5LMUL

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5lmuL00
3G6EA 4BBSG 3PCOB 4UP9A 1WI5A 4H02A 2UUCL 3GTGH 2AWNA 1X3FA 3M4QA 3OTOL 1HNXL 1UE6A 4B3TL 4K0KL 1X3EA 1CKOA 4A3IH 4UY8C 4J15A 4QJFA 1KD1C 1Y1VH 4LF8L 4X62L 5GQOA 1CKNB 1XNRQ 1VQ9A 2NVQH 4AYBG 4UPAA 1NY4A 1Q1EA 4YY3L 5IWAL 4A76A 1XMQQ 2CCZA 1VQ4A 1JT8A 4YCWA 5AJ3L 1HNWL 4LF6Q 3CCQA 2D0OA 1WCMG 3LGJA 1HNWQ 3ULJA 2JA6G 5GADC 3FKIG 3CC4A 2K4KA 2NZOA 4C3HH 1VQIA 1YI2A 1N36Q 3GDEA 2JA8H 4O0AA 2K5VA 3CCEA 4B3SQ 3I4NH 4HIMA 2JA5H 3PGZA 5LMUL 3UDIA 4GN4B 2VW9A 1YJ9A 1J5EL 4GN3B 2A8VA 5M3MG 2VQFL 4JOIC 4C3JH 4EQ5A 3CF5A 1P8LA 2BH2A 4JI8Q 1PH1A 4PMWA 3S17H 3G48A 1VQEA 2R6GA 4A93H 1OXTA 1TWHH 5M3FH 1XPUA 4QGUA 3GTMH 4HJ9A 1U5KA 2ES2A 1WJJA 2N78A 3AYHB 4OONA 2GVAA 4HJAA 1PH7A 3W1BA 1VQBA 2E2JH 3S16H 2KHIA 4HIOA 5JJIA 4GKKL 2RCNA 4YWMA 1MJEA 3ERSX 1PH8A 3U50C 1VQ5A 1K3RA 2XGTA 1S72A 2ZTCA 4MNOA 4DR4L 5C44H 1V43A 1I3QH 3OYYA 3I55A 1QZHA 4L5QA 3I4OA 4JI3L 1GO3E 3HOUH 2F3IA 5FJ8G 4JI5Q 1MJCA 1I94Q 4YCUA 2Q2HA 3K7AH 4P75A 1Q82C 1NMGA 2ALYB 1N34Q 5M5XH 4A3DH 3RLFA 1XNQQ 1YJNA 2VL6A 2UU9L 2ZM6L 2JE6I 3FP9A 1I5FA 4GLXA 4DKAC 3PUWA 2JEAI 2VZAA 4LUZA 3H3VI 1X65A 2UU9Q 3ULLA 5C3EH 4NXML 1IYJB 4X65Q 3CCMA 2MNAA 4LUOA 3WWVA 4DR7Q 1XJVA 1C7YA 5LMNL 4GNXC 3HOZG 2PI2E 4A3EG 3Q8DA 4DV0Q 2CFMA 3PO3H 3H0GH 4JBKA 1L2FA 4LF5Q 1X6OA 4A3BH 3G4SA 4NXNQ 3CW2C 4A75A 1LTLA 2UXDL 1HZCA 2XTIA 4GKJL 3CQZH 3HKZG 4DV1L 1IBKL 1Q8KA 3GTQH 3S2HH 1XPRA 3DLLA 1AH9A 1IBKQ 1HR0L 4GNXA 1IBLQ 1JJCB 1N33L 4A3KH 1VQ6A 3KFUA 3E0EA 3CCRA 2OCEA 3HOWH 1HZAA 2FXQA 3K80C 4JI2Q 3A5UA 1VQ7A 3AFQA 1N33Q 3HOVG 5C4JH 2DGYA 4DAMA 4XIGS 1YZ6A 4DR2L 4BY7H 4X66L 1V9PA 5K36G 3J80c 1EYGA 2D0PA 1JB7A 1LUZA 5IYBG 4DUZL 1E24A 4JCVE 2NVXH 5FLXc 2BA0A 3JAMi 4LW1A 3HOYH 3M3YH 4A3LH 2MO0A 1HR0W 5IT9c 2I5MX 3F2CA 1IL2A 3GTPH 3NELA 1VQKA 4DK3C 4R4TA 2NVTH 4LFBL 1JJGA 3VDYA 3I4MG 1EIYB 1PH3A 2ID0A 3STBC 4LFBQ 2HQLA 2UUBL 4GLVB 3BZKA 5IP9G 2R7DA 5IYDH 2A19A 5JJKA 4AQYQ 2RHQB 1QUQA 4L5TA 1PV4A 2KHJA 1DGSA 4GLAC 1PH9A 5GAEC 4DR5Q 1KHIA 2MQHA 3W5OA 4DUYQ 1UE5A 3HKZE 4DV2Q 4L5RC 2B63G 1Y1WG 3PUYA 4GOPB 5C0XJ 1VQGA 2A1AA 3HFZB 3KYHC 1XMOQ 1XNRL 5GAGC 3S1NH 1YNXA 4JI4Q 1HJPA 3CP0A 4A3CH 1UE1A 3AQQA 1KAWA 1E1TA 2WAQG 1X9NA 2ZJRA 1XMQL 4A3GH 3GTLH 2Y0SG 3PUXA 4HJ7A 4JI6Q 4LF6L 3TS0A 4DV7L 4HIKA 1CSPA 3CPWA 3H3VH 1N32Q 2OTLA 2VQEQ 1N36L 1KRTA 1EQRA 4KHZA 4DV7Q 3PF4A 4EX5A 3TQYA 1Z47A 2WB1G 1K9MC 2ATWA 2R7ZG 5DLQE 1KXLA 4DV4Q 1E7ZA 3GTOH 1YEZA 4DPGA 4B3SL 2UXCQ 1A8VA 4BBSH 5IYCG 1TWAH 1N8RC 2PQAB 2OQ0A 2JK8A 3F2BA 1D8LA 4IOCA 4OX9Q 2OTJA 2ZTEA 4HJ5A 2H5XA 3B6YA 2CWAA 2GN5A 2Z6KC 3NEMA 4JI8L 1YHAA 3PIPA 1YHQA 1B8AA 1Q46A 4DK6C 4OWWB 4LNQA 2EIFA 1FJGQ 4POFA 3MEFA 3DM3A 3TRZA 4JBWA 5FLMG 4JYAQ 5ELOA 5IP7G 1CUKA 2D62A 4QIWE 1JJ2A 4YWKA 5BR8L 2YYZA 4YHHQ 1WCMH 1HH2P 1N9WA 4QL5A 2JA6H 3FKIH 3KF8B 5BR8Q 1VS0A 4IJLA 1I50H 4BA1I 2Z6KA 4MTNA 2R93G 1TXYA 2ZTDA 4KHPQ 3M7NA 4DV5Q 2WAQE 2HIVA 3GO5A 4MZ9A 2Y0SE 4KLKA 1X56A 3CD6A 2I5LX 1VQ8A 4LFCQ 1P16A 2IY5B 2JQOA 4JI5L 4A3FG 4JV5Q 4A3MG 3SGIA 1I94L 5M5YH 4LF7L 5E7NA 5M3MH 1N34L 4P74A 1JMCA 3EBEA 2IX1A 2JA7G 3RN2A 4IPDA 4JI7Q 4X64Q 1XNQL 3K81C 4POGA 4LF7Q 2I5HA 2WB1E 4R1JA 4JI1L 2NN6G 1BKBA 4P72A 1Q1BA 4LF4Q 1Q7YC 3F8TA 2AMCB 3T1HQ 1TWCH 1VQPA 3PUZA 1B7YB 1BVSA 1V1QA 4JI1Q 3K8AA 1W2BA 1GM5A 2KCMA 3A74A 4ME3A 4X65L 1YJWA 4DR7L 1X3GA 1YITA 1HZBA 3FHWA 1VQMA 2K14A 5HY6A 4DV0L 3KF6A 1KRSA 4LF5L 1K73C 2R92G 1CSQA 4NXNL 3KJOA 1U0LA 3J81c 1K8GA 3HOXG 1VQCA 5FJ8H 4LF9Q 1C9OA 1PHJA 2QA4A 4PZ8A 3CAMA 4AIMA 1ASZA 1L1OC 3CMEA 1EIFA 1NE3A 3KDFA 1GVPA 1AE2A 3ULPA 1Q12A 2HHHQ 1G51A 1IBLL 4B3RQ 2VUMG 4BBRG 3RNUA 3J81j 4KI0A 3H15A 4DV3Q 2IT1A 5LMNW 1C0AA 2CQOA 4DV6Q 2K50A 3F2DA 4ALPA 3RZDH 4JI2L 1VQNA 2UXBQ 2AWOA 2E5LQ 1UWVA 1OXXK 3ZJYC 5GROA 3CCJA 1YIJA 1QVGA 1ASYA 3S1QH 4BXXG 4APVA 1D7QA 2IX0A 4RG1A 4QQBX 1L1OA 3HOZH 2KBNA 4A3JG 4BY1G 3HOYG 1SE8A 2EXDA 1HNZQ 1CKMA 2CKZB 1PVOA 1PYBA 2QGQA 1GD7A 1PYSB 1VQJA 3NENA 2K5NA 4DNIA 3PF5A 1EFWA 1CKNA 1OXSC 3T1YQ 2Q2TA 4LFAL 2GVBA 1IBMQ 4AQYL 1KC8C 5IYDG 1WOCA 2MO1A 4JI0L 3GTKH 3A5ZB 4LFAQ 3PO2H 3KLWA 2VNUD 1EWIA 4DR5L 1VQLA 4JI0Q 1X55A 4DUYL 1R9TH 3CC2A 2PMZE 4DV2L 3S15H 2JEBI 3JC66 2L15A 1VQAA 2YTXA 4PZ6A 1PFSA 3M4PA 5IYBH 5HGQA 3J80i 3L2PA 5C0XG 4UP8A 2K75A 3EIVA 1XMOL 3BU2A 1PH6A 4JI4L 4A3IG 2YU9H 5C4XH 3K7UC 2R7FA 1M90C 1EUJA 3J7ZC 1SFOH 1Y1VG 2F4VQ 1FGUA 4DR6Q 4A3CG 1A63A 4OWTB 1OXVA 4JI6L 3E9IA 1YVCA 3I4MH 3L0OA 2VY3A 1TWGH 4AH6A 1TWFH 1A62A 3PSIA 2NN6I 4B3ML 2Z0SA 5IP9H 1N32L 1Z9FA 2VQEL 1FVIA 4TVAB 1E1OA 3UDXA 1WFQA 2ZJPA 1O7IA 4B3MQ 3AEVA 4X6AH 2LSSA 2YV5A 3TEHB 4DV4L 4FDBA 4R4IA 1YHBA 1KL9A 2UXCL 5JEAG 2Q2UA 4Y7NH 2JA8G 4IFDG 3OW2A 4NB3A 5JEAJ 4OX9L 3CC7A 2E2HH 2ZJQA 3IRBA 2BH8A 2B63H 4IFDJ 1XTDA 3CPFA 1Y1WH 3I4NG 3NBHB 2JA5G 1YBYA 2UUCQ 3OTOQ 1HNXQ 2YTYA 1Q81C 4B3TQ 3PIOA 2RHSB 3I56A 5H1SE 3KJPA 1IZ6A 1AE3A 4PG3A 2I0QA 4K0KQ 1QVCA 2F52A 1UE7A 4IJHA 4NPSA 3J7A5 4JYAL 4LF8Q 4X62Q 1UEBA 5ELNA 4A93G 2N8NA 1X54A 4YHHL 2CWPA 4OO1G 4XTCS 5M3FG 4YY3Q 4WJ4A 3K0XA 1QUQB 5IWAQ 4P71A 2OWOA 1FJGL 4Y52H 3ER0A 1NTGA 5AJ3Q 3U58A 3S1RH 4L5SA 1L0WA 3W1GA 4KHPL 4DV5L 2R7ZH 4DAYB 1PH5A 3PO3G 1XPOA 3UE1A 4R4OA 4LFCL 2EQSA 3PV0A 2N49A 5EAYA 4JV5L 5IYCH 5C44G 3S1MH 2YTVA 3CCVA 1SLJA 3CXCA 3M85A 1VQFA 3HOUG 1MKHA 3S24A 4X64L 4JI7L 2B29A 1OXUA 3PUVA 5LMUQ 1J5EQ 2K52A 2N3SA 4LUVA 2VQFQ 4LF4L 4A3DG 3T1HL 4A4IA 5FLMH 1RL2A 3MXNB 5IP7H 2NVYH 4YCVA 1EOVA 2JA9A 3I2ZA 3S2DH 4YWLA 5C3EG 1VCIA 1W3SA 5GAHC 2PNHA 1I6HH 1SN8A 2UXBL 2E8GA 4JOIA 2R93H 3EN2A 2KCTA 5M5WH 3U4ZA 4AYBE 3CCUA 1PH2A 1OTCA 4GKKQ 4OXPA 1NMFA 4GS3A 2QEXA 1E3PA 3D0FA 4C3IH 5C0XI 4JBMA 4LF9L 1QVFA 2C35B 3H0GG 3M9BA 3UDGA 2VS1A 4A3FH 4A3MH 3CCLA 1BBWA 4A3BG 4QY7A 2E2IH 2B3GA 2HT1A 4DR4Q 1IXRA 4JI3Q 2JA7H 4IPCA 4HJ8A 1GKHA 2HHHL 3E9HA 4B3RL 4DV3L 1K8AC 1QZGA 1A0IA 1S3OA 4DV6L 4GOPC 3F1ZA 2ZM6Q 4A3KG 2E5LL 3A0JA 4JC0A 2HIXA 1LYLA 2DUDA 1G6PA 1LM0A 3CMAA 4IO9A 3I7FA 4UP7A 1J6QA 2ASBA 3HOWG 1JE5A 2V1CC 2Q2IA 4NXMQ 4IFDI 1EQQA 4TQUS 4BY7G 2UUAL 1MIUA 3RZOH 4C2MH 1WYDA 2R92H 4O2DA 3JAMc 5LMNQ 4P73A 4A3EH 1HNZL 2AKWB 3KOJA 3HOXH 3J81i 2UUAQ 4A3LG 3RR5A 4GOPA 3S14H 1KIXA 4DR3L 3AFPA 3T1YL 5JJLA 1PA6A 2K5HA 1E22A 1IBML 1RIPA 2UXDQ 3TREA 4LWCA 4GKJQ 2JJQA 3HKSA 3GD7A 4DR1L 4DV1Q 4DR3Q 2VUMH 4BBRH 1Q86C 1SMXA 3PO2G 1NBWA 4PZ7A 4OO1I 1Y14B 3RLOA 4DR1Q 2IHFA 1HR0Q 4OWXB 3BZCA 4BXXH 1NJIC 3KF6B 1VQHA 3HOVH 2AHOB 4HIDA 2PI2A 2RF4A 4JBJA 1S40A 3RLNA 4A3JH 4BY1H 4DR2Q 4X66Q 2F4VL 2PQAA 5IE8A 4DR6L 1SROA 4DUZQ 3RN5A 4BA2I 1FL0A 2KENA 5C4XG 4IPGA 3TS2A 3L7ZC 4WJ3M 1BBUA 3GTJH 1H95A 1VQDA 3KDFB 4A3GG 4JG2A 1VQOA 2NZHA 1KQSA 2MFIA 5J3BA 3G71A 3UDFA 1PH4A 2IHEA 1K83H 4IPHA 3BJUA 4GNXB 1K0RA 3ICEA 2LXJA 2UUBQ 2OQKA 2WFWA 1B70B 3U4VA 1G291 1HZ9A 1SRUA 2BA1A 3UE0A 3D31A 5IY0A 3M4OH 4IOAA 1T9HA 2LXKA 3STBD 3CCSA 4GN5A 4R4QA 4RMFA 1L1OB 1SR3A 2WP8J 4R4CA 1M1KC
chains in the Genus database with same CATH superfamily
3MFYA 3X3MA 3M4QA 4R8NA 3GTMB 4K0KL 1X3EA 3S2DB 1CA5A 4J15A 3QIAA 1KD1C 3P1HA 4LF8L 5GQOA 1Z6HA 2J4XA 1VQ9A 2A68D 4A76A 1YNNC 1O7LA 4YCWA 1GUTA 4FYDA 2RDGA 2R3ZA 2K5QA 3CC4A 5JEAH 1JWSD 2FMCA 3J80L 4B3SQ 3I91A 3H91A 2X6LA 4GN4B 5M3MG 1NAPA 1AEXA 4C3JH 4EQ5A 3CF5A 2BH2A 3VYUA 2XRSD 4KY6A 3R8BA 5M3FH 2F0JA 2ES2A 4RGNA 2ICIA 2OXPA 2PMZB 3W1BA 3EQLC 4KD4A 4ZK9B 2M00A 1VQ5A 2XGTA 2KEDA 4HMJA 4MNOA 5C44H 4DR4L 1V43A 1T5XD 3I55A 1ESRA 3WOFA 4BBRB 1GO3E 4ME5A 3HOUH 5FJ8G 2DNCA 2PCFB 5IT9E 5CC4A 1TS5A 1NMGA 3OWEB 4FVMA 2KCNA 4A3DH 4G7OC 4BY7B 2ZM6L 3FP9A 3TZDA 4LUZA 2NVXB 1X65A 2UU9Q 3ULLA 5C3EH 1SMYD 3HOYB 2IW3A 4B9WA 2F1MA 4X65Q 3CCMA 2MNAA 1TQOA 3WWVA 1TKWB 1MGSA 4GNXC 2H1EA 2CH4A 2PI2E 3Q8DA 2CFMA 2AQ3B 1GXDC 3H0GH 1L2FA 4KTAA 1X6OA 2F0GA 3FVQA 3G4SA 4MN3A 1HZCA 3CQZH 5CBAE 1Q8KA 1LTTD 2NTSA 3S2HH 3DLLA 1HRJA 4IURA 1IBKQ 1HR0L 3G6JB 4GNXA 1VQ6A 1CQFA 3KFUA 1SJHD 2OCEA 4A3IB 1J9OA 4JI2Q 2K1BA 2L0CA 1Y1VB 3D6WA 5C4JH 2DGYA 3SEBA 4X66L 1V9PA 1ENAA 2V4DA 3KBXA 1E24A 5M9OA 2WIIB 2NBFA 5IT9c 3F2CA 3NELA 3MXUA 1JJGA 3VDYA 4C3HB 2ID0A 4LFBQ 2JA8B 5FO9B 1ICFB 2WINB 3BZKA 4GLVB 1K0SA 1TWAB 5IYDH 5JJKA 1PZJD 3T56B 1QUQA 2E2DC 4L5TA 1DGSA 1PH9A 2F0DA 4HAEA 5GAEC 4M8AA 2B2VC 5CV4A 4DUYQ 1PLFA 1UE5A 4DAYA 4L5RC 3S17B 2EY1A 3PUYA 1S5DD 4GOPB 5C0XJ 5KNDA 1XNRL 5D14A 1TY2A 3AQQA 1XMQL 4EQOA 2CQAA 4RGMA 3OMGA 4GZYC 1M4VA 2B2VA 4LF6L 3TS0A 1ICWA 5LL6S 1CSPA 2VQEQ 2K05A 4N8FA 2A6HD 1EQRA 5M3MB 4DV7Q 3PF4A 1PDQA 1Z47A 3VYTA 5CYUA 4DK1A 4DPGA 1VDZA 2OEOA 2L11A 5CV5A 1DJRD 1RHPA 1D8LA 4IOCA 3HP3A 4IQZA 1CI3M 2CWAA 3NEMA 3QJYA 2MGSA 3PIPA 2EIFA 1FJGQ 3I4LA 3DM3A 5FLMG 4JYAQ 1CUKA 1DYQA 4RHSA 2D62A 1MHWC 4CJ2C 1BR9A 4DN4M 2NWGA 3QOJA 1BCPB 3FKIH 5BR8Q 5ELEA 1BUVT 3BYYB 3M7NA 2WAQE 1H9MA 2HIVA 2JYOA 5I4DA 2Y0SE 3GTQB 1VQ8A 2EYFA 1P16A 4A3FG 4JI5L 3PMFA 3HS0C 3NP8A 5M5YH 1DONA 1KLGD 3RZDB 5E4XA 1N34L 4JI7Q 5IODA 4POGA 4LF7Q 2TMPA 1F2MA 2WB1E 4JI1L 1XYIA 3PIO3 4DF7A 2AQ2B 3P20A 1STYA 4ME3A 2ZXOA 2N55A 2DY7A 1VQMA 2NVTB 2KUMA 4DV0L 1KRSA 2QILA 4LF5L 2R92G 1CSQA 1U0LA 1VQCA 1ZXTA 1A6XA 3CAMA 4ABNA 3TN2A 1ASZA 1FR3A 1F9QA 2MUYA 3KDFA 3RUZA 2HHHQ 1IBLL 1U4LA 2WKCA 1C0AA 4ALPA 1EY7A 3MWYW 1VF5C 3SXHA 2AWOA 2E5LQ 1OXXK 3ZYYX 1YIJA 1QVGA 1ASYA 3S1QH 1D7QA 1TWGB 3J7AF 1U4PA 4OHJA 2NB0A 1SYGA 