5LMUL

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5lmuL00
2BA0A 1FGUA 2CWPA 2QGQA 1XMQL 1UWVA 1VQ5A 1T9HA 4JI2L 1Z47A 2KENA 4A3KH 2LXKA 5BR8Q 1VS0A 1EFWA 2WAQE 3B6YA 4A93G 3PV0A 2IX1A 3HOZH 4GOPB 4GLAC 2JA7G 4JC0A 2YTVA 4OXPA 3TREA 4DR5Q 4B3SQ 3HOUH 1FL0A 3PSIA 4JI7Q 1RIPA 1OXSC 4X6AH 1UEBA 1WCMG 4JI3L 5AJ3L 1EIYB 2WAQG 3ERSX 1XNQQ 3HFZB 3G71A 1CKNA 4DV2Q 4LF6Q 3NENA 2AHOB 3RLFA 1VQKA 3PO2H 2K52A 2NN6I 2VY3A 3FKIH 1D7QA 4LUOA 4DR2L 5IE8A 3CCRA 3GTLH 4GKJQ 1TWHH 3M4PA 3Q8DA 2RF4A 1OXVA 3MEFA 2CFMA 5GAEC 4LF7L 5IWAQ 1N36L 2UXCL 1HZBA 2V1CC 4O2DA 1D8LA 4K0KQ 1EIFA 5C44H 1Y1VH 3RZDH 4APVA 3I56A 1N33Q 3CCSA 4HJ9A 3CD6A 1N9WA 4B3MQ 3S2HH 2YTYA 1I3QH 3PO3H 2D0OA 2UUAQ 1N36Q 2ZM6Q 2JQOA 2UXCQ 4TVAB 3I4NH 2IY5B 2IT1A 3BU2A 3KJPA 4PG3A 4X66Q 5GADC 4AQYL 1N33L 3OTOL 1P16A 4LF9L 1YITA 2IX0A 1X56A 3W1BA 3HOXG 4DV5L 4LNQA 1KRSA 2B63G 4NXNQ 3STBD 1YJNA 2PMZE 1XNRL 4P71A 1Q1BA 3MXNB 2R92G 1VQPA 1AH9A 2NZHA 4DAYB 4R4QA 3CMEA 1GKHA 2K14A 5GROA 1PYSB 4A3FH 1IBML 3KLWA 2UU9Q 3PUYA 1IBLL 2OWOA 3HOWG 4WJ4A 1A0IA 1TWFH 3UE1A 1VQ6A 4YWLA 3ER0A 4L5QA 1A8VA 4GN5A 3U58A 1Z9FA 2E5LQ 3S17H 4A3BH 4IPDA 1AE2A 2IHEA 3UDXA 3CPFA 4BBSG 2K5NA 4NB3A 4GS3A 4P75A 1E3PA 4YWKA 2MNAA 1M1KC 3KFUA 4A3IH 4A3CH 1Q86C 5M3MH 4A3FG 3CW2C 1WYDA 1I5FA 3CCUA 1XNQL 4IFDI 1UE1A 5LMNW 1IL2A 4UPAA 3CC2A 1L1OB 5M3FH 3HKZG 3CCJA 4A3BG 2F4VL 3J80i 1Q46A 2VQEL 1JJ2A 4A3JH 3CCLA 4OX9Q 1YI2A 1E1TA 2Q2HA 2JA5H 4GN3B 1EOVA 4JI8Q 4DV6L 4B3TQ 2DUDA 1HNXQ 4YWMA 2JE6I 3L7ZC 1L1OC 2KHIA 5JJKA 1KRTA 4IPHA 4LUZA 3GTJH 1Q1EA 4JI5L 4KLKA 5IY0A 4JI1Q 2UUAL 2UUCQ 1TXYA 2ZJRA 3HOVH 1Q12A 1VQFA 4X66L 4JI0Q 3GTGH 1VQ4A 4MZ9A 2MO0A 5LMUQ 1LUZA 3PUWA 2Y0SG 3ICEA 3K8AA 4LF5L 1QZHA 4EQ5A 1BVSA 1XNRQ 1NTGA 1VQJA 2NN6G 2VZAA 3AQQA 5LMNL 2JJQA 1XMOQ 1E22A 1VQBA 2KHJA 1NMFA 3M7NA 3S15H 3FHWA 5LMUL 4DUZL 1FJGQ 4BXXG 4X62L 2ZJPA 1XMQQ 1HR0W 4AH6A 4JI4L 5EAYA 1QZGA 3ZJYC 5M5WH 4BBRH 3S1NH 2PQAB 2JA8G 2CKZB 3S24A 4PMWA 4OWWB 2F52A 4KHPQ 4LF4L 3I4OA 3U4VA 1OXXK 2R93H 4DR1L 3H0GG 3I4NG 3CCVA 3M4OH 2HT1A 2VNUD 1Y1VG 4NPSA 1NE3A 5IWAL 4UY8C 1VQEA 1R9TH 2HQLA 2YV5A 4DNIA 3HOUG 5C4XH 4X64Q 4ME3A 2ATWA 2E8GA 1PHJA 4DR1Q 3STBC 1HH2P 3PF4A 4JBJA 3ULLA 4JYAQ 5IP9H 1S40A 5IYCG 2D62A 1I6HH 1G291 1E24A 4OONA 4RG1A 4DV1L 1PH8A 4OX9L 1Q8KA 2PI2A 3PO2G 4IPGA 4JCVE 2JEAI 4H02A 5K36G 4MNOA 3DM3A 1K3RA 4P74A 1KL9A 4JI1L 4C3HH 1SN8A 2VQFL 4DV5Q 4LF7Q 2NVQH 5IYBG 4LW1A 5ELNA 2ZJQA 1BKBA 1AE3A 3S2DH 1P8LA 1I50H 1KC8C 4KI0A 3L2PA 3GD7A 5IYDG 2OCEA 2JA7H 2ZTCA 4UP7A 1IBMQ 4QQBX 5FJ8G 3TRZA 4GOPC 1GD7A 1XPOA 4L5RC 2EQSA 1X6OA 4YY3L 5LMNQ 1XMOL 4DR6L 1PYBA 4QJFA 3H3VH 3PF5A 4IFDG 3AYHB 4Y7NH 1ASYA 4LF9Q 3M85A 4LF5Q 1QUQA 4UP8A 1YZ6A 4B3SL 2I5MX 2YU9H 2OTLA 1PH7A 3UDIA 1YVCA 2LSSA 2RHSB 1Y1WG 2PNHA 1W3SA 4BY1G 4GKKQ 1SR3A 2GN5A 4Y52H 4L5TA 1LYLA 3ULJA 4GNXA 4OWXB 2UXBL 1UE5A 4DV0L 4IOCA 1G6PA 3HOYG 4BXXH 1W2BA 4A75A 3UDGA 4A4IA 4NXML 4OO1I 2YTXA 1VQNA 1VQAA 4LWCA 3LGJA 3PGZA 1CUKA 3CF5A 4A3DH 1KHIA 1KAWA 4GKJL 1JB7A 2R7ZH 3F1ZA 2N3SA 3I4MH 1KIXA 1VQCA 1CKMA 1VQGA 2UXDL 1PVOA 3JAMc 4JI5Q 2K5VA 3PIPA 1WFQA 1B8AA 5J3BA 3CCQA 3WWVA 5C4JH 4A93H 5M3FG 4LFBQ 1N34Q 1MIUA 2AWOA 4A3EH 4BY7G 1EWIA 4DV1Q 4A3LG 2VUMG 4GNXC 1KXLA 3BJUA 4A3IG 4HIKA 4A3CG 2VUMH 4DV6Q 2FXQA 2Y0SE 4A3MH 2PQAA 3UDFA 1VQ7A 4B3RL 1PH2A 3GTOH 4LFCL 2QA4A 5JEAJ 4R4TA 2Z0SA 5IYDH 1JMCA 2I0QA 1WJJA 1YIJA 3VDYA 3HKSA 4A3DG 5M5XH 3RLNA 4A3GG 2C35B 4C2MH 5JJIA 3G4SA 2K5HA 2UUBL 3H15A 5IYBH 4B3RQ 4C3IH 3M4QA 2JEBI 2YYZA 1OXUA 1WI5A 4PZ7A 4JI0L 1HZ9A 3RN2A 1JJGA 2CQOA 3IRBA 3KF6A 2AKWB 1YJWA 5HY6A 5IP7G 3HOXH 4P72A 3HOZG 4JI2Q 1OXTA 2JK8A 5JJLA 4JI6Q 1S3OA 3TQYA 2A1AA 1Y1WH 1EYGA 3GTMH 2UXBQ 4BY7H 1U0LA 2E5LL 4DV0Q 1L2FA 4YHHL 2Z6KA 3CMAA 1RL2A 3GDEA 3A74A 3A0JA 3E9HA 3J81j 4PZ6A 4JYAL 5JEAG 3L0OA 5C44G 3K80C 2NVYH 2QEXA 2BH8A 2JA6H 4DR4L 1H95A 1PV4A 4NXMQ 4K0KL 4DK6C 4DV2L 3A5UA 2CCZA 1IZ6A 1NBWA 3KYHC 4GLVB 3PUZA 4DR6Q 2JA8H 3AFPA 3F8TA 3KF8B 3GTPH 2VQEQ 1O7IA 3HOYH 4DR7Q 4DV4Q 2R7ZG 1TWGH 3NEMA 1PH5A 3S16H 2NVXH 4AQYQ 1SE8A 2MO1A 1J6QA 4LFAQ 4IOAA 1CSQA 4JI8L 4B3TL 1CKNB 1IXRA 3ULPA 3U50C 1X3EA 3CCEA 3KJOA 1X55A 5H1SE 4YCUA 4LF8Q 1LTLA 5GAHC 1UE6A 2UUCL 2A8VA 3CAMA 3T1HQ 3OYYA 1SFOH 1Q82C 4FDBA 5IP9G 1M90C 4J15A 5DLQE 4HJ5A 1V1QA 5ELOA 1JE5A 2VW9A 4DR3Q 2CWAA 2I5HA 2KBNA 4BY1H 4A3LH 4DV7Q 4AIMA 4JBMA 3K7UC 1QUQB 1VQLA 4A3KG 3CC4A 1K9MC 1YBYA 4O0AA 2NZOA 4OO1G 1TWAH 3BZKA 5C3EH 2R93G 4LUVA 4NXNL 3I4MG 1HR0L 4QIWE 4R4IA 4DV3Q 3AEVA 3HOWH 4POFA 3TEHB 3NBHB 4XTCS 1I94L 1PH6A 4BBRG 1IBKQ 3GTKH 1JJCB 4X65L 1VQDA 3I2ZA 3H3VI 1C0AA 4DR5L 1IBLQ 3F2BA 3J81c 2Q2IA 3JAMi 1Y14B 1NJIC 1HR0Q 2AWNA 4JBWA 4JG2A 4C3JH 4DKAC 3HKZE 5C3EG 3F2DA 1N32Q 4IJHA 4X64L 1KQSA 4X65Q 2Q2UA 1CKOA 2UXDQ 2LXJA 1HZAA 1TWCH 2D0PA 2ZTDA 3AFQA 3CCMA 1N34L 4BA2I 1N32L 2JA9A 1NMGA 4UP9A 3CC7A 1JT8A 1K73C 5GAGC 3H0GH 2AMCB 3I7FA 4IPCA 3HOVG 2VS1A 3OW2A 4IO9A 2I5LX 5HGQA 4DV4L 3M9BA 4OWTB 5IP7H 5C4XG 1HZCA 2E2HH 4DUYQ 2KCMA 1V9PA 4TQUS 5E7NA 3W1GA 1X3GA 3K0XA 3OTOQ 3T1YL 1GVPA 4AYBG 2WB1G 4JOIC 3D0FA 2PI2E 4LFBL 3E9IA 1U5KA 3FKIG 3FP9A 1VQHA 3NELA 1EQRA 5IT9c 4YCWA 4WJ3M 3W5OA 1Q81C 3TS2A 1BBWA 1SRUA 4A3GH 4JV5Q 1YNXA 1GO3E 1VQIA 4GN4B 1GM5A 1PFSA 4ALPA 4DR3L 2WB1E 1WCMH 4X62Q 4JI4Q 4EX5A 1PA6A 1YHAA 3E0EA 5FLMH 1PH4A 4DV7L 1X65A 4BA1I 1B7YB 4A3MG 2Q2TA 3GTQH 1L1OA 4YY3Q 3TS0A 1VCIA 4IJLA 1E7ZA 5AJ3Q 1VQOA 1XJVA 3KDFA 1IBKL 4DPGA 2R6GA 3J80c 4A76A 4KHPL 3EBEA 4GKKL 1X54A 1XPRA 1ASZA 2UU9L 2K4KA 3UE0A 2UUBQ 2RHQB 3G48A 1QVFA 4HJAA 2B29A 2JA6G 2WFWA 2HIXA 5C0XJ 3PCOB 4DR2Q 5BR8L 1VQ8A 2OQ0A 1K8AC 4BBSH 3M3YH 1IYJB 2GVAA 2JA5G 1BBUA 4JI6L 4JI7L 3K7AH 4HIOA 4R4OA 2HHHL 4HJ8A 2WP8J 2E2JH 2MQHA 4DR7L 1HNWL 2H5XA 5GQOA 1N8RC 3DLLA 4YHHQ 2EIFA 2XGTA 2ZTEA 1YHQA 4LF4Q 4QL5A 2B63H 2E2IH 2N49A 3G6EA 4HJ7A 4B3ML 3KF6B 2F4VQ 2R7DA 1HNZL 2R92H 3PUVA 4LF8L 2B3GA 1S72A 3RNUA 4A3JG 3J7ZC 4GNXB 1MJEA 1DGSA 1YEZA 2IHFA 3RR5A 4RMFA 4L5SA 1KD1C 5C0XG 2BA1A 3S1QH 2Z6KC 3PUXA 3PO3G 3KDFB 4DUYL 3JC66 2OTJA 2R7FA 2ID0A 2K75A 3RZOH 1VQMA 4JV5L 3CP0A 1EUJA 1K83H 1X9NA 1YHBA 3S1RH 1J5EL 4YCVA 4DV3L 4AYBE 4LFCQ 3S1MH 1X3FA 2KCTA 1SROA 1UE7A 2ALYB 1XTDA 1A63A 5FLMG 5FLXc 2N8NA 1C7YA 3CQZH 2EXDA 4POGA 1K8GA 2OQKA 1J5EQ 1CSPA 4R1JA 2ASBA 1G51A 2GVBA 2HIVA 3I55A 1MKHA 4HIMA 1C9OA 3SGIA 4HIDA 3D31A 1B70B 1EQQA 4LF6L 1FJGL 2NVTH 1NY4A 2BH2A 4PZ8A 1PH3A 2DGYA 3EIVA 1PH9A 1QVCA 2MFIA 1L0WA 4GOPA 2HHHQ 1I94Q 4JI3Q 1XPUA 2RCNA 1E1OA 1V43A 1HNWQ 4R4CA 5M3MG 2F3IA 3A5ZB 3J7A5 3EN2A 3BZCA 4A3EG 4JBKA 2VL6A 1HNZQ 5C0XI 1QVGA 1FVIA 1VQ9A 2N78A 1SLJA 4IFDJ 4DR4Q 2A19A 4KHZA 3K81C 4QY7A 2ES2A 1SMXA 3CXCA 2K50A 3F2CA 4LFAL 4P73A 1A62A 3GO5A 3T1YQ 1YJ9A 3U4ZA 4DAMA 3CPWA 3RLOA 1WOCA 5FJ8H 2VQFQ 2ZM6L 3J81i 2XTIA 4JOIA 1PH1A 3T1HL 1Q7YC 4GLXA 3RN5A 5M5YH 4MTNA 5IYCH 1OTCA 1HNXL 3S14H 3PIOA 1K0RA 4DK3C 1HJPA 4QGUA 1LM0A 4XIGS 3KOJA 4DUZQ 1MJCA 2L15A
chains in the Genus database with same CATH superfamily
2PW7A 1XMQL 3KBXA 2EY1A 1B3QA 3GTOB 2LXKA 5BR8Q 3S1MB 1VS0A 1EFWA 2WAQE 3PV0A 2IX1A 1KTKA 4GOPB 4GLAC 4JC0A 3PSIA 3CRLC 4JI7Q 1RIPA 3A55A 1EIYB 1STNA 1CTMA 3PO2H 1GUNA 2B39A 1FYCA 4O42A 1DOMA 2C5CA 3Q8DA 2RF4A 2M2LA 1PZID 2O5JC 1A15A 5IWAQ 2UXCL 3SVMA 2BE5D 4O2DA 4ZUJA 4HJ9A 1ENCA 1TU2B 3MXPA 1RTOA 4C1NI 3PO3H 4N9PA 1CFMA 3MAQA 2IT1A 3BU2A 4FF4A 3NPPA 4X66Q 1Y8OB 1I6HB 1VMCA 4LF9L 1YITA 4CDDC 3HOXG 4H7BA 4EQPA 1PZKD 2RDGA 4LNQA 2B63G 4NXNQ 3STBD 1XNRL 1Q1BA 2NZHA 3D3RA 2K14A 1K3BC 5GROA 3S17B 5EKKA 3PUYA 3HOWG 2OXPA 3S1QB 1SYFA 3JAML 1STBA 4L5QA 2E5LQ 1AE2A 1H9RA 2E2DC 3UDXA 4BBSG 2K5NA 3W2DA 4YWKA 3KFUA 2AQ1B 3CW2C 1WYDA 2AUKA 3CCUA 2O4XA 3VYRA 4A3KB 3DXJC 2Z6BA 4A3BG 2F4VL 3J80i 1Q46A 5E1FA 4HAEA 1S5DD 4KK7A 4OX9Q 1E1TA 2Q2HA 2F3VA 4JI8Q 3D8GA 5EBCA 3L7ZC 5JJKA 1KRTA 4XQQA 4LUZA 3T53B 4KLKA 5IY0A 5ELCA 1EYCA 5A2QL 3K6OA 4ABNA 3V05A 3M4YA 2MUYA 3IKJA 4HCSA 5LMUQ 1SSOA 3KLRA 4LF5L 1QZHA 1XNRQ 4IFDH 2VZAA 5LMNL 2IPKD 1VQBA 4DXFA 4X62L 2B2TC 5ELBA 5EAYA 5D65A 1QZGA 5M5WH 5EPKA 5FLXE 2JA8G 3S24A 3I73A 1ILPA 3H94A 2F0WA 2HT1A 2MPMA 3Q0AA 4NPSA 4UY8C 1VQEA 1R9TH 2HQLA 2M00A 1ZXTA 4TKOB 4ME3A 2E8GA 1JORA 4DR1Q 1HH2P 4JYAQ 5IP9H 1JWUD 1I6HH 1EYAA 1G291 1ZYRD 4A3JB 3PO2G 5K36G 4IPGA 3T13A 1GUSA 3DM3A 1ET6A 1K3RA 1KL9A 4LF7Q 3S2DB 1SN8A 4C3IG 2ZJQA 1JE4A 1KC8C 2BDNA 4V0BA 3KLSA 2JA7H 2ZTCA 2L12A 1F2MA 4GOPC 4FXDA 1GD7A 1XPOA 1SBBB 1U4RA 4L5RC 1X6OA 2IL8A 4IFDG 4QJFA 3H3VH 3AYHB 2Z4IA 1NSNS 2EXZA 3M85A 5T1IA 4UP8A 4B3SL 2OTLA 4C2MB 3UDIA 1YVCA 2H1EA 2B2YA 3C1FA 1VDZA 4FNFA 4BY1G 1RJTA 4Y52H 1U4PA 1XTCD 4GNXA 1UE5A 2K32A 3HEJA 2K05A 4A4IA 1SNPA 2F0PA 2J0TD 1CUKA 3FRPB 5HURA 1KAWA 4GKJL 1SNOA 2R7ZH 2L9HA 3RZDB 3MC0B 2WAQB 1VQCA 1CKMA 1SNCA 2B2YC 1KIXA 2UXDL 1LTSD 2K5VA 1S5BD 1RD9D 3WWVA 3GV6A 1MIUA 4DV1Q 3MXUA 4A3LG 1WTQA 1EY9A 4K2KA 2NUCA 4J1MA 1ENFA 4N9TA 2F3WA 1ZKOA 2PQAA 5JEAJ 4R4TA 5IYDH 4FF2A 1WJJA 1BOSA 5M5XH 1X3PA 3M4OB 3FPPA 1HA5A 1SDFA 4PZ7A 4NKLA 1HZ9A 2WINB 3RN2A 3IRBA 1YJWA 5G3LF 5HY6A 5FKAC 5CGKA 3HOZG 5JJLA 2VB3X 1RKNA 1V1PA 1EYGA 2E5LL 1L2FA 1LT5D 4G57A 1CHPD 3PIO3 1BUVT 3A0JA 3J81j 4PZ6A 4DA2A 1ICWA 4JYAL 5JEAG 2HCIA 1EU4A 3SXHA 3K80C 2NVYH 2JA6H 4DR4L 2BCOA 1MHWC 2CCZA 4EGVA 5C3XA 3FPUB 3AFPA 2JA8H 3GTPH 1JOQA 5E3FA 1O7IA 4NMZA 3HOYH 1TWGH 3NEMA 