5LMUL

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5lmuL00
2I0QA 3KF8B 4A3EG 2HIVA 4A75A 4DR7Q 1TWAH 2JA5H 4DR1L 3NEMA 2OTLA 1LTLA 3HOYG 1Q46A 2B29A 5C0XG 1K8GA 1E7ZA 1PFSA 2ZTCA 3HOWG 4DV3Q 3M3YH 5K36G 2JA7H 1N9WA 4X62Q 1J5EQ 2VUMG 2ZTDA 5ELNA 3RLFA 3RN2A 4JYAL 2UXDL 4KHPQ 1M90C 4DV6Q 1N32Q 2E2IH 1PH4A 2UU9L 1JJCB 1R9TH 2UXDQ 3PUYA 1UEBA 2HQLA 4O0AA 4QQBX 1Y14B 5IP9G 4XIGS 4DV0L 4JI2L 4BY7H 1OXUA 3CPWA 1OXVA 3B6YA 4LFCL 2JEBI 2YTXA 2MO1A 4Y7NH 2Q2HA 3GTLH 4HJ5A 4DR7L 5GQOA 4A3MH 3PF5A 4EQ5A 4NXNQ 4A3GG 4OWTB 3K8AA 2Q2UA 5M3MH 3FKIH 3HOZG 1B7YB 4LF6L 4A3CG 4KLKA 4KHZA 3FKIG 4QJFA 3G6EA 4DV4L 2ZJRA 3U50C 3HOZH 1WYDA 4LWCA 3S1NH 4GNXA 4JI1Q 2BH8A 5LMNQ 3L2PA 4A3IH 4A3MG 4C3IH 1I3QH 2F52A 1ASYA 1H95A 2ASBA 4IO9A 1XNRQ 1AE3A 2ZM6Q 3STBC 4X65L 1KRTA 1A63A 3PUVA 4GNXB 4DR2Q 3KYHC 4P71A 4H02A 3JC66 5C3EG 3CCEA 5GAHC 2Y0SG 2E2JH 1CSQA 1E24A 3GTPH 3HKSA 2ID0A 4LFBL 3BZKA 3CD6A 1VQDA 2VQEL 1VQ5A 4DPGA 1S40A 1SRUA 2JA6G 3ICEA 4AH6A 5BR8Q 4DV5Q 4DV6L 3PUXA 2UUCQ 4A3CH 4JBJA 4Y52H 1Y1VH 4HIMA 1VQ8A 2XTIA 5M3FG 3K81C 4IJLA 4GN4B 1L2FA 1YBYA 2K50A 1YITA 1VQLA 2YV5A 2C35B 1GKHA 1QVCA 3CCUA 2K75A 1YJWA 2R7DA 4R4IA 5GAEC 1ASZA 4POGA 5HGQA 1OTCA 4C3JH 1J5EL 4LUZA 1WFQA 3UE0A 2YU9H 1OXXK 4A76A 3T1HL 1QZGA 4JI6Q 3S24A 1HNWQ 2CFMA 4A3LG 1B8AA 1QUQA 2PNHA 4GKJL 1S3OA 2QEXA 3RNUA 1EIFA 4HIDA 2JA8G 2H5XA 4JI5L 1Q1EA 3LGJA 2CWPA 1W3SA 1IL2A 1VQ7A 4QY7A 1TWCH 4JOIC 2PI2E 2OTJA 4WJ4A 5C44H 3CCSA 4B3TL 3TQYA 1VQIA 2D0OA 1OXSC 4UP7A 5C44G 1XPRA 2HHHL 4BA1I 3FP9A 5C4JH 3I4NG 4A93G 4B3ML 4OWXB 4OX9Q 2RCNA 1CKOA 2AMCB 3KFUA 4IJHA 2HHHQ 5C4XG 3RLOA 1NY4A 1X65A 4YCVA 3HOUH 4LFCQ 1RL2A 1UE6A 2OWOA 1KD1C 4LFAL 4A3JG 3Q8DA 3ULLA 3UDIA 2JA6H 1KRSA 4JYAQ 1X3FA 2MO0A 4DR4L 3J81i 4YY3Q 5M5XH 1KQSA 4KI0A 2B63H 5LMUL 3I4MH 5FLMG 4DR4Q 5C3EH 4YCWA 1MKHA 3KDFB 3PCOB 4JI0Q 2R93G 1HNXL 4ALPA 2NVTH 4A3KH 1SR3A 1VQEA 4QGUA 3PIPA 1UE7A 2ALYB 2K4KA 4PG3A 1SFOH 5IE8A 1TWHH 2WB1G 1KL9A 2N8NA 5FJ8G 3HOXG 1XNQL 2LXJA 2Q2IA 4A3KG 2JEAI 4WJ3M 1TWGH 1PH6A 3CW2C 3G71A 3K0XA 4YHHL 1NE3A 1TWFH 1X9NA 1KAWA 1A8VA 1EOVA 3GTJH 3RZOH 1NTGA 1VQGA 4LF8Q 3I55A 2WP8J 3HFZB 3KLWA 2PI2A 5JEAG 1FL0A 3RN5A 3J81j 1N34Q 1W2BA 3HOVH 2VL6A 1UE1A 1CUKA 3CMEA 1Y1WH 1FJGQ 1O7IA 2KENA 4APVA 1DGSA 1KHIA 1N36Q 3HOUG 2KCTA 2BA0A 1HR0Q 4JI5Q 1HH2P 1XPUA 3KF6A 4QL5A 4DNIA 1N8RC 1PH9A 4K0KL 1LUZA 5M5WH 1HZ9A 5JEAJ 3T1HQ 1YHBA 1PHJA 3HOXH 4JI6L 3A5UA 2B63G 4B3MQ 3H3VI 3T1YL 3G4SA 1XMOL 4JI3L 3CQZH 1L1OA 3GTGH 1HNWL 1YJ9A 4A3EH 3S2DH 1X3GA 1UWVA 1B70B 3H0GH 3U4ZA 3PIOA 2ZTEA 1HZCA 1A62A 3K7AH 3BU2A 4AYBE 1XMOQ 3HKZE 2GN5A 4GN3B 3UE1A 2IT1A 5C4XH 2KHIA 1PH2A 2UUAL 4JI4Q 4UY8C 4DR6Q 4HJ7A 4DK6C 5DLQE 4HJ9A 4JCVE 4YY3L 1E22A 1VQ6A 1TXYA 4OO1I 2UXCQ 1BBWA 1WCMG 1CKNA 1E3PA 2D62A 3D31A 3I4NH 1V9PA 4DUYQ 3TS0A 3AYHB 3I4OA 1D8LA 1VQFA 1PYBA 1YJNA 2Q2TA 2YTVA 4GLAC 4BY1G 4DR6L 4LNQA 3EBEA 1VQJA 1JE5A 1SLJA 5IWAL 5M3FH 4DKAC 4GNXC 4UPAA 1K0RA 5IY0A 1VS0A 2I5LX 3H0GG 3OYYA 4MZ9A 1HNZQ 2E5LL 1SE8A 2PMZE 4AYBG 3S1QH 4JOIA 1NMFA 4A3BG 2ATWA 2K14A 1PV4A 1PH1A 1I94Q 3JAMc 4LFBQ 1YI2A 2E5LQ 3I2ZA 1U0LA 1BBUA 4PZ8A 5H1SE 3CCMA 4JI1L 4LF5Q 2MFIA 1N33L 1FGUA 4LF4Q 3A5ZB 4JI7L 4X64Q 4IOCA 3HOVG 3UDGA 1MJCA 2RHQB 3AQQA 5AJ3Q 3CC4A 3CPFA 4JI4L 4K0KQ 1U5KA 4A3DG 4ME3A 3M7NA 4KHPL 3G48A 2K5NA 3NBHB 4R1JA 3VDYA 5FLMH 1D7QA 3WWVA 4AQYQ 1S72A 1E1OA 1GD7A 1L0WA 3UDFA 1XNRL 2K5VA 4GKKQ 1EFWA 4JI2Q 4DV0Q 2RF4A 3DM3A 3W1GA 4DV3L 4LF9Q 3CMAA 2GVAA 5M3MG 5E7NA 3RR5A 4NXNL 3DLLA 4AQYL 2R93H 1C7YA 5FLXc 4OO1G 4L5SA 2R7ZG 3PO2G 1KIXA 4A3DH 3AFPA 2VUMH 4GS3A 1QVFA 4BBRH 1YNXA 3T1YQ 2FXQA 4PMWA 4FDBA 2JA7G 3JAMi 4DV1Q 2MNAA 2IX1A 2AHOB 3J81c 3S1RH 4A3BH 3PF4A 2LXKA 3E9HA 1PH5A 4GKJQ 3ER0A 3STBD 1NMGA 3J7ZC 3W5OA 3ERSX 3K80C 4JI7Q 3OTOL 4GN5A 4C2MH 3BZCA 4A3FG 1Q8KA 3H3VH 4YWKA 1KC8C 4R4CA 5AJ3L 4GOPB 4DR1Q 4BY7G 3HKZG 1OXTA 3A0JA 1L1OC 4L5RC 1G6PA 4A3JH 4X62L 2EIFA 1PH3A 2NVQH 2EQSA 1A0IA 2ZJQA 5ELOA 1XPOA 4DV2L 4JI0L 3F8TA 1HNZL 2KCMA 4POFA 2DGYA 3PO3G 1IYJB 2Z6KA 1VQ4A 1V43A 1PVOA 2NN6I 4DV7L 5IP7G 1VQOA 2A19A 1BVSA 2NN6G 2R6GA 4IPDA 2AWOA 4DR3L 1Y1WG 3GD7A 4LF5L 4X65Q 1Z47A 1Q86C 1G291 1EIYB 2HIXA 3I7FA 5IYBG 5EAYA 1YHAA 2AWNA 3S15H 1N33Q 2JA8H 2R7FA 4JI8L 4C3HH 1N34L 1Y1VG 1M1KC 2K52A 4EX5A 1JJ2A 4A3LH 1KXLA 1I5FA 4LF8L 4YCUA 3TRZA 2Z0SA 1N36L 1Z9FA 3TREA 1YHQA 3D0FA 1QUQB 1I50H 2JK8A 1NBWA 1JB7A 4YWMA 1IBMQ 1P16A 4BBSG 1MIUA 1CKMA 2E2HH 2MQHA 4X6AH 3F2CA 4DUZL 2WAQE 2VNUD 5GADC 4JBWA 4PZ7A 2Y0SE 2V1CC 4LUVA 1J6QA 2VW9A 4HJ8A 4OWWB 1SMXA 2DUDA 4LF7L 1QZHA 4R4OA 2JJQA 5C0XJ 2UXCL 3ULPA 1P8LA 1EQQA 4DUYL 1UE5A 3CC7A 1NJIC 5GROA 1WOCA 3J80i 4RG1A 1LM0A 4GLXA 3S1MH 3M9BA 2LSSA 5GAGC 1HR0W 4J15A 4BXXG 3F2BA 3UDXA 1X56A 1RIPA 1N32L 1Q1BA 3J80c 3RZDH 4BBSH 4HIKA 2ES2A 4JBKA 2A8VA 3K7UC 2CKZB 2VQFQ 4DAMA 2IHEA 3CCRA 4B3SL 1EYGA 5FJ8H 5LMUQ 4GOPA 4JC0A 3S16H 2WAQG 3MEFA 4A3IG 3KDFA 1YEZA 4TQUS 3MXNB 1G51A 4P73A 1LYLA 1WI5A 2KBNA 4R4TA 1VQCA 4OX9L 3J7A5 1IXRA 4X66Q 4XTCS 1T9HA 3GTKH 1HJPA 1Q82C 2CCZA 4DR3Q 1IBKQ 4X66L 1XNQQ 1GO3E 1VCIA 2AKWB 3CXCA 5JJLA 2JA5G 5IP9H 3SGIA 3HOYH 3ZJYC 1IBKL 2YYZA 2NZOA 5LMNL 1VQNA 2WFWA 3H15A 3PUZA 4L5TA 4P72A 4LUOA 1VQPA 1Q7YC 2NVYH 4HJAA 1HR0L 4B3SQ 4NXMQ 3M4QA 2ZJPA 3E9IA 2R92H 4B3RQ 3U4VA 5M5YH 3KJPA 3IRBA 3CP0A 1JMCA 1X3EA 3FHWA 5IP7H 4BA2I 1Q12A 2E8GA 4UP9A 3CCVA 2N78A 3GTQH 4A93H 2OCEA 2IX0A 4IPHA 1VQBA 4QIWE 2B3GA 2UXBQ 2A1AA 1WJJA 4NB3A 4IFDG 2UUBQ 4IPGA 1C9OA 3L7ZC 2BA1A 2F3IA 5J3BA 2VQFL 4HIOA 4LF7Q 3U58A 2R92G 3M85A 2F4VL 1VQKA 1WCMH 3RLNA 2I5MX 2D0PA 4MNOA 1X6OA 1VQ9A 3PV0A 4GKKL 3TS2A 2UU9Q 3OW2A 2CWAA 3GO5A 4LW1A 2L15A 4BBRG 1XTDA 4DK3C 2QA4A 4IFDJ 3GTOH 2CQOA 2WB1E 1AH9A 1SN8A 2EXDA 3CCQA 4IOAA 4A4IA 1IZ6A 1VQHA 1YVCA 1SROA 3S2HH 2N49A 1PYSB 3ULJA 1VQAA 1PA6A 4DR5L 4P74A 4DV1L 1MJEA 4LF6Q 3CCJA 1XMQQ 1K9MC 4NXML 2RHSB 5IYCH 4GOPC 2VZAA 5IYDH 1JJGA 2VY3A 4AIMA 4B3TQ 2R7ZH 3AEVA 1L1OB 3F2DA 3KJOA 3PO2H 1C0AA 4TVAB 3CAMA 3L0OA 1Q81C 1XMQL 4RMFA 4BXXH 1PH7A 4JV5Q 2JE6I 2NVXH 1K83H 3CC2A 5IWAQ 2PQAA 3PUWA 2Z6KC 3CF5A 4DR2L 4PZ6A 3I4MG 4OXPA 5HY6A 1PH8A 3CCLA 1VQMA 2UUBL 2QGQA 4OONA 4LF9L 5JJKA 1HZAA 3M4PA 4GLVB 4O2DA 1YIJA 1X55A 2OQKA 3BJUA 4DR5Q 2HT1A 1K3RA 4DV2Q 4NPSA 4DV7Q 1EQRA 2GVBA 4DV5L 2KHJA 2UUCL 3I56A 2UUAQ 1X54A 1IBLQ 1HNXQ 4A3GH 1I6HH 1YZ6A 4MTNA 4P75A 3TEHB 5IYCG 5IYDG 1GVPA 1CSPA 1FVIA 2K5HA 4LFAQ 5LMNW 2JQOA 4X64L 4IPCA 2VQEQ 2UXBL 1HZBA 1EUJA 4JG2A 1IBLL 4JV5L 1JT8A 3PSIA 2I5HA 2N3SA 1IBML 1BKBA 4JI3Q 3KF6B 3F1ZA 4JBMA 2XGTA 4DUZQ 3S17H 3M4OH 1GM5A 4IFDI 3W1BA 1I94L 2JA9A 5IYBH 3E0EA 5BR8L 5JJIA 4YWLA 4LF4L 3A74A 2PQAB 3EN2A 3GDEA 2YTYA 4YHHQ 2BH2A 3EIVA 3NENA 3KOJA 1AE2A 1E1TA 2NZHA 3HOWH 4DV4Q 4B3RL 3GTMH 5IT9c 2VS1A 1FJGL 1EWIA 4UP8A 3PO3H 2F4VQ 1XJVA 1QVGA 2IY5B 3PGZA 4L5QA 1CKNB 4JI8Q 2OQ0A 1K73C 4A3FH 3S14H 4DAYB 4BY1H 3NELA 4R4QA 2IHFA 3AFQA 5C0XI 1V1QA 3OTOQ 2ZM6L 1K8AC
chains in the Genus database with same CATH superfamily
3EQLC 1JOOA 1CM9A 2HIVA 3ND8A 3QWNA 1TWAH 2KCCA 4JW0A 2JA7H 4J8QA 4HSPA 2VUMG 1A2UA 3K5NA 2IJ0A 2E2IH 1D5XC 3MHBA 3KK7A 4QQBX 1GJXA 3CPWA 3P75A 4LFCL 2JEBI 1SMYC 1KNAA 3R93A 2HUGA 1II3A 2XWJB 3K8AA 4OWTB 4FYDA 1WYDA 3S1NH 5C4XB 4GNXA 4JI1Q 4ZCKA 1H95A 4N9PA 4IO9A 1RDPD 1XNRQ 3RMHA 2B2WC 2OEOA 4A3EB 4B9XA 3KYHC 4H02A 3KLRA 5GAHC 1WTWA 1E24A 2ID0A 1NR4A 2F0WA 2VQEL 2Q8RE 1S40A 4IURA 1SRUA 3W3AA 1LO5D 1LTAD 4AH6A 4FNFA 2B2UA 1CA5A 3PUXA 2NVYB 3OPOA 3HOVB 5M3FG 3K81C 2KA7A 4C3HG 2K50A 1EY8A 1V8QA 3T4AC 4RKBA 2B39A 1YITA 1YJWA 3RZOB 3A7AB 4R4IA 4RWSC 1TWFB 1B3AA 1ASZA 1QWYA 4FXKC 4R9WA 1TWGB 3D4RA 1WFQA 2YU9H 1OXXK 4A76A 1DYQA 1QZGA 2X69A 4FXDA 2PNHA 1EY4A 1S3OA 4C56C 2CH4W 3RNUA 2JA8G 4M1UB 4HIDA 2H5XA 3NXWA 4RHRA 1IL2A 3LGJA 1TWCH 2AQ1B 3L9AX 2OTJA 1K0SA 2RDGA 2F0FA 2D0OA 5C44G 5C3EB 4BA1I 3I4MB 4B3ML 4OWXB 1CKOA 3N52A 5CV8A 4PMBA 5C4XG 4YCVA 2R3ZA 3HOUH 1KD1C 1WTOA 2MUYA 4V190 3UDIA 1KRSA 1A2TA 2FFKB 1I4HA 2K01A 3VR2A 4G7OC 3EJIA 4KI0A 5LMUL 3K6OA 2B2WA 1STAA 5KGUA 1HNXL 2NYZD 4K6DA 4GZYC 3CRKC 5EGTA 2XNAC 3PIPA 5FOBB 1TWHH 3A7LA 2LXJA 2RQXA 1BO0A 2JXMB 3GP7A 4WJ3M 2PZTA 2PO4A 4H44C 1X9NA 3ND9A 5EJWA 1EOVA 3GTJH 4FP5D 1VQGA 4LF8Q 1IKLA 3I55A 3J81j 1FR3A 4ME5A 1UE1A 1CUKA 3CMEA 4APVA 2F0LA 1WVLA 2KCTA 3P1HA 1XPUA 3KF6A 4QL5A 1F9RA 2V4DA 5C5MA 1KTKA 5JEAJ 4DF7A 1PHJA 5CBAE 3BVMA 3A5UA 3T13A 1DONA 3CQZH 3S2DH 3U4ZA 1D5MC 1HZCA 1A62A 1O7YA 3DEPA 3K7AH 4AYBE 1Q3LA 3HKZE 2DNEA 4GN3B 2IT1A 1DOKA 4A3BB 3W2DA 4UY8C 4DR6Q 4HJ7A 4HJ9A 5IGCA 5M3MB 3K58A 1VQ6A 1WCMG 1O7ZA 2F1MA 1CKNA 2D62A 2DY7A 1HXYD 3D31A 4KMUC 4DU9A 3I4OA 1D8LA 4Y7NB 1PYWD 1H9SA 1CTMA 4GLAC 4BY1G 2WKCA 1G2SA 1VQJA 3EBEA 1EY7A 3DXJC 1BOSA 3MTSA 1K0RA 1WD1A 3OYYA 3H0GG 1BUVT 2B8GA 4RCNA 1QJOA 4KK7A 4JOIA 5JOBA 2ATWA 1I94Q 5E1FA 4RGOS 4LFBQ 2E5LQ 3I2ZA 3CRLC 1U0LA 2JA5B 1ZKOA 1QOHA 4JI1L 3CCMA 3AMUA 5C3XA 1CFMA 4LF4Q 1ZYRC 4K8IA 1TS3A 1X32A 4RHSA 1MJCA 3CC4A 2JN4A 1SNMA 1SNQA 2B2TA 1B9NA 3MC0B 3G48A 2F0MA 1GD7A 2Q8IB 2F0SA 1RTOA 2K5VA 4RGTA 4GKKQ 4DV0Q 5D65A 1E2VA 2EJFC 3CMAA 3DLLA 4AQYL 5A2QL 2K7VA 4KY5A 4L5SA 4GS3A 1QE6A 2K05A 4EQOA 3J81c 3S1RH 1VMPA 1F2LA 3J7ZC 3K80C 4F87A 5D3DA 3OTOL 1BCPB 4ZUJA 3H3VH 3A55A 2DJGC 4R4CA 4DN4M 4BY7G 4E6IA 4CJ1B 1G6PA 1BXTA 2EIFA 2NVQH 2ZJQA 1F9QA 2E74C 1TKWB 1JOKA 