5LMUL

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5lmuL00
2UXCQ 1J5EL 4JBMA 2ZJPA 2C35B 4JI8Q 5H1SE 4DKAC 2GVBA 2YV5A 1C0AA 3NBHB 5J3BA 5M5WH 1V43A 2K5HA 3AQQA 1XMQQ 2I5LX 1X65A 5LMUL 3GTGH 3T1HQ 2E5LL 2IX0A 2FXQA 1S3OA 3ICEA 2JA6H 1L1OC 2UXBL 1H95A 2VQFL 4ALPA 2Q2IA 1CSPA 5IY0A 4NXML 1PYSB 4AQYL 1KHIA 3BZKA 4NPSA 5EAYA 3UDFA 2R7FA 4C3IH 2K50A 4DV3L 4BY1H 4JOIA 3J81j 3NENA 3HOZG 1IBKL 4JI5Q 1A63A 3TEHB 2E2IH 1JB7A 3HKZE 4K0KQ 1CKNA 1E24A 2LXJA 4A3IH 4B3TQ 4MZ9A 4A3CG 4PZ6A 1PH6A 1SN8A 4DR1Q 3CF5A 1HZAA 1FGUA 2UUCL 4A93H 5E7NA 2ZJRA 2ATWA 3G71A 4A3GG 4A3DG 3ZJYC 4IO9A 2VY3A 1N32Q 4A4IA 3OTOQ 4DR5Q 4JV5L 2RF4A 4MTNA 5JEAJ 1VQHA 4Y52H 1UE5A 1NTGA 1SE8A 2IT1A 2Y0SE 3NELA 1Q46A 2WAQG 1OXSC 4JBJA 4TVAB 4PMWA 4C3HH 3ER0A 3I55A 5LMUQ 3PF4A 3M4QA 3G4SA 1XNRQ 4JCVE 4NXMQ 4OWWB 2UU9L 1CKMA 4DV3Q 1Y1VH 5ELNA 1SR3A 4O2DA 1PH5A 2JA6G 2JA7G 3GTLH 3DLLA 3CC2A 3J80i 4JI7Q 1PVOA 4X65L 1PH7A 4BY1G 1HZ9A 4DR3Q 4J15A 1CUKA 1BKBA 1LYLA 1O7IA 2MO1A 4AIMA 1OXXK 4MNOA 3J81c 3HOXH 1NY4A 2JJQA 4DR2Q 2UUCQ 3S2DH 4DAYB 2ZTCA 5C44H 4A3IG 4A3KH 4R4QA 4LFAL 4BBSH 5IYDH 2A19A 5IT9c 5K36G 1K8GA 3MXNB 4DV5L 2WB1E 1VQPA 2Q2TA 2Z6KA 2R7DA 1D7QA 3TS0A 3J7A5 1Z9FA 4IJLA 3PIPA 4DR7L 1E3PA 2IHEA 5LMNW 1X6OA 2UUBL 2VUMG 3PF5A 1S72A 3CD6A 3S1NH 3K8AA 4DV4L 2EXDA 1LM0A 1RL2A 4KHZA 3L2PA 3PGZA 2IY5B 2CWPA 4KHPL 1CKNB 2HQLA 1X9NA 1M90C 3AEVA 2K5NA 4EQ5A 2R92H 1WYDA 2VS1A 2VQEQ 2IX1A 4BXXH 4JYAQ 2AHOB 1X3EA 3TS2A 4JI1L 3DM3A 1K8AC 4JI0L 1U5KA 3JC66 4POGA 1Y1VG 3CCJA 4LUOA 1SFOH 1SLJA 1VQJA 2A1AA 3S24A 3JAMi 4DUZL 1WOCA 4Y7NH 2ZM6L 5C0XG 3STBC 3L7ZC 3S14H 3T1YL 4UY8C 1L1OB 1UE1A 3PUYA 5IYDG 5C44G 4A3KG 4JYAL 4O0AA 1N33L 2PI2E 1PYBA 1YITA 1VQNA 4HJ5A 2N8NA 5GAEC 4LF8Q 1K9MC 4LF9L 1ASYA 5GAHC 1YHBA 3F2BA 2JK8A 4DV6Q 1XNQQ 3HOUH 4DR4L 2NN6I 1JJGA 2QGQA 1HNZL 4A3FH 2NZOA 5DLQE 4KHPQ 5LMNQ 4DV1L 1EQQA 5AJ3Q 4OO1I 4LF4Q 1LUZA 4AYBE 1OTCA 2NVYH 5GADC 2B3GA 2VL6A 1TWCH 4A3LG 2R92G 4PZ8A 4R1JA 1XPOA 1YNXA 1VQ4A 3RZDH 1MJEA 4JI0Q 2CFMA 2CKZB 3F1ZA 1VQBA 3J80c 1NE3A 4BXXG 2VNUD 5JJLA 1EOVA 1V9PA 2HIVA 2XTIA 3I7FA 4DPGA 4GLXA 3VDYA 3W5OA 3S15H 3FHWA 3S1MH 3A74A 5JJKA 3I4MG 1VQIA 3PCOB 3GTOH 4JOIC 2ZM6Q 4DV7Q 3K81C 4JI3L 2I5HA 1VQKA 1IBLL 1WJJA 1HNWQ 2N78A 4LF6Q 3PUWA 3U4ZA 4JG2A 1YEZA 1N33Q 3H15A 4LF5Q 3GTKH 1C9OA 4ME3A 2GVAA 4X62L 3G48A 4OXPA 2CQOA 4LF9Q 1E1OA 2JEAI 2UUAL 3S2HH 4GN3B 1HH2P 1V1QA 1XMOQ 1HNZQ 1N9WA 5M3FH 4GLAC 1QVGA 3GTQH 2MQHA 4RG1A 4GN5A 2KCMA 2YYZA 4DK6C 1XJVA 4A3LH 5FJ8H 2ZTEA 4OX9L 3HOUG 3OW2A 4A3FG 1I94L 3CCRA 4APVA 1TXYA 3BJUA 2JA7H 3U4VA 2R93H 2PI2A 4GS3A 4QIWE 3CCUA 1KD1C 1TWFH 3F2DA 4TQUS 3KOJA 1DGSA 1MIUA 4DUYQ 1YIJA 3Q8DA 3S17H 1HR0L 4JI3Q 3JAMc 4XTCS 1Q12A 1QZGA 4X64Q 2LXKA 4DR6Q 4JBKA 3A5UA 4JI6Q 4BA2I 1RIPA 1IYJB 4YHHL 4R4OA 2GN5A 4IPCA 4L5QA 4BY7G 3A0JA 2UUAQ 3EBEA 1K83H 2OQKA 4R4CA 1J5EQ 4B3SL 3KDFA 2VUMH 2Z6KC 4HJ8A 1KRTA 4FDBA 3CMEA 5M3FG 3I2ZA 3D0FA 5IE8A 2HHHL 5FJ8G 1Q82C 2E5LQ 3CCVA 3S1QH 3H3VI 2UXBQ 3CCMA 4WJ4A 3EIVA 2VQFQ 2PMZE 4KI0A 1Q81C 4AQYQ 2N49A 3FP9A 2F4VL 2E8GA 4LFCL 2R93G 1PH1A 1E7ZA 4IPDA 2OTLA 1IBKQ 1EIYB 4L5TA 1WCMH 2A8VA 1B8AA 4HIKA 1N36L 5ELOA 2AMCB 4EX5A 1XPRA 2RCNA 4UP9A 1GO3E 5GROA 1VQ7A 1X3FA 3HOYH 2R7ZH 4YY3L 3W1GA 1XPUA 1BBWA 2MO0A 2WAQE 1TWAH 1AH9A 3GTPH 2F3IA 3K80C 3KF6A 2WB1G 3CQZH 4JV5Q 3AFQA 1CSQA 3BZCA 3GTMH 1AE3A 2QEXA 2KENA 4UPAA 4JI2Q 1VQAA 3S1RH 2HHHQ 4R4TA 4UP8A 5M5YH 4JBWA 3U50C 1BVSA 1NMFA 3PUVA 3RLOA 3RN2A 3SGIA 1G291 1VQ8A 2NVQH 2BH8A 4LUVA 2JE6I 2KBNA 3K7AH 4A3EH 4YCVA 2UU9Q 2UXCL 1T9HA 4A75A 1AE2A 5JJIA 2UXDL 1JJCB 4X66L 3CPFA 3E9IA 4X65Q 4LNQA 3I4MH 1B7YB 2NN6G 2RHSB 1EUJA 1WI5A 1OXUA 3GTJH 4B3ML 4HJ9A 1HNXL 1WCMG 3K0XA 4LFAQ 2F52A 3G6EA 3M4OH 3RN5A 4DV0L 4NB3A 5BR8L 3ERSX 3PUZA 3HOYG 5IWAL 2Z0SA 2K52A 2R7ZG 4DV5Q 4IPGA 2YTXA 1PH2A 4LFBL 4GKJL 2EIFA 1A0IA 5IP9G 1A62A 4GKKL 4DR7Q 2KHJA 2D0OA 1K3RA 2UUBQ 3RR5A 5HGQA 4YWKA 1OXVA 3I56A 5JEAG 4DV4Q 1MJCA 4HIDA 3HOVG 1KXLA 1X55A 1PFSA 1IXRA 1K0RA 2WP8J 2AKWB 3D31A 1QUQA 4X6AH 2LSSA 3CCSA 1VQDA 4JI1Q 3PO3G 5M5XH 1N8RC 4A3EG 4GOPC 4YWMA 4B3RL 2ALYB 4IFDI 1U0LA 4B3MQ 4DK3C 5C3EH 3H3VH 4P71A 4DUZQ 2ZTDA 3AFPA 1TWGH 1YBYA 1YHAA 1Q86C 3M3YH 2CWAA 2JA5G 2B29A 4DV0Q 3PO2H 3CCQA 3T1YQ 1QZHA 2AWOA 2YTYA 2ID0A 4JC0A 1VCIA 5C4JH 4BY7H 1KQSA 2K4KA 3F2CA 1Q1EA 2OQ0A 3UDXA 1KIXA 1JJ2A 1D8LA 1X56A 3OYYA 5FLXc 3AYHB 3GD7A 5IYBH 3PSIA 2K75A 1FL0A 3WWVA 1TWHH 2K5VA 5C0XI 1XMQL 1PH4A 4DR4Q 3T1HL 5IP7H 1I5FA 2XGTA 3J7ZC 1Y14B 4DV1Q 2KCTA 1UE7A 3A5ZB 3UE1A 2JQOA 1KC8C 4QL5A 3CAMA 3HFZB 3UDIA 3NEMA 4JI5L 4GOPA 1YJNA 1Y1WH 1SRUA 1HR0W 4K0KL 3J81i 4YCUA 1W2BA 2IHFA 1PH8A 4P74A 3M85A 4DR1L 1EIFA 2I5MX 2OTJA 2RHQB 1IBLQ 1MKHA 1VS0A 5C3EG 1SROA 1IL2A 1N32L 3HKZG 3OTOL 3UDGA 4JI2L 3PO2G 4X62Q 5FLMH 1QUQB 4DR5L 4IJHA 1B70B 3TREA 1FJGL 3CPWA 4OWXB 4IFDJ 2I0QA 2E2HH 4DNIA 1I6HH 5GAGC 5IYBG 1XNRL 3PV0A 1W3SA 1NMGA 4LUZA 1HZBA 3CW2C 5IYCH 4LF7L 3KJOA 1S40A 4OX9Q 5IP7G 1QVFA 2KHIA 2L15A 1I94Q 1E22A 4BBRH 2NZHA 4A3MH 3W1BA 1UEBA 4DV2L 1GD7A 2Y0SG 4JI7L 2NVTH 1EQRA 4AH6A 5M3MH 2Q2UA 1C7YA 2PQAA 2H5XA 2BH2A 3M9BA 1YZ6A 2DUDA 2JA9A 4DR3L 5C0XJ 1K73C 3I4NH 5GQOA 1M1KC 1Q8KA 1Y1WG 1HNWL 4GNXC 4DR2L 2B63H 1HR0Q 4UP7A 4OONA 1Q1BA 4NXNL 1LTLA 1PHJA 1KAWA 1EFWA 3CMAA 1L2FA 3U58A 2QA4A 4KLKA 2ZJQA 3FKIH 4C3JH 1J6QA 4YHHQ 3CXCA 4IOAA 3CC7A 1FJGQ 3E0EA 1FVIA 1I50H 2EQSA 5FLMG 4GOPB 5IP9H 1EYGA 4B3SQ 1X54A 1L1OA 3H0GH 1BBUA 3K7UC 4YWLA 2YU9H 1KL9A 4LF7Q 3S16H 3EN2A 2VQEL 3RLFA 1P16A 4DAMA 3HOVH 3CCLA 2CCZA 2ES2A 4HJ7A 3TRZA 3KF8B 1PV4A 1UWVA 4DV2Q 4POFA 5IYCG 2E2JH 2VW9A 4A3JH 1VQLA 4YCWA 5C4XH 2MNAA 4BBRG 1N34L 3I4OA 4A3MG 4BA1I 3ULJA 2F4VQ 4QJFA 5M3MG 4LFCQ 4GNXA 1GVPA 4JI4L 1E1TA 4QQBX 3I4NG 3HOWH 1PA6A 2BA0A 3CCEA 4NXNQ 1QVCA 3M4PA 4LWCA 3KDFB 1N36Q 2B63G 4A93G 2JA5H 1ASZA 4OO1G 2VZAA 4YY3Q 4LF8L 1VQGA 1R9TH 4P72A 1PH9A 2R6GA 4GLVB 3RNUA 1OXTA 3FKIG 4DV6L 1L0WA 1HJPA 1XNQL 4IFDG 2PQAB 3ULPA 5LMNL 5HY6A 3GDEA 5AJ3L 1G6PA 2DGYA 1IBML 1XTDA 4PZ7A 1VQ9A 4LF4L 3M7NA 2K14A 1VQMA 3H0GG 4PG3A 3L0OA 4HIOA 2N3SA 4IPHA 4H02A 1VQ6A 1N34Q 4OWTB 1GKHA 1Q7YC 1YHQA 3TQYA 1Z47A 3B6YA 4A3JG 1YJWA 4AYBG 1NBWA 3HKSA 1JMCA 2UXDQ 4X66Q 5C4XG 4HIMA 2AWNA 1VQFA 4DV7L 4JI4Q 1P8LA 2Q2HA 3HOXG 2HIXA 1IZ6A 4P75A 1SMXA 2WFWA 3UE0A 1NJIC 4LF6L 2JA8H 3KF6B 1HNXQ 4BBSG 3BU2A 3HOWG 4GN4B 4LF5L 3STBD 4A3BH 2PNHA 2OWOA 2BA1A 1YJ9A 2NVXH 1GM5A 5BR8Q 1I3QH 1KRSA 5IWAQ 1VQCA 3PIOA 3E9HA 3CP0A 1XMOL 4QY7A 4LW1A 2OCEA 3KJPA 4JI8L 1A8VA 3RLNA 4LFBQ 1IBMQ 4RMFA 1HZCA 4XIGS 1VQEA 3ULLA 4HJAA 4GKKQ 4GNXB 1JT8A 4C2MH 2D0PA 2HT1A 3KYHC 4R4IA 2ASBA 3PO3H 3F8TA 4QGUA 3PUXA 3IRBA 1VQ5A 3HOZH 3CC4A 3KLWA 4WJ3M 4L5RC 2YTVA 1VQOA 1G51A 4DUYL 2MFIA 1X3GA 4A3CH 1PH3A 1YVCA 4P73A 4IOCA 4A76A 4B3RQ 4X64L 1JE5A 2JEBI 4L5SA 1WFQA 3KFUA 4DR6L 4B3TL 1EWIA 1YI2A 4JI6L 4A3GH 4A3DH 1UE6A 4GKJQ 3LGJA 2JA8G 3MEFA 3RZOH 2V1CC 1CKOA 3GO5A 2D62A 4A3BG
chains in the Genus database with same CATH superfamily
1J5EL 1GUTA 5IIFA 4TSSA 3JAME 5A2QL 4N9TA 1PRTD 1PTOH 5IGDA 1STHA 5J3BA 1PTOB 1CQFA 1V43A 1RF2D 3E6ZX 2HCIA 5LMUL 1EU3A 3HZXA 3ICEA 2IX0A 1S3OA 2JA6H 1FR3A 2VQFL 2ENBA 5IY0A 4NXML 2JA6B 4DNRB 1KHIA 3HS0C 4NPSA 5EAYA 1A3UA 4BY1H 4JOIA 3J81j 4BY1B 1S5ED 1JWUD 3GV6A 4BBRB 1BF4A 3HKZE 4PV1C 4A3CG 4A93H 3M4YA 3X3MA 4A93B 4A3DG 3U9OA 2PO4A 3K5LA 1WVLA 4A4IA 3OTOQ 4OHJA 1G91A 1CM9A 4JV5L 2RF4A 2ZXOA 1Q3LA 4MTNA 5JEAJ 1UE5A 1NTGA 2Y0SE 4EQOA 3VYTA 4JBJA 3MHBA 5LMUQ 4K14A 4C3HH 1O7ZA 3T13A 3G6JB 3OMGA 4NXMQ 3H0GB 1H9MA 2Q8RE 5JJZA 3S16B 3A54A 3DLLA 5K5PA 5A2QE 2BOSA 4XDXA 1BNZA 2F03A 1HNWQ 1LYLA 1O7IA 2MO1A 2O2LD 4MNOA 4AIMA 3J81c 1NY4A 4DAYB 2ZTCA 4A3KH 2DY7A 4LFAL 4BBSH 5EGTA 4A3KB 4BBSB 5I6WA 1PMRA 5K36G 5FO8B 2Z6KA 2TSSA 4OL7A 3TS0A 5KIXA 4UAIA 4O42A 3QOJA 3K8AA 3G7LA 2EXDA 2HUGA 4KHZA 1ILPA 3HGBA 5D3DA 1R4PB 4K5VA 2OXPA 1SXTA 3TS2A 1PRTB 4DAVA 1K8AC 1U5KA 2OEOA 4POGA 3P75A 4LUOA 1SFOH 5EKIA 1SLJA 2Z4IA 1SFOB 1QJOA 1BDOA 3NUCA 1WOCA 4Y7NH 3ITPA 4Y7NB 3GP7A 3L7ZC 1A6XA 1L1OB 3PUYA 4O0AA 1N33L 2PI2E 4HJ5A 4DNTB 4CDDC 5G3LD 1E2VA 1K9MC 3J7YW 3KLSX 4R8NA 4JPBW 1DXMA 2F1MA 4FF4A 1HQRD 4S3SA 5LMNQ 3GV3A 4F7XA 4DV1L 4OO1I 2N55A 2PNRC 5GADC 1TWCH 4PZ8A 3T16A 1TWCB 4B9XA 3MXGA 3FRPB 4BXXG 2HIVA 2XTIA 5KYLA 3SHLA 3S1MH 1RD9D 1VQIA 2EY6A 3S1MB 4JOIC 2LMCB 1STNA 5LL6S 4LF6Q 1IW7D 1I4XA 3NTKA 4RKBA 1YEZA 1N33Q 2P5ZX 2F0SA 3GTKH 1C9OA 3G48A 4J6HA 5CMDA 2MUYA 2JEAI 1CHPD 3MEHA 3OOCA 4DU9A 4GN3B 2BE5C 3SE0A 5FJ8H 4YIJA 4A3FG 4APVA 4XQNA 4HAEA 3BJUA 4DK0A 2R93H 2PI2A 1VDZA 2AQ3B 2R93B 2IWHA 4TQUS 2G9DA 3MTSA 1DGSA 1MIUA 1EEID 1H9JA 3S17H 3S17B 2E74C 4XTCS 1QZGA 4X64Q 2QCPX 1IYJB 4IZ8A 4YHHL 1QNUA 2RCFA 4IPCA 1WTOA 1SYCA 1BCPC 3KDFA 2Z6KC 1F9SA 3I2ZA 3D0FA 2NTTA 2HHHL 3I72A 3EIVA 4RHSA 4KI0A 1DJRD 3FP9A 2E8GA 2OTLA 4IPDA 2XRSD 4L5TA 1WCMH 1D1KA 5ELFA 1HA6A 1WCMB 1UEAB 5FO7B 1XYIA 1TU2B 4UP9A 1VQ7A 3MAQA 4LJZC 1WD1A 2F3IA 3K80C 2VB2X 2FINB 2WB1G 4XT1B 3GTMH 3FPPA 2QEXA 4JI2Q 3GTMB 3S1RH 2HHHQ 2LS01 1YNND 3U50C 1BVSA 1JR0D 3PUVA 3S1RB 2K6AA 1G291 1VQ8A 4LUVA 2UU9Q 2UXCL 4UHVA 1WI5A 1HNXL 1JWSD 2EDGA 5C6AA 1D6EC 5BR8L 3HOYG 3PUZA 4ID6A 1KNAA 2I46A 1PH2A 1XWEA 1CZWA 2IL8A 4RA8A 2D0OA 1BUVT 3A56A 4DXFA 4YWKA 5TSSA 3EQLC 4HIDA 3QB3A 1KXLA 1X55A 1IXRA 1K0RA 2WP8J 1STYA 5A35A 4X6AH 