1HNZ L;  3ER0 A;  3GTL H;  1N32 L;  2F3I A;  1JT8 A;  3F8T A;  4IJH A;  1XNR L;  2IT1 A;  3PF5 A;  3S2H H;  2AHO B;  4YHH Q;  1TWH H;  2R7D A;  1A8V A;  1EIY B;  1YVC A;  1HZC A;  3CAM A;  1N34 L;  1GO3 E;  3CCV A;  4JI8 Q;  3RLO A;  3T1Y L;  1JJ2 A;  2E5L L;  4AIM A;  2D62 A;  5IP9 H;  3F2C A;  4Y7N H;  2E2H H;  3S2D H;  3CC4 A;  1VQI A;  4ME3 A;  1YJW A;  4DV2 Q;  2K5V A;  1Y1W G;  4AYB E;  1PH8 A;  4YCW A;  4QY7 A;  4A3M H;  4JI7 L;  2NZO A;  1VQF A;  5M5W H;  5M3F G;  1N33 Q;  5LMN W;  4KI0 A;  3DLL A;  2K4K A;  2D0P A;  1X3F A;  2IX1 A;  3HOY H;  3CCU A;  1YHQ A;  1VQB A;  3CW2 C;  3ZJY C;  1NY4 A;  5LMU Q;  2R93 G;  1Y14 B;  4UP9 A;  4BBS H;  4IFD I;  3FP9 A;  3GTQ H;  3J7A 5;  3BZK A;  1YI2 A;  1KRT A;  4LFB L;  4HJ5 A;  4AQY Q;  4QIW E;  2IHE A;  2OTL A;  2MO1 A;  4HJA A;  1XNQ Q;  2K50 A;  4DV2 L;  4JV5 Q;  4XIG S;  3RLN A;  4JI4 Q;  3OTO L;  2YTX A;  3KDF A;  1YHA A;  3HOU G;  1HZA A;  1Z47 A;  1UE7 A;  1VQH A;  1Q1B A;  5GAG C;  2ZTD A;  2I5H A;  1L1O C;  2KCM A;  2XTI A;  1XMQ Q;  1K9M C;  2E2I H;  2KCT A;  5J3B A;  3A5U A;  4B3M Q;  5IT9 c;  3UDF A;  5IWA Q;  4A3G G;  4R4O A;  5E7N A;  4QGU A;  5LMU L;  1TWG H;  4GNX A;  4IO9 A;  3G4S A;  1HNX L;  2AMC B;  1S72 A;  3HOV G;  1GKH A;  1EQQ A;  1Z9F A;  5JEA G;  4NXM Q;  4GN5 A;  1XNQ L;  4LW1 A;  4A4I A;  1JMC A;  4JI4 L;  4OXP A;  3RZD H;  2K5H A;  3I4M H;  3M4O H;  5IYD H;  2Q2U A;  4DV4 L;  1SR3 A;  4B3T Q;  1J6Q A;  4JYA L;  4OWX B;  1VQ8 A;  2VNU D;  3KJO A;  1M90 C;  2ATW A;  4TVA B;  1HR0 W;  4A3D H;  2PI2 A;  3W1B A;  4A3F G;  2Q2T A;  3T1H L;  1NMG A;  4B3M L;  4LF8 L;  2OQK A;  4YCV A;  1CSP A;  4IPC A;  3A5Z B;  4BY1 G;  2EIF A;  4PZ7 A;  4LF7 Q;  4IFD J;  1G29 1;  1VCI A;  1XPU A;  1M1K C;  3HOZ G;  1Q1E A;  2QEX A;  4DV7 Q;  4A3B H;  1FGU A;  2B63 G;  2A19 A;  5JJL A;  3D0F A;  5M3M H;  4DR5 Q;  3CC2 A;  3G71 A;  4IOC A;  2QA4 A;  1N36 Q;  1W2B A;  3I4N G;  4IPH A;  1GD7 A;  3U4Z A;  4DR7 Q;  3CC7 A;  3H15 A;  4DR4 L;  3ERS X;  4B3R Q;  2IX0 A;  1QZH A;  4UY8 C;  4B3T L;  4JOI C;  1YJ9 A;  1SN8 A;  2L15 A;  3RR5 A;  1QUQ A;  3GDE A;  3AFQ A;  2NVX H;  1KHI A;  2V1C C;  1IBK Q;  2PNH A;  5JJI A;  3G6E A;  1HZ9 A;  1UE6 A;  4C3J H;  1D7Q A;  2XGT A;  4L5Q A;  3UDI A;  1SMX A;  3H0G H;  3CME A;  4KHP Q;  2Y0S E;  2AWO A;  2UUA Q;  1Y1W H;  3ULL A;  3KF6 B;  1IBL Q;  3H3V H;  4TQU S;  4A3E G;  4DR5 L;  1Q12 A;  4HID A;  3AEV A;  3PO2 G;  1N36 L;  4DR2 Q;  5M3F H;  3BZC A;  4DV5 L;  4DR6 L;  4X62 Q;  4B3R L;  1X6O A;  2YU9 H;  4JI0 L;  2Z0S A;  3EIV A;  4DR1 L;  1E24 A;  1UEB A;  1HNZ Q;  2JA6 G;  2NN6 G;  1X65 A;  1KC8 C;  2R93 H;  4JCV E;  4HIO A;  3W5O A;  3JAM i;  5C44 G;  1YEZ A;  1C9O A;  4GOP A;  4EX5 A;  4PMW A;  1VS0 A;  1CKO A;  2ZJP A;  1CKN A;  1V9P A;  3GD7 A;  1OXU A;  3KFU A;  1B8A A;  3L7Z C;  3T1Y Q;  3PF4 A;  3ULP A;  1IYJ B;  1ASZ A;  2RCN A;  3CPW A;  3ULJ A;  5AJ3 Q;  1IBL L;  3HOU H;  4A3K H;  2K75 A;  4DR2 L;  1EWI A;  1JE5 A;  4X66 Q;  2MQH A;  4GKJ Q;  4IPG A;  4OWW B;  1JJC B;  4R1J A;  5LMN L;  4JI7 Q;  3M7N A;  1YZ6 A;  2Q2I A;  2YYZ A;  1KL9 A;  1SRU A;  3HKS A;  4R4C A;  4A3G H;  1I50 H;  2KHI A;  4L5T A;  3SGI A;  3GTG H;  4A3I G;  2CWA A;  3PO3 G;  4FDB A;  4YWL A;  3S1M H;  3GTM H;  1TWA H;  2WAQ G;  3KLW A;  4LWC A;  2CWP A;  1PH3 A;  1J5E L;  4JI2 L;  2ZJQ A;  2CFM A;  3S24 A;  1BKB A;  4APV A;  3J81 j;  1X9N A;  3HOV H;  3UDX A;  3BU2 A;  3J7Z C;  2N78 A;  4BXX G;  4LFC Q;  4IOA A;  4OO1 I;  3CPF A;  3OYY A;  1PH7 A;  4A3C G;  2H5X A;  2E2J H;  2PQA B;  5AJ3 L;  4HJ9 A;  2IY5 B;  3K7A H;  4OON A;  3W1G A;  1W3S A;  2DUD A;  3OTO Q;  4UPA A;  4X66 L;  4GKJ L;  2JA7 G;  3CF5 A;  2IHF A;  3H3V I;  3FHW A;  3HOX G;  4A3F H;  4P74 A;  1HR0 Q;  1DGS A;  1IXR A;  4AH6 A;  5C0X I;  2PMZ E;  1B7Y B;  1VQ7 A;  4BY1 H;  3UE0 A;  2BH8 A;  4QJF A;  2BA1 A;  2JK8 A;  4X64 L;  1L1O B;  1WCM G;  4NXN Q;  3JAM c;  2B63 H;  4JI6 Q;  3G48 A;  4IFD G;  4DUY Q;  3AYH B;  2K14 A;  3KJP A;  2BH2 A;  4LFC L;  3I4N H;  4DKA C;  4XTC S;  1HNX Q;  1PH5 A;  2YV5 A;  3CCQ A;  1VQK A;  1YNX A;  4EQ5 A;  4DR3 L;  1K8G A;  2R7F A;  4X6A H;  4A93 G;  2WB1 G;  2ZJR A;  3CCS A;  1U5K A;  1FL0 A;  3PIO A;  3GTK H;  1FVI A;  1QVF A;  3KF8 B;  4JBJ A;  4DV4 Q;  4LF4 L;  1G6P A;  2VW9 A;  4JYA Q;  4KLK A;  2ZTC A;  1HR0 L;  3TS0 A;  1UE1 A;  3S1R H;  2JA9 A;  4DV1 Q;  4GKK L;  1HH2 P;  2MO0 A;  3HOW G;  4HIK A;  1PH4 A;  3T1H Q;  2JA5 H;  3S1Q H;  2VS1 A;  5FJ8 G;  4GN3 B;  2RF4 A;  2JQO A;  4LUV A;  3U4V A;  3MEF A;  3NBH B;  1AE3 A;  4GN4 B;  4NXN L;  3J81 i;  2UXD L;  1X54 A;  4A3E H;  4JI6 L;  4DUY L;  3PO2 H;  3S1N H;  1YHB A;  4OX9 L;  2DGY A;  2VQF L;  1HZB A;  2VQE L;  3S14 H;  1YJN A;  2PI2 E;  2D0O A;  4GNX C;  5BR8 L;  3CCJ A;  2JA6 H;  4DR4 Q;  2JA8 G;  5FLX c;  4X65 L;  4Y52 H;  4BA1 I;  1SE8 A;  5C44 H;  1PHJ A;  2ALY B;  3K81 C;  4LNQ A;  2LSS A;  1RIP A;  4DV1 L;  2YTV A;  1OXT A;  2R7Z G;  4PG3 A;  3UE1 A;  4LF6 Q;  5JJK A;  1E7Z A; 
