5LMUL

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5lmuL00
4LFCL 4NXMQ 2E2JH 5BR8L 3CQZH 4DV4Q 3S2DH 4JYAQ 1Q86C 3HOUH 1IBMQ 2Z6KC 3ULJA 3RNUA 4DR7L 1I3QH 3HKZE 2PNHA 1E1TA 2EXDA 4DNIA 3S1MH 1JJGA 3A5ZB 4OWWB 1MIUA 4DV5Q 2VUMG 4DR4L 3CXCA 3RN2A 4YHHL 4DV7Q 4IFDI 4PZ6A 4BY1H 2KHIA 2B63H 2ZTEA 4PMWA 3S1RH 1HZAA 1PYBA 4OO1I 3PUYA 4BBSG 4B3TL 1UE5A 3KF6B 2DGYA 3HOWG 3CPFA 3GDEA 4WJ4A 4NXNQ 3M3YH 1UE6A 1V9PA 1FVIA 4LF6L 3S2HH 4A3DH 4DAYB 2ZJQA 1AE3A 1YVCA 5FLMH 1MKHA 1PH2A 4JI4Q 4JI6Q 1M1KC 1N32L 1IBLL 5C0XG 1YJWA 3J7A5 1VQBA 1HZ9A 1KHIA 2GN5A 2A8VA 5C3EG 1YJ9A 2PQAB 2QEXA 2OTJA 1JE5A 3KDFA 1B7YB 2N3SA 2OQKA 4TVAB 1JJ2A 2UUAL 2E2HH 2JA6H 2JA7G 2WFWA 1EQQA 4IFDJ 3JAMc 1VQGA 3J7ZC 4R4OA 4P74A 4NXML 2AWOA 3PGZA 1XNRQ 3NENA 4DV4L 1UWVA 2MFIA 3E9HA 4LFAQ 1YHBA 4JYAL 2NVYH 2RCNA 1IBML 4K0KQ 3CCSA 1Q12A 3KFUA 1BBWA 4BY7G 3BZKA 2WP8J 3FP9A 3CCJA 1VQKA 1VQAA 1X56A 4C2MH 4GKKQ 4QQBX 1A63A 1LTLA 4DV7L 3A74A 1X3GA 2UXCQ 1N8RC 1EYGA 2R92H 4DV0Q 1JB7A 3M4PA 4GOPA 3KLWA 3OTOQ 1N34Q 3I4NH 4YWLA 1OXSC 2F3IA 1B70B 3MXNB 3HKZG 1W3SA 2LXJA 1Q1BA 4LF5Q 3CC2A 4A93H 3EIVA 1PVOA 1MJCA 3K7AH 3PSIA 4L5TA 1O7IA 1SRUA 5ELNA 3LGJA 4NXNL 5IP7G 2MNAA 2BH2A 3HOVH 4JI6L 4JI4L 3K0XA 4LF7Q 3M7NA 1WI5A 3HOZG 4A3LG 2VQEQ 4XTCS 2K50A 2Q2IA 1GKHA 2JA9A 3HOYG 5C4XH 3AFQA 4JBMA 2IX1A 4NB3A 1XNQQ 3GTQH 3VDYA 3CC7A 3PV0A 4JV5Q 2YTVA 3IRBA 4PZ7A 3M9BA 3S17H 5GAHC 4DK3C 4LNQA 1XNRL 2ASBA 2JA5G 4LFAL 4K0KL 5GQOA 1C9OA 3ICEA 2VW9A 4HJAA 2JA8H 4X6AH 1CKNA 3W1GA 4ALPA 1VQ9A 4P73A 1X54A 1NY4A 3CAMA 4IJHA 3L7ZC 3RLOA 4DR7Q 4GKKL 2BA1A 2KHJA 4YWKA 3T1HQ 2VUMH 2CWAA 1A0IA 3CCUA 2UXDQ 3FHWA 4OWXB 1UE7A 1H95A 2FXQA 1P16A 1SFOH 1PH7A 4DV0L 1I5FA 3OTOL 4HIMA 4A3IG 1YHQA 1N34L 4DR4Q 3FKIG 4DAMA 3PO3G 3I56A 3HOWH 4A3FH 4LF5L 1EOVA 3CCRA 1PH4A 4B3MQ 4JOIC 4LUZA 4GOPB 1GVPA 4B3TQ 4HIOA 2JEAI 4GS3A 2ZJPA 1WFQA 4LF7L 1RL2A 1NMGA 2R7DA 4GLXA 3T1YQ 3K80C 4PG3A 2VQEL 4JI5Q 1V1QA 3J81i 1A8VA 1Q1EA 1IXRA 1SE8A 4R4QA 3F8TA 2KENA 5C3EH 3CCEA 1K73C 1K0RA 4IPGA 2Z0SA 1SROA 2F52A 3U58A 4HJ7A 3TQYA 5IWAQ 4Y7NH 4HIKA 1GO3E 2D0OA 2MQHA 1XNQL 4JV5L 5IYDH 1PH3A 2Q2HA 4ME3A 2NVXH 3J80i 4QJFA 2UU9Q 4X66Q 2RF4A 4IPHA 3H3VH 4JBKA 3HKSA 4DKAC 1VQNA 4P71A 3K7UC 3EN2A 1Y14B 3W5OA 4A75A 4A3MG 4DR3Q 1QVGA 5C0XI 3EBEA 4QL5A 2HHHQ 2C35B 1VQ8A 3PF4A 2QGQA 4R4IA 1OXXK 4JCVE 1X9NA 5GADC 4GNXA 2R93G 5IYCG 4DPGA 3T1HL 3U50C 5ELOA 2JJQA 2UXDL 1Q7YC 2MO0A 1K9MC 3ERSX 1I50H 1PH9A 4LF8Q 2F4VQ 2K52A 3H3VI 2K4KA 2NVQH 3CMEA 4QGUA 4BA2I 4OXPA 1S40A 1N33Q 2CFMA 4DR1L 1D7QA 1OTCA 2PMZE 1Q81C 1X55A 4DR2Q 3NELA 4B3ML 4LF9Q 4IOAA 3ULLA 1VS0A 1MJEA 4GN5A 3I4OA 1GM5A 4BBRG 1K3RA 5FJ8G 1QVFA 3T1YL 2HQLA 1JJCB 4GN4B 4A76A 3CCMA 4JI5L 5C0XJ 2YV5A 4R1JA 2XGTA 3K8AA 4X62Q 4DUZQ 5M3FG 4HJ9A 3JC66 4AQYQ 3TS0A 3HOYH 2D0PA 2OTLA 3RR5A 1XPRA 1TWCH 1T9HA 4A3JG 5H1SE 3PIOA 4AIMA 5IWAL 2UUBQ 2JK8A 4KHZA 1KXLA 1UE1A 3I7FA 3I4MG 4APVA 2BH8A 4UPAA 3J81j 1SLJA 2UU9L 1RIPA 4X66L 2ID0A 2Z6KA 2JA5H 2GVAA 5GROA 4DR3L 3M85A 1X3EA 2HHHL 4JI2Q 1HZCA 3BJUA 2QA4A 1E3PA 1E1OA 5HY6A 3HOXG 1K8AC 3AYHB 3GTGH 3WWVA 1XMOQ 2IX0A 2NZHA 1XMQQ 1K83H 4QY7A 1PV4A 3GTMH 3GD7A 4XIGS 4LF8L 2F4VL 4A3IH 1BBUA 2AWNA 3FKIH 2IHFA 4GNXB 3PO3H 1N33L 3RZDH 1KD1C 1K8GA 4DR6Q 3TREA 4DR2L 4LF9L 4FDBA 1CKMA 1J6QA 2JEBI 4O2DA 1SN8A 1I94Q 2CKZB 1L1OC 2IY5B 1AH9A 3GTOH 1NMFA 4LFBQ 1M90C 1PA6A 4BA1I 1BVSA 1W2BA 1X65A 5GAEC 2I0QA 2VY3A 3I2ZA 2HIVA 3H0GH 4YCVA 4X62L 4DUZL 4AQYL 4A3CG 2B3GA 4GLAC 3HOUG 2UUBL 3U4VA 1FJGQ 2R7ZG 4WJ3M 1TXYA 3CPWA 4A3GG 3JAMi 1SMXA 1WOCA 1Z9FA 1VQHA 1N36Q 1Q8KA 5C4JH 4A3MH 2KCTA 2K5HA 5LMUL 5GAGC 4L5QA 3KDFB 4P72A 4JI2L 2Y0SE 4BXXG 1KRSA 1QUQA 1EIYB 1FL0A 1YHAA 1IBKQ 3S14H 3CF5A 1XMOL 5IYCH 2R93H 4HJ8A 3F2BA 4OWTB 4IPDA 3TEHB 2D62A 4NPSA 4YWMA 3W1BA 3GTJH 1IYJB 1XMQL 1VQMA 4A3KG 2YTXA 2LSSA 2JQOA 4POGA 1OXVA 1DGSA 2VS1A 1ASYA 2CCZA 3NEMA 1PH5A 3UDFA 4DR6L 2PI2A 2AKWB 5EAYA 1TWGH 2I5HA 3AFPA 4BBSH 1VQIA 2R7FA 3S16H 3S1QH 4DR1Q 1N9WA 4BBRH 1D8LA 1YEZA 1HJPA 3CMAA 1I94L 4LWCA 1PH6A 4UP9A 5FJ8H 1PHJA 4J15A 4LFBL 2JA6G 3AQQA 1YBYA 3KJPA 4OX9Q 1HNWQ 3STBC 3J80c 5M3FH 4YCWA 4KI0A 3F2CA 4X65Q 4A3JH 1HNXL 1FJGL 2HIXA 3KOJA 3PUVA 4PZ8A 3I4MH 2AHOB 2I5MX 2LXKA 5JJKA 1VQJA 3MEFA 3A0JA 1X3FA 4JI7Q 4UP7A 3E9IA 4HIDA 1N36L 1Y1VG 1TWFH 1U5KA 1Y1WG 5JJIA 1PYSB 2R92G 2Q2TA 4EQ5A 5AJ3Q 1YITA 2B29A 4AYBG 1WCMG 1VQPA 1S72A 2IHEA 3I4NG 2VNUD 4AH6A 1HNZQ 2VZAA 4O0AA 5IP9G 3HOXH 4LUOA 1IBKL 1NBWA 4A93G 3DM3A 3F1ZA 4MZ9A 1Z47A 4BY7H 4IOCA 1LYLA 1QUQB 2XTIA 1VQ4A 3U4ZA 1IL2A 1YI2A 4JI1Q 5IYBG 4C3JH 1HR0Q 1UEBA 4JOIA 1CKNB 1E22A 4A3EG 1CSPA 2Y0SG 4MNOA 1VCIA 2A19A 2YTYA 1WYDA 2OQ0A 1EQRA 1KQSA 4GLVB 1G6PA 1HZBA 2EQSA 4L5SA 3TS2A 5C4XG 1XTDA 1Q46A 4UP8A 3PUWA 5DLQE 5IP7H 1PH8A 1LUZA 3STBD 2NN6G 4A3BG 3DLLA 1KIXA 2A1AA 2H5XA 4DV1Q 4OX9L 4R4CA 5J3BA 1HNWL 1C0AA 1TWHH 5LMNQ 3HOZH 4DUYQ 3G4SA 4A3CH 4A3LH 3UE1A 3K81C 4X65L 1EIFA 2CWPA 2VL6A 3PF5A 2N78A 2JA8G 2R7ZH 4A3GH 2ZTDA 1GD7A 3UDIA 1IZ6A 3UE0A 4JI7L 1E24A 1VQ7A 2ZM6Q 4DV3Q 3KJOA 5IT9c 5E7NA 2WAQE 2R6GA 4KHPQ 2UXBQ 5M3MG 5AJ3L 4BXXH 5IE8A 1OXTA 1CUKA 1V43A 4IPCA 3S24A 2VQFQ 1HNZL 3CW2C 1VQ5A 4JI0Q 2N49A 5M5YH 5LMUQ 4YY3Q 4A3FG 2E5LL 2ATWA 4RMFA 3GTLH 2GVBA 1KRTA 4QIWE 1KAWA 4GOPC 1NTGA 2E8GA 3G71A 4A3KH 3AEVA 3RZOH 2OCEA 4JI1L 1HR0L 3L0OA 5C44G 1TWAH 3PO2G 3D31A 1AE2A 4JI8Q 2E2IH 1X6OA 2L15A 5JEAJ 3GTKH 1J5EQ 3S15H 2JE6I 4C3HH 1YJNA 3GO5A 3HFZB 5JEAG 1A62A 2ZJRA 2OWOA 4EX5A 4UY8C 3BZCA 1L2FA 2AMCB 1ASZA 1XPOA 4DR5Q 3TRZA 2RHSB 4DV1L 1NJIC 4OONA 4B3RQ 3A5UA 3OYYA 4JC0A 2UUCQ 4IFDG 5LMNL 4DUYL 1SR3A 5IYDG 1XJVA 4LF4Q 3ZJYC 2IT1A 4OO1G 2RHQB 3S1NH 3G6EA 4A3BH 2DUDA 5IY0A 2N8NA 2KCMA 4AYBE 1HNXQ 3GTPH 1VQLA 2ZM6L 3KYHC 4DV3L 4DV5L 1Y1VH 3D0FA 1VQDA 1Y1WH 4GKJQ 4JBWA 1L0WA 4KHPL 2MO1A 3UDXA 2UXBL 4RG1A 1WCMH 2EIFA 2VQFL 5IP9H 3NBHB 4JI0L 4BY1G 4YY3L 4JI3Q 2B63G 3UDGA 2K5VA 4P75A 5JJLA 1QZGA 5M5XH 3ULPA 2WB1E 3H15A 1E7ZA 2HT1A 1EFWA 2WAQG 5IYBH 1VQ6A 4A3EH 3CC4A 4JI8L 4MTNA 1FGUA 2K14A 4HJ5A 4H02A 1PFSA 4C3IH 4TQUS 2YU9H 4X64Q 4A3DG 3I55A 5FLMG 1J5EL 1L1OA 1EWIA 3ER0A 1G51A 2NZOA 4KLKA 1XPUA 4DV6Q 4DK6C 1WJJA 3J81c 5M5WH 1S3OA 3RLFA 4DR5L 4B3RL 1QZHA 3CCLA 3PCOB 4B3SQ 1YIJA 2UUCL 2CQOA 3M4QA 4DV2Q 3RLNA 5HGQA 1OXUA 4LF4L 2BA0A 4LFCQ 2K5NA 5BR8Q 1C7YA 1CSQA 1KL9A 1YNXA 3Q8DA 4GN3B 1QVCA 2K75A 3E0EA 1HR0W 1CKOA 3BU2A 4A4IA 2YYZA 2NN6I 4GKJL 2UXCL 5M3MH 3PUZA 2ES2A 4IO9A 3KF6A 1EUJA 1Q82C 2JA7H 1G291 4YHHQ 1LM0A 5FLXc 4GNXC 3G48A 3CD6A 4POFA 4JI3L 3M4OH 2NVTH 4R4TA 3SGIA 1BKBA 3L2PA 4IJLA 1HH2P 3CCQA 2ALYB 3OW2A 2E5LQ 3RN5A 5C44H 1VQEA 4L5RC 5LMNW 3PO2H 4LF6Q 3PUXA 1P8LA 1PH1A 4X64L 3HOVG 2PQAA 4LW1A 3H0GG 3PIPA 4DV6L 3F2DA 1N32Q 3B6YA 4LUVA 4YCUA 1VQOA 1IBLQ 1VQFA 1R9TH 1NE3A 2WB1G 5K36G 2PI2E 4JG2A 4Y52H 1L1OB 3KF8B 1KC8C 1JMCA 2V1CC 2ZTCA 1B8AA 1VQCA 4B3SL 3CCVA 1JT8A 3CP0A 2UUAQ 4JBJA 1YZ6A 2I5LX 4DV2L 1U0LA 1I6HH 2KBNA 2Q2UA
chains in the Genus database with same CATH superfamily
2B2TC 2E2JH 2EY6A 3CQZH 1QCBD 3HOUH 3ULJA 2DJFC 1E1TA 2B63B 4DV5Q 2F0FA 3NTIA 3S1RH 1HZAA 2WAQB 1PMRA 4BBSG 3A55A 5EBDA 2F0OA 4U673 2XSCA 3CPFA 1LO5D 1UE6A 2B2WC 1OO9B 1YVCA 4JI6Q 4K8JA 1N32L 1WTXA 5C0XG 1VQBA 2GN5A 4B9XA 1SNPA 2JA5B 2QEXA 2OQKA 4TVAB 1JJ2A 2JA6H 4QB4A 4P74A 5ELDA 2KECA 3PGZA 4K0KQ 1YHBA 2F0SA 1IBML 3GTMB 4A3IB 1CQVA 3QOJA 1BNZA 4GKKQ 3U9OA 4C2MH 1X3GA 4O42A 2R92H 3R2IA 1N34Q 4YWLA 2F3IA 1HRJA 1B70B 4ABNA 1DONA 1FNUA 3HKZG 1W3SA 3DXJC 3EIVA 2A6ED 3PSIA 4L5TA 5IP7G 4NXNL 1S5FD 3VR5A 2BH2A 3LGJA 2CH4W 2QCPX 1F77A 3HOVH 1AN8A 3K0XA 3HOZG 3KLRA 4Z9CB 5C4XH 1PZJD 2IX1A 3GTQH 4I65A 2NN6H 2L1BA 2WKDA 4PZ7A 2EY2A 1SNOA 1GHJA 2PW5A 2R93B 5KYLA 2RSOA 4LFAL 2PCFB 4X3KA 2CW0D 2F0TA 5G3LF 3W1GA 1VQ9A 4IJHA 2PNRC 4YWKA 3T1HQ 1A0IA 1TWGB 1UE7A 4BBSB 2EJMA 3OTOL 3MXUA 4DR4Q 2XIWA 3PO3G 1EYDA 3I56A 2CVRA 1EOVA 4LF5L 1PH4A 5J1ZA 4JOIC 4LUZA 2KUMA 4LMQD 4HIOA 2JEAI 1YNJC 4A3JB 1A3VA 1RL2A 1NMGA 2R7DA 3K80C 1V1QA 4TSSA 1K73C 4A3BG 3WOFA 1SROA 3U58A 5COYA 4OIJA 4HJ7A 3TQYA 4HIKA 2MQHA 1EY5A 3VYUA 3J80i 5K5PA 3H3VH 4U68A 1QE6A 2PZWA 2J4XA 3HKSA 3SK5A 4P71A 4DKAC 4EGVA 3W5OA 1Y14B 4XXEA 3DEOA 4A75A 5D65A 3Q24A 1A2TA 2C35B 3W2DA 1OXXK 4JCVE 1X9NA 3ZYYX 4K5XA 3I3CA 4KN7C 3NWSA 1H9JA 1ENAA 4OXPA 1S40A 1OTCA 2PMZE 4IOAA 4N9TA 3I4OA 1A3UA 3HOZB 2HUGA 5FJ8G 1RCVD 1JJCB 1JOKA 5E1FA 2WKCA 3K8AA 4WRDA 4DUZQ 4AQYQ 2D0PA 5T1GA 5IWAL 4KHZA 3I4MG 3T53B 1PFNA 4UPAA 3J81j 1SLJA 1EZ6A 1RIPA 4X66L 2ID0A 2FHTA 2JA5H 5LHY1 1T5XD 3GTLB 4DR3L 1ZYRD 1QNUA 1RD9D 1E1OA 5HY6A 1WTWA 5CC4A 3QO2A 4RAUC 2NZHA 4KJNA 1PV4A 1CFMA 3P1HA 3GTMH 3S15B 1LACA 3W3AA 1BBUA 4A3IH 1SSOA 2IHFA 4GNXB 4S3SA 5ELEA 2RDHA 2HDMA 4DR6Q 1UUPA 3FRPB 4DR2L 4FF1A 1CKMA 3K5LA 3MEHA 1G2TA 3X3NA 1J6QA 2XNAC 4ID6A 4A3BB 5IT9E 1PZKD 3SDZA 5GAEC 2HIVA 2UUBL 3U4VA 3A7AB 1WD1A 4WJ3M 1AZQA 3CPWA 1V8QA 1BXTA 1WOCA 2M9VA 2RCFA 5C4JH 4JW0A 2MHVA 3T13A 4CHTB 4A3EB 3CRKC 4HMIA 3S14H 2M00A 2R93H 4KY7A 5IYCH 3BDLA 1EEFD 4IPDA 4NPSA 4OWTB 4YIJA 3W1BA 3L3OC 4V190 4A3KG 4POGA 3D4WA 1EWCA 1DXMA 3UDFA 3FEWX 2PI2A 5EKLA 5EAYA 1TWGH 5M5WB 4K14A 4BBSH 1D6EC 4DR1Q 1N9WA 1PRTF 4HSPA 4UP9A 1PH6A 1D2BA 1K3BC 4LFBL 1TY0A 3ND8A 4F7XA 4J1MA 2FMMA 5FK9C 4KI0A 3F2CA 4A3JH 3OHXC 1FJGL 3PUVA 2Z1CA 2AHOB 2LXKA 2O4XA 3A0JA 1X3FA 3G7LA 1R4QB 4H13C 