1B53A

Nmr structure of human mip-1a d26a, minimized average structure
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
69
structure length
69
Chain Sequence
SLAADTPTACCFSYTSRQIPQNFIAAYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chemokine
molecule keywords MIP-1A
publication title Identification of amino acid residues critical for aggregation of human CC chemokines macrophage inflammatory protein (MIP)-1alpha, MIP-1beta, and RANTES. Characterization of active disaggregated chemokine variants.
pubmed doi rcsb
source organism Homo sapiens
total genus 1
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1b53A00
2L4NA 2RVLA 2L12A 1WTRA 2EPBA 1G2SA 1F2LA 1F9SA 1NCVA 1U4LA 3D6WA 2FHTA 1PDQA 1HUMA 3KUPA 3DEPA 5E4WC 1HFGA 3I8ZA 2EOTA 3SVMA 2IL8A 2HCIA 3GV3A 3GV6A 1BF4A 1VMPA 1CM9A 1G6ZA 2K28A 2NZ1D 4IUQA 1EL0A 3I3CA 5EPJA 1WTVA 1Q3LA 1ML0D 2R3ZA 2HUGA 1HFNA 2MPMA 1LV9A 1IKMA 4R9WA 2N88A 1HUNA 1F9RA 4LMQD 1BBXC 1NR2A 1S4ZA 2DY7A 1O7ZA 1TVXA 4X3UA 1NAPA 1B2TA 1JE4A 1PLFA 3HP3A 3QO2A 2L11A 1J8IA 4HAEA 4NW2A 1QG7A 4X3KA 2KUMA 1QE6A 1WVLA 1WD0A 2X6GA 2HDLA 4MN3A 5E4XA 2EE1A 4R8IA 2B2TA 3I90A 1MGSA 1ILQA 3UI2A 3F2UA 1XX8A 3N52A 4ZLTF 1B53A 3FDTA 2CVRA 2L1BA 4RWSC 4IUUA 3G7LA 2Q8TA 1CA5A 1ESRA 1ICWA 2JP1A 1GUWA 2B2YC 5CBAE 4IUTA 1M8AA 1KNEA 1MI2A 4CJ0B 1WTQA 4QUCA 4CJ2C 1F9QA 4RA8A 1WTXA 3TN2A 1B3AA 4X3SA 3DM1A 4DN4M 3TZDA 1U4MA 5T1GA 1EIHA 5CORA 2DY8A 1WTOA 1U4RA 4MHEA 3Q6SA 1X3PA 3H91A 2VXWA 4OIJA 1HRJA 2K04A 2FMMA 2JYOA 3MTSA 3IFDA 1NR4A 4HCSA 2K01A 2MP1A 2X6LA 3LWEA 1SSOA 4OIKA 5JJZA 1WTWA 1IKLA 1RODA 1AP0A 2RA4A 1PFBA 3IL8A 4CJ1B 3P7JA 1IL8A 1F9PA 1X32A 1ZXTA 4IUVA 1BO0A 1KNAA 2HCCA 2MGSA 5EJWA 1MSHA 1E0BA 1JICA 5EKIA 1BNZA 2L9HA 1A15A 2K03A 2J7ZA 5EPKA 4ZKCB 3KBXA 4RAUC 1DOMA 4ZAIA 1J9OA 2MJ8A 1O7YA 5D65A 1WD1A 1HA6A 4XT3B 5COYA 5EPLA 4XT1B 2H1EA 5DNFA 1CA6A 1DONA 5EQ0A 2KEEA 2B2WC 2B2UC 3I91A 2XIWA 1U4PA 3MWYW 2B2VC 1XYIA 1G2TA 2RSOA 2B2YA 1X3QA 5CBEE 1PFMA 1SDFA 2FINB 3DEOA 2FFKB 1C8CA 2KECA 1B4OA 4HEDA 1RTOA 1B50A 1EOTA 1DOKA 1RJTA 2SDFA 3R93A 2KOLA 1ILPA 2KVMA 4U68A 2B2TC 1DZ1A 2FJ2A 2BDNA 2B2WA 2B2UA 2RSNA 1AZQA 2M2LA 1G91A 2B2VA 1SAPA 2NWGA 4O42A 1WTPA 4IURA 2Q8RE 3ONAB 1PFNA 4QUFA 5T1IA 1QNKA 1RHPA 4IUPA 2NYZD 4UAIA 5CMDA 5D14A 1EQTA 4XDXA 3FPUB 2HDMA 2KEDA 2K1BA 4ZK9B 1EIGA 1RTNA 1MSGA 2D9UA 5AFWA 4ZKBB 1O80A 1HHVA 4X3TA 4HSVA 2X69A 2K05A 1AZPA 2N55A 1DOLA 1VMCA
chains in the Genus database with same CATH superfamily
1EYAA 1I3QB 2JA7B 1F9SA 4GKJL 4MTNA 4B3SQ 4HJ9A 1GUGA 4DV4Q 3I56A 4IJHA 4IPCA 1HNXQ 1ML0D 4K5XA 4JI3L 4OONA 4R9WA 1NR2A 1O7ZA 5FLXL 4HMJA 2GA4B 2DGYA 2L11A 1BCPB 3DHQA 4JI7L 3T16A 4GS3A 3GTMH 2ENBA 1Y14B 2HDLA 3I4NB 1PA6A 4A3FB 2CH4W 3TP7A 1XX8A 5IWAL 3KOJA 1YNJD 5FLMH 4BBSB 1SN8A 2UXDL 4IUUA 1VQGA 5C5MA 2K5QA 2I5MX 4B3RQ 1RF2D 5A35A 2PQAA 2Z6BA 5FO7B 4P71A 1PH7A 1TWFH 4MIUA 1CQVA 2EYPA 4RA8A 3CCUA 1HZAA 4K2KA 1JT8A 3CRLC 4GKJQ 1QNUA 2PMZB 1WCMB 1X3PA 3T4AC 2K04A 1UNSA 3TP6A 3PO3B 4Q5VA 2EY2A 4JI3Q 5EAYA 1I4HA 4DV7L 3K59A 1F9PA 4IUVA 2SNMA 1HCZA 2A6EC 2MGSA 4ABNA 4JI7Q 1FJGL 3G6JB 2WKCA 1CKNB 2K03A 3EN2A 3FRPB 4LNQA 1EQRA 2IHFA 2XN9C 1DOMA 4JW0A 4NXML 2EQSA 5M9OA 1TS3A 3U58A 5IWAQ 1H9JA 2Z1CA 3CCVA 2AQ1B 2UXDQ 1AEXA 4K8IA 3DWQA 1D5XC 4R4IA 1CHPD 2B2YA 1TS4A 4HJAA 1XNQL 1K83B 4OEMB 2KOLA 2D2CC 2R7ZB 4X6AH 4U68A 2KENA 2FJ2A 2WAQE 2M2LA 2F0OA 1J6QA 3SK6A 2CWPA 1J5EL 3K5LA 2A6HD 4GOPA 3HOWB 4JI8Q 1V1PB 2R6GA 1EQTA 4DV7Q 3RN2A 1LACA 1O80A 4H7BA 3OIPA 4KK7A 1U4LA 4ME5A 3DXJC 4NXMQ 3M9BA 1T5EA 2EOTA 2Y0SB 4JK1C 1KIXA 4UY8C 3UE1A 2YTYA 3I3CA 3GTKB 1LV9A 5D3IB 4BBRB 3E0JA 2DY7A 4QL5A 5C6AA 4A3KB 1M1KC 4BY1H 2UXCL 4YY3L 1RDPD 1JE5A 3NWTA 2K75A 4JPBW 1CHQD 4XXEA 5IGDA 2KUMA 2NVYB 3KJOA 4LFAL 1VQBA 1PH2A 4MN3A 2Q2IA 2K5HA 1B7YB 3A8KE 2XSCA 1TWAH 3PV0A 1J5EQ 3J7ZC 4BY7H 1ICWA 4M1UB 4CHTB 4Y52H 1QVCA 1HQRD 5M5XB 1Y1VG 3HOXG 2DUDA 1EQQA 1QZGA 4YHHL 4X66L 3HOYB 1SJED 2SNSA 2JEBI 1JCKB 3K7AH 1U4RA 5FLXE 3VA5A 1VQCA 1L2FA 3A54A 4JYAL 1KLUD 3CP0A 4FYDA 4X62L 1SSOA 4BXXG 3CD6A 1RODA 4A3EG 4ULLA 3S2HB 2RA4A 2UXCQ 1VDZA 4UDUC 2HT1A 1GHKA 1WFQA 1EU3A 3AFPA 4PV1C 4QQBX 1FYCA 1R4QB 4CKBA 4ILWA 4KHZA 2VUMG 2EVBA 3ND8A 5FOBB 4XT3B 4POGA 2Z6KC 4G7OC 5C5LA 1KHIA 4LF5L 4A4IA 3I91A 3MWYW 2CKZB 3PGZA 2Z9HA 4R4TA 5CV4A 3A56A 5M3MG 5M5WB 1SYGA 1U5KA 2XWJB 4CDDC 4X66Q 3QOJA 2ZXPA 1B44D 2KQ3A 2VB2X 4QJFA 1SEBD 1RD9D 1BUVT 3K0XA 2ZJQA 4OWWB 1RHPA 1HR0L 2A6ED 4DAYB 3R2TA 1G51A 4DV3L 4UP9A 1VQ6A 1EU4A 1ZEQX 3PUXA 3E5SA 5ELEA 2I0QA 2L4NA 4AH6A 1G2SA 3J80c 3OW7A 1HFGA 1VQKA 4ZQ3A 2ZJPA 1PRTB 5HY6A 5I2XA 1U9RA 4LF5Q 3NWSA 3VA7A 1IZ6A 2O5JC 3CRKC 3OSOA 4LFBL 3H0GH 4HR7B 3U50C 2KCCA 2G9DA 4KKUA 3CCRA 4XYQA 3CPWA 4XTCS 2F0SA 1X9NA 2X6GA 3OHXC 1WD0A 3VR5A 1V1OA 1GUSA 1X3FA 3SK5A 5IP7H 2R93H 1DJRD 1IHZA 3K80C 2VQFL 1HNZL 1HR0Q 3FPPA 1FNWA 2QILA 4IUTA 1DGSA 3SK4A 1Z47A 4DV3Q 4C3IG 5C44H 1VQJA 2BCOA 5D3DA 4IOAA 5JPNC 1A2TA 5DM73 1EY6A 3QR8A 4DV2L 3I4MG 1HRJA 4BWGB 2YTVA 4DXFA 3C2PA 3NBHA 4LFCL 3K5OA 2VW9A 1NR4A 2IWHA 2BE5D 4DV6L 3CC2A 1Q8KA 1Y1VB 3HOXB 2MP1A 4EVOA 1ET9A 5JJZA 4LFBQ 5C4ZA 3QB3A 3J81c 4RCNA 5ELNA 3SEBA 1JWMD 5LL6X 4DAVA 2NVQH 4LW1A 4A3GH 2NN6G 1I94L 4HN7A 4K8JA 4A3JH 2Z4HA 1JICA 2EXZA 3HG9A 1VQ8A 4FF3A 3I7FA 2E8GA 4F7XA 4IPHA 1Y1WG 3S16H 3MXUA 4PMWA 1BCPC 4A3EB 2QA4A 1HJPA 1HNZQ 1EFWA 2WACA 3I4OA 3M3YB 3FHWA 1Z6HA 1L1OA 1B4OA 3S1MH 1YNNC 2VUMB 2RHSB 2JA9A 1SNDA 5JAVA 3OTOL 1DZ1A 1N34L 2ATWA 4WJ4A 1CKOA 1S5FD 2KA7A 2R61A 4NP5A 5BN3A 1NE3A 1PFNA 4LFCQ 2HIXA 4DV6Q 2QKIC 3MHBA 2E74C 1QZHA 5AFWA 4JI6L 2BOSA 1HHVA 4R4QA 1I94Q 2N55A 4TVAB 3GTQH 1HA6A 3U4ZA 3UE0A 2F52A 2OTJA 3I70A 1TWCH 1GKHA 2ICEC 5IGEA 1YHBA 1LTAD 1C9OA 2K5NA 5FKAC 1J8IA 1PLFA 4F87A 4C56C 2Q2UA 4DXGA 4C2MB 5GADC 3CXCA 4N8X1 3OTOQ 2B63H 3OIQA 4YIJA 3KDFB 1N34Q 2OQ0A 4A3LG 3CQZH 4DUYL 3J80L 3HKZG 3E6ZX 4ZUJA 2JP1A 2LS01 1E3PA 1D5ZC 2ZM6L 1E1OA 3RLNA 4QMGA 3MVVA 2JK8A 3IKJA 4JI6Q 4G57A 2TSSA 2D0OA 4GLXA 3J7AF 5JJLA 2VY3A 1Q7YC 2M00A 3MFYA 3D4RA 2A1AA 2F0WA 3PUVA 1TWGH 2WAQG 3K6OA 2J0TD 3GTLH 4EQ5A 1IKLA 4BA1I 3ZJYC 4J1MA 4MZ9A 2EYJA 3JC66 3S1RB 3V2TA 5FK9C 3T53B 2JN4A 2JSOA 3AYHB 2RCNA 3I4MB 1M4VA 4IQZA 1STNA 1GUTA 2RQXA 1FL0A 4YWMA 3W5OA 1L0XB 2H1EA 4DUYQ 1CA6A 4H13C 2KEEA 3SXHA 4GLVB 1S40A 1LT5D 1PH5A 5IP9H 1NMFA 1N8RC 2ZM6Q 2FINB 2OQKA 5HGQA 1IBMQ 4RKLA 2KECA 2IT1A 1B50A 1SLJA 3R93A 3A8JE 3RMHA 4GNXB 3J81L 1KDBA 1CT1D 3NENA 4PQXA 1RIPA 1I3QH 2K5DA 2JA7H 5DM63 1H9RA 1Y1WB 3AQQA 3BZDB 2EY6A 2F0QA 1YITA 3TMEA 1QNKA 5E3FA 3WOEA 4JBMA 2IHEA 1X6OA 5CMDA 1B3QA 1DM0B 1RCVD 2K1BA 5CV9A 2D9UA 4GKKL 2ES2A 3RZOB 1KL9A 1MJCA 1WTRA 1HXYD 2FHTA 1PDQA 3S15B 2L15A 1H9SB 1BCPD 4A3FH 2BH2A 3GV6A 4K0KL 3Q8DA 2UXBL 3EBEA 1MIUA 5CV6A 4BBSH 1ASYA 4IZ8A 2F1MA 3K58A 3QO2A 1QG7A 4HIKA 3RZDB 1XNRL 1B8AA 3NBIA 4OGQC 4JI2L 2O5IC 1X3EA 1WCMH 2JA8G 2MO1A 3GTGB 3LNNA 2ZJRA 3I4NG 5M3FG 4C1NI 3PIP3 2QF7A 4DR1L 5EBDA 2NN6I 2D0PA 4P2CB 2R92G 4GKKQ 1X54A 3S14B 4C3JH 1KABA 3I72A 3G6EA 4DUZL 2H4OA 5HURA 2OF1A 3Q6SA 4DK3C 3T1HL 1KQSA 2A69D 5IYDG 2JYOA 3HOVG 4K0KQ 3W1GA 1CKMA 2B8FA 1BBWA 1IL8A 3PO3G 3J80E 1PMRA 3MXNB 1K83H 4H0LC 2NVXH 1QOHA 5G3LD 1PRTC 4DAPA 5EKIA 1BNZA 3B6YA 2R7ZH 2WAQB 5LL6S 1O7YA 4JI2Q 1PTOF 1AE2A 5COYA 1E2ZA 4EQOA 4PMBA 3NXWA 3HOWH 3W2DA 4DR1Q 2F3WA 2PW5A 1JC7A 1HNWL 2ASBA 4RGTA 4DFAA 1F2MA 1K9MC 4A3DB 1K8MA 4JBJA 4DUZQ 3T13A 4DR6L 2K4KA 1QWYA 3T1HQ 1JWUD 2EZVA 1K3RA 4IURA 5CV5A 1A8VA 1VQEA 5JPMC 1D1KA 2F3IA 3QWNA 4ME3A 3U9SA 4N9TA 2LXJA 2K32A 1Q8IA 1RTNA 4BBRH 1EWHA 2MQHA 4A3KH 3NHHA 1LO5D 1KAWA 3MEHA 3M4OB 3CHBD 3KUPA 3T51B 4DV5L 2HIVA 3IFTA 1SE8A 3A5ZB 2UUAL 1A3VA 2EXDA 3J81E 4DK6C 5C4XG 2ZTDA 2N88A 1F9RA 1S4ZA 5M5XH 1Y8OB 4K2LA 1HNWQ 5J22A 4NW2A 3BDOA 4KHVA 1LTID 3D6CA 3UI2A 5AJ3L 4L63B 4LF6Q 2Z4IA 3NK9A 3TQYA 2VZAA 4JBWA 2BA1A 1CKNA 1LT6D 4RWSC 2YU9B 2RDFA 1GXDC 1Q46A 3CMEA 1MJEA 2FXQA 4GLAC 1SROA 3S2HH 1WTXA 3EVQA 1FR3A 3OMGA 3TN2A 3K5MA 3FP9A 4A93G 2CQAA 1CSPA 4JI4L 3M7NA 4TQUS 3M4YA 4B08A 2JA8B 1BBUA 5C0XG 3PO2G 3KF6B 3L2PA 3AMUA 2IX3A 4WRDA 2FMMA 3V05A 4DV5Q 3IFDA 5M3FB 3HOYG 1LTGD 2UUAQ 1PHJA 2I46A 2IX0A 1VQMA 1WTWA 1PV4A 1TWHB 1TKWB 2R92B 1NJIC 2P5ZX 4LF4L 4XYOA 1UUPA 2NB0A 5EJWA 1NNXA 1S5BD 3A5UA 2WB1G 4F8MA 5AJ3Q 3FMCA 3HOVB 3HOUB 2K14A 3DLLA 2B2VC 3HRZC 3RR5A 4AYBE 4JI8L 5GROA 3NTIA 2XNAC 2ZT9C 4JI4Q 1ICFB 2B2TC 2RDGA 5EKKA 3OOCA 1AZQA 5IGGA 3CAMA 1EFID 5CR3A 1TS5A 4DPGA 2PO4A 1SMYD 2K7VA 1JJCB 2M9VA 2YV5A 1MD2D 1PRTD 3P75A 5I9PA 4LF4Q 2L0CA 