1D1KA

Mutated shiga-like toxin b subunit (d17e/w34a) complexed with receptor gb3 analogue
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
b'TPDCVTGKVEYTKYNDEDTFTVKVGDKELFTNRANLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SHIGA-LIKE TOXIN I SUBUNIT B
publication title Mutated Shiga-like toxin B subunit (D17E/W34A) complexed with receptor Gb3 analogue
rcsb
source organism Phage h30
molecule tags Toxin
total genus 16
structure length 69
sequence length 69
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 1999-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d1kA00
1DM0B 2GA4B 1BOSA 1R4QB 1D1KA 1QNUA 3MXGA 1C4QA 2BOSA 1CQFA 4M1UB 1D1IA 4ULLA 2C5CA 4P2CB 1R4PB 1CZGA 1QOHA 1C48A 1CZWA 2XSCA
chains in the Genus database with same CATH superfamily
2KCMA 2EE1A 4DNTB 4JI4Q 2B63B 1XMOL 3S16B 4JBWA 3B6YA 4A3KG 5I6YA 1OTCA 1BCPD 1ILPA 4A3JH 3D0FA 1U5KA 3I3CA 4IPDA 4S3SA 4CKCA 4DV7L 4EVOA 3S1NB 2V1CC 4BY7B 3EBEA 1STHA 3D8GA 4RH6A 1IXRA 1G291 1JC7A 1VQMA 3J7A5 2EY2A 3BZDB 3G7LA 3K7AB 3MWYW 2R7ZH 1AP0A 4B3RQ 5TSSA 1L1OA 3OWEB 1ASYA 1JJGA 1AFPA 4R4QA 1II3A 1S5FD 4OONA 1WCMH 4B3SQ 4Q0FA 3G71A 5FOBB 5J22A 1WTVA 1BBUA 1I50B 4RFBA 4DNIA 2K32A 2F0UA 4JI6L 1D8LA 3BVGA 3CC4A 5HY6A 1JE4A 1FD7D 1JR0D 3I4OA 1PH7A 4YWMA 1DOKA 2C35B 3T1HL 2L5TA 2WKCA 1P16A 3PIO3 1TWFB 4OGQC 2A69D 2JP1A 3D4DA 2NTSA 4YIJA 5AJ3Q 3J81c 4Z9CB 5LL6S 3X3NA 3NUCA 4N9PA 5C3EH 2F0TA 2A6EC 3M4OB 3GV6A 5BN3A 4JBJA 1SNOA 4WJWA 4FYDA 4K2KA 1EY6A 1O7YA 2PNHA 4DV5L 3CKIB 3CPFA 4X64Q 1PTOC 3QO2A 1JWSD 3MAQA 3QWNA 1IYUA 1WOCA 5M3FB 3WWVA 3RLOA 1A63A 1B9MA 2B2YA 1OXTA 1Y8NB 4C3JB 4G7ZC 1F2LA 4PZ6A 1L0XB 2J0TD 1EIYB 1V1PA 3RD4A 5FJ8H 4JC0A 1A8VA 5IGCA 2ZJPA 4L5QA 3TEHB 4H0LC 1VQIA 3EJIA 2WAQB 3OIPA 1G2SA 5EPJA 2MJ8A 3MFYA 3I4LA 4IUNA 1KLUD 4HSPA 1M8AA 3DXJC 4PMWA 2P5ZX 1EWHA 4J8QA 1BCPB 