2Q8RE

Structural and functional characterization of cc chemokine ccl14
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords CCL14
publication title Structural and Functional Characterization of CC Chemokine CCL14
pubmed doi rcsb
total genus 14
structure length 66
sequence length 66
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2007-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2q8rE00
1S4ZA 2KECA 2FJ2A 2L1BA 1J8IA 2DY7A 2KVMA 4ZKCB 1DOKA 1U4PA 1JE4A 1MSHA 2JYOA 1WTWA 4ZAIA 4ZK9B 3KUPA 1WD1A 3TN2A 2L12A 2B2YA 1PDQA 1NR2A 2MPMA 3DEPA 2XIWA 1EIHA 3G7LA 4RA8A 1RJTA 3I91A 1EQTA 1B3AA 1O7ZA 5AFWA 1MGSA 4MN3A 1DZ1A 3R93A 4ZLTF 1NCVA 5EJWA 5EPJA 1BNZA 1EIGA 2FHTA 4CJ1B 1CA6A 4XDXA 1G6ZA 1DONA 2B2TC 1PFNA 2X6GA 3Q6SA 2NYZD 1O7YA 1DOLA 3F2UA 2EE1A 4X3SA 1JICA 3IFDA 1M8AA 2FFKB 1G2TA 2MGSA 1BO0A 2KEDA 1RODA 4HCSA 3D6WA 2NWGA 3DEOA 1MSGA 1PLFA 4IUQA 1B4OA 5DNFA 5E4XA 1IKMA 2FMMA 1F9PA 2K01A 1WTRA 2K28A 1X32A 2X6LA 1XYIA 2K04A 5EKIA 2Q8TA 4X3TA 1NAPA 1GUWA 2MJ8A 4OIJA 1HHVA 2HDMA 1IL8A 1QNKA 2L4NA 4MHEA 1G2SA 2B2WC 1HUNA 1U4MA 1X3QA 3SVMA 1G91A 2FINB 1AP0A 2B2UA 4X3KA 1WD0A 2NZ1D 1NR4A 5EPKA 2DY8A 2Q8RE 5JJZA 1F9QA 1ESRA 3ONAB 2B2WA 1WTOA 1HFNA 3N52A 1PFMA 4HAEA 1WTVA 3GV6A 2RVLA 3P7JA 3FPUB 5CORA 1ML0D 2VXWA 4R8IA 1RTNA 2KEEA 4HEDA 1XX8A 1WTQA 4O42A 1KNAA 3H91A 3KBXA 4XT1B 4NW2A 1HRJA 3MWYW 4LMQD 1B53A 1IKLA 1PFBA 3I8ZA 1X3PA 1EL0A 2B2TA 2BDNA 2K1BA 3I3CA 4QUCA 2L9HA 2K05A 1QG7A 5COYA 1TVXA 2JP1A 2MP1A 2B2VC 1ILPA 1HA6A 4CJ0B 4QUFA 5EQ0A 2D9UA 3LWEA 2N88A 1WTPA 1F9RA 1HUMA 2K03A 4R9WA 1BBXC 1WTXA 4XT3B 4RWSC 1CA5A 2CVRA 2IL8A 3I90A 1C8CA 1SAPA 1J9OA 2SDFA 5CBEE 2RA4A 1U4LA 3IL8A 4CJ2C 3HP3A 4IUTA 4IUVA 1AZPA 1HFGA 2B2VA 1B50A 4DN4M 3DM1A 1RHPA 2EPBA 1SSOA 1BF4A 3TZDA 2B2YC 1B2TA 5D65A 4IUUA 1U4RA 1A15A 1ILQA 2R3ZA 2J7ZA 3GV3A 1WVLA 3UI2A 1E0BA 5D14A 5CMDA 1CM9A 1EOTA 1AZQA 1Q3LA 2H1EA 3MTSA 2KOLA 5T1GA 4X3UA 3QO2A 1MI2A 2HUGA 5T1IA 2RSOA 1VMCA 2HCCA 4ZKBB 4IUPA 2HDLA 1O80A 2M2LA 4IURA 4HSVA 5CBAE 2N55A 5E4WC 4U68A 4OIKA 2HCIA 1KNEA 2RSNA 5EPLA 2KUMA 4UAIA 1F9SA 1VMPA 1QE6A 1F2LA 2L11A 4RAUC 2EOTA 1ICWA 1ZXTA 2X69A 1DOMA 1SDFA 3FDTA 1RTOA 2B2UC 1LV9A
chains in the Genus database with same CATH superfamily
2QDBA 4ZRZA 2EYOA 2WAQG 3NTKA 1H9SB 2EY1A 5C0XH 5IT9E 1K8OA 4IFDG 3NWSA 3CW2C 1KL9A 4NKLA 4POGA 2K5WA 2XIWA 4MNOA 3HOXH 1B3AA 5JVG3 4DR1Q 3PO2H 4RGTA 1DZ1A 1II3A 4A3BG 5EJWA 1BNZA 3OW2A 1QNUA 1PFNA 1YBYA 5I9OA 4A3JH 1STNA 1M8AA 1KLUD 2MGSA 1SROA 5GROA 4OL7A 5E4XA 4A3MG 4IPCA 3HOVG 3GTQB 2JJQA 4A75A 1EU4A 4K8IA 3A8IE 2Q8TA 4KY7A 4QIWB 4UP9A 1L2FA 1PA6A 1Q82C 4NXMQ 2HD3A 3JAMi 3CC4A 1VS0A 1RF2D 2LFNA 4A3KH 3CCSA 1HQMC 5TSSA 3CCMA 4CDEC 3RN5A 3PUWA 1HXYD 4KY6A 4JYAQ 3RR5A 3TP5A 4KHPL 3BYTB 3I3CA 4DA2A 1TVXA 4PZ7A 4IFDJ 1WCMG 3LWEA 1X3EA 4RWSC 3SK4A 1WFQA 2K5DA 2F3IA 3L9AX 4Q0FA 1OXVA 4DN4M 3DM1A 4N9TA 1SNCA 2XGTA 5HURA 3VYTA 5D65A 3FKIH 2R3ZA 2AUJD 4JI1Q 2EYMA 1IZ6A 3U50C 4CDCC 3PUVA 1Q12A 5BN3A 1NMFA 1Q90A 2CWAA 4L63B 1LO5D 4MIUA 3NQIA 2KA7A 4G7HC 2M2LA 3BVZA 3BYYB 2UXBQ 1Y1WG 4GZYC 1KNEA 2XRSD 3CRKC 3EFXD 2NN6G 2ZJRA 1LTGD 3BDOA 4WFN3 2UXDQ 2EOTA 2LXJA 3FDTA 1JWSD 3H0GH 3TMEA 1I4QA 3GD7A 4ZKCB 1IBML 1MSHA 2JYOA 1EQQA 3M3YB 3U4VA 4X65Q 1PDQA 1C0AA 4DV1Q 1SE4A 1VQ8A 4LF6Q 1ASYA 4K0KQ 4RGNA 4LFCQ 3G6JB 4JI4Q 3EVQA 3OIPA 1HR0Q 2B2TC 4KY5A 3Q6SA 1UEAB 1Y8NB 4AIMA 2AHOB 2RCNA 3J81c 4B3SL 4JBJA 1CK1A 4TKOB 5I4DA 2JA9A 4LF4Q 2K28A 2F3WA 1V43A 5JEAG 3PCOB 2F1MA 3CCJA 1X3QA 3V05A 3MFGA 2F0MA 3UDXA 1VQMA 1FJGL 1GJXA 2NZ1D 5C3XA 3CC7A 1NR4A 1X56A 2WB1B 3GTQH 1VQCA 3U9OA 5IP9G 5ELEA 2LS01 5CV4A 1SEBD 2ENBA 2F0LA 3FPUB 4CHTB 4JI7Q 2NVQB 3NBHA 4DR3L 2K6AA 3RLNA 1W2BA 2JA5B 5IODA 3RUZA 1I50B 3E0JA 1SLJA 3ERSX 1N33L 1CHQD 1X3PA 2Z6KA 1SRUA 1EFWA 3Q24A 4C3HH 2NVTB 4KJOA 2DGYA 5J3BA 1EWIA 2F0FA 5IYCH 3FPPA 3CHBD 2ZM6Q 2MP1A 4K8JA 2CW0C 2DNEA 1JWUD 1SJED 4M8AA 2I5MX 5M3MH 1C8CA 1IBKL 1N36L 1STEA 1VQEA 1T9HA 3K0YA 3NWTA 3K5MA 1GHKA 2R61A 2E8GA 5DM73 4ME5A 3GTJH 1SSOA 3CXCA 2PPBC 3C1EA 2F0WA 4N8FA 4NMZA 2SNMA 2VUMH 4DUZL 4XYOA 1Y8PB 3SGIA 4JI0L 2KOLA 3EBEA 2IX1A 5JEAJ 3TRZA 4AYBG 3CP0A 1P16A 3J80i 2RSOA 2UUBL 1PH9A 3E0EA 1VMCA 1LLRD 1O80A 2VY3A 4FO2A 4E6IA 2Z9HA 1BCPF 2QILA 3KYHC 2L11A 3NUCA 3SE0A 1DOMA 1TU2B 2F0JA 2F0IA 5C3WA 3D0FA 1ZYRD 1SYDA 3RLOA 1GKHA 2A69D 2L9HA 5BN4A 3H94A 1Q8IA 2KVMA 5D3DA 1DOKA 1U4PA 3SK6A 5JPMC 3VYRA 5LMUL 2R7ZG 1QUQA 4PZ6A 3CRLC 2A19A 1VQ4A 4DAYA 3I7FA 1EQTA 4BWGB 2H5XA 1O7ZA 1CT1D 3QOLA 5LL6X 4LF7Q 2PCFB 2JA7G 2NYZD 4PMCA 1F2YA 1F77A 1DOLA 2EE1A 1KQSA 1EQVA 3D4WA 2VL6A 1A3TA 2K01A 2X6LA 1XYIA 4CKBA 4YWKA 2MJ8A 4OIJA 1KHIA 3SVMA 3IFTA 1GO3E 3CC2A 1DJRD 2RF4A 4LF8Q 2OQKA 4YIJA 2Q8RE 2A6EC 2E2JH 4A3LG 4OWXB 3OMGA 3DWQA 3DLLA 2OF1A 4X62L 2UXCQ 3TREA 2Z6KC 3D4DA 2KQ3A 5IP7H 3W2DA 3I70A 4JI5Q 2R93B 4EQNA 3MAQA 1YHBA 2LMCB 4F88A 4JI3Q 1YNJD 2ZTCA 4EGVA 3PIOA 1FGUA 5FLMH 1RDPD 3FMCA 4L5QA 2NVQH 3K58A 1R4QB 1PZID 2EYFA 1JOKA 4QUFA 2XN9C 1CKNA 4R9WA 1EY8A 4XT3B 1ASZA 3BG3A 2CVRA 4XIGS 2IT1A 3NENA 3M4OB 1U4LA 5ISRA 3G4SA 3F8TA 1B50A 2Q8IB 4DR7Q 1K8MA 4HR7B 3I4MG 4B3ML 1I6VC 1DGSA 4OONA 3GV3A 2VQFL 1VQGA 1AZQA 5IGCA 3BDCA 4KI0A 4OELB 4A3GG 2NTTA 1YHQA 2MFIA 4J8QA 2XSCA 3NP8A 1MI2A 3HKZE 5GAEC 3HOZG 3S1RB 1LTSD 2A73B 1XXGA 5FO7B 3MXGA 5E4WC 1V1QA 2K4KA 3ULLA 4QY7A 1AH9A 4OO1G 2JA6G 4HJ5A 1LV9A 1S4ZA 1TWCB 4C3JB 1M1KC 1M4VA 1X55A 4ZUJA 1B70B 2E5LL 4LFBQ 1WTWA 3KDFA 2A68C 2D2CC 1LACA 4FXKC 1GD7A 4LW1A 4RH6A 1NR2A 1K28A 3LX0A 3HOUH 2C5CA 3AB9A 3J81E 4A3DG 1HZAA 4XTCS 1PVOA 1HQRD 1PH8A 2F4IA 3R3OA 4DV3L 1EY0A 1XWEA 1D5XC 3F2UA 2JN4A 1JICA 3A56A 2FFKB 3T4AC 4DV4Q 1XNRL 1B4OA 2HHHL 2L0CA 1A3VA 5IWAL 2J0TD 3PUXA 3VR5A 4Y52H 2RQXA 3L7ZC 4HJ9A 1CZGA 2FINB 2HQEA 1B3QA 1Y8OB 2B2UA 2EXDA 3JAMc 1KAAA 1BQQT 5M3FH 1SBBB 3RNUA 1AE2A 2QEJC 2WKCA 3N52A 4HAEA 4DR6L 2IY5B 1JB3A 4DAMA 2E2IB 1OXTA 5KIXA 2OCEA 3HGBA 1XMOQ 3EA6A 5AJ3Q 1SFOB 1X65A 3H3VI 5G3LD 2CWPA 2R93H 1SYBA 1HA6A 1SNDA 4HIOA 2K03A 1STYA 4YHHQ 4C3JG 4YY3L 1J9OA 4WJ4A 3NK9A 3PQIA 2GVBA 1H9SA 4DV0L 4LWCA 5BR8Q 5F2DA 2VQEL 4X66Q 2J7ZA 2WINB 2OTJA 3OTOL 3M4OH 1ESFA 3BU2A 1C48A 2BA0A 4X6AH 4RHRA 3VA7A 5FLXc 4C2MB 4NXNL 4HIMA 4JV5L 2JSOA 2CFMA 2HUGA 2HCCA 2QA4A 1KDAA 3MFYA 4S3SA 4IURA 2Z1CA 2R92G 3KLRA 1TWFB 3I4LA 3DMUA 1WOCA 1ICWA 4BY7G 1UUPA 3NHHA 3M85A 1RTOA 1K8AC 2QEXA 3CCUA 1P8LA 1STGA 4R4CA 4ZK9B 2RHQB 3DEPA 2B2YA 2UUCQ 1FVIA 1TWGH 3G7LA 4RA8A 2UUAL 1I6HB 2PMZB 4DR5Q 1VQ9A 2RCFA 1TWCH 4A93G 1EYAA 2A1AA 2B63H 1XNQL 2KHIA 3W5OA 3LGJA 4KK7A 1SYFA 1S5DD 4J1MA 1EY4A 5EGTA 4AQYQ 1TKWB 4DNIA 3A8JE 5EAYA 1EUJA 3Q0AA 1O7LA 1KIXA 1L0XB 5M9OA 5EKIA 4GKJL 2QCPX 5C4ZA 1Q1BA 1B44D 5GQOA 1MBYA 5C3EG 4FYDA 1U9RA 3M4QA 4GNXC 4A3IB 1EU3A 2CW0D 3KJPA 1ESRA 2PZWA 1BKBA 1GUOA 2RVLA 3OSOA 2VXWA 3OYYA 3BJUA 4AH6A 4O2DA 1WTQA 3TS0A 1ZYRC 1PH6A 1NSNS 3OW7A 4DGZA 4IZ8A 1STHA 4OHJA 2EIFA 3LWUA 4H0LC 1N34L 2OEOA 2NUCA 1XPRA 3CMEA 2ZTDA 4L5RC 3GTPH 2JA8B 2F0UA 2QF7A 3KF8B 1PRTB 2G9HD 1VQJA 5EQ0A 1RKNA 2E2IH 1HZ9A 5IYDG 1WTXA 1U5KA 1X3GA 2K5VA 1SAPA 4JOIC 1EEID 1H95A 4JW0A 2WAQB 4P71A 1SFOH 4GKKL 3GTMH 1RHPA 3CU7A 3ITPA 3SK8A 1Q7YC 3J80L 4IUUA 1W3SA 3PIPA 4ABNA 4A3BB 4JVZA 4LUOA 2IJ0A 1LTRD 5A2QE 3HKSA 1EY6A 4K14A 3A5ZB 5M5XB 4N8X1 1HJPA 2Q2IA 4IUPA 3WWVA 3X3MA 3VR2A 1I94L 1IYUA 4A3MB 1PTOB 3HOVB 2AKWB 2LKVA 2IPKD 4LNQA 4C2MH 1E3PA 1GUSA 5CR3A 2K7VA 1HCZA 4DR2L 1DXMA 4DV2Q 1XMQQ 2VNUD 1LUZA 3KUPA 1V8QA 1WYDA 4GNXB 1IL2A 1YITA 3T13A 2ZT9C 2NVXB 5CGKA 4FF2A 4BXXH 3EIVA 3CD6A 2A6ED 3FRPB 2EJFC 1LTBD 1I6HH 1WCMB 4DV5L 3DUZA 1WTRA 1TR5A 4BBRG 1IBLL 1QNKA 2L4NA 3TSSA 4RHSA 3IAYA 5KNBA 4A3CH 3URYA 2UXDL 1QB5D 2CCZA 4M1UB 5DLQE 3HOWG 1F9QA 1S3OA 1PFMA 3GV6A 3TEHB 2I5HA 2L15A 4A3IH 4HSPA 1JE5A 4L8JA 2D62A 4HIDA 1EL0A 3T56B 2B2TA 1TWAB 3GDEA 2BDNA 1F2MA 1Y1WB 1Z6HA 1EIFA 5IGDA 4DK0A 3FHWA 1J5EQ 4DUYL 3PUYA 1BBXC 5CYUA 1CA5A 3I90A 4X64L 4IO9A 4RMFA 3G48A 4CJ2C 5KGUA 3KFUA 2N3SA 2I5LX 2B2VA 3S16B 1VQOA 2F4VL 4V0BA 2JA8H 1LM0A 2YTVA 5FLXE 3UDGA 1L0YB 1C9OA 2F3VA 5CMDA 3STBC 2GN5A 3QIAA 1BOSA 1VQDA 4APVA 3QB3A 1KABA 1TY0A 2EY5A 3P1HA 2L5TA 3BVGA 3DWAA 2JXMB 2A68D 4K6DA 4KLKA 2ICIA 4TSSA 4X3UA 4K5VA 4IFDH 4FXDA 1C7YA 3R8BA 3M7NA 1A2UA 1I3QB 2RKSA 2N55A 3K6OA 3T53B 3G6EA 1HA5A 4A3BH 2RDFA 1B9NA 1SNOA 4C1NI 4ALPA 1KRTA 4RAUC 5M5XH 4A4IA 2NZOA 3VR3A 3V2TA 3HOVH 2SEBD 5C4JB 1CSPA 5H1SE 3I91A 5I2YA 1IYJB 5AFWA 3PSIA 2K5HA 4MN3A 1TQOA 5HGQA 3T1YQ 2EZVA 5CV6A 1SR3A 1KD1C 