2Z9HA 1PVOA 2NN6I 1H9KA 5IP7G 1SE2A 3SDZA 2AWOA 1Y1WG 1HQRD 3GD7A 4LF5L 2KJXA 4ID6A 4U673 2N55A 5EAYA 3KUPA 3S15H 1BR9A 2ZXOA 3KF8A 1N34L 3HEJA 4YIJA 1CI3M 2B2TC 4K5WA 1BCPC 3NHHA 5CV5A 1I5FA 5FLXL 1GUNA 5L37A 1EU4A 1N36L 1QG7A 1VF5C 3SHLA 4PV1C 3J81E 1JB7A 4BBSG 1IBMQ 1MIUA 3J7AF 2E2HH 2PYKA 3F2CA 3FPPA 4JBWA 5J22A 2JA6B 1J6QA 3J7A5 1SMXA 4LF7L 1QZHA 2JJQA 1NSNS 1UE5A 3CC7A 4FO2A 1NJIC 1WOCA 1ZYRD 4GLXA 3S1MH 5GAGC 4BXXG 4J15A 3F2BA 3UDXA 2O4XA 3J80c 2SEBD 3BZDB 3RZDH 5C44B 4DAMA 2IHEA 2L4NA 3CCRA 1JC7A 5EKLA 5FJ8H 2B2VC 2SNMA 3S16H 4IUTA 4TQUS 4P73A 5KEEA 3AB9A 5G3LF 2EE1A 1SYGA 3U9SA 2A68C 2FINB 1Q82C 2B2YA 1T5EA 1IBKQ 5FO8B 1PTOH 1VCIA 3FMCA 3CXCA 2F0EA 2JA5G 4C3JG 5EBDA 2QF7A 1IBKL 2WFWA 4L5TA 2F0VA 1HR0L 2KECA 4B9WA 2ZJPA 1I4GA 4WORA 2I46A 5IP7H 5DNFA 2E8GA 1JWUD 3GTQH 2N78A 4A93H 2IX0A 4IPHA 2B3GA 1WTXA 1STGA 2A1AA 1TS5A 2F0PA 1LV9A 1PZID 5I6WA 1TY0A 3L7ZC 5J3BA 3VYSA 3H3VC 4C3IB 4A3IB 1VQKA 3RLNA 2JA8B 2I5MX 2D0PA 4G7ZC 1X6OA 1VQ9A 3TN2A 2KUMA 2CWAA 3GO5A 3FRPB 5EKKA 2QA4A 2HCIA 2OF1A 2B8FA 4IZ8A 2CQOA 1AH9A 1G6ZA 3GTLB 2EXDA 3CCQA 4IOAA 1YNND 3N6RA 1S5DD 3Q24A 3L3OC 3NPPA 1S5ED 2N49A 3C1EA 3TZDA 4P74A 3PIP3 2NUCA 2LMCB 1EQTA 4KD4A 4CKBA 4NXML 1JJGA 1KDAA 2R7ZH 3PO2H 3AEVA 1L1OB 1F2ZA 4Z9CB 1QCBD 2X6LA 4BXXH 2NVXH 1SYDA 3PUWA 1AZPA 2Z6KC 2HD3A 3MXPA 3I4MG 1CZGA 3URYA 1PH8A 5T1GA 4LF9L 4GLVB 1YIJA 2NWGA 4DR5Q 5E4WC 4DV2Q 4NPSA 1A6XA 2GVBA 2QKIC 4KKTA 1WD0A 4MTNA 3TEHB 5IYDG 4BWGB 1CSPA 4LFAQ 2K5HA 5JPNC 1TY2A 3I90A 2EZVA 1EY5A 2G9HD 2NTSA 3M4OB 4HMJA 3F1ZA 4DUZQ 4ZUIA 3M4OH 4IFDI 3W1BA 2DN8A 1I94L 2JA9A 3E0EA 3A74A 2PQAB 3VR6A 2BH2A 3EIVA 2RA4A 3NENA 2CVRA 1IYVA 2NZHA 2MP1A 3GTMH 4OL7A 1EWIA 5CBEE 2IY5B 1K8OA 1K73C 4R4QA 5C0XI 3AFQA 4OIJA 4A3EG 1I4RA 4DR1L 1NNXA 1ONLA 3MEHA 2OTLA 3HOYG 4DV3Q 2Q8TA 2A69D 4X62Q 1J5EQ 1CHPD 3RLFA 3RN2A 3PO2B 2R7ZB 3R3OA 5ELBA 3E0JA 5IGGA 2JP1A 5ELCA 1PH4A 1JJCB 1JQYD 1RF2D 1GOZA 4C1NK 3MA2B 3CKIB 4DV0L 1XXGA 3GTLH 1IHZA 3K5MA 2Q2HA 1SEBD 4DR7L 5GQOA 4A3MH 4A3GG 1U4RA 4J6HA 3HOZG 1B7YB 1TS2A 1HA5A 4KLKA 3G6EA 4QJFA 1U9RA 1VF7A 3HOZH 1EY6A 4LWCA 4A3MG 2BH8A 4A3IH 4WRDA 3L2PA 1MHWC 4C3IH 2F52A 1ZXTA 4OHJA 1NCVA 3M4YA 4H13C 2K5DA 1S5CD 5I2YA 3OWEB 3PUVA 4DR2Q 3CCEA 4A93B 5C5LA 2E2JH 5F2DA 3HKSA 1A3UA 1I4XA 2A5HA 1VQ5A 1JCKB 1EIHA 1VDZA 1J9OA 1H9JA 2P5ZX 4DV6L 4A3CH 1Y1VH 2XTIA 3J80E 3LX0A 3C3LA 1VQLA 1AN8A 1PTOB 1BF4A 1QVCA 1AW7A 2MPMA 1BDOA 1LACA 2K6AA 5HGQA 2PZUA 5ELEA 4L6TB 4HEDA 3UE0A 3VYTA 5FLXE 4KV6A 4JI6Q 3LWUA 4OGQC 1SFOB 3NP8A 2VB2X 4HR7B 3S16B 1Q1EA 2CWPA 3EVQA 2C9OA 5C44H 5BN4A 3RZDB 2HHHL 5G3LD 3FP9A 5ELFA 4OX9Q 1A3TA 3KFUA 3S1MB 2HHHQ 3RLOA 5IT9L 1X65A 4ZKBB 4LFCQ 1RL2A 4IQZA 3G7LA 2JA6H 1X3FA 4DR4L 4ABNA 3J81i 4YY3Q 3I3CA 4ODGA 4XT1B 5C4JB 2IL8A 1XYIA 4YCWA 4DR4Q 1YNNC 1MKHA 3PCOB 4JI0Q 3MXGA 4DFAA 1AEXA 1STEA 3KLSX 2K1BA 4A3KH 4QGUA 1UE7A 2ALYB 5BN3A 4N8FA 1KL9A 3HOXG 4A3KG 5CV4A 1A15A 4C3JB 1SNPA 1QB5D 1NE3A 2GA4B 3IFDA 1ICFB 1KAWA 1FGBD 1B44D 1FL0A 3D4WA 2PW7A 1I4QA 4KY7A 2J4XA 4DAVA 1DGSA 5COYA 1KHIA 4CKEA 1HR0Q 1FD7D 1F9PA 3VYRA 4K0KL 3GTPB 1YHBA 3HOXH 2B63G 4B3MQ 3G4SA 3TP6A 5CMDA 1L1OA 1F9SA 4MIUA 1UWVA 3H0GH 2ZTEA 1LTID 2GN5A 1I3QB 3UE1A 5FO9B 2UUAL 1SSOA 4DK6C 3IL8A 4JCVE 1BBWA 3RD4A 4KKSA 3C2PA 2K03A 1V9PA 2A69C 3M7GA 3AYHB 5IODA 2F0KA 1VQFA 4DUYQ 3TS0A 1HCZA 4TRDA 2H4OA 4BY7B 1EU3A 1RTNA 4G57A 4IFDH 2A73B 1YI2A 4GNXC 3V96A 5IY0A 4QUCA 4MZ9A 1XTCD 2I5LX 2E5LL 5C3WA 3BDOA 3TSSA 4AYBG 4DAPA 5CV7A 4RFBA 2EY6A 4QB4A 5NUCA 1HA6A 3OWFA 5AFWA 1PH1A 3JAMc 1NAPA 1BBUA 3ZYYX 4PZ8A 2XN9C 2MFIA 2ZT9C 5KNCA 4RGMA 2DNCA 2B2UC 5FKAC 2EYJA 3PO3B 2O5IC 3AQQA 3CPFA 1B9MA 4JI4L 2AQ2B 4KHPL 1F77A 2F0HA 4WJWA 1ENFA 1I4PA 3WWVA 5I9OA 3K59A 4AQYQ 1S72A 2A6ED 1L0WA 1G91A 1EFWA 4JI2Q 5JPMC 2RF4A 3DM3A 1PFMA 1TT2A 4LF9Q 2GVAA 4DXGA 2RSOA 1AP0A 2R93H 3V05A 1C7YA 4FF4A 5FLXc 1FNUA 5EPKA 4G4KA 3AFPA 1I6HB 3HG9A 1KDCA 4FDBA 3OW7A 4DV1Q 2DJFC 2MNAA 2AHOB 4A3BH 1E2ZA 3ER0A 3STBD 1WTQA 3K7AB 3W5OA 3ERSX 4JI7Q 1TR5A 3CQZB 2QCPX 3I72A 5FK9C 3KBGA 5J39A 4YWKA 1KC8C 3EA6A 5CV6A 4DR1Q 1L1OC 4XDXA 4LMQD 4A3JH 4X62L 3SXHA 1O7LA 1A0IA 2WAQB 1SDFA 1JWSD 1MI2A 2KCMA 2DGYA 1S5FD 1V43A 4DV7L 1VQOA 2A19A 2FMMA 4IPDA 4DR3L 1J8IA 1QILA 1Z47A 3IKJA 2NTTA 2HIXA 1QNUA 3J81L 1YHAA 2IX3A 2CW0D 1EQVA 1BNZA 4JI8L 2K32A 4C3HH 3GV6A 1M1KC 2K52A 4A3LH 5IIFA 3J7AV 4LF8L 3TREA 1YHQA 5D3IB 3S9WA 2JK8A 5HGTA 4I65A 1NBWA 1P16A 5DEHA 4X6AH 3ITPA 2VXWA 4J1MA 4PZ7A 4KD3A 4LUVA 2V1CC 2VW9A 2DUDA 2Z1CA 2UXCL 1EOTA 5M5YB 2EYPA 3ULPA 3HOUB 4UHVA 1B4OA 1LM0A 1JICA 1KNEA 2L5TA 2LSSA 1SYBA 1N32L 1GHJA 5EPJA 4HIKA 2A8VA 3GTKB 1TWCB 2CKZB 3NTHA 5LL6S 1SNDA 3TDQA 4B3SL 4GOPA 2WAQG 3R2TA 1EZ6A 1G51A 1C48A 1LYLA 4OX9L 2YU9B 4X66Q 3HGBA 2M00A 3GTKH 2CCZA 3EROA 4X66L 1UEAB 2AKWB 2NN6H 3R8BA 2IWHA 1IW7D 5KYLA 1VQNA 3H15A 4HSVA 2NVYH 4NXMQ 3M4QA 4CDCC 5M5YH 1C4QA 3KJPA 4KY6A 1EWCA 5I2XA 5IOCA 1D5ZC 1X3EA 3FHWA 4RKLA 4UP9A 1Y69U 2UXBQ 4I7ZC 1WJJA 4IFDG 5ISRA 4IPGA 1B1ZA 2L12A 4HIOA 2VQFL 4LF7Q 1M4VA 2OT2A 3U58A 3SK8A 2F4VL 4C3HB 4EGVA 4ZQ3A 4MNOA 3FVQA 4GKKL 3PV0A 1SYFA 3G6JB 2L15A 1HUMA 2WB1E 1V1PB 1SN8A 4XYQA 3NTIA 1A3VA 1YVCA 1STBA 2VB3X 1Q8IA 2RDHA 5CYUA 1K9MC 2E2IB 4A3JB 5IYDH 2VY3A 1FNVA 2K04A 2JA7B 1PH7A 1Q90A 4JV5Q 5IWAQ 2PQAA 2ZXRA 4DR2L 4PZ6A 4CKCA 2A68D 3CCLA 1VQMA 2M9VA 3NQIA 4IUPA 2MJ8A 2QGQA 5JJKA 1ET9A 5JAVA 4O2DA 3S14B 2OQKA 3BJUA 1LTRD 5CC4A 3I56A 2UUAQ 1X54A 1IBLQ 3HOWB 1I6HH 2O2LD 1FVIA 2R93B 1Y8NB 4QF4A 2JQOA 4X64L 4RGNA 1JT8A 1EUJA 4JG2A 1IBLL 3PSIA 2I5HA 1BKBA 4JBMA 1HQMC 4KJNA 3S17H 1ENAA 3BYYB 5BR8L 2K5WA 4LF4L 3SK5A 3GDEA 2A6HC 1JR0D 1E1TA 4A3GB 2ENBA 2K5QA 4B3RL 2KEEA 1CA6A 1CT1D 1PXUA 2VS1A 1FJGL 1EFID 3PO3H 1QVGA 5LHY1 4JI8Q 1CKNB 1E2WA 2OQ0A 4A3FH 3QR8A 1V1QA 3LNNA 3A8IE 1U4LA 2I0QA 1W6KA 3KF8B 1U4PA 4A75A 1F2YA 1Z7TA 1Q46A 2B29A 5C0XG 4IUVA 1K8GA 5K36G 1W6JA 2ZTCA 2B2VA 3M3YH 4IUQA 5KIXA 3PIO3 4KHPQ 4DV6Q 5JVG3 1R9TH 3PUYA 1UEBA 1Y14B 4JI2L 4BY7H 1OXVA 2YTXA 2MO1A 1RCVD 3GTOB 1G8ZD 3PF5A 3X3NA 4EQ5A 4A3CG 3DUZA 2KVMA 2ZJRA 3U50C 4JBKA 5LMNQ 1I3QH 1GXDC 3H0GB 1C8CA 1CZWA 5C4HA 1AE3A 2ZM6Q 4X65L 4CBVA 3R2IA 4H7BA 4GNXB 5BN5A 3I70A 1F2MA 3JC66 3HOXB 2Y0SG 1CSQA 3GTPH 4LFBL 3BZKA 1VQDA 2EYFA 2HDMA 1LABA 1HUNA 1PRTB 3MXUA 3MAQA 2R92B 4Y52H 1VQ8A 3P7JA 1SNCA 4GN4B 4IJLA 5EBCA 1B3QA 4RAUC 2C35B 3E5SA 3T16A 2HDLA 3CCUA 1IW7C 2R7DA 4MHEA 4POGA 1OTCA 2QDLA 3H91A 4C3JH 1J5EL 4LUZA 3QB3A 2QDBA 2KCNA 3T1HL 1Y8PB 2XRQD 2CFMA 3BVGA 1B8AA 1QUQA 3X3MA 3A54A 2QEXA 1EIFA 3DM1A 4A3KB 4JI5L 1W3SA 3HP3A 2SOBA 4JOIC 4NMZA 3CCSA 4B3TL 5C6AA 1VQIA 4BBSB 4UP7A 4A93G 5C4JH 1ICWA 1PRTD 2RCNA 3K5LA 2AMCB 4PMCA 4IJHA 3IAYA 1XWEA 1JOQA 4K5VA 4G7HC 1QNKA 1SAPA 1V1PA 2OWOA 1UE6A 3F2UA 4DNTB 2KEDA 4L63B 5CGKA 4JYAQ 3QG1A 2B63H 4CDFC 3OSOA 1SE3A 1K8MA 1R4PB 3K57A 4X3SA 4H0LC 3U9OA 2R93G 1OO9B 3K0YA 1D2BA 4ALPA 2E75C 2NVTH 1KLGD 1VQEA 1HFGA 4PG3A 2K4KA 1SFOH 1WTPA 2E2DC 2N8NA 5FJ8G 2F0QA 1PH6A 3CW2C 3G71A 3K0XA 1IYUA 4YHHL 3I4LA 4QCLA 4XQJA 1D1IA 3C46A 3RN5A 2PI2A 3MVVA 1N34Q 2VL6A 1Y1VB 1B2TA 1Y1WH 3ERQA 1O7IA 3TP5A 1N36Q 3A56A 3HOUG 2BDNA 1N8RC 1UNSA 3WDNA 1PH9A 1LUZA 5D14A 1HZ9A 4JI6L 2E2JB 4CGYB 4JI3L 1DM0B 1Z6HA 3GTGH 1YJ9A 3SEBA 5HURA 3NQTA 1X3GA 3PIOA 1SYCA 3BU2A 2EYOA 2KHIA 4JI4Q 3HOZB 5DLQE 2L9HA 4YY3L 1E22A 1TXYA 4HTHA 4OO1I 4A3MB 1E3PA 2FJ2A 3I4NH 4DNRB 1YJNA 1PYBA 3H94A 4HAEA 1ENCA 5KNBA 2A74C 1GUWA 2CW0C 1JE5A 4K8JA 5M3FH 2F3WA 4DKAC 4UPAA 3C1FA 3S1QH 2NB0A 4FF3A 4A3BG 2BE5C 2K14A 2JSOA 2Y0SB 4ZK9B 4HCSA 1WTRA 1ILQA 2RVLA 1N33L 1FGUA 2BCOA 1PLFA 4JI7L 3BDCA 3QOJA 2FMCA 3D8GA 3ONAB 2F3VA 2Z4HA 3HOVG 2EYHA 1LT5D 2J0TD 3GTMB 1UAPA 4NW2A 1TIID 4K0KQ 1Y8OB 1U5KA 1S4ZA 3NBHB 1D7QA 1SE4A 3UDFA 3QO2A 2E76C 1DCZA 4N9TA 3W1GA 5M3MG 5E7NA 3RR5A 4NXNL 4OO1G 2R7ZG 3PO2G 1KIXA 2VUMH 4BS9A 4IUNA 1QVFA 4BBRH 1YNXA 2FXQA 2JA7G 5LL6X 5DM73 2IX1A 2D5DA 3DWPA 3D6WA 2F0IA 3PF4A 2LXKA 1PH5A 3DMUA 4M8AA 1STNA 4K2KA 4GN5A 4C2MH 3BZCA 4A3FG 2CHBD 4KJOA 1Q8KA 5JVH3 5A35A 2NVXB 3T53B 5AJ3L 5M5WB 3HKZG 1OXTA 1FNWA 3A0JA 4R8NA 1HHVA 5ELOA 1XPOA 4JI0L 1SXTA 2XVSA 2Z6KA 1O80A 2EJMA 1BVSA 2NN6G 5T1IA 5EKIA 1EZ8A 3WOEA 4CDDC 4UAIA 1EYDA 1N33Q 2JA8H 2R7FA 4OEMB 4QMGA 1Y1VG 4EX5A 1KXLA 1STHA 1LTSD 3TRZA 3OMCA 3MZ5A 3D0FA 3VR3A 3TP7A 5C4ZA 1I50H 2PNRC 3J7YW 3NE5B 3GTQB 5M5XB 2IPKD 3DHQA 4DUZL 2VNUD 4OWWB 4HJ8A 4R4OA 5C0XJ 1I6VC 4FF1A 1MBYA 4QIWB 1EQQA 2ZXPA 4ZAIA 4C3IG 1B53A 4EQPA 5GROA 3J80i 4RG1A 2N88A 4XQNA 3M9BA 3D3RA 2G5DA 1BCPF 1G2TA 5CORA 2ES2A 2LKVA 3K7UC 3MFGA 2H1EA 1AFPA 2VQFQ 2AUKA 2K33A 1K3BC 1X3QA 3SVMA 4JC0A 3EFXD 1GUTA 3DWQA 3MEFA 1YEZA 1PRTF 1GUOA 1VQCA 1D1KA 1IXRA 4XTCS 4LAAA 1T9HA 1HJPA 2A6HD 2G9DA 4DR3Q 1HTLD 1CQVA 1XNQQ 1GO3E 5JJLA 3SGIA 3HOYH 3ZJYC 4ZLTF 2EOTA 2YYZA 2Z4IA 3PUZA 1Q7YC 4JK1C 1FYCA 3K5OA 4B3RQ 3U4VA 3IRBA 3NSWA 4X3TA 1Q12A 2E2HB 3FPUB 3QOLA 1VQBA 2D2CC 2QEJC 4NB3A 4F7XA 2BA1A 2ICEC 4K5XA 1EWHA 4R8IA 1PRTC 1WCMH 1EY0A 3S15B 2TMPA 3TS2A 3FKIB 3OW2A 3BYTB 3I91A 1STYA 3NTKA 4IFDJ 5DAUA 2BDOA 2TSSA 4A4IA 1VQHA 2F0NA 1PYSB 4ZYSA 4DR5L 2L1BA 5M9OA 4DV1L 1DOLA 4EQNA 1MJEA 3Q6SA 3CCJA 1LTTD 2NVQB 4GOPC 1IKMA 1TS4A 3KJOA 2L11A 3F2DA 1C0AA 1Q81C 3GQBA 2JE6I 4K14A 3CC2A 3FDTA 3CF5A 1L0XB 3Q22A 4OXPA 5HY6A 1AZQA 2AUJD 2UUBL 2RKSA 4OONA 5C0XH 