1VQDA 4JI1Q 2DJFC 1ZKOA 1U4PA 1SJHD 3RZDB 4B3RL 2ALYB 1B1ZA 1G6ZA 4H7BA 4KKTA 3M3YH 2O4XA 2ZTDA 3A55A 1YBYA 2JA5G 2B29A 3CCQA 1LT5D 3T1YQ 2ID0A 2WV6D 1KQSA 3A7AB 3F2CA 1Q1EA 2OQ0A 2QW7A 3OYYA 5FLXc 4H0LC 1L0YB 4ZKBB 2MP1A 3PSIA 3DHQA 5I4DA 1XMQL 1PH4A 2K5VA 3SK4A 3T1HL 2QEJC 1SYBA 1ICFB 1Y8PB 3K5NA 2KCTA 5J39A 3FVQA 2JQOA 2K32A 3NXWA 1D1IA 1T5EA 3NEMA 1Y1WH 4QUFA 3J7AF 4K0KL 1Y1WB 4PNYA 4YCUA 5ELBA 4H44C 2IHFA 3TP7A 1TT2A 2E76C 2EJGC 2OTJA 2RHQB 1IBLQ 5CV8A 1EQTA 5CYUA 1SROA 5T1GA 4FF2A 3UDGA 2N88A 3PO2G 2K5WA 1QUQB 3A8KE 3T53B 3I3CA 1EEFD 2I0QA 2E2HH 2WB1B 1STAA 3MXNA 2E2HB 4JW0A 1XNRL 3I70A 4LUZA 1HZBA 4OX9Q 1GOZA 1QVFA 3L3OC 2KHIA 1I94Q 1E22A 2NZHA 4FXKC 3NK9A 1EQVA 2RA4A 4HN7A 4RCOA 2PQAA 4CJ1B 1FNWA 4DR3L 3I4NH 1M1KC 1ZYRC 4DR2L 2B63H 1HR0Q 1ENAA 1AP0A 4NXNL 1PHJA 3CMAA 3DXJC 1TR5A 3FKIH 2ZJQA 4IOAA 1HFNA 2ZXRA 4NP5A 1NR2A 1FVIA 5FLMG 2A74C 1TWAB 4RHRA 1SE2A 2M2LA 4WRDA 2A68C 3RLFA 4DAMA 2FFKB 2ES2A 3KF8B 2EYJA 5IYCG 3A7LA 2E2JH 4V0BA 2E2JB 5D3IB 3I4OA 2F4VQ 2NVQB 5M3MG 1QCBD 2F0FA 2WKCA 3K6OA 1QNKA 4HSPA 5FOBB 4IALA 4NXNQ 1WTHA 2JA5H 2PZWA 2B8FA 2JA5B 4LF8L 1F9PA 3A8JE 1PH9A 4C3JG 3SDZA 1ZEQX 1L0WA 4IFDG 3ULPA 1G6PA 2DGYA 2K14A 1VQMA 1VMPA 4G7OC 4ABNA 3SVMA 2N3SA 1VQ6A 2NZ1D 2XVSA 3S9WA 1GKHA 1Q7YC 1KABA 4A3JG 1Z47A 3B6YA 3WDNA 1NBWA 3HKSA 2UXDQ 4RKLA 1VQFA 4DV7L 1HQMC 1IZ6A 2WFWA 2G9HD 4NW2A 3HOWG 2PNHA 2OWOA 3R8BA 3PMFA 2A6EC 4DGZA 1KRSA 5HGTA 5IWAQ 3E9HA 4LW1A 3IKJA 4LFBQ 3HG9A 5C4HA 4HJAA 4GNXB 1Y8OB 3KYHC 4ZAIA 4K5WA 2F0WA 2TMPA 4ZUJA 3HOZH 3NSWA 3KLWA 2IJ0A 4DUYL 3I90A 1UUPA 3OSOA 3BVGA 3HP3A 4Z9CB 1PH3A 1YVCA 4P73A 5NUCA 4L5SA 3KFUA 2FMCA 1U9RA 3D6WA 2HDLA 4EGVA 2D62A 4XQQA 4JBMA 2ZJPA 3M7GA 2F0KA 4DKAC 1XXGA 2WAQB 2BE5D 2K5HA 4DF7A 1FD7D 2RBMA 2O5JC 2Q2IA 1PYSB 4AQYL 3PO3G 4K5XA 3QO2A 4OIKA 2R7FA 2K50A 1FNVA 3N52A 1DCZA 3OIQA 4JI5Q 3TEHB 2E2IH 4KN4C 3V96A 1JB7A 2E2IB 2NVTB 5IODA 1CKNA 1E24A 4KV6A 3CRKC 4A3IH 4MZ9A 4O1NA 1PH6A 4DR1Q 5E7NA 4A3GG 1RJTA 4OEMB 4IO9A 1N32Q 3EFXD 1Q90A 1VQHA 4C3JB 1BCPD 4IFDH 4Y52H 1Q46A 4FVMA 1OXSC 1SNPA 4TVAB 3PF4A 3URYA 1GHKA 1D5MC 5KNBA 5COYA 1ET6A 1CKMA 2JA6G 1Y1VH 4G7ZC 2JA7G 4JYAL 1PRTF 2NYZD 1Y1VB 3J80i 3VYUA 4B08A 4X65L 4BY1G 1HZ9A 4A3JB 5C0XH 2VB3X 1BKBA 1OXXK 3S2DH 5C44H 3S2DB 4L8JA 4R4QA 1HRJA 5C44B 3KUPA 1TY2A 4DV5L 4TKOB 1EFID 2R7DA 1D7QA 2MGSA 2LFNA 5FLXL 1Z9FA 1M4VA 3LWEA 4DR7L 2WACA 2IHEA 2UUBL 3CD6A 4LMQD 4DV4L 1V1OA 3PGZA 3H94A 3H91A 2R92H 3NWSA 1WYDA 4C3HG 1EY5A 1ZXTA 2VQEQ 2R92B 4JYAQ 4KK7A 2BCOA 2F0VA 5I2YA 2F4IA 2J0TD 1TS2A 4CDCC 3CCJA 1DONA 3SEBA 3FMCA 3S24A 4U673 4DUZL 1JQYD 3STBC 1CQVA 3S14H 1UE1A 4A3KG 3S14B 1QG7A 1PYBA 3TZUA 4ZYSA 5GAEC 5CBAE 3CRLC 5GAHC 1YHBA 1WTQA 1ASYA 2PW7A 4M8AA 1LUZA 4KJOA 1OTCA 3NE5B 2NVYH 2NVYB 1XPOA 4R1JA 3NPPA 5T1IA 1VQ4A 1MJEA 2CFMA 3F1ZA 5FLXE 1BCPB 5JJLA 1I4QA 1V9PA 2EYMA 3I7FA 4DPGA 3A74A 2MHVA 3I4MG 3PCOB 1MD2D 3K81C 1VQKA 1GUGA 2N78A 3PUWA 4ULLA 2K04A 4LF5Q 1G2TA 1B3AA 4ME3A 1I6VC 2GVAA 4X62L 1SDFA 4OXPA 4A3GB 1E1OA 1NNXA 3DWAA 5EBDA 2UUAL 1HH2P 1V1QA 2JYOA 2RSOA 1C48A 3GTQH 4RG1A 2KCMA 2YYZA 2ZTEA 4UDUC 4KN7C 3CCRA 5G3LF 2KHSA 3AU7A 1JOQA 5FO9B 2EY5A 2L11A 2JA7H 4FYDA 4QIWE 2JA7B 3CCUA 1TWFH 3F2DA 1BBXC 3KOJA 1EIGA 1TWFB 2RDFA 1F2YA 1V8QA 1DOKA 1PLFA 1SNDA 4JI6Q 4R4OA 1Y69U 1BOSA 2GN5A 3A0JA 2UUAQ 4XYQA 2E75C 2OQKA 1J5EQ 4R4CA 3F2UA 1MBYA 5LL6X 1TKWB 2Q8IB 1KRTA 1ICWA 4FDBA 1LT3D 5FJ8G 1F2MA 4C3HB 2VQFQ 1GUSA 2PMZE 3VA5A 1Q81C 1LABA 5JPNC 4QB4A 3T51B 4DFAA 1LLRD 2R93G 2LKVA 2RVLA 1E2WA 1EIYB 5EKKA 5CBEE 4HIKA 1ZYRD 3I4LA 1XPRA 2RCNA 1GO3E 1X3FA 5I9PA 4YY3L 3I73A 1STGA 5D14A 3GTPH 4K2KA 2F0EA 1H9SA 1F9RA 3CQZH 4IQZA 4JV5Q 3AFQA 4DA2A 3CQZB 1NR4A 1AE3A 3HRZC 2J7ZA 4UPAA 3EJIA 1VQAA 4R4TA 1G2SA 4JBWA 3PQIA 2A68D 1CI3M 3QG1A 3K7AH 2K03A 4L6TB 2DNEA 1ENCA 1T9HA 4A75A 1DM0B 1JJCB 4X66L 1NSNS 3WOEA 1F9QA 3I4MH 1B7YB 4X3KA 2F0IA 4RH6A 4ZLTF 2KECA 3I4MB 2F0QA 1WCMG 2L55A 4LFAQ 3RN5A 2JN4A 3R2TA 2Z0SA 1XTCD 1DOLA 1A0IA 1K3RA 5EPKA 5HGQA 1OXVA 4GZYC 4IUTA 1K3BC 4RAUC 2JXMB 2LSSA 5CR3A 3TN2A 4GOPC 4YWMA 1U0LA 1A2TA 4P2CB 4DK3C 1JCKB 3BZDB 4GKJL 4HCEA 5CV7A 1Q86C 3MWYW 2CWAA 4IURA 4X3UA 2A73B 2YTYA 4JC0A 1VCIA 3HEJA 2A6ED 3GTKB 2HD3A 1D8LA 2M9VA 4CGYB 2HDMA 2K75A 4DV1Q 1UE7A 1WTPA 3UE1A 1KC8C 1S5CD 3CAMA 3KLSA 5FK9C 3UDIA 4FF3A 3J81i 2F0JA 2KJXA 2Q8TA 3M85A 1VS0A 3TP6A 1TS4A 1JE4A 2B2TC 2CH4W 1A15A 4DR5L 1H9RA 5KRUA 3TREA 1FJGL 4WORA 2K5DA 2SNSA 5GAGC 4X3SA 4E6IA 1NMGA 2PZTA 5AFWA 4LF7L 4WJWA 2L12A 4A3MH 1UEBA 4JI7L 1GD7A 1I4HA 2DUDA 1K73C 1Y1WG 4MN3A 1QOHA 4OO1H 4OONA 1Q1BA 2B8GA 2F0PA 2QA4A 3W3AA 4YHHQ 1FJGQ 3RUZA 1L1OA 4YWLA 3K7UC 1ONLA 2YU9H 4LF7Q 1MHWC 1PFMA 5I9OA 2YU9B 2CCZA 4HJ7A 1PV4A 4POFA 2VW9A 3R3OA 1Y8NB 4YCWA 4AYBB 4BA1I 2RQXA 1PTOC 4Q0FA 3I4NG 4HSVA 2F0HA 4LWCA 3SR1A 2B63G 1TVXA 1JICA 2VZAA 3P20A 1R9TH 4P72A 3RNUA 1R9TB 1OXTA 3FKIG 4DV6L 1XNQL 2PQAB 4F8MA 2PYKA 2F0TA 5AJ3L 1EZ6A 5IGFA 1XTDA 4PZ7A 4LF4L 2EY1A 3A8IE 3OIPA 5BN3A 4FNFA 2UXCQ 1GUOA 3TQYA 3NBHA 1YJWA 1RDPD 5KGUA 4HIMA 5I6YA 4RGTA 1P8LA 1SEBD 3TSSA 2HIXA 5CV9A 4P75A 3UE0A 3VR3A 2JA8H 3KF6B 1HNXQ 3BU2A 5C5LA 3STBD 1WTXA 4A3BH 4A3BB 3M3YB 1GM5A 5BR8Q 1I3QH 1W6JA 1KNEA 1WD0A 1I3QB 3CP0A 4QY7A 1XMOL 2OCEA 3KJPA 4JI8L 1A8VA 1HZCA 3P1HA 4ZRZA 2K7VA 2ASBA 4I7AA 4KD3A 3LX0A 1QE6A 1A3VA 3IRBA 1VQ5A 5DM73 2J4XA 2YTVA 1G51A 1SSOA 4IOCA 4B3RQ 1JE5A 2JEBI 2AQ2B 1WFQA 4DR6L 3CHBD 1YI2A 4ILWA 1C4QA 3LGJA 3NQTA 4K8IA 5F2DA 2GA4B 1K0SA 4JI8Q 4CDFC 1BR9A 2M00A 1XMQQ 1KDBA 2AUJD 3GTGH 5CORA 3T1HQ 2E5LL 2UXBL 3GTGB 1H95A 1L1OC 4G4KA 5M9OA 5DM63 1B50A 2KUMA 3BZKA 4C3IH 3UDFA 2ZT9C 4DV3L 3WOFA 4C3IB 3HOZG 1IBKL 1A63A 1BO0A 3PIO3 3TZDA 4K0KQ 3TP8A 4IUPA 4PZ6A 2XWBB 4BWGB 3I4NB 2KOLA 3CF5A 1HZAA 1FGUA 1S5FD 2BDOA 3D4DA 2IX3A 1S5BD 3G71A 2B63B 4CJ0B 2VY3A 3C46A 1SE3A 2G5DA 1QB5D 3FKIB 3V05A 2XSCA 3NELA 1YJNA 2WAQG 4PMWA 2F3WA 2H4OA 3ER0A 1PXUA 3M4QA 2L1BA 4KY5A 1XNRQ 2X69A 1A3TA 1B9NA 1LTGD 3H6MA 4DV3Q 5ELNA 4O2DA 1PH5A 3GTLH 1PVOA 1K8MA 3GTLB 5EKLA 4ODGA 1PH7A 4CDEC 4DR3Q 4J15A 1CUKA 4PMBA 4DR2Q 4A3IG 5IYDH 2A19A 5IT9c 2WB1E 1X3QA 3X3NA 1E3PA 5LMNW 2VUMG 1X6OA 3S1NH 3ERQA 3S1NB 1LM0A 1RL2A 3L2PA 4A3LH 1CKNB 2HQLA 5KNCA 5JVG3 1X9NA 1MGSA 2K5NA 1O7LA 1Z6HA 4IUVA 1STBA 1X3EA 2OT2A 3DM3A 4ZCKA 2MPMA 1BCPF 2B2UA 2B2VA 1Y1VG 2FHTA 2A1AA 3JAMi 4XXEA 2ZM6L 5C0XG 5C4ZA 4RWSC 1HUNA 3BYTB 5C44G 2N8NA 4LF8Q 1TS5A 2A69C 3D6CA 4DAPA 4DR4L 3HOUH 2NN6I 1OO9B 2QGQA 2R61A 3VYRA 2NZOA 1E0BA 3HOUB 5DLQE 1EQQA 4CHTB 1B53A 2B3GA 2HQEA 2IW3A 3NBIA 5C3WA 2R92G 3C3LA 4K6LA 2CKZB 1VQBA 3J80c 5JAVA 3VDYA 3S15H 4GLXA 3S15B 3C2PA 3HOZB 5JJKA 3P7JA 3PIP3 3GTOH 1PFNA 3NTIA 2ZM6Q 4DV7Q 3GTOB 2QF7A 1WJJA 1ML0D 2X6LA 5I2XA 1AFPA 3U4ZA 4PQXA 3H15A 1V1PB 2KEDA 2VXWA 4ZKCB 2CQOA 3K0YA 3VA7A 4DXGA 5M3FH 4GLAC 1QVGA 5M3FB 3CU7A 1XJVA 3OW2A 5EQ0A 2EYFA 3D8GA 4K2LA 1LTSD 1CZGA 3U4VA 1EIHA 1KD1C 1UAPA 5EBCA 1HUMA 4DUYQ 3K5MA 1YIJA 1F2ZA 1KDAA 3KF8A 1Q12A 1R4QB 4KMUC 2LXKA 2F3VA 4JBKA 4A3IB 1RCVD 1GHJA 2K1BA 4BY7G 3EBEA 4B3SL 1EY4A 2VUMH 2K28A 3DWPA 2VUMB 4QF4A 5IE8A 1LT4D 1Q82C 3S1QH 1KAAA 3CCMA 1EZ8A 3S1QB 4X3TA 3DEPA 2F0NA 4AQYQ 2N49A 4LFCL 2LY7A 3TMEA 2NN6H 5EPLA 4ZQ3A 3I8ZA 4KY6A 2KEEA 4IUUA 2B2UC 2B2VC 1N36L 5ELOA 1LT6D 2AMCB 5JOBA 4EX5A 4CBVA 4F87A 2R7ZH 1XPUA 1BBWA 2WAQE 2R7ZB 1FYCA 5JEAH 3BZCA 1FNUA 2KENA 1SMYC 1B4OA 5M5YH 5KYIA 1NMFA 5M5YB 2XNAC 2BH8A 4A3EH 4YCVA 1AE2A 3OWFA 4KKUA 4A3EB 3KBGA 3CPFA 3E9IA 4X65Q 4CKCA 5EPJA 1OXUA 5KEEA 3GTJH 1PTOD 3MZ5A 4HJ9A 3GTJB 2F52A 3G6EA 2SEBD 4DV0L 4HMJA 4DV5Q 3QJYA 4IPGA 2YTXA 2MJ8A 2EIFA 4GKKL 5IP9G 4DR7Q 5JVH3 2UUBQ 4BS9A 2OF1A 5E1FA 4DV4Q 2B2WA 3IAYA 2V4DA 4LK1C 1PFSA 2B39A 2K01A 2SOBA 2AKWB 3D31A 4CKEA 5M5XH 1SE4A 1HCZA 5M5XB 3UI2A 4Q5VA 5C3EH 4DUZQ 4HMIA 5C3EB 1VF7A 4DV0Q 1LO5D 3HKZB 2SNMA 1S5DD 2AWOA 5C4JH 4BY7H 1B44D 2K4KA 5C4JB 4EQNA 4BY7B 3UDXA 2EVBA 1B2TA 1SNMA 1X56A 2Z1CA 3AYHB 1JOOA 5IYBH 2NB0A 3OHXC 3WWVA 1TWHH 2WKDA 5IP7H 1HXYD 1LTRD 2RDGA 2XGTA 3J7ZC 3GTQB 2Y0SB 3HFZB 4GOPA 2PMZB 1HR0W 1I4PA 1YNJC 4P74A 3MVVA 1B3QA 2I5MX 5IT9L 1GJXA 4HR7B 3OTOL 4X62Q 4F88A 4IJHA 2L0CA 4EQPA 4IFDJ 3CPWA 4OWXB 3TP5A 2XN9C 4DNIA 1F77A 3CW2C 1S40A 4R8IA 4BBRH 3H3VC 3W1BA 4DV2L 4AH6A 2QILA 1C7YA 2BH2A 1PYWD 2XWJB 5C0XJ 2KCNA 5GQOA 1HNWL 1Q8KA 1II3A 1A2UA 4GNXC 4UP7A 3KBXA 1J8IA 2A6HC 1LTLA 2B2TA 3OWEB 1EY6A 1L2FA 3U58A 4KLKA 2Z6BA 2A5HA 2B2YA 3E0EA 1I50H 2EQSA 1EYGA 5IP9H 1X54A 1I50B 3GTPB 3H0GH 5IT9E 1EY0A 3S16H 3OPOA 3CCLA 1UWVA 3J80L 4DV2Q 2B2WC 1VQLA 2MNAA 5C4XH 3SK6A 4A3MG 5C4XB 1H9KA 3K7AB 1KDCA 2FJ2A 4H13C 1NCVA 4JI4L 1PA6A 2BA0A 5BN5A 3M4PA 2R3ZA 3KDFB 4OO1G 2PCFB 4KY7A 5CC4A 4YY3Q 4QCLA 2K05A 1ESRA 5CGKA 4OGQC 1EY9A 5LMNL 5HY6A 1PZID 1IBML 3T56B 3L0OA 4HIOA 4IPHA 1YHQA 4XQJA 1JMCA 4FF1A 4AYBG 1SYFA 4X66Q 2AWNA 4JI4Q 4XYOA 3IFTA 3HOXG 4J8QA 3K58A 1SMXA 4LF6L 1JC7A 4I7ZC 2FMMA 3J80E 4ZUIA 2BA1A 3E0JA 1YJ9A 1D5XC 1F2LA 2NVXH 4NKLA 2NVXB 2F0OA 3PIOA 3I91A 4DK1A 2A69D 3RLNA 1EYCA 4RMFA 1IBMQ 1VQEA 3ULLA 1JT8A 2F0LA 3VYSA 3DUZA 4RGOS 3F8TA 1PDQA 1U4LA 3N6RA 3PUXA 3VR5A 1IL8A 3CC4A 3NP8A 4WJ3M 4L5RC 3IL8A 1EU4A 1VQOA 3QWNA 1X3GA 4A3CH 1GUNA 4X64L 1ILQA 4R9WA 4B3TL 1EWIA 2CW0D 3EA6A 4A3DH 4QMGA 1UE6A 4FO2A 4GKJQ 5IGGA 2Z4HA 2JA8G 4A3DB 3C1FA 3RZOH 1CKOA 3GO5A 1ASZA 4A3BG 