1SEBD 2QCPX 4CDDC 1PYBA 1GD7A 3NENA 3R93A 4DNIA 2K5NA 3TP6A 5DM73 3PF5A 1CKNA 3T1YQ 1EFWA 2Q2TA 5IGEA 2O5JC 4ILWA 2GVBA 1IBMQ 3GTOB 5IYDG 3GTKH 2EVBA 2BE5D 3SK8A 2VNUD 3KLWA 3WDNA 5A2QL 1I4PA 1EWIA 4DR5L 5DAUA 1VQLA 5CV7A 3CC2A 3JC66 4PZ6A 2PZUA 1K8OA 2XNAC 3EIVA 1XMOL 3BU2A 4JI4L 2A68C 5C4XH 3S1RB 1II3A 4DR6Q 5J22A 3H09A 1YVCA 3D6CA 4MHEA 3I4MH 1TWFH 1A62A 5J39A 4XT1B 3MXPA 1BCPD 1FVIA 1A2UA 3S1MB 1E1OA 3UDXA 4KHVA 4B3MQ 3DM1A 2LSSA 3TEHB 3NQTA 2Q2UA 2Q8IB 4YIJA 2WKDA 4WJWA 1S5FD 2R61A 4I7ZC 2KVMA 2ZJQA 2B63H 3MHBA 4IFDJ 4FF1A 3I4NG 2M2LA 2DJGC 2JA5G 2UUCQ 3OTOQ 5BN5A 1HNXQ 1Q81C 1H9SA 1IZ6A 1AE3A 2F4IA 4EGVA 2F52A 1IL8A 1QWYA 2K32A 5ELNA 4A93G 2N8NA 2IWHA 2EZVA 1QUQB 2OWOA 5I2YA 4Y52H 4Z9CB 4IUPA 2F0TA 4DAYB 3NUCA 1YNND 4HR7B 1XPOA 5EAYA 5IYCH 3CCVA 1OXUA 5LMUQ 3A8JE 3GV6A 2QF7A 1DD2A 1QE6A 2N3SA 5DM63 2VQFQ 1SBBB 1AFPA 2EY2A 2HQEA 1Q8IA 2F0PA 3RZOB 4B08A 3HOZB 4YCVA 1ONLA 2JA9A 3I2ZA 3S2DH 1VCIA 1W3SA 1SN8A 2UXBL 4IUVA 1RTNA 4JOIA 2KCTA 1OTCA 3U4ZA 3I8ZA 4U673 2QEXA 1E3PA 5C0XI 4LF9L 3M9BA 4CHTB 3UDGA 1BBWA 4A3BG 1X3QA 3ERQA 5JJZA 5KNBA 4IPCA 5AFWA 4B3RL 4K5XA 4KKSA 3S15B 1W6JA 2XRQD 3F1ZA 2F0OA 4A3KG 1F9SA 4CKCA 2HIXA 1LYLA 4IUNA 3HRZC 1LM0A 4CJ0B 3CMAA 4UP7A 4IO9A 1J6QA 2YU9B 3HOWG 1SFOB 4NXMQ 1VMCA 3HG9A 4F8MA 2K28A 1HNZL 1HUNA 4A3LG 3BDOA 4ZCKA 1BXTA 3DXJC 3H94A 2UXDQ 4LWCA 1Y8OB 4DR1L 4DV1Q 2NZ1D 4BBRH 1SMXA 1Q86C 1NBWA 2EYMA 1LLRD 3X3NA 1EWCA 2IHFA 3BZCA 1F9PA 1X3PA 1VQHA 2AHOB 3SVMA 2WAQB 4HN7A 1MI2A 3D4RA 4MIUA 2Y0SB 3NQIA 1S40A 4DR2Q 4DGZA 2F4VL 1LTRD 5IE8A 5C4XG 1SROA 1YNJC 1FL0A 4IPGA 4RAUC 2B2TC 4R9WA 3KDFB 3VA5A 1XX8A 2MFIA 2WB1B 5J3BA 1EYCA 2IHEA 1EFID 3BJUA 1D5XC 3U4VA 1RODA 1A2TA 1HZ9A 3VYSA 3D8GA 1EY5A 1SE4A 1T9HA 1Y8NB 1SR3A 2B2TA 4R4CA 1G2SA 1ILPA 1B9MA 1PZID 3PCOB 4H02A 4RH6A 4A93B 1X3FA 1TWHB 1H9KA 1HXYD 2L1BA 5LHY1 4A3IH 2PZTA 1Y1VH 4X62L 1CKNB 2KOLA 2CVRA 4DA2A 2IJ0A 1Q1EA 4YY3L 1EEFD 1SJED 1IKMA 2AUKA 1VQ4A 1A15A 3A7LA 5AJ3L 1FGBD 3Q24A 3D4WA 3LGJA 2F0LA 3ULJA 2JA6G 4C3HH 2NZOA 1SNQA 1YI2A 4ZYSA 4O1NA 2JA8H 3NWSA 3ND9A 4IFDH 4RWSC 5KRUA 4O0AA 2ENBA 2K5VA 5FLXL 1QILA 3CCEA 3V05A 1JB3A 4XXEA 1J5EL 2A8VA 2K7VA 4GN3B 2BOSA 3NBIA 4JI8Q 2L55A 1AZPA 3S17H 1OXTA 4OO1H 4RKLA 5CBEE 4K5VA 3HOXB 4HJAA 2MP1A 3EJIA 1SNPA 1PH7A 3S16H 3S14B 5JJIA 4OELB 4GKKL 4YWMA 3IL8A 1K3RA 1BF4A 3OYYA 1HQRD 3NK9A 5D3DA 3I4OA 4JI3L 1LTAD 4A3KB 2F3IA 3VR5A 1H9SB 3K7AH 4P75A 2EY5A 1BO0A 3RLFA 4CKEA 2UU9L 3PIP3 1I5FA 4DKAC 3PUWA 4V0BA 3T4AC 2JEAI 4N9TA 1X32A 1GOZA 1WTOA 5E1FA 4PNYA 2EYPA 3GTPB 2KQ3A 1EY4A 1F77A 2AUJD 4IUQA 4LUOA 1XJVA 1C7YA 5LMNL 3GV3A 2G9DA 3D3RA 4JBKA 1PTOC 5ELBA 4DAVA 4WORA 3M4OB 3HKZG 4X3SA 1IBKL 1UUPA 3GTQH 4HCSA 4OIKA 1XPRA 3K6OA 4KY7A 2K5DA 4NMZA 3HGBA 3E0EA 1KDAA 3S1NB 1HZAA 3K80C 1N33Q 3AFQA 2F0EA 4DAMA 1E2WA 4DNRB 2EXZA 2RSOA 4V190 4ZRZA 2D0PA 1B44D 1LUZA 1JB7A 2IX3A 2BA0A 5C3WA 1KABA 4OL7A 2I5MX 2NVTH 1VQKA 4LFBL 1EQVA 4DXFA 1BDOA 1W6KA 2HQLA 2UUBL 2HUGA 5IP9G 1O78A 1XXGA 1PV4A 4QCLA 1F2LA 1L0YB 1K28A 4K8IA 3AMUA 3R2IA 3DMUA 5C6AA 2A1AA 5GAGC 2JA6B 1KAWA 4A3GH 1E1TA 2FMMA 1FNUA 2ZJRA 1I50B 1X9NA 2B8GA 5CV9A 4JI6Q 1HHVA 1QNUA 4DV7L 4HIKA 3CPWA 1I3QB 1N32Q 2OTLA 1N36L 4NKLA 4CDEC 1KRTA 4KHZA 4EX5A 1KXLA 5I2XA 2B2YC 4DV4Q 1BCPF 3MZ5A 3GTOH 1S5CD 3CRLC 1ILQA 1A8VA 4BBSH 4UAIA 4RA8A 5DEHA 1N8RC 2OQ0A 4OX9Q 1D1KA 2EPBA 4KJNA 3J81E 2XSCA 4HJ5A 3B6YA 4PV1C 1ESFA 2PW7A 3DWQA 1YHQA 1Q46A 5K5PA 4LNQA 2X69A 3IFTA 4POFA 1SDFA 1HTPA 1NNXA 1AP0A 2C5CA 2B2YA 5ELOA 5IP7G 1SYFA 5BR8L 2I07B 1WCMH 4HSVA 4QL5A 1VS0A 4LAAA 2R93G 1TXYA 4KHPQ 3EA6A 4DV5Q 3PO3G 4KLKA 4LFCQ 3SGIA 2TSSA 1I94L 4LF7L 4K2LA 3S9WA 1D6EC 2A5HA 3EBEA 5CORA 5EPJA 3RN2A 4X64Q 3EVQA 1XNQL 3K81C 1TIID 5FK9C 3U9SA 2NN6G 1BKBA 3FPPA 4P72A 1Q1BA 4LF4Q 3T1HQ 3PUZA 1B7YB 1V1QA 3BDLA 2K03A 2KCMA 4DR7L 4K6LA 1HZBA 1LTSD 3HKZB 3A55A 5EPLA 3OIPA 2G9HD 1STGA 4BWGB 5BN3A 1K73C 4NXNL 4KJOA 3J81c 1K8GA 3PO2B 3F2UA 1HFGA 4AIMA 3CMEA 1AE2A 1Q12A 5I6WA 1G51A 4PQXA 4XQJA 3MC0B 3U9OA 4DV3Q 2PPBC 2SOBA 5LMNW 2EJFC 2FFKB 2K50A 1I4HA 5GROA 4BXXG 1PFNA 1AZQA 1DOKA 2A69D 4DAPA 4QQBX 3GTLB 2BCOA 3HOZH 4QF4A 4A3JG 4G4KA 2EE1A 1BNZA 1NCVA 2K6AA 1OO9B 1VQJA 2D5DA 3IFDA 1OXSC 3OMCA 4Y7NB 2MPMA 4AQYL 1KC8C 3P7JA 2E2HB 3NSWA 4LFAQ 1HA5A 5D65A 3CKIB 2B2WC 1JC7A 2RA4A 2QDBA 4JI0Q 1R9TH 4DV2L 1QG7A 3S15H 2PYKA 1PFSA 3C46A 5K36H 5IYBH 1MBYA 3L2PA 4UP8A 3NXWA 1FNWA 2YU9H 1M90C 1EUJA 1SFOH 2B2WA 3QWNA 3E9IA 2VY3A 1U4MA 4B3ML 2Z0SA 3L3OC 1YNJD 1HPCA 4FF3A 2A6ED 1WFQA 4X6AH 2YV5A 4DFAA 4FDBA 3KF8A 1KL9A 1PTOB 2UXCL 4KKUA 5JEAG 1SNDA 4NB3A 1XTDA 1Y1WH 2GA4B 2Z8LA 1YBYA 1GHJA 3SK4A 5H1SE 4K0KQ 4C3JG 1E2VA 3TP7A 3J7YW 3A8KE 4LF8Q 5G3LD 1UEBA 4FF4A 2WACA 1X54A 3CU7A 4YHHL 5M3FG 1EEID 3K0XA 4QUFA 3ER0A 4L5SA 2E2IB 3BVGA 1CZWA 1JWUD 2R7ZH 2SEBD 5EQ0A 1PH5A 3UE1A 2N49A 4JV5L 5C44G 3PQIA 1RD9D 2CHBD 3JAME 3M85A 3HOUG 3SDZA 3S24A 1KAAA 1MSGA 3UI2A 4ZQ3A 4LUVA 4A3DG 2E76C 2L9HA 4A4IA 5E4WC 1GUOA 2NVYH 5E3FA 1STBA 5C3EG 4UDUC 5GAHC 1I6HH 1RJTA 3M4YA 4CJ1B 1VF7A 1RCVD 2E8GA 3EN2A 4AYBE 3T51B 5FOBB 4QB4A 4GS3A 4C3IH 4JBMA 3H0GG 3CCLA 4A3MH 4DR4Q 4QY7A 1IXRA 2JA7H 4HJ8A 4C1NK 3N52A 1QZGA 3P75A 2Z6BA 4PMBA 1A0IA 1S3OA 4DV6L 4A3JB 4OEMB 2ZM6Q 2LY7A 4JC0A 1G6PA 2DUDA 5CR3A 3DWAA 4OGQC 3KK7A 2ASBA 3GTJB 1WTXA 1JE5A 4C1NI 1EQQA 1MIUA 1K83B 2G5DA 3JAMc 4A3EH 3QB3A 5FKAC 3HOXH 1DXMA 2UUAQ 2F3VA 3S14H 3KLSA 5IIFA 5JJLA 1RIPA 1ML0D 4XDXA 3TREA 2JJQA 4DR3Q 2VUMH 1O80A 2DN8A 4TKOB 1PTOD 2XWJB 1HR0Q 2NTTA 1NJIC 3HOVH 2F0HA 2RF4A 3V96A 4BY1H 4X66Q 2PQAA 3QO2A 4ZKCB 4WJ3M 4FXKC 3L7ZC 1H95A 1VQDA 3NWTA 4DXGA 2NZHA 5EKIA 1PH4A 1ZKOA 2ICEC 1G6ZA 5NUCA 4GNXB 1B3QA 3MTSA 2LXJA 2WFWA 1B70B 3M4OH 1EZ8A 4WRDA 4RMFA 1LACA 1WTRA 2WP8J 3ITPA 5COYA 1RKNA 2JP1A 1WI5A 2AWNA 3BVMA 5C0XH 2RDHA 4B3TL 5M3FB 1V8QA 1CKOA 1Z7TA 3CRKC 3QG1A 1D1IA 1XNRQ 2NVQH 4AYBG 3MFGA 4UPAA 1NY4A 3GQBA 3KBGA 2FINB 5IWAL 1XMQQ 2CCZA 5J1ZA 1SNOA 3MXNA 5C44B 4LF6Q 3CCQA 2D0OA 4A3FB 1HNWQ 5GADC 3FKIG 2K4KA 4CKBA 1BQQT 1VQIA 2PZWA 3NHHA 3GDEA 4A3DB 1B1ZA 4HIMA 5IT9L 3PGZA 3UDIA 1YJ9A 4JOIC 1WTQA 3G7LA 1PH1A 4PMWA 2RSNA 1MSHA 1XPUA 3GTMH 4HJ9A 2R92B 1U5KA 3H3VC 3NTHA 2BDOA 1WJJA 2N78A 3NE5B 4OONA 5EKKA 5EPKA 2LMCB 1VQBA 1EOTA 3CQZB 4HIOA 3ERSX 1PH8A 4ZUIA 4C3IG 3J80E 1I3QH 1QZHA 1LABA 1SAPA 2MJ8A 4ZAIA 4JI5Q 1DOLA 1MJCA 1XTCD 4G57A 1N34Q 1SYBA 2ALYB 3MVVA 5C4JB 3SHLA 5C5MA 1Y69U 2VL6A 4GLXA 2VZAA 2A69C 1G8ZD 3H3VI 4KY5A 1SE3A 1PMRA 4L63B 1A3UA 1T5EA 1BBXC 4F88A 1EYDA 5KYIA 3KUPA 4A3EG 4DV0Q 1F2YA 1CA6A 4LF5Q 1RDPD 1JR0D 3VR3A 1PRTC 2L12A 2ZT9C 4GKJL 1B2TA 2F3WA 5C3XA 2JSOA 2EDGA 1AH9A 1ENCA 2RBMA 1IBLQ 1N33L 3GTGB 1ET9A 1JORA 2FXQA 4CDFC 3HOVG 1LV9A 4XIGS 1YZ6A 1SYDA 4BY7H 5CMDA 2P5ZX 3W3AA 4DK0A 3J80c 1EYGA 4DUZL 4L8JA 2NVXH 4JCVE 2K04A 4LW1A 3NBHA 4N8X1 3HOYH 2MO0A 2A6EC 3I4MG 1HCZA 3A54A 2J0TD 5T1IA 1HUMA 2RHQB 3I4NB 3L9AX 1PYWD 2EOTA 2JA5B 4GLAC 4DR5Q 1KHIA 1CTMA 2MQHA 4KK7A 4QMGA 3W5OA 4AYBB 1Q90A 4C56C 3HKZE 2B63G 1A3VA 2Z1CA 1VMPA 2HDMA 2XIWA 2K33A 1VQGA 3KYHC 1XMOQ 4HMIA 4JI4Q 1HJPA 3CP0A 2Q8RE 2E2JB 2F03A 3GTLH 4H0LC 1RF2D 3PUXA 4HJ7A 1D5ZC 3Q23A 4MTKA 4H13C 4U68A 5M5YB 1AW7A 1SNMA 3TQYA 1K9MC 5DLQE 3SK5A 4B3SL 4JVZA 5M5XB 5IYCG 1TWAH 4ZKBB 2PQAB 1HFNA 1L0XB 3F2BA 2OTJA 4I65A 2ZTEA 2Z6KC 1YHAA 3OIQA 4OWWB 3MEHA 1PFBA 2KHSA 5KGUA 3TRZA 3I3CA 2CH4W 1GUNA 2YYZA 1HH2P 4EVOA 4J8QA 4KKTA 4WFN3 2LKVA 4A3BB 5G3LF 1ZEQX 4LJZC 1QNKA 1V1OA 4IJLA 2Z6KA 1NUCA 4UHVA 2ZTDA 4FXDA 3VR4A 4MZ9A 3CD6A 3BDCA 1G2TA 2EYJA 2QEJC 4ULLA 5M3MH 3BG3A 4P74A 1JMCA 1H9JA 1EIHA 2KCCA 3HOWB 1S5BD 2I5HA 1JICA 4R1JA 1Q7YC 3F8TA 1BVSA 1W2BA 3K8AA 2Z4IA 3A74A 4X65L 1YJWA 3M3YB 1EYAA 1X3GA 3LWEA 1YITA 3FHWA 2WV6D 1J8IA 5HY6A 4KN4C 3HZXA 3VR2A 4IN3A 4LF9Q 5FJ8H 2EYOA 1PHJA 2QA4A 5EBCA 4PZ8A 4ODGA 2DJFC 1ENFA 4B3RQ 4BBRG 3RNUA 3J81j 4KI0A 3H15A 1LT6D 4JI2L 3F2DA 1XWEA 4EQNA 3RZDH 5C4XB 1UWVA 3ZJYC 1O7ZA 3I4MB 2IX0A 2MHVA 4RG1A 2K5WA 1STEA 4X3TA 3HOYG 1SE8A 2EXDA 5KIXA 1HNZQ 2CKZB 2RCFA 4FF2A 1PVOA 2QGQA 1PYSB 4LFAL 2RVLA 4Q0FA 1SYCA 1WOCA 4JI0L 1MD2D 2B63B 1B4OA 1X55A 3K0YA 5HURA 4DUYL 4IUUA 1GHKA 2PQEA 4K6DA 2JEBI 1JWMD 1FYCA 1VQAA 3M4PA 1PTOF 3TSSA 5HGQA 1IYUA 1TR5A 1PH6A 2Z4HA 4A3IG 5JVG3 1S5ED 3K7UC 2R7FA 2F4VQ 1SXTA 1Y1VG 1CHQD 1FGUA 1ZYRC 1A63A 1OXVA 3DWPA 4ZLTF 1B9NA 5IGFA 1K8MA 1TS2A 1TWGH 1B3AA 4AH6A 3PSIA 2NN6I 2C9OA 2VQEL 3K57A 2QW7A 3AEVA 1O7IA 4HSPA 5A2QE 4R4IA 4C3HG 1YHBA 1CK1A 1PRTB 1DM0B 1WVLA 2JA8G 4IFDG 4HTHA 4K14A 2KEEA 3K5OA 3CC7A 3IRBA 2BH8A 2N88A 3T53B 3TZUA 3NBHB 1TWCB 1TU2B 3QOLA 1NR4A 2YTYA 4TRDA 1FJGL 5IGCA 2I0QA 1QVCA 5FO8B 1UE7A 4IJHA 4NPSA 3SR1A 3SK6A 3J7A5 4X62Q 1O7YA 4JYAL 4K5WA 2LS01 3KLRA 3VR6A 4OO1G 4XTCS 1R4PB 3SE0A 4YY3Q 4WJ4A 4RGOS 4P71A 3J7AV 5AJ3Q 1NTGA 3MAQA 3S1RH 1WTVA 3W1GA 1H9RA 1EY6A 2L4NA 2HCCA 5F2DA 4KD3A 2Z9HA 4DU9A 1U9RA 3PV0A 3TP5A 1GUSA 2KECA 2M9VA 4IUTA 3S1MH 2YTVA 5ELCA 3H6MA 1KLUD 1VQFA 2X6GA 1MKHA 4JI7L 2B29A 3PUVA 2ZXRA 1J5EQ 4F87A 3RMHA 2K52A 4X3UA 5FLMH 2L5TA 5D3IB 5EBDA 2SDFA 2PNHA 4HEDA 3V2TA 2HDLA 4RFBA 1STNA 1BOSA 1PH2A 4GKKQ 1NMFA 4R8IA 3D0FA 3OSOA 2ZXPA 2C35B 4BS9A 4A3FH 2VS1A 4CDCC 2B3GA 5A35A 2HT1A 2HCIA 4JI3Q 4XYOA 5JVH3 1GKHA 2HHHL 2VXWA 3OHXC 1TVXA 4F7XA 2OF1A 1E0BA 1E2ZA 4LMQD 5KNCA 2E5LL 1LT4D 2V1CC 2XWBB 2F0IA 