4GOPA

Structure and conformational change of a replication protein a heterotrimer bound to ssdna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
112
structure length
108
Chain Sequence
MEKPTPLINSSMLGQYVGQTVRIVGKVHKVTGNTLLMQTSDLGNVEIAMTPDSDVSSSTFVEVTGKVSDAGSSFQANQIREFTTVDVDLTLVENVVQISAAFPNLFSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Putative uncharacterized protein
publication title Structure and conformational change of a replication protein A heterotrimer bound to ssDNA.
pubmed doi rcsb
source organism Ustilago maydis
total genus 22
structure length 108
sequence length 112
chains with identical sequence X
ec nomenclature
pdb deposition date 2012-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gopA00
4JI5Q 1PH9A 1YJNA 2UXBQ 5H1SE 5AJ3Q 4OONA 1MJEA 4POFA 2JEAI 2PI2E 2YV5A 3H0GH 2OCEA 2ATWA 2WB1E 2Z0SA 3KOJA 4UPAA 4YCUA 1KAWA 3ULJA 1MJCA 2D0PA 4X66L 4DV5L 2VQFQ 1HNXQ 3IRBA 4DAYB 4DR2Q 1A63A 3HOVH 3A74A 4JI1L 4A3EG 1TWGH 1NTGA 4OWTB 5EAYA 4DV0Q 1C0AA 3ER0A 3I7FA 2NN6G 4P75A 1HZCA 3U4VA 4R4OA 3CW2C 2ZM6Q 4ALPA 1OTCA 4B3TL 5M5XH 1VQ5A 3A0JA 1Z9FA 1YHAA 1OXTA 1GM5A 4HJ7A 2IHEA 4A3JG 2UUCQ 3TS2A 1Q81C 1L0WA 3J80c 3HOZG 3ULLA 1YI2A 3PUWA 4A3GG 3PO3H 3KYHC 3PF4A 2VUMG 1VQFA 3AFQA 3JC66 4DK3C 4BY7G 2KBNA 3JAMc 1TXYA 4LF7L 3GD7A 3U58A 1VQNA 4DV6L 1EIFA 2BH8A 3FKIG 4X66Q 4DV5Q 1IBKL 1IBLL 3KF6B 4DR1L 2I0QA 1KIXA 4X64L 4HIMA 4O2DA 1PV4A 1EIYB 3M85A 3T1HQ 2ZTEA 3J81j 4AYBE 3DM3A 1YJ9A 4BBSH 3CP0A 4YWKA 1R9TH 1AE2A 4AQYQ 4B3TQ 2GVAA 1Z47A 3KF8B 1HNZQ 5C3EG 3PGZA 1N9WA 2UUBQ 4JBJA 4HJ9A 4B3ML 4C3JH 2KCTA 1J6QA 3J80i 2PMZE 2MO1A 5C44G 3I4NG 2IT1A 2GN5A 4QGUA 5BR8L 3DLLA 4DUZL 4A3EH 5C0XG 4L5SA 1VQKA 4DR7Q 5IP7G 5IWAQ 1N34L 3MEFA 1YITA 2UXDQ 5ELOA 3PUVA 1QZHA 1SLJA 1YNXA 4GKJL 1Q1EA 4A3JH 2E2HH 4DR1Q 1VQ4A 4X64Q 4H02A 1FL0A 4JOIC 2OTLA 2NZOA 1S40A 4B3SL 3GDEA 2B63G 4A3GH 2OWOA 4JI6Q 2VUMH 2BA0A 5GADC 1PH8A 2JA7G 1FJGL 5ELNA 4BY7H 1XPRA 1WOCA 3CAMA 1SN8A 3K81C 3F2BA 3CXCA 3S14H 3S1NH 4JV5L 2JE6I 4IOAA 4LNQA 1LUZA 2RHQB 2K5VA 3CC4A 4DAMA 1KQSA 3RZOH 4KI0A 3UDIA 4O0AA 1JJGA 3CCJA 4JI4L 2I5HA 2JEBI 4J15A 2OTJA 5LMNW 4L5TA 1CKNB 1M1KC 3A5UA 3HOUG 1VQ7A 2VS1A 2UUAQ 2RHSB 3UDFA 5IE8A 3PIOA 4RG1A 1SR3A 5C3EH 2QEXA 2XGTA 4LFBL 2N8NA 4C2MH 2VQEQ 4NXML 1K3RA 3TS0A 2HIVA 1E22A 3RLNA 1YBYA 5C44H 4YY3L 1FVIA 3I4NH 4P73A 1N33L 2DGYA 4LF4L 1FJGQ 2A1AA 2ZTDA 2JA8G 2MFIA 1L1OA 5JJIA 2JJQA 4YCVA 4IPHA 5IP7H 4JI6L 3HKZG 4JI5L 2H5XA 3CCEA 1E3PA 4DKAC 1JJCB 4JI8Q 3W1BA 4DR3Q 2UXBL 3PSIA 1OXUA 1KHIA 4LFCQ 5LMUQ 1JMCA 2JA9A 2UU9Q 1IBMQ 3CD6A 2N3SA 2B63H 1Q86C 3M4PA 3M4OH 3S1QH 1XMOQ 2JA7H 3S1MH 5JJLA 5IYDG 3J81i 1KC8C 4X6AH 2AWNA 1GKHA 3EN2A 4LUZA 4LF9Q 2CWPA 2MO0A 2WAQE 2VZAA 3G48A 2VQFL 1VS0A 4APVA 4LUVA 2VL6A 1PYSB 2R6GA 1HNXL 4DK6C 4R1JA 4DUYQ 4DR2L 2GVBA 4NXMQ 1VQ9A 4LF5Q 2K4KA 4AIMA 5M3FG 4DV0L 1RL2A 3TQYA 3J7A5 4L5QA 2ZM6L 1CKOA 1Y1VG 3F2CA 4UP8A 1VQMA 1XNRQ 2Q2UA 4LF4Q 2CFMA 3HOWG 1QUQA 2B29A 3G71A 1H95A 3HOUH 2UUCL 2NN6I 5E7NA 1JB7A 2Y0SE 2K5HA 5IY0A 2AKWB 1D7QA 2HIXA 5M5WH 4DV4Q 4OWWB 1X3GA 1Y14B 3CCVA 4BBSG 1J5EQ 5LMNQ 4HJ5A 5M5YH 3M3YH 3CCSA 4B3RL 4JBKA 4A93G 4Y52H 1X65A 1HZAA 1SE8A 3L7ZC 2JA8H 4WJ4A 2JA5G 2Z6KA 2LSSA 2ASBA 1Q46A 3AQQA 4LUOA 3CF5A 3ZJYC 3T1HL 1BKBA 1BBWA 1QVFA 5HY6A 1YEZA 3FP9A 1X3FA 1E7ZA 3I2ZA 4GNXA 1UE7A 4QIWE 4P71A 1EUJA 1LM0A 1P8LA 3RLFA 3S24A 3Q8DA 4AQYL 4UP9A 4FDBA 4A3FH 4HIKA 2R93H 5IYDH 1XPOA 1HNZL 4JI3Q 4LWCA 1B8AA 1G6PA 4GOPC 3CC2A 5GQOA 2UUBL 1PH1A 1K73C 3W1GA 3UDGA 1RIPA 3BJUA 2PI2A 4L5RC 1X55A 5M3FH 4DR7L 4B3RQ 1Y1VH 3ULPA 5DLQE 5IWAL 2E8GA 2UXDL 3HOWH 4IJHA 4R4TA 5C0XI 3KJPA 3KDFA 4X65Q 3OW2A 4GN4B 2IHFA 1GD7A 4MZ9A 1YHBA 1QVCA 2F3IA 1PYBA 2E5LQ 5C4JH 1I94L 2NVQH 3NEMA 2ZJPA 2E2JH 4A3IG 4PZ6A 3NBHB 1A0IA 2E2IH 3S16H 3GTLH 1KL9A 4A93H 1VQHA 1VQGA 1VCIA 2A19A 4RMFA 2CCZA 4BY1G 2JA5H 4YCWA 1CKMA 1NY4A 1LYLA 1L1OC 4DR5Q 2KHIA 4R4QA 4R4CA 1VQDA 2K5NA 4GLVB 2IX0A 4JG2A 3K80C 2MQHA 3TEHB 1SFOH 3AEVA 3J7ZC 1PFSA 5JJKA 1XTDA 4GS3A 2UUAL 3HOYG 3PIPA 4GN5A 5JEAJ 2VQEL 1HNWQ 1KRSA 1BBUA 3KDFB 4K0KQ 1I94Q 4KHPQ 2UXCQ 3RN2A 4JBMA 3GTJH 4YHHQ 4IPCA 4GOPA 2VY3A 1HR0W 3FHWA 2BA1A 1PH4A 4DR3L 4X62Q 1N8RC 1EYGA 1UE6A 4JI8L 4DR6Q 1T9HA 1SMXA 4LFCL 2D62A 3CPFA 5LMUL 2NZHA 3UE0A 4HIDA 1WI5A 4BBRG 1BVSA 1L2FA 3T1YQ 1IBML 3F2DA 4DV7L 2UU9L 2JK8A 3HOXG 4A3IH 3J81c 3RLOA 2HHHQ 4A3MG 3PUXA 3A5ZB 2D0OA 2EIFA 4NB3A 4KHZA 3I56A 1VQPA 1XMOL 4BA2I 1HZ9A 2RF4A 2A8VA 4GKKQ 4DV2Q 1K9MC 4NPSA 4JI2Q 4LF9L 1Q82C 3GTQH 1NBWA 4DUYL 4HJAA 4BY1H 1D8LA 4LF5L 2K52A 2Z6KC 3H3VH 2JQOA 1JE5A 5IYCG 1EFWA 2ZJRA 3KLWA 2L15A 1XNRL 3GO5A 4AH6A 5FLMG 4JYAQ 2WB1G 2ID0A 1IYJB 4GNXC 1AE3A 1OXXK 4GOPB 3U4ZA 1A62A 3HOYH 2R7FA 4NXNQ 4DV4L 4DV1L 4A4IA 1V9PA 2JA6G 1NE3A 2PQAA 2IX1A 2EXDA 1J5EL 4DV7Q 5LMNL 1I50H 1K8AC 4JI0Q 1C7YA 2BH2A 1IXRA 4A3FG 1E24A 2R93G 1M90C 1PH7A 2XTIA 1V43A 2AWOA 4A3DG 1X54A 4A3LG 3M7NA 4BXXG 1P16A 3K0XA 1X6OA 4DPGA 5C0XJ 2QGQA 4OWXB 3NELA 4BBRH 4MTNA 4QY7A 1EQQA 3G4SA 1VQLA 3F1ZA 1HR0Q 1OXVA 3EBEA 4ME3A 3HOXH 4POGA 1V1QA 3F8TA 4A75A 4A3MH 2B3GA 2VNUD 4LF6Q 2Q2IA 1VQ6A 1OXSC 4OO1G 1Q1BA 3OTOL 4QJFA 1VQJA 4PG3A 4JI3L 4PZ8A 1PH5A 2F4VQ 4IFDI 1L1OB 4UP7A 1CUKA 3E9IA 5HGQA 4DV1Q 3S17H 2AMCB 3U50C 4AYBG 5IYCH 3HFZB 2CQOA 3SGIA 1C9OA 2IY5B 3LGJA 4IPDA 1XNQQ 2ZTCA 4XTCS 1W3SA 2PNHA 5FLMH 1YVCA 2KENA 4X65L 1WFQA 1GVPA 3PO2G 4JI7Q 2NVYH 4KLKA 2E5LL 2YU9H 1ASYA 2HT1A 4IFDG 3CQZH 1N32Q 4A3KH 2JA6H 1IZ6A 3W5OA 1YHQA 3S2HH 4PZ7A 5GAHC 3OTOQ 1KRTA 1TWAH 4WJ3M 5IT9c 5JEAG 3BZKA 4A3DH 1QUQB 3D0FA 4YWLA 4PMWA 4DR5L 1A8VA 1K0RA 1MIUA 5C4XH 3S1RH 1XMQQ 3GTMH 2Q2TA 3I4MG 1PVOA 4BXXH 4LF8L 2CKZB 1HZBA 3HKZE 3KF6A 2KHJA 3RNUA 3H3VI 3TREA 1VQ8A 2VW9A 1TWHH 2NVTH 1JJ2A 3B6YA 4MNOA 4Y7NH 4OX9Q 4P74A 2QA4A 1XPUA 1HNWL 4K0KL 2N78A 1ASZA 4KHPL 2UXCL 3RZDH 2C35B 1PH3A 1TWFH 1SROA 2KCMA 1KXLA 3ERSX 4YHHL 2OQKA 3CPWA 1NJIC 4QQBX 2WFWA 4DNIA 3BU2A 1I5FA 4GNXB 3UDXA 4A76A 2YTYA 3VDYA 1PHJA 1EOVA 4X62L 1U5KA 1IL2A 4A3BG 3CCQA 5GAGC 4DR6L 5GROA 3CMAA 4QL5A 1YJWA 3RR5A 3PO2H 3L2PA 3PUYA 3T1YL 4LF8Q 2HHHL 3EIVA 1WYDA 1E1TA 3NENA 3D31A 5K36G 3S15H 5IP9G 3AYHB 4DV2L 4GKKL 4JI2L 3GTOH 1I3QH 2LXJA 4JI1Q 1VQIA 3CCMA 3S2DH 2AHOB 1S3OA 4GLXA 1WJJA 1UE1A 1K8GA 1E1OA 1VQEA 3I4MH 2LXKA 4DR4L 3CC7A 1N36L 4JYAL 3PCOB 1Y1WG 1Q8KA 2R7ZG 1X3EA 4JC0A 3CCRA 1CSPA 4UY8C 2R92G 3TRZA 1HJPA 2CWAA 1NMGA 2WAQG 3K8AA 4NXNL 3CCUA 1CKNA 3PF5A 2ZJQA 1WCMG 3I4OA 4IFDJ 2DUDA 4LF7Q 3GTGH 4DV6Q 2N49A 3CCLA 4R4IA 3JAMi 4JI0L 3PV0A 4HIOA 1X9NA 1TWCH 1G51A 1U0LA 1VQOA 1IBKQ 1IBLQ 1QZGA 5FLXc 3UE1A 2NVXH 3ICEA 3HOZH 3BZCA 2F52A 3KJOA 1EWIA 2WP8J 4JCVE 1HH2P 4A3BH 2Y0SG 4EQ5A 2YYZA 2I5LX 1JT8A 1S72A 3I55A 1VQAA 2I5MX 1HR0L 4DR4Q 3GTPH 1N36Q 3FKIH 5FJ8G 4LF6L 3KFUA 5M3MG 4B3MQ 3HKSA 4LW1A 1DGSA 2K14A 5IP9H 2F4VL 1G291 3H15A 5BR8Q 4DUZQ 2OQ0A 1UE5A 1YIJA 4A3KG 4TQUS 4A3CG 4OO1I 3STBC 5IYBG 4XIGS 2MNAA 4C3HH 3M9BA 1N34Q 1W2BA 1B70B 2Q2HA 4LFAL 4GKJQ 1XNQL 4A3LH 1QVGA 1CSQA 3GTKH 1AH9A 5J3BA 1GO3E 3AFPA 3CMEA 1PA6A 4TVAB 4HJ8A 1Y1WH 4B3SQ 3H0GG 2R7ZH 1K83H 1B7YB 2R92H 5C4XG 3MXNB 4JI7L 2YTVA 4JBWA 2K50A 1VQCA 4IOCA 4C3IH 1WCMH 1FGUA 3M4QA 4IJLA 4P72A 3STBD 4DV3L 2YTXA 1N32L 1O7IA 3OYYA 3WWVA 2RCNA 3L0OA 4JV5Q 4IPGA 1I6HH 3HOVG 3E0EA 5AJ3L 2R7DA 5GAEC 1EQRA 1UEBA 1UWVA 1LTLA 1XMQL 4IO9A 3E9HA 4YWMA 1VQBA 4JI4Q 1Q7YC 1X56A 4GLAC 1Q12A 2V1CC 3RN5A 4JOIA 3G6EA 1PH6A 4BA1I 2PQAB 1XJVA 4LFAQ 4GN3B 4EX5A 4LFBQ 1MKHA 3PO3G 5FJ8H 1SRUA 3K7UC 2ALYB 5M3MH 1PH2A 2K75A 3K7AH 2HQLA 4YY3Q 4OX9L 1YZ6A 1N33Q 2FXQA 1KD1C 4DV3Q 2ES2A 4A3CH 1NMFA 3PUZA 4OXPA 5IYBH 2EQSA
chains in the Genus database with same CATH superfamily
2AQ2B 2UXBQ 5H1SE 5AJ3Q 3RZOB 1S5FD 5CBEE 2PI2E 2PQEA 3KOJA 4UPAA 3ULJA 5FLXE 1MJCA 1ZEQX 2D0PA 2F0PA 4X66L 2O2LD 1HNXQ 3IRBA 1D5ZC 3NWSA 4RGTA 2R7ZB 4ZQ3A 2MGSA 1GXDC 1TWGH 5EAYA 2ZM6Q 1OTCA 4XQNA 3KF8A 1WTWA 4B3TL 3DEOA 1V8QA 4KKTA 1TS2A 5M5XH 1OXTA 1GM5A 4HJ7A 3HOZG 2F0MA 1IW7D 2RDFA 3KYHC 1AEXA 2B63B 3EFXD 1EL0A 4QUCA 2B2TC 1EIFA 1XWEA 4JVZA 5CV5A 2I0QA 4HIMA 1T5EA 1JOQA 3M85A 3T1HQ 2AQ3B 4AYBE 1KNAA 2DJGC 3DM3A 2NTTA 3A7AB 4DU9A 3J80L 2GVAA 1HA6A 1H9JA 3PGZA 4ZUIA 4IUUA 1N9WA 3A56A 5LL6S 5M5WB 2UUBQ 4C3JH 2KCTA 4YIJA 3JAML 1G6ZA 1J6QA 4DNRB 2PMZE 2MO1A 5C44G 4QGUA 4DUZL 4A3EH 4DR7Q 4IFDH 1ET6A 2NN6H 2F0TA 5IP7G 5ELOA 4HEDA 3HKZB 4A3JH 1PMRA 1SE4A 1JOOA 2NBFA 5EJWA 1VQ4A 1FL0A 3BZDB 3LX0A 4KV6A 1S40A 4B3SL 4A3GH 3IL8A 2BA0A 2B2YA 2EY2A 2L4NA 4BY7H 2EE1A 5C3XA 3NUCA 3CXCA 3S1NH 4JV5L 1F9QA 2F0IA 1D5MC 1LUZA 2K05A 3CC4A 4DAMA 1KQSA 1GUGA 3DHQA 4XT1B 1SMYD 4HN7A 2I5HA 2JEBI 5CV8A 1JICA 1CKNB 1M1KC 3AMUA 3HOWB 1ILQA 4LFBL 1RDPD 2XNAC 2HIVA 3TS0A 3RLNA 1YBYA 4P73A 2DGYA 2A1AA 1JOKA 4QUFA 2MFIA 1B9MA 4JI6L 2F0HA 4DKAC 2EVBA 1SYCA 3NK9A 3PSIA 1HQMC 3NTHA 3CD6A 2N3SA 1CTMA 1SFOB 3S1QH 1XMOQ 3S1MH 3P20A 3EN2A 1RTOA 2LY7A 2VQFL 2XWBB 1II3A 3DUZA 1SYFA 4DUYQ 3J7A5 1XNRQ 2CFMA 1Q90A 3HOUH 3HG9A 2K5HA 1IKLA 3PMFA 4DV4Q 2B8GA 1SJED 2MHVA 1SE8A 3T16A 4WRDA 1EYAA 2JA8H 2C9OA 3GTQB 4PNYA 1Q46A 2LMCB 3AQQA 4M1UB 4P2CB 1BKBA 1BBWA 3FP9A 1X3FA 2HD3A 3I2ZA 1UE7A 4QIWE 1EUJA 1TR5A 1P8LA 3Q8DA 3T51B 4FDBA 2B2YC 3OWFA 4JI3Q 1G6PA 4UDUC 4GOPC 1UEAB 1PH1A 5A35A 3UDGA 5KYIA 1NR2A 1X3PA 3HEJA 3M4YA 1EY8A 4ZKCB 2A74C 5C0XI 3WOEA 4X65Q 4MZ9A 1RODA 4HSVA 1PYBA 4FXGC 4A3IG 3HOXB 4ZUJA 1A0IA 5D3DA 1CQFA 3S16H 