5HURA 3RZOB 1SBBB 1EYAA 2C35B 1STEA 2O5IC 5H1SE 2GVBA 2YV5A 1C0AA 1ESFA 3NBHB 3H09A 1XX8A 4DAYA 4TRDA 2B2YC 5M5WH 3AQQA 1GXDC 2I5LX 1X65A 5M5WB 1JB3A 2FXQA 4ALPA 1CSPA 3VR6A 4WFN3 3NENA 1WTVA 3DMUA 4A3MB 3BVZA 2LXJA 4K8JA 4B3TQ 1SN8A 5K36H 3E5SA 2UUCL 2ZJRA 2ATWA 2C5CA 3ZJYC 1EWCA 1SNCA 4DR5Q 3MC0B 4OIJA 5IGBA 1SE8A 2IT1A 3I55A 4JI2L 1D2BA 2NWGA 3ZYYX 3BYYB 3G4SA 4JCVE 3KLRA 4OWWB 3AB9A 2UU9L 3AMUA 2RDHA 5ELEA 1M8AA 4JVZA 1SR3A 4KJNA 1B9MA 3Q23A 3CC2A 4JI7Q 1QWYA 2DJGC 3MFYA 4C3IG 1X3PA 2PQEA 3HOXH 3BS1A 3GQBA 1PZKD 4CJ2C 2JJQA 3HOXB 4N8FA 2UUCQ 2F0MA 1CK1A 2XRQD 1K8GA 3MXNB 5C5MA 1VQPA 2Q2TA 1SYDA 2SDFA 1HFGA 3J7A5 3K5OA 4IJLA 3ONAB 3EROA 3PIPA 3NWTA 3PF5A 1S72A 5CV5A 2EYHA 2CWPA 4KHPL 1M90C 3AEVA 4EQ5A 1SMYD 2VS1A 3LNNA 2IX1A 4BXXH 2AHOB 4JI1L 4JI0L 1EWHA 3JC66 2BDNA 3FEWX 4RCNA 1VQJA 5DEHA 3U9SA 1CFMA 2PZUA 2XIWA 3R2IA 4FXGC 1K8OA 3T1YL 4UY8C 4L63B 1PZJD 5IYDG 3BVMA 1C8CA 1VQNA 1YITA 1U4RA 2JA8B 1RODA 2HCCA 3VR4A 4LF9L 2PW5A 3F2BA 2EZVA 2JK8A 3QOLA 4FP5D 1HA5A 1UNSA 4DV6Q 1XNQQ 4G57A 5DAUA 1JJGA 1HNZL 4A3FH 4FXDA 3FPUB 4KHPQ 1LACA 5AJ3Q 4A3FB 4LF4Q 1RKNA 4AYBE 1TY0A 2VL6A 1S4ZA 4A3LG 3VR2A 2IY5B 1YNXA 2NTSA 3RZDH 4JI0Q 2VNUD 1NE3A 1EOVA 3W5OA 1SJED 3FHWA 4PMCA 1LTBD 5ELCA 4JI3L 2I5HA 1IBLL 5DNFA 4JG2A 4LF9Q 4RGNA 1I4RA 1PRTC 3BDCA 3S2HH 4EVOA 2Z8LA 1XMOQ 1HNZQ 1N9WA 3S2HB 5IGEA 2MQHA 4GN5A 4DK6C 3DWQA 4HEDA 4OX9L 3HOUG 1I4GA 1I94L 1TXYA 3RD4A 4GS3A 3J81L 3BG3A 3OMCA 1WTRA 2KA7A 3Q8DA 3R93A 1HR0L 4JI3Q 2NUCA 3JAMc 5E4WC 4CKBA 1O78A 1YNJD 4DR6Q 3Q24A 3QR8A 3A5UA 4BA2I 2F0DA 1RIPA 4L5QA 2I07B 1VF5C 1K83H 2F0GA 3DEOA 3Q6SA 4ZK9B 1K83B 1HHVA 1MI2A 1L0XB 4HJ8A 3CMEA 4N9PA 2EE1A 5M3FG 5J1ZA 5JPMC 1AZPA 4C1NI 2E5LQ 3CCVA 2UXBQ 3H3VI 4WJ4A 2JP1A 3V2TA 4N8X1 4I65A 2F4VL 3C1EA 1O80A 1E7ZA 2EYOA 1PH1A 1IBKQ 2A8VA 1B8AA 1CA6A 4U68A 1J9OA 1IHZA 2EJMA 3RMHA 1AN8A 5GROA 1KLUD 3HOYH 2A6HD 3W1GA 3HOYB 2MO0A 1TWAH 1TQOA 3J81E 4KD4A 5C3XA 1AH9A 1WTWA 1E2ZA 3SK8A 1LV9A 3KF6A 1IYUA 5CV4A 1CSQA 1LTTD 1QILA 2DNCA 2D9UA 1GUWA 4UP8A 1D5ZC 3RN2A 3DM1A 3L9AX 3RLOA 3SGIA 2NVQH 2JE6I 2KBNA 1NAPA 2EPBA 5JJIA 2UXDL 1JWMD 4LNQA 3T4AC 2NN6G 2CQAA 2RHSB 1EUJA 2IPKD 4B3ML 1U4MA 4IUQA 5D65A 3K57A 3K0XA 4HCSA 2L9HA 4NDXA 3M4OH 2KCCA 5E4XA 4NB3A 4RGMA 5E3FA 3ERSX 3M4OB 4MHEA 5IWAL 2K52A 5J22A 2R7ZG 1AW7A 1AEXA 4LFBL 1A62A 4LAAA 2KHJA 2RKSA 1SYGA 3RR5A 1IYVA 2KQ3A 3I56A 5JEAG 1MJCA 3HOVG 1VMCA 5IOCA 4NMZA 1QUQA 2EY2A 3NQIA 3CCSA 1LTAD 1N8RC 2L5TA 4A3EG 3BDLA 2ICIA 1SYEA 1EOTA 4IFDI 2K5QA 3D4RA 4B3MQ 1IW7C 3H3VH 4P71A 3AFPA 1TWGH 1YHAA 1CA5A 2CW0C 3KK7A 1G8ZD 1TWGB 3PO2H 1QZHA 2ZXPA 3PO2B 2CVRA 3IFDA 4RFBA 1HTLD 1X32A 3ND8A 4DN4M 1RHPA 3SXHA 1KIXA 1PTOF 1JJ2A 4C1NK 4KTAA 3GD7A 1IKLA 2EXZA 5C0XI 2AQ1B 1FL0A 1ET9A 2RSNA 4DR4Q 1I5FA 1Y14B 1BXTA 3A5ZB 3QIAA 4QL5A 2K33A 1ENFA 4B9WA 1HTPA 4IN3A 2EJFC 4JI5L 1EL0A 4K6DA 1KTKA 5KNDA 2AUKA 4MIUA 3SK5A 1SRUA 1EY8A 3ND9A 2CHBD 1SNOA 1W2BA 1EYDA 1PH8A 3MXPA 4DR1L 1EIFA 1SAPA 1EY7A 1MKHA 3TDQA 5C3EG 3NHHA 5CV6A 1IL2A 1N32L 3HKZG 5FLMH 1B70B 1FGBD 1HPCA 3MA2B 1I6HH 2DN8A 4IUNA 4XT3B 1I6HB 5IYBG 3PV0A 1W3SA 1RTOA 5IYCH 2EOTA 2QKIC 3KJOA 5IP7G 3OW7A 2L15A 1Z7TA 2C9OA 2Y0SG 4JK1C 2NVTH 1EQRA 5M3MH 2Q2UA 5M3MB 2H5XA 1JORA 3M9BA 1YZ6A 2JA9A 1CT1D 2NBFA 4M1UB 2EYPA 5ELDA 4ME5A 2L4NA 1EFWA 1KAWA 3J7AV 2ICEC 3O13A 1CTMA 3CXCA 1BQQT 1J6QA 2E2DC 4C3JH 3CC7A 2F0UA 4GOPB 4B3SQ 2JSOA 3MXUA 4MTKA 1YNNC 1BBUA 1KL9A 2QDBA 3EN2A 2VQEL 3HOVH 1P16A 5L37A 1SNQA 1K28A 4KHVA 3TRZA 3HOVB 4A3JH 2D2CC 1DD2A 1DZ1A 4BBRG 1N34L 1TIID 1DYQA 1DOMA 3ULJA 4QJFA 4LFCQ 2DY8A 4GNXA 1GVPA 3W2DA 1PFBA 1E1TA 4C56C 4QQBX 3HOWH 3CCEA 1QVCA 3HOWB 1O7YA 1N36Q 4A93G 4OELB 3LWUA 3FDTA 2QDLA 1CHQD 1VQGA 4QUCA 5FKAC 3CKIB 2R6GA 4GLVB 2EYLA 3BDOA 1HJPA 1JOKA 4J1MA 1T5XD 3GDEA 1V1PA 1VQ9A 3K59A 3M7NA 5LHY1 3H0GG 4PG3A 3EVQA 4H02A 1N34Q 1MSHA 4OWTB 3E3XA 3MFGA 1W6KA 5C4XG 3JAML 3NTHA 2Q2HA 4G7HC 5EJWA 1NJIC 1H9SB 4QIWB 4BBSG 4GN4B 4LF5L 4HTHA 4KKSA 1TS3A 1IKMA 4V190 5IGCA 1VQCA 1AZQA 2CH4A 3D3RA 4GKKQ 4XIGS 4C2MH 2D0PA 1RTNA 2HT1A 4R4IA 1KLGD 4C2MB 3PO3H 5BN4A 1TWHB 2D5DA 3PO3B 4QGUA 5ISRA 2Z9HA 3D4WA 2PPBC 1NUCA 1Q8IA 2MFIA 1LTID 4A76A 3TBIB 2WIIB 2KVMA 4JI6L 4A3GH 3MEFA 3Q22A 2WINB 2V1CC 3Q0AA 1MSGA 2X6GA 2H1EA
chains in the Genus database with same CATH topology
2UXCQ 1J5EL 4JBMA 2ZJPA 2C35B 4JI8Q 5H1SE 4DKAC 2GVBA 2YV5A 1C0AA 3NBHB 5J3BA 5M5WH 1V43A 2K5HA 3AQQA 1XMQQ 2I5LX 1X65A 5LMUL 3GTGH 3T1HQ 2E5LL 2IX0A 2FXQA 1S3OA 3ICEA 2JA6H 1L1OC 2UXBL 1H95A 2VQFL 4ALPA 2Q2IA 1CSPA 5IY0A 4NXML 1PYSB 4AQYL 1KHIA 3BZKA 4NPSA 5EAYA 3UDFA 2R7FA 4C3IH 2K50A 4DV3L 4BY1H 4JOIA 3J81j 3NENA 3HOZG 1IBKL 4JI5Q 1A63A 3TEHB 2E2IH 1JB7A 3HKZE 4K0KQ 1CKNA 1E24A 2LXJA 4A3IH 4B3TQ 4MZ9A 4A3CG 4PZ6A 1PH6A 1SN8A 4DR1Q 3CF5A 1HZAA 1FGUA 2UUCL 4A93H 5E7NA 2ZJRA 2ATWA 3G71A 4A3GG 4A3DG 3ZJYC 4IO9A 2VY3A 1N32Q 4A4IA 3OTOQ 4DR5Q 4JV5L 2RF4A 4MTNA 5JEAJ 1VQHA 4Y52H 1UE5A 1NTGA 1SE8A 2IT1A 2Y0SE 3NELA 1Q46A 2WAQG 1OXSC 4JBJA 4TVAB 4PMWA 4C3HH 3ER0A 3I55A 5LMUQ 3PF4A 3M4QA 3G4SA 1XNRQ 4JCVE 4NXMQ 4OWWB 2UU9L 1CKMA 4DV3Q 1Y1VH 5ELNA 1SR3A 4O2DA 1PH5A 2JA6G 2JA7G 3GTLH 3DLLA 3CC2A 3J80i 4JI7Q 1PVOA 4X65L 1PH7A 4BY1G 1HZ9A 4DR3Q 4J15A 1CUKA 1BKBA 1LYLA 1O7IA 2MO1A 4AIMA 1OXXK 4MNOA 3J81c 3HOXH 1NY4A 2JJQA 4DR2Q 2UUCQ 3S2DH 4DAYB 2ZTCA 5C44H 4A3IG 4A3KH 4R4QA 4LFAL 4BBSH 5IYDH 2A19A 5IT9c 5K36G 1K8GA 3MXNB 4DV5L 2WB1E 1VQPA 2Q2TA 2Z6KA 2R7DA 1D7QA 3TS0A 3J7A5 1Z9FA 4IJLA 3PIPA 4DR7L 1E3PA 2IHEA 5LMNW 1X6OA 2UUBL 2VUMG 3PF5A 1S72A 3CD6A 3S1NH 3K8AA 4DV4L 2EXDA 1LM0A 1RL2A 4KHZA 3L2PA 3PGZA 2IY5B 2CWPA 4KHPL 1CKNB 2HQLA 1X9NA 1M90C 3AEVA 2K5NA 4EQ5A 2R92H 1WYDA 2VS1A 2VQEQ 2IX1A 4BXXH 4JYAQ 2AHOB 1X3EA 3TS2A 4JI1L 3DM3A 1K8AC 4JI0L 1U5KA 3JC66 4POGA 1Y1VG 3CCJA 4LUOA 1SFOH 1SLJA 1VQJA 2A1AA 3S24A 3JAMi 4DUZL 1WOCA 4Y7NH 2ZM6L 5C0XG 3STBC 3L7ZC 3S14H 3T1YL 4UY8C 1L1OB 1UE1A 3PUYA 5IYDG 5C44G 4A3KG 4JYAL 4O0AA 1N33L 2PI2E 1PYBA 1YITA 1VQNA 4HJ5A 2N8NA 5GAEC 4LF8Q 1K9MC 4LF9L 1ASYA 5GAHC 1YHBA 3F2BA 2JK8A 4DV6Q 1XNQQ 3HOUH 4DR4L 2NN6I 1JJGA 2QGQA 1HNZL 4A3FH 2NZOA 5DLQE 4KHPQ 5LMNQ 4DV1L 1EQQA 5AJ3Q 4OO1I 4LF4Q 1LUZA 4AYBE 1OTCA 2NVYH 5GADC 2B3GA 2VL6A 1TWCH 4A3LG 2R92G 4PZ8A 4R1JA 1XPOA 1YNXA 1VQ4A 3RZDH 1MJEA 4JI0Q 2CFMA 2CKZB 3F1ZA 1VQBA 3J80c 1NE3A 4BXXG 2VNUD 5JJLA 1EOVA 1V9PA 2HIVA 2XTIA 3I7FA 4DPGA 4GLXA 3VDYA 3W5OA 3S15H 3FHWA 3S1MH 3A74A 5JJKA 3I4MG 1VQIA 3PCOB 3GTOH 4JOIC 2ZM6Q 4DV7Q 3K81C 4JI3L 2I5HA 1VQKA 1IBLL 1WJJA 1HNWQ 2N78A 4LF6Q 3PUWA 3U4ZA 4JG2A 1YEZA 1N33Q 3H15A 4LF5Q 3GTKH 1C9OA 4ME3A 2GVAA 4X62L 3G48A 4OXPA 2CQOA 4LF9Q 1E1OA 2JEAI 2UUAL 3S2HH 4GN3B 1HH2P 1V1QA 1XMOQ 1HNZQ 1N9WA 5M3FH 4GLAC 1QVGA 3GTQH 2MQHA 4RG1A 4GN5A 2KCMA 2YYZA 4DK6C 1XJVA 4A3LH 5FJ8H 2ZTEA 4OX9L 3HOUG 3OW2A 4A3FG 1I94L 3CCRA 4APVA 1TXYA 3BJUA 2JA7H 3U4VA 2R93H 2PI2A 4GS3A 4QIWE 3CCUA 1KD1C 1TWFH 3F2DA 4TQUS 3KOJA 1DGSA 1MIUA 4DUYQ 1YIJA 3Q8DA 3S17H 1HR0L 4JI3Q 3JAMc 4XTCS 1Q12A 1QZGA 4X64Q 2LXKA 4DR6Q 4JBKA 3A5UA 4JI6Q 4BA2I 1RIPA 1IYJB 4YHHL 4R4OA 2GN5A 4IPCA 4L5QA 4BY7G 3A0JA 2UUAQ 3EBEA 1K83H 2OQKA 4R4CA 1J5EQ 4B3SL 3KDFA 2VUMH 2Z6KC 4HJ8A 1KRTA 4FDBA 3CMEA 5M3FG 3I2ZA 3D0FA 5IE8A 2HHHL 5FJ8G 1Q82C 2E5LQ 3CCVA 3S1QH 3H3VI 2UXBQ 3CCMA 4WJ4A 3EIVA 2VQFQ 2PMZE 4KI0A 1Q81C 4AQYQ 2N49A 3FP9A 2F4VL 2E8GA 4LFCL 2R93G 1PH1A 1E7ZA 4IPDA 2OTLA 1IBKQ 1EIYB 4L5TA 1WCMH 2A8VA 1B8AA 4HIKA 1N36L 5ELOA 2AMCB 4EX5A 1XPRA 2RCNA 4UP9A 1GO3E 5GROA 1VQ7A 1X3FA 3HOYH 2R7ZH 4YY3L 3W1GA 1XPUA 1BBWA 2MO0A 2WAQE 1TWAH 1AH9A 3GTPH 2F3IA 3K80C 3KF6A 2WB1G 3CQZH 4JV5Q 3AFQA 1CSQA 3BZCA 3GTMH 1AE3A 2QEXA 2KENA 4UPAA 4JI2Q 1VQAA 3S1RH 2HHHQ 4R4TA 4UP8A 5M5YH 4JBWA 3U50C 1BVSA 1NMFA 3PUVA 3RLOA 3RN2A 3SGIA 1G291 1VQ8A 2NVQH 2BH8A 4LUVA 2JE6I 2KBNA 3K7AH 4A3EH 4YCVA 2UU9Q 2UXCL 1T9HA 4A75A 1AE2A 5JJIA 2UXDL 1JJCB 4X66L 3CPFA 3E9IA 4X65Q 4LNQA 3I4MH 1B7YB 2NN6G 2RHSB 1EUJA 1WI5A 1OXUA 3GTJH 4B3ML 4HJ9A 1HNXL 1WCMG 3K0XA 4LFAQ 2F52A 3G6EA 3M4OH 3RN5A 4DV0L 4NB3A 5BR8L 3ERSX 3PUZA 3HOYG 5IWAL 2Z0SA 2K52A 2R7ZG 4DV5Q 4IPGA 2YTXA 1PH2A 4LFBL 4GKJL 2EIFA 1A0IA 5IP9G 1A62A 4GKKL 4DR7Q 2KHJA 2D0OA 1K3RA 2UUBQ 3RR5A 5HGQA 4YWKA 1OXVA 3I56A 5JEAG 4DV4Q 1MJCA 4HIDA 3HOVG 1KXLA 1X55A 1PFSA 1IXRA 1K0RA 2WP8J 2AKWB 3D31A 1QUQA 4X6AH 2LSSA 3CCSA 1VQDA 4JI1Q 3PO3G 5M5XH 1N8RC 4A3EG 4GOPC 4YWMA 4B3RL 2ALYB 4IFDI 1U0LA 4B3MQ 4DK3C 5C3EH 3H3VH 4P71A 4DUZQ 2ZTDA 3AFPA 1TWGH 1YBYA 1YHAA 1Q86C 3M3YH 2CWAA 2JA5G 2B29A 4DV0Q 3PO2H 3CCQA 3T1YQ 1QZHA 2AWOA 2YTYA 2ID0A 4JC0A 1VCIA 5C4JH 4BY7H 1KQSA 2K4KA 3F2CA 1Q1EA 2OQ0A 3UDXA 1KIXA 1JJ2A 1D8LA 1X56A 3OYYA 5FLXc 3AYHB 3GD7A 5IYBH 3PSIA 2K75A 1FL0A 3WWVA 1TWHH 2K5VA 5C0XI 1XMQL 1PH4A 4DR4Q 3T1HL 5IP7H 1I5FA 2XGTA 3J7ZC 1Y14B 4DV1Q 2KCTA 1UE7A 3A5ZB 3UE1A 2JQOA 1KC8C 4QL5A 3CAMA 3HFZB 3UDIA 3NEMA 4JI5L 4GOPA 1YJNA 1Y1WH 1SRUA 1HR0W 4K0KL 3J81i 4YCUA 1W2BA 2IHFA 1PH8A 4P74A 3M85A 4DR1L 1EIFA 2I5MX 2OTJA 2RHQB 1IBLQ 1MKHA 1VS0A 5C3EG 1SROA 1IL2A 1N32L 3HKZG 3OTOL 3UDGA 4JI2L 3PO2G 4X62Q 5FLMH 1QUQB 4DR5L 4IJHA 1B70B 3TREA 1FJGL 3CPWA 4OWXB 4IFDJ 2I0QA 2E2HH 4DNIA 1I6HH 5GAGC 5IYBG 1XNRL 3PV0A 1W3SA 1NMGA 4LUZA 1HZBA 3CW2C 5IYCH 4LF7L 3KJOA 1S40A 4OX9Q 5IP7G 1QVFA 2KHIA 2L15A 1I94Q 1E22A 4BBRH 2NZHA 4A3MH 3W1BA 1UEBA 4DV2L 