2WIIB 1K9MC 2NVYH 3DEOA 1VQPA 2NVXH 1ENFA 4QIWE 2FMMA 1KLGD 4RGMA 1K0SA 5K5PA 1K83H 4QQBX 3S24A 1HHVA 1CKOA 5C4XG 3D31A 3K7AB 4JCVE 4KJNA 4P73A 3PV0A 3AFQA 3MVVA 1GUNA 3S14B 1WCMH 1SN8A 2LSSA 4BY1G 3NSWA 4C3IG 1JR0D 4HIKA 3ONAB 2B2WA 5EKKA 1WTOA 1HNZL 4OEMB 5CORA 3F2CA 1D6EC 1TS2A 3D4RA 1CSQA 5ELNA 4NW2A 4AYBB 1AEXA 1B53A 4G4KA 1D8LA 4C1NK 4C3HG 5HY6A 1PFBA 3LNNA 4BBSG 1GUGA 4O0AA 3J7A5 1JWMD 2K75A 2O2LD 5JAVA 3S1QB 3S2HB 1BVSA 4DAVA 4HCEA 4DV6L 4YCUA 2B2VC 5FO9B 1YI2A 5M3MG 3ULJA 3K81C 4KHZA 1FYCA 3HS0C 4PG3A 2ZXRA 1EWCA 3PIO3 1Y1WH 1OXUA 4I65A 1LTLA 2EPBA 2R7ZB 2NN6H 2ZJQA 3ZYYX 2IX3A 3AQQA 2F0QA 1ET6A 4LJZC 1BR9A 2JA7B 4A76A 3TP6A 4PV1C 2H1EA 3S16H 2YYZA 1ZKOA 2PQEA 1A3UA 3PO3G 1GHJA 5K36G 3K5LA 4KHPQ 1Z47A 1DYQA 2KENA 1STAA 2HCIA 3N6RA 5G3LF 4DNRB 4JI6L 5DM63 1HNWL 1SDFA 2Q2TA 1HNXL 3IFDA 4YCWA 1J8IA 1I3QH 1SE8A 2MNAA 1GVPA 2EDGA 1JE4A 5JEAH 3SHLA 3X3NA 4UPAA 5C5LA 5LMNW 1AN8A 4K2LA 3GTOB 3ZJYC 4DKAC 4DK6C 1D1KA 4LF5L 1EIGA 1G6ZA 1CHPD 5IP9H 2CH4W 1VQNA 3GTLB 5C0XI 1I4RA 1E2VA 4LUVA 1BO0A 1CFMA 2KEDA 5C6AA 2XVSA 4DXGA 5IYBG 1EYCA 3R2IA 5CV9A 2YTXA 2B2WC 3TQYA 1MJCA 5CV7A 2WB1E 1IBMQ 3I4MB 1WJJA 2DY8A 4GS3A 1ET9A 1SE2A 3M7GA 1MKHA 2BE5C 1XTDA 2OTLA 3K7AH 4A3GB 3M3YH 4LMQD 2PI2A 4QMGA 2UU9L 3HOZB 1HH2P 1MD2D 4MZ9A 3R2TA 4IOAA 2E76C 3OHXC 4DV7L 4A3EG 1J6QA 4MTKA 4R4TA 2JA6B 3K59A 2IL8A 2SDFA 4GLXA 4DPGA 2B29A 3MA2B 3S2HH 3KLWA 1FJGQ 2MO0A 1AW7A 3ERQA 4IFDI 4POFA 4EVOA 5CC4A 4RG1A 1YNXA 2M9VA 1VQ7A 4A3DB 2D5DA 5ELFA 4DR3Q 1KDBA 2R7ZH 1UAPA 3I55A 3A5UA 2D0PA 3S15B 4H44C 1N33Q 1ENCA 5JPNC 2JA5H 1SYGA 4GN5A 3S1NB 2HDLA 1I50H 1B7YB 1PMRA 1YNNC 4OGQC 3F2BA 5L37A 4KKSA 2NVTH 4OXPA 2F0OA 1F9SA 4CDFC 2AUKA 5IIFA 4P74A 1IBKQ 1N36Q 4KN7C 2O4XA 3M4PA 4JBWA 2EJMA 2SNSA 3JC66 3TN2A 3OMCA 2BH8A 1SJHD 3HOUG 4WRDA 1RJTA 5M5WB 4DUZQ 2Z8LA 4ZLTF 4NDXA 4JI0Q 5EPJA 2C35B 2BH2A 5IGGA 4CJ1B 5C44G 4A3LH 1X9NA 4B3TL 2UUBQ 2Z6BA 2B8FA 3DWPA 4JI8L 3KF8A 3I2ZA 2NWGA 4PZ8A 1PYBA 5A2QL 3GTOH 1QVCA 1MSGA 3HKZG 5KEEA 5E7NA 2G9DA 1QWYA 3CMAA 1N32L 2EVBA 2JK8A 3GTLH 1IL8A 1ENAA 5FO8B 2PO4A 1S40A 1CTMA 4H02A 4RKLA 1FNVA 1H9RA 2AWOA 5LMUQ 3W1BA 2F0EA 1WTVA 1VF5C 3CQZB 2XTIA 4R8IA 4FXGC 4HEDA 3K8AA 1KNAA 3MXNB 4XT1B 1HRJA 2R7DA 5LMNL 3I4MH 4GOPC 2A5HA 2LY7A 3STBD 3A74A 5CV8A 2R92B 4A3GH 3J7ZC 5HGTA 4CJ0B 4BY7B 1D2BA 1SNMA 3HOZH 3GTKB 2Y0SE 2MQHA 2VB2X 3CCQA 1GXDC 5J22A 4U673 3DM3A 4GNXA 3HOYG 2B8GA 2PW5A 4JI2L 5ELDA 4LF9L 2JA6H 4OO1H 4K6LA 1WVLA 4X62Q 2PQAB 4P2CB 5FJ8G 4JBMA 3UI2A 5IT9L 4A93B 4IPDA 4FNFA 1A2TA 4LK1C 1Q81C 3L2PA 3MTSA 5GAHC 3K57A 3QO2A 1YJ9A 1NNXA 3NELA 4A3DH 2F0TA 4HMJA 4U68A 3PIP3 3I4NB 4N9PA 1JT8A 1VMPA 3J81i 1QE6A 1BUVT 2OXPA 3S15H 1G6PA 1EY7A 5C3EB 4JOIA 4NPSA 4XQQA 1IHZA 3FP9A 1VQHA 2EYLA 1OXSC 3TP7A 3A55A 1Y1VG 2C9OA 4ZAIA 3CPWA 1WD1A 2VS1A 2YU9B 1E22A 4LFAL 4B3MQ 2VQFQ 2A8VA 1Q8KA 5EBDA 2F0NA 2B63G 1PRTC 2DJFC 4OX9L 4TRDA 1W6JA 3E5SA 4X3SA 2HIVA 1H9JA 4A3FG 3RD4A 1BBWA 2FXQA 2F0HA 5M5WH 4GOPB 1VF7A 1PLFA 2MUYA 5DNFA 1TS3A 2H4OA 3S1RH 1E7ZA 1F9PA 1YJWA 1LTID 2HDMA 1EEFD 1V9PA 4B3RL 1G2SA 2LXKA 1EOVA 2E5LQ 4IN3A 3A0JA 4HTHA 4C3JH 1QVGA 4K5XA 2PNHA 3P7JA 1ML0D 1PTOC 1NY4A 2NZHA 4FF3A 5GADC 1S5FD 3MHBA 3MWYW 1EYGA 1TY2A 1B1ZA 3KOJA 1IKLA 5M5YB 4DV3Q 1PHJA 3I4NG 4DR4L 3GTGB 5JJKA 3CQZH 3T1HL 2DN8A 2KCMA 1X3FA 1DD2A 1VQ5A 1XNRQ 1MJEA 2K33A 2D9UA 3HEJA 1H9KA 2HHHQ 1EZ6A 5IWAQ 3KJOA 4B08A 5CBEE 2ATWA 4FF1A 2WFWA 4LUZA 1EYDA 3EROA 3AU7A 4EQPA 3NTHA 4K5WA 1D5ZC 2R92H 1PH3A 1B2TA 4QCLA 4KKUA 1HZBA 1ILQA 4BY7H 3P20A 1Q86C 4DR1L 3GTKH 4DR6Q 2RDGA 1JOQA 2PI2E 1EY9A 1NMGA 3KLSA 1BXTA 1QILA 3SR1A 1VQIA 1X54A 2ICEC 4UY8C 4BS9A 3U9SA 2RSNA 3CAMA 5EPLA 4BBRB 4FF4A 2BOSA 1N9WA 1G291 1RIPA 2AQ1B 4YY3Q 3MEHA 3C46A 1GM5A 4FVMA 2AMCB 5I2XA 2L1BA 3I4OA 3AFPA 5EBCA 4DV0Q 4NXML 3IKJA 1T5XD 3PMFA 3HOWB 3AEVA 3E9HA 2PMZE 3KBGA 1QJOA 2MPMA 2VQEQ 1A62A 3J80c 3OTOQ 5C3EH 1YZ6A 1TT2A 1PH1A 4L5TA 2IW3A 4OWTB 1RL2A 1L1OB 3V96A 3S1MB 4JV5Q 4NXNQ 3W1GA 4JYAL 1TXYA 2X6GA 4G7ZC 2YU9H 1JQYD 2V4DA 2OT2A 1V1PB 1RODA 2BE5D 3D6WA 4GN3B 2RDHA 4MTNA 2DUDA 4IUQA 1CI3M 3KLSX 5C0XG 1O78A 3VYSA 1PTOF 2E75C 3Q23A 4QJFA 1TWFH 3OIQA 3HOXG 3PO2G 1Q46A 5IYDH 1VQAA 1GOZA 1QZGA 3TP8A 4JI1L 5ELOA 4B9WA 4JC0A 2UUAQ 4A3JG 2TMPA 1XNQQ 2XNAC 5DAUA 2Q2UA 2ZXPA 4ME3A 2K05A 2IWHA 1JORA 1IW7C 3JAME 3H3VC 2UXBL 2JP1A 3GQBA 3WOEA 1R9TB 2N88A 2Z4IA 2WAQE 2K32A 5KYLA 3GO5A 5M5YH 2RA4A 2RHSB 4GKJQ 4H7BA 4A3KG 1YNND 2IHFA 3GTGH 4QL5A 2KBNA 3NXWA 4CKCA 2DJGC 4X65L 4DV1L 3IRBA 4K0KL 4LF6L 3QG1A 4GN4B 3J81j 1CUKA 1C4QA 1SMYC 3A7LA 4JG2A 4LFCL 2WV6D 3BS1A 4JI4L 2PZTA 5C0XJ 1HR0L 3UDIA 3ER0A 1L0WA 2N8NA 3BVMA 1OXXK 1N34Q 2F0VA 2NB0A 2HQLA 4OIKA 2OQ0A 4LF4L 5DEHA 4EX5A 2KUMA 5C4XB 3FKIG 5FOBB 3NE5B 2R7FA 1S72A 2KECA 3MC0B 4GKKQ 5KNCA 1S5ED 4BY1B 1SNQA 4C3IB 1PXUA 4XQNA 1FD7D 2QDLA 3DHQA 4BBRH 4JI7L 4IJHA 5J39A 2ALYB 5I6YA 2KCCA 1TS5A 3G71A 5IGBA 3K5NA 4C3HB 5JVH3 4BBSB 1ONLA 2FHTA 1UEBA 4F8MA 2YV5A 3HOWH 3NTIA 1KRSA 1O7YA 4IJLA 4KN4C 3KF6B 3VDYA 1G2TA 2R6GA 3MXPA 4QF4A 3SEBA 1Y14B 2GA4B 3H0GG 5M3MB 2ZM6L 1I94Q 4YCVA 3PF5A 2QKIC 3S1MH 2MO1A 4J15A 4A3MH 1PTOH 3H15A 3GTJB 2E2HB 1A6XA 1QVFA 4MHEA 1U4MA 4DR2Q 1G91A 2E74C 1WD0A 3P75A 5C5MA 2VUMB 3EQLC 2M00A 3D8GA 1KXLA 4IUNA 5JJZA 3NPPA 4V190 2F52A 1NBWA 1PH2A 3A7AB 3TBIB 1RTNA 4O42A 3C3LA 3H91A 3KBXA 3PO3B 5KRUA 4FDBA 1DCZA 3I8ZA 4JBKA 5LL6S 2QGQA 2WACA 3M9BA 4QB4A 1VDZA 4UDUC 5COYA 2DNCA 2YTYA 1STBA 4G57A 2EYHA 4DV5Q 2P5ZX 3BZCA 3IL8A 2ID0A 3HP3A 1IBLQ 1FNWA 2BDOA 3VYUA 1HZCA 1LTAD 1BF4A 1Z7TA 4ID6A 1R9TH 4PMWA 2Q2HA 5FK9C 3RZOB 4WJ3M 2IX0A 1BDOA 3W3AA 1YVCA 1BCPC 4LF7L 5IYCG 1B9MA 2O5JC 1OO9B 5CV5A 4B9XA 1CQVA 3J81L 2K5QA 4ZUIA 2XWJB 2N78A 4RGOS 1EFID 4GLVB 1VQFA 1K0RA 3K0XA 3RZDB 2V1CC 2VZAA 2EYJA 1PRTD 4Y7NB 1TWAH 2PW7A 3VR6A 4HN7A 4DUYQ 1D1IA 4ULLA 2CQOA 4X64Q 1PH4A 3ND8A 2QW7A 4HMIA 2VUMG 2E2JB 3J80E 1VQLA 1IXRA 2L55A 1F2ZA 1MIUA 4LF8L 1JJ2A 2F4VQ 1XPOA 2JE6I 3H09A 2CHBD 2UXCL 5C4XH 1IYVA 3VA5A 3MXNA 4JI5L 2ZTEA 4KD4A 1E1OA 1E24A 4FP5D 4JI3L 4BY1H 1B8AA 4C3IH 5IGFA 4UP7A 1EIYB 3F2DA 1TIID 4DXFA 1TWHB 1PTOD 4DNTB 4HCSA 4A3EB 4IQZA 1K3RA 4BBSH 1UNSA 3RMHA 4X3TA 1GUWA 2VW9A 3Q8DA 1FR3A 3SXHA 4X3KA 2SOBA 4QGUA 3CCEA 2OWOA 3CKIB 4DR7L 1PH7A 2PQAA 4F87A 4CDDC 2F03A 4R1JA 1HTLD 3H3VH 3MEFA 1HFNA 4NP5A 5KNDA 4KV6A 4AYBE 4Q5VA 2E2HH 5C4JH 2KEEA 2A6HC 1SE3A 1BCPB 1KDCA 3HZXA 1SNPA 3UE1A 5C4HA 1FL0A 1K8GA 1SYEA 4DF7A 1HUMA 2K52A 3HRZC 3PO3H 3AMUA 5K36H 5IP7G 3S17B 1HFGA 1NE3A 4LFBL 3K5OA 3HOUB 2F0GA 1PYSB 3SK5A 4UP8A 2AQ3B 1HNZQ 2WB1G 1FGBD 1QOHA 3S14H 4IPHA 5FLMG 3CPFA 3D3RA 5C44B 5BN5A 1S5BD 5T1GA 2JA5G 4B3SQ 3J7AV 4R4IA 4GOPA 3RZOH 4DV4L 4KHVA 4IALA 3HKZB 1JC7A 3H6MA 5D3IB 4DV6Q 3PUZA 2BA1A 4UAIA 4R4QA 5IOCA 3S1QH 4J6HA 1ZXTA 3OWEB 2CQAA 5I6WA 3EJIA 1JCKB 5M3FB 3CCRA 3ICEA 3RZDH 5I9PA 5IYBH 4LAAA 1VQKA 4Y7NH 4UHVA 4P75A 2L12A 4DU9A 4HJ8A 3C2PA 3R93A 5ELCA 3D6CA 4XDXA 4DK3C 2JA7H 1DONA 1XMOL 4RCOA 1GUTA 3WDNA 3C1FA 2ASBA 5AJ3L 2J4XA 1T5EA 3QOJA 1X6OA 5KYIA 4I7AA 1H9MA 2XRQD 4WJWA 1YJNA 1IKMA 4YHHL 3BZDB 2K04A 4JI6Q 2GVAA 2NTSA 1HNWQ 1VQBA 3E9IA 4L6TB 2JQOA 1HNXQ 2ZXOA 1IW7D 3HOYB 2KHSA 1TWHH 4A3EH 3RN2A 5BR8L 1D7QA 4X66L 5EPKA 1TS4A 2Z4HA 2VB3X 2Y0SB 2EXZA 4ILWA 3NEMA 1PZKD 1XX8A 4RCNA 2KCTA 1CKMA 2F0PA 4LF5Q 1CQFA 2CH4A 3CCLA 3I56A 2XWBB 1SMYD 1E2ZA 3A8KE 4ZYSA 2D0OA 3Q22A 2KJXA 4C56C 1F9RA 1NTGA 1HTPA 5M3FG 1NJIC 4RKBA 4R8NA 4IUTA 5GAGC 1AZPA 1Y1VB 1TWGB 3BZKA 3TZDA 4P72A 4PMBA 1U4RA 2UUCL 1V1OA 1OTCA 1SYCA 4CGYB 3HG9A 4DR5L 5E1FA 2B63B 1L1OA 1E0BA 1CM9A 3S17H 2R93G 1O7IA 3NBHB 1RCVD 1AFPA 1V1PA 4A3FB 1W6KA 2UU9Q 2NN6I 1N8RC 4AQYL 2HIXA 5CBAE 4HSVA 3QJYA 1A63A 4O1NA 4DV7Q 4KD3A 4KMUC 4KTAA 5C44H 5EKLA 4H13C 2EYPA 2KCNA 2X69A 3CF5A 2FJ2A 2FMCA 3JAML 4XQJA 2DY7A 4PNYA 3TDQA 1JMCA 4JPBW 1LT6D 1WI5A 2Y0SG 2K5NA 1EIHA 4NB3A 1YHAA 1YEZA 1D5MC 3J7YW 1NCVA 5IT9c 1VQ6A 1CA6A 3PF4A 3GTPB 1A8VA 2G5DA 4GLAC 3ULPA 3A54A 1LABA 1S5CD 5IE8A 1WTHA 2I07B 3GP7A 2ZJPA 2TSSA 3S1NH 2RBMA 4TQUS 1X32A 1G8ZD 1EZ8A 3GTMB 4YWLA 1NUCA 3NBIA 1HUNA 2I46A 1KTKA 1EQRA 3B6YA 1JJGA 4KKTA 1UWVA 2JEBI 1PV4A 5A35A 5FLXL 1QUQB 2AWNA 4DAYB 3SDZA 1BBUA 3HOYH 2WP8J 1UE1A 2NBFA 1U0LA 3CCVA 1XTCD 1UE5A 3S9WA 4EQOA 4XYQA 1AE3A 4DFAA 4B3TQ 1UE6A 5FJ8H 4HJAA 3WOFA 5JOBA 3UE0A 3PGZA 4QUCA 4JI8Q 4DAPA 3U4ZA 2K14A 1BCPD 2E2DC 3TS2A 1SXTA 3J7AF 1WTPA 1N32Q 3O13A 1E2WA 3K7UC 4DV2L 1K3BC 1L1OC 3T51B 1XMQL 1HR0W 3U58A 1A15A 3QR8A 1I4HA 3S2DB 2PZUA 1I5FA 1JJCB 1EOTA 3K80C 2AQ2B 1Y1VH 3OOCA 3TZUA 2CKZB 5LMNQ 5J1ZA 5T1IA 3KF6A 2B39A 3ND9A 3F1ZA 4RFBA 4ZKBB 1A0IA 2F0DA 1I4PA 2PNRC 1JB7A 5FKAC 1KAWA 1PFSA 1XJVA 1Q1EA 1RD9D 1VCIA 1EWHA 3HOXB 1CKNB 4A3FH 5JJIA 3PO2B 2A74C 3NQTA 2B2UC 3I72A 1SMXA 1LYLA 1M90C 4BA1I 4JI2Q 1ZEQX 4A3JB 4CBVA 4LF9Q 4JK1C 3RLFA 2JEAI 1MGSA 4G7OC 2KHJA 4Z9CB 1PZJD 5NUCA 5IGEA 2B3GA 1YIJA 3E6ZX 4A93H 2F0KA 1MHWC 3FVQA 3I73A 2A69C 2A6HD 1UE7A 4ZQ3A 3AYHB 1K73C 1J5EL 1HPCA 1LT4D 1PRTF 2EJGC 2BCOA 4DK1A 4A3KB 1NAPA 4R4OA 3I4NH 4ODGA 1AP0A 1PH5A 1XPUA 3L0OA 1DM0B 1JOOA 3MZ5A 1FNUA 2ES2A 4I7ZC 4BXXG 4CKEA 2N49A 1KC8C 3KDFB 4LFAQ 4WORA 4BA2I 4EQ5A 3T16A 1LTTD 4ZCKA 4OX9Q 1EY5A 3L3OC 4L5SA 2K1BA 1QZHA 1QG7A 4YWMA 5LHY1 3OPOA 4A3CG 1LT3D 1ILPA 1CZWA 4HJ7A 5E3FA 3FKIB 3VR4A 3BDLA 5IY0A 2EY6A 4B3RQ 4IUVA 4TVAB 1QCBD 4PQXA 4A3IG 2B2YC 4IOCA 1YNJC 5ELBA 4IPGA 2Z0SA 2WKDA 1ICFB 2EQSA 4XXEA 3KK7A 5D14A 1Q3LA 3T1YL 1Z9FA 2NVYB 5JJLA 1R4PB 3UDFA 2F0SA 2PYKA 2EY2A 3H0GB 4OWWB 3QWNA 2I0QA 2HT1A 3S2DH 4OO1I 2MHVA 4DR4Q 1K83B 1PYWD 3T1HQ 3M4YA 3E3XA 3DXJC 2IHEA 1G51A 3MXUA 2JA8G 1E1TA 1Y69U 2O5IC 1I4XA 1F2LA 1I4GA 4F7XA 2K50A 4K2KA 3EN2A 3FEWX 1LT5D 3HFZB 3OWFA