1EYCA 4JVZA 5TSSA 4BY1B 1X55A 2MHVA 2HT1A 1TU2B 5IGFA 3S1RB 1XX8A 1VMCA 2KHJA 4Q0FA 5DM63 1HNXQ 1YZ6A 3BVZA 5IYCG 2UXBL 5LMNW 1NR2A 4IPCA 1IBML 3VA5A 4JI3Q 2XGTA 4LK1C 4DXFA 2NZ1D 3WOFA 4YWLA 1BCPD 1SJHD 4V0BA 1SJED 3KOJA 1AE2A 2Z6BA 5IT9c 2F4VQ 3TBIB 4L5QA 5J1ZA 2IW3A 3HRZC 4BY1H 3NELA 1SYEA 2IHFA 2ZM6L 5K5PA 1KABA 1R4QB 4KHVA 4DR7Q 2JA5H 2QILA 3NEMA 1LTLA 1E7ZA 1PFSA 3HOWG 2WKDA 3KBXA 1N9WA 1LTBD 4JYAL 2ZTDA 5ELNA 2UXDL 2WB1B 1M90C 1N32Q 2F03A 2UU9L 5E3FA 2UXDQ 2HQLA 4O0AA 5IP9G 3UI2A 4XIGS 4DK0A 1OXUA 3B6YA 4U68A 4Y7NH 3A8KE 4CHTB 4HJ5A 4K6LA 4NXNQ 4OO1H 2Q2UA 5M3MH 3FKIH 4ZRZA 4LF6L 4KHZA 3FKIG 4DV4L 3SK6A 1WCMB 1O78A 3NWSA 1ASYA 1T5XD 3MFYA 3NBHA 2ASBA 3Q23A 3S2DB 3STBC 5A2QE 1KRTA 1A63A 4P71A 5C3EG 4IALA 1BBXC 5IGEA 1HPCA 3CD6A 4DPGA 3OOCA 2JA6G 3ICEA 4L8JA 5BR8Q 4DV5Q 2UUCQ 4JBJA 2KHSA 4HIMA 1L2FA 1YBYA 3HOYB 2YV5A 3DWAA 1GKHA 3GTJB 2K75A 1DZ1A 2PW5A 3NBIA 5GAEC 1HFNA 4MN3A 3I73A 4XQQA 5IGDA 3S24A 1HNWQ 1TWHB 4B08A 4A3LG 4FVMA 1EEFD 2EY5A 4GKJL 1RODA 1HTPA 1VQ7A 2RSNA 4QY7A 2PI2E 1GUGA 2EPBA 5KNDA 4WJ4A 3TQYA 1XPRA 3I4NG 1OXSC 3I8ZA 4UDUC 5ELDA 2WINB 1NY4A 4LFAL 4A3JG 3Q8DA 3ULLA 2F0DA 2MO0A 2PCFB 1LT6D 5IT9E 4OELB 4RH6A 1D6EC 5M5XH 5JEAH 1KQSA 2HCCA 4HCEA 3O13A 3I4MH 5FLMG 5C3EH 3H09A 1CHQD 3KDFB 1I50B 4IN3A 3J80L 1SR3A 3NUCA 3QJYA 1ESRA 5IE8A 2WB1G 1XNQL 2Q2IA 2JEAI 1TWGH 1DOMA 2I07B 4XT3B 1TWFH 1A8VA 3RZOH 1NTGA 1MSHA 1UUPA 4KN7C 2WP8J 3HFZB 2JYOA 3KLWA 5JEAG 1W2BA 3HOVH 1FJGQ 2EXZA 2KENA 4DA2A 5EQ0A 4JI5Q 2BA0A 3HS0C 1HH2P 1JE4A 4DNIA 4K2LA 1DD2A 5I9PA 5M5WH 1GUSA 3T1HQ 3H3VI 3T51B 3T1YL 2F4IA 2O5JC 1XMOL 1DJRD 4C2MB 1HNWL 4A3EH 2LS01 1B70B 1SNOA 4NP5A 1XMOQ 2ICIA 1DXMA 3CU7A 5C4XH 3S1NB 2L55A 1PH2A 5K36H 4BBRB 3VA7A 2UXCQ 1EL0A 1MSGA 2VUMB 4EVOA 4DAYA 4KN4C 4TSSA 2Q2TA 2FHTA 3E3XA 3Q0AA 1K28A 2F0GA 2YTVA 1ET6A 4DR6L 3GV3A 4LNQA 1SLJA 5IWAL 1VS0A 1WTHA 1HNZQ 1SE8A 2OXPA 2PMZE 1NMFA 1PV4A 1RD9D 1PFNA 2F0TA 2PZWA 3BG3A 2EVBA 1TWAB 5H1SE 1LLRD 4LF5Q 4NKLA 3A5ZB 4CJ2C 2KQ3A 2KOLA 4X64Q 1LTGD 1PDQA 4IOCA 3VYUA 4F88A 3UDGA 1HRJA 2RHQB 5AJ3Q 1M8AA 2F0JA 5FO7B 3SE0A 4A3DG 4ME3A 4XYOA 3M7NA 3RUZA 4KTAA 2K5NA 4R1JA 1H9RA 4PNYA 4X3UA 3VDYA 3HZXA 5FLMH 3S1QB 4O1NA 1E1OA 1XNRL 2F0OA 5M3FB 3PQIA 4DV3L 3A8JE 3SK4A 4S3SA 2EDGA 1B50A 2Z8LA 3I4NB 4A3DH 1ML0D 5KYIA 5KRUA 3T1YQ 4PMWA 5I6YA 4WFN3 3JAMi 3SR1A 4GKJQ 3E9HA 1LT3D 2CH4A 2J7ZA 1NMGA 4PQXA 1BQQT 3GTGB 3TP8A 1K83B 3OIPA 4GOPB 2NBFA 2SNSA 1JWMD 2PPBC 4L5RC 1EY9A 3BS1A 4CDEC 4F8MA 3V2TA 1PH3A 2EQSA 3NWTA 3VR5A 4FXGC 4DV2L 1Y1WB 4IUUA 3F8TA 1HNZL 4POFA 2X6GA 3S2HB 3PO3G 1IYJB 3T56B 1VQ4A 2R6GA 2D9UA 4FF2A 3IFTA 4X65Q 3MWYW 1Q86C 1EEID 1G291 1EIYB 3I7FA 5IYBG 1SBBB 1TQOA 3TMEA 2AWNA 4ZKCB 4O42A 1EYAA 1JJ2A 5CR3A 4OIKA 5CV9A 4YCUA 2NVTB 2Z0SA 1Z9FA 2RBMA 2EY1A 1QUQB 1YNJD 4YWMA 2WV6D 1SMYD 1CKMA 4ILWA 3AU7A 2B63B 2MQHA 1JB3A 2WAQE 5GADC 2Y0SE 2EY2A 2LY7A 2SDFA 3TZUA 1YNJC 2EYMA 5JJZA 1P8LA 4DUYL 2R61A 1JORA 1HR0W 4MTKA 1X56A 1RIPA 1Q1BA 3JAME 1TVXA 4BBSH 4X3KA 1EYGA 5LMUQ 4Q5VA 4A3IG 3KDFA 3MXNB 1KLUD 1X3PA 1PFBA 1WI5A 2KBNA 4R4TA 1S5BD 3HKZB 4AYBB 3VR4A 1RHPA 2XRSD 2C5CA 3KLSA 5IP9H 3FEWX 5LMNL 2NZOA 4P72A 1VQPA 4LUOA 3QIAA 4HJAA 4B3SQ 2R92H 3E9IA 3CP0A 1PMRA 1JMCA 4TKOB 2WIIB 1H9SB 4BA2I 2DY8A 3CCVA 1PZJD 1V1OA 2OCEA 4I7AA 1PTOF 4QIWE 3MXNA 2UUBQ 2BOSA 1C9OA 2F3IA 5EPLA 2R92G 2WACA 4LJZC 3M85A 2XWBB 2F0UA 1CK1A 1LT4D 1MD2D 2UU9Q 4LW1A 1CQFA 4BBRG 1XTDA 2PMZB 4DK3C 3GTOH 1PTOC 2RDFA 4KKUA 1IZ6A 1SROA 3S2HH 1NUCA 3ULJA 1VQAA 2LFNA 1PA6A 1R9TB 3LWEA 4N8X1 4LF6Q 2RCFA 3OIQA 1E0BA 1XMQQ 3BDLA 1PTOD 2RHSB 2M2LA 5IYCH 2VZAA 4B3TQ 4AIMA 5IGBA 2QW7A 1U4MA 4JPBW 4TVAB 3CAMA 3L0OA 4DGZA 1XMQL 4RMFA 3M3YB 1RJTA 1K83H 5E4XA 1IL8A 1RKNA 3OHXC 1ESFA 3PMFA 1HZAA 3M4PA 4A3FB 4CJ0B 4NDXA 1KAAA 3CHBD 4HMIA 1K3RA 1L0YB 1EIGA 3H6MA 1EQRA 4DV7Q 4DV5L 2UUCL 2HQEA 4RA8A 1ILPA 4A3GH 2AQ3B 1H9MA 4HN7A 4DK1A 4P75A 4A3DB 1GVPA 2VQEQ 4ULLA 1WTVA 1HZBA 4JV5L 1GHKA 3DEOA 3E6ZX 2N3SA 2MGSA 3S17B 3KF6B 4C1NI 2A6EC 3OMGA 4RCOA 4P2CB 1GM5A 1MGSA 5IYBH 2B2YC 2PQEA 2XSCA 5JJIA 5I4DA 3EN2A 2K28A 3NK9A 2L0CA 3JAML 2YTYA 4XXEA 4YHHQ 2CQAA 3P20A 1ZEQX 3HOWH 3D4DA 2XIWA 4QUFA 4DV4Q 1KDBA 2EJGC 4UP8A 2BE5D 1XJVA 1PZKD 3PGZA 3S14H 2EYLA 4DAYB 3OTOQ 1K8AC 3D6CA
chains in the Genus database with same CATH topology
2I0QA 3KF8B 4A3EG 2HIVA 4A75A 4DR7Q 1TWAH 2JA5H 4DR1L 3NEMA 2OTLA 1LTLA 3HOYG 1Q46A 2B29A 5C0XG 1K8GA 1E7ZA 1PFSA 2ZTCA 3HOWG 4DV3Q 3M3YH 5K36G 2JA7H 1N9WA 4X62Q 1J5EQ 2VUMG 2ZTDA 5ELNA 3RLFA 3RN2A 4JYAL 2UXDL 4KHPQ 1M90C 4DV6Q 1N32Q 2E2IH 1PH4A 2UU9L 1JJCB 1R9TH 2UXDQ 3PUYA 1UEBA 2HQLA 4O0AA 4QQBX 1Y14B 5IP9G 4XIGS 4DV0L 4JI2L 4BY7H 1OXUA 3CPWA 1OXVA 3B6YA 4LFCL 2JEBI 2YTXA 2MO1A 4Y7NH 2Q2HA 3GTLH 4HJ5A 4DR7L 5GQOA 4A3MH 3PF5A 4EQ5A 4NXNQ 4A3GG 4OWTB 3K8AA 2Q2UA 5M3MH 3FKIH 3HOZG 1B7YB 4LF6L 4A3CG 4KLKA 4KHZA 3FKIG 4QJFA 3G6EA 4DV4L 2ZJRA 3U50C 3HOZH 1WYDA 4LWCA 3S1NH 4GNXA 4JI1Q 2BH8A 5LMNQ 3L2PA 4A3IH 4A3MG 4C3IH 1I3QH 2F52A 1ASYA 1H95A 2ASBA 4IO9A 1XNRQ 1AE3A 2ZM6Q 3STBC 4X65L 1KRTA 1A63A 3PUVA 4GNXB 4DR2Q 3KYHC 4P71A 4H02A 3JC66 5C3EG 3CCEA 5GAHC 2Y0SG 2E2JH 1CSQA 1E24A 3GTPH 3HKSA 2ID0A 4LFBL 3BZKA 3CD6A 1VQDA 2VQEL 1VQ5A 4DPGA 1S40A 1SRUA 2JA6G 3ICEA 4AH6A 5BR8Q 4DV5Q 4DV6L 3PUXA 2UUCQ 4A3CH 4JBJA 4Y52H 1Y1VH 4HIMA 1VQ8A 2XTIA 5M3FG 3K81C 4IJLA 4GN4B 1L2FA 1YBYA 2K50A 1YITA 1VQLA 2YV5A 2C35B 1GKHA 1QVCA 3CCUA 2K75A 1YJWA 2R7DA 4R4IA 5GAEC 1ASZA 4POGA 5HGQA 1OTCA 4C3JH 1J5EL 4LUZA 1WFQA 3UE0A 2YU9H 1OXXK 4A76A 3T1HL 1QZGA 4JI6Q 3S24A 1HNWQ 2CFMA 4A3LG 1B8AA 1QUQA 2PNHA 4GKJL 1S3OA 2QEXA 3RNUA 1EIFA 4HIDA 2JA8G 2H5XA 4JI5L 1Q1EA 3LGJA 2CWPA 1W3SA 1IL2A 1VQ7A 4QY7A 1TWCH 4JOIC 2PI2E 2OTJA 4WJ4A 5C44H 3CCSA 4B3TL 3TQYA 1VQIA 2D0OA 1OXSC 4UP7A 5C44G 1XPRA 2HHHL 4BA1I 3FP9A 5C4JH 3I4NG 4A93G 4B3ML 4OWXB 4OX9Q 2RCNA 1CKOA 2AMCB 3KFUA 4IJHA 2HHHQ 5C4XG 3RLOA 1NY4A 1X65A 4YCVA 3HOUH 4LFCQ 1RL2A 1UE6A 2OWOA 1KD1C 4LFAL 4A3JG 3Q8DA 3ULLA 3UDIA 2JA6H 1KRSA 4JYAQ 1X3FA 2MO0A 4DR4L 3J81i 4YY3Q 5M5XH 1KQSA 4KI0A 2B63H 5LMUL 3I4MH 5FLMG 4DR4Q 5C3EH 4YCWA 1MKHA 3KDFB 3PCOB 4JI0Q 2R93G 1HNXL 4ALPA 2NVTH 4A3KH 1SR3A 1VQEA 4QGUA 3PIPA 1UE7A 2ALYB 2K4KA 4PG3A 1SFOH 5IE8A 1TWHH 2WB1G 1KL9A 2N8NA 5FJ8G 3HOXG 1XNQL 2LXJA 2Q2IA 4A3KG 2JEAI 4WJ3M 1TWGH 1PH6A 3CW2C 3G71A 3K0XA 4YHHL 1NE3A 1TWFH 1X9NA 1KAWA 1A8VA 1EOVA 3GTJH 3RZOH 1NTGA 1VQGA 4LF8Q 3I55A 2WP8J 3HFZB 3KLWA 2PI2A 5JEAG 1FL0A 3RN5A 3J81j 1N34Q 1W2BA 3HOVH 2VL6A 1UE1A 1CUKA 3CMEA 1Y1WH 1FJGQ 1O7IA 2KENA 4APVA 1DGSA 1KHIA 1N36Q 3HOUG 2KCTA 2BA0A 1HR0Q 4JI5Q 1HH2P 1XPUA 3KF6A 4QL5A 4DNIA 1N8RC 1PH9A 4K0KL 1LUZA 5M5WH 1HZ9A 5JEAJ 3T1HQ 1YHBA 1PHJA 3HOXH 4JI6L 3A5UA 2B63G 4B3MQ 3H3VI 3T1YL 3G4SA 1XMOL 4JI3L 3CQZH 1L1OA 3GTGH 1HNWL 1YJ9A 4A3EH 3S2DH 1X3GA 1UWVA 1B70B 3H0GH 3U4ZA 3PIOA 2ZTEA 1HZCA 1A62A 3K7AH 3BU2A 4AYBE 1XMOQ 3HKZE 2GN5A 4GN3B 3UE1A 2IT1A 5C4XH 2KHIA 1PH2A 2UUAL 4JI4Q 4UY8C 4DR6Q 4HJ7A 4DK6C 5DLQE 4HJ9A 4JCVE 4YY3L 1E22A 1VQ6A 1TXYA 4OO1I 2UXCQ 1BBWA 1WCMG 1CKNA 1E3PA 2D62A 3D31A 3I4NH 1V9PA 4DUYQ 3TS0A 3AYHB 3I4OA 1D8LA 1VQFA 1PYBA 1YJNA 2Q2TA 2YTVA 4GLAC 4BY1G 4DR6L 4LNQA 3EBEA 1VQJA 1JE5A 1SLJA 5IWAL 5M3FH 4DKAC 4GNXC 4UPAA 1K0RA 5IY0A 1VS0A 2I5LX 3H0GG 3OYYA 4MZ9A 1HNZQ 2E5LL 1SE8A 2PMZE 4AYBG 3S1QH 4JOIA 1NMFA 4A3BG 2ATWA 2K14A 1PV4A 1PH1A 1I94Q 3JAMc 4LFBQ 1YI2A 2E5LQ 3I2ZA 1U0LA 1BBUA 4PZ8A 5H1SE 3CCMA 4JI1L 4LF5Q 2MFIA 1N33L 1FGUA 4LF4Q 3A5ZB 4JI7L 4X64Q 4IOCA 3HOVG 3UDGA 1MJCA 2RHQB 3AQQA 5AJ3Q 3CC4A 3CPFA 4JI4L 4K0KQ 1U5KA 4A3DG 4ME3A 3M7NA 4KHPL 3G48A 2K5NA 3NBHB 4R1JA 3VDYA 5FLMH 1D7QA 3WWVA 4AQYQ 1S72A 1E1OA 1GD7A 1L0WA 3UDFA 1XNRL 2K5VA 4GKKQ 1EFWA 4JI2Q 4DV0Q 2RF4A 3DM3A 3W1GA 4DV3L 4LF9Q 3CMAA 2GVAA 5M3MG 5E7NA 3RR5A 4NXNL 3DLLA 4AQYL 2R93H 1C7YA 5FLXc 4OO1G 4L5SA 2R7ZG 3PO2G 1KIXA 4A3DH 3AFPA 2VUMH 4GS3A 1QVFA 4BBRH 1YNXA 3T1YQ 2FXQA 4PMWA 4FDBA 2JA7G 3JAMi 4DV1Q 2MNAA 2IX1A 2AHOB 3J81c 3S1RH 4A3BH 3PF4A 2LXKA 3E9HA 1PH5A 4GKJQ 3ER0A 3STBD 1NMGA 3J7ZC 3W5OA 3ERSX 3K80C 4JI7Q 3OTOL 4GN5A 4C2MH 3BZCA 4A3FG 1Q8KA 3H3VH 4YWKA 1KC8C 4R4CA 5AJ3L 4GOPB 4DR1Q 4BY7G 3HKZG 1OXTA 3A0JA 1L1OC 4L5RC 1G6PA 4A3JH 4X62L 2EIFA 1PH3A 2NVQH 2EQSA 1A0IA 2ZJQA 5ELOA 1XPOA 4DV2L 4JI0L 3F8TA 1HNZL 2KCMA 4POFA 2DGYA 3PO3G 1IYJB 2Z6KA 1VQ4A 1V43A 1PVOA 2NN6I 4DV7L 5IP7G 1VQOA 2A19A 1BVSA 2NN6G 2R6GA 4IPDA 2AWOA 4DR3L 1Y1WG 3GD7A 4LF5L 4X65Q 1Z47A 1Q86C 1G291 1EIYB 2HIXA 3I7FA 5IYBG 5EAYA 1YHAA 2AWNA 3S15H 1N33Q 2JA8H 2R7FA 4JI8L 4C3HH 1N34L 1Y1VG 1M1KC 2K52A 4EX5A 1JJ2A 4A3LH 1KXLA 1I5FA 4LF8L 4YCUA 3TRZA 2Z0SA 1N36L 1Z9FA 3TREA 1YHQA 3D0FA 1QUQB 1I50H 2JK8A 1NBWA 1JB7A 4YWMA 1IBMQ 1P16A 4BBSG 1MIUA 1CKMA 2E2HH 2MQHA 4X6AH 3F2CA 4DUZL 2WAQE 2VNUD 5GADC 4JBWA 4PZ7A 2Y0SE 2V1CC 4LUVA 1J6QA 2VW9A 4HJ8A 4OWWB 1SMXA 2DUDA 4LF7L 1QZHA 4R4OA 2JJQA 5C0XJ 2UXCL 3ULPA 1P8LA 1EQQA 4DUYL 1UE5A 3CC7A 1NJIC 5GROA 1WOCA 3J80i 4RG1A 1LM0A 4GLXA 3S1MH 3M9BA 2LSSA 5GAGC 1HR0W 4J15A 4BXXG 3F2BA 3UDXA 1X56A 1RIPA 1N32L 1Q1BA 3J80c 3RZDH 4BBSH 4HIKA 2ES2A 4JBKA 2A8VA 3K7UC 2CKZB 2VQFQ 4DAMA 2IHEA 3CCRA 4B3SL 1EYGA 5FJ8H 5LMUQ 4GOPA 4JC0A 3S16H 2WAQG 3MEFA 4A3IG 3KDFA 1YEZA 4TQUS 3MXNB 1G51A 4P73A 1LYLA 1WI5A 2KBNA 4R4TA 1VQCA 4OX9L 3J7A5 1IXRA 4X66Q 4XTCS 1T9HA 3GTKH 1HJPA 1Q82C 