1PH5A 5C4ZA 2NVXH 2F0IA 4LFAQ 3NTHA 4OIJA 3MFYA 4B3TL 2SEBD 5DAUA 1WTXA 3KJOA 5H1SE 2YU9B 1A6XA 5CMDA 5CBAE 1UAPA 5IP9G 4PNYA 5DLQE 1AZQA 1PLFA 4PMBA 2I5HA 1I4XA 3OMGA 4DV7Q 1MGSA 3QJYA 4AIMA 4JBMA 4XYQA 2Q8TA 5EKLA 2R93G 4PV1C 2KECA 4FXGC 3AEVA 2WKDA 3TEHB 3GTKH 5HGTA 1JJCB 3I2ZA 1F9PA 3J81c 1HR0Q 1Y14B 1QWYA 5C3EG 4JG2A 4C3JH 3HKZE 2CH4W 2Q2UA 4X65Q 1CT1D 5M5WB 5L37A 3T56B 1B9NA 1CKOA 1AP0A 3PO3B 2LXJA 1TWCH 2PW5A 1SE4A 3PO2B 2PCFB 1TS5A 2F1MA 1N32L 2Z9HA 3NWTA 3CC7A 4HMJA 4IPCA 3T16A 1BQQT 4DV4L 3C46A 4ZAIA 3MEHA 1L0YB 1ONLA 4TQUS 4K8JA 1I50B 2LS01 1SMYC 1BF4A 1X3GA 3KUPA 3T1YL 1EQVA 1V1PB 3FKIG 3FP9A 1VQHA 2QDLA 1I4RA 4F8MA 4A3GH 1BBWA 3I8ZA 1GO3E 4GN4B 1CHQD 4X62Q 1PH4A 4BY1B 2CW0D 2EE1A 1L1OA 1XJVA 1VCIA 1E7ZA 3KDFA 3CRKC 4GKKL 4HSPA 2FHTA 4CKCA 1SYEA 2RHQB 1MSGA 3G48A 3SK4A 5JVH3 5DM73 3HZXA 1ENAA 4ZK9B 1D1KA 1FNUA 1I3QB 4MTKA 4JI6L 4JI7L 4HIOA 1SXTA 4R4OA 2E2JH 4DR7L 2MQHA 3DEOA 2LY7A 1HTPA 2XGTA 4LF4Q 1EU3A 4KY7A 2N49A 4IN3A 4B3ML 2R92H 1O7ZA 2F0JA 4LF8L 2B3GA 2XWBB 3RNUA 4GNXB 4KTAA 2IHFA 1TKWB 3NWSA 4L5SA 1KLGD 1TWFB 2PO4A 5E4XA 3KDFB 2HQEA 3HS0C 4DUYL 3JC66 1JWSD 1LTBD 2ID0A 2K75A 1WTVA 1EUJA 5D3DA 1Y1VB 3S1RH 1IKLA 3PQIA 1J5EL 4YCVA 1V8QA 2OEOA 3S1MH 4I65A 1UE7A 1XTDA 3A8JE 5FLXc 3DM1A 5FLXL 1ICFB 3K7AB 4N8X1 2K01A 5K36H 1C9OA 2JYOA 1SAPA 4RGNA 1DXMA 5IGCA 2DGYA 4FP5D 1PH9A 1QVCA 2ZT9C 5M3MG 4RH6A 3J7A5 3BVGA 3BG3A 2L11A 1VQ9A 1SLJA 4QY7A 4LFAL 4P73A 1A62A 3K57A 3T1YQ 1GHKA 1SEBD 4G7HC 3J81i 1FD7D 3RN5A 3HOYB 3OWEB 4MTNA 5IYCH 4G7OC 1HNXL 1EWHA 2FMCA 2LMCB 1DONA 1HJPA 4QGUA 1RF2D 3M3YB 3M7GA 2QKIC 2RVLA 2L15A 2BA0A 3H0GB 1FGUA 2QGQA 1UWVA 4OEMB 2Z4HA 5FK9C 2A69C 5C4HA 4A3KH 1PTOH 2A6ED 3VR5A 1EQTA 1U9RA 3HOZH 4IURA 1BR9A 2JA7G 2AUJD 4B3SQ 3H91A 4X6AH 3SK6A 4JI3L 5JVG3 3LWEA 1XNQQ 3HFZB 1CKNA 4DV2Q 2AHOB 3VYSA 2FJ2A 3QR8A 4KY6A 1VQKA 4Q0FA 2NN6I 5ELEA 1D7QA 4Y7NB 3ZYYX 3GTLH 3M4PA 1B3AA 2EJFC 4BBRB 5M3MB 1C48A 4C3JB 1NCVA 3BVZA 1GUOA 4LF7L 3K5MA 3CKIB 3E5SA 1N36L 2NVTB 1WCMB 4K0KQ 1IL8A 1EIFA 5C44H 1Y1VH 3RZDH 2R7ZB 3I56A 1N33Q 3MZ5A 3CCSA 3GP7A 5KYIA 4B3MQ 1F9RA 2UUAQ 1TQOA 1N36Q 2JQOA 4TVAB 1EZ8A 3I4NH 2IY5B 4AQYL 5C44B 1TS4A 1N33L 4FF3A 4HTHA 1X56A 3A56A 1KRSA 2Z1CA 2PMZE 2A6HC 3MXNB 4DAYB 3OOCA 3SHLA 5M5XB 3CMEA 3R8BA 1IBML 3KLWA 4WJ4A 2NN6H 1VQ6A 2QW7A 4CJ1B 2NVYB 1A8VA 3S17H 4LMQD 2IHEA 3IFDA 3CPFA 2XRSD 4P75A 3DWAA 4ZRZA 1M1KC 1D5MC 3D4WA 4A3IH 1D5ZC 4A3CH 1CA6A 4IFDI 1EFID 2H4OA 1IL2A 1L1OB 3SEBA 4QB4A 5M9OA 2K04A 3E0JA 1TY0A 1HXYD 1M4VA 2VQEL 3P75A 1GJXA 1DOKA 4A3JH 3KK7A 2EOTA 1B9MA 4YWMA 3MXNA 1FR3A 2E76C 1TWGB 5ISRA 5A35A 2SOBA 1IW7C 1Q1EA 1STYA 5CBEE 1W6JA 5BN4A 2UUCQ 2F0KA 2EVBA 3HOVH 1Q12A 5FO9B 3GTKB 4JI0Q 4MZ9A 2MO0A 3R93A 3AB9A 3K8AA 3Q22A 1BVSA 5IGFA 1NTGA 2NN6G 5EJWA 4CJ0B 1XMOQ 2JJQA 1I4PA 3M7NA 5BN3A 5LMUL 1C4QA 1HR0W 3A8IE 4AH6A 1JOOA 4DXGA 2LKVA 4BBRH 4B08A 2PQAB 4KD3A 4OWWB 2F52A 4LF4L 3U4VA 2F0OA 1A3TA 2XVSA 2ICIA 4DR1L 3I4NG 4R8NA 4CGYB 2G9HD 4DNIA 5I6YA 1PHJA 1LO5D 4IUPA 1YNJD 2WV6D 4C3JG 5JJZA 1E24A 3TZUA 4DV1L 1PH8A 4EQOA 1PFBA 1NUCA 4P74A 4C3HH 2NVQH 3I4MB 1ET9A 2KEDA 4LW1A 1V1OA 5C3EB 4R9WA 3HOUB 1BKBA 3S2DH 5IGGA 1I50H 4KI0A 3L2PA 5IYDG 4UP7A 1GUTA 3TRZA 2JA7B 2QCPX 2N55A 1EY4A 3BS1A 4OGQC 4CKEA 1XMOL 4DR6L 1BCPF 1O80A 1B53A 1W6KA 3E3XA 2RHSB 3DWQA 2IX3A 2PNHA 4GKKQ 1JQYD 3VYUA 4L5TA 1AN8A 4H44C 3ULJA 2DNEA 3HOZB 4IQZA 4IOCA 1G6PA 2E2HB 1W2BA 2B8FA 2YTXA 4LWCA 3D4RA 3NQIA 4J8QA 1KHIA 3J7AF 4ZUIA 3G7LA 2B2WA 1ZYRC 4JI5Q 3S16H 3PIPA 3CCQA 5C4JH 4A93H 4DAPA 1N34Q 1BNZA 1KABA 1KXLA 2VUMH 2F03A 2FXQA 4A3BB 4A3MH 3SK5A 1VQ7A 4B3RL 4ZYSA 3K5OA 3GTOH 4LFCL 2QA4A 2Z0SA 3VDYA 4A3DG 3VR6A 4X3KA 1LTGD 4C2MH 1UNSA 2UUBL 3A8KE 4K2LA 2KHSA 2KOLA 2JN4A 1LTID 3C1EA 4FO2A 2AKWB 5IP7G 2R3ZA 3HOXH 4P72A 4JI2Q 4KV6A 1Y1WH 2MGSA 4BY7H 1K8MA 3TP5A 3IFTA 2KEEA 1RL2A 4ID6A 3A74A 3NP8A 2A6HD 3U9SA 1BCPB 4RGTA 2QEXA 5KNCA 4K0KL 3WOEA 1LTTD 1IZ6A 1WTWA 3F8TA 3KF8B 5CR3A 2VQEQ 1KNEA 4AQYQ 3QO2A 3NE5B 2HUGA 1WTPA 1IXRA 3ULPA 3U50C 3CCEA 1X55A 5GAHC 1CQVA 2UUCL 2HDLA 2K6AA 3HGBA 1Q82C 4FDBA 4HJ5A 4DR3Q 2CWAA 4BY1H 4A3LH 3K7UC 1UUPA 1K9MC 2E2JB 2L4NA 2N88A 3RZOB 1WVLA 4DV3Q 3GTLB 1HTLD 4RCOA 1C0AA 2DJGC 4JBWA 4DKAC 1PTOD 4NDXA 3BDCA 4XT1B 1QOHA 4HEDA 1HPCA 1HZAA 1STAA 2D0PA 1DJRD 2X6LA 5KEEA 1N34L 4BA2I 2TSSA 3I4NB 5GAGC 2AMCB 3I7FA 3HOVG 3QOJA 4IO9A 1TS3A 3M9BA 5IP7H 2F0VA 4RWSC 2KCMA 5E7NA 1WD1A 3K0XA 4AYBG 2WB1G 3TZDA 4JOIC 5IGBA 3NELA 4QF4A 2B2UC 3W5OA 3TS2A 1YNXA 1VQIA 1GM5A 1PFSA 4JI4Q 1YHAA 2NBFA 2K33A 3GTQH 2F0MA 4YY3Q 4OO1H 5CV7A 1JR0D 1IBKL 1XPRA 1ASZA 2SDFA 2UUBQ 2K4KA 3UE0A 2ENBA 3GTPB 2EYOA 4KKTA 1TR5A 2WFWA 1QNKA 1E2VA 2EY6A 4KKSA 1NAPA 4BBSH 2ICEC 2CVRA 4DN4M 4DAYA 5I9PA 1XYIA 2JA5G 5KRUA 3TMEA 2RDHA 2D9UA 2LFNA 2WP8J 1LV9A 3NUCA 5GQOA 4CJ2C 1AFPA 1YHQA 1G6ZA 2A6EC 4QL5A 1QB5D 2B63H 2A69D 1STGA 2F4VQ 1HNZL 1F2YA 1E2ZA 2K7VA 1MD2D 4X3SA 1S72A 3EVQA 5CV6A 1YEZA 1EY5A 1I4HA 3HP3A 5C0XG 2F0TA 2BA1A 2Z6KC 5EGTA 4A3DB 2X69A 2XWJB 4ZQ3A 2KCCA 5KNDA 3RZOH 1D2BA 2JP1A 1VQMA 4E6IA 2AQ3B 4WORA 3CP0A 4RKLA 3TSSA 1YHBA 3FEWX 4L6TB 4I7AA 1DD2A 2F0HA 2A68D 2BOSA 2N8NA 2EPBA 3ITPA 5C5LA 4POGA 1J5EQ 4R1JA 1QNUA 1VF5C 4UAIA 2ASBA 2HIVA 1GXDC 2AQ2B 4HIMA 4KY5A 3D31A 1B70B 1D1IA 4LF6L 2NVTH 1NY4A 2BH2A 2MFIA 4GOPA 3MA2B 4HR7B 4JI3Q 1XPUA 1IYVA 2RCNA 1E1OA 1V43A 3J7YW 2ZXRA 5C0XI 2NVQB 5JOBA 5I9OA 1ILQA 1WTOA 1CK1A 2A19A 4KHZA 4A3GB 2I07B 2ES2A 1EIHA 3GO5A 4G4KA 1B44D 3CPWA 5FJ8H 2VQFQ 2EDGA 2NWGA 2VUMB 1I4GA 4JOIA 1PH1A 2SNSA 3T1HL 1EY8A 1X3QA 4ODGA 3D4DA 5M5YH 4QIWB 1OTCA 5I6WA 4AYBB 5A2QE 4RCNA 3D6WA 3K7AH 1H95A 5JPNC 2F0NA 1T9HA 4JI2L 2QDBA 1Z47A 2KENA 1KDBA 4K6DA 3OIPA 1Z7TA 4OXPA 2NZ1D 3TREA 3PIP3 4DR5Q 1FL0A 3FKIB 2EJMA 1UEBA 5AJ3L 2F0LA 3ERSX 5ELFA 2DJFC 3NENA 2KUMA 1TVXA 2VY3A 3FKIH 4DNRB 3TDQA 4DR2L 4GKJQ 3CCRA 2NVXB 2EY2A 4K8IA 1OXVA 3QOLA 3MEFA 1BO0A 2CFMA 4BWGB 5GAEC 3ERQA 5IOCA 1HZBA 2V1CC 2PPBC 4DAVA 1D8LA 2L5TA 5NUCA 1SJED 2XNAC 2YTYA 1I3QH 2UXCQ 4MHEA 3BDLA 3HOVB 3KJPA 5GADC 1JWMD 1P16A 5FOBB 1YNNC 1R4PB 4DV5L 2PNRC 4YIJA 2F4IA 3BVMA 5IGEA 4P71A 4L8JA 3OPOA 1F9SA 2EYLA 1GKHA 3T51B 5I2XA 1HCZA 1PYSB 4A3FH 1AH9A 1CZGA 1A0IA 1TWFH 3UE1A 4YWLA 1CZWA 4GN5A 3U58A 4IPDA 5G3LD 2K5QA 1E3PA 2MNAA 3OSOA 4RKBA 3Q24A 2PYKA 5M3MH 1K28A 1KDCA 3SDZA 4N8FA 1XNQL 1UE1A 3MXGA 4WJWA 5M3FH 2IJ0A 1H9KA 3EJIA 1STHA 3CCLA 2F0QA 4HMIA 5M3FB 1YI2A 1J9OA 2JA5H 4O1NA 1EOVA 1Y8PB 2DUDA 2JE6I 1L1OC 1PTOB 5KNBA 5J1ZA 4JI1Q 2UUAL 1A3VA 1B4OA 2ZJRA 1JC7A 1SE2A 3GTGH 1LTAD 1GUWA 1LUZA 5CORA 3PUWA 1DOLA 2Y0SG 3ICEA 1GOZA 1QE6A 3DMUA 1T5EA 4EQ5A 1VQJA 3AQQA 1O78A 2KHJA 1NMFA 4BXXG 4DUZL 1FJGQ 2ZJPA 3TP6A 3ZJYC 3S1NH 1A3UA 1O7YA 4PMWA 3I4OA 3H0GG 3I3CA 1KNAA 3VA7A 2VNUD 4RAUC 1Y1VG 1NE3A 1XX8A 5IWAL 4FVMA 4FYDA 1S5FD 5C4XH 5CC4A 1TIID 4ZCKA 2P5ZX 1IHZA 3PF4A 2K03A 3ULLA 1I4QA 5IYCG 4OONA 3I91A 1Q8KA 2PI2A 3DHQA 2JEAI 4H02A 2EYFA 3N6RA 4JI1L 3LNNA 2VQFL 5IYBG 5ELNA 5KYLA 4DK0A 3TP7A 1P8LA 1K0SA 3GD7A 4LJZC 2OCEA 5IT9L 2L55A 1AW7A 5LMNQ 1PYBA 1HQMC 3PF5A 4LF9Q 4LF5Q 3AU7A 1QUQA 1YZ6A 1PH7A 1SNDA 3J80L 1Y1WG 3MHBA 1W3SA 1SR3A 1SNMA 2GN5A 2UXBL 4KJOA 1PTOC 4OO1I 1NR2A 2A5HA 1PDQA 1VQAA 1VQNA 3PGZA 2E75C 4XDXA 2JXMB 3CF5A 4A3DH 1JB7A 1JICA 3QIAA 5EPJA 3F1ZA 2N3SA 3I4MH 1CM9A 4JVZA 1PVOA 3JAMc 5JPMC 5T1GA 1B8AA 3GTGB 5M3FG 4A3IB 4LFBQ 2AWOA 1SYDA 4A3EH 4C56C 4K5XA 2RCFA 2DY7A 3BJUA 3OIQA 4DV6Q 2Y0SE 4JK1C 3OW7A 2KCNA 5EPLA 1PH2A 3FDTA 4RA8A 3CHBD 1JMCA 3HKSA 2C35B 3S1NB 2XRQD 1SYCA 3H15A 3TN2A 4B3RQ 3ONAB 1TT2A 3M4QA 1JCKB 2DY8A 2YYZA 1OXUA 3U9OA 1E2WA 1OXTA 1QJOA 3A54A 4JI6Q 1S3OA 2I46A 1PRTF 3MFGA 3GTMH 2UXBQ 4GZYC 3GDEA 1UEAB 2F0FA 1IKMA 2E74C 3TP8A 5JAVA 3URYA 1HA6A 4NXMQ 4DV2L 2O2LD 4GLVB 1NBWA 3KYHC 5DM63 1TWHB 2V4DA 1FNVA 2EYMA 3NHHA 4KJNA 1J6QA 3GTQB 1R9TB 1CSQA 1CKNB 1NNXA 1X3EA 4LF8Q 2JA5B 1PMRA 1ML0D 2NB0A 1QILA 3K5LA 3T1HQ 5K5PA 4RHRA 4J15A 4XXEA 1DCZA 3D6CA 1JE5A 4K6LA 1QCBD 2CHBD 4XYOA 1S5ED 3ND9A 3S15B 4A3KG 1SNQA 4O0AA 2CW0C 1IYUA 4OO1G 3BZKA 4NXNL 4C3HB 3I4MG 4R4IA 2B8GA 5D14A 3VR2A 4KD4A 1CQFA 4POFA 1I94L 3NBIA 1PH6A 2EZVA 1H9JA 4BBSB 4X65L 1LTRD 1VQDA 3VR4A 3H3VI 4HN7A 4ILWA 4OELB 4DR5L 1IBLQ 1OO9B 5FO7B 2F0EA 3RMHA 2AWNA 4IJHA 4X64L 1L0XB 1PTOF 3RD4A 2UXDQ 2HCCA 4L63B 5F2DA 3AFQA 4OIKA 3CCMA 1HUMA 5BN5A 1JT8A 1MI2A 1K73C 2IW3A 3JAME 1WTRA 2VS1A 3OW2A 5HGQA 2BDOA 4JPBW 1HZCA 2E2HH 1B1ZA 1V9PA 1LACA 3OTOQ 1GVPA 2MHVA 3D0FA 2PI2E 4CDEC 3E9IA 5IT9c 4DGZA 2QEJC 1Q81C 4F87A 4DR3L 1WCMH 1EL0A 4EX5A 1PA6A 3E0EA 3I72A 1DYQA 1K83B 3TS0A 1C8CA 5IIFA 1VQOA 4FXKC 4A76A 2R6GA 3J80c 4KHPL 3EBEA 2UU9L 4UHVA 1QVFA 4HJAA 4WFN3 2HIXA 3OMCA 3L3OC 2O5IC 1FNWA 1PZJD 2GVAA 3N52A 4X3TA 2K28A 4U68A 2R93B 2XN9C 5M5YB 3DLLA 2EIFA 3A7LA 1LLRD 4HJ7A 1JOKA 3KF6B 3E6ZX 4ULLA 3HOXB 3PUVA 1JB3A 2K5DA 4CKBA 1VF7A 4A3JG 5JEAH 1DGSA 1D6EC 1U4MA 3RR5A 4RMFA 1RODA 1BCPC 2K1BA 2WACA 3S1QH 1PRTB 2X6GA 4RFBA 3PO3G 1TY2A 3GQBA 4ZKCB 1MBYA 4AYBE 4LFCQ 3I70A 1X3FA 3EFXD 2KCTA 2NYZD 4MN3A 1A2UA 1LT4D 2A74C 1SROA 5CYUA 1A63A 5FLMG 2JA6B 4CHTB 2IWHA 2OQKA 1CSPA 4FF1A 1G51A 2GVBA 5TSSA 1MKHA 4HIDA 1EQQA 5J22A 3WOFA 5I2YA 2Z8LA 3CU7A 1H9MA 3R3OA 4R4CA 3FVQA 1Q90A 1EYDA 5C3WA 3BYYB 4A3EG 2VL6A 1HNZQ 1QVGA 1FVIA 3DUZA 2N78A 1XXGA 3K81C 1DZ1A 1SMXA 3F2CA 3LX0A 