#chains in the Genus database with same CATH topology
 1E2Z A;  2EPB A;  4LF9 L;  4CBV A;  2VZA A;  4HED A;  1YIJ A;  1HNW L;  2E2I B;  1XXG A;  4UDU C;  4MNO A;  2JA5 B;  3RNU A;  4DR6 Q;  1DZ1 A;  4A3E B;  4A3I H;  4DR1 Q;  2RDH A;  1RL2 A;  3FKI G;  2I0Q A;  2F0F A;  1PLF A;  5LL6 S;  4JI1 L;  5CR3 A;  1Y8P B;  3VYS A;  2PO4 A;  3M4O B;  2E2D C;  5C44 B;  5H1S E;  1H95 A;  3J81 c;  3Q8D A;  2L11 A;  4B3S L;  4XXE A;  3MEH A;  3HOX H;  2F0U A;  1KAW A;  2B2Y A;  4DV0 Q;  2IWH A;  3I7F A;  1WTW A;  4JBW A;  2Q8R E;  5IP7 G;  1G51 A;  4A3B B;  3N6R A;  1LTB D;  4K6D A;  1LUZ A;  2KCC A;  2C35 B;  1YBY A;  1G91 A;  2I07 B;  3JC6 6;  4JI2 Q;  4JI5 L;  3NTK A;  4K0K L;  2NVX B;  1I3Q B;  1GVP A;  2WAQ E;  4HIM A;  1TY2 A;  2UXC Q;  4BY7 G;  4GLX A;  4NW2 A;  3J80 L;  1DOK A;  3C46 A;  5KRU A;  1FJG L;  1O7I A;  4R9W A;  2JA7 B;  5CV8 A;  2H1E A;  2GN5 A;  4DXG A;  3KYH C;  5M3F B;  2F0W A;  1F9Q A;  2M00 A;  2HIX A;  1M8A A;  5GRO A;  1ILP A;  3BDO A;  1EWH A;  1HA5 A;  2JA8 H;  1K83 H;  3ICE A;  2UU9 L;  3P7J A;  4CJ1 B;  5C3X A;  2JEA I;  1B9N A;  3GO5 A;  3QG1 A;  5D14 A;  4WOR A;  3MHB A;  4BA2 I;  2ASB A;  5CMD A;  1WTQ A;  4POF A;  4G7H C;  2WB1 E;  4GKK Q;  3OOC A;  3HOZ H;  3KDF B;  2D2C C;  2BOS A;  2HHH Q;  2IX3 A;  4L63 B;  1PYW D;  5IYB G;  2VQF Q;  1SJE D;  2VQE Q;  1X32 A;  4NKL A;  4NP5 A;  3H0G G;  5K5P A;  3M4Q A;  3FKI H;  4GNX B;  2UXB Q;  1IBM Q;  2ZM6 L;  2F3W A;  4RCO A;  4C3H B;  1JWS D;  1YNN C;  3EVQ A;  3AQQ A;  3S17 H;  1SNQ A;  1AZP A;  3OHX C;  2K7V A;  4GLV B;  1STN A;  4LF9 Q;  1T5E A;  4DPG A;  3CCE A;  3K57 A;  2KA7 A;  1HNW Q;  5HGQ A;  4CDF C;  4A75 A;  5IP7 H;  3TRZ A;  2K6A A;  2HIV A;  4B9X A;  3PIO 3;  3NE5 B;  4XT3 B;  1F77 A;  1JWU D;  3AMU A;  1LM0 A;  3U58 A;  1N33 L;  2JJQ A;  4DUZ Q;  3D31 A;  4L5R C;  1F2M A;  1B70 B;  4JI1 Q;  3A8I E;  3I8Z A;  3PUZ A;  1NNX A;  2NTS A;  1LAB A;  1QUQ B;  3S1R B;  4K8J A;  4BY7 H;  4MTK A;  2N88 A;  4H44 C;  3S1Q B;  1PZI D;  4RHR A;  1P16 A;  1SNC A;  1JIC A;  2ZTE A;  1IL2 A;  1JWM D;  2AUK A;  3Q23 A;  3C3L A;  3HEJ A;  4X3K A;  1DD2 A;  3S16 B;  1WI5 A;  4POG A;  3WWV A;  4JI5 Q;  1O7Y A;  2PW5 A;  2NVT H;  2F52 A;  1KIX A;  1BCP F;  1MI2 A;  5EJW A;  1FYC A;  1K8M A;  3MXN B;  5JVG 3;  4CKB A;  1SNM A;  3PUV A;  2NYZ D;  4P75 A;  3PSI A;  4C2M H;  1K73 C;  2DY8 A;  1AZQ A;  2B2Y C;  1FJG Q;  1EL0 A;  1LTT D;  2KEE A;  4NPS A;  5IYB H;  2GVA A;  1VQE A;  1KNE A;  3U9S A;  3I2Z A;  3DWQ A;  3A8K E;  3DWA A;  1SRO A;  3MXP A;  3RD4 A;  4DV6 L;  2FMC A;  4DR7 L;  1UEA B;  1ESF A;  5C3E B;  1IW7 C;  4HJ7 A;  1EIH A;  1N8R C;  3I4M G;  2QCP X;  5KIX A;  1IZ6 A;  2K05 A;  1B1Z A;  4KN4 C;  1IBK L;  3TS2 A;  3W3A A;  5GQO A;  3DHQ A;  1K3R A;  4ZLT F;  1V1O A;  2E5L Q;  1A0I A;  1LTS D;  4A76 A;  2RHQ B;  4WJ4 A;  5D3D A;  1V43 A;  1XPR A;  1CI3 M;  2L55 A;  3TQY A;  4DV3 L;  4C3I H;  4X62 L;  2I5L X;  1QOH A;  4RHS A;  4A93 B;  2R7Z H;  2ZM6 Q;  3S15 H;  3ER0 A;  1N32 L;  1HFN A;  3K5M A;  3F8T A;  1O7Z A;  2QDL A;  3C2P A;  4V19 0;  1XNR L;  3S2H H;  2F0I A;  1EIY B;  1YVC A;  1HZC A;  4ME5 A;  4N9P A;  1E2V A;  3OMC A;  4AIM A;  2D62 A;  1EQV A;  3HGB A;  4C3J G;  1VQI A;  1ET9 A;  4AYB B;  1YJW A;  4AYB E;  2PPB C;  3H3V C;  4YCW A;  3NPP A;  1D5X C;  4QY7 A;  1VQF A;  1N33 Q;  5LMN W;  1SND A;  5G3L F;  3DLL A;  3GP7 A;  1V1P A;  1UUP A;  4IUR A;  1IW7 D;  1NY4 A;  5LMU Q;  1NSN S;  2ZXR A;  2OTL A;  2O4X A;  1TQO A;  3DEO A;  4F7X A;  1TWH B;  2SDF A;  2E76 C;  2EYL A;  1HZA A;  3LX0 A;  4UHV A;  2XTI A;  5FO8 B;  1B4O A;  4A3M B;  5M5W B;  1VF5 C;  1TS3 A;  1SBB B;  2AMC B;  3MZ5 A;  1GKH A;  1Z9F A;  1XNQ L;  4DGZ A;  4JI4 L;  2K5D A;  2K5H A;  3I4M H;  4B3T Q;  1STE A;  1VQ8 A;  1HHV A;  4FP5 D;  2C5C A;  1M90 C;  2ATW A;  1HR0 W;  4A3F G;  4B9W A;  2OQK A;  1SYE A;  1ONL A;  4IPC A;  2DNE A;  2K5Q A;  2EIF A;  2V4D A;  1XPU A;  1PRT C;  2HCC A;  2BDN A;  3D0F A;  5A2Q L;  5EKI A;  3NSW A;  3TSS A;  4IPH A;  4DR7 Q;  3U4Z A;  2L4N A;  3ERS X;  4EQO A;  4EVO A;  5IGC A;  3D6C A;  1SN8 A;  4I7A A;  1B50 A;  2PNR C;  2F0L A;  4JPB W;  1U4P A;  1QCB D;  3GDE A;  1IBK Q;  2PNH A;  5C4J B;  4C3J H;  5M5X B;  4L5Q A;  5CBA E;  3ULL A;  1HTP A;  1Q12 A;  4HID A;  3GV3 A;  5D3I B;  5C0X H;  2XWJ B;  4DV5 L;  4X62 Q;  3VYU A;  4B3R L;  5NUC A;  3VR6 A;  4JI0 L;  2Z0S A;  2GA4 B;  3EIV A;  1WD0 A;  2NN6 G;  4FXK C;  5M3M B;  1CM9 A;  3W5O A;  4FNF A;  1F9P A;  1JOR A;  1CKN A;  1OXU A;  2K5W A;  3A56 A;  2MPM A;  1HFG A;  3A7A B;  4F8M A;  3H94 A;  1JE5 A;  4DF7 A;  1LT5 D;  1TS2 A;  5LMN L;  1YZ6 A;  1SRU A;  1I50 H;  2KHI A;  5CV7 