2RKSA 1WTPA 4TQUS 2UUAL 2OT2A 3RZOH 2R92H 4O2DA 5LMNQ 2AKWB 3KOJA 1NSNS 3J81i 3RR5A 1KIXA 4DR3L 3AFPA 3TBIB 3T1YL 2IL8A 2K5HA 1IBML 3TP8A 1WTWA 1CT1D 3HKSA 2FJ2A 1IW7C 3FDTA 3C1FA 1LTGD 1K3BC 2H4OA 1PRTD 1RTOA 1CQVA 3RLOA 2KA7A 4OWXB 2F0FA 5CGKA 1D5MC 4ID6A 3DEPA 1EL0A 2PI2A 4N9PA 4JBJA 1C4QA 1SE2A 4DR6L 3RN5A 2DY8A 2F0MA 4BA2I 2KENA 3TS2A 1BBUA 1FD7D 1CM9A 4A3GG 4RHRA 4KN7C 1VQOA 1C48A 1JOKA 1F9RA 4IPHA 4M1UB 1K0RA 2UUBQ 3WOEA 1U4RA 2FHTA 5ELDA 1G291 1SRUA 2BA1A 3UE0A 2XVSA 4GN5A 3OWFA 3MXGA 3G6EA 4BBSG 4UP9A 2UUCL 4K8JA 1HTLD 3GTGH 3OTOL 1HNXL 1UE6A 4UY8C 4QJFA 3BS1A 2E75C 3S16B 2VB3X 1JT8A 2R93B 5I9PA 1HNWL 5M5WB 3PO3B 1WCMG 1QOHA 3W2DA 1EZ6A 2RQXA 3VA7A 3FEWX 4H7BA 1N36Q 3K7AB 4G7ZC 5L37A 3I4NH 2JA5H 2EJMA 5LMUL 4XQQA 2VW9A 1KTKA 2VQFL 2O5IC 1P8LA 4FNFA 1UAPA 3G48A 1VQEA 2R6GA 1UEAB 5EKLA 4A93H 2PW5A 2F0QA 1TWHH 4C2MB 4QGUA 2F0KA 1TY0A 3AYHB 3I73A 2GVAA 2E2JH 3M7GA 2KHIA 4X3KA 2RCNA 1MJEA 5KEEA 3U50C 1S72A 2ZTCA 4L5QA 1I4QA 5FLXE 1PXUA 1TS4A 1KNEA 1I94Q 4YCUA 2Q2HA 1Q82C 4FO2A 5M5XH 1XNQQ 1YJNA 2JE6I 3Q0AA 4JPBW 5CV6A 2J7ZA 2EYLA 4RGTA 3BYTB 1EU4A 4NXML 1IYJB 2B39A 4DR7Q 5JAVA 5ELFA 3HOZG 4A3BH 2CW0C 3CW2C 4NXNQ 4A75A 4NW2A 1LTLA 2UXDL 2XTIA 1I4GA 5CV8A 4DV1L 1LT5D 3TDQA 5BN4A 1C8CA 1JJCB 4A3KH 1Q3LA 3TMEA 1R4QB 3CCRA 2F0UA 3HOWH 3A5UA 1VQ7A 4A3GB 3GP7A 4J1MA 4DR2L 5K36G 4Q5VA 1STHA 5IYBG 3URYA 2Q8TA 4L6TB 5FLXc 3JAMi 1WTHA 3M3YH 4A3LH 1HR0W 3E6ZX 3GTPH 1IL2A 3C3LA 4DK3C 4R4TA 1HA6A 1EIYB 1PH3A 4TSSA 3DHQA 3STBC 4BBSB 4J6HA 3ONAB 2R7DA 2A19A 4AQYQ 4ZUJA 3IAYA 2KHJA 1EIGA 3AU7A 4B9XA 4C3JB 3LNNA 4DV2Q 5I9OA 3J81L 3E3XA 1Y1WG 3C2PA 1EU3A 4JW0A 1STAA 2HD3A 2I46A 3HFZB 1WCMB 1I4XA 3S1NH 1YNXA 3NTIA 4A3CH 1UE1A 3DUZA 2PO4A 2WAQG 1A3TA 2Y0SG 1QB5D 1TS3A 3I90A 3R2TA 1LT3D 3H3VH 1ZYRD 2PNRC 3C1EA 3HOUB 5JPMC 2ATWA 2WB1G 1JE4A 2R7ZG 1E7ZA 2B2UC 3FMCA 1PZKD 1YEZA 2UXCQ 2O4XA 3R3OA 3K59A 2F0SA 5JOBA 3KLSX 1B53A 2JK8A 5C4ZA 2H5XA 2GN5A 3AB9A 5C5LA 1KDCA 4JI8L 5C3EB 1B8AA 5T1GA 4DK6C 4S3SA 3MEFA 4JBWA 4H44C 3FRPB 1Y8PB 2B2UA 5DNFA 4CGYB 1JJ2A 4QIWE 4G7HC 4YWKA 1JCKB 3K5NA 1NR2A 4YHHQ 1JQYD 3H0GB 1N9WA 1IKLA 4FXGC 2JA6H 1S4ZA 4XQNA 1EWHA 4DNTB 3KF8B 1GJXA 1I50H 4BA1I 4MTNA 4LK1C 1AN8A 1EY8A 3GO5A 3S2HB 1X56A 2I5LX 2IY5B 2JQOA 4JV5Q 4A3MG 5E7NA 2IX1A 2JA7G 4IPDA 1SMYC 3E0JA 4HCEA 2VB2X 4IZ8A 1DCZA 1M8AA 2AMCB 1TWCH 1VQPA 4JI1Q 1GM5A 3A7AB 3NPPA 1M1KC 2K14A 2SNMA 3KF6A 2EY6A 3KJOA 1V1PA 3HOXG 3LX0A 1C9OA 1B50A 2JXMB 1L1OC 1R9TB 1EIFA 1NE3A 1GVPA 2DNEA 3ULPA 2D9UA 2VUMG 2A73B 3OPOA 2IT1A 3Q6SA 5C4HA 2CQOA 4DV6Q 1VQNA 3CCJA 3EROA 4APVA 1DOMA 1L1OA 2KBNA 4BY1G 1ET6A 1CKMA 3CHBD 3K5LA 3BZDB 2MO1A 3A5ZB 3PO2H 1Y1WB 2NYZD 2XN9C 2K01A 2PMZE 4XYQA 1IW7D 4RKBA 2L15A 2YTXA 1PRTF 4XT3B 3J80i 3Q22A 1IYVA 2F0WA 5C0XG 2K75A 2BDNA 1WD0A 4E6IA 4A3CG 3J7ZC 4OWTB 2A6HC 3FKIB 4JI6L 2R7ZB 3L0OA 1JOQA 5JPNC 5IP9H 1N32L 1Z9FA 3E5SA 4TVAB 4O42A 2ZJPA 1IHZA 1GUGA 4DV4L 4OIJA 3VYRA 1DZ1A 4Y7NH 3OW2A 3ND8A 5JEAJ 3JAML 4OX9L 2E2HH 2A74C 3K5MA 1QCBD 3CPFA 2NVYB 4B3TQ 3PIOA 2RHSB 3I56A 4PMCA 3KJPA 4PG3A 2EJGC 1I6HB 5IGBA 5EGTA 1UNSA 2CWPA 4C3IB 5IWAQ 3I70A 4A3MB 3U58A 4P2CB 4NDXA 1L0WA 5LL6X 4KHPL 2JA7B 4DV5L 1LO5D 1KDBA 3HEJA 4CBVA 4R4OA 4LFCL 2EQSA 3BVZA 3MA2B 2B8FA 1SLJA 3CXCA 2QDLA 4X64L 2IPKD 3FPUB 1PTOH 3OW7A 1LTBD 3O13A 3EFXD 5TSSA 4KV6A 4LF4L 3T1HL 2NUCA 5IOCA 2JN4A 1KNAA 2KJXA 3S1QB 1LTID 1RL2A 3MXNB 5IP7H 1EOVA 4A3EB 2D2CC 4YWLA 1FNVA 4RCNA 1QJOA 2AQ1B 2SNSA 2R93H 3A56A 2UXBQ 5M5WH 3CCUA 2E74C 4OXPA 1QVFA 3PO3H 5IGDA 2VUMB 1I6VC 3GTKB 2E2IH 1PFMA 1WD1A 4FP5D 3E9HA 2QKIC 3K58A 3DEOA 4DV3L 1K8AC 3HOVB 1TT2A 2LFNA 2NN6H 3LWUA 3T16A 4I7AA 1CHPD 4GOPC 4BY1B 5KYLA 3A0JA 2EYHA 5HGTA 5EJWA 3T13A 3A8IE 1CFMA 3I7FA 2RDFA 2Q2IA 4JK1C 4IFDI 4BY7G 4K2KA 1TWFB 2F0VA 1WYDA 4C2MH 4P73A 2BE5C 4GOPA 1PA6A 1E22A 4GKJQ 1HQMC 1EY0A 3GD7A 3PO2G 4OO1I 5IGGA 4PZ7A 4QIWB 2CW0D 3RD4A 5I6YA 1Y14B 4DR1Q 3IKJA 4IALA 3NTKA 3I72A 1GUWA 1EY9A 1SSOA 2O2LD 3KF6B 4BXXH 3N6RA 2NVQB 4HIDA 4RCOA 1V1PB 3RLNA 4A3JH 1I4RA 1D2BA 4KMUC 1BCPC 1CZGA 4DUZQ 3GTJH 4JG2A 4NP5A 1KQSA 3G71A 3UDFA 1SYEA 1G91A 3D4DA 1F2ZA 1K83H 3QR8A 4QUCA 3ICEA 2OQKA 1JOOA 1SNCA 4EQPA 5ISRA 5IY0A 3D31A 5FO7B 4IOAA 1EQTA 2LXKA 2F0NA 3STBD 3CCSA 4R4QA 1L1OB 3OOCA
chains in the Genus database with same CATH topology
3G6EA 4BBSG 3PCOB 4UP9A 1WI5A 4H02A 2UUCL 3GTGH 2AWNA 1X3FA 3M4QA 3OTOL 1HNXL 1UE6A 4B3TL 4K0KL 1X3EA 1CKOA 4A3IH 4UY8C 4J15A 4QJFA 1KD1C 1Y1VH 4LF8L 4X62L 5GQOA 1CKNB 1XNRQ 1VQ9A 2NVQH 4AYBG 4UPAA 1NY4A 1Q1EA 4YY3L 5IWAL 4A76A 1XMQQ 2CCZA 1VQ4A 1JT8A 4YCWA 5AJ3L 1HNWL 4LF6Q 3CCQA 2D0OA 1WCMG 3LGJA 1HNWQ 3ULJA 2JA6G 5GADC 3FKIG 3CC4A 2K4KA 2NZOA 4C3HH 1VQIA 1YI2A 1N36Q 3GDEA 2JA8H 4O0AA 2K5VA 3CCEA 4B3SQ 3I4NH 4HIMA 2JA5H 3PGZA 5LMUL 3UDIA 4GN4B 2VW9A 1YJ9A 1J5EL 4GN3B 2A8VA 5M3MG 2VQFL 4JOIC 4C3JH 4EQ5A 3CF5A 1P8LA 2BH2A 4JI8Q 1PH1A 4PMWA 3S17H 3G48A 1VQEA 2R6GA 4A93H 1OXTA 1TWHH 5M3FH 1XPUA 4QGUA 3GTMH 4HJ9A 1U5KA 2ES2A 1WJJA 2N78A 3AYHB 4OONA 2GVAA 4HJAA 1PH7A 3W1BA 1VQBA 2E2JH 3S16H 2KHIA 4HIOA 5JJIA 4GKKL 2RCNA 4YWMA 1MJEA 3ERSX 1PH8A 3U50C 1VQ5A 1K3RA 2XGTA 1S72A 2ZTCA 4MNOA 4DR4L 5C44H 1V43A 1I3QH 3OYYA 3I55A 1QZHA 4L5QA 3I4OA 4JI3L 1GO3E 3HOUH 2F3IA 5FJ8G 4JI5Q 1MJCA 1I94Q 4YCUA 2Q2HA 3K7AH 4P75A 1Q82C 1NMGA 2ALYB 1N34Q 5M5XH 4A3DH 3RLFA 1XNQQ 1YJNA 2VL6A 2UU9L 2ZM6L 2JE6I 3FP9A 1I5FA 4GLXA 4DKAC 3PUWA 2JEAI 2VZAA 4LUZA 3H3VI 1X65A 2UU9Q 3ULLA 5C3EH 4NXML 1IYJB 4X65Q 3CCMA 2MNAA 4LUOA 3WWVA 4DR7Q 1XJVA 1C7YA 5LMNL 4GNXC 3HOZG 2PI2E 4A3EG 3Q8DA 4DV0Q 2CFMA 3PO3H 3H0GH 4JBKA 1L2FA 4LF5Q 1X6OA 4A3BH 3G4SA 4NXNQ 3CW2C 4A75A 1LTLA 2UXDL 1HZCA 2XTIA 4GKJL 3CQZH 3HKZG 4DV1L 1IBKL 1Q8KA 3GTQH 3S2HH 1XPRA 3DLLA 1AH9A 1IBKQ 1HR0L 4GNXA 1IBLQ 1JJCB 1N33L 4A3KH 1VQ6A 3KFUA 3E0EA 3CCRA 2OCEA 3HOWH 1HZAA 2FXQA 3K80C 4JI2Q 3A5UA 1VQ7A 3AFQA 1N33Q 3HOVG 5C4JH 2DGYA 4DAMA 4XIGS 1YZ6A 4DR2L 4BY7H 4X66L 1V9PA 5K36G 3J80c 1EYGA 2D0PA 1JB7A 1LUZA 5IYBG 4DUZL 1E24A 4JCVE 2NVXH 5FLXc 2BA0A 3JAMi 4LW1A 3HOYH 3M3YH 4A3LH 2MO0A 1HR0W 5IT9c 2I5MX 3F2CA 1IL2A 3GTPH 3NELA 1VQKA 4DK3C 4R4TA 2NVTH 4LFBL 1JJGA 3VDYA 3I4MG 1EIYB 1PH3A 2ID0A 3STBC 4LFBQ 2HQLA 2UUBL 4GLVB 3BZKA 5IP9G 2R7DA 5IYDH 2A19A 5JJKA 4AQYQ 2RHQB 1QUQA 4L5TA 1PV4A 2KHJA 1DGSA 4GLAC 1PH9A 5GAEC 4DR5Q 1KHIA 2MQHA 3W5OA 4DUYQ 1UE5A 3HKZE 4DV2Q 4L5RC 2B63G 1Y1WG 3PUYA 4GOPB 5C0XJ 1VQGA 2A1AA 3HFZB 3KYHC 1XMOQ 1XNRL 5GAGC 3S1NH 1YNXA 4JI4Q 1HJPA 3CP0A 4A3CH 1UE1A 3AQQA 1KAWA 1E1TA 2WAQG 1X9NA 2ZJRA 1XMQL 4A3GH 3GTLH 2Y0SG 3PUXA 4HJ7A 4JI6Q 4LF6L 3TS0A 4DV7L 4HIKA 1CSPA 3CPWA 3H3VH 1N32Q 2OTLA 2VQEQ 1N36L 1KRTA 1EQRA 4KHZA 4DV7Q 3PF4A 4EX5A 3TQYA 1Z47A 2WB1G 1K9MC 2ATWA 2R7ZG 5DLQE 1KXLA 4DV4Q 1E7ZA 3GTOH 1YEZA 4DPGA 4B3SL 2UXCQ 1A8VA 4BBSH 5IYCG 1TWAH 1N8RC 2PQAB 2OQ0A 2JK8A 3F2BA 1D8LA 4IOCA 4OX9Q 2OTJA 2ZTEA 4HJ5A 2H5XA 3B6YA 2CWAA 2GN5A 2Z6KC 3NEMA 4JI8L 1YHAA 3PIPA 1YHQA 1B8AA 1Q46A 4DK6C 4OWWB 4LNQA 2EIFA 1FJGQ 4POFA 3MEFA 3DM3A 3TRZA 4JBWA 5FLMG 4JYAQ 5ELOA 5IP7G 1CUKA 2D62A 4QIWE 1JJ2A 4YWKA 5BR8L 2YYZA 4YHHQ 1WCMH 1HH2P 1N9WA 4QL5A 2JA6H 3FKIH 3KF8B 5BR8Q 1VS0A 4IJLA 1I50H 4BA1I 2Z6KA 4MTNA 2R93G 1TXYA 2ZTDA 4KHPQ 3M7NA 4DV5Q 2WAQE 2HIVA 3GO5A 4MZ9A 2Y0SE 4KLKA 1X56A 3CD6A 2I5LX 1VQ8A 4LFCQ 1P16A 2IY5B 2JQOA 4JI5L 4A3FG 4JV5Q 4A3MG 3SGIA 1I94L 5M5YH 4LF7L 5E7NA 5M3MH 1N34L 4P74A 1JMCA 3EBEA 2IX1A 2JA7G 3RN2A 4IPDA 4JI7Q 4X64Q 1XNQL 3K81C 4POGA 4LF7Q 2I5HA 2WB1E 4R1JA 4JI1L 2NN6G 1BKBA 4P72A 1Q1BA 4LF4Q 1Q7YC 3F8TA 2AMCB 3T1HQ 1TWCH 1VQPA 3PUZA 1B7YB 1BVSA 1V1QA 4JI1Q 3K8AA 1W2BA 1GM5A 2KCMA 3A74A 4ME3A 4X65L 1YJWA 4DR7L 1X3GA 1YITA 1HZBA 3FHWA 1VQMA 2K14A 5HY6A 4DV0L 3KF6A 1KRSA 4LF5L 1K73C 2R92G 1CSQA 4NXNL 3KJOA 1U0LA 3J81c 1K8GA 3HOXG 1VQCA 5FJ8H 4LF9Q 1C9OA 1PHJA 2QA4A 4PZ8A 3CAMA 4AIMA 1ASZA 1L1OC 3CMEA 1EIFA 1NE3A 3KDFA 1GVPA 1AE2A 3ULPA 1Q12A 2HHHQ 1G51A 1IBLL 4B3RQ 2VUMG 4BBRG 3RNUA 3J81j 4KI0A 3H15A 4DV3Q 2IT1A 5LMNW 1C0AA 2CQOA 4DV6Q 2K50A 3F2DA 4ALPA 3RZDH 4JI2L 1VQNA 2UXBQ 2AWOA 2E5LQ 1UWVA 1OXXK 3ZJYC 5GROA 3CCJA 1YIJA 1QVGA 1ASYA 3S1QH 4BXXG 4APVA 1D7QA 2IX0A 4RG1A 4QQBX 1L1OA 3HOZH 2KBNA 4A3JG 4BY1G 3HOYG 1SE8A 2EXDA 1HNZQ 1CKMA 2CKZB 1PVOA 1PYBA 2QGQA 1GD7A 1PYSB 1VQJA 3NENA 2K5NA 4DNIA 3PF5A 1EFWA 1CKNA 1OXSC 3T1YQ 2Q2TA 4LFAL 2GVBA 1IBMQ 4AQYL 1KC8C 5IYDG 1WOCA 2MO1A 4JI0L 3GTKH 3A5ZB 4LFAQ 3PO2H 3KLWA 2VNUD 1EWIA 4DR5L 1VQLA 4JI0Q 1X55A 4DUYL 1R9TH 3CC2A 2PMZE 4DV2L 3S15H 2JEBI 3JC66 2L15A 1VQAA 2YTXA 4PZ6A 1PFSA 3M4PA 5IYBH 5HGQA 3J80i 3L2PA 5C0XG 4UP8A 2K75A 3EIVA 1XMOL 3BU2A 1PH6A 4JI4L 4A3IG 2YU9H 5C4XH 3K7UC 2R7FA 1M90C 1EUJA 3J7ZC 1SFOH 1Y1VG 2F4VQ 1FGUA 4DR6Q 4A3CG 1A63A 4OWTB 1OXVA 4JI6L 3E9IA 1YVCA 3I4MH 3L0OA 2VY3A 1TWGH 4AH6A 1TWFH 1A62A 3PSIA 2NN6I 4B3ML 2Z0SA 5IP9H 1N32L 1Z9FA 2VQEL 1FVIA 4TVAB 1E1OA 3UDXA 1WFQA 2ZJPA 1O7IA 4B3MQ 3AEVA 4X6AH 2LSSA 2YV5A 3TEHB 4DV4L 4FDBA 4R4IA 1YHBA 1KL9A 2UXCL 5JEAG 2Q2UA 4Y7NH 2JA8G 4IFDG 3OW2A 4NB3A 5JEAJ 4OX9L 3CC7A 2E2HH 2ZJQA 3IRBA 2BH8A 2B63H 4IFDJ 1XTDA 3CPFA 1Y1WH 3I4NG 3NBHB 2JA5G 1YBYA 2UUCQ 3OTOQ 1HNXQ 2YTYA 1Q81C 4B3TQ 3PIOA 2RHSB 3I56A 5H1SE 3KJPA 1IZ6A 1AE3A 4PG3A 2I0QA 4K0KQ 1QVCA 2F52A 1UE7A 4IJHA 4NPSA 3J7A5 4JYAL 4LF8Q 4X62Q 1UEBA 5ELNA 4A93G 2N8NA 1X54A 4YHHL 2CWPA 4OO1G 