4B3TL 2NZOA 1HTLD 4B9XA 5A2QL 2AMCB 2K05A 4EGVA 3D6WA 2JJQA 4LUZA 3I8ZA 3UDIA 1CFMA 2F0HA 4U673 3Q23A 5DAUA 1HTPA 3MC0B 3TS0A 2NZ1D 5CGKA 2R3ZA 3S1NB 3TP8A 3BVGA 4QF4A 3NP8A 3BVMA 2F0DA 1EY7A 3AB9A 5GAHC 4EX5A 4DK1A 1VQFA 2N78A 1VQDA 2H5XA 3PF4A 5C4XB 3GTPB 1Y1VH 3HOXH 2AWOA 3KK7A 1JB3A 5KGUA 4GNXC 1WTHA 1I4XA 2JA5G 1N36L 4B3TQ 2PQAB 4DN4M 1OXUA 4F88A 4HTHA 1E1TA 1DD2A 3N6RA 3KLSX 1Q1BA 1FVIA 2EYFA 3GO5A 4PZ6A 3F2BA 4HJ5A 2ICIA 4XQJA 5M5YB 3A7AB 4BXXH 5JJIA 1KDCA 3NPPA 4A3EH 4HIMA 3CMAA 3A55A 2Z0SA 1X32A 1S5DD 4A93B 3VR6A 2HQLA 3CU7A 4KV6A 2VUMH 3PO2B 1D7QA 3C46A 2MJ8A 1YBYA 2AUJD 3GDEA 3BJUA 4POFA 1STBA 4P75A 1W6KA 5M3MH 1EYCA 4CDEC 5LMNL 3DWPA 1N36Q 5E1FA 2WB1B 3RD4A 1ONLA 1L0YB 1TXYA 4YCUA 3I73A 1CSQA 4IO9A 4L5RC 1PVOA 3CF5A 3BVZA 2D5DA 4DK0A 4FNFA 5K36G 2IX1A 3FPUB 2EJFC 4FXGC 4E6IA 2MNAA 3CCLA 3P1HA 4LF9L 5IODA 1VMCA 3PUWA 2L12A 4OWXB 2L55A 2V1CC 4KY7A 3LGJA 2F0TA 4RKBA 2OCEA 1G6PA 3SK8A 2WP8J 2VNUD 1SYCA 4N9PA 4J15A 3M4PA 3NTKA 1LTSD 5LMNQ 4OO1G 3NE5B 3JAMi 5E4XA 4BS9A 5C0XI 1EYGA 5KIXA 5JVH3 1LABA 1TWFB 5A2QE 3OYYA 2CVRA 3BU2A 5NUCA 4K5VA 1O7IA 3G7LA 1CA5A 4C3IH 5FO8B 1VQAA 1SE4A 1V8QA 4LF7Q 4QUCA 4CJ2C 3S17B 3S1RH 4J6HA 2ALYB 4LF9Q 3GQBA 5LHY1 4FDBA 4RFBA 2F0LA 1I6VC 3PF5A 3I4MH 3H91A 1NY4A 3ITPA 3RUZA 1M90C 1E24A 2PYKA 5IOCA 1SE2A 1N33L 1QCBD 3LWEA 3VDYA 2IJ0A 2PPBC 2JA5B 1AP0A 5C0XJ 3Q0AA 3H6MA 2CH4A 2NN6H 2QCPX 3HFZB 3SHLA 1E0BA 2OEOA 4R1JA 1KAAA 4ZAIA 1WD1A 2ZXRA 1Y1WH 1WOCA 4QGUA 4A76A 1N32L 2F0UA 4KD4A 4RG1A 2J4XA 2YTXA 1CUKA 2WV6D 3KF8B 1D8LA 3X3MA 1A63A 5IT9c 5KNDA 3BYYB 1FGUA 3RZOH 4KLKA 1I50H 1ILPA 2L5TA 3CCQA 2NTTA 2AQ3B 1G8ZD 3S15H 2B2VA 2NWGA 4IALA 4DNIA 5E7NA 3ONAB 2A19A 2MHVA 1XXGA 2NZHA 5T1IA 1N33Q 1A2UA 2NYZD 4UAIA 5IY0A 3KDFA 1CI3M 1GOZA 2XTIA 4XIGS 4ZK9B 4P73A 2C35B 2A8VA 3GTJH 2JA6G 3TP5A 2F0EA 2AKWB 4A3MG 1HUMA 3TEHB 1V9PA 1X56A 3RZDH 2LMCB 1YJ9A 3SVMA 2HCIA 2NTSA 1ZKOA 1N32Q 5IYCG 1WTVA 1QUQB 3GTGH 4RGNA 3R2IA 2NUCA 2RCFA 1IBLL 1PZJD 2OXPA 1TVXA 1LTTD 1JE4A 1STEA 1HQMC 3S14H 4BY7B 4C3HG 1VQ7A 3ER0A 4X64L 1BVSA 2KHSA 4A3LH 2L1BA 1A3UA 4KN4C 1E7ZA 1OXVA 4HMIA 2A73B 2CW0C 3VR2A 2Q2TA 4JOIC 3CCJA 2F4VL 1LYLA 1T5XD 3GP7A 4CJ0B 1N9WA 4AYBG 2F0JA 5IGBA 2PNRC 3TZDA 5T1GA 1EIHA 2Z8LA 4RGMA 1GJXA 4MHEA 4HJ7A 1YJNA 3NEMA 3ULJA 3G4SA 2BDOA 3MTSA 3TRZA 5ELBA 4GN3B 4IFDG 2E2HB 3C3LA 1JR0D 2WIIB 4JVZA 4JBKA 3NBHB 3NTHA 1IBLQ 1D5MC 3J7A5 4WORA 2ZTCA 3H3VI 4CDCC 1DCZA 1YJWA 3QG1A 1IBML 1EY8A 2L9HA 5I9OA 1PZKD 3W3AA 4X64Q 1YIJA 3I55A 4IJLA 5KNBA 2UU9L 3S1QB 1K73C 1PH4A 5EQ0A 4YCVA 4Y7NB 2XIWA 1H9SA 1NBWA 1PFMA 1Q12A 2F4VQ 5I2YA 4DKAC 1F77A 1RTOA 1CTMA 1QILA 1I4QA 4DAMA 1DOKA 1DYQA 3FKIG 3M4OH 1L1OB 4KHPL 1I6HB 2RSNA 3AFQA 4G4KA 5FJ8G 2UUBQ 1OXXK 5I6YA 4A3DG 1TR5A 1D6EC 3EIVA 1L0WA 4XDXA 4DF7A 3PUZA 3D8GA 2HDMA 5GAGC 4OO1I 4LJZC 2HQEA 4NDXA 1F2LA 5IT9L 1PTOB 1PYWD 1EOVA 3BG3A 2BH8A 2Z6KA 3BZKA 3GV3A 1VMPA 1BF4A 2UU9Q 4WJ3M 5JEAG 5TSSA 4V190 4DR7L 3NSWA 1AFPA 1HFNA 1BBXC 5BR8Q 2JA6B 2F0VA 1I4RA 3M7GA 3KBGA 4A3MB 2IY5B 3D4DA 1QE6A 5ELDA 3TBIB 4KHPQ 3HOZG 1XMQL 3MXNA 2JA8H 1KTKA 4ZLTF 5IGFA 1B53A 3I4NH 5M3FH 2Q8TA 1ESRA 3K57A 2B2YC 2FMCA 4N8FA 4UPAA 4K5WA 2R92H 1TWHH 1MI2A 1YNND 1B3AA 4C3HB 2N49A 2AWNA 4ALPA 3K8AA 4NB3A 4A3IG 1IW7C 5IYDH 3HOVH 1TT2A 5IGCA 3T1YL 1VQ5A 2K5VA 4FF1A 4DNRB 4CDFC 1ZYRC 2X6LA 4A3JB 4DR7Q 3S2DB 4AQYL 2GN5A 4AYBB 3PO3H 1ZXTA 2JEAI 1KNAA 4GN5A 1D1IA 3WDNA 2OWOA 4GN4B 2NBFA 1HR0W 2EYMA 1XMQQ 1J9OA 4RMFA 3URYA 4JC0A 2CW0D 4WFN3 1QVGA 1KDAA 4FF2A 1MBYA 1G2TA 3OMCA 3TREA 4K14A 1XJVA 2RBMA 5CBEE 1Q86C 4JI0L 3HOUG 2K6AA 1W6JA 4HEDA 4UP8A 1K8AC 1EWIA 4DGZA 4IPGA 1SYEA 3CPFA 4FF4A 5JJKA 3T1YQ 4DA2A 1FD7D 4KTAA 4LF8L 3S24A 3H15A 5D14A 3S1NH 4AQYQ 1GVPA 3VR4A 3X3NA 1EIYB 4ZKBB 3FKIB 4TRDA 5J39A 2HD3A 2EPBA 3PSIA 4A75A 4HSPA 4L5QA 2PW7A 3DEPA 3A0JA 1UWVA 1JJ2A 4RGOS 4LF6L 1EL0A 1Q3LA 5C4XH 2EIFA 3GTPH 1TY2A 1KXLA 1K28A 4JI0Q 4X3UA 3DMUA 3MZ5A 4DR3L 3IAYA 3GTKH 5J3BA 1VQHA 4R8IA 4OWTB 3F2UA 2RHQB 1I4PA 3PMFA 4KKTA 3RNUA 4HIOA 2NVYH 4IFDI 4A3CG 2A6HC 3ZYYX 4LF8Q 5IT9E 1TY0A 4KMUC 1VQOA 5M5YH 3ERQA 3HZXA 3STBC 3C1EA 1Z7TA 1VQIA 1A3TA 2EYLA 5CV7A 5I6WA 1S5CD 1WTQA 1F9QA 1TQOA 3DUZA 2PCFB 1YEZA 4A93H 2E75C 3HOZB 2F0KA 1U4MA 5FO9B 5C0XH 5CORA 3PO2H 2CCZA 1WTOA 5C3XA 5IYBG 1TU2B 3E9IA 5KYLA 5JVG3 3GTOB 3HOYH 1IYJB 3KYHC 3R3OA 4LAAA 3V96A 4ZCKA 4UP7A 1HA5A 4HCSA 5ELOA 3H3VC 4OIKA 2F4IA 1LTLA 1GUOA 2E2JB 2F0GA 2Q2HA 3SR1A 2EY1A 1SYFA 1MSHA 2QW7A 1PYSB 4YCWA 4DR3Q 4FXDA 2I5HA 1SYBA 4XQQA 4A3IB 4IFDJ 4RAUC 4EQNA 3CCMA 2CQOA 1SNMA 1W2BA 1QB5D 1R9TB 4KY6A 1Q90A 5GQOA 3L7ZC 1U4PA 2VS1A 4O2DA 3R8BA 3CW2C 2OTLA 1UEAB 5C3EG 2IW3A 1STYA 1EYDA 1P8LA 2EDGA 2ZTEA 1XWEA 5CV8A 2SDFA 1ENAA 1FGBD 1IW7D 1LM0A 2A68C 1PFSA 3JAMc 1Y69U 5M5WH 1A6XA 2E2IB 3VYRA 2XGTA 1ZYRD 2DJFC 1V1PA 3BDLA 2JE6I 1LTRD 3KLWA 1SFOB 4A3BG 4IN3A 1K8GA 2DN8A 2KEDA 2PI2A 3OPOA 1EIGA 1MSGA 5C4JB 1VQLA 3P20A 4ID6A 4BA2I 3W1BA 3L0OA 1AE3A 1NCVA 3PIPA 1CK1A 3D0FA 2F0IA 1LT3D 4NXNL 2IL8A 1P16A 1CM9A 1IYUA 1SBBB 4QIWE 1B9NA 1K3BC 1JOOA 1S3OA 3DWAA 3S17H 3LX0A 5JEAJ 4PG3A 2EE1A 5IE8A 1PH9A 4FXKC 4DNTB 2SOBA 1CZGA 3QJYA 2XRSD 3CC7A 4B3ML 5KNCA 5FLMG 4L8JA 2E2DC 4C3JB 4O0AA 2VQEL 5CYUA 2JA5H 1L1OC 4PMCA 1JMCA 3HKZE 1VQNA 1U0LA 3D4WA 3NQIA 1SXTA 5EGTA 4QY7A 5CC4A 3K7UC 2XRQD 4NXNQ 1IL2A 5HGTA 1BOSA 4PZ7A 4AIMA 2NVXB 2K01A 1YZ6A 4NMZA 5ISRA 1B1ZA 2NVTB 1I4GA 1C48A 3VYTA 4DR5L 1PTOC 1S72A 2QDLA 4O1NA 3F2CA 1KD1C 1SMXA 4JI1L 3RLFA 5LMUL 4HJ8A 3LWUA 3PQIA 5L37A 2DJGC 2EYHA 5EPLA 4NPSA 3NUCA 3STBD 4B3MQ 1GUNA 2B2WC 1YHQA 1JOKA 1O7LA 2RSOA 1WJJA 1X3QA 1FJGQ 2VQEQ 1UE5A 1K8OA 1EOTA 1RJTA 1BCPF 1UAPA 3H3VH 4HCEA 1YI2A 1EEID 3M3YH 3RN5A 2PNHA 2MFIA 2F0MA 2PZTA 1SAPA 2KCTA 4DAYA 1CQFA 1XTDA 2BE5C 1XNQQ 3TS2A 3EA6A 4X65L 5C3EB 4IUPA 5K36H 1A62A 3HGBA 4K6LA 5K5PA 4I65A 4DR5Q 1BKBA 2AHOB 4S3SA 3A7LA 1KRSA 1CZWA 4L5SA 4KD3A 4JI1Q 5LMUQ 1HZCA 1PH3A 3M4QA 3ULPA 1FNUA 3JAML 3U9OA 4A3BB 5DEHA 1V43A 4APVA 5H1SE 1TS2A 4RHRA 3GD7A 3MEFA 2F03A 2A68D 1DXMA 2ZXOA 1B2TA 4BY1G 3UDGA 4OO1H 4HAEA 2E5LL 4X3KA 1RL2A 4RCOA 3Q24A 4LF7L 2QEJC 3OW2A 5KRUA 4GOPB 1MGSA 1BQQT 2VL6A 4C2MH 1I5FA 4YY3Q 4X65Q 4BY7G 4C1NK 1KC8C 2E2HH 5CBAE 1IBKL 1M8AA 5G3LF 2CFMA 1KNEA 4LFAQ 4P72A 4K6DA 3GTMB 3PUYA 2B29A 3KF8A 4IOCA 2F3VA 4JV5L 4OIJA 1B70B 2C5CA 4KN7C 4M8AA 2F0NA 3BZCA 3CCSA 1VF5C 3S1QH 4H44C 3FEWX 5F2DA 4Y7NH 4YHHQ 1BDOA 1UE7A 1PFBA 2QGQA 3IL8A 4CJ1B 1MHWC 3P7JA 1EY0A 5KYIA 4JCVE 2E5LQ 2MO0A 1NSNS 1A15A 2XVSA 4JYAQ 4ZKCB 2PMZE 1I6HH 4X62Q 3HKSA 5GAEC 2K33A 4WJWA 1NUCA 1GO3E 2JXMB 4EQPA 1Z9FA 1IBKQ 3DEOA 1II3A 1C8CA 3D31A 1QUQA 1YNXA 2KVMA 2O2LD 1G91A 2BA0A 4JV5Q 3WWVA 1PTOH 2RKSA 3CKIB 1Y8NB 2LSSA 1NMGA 3E3XA 3F2DA 2O4XA 4L6TB 1PTOD 1C4QA 1PXUA 2JA6H 1KRTA 1AZPA 1F2ZA 2Q8RE 3CCEA 4A3MH 3NELA 2K5WA 5E4WC 4LUVA 1EIFA 2E76C 3J81j 5IYCH 5EKLA 2CWAA 4IUQA 5EPJA 1ET6A 2HUGA 4ZUIA 3VYSA 2MPMA 1IKMA 1HUNA 4LMQD 2DNCA 3H0GG 3HP3A 1JB7A 3EFXD 2PI2E 4C3HH 1VF7A 2B2TA 1Q81C 1JJGA 2Y0SE 3N52A 5IP7G 2R93G 4DV1L 1GM5A 2PZWA 3A74A 1STAA 2Q8IB 3RLOA 1H95A 4NKLA 1AW7A 1O78A 4DR2L 1QJOA 2SEBD 4BY1B 5BN4A 3S2DH 4QCLA 1D2BA 3JAME 1SJHD 1RKNA 5C44G 3H94A 4KY5A 1ASZA 4X3SA 3BDCA 4KJNA 4KI0A 3ICEA 2DY8A 2VQFQ 1XTCD 1TWAB 1HH2P 1PH8A 2LKVA 3PIO3 2EJMA 4V0BA 3MAQA 1A0IA 4IFDH 4DR4L 3HS0C 4FO2A 5ELCA 1BO0A 4A3GG 4DV2Q 1Y8PB 4A3JG 2N3SA 4LUOA 4G7ZC 1PH1A 3K7AB 5EPKA 3SDZA 5M3MB 5IIFA 3G48A 4R8NA 5D65A 4IUNA 1E2WA 1X3GA 5DNFA 3F1ZA 4RHSA 2OT2A 3FVQA 4DV1Q 1PRTF 3E9HA 2B2UC 1XYIA 1EUJA 2LY7A 2WB1E 2WFWA 1C0AA 4GNXA 1X55A 4DR2Q 2UUBL 2N8NA 3K5NA 2K50A 1LUZA 5BN5A 3D3RA 1JQYD 3M85A 3FKIH 1X65A 2B2WA 4YWKA 2GVAA 3HEJA 2A69C 4O42A 1OXSC 3L9AX 1AN8A 1SNQA 4I7AA 3U4VA 5FJ8H 4QUFA 2YYZA 1JOQA 4A3DH 1PH6A 2ID0A 3C1FA 5EBCA 4DR4Q 2EYOA 2R7DA 3UDFA 1VS0A 1SNCA 1EY9A 1UEBA 4I7ZC 1SRUA 4X3TA 2EY5A 2MUYA 2KJXA 4ZYSA 3DM1A 1DOLA 2GVBA 1QVFA 2RVLA 5BR8L 3QOLA 3ERSX 4DV0L 3O13A 3J7AV 2F0FA 2K28A 1LT4D 5JEAH 3Q22A 2WKDA 4CGYB 2HHHL 4CKCA 2QDBA 4QB4A 1SE3A 2KHIA 1NAPA 1EZ6A 4KKSA 1YVCA 2EJGC 5ELFA 1WVLA 2I5LX 2V4DA 4G7HC 3HOZH 1B9MA 2WINB 1ILQA 1VCIA 2B63G 5I4DA 2A5HA 1LLRD 4C3IB 1OTCA 3KJPA 4Z9CB 1H9KA 3GTOH 1EWCA 3I2ZA 3VYUA 3H0GB 4JI5L 2A74C 3KLRA 1SNOA 2E2JH 1E2VA 3MXPA 2YU9H 3TDQA 3J80i 3IRBA 3EROA 4OELB 4A3IH 2R93B 4DV0Q 2LXKA 3KLSA 5C3WA 5LMNW 3E0EA 4OX9L 1R9TH 2HHHQ 1EZ8A 5C44B 4FP5D 1STGA 3NQTA 2JQOA 3TZUA 2KBNA 4B9WA 4CKEA 3KBXA 1JWSD 4TKOB 4PNYA 4UHVA 1BXTA 2E2IH 3AEVA 4GZYC 3MFGA 2VB3X 4XT1B 3SGIA 1DONA 2G9HD 