1GD7A 2Y0SG 4JI7L 2NVTH 1EQRA 4AH6A 5M3MH 2Q2UA 1C7YA 2PQAA 2H5XA 2BH2A 3M9BA 1YZ6A 2DUDA 2JA9A 4DR3L 5C0XJ 1K73C 3I4NH 5GQOA 1M1KC 1Q8KA 1Y1WG 1HNWL 4GNXC 4DR2L 2B63H 1HR0Q 4UP7A 4OONA 1Q1BA 4NXNL 1LTLA 1PHJA 1KAWA 1EFWA 3CMAA 1L2FA 3U58A 2QA4A 4KLKA 2ZJQA 3FKIH 4C3JH 1J6QA 4YHHQ 3CXCA 4IOAA 3CC7A 1FJGQ 3E0EA 1FVIA 1I50H 2EQSA 5FLMG 4GOPB 5IP9H 1EYGA 4B3SQ 1X54A 1L1OA 3H0GH 1BBUA 3K7UC 4YWLA 2YU9H 1KL9A 4LF7Q 3S16H 3EN2A 2VQEL 3RLFA 1P16A 4DAMA 3HOVH 3CCLA 2CCZA 2ES2A 4HJ7A 3TRZA 3KF8B 1PV4A 1UWVA 4DV2Q 4POFA 5IYCG 2E2JH 2VW9A 4A3JH 1VQLA 4YCWA 5C4XH 2MNAA 4BBRG 1N34L 3I4OA 4A3MG 4BA1I 3ULJA 2F4VQ 4QJFA 5M3MG 4LFCQ 4GNXA 1GVPA 4JI4L 1E1TA 4QQBX 3I4NG 3HOWH 1PA6A 2BA0A 3CCEA 4NXNQ 1QVCA 3M4PA 4LWCA 3KDFB 1N36Q 2B63G 4A93G 2JA5H 1ASZA 4OO1G 2VZAA 4YY3Q 4LF8L 1VQGA 1R9TH 4P72A 1PH9A 2R6GA 4GLVB 3RNUA 1OXTA 3FKIG 4DV6L 1L0WA 1HJPA 1XNQL 4IFDG 2PQAB 3ULPA 5LMNL 5HY6A 3GDEA 5AJ3L 1G6PA 2DGYA 1IBML 1XTDA 4PZ7A 1VQ9A 4LF4L 3M7NA 2K14A 1VQMA 3H0GG 4PG3A 3L0OA 4HIOA 2N3SA 4IPHA 4H02A 1VQ6A 1N34Q 4OWTB 1GKHA 1Q7YC 1YHQA 3TQYA 1Z47A 3B6YA 4A3JG 1YJWA 4AYBG 1NBWA 3HKSA 1JMCA 2UXDQ 4X66Q 5C4XG 4HIMA 2AWNA 1VQFA 4DV7L 4JI4Q 1P8LA 2Q2HA 3HOXG 2HIXA 1IZ6A 4P75A 1SMXA 2WFWA 3UE0A 1NJIC 4LF6L 2JA8H 3KF6B 1HNXQ 4BBSG 3BU2A 3HOWG 4GN4B 4LF5L 3STBD 4A3BH 2PNHA 2OWOA 2BA1A 1YJ9A 2NVXH 1GM5A 5BR8Q 1I3QH 1KRSA 5IWAQ 1VQCA 3PIOA 3E9HA 3CP0A 1XMOL 4QY7A 4LW1A 2OCEA 3KJPA 4JI8L 1A8VA 3RLNA 4LFBQ 1IBMQ 4RMFA 1HZCA 4XIGS 1VQEA 3ULLA 4HJAA 4GKKQ 4GNXB 1JT8A 4C2MH 2D0PA 2HT1A 3KYHC 4R4IA 2ASBA 3PO3H 3F8TA 4QGUA 3PUXA 3IRBA 1VQ5A 3HOZH 3CC4A 3KLWA 4WJ3M 4L5RC 2YTVA 1VQOA 1G51A 4DUYL 2MFIA 1X3GA 4A3CH 1PH3A 1YVCA 4P73A 4IOCA 4A76A 4B3RQ 4X64L 1JE5A 2JEBI 4L5SA 1WFQA 3KFUA 4DR6L 4B3TL 1EWIA 1YI2A 4JI6L 4A3GH 4A3DH 1UE6A 4GKJQ 3LGJA 2JA8G 3MEFA 3RZOH 2V1CC 1CKOA 3GO5A 2D62A 4A3BG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC Q;  1J5E L;  4JBM A;  2ZJP A;  2C35 B;  4JI8 Q;  5H1S E;  4DKA C;  2GVB A;  2YV5 A;  1C0A A;  3NBH B;  5J3B A;  5M5W H;  1V43 A;  2K5H A;  3AQQ A;  1XMQ Q;  2I5L X;  1X65 A;  5LMU L;  3GTG H;  3T1H Q;  2E5L L;  2IX0 A;  2FXQ A;  1S3O A;  3ICE A;  2JA6 H;  1L1O C;  2UXB L;  1H95 A;  2VQF L;  4ALP A;  2Q2I A;  1CSP A;  5IY0 A;  4NXM L;  1PYS B;  4AQY L;  1KHI A;  3BZK A;  4NPS A;  5EAY A;  3UDF A;  2R7F A;  4C3I H;  2K50 A;  4DV3 L;  4BY1 H;  4JOI A;  3J81 j;  3NEN A;  3HOZ G;  1IBK L;  4JI5 Q;  1A63 A;  3TEH B;  2E2I H;  1JB7 A;  3HKZ E;  4K0K Q;  1CKN A;  1E24 A;  2LXJ A;  4A3I H;  4B3T Q;  4MZ9 A;  4A3C G;  4PZ6 A;  1PH6 A;  1SN8 A;  4DR1 Q;  3CF5 A;  1HZA A;  1FGU A;  2UUC L;  4A93 H;  5E7N A;  2ZJR A;  2ATW A;  3G71 A;  4A3G G;  4A3D G;  3ZJY C;  4IO9 A;  2VY3 A;  1N32 Q;  4A4I A;  3OTO Q;  4DR5 Q;  4JV5 L;  2RF4 A;  4MTN A;  5JEA J;  1VQH A;  4Y52 H;  1UE5 A;  1NTG A;  1SE8 A;  2IT1 A;  2Y0S E;  3NEL A;  1Q46 A;  2WAQ G;  1OXS C;  4JBJ A;  4TVA B;  4PMW A;  4C3H H;  3ER0 A;  3I55 A;  5LMU Q;  3PF4 A;  3M4Q A;  3G4S A;  1XNR Q;  4JCV E;  4NXM Q;  4OWW B;  2UU9 L;  1CKM A;  4DV3 Q;  1Y1V H;  5ELN A;  1SR3 A;  4O2D A;  1PH5 A;  2JA6 G;  2JA7 G;  3GTL H;  3DLL A;  3CC2 A;  3J80 i;  4JI7 Q;  1PVO A;  4X65 L;  1PH7 A;  4BY1 G;  1HZ9 A;  4DR3 Q;  4J15 A;  1CUK A;  1BKB A;  1LYL A;  1O7I A;  2MO1 A;  4AIM A;  1OXX K;  4MNO A;  3J81 c;  3HOX H;  1NY4 A;  2JJQ A;  4DR2 Q;  2UUC Q;  3S2D H;  4DAY B;  2ZTC A;  5C44 H;  4A3I G;  4A3K H;  4R4Q A;  4LFA L;  4BBS H;  5IYD H;  2A19 A;  5IT9 c;  5K36 G;  1K8G A;  3MXN B;  4DV5 L;  2WB1 E;  1VQP A;  2Q2T A;  2Z6K A;  2R7D A;  1D7Q A;  3TS0 A;  3J7A 5;  1Z9F A;  4IJL A;  3PIP A;  4DR7 L;  1E3P A;  2IHE A;  5LMN W;  1X6O A;  2UUB L;  2VUM G;  3PF5 A;  1S72 A;  3CD6 A;  3S1N H;  3K8A A;  4DV4 L;  2EXD A;  1LM0 A;  1RL2 A;  4KHZ A;  3L2P A;  3PGZ A;  2IY5 B;  2CWP A;  4KHP L;  1CKN B;  2HQL A;  1X9N A;  1M90 C;  3AEV A;  2K5N A;  4EQ5 A;  2R92 H;  1WYD A;  2VS1 A;  2VQE Q;  2IX1 A;  4BXX H;  4JYA Q;  2AHO B;  1X3E A;  3TS2 A;  4JI1 L;  3DM3 A;  1K8A C;  4JI0 L;  1U5K A;  3JC6 6;  4POG A;  1Y1V G;  3CCJ A;  4LUO A;  1SFO H;  1SLJ A;  1VQJ A;  2A1A A;  3S24 A;  3JAM i;  4DUZ L;  1WOC A;  4Y7N H;  2ZM6 L;  5C0X G;  3STB C;  3L7Z C;  3S14 H;  3T1Y L;  4UY8 C;  1L1O B;  1UE1 A;  3PUY A;  5IYD G;  5C44 G;  4A3K G;  4JYA L;  4O0A A;  1N33 L;  2PI2 E;  1PYB A;  1YIT A;  1VQN A;  4HJ5 A;  2N8N A;  5GAE C;  4LF8 Q;  1K9M C;  4LF9 L;  1ASY A;  5GAH C;  1YHB A;  3F2B A;  2JK8 A;  4DV6 Q;  1XNQ Q;  3HOU H;  4DR4 L;  2NN6 I;  1JJG A;  2QGQ A;  1HNZ L;  4A3F H;  2NZO A;  5DLQ E;  4KHP Q;  5LMN Q;  4DV1 L;  1EQQ A;  5AJ3 Q;  4OO1 I;  4LF4 Q;  1LUZ A;  4AYB E;  1OTC A;  2NVY H;  5GAD C;  2B3G A;  2VL6 A;  1TWC H;  4A3L G;  2R92 G;  4PZ8 A;  4R1J A;  1XPO A;  1YNX A;  1VQ4 A;  3RZD H;  1MJE A;  4JI0 Q;  2CFM A;  2CKZ B;  3F1Z A;  1VQB A;  3J80 c;  1NE3 A;  4BXX G;  2VNU D;  5JJL A;  1EOV A;  1V9P A;  2HIV A;  2XTI A;  3I7F A;  4DPG A;  4GLX A;  3VDY A;  3W5O A;  3S15 H;  3FHW A;  3S1M H;  3A74 A;  5JJK A;  3I4M G;  1VQI A;  3PCO B;  3GTO H;  4JOI C;  2ZM6 Q;  4DV7 Q;  3K81 C;  4JI3 L;  2I5H A;  1VQK A;  1IBL L;  1WJJ A;  1HNW Q;  2N78 A;  4LF6 Q;  3PUW A;  3U4Z A;  4JG2 A;  1YEZ A;  1N33 Q;  3H15 A;  4LF5 Q;  3GTK H;  1C9O A;  4ME3 A;  2GVA A;  4X62 L;  3G48 A;  4OXP A;  2CQO A;  4LF9 Q;  1E1O A;  2JEA I;  2UUA L;  3S2H H;  4GN3 B;  1HH2 P;  1V1Q A;  1XMO Q;  1HNZ Q;  1N9W A;  5M3F H;  4GLA C;  1QVG A;  3GTQ H;  2MQH A;  4RG1 A;  4GN5 A;  2KCM A;  2YYZ A;  4DK6 C;  1XJV A;  4A3L H;  5FJ8 H;  2ZTE A;  4OX9 L;  3HOU G;  3OW2 A;  4A3F G;  1I94 L;  3CCR A;  4APV A;  1TXY A;  3BJU A;  2JA7 H;  3U4V A;  2R93 H;  2PI2 A;  4GS3 A;  4QIW E;  3CCU A;  1KD1 C;  1TWF H;  3F2D A;  4TQU S;  3KOJ A;  1DGS A;  1MIU A;  4DUY Q;  1YIJ A;  3Q8D A;  3S17 H;  1HR0 L;  4JI3 Q;  3JAM c;  4XTC S;  1Q12 A;  1QZG A;  4X64 Q;  2LXK A;  4DR6 Q;  4JBK A;  3A5U A;  4JI6 Q;  4BA2 I;  1RIP A;  1IYJ B;  4YHH L;  4R4O A;  2GN5 A;  4IPC A;  4L5Q A;  4BY7 G;  3A0J A;  2UUA Q;  3EBE A;  1K83 H;  2OQK A;  4R4C A;  1J5E Q;  4B3S L;  3KDF A;  2VUM H;  2Z6K C;  4HJ8 A;  1KRT A;  4FDB A;  3CME A;  5M3F G;  3I2Z A;  3D0F A;  5IE8 A;  2HHH L;  5FJ8 G;  1Q82 C;  2E5L Q;  3CCV A;  3S1Q H;  3H3V I;  2UXB Q;  3CCM A;  4WJ4 A;  3EIV A;  2VQF Q;  2PMZ E;  4KI0 A;  1Q81 C;  4AQY Q;  2N49 A;  3FP9 A;  2F4V L;  2E8G A;  4LFC L;  2R93 G;  1PH1 A;  1E7Z A;  4IPD A;  2OTL A;  1IBK Q;  1EIY B;  4L5T A;  1WCM H;  2A8V A;  1B8A A;  4HIK A;  1N36 L;  5ELO A;  2AMC B;  4EX5 A;  1XPR A;  2RCN A;  4UP9 A;  1GO3 E;  5GRO A;  1VQ7 A;  1X3F A;  3HOY H;  2R7Z H;  4YY3 L;  3W1G A;  1XPU A;  1BBW A;  2MO0 A;  2WAQ E;  1TWA H;  1AH9 A;  3GTP H;  2F3I A;  3K80 C;  3KF6 A;  2WB1 G;  3CQZ H;  4JV5 Q;  3AFQ A;  1CSQ A;  3BZC A;  3GTM H;  1AE3 A;  2QEX A;  2KEN A;  4UPA A;  4JI2 Q;  1VQA A;  3S1R H;  2HHH Q;  4R4T A;  4UP8 A;  5M5Y H;  4JBW A;  3U50 C;  1BVS A;  1NMF A;  3PUV A;  3RLO A;  3RN2 A;  3SGI A;  1G29 1;  1VQ8 A;  2NVQ H;  2BH8 A;  4LUV A;  2JE6 I;  2KBN A;  3K7A H;  4A3E H;  4YCV A;  2UU9 Q;  2UXC L;  1T9H A;  4A75 A;  1AE2 A;  5JJI A;  2UXD L;  1JJC B;  4X66 L;  3CPF A;  3E9I A;  4X65 Q;  4LNQ A;  3I4M H;  1B7Y B;  2NN6 G;  2RHS B;  1EUJ A;  1WI5 A;  1OXU A;  3GTJ H;  4B3M L;  4HJ9 A;  1HNX L;  1WCM G;  3K0X A;  4LFA Q;  2F52 A;  3G6E A;  3M4O H;  3RN5 A;  4DV0 L;  4NB3 A;  5BR8 L;  3ERS X;  3PUZ A;  3HOY G;  5IWA L;  2Z0S A;  2K52 A;  2R7Z G;  4DV5 Q;  4IPG A;  2YTX A;  1PH2 A;  4LFB L;  4GKJ L;  2EIF A;  1A0I A;  5IP9 G;  1A62 A;  4GKK L;  4DR7 Q;  2KHJ A;  2D0O A;  1K3R A;  2UUB Q;  3RR5 A;  5HGQ A;  4YWK A;  1OXV A;  3I56 A;  5JEA G;  4DV4 Q;  1MJC A;  4HID A;  3HOV G;  1KXL A;  1X55 A;  1PFS A;  1IXR A;  1K0R A;  2WP8 J;  2AKW B;  3D31 A;  1QUQ A;  4X6A H;  2LSS A;  3CCS A;  1VQD A;  4JI1 Q;  3PO3 G;  5M5X H;  1N8R C;  4A3E G;  4GOP C;  4YWM A;  4B3R L;  2ALY B;  4IFD I;  1U0L A;  4B3M Q;  4DK3 C;  5C3E H;  3H3V H;  4P71 A;  4DUZ Q;  2ZTD A;  3AFP A;  1TWG H;  1YBY A;  1YHA A;  1Q86 C;  3M3Y H;  2CWA A;  2JA5 G;  2B29 A;  4DV0 Q;  3PO2 H;  3CCQ A;  3T1Y Q;  1QZH A;  2AWO A;  2YTY A;  2ID0 A;  4JC0 A;  1VCI A;  5C4J H;  4BY7 H;  1KQS A;  2K4K A;  3F2C A;  1Q1E A;  2OQ0 A;  3UDX A;  1KIX A;  1JJ2 A;  1D8L A;  1X56 A;  3OYY A;  5FLX c;  3AYH B;  3GD7 A;  5IYB H;  3PSI A;  2K75 A;  1FL0 A;  3WWV A;  1TWH H;  2K5V A;  5C0X I;  1XMQ L;  1PH4 A;  4DR4 Q;  3T1H L;  5IP7 H;  1I5F A;  2XGT A;  3J7Z C;  1Y14 B;  4DV1 Q;  2KCT A;  1UE7 A;  3A5Z B;  3UE1 A;  2JQO A;  1KC8 C;  4QL5 A;  3CAM A;  3HFZ B;  3UDI A;  3NEM A;  4JI5 L;  4GOP A;  1YJN A;  1Y1W H;  1SRU A;  1HR0 W;  4K0K L;  3J81 i;  4YCU A;  1W2B A;  2IHF A;  1PH8 A;  4P74 A;  3M85 A;  4DR1 L;  1EIF A;  2I5M X;  2OTJ A;  2RHQ B;  1IBL Q;  1MKH A;  1VS0 A;  5C3E G;  1SRO A;  1IL2 A;  1N32 L;  3HKZ G;  3OTO L;  3UDG A;  4JI2 L;  3PO2 G;  4X62 Q;  5FLM H;  1QUQ B;  4DR5 L;  4IJH A;  1B70 B;  3TRE A;  1FJG L;  3CPW A;  4OWX B;  4IFD J;  2I0Q A;  2E2H H;  4DNI A;  1I6H H;  5GAG C;  5IYB G;  1XNR L;  3PV0 A;  1W3S A;  1NMG A;  4LUZ A;  1HZB A;  3CW2 C;  5IYC H;  4LF7 L;  3KJO A;  1S40 A;  4OX9 Q;  5IP7 G;  1QVF A;  2KHI