chains in the Genus database with same CATH topology
2QDBA 4ZRZA 2EYOA 3NTKA 1H9SB 2EY1A 5C0XH 5IT9E 1K8OA 4IFDG 3NWSA 4NKLA 2K5WA 2XIWA 5JVG3 1B3AA 4RGTA 1DZ1A 1II3A 5EJWA 1BNZA 1QNUA 1PFNA 5I9OA 1STNA 1M8AA 1KLUD 2MGSA 4OL7A 5E4XA 3GTQB 1EU4A 4K8IA 3A8IE 2Q8TA 4KY7A 4QIWB 1RF2D 2LFNA 1HQMC 5TSSA 3PUWA 1HXYD 4KY6A 3TP5A 3BYTB 3I3CA 4DA2A 1TVXA 4IFDJ 3LWEA 4RWSC 3SK4A 2K5DA 3L9AX 4Q0FA 1OXVA 4DN4M 3DM1A 4N9TA 1SNCA 5HURA 3VYTA 5D65A 2R3ZA 2AUJD 2EYMA 3PUVA 1Q12A 5BN3A 1Q90A 4L63B 1LO5D 4MIUA 3NQIA 2KA7A 4G7HC 2M2LA 3BVZA 3BYYB 4GZYC 1KNEA 2XRSD 3CRKC 3EFXD 2NN6G 1LTGD 3BDOA 4WFN3 2EOTA 3FDTA 1JWSD 3TMEA 1I4QA 3GD7A 4ZKCB 1MSHA 2JYOA 3M3YB 1PDQA 1SE4A 4RGNA 3G6JB 3EVQA 3OIPA 2B2TC 4KY5A 3Q6SA 1UEAB 1Y8NB 4TKOB 1CK1A 5I4DA 2K28A 2F3WA 1V43A 5JEAG 2F1MA 1X3QA 3V05A 3MFGA 2F0MA 1GJXA 2NZ1D 5C3XA 1NR4A 2WB1B 3U9OA 5ELEA 2LS01 5CV4A 4CHTB 1SEBD 2ENBA 2F0LA 3FPUB 2NVQB 3NBHA 2K6AA 2JA5B 5IODA 3RUZA 1I50B 3E0JA 1CHQD 1X3PA 3Q24A 2NVTB 4KJOA 2F0FA 3FPPA 3CHBD 2MP1A 4K8JA 2CW0C 2DNEA 1JWUD 1SJED 4M8AA 1C8CA 1STEA 3K5MA 3K0YA 3NWTA 1GHKA 2R61A 5DM73 4ME5A 1SSOA 2PPBC 3C1EA 2F0WA 4NMZA 2SNMA 4XYOA 1Y8PB 2KOLA 2IX1A 5JEAJ 2RSOA 1VMCA 1LLRD 1O80A 4FO2A 4E6IA 1BCPF 2QILA 2L11A 3SE0A 3NUCA 1DOMA 1TU2B 2F0JA 2F0IA 5C3WA 5BN4A 1ZYRD 1SYDA 2L9HA 2A69D 3H94A 1Q8IA 3SK6A 2KVMA 1DOKA 1U4PA 5D3DA 5JPMC 3VYRA 3CRLC 4DAYA 1EQTA 4BWGB 1O7ZA 1CT1D 3QOLA 5LL6X 2PCFB 2NYZD 4PMCA 1F2YA 1F77A 1DOLA 2EE1A 1EQVA 3D4WA 1A3TA 2K01A 2X6LA 1XYIA 4CKBA 2MJ8A 4OIJA 3SVMA 3IFTA 1DJRD 4YIJA 2Q8RE 2A6EC 3OMGA 3DWQA 2OF1A 3D4DA 2KQ3A 3W2DA 3I70A 2R93B 4EQNA 3MAQA 2LMCB 4F88A 1YNJD 4EGVA 1RDPD 3FMCA 3K58A 1R4QB 1PZID 2EYFA 1JOKA 4QUFA 2XN9C 4R9WA 1EY8A 4XT3B 3BG3A 2CVRA 4XIGS 2IT1A 3M4OB 1U4LA 5ISRA 1B50A 2Q8IB 1K8MA 4HR7B 1I6VC 3GV3A 1AZQA 5IGCA 3BDCA 4KI0A 2NTTA 4J8QA 2XSCA 3NP8A 1MI2A 3S1RB 1LTSD 2A73B 1XXGA 5FO7B 3MXGA 5E4WC 4OO1G 1LV9A 1S4ZA 1TWCB 4C3JB 1M4VA 4ZUJA 1WTWA 2A68C 2D2CC 1LACA 4FXKC 4RH6A 1NR2A 3LX0A 2C5CA 3AB9A 3J81E 4XTCS 1HQRD 2F4IA 3R3OA 1EY0A 1XWEA 1D5XC 3F2UA 1JICA 3A56A 2FFKB 3T4AC 1B4OA 2L0CA 1A3VA 2J0TD 3PUXA 3VR5A 2RQXA 3L7ZC 1CZGA 2FINB 2HQEA 1Y8OB 2B2UA 1KAAA 1BQQT 1SBBB 2QEJC 2WKCA 3N52A 4HAEA 1JB3A 2E2IB 1OXTA 5KIXA 3HGBA 3EA6A 1SFOB 5G3LD 1SYBA 1HA6A 1SNDA 2K03A 1STYA 4C3JG 1J9OA 3NK9A 1H9SA 5F2DA 2J7ZA 2WINB 1ESFA 1C48A 2BA0A 4RHRA 3VA7A 4C2MB 2JSOA 2HUGA 2HCCA 1KDAA 3MFYA 4S3SA 4IURA 2Z1CA 3KLRA 1TWFB 3I4LA 3DMUA 1ICWA 1UUPA 3NHHA 3M85A 1RTOA 1STGA 4ZK9B 3DEPA 2B2YA 3G7LA 4RA8A 1I6HB 2PMZB 1EYAA 4KK7A 1SYFA 1S5DD 4J1MA 1EY4A 5EGTA 1TKWB 3A8JE 3Q0AA 1O7LA 1L0XB 5M9OA 5EKIA 2QCPX 5C4ZA 1Q1BA 1B44D 1MBYA 4FYDA 1U9RA 4A3IB 1EU3A 2CW0D 1ESRA 2PZWA 2RVLA 1GUOA 3OSOA 2VXWA 1WTQA 1ZYRC 1NSNS 3OW7A 4DGZA 4IZ8A 1STHA 4OHJA 3LWUA 4H0LC 2OEOA 2NUCA 2JA8B 2F0UA 2QF7A 1PRTB 2G9HD 5EQ0A 1RKNA 1WTXA 1SAPA 1EEID 2WAQB 1RHPA 3CU7A 3ITPA 3SK8A 3J80L 4IUUA 4ABNA 4A3BB 2IJ0A 1LTRD 5A2QE 1EY6A 4K14A 5M5XB 4IUPA 3X3MA 3VR2A 1IYUA 4A3MB 1PTOB 3HOVB 2LKVA 2IPKD 1GUSA 5CR3A 2K7VA 1HCZA 1DXMA 2VNUD 3KUPA 1V8QA 3T13A 2ZT9C 2NVXB 5CGKA 4FF2A 2A6ED 3FRPB 2EJFC 1LTBD 1WCMB 3DUZA 1WTRA 1TR5A 1QNKA 2L4NA 3TSSA 4RHSA 3IAYA 5KNBA 3URYA 1QB5D 4M1UB 1F9QA 1PFMA 3GV6A 4HSPA 4L8JA 2D62A 1EL0A 3T56B 2B2TA 1TWAB 2BDNA 1F2MA 1Y1WB 1Z6HA 5IGDA 4DK0A 3PUYA 1BBXC 5CYUA 1CA5A 3I90A 4CJ2C 5KGUA 2B2VA 3S16B 4V0BA 5FLXE 1L0YB 2F3VA 5CMDA 3QIAA 1BOSA 3QB3A 1KABA 1TY0A 2EY5A 3BVGA 2L5TA 3P1HA 3DWAA 2JXMB 2A68D 4K6DA 4TSSA 2ICIA 4X3UA 4IFDH 4K5VA 4FXDA 3R8BA 3M7NA 1A2UA 1I3QB 2RKSA 2N55A 3K6OA 3T53B 1HA5A 2RDFA 1B9NA 1SNOA 4C1NI 4RAUC 3VR3A 3V2TA 2SEBD 5C4JB 3I91A 5I2YA 5AFWA 4MN3A 1TQOA 2EZVA 5CV6A 2WIIB 3DEOA 1ENFA 2FMMA 1KLGD 4RGMA 5K5PA 1HHVA 3D31A 3K7AB 4KJNA 3PV0A 3MVVA 1GUNA 3S14B 3NSWA 4C3IG 1JR0D 3ONAB 2B2WA 5EKKA 1WTOA 5CORA 1D6EC 1TS2A 3D4RA 4NW2A 4AYBB 1AEXA 1B53A 4G4KA 4C1NK 4C3HG 1PFBA 3LNNA 1GUGA 1JWMD 2O2LD 5JAVA 3S1QB 3S2HB 4DAVA 4HCEA 2B2VC 5FO9B 4KHZA 1FYCA 3HS0C 2ZXRA 1EWCA 3PIO3 1OXUA 4I65A 2EPBA 2R7ZB 2NN6H 3ZYYX 2IX3A 2F0QA 1ET6A 4LJZC 1BR9A 2JA7B 3TP6A 4PV1C 2H1EA 2YYZA 1ZKOA 2PQEA 1A3UA 1GHJA 5K36G 3K5LA 1Z47A 1DYQA 1STAA 2HCIA 3N6RA 5G3LF 4DNRB 5DM63 1SDFA 3IFDA 1J8IA 2EDGA 1JE4A 5JEAH 3SHLA 3X3NA 5C5LA 1AN8A 4K2LA 3GTOB 1D1KA 1EIGA 1G6ZA 1CHPD 3GTLB 5C0XI 1I4RA 1E2VA 1BO0A 1CFMA 2KEDA 5C6AA 2XVSA 4DXGA 1EYCA 3R2IA 5CV9A 2B2WC 5CV7A 3I4MB 2DY8A 1ET9A 1SE2A 3M7GA 2BE5C 4A3GB 4LMQD 4QMGA 3HOZB 1MD2D 3R2TA 2E76C 3OHXC 2JA6B 3K59A 2IL8A 2SDFA 3MA2B 1AW7A 3ERQA 4IFDI 4EVOA 5CC4A 2M9VA 4A3DB 2D5DA 5ELFA 1KDBA 1UAPA 3S15B 4H44C 1ENCA 5JPNC 1SYGA 3S1NB 2HDLA 1PMRA 1YNNC 4OGQC 4KKSA 2F0OA 1F9SA 2AUKA 5IIFA 4KN7C 2O4XA 4JBWA 2EJMA 2SNSA 3TN2A 3OMCA 1SJHD 4WRDA 1RJTA 5M5WB 2Z8LA 4ZLTF 4NDXA 5EPJA 5IGGA 4CJ1B 2B8FA 3DWPA 3KF8A 2NWGA 5A2QL 1MSGA 5KEEA 2G9DA 1QWYA 2EVBA 1IL8A 1ENAA 5FO8B 2PO4A 1CTMA 4RKLA 1FNVA 1H9RA 2AWOA 2F0EA 1WTVA 1VF5C 3CQZB 4R8IA 4FXGC 4HEDA 1KNAA 4XT1B 1HRJA 2A5HA 2LY7A 5CV8A 2R92B 5HGTA 4CJ0B 4BY7B 1D2BA 1SNMA 3GTKB 2VB2X 1GXDC 5J22A 4U673 2B8GA 2PW5A 5ELDA 4OO1H 4K6LA 1WVLA 4P2CB 3UI2A 5IT9L 4A93B 4FNFA 1A2TA 4LK1C 3MTSA 3K57A 3QO2A 2F0TA 4HMJA 4U68A 3PIP3 3I4NB 4N9PA 1VMPA 1QE6A 1BUVT 2OXPA 1EY7A 5C3EB 4XQQA 1IHZA 2EYLA 1OXSC 3TP7A 3A55A 2C9OA 4ZAIA 1WD1A 2YU9B 5EBDA 2F0NA 1PRTC 4TRDA 1W6JA 3E5SA 4X3SA 1H9JA 3RD4A 2F0HA 1VF7A 1PLFA 2MUYA 5DNFA 1TS3A 2H4OA 1F9PA 1LTID 2HDMA 1EEFD 1G2SA 4IN3A 4HTHA 4K5XA 3P7JA 1ML0D 1PTOC 4FF3A 1S5FD 3MHBA 3MWYW 1TY2A 1B1ZA 1IKLA 5M5YB 3GTGB 2DN8A 1DD2A 2K33A 2D9UA 3HEJA 1H9KA 1EZ6A 4B08A 5CBEE 4FF1A 1EYDA 3EROA 3AU7A 4EQPA 3NTHA 4K5WA 1D5ZC 1B2TA 4QCLA 4KKUA 1ILQA 3P20A 2RDGA 1JOQA 1EY9A 3KLSA 1BXTA 1QILA 3SR1A 2ICEC 4BS9A 3U9SA 2RSNA 5EPLA 4BBRB 4FF4A 2BOSA 1G291 2AQ1B 3MEHA 3C46A 4FVMA 5I2XA 2L1BA 5EBCA 3IKJA 1T5XD 3PMFA 3HOWB 3KBGA 1QJOA 2MPMA 1TT2A 2IW3A 3V96A 3S1MB 2X6GA 4G7ZC 1JQYD 2V4DA 2OT2A 1V1PB 1RODA 2BE5D 3D6WA 2RDHA 4IUQA 1CI3M 3KLSX 5C0XG 1O78A 3VYSA 1PTOF 2E75C 3Q23A 3OIQA 1GOZA 3TP8A 4B9WA 2TMPA 2XNAC 5DAUA 2ZXPA 2K05A 2IWHA 1JORA 1IW7C 3JAME 3H3VC 2JP1A 3GQBA 3WOEA 1R9TB 2N88A 2Z4IA 2K32A 5KYLA 3GO5A 2RA4A 4H7BA 1YNND 3NXWA 4CKCA 3QG1A 1C4QA 1SMYC 3A7LA 3BS1A 2WV6D 2PZTA 5C0XJ 3BVMA 1OXXK 2F0VA 2NB0A 4OIKA 5DEHA 2KUMA 5C4XB 5FOBB 3NE5B 2KECA 3MC0B 5KNCA 1S5ED 4BY1B 1SNQA 4C3IB 1PXUA 4XQNA 1FD7D 3DHQA 5J39A 5I6YA 2KCCA 1TS5A 5IGBA 3K5NA 4C3HB 5JVH3 4BBSB 1ONLA 2FHTA 4F8MA 3NTIA 1O7YA 4KN4C 1G2TA 2R6GA 3MXPA 4QF4A 3SEBA 2GA4B 5M3MB 2QKIC 1PTOH 3GTJB 2E2HB 1A6XA 4MHEA 1U4MA 1G91A 2E74C 1WD0A 3P75A 5C5MA 2VUMB 3EQLC 2M00A 3D8GA 4IUNA 5JJZA 3NPPA 4V190 3A7AB 3TBIB 1RTNA 4O42A 3C3LA 3H91A 3KBXA 3PO3B 5KRUA 1DCZA 3I8ZA 5LL6S 2WACA 4QB4A 1VDZA 4UDUC 5COYA 2DNCA 1STBA 4G57A 2EYHA 3IL8A 2ID0A 3HP3A 1FNWA 2BDOA 3VYUA 1LTAD 1BF4A 1Z7TA 4ID6A 4PMWA 5FK9C 3RZOB 2IX0A 1BDOA 3W3AA 1BCPC 1B9MA 2O5JC 1OO9B 5CV5A 4B9XA 1CQVA 3J81L 2K5QA 4ZUIA 2XWJB 4RGOS 1EFID 3RZDB 1PRTD 4Y7NB 2PW7A 3VR6A 4HN7A 1D1IA 4ULLA 3ND8A 4HMIA 2E2JB 3J80E 2L55A 1F2ZA 2JE6I 3H09A 2CHBD 1IYVA 3VA5A 3MXNA 4KD4A 4FP5D 5IGFA 1TIID 4DXFA 1TWHB 1PTOD 4DNTB 4HCSA 4A3EB 4IQZA 1UNSA 3RMHA 4X3TA 1GUWA 1FR3A 3SXHA 4X3KA 2SOBA 3CKIB 4F87A 2F03A 1HTLD 1HFNA 4NP5A 5KNDA 4KV6A 4Q5VA 2KEEA 2A6HC 1SE3A 