4XTCS 5M3FG 4YY3Q 4WJ4A 3K0XA 1QUQB 5IWAQ 4P71A 2OWOA 1FJGL 4Y52H 3ER0A 1NTGA 5AJ3Q 3U58A 3S1RH 4L5SA 1L0WA 3W1GA 4KHPL 4DV5L 2R7ZH 4DAYB 1PH5A 3PO3G 1XPOA 3UE1A 4R4OA 4LFCL 2EQSA 3PV0A 2N49A 5EAYA 4JV5L 5IYCH 5C44G 3S1MH 2YTVA 3CCVA 1SLJA 3CXCA 3M85A 1VQFA 3HOUG 1MKHA 3S24A 4X64L 4JI7L 2B29A 1OXUA 3PUVA 5LMUQ 1J5EQ 2K52A 2N3SA 4LUVA 2VQFQ 4LF4L 4A3DG 3T1HL 4A4IA 5FLMH 1RL2A 3MXNB 5IP7H 2NVYH 4YCVA 1EOVA 2JA9A 3I2ZA 3S2DH 4YWLA 5C3EG 1VCIA 1W3SA 5GAHC 2PNHA 1I6HH 1SN8A 2UXBL 2E8GA 4JOIA 2R93H 3EN2A 2KCTA 5M5WH 3U4ZA 4AYBE 3CCUA 1PH2A 1OTCA 4GKKQ 4OXPA 1NMFA 4GS3A 2QEXA 1E3PA 3D0FA 4C3IH 5C0XI 4JBMA 4LF9L 1QVFA 2C35B 3H0GG 3M9BA 3UDGA 2VS1A 4A3FH 4A3MH 3CCLA 1BBWA 4A3BG 4QY7A 2E2IH 2B3GA 2HT1A 4DR4Q 1IXRA 4JI3Q 2JA7H 4IPCA 4HJ8A 1GKHA 2HHHL 3E9HA 4B3RL 4DV3L 1K8AC 1QZGA 1A0IA 1S3OA 4DV6L 4GOPC 3F1ZA 2ZM6Q 4A3KG 2E5LL 3A0JA 4JC0A 2HIXA 1LYLA 2DUDA 1G6PA 1LM0A 3CMAA 4IO9A 3I7FA 4UP7A 1J6QA 2ASBA 3HOWG 1JE5A 2V1CC 2Q2IA 4NXMQ 4IFDI 1EQQA 4TQUS 4BY7G 2UUAL 1MIUA 3RZOH 4C2MH 1WYDA 2R92H 4O2DA 3JAMc 5LMNQ 4P73A 4A3EH 1HNZL 2AKWB 3KOJA 3HOXH 3J81i 2UUAQ 4A3LG 3RR5A 4GOPA 3S14H 1KIXA 4DR3L 3AFPA 3T1YL 5JJLA 1PA6A 2K5HA 1E22A 1IBML 1RIPA 2UXDQ 3TREA 4LWCA 4GKJQ 2JJQA 3HKSA 3GD7A 4DR1L 4DV1Q 4DR3Q 2VUMH 4BBRH 1Q86C 1SMXA 3PO2G 1NBWA 4PZ7A 4OO1I 1Y14B 3RLOA 4DR1Q 2IHFA 1HR0Q 4OWXB 3BZCA 4BXXH 1NJIC 3KF6B 1VQHA 3HOVH 2AHOB 4HIDA 2PI2A 2RF4A 4JBJA 1S40A 3RLNA 4A3JH 4BY1H 4DR2Q 4X66Q 2F4VL 2PQAA 5IE8A 4DR6L 1SROA 4DUZQ 3RN5A 4BA2I 1FL0A 2KENA 5C4XG 4IPGA 3TS2A 3L7ZC 4WJ3M 1BBUA 3GTJH 1H95A 1VQDA 3KDFB 4A3GG 4JG2A 1VQOA 2NZHA 1KQSA 2MFIA 5J3BA 3G71A 3UDFA 1PH4A 2IHEA 1K83H 4IPHA 3BJUA 4GNXB 1K0RA 3ICEA 2LXJA 2UUBQ 2OQKA 2WFWA 1B70B 3U4VA 1G291 1HZ9A 1SRUA 2BA1A 3UE0A 3D31A 5IY0A 3M4OH 4IOAA 1T9HA 2LXKA 3STBD 3CCSA 4GN5A 4R4QA 4RMFA 1L1OB 1SR3A 2WP8J 4R4CA 1M1KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E A;  4BBS G;  3PCO B;  4UP9 A;  1WI5 A;  4H02 A;  2UUC L;  3GTG H;  2AWN A;  1X3F A;  3M4Q A;  3OTO L;  1HNX L;  1UE6 A;  4B3T L;  4K0K L;  1X3E A;  1CKO A;  4A3I H;  4UY8 C;  4J15 A;  4QJF A;  1KD1 C;  1Y1V H;  4LF8 L;  4X62 L;  5GQO A;  1CKN B;  1XNR Q;  1VQ9 A;  2NVQ H;  4AYB G;  4UPA A;  1NY4 A;  1Q1E A;  4YY3 L;  5IWA L;  4A76 A;  1XMQ Q;  2CCZ A;  1VQ4 A;  1JT8 A;  4YCW A;  5AJ3 L;  1HNW L;  4LF6 Q;  3CCQ A;  2D0O A;  1WCM G;  3LGJ A;  1HNW Q;  3ULJ A;  2JA6 G;  5GAD C;  3FKI G;  3CC4 A;  2K4K A;  2NZO A;  4C3H H;  1VQI A;  1YI2 A;  1N36 Q;  3GDE A;  2JA8 H;  4O0A A;  2K5V A;  3CCE A;  4B3S Q;  3I4N H;  4HIM A;  2JA5 H;  3PGZ A;  5LMU L;  3UDI A;  4GN4 B;  2VW9 A;  1YJ9 A;  1J5E L;  4GN3 B;  2A8V A;  5M3M G;  2VQF L;  4JOI C;  4C3J H;  4EQ5 A;  3CF5 A;  1P8L A;  2BH2 A;  4JI8 Q;  1PH1 A;  4PMW A;  3S17 H;  3G48 A;  1VQE A;  2R6G A;  4A93 H;  1OXT A;  1TWH H;  5M3F H;  1XPU A;  4QGU A;  3GTM H;  4HJ9 A;  1U5K A;  2ES2 A;  1WJJ A;  2N78 A;  3AYH B;  4OON A;  2GVA A;  4HJA A;  1PH7 A;  3W1B A;  1VQB A;  2E2J H;  3S16 H;  2KHI A;  4HIO A;  5JJI A;  4GKK L;  2RCN A;  4YWM A;  1MJE A;  3ERS X;  1PH8 A;  3U50 C;  1VQ5 A;  1K3R A;  2XGT A;  1S72 A;  2ZTC A;  4MNO A;  4DR4 L;  5C44 H;  1V43 A;  1I3Q H;  3OYY A;  3I55 A;  1QZH A;  4L5Q A;  3I4O A;  4JI3 L;  1GO3 E;  3HOU H;  2F3I A;  5FJ8 G;  4JI5 Q;  1MJC A;  1I94 Q;  4YCU A;  2Q2H A;  3K7A H;  4P75 A;  1Q82 C;  1NMG A;  2ALY B;  1N34 Q;  5M5X H;  4A3D H;  3RLF A;  1XNQ Q;  1YJN A;  2VL6 A;  2UU9 L;  2ZM6 L;  2JE6 I;  3FP9 A;  1I5F A;  4GLX A;  4DKA C;  3PUW A;  2JEA I;  2VZA A;  4LUZ A;  3H3V I;  1X65 A;  2UU9 Q;  3ULL A;  5C3E H;  4NXM L;  1IYJ B;  4X65 Q;  3CCM A;  2MNA A;  4LUO A;  3WWV A;  4DR7 Q;  1XJV A;  1C7Y A;  5LMN L;  4GNX C;  3HOZ G;  2PI2 E;  4A3E G;  3Q8D A;  4DV0 Q;  2CFM A;  3PO3 H;  3H0G H;  4JBK A;  1L2F A;  4LF5 Q;  1X6O A;  4A3B H;  3G4S A;  4NXN Q;  3CW2 C;  4A75 A;  1LTL A;  2UXD L;  1HZC A;  2XTI A;  4GKJ L;  3CQZ H;  3HKZ G;  4DV1 L;  1IBK L;  1Q8K A;  3GTQ H;  3S2H H;  1XPR A;  3DLL A;  1AH9 A;  1IBK Q;  1HR0 L;  4GNX A;  1IBL Q;  1JJC B;  1N33 L;  4A3K H;  1VQ6 A;  3KFU A;  3E0E A;  3CCR A;  2OCE A;  3HOW H;  1HZA A;  2FXQ A;  3K80 C;  4JI2 Q;  3A5U A;  1VQ7 A;  3AFQ A;  1N33 Q;  3HOV G;  5C4J H;  2DGY A;  4DAM A;  4XIG S;  1YZ6 A;  4DR2 L;  4BY7 H;  4X66 L;  1V9P A;  5K36 G;  3J80 c;  1EYG A;  2D0P A;  1JB7 A;  1LUZ A;  5IYB G;  4DUZ L;  1E24 A;  4JCV E;  2NVX H;  5FLX c;  2BA0 A;  3JAM i;  4LW1 A;  3HOY H;  3M3Y H;  4A3L H;  2MO0 A;  1HR0 W;  5IT9 c;  2I5M X;  3F2C A;  1IL2 A;  3GTP H;  3NEL A;  1VQK A;  4DK3 C;  4R4T A;  2NVT H;  4LFB L;  1JJG A;  3VDY A;  3I4M G;  1EIY B;  1PH3 A;  2ID0 A;  3STB C;  4LFB Q;  2HQL A;  2UUB L;  4GLV B;  3BZK A;  5IP9 G;  2R7D A;  5IYD H;  2A19 A;  5JJK A;  4AQY Q;  2RHQ B;  1QUQ A;  4L5T A;  1PV4 A;  2KHJ A;  1DGS A;  4GLA C;  1PH9 A;  5GAE C;  4DR5 Q;  1KHI A;  2MQH A;  3W5O A;  4DUY Q;  1UE5 A;  3HKZ E;  4DV2 Q;  4L5R C;  2B63 G;  1Y1W G;  3PUY A;  4GOP B;  5C0X J;  1VQG A;  2A1A A;  3HFZ B;  3KYH C;  1XMO Q;  1XNR L;  5GAG C;  3S1N H;  1YNX A;  4JI4 Q;  1HJP A;  3CP0 A;  4A3C H;  1UE1 A;  3AQQ A;  1KAW A;  1E1T A;  2WAQ G;  1X9N A;  2ZJR A;  1XMQ L;  4A3G H;  3GTL H;  2Y0S G;  3PUX A;  4HJ7 A;  4JI6 Q;  4LF6 L;  3TS0 A;  4DV7 L;  4HIK A;  1CSP A;  3CPW A;  3H3V H;  1N32 Q;  2OTL A;  2VQE Q;  1N36 L;  1KRT A;  1EQR A;  4KHZ A;  4DV7 Q;  3PF4 A;  4EX5 A;  3TQY A;  1Z47 A;  2WB1 G;  1K9M C;  2ATW A;  2R7Z G;  5DLQ E;  1KXL A;  4DV4 Q;  1E7Z A;  3GTO H;  1YEZ A;  4DPG A;  4B3S L;  2UXC Q;  1A8V A;  4BBS H;  5IYC G;  1TWA H;  1N8R C;  2PQA B;  2OQ0 A;  2JK8 A;  3F2B A;  1D8L A;  4IOC A;  4OX9 Q;  2OTJ A;  2ZTE A;  4HJ5 A;  2H5X A;  3B6Y A;  2CWA A;  2GN5 A;  2Z6K C;  3NEM A;  4JI8 L;  1YHA A;  3PIP A;  1YHQ A;  1B8A A;  1Q46 A;  4DK6 C;  4OWW B;  4LNQ A;  2EIF A;  1FJG Q;  4POF A;  3MEF A;  3DM3 A;  3TRZ A;  4JBW A;  5FLM G;  4JYA Q;  5ELO A;  5IP7 G;  1CUK A;  2D62 A;  4QIW E;  1JJ2 A;  4YWK A;  5BR8 L;  2YYZ A;  4YHH Q;  1WCM H;  1HH2 P;  1N9W A;  4QL5 A;  2JA6 H;  3FKI H;  3KF8 B;  5BR8 Q;  1VS0 A;  4IJL A;  1I50 H;  4BA1 I;  2Z6K A;  4MTN A;  2R93 G;  1TXY A;  2ZTD A;  4KHP Q;  3M7N A;  4DV5 Q;  2WAQ E;  2HIV A;  3GO5 A;  4MZ9 A;  2Y0S E;  4KLK A;  1X56 A;  3CD6 A;  2I5L X;  1VQ8 A;  4LFC Q;  1P16 A;  2IY5 B;  2JQO A;  4JI5 L;  4A3F G;  4JV5 Q;  4A3M G;  3SGI A;  1I94 L;  5M5Y H;  4LF7 L;  5E7N A;  5M3M H;  1N34 L;  4P74 A;  1JMC A;  3EBE A;  2IX1 A;  2JA7 G;  3RN2 A;  4IPD A;  4JI7 Q;  4X64 Q;  1XNQ L;  3K81 C;  4POG A;  4LF7 Q;  2I5H A;  2WB1 E;  4R1J A;  4JI1 L;  2NN6 G;  1BKB A;  4P72 A;  1Q1B A;  4LF4 Q;  1Q7Y C;  3F8T A;  2AMC B;  3T1H Q;  1TWC H;  1VQP A;  3PUZ A;  1B7Y B;  1BVS A;  1V1Q A;  4JI1 Q;  3K8A A;  1W2B A;  1GM5 A;  2KCM A;  3A74 A;  4ME3 A;  4X65 L;  1YJW A;  4DR7 L;  1X3G A;  1YIT A;  1HZB A;  3FHW A;  1VQM A;  2K14 A;  5HY6 A;  4DV0 L;  3KF6 A;  1KRS A;  4LF5 L;  1K73 C;  2R92 G;  1CSQ A;  4NXN L;  3KJO A;  1U0L A;  3J81 c;  1K8G A;  3HOX G;  1VQC A;  5FJ8 H;  4LF9 Q;  1C9O A;  1PHJ A;  2QA4 A;  4PZ8 A;  3CAM A;  4AIM A;  1ASZ A;  1L1O C;  3CME A;  1EIF A;  1NE3 A;  3KDF A;  1GVP A;  1AE2 A;  3ULP A;  1Q12 A;  2HHH Q;  1G51 A;  1IBL L;  4B3R Q;  2VUM G;  4BBR G;  3RNU A;  3J81 j;  4KI0 A;  3H15 A;  4DV3 Q;  2IT1 A;  5LMN W;  1C0A A;  2CQO A;  4DV6 Q;  2K50 A;  3F2D A;  4ALP A;  3RZD H;  4JI2 L;  1VQN A;  2UXB Q;  2AWO A;  2E5L Q;  1UWV A;  1OXX K;  3ZJY C;  5GRO A;  3CCJ A;  1YIJ A;  1QVG A;  1ASY A;  3S1Q H;  4BXX G;  4APV A;  1D7Q A;  2IX0 A;  4RG1 A;  4QQB X;  1L1O A;  3HOZ H;  2KBN A;  4A3J G;  4BY1 G;  3HOY G;  1SE8 A;  2EXD A;  1HNZ Q;  1CKM A;  2CKZ B;  1PVO A;  1PYB A;  2QGQ A;  1GD7 A;  1PYS B;  1VQJ A;  3NEN A;  2K5N A;  4DNI A;  3PF5 A;  1EFW A;  1CKN A;  1OXS C;  3T1Y Q;  2Q2T A;  4LFA L;  2GVB A;  1IBM Q;  4AQY L;  1KC8 C;  5IYD G;  1WOC A;  2MO1 A;  4JI0 L;  3GTK H;  3A5Z B;  4LFA Q;  3PO2 H;  3KLW A;  2VNU D;  1EWI A;  4DR5 L;  1VQL A;  4JI0 Q;  1X55 A;  4DUY L;  1R9T H;  3CC2 A;  2PMZ E;  4DV2 L;  3S15 H;  2JEB I;  3JC6 6;  2L15 A;  1VQA A;  2YTX A;  4PZ6 A;  1PFS A;  3M4P A;  5IYB H;  5HGQ A;  3J80 i;  3L2P A;  5C0X G;  4UP8 A;  2K75 A;  3EIV A;  1XMO L;  3BU2 A;  1PH6 A;  4JI4 L;  4A3I G;  2YU9 H;  5C4X H;  3K7U C;  2R7F A;  1M90 C;  1EUJ A;  3J7Z C;  1SFO H;  1Y1V G;  2F4V Q;  1FGU A;  4DR6 Q;  4A3C G;  1A63 A;  4OWT B;  1OXV A;  4JI6 L;  3E9I A;  1YVC A;  3I4M H;  3L0O A;  2VY3 A;  1TWG H;  4AH6 A;  1TWF H;  1A62 A;  3PSI A;  2NN6 I;  4B3M L;  2Z0S A;  5IP9 H;  1N32 L;  1Z9F A;  2VQE L;  1FVI A;  4TVA B;  1E1O A;  3UDX A;  1WFQ A;  2ZJP A;  1O7I A;  4B3M Q;  3AEV A;  4X6A H;  2LSS A;  2YV5 A;  3TEH B;  4DV4 L;  4FDB A;  4R4I A;  1YHB A;  1KL9 A;  2UXC L;  5JEA G;  2Q2U A;  4Y7N H;  2JA8 G;  4IFD G;  3OW2 A;  4NB3 A;  5JEA J;  4OX9 L;  3CC7 A;  2E2H H;  2ZJQ A;  3IRB A;  2BH8 A;  2B63 H;  4IFD J;  1XTD A;  3CPF A;  1Y1W H;  3I4N G;  3NBH B;  2JA5 G;  1YBY A;  2UUC Q;  3OTO Q;  1HNX Q;  2YTY A;  1Q81 C;  4B3T Q;  3PIO A;  2RHS B;  3I56 A;  5H1S E;  3KJP A;  1IZ6 A;  1AE3 A;  4PG3 A;  2I0Q A;  4K0K Q;  1QVC A;  2F52 A;  1UE7 A;  4IJH A;  4NPS A;  3J7A 5;  4JYA L;  4LF8 