A;  2L15 A;  1I94 Q;  1E22 A;  4BBR H;  2NZH A;  4A3M H;  3W1B A;  1UEB A;  4DV2 L;  1GD7 A;  2Y0S G;  4JI7 L;  2NVT H;  1EQR A;  4AH6 A;  5M3M H;  2Q2U A;  1C7Y A;  2PQA A;  2H5X A;  2BH2 A;  3M9B A;  1YZ6 A;  2DUD A;  2JA9 A;  4DR3 L;  5C0X J;  1K73 C;  3I4N H;  5GQO A;  1M1K C;  1Q8K A;  1Y1W G;  1HNW L;  4GNX C;  4DR2 L;  2B63 H;  1HR0 Q;  4UP7 A;  4OON A;  1Q1B A;  4NXN L;  1LTL A;  1PHJ A;  1KAW A;  1EFW A;  3CMA A;  1L2F A;  3U58 A;  2QA4 A;  4KLK A;  2ZJQ A;  3FKI H;  4C3J H;  1J6Q A;  4YHH Q;  3CXC A;  4IOA A;  3CC7 A;  1FJG Q;  3E0E A;  1FVI A;  1I50 H;  2EQS A;  5FLM G;  4GOP B;  5IP9 H;  1EYG A;  4B3S Q;  1X54 A;  1L1O A;  3H0G H;  1BBU A;  3K7U C;  4YWL A;  2YU9 H;  1KL9 A;  4LF7 Q;  3S16 H;  3EN2 A;  2VQE L;  3RLF A;  1P16 A;  4DAM A;  3HOV H;  3CCL A;  2CCZ A;  2ES2 A;  4HJ7 A;  3TRZ A;  3KF8 B;  1PV4 A;  1UWV A;  4DV2 Q;  4POF A;  5IYC G;  2E2J H;  2VW9 A;  4A3J H;  1VQL A;  4YCW A;  5C4X H;  2MNA A;  4BBR G;  1N34 L;  3I4O A;  4A3M G;  4BA1 I;  3ULJ A;  2F4V Q;  4QJF A;  5M3M G;  4LFC Q;  4GNX A;  1GVP A;  4JI4 L;  1E1T A;  4QQB X;  3I4N G;  3HOW H;  1PA6 A;  2BA0 A;  3CCE A;  4NXN Q;  1QVC A;  3M4P A;  4LWC A;  3KDF B;  1N36 Q;  2B63 G;  4A93 G;  2JA5 H;  1ASZ A;  4OO1 G;  2VZA A;  4YY3 Q;  4LF8 L;  1VQG A;  1R9T H;  4P72 A;  1PH9 A;  2R6G A;  4GLV B;  3RNU A;  1OXT A;  3FKI G;  4DV6 L;  1L0W A;  1HJP A;  1XNQ L;  4IFD G;  2PQA B;  3ULP A;  5LMN L;  5HY6 A;  3GDE A;  5AJ3 L;  1G6P A;  2DGY A;  1IBM L;  1XTD A;  4PZ7 A;  1VQ9 A;  4LF4 L;  3M7N A;  2K14 A;  1VQM A;  3H0G G;  4PG3 A;  3L0O A;  4HIO A;  2N3S A;  4IPH A;  4H02 A;  1VQ6 A;  1N34 Q;  4OWT B;  1GKH A;  1Q7Y C;  1YHQ A;  3TQY A;  1Z47 A;  3B6Y A;  4A3J G;  1YJW A;  4AYB G;  1NBW A;  3HKS A;  1JMC A;  2UXD Q;  4X66 Q;  5C4X G;  4HIM A;  2AWN A;  1VQF A;  4DV7 L;  4JI4 Q;  1P8L A;  2Q2H A;  3HOX G;  2HIX A;  1IZ6 A;  4P75 A;  1SMX A;  2WFW A;  3UE0 A;  1NJI C;  4LF6 L;  2JA8 H;  3KF6 B;  1HNX Q;  4BBS G;  3BU2 A;  3HOW G;  4GN4 B;  4LF5 L;  3STB D;  4A3B H;  2PNH A;  2OWO A;  2BA1 A;  1YJ9 A;  2NVX H;  1GM5 A;  5BR8 Q;  1I3Q H;  1KRS A;  5IWA Q;  1VQC A;  3PIO A;  3E9H A;  3CP0 A;  1XMO L;  4QY7 A;  4LW1 A;  2OCE A;  3KJP A;  4JI8 L;  1A8V A;  3RLN A;  4LFB Q;  1IBM Q;  4RMF A;  1HZC A;  4XIG S;  1VQE A;  3ULL A;  4HJA A;  4GKK Q;  4GNX B;  1JT8 A;  4C2M H;  2D0P A;  2HT1 A;  3KYH C;  4R4I A;  2ASB A;  3PO3 H;  3F8T A;  4QGU A;  3PUX A;  3IRB A;  1VQ5 A;  3HOZ H;  3CC4 A;  3KLW A;  4WJ3 M;  4L5R C;  2YTV A;  1VQO A;  1G51 A;  4DUY L;  2MFI A;  1X3G A;  4A3C H;  1PH3 A;  1YVC A;  4P73 A;  4IOC A;  4A76 A;  4B3R Q;  4X64 L;  1JE5 A;  2JEB I;  4L5S A;  1WFQ A;  3KFU A;  4DR6 L;  4B3T L;  1EWI A;  1YI2 A;  4JI6 L;  4A3G H;  4A3D H;  1UE6 A;  4GKJ Q;  3LGJ A;  2JA8 G;  3MEF A;  3RZO H;  2V1C C;  1CKO A;  3GO5 A;  2D62 A;  4A3B G; 
#chains in the Genus database with same CATH topology
 1J5E L;  1GUT A;  5IIF A;  4TSS A;  3JAM E;  5A2Q L;  4N9T A;  1PRT D;  1PTO H;  5IGD A;  1STH A;  5J3B A;  1PTO B;  1CQF A;  1V43 A;  1RF2 D;  3E6Z X;  2HCI A;  5LMU L;  1EU3 A;  3HZX A;  3ICE A;  2IX0 A;  1S3O A;  2JA6 H;  1FR3 A;  2VQF L;  2ENB A;  5IY0 A;  4NXM L;  2JA6 B;  4DNR B;  1KHI A;  3HS0 C;  4NPS A;  5EAY A;  1A3U A;  4BY1 H;  4JOI A;  3J81 j;  4BY1 B;  1S5E D;  1JWU D;  3GV6 A;  4BBR B;  1BF4 A;  3HKZ E;  4PV1 C;  4A3C G;  4A93 H;  3M4Y A;  3X3M A;  4A93 B;  4A3D G;  3U9O A;  2PO4 A;  3K5L A;  1WVL A;  4A4I A;  3OTO Q;  4OHJ A;  1G91 A;  1CM9 A;  4JV5 L;  2RF4 A;  2ZXO A;  1Q3L A;  4MTN A;  5JEA J;  1UE5 A;  1NTG A;  2Y0S E;  4EQO A;  3VYT A;  4JBJ A;  3MHB A;  5LMU Q;  4K14 A;  4C3H H;  1O7Z A;  3T13 A;  3G6J B;  3OMG A;  4NXM Q;  3H0G B;  1H9M A;  2Q8R E;  5JJZ A;  3S16 B;  3A54 A;  3DLL A;  5K5P A;  5A2Q E;  2BOS A;  4XDX A;  1BNZ A;  2F03 A;  1HNW Q;  1LYL A;  1O7I A;  2MO1 A;  2O2L D;  4MNO A;  4AIM A;  3J81 c;  1NY4 A;  4DAY B;  2ZTC A;  4A3K H;  2DY7 A;  4LFA L;  4BBS H;  5EGT A;  4A3K B;  4BBS B;  5I6W A;  1PMR A;  5K36 G;  5FO8 B;  2Z6K A;  2TSS A;  4OL7 A;  3TS0 A;  5KIX A;  4UAI A;  4O42 A;  3QOJ A;  3K8A A;  3G7L A;  2EXD A;  2HUG A;  4KHZ A;  1ILP A;  3HGB A;  5D3D A;  1R4P B;  4K5V A;  2OXP A;  1SXT A;  3TS2 A;  1PRT B;  4DAV A;  1K8A C;  1U5K A;  2OEO A;  4POG A;  3P75 A;  4LUO A;  1SFO H;  5EKI A;  1SLJ A;  2Z4I A;  1SFO B;  1QJO A;  1BDO A;  3NUC A;  1WOC A;  4Y7N H;  3ITP A;  4Y7N B;  3GP7 A;  3L7Z C;  1A6X A;  1L1O B;  3PUY A;  4O0A A;  1N33 L;  2PI2 E;  4HJ5 A;  4DNT B;  4CDD C;  5G3L D;  1E2V A;  1K9M C;  3J7Y W;  3KLS X;  4R8N A;  4JPB W;  1DXM A;  2F1M A;  4FF4 A;  1HQR D;  4S3S A;  5LMN Q;  3GV3 A;  4F7X A;  4DV1 L;  4OO1 I;  2N55 A;  2PNR C;  5GAD C;  1TWC H;  4PZ8 A;  3T16 A;  1TWC B;  4B9X A;  3MXG A;  3FRP B;  4BXX G;  2HIV A;  2XTI A;  5KYL A;  3SHL A;  3S1M H;  1RD9 D;  1VQI A;  2EY6 A;  3S1M B;  4JOI C;  2LMC B;  1STN A;  5LL6 S;  4LF6 Q;  1IW7 D;  1I4X A;  3NTK A;  4RKB A;  1YEZ A;  1N33 Q;  2P5Z X;  2F0S A;  3GTK H;  1C9O A;  3G48 A;  4J6H A;  5CMD A;  2MUY A;  2JEA I;  1CHP D;  3MEH A;  3OOC A;  4DU9 A;  4GN3 B;  2BE5 C;  3SE0 A;  5FJ8 H;  4YIJ A;  4A3F G;  4APV A;  4XQN A;  4HAE A;  3BJU A;  4DK0 A;  2R93 H;  2PI2 A;  1VDZ A;  2AQ3 B;  2R93 B;  2IWH A;  4TQU S;  2G9D A;  3MTS A;  1DGS A;  1MIU A;  1EEI D;  1H9J A;  3S17 H;  3S17 B;  2E74 C;  4XTC S;  1QZG A;  4X64 Q;  2QCP X;  1IYJ B;  4IZ8 A;  4YHH L;  1QNU A;  2RCF A;  4IPC A;  1WTO A;  1SYC A;  1BCP C;  3KDF A;  2Z6K C;  1F9S A;  3I2Z A;  3D0F A;  2NTT A;  2HHH L;  3I72 A;  3EIV A;  4RHS A;  4KI0 A;  1DJR D;  3FP9 A;  2E8G A;  2OTL A;  4IPD A;  2XRS D;  4L5T A;  1WCM H;  1D1K A;  5ELF A;  1HA6 A;  1WCM B;  1UEA B;  5FO7 B;  1XYI A;  1TU2 B;  4UP9 A;  1VQ7 A;  3MAQ A;  4LJZ C;  1WD1 A;  2F3I A;  3K80 C;  2VB2 X;  2FIN B;  2WB1 G;  4XT1 B;  3GTM H;  3FPP A;  2QEX A;  4JI2 Q;  3GTM B;  3S1R H;  2HHH Q;  2LS0 1;  1YNN D;  3U50 C;  1BVS A;  1JR0 D;  3PUV A;  3S1R B;  2K6A A;  1G29 1;  1VQ8 A;  4LUV A;  2UU9 Q;  2UXC L;  4UHV A;  1WI5 A;  1HNX L;  1JWS D;  2EDG A;  5C6A A;  1D6E C;  5BR8 L;  3HOY G;  3PUZ A;  4ID6 A;  1KNA A;  2I46 A;  1PH2 A;  1XWE A;  1CZW A;  2IL8 A;  4RA8 A;  2D0O A;  1BUV T;  3A56 A;  4DXF A;  4YWK A;  5TSS A;  3EQL C;  4HID A;  3QB3 A;  1KXL A;  1X55 A;  1IXR A;  1K0R A;  2WP8 J;  1STY A;  5A35 A;  4X6A H;  1VQD A;  4JI1 Q;  2DJF C;  1ZKO A;  1U4P A;  1SJH D;  3RZD B;  4B3R L;  2ALY B;  1B1Z A;  1G6Z A;  4H7B A;  4KKT A;  3M3Y H;  2O4X A;  2ZTD A;  3A55 A;  1YBY A;  2JA5 G;  2B29 A;  3CCQ A;  1LT5 D;  3T1Y Q;  2ID0 A;  2WV6 D;  1KQS A;  3A7A B;  3F2C A;  1Q1E A;  2OQ0 A;  2QW7 A;  3OYY A;  5FLX c;  4H0L C;  1L0Y B;  4ZKB B;  2MP1 A;  3PSI A;  3DHQ A;  5I4D A;  1XMQ L;  1PH4 A;  2K5V A;  3SK4 A;  3T1H L;  2QEJ C;  1SYB A;  1ICF B;  1Y8P B;  3K5N A;  2KCT A;  5J39 A;  3FVQ A;  2JQO A;  2K32 A;  3NXW A;  1D1I A;  1T5E A;  3NEM A;  1Y1W H;  4QUF A;  3J7A F;  4K0K L;  1Y1W B;  4PNY A;  4YCU A;  5ELB A;  4H44 C;  2IHF A;  3TP7 A;  1TT2 A;  2E76 C;  2EJG C;  2OTJ A;  2RHQ B;  1IBL Q;  5CV8 A;  1EQT A;  5CYU A;  1SRO A;  5T1G A;  4FF2 A;  3UDG A;  2N88 A;  3PO2 G;  2K5W A;  1QUQ B;  3A8K E;  3T53 B;  3I3C A;  1EEF D;  2I0Q A;  2E2H H;  2WB1 B;  1STA A;  3MXN A;  2E2H B;  4JW0 A;  1XNR L;  3I70 A;  4LUZ A;  1HZB A;  4OX9 Q;  1GOZ A;  1QVF A;  3L3O C;  2KHI A;  1I94 Q;  1E22 A;  2NZH A;  4FXK C;  3NK9 A;  1EQV A;  2RA4 A;  4HN7 A;  4RCO A;  2PQA A;  4CJ1 B;  1FNW A;  4DR3 L;  3I4N H;  1M1K C;  1ZYR C;  4DR2 L;  2B63 H;  1HR0 Q;  1ENA A;  1AP0 A;  4NXN L;  1PHJ A;  3CMA A;  3DXJ C;  1TR5 A;  3FKI H;  2ZJQ A;  4IOA A;  1HFN A;  2ZXR A;  4NP5 A;  1NR2 A;  1FVI A;  5FLM G;  2A74 C;  1TWA B;  4RHR A;  1SE2 A;  2M2L A;  4WRD A;  2A68 C;  3RLF A;  4DAM A;  2FFK B;  2ES2 A;  3KF8 B;  2EYJ A;  5IYC G;  3A7L A;  2E2J H;  4V0B A;  2E2J B;  5D3I B;  3I4O A;  2F4V Q;  2NVQ B;  5M3M G;  1QCB D;  2F0F A;  2WKC A;  3K6O A;  1QNK A;  4HSP A;  5FOB B;  4IAL A;  4NXN Q;  1WTH A;  2JA5 H;  2PZW A;  2B8F A;  2JA5 B;  4LF8 L;  1F9P A;  3A8J E;  1PH9 A;  4C3J G;  3SDZ A;  1ZEQ X;  1L0W A;  4IFD G;  3ULP A;  1G6P A;  2DGY A;  2K14 A;  1VQM A;  1VMP A;  4G7O C;  4ABN A;  3SVM A;  2N3S A;  1VQ6 A;  2NZ1 D;  2XVS A;  3S9W A;  1GKH A;  1Q7Y C;  1KAB A;  4A3J G;  1Z47 A;  3B6Y A;  3WDN A;  1NBW A;  3HKS A;  2UXD Q;  4RKL A;  1VQF A;  4DV7 L;  1HQM C;  1IZ6 A;  2WFW A;  2G9H D;  4NW2 A;  3HOW G;  2PNH A;  2OWO A;  3R8B A;  3PMF A;  2A6E C;  4DGZ A;  1KRS A;  5HGT A;  5IWA Q;  3E9H A;  4LW1 A;  3IKJ A;  4LFB Q;  3HG9 A;  5C4H A;  4HJA A;  4GNX B;  1Y8O B;  3KYH C;  4ZAI A;  4K5W A;  2F0W A;  2TMP A;  4ZUJ A;  3HOZ H;  3NSW A;  3KLW A;  2IJ0 A;  4DUY L;  3I90 A;  1UUP A;  3OSO A;  3BVG A;  3HP3 A;  4Z9C B;  1PH3 A;  1YVC A;  4P73 A;  5NUC A;  4L5S A;  3KFU A;  2FMC A;  1U9R A;  3D6W A;  2HDL A;  4EGV A;  2D62 A;  4XQQ A;  4JBM A;  2ZJP A;  3M7G A;  2F0K A;  4DKA C;  1XXG A;  2WAQ B;  2BE5 D;  2K5H A;  4DF7 A;  1FD7 D;  2RBM A;  2O5J C;  2Q2I A;  1PYS B;  4AQY L;  3PO3 G;  4K5X A;  3QO2 A;  4OIK A;  2R7F A;  2K50 A;  1FNV A;  3N52 A;  1DCZ A;  3OIQ A;  4JI5 Q;  3TEH B;  2E2I H;  4KN4 C;  