5LMUL

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5lmuL00
1SE8A 1I94Q 1NY4A 3K8AA 4JOIA 1IZ6A 5GQOA 4DV1Q 4HJAA 3U50C 2RF4A 1VQ6A 3DM3A 1UE6A 4O2DA 4XTCS 3W1GA 1XJVA 5JJIA 2JJQA 4IFDJ 4HJ9A 4A3LG 1SN8A 4LF8L 4IOCA 3U4VA 4LF8Q 1H95A 3ERSX 1HZBA 1YVCA 4JI2Q 1I3QH 1HH2P 3PUWA 4DR7Q 1D8LA 1K3RA 4OO1I 1YNXA 2YV5A 3S16H 5IY0A 3RZOH 3RZDH 3PUZA 4DR4L 1S3OA 2ZTEA 4R4QA 2K52A 4A3MH 2L15A 3FKIH 5C0XI 4JC0A 4LF6L 3IRBA 3HOYG 4FDBA 2R7ZH 4LUVA 2HHHL 4OONA 2NN6I 3JAMi 2K14A 3F2CA 4GLXA 4DV4L 2K50A 1IBMQ 1PH5A 2OTLA 3Q8DA 1C0AA 1AE2A 4BBRG 2LXJA 2UXBQ 1VQPA 3CCVA 2JA7G 1QVCA 2ATWA 1NMFA 1TWCH 1XMOQ 5IYBG 3HOXG 4OWXB 4DV7L 1BVSA 3W5OA 2ZM6L 2VQEQ 2ZJPA 3KF8B 2IT1A 3UDFA 1KXLA 5FJ8H 2PQAA 1MKHA 5E7NA 3PCOB 4GLVB 5H1SE 4A3FH 3T1YL 3CC4A 1VQIA 3ULPA 1O7IA 1XMQL 4A3EG 4BY7G 1NMGA 1XMQQ 3HOUG 1JT8A 4DV0L 3KDFA 1IBKQ 4DV2L 1AH9A 2QGQA 2E2IH 1JB7A 3M4QA 2Q2HA 2EIFA 2F52A 3I4OA 3KDFB 4MNOA 4JOIC 3OTOL 1P8LA 2AWOA 1XNRQ 3JAMc 4JV5L 4WJ4A 2BH2A 3KF6A 5FLXc 1S72A 1B70B 5IP9H 5C44G 1KQSA 1VQ7A 4IFDG 3UE0A 2OQKA 4A3CG 3K7AH 3L2PA 3KF6B 2WAQG 4JI1L 4BXXG 2VUMG 2JA6H 4UPAA 1OTCA 4C2MH 1Q82C 2N8NA 4QIWE 4LW1A 3CPFA 3GD7A 3J7ZC 3G71A 2UUAL 4A3JH 5IYDG 1AE3A 2UXCL 1Q1BA 1UEBA 4A76A 1SMXA 1UE1A 1YJWA 3A5UA 4X64Q 4JI5Q 1G291 2D0PA 4RG1A 1QVFA 2R92H 3M7NA 4KHPL 4NB3A 3D31A 4DR2L 4B3RL 1HNXL 5JJLA 1SR3A 4B3RQ 2B63H 1QZHA 4JI4L 4YWMA 4X66L 3HKSA 3I56A 1YJNA 1HR0W 4AIMA 4MTNA 5IWAL 2AMCB 1VQCA 4DV6Q 4B3ML 3J80i 1PH1A 1HR0L 5GROA 1WYDA 2H5XA 3HKZE 5M3MH 1Q46A 4QL5A 1N32L 2YTVA 4K0KQ 1GVPA 1UE5A 2VY3A 1KRSA 3E0EA 3F8TA 2PI2A 4UP9A 3KJPA 3H15A 2ZJRA 4DV5L 3STBD 4JCVE 1Q81C 1EIYB 4LNQA 4A3GG 3G48A 4A3DG 1LYLA 4ME3A 4AQYL 5M3FG 1L0WA 3ER0A 3I55A 1MJCA 3PO2H 4X62L 5BR8L 2KCTA 4JI3L 2NZOA 4DPGA 4H02A 2CCZA 3H0GG 2RHSB 3F1ZA 4BA1I 4IJLA 2VQFL 5GAHC 4NXMQ 4YY3L 3I4MG 2R6GA 4A3KH 1PVOA 2XGTA 2KENA 4PMWA 5C4XH 1N33Q 4JYAQ 4HIMA 3ULLA 1IL2A 2E5LL 2BH8A 4C3HH 4PZ6A 2E5LQ 4DK6C 4LF7L 3PGZA 4LF7Q 1XNQL 1N36L 1N36Q 4YCUA 5AJ3Q 3J80c 1A8VA 2QA4A 3HFZB 1N34L 2IHEA 1YBYA 1N34Q 2MQHA 1BBWA 3GTLH 3CXCA 1W2BA 4OO1G 3CQZH 4L5QA 2MFIA 2N78A 3KYHC 4DV3L 3TREA 1PH8A 3TRZA 1TWGH 2UXBL 1I94L 5IP7G 2ID0A 2MNAA 4A93G 5M5XH 3JC66 4YWKA 2UXDQ 4B3TL 3S2DH 4DV1L 3L7ZC 3J81c 1V1QA 1VQ4A 4B3TQ 1VQNA 4A3LH 4YCWA 3KFUA 4DKAC 3RN2A 2QEXA 1VQGA 2UU9Q 3CC2A 3A0JA 4DUZQ 3TEHB 1Y1WG 1VQAA 4HJ7A 3BZCA 1OXTA 4GN3B 1YITA 1IYJB 2B3GA 4X65Q 2YTYA 4JI2L 3GTJH 2IX0A 2IX1A 1J5EQ 2WB1G 4POFA 1HJPA 4DR7L 1D7QA 3HOYH 4A3IG 4GN5A 1SROA 3S1QH 4GKJL 2OCEA 4GKJQ 1X54A 3E9HA 2JA5G 1KRTA 3S15H 2FXQA 2K5VA 1JJGA 3A5ZB 4HIKA 3DLLA 1KHIA 3CD6A 4BBRH 1WI5A 1VQKA 4GNXB 1E1TA 1L2FA 3SGIA 1MJEA 2JA7H 2NVYH 1IBML 2WP8J 1FJGL 5HY6A 3HOXH 2KCMA 1K8AC 1CKMA 4QY7A 2WAQE 4P74A 1FJGQ 3ULJA 1DGSA 1MIUA 1SFOH 4R4TA 5C3EH 4PZ8A 2F4VQ 1XMOL 1TWAH 2CQOA 3I2ZA 2VQEL 1PH3A 2RCNA 4BY7H 4IO9A 1Z47A 1SLJA 1EOVA 4HJ5A 1JMCA 3BJUA 1Z9FA 4GOPB 1E7ZA 4DR1L 2Z0SA 1HZAA 2R7DA 3NENA 3CCLA 2CFMA 4EQ5A 4DR1Q 3CCSA 1K0RA 3RNUA 4DAMA 4GKKQ 1Q12A 3M4PA 4A75A 1IBKL 3GTQH 2RHQB 4POGA 4A3CH 4A3MG 1KC8C 2KHJA 1XNRL 2VUMH 1HZ9A 1I50H 1FGUA 3W1BA 3RR5A 1YJ9A 1C9OA 2GVBA 1VQ5A 1A62A 2Y0SG 2N3SA 1LTLA 3PUYA 5IT9c 1VQ9A 5IYDH 1VCIA 1PV4A 1QVGA 3PO3H 2IY5B 1VS0A 4QGUA 1X3EA 4OX9L 1PH7A 2R7FA 2WFWA 4B3SQ 1VQJA 3I4NH 4OX9Q 1K83H 5LMUL 1M90C 1IBLQ 5J3BA 4YWLA 2R93H 1GD7A 5LMUQ 1K73C 1RL2A 4DAYB 1YHQA 4JBKA 1N8RC 4X64L 4JI5L 1PH2A 1X56A 1EUJA 4JI8Q 1JE5A 4LF5Q 3PV0A 1L1OB 5FJ8G 3F2DA 5C0XJ 1Q8KA 2DGYA 4C3IH 2BA0A 5LMNQ 1NJIC 2JA8G 4A4IA 1X9NA 2D0OA 5ELNA 5M5WH 3GO5A 1S40A 1K9MC 3UDGA 4A3BG 1QUQB 3HOWH 3NEMA 1E3PA 2ZJQA 1YHBA 4DV6L 4IPCA 5IYCG 1V43A 1YZ6A 3HOVG 4BBSH 1GKHA 4A3GH 2A8VA 1N9WA 4DR6Q 3D0FA 4P71A 5K36G 1NTGA 5M3FH 3FP9A 3CC7A 2C35B 5GAEC 3EN2A 2YU9H 4UP8A 1EQRA 4LFAQ 3S17H 3HOZG 3S1RH 1JJCB 3CCJA 2JA6G 4WJ3M 3H3VH 1FL0A 4GOPC 4OXPA 1PYBA 3CMEA 3PUVA 1G51A 4R4OA 4DNIA 4K0KL 1LM0A 4LF4Q 1PFSA 4LFCL 3J81i 1HZCA 3KJOA 1WCMG 2KBNA 1C7YA 1ASYA 1OXXK 3KOJA 4LFCQ 2NVXH 4NXML 3BZKA 1N33L 4JYAL 4KI0A 1A0IA 1W3SA 4EX5A 4X6AH 4JBMA 1CUKA 4O0AA 3PF4A 4TQUS 1OXSC 1I5FA 5IE8A 2E8GA 4LUOA 1VQBA 3M9BA 2WB1E 4XIGS 5AJ3L 3K80C 4DUYL 1EIFA 2UUBL 4BY1G 1A63A 4DUYQ 2UUBQ 1PHJA 4GN4B 4KHZA 1Y1VG 2I5LX 2EXDA 1YI2A 1NE3A 3CF5A 4OWTB 3AFQA 4A93H 2UUCQ 4TVAB 3CAMA 4LFBQ 4LWCA 4QJFA 3CCUA 4L5TA 3TQYA 1I6HH 2OTJA 1EYGA 1YIJA 2K4KA 1TWHH 3M85A 3TS0A 2XTIA 1Y1WH 3GDEA 5C0XG 2UXDL 3K0XA 3UDIA 1QZGA 2AKWB 1EQQA 3AYHB 2NN6G 1U5KA 2JK8A 2UU9L 1BKBA 2E2HH 3GTPH 4DUZL 2JEAI 1PH6A 4DR5Q 1XPRA 4HIDA 1TWFH 4A3IH 3PUXA 4AYBG 2PI2E 3OYYA 4X65L 4DR3Q 2VW9A 2PNHA 1VQ8A 2JA5H 1J5EL 1T9HA 1XPOA 1RIPA 2JA9A 2HT1A 4R4CA 4LF9Q 1VQOA 3OW2A 4P73A 3GTOH 3RN5A 2Q2IA 3K7UC 4R1JA 3T1HQ 1E22A 1X3FA 3CCQA 3H3VI 1J6QA 3STBC 3CPWA 1XTDA 4Y52H 1SRUA 2CWAA 4P75A 4GNXA 5FLMG 1OXVA 5JJKA 1KIXA 2OQ0A 2LSSA 2N49A 3S24A 1UE7A 4JBWA 1Q86C 3RLOA 1CKOA 2Y0SE 1X65A 5IYBH 2YTXA 1GO3E 3E9IA 2BA1A 3U4ZA 1FVIA 1NBWA 4L5RC 3S1NH 2F4VL 2E2JH 4QQBX 1X6OA 3J81j 2CKZB 3PIOA 4IOAA 3CMAA 1G6PA 3CW2C 3PIPA 4JG2A 4GOPA 1K8GA 4A3EH 4R4IA 4UP7A 1YHAA 5ELOA 3HOUH 2V1CC 4IPGA 3I7FA 3S1MH 2AHOB 4DR4Q 4LF6Q 3CCRA 4C3JH 3AQQA 2I5HA 4GKKL 5JEAG 1ASZA 4YCVA 3RLFA 3MXNB 2HHHQ 2ASBA 5C44H 3FKIG 4DV4Q 4DK3C 3G4SA 4BXXH 4PG3A 2R7ZG 2K75A 4JI7L 2MO0A 3PSIA 4JI7Q 4KLKA 1B7YB 3NELA 4IPHA 3EIVA 4APVA 1IXRA 1HNZL 1HNZQ 3WWVA 3BU2A 4NPSA 2YYZA 4DV7Q 2ZM6Q 2GN5A 4AH6A 1PYSB 4GS3A 2Z6KA 1VQFA 5C3EG 5EAYA 3KLWA 4B3SL 1XPUA 4JI0L 3B6YA 1IBLL 4JI0Q 3T1YQ 2LXKA 1P16A 1U0LA 1L1OA 2PQAB 2JA8H 2I0QA 4A3BH 4JI8L 4LF5L 5LMNW 1UWVA 4DV0Q 4DV2Q 4NXNL 3F2BA 1VQLA 3HOVH 5IYCH 4A3FG 5LMNL 4NXNQ 4GNXC 1QUQA 1LUZA 3OTOQ 2VNUD 4JV5Q 1VQDA 4BA2I 3UDXA 2HIVA 3HOZH 4DR6L 4HJ8A 2JEBI 4JI1Q 4A3DH 2A19A 2ES2A 1GM5A 1JJ2A 2HQLA 1PA6A 3K81C 5GADC 4LFAL 5GAGC 2A1AA 2MO1A 3ZJYC 5IP9G 2HIXA 2K5NA 4YHHL 1Y14B 2UUAQ 3H0GH 1KL9A 4YHHQ 3PO3G 1WCMH 2UXCQ 1VQHA 2AWNA 4JBJA 3I4MH 1X55A 2CWPA 1EWIA 3G6EA 2Q2TA 4HIOA 1WJJA 1CKNA 3I4NG 4A3JG 4LF4L 4KHPQ 2R93G 3CCMA 4DR2Q 2F3IA 3EBEA 4J15A 1CKNB 1HNXQ 1PH9A 4UY8C 4JI4Q 2NVQH 1WOCA 3U58A 2NZHA 4X66Q 2ZTCA 3L0OA 1V9PA 2R92G 5IWAQ 4BY1H 3GTMH 3S2HH 4IFDI 3AFPA 4B3MQ 3GTKH 4AYBE 1Y1VH 1HR0Q 2B63G 3CCEA 4Y7NH 3LGJA 1N32Q 5DLQE 1R9TH 3HOWG 1VQEA 1X3GA 3S14H 2B29A 2VS1A 3UE1A 3RLNA 4DV5Q 4BBSG 2D62A 1TXYA 2GVAA 2IHFA 4IJHA 5M3MG 2UUCL 4ALPA 4AQYQ 5IP7H 3VDYA 1KD1C 2Q2UA 4LFBL 5HGQA 4X62Q 2Z6KC 3NBHB 5BR8Q 2OWOA 4JI3Q 1PH4A 1E24A 3AEVA 3M4OH 1OXUA 3M3YH 3CP0A 2VQFQ 1CSQA 5JEAJ 4GLAC 3FHWA 4RMFA 4YY3Q 1L1OC 3ICEA 3PO2G 1Q7YC 2JE6I 1Q1EA 2EQSA 5C4JH 3TS2A 4IPDA 3A74A 4JI6L 2ZTDA 2JQOA 4DR5L 2I5MX 2VL6A 4JI6Q 1XNQQ 4A3KG 4MZ9A 4L5SA 5C4XG 1E1OA 2PMZE 1HNWL 1CSPA 1BBUA 4DR3L 1HNWQ 3PF5A 2VZAA 3HKZG 4P72A 1KAWA 2KHIA 1VQMA 3GTGH 2NVTH 1YEZA 1B8AA 4LF9L 4LUZA 5M5YH 5FLMH 1EFWA 2ALYB 4OWWB 1WFQA 3T1HL 2DUDA 4DV3Q 1M1KC 3J7A5 3MEFA 2K5HA 4PZ7A
chains in the Genus database with same CATH superfamily
3SK4A 2MGSA 1MSGA 5EPLA 5JJIA 2JJQA 4PMCA 5CV9A 4HJ9A 3DM1A 1SN8A 2IW3A 1HZBA 4JI2Q 3T53B 4DR7Q 2C5CA 2XN9C 3FPUB 1K3RA 3S16H 4WRDA 2PZTA 3PUZA 2ZTEA 3MWYW 3FKIH 4JC0A 4LUVA 2HHHL 2MPMA 1BBXC 1BQQT 4I7ZC 1GUSA 5F2DA 1SYEA 1QVCA 5G3LD 2NVQB 3HOXG 2ZM6L 4BY1B 2Z4HA 1STBA 3BDLA 1PZKD 3UDFA 1K8MA 2PQAA 1MKHA 3KUPA 2QW7A 2RDGA 1XMQL 4BY7G 1XMQQ 3HOUG 1Q90A 3KDFA 4PV1C 2F0NA 2QGQA 4CKBA 2F0WA 4XQJA 1JB7A 2E2IH 3I4OA 2F52A 5EKKA 3V96A 3OTOL 4JOIC 5KRUA 1WTPA 3QOLA 3M4OB 5IT9E 5IP9H 4IFDG 4A3CG 3UE0A 2OQKA 2KQ3A 3L2PA 3KF6B 4JI1L 5KEEA 3NE5B 1LACA 2JA6H 1FYCA 2LKVA 2N8NA 4QIWE 5E4XA 2WKCA 5CV7A 4XYQA 1BF4A 1LTGD 4NW2A 4DU9A 2O2LD 1SMXA 4JI5Q 1G291 4RG1A 4NB3A 3CQZB 4DXGA 1SR3A 4YWMA 2B2TA 3HKSA 1YJNA 4AIMA 2VB3X 4B08A 1FGBD 4DV6Q 4B3ML 3J80i 1G2SA 2A6HC 5GROA 4XT1B 1N32L 3ONAB 1UE5A 2VY3A 3KJPA 3E0EA 2WACA 2O5JC 2EPBA 4JCVE 3KLRA 3BYTB 5IIFA 4CDFC 4AQYL 5M3FG 1L0WA 3OMGA 3PO2H 4DPGA 3OHXC 4IUPA 4CJ2C 3F1ZA 4BA1I 4IJLA 3I91A 5A35A 1PVOA 1BXTA 4YY3L 3I4MG 3MHBA 4JYAQ 3RZOB 3EA6A 4HIMA 5ELFA 3LWEA 4DK6C 1YNJC 4BBRB 2R7ZB 1PTOD 1GXDC 3NHHA 1Q3LA 1N34L 1CZGA 4K5VA 4K6DA 1N34Q 1I4QA 1IYUA 3CXCA 1W2BA 5C3EB 4L5QA 3NK9A 3KYHC 1PH8A 3DEPA 4IZ8A 1EY8A 2ID0A 3I70A 2KOLA 5M5XH 4HMJA 4DV1L 4A3LH 1TKWB 4A3FB 3VYSA 4FXDA 3VR6A 3QIAA 3CC2A 3A0JA 4R8NA 3BZCA 5L37A 4GN3B 1YITA 4CDDC 1IYJB 2L0CA 3TN2A 2ZT9C 5EKIA 2B3GA 2YTYA 1J5EQ 4POFA 1EOTA 1HJPA 4H0LC 1FNWA 3HOYH 2K01A 3A55A 3DHQA 3K7AB 4O1NA 3E9HA 4KN4C 4C2MB 1QB5D 1JWMD 1KHIA 4PQXA 3CD6A 1SNDA 3I4NB 4A3JB 1L2FA 2F0FA 1MJEA 1R4QB 2JA7H 5KNDA 1EQTA 2HDLA 1KABA 1QG7A 1CKMA 1PTOH 5KGUA 1DGSA 4X3KA 2F4VQ 1XMOL 3SVMA 1PH3A 1V8QA 4A3GB 1Z47A 3NQIA 4OGQC 4GOPB 2Z0SA 1HZAA 5M3MB 2A73B 3N6RA 1VMPA 4GKKQ 1AN8A 3NPPA 1SE2A 4A3MG 1KC8C 2K1BA 1XNRL 2VUMH 1I50H 1CA5A 1A62A 4PNYA 4I7AA 2DJFC 3BVZA 1LTLA 1I4RA 5IYDH 1PV4A 3OSOA 2DNCA 3PO3H 3BDCA 4QGUA 4F88A 2EYPA 3M4YA 1K83H 1M90C 2R93H 5J3BA 1RL2A 2B2VA 2NWGA 3CKIB 4JBKA 2CW0C 1TS3A 1DCZA 4LF5Q 3PV0A 1DONA 5C0XJ 5BN5A 2BA0A 5ELNA 1K9MC 3UDGA 3PQIA 1QUQB 4HTHA 3NEMA 2ZJQA 3HOWH 4M1UB 1V43A 1CQFA 3I3CA 2C35B 3EN2A 3S17H 1ESFA 1EFID 2KECA 1CHPD 1JJCB 2F0UA 1YNND 1XX8A 1MBYA 4ZUIA 1FL0A 4OXPA 2JA5B 5IGGA 3R2IA 1LLRD 4Q5VA 1G2TA 4K0KL 2ATWA 4K0KQ 3J81i 1ASYA 3GTOB 2VB2X 3KOJA 3ND8A 1F9RA 3A7LA 