1YJ9A 3U4ZA 4TRDA 4A3MB 3RLOA 1WOCA 3G6JB 2QILA 1PFMA 1RHPA 3KF8A 4GLXA 4RGOS 3V96A 3S14H 1K0RA 4KHVA 3T4AC 4DK3C 1O7LA 3R2IA 2TMPA 1ZEQX 1G91A 3MWYW 1I6VC 2D5DA 1PRTD 1AZPA 1LABA 4XIGS 3BYTB 3KOJA 1MJCA 2CWPA 1GHJA 1VQ5A 2RKSA 4DK1A 2Q8RE 3GTJB 5KIXA 1TWCB 3B6YA 4A93G 3IL8A 3Q6SA 2YTVA 1PYWD 3HOUH 4OHJA 4G7ZC 1OXSC 4RHSA 1WCMG 3HKZB 2WAQG 3G71A 4LF6Q 4IZ8A 5C5MA 3RLFA 1II3A 2K52A 4LK1C 4LUOA 5IE8A 4C1NK 1LT6D 4KKUA 5KGUA 1TWHH 3V2TA 4NW2A 3EQLC 5AFWA 3DEPA 3BDOA 4APVA 2RSNA 3X3MA 4V190 3CD6A 2RSOA 1N9WA 1ESRA 2D0OA 1B2TA 2ZM6Q 1PFNA 1IW7D 2G5DA 4PG3A 4ZLTF 3C2PA 1HUNA 1Q8IA 5CV8A 3BZDB 3LWUA 3OTOL 5LHY1 1QG7A 2KVMA 2IX0A 3W1BA 4U673 4IUUA 2B2VA 1LT3D 1YJNA 2R92G 2E2IB 1FGBD 1VQPA 1H9SA 2RDFA 3C3LA 4R4QA 2OWOA 2UU9Q 1IBLL 2Y0SB 2OT2A 3ER0A 1TWAB 1Z9FA 4A3BH 2F0GA 1CA5A 4NB3A 4GS3A 3PMFA 4BS9A 3P1HA 4PMCA 4KN7C 1Q86C 1SMYD 4A3FG 4QUFA 3GV3A 1I5FA 3S16B 1F77A 5LMNW 4UPAA 3CC2A 1Y69U 3HKZG 3CCJA 4M8AA 1S4ZA 1EZ6A 4MIUA 2G9DA 2L0CA 2C9OA 1JJ2A 3L9AX 5C6AA 2PQEA 4K5WA 1BBXC 4BY7B 2PZUA 4GN3B 4DV6L 4B3TQ 4K14A 1HNXQ 2ZXPA 4IUTA 2KHIA 3J81E 1EEFD 2D2CC 4IPHA 3GTJH 4JI5L 1EY7A 1TXYA 1VQFA 4X66L 1EOTA 1VQ4A 3HOWB 2VB2X 4IUNA 4K5VA 4H13C 5CV9A 1X32A 3I4LA 2F0UA 4OL7A 1NR4A 1E22A 3S15H 4EQNA 3FHWA 2EJGC 4JI4L 1XWEA 1XMQQ 1PXUA 4XQJA 1ESFA 2OF1A 2CKZB 3P7JA 4KHPQ 1AEXA 1S5CD 2F0DA 1HFGA 1OXXK 2R93H 3CCVA 3M4OH 4QCLA 2HD3A 2YV5A 3HOUG 4X64Q 5FO8B 2KA7A 3STBC 5C4XB 2A73B 4JBJA 1S40A 2D62A 1F2LA 4A3EB 3X3NA 1HHVA 4OX9L 4RG1A 4X3UA 4JCVE 4MNOA 2MJ8A 4XT3B 5ELDA 1EWCA 2PMZB 3NSWA 3A7AB 3VYTA 4DV5Q 2Q8IB 2EYJA 1AE3A 3NTIA 2B2VC 4UDUC 3GTMB 5I4DA 1IBMQ 4QQBX 5D3IB 4A93B 5FJ8G 4KN4C 1Z6HA 2EQSA 4YY3L 4Y7NH 1ASYA 2I5MX 2YU9H 5EQ0A 2LSSA 3K0YA 1RDPD 1LYLA 2SNMA 3QG1A 4OWXB 4DV0L 2EY5A 3HOYG 4BXXH 1STEA 4A75A 3UDGA 4NXML 4J6HA 3SR1A 3K5NA 4M1UB 5LL6S 3S2HB 3LGJA 1HQRD 1VMPA 4XQNA 2FINB 2RA4A 5DEHA 3F2UA 2GA4B 1KLUD 1VQGA 1D5XC 1WFQA 2J7ZA 5J3BA 2NTSA 4DFAA 5C0XH 4R8IA 2L1BA 4BY7G 3SE0A 1EWIA 2WIIB 2VUMG 4GNXC 2WKCA 4HIKA 4A3IG 4A3CG 5EBDA 4HCEA 3UDFA 2PZTA 5IT9E 3R2TA 1SJHD 3CQZB 3KBGA 3MTSA 4CBVA 2ZXOA 2I0QA 1YIJA 3RLNA 4A3GG 5JJIA 5E4WC 3G4SA 2K5HA 3NTKA 5IYBH 4C3IH 2JEBI 1RCVD 1WI5A 1G2SA 5IGDA 3NQTA 4JI0L 1JJGA 2CQOA 3KF6A 4B9WA 2JK8A 4CDCC 3TQYA 2A1AA 3H09A 1U0LA 5CV5A 4CDFC 4DV0Q 3J7AV 3KLSX 4YHHL 2Z6KA 3CMAA 3E9HA 4F7XA 3L0OA 2PZWA 5C44G 2BH8A 1PV4A 4DK6C 1Q3LA 4IUVA 3IAYA 3A5UA 2WB1B 3PUZA 4DU9A 3S14B 2RQXA 3S1RB 1EY6A 4H0LC 4DR7Q 4DV4Q 2CH4A 2R7ZG 1SE8A 2M9VA 2MO1A 1SFOB 2J4XA 2KJXA 4IOAA 5DNFA 4JI8L 1WD0A 1EEID 1BCPD 4YCUA 1LTLA 1UE6A 3H6MA 2A8VA 3CAMA 4DF7A 3OYYA 1SFOH 1M90C 1HRJA 1V1QA 5ELOA 2VW9A 3S9WA 3OHXC 2KBNA 3I90A 1QUQB 3O13A 4P2CB 1VQLA 3CC4A 1YBYA 3WDNA 2NZOA 1TWAH 5C3EH 2HDMA 1EIGA 4LUVA 1TS2A 4IUQA 1HR0L 4QIWE 3HOWH 2DN8A 3NBHB 4XTCS 1IBKQ 2BE5C 4RGMA 4BBRG 2VXWA 4C3HG 4ME5A 1CI3M 3F2BA 1KDAA 2Q2IA 3QWNA 1EY0A 3JAMi 4JW0A 1NJIC 1YNND 2B2TA 3F2DA 1N32Q 3NXWA 1KQSA 1YNJC 5IODA 1K8OA 3EA6A 1DM0B 1B50A 3VR3A 3OWFA 2ZTDA 5J39A 2JA9A 1NMGA 4UP9A 2XSCA 1U4LA 4HSVA 3HG9A 3Q23A 3H0GH 2FFKB 5LL6X 1WTHA 2I5LX 4I7ZC 1R4QB 4OWTB 3SK8A 4DNTB 3QB3A 5C4XG 4DUYQ 2B63B 3W1GA 2NTTA 4LFBL 1U5KA 3AMUA 1EQRA 4YCWA 4WJ3M 1M8AA 1SRUA 3K58A 4JV5Q 5CV4A 3FMCA 2B2WC 2MP1A 4ALPA 2WB1E 3J81L 5FLMH 4NP5A 2A68C 4LAAA 4DV7L 1X65A 4BA1I 1B7YB 4A3MG 2Q2TA 2ATWA 1Y8NB 2E2IH 4IJLA 5AJ3Q 4DR6Q 4DPGA 4QMGA 4TSSA 1X54A 2JA6G 2B29A 3RUZA 3P20A 5C0XJ 3PCOB 4KMUC 5BR8L 4DR2Q 1VQ8A 3EROA 2OQ0A 1K8AC 3M3YH 1IYJB 5C4JB 1SE3A 4QUCA 1A2TA 1H9SB 1PRTC 3UI2A 1BBUA 2HHHL 4WRDA 2JSOA 4HJ8A 1HNWL 2H5XA 1N8RC 2R92B 4YHHQ 2ZTEA 1BDOA 1Y1WB 2EYPA 3G6EA 2R7DA 3J7ZC 1MJEA 3J80E 2FMMA 1F2ZA 1KD1C 3PUXA 4A3FB 4EVOA 3HRZC 1J8IA 2R7FA 3W3AA 4JV5L 4PQXA 2F0SA 1GUGA 1K83H 1HFNA 1X9NA 1E0BA 1BXTA 4DV3L 2ALYB 1C7YA 3CQZH 2K5WA 2EXDA 2DNCA 1K8GA 1KAAA 3I55A 4IALA 3SGIA 4B9XA 1FJGL 3NK9A 2EYHA 4PZ8A 1PH3A 2QF7A 3EIVA 5EKIA 3S2HH 1L0WA 2HHHQ 4ZKBB 1HNWQ 1I94Q 2OTJA 1SYBA 2F3IA 3A5ZB 1F9QA 3EN2A 1SYGA 2XIWA 3BZCA 4JBKA 2JA8B 5COYA 4S3SA 4IFDJ 1RTNA 4DR4Q 4Z9CB 3CXCA 2K50A 1G8ZD 2R61A 2B2UA 4DAMA 3ND8A 3VA5A 4F88A 2ZM6L 4Q5VA 1G2TA 1T5XD 2XTIA 1Q7YC 3MVVA 3H3VC 3PIOA 3NBHA 1MSHA 3K59A 2KQ3A 1LM0A 2CQAA 2RBMA 4C3IB 4DUZQ 3DWPA 3TBIB
chains in the Genus database with same CATH topology
2BA0A 1FGUA 2CWPA 2QGQA 1XMQL 1UWVA 1VQ5A 1T9HA 4JI2L 1Z47A 2KENA 4A3KH 2LXKA 5BR8Q 1VS0A 1EFWA 2WAQE 3B6YA 4A93G 3PV0A 2IX1A 3HOZH 4GOPB 4GLAC 2JA7G 4JC0A 2YTVA 4OXPA 3TREA 4DR5Q 4B3SQ 3HOUH 1FL0A 3PSIA 4JI7Q 1RIPA 1OXSC 4X6AH 1UEBA 1WCMG 4JI3L 5AJ3L 1EIYB 2WAQG 3ERSX 1XNQQ 3HFZB 3G71A 1CKNA 4DV2Q 4LF6Q 3NENA 2AHOB 3RLFA 1VQKA 3PO2H 2K52A 2NN6I 2VY3A 3FKIH 1D7QA 4LUOA 4DR2L 5IE8A 3CCRA 3GTLH 4GKJQ 1TWHH 3M4PA 3Q8DA 2RF4A 1OXVA 3MEFA 2CFMA 5GAEC 4LF7L 5IWAQ 1N36L 2UXCL 1HZBA 2V1CC 4O2DA 1D8LA 4K0KQ 1EIFA 5C44H 1Y1VH 3RZDH 4APVA 3I56A 1N33Q 3CCSA 4HJ9A 3CD6A 1N9WA 4B3MQ 3S2HH 2YTYA 1I3QH 3PO3H 2D0OA 2UUAQ 1N36Q 2ZM6Q 2JQOA 2UXCQ 4TVAB 3I4NH 2IY5B 2IT1A 3BU2A 3KJPA 4PG3A 4X66Q 5GADC 4AQYL 1N33L 3OTOL 1P16A 4LF9L 1YITA 2IX0A 1X56A 3W1BA 3HOXG 4DV5L 4LNQA 1KRSA 2B63G 4NXNQ 3STBD 1YJNA 2PMZE 1XNRL 4P71A 1Q1BA 3MXNB 2R92G 1VQPA 1AH9A 2NZHA 4DAYB 4R4QA 3CMEA 1GKHA 2K14A 5GROA 1PYSB 4A3FH 1IBML 3KLWA 2UU9Q 3PUYA 1IBLL 2OWOA 3HOWG 4WJ4A 1A0IA 1TWFH 3UE1A 1VQ6A 4YWLA 3ER0A 4L5QA 1A8VA 4GN5A 3U58A 1Z9FA 2E5LQ 3S17H 4A3BH 4IPDA 1AE2A 2IHEA 3UDXA 3CPFA 4BBSG 2K5NA 4NB3A 4GS3A 4P75A 1E3PA 4YWKA 2MNAA 1M1KC 3KFUA 4A3IH 4A3CH 1Q86C 5M3MH 4A3FG 3CW2C 1WYDA 1I5FA 3CCUA 1XNQL 4IFDI 1UE1A 5LMNW 1IL2A 4UPAA 3CC2A 1L1OB 5M3FH 3HKZG 3CCJA 4A3BG 2F4VL 3J80i 1Q46A 2VQEL 1JJ2A 4A3JH 3CCLA 4OX9Q 1YI2A 1E1TA 2Q2HA 2JA5H 4GN3B 1EOVA 4JI8Q 4DV6L 4B3TQ 2DUDA 1HNXQ 4YWMA 2JE6I 3L7ZC 1L1OC 2KHIA 5JJKA 1KRTA 4IPHA 4LUZA 3GTJH 1Q1EA 4JI5L 4KLKA 5IY0A 4JI1Q 2UUAL 2UUCQ 1TXYA 2ZJRA 3HOVH 1Q12A 1VQFA 4X66L 4JI0Q 3GTGH 1VQ4A 4MZ9A 2MO0A 5LMUQ 1LUZA 3PUWA 2Y0SG 3ICEA 3K8AA 4LF5L 1QZHA 4EQ5A 1BVSA 1XNRQ 1NTGA 1VQJA 2NN6G 2VZAA 3AQQA 5LMNL 2JJQA 1XMOQ 1E22A 1VQBA 2KHJA 1NMFA 3M7NA 3S15H 3FHWA 5LMUL 4DUZL 1FJGQ 4BXXG 4X62L 2ZJPA 1XMQQ 1HR0W 4AH6A 4JI4L 5EAYA 1QZGA 3ZJYC 5M5WH 4BBRH 3S1NH 2PQAB 2JA8G 2CKZB 3S24A 4PMWA 4OWWB 2F52A 4KHPQ 4LF4L 3I4OA 3U4VA 1OXXK 2R93H 4DR1L 3H0GG 3I4NG 3CCVA 3M4OH 2HT1A 2VNUD 1Y1VG 4NPSA 1NE3A 5IWAL 4UY8C 1VQEA 1R9TH 2HQLA 2YV5A 4DNIA 3HOUG 5C4XH 4X64Q 4ME3A 2ATWA 2E8GA 1PHJA 4DR1Q 3STBC 1HH2P 3PF4A 4JBJA 3ULLA 4JYAQ 5IP9H 1S40A 5IYCG 2D62A 1I6HH 1G291 1E24A 4OONA 4RG1A 4DV1L 1PH8A 4OX9L 1Q8KA 2PI2A 3PO2G 4IPGA 4JCVE 2JEAI 4H02A 5K36G 4MNOA 3DM3A 1K3RA 4P74A 1KL9A 4JI1L 4C3HH 1SN8A 2VQFL 4DV5Q 4LF7Q 2NVQH 5IYBG 4LW1A 5ELNA 2ZJQA 1BKBA 1AE3A 3S2DH 1P8LA 1I50H 1KC8C 4KI0A 3L2PA 3GD7A 5IYDG 2OCEA 2JA7H 2ZTCA 4UP7A 1IBMQ 4QQBX 5FJ8G 3TRZA 4GOPC 1GD7A 1XPOA 4L5RC 2EQSA 1X6OA 4YY3L 5LMNQ 1XMOL 4DR6L 1PYBA 4QJFA 3H3VH 3PF5A 4IFDG 3AYHB 4Y7NH 1ASYA 4LF9Q 3M85A 4LF5Q 1QUQA 4UP8A 1YZ6A 4B3SL 2I5MX 2YU9H 2OTLA 1PH7A 3UDIA 1YVCA 2LSSA 2RHSB 1Y1WG 2PNHA 1W3SA 4BY1G 4GKKQ 1SR3A 2GN5A 4Y52H 4L5TA 1LYLA 3ULJA 4GNXA 4OWXB 2UXBL 1UE5A 4DV0L 4IOCA 1G6PA 3HOYG 4BXXH 1W2BA 4A75A 3UDGA 4A4IA 4NXML 4OO1I 2YTXA 1VQNA 1VQAA 4LWCA 3LGJA 3PGZA 1CUKA 3CF5A 4A3DH 1KHIA 1KAWA 4GKJL 1JB7A 2R7ZH 3F1ZA 2N3SA 3I4MH 1KIXA 1VQCA 1CKMA 1VQGA 2UXDL 1PVOA 3JAMc 4JI5Q 2K5VA 3PIPA 1WFQA 1B8AA 5J3BA 3CCQA 3WWVA 5C4JH 4A93H 5M3FG 4LFBQ 1N34Q 1MIUA 2AWOA 4A3EH 4BY7G 1EWIA 4DV1Q 4A3LG 2VUMG 4GNXC 1KXLA 3BJUA 4A3IG 4HIKA 4A3CG 2VUMH 4DV6Q 2FXQA 2Y0SE 4A3MH 2PQAA 3UDFA 1VQ7A 4B3RL 1PH2A 3GTOH 4LFCL 2QA4A 5JEAJ 4R4TA 2Z0SA 5IYDH 1JMCA 2I0QA 1WJJA 1YIJA 3VDYA 3HKSA 4A3DG 5M5XH 3RLNA 4A3GG 2C35B 4C2MH 5JJIA 3G4SA 2K5HA 2UUBL 3H15A 5IYBH 4B3RQ 4C3IH 3M4QA 2JEBI 2YYZA 1OXUA 1WI5A 4PZ7A 4JI0L 1HZ9A 3RN2A 1JJGA 2CQOA 3IRBA 3KF6A 2AKWB 1YJWA 5HY6A 5IP7G 3HOXH 4P72A 3HOZG 4JI2Q 1OXTA 2JK8A 5JJLA 4JI6Q 1S3OA 3TQYA 2A1AA 1Y1WH 1EYGA 3GTMH 2UXBQ 4BY7H 1U0LA 2E5LL 4DV0Q 1L2FA 4YHHL 2Z6KA 3CMAA 1RL2A 3GDEA 3A74A 3A0JA 3E9HA 3J81j 4PZ6A 4JYAL 5JEAG 3L0OA 5C44G 3K80C 2NVYH 2QEXA 2BH8A 2JA6H 4DR4L 1H95A 1PV4A 4NXMQ 4K0KL 4DK6C 4DV2L 3A5UA 2CCZA 1IZ6A 1NBWA 3KYHC 4GLVB 3PUZA 4DR6Q 2JA8H 3AFPA 3F8TA 3KF8B 3GTPH 2VQEQ 1O7IA 3HOYH 4DR7Q 4DV4Q 2R7ZG 1TWGH 3NEMA 1PH5A 3S16H 2NVXH 4AQYQ 1SE8A 2MO1A 1J6QA 4LFAQ 4IOAA 1CSQA 4JI8L 4B3TL 1CKNB 1IXRA 3ULPA 3U50C 1X3EA 3CCEA 3KJOA 1X55A 5H1SE 4YCUA 4LF8Q 1LTLA 5GAHC 1UE6A 2UUCL 2A8VA 3CAMA 3T1HQ 3OYYA 1SFOH 1Q82C 4FDBA 5IP9G 1M90C 4J15A 5DLQE 4HJ5A 1V1QA 5ELOA 1JE5A 2VW9A 4DR3Q 2CWAA 2I5HA 2KBNA 4BY1H 4A3LH 4DV7Q 4AIMA 4JBMA 3K7UC 1QUQB 1VQLA 4A3KG 3CC4A 1K9MC 1YBYA 4O0AA 2NZOA 4OO1G 1TWAH 3BZKA 5C3EH 2R93G 4LUVA 4NXNL 3I4MG 1HR0L 4QIWE 4R4IA 4DV3Q 3AEVA 3HOWH 4POFA 3TEHB 3NBHB 4XTCS 1I94L 1PH6A 4BBRG 1IBKQ 3GTKH 1JJCB 4X65L 1VQDA 3I2ZA 3H3VI 1C0AA 4DR5L 1IBLQ 3F2BA 3J81c 2Q2IA 3JAMi 1Y14B 1NJIC 1HR0Q 2AWNA 4JBWA 4JG2A 4C3JH 4DKAC 3HKZE 5C3EG 3F2DA 1N32Q 4IJHA 4X64L 1KQSA 4X65Q 2Q2UA 1CKOA 2UXDQ 2LXJA 1HZAA 1TWCH 2D0PA 2ZTDA 3AFQA 3CCMA 1N34L 4BA2I 1N32L 2JA9A 1NMGA 4UP9A 3CC7A 1JT8A 1K73C 5GAGC 3H0GH 2AMCB 3I7FA 4IPCA 3HOVG 2VS1A 3OW2A 4IO9A 2I5LX 5HGQA 4DV4L 3M9BA 4OWTB 5IP7H 5C4XG 1HZCA 2E2HH 4DUYQ 2KCMA 1V9PA 4TQUS 5E7NA 3W1GA 1X3GA 3K0XA 