3V96 A;  1JB7 A;  2E2I B;  2NVT B;  5IOD A;  1CKN A;  1E24 A;  4KV6 A;  3CRK C;  4A3I H;  4MZ9 A;  4O1N A;  1PH6 A;  4DR1 Q;  5E7N A;  4A3G G;  1RJT A;  4OEM B;  4IO9 A;  1N32 Q;  3EFX D;  1Q90 A;  1VQH A;  4C3J B;  1BCP D;  4IFD H;  4Y52 H;  1Q46 A;  4FVM A;  1OXS C;  1SNP A;  4TVA B;  3PF4 A;  3URY A;  1GHK A;  1D5M C;  5KNB A;  5COY A;  1ET6 A;  1CKM A;  2JA6 G;  1Y1V H;  4G7Z C;  2JA7 G;  4JYA L;  1PRT F;  2NYZ D;  1Y1V B;  3J80 i;  3VYU A;  4B08 A;  4X65 L;  4BY1 G;  1HZ9 A;  4A3J B;  5C0X H;  2VB3 X;  1BKB A;  1OXX K;  3S2D H;  5C44 H;  3S2D B;  4L8J A;  4R4Q A;  1HRJ A;  5C44 B;  3KUP A;  1TY2 A;  4DV5 L;  4TKO B;  1EFI D;  2R7D A;  1D7Q A;  2MGS A;  2LFN A;  5FLX L;  1Z9F A;  1M4V A;  3LWE A;  4DR7 L;  2WAC A;  2IHE A;  2UUB L;  3CD6 A;  4LMQ D;  4DV4 L;  1V1O A;  3PGZ A;  3H94 A;  3H91 A;  2R92 H;  3NWS A;  1WYD A;  4C3H G;  1EY5 A;  1ZXT A;  2VQE Q;  2R92 B;  4JYA Q;  4KK7 A;  2BCO A;  2F0V A;  5I2Y A;  2F4I A;  2J0T D;  1TS2 A;  4CDC C;  3CCJ A;  1DON A;  3SEB A;  3FMC A;  3S24 A;  4U67 3;  4DUZ L;  1JQY D;  3STB C;  1CQV A;  3S14 H;  1UE1 A;  4A3K G;  3S14 B;  1QG7 A;  1PYB A;  3TZU A;  4ZYS A;  5GAE C;  5CBA E;  3CRL C;  5GAH C;  1YHB A;  1WTQ A;  1ASY A;  2PW7 A;  4M8A A;  1LUZ A;  4KJO A;  1OTC A;  3NE5 B;  2NVY H;  2NVY B;  1XPO A;  4R1J A;  3NPP A;  5T1I A;  1VQ4 A;  1MJE A;  2CFM A;  3F1Z A;  5FLX E;  1BCP B;  5JJL A;  1I4Q A;  1V9P A;  2EYM A;  3I7F A;  4DPG A;  3A74 A;  2MHV A;  3I4M G;  3PCO B;  1MD2 D;  3K81 C;  1VQK A;  1GUG A;  2N78 A;  3PUW A;  4ULL A;  2K04 A;  4LF5 Q;  1G2T A;  1B3A A;  4ME3 A;  1I6V C;  2GVA A;  4X62 L;  1SDF A;  4OXP A;  4A3G B;  1E1O A;  1NNX A;  3DWA A;  5EBD A;  2UUA L;  1HH2 P;  1V1Q A;  2JYO A;  2RSO A;  1C48 A;  3GTQ H;  4RG1 A;  2KCM A;  2YYZ A;  2ZTE A;  4UDU C;  4KN7 C;  3CCR A;  5G3L F;  2KHS A;  3AU7 A;  1JOQ A;  5FO9 B;  2EY5 A;  2L11 A;  2JA7 H;  4FYD A;  4QIW E;  2JA7 B;  3CCU A;  1TWF H;  3F2D A;  1BBX C;  3KOJ A;  1EIG A;  1TWF B;  2RDF A;  1F2Y A;  1V8Q A;  1DOK A;  1PLF A;  1SND A;  4JI6 Q;  4R4O A;  1Y69 U;  1BOS A;  2GN5 A;  3A0J A;  2UUA Q;  4XYQ A;  2E75 C;  2OQK A;  1J5E Q;  4R4C A;  3F2U A;  1MBY A;  5LL6 X;  1TKW B;  2Q8I B;  1KRT A;  1ICW A;  4FDB A;  1LT3 D;  5FJ8 G;  1F2M A;  4C3H B;  2VQF Q;  1GUS A;  2PMZ E;  3VA5 A;  1Q81 C;  1LAB A;  5JPN C;  4QB4 A;  3T51 B;  4DFA A;  1LLR D;  2R93 G;  2LKV A;  2RVL A;  1E2W A;  1EIY B;  5EKK A;  5CBE E;  4HIK A;  1ZYR D;  3I4L A;  1XPR A;  2RCN A;  1GO3 E;  1X3F A;  5I9P A;  4YY3 L;  3I73 A;  1STG A;  5D14 A;  3GTP H;  4K2K A;  2F0E A;  1H9S A;  1F9R A;  3CQZ H;  4IQZ A;  4JV5 Q;  3AFQ A;  4DA2 A;  3CQZ B;  1NR4 A;  1AE3 A;  3HRZ C;  2J7Z A;  4UPA A;  3EJI A;  1VQA A;  4R4T A;  1G2S A;  4JBW A;  3PQI A;  2A68 D;  1CI3 M;  3QG1 A;  3K7A H;  2K03 A;  4L6T B;  2DNE A;  1ENC A;  1T9H A;  4A75 A;  1DM0 B;  1JJC B;  4X66 L;  1NSN S;  3WOE A;  1F9Q A;  3I4M H;  1B7Y B;  4X3K A;  2F0I A;  4RH6 A;  4ZLT F;  2KEC A;  3I4M B;  2F0Q A;  1WCM G;  2L55 A;  4LFA Q;  3RN5 A;  2JN4 A;  3R2T A;  2Z0S A;  1XTC D;  1DOL A;  1A0I A;  1K3R A;  5EPK A;  5HGQ A;  1OXV A;  4GZY C;  4IUT A;  1K3B C;  4RAU C;  2JXM B;  2LSS A;  5CR3 A;  3TN2 A;  4GOP C;  4YWM A;  1U0L A;  1A2T A;  4P2C B;  4DK3 C;  1JCK B;  3BZD B;  4GKJ L;  4HCE A;  5CV7 A;  1Q86 C;  3MWY W;  2CWA A;  4IUR A;  4X3U A;  2A73 B;  2YTY A;  4JC0 A;  1VCI A;  3HEJ A;  2A6E D;  3GTK B;  2HD3 A;  1D8L A;  2M9V A;  4CGY B;  2HDM A;  2K75 A;  4DV1 Q;  1UE7 A;  1WTP A;  3UE1 A;  1KC8 C;  1S5C D;  3CAM A;  3KLS A;  5FK9 C;  3UDI A;  4FF3 A;  3J81 i;  2F0J A;  2KJX A;  2Q8T A;  3M85 A;  1VS0 A;  3TP6 A;  1TS4 A;  1JE4 A;  2B2T C;  2CH4 W;  1A15 A;  4DR5 L;  1H9R A;  5KRU A;  3TRE A;  1FJG L;  4WOR A;  2K5D A;  2SNS A;  5GAG C;  4X3S A;  4E6I A;  1NMG A;  2PZT A;  5AFW A;  4LF7 L;  4WJW A;  2L12 A;  4A3M H;  1UEB A;  4JI7 L;  1GD7 A;  1I4H A;  2DUD A;  1K73 C;  1Y1W G;  4MN3 A;  1QOH A;  4OO1 H;  4OON A;  1Q1B A;  2B8G A;  2F0P A;  2QA4 A;  3W3A A;  4YHH Q;  1FJG Q;  3RUZ A;  1L1O A;  4YWL A;  3K7U C;  1ONL A;  2YU9 H;  4LF7 Q;  1MHW C;  1PFM A;  5I9O A;  2YU9 B;  2CCZ A;  4HJ7 A;  1PV4 A;  4POF A;  2VW9 A;  3R3O A;  1Y8N B;  4YCW A;  4AYB B;  4BA1 I;  2RQX A;  1PTO C;  4Q0F A;  3I4N G;  4HSV A;  2F0H A;  4LWC A;  3SR1 A;  2B63 G;  1TVX A;  1JIC A;  2VZA A;  3P20 A;  1R9T H;  4P72 A;  3RNU A;  1R9T B;  1OXT A;  3FKI G;  4DV6 L;  1XNQ L;  2PQA B;  4F8M A;  2PYK A;  2F0T A;  5AJ3 L;  1EZ6 A;  5IGF A;  1XTD A;  4PZ7 A;  4LF4 L;  2EY1 A;  3A8I E;  3OIP A;  5BN3 A;  4FNF A;  2UXC Q;  1GUO A;  3TQY A;  3NBH A;  1YJW A;  1RDP D;  5KGU A;  4HIM A;  5I6Y A;  4RGT A;  1P8L A;  1SEB D;  3TSS A;  2HIX A;  5CV9 A;  4P75 A;  3UE0 A;  3VR3 A;  2JA8 H;  3KF6 B;  1HNX Q;  3BU2 A;  5C5L A;  3STB D;  1WTX A;  4A3B H;  4A3B B;  3M3Y B;  1GM5 A;  5BR8 Q;  1I3Q H;  1W6J A;  1KNE A;  1WD0 A;  1I3Q B;  3CP0 A;  4QY7 A;  1XMO L;  2OCE A;  3KJP A;  4JI8 L;  1A8V A;  1HZC A;  3P1H A;  4ZRZ A;  2K7V A;  2ASB A;  4I7A A;  4KD3 A;  3LX0 A;  1QE6 A;  1A3V A;  3IRB A;  1VQ5 A;  5DM7 3;  2J4X A;  2YTV A;  1G51 A;  1SSO A;  4IOC A;  4B3R Q;  1JE5 A;  2JEB I;  2AQ2 B;  1WFQ A;  4DR6 L;  3CHB D;  1YI2 A;  4ILW A;  1C4Q A;  3LGJ A;  3NQT A;  4K8I A;  5F2D A;  2GA4 B;  1K0S A;  4JI8 Q;  4CDF C;  1BR9 A;  2M00 A;  1XMQ Q;  1KDB A;  2AUJ D;  3GTG H;  5COR A;  3T1H Q;  2E5L L;  2UXB L;  3GTG B;  1H95 A;  1L1O C;  4G4K A;  5M9O A;  5DM6 3;  1B50 A;  2KUM A;  3BZK A;  4C3I H;  3UDF A;  2ZT9 C;  4DV3 L;  3WOF A;  4C3I B;  3HOZ G;  1IBK L;  1A63 A;  1BO0 A;  3PIO 3;  3TZD A;  4K0K Q;  3TP8 A;  4IUP A;  4PZ6 A;  2XWB B;  4BWG B;  3I4N B;  2KOL A;  3CF5 A;  1HZA A;  1FGU A;  1S5F D;  2BDO A;  3D4D A;  2IX3 A;  1S5B D;  3G71 A;  2B63 B;  4CJ0 B;  2VY3 A;  3C46 A;  1SE3 A;  2G5D A;  1QB5 D;  3FKI B;  3V05 A;  2XSC A;  3NEL A;  1YJN A;  2WAQ G;  4PMW A;  2F3W A;  2H4O A;  3ER0 A;  1PXU A;  3M4Q A;  2L1B A;  4KY5 A;  1XNR Q;  2X69 A;  1A3T A;  1B9N A;  1LTG D;  3H6M A;  4DV3 Q;  5ELN A;  4O2D A;  1PH5 A;  3GTL H;  1PVO A;  1K8M A;  3GTL B;  5EKL A;  4ODG A;  1PH7 A;  4CDE C;  4DR3 Q;  4J15 A;  1CUK A;  4PMB A;  4DR2 Q;  4A3I G;  5IYD H;  2A19 A;  5IT9 c;  2WB1 E;  1X3Q A;  3X3N A;  1E3P A;  5LMN W;  2VUM G;  1X6O A;  3S1N H;  3ERQ A;  3S1N B;  1LM0 A;  1RL2 A;  3L2P A;  4A3L H;  1CKN B;  2HQL A;  5KNC A;  5JVG 3;  1X9N A;  1MGS A;  2K5N A;  1O7L A;  1Z6H A;  4IUV A;  1STB A;  1X3E A;  2OT2 A;  3DM3 A;  4ZCK A;  2MPM A;  1BCP F;  2B2U A;  2B2V A;  1Y1V G;  2FHT A;  2A1A A;  3JAM i;  4XXE A;  2ZM6 L;  5C0X G;  5C4Z A;  4RWS C;  1HUN A;  3BYT B;  5C44 G;  2N8N A;  4LF8 Q;  1TS5 A;  2A69 C;  3D6C A;  4DAP A;  4DR4 L;  3HOU H;  2NN6 I;  1OO9 B;  2QGQ A;  2R61 A;  3VYR A;  2NZO A;  1E0B A;  3HOU B;  5DLQ E;  1EQQ A;  4CHT B;  1B53 A;  2B3G A;  2HQE A;  2IW3 A;  3NBI A;  5C3W A;  2R92 G;  3C3L A;  4K6L A;  2CKZ B;  1VQB A;  3J80 c;  5JAV A;  3VDY A;  3S15 H;  4GLX A;  3S15 B;  3C2P A;  3HOZ B;  5JJK A;  3P7J A;  3PIP 3;  3GTO H;  1PFN A;  3NTI A;  2ZM6 Q;  4DV7 Q;  3GTO B;  2QF7 A;  1WJJ A;  1ML0 D;  2X6L A;  5I2X A;  1AFP A;  3U4Z A;  4PQX A;  3H15 A;  1V1P B;  2KED A;  2VXW A;  4ZKC B;  2CQO A;  3K0Y A;  3VA7 A;  4DXG A;  5M3F H;  4GLA C;  1QVG A;  5M3F B;  3CU7 A;  1XJV A;  3OW2 A;  5EQ0 A;  2EYF A;  3D8G A;  4K2L A;  1LTS D;  1CZG A;  3U4V A;  1EIH A;  1KD1 C;  1UAP A;  5EBC A;  1HUM A;  4DUY Q;  3K5M A;  1YIJ A;  1F2Z A;  1KDA A;  3KF8 A;  1Q12 A;  1R4Q B;  4KMU C;  2LXK A;  2F3V A;  4JBK A;  4A3I B;  1RCV D;  1GHJ A;  2K1B A;  4BY7 G;  3EBE A;  4B3S L;  1EY4 A;  2VUM H;  2K28 A;  3DWP A;  2VUM B;  4QF4 A;  5IE8 A;  1LT4 D;  1Q82 C;  3S1Q H;  1KAA A;  3CCM A;  1EZ8 A;  3S1Q B;  4X3T A;  3DEP A;  2F0N A;  4AQY Q;  2N49 A;  4LFC L;  2LY7 A;  3TME A;  2NN6 H;  5EPL A;  4ZQ3 A;  3I8Z A;  4KY6 A;  2KEE A;  4IUU A;  2B2U C;  2B2V C;  1N36 L;  5ELO A;  1LT6 D;  2AMC B;  5JOB A;  4EX5 A;  4CBV A;  4F87 A;  2R7Z H;  1XPU A;  1BBW A;  2WAQ E;  2R7Z B;  1FYC A;  5JEA H;  3BZC A;  1FNU A;  2KEN A;  1SMY C;  1B4O A;  5M5Y H;  5KYI A;  1NMF A;  5M5Y B;  2XNA C;  2BH8 A;  4A3E H;  4YCV A;  1AE2 A;  3OWF A;  4KKU A;  4A3E B;  3KBG A;  3CPF A;  3E9I A;  4X65 Q;  4CKC A;  5EPJ A;  1OXU A;  5KEE A;  3GTJ H;  1PTO D;  3MZ5 A;  4HJ9 A;  3GTJ B;  2F52 A;  3G6E A;  2SEB D;  4DV0 L;  4HMJ A;  4DV5 Q;  3QJY A;  4IPG A;  2YTX A;  2MJ8 A;  2EIF A;  4GKK L;  5IP9 G;  4DR7 Q;  5JVH 3;  2UUB Q;  4BS9 A;  2OF1 A;  5E1F A;  4DV4 Q;  2B2W A;  3IAY A;  2V4D A;  4LK1 C;  1PFS A;  2B39 A;  2K01 A;  2SOB A;  2AKW B;  3D31 A;  4CKE A;  5M5X H;  1SE4 A;  1HCZ A;  5M5X B;  3UI2 A;  4Q5V A;  5C3E H;  4DUZ Q;  4HMI A;  5C3E B;  1VF7 A;  4DV0 Q;  1LO5 D;  3HKZ B;  2SNM A;  1S5D D;  2AWO A;  5C4J H;  4BY7 H;  1B44 D;  2K4K A;  5C4J B;  4EQN A;  4BY7 B;  3UDX A;  2EVB A;  1B2T A;  1SNM A;  1X56 A;  2Z1C A;  3AYH B;  1JOO A;  5IYB H;  2NB0 A;  3OHX C;  3WWV A;  1TWH H;  2WKD A;  5IP7 H;  1HXY D;  1LTR D;  2RDG A;  2XGT A;  3J7Z C;  3GTQ B;  2Y0S B;  3HFZ B;  4GOP A;  2PMZ B;  1HR0 W;  1I4P A;  1YNJ C;  4P74 A;  3MVV A;  1B3Q A;  2I5M X;  5IT9 L;  1GJX A;  4HR7 B;  3OTO