1N36L 1XYIA 2NVTB 1I4QA 1KDBA 3I4NG 2B29A 1VQPA 2IHEA 3VYSA 2C5CA 4LUOA 1T5EA 2EY1A 3A8IE 4A93G 5HGTA 1TU2B 4IOCA 1B53A 1VMCA 1QUQB 1VQ4A 1J9OA 3U4ZA 1HR0Q 5IYBG 3O13A 4TKOB 2Y0SG 1QILA 3WOEA 2N88A 1SBBB 1EQRA 2OQ0A 3K57A 3J80E 2EQSA 4WORA 1NAPA 1XTDA 5IP7H 1LUZA 3STBD 3DLLA 2A1AA 4R4CA 1LTRD 5LMNQ 1I3QB 3HOZH 4DUYQ 1JOQA 3UE1A 4X65L 5FLXE 4FF2A 2JA8G 4LAAA 3UDIA 4ZLTF 1F2MA 4ZRZA 2KA7A 3UE0A 1VQ7A 4NMZA 1CA5A 1HHVA 2WAQE 2R6GA 4I7ZC 3HS0C 5CR3A 4BXXH 5IE8A 1VQ5A 3EJIA 1QOHA 3GV6A 3S2HB 1L0XB 2R61A 2XWBB 3MWYW 5JOBA 3GTLH 4GOPC 1F2LA 1KAWA 2ICEC 1WTVA 4JI1L 4QIWB 3GTKB 3TP5A 5C44G 4OHJA 5JEAJ 1DZ1A 3S15H 1F2ZA 1TIID 4XQQA 3GO5A 2OWOA 2FJ2A 3BZCA 3C3LA 1KDCA 2RBMA 2F0MA 2SOBA 3M4YA 2RHSB 4DV1L 4DR5Q 4OONA 1TR5A 5BN3A 5C5MA 3P20A 4IFDG 1ILPA 1M8AA 4A3BH 3G6EA 4AYBE 1LT5D 1K28A 2IPKD 2TMPA 3I4NB 2KEEA 1Y1VH 2F0PA 1BQQT 1SMYD 4NKLA 1B2TA 1H9RA 1L0WA 2UXBL 2MO1A 2QDLA 2EIFA 4A93B 1B3AA 2VQFL 3K59A 1HTLD 4P75A 3VYRA 3KLSA 3ULPA 3H15A 1E7ZA 3MXGA 1GUNA 3KBGA 1NNXA 2C9OA 3KK7A 4A3EH 3CC4A 1PRTC 4I7AA 1PFSA 4RGMA 3URYA 3I55A 3ER0A 1XPUA 4DK6C 2B2VA 5ELFA 3Q0AA 4Q0FA 3S17B 3SK8A 2XRQD 1SNQA 3NTKA 5M5WH 1S3OA 3RLFA 2LFNA 4LK1C 1QZHA 3CCLA 4B3RL 4K5VA 2JA8B 2CQOA 3H94A 4DV2Q 1KAAA 1E2VA 1SE3A 2BA0A 2AQ1B 2K5NA 1C7YA 3OWFA 4IUQA 3Q8DA 4QUCA 1ICFB 1TS4A 2UXCL 1HFGA 3IAYA 1GHKA 1EUJA 1MI2A 3M4OB 3AU7A 2QILA 4QF4A 4POFA 4JI3L 2NVTH 4R4TA 3SGIA 3CCQA 2CHBD 2E5LQ 1KLGD 4FP5D 1VQEA 1K8MA 5C3EB 4X64L 1D5XC 3HOVG 2JXMB 3H0GG 4DV6L 1N32Q 3B6YA 4IQZA 4LUVA 1VQOA 2NVXB 2WB1G 4G7OC 2CQAA 1JMCA 2V1CC 4B3SL 1JT8A 3CP0A 1YZ6A 3CQZB 4HTHA 4UY8C 4PQXA 2B39A 5IGDA 4CKCA 4EQNA 4RGNA 1L0YB 1IBMQ 4ME5A 3JAML 4DR7L 1I3QH 3HKZE 2PNHA 4P2CB 3CXCA 2ZTEA 4PMWA 4OO1I 3PUYA 1UE5A 4RGTA 2A6HD 3GDEA 2L55A 4NXNQ 1V9PA 1FVIA 3S2HH 4M1UB 4DAYB 1Q90A 1JC7A 5CV9A 1MKHA 3IFTA 5FLMH 1IBLL 1YJWA 5ELBA 2PQAB 1JE5A 1B7YB 2WFWA 1EQQA 3J7ZC 1MGSA 4IUUA 2AWOA 2L9HA 1PTOC 3NENA 4DV4L 3J7AV 3E9HA 4LFAQ 4JYAL 1E2ZA 3D6WA 3CCSA 1Q12A 1CT1D 3FKIB 4HCSA 2PQEA 1LTAD 3RZDB 4QQBX 4DV7L 3A74A 1N8RC 1EYGA 2WV6D 3I4NH 3OTOQ 3MXNB 2LXJA 4LF5Q 3FDTA 3SEBA 5JVH3 4A93H 2OT2A 1PVOA 1MJCA 4KTAA 2MNAA 3H0GB 1I4HA 4JI4L 2WB1B 3M7NA 4A3LG 1JR0D 4E6IA 1GKHA 2DNEA 3AFQA 2B2YC 3QJYA 3PV0A 3I91A 5KEEA 2YTVA 3M9BA 3S17H 1XNRL 2ASBA 2JA5G 5EJWA 5CV6A 3RUZA 2E75C 4HJAA 2JA8H 3L7ZC 1G8ZD 2WINB 2KHJA 3PMFA 2CWAA 3CCUA 3FHWA 1H95A 1PH7A 4DV0L 3S16B 3BYYB 4A3IG 1G91A 4DAMA 5I9OA 3CU7A 1S5CD 3K5OA 1GVPA 4B3TQ 5IOCA 4GS3A 2Z4HA 2ZJPA 1WFQA 3RD4A 3BS1A 1LV9A 2B2UC 4LF7L 2RKSA 1FYCA 4PG3A 2VQEL 2OXPA 1EU3A 1A8VA 4R4QA 4HCEA 3F8TA 2KENA 5C3EH 1K0RA 1TWFB 5IWAQ 4Y7NH 3NXWA 2D0OA 2BOSA 2Q2HA 2NVXH 1HFNA 4RKBA 4X66Q 2RF4A 3TMEA 4JBKA 1RTOA 3E5SA 3K7UC 3T4AC 1O7ZA 4DR3Q 1QVGA 2BE5C 4QL5A 4CJ0B 4PMCA 3NQIA 4C3JB 3FPUB 4GNXA 2R93G 3G6JB 1A15A 3N6RA 5IYCG 3U50C 5ELOA 4B9WA 3ERSX 1NR4A 2K52A 3D3RA 2K4KA 4C3IG 2NVQH 2CFMA 1GUGA 4NP5A 3ND9A 4DR2Q 4B3ML 4UDUC 1B9NA 1DOLA 3ULLA 1IYUA 3TZDA 4GN5A 3R93A 1K0SA 2MGSA 1SNCA 5ELCA 1K3RA 1D5MC 3EQLC 3HZXA 3T1YL 2HQLA 4GN4B 4HJ9A 4RH6A 4A3JG 2UUBQ 5H1SE 3PIOA 3I8ZA 4APVA 4N9PA 3NBIA 2UU9L 5M5YB 3NPPA 2Z6KA 2GVAA 1CM9A 4ZCKA 4XYQA 3RZOB 2HHHL 1HZCA 3BJUA 1MSGA 4L6TB 3D6CA 2KJXA 3WDNA 3TZUA 3AYHB 2Q8IB 3WWVA 2AQ3B 2ENBA 1KDAA 4JK1C 1K83H 3E0JA 4LF8L 4XIGS 2F4VL 2EJFC 3FKIH 1S5DD 2PPBC 1YNNC 3RZDH 2ZXRA 3TREA 4FDBA 3NSWA 4C1NK 2JEBI 1SN8A 3BVZA 1L1OC 4L63B 1DJRD 1AH9A 1JICA 4LFBQ 1EYCA 1SNMA 1PA6A 1BVSA 2JN4A 3TP7A 2VY3A 3ERQA 3H0GH 3I2ZA 4YCVA 3DWQA 4X62L 1IKMA 2B3GA 1Y1WB 2F0GA 2F4IA 1FJGQ 1ENCA 3J80L 2KEDA 2XVSA 5C4JB 5E4WC 1N36Q 2QEJC 3S14B 3EVQA 4P72A 4JI2L 2Y0SE 4BXXG 1I4PA 1QUQA 1FL0A 2RA4A 5T1IA 5D14A 3CF5A 5KNDA 2QW7A 4DAPA 4C3IB 4R8IA 2MP1A 1SJED 1SYDA 1OXVA 2VS1A 2CCZA 3NEMA 1AW7A 3OWEB 3LNNA 3AFPA 3MTSA 2R7FA 3S16H 4BBRH 1YEZA 4LWCA 4J15A 3AQQA 1BUVT 1X3QA 3K0YA 1A3TA 3STBC 1F2YA 1HPCA 4OGQC 4X65Q 4CJ1B 4PZ8A 1PZID 2JA7B 1ESFA 3GV3A 3QR8A 1Y1VG 1TWFH 3K58A 5JJIA 2F1MA 2VNUD 4KKSA 4DXGA 4AH6A 3M7GA 3C46A 2BDOA 1KNEA 2NWGA 4ZKBB 3F1ZA 3DM3A 2A68C 1Z47A 4MZ9A 3FVQA 2PW7A 2D9UA 1NSNS 2XTIA 1B9MA 1O7YA 3DHQA 1YI2A 4JI1Q 4C3JH 1UEBA 1R9TB 4A3EG 1E22A 3HGBA 1D1KA 1WYDA 1G6PA 1BOSA 1TY2A 4DK1A 1ESRA 5IIFA 1FNVA 3S2DB 2H5XA 4DV1Q 3A56A 4A3CH 3G4SA 4A3LH 2R7ZH 2F0NA 4A3GH 4MIUA 1GD7A 1IZ6A 3GQBA 4JI7L 1E24A 4BY1B 4IUPA 3KJOA 5E7NA 1LTGD 3TP6A 1AP0A 1RKNA 2UXBQ 3MA2B 3A8KE 1SYCA 1CUKA 4IPCA 3S24A 1SMYC 2VQFQ 1HNZL 3C1FA 1SE4A 3A7LA 4A3FG 5M5YH 5LMUQ 2ATWA 1SXTA 2Z9HA 3RZOH 2OCEA 3L0OA 2G9DA 1EFID 3SK6A 4ZK9B 3MC0B 1EY6A 3D8GA 2E2HB 2B8GA 2ZJRA 1HUMA 4EX5A 2F0HA 1BR9A 1JWUD 3TSSA 1ASZA 2HCCA 1HTPA 1NJIC 4B3RQ 2NVYB 2R3ZA 2FMCA 1EIHA 1XJVA 3J81L 3SR1A 3ZJYC 2IT1A 4V0BA 2RHQB 2HCIA 4IUTA 2DUDA 2N8NA 1Y1VB 3I73A 1HNXQ 1IYVA 1M4VA 4DV5L 1SYFA 3D0FA 1Y1WH 4JBWA 2EYJA 1X32A 5I2XA 3UDXA 4RG1A 1WCMH 4KKTA 5IP9H 4JI0L 3K7AB 2AUJD 4JI3Q 5EBCA 2K5VA 5JJLA 1E0BA 3T56B 3SHLA 3ITPA 2WB1E 4IN3A 1EFWA 3IKJA 4KKUA 1VQ6A 2PZTA 2Q8RE 1FGUA 2K14A 4KD4A 2D5DA 4C3IH 4TQUS 4X64Q 2EVBA 3CHBD 4ZAIA 5FLMG 1J5EL 1G51A 4KLKA 3V96A 4DV6Q 1WJJA 2RDFA 3K5MA 2QKIC 4B3SQ 1VDZA 3M4QA 2F3WA 1GXDC 1BDOA 4CKBA 5CV4A 4KJOA 2NTTA 1EEID 2VUMB 2K32A 5FO8B 2F0IA 1PLFA 1CKOA 4A4IA 2NN6I 3KBXA 3U9SA 3X3MA 4A3FB 2JA7H 4H44C 1LM0A 3G48A 3CD6A 4BWGB 1MSHA 5JJZA 3L2PA 1ILQA 3VR3A 4DAYA 2K28A 5IGCA 3OW2A 3DWAA 1H9MA 2K6AA 1Q8IA 1KTKA 4L5RC 1ET6A 2A6HC 1P8LA 3RMHA 2PQAA 2QF7A 1EQTA 1G2SA 3SVMA 3F2DA 4YCUA 1II3A 1IBLQ 1R9TH 2F0UA 2A69C 4IZ8A 1W6KA 2ZTCA 5IYDH 1VMPA 2KBNA 2Q2UA 1HUNA 4LFCL 1C8CA 4OO1H 1LTSD 5BR8L 1IW7D 1HCZA 1B1ZA 4DV4Q 3S2DH 4JYAQ 3QOLA 1Q86C 3I72A 3RNUA 1I50B 4UAIA 5D3IB 2EXDA 5FKAC 3S1MH 3MXNA 1MIUA 4DR4L 4DV7Q 4PZ6A 4BY1H 2KHIA 2IL8A 5DNFA 5CMDA 1YNJD 2DGYA 2CH4A 2GA4B 3K6OA 4WJ4A 3I90A 4B08A 3M3YH 4LF6L 3NUCA 3HOYB 4A3DH 5TSSA 4PMBA 4JI4Q 1M1KC 2G9HD 1JE4A 1LTBD 3J7A5 1JWSD 2DY7A 2BDNA 1IHZA 5C3EG 1YJ9A 2N3SA 2UUAL 2E2HH 3JAMc 1VQGA 4NXML 1XNRQ 3GTGB 1UWVA 3J7YW 2NVYH 2RCNA 2F0LA 3LX0A 1EY0A 1BBWA 4DXFA 3I4LA 3CCJA 1VQAA 2L4NA 5JAVA 3D4DA 4DV0Q 3M4PA 3KLWA 2KVMA 5LL6X 3C1EA 1MBYA 3SK4A 3CC2A 3DUZA 3K7AH 1O7IA 1SRUA 5ELNA 2V4DA 4O1NA 4LF7Q 3MFYA 4CGYB 2SEBD 4DN4M 4DK0A 2VQEQ 3CRLC 2K50A 2Q2IA 3OIQA 3V05A 2K5QA 2JA9A 5J39A 5HURA 4JBMA 4A3MB 3CC7A 3IRBA 5KGUA 5GAHC 4DK3C 4LNQA 1C9OA 2K04A 3ICEA 3GTJB 4X6AH 3VR4A 4ALPA 1NY4A 3CAMA 2PYKA 3E3XA 1S5ED 2VUMH 1B3QA 4OWXB 2FXQA 2DN8A 3VYTA 1I5FA 1H9KA 4HIMA 1YHQA 4RKLA 3FKIG 4FVMA 4C3HG 3HOWH 4A3FH 4KY5A 3CCRA 4B3MQ 2SDFA 4GOPB 1WVLA 1EYAA 3TN2A 1WTPA 3NTHA 1A2UA 4F8MA 4KN4C 1JWMD 1BCPB 2SNMA 2EOTA 3T1YQ 1U4RA 2OEOA 2QDBA 3MFGA 1SYEA 3KUPA 3QIAA 1Q1EA 3CCEA 1SE8A 4Y7NB 2Q2TA 4IPGA 2Z0SA 4HAEA 1XNQL 1QNKA 2F0EA 4R8NA 1CQFA 2EPBA 4RCOA 4JV5L 3Q6SA 2IJ0A 3T51B 2UU9Q 3HOXB 1ICWA 3OIPA 5AFWA 5C0XI 3EBEA 2HHHQ 3PF4A 2RSNA 2QGQA 4UHVA 3BVMA 1B4OA 1DYQA 1JOOA 5GADC 2UXDL 2JJQA 2NVQB 1Q7YC 2MO0A 2EZVA 2J0TD 1PH9A 1I50H 4LF8Q 2F4VQ 1ET9A 1F9RA 5E3FA 4QGUA 4BA2I 1STBA 1KNAA 4DR1L 1PYWD 3NELA 3A54A 1VS0A 4OL7A 4FO2A 2PMZB 1MJEA 1TWHB 1GM5A 4BBRG 5DAUA 3S9WA 1PRTB 4A76A 3CCMA 2A6EC 4JI5L 5IGEA 5C0XJ 2YV5A 2XGTA 4ZUIA 4C56C 5C6AA 4X62Q 3HOYH 3JC66 3RR5A 1CI3M 2F3VA 3TDQA 3I70A 1KXLA 3I7FA 2B2TA 2NYZD 2BH8A 3H09A 5JVG3 5IGFA 5EQ0A 2L0CA 4JI2Q 4X3TA 2QA4A 1K8AC 1TWAB 1K83B 2KHSA 2F0WA 3GTGH 2IX0A 2CW0C 4C3HB 2AWNA 4C3JG 1N33L 1KD1C 2B2WA 4DF7A 4LF9L 4DNTB 1DM0B 5KYIA 2LKVA 1NR2A 3H3VC 3PIP3 1ZEQX 2CKZB 2IY5B 2K5DA 3MVVA 1NMFA 1CZGA 2B2VC 2PO4A 3S1NB 5F2DA 5KRUA 1M90C 4BA1I 1ENFA 2I0QA 3GTPB 2EXZA 1CZWA 5I2YA 1S5BD 4A3CG 2XN9C 2A5HA 2R7ZG 1TXYA 4A3GG 3JAMi 1WD0A 1Q3LA 2EE1A 2LS01 1VQHA 4J8QA 5KIXA 1STHA 1Q8KA 4J6HA 4A3MH 2KCTA 5I6WA 5GAGC 2AQ2B 5I9PA 1F9QA 4OIKA 3H6MA 1XMOL 1BCPD 2YU9B 2K05A 3VR6A 3HG9A 4LJZC 1XMQL 2A73B 3GTJH 1IYJB 1NUCA 1VQMA 2LSSA 4XYOA 1PH5A 2KCCA 4RHSA 4Q5VA 1AFPA 4BBRB 1GJXA 2I5HA 3P7JA 1VQIA 2KOLA 3S1QH 1D8LA 3CMAA 1I94L 1PHJA 2EYHA 5C4HA 1YBYA 3KJPA 2K7VA 1RDPD 1JB3A 3J80c 5M3FH 4YCWA 4CDFC 3KOJA 5M3MB 2I5MX 2HQEA 5JJKA 1VQJA 3MEFA 1RODA 4JI7Q 4UP7A 3E9IA 2EY5A 4CJ2C 2PZUA 1Y1WG 1PYSB 1PTOB 4EQ5A 1YITA 4AYBG 1WCMG 2ZT9C 1S72A 1XXGA 5IP9G 1HNZQ 3LWEA 3HOXH 5IT9L 1U9RA 1IBKL 1NBWA 1SE2A 3FMCA 4ZYSA 5CBAE 1ZYRC 3D4RA 4ZUJA 1IL2A 4JOIA 1W6JA 5M9OA 4MNOA 1BBXC 1VCIA 2YTYA 3IL8A 3QWNA 5KNCA 1HZBA 4L5SA 1Q46A 4UP8A 3PUWA 5DLQE 1RTNA 1PH8A 1JORA 1KIXA 4OX9L 1HNWL 2R7ZB 2B8FA 4KHVA 1TWHH 4A3GB 2F0KA 1RF2D 1U4MA 1DCZA 2CWPA 2VL6A 3PF5A 2ZTDA 1DOMA 1MD2D 5A2QE 4HR7B 4G57A 5J22A 5IGGA 5AJ3L 4KV6A 1SYBA 2JA7G 4JI0Q 2N49A 2E5LL 5FOBB 4N8FA 3NQTA 4QIWE 5C5LA 1NTGA 3G71A 3AEVA 1V1PB 2AUKA 1TWAH 1AE2A 4RCNA 2L15A 2Z6BA 2ZXPA 1J5EQ 4C3HH 1YJNA 1A62A 4PNYA 3BYTB 3TRZA 3OYYA 4JC0A 4IURA 1O7LA 3BVGA 1SR3A 5IYDG 1D5ZC 4OO1G 3S1NH 1B44D 4M8AA 3GTPH 2ZM6L 3KYHC 4DV3L 4TRDA 4AYBB 1WCMB 1VQDA 1RHPA 1WTQA 4KHPL 1JQYD 1CHPD 1EU4A 4BY1G 4YY3L 3UDGA 1LT6D 5KNBA 5EPKA 4BS9A 5FLXL 1LT3D 2IX3A 2IWHA 3R3OA 4IUVA 1EY7A 4JI8L 4N8X1 4MTKA 4A3DG 3JAME 4H02A 3MAQA 2YU9H 1EWIA 2NZOA 1EWHA 1EOTA 2E74C 5CV8A 1Y69U 5IODA 2X69A 3J81c 3VR2A 4HEDA 1PTOD 4G7HC 3EA6A 1SAPA 5CYUA 4OEMB 2UUCL 5I4DA 5HGQA 4LF4L 4LFCQ 4K8IA 5BR8Q 4FNFA 1CSQA 1KL9A 2NBFA 1QVCA 5C3WA 3Q22A 2K1BA 1SFOB 3E0EA 1LTID 1IW7C 3BU2A 