2B2UA 3BZKA 1C8CA 4KI0A 4TKOB 1JCKB 3S15B 4EX5A 4JBMA 1STHA 1I5FA 2E8GA 3D8GA 4DXFA 4FNFA 2WB1E 1NSNS 2CHBD 4BY1G 5DM63 1A63A 1RCVD 2I5LX 1NE3A 4LWCA 1SFOB 4L5TA 2EY5A 1I6HH 3SHLA 2OTJA 4QMGA 3OWEB 4EQOA 1QZGA 3S1MB 1F2ZA 1I6VC 2NN6G 3RMHA 2E2HH 2UU9L 2A6EC 1B53A 2E76C 1XPRA 1ET6A 3NTHA 4A3IH 2Y0SB 3AB9A 1HTLD 2PZUA 3PUXA 2PI2E 2BDOA 2WAQB 4QB4A 1VQ8A 3V2TA 2LMCB 4F7XA 3E6ZX 1QJOA 3DWQA 3H91A 4HR7B 1XTDA 3KLSA 4Z9CB 2AUKA 2B2WC 2R3ZA 1KIXA 1SNPA 5JAVA 3S24A 1LO5D 4JBWA 4Q0FA 3QOJA 3RLOA 4YIJA 1CKOA 2Y0SE 2DNEA 1SNCA 2D2CC 1B44D 1NR2A 3HOVB 1GHKA 3U4ZA 3S1NH 1SNOA 1WTVA 5M5WB 2CKZB 5FO9B 3CMAA 4KY7A 3TP7A 3OWFA 4A3EH 1YHAA 4L63B 5EQ0A 1M8AA 3NWSA 3Q0AA 3CCRA 4C3JH 4U673 5D3DA 1WCMB 4ULLA 2A6HD 5IT9L 5C44H 4IQZA 4DV4Q 1JQYD 1HQRD 3QWNA 4DK3C 4BXXH 3QO2A 4KKUA 4PG3A 2R7ZG 2RDHA 3TDQA 2OT2A 4IPHA 1VDZA 1PYSB 1VQFA 5C3EG 1XXGA 1NCVA 4DAYA 3S14B 2B8FA 2PQAB 2SDFA 3KBGA 2I0QA 5KYIA 1CM9A 1V1PB 4DV2Q 4A93B 1HUMA 4A3FG 4CHTB 1L0YB 1LUZA 4FF4A 2L55A 2EE1A 1TWHB 3SXHA 3SK6A 2RBMA 3HOZH 2FINB 2ZXOA 4HJ8A 1GM5A 1SDFA 1PA6A 2A1AA 5LL6X 2UUAQ 1PFMA 3MZ5A 3NQTA 2J0TD 2UXCQ 1VQHA 2AWNA 4JBJA 4RKBA 1X55A 1EWIA 4HIOA 1K8OA 1CKNA 1G8ZD 3I4NG 3D3RA 3MXUA 4A3JG 4LF4L 5DAUA 4UY8C 1X3QA 1JR0D 2PO4A 2EYLA 4JI4Q 4J1MA 3L0OA 5I6WA 4K8JA 3S2HH 1ZYRD 2F0SA 3GTKH 4AYBE 4QUFA 1B3AA 3LGJA 5DLQE 5TSSA 3RLNA 5JOBA 3D4RA 3QB3A 2MHVA 4OIKA 4ZAIA 1TXYA 2GVAA 2IHFA 4IJHA 1UAPA 1CTMA 5M3MG 2UUCL 1H9JA 5IP7H 1HA5A 1KD1C 4XDXA 2Q2UA 5CV5A 2TMPA 1LTRD 1E24A 1PXUA 1QNUA 3S16B 2ENBA 2PZWA 1CSQA 1ZKOA 1L1OC 3ICEA 4ABNA 3FKIB 2QF7A 3A74A 2X6GA 1WD0A 2JQOA 4DR5L 1CA6A 2VL6A 1E1OA 2PMZE 1HNWL 1CSPA 2GA4B 1HNWQ 3PF5A 1KAWA 1HHVA 2KHIA 1VQMA 3GTGH 5JPNC 5I2XA 1B3QA 2ALYB 4DV3Q 2F3WA 2HDMA 3J7A5 3FVQA 4KN7C 2UXBQ 2F0TA 1SE8A 1ILPA 1NY4A 3K8AA 4JOIA 3G7LA 2F0KA 4HJAA 2J4XA 1ZEQX 2JA8B 3DM3A 1UE6A 4A3BB 4O2DA 4XTCS 3W1GA 1PRTC 5EPJA 1XJVA 3LNNA 4M8AA 1Y69U 4LF8L 2E2IB 4LF8Q 1H95A 1HRJA 4HCEA 1BCPB 1YVCA 2CH4W 2CW0D 3PUWA 1D8LA 3K59A 1MGSA 1XWEA 2JA6B 3E3XA 4IUVA 4ZCKA 5KNCA 4DR4L 1CQVA 4LF6L 2F0VA 3D4WA 4KHVA 3IRBA 2NN6I 3JAMi 4GLXA 2DY7A 2K50A 1IBMQ 2C9OA 5EBDA 1AE2A 3AMUA 3TMEA 1QOHA 2N55A 1TS2A 3P20A 3CCVA 2O4XA 1TWCH 2K03A 4OWXB 1BVSA 2BOSA 5K5PA 4RWSC 1S5DD 1SNMA 4Y7NB 4K5WA 5E7NA 3PCOB 4GLVB 4HMIA 5H1SE 1VQIA 3ULPA 1NMGA 1CFMA 1II3A 1JT8A 4DV0L 1IBKQ 2B39A 1SYGA 5E4WC 3PO2B 3M4QA 1EY5A 4JV5L 1CHQD 3E5SA 2BH2A 1S72A 4WJ4A 1AFPA 3E0JA 1KQSA 1VQ7A 3TBIB 4LJZC 2WAQG 2A5HA 4RHRA 1Q82C 3R3OA 1TU2B 2SNMA 4LW1A 5EBCA 3J7ZC 5DNFA 3D4DA 1AE3A 4LMQD 1UEBA 4A76A 1BCPF 1DYQA 3A5UA 4X64Q 1XTCD 2NVTB 2D0PA 4ZQ3A 1RHPA 4K2KA 4N8FA 2R92H 5IODA 1HNXL 5M5YB 1RD9D 1QZHA 4PMBA 5D3IB 4X66L 2FHTA 2A69C 4MTNA 2AMCB 5M5XB 1VQCA 5FOBB 3R2TA 4FF2A 1HR0L 4N8X1 1WYDA 3HKZE 2K04A 1FNVA 3PMFA 1Q46A 4QL5A 4ZUJA 4IUNA 1R9TH 3F8TA 4UP9A 2PI2A 4DV5L 2ZJRA 1ENCA 3P75A 1RODA 4X62L 4JI3L 4H02A 2CCZA 3HOYB 2FFKB 1D5MC 4NXMQ 5HURA 3K5LA 4A3KH 4RHSA 4C3HH 4PZ6A 4LF7L 1ESRA 3PGZA 4LF7Q 1XNQL 1N36L 1N36Q 3J7AV 1A8VA 2R61A 2QA4A 3HFZB 1PTOB 2IHEA 5IGBA 2MQHA 1BBWA 3GTLH 4OO1G 1H9SA 1RF2D 2MFIA 2N78A 2E2DC 4WJWA 2MNAA 4A93G 5IOCA 2XVSA 3NWTA 1VQNA 1F9PA 3J81c 3H94A 2QEXA 4DUZQ 3TEHB 1OXTA 4TSSA 4JI2L 1BDOA 2RKSA 2IX0A 2IX1A 4DR7L 1D7QA 1PRTF 2OCEA 2I46A 5JEAH 4IURA 3PO3B 4C1NI 1R4PB 1TIID 4HIKA 1E1TA 2R93B 2PQEA 3SGIA 2L12A 1FJGL 3HOXH 2ZXRA 1GHJA 1K8AC 1FJGQ 4P74A 3CRLC 2B63B 4G7HC 1MIUA 4R4TA 5COYA 1TWAH 3I2ZA 1TQOA 4H7BA 3KF8A 1JE4A 4RGMA 1EEFD 3HOWB 2JSOA 2RCNA 4BY7H 2K32A 3MXGA 1KNAA 4HJ5A 4IO9A 1JMCA 3BJUA 2K33A 1Z9FA 4QIWB 4G7ZC 1IHZA 1K0RA 3RNUA 1HQMC 5I4DA 1ICWA 2RHQB 4IFDH 4A3CH 1IW7C 1EY9A 2EOTA 3VR4A 3SK8A 1VQ5A 4S3SA 1LTBD 1VQ9A 1JICA 3PUYA 5C4XB 5CYUA 1VCIA 1A2UA 1QVGA 5JJZA 2HCIA 2NTSA 2IY5B 5EKLA 1VS0A 1X32A 1X3EA 2PNRC 1PH7A 4B3SQ 1IBLQ 4YWLA 4IUTA 4JK1C 2K28A 4DAYB 4JI5L 2F0GA 3KK7A 4JI8Q 1JE5A 4C3IH 3Q24A 4FF3A 2JA8G 1X9NA 1S40A 4A3BG 1I6HB 3WDNA 1LT5D 2SNSA 1IKMA 4FP5D 1E3PA 1YHBA 4DV6L 5FKAC 5IYCG 4BBSH 2A8VA 1N9WA 4DR6Q 3S2DB 5M3FH 1SE4A 3FP9A 2YU9H 2E2HB 1RKNA 4MHEA 3S1RH 4A3IB 2JA6G 4DNRB 4GOPC 3EJIA 3IFDA 3GTJB 1F2YA 1G51A 4OELB 2NZ1D 1JOOA 3S1QB 1HZCA 2KBNA 1OXXK 2X6LA 3SR1A 2NVXH 2MP1A 4JYAL 1U9RA 2OF1A 4O0AA 3PF4A 4CJ0B 1W6JA 3MAQA 4DUYL 2NVYB 3SK5A 4DUYQ 2EXDA 3S1NB 2Q8IB 3CAMA 4LFBQ 1SMYC 4QJFA 4KMUC 3TQYA 1CZWA 2QDBA 1YIJA 4A3EB 2XTIA 2NTTA 3SEBA 3K0XA 2AKWB 3AYHB 2JK8A 3DUZA 1PH6A 3J80E 2L9HA 4DA2A 3J7YW 5C44B 2RDFA 3OYYA 2Z1CA 1J5EL 1XPOA 2JA9A 4LF9Q 3MFGA 3OW2A 3QR8A 3WOFA 1E22A 4K14A 1X3FA 1JWUD 3CCQA 3STBC 2B8GA 4OL7A 1PZID 4P75A 1OXVA 1KDBA 3TP8A 5LHY1 5IYBH 1E0BA 2JN4A 1GO3E 3E9IA 1E2ZA 4L5RC 1NBWA 1I4HA 2F4VL 2L5TA 4EQPA 4KD3A 5FO8B 2BDNA 1G6PA 1SYFA 3ND9A 1J8IA 5J1ZA 1WTXA 2AHOB 3K5OA 4IUUA 1KDCA 1AEXA 1U4LA 2A69D 3AQQA 1EYDA 3NUCA 4GKKL 1ASZA 3RLFA 2ASBA 3TZDA 3G4SA 4RH6A 2K6AA 5LL6S 2AUJD 1WTWA 2MO0A 3T51B 4DAPA 3NP8A 1B7YB 1U4RA 2NYZD 3EIVA 3FPPA 1IXRA 3NELA 4JW0A 4NPSA 4DV7Q 2KCCA 3K0YA 1GUWA 5EAYA 3KLWA 4FVMA 3K6OA 4DK1A 3T1YQ 2LXKA 1P16A 1L1OA 4LF5L 5LMNW 1BOSA 1NR4A 3S9WA 3F2BA 4CKEA 4CBVA 2EY2A 4GNXC 4EGVA 2VNUD 3GV3A 3VA5A 1EY6A 3UDXA 2QEJC 2HIVA 1Y1WB 4NMZA 4A3DH 2JEBI 2ES2A 1JJ2A 1L0XB 5CV8A 3K81C 5GAGC 2MO1A 2RCFA 1C4QA 2K5NA 2WB1B 1Y14B 4YHHL 5JVH3 3H0GH 4YHHQ 3PO3G 2O5IC 2CWPA 2Q2TA 3GTGB 4K8IA 3EQLC 4KHPQ 2R93G 4DR2Q 4J15A 1K0SA 4ZLTF 1PH9A 3VR3A 1WOCA 2BE5C 3U58A 2NVQH 3LX0A 5IWAQ 4BY1H 3GTMH 4IFDI 2B63G 1TVXA 1M4VA 3HGBA 3D6WA 3EFXD 3HOWG 1VQEA 3I8ZA 4J6HA 2D62A 2EXZA 3X3MA 2M00A 4KKTA 3K58A 1WTHA 3VDYA 2JP1A 1ET9A 5BR8Q 4DAVA 2NN6H 1FNUA 3M4OH 1OXUA 4B9XA 3M3YH 2VQFQ 5JEAJ 3FHWA 1LT6D 2Q8RE 5C4JH 3TS2A 4IPDA 2ZTDA 5JPMC 1PZJD 1T5EA 2XRSD 4MZ9A 4K2LA 4L5SA 5C4XG 2F4IA 5DEHA 1A3TA 1BR9A 4P72A 2G9HD 3BYYB 1STGA 1O7ZA 1WFQA 4RA8A 1LV9A 3F2UA 2A68C 4IALA 1M1KC 1IW7D 1BNZA 1G91A 4RGNA 3L9AX 2K5HA 2L11A 1I94Q 3J81E 1IZ6A 3C46A 4OIJA 3U50C 1LTTD 2RF4A 1VQ6A 2B2TC 2F0LA 4IFDJ 2KEDA 3U4VA 5BN3A 1IYVA 2NUCA 2LS01 2YV5A 3A54A 1STNA 3RZOH 3R8BA 1TT2A 2K52A 5FO7B 2NB0A 2K5DA 2F0OA 4FDBA 2R7ZH 4OONA 1ENAA 3NSWA 1GUNA 3NTIA 2K14A 4IN3A 3F2CA 4DV4L 1PH5A 4BBRG 3I4LA 1NMFA 5DM73 2VQEQ 4XT3B 2ZJPA 1SXTA 3KF8B 2IT1A 2WV6D 1Y1VB 3A8JE 5FJ8H 3CC4A 1R9TB 4A3FH 3J7AF 2DN8A 4JVZA 1O7IA 5EGTA 4A3EG 3A56A 4DV2L 1AH9A 1YNJD 3FRPB 5CBEE 2Q2HA 3DWAA 3KDFB 4JPBW 5K36H 2F0DA 2AWOA 3TP5A 2B2YA 3KF6A 3QG1A 1EWHA 5C44G 4A3KB 1O7YA 3K7AH 4BXXG 1SMYD 4CKCA 1OTCA 4C2MH 1BCPC 4AYBB 4F8MA 3CPFA 4X3UA 1D5XC 2UUAL 4A3JH 2UXCL 2EYJA 4H13C 5KYLA 5ELDA 3M7NA 1CI3M 2RSOA 3D31A 1DJRD 1IKLA 4ZK9B 4JI4L 1A6XA 3HP3A 2QDLA 1HUNA 1T5XD 1PH1A 3H6MA 1RTOA 3HRZC 2K7VA 3SDZA 5M3MH 1KLUD 2YTVA 1GVPA 1KRSA 2KUMA 1GOZA 1X3PA 3STBD 1EY7A 2PMZB 3X3NA 1EIYB 4A3GG 3G48A 1D1KA 2F0HA 3I55A 5I6YA 2XWBB 1ZXTA 1EYCA 4I65A 4KD4A 5GAHC 2R6GA 1SJED 2XGTA 4PMWA 2KVMA 1N33Q 3J80L 1IL2A 3ULLA 4EQNA 4YCUA 5AJ3Q 1LABA 3J80c 2F03A 5C5MA 1YBYA 5CC4A 1TWAB 4DV3L 1DOLA 4BY7B 1TWGH 2UXBL 3QJYA 5IP7G 3JC66 4YWKA 2UXDQ 4B3TL 3L7ZC 1VQ4A 4B3TQ 1VQGA 2OEOA 5C3XA 2V4DA 1Y1WG 1VQAA 4HJ7A 3OPOA 4X65Q 3KLSX 2RVLA 2WB1G 4ODGA 4WFN3 4GN5A 1SROA 1X54A 3WOEA 2JA5G 3G6JB 3S15H 2K5VA 3K5NA 3A5ZB 2IPKD 5AFWA 2EVBA 3CU7A 3FMCA 2P5ZX 1IBML 1KAAA 5HY6A 2EJFC 2PYKA 3R93A 3RUZA 4C3IB 1SSOA 1SFOH 2CQOA 3IAYA 1A2TA 1PTOC 4BBSB 1SLJA 1EOVA 1E7ZA 3CCLA 2R7DA 2YU9B 1E2WA 2BE5D 2OXPA 4G4KA 1D2BA 3CCSA 1ILQA 3S1RB 1VF5C 5EPKA 4DAMA 3ZYYX 1Q12A 3M4PA 1IBKL 3GTQH 2JYOA 4POGA 2M2LA 1MHWC 1HZ9A 2KHSA 1YJ9A 3RR5A 2GVBA 2NVXB 1GUOA 2N3SA 2Y0SG 3MXPA 4RCNA 5C5LA 3HKZB 5J39A 1VQJA 1EQVA 5LMUL 1B1ZA 1GD7A 5LMUQ 1K73C 2Z8LA 3MFYA 4X64L 3DXJC 1PH2A 1EUJA 1L1OB 2FMMA 1Q8KA 2A6ED 2DGYA 3JAME 5LMNQ 1NJIC 2F0MA 5FLXE 5M5WH 4CJ1B 1B9NA 4FO2A 3FDTA 3HOVG 1B9MA 3D0FA 4P71A 3W3AA 2XSCA 2XRQD 1EYAA 3W2DA 2RQXA 3CC7A 4UP8A 1EQRA 4LFAQ 3BVGA 3CCJA 2ICIA 4WJ3M 1GUGA 2PW7A 3PUVA 3HG9A 4BS9A 4DNIA 3TZUA 1LM0A 1PFSA 4LFCL 3KJOA 1WCMG 4LFCQ 4NXML 5G3LF 4LK1C 1ICFB 1W3SA 2FJ2A 1D1IA 4X6AH 4G57A 3TP6A 1CUKA 3A8KE 5NUCA 3Q22A 3MC0B 4TQUS 4UDUC 2IWHA 1EZ8A 1HA6A 3M9BA 4XIGS 2JA7B 1WVLA 1EIFA 4XXEA 5KIXA 1UNSA 2J7ZA 4GN4B 4KHZA 1Y1VG 2D9UA 3CF5A 3BVMA 4A93H 1AW7A 3J81L 3CCUA 4RGTA 2HUGA 1EY4A 1EYGA 2K4KA 1TWHH 3TS0A 3GDEA 5C0XG 1GJXA 1EQQA 1U5KA 3GTPH 4DUZL 1MD2D 4HIDA 1TWFH 2M9VA 4AYBG 2XNAC 4DR3Q 4HCSA 2PNHA 2VW9A 2VUMB 1I50B 1SYDA 1T9HA 1RIPA 3KBXA 4R4CA 2L4NA 4ZYSA 4RAUC 1STEA 1VQOA 4P73A 3HS0C 4KY6A 4R1JA 3T1HQ 4DN4M 1S5FD 3H3VI 1J6QA 2PCFB 1YNNC 4TRDA 1SRUA 2CWAA 2Z4IA 4GNXA 1D5ZC 5FLMG 3IKJA 2OQ0A 1K83B 1PFNA 2G9DA 1JOKA 2N49A 1SNQA 1UE7A 4ILWA 1BCPD 2PW5A 3CHBD 1J9OA 2YTXA 5T1GA 1KNEA 3T4AC 2E2JH 4QQBX 3J81j 3NBIA 4ZRZA 4IOAA 4L8JA 3T16A 1MSHA 3CW2C 4JG2A 4RKLA 3VA7A 1K8GA 4A3DB 4R4IA 3HOUH 1EIGA 2V1CC 3S17B 1I4GA 3H0GB 5JEAG 2HHHQ 2AQ1B 1PTOF 4YCVA 3C1EA 5BN4A 3VR2A 1Y8OB 3FKIG 1O7LA 2K75A 4APVA 1AZPA 1BO0A 5CORA 2KA7A 3GTMB 1Q8IA 2ZM6Q 4DFAA 3D6CA 4B3SL 1SJHD 1IBLL 1V1PA 2JA8H 1U0LA 4A3BH 4QCLA 1CT1D 4JI8L 4ZKBB 2F0PA 1UWVA 1VQLA 4NXNL 5IYCH 1C48A 4NXNQ 4GZYC 1LTID 3OTOQ 1VQDA 3M3YB 5FK9C 3VR5A 2H4OA 4DR6L 1DD2A 4JI1Q 2A19A 2ZXPA 1TY2A 5C4JB 2RSNA 5GADC 5IP9G 4KKSA 3ZJYC 2HIXA 1EZ6A 3L3OC 4KJOA 1A15A 1KL9A 5ELBA 2K05A 3I4MH 3G6EA 2B2WA 1WJJA 3SE0A 3CCMA 1EIHA 1PRTD 1CKNB 