3ND9A 1OO9B 1LTBD 1I50B 1C7YA 1STHA 4JI5Q 1SFOH 2NVQB 3HOUH 5IP9G 4A3GB 5J1ZA 1EQVA 4GOPC 3G71A 3TSSA 1MKHA 4Q0FA 5C4JH 5JOBA 1VQPA 2BDNA 2JA7G 1JORA 1XPUA 5DLQE 1SYDA 1WTPA 4XQNA 3S16B 4CBVA 4JG2A 5FLXc 1IYVA 4OX9Q 3GTJB 3PIOA 2PQEA 1YNJC 4QIWB 4TSSA 3J81i 2I07B 3S1MB 4RH6A 1EY4A 4OHJA 3J7YW 3BS1A 2UUCL 1VQ4A 4KJOA 4A3FG 4YWLA 4R4CA 3ULLA 1G6ZA 1EEFD 1BR9A 1TIID 3MXGA 3AU7A 1F2YA 1H9MA 1S5ED 1HZBA 4BBSG 5KEEA 4H02A 1Q1EA 4ZRZA 3PCOB 4PZ8A 2DNEA 3A8IE 4R4OA 1KLGD 2B3GA 3SE0A 1XPOA 1W3SA 3GTQB 2D62A 3HKZB 2PZUA 1K0SA 1V1QA 3OWFA 3I90A 2UXBQ 3EQLC 3K81C 1WI5A 4LWCA 1SR3A 1TWCB 2CHBD 3F8TA 1WCMG 2F0PA 4A3CH 3FDTA 4MNOA 1SMYC 1GD7A 1ENCA 3L3OC 1UE1A 2KCNA 1GUWA 1NTGA 4FVMA 2RF4A 1XNRQ 2KHJA 3OWEB 2NVTH 3KF6A 4OL7A 4IPDA 1PYBA 4C3JG 1HZ9A 1ENFA 2B63B 4MTKA 5IYBH 1T9HA 2UUCQ 3QIAA 2VXWA 3CQZB 3BYTB 3EJIA 2AUKA 4J8QA 1XMOL 3MA2B 1R4PB 2QEXA 1OXTA 2TMPA 4OXPA 3S9WA 2HCCA 4LK1C 1ESFA 2LFNA 5C4HA 2B39A 1EY5A 4ODGA 2IPKD 4B3SL 2J7ZA 3DM3A 4DV4L 2R7ZG 2AQ2B 1TWGB 1IXRA 3UDXA 1HNXL 4P74A 1XPRA 1PZID 4L5TA 3GTLB 2C9OA 2B8GA 4DU9A 2K52A 5C3EH 2KCMA 1E22A 4HIDA 3HOWG 3H09A 4JOIA 1SDFA 2FFKB 1UE6A 2G5DA 3VR3A 2XWBB 3T56B 3CC4A 1HPCA 1AH9A 3I4LA 3K0YA 2B2UA 1WYDA 2RDHA 1YHAA 1XMOQ 1GHJA 2Y0SG 3WOFA 1VQ9A 4A3BH 1G291 1K0RA 1FNVA 4B3RL 3KFUA 1SNPA 4BBRG 1Q82C 4DR6Q 4A3KG 4HSVA 2X69A 2R7FA
chains in the Genus database with same CATH topology
1EYAA 1I3QB 2JA7B 1F9SA 1GUGA 1ML0D 4K5XA 4R9WA 1NR2A 1O7ZA 5FLXL 4HMJA 2GA4B 2L11A 1BCPB 3DHQA 3T16A 2ENBA 2HDLA 3I4NB 4A3FB 3TP7A 1XX8A 1YNJD 4BBSB 4IUUA 5C5MA 2K5QA 1RF2D 5A35A 5FO7B 4MIUA 1CQVA 2EYPA 4RA8A 4K2KA 3CRLC 1QNUA 2PMZB 1WCMB 1X3PA 3T4AC 2K04A 1UNSA 3TP6A 3PO3B 4Q5VA 2EY2A 1I4HA 3K59A 1F9PA 4IUVA 2SNMA 1HCZA 2A6EC 2MGSA 4ABNA 3G6JB 2WKCA 2K03A 3FRPB 2XN9C 1DOMA 5M9OA 1TS3A 1H9JA 2Z1CA 2AQ1B 1AEXA 4K8IA 3DWQA 1D5XC 1CHPD 2B2YA 1TS4A 1K83B 2KOLA 2D2CC 2R7ZB 4U68A 2FJ2A 2M2LA 2F0OA 3SK6A 3K5LA 2A6HD 3HOWB 1V1PB 2R6GA 1EQTA 1LACA 1O80A 4H7BA 3OIPA 4KK7A 1U4LA 4ME5A 3DXJC 1T5EA 2EOTA 2Y0SB 4JK1C 3I3CA 3GTKB 1LV9A 5D3IB 4BBRB 3E0JA 2DY7A 5C6AA 4A3KB 1RDPD 3NWTA 1CHQD 4XXEA 5IGDA 2KUMA 2NVYB 4MN3A 3A8KE 2XSCA 3PV0A 1ICWA 4M1UB 4CHTB 5M5XB 1HQRD 3HOYB 1SJED 2SNSA 2JEBI 1JCKB 1U4RA 5FLXE 3VA5A 3A54A 1KLUD 4FYDA 1SSOA 1RODA 4ULLA 3S2HB 2RA4A 1VDZA 4UDUC 1GHKA 1EU3A 4PV1C 1FYCA 1R4QB 4CKBA 4ILWA 4KHZA 2EVBA 3ND8A 5FOBB 4XT3B 4G7OC 5C5LA 3I91A 3MWYW 5CV4A 3A56A 5M5WB 1SYGA 2XWJB 3QOJA 2ZXPA 1B44D 2KQ3A 2VB2X 1SEBD 1RD9D 1BUVT 1RHPA 2A6ED 3R2TA 1EU4A 1ZEQX 3PUXA 3E5SA 5ELEA 2L4NA 1G2SA 3OW7A 1HFGA 4ZQ3A 1PRTB 5I2XA 1U9RA 3NWSA 3VA7A 2O5JC 3CRKC 3OSOA 4HR7B 2KCCA 2G9DA 4KKUA 4XYQA 4XTCS 2F0SA 1WD0A 2X6GA 3OHXC 3VR5A 1V1OA 1GUSA 3SK5A 1DJRD 1IHZA 3FPPA 1FNWA 2QILA 4IUTA 3SK4A 1Z47A 4C3IG 2BCOA 5D3DA 5JPNC 1A2TA 5DM73 1EY6A 1HRJA 4BWGB 4DXFA 3C2PA 3NBHA 3K5OA 1NR4A 2IWHA 2BE5D 1Y1VB 3HOXB 2MP1A 4EVOA 1ET9A 5JJZA 5C4ZA 3QB3A 4RCNA 3SEBA 4DAVA 1JWMD 5LL6X 2NN6G 4HN7A 4K8JA 2Z4HA 1JICA 2EXZA 3HG9A 4FF3A 4F7XA 3MXUA 4PMWA 1BCPC 4A3EB 2WACA 3M3YB 1Z6HA 1B4OA 1YNNC 2VUMB 1SNDA 5JAVA 1DZ1A 1S5FD 2KA7A 2R61A 4NP5A 5BN3A 1PFNA 2QKIC 3MHBA 2E74C 5AFWA 2BOSA 1HHVA 2N55A 1HA6A 3I70A 2ICEC 5IGEA 1LTAD 5FKAC 1J8IA 1PLFA 4F87A 4C56C 4DXGA 4C2MB 3OIQA 4YIJA 3J80L 3E6ZX 4ZUJA 2JP1A 2LS01 1D5ZC 4QMGA 3MVVA 3IKJA 4G57A 2TSSA 3J7AF 2M00A 3MFYA 3D4RA 2F0WA 3PUVA 3K6OA 2J0TD 1IKLA 4BA1I 4J1MA 2EYJA 3S1RB 3V2TA 5FK9C 3T53B 2JSOA 3I4MB 1M4VA 4IQZA 1STNA 1GUTA 2RQXA 1L0XB 2H1EA 1CA6A 4H13C 2KEEA 3SXHA 1LT5D 2FINB 4RKLA 2KECA 2IT1A 1B50A 3R93A 3A8JE 3RMHA 3J81L 1KDBA 1CT1D 4PQXA 2K5DA 5DM63 1H9RA 1Y1WB 3BZDB 2EY6A 2F0QA 3TMEA 1QNKA 5E3FA 3WOEA 5CMDA 1DM0B 1RCVD 2K1BA 5CV9A 2D9UA 3RZOB 1WTRA 1HXYD 2FHTA 1PDQA 3S15B 1H9SB 1BCPD 3GV6A 5CV6A 4IZ8A 2F1MA 3K58A 3QO2A 1QG7A 3RZDB 3NBIA 4OGQC 2O5IC 3GTGB 3LNNA 4C1NI 3PIP3 2QF7A 5EBDA 2NN6I 4P2CB 3S14B 1KABA 3I72A 2H4OA 5HURA 2OF1A 3Q6SA 2A69D 2JYOA 2B8FA 1IL8A 3J80E 1PMRA 4H0LC 1QOHA 5G3LD 1PRTC 4DAPA 5EKIA 1BNZA 2WAQB 5LL6S 1O7YA 1PTOF 5COYA 1E2ZA 4EQOA 4PMBA 3NXWA 3W2DA 2F3WA 2PW5A 1JC7A 4RGTA 4DFAA 1F2MA 4A3DB 1K8MA 3T13A 1QWYA 1JWUD 2EZVA 4IURA 5CV5A 5JPMC 1D1KA 3QWNA 3U9SA 4N9TA 2K32A 1Q8IA 1RTNA 1EWHA 3NHHA 1LO5D 3MEHA 3M4OB 3CHBD 3KUPA 3T51B 3IFTA 1A3VA 3J81E 2N88A 1F9RA 1S4ZA 1Y8OB 4K2LA 5J22A 4NW2A 3BDOA 4KHVA 1LTID 3D6CA 3UI2A 4L63B 2Z4IA 3NK9A 4JBWA 2BA1A 1LT6D 4RWSC 2YU9B 2RDFA 1GXDC 1WTXA 3EVQA 1FR3A 3OMGA 3TN2A 3K5MA 2CQAA 3M7NA 4TQUS 3M4YA 4B08A 2JA8B 5C0XG 3AMUA 2IX3A 4WRDA 2FMMA 3V05A 3IFDA 5M3FB 1LTGD 2I46A 2IX0A 1WTWA 2R92B 1TWHB 1TKWB 4XYOA 1UUPA 2NB0A 5EJWA 1S5BD 4F8MA 3FMCA 3HOVB 3HOUB 2B2VC 3HRZC 3NTIA 2XNAC 2ZT9C 2B2TC 2RDGA 5EKKA 3OOCA 1AZQA 5IGGA 1EFID 5CR3A 1TS5A 2PO4A 1SMYD 2K7VA 2M9VA 1MD2D 1PRTD 3P75A 5I9PA 2L0CA 1HTLD 4B9XA 5A2QL 2K05A 4EGVA 3D6WA 3I8ZA 1CFMA 2F0HA 4U673 3Q23A 5DAUA 1HTPA 3MC0B 2NZ1D 5CGKA 2R3ZA 3S1NB 3TP8A 3BVGA 4QF4A 3NP8A 3BVMA 2F0DA 1EY7A 3AB9A 4DK1A 5C4XB 3GTPB 2AWOA 3KK7A 1JB3A 5KGUA 1I4XA 4DN4M 1OXUA 4F88A 4HTHA 1DD2A 3N6RA 3KLSX 1Q1BA 3GO5A 2EYFA 2ICIA 4XQJA 5M5YB 3A7AB 1KDCA 3NPPA 3A55A 1X32A 1S5DD 4A93B 3VR6A 3CU7A 4KV6A 3PO2B 3C46A 2MJ8A 2AUJD 1STBA 1W6KA 1EYCA 3DWPA 5E1FA 2WB1B 3RD4A 1L0YB 1ONLA 3I73A 3BVZA 2D5DA 4DK0A 4FNFA 5K36G 2IX1A 3FPUB 2EJFC 4FXGC 4E6IA 3P1HA 5IODA 1VMCA 3PUWA 2L12A 2L55A 4KY7A 2F0TA 4RKBA 3SK8A 2WP8J 2VNUD 1SYCA 4N9PA 3NTKA 1LTSD 4OO1G 3NE5B 5E4XA 4BS9A 5C0XI 5KIXA 5JVH3 1LABA 1TWFB 5A2QE 2CVRA 5NUCA 4K5VA 3G7LA 1CA5A 5FO8B 1SE4A 1V8QA 4QUCA 4CJ2C 3S17B 4J6HA 3GQBA 5LHY1 4RFBA 2F0LA 1I6VC 3H91A 3ITPA 3RUZA 2PYKA 5IOCA 1SE2A 1QCBD 3LWEA 2PPBC 2IJ0A 2JA5B 1AP0A 5C0XJ 3Q0AA 3H6MA 2NN6H 2QCPX 3SHLA 1E0BA 2OEOA 1KAAA 4ZAIA 1WD1A 2ZXRA 2F0UA 4KD4A 2J4XA 2WV6D 3X3MA 5KNDA 3BYYB 1ILPA 2L5TA 2NTTA 2AQ3B 1G8ZD 2B2VA 2NWGA 4IALA 3ONAB 2MHVA 1XXGA 5T1IA 1A2UA 2NYZD 4UAIA 1CI3M 1GOZA 4XIGS 4ZK9B 3TP5A 2F0EA 1HUMA 2LMCB 3SVMA 2HCIA 2NTSA 1ZKOA 1WTVA 4RGNA 3R2IA 2NUCA 1PZJD 2OXPA 1TVXA 1LTTD 1JE4A 1STEA 1HQMC 4BY7B 4C3HG 2KHSA 2L1BA 1A3UA 4KN4C 1OXVA 4HMIA 2A73B 2CW0C 3VR2A 1T5XD 3GP7A 4CJ0B 2F0JA 5IGBA 2PNRC 3TZDA 5T1GA 1EIHA 2Z8LA 4RGMA 1GJXA 4MHEA 2BDOA 3MTSA 5ELBA 4IFDG 2E2HB 3C3LA 1JR0D 2WIIB 3NTHA 1D5MC 4WORA 1DCZA 3QG1A 1EY8A 2L9HA 5I9OA 1PZKD 3W3AA 5KNBA 3S1QB 5EQ0A 4Y7NB 2XIWA 1H9SA 1PFMA 1Q12A 5I2YA 1F77A 1RTOA 1CTMA 1QILA 1I4QA 1DOKA 1DYQA 1I6HB 2RSNA 4G4KA 1OXXK 5I6YA 1TR5A 1D6EC 4XDXA 4DF7A 3PUZA 3D8GA 2HDMA 4OO1I 4LJZC 2HQEA 4NDXA 1F2LA 5IT9L 1PTOB 1PYWD 3BG3A 1BF4A 3GV3A 1VMPA 5JEAG 5TSSA 4V190 1AFPA 3NSWA 1HFNA 1BBXC 2JA6B 2F0VA 1I4RA 3M7GA 3KBGA 4A3MB 3D4DA 1QE6A 5ELDA 3TBIB 3MXNA 1KTKA 4ZLTF 5IGFA 1B53A 2Q8TA 1ESRA 3K57A 2B2YC 2FMCA 4K5WA 1MI2A 1YNND 1B3AA 4C3HB 2AWNA 1IW7C 1TT2A 5IGCA 4FF1A 4DNRB 4A3JB 1ZYRC 2X6LA 3S2DB 4AYBB 1ZXTA 2JEAI 1KNAA 1D1IA 3WDNA 2NBFA 2EYMA 1J9OA 3URYA 4WFN3 2CW0D 1KDAA 4FF2A 1MBYA 1G2TA 3OMCA 4K14A 2RBMA 5CBEE 2K6AA 1W6JA 4HEDA 4DGZA 1SYEA 4FF4A 4DA2A 1FD7D 4KTAA 5D14A 3X3NA 3VR4A 4ZKBB 3FKIB 4TRDA 5J39A 2EPBA 4HSPA 2PW7A 3DEPA 4RGOS 1EL0A 1Q3LA 1TY2A 4X3UA 3DMUA 3MZ5A 3IAYA 4R8IA 3F2UA 1I4PA 3PMFA 4KKTA 4IFDI 2A6HC 3ZYYX 5IT9E 1TY0A 4KMUC 3ERQA 3HZXA 3C1EA 1Z7TA 1A3TA 2EYLA 5CV7A 5I6WA 1S5CD 1WTQA 1F9QA 1TQOA 3DUZA 2PCFB 2E75C 3HOZB 2F0KA 1U4MA 5FO9B 5C0XH 5CORA 1WTOA 5C3XA 1TU2B 5KYLA 5JVG3 3GTOB 3R3OA 4LAAA 3V96A 1HA5A 4HCSA 3H3VC 4OIKA 2F4IA 1GUOA 2E2JB 2F0GA 3SR1A 2EY1A 1SYFA 1MSHA 4FXDA 1SYBA 4XQQA 4A3IB 4IFDJ 4RAUC 4EQNA 1SNMA 1QB5D 1R9TB 4KY6A 1Q90A 3L7ZC 1U4PA 3R8BA 1UEAB 2IW3A 1STYA 1EYDA 2EDGA 1XWEA 5CV8A 2SDFA 1ENAA 1FGBD 1IW7D 2A68C 1A6XA 1Y69U 2E2IB 3VYRA 1ZYRD 1V1PA 3BDLA 2JE6I 1LTRD 1SFOB 4IN3A 2DN8A 2KEDA 3OPOA 1EIGA 1MSGA 5C4JB 3P20A 4ID6A 4BA2I 1NCVA 1CK1A 2F0IA 1LT3D 2IL8A 1CM9A 1IYUA 1SBBB 1B9NA 1JOOA 3DWAA 3LX0A 5JEAJ 2EE1A 4FXKC 4DNTB 2SOBA 1CZGA 3QJYA 2XRSD 5KNCA 4L8JA 2E2DC 4C3JB 5CYUA 4PMCA 3D4WA 3NQIA 1SXTA 5EGTA 5CC4A 2XRQD 5HGTA 1BOSA 2NVXB 2K01A 4NMZA 5ISRA 1B1ZA 2NVTB 1I4GA 1C48A 3VYTA 1PTOC 4O1NA 3RLFA 3LWUA 2EYHA 5EPLA 3NUCA 1GUNA 2B2WC 1JOKA 1O7LA 2RSOA 1X3QA 1K8OA 1EOTA 1RJTA 1BCPF 1UAPA 4HCEA 1EEID 2PZTA 2F0MA 1SAPA 4DAYA 1CQFA 2BE5C 3EA6A 5C3EB 4IUPA 5K36H 5K5PA 3HGBA 4K6LA 4I65A 4S3SA 3A7LA 1CZWA 4KD3A 1FNUA 3JAML 3U9OA 4A3BB 5DEHA 1V43A 1TS2A 4RHRA 3GD7A 2F03A 2A68D 1DXMA 2ZXOA 1B2TA 4OO1H 4HAEA 4X3KA 4RCOA 3Q24A 2QEJC 5KRUA 1MGSA 1BQQT 4C1NK 5CBAE 1M8AA 5G3LF 1KNEA 4K6DA 3GTMB 3PUYA 3KF8A 2F3VA 4OIJA 2C5CA 4KN7C 