L;  4X62 Q;  4F88 A;  4IJH A;  2L0C A;  4EQP A;  4IFD J;  3CPW A;  4OWX B;  3TP5 A;  2XN9 C;  4DNI A;  1F77 A;  3CW2 C;  1S40 A;  4R8I A;  4BBR H;  3H3V C;  3W1B A;  4DV2 L;  4AH6 A;  2QIL A;  1C7Y A;  2BH2 A;  1PYW D;  2XWJ B;  5C0X J;  2KCN A;  5GQO A;  1HNW L;  1Q8K A;  1II3 A;  1A2U A;  4GNX C;  4UP7 A;  3KBX A;  1J8I A;  2A6H C;  1LTL A;  2B2T A;  3OWE B;  1EY6 A;  1L2F A;  3U58 A;  4KLK A;  2Z6B A;  2A5H A;  2B2Y A;  3E0E A;  1I50 H;  2EQS A;  1EYG A;  5IP9 H;  1X54 A;  1I50 B;  3GTP B;  3H0G H;  5IT9 E;  1EY0 A;  3S16 H;  3OPO A;  3CCL A;  1UWV A;  3J80 L;  4DV2 Q;  2B2W C;  1VQL A;  2MNA A;  5C4X H;  3SK6 A;  4A3M G;  5C4X B;  1H9K A;  3K7A B;  1KDC A;  2FJ2 A;  4H13 C;  1NCV A;  4JI4 L;  1PA6 A;  2BA0 A;  5BN5 A;  3M4P A;  2R3Z A;  3KDF B;  4OO1 G;  2PCF B;  4KY7 A;  5CC4 A;  4YY3 Q;  4QCL A;  2K05 A;  1ESR A;  5CGK A;  4OGQ C;  1EY9 A;  5LMN L;  5HY6 A;  1PZI D;  1IBM L;  3T56 B;  3L0O A;  4HIO A;  4IPH A;  1YHQ A;  4XQJ A;  1JMC A;  4FF1 A;  4AYB G;  1SYF A;  4X66 Q;  2AWN A;  4JI4 Q;  4XYO A;  3IFT A;  3HOX G;  4J8Q A;  3K58 A;  1SMX A;  4LF6 L;  1JC7 A;  4I7Z C;  2FMM A;  3J80 E;  4ZUI A;  2BA1 A;  3E0J A;  1YJ9 A;  1D5X C;  1F2L A;  2NVX H;  4NKL A;  2NVX B;  2F0O A;  3PIO A;  3I91 A;  4DK1 A;  2A69 D;  3RLN A;  1EYC A;  4RMF A;  1IBM Q;  1VQE A;  3ULL A;  1JT8 A;  2F0L A;  3VYS A;  3DUZ A;  4RGO S;  3F8T A;  1PDQ A;  1U4L A;  3N6R A;  3PUX A;  3VR5 A;  1IL8 A;  3CC4 A;  3NP8 A;  4WJ3 M;  4L5R C;  3IL8 A;  1EU4 A;  1VQO A;  3QWN A;  1X3G A;  4A3C H;  1GUN A;  4X64 L;  1ILQ A;  4R9W A;  4B3T L;  1EWI A;  2CW0 D;  3EA6 A;  4A3D H;  4QMG A;  1UE6 A;  4FO2 A;  4GKJ Q;  5IGG A;  2Z4H A;  2JA8 G;  4A3D B;  3C1F A;  3RZO H;  1CKO A;  3GO5 A;  1ASZ A;  4A3B G;  5HUR A;  3RZO B;  1SBB B;  1EYA A;  2C35 B;  1STE A;  2O5I C;  5H1S E;  2GVB A;  2YV5 A;  1C0A A;  1ESF A;  3NBH B;  3H09 A;  1XX8 A;  4DAY A;  4TRD A;  2B2Y C;  5M5W H;  3AQQ A;  1GXD C;  2I5L X;  1X65 A;  5M5W B;  1JB3 A;  2FXQ A;  4ALP A;  1CSP A;  3VR6 A;  4WFN 3;  3NEN A;  1WTV A;  3DMU A;  4A3M B;  3BVZ A;  2LXJ A;  4K8J A;  4B3T Q;  1SN8 A;  5K36 H;  3E5S A;  2UUC L;  2ZJR A;  2ATW A;  2C5C A;  3ZJY C;  1EWC A;  1SNC A;  4DR5 Q;  3MC0 B;  4OIJ A;  5IGB A;  1SE8 A;  2IT1 A;  3I55 A;  4JI2 L;  1D2B A;  2NWG A;  3ZYY X;  3BYY B;  3G4S A;  4JCV E;  3KLR A;  4OWW B;  3AB9 A;  2UU9 L;  3AMU A;  2RDH A;  5ELE A;  1M8A A;  4JVZ A;  1SR3 A;  4KJN A;  1B9M A;  3Q23 A;  3CC2 A;  4JI7 Q;  1QWY A;  2DJG C;  3MFY A;  4C3I G;  1X3P A;  2PQE A;  3HOX H;  3BS1 A;  3GQB A;  1PZK D;  4CJ2 C;  2JJQ A;  3HOX B;  4N8F A;  2UUC Q;  2F0M A;  1CK1 A;  2XRQ D;  1K8G A;  3MXN B;  5C5M A;  1VQP A;  2Q2T A;  1SYD A;  2SDF A;  1HFG A;  3J7A 5;  3K5O A;  4IJL A;  3ONA B;  3ERO A;  3PIP A;  3NWT A;  3PF5 A;  1S72 A;  5CV5 A;  2EYH A;  2CWP A;  4KHP L;  1M90 C;  3AEV A;  4EQ5 A;  1SMY D;  2VS1 A;  3LNN A;  2IX1 A;  4BXX H;  2AHO B;  4JI1 L;  4JI0 L;  1EWH A;  3JC6 6;  2BDN A;  3FEW X;  4RCN A;  1VQJ A;  5DEH A;  3U9S A;  1CFM A;  2PZU A;  2XIW A;  3R2I A;  4FXG C;  1K8O A;  3T1Y L;  4UY8 C;  4L63 B;  1PZJ D;  5IYD G;  3BVM A;  1C8C A;  1VQN A;  1YIT A;  1U4R A;  2JA8 B;  1ROD A;  2HCC A;  3VR4 A;  4LF9 L;  2PW5 A;  3F2B A;  2EZV A;  2JK8 A;  3QOL A;  4FP5 D;  1HA5 A;  1UNS A;  4DV6 Q;  1XNQ Q;  4G57 A;  5DAU A;  1JJG A;  1HNZ L;  4A3F H;  4FXD A;  3FPU B;  4KHP Q;  1LAC A;  5AJ3 Q;  4A3F B;  4LF4 Q;  1RKN A;  4AYB E;  1TY0 A;  2VL6 A;  1S4Z A;  4A3L G;  3VR2 A;  2IY5 B;  1YNX A;  2NTS A;  3RZD H;  4JI0 Q;  2VNU D;  1NE3 A;  1EOV A;  3W5O A;  1SJE D;  3FHW A;  4PMC A;  1LTB D;  5ELC A;  4JI3 L;  2I5H A;  1IBL L;  5DNF A;  4JG2 A;  4LF9 Q;  4RGN A;  1I4R A;  1PRT C;  3BDC A;  3S2H H;  4EVO A;  2Z8L A;  1XMO Q;  1HNZ Q;  1N9W A;  3S2H B;  5IGE A;  2MQH A;  4GN5 A;  4DK6 C;  3DWQ A;  4HED A;  4OX9 L;  3HOU G;  1I4G A;  1I94 L;  1TXY A;  3RD4 A;  4GS3 A;  3J81 L;  3BG3 A;  3OMC A;  1WTR A;  2KA7 A;  3Q8D A;  3R93 A;  1HR0 L;  4JI3 Q;  2NUC A;  3JAM c;  5E4W C;  4CKB A;  1O78 A;  1YNJ D;  4DR6 Q;  3Q24 A;  3QR8 A;  3A5U A;  4BA2 I;  2F0D A;  1RIP A;  4L5Q A;  2I07 B;  1VF5 C;  1K83 H;  2F0G A;  3DEO A;  3Q6S A;  4ZK9 B;  1K83 B;  1HHV A;  1MI2 A;  1L0X B;  4HJ8 A;  3CME A;  4N9P A;  2EE1 A;  5M3F G;  5J1Z A;  5JPM C;  1AZP A;  4C1N I;  2E5L Q;  3CCV A;  2UXB Q;  3H3V I;  4WJ4 A;  2JP1 A;  3V2T A;  4N8X 1;  4I65 A;  2F4V L;  3C1E A;  1O80 A;  1E7Z A;  2EYO A;  1PH1 A;  1IBK Q;  2A8V A;  1B8A A;  1CA6 A;  4U68 A;  1J9O A;  1IHZ A;  2EJM A;  3RMH A;  1AN8 A;  5GRO A;  1KLU D;  3HOY H;  2A6H D;  3W1G A;  3HOY B;  2MO0 A;  1TWA H;  1TQO A;  3J81 E;  4KD4 A;  5C3X A;  1AH9 A;  1WTW A;  1E2Z A;  3SK8 A;  1LV9 A;  3KF6 A;  1IYU A;  5CV4 A;  1CSQ A;  1LTT D;  1QIL A;  2DNC A;  2D9U A;  1GUW A;  4UP8 A;  1D5Z C;  3RN2 A;  3DM1 A;  3L9A X;  3RLO A;  3SGI A;  2NVQ H;  2JE6 I;  2KBN A;  1NAP A;  2EPB A;  5JJI A;  2UXD L;  1JWM D;  4LNQ A;  3T4A C;  2NN6 G;  2CQA A;  2RHS B;  1EUJ A;  2IPK D;  4B3M L;  1U4M A;  4IUQ A;  5D65 A;  3K57 A;  3K0X A;  4HCS A;  2L9H A;  4NDX A;  3M4O H;  2KCC A;  5E4X A;  4NB3 A;  4RGM A;  5E3F A;  3ERS X;  3M4O B;  4MHE A;  5IWA L;  2K52 A;  5J22 A;  2R7Z G;  1AW7 A;  1AEX A;  4LFB L;  1A62 A;  4LAA A;  2KHJ A;  2RKS A;  1SYG A;  3RR5 A;  1IYV A;  2KQ3 A;  3I56 A;  5JEA G;  1MJC A;  3HOV G;  1VMC A;  5IOC A;  4NMZ A;  1QUQ A;  2EY2 A;  3NQI A;  3CCS A;  1LTA D;  1N8R C;  2L5T A;  4A3E G;  3BDL A;  2ICI A;  1SYE A;  1EOT A;  4IFD I;  2K5Q A;  3D4R A;  4B3M Q;  1IW7 C;  3H3V H;  4P71 A;  3AFP A;  1TWG H;  1YHA A;  1CA5 A;  2CW0 C;  3KK7 A;  1G8Z D;  1TWG B;  3PO2 H;  1QZH A;  2ZXP A;  3PO2 B;  2CVR A;  3IFD A;  4RFB A;  1HTL D;  1X32 A;  3ND8 A;  4DN4 M;  1RHP A;  3SXH A;  1KIX A;  1PTO F;  1JJ2 A;  4C1N K;  4KTA A;  3GD7 A;  1IKL A;  2EXZ A;  5C0X I;  2AQ1 B;  1FL0 A;  1ET9 A;  2RSN A;  4DR4 Q;  1I5F A;  1Y14 B;  1BXT A;  3A5Z B;  3QIA A;  4QL5 A;  2K33 A;  1ENF A;  4B9W A;  1HTP A;  4IN3 A;  2EJF C;  4JI5 L;  1EL0 A;  4K6D A;  1KTK A;  5KND A;  2AUK A;  4MIU A;  3SK5 A;  1SRU A;  1EY8 A;  3ND9 A;  2CHB D;  1SNO A;  1W2B A;  1EYD A;  1PH8 A;  3MXP A;  4DR1 L;  1EIF A;  1SAP A;  1EY7 A;  1MKH A;  3TDQ A;  5C3E G;  3NHH A;  5CV6 A;  1IL2 A;  1N32 L;  3HKZ G;  5FLM H;  1B70 B;  1FGB D;  1HPC A;  3MA2 B;  1I6H H;  2DN8 A;  4IUN A;  4XT3 B;  1I6H B;  5IYB G;  3PV0 A;  1W3S A;  1RTO A;  5IYC H;  2EOT A;  2QKI C;  3KJO A;  5IP7 G;  3OW7 A;  2L15 A;  1Z7T A;  2C9O A;  2Y0S G;  4JK1 C;  2NVT H;  1EQR A;  5M3M H;  2Q2U A;  5M3M B;  2H5X A;  1JOR A;  3M9B A;  1YZ6 A;  2JA9 A;  1CT1 D;  2NBF A;  4M1U B;  2EYP A;  5ELD A;  4ME5 A;  2L4N A;  1EFW A;  1KAW A;  3J7A V;  2ICE C;  3O13 A;  1CTM A;  3CXC A;  1BQQ T;  1J6Q A;  2E2D C;  4C3J H;  3CC7 A;  2F0U A;  4GOP B;  4B3S Q;  2JSO A;  3MXU A;  4MTK A;  1YNN C;  1BBU A;  1KL9 A;  2QDB A;  3EN2 A;  2VQE L;  3HOV H;  1P16 A;  5L37 A;  1SNQ A;  1K28 A;  4KHV A;  3TRZ A;  3HOV B;  4A3J H;  2D2C C;  1DD2 A;  1DZ1 A;  4BBR G;  1N34 L;  1TII D;  1DYQ A;  1DOM A;  3ULJ A;  4QJF A;  4LFC Q;  2DY8 A;  4GNX A;  1GVP A;  3W2D A;  1PFB A;  1E1T A;  4C56 C;  4QQB X;  3HOW H;  3CCE A;  1QVC A;  3HOW B;  1O7Y A;  1N36 Q;  4A93 G;  4OEL B;  3LWU A;  3FDT A;  2QDL A;  1CHQ D;  1VQG A;  4QUC A;  5FKA C;  3CKI B;  2R6G A;  4GLV B;  2EYL A;  3BDO A;  1HJP A;  1JOK A;  4J1M A;  1T5X D;  3GDE A;  1V1P A;  1VQ9 A;  3K59 A;  3M7N A;  5LHY 1;  3H0G G;  4PG3 A;  3EVQ A;  4H02 A;  1N34 Q;  1MSH A;  4OWT B;  3E3X A;  3MFG A;  1W6K A;  5C4X G;  3JAM L;  3NTH A;  2Q2H A;  4G7H C;  5EJW A;  1NJI C;  1H9S B;  4QIW B;  4BBS G;  4GN4 B;  4LF5 L;  4HTH A;  4KKS A;  1TS3 A;  1IKM A;  4V19 0;  5IGC A;  1VQC A;  1AZQ A;  2CH4 A;  3D3R A;  4GKK Q;  4XIG S;  4C2M H;  2D0P A;  1RTN A;  2HT1 A;  4R4I A;  1KLG D;  4C2M B;  3PO3 H;  5BN4 A;  1TWH B;  2D5D A;  3PO3 B;  4QGU A;  5ISR A;  2Z9H A;  3D4W A;  2PPB C;  1NUC A;  1Q8I A;  2MFI A;  1LTI D;  4A76 A;  3TBI B;  2WII B;  2KVM A;  4JI6 L;  4A3G H;  3MEF A;  3Q22 A;  2WIN B;  2V1C C;  3Q0A A;  1MSG A;  2X6G A;  2H1E A; 
#chains in the Genus database with same CATH homology