3GTLH 1KL9A 5CYUA 4CHTB 4DXFA 4RMFA 4BY1G 3I70A 4IURA 4U68A 1Z6HA 4R4CA 2QDLA 1KTKA 2K5NA 1BF4A 4Q5VA 1CT1D 1JC7A 1L0XB 4N8FA 3C2PA 4NW2A 2UUAL 1TVXA 3C1FA 2KEEA 5CR3A 2VQEL 2MPMA 2UXCQ 5KNDA 1QILA 3TP7A 1HR0W 3FHWA 2BA1A 1PH4A 4N9TA 3VYUA 3VYSA 1SMXA 4LFCL 1GOZA 5LMUL 2NZHA 2R3ZA 1BVSA 1L2FA 3T1YQ 1IBML 2UU9L 1LT4D 5G3LF 1QB5D 4A3MG 1UAPA 1MGSA 2EIFA 4NB3A 3I56A 2IJ0A 1PZID 3K5NA 4GKKQ 4DV2Q 1RJTA 2NVTB 4LF9L 1WVLA 1EY5A 3HZXA 3DWPA 5ISRA 2JQOA 1EFWA 2ZJRA 2L15A 1X3QA 3D4RA 3GO5A 5FLMG 2WB1G 2IX3A 1IYJB 1O80A 1AE3A 1A62A 1GUSA 2QEJC 4A4IA 2JA6G 2PQAA 4DV7Q 4JW0A 1M8AA 1K8AC 3NWTA 1C7YA 4A3FG 1M90C 1PH7A 3S15B 2XTIA 5CV7A 3I8ZA 2XVSA 3TMEA 3H94A 1DD2A 1SNCA 1ZKOA 2JXMB 1P16A 3K0XA 2OT2A 4K2LA 3X3MA 4OWXB 2O5IC 2RA4A 4BBRH 1EQQA 3G4SA 3Q24A 3F1ZA 3VR5A 1V1QA 1ILPA 1EWCA 1CA5A 1EZ8A 4LF6Q 1OXSC 4OO1G 1Q1BA 1EY0A 1B3QA 4IFDI 2F4VQ 1L1OB 4I7ZC 5LL6X 1PFBA 3S17H 2AMCB 3HFZB 2CQOA 3MFYA 2ZTCA 2PNHA 4K5WA 3C3LA 2PZUA 1GUNA 1DJRD 2K5QA 3R2IA 1WFQA 4JI7Q 5CGKA 2NVYH 1KDAA 3CQZH 4A3KH 1S4ZA 3NE5B 4PZ7A 3OTOQ 1QUQB 3D0FA 3EA6A 4A3LH 1A8VA 5C4XH 1PVOA 1E2ZA 3J81E 1KNEA 3HKZE 4DAPA 4CJ2C 2F0JA 3QOLA 5A2QL 3OIQA 4FF1A 3TREA 2VW9A 2WIIB 2R92B 5CV6A 2J4XA 3B6YA 4P74A 5D14A 1HNWL 4K0KL 4KHPL 2C35B 1KXLA 3ERSX 3W3AA 4HAEA 5IT9L 3BYYB 3CPWA 4QQBX 4CDFC 1I6HB 1NAPA 1TS5A 4KK7A 4A76A 2YTYA 3E3XA 4X62L 2F0OA 3CCQA 4ODGA 2KVMA 3BS1A 4DR6L 4DFAA 3PO2H 4H0LC 4O42A 1LTID 4IUTA 3EIVA 2QCPX 1SNPA 4PQXA 3MVVA 2VB3X 5J22A 4IUVA 2EY6A 4KJOA 2Z9HA 5M3MB 3GTOH 3CCMA 5IGBA 1S3OA 5JEAH 1HA5A 1WJJA 3TZDA 1IYVA 1HXYD 4A3KB 4RCOA 5I9PA 3EQLC 3Q22A 1N36L 4JYAL 3PCOB 4FNFA 1TU2B 1STAA 1Q8KA 2TMPA 5EQ0A 1EU3A 3QWNA 3TRZA 2BCOA 1HJPA 2CWAA 5C4XB 1SJHD 2ZJQA 1CKNA 3PF5A 3I4OA 3MWYW 4HSPA 5M9OA 3MAQA 4DV6Q 4CDEC 2F3VA 3ZYYX 2NVXH 3HOZH 3KJOA 4IALA 4JCVE 2WP8J 3TDQA 3VYRA 3IAYA 1DOLA 4KY6A 2YYZA 1JT8A 2NUCA 4DR4Q 1STNA 2O5JC 4B9XA 3PO3B 3MXPA 1EY9A 1YNJC 3H15A 5BR8Q 1W6JA 2XN9C 4A3CG 5FLXL 1WTRA 3K5LA 4OL7A 2NZ1D 2SOBA 2KUMA 2Q2HA 4KTAA 4C1NK 5J3BA 4DNTB 2EY1A 3AFPA 4G7ZC 1K0SA 1Y1WH 4N8X1 1CA6A 1MSGA 1B7YB 3MXNB 1GUWA 2BE5C 2KQ3A 4DV3L 1FGUA 2FHTA 3I91A 3OYYA 2RCNA 1E2WA 3HOVG 3E0EA 1ENFA 5AJ3L 2OF1A 5GAEC 1UEBA 1IYUA 5BN4A 1UWVA 1ZYRC 3E9HA 4YWMA 1Q7YC 1PTOB 2K01A 2MJ8A 1F2LA 4QMGA 2E2HB 3BDCA 4LFAQ 4GN3B 3M7GA 4DK1A 4F87A 3HOZB 2NVXB 2ALYB 2K75A 2HQLA 2M00A 4RFBA 3NP8A 1KD1C 3PUZA 3CPFA 4UHVA 4IUPA 4JI5Q 2F0QA 5FOBB 3D8GA 5LHY1 3H0GH 2SNSA 2OCEA 4YCUA 4DF7A 4C2MB 4CJ0B 1ESFA 5C44B 1NTGA 4OWTB 4DV0Q 3ER0A 3I7FA 3U4VA 1HZCA 1VDZA 1F9PA 1C48A 3OMGA 2G9HD 1FNWA 4ILWA 1YHAA 5JPNC 3VYTA 2UUCQ 2PW5A 1G2SA 3J80c 2Z1CA 4FF3A 1WD0A 1YI2A 1FGBD 5CV4A 3PF4A 4NKLA 3JC66 4S3SA 3JAMc 2LKVA 4LF7L 1VQNA 3G6JB 1D5XC 2B2VC 4DV5Q 1IBKL 1IBLL 4RHSA 3KF6B 1PV4A 1V1OA 1EIYB 2ZTEA 3O13A 1MSHA 4LK1C 3J81j 3S9WA 2HQEA 1R9TH 1AE2A 5T1IA 4RKBA 5C3EG 4L8JA 4JBJA 3D4WA 3KLSX 4HJ9A 1TKWB 4K14A 5CORA 5EBDA 2PZTA 5IGFA 3I4NG 3H0GB 2GN5A 3QIAA 3M3YB 3NSWA 4L5SA 4C3IG 4UAIA 5IWAQ 1N34L 1E0BA 1WTOA 5AFWA 1QZHA 1SLJA 2PPBC 5C3WA 3TSSA 4DR1Q 4E6IA 4ME5A 4X64Q 3I4LA 2VUMH 5GADC 1PFMA 2JA7G 4KJNA 5ELNA 3TP8A 1WOCA 3CAMA 3K81C 2M9VA 1ET9A 1EWHA 1O7ZA 1SNOA 2X6GA 4L63B 3RZOH 1ICWA 3R2TA 4KI0A 3UDIA 4O0AA 1CHPD 4JI4L 4I65A 4L5TA 2L1BA 1HPCA 3A5UA 2RHSB 2DN8A 5IE8A 3P1HA 2F4IA 3PIOA 1VMCA 1SR3A 4B08A 1SNQA 5C4JB 2FJ2A 1E22A 3MEHA 1YNJD 3SVMA 4YY3L 4OIKA 1R9TB 3RMHA 2D2CC 1FJGQ 5C0XH 2ZTDA 1L1OA 5JJIA 4NDXA 2M2LA 1PZJD 4G4KA 1F9SA 3CCEA 4JI8Q 1I4PA 1EY4A 1OXUA 2JA9A 3KK7A 2B63H 2FMCA 3ND9A 2BE5D 5JJLA 5IYDG 1KC8C 5DNFA 4EVOA 1GKHA 2MO0A 1VS0A 4APVA 4KY5A 2VL6A 4LUVA 4DR2L 2K5WA 3BYTB 5M3FG 2J0TD 1RL2A 3GTJB 1Y1VG 4FYDA 3F2CA 2Q2UA 1ZYRD 1CQVA 1F2YA 1TQOA 2P5ZX 1QUQA 1H95A 5E7NA 2Y0SE 1KABA 2JSOA 2PYKA 5M5WH 4OWWB 1Y14B 5LMNQ 4HJ5A 4FF2A 4JBKA 4A93G 2R61A 4Y52H 1HZAA 2JA5G 1ONLA 2LSSA 1MD2D 4BY1B 2RVLA 2I07B 2RBMA 1K8OA 1QVFA 1YEZA 4P71A 4Z9CB 4AQYL 3S24A 4A3FH 1XPOA 1HNZL 4LWCA 1B8AA 1CZWA 5GQOA 3N6RA 1G91A 3BJUA 1VF7A 2PI2A 2WACA 5EPJA 3J7YW 4L5RC 3QO2A 4N9PA 1XXGA 2G9DA 3I72A 4B3RQ 3ULPA 5DLQE 2KA7A 2UXDL 3HOWH 4IJHA 2KHSA 3NXWA 3KJPA 1BQQT 4GN4B 2IHFA 3QOJA 1QVCA 2B8FA 1O7YA 3H91A 4F8MA 4A3MB 1M4VA 2L55A 5E4WC 1VQHA 1VQGA 5IGDA 2PW7A 1LYLA 1L1OC 2SNMA 4DR5Q 3L9AX 2BOSA 2ENBA 5EKLA 2B2UA 5G3LD 3K80C 1SFOH 4CDDC 3AEVA 1XTDA 1CK1A 3HOYG 5I2XA 2L9HA 1TS4A 4R8IA 2SDFA 1KRSA 3KDFB 1EEFD 3H6MA 2JA6B 2EOTA 2A6HC 4JBMA 4LJZC 4YHHQ 1NCVA 3S2HB 4A3FB 4GOPA 3U9OA 1F9RA 4DR3L 4TSSA 3ERQA 3GTMB 2H1EA 2D62A 3RUZA 4DV7L 2EYOA 3Q0AA 3OHXC 3PUXA 2H4OA 1VQPA 4BA2I 3T53B 1HZ9A 2RF4A 2A8VA 2K7VA 3CRKC 3MXNA 4Y7NB 3D6WA 4Q0FA 3GTQH 5I4DA 4HJAA 4OEMB 1D8LA 4LF5L 1SYDA 3KLWA 3IFDA 4AH6A 5DM73 2CH4W 2K1BA 3DWQA 1OXXK 3J81L 1A3UA 1V9PA 2IX1A 1HRJA 2EXDA 1J5EL 2EPBA 1I50H 1UUPA 1IXRA 1E24A 1V43A 4A3DG 1A15A 1X54A 4M8AA 2RKSA 3M7NA 4BXXG 4DPGA 1X6OA 4KMUC 1X32A 1OXVA 4ME3A 3HOXH 4HR7B 2VNUD 1YNNC 2Q2IA 1VQ6A 3OTOL 1XYIA 4QJFA 1VQJA 1FD7D 1K8MA 1NUCA 4BWGB 1CUKA 4XDXA 1KAAA 2JN4A 1C4QA 2IWHA 4WORA 5IYCH 1C9OA 1S5ED 1B4OA 2B2UC 3URYA 2FMMA 2ZXOA 5HGTA 1WTPA 1HFNA 4KLKA 1EZ6A 2E5LL 2HT1A 1ASYA 4NP5A 1I4HA 4K6DA 3GTPB 5FO9B 3W5OA 1YHQA 4J6HA 2E2DC 2PNRC 4WJ3M 5IT9c 1Y8OB 4YWLA 1SSOA 1D1IA 3I3CA 1DXMA 1QWYA 4IUQA 4H44C 3I4MG 1I50B 3KF6A 5BN5A 2WV6D 3GTKB 3U9SA 1RF2D 1VQ8A 1DOKA 2NVTH 4MNOA 4OX9Q 1SBBB 2MUYA 1JR0D 4XYOA 2N78A 1PH3A 1TWFH 1SROA 5CC4A 2ICIA 3BU2A 1SEBD 2K6AA 4GNXB 2IPKD 5NUCA 1F2ZA 3SK6A 2O4XA 3PIP3 4A3BG 3CMAA 1YJWA 1PYWD 3L2PA 4LF8Q 3A8JE 3MA2B 2HHHL 1E1TA 3ND8A 5FO8B 5K36G 2QILA 3S15H 2IW3A 4JI2L 3K7AB 4GLXA 3J7AV 1K8GA 1B44D 2CVRA 4FF4A 2LXKA 4DR4L 3W2DA 5CMDA 5BN3A 4RGMA 2KOLA 2R7ZG 4JC0A 3CCRA 1S5BD 1NMGA 2WAQG 4NXNL 4WFN3 3CCUA 4ZK9B 1WCMG 3HRZC 1B3AA 2F1MA 2AUKA 2N49A 3JAMi 4JI0L 2A6HD 3MZ5A 5FLXc 3UE1A 3BZCA 1EWIA 4G57A 4HMIA 4EQ5A 2F0UA 1RTNA 1TWFB 1S72A 1VQAA 1HR0L 1VMPA 5FJ8G 2K03A 4MIUA 2ZXPA 1MI2A 3MFGA 5IP9H 1DGSA 1FNUA 4DUZQ 1Q3LA 2OQ0A 1A3TA 3Q6SA 4OO1I 3DWAA 4TQUS 5IYBG 1GHJA 3OOCA 1B9NA 1W2BA 1B70B 4LFAL 4PV1C 1AH9A 1XNQL 4TVAB 4HJ8A 4B3SQ 4V190 2R92H 5JAVA 3NQIA 2K50A 4FP5D 2KCCA 4C3IH 1N32L 3M4QA 3STBD 2Z6BA 1TS3A 2GA4B 4JV5Q 4IPGA 1I6HH 2R7DA 1NR4A 3K59A 1STBA 3L3OC 1EYCA 1LTLA 4LAAA 4RCNA 1XMQL 3MC0B 1ICFB 4ZKBB 1X56A 4JOIA 3G6EA 1LABA 1XJVA 4LFBQ 2JYOA 4IN3A 1YNND 4JK1C 5M3MH 3A55A 4PMBA 3IFTA 3V05A 1NMFA 5JPMC 4JI6Q 1PH9A 1YJNA 3TBIB 1WTQA 2JEAI 1EIHA 1BCPB 3C1EA 3CU7A 2QF7A 1V1PB 3Q23A 2ATWA 2WB1E 1HTPA 1U4MA 4DV5L 2VQFQ 5IODA 5C3EB 4C3JG 3LNNA 1A63A 1SYGA 3A74A 4JI1L 2F3WA 2NWGA 4A3EG 3LWEA 3I4NB 3DEPA 4IFDG 2NN6G 5EPLA 2D9UA 3CW2C 4C3IB 4R9WA 1VQ5A 1Z9FA 3FMCA 2F0LA 4A3JG 2IHEA 3TS2A 2BDNA 3NTIA 1Q81C 1HUMA 4ID6A 3ULLA 3DXJC 5I6YA 4A3GG 3PO3H 1CI3M 2DY7A 2N55A 1ESRA 4G7HC 3M4OB 4BY7G 1TXYA 2Y0SB 2JA7B 3U58A 4OHJA 2BDOA 2BH8A 3F2UA 2AQ1B 4DR1L 4X64L 1ENCA 4O2DA 3MHBA 2L0CA 5T1GA 3SK4A 4FXDA 1YJ9A 1EU4A 1EOTA 4YWKA 4C3HG 3OMCA 3BVGA 1EYDA 3KF8B 1PTOD 2HDLA 3BDOA 1BBXC 4B3ML 2B2WA 4IZ8A 5C6AA 1E2VA 2IT1A 3DLLA 5M5YB 2F0KA 4C1NI 1VQKA 3QR8A 3DM1A 4RGNA 4GZYC 1PTOH 2EZVA 3FRPB 3SXHA 5TSSA 4GKJL 1YNXA 1Q1EA 4OGQC 2E2HH 4MHEA 2E75C 4JOIC 2OTLA 2E76C 2OWOA 1PH8A 1FJGL 3A7LA 1XPRA 3WOFA 3G7LA 1LT5D 5E4XA 5M3FB 1JJGA 1Y1VB 2B2VA 3CCJA 4J15A 2OTJA 5LMNW 3HOUG 1B53A 1VQ7A 2UUAQ 1JQYD 4RG1A 1RCVD 1AFPA 2QEXA 2XGTA 1FNVA 2PCFB 2N8NA 5DEHA 4C2MH 2VQEQ 2NVQB 1K3RA 2E2JB 2VB2X 5C44H 1FVIA 1N33L 1BCPF 3FPPA 2E2IB 1I4GA 4A93B 2JA8G 1LTGD 2JP1A 2AUJD 5IP7H 4IPHA 2JA5B 1E3PA 3QJYA 1JJCB 1GUTA 2UXBL 4LFCQ 5LMUQ 4KD3A 1JMCA 1LV9A 2HCIA 4MN3A 2UU9Q 1IBMQ 4QB4A 1Q86C 4OIJA 1G8ZD 1QG7A 4X3UA 4I7AA 1MBYA 4LUZA 4LF9Q 1ENAA 2VZAA 3G48A 1T5XD 3HS0C 1HNXL 2R6GA 2GVBA 4NXMQ 4AIMA 3TQYA 2Q8IB 4L5QA 2ZM6L 4UP8A 4LF4Q 4X3KA 2B29A 3G71A 4QCLA 1AZPA 1JB7A 1D7QA 3SK5A 2HIXA 3EJIA 1X3GA 4BBSG 2B2WC 3M3YH 4B3RL 2EYMA 1X65A 1I6VC 4EGVA 2Z6KA 5DM63 5IGCA 3VA5A 3CF5A 4HCSA 1A2TA 3OW7A 3ZJYC 3T1HL 5HY6A 1E7ZA 4X3SA 4GNXA 3RLFA 4UP9A 3E0JA 4HIKA 3HOYB 1TY2A 4DK0A 2UUBL 2SEBD 1X55A 5EGTA 4DR7L 1EQVA 1LTRD 4HCEA 2HUGA 2E8GA 4X3TA 4R4TA 3OW2A 5KNCA 1YHBA 5JOBA 5C4JH 4EQPA 3NEMA 2ZJPA 1JWMD 3NBHB 3TP5A 5JVH3 2Q8TA 2A68D 3PQIA 1VCIA 4YCWA 2DNEA 2KHIA 3BG3A 1DYQA 3ONAB 2IX0A 4JG2A 3TEHB 4ZCKA 5JJKA 1PFSA 1LLRD 3D3RA 3E5SA 4XXEA 4GS3A 4GN5A 1DOMA 2YU9B 1HNWQ 4K0KQ 1I94Q 4KHPQ 1SDFA 3GTJH 4IPCA 5KIXA 2VY3A 2V4DA 3NTKA 1PTOF 1TWAB 3K58A 4A3DB 4X62Q 4H7BA 1UE6A 3I90A 1SE2A 4DR6Q 1T9HA 4WJWA 1HTLD 1Z7TA 1WI5A 4BBRG 4DA2A 5FO7B 1STEA 2JK8A 4A3IH 3J81c 4KHVA 3A5ZB 1Y8PB 1XMOL 3T4AC 3GP7A 1K9MC 4NPSA 3J7AF 1NBWA 4DUYL 4BY1H 5E1FA 2KECA 2K52A 3RZDB 2Z6KC 1JE5A 4J1MA 4ULLA 1XNRL 1DM0B 4LMQD 3KLSA 4JYAQ 2XRSD 2ID0A 3SK8A 4GNXC 3GV6A 2F0VA 3U4ZA 5F2DA 2R7FA 1O78A 4K6LA 4DV4L 1IL8A 2HDMA 2KEDA 2BH2A 1BDOA 2R93G 1STYA 1I3QB 2AWOA 4IUNA 3S2DB 4A3LG 3FPUB 4ZLTF 1FR3A 1FYCA 5C0XJ 3I4MB 2QGQA 3NELA 4MTNA 4QY7A 2LFNA 3EBEA 1D2BA 4OELB 1JE4A 4A75A 4A3MH 1LT3D 2B3GA 2C5CA 5KEEA 4JI3L 1V1PA 1PH5A 2L12A 5HURA 4UP7A 4ZAIA 3E9IA 5HGQA 4DV1Q 1XTCD 3GTGB 4A3IB 1TWCB 3U50C 4AYBG 2IY5B 3SGIA 3LGJA 4IPDA 4XTCS 1LTAD 2DJFC 5FLMH 3QB3A 4X65L 1GVPA 1TT2A 3PO2G 2JA6H 1IZ6A 1Y8NB 1B1ZA 3S2HH 4RA8A 4RWSC 5GAHC 1LO5D 2K32A 2CW0D 1CHQD 1KRTA 5JEAG 4XQQA 3BZKA 1MIUA 1K0RA 3S1RH 1BNZA 1PRTB 3GTMH 2Q2TA 2EYFA 4LF8L 3EVQA 1QJOA 5I6WA 2KHJA 4MTKA 4K5VA 5JJZA 