Q;  4X62 Q;  1UEB A;  5ELN A;  4A93 G;  2N8N A;  1X54 A;  4YHH L;  2CWP A;  4OO1 G;  4XTC S;  5M3F G;  4YY3 Q;  4WJ4 A;  3K0X A;  1QUQ B;  5IWA Q;  4P71 A;  2OWO A;  1FJG L;  4Y52 H;  3ER0 A;  1NTG A;  5AJ3 Q;  3U58 A;  3S1R H;  4L5S A;  1L0W A;  3W1G A;  4KHP L;  4DV5 L;  2R7Z H;  4DAY B;  1PH5 A;  3PO3 G;  1XPO A;  3UE1 A;  4R4O A;  4LFC L;  2EQS A;  3PV0 A;  2N49 A;  5EAY A;  4JV5 L;  5IYC H;  5C44 G;  3S1M H;  2YTV A;  3CCV A;  1SLJ A;  3CXC A;  3M85 A;  1VQF A;  3HOU G;  1MKH A;  3S24 A;  4X64 L;  4JI7 L;  2B29 A;  1OXU A;  3PUV A;  5LMU Q;  1J5E Q;  2K52 A;  2N3S A;  4LUV A;  2VQF Q;  4LF4 L;  4A3D G;  3T1H L;  4A4I A;  5FLM H;  1RL2 A;  3MXN B;  5IP7 H;  2NVY H;  4YCV A;  1EOV A;  2JA9 A;  3I2Z A;  3S2D H;  4YWL A;  5C3E G;  1VCI A;  1W3S A;  5GAH C;  2PNH A;  1I6H H;  1SN8 A;  2UXB L;  2E8G A;  4JOI A;  2R93 H;  3EN2 A;  2KCT A;  5M5W H;  3U4Z A;  4AYB E;  3CCU A;  1PH2 A;  1OTC A;  4GKK Q;  4OXP A;  1NMF A;  4GS3 A;  2QEX A;  1E3P A;  3D0F A;  4C3I H;  5C0X I;  4JBM A;  4LF9 L;  1QVF A;  2C35 B;  3H0G G;  3M9B A;  3UDG A;  2VS1 A;  4A3F H;  4A3M H;  3CCL A;  1BBW A;  4A3B G;  4QY7 A;  2E2I H;  2B3G A;  2HT1 A;  4DR4 Q;  1IXR A;  4JI3 Q;  2JA7 H;  4IPC A;  4HJ8 A;  1GKH A;  2HHH L;  3E9H A;  4B3R L;  4DV3 L;  1K8A C;  1QZG A;  1A0I A;  1S3O A;  4DV6 L;  4GOP C;  3F1Z A;  2ZM6 Q;  4A3K G;  2E5L L;  3A0J A;  4JC0 A;  2HIX A;  1LYL A;  2DUD A;  1G6P A;  1LM0 A;  3CMA A;  4IO9 A;  3I7F A;  4UP7 A;  1J6Q A;  2ASB A;  3HOW G;  1JE5 A;  2V1C C;  2Q2I A;  4NXM Q;  4IFD I;  1EQQ A;  4TQU S;  4BY7 G;  2UUA L;  1MIU A;  3RZO H;  4C2M H;  1WYD A;  2R92 H;  4O2D A;  3JAM c;  5LMN Q;  4P73 A;  4A3E H;  1HNZ L;  2AKW B;  3KOJ A;  3HOX H;  3J81 i;  2UUA Q;  4A3L G;  3RR5 A;  4GOP A;  3S14 H;  1KIX A;  4DR3 L;  3AFP A;  3T1Y L;  5JJL A;  1PA6 A;  2K5H A;  1E22 A;  1IBM L;  1RIP A;  2UXD Q;  3TRE A;  4LWC A;  4GKJ Q;  2JJQ A;  3HKS A;  3GD7 A;  4DR1 L;  4DV1 Q;  4DR3 Q;  2VUM H;  4BBR H;  1Q86 C;  1SMX A;  3PO2 G;  1NBW A;  4PZ7 A;  4OO1 I;  1Y14 B;  3RLO A;  4DR1 Q;  2IHF A;  1HR0 Q;  4OWX B;  3BZC A;  4BXX H;  1NJI C;  3KF6 B;  1VQH A;  3HOV H;  2AHO B;  4HID A;  2PI2 A;  2RF4 A;  4JBJ A;  1S40 A;  3RLN A;  4A3J H;  4BY1 H;  4DR2 Q;  4X66 Q;  2F4V L;  2PQA A;  5IE8 A;  4DR6 L;  1SRO A;  4DUZ Q;  3RN5 A;  4BA2 I;  1FL0 A;  2KEN A;  5C4X G;  4IPG A;  3TS2 A;  3L7Z C;  4WJ3 M;  1BBU A;  3GTJ H;  1H95 A;  1VQD A;  3KDF B;  4A3G G;  4JG2 A;  1VQO A;  2NZH A;  1KQS A;  2MFI A;  5J3B A;  3G71 A;  3UDF A;  1PH4 A;  2IHE A;  1K83 H;  4IPH A;  3BJU A;  4GNX B;  1K0R A;  3ICE A;  2LXJ A;  2UUB Q;  2OQK A;  2WFW A;  1B70 B;  3U4V A;  1G29 1;  1HZ9 A;  1SRU A;  2BA1 A;  3UE0 A;  3D31 A;  5IY0 A;  3M4O H;  4IOA A;  1T9H A;  2LXK A;  3STB D;  3CCS A;  4GN5 A;  4R4Q A;  4RMF A;  1L1O B;  1SR3 A;  2WP8 J;  4R4C A;  1M1K C; 
#chains in the Genus database with same CATH topology
 3MFY A;  3X3M A;  3M4Q A;  4R8N A;  3GTM B;  4K0K L;  1X3E A;  3S2D B;  1CA5 A;  4J15 A;  3QIA A;  1KD1 C;  3P1H A;  4LF8 L;  5GQO A;  1Z6H A;  2J4X A;  1VQ9 A;  2A68 D;  4A76 A;  1YNN C;  1O7L A;  4YCW A;  1GUT A;  4FYD A;  2RDG A;  2R3Z A;  2K5Q A;  3CC4 A;  5JEA H;  1JWS D;  2FMC A;  3J80 L;  4B3S Q;  3I91 A;  3H91 A;  2X6L A;  4GN4 B;  5M3M G;  1NAP A;  1AEX A;  4C3J H;  4EQ5 A;  3CF5 A;  2BH2 A;  3VYU A;  2XRS D;  4KY6 A;  3R8B A;  5M3F H;  2F0J A;  2ES2 A;  4RGN A;  2ICI A;  2OXP A;  2PMZ B;  3W1B A;  3EQL C;  4KD4 A;  4ZK9 B;  2M00 A;  1VQ5 A;  2XGT A;  2KED A;  4HMJ A;  4MNO A;  5C44 H;  4DR4 L;  1V43 A;  1T5X D;  3I55 A;  1ESR A;  3WOF A;  4BBR B;  1GO3 E;  4ME5 A;  3HOU H;  5FJ8 G;  2DNC A;  2PCF B;  5IT9 E;  5CC4 A;  1TS5 A;  1NMG A;  3OWE B;  4FVM A;  2KCN A;  4A3D H;  4G7O C;  4BY7 B;  2ZM6 L;  3FP9 A;  3TZD A;  4LUZ A;  2NVX B;  1X65 A;  2UU9 Q;  3ULL A;  5C3E H;  1SMY D;  3HOY B;  2IW3 A;  4B9W A;  2F1M A;  4X65 Q;  3CCM A;  2MNA A;  1TQO A;  3WWV A;  1TKW B;  1MGS A;  4GNX C;  2H1E A;  2CH4 A;  2PI2 E;  3Q8D A;  2CFM A;  2AQ3 B;  1GXD C;  3H0G H;  1L2F A;  4KTA A;  1X6O A;  2F0G A;  3FVQ A;  3G4S A;  4MN3 A;  1HZC A;  3CQZ H;  5CBA E;  1Q8K A;  1LTT D;  2NTS A;  3S2H H;  3DLL A;  1HRJ A;  4IUR A;  1IBK Q;  1HR0 L;  3G6J B;  4GNX A;  1VQ6 A;  1CQF A;  3KFU A;  1SJH D;  2OCE A;  4A3I B;  1J9O A;  4JI2 Q;  2K1B A;  2L0C A;  1Y1V B;  3D6W A;  5C4J H;  2DGY A;  3SEB A;  4X66 L;  1V9P A;  1ENA A;  2V4D A;  3KBX A;  1E24 A;  5M9O A;  2WII B;  2NBF A;  5IT9 c;  3F2C A;  3NEL A;  3MXU A;  1JJG A;  3VDY A;  4C3H B;  2ID0 A;  4LFB Q;  2JA8 B;  5FO9 B;  1ICF B;  2WIN B;  3BZK A;  4GLV B;  1K0S A;  1TWA B;  5IYD H;  5JJK A;  1PZJ D;  3T56 B;  1QUQ A;  2E2D C;  4L5T A;  1DGS A;  1PH9 A;  2F0D A;  4HAE A;  5GAE C;  4M8A A;  2B2V C;  5CV4 A;  4DUY Q;  1PLF A;  1UE5 A;  4DAY A;  4L5R C;  3S17 B;  2EY1 A;  3PUY A;  1S5D D;  4GOP B;  5C0X J;  5KND A;  1XNR L;  5D14 A;  1TY2 A;  3AQQ A;  1XMQ L;  4EQO A;  2CQA A;  4RGM A;  3OMG A;  4GZY C;  1M4V A;  2B2V A;  4LF6 L;  3TS0 A;  1ICW A;  5LL6 S;  1CSP A;  2VQE Q;  2K05 A;  4N8F A;  2A6H D;  1EQR A;  5M3M B;  4DV7 Q;  3PF4 A;  1PDQ A;  1Z47 A;  3VYT A;  5CYU A;  4DK1 A;  4DPG A;  1VDZ A;  2OEO A;  2L11 A;  5CV5 A;  1DJR D;  1RHP A;  1D8L A;  4IOC A;  3HP3 A;  4IQZ A;  1CI3 M;  2CWA A;  3NEM A;  3QJY A;  2MGS A;  3PIP A;  2EIF A;  1FJG Q;  3I4L A;  3DM3 A;  5FLM G;  4JYA Q;  1CUK A;  1DYQ A;  4RHS A;  2D62 A;  1MHW C;  4CJ2 C;  1BR9 A;  4DN4 M;  2NWG A;  3QOJ A;  1BCP B;  3FKI H;  5BR8 Q;  5ELE A;  1BUV T;  3BYY B;  3M7N A;  2WAQ E;  1H9M A;  2HIV A;  2JYO A;  5I4D A;  2Y0S E;  3GTQ B;  1VQ8 A;  2EYF A;  1P16 A;  4A3F G;  4JI5 L;  3PMF A;  3HS0 C;  3NP8 A;  5M5Y H;  1DON A;  1KLG D;  3RZD B;  5E4X A;  1N34 L;  4JI7 Q;  5IOD A;  4POG A;  4LF7 Q;  2TMP A;  1F2M A;  2WB1 E;  4JI1 L;  1XYI A;  3PIO 3;  4DF7 A;  2AQ2 B;  3P20 A;  1STY A;  4ME3 A;  2ZXO A;  2N55 A;  2DY7 A;  1VQM A;  2NVT B;  2KUM A;  4DV0 L;  1KRS A;  2QIL A;  4LF5 L;  2R92 G;  1CSQ A;  1U0L A;  1VQC A;  1ZXT A;  1A6X A;  3CAM A;  4ABN A;  3TN2 A;  1ASZ A;  1FR3 A;  1F9Q A;  2MUY A;  3KDF A;  3RUZ A;  2HHH Q;  1IBL L;  1U4L A;  2WKC A;  1C0A A;  4ALP A;  1EY7 A;  3MWY W;  1VF5 C;  3SXH A;  2AWO A;  2E5L Q;  1OXX K;  3ZYY X;  1YIJ A;  1QVG A;  1ASY A;  3S1Q H;  1D7Q A;  1TWG B;  3J7A F;  1U4P A;  4OHJ A;  2NB0 A;  1SYG A;  1SEB D;  2QCP X;  4CDD C;  1PYB A;  1GD7 A;  3NEN A;  3R93 A;  4DNI A;  2K5N A;  3TP6 A;  5DM7 3;  3PF5 A;  1CKN A;  3T1Y Q;  1EFW A;  2Q2T A;  5IGE A;  2O5J C;  4ILW A;  2GVB A;  1IBM Q;  3GTO B;  5IYD G;  3GTK H;  2EVB A;  2BE5 D;  3SK8 A;  2VNU D;  3KLW A;  3WDN A;  5A2Q L;  1I4P A;  1EWI A;  4DR5 L;  5DAU A;  1VQL A;  5CV7 A;  3CC2 A;  3JC6 6;  4PZ6 A;  2PZU A;  1K8O A;  2XNA C;  3EIV A;  1XMO L;  3BU2 A;  4JI4 L;  2A68 C;  5C4X H;  3S1R B;  1II3 A;  4DR6 Q;  5J22 A;  3H09 A;  1YVC A;  3D6C A;  4MHE A;  3I4M H;  1TWF H;  1A62 A;  5J39 A;  4XT1 B;  3MXP A;  1BCP D;  1FVI A;  1A2U A;  3S1M B;  1E1O A;  3UDX A;  4KHV A;  4B3M Q;  3DM1 A;  2LSS A;  3TEH B;  3NQT A;  2Q2U A;  2Q8I B;  4YIJ A;  2WKD A;  4WJW A;  1S5F D;  2R61 A;  4I7Z C;  2KVM A;  2ZJQ A;  2B63 H;  3MHB A;  4IFD J;  4FF1 A;  3I4N G;  2M2L A;  2DJG C;  2JA5 G;  2UUC Q;  3OTO Q;  5BN5 A;  1HNX Q;  1Q81 C;  1H9S A;  1IZ6 A;  1AE3 A;  2F4I A;  4EGV A;  2F52 A;  1IL8 A;  1QWY A;  2K32 A;  5ELN A;  4A93 G;  2N8N A;  2IWH A;  2EZV A;  1QUQ B;  2OWO A;  5I2Y A;  4Y52 H;  4Z9C B;  4IUP A;  2F0T A;  4DAY B;  3NUC A;  1YNN D;  4HR7 B;  1XPO A;  5EAY A;  5IYC H;  3CCV A;  1OXU A;  5LMU Q;  3A8J E;  3GV6 A;  2QF7 A;  1DD2 A;  1QE6 A;  2N3S A;  5DM6 3;  2VQF Q;  1SBB B;  1AFP A;  2EY2 A;  2HQE A;  1Q8I A;  2F0P A;  3RZO B;  4B08 A;  3HOZ B;  4YCV A;  1ONL A;  2JA9 A;  3I2Z A;  3S2D H;  1VCI A;  1W3S A;  1SN8 A;  2UXB L;  4IUV A;  1RTN A;  4JOI A;  2KCT A;  1OTC A;  3U4Z A;  3I8Z A;  4U67 3;  2QEX A;  1E3P A;  5C0X I;  4LF9 L;  3M9B A;  4CHT B;  3UDG A;  1BBW A;  4A3B G;  1X3Q A;  3ERQ A;  5JJZ A;  5KNB A;  4IPC A;  5AFW A;  4B3R L;  4K5X A;  4KKS A;  3S15 B;  1W6J A;  2XRQ D;  3F1Z A;  2F0O A;  4A3K G;  1F9S A;  4CKC A;  2HIX A;  1LYL A;  4IUN A;  3HRZ C;  1LM0 A;  4CJ0 B;  3CMA A;  4UP7 A;  4IO9 A;  1J6Q A;  2YU9 B;  3HOW G;  1SFO B;  4NXM Q;  1VMC A;  3HG9 A;  4F8M A;  2K28 A;  1HNZ L;  1HUN A;  4A3L G;  3BDO A;  4ZCK A;  1BXT A;  3DXJ C;  3H94 A;  2UXD Q;  4LWC A;  1Y8O B;  4DR1 L;  4DV1 Q;  2NZ1 D;  4BBR H;  1SMX A;  1Q86 C;  1NBW A;  2EYM A;  1LLR D;  3X3N A;  1EWC A;  2IHF A;  3BZC A;  1F9P A;  1X3P A;  1VQH A;  2AHO B;  3SVM A;  2WAQ B;  4HN7 A;  1MI2 A;  3D4R A;  4MIU A;  2Y0S B;  3NQI A;  1S40 A;  4DR2 Q;  4DGZ A;  2F4V L;  1LTR D;  5IE8 A;  5C4X G;  1SRO A;  1YNJ C;  1FL0 A;  4IPG A;  4RAU C;  2B2T C;  4R9W A;  3KDF B;  3VA5 A;  1XX8 A;  2MFI A;  2WB1 B;  5J3B A;  1EYC A;  2IHE A;  1EFI D;  3BJU A;  1D5X C;  3U4V A;  1ROD A;  1A2T A;  1HZ9 A;  3VYS A;  3D8G A;  1EY5 A;  1SE4 A;  1T9H A;  1Y8N B;  1SR3 A;  2B2T A;  4R4C A;  1G2S A;  1ILP A;  1B9M A;  1PZI D;  3PCO B;  4H02 A;  4RH6 A;  4A93 B;  1X3F A;  1TWH B;  1H9K A;  1HXY D;  2L1B A;  5LHY 1;  4A3I H;  2PZT A;  1Y1V H;  4X62 L;  