4M8AA 2F0NA 1VF5C 4H44C 3FEWX 5F2DA 1BDOA 1PFBA 3IL8A 4CJ1B 3P7JA 1EY0A 5KYIA 1NSNS 1A15A 2XVSA 4ZKCB 2K33A 4WJWA 1NUCA 2JXMB 4EQPA 3DEOA 1II3A 1C8CA 3D31A 2KVMA 2O2LD 1G91A 2BA0A 1PTOH 2RKSA 3CKIB 1Y8NB 2O4XA 4L6TB 1PTOD 1C4QA 1PXUA 1AZPA 1F2ZA 2Q8RE 2K5WA 5E4WC 2E76C 5EKLA 4IUQA 5EPJA 1ET6A 2HUGA 4ZUIA 3VYSA 2MPMA 1IKMA 1HUNA 4LMQD 2DNCA 3HP3A 3EFXD 1VF7A 2B2TA 3N52A 2PZWA 1STAA 2Q8IB 4NKLA 1AW7A 1O78A 4BY1B 1QJOA 2SEBD 4QCLA 5BN4A 1D2BA 3JAME 1SJHD 1RKNA 3H94A 4KY5A 4X3SA 3BDCA 4KJNA 4KI0A 2DY8A 1XTCD 1TWAB 2LKVA 3PIO3 2EJMA 4V0BA 3MAQA 4IFDH 3HS0C 4FO2A 5ELCA 1BO0A 1Y8PB 4G7ZC 3K7AB 5EPKA 3SDZA 5M3MB 5IIFA 4R8NA 5D65A 4IUNA 1E2WA 5DNFA 4RHSA 2OT2A 3FVQA 1PRTF 2B2UC 1XYIA 2LY7A 3K5NA 5BN5A 3D3RA 1JQYD 3M85A 2B2WA 3HEJA 2A69C 4O42A 1OXSC 3L9AX 4QUFA 1AN8A 1SNQA 2YYZA 1JOQA 2ID0A 3C1FA 5EBCA 2EYOA 1SNCA 1EY9A 4I7ZC 4ZYSA 4X3TA 2EY5A 2MUYA 2KJXA 3DM1A 1DOLA 2RVLA 3QOLA 3O13A 3J7AV 2F0FA 2K28A 1LT4D 5JEAH 3Q22A 2WKDA 4CGYB 4CKCA 2QDBA 4QB4A 1SE3A 1NAPA 1EZ6A 4KKSA 2EJGC 5ELFA 1WVLA 2V4DA 4G7HC 1B9MA 2WINB 1ILQA 1VCIA 5I4DA 2A5HA 1LLRD 4C3IB 4Z9CB 1H9KA 1EWCA 3VYUA 3H0GB 2A74C 3KLRA 1SNOA 1E2VA 3MXPA 3TDQA 3EROA 2R93B 3KLSA 5C3WA 1EZ8A 5C44B 4FP5D 1STGA 3NQTA 3TZUA 4CKEA 4B9WA 3KBXA 1JWSD 4TKOB 4PNYA 1BXTA 4GZYC 3MFGA 2VB3X 4XT1B 1DONA 2G9HD 3ND9A 1OO9B 1LTBD 1I50B 1STHA 2NVQB 4A3GB 5J1ZA 1EQVA 3TSSA 4Q0FA 5JOBA 2BDNA 1JORA 1SYDA 1WTPA 4XQNA 3S16B 4CBVA 1IYVA 3GTJB 2PQEA 1YNJC 4QIWB 4TSSA 2I07B 3S1MB 4RH6A 1EY4A 4OHJA 3J7YW 3BS1A 4KJOA 1G6ZA 1EEFD 1BR9A 1TIID 3MXGA 3AU7A 1F2YA 1H9MA 1S5ED 5KEEA 1Q1EA 4ZRZA 2DNEA 3A8IE 1KLGD 3SE0A 3GTQB 2D62A 3HKZB 2PZUA 3OWFA 3I90A 3EQLC 1TWCB 2CHBD 2F0PA 3FDTA 1SMYC 1ENCA 3L3OC 2KCNA 1GUWA 4FVMA 3OWEB 4OL7A 4C3JG 1ENFA 2B63B 3QIAA 2VXWA 3CQZB 3BYTB 3EJIA 2AUKA 4J8QA 3MA2B 1R4PB 1OXTA 2TMPA 3S9WA 2HCCA 4LK1C 1ESFA 2LFNA 5C4HA 2B39A 1EY5A 4ODGA 2IPKD 2J7ZA 2AQ2B 1TWGB 1PZID 3GTLB 2C9OA 2B8GA 4DU9A 3H09A 1SDFA 2FFKB 3VR3A 2XWBB 3T56B 1HPCA 3I4LA 3K0YA 2B2UA 2RDHA 1GHJA 3WOFA 1G291 1FNVA 1SNPA 4HSVA 2X69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L4N A;  2RVL A;  2L12 A;  1WTR A;  2EPB A;  1G2S A;  1F2L A;  1F9S A;  1NCV A;  1U4L A;  3D6W A;  2FHT A;  1PDQ A;  1HUM A;  3KUP A;  3DEP A;  5E4W C;  1HFG A;  3I8Z A;  2EOT A;  3SVM A;  2IL8 A;  2HCI A;  3GV3 A;  3GV6 A;  1BF4 A;  1VMP A;  1CM9 A;  1G6Z A;  2K28 A;  2NZ1 D;  4IUQ A;  1EL0 A;  3I3C A;  5EPJ A;  1WTV A;  1Q3L A;  1ML0 D;  2R3Z A;  2HUG A;  1HFN A;  2MPM A;  1LV9 A;  1IKM A;  4R9W A;  2N88 A;  1HUN A;  1F9R A;  4LMQ D;  1BBX C;  1NR2 A;  1S4Z A;  2DY7 A;  1O7Z A;  1TVX A;  4X3U A;  1NAP A;  1B2T A;  1JE4 A;  1PLF A;  3HP3 A;  3QO2 A;  2L11 A;  1J8I A;  4HAE A;  4NW2 A;  1QG7 A;  4X3K A;  2KUM A;  1QE6 A;  1WVL A;  1WD0 A;  2X6G A;  2HDL A;  4MN3 A;  5E4X A;  2EE1 A;  4R8I A;  2B2T A;  3I90 A;  1MGS A;  1ILQ A;  3UI2 A;  3F2U A;  1XX8 A;  3N52 A;  4ZLT F;  1B53 A;  3FDT A;  2CVR A;  2L1B A;  4RWS C;  4IUU A;  3G7L A;  2Q8T A;  1CA5 A;  1ESR A;  1ICW A;  2JP1 A;  1GUW A;  2B2Y C;  5CBA E;  4IUT A;  1M8A A;  1KNE A;  1MI2 A;  4CJ0 B;  1WTQ A;  4QUC A;  4CJ2 C;  1F9Q A;  4RA8 A;  1WTX A;  3TN2 A;  1B3A A;  4X3S A;  3DM1 A;  4DN4 M;  3TZD A;  1U4M A;  5T1G A;  1EIH A;  5COR A;  2DY8 A;  1WTO A;  1U4R A;  4MHE A;  3Q6S A;  1X3P A;  3H91 A;  2VXW A;  4OIJ A;  1HRJ A;  2K04 A;  2FMM A;  2JYO A;  3MTS A;  3IFD A;  1NR4 A;  4HCS A;  2K01 A;  2MP1 A;  2X6L A;  3LWE A;  1SSO A;  4OIK A;  5JJZ A;  1WTW A;  1IKL A;  1ROD A;  1AP0 A;  2RA4 A;  1PFB A;  3IL8 A;  4CJ1 B;  3P7J A;  1IL8 A;  1F9P A;  1X32 A;  1ZXT A;  4IUV A;  1BO0 A;  1KNA A;  2HCC A;  2MGS A;  5EJW A;  1MSH A;  1E0B A;  1JIC A;  5EKI A;  1BNZ A;  2L9H A;  1A15 A;  2K03 A;  2J7Z A;  5EPK A;  4ZKC B;  3KBX A;  4RAU C;  1DOM A;  4ZAI A;  1J9O A;  2MJ8 A;  1O7Y A;  5D65 A;  1WD1 A;  1HA6 A;  4XT3 B;  5COY A;  5EPL A;  4XT1 B;  2H1E A;  5DNF A;  1CA6 A;  1DON A;  5EQ0 A;  2KEE A;  2B2W C;  2B2U C;  3I91 A;  2XIW A;  1U4P A;  3MWY W;  2B2V C;  1XYI A;  1G2T A;  2RSO A;  2B2Y A;  1X3Q A;  5CBE E;  1PFM A;  1SDF A;  2FIN B;  3DEO A;  2FFK B;  1C8C A;  2KEC A;  1B4O A;  4HED A;  1RTO A;  1B50 A;  1EOT A;  1DOK A;  1RJT A;  2SDF A;  3R93 A;  2KOL A;  1ILP A;  2KVM A;  4U68 A;  2B2T C;  1DZ1 A;  2FJ2 A;  2BDN A;  2B2W A;  2B2U A;  2RSN A;  1AZQ A;  2M2L A;  1G91 A;  2B2V A;  1SAP A;  2NWG A;  4O42 A;  1WTP A;  4IUR A;  2Q8R E;  3ONA B;  1PFN A;  4QUF A;  5T1I A;  1QNK A;  1RHP A;  4IUP A;  2NYZ D;  4UAI A;  5CMD A;  5D14 A;  1EQT A;  4XDX A;  3FPU B;  2HDM A;  2KED A;  2K1B A;  4ZK9 B;  1EIG A;  1RTN A;  1MSG A;  2D9U A;  5AFW A;  4ZKB B;  1O80 A;  1HHV A;  4X3T A;  4HSV A;  2X69 A;  2K05 A;  1AZP A;  2N55 A;  1DOL A;  1VMC A; 
#chains in the Genus database with same CATH topology
 1EYA A;  1I3Q B;  2JA7 B;  1F9S A;  4GKJ L;  4MTN A;  4B3S Q;  4HJ9 A;  1GUG A;  4DV4 Q;  3I56 A;  4IJH A;  4IPC A;  1HNX Q;  1ML0 D;  4K5X A;  4JI3 L;  4OON A;  4R9W A;  1NR2 A;  1O7Z A;  5FLX L;  4HMJ A;  2GA4 B;  2DGY A;  2L11 A;  1BCP B;  3DHQ A;  4JI7 L;  3T16 A;  4GS3 A;  3GTM H;  2ENB A;  1Y14 B;  2HDL A;  3I4N B;  1PA6 A;  4A3F B;  2CH4 W;  3TP7 A;  1XX8 A;  5IWA L;  3KOJ A;  1YNJ D;  5FLM H;  4BBS B;  1SN8 A;  2UXD L;  4IUU A;  1VQG A;  5C5M A;  2K5Q A;  2I5M X;  4B3R Q;  1RF2 D;  5A35 A;  2PQA A;  2Z6B A;  5FO7 B;  4P71 A;  1PH7 A;  1TWF H;  4MIU A;  1CQV A;  2EYP A;  4RA8 A;  3CCU A;  1HZA A;  4K2K A;  1JT8 A;  3CRL C;  4GKJ Q;  1QNU A;  2PMZ B;  1WCM B;  1X3P A;  3T4A C;  2K04 A;  1UNS A;  3TP6 A;  3PO3 B;  4Q5V A;  2EY2 A;  4JI3 Q;  5EAY A;  1I4H A;  4DV7 L;  3K59 A;  1F9P A;  4IUV A;  2SNM A;  1HCZ A;  2A6E C;  2MGS A;  4ABN A;  4JI7 Q;  1FJG L;  3G6J B;  2WKC A;  1CKN B;  2K03 A;  3EN2 A;  3FRP B;  4LNQ A;  1EQR A;  2IHF A;  2XN9 C;  1DOM A;  4JW0 A;  4NXM L;  2EQS A;  5M9O A;  1TS3 A;  3U58 A;  5IWA Q;  1H9J A;  2Z1C A;  3CCV A;  2AQ1 B;  2UXD Q;  1AEX A;  4K8I A;  3DWQ A;  1D5X C;  4R4I A;  1CHP D;  2B2Y A;  1TS4 A;  4HJA A;  1XNQ L;  1K83 B;  4OEM B;  2KOL A;  2D2C C;  2R7Z B;  4X6A H;  4U68 A;  2KEN A;  2FJ2 A;  2WAQ E;  2M2L A;  2F0O A;  1J6Q A;  3SK6 A;  2CWP A;  1J5E L;  3K5L A;  2A6H D;  4GOP A;  3HOW B;  4JI8 Q;  1V1P B;  2R6G A;  1EQT A;  4DV7 Q;  3RN2 A;  1LAC A;  1O80 A;  4H7B A;  3OIP A;  4KK7 A;  1U4L A;  4ME5 A;  3DXJ C;  4NXM Q;  3M9B A;  1T5E A;  2EOT A;  2Y0S B;  4JK1 C;  1KIX A;  4UY8 C;  3UE1 A;  2YTY A;  3I3C A;  3GTK B;  1LV9 A;  5D3I B;  4BBR B;  3E0J A;  2DY7 A;  4QL5 A;  5C6A A;  4A3K B;  1M1K C;  4BY1 H;  2UXC L;  4YY3 L;  1RDP D;  1JE5 A;  3NWT A;  2K75 A;  4JPB W;  1CHQ D;  4XXE A;  5IGD A;  2KUM A;  2NVY B;  3KJO A;  4LFA L;  1VQB A;  1PH2 A;  4MN3 A;  2Q2I A;  2K5H A;  1B7Y B;  3A8K E;  2XSC A;  1TWA H;  3PV0 A;  1J5E Q;  3J7Z C;  4BY7 H;  1ICW A;  4M1U B;  4CHT B;  4Y52 H;  1QVC A;  1HQR D;  5M5X B;  1Y1V G;  3HOX G;  2DUD A;  1EQQ A;  1QZG A;  4YHH L;  4X66 L;  3HOY B;  1SJE D;  2SNS A;  2JEB I;  1JCK B;  3K7A H;  1U4R A;  5FLX E;  3VA5 A;  1VQC A;  1L2F A;  3A54 A;  4JYA L;  1KLU D;  3CP0 A;  4FYD A;  4X62 L;  1SSO A;  4BXX G;  3CD6 A;  1ROD A;  4A3E G;  4ULL A;  3S2H B;  2RA4 A;  2UXC Q;  1VDZ A;  4UDU C;  2HT1 A;  1GHK A;  1WFQ A;  1EU3 A;  3AFP A;  4PV1 C;  4QQB X;  1FYC A;  1R4Q B;  4CKB A;  4ILW A;  4KHZ A;  2VUM G;  2EVB A;  3ND8 A;  5FOB B;  4XT3 B;  4POG A;  2Z6K C;  4G7O C;  5C5L A;  1KHI A;  4LF5 L;  4A4I A;  3I91 A;  3MWY W;  2CKZ B;  3PGZ A;  2Z9H A;  4R4T A;  5CV4 A;  3A56 A;  5M3M G;  5M5W B;  1SYG A;  1U5K A;  2XWJ B;  4CDD C;  4X66 Q;  3QOJ A;  2ZXP A;  1B44 D;  2KQ3 A;  2VB2 X;  4QJF A;  1SEB D;  1RD9 D;  1BUV T;  3K0X A;  2ZJQ A;  4OWW B;  1RHP A;  1HR0 L;  2A6E D;  4DAY B;  3R2T A;  1G51 A;  4DV3 L;  4UP9 A;  1VQ6 A;  1EU4 A;  1ZEQ X;  3PUX A;  3E5S A;  5ELE A;  2I0Q A;  2L4N A;  4AH6 A;  1G2S A;  3J80 c;  3OW7 A;  1HFG A;  1VQK A;  4ZQ3 A;  2ZJP A;  1PRT B;  5HY6 A;  5I2X A;  1U9R A;  4LF5 Q;  3NWS A;  3VA7 A;  1IZ6 A;  2O5J C;  3CRK C;  3OSO A;  4LFB L;  3H0G H;  4HR7 B;  3U50 C;  2KCC A;  2G9D A;  4KKU A;  3CCR A;  4XYQ A;  3CPW A;  4XTC S;  2F0S A;  1X9N A;  2X6G A;  3OHX C;  1WD0 A;  3VR5 A;  1V1O A;  1GUS A;  1X3F A;  3SK5 A;  5IP7 H;  2R93 H;  1DJR D;  1IHZ A;  3K80 C;  2VQF L;  1HNZ L;  1HR0 Q;  3FPP A;  1FNW A;  2QIL A;  4IUT A;  1DGS A;  3SK4 A;  1Z47 A;  4DV3 Q;  4C3I G;  5C44 H;  1VQJ A;  2BCO A;  5D3D