3OTOQ 3T1YL 1GVPA 4AYBG 2WB1G 4JOIC 3D0FA 2PI2E 4LFBL 3E9IA 1U5KA 3FKIG 3FP9A 1VQHA 3NELA 1EQRA 5IT9c 4YCWA 4WJ3M 3W5OA 1Q81C 3TS2A 1BBWA 1SRUA 4A3GH 4JV5Q 1YNXA 1GO3E 1VQIA 4GN4B 1GM5A 1PFSA 4ALPA 4DR3L 2WB1E 1WCMH 4X62Q 4JI4Q 4EX5A 1PA6A 1YHAA 3E0EA 5FLMH 1PH4A 4DV7L 1X65A 4BA1I 1B7YB 4A3MG 2Q2TA 3GTQH 1L1OA 4YY3Q 3TS0A 1VCIA 4IJLA 1E7ZA 5AJ3Q 1VQOA 1XJVA 3KDFA 1IBKL 4DPGA 2R6GA 3J80c 4A76A 4KHPL 3EBEA 4GKKL 1X54A 1XPRA 1ASZA 2UU9L 2K4KA 3UE0A 2UUBQ 2RHQB 3G48A 1QVFA 4HJAA 2B29A 2JA6G 2WFWA 2HIXA 5C0XJ 3PCOB 4DR2Q 5BR8L 1VQ8A 2OQ0A 1K8AC 4BBSH 3M3YH 1IYJB 2GVAA 2JA5G 1BBUA 4JI6L 4JI7L 3K7AH 4HIOA 4R4OA 2HHHL 4HJ8A 2WP8J 2E2JH 2MQHA 4DR7L 1HNWL 2H5XA 5GQOA 1N8RC 3DLLA 4YHHQ 2EIFA 2XGTA 2ZTEA 1YHQA 4LF4Q 4QL5A 2B63H 2E2IH 2N49A 3G6EA 4HJ7A 4B3ML 3KF6B 2F4VQ 2R7DA 1HNZL 2R92H 3PUVA 4LF8L 2B3GA 1S72A 3RNUA 4A3JG 3J7ZC 4GNXB 1MJEA 1DGSA 1YEZA 2IHFA 3RR5A 4RMFA 4L5SA 1KD1C 5C0XG 2BA1A 3S1QH 2Z6KC 3PUXA 3PO3G 3KDFB 4DUYL 3JC66 2OTJA 2R7FA 2ID0A 2K75A 3RZOH 1VQMA 4JV5L 3CP0A 1EUJA 1K83H 1X9NA 1YHBA 3S1RH 1J5EL 4YCVA 4DV3L 4AYBE 4LFCQ 3S1MH 1X3FA 2KCTA 1SROA 1UE7A 2ALYB 1XTDA 1A63A 5FLMG 5FLXc 2N8NA 1C7YA 3CQZH 2EXDA 4POGA 1K8GA 2OQKA 1J5EQ 1CSPA 4R1JA 2ASBA 1G51A 2GVBA 2HIVA 3I55A 1MKHA 4HIMA 1C9OA 3SGIA 4HIDA 3D31A 1B70B 1EQQA 4LF6L 1FJGL 2NVTH 1NY4A 2BH2A 4PZ8A 1PH3A 2DGYA 3EIVA 1PH9A 1QVCA 2MFIA 1L0WA 4GOPA 2HHHQ 1I94Q 4JI3Q 1XPUA 2RCNA 1E1OA 1V43A 1HNWQ 4R4CA 5M3MG 2F3IA 3A5ZB 3J7A5 3EN2A 3BZCA 4A3EG 4JBKA 2VL6A 1HNZQ 5C0XI 1QVGA 1FVIA 1VQ9A 2N78A 1SLJA 4IFDJ 4DR4Q 2A19A 4KHZA 3K81C 4QY7A 2ES2A 1SMXA 3CXCA 2K50A 3F2CA 4LFAL 4P73A 1A62A 3GO5A 3T1YQ 1YJ9A 3U4ZA 4DAMA 3CPWA 3RLOA 1WOCA 5FJ8H 2VQFQ 2ZM6L 3J81i 2XTIA 4JOIA 1PH1A 3T1HL 1Q7YC 4GLXA 3RN5A 5M5YH 4MTNA 5IYCH 1OTCA 1HNXL 3S14H 3PIOA 1K0RA 4DK3C 1HJPA 4QGUA 1LM0A 4XIGS 3KOJA 4DUZQ 1MJCA 2L15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BA0 A;  1FGU A;  2CWP A;  2QGQ A;  1XMQ L;  1UWV A;  1VQ5 A;  1T9H A;  4JI2 L;  1Z47 A;  2KEN A;  4A3K H;  2LXK A;  5BR8 Q;  1VS0 A;  1EFW A;  2WAQ E;  3B6Y A;  4A93 G;  3PV0 A;  2IX1 A;  3HOZ H;  4GOP B;  4GLA C;  2JA7 G;  4JC0 A;  2YTV A;  4OXP A;  3TRE A;  4DR5 Q;  4B3S Q;  3HOU H;  1FL0 A;  3PSI A;  4JI7 Q;  1RIP A;  1OXS C;  4X6A H;  1UEB A;  1WCM G;  4JI3 L;  5AJ3 L;  1EIY B;  2WAQ G;  3ERS X;  1XNQ Q;  3HFZ B;  3G71 A;  1CKN A;  4DV2 Q;  4LF6 Q;  3NEN A;  2AHO B;  3RLF A;  1VQK A;  3PO2 H;  2K52 A;  2NN6 I;  2VY3 A;  3FKI H;  1D7Q A;  4LUO A;  4DR2 L;  5IE8 A;  3CCR A;  3GTL H;  4GKJ Q;  1TWH H;  3M4P A;  3Q8D A;  2RF4 A;  1OXV A;  3MEF A;  2CFM A;  5GAE C;  4LF7 L;  5IWA Q;  1N36 L;  2UXC L;  1HZB A;  2V1C C;  4O2D A;  1D8L A;  4K0K Q;  1EIF A;  5C44 H;  1Y1V H;  3RZD H;  4APV A;  3I56 A;  1N33 Q;  3CCS A;  4HJ9 A;  3CD6 A;  1N9W A;  4B3M Q;  3S2H H;  2YTY A;  1I3Q H;  3PO3 H;  2D0O A;  2UUA Q;  1N36 Q;  2ZM6 Q;  2JQO A;  2UXC Q;  4TVA B;  3I4N H;  2IY5 B;  2IT1 A;  3BU2 A;  3KJP A;  4PG3 A;  4X66 Q;  5GAD C;  4AQY L;  1N33 L;  3OTO L;  1P16 A;  4LF9 L;  1YIT A;  2IX0 A;  1X56 A;  3W1B A;  3HOX G;  4DV5 L;  4LNQ A;  1KRS A;  2B63 G;  4NXN Q;  3STB D;  1YJN A;  2PMZ E;  1XNR L;  4P71 A;  1Q1B A;  3MXN B;  2R92 G;  1VQP A;  1AH9 A;  2NZH A;  4DAY B;  4R4Q A;  3CME A;  1GKH A;  2K14 A;  5GRO A;  1PYS B;  4A3F H;  1IBM L;  3KLW A;  2UU9 Q;  3PUY A;  1IBL L;  2OWO A;  3HOW G;  4WJ4 A;  1A0I A;  1TWF H;  3UE1 A;  1VQ6 A;  4YWL A;  3ER0 A;  4L5Q A;  1A8V A;  4GN5 A;  3U58 A;  1Z9F A;  2E5L Q;  3S17 H;  4A3B H;  4IPD A;  1AE2 A;  2IHE A;  3UDX A;  3CPF A;  4BBS G;  2K5N A;  4NB3 A;  4GS3 A;  4P75 A;  1E3P A;  4YWK A;  2MNA A;  1M1K C;  3KFU A;  4A3I H;  4A3C H;  1Q86 C;  5M3M H;  4A3F G;  3CW2 C;  1WYD A;  1I5F A;  3CCU A;  1XNQ L;  4IFD I;  1UE1 A;  5LMN W;  1IL2 A;  4UPA A;  3CC2 A;  1L1O B;  5M3F H;  3HKZ G;  3CCJ A;  4A3B G;  2F4V L;  3J80 i;  1Q46 A;  2VQE L;  1JJ2 A;  4A3J H;  3CCL A;  4OX9 Q;  1YI2 A;  1E1T A;  2Q2H A;  2JA5 H;  4GN3 B;  1EOV A;  4JI8 Q;  4DV6 L;  4B3T Q;  2DUD A;  1HNX Q;  4YWM A;  2JE6 I;  3L7Z C;  1L1O C;  2KHI A;  5JJK A;  1KRT A;  4IPH A;  4LUZ A;  3GTJ H;  1Q1E A;  4JI5 L;  4KLK A;  5IY0 A;  4JI1 Q;  2UUA L;  2UUC Q;  1TXY A;  2ZJR A;  3HOV H;  1Q12 A;  1VQF A;  4X66 L;  4JI0 Q;  3GTG H;  1VQ4 A;  4MZ9 A;  2MO0 A;  5LMU Q;  1LUZ A;  3PUW A;  2Y0S G;  3ICE A;  3K8A A;  4LF5 L;  1QZH A;  4EQ5 A;  1BVS A;  1XNR Q;  1NTG A;  1VQJ A;  2NN6 G;  2VZA A;  3AQQ A;  5LMN L;  2JJQ A;  1XMO Q;  1E22 A;  1VQB A;  2KHJ A;  1NMF A;  3M7N A;  3S15 H;  3FHW A;  5LMU L;  4DUZ L;  1FJG Q;  4BXX G;  4X62 L;  2ZJP A;  1XMQ Q;  1HR0 W;  4AH6 A;  4JI4 L;  5EAY A;  1QZG A;  3ZJY C;  5M5W H;  4BBR H;  3S1N H;  2PQA B;  2JA8 G;  2CKZ B;  3S24 A;  4PMW A;  4OWW B;  2F52 A;  4KHP Q;  4LF4 L;  3I4O A;  3U4V A;  1OXX K;  2R93 H;  4DR1 L;  3H0G G;  3I4N G;  3CCV A;  3M4O H;  2HT1 A;  2VNU D;  1Y1V G;  4NPS A;  1NE3 A;  5IWA L;  4UY8 C;  1VQE A;  1R9T H;  2HQL A;  2YV5 A;  4DNI A;  3HOU G;  5C4X H;  4X64 Q;  4ME3 A;  2ATW A;  2E8G A;  1PHJ A;  4DR1 Q;  3STB C;  1HH2 P;  3PF4 A;  4JBJ A;  3ULL A;  4JYA Q;  5IP9 H;  1S40 A;  5IYC G;  2D62 A;  1I6H H;  1G29 1;  1E24 A;  4OON A;  4RG1 A;  4DV1 L;  1PH8 A;  4OX9 L;  1Q8K A;  2PI2 A;  3PO2 G;  4IPG A;  4JCV E;  2JEA I;  4H02 A;  5K36 G;  4MNO A;  3DM3 A;  1K3R A;  4P74 A;  1KL9 A;  4JI1 L;  4C3H H;  1SN8 A;  2VQF L;  4DV5 Q;  4LF7 Q;  2NVQ H;  5IYB G;  4LW1 A;  5ELN A;  2ZJQ A;  1BKB A;  1AE3 A;  3S2D H;  1P8L A;  1I50 H;  1KC8 C;  4KI0 A;  3L2P A;  3GD7 A;  5IYD G;  2OCE A;  2JA7 H;  2ZTC A;  4UP7 A;  1IBM Q;  4QQB X;  5FJ8 G;  3TRZ A;  4GOP C;  1GD7 A;  1XPO A;  4L5R C;  2EQS A;  1X6O A;  4YY3 L;  5LMN Q;  1XMO L;  4DR6 L;  1PYB A;  4QJF A;  3H3V H;  3PF5 A;  4IFD G;  3AYH B;  4Y7N H;  1ASY A;  4LF9 Q;  3M85 A;  4LF5 Q;  1QUQ A;  4UP8 A;  1YZ6 A;  4B3S L;  2I5M X;  2YU9 H;  2OTL A;  1PH7 A;  3UDI A;  1YVC A;  2LSS A;  2RHS B;  1Y1W G;  2PNH A;  1W3S A;  4BY1 G;  4GKK Q;  1SR3 A;  2GN5 A;  4Y52 H;  4L5T A;  1LYL A;  3ULJ A;  4GNX A;  4OWX B;  2UXB L;  1UE5 A;  4DV0 L;  4IOC A;  1G6P A;  3HOY G;  4BXX H;  1W2B A;  4A75 A;  3UDG A;  4A4I A;  4NXM L;  4OO1 I;  2YTX A;  1VQN A;  1VQA A;  4LWC A;  3LGJ A;  3PGZ A;  1CUK A;  3CF5 A;  4A3D H;  1KHI A;  1KAW A;  4GKJ L;  1JB7 A;  2R7Z H;  3F1Z A;  2N3S A;  3I4M H;  1KIX A;  1VQC A;  1CKM A;  1VQG A;  2UXD L;  1PVO A;  3JAM c;  4JI5 Q;  2K5V A;  3PIP A;  1WFQ A;  1B8A A;  5J3B A;  3CCQ A;  3WWV A;  5C4J H;  4A93 H;  5M3F G;  4LFB Q;  1N34 Q;  1MIU A;  2AWO A;  4A3E H;  4BY7 G;  1EWI A;  4DV1 Q;  4A3L G;  2VUM G;  4GNX C;  1KXL A;  3BJU A;  4A3I G;  4HIK A;  4A3C G;  2VUM H;  4DV6 Q;  2FXQ A;  2Y0S E;  4A3M H;  2PQA A;  3UDF A;  1VQ7 A;  4B3R L;  1PH2 A;  3GTO H;  4LFC L;  2QA4 A;  5JEA J;  4R4T A;  2Z0S A;  5IYD H;  1JMC A;  2I0Q A;  1WJJ A;  1YIJ A;  3VDY A;  3HKS A;  4A3D G;  5M5X H;  3RLN A;  4A3G G;  2C35 B;  4C2M H;  5JJI A;  3G4S A;  2K5H A;  2UUB L;  3H15 A;  5IYB H;  4B3R Q;  4C3I H;  3M4Q A;  2JEB I;  2YYZ A;  1OXU A;  1WI5 A;  4PZ7 A;  4JI0 L;  1HZ9 A;  3RN2 A;  1JJG A;  2CQO A;  3IRB A;  3KF6 A;  2AKW B;  1YJW A;  5HY6 A;  5IP7 G;  3HOX H;  4P72 A;  3HOZ G;  4JI2 Q;  1OXT A;  2JK8 A;  5JJL A;  4JI6 Q;  1S3O A;  3TQY A;  2A1A A;  1Y1W H;  1EYG A;  3GTM H;  2UXB Q;  4BY7 H;  1U0L A;  2E5L L;  4DV0 Q;  1L2F A;  4YHH L;  2Z6K A;  3CMA A;  1RL2 A;  3GDE A;  3A74 A;  3A0J A;  3E9H A;  3J81 j;  4PZ6 A;  4JYA L;  5JEA G;  3L0O A;  5C44 G;  3K80 C;  2NVY H;  2QEX A;  2BH8 A;  2JA6 H;  4DR4 L;  1H95 A;  1PV4 A;  4NXM Q;  4K0K L;  4DK6 C;  4DV2 L;  3A5U A;  2CCZ A;  1IZ6 A;  1NBW A;  3KYH C;  4GLV B;  3PUZ A;  4DR6 Q;  2JA8 H;  3AFP A;  3F8T A;  3KF8 B;  3GTP H;  2VQE Q;  1O7I A;  3HOY H;  4DR7 Q;  4DV4 Q;  2R7Z G;  1TWG H;  3NEM A;  1PH5 A;  3S16 H;  2NVX H;  4AQY Q;  1SE8 A;  2MO1 A;  1J6Q A;  4LFA Q;  4IOA A;  1CSQ A;  4JI8 L;  4B3T L;  1CKN B;  1IXR A;  3ULP A;  3U50 C;  1X3E A;  3CCE A;  3KJO A;  1X55 A;  5H1S E;  4YCU A;  4LF8 Q;  1LTL A;  5GAH C;  1UE6 A;  2UUC L;  2A8V A;  3CAM A;  3T1H Q;  3OYY A;  1SFO H;  1Q82 C;  4FDB A;  5IP9 G;  1M90 C;  4J15 A;  5DLQ E;  4HJ5 A;  1V1Q A;  5ELO A;  1JE5 A;  2VW9 A;  4DR3 Q;  2CWA A;  2I5H A;  2KBN A;  4BY1 H;  4A3L H;  4DV7 Q;  4AIM A;  4JBM A;  3K7U C;  1QUQ B;  1VQL A;  4A3K G;  3CC4 A;  1K9M C;  1YBY A;  4O0A A;  2NZO A;  4OO1 G;  1TWA H;  3BZK A;  5C3E H;  2R93 G;  4LUV A;  4NXN L;  3I4M G;  1HR0 L;  4QIW E;  4R4I A;  4DV3 Q;  3AEV A;  3HOW H;  4POF A;  3TEH B;  3NBH B;  4XTC S;  1I94 L;  1PH6 A;  4BBR G;  1IBK Q;  3GTK H;  1JJC B;  4X65 L;  1VQD A;  3I2Z A;  3H3V I;  1C0A A;  4DR5 L;  1IBL Q;  3F2B A;  3J81 c;  2Q2I A;  3JAM i;  1Y14 B;  1NJI C;  1HR0 Q;  2AWN A;  4JBW A;  4JG2 A;  4C3J H;  4DKA C;  3HKZ E;  5C3E G;  3F2D A;  1N32 Q;  4IJH A;  4X64 L;  1KQS A;  4X65 Q;  2Q2U A;  1CKO A;  2UXD Q;  2LXJ A;  1HZA A;  1TWC H;  2D0P A;  2ZTD A;  3AFQ A;  3CCM A;  1N34 L;  4BA2 I;  1N32 L;  2JA9 A;  1NMG A;  4UP9 A;  3CC7 A;  1JT8 A;  1K73 C;  5GAG C;  3H0G H;  2AMC B;  3I7F A;  4IPC A;  3HOV G;  2VS1 A;  3OW2 A;  4IO9 A;  2I5L X;  5HGQ A;  4DV4 L;  3M9B A;  4OWT B;  5IP7 H;  5C4X G;  1HZC