3H3VI 2RSNA 1EFID 4PMCA 4OO1H 1K83B 5L37A 1JJ2A 4JPBW 1JORA 3SHLA 4Y7NH 3R8BA 2WAQB 1XPUA 1WCMB 2UXCL 4K8IA 5CV9A 3TN2A 1QE6A 5EKIA 1NJIC 2WFWA 4DNIA 2HCCA 1I5FA 3VDYA 1PHJA 1C8CA 1EOVA 1U5KA 1IL2A 2Z4IA 3RR5A 1B2TA 4J8QA 3PUYA 3T1YL 5JVG3 3D31A 2WB1B 4GKKL 4DV2L 5I9OA 2LXJA 2AHOB 2F0FA 2DNCA 2WKCA 3SR1A 1UE1A 3K6OA 1AW7A 1U4RA 1RKNA 1Y1WG 1U9RA 3OPOA 2I46A 4UY8C 1CSPA 3K0YA 3TP6A 3S1RB 3K8AA 3V2TA 1BCPC 4IFDJ 2DUDA 4LF7Q 2EJFC 3HGBA 4KY7A 1VQOA 1IBKQ 1IBLQ 1QZGA 3ICEA 1TWGB 1HH2P 1S5DD 4KKUA 5M5XB 2I5LX 4FO2A 3I55A 2I5MX 2CHBD 3T13A 3GTPH 2EYPA 2EYJA 4LF6L 3VR6A 2F03A 3KFUA 3HKSA 1EEID 1U4LA 2K14A 2F4VL 1UE5A 2EYHA 1MHWC 1YIJA 3STBC 2MNAA 4C3HH 3M9BA 4KN7C 1N34Q 2QDBA 1QVGA 3GTKH 1PA6A 3KBGA 3H0GG 4ABNA 2PO4A 4JI7L 2YTVA 1VQCA 1PRTF 5DAUA 4C56C 2YTXA 5CBAE 1O7IA 3WWVA 3L0OA 2TSSA 4K5XA 4C3JB 2DY8A 4A3EB 2K28A 3LWUA 1SE3A 4EQOA 4JI4Q 1Q12A 4KN4C 3RN5A 1GUOA 4A3JB 2XIWA 1I4XA 1MKHA 1CFMA 1BO0A 1SRUA 3K7UC 4A3GB 3K7AH 1HQRD 5COYA 4YY3Q 1SAPA 4L6TB 4BY7B 2F0WA 2ES2A 4A3CH 3E6ZX 4OXPA 3ITPA 2A5HA 3S1NB 2EQSA 1H9MA 1EQTA 5C5MA 3NQTA 4XYQA 4OONA 1MJEA 4POFA 2A69C 1JCKB 2YV5A 3SEBA 2Z0SA 1LTTD 3RD4A 4C3HB 4CJ1B 1AP0A 1KAWA 3OWEB 5E3FA 3GQBA 5KRUA 5ELBA 3EROA 4DAYB 4DR2Q 1D6EC 3HOVH 4CDCC 3NBHA 1C0AA 4P75A 1HHVA 4R4OA 5C4HA 4ALPA 3A0JA 2EDGA 1L0WA 3BVZA 1O7LA 2EYLA 3PUWA 1BR9A 2VUMG 1VQFA 1KDCA 3AFQA 4DK3C 1OO9B 2KBNA 3S1QB 3S1MB 2NYZD 3GD7A 4RH6A 4DV6L 4HMJA 1PTOC 2X6LA 4BS9A 3FKIG 4X66Q 3KLRA 4DXGA 1KIXA 3OIPA 4ZRZA 2KCNA 3D4DA 1WTHA 1GJXA 2NTSA 1WTXA 4BBSH 3CP0A 5ELDA 2F0GA 1TIID 4AQYQ 4B3TQ 1Z47A 3HOUB 1HNZQ 3FEWX 4KKSA 1KLUD 3J80i 3VR4A 4TKOB 5BR8L 1STGA 5C0XG 1HUNA 1GHKA 2JA8B 1J9OA 3MEFA 1YITA 2UXDQ 3PUVA 3R3OA 3K57A 3X3NA 4H02A 3HOVB 2NZOA 3GDEA 2B63G 4RHRA 3H3VC 4QF4A 1BCPD 1SN8A 2F0EA 3F2BA 3S14H 2JE6I 1W6KA 1AZQA 4IOAA 4LNQA 3GV3A 2RHQB 2K5VA 2X69A 1K28A 3H09A 3HP3A 4U673 2VS1A 2MP1A 3UDFA 4F7XA 5C3EH 3SE0A 4NXML 3CHBD 4BBSB 3I4NH 1EY6A 4LF4L 3S16B 3GTLB 3J80E 2JJQA 4YCVA 2K33A 2F0SA 2ZT9C 3HKZG 4JI5L 2H5XA 4DR3Q 3W1BA 4V0BA 3C46A 4FVMA 2RDGA 1KHIA 2XSCA 3JAME 1H9SB 2WINB 3NBIA 1KLGD 3M4PA 3M4OH 5D3IB 2JA7H 3J81i 4X6AH 2AWNA 2CWPA 2WAQE 1HFGA 1JWSD 1PYSB 3WDNA 4DK6C 4R1JA 3TZUA 5KYLA 1VQ9A 4LF5Q 2K4KA 4DV0L 1CKOA 4DAVA 1VQMA 2OXPA 2WKDA 3HOWG 4EQNA 3S14B 3I73A 1LTSD 2NN6I 2UUCL 5IY0A 1A6XA 2AKWB 1Q8IA 5C4ZA 1R4PB 2A6EC 3CCVA 1J5EQ 3A54A 1PZKD 5M5YH 3P7JA 3CCSA 3DMUA 1J8IA 1XX8A 3L7ZC 4O1NA 4WJ4A 4XT3B 1SNMA 2ASBA 1D1KA 4LUOA 4K8JA 2A69D 1H9KA 2D5DA 1LM0A 4DGZA 3CRLC 2R93H 4K2KA 5IYDH 2KJXA 4ZYSA 3NHHA 1K73C 3W1GA 2Z4HA 1RIPA 1JWUD 1QNUA 5M3FH 2K5DA 1R4QB 1Y1VH 2A68C 2VXWA 3N52A 3OSOA 5IWAL 1DONA 3A8KE 4KD4A 3KDFA 1GD7A 3BDLA 5FK9C 2F3IA 2E5LQ 1I94L 2NVQH 4BBRB 2E2JH 4PZ6A 2QW7A 1JB3A 1STHA 2PZWA 4H13C 2E2IH 4A93H 1G2TA 2CH4A 2A19A 2CCZA 2JA5H 1CKMA 1NY4A 4R4QA 5IOCA 1VQDA 2K04A 2OEOA 3S17B 1DZ1A 4GLVB 2F0NA 1F77A 2MQHA 2XWJB 1ZXTA 4B9WA 4DN4M 3J7ZC 3PIPA 2NVYB 5JEAJ 4CKBA 3CQZB 1BBUA 1EIGA 1Y69U 3RN2A 3K5MA 5IIFA 1EY7A 3MTSA 2R93B 1L0YB 1WD1A 1I4QA 4NMZA 4CKCA 3FDTA 5KGUA 3PIO3 4JI8L 5EBCA 1N8RC 1EYGA 2Z8LA 4HIDA 3UE0A 5ELEA 1PRTC 3F2DA 3HOXG 1F2MA 2HHHQ 3RLOA 2D0OA 4KHZA 1DCZA 4JI2Q 1Q82C 1I4RA 1UNSA 3H3VH 5IYCG 2L5TA 4AYBB 1SNDA 4RKLA 3AB9A 4GOPB 5KNBA 5FKAC 1CZGA 4CKEA 3HOYH 4NXNQ 3PO2B 4DV1L 1NE3A 5J39A 1A3VA 1K3BC 4CBVA 5LMNL 4JI0Q 2PMZB 3NPPA 3GTOB 2RQXA 3QG1A 2RSOA 3IKJA 3SDZA 1RD9D 3A8IE 1VQLA 1HR0Q 4POGA 4R8NA 3F8TA 1PLFA 1LTBD 4RAUC 4PG3A 4PZ8A 5IGGA 2IL8A 4DAYA 2LS01 1XNQQ 1WTVA 1W3SA 1YVCA 2CW0C 2KENA 2XRQD 5EKKA 1A2UA 5J1ZA 2YU9H 1LT6D 2A6ED 1N32Q 1H9RA 5EPKA 3UI2A 1TWAH 3K5OA 4F88A 1HCZA 4A3DH 4PMWA 3T56B 4DR5L 1XMQQ 1LACA 1PFNA 4BXXH 2CKZB 1HZBA 2ICEC 5D65A 4CGYB 1SYBA 2FFKB 3RNUA 3KUPA 2B39A 1IW7C 1Y1WB 2EY5A 1TWHH 3R93A 4HTHA 1VF5C 2QA4A 3P75A 1ASZA 2A73B 3RZDH 2KCMA 4IQZA 1TY0A 1QOHA 2OQKA 4YHHL 1U4PA 1S5CD 4FXKC 2CQAA 3D6CA 4XQJA 3UDXA 5GAGC 5GROA 4QL5A 1WYDA 3NENA 2FINB 1NNXA 1AN8A 3FVQA 5IP9G 3AYHB 2QKIC 1I3QH 4JI1Q 3S2DH 1VQIA 2EXZA 3VR3A 1BOSA 1B50A 1E1OA 1VQEA 3I4MH 3BVMA 3CC7A 4QIWB 4TRDA 1PXUA 1X3EA 2R92G 2Q8RE 3GTGH 3CCLA 2NB0A 4R4IA 3PV0A 4HIOA 1X9NA 1TWCH 1G51A 1U0LA 5A2QE 2RCFA 3MXUA 1TWHB 2F52A 5I2YA 1PDQA 3VR2A 1SMYC 5K5PA 1ML0D 4A3BH 2Y0SG 3AU7A 2RDHA 1BUVT 1PRTD 2F0DA 1N36Q 3FKIH 5IT9E 5K36H 5M3MG 4B3MQ 1H9SA 4LW1A 1G291 2B2TA 2ZXRA 4A3KG 2EJMA 2G5DA 4XIGS 4GKJQ 1CSQA 5IGEA 1QNKA 2N88A 1GO3E 1SYEA 3CMEA 3KBXA 2R7ZH 1K83H 5C4XG 4JBWA 4IOCA 3CC2A 1WCMH 4IJLA 4P72A 2L11A 1KDBA 3V96A 1NSNS 1EQRA 3VA7A 2EJGC 4IO9A 1VQBA 5ELCA 3CKIB 1BXTA 5ELFA 4GLAC 2V1CC 1IKMA 1PH6A 4G7OC 4BA1I 2PQAB 1RHPA 4EX5A 3PO3G 5FJ8H 2J7ZA 1SXTA 1PH2A 2VUMB 5C5LA 4A3BB 4OX9L 1YZ6A 2E74C 1N33Q 1CM9A 1QCBD 2FXQA 3MXGA 4DV3Q 1IHZA 5IYBH 4RGOS 3FKIB
chains in the Genus database with same CATH topology
4JI5Q 1PH9A 1YJNA 2UXBQ 5H1SE 5AJ3Q 4OONA 1MJEA 4POFA 2JEAI 2PI2E 2YV5A 3H0GH 2OCEA 2ATWA 2WB1E 2Z0SA 3KOJA 4UPAA 4YCUA 1KAWA 3ULJA 1MJCA 2D0PA 4X66L 4DV5L 2VQFQ 1HNXQ 3IRBA 4DAYB 4DR2Q 1A63A 3HOVH 3A74A 4JI1L 4A3EG 1TWGH 1NTGA 4OWTB 5EAYA 4DV0Q 1C0AA 3ER0A 3I7FA 2NN6G 4P75A 1HZCA 3U4VA 4R4OA 3CW2C 2ZM6Q 4ALPA 1OTCA 4B3TL 5M5XH 1VQ5A 3A0JA 1Z9FA 1YHAA 1OXTA 1GM5A 4HJ7A 2IHEA 4A3JG 2UUCQ 3TS2A 1Q81C 1L0WA 3J80c 3HOZG 3ULLA 1YI2A 3PUWA 4A3GG 3PO3H 3KYHC 3PF4A 2VUMG 1VQFA 3AFQA 3JC66 4DK3C 4BY7G 2KBNA 3JAMc 1TXYA 4LF7L 3GD7A 3U58A 1VQNA 4DV6L 1EIFA 2BH8A 3FKIG 4X66Q 4DV5Q 1IBKL 1IBLL 3KF6B 4DR1L 2I0QA 1KIXA 4X64L 4HIMA 4O2DA 1PV4A 1EIYB 3M85A 3T1HQ 2ZTEA 3J81j 4AYBE 3DM3A 1YJ9A 4BBSH 3CP0A 4YWKA 1R9TH 1AE2A 4AQYQ 4B3TQ 2GVAA 1Z47A 3KF8B 1HNZQ 5C3EG 3PGZA 1N9WA 2UUBQ 4JBJA 4HJ9A 4B3ML 4C3JH 2KCTA 1J6QA 3J80i 2PMZE 2MO1A 5C44G 3I4NG 2IT1A 2GN5A 4QGUA 5BR8L 3DLLA 4DUZL 4A3EH 5C0XG 4L5SA 1VQKA 4DR7Q 5IP7G 5IWAQ 1N34L 3MEFA 1YITA 2UXDQ 5ELOA 3PUVA 1QZHA 1SLJA 1YNXA 4GKJL 1Q1EA 4A3JH 2E2HH 4DR1Q 1VQ4A 4X64Q 4H02A 1FL0A 4JOIC 2OTLA 2NZOA 1S40A 4B3SL 3GDEA 2B63G 4A3GH 2OWOA 4JI6Q 2VUMH 2BA0A 5GADC 1PH8A 2JA7G 1FJGL 5ELNA 4BY7H 1XPRA 1WOCA 3CAMA 1SN8A 3K81C 3F2BA 3CXCA 3S14H 3S1NH 4JV5L 2JE6I 4IOAA 4LNQA 1LUZA 2RHQB 2K5VA 3CC4A 4DAMA 1KQSA 3RZOH 4KI0A 3UDIA 4O0AA 1JJGA 3CCJA 4JI4L 2I5HA 2JEBI 4J15A 2OTJA 5LMNW 4L5TA 1CKNB 1M1KC 3A5UA 3HOUG 1VQ7A 2VS1A 2UUAQ 2RHSB 3UDFA 5IE8A 3PIOA 4RG1A 1SR3A 5C3EH 2QEXA 2XGTA 4LFBL 2N8NA 4C2MH 2VQEQ 4NXML 1K3RA 3TS0A 2HIVA 1E22A 3RLNA 1YBYA 5C44H 4YY3L 1FVIA 3I4NH 4P73A 1N33L 2DGYA 4LF4L 1FJGQ 2A1AA 2ZTDA 2JA8G 2MFIA 1L1OA 5JJIA 2JJQA 4YCVA 4IPHA 5IP7H 4JI6L 3HKZG 4JI5L 2H5XA 3CCEA 1E3PA 4DKAC 1JJCB 4JI8Q 3W1BA 4DR3Q 2UXBL 3PSIA 1OXUA 1KHIA 4LFCQ 5LMUQ 1JMCA 2JA9A 2UU9Q 1IBMQ 3CD6A 2N3SA 2B63H 1Q86C 3M4PA 3M4OH 3S1QH 1XMOQ 2JA7H 3S1MH 5JJLA 5IYDG 3J81i 1KC8C 4X6AH 2AWNA 1GKHA 3EN2A 4LUZA 4LF9Q 2CWPA 2MO0A 2WAQE 2VZAA 3G48A 2VQFL 1VS0A 4APVA 4LUVA 2VL6A 1PYSB 2R6GA 1HNXL 4DK6C 4R1JA 4DUYQ 4DR2L 2GVBA 4NXMQ 1VQ9A 4LF5Q 2K4KA 4AIMA 5M3FG 4DV0L 1RL2A 3TQYA 3J7A5 4L5QA 2ZM6L 1CKOA 1Y1VG 3F2CA 4UP8A 1VQMA 1XNRQ 2Q2UA 4LF4Q 2CFMA 3HOWG 1QUQA 2B29A 3G71A 1H95A 3HOUH 2UUCL 2NN6I 5E7NA 1JB7A 2Y0SE 2K5HA 5IY0A 2AKWB 1D7QA 2HIXA 5M5WH 4DV4Q 4OWWB 1X3GA 1Y14B 3CCVA 4BBSG 1J5EQ 5LMNQ 4HJ5A 5M5YH 3M3YH 3CCSA 4B3RL 4JBKA 4A93G 4Y52H 1X65A 1HZAA 1SE8A 3L7ZC 2JA8H 4WJ4A 2JA5G 2Z6KA 2LSSA 2ASBA 1Q46A 3AQQA 4LUOA 3CF5A 3ZJYC 3T1HL 1BKBA 1BBWA 1QVFA 5HY6A 1YEZA 3FP9A 1X3FA 1E7ZA 3I2ZA 4GNXA 1UE7A 4QIWE 4P71A 1EUJA 1LM0A 1P8LA 3RLFA 3S24A 3Q8DA 4AQYL 4UP9A 4FDBA 4A3FH 4HIKA 2R93H 5IYDH 1XPOA 1HNZL 4JI3Q 4LWCA 1B8AA 1G6PA 4GOPC 3CC2A 5GQOA 2UUBL 1PH1A 1K73C 3W1GA 3UDGA 1RIPA 3BJUA 2PI2A 4L5RC 1X55A 5M3FH 4DR7L 4B3RQ 1Y1VH 3ULPA 5DLQE 5IWAL 2E8GA 2UXDL 3HOWH 4IJHA 4R4TA 5C0XI 3KJPA 3KDFA 4X65Q 3OW2A 4GN4B 2IHFA 1GD7A 4MZ9A 1YHBA 1QVCA 2F3IA 1PYBA 2E5LQ 5C4JH 1I94L 2NVQH 3NEMA 2ZJPA 2E2JH 4A3IG 4PZ6A 3NBHB 1A0IA 2E2IH 3S16H 3GTLH 1KL9A 4A93H 1VQHA 1VQGA 1VCIA 2A19A 4RMFA 2CCZA 4BY1G 2JA5H 4YCWA 1CKMA 1NY4A 1LYLA 1L1OC 4DR5Q 2KHIA 4R4QA 4R4CA 1VQDA 2K5NA 4GLVB 2IX0A 4JG2A 3K80C 2MQHA 3TEHB 1SFOH 3AEVA 3J7ZC 1PFSA 5JJKA 1XTDA 4GS3A 2UUAL 3HOYG 3PIPA 4GN5A 5JEAJ 2VQEL 1HNWQ 1KRSA 1BBUA 3KDFB 4K0KQ 1I94Q 4KHPQ 2UXCQ 3RN2A 4JBMA 3GTJH 4YHHQ 4IPCA 4GOPA 2VY3A 1HR0W 3FHWA 2BA1A 1PH4A 4DR3L 4X62Q 1N8RC 1EYGA 1UE6A 4JI8L 4DR6Q 1T9HA 1SMXA 4LFCL 2D62A 3CPFA 5LMUL 2NZHA 3UE0A 4HIDA 1WI5A 4BBRG 1BVSA 1L2FA 3T1YQ 1IBML 3F2DA 4DV7L 2UU9L 2JK8A 3HOXG 4A3IH 3J81c 3RLOA 2HHHQ 4A3MG 3PUXA 3A5ZB 2D0OA 2EIFA 4NB3A 4KHZA 3I56A 1VQPA 1XMOL 4BA2I 1HZ9A 2RF4A 2A8VA 4GKKQ 4DV2Q 1K9MC 4NPSA 4JI2Q 4LF9L 1Q82C 3GTQH 1NBWA 4DUYL 4HJAA 4BY1H 1D8LA 4LF5L 2K52A 2Z6KC 3H3VH 2JQOA 1JE5A 5IYCG 1EFWA 2ZJRA 3KLWA 2L15A 1XNRL 3GO5A 4AH6A 5FLMG 4JYAQ 2WB1G 2ID0A 1IYJB 4GNXC 1AE3A 1OXXK 4GOPB 3U4ZA 1A62A 3HOYH 2R7FA 4NXNQ 4DV4L 4DV1L 4A4IA 1V9PA 2JA6G 1NE3A 2PQAA 2IX1A 2EXDA 1J5EL 4DV7Q 5LMNL 1I50H 1K8AC 4JI0Q 1C7YA 2BH2A 1IXRA 4A3FG 1E24A 2R93G 1M90C 1PH7A 2XTIA 1V43A 2AWOA 4A3DG 1X54A 4A3LG 3M7NA 4BXXG 1P16A 3K0XA 1X6OA 4DPGA 5C0XJ 2QGQA 4OWXB 3NELA 4BBRH 4MTNA 4QY7A 1EQQA 3G4SA 1VQLA 3F1ZA 1HR0Q 1OXVA 3EBEA 4ME3A 3HOXH 4POGA 1V1QA 3F8TA 4A75A 4A3MH 2B3GA 2VNUD 4LF6Q 2Q2IA 1VQ6A 1OXSC 4OO1G 1Q1BA 3OTOL 4QJFA 1VQJA 4PG3A 4JI3L 4PZ8A 1PH5A 2F4VQ 4IFDI 1L1OB 4UP7A 1CUKA 3E9IA 5HGQA 4DV1Q 3S17H 2AMCB 3U50C 4AYBG 5IYCH 3HFZB 2CQOA 3SGIA 