A;  4IOA A;  5JPN C;  1A2T A;  5DM7 3;  1EY6 A;  3QR8 A;  4DV2 L;  3I4M G;  1HRJ A;  4BWG B;  2YTV A;  4DXF A;  3C2P A;  3NBH A;  4LFC L;  3K5O A;  2VW9 A;  1NR4 A;  2IWH A;  2BE5 D;  4DV6 L;  3CC2 A;  1Q8K A;  1Y1V B;  3HOX B;  2MP1 A;  4EVO A;  1ET9 A;  5JJZ A;  4LFB Q;  5C4Z A;  3QB3 A;  3J81 c;  4RCN A;  5ELN A;  3SEB A;  1JWM D;  5LL6 X;  4DAV A;  2NVQ H;  4LW1 A;  4A3G H;  2NN6 G;  1I94 L;  4HN7 A;  4K8J A;  4A3J H;  2Z4H A;  1JIC A;  2EXZ A;  3HG9 A;  1VQ8 A;  4FF3 A;  3I7F A;  2E8G A;  4F7X A;  4IPH A;  1Y1W G;  3S16 H;  3MXU A;  4PMW A;  1BCP C;  4A3E B;  2QA4 A;  1HJP A;  1HNZ Q;  1EFW A;  2WAC A;  3I4O A;  3M3Y B;  3FHW A;  1Z6H A;  1L1O A;  1B4O A;  3S1M H;  1YNN C;  2VUM B;  2RHS B;  2JA9 A;  1SND A;  5JAV A;  3OTO L;  1DZ1 A;  1N34 L;  2ATW A;  4WJ4 A;  1CKO A;  1S5F D;  2KA7 A;  2R61 A;  4NP5 A;  5BN3 A;  1NE3 A;  1PFN A;  4LFC Q;  2HIX A;  4DV6 Q;  2QKI C;  3MHB A;  2E74 C;  1QZH A;  5AFW A;  4JI6 L;  2BOS A;  1HHV A;  4R4Q A;  1I94 Q;  2N55 A;  4TVA B;  3GTQ H;  1HA6 A;  3U4Z A;  3UE0 A;  2F52 A;  2OTJ A;  3I70 A;  1TWC H;  1GKH A;  2ICE C;  5IGE A;  1YHB A;  1LTA D;  1C9O A;  2K5N A;  5FKA C;  1J8I A;  1PLF A;  4F87 A;  4C56 C;  2Q2U A;  4DXG A;  4C2M B;  5GAD C;  3CXC A;  4N8X 1;  3OTO Q;  2B63 H;  3OIQ A;  4YIJ A;  3KDF B;  1N34 Q;  2OQ0 A;  4A3L G;  3CQZ H;  4DUY L;  3J80 L;  3HKZ G;  3E6Z X;  4ZUJ A;  2JP1 A;  2LS0 1;  1E3P A;  1D5Z C;  2ZM6 L;  1E1O A;  3RLN A;  4QMG A;  3MVV A;  2JK8 A;  3IKJ A;  4JI6 Q;  4G57 A;  2TSS A;  2D0O A;  4GLX A;  3J7A F;  5JJL A;  2VY3 A;  1Q7Y C;  2M00 A;  3MFY A;  3D4R A;  2A1A A;  2F0W A;  3PUV A;  1TWG H;  2WAQ G;  3K6O A;  2J0T D;  3GTL H;  4EQ5 A;  1IKL A;  4BA1 I;  3ZJY C;  4J1M A;  4MZ9 A;  2EYJ A;  3JC6 6;  3S1R B;  3V2T A;  5FK9 C;  3T53 B;  2JN4 A;  2JSO A;  3AYH B;  2RCN A;  3I4M B;  1M4V A;  4IQZ A;  1STN A;  1GUT A;  2RQX A;  1FL0 A;  4YWM A;  3W5O A;  1L0X B;  2H1E A;  4DUY Q;  1CA6 A;  4H13 C;  2KEE A;  3SXH A;  4GLV B;  1S40 A;  1LT5 D;  1PH5 A;  5IP9 H;  1NMF A;  1N8R C;  2ZM6 Q;  2FIN B;  2OQK A;  5HGQ A;  1IBM Q;  4RKL A;  2KEC A;  2IT1 A;  1B50 A;  1SLJ A;  3R93 A;  3A8J E;  3RMH A;  4GNX B;  3J81 L;  1KDB A;  1CT1 D;  3NEN A;  4PQX A;  1RIP A;  1I3Q H;  2K5D A;  2JA7 H;  5DM6 3;  1H9R A;  1Y1W B;  3AQQ A;  3BZD B;  2EY6 A;  2F0Q A;  1YIT A;  3TME A;  1QNK A;  5E3F A;  3WOE A;  4JBM A;  2IHE A;  1X6O A;  5CMD A;  1B3Q A;  1DM0 B;  1RCV D;  2K1B A;  5CV9 A;  2D9U A;  4GKK L;  2ES2 A;  3RZO B;  1KL9 A;  1MJC A;  1WTR A;  1HXY D;  2FHT A;  1PDQ A;  3S15 B;  2L15 A;  1H9S B;  1BCP D;  4A3F H;  2BH2 A;  3GV6 A;  4K0K L;  3Q8D A;  2UXB L;  3EBE A;  1MIU A;  5CV6 A;  4BBS H;  1ASY A;  4IZ8 A;  2F1M A;  3K58 A;  3QO2 A;  1QG7 A;  4HIK A;  3RZD B;  1XNR L;  1B8A A;  3NBI A;  4OGQ C;  4JI2 L;  2O5I C;  1X3E A;  1WCM H;  2JA8 G;  2MO1 A;  3GTG B;  3LNN A;  2ZJR A;  3I4N G;  5M3F G;  4C1N I;  3PIP 3;  2QF7 A;  4DR1 L;  5EBD A;  2NN6 I;  2D0P A;  4P2C B;  2R92 G;  4GKK Q;  1X54 A;  3S14 B;  4C3J H;  1KAB A;  3I72 A;  3G6E A;  4DUZ L;  2H4O A;  5HUR A;  2OF1 A;  3Q6S A;  4DK3 C;  3T1H L;  1KQS A;  2A69 D;  5IYD G;  2JYO A;  3HOV G;  4K0K Q;  3W1G A;  1CKM A;  2B8F A;  1BBW A;  1IL8 A;  3PO3 G;  3J80 E;  1PMR A;  3MXN B;  1K83 H;  4H0L C;  2NVX H;  1QOH A;  5G3L D;  1PRT C;  4DAP A;  5EKI A;  1BNZ A;  3B6Y A;  2R7Z H;  2WAQ B;  5LL6 S;  1O7Y A;  4JI2 Q;  1PTO F;  1AE2 A;  5COY A;  1E2Z A;  4EQO A;  4PMB A;  3NXW A;  3HOW H;  3W2D A;  4DR1 Q;  2F3W A;  2PW5 A;  1JC7 A;  1HNW L;  2ASB A;  4RGT A;  4DFA A;  1F2M A;  1K9M C;  4A3D B;  1K8M A;  4JBJ A;  4DUZ Q;  3T13 A;  4DR6 L;  2K4K A;  1QWY A;  3T1H Q;  1JWU D;  2EZV A;  1K3R A;  4IUR A;  5CV5 A;  1A8V A;  1VQE A;  5JPM C;  1D1K A;  2F3I A;  3QWN A;  4ME3 A;  3U9S A;  4N9T A;  2LXJ A;  2K32 A;  1Q8I A;  1RTN A;  4BBR H;  1EWH A;  2MQH A;  4A3K H;  3NHH A;  1LO5 D;  1KAW A;  3MEH A;  3M4O B;  3CHB D;  3KUP A;  3T51 B;  4DV5 L;  2HIV A;  3IFT A;  1SE8 A;  3A5Z B;  2UUA L;  1A3V A;  2EXD A;  3J81 E;  4DK6 C;  5C4X G;  2ZTD A;  2N88 A;  1F9R A;  1S4Z A;  5M5X H;  1Y8O B;  4K2L A;  1HNW Q;  5J22 A;  4NW2 A;  3BDO A;  4KHV A;  1LTI D;  3D6C A;  3UI2 A;  5AJ3 L;  4L63 B;  4LF6 Q;  2Z4I A;  3NK9 A;  3TQY A;  2VZA A;  4JBW A;  2BA1 A;  1CKN A;  1LT6 D;  4RWS C;  2YU9 B;  2RDF A;  1GXD C;  1Q46 A;  3CME A;  1MJE A;  2FXQ A;  4GLA C;  1SRO A;  3S2H H;  1WTX A;  3EVQ A;  1FR3 A;  3OMG A;  3TN2 A;  3K5M A;  3FP9 A;  4A93 G;  2CQA A;  1CSP A;  4JI4 L;  3M7N A;  4TQU S;  3M4Y A;  4B08 A;  2JA8 B;  1BBU A;  5C0X G;  3PO2 G;  3KF6 B;  3L2P A;  3AMU A;  2IX3 A;  4WRD A;  2FMM A;  3V05 A;  4DV5 Q;  3IFD A;  5M3F B;  3HOY G;  1LTG D;  2UUA Q;  1PHJ A;  2I46 A;  2IX0 A;  1VQM A;  1WTW A;  1PV4 A;  1TWH B;  1TKW B;  2R92 B;  1NJI C;  2P5Z X;  4LF4 L;  4XYO A;  1UUP A;  2NB0 A;  5EJW A;  1NNX A;  1S5B D;  3A5U A;  2WB1 G;  4F8M A;  5AJ3 Q;  3FMC A;  3HOV B;  3HOU B;  2K14 A;  3DLL A;  2B2V C;  3HRZ C;  3RR5 A;  4AYB E;  4JI8 L;  5GRO A;  3NTI A;  2XNA C;  2ZT9 C;  4JI4 Q;  1ICF B;  2B2T C;  2RDG A;  5EKK A;  3OOC A;  1AZQ A;  5IGG A;  3CAM A;  1EFI D;  5CR3 A;  1TS5 A;  4DPG A;  2PO4 A;  1SMY D;  2K7V A;  1JJC B;  2M9V A;  2YV5 A;  1MD2 D;  1PRT D;  3P75 A;  5I9P A;  4LF4 Q;  2L0C A;  4B3T L;  2NZO A;  1HTL D;  4B9X A;  5A2Q L;  2AMC B;  2K05 A;  4EGV A;  3D6W A;  2JJQ A;  4LUZ A;  3I8Z A;  3UDI A;  1CFM A;  2F0H A;  4U67 3;  3Q23 A;  5DAU A;  1HTP A;  3MC0 B;  3TS0 A;  2NZ1 D;  5CGK A;  2R3Z A;  3S1N B;  3TP8 A;  3BVG A;  4QF4 A;  3NP8 A;  3BVM A;  2F0D A;  1EY7 A;  3AB9 A;  5GAH C;  4EX5 A;  4DK1 A;  1VQF A;  2N78 A;  1VQD A;  2H5X A;  3PF4 A;  5C4X B;  3GTP B;  1Y1V H;  3HOX H;  2AWO A;  3KK7 A;  1JB3 A;  5KGU A;  4GNX C;  1WTH A;  1I4X A;  2JA5 G;  1N36 L;  4B3T Q;  2PQA B;  4DN4 M;  1OXU A;  4F88 A;  4HTH A;  1E1T A;  1DD2 A;  3N6R A;  3KLS X;  1Q1B A;  1FVI A;  2EYF A;  3GO5 A;  4PZ6 A;  3F2B A;  4HJ5 A;  2ICI A;  4XQJ A;  5M5Y B;  3A7A B;  4BXX H;  5JJI A;  1KDC A;  3NPP A;  4A3E H;  4HIM A;  3CMA A;  3A55 A;  2Z0S A;  1X32 A;  1S5D D;  4A93 B;  3VR6 A;  2HQL A;  3CU7 A;  4KV6 A;  2VUM H;  3PO2 B;  1D7Q A;  3C46 A;  2MJ8 A;  1YBY A;  2AUJ D;  3GDE A;  3BJU A;  4POF A;  1STB A;  4P75 A;  1W6K A;  5M3M H;  1EYC A;  4CDE C;  5LMN L;  3DWP A;  1N36 Q;  5E1F A;  2WB1 B;  3RD4 A;  1ONL A;  1L0Y B;  1TXY A;  4YCU A;  3I73 A;  1CSQ A;  4IO9 A;  4L5R C;  1PVO A;  3CF5 A;  3BVZ A;  2D5D A;  4DK0 A;  4FNF A;  5K36 G;  2IX1 A;  3FPU B;  2EJF C;  4FXG C;  4E6I A;  2MNA A;  3CCL A;  3P1H A;  4LF9 L;  5IOD A;  1VMC A;  3PUW A;  2L12 A;  4OWX B;  2L55 A;  2V1C C;  4KY7 A;  3LGJ A;  2F0T A;  4RKB A;  2OCE A;  1G6P A;  3SK8 A;  2WP8 J;  2VNU D;  1SYC A;  4N9P A;  4J15 A;  3M4P A;  3NTK A;  1LTS D;  5LMN Q;  4OO1 G;  3NE5 B;  3JAM i;  5E4X A;  4BS9 A;  5C0X I;  1EYG A;  5KIX A;  5JVH 3;  1LAB A;  1TWF B;  5A2Q E;  3OYY A;  2CVR A;  3BU2 A;  5NUC A;  4K5V A;  1O7I A;  3G7L A;  1CA5 A;  4C3I H;  5FO8 B;  1VQA A;  1SE4 A;  1V8Q A;  4LF7 Q;  4QUC A;  4CJ2 C;  3S17 B;  3S1R H;  4J6H A;  2ALY B;  4LF9 Q;  3GQB A;  5LHY 1;  4FDB A;  4RFB A;  2F0L A;  1I6V C;  3PF5 A;  3I4M H;  3H91 A;  1NY4 A;  3ITP A;  3RUZ A;  1M90 C;  1E24 A;  2PYK A;  5IOC A;  1SE2 A;  1N33 L;  1QCB D;  3LWE A;  3VDY A;  2IJ0 A;  2PPB C;  2JA5 B;  1AP0 A;  5C0X J;  3Q0A A;  3H6M A;  2CH4 A;  2NN6 H;  2QCP X;  3HFZ B;  3SHL A;  1E0B A;  2OEO A;  4R1J A;  1KAA A;  4ZAI A;  1WD1 A;  2ZXR A;  1Y1W H;  1WOC A;  4QGU A;  4A76 A;  1N32 L;  2F0U A;  4KD4 A;  4RG1 A;  2J4X A;  2YTX A;  1CUK A;  2WV6 D;  3KF8 B;  1D8L A;  3X3M A;  1A63 A;  5IT9 c;  5KND A;  3BYY B;  1FGU A;  3RZO H;  4KLK A;  1I50 H;  1ILP A;  2L5T A;  3CCQ A;  2NTT A;  2AQ3 B;  1G8Z D;  3S15 H;  2B2V A;  2NWG A;  4IAL A;  4DNI A;  5E7N A;  3ONA B;  2A19 A;  2MHV A;  1XXG A;  2NZH A;  5T1I A;  1N33 Q;  1A2U A;  2NYZ D;  4UAI A;  5IY0 A;  3KDF A;  1CI3 M;  1GOZ A;  2XTI A;  4XIG S;  4ZK9 B;  4P73 A;  2C35 B;  2A8V A;  3GTJ H;  2JA6 G;  3TP5 A;  2F0E A;  2AKW B;  4A3M G;  1HUM A;  3TEH B;  1V9P A;  1X56 A;  3RZD H;  2LMC B;  1YJ9 A;  3SVM A;  2HCI A;  2NTS A;  1ZKO A;  1N32 Q;  5IYC G;  1WTV A;  1QUQ B;  3GTG H;  4RGN A;  3R2I A;  2NUC A;  2RCF A;  1IBL L;  1PZJ D;  2OXP A;  1TVX A;  1LTT D;  1JE4 A;  1STE A;  1HQM C;  3S14 H;  4BY7 B;  4C3H G;  1VQ7 A;  3ER0 A;  4X64 L;  1BVS A;  2KHS A;  4A3L H;  2L1B