5KNBA 4QUCA 3H3VC 2NZHA 3A7AB 1V9PA 2IJ0A 4C3IG 5I9PA 4B3MQ 2XIWA 4Y7NH 1N32Q 1X3GA 2QILA 1HFGA 2B29A 1LTSD 2VS1A 3UE1A 1O78A 4BBSG 1Z6HA 5E3FA 4AQYQ 4LFBL 2IL8A 2AQ3B 2Z6KC 1S5CD 2EYOA 5T1IA 1PH4A 4K5XA 3DEOA 2K5WA 3CP0A 5ELCA 4WORA 4GLAC 4YY3Q 3IFTA 3PO2G 4FXKC 1Q7YC 2JE6I 2EQSA 1DXMA 3MVVA 4JI6L 4C3JB 4HN7A 3C2PA 2I5MX 4JI6Q 3CRKC 3BS1A 2NBFA 1TY0A 1BBUA 1SAPA 3HKZG 4ME5A 4C56C 2NVTH 1YEZA 1B8AA 4LF9L 2EYFA 4NP5A 5M5YH 1EFWA 4OWWB 2DUDA 2EYHA 3DMUA 3TSSA 3EROA 3MEFA 4PZ7A 5A2QE 1A3VA 2CH4A 3OOCA 4BWGB 4RCOA 5GQOA 2X69A 4P2CB 3K5MA 4DV1Q 4KV6A 1EL0A 1MI2A 4N9TA 1KTKA 3ERQA 2L1BA 2MJ8A 4A3LG 2CQAA 5C4HA 4IOCA 3ERSX 2G5DA 4V0BA 1WD1A 1ZYRC 1I3QH 4KK7A 1I4XA 1HH2P 4UAIA 2Z9HA 3NXWA 4DF7A 4OO1I 1YNXA 3HOZB 5IY0A 3RZDH 1S3OA 3FEWX 4R4QA 4A3MH 2L15A 5C0XI 3HOYG 1TR5A 4MN3A 3MXNA 1DM0B 1F2LA 2EY1A 1QE6A 4O42A 2EJMA 2N88A 1TS5A 4HSPA 3P1HA 5C3WA 3Q8DA 5ISRA 1O80A 2OTLA 1C0AA 2LXJA 1VQPA 3OIQA 2JA7G 2AQ2B 1UUPA 4J8QA 1S5BD 3T13A 5IYBG 1ML0D 2E74C 2MUYA 3W5OA 4DV7L 1XMOQ 3S2HB 3GTKB 4CGYB 1KXLA 1PMRA 3VYRA 1RDPD 3T1YL 3JAML 4LAAA 1NAPA 5FLXL 4HSVA 1HTPA 1U4PA 1W6KA 2EIFA 4MNOA 1XNRQ 1P8LA 3C1FA 4ID6A 3JAMc 4NDXA 4FYDA 4K6LA 5FLXc 1B70B 2RA4A 1H9KA 5CV4A 2VUMG 4UPAA 1ENFA 1QILA 2CVRA 2ICEC 3GD7A 1JC7A 3G71A 5IYDG 1OO9B 4NKLA 1DZ1A 1Q1BA 3O13A 1SBBB 2XWJB 1UE1A 1YJWA 4KTAA 1QVFA 4KHPL 5JJLA 4DR2L 4B3RL 4B3RQ 2B63H 2Z6BA 1XYIA 3I56A 3AU7A 1TWGB 4IUQA 1HR0W 5IWAL 1Z7TA 5D14A 1EU3A 1V1OA 4OEMB 2H5XA 1Y8PB 1UEAB 3BG3A 3PIO3 3H15A 1Q81C 4LNQA 4A3DG 3PIP3 1LYLA 4ME3A 2QCPX 1S5ED 3ER0A 1MJCA 3NBHA 5BR8L 2KCTA 2NZOA 3H0GG 2RHSB 5IGEA 2VQFL 2KENA 5C4XH 1STYA 4XYOA 3N52A 2E5LL 2BH8A 1LT3D 5CGKA 2E5LQ 1WTQA 2E75C 3NTKA 3BDOA 1WTRA 1A3UA 1F9SA 1K28A 1NUCA 2EDGA 2WKDA 2JXMB 1GUTA 4UHVA 3CQZH 2SEBD 1B2TA 1HPCA 1TWCB 3TREA 3TRZA 5IGFA 1H9SB 2I07B 1I94L 1AP0A 2FMCA 3S2DH 1V1QA 4FF1A 3OIPA 4YCWA 4DKAC 3RN2A 3KFUA 2UU9Q 2SOBA 2EYMA 5IGCA 3GTQB 4XQQA 4MIUA 2DY8A 3GTJH 1S4ZA 4A3IG 1NNXA 3S1QH 4GKJL 3UI2A 4GKJQ 4DK0A 1KRTA 2FXQA 1EU4A 2F1MA 1JJGA 3IL8A 1VF7A 4DGZA 3DLLA 4BBRH 1WI5A 1VQKA 4GNXB 2A74C 4HEDA 2NVYH 2WP8J 5HGTA 1PLFA 2KCMA 4QY7A 1FR3A 2WAQE 2R92B 3ULJA 4X3TA 5C3EH 4PZ8A 1VMCA 1STAA 4QF4A 2VQEL 2EJGC 3P7JA 4DR1L 3NENA 2CFMA 4EQ5A 4DR1Q 3EVQA 1PYWD 4A75A 1IL8A 2KHJA 4C3JG 3I72A 1FGUA 3W1BA 3HZXA 1C9OA 5D65A 1RJTA 3MEHA 5IT9c 1DOMA 1QWYA 2HQEA 4C3HB 5JVG3 1JORA 3VYUA 4OX9L 2R7FA 2WFWA 3I4NH 4OX9Q 1YHQA 2F0QA 1N8RC 1X56A 4G7OC 5IGDA 4E6IA 5FJ8G 3F2DA 2H1EA 3GTLB 5I9OA 4A4IA 2D0OA 3GO5A 5ELEA 3GP7A 4IPCA 1YZ6A 3GQBA 3I90A 4A3GH 1GKHA 1G6ZA 5K36G 1F2MA 1NTGA 3T56B 3GTPB 5GAEC 1PDQA 1TWFB 3OMCA 3HOZG 3H3VH 1I4PA 4L6TB 1QNKA 1PYBA 3CMEA 1SYBA 4R4OA 3BZDB 4HAEA 3U9OA 4LF4Q 1C7YA 1N33L 1A0IA 3URYA 5CMDA 1B4OA 4CDCC 1OXSC 5IE8A 4LUOA 1VQBA 5AJ3L 3K80C 2UUBL 2EZVA 2UUBQ 1PHJA 3MTSA 3HOXB 1YI2A 2VXWA 4OWTB 3AFQA 5A2QL 2UUCQ 4TVAB 2E2JB 1LT4D 3M85A 4KY5A 1HFNA 1Y1WH 1D6EC 3HOUB 2B2VC 4F87A 3UDIA 4MTKA 2UXDL 2TSSA 5M9OA 1BKBA 1CK1A 2JEAI 4DR5Q 1BUVT 5C4ZA 4X65L 2F0JA 2JA5H 2HT1A 1TS4A 1SEBD 2KEEA 3V05A 3GTOH 3RN5A 2Q2IA 3K7UC 4XQNA 3CPWA 4V190 4Y52H 4RFBA 1EEID 4U68A 4CDEC 5JJKA 1JB3A 2LSSA 1Q86C 1RTNA 2KJXA 4DNTB 1X65A 2B2UC 4X3SA 1H9RA 1HXYD 2BA1A 3Q23A 1FVIA 3U9SA 1F77A 1X6OA 3PIOA 3OW7A 3PIPA 4GOPA 4UP7A 5ELOA 4IPGA 3I7FA 3S1MH 1KLGD 5M3FB 1EWCA 2LY7A 3HEJA 3M7GA 4DR4Q 4LF6Q 2I5HA 3MXNB 1AZQA 5J22A 3I4MB 5E1FA 2K5QA 4JI7L 3PSIA 4JI7Q 4KLKA 1HNZL 1E2VA 1HNZQ 3WWVA 3BU2A 2HCCA 2YYZA 2GN5A 3MA2B 4AH6A 4GS3A 2HD3A 2Z6KA 1XPUA 4JI0L 3B6YA 2F0IA 4C1NK 4JI0Q 2BCOA 2IX3A 4DV0Q 3HOVH 5LMNL 5CV6A 3LWUA 1QUQA 4EVOA 4JV5Q 3H09A 4BA2I 1K3BC 3GV6A 4N9PA 3C3LA 1Y8NB 3VYTA 2HQLA 3A8IE 2Q8TA 4LFAL 2A68D 1FD7D 3I73A 1WCMH 1WTOA 1PFBA 1U4MA 3K57A 2EY6A 4B9WA 4RGOS 3RD4A 2F3IA 3EBEA 1HNXQ 1HCZA 2PPBC 4X66Q 2ZTCA 4R8IA 1SE3A 5I2YA 1JWSD 1PRTB 3ITPA 5EJWA 2R92G 3AFPA 1Y1VH 2D5DA 1HR0Q 3CCEA 2KCNA 2WINB 4OHJA 1SYCA 4ZKCB 1F9QA 4OO1H 3S14H 1ONLA 4DV5Q 1B50A 5CR3A 1DOKA 2F3VA 4ALPA 5C0XH 5HGQA 1I3QB 4X62Q 3NBHB 2OWOA 4JI3Q 1LTAD 4R9WA 3AEVA 2DJGC 2QKIC 4RMFA 3RZDB 4FXGC 1Q1EA 4A3MB 5C6AA 2F0EA 4KJNA 1XNQQ 4A3KG 2LFNA 2B2YC 3DWPA 5CBAE 4DR3L 2WIIB 1KDAA 2VZAA 4C3HG 1JOQA 1QCBD 1H9MA 4LUZA 1EY0A 5FLMH 3T1HL 3Q6SA 4H44C
chains in the Genus database with same CATH topology
1SE8A 1I94Q 1NY4A 3K8AA 4JOIA 1IZ6A 5GQOA 4DV1Q 4HJAA 3U50C 2RF4A 1VQ6A 3DM3A 1UE6A 4O2DA 4XTCS 3W1GA 1XJVA 5JJIA 2JJQA 4IFDJ 4HJ9A 4A3LG 1SN8A 4LF8L 4IOCA 3U4VA 4LF8Q 1H95A 3ERSX 1HZBA 1YVCA 4JI2Q 1I3QH 1HH2P 3PUWA 4DR7Q 1D8LA 1K3RA 4OO1I 1YNXA 2YV5A 3S16H 5IY0A 3RZOH 3RZDH 3PUZA 4DR4L 1S3OA 2ZTEA 4R4QA 2K52A 4A3MH 2L15A 3FKIH 5C0XI 4JC0A 4LF6L 3IRBA 3HOYG 4FDBA 2R7ZH 4LUVA 2HHHL 4OONA 2NN6I 3JAMi 2K14A 3F2CA 4GLXA 4DV4L 2K50A 1IBMQ 1PH5A 2OTLA 3Q8DA 1C0AA 1AE2A 4BBRG 2LXJA 2UXBQ 1VQPA 3CCVA 2JA7G 1QVCA 2ATWA 1NMFA 1TWCH 1XMOQ 5IYBG 3HOXG 4OWXB 4DV7L 1BVSA 3W5OA 2ZM6L 2VQEQ 2ZJPA 3KF8B 2IT1A 3UDFA 1KXLA 5FJ8H 2PQAA 1MKHA 5E7NA 3PCOB 4GLVB 5H1SE 4A3FH 3T1YL 3CC4A 1VQIA 3ULPA 1O7IA 1XMQL 4A3EG 4BY7G 1NMGA 1XMQQ 3HOUG 1JT8A 4DV0L 3KDFA 1IBKQ 4DV2L 1AH9A 2QGQA 2E2IH 1JB7A 3M4QA 2Q2HA 2EIFA 2F52A 3I4OA 3KDFB 4MNOA 4JOIC 3OTOL 1P8LA 2AWOA 1XNRQ 3JAMc 4JV5L 4WJ4A 2BH2A 3KF6A 5FLXc 1S72A 1B70B 5IP9H 5C44G 1KQSA 1VQ7A 4IFDG 3UE0A 2OQKA 4A3CG 3K7AH 3L2PA 3KF6B 2WAQG 4JI1L 4BXXG 2VUMG 2JA6H 4UPAA 1OTCA 4C2MH 1Q82C 2N8NA 4QIWE 4LW1A 3CPFA 3GD7A 3J7ZC 3G71A 2UUAL 4A3JH 5IYDG 1AE3A 2UXCL 1Q1BA 1UEBA 4A76A 1SMXA 1UE1A 1YJWA 3A5UA 4X64Q 4JI5Q 1G291 2D0PA 4RG1A 1QVFA 2R92H 3M7NA 4KHPL 4NB3A 3D31A 4DR2L 4B3RL 1HNXL 5JJLA 1SR3A 4B3RQ 2B63H 1QZHA 4JI4L 4YWMA 4X66L 3HKSA 3I56A 1YJNA 1HR0W 4AIMA 4MTNA 5IWAL 2AMCB 1VQCA 4DV6Q 4B3ML 3J80i 1PH1A 1HR0L 5GROA 1WYDA 2H5XA 3HKZE 5M3MH 1Q46A 4QL5A 1N32L 2YTVA 4K0KQ 1GVPA 1UE5A 2VY3A 1KRSA 3E0EA 3F8TA 2PI2A 4UP9A 3KJPA 3H15A 2ZJRA 4DV5L 3STBD 4JCVE 1Q81C 1EIYB 4LNQA 4A3GG 3G48A 4A3DG 1LYLA 4ME3A 4AQYL 5M3FG 1L0WA 3ER0A 3I55A 1MJCA 3PO2H 4X62L 5BR8L 2KCTA 4JI3L 2NZOA 4DPGA 4H02A 2CCZA 3H0GG 2RHSB 3F1ZA 4BA1I 4IJLA 2VQFL 5GAHC 4NXMQ 4YY3L 3I4MG 2R6GA 4A3KH 1PVOA 2XGTA 2KENA 4PMWA 5C4XH 1N33Q 4JYAQ 4HIMA 3ULLA 1IL2A 2E5LL 2BH8A 4C3HH 4PZ6A 2E5LQ 4DK6C 4LF7L 3PGZA 4LF7Q 1XNQL 1N36L 1N36Q 4YCUA 5AJ3Q 3J80c 1A8VA 2QA4A 3HFZB 1N34L 2IHEA 1YBYA 1N34Q 2MQHA 1BBWA 3GTLH 3CXCA 1W2BA 4OO1G 3CQZH 4L5QA 2MFIA 2N78A 3KYHC 4DV3L 3TREA 1PH8A 3TRZA 1TWGH 2UXBL 1I94L 5IP7G 2ID0A 2MNAA 4A93G 5M5XH 3JC66 4YWKA 2UXDQ 4B3TL 3S2DH 4DV1L 3L7ZC 3J81c 1V1QA 1VQ4A 4B3TQ 1VQNA 4A3LH 4YCWA 3KFUA 4DKAC 3RN2A 2QEXA 1VQGA 2UU9Q 3CC2A 3A0JA 4DUZQ 3TEHB 1Y1WG 1VQAA 4HJ7A 3BZCA 1OXTA 4GN3B 1YITA 1IYJB 2B3GA 4X65Q 2YTYA 4JI2L 3GTJH 2IX0A 2IX1A 1J5EQ 2WB1G 4POFA 1HJPA 4DR7L 1D7QA 3HOYH 4A3IG 4GN5A 1SROA 3S1QH 4GKJL 2OCEA 4GKJQ 1X54A 3E9HA 2JA5G 1KRTA 3S15H 2FXQA 2K5VA 1JJGA 3A5ZB 4HIKA 3DLLA 1KHIA 3CD6A 4BBRH 1WI5A 1VQKA 4GNXB 1E1TA 1L2FA 3SGIA 1MJEA 2JA7H 2NVYH 1IBML 2WP8J 1FJGL 5HY6A 3HOXH 2KCMA 1K8AC 1CKMA 4QY7A 2WAQE 4P74A 1FJGQ 3ULJA 1DGSA 1MIUA 1SFOH 4R4TA 5C3EH 4PZ8A 2F4VQ 1XMOL 1TWAH 2CQOA 3I2ZA 2VQEL 1PH3A 2RCNA 4BY7H 4IO9A 1Z47A 1SLJA 1EOVA 4HJ5A 1JMCA 3BJUA 1Z9FA 4GOPB 1E7ZA 4DR1L 2Z0SA 1HZAA 2R7DA 3NENA 3CCLA 2CFMA 4EQ5A 4DR1Q 3CCSA 1K0RA 3RNUA 4DAMA 4GKKQ 1Q12A 3M4PA 4A75A 1IBKL 3GTQH 2RHQB 4POGA 4A3CH 4A3MG 1KC8C 2KHJA 1XNRL 2VUMH 1HZ9A 1I50H 1FGUA 3W1BA 3RR5A 1YJ9A 1C9OA 2GVBA 1VQ5A 1A62A 2Y0SG 2N3SA 1LTLA 3PUYA 5IT9c 1VQ9A 5IYDH 1VCIA 1PV4A 1QVGA 3PO3H 2IY5B 1VS0A 4QGUA 1X3EA 4OX9L 1PH7A 2R7FA 2WFWA 4B3SQ 1VQJA 3I4NH 4OX9Q 1K83H 5LMUL 1M90C 1IBLQ 5J3BA 4YWLA 2R93H 1GD7A 5LMUQ 1K73C 1RL2A 4DAYB 1YHQA 4JBKA 1N8RC 4X64L 4JI5L 1PH2A 1X56A 1EUJA 4JI8Q 1JE5A 4LF5Q 3PV0A 1L1OB 5FJ8G 3F2DA 5C0XJ 1Q8KA 2DGYA 4C3IH 2BA0A 5LMNQ 1NJIC 2JA8G 4A4IA 1X9NA 2D0OA 5ELNA 5M5WH 3GO5A 1S40A 1K9MC 3UDGA 4A3BG 1QUQB 3HOWH 3NEMA 1E3PA 2ZJQA 1YHBA 4DV6L 4IPCA 5IYCG 1V43A 1YZ6A 3HOVG 4BBSH 1GKHA 4A3GH 2A8VA 1N9WA 4DR6Q 3D0FA 4P71A 5K36G 1NTGA 5M3FH 3FP9A 3CC7A 2C35B 5GAEC 3EN2A 2YU9H 4UP8A 1EQRA 4LFAQ 3S17H 3HOZG 3S1RH 1JJCB 3CCJA 2JA6G 4WJ3M 3H3VH 1FL0A 4GOPC 4OXPA 1PYBA 3CMEA 3PUVA 1G51A 4R4OA 4DNIA 4K0KL 1LM0A 4LF4Q 1PFSA 4LFCL 3J81i 1HZCA 3KJOA 1WCMG 2KBNA 1C7YA 1ASYA 1OXXK 3KOJA 4LFCQ 2NVXH 4NXML 3BZKA 1N33L 4JYAL 4KI0A 1A0IA 1W3SA 4EX5A 4X6AH 4JBMA 1CUKA 4O0AA 3PF4A 4TQUS 1OXSC 1I5FA 5IE8A 2E8GA 4LUOA 1VQBA 3M9BA 2WB1E 4XIGS 5AJ3L 3K80C 4DUYL 1EIFA 2UUBL 4BY1G 1A63A 4DUYQ 2UUBQ 1PHJA 4GN4B 4KHZA 1Y1VG 2I5LX 2EXDA 1YI2A 1NE3A 3CF5A 4OWTB 3AFQA 4A93H 2UUCQ 4TVAB 3CAMA 4LFBQ 4LWCA 4QJFA 3CCUA 4L5TA 3TQYA 1I6HH 2OTJA 1EYGA 1YIJA 2K4KA 1TWHH 3M85A 3TS0A 2XTIA 1Y1WH 3GDEA 5C0XG 2UXDL 3K0XA 3UDIA 1QZGA 2AKWB 1EQQA 3AYHB 2NN6G 1U5KA 2JK8A 2UU9L 1BKBA 2E2HH 3GTPH 4DUZL 2JEAI 1PH6A 4DR5Q 1XPRA 4HIDA 1TWFH 4A3IH 3PUXA 4AYBG 2PI2E 3OYYA 4X65L 4DR3Q 2VW9A 2PNHA 1VQ8A 2JA5H 1J5EL 1T9HA 1XPOA 1RIPA 2JA9A 2HT1A 4R4CA 4LF9Q 1VQOA 3OW2A 4P73A 3GTOH 3RN5A 2Q2IA 3K7UC 4R1JA 3T1HQ 1E22A 1X3FA 3CCQA 3H3VI 1J6QA 3STBC 3CPWA 1XTDA 4Y52H 1SRUA 2CWAA 4P75A 4GNXA 5FLMG 1OXVA 5JJKA 1KIXA 2OQ0A 2LSSA 2N49A 3S24A 1UE7A 4JBWA 1Q86C 3RLOA 1CKOA 2Y0SE 1X65A 5IYBH 2YTXA 1GO3E 3E9IA 2BA1A 3U4ZA 1FVIA 1NBWA 4L5RC 3S1NH 2F4VL 2E2JH 4QQBX 1X6OA 3J81j 2CKZB 3PIOA 