1CKN B;  2KOL A;  2CVR A;  4DA2 A;  2IJ0 A;  1Q1E A;  4YY3 L;  1EEF D;  1SJE D;  1IKM A;  2AUK A;  1VQ4 A;  1A15 A;  3A7L A;  5AJ3 L;  1FGB D;  3Q24 A;  3D4W A;  3LGJ A;  2F0L A;  3ULJ A;  2JA6 G;  4C3H H;  2NZO A;  1SNQ A;  1YI2 A;  4ZYS A;  4O1N A;  2JA8 H;  3NWS A;  3ND9 A;  4IFD H;  4RWS C;  5KRU A;  4O0A A;  2ENB A;  2K5V A;  5FLX L;  1QIL A;  3CCE A;  3V05 A;  1JB3 A;  4XXE A;  1J5E L;  2A8V A;  2K7V A;  4GN3 B;  2BOS A;  3NBI A;  4JI8 Q;  2L55 A;  1AZP A;  3S17 H;  1OXT A;  4OO1 H;  4RKL A;  5CBE E;  4K5V A;  3HOX B;  4HJA A;  2MP1 A;  3EJI A;  1SNP A;  1PH7 A;  3S16 H;  3S14 B;  5JJI A;  4OEL B;  4GKK L;  4YWM A;  3IL8 A;  1K3R A;  1BF4 A;  3OYY A;  1HQR D;  3NK9 A;  5D3D A;  3I4O A;  4JI3 L;  1LTA D;  4A3K B;  2F3I A;  3VR5 A;  1H9S B;  3K7A H;  4P75 A;  2EY5 A;  1BO0 A;  3RLF A;  4CKE A;  2UU9 L;  3PIP 3;  1I5F A;  4DKA C;  3PUW A;  4V0B A;  3T4A C;  2JEA I;  4N9T A;  1X32 A;  1GOZ A;  1WTO A;  5E1F A;  4PNY A;  2EYP A;  3GTP B;  2KQ3 A;  1EY4 A;  1F77 A;  2AUJ D;  4IUQ A;  4LUO A;  1XJV A;  1C7Y A;  5LMN L;  3GV3 A;  2G9D A;  3D3R A;  4JBK A;  1PTO C;  5ELB A;  4DAV A;  4WOR A;  3M4O B;  3HKZ G;  4X3S A;  1IBK L;  1UUP A;  3GTQ H;  4HCS A;  4OIK A;  1XPR A;  3K6O A;  4KY7 A;  2K5D A;  4NMZ A;  3HGB A;  3E0E A;  1KDA A;  3S1N B;  1HZA A;  3K80 C;  1N33 Q;  3AFQ A;  2F0E A;  4DAM A;  1E2W A;  4DNR B;  2EXZ A;  2RSO A;  4V19 0;  4ZRZ A;  2D0P A;  1B44 D;  1LUZ A;  1JB7 A;  2IX3 A;  2BA0 A;  5C3W A;  1KAB A;  4OL7 A;  2I5M X;  2NVT H;  1VQK A;  4LFB L;  1EQV A;  4DXF A;  1BDO A;  1W6K A;  2HQL A;  2UUB L;  2HUG A;  5IP9 G;  1O78 A;  1XXG A;  1PV4 A;  4QCL A;  1F2L A;  1L0Y B;  1K28 A;  4K8I A;  3AMU A;  3R2I A;  3DMU A;  5C6A A;  2A1A A;  5GAG C;  2JA6 B;  1KAW A;  4A3G H;  1E1T A;  2FMM A;  1FNU A;  2ZJR A;  1I50 B;  1X9N A;  2B8G A;  5CV9 A;  4JI6 Q;  1HHV A;  1QNU A;  4DV7 L;  4HIK A;  3CPW A;  1I3Q B;  1N32 Q;  2OTL A;  1N36 L;  4NKL A;  4CDE C;  1KRT A;  4KHZ A;  4EX5 A;  1KXL A;  5I2X A;  2B2Y C;  4DV4 Q;  1BCP F;  3MZ5 A;  3GTO H;  1S5C D;  3CRL C;  1ILQ A;  1A8V A;  4BBS H;  4UAI A;  4RA8 A;  5DEH A;  1N8R C;  2OQ0 A;  4OX9 Q;  1D1K A;  2EPB A;  4KJN A;  3J81 E;  2XSC A;  4HJ5 A;  3B6Y A;  4PV1 C;  1ESF A;  2PW7 A;  3DWQ A;  1YHQ A;  1Q46 A;  5K5P A;  4LNQ A;  2X69 A;  3IFT A;  4POF A;  1SDF A;  1HTP A;  1NNX A;  1AP0 A;  2C5C A;  2B2Y A;  5ELO A;  5IP7 G;  1SYF A;  5BR8 L;  2I07 B;  1WCM H;  4HSV A;  4QL5 A;  1VS0 A;  4LAA A;  2R93 G;  1TXY A;  4KHP Q;  3EA6 A;  4DV5 Q;  3PO3 G;  4KLK A;  4LFC Q;  3SGI A;  2TSS A;  1I94 L;  4LF7 L;  4K2L A;  3S9W A;  1D6E C;  2A5H A;  3EBE A;  5COR A;  5EPJ A;  3RN2 A;  4X64 Q;  3EVQ A;  1XNQ L;  3K81 C;  1TII D;  5FK9 C;  3U9S A;  2NN6 G;  1BKB A;  3FPP A;  4P72 A;  1Q1B A;  4LF4 Q;  3T1H Q;  3PUZ A;  1B7Y B;  1V1Q A;  3BDL A;  2K03 A;  2KCM A;  4DR7 L;  4K6L A;  1HZB A;  1LTS D;  3HKZ B;  3A55 A;  5EPL A;  3OIP A;  2G9H D;  1STG A;  4BWG B;  5BN3 A;  1K73 C;  4NXN L;  4KJO A;  3J81 c;  1K8G A;  3PO2 B;  3F2U A;  1HFG A;  4AIM A;  3CME A;  1AE2 A;  1Q12 A;  5I6W A;  1G51 A;  4PQX A;  4XQJ A;  3MC0 B;  3U9O A;  4DV3 Q;  2PPB C;  2SOB A;  5LMN W;  2EJF C;  2FFK B;  2K50 A;  1I4H A;  5GRO A;  4BXX G;  1PFN A;  1AZQ A;  1DOK A;  2A69 D;  4DAP A;  4QQB X;  3GTL B;  2BCO A;  3HOZ H;  4QF4 A;  4A3J G;  4G4K A;  2EE1 A;  1BNZ A;  1NCV A;  2K6A A;  1OO9 B;  1VQJ A;  2D5D A;  3IFD A;  1OXS C;  3OMC A;  4Y7N B;  2MPM A;  4AQY L;  1KC8 C;  3P7J A;  2E2H B;  3NSW A;  4LFA Q;  1HA5 A;  5D65 A;  3CKI B;  2B2W C;  1JC7 A;  2RA4 A;  2QDB A;  4JI0 Q;  1R9T H;  4DV2 L;  1QG7 A;  3S15 H;  2PYK A;  1PFS A;  3C46 A;  5K36 H;  5IYB H;  1MBY A;  3L2P A;  4UP8 A;  3NXW A;  1FNW A;  2YU9 H;  1M90 C;  1EUJ A;  1SFO H;  2B2W A;  3QWN A;  3E9I A;  2VY3 A;  1U4M A;  4B3M L;  2Z0S A;  3L3O C;  1YNJ D;  1HPC A;  4FF3 A;  2A6E D;  1WFQ A;  4X6A H;  2YV5 A;  4DFA A;  4FDB A;  3KF8 A;  1KL9 A;  1PTO B;  2UXC L;  4KKU A;  5JEA G;  1SND A;  4NB3 A;  1XTD A;  1Y1W H;  2GA4 B;  2Z8L A;  1YBY A;  1GHJ A;  3SK4 A;  5H1S E;  4K0K Q;  4C3J G;  1E2V A;  3TP7 A;  3J7Y W;  3A8K E;  4LF8 Q;  5G3L D;  1UEB A;  4FF4 A;  2WAC A;  1X54 A;  3CU7 A;  4YHH L;  5M3F G;  1EEI D;  3K0X A;  4QUF A;  3ER0 A;  4L5S A;  2E2I B;  3BVG A;  1CZW A;  1JWU D;  2R7Z H;  2SEB D;  5EQ0 A;  1PH5 A;  3UE1 A;  2N49 A;  4JV5 L;  5C44 G;  3PQI A;  1RD9 D;  2CHB D;  3JAM E;  3M85 A;  3HOU G;  3SDZ A;  3S24 A;  1KAA A;  1MSG A;  3UI2 A;  4ZQ3 A;  4LUV A;  4A3D G;  2E76 C;  2L9H A;  4A4I A;  5E4W C;  1GUO A;  2NVY H;  5E3F A;  1STB A;  5C3E G;  4UDU C;  5GAH C;  1I6H H;  1RJT A;  3M4Y A;  4CJ1 B;  1VF7 A;  1RCV D;  2E8G A;  3EN2 A;  4AYB E;  3T51 B;  5FOB B;  4QB4 A;  4GS3 A;  4C3I H;  4JBM A;  3H0G G;  3CCL A;  4A3M H;  4DR4 Q;  4QY7 A;  1IXR A;  2JA7 H;  4HJ8 A;  4C1N K;  3N52 A;  1QZG A;  3P75 A;  2Z6B A;  4PMB A;  1A0I A;  1S3O A;  4DV6 L;  4A3J B;  4OEM B;  2ZM6 Q;  2LY7 A;  4JC0 A;  1G6P A;  2DUD A;  5CR3 A;  3DWA A;  4OGQ C;  3KK7 A;  2ASB A;  3GTJ B;  1WTX A;  1JE5 A;  4C1N I;  1EQQ A;  1MIU A;  1K83 B;  2G5D A;  3JAM c;  4A3E H;  3QB3 A;  5FKA C;  3HOX H;  1DXM A;  2UUA Q;  2F3V A;  3S14 H;  3KLS A;  5IIF A;  5JJL A;  1RIP A;  1ML0 D;  4XDX A;  3TRE A;  2JJQ A;  4DR3 Q;  2VUM H;  1O80 A;  2DN8 A;  4TKO B;  1PTO D;  2XWJ B;  1HR0 Q;  2NTT A;  1NJI C;  3HOV H;  2F0H A;  2RF4 A;  3V96 A;  4BY1 H;  4X66 Q;  2PQA A;  3QO2 A;  4ZKC B;  4WJ3 M;  4FXK C;  3L7Z C;  1H95 A;  1VQD A;  3NWT A;  4DXG A;  2NZH A;  5EKI A;  1PH4 A;  1ZKO A;  2ICE C;  1G6Z A;  5NUC A;  4GNX B;  1B3Q A;  3MTS A;  2LXJ A;  2WFW A;  1B70 B;  3M4O H;  1EZ8 A;  4WRD A;  4RMF A;  1LAC A;  1WTR A;  2WP8 J;  3ITP A;  5COY A;  1RKN A;  2JP1 A;  1WI5 A;  2AWN A;  3BVM A;  5C0X H;  2RDH A;  4B3T L;  5M3F B;  1V8Q A;  1CKO A;  1Z7T A;  3CRK C;  3QG1 A;  1D1I A;  1XNR Q;  2NVQ H;  4AYB G;  3MFG A;  4UPA A;  1NY4 A;  3GQB A;  3KBG A;  2FIN B;  5IWA L;  1XMQ Q;  2CCZ A;  5J1Z A;  1SNO A;  3MXN A;  5C44 B;  4LF6 Q;  3CCQ A;  2D0O A;  4A3F B;  1HNW Q;  5GAD C;  3FKI G;  2K4K A;  4CKB A;  1BQQ T;  1VQI A;  2PZW A;  3NHH A;  3GDE A;  4A3D B;  1B1Z A;  4HIM A;  5IT9 L;  3PGZ A;  3UDI A;  1YJ9 A;  4JOI C;  1WTQ A;  3G7L A;  1PH1 A;  4PMW A;  2RSN A;  1MSH A;  1XPU A;  3GTM H;  4HJ9 A;  2R92 B;  1U5K A;  3H3V C;  3NTH A;  2BDO A;  1WJJ A;  2N78 A;  3NE5 B;  4OON A;  5EKK A;  5EPK A;  2LMC B;  1VQB A;  1EOT A;  3CQZ B;  4HIO A;  3ERS X;  1PH8 A;  4ZUI A;  4C3I G;  3J80 E;  1I3Q H;  1QZH A;  1LAB A;  1SAP A;  2MJ8 A;  4ZAI A;  4JI5 Q;  1DOL A;  1MJC A;  1XTC D;  4G57 A;  1N34 Q;  1SYB A;  2ALY B;  3MVV A;  5C4J B;  3SHL A;  5C5M A;  1Y69 U;  2VL6 A;  4GLX A;  2VZA A;  2A69 C;  1G8Z D;  3H3V I;  4KY5 A;  1SE3 A;  1PMR A;  4L63 B;  1A3U A;  1T5E A;  1BBX C;  4F88 A;  1EYD A;  5KYI A;  3KUP A;  4A3E G;  4DV0 Q;  1F2Y A;  1CA6 A;  4LF5 Q;  1RDP D;  1JR0 D;  3VR3 A;  1PRT C;  2L12 A;  2ZT9 C;  4GKJ L;  1B2T A;  2F3W A;  5C3X A;  2JSO A;  2EDG A;  1AH9 A;  1ENC A;  2RBM A;  1IBL Q;  1N33 L;  3GTG B;  1ET9 A;  1JOR A;  2FXQ A;  4CDF C;  3HOV G;  1LV9 A;  4XIG S;  1YZ6 A;  1SYD A;  4BY7 H;  5CMD A;  2P5Z X;  3W3A A;  4DK0 A;  3J80 c;  1EYG A;  4DUZ L;  4L8J A;  2NVX H;  4JCV E;  2K04 A;  4LW1 A;  3NBH A;  4N8X 1;  3HOY H;  2MO0 A;  2A6E C;  3I4M G;  1HCZ A;  3A54 A;  2J0T D;  5T1I A;  1HUM A;  2RHQ B;  3I4N B;  3L9A X;  1PYW D;  2EOT A;  2JA5 B;  4GLA C;  4DR5 Q;  1KHI A;  1CTM A;  2MQH A;  4KK7 A;  4QMG A;  3W5O A;  4AYB B;  1Q90 A;  4C56 C;  3HKZ E;  2B63 G;  1A3V A;  2Z1C A;  1VMP A;  2HDM A;  2XIW A;  2K33 A;  1VQG A;  3KYH C;  1XMO Q;  4HMI A;  4JI4 Q;  1HJP A;  3CP0 A;  2Q8R E;  2E2J B;  2F03 A;  3GTL H;  4H0L C;  1RF2 D;  3PUX A;  4HJ7 A;  1D5Z C;  3Q23 A;  4MTK A;  4H13 C;  4U68 A;  5M5Y B;  1AW7 A;  1SNM A;  3TQY A;  1K9M C;  5DLQ E;  3SK5 A;  4B3S L;  4JVZ A;  5M5X B;  5IYC G;  1TWA H;  4ZKB B;  2PQA B;  1HFN A;  1L0X B;  3F2B A;  2OTJ A;  4I65 A;  2ZTE A;  2Z6K C;  1YHA A;  3OIQ A;  4OWW B;  3MEH A;  1PFB A;  2KHS A;  5KGU A;  3TRZ A;  3I3C A;  2CH4 W;  1GUN A;  2YYZ A;  1HH2 P;  4EVO A;  4J8Q A;  4KKT A;  4WFN 3;  2LKV A;  4A3B B;  5G3L F;  1ZEQ X;  4LJZ C;  1QNK A;  1V1O A;  4IJL A;  2Z6K A;  1NUC A;  4UHV A;  2ZTD A;  4FXD A;  3VR4 A;  4MZ9 A;  3CD6 A;  3BDC A;  1G2T A;  2EYJ A;  2QEJ C;  4ULL A;  5M3M H;  3BG3 A;  4P74 A;  1JMC A;  1H9J A;  1EIH A;  2KCC A;  3HOW B;  1S5B D;  2I5H A;  1JIC A;  4R1J A;  1Q7Y C;  3F8T A;  1BVS A;  1W2B A;  3K8A A;  2Z4I A;  3A74 A;  4X65 L;  1YJW A;  3M3Y B;  1EYA A;  1X3G A;  3LWE A;  1YIT A;  3FHW A;  2WV6 D;  1J8I A;  5HY6 A;  4KN4 C;  3HZX A;  3VR2 A;  4IN3 A;  4LF9 Q;  5FJ8 H;  2EYO A;  1PHJ A;  2QA4 A;  5EBC A;  4PZ8 A;  4ODG A;  2DJF C;  1ENF A;  4B3R Q;  4BBR G;  3RNU A;  3J81 j;  4KI0 A;  3H15 A;  1LT6 D;  4JI2 L;  3F2D A;  1XWE A;  4EQN A;  3RZD H;  5C4X B;  1UWV A;  3ZJY C;  1O7Z A;  3I4M B;  2IX0 A;  2MHV A;  4RG1 A;  2K5W A;  1STE A;  4X3T A;  3HOY G;  1SE8 A;  2EXD A;  5KIX A;  1HNZ Q;  2CKZ B;  2RCF A;  4FF2 A;  1PVO A;  2QGQ A;  1PYS B;  4LFA L;  2RVL A;  4Q0F A;  1SYC A;  1WOC A;  4JI0 L;  1MD2 D;  2B63 B;  1B4O A;  1X55 A;  3K0Y