A;  2E2H H;  4DUY Q;  2KCM A;  1V9P A;  4TQU S;  5E7N A;  3W1G A;  1X3G A;  3K0X A;  3OTO Q;  3T1Y L;  1GVP A;  4AYB G;  2WB1 G;  4JOI C;  3D0F A;  2PI2 E;  4LFB L;  3E9I A;  1U5K A;  3FKI G;  3FP9 A;  1VQH A;  3NEL A;  1EQR A;  5IT9 c;  4YCW A;  4WJ3 M;  3W5O A;  1Q81 C;  3TS2 A;  1BBW A;  1SRU A;  4A3G H;  4JV5 Q;  1YNX A;  1GO3 E;  1VQI A;  4GN4 B;  1GM5 A;  1PFS A;  4ALP A;  4DR3 L;  2WB1 E;  1WCM H;  4X62 Q;  4JI4 Q;  4EX5 A;  1PA6 A;  1YHA A;  3E0E A;  5FLM H;  1PH4 A;  4DV7 L;  1X65 A;  4BA1 I;  1B7Y B;  4A3M G;  2Q2T A;  3GTQ H;  1L1O A;  4YY3 Q;  3TS0 A;  1VCI A;  4IJL A;  1E7Z A;  5AJ3 Q;  1VQO A;  1XJV A;  3KDF A;  1IBK L;  4DPG A;  2R6G A;  3J80 c;  4A76 A;  4KHP L;  3EBE A;  4GKK L;  1X54 A;  1XPR A;  1ASZ A;  2UU9 L;  2K4K A;  3UE0 A;  2UUB Q;  2RHQ B;  3G48 A;  1QVF A;  4HJA A;  2B29 A;  2JA6 G;  2WFW A;  2HIX A;  5C0X J;  3PCO B;  4DR2 Q;  5BR8 L;  1VQ8 A;  2OQ0 A;  1K8A C;  4BBS H;  3M3Y H;  1IYJ B;  2GVA A;  2JA5 G;  1BBU A;  4JI6 L;  4JI7 L;  3K7A H;  4HIO A;  4R4O A;  2HHH L;  4HJ8 A;  2WP8 J;  2E2J H;  2MQH A;  4DR7 L;  1HNW L;  2H5X A;  5GQO A;  1N8R C;  3DLL A;  4YHH Q;  2EIF A;  2XGT A;  2ZTE A;  1YHQ A;  4LF4 Q;  4QL5 A;  2B63 H;  2E2I H;  2N49 A;  3G6E A;  4HJ7 A;  4B3M L;  3KF6 B;  2F4V Q;  2R7D A;  1HNZ L;  2R92 H;  3PUV A;  4LF8 L;  2B3G A;  1S72 A;  3RNU A;  4A3J G;  3J7Z C;  4GNX B;  1MJE A;  1DGS A;  1YEZ A;  2IHF A;  3RR5 A;  4RMF A;  4L5S A;  1KD1 C;  5C0X G;  2BA1 A;  3S1Q H;  2Z6K C;  3PUX A;  3PO3 G;  3KDF B;  4DUY L;  3JC6 6;  2OTJ A;  2R7F A;  2ID0 A;  2K75 A;  3RZO H;  1VQM A;  4JV5 L;  3CP0 A;  1EUJ A;  1K83 H;  1X9N A;  1YHB A;  3S1R H;  1J5E L;  4YCV A;  4DV3 L;  4AYB E;  4LFC Q;  3S1M H;  1X3F A;  2KCT A;  1SRO A;  1UE7 A;  2ALY B;  1XTD A;  1A63 A;  5FLM G;  5FLX c;  2N8N A;  1C7Y A;  3CQZ H;  2EXD A;  4POG A;  1K8G A;  2OQK A;  1J5E Q;  1CSP A;  4R1J A;  2ASB A;  1G51 A;  2GVB A;  2HIV A;  3I55 A;  1MKH A;  4HIM A;  1C9O A;  3SGI A;  4HID A;  3D31 A;  1B70 B;  1EQQ A;  4LF6 L;  1FJG L;  2NVT H;  1NY4 A;  2BH2 A;  4PZ8 A;  1PH3 A;  2DGY A;  3EIV A;  1PH9 A;  1QVC A;  2MFI A;  1L0W A;  4GOP A;  2HHH Q;  1I94 Q;  4JI3 Q;  1XPU A;  2RCN A;  1E1O A;  1V43 A;  1HNW Q;  4R4C A;  5M3M G;  2F3I A;  3A5Z B;  3J7A 5;  3EN2 A;  3BZC A;  4A3E G;  4JBK A;  2VL6 A;  1HNZ Q;  5C0X I;  1QVG A;  1FVI A;  1VQ9 A;  2N78 A;  1SLJ A;  4IFD J;  4DR4 Q;  2A19 A;  4KHZ A;  3K81 C;  4QY7 A;  2ES2 A;  1SMX A;  3CXC A;  2K50 A;  3F2C A;  4LFA L;  4P73 A;  1A62 A;  3GO5 A;  3T1Y Q;  1YJ9 A;  3U4Z A;  4DAM A;  3CPW A;  3RLO A;  1WOC A;  5FJ8 H;  2VQF Q;  2ZM6 L;  3J81 i;  2XTI A;  4JOI A;  1PH1 A;  3T1H L;  1Q7Y C;  4GLX A;  3RN5 A;  5M5Y H;  4MTN A;  5IYC H;  1OTC A;  1HNX L;  3S14 H;  3PIO A;  1K0R A;  4DK3 C;  1HJP A;  4QGU A;  1LM0 A;  4XIG S;  3KOJ A;  4DUZ Q;  1MJC A;  2L15 A; 
#chains in the Genus database with same CATH topology
 2PW7 A;  1XMQ L;  3KBX A;  2EY1 A;  1B3Q A;  3GTO B;  2LXK A;  5BR8 Q;  3S1M B;  1VS0 A;  1EFW A;  2WAQ E;  3PV0 A;  2IX1 A;  1KTK A;  4GOP B;  4GLA C;  4JC0 A;  3PSI A;  3CRL C;  4JI7 Q;  1RIP A;  3A55 A;  1EIY B;  1STN A;  1CTM A;  3PO2 H;  1GUN A;  2B39 A;  1FYC A;  4O42 A;  1DOM A;  2C5C A;  3Q8D A;  2RF4 A;  2M2L A;  1PZI D;  2O5J C;  1A15 A;  5IWA Q;  2UXC L;  3SVM A;  2BE5 D;  4O2D A;  4ZUJ A;  4HJ9 A;  1ENC A;  1TU2 B;  3MXP A;  1RTO A;  4C1N I;  3PO3 H;  4N9P A;  1CFM A;  3MAQ A;  2IT1 A;  3BU2 A;  4FF4 A;  3NPP A;  4X66 Q;  1Y8O B;  1I6H B;  1VMC A;  4LF9 L;  1YIT A;  4CDD C;  3HOX G;  4H7B A;  4EQP A;  1PZK D;  2RDG A;  4LNQ A;  2B63 G;  4NXN Q;  3STB D;  1XNR L;  1Q1B A;  2NZH A;  3D3R A;  2K14 A;  1K3B C;  5GRO A;  3S17 B;  5EKK A;  3PUY A;  3HOW G;  2OXP A;  3S1Q B;  1SYF A;  3JAM L;  1STB A;  4L5Q A;  2E5L Q;  1AE2 A;  1H9R A;  2E2D C;  3UDX A;  4BBS G;  2K5N A;  3W2D A;  4YWK A;  3KFU A;  2AQ1 B;  3CW2 C;  1WYD A;  2AUK A;  3CCU A;  2O4X A;  3VYR A;  4A3K B;  3DXJ C;  2Z6B A;  4A3B G;  2F4V L;  3J80 i;  1Q46 A;  5E1F A;  4HAE A;  1S5D D;  4KK7 A;  4OX9 Q;  1E1T A;  2Q2H A;  2F3V A;  4JI8 Q;  3D8G A;  5EBC A;  3L7Z C;  5JJK A;  1KRT A;  4XQQ A;  4LUZ A;  3T53 B;  4KLK A;  5IY0 A;  5ELC A;  1EYC A;  5A2Q L;  3K6O A;  4ABN A;  3V05 A;  3M4Y A;  2MUY A;  3IKJ A;  4HCS A;  5LMU Q;  1SSO A;  3KLR A;  4LF5 L;  1QZH A;  1XNR Q;  4IFD H;  2VZA A;  5LMN L;  2IPK D;  1VQB A;  4DXF A;  4X62 L;  2B2T C;  5ELB A;  5EAY A;  5D65 A;  1QZG A;  5M5W H;  5EPK A;  5FLX E;  2JA8 G;  3S24 A;  3I73 A;  1ILP A;  3H94 A;  2F0W A;  2HT1 A;  2MPM A;  3Q0A A;  4NPS A;  4UY8 C;  1VQE A;  1R9T H;  2HQL A;  2M00 A;  1ZXT A;  4TKO B;  4ME3 A;  2E8G A;  1JOR A;  4DR1 Q;  1HH2 P;  4JYA Q;  5IP9 H;  1JWU D;  1I6H H;  1EYA A;  1G29 1;  1ZYR D;  4A3J B;  3PO2 G;  5K36 G;  4IPG A;  3T13 A;  1GUS A;  3DM3 A;  1ET6 A;  1K3R A;  1KL9 A;  4LF7 Q;  3S2D B;  1SN8 A;  4C3I G;  2ZJQ A;  1JE4 A;  1KC8 C;  2BDN A;  4V0B A;  3KLS A;  2JA7 H;  2ZTC A;  2L12 A;  1F2M A;  4GOP C;  4FXD A;  1GD7 A;  1XPO A;  1SBB B;  1U4R A;  4L5R C;  1X6O A;  2IL8 A;  4IFD G;  4QJF A;  3H3V H;  3AYH B;  2Z4I A;  1NSN S;  2EXZ A;  3M85 A;  5T1I A;  4UP8 A;  4B3S L;  2OTL A;  4C2M B;  3UDI A;  1YVC A;  2H1E A;  2B2Y A;  3C1F A;  1VDZ A;  4FNF A;  4BY1 G;  1RJT A;  4Y52 H;  1U4P A;  1XTC D;  4GNX A;  1UE5 A;  2K32 A;  3HEJ A;  2K05 A;  4A4I A;  1SNP A;  2F0P A;  2J0T D;  1CUK A;  3FRP B;  5HUR A;  1KAW A;  4GKJ L;  1SNO A;  2R7Z H;  2L9H A;  3RZD B;  3MC0 B;  2WAQ B;  1VQC A;  1CKM A;  1SNC A;  2B2Y C;  1KIX A;  2UXD L;  1LTS D;  2K5V A;  1S5B D;  1RD9 D;  3WWV A;  3GV6 A;  1MIU A;  4DV1 Q;  3MXU A;  4A3L G;  1WTQ A;  1EY9 A;  4K2K A;  2NUC A;  4J1M A;  1ENF A;  4N9T A;  2F3W A;  1ZKO A;  2PQA A;  5JEA J;  4R4T A;  5IYD H;  4FF2 A;  1WJJ A;  1BOS A;  5M5X H;  1X3P A;  3M4O B;  3FPP A;  1HA5 A;  1SDF A;  4PZ7 A;  4NKL A;  1HZ9 A;  2WIN B;  3RN2 A;  3IRB A;  1YJW A;  5G3L F;  5HY6 A;  5FKA C;  5CGK A;  3HOZ G;  5JJL A;  2VB3 X;  1RKN A;  1V1P A;  1EYG A;  2E5L L;  1L2F A;  1LT5 D;  4G57 A;  1CHP D;  3PIO 3;  1BUV T;  3A0J A;  3J81 j;  4PZ6 A;  4DA2 A;  1ICW A;  4JYA L;  5JEA G;  2HCI A;  1EU4 A;  3SXH A;  3K80 C;  2NVY H;  2JA6 H;  4DR4 L;  2BCO A;  1MHW C;  2CCZ A;  4EGV A;  5C3X A;  3FPU B;  3AFP A;  2JA8 H;  3GTP H;  1JOQ A;  5E3F A;  1O7I A;  4NMZ A;  3HOY H;  1TWG H;  3NEM A;  1PH5 A;  5C4Z A;  2NVX H;  2F0I A;  4LFA Q;  3NTH A;  4OIJ A;  3MFY A;  4B3T L;  2SEB D;  5DAU A;  1WTX A;  3KJO A;  5H1S E;  2YU9 B;  1A6X A;  5CMD A;  5CBA E;  1UAP A;  5IP9 G;  4PNY A;  5DLQ E;  1AZQ A;  1PLF A;  4PMB A;  2I5H A;  1I4X A;  3OMG A;  4DV7 Q;  1MGS A;  3QJY A;  4AIM A;  4JBM A;  4XYQ A;  2Q8T A;  5EKL A;  2R93 G;  4PV1 C;  2KEC A;  4FXG C;  3AEV A;  2WKD A;  3TEH B;  3GTK H;  5HGT A;  1JJC B;  3I2Z A;  1F9P A;  3J81 c;  1HR0 Q;  1Y14 B;  1QWY A;  5C3E G;  4JG2 A;  4C3J H;  3HKZ E;  2CH4 W;  2Q2U A;  4X65 Q;  1CT1 D;  5M5W B;  5L37 A;  3T56 B;  1B9N A;  1CKO A;  1AP0 A;  3PO3 B;  2LXJ A;  1TWC H;  2PW5 A;  1SE4 A;  3PO2 B;  2PCF B;  1TS5 A;  2F1M A;  1N32 L;  2Z9H A;  3NWT A;  3CC7 A;  4HMJ A;  4IPC A;  3T16 A;  1BQQ T;  4DV4 L;  3C46 A;  4ZAI A;  3MEH A;  1L0Y B;  1ONL A;  4TQU S;  4K8J A;  1I50 B;  2LS0 1;  1SMY C;  1BF4 A;  1X3G A;  3KUP A;  3T1Y L;  1EQV A;  1V1P B;  3FKI G;  3FP9 A;  1VQH A;  2QDL A;  1I4R A;  4F8M A;  4A3G H;  1BBW A;  3I8Z A;  1GO3 E;  4GN4 B;  1CHQ D;  4X62 Q;  1PH4 A;  4BY1 B;  2CW0 D;  2EE1 A;  1L1O A;  1XJV A;  1VCI A;  1E7Z A;  3KDF A;  3CRK C;  4GKK L;  4HSP A;  2FHT A;  4CKC A;  1SYE A;  2RHQ B;  1MSG A;  3G48 A;  3SK4 A;  5JVH 3;  5DM7 3;  3HZX A;  1ENA A;  4ZK9 B;  1D1K A;  1FNU A;  1I3Q B;  4MTK A;  4JI6 L;  4JI7 L;  4HIO A;  1SXT A;  4R4O A;  2E2J H;  4DR7 L;  2MQH A;  3DEO A;  2LY7 A;  1HTP A;  2XGT A;  4LF4 Q;  1EU3 A;  4KY7 A;  2N49 A;  4IN3 A;  4B3M L;  2R92 H;  1O7Z A;  2F0J A;  4LF8 L;  2B3G A;  2XWB B;  3RNU A;  4GNX B;  4KTA A;  2IHF A;  1TKW B;  3NWS A;  4L5S A;  1KLG D;  1TWF B;  2PO4 A;  5E4X A;  3KDF B;  2HQE A;  3HS0 C;  4DUY L;  3JC6 6;  1JWS D;  1LTB D;  2ID0 A;  2K75 A;  1WTV A;  1EUJ A;  5D3D A;  1Y1V B;  3S1R H;  1IKL A;  3PQI A;  1J5E L;  4YCV A;  1V8Q A;  2OEO A;  3S1M H;  4I65 A;  1UE7 A;  1XTD A;  3A8J E;  5FLX c;  3DM1 A;  5FLX L;  1ICF B;  3K7A B;  4N8X 1;  2K01 A;  5K36 H;  1C9O A;  2JYO A;  1SAP A;  4RGN A;  1DXM A;  5IGC A;  2DGY A;  4FP5 D;  1PH9 A;  1QVC A;  2ZT9 C;  5M3M G;  4RH6 A;  3J7A 5;  3BVG A;  3BG3 A;  2L11 A;  1VQ9 A;  1SLJ A;  4QY7 A;  4LFA L;  4P73 A;  1A62 A;  3K57 A;  3T1Y Q;  1GHK A;  1SEB D;  4G7H C;  3J81 i;  1FD7 D;  3RN5 A;  3HOY B;  3OWE B;  4MTN A;  5IYC H;  4G7O C;  1HNX L;  1EWH A;  2FMC A;  2LMC B;  1DON A;  1HJP A;  4QGU A;  1RF2 D;  3M3Y B;  3M7G A;  2QKI C;  2RVL A;  2L15 A;  2BA0 A;  3H0G B;  1FGU A;  2QGQ A;  1UWV A;  4OEM B;  2Z4H A;  5FK9 C;  2A69 C;  5C4H A;  4A3K H;  1PTO H;  2A6E D;  3VR5 A;  1EQT A;  1U9R A;  3HOZ H;  4IUR A;  1BR9 A;  2JA7 G;  2AUJ D;  4B3S Q;  3H91 A;  4X6A H;  3SK6 A;  4JI3 L;  5JVG 3;  3LWE A;  1XNQ Q;  3HFZ B;  1CKN A;  4DV2 Q;  2AHO B;  3VYS A;  2FJ2 A;  3QR8 A;  4KY6 A;  1VQK A;  4Q0F A;  2NN6 I;  5ELE A;  