4IOAA 3CMAA 1G6PA 3CW2C 3PIPA 4JG2A 4GOPA 1K8GA 4A3EH 4R4IA 4UP7A 1YHAA 5ELOA 3HOUH 2V1CC 4IPGA 3I7FA 3S1MH 2AHOB 4DR4Q 4LF6Q 3CCRA 4C3JH 3AQQA 2I5HA 4GKKL 5JEAG 1ASZA 4YCVA 3RLFA 3MXNB 2HHHQ 2ASBA 5C44H 3FKIG 4DV4Q 4DK3C 3G4SA 4BXXH 4PG3A 2R7ZG 2K75A 4JI7L 2MO0A 3PSIA 4JI7Q 4KLKA 1B7YB 3NELA 4IPHA 3EIVA 4APVA 1IXRA 1HNZL 1HNZQ 3WWVA 3BU2A 4NPSA 2YYZA 4DV7Q 2ZM6Q 2GN5A 4AH6A 1PYSB 4GS3A 2Z6KA 1VQFA 5C3EG 5EAYA 3KLWA 4B3SL 1XPUA 4JI0L 3B6YA 1IBLL 4JI0Q 3T1YQ 2LXKA 1P16A 1U0LA 1L1OA 2PQAB 2JA8H 2I0QA 4A3BH 4JI8L 4LF5L 5LMNW 1UWVA 4DV0Q 4DV2Q 4NXNL 3F2BA 1VQLA 3HOVH 5IYCH 4A3FG 5LMNL 4NXNQ 4GNXC 1QUQA 1LUZA 3OTOQ 2VNUD 4JV5Q 1VQDA 4BA2I 3UDXA 2HIVA 3HOZH 4DR6L 4HJ8A 2JEBI 4JI1Q 4A3DH 2A19A 2ES2A 1GM5A 1JJ2A 2HQLA 1PA6A 3K81C 5GADC 4LFAL 5GAGC 2A1AA 2MO1A 3ZJYC 5IP9G 2HIXA 2K5NA 4YHHL 1Y14B 2UUAQ 3H0GH 1KL9A 4YHHQ 3PO3G 1WCMH 2UXCQ 1VQHA 2AWNA 4JBJA 3I4MH 1X55A 2CWPA 1EWIA 3G6EA 2Q2TA 4HIOA 1WJJA 1CKNA 3I4NG 4A3JG 4LF4L 4KHPQ 2R93G 3CCMA 4DR2Q 2F3IA 3EBEA 4J15A 1CKNB 1HNXQ 1PH9A 4UY8C 4JI4Q 2NVQH 1WOCA 3U58A 2NZHA 4X66Q 2ZTCA 3L0OA 1V9PA 2R92G 5IWAQ 4BY1H 3GTMH 3S2HH 4IFDI 3AFPA 4B3MQ 3GTKH 4AYBE 1Y1VH 1HR0Q 2B63G 3CCEA 4Y7NH 3LGJA 1N32Q 5DLQE 1R9TH 3HOWG 1VQEA 1X3GA 3S14H 2B29A 2VS1A 3UE1A 3RLNA 4DV5Q 4BBSG 2D62A 1TXYA 2GVAA 2IHFA 4IJHA 5M3MG 2UUCL 4ALPA 4AQYQ 5IP7H 3VDYA 1KD1C 2Q2UA 4LFBL 5HGQA 4X62Q 2Z6KC 3NBHB 5BR8Q 2OWOA 4JI3Q 1PH4A 1E24A 3AEVA 3M4OH 1OXUA 3M3YH 3CP0A 2VQFQ 1CSQA 5JEAJ 4GLAC 3FHWA 4RMFA 4YY3Q 1L1OC 3ICEA 3PO2G 1Q7YC 2JE6I 1Q1EA 2EQSA 5C4JH 3TS2A 4IPDA 3A74A 4JI6L 2ZTDA 2JQOA 4DR5L 2I5MX 2VL6A 4JI6Q 1XNQQ 4A3KG 4MZ9A 4L5SA 5C4XG 1E1OA 2PMZE 1HNWL 1CSPA 1BBUA 4DR3L 1HNWQ 3PF5A 2VZAA 3HKZG 4P72A 1KAWA 2KHIA 1VQMA 3GTGH 2NVTH 1YEZA 1B8AA 4LF9L 4LUZA 5M5YH 5FLMH 1EFWA 2ALYB 4OWWB 1WFQA 3T1HL 2DUDA 4DV3Q 1M1KC 3J7A5 3MEFA 2K5HA 4PZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SE8 A;  1I94 Q;  1NY4 A;  3K8A A;  4JOI A;  1IZ6 A;  5GQO A;  4DV1 Q;  4HJA A;  3U50 C;  2RF4 A;  1VQ6 A;  3DM3 A;  1UE6 A;  4O2D A;  4XTC S;  3W1G A;  1XJV A;  5JJI A;  2JJQ A;  4IFD J;  4HJ9 A;  4A3L G;  1SN8 A;  4LF8 L;  4IOC A;  3U4V A;  4LF8 Q;  1H95 A;  3ERS X;  1HZB A;  1YVC A;  4JI2 Q;  1I3Q H;  1HH2 P;  3PUW A;  4DR7 Q;  1D8L A;  1K3R A;  4OO1 I;  1YNX A;  2YV5 A;  3S16 H;  5IY0 A;  3RZO H;  3RZD H;  3PUZ A;  4DR4 L;  1S3O A;  2ZTE A;  4R4Q A;  2K52 A;  4A3M H;  2L15 A;  3FKI H;  5C0X I;  4JC0 A;  4LF6 L;  3IRB A;  3HOY G;  4FDB A;  2R7Z H;  4LUV A;  2HHH L;  4OON A;  2NN6 I;  3JAM i;  2K14 A;  3F2C A;  4GLX A;  4DV4 L;  2K50 A;  1IBM Q;  1PH5 A;  2OTL A;  3Q8D A;  1C0A A;  1AE2 A;  4BBR G;  2LXJ A;  2UXB Q;  1VQP A;  3CCV A;  2JA7 G;  1QVC A;  2ATW A;  1NMF A;  1TWC H;  1XMO Q;  5IYB G;  3HOX G;  4OWX B;  4DV7 L;  1BVS A;  3W5O A;  2ZM6 L;  2VQE Q;  2ZJP A;  3KF8 B;  2IT1 A;  3UDF A;  1KXL A;  5FJ8 H;  2PQA A;  1MKH A;  5E7N A;  3PCO B;  4GLV B;  5H1S E;  4A3F H;  3T1Y L;  3CC4 A;  1VQI A;  3ULP A;  1O7I A;  1XMQ L;  4A3E G;  4BY7 G;  1NMG A;  1XMQ Q;  3HOU G;  1JT8 A;  4DV0 L;  3KDF A;  1IBK Q;  4DV2 L;  1AH9 A;  2QGQ A;  2E2I H;  1JB7 A;  3M4Q A;  2Q2H A;  2EIF A;  2F52 A;  3I4O A;  3KDF B;  4MNO A;  4JOI C;  3OTO L;  1P8L A;  2AWO A;  1XNR Q;  3JAM c;  4JV5 L;  4WJ4 A;  2BH2 A;  3KF6 A;  5FLX c;  1S72 A;  1B70 B;  5IP9 H;  5C44 G;  1KQS A;  1VQ7 A;  4IFD G;  3UE0 A;  2OQK A;  4A3C G;  3K7A H;  3L2P A;  3KF6 B;  2WAQ G;  4JI1 L;  4BXX G;  2VUM G;  2JA6 H;  4UPA A;  1OTC A;  4C2M H;  1Q82 C;  2N8N A;  4QIW E;  4LW1 A;  3CPF A;  3GD7 A;  3J7Z C;  3G71 A;  2UUA L;  4A3J H;  5IYD G;  1AE3 A;  2UXC L;  1Q1B A;  1UEB A;  4A76 A;  1SMX A;  1UE1 A;  1YJW A;  3A5U A;  4X64 Q;  4JI5 Q;  1G29 1;  2D0P A;  4RG1 A;  1QVF A;  2R92 H;  3M7N A;  4KHP L;  4NB3 A;  3D31 A;  4DR2 L;  4B3R L;  1HNX L;  5JJL A;  1SR3 A;  4B3R Q;  2B63 H;  1QZH A;  4JI4 L;  4YWM A;  4X66 L;  3HKS A;  3I56 A;  1YJN A;  1HR0 W;  4AIM A;  4MTN A;  5IWA L;  2AMC B;  1VQC A;  4DV6 Q;  4B3M L;  3J80 i;  1PH1 A;  1HR0 L;  5GRO A;  1WYD A;  2H5X A;  3HKZ E;  5M3M H;  1Q46 A;  4QL5 A;  1N32 L;  2YTV A;  4K0K Q;  1GVP A;  1UE5 A;  2VY3 A;  1KRS A;  3E0E A;  3F8T A;  2PI2 A;  4UP9 A;  3KJP A;  3H15 A;  2ZJR A;  4DV5 L;  3STB D;  4JCV E;  1Q81 C;  1EIY B;  4LNQ A;  4A3G G;  3G48 A;  4A3D G;  1LYL A;  4ME3 A;  4AQY L;  5M3F G;  1L0W A;  3ER0 A;  3I55 A;  1MJC A;  3PO2 H;  4X62 L;  5BR8 L;  2KCT A;  4JI3 L;  2NZO A;  4DPG A;  4H02 A;  2CCZ A;  3H0G G;  2RHS B;  3F1Z A;  4BA1 I;  4IJL A;  2VQF L;  5GAH C;  4NXM Q;  4YY3 L;  3I4M G;  2R6G A;  4A3K H;  1PVO A;  2XGT A;  2KEN A;  4PMW A;  5C4X H;  1N33 Q;  4JYA Q;  4HIM A;  3ULL A;  1IL2 A;  2E5L L;  2BH8 A;  4C3H H;  4PZ6 A;  2E5L Q;  4DK6 C;  4LF7 L;  3PGZ A;  4LF7 Q;  1XNQ L;  1N36 L;  1N36 Q;  4YCU A;  5AJ3 Q;  3J80 c;  1A8V A;  2QA4 A;  3HFZ B;  1N34 L;  2IHE A;  1YBY A;  1N34 Q;  2MQH A;  1BBW A;  3GTL H;  3CXC A;  1W2B A;  4OO1 G;  3CQZ H;  4L5Q A;  2MFI A;  2N78 A;  3KYH C;  4DV3 L;  3TRE A;  1PH8 A;  3TRZ A;  1TWG H;  2UXB L;  1I94 L;  5IP7 G;  2ID0 A;  2MNA A;  4A93 G;  5M5X H;  3JC6 6;  4YWK A;  2UXD Q;  4B3T L;  3S2D H;  4DV1 L;  3L7Z C;  3J81 c;  1V1Q A;  1VQ4 A;  4B3T Q;  1VQN A;  4A3L H;  4YCW A;  3KFU A;  4DKA C;  3RN2 A;  2QEX A;  1VQG A;  2UU9 Q;  3CC2 A;  3A0J A;  4DUZ Q;  3TEH B;  1Y1W G;  1VQA A;  4HJ7 A;  3BZC A;  1OXT A;  4GN3 B;  1YIT A;  1IYJ B;  2B3G A;  4X65 Q;  2YTY A;  4JI2 L;  3GTJ H;  2IX0 A;  2IX1 A;  1J5E Q;  2WB1 G;  4POF A;  1HJP A;  4DR7 L;  1D7Q A;  3HOY H;  4A3I G;  4GN5 A;  1SRO A;  3S1Q H;  4GKJ L;  2OCE A;  4GKJ Q;  1X54 A;  3E9H A;  2JA5 G;  1KRT A;  3S15 H;  2FXQ A;  2K5V A;  1JJG A;  3A5Z B;  4HIK A;  3DLL A;  1KHI A;  3CD6 A;  4BBR H;  1WI5 A;  1VQK A;  4GNX B;  1E1T A;  1L2F A;  3SGI A;  1MJE A;  2JA7 H;  2NVY H;  1IBM L;  2WP8 J;  1FJG L;  5HY6 A;  3HOX H;  2KCM A;  1K8A C;  1CKM A;  4QY7 A;  2WAQ E;  4P74 A;  1FJG Q;  3ULJ A;  1DGS A;  1MIU A;  1SFO H;  4R4T A;  5C3E H;  4PZ8 A;  2F4V Q;  1XMO L;  1TWA H;  2CQO A;  3I2Z A;  2VQE L;  1PH3 A;  2RCN A;  4BY7 H;  4IO9 A;  1Z47 A;  1SLJ A;  1EOV A;  4HJ5 A;  1JMC A;  3BJU A;  1Z9F A;  4GOP B;  1E7Z A;  4DR1 L;  2Z0S A;  1HZA A;  2R7D A;  3NEN A;  3CCL A;  2CFM A;  4EQ5 A;  4DR1 Q;  3CCS A;  1K0R A;  3RNU A;  4DAM A;  4GKK Q;  1Q12 A;  3M4P A;  4A75 A;  1IBK L;  3GTQ H;  2RHQ B;  4POG A;  4A3C H;  4A3M G;  1KC8 C;  2KHJ A;  1XNR L;  2VUM H;  1HZ9 A;  1I50 H;  1FGU A;  3W1B A;  3RR5 A;  1YJ9 A;  1C9O A;  2GVB A;  1VQ5 A;  1A62 A;  2Y0S G;  2N3S A;  1LTL A;  3PUY A;  5IT9 c;  1VQ9 A;  5IYD H;  1VCI A;  1PV4 A;  1QVG A;  3PO3 H;  2IY5 B;  1VS0 A;  4QGU A;  1X3E A;  4OX9 L;  1PH7 A;  2R7F A;  2WFW A;  4B3S Q;  1VQJ A;  3I4N H;  4OX9 Q;  1K83 H;  5LMU L;  1M90 C;  1IBL Q;  5J3B A;  4YWL A;  2R93 H;  1GD7 A;  5LMU Q;  1K73 C;  1RL2 A;  4DAY B;  1YHQ A;  4JBK A;  1N8R C;  4X64 L;  4JI5 L;  1PH2 A;  1X56 A;  1EUJ A;  4JI8 Q;  1JE5 A;  4LF5 Q;  3PV0 A;  1L1O B;  5FJ8 G;  3F2D A;  5C0X J;  1Q8K A;  2DGY A;  4C3I H;  2BA0 A;  5LMN Q;  1NJI C;  2JA8 G;  4A4I A;  1X9N A;  2D0O A;  5ELN A;  5M5W H;  3GO5 A;  1S40 A;  1K9M C;  3UDG A;  4A3B G;  1QUQ B;  3HOW H;  3NEM A;  1E3P A;  2ZJQ A;  1YHB A;  4DV6 L;  4IPC A;  5IYC G;  1V43 A;  1YZ6 A;  3HOV G;  4BBS H;  1GKH A;  4A3G H;  2A8V A;  1N9W A;  4DR6 Q;  3D0F A;  4P71 A;  5K36 G;  1NTG A;  5M3F H;  3FP9 A;  3CC7 A;  2C35 B;  5GAE C;  3EN2 A;  2YU9 H;  4UP8 A;  1EQR A;  4LFA Q;  3S17 H;  3HOZ G;  3S1R H;  1JJC B;  3CCJ A;  2JA6 G;  4WJ3 M;  3H3V H;  1FL0 A;  4GOP C;  4OXP A;  1PYB A;  3CME A;  3PUV A;  1G51 A;  4R4O A;  4DNI A;  4K0K L;  1LM0 A;  4LF4 Q;  1PFS A;  4LFC L;  3J81 i;  1HZC A;  3KJO A;  1WCM G;  2KBN A;  1C7Y A;  1ASY A;  1OXX K;  3KOJ A;  4LFC Q;  2NVX H;  4NXM L;  3BZK A;  1N33 L;  4JYA L;  4KI0 A;  1A0I A;  1W3S A;  4EX5 A;  4X6A H;  4JBM A;  1CUK A;  4O0A A;  3PF4 A;  4TQU S;  1OXS C;  1I5F A;  5IE8 A;  2E8G A;  4LUO A;  1VQB A;  3M9B A;  2WB1 E;  4XIG S;  5AJ3 L;  3K80 C;  4DUY L;  1EIF A;  2UUB L;  4BY1 G;  1A63 A;  4DUY Q;  2UUB Q;  1PHJ A;  4GN4 B;  4KHZ A;  1Y1V G;  2I5L X;  2EXD A;  1YI2 A;  1NE3 A;  3CF5 A;  4OWT B;  3AFQ A;  4A93 H;  2UUC Q;  4TVA B;  3CAM A;  4LFB Q;  4LWC A;  4QJF A;  3CCU A;  4L5T A;  3TQY A;  1I6H H;  2OTJ A;  1EYG A;  1YIJ A;  2K4K A;  1TWH H;  3M85 A;  3TS0 A;  2XTI A;  1Y1W H;  3GDE A;  5C0X G;  2UXD L;  3K0X A;  3UDI A;  1QZG A;  2AKW B;  1EQQ A;  3AYH B;  2NN6 G;  1U5K A;  2JK8 A;  2UU9 L;  1BKB A;  2E2H H;  3GTP H;  4DUZ L;  2JEA I;  1PH6 A;  4DR5 Q;  1XPR A;  4HID A;  1TWF H;  4A3I H;  3PUX A;  4AYB G;  2PI2 E;  3OYY A;  4X65 L;  4DR3 Q;  2VW9 A;  2PNH A;  1VQ8 A;  2JA5 H;  1J5E L;  1T9H A;  1XPO A;  1RIP A;  2JA9 A;  2HT1 A;  4R4C A;  4LF9 Q;  1VQO A;  3OW2 A;  4P73 A;  3GTO H;  3RN5 A;  2Q2I A;  3K7U C;  4R1J A;  3T1H Q;  1E22 A;  1X3F A;  3CCQ A;  3H3V I;  1J6Q A;  3STB C;  3CPW A;  1XTD A;  4Y52 H;  1SRU A;  2CWA A;  4P75 A;  4GNX A;  5FLM G;  1OXV A;  5JJK A;  1KIX A;  2OQ0 A;  2LSS A;  2N49 A;  3S24 A;  1UE7 A;  4JBW A;  1Q86 C;  3RLO A;  1CKO A;  2Y0S E;  1X65 A;  5IYB H;  2YTX A;  1GO3 E;  3E9I A;  2BA1 A;  3U4Z A;  1FVI A;  1NBW