A;  3GTG H;  1LTR D;  4YWL A;  3V2T A;  1Q3L A;  5IGD A;  3S1M H;  2CVR A;  2NWG A;  4LWC A;  2CWP A;  3ITP A;  3TP6 A;  4KD4 A;  2YU9 B;  2ZJQ A;  1BKB A;  4BXX G;  4OO1 I;  1PTO H;  2N78 A;  3KLS A;  4LFC Q;  3OYY A;  1G8Z D;  1PH7 A;  5JPN C;  1ESR A;  4JW0 A;  4LK1 C;  4CHT B;  5JPM C;  1ICF B;  1WTO A;  3CF5 A;  2IHF A;  3H3V I;  3FHW A;  4A3F H;  1SNP A;  2G9D A;  4L6T B;  1IXR A;  4DAY A;  1B7Y B;  1CTM A;  3UE0 A;  4A3K B;  2BH8 A;  3N52 A;  4KD3 A;  1JB3 A;  3JAM c;  4HMJ A;  4DK1 A;  4JI6 Q;  1VF7 A;  2BH2 A;  4DKA C;  2MJ8 A;  5BN3 A;  1VQK A;  3BDC A;  2R7F A;  3GTM B;  1TWA B;  3GTK H;  4JBJ A;  2EXZ A;  3HOV B;  1RD9 D;  4LF4 L;  2VW9 A;  4KLK A;  4R8I A;  1EYD A;  2E2H B;  1HR0 L;  2EY1 A;  2JA9 A;  1HH2 P;  3ND9 A;  2VS1 A;  4GN3 B;  3D4D A;  3MEF A;  4X3U A;  4GN4 B;  2JP1 A;  2UXD L;  3TZD A;  1KAB A;  4OX9 L;  4FF3 A;  3HOY B;  3S14 H;  1PRT B;  2PI2 E;  2NN6 H;  4BBS B;  4Y52 H;  3GTQ B;  4M8A A;  1SE8 A;  2LSS A;  4G57 A;  2Z1C A;  2YTV A;  1OXT A;  2RCF A;  3MC0 B;  1Z7T A;  1ZYR C;  1OTC A;  4A3L G;  1I6V C;  1Y8N B;  1PH9 A;  4ZRZ A;  1UWV A;  1ET6 A;  5FLX E;  4CDE C;  1TT2 A;  5IP9 G;  4DV5 Q;  1SYB A;  1B3A A;  2Z6K A;  1F2Y A;  3PO2 B;  4JI0 Q;  1QVC A;  1S5B D;  1XTC D;  2ENB A;  4OWT B;  5I9P A;  3NK9 A;  1PV4 A;  4BXX H;  4LF6 L;  1NTG A;  1Y1V G;  3GTP H;  2Y0S B;  5GAH C;  2BCO A;  4KY5 A;  1KTK A;  1VQG A;  1YNJ C;  3J80 i;  3H91 A;  4QCL A;  4K5V A;  3NHH A;  1P8L A;  2SNS A;  3V96 A;  1GUG A;  2OXP A;  4IAL A;  2BDO A;  1A63 A;  2JEB I;  1MJE A;  5LMN Q;  1K8A C;  1OXV A;  2BE5 C;  3DM3 A;  2XVS A;  3VR3 A;  5D65 A;  5FLM G;  3VR2 A;  4A3I B;  5JVH 3;  2NB0 A;  4U68 A;  1G2S A;  1T9H A;  5J22 A;  4DNI A;  4H02 A;  1JJG A;  4KHV A;  4DV0 L;  1SE3 A;  5E3F A;  2OTJ A;  3CCM A;  2OF1 A;  2ZXO A;  2LXK A;  2OQ0 A;  4P71 A;  3CXC A;  1VQO A;  5IYD G;  2E75 C;  3KF6 A;  3E5S A;  1C48 A;  2VXW A;  3K59 A;  1PYS B;  1C4Q A;  1HUN A;  3TZU A;  5GAD C;  1RCV D;  4HJ8 A;  2B3G A;  2R93 B;  4QL5 A;  2TMP A;  3VR4 A;  1O7L A;  3T16 A;  2UXC L;  1KRS A;  2HQL A;  3DWP A;  2MUY A;  3SK4 A;  3M9B A;  4LF4 Q;  2N3S A;  1YNJ D;  3E0J A;  1HJP A;  3I90 A;  1U0L A;  2J4X A;  1A2U A;  1SFO H;  4A3L H;  2UXD Q;  3SXH A;  2BE5 D;  4DK3 C;  4OX9 Q;  1VQ4 A;  1Q46 A;  2KBN A;  3U50 C;  3U9O A;  1A3U A;  4K6L A;  3GTO H;  5EQ0 A;  3DM1 A;  4WJ3 M;  2JA8 B;  4GZY C;  2PZW A;  1SYG A;  1UNS A;  1Y1V H;  2E2J B;  5ELN A;  3K7A B;  2EDG A;  2TSS A;  5EPL A;  2PQA A;  1LTL A;  1EEI D;  2HHH L;  2J0T D;  1WTV A;  2PZT A;  3K80 C;  1WD1 A;  4LFA Q;  2AQ3 B;  3NQI A;  1STH A;  4JI8 L;  2XRQ D;  2F03 A;  4A3J G;  1STG A;  2R92 G;  3AFP A;  1QZG A;  3HOZ B;  4O2D A;  4BBR G;  2L1B A;  2HQE A;  3E9I A;  4OL7 A;  2B63 B;  2OEO A;  5J1Z A;  1GUO A;  3IFD A;  4NDX A;  2UXB L;  1IBM L;  5FLM H;  2A69 D;  3M4Y A;  1I4G A;  2M9V A;  2WV6 D;  1A2T A;  1AFP A;  3FKI B;  2CQO A;  4J15 A;  1I6H H;  4DAM A;  4OEL B;  2R6G A;  4KK7 A;  4YWM A;  3HZX A;  4C1N K;  3S17 B;  4J6H A;  5IY0 A;  1GUS A;  1X56 A;  4AQY L;  3K5O A;  1JB7 A;  4QQB X;  2VB3 X;  4DK0 A;  3RN5 A;  1KXL A;  2EXD A;  2FXQ A;  1C8C A;  1EY9 A;  4DUZ L;  2Z6K C;  2F0V A;  1UE5 A;  5HY6 A;  2EZV A;  1WJJ A;  3CCR A;  2JA6 B;  4FF4 A;  2K52 A;  5IWA L;  1SLJ A;  1PFS A;  3SR1 A;  4I7Z C;  2EE1 A;  3IRB A;  2QKI C;  4HN7 A;  5T1I A;  1IKL A;  1V1Q A;  1E1O A;  2B29 A;  1CKN B;  1K3B C;  4J1M A;  3GTJ B;  3L0O A;  5C4Z A;  3NEM A;  2X6L A;  5IIF A;  4V0B A;  4CJ2 C;  3KBX A;  4H0L C;  2JA5 G;  3FVQ A;  3OIP A;  2NZH A;  2WAQ B;  1RKN A;  5EKL A;  2JYO A;  5EKK A;  3CQZ H;  5CV5 A;  3HKZ E;  3MVV A;  2NVT B;  3NP8 A;  2AKW B;  3BS1 A;  2KEN A;  1B3Q A;  3QOL A;  5CV6 A;  3QWN A;  1IL8 A;  1TXY A;  1JC7 A;  4C2M B;  2A8V A;  2DY7 A;  4A3J H;  2R92 H;  2AWN A;  2QF7 A;  3HKZ G;  4DAY B;  4A3D G;  1O78 A;  3MWY W;  4BBR H;  2UUA L;  3MFY A;  3ZYY X;  3SK5 A;  4A3B G;  1E22 A;  1LYL A;  2K03 A;  4X3S A;  3CCL A;  2O2L D;  3SE0 A;  1W6K A;  2WB1 B;  2NBF A;  3E0E A;  5ELO A;  1OXX K;  5KEE A;  5I9O A;  1HNZ L;  3GTL H;  2XRS D;  2B2V A;  4IJH A;  1QB5 D;  2IT1 A;  3PF5 A;  2AHO B;  1FNU A;  4IFD I;  4ZK9 B;  5FO7 B;  1EY5 A;  4JI8 Q;  3RLO A;  2E5L L;  2JN4 A;  4Y7N H;  1EU3 A;  3CC4 A;  4TSS A;  1PH8 A;  5M3F G;  4M1U B;  2K4K A;  1U4R A;  1X3F A;  2EY6 A;  1F9R A;  3VYR A;  1MSH A;  4HTH A;  4C3I B;  1STA A;  3CW2 C;  4QF4 A;  4ILW A;  2R7Z B;  3S15 B;  5IT9 L;  1BOS A;  1LT4 D;  2MP1 A;  3BZK A;  3IKJ A;  4QIW E;  3J7Y W;  4AQY Q;  2K50 A;  3RLN A;  2B8F A;  3OTO L;  1KLG D;  2YTX A;  2FIN B;  3HOU G;  1Z47 A;  1QJO A;  1GXD C;  3D4W A;  2E2I H;  3FMC A;  4B3M Q;  3UDF A;  4MN3 A;  5IWA Q;  3IAY A;  4DFA A;  3I72 A;  4C1N I;  5LMU L;  4QGU A;  3G4S A;  1S72 A;  1EQQ A;  1PTO C;  2A74 C;  4LW1 A;  1TKW B;  1EQT A;  