2Q2UA 2JEAI 3NQTA 2IX3A 3NTKA 3UI2A 2R92H 2ZXOA 4CDCC 5M3MH 4C2MB 1TWCB 2KEEA 2MQHA 1B44D 1D7QA 4HJ7A 4J6HA 2KECA 1K3RA 2JEBI 3W1GA 3GD7A 2E5LL 4IFDG 1NUCA 2NZHA 3SEBA 4BXXH 3CRLC 4A93G 3TP5A 3ZYYX 4TSSA 1VQJA 3CQZB 1MD2D 1JT8A 1XTDA 3C1FA 1GUTA 3PF5A 4KHPL 1O78A 3KK7A 2MGSA 1WTWA 3K81C 2GVAA 2MHVA 4A3IB 3HS0C 3AMUA 4A3BH 5T1GA 3SK8A 4DUYQ 4ME3A 4DK3C 3J7AV 3AYHB 2QDBA 4PNYA 3HKZG 1Q81C 4FO2A 1HQMC 4DV3Q 2FMMA 5HGQA 1HNWL 3H6MA 3NBHB 3TSSA 5M9OA 4GOPB 3HOVG 2R7FA 5FKAC 5DM63 3FKIH 5IP7H 4JYAL 1X3QA 2K28A 1JORA 2XGTA 2AUJD 4KV6A 4A3LH 4EQ5A 2Q2HA 5C44B 1STAA 3RZOH 1GUWA 2VB3X 1PRTF 2L11A 2F0NA 2L12A 1VF7A 4NXML 4R4IA 3K5MA 1EWCA 3P7JA 1CHQD 2DGYA 3GTQB 2WP8J 4OWXB 2K5DA 1TWAH 2K03A 1X3EA 4A3MH 4IPGA 2R7ZB 2N88A 2K14A 1JB7A 1G91A 4HCSA 3E6ZX 3I91A 3NK9A 5GAGC 5JJIA 4ILWA 4R4TA 1MJEA 2FINB 1SEBD 2F4IA 5C4XH 4GOPA 1WCMB 1HA6A 2EYLA 4OWTB 1F9PA 3KLSA 3HOWG 3QG1A 4YCUA 4BBSB 1W6JA 2Q2IA 2K1BA 2QGQA 1S5DD 2KOLA 4LJZC 2CW0C 2B2UC 1PTOD 1STBA 3FDTA 3UDXA 4LFCL 3GTPB 3KDFA 2XVSA 4EX5A 1IBKQ 1XPUA 1B2TA 1DYQA 3GTJH 2K4KA 4CDDC 3H3VC 3PIPA 4AQYL 1N32L 2A68C 3HKSA 5IGDA 2H1EA 3OIQA 4KJOA 1DCZA 1V1QA 2EYMA 4GN5A 5DM73 4JW0A 1TVXA 4XTCS 2JA8G 1ASZA 1SXTA 2PMZE 1PZID 1X3PA 1KDBA 2NYZD 4PQXA 1PV4A 5GAHC 1FNVA 1Q1BA 1DOLA 1JQYD 3E0JA 4KJNA 2NVXB 5CMDA 4A3EB 4IO9A 1EIFA 3OW7A 1G51A 3UE0A 1VQFA 3HEJA 2QDLA 3MEFA 2FXQA 3CF5A 1QNKA 1NJIC 1NR2A 4FF1A 1LO5D 1UE1A 2VQEQ 3PO2H 4PZ7A 4RA8A 1XPRA 4R4OA 5C0XG 5FLMH 5CBAE 1WTXA 2K50A 2N55A 3KUPA 1PH9A 2R93G 4DR6L 4XQQA 3PV0A 4HJ5A 2VB2X 4B9WA 3CCJA 5JJLA 4CJ2C 4L63B 4ZK9B 1A3VA 4DV4Q 4C1NI 1KIXA 2XIWA 1A15A 5E4WC 1K0RA 2F3VA 5FO9B 1X3FA 3K80C 4DFAA 1HA5A 3JAML 5JPMC 3LNNA 3OTOL 1AZPA 4RKLA 1EFWA 4A3DG 5CV5A 5KNBA 1HNXQ 4B3RL 1TWGB 1Y1WG 3PUWA 2EVBA 4A4IA 1HTPA 2VZAA 4EQNA 1VQAA 2ATWA 4K5VA 2YTXA 3HOZG 1TXYA 5C3XA 5JAVA 1L1OC 