A;  4L5R C;  3S1N H;  2F4V L;  2E2J H;  4QQB X;  1X6O A;  3J81 j;  2CKZ B;  3PIO A;  4IOA A;  3CMA A;  1G6P A;  3CW2 C;  3PIP A;  4JG2 A;  4GOP A;  1K8G A;  4A3E H;  4R4I A;  4UP7 A;  1YHA A;  5ELO A;  3HOU H;  2V1C C;  4IPG A;  3I7F A;  3S1M H;  2AHO B;  4DR4 Q;  4LF6 Q;  3CCR A;  4C3J H;  3AQQ A;  2I5H A;  4GKK L;  5JEA G;  1ASZ A;  4YCV A;  3RLF A;  3MXN B;  2HHH Q;  2ASB A;  5C44 H;  3FKI G;  4DV4 Q;  4DK3 C;  3G4S A;  4BXX H;  4PG3 A;  2R7Z G;  2K75 A;  4JI7 L;  2MO0 A;  3PSI A;  4JI7 Q;  4KLK A;  1B7Y B;  3NEL A;  4IPH A;  3EIV A;  4APV A;  1IXR A;  1HNZ L;  1HNZ Q;  3WWV A;  3BU2 A;  4NPS A;  2YYZ A;  4DV7 Q;  2ZM6 Q;  2GN5 A;  4AH6 A;  1PYS B;  4GS3 A;  2Z6K A;  1VQF A;  5C3E G;  5EAY A;  3KLW A;  4B3S L;  1XPU A;  4JI0 L;  3B6Y A;  1IBL L;  4JI0 Q;  3T1Y Q;  2LXK A;  1P16 A;  1U0L A;  1L1O A;  2PQA B;  2JA8 H;  2I0Q A;  4A3B H;  4JI8 L;  4LF5 L;  5LMN W;  1UWV A;  4DV0 Q;  4DV2 Q;  4NXN L;  3F2B A;  1VQL A;  3HOV H;  5IYC H;  4A3F G;  5LMN L;  4NXN Q;  4GNX C;  1QUQ A;  1LUZ A;  3OTO Q;  2VNU D;  4JV5 Q;  1VQD A;  4BA2 I;  3UDX A;  2HIV A;  3HOZ H;  4DR6 L;  4HJ8 A;  2JEB I;  4JI1 Q;  4A3D H;  2A19 A;  2ES2 A;  1GM5 A;  1JJ2 A;  2HQL A;  1PA6 A;  3K81 C;  5GAD C;  4LFA L;  5GAG C;  2A1A A;  2MO1 A;  3ZJY C;  5IP9 G;  2HIX A;  2K5N A;  4YHH L;  1Y14 B;  2UUA Q;  3H0G H;  1KL9 A;  4YHH Q;  3PO3 G;  1WCM H;  2UXC Q;  1VQH A;  2AWN A;  4JBJ A;  3I4M H;  1X55 A;  2CWP A;  1EWI A;  3G6E A;  2Q2T A;  4HIO A;  1WJJ A;  1CKN A;  3I4N G;  4A3J G;  4LF4 L;  4KHP Q;  2R93 G;  3CCM A;  4DR2 Q;  2F3I A;  3EBE A;  4J15 A;  1CKN B;  1HNX Q;  1PH9 A;  4UY8 C;  4JI4 Q;  2NVQ H;  1WOC A;  3U58 A;  2NZH A;  4X66 Q;  2ZTC A;  3L0O A;  1V9P A;  2R92 G;  5IWA Q;  4BY1 H;  3GTM H;  3S2H H;  4IFD I;  3AFP A;  4B3M Q;  3GTK H;  4AYB E;  1Y1V H;  1HR0 Q;  2B63 G;  3CCE A;  4Y7N H;  3LGJ A;  1N32 Q;  5DLQ E;  1R9T H;  3HOW G;  1VQE A;  1X3G A;  3S14 H;  2B29 A;  2VS1 A;  3UE1 A;  3RLN A;  4DV5 Q;  4BBS G;  2D62 A;  1TXY A;  2GVA A;  2IHF A;  4IJH A;  5M3M G;  2UUC L;  4ALP A;  4AQY Q;  5IP7 H;  3VDY A;  1KD1 C;  2Q2U A;  4LFB L;  5HGQ A;  4X62 Q;  2Z6K C;  3NBH B;  5BR8 Q;  2OWO A;  4JI3 Q;  1PH4 A;  1E24 A;  3AEV A;  3M4O H;  1OXU A;  3M3Y H;  3CP0 A;  2VQF Q;  1CSQ A;  5JEA J;  4GLA C;  3FHW A;  4RMF A;  4YY3 Q;  1L1O C;  3ICE A;  3PO2 G;  1Q7Y C;  2JE6 I;  1Q1E A;  2EQS A;  5C4J H;  3TS2 A;  4IPD A;  3A74 A;  4JI6 L;  2ZTD A;  2JQO A;  4DR5 L;  2I5M X;  2VL6 A;  4JI6 Q;  1XNQ Q;  4A3K G;  4MZ9 A;  4L5S A;  5C4X G;  1E1O A;  2PMZ E;  1HNW L;  1CSP A;  1BBU A;  4DR3 L;  1HNW Q;  3PF5 A;  2VZA A;  3HKZ G;  4P72 A;  1KAW A;  2KHI A;  1VQM A;  3GTG H;  2NVT H;  1YEZ A;  1B8A A;  4LF9 L;  4LUZ A;  5M5Y H;  5FLM H;  1EFW A;  2ALY B;  4OWW B;  1WFQ A;  3T1H L;  2DUD A;  4DV3 Q;  1M1K C;  3J7A 5;  3MEF A;  2K5H A;  4PZ7 A; 
#chains in the Genus database with same CATH topology
 3SK4 A;  2MGS A;  1MSG A;  5EPL A;  5JJI A;  2JJQ A;  4PMC A;  5CV9 A;  4HJ9 A;  3DM1 A;  1SN8 A;  2IW3 A;  1HZB A;  4JI2 Q;  3T53 B;  4DR7 Q;  2C5C A;  2XN9 C;  3FPU B;  1K3R A;  3S16 H;  4WRD A;  2PZT A;  3PUZ A;  2ZTE A;  3MWY W;  3FKI H;  4JC0 A;  4LUV A;  2HHH L;  2MPM A;  1BBX C;  1BQQ T;  4I7Z C;  1GUS A;  5F2D A;  1SYE A;  1QVC A;  5G3L D;  2NVQ B;  3HOX G;  2ZM6 L;  4BY1 B;  2Z4H A;  1STB A;  3BDL A;  1PZK D;  3UDF A;  1K8M A;  2PQA A;  1MKH A;  3KUP A;  2QW7 A;  2RDG A;  1XMQ L;  4BY7 G;  1XMQ Q;  3HOU G;  1Q90 A;  3KDF A;  4PV1 C;  2F0N A;  2QGQ A;  4CKB A;  2F0W A;  4XQJ A;  1JB7 A;  2E2I H;  3I4O A;  2F52 A;  5EKK A;  3V96 A;  3OTO L;  4JOI C;  5KRU A;  1WTP A;  3QOL A;  3M4O B;  5IT9 E;  5IP9 H;  4IFD G;  4A3C G;  3UE0 A;  2OQK A;  2KQ3 A;  3L2P A;  3KF6 B;  4JI1 L;  5KEE A;  3NE5 B;  1LAC A;  2JA6 H;  1FYC A;  2LKV A;  2N8N A;  4QIW E;  5E4X A;  2WKC A;  5CV7 A;  4XYQ A;  1BF4 A;  1LTG D;  4NW2 A;  4DU9 A;  2O2L D;  1SMX A;  4JI5 Q;  1G29 1;  4RG1 A;  4NB3 A;  3CQZ B;  4DXG A;  1SR3 A;  4YWM A;  2B2T A;  3HKS A;  1YJN A;  4AIM A;  2VB3 X;  4B08 A;  1FGB D;  4DV6 Q;  4B3M L;  3J80 i;  1G2S A;  2A6H C;  5GRO A;  4XT1 B;  1N32 L;  3ONA B;  1UE5 A;  2VY3 A;  3KJP A;  3E0E A;  2WAC A;  2O5J C;  2EPB A;  4JCV E;  3KLR A;  3BYT B;  5IIF A;  4CDF C;  4AQY L;  5M3F G;  1L0W A;  3OMG A;  3PO2 H;  4DPG A;  3OHX C;  4IUP A;  4CJ2 C;  3F1Z A;  4BA1 I;  4IJL A;  3I91 A;  5A35 A;  1PVO A;  1BXT A;  4YY3 L;  3I4M G;  3MHB A;  4JYA Q;  3RZO B;  3EA6 A;  4HIM A;  5ELF A;  3LWE A;  4DK6 C;  1YNJ C;  4BBR B;  2R7Z B;  1PTO D;  1GXD C;  3NHH A;  1Q3L A;  1N34 L;  1CZG A;  4K5V A;  4K6D A;  1N34 Q;  1I4Q A;  1IYU A;  3CXC A;  1W2B A;  5C3E B;  4L5Q A;  3NK9 A;  3KYH C;  1PH8 A;  3DEP A;  4IZ8 A;  1EY8 A;  2ID0 A;  3I70 A;  2KOL A;  5M5X H;  4HMJ A;  4DV1 L;  4A3L H;  1TKW B;  4A3F B;  3VYS A;  4FXD A;  3VR6 A;  3QIA A;  3CC2 A;  3A0J A;  4R8N A;  3BZC A;  5L37 A;  4GN3 B;  1YIT A;  4CDD C;  1IYJ B;  2L0C A;  3TN2 A;  2ZT9 C;  5EKI A;  2B3G A;  2YTY A;  1J5E Q;  4POF A;  1EOT A;  1HJP A;  4H0L C;  1FNW A;  3HOY H;  2K01 A;  3A55 A;  3DHQ A;  3K7A B;  4O1N A;  3E9H A;  4KN4 C;  4C2M B;  1QB5 D;  1JWM D;  1KHI A;  4PQX A;  3CD6 A;  1SND A;  3I4N B;  4A3J B;  1L2F A;  2F0F A;  1MJE A;  1R4Q B;  2JA7 H;  5KND A;  1EQT A;  2HDL A;  1KAB A;  1QG7 A;  1CKM A;  1PTO H;  5KGU A;  1DGS A;  4X3K A;  2F4V Q;  1XMO L;  3SVM A;  1PH3 A;  1V8Q A;  4A3G B;  1Z47 A;  3NQI A;  4OGQ C;  4GOP B;  2Z0S A;  1HZA A;  5M3M B;  2A73 B;  3N6R A;  1VMP A;  4GKK Q;  1AN8 A;  3NPP A;  1SE2 A;  4A3M G;  1KC8 C;  2K1B A;  1XNR L;  2VUM H;  1I50 H;  1CA5 A;  1A62 A;  4PNY A;  4I7A A;  2DJF C;  3BVZ A;  1LTL A;  1I4R A;  5IYD H;  1PV4 A;  3OSO A;  2DNC A;  3PO3 H;  3BDC A;  4QGU A;  4F88 A;  2EYP A;  3M4Y A;  1K83 H;  1M90 C;  2R93 H;  5J3B A;  1RL2 A;  2B2V A;  2NWG A;  3CKI B;  4JBK A;  2CW0 C;  1TS3 A;  1DCZ A;  4LF5 Q;  3PV0 A;  1DON A;  5C0X J;  5BN5 A;  2BA0 A;  5ELN A;  1K9M C;  3UDG A;  3PQI A;  1QUQ B;  4HTH A;  3NEM A;  2ZJQ A;  3HOW H;  4M1U B;  1V43 A;  1CQF A;  3I3C A;  2C35 B;  3EN2 A;  3S17 H;  1ESF A;  1EFI D;  2KEC A;  1CHP D;  1JJC B;  2F0U A;  1YNN D;  1XX8 A;  1MBY A;  4ZUI A;  1FL0 A;  4OXP A;  2JA5 B;  5IGG A;  3R2I A;  1LLR D;  4Q5V A;  1G2T A;  4K0K L;  2ATW A;  4K0K Q;  3J81 i;  1ASY A;  3GTO B;  2VB2 X;  3KOJ A;  3ND8 A;  1F9R A;  3A7L A;  2B2U A;  3BZK A;  1C8C A;  4KI0 A;  4TKO B;  1JCK B;  3S15 B;  4EX5 A;  4JBM A;  1STH A;  1I5F A;  2E8G A;  3D8G A;  4DXF A;  4FNF A;  2WB1 E;  1NSN S;  2CHB D;  4BY1 G;  5DM6 3;  1A63 A;  1RCV D;  2I5L X;  1NE3 A;  4LWC A;  1SFO B;  4L5T A;  2EY5 A;  1I6H H;  3SHL A;  2OTJ A;  4QMG A;  3OWE B;  4EQO A;  1QZG A;  3S1M B;  1F2Z A;  1I6V C;  2NN6 G;  3RMH A;  2E2H H;  2UU9 L;  2A6E C;  1B53 A;  2E76 C;  1XPR A;  1ET6 A;  3NTH A;  4A3I H;  2Y0S B;  3AB9 A;  1HTL D;  2PZU A;  3PUX A;  2PI2 E;  2BDO A;  2WAQ B;  4QB4 A;  1VQ8 A;  3V2T A;  2LMC B;  4F7X A;  3E6Z X;  1QJO A;  3DWQ A;  3H91 A;  4HR7 B;  1XTD A;  3KLS A;  4Z9C B;  2AUK A;  2B2W C;  2R3Z A;  1KIX A;  1SNP A;  5JAV A;  3S24 A;  1LO5 D;  4JBW A;  4Q0F A;  3QOJ A;  3RLO A;  4YIJ A;  1CKO A;  2Y0S E;  2DNE A;  1SNC A;  2D2C C;  1B44 D;  1NR2 A;  3HOV B;  1GHK A;  3U4Z A;  3S1N H;  1SNO A;  1WTV A;  5M5W B;  2CKZ B;  5FO9 B;  3CMA A;  4KY7 A;  3TP7 A;  3OWF A;  4A3E H;  1YHA A;  4L63 B;  5EQ0 A;  1M8A A;  3NWS A;  3Q0A A;  3CCR A;  4C3J H;  4U67 3;  5D3D A;  1WCM B;  4ULL A;  2A6H D;  5IT9 L;  5C44 H;  4IQZ A;  4DV4 Q;  1JQY D;  1HQR D;  3QWN A;  4DK3 C;  4BXX H;  3QO2 A;  4KKU A;  4PG3 A;  2R7Z G;  2RDH A;  3TDQ A;  2OT2 A;  4IPH A;  1VDZ A;  1PYS B;  1VQF A;  5C3E G;  1XXG A;  1NCV A;  4DAY A;  3S14 B;  2B8F A;  2PQA B;  2SDF A;  3KBG A;  2I0Q A;  5KYI A;  1CM9 A;  1V1P B;  4DV2 Q;  4A93 B;  1HUM A;  4A3F G;  4CHT B;  1L0Y B;  1LUZ A;  4FF4 A;  2L55 A;  2EE1 A;  1TWH B;  3SXH A;  3SK6 A;  2RBM A;  3HOZ H;  2FIN B;  2ZXO A;  4HJ8 A;  1GM5 A;  1SDF A;  1PA6 A;  2A1A A;  5LL6 X;  2UUA Q;  1PFM A;  3MZ5 A;  3NQT A;  2J0T D;  2UXC Q;  1VQH A;  2AWN A;  4JBJ A;  4RKB A;  1X55 A;  1EWI A;  4HIO A;  1K8O A;  1CKN A;  1G8Z D;  3I4N G;  3D3R A;  3MXU A;  4A3J G;  4LF4 L;  5DAU A;  4UY8 C;  1X3Q A;  1JR0 D;  2PO4 A;  2EYL A;  4JI4 Q;  4J1M A;  3L0O A;  5I6W A;  4K8J A;  3S2H H;  1ZYR D;  2F0S A;  3GTK H;  4AYB E;  4QUF A;  1B3A A;  3LGJ A;  5DLQ E;  5TSS A;  3RLN A;  5JOB A;  3D4R A;  3QB3 A;  2MHV A;  4OIK A;  4ZAI A;  1TXY A;  2GVA A;  2IHF A;  4IJH A;  1UAP A;  1CTM A;  5M3M G;  2UUC L;  1H9J A;  5IP7 H;  1HA5 A;  1KD1 C;  4XDX A;  2Q2U A;  5CV5 A;  2TMP A;  1LTR D;  1E24 A;  1PXU A;  1QNU A;  3S16 B;  2ENB A;  2PZW A;  1CSQ A;  1ZKO A;  1L1O C;  3ICE A;  4ABN A;  3FKI B;  2QF7 A;  3A74 A;  2X6G A;  1WD0 A;  2JQO A;  4DR5 L;  1CA6 A;  2VL6 A;  1E1O A;  2PMZ E;  1HNW L;  1CSP A;  2GA4 B;  1HNW Q;  3PF5 A;  1KAW A;  1HHV A;  2KHI A;  1VQM A;  3GTG H;  5JPN C;  5I2X A;  1B3Q A;  2ALY B;  4DV3 Q;  2F3W A;  2HDM A;  3J7A 5;  3FVQ A;  4KN7 C;  2UXB Q;  2F0T A;  1SE8 A;  1ILP A;  1NY4 A;  3K8A A;  4JOI A;  3G7L A;  2F0K A;  4HJA A;  2J4X A;  1ZEQ X;  2JA8 B;  3DM3 A;  1UE6 A;  4A3B B;  4O2D A;  4XTC S;  