1BCPB 1KDCA 3HZXA 1SNPA 5C4HA 1SYEA 4DF7A 1HUMA 3HRZC 3AMUA 5K36H 3S17B 1HFGA 3K5OA 3HOUB 2F0GA 3SK5A 2AQ3B 1FGBD 1QOHA 3D3RA 5C44B 5BN5A 1S5BD 5T1GA 3J7AV 4KHVA 4IALA 3HKZB 1JC7A 3H6MA 5D3IB 3PUZA 2BA1A 4UAIA 5IOCA 4J6HA 1ZXTA 3OWEB 2CQAA 5I6WA 3EJIA 1JCKB 5M3FB 5I9PA 4LAAA 2L12A 4DU9A 3C2PA 3R93A 5ELCA 3D6CA 4XDXA 1DONA 4RCOA 1GUTA 3WDNA 3C1FA 2J4XA 1T5EA 3QOJA 5KYIA 1H9MA 2XRQD 4WJWA 1IKMA 3BZDB 2K04A 2NTSA 4L6TB 2ZXOA 1IW7D 3HOYB 2KHSA 5EPKA 1TS4A 2Z4HA 2VB3X 2Y0SB 2EXZA 4ILWA 1PZKD 1XX8A 4RCNA 2F0PA 1CQFA 2XWBB 1SMYD 1E2ZA 3A8KE 4ZYSA 3Q22A 2KJXA 4C56C 1F9RA 1HTPA 4RKBA 4R8NA 4IUTA 1AZPA 1Y1VB 1TWGB 3TZDA 4PMBA 1U4RA 1V1OA 1SYCA 4CGYB 3HG9A 2B63B 5E1FA 1E0BA 1CM9A 1RCVD 1AFPA 1V1PA 4A3FB 1W6KA 2NN6I 5CBAE 4HSVA 3QJYA 4O1NA 4KD3A 4KMUC 4KTAA 5EKLA 4H13C 2EYPA 2KCNA 2X69A 2FJ2A 2FMCA 3JAML 4XQJA 2DY7A 3TDQA 4PNYA 1LT6D 1EIHA 1D5MC 3J7YW 1NCVA 1CA6A 3GTPB 3A54A 1LABA 1S5CD 2I07B 3GP7A 2TSSA 2RBMA 4TQUS 1X32A 1G8ZD 1EZ8A 3GTMB 1NUCA 3NBIA 1HUNA 2I46A 1KTKA 4KKTA 2JEBI 5A35A 5FLXL 2AWNA 3SDZA 2WP8J 2NBFA 1XTCD 3S9WA 4EQOA 4XYQA 4DFAA 3WOFA 5JOBA 4QUCA 4DAPA 1BCPD 2E2DC 1SXTA 3J7AF 1WTPA 3O13A 1E2WA 3T51B 1A15A 1I4HA 3S2DB 2PZUA 1EOTA 2AQ2B 3OOCA 3TZUA 5J1ZA 5T1IA 2B39A 3ND9A 4RFBA 4ZKBB 2F0DA 1I4PA 2PNRC 5FKAC 1Q1EA 1RD9D 1VCIA 1EWHA 3HOXB 3PO2B 2A74C 3NQTA 2B2UC 3I72A 4BA1I 1ZEQX 4A3JB 4CBVA 4JK1C 3RLFA 2JEAI 1MGSA 4G7OC 4Z9CB 1PZJD 5NUCA 5IGEA 3E6ZX 2F0KA 3FVQA 3I73A 2A69C 2A6HD 4ZQ3A 1HPCA 1LT4D 1PRTF 2EJGC 2BCOA 4DK1A 4A3KB 1NAPA 4ODGA 1AP0A 1DM0B 1JOOA 3MZ5A 1FNUA 4I7ZC 4CKEA 4WORA 4BA2I 3T16A 1LTTD 1EY5A 3L3OC 2K1BA 1QG7A 5LHY1 3OPOA 1LT3D 1ILPA 1CZWA 5E3FA 3FKIB 3VR4A 3BDLA 2EY6A 4IUVA 1QCBD 4PQXA 2B2YC 1YNJC 5ELBA 2WKDA 4XXEA 3KK7A 5D14A 1Q3LA 2NVYB 1R4PB 2F0SA 2PYKA 2EY2A 3H0GB 3QWNA 4OO1I 2MHVA 1K83B 1PYWD 3M4YA 3DXJC 3MXUA 1Y69U 2O5IC 1I4XA 1F2LA 1I4GA 4F7XA 4K2KA 2EYJA 3FEWX 1LT5D 3OWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4Z A;  2KEC A;  2FJ2 A;  2L1B A;  1J8I A;  2DY7 A;  2KVM A;  4ZKC B;  1DOK A;  1U4P A;  1JE4 A;  1MSH A;  2JYO A;  1WTW A;  4ZAI A;  4ZK9 B;  3KUP A;  1WD1 A;  3TN2 A;  2L12 A;  2B2Y A;  1PDQ A;  1NR2 A;  2MPM A;  3DEP A;  2XIW A;  1EIH A;  3G7L A;  4RA8 A;  1RJT A;  3I91 A;  1EQT A;  1B3A A;  1O7Z A;  5AFW A;  1MGS A;  4MN3 A;  1DZ1 A;  3R93 A;  4ZLT F;  1NCV A;  5EJW A;  5EPJ A;  1BNZ A;  1EIG A;  2FHT A;  4CJ1 B;  1CA6 A;  4XDX A;  1G6Z A;  1DON A;  2B2T C;  1PFN A;  2X6G A;  3Q6S A;  2NYZ D;  1O7Y A;  1DOL A;  3F2U A;  2EE1 A;  4X3S A;  1JIC A;  3IFD A;  1M8A A;  2FFK B;  1G2T A;  2MGS A;  1BO0 A;  2KED A;  1ROD A;  4HCS A;  3D6W A;  2NWG A;  3DEO A;  1MSG A;  1PLF A;  4IUQ A;  1B4O A;  5DNF A;  5E4X A;  1IKM A;  2FMM A;  1F9P A;  2K01 A;  1WTR A;  2K28 A;  1X32 A;  2X6L A;  1XYI A;  2K04 A;  5EKI A;  2Q8T A;  4X3T A;  1NAP A;  1GUW A;  2MJ8 A;  4OIJ A;  1HHV A;  2HDM A;  1IL8 A;  1QNK A;  2L4N A;  4MHE A;  1G2S A;  2B2W C;  1HUN A;  1U4M A;  1X3Q A;  3SVM A;  1G91 A;  2FIN B;  1AP0 A;  2B2U A;  4X3K A;  1WD0 A;  2NZ1 D;  1NR4 A;  5EPK A;  2DY8 A;  2Q8R E;  5JJZ A;  1F9Q A;  1ESR A;  3ONA B;  2B2W A;  1WTO A;  1HFN A;  3N52 A;  1PFM A;  4HAE A;  1WTV A;  3GV6 A;  2RVL A;  3P7J A;  3FPU B;  5COR A;  1ML0 D;  2VXW A;  4R8I A;  1RTN A;  2KEE A;  4HED A;  1XX8 A;  1WTQ A;  4O42 A;  1KNA A;  3H91 A;  3KBX A;  4XT1 B;  4NW2 A;  1HRJ A;  3MWY W;  4LMQ D;  1B53 A;  1IKL A;  1PFB A;  3I8Z A;  1X3P A;  1EL0 A;  2B2T A;  2BDN A;  2K1B A;  3I3C A;  4QUC A;  2L9H A;  2K05 A;  1QG7 A;  5COY A;  1TVX A;  2JP1 A;  2MP1 A;  2B2V C;  1ILP A;  1HA6 A;  4CJ0 B;  4QUF A;  5EQ0 A;  2D9U A;  3LWE A;  2N88 A;  1WTP A;  1F9R A;  1HUM A;  2K03 A;  4R9W A;  1BBX C;  1WTX A;  4XT3 B;  4RWS C;  1CA5 A;  2CVR A;  2IL8 A;  3I90 A;  1C8C A;  1SAP A;  1J9O A;  2SDF A;  5CBE E;  2RA4 A;  1U4L A;  3IL8 A;  4CJ2 C;  3HP3 A;  4IUT A;  4IUV A;  1AZP A;  1HFG A;  2B2V A;  1B50 A;  4DN4 M;  3DM1 A;  1RHP A;  2EPB A;  1SSO A;  1BF4 A;  3TZD A;  2B2Y C;  1B2T A;  5D65 A;  4IUU A;  1U4R A;  1A15 A;  1ILQ A;  2R3Z A;  2J7Z A;  3GV3 A;  1WVL A;  3UI2 A;  1E0B A;  5D14 A;  5CMD A;  1CM9 A;  1EOT A;  1AZQ A;  1Q3L A;  2H1E A;  3MTS A;  2KOL A;  5T1G A;  4X3U A;  3QO2 A;  1MI2 A;  2HUG A;  5T1I A;  2RSO A;  1VMC A;  2HCC A;  4ZKB B;  4IUP A;  2HDL A;  1O80 A;  2M2L A;  4IUR A;  4HSV A;  5CBA E;  2N55 A;  5E4W C;  4U68 A;  4OIK A;  2HCI A;  1KNE A;  2RSN A;  5EPL A;  2KUM A;  4UAI A;  1F9S A;  1VMP A;  1QE6 A;  1F2L A;  2L11 A;  4RAU C;  2EOT A;  1ICW A;  1ZXT A;  2X69 A;  1DOM A;  1SDF A;  3FDT A;  1RTO A;  2B2U C;  1LV9 A; 
#chains in the Genus database with same CATH topology
 2QDB A;  4ZRZ A;  2EYO A;  2WAQ G;  3NTK A;  1H9S B;  2EY1 A;  5C0X H;  5IT9 E;  1K8O A;  4IFD G;  3NWS A;  3CW2 C;  1KL9 A;  4NKL A;  4POG A;  2K5W A;  2XIW A;  4MNO A;  3HOX H;  1B3A A;  5JVG 3;  4DR1 Q;  3PO2 H;  4RGT A;  1DZ1 A;  1II3 A;  4A3B G;  5EJW A;  1BNZ A;  3OW2 A;  1QNU A;  1PFN A;  1YBY A;  5I9O A;  4A3J H;  1STN A;  1M8A A;  1KLU D;  2MGS A;  1SRO A;  5GRO A;  4OL7 A;  5E4X A;  4A3M G;  4IPC A;  3HOV G;  3GTQ B;  2JJQ A;  4A75 A;  1EU4 A;  4K8I A;  3A8I E;  2Q8T A;  4KY7 A;  4QIW B;  4UP9 A;  1L2F A;  1PA6 A;  1Q82 C;  4NXM Q;  2HD3 A;  3JAM i;  3CC4 A;  1VS0 A;  1RF2 D;  2LFN A;  4A3K H;  3CCS A;  1HQM C;  5TSS A;  3CCM A;  4CDE C;  3RN5 A;  3PUW A;  1HXY D;  4KY6 A;  4JYA Q;  3RR5 A;  3TP5 A;  4KHP L;  3BYT B;  3I3C A;  4DA2 A;  1TVX A;  4PZ7 A;  4IFD J;  1WCM G;  3LWE A;  1X3E A;  4RWS C;  3SK4 A;  1WFQ A;  2K5D A;  2F3I A;  3L9A X;  4Q0F A;  1OXV A;  4DN4 M;  3DM1 A;  4N9T A;  1SNC A;  2XGT A;  5HUR A;  3VYT A;  5D65 A;  3FKI H;  2R3Z A;  2AUJ D;  4JI1 Q;  2EYM A;  1IZ6 A;  3U50 C;  4CDC C;  3PUV A;  1Q12 A;  5BN3 A;  1NMF A;  1Q90 A;  2CWA A;  4L63 B;  1LO5 D;  4MIU A;  3NQI A;  2KA7 A;  4G7H C;  2M2L A;  3BVZ A;  3BYY B;  2UXB Q;  1Y1W G;  4GZY C;  1KNE A;  2XRS D;  3CRK C;  3EFX D;  2NN6 G;  2ZJR A;  1LTG D;  3BDO A;  4WFN 3;  2UXD Q;  2EOT A;  2LXJ A;  3FDT A;  1JWS D;  3H0G H;  3TME A;  1I4Q A;  3GD7 A;  4ZKC B;  1IBM L;  1MSH A;  2JYO A;  1EQQ A;  3M3Y B;  3U4V A;  4X65 Q;  1PDQ A;  1C0A A;  4DV1 Q;  1SE4 A;  1VQ8 A;  4LF6 Q;  1ASY A;  4K0K Q;  4RGN A;  4LFC Q;  3G6J B;  4JI4 Q;  3EVQ A;  3OIP A;  1HR0 Q;  2B2T C;  4KY5 A;  3Q6S A;  1UEA B;  1Y8N B;  4AIM A;  2AHO B;  2RCN A;  3J81 c;  4B3S L;  4JBJ A;  1CK1 A;  4TKO B;  5I4D A;  2JA9 A;  4LF4 Q;  2K28 A;  2F3W A;  1V43 A;  5JEA G;  3PCO B;  2F1M A;  3CCJ A;  1X3Q A;  3V05 A;  3MFG A;  2F0M A;  3UDX A;  1VQM A;  1FJG L;  1GJX A;  2NZ1 D;  5C3X A;  3CC7 A;  1NR4 A;  1X56 A;  2WB1 B;  3GTQ H;  1VQC A;  3U9O A;  5IP9 G;  5ELE A;  2LS0 1;  5CV4 A;  1SEB D;  2ENB A;  2F0L A;  3FPU B;  4CHT B;  4JI7 Q;  2NVQ B;  3NBH A;  4DR3 L;  2K6A A;  3RLN A;  1W2B A;  2JA5 B;  5IOD A;  3RUZ A;  1I50 B;  3E0J A;  1SLJ A;  3ERS X;  1N33 L;  1CHQ D;  1X3P A;  2Z6K A;  1SRU A;  1EFW A;  3Q24 A;  4C3H H;  2NVT B;  4KJO A;  2DGY A;  5J3B A;  1EWI A;  2F0F A;  5IYC H;  3FPP A;  3CHB D;  2ZM6 Q;  2MP1 A;  4K8J A;  2CW0 C;  2DNE A;  1JWU D;  1SJE D;  4M8A A;  2I5M X;  5M3M H;  1C8C A;  1IBK L;  1N36 L;  1STE A;  1VQE A;  1T9H A;  3K0Y A;  3NWT A;  3K5M A;  1GHK A;  2R61 A;  2E8G A;  5DM7 3;  4ME5 A;  3GTJ H;  1SSO A;  3CXC A;  2PPB C;  3C1E A;  2F0W A;  4N8F A;  4NMZ A;  2SNM A;  2VUM H;  4DUZ L;  4XYO A;  1Y8P B;  3SGI A;  4JI0 L;  2KOL A;  3EBE A;  2IX1 A;  5JEA J;  3TRZ A;  4AYB G;  3CP0 A;  1P16 A;  3J80 i;  2RSO A;  2UUB L;  1PH9 A;  3E0E A;  1VMC A;  1LLR D;  1O80 A;  2VY3 A;  4FO2 A;  4E6I A;  2Z9H A;  1BCP F;  2QIL A;  3KYH C;  2L11 A;  3NUC A;  3SE0 A;  1DOM A;  1TU2 B;  2F0J A;  2F0I A;  5C3W A;  3D0F A;  1ZYR D;  1SYD A;  3RLO A;  1GKH A;  2A69 D;  2L9H A;  5BN4 A;  3H94 A;  1Q8I A;  2KVM A;  5D3D A;  1DOK A;  1U4P A;  3SK6 A;  5JPM C;  3VYR A;  5LMU L;  2R7Z G;  1QUQ A;  4PZ6 A;  3CRL C;  2A19 A;  1VQ4 A;  4DAY A;  3I7F A;  1EQT A;  4BWG B;  2H5X A;  1O7Z A;  1CT1 D;  3QOL A;  5LL6 X;  4LF7 Q;  2PCF B;  2JA7 G;  2NYZ D;  4PMC A;  1F2Y A;  1F77 A;  1DOL A;  2EE1 A;  1KQS A;  1EQV A;  3D4W A;  2VL6 A;  1A3T A;  2K01 A;  2X6L A;  1XYI A;  4CKB A;  4YWK A;  2MJ8 A;  4OIJ A;  1KHI A;  3SVM A;  3IFT A;  1GO3 E;  3CC2 A;  1DJR D;  2RF4 A;  4LF8 Q;  2OQK A;  4YIJ A;  2Q8R E;  2A6E C;  2E2J H;  4A3L G;  4OWX B;  3OMG A;  3DWQ A;  3DLL A;  