5ELB A;  1LO5 D;  3RZD H;  3TDQ A;  3M4O H;  1QG7 A;  2Q2U A;  4DV4 L;  1A3T A;  1SR3 A;  2VNU D;  4OWX B;  3KJO A;  1TII D;  4TVA B;  4ABN A;  3DUZ A;  4A3D H;  5C4X B;  2PI2 A;  2DJF C;  1NMG A;  1Q8I A;  1H9J A;  3A5Z B;  3VA7 A;  1G29 1;  2KVM A;  4F88 A;  1TY0 A;  1B53 A;  1AW7 A;  1YNN D;  3L9A X;  4A3B H;  3LWE A;  1QIL A;  1FGU A;  2WII B;  2A19 A;  5IGG A;  3CC2 A;  3I4N G;  1GD7 A;  3H15 A;  4FVM A;  4B3T L;  3RR5 A;  5JOB A;  3SDZ A;  2NVX H;  3AFQ A;  4ODG A;  4RGT A;  4S3S A;  3RMH A;  3I4M B;  5A35 A;  3EFX D;  1ZEQ X;  1HZ9 A;  1UE6 A;  1LT6 D;  1SMX A;  3H0G H;  2UUA Q;  3KF6 B;  2LFN A;  2QIL A;  3ERQ A;  5M3F H;  3BZC A;  1CA6 A;  4WFN 3;  1X6O A;  1UEB A;  1HNZ Q;  2IJ0 A;  1KC8 C;  4DNT B;  4JCV E;  1B9M A;  1C9O A;  3T4A C;  4GOP A;  4C56 C;  4EX5 A;  4IUQ A;  1V9P A;  3GD7 A;  3KFU A;  1B8A A;  4ZKB B;  3DXJ C;  1IYJ B;  2RCN A;  3CPW A;  2K01 A;  3ULJ A;  1PXU A;  3HOU H;  2K75 A;  1EWI A;  4KY6 A;  4GKJ Q;  3H6M A;  3CU7 A;  4G4K A;  3M7N A;  2YYZ A;  1KL9 A;  3SGI A;  3PO3 G;  2XN9 C;  4F87 A;  4FDB A;  3OW7 A;  4HCE A;  3D4R A;  1U4M A;  2F0T A;  1PH3 A;  1J5E L;  2B2V C;  2CFM A;  3S24 A;  3J81 j;  5F2D A;  2QDB A;  4K14 A;  2F0N A;  1BF4 A;  2H5X A;  2PQA B;  3C1F A;  1CZG A;  4HAE A;  3OTO Q;  1ENF A;  4IUV A;  1VMP A;  3OWE B;  5DM6 3;  1DGS A;  5C0X I;  2PMZ E;  1Y69 U;  2IW3 A;  4N9T A;  2BA1 A;  1SYF A;  4HSP A;  3VA5 A;  5M9O A;  1WCM G;  5E1F A;  4CJ0 B;  2SOB A;  1OO9 B;  1RF2 D;  3AYH B;  2K14 A;  3KJP A;  3I4N H;  4LFC L;  3GTG B;  4XTC S;  3A8J E;  3AB9 A;  1YNX A;  4DR3 L;  3S1M B;  4H7B A;  4A93 G;  3J7A V;  2CW0 C;  1FL0 A;  1S5C D;  4DV4 Q;  4RGN A;  1PTO B;  1G6P A;  3TS0 A;  3S1R H;  5FLX L;  1I4Q A;  3JAM E;  3HOW G;  4HIK A;  1KDC A;  2QEJ C;  1PH4 A;  3S1Q H;  3U4V A;  2EYM A;  1PZJ D;  1SSO A;  1SYD A;  4JI6 L;  4FXG C;  1B2T A;  2JXM B;  2DN8 A;  2SEB D;  4BWG B;  4KMU C;  1CZW A;  2D0O A;  3CCJ A;  4RFB A;  2EYP A;  3KBG A;  1U4L A;  5KND A;  4PV1 C;  3K81 C;  1RIP A;  4DNR B;  2AQ2 B;  3UE1 A;  4ZYS A;  1AEX A;  2NTT A;  4KJN A;  1E7Z A;  1PDQ A;  1NAP A;  2KJX A;  2D9U A;  3MXU A;  3A74 A;  3GV6 A;  4P73 A;  2VUM G;  5ELC A;  2F0H A;  3J81 L;  1D1K A;  1R4P B;  1EYC A;  3PO3 H;  3I56 A;  1X3E A;  4TRD A;  1EWC A;  3S14 B;  4YY3 Q;  2EQS A;  4LJZ C;  2Q2H A;  3NEL A;  4XQN A;  1FGB D;  1EOV A;  2B2W A;  2WKD A;  3M3Y H;  2KED A;  4JBK A;  3E6Z X;  1E1T A;  4O1N A;  1WYD A;  2RSO A;  4R4T A;  1NR4 A;  3I55 A;  1WCM H;  1EYG A;  2A6E C;  4PZ6 A;  4YWK A;  4KKU A;  4H13 C;  1J5E Q;  2NVY H;  3CRK C;  2NVQ H;  1GM5 A;  4GOP C;  3O13 A;  4A93 H;  4RKL A;  5IOD A;  3MXG A;  5FKA C;  4NMZ A;  2J7Z A;  2F4V Q;  1VQA A;  2I5M X;  4LUO A;  1Q82 C;  3BJU A;  3GTP B;  3HFZ B;  4O0A A;  1CQV A;  4DK6 C;  3HOW H;  1AH9 A;  1SEB D;  1KAA A;  1PRT D;  1L0W A;  3TP8 A;  1Q8K A;  4XYQ A;  2N49 A;  1DOM A;  2QGQ A;  1PH6 A;  4LUZ A;  1Q7Y C;  2EJG C;  2ICE C;  3I4L A;  3OSO A;  3RUZ A;  4DR3 Q;  1VQ9 A;  1X3G A;  3J80 c;  3P75 A;  4OHJ A;  1R9T H;  2PQE A;  2VY3 A;  1D8L A;  4JI3 L;  1YIT A;  1JCK B;  3SHL A;  3F2U A;  3CP0 A;  2F0D A;  2K04 A;  1GHK A;  3L3O C;  4PMC A;  2LKV A;  3K8A A;  4LF5 Q;  3EN2 A;  1S5D D;  2ICI A;  1MD2 D;  4OO1 G;  1D1I A;  2VUM H;  2MNA A;  3I73 A;  1I94 Q;  3PUX A;  2G9H D;  4A3G B;  2A6E D;  3BZD B;  3GQB A;  1BNZ A;  4K5W A;  1PRT F;  3X3M A;  3NEN A;  3PIP A;  1CUK A;  5BN4 A;  1VQL A;  1C7Y A;  1SAP A;  1K0R A;  4R4Q A;  2EOT A;  1S3O A;  3M85 A;  4GS3 A;  4XQJ A;  1PFM A;  3I4O A;  5EBD A;  4PMB A;  1VQ6 A;  3RZO H;  3K7U C;  1A3V A;  1E3P A;  1AE2 A;  1CSQ A;  3LGJ A;  4A3K G;  1BUV T;  2HDL A;  3CD6 A;  3X3N A;  4LF8 Q;  1J9O A;  1S40 A;  3A7L A;  4ZUJ A;  2ES2 A;  1X3Q A;  3PQI A;  4LFA L;  1IYV A;  1NJI C;  1Y1V B;  4YIJ A;  1NE3 A;  3QO2 A;  3FDT A;  3UDG A;  1RDP D;  2ID0 A;  1PVO A;  4MZ9 A;  3TRE A;  2K28 A;  5C4J H;  2F0S A;  1XWE A;  2F0Q A;  3NWS A;  5KNB A;  5M5X H;  3S1N B;  1NCV A;  4RWS C;  1ZXT A;  4L5S A;  1KDB A;  3I91 A;  4QB4 A;  1A15 A;  5LHY 1;  1XMQ L;  2JE6 I;  3P1H A;  1L2F A;  4RMF A;  3J7A F;  2WFW A;  1Q81 C;  3SEB A;  5M5Y H;  3F2B A;  3HOY G;  3WOF A;  1EIG A;  1TWF H;  3RN2 A;  1CKM A;  4XYO A;  4GOP B;  1PYB A;  5I2Y A;  4BBS G;  4QUF A;  2B2W C;  2F0P A;  1WTX A;  4NXM L;  4PZ8 A;  4IUU A;  4JOI A;  1TR5 A;  2D5D A;  3RLF A;  1VQC A;  2HUG A;  2Q8T A;  4OO1 H;  4P72 A;  5C6A A;  2FHT A;  2WP8 J;  4UP7 A;  2UUC Q;  5COR A;  3PCO B;  1HXY D;  2L12 A;  1L0Y B;  4IUN A;  1CA5 A;  4LF7 L;  2A1A A;  1RJT A;  2KUM A;  1VQD A;  1DON A;  3PV0 A;  3TEH B;  5EGT A;  3ERO A;  1WOC A;  3LWU A;  4IPD A;  1QVG A;  3R2T A;  1F2Z A;  4JI3 Q;  1EY7 A;  1ZYR D;  3PUW A;  1H9M A;  1EY4 A;  1J8I A;  2Y0S G;  3HOX B;  2YTY A;  3OPO A;  1ILQ A;  4OGQ C;  3PUY A;  3MXN A;  2N8N A;  