 2UXC Q;  1J5E L;  4JBM A;  2ZJP A;  2C35 B;  4JI8 Q;  5H1S E;  4DKA C;  2GVB A;  2YV5 A;  1C0A A;  3NBH B;  5J3B A;  5M5W H;  1V43 A;  2K5H A;  3AQQ A;  1XMQ Q;  2I5L X;  1X65 A;  5LMU L;  3GTG H;  3T1H Q;  2E5L L;  2IX0 A;  2FXQ A;  1S3O A;  3ICE A;  2JA6 H;  1L1O C;  2UXB L;  1H95 A;  2VQF L;  4ALP A;  2Q2I A;  1CSP A;  5IY0 A;  4NXM L;  1PYS B;  4AQY L;  1KHI A;  3BZK A;  4NPS A;  5EAY A;  3UDF A;  2R7F A;  4C3I H;  2K50 A;  4DV3 L;  4BY1 H;  4JOI A;  3J81 j;  3NEN A;  3HOZ G;  1IBK L;  4JI5 Q;  1A63 A;  3TEH B;  2E2I H;  1JB7 A;  3HKZ E;  4K0K Q;  1CKN A;  1E24 A;  2LXJ A;  4A3I H;  4B3T Q;  4MZ9 A;  4A3C G;  4PZ6 A;  1PH6 A;  1SN8 A;  4DR1 Q;  3CF5 A;  1HZA A;  1FGU A;  2UUC L;  4A93 H;  5E7N A;  2ZJR A;  2ATW A;  3G71 A;  4A3G G;  4A3D G;  3ZJY C;  4IO9 A;  2VY3 A;  1N32 Q;  4A4I A;  3OTO Q;  4DR5 Q;  4JV5 L;  2RF4 A;  4MTN A;  5JEA J;  1VQH A;  4Y52 H;  1UE5 A;  1NTG A;  1SE8 A;  2IT1 A;  2Y0S E;  3NEL A;  1Q46 A;  2WAQ G;  1OXS C;  4JBJ A;  4TVA B;  4PMW A;  4C3H H;  3ER0 A;  3I55 A;  5LMU Q;  3PF4 A;  3M4Q A;  3G4S A;  1XNR Q;  4JCV E;  4NXM Q;  4OWW B;  2UU9 L;  1CKM A;  4DV3 Q;  1Y1V H;  5ELN A;  1SR3 A;  4O2D A;  1PH5 A;  2JA6 G;  2JA7 G;  3GTL H;  3DLL A;  3CC2 A;  3J80 i;  4JI7 Q;  1PVO A;  4X65 L;  1PH7 A;  4BY1 G;  1HZ9 A;  4DR3 Q;  4J15 A;  1CUK A;  1BKB A;  1LYL A;  1O7I A;  2MO1 A;  4AIM A;  1OXX K;  4MNO A;  3J81 c;  3HOX H;  1NY4 A;  2JJQ A;  4DR2 Q;  2UUC Q;  3S2D H;  4DAY B;  2ZTC A;  5C44 H;  4A3I G;  4A3K H;  4R4Q A;  4LFA L;  4BBS H;  5IYD H;  2A19 A;  5IT9 c;  5K36 G;  1K8G A;  3MXN B;  4DV5 L;  2WB1 E;  1VQP A;  2Q2T A;  2Z6K A;  2R7D A;  1D7Q A;  3TS0 A;  3J7A 5;  1Z9F A;  4IJL A;  3PIP A;  4DR7 L;  1E3P A;  2IHE A;  5LMN W;  1X6O A;  2UUB L;  2VUM G;  3PF5 A;  1S72 A;  3CD6 A;  3S1N H;  3K8A A;  4DV4 L;  2EXD A;  1LM0 A;  1RL2 A;  4KHZ A;  3L2P A;  3PGZ A;  2IY5 B;  2CWP A;  4KHP L;  1CKN B;  2HQL A;  1X9N A;  1M90 C;  3AEV A;  2K5N A;  4EQ5 A;  2R92 H;  1WYD A;  2VS1 A;  2VQE Q;  2IX1 A;  4BXX H;  4JYA Q;  2AHO B;  1X3E A;  3TS2 A;  4JI1 L;  3DM3 A;  1K8A C;  4JI0 L;  1U5K A;  3JC6 6;  4POG A;  1Y1V G;  3CCJ A;  4LUO A;  1SFO H;  1SLJ A;  1VQJ A;  2A1A A;  3S24 A;  3JAM i;  4DUZ L;  1WOC A;  4Y7N H;  2ZM6 L;  5C0X G;  3STB C;  3L7Z C;  3S14 H;  3T1Y L;  4UY8 C;  1L1O B;  1UE1 A;  3PUY A;  5IYD G;  5C44 G;  4A3K G;  4JYA L;  4O0A A;  1N33 L;  2PI2 E;  1PYB A;  1YIT A;  1VQN A;  4HJ5 A;  2N8N A;  5GAE C;  4LF8 Q;  1K9M C;  4LF9 L;  1ASY A;  5GAH C;  1YHB A;  3F2B A;  2JK8 A;  4DV6 Q;  1XNQ Q;  3HOU H;  4DR4 L;  2NN6 I;  1JJG A;  2QGQ A;  1HNZ L;  4A3F H;  2NZO A;  5DLQ E;  4KHP Q;  5LMN Q;  4DV1 L;  1EQQ A;  5AJ3 Q;  4OO1 I;  4LF4 Q;  1LUZ A;  4AYB E;  1OTC A;  2NVY H;  5GAD C;  2B3G A;  2VL6 A;  1TWC H;  4A3L G;  2R92 G;  4PZ8 A;  4R1J A;  1XPO A;  1YNX A;  1VQ4 A;  3RZD H;  1MJE A;  4JI0 Q;  2CFM A;  2CKZ B;  3F1Z A;  1VQB A;  3J80 c;  1NE3 A;  4BXX G;  2VNU D;  5JJL A;  1EOV A;  1V9P A;  2HIV A;  2XTI A;  3I7F A;  4DPG A;  4GLX A;  3VDY A;  3W5O A;  3S15 H;  3FHW A;  3S1M H;  3A74 A;  5JJK A;  3I4M G;  1VQI A;  3PCO B;  3GTO H;  4JOI C;  2ZM6 Q;  4DV7 Q;  3K81 C;  4JI3 L;  2I5H A;  1VQK A;  1IBL L;  1WJJ A;  1HNW Q;  2N78 A;  4LF6 Q;  3PUW A;  3U4Z A;  4JG2 A;  1YEZ A;  1N33 Q;  3H15 A;  4LF5 Q;  3GTK H;  1C9O A;  4ME3 A;  2GVA A;  4X62 L;  3G48 A;  4OXP A;  2CQO A;  4LF9 Q;  1E1O A;  2JEA I;  2UUA L;  3S2H H;  4GN3 B;  1HH2 P;  1V1Q A;  1XMO Q;  1HNZ Q;  1N9W A;  5M3F H;  4GLA C;  1QVG A;  3GTQ H;  2MQH A;  4RG1 A;  4GN5 A;  2KCM A;  2YYZ A;  4DK6 C;  1XJV A;  4A3L H;  5FJ8 H;  2ZTE A;  4OX9 L;  3HOU G;  3OW2 A;  4A3F G;  1I94 L;  3CCR A;  4APV A;  1TXY A;  3BJU A;  2JA7 H;  3U4V A;  2R93 H;  2PI2 A;  4GS3 A;  4QIW E;  3CCU A;  1KD1 C;  1TWF H;  3F2D A;  4TQU S;  3KOJ A;  1DGS A;  1MIU A;  4DUY Q;  1YIJ A;  3Q8D A;  3S17 H;  1HR0 L;  4JI3 Q;  3JAM c;  4XTC S;  1Q12 A;  1QZG A;  4X64 Q;  2LXK A;  4DR6 Q;  4JBK A;  3A5U A;  4JI6 Q;  4BA2 I;  1RIP A;  1IYJ B;  4YHH L;  4R4O A;  2GN5 A;  4IPC A;  4L5Q A;  4BY7 G;  3A0J A;  2UUA Q;  3EBE A;  1K83 H;  2OQK A;  4R4C A;  1J5E Q;  4B3S L;  3KDF A;  2VUM H;  2Z6K C;  4HJ8 A;  1KRT A;  4FDB A;  3CME A;  5M3F G;  3I2Z A;  3D0F A;  5IE8 A;  2HHH L;  5FJ8 G;  1Q82 C;  2E5L Q;  3CCV A;  3S1Q H;  3H3V I;  2UXB Q;  3CCM A;  4WJ4 A;  3EIV A;  2VQF Q;  2PMZ E;  4KI0 A;  1Q81 C;  4AQY Q;  2N49 A;  3FP9 A;  2F4V L;  2E8G A;  4LFC L;  2R93 G;  1PH1 A;  1E7Z A;  4IPD A;  2OTL A;  1IBK Q;  1EIY B;  4L5T A;  1WCM H;  2A8V A;  1B8A A;  4HIK A;  1N36 L;  5ELO A;  2AMC B;  4EX5 A;  1XPR A;  2RCN A;  4UP9 A;  1GO3 E;  5GRO A;  1VQ7 A;  1X3F A;  3HOY H;  2R7Z H;  4YY3 L;  3W1G A;  1XPU A;  1BBW A;  2MO0 A;  2WAQ E;  1TWA H;  1AH9 A;  3GTP H;  2F3I A;  3K80 C;  3KF6 A;  2WB1 G;  3CQZ H;  4JV5 Q;  3AFQ A;  1CSQ A;  3BZC A;  3GTM H;  1AE3 A;  2QEX A;  2KEN A;  4UPA A;  4JI2 Q;  1VQA A;  3S1R H;  2HHH Q;  4R4T A;  4UP8 A;  5M5Y H;  4JBW A;  3U50 C;  1BVS A;  1NMF A;  3PUV A;  3RLO A;  3RN2 A;  3SGI A;  1G29 1;  1VQ8 A;  2NVQ H;  2BH8 A;  4LUV A;  2JE6 I;  2KBN A;  3K7A H;  4A3E H;  4YCV A;  2UU9 Q;  2UXC L;  1T9H A;  4A75 A;  1AE2 A;  5JJI A;  2UXD L;  1JJC B;  4X66 L;  3CPF A;  3E9I A;  4X65 Q;  4LNQ A;  3I4M H;  1B7Y B;  2NN6 G;  2RHS B;  1EUJ A;  1WI5 A;  1OXU A;  3GTJ H;  4B3M L;  4HJ9 A;  1HNX L;  1WCM G;  3K0X A;  4LFA Q;  2F52 A;  3G6E A;  3M4O H;  3RN5 A;  4DV0 L;  4NB3 A;  5BR8 L;  3ERS X;  3PUZ A;  3HOY G;  5IWA L;  2Z0S A;  2K52 A;  2R7Z G;  4DV5 Q;  4IPG A;  2YTX A;  1PH2 A;  4LFB L;  4GKJ L;  2EIF A;  1A0I A;  5IP9 G;  1A62 A;  4GKK L;  4DR7 Q;  2KHJ A;  2D0O A;  1K3R A;  2UUB Q;  3RR5 A;  5HGQ A;  4YWK A;  1OXV A;  3I56 A;  5JEA G;  4DV4 Q;  1MJC A;  4HID A;  3HOV G;  1KXL A;  1X55 A;  1PFS A;  1IXR A;  1K0R A;  2WP8 J;  2AKW B;  3D31 A;  1QUQ A;  4X6A H;  2LSS A;  3CCS A;  1VQD A;  4JI1 Q;  3PO3 G;  5M5X H;  1N8R C;  4A3E G;  4GOP C;  4YWM A;  4B3R L;  2ALY B;  4IFD I;  1U0L A;  4B3M Q;  4DK3 C;  5C3E H;  3H3V H;  4P71 A;  4DUZ Q;  2ZTD A;  3AFP A;  1TWG H;  1YBY A;  1YHA A;  1Q86 C;  3M3Y H;  2CWA A;  2JA5 G;  2B29 A;  4DV0 Q;  3PO2 H;  3CCQ A;  3T1Y Q;  1QZH A;  2AWO A;  2YTY A;  2ID0 A;  4JC0 A;  1VCI A;  5C4J H;  4BY7 H;  1KQS A;  2K4K A;  3F2C A;  1Q1E A;  2OQ0 A;  3UDX A;  1KIX A;  1JJ2 A;  1D8L A;  1X56 A;  3OYY A;  5FLX c;  3AYH B;  3GD7 A;  5IYB H;  3PSI A;  2K75 A;  1FL0 A;  3WWV A;  1TWH H;  2K5V A;  5C0X I;  1XMQ L;  1PH4 A;  4DR4 Q;  3T1H L;  5IP7 H;  1I5F A;  2XGT A;  3J7Z C;  1Y14 B;  4DV1 Q;  2KCT A;  1UE7 A;  3A5Z B;  3UE1 A;  2JQO A;  1KC8 C;  4QL5 A;  3CAM A;  3HFZ B;  3UDI A;  3NEM A;  4JI5 L;  4GOP A;  1YJN A;  1Y1W H;  1SRU A;  1HR0 W;  4K0K L;  3J81 i;  4YCU A;  1W2B A;  2IHF A;  1PH8 A;  4P74 A;  3M85 A;  4DR1 L;  1EIF A;  2I5M X;  2OTJ A;  2RHQ B;  1IBL Q;  1MKH A;  1VS0 A;  5C3E G;  1SRO A;  1IL2 A;  1N32 L;  3HKZ G;  3OTO L;  3UDG A;  4JI2 L;  3PO2 G;  4X62 Q;  5FLM H;  1QUQ B;  4DR5 L;  4IJH A;  1B70 B;  3TRE A;  1FJG L;  3CPW A;  4OWX B;  4IFD J;  2I0Q A;  2E2H H;  4DNI A;  1I6H H;  5GAG C;  5IYB G;  1XNR L;  3PV0 A;  1W3S A;  1NMG A;  4LUZ A;  1HZB A;  3CW2 C;  5IYC H;  4LF7 L;  3KJO A;  1S40 A;  4OX9 Q;  5IP7 G;  1QVF A;  2KHI A;  2L15 A;  1I94 Q;  1E22 A;  4BBR H;  2NZH A;  4A3M H;  3W1B A;  1UEB A;  4DV2 L;  1GD7 A;  2Y0S G;  4JI7 L;  2NVT H;  1EQR A;  4AH6 A;  5M3M H;  2Q2U A;  1C7Y A;  2PQA A;  2H5X A;  2BH2 A;  3M9B A;  1YZ6 A;  2DUD A;  2JA9 A;  4DR3 L;  5C0X J;  1K73 C;  3I4N H;  5GQO A;  1M1K C;  1Q8K A;  1Y1W G;  1HNW L;  4GNX C;  4DR2 L;  2B63 H;  1HR0 Q;  4UP7 A;  4OON A;  1Q1B A;  4NXN L;  1LTL A;  1PHJ A;  1KAW A;  1EFW A;  3CMA A;  1L2F A;  3U58 A;  2QA4 A;  4KLK A;  2ZJQ A;  3FKI H;  4C3J H;  1J6Q A;  4YHH Q;  3CXC A;  4IOA A;  3CC7 A;  1FJG Q;  3E0E A;  1FVI A;  1I50 H;  2EQS A;  5FLM G;  4GOP B;  5IP9 H;  1EYG A;  4B3S Q;  1X54 A;  1L1O A;  3H0G H;  1BBU A;  3K7U C;  4YWL A;  2YU9 H;  1KL9 A;  4LF7 Q;  3S16 H;  3EN2 A;  2VQE L;  3RLF A;  1P16 A;  4DAM A;  3HOV H;  3CCL A;  2CCZ A;  2ES2 A;  4HJ7 A;  3TRZ A;  3KF8 B;  1PV4 A;  1UWV A;  4DV2 Q;  4POF A;  5IYC G;  2E2J H;  2VW9 A;  4A3J H;  1VQL A;  4YCW A;  5C4X H;  2MNA A;  4BBR G;  1N34 L;  3I4O A;  4A3M G;  4BA1 I;  3ULJ A;  2F4V Q;  4QJF A;  5M3M G;  4LFC Q;  4GNX A;  1GVP A;  4JI4 L;  1E1T A;  4QQB X;  3I4N G;  3HOW H;  1PA6 A;  2BA0 A;  3CCE A;  4NXN Q;  1QVC A;  3M4P A;  4LWC A;  3KDF B;  1N36 Q;  2B63 G;  4A93 G;  2JA5 H;  1ASZ A;  4OO1 G;  2VZA A;  4YY3 Q;  4LF8 L;  1VQG A;  1R9T H;  4P72 A;  1PH9 A;  2R6G A;  4GLV B;  3RNU A;  1OXT A;  3FKI G;  4DV6 L;  1L0W A;  1HJP A;  1XNQ L;  4IFD G;  2PQA B;  3ULP A;  5LMN L;  5HY6 A;  3GDE A;  5AJ3 L;  1G6P A;  2DGY A;  1IBM L;  1XTD A;  4PZ7 A;  1VQ9 A;  4LF4 L;  3M7N A;  2K14 A;  1VQM A;  3H0G G;  4PG3 A;  3L0O A;  4HIO A;  2N3S A;  4IPH A;  4H02 A;  1VQ6 A;  1N34 Q;  4OWT B;  1GKH A;  1Q7Y C;  1YHQ A;  3TQY A;  1Z47 A;  3B6Y A;  4A3J G;  1YJW A;  4AYB G;  1NBW A;  3HKS A;  1JMC A;  2UXD Q;  4X66 Q;  5C4X G;  4HIM A;  2AWN A;  1VQF A;  4DV7 L;  4JI4 Q;  1P8L A;  2Q2H A;  3HOX G;  2HIX A;  1IZ6 A;  4P75 A;  1SMX A;  2WFW A;  3UE0 A;  1NJI C;  4LF6 L;  2JA8 H;  3KF6 B;  1HNX Q;  4BBS G;  3BU2 A;  3HOW G;  4GN4 B;  4LF5 L;  3STB D;  4A3B H;  2PNH A;  2OWO A;  2BA1 A;  1YJ9 A;  2NVX H;  1GM5 A;  5BR8 Q;  1I3Q H;  1KRS A;  5IWA Q;  1VQC A;  3PIO A;  3E9H A;  3CP0 A;  1XMO L;  4QY7 A;  4LW1 A;  2OCE A;  3KJP A;  4JI8 L;  1A8V A;  3RLN A;  4LFB Q;  1IBM Q;  4RMF A;  1HZC A;  4XIG S;  1VQE A;  3ULL A;  4HJA A;  4GKK Q;  4GNX B;  1JT8 A;  4C2M H;  2D0P A;  2HT1 A;  3KYH C;  4R4I A;  2ASB A;  3PO3 H;  3F8T A;  4QGU A;  3PUX A;  3IRB A;  1VQ5 A;  3HOZ H;  3CC4 A;  3KLW A;  4WJ3 M;  4L5R C;  2YTV A;  1VQO A;  1G51 A;  4DUY L;  2MFI A;  1X3G A;  4A3C H;  1PH3 A;  1YVC A;  4P73 A;  4IOC A;  4A76 A;  4B3R Q;  4X64 L;  1JE5 A;  2JEB I;  4L5S A;  1WFQ A;  3KFU A;  4DR6 L;  4B3T L;  1EWI A;  1YI2 A;  4JI6 L;  4A3G H;  4A3D H;  1UE6 A;  4GKJ Q;  3LGJ A;  2JA8 G;  3MEF A;  3RZO H;  2V1C C;  1CKO A;  3GO5 A;  2D62 A;  4A3B G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...