1DD2A 1UNSA 4RFBA 2E2DC 2N55A 4GKJL 5M3MH 2ES2A 1Q82C 2RQXA 2WACA 2NB0A 2JYOA 4GNXC 5EPLA 1WTOA 5JPNC 2MUYA 2O5IC 1IL8A 5DM73 1BKBA 4IJLA 1PTOH 1HH2P 1A6XA 2KQ3A 3AB9A 3RN5A 3F2UA 1JCKB 3KLSX 1B50A 3PO2H 3OMCA 4DFAA 4LF6Q 3PUXA 2K33A 2L12A 3PIPA 1ZXTA 4FF4A 5JEAH 1VQFA 5K36G 1ML0D 2PI2E 1L1OB 5E4XA 5DEHA 1B8AA 1Y8OB 3E6ZX 2UUAQ 4JBJA 1D1IA 4NXMQ 1TKWB 1GUTA 3LWUA 4CDEC 4WFN3 3S1MB 2I07B 2Z6KC 1WTHA 1C48A 3SXHA 1I6VC 1EY4A 4H0LC 4DNIA 3HKZB 1JJGA 1F9SA 3A5ZB 4OWWB 2VUMG 3RN2A 4YHHL 4IFDI 3DM1A 2B63H 1PYBA 1XTCD 4IALA 4B3TL 3KF6B 3HOWG 3M3YB 4K5WA 4A3DB 4HMJA 3NP8A 2ZJQA 1AE3A 1TWCB 1PH2A 3DMUA 3BDCA 4ODGA 1XWEA 2O2LD 3R8BA 1HZ9A 1KHIA 1O78A 2A8VA 2OTJA 1O80A 3KDFA 2L5TA 4FYDA 1VF5C 2BE5D 5ISRA 2DY8A 4FXDA 4IFDJ 2F0JA 4XT3B 4R4OA 2X6LA 1Y8NB 2MFIA 3FPPA 5L37A 4GZYC 1PDQA 3KFUA 2F0VA 4BY7G 3BZKA 3PO3B 2WP8J 1H9SA 3FP9A 1VQKA 3PQIA 1X56A 4OELB 5IGBA 1A63A 1LTLA 4MHEA 2RVLA 3Q23A 2UXCQ 1JB7A 4HSVA 4GOPA 1OXSC 3GTOB 3EFXD 4DGZA 4F87A 2JP1A 1Q1BA 1BCPF 1I4RA 1RJTA 3TBIB 1DOKA 2WIIB 2EDGA 2XRSD 4JI6L 1WI5A 4XTCS 1IKLA 2A74C 1LT4D 4CDCC 3HOYG 4K2KA 4NB3A 4QMGA 1XNQQ 4RA8A 3VDYA 1GUWA 1AEXA 4JV5Q 3NE5B 3NHHA 1UAPA 1GUOA 1Z7TA 3L9AX 2Z8LA 2F0DA 4K0KL 5GQOA 2VW9A 5CV5A 1CKNA 1HQMC 4P73A 1X54A 1YNND 4FXGC 3RLOA 5CBEE 4DR7Q 2BA1A 1KLUD 4GKKL 2HD3A 2UXDQ 5LL6S 1STEA 1P16A 1SFOH 3HOWB 1N34L 1LABA 1SEBD 1GUSA 1Y8PB 1C4QA 2F0QA 2DNCA 4ULLA 2EYOA 3J7AF 4GLXA 3I4MB 4IUNA 5C0XH 4JI5Q 3J81i 1IXRA 4CBVA 2F52A 2L11A 1GO3E 3P75A 2E76C 1PH3A 2FINB 4ME3A 2X6GA 1STNA 2P5ZX 1K8OA 4QJFA 4IPHA 4XT1B 1VQNA 4BY7B 3EN2A 4X3SA 4A3MG 1VQ8A 3BDOA 4R4IA 4DPGA 3T1HL 1LLRD 1MHWC 2BCOA 4DU9A 4ZKCB 3DWPA 1FR3A 1K9MC 4RHRA 5EKKA 3H3VI 3CMEA 2LY7A 1N33Q 2KCNA 1D7QA 1Q81C 1X55A 4LF9Q 2HDLA 4PV1C 1KABA 2NZ1D 1CA6A 1QVFA 1SDFA 3R2TA 4EQOA 5EGTA 1PFMA 4R1JA 1HXYD 1TS3A 5M3FG 3TS0A 2OTLA 1XPRA 1TWCH 1T9HA 5EPJA 1FNWA 4AIMA 2EYMA 2JK8A 5CV7A 3NBHA 1UE1A 4K6DA 3EROA 3QG1A 2O5JC 2A68D 5GROA 3OMGA 4JVZA 3N52A 1X3EA 4K2LA 3M85A 4A3KB 3OW7A 1E3PA 3HOXG 4JPBW 1XMOQ 2E2IB 1XMQQ 4QY7A 3ONAB 2IW3A 1BCPC 3GD7A 4QCLA 3PO3H 4KMUC 1K8GA 1AZPA 1PXUA 2ZXOA 4O2DA 1I94Q 3V2TA 3GTOH 3VA5A 1QJOA 4KK7A 2EYLA 1X65A 1W2BA 1LTTD 4DUZL 4AQYL 4KY6A 4C1NI 4GLAC 5C4ZA 4F88A 3HOUG 1EZ8A 2VB2X 4K6LA 5K36H 1HA6A 1SMXA 1PTOF 1HQRD 1Z9FA 4CDDC 5CORA 1EIGA 2K5HA 5LMUL 3VA7A 5M5XB 4L5QA 3KDFB 4EVOA 5DM63 4DNRB 1KRSA 1EIYB 4NW2A 1YHAA 1IBKQ 2Y0SB 4XDXA 4HJ8A 3F2BA 3SE0A 1FGBD 2D62A 4YWMA 3TEHB 2VXWA 2YTXA 5A2QL 2JQOA 1DGSA 1I4XA 1ASYA 2EJGC 3KF8A 3IFDA 4DR6L 3S1QB 2AKWB 1H9SB 1U4LA 2XWJB 5EKIA 2D2CC 5FO7B 1HJPA 3HEJA 2ICIA 1HA5A 5FJ8H 4NDXA 3PIO3 4H7BA 2JA6G 5M3FB 1V1OA 4OX9Q 1HNWQ 2K03A 1SJHD 2B2YA 1SYGA 1HNXL 2HIXA 5G3LD 3I4MH 3T16A 1STGA 4G7ZC 4HIDA 5C3XA 4XQJA 4XQNA 1QB5D 1U5KA 2VB3X 2R92G 5AJ3Q 3DEPA 1EL0A 2VZAA 4O0AA 5C44B 3HRZC 1V1PA 1BO0A 1FD7D 1QWYA 2LMCB 2H4OA 4BY7H 1LYLA 3J81E 1SNDA 3QB3A 4DA2A 5BN4A 1CKNB 1CSPA 2Z4IA 2A19A 1UEAB 1KQSA 2MPMA 4GLVB 2B2UA 3TS2A 5C4XG 1I6HB 2E2JB 1STAA 2NN6G 1R4PB 2G5DA 1C0AA 3HOUB 2K5WA 5J3BA 4RWSC 5BN5A 3K81C 1EIFA 2I46A 2N78A 3UI2A 5JPMC 1G6ZA 3MZ5A 1STYA 2ZM6Q 4EQPA 4DV3Q 5IT9c 3S1RB 3K5NA 2K01A 2EYFA 3HP3A 4KHPQ 5M3MG 3C2PA 1OXTA 1V43A 1ONLA 3BZDB 1EY8A 1TT2A 3CW2C 4YY3Q 4RMFA 2GVBA 1KRTA 2M2LA 2E8GA 3CKIB 4A3KH 3AMUA 1VF7A 1HR0L 2H1EA 3PO2G 3D31A 4JI8Q 2A69D 2E2IH 1X6OA 3GTKH 2JE6I 3OOCA 2NUCA 2JA6B 3HFZB 5JEAG 3A8JE 1Z6HA 2SNSA 1L2FA 1CK1A 2AMCB 1XPOA 1PFBA 4ILWA 3A5UA 2UUCQ 4MN3A 5D3DA 5LMNL 4DUYL 4LF4Q 1U4PA 4C2MB 5IY0A 1CTMA 2KCMA 1VQLA 2Q8TA 1I4GA 2R92B 4DAVA 3NK9A 4GKJQ 1E2WA 1S4ZA 4CKEA 1NCVA 1EY9A 1GOZA 3NBHB 5I6YA 2OF1A 2B63G 1CHQD 3HOVB 1TQOA 1QZGA 5M5XH 2HT1A 2J7ZA 2WAQG 5IYBH 4R9WA 1F9PA 2NTSA 4MTNA 4HJ5A 5C4XB 2TSSA 1L1OA 3MHBA 3GTQB 3H91A 1EQVA 1ZKOA 3GP7A 3MXPA 4DR5L 3PCOB 1YIJA 3RLNA 1OXUA 4FXKC 1X3PA 4G4KA 2EYPA 1YNXA 1TS2A 5CGKA 4GN3B 2K75A 2DJGC 4QUFA 1HR0W 2YYZA 3PUZA 4IO9A 3TP8A 3KF6A 4HN7A 3OSOA 1WTRA 1G291 4YHHQ 5FLXc 1XX8A 1TVXA 3M4OH 4WJWA 3PO2B 5A35A 1PRTD 2ALYB 1QG7A 4L8JA 5FO9B 4KD3A 3NWTA 5C44H 5LMNW 2FFKB 1PH1A 4X3UA 4ZQ3A 4LW1A 3OPOA 1BF4A 4RGOS 1NE3A 2F03A 4JG2A 4Y52H 1TS5A 2MJ8A 3KF8B 1KC8C 2RDGA 1VQCA 2JSOA 5NUCA 3BG3A 3CCVA 4IFDH 1J8IA 4DV2L 2I5LX 1U0LA 4FF3A 1I6HH
chains in the Genus database with same CATH topology
4LFCL 4NXMQ 2E2JH 5BR8L 3CQZH 4DV4Q 3S2DH 4JYAQ 1Q86C 3HOUH 1IBMQ 2Z6KC 3ULJA 3RNUA 4DR7L 1I3QH 3HKZE 2PNHA 1E1TA 2EXDA 4DNIA 3S1MH 1JJGA 3A5ZB 4OWWB 1MIUA 4DV5Q 2VUMG 4DR4L 3CXCA 3RN2A 4YHHL 4DV7Q 4IFDI 4PZ6A 4BY1H 2KHIA 2B63H 2ZTEA 4PMWA 3S1RH 1HZAA 1PYBA 4OO1I 3PUYA 4BBSG 4B3TL 1UE5A 3KF6B 2DGYA 3HOWG 3CPFA 3GDEA 4WJ4A 4NXNQ 3M3YH 1UE6A 1V9PA 1FVIA 4LF6L 3S2HH 4A3DH 4DAYB 2ZJQA 1AE3A 1YVCA 5FLMH 1MKHA 1PH2A 4JI4Q 4JI6Q 1M1KC 1N32L 1IBLL 5C0XG 1YJWA 3J7A5 1VQBA 1HZ9A 1KHIA 2GN5A 2A8VA 5C3EG 1YJ9A 2PQAB 2QEXA 2OTJA 1JE5A 3KDFA 1B7YB 2N3SA 2OQKA 4TVAB 1JJ2A 2UUAL 2E2HH 2JA6H 2JA7G 2WFWA 1EQQA 4IFDJ 3JAMc 1VQGA 3J7ZC 4R4OA 4P74A 4NXML 2AWOA 3PGZA 1XNRQ 3NENA 4DV4L 1UWVA 2MFIA 3E9HA 4LFAQ 1YHBA 4JYAL 2NVYH 2RCNA 1IBML 4K0KQ 3CCSA 1Q12A 3KFUA 1BBWA 4BY7G 3BZKA 2WP8J 3FP9A 3CCJA 1VQKA 1VQAA 1X56A 4C2MH 4GKKQ 4QQBX 1A63A 1LTLA 4DV7L 3A74A 1X3GA 2UXCQ 1N8RC 1EYGA 2R92H 4DV0Q 1JB7A 3M4PA 4GOPA 3KLWA 3OTOQ 1N34Q 3I4NH 4YWLA 1OXSC 2F3IA 1B70B 3MXNB 3HKZG 1W3SA 2LXJA 1Q1BA 4LF5Q 3CC2A 4A93H 3EIVA 1PVOA 1MJCA 3K7AH 3PSIA 4L5TA 1O7IA 1SRUA 5ELNA 3LGJA 4NXNL 5IP7G 2MNAA 2BH2A 3HOVH 4JI6L 4JI4L 3K0XA 4LF7Q 3M7NA 1WI5A 3HOZG 4A3LG 2VQEQ 4XTCS 2K50A 2Q2IA 1GKHA 2JA9A 3HOYG 5C4XH 3AFQA 4JBMA 2IX1A 4NB3A 1XNQQ 3GTQH 3VDYA 3CC7A 3PV0A 4JV5Q 2YTVA 3IRBA 4PZ7A 3M9BA 3S17H 5GAHC 4DK3C 4LNQA 1XNRL 2ASBA 2JA5G 4LFAL 4K0KL 5GQOA 1C9OA 3ICEA 2VW9A 4HJAA 2JA8H 4X6AH 1CKNA 3W1GA 4ALPA 1VQ9A 4P73A 1X54A 1NY4A 3CAMA 4IJHA 3L7ZC 3RLOA 4DR7Q 4GKKL 2BA1A 2KHJA 4YWKA 3T1HQ 2VUMH 2CWAA 1A0IA 3CCUA 2UXDQ 3FHWA 4OWXB 1UE7A 1H95A 2FXQA 1P16A 1SFOH 1PH7A 4DV0L 1I5FA 3OTOL 4HIMA 4A3IG 1YHQA 1N34L 4DR4Q 3FKIG 4DAMA 3PO3G 3I56A 3HOWH 4A3FH 4LF5L 1EOVA 3CCRA 1PH4A 4B3MQ 4JOIC 4LUZA 4GOPB 1GVPA 4B3TQ 4HIOA 2JEAI 4GS3A 2ZJPA 1WFQA 4LF7L 1RL2A 1NMGA 2R7DA 4GLXA 3T1YQ 3K80C 4PG3A 2VQEL 4JI5Q 1V1QA 3J81i 1A8VA 1Q1EA 1IXRA 1SE8A 4R4QA 3F8TA 2KENA 5C3EH 3CCEA 1K73C 1K0RA 4IPGA 2Z0SA 1SROA 2F52A 3U58A 4HJ7A 3TQYA 5IWAQ 4Y7NH 4HIKA 1GO3E 2D0OA 2MQHA 1XNQL 4JV5L 5IYDH 1PH3A 2Q2HA 4ME3A 2NVXH 3J80i 4QJFA 2UU9Q 4X66Q 2RF4A 4IPHA 3H3VH 4JBKA 3HKSA 4DKAC 1VQNA 4P71A 3K7UC 3EN2A 1Y14B 3W5OA 4A75A 4A3MG 4DR3Q 1QVGA 5C0XI 3EBEA 4QL5A 2HHHQ 2C35B 1VQ8A 3PF4A 2QGQA 4R4IA 1OXXK 4JCVE 1X9NA 5GADC 4GNXA 2R93G 5IYCG 4DPGA 3T1HL 3U50C 5ELOA 2JJQA 2UXDL 1Q7YC 2MO0A 1K9MC 3ERSX 1I50H 1PH9A 4LF8Q 2F4VQ 2K52A 3H3VI 2K4KA 2NVQH 3CMEA 4QGUA 4BA2I 4OXPA 1S40A 1N33Q 2CFMA 4DR1L 1D7QA 1OTCA 2PMZE 1Q81C 1X55A 4DR2Q 3NELA 4B3ML 4LF9Q 4IOAA 3ULLA 1VS0A 1MJEA 4GN5A 3I4OA 1GM5A 4BBRG 1K3RA 5FJ8G 1QVFA 3T1YL 2HQLA 1JJCB 4GN4B 4A76A 3CCMA 4JI5L 5C0XJ 2YV5A 4R1JA 2XGTA 3K8AA 4X62Q 4DUZQ 5M3FG 4HJ9A 3JC66 4AQYQ 3TS0A 3HOYH 2D0PA 2OTLA 3RR5A 1XPRA 1TWCH 1T9HA 4A3JG 5H1SE 3PIOA 4AIMA 5IWAL 2UUBQ 2JK8A 4KHZA 1KXLA 1UE1A 3I7FA 3I4MG 4APVA 2BH8A 4UPAA 3J81j 1SLJA 2UU9L 1RIPA 4X66L 2ID0A 2Z6KA 2JA5H 2GVAA 5GROA 4DR3L 3M85A 1X3EA 2HHHL 4JI2Q 1HZCA 3BJUA 2QA4A 1E3PA 1E1OA 5HY6A 3HOXG 1K8AC 3AYHB 3GTGH 3WWVA 1XMOQ 2IX0A 2NZHA 1XMQQ 1K83H 4QY7A 1PV4A 3GTMH 3GD7A 4XIGS 4LF8L 2F4VL 4A3IH 1BBUA 2AWNA 3FKIH 2IHFA 4GNXB 3PO3H 1N33L 3RZDH 1KD1C 1K8GA 4DR6Q 3TREA 4DR2L 4LF9L 4FDBA 1CKMA 1J6QA 2JEBI 4O2DA 1SN8A 1I94Q 2CKZB 1L1OC 2IY5B 1AH9A 3GTOH 1NMFA 4LFBQ 1M90C 1PA6A 4BA1I 1BVSA 1W2BA 1X65A 5GAEC 2I0QA 2VY3A 3I2ZA 2HIVA 3H0GH 4YCVA 4X62L 4DUZL 4AQYL 4A3CG 2B3GA 4GLAC 3HOUG 2UUBL 3U4VA 1FJGQ 2R7ZG 4WJ3M 1TXYA 3CPWA 4A3GG 3JAMi 1SMXA 1WOCA 1Z9FA 1VQHA 1N36Q 1Q8KA 5C4JH 4A3MH 2KCTA 2K5HA 5LMUL 5GAGC 4L5QA 3KDFB 4P72A 4JI2L 2Y0SE 4BXXG 1KRSA 1QUQA 1EIYB 1FL0A 1YHAA 1IBKQ 3S14H 3CF5A 1XMOL 5IYCH 2R93H 4HJ8A 3F2BA 4OWTB 4IPDA 3TEHB 2D62A 4NPSA 4YWMA 3W1BA 3GTJH 1IYJB 1XMQL 1VQMA 4A3KG 2YTXA 2LSSA 2JQOA 4POGA 1OXVA 1DGSA 2VS1A 1ASYA 2CCZA 3NEMA 1PH5A 3UDFA 4DR6L 2PI2A 2AKWB 5EAYA 1TWGH 2I5HA 3AFPA 4BBSH 1VQIA 2R7FA 3S16H 3S1QH 4DR1Q 1N9WA 4BBRH 1D8LA 1YEZA 1HJPA 3CMAA 1I94L 4LWCA 1PH6A 4UP9A 5FJ8H 1PHJA 4J15A 4LFBL 2JA6G 3AQQA 1YBYA 3KJPA 4OX9Q 1HNWQ 3STBC 3J80c 5M3FH 4YCWA 4KI0A 3F2CA 4X65Q 4A3JH 1HNXL 1FJGL 2HIXA 3KOJA 3PUVA 4PZ8A 3I4MH 2AHOB 2I5MX 2LXKA 5JJKA 1VQJA 3MEFA 3A0JA 1X3FA 4JI7Q 4UP7A 3E9IA 4HIDA 1N36L 1Y1VG 1TWFH 1U5KA 1Y1WG 5JJIA 1PYSB 2R92G 2Q2TA 4EQ5A 5AJ3Q 1YITA 2B29A 4AYBG 1WCMG 1VQPA 1S72A 2IHEA 3I4NG 2VNUD 4AH6A 1HNZQ 2VZAA 4O0AA 5IP9G 3HOXH 4LUOA 1IBKL 1NBWA 4A93G 3DM3A 3F1ZA 4MZ9A 1Z47A 4BY7H 4IOCA 1LYLA 1QUQB 2XTIA 1VQ4A 3U4ZA 1IL2A 1YI2A 4JI1Q 5IYBG 4C3JH 1HR0Q 1UEBA 4JOIA 1CKNB 1E22A 4A3EG 1CSPA 2Y0SG 4MNOA 1VCIA 2A19A 2YTYA 1WYDA 2OQ0A 1EQRA 1KQSA 4GLVB 1G6PA 1HZBA 2EQSA 4L5SA 3TS2A 5C4XG 1XTDA 1Q46A 4UP8A 3PUWA 5DLQE 5IP7H 1PH8A 1LUZA 3STBD 2NN6G 4A3BG 3DLLA 1KIXA 2A1AA 2H5XA 4DV1Q 4OX9L 4R4CA 5J3BA 1HNWL 1C0AA 1TWHH 5LMNQ 3HOZH 4DUYQ 3G4SA 4A3CH 4A3LH 3UE1A 3K81C 4X65L 1EIFA 2CWPA 2VL6A 3PF5A 2N78A 2JA8G 2R7ZH 4A3GH 2ZTDA 1GD7A 3UDIA 1IZ6A 3UE0A 4JI7L 1E24A 1VQ7A 2ZM6Q 4DV3Q 