2CCZA 4DR3Q 1IBKQ 4X66L 1XNQQ 1GO3E 1VCIA 2AKWB 3CXCA 5JJLA 2JA5G 5IP9H 3SGIA 3HOYH 3ZJYC 1IBKL 2YYZA 2NZOA 5LMNL 1VQNA 2WFWA 3H15A 3PUZA 4L5TA 4P72A 4LUOA 1VQPA 1Q7YC 2NVYH 4HJAA 1HR0L 4B3SQ 4NXMQ 3M4QA 2ZJPA 3E9IA 2R92H 4B3RQ 3U4VA 5M5YH 3KJPA 3IRBA 3CP0A 1JMCA 1X3EA 3FHWA 5IP7H 4BA2I 1Q12A 2E8GA 4UP9A 3CCVA 2N78A 3GTQH 4A93H 2OCEA 2IX0A 4IPHA 1VQBA 4QIWE 2B3GA 2UXBQ 2A1AA 1WJJA 4NB3A 4IFDG 2UUBQ 4IPGA 1C9OA 3L7ZC 2BA1A 2F3IA 5J3BA 2VQFL 4HIOA 4LF7Q 3U58A 2R92G 3M85A 2F4VL 1VQKA 1WCMH 3RLNA 2I5MX 2D0PA 4MNOA 1X6OA 1VQ9A 3PV0A 4GKKL 3TS2A 2UU9Q 3OW2A 2CWAA 3GO5A 4LW1A 2L15A 4BBRG 1XTDA 4DK3C 2QA4A 4IFDJ 3GTOH 2CQOA 2WB1E 1AH9A 1SN8A 2EXDA 3CCQA 4IOAA 4A4IA 1IZ6A 1VQHA 1YVCA 1SROA 3S2HH 2N49A 1PYSB 3ULJA 1VQAA 1PA6A 4DR5L 4P74A 4DV1L 1MJEA 4LF6Q 3CCJA 1XMQQ 1K9MC 4NXML 2RHSB 5IYCH 4GOPC 2VZAA 5IYDH 1JJGA 2VY3A 4AIMA 4B3TQ 2R7ZH 3AEVA 1L1OB 3F2DA 3KJOA 3PO2H 1C0AA 4TVAB 3CAMA 3L0OA 1Q81C 1XMQL 4RMFA 4BXXH 1PH7A 4JV5Q 2JE6I 2NVXH 1K83H 3CC2A 5IWAQ 2PQAA 3PUWA 2Z6KC 3CF5A 4DR2L 4PZ6A 3I4MG 4OXPA 5HY6A 1PH8A 3CCLA 1VQMA 2UUBL 2QGQA 4OONA 4LF9L 5JJKA 1HZAA 3M4PA 4GLVB 4O2DA 1YIJA 1X55A 2OQKA 3BJUA 4DR5Q 2HT1A 1K3RA 4DV2Q 4NPSA 4DV7Q 1EQRA 2GVBA 4DV5L 2KHJA 2UUCL 3I56A 2UUAQ 1X54A 1IBLQ 1HNXQ 4A3GH 1I6HH 1YZ6A 4MTNA 4P75A 3TEHB 5IYCG 5IYDG 1GVPA 1CSPA 1FVIA 2K5HA 4LFAQ 5LMNW 2JQOA 4X64L 4IPCA 2VQEQ 2UXBL 1HZBA 1EUJA 4JG2A 1IBLL 4JV5L 1JT8A 3PSIA 2I5HA 2N3SA 1IBML 1BKBA 4JI3Q 3KF6B 3F1ZA 4JBMA 2XGTA 4DUZQ 3S17H 3M4OH 1GM5A 4IFDI 3W1BA 1I94L 2JA9A 5IYBH 3E0EA 5BR8L 5JJIA 4YWLA 4LF4L 3A74A 2PQAB 3EN2A 3GDEA 2YTYA 4YHHQ 2BH2A 3EIVA 3NENA 3KOJA 1AE2A 1E1TA 2NZHA 3HOWH 4DV4Q 4B3RL 3GTMH 5IT9c 2VS1A 1FJGL 1EWIA 4UP8A 3PO3H 2F4VQ 1XJVA 1QVGA 2IY5B 3PGZA 4L5QA 1CKNB 4JI8Q 2OQ0A 1K73C 4A3FH 3S14H 4DAYB 4BY1H 3NELA 4R4QA 2IHFA 3AFQA 5C0XI 1V1QA 3OTOQ 2ZM6L 1K8AC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0Q A;  3KF8 B;  4A3E G;  2HIV A;  4A75 A;  4DR7 Q;  1TWA H;  2JA5 H;  4DR1 L;  3NEM A;  2OTL A;  1LTL A;  3HOY G;  1Q46 A;  2B29 A;  5C0X G;  1K8G A;  1E7Z A;  1PFS A;  2ZTC A;  3HOW G;  4DV3 Q;  3M3Y H;  5K36 G;  2JA7 H;  1N9W A;  4X62 Q;  1J5E Q;  2VUM G;  2ZTD A;  5ELN A;  3RLF A;  3RN2 A;  4JYA L;  2UXD L;  4KHP Q;  1M90 C;  4DV6 Q;  1N32 Q;  2E2I H;  1PH4 A;  2UU9 L;  1JJC B;  1R9T H;  2UXD Q;  3PUY A;  1UEB A;  2HQL A;  4O0A A;  4QQB X;  1Y14 B;  5IP9 G;  4XIG S;  4DV0 L;  4JI2 L;  4BY7 H;  1OXU A;  3CPW A;  1OXV A;  3B6Y A;  4LFC L;  2JEB I;  2YTX A;  2MO1 A;  4Y7N H;  2Q2H A;  3GTL H;  4HJ5 A;  4DR7 L;  5GQO A;  4A3M H;  3PF5 A;  4EQ5 A;  4NXN Q;  4A3G G;  4OWT B;  3K8A A;  2Q2U A;  5M3M H;  3FKI H;  3HOZ G;  1B7Y B;  4LF6 L;  4A3C G;  4KLK A;  4KHZ A;  3FKI G;  4QJF A;  3G6E A;  4DV4 L;  2ZJR A;  3U50 C;  3HOZ H;  1WYD A;  4LWC A;  3S1N H;  4GNX A;  4JI1 Q;  2BH8 A;  5LMN Q;  3L2P A;  4A3I H;  4A3M G;  4C3I H;  1I3Q H;  2F52 A;  1ASY A;  1H95 A;  2ASB A;  4IO9 A;  1XNR Q;  1AE3 A;  2ZM6 Q;  3STB C;  4X65 L;  1KRT A;  1A63 A;  3PUV A;  4GNX B;  4DR2 Q;  3KYH C;  4P71 A;  4H02 A;  3JC6 6;  5C3E G;  3CCE A;  5GAH C;  2Y0S G;  2E2J H;  1CSQ A;  1E24 A;  3GTP H;  3HKS A;  2ID0 A;  4LFB L;  3BZK A;  3CD6 A;  1VQD A;  2VQE L;  1VQ5 A;  4DPG A;  1S40 A;  1SRU A;  2JA6 G;  3ICE A;  4AH6 A;  5BR8 Q;  4DV5 Q;  4DV6 L;  3PUX A;  2UUC Q;  4A3C H;  4JBJ A;  4Y52 H;  1Y1V H;  4HIM A;  1VQ8 A;  2XTI A;  5M3F G;  3K81 C;  4IJL A;  4GN4 B;  1L2F A;  1YBY A;  2K50 A;  1YIT A;  1VQL A;  2YV5 A;  2C35 B;  1GKH A;  1QVC A;  3CCU A;  2K75 A;  1YJW A;  2R7D A;  4R4I A;  5GAE C;  1ASZ A;  4POG A;  5HGQ A;  1OTC A;  4C3J H;  1J5E L;  4LUZ A;  1WFQ A;  3UE0 A;  2YU9 H;  1OXX K;  4A76 A;  3T1H L;  1QZG A;  4JI6 Q;  3S24 A;  1HNW Q;  2CFM A;  4A3L G;  1B8A A;  1QUQ A;  2PNH A;  4GKJ L;  1S3O A;  2QEX A;  3RNU A;  1EIF A;  4HID A;  2JA8 G;  2H5X A;  4JI5 L;  1Q1E A;  3LGJ A;  2CWP A;  1W3S A;  1IL2 A;  1VQ7 A;  4QY7 A;  1TWC H;  4JOI C;  2PI2 E;  2OTJ A;  4WJ4 A;  5C44 H;  3CCS A;  4B3T L;  3TQY A;  1VQI A;  2D0O A;  1OXS C;  4UP7 A;  5C44 G;  1XPR A;  2HHH L;  4BA1 I;  3FP9 A;  5C4J H;  3I4N G;  4A93 G;  4B3M L;  4OWX B;  4OX9 Q;  2RCN A;  1CKO A;  2AMC B;  3KFU A;  4IJH A;  2HHH Q;  5C4X G;  3RLO A;  1NY4 A;  1X65 A;  4YCV A;  3HOU H;  4LFC Q;  1RL2 A;  1UE6 A;  2OWO A;  1KD1 C;  4LFA L;  4A3J G;  3Q8D A;  3ULL A;  3UDI A;  2JA6 H;  1KRS A;  4JYA Q;  1X3F A;  2MO0 A;  4DR4 L;  3J81 i;  4YY3 Q;  5M5X H;  1KQS A;  4KI0 A;  2B63 H;  5LMU L;  3I4M H;  5FLM G;  4DR4 Q;  5C3E H;  4YCW A;  1MKH A;  3KDF B;  3PCO B;  4JI0 Q;  2R93 G;  1HNX L;  4ALP A;  2NVT H;  4A3K H;  1SR3 A;  1VQE A;  4QGU A;  3PIP A;  1UE7 A;  2ALY B;  2K4K A;  4PG3 A;  1SFO H;  5IE8 A;  1TWH H;  2WB1 G;  1KL9 A;  2N8N A;  5FJ8 G;  3HOX G;  1XNQ L;  2LXJ A;  2Q2I A;  4A3K G;  2JEA I;  4WJ3 M;  1TWG H;  1PH6 A;  3CW2 C;  3G71 A;  3K0X A;  4YHH L;  1NE3 A;  1TWF H;  1X9N A;  1KAW A;  1A8V A;  1EOV A;  3GTJ H;  3RZO H;  1NTG A;  1VQG A;  4LF8 Q;  3I55 A;  2WP8 J;  3HFZ B;  3KLW A;  2PI2 A;  5JEA G;  1FL0 A;  3RN5 A;  3J81 j;  1N34 Q;  1W2B A;  3HOV H;  2VL6 A;  1UE1 A;  1CUK A;  3CME A;  1Y1W H;  1FJG Q;  1O7I A;  2KEN A;  4APV A;  1DGS A;  1KHI A;  1N36 Q;  3HOU G;  2KCT A;  2BA0 A;  1HR0 Q;  4JI5 Q;  1HH2 P;  1XPU A;  3KF6 A;  4QL5 A;  4DNI A;  1N8R C;  1PH9 A;  4K0K L;  1LUZ A;  5M5W H;  1HZ9 A;  5JEA J;  3T1H Q;  1YHB A;  1PHJ A;  3HOX H;  4JI6 L;  3A5U A;  2B63 G;  4B3M Q;  3H3V I;  3T1Y L;  3G4S A;  1XMO L;  4JI3 L;  3CQZ H;  1L1O A;  3GTG H;  1HNW L;  1YJ9 A;  4A3E H;  3S2D H;  1X3G A;  1UWV A;  1B70 B;  3H0G H;  3U4Z A;  3PIO A;  2ZTE A;  1HZC A;  1A62 A;  3K7A H;  3BU2 A;  4AYB E;  1XMO Q;  3HKZ E;  2GN5 A;  4GN3 B;  3UE1 A;  2IT1 A;  5C4X H;  2KHI A;  1PH2 A;  2UUA L;  4JI4 Q;  4UY8 C;  4DR6 Q;  4HJ7 A;  4DK6 C;  5DLQ E;  4HJ9 A;  4JCV E;  4YY3 L;  1E22 A;  1VQ6 A;  1TXY A;  4OO1 I;  2UXC Q;  1BBW A;  1WCM G;  1CKN A;  1E3P A;  2D62 A;  3D31 A;  3I4N H;  1V9P A;  4DUY Q;  3TS0 A;  3AYH B;  3I4O A;  1D8L A;  1VQF A;  1PYB A;  1YJN A;  2Q2T A;  2YTV A;  4GLA C;  4BY1 G;  4DR6 L;  4LNQ A;  3EBE A;  1VQJ A;  1JE5 A;  1SLJ A;  5IWA L;  5M3F H;  4DKA C;  4GNX C;  4UPA A;  1K0R A;  5IY0 A;  1VS0 A;  2I5L X;  3H0G G;  3OYY A;  4MZ9 A;  1HNZ Q;  2E5L L;  1SE8 A;  2PMZ E;  4AYB G;  3S1Q H;  4JOI A;  1NMF A;  4A3B G;  2ATW A;  2K14 A;  1PV4 A;  1PH1 A;  1I94 Q;  3JAM c;  4LFB Q;  1YI2 A;  2E5L Q;  3I2Z A;  1U0L A;  1BBU A;  4PZ8 A;  5H1S E;  3CCM A;  4JI1 L;  4LF5 Q;  2MFI A;  1N33 L;  1FGU A;  4LF4 Q;  3A5Z B;  4JI7 L;  4X64 Q;  4IOC A;  3HOV G;  3UDG A;  1MJC A;  2RHQ B;  3AQQ A;  5AJ3 Q;  3CC4 A;  3CPF A;  4JI4 L;  4K0K Q;  1U5K A;  4A3D G;  4ME3 A;  3M7N A;  4KHP L;  3G48 A;  2K5N A;  3NBH B;  4R1J A;  3VDY A;  5FLM H;  1D7Q A;  3WWV A;  4AQY Q;  1S72 A;  1E1O A;  1GD7 A;  1L0W A;  3UDF A;  1XNR L;  2K5V A;  4GKK Q;  1EFW A;  4JI2 Q;  4DV0 Q;  2RF4 A;  3DM3 A;  3W1G A;  4DV3 L;  4LF9 Q;  3CMA A;  2GVA A;  5M3M G;  5E7N A;  3RR5 A;  4NXN L;  3DLL A;  4AQY L;  2R93 H;  1C7Y A;  5FLX c;  4OO1 G;  4L5S A;  2R7Z G;  3PO2 G;  1KIX A;  4A3D H;  3AFP A;  2VUM H;  4GS3 A;  1QVF A;  4BBR H;  1YNX A;  3T1Y Q;  2FXQ A;  4PMW A;  4FDB A;  2JA7 G;  3JAM i;  4DV1 Q;  2MNA A;  2IX1 A;  2AHO B;  3J81 c;  3S1R H;  4A3B H;  3PF4 A;  2LXK A;  3E9H A;  1PH5 A;  4GKJ Q;  3ER0 A;  3STB D;  1NMG A;  3J7Z C;  3W5O A;  3ERS X;  3K80 C;  4JI7 Q;  3OTO L;  4GN5 A;  4C2M H;  3BZC A;  4A3F G;  1Q8K A;  3H3V H;  4YWK A;  1KC8 C;  4R4C A;  5AJ3 L;  4GOP B;  4DR1 Q;  4BY7 G;  3HKZ G;  1OXT A;  3A0J A;  1L1O C;  4L5R C;  1G6P A;  4A3J H;  4X62 L;  2EIF A;  1PH3 A;  2NVQ H;  2EQS A;  1A0I A;  2ZJQ A;  5ELO A;  1XPO A;  4DV2 L;  4JI0 L;  3F8T A;  1HNZ L;  2KCM A;  4POF A;  2DGY A;  3PO3 G;  1IYJ B;  2Z6K A;  1VQ4 A;  1V43 A;  1PVO A;  2NN6 I;  4DV7 L;  5IP7 G;  1VQO A;  2A19 A;  1BVS A;  2NN6 G;  2R6G A;  4IPD A;  2AWO A;  4DR3 L;  1Y1W G;  3GD7 A;  4LF5 L;  4X65 Q;  1Z47 A;  1Q86 C;  1G29 1;  1EIY B;  2HIX A;  3I7F A;  5IYB G;  5EAY A;  1YHA A;  2AWN A;  3S15 H;  1N33 Q;  2JA8 H;  2R7F A;  4JI8 L;  4C3H H;  1N34 L;  1Y1V G;  1M1K C;  2K52 A;  4EX5 A;  1JJ2 A;  4A3L H;  1KXL A;  1I5F A;  4LF8 L;  4YCU A;  3TRZ A;  2Z0S A;  1N36 L;  1Z9F A;  3TRE A;  1YHQ A;  3D0F A;  1QUQ B;  1I50 H;  2JK8 A;  1NBW A;  1JB7 A;  4YWM A;  1IBM Q;  1P16 A;  4BBS G;  1MIU A;  1CKM A;  2E2H H;  2MQH A;  4X6A H;  3F2C A;  4DUZ L;  2WAQ E;  2VNU D;  5GAD C;  4JBW A;  4PZ7 A;  2Y0S E;  2V1C C;  4LUV A;  1J6Q A;  2VW9 A;  4HJ8 A;  4OWW B;  1SMX A;  2DUD A;  4LF7 L;  1QZH A;  4R4O A;  2JJQ A;  5C0X J;  2UXC L;  3ULP A;  1P8L A;  1EQQ A;  4DUY L;  1UE5 A;  3CC7 A;  1NJI C;  5GRO A;  1WOC A;  3J80 i;  4RG1 A;  1LM0 A;  4GLX A;  3S1M H;  3M9B A;  2LSS A;  5GAG C;  1HR0 W;  4J15 A;  4BXX G;  3F2B A;  3UDX A;  1X56 A;  1RIP A;  1N32 L;  1Q1B A;  3J80 c;  3RZD H;  4BBS H;  4HIK A;  2ES2 A;  4JBK A;  2A8V A;  3K7U C;  2CKZ B;  2VQF Q;  4DAM A;  2IHE A;  3CCR A;  4B3S L;  1EYG A;  5FJ8 H;  5LMU Q;  4GOP A;  4JC0 A;  3S16 H;  2WAQ G;  3MEF A;  4A3I G;  3KDF A;  1YEZ A;  4TQU S;  3MXN B;  1G51 A;  4P73 A;  1LYL A;  1WI5 A;  2KBN A;  4R4T A;  1VQC