3J80c 4MTNA 3EROA 1EY9A 5C5MA 3K5OA 1EY0A 4DK1A 1KABA 5M5XH 1MSHA 3EIVA 2D0OA 1IW7C 2Z4IA 1PH3A 3HOXG 3NP8A 1AH9A 2XRQD 3FEWX 3TMEA 3F1ZA 1B1ZA 4IN3A 1XTCD 5CORA 2NVQH 1E24A 1PTOB 4QY7A 4JI6Q 1Y1VH 4HSVA 1E22A 1OO9B 3GV3A 4L6TB 1WTQA 3BZKA 2EJMA 4OO1I 3PQIA 4OX9L 2L4NA 3PIP3 2A19A 4IPHA 3T1HQ 2UUCQ 1B3AA 1RKNA 2CW0D 1KDAA 2N49A 2E2DC 1QE6A 3TZDA 1SYGA 5E4XA 1PZKD 1EL0A 1KNAA 1N8RC 2A5HA 2UXBQ 4RGMA 2RCFA 4QUCA 2M9VA 4X64L 3QOLA 3NHHA 1TWAB 1X3GA 1IYJB 1BDOA 2A68D 1SAPA 3CC2A 1DOMA 2J7ZA 3M7NA 3OYYA 4BY1H 1EWIA 1IYVA 1O80A 4Y7NH 3HGBA 1Z7TA 2B2YC 1Q46A 1YVCA 1JJCB 3VA7A 2NVTB 5C4XB 1YBYA 4O0AA 4R8IA 2EXDA 2AMCB 1Y8PB 3RLFA 1JWUD 5EBCA 2JA6H 4A3FB 5IGFA 3K6OA 4WJ3M 4H44C 1I4GA 3TP8A 5G3LD 2G5DA 2B63H 2F3WA 3S16H 3W3AA 2PW5A 5CBEE 2ZTCA 4F7XA 3A54A 3FPUB 2EJGC 4H13C 3BDOA 2MO1A 3SR1A 1EQRA 1M4VA 1I4RA 4OIKA 1LTTD 1S5BD 4ZRZA 2NZ1D 3J7ZC 1CM9A 1SROA 3M4QA 3S14H 5T1IA 3RN5A 1I4XA 1NCVA 3MHBA 3OSOA 3K7AH 2Y0SB 3QB3A 4IJHA 2E5LQ 3WDNA 1A2UA 4OL7A 3DWQA 3VYSA 1OXXK 4J15A 1FVIA 5IP9H 4BY7G 1BXTA 3NELA 3T4AC 4K8JA 1ESRA 1VQGA 4TQUS 4P74A 3TN2A 4IOCA 2WACA 1TWHB 1SE4A 3V2TA 2ZTDA 1ESFA 1XXGA 1QVFA 1BOSA 1I50H 4ODGA 3CMEA 3VDYA 4KHPQ 2B3GA 3MXGA 4B08A 2ZXPA 1TIID 1LTGD 3MA2B 4DV3L 3E3XA 4NP5A 2UUAQ 5FLXL 3NENA 5D3DA 1SMXA 5D14A 2B39A 3JAMi 5NUCA 3H0GB 4GLVB 1RF2D 2JA5G 1LABA 1V43A 2AKWB 1FR3A 1SYEA 3VYUA 4DR5L 1RTOA 1UEAB 1Y69U 2KQ3A 4B9XA 1C8CA 2F0HA 3U58A 1GKHA 3M4OH 5C4ZA 5CV4A 2FMCA 3L7ZC 4QJFA 5E1FA 2VUMH 1TY2A 3M3YB 4JI7Q 1IKLA 1PH1A 2F0PA 2I46A 5LMNW 1CZWA 1VQLA 3RLNA 2KVMA 1NMFA 3HOYG 4PG3A 4IUVA 5KNCA 1E2VA 5M3FH 1D5MC 2TMPA 4C3JH 1G6ZA 2F0EA 3PO3B 2NN6I 2FJ2A 1VQ9A 1SMYC 1PXUA 3C46A 1YNJD 3HFZB 3MVVA 1AE2A 2NVQB 1FL0A 1S5ED 4QL5A 1IBKL 3K5LA 2OTJA 3N52A 3KLRA 4CGYB 5JVG3 2JA7H 4LFCQ 1JE5A 4OO1H 2M2LA 3TQYA 2MP1A 2KCNA 1PH6A 4UP8A 1SNDA 2I0QA 2ES2A 