3KJOA 5IT9c 5E7NA 2WAQE 2R6GA 4KHPQ 2UXBQ 5M3MG 5AJ3L 4BXXH 5IE8A 1OXTA 1CUKA 1V43A 4IPCA 3S24A 2VQFQ 1HNZL 3CW2C 1VQ5A 4JI0Q 2N49A 5M5YH 5LMUQ 4YY3Q 4A3FG 2E5LL 2ATWA 4RMFA 3GTLH 2GVBA 1KRTA 4QIWE 1KAWA 4GOPC 1NTGA 2E8GA 3G71A 4A3KH 3AEVA 3RZOH 2OCEA 4JI1L 1HR0L 3L0OA 5C44G 1TWAH 3PO2G 3D31A 1AE2A 4JI8Q 2E2IH 1X6OA 2L15A 5JEAJ 3GTKH 1J5EQ 3S15H 2JE6I 4C3HH 1YJNA 3GO5A 3HFZB 5JEAG 1A62A 2ZJRA 2OWOA 4EX5A 4UY8C 3BZCA 1L2FA 2AMCB 1ASZA 1XPOA 4DR5Q 3TRZA 2RHSB 4DV1L 1NJIC 4OONA 4B3RQ 3A5UA 3OYYA 4JC0A 2UUCQ 4IFDG 5LMNL 4DUYL 1SR3A 5IYDG 1XJVA 4LF4Q 3ZJYC 2IT1A 4OO1G 2RHQB 3S1NH 3G6EA 4A3BH 2DUDA 5IY0A 2N8NA 2KCMA 4AYBE 1HNXQ 3GTPH 1VQLA 2ZM6L 3KYHC 4DV3L 4DV5L 1Y1VH 3D0FA 1VQDA 1Y1WH 4GKJQ 4JBWA 1L0WA 4KHPL 2MO1A 3UDXA 2UXBL 4RG1A 1WCMH 2EIFA 2VQFL 5IP9H 3NBHB 4JI0L 4BY1G 4YY3L 4JI3Q 2B63G 3UDGA 2K5VA 4P75A 5JJLA 1QZGA 5M5XH 3ULPA 2WB1E 3H15A 1E7ZA 2HT1A 1EFWA 2WAQG 5IYBH 1VQ6A 4A3EH 3CC4A 4JI8L 4MTNA 1FGUA 2K14A 4HJ5A 4H02A 1PFSA 4C3IH 4TQUS 2YU9H 4X64Q 4A3DG 3I55A 5FLMG 1J5EL 1L1OA 1EWIA 3ER0A 1G51A 2NZOA 4KLKA 1XPUA 4DV6Q 4DK6C 1WJJA 3J81c 5M5WH 1S3OA 3RLFA 4DR5L 4B3RL 1QZHA 3CCLA 3PCOB 4B3SQ 1YIJA 2UUCL 2CQOA 3M4QA 4DV2Q 3RLNA 5HGQA 1OXUA 4LF4L 2BA0A 4LFCQ 2K5NA 5BR8Q 1C7YA 1CSQA 1KL9A 1YNXA 3Q8DA 4GN3B 1QVCA 2K75A 3E0EA 1HR0W 1CKOA 3BU2A 4A4IA 2YYZA 2NN6I 4GKJL 2UXCL 5M3MH 3PUZA 2ES2A 4IO9A 3KF6A 1EUJA 1Q82C 2JA7H 1G291 4YHHQ 1LM0A 5FLXc 4GNXC 3G48A 3CD6A 4POFA 4JI3L 3M4OH 2NVTH 4R4TA 3SGIA 1BKBA 3L2PA 4IJLA 1HH2P 3CCQA 2ALYB 3OW2A 2E5LQ 3RN5A 5C44H 1VQEA 4L5RC 5LMNW 3PO2H 4LF6Q 3PUXA 1P8LA 1PH1A 4X64L 3HOVG 2PQAA 4LW1A 3H0GG 3PIPA 4DV6L 3F2DA 1N32Q 3B6YA 4LUVA 4YCUA 1VQOA 1IBLQ 1VQFA 1R9TH 1NE3A 2WB1G 5K36G 2PI2E 4JG2A 4Y52H 1L1OB 3KF8B 1KC8C 1JMCA 2V1CC 2ZTCA 1B8AA 1VQCA 4B3SL 3CCVA 1JT8A 3CP0A 2UUAQ 4JBJA 1YZ6A 2I5LX 4DV2L 1U0LA 1I6HH 2KBNA 2Q2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFC L;  4NXM Q;  2E2J H;  5BR8 L;  3CQZ H;  4DV4 Q;  3S2D H;  4JYA Q;  1Q86 C;  3HOU H;  1IBM Q;  2Z6K C;  3ULJ A;  3RNU A;  4DR7 L;  1I3Q H;  3HKZ E;  2PNH A;  1E1T A;  2EXD A;  4DNI A;  3S1M H;  1JJG A;  3A5Z B;  4OWW B;  1MIU A;  4DV5 Q;  2VUM G;  4DR4 L;  3CXC A;  3RN2 A;  4YHH L;  4DV7 Q;  4IFD I;  4PZ6 A;  4BY1 H;  2KHI A;  2B63 H;  2ZTE A;  4PMW A;  3S1R H;  1HZA A;  1PYB A;  4OO1 I;  3PUY A;  4BBS G;  4B3T L;  1UE5 A;  3KF6 B;  2DGY A;  3HOW G;  3CPF A;  3GDE A;  4WJ4 A;  4NXN Q;  3M3Y H;  1UE6 A;  1V9P A;  1FVI A;  4LF6 L;  3S2H H;  4A3D H;  4DAY B;  2ZJQ A;  1AE3 A;  1YVC A;  5FLM H;  1MKH A;  1PH2 A;  4JI4 Q;  4JI6 Q;  1M1K C;  1N32 L;  1IBL L;  5C0X G;  1YJW A;  3J7A 5;  1VQB A;  1HZ9 A;  1KHI A;  2GN5 A;  2A8V A;  5C3E G;  1YJ9 A;  2PQA B;  2QEX A;  2OTJ A;  1JE5 A;  3KDF A;  1B7Y B;  2N3S A;  2OQK A;  4TVA B;  1JJ2 A;  2UUA L;  2E2H H;  2JA6 H;  2JA7 G;  2WFW A;  1EQQ A;  4IFD J;  3JAM c;  1VQG A;  3J7Z C;  4R4O A;  4P74 A;  4NXM L;  2AWO A;  3PGZ A;  1XNR Q;  3NEN A;  4DV4 L;  1UWV A;  2MFI A;  3E9H A;  4LFA Q;  1YHB A;  4JYA L;  2NVY H;  2RCN A;  1IBM L;  4K0K Q;  3CCS A;  1Q12 A;  3KFU A;  1BBW A;  4BY7 G;  3BZK A;  2WP8 J;  3FP9 A;  3CCJ A;  1VQK A;  1VQA A;  1X56 A;  4C2M H;  4GKK Q;  4QQB X;  1A63 A;  1LTL A;  4DV7 L;  3A74 A;  1X3G A;  2UXC Q;  1N8R C;  1EYG A;  2R92 H;  4DV0 Q;  1JB7 A;  3M4P A;  4GOP A;  3KLW A;  3OTO Q;  1N34 Q;  3I4N H;  4YWL A;  1OXS C;  2F3I A;  1B70 B;  3MXN B;  3HKZ G;  1W3S A;  2LXJ A;  1Q1B A;  4LF5 Q;  3CC2 A;  4A93 H;  3EIV A;  1PVO A;  1MJC A;  3K7A H;  3PSI A;  4L5T A;  1O7I A;  1SRU A;  5ELN A;  3LGJ A;  4NXN L;  5IP7 G;  2MNA A;  2BH2 A;  3HOV H;  4JI6 L;  4JI4 L;  3K0X A;  4LF7 Q;  3M7N A;  1WI5 A;  3HOZ G;  4A3L G;  2VQE Q;  4XTC S;  2K50 A;  2Q2I A;  1GKH A;  2JA9 A;  3HOY G;  5C4X H;  3AFQ A;  4JBM A;  2IX1 A;  4NB3 A;  1XNQ Q;  3GTQ H;  3VDY A;  3CC7 A;  3PV0 A;  4JV5 Q;  2YTV A;  3IRB A;  4PZ7 A;  3M9B A;  3S17 H;  5GAH C;  4DK3 C;  4LNQ A;  1XNR L;  2ASB A;  2JA5 G;  4LFA L;  4K0K L;  5GQO A;  1C9O A;  3ICE A;  2VW9 A;  4HJA A;  2JA8 H;  4X6A H;  1CKN A;  3W1G A;  4ALP A;  1VQ9 A;  4P73 A;  1X54 A;  1NY4 A;  3CAM A;  4IJH A;  3L7Z C;  3RLO A;  4DR7 Q;  4GKK L;  2BA1 A;  2KHJ A;  4YWK A;  3T1H Q;  2VUM H;  2CWA A;  1A0I A;  3CCU A;  2UXD Q;  3FHW A;  4OWX B;  1UE7 A;  1H95 A;  2FXQ A;  1P16 A;  1SFO H;  1PH7 A;  4DV0 L;  1I5F A;  3OTO L;  4HIM A;  4A3I G;  1YHQ A;  1N34 L;  4DR4 Q;  3FKI G;  4DAM A;  3PO3 G;  3I56 A;  3HOW H;  4A3F H;  4LF5 L;  1EOV A;  3CCR A;  1PH4 A;  4B3M Q;  4JOI C;  4LUZ A;  4GOP B;  1GVP A;  4B3T Q;  4HIO A;  2JEA I;  4GS3 A;  2ZJP A;  1WFQ A;  4LF7 L;  1RL2 A;  1NMG A;  2R7D A;  4GLX A;  3T1Y Q;  3K80 C;  4PG3 A;  2VQE L;  4JI5 Q;  1V1Q A;  3J81 i;  1A8V A;  1Q1E A;  1IXR A;  1SE8 A;  4R4Q A;  3F8T A;  2KEN A;  5C3E H;  3CCE A;  1K73 C;  1K0R A;  4IPG A;  2Z0S A;  1SRO A;  2F52 A;  3U58 A;  4HJ7 A;  3TQY A;  5IWA Q;  4Y7N H;  4HIK A;  1GO3 E;  2D0O A;  2MQH A;  1XNQ L;  4JV5 L;  5IYD H;  1PH3 A;  2Q2H A;  4ME3 A;  2NVX H;  3J80 i;  4QJF A;  2UU9 Q;  4X66 Q;  2RF4 A;  4IPH A;  3H3V H;  4JBK A;  3HKS A;  4DKA C;  1VQN A;  4P71 A;  3K7U C;  3EN2 A;  1Y14 B;  3W5O A;  4A75 A;  4A3M G;  4DR3 Q;  1QVG A;  5C0X I;  3EBE A;  4QL5 A;  2HHH Q;  2C35 B;  1VQ8 A;  3PF4 A;  2QGQ A;  4R4I A;  1OXX K;  4JCV E;  1X9N A;  5GAD C;  4GNX A;  2R93 G;  5IYC G;  4DPG A;  3T1H L;  3U50 C;  5ELO A;  2JJQ A;  2UXD L;  1Q7Y C;  2MO0 A;  1K9M C;  3ERS X;  1I50 H;  1PH9 A;  4LF8 Q;  2F4V Q;  2K52 A;  3H3V I;  2K4K A;  2NVQ H;  3CME A;  4QGU A;  4BA2 I;  4OXP A;  1S40 A;  1N33 Q;  2CFM A;  4DR1 L;  1D7Q A;  1OTC A;  2PMZ E;  1Q81 C;  1X55 A;  4DR2 Q;  3NEL A;  4B3M L;  4LF9 Q;  4IOA A;  3ULL A;  1VS0 A;  1MJE A;  4GN5 A;  3I4O A;  1GM5 A;  4BBR G;  1K3R A;  5FJ8 G;  1QVF A;  3T1Y L;  2HQL A;  1JJC B;  4GN4 B;  4A76 A;  3CCM A;  4JI5 L;  5C0X J;  2YV5 A;  4R1J A;  2XGT A;  3K8A A;  4X62 Q;  4DUZ Q;  5M3F G;  4HJ9 A;  3JC6 6;  4AQY Q;  3TS0 A;  3HOY H;  2D0P A;  2OTL A;  3RR5 A;  1XPR A;  1TWC H;  1T9H A;  4A3J G;  5H1S E;  3PIO A;  4AIM A;  5IWA L;  2UUB Q;  2JK8 A;  4KHZ A;  1KXL A;  1UE1 A;  3I7F A;  3I4M G;  4APV A;  2BH8 A;  4UPA A;  3J81 j;  1SLJ A;  2UU9 L;  1RIP A;  4X66 L;  2ID0 A;  2Z6K A;  2JA5 H;  2GVA A;  5GRO A;  4DR3 L;  3M85 A;  1X3E A;  2HHH L;  4JI2 Q;  1HZC A;  3BJU A;  2QA4 A;  1E3P A;  1E1O A;  5HY6 A;  3HOX G;  1K8A C;  3AYH B;  3GTG H;  3WWV A;  1XMO Q;  2IX0 A;  2NZH A;  1XMQ Q;  1K83 H;  4QY7 A;  1PV4 A;  3GTM H;  3GD7 A;  4XIG S;  4LF8 L;  2F4V L;  4A3I H;  1BBU A;  2AWN A;  3FKI H;  2IHF A;  4GNX B;  3PO3 H;  1N33 L;  3RZD H;  1KD1 C;  1K8G A;  4DR6 Q;  3TRE A;  4DR2 L;  4LF9 L;  4FDB A;  1CKM A;  1J6Q A;  2JEB I;  4O2D A;  1SN8 A;  1I94 Q;  2CKZ B;  1L1O C;  2IY5 B;  1AH9 A;  3GTO H;  1NMF A;  4LFB Q;  1M90 C;  1PA6 A;  4BA1 I;  1BVS A;  1W2B A;  1X65 A;  5GAE C;  2I0Q A;  2VY3 A;  3I2Z A;  2HIV A;  3H0G H;  4YCV A;  4X62 L;  4DUZ L;  4AQY L;  4A3C G;  2B3G A;  4GLA C;  3HOU G;  2UUB L;  3U4V A;  1FJG Q;  2R7Z G;  4WJ3 M;  1TXY A;  3CPW A;  4A3G G;  3JAM i;  1SMX A;  1WOC A;  1Z9F A;  1VQH A;  1N36 Q;  1Q8K A;  5C4J H;  4A3M H;  2KCT A;  2K5H A;  5LMU L;  5GAG C;  4L5Q A;  3KDF B;  4P72 A;  4JI2 L;  2Y0S E;  4BXX G;  1KRS A;  1QUQ A;  1EIY B;  1FL0 A;  1YHA A;  1IBK Q;  3S14 H;  3CF5 A;  1XMO L;  5IYC H;  2R93 H;  4HJ8 A;  3F2B A;  4OWT B;  4IPD A;  3TEH B;  2D62 A;  4NPS A;  4YWM A;  3W1B A;  3GTJ H;  1IYJ B;  1XMQ L;  1VQM A;  4A3K G;  2YTX A;  2LSS A;  2JQO A;  4POG A;  1OXV A;  1DGS A;  2VS1 A;  1ASY A;  2CCZ A;  3NEM A;  1PH5 A;  3UDF A;  4DR6 L;  2PI2 A;  2AKW B;  5EAY A;  1TWG H;  2I5H A;  3AFP A;  4BBS H;  1VQI A;  2R7F A;  3S16 H;  3S1Q H;  4DR1 Q;  1N9W A;  4BBR H;  1D8L A;  1YEZ A;  1HJP A;  3CMA A;  1I94 L;  4LWC A;  1PH6 A;  4UP9 A;  5FJ8 H;  1PHJ A;  4J15 A;  4LFB L;  2JA6 G;  3AQQ A;  1YBY A;  3KJP A;  4OX9 Q;  1HNW Q;  3STB C;  3J80 c;  5M3F H;  4YCW A;  4KI0 A;  3F2C A;  4X65 Q;  4A3J H;  1HNX L;  1FJG L;  2HIX A;  3KOJ A;  3PUV A;  4PZ8 A;  3I4M H;  2AHO B;  2I5M X;  2LXK A;  5JJK A;  1VQJ A;  3MEF A;  3A0J A;  1X3F A;  4JI7 Q;  4UP7 A;  3E9I A;  4HID A;  1N36 L;  1Y1V G;  1TWF H;  1U5K A;  1Y1W G;  5JJI A;  1PYS B;  2R92 G;  2Q2T A;  4EQ5 A;  5AJ3 Q;  1YIT A;  2B29 A;  4AYB G;  1WCM G;  1VQP A;  1S72 A;  2IHE A;  3I4N G;  2VNU D;  4AH6 A;  1HNZ Q;  2VZA A;  4O0A A;  5IP9 G;  3HOX H;  4LUO A;  1IBK L;  1NBW A;  4A93 G;  3DM3 A;  3F1Z A;  4MZ9 A;  1Z47 A;  4BY7 H;  4IOC A;  1LYL A;  1QUQ B;  2XTI A;  1VQ4 A;  3U4Z A;  1IL2 A;  1YI2 A;  4JI1 Q;  5IYB G;  4C3J H;  1HR0 Q;  1UEB A;  4JOI A;  1CKN B;  1E22 A;  4A3E G;  1CSP A;  2Y0S G;  4MNO A;  1VCI A;  2A19 A;  2YTY A;  1WYD A;  2OQ0 A;  1EQR A;  1KQS A;  4GLV B;  1G6P A;  1HZB A;  2EQS A;  4L5S A;  3TS2 A;  5C4X G;  1XTD A;  1Q46 A;  4UP8 A;  3PUW A;  5DLQ E;  5IP7 H;  1PH8 A;  1LUZ A;  3STB D;  2NN6 G;  4A3B G;  3DLL A;  1KIX A;  2A1A A;  2H5X A;  4DV1 Q;  4OX9 L;  4R4C A;  5J3B A;  1HNW L;  1C0A A;  1TWH H;  5LMN Q;  3HOZ H;  4DUY Q;  3G4S A;  4A3C H;  4A3L H;  3UE1 A;  3K81 C;  4X65 L;  1EIF A;  2CWP A;  2VL6 A;  3PF5 A;  2N78 A;  2JA8 G;  2R7Z H;  4A3G H;  2ZTD A;  1GD7 