1C9OA 2IY5B 3LGJA 4IPDA 1XNQQ 2ZTCA 4XTCS 1W3SA 2PNHA 5FLMH 1YVCA 2KENA 4X65L 1WFQA 1GVPA 3PO2G 4JI7Q 2NVYH 4KLKA 2E5LL 2YU9H 1ASYA 2HT1A 4IFDG 3CQZH 1N32Q 4A3KH 2JA6H 1IZ6A 3W5OA 1YHQA 3S2HH 4PZ7A 5GAHC 3OTOQ 1KRTA 1TWAH 4WJ3M 5IT9c 5JEAG 3BZKA 4A3DH 1QUQB 3D0FA 4YWLA 4PMWA 4DR5L 1A8VA 1K0RA 1MIUA 5C4XH 3S1RH 1XMQQ 3GTMH 2Q2TA 3I4MG 1PVOA 4BXXH 4LF8L 2CKZB 1HZBA 3HKZE 3KF6A 2KHJA 3RNUA 3H3VI 3TREA 1VQ8A 2VW9A 1TWHH 2NVTH 1JJ2A 3B6YA 4MNOA 4Y7NH 4OX9Q 4P74A 2QA4A 1XPUA 1HNWL 4K0KL 2N78A 1ASZA 4KHPL 2UXCL 3RZDH 2C35B 1PH3A 1TWFH 1SROA 2KCMA 1KXLA 3ERSX 4YHHL 2OQKA 3CPWA 1NJIC 4QQBX 2WFWA 4DNIA 3BU2A 1I5FA 4GNXB 3UDXA 4A76A 2YTYA 3VDYA 1PHJA 1EOVA 4X62L 1U5KA 1IL2A 4A3BG 3CCQA 5GAGC 4DR6L 5GROA 3CMAA 4QL5A 1YJWA 3RR5A 3PO2H 3L2PA 3PUYA 3T1YL 4LF8Q 2HHHL 3EIVA 1WYDA 1E1TA 3NENA 3D31A 5K36G 3S15H 5IP9G 3AYHB 4DV2L 4GKKL 4JI2L 3GTOH 1I3QH 2LXJA 4JI1Q 1VQIA 3CCMA 3S2DH 2AHOB 1S3OA 4GLXA 1WJJA 1UE1A 1K8GA 1E1OA 1VQEA 3I4MH 2LXKA 4DR4L 3CC7A 1N36L 4JYAL 3PCOB 1Y1WG 1Q8KA 2R7ZG 1X3EA 4JC0A 3CCRA 1CSPA 4UY8C 2R92G 3TRZA 1HJPA 2CWAA 1NMGA 2WAQG 3K8AA 4NXNL 3CCUA 1CKNA 3PF5A 2ZJQA 1WCMG 3I4OA 4IFDJ 2DUDA 4LF7Q 3GTGH 4DV6Q 2N49A 3CCLA 4R4IA 3JAMi 4JI0L 3PV0A 4HIOA 1X9NA 1TWCH 1G51A 1U0LA 1VQOA 1IBKQ 1IBLQ 1QZGA 5FLXc 3UE1A 2NVXH 3ICEA 3HOZH 3BZCA 2F52A 3KJOA 1EWIA 2WP8J 4JCVE 1HH2P 4A3BH 2Y0SG 4EQ5A 2YYZA 2I5LX 1JT8A 1S72A 3I55A 1VQAA 2I5MX 1HR0L 4DR4Q 3GTPH 1N36Q 3FKIH 5FJ8G 4LF6L 3KFUA 5M3MG 4B3MQ 3HKSA 4LW1A 1DGSA 2K14A 5IP9H 2F4VL 1G291 3H15A 5BR8Q 4DUZQ 2OQ0A 1UE5A 1YIJA 4A3KG 4TQUS 4A3CG 4OO1I 3STBC 5IYBG 4XIGS 2MNAA 4C3HH 3M9BA 1N34Q 1W2BA 1B70B 2Q2HA 4LFAL 4GKJQ 1XNQL 4A3LH 1QVGA 1CSQA 3GTKH 1AH9A 5J3BA 1GO3E 3AFPA 3CMEA 1PA6A 4TVAB 4HJ8A 1Y1WH 4B3SQ 3H0GG 2R7ZH 1K83H 1B7YB 2R92H 5C4XG 3MXNB 4JI7L 2YTVA 4JBWA 2K50A 1VQCA 4IOCA 4C3IH 1WCMH 1FGUA 3M4QA 4IJLA 4P72A 3STBD 4DV3L 2YTXA 1N32L 1O7IA 3OYYA 3WWVA 2RCNA 3L0OA 4JV5Q 4IPGA 1I6HH 3HOVG 3E0EA 5AJ3L 2R7DA 5GAEC 1EQRA 1UEBA 1UWVA 1LTLA 1XMQL 4IO9A 3E9HA 4YWMA 1VQBA 4JI4Q 1Q7YC 1X56A 4GLAC 1Q12A 2V1CC 3RN5A 4JOIA 3G6EA 1PH6A 4BA1I 2PQAB 1XJVA 4LFAQ 4GN3B 4EX5A 4LFBQ 1MKHA 3PO3G 5FJ8H 1SRUA 3K7UC 2ALYB 5M3MH 1PH2A 2K75A 3K7AH 2HQLA 4YY3Q 4OX9L 1YZ6A 1N33Q 2FXQA 1KD1C 4DV3Q 2ES2A 4A3CH 1NMFA 3PUZA 4OXPA 5IYBH 2EQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 Q;  1PH9 A;  1YJN A;  2UXB Q;  5H1S E;  5AJ3 Q;  4OON A;  1MJE A;  4POF A;  2JEA I;  2PI2 E;  2YV5 A;  3H0G H;  2OCE A;  2ATW A;  2WB1 E;  2Z0S A;  3KOJ A;  4UPA A;  4YCU A;  1KAW A;  3ULJ A;  1MJC A;  2D0P A;  4X66 L;  4DV5 L;  2VQF Q;  1HNX Q;  3IRB A;  4DAY B;  4DR2 Q;  1A63 A;  3HOV H;  3A74 A;  4JI1 L;  4A3E G;  1TWG H;  1NTG A;  4OWT B;  5EAY A;  4DV0 Q;  1C0A A;  3ER0 A;  3I7F A;  2NN6 G;  4P75 A;  1HZC A;  3U4V A;  4R4O A;  3CW2 C;  2ZM6 Q;  4ALP A;  1OTC A;  4B3T L;  5M5X H;  1VQ5 A;  3A0J A;  1Z9F A;  1YHA A;  1OXT A;  1GM5 A;  4HJ7 A;  2IHE A;  4A3J G;  2UUC Q;  3TS2 A;  1Q81 C;  1L0W A;  3J80 c;  3HOZ G;  3ULL A;  1YI2 A;  3PUW A;  4A3G G;  3PO3 H;  3KYH C;  3PF4 A;  2VUM G;  1VQF A;  3AFQ A;  3JC6 6;  4DK3 C;  4BY7 G;  2KBN A;  3JAM c;  1TXY A;  4LF7 L;  3GD7 A;  3U58 A;  1VQN A;  4DV6 L;  1EIF A;  2BH8 A;  3FKI G;  4X66 Q;  4DV5 Q;  1IBK L;  1IBL L;  3KF6 B;  4DR1 L;  2I0Q A;  1KIX A;  4X64 L;  4HIM A;  4O2D A;  1PV4 A;  1EIY B;  3M85 A;  3T1H Q;  2ZTE A;  3J81 j;  4AYB E;  3DM3 A;  1YJ9 A;  4BBS H;  3CP0 A;  4YWK A;  1R9T H;  1AE2 A;  4AQY Q;  4B3T Q;  2GVA A;  1Z47 A;  3KF8 B;  1HNZ Q;  5C3E G;  3PGZ A;  1N9W A;  2UUB Q;  4JBJ A;  4HJ9 A;  4B3M L;  4C3J H;  2KCT A;  1J6Q A;  3J80 i;  2PMZ E;  2MO1 A;  5C44 G;  3I4N G;  2IT1 A;  2GN5 A;  4QGU A;  5BR8 L;  3DLL A;  4DUZ L;  4A3E H;  5C0X G;  4L5S A;  1VQK A;  4DR7 Q;  5IP7 G;  5IWA Q;  1N34 L;  3MEF A;  1YIT A;  2UXD Q;  5ELO A;  3PUV A;  1QZH A;  1SLJ A;  1YNX A;  4GKJ L;  1Q1E A;  4A3J H;  2E2H H;  4DR1 Q;  1VQ4 A;  4X64 Q;  4H02 A;  1FL0 A;  4JOI C;  2OTL A;  2NZO A;  1S40 A;  4B3S L;  3GDE A;  2B63 G;  4A3G H;  2OWO A;  4JI6 Q;  2VUM H;  2BA0 A;  5GAD C;  1PH8 A;  2JA7 G;  1FJG L;  5ELN A;  4BY7 H;  1XPR A;  1WOC A;  3CAM A;  1SN8 A;  3K81 C;  3F2B A;  3CXC A;  3S14 H;  3S1N H;  4JV5 L;  2JE6 I;  4IOA A;  4LNQ A;  1LUZ A;  2RHQ B;  2K5V A;  3CC4 A;  4DAM A;  1KQS A;  3RZO H;  4KI0 A;  3UDI A;  4O0A A;  1JJG A;  3CCJ A;  4JI4 L;  2I5H A;  2JEB I;  4J15 A;  2OTJ A;  5LMN W;  4L5T A;  1CKN B;  1M1K C;  3A5U A;  3HOU G;  1VQ7 A;  2VS1 A;  2UUA Q;  2RHS B;  3UDF A;  5IE8 A;  3PIO A;  4RG1 A;  1SR3 A;  5C3E H;  2QEX A;  2XGT A;  4LFB L;  2N8N A;  4C2M H;  2VQE Q;  4NXM L;  1K3R A;  3TS0 A;  2HIV A;  1E22 A;  3RLN A;  1YBY A;  5C44 H;  4YY3 L;  1FVI A;  3I4N H;  4P73 A;  1N33 L;  2DGY A;  4LF4 L;  1FJG Q;  2A1A A;  2ZTD A;  2JA8 G;  2MFI A;  1L1O A;  5JJI A;  2JJQ A;  4YCV A;  4IPH A;  5IP7 H;  4JI6 L;  3HKZ G;  4JI5 L;  2H5X A;  3CCE A;  1E3P A;  4DKA C;  1JJC B;  4JI8 Q;  3W1B A;  4DR3 Q;  2UXB L;  3PSI A;  1OXU A;  1KHI A;  4LFC Q;  5LMU Q;  1JMC A;  2JA9 A;  2UU9 Q;  1IBM Q;  3CD6 A;  2N3S A;  2B63 H;  1Q86 C;  3M4P A;  3M4O H;  3S1Q H;  1XMO Q;  2JA7 H;  3S1M H;  5JJL A;  5IYD G;  3J81 i;  1KC8 C;  4X6A H;  2AWN A;  1GKH A;  3EN2 A;  4LUZ A;  4LF9 Q;  2CWP A;  2MO0 A;  2WAQ E;  2VZA A;  3G48 A;  2VQF L;  1VS0 A;  4APV A;  4LUV A;  2VL6 A;  1PYS B;  2R6G A;  1HNX L;  4DK6 C;  4R1J A;  4DUY Q;  4DR2 L;  2GVB A;  4NXM Q;  1VQ9 A;  4LF5 Q;  2K4K A;  4AIM A;  5M3F G;  4DV0 L;  1RL2 A;  3TQY A;  3J7A 5;  4L5Q A;  2ZM6 L;  1CKO A;  1Y1V G;  3F2C A;  4UP8 A;  1VQM A;  1XNR Q;  2Q2U A;  4LF4 Q;  2CFM A;  3HOW G;  1QUQ A;  2B29 A;  3G71 A;  1H95 A;  3HOU H;  2UUC L;  2NN6 I;  5E7N A;  1JB7 A;  2Y0S E;  2K5H A;  5IY0 A;  2AKW B;  1D7Q A;  2HIX A;  5M5W H;  4DV4 Q;  4OWW B;  1X3G A;  1Y14 B;  3CCV A;  4BBS G;  1J5E Q;  5LMN Q;  4HJ5 A;  5M5Y H;  3M3Y H;  3CCS A;  4B3R L;  4JBK A;  4A93 G;  4Y52 H;  1X65 A;  1HZA A;  1SE8 A;  3L7Z C;  2JA8 H;  4WJ4 A;  2JA5 G;  2Z6K A;  2LSS A;  2ASB A;  1Q46 A;  3AQQ A;  4LUO A;  3CF5 A;  3ZJY C;  3T1H L;  1BKB A;  1BBW A;  1QVF A;  5HY6 A;  1YEZ A;  3FP9 A;  1X3F A;  1E7Z A;  3I2Z A;  4GNX A;  1UE7 A;  4QIW E;  4P71 A;  1EUJ A;  1LM0 A;  1P8L A;  3RLF A;  3S24 A;  3Q8D A;  4AQY L;  4UP9 A;  4FDB A;  4A3F H;  4HIK A;  2R93 H;  5IYD H;  1XPO A;  1HNZ L;  4JI3 Q;  4LWC A;  1B8A A;  1G6P A;  4GOP C;  3CC2 A;  5GQO A;  2UUB L;  1PH1 A;  1K73 C;  3W1G A;  3UDG A;  1RIP A;  3BJU A;  2PI2 A;  4L5R C;  1X55 A;  5M3F H;  4DR7 L;  4B3R Q;  1Y1V H;  3ULP A;  5DLQ E;  5IWA L;  2E8G A;  2UXD L;  3HOW H;  4IJH A;  4R4T A;  5C0X I;  3KJP A;  3KDF A;  4X65 Q;  3OW2 A;  4GN4 B;  2IHF A;  1GD7 A;  4MZ9 A;  1YHB A;  1QVC A;  2F3I A;  1PYB A;  2E5L Q;  5C4J H;  1I94 L;  2NVQ H;  3NEM A;  2ZJP A;  2E2J H;  4A3I G;  4PZ6 A;  3NBH B;  1A0I A;  2E2I H;  3S16 H;  3GTL H;  1KL9 A;  4A93 H;  1VQH A;  1VQG A;  1VCI A;  2A19 A;  4RMF A;  2CCZ A;  4BY1 G;  2JA5 H;  4YCW A;  1CKM A;  1NY4 A;  1LYL A;  1L1O C;  4DR5 Q;  2KHI A;  4R4Q A;  4R4C A;  1VQD A;  2K5N A;  4GLV B;  2IX0 A;  4JG2 A;  3K80 C;  2MQH A;  3TEH B;  1SFO H;  3AEV A;  3J7Z C;  1PFS A;  5JJK A;  1XTD A;  4GS3 A;  2UUA L;  3HOY G;  3PIP A;  4GN5 A;  5JEA J;  2VQE L;  1HNW Q;  1KRS A;  1BBU A;  3KDF B;  4K0K Q;  1I94 Q;  4KHP Q;  2UXC Q;  3RN2 A;  4JBM A;  3GTJ H;  4YHH Q;  4IPC A;  4GOP A;  2VY3 A;  1HR0 W;  3FHW A;  2BA1 A;  1PH4 A;  4DR3 L;  4X62 Q;  1N8R C;  1EYG A;  1UE6 A;  4JI8 L;  4DR6 Q;  1T9H A;  1SMX A;  4LFC L;  2D62 A;  3CPF A;  5LMU L;  2NZH A;  3UE0 A;  4HID A;  1WI5 A;  4BBR G;  1BVS A;  1L2F A;  3T1Y Q;  1IBM L;  3F2D A;  4DV7 L;  2UU9 L;  2JK8 A;  3HOX G;  4A3I H;  3J81 c;  3RLO A;  2HHH Q;  4A3M G;  3PUX A;  3A5Z B;  2D0O A;  2EIF A;  4NB3 A;  4KHZ A;  3I56 A;  1VQP A;  1XMO L;  4BA2 I;  1HZ9 A;  2RF4 A;  2A8V A;  4GKK Q;  4DV2 Q;  1K9M C;  4NPS A;  4JI2 Q;  4LF9 L;  1Q82 C;  3GTQ H;  1NBW A;  4DUY L;  4HJA A;  4BY1 H;  1D8L A;  4LF5 L;  2K52 A;  2Z6K C;  3H3V H;  2JQO A;  1JE5 A;  5IYC G;  1EFW A;  2ZJR A;  3KLW A;  2L15 A;  1XNR L;  3GO5 A;  4AH6 A;  5FLM G;  4JYA Q;  2WB1 G;  2ID0 A;  1IYJ B;  4GNX C;  1AE3 A;  1OXX K;  4GOP B;  3U4Z A;  1A62 A;  3HOY H;  2R7F A;  4NXN Q;  4DV4 L;  4DV1 L;  4A4I A;  1V9P A;  2JA6 G;  1NE3 A;  2PQA A;  2IX1 A;  2EXD A;  1J5E L;  4DV7 Q;  5LMN L;  1I50 H;  1K8A C;  4JI0 Q;  1C7Y A;  2BH2 A;  1IXR A;  4A3F G;  1E24 A;  2R93 G;  1M90 C;  1PH7 A;  2XTI A;  1V43 A;  2AWO A;  4A3D G;  1X54 A;  4A3L G;  3M7N A;  4BXX G;  1P16 A;  3K0X A;  1X6O A;  4DPG A;  5C0X J;  2QGQ A;  4OWX B;  3NEL A;  4BBR H;  4MTN A;  4QY7 A;  1EQQ A;  3G4S A;  1VQL A;  3F1Z A;  1HR0 Q;  1OXV A;  3EBE A;  4ME3 A;  3HOX H;  4POG A;  1V1Q A;  3F8T A;  4A75 A;  4A3M H;  2B3G A;  2VNU D;  4LF6 Q;  2Q2I A;  1VQ6 A;  1OXS C;  4OO1 G;  1Q1B A;  3OTO L;  4QJF A;  1VQJ A;  4PG3 A;  4JI3 L;  4PZ8 A;  1PH5 A;  2F4V Q;  4IFD I;  1L1O B;  4UP7 A;  1CUK A;  3E9I A;  5HGQ A;  4DV1 Q;  3S17 H;  2AMC B;  3U50 C;  4AYB G;  5IYC H;  3HFZ B;  2CQO A;  3SGI A;  1C9O A;  2IY5 B;  3LGJ A;  4IPD A;  1XNQ Q;  2ZTC A;  4XTC S;  1W3S A;  2PNH A;  5FLM H;  1YVC A;  2KEN A;  4X65 L;  1WFQ A;  1GVP A;  3PO2 G;  4JI7 Q;  2NVY H;  4KLK A;  2E5L L;  2YU9 H;  1ASY A;  2HT1 A;  4IFD