2OF1 A;  4X62 L;  2UXC Q;  3TRE A;  2Z6K C;  3D4D A;  2KQ3 A;  5IP7 H;  3W2D A;  3I70 A;  4JI5 Q;  2R93 B;  4EQN A;  3MAQ A;  1YHB A;  2LMC B;  4F88 A;  4JI3 Q;  1YNJ D;  2ZTC A;  4EGV A;  3PIO A;  1FGU A;  5FLM H;  1RDP D;  3FMC A;  4L5Q A;  2NVQ H;  3K58 A;  1R4Q B;  1PZI D;  2EYF A;  1JOK A;  4QUF A;  2XN9 C;  1CKN A;  4R9W A;  1EY8 A;  4XT3 B;  1ASZ A;  3BG3 A;  2CVR A;  4XIG S;  2IT1 A;  3NEN A;  3M4O B;  1U4L A;  5ISR A;  3G4S A;  3F8T A;  1B50 A;  2Q8I B;  4DR7 Q;  1K8M A;  4HR7 B;  3I4M G;  4B3M L;  1I6V C;  1DGS A;  4OON A;  3GV3 A;  2VQF L;  1VQG A;  1AZQ A;  5IGC A;  3BDC A;  4KI0 A;  4OEL B;  4A3G G;  2NTT A;  1YHQ A;  2MFI A;  4J8Q A;  2XSC A;  3NP8 A;  1MI2 A;  3HKZ E;  5GAE C;  3HOZ G;  3S1R B;  1LTS D;  2A73 B;  1XXG A;  5FO7 B;  3MXG A;  5E4W C;  1V1Q A;  2K4K A;  3ULL A;  4QY7 A;  1AH9 A;  4OO1 G;  2JA6 G;  4HJ5 A;  1LV9 A;  1S4Z A;  1TWC B;  4C3J B;  1M1K C;  1M4V A;  1X55 A;  4ZUJ A;  1B70 B;  2E5L L;  4LFB Q;  1WTW A;  3KDF A;  2A68 C;  2D2C C;  1LAC A;  4FXK C;  1GD7 A;  4LW1 A;  4RH6 A;  1NR2 A;  1K28 A;  3LX0 A;  3HOU H;  2C5C A;  3AB9 A;  3J81 E;  4A3D G;  1HZA A;  4XTC S;  1PVO A;  1HQR D;  1PH8 A;  2F4I A;  3R3O A;  4DV3 L;  1EY0 A;  1XWE A;  1D5X C;  3F2U A;  2JN4 A;  1JIC A;  3A56 A;  2FFK B;  3T4A C;  4DV4 Q;  1XNR L;  1B4O A;  2HHH L;  2L0C A;  1A3V A;  5IWA L;  2J0T D;  3PUX A;  3VR5 A;  4Y52 H;  2RQX A;  3L7Z C;  4HJ9 A;  1CZG A;  2FIN B;  2HQE A;  1B3Q A;  1Y8O B;  2B2U A;  2EXD A;  3JAM c;  1KAA A;  1BQQ T;  5M3F H;  1SBB B;  3RNU A;  1AE2 A;  2QEJ C;  2WKC A;  3N52 A;  4HAE A;  4DR6 L;  2IY5 B;  1JB3 A;  4DAM A;  2E2I B;  1OXT A;  5KIX A;  2OCE A;  3HGB A;  1XMO Q;  3EA6 A;  5AJ3 Q;  1SFO B;  1X65 A;  3H3V I;  5G3L D;  2CWP A;  2R93 H;  1SYB A;  1HA6 A;  1SND A;  4HIO A;  2K03 A;  1STY A;  4YHH Q;  4C3J G;  4YY3 L;  1J9O A;  4WJ4 A;  3NK9 A;  3PQI A;  2GVB A;  1H9S A;  4DV0 L;  4LWC A;  5BR8 Q;  5F2D A;  2VQE L;  4X66 Q;  2J7Z A;  2WIN B;  2OTJ A;  3OTO L;  3M4O H;  1ESF A;  3BU2 A;  1C48 A;  2BA0 A;  4X6A H;  4RHR A;  3VA7 A;  5FLX c;  4C2M B;  4NXN L;  4HIM A;  4JV5 L;  2JSO A;  2CFM A;  2HUG A;  2HCC A;  2QA4 A;  1KDA A;  3MFY A;  4S3S A;  4IUR A;  2Z1C A;  2R92 G;  3KLR A;  1TWF B;  3I4L A;  3DMU A;  1WOC A;  1ICW A;  4BY7 G;  1UUP A;  3NHH A;  3M85 A;  1RTO A;  1K8A C;  2QEX A;  3CCU A;  1P8L A;  1STG A;  4R4C A;  4ZK9 B;  2RHQ B;  3DEP A;  2B2Y A;  2UUC Q;  1FVI A;  1TWG H;  3G7L A;  4RA8 A;  2UUA L;  1I6H B;  2PMZ B;  4DR5 Q;  1VQ9 A;  2RCF A;  1TWC H;  4A93 G;  1EYA A;  2A1A A;  2B63 H;  1XNQ L;  2KHI A;  3W5O A;  3LGJ A;  4KK7 A;  1SYF A;  1S5D D;  4J1M A;  1EY4 A;  5EGT A;  4AQY Q;  1TKW B;  4DNI A;  3A8J E;  5EAY A;  1EUJ A;  3Q0A A;  1O7L A;  1KIX A;  1L0X B;  5M9O A;  5EKI A;  4GKJ L;  2QCP X;  5C4Z A;  1Q1B A;  1B44 D;  5GQO A;  1MBY A;  5C3E G;  4FYD A;  1U9R A;  3M4Q A;  4GNX C;  4A3I B;  1EU3 A;  2CW0 D;  3KJP A;  1ESR A;  2PZW A;  1BKB A;  1GUO A;  2RVL A;  3OSO A;  2VXW A;  3OYY A;  3BJU A;  4AH6 A;  4O2D A;  1WTQ A;  3TS0 A;  1ZYR C;  1PH6 A;  1NSN S;  3OW7 A;  4DGZ A;  4IZ8 A;  1STH A;  4OHJ A;  2EIF A;  3LWU A;  4H0L C;  1N34 L;  2OEO A;  2NUC A;  1XPR A;  3CME A;  2ZTD A;  4L5R C;  3GTP H;  2JA8 B;  2F0U A;  2QF7 A;  3KF8 B;  1PRT B;  2G9H D;  1VQJ A;  5EQ0 A;  1RKN A;  2E2I H;  1HZ9 A;  5IYD G;  1WTX A;  1U5K A;  1X3G A;  2K5V A;  1SAP A;  4JOI C;  1EEI D;  1H95 A;  4JW0 A;  2WAQ B;  4P71 A;  1SFO H;  4GKK L;  3GTM H;  1RHP A;  3CU7 A;  3ITP A;  3SK8 A;  1Q7Y C;  3J80 L;  4IUU A;  1W3S A;  3PIP A;  4ABN A;  4A3B B;  4JVZ A;  4LUO A;  2IJ0 A;  1LTR D;  5A2Q E;  3HKS A;  1EY6 A;  4K14 A;  3A5Z B;  5M5X B;  4N8X 1;  1HJP A;  2Q2I A;  4IUP A;  3WWV A;  3X3M A;  3VR2 A;  1I94 L;  1IYU A;  4A3M B;  1PTO B;  3HOV B;  2AKW B;  2LKV A;  2IPK D;  4LNQ A;  4C2M H;  1E3P A;  1GUS A;  5CR3 A;  2K7V A;  1HCZ A;  4DR2 L;  1DXM A;  4DV2 Q;  1XMQ Q;  2VNU D;  1LUZ A;  3KUP A;  1V8Q A;  1WYD A;  4GNX B;  1IL2 A;  1YIT A;  3T13 A;  2ZT9 C;  2NVX B;  5CGK A;  4FF2 A;  4BXX H;  3EIV A;  3CD6 A;  2A6E D;  3FRP B;  2EJF C;  1LTB D;  1I6H H;  1WCM B;  4DV5 L;  3DUZ A;  1WTR A;  1TR5 A;  4BBR G;  1IBL L;  1QNK A;  2L4N A;  3TSS A;  4RHS A;  3IAY A;  5KNB A;  4A3C H;  3URY A;  2UXD L;  1QB5 D;  2CCZ A;  4M1U B;  5DLQ E;  3HOW G;  1F9Q A;  1S3O A;  1PFM A;  3GV6 A;  3TEH B;  2I5H A;  2L15 A;  4A3I H;  4HSP A;  1JE5 A;  4L8J A;  2D62 A;  4HID A;  1EL0 A;  3T56 B;  2B2T A;  1TWA B;  3GDE A;  2BDN A;  1F2M A;  1Y1W B;  1Z6H A;  1EIF A;  5IGD A;  4DK0 A;  3FHW A;  1J5E Q;  4DUY L;  3PUY A;  1BBX C;  5CYU A;  1CA5 A;  3I90 A;  4X64 L;  4IO9 A;  4RMF A;  3G48 A;  4CJ2 C;  5KGU A;  3KFU A;  2N3S A;  2I5L X;  2B2V A;  3S16 B;  1VQO A;  2F4V L;  4V0B A;  2JA8 H;  1LM0 A;  2YTV A;  5FLX E;  3UDG A;  1L0Y B;  1C9O A;  2F3V A;  5CMD A;  3STB C;  2GN5 A;  3QIA A;  1BOS A;  1VQD A;  4APV A;  3QB3 A;  1KAB A;  1TY0 A;  2EY5 A;  3P1H A;  2L5T A;  3BVG A;  3DWA A;  2JXM B;  2A68 D;  4K6D A;  4KLK A;  2ICI A;  4TSS A;  4X3U A;  4K5V A;  4IFD H;  4FXD A;  1C7Y A;  3R8B A;  3M7N A;  1A2U A;  1I3Q B;  2RKS A;  2N55 A;  3K6O A;  3T53 B;  3G6E A;  1HA5 A;  4A3B H;  2RDF A;  1B9N A;  1SNO A;  4C1N I;  4ALP A;  1KRT A;  4RAU C;  5M5X H;  4A4I A;  2NZO A;  3VR3 A;  3V2T A;  3HOV H;  2SEB D;  5C4J B;  1CSP A;  5H1S E;  3I91 A;  5I2Y A;  1IYJ B;  5AFW A;  3PSI A;  2K5H A;  4MN3 A;  1TQO A;  5HGQ A;  3T1Y Q;  2EZV A;  5CV6 A;  1SR3 A;  1KD1 C;  2WII B;  1K9M C;  2NVY H;  3DEO A;  1VQP A;  2NVX H;  1ENF A;  4QIW E;  2FMM A;  1KLG D;  4RGM A;  1K0S A;  5K5P A;  1K83 H;  4QQB X;  3S24 A;  1HHV A;  1CKO A;  5C4X G;  3D31 A;  3K7A B;  4JCV E;  4KJN A;  4P73 A;  3PV0 A;  3AFQ A;  3MVV A;  1GUN A;  3S14 B;  1WCM H;  1SN8 A;  2LSS A;  4BY1 G;  3NSW A;  4C3I G;  1JR0 D;  4HIK A;  3ONA B;  2B2W A;  5EKK A;  1WTO A;  1HNZ L;  4OEM B;  5COR A;  3F2C A;  1D6E C;  1TS2 A;  3D4R A;  1CSQ A;  5ELN A;  4NW2 A;  4AYB B;  1AEX A;  1B53 A;  4G4K A;  1D8L A;  4C1N K;  4C3H G;  5HY6 A;  1PFB A;  3LNN A;  4BBS G;  1GUG A;  4O0A A;  3J7A 5;  1JWM D;  2K75 A;  2O2L D;  5JAV A;  3S1Q B;  3S2H B;  1BVS A;  4DAV A;  4HCE A;  4DV6 L;  4YCU A;  2B2V C;  5FO9 B;  1YI2 A;  5M3M G;  3ULJ A;  3K81 C;  4KHZ A;  1FYC A;  3HS0 C;  4PG3 A;  2ZXR A;  1EWC A;  3PIO 3;  1Y1W H;  1OXU A;  4I65 A;  1LTL A;  2EPB A;  2R7Z B;  2NN6 H;  2ZJQ A;  3ZYY X;  2IX3 A;  3AQQ A;  2F0Q A;  1ET6 A;  4LJZ C;  1BR9 A;  2JA7 B;  4A76 A;  3TP6 A;  4PV1 C;  2H1E A;  3S16 H;  2YYZ A;  1ZKO A;  2PQE A;  1A3U A;  3PO3 G;  1GHJ A;  5K36 G;  3K5L A;  4KHP Q;  1Z47 A;  1DYQ A;  2KEN A;  1STA A;  2HCI A;  3N6R A;  5G3L F;  4DNR B;  4JI6 L;  5DM6 3;  1HNW L;  1SDF A;  2Q2T A;  1HNX L;  3IFD A;  4YCW A;  1J8I A;  1I3Q H;  1SE8 A;  2MNA A;  1GVP A;  2EDG A;  1JE4 A;  5JEA H;  3SHL A;  3X3N A;  4UPA A;  5C5L A;  5LMN W;  1AN8 A;  4K2L A;  3GTO B;  3ZJY C;  4DKA C;  4DK6 C;  1D1K A;  4LF5 L;  1EIG A;  1G6Z A;  1CHP D;  5IP9 H;  2CH4 W;  1VQN A;  3GTL B;  5C0X I;  1I4R A;  1E2V A;  4LUV A;  1BO0 A;  1CFM A;  2KED A;  5C6A A;  2XVS A;  4DXG A;  5IYB G;  1EYC A;  3R2I A;  5CV9 A;  2YTX A;  2B2W C;  3TQY A;  1MJC A;  5CV7 A;  2WB1 E;  1IBM Q;  3I4M B;  1WJJ A;  2DY8 A;  4GS3 A;  1ET9 A;  1SE2 A;  3M7G A;  1MKH A;  2BE5 C;  1XTD A;  2OTL A;  3K7A H;  4A3G B;  3M3Y H;  4LMQ D;  2PI2 A;  4QMG A;  2UU9 L;  3HOZ B;  1HH2 P;  1MD2 D;  4MZ9 A;  3R2T A;  4IOA A;  2E76 C;  3OHX C;  4DV7 L;  4A3E G;  1J6Q A;  4MTK A;  4R4T A;  2JA6 B;  3K59 A;  2IL8 A;  2SDF A;  4GLX A;  4DPG A;  2B29 A;  3MA2 B;  3S2H H;  3KLW A;  1FJG Q;  2MO0 A;  1AW7 A;  3ERQ A;  4IFD I;  4POF A;  4EVO A;  5CC4 A;  4RG1 A;  1YNX A;  2M9V A;  1VQ7 A;  4A3D B;  2D5D A;  5ELF A;  4DR3 Q;  1KDB A;  2R7Z H;  1UAP A;  3I55 A;  3A5U A;  2D0P A;  3S15 B;  4H44 C;  1N33 Q;  1ENC A;  5JPN C;  2JA5 H;  1SYG A;  4GN5 A;  3S1N B;  2HDL A;  1I50 H;  1B7Y B;  1PMR A;  1YNN C;  4OGQ C;  3F2B A;  5L37 A;  4KKS A;  2NVT H;  4OXP A;  2F0O A;  1F9S A;  4CDF C;  2AUK A;  5IIF A;  4P74 A;  1IBK Q;  1N36 Q;  4KN7 C;  2O4X A;  3M4P A;  4JBW A;  2EJM A;  2SNS A;  3JC6 6;  3TN2 A;  3OMC A;  2BH8 A;  1SJH D;  3HOU G;  4WRD A;  1RJT A;  5M5W B;  4DUZ Q;  2Z8L A;  4ZLT F;  4NDX A;  4JI0 Q;  5EPJ A;  2C35 B;  2BH2 A;  5IGG A;  4CJ1 B;  5C44 G;  4A3L H;  1X9N A;  4B3T L;  2UUB Q;  2Z6B A;  2B8F A;  3DWP A;  