1D7Q A;  4Y7N B;  3ZYY X;  3GTL H;  3M4P A;  1B3A A;  2EJF C;  4BBR B;  5M3M B;  1C48 A;  4C3J B;  1NCV A;  3BVZ A;  1GUO A;  4LF7 L;  3K5M A;  3CKI B;  3E5S A;  1N36 L;  2NVT B;  1WCM B;  4K0K Q;  1IL8 A;  1EIF A;  5C44 H;  1Y1V H;  3RZD H;  2R7Z B;  3I56 A;  1N33 Q;  3MZ5 A;  3CCS A;  3GP7 A;  5KYI A;  4B3M Q;  1F9R A;  2UUA Q;  1TQO A;  1N36 Q;  2JQO A;  4TVA B;  1EZ8 A;  3I4N H;  2IY5 B;  4AQY L;  5C44 B;  1TS4 A;  1N33 L;  4FF3 A;  4HTH A;  1X56 A;  3A56 A;  1KRS A;  2Z1C A;  2PMZ E;  2A6H C;  3MXN B;  4DAY B;  3OOC A;  3SHL A;  5M5X B;  3CME A;  3R8B A;  1IBM L;  3KLW A;  4WJ4 A;  2NN6 H;  1VQ6 A;  2QW7 A;  4CJ1 B;  2NVY B;  1A8V A;  3S17 H;  4LMQ D;  2IHE A;  3IFD A;  3CPF A;  2XRS D;  4P75 A;  3DWA A;  4ZRZ A;  1M1K C;  1D5M C;  3D4W A;  4A3I H;  1D5Z C;  4A3C H;  1CA6 A;  4IFD I;  1EFI D;  2H4O A;  1IL2 A;  1L1O B;  3SEB A;  4QB4 A;  5M9O A;  2K04 A;  3E0J A;  1TY0 A;  1HXY D;  1M4V A;  2VQE L;  3P75 A;  1GJX A;  1DOK A;  4A3J H;  3KK7 A;  2EOT A;  1B9M A;  4YWM A;  3MXN A;  1FR3 A;  2E76 C;  1TWG B;  5ISR A;  5A35 A;  2SOB A;  1IW7 C;  1Q1E A;  1STY A;  5CBE E;  1W6J A;  5BN4 A;  2UUC Q;  2F0K A;  2EVB A;  3HOV H;  1Q12 A;  5FO9 B;  3GTK B;  4JI0 Q;  4MZ9 A;  2MO0 A;  3R93 A;  3AB9 A;  3K8A A;  3Q22 A;  1BVS A;  5IGF A;  1NTG A;  2NN6 G;  5EJW A;  4CJ0 B;  1XMO Q;  2JJQ A;  1I4P A;  3M7N A;  5BN3 A;  5LMU L;  1C4Q A;  1HR0 W;  3A8I E;  4AH6 A;  1JOO A;  4DXG A;  2LKV A;  4BBR H;  4B08 A;  2PQA B;  4KD3 A;  4OWW B;  2F52 A;  4LF4 L;  3U4V A;  2F0O A;  1A3T A;  2XVS A;  2ICI A;  4DR1 L;  3I4N G;  4R8N A;  4CGY B;  2G9H D;  4DNI A;  5I6Y A;  1PHJ A;  1LO5 D;  4IUP A;  1YNJ D;  2WV6 D;  4C3J G;  5JJZ A;  1E24 A;  3TZU A;  4DV1 L;  1PH8 A;  4EQO A;  1PFB A;  1NUC A;  4P74 A;  4C3H H;  2NVQ H;  3I4M B;  1ET9 A;  2KED A;  4LW1 A;  1V1O A;  5C3E B;  4R9W A;  3HOU B;  1BKB A;  3S2D H;  5IGG A;  1I50 H;  4KI0 A;  3L2P A;  5IYD G;  4UP7 A;  1GUT A;  3TRZ A;  2JA7 B;  2QCP X;  2N55 A;  1EY4 A;  3BS1 A;  4OGQ C;  4CKE A;  1XMO L;  4DR6 L;  1BCP F;  1O80 A;  1B53 A;  1W6K A;  3E3X A;  2RHS B;  3DWQ A;  2IX3 A;  2PNH A;  4GKK Q;  1JQY D;  3VYU A;  4L5T A;  1AN8 A;  4H44 C;  3ULJ A;  2DNE A;  3HOZ B;  4IQZ A;  4IOC A;  1G6P A;  2E2H B;  1W2B A;  2B8F A;  2YTX A;  4LWC A;  3D4R A;  3NQI A;  4J8Q A;  1KHI A;  3J7A F;  4ZUI A;  3G7L A;  2B2W A;  1ZYR C;  4JI5 Q;  3S16 H;  3PIP A;  3CCQ A;  5C4J H;  4A93 H;  4DAP A;  1N34 Q;  1BNZ A;  1KAB A;  1KXL A;  2VUM H;  2F03 A;  2FXQ A;  4A3B B;  4A3M H;  3SK5 A;  1VQ7 A;  4B3R L;  4ZYS A;  3K5O A;  3GTO H;  4LFC L;  2QA4 A;  2Z0S A;  3VDY A;  4A3D G;  3VR6 A;  4X3K A;  1LTG D;  4C2M H;  1UNS A;  2UUB L;  3A8K E;  4K2L A;  2KHS A;  2KOL A;  2JN4 A;  1LTI D;  3C1E A;  4FO2 A;  2AKW B;  5IP7 G;  2R3Z A;  3HOX H;  4P72 A;  4JI2 Q;  4KV6 A;  1Y1W H;  2MGS A;  4BY7 H;  1K8M A;  3TP5 A;  3IFT A;  2KEE A;  1RL2 A;  4ID6 A;  3A74 A;  3NP8 A;  2A6H D;  3U9S A;  1BCP B;  4RGT A;  2QEX A;  5KNC A;  4K0K L;  3WOE A;  1LTT D;  1IZ6 A;  1WTW A;  3F8T A;  3KF8 B;  5CR3 A;  2VQE Q;  1KNE A;  4AQY Q;  3QO2 A;  3NE5 B;  2HUG A;  1WTP A;  1IXR A;  3ULP A;  3U50 C;  3CCE A;  1X55 A;  5GAH C;  1CQV A;  2UUC L;  2HDL A;  2K6A A;  3HGB A;  1Q82 C;  4FDB A;  4HJ5 A;  4DR3 Q;  2CWA A;  4BY1 H;  4A3L H;  3K7U C;  1UUP A;  1K9M C;  2E2J B;  2L4N A;  2N88 A;  3RZO B;  1WVL A;  4DV3 Q;  3GTL B;  1HTL D;  4RCO A;  1C0A A;  2DJG C;  4JBW A;  4DKA C;  1PTO D;  4NDX A;  3BDC A;  4XT1 B;  1QOH A;  4HED A;  1HPC A;  1HZA A;  1STA A;  2D0P A;  1DJR D;  2X6L A;  5KEE A;  1N34 L;  4BA2 I;  2TSS A;  3I4N B;  5GAG C;  2AMC B;  3I7F A;  3HOV G;  3QOJ A;  4IO9 A;  1TS3 A;  3M9B A;  5IP7 H;  2F0V A;  4RWS C;  2KCM A;  5E7N A;  1WD1 A;  3K0X A;  4AYB G;  2WB1 G;  3TZD A;  4JOI C;  5IGB A;  3NEL A;  4QF4 A;  2B2U C;  3W5O A;  3TS2 A;  1YNX A;  1VQI A;  1GM5 A;  1PFS A;  4JI4 Q;  1YHA A;  2NBF A;  2K33 A;  3GTQ H;  2F0M A;  4YY3 Q;  4OO1 H;  5CV7 A;  1JR0 D;  1IBK L;  1XPR A;  1ASZ A;  2SDF A;  2UUB Q;  2K4K A;  3UE0 A;  2ENB A;  3GTP B;  2EYO A;  4KKT A;  1TR5 A;  2WFW A;  1QNK A;  1E2V A;  2EY6 A;  4KKS A;  1NAP A;  4BBS H;  2ICE C;  2CVR A;  4DN4 M;  4DAY A;  5I9P A;  1XYI A;  2JA5 G;  5KRU A;  3TME A;  2RDH A;  2D9U A;  2LFN A;  2WP8 J;  1LV9 A;  3NUC A;  5GQO A;  4CJ2 C;  1AFP A;  1YHQ A;  1G6Z A;  2A6E C;  4QL5 A;  1QB5 D;  2B63 H;  2A69 D;  1STG A;  2F4V Q;  1HNZ L;  1F2Y A;  1E2Z A;  2K7V A;  1MD2 D;  4X3S A;  1S72 A;  3EVQ A;  5CV6 A;  1YEZ A;  1EY5 A;  1I4H A;  3HP3 A;  5C0X G;  2F0T A;  2BA1 A;  2Z6K C;  5EGT A;  4A3D B;  2X69 A;  2XWJ B;  4ZQ3 A;  2KCC A;  5KND A;  3RZO H;  1D2B A;  2JP1 A;  1VQM A;  4E6I A;  2AQ3 B;  4WOR A;  3CP0 A;  4RKL A;  3TSS A;  1YHB A;  3FEW X;  4L6T B;  4I7A A;  1DD2 A;  2F0H A;  2A68 D;  2BOS A;  2N8N A;  2EPB A;  3ITP A;  5C5L A;  4POG A;  1J5E Q;  4R1J A;  1QNU A;  1VF5 C;  4UAI A;  2ASB A;  2HIV A;  1GXD C;  2AQ2 B;  4HIM A;  4KY5 A;  3D31 A;  1B70 B;  1D1I A;  4LF6 L;  2NVT H;  1NY4 A;  2BH2 A;  2MFI A;  4GOP A;  3MA2 B;  4HR7 B;  4JI3 Q;  1XPU A;  1IYV A;  2RCN A;  1E1O A;  1V43 A;  3J7Y W;  2ZXR A;  5C0X I;  2NVQ B;  5JOB A;  5I9O A;  1ILQ A;  1WTO A;  1CK1 A;  2A19 A;  4KHZ A;  4A3G B;  2I07 B;  2ES2 A;  1EIH A;  3GO5 A;  4G4K A;  1B44 D;  3CPW A;  5FJ8 H;  2VQF Q;  2EDG A;  2NWG A;  2VUM B;  1I4G A;  4JOI A;  1PH1 A;  2SNS A;  3T1H L;  1EY8 A;  1X3Q A;  4ODG A;  3D4D A;  5M5Y H;  4QIW B;  1OTC A;  5I6W A;  4AYB B;  5A2Q E;  4RCN A;  3D6W A;  3K7A H;  1H95 A;  5JPN C;  2F0N A;  1T9H A;  4JI2 L;  2QDB A;  1Z47 A;  2KEN A;  1KDB A;  4K6D A;  3OIP A;  1Z7T A;  4OXP A;  2NZ1 D;  3TRE A;  3PIP 3;  4DR5 Q;  1FL0 A;  3FKI B;  2EJM A;  1UEB A;  5AJ3 L;  2F0L A;  3ERS X;  5ELF A;  2DJF C;  3NEN A;  2KUM A;  1TVX A;  2VY3 A;  3FKI H;  4DNR B;  3TDQ A;  4DR2 L;  4GKJ Q;  3CCR A;  2NVX B;  2EY2 A;  4K8I A;  1OXV A;  3QOL A;  3MEF A;  1BO0 A;  2CFM A;  4BWG B;  5GAE C;  3ERQ A;  5IOC A;  1HZB A;  2V1C C;  2PPB C;  4DAV A;  1D8L A;  2L5T A;  5NUC A;  1SJE D;  2XNA C;  2YTY A;  1I3Q H;  2UXC Q;  4MHE A;  3BDL A;  3HOV B;  3KJP A;  5GAD C;  1JWM D;  1P16 A;  5FOB B;  1YNN C;  1R4P B;  4DV5 L;  2PNR C;  4YIJ A;  2F4I A;  3BVM A;  5IGE A;  4P71 A;  4L8J A;  3OPO A;  1F9S A;  2EYL A;  1GKH A;  3T51 B;  5I2X A;  1HCZ A;  1PYS B;  4A3F H;  1AH9 A;  1CZG A;  1A0I A;  1TWF H;  3UE1 A;  4YWL A;  1CZW A;  4GN5 A;  3U58 A;  4IPD A;  5G3L D;  2K5Q A;  1E3P A;  2MNA A;  3OSO A;  4RKB A;  3Q24 A;  2PYK A;  5M3M H;  1K28 A;  1KDC A;  3SDZ A;  4N8F A;  1XNQ L;  1UE1 A;  3MXG A;  4WJW A;  5M3F H;  2IJ0 A;  1H9K A;  3EJI A;  1STH A;  3CCL A;  2F0Q A;  4HMI A;  5M3F B;  1YI2 A;  1J9O A;  2JA5 H;  4O1N A;  1EOV A;  1Y8P B;  2DUD A;  2JE6 I;  1L1O C;  1PTO B;  5KNB A;  5J1Z A;  4JI1 Q;  2UUA L;  1A3V A;  1B4O A;  2ZJR A;  1JC7 A;  1SE2 A;  3GTG H;  1LTA D;  1GUW A;  1LUZ A;  5COR A;  3PUW A;  1DOL A;  2Y0S G;  3ICE A;  1GOZ A;  1QE6 A;  3DMU A;  1T5E A;  4EQ5 A;  1VQJ A;  3AQQ A;  1O78 A;  2KHJ A;  1NMF A;  4BXX G;  4DUZ L;  1FJG Q;  2ZJP A;  3TP6 A;  3ZJY C;  3S1N H;  1A3U A;  1O7Y A;  4PMW A;  3I4O A;  3H0G G;  3I3C A;  1KNA A;  3VA7 A;  2VNU D;  4RAU C;  1Y1V G;  1NE3 A;  1XX8 A;  5IWA L;  4FVM A;  4FYD A;  1S5F D;  5C4X H;  5CC4 A;  1TII D;  4ZCK A;  2P5Z X;  1IHZ A;  3PF4 A;  2K03 A;  3ULL A;  1I4Q A;  5IYC G;  4OON A;  3I91 A;  1Q8K A;  2PI2 A;  3DHQ A;  2JEA I;  4H02 A;  2EYF A;  3N6R A;  4JI1 L;  3LNN A;  2VQF L;  5IYB G;  5ELN A;  5KYL A;  4DK0 A;  3TP7 A;  1P8L A;  1K0S A;  3GD7 A;  4LJZ C;  2OCE A;  5IT9 L;  2L55 A;  1AW7 A;  5LMN Q;  1PYB A;  1HQM C;  3PF5 A;  4LF9 Q;  4LF5 Q;  3AU7 A;  1QUQ A;  1YZ6 A;  1PH7 A;  1SND A;  3J80 L;  1Y1W G;  3MHB A;  1W3S A;  1SR3 A;  1SNM A;  2GN5 A;  2UXB L;  4KJO A;  1PTO C;  4OO1 I;  1NR2 A;  2A5H A;  1PDQ A;  1VQA A;  1VQN A;  3PGZ A;  2E75 C;  4XDX A;  2JXM B;  3CF5 A;  4A3D H;  1JB7 A;  1JIC A;  3QIA A;  5EPJ A;  3F1Z A;  2N3S A;  3I4M H;  1CM9 A;  4JVZ A;  1PVO A;  3JAM c;  5JPM C;  5T1G A;  1B8A A;  3GTG B;  5M3F G;  4A3I B;  4LFB Q;  2AWO A;  1SYD A;  4A3E H;  4C56 C;  4K5X A;  2RCF A;  2DY7 A;  3BJU A;  3OIQ A;  4DV6 Q;  2Y0S E;  4JK1 C;  3OW7 A;  2KCN A;  5EPL A;  1PH2 A;  3FDT A;  4RA8 A;  3CHB D;  1JMC A;  3HKS A;  2C35 B;  3S1N B;  2XRQ D;  1SYC A;  3H15 A;  3TN2 A;  4B3R Q;  3ONA B;  1TT2 A;  3M4Q A;  1JCK B;  2DY8 A;  2YYZ A;  1OXU A;  3U9O A;  1E2W A;  1OXT A;  1QJO A;  3A54 A;  4JI6 Q;  1S3O A;  2I46 A;  1PRT F;  3MFG A;  3GTM H;  2UXB Q;  4GZY C;  3GDE A;  1UEA B;  2F0F A;  1IKM A;  2E74 C;  3TP8 A;  5JAV A;  3URY A;  1HA6 A;  4NXM Q;  4DV2 L;  2O2L D;  4GLV B;  1NBW A;  3KYH C;  5DM6 3;  1TWH B;  2V4D A;  1FNV A;  2EYM A;  3NHH A;  4KJN A;  1J6Q A;  3GTQ B;  1R9T B;  1CSQ A;  1CKN B;  1NNX A;  1X3E A;  4LF8 Q;  2JA5 B;  1PMR A;  1ML0 D;  2NB0 A;  1QIL A;  3K5L A;  3T1H Q;  5K5P A;  4RHR A;  4J15 A;  4XXE A;  1DCZ A;  3D6C A;  1JE5 A;  4K6L A;  1QCB D;  2CHB D;  4XYO A;  1S5E D;  3ND9 A;  3S15 B;  4A3K G;  1SNQ A;  4O0A A;  2CW0 C;  1IYU A;  4OO1 G;  3BZK A;  4NXN L;  4C3H B;  3I4M G;  4R4I A;  2B8G A;  5D14 A;  3VR2 A;  4KD4 A;  1CQF A;  4POF A;  1I94 