A;  1A3U A;  4KN4 C;  1E7Z A;  1OXV A;  4HMI A;  2A73 B;  2CW0 C;  3VR2 A;  2Q2T A;  4JOI C;  3CCJ A;  2F4V L;  1LYL A;  1T5X D;  3GP7 A;  4CJ0 B;  1N9W A;  4AYB G;  2F0J A;  5IGB A;  2PNR C;  3TZD A;  5T1G A;  1EIH A;  2Z8L A;  4RGM A;  1GJX A;  4MHE A;  4HJ7 A;  1YJN A;  3NEM A;  3ULJ A;  3G4S A;  2BDO A;  3MTS A;  3TRZ A;  5ELB A;  4GN3 B;  4IFD G;  2E2H B;  3C3L A;  1JR0 D;  2WII B;  4JVZ A;  4JBK A;  3NBH B;  3NTH A;  1IBL Q;  1D5M C;  3J7A 5;  4WOR A;  2ZTC A;  3H3V I;  4CDC C;  1DCZ A;  1YJW A;  3QG1 A;  1IBM L;  1EY8 A;  2L9H A;  5I9O A;  1PZK D;  3W3A A;  4X64 Q;  1YIJ A;  3I55 A;  4IJL A;  5KNB A;  2UU9 L;  3S1Q B;  1K73 C;  1PH4 A;  5EQ0 A;  4YCV A;  4Y7N B;  2XIW A;  1H9S A;  1NBW A;  1PFM A;  1Q12 A;  2F4V Q;  5I2Y A;  4DKA C;  1F77 A;  1RTO A;  1CTM A;  1QIL A;  1I4Q A;  4DAM A;  1DOK A;  1DYQ A;  3FKI G;  3M4O H;  1L1O B;  4KHP L;  1I6H B;  2RSN A;  3AFQ A;  4G4K A;  5FJ8 G;  2UUB Q;  1OXX K;  5I6Y A;  4A3D G;  1TR5 A;  1D6E C;  3EIV A;  1L0W A;  4XDX A;  4DF7 A;  3PUZ A;  3D8G A;  2HDM A;  5GAG C;  4OO1 I;  4LJZ C;  2HQE A;  4NDX A;  1F2L A;  5IT9 L;  1PTO B;  1PYW D;  1EOV A;  3BG3 A;  2BH8 A;  2Z6K A;  3BZK A;  3GV3 A;  1VMP A;  1BF4 A;  2UU9 Q;  4WJ3 M;  5JEA G;  5TSS A;  4V19 0;  4DR7 L;  3NSW A;  1AFP A;  1HFN A;  1BBX C;  5BR8 Q;  2JA6 B;  2F0V A;  1I4R A;  3M7G A;  3KBG A;  4A3M B;  2IY5 B;  3D4D A;  1QE6 A;  5ELD A;  3TBI B;  4KHP Q;  3HOZ G;  1XMQ L;  3MXN A;  2JA8 H;  1KTK A;  4ZLT F;  5IGF A;  1B53 A;  3I4N H;  5M3F H;  2Q8T A;  1ESR A;  3K57 A;  2B2Y C;  2FMC A;  4N8F A;  4UPA A;  4K5W A;  2R92 H;  1TWH H;  1MI2 A;  1YNN D;  1B3A A;  4C3H B;  2N49 A;  2AWN A;  4ALP A;  3K8A A;  4NB3 A;  4A3I G;  1IW7 C;  5IYD H;  3HOV H;  1TT2 A;  5IGC A;  3T1Y L;  1VQ5 A;  2K5V A;  4FF1 A;  4DNR B;  4CDF C;  1ZYR C;  2X6L A;  4A3J B;  4DR7 Q;  3S2D B;  4AQY L;  2GN5 A;  4AYB B;  3PO3 H;  1ZXT A;  2JEA I;  1KNA A;  4GN5 A;  1D1I A;  3WDN A;  2OWO A;  4GN4 B;  2NBF A;  1HR0 W;  2EYM A;  1XMQ Q;  1J9O A;  4RMF A;  3URY A;  4JC0 A;  2CW0 D;  4WFN 3;  1QVG A;  1KDA A;  4FF2 A;  1MBY A;  1G2T A;  3OMC A;  3TRE A;  4K14 A;  1XJV A;  2RBM A;  5CBE E;  1Q86 C;  4JI0 L;  3HOU G;  2K6A A;  1W6J A;  4HED A;  4UP8 A;  1K8A C;  1EWI A;  4DGZ A;  4IPG A;  1SYE A;  3CPF A;  4FF4 A;  5JJK A;  3T1Y Q;  4DA2 A;  1FD7 D;  4KTA A;  4LF8 L;  3S24 A;  3H15 A;  5D14 A;  3S1N H;  4AQY Q;  1GVP A;  3VR4 A;  3X3N A;  1EIY B;  4ZKB B;  3FKI B;  4TRD A;  5J39 A;  2HD3 A;  2EPB A;  3PSI A;  4A75 A;  4HSP A;  4L5Q A;  2PW7 A;  3DEP A;  3A0J A;  1UWV A;  1JJ2 A;  4RGO S;  4LF6 L;  1EL0 A;  1Q3L A;  5C4X H;  2EIF A;  3GTP H;  1TY2 A;  1KXL A;  1K28 A;  4JI0 Q;  4X3U A;  3DMU A;  3MZ5 A;  4DR3 L;  3IAY A;  3GTK H;  5J3B A;  1VQH A;  4R8I A;  4OWT B;  3F2U A;  2RHQ B;  1I4P A;  3PMF A;  4KKT A;  3RNU A;  4HIO A;  2NVY H;  4IFD I;  4A3C G;  2A6H C;  3ZYY X;  4LF8 Q;  5IT9 E;  1TY0 A;  4KMU C;  1VQO A;  5M5Y H;  3ERQ A;  3HZX A;  3STB C;  3C1E A;  1Z7T A;  1VQI A;  1A3T A;  2EYL A;  5CV7 A;  5I6W A;  1S5C D;  1WTQ A;  1F9Q A;  1TQO A;  3DUZ A;  2PCF B;  1YEZ A;  4A93 H;  2E75 C;  3HOZ B;  2F0K A;  1U4M A;  5FO9 B;  5C0X H;  5COR A;  3PO2 H;  2CCZ A;  1WTO A;  5C3X A;  5IYB G;  1TU2 B;  3E9I A;  5KYL A;  5JVG 3;  3GTO B;  3HOY H;  1IYJ B;  3KYH C;  3R3O A;  4LAA A;  3V96 A;  4ZCK A;  4UP7 A;  1HA5 A;  4HCS A;  5ELO A;  3H3V C;  4OIK A;  2F4I A;  1LTL A;  1GUO A;  2E2J B;  2F0G A;  2Q2H A;  3SR1 A;  2EY1 A;  1SYF A;  1MSH A;  2QW7 A;  1PYS B;  4YCW A;  4DR3 Q;  4FXD A;  2I5H A;  1SYB A;  4XQQ A;  4A3I B;  4IFD J;  4RAU C;  4EQN A;  3CCM A;  2CQO A;  1SNM A;  1W2B A;  1QB5 D;  1R9T B;  4KY6 A;  1Q90 A;  5GQO A;  3L7Z C;  1U4P A;  2VS1 A;  4O2D A;  3R8B A;  3CW2 C;  2OTL A;  1UEA B;  5C3E G;  2IW3 A;  1STY A;  1EYD A;  1P8L A;  2EDG A;  2ZTE A;  1XWE A;  5CV8 A;  2SDF A;  1ENA A;  1FGB D;  1IW7 D;  1LM0 A;  2A68 C;  1PFS A;  3JAM c;  1Y69 U;  5M5W H;  1A6X A;  2E2I B;  3VYR A;  2XGT A;  1ZYR D;  2DJF C;  1V1P A;  3BDL A;  2JE6 I;  1LTR D;  3KLW A;  1SFO B;  4A3B G;  4IN3 A;  1K8G A;  2DN8 A;  2KED A;  2PI2 A;  3OPO A;  1EIG A;  1MSG A;  5C4J B;  1VQL A;  3P20 A;  4ID6 A;  4BA2 I;  3W1B A;  3L0O A;  1AE3 A;  1NCV A;  3PIP A;  1CK1 A;  3D0F A;  2F0I A;  1LT3 D;  4NXN L;  2IL8 A;  1P16 A;  1CM9 A;  1IYU A;  1SBB B;  4QIW E;  1B9N A;  1K3B C;  1JOO A;  1S3O A;  3DWA A;  3S17 H;  3LX0 A;  5JEA J;  4PG3 A;  2EE1 A;  5IE8 A;  1PH9 A;  4FXK C;  4DNT B;  2SOB A;  1CZG A;  3QJY A;  2XRS D;  3CC7 A;  4B3M L;  5KNC A;  5FLM G;  4L8J A;  2E2D C;  4C3J B;  4O0A A;  2VQE L;  5CYU A;  2JA5 H;  1L1O C;  4PMC A;  1JMC A;  3HKZ E;  1VQN A;  1U0L A;  3D4W A;  3NQI A;  1SXT A;  5EGT A;  4QY7 A;  5CC4 A;  3K7U C;  2XRQ D;  4NXN Q;  1IL2 A;  5HGT A;  1BOS A;  4PZ7 A;  4AIM A;  2NVX B;  2K01 A;  1YZ6 A;  4NMZ A;  5ISR A;  1B1Z A;  2NVT B;  1I4G A;  1C48 A;  3VYT A;  4DR5 L;  1PTO C;  1S72 A;  2QDL A;  4O1N A;  3F2C A;  1KD1 C;  1SMX A;  4JI1 L;  3RLF A;  5LMU L;  4HJ8 A;  3LWU A;  3PQI A;  5L37 A;  2DJG C;  2EYH A;  5EPL A;  4NPS A;  3NUC A;  3STB D;  4B3M Q;  1GUN A;  2B2W C;  1YHQ A;  1JOK A;  1O7L A;  2RSO A;  1WJJ A;  1X3Q A;  1FJG Q;  2VQE Q;  1UE5 A;  1K8O A;  1EOT A;  1RJT A;  1BCP F;  1UAP A;  3H3V H;  4HCE A;  1YI2 A;  1EEI D;  3M3Y H;  3RN5 A;  2PNH A;  2MFI A;  2F0M A;  2PZT A;  1SAP A;  2KCT A;  4DAY A;  1CQF A;  1XTD A;  2BE5 C;  1XNQ Q;  3TS2 A;  3EA6 A;  4X65 L;  5C3E B;  4IUP A;  5K36 H;  1A62 A;  3HGB A;  4K6L A;  5K5P A;  4I65 A;  4DR5 Q;  1BKB A;  2AHO B;  4S3S A;  3A7L A;  1KRS A;  1CZW A;  4L5S A;  4KD3 A;  4JI1 Q;  5LMU Q;  1HZC A;  1PH3 A;  3M4Q A;  3ULP A;  1FNU A;  3JAM L;  3U9O A;  4A3B B;  5DEH A;  1V43 A;  4APV A;  5H1S E;  1TS2 A;  4RHR A;  3GD7 A;  3MEF A;  2F03 A;  2A68 D;  1DXM A;  2ZXO A;  1B2T A;  4BY1 G;  3UDG A;  4OO1 H;  4HAE A;  2E5L L;  4X3K A;  1RL2 A;  4RCO A;  3Q24 A;  4LF7 L;  2QEJ C;  3OW2 A;  5KRU A;  4GOP B;  1MGS A;  1BQQ T;  2VL6 A;  4C2M H;  1I5F A;  4YY3 Q;  4X65 Q;  4BY7 G;  4C1N K;  1KC8 C;  2E2H H;  5CBA E;  1IBK L;  1M8A A;  5G3L F;  2CFM A;  1KNE A;  4LFA Q;  4P72 A;  4K6D A;  3GTM B;  3PUY A;  2B29 A;  3KF8 A;  4IOC A;  2F3V A;  4JV5 L;  4OIJ A;  1B70 B;  2C5C A;  4KN7 C;  4M8A A;  2F0N A;  3BZC A;  3CCS A;  1VF5 C;  3S1Q H;  4H44 C;  3FEW X;  5F2D A;  4Y7N H;  4YHH Q;  1BDO A;  1UE7 A;  1PFB A;  2QGQ A;  3IL8 A;  4CJ1 B;  1MHW C;  3P7J A;  1EY0 A;  5KYI A;  4JCV E;  2E5L Q;  2MO0 A;  1NSN S;  1A15 A;  2XVS A;  4JYA Q;  4ZKC B;  2PMZ E;  1I6H H;  4X62 Q;  3HKS A;  5GAE C;  2K33 A;  4WJW A;  1NUC A;  1GO3 E;  2JXM B;  4EQP A;  1Z9F A;  1IBK Q;  3DEO A;  1II3 A;  1C8C A;  3D31 A;  1QUQ A;  1YNX A;  2KVM A;  2O2L D;  1G91 A;  2BA0 A;  4JV5 Q;  3WWV A;  1PTO H;  2RKS A;  3CKI B;  1Y8N B;  2LSS A;  1NMG A;  3E3X A;  3F2D A;  2O4X A;  4L6T B;  1PTO D;  1C4Q A;  1PXU A;  2JA6 H;  1KRT A;  1AZP A;  1F2Z A;  2Q8R E;  3CCE A;  4A3M H;  3NEL A;  2K5W A;  5E4W C;  4LUV A;  1EIF A;  2E76 C;  3J81 j;  5IYC H;  5EKL A;  2CWA A;  4IUQ A;  5EPJ A;  1ET6 A;  2HUG A;  4ZUI A;  3VYS A;  2MPM A;  1IKM A;  1HUN A;  4LMQ D;  2DNC A;  3H0G G;  3HP3 A;  1JB7 A;  3EFX D;  2PI2 E;  4C3H H;  1VF7 A;  2B2T A;  1Q81 C;  1JJG A;  2Y0S E;  3N52 A;  5IP7 G;  2R93 G;  4DV1 L;  1GM5 A;  2PZW A;  3A74 A;  1STA A;  2Q8I B;  3RLO A;  1H95 A;  4NKL A;  1AW7 A;  1O78 A;  4DR2 L;  1QJO A;  2SEB D;  4BY1 B;  5BN4 A;  3S2D H;  4QCL A;  1D2B A;  3JAM E;  1SJH D;  1RKN A;  5C44 G;  3H94 A;  4KY5 A;  1ASZ A;  4X3S A;  3BDC A;  4KJN A;  4KI0 A;  3ICE A;  2DY8 A;  2VQF Q;  1XTC D;  1TWA B;  1HH2 P;  1PH8 A;  2LKV A;  3PIO 3;  2EJM A;  4V0B A;  3MAQ A;  1A0I A;  4IFD H;  4DR4 L;  3HS0 C;  4FO2 A;  5ELC A;  1BO0 A;  4A3G G;  4DV2 Q;  1Y8P B;  4A3J G;  2N3S A;  4LUO A;  4G7Z C;  1PH1 A;  3K7A B;  5EPK A;  3SDZ A;  5M3M B;  5IIF A;  3G48 A;  4R8N A;  5D65 A;  4IUN A;  1E2W A;  1X3G A;  5DNF A;  3F1Z A;  4RHS A;  2OT2 A;  3FVQ A;  4DV1 Q;  1PRT F;  3E9H A;  2B2U C;  1XYI A;  1EUJ A;  2LY7 A;  2WB1 E;  2WFW A;  1C0A A;  4GNX A;  1X55 A;  4DR2 Q;  2UUB L;  2N8N A;  3K5N A;  2K50 A;  1LUZ A;  5BN5 A;  3D3R A;  1JQY D;  3M85 A;  3FKI H;  1X65 A;  2B2W A;  4YWK A;  2GVA A;  3HEJ A;  2A69 C;  4O42 A;  1OXS C;  3L9A X;  1AN8 A;  1SNQ A;  4I7A A;  3U4V A;  5FJ8 H;  4QUF A;  2YYZ A;  1JOQ A;  4A3D H;  1PH6 A;  2ID0 A;  3C1F A;  5EBC A;  4DR4 Q;  2EYO