4JI8 L;  3KF8 A;  3I2Z A;  2NWG A;  4PZ8 A;  1PYB A;  5A2Q L;  3GTO H;  1QVC A;  1MSG A;  3HKZ G;  5KEE A;  5E7N A;  2G9D A;  1QWY A;  3CMA A;  1N32 L;  2EVB A;  2JK8 A;  3GTL H;  1IL8 A;  1ENA A;  5FO8 B;  2PO4 A;  1S40 A;  1CTM A;  4H02 A;  4RKL A;  1FNV A;  1H9R A;  2AWO A;  5LMU Q;  3W1B A;  2F0E A;  1WTV A;  1VF5 C;  3CQZ B;  2XTI A;  4R8I A;  4FXG C;  4HED A;  3K8A A;  1KNA A;  3MXN B;  4XT1 B;  1HRJ A;  2R7D A;  5LMN L;  3I4M H;  4GOP C;  2A5H A;  2LY7 A;  3STB D;  3A74 A;  5CV8 A;  2R92 B;  4A3G H;  3J7Z C;  5HGT A;  4CJ0 B;  4BY7 B;  1D2B A;  1SNM A;  3HOZ H;  3GTK B;  2Y0S E;  2MQH A;  2VB2 X;  3CCQ A;  1GXD C;  5J22 A;  4U67 3;  3DM3 A;  4GNX A;  3HOY G;  2B8G A;  2PW5 A;  4JI2 L;  5ELD A;  4LF9 L;  2JA6 H;  4OO1 H;  4K6L A;  1WVL A;  4X62 Q;  2PQA B;  4P2C B;  5FJ8 G;  4JBM A;  3UI2 A;  5IT9 L;  4A93 B;  4IPD A;  4FNF A;  1A2T A;  4LK1 C;  1Q81 C;  3L2P A;  3MTS A;  5GAH C;  3K57 A;  3QO2 A;  1YJ9 A;  1NNX A;  3NEL A;  4A3D H;  2F0T A;  4HMJ A;  4U68 A;  3PIP 3;  3I4N B;  4N9P A;  1JT8 A;  1VMP A;  3J81 i;  1QE6 A;  1BUV T;  2OXP A;  3S15 H;  1G6P A;  1EY7 A;  5C3E B;  4JOI A;  4NPS A;  4XQQ A;  1IHZ A;  3FP9 A;  1VQH A;  2EYL A;  1OXS C;  3TP7 A;  3A55 A;  1Y1V G;  2C9O A;  4ZAI A;  3CPW A;  1WD1 A;  2VS1 A;  2YU9 B;  1E22 A;  4LFA L;  4B3M Q;  2VQF Q;  2A8V A;  1Q8K A;  5EBD A;  2F0N A;  2B63 G;  1PRT C;  2DJF C;  4OX9 L;  4TRD A;  1W6J A;  3E5S A;  4X3S A;  2HIV A;  1H9J A;  4A3F G;  3RD4 A;  1BBW A;  2FXQ A;  2F0H A;  5M5W H;  4GOP B;  1VF7 A;  1PLF A;  2MUY A;  5DNF A;  1TS3 A;  2H4O A;  3S1R H;  1E7Z A;  1F9P A;  1YJW A;  1LTI D;  2HDM A;  1EEF D;  1V9P A;  4B3R L;  1G2S A;  2LXK A;  1EOV A;  2E5L Q;  4IN3 A;  3A0J A;  4HTH A;  4C3J H;  1QVG A;  4K5X A;  2PNH A;  3P7J A;  1ML0 D;  1PTO C;  1NY4 A;  2NZH A;  4FF3 A;  5GAD C;  1S5F D;  3MHB A;  3MWY W;  1EYG A;  1TY2 A;  1B1Z A;  3KOJ A;  1IKL A;  5M5Y B;  4DV3 Q;  1PHJ A;  3I4N G;  4DR4 L;  3GTG B;  5JJK A;  3CQZ H;  3T1H L;  2DN8 A;  2KCM A;  1X3F A;  1DD2 A;  1VQ5 A;  1XNR Q;  1MJE A;  2K33 A;  2D9U A;  3HEJ A;  1H9K A;  2HHH Q;  1EZ6 A;  5IWA Q;  3KJO A;  4B08 A;  5CBE E;  2ATW A;  4FF1 A;  2WFW A;  4LUZ A;  1EYD A;  3ERO A;  3AU7 A;  4EQP A;  3NTH A;  4K5W A;  1D5Z C;  2R92 H;  1PH3 A;  1B2T A;  4QCL A;  4KKU A;  1HZB A;  1ILQ A;  4BY7 H;  3P20 A;  1Q86 C;  4DR1 L;  3GTK H;  4DR6 Q;  2RDG A;  1JOQ A;  2PI2 E;  1EY9 A;  1NMG A;  3KLS A;  1BXT A;  1QIL A;  3SR1 A;  1VQI A;  1X54 A;  2ICE C;  4UY8 C;  4BS9 A;  3U9S A;  2RSN A;  3CAM A;  5EPL A;  4BBR B;  4FF4 A;  2BOS A;  1N9W A;  1G29 1;  1RIP A;  2AQ1 B;  4YY3 Q;  3MEH A;  3C46 A;  1GM5 A;  4FVM A;  2AMC B;  5I2X A;  2L1B A;  3I4O A;  3AFP A;  5EBC A;  4DV0 Q;  4NXM L;  3IKJ A;  1T5X D;  3PMF A;  3HOW B;  3AEV A;  3E9H A;  2PMZ E;  3KBG A;  1QJO A;  2MPM A;  2VQE Q;  1A62 A;  3J80 c;  3OTO Q;  5C3E H;  1YZ6 A;  1TT2 A;  1PH1 A;  4L5T A;  2IW3 A;  4OWT B;  1RL2 A;  1L1O B;  3V96 A;  3S1M B;  4JV5 Q;  4NXN Q;  3W1G A;  4JYA L;  1TXY A;  2X6G A;  4G7Z C;  2YU9 H;  1JQY D;  2V4D A;  2OT2 A;  1V1P B;  1ROD A;  2BE5 D;  3D6W A;  4GN3 B;  2RDH A;  4MTN A;  2DUD A;  4IUQ A;  1CI3 M;  3KLS X;  5C0X G;  1O78 A;  3VYS A;  1PTO F;  2E75 C;  3Q23 A;  4QJF A;  1TWF H;  3OIQ A;  3HOX G;  3PO2 G;  1Q46 A;  5IYD H;  1VQA A;  1GOZ A;  1QZG A;  3TP8 A;  4JI1 L;  5ELO A;  4B9W A;  4JC0 A;  2UUA Q;  4A3J G;  2TMP A;  1XNQ Q;  2XNA C;  5DAU A;  2Q2U A;  2ZXP A;  4ME3 A;  2K05 A;  2IWH A;  1JOR A;  1IW7 C;  3JAM E;  3H3V C;  2UXB L;  2JP1 A;  3GQB A;  3WOE A;  1R9T B;  2N88 A;  2Z4I A;  2WAQ E;  2K32 A;  5KYL A;  3GO5 A;  5M5Y H;  2RA4 A;  2RHS B;  4GKJ Q;  4H7B A;  4A3K G;  1YNN D;  2IHF A;  3GTG H;  4QL5 A;  2KBN A;  3NXW A;  4CKC A;  2DJG C;  4X65 L;  4DV1 L;  3IRB A;  4K0K L;  4LF6 L;  3QG1 A;  4GN4 B;  3J81 j;  1CUK A;  1C4Q A;  1SMY C;  3A7L A;  4JG2 A;  4LFC L;  2WV6 D;  3BS1 A;  4JI4 L;  2PZT A;  5C0X J;  1HR0 L;  3UDI A;  3ER0 A;  1L0W A;  2N8N A;  3BVM A;  1OXX K;  1N34 Q;  2F0V A;  2NB0 A;  2HQL A;  4OIK A;  2OQ0 A;  4LF4 L;  5DEH A;  4EX5 A;  2KUM A;  5C4X B;  3FKI G;  5FOB B;  3NE5 B;  2R7F A;  1S72 A;  2KEC A;  3MC0 B;  4GKK Q;  5KNC A;  1S5E D;  4BY1 B;  1SNQ A;  4C3I B;  1PXU A;  4XQN A;  1FD7 D;  2QDL A;  3DHQ A;  4BBR H;  4JI7 L;  4IJH A;  5J39 A;  2ALY B;  5I6Y A;  2KCC A;  1TS5 A;  3G71 A;  5IGB A;  3K5N A;  4C3H B;  5JVH 3;  4BBS B;  1ONL A;  2FHT A;  1UEB A;  4F8M A;  2YV5 A;  3HOW H;  3NTI A;  1KRS A;  1O7Y A;  4IJL A;  4KN4 C;  3KF6 B;  3VDY A;  1G2T A;  2R6G A;  3MXP A;  4QF4 A;  3SEB A;  1Y14 B;  2GA4 B;  3H0G G;  5M3M B;  2ZM6 L;  1I94 Q;  4YCV A;  3PF5 A;  2QKI C;  3S1M H;  2MO1 A;  4J15 A;  4A3M H;  1PTO H;  3H15 A;  3GTJ B;  2E2H B;  1A6X A;  1QVF A;  4MHE A;  1U4M A;  4DR2 Q;  1G91 A;  2E74 C;  1WD0 A;  3P75 A;  5C5M A;  2VUM B;  3EQL C;  2M00 A;  3D8G A;  1KXL A;  4IUN A;  5JJZ A;  3NPP A;  4V19 0;  2F52 A;  1NBW A;  1PH2 A;  3A7A B;  3TBI B;  1RTN A;  4O42 A;  3C3L A;  3H91 A;  3KBX A;  3PO3 B;  5KRU A;  4FDB A;  1DCZ A;  3I8Z A;  4JBK A;  5LL6 S;  2QGQ A;  2WAC A;  3M9B A;  4QB4 A;  1VDZ A;  4UDU C;  5COY A;  2DNC A;  2YTY A;  1STB A;  4G57 A;  2EYH A;  4DV5 Q;  2P5Z X;  3BZC A;  3IL8 A;  2ID0 A;  3HP3 A;  1IBL Q;  1FNW A;  2BDO A;  3VYU A;  1HZC A;  1LTA D;  1BF4 A;  1Z7T A;  4ID6 A;  1R9T H;  4PMW A;  2Q2H A;  5FK9 C;  3RZO B;  4WJ3 M;  2IX0 A;  1BDO A;  3W3A A;  1YVC A;  1BCP C;  4LF7 L;  5IYC G;  1B9M A;  2O5J C;  1OO9 B;  5CV5 A;  4B9X A;  1CQV A;  3J81 L;  2K5Q A;  4ZUI A;  2XWJ B;  2N78 A;  4RGO S;  1EFI D;  4GLV B;  1VQF A;  1K0R A;  3K0X A;  3RZD B;  2V1C C;  2VZA A;  2EYJ A;  1PRT D;  4Y7N B;  1TWA H;  2PW7 A;  3VR6 A;  4HN7 A;  4DUY Q;  1D1I A;  4ULL A;  2CQO A;  4X64 Q;  1PH4 A;  3ND8 A;  2QW7 A;  4HMI A;  2VUM G;  2E2J B;  3J80 E;  1VQL A;  1IXR A;  2L55 A;  1F2Z A;  1MIU A;  4LF8 L;  1JJ2 A;  2F4V Q;  1XPO A;  2JE6 I;  3H09 A;  2CHB D;  2UXC L;  5C4X H;  1IYV A;  3VA5 A;  3MXN A;  4JI5 L;  2ZTE A;  4KD4 A;  1E1O A;  1E24 A;  4FP5 D;  4JI3 L;  4BY1 H;  1B8A A;  4C3I H;  5IGF A;  4UP7 A;  1EIY B;  3F2D A;  1TII D;  4DXF A;  1TWH B;  1PTO D;  4DNT B;  4HCS A;  4A3E B;  4IQZ A;  1K3R A;  4BBS H;  1UNS A;  3RMH A;  4X3T A;  1GUW A;  2VW9 A;  3Q8D A;  1FR3 A;  3SXH A;  4X3K A;  2SOB A;  4QGU A;  3CCE A;  2OWO A;  3CKI B;  4DR7 L;  1PH7 A;  2PQA A;  4F87 A;  4CDD C;  2F03 A;  4R1J A;  1HTL D;  3H3V H;  3MEF A;  1HFN A;  4NP5 A;  5KND A;  4KV6 A;  4AYB E;  4Q5V A;  2E2H H;  5C4J H;  2KEE A;  2A6H C;  1SE3 A;  1BCP B;  1KDC A;  3HZX A;  1SNP A;  3UE1 A;  5C4H A;  1FL0 A;  1K8G A;  1SYE A;  4DF7 A;  1HUM A;  2K52 A;  3HRZ C;  3PO3 H;  3AMU A;  5K36 H;  5IP7 G;  3S17 B;  1HFG A;  1NE3 A;  4LFB L;  3K5O A;  3HOU B;  2F0G A;  1PYS B;  3SK5 A;  4UP8 A;  2AQ3 B;  1HNZ Q;  2WB1 G;  1FGB D;  1QOH A;  3S14 H;  4IPH A;  5FLM G;  3CPF A;  3D3R A;  5C44 B;  5BN5 A;  1S5B D;  5T1G A;  2JA5 G;  4B3S Q;  3J7A V;  4R4I A;  4GOP A;  3RZO H;  4DV4 L;  4KHV A;  4IAL A;  3HKZ B;  1JC7 A;  3H6M A;  5D3I B;  4DV6 Q;  3PUZ A;  2BA1 A;  4UAI A;  4R4Q A;  5IOC A;  3S1Q H;  4J6H A;  1ZXT A;  3OWE B;  2CQA A;  5I6W A;  3EJI A;  1JCK B;  5M3F B;  3CCR A;  3ICE A;  3RZD H;  5I9P A;  5IYB H;  4LAA A;  1VQK A;  4Y7N H;  4UHV A;  4P75 A;  2L12 A;  4DU9 A;  4HJ8 A;  3C2P A;  3R93 A;  5ELC A;  3D6C A;  4XDX A;  4DK3 C;  2JA7 H;  1DON A;  1XMO L;  4RCO A;  1GUT A;  3WDN A;  3C1F A;  2ASB A;  5AJ3 L;  2J4X A;  1T5E A;  3QOJ A;  1X6O A;  5KYI A;  4I7A A;  1H9M A;  2XRQ D;  4WJW A;  1YJN A;  1IKM A;  4YHH L;  3BZD B;  2K04 A;  4JI6 Q;  2GVA A;  2NTS A;  1HNW Q;  1VQB A;  3E9I A;  4L6T B;  2JQO A;  1HNX Q;  2ZXO A;  1IW7 D;  3HOY B;  2KHS A;  1TWH H;  4A3E H;  3RN2 A;  5BR8 L;  1D7Q A;  4X66 L;  5EPK A;  1TS4 A;  2Z4H A;  2VB3 X;  2Y0S B;  2EXZ A;  4ILW A;  3NEM A;  1PZK D;  1XX8 A;  4RCN A;  2KCT A;  1CKM A;  2F0P A;  4LF5 Q;  1CQF A;  2CH4 A;  3CCL A;  3I56 A;  2XWB B;  1SMY D;  1E2Z A;  3A8K E;  4ZYS A;  2D0O A;  3Q22 A;  2KJX A;  4C56 C;  1F9R A;  1NTG A;  1HTP A;  5M3F G;  1NJI C;  4RKB A;  4R8N A;  4IUT A;  5GAG C;  1AZP A;  1Y1V B;  1TWG B;  3BZK A;  3TZD A;  4P72 A;  4PMB A;  1U4R A;  2UUC L;  1V1O A;  1OTC A;  1SYC A;  4CGY B;  3HG9 A;  4DR5 L;  5E1F A;  2B63 B;  1L1O A;  1E0B A;  1CM9 A;  3S17 H;  2R93 G;  1O7I A;  3NBH B;  1RCV D;  1AFP A;  1V1P A;  4A3F B;  