A;  4OX9 L;  3J7A 5;  1IXR A;  4X66 Q;  4XTC S;  1T9H A;  3GTK H;  1HJP A;  1Q82 C;  2CCZ A;  4DR3 Q;  1IBK Q;  4X66 L;  1XNQ Q;  1GO3 E;  1VCI A;  2AKW B;  3CXC A;  5JJL A;  2JA5 G;  5IP9 H;  3SGI A;  3HOY H;  3ZJY C;  1IBK L;  2YYZ A;  2NZO A;  5LMN L;  1VQN A;  2WFW A;  3H15 A;  3PUZ A;  4L5T A;  4P72 A;  4LUO A;  1VQP A;  1Q7Y C;  2NVY H;  4HJA A;  1HR0 L;  4B3S Q;  4NXM Q;  3M4Q A;  2ZJP A;  3E9I A;  2R92 H;  4B3R Q;  3U4V A;  5M5Y H;  3KJP A;  3IRB A;  3CP0 A;  1JMC A;  1X3E A;  3FHW A;  5IP7 H;  4BA2 I;  1Q12 A;  2E8G A;  4UP9 A;  3CCV A;  2N78 A;  3GTQ H;  4A93 H;  2OCE A;  2IX0 A;  4IPH A;  1VQB A;  4QIW E;  2B3G A;  2UXB Q;  2A1A A;  1WJJ A;  4NB3 A;  4IFD G;  2UUB Q;  4IPG A;  1C9O A;  3L7Z C;  2BA1 A;  2F3I A;  5J3B A;  2VQF L;  4HIO A;  4LF7 Q;  3U58 A;  2R92 G;  3M85 A;  2F4V L;  1VQK A;  1WCM H;  3RLN A;  2I5M X;  2D0P A;  4MNO A;  1X6O A;  1VQ9 A;  3PV0 A;  4GKK L;  3TS2 A;  2UU9 Q;  3OW2 A;  2CWA A;  3GO5 A;  4LW1 A;  2L15 A;  4BBR G;  1XTD A;  4DK3 C;  2QA4 A;  4IFD J;  3GTO H;  2CQO A;  2WB1 E;  1AH9 A;  1SN8 A;  2EXD A;  3CCQ A;  4IOA A;  4A4I A;  1IZ6 A;  1VQH A;  1YVC A;  1SRO A;  3S2H H;  2N49 A;  1PYS B;  3ULJ A;  1VQA A;  1PA6 A;  4DR5 L;  4P74 A;  4DV1 L;  1MJE A;  4LF6 Q;  3CCJ A;  1XMQ Q;  1K9M C;  4NXM L;  2RHS B;  5IYC H;  4GOP C;  2VZA A;  5IYD H;  1JJG A;  2VY3 A;  4AIM A;  4B3T Q;  2R7Z H;  3AEV A;  1L1O B;  3F2D A;  3KJO A;  3PO2 H;  1C0A A;  4TVA B;  3CAM A;  3L0O A;  1Q81 C;  1XMQ L;  4RMF A;  4BXX H;  1PH7 A;  4JV5 Q;  2JE6 I;  2NVX H;  1K83 H;  3CC2 A;  5IWA Q;  2PQA A;  3PUW A;  2Z6K C;  3CF5 A;  4DR2 L;  4PZ6 A;  3I4M G;  4OXP A;  5HY6 A;  1PH8 A;  3CCL A;  1VQM A;  2UUB L;  2QGQ A;  4OON A;  4LF9 L;  5JJK A;  1HZA A;  3M4P A;  4GLV B;  4O2D A;  1YIJ A;  1X55 A;  2OQK A;  3BJU A;  4DR5 Q;  2HT1 A;  1K3R A;  4DV2 Q;  4NPS A;  4DV7 Q;  1EQR A;  2GVB A;  4DV5 L;  2KHJ A;  2UUC L;  3I56 A;  2UUA Q;  1X54 A;  1IBL Q;  1HNX Q;  4A3G H;  1I6H H;  1YZ6 A;  4MTN A;  4P75 A;  3TEH B;  5IYC G;  5IYD G;  1GVP A;  1CSP A;  1FVI A;  2K5H A;  4LFA Q;  5LMN W;  2JQO A;  4X64 L;  4IPC A;  2VQE Q;  2UXB L;  1HZB A;  1EUJ A;  4JG2 A;  1IBL L;  4JV5 L;  1JT8 A;  3PSI A;  2I5H A;  2N3S A;  1IBM L;  1BKB A;  4JI3 Q;  3KF6 B;  3F1Z A;  4JBM A;  2XGT A;  4DUZ Q;  3S17 H;  3M4O H;  1GM5 A;  4IFD I;  3W1B A;  1I94 L;  2JA9 A;  5IYB H;  3E0E A;  5BR8 L;  5JJI A;  4YWL A;  4LF4 L;  3A74 A;  2PQA B;  3EN2 A;  3GDE A;  2YTY A;  4YHH Q;  2BH2 A;  3EIV A;  3NEN A;  3KOJ A;  1AE2 A;  1E1T A;  2NZH A;  3HOW H;  4DV4 Q;  4B3R L;  3GTM H;  5IT9 c;  2VS1 A;  1FJG L;  1EWI A;  4UP8 A;  3PO3 H;  2F4V Q;  1XJV A;  1QVG A;  2IY5 B;  3PGZ A;  4L5Q A;  1CKN B;  4JI8 Q;  2OQ0 A;  1K73 C;  4A3F H;  3S14 H;  4DAY B;  4BY1 H;  3NEL A;  4R4Q A;  2IHF A;  3AFQ A;  5C0X I;  1V1Q A;  3OTO Q;  2ZM6 L;  1K8A C; 
#chains in the Genus database with same CATH topology
 3EQL C;  1JOO A;  1CM9 A;  2HIV A;  3ND8 A;  3QWN A;  1TWA H;  2KCC A;  4JW0 A;  2JA7 H;  4J8Q A;  4HSP A;  2VUM G;  1A2U A;  3K5N A;  2IJ0 A;  2E2I H;  1D5X C;  3MHB A;  3KK7 A;  4QQB X;  1GJX A;  3CPW A;  3P75 A;  4LFC L;  2JEB I;  1SMY C;  1KNA A;  3R93 A;  2HUG A;  1II3 A;  2XWJ B;  3K8A A;  4OWT B;  4FYD A;  1WYD A;  3S1N H;  5C4X B;  4GNX A;  4JI1 Q;  4ZCK A;  1H95 A;  4N9P A;  4IO9 A;  1RDP D;  1XNR Q;  3RMH A;  2B2W C;  2OEO A;  4A3E B;  4B9X A;  3KYH C;  4H02 A;  3KLR A;  5GAH C;  1WTW A;  1E24 A;  2ID0 A;  1NR4 A;  2F0W A;  2VQE L;  2Q8R E;  1S40 A;  4IUR A;  1SRU A;  3W3A A;  1LO5 D;  1LTA D;  4AH6 A;  4FNF A;  2B2U A;  1CA5 A;  3PUX A;  2NVY B;  3OPO A;  3HOV B;  5M3F G;  3K81 C;  2KA7 A;  4C3H G;  2K50 A;  1EY8 A;  1V8Q A;  3T4A C;  4RKB A;  2B39 A;  1YIT A;  1YJW A;  3RZO B;  3A7A B;  4R4I A;  4RWS C;  1TWF B;  1B3A A;  1ASZ A;  1QWY A;  4FXK C;  4R9W A;  1TWG B;  3D4R A;  1WFQ A;  2YU9 H;  1OXX K;  4A76 A;  1DYQ A;  1QZG A;  2X69 A;  4FXD A;  2PNH A;  1EY4 A;  1S3O A;  4C56 C;  2CH4 W;  3RNU A;  2JA8 G;  4M1U B;  4HID A;  2H5X A;  3NXW A;  4RHR A;  1IL2 A;  3LGJ A;  1TWC H;  2AQ1 B;  3L9A X;  2OTJ A;  1K0S A;  2RDG A;  2F0F A;  2D0O A;  5C44 G;  5C3E B;  4BA1 I;  3I4M B;  4B3M L;  4OWX B;  1CKO A;  3N52 A;  5CV8 A;  4PMB A;  5C4X G;  4YCV A;  2R3Z A;  3HOU H;  1KD1 C;  1WTO A;  2MUY A;  4V19 0;  3UDI A;  1KRS A;  1A2T A;  2FFK B;  1I4H A;  2K01 A;  3VR2 A;  4G7O C;  3EJI A;  4KI0 A;  5LMU L;  3K6O A;  2B2W A;  1STA A;  5KGU A;  1HNX L;  2NYZ D;  4K6D A;  4GZY C;  3CRK C;  5EGT A;  2XNA C;  3PIP A;  5FOB B;  1TWH H;  3A7L A;  2LXJ A;  2RQX A;  1BO0 A;  2JXM B;  3GP7 A;  4WJ3 M;  2PZT A;  2PO4 A;  4H44 C;  1X9N A;  3ND9 A;  5EJW A;  1EOV A;  3GTJ H;  4FP5 D;  1VQG A;  4LF8 Q;  1IKL A;  3I55 A;  3J81 j;  1FR3 A;  4ME5 A;  1UE1 A;  1CUK A;  3CME A;  4APV A;  2F0L A;  1WVL A;  2KCT A;  3P1H A;  1XPU A;  3KF6 A;  4QL5 A;  1F9R A;  2V4D A;  5C5M A;  1KTK A;  5JEA J;  4DF7 A;  1PHJ A;  5CBA E;  3BVM A;  3A5U A;  3T13 A;  1DON A;  3CQZ H;  3S2D H;  3U4Z A;  1D5M C;  1HZC A;  1A62 A;  1O7Y A;  3DEP A;  3K7A H;  4AYB E;  1Q3L A;  3HKZ E;  2DNE A;  4GN3 B;  2IT1 A;  1DOK A;  4A3B B;  3W2D A;  4UY8 C;  4DR6 Q;  4HJ7 A;  4HJ9 A;  5IGC A;  5M3M B;  3K58 A;  1VQ6 A;  1WCM G;  1O7Z A;  2F1M A;  1CKN A;  2D62 A;  2DY7 A;  1HXY D;  3D31 A;  4KMU C;  4DU9 A;  3I4O A;  1D8L A;  4Y7N B;  1PYW D;  1H9S A;  1CTM A;  4GLA C;  4BY1 G;  2WKC A;  1G2S A;  1VQJ A;  3EBE A;  1EY7 A;  3DXJ C;  1BOS A;  3MTS A;  1K0R A;  1WD1 A;  3OYY A;  3H0G G;  1BUV T;  2B8G A;  4RCN A;  1QJO A;  4KK7 A;  4JOI A;  5JOB A;  2ATW A;  1I94 Q;  5E1F A;  4RGO S;  4LFB Q;  2E5L Q;  3I2Z A;  3CRL C;  1U0L A;  2JA5 B;  1ZKO A;  1QOH A;  4JI1 L;  3CCM A;  3AMU A;  5C3X A;  1CFM A;  4LF4 Q;  1ZYR C;  4K8I A;  1TS3 A;  1X32 A;  4RHS A;  1MJC A;  3CC4 A;  2JN4 A;  1SNM A;  1SNQ A;  2B2T A;  1B9N A;  3MC0 B;  3G48 A;  2F0M A;  1GD7 A;  2Q8I B;  2F0S A;  1RTO A;  2K5V A;  4RGT A;  4GKK Q;  4DV0 Q;  5D65 A;  1E2V A;  2EJF C;  3CMA A;  3DLL A;  4AQY L;  5A2Q L;  2K7V A;  4KY5 A;  4L5S A;  4GS3 A;  1QE6 A;  2K05 A;  4EQO A;  3J81 c;  3S1R H;  1VMP A;  1F2L A;  3J7Z C;  3K80 C;  4F87 A;  5D3D A;  3OTO L;  1BCP B;  4ZUJ A;  3H3V H;  3A55 A;  2DJG C;  4R4C A;  4DN4 M;  4BY7 G;  4E6I A;  4CJ1 B;  1G6P A;  1BXT A;  2EIF A;  2NVQ H;  2ZJQ A;  1F9Q A;  2E74 C;  1TKW B;  1JOK A;  2Z9H A;  1PVO A;  2NN6 I;  1H9K A;  5IP7 G;  1SE2 A;  3SDZ A;  2AWO A;  1Y1W G;  1HQR D;  3GD7 A;  4LF5 L;  2KJX A;  4ID6 A;  4U67 3;  2N55 A;  5EAY A;  3KUP A;  3S15 H;  1BR9 A;  2ZXO A;  3KF8 A;  1N34 L;  3HEJ A;  4YIJ A;  1CI3 M;  2B2T C;  4K5W A;  1BCP C;  3NHH A;  5CV5 A;  1I5F A;  5FLX L;  1GUN A;  5L37 A;  1EU4 A;  1N36 L;  1QG7 A;  1VF5 C;  3SHL A;  4PV1 C;  3J81 E;  1JB7 A;  4BBS G;  1IBM Q;  1MIU A;  3J7A F;  2E2H H;  2PYK A;  3F2C A;  3FPP A;  4JBW A;  5J22 A;  2JA6 B;  1J6Q A;  3J7A 5;  1SMX A;  4LF7 L;  1QZH A;  2JJQ A;  1NSN S;  1UE5 A;  3CC7 A;  4FO2 A;  1NJI C;  1WOC A;  1ZYR D;  4GLX A;  3S1M H;  5GAG C;  4BXX G;  4J15 A;  3F2B A;  3UDX A;  2O4X A;  3J80 c;  2SEB D;  3BZD B;  3RZD H;  5C44 B;  4DAM A;  2IHE A;  2L4N A;  3CCR A;  1JC7 A;  5EKL A;  5FJ8 H;  2B2V C;  2SNM A;  3S16 H;  4IUT A;  4TQU S;  4P73 A;  5KEE A;  3AB9 A;  5G3L F;  2EE1 A;  1SYG A;  3U9S A;  2A68 C;  2FIN B;  1Q82 C;  2B2Y A;  1T5E A;  1IBK Q;  5FO8 B;  1PTO H;  1VCI A;  3FMC A;  3CXC A;  2F0E A;  2JA5 G;  4C3J G;  5EBD A;  2QF7 A;  1IBK L;  2WFW A;  4L5T A;  2F0V A;  1HR0 L;  2KEC A;  4B9W A;  2ZJP A;  1I4G A;  4WOR A;  2I46 A;  5IP7 H;  5DNF A;  2E8G A;  1JWU D;  3GTQ H;  2N78 A;  4A93 H;  2IX0 A;  4IPH A;  2B3G A;  1WTX A;  1STG A;  2A1A A;  1TS5 A;  2F0P A;  1LV9 A;  1PZI D;  5I6W A;  1TY0 A;  3L7Z C;  5J3B A;  3VYS A;  3H3V C;  4C3I B;  4A3I B;  1VQK A;  3RLN A;  2JA8 B;  2I5M X;  2D0P A;  4G7Z C;  1X6O A;  1VQ9 A;  3TN2 A;  2KUM A;  2CWA A;  3GO5 A;  3FRP B;  5EKK A;  2QA4 A;  2HCI A;  2OF1 A;  2B8F A;  4IZ8 A;  2CQO A;  1AH9 A;  1G6Z A;  3GTL B;  2EXD A;  3CCQ A;  4IOA A;  1YNN D;  3N6R A;  1S5D D;  3Q24 A;  3L3O C;  3NPP A;  1S5E D;  2N49 A;  3C1E A;  3TZD A;  4P74 A;  3PIP 3;  2NUC A;  2LMC B;  1EQT A;  4KD4 A;  4CKB A;  4NXM L;  1JJG A;  1KDA A;  2R7Z H;  3PO2 H;  3AEV A;  1L1O B;  1F2Z A;  4Z9C B;  1QCB D;  2X6L A;  4BXX H;  2NVX H;  1SYD A;  3PUW A;  1AZP A;  2Z6K C;  2HD3 A;  3MXP A;  3I4M G;  1CZG A;  3URY A;  1PH8 A;  5T1G A;  4LF9 L;  4GLV B;  1YIJ A;  2NWG A;  4DR5 Q;  5E4W C;  4DV2 Q;  4NPS A;  1A6X A;  2GVB A;  2QKI C;  4KKT A;  1WD0 A;  4MTN A;  3TEH B;  5IYD G;  4BWG B;  1CSP A;  4LFA Q;  2K5H A;  5JPN C;  1TY2 A;  3I90 A;  2EZV A;  1EY5 A;  2G9H D;  2NTS A;  3M4O B;  4HMJ A;  3F1Z A;  4DUZ Q;  4ZUI A;  3M4O H;  4IFD I;  3W1B A;  2DN8 A;  1I94 L;  2JA9 A;  3E0E A;  3A74 A;  2PQA B;  3VR6 A;  2BH2 A;  3EIV A;  2RA4 A;  3NEN A;  2CVR A;  1IYV A;  2NZH A;  2MP1 A;  3GTM H;  4OL7 A;  1EWI A;  5CBE E;  2IY5 B;  1K8O A;  1K73 C;  4R4Q A;  5C0X I;  3AFQ A;  4OIJ A;  4A3E G;  1I4R A;  4DR1 L;  1NNX A;  1ONL A;  3MEH A;  2OTL A;  3HOY G;  4DV3 Q;  2Q8T A;  2A69 D;  4X62 Q;  1J5E Q;  1CHP D;  3RLF A;  3RN2 A;  3PO2 B;  2R7Z B;  3R3O A;  5ELB A;  