G;  3CQZ H;  1N32 Q;  4A3K H;  2JA6 H;  1IZ6 A;  3W5O A;  1YHQ A;  3S2H H;  4PZ7 A;  5GAH C;  3OTO Q;  1KRT A;  1TWA H;  4WJ3 M;  5IT9 c;  5JEA G;  3BZK A;  4A3D H;  1QUQ B;  3D0F A;  4YWL A;  4PMW A;  4DR5 L;  1A8V A;  1K0R A;  1MIU A;  5C4X H;  3S1R H;  1XMQ Q;  3GTM H;  2Q2T A;  3I4M G;  1PVO A;  4BXX H;  4LF8 L;  2CKZ B;  1HZB A;  3HKZ E;  3KF6 A;  2KHJ A;  3RNU A;  3H3V I;  3TRE A;  1VQ8 A;  2VW9 A;  1TWH H;  2NVT H;  1JJ2 A;  3B6Y A;  4MNO A;  4Y7N H;  4OX9 Q;  4P74 A;  2QA4 A;  1XPU A;  1HNW L;  4K0K L;  2N78 A;  1ASZ A;  4KHP L;  2UXC L;  3RZD H;  2C35 B;  1PH3 A;  1TWF H;  1SRO A;  2KCM A;  1KXL A;  3ERS X;  4YHH L;  2OQK A;  3CPW A;  1NJI C;  4QQB X;  2WFW A;  4DNI A;  3BU2 A;  1I5F A;  4GNX B;  3UDX A;  4A76 A;  2YTY A;  3VDY A;  1PHJ A;  1EOV A;  4X62 L;  1U5K A;  1IL2 A;  4A3B G;  3CCQ A;  5GAG C;  4DR6 L;  5GRO A;  3CMA A;  4QL5 A;  1YJW A;  3RR5 A;  3PO2 H;  3L2P A;  3PUY A;  3T1Y L;  4LF8 Q;  2HHH L;  3EIV A;  1WYD A;  1E1T A;  3NEN A;  3D31 A;  5K36 G;  3S15 H;  5IP9 G;  3AYH B;  4DV2 L;  4GKK L;  4JI2 L;  3GTO H;  1I3Q H;  2LXJ A;  4JI1 Q;  1VQI A;  3CCM A;  3S2D H;  2AHO B;  1S3O A;  4GLX A;  1WJJ A;  1UE1 A;  1K8G A;  1E1O A;  1VQE A;  3I4M H;  2LXK A;  4DR4 L;  3CC7 A;  1N36 L;  4JYA L;  3PCO B;  1Y1W G;  1Q8K A;  2R7Z G;  1X3E A;  4JC0 A;  3CCR A;  1CSP A;  4UY8 C;  2R92 G;  3TRZ A;  1HJP A;  2CWA A;  1NMG A;  2WAQ G;  3K8A A;  4NXN L;  3CCU A;  1CKN A;  3PF5 A;  2ZJQ A;  1WCM G;  3I4O A;  4IFD J;  2DUD A;  4LF7 Q;  3GTG H;  4DV6 Q;  2N49 A;  3CCL A;  4R4I A;  3JAM i;  4JI0 L;  3PV0 A;  4HIO A;  1X9N A;  1TWC H;  1G51 A;  1U0L A;  1VQO A;  1IBK Q;  1IBL Q;  1QZG A;  5FLX c;  3UE1 A;  2NVX H;  3ICE A;  3HOZ H;  3BZC A;  2F52 A;  3KJO A;  1EWI A;  2WP8 J;  4JCV E;  1HH2 P;  4A3B H;  2Y0S G;  4EQ5 A;  2YYZ A;  2I5L X;  1JT8 A;  1S72 A;  3I55 A;  1VQA A;  2I5M X;  1HR0 L;  4DR4 Q;  3GTP H;  1N36 Q;  3FKI H;  5FJ8 G;  4LF6 L;  3KFU A;  5M3M G;  4B3M Q;  3HKS A;  4LW1 A;  1DGS A;  2K14 A;  5IP9 H;  2F4V L;  1G29 1;  3H15 A;  5BR8 Q;  4DUZ Q;  2OQ0 A;  1UE5 A;  1YIJ A;  4A3K G;  4TQU S;  4A3C G;  4OO1 I;  3STB C;  5IYB G;  4XIG S;  2MNA A;  4C3H H;  3M9B A;  1N34 Q;  1W2B A;  1B70 B;  2Q2H A;  4LFA L;  4GKJ Q;  1XNQ L;  4A3L H;  1QVG A;  1CSQ A;  3GTK H;  1AH9 A;  5J3B A;  1GO3 E;  3AFP A;  3CME A;  1PA6 A;  4TVA B;  4HJ8 A;  1Y1W H;  4B3S Q;  3H0G G;  2R7Z H;  1K83 H;  1B7Y B;  2R92 H;  5C4X G;  3MXN B;  4JI7 L;  2YTV A;  4JBW A;  2K50 A;  1VQC A;  4IOC A;  4C3I H;  1WCM H;  1FGU A;  3M4Q A;  4IJL A;  4P72 A;  3STB D;  4DV3 L;  2YTX A;  1N32 L;  1O7I A;  3OYY A;  3WWV A;  2RCN A;  3L0O A;  4JV5 Q;  4IPG A;  1I6H H;  3HOV G;  3E0E A;  5AJ3 L;  2R7D A;  5GAE C;  1EQR A;  1UEB A;  1UWV A;  1LTL A;  1XMQ L;  4IO9 A;  3E9H A;  4YWM A;  1VQB A;  4JI4 Q;  1Q7Y C;  1X56 A;  4GLA C;  1Q12 A;  2V1C C;  3RN5 A;  4JOI A;  3G6E A;  1PH6 A;  4BA1 I;  2PQA B;  1XJV A;  4LFA Q;  4GN3 B;  4EX5 A;  4LFB Q;  1MKH A;  3PO3 G;  5FJ8 H;  1SRU A;  3K7U C;  2ALY B;  5M3M H;  1PH2 A;  2K75 A;  3K7A H;  2HQL A;  4YY3 Q;  4OX9 L;  1YZ6 A;  1N33 Q;  2FXQ A;  1KD1 C;  4DV3 Q;  2ES2 A;  4A3C H;  1NMF A;  3PUZ A;  4OXP A;  5IYB H;  2EQS A; 
#chains in the Genus database with same CATH topology
 2AQ2 B;  2UXB Q;  5H1S E;  5AJ3 Q;  3RZO B;  1S5F D;  5CBE E;  2PI2 E;  2PQE A;  3KOJ A;  4UPA A;  3ULJ A;  5FLX E;  1MJC A;  1ZEQ X;  2D0P A;  2F0P A;  4X66 L;  2O2L D;  1HNX Q;  3IRB A;  1D5Z C;  3NWS A;  4RGT A;  2R7Z B;  4ZQ3 A;  2MGS A;  1GXD C;  1TWG H;  5EAY A;  2ZM6 Q;  1OTC A;  4XQN A;  3KF8 A;  1WTW A;  4B3T L;  3DEO A;  1V8Q A;  4KKT A;  1TS2 A;  5M5X H;  1OXT A;  1GM5 A;  4HJ7 A;  3HOZ G;  2F0M A;  1IW7 D;  2RDF A;  3KYH C;  1AEX A;  2B63 B;  3EFX D;  1EL0 A;  4QUC A;  2B2T C;  1EIF A;  1XWE A;  4JVZ A;  5CV5 A;  2I0Q A;  4HIM A;  1T5E A;  1JOQ A;  3M85 A;  3T1H Q;  2AQ3 B;  4AYB E;  1KNA A;  2DJG C;  3DM3 A;  2NTT A;  3A7A B;  4DU9 A;  3J80 L;  2GVA A;  1HA6 A;  1H9J A;  3PGZ A;  4ZUI A;  4IUU A;  1N9W A;  3A56 A;  5LL6 S;  5M5W B;  2UUB Q;  4C3J H;  2KCT A;  4YIJ A;  3JAM L;  1G6Z A;  1J6Q A;  4DNR B;  2PMZ E;  2MO1 A;  5C44 G;  4QGU A;  4DUZ L;  4A3E H;  4DR7 Q;  4IFD H;  1ET6 A;  2NN6 H;  2F0T A;  5IP7 G;  5ELO A;  4HED A;  3HKZ B;  4A3J H;  1PMR A;  1SE4 A;  1JOO A;  2NBF A;  5EJW A;  1VQ4 A;  1FL0 A;  3BZD B;  3LX0 A;  4KV6 A;  1S40 A;  4B3S L;  4A3G H;  3IL8 A;  2BA0 A;  2B2Y A;  2EY2 A;  2L4N A;  4BY7 H;  2EE1 A;  5C3X A;  3NUC A;  3CXC A;  3S1N H;  4JV5 L;  1F9Q A;  2F0I A;  1D5M C;  1LUZ A;  2K05 A;  3CC4 A;  4DAM A;  1KQS A;  1GUG A;  3DHQ A;  4XT1 B;  1SMY D;  4HN7 A;  2I5H A;  2JEB I;  5CV8 A;  1JIC A;  1CKN B;  1M1K C;  3AMU A;  3HOW B;  1ILQ A;  4LFB L;  1RDP D;  2XNA C;  2HIV A;  3TS0 A;  3RLN A;  1YBY A;  4P73 A;  2DGY A;  2A1A A;  1JOK A;  4QUF A;  2MFI A;  1B9M A;  4JI6 L;  2F0H A;  4DKA C;  2EVB A;  1SYC A;  3NK9 A;  3PSI A;  1HQM C;  3NTH A;  3CD6 A;  2N3S A;  1CTM A;  1SFO B;  3S1Q H;  1XMO Q;  3S1M H;  3P20 A;  3EN2 A;  1RTO A;  2LY7 A;  2VQF L;  2XWB B;  1II3 A;  3DUZ A;  1SYF A;  4DUY Q;  3J7A 5;  1XNR Q;  2CFM A;  1Q90 A;  3HOU H;  3HG9 A;  2K5H A;  1IKL A;  3PMF A;  4DV4 Q;  2B8G A;  1SJE D;  2MHV A;  1SE8 A;  3T16 A;  4WRD A;  1EYA A;  2JA8 H;  2C9O A;  3GTQ B;  4PNY A;  1Q46 A;  2LMC B;  3AQQ A;  4M1U B;  4P2C B;  1BKB A;  1BBW A;  3FP9 A;  1X3F A;  2HD3 A;  3I2Z A;  1UE7 A;  4QIW E;  1EUJ A;  1TR5 A;  1P8L A;  3Q8D A;  3T51 B;  4FDB A;  2B2Y C;  3OWF A;  4JI3 Q;  1G6P A;  4UDU C;  4GOP C;  1UEA B;  1PH1 A;  5A35 A;  3UDG A;  5KYI A;  1NR2 A;  1X3P A;  3HEJ A;  3M4Y A;  1EY8 A;  4ZKC B;  2A74 C;  5C0X I;  3WOE A;  4X65 Q;  4MZ9 A;  1ROD A;  4HSV A;  1PYB A;  4FXG C;  4A3I G;  3HOX B;  4ZUJ A;  1A0I A;  5D3D A;  1CQF A;  3S16 H;  3GTL H;  1KL9 A;  5CYU A;  4CHT B;  4DXF A;  4RMF A;  4BY1 G;  3I70 A;  4IUR A;  4U68 A;  1Z6H A;  4R4C A;  2QDL A;  1KTK A;  2K5N A;  1BF4 A;  4Q5V A;  1CT1 D;  1JC7 A;  1L0X B;  4N8F A;  3C2P A;  4NW2 A;  2UUA L;  1TVX A;  3C1F A;  2KEE A;  5CR3 A;  2VQE L;  2MPM A;  2UXC Q;  5KND A;  1QIL A;  3TP7 A;  1HR0 W;  3FHW A;  2BA1 A;  1PH4 A;  4N9T A;  3VYU A;  3VYS A;  1SMX A;  4LFC L;  1GOZ A;  5LMU L;  2NZH A;  2R3Z A;  1BVS A;  1L2F A;  3T1Y Q;  1IBM L;  2UU9 L;  1LT4 D;  5G3L F;  1QB5 D;  4A3M G;  1UAP A;  1MGS A;  2EIF A;  4NB3 A;  3I56 A;  2IJ0 A;  1PZI D;  3K5N A;  4GKK Q;  4DV2 Q;  1RJT A;  2NVT B;  4LF9 L;  1WVL A;  1EY5 A;  3HZX A;  3DWP A;  5ISR A;  2JQO A;  1EFW A;  2ZJR A;  2L15 A;  1X3Q A;  3D4R A;  3GO5 A;  5FLM G;  2WB1 G;  2IX3 A;  1IYJ B;  1O80 A;  1AE3 A;  1A62 A;  1GUS A;  2QEJ C;  4A4I A;  2JA6 G;  2PQA A;  4DV7 Q;  4JW0 A;  1M8A A;  1K8A C;  3NWT A;  1C7Y A;  4A3F G;  1M90 C;  1PH7 A;  3S15 B;  2XTI A;  5CV7 A;  3I8Z A;  2XVS A;  3TME A;  3H94 A;  1DD2 A;  1SNC A;  1ZKO A;  2JXM B;  1P16 A;  3K0X A;  2OT2 A;  4K2L A;  3X3M A;  4OWX B;  2O5I C;  2RA4 A;  4BBR H;  1EQQ A;  3G4S A;  3Q24 A;  3F1Z A;  3VR5 A;  1V1Q A;  1ILP A;  1EWC A;  1CA5 A;  1EZ8 A;  4LF6 Q;  1OXS C;  4OO1 G;  1Q1B A;  1EY0 A;  1B3Q A;  4IFD I;  2F4V Q;  1L1O B;  4I7Z C;  5LL6 X;  1PFB A;  3S17 H;  2AMC B;  3HFZ B;  2CQO A;  3MFY A;  2ZTC A;  2PNH A;  4K5W A;  3C3L A;  2PZU A;  1GUN A;  1DJR D;  2K5Q A;  3R2I A;  1WFQ A;  4JI7 Q;  5CGK A;  2NVY H;  1KDA A;  3CQZ H;  4A3K H;  1S4Z A;  3NE5 B;  4PZ7 A;  3OTO Q;  1QUQ B;  3D0F A;  3EA6 A;  4A3L H;  1A8V A;  5C4X H;  1PVO A;  1E2Z A;  3J81 E;  1KNE A;  3HKZ E;  4DAP A;  4CJ2 C;  2F0J A;  3QOL A;  5A2Q L;  3OIQ A;  4FF1 A;  3TRE A;  2VW9 A;  2WII B;  2R92 B;  5CV6 A;  2J4X A;  3B6Y A;  4P74 A;  5D14 A;  1HNW L;  4K0K L;  4KHP L;  2C35 B;  1KXL A;  3ERS X;  3W3A A;  4HAE A;  5IT9 L;  3BYY B;  3CPW A;  4QQB X;  4CDF C;  1I6H B;  1NAP A;  1TS5 A;  4KK7 A;  4A76 A;  2YTY A;  3E3X A;  4X62 L;  2F0O A;  3CCQ A;  4ODG A;  2KVM A;  3BS1 A;  4DR6 L;  4DFA A;  3PO2 H;  4H0L C;  4O42 A;  1LTI D;  4IUT A;  3EIV A;  2QCP X;  1SNP A;  4PQX A;  3MVV A;  2VB3 X;  5J22 A;  4IUV A;  2EY6 A;  4KJO A;  2Z9H A;  5M3M B;  3GTO H;  3CCM A;  5IGB A;  1S3O A;  5JEA H;  1HA5 A;  1WJJ A;  3TZD A;  1IYV A;  1HXY D;  4A3K B;  4RCO A;  5I9P A;  3EQL C;  3Q22 A;  1N36 L;  4JYA L;  3PCO B;  4FNF A;  1TU2 B;  1STA A;  1Q8K A;  2TMP A;  5EQ0 A;  1EU3 A;  3QWN A;  3TRZ A;  2BCO A;  1HJP A;  2CWA A;  5C4X B;  1SJH D;  2ZJQ A;  1CKN A;  3PF5 A;  3I4O A;  3MWY W;  4HSP A;  5M9O A;  3MAQ A;  4DV6 Q;  4CDE C;  2F3V A;  3ZYY X;  2NVX H;  3HOZ H;  3KJO A;  4IAL A;  4JCV E;  2WP8 J;  3TDQ A;  3VYR A;  3IAY A;  1DOL A;  4KY6 A;  2YYZ A;  1JT8 A;  2NUC A;  4DR4 Q;  1STN A;  2O5J C;  4B9X A;  3PO3 B;  3MXP A;  1EY9 A;  1YNJ C;  3H15 A;  5BR8 Q;  1W6J A;  2XN9 C;  4A3C G;  5FLX L;  1WTR A;  3K5L A;  4OL7 A;  2NZ1 D;  2SOB A;  2KUM A;  2Q2H A;  4KTA A;  4C1N K;  5J3B A;  4DNT B;  2EY1 A;  3AFP A;  4G7Z C;  1K0S A;  1Y1W H;  4N8X 1;  1CA6 A;  1MSG A;  1B7Y B;  3MXN B;  1GUW A;  2BE5 C;  2KQ3 A;  4DV3 L;  1FGU A;  2FHT A;  3I91 A;  3OYY A;  2RCN A;  1E2W A;  3HOV G;  3E0E A;  1ENF A;  5AJ3 L;  2OF1 A;  5GAE C;  1UEB A;  1IYU A;  5BN4 A;  1UWV A;  1ZYR C;  3E9H A;  4YWM A;  1Q7Y C;  1PTO B;  2K01 A;  2MJ8 A;  1F2L A;  4QMG A;  2E2H B;  3BDC A;  4LFA Q;  4GN3 B;  3M7G A;  4DK1 