3W1G A;  1PRT C;  5EPJ A;  1XJV A;  3LNN A;  4M8A A;  1Y69 U;  4LF8 L;  2E2I B;  4LF8 Q;  1H95 A;  1HRJ A;  4HCE A;  1BCP B;  1YVC A;  2CH4 W;  2CW0 D;  3PUW A;  1D8L A;  3K59 A;  1MGS A;  1XWE A;  2JA6 B;  3E3X A;  4IUV A;  4ZCK A;  5KNC A;  4DR4 L;  1CQV A;  4LF6 L;  2F0V A;  3D4W A;  4KHV A;  3IRB A;  2NN6 I;  3JAM i;  4GLX A;  2DY7 A;  2K50 A;  1IBM Q;  2C9O A;  5EBD A;  1AE2 A;  3AMU A;  3TME A;  1QOH A;  2N55 A;  1TS2 A;  3P20 A;  3CCV A;  2O4X A;  1TWC H;  2K03 A;  4OWX B;  1BVS A;  2BOS A;  5K5P A;  4RWS C;  1S5D D;  1SNM A;  4Y7N B;  4K5W A;  5E7N A;  3PCO B;  4GLV B;  4HMI A;  5H1S E;  1VQI A;  3ULP A;  1NMG A;  1CFM A;  1II3 A;  1JT8 A;  4DV0 L;  1IBK Q;  2B39 A;  1SYG A;  5E4W C;  3PO2 B;  3M4Q A;  1EY5 A;  4JV5 L;  1CHQ D;  3E5S A;  2BH2 A;  1S72 A;  4WJ4 A;  1AFP A;  3E0J A;  1KQS A;  1VQ7 A;  3TBI B;  4LJZ C;  2WAQ G;  2A5H A;  4RHR A;  1Q82 C;  3R3O A;  1TU2 B;  2SNM A;  4LW1 A;  5EBC A;  3J7Z C;  5DNF A;  3D4D A;  1AE3 A;  4LMQ D;  1UEB A;  4A76 A;  1BCP F;  1DYQ A;  3A5U A;  4X64 Q;  1XTC D;  2NVT B;  2D0P A;  4ZQ3 A;  1RHP A;  4K2K A;  4N8F A;  2R92 H;  5IOD A;  1HNX L;  5M5Y B;  1RD9 D;  1QZH A;  4PMB A;  5D3I B;  4X66 L;  2FHT A;  2A69 C;  4MTN A;  2AMC B;  5M5X B;  1VQC A;  5FOB B;  3R2T A;  4FF2 A;  1HR0 L;  4N8X 1;  1WYD A;  3HKZ E;  2K04 A;  1FNV A;  3PMF A;  1Q46 A;  4QL5 A;  4ZUJ A;  4IUN A;  1R9T H;  3F8T A;  4UP9 A;  2PI2 A;  4DV5 L;  2ZJR A;  1ENC A;  3P75 A;  1ROD A;  4X62 L;  4JI3 L;  4H02 A;  2CCZ A;  3HOY B;  2FFK B;  1D5M C;  4NXM Q;  5HUR A;  3K5L A;  4A3K H;  4RHS A;  4C3H H;  4PZ6 A;  4LF7 L;  1ESR A;  3PGZ A;  4LF7 Q;  1XNQ L;  1N36 L;  1N36 Q;  3J7A V;  1A8V A;  2R61 A;  2QA4 A;  3HFZ B;  1PTO B;  2IHE A;  5IGB A;  2MQH A;  1BBW A;  3GTL H;  4OO1 G;  1H9S A;  1RF2 D;  2MFI A;  2N78 A;  2E2D C;  4WJW A;  2MNA A;  4A93 G;  5IOC A;  2XVS A;  3NWT A;  1VQN A;  1F9P A;  3J81 c;  3H94 A;  2QEX A;  4DUZ Q;  3TEH B;  1OXT A;  4TSS A;  4JI2 L;  1BDO A;  2RKS A;  2IX0 A;  2IX1 A;  4DR7 L;  1D7Q A;  1PRT F;  2OCE A;  2I46 A;  5JEA H;  4IUR A;  3PO3 B;  4C1N I;  1R4P B;  1TII D;  4HIK A;  1E1T A;  2R93 B;  2PQE A;  3SGI A;  2L12 A;  1FJG L;  3HOX H;  2ZXR A;  1GHJ A;  1K8A C;  1FJG Q;  4P74 A;  3CRL C;  2B63 B;  4G7H C;  1MIU A;  4R4T A;  5COY A;  1TWA H;  3I2Z A;  1TQO A;  4H7B A;  3KF8 A;  1JE4 A;  4RGM A;  1EEF D;  3HOW B;  2JSO A;  2RCN A;  4BY7 H;  2K32 A;  3MXG A;  1KNA A;  4HJ5 A;  4IO9 A;  1JMC A;  3BJU A;  2K33 A;  1Z9F A;  4QIW B;  4G7Z C;  1IHZ A;  1K0R A;  3RNU A;  1HQM C;  5I4D A;  1ICW A;  2RHQ B;  4IFD H;  4A3C H;  1IW7 C;  1EY9 A;  2EOT A;  3VR4 A;  3SK8 A;  1VQ5 A;  4S3S A;  1LTB D;  1VQ9 A;  1JIC A;  3PUY A;  5C4X B;  5CYU A;  1VCI A;  1A2U A;  1QVG A;  5JJZ A;  2HCI A;  2NTS A;  2IY5 B;  5EKL A;  1VS0 A;  1X32 A;  1X3E A;  2PNR C;  1PH7 A;  4B3S Q;  1IBL Q;  4YWL A;  4IUT A;  4JK1 C;  2K28 A;  4DAY B;  4JI5 L;  2F0G A;  3KK7 A;  4JI8 Q;  1JE5 A;  4C3I H;  3Q24 A;  4FF3 A;  2JA8 G;  1X9N A;  1S40 A;  4A3B G;  1I6H B;  3WDN A;  1LT5 D;  2SNS A;  1IKM A;  4FP5 D;  1E3P A;  1YHB A;  4DV6 L;  5FKA C;  5IYC G;  4BBS H;  2A8V A;  1N9W A;  4DR6 Q;  3S2D B;  5M3F H;  1SE4 A;  3FP9 A;  2YU9 H;  2E2H B;  1RKN A;  4MHE A;  3S1R H;  4A3I B;  2JA6 G;  4DNR B;  4GOP C;  3EJI A;  3IFD A;  3GTJ B;  1F2Y A;  1G51 A;  4OEL B;  2NZ1 D;  1JOO A;  3S1Q B;  1HZC A;  2KBN A;  1OXX K;  2X6L A;  3SR1 A;  2NVX H;  2MP1 A;  4JYA L;  1U9R A;  2OF1 A;  4O0A A;  3PF4 A;  4CJ0 B;  1W6J A;  3MAQ A;  4DUY L;  2NVY B;  3SK5 A;  4DUY Q;  2EXD A;  3S1N B;  2Q8I B;  3CAM A;  4LFB Q;  1SMY C;  4QJF A;  4KMU C;  3TQY A;  1CZW A;  2QDB A;  1YIJ A;  4A3E B;  2XTI A;  2NTT A;  3SEB A;  3K0X A;  2AKW B;  3AYH B;  2JK8 A;  3DUZ A;  1PH6 A;  3J80 E;  2L9H A;  4DA2 A;  3J7Y W;  5C44 B;  2RDF A;  3OYY A;  2Z1C A;  1J5E L;  1XPO A;  2JA9 A;  4LF9 Q;  3MFG A;  3OW2 A;  3QR8 A;  3WOF A;  1E22 A;  4K14 A;  1X3F A;  1JWU D;  3CCQ A;  3STB C;  2B8G A;  4OL7 A;  1PZI D;  4P75 A;  1OXV A;  1KDB A;  3TP8 A;  5LHY 1;  5IYB H;  1E0B A;  2JN4 A;  1GO3 E;  3E9I A;  1E2Z A;  4L5R C;  1NBW A;  1I4H A;  2F4V L;  2L5T A;  4EQP A;  4KD3 A;  5FO8 B;  2BDN A;  1G6P A;  1SYF A;  3ND9 A;  1J8I A;  5J1Z A;  1WTX A;  2AHO B;  3K5O A;  4IUU A;  1KDC A;  1AEX A;  1U4L A;  2A69 D;  3AQQ A;  1EYD A;  3NUC A;  4GKK L;  1ASZ A;  3RLF A;  2ASB A;  3TZD A;  3G4S A;  4RH6 A;  2K6A A;  5LL6 S;  2AUJ D;  1WTW A;  2MO0 A;  3T51 B;  4DAP A;  3NP8 A;  1B7Y B;  1U4R A;  2NYZ D;  3EIV A;  3FPP A;  1IXR A;  3NEL A;  4JW0 A;  4NPS A;  4DV7 Q;  2KCC A;  3K0Y A;  1GUW A;  5EAY A;  3KLW A;  4FVM A;  3K6O A;  4DK1 A;  3T1Y Q;  2LXK A;  1P16 A;  1L1O A;  4LF5 L;  5LMN W;  1BOS A;  1NR4 A;  3S9W A;  3F2B A;  4CKE A;  4CBV A;  2EY2 A;  4GNX C;  4EGV A;  2VNU D;  3GV3 A;  3VA5 A;  1EY6 A;  3UDX A;  2QEJ C;  2HIV A;  1Y1W B;  4NMZ A;  4A3D H;  2JEB I;  2ES2 A;  1JJ2 A;  1L0X B;  5CV8 A;  3K81 C;  5GAG C;  2MO1 A;  2RCF A;  1C4Q A;  2K5N A;  2WB1 B;  1Y14 B;  4YHH L;  5JVH 3;  3H0G H;  4YHH Q;  3PO3 G;  2O5I C;  2CWP A;  2Q2T A;  3GTG B;  4K8I A;  3EQL C;  4KHP Q;  2R93 G;  4DR2 Q;  4J15 A;  1K0S A;  4ZLT F;  1PH9 A;  3VR3 A;  1WOC A;  2BE5 C;  3U58 A;  2NVQ H;  3LX0 A;  5IWA Q;  4BY1 H;  3GTM H;  4IFD I;  2B63 G;  1TVX A;  1M4V A;  3HGB A;  3D6W A;  3EFX D;  3HOW G;  1VQE A;  3I8Z A;  4J6H A;  2D62 A;  2EXZ A;  3X3M A;  2M00 A;  4KKT A;  3K58 A;  1WTH A;  3VDY A;  2JP1 A;  1ET9 A;  5BR8 Q;  4DAV A;  2NN6 H;  1FNU A;  3M4O H;  1OXU A;  4B9X A;  3M3Y H;  2VQF Q;  5JEA J;  3FHW A;  1LT6 D;  2Q8R E;  5C4J H;  3TS2 A;  4IPD A;  2ZTD A;  5JPM C;  1PZJ D;  1T5E A;  2XRS D;  4MZ9 A;  4K2L A;  4L5S A;  5C4X G;  2F4I A;  5DEH A;  1A3T A;  1BR9 A;  4P72 A;  2G9H D;  3BYY B;  1STG A;  1O7Z A;  1WFQ A;  4RA8 A;  1LV9 A;  3F2U A;  2A68 C;  4IAL A;  1M1K C;  1IW7 D;  1BNZ A;  1G91 A;  4RGN A;  3L9A X;  2K5H A;  2L11 A;  1I94 Q;  3J81 E;  1IZ6 A;  3C46 A;  4OIJ A;  3U50 C;  1LTT D;  2RF4 A;  1VQ6 A;  2B2T C;  2F0L A;  4IFD J;  2KED A;  3U4V A;  5BN3 A;  1IYV A;  2NUC A;  2LS0 1;  2YV5 A;  3A54 A;  1STN A;  3RZO H;  3R8B A;  1TT2 A;  2K52 A;  5FO7 B;  2NB0 A;  2K5D A;  2F0O A;  4FDB A;  2R7Z H;  4OON A;  1ENA A;  3NSW A;  1GUN A;  3NTI A;  2K14 A;  4IN3 A;  3F2C A;  4DV4 L;  1PH5 A;  4BBR G;  3I4L A;  1NMF A;  5DM7 3;  2VQE Q;  4XT3 B;  2ZJP A;  1SXT A;  3KF8 B;  2IT1 A;  2WV6 D;  1Y1V B;  3A8J E;  5FJ8 H;  3CC4 A;  1R9T B;  4A3F H;  3J7A F;  2DN8 A;  4JVZ A;  1O7I A;  5EGT A;  4A3E G;  3A56 A;  4DV2 L;  1AH9 A;  1YNJ D;  3FRP B;  5CBE E;  2Q2H A;  3DWA A;  3KDF B;  4JPB W;  5K36 H;  2F0D A;  2AWO A;  3TP5 A;  2B2Y A;  3KF6 A;  3QG1 A;  1EWH A;  5C44 G;  4A3K B;  1O7Y A;  3K7A H;  4BXX G;  1SMY D;  4CKC A;  1OTC A;  4C2M H;  1BCP C;  4AYB B;  4F8M A;  3CPF A;  4X3U A;  1D5X C;  2UUA L;  4A3J H;  2UXC L;  2EYJ A;  4H13 C;  5KYL A;  5ELD A;  3M7N A;  1CI3 M;  2RSO A;  3D31 A;  1DJR D;  1IKL A;  4ZK9 B;  4JI4 L;  1A6X A;  3HP3 A;  2QDL A;  1HUN A;  1T5X D;  1PH1 A;  3H6M A;  1RTO A;  3HRZ C;  2K7V A;  3SDZ A;  5M3M H;  1KLU D;  2YTV A;  1GVP A;  1KRS A;  2KUM A;  1GOZ A;  1X3P A;  3STB D;  1EY7 A;  2PMZ B;  3X3N A;  1EIY B;  4A3G G;  3G48 A;  1D1K A;  2F0H A;  3I55 A;  5I6Y A;  2XWB B;  1ZXT A;  1EYC A;  4I65 A;  4KD4 A;  5GAH C;  2R6G A;  1SJE D;  2XGT A;  4PMW A;  2KVM A;  1N33 Q;  3J80 L;  1IL2 A;  3ULL A;  4EQN A;  4YCU A;  5AJ3 Q;  1LAB A;  3J80 c;  2F03 A;  5C5M A;  1YBY A;  5CC4 A;  1TWA B;  4DV3 L;  1DOL A;  4BY7 B;  1TWG H;  2UXB L;  3QJY A;  5IP7 G;  3JC6 6;  4YWK A;  2UXD Q;  4B3T L;  3L7Z C;  1VQ4 A;  4B3T Q;  1VQG A;  2OEO A;  5C3X A;  2V4D A;  1Y1W G;  1VQA A;  4HJ7 A;  3OPO A;  4X65 Q;  3KLS X;  2RVL A;  2WB1 G;  4ODG A;  4WFN 3;  4GN5 A;  1SRO A;  1X54 A;  3WOE A;  2JA5 G;  3G6J B;  3S15 H;  2K5V A;  3K5N A;  3A5Z B;  2IPK D;  5AFW A;  2EVB A;  3CU7 A;  3FMC A;  2P5Z X;  1IBM L;  1KAA A;  5HY6 A;  2EJF C;  2PYK A;  3R93 A;  3RUZ A;  4C3I B;  1SSO A;  1SFO H;  2CQO A;  3IAY A;  1A2T A;  1PTO C;  4BBS B;  1SLJ A;  1EOV A;  1E7Z A;  3CCL A;  2R7D A;  2YU9 B;  1E2W A;  2BE5 D;  2OXP A;  4G4K A;  1D2B A;  3CCS A;  1ILQ A;  3S1R B;  1VF5 C;  5EPK A;  4DAM A;  3ZYY X;  1Q12 A;  3M4P A;  1IBK L;  3GTQ H;  2JYO A;  4POG A;  2M2L A;  1MHW C;  1HZ9 A;  2KHS A;  1YJ9 A;  3RR5 A;  2GVB A;  2NVX B;  1GUO A;  2N3S A;  2Y0S G;  3MXP A;  4RCN A;  5C5L A;  3HKZ B;  5J39 A;  1VQJ A;  1EQV A;  5LMU L;  1B1Z A;  1GD7 A;  5LMU Q;  1K73 C;  2Z8L A;  3MFY A;  4X64 L;  3DXJ C;  1PH2 A;  1EUJ A;  1L1O B;  2FMM A;  1Q8K A;  2A6E D;  2DGY A;  3JAM E;  5LMN Q;  1NJI C;  2F0M A;  5FLX E;  5M5W H;  4CJ1 B;  1B9N A;  4FO2 A;  3FDT A;  3HOV G;  1B9M A;  3D0F A;  4P71 A;  3W3A A;  2XSC A;  2XRQ D;  1EYA A;  3W2D A;  2RQX A;  3CC7 A;  4UP8 A;  1EQR A;  4LFA Q;  3BVG A;  3CCJ A;  2ICI A;  4WJ3 M;  1GUG A;  2PW7 A;  3PUV A;  3HG9 A;  4BS9 A;  4DNI A;  3TZU A;  1LM0 A;  1PFS A;  4LFC L;  3KJO A;  1WCM G;  4LFC Q;  4NXM L;  5G3L F;  4LK1 C;  1ICF B;  1W3S A;  2FJ2 A;  1D1I A;  4X6A H;  4G57 A;  3TP6 A;  1CUK A;  3A8K E;  5NUC A;  3Q22 A;  3MC0 B;  4TQU S;  4UDU C;  2IWH A;  1EZ8 A;  1HA6 A;  3M9B A;  4XIG