5FOB B;  3P20 A;  1N34 Q;  4QUC A;  1TWC H;  3CMA A;  4N8F A;  1BR9 A;  1V1P B;  4NB3 A;  1S5F D;  3NUC A;  1BBW A;  5GAE C;  1MSG A;  1MHW C;  3OW2 A;  1MBY A;  2RDG A;  3T13 A;  1IYU A;  1HA6 A;  3CQZ B;  2F3I A;  3K5L A;  1D5M C;  3CKI B;  1WTP A;  2B2U A;  4ZUI A;  4OEM B;  1GHJ A;  3CAM A;  5IOC A;  1C0A A;  1BO0 A;  2VB2 X;  3T1Y L;  4LFB Q;  3S2D H;  5IP9 H;  2E2H H;  1WTR A;  1LTG D;  3CRL C;  2IL8 A;  2I46 A;  3I70 A;  4DV2 Q;  4HMI A;  1Y1W G;  2B39 A;  4A3J B;  2R92 B;  5I2X A;  1QNU A;  3R93 A;  2NZO A;  4JI7 L;  2CH4 W;  2XNA C;  1K83 B;  5DNF A;  2D0P A;  3HOY H;  3CCU A;  3DEP A;  1VQB A;  3TP5 A;  1JOO A;  1LAC A;  3ZJY C;  1BXT A;  3T51 B;  2R93 G;  1SNO A;  4UP9 A;  4BBS H;  3GTQ H;  2WIN B;  4FO2 A;  1KRT A;  4KN7 C;  3K6O A;  2L5T A;  2MO1 A;  4HJA A;  2R61 A;  3C1E A;  5DM7 3;  1VQH A;  1CT1 D;  1LTA D;  1Q1B A;  2LMC B;  1XMQ Q;  1ROD A;  2F1M A;  5J3B A;  3A5U A;  1KDA A;  4WRD A;  4R4O A;  1HCZ A;  5E7N A;  4ID6 A;  1TWG H;  3TBI B;  3K0Y A;  1HNX L;  2FFK B;  4NXM Q;  1TU2 B;  4GN5 A;  4DN4 M;  1H9S A;  1GOZ A;  4OXP A;  1JMC A;  5IYD H;  1EOT A;  5IGB A;  3QR8 A;  2Q8I B;  3T1H L;  4B3M L;  4YCV A;  1CSP A;  5IGF A;  4BY1 G;  2F0K A;  4IFD J;  4LF7 Q;  1VCI A;  2RQX A;  1H9R A;  3HOZ G;  2B63 G;  4DR5 Q;  3G71 A;  4DA2 A;  1N36 Q;  4Z9C B;  1W2B A;  4DAP A;  4DR4 L;  4CKE A;  3MTS A;  3Q24 A;  5KYL A;  1QZH A;  2DJG C;  4JOI C;  4BY7 B;  1NUC A;  2CHB D;  3BVZ A;  4XDX A;  3D6W A;  3RZD B;  5JJI A;  4RA8 A;  3G6E A;  2EVB A;  1PMR A;  2XGT A;  1QNK A;  1K0S A;  2AWO A;  1Y1W H;  2RKS A;  4A3D B;  1IBL Q;  3HKZ B;  4TQU S;  4A3E G;  3NXW A;  4DR2 Q;  2N55 A;  4MIU A;  5IGE A;  1DCZ A;  1E24 A;  2JA6 G;  1M4V A;  1TVX A;  1X65 A;  3FPU B;  2DNC A;  2PW7 A;  4HIO A;  2R93 H;  5C44 G;  1YEZ A;  2KQ3 A;  2ZJP A;  1ENA A;  3PF4 A;  3T1Y Q;  3ULP A;  1ASZ A;  1EY6 A;  5AJ3 Q;  3OIQ A;  3A55 A;  4X66 Q;  1HTL D;  4IPG A;  4OWW B;  3H0G B;  2HCI A;  4R1J A;  4JI7 Q;  2Q2I A;  2EY2 A;  5JJZ A;  4L5T A;  2CWA A;  2F0E A;  5EPK A;  5CBE E;  2PZU A;  2XIW A;  3KLW A;  3KK7 A;  1EY0 A;  2WAQ G;  3QOJ A;  5C5M A;  2KOL A;  1X9N A;  1BCP C;  2B2U C;  2IPK D;  1LT3 D;  4A3C G;  3JAM L;  1TS4 A;  2E2J H;  2RBM A;  2IY5 B;  3K7A H;  3W1G A;  1KLU D;  4UPA A;  4GKJ L;  2JA7 G;  1AN8 A;  5CC4 A;  2A73 B;  5L37 A;  4EGV A;  3HOU B;  4BY1 H;  4XT1 B;  2PYK A;  4X64 L;  3R2I A;  4IZ8 A;  4NXN Q;  4RCN A;  2B63 H;  4IFD G;  4ZQ3 A;  4DUY Q;  2ZXP A;  4QIW B;  4E6I A;  1HNX Q;  1PH5 A;  1X3P A;  1K8G A;  4EQ5 A;  4X6A H;  3M7G A;  2WB1 G;  2ZJR A;  3S2H B;  1U5K A;  3PIO A;  1FVI A;  2K1B A;  1UE1 A;  4DV1 Q;  1F9S A;  1O80 A;  3T1H Q;  2JA5 H;  5FJ8 G;  2JQO A;  1GUN A;  1SE2 A;  2XSC A;  3J81 i;  2LY7 A;  1X54 A;  4A3E H;  5CYU A;  5JAV A;  1YHB A;  4JVZ A;  3A54 A;  1HZB A;  2A6H C;  2WKC A;  1IKM A;  1G6Z A;  2F0M A;  4KY7 A;  5BR8 L;  2JA6 H;  4DR4 Q;  4C3H G;  4X65 L;  1BCP D;  4BA1 I;  3I4N B;  1BDO A;  5C44 H;  4C3I G;  3VR5 A;  2R7Z G;  4TKO B;  5JJK A;  3F2D A;  2KHJ A;  3GTJ H;  3K0X A;  1NMF A;  5IYC G;  4B3S Q;  3SK8 A;  2QW7 A;  1JQY D;  3KLR A;  5C3W A;  2HT1 A;  1Z6H A;  3K5N A;  4KHZ A;  3BYY B;  5C0X J;  1DJR D;  3NQT A;  4UP8 A;  2Z9H A;  2K5N A;  1I3Q H;  3ND8 A;  1PA6 A;  5ELF A;  1DOL A;  4A3C H;  3FPP A;  3OWF A;  4JC0 A;  1VQN A;  1H9K A;  4K0K Q;  3IL8 A;  2OWO A;  2UUB L;  2X6G A;  2JA7 H;  3ONA B;  4LMQ D;  4BS9 A;  1MKH A;  1NBW A;  2A68 C;  3NBI A;  2PCF B;  5DLQ E;  3KLS X;  4XQQ A;  4CDC C;  5C4X G;  5K36 G;  1R4Q B;  2A6H D;  1JE4 A;  1MIU A;  4R8N A;  4YY3 L;  1PTO D;  1QE6 A;  4Q5V A;  4IFD H;  2KHS A;  1XMO L;  3PO3 B;  1EU4 A;  1MGS A;  1GUT A;  2UU9 Q;  4EQP A;  1BCP B;  2WAC A;  1PH1 A;  1MJC A;  4C3J B;  5DAU A;  3HG9 A;  1BBU A;  1XTD A;  1UAP A;  5FJ8 H;  3M3Y B;  1PZK D;  1SJH D;  1VQJ A;  3B6Y A;  3QIA A;  2MGS A;  4X64 Q;  1A62 A;  5G3L D;  1EY8 A;  2L0C A;  1B44 D;  1EUJ A;  1PFN A;  1WCM B;  4C3H H;  4FF1 A;  2F4V L;  5EPJ A;  5C3E G;  1LLR D;  4IUP A;  3KOJ A;  1VQP A;  2NVY B;  4I65 A;  2NVQ B;  4YCU A;  1VQM A;  1PTO F;  4L8J A;  1ASY A;  2E8G A;  1KD1 C;  2PMZ B;  2F0J A;  5KYI A;  2A5H A;  2E74 C;  2A68 D;  4MTN A;  5IYC H;  3HOW B;  5HGT A;  3J80 E;  1I50 B;  3F1Z A;  2CKZ B;  3DMU A;  2RHS B;  2EYH A;  5EBC A;  2GVB A;  3EBE A;  5BR8 Q;  5EAY A;  1I4P A;  2HDM A;  4X65 Q;  1XJV A;  2G5D A;  5C0X G;  2P5Z X;  2F3V A;  1R9T B;  1H9S B;  1D6E C;  1DXM A;  2NUC A;  2OCE A;  4LF5 L;  1L0X B;  1BQQ T;  1TS5 A;  4YHH L;  1BVS A;  4R4I A;  4JBM A;  2EYO A;  4DU9 A;  3Q0A A;  4A3F B;  4AYB G;  5DEH A;  2MHV A;  3HP3 A;  1I94 L;  4MHE A;  3R3O A;  1JR0 D;  1N9W A;  5C4X H;  3FRP B;  5K36 H;  4ZCK A;  3S16 H;  2B2T A;  1T5X D;  2F0O A;  2VUM B;  2XWB B;  1L1O A;  3D8G A;  1EZ6 A;  2CCZ A;  1FNW A;  3E9H A;  1JOQ A;  3WDN