A;  5HUR A;  4DUY L;  4IUU A;  1GHK A;  2PQE A;  4K6D A;  2JEB I;  1JWM D;  1FYC A;  1VQA A;  3M4P A;  1PTO F;  3TSS A;  5HGQ A;  1IYU A;  1TR5 A;  1PH6 A;  2Z4H A;  4A3I G;  5JVG 3;  1S5E D;  3K7U C;  2R7F A;  2F4V Q;  1SXT A;  1Y1V G;  1CHQ D;  1FGU A;  1ZYR C;  1A63 A;  1OXV A;  3DWP A;  4ZLT F;  1B9N A;  5IGF A;  1K8M A;  1TS2 A;  1TWG H;  1B3A A;  4AH6 A;  3PSI A;  2NN6 I;  2C9O A;  2VQE L;  3K57 A;  2QW7 A;  3AEV A;  1O7I A;  4HSP A;  5A2Q E;  4R4I A;  4C3H G;  1YHB A;  1CK1 A;  1PRT B;  1DM0 B;  1WVL A;  2JA8 G;  4IFD G;  4HTH A;  4K14 A;  2KEE A;  3K5O A;  3CC7 A;  3IRB A;  2BH8 A;  2N88 A;  3T53 B;  3TZU A;  3NBH B;  1TWC B;  1TU2 B;  3QOL A;  1NR4 A;  2YTY A;  4TRD A;  1FJG L;  5IGC A;  2I0Q A;  1QVC A;  5FO8 B;  1UE7 A;  4IJH A;  4NPS A;  3SR1 A;  3SK6 A;  3J7A 5;  4X62 Q;  1O7Y A;  4JYA L;  4K5W A;  2LS0 1;  3KLR A;  3VR6 A;  4OO1 G;  4XTC S;  1R4P B;  3SE0 A;  4YY3 Q;  4WJ4 A;  4RGO S;  4P71 A;  3J7A V;  5AJ3 Q;  1NTG A;  3MAQ A;  3S1R H;  1WTV A;  3W1G A;  1H9R A;  1EY6 A;  2L4N A;  2HCC A;  5F2D A;  4KD3 A;  2Z9H A;  4DU9 A;  1U9R A;  3PV0 A;  3TP5 A;  1GUS A;  2KEC A;  2M9V A;  4IUT A;  3S1M H;  2YTV A;  5ELC A;  3H6M A;  1KLU D;  1VQF A;  2X6G A;  1MKH A;  4JI7 L;  2B29 A;  3PUV A;  2ZXR A;  1J5E Q;  4F87 A;  3RMH A;  2K52 A;  4X3U A;  5FLM H;  2L5T A;  5D3I B;  5EBD A;  2SDF A;  2PNH A;  4HED A;  3V2T A;  2HDL A;  4RFB A;  1STN A;  1BOS A;  1PH2 A;  4GKK Q;  1NMF A;  4R8I A;  3D0F A;  3OSO A;  2ZXP A;  2C35 B;  4BS9 A;  4A3F H;  2VS1 A;  4CDC C;  2B3G A;  5A35 A;  2HT1 A;  2HCI A;  4JI3 Q;  4XYO A;  5JVH 3;  1GKH A;  2HHH L;  2VXW A;  3OHX C;  1TVX A;  4F7X A;  2OF1 A;  1E0B A;  1E2Z A;  4LMQ D;  5KNC A;  2E5L L;  1LT4 D;  2V1C C;  2XWB B;  2F0I A;  2RKS A;  1WTP A;  4TQU S;  2UUA L;  2OT2 A;  3RZO H;  2R92 H;  4O2D A;  5LMN Q;  2AKW B;  3KOJ A;  1NSN S;  3J81 i;  3RR5 A;  1KIX A;  4DR3 L;  3AFP A;  3TBI B;  3T1Y L;  2IL8 A;  2K5H A;  1IBM L;  3TP8 A;  1WTW A;  1CT1 D;  3HKS A;  2FJ2 A;  1IW7 C;  3FDT A;  3C1F A;  1LTG D;  1K3B C;  2H4O A;  1PRT D;  1RTO A;  1CQV A;  3RLO A;  2KA7 A;  4OWX B;  2F0F A;  5CGK A;  1D5M C;  4ID6 A;  3DEP A;  1EL0 A;  2PI2 A;  4N9P A;  4JBJ A;  1C4Q A;  1SE2 A;  4DR6 L;  3RN5 A;  2DY8 A;  2F0M A;  4BA2 I;  2KEN A;  3TS2 A;  1BBU A;  1FD7 D;  1CM9 A;  4A3G G;  4RHR A;  4KN7 C;  1VQO A;  1C48 A;  1JOK A;  1F9R A;  4IPH A;  4M1U B;  1K0R A;  2UUB Q;  3WOE A;  1U4R A;  2FHT A;  5ELD A;  1G29 1;  1SRU A;  2BA1 A;  3UE0 A;  2XVS A;  4GN5 A;  3OWF A;  3MXG A;  3G6E A;  4BBS G;  4UP9 A;  2UUC L;  4K8J A;  1HTL D;  3GTG H;  3OTO L;  1HNX L;  1UE6 A;  4UY8 C;  4QJF A;  3BS1 A;  2E75 C;  3S16 B;  2VB3 X;  1JT8 A;  2R93 B;  5I9P A;  1HNW L;  5M5W B;  3PO3 B;  1WCM G;  1QOH A;  3W2D A;  1EZ6 A;  2RQX A;  3VA7 A;  3FEW X;  4H7B A;  1N36 Q;  3K7A B;  4G7Z C;  5L37 A;  3I4N H;  2JA5 H;  2EJM A;  5LMU L;  4XQQ A;  2VW9 A;  1KTK A;  2VQF L;  2O5I C;  1P8L A;  4FNF A;  1UAP A;  3G48 A;  1VQE A;  2R6G A;  1UEA B;  5EKL A;  4A93 H;  2PW5 A;  2F0Q A;  1TWH H;  4C2M B;  4QGU A;  2F0K A;  1TY0 A;  3AYH B;  3I73 A;  2GVA A;  2E2J H;  3M7G A;  2KHI A;  4X3K A;  2RCN A;  1MJE A;  5KEE A;  3U50 C;  1S72 A;  2ZTC A;  4L5Q A;  1I4Q A;  5FLX E;  1PXU A;  1TS4 A;  1KNE A;  1I94 Q;  4YCU A;  2Q2H A;  1Q82 C;  4FO2 A;  5M5X H;  1XNQ Q;  1YJN A;  2JE6 I;  3Q0A A;  4JPB W;  5CV6 A;  2J7Z A;  2EYL A;  4RGT A;  3BYT B;  1EU4 A;  4NXM L;  1IYJ B;  2B39 A;  4DR7 Q;  5JAV A;  5ELF A;  3HOZ G;  4A3B H;  2CW0 C;  3CW2 C;  4NXN Q;  4A75 A;  4NW2 A;  1LTL A;  2UXD L;  2XTI A;  1I4G A;  5CV8 A;  4DV1 L;  1LT5 D;  3TDQ A;  5BN4 A;  1C8C A;  1JJC B;  4A3K H;  1Q3L A;  3TME A;  1R4Q B;  3CCR A;  2F0U A;  3HOW H;  3A5U A;  1VQ7 A;  4A3G B;  3GP7 A;  4J1M A;  4DR2 L;  5K36 G;  4Q5V A;  1STH A;  5IYB G;  3URY A;  2Q8T A;  4L6T B;  5FLX c;  3JAM i;  1WTH A;  3M3Y H;  4A3L H;  1HR0 W;  3E6Z X;  3GTP H;  1IL2 A;  3C3L A;  4DK3 C;  4R4T A;  1HA6 A;  1EIY B;  1PH3 A;  4TSS A;  3DHQ A;  3STB C;  4BBS B;  4J6H A;  3ONA B;  2R7D A;  2A19 A;  4AQY Q;  4ZUJ A;  3IAY A;  2KHJ A;  1EIG A;  3AU7 A;  4B9X A;  4C3J B;  3LNN A;  4DV2 Q;  5I9O A;  3J81 L;  3E3X A;  1Y1W G;  3C2P A;  1EU3 A;  4JW0 A;  1STA A;  2HD3 A;  2I46 A;  3HFZ B;  1WCM B;  1I4X A;  3S1N H;  1YNX A;  3NTI A;  4A3C H;  1UE1 A;  3DUZ A;  2PO4 A;  2WAQ G;  1A3T A;  2Y0S G;  1QB5 D;  1TS3 A;  3I90 A;  3R2T A;  1LT3 D;  3H3V H;  1ZYR D;  2PNR C;  3C1E A;  3HOU B;  5JPM C;  2ATW A;  2WB1 G;  1JE4 A;  2R7Z G;  1E7Z A;  2B2U C;  3FMC A;  1PZK D;  1YEZ A;  2UXC Q;  2O4X A;  3R3O A;  3K59 A;  2F0S A;  5JOB A;  3KLS X;  1B53 A;  2JK8 A;  5C4Z A;  2H5X A;  2GN5 A;  3AB9 A;  5C5L A;  1KDC A;  4JI8 L;  5C3E B;  1B8A A;  5T1G A;  4DK6 C;  4S3S A;  3MEF A;  4JBW A;  4H44 C;  3FRP B;  1Y8P B;  2B2U A;  5DNF A;  4CGY B;  1JJ2 A;  4QIW E;  4G7H C;  4YWK A;  1JCK B;  3K5N A;  1NR2 A;  4YHH Q;  1JQY D;  3H0G B;  1N9W A;  1IKL A;  4FXG C;  2JA6 H;  1S4Z A;  4XQN A;  1EWH A;  4DNT B;  3KF8 B;  1GJX A;  1I50 H;  4BA1 I;  4MTN A;  4LK1 C;  1AN8 A;  1EY8 A;  3GO5 A;  3S2H B;  1X56 A;  2I5L X;  2IY5 B;  2JQO A;  4JV5 Q;  4A3M G;  5E7N A;  2IX1 A;  2JA7 G;  4IPD A;  1SMY C;  3E0J A;  4HCE A;  2VB2 X;  4IZ8 A;  1DCZ A;  1M8A A;  2AMC B;  1TWC H;  1VQP A;  4JI1 Q;  1GM5 A;  3A7A B;  3NPP A;  1M1K C;  2K14 A;  2SNM A;  3KF6 A;  2EY6 A;  3KJO A;  1V1P A;  3HOX G;  3LX0 A;  1C9O A;  1B50 A;  2JXM B;  1L1O C;  1R9T B;  1EIF A;  1NE3 A;  1GVP A;  2DNE A;  3ULP A;  2D9U A;  2VUM G;  2A73 B;  3OPO A;  2IT1 A;  3Q6S A;  5C4H A;  2CQO A;  4DV6 Q;  1VQN A;  3CCJ A;  3ERO A;  4APV A;  1DOM A;  1L1O A;  2KBN A;  4BY1 G;  1ET6 A;  1CKM A;  3CHB D;  3K5L A;  3BZD B;  2MO1 A;  3A5Z B;  3PO2 H;  1Y1W B;  2NYZ D;  2XN9 C;  2K01 A;  2PMZ E;  4XYQ A;  1IW7 D;  4RKB A;  2L15 A;  2YTX A;  1PRT F;  4XT3 B;  3J80 i;  3Q22 A;  1IYV A;  2F0W A;  5C0X G;  2K75 A;  2BDN A;  1WD0 A;  4E6I A;  4A3C G;  3J7Z C;  4OWT B;  2A6H C;  3FKI B;  4JI6 L;  2R7Z B;  3L0O A;  1JOQ A;  5JPN C;  5IP9 H;  1N32 L;  1Z9F A;  3E5S A;  4TVA B;  4O42 A;  2ZJP A;  1IHZ A;  1GUG A;  4DV4 L;  4OIJ A;  3VYR A;  1DZ1 A;  4Y7N H;  3OW2 A;  3ND8 A;  5JEA J;  3JAM L;  4OX9 L;  2E2H H;  2A74 C;  3K5M A;  1QCB D;  3CPF A;  2NVY B;  4B3T Q;  3PIO A;  2RHS B;  3I56 A;  4PMC A;  3KJP A;  4PG3 A;  2EJG C;  1I6H B;  5IGB A;  5EGT A;  1UNS A;  2CWP A;  4C3I B;  5IWA Q;  3I70 A;  4A3M B;  3U58 A;  4P2C B;  4NDX A;  1L0W A;  5LL6 X;  4KHP L;  2JA7 B;  4DV5 L;  1LO5 D;  1KDB A;  3HEJ A;  4CBV A;  4R4O A;  4LFC L;  2EQS A;  3BVZ A;  3MA2 B;  2B8F A;  1SLJ A;  3CXC A;  2QDL A;  4X64 L;  2IPK D;  3FPU B;  1PTO H;  3OW7 A;  1LTB D;  3O13 A;  3EFX D;  5TSS A;  4KV6 A;  4LF4 L;  3T1H L;  2NUC A;  5IOC A;  2JN4 A;  1KNA A;  2KJX A;  3S1Q B;  1LTI D;  1RL2 A;  3MXN B;  5IP7 H;  1EOV A;  4A3E B;  2D2C C;  4YWL A;  1FNV A;  4RCN A;  1QJO A;  2AQ1 B;  2SNS A;  2R93 H;  3A56 A;  2UXB Q;  5M5W H;  3CCU A;  2E74 C;  4OXP A;  1QVF A;  3PO3 H;  5IGD A;  2VUM B;  1I6V C;  3GTK B;  2E2I H;  1PFM A;  1WD1 A;  4FP5 D;  3E9H A;  2QKI C;  3K58 A;  3DEO A;  4DV3 L;  1K8A C;  3HOV B;  1TT2 A;  2LFN A;  2NN6 H;  3LWU A;  3T16 A;  4I7A A;  1CHP D;  4GOP C;  4BY1 B;  5KYL A;  3A0J A;  2EYH A;  5HGT A;  5EJW A;  3T13 A;  3A8I E;  1CFM A;  3I7F A;  2RDF A;  2Q2I A;  4JK1 C;  4IFD I;  4BY7 G;  4K2K A;  1TWF B;  2F0V A;  1WYD A;  4C2M H;  4P73 A;  2BE5 C;  4GOP A;  1PA6 A;  1E22 A;  4GKJ Q;  1HQM C;  1EY0 A;  3GD7 A;  3PO2 G;  4OO1 I;  5IGG A;  4PZ7 A;  4QIW B;  2CW0 D;  3RD4 A;  5I6Y A;  1Y14 B;  4DR1 Q;  3IKJ A;  4IAL A;  3NTK A;  3I72 A;  1GUW A;  1EY9 A;  1SSO A;  2O2L D;  3KF6 B;  4BXX H;  3N6R A;  2NVQ B;  4HID A;  4RCO A;  1V1P B;  3RLN A;  4A3J H;  1I4R A;  1D2B A;  4KMU C;  1BCP C;  1CZG A;  4DUZ Q;  3GTJ H;  4JG2 A;  4NP5 A;  1KQS A;  3G71 A;  3UDF A;  1SYE A;  1G91 A;  3D4D A;  1F2Z A;  1K83 H;  3QR8 A;  4QUC A;  3ICE A;  2OQK A;  1JOO A;  1SNC A;  4EQP A;  5ISR A;  5IY0 A;  3D31 A;  5FO7 B;  4IOA A;  1EQT A;  2LXK A;  2F0N A;  3STB D;  3CCS A;  4R4Q A;  1L1O B;  3OOC A; 
#chains in the Genus database with same CATH homology