S;  2JA7 B;  1WVL A;  1EIF A;  4XXE A;  5KIX A;  1UNS A;  2J7Z A;  4GN4 B;  4KHZ A;  1Y1V G;  2D9U A;  3CF5 A;  3BVM A;  4A93 H;  1AW7 A;  3J81 L;  3CCU A;  4RGT A;  2HUG A;  1EY4 A;  1EYG A;  2K4K A;  1TWH H;  3TS0 A;  3GDE A;  5C0X G;  1GJX A;  1EQQ A;  1U5K A;  3GTP H;  4DUZ L;  1MD2 D;  4HID A;  1TWF H;  2M9V A;  4AYB G;  2XNA C;  4DR3 Q;  4HCS A;  2PNH A;  2VW9 A;  2VUM B;  1I50 B;  1SYD A;  1T9H A;  1RIP A;  3KBX A;  4R4C A;  2L4N A;  4ZYS A;  4RAU C;  1STE A;  1VQO A;  4P73 A;  3HS0 C;  4KY6 A;  4R1J A;  3T1H Q;  4DN4 M;  1S5F D;  3H3V I;  1J6Q A;  2PCF B;  1YNN C;  4TRD A;  1SRU A;  2CWA A;  2Z4I A;  4GNX A;  1D5Z C;  5FLM G;  3IKJ A;  2OQ0 A;  1K83 B;  1PFN A;  2G9D A;  1JOK A;  2N49 A;  1SNQ A;  1UE7 A;  4ILW A;  1BCP D;  2PW5 A;  3CHB D;  1J9O A;  2YTX A;  5T1G A;  1KNE A;  3T4A C;  2E2J H;  4QQB X;  3J81 j;  3NBI A;  4ZRZ A;  4IOA A;  4L8J A;  3T16 A;  1MSH A;  3CW2 C;  4JG2 A;  4RKL A;  3VA7 A;  1K8G A;  4A3D B;  4R4I A;  3HOU H;  1EIG A;  2V1C C;  3S17 B;  1I4G A;  3H0G B;  5JEA G;  2HHH Q;  2AQ1 B;  1PTO F;  4YCV A;  3C1E A;  5BN4 A;  3VR2 A;  1Y8O B;  3FKI G;  1O7L A;  2K75 A;  4APV A;  1AZP A;  1BO0 A;  5COR A;  2KA7 A;  3GTM B;  1Q8I A;  2ZM6 Q;  4DFA A;  3D6C A;  4B3S L;  1SJH D;  1IBL L;  1V1P A;  2JA8 H;  1U0L A;  4A3B H;  4QCL A;  1CT1 D;  4JI8 L;  4ZKB B;  2F0P A;  1UWV A;  1VQL A;  4NXN L;  5IYC H;  1C48 A;  4NXN Q;  4GZY C;  1LTI D;  3OTO Q;  1VQD A;  3M3Y B;  5FK9 C;  3VR5 A;  2H4O A;  4DR6 L;  1DD2 A;  4JI1 Q;  2A19 A;  2ZXP A;  1TY2 A;  5C4J B;  2RSN A;  5GAD C;  5IP9 G;  4KKS A;  3ZJY C;  2HIX A;  1EZ6 A;  3L3O C;  4KJO A;  1A15 A;  1KL9 A;  5ELB A;  2K05 A;  3I4M H;  3G6E A;  2B2W A;  1WJJ A;  3SE0 A;  3CCM A;  1EIH A;  1PRT D;  1CKN B;  5KNB A;  4QUC A;  3H3V C;  2NZH A;  3A7A B;  1V9P A;  2IJ0 A;  4C3I G;  5I9P A;  4B3M Q;  2XIW A;  4Y7N H;  1N32 Q;  1X3G A;  2QIL A;  1HFG A;  2B29 A;  1LTS D;  2VS1 A;  3UE1 A;  1O78 A;  4BBS G;  1Z6H A;  5E3F A;  4AQY Q;  4LFB L;  2IL8 A;  2AQ3 B;  2Z6K C;  1S5C D;  2EYO A;  5T1I A;  1PH4 A;  4K5X A;  3DEO A;  2K5W A;  3CP0 A;  5ELC A;  4WOR A;  4GLA C;  4YY3 Q;  3IFT A;  3PO2 G;  4FXK C;  1Q7Y C;  2JE6 I;  2EQS A;  1DXM A;  3MVV A;  4JI6 L;  4C3J B;  4HN7 A;  3C2P A;  2I5M X;  4JI6 Q;  3CRK C;  3BS1 A;  2NBF A;  1TY0 A;  1BBU A;  1SAP A;  3HKZ G;  4ME5 A;  4C56 C;  2NVT H;  1YEZ A;  1B8A A;  4LF9 L;  2EYF A;  4NP5 A;  5M5Y H;  1EFW A;  4OWW B;  2DUD A;  2EYH A;  3DMU A;  3TSS A;  3ERO A;  3MEF A;  4PZ7 A;  5A2Q E;  1A3V A;  2CH4 A;  3OOC A;  4BWG B;  4RCO A;  5GQO A;  2X69 A;  4P2C B;  3K5M A;  4DV1 Q;  4KV6 A;  1EL0 A;  1MI2 A;  4N9T A;  1KTK A;  3ERQ A;  2L1B A;  2MJ8 A;  4A3L G;  2CQA A;  5C4H A;  4IOC A;  3ERS X;  2G5D A;  4V0B A;  1WD1 A;  1ZYR C;  1I3Q H;  4KK7 A;  1I4X A;  1HH2 P;  4UAI A;  2Z9H A;  3NXW A;  4DF7 A;  4OO1 I;  1YNX A;  3HOZ B;  5IY0 A;  3RZD H;  1S3O A;  3FEW X;  4R4Q A;  4A3M H;  2L15 A;  5C0X I;  3HOY G;  1TR5 A;  4MN3 A;  3MXN A;  1DM0 B;  1F2L A;  2EY1 A;  1QE6 A;  4O42 A;  2EJM A;  2N88 A;  1TS5 A;  4HSP A;  3P1H A;  5C3W A;  3Q8D A;  5ISR A;  1O80 A;  2OTL A;  1C0A A;  2LXJ A;  1VQP A;  3OIQ A;  2JA7 G;  2AQ2 B;  1UUP A;  4J8Q A;  1S5B D;  3T13 A;  5IYB G;  1ML0 D;  2E74 C;  2MUY A;  3W5O A;  4DV7 L;  1XMO Q;  3S2H B;  3GTK B;  4CGY B;  1KXL A;  1PMR A;  3VYR A;  1RDP D;  3T1Y L;  3JAM L;  4LAA A;  1NAP A;  5FLX L;  4HSV A;  1HTP A;  1U4P A;  1W6K A;  2EIF A;  4MNO A;  1XNR Q;  1P8L A;  3C1F A;  4ID6 A;  3JAM c;  4NDX A;  4FYD A;  4K6L A;  5FLX c;  1B70 B;  2RA4 A;  1H9K A;  5CV4 A;  2VUM G;  4UPA A;  1ENF A;  1QIL A;  2CVR A;  2ICE C;  3GD7 A;  1JC7 A;  3G71 A;  5IYD G;  1OO9 B;  4NKL A;  1DZ1 A;  1Q1B A;  3O13 A;  1SBB B;  2XWJ B;  1UE1 A;  1YJW A;  4KTA A;  1QVF A;  4KHP L;  5JJL A;  4DR2 L;  4B3R L;  4B3R Q;  2B63 H;  2Z6B A;  1XYI A;  3I56 A;  3AU7 A;  1TWG B;  4IUQ A;  1HR0 W;  5IWA L;  1Z7T A;  5D14 A;  1EU3 A;  1V1O A;  4OEM B;  2H5X A;  1Y8P B;  1UEA B;  3BG3 A;  3PIO 3;  3H15 A;  1Q81 C;  4LNQ A;  4A3D G;  3PIP 3;  1LYL A;  4ME3 A;  2QCP X;  1S5E D;  3ER0 A;  1MJC A;  3NBH A;  5BR8 L;  2KCT A;  2NZO A;  3H0G G;  2RHS B;  5IGE A;  2VQF L;  2KEN A;  5C4X H;  1STY A;  4XYO A;  3N52 A;  2E5L L;  2BH8 A;  1LT3 D;  5CGK A;  2E5L Q;  1WTQ A;  2E75 C;  3NTK A;  3BDO A;  1WTR A;  1A3U A;  1F9S A;  1K28 A;  1NUC A;  2EDG A;  2WKD A;  2JXM B;  1GUT A;  4UHV A;  3CQZ H;  2SEB D;  1B2T A;  1HPC A;  1TWC B;  3TRE A;  3TRZ A;  5IGF A;  1H9S B;  2I07 B;  1I94 L;  1AP0 A;  2FMC A;  3S2D H;  1V1Q A;  4FF1 A;  3OIP A;  4YCW A;  4DKA C;  3RN2 A;  3KFU A;  2UU9 Q;  2SOB A;  2EYM A;  5IGC A;  3GTQ B;  4XQQ A;  4MIU A;  2DY8 A;  3GTJ H;  1S4Z A;  4A3I G;  1NNX A;  3S1Q H;  4GKJ L;  3UI2 A;  4GKJ Q;  4DK0 A;  1KRT A;  2FXQ A;  1EU4 A;  2F1M A;  1JJG A;  3IL8 A;  1VF7 A;  4DGZ A;  3DLL A;  4BBR H;  1WI5 A;  1VQK A;  4GNX B;  2A74 C;  4HED A;  2NVY H;  2WP8 J;  5HGT A;  1PLF A;  2KCM A;  4QY7 A;  1FR3 A;  2WAQ E;  2R92 B;  3ULJ A;  4X3T A;  5C3E H;  4PZ8 A;  1VMC A;  1STA A;  4QF4 A;  2VQE L;  2EJG C;  3P7J A;  4DR1 L;  3NEN A;  2CFM A;  4EQ5 A;  4DR1 Q;  3EVQ A;  1PYW D;  4A75 A;  1IL8 A;  2KHJ A;  4C3J G;  3I72 A;  1FGU A;  3W1B A;  3HZX A;  1C9O A;  5D65 A;  1RJT A;  3MEH A;  5IT9 c;  1DOM A;  1QWY A;  2HQE A;  4C3H B;  5JVG 3;  1JOR A;  3VYU A;  4OX9 L;  2R7F A;  2WFW A;  3I4N H;  4OX9 Q;  1YHQ A;  2F0Q A;  1N8R C;  1X56 A;  4G7O C;  5IGD A;  4E6I A;  5FJ8 G;  3F2D A;  2H1E A;  3GTL B;  5I9O A;  4A4I A;  2D0O A;  3GO5 A;  5ELE A;  3GP7 A;  4IPC A;  1YZ6 A;  3GQB A;  3I90 A;  4A3G H;  1GKH A;  1G6Z A;  5K36 G;  1F2M A;  1NTG A;  3T56 B;  3GTP B;  5GAE C;  1PDQ A;  1TWF B;  3OMC A;  3HOZ G;  3H3V H;  1I4P A;  4L6T B;  1QNK A;  1PYB A;  3CME A;  1SYB A;  4R4O A;  3BZD B;  4HAE A;  3U9O A;  4LF4 Q;  1C7Y A;  1N33 L;  1A0I A;  3URY A;  5CMD A;  1B4O A;  4CDC C;  1OXS C;  5IE8 A;  4LUO A;  1VQB A;  5AJ3 L;  3K80 C;  2UUB L;  2EZV A;  2UUB Q;  1PHJ A;  3MTS A;  3HOX B;  1YI2 A;  2VXW A;  4OWT B;  3AFQ A;  5A2Q L;  2UUC Q;  4TVA B;  2E2J B;  1LT4 D;  3M85 A;  4KY5 A;  1HFN A;  1Y1W H;  1D6E C;  3HOU B;  2B2V C;  4F87 A;  3UDI A;  4MTK A;  2UXD L;  2TSS A;  5M9O A;  1BKB A;  1CK1 A;  2JEA I;  4DR5 Q;  1BUV T;  5C4Z A;  4X65 L;  2F0J A;  2JA5 H;  2HT1 A;  1TS4 A;  1SEB D;  2KEE A;  3V05 A;  3GTO H;  3RN5 A;  2Q2I A;  3K7U C;  4XQN A;  3CPW A;  4V19 0;  4Y52 H;  4RFB A;  1EEI D;  4U68 A;  4CDE C;  5JJK A;  1JB3 A;  2LSS A;  1Q86 C;  1RTN A;  2KJX A;  4DNT B;  1X65 A;  2B2U C;  4X3S A;  1H9R A;  1HXY D;  2BA1 A;  3Q23 A;  1FVI A;  3U9S A;  1F77 A;  1X6O A;  3PIO A;  3OW7 A;  3PIP A;  4GOP A;  4UP7 A;  5ELO A;  4IPG A;  3I7F A;  3S1M H;  1KLG D;  5M3F B;  1EWC A;  2LY7 A;  3HEJ A;  3M7G A;  4DR4 Q;  4LF6 Q;  2I5H A;  3MXN B;  1AZQ A;  5J22 A;  3I4M B;  5E1F A;  2K5Q A;  4JI7 L;  3PSI A;  4JI7 Q;  4KLK A;  1HNZ L;  1E2V A;  1HNZ Q;  3WWV A;  3BU2 A;  2HCC A;  2YYZ A;  2GN5 A;  3MA2 B;  4AH6 A;  4GS3 A;  2HD3 A;  2Z6K A;  1XPU A;  4JI0 L;  3B6Y A;  2F0I A;  4C1N K;  4JI0 Q;  2BCO A;  2IX3 A;  4DV0 Q;  3HOV H;  5LMN L;  5CV6 A;  3LWU A;  1QUQ A;  4EVO A;  4JV5 Q;  3H09 A;  4BA2 I;  1K3B C;  3GV6 A;  4N9P A;  3C3L A;  1Y8N B;  3VYT A;  2HQL A;  3A8I E;  2Q8T A;  4LFA L;  2A68 D;  1FD7 D;  3I73 A;  1WCM H;  1WTO A;  1PFB A;  1U4M A;  3K57 A;  2EY6 A;  4B9W A;  4RGO S;  3RD4 A;  2F3I A;  3EBE A;  1HNX Q;  1HCZ A;  2PPB C;  4X66 Q;  2ZTC A;  4R8I A;  1SE3 A;  5I2Y A;  1JWS D;  1PRT B;  3ITP A;  5EJW A;  2R92 G;  3AFP A;  1Y1V H;  2D5D A;  1HR0 Q;  3CCE A;  2KCN A;  2WIN B;  4OHJ A;  1SYC A;  4ZKC B;  1F9Q A;  4OO1 H;  3S14 H;  1ONL A;  4DV5 Q;  1B50 A;  5CR3 A;  1DOK A;  2F3V A;  4ALP A;  5C0X H;  5HGQ A;  1I3Q B;  4X62 Q;  3NBH B;  2OWO A;  4JI3 Q;  1LTA D;  4R9W A;  3AEV A;  2DJG C;  2QKI C;  4RMF A;  3RZD B;  4FXG C;  1Q1E A;  4A3M B;  5C6A A;  2F0E A;  4KJN A;  1XNQ Q;  4A3K G;  2LFN A;  2B2Y C;  3DWP A;  5CBA E;  4DR3 L;  2WII B;  1KDA A;  2VZA A;  4C3H G;  1JOQ A;  1QCB D;  1H9M A;  4LUZ A;  1EY0 A;  5FLM H;  3T1H L;  3Q6S A;  4H44 C; 
#chains in the Genus database with same CATH homology