3E0J A;  5IGG A;  2JP1 A;  5ELC A;  1PH4 A;  1JJC B;  1JQY D;  1RF2 D;  1GOZ A;  4C1N K;  3MA2 B;  3CKI B;  4DV0 L;  1XXG A;  3GTL H;  1IHZ A;  3K5M A;  2Q2H A;  1SEB D;  4DR7 L;  5GQO A;  4A3M H;  4A3G G;  1U4R A;  4J6H A;  3HOZ G;  1B7Y B;  1TS2 A;  1HA5 A;  4KLK A;  3G6E A;  4QJF A;  1U9R A;  1VF7 A;  3HOZ H;  1EY6 A;  4LWC A;  4A3M G;  2BH8 A;  4A3I H;  4WRD A;  3L2P A;  1MHW C;  4C3I H;  2F52 A;  1ZXT A;  4OHJ A;  1NCV A;  3M4Y A;  4H13 C;  2K5D A;  1S5C D;  5I2Y A;  3OWE B;  3PUV A;  4DR2 Q;  3CCE A;  4A93 B;  5C5L A;  2E2J H;  5F2D A;  3HKS A;  1A3U A;  1I4X A;  2A5H A;  1VQ5 A;  1JCK B;  1EIH A;  1VDZ A;  1J9O A;  1H9J A;  2P5Z X;  4DV6 L;  4A3C H;  1Y1V H;  2XTI A;  3J80 E;  3LX0 A;  3C3L A;  1VQL A;  1AN8 A;  1PTO B;  1BF4 A;  1QVC A;  1AW7 A;  2MPM A;  1BDO A;  1LAC A;  2K6A A;  5HGQ A;  2PZU A;  5ELE A;  4L6T B;  4HED A;  3UE0 A;  3VYT A;  5FLX E;  4KV6 A;  4JI6 Q;  3LWU A;  4OGQ C;  1SFO B;  3NP8 A;  2VB2 X;  4HR7 B;  3S16 B;  1Q1E A;  2CWP A;  3EVQ A;  2C9O A;  5C44 H;  5BN4 A;  3RZD B;  2HHH L;  5G3L D;  3FP9 A;  5ELF A;  4OX9 Q;  1A3T A;  3KFU A;  3S1M B;  2HHH Q;  3RLO A;  5IT9 L;  1X65 A;  4ZKB B;  4LFC Q;  1RL2 A;  4IQZ A;  3G7L A;  2JA6 H;  1X3F A;  4DR4 L;  4ABN A;  3J81 i;  4YY3 Q;  3I3C A;  4ODG A;  4XT1 B;  5C4J B;  2IL8 A;  1XYI A;  4YCW A;  4DR4 Q;  1YNN C;  1MKH A;  3PCO B;  4JI0 Q;  3MXG A;  4DFA A;  1AEX A;  1STE A;  3KLS X;  2K1B A;  4A3K H;  4QGU A;  1UE7 A;  2ALY B;  5BN3 A;  4N8F A;  1KL9 A;  3HOX G;  4A3K G;  5CV4 A;  1A15 A;  4C3J B;  1SNP A;  1QB5 D;  1NE3 A;  2GA4 B;  3IFD A;  1ICF B;  1KAW A;  1FGB D;  1B44 D;  1FL0 A;  3D4W A;  2PW7 A;  1I4Q A;  4KY7 A;  2J4X A;  4DAV A;  1DGS A;  5COY A;  1KHI A;  4CKE A;  1HR0 Q;  1FD7 D;  1F9P A;  3VYR A;  4K0K L;  3GTP B;  1YHB A;  3HOX H;  2B63 G;  4B3M Q;  3G4S A;  3TP6 A;  5CMD A;  1L1O A;  1F9S A;  4MIU A;  1UWV A;  3H0G H;  2ZTE A;  1LTI D;  2GN5 A;  1I3Q B;  3UE1 A;  5FO9 B;  2UUA L;  1SSO A;  4DK6 C;  3IL8 A;  4JCV E;  1BBW A;  3RD4 A;  4KKS A;  3C2P A;  2K03 A;  1V9P A;  2A69 C;  3M7G A;  3AYH B;  5IOD A;  2F0K A;  1VQF A;  4DUY Q;  3TS0 A;  1HCZ A;  4TRD A;  2H4O A;  4BY7 B;  1EU3 A;  1RTN A;  4G57 A;  4IFD H;  2A73 B;  1YI2 A;  4GNX C;  3V96 A;  5IY0 A;  4QUC A;  4MZ9 A;  1XTC D;  2I5L X;  2E5L L;  5C3W A;  3BDO A;  3TSS A;  4AYB G;  4DAP A;  5CV7 A;  4RFB A;  2EY6 A;  4QB4 A;  5NUC A;  1HA6 A;  3OWF A;  5AFW A;  1PH1 A;  3JAM c;  1NAP A;  1BBU A;  3ZYY X;  4PZ8 A;  2XN9 C;  2MFI A;  2ZT9 C;  5KNC A;  4RGM A;  2DNC A;  2B2U C;  5FKA C;  2EYJ A;  3PO3 B;  2O5I C;  3AQQ A;  3CPF A;  1B9M A;  4JI4 L;  2AQ2 B;  4KHP L;  1F77 A;  2F0H A;  4WJW A;  1ENF A;  1I4P A;  3WWV A;  5I9O A;  3K59 A;  4AQY Q;  1S72 A;  2A6E D;  1L0W A;  1G91 A;  1EFW A;  4JI2 Q;  5JPM C;  2RF4 A;  3DM3 A;  1PFM A;  1TT2 A;  4LF9 Q;  2GVA A;  4DXG A;  2RSO A;  1AP0 A;  2R93 H;  3V05 A;  1C7Y A;  4FF4 A;  5FLX c;  1FNU A;  5EPK A;  4G4K A;  3AFP A;  1I6H B;  3HG9 A;  1KDC A;  4FDB A;  3OW7 A;  4DV1 Q;  2DJF C;  2MNA A;  2AHO B;  4A3B H;  1E2Z A;  3ER0 A;  3STB D;  1WTQ A;  3K7A B;  3W5O A;  3ERS X;  4JI7 Q;  1TR5 A;  3CQZ B;  2QCP X;  3I72 A;  5FK9 C;  3KBG A;  5J39 A;  4YWK A;  1KC8 C;  3EA6 A;  5CV6 A;  4DR1 Q;  1L1O C;  4XDX A;  4LMQ D;  4A3J H;  4X62 L;  3SXH A;  1O7L A;  1A0I A;  2WAQ B;  1SDF A;  1JWS D;  1MI2 A;  2KCM A;  2DGY A;  1S5F D;  1V43 A;  4DV7 L;  1VQO A;  2A19 A;  2FMM A;  4IPD A;  4DR3 L;  1J8I A;  1QIL A;  1Z47 A;  3IKJ A;  2NTT A;  2HIX A;  1QNU A;  3J81 L;  1YHA A;  2IX3 A;  2CW0 D;  1EQV A;  1BNZ A;  4JI8 L;  2K32 A;  4C3H H;  3GV6 A;  1M1K C;  2K52 A;  4A3L H;  5IIF A;  3J7A V;  4LF8 L;  3TRE A;  1YHQ A;  5D3I B;  3S9W A;  2JK8 A;  5HGT A;  4I65 A;  1NBW A;  1P16 A;  5DEH A;  4X6A H;  3ITP A;  2VXW A;  4J1M A;  4PZ7 A;  4KD3 A;  4LUV A;  2V1C C;  2VW9 A;  2DUD A;  2Z1C A;  2UXC L;  1EOT A;  5M5Y B;  2EYP A;  3ULP A;  3HOU B;  4UHV A;  1B4O A;  1LM0 A;  1JIC A;  1KNE A;  2L5T A;  2LSS A;  1SYB A;  1N32 L;  1GHJ A;  5EPJ A;  4HIK A;  2A8V A;  3GTK B;  1TWC B;  2CKZ B;  3NTH A;  5LL6 S;  1SND A;  3TDQ A;  4B3S L;  4GOP A;  2WAQ G;  3R2T A;  1EZ6 A;  1G51 A;  1C48 A;  1LYL A;  4OX9 L;  2YU9 B;  4X66 Q;  3HGB A;  2M00 A;  3GTK H;  2CCZ A;  3ERO A;  4X66 L;  1UEA B;  2AKW B;  2NN6 H;  3R8B A;  2IWH A;  1IW7 D;  5KYL A;  1VQN A;  3H15 A;  4HSV A;  2NVY H;  4NXM Q;  3M4Q A;  4CDC C;  5M5Y H;  1C4Q A;  3KJP A;  4KY6 A;  1EWC A;  5I2X A;  5IOC A;  1D5Z C;  1X3E A;  3FHW A;  4RKL A;  4UP9 A;  1Y69 U;  2UXB Q;  4I7Z C;  1WJJ A;  4IFD G;  5ISR A;  4IPG A;  1B1Z A;  2L12 A;  4HIO A;  2VQF L;  4LF7 Q;  1M4V A;  2OT2 A;  3U58 A;  3SK8 A;  2F4V L;  4C3H B;  4EGV A;  4ZQ3 A;  4MNO A;  3FVQ A;  4GKK L;  3PV0 A;  1SYF A;  3G6J B;  2L15 A;  1HUM A;  2WB1 E;  1V1P B;  1SN8 A;  4XYQ A;  3NTI A;  1A3V A;  1YVC A;  1STB A;  2VB3 X;  1Q8I A;  2RDH A;  5CYU A;  1K9M C;  2E2I B;  4A3J B;  5IYD H;  2VY3 A;  1FNV A;  2K04 A;  2JA7 B;  1PH7 A;  1Q90 A;  4JV5 Q;  5IWA Q;  2PQA A;  2ZXR A;  4DR2 L;  4PZ6 A;  4CKC A;  2A68 D;  3CCL A;  1VQM A;  2M9V A;  3NQI A;  4IUP A;  2MJ8 A;  2QGQ A;  5JJK A;  1ET9 A;  5JAV A;  4O2D A;  3S14 B;  2OQK A;  3BJU A;  1LTR D;  5CC4 A;  3I56 A;  2UUA Q;  1X54 A;  1IBL Q;  3HOW B;  1I6H H;  2O2L D;  1FVI A;  2R93 B;  1Y8N B;  4QF4 A;  2JQO A;  4X64 L;  4RGN A;  1JT8 A;  1EUJ A;  4JG2 A;  1IBL L;  3PSI A;  2I5H A;  1BKB A;  4JBM A;  1HQM C;  4KJN A;  3S17 H;  1ENA A;  3BYY B;  5BR8 L;  2K5W A;  4LF4 L;  3SK5 A;  3GDE A;  2A6H C;  1JR0 D;  1E1T A;  4A3G B;  2ENB A;  2K5Q A;  4B3R L;  2KEE A;  1CA6 A;  1CT1 D;  1PXU A;  2VS1 A;  1FJG L;  1EFI D;  3PO3 H;  1QVG A;  5LHY 1;  4JI8 Q;  1CKN B;  1E2W A;  2OQ0 A;  4A3F H;  3QR8 A;  1V1Q A;  3LNN A;  3A8I E;  1U4L A;  2I0Q A;  1W6K A;  3KF8 B;  1U4P A;  4A75 A;  1F2Y A;  1Z7T A;  1Q46 A;  2B29 A;  5C0X G;  4IUV A;  1K8G A;  5K36 G;  1W6J A;  2ZTC A;  2B2V A;  3M3Y H;  4IUQ A;  5KIX A;  3PIO 3;  4KHP Q;  4DV6 Q;  5JVG 3;  1R9T H;  3PUY A;  1UEB A;  1Y14 B;  4JI2 L;  4BY7 H;  1OXV A;  2YTX A;  2MO1 A;  1RCV D;  3GTO B;  1G8Z D;  3PF5 A;  3X3N A;  4EQ5 A;  4A3C G;  3DUZ A;  2KVM A;  2ZJR A;  3U50 C;  4JBK A;  5LMN Q;  1I3Q H;  1GXD C;  3H0G B;  1C8C A;  1CZW A;  5C4H A;  1AE3 A;  2ZM6 Q;  4X65 L;  4CBV A;  3R2I A;  4H7B A;  4GNX B;  5BN5 A;  3I70 A;  1F2M A;  3JC6 6;  3HOX B;  2Y0S G;  1CSQ A;  3GTP H;  4LFB L;  3BZK A;  1VQD A;  2EYF A;  2HDM A;  1LAB A;  1HUN A;  1PRT B;  3MXU A;  3MAQ A;  2R92 B;  4Y52 H;  1VQ8 A;  3P7J A;  1SNC A;  4GN4 B;  4IJL A;  5EBC A;  1B3Q A;  4RAU C;  2C35 B;  3E5S A;  3T16 A;  2HDL A;  3CCU A;  1IW7 C;  2R7D A;  4MHE A;  4POG A;  1OTC A;  2QDL A;  3H91 A;  4C3J H;  1J5E L;  4LUZ A;  3QB3 A;  2QDB A;  2KCN A;  3T1H L;  1Y8P B;  2XRQ D;  2CFM A;  3BVG A;  1B8A A;  1QUQ A;  3X3M A;  3A54 A;  2QEX A;  1EIF A;  3DM1 A;  4A3K B;  4JI5 L;  1W3S A;  3HP3 A;  2SOB A;  4JOI C;  4NMZ A;  3CCS A;  4B3T L;  5C6A A;  1VQI A;  4BBS B;  4UP7 A;  4A93 G;  5C4J H;  1ICW A;  1PRT D;  2RCN A;  3K5L A;  2AMC B;  4PMC A;  4IJH A;  3IAY A;  1XWE A;  1JOQ A;  4K5V A;  4G7H C;  1QNK A;  1SAP A;  1V1P A;  2OWO A;  1UE6 A;  3F2U A;  4DNT B;  2KED A;  4L63 B;  5CGK A;  4JYA Q;  3QG1 A;  2B63 H;  4CDF C;  3OSO A;  1SE3 A;  1K8M A;  1R4P B;  3K57 A;  4X3S A;  4H0L C;  3U9O A;  2R93 G;  1OO9 B;  3K0Y A;  1D2B A;  4ALP A;  2E75 C;  2NVT H;  1KLG D;  1VQE A;  1HFG A;  4PG3 A;  2K4K A;  1SFO H;  1WTP A;  2E2D C;  2N8N A;  5FJ8 G;  2F0Q A;  1PH6 A;  3CW2 C;  3G71 A;  3K0X A;  1IYU A;  4YHH L;  3I4L A;  4QCL A;  4XQJ A;  1D1I A;  3C46 A;  3RN5 A;  2PI2 A;  3MVV A;  1N34 Q;  2VL6 A;  1Y1V B;  1B2T A;  1Y1W H;  3ERQ A;  1O7I A;  3TP5 A;  1N36 Q;  3A56 A;  3HOU G;  2BDN A;  1N8R C;  1UNS A;  3WDN A;  1PH9 A;  1LUZ A;  5D14 A;  1HZ9 A;  4JI6 L;  2E2J B;  4CGY B;  4JI3 L;  1DM0 B;  1Z6H A;  3GTG H;  1YJ9 A;  3SEB A;  5HUR A;  3NQT A;  1X3G A;  3PIO A;  1SYC A;  3BU2 A;  2EYO A;  2KHI A;  4JI4 Q;  3HOZ B;  5DLQ E;  2L9H A;  4YY3 L;  1E22 A;  1TXY A;  4HTH A;  4OO1 I;  4A3M B;  1E3P A;  2FJ2 A;  3I4N H;  4DNR B;  1YJN A;  1PYB A;  3H94 A;  4HAE A;  1ENC A;  5KNB A;  2A74 C;  1GUW A;  2CW0 C;  1JE5 A;  4K8J A;  5M3F H;  2F3W A;  4DKA C;  4UPA A;  3C1F A;  3S1Q H;  2NB0 A;  4FF3 A;  4A3B G;  2BE5 C;  2K14 A;  2JSO A;  2Y0S B;  4ZK9 B;  4HCS A;  1WTR A;  1ILQ A;  2RVL A;  1N33 L;  1FGU A;  2BCO A;  1PLF A;  4JI7 L;  3BDC A;  3QOJ A;  2FMC A;  3D8G A;  3ONA B;  2F3V A;  2Z4H A;  3HOV G;  2EYH A;  1LT5 D;  2J0T D;  3GTM B;  1UAP A;  4NW2 A;  1TII D;  4K0K Q;  1Y8O B;  1U5K A;  1S4Z A;  3NBH B;  1D7Q A;  1SE4 A;  3UDF A;  3QO2 A;  2E76 C;  1DCZ A;  4N9T A;  3W1G A;  5M3M G;  5E7N A;  3RR5 A;  4NXN L;  4OO1 G;  2R7Z G;  3PO2 G;  1KIX A;  2VUM H;  4BS9 A;  4IUN A;  1QVF A;  4BBR H;  1YNX A;  2FXQ A;  2JA7 G;  5LL6 X;  5DM7 3;  2IX1 A;  2D5D A;  3DWP A;  3D6W A;  2F0I A;  3PF4 A;  2LXK A;  1PH5 A;  3DMU A;  4M8A A;  1STN A;  4K2K A;  4GN5 A;  4C2M H;  3BZC A;  4A3F G;  2CHB D;  4KJO A;  1Q8K A;  5JVH 3;  5A35 A;  2NVX B;  3T53 B;  5AJ3 L;  5M5W B;  3HKZ G;  1OXT A;  1FNW A;  3A0J A;  4R8N A;  1HHV A;  5ELO A;  1XPO A;  4JI0 