A;  4F87 A;  3HOZ B;  2NVX B;  2ALY B;  2K75 A;  2HQL A;  2M00 A;  4RFB A;  3NP8 A;  1KD1 C;  3PUZ A;  3CPF A;  4UHV A;  4IUP A;  4JI5 Q;  2F0Q A;  5FOB B;  3D8G A;  5LHY 1;  3H0G H;  2SNS A;  2OCE A;  4YCU A;  4DF7 A;  4C2M B;  4CJ0 B;  1ESF A;  5C44 B;  1NTG A;  4OWT B;  4DV0 Q;  3ER0 A;  3I7F A;  3U4V A;  1HZC A;  1VDZ A;  1F9P A;  1C48 A;  3OMG A;  2G9H D;  1FNW A;  4ILW A;  1YHA A;  5JPN C;  3VYT A;  2UUC Q;  2PW5 A;  1G2S A;  3J80 c;  2Z1C A;  4FF3 A;  1WD0 A;  1YI2 A;  1FGB D;  5CV4 A;  3PF4 A;  4NKL A;  3JC6 6;  4S3S A;  3JAM c;  2LKV A;  4LF7 L;  1VQN A;  3G6J B;  1D5X C;  2B2V C;  4DV5 Q;  1IBK L;  1IBL L;  4RHS A;  3KF6 B;  1PV4 A;  1V1O A;  1EIY B;  2ZTE A;  3O13 A;  1MSH A;  4LK1 C;  3J81 j;  3S9W A;  2HQE A;  1R9T H;  1AE2 A;  5T1I A;  4RKB A;  5C3E G;  4L8J A;  4JBJ A;  3D4W A;  3KLS X;  4HJ9 A;  1TKW B;  4K14 A;  5COR A;  5EBD A;  2PZT A;  5IGF A;  3I4N G;  3H0G B;  2GN5 A;  3QIA A;  3M3Y B;  3NSW A;  4L5S A;  4C3I G;  4UAI A;  5IWA Q;  1N34 L;  1E0B A;  1WTO A;  5AFW A;  1QZH A;  1SLJ A;  2PPB C;  5C3W A;  3TSS A;  4DR1 Q;  4E6I A;  4ME5 A;  4X64 Q;  3I4L A;  2VUM H;  5GAD C;  1PFM A;  2JA7 G;  4KJN A;  5ELN A;  3TP8 A;  1WOC A;  3CAM A;  3K81 C;  2M9V A;  1ET9 A;  1EWH A;  1O7Z A;  1SNO A;  2X6G A;  4L63 B;  3RZO H;  1ICW A;  3R2T A;  4KI0 A;  3UDI A;  4O0A A;  1CHP D;  4JI4 L;  4I65 A;  4L5T A;  2L1B A;  1HPC A;  3A5U A;  2RHS B;  2DN8 A;  5IE8 A;  3P1H A;  2F4I A;  3PIO A;  1VMC A;  1SR3 A;  4B08 A;  1SNQ A;  5C4J B;  2FJ2 A;  1E22 A;  3MEH A;  1YNJ D;  3SVM A;  4YY3 L;  4OIK A;  1R9T B;  3RMH A;  2D2C C;  1FJG Q;  5C0X H;  2ZTD A;  1L1O A;  5JJI A;  4NDX A;  2M2L A;  1PZJ D;  4G4K A;  1F9S A;  3CCE A;  4JI8 Q;  1I4P A;  1EY4 A;  1OXU A;  2JA9 A;  3KK7 A;  2B63 H;  2FMC A;  3ND9 A;  2BE5 D;  5JJL A;  5IYD G;  1KC8 C;  5DNF A;  4EVO A;  1GKH A;  2MO0 A;  1VS0 A;  4APV A;  4KY5 A;  2VL6 A;  4LUV A;  4DR2 L;  2K5W A;  3BYT B;  5M3F G;  2J0T D;  1RL2 A;  3GTJ B;  1Y1V G;  4FYD A;  3F2C A;  2Q2U A;  1ZYR D;  1CQV A;  1F2Y A;  1TQO A;  2P5Z X;  1QUQ A;  1H95 A;  5E7N A;  2Y0S E;  1KAB A;  2JSO A;  2PYK A;  5M5W H;  4OWW B;  1Y14 B;  5LMN Q;  4HJ5 A;  4FF2 A;  4JBK A;  4A93 G;  2R61 A;  4Y52 H;  1HZA A;  2JA5 G;  1ONL A;  2LSS A;  1MD2 D;  4BY1 B;  2RVL A;  2I07 B;  2RBM A;  1K8O A;  1QVF A;  1YEZ A;  4P71 A;  4Z9C B;  4AQY L;  3S24 A;  4A3F H;  1XPO A;  1HNZ L;  4LWC A;  1B8A A;  1CZW A;  5GQO A;  3N6R A;  1G91 A;  3BJU A;  1VF7 A;  2PI2 A;  2WAC A;  5EPJ A;  3J7Y W;  4L5R C;  3QO2 A;  4N9P A;  1XXG A;  2G9D A;  3I72 A;  4B3R Q;  3ULP A;  5DLQ E;  2KA7 A;  2UXD L;  3HOW H;  4IJH A;  2KHS A;  3NXW A;  3KJP A;  1BQQ T;  4GN4 B;  2IHF A;  3QOJ A;  1QVC A;  2B8F A;  1O7Y A;  3H91 A;  4F8M A;  4A3M B;  1M4V A;  2L55 A;  5E4W C;  1VQH A;  1VQG A;  5IGD A;  2PW7 A;  1LYL A;  1L1O C;  2SNM A;  4DR5 Q;  3L9A X;  2BOS A;  2ENB A;  5EKL A;  2B2U A;  5G3L D;  3K80 C;  1SFO H;  4CDD C;  3AEV A;  1XTD A;  1CK1 A;  3HOY G;  5I2X A;  2L9H A;  1TS4 A;  4R8I A;  2SDF A;  1KRS A;  3KDF B;  1EEF D;  3H6M A;  2JA6 B;  2EOT A;  2A6H C;  4JBM A;  4LJZ C;  4YHH Q;  1NCV A;  3S2H B;  4A3F B;  4GOP A;  3U9O A;  1F9R A;  4DR3 L;  4TSS A;  3ERQ A;  3GTM B;  2H1E A;  2D62 A;  3RUZ A;  4DV7 L;  2EYO A;  3Q0A A;  3OHX C;  3PUX A;  2H4O A;  1VQP A;  4BA2 I;  3T53 B;  1HZ9 A;  2RF4 A;  2A8V A;  2K7V A;  3CRK C;  3MXN A;  4Y7N B;  3D6W A;  4Q0F A;  3GTQ H;  5I4D A;  4HJA A;  4OEM B;  1D8L A;  4LF5 L;  1SYD A;  3KLW A;  3IFD A;  4AH6 A;  5DM7 3;  2CH4 W;  2K1B A;  3DWQ A;  1OXX K;  3J81 L;  1A3U A;  1V9P A;  2IX1 A;  1HRJ A;  2EXD A;  1J5E L;  2EPB A;  1I50 H;  1UUP A;  1IXR A;  1E24 A;  1V43 A;  4A3D G;  1A15 A;  1X54 A;  4M8A A;  2RKS A;  3M7N A;  4BXX G;  4DPG A;  1X6O A;  4KMU C;  1X32 A;  1OXV A;  4ME3 A;  3HOX H;  4HR7 B;  2VNU D;  1YNN C;  2Q2I A;  1VQ6 A;  3OTO L;  1XYI A;  4QJF A;  1VQJ A;  1FD7 D;  1K8M A;  1NUC A;  4BWG B;  1CUK A;  4XDX A;  1KAA A;  2JN4 A;  1C4Q A;  2IWH A;  4WOR A;  5IYC H;  1C9O A;  1S5E D;  1B4O A;  2B2U C;  3URY A;  2FMM A;  2ZXO A;  5HGT A;  1WTP A;  1HFN A;  4KLK A;  1EZ6 A;  2E5L L;  2HT1 A;  1ASY A;  4NP5 A;  1I4H A;  4K6D A;  3GTP B;  5FO9 B;  3W5O A;  1YHQ A;  4J6H A;  2E2D C;  2PNR C;  4WJ3 M;  5IT9 c;  1Y8O B;  4YWL A;  1SSO A;  1D1I A;  3I3C A;  1DXM A;  1QWY A;  4IUQ A;  4H44 C;  3I4M G;  1I50 B;  3KF6 A;  5BN5 A;  2WV6 D;  3GTK B;  3U9S A;  1RF2 D;  1VQ8 A;  1DOK A;  2NVT H;  4MNO A;  4OX9 Q;  1SBB B;  2MUY A;  1JR0 D;  4XYO A;  2N78 A;  1PH3 A;  1TWF H;  1SRO A;  5CC4 A;  2ICI A;  3BU2 A;  1SEB D;  2K6A A;  4GNX B;  2IPK D;  5NUC A;  1F2Z A;  3SK6 A;  2O4X A;  3PIP 3;  4A3B G;  3CMA A;  1YJW A;  1PYW D;  3L2P A;  4LF8 Q;  3A8J E;  3MA2 B;  2HHH L;  1E1T A;  3ND8 A;  5FO8 B;  5K36 G;  2QIL A;  3S15 H;  2IW3 A;  4JI2 L;  3K7A B;  4GLX A;  3J7A V;  1K8G A;  1B44 D;  2CVR A;  4FF4 A;  2LXK A;  4DR4 L;  3W2D A;  5CMD A;  5BN3 A;  4RGM A;  2KOL A;  2R7Z G;  4JC0 A;  3CCR A;  1S5B D;  1NMG A;  2WAQ G;  4NXN L;  4WFN 3;  3CCU A;  4ZK9 B;  1WCM G;  3HRZ C;  1B3A A;  2F1M A;  2AUK A;  2N49 A;  3JAM i;  4JI0 L;  2A6H D;  3MZ5 A;  5FLX c;  3UE1 A;  3BZC A;  1EWI A;  4G57 A;  4HMI A;  4EQ5 A;  2F0U A;  1RTN A;  1TWF B;  1S72 A;  1VQA A;  1HR0 L;  1VMP A;  5FJ8 G;  2K03 A;  4MIU A;  2ZXP A;  1MI2 A;  3MFG A;  5IP9 H;  1DGS A;  1FNU A;  4DUZ Q;  1Q3L A;  2OQ0 A;  1A3T A;  3Q6S A;  4OO1 I;  3DWA A;  4TQU S;  5IYB G;  1GHJ A;  3OOC A;  1B9N A;  1W2B A;  1B70 B;  4LFA L;  4PV1 C;  1AH9 A;  1XNQ L;  4TVA B;  4HJ8 A;  4B3S Q;  4V19 0;  2R92 H;  5JAV A;  3NQI A;  2K50 A;  4FP5 D;  2KCC A;  4C3I H;  1N32 L;  3M4Q A;  3STB D;  2Z6B A;  1TS3 A;  2GA4 B;  4JV5 Q;  4IPG A;  1I6H H;  2R7D A;  1NR4 A;  3K59 A;  1STB A;  3L3O C;  1EYC A;  1LTL A;  4LAA A;  4RCN A;  1XMQ L;  3MC0 B;  1ICF B;  4ZKB B;  1X56 A;  4JOI A;  3G6E A;  1LAB A;  1XJV A;  4LFB Q;  2JYO A;  4IN3 A;  1YNN D;  4JK1 C;  5M3M H;  3A55 A;  4PMB A;  3IFT A;  3V05 A;  1NMF A;  5JPM C;  4JI6 Q;  1PH9 A;  1YJN A;  3TBI B;  1WTQ A;  2JEA I;  1EIH A;  1BCP B;  3C1E A;  3CU7 A;  2QF7 A;  1V1P B;  3Q23 A;  2ATW A;  2WB1 E;  1HTP A;  1U4M A;  4DV5 L;  2VQF Q;  5IOD A;  5C3E B;  4C3J G;  3LNN A;  1A63 A;  1SYG A;  3A74 A;  4JI1 L;  2F3W A;  2NWG A;  4A3E G;  3LWE A;  3I4N B;  3DEP A;  4IFD G;  2NN6 G;  5EPL A;  2D9U A;  3CW2 C;  4C3I B;  4R9W A;  1VQ5 A;  1Z9F A;  3FMC A;  2F0L A;  4A3J G;  2IHE A;  3TS2 A;  2BDN A;  3NTI A;  1Q81 C;  1HUM A;  4ID6 A;  3ULL A;  3DXJ C;  5I6Y A;  4A3G G;  3PO3 H;  1CI3 M;  2DY7 A;  2N55 A;  1ESR A;  4G7H C;  3M4O B;  4BY7 G;  1TXY A;  2Y0S B;  2JA7 B;  3U58 A;  4OHJ A;  2BDO A;  2BH8 A;  3F2U A;  2AQ1 B;  4DR1 L;  4X64 L;  1ENC A;  4O2D A;  3MHB A;  2L0C A;  5T1G A;  3SK4 A;  4FXD A;  1YJ9 A;  1EU4 A;  1EOT A;  4YWK A;  4C3H G;  3OMC A;  3BVG A;  1EYD A;  3KF8 B;  1PTO D;  2HDL A;  3BDO A;  1BBX C;  4B3M L;  2B2W A;  4IZ8 A;  5C6A A;  1E2V A;  2IT1 A;  3DLL A;  5M5Y B;  2F0K A;  4C1N I;  1VQK A;  3QR8 A;  3DM1 A;  4RGN A;  4GZY C;  1PTO H;  2EZV A;  3FRP B;  3SXH A;  5TSS A;  4GKJ L;  1YNX A;  1Q1E A;  4OGQ C;  2E2H H;  4MHE A;  2E75 C;  4JOI C;  2OTL A;  2E76 C;  2OWO A;  1PH8 A;  1FJG L;  3A7L A;  1XPR A;  3WOF A;  3G7L A;  1LT5 D;  5E4X A;  5M3F B;  1JJG A;  1Y1V B;  2B2V A;  3CCJ A;  4J15 A;  2OTJ A;  5LMN W;  3HOU G;  1B53 A;  1VQ7 A;  2UUA Q;  1JQY D;  4RG1 A;  1RCV D;  1AFP A;  2QEX A;  2XGT A;  1FNV A;  2PCF B;  2N8N A;  5DEH A;  4C2M H;  2VQE Q;  2NVQ B;  1K3R A;  2E2J B;  2VB2 X;  5C44 H;  1FVI A;  1N33 L;  1BCP F;  3FPP A;  2E2I B;  1I4G A;  4A93 B;  2JA8 G;  1LTG D;  2JP1 A;  2AUJ D;  5IP7 H;  4IPH A;  2JA5 B;  1E3P A;  3QJY A;  1JJC B;  1GUT A;  2UXB L;  4LFC Q;  5LMU Q;  4KD3 A;  1JMC A;  1LV9 A;  2HCI A;  4MN3 A;  2UU9 Q;  1IBM Q;  4QB4 A;  1Q86 C;  4OIJ A;  1G8Z D;  1QG7 A;  4X3U A;  4I7A A;  1MBY A;  4LUZ A;  4LF9 Q;  1ENA A;  2VZA A;  3G48 A;  1T5X D;  3HS0 C;  1HNX L;  2R6G A;  2GVB A;  4NXM Q;  4AIM A;  3TQY A;  2Q8I B;  4L5Q A;  2ZM6 L;  4UP8 A;  4LF4 Q;  4X3K A;  2B29 A;  3G71 A;  4QCL A;  1AZP A;  1JB7 A;  1D7Q A;  3SK5 A;  2HIX A;  3EJI A;  1X3G A;  4BBS G;  2B2W C;  3M3Y H;  4B3R L;  2EYM A;  1X65 A;  1I6V C;  4EGV A;  2Z6K A;  5DM6 3;  5IGC A;  3VA5 A;  3CF5 A;  4HCS A;  1A2T A;  3OW7 A;  3ZJY C;  3T1H L;  5HY6 A;  1E7Z A;  4X3S A;  4GNX A;  3RLF A;  4UP9 A;  3E0J A;  4HIK A;  3HOY B;  1TY2 A;  4DK0 A;  2UUB L;  2SEB D;  1X55 A;  5EGT A;  4DR7 L;  1EQV A;  1LTR D;  4HCE A;  2HUG A;  2E8G A;  4X3T A;  4R4T A;  3OW2 A;  5KNC A;  1YHB A;  5JOB A;  5C4J H;  4EQP A;  3NEM A;  2ZJP A;  1JWM D;  3NBH B;  3TP5 A;  5JVH 3;  2Q8T A;  2A68 D;  3PQI A;  1VCI A;  4YCW A;  2DNE A;  2KHI A;  3BG3 A;  1DYQ A;  3ONA B;  2IX0 A;  4JG2 A;  3TEH B;  4ZCK A;  5JJK A;  1PFS A;  1LLR D;  3D3R A;  3E5S A;  4XXE A;  4GS3 A;  4GN5 A;  1DOM A;  2YU9 B;  1HNW Q;  4K0K Q;  1I94 Q;  4KHP Q;  1SDF A;  3GTJ H;  4IPC A;  5KIX A;  2VY3 A;  2V4D A;  3NTK A;  1PTO F;  1TWA B;  3K58 A;  4A3D B;  4X62 Q;  4H7B A;  1UE6 A;  3I90 A;  1SE2 A;  4DR6 Q;  1T9H A;  4WJW A;  1HTL D;  1Z7T A;  1WI5 A;  4BBR G;  4DA2 A;  5FO7 B;  1STE A;  2JK8 A;  4A3I H;  3J81 c;  4KHV A;  3A5Z B;  1Y8P B;  1XMO L;  3T4A C;  3GP7 A;  1K9M C;  