4C2MH 1TWCH 1PFBA 3KBXA 1EQVA 2CQAA 3D6WA 4GN3B 1EUJA 1BCPF 5C6AA 1VQ7A 1RCVD 2Z9HA 2C5CA 1X55A 4A3GG 3KLWA 5EAYA 3L2PA 3AQQA 2MUYA 4IFDI 3PSIA 3G4SA 1D6EC 1YNXA 3M9BA 2VS1A 1N36Q 4FXGC 3ITPA 2BE5D 3NEMA 3G48A 4QCLA 2SDFA 4BY1B 2ID0A 4LUOA 4Y7NB 4KKTA 5IYDG 3ULLA 2VQEL 1W2BA 2X69A 1G2TA 5EPLA 1OXSC 5C5LA 1HR0Q 4ME5A 1GVPA 4YY3Q 2IX1A 3KFUA 1F77A 1LTSD 1L1OB 1Q8IA 2B2VA 4KY5A 1STEA 2OQKA 4A3IG 1EOVA 4DR6Q 5ELCA 2K5WA 2AQ1B 3K57A 5C44H 3CCVA 2SEBD 1LT5D 4A3CG 1CHPD 1XWEA 1QZGA 1HNXL 3A56A 5FJ8G 4KMUC 3A5UA 4POGA 4N9TA 3HOUH 3S14B 3GTQH 3OTOQ 1AEXA 1JB3A 1WD0A 2YTYA 1WVLA 3S1QH 4UAIA 1YJNA 4A3JG 3MTSA 3PGZA 1PFSA 2F1MA 2JSOA 4NKLA 5EBDA 1E2WA 1CA6A 2PI2E 1WI5A 1EY8A 1U0LA 1M90C 1RDPD 1STGA 3UDFA 3A55A 3R2TA 1YZ6A 3ND8A 1WYDA 2RF4A 2ALYB 2IX0A 4X3TA 2HIXA 1NSNS 1SR3A 2OTLA 4LF6L 3DM1A 4LAAA 5C4JB 4BBSH 4NB3A 2HCCA 3BU2A 1GXDC 4JVZA 1QOHA 1H9MA 4C3HB 3GTPH 1B70B 1WCMG 3JAME 2DN8A 1AW7A 1BUVT 4HIMA 2YTVA 1V1PB 4RHSA 2UUCL 1GUGA 4O42A 5HGTA 1IBMQ 4N8FA 3BG3A 3J81i 3KOJA 1Q90A 1EFID 1SMYD 3BVZA 2JJQA 5CV6A 4OX9Q 1X9NA 1MIUA 1VF5C 5ELDA 1A3TA 2JN4A 5JJKA 1D5XC 5CGKA 2UXBL 2A74C 1SFOH 1PMRA 2L1BA 2V4DA 2VXWA 1RD9D 4WORA 1JWMD 5IGEA 2A8VA 2FHTA 5IT9L 1CKOA 4G7HC 2R7DA 1SJHD 3AEVA 2VUMB 4HR7B 4DNRB 4C3IH 5GADC 2XTIA 1ENFA 2NVXH 5EKLA 4LF5L 2DY8A 4A3EH 3S2DB 3CCQA 2RDHA 5C3EG 5J1ZA 1U9RA 1EEID 2N78A 2BA0A 1Q12A 4DR4L 2NN6H 4KKSA 3LWUA 3TBIB 2JK8A 3RMHA 4JI2L 1KTKA 4JI8Q 2F0KA 4JI0Q 3K58A 4R9WA 2RQXA 5EKKA 4DK0A 5I2XA 3KYHC 5JOBA 4BBRB 1I6HB 2JA7B 4G4KA 1DJRD 3A7LA 2EY5A 1PYWD 5LMUQ 4OIJA 3MXUA 1X6OA 1DD2A 1TWGH 5IWAL 4J1MA 2E2IB 3M4PA 3PUVA 3H3VI 2KUMA 2WAQE 3U9SA 4F88A 1H9KA 2R92G 3NBIA 1VMPA 3I90A 3QR8A 1TQOA 1NE3A 4LK1C 2MNAA 1ENCA 2B8FA 5M3MG 4RCNA 2CVRA 3K0XA 1UE7A 1LYLA 2NWGA 1BBXC 3FRPB 4BXXG 5KGUA 3O13A 4DAYA 4FVMA 2UUAL 1BBWA 2WV6D 2L9HA 2WKDA 4DGZA 