A;  2R7D A;  3UDF A;  1VS0 A;  1SNC A;  1EY9 A;  1UEB A;  4I7Z C;  1SRU A;  4X3T A;  2EY5 A;  2MUY A;  2KJX A;  4ZYS A;  3DM1 A;  1DOL A;  2GVB A;  1QVF A;  2RVL A;  5BR8 L;  3QOL A;  3ERS X;  4DV0 L;  3O13 A;  3J7A V;  2F0F A;  2K28 A;  1LT4 D;  5JEA H;  3Q22 A;  2WKD A;  4CGY B;  2HHH L;  4CKC A;  2QDB A;  4QB4 A;  1SE3 A;  2KHI A;  1NAP A;  1EZ6 A;  4KKS A;  1YVC A;  2EJG C;  5ELF A;  1WVL A;  2I5L X;  2V4D A;  4G7H C;  3HOZ H;  1B9M A;  2WIN B;  1ILQ A;  1VCI A;  2B63 G;  5I4D A;  2A5H A;  1LLR D;  4C3I B;  1OTC A;  3KJP A;  4Z9C B;  1H9K A;  3GTO H;  1EWC A;  3I2Z A;  3VYU A;  3H0G B;  4JI5 L;  2A74 C;  3KLR A;  1SNO A;  2E2J H;  1E2V A;  3MXP A;  2YU9 H;  3TDQ A;  3J80 i;  3IRB A;  3ERO A;  4OEL B;  4A3I H;  2R93 B;  4DV0 Q;  2LXK A;  3KLS A;  5C3W A;  5LMN W;  3E0E A;  4OX9 L;  1R9T H;  2HHH Q;  1EZ8 A;  5C44 B;  4FP5 D;  1STG A;  3NQT A;  2JQO A;  3TZU A;  2KBN A;  4B9W A;  4CKE A;  3KBX A;  1JWS D;  4TKO B;  4PNY A;  4UHV A;  1BXT A;  2E2I H;  3AEV A;  4GZY C;  3MFG A;  2VB3 X;  4XT1 B;  3SGI A;  1DON A;  2G9H D;  3ND9 A;  1OO9 B;  1LTB D;  1I50 B;  1C7Y A;  1STH A;  4JI5 Q;  1SFO H;  2NVQ B;  3HOU H;  5IP9 G;  4A3G B;  5J1Z A;  1EQV A;  4GOP C;  3G71 A;  3TSS A;  1MKH A;  4Q0F A;  5C4J H;  5JOB A;  1VQP A;  2BDN A;  2JA7 G;  1JOR A;  1XPU A;  5DLQ E;  1SYD A;  1WTP A;  4XQN A;  3S16 B;  4CBV A;  4JG2 A;  5FLX c;  1IYV A;  4OX9 Q;  3GTJ B;  3PIO A;  2PQE A;  1YNJ C;  4QIW B;  4TSS A;  3J81 i;  2I07 B;  3S1M B;  4RH6 A;  1EY4 A;  4OHJ A;  3J7Y W;  3BS1 A;  2UUC L;  1VQ4 A;  4KJO A;  4A3F G;  4YWL A;  4R4C A;  3ULL A;  1G6Z A;  1EEF D;  1BR9 A;  1TII D;  3MXG A;  3AU7 A;  1F2Y A;  1H9M A;  1S5E D;  1HZB A;  4BBS G;  5KEE A;  4H02 A;  1Q1E A;  4ZRZ A;  3PCO B;  4PZ8 A;  2DNE A;  3A8I E;  4R4O A;  1KLG D;  2B3G A;  3SE0 A;  1XPO A;  1W3S A;  3GTQ B;  2D62 A;  3HKZ B;  2PZU A;  1K0S A;  1V1Q A;  3OWF A;  3I90 A;  2UXB Q;  3EQL C;  3K81 C;  1WI5 A;  4LWC A;  1SR3 A;  1TWC B;  2CHB D;  3F8T A;  1WCM G;  2F0P A;  4A3C H;  3FDT A;  4MNO A;  1SMY C;  1GD7 A;  1ENC A;  3L3O C;  1UE1 A;  2KCN A;  1GUW A;  1NTG A;  4FVM A;  2RF4 A;  1XNR Q;  2KHJ A;  3OWE B;  2NVT H;  3KF6 A;  4OL7 A;  4IPD A;  1PYB A;  4C3J G;  1HZ9 A;  1ENF A;  2B63 B;  4MTK A;  5IYB H;  1T9H A;  2UUC Q;  3QIA A;  2VXW A;  3CQZ B;  3BYT B;  3EJI A;  2AUK A;  4J8Q A;  1XMO L;  3MA2 B;  1R4P B;  2QEX A;  1OXT A;  2TMP A;  4OXP A;  3S9W A;  2HCC A;  4LK1 C;  1ESF A;  2LFN A;  5C4H A;  2B39 A;  1EY5 A;  4ODG A;  2IPK D;  4B3S L;  2J7Z A;  3DM3 A;  4DV4 L;  2R7Z G;  2AQ2 B;  1TWG B;  1IXR A;  3UDX A;  1HNX L;  4P74 A;  1XPR A;  1PZI D;  4L5T A;  3GTL B;  2C9O A;  2B8G A;  4DU9 A;  2K52 A;  5C3E H;  2KCM A;  1E22 A;  4HID A;  3HOW G;  3H09 A;  4JOI A;  1SDF A;  2FFK B;  1UE6 A;  2G5D A;  3VR3 A;  2XWB B;  3T56 B;  3CC4 A;  1HPC A;  1AH9 A;  3I4L A;  3K0Y A;  2B2U A;  1WYD A;  2RDH A;  1YHA A;  1XMO Q;  1GHJ A;  2Y0S G;  3WOF A;  1VQ9 A;  4A3B H;  1G29 1;  1K0R A;  1FNV A;  4B3R L;  3KFU A;  1SNP A;  4BBR G;  1Q82 C;  4DR6 Q;  4A3K G;  4HSV A;  2X69 A;  2R7F A; 
#chains in the Genus database with same CATH homology
 1EYA A;  1I3Q B;  2JA7 B;  1F9S A;  1GUG A;  1ML0 D;  4K5X A;  4R9W A;  1NR2 A;  1O7Z A;  5FLX L;  4HMJ A;  2GA4 B;  2L11 A;  1BCP B;  3DHQ A;  3T16 A;  2ENB A;  2HDL A;  3I4N B;  4A3F B;  3TP7 A;  1XX8 A;  1YNJ D;  4BBS B;  4IUU A;  5C5M A;  2K5Q A;  1RF2 D;  5A35 A;  5FO7 B;  4MIU A;  1CQV A;  2EYP A;  4RA8 A;  4K2K A;  3CRL C;  1QNU A;  2PMZ B;  1WCM B;  1X3P A;  3T4A C;  2K04 A;  1UNS A;  3TP6 A;  3PO3 B;  4Q5V A;  2EY2 A;  1I4H A;  3K59 A;  1F9P A;  4IUV A;  2SNM A;  1HCZ A;  2A6E C;  2MGS A;  4ABN A;  3G6J B;  2WKC A;  2K03 A;  3FRP B;  2XN9 C;  1DOM A;  5M9O A;  1TS3 A;  1H9J A;  2Z1C A;  2AQ1 B;  1AEX A;  4K8I A;  3DWQ A;  1D5X C;  1CHP D;  2B2Y A;  1TS4 A;  1K83 B;  2KOL A;  2D2C C;  2R7Z B;  4U68 A;  2FJ2 A;  2M2L A;  2F0O A;  3SK6 A;  3K5L A;  2A6H D;  3HOW B;  1V1P B;  2R6G A;  1EQT A;  1LAC A;  1O80 A;  4H7B A;  3OIP A;  4KK7 A;  1U4L A;  4ME5 A;  3DXJ C;  1T5E A;  2EOT A;  2Y0S B;  4JK1 C;  3I3C A;  3GTK B;  1LV9 A;  5D3I B;  4BBR B;  3E0J A;  2DY7 A;  5C6A A;  4A3K B;  1RDP D;  3NWT A;  1CHQ D;  4XXE A;  5IGD A;  2KUM A;  2NVY B;  4MN3 A;  3A8K E;  2XSC A;  3PV0 A;  1ICW A;  4M1U B;  4CHT B;  5M5X B;  1HQR D;  3HOY B;  1SJE D;  2SNS A;  2JEB I;  1JCK B;  1U4R A;  5FLX E;  3VA5 A;  3A54 A;  1KLU D;  4FYD A;  1SSO A;  1ROD A;  4ULL A;  3S2H B;  2RA4 A;  1VDZ A;  4UDU C;  1GHK A;  1EU3 A;  4PV1 C;  1FYC A;  1R4Q B;  4CKB A;  4ILW A;  4KHZ A;  2EVB A;  3ND8 A;  5FOB B;  4XT3 B;  4G7O C;  5C5L A;  3I91 A;  3MWY W;  5CV4 A;  3A56 A;  5M5W B;  1SYG A;  2XWJ B;  3QOJ A;  2ZXP A;  1B44 D;  2KQ3 A;  2VB2 X;  1SEB D;  1RD9 D;  1BUV T;  1RHP A;  2A6E D;  3R2T A;  1EU4 A;  1ZEQ X;  3PUX A;  3E5S A;  5ELE A;  2L4N A;  1G2S A;  3OW7 A;  1HFG A;  4ZQ3 A;  1PRT B;  5I2X A;  1U9R A;  3NWS A;  3VA7 A;  2O5J C;  3CRK C;  3OSO A;  4HR7 B;  2KCC A;  2G9D A;  4KKU A;  4XYQ A;  4XTC S;  2F0S A;  1WD0 A;  2X6G A;  3OHX C;  3VR5 A;  1V1O A;  1GUS A;  3SK5 A;  1DJR D;  1IHZ A;  3FPP A;  1FNW A;  2QIL A;  4IUT A;  3SK4 A;  1Z47 A;  4C3I G;  2BCO A;  5D3D A;  5JPN C;  1A2T A;  5DM7 3;  1EY6 A;  1HRJ A;  4BWG B;  4DXF A;  3C2P A;  3NBH A;  3K5O A;  1NR4 A;  2IWH A;  2BE5 D;  1Y1V B;  3HOX B;  2MP1 A;  4EVO A;  1ET9 A;  5JJZ A;  5C4Z A;  3QB3 A;  4RCN A;  3SEB A;  4DAV A;  1JWM D;  5LL6 X;  2NN6 G;  4HN7 A;  4K8J A;  2Z4H A;  1JIC A;  2EXZ A;  3HG9 A;  4FF3 A;  4F7X A;  3MXU A;  4PMW A;  1BCP C;  4A3E B;  2WAC A;  3M3Y B;  1Z6H A;  1B4O A;  1YNN C;  2VUM B;  1SND A;  5JAV A;  1DZ1 A;  1S5F D;  2KA7 A;  2R61 A;  4NP5 A;  5BN3 A;  1PFN A;  2QKI C;  3MHB A;  2E74 C;  5AFW A;  2BOS A;  1HHV A;  2N55 A;  1HA6 A;  3I70 A;  2ICE C;  5IGE A;  1LTA D;  5FKA C;  1J8I A;  1PLF A;  4F87 A;  4C56 C;  4DXG A;  4C2M B;  3OIQ A;  4YIJ A;  3J80 L;  3E6Z X;  4ZUJ A;  2JP1 A;  2LS0 1;  1D5Z C;  4QMG A;  3MVV A;  3IKJ A;  4G57 A;  2TSS A;  3J7A F;  2M00 A;  3MFY A;  3D4R A;  2F0W A;  3PUV A;  3K6O A;  2J0T D;  1IKL A;  4BA1 I;  4J1M A;  2EYJ A;  3S1R B;  3V2T A;  5FK9 C;  3T53 B;  2JSO A;  3I4M B;  1M4V A;  4IQZ A;  1STN A;  1GUT A;  2RQX A;  1L0X B;  2H1E A;  1CA6 A;  4H13 C;  2KEE A;  3SXH A;  1LT5 D;  2FIN B;  4RKL A;  2KEC A;  2IT1 A;  1B50 A;  3R93 A;  3A8J E;  3RMH A;  3J81 L;  1KDB A;  1CT1 D;  4PQX A;  2K5D A;  5DM6 3;  1H9R A;  1Y1W B;  3BZD B;  2EY6 A;  2F0Q A;  3TME A;  1QNK A;  5E3F A;  3WOE A;  5CMD A;  1DM0 B;  1RCV D;  2K1B A;  5CV9 A;  2D9U A;  3RZO B;  1WTR A;  1HXY D;  2FHT A;  1PDQ A;  3S15 B;  1H9S B;  1BCP D;  3GV6 A;  5CV6 A;  4IZ8 A;  2F1M A;  3K58 A;  3QO2 A;  1QG7 A;  3RZD B;  3NBI A;  4OGQ C;  2O5I C;  3GTG B;  3LNN A;  4C1N I;  3PIP 3;  2QF7 A;  5EBD A;  2NN6 I;  4P2C B;  3S14 B;  1KAB A;  3I72 A;  2H4O A;  5HUR A;  2OF1 A;  3Q6S A;  2A69 D;  2JYO A;  2B8F A;  1IL8 A;  3J80 E;  1PMR A;  4H0L C;  1QOH A;  5G3L D;  1PRT C;  4DAP A;  5EKI A;  1BNZ A;  2WAQ B;  5LL6 S;  1O7Y A;  1PTO F;  5COY A;  1E2Z A;  4EQO A;  4PMB A;  3NXW A;  3W2D A;  2F3W A;  2PW5 A;  1JC7 A;  4RGT A;  4DFA A;  1F2M A;  4A3D B;  1K8M A;  3T13 A;  1QWY A;  1JWU D;  2EZV A;  4IUR A;  5CV5 A;  5JPM C;  1D1K A;  3QWN A;  3U9S A;  4N9T A;  2K32 A;  1Q8I A;  1RTN A;  1EWH A;  3NHH A;  1LO5 D;  3MEH A;  3M4O B;  3CHB D;  3KUP A;  3T51 B;  3IFT A;  1A3V A;  3J81 E;  2N88 A;  1F9R A;  1S4Z A;  1Y8O B;  4K2L A;  5J22 A;  4NW2 A;  3BDO A;  4KHV A;  1LTI D;  3D6C A;  3UI2 A;  4L63 B;  2Z4I A;  3NK9 A;  4JBW A;  2BA1 A;  1LT6 D;  4RWS C;  2YU9 B;  2RDF A;  1GXD C;  1WTX A;  3EVQ A;  1FR3 A;  3OMG A;  3TN2 A;  3K5M A;  2CQA A;  3M7N A;  4TQU S;  3M4Y A;  4B08 A;  2JA8 B;  5C0X G;  3AMU A;  2IX3 A;  4WRD A;  2FMM A;  3V05 A;  3IFD A;  5M3F B;  1LTG D;  2I46 A;  2IX0 A;  1WTW A;  2R92 B;  1TWH B;  1TKW B;  4XYO A;  1UUP A;  2NB0 A;  5EJW A;  1S5B D;  4F8M A;  3FMC A;  3HOV B;  3HOU B;  2B2V C;  3HRZ C;  3NTI A;  2XNA C;  2ZT9 C;  2B2T C;  2RDG A;  5EKK A;  3OOC A;  1AZQ A;  5IGG A;  1EFI D;  5CR3 A;  1TS5 A;  2PO4 A;  1SMY D;  2K7V A;  2M9V A;  1MD2 D;  1PRT D;  3P75 A;  5I9P A;  2L0C A;  1HTL D;  4B9X A;  5A2Q L;  2K05 A;  4EGV A;  3D6W A;  3I8Z A;  1CFM A;  2F0H A;  4U67 3;  3Q23 A;  5DAU A;  1HTP A;  3MC0 B;  2NZ1 D;  5CGK A;  2R3Z A;  3S1N B;  3TP8 A;  3BVG A;  4QF4 A;  3NP8 