A;  3UDI A;  1IZ6 A;  3UE0 A;  4JI7 L;  1E24 A;  1VQ7 A;  2ZM6 Q;  4DV3 Q;  3KJO A;  5IT9 c;  5E7N A;  2WAQ E;  2R6G A;  4KHP Q;  2UXB Q;  5M3M G;  5AJ3 L;  4BXX H;  5IE8 A;  1OXT A;  1CUK A;  1V43 A;  4IPC A;  3S24 A;  2VQF Q;  1HNZ L;  3CW2 C;  1VQ5 A;  4JI0 Q;  2N49 A;  5M5Y H;  5LMU Q;  4YY3 Q;  4A3F G;  2E5L L;  2ATW A;  4RMF A;  3GTL H;  2GVB A;  1KRT A;  4QIW E;  1KAW A;  4GOP C;  1NTG A;  2E8G A;  3G71 A;  4A3K H;  3AEV A;  3RZO H;  2OCE A;  4JI1 L;  1HR0 L;  3L0O A;  5C44 G;  1TWA H;  3PO2 G;  3D31 A;  1AE2 A;  4JI8 Q;  2E2I H;  1X6O A;  2L15 A;  5JEA J;  3GTK H;  1J5E Q;  3S15 H;  2JE6 I;  4C3H H;  1YJN A;  3GO5 A;  3HFZ B;  5JEA G;  1A62 A;  2ZJR A;  2OWO A;  4EX5 A;  4UY8 C;  3BZC A;  1L2F A;  2AMC B;  1ASZ A;  1XPO A;  4DR5 Q;  3TRZ A;  2RHS B;  4DV1 L;  1NJI C;  4OON A;  4B3R Q;  3A5U A;  3OYY A;  4JC0 A;  2UUC Q;  4IFD G;  5LMN L;  4DUY L;  1SR3 A;  5IYD G;  1XJV A;  4LF4 Q;  3ZJY C;  2IT1 A;  4OO1 G;  2RHQ B;  3S1N H;  3G6E A;  4A3B H;  2DUD A;  5IY0 A;  2N8N A;  2KCM A;  4AYB E;  1HNX Q;  3GTP H;  1VQL A;  2ZM6 L;  3KYH C;  4DV3 L;  4DV5 L;  1Y1V H;  3D0F A;  1VQD A;  1Y1W H;  4GKJ Q;  4JBW A;  1L0W A;  4KHP L;  2MO1 A;  3UDX A;  2UXB L;  4RG1 A;  1WCM H;  2EIF A;  2VQF L;  5IP9 H;  3NBH B;  4JI0 L;  4BY1 G;  4YY3 L;  4JI3 Q;  2B63 G;  3UDG A;  2K5V A;  4P75 A;  5JJL A;  1QZG A;  5M5X H;  3ULP A;  2WB1 E;  3H15 A;  1E7Z A;  2HT1 A;  1EFW A;  2WAQ G;  5IYB H;  1VQ6 A;  4A3E H;  3CC4 A;  4JI8 L;  4MTN A;  1FGU A;  2K14 A;  4HJ5 A;  4H02 A;  1PFS A;  4C3I H;  4TQU S;  2YU9 H;  4X64 Q;  4A3D G;  3I55 A;  5FLM G;  1J5E L;  1L1O A;  1EWI A;  3ER0 A;  1G51 A;  2NZO A;  4KLK A;  1XPU A;  4DV6 Q;  4DK6 C;  1WJJ A;  3J81 c;  5M5W H;  1S3O A;  3RLF A;  4DR5 L;  4B3R L;  1QZH A;  3CCL A;  3PCO B;  4B3S Q;  1YIJ A;  2UUC L;  2CQO A;  3M4Q A;  4DV2 Q;  3RLN A;  5HGQ A;  1OXU A;  4LF4 L;  2BA0 A;  4LFC Q;  2K5N A;  5BR8 Q;  1C7Y A;  1CSQ A;  1KL9 A;  1YNX A;  3Q8D A;  4GN3 B;  1QVC A;  2K75 A;  3E0E A;  1HR0 W;  1CKO A;  3BU2 A;  4A4I A;  2YYZ A;  2NN6 I;  4GKJ L;  2UXC L;  5M3M H;  3PUZ A;  2ES2 A;  4IO9 A;  3KF6 A;  1EUJ A;  1Q82 C;  2JA7 H;  1G29 1;  4YHH Q;  1LM0 A;  5FLX c;  4GNX C;  3G48 A;  3CD6 A;  4POF A;  4JI3 L;  3M4O H;  2NVT H;  4R4T A;  3SGI A;  1BKB A;  3L2P A;  4IJL A;  1HH2 P;  3CCQ A;  2ALY B;  3OW2 A;  2E5L Q;  3RN5 A;  5C44 H;  1VQE A;  4L5R C;  5LMN W;  3PO2 H;  4LF6 Q;  3PUX A;  1P8L A;  1PH1 A;  4X64 L;  3HOV G;  2PQA A;  4LW1 A;  3H0G G;  3PIP A;  4DV6 L;  3F2D A;  1N32 Q;  3B6Y A;  4LUV A;  4YCU A;  1VQO A;  1IBL Q;  1VQF A;  1R9T H;  1NE3 A;  2WB1 G;  5K36 G;  2PI2 E;  4JG2 A;  4Y52 H;  1L1O B;  3KF8 B;  1KC8 C;  1JMC A;  2V1C C;  2ZTC A;  1B8A A;  1VQC A;  4B3S L;  3CCV A;  1JT8 A;  3CP0 A;  2UUA Q;  4JBJ A;  1YZ6 A;  2I5L X;  4DV2 L;  1U0L A;  1I6H H;  2KBN A;  2Q2U A; 
#chains in the Genus database with same CATH topology
 2B2T C;  2E2J H;  2EY6 A;  3CQZ H;  1QCB D;  3HOU H;  3ULJ A;  2DJF C;  1E1T A;  2B63 B;  4DV5 Q;  2F0F A;  3NTI A;  3S1R H;  1HZA A;  2WAQ B;  1PMR A;  4BBS G;  3A55 A;  5EBD A;  2F0O A;  4U67 3;  2XSC A;  3CPF A;  1LO5 D;  1UE6 A;  2B2W C;  1OO9 B;  1YVC A;  4JI6 Q;  4K8J A;  1N32 L;  1WTX A;  5C0X G;  1VQB A;  2GN5 A;  4B9X A;  1SNP A;  2JA5 B;  2QEX A;  2OQK A;  4TVA B;  1JJ2 A;  2JA6 H;  4QB4 A;  4P74 A;  5ELD A;  2KEC A;  3PGZ A;  4K0K Q;  1YHB A;  2F0S A;  1IBM L;  3GTM B;  4A3I B;  1CQV A;  3QOJ A;  1BNZ A;  4GKK Q;  3U9O A;  4C2M H;  1X3G A;  4O42 A;  2R92 H;  3R2I A;  1N34 Q;  4YWL A;  2F3I A;  1HRJ A;  1B70 B;  4ABN A;  1DON A;  1FNU A;  3HKZ G;  1W3S A;  3DXJ C;  3EIV A;  2A6E D;  3PSI A;  4L5T A;  5IP7 G;  4NXN L;  1S5F D;  3VR5 A;  2BH2 A;  3LGJ A;  2CH4 W;  2QCP X;  1F77 A;  3HOV H;  1AN8 A;  3K0X A;  3HOZ G;  3KLR A;  4Z9C B;  5C4X H;  1PZJ D;  2IX1 A;  3GTQ H;  4I65 A;  2NN6 H;  2L1B A;  2WKD A;  4PZ7 A;  2EY2 A;  1SNO A;  1GHJ A;  2PW5 A;  2R93 B;  5KYL A;  2RSO A;  4LFA L;  2PCF B;  4X3K A;  2CW0 D;  2F0T A;  5G3L F;  3W1G A;  1VQ9 A;  4IJH A;  2PNR C;  4YWK A;  3T1H Q;  1A0I A;  1TWG B;  1UE7 A;  4BBS B;  2EJM A;  3OTO L;  3MXU A;  4DR4 Q;  2XIW A;  3PO3 G;  1EYD A;  3I56 A;  2CVR A;  1EOV A;  4LF5 L;  1PH4 A;  5J1Z A;  4JOI C;  4LUZ A;  2KUM A;  4LMQ D;  4HIO A;  2JEA I;  1YNJ C;  4A3J B;  1A3V A;  1RL2 A;  1NMG A;  2R7D A;  3K80 C;  1V1Q A;  4TSS A;  1K73 C;  4A3B G;  3WOF A;  1SRO A;  3U58 A;  5COY A;  4OIJ A;  4HJ7 A;  3TQY A;  4HIK A;  2MQH A;  1EY5 A;  3VYU A;  3J80 i;  5K5P A;  3H3V H;  4U68 A;  1QE6 A;  2PZW A;  2J4X A;  3HKS A;  3SK5 A;  4P71 A;  4DKA C;  4EGV A;  3W5O A;  1Y14 B;  4XXE A;  3DEO A;  4A75 A;  5D65 A;  3Q24 A;  1A2T A;  2C35 B;  3W2D A;  1OXX K;  4JCV E;  1X9N A;  3ZYY X;  4K5X A;  3I3C A;  4KN7 C;  3NWS A;  1H9J A;  1ENA A;  4OXP A;  1S40 A;  1OTC A;  2PMZ E;  4IOA A;  4N9T A;  3I4O A;  1A3U A;  3HOZ B;  2HUG A;  5FJ8 G;  1RCV D;  1JJC B;  1JOK A;  5E1F A;  2WKC A;  3K8A A;  4WRD A;  4DUZ Q;  4AQY Q;  2D0P A;  5T1G A;  5IWA L;  4KHZ A;  3I4M G;  3T53 B;  1PFN A;  4UPA A;  3J81 j;  1SLJ A;  1EZ6 A;  1RIP A;  4X66 L;  2ID0 A;  2FHT A;  2JA5 H;  5LHY 1;  1T5X D;  3GTL B;  4DR3 L;  1ZYR D;  1QNU A;  1RD9 D;  1E1O A;  5HY6 A;  1WTW A;  5CC4 A;  3QO2 A;  4RAU C;  2NZH A;  4KJN A;  1PV4 A;  1CFM A;  3P1H A;  3GTM H;  3S15 B;  1LAC A;  3W3A A;  1BBU A;  4A3I H;  1SSO A;  2IHF A;  4GNX B;  4S3S A;  5ELE A;  2RDH A;  2HDM A;  4DR6 Q;  1UUP A;  3FRP B;  4DR2 L;  4FF1 A;  1CKM A;  3K5L A;  3MEH A;  1G2T A;  3X3N A;  1J6Q A;  2XNA C;  4ID6 A;  4A3B B;  5IT9 E;  1PZK D;  3SDZ A;  5GAE C;  2HIV A;  2UUB L;  3U4V A;  3A7A B;  1WD1 A;  4WJ3 M;  1AZQ A;  3CPW A;  1V8Q A;  1BXT A;  1WOC A;  2M9V A;  2RCF A;  5C4J H;  4JW0 A;  2MHV A;  3T13 A;  4CHT B;  4A3E B;  3CRK C;  4HMI A;  3S14 H;  2M00 A;  2R93 H;  4KY7 A;  5IYC H;  3BDL A;  1EEF D;  4IPD A;  4NPS A;  4OWT B;  4YIJ A;  3W1B A;  3L3O C;  4V19 0;  4A3K G;  4POG A;  3D4W A;  1EWC A;  1DXM A;  3UDF A;  3FEW X;  2PI2 A;  5EKL A;  5EAY A;  1TWG H;  5M5W B;  4K14 A;  4BBS H;  1D6E C;  4DR1 Q;  1N9W A;  1PRT F;  4HSP A;  4UP9 A;  1PH6 A;  1D2B A;  1K3B C;  4LFB L;  1TY0 A;  3ND8 A;  4F7X A;  4J1M A;  2FMM A;  5FK9 C;  4KI0 A;  3F2C A;  4A3J H;  3OHX C;  1FJG L;  3PUV A;  2Z1C A;  2AHO B;  2LXK A;  2O4X A;  3A0J A;  1X3F A;  3G7L A;  1R4Q B;  4H13 C;  1N36 L;  1XYI A;  2NVT B;  1I4Q A;  1KDB A;  3I4N G;  2B29 A;  1VQP A;  2IHE A;  3VYS A;  2C5C A;  4LUO A;  1T5E A;  2EY1 A;  3A8I E;  4A93 G;  5HGT A;  1TU2 B;  4IOC A;  1B53 A;  1VMC A;  1QUQ B;  1VQ4 A;  1J9O A;  3U4Z A;  1HR0 Q;  5IYB G;  3O13 A;  4TKO B;  2Y0S G;  1QIL A;  3WOE A;  2N88 A;  1SBB B;  1EQR A;  2OQ0 A;  3K57 A;  3J80 E;  2EQS A;  4WOR A;  1NAP A;  1XTD A;  5IP7 H;  1LUZ A;  3STB D;  3DLL A;  2A1A A;  4R4C A;  1LTR D;  5LMN Q;  1I3Q B;  3HOZ H;  4DUY Q;  1JOQ A;  3UE1 A;  4X65 L;  5FLX E;  4FF2 A;  2JA8 G;  4LAA A;  3UDI A;  4ZLT F;  1F2M A;  4ZRZ A;  2KA7 A;  3UE0 A;  1VQ7 A;  4NMZ A;  1CA5 A;  1HHV A;  2WAQ E;  2R6G A;  4I7Z C;  3HS0 C;  5CR3 A;  4BXX H;  5IE8 A;  1VQ5 A;  3EJI A;  1QOH A;  3GV6 A;  3S2H B;  1L0X B;  2R61 A;  2XWB B;  3MWY W;  5JOB A;  3GTL H;  4GOP C;  1F2L A;  1KAW A;  2ICE C;  1WTV A;  4JI1 L;  4QIW B;  3GTK B;  3TP5 A;  5C44 G;  4OHJ A;  5JEA J;  1DZ1 A;  3S15 H;  1F2Z A;  1TII D;  4XQQ A;  3GO5 A;  2OWO A;  2FJ2 A;  3BZC A;  3C3L A;  1KDC A;  2RBM A;  2F0M A;  2SOB A;  3M4Y A;  2RHS B;  4DV1 L;  4DR5 Q;  4OON A;  1TR5 A;  5BN3 A;  5C5M A;  3P20 A;  4IFD G;  1ILP A;  1M8A A;  4A3B H;  3G6E A;  4AYB E;  1LT5 D;  1K28 A;  2IPK D;  2TMP A;  3I4N B;  2KEE A;  1Y1V H;  2F0P A;  1BQQ T;  1SMY D;  4NKL A;  1B2T A;  1H9R A;  1L0W A;  2UXB L;  2MO1 A;  2QDL A;  2EIF A;  4A93 B;  1B3A A;  2VQF L;  3K59 A;  1HTL D;  4P75 A;  3VYR A;  3KLS A;  3ULP A;  3H15 A;  1E7Z A;  3MXG A;  1GUN A;  3KBG A;  1NNX A;  2C9O A;  3KK7 A;  4A3E H;  3CC4 A;  1PRT C;  4I7A A;  1PFS A;  4RGM A;  3URY A;  3I55 A;  3ER0 A;  1XPU A;  4DK6 C;  2B2V A;  5ELF A;  3Q0A A;  4Q0F A;  3S17 B;  3SK8 A;  2XRQ D;  1SNQ A;  3NTK A;  5M5W H;  1S3O A;  3RLF A;  2LFN A;  4LK1 C;  1QZH A;  3CCL A;  4B3R L;  4K5V A;  2JA8 B;  2CQO A;  3H94 A;  4DV2 Q;  1KAA A;  1E2V A;  1SE3 A;  2BA0 A;  2AQ1 B;  2K5N A;  1C7Y A;  3OWF A;  4IUQ A;  3Q8D A;  4QUC A;  1ICF B;  1TS4 A;  2UXC L;  1HFG A;  3IAY A;  1GHK A;  1EUJ A;  1MI2 A;  3M4O B;  3AU7 A;  2QIL A;  4QF4 A;  4POF A;  4JI3 L;  2NVT H;  4R4T A;  3SGI A;  3CCQ A;  2CHB D;  2E5L Q;  1KLG D;  4FP5 D;  1VQE A;  1K8M A;  5C3E B;  4X64 L;  1D5X C;  3HOV G;  2JXM B;  3H0G G;  4DV6 L;  1N32 Q;  3B6Y A;  4IQZ A;  4LUV A;  1VQO A;  2NVX B;  2WB1 G;  4G7O C;  2CQA A;  1JMC A;  2V1C C;  4B3S L;  1JT8 A;  3CP0 A;  1YZ6 A;  3CQZ B;  4HTH A;  4UY8 C;  4PQX A;  2B39 A;  5IGD A;  4CKC A;  4EQN A;  4RGN A;  1L0Y B;  1IBM Q;  4ME5 A;  3JAM L;  4DR7 L;  1I3Q H;  3HKZ E;  2PNH A;  4P2C B;  3CXC A;  2ZTE A;  4PMW A;  4OO1 I;  3PUY A;  1UE5 A;  4RGT A;  2A6H D;  3GDE A;  2L55 A;  4NXN Q;  1V9P A;  1FVI A;  3S2H H;  4M1U B;  4DAY B;  1Q90 A;  1JC7 A;  5CV9 A;  1MKH A;  3IFT A;  5FLM H;  1IBL L;  1YJW A;  5ELB A;  2PQA B;  1JE5 A;  