L;  3NBI A;  1PH6 A;  2EZV A;  1H9J A;  4BBS B;  4X65 L;  1LTR D;  1VQD A;  3VR4 A;  3H3V I;  4HN7 A;  4ILW A;  4OEL B;  4DR5 L;  1IBL Q;  1OO9 B;  5FO7 B;  2F0E A;  3RMH A;  2AWN A;  4IJH A;  4X64 L;  1L0X B;  1PTO F;  3RD4 A;  2UXD Q;  2HCC A;  4L63 B;  5F2D A;  3AFQ A;  4OIK A;  3CCM A;  1HUM A;  5BN5 A;  1JT8 A;  1MI2 A;  1K73 C;  2IW3 A;  3JAM E;  1WTR A;  2VS1 A;  3OW2 A;  5HGQ A;  2BDO A;  4JPB W;  1HZC A;  2E2H H;  1B1Z A;  1V9P A;  1LAC A;  3OTO Q;  1GVP A;  2MHV A;  3D0F A;  2PI2 E;  4CDE C;  3E9I A;  5IT9 c;  4DGZ A;  2QEJ C;  1Q81 C;  4F87 A;  4DR3 L;  1WCM H;  1EL0 A;  4EX5 A;  1PA6 A;  3E0E A;  3I72 A;  1DYQ A;  1K83 B;  3TS0 A;  1C8C A;  5IIF A;  1VQO A;  4FXK C;  4A76 A;  2R6G A;  3J80 c;  4KHP L;  3EBE A;  2UU9 L;  4UHV A;  1QVF A;  4HJA A;  4WFN 3;  2HIX A;  3OMC A;  3L3O C;  2O5I C;  1FNW A;  1PZJ D;  2GVA A;  3N52 A;  4X3T A;  2K28 A;  4U68 A;  2R93 B;  2XN9 C;  5M5Y B;  3DLL A;  2EIF A;  3A7L A;  1LLR D;  4HJ7 A;  1JOK A;  3KF6 B;  3E6Z X;  4ULL A;  3HOX B;  3PUV A;  1JB3 A;  2K5D A;  4CKB A;  1VF7 A;  4A3J G;  5JEA H;  1DGS A;  1D6E C;  1U4M A;  3RR5 A;  4RMF A;  1ROD A;  1BCP C;  2K1B A;  2WAC A;  3S1Q H;  1PRT B;  2X6G A;  4RFB A;  3PO3 G;  1TY2 A;  3GQB A;  4ZKC B;  1MBY A;  4AYB E;  4LFC Q;  3I70 A;  1X3F A;  3EFX D;  2KCT A;  2NYZ D;  4MN3 A;  1A2U A;  1LT4 D;  2A74 C;  1SRO A;  5CYU A;  1A63 A;  5FLM G;  2JA6 B;  4CHT B;  2IWH A;  2OQK A;  1CSP A;  4FF1 A;  1G51 A;  2GVB A;  5TSS A;  1MKH A;  4HID A;  1EQQ A;  5J22 A;  3WOF A;  5I2Y A;  2Z8L A;  3CU7 A;  1H9M A;  3R3O A;  4R4C A;  3FVQ A;  1Q90 A;  1EYD A;  5C3W A;  3BYY B;  4A3E G;  2VL6 A;  1HNZ Q;  1QVG A;  1FVI A;  3DUZ A;  2N78 A;  1XXG A;  3K81 C;  1DZ1 A;  1SMX A;  3F2C A;  3LX0 A;  1YJ9 A;  3U4Z A;  4TRD A;  4A3M B;  3RLO A;  1WOC A;  3G6J B;  2QIL A;  1PFM A;  1RHP A;  3KF8 A;  4GLX A;  4RGO S;  3V96 A;  3S14 H;  1K0R A;  4KHV A;  3T4A C;  4DK3 C;  1O7L A;  3R2I A;  2TMP A;  1ZEQ X;  1G91 A;  3MWY W;  1I6V C;  2D5D A;  1PRT D;  1AZP A;  1LAB A;  4XIG S;  3BYT B;  3KOJ A;  1MJC A;  2CWP A;  1GHJ A;  1VQ5 A;  2RKS A;  4DK1 A;  2Q8R E;  3GTJ B;  5KIX A;  1TWC B;  3B6Y A;  4A93 G;  3IL8 A;  3Q6S A;  2YTV A;  1PYW D;  3HOU H;  4OHJ A;  4G7Z C;  1OXS C;  4RHS A;  1WCM G;  3HKZ B;  2WAQ G;  3G71 A;  4LF6 Q;  4IZ8 A;  5C5M A;  3RLF A;  1II3 A;  2K52 A;  4LK1 C;  4LUO A;  5IE8 A;  4C1N K;  1LT6 D;  4KKU A;  5KGU A;  1TWH H;  3V2T A;  4NW2 A;  3EQL C;  5AFW A;  3DEP A;  3BDO A;  4APV A;  2RSN A;  3X3M A;  4V19 0;  3CD6 A;  2RSO A;  1N9W A;  1ESR A;  2D0O A;  1B2T A;  2ZM6 Q;  1PFN A;  1IW7 D;  2G5D A;  4PG3 A;  4ZLT F;  3C2P A;  1HUN A;  1Q8I A;  5CV8 A;  3BZD B;  3LWU A;  3OTO L;  5LHY 1;  1QG7 A;  2KVM A;  2IX0 A;  3W1B A;  4U67 3;  4IUU A;  2B2V A;  1LT3 D;  1YJN A;  2R92 G;  2E2I B;  1FGB D;  1VQP A;  1H9S A;  2RDF A;  3C3L A;  4R4Q A;  2OWO A;  2UU9 Q;  1IBL L;  2Y0S B;  2OT2 A;  3ER0 A;  1TWA B;  1Z9F A;  4A3B H;  2F0G A;  1CA5 A;  4NB3 A;  4GS3 A;  3PMF A;  4BS9 A;  3P1H A;  4PMC A;  4KN7 C;  1Q86 C;  1SMY D;  4A3F G;  4QUF A;  3GV3 A;  1I5F A;  3S16 B;  1F77 A;  5LMN W;  4UPA A;  3CC2 A;  1Y69 U;  3HKZ G;  3CCJ A;  4M8A A;  1S4Z A;  1EZ6 A;  4MIU A;  2G9D A;  2L0C A;  2C9O A;  1JJ2 A;  3L9A X;  5C6A A;  2PQE A;  4K5W A;  1BBX C;  4BY7 B;  2PZU A;  4GN3 B;  4DV6 L;  4B3T Q;  4K14 A;  1HNX Q;  2ZXP A;  4IUT A;  2KHI A;  3J81 E;  1EEF D;  2D2C C;  4IPH A;  3GTJ H;  4JI5 L;  1EY7 A;  1TXY A;  1VQF A;  4X66 L;  1EOT A;  1VQ4 A;  3HOW B;  2VB2 X;  4IUN A;  4K5V A;  4H13 C;  5CV9 A;  1X32 A;  3I4L A;  2F0U A;  4OL7 A;  1NR4 A;  1E22 A;  3S15 H;  4EQN A;  3FHW A;  2EJG C;  4JI4 L;  1XWE A;  1XMQ Q;  1PXU A;  4XQJ A;  1ESF A;  2OF1 A;  2CKZ B;  3P7J A;  4KHP Q;  1AEX A;  1S5C D;  2F0D A;  1HFG A;  1OXX K;  2R93 H;  3CCV A;  3M4O H;  4QCL A;  2HD3 A;  2YV5 A;  3HOU G;  4X64 Q;  5FO8 B;  2KA7 A;  3STB C;  5C4X B;  2A73 B;  4JBJ A;  1S40 A;  2D62 A;  1F2L A;  4A3E B;  3X3N A;  1HHV A;  4OX9 L;  4RG1 A;  4X3U A;  4JCV E;  4MNO A;  2MJ8 A;  4XT3 B;  5ELD A;  1EWC A;  2PMZ B;  3NSW A;  3A7A B;  3VYT A;  4DV5 Q;  2Q8I B;  2EYJ A;  1AE3 A;  3NTI A;  2B2V C;  4UDU C;  3GTM B;  5I4D A;  1IBM Q;  4QQB X;  5D3I B;  4A93 B;  5FJ8 G;  4KN4 C;  1Z6H A;  2EQS A;  4YY3 L;  4Y7N H;  1ASY A;  2I5M X;  2YU9 H;  5EQ0 A;  2LSS A;  3K0Y A;  1RDP D;  1LYL A;  2SNM A;  3QG1 A;  4OWX B;  4DV0 L;  2EY5 A;  3HOY G;  4BXX H;  1STE A;  4A75 A;  3UDG A;  4NXM L;  4J6H A;  3SR1 A;  3K5N A;  4M1U B;  5LL6 S;  3S2H B;  3LGJ A;  1HQR D;  1VMP A;  4XQN A;  2FIN B;  2RA4 A;  5DEH A;  3F2U A;  2GA4 B;  1KLU D;  1VQG A;  1D5X C;  1WFQ A;  2J7Z A;  5J3B A;  2NTS A;  4DFA A;  5C0X H;  4R8I A;  2L1B A;  4BY7 G;  3SE0 A;  1EWI A;  2WII B;  2VUM G;  4GNX C;  2WKC A;  4HIK A;  4A3I G;  4A3C G;  5EBD A;  4HCE A;  3UDF A;  2PZT A;  5IT9 E;  3R2T A;  1SJH D;  3CQZ B;  3KBG A;  3MTS A;  4CBV A;  2ZXO A;  2I0Q A;  1YIJ A;  3RLN A;  4A3G G;  5JJI A;  5E4W C;  3G4S A;  2K5H A;  3NTK A;  5IYB H;  4C3I H;  2JEB I;  1RCV D;  1WI5 A;  1G2S A;  5IGD A;  3NQT A;  4JI0 L;  1JJG A;  2CQO A;  3KF6 A;  4B9W A;  2JK8 A;  4CDC C;  3TQY A;  2A1A A;  3H09 A;  1U0L A;  5CV5 A;  4CDF C;  4DV0 Q;  3J7A V;  3KLS X;  4YHH L;  2Z6K A;  3CMA A;  3E9H A;  4F7X A;  3L0O A;  2PZW A;  5C44 G;  2BH8 A;  1PV4 A;  4DK6 C;  1Q3L A;  4IUV A;  3IAY A;  3A5U A;  2WB1 B;  3PUZ A;  4DU9 A;  3S14 B;  2RQX A;  3S1R B;  1EY6 A;  4H0L C;  4DR7 Q;  4DV4 Q;  2CH4 A;  2R7Z G;  1SE8 A;  2M9V A;  2MO1 A;  1SFO B;  2J4X A;  2KJX A;  4IOA A;  5DNF A;  4JI8 L;  1WD0 A;  1EEI D;  1BCP D;  4YCU A;  1LTL A;  1UE6 A;  3H6M A;  2A8V A;  3CAM A;  4DF7 A;  3OYY A;  1SFO H;  1M90 C;  1HRJ A;  1V1Q A;  5ELO A;  2VW9 A;  3S9W A;  3OHX C;  2KBN A;  3I90 A;  1QUQ B;  3O13 A;  4P2C B;  1VQL A;  3CC4 A;  1YBY A;  3WDN A;  2NZO A;  1TWA H;  5C3E H;  2HDM A;  1EIG A;  4LUV A;  1TS2 A;  4IUQ A;  1HR0 L;  4QIW E;  3HOW H;  2DN8 A;  3NBH B;  4XTC S;  1IBK Q;  2BE5 C;  4RGM A;  4BBR G;  2VXW A;  4C3H G;  4ME5 A;  1CI3 M;  3F2B A;  1KDA A;  2Q2I A;  3QWN A;  1EY0 A;  3JAM i;  4JW0 A;  1NJI C;  1YNN D;  2B2T A;  3F2D A;  1N32 Q;  3NXW A;  1KQS A;  1YNJ C;  5IOD A;  1K8O A;  3EA6 A;  1DM0 B;  1B50 A;  3VR3 A;  3OWF A;  2ZTD A;  5J39 A;  2JA9 A;  1NMG A;  4UP9 A;  2XSC A;  1U4L A;  4HSV A;  3HG9 A;  3Q23 A;  3H0G H;  2FFK B;  5LL6 X;  1WTH A;  2I5L X;  4I7Z C;  1R4Q B;  4OWT B;  3SK8 A;  4DNT B;  3QB3 A;  5C4X G;  4DUY Q;  2B63 B;  3W1G A;  2NTT A;  4LFB L;  1U5K A;  3AMU A;  1EQR A;  4YCW A;  4WJ3 M;  1M8A A;  1SRU A;  3K58 A;  4JV5 Q;  5CV4 A;  3FMC A;  2B2W C;  2MP1 A;  4ALP A;  2WB1 E;  3J81 L;  5FLM H;  4NP5 A;  2A68 C;  4LAA A;  4DV7 L;  1X65 A;  4BA1 I;  1B7Y B;  4A3M G;  2Q2T A;  2ATW A;  1Y8N B;  2E2I H;  4IJL A;  5AJ3 Q;  4DR6 Q;  4DPG A;  4QMG A;  4TSS A;  1X54 A;  2JA6 G;  2B29 A;  3RUZ A;  3P20 A;  5C0X J;  3PCO B;  4KMU C;  5BR8 L;  4DR2 Q;  1VQ8 A;  3ERO A;  2OQ0 A;  1K8A C;  3M3Y H;  1IYJ B;  5C4J B;  1SE3 A;  4QUC A;  1A2T A;  1H9S B;  1PRT C;  3UI2 A;  1BBU A;  2HHH L;  4WRD A;  2JSO A;  4HJ8 A;  1HNW L;  2H5X A;  1N8R C;  2R92 B;  4YHH Q;  2ZTE A;  1BDO A;  1Y1W B;  2EYP A;  3G6E A;  2R7D A;  3J7Z C;  1MJE A;  3J80 E;  2FMM A;  1F2Z A;  1KD1 C;  3PUX A;  4A3F B;  4EVO A;  3HRZ C;  1J8I A;  2R7F A;  3W3A A;  4JV5 L;  4PQX A;  2F0S A;  1GUG A;  1K83 H;  1HFN A;  1X9N A;  1E0B A;  1BXT A;  4DV3 L;  2ALY B;  1C7Y A;  3CQZ H;  2K5W A;  2EXD A;  2DNC A;  1K8G A;  1KAA A;  3I55 A;  4IAL A;  3SGI A;  4B9X A;  1FJG L;  3NK9 A;  2EYH A;  4PZ8 A;  1PH3 A;  2QF7 A;  3EIV A;  5EKI A;  3S2H H;  1L0W A;  2HHH Q;  4ZKB B;  1HNW Q;  1I94 Q;  2OTJ A;  1SYB A;  2F3I A;  3A5Z B;  1F9Q A;  3EN2 A;  1SYG A;  2XIW A;  3BZC A;  4JBK A;  2JA8 B;  5COY A;  4S3S A;  4IFD J;  1RTN A;  4DR4 Q;  4Z9C B;  3CXC A;  2K50 A;  1G8Z D;  2R61 A;  2B2U A;  4DAM A;  3ND8 A;  3VA5 A;  4F88 A;  2ZM6 L;  4Q5V A;  1G2T A;  1T5X D;  2XTI A;  1Q7Y C;  3MVV A;  3H3V C;  3PIO A;  3NBH A;  1MSH A;  3K59 A;  2KQ3 A;  1LM0 A;  2CQA A;  2RBM A;  4C3I B;  4DUZ Q;  3DWP A;  3TBI B; 
#chains in the Genus database with same CATH homology