A;  3BVM A;  2F0D A;  1EY7 A;  3AB9 A;  4DK1 A;  5C4X B;  3GTP B;  2AWO A;  3KK7 A;  1JB3 A;  5KGU A;  1I4X A;  4DN4 M;  1OXU A;  4F88 A;  4HTH A;  1DD2 A;  3N6R A;  3KLS X;  1Q1B A;  3GO5 A;  2EYF A;  2ICI A;  4XQJ A;  5M5Y B;  3A7A B;  1KDC A;  3NPP A;  3A55 A;  1X32 A;  1S5D D;  4A93 B;  3VR6 A;  3CU7 A;  4KV6 A;  3PO2 B;  3C46 A;  2MJ8 A;  2AUJ D;  1STB A;  1W6K A;  1EYC A;  3DWP A;  5E1F A;  2WB1 B;  3RD4 A;  1L0Y B;  1ONL A;  3I73 A;  3BVZ A;  2D5D A;  4DK0 A;  4FNF A;  5K36 G;  2IX1 A;  3FPU B;  2EJF C;  4FXG C;  4E6I A;  3P1H A;  5IOD A;  1VMC A;  3PUW A;  2L12 A;  2L55 A;  4KY7 A;  2F0T A;  4RKB A;  3SK8 A;  2WP8 J;  2VNU D;  1SYC A;  4N9P A;  3NTK A;  1LTS D;  4OO1 G;  3NE5 B;  5E4X A;  4BS9 A;  5C0X I;  5KIX A;  5JVH 3;  1LAB A;  1TWF B;  5A2Q E;  2CVR A;  5NUC A;  4K5V A;  3G7L A;  1CA5 A;  5FO8 B;  1SE4 A;  1V8Q A;  4QUC A;  4CJ2 C;  3S17 B;  4J6H A;  3GQB A;  5LHY 1;  4RFB A;  2F0L A;  1I6V C;  3H91 A;  3ITP A;  3RUZ A;  2PYK A;  5IOC A;  1SE2 A;  1QCB D;  3LWE A;  2PPB C;  2IJ0 A;  2JA5 B;  1AP0 A;  5C0X J;  3Q0A A;  3H6M A;  2NN6 H;  2QCP X;  3SHL A;  1E0B A;  2OEO A;  1KAA A;  4ZAI A;  1WD1 A;  2ZXR A;  2F0U A;  4KD4 A;  2J4X A;  2WV6 D;  3X3M A;  5KND A;  3BYY B;  1ILP A;  2L5T A;  2NTT A;  2AQ3 B;  1G8Z D;  2B2V A;  2NWG A;  4IAL A;  3ONA B;  2MHV A;  1XXG A;  5T1I A;  1A2U A;  2NYZ D;  4UAI A;  1CI3 M;  1GOZ A;  4XIG S;  4ZK9 B;  3TP5 A;  2F0E A;  1HUM A;  2LMC B;  3SVM A;  2HCI A;  2NTS A;  1ZKO A;  1WTV A;  4RGN A;  3R2I A;  2NUC A;  1PZJ D;  2OXP A;  1TVX A;  1LTT D;  1JE4 A;  1STE A;  1HQM C;  4BY7 B;  4C3H G;  2KHS A;  2L1B A;  1A3U A;  4KN4 C;  1OXV A;  4HMI A;  2A73 B;  2CW0 C;  3VR2 A;  1T5X D;  3GP7 A;  4CJ0 B;  2F0J A;  5IGB A;  2PNR C;  3TZD A;  5T1G A;  1EIH A;  2Z8L A;  4RGM A;  1GJX A;  4MHE A;  2BDO A;  3MTS A;  5ELB A;  4IFD G;  2E2H B;  3C3L A;  1JR0 D;  2WII B;  3NTH A;  1D5M C;  4WOR A;  1DCZ A;  3QG1 A;  1EY8 A;  2L9H A;  5I9O A;  1PZK D;  3W3A A;  5KNB A;  3S1Q B;  5EQ0 A;  4Y7N B;  2XIW A;  1H9S A;  1PFM A;  1Q12 A;  5I2Y A;  1F77 A;  1RTO A;  1CTM A;  1QIL A;  1I4Q A;  1DOK A;  1DYQ A;  1I6H B;  2RSN A;  4G4K A;  1OXX K;  5I6Y A;  1TR5 A;  1D6E C;  4XDX A;  4DF7 A;  3PUZ A;  3D8G A;  2HDM A;  4OO1 I;  4LJZ C;  2HQE A;  4NDX A;  1F2L A;  5IT9 L;  1PTO B;  1PYW D;  3BG3 A;  1BF4 A;  3GV3 A;  1VMP A;  5JEA G;  5TSS A;  4V19 0;  1AFP A;  3NSW A;  1HFN A;  1BBX C;  2JA6 B;  2F0V A;  1I4R A;  3M7G A;  3KBG A;  4A3M B;  3D4D A;  1QE6 A;  5ELD A;  3TBI B;  3MXN A;  1KTK A;  4ZLT F;  5IGF A;  1B53 A;  2Q8T A;  1ESR A;  3K57 A;  2B2Y C;  2FMC A;  4K5W A;  1MI2 A;  1YNN D;  1B3A A;  4C3H B;  2AWN A;  1IW7 C;  1TT2 A;  5IGC A;  4FF1 A;  4DNR B;  4A3J B;  1ZYR C;  2X6L A;  3S2D B;  4AYB B;  1ZXT A;  2JEA I;  1KNA A;  1D1I A;  3WDN A;  2NBF A;  2EYM A;  1J9O A;  3URY A;  4WFN 3;  2CW0 D;  1KDA A;  4FF2 A;  1MBY A;  1G2T A;  3OMC A;  4K14 A;  2RBM A;  5CBE E;  2K6A A;  1W6J A;  4HED A;  4DGZ A;  1SYE A;  4FF4 A;  4DA2 A;  1FD7 D;  4KTA A;  5D14 A;  3X3N A;  3VR4 A;  4ZKB B;  3FKI B;  4TRD A;  5J39 A;  2EPB A;  4HSP A;  2PW7 A;  3DEP A;  4RGO S;  1EL0 A;  1Q3L A;  1TY2 A;  4X3U A;  3DMU A;  3MZ5 A;  3IAY A;  4R8I A;  3F2U A;  1I4P A;  3PMF A;  4KKT A;  4IFD I;  2A6H C;  3ZYY X;  5IT9 E;  1TY0 A;  4KMU C;  3ERQ A;  3HZX A;  3C1E A;  1Z7T A;  1A3T A;  2EYL A;  5CV7 A;  5I6W A;  1S5C D;  1WTQ A;  1F9Q A;  1TQO A;  3DUZ A;  2PCF B;  2E75 C;  3HOZ B;  2F0K A;  1U4M A;  5FO9 B;  5C0X H;  5COR A;  1WTO A;  5C3X A;  1TU2 B;  5KYL A;  5JVG 3;  3GTO B;  3R3O A;  4LAA A;  3V96 A;  1HA5 A;  4HCS A;  3H3V C;  4OIK A;  2F4I A;  1GUO A;  2E2J B;  2F0G A;  3SR1 A;  2EY1 A;  1SYF A;  1MSH A;  4FXD A;  1SYB A;  4XQQ A;  4A3I B;  4IFD J;  4RAU C;  4EQN A;  1SNM A;  1QB5 D;  1R9T B;  4KY6 A;  1Q90 A;  3L7Z C;  1U4P A;  3R8B A;  1UEA B;  2IW3 A;  1STY A;  1EYD A;  2EDG A;  1XWE A;  5CV8 A;  2SDF A;  1ENA A;  1FGB D;  1IW7 D;  2A68 C;  1A6X A;  1Y69 U;  2E2I B;  3VYR A;  1ZYR D;  1V1P A;  3BDL A;  2JE6 I;  1LTR D;  1SFO B;  4IN3 A;  2DN8 A;  2KED A;  3OPO A;  1EIG A;  1MSG A;  5C4J B;  3P20 A;  4ID6 A;  4BA2 I;  1NCV A;  1CK1 A;  2F0I A;  1LT3 D;  2IL8 A;  1CM9 A;  1IYU A;  1SBB B;  1B9N A;  1JOO A;  3DWA A;  3LX0 A;  5JEA J;  2EE1 A;  4FXK C;  4DNT B;  2SOB A;  1CZG A;  3QJY A;  2XRS D;  5KNC A;  4L8J A;  2E2D C;  4C3J B;  5CYU A;  4PMC A;  3D4W A;  3NQI A;  1SXT A;  5EGT A;  5CC4 A;  2XRQ D;  5HGT A;  1BOS A;  2NVX B;  2K01 A;  4NMZ A;  5ISR A;  1B1Z A;  2NVT B;  1I4G A;  1C48 A;  3VYT A;  1PTO C;  4O1N A;  3RLF A;  3LWU A;  2EYH A;  5EPL A;  3NUC A;  1GUN A;  2B2W C;  1JOK A;  1O7L A;  2RSO A;  1X3Q A;  1K8O A;  1EOT A;  1RJT A;  1BCP F;  1UAP A;  4HCE A;  1EEI D;  2PZT A;  2F0M A;  1SAP A;  4DAY A;  1CQF A;  2BE5 C;  3EA6 A;  5C3E B;  4IUP A;  5K36 H;  5K5P A;  3HGB A;  4K6L A;  4I65 A;  4S3S A;  3A7L A;  1CZW A;  4KD3 A;  1FNU A;  3JAM L;  3U9O A;  4A3B B;  5DEH A;  1V43 A;  1TS2 A;  4RHR A;  3GD7 A;  2F03 A;  2A68 D;  1DXM A;  2ZXO A;  1B2T A;  4OO1 H;  4HAE A;  4X3K A;  4RCO A;  3Q24 A;  2QEJ C;  5KRU A;  1MGS A;  1BQQ T;  4C1N K;  5CBA E;  1M8A A;  5G3L F;  1KNE A;  4K6D A;  3GTM B;  3PUY A;  3KF8 A;  2F3V A;  4OIJ A;  2C5C A;  4KN7 C;  4M8A A;  2F0N A;  1VF5 C;  4H44 C;  3FEW X;  5F2D A;  1BDO A;  1PFB A;  3IL8 A;  4CJ1 B;  3P7J A;  1EY0 A;  5KYI A;  1NSN S;  1A15 A;  2XVS A;  4ZKC B;  2K33 A;  4WJW A;  1NUC A;  2JXM B;  4EQP A;  3DEO A;  1II3 A;  1C8C A;  3D31 A;  2KVM A;  2O2L D;  1G91 A;  2BA0 A;  1PTO H;  2RKS A;  3CKI B;  1Y8N B;  2O4X A;  4L6T B;  1PTO D;  1C4Q A;  1PXU A;  1AZP A;  1F2Z A;  2Q8R E;  2K5W A;  5E4W C;  2E76 C;  5EKL A;  4IUQ A;  5EPJ A;  1ET6 A;  2HUG A;  4ZUI A;  3VYS A;  2MPM A;  1IKM A;  1HUN A;  4LMQ D;  2DNC A;  3HP3 A;  3EFX D;  1VF7 A;  2B2T A;  3N52 A;  2PZW A;  1STA A;  2Q8I B;  4NKL A;  1AW7 A;  1O78 A;  4BY1 B;  1QJO A;  2SEB D;  4QCL A;  5BN4 A;  1D2B A;  3JAM E;  1SJH D;  1RKN A;  3H94 A;  4KY5 A;  4X3S A;  3BDC A;  4KJN A;  4KI0 A;  2DY8 A;  1XTC D;  1TWA B;  2LKV A;  3PIO 3;  2EJM A;  4V0B A;  3MAQ A;  4IFD H;  3HS0 C;  4FO2 A;  5ELC A;  1BO0 A;  1Y8P B;  4G7Z C;  3K7A B;  5EPK A;  3SDZ A;  5M3M B;  5IIF A;  4R8N A;  5D65 A;  4IUN A;  1E2W A;  5DNF A;  4RHS A;  2OT2 A;  3FVQ A;  1PRT F;  2B2U C;  1XYI A;  2LY7 A;  3K5N A;  5BN5 A;  3D3R A;  1JQY D;  3M85 A;  2B2W A;  3HEJ A;  2A69 C;  4O42 A;  1OXS C;  3L9A X;  4QUF A;  1AN8 A;  1SNQ A;  2YYZ A;  1JOQ A;  2ID0 A;  3C1F A;  5EBC A;  2EYO A;  1SNC A;  1EY9 A;  4I7Z C;  4ZYS A;  4X3T A;  2EY5 A;  2MUY A;  2KJX A;  3DM1 A;  1DOL A;  2RVL A;  3QOL A;  3O13 A;  3J7A V;  2F0F A;  2K28 A;  1LT4 D;  5JEA H;  3Q22 A;  2WKD A;  4CGY B;  4CKC A;  2QDB A;  4QB4 A;  1SE3 A;  1NAP A;  1EZ6 A;  4KKS A;  2EJG C;  5ELF A;  1WVL A;  2V4D A;  4G7H C;  1B9M A;  2WIN B;  1ILQ A;  1VCI A;  5I4D A;  2A5H A;  1LLR D;  4C3I B;  4Z9C B;  1H9K A;  1EWC A;  3VYU A;  3H0G B;  2A74 C;  3KLR A;  1SNO A;  1E2V A;  3MXP A;  3TDQ A;  3ERO A;  2R93 B;  3KLS A;  5C3W A;  1EZ8 A;  5C44 B;  4FP5 D;  1STG A;  3NQT A;  3TZU A;  4CKE A;  4B9W A;  3KBX A;  1JWS D;  4TKO B;  4PNY A;  1BXT A;  4GZY C;  3MFG A;  2VB3 X;  4XT1 B;  1DON A;  2G9H D;  3ND9 A;  1OO9 B;  1LTB D;  1I50 B;  1STH A;  2NVQ B;  4A3G B;  5J1Z A;  1EQV A;  3TSS A;  4Q0F A;  5JOB A;  2BDN A;  1JOR A;  1SYD A;  1WTP A;  4XQN A;  3S16 B;  4CBV A;  1IYV A;  3GTJ B;  2PQE A;  1YNJ C;  4QIW B;  4TSS A;  2I07 B;  3S1M B;  4RH6 A;  1EY4 A;  4OHJ A;  3J7Y W;  3BS1 A;  4KJO A;  1G6Z A;  1EEF D;  1BR9 A;  1TII D;  3MXG A;  3AU7 A;  1F2Y A;  1H9M A;  1S5E D;  5KEE A;  1Q1E A;  4ZRZ A;  2DNE A;  3A8I E;  1KLG D;  3SE0 A;  3GTQ B;  2D62 A;  3HKZ B;  2PZU A;  3OWF A;  3I90 A;  3EQL C;  1TWC B;  2CHB D;  2F0P A;  3FDT A;  1SMY C;  1ENC A;  3L3O C;  2KCN A;  1GUW A;  4FVM A;  3OWE B;  4OL7 A;  4C3J G;  1ENF A;  2B63 B;  3QIA A;  2VXW A;  3CQZ B;  3BYT B;  3EJI A;  2AUK A;  4J8Q A;  3MA2 B;  1R4P B;  1OXT A;  2TMP A;  3S9W A;  2HCC A;  4LK1 C;  1ESF A;  2LFN A;  5C4H A;  2B39 A;  1EY5 A;  4ODG A;  2IPK D;  2J7Z A;  2AQ2 B;  1TWG B;  1PZI D;  3GTL B;  2C9O A;  2B8G A;  4DU9 A;  3H09 A;  1SDF A;  2FFK B;  3VR3 A;  2XWB B;  3T56 B;  1HPC A;  3I4L A;  3K0Y A;  2B2U A;  2RDH A;  1GHJ A;  3WOF A;  1G29 1;  1FNV A;  1SNP A;  4HSV A;  2X69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...