1B7Y B;  2WFW A;  1EQQ A;  3J7Z C;  1MGS A;  4IUU A;  2AWO A;  2L9H A;  1PTO C;  3NEN A;  4DV4 L;  3J7A V;  3E9H A;  4LFA Q;  4JYA L;  1E2Z A;  3D6W A;  3CCS A;  1Q12 A;  1CT1 D;  3FKI B;  4HCS A;  2PQE A;  1LTA D;  3RZD B;  4QQB X;  4DV7 L;  3A74 A;  1N8R C;  1EYG A;  2WV6 D;  3I4N H;  3OTO Q;  3MXN B;  2LXJ A;  4LF5 Q;  3FDT A;  3SEB A;  5JVH 3;  4A93 H;  2OT2 A;  1PVO A;  1MJC A;  4KTA A;  2MNA A;  3H0G B;  1I4H A;  4JI4 L;  2WB1 B;  3M7N A;  4A3L G;  1JR0 D;  4E6I A;  1GKH A;  2DNE A;  3AFQ A;  2B2Y C;  3QJY A;  3PV0 A;  3I91 A;  5KEE A;  2YTV A;  3M9B A;  3S17 H;  1XNR L;  2ASB A;  2JA5 G;  5EJW A;  5CV6 A;  3RUZ A;  2E75 C;  4HJA A;  2JA8 H;  3L7Z C;  1G8Z D;  2WIN B;  2KHJ A;  3PMF A;  2CWA A;  3CCU A;  3FHW A;  1H95 A;  1PH7 A;  4DV0 L;  3S16 B;  3BYY B;  4A3I G;  1G91 A;  4DAM A;  5I9O A;  3CU7 A;  1S5C D;  3K5O A;  1GVP A;  4B3T Q;  5IOC A;  4GS3 A;  2Z4H A;  2ZJP A;  1WFQ A;  3RD4 A;  3BS1 A;  1LV9 A;  2B2U C;  4LF7 L;  2RKS A;  1FYC A;  4PG3 A;  2VQE L;  2OXP A;  1EU3 A;  1A8V A;  4R4Q A;  4HCE A;  3F8T A;  2KEN A;  5C3E H;  1K0R A;  1TWF B;  5IWA Q;  4Y7N H;  3NXW A;  2D0O A;  2BOS A;  2Q2H A;  2NVX H;  1HFN A;  4RKB A;  4X66 Q;  2RF4 A;  3TME A;  4JBK A;  1RTO A;  3E5S A;  3K7U C;  3T4A C;  1O7Z A;  4DR3 Q;  1QVG A;  2BE5 C;  4QL5 A;  4CJ0 B;  4PMC A;  3NQI A;  4C3J B;  3FPU B;  4GNX A;  2R93 G;  3G6J B;  1A15 A;  3N6R A;  5IYC G;  3U50 C;  5ELO A;  4B9W A;  3ERS X;  1NR4 A;  2K52 A;  3D3R A;  2K4K A;  4C3I G;  2NVQ H;  2CFM A;  1GUG A;  4NP5 A;  3ND9 A;  4DR2 Q;  4B3M L;  4UDU C;  1B9N A;  1DOL A;  3ULL A;  1IYU A;  3TZD A;  4GN5 A;  3R93 A;  1K0S A;  2MGS A;  1SNC A;  5ELC A;  1K3R A;  1D5M C;  3EQL C;  3HZX A;  3T1Y L;  2HQL A;  4GN4 B;  4HJ9 A;  4RH6 A;  4A3J G;  2UUB Q;  5H1S E;  3PIO A;  3I8Z A;  4APV A;  4N9P A;  3NBI A;  2UU9 L;  5M5Y B;  3NPP A;  2Z6K A;  2GVA A;  1CM9 A;  4ZCK A;  4XYQ A;  3RZO B;  2HHH L;  1HZC A;  3BJU A;  1MSG A;  4L6T B;  3D6C A;  2KJX A;  3WDN A;  3TZU A;  3AYH B;  2Q8I B;  3WWV A;  2AQ3 B;  2ENB A;  1KDA A;  4JK1 C;  1K83 H;  3E0J A;  4LF8 L;  4XIG S;  2F4V L;  2EJF C;  3FKI H;  1S5D D;  2PPB C;  1YNN C;  3RZD H;  2ZXR A;  3TRE A;  4FDB A;  3NSW A;  4C1N K;  2JEB I;  1SN8 A;  3BVZ A;  1L1O C;  4L63 B;  1DJR D;  1AH9 A;  1JIC A;  4LFB Q;  1EYC A;  1SNM A;  1PA6 A;  1BVS A;  2JN4 A;  3TP7 A;  2VY3 A;  3ERQ A;  3H0G H;  3I2Z A;  4YCV A;  3DWQ A;  4X62 L;  1IKM A;  2B3G A;  1Y1W B;  2F0G A;  2F4I A;  1FJG Q;  1ENC A;  3J80 L;  2KED A;  2XVS A;  5C4J B;  5E4W C;  1N36 Q;  2QEJ C;  3S14 B;  3EVQ A;  4P72 A;  4JI2 L;  2Y0S E;  4BXX G;  1I4P A;  1QUQ A;  1FL0 A;  2RA4 A;  5T1I A;  5D14 A;  3CF5 A;  5KND A;  2QW7 A;  4DAP A;  4C3I B;  4R8I A;  2MP1 A;  1SJE D;  1SYD A;  1OXV A;  2VS1 A;  2CCZ A;  3NEM A;  1AW7 A;  3OWE B;  3LNN A;  3AFP A;  3MTS A;  2R7F A;  3S16 H;  4BBR H;  1YEZ A;  4LWC A;  4J15 A;  3AQQ A;  1BUV T;  1X3Q A;  3K0Y A;  1A3T A;  3STB C;  1F2Y A;  1HPC A;  4OGQ C;  4X65 Q;  4CJ1 B;  4PZ8 A;  1PZI D;  2JA7 B;  1ESF A;  3GV3 A;  3QR8 A;  1Y1V G;  1TWF H;  3K58 A;  5JJI A;  2F1M A;  2VNU D;  4KKS A;  4DXG A;  4AH6 A;  3M7G A;  3C46 A;  2BDO A;  1KNE A;  2NWG A;  4ZKB B;  3F1Z A;  3DM3 A;  2A68 C;  1Z47 A;  4MZ9 A;  3FVQ A;  2PW7 A;  2D9U A;  1NSN S;  2XTI A;  1B9M A;  1O7Y A;  3DHQ A;  1YI2 A;  4JI1 Q;  4C3J H;  1UEB A;  1R9T B;  4A3E G;  1E22 A;  3HGB A;  1D1K A;  1WYD A;  1G6P A;  1BOS A;  1TY2 A;  4DK1 A;  1ESR A;  5IIF A;  1FNV A;  3S2D B;  2H5X A;  4DV1 Q;  3A56 A;  4A3C H;  3G4S A;  4A3L H;  2R7Z H;  2F0N A;  4A3G H;  4MIU A;  1GD7 A;  1IZ6 A;  3GQB A;  4JI7 L;  1E24 A;  4BY1 B;  4IUP A;  3KJO A;  5E7N A;  1LTG D;  3TP6 A;  1AP0 A;  1RKN A;  2UXB Q;  3MA2 B;  3A8K E;  1SYC A;  1CUK A;  4IPC A;  3S24 A;  1SMY C;  2VQF Q;  1HNZ L;  3C1F A;  1SE4 A;  3A7L A;  4A3F G;  5M5Y H;  5LMU Q;  2ATW A;  1SXT A;  2Z9H A;  3RZO H;  2OCE A;  3L0O A;  2G9D A;  1EFI D;  3SK6 A;  4ZK9 B;  3MC0 B;  1EY6 A;  3D8G A;  2E2H B;  2B8G A;  2ZJR A;  1HUM A;  4EX5 A;  2F0H A;  1BR9 A;  1JWU D;  3TSS A;  1ASZ A;  2HCC A;  1HTP A;  1NJI C;  4B3R Q;  2NVY B;  2R3Z A;  2FMC A;  1EIH A;  1XJV A;  3J81 L;  3SR1 A;  3ZJY C;  2IT1 A;  4V0B A;  2RHQ B;  2HCI A;  4IUT A;  2DUD A;  2N8N A;  1Y1V B;  3I73 A;  1HNX Q;  1IYV A;  1M4V A;  4DV5 L;  1SYF A;  3D0F A;  1Y1W H;  4JBW A;  2EYJ A;  1X32 A;  5I2X A;  3UDX A;  4RG1 A;  1WCM H;  4KKT A;  5IP9 H;  4JI0 L;  3K7A B;  2AUJ D;  4JI3 Q;  5EBC A;  2K5V A;  5JJL A;  1E0B A;  3T56 B;  3SHL A;  3ITP A;  2WB1 E;  4IN3 A;  1EFW A;  3IKJ A;  4KKU A;  1VQ6 A;  2PZT A;  2Q8R E;  1FGU A;  2K14 A;  4KD4 A;  2D5D A;  4C3I H;  4TQU S;  4X64 Q;  2EVB A;  3CHB D;  4ZAI A;  5FLM G;  1J5E L;  1G51 A;  4KLK A;  3V96 A;  4DV6 Q;  1WJJ A;  2RDF A;  3K5M A;  2QKI C;  4B3S Q;  1VDZ A;  3M4Q A;  2F3W A;  1GXD C;  1BDO A;  4CKB A;  5CV4 A;  4KJO A;  2NTT A;  1EEI D;  2VUM B;  2K32 A;  5FO8 B;  2F0I A;  1PLF A;  1CKO A;  4A4I A;  2NN6 I;  3KBX A;  3U9S A;  3X3M A;  4A3F B;  2JA7 H;  4H44 C;  1LM0 A;  3G48 A;  3CD6 A;  4BWG B;  1MSH A;  5JJZ A;  3L2P A;  1ILQ A;  3VR3 A;  4DAY A;  2K28 A;  5IGC A;  3OW2 A;  3DWA A;  1H9M A;  2K6A A;  1Q8I A;  1KTK A;  4L5R C;  1ET6 A;  2A6H C;  1P8L A;  3RMH A;  2PQA A;  2QF7 A;  1EQT A;  1G2S A;  3SVM A;  3F2D A;  4YCU A;  1II3 A;  1IBL Q;  1R9T H;  2F0U A;  2A69 C;  4IZ8 A;  1W6K A;  2ZTC A;  5IYD H;  1VMP A;  2KBN A;  2Q2U A;  1HUN A;  4LFC L;  1C8C A;  4OO1 H;  1LTS D;  5BR8 L;  1IW7 D;  1HCZ A;  1B1Z A;  4DV4 Q;  3S2D H;  4JYA Q;  3QOL A;  1Q86 C;  3I72 A;  3RNU A;  1I50 B;  4UAI A;  5D3I B;  2EXD A;  5FKA C;  3S1M H;  3MXN A;  1MIU A;  4DR4 L;  4DV7 Q;  4PZ6 A;  4BY1 H;  2KHI A;  2IL8 A;  5DNF A;  5CMD A;  1YNJ D;  2DGY A;  2CH4 A;  2GA4 B;  3K6O A;  4WJ4 A;  3I90 A;  4B08 A;  3M3Y H;  4LF6 L;  3NUC A;  3HOY B;  4A3D H;  5TSS A;  4PMB A;  4JI4 Q;  1M1K C;  2G9H D;  1JE4 A;  1LTB D;  3J7A 5;  1JWS D;  2DY7 A;  2BDN A;  1IHZ A;  5C3E G;  1YJ9 A;  2N3S A;  2UUA L;  2E2H H;  3JAM c;  1VQG A;  4NXM L;  1XNR Q;  3GTG B;  1UWV A;  3J7Y W;  2NVY H;  2RCN A;  2F0L A;  3LX0 A;  1EY0 A;  1BBW A;  4DXF A;  3I4L A;  3CCJ A;  1VQA A;  2L4N A;  5JAV A;  3D4D A;  4DV0 Q;  3M4P A;  3KLW A;  2KVM A;  5LL6 X;  3C1E A;  1MBY A;  3SK4 A;  3CC2 A;  3DUZ A;  3K7A H;  1O7I A;  1SRU A;  5ELN A;  2V4D A;  4O1N A;  4LF7 Q;  3MFY A;  4CGY B;  2SEB D;  4DN4 M;  4DK0 A;  2VQE Q;  3CRL C;  2K50 A;  2Q2I A;  3OIQ A;  3V05 A;  2K5Q A;  2JA9 A;  5J39 A;  5HUR A;  4JBM A;  4A3M B;  3CC7 A;  3IRB A;  5KGU A;  5GAH C;  4DK3 C;  4LNQ A;  1C9O A;  2K04 A;  3ICE A;  3GTJ B;  4X6A H;  3VR4 A;  4ALP A;  1NY4 A;  3CAM A;  2PYK A;  3E3X A;  1S5E D;  2VUM H;  1B3Q A;  4OWX B;  2FXQ A;  2DN8 A;  3VYT A;  1I5F A;  1H9K A;  4HIM A;  1YHQ A;  4RKL A;  3FKI G;  4FVM A;  4C3H G;  3HOW H;  4A3F H;  4KY5 A;  3CCR A;  4B3M Q;  2SDF A;  4GOP B;  1WVL A;  1EYA A;  3TN2 A;  1WTP A;  3NTH A;  1A2U A;  4F8M A;  4KN4 C;  1JWM D;  1BCP B;  2SNM A;  2EOT A;  3T1Y Q;  1U4R A;  2OEO A;  2QDB A;  3MFG A;  1SYE A;  3KUP A;  3QIA A;  1Q1E A;  3CCE A;  1SE8 A;  4Y7N B;  2Q2T A;  4IPG A;  2Z0S A;  4HAE A;  1XNQ L;  1QNK A;  2F0E A;  4R8N A;  1CQF A;  2EPB A;  4RCO A;  4JV5 L;  3Q6S A;  2IJ0 A;  3T51 B;  2UU9 Q;  3HOX B;  1ICW A;  3OIP A;  5AFW A;  5C0X I;  3EBE A;  2HHH Q;  3PF4 A;  2RSN A;  2QGQ A;  4UHV A;  3BVM A;  1B4O A;  1DYQ A;  1JOO A;  5GAD C;  2UXD L;  2JJQ A;  2NVQ B;  1Q7Y C;  2MO0 A;  2EZV A;  2J0T D;  1PH9 A;  1I50 H;  4LF8 Q;  2F4V Q;  1ET9 A;  1F9R A;  5E3F A;  4QGU A;  4BA2 I;  1STB A;  1KNA A;  4DR1 L;  1PYW D;  3NEL A;  3A54 A;  1VS0 A;  4OL7 A;  4FO2 A;  2PMZ B;  1MJE A;  1TWH B;  1GM5 A;  4BBR G;  5DAU A;  3S9W A;  1PRT B;  4A76 A;  3CCM A;  2A6E C;  4JI5 L;  5IGE A;  5C0X J;  2YV5 A;  2XGT A;  4ZUI A;  4C56 C;  5C6A A;  4X62 Q;  3HOY H;  3JC6 6;  3RR5 A;  1CI3 M;  2F3V A;  3TDQ A;  3I70 A;  1KXL A;  3I7F A;  2B2T A;  2NYZ D;  2BH8 A;  3H09 A;  5JVG 3;  5IGF A;  5EQ0 A;  2L0C A;  4JI2 Q;  4X3T A;  2QA4 A;  1K8A C;  1TWA B;  1K83 B;  2KHS A;  2F0W A;  3GTG H;  2IX0 A;  2CW0 C;  4C3H B;  2AWN A;  4C3J G;  1N33 L;  1KD1 C;  2B2W A;  4DF7 A;  4LF9 L;  4DNT B;  1DM0 B;  5KYI A;  2LKV A;  1NR2 A;  3H3V C;  3PIP 3;  1ZEQ X;  2CKZ B;  2IY5 B;  2K5D A;  3MVV A;  1NMF A;  1CZG A;  2B2V C;  2PO4 A;  3S1N B;  5F2D A;  5KRU A;  1M90 C;  4BA1 I;  1ENF A;  2I0Q A;  3GTP B;  2EXZ A;  1CZW A;  5I2Y A;  1S5B D;  4A3C G;  2XN9 C;  2A5H A;  2R7Z G;  1TXY A;  4A3G G;  3JAM i;  1WD0 A;  1Q3L A;  2EE1 A;  2LS0 1;  1VQH A;  4J8Q A;  5KIX A;  1STH A;  1Q8K A;  4J6H A;  4A3M H;  2KCT A;  5I6W A;  5GAG C;  2AQ2 B;  5I9P A;  1F9Q A;  4OIK A;  3H6M A;  1XMO L;  1BCP D;  2YU9 B;  2K05 A;  3VR6 A;  3HG9 A;  4LJZ C;  1XMQ L;  2A73 B;  3GTJ H;  1IYJ B;  1NUC A;  1VQM A;  2LSS A;  4XYO A;  1PH5 A;  2KCC A;  4RHS A;  4Q5V A;  1AFP A;  4BBR B;  1GJX A;  2I5H A;  3P7J A;  1VQI A;  2KOL A;  3S1Q H;  1D8L A;  3CMA A;  1I94 L;  1PHJ A;  2EYH A;  5C4H A;  1YBY A;  3KJP A;  2K7V A;  1RDP D;  1JB3 A;  3J80 c;  5M3F H;  4YCW A;  4CDF C;  3KOJ A;  5M3M B;  2I5M X;  2HQE A;  5JJK A;  1VQJ A;  3MEF A;  1ROD A;  4JI7 Q;  4UP7 