L;  1SXT A;  2XVS A;  2Z6K A;  1O80 A;  2EJM A;  1BVS A;  2NN6 G;  5T1I A;  5EKI A;  1EZ8 A;  3WOE A;  4CDD C;  4UAI A;  1EYD A;  1N33 Q;  2JA8 H;  2R7F A;  4OEM B;  4QMG A;  1Y1V G;  4EX5 A;  1KXL A;  1STH A;  1LTS D;  3TRZ A;  3OMC A;  3MZ5 A;  3D0F A;  3VR3 A;  3TP7 A;  5C4Z A;  1I50 H;  2PNR C;  3J7Y W;  3NE5 B;  3GTQ B;  5M5X B;  2IPK D;  3DHQ A;  4DUZ L;  2VNU D;  4OWW B;  4HJ8 A;  4R4O A;  5C0X J;  1I6V C;  4FF1 A;  1MBY A;  4QIW B;  1EQQ A;  2ZXP A;  4ZAI A;  4C3I G;  1B53 A;  4EQP A;  5GRO A;  3J80 i;  4RG1 A;  2N88 A;  4XQN A;  3M9B A;  3D3R A;  2G5D A;  1BCP F;  1G2T A;  5COR A;  2ES2 A;  2LKV A;  3K7U C;  3MFG A;  2H1E A;  1AFP A;  2VQF Q;  2AUK A;  2K33 A;  1K3B C;  1X3Q A;  3SVM A;  4JC0 A;  3EFX D;  1GUT A;  3DWQ A;  3MEF A;  1YEZ A;  1PRT F;  1GUO A;  1VQC A;  1D1K A;  1IXR A;  4XTC S;  4LAA A;  1T9H A;  1HJP A;  2A6H D;  2G9D A;  4DR3 Q;  1HTL D;  1CQV A;  1XNQ Q;  1GO3 E;  5JJL A;  3SGI A;  3HOY H;  3ZJY C;  4ZLT F;  2EOT A;  2YYZ A;  2Z4I A;  3PUZ A;  1Q7Y C;  4JK1 C;  1FYC A;  3K5O A;  4B3R Q;  3U4V A;  3IRB A;  3NSW A;  4X3T A;  1Q12 A;  2E2H B;  3FPU B;  3QOL A;  1VQB A;  2D2C C;  2QEJ C;  4NB3 A;  4F7X A;  2BA1 A;  2ICE C;  4K5X A;  1EWH A;  4R8I A;  1PRT C;  1WCM H;  1EY0 A;  3S15 B;  2TMP A;  3TS2 A;  3FKI B;  3OW2 A;  3BYT B;  3I91 A;  1STY A;  3NTK A;  4IFD J;  5DAU A;  2BDO A;  2TSS A;  4A4I A;  1VQH A;  2F0N A;  1PYS B;  4ZYS A;  4DR5 L;  2L1B A;  5M9O A;  4DV1 L;  1DOL A;  4EQN A;  1MJE A;  3Q6S A;  3CCJ A;  1LTT D;  2NVQ B;  4GOP C;  1IKM A;  1TS4 A;  3KJO A;  2L11 A;  3F2D A;  1C0A A;  1Q81 C;  3GQB A;  2JE6 I;  4K14 A;  3CC2 A;  3FDT A;  3CF5 A;  1L0X B;  3Q22 A;  4OXP A;  5HY6 A;  1AZQ A;  2AUJ D;  2UUB L;  2RKS A;  4OON A;  5C0X H;  1EYC A;  4JVZ A;  5TSS A;  4BY1 B;  1X55 A;  2MHV A;  2HT1 A;  1TU2 B;  5IGF A;  3S1R B;  1XX8 A;  1VMC A;  2KHJ A;  4Q0F A;  5DM6 3;  1HNX Q;  1YZ6 A;  3BVZ A;  5IYC G;  2UXB L;  5LMN W;  1NR2 A;  4IPC A;  1IBM L;  3VA5 A;  4JI3 Q;  2XGT A;  4LK1 C;  4DXF A;  2NZ1 D;  3WOF A;  4YWL A;  1BCP D;  1SJH D;  4V0B A;  1SJE D;  3KOJ A;  1AE2 A;  2Z6B A;  5IT9 c;  2F4V Q;  3TBI B;  4L5Q A;  5J1Z A;  2IW3 A;  3HRZ C;  4BY1 H;  3NEL A;  1SYE A;  2IHF A;  2ZM6 L;  5K5P A;  1KAB A;  1R4Q B;  4KHV A;  4DR7 Q;  2JA5 H;  2QIL A;  3NEM A;  1LTL A;  1E7Z A;  1PFS A;  3HOW G;  2WKD A;  3KBX A;  1N9W A;  1LTB D;  4JYA L;  2ZTD A;  5ELN A;  2UXD L;  2WB1 B;  1M90 C;  1N32 Q;  2F03 A;  2UU9 L;  5E3F A;  2UXD Q;  2HQL A;  4O0A A;  5IP9 G;  3UI2 A;  4XIG S;  4DK0 A;  1OXU A;  3B6Y A;  4U68 A;  4Y7N H;  3A8K E;  4CHT B;  4HJ5 A;  4K6L A;  4NXN Q;  4OO1 H;  2Q2U A;  5M3M H;  3FKI H;  4ZRZ A;  4LF6 L;  4KHZ A;  3FKI G;  4DV4 L;  3SK6 A;  1WCM B;  1O78 A;  3NWS A;  1ASY A;  1T5X D;  3MFY A;  3NBH A;  2ASB A;  3Q23 A;  3S2D B;  3STB C;  5A2Q E;  1KRT A;  1A63 A;  4P71 A;  5C3E G;  4IAL A;  1BBX C;  5IGE A;  1HPC A;  3CD6 A;  4DPG A;  3OOC A;  2JA6 G;  3ICE A;  4L8J A;  5BR8 Q;  4DV5 Q;  2UUC Q;  4JBJ A;  2KHS A;  4HIM A;  1L2F A;  1YBY A;  3HOY B;  2YV5 A;  3DWA A;  1GKH A;  3GTJ B;  2K75 A;  1DZ1 A;  2PW5 A;  3NBI A;  5GAE C;  1HFN A;  4MN3 A;  3I73 A;  4XQQ A;  5IGD A;  3S24 A;  1HNW Q;  1TWH B;  4B08 A;  4A3L G;  4FVM A;  1EEF D;  2EY5 A;  4GKJ L;  1ROD A;  1HTP A;  1VQ7 A;  2RSN A;  4QY7 A;  2PI2 E;  1GUG A;  2EPB A;  5KND A;  4WJ4 A;  3TQY A;  1XPR A;  3I4N G;  1OXS C;  3I8Z A;  4UDU C;  5ELD A;  2WIN B;  1NY4 A;  4LFA L;  4A3J G;  3Q8D A;  3ULL A;  2F0D A;  2MO0 A;  2PCF B;  1LT6 D;  5IT9 E;  4OEL B;  4RH6 A;  1D6E C;  5M5X H;  5JEA H;  1KQS A;  2HCC A;  4HCE A;  3O13 A;  3I4M H;  5FLM G;  5C3E H;  3H09 A;  1CHQ D;  3KDF B;  1I50 B;  4IN3 A;  3J80 L;  1SR3 A;  3NUC A;  3QJY A;  1ESR A;  5IE8 A;  2WB1 G;  1XNQ L;  2Q2I A;  2JEA I;  1TWG H;  1DOM A;  2I07 B;  4XT3 B;  1TWF H;  1A8V A;  3RZO H;  1NTG A;  1MSH A;  1UUP A;  4KN7 C;  2WP8 J;  3HFZ B;  2JYO A;  3KLW A;  5JEA G;  1W2B A;  3HOV H;  1FJG Q;  2EXZ A;  2KEN A;  4DA2 A;  5EQ0 A;  4JI5 Q;  2BA0 A;  3HS0 C;  1HH2 P;  1JE4 A;  4DNI A;  4K2L A;  1DD2 A;  5I9P A;  5M5W H;  1GUS A;  3T1H Q;  3H3V I;  3T51 B;  3T1Y L;  2F4I A;  2O5J C;  1XMO L;  1DJR D;  4C2M B;  1HNW L;  4A3E H;  2LS0 1;  1B70 B;  1SNO A;  4NP5 A;  1XMO Q;  2ICI A;  1DXM A;  3CU7 A;  5C4X H;  3S1N B;  2L55 A;  1PH2 A;  5K36 H;  4BBR B;  3VA7 A;  2UXC Q;  1EL0 A;  1MSG A;  2VUM B;  4EVO A;  4DAY A;  4KN4 C;  4TSS A;  2Q2T A;  2FHT A;  3E3X A;  3Q0A A;  1K28 A;  2F0G A;  2YTV A;  1ET6 A;  4DR6 L;  3GV3 A;  4LNQ A;  1SLJ A;  5IWA L;  1VS0 A;  1WTH A;  1HNZ Q;  1SE8 A;  2OXP A;  2PMZ E;  1NMF A;  1PV4 A;  1RD9 D;  1PFN A;  2F0T A;  2PZW A;  3BG3 A;  2EVB A;  1TWA B;  5H1S E;  1LLR D;  4LF5 Q;  4NKL A;  3A5Z B;  4CJ2 C;  2KQ3 A;  2KOL A;  4X64 Q;  1LTG D;  1PDQ A;  4IOC A;  3VYU A;  4F88 A;  3UDG A;  1HRJ A;  2RHQ B;  5AJ3 Q;  1M8A A;  2F0J A;  5FO7 B;  3SE0 A;  4A3D G;  4ME3 A;  4XYO A;  3M7N A;  3RUZ A;  4KTA A;  2K5N A;  4R1J A;  1H9R A;  4PNY A;  4X3U A;  3VDY A;  3HZX A;  5FLM H;  3S1Q B;  4O1N A;  1E1O A;  1XNR L;  2F0O A;  5M3F B;  3PQI A;  4DV3 L;  3A8J E;  3SK4 A;  4S3S A;  2EDG A;  1B50 A;  2Z8L A;  3I4N B;  4A3D H;  1ML0 D;  5KYI A;  5KRU A;  3T1Y Q;  4PMW A;  5I6Y A;  4WFN 3;  3JAM i;  3SR1 A;  4GKJ Q;  3E9H A;  1LT3 D;  2CH4 A;  2J7Z A;  1NMG A;  4PQX A;  1BQQ T;  3GTG B;  3TP8 A;  1K83 B;  3OIP A;  4GOP B;  2NBF A;  2SNS A;  1JWM D;  2PPB C;  4L5R C;  1EY9 A;  3BS1 A;  4CDE C;  4F8M A;  3V2T A;  1PH3 A;  2EQS A;  3NWT A;  3VR5 A;  4FXG C;  4DV2 L;  1Y1W B;  4IUU A;  3F8T A;  1HNZ L;  4POF A;  2X6G A;  3S2H B;  3PO3 G;  1IYJ B;  3T56 B;  1VQ4 A;  2R6G A;  2D9U A;  4FF2 A;  3IFT A;  4X65 Q;  3MWY W;  1Q86 C;  1EEI D;  1G29 1;  1EIY B;  3I7F A;  5IYB G;  1SBB B;  1TQO A;  3TME A;  2AWN A;  4ZKC B;  4O42 A;  1EYA A;  1JJ2 A;  5CR3 A;  4OIK A;  5CV9 A;  4YCU A;  2NVT B;  2Z0S A;  1Z9F A;  2RBM A;  2EY1 A;  1QUQ B;  1YNJ D;  4YWM A;  2WV6 D;  1SMY D;  1CKM A;  4ILW A;  3AU7 A;  2B63 B;  2MQH A;  1JB3 A;  2WAQ E;  5GAD C;  2Y0S E;  2EY2 A;  2LY7 A;  2SDF A;  3TZU A;  1YNJ C;  2EYM A;  5JJZ A;  1P8L A;  4DUY L;  2R61 A;  1JOR A;  1HR0 W;  4MTK A;  1X56 A;  1RIP A;  1Q1B A;  3JAM E;  1TVX A;  4BBS H;  4X3K A;  1EYG A;  5LMU Q;  4Q5V A;  4A3I G;  3KDF A;  3MXN B;  1KLU D;  1X3P A;  1PFB A;  1WI5 A;  2KBN A;  4R4T A;  1S5B D;  3HKZ B;  4AYB B;  3VR4 A;  1RHP A;  2XRS D;  2C5C A;  3KLS A;  5IP9 H;  3FEW X;  5LMN L;  2NZO A;  4P72 A;  1VQP A;  4LUO A;  3QIA A;  4HJA A;  4B3S Q;  2R92 H;  3E9I A;  3CP0 A;  1PMR A;  1JMC A;  4TKO B;  2WII B;  1H9S B;  4BA2 I;  2DY8 A;  3CCV A;  1PZJ D;  1V1O A;  2OCE A;  4I7A A;  1PTO F;  4QIW E;  3MXN A;  2UUB Q;  2BOS A;  1C9O A;  2F3I A;  5EPL A;  2R92 G;  2WAC A;  4LJZ C;  3M85 A;  2XWB B;  2F0U A;  1CK1 A;  1LT4 D;  1MD2 D;  2UU9 Q;  4LW1 A;  1CQF A;  4BBR G;  1XTD A;  2PMZ B;  4DK3 C;  3GTO H;  1PTO C;  2RDF A;  4KKU A;  1IZ6 A;  1SRO A;  3S2H H;  1NUC A;  3ULJ A;  1VQA A;  2LFN A;  1PA6 A;  1R9T B;  3LWE A;  4N8X 1;  4LF6 Q;  2RCF A;  3OIQ A;  1E0B A;  1XMQ Q;  3BDL A;  1PTO D;  2RHS B;  2M2L A;  5IYC H;  2VZA A;  4B3T Q;  4AIM A;  5IGB A;  2QW7 A;  1U4M A;  4JPB W;  4TVA B;  3CAM A;  3L0O A;  4DGZ A;  1XMQ L;  4RMF A;  3M3Y B;  1RJT A;  1K83 H;  5E4X A;  1IL8 A;  1RKN A;  3OHX C;  1ESF A;  3PMF A;  1HZA A;  3M4P A;  4A3F B;  4CJ0 B;  4NDX A;  1KAA A;  3CHB D;  4HMI A;  1K3R A;  1L0Y B;  1EIG A;  3H6M A;  1EQR A;  4DV7 Q;  4DV5 L;  2UUC L;  2HQE A;  4RA8 A;  1ILP A;  4A3G H;  2AQ3 B;  1H9M A;  4HN7 A;  4DK1 A;  4P75 A;  4A3D B;  1GVP A;  2VQE Q;  4ULL A;  1WTV A;  1HZB A;  4JV5 L;  1GHK A;  3DEO A;  3E6Z X;  2N3S A;  2MGS A;  3S17 B;  3KF6 B;  4C1N I;  2A6E C;  3OMG A;  4RCO A;  4P2C B;  1GM5 A;  1MGS A;  5IYB H;  2B2Y C;  2PQE A;  2XSC A;  5JJI A;  5I4D A;  3EN2 A;  2K28 A;  3NK9 A;  2L0C A;  3JAM L;  2YTY A;  4XXE A;  4YHH Q;  2CQA A;  3P20 A;  1ZEQ X;  3HOW H;  3D4D A;  2XIW A;  4QUF A;  4DV4 Q;  1KDB A;  2EJG C;  4UP8 A;  2BE5 D;  1XJV A;  1PZK D;  3PGZ A;  3S14 H;  2EYL A;  4DAY B;  3OTO Q;  1K8A C;  3D6C A; 
#chains in the Genus database with same CATH homology