A;  3T53 B;  3FEW X;  3STB C;  1EFW A;  1II3 A;  2Z6B A;  3GTK B;  1Q86 C;  1X55 A;  2JSO A;  3VYT A;  5E4W C;  1LTI D;  1G2T A;  2L9H A;  3KF8 A;  2BA0 A;  2UUB Q;  3M4P A;  1I5F A;  4RG1 A;  2MFI A;  4JG2 A;  3EJI A;  3L2P A;  1ENC A;  1EIF A;  1OXS C;  1SXT A;  4JV5 L;  1CFM A;  3SK6 A;  5BN5 A;  3NBH A;  3BYT B;  4QMG A;  4JK1 C;  5IT9 E;  3RZO B;  1XPO A;  4KKT A;  2CW0 D;  4A3M G;  1XMO Q;  4LF8 L;  4IQZ A;  1I4R A;  3G6J B;  4OIK A;  5C3E H;  5AFW A;  4ALP A;  5I6Y A;  4HCS A;  4DV6 Q;  4CDD C;  3A0J A;  3OMG A;  2F4I A;  5J39 A;  5FK9 C;  1AP0 A;  1ICW A;  3TP7 A;  1NR2 A;  2NN6 I;  2O5J C;  2VL6 A;  5ELE A;  5CV9 A;  4GLA C;  2RA4 A;  5HUR A;  4DV7 L;  3STB D;  5JEA J;  2H4O A;  4IJL A;  5ISR A;  3KUP A;  4DV3 Q;  1WFQ A;  3NTI A;  5M5Y B;  1HQM C;  3I3C A;  1STB A;  3MFG A;  1EQR A;  1TWF B;  1RHP A;  1RTN A;  1KQS A;  1N32 Q;  3PGZ A;  5IE8 A;  5ELD A;  4ULL A;  1XNR Q;  2LXJ A;  2K32 A;  3CHB D;  4G7Z C;  2UUC L;  4FXD A;  3W2D A;  4PQX A;  1PH2 A;  4KHP L;  1CQF A;  1I4X A;  1A6X A;  4RGO S;  1SDF A;  4P2C B;  2FJ2 A;  4K5X A;  3VDY A;  3E3X A;  1SMY C;  5M3M G;  5TSS A;  1VQ5 A;  4UAI A;  1Y8O B;  3K58 A;  1JT8 A;  4YHH Q;  1TWH H;  2R7D A;  1A8V A;  4KTA A;  1N34 L;  1GO3 E;  2AQ1 B;  2KCN A;  4LAA A;  3CCV A;  1JJ2 A;  3F2C A;  4ME3 A;  2K5V A;  2EJF C;  4CGY B;  4FF2 A;  1V8Q A;  1LV9 A;  4A3M H;  4X3T A;  5M5W H;  1TWC B;  4KI0 A;  2O5I C;  2IX1 A;  2B8G A;  2KEC A;  3LNN A;  1YHQ A;  4U67 3;  1Y14 B;  3FP9 A;  3J7A 5;  1YI2 A;  4LFB L;  2RVL A;  4HJ5 A;  1GUW A;  3WOE A;  1S4Z A;  2IHE A;  3BG3 A;  4ZAI A;  1SFO B;  2NZ1 D;  1XNQ Q;  4DV2 L;  4N8X 1;  4JV5 Q;  4XIG S;  4JI4 Q;  3URY A;  3PIP 3;  3KDF A;  1YHA A;  2X69 A;  5COY A;  5CV4 A;  4CKC A;  1UE7 A;  5GAG C;  3S2D B;  3HS0 C;  2B2T C;  2ZTD A;  1PFB A;  2I5H A;  1L1O C;  2KCM A;  2Z4H A;  4DAV A;  5KNC A;  1K9M C;  2KCT A;  2LS0 1;  5IT9 c;  1SMY D;  4A3G G;  3HRZ C;  3GTO B;  1DM0 B;  2Z8L A;  4GNX A;  2HD3 A;  4IO9 A;  3HOV G;  4B08 A;  5JEA G;  4A4I A;  1J6Q A;  4JYA L;  1HRJ A;  1RTO A;  3EA6 A;  4FYD A;  3W1B A;  2Q2T A;  4WJW A;  5C5L A;  2OT2 A;  4PZ7 A;  1EFI D;  3NTH A;  4PNY A;  2EY5 A;  4K8I A;  1Q1E A;  1STY A;  1U9R A;  4DXF A;  5I4D A;  2QEX A;  4DV7 Q;  1M1K C;  1SYC A;  1WTH A;  5JJL A;  1XYI A;  5M3M H;  4IOC A;  3TME A;  2QA4 A;  1HPC A;  4RKB A;  3CC7 A;  1I6H B;  4B3R Q;  2Z4I A;  1TWG B;  2IX0 A;  4UY8 C;  1EYA A;  1K8O A;  5KGU A;  1YJ9 A;  2L15 A;  1VDZ A;  1QUQ A;  4HR7 B;  4EQN A;  1KHI A;  4RAU C;  2V1C C;  3S9W A;  3MAQ A;  1ZKO A;  1IHZ A;  2RDF A;  3BVG A;  1D7Q A;  2EYJ A;  3UDI A;  4KHP Q;  3CME A;  4HSV A;  1FR3 A;  2Y0S E;  1JOK A;  3H3V H;  4DR5 L;  3AEV A;  1CHQ D;  3PO2 G;  1N36 L;  2EJM A;  4DR6 L;  4Q0F A;  2YU9 H;  2F0G A;  4DR1 L;  3T56 B;  3PMF A;  3BVM A;  1HUM A;  5FO9 B;  3JAM i;  5A2Q E;  3NWT A;  4IUT A;  4PMW A;  1VS0 A;  3J81 E;  1I4H A;  2CQA A;  1CKO A;  3H09 A;  1EZ8 A;  3IFT A;  3L7Z C;  3SVM A;  4G7O C;  2K33 A;  1D5Z C;  4K2L A;  1IBL L;  4A3K H;  3V05 A;  4J8Q A;  4DR2 L;  2MQH A;  1JJC B;  5C4H A;  4K2K A;  1Y1W B;  3HKS A;  4R4C A;  4A3G H;  1KNA A;  1Q90 A;  1GJX A;  1FD7 D;  4A3I G;  5E4X A;  3GTM H;  1E2W A;  1TWA H;  1W6J A;  4JI2 L;  4APV A;  3QJY A;  1K28 A;  3HOV H;  4IOA A;  3UDX A;  3BU2 A;  5JEA H;  3J7Z C;  3CPF A;  2A69 C;  2EYF A;  5AJ3 L;  4HJ9 A;  4OON A;  4RH6 A;  1W3S A;  2DUD A;  1XX8 A;  4IN3 A;  4X66 L;  1F2L A;  1QWY A;  1S5E D;  1DYQ A;  3HOX G;  2R3Z A;  4P74 A;  4BBR B;  1HR0 Q;  4AH6 A;  2ZT9 C;  1VQ7 A;  1D2B A;  3MA2 B;  3Q6S A;  1EEF D;  4QJF A;  2RSN A;  2JK8 A;  1L1O B;  5CGK A;  2M2L A;  4KKS A;  3G48 A;  3G7L A;  3GTL B;  1HQR D;  2YV5 A;  3CCQ A;  1SE4 A;  4ZKC B;  3CCS A;  3D3R A;  1BBX C;  1QVF A;  3KF8 B;  1CHP D;  4JYA Q;  1E0B A;  3R8B A;  2ZTC A;  4Y7N B;  4OIJ A;  4GKK L;  2MO0 A;  5I6W A;  4O42 A;  2RF4 A;  4LUV A;  3TN2 A;  3NBH B;  1AE3 A;  4NXN L;  2FMM A;  4KJO A;  1CK1 A;  4DUY L;  3PO2 H;  3S1N H;  3EQL C;  2DGY A;  3BDL A;  2VQF L;  4BY1 B;  2SNM A;  2VQE L;  2AUJ D;  1WVL A;  5LL6 X;  1YJN A;  3QB3 A;  4GNX C;  3AU7 A;  1FNV A;  2JA8 G;  1VMC A;  5FLX c;  2CH4 A;  1PHJ A;  4RGM A;  2ALY B;  4LNQ A;  1ML0 D;  3Q22 A;  2C9O A;  5T1G A;  4KV6 A;  4DV1 L;  3UI2 A;  4PG3 A;  4LF6 Q; 
#chains in the Genus database with same CATH homology