1W6K A;  2UU9 Q;  2NN6 I;  1N8R C;  4AQY L;  2HIX A;  5CBA E;  4HSV A;  3QJY A;  1A63 A;  4O1N A;  4DV7 Q;  4KD3 A;  4KMU C;  4KTA A;  5C44 H;  5EKL A;  4H13 C;  2EYP A;  2KCN A;  2X69 A;  3CF5 A;  2FJ2 A;  2FMC A;  3JAM L;  4XQJ A;  2DY7 A;  4PNY A;  3TDQ A;  1JMC A;  4JPB W;  1LT6 D;  1WI5 A;  2Y0S G;  2K5N A;  1EIH A;  4NB3 A;  1YHA A;  1YEZ A;  1D5M C;  3J7Y W;  1NCV A;  5IT9 c;  1VQ6 A;  1CA6 A;  3PF4 A;  3GTP B;  1A8V A;  2G5D A;  4GLA C;  3ULP A;  3A54 A;  1LAB A;  1S5C D;  5IE8 A;  1WTH A;  2I07 B;  3GP7 A;  2ZJP A;  2TSS A;  3S1N H;  2RBM A;  4TQU S;  1X32 A;  1G8Z D;  1EZ8 A;  3GTM B;  4YWL A;  1NUC A;  3NBI A;  1HUN A;  2I46 A;  1KTK A;  1EQR A;  3B6Y A;  1JJG A;  4KKT A;  1UWV A;  2JEB I;  1PV4 A;  5A35 A;  5FLX L;  1QUQ B;  2AWN A;  4DAY B;  3SDZ A;  1BBU A;  3HOY H;  2WP8 J;  1UE1 A;  2NBF A;  1U0L A;  3CCV A;  1XTC D;  1UE5 A;  3S9W A;  4EQO A;  4XYQ A;  1AE3 A;  4DFA A;  4B3T Q;  1UE6 A;  5FJ8 H;  4HJA A;  3WOF A;  5JOB A;  3UE0 A;  3PGZ A;  4QUC A;  4JI8 Q;  4DAP A;  3U4Z A;  2K14 A;  1BCP D;  2E2D C;  3TS2 A;  1SXT A;  3J7A F;  1WTP A;  1N32 Q;  3O13 A;  1E2W A;  3K7U C;  4DV2 L;  1K3B C;  1L1O C;  3T51 B;  1XMQ L;  1HR0 W;  3U58 A;  1A15 A;  3QR8 A;  1I4H A;  3S2D B;  2PZU A;  1I5F A;  1JJC B;  1EOT A;  3K80 C;  2AQ2 B;  1Y1V H;  3OOC A;  3TZU A;  2CKZ B;  5LMN Q;  5J1Z A;  5T1I A;  3KF6 A;  2B39 A;  3ND9 A;  3F1Z A;  4RFB A;  4ZKB B;  1A0I A;  2F0D A;  1I4P A;  2PNR C;  1JB7 A;  5FKA C;  1KAW A;  1PFS A;  1XJV A;  1Q1E A;  1RD9 D;  1VCI A;  1EWH A;  3HOX B;  1CKN B;  4A3F H;  5JJI A;  3PO2 B;  2A74 C;  3NQT A;  2B2U C;  3I72 A;  1SMX A;  1LYL A;  1M90 C;  4BA1 I;  4JI2 Q;  1ZEQ X;  4A3J B;  4CBV A;  4LF9 Q;  4JK1 C;  3RLF A;  2JEA I;  1MGS A;  4G7O C;  2KHJ A;  4Z9C B;  1PZJ D;  5NUC A;  5IGE A;  2B3G A;  1YIJ A;  3E6Z X;  4A93 H;  2F0K A;  1MHW C;  3FVQ A;  3I73 A;  2A69 C;  2A6H D;  1UE7 A;  4ZQ3 A;  3AYH B;  1K73 C;  1J5E L;  1HPC A;  1LT4 D;  1PRT F;  2EJG C;  2BCO A;  4DK1 A;  4A3K B;  1NAP A;  4R4O A;  3I4N H;  4ODG A;  1AP0 A;  1PH5 A;  1XPU A;  3L0O A;  1DM0 B;  1JOO A;  3MZ5 A;  1FNU A;  2ES2 A;  4I7Z C;  4BXX G;  4CKE A;  2N49 A;  1KC8 C;  3KDF B;  4LFA Q;  4WOR A;  4BA2 I;  4EQ5 A;  3T16 A;  1LTT D;  4ZCK A;  4OX9 Q;  1EY5 A;  3L3O C;  4L5S A;  2K1B A;  1QZH A;  1QG7 A;  4YWM A;  5LHY 1;  3OPO A;  4A3C G;  1LT3 D;  1ILP A;  1CZW A;  4HJ7 A;  5E3F A;  3FKI B;  3VR4 A;  3BDL A;  5IY0 A;  2EY6 A;  4B3R Q;  4IUV A;  4TVA B;  1QCB D;  4PQX A;  4A3I G;  2B2Y C;  4IOC A;  1YNJ C;  5ELB A;  4IPG A;  2Z0S A;  2WKD A;  1ICF B;  2EQS A;  4XXE A;  3KK7 A;  5D14 A;  1Q3L A;  3T1Y L;  1Z9F A;  2NVY B;  5JJL A;  1R4P B;  3UDF A;  2F0S A;  2PYK A;  2EY2 A;  3H0G B;  4OWW B;  3QWN A;  2I0Q A;  2HT1 A;  3S2D H;  4OO1 I;  2MHV A;  4DR4 Q;  1K83 B;  1PYW D;  3T1H Q;  3M4Y A;  3E3X A;  3DXJ C;  2IHE A;  1G51 A;  3MXU A;  2JA8 G;  1E1T A;  1Y69 U;  2O5I C;  1I4X A;  1F2L A;  1I4G A;  4F7X A;  2K50 A;  4K2K A;  3EN2 A;  3FEW X;  1LT5 D;  3HFZ B;  3OWF A; 
#chains in the Genus database with same CATH homology
 2QDB A;  4ZRZ A;  2EYO A;  3NTK A;  1H9S B;  2EY1 A;  5C0X H;  5IT9 E;  1K8O A;  4IFD G;  3NWS A;  4NKL A;  2K5W A;  2XIW A;  5JVG 3;  1B3A A;  4RGT A;  1DZ1 A;  1II3 A;  5EJW A;  1BNZ A;  1QNU A;  1PFN A;  5I9O A;  1STN A;  1M8A A;  1KLU D;  2MGS A;  4OL7 A;  5E4X A;  3GTQ B;  1EU4 A;  4K8I A;  3A8I E;  2Q8T A;  4KY7 A;  4QIW B;  1RF2 D;  2LFN A;  1HQM C;  5TSS A;  3PUW A;  1HXY D;  4KY6 A;  3TP5 A;  3BYT B;  3I3C A;  4DA2 A;  1TVX A;  4IFD J;  3LWE A;  4RWS C;  3SK4 A;  2K5D A;  3L9A X;  4Q0F A;  1OXV A;  4DN4 M;  3DM1 A;  4N9T A;  1SNC A;  5HUR A;  3VYT A;  5D65 A;  2R3Z A;  2AUJ D;  2EYM A;  3PUV A;  1Q12 A;  5BN3 A;  1Q90 A;  4L63 B;  1LO5 D;  4MIU A;  3NQI A;  2KA7 A;  4G7H C;  2M2L A;  3BVZ A;  3BYY B;  4GZY C;  1KNE A;  2XRS D;  3CRK C;  3EFX D;  2NN6 G;  1LTG D;  3BDO A;  4WFN 3;  2EOT A;  3FDT A;  1JWS D;  3TME A;  1I4Q A;  3GD7 A;  4ZKC B;  1MSH A;  2JYO A;  3M3Y B;  1PDQ A;  1SE4 A;  4RGN A;  3G6J B;  3EVQ A;  3OIP A;  2B2T C;  4KY5 A;  3Q6S A;  1UEA B;  1Y8N B;  4TKO B;  1CK1 A;  5I4D A;  2K28 A;  2F3W A;  1V43 A;  5JEA G;  2F1M A;  1X3Q A;  3V05 A;  3MFG A;  2F0M A;  1GJX A;  2NZ1 D;  5C3X A;  1NR4 A;  2WB1 B;  3U9O A;  5ELE A;  2LS0 1;  5CV4 A;  4CHT B;  1SEB D;  2ENB A;  2F0L A;  3FPU B;  2NVQ B;  3NBH A;  2K6A A;  2JA5 B;  5IOD A;  3RUZ A;  1I50 B;  3E0J A;  1CHQ D;  1X3P A;  3Q24 A;  2NVT B;  4KJO A;  2F0F A;  3FPP A;  3CHB D;  2MP1 A;  4K8J A;  2CW0 C;  2DNE A;  1JWU D;  1SJE D;  4M8A A;  1C8C A;  1STE A;  3K5M A;  3K0Y A;  3NWT A;  1GHK A;  2R61 A;  5DM7 3;  4ME5 A;  1SSO A;  2PPB C;  3C1E A;  2F0W A;  4NMZ A;  2SNM A;  4XYO A;  1Y8P B;  2KOL A;  2IX1 A;  5JEA J;  2RSO A;  1VMC A;  1LLR D;  1O80 A;  4FO2 A;  4E6I A;  1BCP F;  2QIL A;  2L11 A;  3SE0 A;  3NUC A;  1DOM A;  1TU2 B;  2F0J A;  2F0I A;  5C3W A;  5BN4 A;  1ZYR D;  1SYD A;  2L9H A;  2A69 D;  3H94 A;  1Q8I A;  3SK6 A;  2KVM A;  1DOK A;  1U4P A;  5D3D A;  5JPM C;  3VYR A;  3CRL C;  4DAY A;  1EQT A;  4BWG B;  1O7Z A;  1CT1 D;  3QOL A;  5LL6 X;  2PCF B;  2NYZ D;  4PMC A;  1F2Y A;  1F77 A;  1DOL A;  2EE1 A;  1EQV A;  3D4W A;  1A3T A;  2K01 A;  2X6L A;  1XYI A;  4CKB A;  2MJ8 A;  4OIJ A;  3SVM A;  3IFT A;  1DJR D;  4YIJ A;  2Q8R E;  2A6E C;  3OMG A;  3DWQ A;  2OF1 A;  3D4D A;  2KQ3 A;  3W2D A;  3I70 A;  2R93 B;  4EQN A;  3MAQ A;  2LMC B;  4F88 A;  1YNJ D;  4EGV A;  1RDP D;  3FMC A;  3K58 A;  1R4Q B;  1PZI D;  2EYF A;  1JOK A;  4QUF A;  2XN9 C;  4R9W A;  1EY8 A;  4XT3 B;  3BG3 A;  2CVR A;  4XIG S;  2IT1 A;  3M4O B;  1U4L A;  5ISR A;  1B50 A;  2Q8I B;  1K8M A;  4HR7 B;  1I6V C;  3GV3 A;  1AZQ A;  5IGC A;  3BDC A;  4KI0 A;  2NTT A;  4J8Q A;  2XSC A;  3NP8 A;  1MI2 A;  3S1R B;  1LTS D;  2A73 B;  1XXG A;  5FO7 B;  3MXG A;  5E4W C;  4OO1 G;  1LV9 A;  1S4Z A;  1TWC B;  4C3J B;  1M4V A;  4ZUJ A;  1WTW A;  2A68 C;  2D2C C;  1LAC A;  4FXK C;  4RH6 A;  1NR2 A;  3LX0 A;  2C5C A;  3AB9 A;  3J81 E;  4XTC S;  1HQR D;  2F4I A;  3R3O A;  1EY0 A;  1XWE A;  1D5X C;  3F2U A;  1JIC A;  3A56 A;  2FFK B;  3T4A C;  1B4O A;  2L0C A;  1A3V A;  2J0T D;  3PUX A;  3VR5 A;  2RQX A;  3L7Z C;  1CZG A;  2FIN B;  2HQE A;  1Y8O B;  2B2U A;  1KAA A;  1BQQ T;  1SBB B;  2QEJ C;  2WKC A;  3N52 A;  4HAE A;  1JB3 A;  2E2I B;  1OXT A;  5KIX A;  3HGB A;  3EA6 A;  1SFO B;  5G3L D;  1SYB A;  1HA6 A;  1SND A;  2K03 A;  1STY A;  4C3J G;  1J9O A;  3NK9 A;  1H9S A;  5F2D A;  2J7Z A;  2WIN B;  1ESF A;  1C48 A;  2BA0 A;  4RHR A;  3VA7 A;  4C2M B;  2JSO A;  2HUG A;  2HCC A;  1KDA A;  3MFY A;  4S3S A;  4IUR A;  2Z1C A;  3KLR A;  1TWF B;  3I4L A;  3DMU A;  1ICW A;  1UUP A;  3NHH A;  3M85 A;  1RTO A;  1STG A;  4ZK9 B;  3DEP A;  2B2Y A;  3G7L A;  4RA8 A;  1I6H B;  2PMZ B;  1EYA A;  4KK7 A;  1SYF A;  1S5D D;  4J1M A;  1EY4 A;  5EGT A;  1TKW B;  3A8J E;  3Q0A A;  1O7L A;  1L0X B;  5M9O A;  5EKI A;  2QCP X;  5C4Z A;  1Q1B A;  1B44 D;  1MBY A;  4FYD A;  1U9R A;  4A3I B;  1EU3 A;  2CW0 D;  1ESR A;  2PZW A;  2RVL A;  1GUO A;  3OSO A;  2VXW A;  1WTQ A;  1ZYR C;  1NSN S;  3OW7 A;  4DGZ A;  4IZ8 A;  1STH A;  4OHJ A;  3LWU A;  4H0L C;  2OEO A;  2NUC A;  2JA8 B;  2F0U A;  2QF7 A;  1PRT B;  2G9H D;  5EQ0 A;  1RKN A;  1WTX A;  1SAP A;  1EEI D;  2WAQ B;  1RHP A;  3CU7 A;  3ITP A;  3SK8 A;  3J80 L;  4IUU A;  4ABN A;  4A3B B;  2IJ0 A;  1LTR D;  5A2Q E;  1EY6 A;  4K14 A;  5M5X B;  4IUP A;  3X3M A;  3VR2 A;  1IYU A;  4A3M B;  1PTO B;  3HOV B;  2LKV A;  2IPK D;  1GUS A;  5CR3 A;  2K7V A;  1HCZ A;  1DXM A;  2VNU D;  3KUP A;  1V8Q A;  3T13 A;  2ZT9 C;  2NVX B;  5CGK A;  4FF2 A;  2A6E D;  3FRP B;  2EJF C;  1LTB D;  1WCM B;  3DUZ A;  1WTR A;  1TR5 A;  1QNK A;  2L4N A;  3TSS A;  4RHS A;  3IAY A;  5KNB A;  3URY A;  1QB5 D;  4M1U B;  1F9Q A;  1PFM A;  3GV6 A;  4HSP A;  4L8J A;  2D62 A;  1EL0 A;  3T56 B;  2B2T A;  1TWA B;  2BDN A;  1F2M A;  1Y1W B;  1Z6H A;  5IGD A;  4DK0 A;  3PUY A;  1BBX C;  5CYU A;  1CA5 A;  3I90 A;  4CJ2 C;  5KGU A;  2B2V A;  3S16 B;  4V0B A;  5FLX E;  1L0Y B;  2F3V A;  5CMD A;  3QIA A;  1BOS A;  3QB3 A;  1KAB A;  1TY0 A;  2EY5 A;  3BVG A;  2L5T A;  3P1H A;  3DWA A;  2JXM B;  2A68 D;  4K6D A;  4TSS A;  2ICI A;  4X3U A;  4IFD H;  4K5V A;  4FXD A;  3R8B A;  3M7N A;  1A2U A;  1I3Q B;  2RKS A;  2N55 A;  3K6O A;  3T53 B;  1HA5 A;  2RDF A;  1B9N