A;  3E9I A;  2EY5 A;  4CJ2 C;  2PZU A;  1Y1W G;  1PYS B;  1PTO B;  4EQ5 A;  1YIT A;  4AYB G;  1WCM G;  2ZT9 C;  1S72 A;  1XXG A;  5IP9 G;  1HNZ Q;  3LWE A;  3HOX H;  5IT9 L;  1U9R A;  1IBK L;  1NBW A;  1SE2 A;  3FMC A;  4ZYS A;  5CBA E;  1ZYR C;  3D4R A;  4ZUJ A;  1IL2 A;  4JOI A;  1W6J A;  5M9O A;  4MNO A;  1BBX C;  1VCI A;  2YTY A;  3IL8 A;  3QWN A;  5KNC A;  1HZB A;  4L5S A;  1Q46 A;  4UP8 A;  3PUW A;  5DLQ E;  1RTN A;  1PH8 A;  1JOR A;  1KIX A;  4OX9 L;  1HNW L;  2R7Z B;  2B8F A;  4KHV A;  1TWH H;  4A3G B;  2F0K A;  1RF2 D;  1U4M A;  1DCZ A;  2CWP A;  2VL6 A;  3PF5 A;  2ZTD A;  1DOM A;  1MD2 D;  5A2Q E;  4HR7 B;  4G57 A;  5J22 A;  5IGG A;  5AJ3 L;  4KV6 A;  1SYB A;  2JA7 G;  4JI0 Q;  2N49 A;  2E5L L;  5FOB B;  4N8F A;  3NQT A;  4QIW E;  5C5L A;  1NTG A;  3G71 A;  3AEV A;  1V1P B;  2AUK A;  1TWA H;  1AE2 A;  4RCN A;  2L15 A;  2Z6B A;  2ZXP A;  1J5E Q;  4C3H H;  1YJN A;  1A62 A;  4PNY A;  3BYT B;  3TRZ A;  3OYY A;  4JC0 A;  4IUR A;  1O7L A;  3BVG A;  1SR3 A;  5IYD G;  1D5Z C;  4OO1 G;  3S1N H;  1B44 D;  4M8A A;  3GTP H;  2ZM6 L;  3KYH C;  4DV3 L;  4TRD A;  4AYB B;  1WCM B;  1VQD A;  1RHP A;  1WTQ A;  4KHP L;  1JQY D;  1CHP D;  1EU4 A;  4BY1 G;  4YY3 L;  3UDG A;  1LT6 D;  5KNB A;  5EPK A;  4BS9 A;  5FLX L;  1LT3 D;  2IX3 A;  2IWH A;  3R3O A;  4IUV A;  1EY7 A;  4JI8 L;  4N8X 1;  4MTK A;  4A3D G;  3JAM E;  4H02 A;  3MAQ A;  2YU9 H;  1EWI A;  2NZO A;  1EWH A;  1EOT A;  2E74 C;  5CV8 A;  1Y69 U;  5IOD A;  2X69 A;  3J81 c;  3VR2 A;  4HED A;  1PTO D;  4G7H C;  3EA6 A;  1SAP A;  5CYU A;  4OEM B;  2UUC L;  5I4D A;  5HGQ A;  4LF4 L;  4LFC Q;  4K8I A;  5BR8 Q;  4FNF A;  1CSQ A;  1KL9 A;  2NBF A;  1QVC A;  5C3W A;  3Q22 A;  2K1B A;  1SFO B;  3E0E A;  1LTI D;  1IW7 C;  3BU2 A;  1DD2 A;  1UNS A;  4RFB A;  2E2D C;  2N55 A;  4GKJ L;  5M3M H;  2ES2 A;  1Q82 C;  2RQX A;  2WAC A;  2NB0 A;  2JYO A;  4GNX C;  5EPL A;  1WTO A;  5JPN C;  2MUY A;  2O5I C;  1IL8 A;  5DM7 3;  1BKB A;  4IJL A;  1PTO H;  1HH2 P;  1A6X A;  2KQ3 A;  3AB9 A;  3RN5 A;  3F2U A;  1JCK B;  3KLS X;  1B50 A;  3PO2 H;  3OMC A;  4DFA A;  4LF6 Q;  3PUX A;  2K33 A;  2L12 A;  3PIP A;  1ZXT A;  4FF4 A;  5JEA H;  1VQF A;  5K36 G;  1ML0 D;  2PI2 E;  1L1O B;  5E4X A;  5DEH A;  1B8A A;  1Y8O B;  3E6Z X;  2UUA Q;  4JBJ A;  1D1I A;  4NXM Q;  1TKW B;  1GUT A;  3LWU A;  4CDE C;  4WFN 3;  3S1M B;  2I07 B;  2Z6K C;  1WTH A;  1C48 A;  3SXH A;  1I6V C;  1EY4 A;  4H0L C;  4DNI A;  3HKZ B;  1JJG A;  1F9S A;  3A5Z B;  4OWW B;  2VUM G;  3RN2 A;  4YHH L;  4IFD I;  3DM1 A;  2B63 H;  1PYB A;  1XTC D;  4IAL A;  4B3T L;  3KF6 B;  3HOW G;  3M3Y B;  4K5W A;  4A3D B;  4HMJ A;  3NP8 A;  2ZJQ A;  1AE3 A;  1TWC B;  1PH2 A;  3DMU A;  3BDC A;  4ODG A;  1XWE A;  2O2L D;  3R8B A;  1HZ9 A;  1KHI A;  1O78 A;  2A8V A;  2OTJ A;  1O80 A;  3KDF A;  2L5T A;  4FYD A;  1VF5 C;  2BE5 D;  5ISR A;  2DY8 A;  4FXD A;  4IFD J;  2F0J A;  4XT3 B;  4R4O A;  2X6L A;  1Y8N B;  2MFI A;  3FPP A;  5L37 A;  4GZY C;  1PDQ A;  3KFU A;  2F0V A;  4BY7 G;  3BZK A;  3PO3 B;  2WP8 J;  1H9S A;  3FP9 A;  1VQK A;  3PQI A;  1X56 A;  4OEL B;  5IGB A;  1A63 A;  1LTL A;  4MHE A;  2RVL A;  3Q23 A;  2UXC Q;  1JB7 A;  4HSV A;  4GOP A;  1OXS C;  3GTO B;  3EFX D;  4DGZ A;  4F87 A;  2JP1 A;  1Q1B A;  1BCP F;  1I4R A;  1RJT A;  3TBI B;  1DOK A;  2WII B;  2EDG A;  2XRS D;  4JI6 L;  1WI5 A;  4XTC S;  1IKL A;  2A74 C;  1LT4 D;  4CDC C;  3HOY G;  4K2K A;  4NB3 A;  4QMG A;  1XNQ Q;  4RA8 A;  3VDY A;  1GUW A;  1AEX A;  4JV5 Q;  3NE5 B;  3NHH A;  1UAP A;  1GUO A;  1Z7T A;  3L9A X;  2Z8L A;  2F0D A;  4K0K L;  5GQO A;  2VW9 A;  5CV5 A;  1CKN A;  1HQM C;  4P73 A;  1X54 A;  1YNN D;  4FXG C;  3RLO A;  5CBE E;  4DR7 Q;  2BA1 A;  1KLU D;  4GKK L;  2HD3 A;  2UXD Q;  5LL6 S;  1STE A;  1P16 A;  1SFO H;  3HOW B;  1N34 L;  1LAB A;  1SEB D;  1GUS A;  1Y8P B;  1C4Q A;  2F0Q A;  2DNC A;  4ULL A;  2EYO A;  3J7A F;  4GLX A;  3I4M B;  4IUN A;  5C0X H;  4JI5 Q;  3J81 i;  1IXR A;  4CBV A;  2F52 A;  2L11 A;  1GO3 E;  3P75 A;  2E76 C;  1PH3 A;  2FIN B;  4ME3 A;  2X6G A;  1STN A;  2P5Z X;  1K8O A;  4QJF A;  4IPH A;  4XT1 B;  1VQN A;  4BY7 B;  3EN2 A;  4X3S A;  4A3M G;  1VQ8 A;  3BDO A;  4R4I A;  4DPG A;  3T1H L;  1LLR D;  1MHW C;  2BCO A;  4DU9 A;  4ZKC B;  3DWP A;  1FR3 A;  1K9M C;  4RHR A;  5EKK A;  3H3V I;  3CME A;  2LY7 A;  1N33 Q;  2KCN A;  1D7Q A;  1Q81 C;  1X55 A;  4LF9 Q;  2HDL A;  4PV1 C;  1KAB A;  2NZ1 D;  1CA6 A;  1QVF A;  1SDF A;  3R2T A;  4EQO A;  5EGT A;  1PFM A;  4R1J A;  1HXY D;  1TS3 A;  5M3F G;  3TS0 A;  2OTL A;  1XPR A;  1TWC H;  1T9H A;  5EPJ A;  1FNW A;  4AIM A;  2EYM A;  2JK8 A;  5CV7 A;  3NBH A;  1UE1 A;  4K6D A;  3ERO A;  3QG1 A;  2O5J C;  2A68 D;  5GRO A;  3OMG A;  4JVZ A;  3N52 A;  1X3E A;  4K2L A;  3M85 A;  4A3K B;  3OW7 A;  1E3P A;  3HOX G;  4JPB W;  1XMO Q;  2E2I B;  1XMQ Q;  4QY7 A;  3ONA B;  2IW3 A;  1BCP C;  3GD7 A;  4QCL A;  3PO3 H;  4KMU C;  1K8G A;  1AZP A;  1PXU A;  2ZXO A;  4O2D A;  1I94 Q;  3V2T A;  3GTO H;  3VA5 A;  1QJO A;  4KK7 A;  2EYL A;  1X65 A;  1W2B A;  1LTT D;  4DUZ L;  4AQY L;  4KY6 A;  4C1N I;  4GLA C;  5C4Z A;  4F88 A;  3HOU G;  1EZ8 A;  2VB2 X;  4K6L A;  5K36 H;  1HA6 A;  1SMX A;  1PTO F;  1HQR D;  1Z9F A;  4CDD C;  5COR A;  1EIG A;  2K5H A;  5LMU L;  3VA7 A;  5M5X B;  4L5Q A;  3KDF B;  4EVO A;  5DM6 3;  4DNR B;  1KRS A;  1EIY B;  4NW2 A;  1YHA A;  1IBK Q;  2Y0S B;  4XDX A;  4HJ8 A;  3F2B A;  3SE0 A;  1FGB D;  2D62 A;  4YWM A;  3TEH B;  2VXW A;  2YTX A;  5A2Q L;  2JQO A;  1DGS A;  1I4X A;  1ASY A;  2EJG C;  3KF8 A;  3IFD A;  4DR6 L;  3S1Q B;  2AKW B;  1H9S B;  1U4L A;  2XWJ B;  5EKI A;  2D2C C;  5FO7 B;  1HJP A;  3HEJ A;  2ICI A;  1HA5 A;  5FJ8 H;  4NDX A;  3PIO 3;  4H7B A;  2JA6 G;  5M3F B;  1V1O A;  4OX9 Q;  1HNW Q;  2K03 A;  1SJH D;  2B2Y A;  1SYG A;  1HNX L;  2HIX A;  5G3L D;  3I4M H;  3T16 A;  1STG A;  4G7Z C;  4HID A;  5C3X A;  4XQJ A;  4XQN A;  1QB5 D;  1U5K A;  2VB3 X;  2R92 G;  5AJ3 Q;  3DEP A;  1EL0 A;  2VZA A;  4O0A A;  5C44 B;  3HRZ C;  1V1P A;  1BO0 A;  1FD7 D;  1QWY A;  2LMC B;  2H4O A;  4BY7 H;  1LYL A;  3J81 E;  1SND A;  3QB3 A;  4DA2 A;  5BN4 A;  1CKN B;  1CSP A;  2Z4I A;  2A19 A;  1UEA B;  1KQS A;  2MPM A;  4GLV B;  2B2U A;  3TS2 A;  5C4X G;  1I6H B;  2E2J B;  1STA A;  2NN6 G;  1R4P B;  2G5D A;  1C0A A;  3HOU B;  2K5W A;  5J3B A;  4RWS C;  5BN5 A;  3K81 C;  1EIF A;  2I46 A;  2N78 A;  3UI2 A;  5JPM C;  1G6Z A;  3MZ5 A;  1STY A;  2ZM6 Q;  4EQP A;  4DV3 Q;  5IT9 c;  3S1R B;  3K5N A;  2K01 A;  2EYF A;  3HP3 A;  4KHP Q;  5M3M G;  3C2P A;  1OXT A;  1V43 A;  1ONL A;  3BZD B;  1EY8 A;  1TT2 A;  3CW2 C;  4YY3 Q;  4RMF A;  2GVB A;  1KRT A;  2M2L A;  2E8G A;  3CKI B;  4A3K H;  3AMU A;  1VF7 A;  1HR0 L;  2H1E A;  3PO2 G;  3D31 A;  4JI8 Q;  2A69 D;  2E2I H;  1X6O A;  3GTK H;  2JE6 I;  3OOC A;  2NUC A;  2JA6 B;  3HFZ B;  5JEA G;  3A8J E;  1Z6H A;  2SNS A;  1L2F A;  1CK1 A;  2AMC B;  1XPO A;  1PFB A;  4ILW A;  3A5U A;  2UUC Q;  4MN3 A;  5D3D A;  5LMN L;  4DUY L;  4LF4 Q;  1U4P A;  4C2M B;  5IY0 A;  1CTM A;  2KCM A;  1VQL A;  2Q8T A;  1I4G A;  2R92 B;  4DAV A;  3NK9 A;  4GKJ Q;  1E2W A;  1S4Z A;  4CKE A;  1NCV A;  1EY9 A;  1GOZ A;  3NBH B;  5I6Y A;  2OF1 A;  2B63 G;  1CHQ D;  3HOV B;  1TQO A;  1QZG A;  5M5X H;  2HT1 A;  2J7Z A;  2WAQ G;  5IYB H;  4R9W A;  1F9P A;  2NTS A;  4MTN A;  4HJ5 A;  5C4X B;  2TSS A;  1L1O A;  3MHB A;  3GTQ B;  3H91 A;  1EQV A;  1ZKO A;  3GP7 A;  3MXP A;  4DR5 L;  3PCO B;  1YIJ A;  3RLN A;  1OXU A;  4FXK C;  1X3P A;  4G4K A;  2EYP A;  1YNX A;  1TS2 A;  5CGK A;  4GN3 B;  2K75 A;  2DJG C;  4QUF A;  1HR0 W;  2YYZ A;  3PUZ A;  4IO9 A;  3TP8 A;  3KF6 A;  4HN7 A;  3OSO A;  1WTR A;  1G29 1;  4YHH Q;  5FLX c;  1XX8 A;  1TVX A;  3M4O H;  4WJW A;  3PO2 B;  5A35 A;  1PRT D;  2ALY B;  1QG7 A;  4L8J A;  5FO9 B;  4KD3 A;  3NWT A;  5C44 H;  5LMN W;  2FFK B;  1PH1 A;  4X3U A;  4ZQ3 A;  4LW1 A;  3OPO A;  1BF4 A;  4RGO S;  1NE3 A;  2F03 A;  4JG2 A;  4Y52 H;  1TS5 A;  2MJ8 A;  3KF8 B;  1KC8 C;  2RDG A;  1VQC A;  2JSO A;  5NUC A;  3BG3 A;  3CCV A;  4IFD H;  1J8I A;  4DV2 L;  2I5L X;  1U0L A;  4FF3 A;  1I6H H; 
#chains in the Genus database with same CATH homology