 4LF9 L;  2KHJ A;  3GTJ H;  2VZA A;  3K0X A;  1NMF A;  1OTC A;  5IYC G;  1YIJ A;  4A3L G;  4B3S Q;  1HNW L;  3A74 A;  1PH9 A;  4P73 A;  4MNO A;  1UWV A;  2VUM G;  3RNU A;  2HT1 A;  5IP9 G;  4DV5 Q;  4DR6 Q;  3PO3 H;  2Z6K A;  3I56 A;  4A3I H;  1X3E A;  4KHZ A;  4JI0 Q;  4DR1 Q;  5C0X J;  1RL2 A;  1QVC A;  4UP8 A;  3FKI G;  2K5N A;  4OWT B;  2EQS A;  4YY3 Q;  2I0Q A;  4JI1 L;  1I3Q H;  1PV4 A;  4BXX H;  4LF6 L;  2Q2H A;  1PA6 A;  3NEL A;  1NTG A;  1Y1V G;  4A3C H;  3GTP H;  1EOV A;  5GAH C;  1VQG A;  4JC0 A;  5H1S E;  1VQN A;  1H95 A;  3J81 c;  3Q8D A;  4K0K Q;  3J80 i;  2OWO A;  2UUB L;  4B3S L;  3M3Y H;  2JA7 H;  4JBK A;  1E1T A;  1P8L A;  3HOX H;  1WYD A;  1KAW A;  1MKH A;  1NBW A;  4DV0 Q;  4R4T A;  3I7F A;  5DLQ E;  4JBW A;  1A63 A;  2JEB I;  1MJE A;  5LMN Q;  5C4X G;  5IP7 G;  1G51 A;  5K36 G;  1K8A C;  1OXV A;  3I55 A;  1LUZ A;  3DM3 A;  1MIU A;  1AH9 A;  1WCM H;  1EYG A;  2C35 B;  4YY3 L;  4PZ6 A;  1YBY A;  4YWK A;  5FLM G;  1PVO A;  1J5E Q;  1XMO L;  2NVY H;  3JC6 6;  4JI2 Q;  2NVQ H;  4JI5 L;  1GM5 A;  4GOP C;  4A93 H;  4K0K L;  2UU9 Q;  4HIM A;  1GVP A;  1VQA A;  1T9H A;  2I5M X;  2WAQ E;  4LUO A;  4DNI A;  1PH1 A;  1MJC A;  2F4V Q;  2UXC Q;  1Q82 C;  4H02 A;  3BJU A;  4BY7 G;  4DV0 L;  1JJG A;  3HFZ B;  4O0A A;  4DK6 C;  4GLX A;  2OTJ A;  3CCM A;  3HOW H;  1BBU A;  1XTD A;  2LXK A;  2OQ0 A;  4P71 A;  1L0W A;  3CXC A;  5FJ8 H;  1VQO A;  1FJG L;  1O7I A;  1Q8K A;  5IYD G;  1VQJ A;  2GN5 A;  3B6Y A;  2N49 A;  3KYH C;  2QGQ A;  3KF6 A;  4X64 Q;  1A62 A;  1PH6 A;  1PYS B;  2HIX A;  4LUZ A;  5GRO A;  5GAD C;  1Q7Y C;  1EUJ A;  4HJ8 A;  2B3G A;  4C3H H;  2JA8 H;  1K83 H;  4QL5 A;  4DR3 Q;  1VQ9 A;  2UU9 L;  3ICE A;  2F4V L;  1X3G A;  5C3E G;  3J80 c;  1R9T H;  3KOJ A;  1VQP A;  2UXC L;  2JEA I;  2VY3 A;  1KRS A;  2HQL A;  1D8L A;  4YCU A;  1VQM A;  4JI3 L;  3GO5 A;  1YIT A;  3M9B A;  1ASY A;  4LF4 Q;  2E8G A;  2N3S A;  1KD1 C;  3CP0 A;  4BA2 I;  2ASB A;  1HJP A;  4POF A;  1U0L A;  2WB1 E;  4GKK Q;  1SFO H;  3K8A A;  4MTN A;  3HOZ H;  4LF5 Q;  3KDF B;  2HHH Q;  3EN2 A;  5IYC H;  4A3L H;  2UXD Q;  4OO1 G;  2VUM H;  5IYB G;  2MNA A;  4DK3 C;  1I94 Q;  4OX9 Q;  3PUX A;  2VQF Q;  1VQ4 A;  3F1Z A;  2CKZ B;  2VQE Q;  1Q46 A;  2KBN A;  2RHS B;  3U50 C;  2GVB A;  3EBE A;  3H0G G;  3NEN A;  5BR8 Q;  5EAY A;  3M4Q A;  3FKI H;  3PIP A;  4X65 Q;  1XJV A;  4GNX B;  1CUK A;  2UXB Q;  1IBM Q;  3GTO H;  4WJ3 M;  2ZM6 L;  1C7Y A;  1VQL A;  5C0X G;  1K0R A;  1Y1V H;  4R4Q A;  5ELN A;  3AQQ A;  3S17 H;  4LFB Q;  1S3O A;  3M85 A;  2OCE A;  2PQA A;  1LTL A;  4GLV B;  4GS3 A;  2HHH L;  4LF5 L;  4YHH L;  4LF9 Q;  1BVS A;  3K80 C;  4R4I A;  4DPG A;  4LFA Q;  3CCE A;  4JBM A;  4AYB G;  3I4O A;  1I94 L;  4JI8 L;  1HNW Q;  1VQ6 A;  3RZO H;  5HGQ A;  4A3J G;  2R92 G;  1N9W A;  3AFP A;  1QZG A;  5C4X H;  4O2D A;  5IP7 H;  4A75 A;  3TRZ A;  4BBR G;  3K7U C;  2HIV A;  3E9I A;  1E3P A;  3S16 H;  1AE2 A;  1CSQ A;  1L1O A;  3LGJ A;  4A3K G;  2UXB L;  1IBM L;  2CCZ A;  5FLM H;  1LM0 A;  3E9H A;  3U58 A;  2JJQ A;  4DUZ Q;  1N33 L;  3D31 A;  4L5R C;  1B70 B;  3STB C;  4JI1 Q;  3CD6 A;  3PUZ A;  1EFW A;  4LF8 Q;  2CQO A;  1X55 A;  4J15 A;  1S40 A;  1Q86 C;  2ES2 A;  1I6H H;  4DAM A;  4LFA L;  2R6G A;  1NJI C;  1QUQ B;  2BA0 A;  4YWM A;  1NE3 A;  2UUB Q;  4BY7 H;  3M4P A;  1I5F A;  4RG1 A;  2MFI A;  4JG2 A;  1X56 A;  2ID0 A;  5IY0 A;  4AQY L;  3L2P A;  3UDG A;  1JB7 A;  3F2D A;  1EIF A;  1OXS C;  1P16 A;  4MZ9 A;  4QQB X;  4JV5 L;  3TRE A;  3RN5 A;  5C4J H;  2EXD A;  1KXL A;  2FXQ A;  2ZTE A;  5M5X H;  1IL2 A;  4DUZ L;  4L5S A;  2Z6K C;  1XMQ L;  1XPO A;  2JE6 I;  1UE5 A;  5HY6 A;  1WJJ A;  3CCR A;  4A3M G;  1L2F A;  4RMF A;  1WI5 A;  4POG A;  2K52 A;  2WFW A;  3WWV A;  5IWA L;  1SLJ A;  1PFS A;  1XMO Q;  5M5Y H;  3F2B A;  1Q81 C;  4JI5 Q;  3HOY G;  1C0A A;  3IRB A;  5C3E H;  2NVT H;  2F52 A;  4ALP A;  1KIX A;  1TWF H;  3RN2 A;  1CKM A;  4GOP B;  1PYB A;  4BBS G;  1V1Q A;  4DV6 Q;  4PZ8 A;  4NXM L;  1E1O A;  3MXN B;  3A0J A;  2B29 A;  4JOI A;  1CKN B;  3PUV A;  4P75 A;  3PSI A;  4C2M H;  1K73 C;  3RLF A;  1VQC A;  3L0O A;  1FJG Q;  3NEM A;  2NN6 I;  2VL6 A;  4NPS A;  4P72 A;  5IYB H;  2WP8 J;  4UP7 A;  2GVA A;  2UUC Q;  1VQE A;  3PCO B;  4LF7 L;  2JA5 G;  4GLA C;  2A1A A;  2NZH A;  4DV7 L;  3I2Z A;  1VQD A;  3STB D;  3PV0 A;  1SRO A;  3CQZ H;  5JEA J;  3TEH B;  4IJL A;  4DV6 L;  1WOC A;  3HKZ E;  1WFQ A;  4IPD A;  4DV3 Q;  1QVG A;  4DR7 L;  4JI3 Q;  1EQR A;  3PUW A;  4HJ7 A;  2AKW B;  1N8R C;  1KQS A;  3I4M G;  1N32 Q;  3PGZ A;  5IE8 A;  1IZ6 A;  2Y0S G;  2YTY A;  2KEN A;  3PUY A;  2LXJ A;  2UUC L;  1IBK L;  1XNR Q;  3TS2 A;  1TXY A;  5GQO A;  2A8V A;  2N8N A;  1K3R A;  4A3J H;  2R92 H;  2AWN A;  4A3D G;  3HKZ G;  4DAY B;  1PH2 A;  1N34 Q;  2E5L Q;  4KHP L;  1A0I A;  4BBR H;  1TWC H;  3CMA A;  2UUA L;  4A76 A;  2RHQ B;  4NB3 A;  4WJ4 A;  3VDY A;  1V43 A;  1XPR A;  3TQY A;  1BBW A;  1E22 A;  1LYL A;  4DV3 L;  4A3B G;  4C3I H;  4X62 L;  2I5L X;  5M3M G;  5GAE C;  3CCL A;  1VQ5 A;  5ELO A;  3E0E A;  2R7Z H;  2ZM6 Q;  1OXX K;  3OW2 A;  3S15 H;  1HNZ L;  3ER0 A;  3GTL H;  1N32 L;  2F3I A;  1JT8 A;  3F8T A;  4IJH A;  1XNR L;  2IT1 A;  3PF5 A;  3S2H H;  2AHO B;  4YHH Q;  1TWH H;  2R7D A;  1A8V A;  1EIY B;  1YVC A;  1HZC A;  3CAM A;  1N34 L;  1GO3 E;  