1PTOH 2DJGC 2PQAA 3D4RA 2F4VQ 2ICEC 5IY0A 3I4NB 1VQHA 5JPNC 2PZTA 3CCSA 2F52A 2JE6I 3OHXC 3RZDB 1A62A 3ND9A 4XIGS 4DR2Q 4A3BG 1PTOF 2EPBA 3FMCA 4LF8Q 3PF4A 4NPSA 2HHHQ 1JCKB 3BZCA 1EYGA 2LFNA 4I65A 1YI2A 3AFQA 1UAPA 1FNUA 4DR5Q 1GHJA 1YNNC 1STNA 2F0GA 1HTLD 4A3KB 2EZVA 1YJWA 2L15A 3KDFB 5IGBA 3E0EA 4FDBA 4JI7L 1DM0B 3DHQA 4DPGA 2K5VA 2PCFB 1ILQA 3M7GA 3FKIG 5IP7G 3HOUB 3L9AX 4DAMA 2AWOA 2YU9H 2A6HC 2E76C 4RG1A 4A3LG 3S1QB 3TP7A 2EOTA 3GQBA 1SE2A 1BO0A 1NR4A 1AE3A 1RHPA 1VQOA 5FLXE 4BS9A 1CT1D 2K01A 2AQ2B 2A6ED 3CHBD 2F0WA 2TSSA 1SYCA 2NVTH 1PH2A 4HMJA 3UE1A 1JOQA 3UDGA 4A3MG 4B3TL 4FF4A 1K8MA 4K5XA 3T51B 4PZ8A 1K8GA 4HEDA 4A3FH 4GN4B 4KK7A 4KN4C 2EY6A 4K5WA 1HZ9A 2HDLA 1LTBD 2SOBA 3NE5B 1WTPA 5C4XG 2KHSA 1K9MC 2F03A 1SJED 4CKEA 1BQQT 2D5DA 2LKVA 3QOJA 3SE0A 2QA4A 4LUVA 1G6PA 1F2YA 4DR1L 4MNOA 3CCLA 3OOCA 1J5EL 3EA6A 4X3UA 2PMZB 1SSOA 1SFOB 1X65A 3MZ5A 1ENAA 2QKIC 3U9OA 4M8AA 3VR3A 3T13A 1N36L 5KYIA 1M1KC 1TWHH 4C3IB 4OWWB 2BH2A 2IPKD 3U4VA 1KD1C 1KDCA 1HH2P 1V8QA 3WOEA 1HR0L 2NB0A 2K52A 4K6DA 5ELBA 4YY3L 2CHBD 1IL2A 4OXPA 4KTAA 3HZXA 1SNCA 1AN8A 3CXCA 3F2CA 3TS2A 1EEFD 2B2VC 3IFDA 3CCUA 4GNXC 4XT1B 1A6XA 3H0GH 1HRJA 2OCEA 2ZTEA 3CMAA 1EQQA 1EY4A 2EY1A 2K5QA 1MJCA 2B2WC 3NWTA 1SBBB 4K6LA 3IAYA 3OW2A 3PO2G 2AQ3B 1KRTA 3E5SA 5FLMG 4DV0Q 3NXWA 5COYA 1TS5A 1EZ6A 2OXPA 4DUZQ 2LS01 1Q1EA 5I9PA 5JEAH 3S17B 3M3YH 4WRDA 1K83B 3H3VH 3EQLC 5H1SE 4ZCKA 1ICFB 4MIUA 2Z0SA 2PNRC 2ZJRA 2PW7A 5KRUA 2J4XA 3SK4A 4CDEC 4MZ9A 3J80i 2Q8IB 4G7OC 1EOTA 1PH8A 2PZWA 1QVGA 4ZYSA 1YNND 4A93B 4O1NA 4TVAB 2N3SA 4LW1A 3I4MG 3A8JE 2D9UA 2IT1A 1DZ1A 2YYZA 5M5YH 4A76A 3PO3H 2B8GA 1XNQL 4LMQD 4G57A 2A6HD 1C4QA 5K36H 3HOXH 4DR3L 4LF6Q 2EIFA 4P73A 2K6AA 2F0IA 4FP5D 1VS0A 1PFMA 3AFPA 4XT3B 2EYPA 4JI5L 2RSNA 3HKZB 4UPAA 1IBML 4GKKQ 2G9HD 4ZKCB 1HPCA 1EY5A 1GUNA 4DXFA 1QZHA 4XQNA 1KHIA 1EZ8A 