 3G6E A;  4BBS G;  3PCO B;  4UP9 A;  1WI5 A;  4H02 A;  2UUC L;  3GTG H;  2AWN A;  1X3F A;  3M4Q A;  3OTO L;  1HNX L;  1UE6 A;  4B3T L;  4K0K L;  1X3E A;  1CKO A;  4A3I H;  4UY8 C;  4J15 A;  4QJF A;  1KD1 C;  1Y1V H;  4LF8 L;  4X62 L;  5GQO A;  1CKN B;  1XNR Q;  1VQ9 A;  2NVQ H;  4AYB G;  4UPA A;  1NY4 A;  1Q1E A;  4YY3 L;  5IWA L;  4A76 A;  1XMQ Q;  2CCZ A;  1VQ4 A;  1JT8 A;  4YCW A;  5AJ3 L;  1HNW L;  4LF6 Q;  3CCQ A;  2D0O A;  1WCM G;  3LGJ A;  1HNW Q;  3ULJ A;  2JA6 G;  5GAD C;  3FKI G;  3CC4 A;  2K4K A;  2NZO A;  4C3H H;  1VQI A;  1YI2 A;  1N36 Q;  3GDE A;  2JA8 H;  4O0A A;  2K5V A;  3CCE A;  4B3S Q;  3I4N H;  4HIM A;  2JA5 H;  3PGZ A;  5LMU L;  3UDI A;  4GN4 B;  2VW9 A;  1YJ9 A;  1J5E L;  4GN3 B;  2A8V A;  5M3M G;  2VQF L;  4JOI C;  4C3J H;  4EQ5 A;  3CF5 A;  1P8L A;  2BH2 A;  4JI8 Q;  1PH1 A;  4PMW A;  3S17 H;  3G48 A;  1VQE A;  2R6G A;  4A93 H;  1OXT A;  1TWH H;  5M3F H;  1XPU A;  4QGU A;  3GTM H;  4HJ9 A;  1U5K A;  2ES2 A;  1WJJ A;  2N78 A;  3AYH B;  4OON A;  2GVA A;  4HJA A;  1PH7 A;  3W1B A;  1VQB A;  2E2J H;  3S16 H;  2KHI A;  4HIO A;  5JJI A;  4GKK L;  2RCN A;  4YWM A;  1MJE A;  3ERS X;  1PH8 A;  3U50 C;  1VQ5 A;  1K3R A;  2XGT A;  1S72 A;  2ZTC A;  4MNO A;  4DR4 L;  5C44 H;  1V43 A;  1I3Q H;  3OYY A;  3I55 A;  1QZH A;  4L5Q A;  3I4O A;  4JI3 L;  1GO3 E;  3HOU H;  2F3I A;  5FJ8 G;  4JI5 Q;  1MJC A;  1I94 Q;  4YCU A;  2Q2H A;  3K7A H;  4P75 A;  1Q82 C;  1NMG A;  2ALY B;  1N34 Q;  5M5X H;  4A3D H;  3RLF A;  1XNQ Q;  1YJN A;  2VL6 A;  2UU9 L;  2ZM6 L;  2JE6 I;  3FP9 A;  1I5F A;  4GLX A;  4DKA C;  3PUW A;  2JEA I;  2VZA A;  4LUZ A;  3H3V I;  1X65 A;  2UU9 Q;  3ULL A;  5C3E H;  4NXM L;  1IYJ B;  4X65 Q;  3CCM A;  2MNA A;  4LUO A;  3WWV A;  4DR7 Q;  1XJV A;  1C7Y A;  5LMN L;  4GNX C;  3HOZ G;  2PI2 E;  4A3E G;  3Q8D A;  4DV0 Q;  2CFM A;  3PO3 H;  3H0G H;  4JBK A;  1L2F A;  4LF5 Q;  1X6O A;  4A3B H;  3G4S A;  4NXN Q;  3CW2 C;  4A75 A;  1LTL A;  2UXD L;  1HZC A;  2XTI A;  4GKJ L;  3CQZ H;  3HKZ G;  4DV1 L;  1IBK L;  1Q8K A;  3GTQ H;  3S2H H;  1XPR A;  3DLL A;  1AH9 A;  1IBK Q;  1HR0 L;  4GNX A;  1IBL Q;  1JJC B;  1N33 L;  4A3K H;  1VQ6 A;  3KFU A;  3E0E A;  3CCR A;  2OCE A;  3HOW H;  1HZA A;  2FXQ A;  3K80 C;  4JI2 Q;  3A5U A;  1VQ7 A;  3AFQ A;  1N33 Q;  3HOV G;  5C4J H;  2DGY A;  4DAM A;  4XIG S;  1YZ6 A;  4DR2 L;  4BY7 H;  4X66 L;  1V9P A;  5K36 G;  3J80 c;  1EYG A;  2D0P A;  1JB7 A;  1LUZ A;  5IYB G;  4DUZ L;  1E24 A;  4JCV E;  2NVX H;  5FLX c;  2BA0 A;  3JAM i;  4LW1 A;  3HOY H;  3M3Y H;  4A3L H;  2MO0 A;  1HR0 W;  5IT9 c;  2I5M X;  3F2C A;  1IL2 A;  3GTP H;  3NEL A;  1VQK A;  4DK3 C;  4R4T A;  2NVT H;  4LFB L;  1JJG A;  3VDY A;  3I4M G;  1EIY B;  1PH3 A;  2ID0 A;  3STB C;  4LFB Q;  2HQL A;  2UUB L;  4GLV B;  3BZK A;  5IP9 G;  2R7D A;  5IYD H;  2A19 A;  5JJK A;  4AQY Q;  2RHQ B;  1QUQ A;  4L5T A;  1PV4 A;  2KHJ A;  1DGS A;  4GLA C;  1PH9 A;  5GAE C;  4DR5 Q;  1KHI A;  2MQH A;  3W5O A;  4DUY Q;  1UE5 A;  3HKZ E;  4DV2 Q;  4L5R C;  2B63 G;  1Y1W G;  3PUY A;  4GOP B;  5C0X J;  1VQG A;  2A1A A;  3HFZ B;  3KYH C;  1XMO Q;  1XNR L;  5GAG C;  3S1N H;  1YNX A;  4JI4 Q;  1HJP A;  3CP0 A;  4A3C H;  1UE1 A;  3AQQ A;  1KAW A;  1E1T A;  2WAQ G;  1X9N A;  2ZJR A;  1XMQ L;  4A3G H;  3GTL H;  2Y0S G;  3PUX A;  4HJ7 A;  4JI6 Q;  4LF6 L;  3TS0 A;  4DV7 L;  4HIK A;  1CSP A;  3CPW A;  3H3V H;  1N32 Q;  2OTL A;  2VQE Q;  1N36 L;  1KRT A;  1EQR A;  4KHZ A;  4DV7 Q;  3PF4 A;  4EX5 A;  3TQY A;  1Z47 A;  2WB1 G;  1K9M C;  2ATW A;  2R7Z G;  5DLQ E;  1KXL A;  4DV4 Q;  1E7Z A;  3GTO H;  1YEZ A;  4DPG A;  4B3S L;  2UXC Q;  1A8V A;  4BBS H;  5IYC G;  1TWA H;  1N8R C;  2PQA B;  2OQ0 A;  2JK8 A;  3F2B A;  1D8L A;  4IOC A;  4OX9 Q;  2OTJ A;  2ZTE A;  4HJ5 A;  2H5X A;  3B6Y A;  2CWA A;  2GN5 A;  2Z6K C;  3NEM A;  4JI8 L;  1YHA A;  3PIP A;  1YHQ A;  1B8A A;  1Q46 A;  4DK6 C;  4OWW B;  4LNQ A;  2EIF A;  1FJG Q;  4POF A;  3MEF A;  3DM3 A;  3TRZ A;  4JBW A;  5FLM G;  4JYA Q;  5ELO A;  5IP7 G;  1CUK A;  2D62 A;  4QIW E;  1JJ2 A;  4YWK A;  5BR8 L;  2YYZ A;  4YHH Q;  1WCM H;  1HH2 P;  1N9W A;  4QL5 A;  2JA6 H;  3FKI H;  3KF8 B;  5BR8 Q;  1VS0 A;  4IJL A;  1I50 H;  4BA1 I;  2Z6K A;  4MTN A;  2R93 G;  1TXY A;  2ZTD A;  4KHP Q;  3M7N A;  4DV5 Q;  2WAQ E;  2HIV A;  3GO5 A;  4MZ9 A;  2Y0S E;  4KLK A;  1X56 A;  3CD6 A;  2I5L X;  1VQ8 A;  4LFC Q;  1P16 A;  2IY5 B;  2JQO A;  4JI5 L;  4A3F G;  4JV5 Q;  4A3M G;  3SGI A;  1I94 L;  5M5Y H;  4LF7 L;  5E7N A;  5M3M H;  1N34 L;  4P74 A;  1JMC A;  3EBE A;  2IX1 A;  2JA7 G;  3RN2 A;  4IPD A;  4JI7 Q;  4X64 Q;  1XNQ L;  3K81 C;  4POG A;  4LF7 Q;  2I5H A;  2WB1 E;  4R1J A;  4JI1 L;  2NN6 G;  1BKB A;  4P72 A;  1Q1B A;  4LF4 Q;  1Q7Y C;  3F8T A;  2AMC B;  3T1H Q;  1TWC H;  1VQP A;  3PUZ A;  1B7Y B;  1BVS A;  1V1Q A;  4JI1 Q;  3K8A A;  1W2B A;  1GM5 A;  2KCM A;  3A74 A;  4ME3 A;  4X65 L;  1YJW A;  4DR7 L;  1X3G A;  1YIT A;  1HZB A;  3FHW A;  1VQM A;  2K14 A;  5HY6 A;  4DV0 L;  3KF6 A;  1KRS A;  4LF5 L;  1K73 C;  2R92 G;  1CSQ A;  4NXN L;  3KJO A;  1U0L A;  3J81 c;  1K8G A;  3HOX G;  1VQC A;  5FJ8 H;  4LF9 Q;  1C9O A;  1PHJ A;  2QA4 A;  4PZ8 A;  3CAM A;  4AIM A;  1ASZ A;  1L1O C;  3CME A;  1EIF A;  1NE3 A;  3KDF A;  1GVP A;  1AE2 A;  3ULP A;  1Q12 A;  2HHH Q;  1G51 A;  1IBL L;  4B3R Q;  2VUM G;  4BBR G;  3RNU A;  3J81 j;  4KI0 A;  3H15 A;  4DV3 Q;  2IT1 A;  5LMN W;  1C0A A;  2CQO A;  4DV6 Q;  2K50 A;  3F2D A;  4ALP A;  3RZD H;  4JI2 L;  1VQN A;  2UXB Q;  2AWO A;  2E5L Q;  1UWV A;  1OXX K;  3ZJY C;  5GRO A;  3CCJ A;  1YIJ A;  1QVG A;  1ASY A;  3S1Q H;  4BXX G;  4APV A;  1D7Q A;  2IX0 A;  4RG1 A;  4QQB X;  1L1O A;  3HOZ H;  2KBN A;  4A3J G;  4BY1 G;  3HOY G;  1SE8 A;  2EXD A;  1HNZ Q;  1CKM A;  2CKZ B;  1PVO A;  1PYB A;  2QGQ A;  1GD7 A;  1PYS B;  1VQJ A;  3NEN A;  2K5N A;  4DNI A;  3PF5 A;  1EFW A;  1CKN A;  1OXS C;  3T1Y Q;  2Q2T A;  4LFA L;  2GVB A;  1IBM Q;  4AQY L;  1KC8 C;  5IYD G;  1WOC A;  2MO1 A;  4JI0 L;  3GTK H;  3A5Z B;  4LFA Q;  3PO2 H;  3KLW A;  2VNU D;  1EWI A;  4DR5 L;  1VQL A;  4JI0 Q;  1X55 A;  4DUY L;  1R9T H;  3CC2 A;  2PMZ E;  4DV2 L;  3S15 H;  2JEB I;  3JC6 6;  2L15 A;  1VQA A;  2YTX A;  4PZ6 A;  1PFS A;  3M4P A;  5IYB H;  5HGQ A;  3J80 i;  3L2P A;  5C0X G;  4UP8 A;  2K75 A;  3EIV A;  1XMO L;  3BU2 A;  1PH6 A;  4JI4 L;  4A3I G;  2YU9 H;  5C4X H;  3K7U C;  2R7F A;  1M90 C;  1EUJ A;  3J7Z C;  1SFO H;  1Y1V G;  2F4V Q;  1FGU A;  4DR6 Q;  4A3C G;  1A63 A;  4OWT B;  1OXV A;  4JI6 L;  3E9I A;  1YVC A;  3I4M H;  3L0O A;  2VY3 A;  1TWG H;  4AH6 A;  1TWF H;  1A62 A;  3PSI A;  2NN6 I;  4B3M L;  2Z0S A;  5IP9 H;  1N32 L;  1Z9F A;  2VQE L;  1FVI A;  4TVA B;  1E1O A;  3UDX A;  1WFQ A;  2ZJP A;  1O7I A;  4B3M Q;  3AEV A;  4X6A H;  2LSS A;  2YV5 A;  3TEH B;  4DV4 L;  4FDB A;  4R4I A;  1YHB A;  1KL9 A;  2UXC L;  5JEA G;  2Q2U A;  4Y7N H;  2JA8 G;  4IFD G;  3OW2 A;  4NB3 A;  5JEA J;  4OX9 L;  3CC7 A;  2E2H H;  2ZJQ A;  3IRB A;  2BH8 A;  2B63 H;  4IFD J;  1XTD A;  3CPF A;  1Y1W H;  3I4N G;  3NBH B;  2JA5 G;  1YBY A;  2UUC Q;  3OTO Q;  1HNX Q;  2YTY A;  1Q81 C;  4B3T Q;  3PIO A;  2RHS B;  3I56 A;  5H1S E;  3KJP A;  1IZ6 A;  1AE3 A;  4PG3 A;  2I0Q A;  4K0K Q;  1QVC A;  2F52 A;  1UE7 A;  4IJH A;  4NPS A;  3J7A 5;  4JYA L;  4LF8 Q;  4X62 Q;  1UEB A;  5ELN A;  4A93 G;  2N8N A;  1X54 A;  4YHH L;  2CWP A;  4OO1 G;  4XTC S;  5M3F G;  4YY3 Q;  4WJ4 A;  3K0X A;  1QUQ B;  5IWA Q;  4P71 A;  2OWO A;  1FJG L;  4Y52 H;  3ER0 A;  1NTG A;  5AJ3 Q;  3U58 A;  3S1R H;  4L5S A;  1L0W A;  3W1G A;  4KHP L;  4DV5 L;  2R7Z H;  4DAY B;  1PH5 A;  3PO3 G;  1XPO A;  3UE1 A;  4R4O A;  4LFC L;  2EQS A;  3PV0 A;  2N49 A;  5EAY A;  4JV5 L;  5IYC H;  5C44 G;  3S1M H;  2YTV A;  3CCV A;  1SLJ A;  3CXC A;  3M85 A;  1VQF A;  3HOU G;  1MKH A;  3S24 A;  4X64 L;  4JI7 L;  2B29 A;  1OXU A;  3PUV A;  5LMU Q;  1J5E Q;  2K52 A;  2N3S A;  4LUV A;  2VQF Q;  4LF4 L;  4A3D G;  3T1H L;  4A4I A;  5FLM H;  1RL2 A;  3MXN B;  5IP7 H;  2NVY H;  4YCV A;  1EOV A;  2JA9 A;  3I2Z A;  3S2D H;  4YWL A;  5C3E G;  1VCI A;  1W3S A;  5GAH C;  2PNH A;  1I6H H;  1SN8 A;  2UXB L;  2E8G A;  4JOI A;  2R93 H;  3EN2 A;  2KCT A;  5M5W H;  3U4Z A;  4AYB E;  3CCU A;  1PH2 A;  1OTC A;  4GKK Q;  4OXP A;  1NMF A;  4GS3 A;  2QEX A;  1E3P A;  3D0F A;  4C3I H;  5C0X I;  4JBM A;  4LF9 L;  1QVF A;  2C35 B;  3H0G G;  3M9B A;  3UDG A;  2VS1 A;  4A3F H;  4A3M H;  3CCL A;  1BBW A;  4A3B G;  4QY7 A;  2E2I H;  2B3G A;  2HT1 A;  4DR4 Q;  1IXR A;  4JI3 Q;  2JA7 H;  4IPC A;  4HJ8 A;  1GKH A;  2HHH L;  3E9H A;  4B3R L;  4DV3 L;  1K8A C;  1QZG A;  1A0I A;  1S3O A;  4DV6 L;  4GOP C;  3F1Z A;  2ZM6 Q;  4A3K G;  2E5L L;  3A0J A;  4JC0 A;  2HIX A;  1LYL A;  2DUD A;  1G6P A;  1LM0 A;  3CMA A;  4IO9 A;  3I7F A;  4UP7 A;  1J6Q A;  2ASB A;  3HOW G;  1JE5 A;  2V1C C;  2Q2I A;  4NXM Q;  4IFD I;  1EQQ A;  4TQU S;  4BY7 G;  2UUA L;  1MIU A;  3RZO H;  4C2M H;  1WYD A;  2R92 H;  4O2D A;  3JAM c;  5LMN Q;  4P73 A;  4A3E H;  1HNZ L;  2AKW B;  3KOJ A;  3HOX H;  3J81 i;  2UUA Q;  4A3L G;  3RR5 A;  4GOP A;  3S14 H;  1KIX A;  4DR3 L;  3AFP A;  3T1Y L;  5JJL A;  1PA6 A;  2K5H A;  1E22 A;  1IBM L;  1RIP A;  2UXD Q;  3TRE A;  4LWC A;  4GKJ Q;  2JJQ A;  3HKS A;  3GD7 A;  4DR1 L;  4DV1 Q;  4DR3 Q;  2VUM H;  4BBR H;  1Q86 C;  1SMX A;  3PO2 G;  1NBW A;  4PZ7 A;  4OO1 I;  1Y14 B;  3RLO A;  4DR1 Q;  2IHF A;  1HR0 Q;  4OWX B;  3BZC A;  4BXX H;  1NJI C;  3KF6 B;  1VQH A;  3HOV H;  2AHO B;  4HID A;  2PI2 A;  2RF4 A;  4JBJ A;  1S40 A;  3RLN A;  4A3J H;  4BY1 H;  4DR2 Q;  4X66 Q;  2F4V L;  2PQA A;  5IE8 A;  4DR6 L;  1SRO A;  4DUZ Q;  3RN5 A;  4BA2 I;  1FL0 A;  2KEN A;  5C4X G;  4IPG A;  3TS2 A;  3L7Z C;  4WJ3 M;  1BBU A;  3GTJ H;  1H95 A;  1VQD A;  3KDF B;  4A3G G;  4JG2 A;  1VQO A;  2NZH A;  1KQS A;  2MFI A;  5J3B A;  3G71 A;  3UDF A;  1PH4 A;  2IHE A;  1K83 H;  4IPH A;  3BJU A;  4GNX B;  1K0R A;  3ICE A;  2LXJ A;  2UUB Q;  2OQK A;  2WFW A;  1B70 B;  3U4V A;  1G29 1;  1HZ9 A;  1SRU A;  2BA1 A;  3UE0 A;  3D31 A;  5IY0 A;  3M4O H;  4IOA A;  1T9H A;  2LXK A;  3STB D;  3CCS A;  4GN5 A;  4R4Q A;  4RMF A;  1L1O B;  1SR3 A;  2WP8 J;  4R4C A;  1M1K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...