3CCV A;  4JI8 Q;  3RLO A;  3T1Y L;  1JJ2 A;  2E5L L;  4AIM A;  2D62 A;  5IP9 H;  3F2C A;  4Y7N H;  2E2H H;  3S2D H;  3CC4 A;  1VQI A;  4ME3 A;  1YJW A;  4DV2 Q;  2K5V A;  1Y1W G;  4AYB E;  1PH8 A;  4YCW A;  4QY7 A;  4A3M H;  4JI7 L;  2NZO A;  1VQF A;  5M5W H;  5M3F G;  1N33 Q;  5LMN W;  4KI0 A;  3DLL A;  2K4K A;  2D0P A;  1X3F A;  2IX1 A;  3HOY H;  3CCU A;  1YHQ A;  1VQB A;  3CW2 C;  3ZJY C;  1NY4 A;  5LMU Q;  2R93 G;  1Y14 B;  4UP9 A;  4BBS H;  4IFD I;  3FP9 A;  3GTQ H;  3J7A 5;  3BZK A;  1YI2 A;  1KRT A;  4LFB L;  4HJ5 A;  4AQY Q;  4QIW E;  2IHE A;  2OTL A;  2MO1 A;  4HJA A;  1XNQ Q;  2K50 A;  4DV2 L;  4JV5 Q;  4XIG S;  3RLN A;  4JI4 Q;  3OTO L;  2YTX A;  3KDF A;  1YHA A;  3HOU G;  1HZA A;  1Z47 A;  1UE7 A;  1VQH A;  1Q1B A;  5GAG C;  2ZTD A;  2I5H A;  1L1O C;  2KCM A;  2XTI A;  1XMQ Q;  1K9M C;  2E2I H;  2KCT A;  5J3B A;  3A5U A;  4B3M Q;  5IT9 c;  3UDF A;  5IWA Q;  4A3G G;  4R4O A;  5E7N A;  4QGU A;  5LMU L;  1TWG H;  4GNX A;  4IO9 A;  3G4S A;  1HNX L;  2AMC B;  1S72 A;  3HOV G;  1GKH A;  1EQQ A;  1Z9F A;  5JEA G;  4NXM Q;  4GN5 A;  1XNQ L;  4LW1 A;  4A4I A;  1JMC A;  4JI4 L;  4OXP A;  3RZD H;  2K5H A;  3I4M H;  3M4O H;  5IYD H;  2Q2U A;  4DV4 L;  1SR3 A;  4B3T Q;  1J6Q A;  4JYA L;  4OWX B;  1VQ8 A;  2VNU D;  3KJO A;  1M90 C;  2ATW A;  4TVA B;  1HR0 W;  4A3D H;  2PI2 A;  3W1B A;  4A3F G;  2Q2T A;  3T1H L;  1NMG A;  4B3M L;  4LF8 L;  2OQK A;  4YCV A;  1CSP A;  4IPC A;  3A5Z B;  4BY1 G;  2EIF A;  4PZ7 A;  4LF7 Q;  4IFD J;  1G29 1;  1VCI A;  1XPU A;  1M1K C;  3HOZ G;  1Q1E A;  2QEX A;  4DV7 Q;  4A3B H;  1FGU A;  2B63 G;  2A19 A;  5JJL A;  3D0F A;  5M3M H;  4DR5 Q;  3CC2 A;  3G71 A;  4IOC A;  2QA4 A;  1N36 Q;  1W2B A;  3I4N G;  4IPH A;  1GD7 A;  3U4Z A;  4DR7 Q;  3CC7 A;  3H15 A;  4DR4 L;  3ERS X;  4B3R Q;  2IX0 A;  1QZH A;  4UY8 C;  4B3T L;  4JOI C;  1YJ9 A;  1SN8 A;  2L15 A;  3RR5 A;  1QUQ A;  3GDE A;  3AFQ A;  2NVX H;  1KHI A;  2V1C C;  1IBK Q;  2PNH A;  5JJI A;  3G6E A;  1HZ9 A;  1UE6 A;  4C3J H;  1D7Q A;  2XGT A;  4L5Q A;  3UDI A;  1SMX A;  3H0G H;  3CME A;  4KHP Q;  2Y0S E;  2AWO A;  2UUA Q;  1Y1W H;  3ULL A;  3KF6 B;  1IBL Q;  3H3V H;  4TQU S;  4A3E G;  4DR5 L;  1Q12 A;  4HID A;  3AEV A;  3PO2 G;  1N36 L;  4DR2 Q;  5M3F H;  3BZC A;  4DV5 L;  4DR6 L;  4X62 Q;  4B3R L;  1X6O A;  2YU9 H;  4JI0 L;  2Z0S A;  3EIV A;  4DR1 L;  1E24 A;  1UEB A;  1HNZ Q;  2JA6 G;  2NN6 G;  1X65 A;  1KC8 C;  2R93 H;  4JCV E;  4HIO A;  3W5O A;  3JAM i;  5C44 G;  1YEZ A;  1C9O A;  4GOP A;  4EX5 A;  4PMW A;  1VS0 A;  1CKO A;  2ZJP A;  1CKN A;  1V9P A;  3GD7 A;  1OXU A;  3KFU A;  1B8A A;  3L7Z C;  3T1Y Q;  3PF4 A;  3ULP A;  1IYJ B;  1ASZ A;  2RCN A;  3CPW A;  3ULJ A;  5AJ3 Q;  1IBL L;  3HOU H;  4A3K H;  2K75 A;  4DR2 L;  1EWI A;  1JE5 A;  4X66 Q;  2MQH A;  4GKJ Q;  4IPG A;  4OWW B;  1JJC B;  4R1J A;  5LMN L;  4JI7 Q;  3M7N A;  1YZ6 A;  2Q2I A;  2YYZ A;  1KL9 A;  1SRU A;  3HKS A;  4R4C A;  4A3G H;  1I50 H;  2KHI A;  4L5T A;  3SGI A;  3GTG H;  4A3I G;  2CWA A;  3PO3 G;  4FDB A;  4YWL A;  3S1M H;  3GTM H;  1TWA H;  2WAQ G;  3KLW A;  4LWC A;  2CWP A;  1PH3 A;  1J5E L;  4JI2 L;  2ZJQ A;  2CFM A;  3S24 A;  1BKB A;  4APV A;  3J81 j;  1X9N A;  3HOV H;  3UDX A;  3BU2 A;  3J7Z C;  2N78 A;  4BXX G;  4LFC Q;  4IOA A;  4OO1 I;  3CPF A;  3OYY A;  1PH7 A;  4A3C G;  2H5X A;  2E2J H;  2PQA B;  5AJ3 L;  4HJ9 A;  2IY5 B;  3K7A H;  4OON A;  3W1G A;  1W3S A;  2DUD A;  3OTO Q;  4UPA A;  4X66 L;  4GKJ L;  2JA7 G;  3CF5 A;  2IHF A;  3H3V I;  3FHW A;  3HOX G;  4A3F H;  4P74 A;  1HR0 Q;  1DGS A;  1IXR A;  4AH6 A;  5C0X I;  2PMZ E;  1B7Y B;  1VQ7 A;  4BY1 H;  3UE0 A;  2BH8 A;  4QJF A;  2BA1 A;  2JK8 A;  4X64 L;  1L1O B;  1WCM G;  4NXN Q;  3JAM c;  2B63 H;  4JI6 Q;  3G48 A;  4IFD G;  4DUY Q;  3AYH B;  2K14 A;  3KJP A;  2BH2 A;  4LFC L;  3I4N H;  4DKA C;  4XTC S;  1HNX Q;  1PH5 A;  2YV5 A;  3CCQ A;  1VQK A;  1YNX A;  4EQ5 A;  4DR3 L;  1K8G A;  2R7F A;  4X6A H;  4A93 G;  2WB1 G;  2ZJR A;  3CCS A;  1U5K A;  1FL0 A;  3PIO A;  3GTK H;  1FVI A;  1QVF A;  3KF8 B;  4JBJ A;  4DV4 Q;  4LF4 L;  1G6P A;  2VW9 A;  4JYA Q;  4KLK A;  2ZTC A;  1HR0 L;  3TS0 A;  1UE1 A;  3S1R H;  2JA9 A;  4DV1 Q;  4GKK L;  1HH2 P;  2MO0 A;  3HOW G;  4HIK A;  1PH4 A;  3T1H Q;  2JA5 H;  3S1Q H;  2VS1 A;  5FJ8 G;  4GN3 B;  2RF4 A;  2JQO A;  4LUV A;  3U4V A;  3MEF A;  3NBH B;  1AE3 A;  4GN4 B;  4NXN L;  3J81 i;  2UXD L;  1X54 A;  4A3E H;  4JI6 L;  4DUY L;  3PO2 H;  3S1N H;  1YHB A;  4OX9 L;  2DGY A;  2VQF L;  1HZB A;  2VQE L;  3S14 H;  1YJN A;  2PI2 E;  2D0O A;  4GNX C;  5BR8 L;  3CCJ A;  2JA6 H;  4DR4 Q;  2JA8 G;  5FLX c;  4X65 L;  4Y52 H;  4BA1 I;  1SE8 A;  5C44 H;  1PHJ A;  2ALY B;  3K81 C;  4LNQ A;  2LSS A;  1RIP A;  4DV1 L;  2YTV A;  1OXT A;  2R7Z G;  4PG3 A;  3UE1 A;  4LF6 Q;  5JJK A;  1E7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...