 2BA0 A;  1FGU A;  2CWP A;  2QGQ A;  1XMQ L;  1UWV A;  1VQ5 A;  1T9H A;  4JI2 L;  1Z47 A;  2KEN A;  4A3K H;  2LXK A;  5BR8 Q;  1VS0 A;  1EFW A;  2WAQ E;  3B6Y A;  4A93 G;  3PV0 A;  2IX1 A;  3HOZ H;  4GOP B;  4GLA C;  2JA7 G;  4JC0 A;  2YTV A;  4OXP A;  3TRE A;  4DR5 Q;  4B3S Q;  3HOU H;  1FL0 A;  3PSI A;  4JI7 Q;  1RIP A;  1OXS C;  4X6A H;  1UEB A;  1WCM G;  4JI3 L;  5AJ3 L;  1EIY B;  2WAQ G;  3ERS X;  1XNQ Q;  3HFZ B;  3G71 A;  1CKN A;  4DV2 Q;  4LF6 Q;  3NEN A;  2AHO B;  3RLF A;  1VQK A;  3PO2 H;  2K52 A;  2NN6 I;  2VY3 A;  3FKI H;  1D7Q A;  4LUO A;  4DR2 L;  5IE8 A;  3CCR A;  3GTL H;  4GKJ Q;  1TWH H;  3M4P A;  3Q8D A;  2RF4 A;  1OXV A;  3MEF A;  2CFM A;  5GAE C;  4LF7 L;  5IWA Q;  1N36 L;  2UXC L;  1HZB A;  2V1C C;  4O2D A;  1D8L A;  4K0K Q;  1EIF A;  5C44 H;  1Y1V H;  3RZD H;  4APV A;  3I56 A;  1N33 Q;  3CCS A;  4HJ9 A;  3CD6 A;  1N9W A;  4B3M Q;  3S2H H;  2YTY A;  1I3Q H;  3PO3 H;  2D0O A;  2UUA Q;  1N36 Q;  2ZM6 Q;  2JQO A;  2UXC Q;  4TVA B;  3I4N H;  2IY5 B;  2IT1 A;  3BU2 A;  3KJP A;  4PG3 A;  4X66 Q;  5GAD C;  4AQY L;  1N33 L;  3OTO L;  1P16 A;  4LF9 L;  1YIT A;  2IX0 A;  1X56 A;  3W1B A;  3HOX G;  4DV5 L;  4LNQ A;  1KRS A;  2B63 G;  4NXN Q;  3STB D;  1YJN A;  2PMZ E;  1XNR L;  4P71 A;  1Q1B A;  3MXN B;  2R92 G;  1VQP A;  1AH9 A;  2NZH A;  4DAY B;  4R4Q A;  3CME A;  1GKH A;  2K14 A;  5GRO A;  1PYS B;  4A3F H;  1IBM L;  3KLW A;  2UU9 Q;  3PUY A;  1IBL L;  2OWO A;  3HOW G;  4WJ4 A;  1A0I A;  1TWF H;  3UE1 A;  1VQ6 A;  4YWL A;  3ER0 A;  4L5Q A;  1A8V A;  4GN5 A;  3U58 A;  1Z9F A;  2E5L Q;  3S17 H;  4A3B H;  4IPD A;  1AE2 A;  2IHE A;  3UDX A;  3CPF A;  4BBS G;  2K5N A;  4NB3 A;  4GS3 A;  4P75 A;  1E3P A;  4YWK A;  2MNA A;  1M1K C;  3KFU A;  4A3I H;  4A3C H;  1Q86 C;  5M3M H;  4A3F G;  3CW2 C;  1WYD A;  1I5F A;  3CCU A;  1XNQ L;  4IFD I;  1UE1 A;  5LMN W;  1IL2 A;  4UPA A;  3CC2 A;  1L1O B;  5M3F H;  3HKZ G;  3CCJ A;  4A3B G;  2F4V L;  3J80 i;  1Q46 A;  2VQE L;  1JJ2 A;  4A3J H;  3CCL A;  4OX9 Q;  1YI2 A;  1E1T A;  2Q2H A;  2JA5 H;  4GN3 B;  1EOV A;  4JI8 Q;  4DV6 L;  4B3T Q;  2DUD A;  1HNX Q;  4YWM A;  2JE6 I;  3L7Z C;  1L1O C;  2KHI A;  5JJK A;  1KRT A;  4IPH A;  4LUZ A;  3GTJ H;  1Q1E A;  4JI5 L;  4KLK A;  5IY0 A;  4JI1 Q;  2UUA L;  2UUC Q;  1TXY A;  2ZJR A;  3HOV H;  1Q12 A;  1VQF A;  4X66 L;  4JI0 Q;  3GTG H;  1VQ4 A;  4MZ9 A;  2MO0 A;  5LMU Q;  1LUZ A;  3PUW A;  2Y0S G;  3ICE A;  3K8A A;  4LF5 L;  1QZH A;  4EQ5 A;  1BVS A;  1XNR Q;  1NTG A;  1VQJ A;  2NN6 G;  2VZA A;  3AQQ A;  5LMN L;  2JJQ A;  1XMO Q;  1E22 A;  1VQB A;  2KHJ A;  1NMF A;  3M7N A;  3S15 H;  3FHW A;  5LMU L;  4DUZ L;  1FJG Q;  4BXX G;  4X62 L;  2ZJP A;  1XMQ Q;  1HR0 W;  4AH6 A;  4JI4 L;  5EAY A;  1QZG A;  3ZJY C;  5M5W H;  4BBR H;  3S1N H;  2PQA B;  2JA8 G;  2CKZ B;  3S24 A;  4PMW A;  4OWW B;  2F52 A;  4KHP Q;  4LF4 L;  3I4O A;  3U4V A;  1OXX K;  2R93 H;  4DR1 L;  3H0G G;  3I4N G;  3CCV A;  3M4O H;  2HT1 A;  2VNU D;  1Y1V G;  4NPS A;  1NE3 A;  5IWA L;  4UY8 C;  1VQE A;  1R9T H;  2HQL A;  2YV5 A;  4DNI A;  3HOU G;  5C4X H;  4X64 Q;  4ME3 A;  2ATW A;  2E8G A;  1PHJ A;  4DR1 Q;  3STB C;  1HH2 P;  3PF4 A;  4JBJ A;  3ULL A;  4JYA Q;  5IP9 H;  1S40 A;  5IYC G;  2D62 A;  1I6H H;  1G29 1;  1E24 A;  4OON A;  4RG1 A;  4DV1 L;  1PH8 A;  4OX9 L;  1Q8K A;  2PI2 A;  3PO2 G;  4IPG A;  4JCV E;  2JEA I;  4H02 A;  5K36 G;  4MNO A;  3DM3 A;  1K3R A;  4P74 A;  1KL9 A;  4JI1 L;  4C3H H;  1SN8 A;  2VQF L;  4DV5 Q;  4LF7 Q;  2NVQ H;  5IYB G;  4LW1 A;  5ELN A;  2ZJQ A;  1BKB A;  1AE3 A;  3S2D H;  1P8L A;  1I50 H;  1KC8 C;  4KI0 A;  3L2P A;  3GD7 A;  5IYD G;  2OCE A;  2JA7 H;  2ZTC A;  4UP7 A;  1IBM Q;  4QQB X;  5FJ8 G;  3TRZ A;  4GOP C;  1GD7 A;  1XPO A;  4L5R C;  2EQS A;  1X6O A;  4YY3 L;  5LMN Q;  1XMO L;  4DR6 L;  1PYB A;  4QJF A;  3H3V H;  3PF5 A;  4IFD G;  3AYH B;  4Y7N H;  1ASY A;  4LF9 Q;  3M85 A;  4LF5 Q;  1QUQ A;  4UP8 A;  1YZ6 A;  4B3S L;  2I5M X;  2YU9 H;  2OTL A;  1PH7 A;  3UDI A;  1YVC A;  2LSS A;  2RHS B;  1Y1W G;  2PNH A;  1W3S A;  4BY1 G;  4GKK Q;  1SR3 A;  2GN5 A;  4Y52 H;  4L5T A;  1LYL A;  3ULJ A;  4GNX A;  4OWX B;  2UXB L;  1UE5 A;  4DV0 L;  4IOC A;  1G6P A;  3HOY G;  4BXX H;  1W2B A;  4A75 A;  3UDG A;  4A4I A;  4NXM L;  4OO1 I;  2YTX A;  1VQN A;  1VQA A;  4LWC A;  3LGJ A;  3PGZ A;  1CUK A;  3CF5 A;  4A3D H;  1KHI A;  1KAW A;  4GKJ L;  1JB7 A;  2R7Z H;  3F1Z A;  2N3S A;  3I4M H;  1KIX A;  1VQC A;  1CKM A;  1VQG A;  2UXD L;  1PVO A;  3JAM c;  4JI5 Q;  2K5V A;  3PIP A;  1WFQ A;  1B8A A;  5J3B A;  3CCQ A;  3WWV A;  5C4J H;  4A93 H;  5M3F G;  4LFB Q;  1N34 Q;  1MIU A;  2AWO A;  4A3E H;  4BY7 G;  1EWI A;  4DV1 Q;  4A3L G;  2VUM G;  4GNX C;  1KXL A;  3BJU A;  4A3I G;  4HIK A;  4A3C G;  2VUM H;  4DV6 Q;  2FXQ A;  2Y0S E;  4A3M H;  2PQA A;  3UDF A;  1VQ7 A;  4B3R L;  1PH2 A;  3GTO H;  4LFC L;  2QA4 A;  5JEA J;  4R4T A;  2Z0S A;  5IYD H;  1JMC A;  2I0Q A;  1WJJ A;  1YIJ A;  3VDY A;  3HKS A;  4A3D G;  5M5X H;  3RLN A;  4A3G G;  2C35 B;  4C2M H;  5JJI A;  3G4S A;  2K5H A;  2UUB L;  3H15 A;  5IYB H;  4B3R Q;  4C3I H;  3M4Q A;  2JEB I;  2YYZ A;  1OXU A;  1WI5 A;  4PZ7 A;  4JI0 L;  1HZ9 A;  3RN2 A;  1JJG A;  2CQO A;  3IRB A;  3KF6 A;  2AKW B;  1YJW A;  5HY6 A;  5IP7 G;  3HOX H;  4P72 A;  3HOZ G;  4JI2 Q;  1OXT A;  2JK8 A;  5JJL A;  4JI6 Q;  1S3O A;  3TQY A;  2A1A A;  1Y1W H;  1EYG A;  3GTM H;  2UXB Q;  4BY7 H;  1U0L A;  2E5L L;  4DV0 Q;  1L2F A;  4YHH L;  2Z6K A;  3CMA A;  1RL2 A;  3GDE A;  3A74 A;  3A0J A;  3E9H A;  3J81 j;  4PZ6 A;  4JYA L;  5JEA G;  3L0O A;  5C44 G;  3K80 C;  2NVY H;  2QEX A;  2BH8 A;  2JA6 H;  4DR4 L;  1H95 A;  1PV4 A;  4NXM Q;  4K0K L;  4DK6 C;  4DV2 L;  3A5U A;  2CCZ A;  1IZ6 A;  1NBW A;  3KYH C;  4GLV B;  3PUZ A;  4DR6 Q;  2JA8 H;  3AFP A;  3F8T A;  3KF8 B;  3GTP H;  2VQE Q;  1O7I A;  3HOY H;  4DR7 Q;  4DV4 Q;  2R7Z G;  1TWG H;  3NEM A;  1PH5 A;  3S16 H;  2NVX H;  4AQY Q;  1SE8 A;  2MO1 A;  1J6Q A;  4LFA Q;  4IOA A;  1CSQ A;  4JI8 L;  4B3T L;  1CKN B;  1IXR A;  3ULP A;  3U50 C;  1X3E A;  3CCE A;  3KJO A;  1X55 A;  5H1S E;  4YCU A;  4LF8 Q;  1LTL A;  5GAH C;  1UE6 A;  2UUC L;  2A8V A;  3CAM A;  3T1H Q;  3OYY A;  1SFO H;  1Q82 C;  4FDB A;  5IP9 G;  1M90 C;  4J15 A;  5DLQ E;  4HJ5 A;  1V1Q A;  5ELO A;  1JE5 A;  2VW9 A;  4DR3 Q;  2CWA A;  2I5H A;  2KBN A;  4BY1 H;  4A3L H;  4DV7 Q;  4AIM A;  4JBM A;  3K7U C;  1QUQ B;  1VQL A;  4A3K G;  3CC4 A;  1K9M C;  1YBY A;  4O0A A;  2NZO A;  4OO1 G;  1TWA H;  3BZK A;  5C3E H;  2R93 G;  4LUV A;  4NXN L;  3I4M G;  1HR0 L;  4QIW E;  4R4I A;  4DV3 Q;  3AEV A;  3HOW H;  4POF A;  3TEH B;  3NBH B;  4XTC S;  1I94 L;  1PH6 A;  4BBR G;  1IBK Q;  3GTK H;  1JJC B;  4X65 L;  1VQD A;  3I2Z A;  3H3V I;  1C0A A;  4DR5 L;  1IBL Q;  3F2B A;  3J81 c;  2Q2I A;  3JAM i;  1Y14 B;  1NJI C;  1HR0 Q;  2AWN A;  4JBW A;  4JG2 A;  4C3J H;  4DKA C;  3HKZ E;  5C3E G;  3F2D A;  1N32 Q;  4IJH A;  4X64 L;  1KQS A;  4X65 Q;  2Q2U A;  1CKO A;  2UXD Q;  2LXJ A;  1HZA A;  1TWC H;  2D0P A;  2ZTD A;  3AFQ A;  3CCM A;  1N34 L;  4BA2 I;  1N32 L;  2JA9 A;  1NMG A;  4UP9 A;  3CC7 A;  1JT8 A;  1K73 C;  5GAG C;  3H0G H;  2AMC B;  3I7F A;  4IPC A;  3HOV G;  2VS1 A;  3OW2 A;  4IO9 A;  2I5L X;  5HGQ A;  4DV4 L;  3M9B A;  4OWT B;  5IP7 H;  5C4X G;  1HZC A;  2E2H H;  4DUY Q;  2KCM A;  1V9P A;  4TQU S;  5E7N A;  3W1G A;  1X3G A;  3K0X A;  3OTO Q;  3T1Y L;  1GVP A;  4AYB G;  2WB1 G;  4JOI C;  3D0F A;  2PI2 E;  4LFB L;  3E9I A;  1U5K A;  3FKI G;  3FP9 A;  1VQH A;  3NEL A;  1EQR A;  5IT9 c;  4YCW A;  4WJ3 M;  3W5O A;  1Q81 C;  3TS2 A;  1BBW A;  1SRU A;  4A3G H;  4JV5 Q;  1YNX A;  1GO3 E;  1VQI A;  4GN4 B;  1GM5 A;  1PFS A;  4ALP A;  4DR3 L;  2WB1 E;  1WCM H;  4X62 Q;  4JI4 Q;  4EX5 A;  1PA6 A;  1YHA A;  3E0E A;  5FLM H;  1PH4 A;  4DV7 L;  1X65 A;  4BA1 I;  1B7Y B;  4A3M G;  2Q2T A;  3GTQ H;  1L1O A;  4YY3 Q;  3TS0 A;  1VCI A;  4IJL A;  1E7Z A;  5AJ3 Q;  1VQO A;  1XJV A;  3KDF A;  1IBK L;  4DPG A;  2R6G A;  3J80 c;  4A76 A;  4KHP L;  3EBE A;  4GKK L;  1X54 A;  1XPR A;  1ASZ A;  2UU9 L;  2K4K A;  3UE0 A;  2UUB Q;  2RHQ B;  3G48 A;  1QVF A;  4HJA A;  2B29 A;  2JA6 G;  2WFW A;  2HIX A;  5C0X J;  3PCO B;  4DR2 Q;  5BR8 L;  1VQ8 A;  2OQ0 A;  1K8A C;  4BBS H;  3M3Y H;  1IYJ B;  2GVA A;  2JA5 G;  1BBU A;  4JI6 L;  4JI7 L;  3K7A H;  4HIO A;  4R4O A;  2HHH L;  4HJ8 A;  2WP8 J;  2E2J H;  2MQH A;  4DR7 L;  1HNW L;  2H5X A;  5GQO A;  1N8R C;  3DLL A;  4YHH Q;  2EIF A;  2XGT A;  2ZTE A;  1YHQ A;  4LF4 Q;  4QL5 A;  2B63 H;  2E2I H;  2N49 A;  3G6E A;  4HJ7 A;  4B3M L;  3KF6 B;  2F4V Q;  2R7D A;  1HNZ L;  2R92 H;  3PUV A;  4LF8 L;  2B3G A;  1S72 A;  3RNU A;  4A3J G;  3J7Z C;  4GNX B;  1MJE A;  1DGS A;  1YEZ A;  2IHF A;  3RR5 A;  4RMF A;  4L5S A;  1KD1 C;  5C0X G;  2BA1 A;  3S1Q H;  2Z6K C;  3PUX A;  3PO3 G;  3KDF B;  4DUY L;  3JC6 6;  2OTJ A;  2R7F A;  2ID0 A;  2K75 A;  3RZO H;  1VQM A;  4JV5 L;  3CP0 A;  1EUJ A;  1K83 H;  1X9N A;  1YHB A;  3S1R H;  1J5E L;  4YCV A;  4DV3 L;  4AYB E;  4LFC Q;  3S1M H;  1X3F A;  2KCT A;  1SRO A;  1UE7 A;  2ALY B;  1XTD A;  1A63 A;  5FLM G;  5FLX c;  2N8N A;  1C7Y A;  3CQZ H;  2EXD A;  4POG A;  1K8G A;  2OQK A;  1J5E Q;  1CSP A;  4R1J A;  2ASB A;  1G51 A;  2GVB A;  2HIV A;  3I55 A;  1MKH A;  4HIM A;  1C9O A;  3SGI A;  4HID A;  3D31 A;  1B70 B;  1EQQ A;  4LF6 L;  1FJG L;  2NVT H;  1NY4 A;  2BH2 A;  4PZ8 A;  1PH3 A;  2DGY A;  3EIV A;  1PH9 A;  1QVC A;  2MFI A;  1L0W A;  4GOP A;  2HHH Q;  1I94 Q;  4JI3 Q;  1XPU A;  2RCN A;  1E1O A;  1V43 A;  1HNW Q;  4R4C A;  5M3M G;  2F3I A;  3A5Z B;  3J7A 5;  3EN2 A;  3BZC A;  4A3E G;  4JBK A;  2VL6 A;  1HNZ Q;  5C0X I;  1QVG A;  1FVI A;  1VQ9 A;  2N78 A;  1SLJ A;  4IFD J;  4DR4 Q;  2A19 A;  4KHZ A;  3K81 C;  4QY7 A;  2ES2 A;  1SMX A;  3CXC A;  2K50 A;  3F2C A;  4LFA L;  4P73 A;  1A62 A;  3GO5 A;  3T1Y Q;  1YJ9 A;  3U4Z A;  4DAM A;  3CPW A;  3RLO A;  1WOC A;  5FJ8 H;  2VQF Q;  2ZM6 L;  3J81 i;  2XTI A;  4JOI A;  1PH1 A;  3T1H L;  1Q7Y C;  4GLX A;  3RN5 A;  5M5Y H;  4MTN A;  5IYC H;  1OTC A;  1HNX L;  3S14 H;  3PIO A;  1K0R A;  4DK3 C;  1HJP A;  4QGU A;  1LM0 A;  4XIG S;  3KOJ A;  4DUZ Q;  1MJC A;  2L15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...