4NPS A;  3J7A F;  1NBW A;  4DUY L;  4BY1 H;  5E1F A;  2KEC A;  2K52 A;  3RZD B;  2Z6K C;  1JE5 A;  4J1M A;  4ULL A;  1XNR L;  1DM0 B;  4LMQ D;  3KLS A;  4JYA Q;  2XRS D;  2ID0 A;  3SK8 A;  4GNX C;  3GV6 A;  2F0V A;  3U4Z A;  5F2D A;  2R7F A;  1O78 A;  4K6L A;  4DV4 L;  1IL8 A;  2HDM A;  2KED A;  2BH2 A;  1BDO A;  2R93 G;  1STY A;  1I3Q B;  2AWO A;  4IUN A;  3S2D B;  4A3L G;  3FPU B;  4ZLT F;  1FR3 A;  1FYC A;  5C0X J;  3I4M B;  2QGQ A;  3NEL A;  4MTN A;  4QY7 A;  2LFN A;  3EBE A;  1D2B A;  4OEL B;  1JE4 A;  4A75 A;  4A3M H;  1LT3 D;  2B3G A;  2C5C A;  5KEE A;  4JI3 L;  1V1P A;  1PH5 A;  2L12 A;  5HUR A;  4UP7 A;  4ZAI A;  3E9I A;  5HGQ A;  4DV1 Q;  1XTC D;  3GTG B;  4A3I B;  1TWC B;  3U50 C;  4AYB G;  2IY5 B;  3SGI A;  3LGJ A;  4IPD A;  4XTC S;  1LTA D;  2DJF C;  5FLM H;  3QB3 A;  4X65 L;  1GVP A;  1TT2 A;  3PO2 G;  2JA6 H;  1IZ6 A;  1Y8N B;  1B1Z A;  3S2H H;  4RA8 A;  4RWS C;  5GAH C;  1LO5 D;  2K32 A;  2CW0 D;  1CHQ D;  1KRT A;  5JEA G;  4XQQ A;  3BZK A;  1MIU A;  1K0R A;  3S1R H;  1BNZ A;  1PRT B;  3GTM H;  2Q2T A;  2EYF A;  4LF8 L;  3EVQ A;  1QJO A;  5I6W A;  2KHJ A;  4MTK A;  4K5V A;  5JJZ A;  3H3V I;  2RSN A;  1EFI D;  4PMC A;  4OO1 H;  1K83 B;  5L37 A;  1JJ2 A;  4JPB W;  1JOR A;  3SHL A;  4Y7N H;  3R8B A;  2WAQ B;  1XPU A;  1WCM B;  2UXC L;  4K8I A;  5CV9 A;  3TN2 A;  1QE6 A;  5EKI A;  1NJI C;  2WFW A;  4DNI A;  2HCC A;  1I5F A;  3VDY A;  1PHJ A;  1C8C A;  1EOV A;  1U5K A;  1IL2 A;  2Z4I A;  3RR5 A;  1B2T A;  4J8Q A;  3PUY A;  3T1Y L;  5JVG 3;  3D31 A;  2WB1 B;  4GKK L;  4DV2 L;  5I9O A;  2LXJ A;  2AHO B;  2F0F A;  2DNC A;  2WKC A;  3SR1 A;  1UE1 A;  3K6O A;  1AW7 A;  1U4R A;  1RKN A;  1Y1W G;  1U9R A;  3OPO A;  2I46 A;  4UY8 C;  1CSP A;  3K0Y A;  3TP6 A;  3S1R B;  3K8A A;  3V2T A;  1BCP C;  4IFD J;  2DUD A;  4LF7 Q;  2EJF C;  3HGB A;  4KY7 A;  1VQO A;  1IBK Q;  1IBL Q;  1QZG A;  3ICE A;  1TWG B;  1HH2 P;  1S5D D;  4KKU A;  5M5X B;  2I5L X;  4FO2 A;  3I55 A;  2I5M X;  2CHB D;  3T13 A;  3GTP H;  2EYP A;  2EYJ A;  4LF6 L;  3VR6 A;  2F03 A;  3KFU A;  3HKS A;  1EEI D;  1U4L A;  2K14 A;  2F4V L;  1UE5 A;  2EYH A;  1MHW C;  1YIJ A;  3STB C;  2MNA A;  4C3H H;  3M9B A;  4KN7 C;  1N34 Q;  2QDB A;  1QVG A;  3GTK H;  1PA6 A;  3KBG A;  3H0G G;  4ABN A;  2PO4 A;  4JI7 L;  2YTV A;  1VQC A;  1PRT F;  5DAU A;  4C56 C;  2YTX A;  5CBA E;  1O7I A;  3WWV A;  3L0O A;  2TSS A;  4K5X A;  4C3J B;  2DY8 A;  4A3E B;  2K28 A;  3LWU A;  1SE3 A;  4EQO A;  4JI4 Q;  1Q12 A;  4KN4 C;  3RN5 A;  1GUO A;  4A3J B;  2XIW A;  1I4X A;  1MKH A;  1CFM A;  1BO0 A;  1SRU A;  3K7U C;  4A3G B;  3K7A H;  1HQR D;  5COY A;  4YY3 Q;  1SAP A;  4L6T B;  4BY7 B;  2F0W A;  2ES2 A;  4A3C H;  3E6Z X;  4OXP A;  3ITP A;  2A5H A;  3S1N B;  2EQS A;  1H9M A;  1EQT A;  5C5M A;  3NQT A;  4XYQ A;  4OON A;  1MJE A;  4POF A;  2A69 C;  1JCK B;  2YV5 A;  3SEB A;  2Z0S A;  1LTT D;  3RD4 A;  4C3H B;  4CJ1 B;  1AP0 A;  1KAW A;  3OWE B;  5E3F A;  3GQB A;  5KRU A;  5ELB A;  3ERO A;  4DAY B;  4DR2 Q;  1D6E C;  3HOV H;  4CDC C;  3NBH A;  1C0A A;  4P75 A;  1HHV A;  4R4O A;  5C4H A;  4ALP A;  3A0J A;  2EDG A;  1L0W A;  3BVZ A;  1O7L A;  2EYL A;  3PUW A;  1BR9 A;  2VUM G;  1VQF A;  1KDC A;  3AFQ A;  4DK3 C;  1OO9 B;  2KBN A;  3S1Q B;  3S1M B;  2NYZ D;  3GD7 A;  4RH6 A;  4DV6 L;  4HMJ A;  1PTO C;  2X6L A;  4BS9 A;  3FKI G;  4X66 Q;  3KLR A;  4DXG A;  1KIX A;  3OIP A;  4ZRZ A;  2KCN A;  3D4D A;  1WTH A;  1GJX A;  2NTS A;  1WTX A;  4BBS H;  3CP0 A;  5ELD A;  2F0G A;  1TII D;  4AQY Q;  4B3T Q;  1Z47 A;  3HOU B;  1HNZ Q;  3FEW X;  4KKS A;  1KLU D;  3J80 i;  3VR4 A;  4TKO B;  5BR8 L;  1STG A;  5C0X G;  1HUN A;  1GHK A;  2JA8 B;  1J9O A;  3MEF A;  1YIT A;  2UXD Q;  3PUV A;  3R3O A;  3K57 A;  3X3N A;  4H02 A;  3HOV B;  2NZO A;  3GDE A;  2B63 G;  4RHR A;  3H3V C;  4QF4 A;  1BCP D;  1SN8 A;  2F0E A;  3F2B A;  3S14 H;  2JE6 I;  1W6K A;  1AZQ A;  4IOA A;  4LNQ A;  3GV3 A;  2RHQ B;  2K5V A;  2X69 A;  1K28 A;  3H09 A;  3HP3 A;  4U67 3;  2VS1 A;  2MP1 A;  3UDF A;  4F7X A;  5C3E H;  3SE0 A;  4NXM L;  3CHB D;  4BBS B;  3I4N H;  1EY6 A;  4LF4 L;  3S16 B;  3GTL B;  3J80 E;  2JJQ A;  4YCV A;  2K33 A;  2F0S A;  2ZT9 C;  3HKZ G;  4JI5 L;  2H5X A;  4DR3 Q;  3W1B A;  4V0B A;  3C46 A;  4FVM A;  2RDG A;  1KHI A;  2XSC A;  3JAM E;  1H9S B;  2WIN B;  3NBI A;  1KLG D;  3M4P A;  3M4O H;  5D3I B;  2JA7 H;  3J81 i;  4X6A H;  2AWN A;  2CWP A;  2WAQ E;  1HFG A;  1JWS D;  1PYS B;  3WDN A;  4DK6 C;  4R1J A;  3TZU A;  5KYL A;  1VQ9 A;  4LF5 Q;  2K4K A;  4DV0 L;  1CKO A;  4DAV A;  1VQM A;  2OXP A;  2WKD A;  3HOW G;  4EQN A;  3S14 B;  3I73 A;  1LTS D;  2NN6 I;  2UUC L;  5IY0 A;  1A6X A;  2AKW B;  1Q8I A;  5C4Z A;  1R4P B;  2A6E C;  3CCV A;  1J5E Q;  3A54 A;  1PZK D;  5M5Y H;  3P7J A;  3CCS A;  3DMU A;  1J8I A;  1XX8 A;  3L7Z C;  4O1N A;  4WJ4 A;  4XT3 B;  1SNM A;  2ASB A;  1D1K A;  4LUO A;  4K8J A;  2A69 D;  1H9K A;  2D5D A;  1LM0 A;  4DGZ A;  3CRL C;  2R93 H;  4K2K A;  5IYD H;  2KJX A;  4ZYS A;  3NHH A;  1K73 C;  3W1G A;  2Z4H A;  1RIP A;  1JWU D;  1QNU A;  5M3F H;  2K5D A;  1R4Q B;  1Y1V H;  2A68 C;  2VXW A;  3N52 A;  3OSO A;  5IWA L;  1DON A;  3A8K E;  4KD4 A;  3KDF A;  1GD7 A;  3BDL A;  5FK9 C;  2F3I A;  2E5L Q;  1I94 L;  2NVQ H;  4BBR B;  2E2J H;  4PZ6 A;  2QW7 A;  1JB3 A;  1STH A;  2PZW A;  4H13 C;  2E2I H;  4A93 H;  1G2T A;  2CH4 A;  2A19 A;  2CCZ A;  2JA5 H;  1CKM A;  1NY4 A;  4R4Q A;  5IOC A;  1VQD A;  2K04 A;  2OEO A;  3S17 B;  1DZ1 A;  4GLV B;  2F0N A;  1F77 A;  2MQH A;  2XWJ B;  1ZXT A;  4B9W A;  4DN4 M;  3J7Z C;  3PIP A;  2NVY B;  5JEA J;  4CKB A;  3CQZ B;  1BBU A;  1EIG A;  1Y69 U;  3RN2 A;  3K5M A;  5IIF A;  1EY7 A;  3MTS A;  2R93 B;  1L0Y B;  1WD1 A;  1I4Q A;  4NMZ A;  4CKC A;  3FDT A;  5KGU A;  3PIO 3;  4JI8 L;  5EBC A;  1N8R C;  1EYG A;  2Z8L A;  4HID A;  3UE0 A;  5ELE A;  1PRT C;  3F2D A;  3HOX G;  1F2M A;  2HHH Q;  3RLO A;  2D0O A;  4KHZ A;  1DCZ A;  4JI2 Q;  1Q82 C;  1I4R A;  1UNS A;  3H3V H;  5IYC G;  2L5T A;  4AYB B;  1SND A;  4RKL A;  3AB9 A;  4GOP B;  5KNB A;  5FKA C;  1CZG A;  4CKE A;  3HOY H;  4NXN Q;  3PO2 B;  4DV1 L;  1NE3 A;  5J39 A;  1A3V A;  1K3B C;  4CBV A;  5LMN L;  4JI0 Q;  2PMZ B;  3NPP A;  3GTO B;  2RQX A;  3QG1 A;  2RSO A;  3IKJ A;  3SDZ A;  1RD9 D;  3A8I E;  1VQL A;  1HR0 Q;  4POG A;  4R8N A;  3F8T A;  1PLF A;  1LTB D;  4RAU C;  4PG3 A;  4PZ8 A;  5IGG A;  2IL8 A;  4DAY A;  2LS0 1;  1XNQ Q;  1WTV A;  1W3S A;  1YVC A;  2CW0 C;  2KEN A;  2XRQ D;  5EKK A;  1A2U A;  5J1Z A;  2YU9 H;  1LT6 D;  2A6E D;  1N32 Q;  1H9R A;  5EPK A;  3UI2 A;  1TWA H;  3K5O A;  4F88 A;  1HCZ A;  4A3D H;  4PMW A;  3T56 B;  4DR5 L;  1XMQ Q;  1LAC A;  1PFN A;  4BXX H;  2CKZ B;  1HZB A;  2ICE C;  5D65 A;  4CGY B;  1SYB A;  2FFK B;  3RNU A;  3KUP A;  2B39 A;  1IW7 C;  1Y1W B;  2EY5 A;  1TWH H;  3R93 A;  4HTH A;  1VF5 C;  2QA4 A;  3P75 A;  1ASZ A;  2A73 B;  3RZD H;  2KCM A;  4IQZ A;  1TY0 A;  1QOH A;  2OQK A;  4YHH L;  1U4P A;  1S5C D;  4FXK C;  2CQA A;  3D6C A;  4XQJ A;  3UDX A;  5GAG C;  5GRO A;  4QL5 A;  1WYD A;  3NEN A;  2FIN B;  1NNX A;  1AN8 A;  3FVQ A;  5IP9 G;  3AYH B;  2QKI C;  1I3Q H;  4JI1 Q;  3S2D H;  1VQI A;  2EXZ A;  3VR3 A;  1BOS A;  1B50 A;  1E1O A;  1VQE A;  3I4M H;  3BVM A;  3CC7 A;  4QIW B;  4TRD A;  1PXU A;  1X3E A;  2R92 G;  2Q8R E;  3GTG H;  3CCL A;  2NB0 A;  4R4I A;  3PV0 A;  4HIO A;  1X9N A;  1TWC H;  1G51 A;  1U0L A;  5A2Q E;  2RCF A;  3MXU A;  1TWH B;  2F52 A;  5I2Y A;  1PDQ A;  3VR2 A;  1SMY C;  5K5P A;  1ML0 D;  4A3B H;  2Y0S G;  3AU7 A;  2RDH A;  1BUV T;  1PRT D;  2F0D A;  1N36 Q;  3FKI H;  5IT9 E;  5K36 H;  5M3M G;  4B3M Q;  1H9S A;  4LW1 A;  1G29 1;  2B2T A;  2ZXR A;  4A3K G;  2EJM A;  2G5D A;  4XIG S;  4GKJ Q;  1CSQ A;  5IGE A;  1QNK A;  2N88 A;  1GO3 E;  1SYE A;  3CME A;  3KBX A;  2R7Z H;  1K83 H;  5C4X G;  4JBW A;  4IOC A;  3CC2 A;  1WCM H;  4IJL A;  4P72 A;  2L11 A;  1KDB A;  3V96 A;  1NSN S;  1EQR A;  3VA7 A;  2EJG C;  4IO9 A;  1VQB A;  5ELC A;  3CKI B;  1BXT A;  5ELF A;  4GLA C;  2V1C C;  1IKM A;  1PH6 A;  4G7O C;  4BA1 I;  2PQA B;  1RHP A;  4EX5 A;  3PO3 G;  5FJ8 H;  2J7Z A;  1SXT A;  1PH2 A;  2VUM B;  5C5L A;  4A3B B;  4OX9 L;  1YZ6 A;  2E74 C;  1N33 Q;  1CM9 A;  1QCB D;  2FXQ A;  3MXG A;  4DV3 Q;  1IHZ A;  5IYB H;  4RGO S;  3FKI B; 
#chains in the Genus database with same CATH homology