 2I0Q A;  3KF8 B;  4A3E G;  2HIV A;  4A75 A;  4DR7 Q;  1TWA H;  2JA5 H;  4DR1 L;  3NEM A;  2OTL A;  1LTL A;  3HOY G;  1Q46 A;  2B29 A;  5C0X G;  1K8G A;  1E7Z A;  1PFS A;  2ZTC A;  3HOW G;  4DV3 Q;  3M3Y H;  5K36 G;  2JA7 H;  1N9W A;  4X62 Q;  1J5E Q;  2VUM G;  2ZTD A;  5ELN A;  3RLF A;  3RN2 A;  4JYA L;  2UXD L;  4KHP Q;  1M90 C;  4DV6 Q;  1N32 Q;  2E2I H;  1PH4 A;  2UU9 L;  1JJC B;  1R9T H;  2UXD Q;  3PUY A;  1UEB A;  2HQL A;  4O0A A;  4QQB X;  1Y14 B;  5IP9 G;  4XIG S;  4DV0 L;  4JI2 L;  4BY7 H;  1OXU A;  3CPW A;  1OXV A;  3B6Y A;  4LFC L;  2JEB I;  2YTX A;  2MO1 A;  4Y7N H;  2Q2H A;  3GTL H;  4HJ5 A;  4DR7 L;  5GQO A;  4A3M H;  3PF5 A;  4EQ5 A;  4NXN Q;  4A3G G;  4OWT B;  3K8A A;  2Q2U A;  5M3M H;  3FKI H;  3HOZ G;  1B7Y B;  4LF6 L;  4A3C G;  4KLK A;  4KHZ A;  3FKI G;  4QJF A;  3G6E A;  4DV4 L;  2ZJR A;  3U50 C;  3HOZ H;  1WYD A;  4LWC A;  3S1N H;  4GNX A;  4JI1 Q;  2BH8 A;  5LMN Q;  3L2P A;  4A3I H;  4A3M G;  4C3I H;  1I3Q H;  2F52 A;  1ASY A;  1H95 A;  2ASB A;  4IO9 A;  1XNR Q;  1AE3 A;  2ZM6 Q;  3STB C;  4X65 L;  1KRT A;  1A63 A;  3PUV A;  4GNX B;  4DR2 Q;  3KYH C;  4P71 A;  4H02 A;  3JC6 6;  5C3E G;  3CCE A;  5GAH C;  2Y0S G;  2E2J H;  1CSQ A;  1E24 A;  3GTP H;  3HKS A;  2ID0 A;  4LFB L;  3BZK A;  3CD6 A;  1VQD A;  2VQE L;  1VQ5 A;  4DPG A;  1S40 A;  1SRU A;  2JA6 G;  3ICE A;  4AH6 A;  5BR8 Q;  4DV5 Q;  4DV6 L;  3PUX A;  2UUC Q;  4A3C H;  4JBJ A;  4Y52 H;  1Y1V H;  4HIM A;  1VQ8 A;  2XTI A;  5M3F G;  3K81 C;  4IJL A;  4GN4 B;  1L2F A;  1YBY A;  2K50 A;  1YIT A;  1VQL A;  2YV5 A;  2C35 B;  1GKH A;  1QVC A;  3CCU A;  2K75 A;  1YJW A;  2R7D A;  4R4I A;  5GAE C;  1ASZ A;  4POG A;  5HGQ A;  1OTC A;  4C3J H;  1J5E L;  4LUZ A;  1WFQ A;  3UE0 A;  2YU9 H;  1OXX K;  4A76 A;  3T1H L;  1QZG A;  4JI6 Q;  3S24 A;  1HNW Q;  2CFM A;  4A3L G;  1B8A A;  1QUQ A;  2PNH A;  4GKJ L;  1S3O A;  2QEX A;  3RNU A;  1EIF A;  4HID A;  2JA8 G;  2H5X A;  4JI5 L;  1Q1E A;  3LGJ A;  2CWP A;  1W3S A;  1IL2 A;  1VQ7 A;  4QY7 A;  1TWC H;  4JOI C;  2PI2 E;  2OTJ A;  4WJ4 A;  5C44 H;  3CCS A;  4B3T L;  3TQY A;  1VQI A;  2D0O A;  1OXS C;  4UP7 A;  5C44 G;  1XPR A;  2HHH L;  4BA1 I;  3FP9 A;  5C4J H;  3I4N G;  4A93 G;  4B3M L;  4OWX B;  4OX9 Q;  2RCN A;  1CKO A;  2AMC B;  3KFU A;  4IJH A;  2HHH Q;  5C4X G;  3RLO A;  1NY4 A;  1X65 A;  4YCV A;  3HOU H;  4LFC Q;  1RL2 A;  1UE6 A;  2OWO A;  1KD1 C;  4LFA L;  4A3J G;  3Q8D A;  3ULL A;  3UDI A;  2JA6 H;  1KRS A;  4JYA Q;  1X3F A;  2MO0 A;  4DR4 L;  3J81 i;  4YY3 Q;  5M5X H;  1KQS A;  4KI0 A;  2B63 H;  5LMU L;  3I4M H;  5FLM G;  4DR4 Q;  5C3E H;  4YCW A;  1MKH A;  3KDF B;  3PCO B;  4JI0 Q;  2R93 G;  1HNX L;  4ALP A;  2NVT H;  4A3K H;  1SR3 A;  1VQE A;  4QGU A;  3PIP A;  1UE7 A;  2ALY B;  2K4K A;  4PG3 A;  1SFO H;  5IE8 A;  1TWH H;  2WB1 G;  1KL9 A;  2N8N A;  5FJ8 G;  3HOX G;  1XNQ L;  2LXJ A;  2Q2I A;  4A3K G;  2JEA I;  4WJ3 M;  1TWG H;  1PH6 A;  3CW2 C;  3G71 A;  3K0X A;  4YHH L;  1NE3 A;  1TWF H;  1X9N A;  1KAW A;  1A8V A;  1EOV A;  3GTJ H;  3RZO H;  1NTG A;  1VQG A;  4LF8 Q;  3I55 A;  2WP8 J;  3HFZ B;  3KLW A;  2PI2 A;  5JEA G;  1FL0 A;  3RN5 A;  3J81 j;  1N34 Q;  1W2B A;  3HOV H;  2VL6 A;  1UE1 A;  1CUK A;  3CME A;  1Y1W H;  1FJG Q;  1O7I A;  2KEN A;  4APV A;  1DGS A;  1KHI A;  1N36 Q;  3HOU G;  2KCT A;  2BA0 A;  1HR0 Q;  4JI5 Q;  1HH2 P;  1XPU A;  3KF6 A;  4QL5 A;  4DNI A;  1N8R C;  1PH9 A;  4K0K L;  1LUZ A;  5M5W H;  1HZ9 A;  5JEA J;  3T1H Q;  1YHB A;  1PHJ A;  3HOX H;  4JI6 L;  3A5U A;  2B63 G;  4B3M Q;  3H3V I;  3T1Y L;  3G4S A;  1XMO L;  4JI3 L;  3CQZ H;  1L1O A;  3GTG H;  1HNW L;  1YJ9 A;  4A3E H;  3S2D H;  1X3G A;  1UWV A;  1B70 B;  3H0G H;  3U4Z A;  3PIO A;  2ZTE A;  1HZC A;  1A62 A;  3K7A H;  3BU2 A;  4AYB E;  1XMO Q;  3HKZ E;  2GN5 A;  4GN3 B;  3UE1 A;  2IT1 A;  5C4X H;  2KHI A;  1PH2 A;  2UUA L;  4JI4 Q;  4UY8 C;  4DR6 Q;  4HJ7 A;  4DK6 C;  5DLQ E;  4HJ9 A;  4JCV E;  4YY3 L;  1E22 A;  1VQ6 A;  1TXY A;  4OO1 I;  2UXC Q;  1BBW A;  1WCM G;  1CKN A;  1E3P A;  2D62 A;  3D31 A;  3I4N H;  1V9P A;  4DUY Q;  3TS0 A;  3AYH B;  3I4O A;  1D8L A;  1VQF A;  1PYB A;  1YJN A;  2Q2T A;  2YTV A;  4GLA C;  4BY1 G;  4DR6 L;  4LNQ A;  3EBE A;  1VQJ A;  1JE5 A;  1SLJ A;  5IWA L;  5M3F H;  4DKA C;  4GNX C;  4UPA A;  1K0R A;  5IY0 A;  1VS0 A;  2I5L X;  3H0G G;  3OYY A;  4MZ9 A;  1HNZ Q;  2E5L L;  1SE8 A;  2PMZ E;  4AYB G;  3S1Q H;  4JOI A;  1NMF A;  4A3B G;  2ATW A;  2K14 A;  1PV4 A;  1PH1 A;  1I94 Q;  3JAM c;  4LFB Q;  1YI2 A;  2E5L Q;  3I2Z A;  1U0L A;  1BBU A;  4PZ8 A;  5H1S E;  3CCM A;  4JI1 L;  4LF5 Q;  2MFI A;  1N33 L;  1FGU A;  4LF4 Q;  3A5Z B;  4JI7 L;  4X64 Q;  4IOC A;  3HOV G;  3UDG A;  1MJC A;  2RHQ B;  3AQQ A;  5AJ3 Q;  3CC4 A;  3CPF A;  4JI4 L;  4K0K Q;  1U5K A;  4A3D G;  4ME3 A;  3M7N A;  4KHP L;  3G48 A;  2K5N A;  3NBH B;  4R1J A;  3VDY A;  5FLM H;  1D7Q A;  3WWV A;  4AQY Q;  1S72 A;  1E1O A;  1GD7 A;  1L0W A;  3UDF A;  1XNR L;  2K5V A;  4GKK Q;  1EFW A;  4JI2 Q;  4DV0 Q;  2RF4 A;  3DM3 A;  3W1G A;  4DV3 L;  4LF9 Q;  3CMA A;  2GVA A;  5M3M G;  5E7N A;  3RR5 A;  4NXN L;  3DLL A;  4AQY L;  2R93 H;  1C7Y A;  5FLX c;  4OO1 G;  4L5S A;  2R7Z G;  3PO2 G;  1KIX A;  4A3D H;  3AFP A;  2VUM H;  4GS3 A;  1QVF A;  4BBR H;  1YNX A;  3T1Y Q;  2FXQ A;  4PMW A;  4FDB A;  2JA7 G;  3JAM i;  4DV1 Q;  2MNA A;  2IX1 A;  2AHO B;  3J81 c;  3S1R H;  4A3B H;  3PF4 A;  2LXK A;  3E9H A;  1PH5 A;  4GKJ Q;  3ER0 A;  3STB D;  1NMG A;  3J7Z C;  3W5O A;  3ERS X;  3K80 C;  4JI7 Q;  3OTO L;  4GN5 A;  4C2M H;  3BZC A;  4A3F G;  1Q8K A;  3H3V H;  4YWK A;  1KC8 C;  4R4C A;  5AJ3 L;  4GOP B;  4DR1 Q;  4BY7 G;  3HKZ G;  1OXT A;  3A0J A;  1L1O C;  4L5R C;  1G6P A;  4A3J H;  4X62 L;  2EIF A;  1PH3 A;  2NVQ H;  2EQS A;  1A0I A;  2ZJQ A;  5ELO A;  1XPO A;  4DV2 L;  4JI0 L;  3F8T A;  1HNZ L;  2KCM A;  4POF A;  2DGY A;  3PO3 G;  1IYJ B;  2Z6K A;  1VQ4 A;  1V43 A;  1PVO A;  2NN6 I;  4DV7 L;  5IP7 G;  1VQO A;  2A19 A;  1BVS A;  2NN6 G;  2R6G A;  4IPD A;  2AWO A;  4DR3 L;  1Y1W G;  3GD7 A;  4LF5 L;  4X65 Q;  1Z47 A;  1Q86 C;  1G29 1;  1EIY B;  2HIX A;  3I7F A;  5IYB G;  5EAY A;  1YHA A;  2AWN A;  3S15 H;  1N33 Q;  2JA8 H;  2R7F A;  4JI8 L;  4C3H H;  1N34 L;  1Y1V G;  1M1K C;  2K52 A;  4EX5 A;  1JJ2 A;  4A3L H;  1KXL A;  1I5F A;  4LF8 L;  4YCU A;  3TRZ A;  2Z0S A;  1N36 L;  1Z9F A;  3TRE A;  1YHQ A;  3D0F A;  1QUQ B;  1I50 H;  2JK8 A;  1NBW A;  1JB7 A;  4YWM A;  1IBM Q;  1P16 A;  4BBS G;  1MIU A;  1CKM A;  2E2H H;  2MQH A;  4X6A H;  3F2C A;  4DUZ L;  2WAQ E;  2VNU D;  5GAD C;  4JBW A;  4PZ7 A;  2Y0S E;  2V1C C;  4LUV A;  1J6Q A;  2VW9 A;  4HJ8 A;  4OWW B;  1SMX A;  2DUD A;  4LF7 L;  1QZH A;  4R4O A;  2JJQ A;  5C0X J;  2UXC L;  3ULP A;  1P8L A;  1EQQ A;  4DUY L;  1UE5 A;  3CC7 A;  1NJI C;  5GRO A;  1WOC A;  3J80 i;  4RG1 A;  1LM0 A;  4GLX A;  3S1M H;  3M9B A;  2LSS A;  5GAG C;  1HR0 W;  4J15 A;  4BXX G;  3F2B A;  3UDX A;  1X56 A;  1RIP A;  1N32 L;  1Q1B A;  3J80 c;  3RZD H;  4BBS H;  4HIK A;  2ES2 A;  4JBK A;  2A8V A;  3K7U C;  2CKZ B;  2VQF Q;  4DAM A;  2IHE A;  3CCR A;  4B3S L;  1EYG A;  5FJ8 H;  5LMU Q;  4GOP A;  4JC0 A;  3S16 H;  2WAQ G;  3MEF A;  4A3I G;  3KDF A;  1YEZ A;  4TQU S;  3MXN B;  1G51 A;  4P73 A;  1LYL A;  1WI5 A;  2KBN A;  4R4T A;  1VQC A;  4OX9 L;  3J7A 5;  1IXR A;  4X66 Q;  4XTC S;  1T9H A;  3GTK H;  1HJP A;  1Q82 C;  2CCZ A;  4DR3 Q;  1IBK Q;  4X66 L;  1XNQ Q;  1GO3 E;  1VCI A;  2AKW B;  3CXC A;  5JJL A;  2JA5 G;  5IP9 H;  3SGI A;  3HOY H;  3ZJY C;  1IBK L;  2YYZ A;  2NZO A;  5LMN L;  1VQN A;  2WFW A;  3H15 A;  3PUZ A;  4L5T A;  4P72 A;  4LUO A;  1VQP A;  1Q7Y C;  2NVY H;  4HJA A;  1HR0 L;  4B3S Q;  4NXM Q;  3M4Q A;  2ZJP A;  3E9I A;  2R92 H;  4B3R Q;  3U4V A;  5M5Y H;  3KJP A;  3IRB A;  3CP0 A;  1JMC A;  1X3E A;  3FHW A;  5IP7 H;  4BA2 I;  1Q12 A;  2E8G A;  4UP9 A;  3CCV A;  2N78 A;  3GTQ H;  4A93 H;  2OCE A;  2IX0 A;  4IPH A;  1VQB A;  4QIW E;  2B3G A;  2UXB Q;  2A1A A;  1WJJ A;  4NB3 A;  4IFD G;  2UUB Q;  4IPG A;  1C9O A;  3L7Z C;  2BA1 A;  2F3I A;  5J3B A;  2VQF L;  4HIO A;  4LF7 Q;  3U58 A;  2R92 G;  3M85 A;  2F4V L;  1VQK A;  1WCM H;  3RLN A;  2I5M X;  2D0P A;  4MNO A;  1X6O A;  1VQ9 A;  3PV0 A;  4GKK L;  3TS2 A;  2UU9 Q;  3OW2 A;  2CWA A;  3GO5 A;  4LW1 A;  2L15 A;  4BBR G;  1XTD A;  4DK3 C;  2QA4 A;  4IFD J;  3GTO H;  2CQO A;  2WB1 E;  1AH9 A;  1SN8 A;  2EXD A;  3CCQ A;  4IOA A;  4A4I A;  1IZ6 A;  1VQH A;  1YVC A;  1SRO A;  3S2H H;  2N49 A;  1PYS B;  3ULJ A;  1VQA A;  1PA6 A;  4DR5 L;  4P74 A;  4DV1 L;  1MJE A;  4LF6 Q;  3CCJ A;  1XMQ Q;  1K9M C;  4NXM L;  2RHS B;  5IYC H;  4GOP C;  2VZA A;  5IYD H;  1JJG A;  2VY3 A;  4AIM A;  4B3T Q;  2R7Z H;  3AEV A;  1L1O B;  3F2D A;  3KJO A;  3PO2 H;  1C0A A;  4TVA B;  3CAM A;  3L0O A;  1Q81 C;  1XMQ L;  4RMF A;  4BXX H;  1PH7 A;  4JV5 Q;  2JE6 I;  2NVX H;  1K83 H;  3CC2 A;  5IWA Q;  2PQA A;  3PUW A;  2Z6K C;  3CF5 A;  4DR2 L;  4PZ6 A;  3I4M G;  4OXP A;  5HY6 A;  1PH8 A;  3CCL A;  1VQM A;  2UUB L;  2QGQ A;  4OON A;  4LF9 L;  5JJK A;  1HZA A;  3M4P A;  4GLV B;  4O2D A;  1YIJ A;  1X55 A;  2OQK A;  3BJU A;  4DR5 Q;  2HT1 A;  1K3R A;  4DV2 Q;  4NPS A;  4DV7 Q;  1EQR A;  2GVB A;  4DV5 L;  2KHJ A;  2UUC L;  3I56 A;  2UUA Q;  1X54 A;  1IBL Q;  1HNX Q;  4A3G H;  1I6H H;  1YZ6 A;  4MTN A;  4P75 A;  3TEH B;  5IYC G;  5IYD G;  1GVP A;  1CSP A;  1FVI A;  2K5H A;  4LFA Q;  5LMN W;  2JQO A;  4X64 L;  4IPC A;  2VQE Q;  2UXB L;  1HZB A;  1EUJ A;  4JG2 A;  1IBL L;  4JV5 L;  1JT8 A;  3PSI A;  2I5H A;  2N3S A;  1IBM L;  1BKB A;  4JI3 Q;  3KF6 B;  3F1Z A;  4JBM A;  2XGT A;  4DUZ Q;  3S17 H;  3M4O H;  1GM5 A;  4IFD I;  3W1B A;  1I94 L;  2JA9 A;  5IYB H;  3E0E A;  5BR8 L;  5JJI A;  4YWL A;  4LF4 L;  3A74 A;  2PQA B;  3EN2 A;  3GDE A;  2YTY A;  4YHH Q;  2BH2 A;  3EIV A;  3NEN A;  3KOJ A;  1AE2 A;  1E1T A;  2NZH A;  3HOW H;  4DV4 Q;  4B3R L;  3GTM H;  5IT9 c;  2VS1 A;  1FJG L;  1EWI A;  4UP8 A;  3PO3 H;  2F4V Q;  1XJV A;  1QVG A;  2IY5 B;  3PGZ A;  4L5Q A;  1CKN B;  4JI8 Q;  2OQ0 A;  1K73 C;  4A3F H;  3S14 H;  4DAY B;  4BY1 H;  3NEL A;  4R4Q A;  2IHF A;  3AFQ A;  5C0X I;  1V1Q A;  3OTO Q;  2ZM6 L;  1K8A C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...