 1SE8 A;  1I94 Q;  1NY4 A;  3K8A A;  4JOI A;  1IZ6 A;  5GQO A;  4DV1 Q;  4HJA A;  3U50 C;  2RF4 A;  1VQ6 A;  3DM3 A;  1UE6 A;  4O2D A;  4XTC S;  3W1G A;  1XJV A;  5JJI A;  2JJQ A;  4IFD J;  4HJ9 A;  4A3L G;  1SN8 A;  4LF8 L;  4IOC A;  3U4V A;  4LF8 Q;  1H95 A;  3ERS X;  1HZB A;  1YVC A;  4JI2 Q;  1I3Q H;  1HH2 P;  3PUW A;  4DR7 Q;  1D8L A;  1K3R A;  4OO1 I;  1YNX A;  2YV5 A;  3S16 H;  5IY0 A;  3RZO H;  3RZD H;  3PUZ A;  4DR4 L;  1S3O A;  2ZTE A;  4R4Q A;  2K52 A;  4A3M H;  2L15 A;  3FKI H;  5C0X I;  4JC0 A;  4LF6 L;  3IRB A;  3HOY G;  4FDB A;  2R7Z H;  4LUV A;  2HHH L;  4OON A;  2NN6 I;  3JAM i;  2K14 A;  3F2C A;  4GLX A;  4DV4 L;  2K50 A;  1IBM Q;  1PH5 A;  2OTL A;  3Q8D A;  1C0A A;  1AE2 A;  4BBR G;  2LXJ A;  2UXB Q;  1VQP A;  3CCV A;  2JA7 G;  1QVC A;  2ATW A;  1NMF A;  1TWC H;  1XMO Q;  5IYB G;  3HOX G;  4OWX B;  4DV7 L;  1BVS A;  3W5O A;  2ZM6 L;  2VQE Q;  2ZJP A;  3KF8 B;  2IT1 A;  3UDF A;  1KXL A;  5FJ8 H;  2PQA A;  1MKH A;  5E7N A;  3PCO B;  4GLV B;  5H1S E;  4A3F H;  3T1Y L;  3CC4 A;  1VQI A;  3ULP A;  1O7I A;  1XMQ L;  4A3E G;  4BY7 G;  1NMG A;  1XMQ Q;  3HOU G;  1JT8 A;  4DV0 L;  3KDF A;  1IBK Q;  4DV2 L;  1AH9 A;  2QGQ A;  2E2I H;  1JB7 A;  3M4Q A;  2Q2H A;  2EIF A;  2F52 A;  3I4O A;  3KDF B;  4MNO A;  4JOI C;  3OTO L;  1P8L A;  2AWO A;  1XNR Q;  3JAM c;  4JV5 L;  4WJ4 A;  2BH2 A;  3KF6 A;  5FLX c;  1S72 A;  1B70 B;  5IP9 H;  5C44 G;  1KQS A;  1VQ7 A;  4IFD G;  3UE0 A;  2OQK A;  4A3C G;  3K7A H;  3L2P A;  3KF6 B;  2WAQ G;  4JI1 L;  4BXX G;  2VUM G;  2JA6 H;  4UPA A;  1OTC A;  4C2M H;  1Q82 C;  2N8N A;  4QIW E;  4LW1 A;  3CPF A;  3GD7 A;  3J7Z C;  3G71 A;  2UUA L;  4A3J H;  5IYD G;  1AE3 A;  2UXC L;  1Q1B A;  1UEB A;  4A76 A;  1SMX A;  1UE1 A;  1YJW A;  3A5U A;  4X64 Q;  4JI5 Q;  1G29 1;  2D0P A;  4RG1 A;  1QVF A;  2R92 H;  3M7N A;  4KHP L;  4NB3 A;  3D31 A;  4DR2 L;  4B3R L;  1HNX L;  5JJL A;  1SR3 A;  4B3R Q;  2B63 H;  1QZH A;  4JI4 L;  4YWM A;  4X66 L;  3HKS A;  3I56 A;  1YJN A;  1HR0 W;  4AIM A;  4MTN A;  5IWA L;  2AMC B;  1VQC A;  4DV6 Q;  4B3M L;  3J80 i;  1PH1 A;  1HR0 L;  5GRO A;  1WYD A;  2H5X A;  3HKZ E;  5M3M H;  1Q46 A;  4QL5 A;  1N32 L;  2YTV A;  4K0K Q;  1GVP A;  1UE5 A;  2VY3 A;  1KRS A;  3E0E A;  3F8T A;  2PI2 A;  4UP9 A;  3KJP A;  3H15 A;  2ZJR A;  4DV5 L;  3STB D;  4JCV E;  1Q81 C;  1EIY B;  4LNQ A;  4A3G G;  3G48 A;  4A3D G;  1LYL A;  4ME3 A;  4AQY L;  5M3F G;  1L0W A;  3ER0 A;  3I55 A;  1MJC A;  3PO2 H;  4X62 L;  5BR8 L;  2KCT A;  4JI3 L;  2NZO A;  4DPG A;  4H02 A;  2CCZ A;  3H0G G;  2RHS B;  3F1Z A;  4BA1 I;  4IJL A;  2VQF L;  5GAH C;  4NXM Q;  4YY3 L;  3I4M G;  2R6G A;  4A3K H;  1PVO A;  2XGT A;  2KEN A;  4PMW A;  5C4X H;  1N33 Q;  4JYA Q;  4HIM A;  3ULL A;  1IL2 A;  2E5L L;  2BH8 A;  4C3H H;  4PZ6 A;  2E5L Q;  4DK6 C;  4LF7 L;  3PGZ A;  4LF7 Q;  1XNQ L;  1N36 L;  1N36 Q;  4YCU A;  5AJ3 Q;  3J80 c;  1A8V A;  2QA4 A;  3HFZ B;  1N34 L;  2IHE A;  1YBY A;  1N34 Q;  2MQH A;  1BBW A;  3GTL H;  3CXC A;  1W2B A;  4OO1 G;  3CQZ H;  4L5Q A;  2MFI A;  2N78 A;  3KYH C;  4DV3 L;  3TRE A;  1PH8 A;  3TRZ A;  1TWG H;  2UXB L;  1I94 L;  5IP7 G;  2ID0 A;  2MNA A;  4A93 G;  5M5X H;  3JC6 6;  4YWK A;  2UXD Q;  4B3T L;  3S2D H;  4DV1 L;  3L7Z C;  3J81 c;  1V1Q A;  1VQ4 A;  4B3T Q;  1VQN A;  4A3L H;  4YCW A;  3KFU A;  4DKA C;  3RN2 A;  2QEX A;  1VQG A;  2UU9 Q;  3CC2 A;  3A0J A;  4DUZ Q;  3TEH B;  1Y1W G;  1VQA A;  4HJ7 A;  3BZC A;  1OXT A;  4GN3 B;  1YIT A;  1IYJ B;  2B3G A;  4X65 Q;  2YTY A;  4JI2 L;  3GTJ H;  2IX0 A;  2IX1 A;  1J5E Q;  2WB1 G;  4POF A;  1HJP A;  4DR7 L;  1D7Q A;  3HOY H;  4A3I G;  4GN5 A;  1SRO A;  3S1Q H;  4GKJ L;  2OCE A;  4GKJ Q;  1X54 A;  3E9H A;  2JA5 G;  1KRT A;  3S15 H;  2FXQ A;  2K5V A;  1JJG A;  3A5Z B;  4HIK A;  3DLL A;  1KHI A;  3CD6 A;  4BBR H;  1WI5 A;  1VQK A;  4GNX B;  1E1T A;  1L2F A;  3SGI A;  1MJE A;  2JA7 H;  2NVY H;  1IBM L;  2WP8 J;  1FJG L;  5HY6 A;  3HOX H;  2KCM A;  1K8A C;  1CKM A;  4QY7 A;  2WAQ E;  4P74 A;  1FJG Q;  3ULJ A;  1DGS A;  1MIU A;  1SFO H;  4R4T A;  5C3E H;  4PZ8 A;  2F4V Q;  1XMO L;  1TWA H;  2CQO A;  3I2Z A;  2VQE L;  1PH3 A;  2RCN A;  4BY7 H;  4IO9 A;  1Z47 A;  1SLJ A;  1EOV A;  4HJ5 A;  1JMC A;  3BJU A;  1Z9F A;  4GOP B;  1E7Z A;  4DR1 L;  2Z0S A;  1HZA A;  2R7D A;  3NEN A;  3CCL A;  2CFM A;  4EQ5 A;  4DR1 Q;  3CCS A;  1K0R A;  3RNU A;  4DAM A;  4GKK Q;  1Q12 A;  3M4P A;  4A75 A;  1IBK L;  3GTQ H;  2RHQ B;  4POG A;  4A3C H;  4A3M G;  1KC8 C;  2KHJ A;  1XNR L;  2VUM H;  1HZ9 A;  1I50 H;  1FGU A;  3W1B A;  3RR5 A;  1YJ9 A;  1C9O A;  2GVB A;  1VQ5 A;  1A62 A;  2Y0S G;  2N3S A;  1LTL A;  3PUY A;  5IT9 c;  1VQ9 A;  5IYD H;  1VCI A;  1PV4 A;  1QVG A;  3PO3 H;  2IY5 B;  1VS0 A;  4QGU A;  1X3E A;  4OX9 L;  1PH7 A;  2R7F A;  2WFW A;  4B3S Q;  1VQJ A;  3I4N H;  4OX9 Q;  1K83 H;  5LMU L;  1M90 C;  1IBL Q;  5J3B A;  4YWL A;  2R93 H;  1GD7 A;  5LMU Q;  1K73 C;  1RL2 A;  4DAY B;  1YHQ A;  4JBK A;  1N8R C;  4X64 L;  4JI5 L;  1PH2 A;  1X56 A;  1EUJ A;  4JI8 Q;  1JE5 A;  4LF5 Q;  3PV0 A;  1L1O B;  5FJ8 G;  3F2D A;  5C0X J;  1Q8K A;  2DGY A;  4C3I H;  2BA0 A;  5LMN Q;  1NJI C;  2JA8 G;  4A4I A;  1X9N A;  2D0O A;  5ELN A;  5M5W H;  3GO5 A;  1S40 A;  1K9M C;  3UDG A;  4A3B G;  1QUQ B;  3HOW H;  3NEM A;  1E3P A;  2ZJQ A;  1YHB A;  4DV6 L;  4IPC A;  5IYC G;  1V43 A;  1YZ6 A;  3HOV G;  4BBS H;  1GKH A;  4A3G H;  2A8V A;  1N9W A;  4DR6 Q;  3D0F A;  4P71 A;  5K36 G;  1NTG A;  5M3F H;  3FP9 A;  3CC7 A;  2C35 B;  5GAE C;  3EN2 A;  2YU9 H;  4UP8 A;  1EQR A;  4LFA Q;  3S17 H;  3HOZ G;  3S1R H;  1JJC B;  3CCJ A;  2JA6 G;  4WJ3 M;  3H3V H;  1FL0 A;  4GOP C;  4OXP A;  1PYB A;  3CME A;  3PUV A;  1G51 A;  4R4O A;  4DNI A;  4K0K L;  1LM0 A;  4LF4 Q;  1PFS A;  4LFC L;  3J81 i;  1HZC A;  3KJO A;  1WCM G;  2KBN A;  1C7Y A;  1ASY A;  1OXX K;  3KOJ A;  4LFC Q;  2NVX H;  4NXM L;  3BZK A;  1N33 L;  4JYA L;  4KI0 A;  1A0I A;  1W3S A;  4EX5 A;  4X6A H;  4JBM A;  1CUK A;  4O0A A;  3PF4 A;  4TQU S;  1OXS C;  1I5F A;  5IE8 A;  2E8G A;  4LUO A;  1VQB A;  3M9B A;  2WB1 E;  4XIG S;  5AJ3 L;  3K80 C;  4DUY L;  1EIF A;  2UUB L;  4BY1 G;  1A63 A;  4DUY Q;  2UUB Q;  1PHJ A;  4GN4 B;  4KHZ A;  1Y1V G;  2I5L X;  2EXD A;  1YI2 A;  1NE3 A;  3CF5 A;  4OWT B;  3AFQ A;  4A93 H;  2UUC Q;  4TVA B;  3CAM A;  4LFB Q;  4LWC A;  4QJF A;  3CCU A;  4L5T A;  3TQY A;  1I6H H;  2OTJ A;  1EYG A;  1YIJ A;  2K4K A;  1TWH H;  3M85 A;  3TS0 A;  2XTI A;  1Y1W H;  3GDE A;  5C0X G;  2UXD L;  3K0X A;  3UDI A;  1QZG A;  2AKW B;  1EQQ A;  3AYH B;  2NN6 G;  1U5K A;  2JK8 A;  2UU9 L;  1BKB A;  2E2H H;  3GTP H;  4DUZ L;  2JEA I;  1PH6 A;  4DR5 Q;  1XPR A;  4HID A;  1TWF H;  4A3I H;  3PUX A;  4AYB G;  2PI2 E;  3OYY A;  4X65 L;  4DR3 Q;  2VW9 A;  2PNH A;  1VQ8 A;  2JA5 H;  1J5E L;  1T9H A;  1XPO A;  1RIP A;  2JA9 A;  2HT1 A;  4R4C A;  4LF9 Q;  1VQO A;  3OW2 A;  4P73 A;  3GTO H;  3RN5 A;  2Q2I A;  3K7U C;  4R1J A;  3T1H Q;  1E22 A;  1X3F A;  3CCQ A;  3H3V I;  1J6Q A;  3STB C;  3CPW A;  1XTD A;  4Y52 H;  1SRU A;  2CWA A;  4P75 A;  4GNX A;  5FLM G;  1OXV A;  5JJK A;  1KIX A;  2OQ0 A;  2LSS A;  2N49 A;  3S24 A;  1UE7 A;  4JBW A;  1Q86 C;  3RLO A;  1CKO A;  2Y0S E;  1X65 A;  5IYB H;  2YTX A;  1GO3 E;  3E9I A;  2BA1 A;  3U4Z A;  1FVI A;  1NBW A;  4L5R C;  3S1N H;  2F4V L;  2E2J H;  4QQB X;  1X6O A;  3J81 j;  2CKZ B;  3PIO A;  4IOA A;  3CMA A;  1G6P A;  3CW2 C;  3PIP A;  4JG2 A;  4GOP A;  1K8G A;  4A3E H;  4R4I A;  4UP7 A;  1YHA A;  5ELO A;  3HOU H;  2V1C C;  4IPG A;  3I7F A;  3S1M H;  2AHO B;  4DR4 Q;  4LF6 Q;  3CCR A;  4C3J H;  3AQQ A;  2I5H A;  4GKK L;  5JEA G;  1ASZ A;  4YCV A;  3RLF A;  3MXN B;  2HHH Q;  2ASB A;  5C44 H;  3FKI G;  4DV4 Q;  4DK3 C;  3G4S A;  4BXX H;  4PG3 A;  2R7Z G;  2K75 A;  4JI7 L;  2MO0 A;  3PSI A;  4JI7 Q;  4KLK A;  1B7Y B;  3NEL A;  4IPH A;  3EIV A;  4APV A;  1IXR A;  1HNZ L;  1HNZ Q;  3WWV A;  3BU2 A;  4NPS A;  2YYZ A;  4DV7 Q;  2ZM6 Q;  2GN5 A;  4AH6 A;  1PYS B;  4GS3 A;  2Z6K A;  1VQF A;  5C3E G;  5EAY A;  3KLW A;  4B3S L;  1XPU A;  4JI0 L;  3B6Y A;  1IBL L;  4JI0 Q;  3T1Y Q;  2LXK A;  1P16 A;  1U0L A;  1L1O A;  2PQA B;  2JA8 H;  2I0Q A;  4A3B H;  4JI8 L;  4LF5 L;  5LMN W;  1UWV A;  4DV0 Q;  4DV2 Q;  4NXN L;  3F2B A;  1VQL A;  3HOV H;  5IYC H;  4A3F G;  5LMN L;  4NXN Q;  4GNX C;  1QUQ A;  1LUZ A;  3OTO Q;  2VNU D;  4JV5 Q;  1VQD A;  4BA2 I;  3UDX A;  2HIV A;  3HOZ H;  4DR6 L;  4HJ8 A;  2JEB I;  4JI1 Q;  4A3D H;  2A19 A;  2ES2 A;  1GM5 A;  1JJ2 A;  2HQL A;  1PA6 A;  3K81 C;  5GAD C;  4LFA L;  5GAG C;  2A1A A;  2MO1 A;  3ZJY C;  5IP9 G;  2HIX A;  2K5N A;  4YHH L;  1Y14 B;  2UUA Q;  3H0G H;  1KL9 A;  4YHH Q;  3PO3 G;  1WCM H;  2UXC Q;  1VQH A;  2AWN A;  4JBJ A;  3I4M H;  1X55 A;  2CWP A;  1EWI A;  3G6E A;  2Q2T A;  4HIO A;  1WJJ A;  1CKN A;  3I4N G;  4A3J G;  4LF4 L;  4KHP Q;  2R93 G;  3CCM A;  4DR2 Q;  2F3I A;  3EBE A;  4J15 A;  1CKN B;  1HNX Q;  1PH9 A;  4UY8 C;  4JI4 Q;  2NVQ H;  1WOC A;  3U58 A;  2NZH A;  4X66 Q;  2ZTC A;  3L0O A;  1V9P A;  2R92 G;  5IWA Q;  4BY1 H;  3GTM H;  3S2H H;  4IFD I;  3AFP A;  4B3M Q;  3GTK H;  4AYB E;  1Y1V H;  1HR0 Q;  2B63 G;  3CCE A;  4Y7N H;  3LGJ A;  1N32 Q;  5DLQ E;  1R9T H;  3HOW G;  1VQE A;  1X3G A;  3S14 H;  2B29 A;  2VS1 A;  3UE1 A;  3RLN A;  4DV5 Q;  4BBS G;  2D62 A;  1TXY A;  2GVA A;  2IHF A;  4IJH A;  5M3M G;  2UUC L;  4ALP A;  4AQY Q;  5IP7 H;  3VDY A;  1KD1 C;  2Q2U A;  4LFB L;  5HGQ A;  4X62 Q;  2Z6K C;  3NBH B;  5BR8 Q;  2OWO A;  4JI3 Q;  1PH4 A;  1E24 A;  3AEV A;  3M4O H;  1OXU A;  3M3Y H;  3CP0 A;  2VQF Q;  1CSQ A;  5JEA J;  4GLA C;  3FHW A;  4RMF A;  4YY3 Q;  1L1O C;  3ICE A;  3PO2 G;  1Q7Y C;  2JE6 I;  1Q1E A;  2EQS A;  5C4J H;  3TS2 A;  4IPD A;  3A74 A;  4JI6 L;  2ZTD A;  2JQO A;  4DR5 L;  2I5M X;  2VL6 A;  4JI6 Q;  1XNQ Q;  4A3K G;  4MZ9 A;  4L5S A;  5C4X G;  1E1O A;  2PMZ E;  1HNW L;  1CSP A;  1BBU A;  4DR3 L;  1HNW Q;  3PF5 A;  2VZA A;  3HKZ G;  4P72 A;  1KAW A;  2KHI A;  1VQM A;  3GTG H;  2NVT H;  1YEZ A;  1B8A A;  4LF9 L;  4LUZ A;  5M5Y H;  5FLM H;  1EFW A;  2ALY B;  4OWW B;  1WFQ A;  3T1H L;  2DUD A;  4DV3 Q;  1M1K C;  3J7A 5;  3MEF A;  2K5H A;  4PZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...