A;  1SNO A;  4C1N I;  4RAU C;  3VR3 A;  3V2T A;  2SEB D;  5C4J B;  3I91 A;  5I2Y A;  5AFW A;  4MN3 A;  1TQO A;  2EZV A;  5CV6 A;  2WII B;  3DEO A;  1ENF A;  2FMM A;  1KLG D;  4RGM A;  5K5P A;  1HHV A;  3D31 A;  3K7A B;  4KJN A;  3PV0 A;  3MVV A;  1GUN A;  3S14 B;  3NSW A;  4C3I G;  1JR0 D;  3ONA B;  2B2W A;  5EKK A;  1WTO A;  5COR A;  1D6E C;  1TS2 A;  3D4R A;  4NW2 A;  4AYB B;  1AEX A;  1B53 A;  4G4K A;  4C1N K;  4C3H G;  1PFB A;  3LNN A;  1GUG A;  1JWM D;  2O2L D;  5JAV A;  3S1Q B;  3S2H B;  4DAV A;  4HCE A;  2B2V C;  5FO9 B;  4KHZ A;  1FYC A;  3HS0 C;  2ZXR A;  1EWC A;  3PIO 3;  1OXU A;  4I65 A;  2EPB A;  2R7Z B;  2NN6 H;  3ZYY X;  2IX3 A;  2F0Q A;  1ET6 A;  4LJZ C;  1BR9 A;  2JA7 B;  3TP6 A;  4PV1 C;  2H1E A;  2YYZ A;  1ZKO A;  2PQE A;  1A3U A;  1GHJ A;  5K36 G;  3K5L A;  1Z47 A;  1DYQ A;  1STA A;  2HCI A;  3N6R A;  5G3L F;  4DNR B;  5DM6 3;  1SDF A;  3IFD A;  1J8I A;  2EDG A;  1JE4 A;  5JEA H;  3SHL A;  3X3N A;  5C5L A;  1AN8 A;  4K2L A;  3GTO B;  1D1K A;  1EIG A;  1G6Z A;  1CHP D;  3GTL B;  5C0X I;  1I4R A;  1E2V A;  1BO0 A;  1CFM A;  2KED A;  5C6A A;  2XVS A;  4DXG A;  1EYC A;  3R2I A;  5CV9 A;  2B2W C;  5CV7 A;  3I4M B;  2DY8 A;  1ET9 A;  1SE2 A;  3M7G A;  2BE5 C;  4A3G B;  4LMQ D;  4QMG A;  3HOZ B;  1MD2 D;  3R2T A;  2E76 C;  3OHX C;  2JA6 B;  3K59 A;  2IL8 A;  2SDF A;  3MA2 B;  1AW7 A;  3ERQ A;  4IFD I;  4EVO A;  5CC4 A;  2M9V A;  4A3D B;  2D5D A;  5ELF A;  1KDB A;  1UAP A;  3S15 B;  4H44 C;  1ENC A;  5JPN C;  1SYG A;  3S1N B;  2HDL A;  1PMR A;  1YNN C;  4OGQ C;  4KKS A;  2F0O A;  1F9S A;  2AUK A;  5IIF A;  4KN7 C;  2O4X A;  4JBW A;  2EJM A;  2SNS A;  3TN2 A;  3OMC A;  1SJH D;  4WRD A;  1RJT A;  5M5W B;  2Z8L A;  4ZLT F;  4NDX A;  5EPJ A;  5IGG A;  4CJ1 B;  2B8F A;  3DWP A;  3KF8 A;  2NWG A;  5A2Q L;  1MSG A;  5KEE A;  2G9D A;  1QWY A;  2EVB A;  1IL8 A;  1ENA A;  5FO8 B;  2PO4 A;  1CTM A;  4RKL A;  1FNV A;  1H9R A;  2AWO A;  2F0E A;  1WTV A;  1VF5 C;  3CQZ B;  4R8I A;  4FXG C;  4HED A;  1KNA A;  4XT1 B;  1HRJ A;  2A5H A;  2LY7 A;  5CV8 A;  2R92 B;  5HGT A;  4CJ0 B;  4BY7 B;  1D2B A;  1SNM A;  3GTK B;  2VB2 X;  1GXD C;  5J22 A;  4U67 3;  2B8G A;  2PW5 A;  5ELD A;  4OO1 H;  4K6L A;  1WVL A;  4P2C B;  3UI2 A;  5IT9 L;  4A93 B;  4FNF A;  1A2T A;  4LK1 C;  3MTS A;  3K57 A;  3QO2 A;  2F0T A;  4HMJ A;  4U68 A;  3PIP 3;  3I4N B;  4N9P A;  1VMP A;  1QE6 A;  1BUV T;  2OXP A;  1EY7 A;  5C3E B;  4XQQ A;  1IHZ A;  2EYL A;  1OXS C;  3TP7 A;  3A55 A;  2C9O A;  4ZAI A;  1WD1 A;  2YU9 B;  5EBD A;  2F0N A;  1PRT C;  4TRD A;  1W6J A;  3E5S A;  4X3S A;  1H9J A;  3RD4 A;  2F0H A;  1VF7 A;  1PLF A;  2MUY A;  5DNF A;  1TS3 A;  2H4O A;  1F9P A;  1LTI D;  2HDM A;  1EEF D;  1G2S A;  4IN3 A;  4HTH A;  4K5X A;  3P7J A;  1ML0 D;  1PTO C;  4FF3 A;  1S5F D;  3MHB A;  3MWY W;  1TY2 A;  1B1Z A;  1IKL A;  5M5Y B;  3GTG B;  2DN8 A;  1DD2 A;  2K33 A;  2D9U A;  3HEJ A;  1H9K A;  1EZ6 A;  4B08 A;  5CBE E;  4FF1 A;  1EYD A;  3ERO A;  3AU7 A;  4EQP A;  3NTH A;  4K5W A;  1D5Z C;  1B2T A;  4QCL A;  4KKU A;  1ILQ A;  3P20 A;  2RDG A;  1JOQ A;  1EY9 A;  3KLS A;  1BXT A;  1QIL A;  3SR1 A;  2ICE C;  4BS9 A;  3U9S A;  2RSN A;  5EPL A;  4BBR B;  4FF4 A;  2BOS A;  1G29 1;  2AQ1 B;  3MEH A;  3C46 A;  4FVM A;  5I2X A;  2L1B A;  5EBC A;  3IKJ A;  1T5X D;  3PMF A;  3HOW B;  3KBG A;  1QJO A;  2MPM A;  1TT2 A;  2IW3 A;  3V96 A;  3S1M B;  2X6G A;  4G7Z C;  1JQY D;  2V4D A;  2OT2 A;  1V1P B;  1ROD A;  2BE5 D;  3D6W A;  2RDH A;  4IUQ A;  1CI3 M;  3KLS X;  5C0X G;  1O78 A;  3VYS A;  1PTO F;  2E75 C;  3Q23 A;  3OIQ A;  1GOZ A;  3TP8 A;  4B9W A;  2TMP A;  2XNA C;  5DAU A;  2ZXP A;  2K05 A;  2IWH A;  1JOR A;  1IW7 C;  3JAM E;  3H3V C;  2JP1 A;  3GQB A;  3WOE A;  1R9T B;  2N88 A;  2Z4I A;  2K32 A;  5KYL A;  3GO5 A;  2RA4 A;  4H7B A;  1YNN D;  3NXW A;  4CKC A;  3QG1 A;  1C4Q A;  1SMY C;  3A7L A;  3BS1 A;  2WV6 D;  2PZT A;  5C0X J;  3BVM A;  1OXX K;  2F0V A;  2NB0 A;  4OIK A;  5DEH A;  2KUM A;  5C4X B;  5FOB B;  3NE5 B;  2KEC A;  3MC0 B;  5KNC A;  1S5E D;  4BY1 B;  1SNQ A;  4C3I B;  1PXU A;  4XQN A;  1FD7 D;  3DHQ A;  5J39 A;  5I6Y A;  2KCC A;  1TS5 A;  5IGB A;  3K5N A;  4C3H B;  5JVH 3;  4BBS B;  1ONL A;  2FHT A;  4F8M A;  3NTI A;  1O7Y A;  4KN4 C;  1G2T A;  2R6G A;  3MXP A;  4QF4 A;  3SEB A;  2GA4 B;  5M3M B;  2QKI C;  1PTO H;  3GTJ B;  2E2H B;  1A6X A;  4MHE A;  1U4M A;  1G91 A;  2E74 C;  1WD0 A;  3P75 A;  5C5M A;  2VUM B;  3EQL C;  2M00 A;  3D8G A;  4IUN A;  5JJZ A;  3NPP A;  4V19 0;  3A7A B;  3TBI B;  1RTN A;  4O42 A;  3C3L A;  3H91 A;  3KBX A;  3PO3 B;  5KRU A;  1DCZ A;  3I8Z A;  5LL6 S;  2WAC A;  4QB4 A;  1VDZ A;  4UDU C;  5COY A;  2DNC A;  1STB A;  4G57 A;  2EYH A;  3IL8 A;  2ID0 A;  3HP3 A;  1FNW A;  2BDO A;  3VYU A;  1LTA D;  1BF4 A;  1Z7T A;  4ID6 A;  4PMW A;  5FK9 C;  3RZO B;  2IX0 A;  1BDO A;  3W3A A;  1BCP C;  1B9M A;  2O5J C;  1OO9 B;  5CV5 A;  4B9X A;  1CQV A;  3J81 L;  2K5Q A;  4ZUI A;  2XWJ B;  4RGO S;  1EFI D;  3RZD B;  1PRT D;  4Y7N B;  2PW7 A;  3VR6 A;  4HN7 A;  1D1I A;  4ULL A;  3ND8 A;  4HMI A;  2E2J B;  3J80 E;  2L55 A;  1F2Z A;  2JE6 I;  3H09 A;  2CHB D;  1IYV A;  3VA5 A;  3MXN A;  4KD4 A;  4FP5 D;  5IGF A;  1TII D;  4DXF A;  1TWH B;  1PTO D;  4DNT B;  4HCS A;  4A3E B;  4IQZ A;  1UNS A;  3RMH A;  4X3T A;  1GUW A;  1FR3 A;  3SXH A;  4X3K A;  2SOB A;  3CKI B;  4F87 A;  2F03 A;  1HTL D;  1HFN A;  4NP5 A;  5KND A;  4KV6 A;  4Q5V A;  2KEE A;  2A6H C;  1SE3 A;  1BCP B;  1KDC A;  3HZX A;  1SNP A;  5C4H A;  1SYE A;  4DF7 A;  1HUM A;  3HRZ C;  3AMU A;  5K36 H;  3S17 B;  1HFG A;  3K5O A;  3HOU B;  2F0G A;  3SK5 A;  2AQ3 B;  1FGB D;  1QOH A;  3D3R A;  5C44 B;  5BN5 A;  1S5B D;  5T1G A;  3J7A V;  4KHV A;  4IAL A;  3HKZ B;  1JC7 A;  3H6M A;  5D3I B;  3PUZ A;  2BA1 A;  4UAI A;  5IOC A;  4J6H A;  1ZXT A;  3OWE B;  2CQA A;  5I6W A;  3EJI A;  1JCK B;  5M3F B;  5I9P A;  4LAA A;  2L12 A;  4DU9 A;  3C2P A;  3R93 A;  5ELC A;  3D6C A;  4XDX A;  1DON A;  4RCO A;  1GUT A;  3WDN A;  3C1F A;  2J4X A;  1T5E A;  3QOJ A;  5KYI A;  1H9M A;  2XRQ D;  4WJW A;  1IKM A;  3BZD B;  2K04 A;  2NTS A;  4L6T B;  2ZXO A;  1IW7 D;  3HOY B;  2KHS A;  5EPK A;  1TS4 A;  2Z4H A;  2VB3 X;  2Y0S B;  2EXZ A;  4ILW A;  1PZK D;  1XX8 A;  4RCN A;  2F0P A;  1CQF A;  2XWB B;  1SMY D;  1E2Z A;  3A8K E;  4ZYS A;  3Q22 A;  2KJX A;  4C56 C;  1F9R A;  1HTP A;  4RKB A;  4R8N A;  4IUT A;  1AZP A;  1Y1V B;  1TWG B;  3TZD A;  4PMB A;  1U4R A;  1V1O A;  1SYC A;  4CGY B;  3HG9 A;  2B63 B;  5E1F A;  1E0B A;  1CM9 A;  1RCV D;  1AFP A;  1V1P A;  4A3F B;  1W6K A;  2NN6 I;  5CBA E;  4HSV A;  3QJY A;  4O1N A;  4KD3 A;  4KMU C;  4KTA A;  5EKL A;  4H13 C;  2EYP A;  2KCN A;  2X69 A;  2FJ2 A;  2FMC A;  3JAM L;  4XQJ A;  2DY7 A;  3TDQ A;  4PNY A;  1LT6 D;  1EIH A;  1D5M C;  3J7Y W;  1NCV A;  1CA6 A;  3GTP B;  3A54 A;  1LAB A;  1S5C D;  2I07 B;  3GP7 A;  2TSS A;  2RBM A;  4TQU S;  1X32 A;  1G8Z D;  1EZ8 A;  3GTM B;  1NUC A;  3NBI A;  1HUN A;  2I46 A;  1KTK A;  4KKT A;  2JEB I;  5A35 A;  5FLX L;  2AWN A;  3SDZ A;  2WP8 J;  2NBF A;  1XTC D;  3S9W A;  4EQO A;  4XYQ A;  4DFA A;  3WOF A;  5JOB A;  4QUC A;  4DAP A;  1BCP D;  2E2D C;  1SXT A;  3J7A F;  1WTP A;  3O13 A;  1E2W A;  3T51 B;  1A15 A;  1I4H A;  3S2D B;  2PZU A;  1EOT A;  2AQ2 B;  3OOC A;  3TZU A;  5J1Z A;  5T1I A;  2B39 A;  3ND9 A;  4RFB A;  4ZKB B;  2F0D A;  1I4P A;  2PNR C;  5FKA C;  1Q1E A;  1RD9 D;  1VCI A;  1EWH A;  3HOX B;  3PO2 B;  2A74 C;  3NQT A;  2B2U C;  3I72 A;  4BA1 I;  1ZEQ X;  4A3J B;  4CBV A;  4JK1 C;  3RLF A;  2JEA I;  1MGS A;  4G7O C;  4Z9C B;  1PZJ D;  5NUC A;  5IGE A;  3E6Z X;  2F0K A;  3FVQ A;  3I73 A;  2A69 C;  2A6H D;  4ZQ3 A;  1HPC A;  1LT4 D;  1PRT F;  2EJG C;  2BCO A;  4DK1 A;  4A3K B;  1NAP A;  4ODG A;  1AP0 A;  1DM0 B;  1JOO A;  3MZ5 A;  1FNU A;  4I7Z C;  4CKE A;  4WOR A;  4BA2 I;  3T16 A;  1LTT D;  1EY5 A;  3L3O C;  2K1B A;  1QG7 A;  5LHY 1;  3OPO A;  1LT3 D;  1ILP A;  1CZW A;  5E3F A;  3FKI B;  3VR4 A;  3BDL A;  2EY6 A;  4IUV A;  1QCB D;  4PQX A;  2B2Y C;  1YNJ C;  5ELB A;  2WKD A;  4XXE A;  3KK7 A;  5D14 A;  1Q3L A;  2NVY B;  1R4P B;  2F0S A;  2PYK A;  2EY2 A;  3H0G B;  3QWN A;  4OO1 I;  2MHV A;  1K83 B;  1PYW D;  3M4Y A;  3DXJ C;  3MXU A;  1Y69 U;  2O5I C;  1I4X A;  1F2L A;  1I4G A;  4F7X A;  4K2K A;  2EYJ A;  3FEW X;  1LT5 D;  3OWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...