 4LFC L;  4NXM Q;  2E2J H;  5BR8 L;  3CQZ H;  4DV4 Q;  3S2D H;  4JYA Q;  1Q86 C;  3HOU H;  1IBM Q;  2Z6K C;  3ULJ A;  3RNU A;  4DR7 L;  1I3Q H;  3HKZ E;  2PNH A;  1E1T A;  2EXD A;  4DNI A;  3S1M H;  1JJG A;  3A5Z B;  4OWW B;  1MIU A;  4DV5 Q;  2VUM G;  4DR4 L;  3CXC A;  3RN2 A;  4YHH L;  4DV7 Q;  4IFD I;  4PZ6 A;  4BY1 H;  2KHI A;  2B63 H;  2ZTE A;  4PMW A;  3S1R H;  1HZA A;  1PYB A;  4OO1 I;  3PUY A;  4BBS G;  4B3T L;  1UE5 A;  3KF6 B;  2DGY A;  3HOW G;  3CPF A;  3GDE A;  4WJ4 A;  4NXN Q;  3M3Y H;  1UE6 A;  1V9P A;  1FVI A;  4LF6 L;  3S2H H;  4A3D H;  4DAY B;  2ZJQ A;  1AE3 A;  1YVC A;  5FLM H;  1MKH A;  1PH2 A;  4JI4 Q;  4JI6 Q;  1M1K C;  1N32 L;  1IBL L;  5C0X G;  1YJW A;  3J7A 5;  1VQB A;  1HZ9 A;  1KHI A;  2GN5 A;  2A8V A;  5C3E G;  1YJ9 A;  2PQA B;  2QEX A;  2OTJ A;  1JE5 A;  3KDF A;  1B7Y B;  2N3S A;  2OQK A;  4TVA B;  1JJ2 A;  2UUA L;  2E2H H;  2JA6 H;  2JA7 G;  2WFW A;  1EQQ A;  4IFD J;  3JAM c;  1VQG A;  3J7Z C;  4R4O A;  4P74 A;  4NXM L;  2AWO A;  3PGZ A;  1XNR Q;  3NEN A;  4DV4 L;  1UWV A;  2MFI A;  3E9H A;  4LFA Q;  1YHB A;  4JYA L;  2NVY H;  2RCN A;  1IBM L;  4K0K Q;  3CCS A;  1Q12 A;  3KFU A;  1BBW A;  4BY7 G;  3BZK A;  2WP8 J;  3FP9 A;  3CCJ A;  1VQK A;  1VQA A;  1X56 A;  4C2M H;  4GKK Q;  4QQB X;  1A63 A;  1LTL A;  4DV7 L;  3A74 A;  1X3G A;  2UXC Q;  1N8R C;  1EYG A;  2R92 H;  4DV0 Q;  1JB7 A;  3M4P A;  4GOP A;  3KLW A;  3OTO Q;  1N34 Q;  3I4N H;  4YWL A;  1OXS C;  2F3I A;  1B70 B;  3MXN B;  3HKZ G;  1W3S A;  2LXJ A;  1Q1B A;  4LF5 Q;  3CC2 A;  4A93 H;  3EIV A;  1PVO A;  1MJC A;  3K7A H;  3PSI A;  4L5T A;  1O7I A;  1SRU A;  5ELN A;  3LGJ A;  4NXN L;  5IP7 G;  2MNA A;  2BH2 A;  3HOV H;  4JI6 L;  4JI4 L;  3K0X A;  4LF7 Q;  3M7N A;  1WI5 A;  3HOZ G;  4A3L G;  2VQE Q;  4XTC S;  2K50 A;  2Q2I A;  1GKH A;  2JA9 A;  3HOY G;  5C4X H;  3AFQ A;  4JBM A;  2IX1 A;  4NB3 A;  1XNQ Q;  3GTQ H;  3VDY A;  3CC7 A;  3PV0 A;  4JV5 Q;  2YTV A;  3IRB A;  4PZ7 A;  3M9B A;  3S17 H;  5GAH C;  4DK3 C;  4LNQ A;  1XNR L;  2ASB A;  2JA5 G;  4LFA L;  4K0K L;  5GQO A;  1C9O A;  3ICE A;  2VW9 A;  4HJA A;  2JA8 H;  4X6A H;  1CKN A;  3W1G A;  4ALP A;  1VQ9 A;  4P73 A;  1X54 A;  1NY4 A;  3CAM A;  4IJH A;  3L7Z C;  3RLO A;  4DR7 Q;  4GKK L;  2BA1 A;  2KHJ A;  4YWK A;  3T1H Q;  2VUM H;  2CWA A;  1A0I A;  3CCU A;  2UXD Q;  3FHW A;  4OWX B;  1UE7 A;  1H95 A;  2FXQ A;  1P16 A;  1SFO H;  1PH7 A;  4DV0 L;  1I5F A;  3OTO L;  4HIM A;  4A3I G;  1YHQ A;  1N34 L;  4DR4 Q;  3FKI G;  4DAM A;  3PO3 G;  3I56 A;  3HOW H;  4A3F H;  4LF5 L;  1EOV A;  3CCR A;  1PH4 A;  4B3M Q;  4JOI C;  4LUZ A;  4GOP B;  1GVP A;  4B3T Q;  4HIO A;  2JEA I;  4GS3 A;  2ZJP A;  1WFQ A;  4LF7 L;  1RL2 A;  1NMG A;  2R7D A;  4GLX A;  3T1Y Q;  3K80 C;  4PG3 A;  2VQE L;  4JI5 Q;  1V1Q A;  3J81 i;  1A8V A;  1Q1E A;  1IXR A;  1SE8 A;  4R4Q A;  3F8T A;  2KEN A;  5C3E H;  3CCE A;  1K73 C;  1K0R A;  4IPG A;  2Z0S A;  1SRO A;  2F52 A;  3U58 A;  4HJ7 A;  3TQY A;  5IWA Q;  4Y7N H;  4HIK A;  1GO3 E;  2D0O A;  2MQH A;  1XNQ L;  4JV5 L;  5IYD H;  1PH3 A;  2Q2H A;  4ME3 A;  2NVX H;  3J80 i;  4QJF A;  2UU9 Q;  4X66 Q;  2RF4 A;  4IPH A;  3H3V H;  4JBK A;  3HKS A;  4DKA C;  1VQN A;  4P71 A;  3K7U C;  3EN2 A;  1Y14 B;  3W5O A;  4A75 A;  4A3M G;  4DR3 Q;  1QVG A;  5C0X I;  3EBE A;  4QL5 A;  2HHH Q;  2C35 B;  1VQ8 A;  3PF4 A;  2QGQ A;  4R4I A;  1OXX K;  4JCV E;  1X9N A;  5GAD C;  4GNX A;  2R93 G;  5IYC G;  4DPG A;  3T1H L;  3U50 C;  5ELO A;  2JJQ A;  2UXD L;  1Q7Y C;  2MO0 A;  1K9M C;  3ERS X;  1I50 H;  1PH9 A;  4LF8 Q;  2F4V Q;  2K52 A;  3H3V I;  2K4K A;  2NVQ H;  3CME A;  4QGU A;  4BA2 I;  4OXP A;  1S40 A;  1N33 Q;  2CFM A;  4DR1 L;  1D7Q A;  1OTC A;  2PMZ E;  1Q81 C;  1X55 A;  4DR2 Q;  3NEL A;  4B3M L;  4LF9 Q;  4IOA A;  3ULL A;  1VS0 A;  1MJE A;  4GN5 A;  3I4O A;  1GM5 A;  4BBR G;  1K3R A;  5FJ8 G;  1QVF A;  3T1Y L;  2HQL A;  1JJC B;  4GN4 B;  4A76 A;  3CCM A;  4JI5 L;  5C0X J;  2YV5 A;  4R1J A;  2XGT A;  3K8A A;  4X62 Q;  4DUZ Q;  5M3F G;  4HJ9 A;  3JC6 6;  4AQY Q;  3TS0 A;  3HOY H;  2D0P A;  2OTL A;  3RR5 A;  1XPR A;  1TWC H;  1T9H A;  4A3J G;  5H1S E;  3PIO A;  4AIM A;  5IWA L;  2UUB Q;  2JK8 A;  4KHZ A;  1KXL A;  1UE1 A;  3I7F A;  3I4M G;  4APV A;  2BH8 A;  4UPA A;  3J81 j;  1SLJ A;  2UU9 L;  1RIP A;  4X66 L;  2ID0 A;  2Z6K A;  2JA5 H;  2GVA A;  5GRO A;  4DR3 L;  3M85 A;  1X3E A;  2HHH L;  4JI2 Q;  1HZC A;  3BJU A;  2QA4 A;  1E3P A;  1E1O A;  5HY6 A;  3HOX G;  1K8A C;  3AYH B;  3GTG H;  3WWV A;  1XMO Q;  2IX0 A;  2NZH A;  1XMQ Q;  1K83 H;  4QY7 A;  1PV4 A;  3GTM H;  3GD7 A;  4XIG S;  4LF8 L;  2F4V L;  4A3I H;  1BBU A;  2AWN A;  3FKI H;  2IHF A;  4GNX B;  3PO3 H;  1N33 L;  3RZD H;  1KD1 C;  1K8G A;  4DR6 Q;  3TRE A;  4DR2 L;  4LF9 L;  4FDB A;  1CKM A;  1J6Q A;  2JEB I;  4O2D A;  1SN8 A;  1I94 Q;  2CKZ B;  1L1O C;  2IY5 B;  1AH9 A;  3GTO H;  1NMF A;  4LFB Q;  1M90 C;  1PA6 A;  4BA1 I;  1BVS A;  1W2B A;  1X65 A;  5GAE C;  2I0Q A;  2VY3 A;  3I2Z A;  2HIV A;  3H0G H;  4YCV A;  4X62 L;  4DUZ L;  4AQY L;  4A3C G;  2B3G A;  4GLA C;  3HOU G;  2UUB L;  3U4V A;  1FJG Q;  2R7Z G;  4WJ3 M;  1TXY A;  3CPW A;  4A3G G;  3JAM i;  1SMX A;  1WOC A;  1Z9F A;  1VQH A;  1N36 Q;  1Q8K A;  5C4J H;  4A3M H;  2KCT A;  2K5H A;  5LMU L;  5GAG C;  4L5Q A;  3KDF B;  4P72 A;  4JI2 L;  2Y0S E;  4BXX G;  1KRS A;  1QUQ A;  1EIY B;  1FL0 A;  1YHA A;  1IBK Q;  3S14 H;  3CF5 A;  1XMO L;  5IYC H;  2R93 H;  4HJ8 A;  3F2B A;  4OWT B;  4IPD A;  3TEH B;  2D62 A;  4NPS A;  4YWM A;  3W1B A;  3GTJ H;  1IYJ B;  1XMQ L;  1VQM A;  4A3K G;  2YTX A;  2LSS A;  2JQO A;  4POG A;  1OXV A;  1DGS A;  2VS1 A;  1ASY A;  2CCZ A;  3NEM A;  1PH5 A;  3UDF A;  4DR6 L;  2PI2 A;  2AKW B;  5EAY A;  1TWG H;  2I5H A;  3AFP A;  4BBS H;  1VQI A;  2R7F A;  3S16 H;  3S1Q H;  4DR1 Q;  1N9W A;  4BBR H;  1D8L A;  1YEZ A;  1HJP A;  3CMA A;  1I94 L;  4LWC A;  1PH6 A;  4UP9 A;  5FJ8 H;  1PHJ A;  4J15 A;  4LFB L;  2JA6 G;  3AQQ A;  1YBY A;  3KJP A;  4OX9 Q;  1HNW Q;  3STB C;  3J80 c;  5M3F H;  4YCW A;  4KI0 A;  3F2C A;  4X65 Q;  4A3J H;  1HNX L;  1FJG L;  2HIX A;  3KOJ A;  3PUV A;  4PZ8 A;  3I4M H;  2AHO B;  2I5M X;  2LXK A;  5JJK A;  1VQJ A;  3MEF A;  3A0J A;  1X3F A;  4JI7 Q;  4UP7 A;  3E9I A;  4HID A;  1N36 L;  1Y1V G;  1TWF H;  1U5K A;  1Y1W G;  5JJI A;  1PYS B;  2R92 G;  2Q2T A;  4EQ5 A;  5AJ3 Q;  1YIT A;  2B29 A;  4AYB G;  1WCM G;  1VQP A;  1S72 A;  2IHE A;  3I4N G;  2VNU D;  4AH6 A;  1HNZ Q;  2VZA A;  4O0A A;  5IP9 G;  3HOX H;  4LUO A;  1IBK L;  1NBW A;  4A93 G;  3DM3 A;  3F1Z A;  4MZ9 A;  1Z47 A;  4BY7 H;  4IOC A;  1LYL A;  1QUQ B;  2XTI A;  1VQ4 A;  3U4Z A;  1IL2 A;  1YI2 A;  4JI1 Q;  5IYB G;  4C3J H;  1HR0 Q;  1UEB A;  4JOI A;  1CKN B;  1E22 A;  4A3E G;  1CSP A;  2Y0S G;  4MNO A;  1VCI A;  2A19 A;  2YTY A;  1WYD A;  2OQ0 A;  1EQR A;  1KQS A;  4GLV B;  1G6P A;  1HZB A;  2EQS A;  4L5S A;  3TS2 A;  5C4X G;  1XTD A;  1Q46 A;  4UP8 A;  3PUW A;  5DLQ E;  5IP7 H;  1PH8 A;  1LUZ A;  3STB D;  2NN6 G;  4A3B G;  3DLL A;  1KIX A;  2A1A A;  2H5X A;  4DV1 Q;  4OX9 L;  4R4C A;  5J3B A;  1HNW L;  1C0A A;  1TWH H;  5LMN Q;  3HOZ H;  4DUY Q;  3G4S A;  4A3C H;  4A3L H;  3UE1 A;  3K81 C;  4X65 L;  1EIF A;  2CWP A;  2VL6 A;  3PF5 A;  2N78 A;  2JA8 G;  2R7Z H;  4A3G H;  2ZTD A;  1GD7 A;  3UDI A;  1IZ6 A;  3UE0 A;  4JI7 L;  1E24 A;  1VQ7 A;  2ZM6 Q;  4DV3 Q;  3KJO A;  5IT9 c;  5E7N A;  2WAQ E;  2R6G A;  4KHP Q;  2UXB Q;  5M3M G;  5AJ3 L;  4BXX H;  5IE8 A;  1OXT A;  1CUK A;  1V43 A;  4IPC A;  3S24 A;  2VQF Q;  1HNZ L;  3CW2 C;  1VQ5 A;  4JI0 Q;  2N49 A;  5M5Y H;  5LMU Q;  4YY3 Q;  4A3F G;  2E5L L;  2ATW A;  4RMF A;  3GTL H;  2GVB A;  1KRT A;  4QIW E;  1KAW A;  4GOP C;  1NTG A;  2E8G A;  3G71 A;  4A3K H;  3AEV A;  3RZO H;  2OCE A;  4JI1 L;  1HR0 L;  3L0O A;  5C44 G;  1TWA H;  3PO2 G;  3D31 A;  1AE2 A;  4JI8 Q;  2E2I H;  1X6O A;  2L15 A;  5JEA J;  3GTK H;  1J5E Q;  3S15 H;  2JE6 I;  4C3H H;  1YJN A;  3GO5 A;  3HFZ B;  5JEA G;  1A62 A;  2ZJR A;  2OWO A;  4EX5 A;  4UY8 C;  3BZC A;  1L2F A;  2AMC B;  1ASZ A;  1XPO A;  4DR5 Q;  3TRZ A;  2RHS B;  4DV1 L;  1NJI C;  4OON A;  4B3R Q;  3A5U A;  3OYY A;  4JC0 A;  2UUC Q;  4IFD G;  5LMN L;  4DUY L;  1SR3 A;  5IYD G;  1XJV A;  4LF4 Q;  3ZJY C;  2IT1 A;  4OO1 G;  2RHQ B;  3S1N H;  3G6E A;  4A3B H;  2DUD A;  5IY0 A;  2N8N A;  2KCM A;  4AYB E;  1HNX Q;  3GTP H;  1VQL A;  2ZM6 L;  3KYH C;  4DV3 L;  4DV5 L;  1Y1V H;  3D0F A;  1VQD A;  1Y1W H;  4GKJ Q;  4JBW A;  1L0W A;  4KHP L;  2MO1 A;  3UDX A;  2UXB L;  4RG1 A;  1WCM H;  2EIF A;  2VQF L;  5IP9 H;  3NBH B;  4JI0 L;  4BY1 G;  4YY3 L;  4JI3 Q;  2B63 G;  3UDG A;  2K5V A;  4P75 A;  5JJL A;  1QZG A;  5M5X H;  3ULP A;  2WB1 E;  3H15 A;  1E7Z A;  2HT1 A;  1EFW A;  2WAQ G;  5IYB H;  1VQ6 A;  4A3E H;  3CC4 A;  4JI8 L;  4MTN A;  1FGU A;  2K14 A;  4HJ5 A;  4H02 A;  1PFS A;  4C3I H;  4TQU S;  2YU9 H;  4X64 Q;  4A3D G;  3I55 A;  5FLM G;  1J5E L;  1L1O A;  1EWI A;  3ER0 A;  1G51 A;  2NZO A;  4KLK A;  1XPU A;  4DV6 Q;  4DK6 C;  1WJJ A;  3J81 c;  5M5W H;  1S3O A;  3RLF A;  4DR5 L;  4B3R L;  1QZH A;  3CCL A;  3PCO B;  4B3S Q;  1YIJ A;  2UUC L;  2CQO A;  3M4Q A;  4DV2 Q;  3RLN A;  5HGQ A;  1OXU A;  4LF4 L;  2BA0 A;  4LFC Q;  2K5N A;  5BR8 Q;  1C7Y A;  1CSQ A;  1KL9 A;  1YNX A;  3Q8D A;  4GN3 B;  1QVC A;  2K75 A;  3E0E A;  1HR0 W;  1CKO A;  3BU2 A;  4A4I A;  2YYZ A;  2NN6 I;  4GKJ L;  2UXC L;  5M3M H;  3PUZ A;  2ES2 A;  4IO9 A;  3KF6 A;  1EUJ A;  1Q82 C;  2JA7 H;  1G29 1;  4YHH Q;  1LM0 A;  5FLX c;  4GNX C;  3G48 A;  3CD6 A;  4POF A;  4JI3 L;  3M4O H;  2NVT H;  4R4T A;  3SGI A;  1BKB A;  3L2P A;  4IJL A;  1HH2 P;  3CCQ A;  2ALY B;  3OW2 A;  2E5L Q;  3RN5 A;  5C44 H;  1VQE A;  4L5R C;  5LMN W;  3PO2 H;  4LF6 Q;  3PUX A;  1P8L A;  1PH1 A;  4X64 L;  3HOV G;  2PQA A;  4LW1 A;  3H0G G;  3PIP A;  4DV6 L;  3F2D A;  1N32 Q;  3B6Y A;  4LUV A;  4YCU A;  1VQO A;  1IBL Q;  1VQF A;  1R9T H;  1NE3 A;  2WB1 G;  5K36 G;  2PI2 E;  4JG2 A;  4Y52 H;  1L1O B;  3KF8 B;  1KC8 C;  1JMC A;  2V1C C;  2ZTC A;  1B8A A;  1VQC A;  4B3S L;  3CCV A;  1JT8 A;  3CP0 A;  2UUA Q;  4JBJ A;  1YZ6 A;  2I5L X;  4DV2 L;  1U0L A;  1I6H H;  2KBN A;  2Q2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...