 4JI5 Q;  1PH9 A;  1YJN A;  2UXB Q;  5H1S E;  5AJ3 Q;  4OON A;  1MJE A;  4POF A;  2JEA I;  2PI2 E;  2YV5 A;  3H0G H;  2OCE A;  2ATW A;  2WB1 E;  2Z0S A;  3KOJ A;  4UPA A;  4YCU A;  1KAW A;  3ULJ A;  1MJC A;  2D0P A;  4X66 L;  4DV5 L;  2VQF Q;  1HNX Q;  3IRB A;  4DAY B;  4DR2 Q;  1A63 A;  3HOV H;  3A74 A;  4JI1 L;  4A3E G;  1TWG H;  1NTG A;  4OWT B;  5EAY A;  4DV0 Q;  1C0A A;  3ER0 A;  3I7F A;  2NN6 G;  4P75 A;  1HZC A;  3U4V A;  4R4O A;  3CW2 C;  2ZM6 Q;  4ALP A;  1OTC A;  4B3T L;  5M5X H;  1VQ5 A;  3A0J A;  1Z9F A;  1YHA A;  1OXT A;  1GM5 A;  4HJ7 A;  2IHE A;  4A3J G;  2UUC Q;  3TS2 A;  1Q81 C;  1L0W A;  3J80 c;  3HOZ G;  3ULL A;  1YI2 A;  3PUW A;  4A3G G;  3PO3 H;  3KYH C;  3PF4 A;  2VUM G;  1VQF A;  3AFQ A;  3JC6 6;  4DK3 C;  4BY7 G;  2KBN A;  3JAM c;  1TXY A;  4LF7 L;  3GD7 A;  3U58 A;  1VQN A;  4DV6 L;  1EIF A;  2BH8 A;  3FKI G;  4X66 Q;  4DV5 Q;  1IBK L;  1IBL L;  3KF6 B;  4DR1 L;  2I0Q A;  1KIX A;  4X64 L;  4HIM A;  4O2D A;  1PV4 A;  1EIY B;  3M85 A;  3T1H Q;  2ZTE A;  3J81 j;  4AYB E;  3DM3 A;  1YJ9 A;  4BBS H;  3CP0 A;  4YWK A;  1R9T H;  1AE2 A;  4AQY Q;  4B3T Q;  2GVA A;  1Z47 A;  3KF8 B;  1HNZ Q;  5C3E G;  3PGZ A;  1N9W A;  2UUB Q;  4JBJ A;  4HJ9 A;  4B3M L;  4C3J H;  2KCT A;  1J6Q A;  3J80 i;  2PMZ E;  2MO1 A;  5C44 G;  3I4N G;  2IT1 A;  2GN5 A;  4QGU A;  5BR8 L;  3DLL A;  4DUZ L;  4A3E H;  5C0X G;  4L5S A;  1VQK A;  4DR7 Q;  5IP7 G;  5IWA Q;  1N34 L;  3MEF A;  1YIT A;  2UXD Q;  5ELO A;  3PUV A;  1QZH A;  1SLJ A;  1YNX A;  4GKJ L;  1Q1E A;  4A3J H;  2E2H H;  4DR1 Q;  1VQ4 A;  4X64 Q;  4H02 A;  1FL0 A;  4JOI C;  2OTL A;  2NZO A;  1S40 A;  4B3S L;  3GDE A;  2B63 G;  4A3G H;  2OWO A;  4JI6 Q;  2VUM H;  2BA0 A;  5GAD C;  1PH8 A;  2JA7 G;  1FJG L;  5ELN A;  4BY7 H;  1XPR A;  1WOC A;  3CAM A;  1SN8 A;  3K81 C;  3F2B A;  3CXC A;  3S14 H;  3S1N H;  4JV5 L;  2JE6 I;  4IOA A;  4LNQ A;  1LUZ A;  2RHQ B;  2K5V A;  3CC4 A;  4DAM A;  1KQS A;  3RZO H;  4KI0 A;  3UDI A;  4O0A A;  1JJG A;  3CCJ A;  4JI4 L;  2I5H A;  2JEB I;  4J15 A;  2OTJ A;  5LMN W;  4L5T A;  1CKN B;  1M1K C;  3A5U A;  3HOU G;  1VQ7 A;  2VS1 A;  2UUA Q;  2RHS B;  3UDF A;  5IE8 A;  3PIO A;  4RG1 A;  1SR3 A;  5C3E H;  2QEX A;  2XGT A;  4LFB L;  2N8N A;  4C2M H;  2VQE Q;  4NXM L;  1K3R A;  3TS0 A;  2HIV A;  1E22 A;  3RLN A;  1YBY A;  5C44 H;  4YY3 L;  1FVI A;  3I4N H;  4P73 A;  1N33 L;  2DGY A;  4LF4 L;  1FJG Q;  2A1A A;  2ZTD A;  2JA8 G;  2MFI A;  1L1O A;  5JJI A;  2JJQ A;  4YCV A;  4IPH A;  5IP7 H;  4JI6 L;  3HKZ G;  4JI5 L;  2H5X A;  3CCE A;  1E3P A;  4DKA C;  1JJC B;  4JI8 Q;  3W1B A;  4DR3 Q;  2UXB L;  3PSI A;  1OXU A;  1KHI A;  4LFC Q;  5LMU Q;  1JMC A;  2JA9 A;  2UU9 Q;  1IBM Q;  3CD6 A;  2N3S A;  2B63 H;  1Q86 C;  3M4P A;  3M4O H;  3S1Q H;  1XMO Q;  2JA7 H;  3S1M H;  5JJL A;  5IYD G;  3J81 i;  1KC8 C;  4X6A H;  2AWN A;  1GKH A;  3EN2 A;  4LUZ A;  4LF9 Q;  2CWP A;  2MO0 A;  2WAQ E;  2VZA A;  3G48 A;  2VQF L;  1VS0 A;  4APV A;  4LUV A;  2VL6 A;  1PYS B;  2R6G A;  1HNX L;  4DK6 C;  4R1J A;  4DUY Q;  4DR2 L;  2GVB A;  4NXM Q;  1VQ9 A;  4LF5 Q;  2K4K A;  4AIM A;  5M3F G;  4DV0 L;  1RL2 A;  3TQY A;  3J7A 5;  4L5Q A;  2ZM6 L;  1CKO A;  1Y1V G;  3F2C A;  4UP8 A;  1VQM A;  1XNR Q;  2Q2U A;  4LF4 Q;  2CFM A;  3HOW G;  1QUQ A;  2B29 A;  3G71 A;  1H95 A;  3HOU H;  2UUC L;  2NN6 I;  5E7N A;  1JB7 A;  2Y0S E;  2K5H A;  5IY0 A;  2AKW B;  1D7Q A;  2HIX A;  5M5W H;  4DV4 Q;  4OWW B;  1X3G A;  1Y14 B;  3CCV A;  4BBS G;  1J5E Q;  5LMN Q;  4HJ5 A;  5M5Y H;  3M3Y H;  3CCS A;  4B3R L;  4JBK A;  4A93 G;  4Y52 H;  1X65 A;  1HZA A;  1SE8 A;  3L7Z C;  2JA8 H;  4WJ4 A;  2JA5 G;  2Z6K A;  2LSS A;  2ASB A;  1Q46 A;  3AQQ A;  4LUO A;  3CF5 A;  3ZJY C;  3T1H L;  1BKB A;  1BBW A;  1QVF A;  5HY6 A;  1YEZ A;  3FP9 A;  1X3F A;  1E7Z A;  3I2Z A;  4GNX A;  1UE7 A;  4QIW E;  4P71 A;  1EUJ A;  1LM0 A;  1P8L A;  3RLF A;  3S24 A;  3Q8D A;  4AQY L;  4UP9 A;  4FDB A;  4A3F H;  4HIK A;  2R93 H;  5IYD H;  1XPO A;  1HNZ L;  4JI3 Q;  4LWC A;  1B8A A;  1G6P A;  4GOP C;  3CC2 A;  5GQO A;  2UUB L;  1PH1 A;  1K73 C;  3W1G A;  3UDG A;  1RIP A;  3BJU A;  2PI2 A;  4L5R C;  1X55 A;  5M3F H;  4DR7 L;  4B3R Q;  1Y1V H;  3ULP A;  5DLQ E;  5IWA L;  2E8G A;  2UXD L;  3HOW H;  4IJH A;  4R4T A;  5C0X I;  3KJP A;  3KDF A;  4X65 Q;  3OW2 A;  4GN4 B;  2IHF A;  1GD7 A;  4MZ9 A;  1YHB A;  1QVC A;  2F3I A;  1PYB A;  2E5L Q;  5C4J H;  1I94 L;  2NVQ H;  3NEM A;  2ZJP A;  2E2J H;  4A3I G;  4PZ6 A;  3NBH B;  1A0I A;  2E2I H;  3S16 H;  3GTL H;  1KL9 A;  4A93 H;  1VQH A;  1VQG A;  1VCI A;  2A19 A;  4RMF A;  2CCZ A;  4BY1 G;  2JA5 H;  4YCW A;  1CKM A;  1NY4 A;  1LYL A;  1L1O C;  4DR5 Q;  2KHI A;  4R4Q A;  4R4C A;  1VQD A;  2K5N A;  4GLV B;  2IX0 A;  4JG2 A;  3K80 C;  2MQH A;  3TEH B;  1SFO H;  3AEV A;  3J7Z C;  1PFS A;  5JJK A;  1XTD A;  4GS3 A;  2UUA L;  3HOY G;  3PIP A;  4GN5 A;  5JEA J;  2VQE L;  1HNW Q;  1KRS A;  1BBU A;  3KDF B;  4K0K Q;  1I94 Q;  4KHP Q;  2UXC Q;  3RN2 A;  4JBM A;  3GTJ H;  4YHH Q;  4IPC A;  4GOP A;  2VY3 A;  1HR0 W;  3FHW A;  2BA1 A;  1PH4 A;  4DR3 L;  4X62 Q;  1N8R C;  1EYG A;  1UE6 A;  4JI8 L;  4DR6 Q;  1T9H A;  1SMX A;  4LFC L;  2D62 A;  3CPF A;  5LMU L;  2NZH A;  3UE0 A;  4HID A;  1WI5 A;  4BBR G;  1BVS A;  1L2F A;  3T1Y Q;  1IBM L;  3F2D A;  4DV7 L;  2UU9 L;  2JK8 A;  3HOX G;  4A3I H;  3J81 c;  3RLO A;  2HHH Q;  4A3M G;  3PUX A;  3A5Z B;  2D0O A;  2EIF A;  4NB3 A;  4KHZ A;  3I56 A;  1VQP A;  1XMO L;  4BA2 I;  1HZ9 A;  2RF4 A;  2A8V A;  4GKK Q;  4DV2 Q;  1K9M C;  4NPS A;  4JI2 Q;  4LF9 L;  1Q82 C;  3GTQ H;  1NBW A;  4DUY L;  4HJA A;  4BY1 H;  1D8L A;  4LF5 L;  2K52 A;  2Z6K C;  3H3V H;  2JQO A;  1JE5 A;  5IYC G;  1EFW A;  2ZJR A;  3KLW A;  2L15 A;  1XNR L;  3GO5 A;  4AH6 A;  5FLM G;  4JYA Q;  2WB1 G;  2ID0 A;  1IYJ B;  4GNX C;  1AE3 A;  1OXX K;  4GOP B;  3U4Z A;  1A62 A;  3HOY H;  2R7F A;  4NXN Q;  4DV4 L;  4DV1 L;  4A4I A;  1V9P A;  2JA6 G;  1NE3 A;  2PQA A;  2IX1 A;  2EXD A;  1J5E L;  4DV7 Q;  5LMN L;  1I50 H;  1K8A C;  4JI0 Q;  1C7Y A;  2BH2 A;  1IXR A;  4A3F G;  1E24 A;  2R93 G;  1M90 C;  1PH7 A;  2XTI A;  1V43 A;  2AWO A;  4A3D G;  1X54 A;  4A3L G;  3M7N A;  4BXX G;  1P16 A;  3K0X A;  1X6O A;  4DPG A;  5C0X J;  2QGQ A;  4OWX B;  3NEL A;  4BBR H;  4MTN A;  4QY7 A;  1EQQ A;  3G4S A;  1VQL A;  3F1Z A;  1HR0 Q;  1OXV A;  3EBE A;  4ME3 A;  3HOX H;  4POG A;  1V1Q A;  3F8T A;  4A75 A;  4A3M H;  2B3G A;  2VNU D;  4LF6 Q;  2Q2I A;  1VQ6 A;  1OXS C;  4OO1 G;  1Q1B A;  3OTO L;  4QJF A;  1VQJ A;  4PG3 A;  4JI3 L;  4PZ8 A;  1PH5 A;  2F4V Q;  4IFD I;  1L1O B;  4UP7 A;  1CUK A;  3E9I A;  5HGQ A;  4DV1 Q;  3S17 H;  2AMC B;  3U50 C;  4AYB G;  5IYC H;  3HFZ B;  2CQO A;  3SGI A;  1C9O A;  2IY5 B;  3LGJ A;  4IPD A;  1XNQ Q;  2ZTC A;  4XTC S;  1W3S A;  2PNH A;  5FLM H;  1YVC A;  2KEN A;  4X65 L;  1WFQ A;  1GVP A;  3PO2 G;  4JI7 Q;  2NVY H;  4KLK A;  2E5L L;  2YU9 H;  1ASY A;  2HT1 A;  4IFD G;  3CQZ H;  1N32 Q;  4A3K H;  2JA6 H;  1IZ6 A;  3W5O A;  1YHQ A;  3S2H H;  4PZ7 A;  5GAH C;  3OTO Q;  1KRT A;  1TWA H;  4WJ3 M;  5IT9 c;  5JEA G;  3BZK A;  4A3D H;  1QUQ B;  3D0F A;  4YWL A;  4PMW A;  4DR5 L;  1A8V A;  1K0R A;  1MIU A;  5C4X H;  3S1R H;  1XMQ Q;  3GTM H;  2Q2T A;  3I4M G;  1PVO A;  4BXX H;  4LF8 L;  2CKZ B;  1HZB A;  3HKZ E;  3KF6 A;  2KHJ A;  3RNU A;  3H3V I;  3TRE A;  1VQ8 A;  2VW9 A;  1TWH H;  2NVT H;  1JJ2 A;  3B6Y A;  4MNO A;  4Y7N H;  4OX9 Q;  4P74 A;  2QA4 A;  1XPU A;  1HNW L;  4K0K L;  2N78 A;  1ASZ A;  4KHP L;  2UXC L;  3RZD H;  2C35 B;  1PH3 A;  1TWF H;  1SRO A;  2KCM A;  1KXL A;  3ERS X;  4YHH L;  2OQK A;  3CPW A;  1NJI C;  4QQB X;  2WFW A;  4DNI A;  3BU2 A;  1I5F A;  4GNX B;  3UDX A;  4A76 A;  2YTY A;  3VDY A;  1PHJ A;  1EOV A;  4X62 L;  1U5K A;  1IL2 A;  4A3B G;  3CCQ A;  5GAG C;  4DR6 L;  5GRO A;  3CMA A;  4QL5 A;  1YJW A;  3RR5 A;  3PO2 H;  3L2P A;  3PUY A;  3T1Y L;  4LF8 Q;  2HHH L;  3EIV A;  1WYD A;  1E1T A;  3NEN A;  3D31 A;  5K36 G;  3S15 H;  5IP9 G;  3AYH B;  4DV2 L;  4GKK L;  4JI2 L;  3GTO H;  1I3Q H;  2LXJ A;  4JI1 Q;  1VQI A;  3CCM A;  3S2D H;  2AHO B;  1S3O A;  4GLX A;  1WJJ A;  1UE1 A;  1K8G A;  1E1O A;  1VQE A;  3I4M H;  2LXK A;  4DR4 L;  3CC7 A;  1N36 L;  4JYA L;  3PCO B;  1Y1W G;  1Q8K A;  2R7Z G;  1X3E A;  4JC0 A;  3CCR A;  1CSP A;  4UY8 C;  2R92 G;  3TRZ A;  1HJP A;  2CWA A;  1NMG A;  2WAQ G;  3K8A A;  4NXN L;  3CCU A;  1CKN A;  3PF5 A;  2ZJQ A;  1WCM G;  3I4O A;  4IFD J;  2DUD A;  4LF7 Q;  3GTG H;  4DV6 Q;  2N49 A;  3CCL A;  4R4I A;  3JAM i;  4JI0 L;  3PV0 A;  4HIO A;  1X9N A;  1TWC H;  1G51 A;  1U0L A;  1VQO A;  1IBK Q;  1IBL Q;  1QZG A;  5FLX c;  3UE1 A;  2NVX H;  3ICE A;  3HOZ H;  3BZC A;  2F52 A;  3KJO A;  1EWI A;  2WP8 J;  4JCV E;  1HH2 P;  4A3B H;  2Y0S G;  4EQ5 A;  2YYZ A;  2I5L X;  1JT8 A;  1S72 A;  3I55 A;  1VQA A;  2I5M X;  1HR0 L;  4DR4 Q;  3GTP H;  1N36 Q;  3FKI H;  5FJ8 G;  4LF6 L;  3KFU A;  5M3M G;  4B3M Q;  3HKS A;  4LW1 A;  1DGS A;  2K14 A;  5IP9 H;  2F4V L;  1G29 1;  3H15 A;  5BR8 Q;  4DUZ Q;  2OQ0 A;  1UE5 A;  1YIJ A;  4A3K G;  4TQU S;  4A3C G;  4OO1 I;  3STB C;  5IYB G;  4XIG S;  2MNA A;  4C3H H;  3M9B A;  1N34 Q;  1W2B A;  1B70 B;  2Q2H A;  4LFA L;  4GKJ Q;  1XNQ L;  4A3L H;  1QVG A;  1CSQ A;  3GTK H;  1AH9 A;  5J3B A;  1GO3 E;  3AFP A;  3CME A;  1PA6 A;  4TVA B;  4HJ8 A;  1Y1W H;  4B3S Q;  3H0G G;  2R7Z H;  1K83 H;  1B7Y B;  2R92 H;  5C4X G;  3MXN B;  4JI7 L;  2YTV A;  4JBW A;  2K50 A;  1VQC A;  4IOC A;  4C3I H;  1WCM H;  1FGU A;  3M4Q A;  4IJL A;  4P72 A;  3STB D;  4DV3 L;  2YTX A;  1N32 L;  1O7I A;  3OYY A;  3WWV A;  2RCN A;  3L0O A;  4JV5 Q;  4IPG A;  1I6H H;  3HOV G;  3E0E A;  5AJ3 L;  2R7D A;  5GAE C;  1EQR A;  1UEB A;  1UWV A;  1LTL A;  1XMQ L;  4IO9 A;  3E9H A;  4YWM A;  1VQB A;  4JI4 Q;  1Q7Y C;  1X56 A;  4GLA C;  1Q12 A;  2V1C C;  3RN5 A;  4JOI A;  3G6E A;  1PH6 A;  4BA1 I;  2PQA B;  1XJV A;  4LFA Q;  4GN3 B;  4EX5 A;  4LFB Q;  1MKH A;  3PO3 G;  5FJ8 H;  1SRU A;  3K7U C;  2ALY B;  5M3M H;  1PH2 A;  2K75 A;  3K7A H;  2HQL A;  4YY3 Q;  4OX9 L;  1YZ6 A;  1N33 Q;  2FXQ A;  1KD1 C;  4DV3 Q;  2ES2 A;  4A3C H;  1NMF A;  3PUZ A;  4OXP A;  5IYB H;  2EQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...