5G3LF 3CAMA 1HCZA 4NW2A 2PQEA 1Y1VG 1A2TA 3HP3A 4BWGB 4L8JA 4KKUA 4JBKA 2Z8LA 1NTGA 3MXNA 2KCCA 3S9WA 1GHKA 1ML0D 3WOFA 5A2QE 1QB5D 2LXJA 4ID6A 2YU9B 3BDLA 2JQOA 1SRUA 4DKAC 3S24A 4GZYC 4LF5Q 4UP7A 3STBC 2ASBA 4OHJA 1QWYA 4AYBG 1LTID 3FP9A 2E8GA 5KIXA 1EIGA 3KF6A 1E7ZA 1B4OA 1RL2A 4JI8L 1BNZA 1U4LA 4R8NA 1XYIA 4JI0L 1CQFA 4ABNA 1O7LA 1NNXA 2G9DA 4DR4Q 4BY1G 3HOWB 1VQ4A 2X6GA 4JI2Q 3Q8DA 1U4PA 3KBGA 3I70A 1QJOA 4QIWE 4A75A 3DWAA 3IL8A 5E3FA 2K05A 3VR6A 5LMUL 1IBLL 2O5JC 2NVYB 3SHLA 4GKJQ 2IL8A 1VQ5A 5IT9E 2JA6G 1VQ8A 3GTMB 1O7ZA 1C9OA 1FNWA 3A8IE 1GUOA 2B63G 4AH6A 3OMCA 3ONAB 4CDFC 1KAWA 4HCEA 5IWAQ 1MKHA 2EYOA 2CFMA 1GO3E 4KY6A 2JA8B 1RTNA 3SVMA 1TKWB 4KLKA 4ZAIA 1JOOA 1XNRL 1RIPA 3DEOA 5GQOA 1Z6HA 3CP0A 4P71A 4NXNQ 5C4JH 2EXZA 1WFQA 1H9SB 2F4VL 4HMIA 1C0AA 4C3HH 1I3QH 1H9JA 5ELOA 5IP9G 3CC7A 2BH8A 2Y0SE 3I2ZA 2HD3A 3J7AF 4ZQ3A 4CKBA 4LFBL 4DR2L 4YHHQ 4CJ1B 4HIOA 4LF8L 4MTKA 2HHHL 4JI3L 1IW7D 2ZM6L 4HJAA 3F2BA 1U4MA 4X66L 1VQNA 2R6GA 3J81j 3NSWA 4ZUIA 3W1BA 4DV2L 3BJUA 3K8AA 3MEHA 1T9HA 2BDNA 1PLFA 1VQDA 5ELEA 1B53A 4FF3A 4I7ZC 4FNFA 3J81L 2EQSA 1AZQA 3JAMc 1H9SA 1C48A 4A3DB 4RKBA 1ET9A 1Y1WB 3S2DH 1ZYRC 3BDCA 1EY7A 5DNFA 2HCIA 3I7FA 1VCIA 3HOZB 5EPKA 2RA4A 3G6JB 1LT6D 1SYFA 4H02A 4EGVA 2KENA 3DLLA 2VUMG 1LTAD 5BN5A 2CQOA 2A73B 5M5YB 2CWPA 4NDXA 1E1TA 2CWAA 5E7NA 4KY7A 2LSSA 2F0OA 2A1AA 3T1YQ 3GP7A 1R4PB 4B3TQ 3HOXB 2VNUD 4U68A 5M3FG 1H95A 2BCOA 4C3JG 1EYDA 5GAEC 3G6EA 1I6HH 4BBRH 3D4WA 1PYSB 2NZOA 3STBD 3LGJA 3S1RB 2WB1B 3CD6A 4JV5L 1FGUA 5IYCH 5IYBH 5AFWA 2K04A 4YCWA 2WAQG 3ULPA 1DGSA 4GNXB 2WFWA 1YEZA 1VQKA 1UWVA 5K5PA 3GTLB 1T5EA 4DR1Q 1Q8KA 2E2IH 3OPOA 1J5EQ 4OO1G 3A74A 2B29A 1I4HA 4A3GH 5LMNL 5I6WA 4UP9A 2KJXA 4GS3A 4DAPA 1D2BA 1KAAA 5CV8A 2ZJQA 3DM3A 5L37A 1IHZA 4CBVA 1TU2B 3RR5A 3IRBA 1F2ZA 2RDGA 1TR5A 4HIDA 1CK1A 4FXDA 2O2LD 4P75A 4GNXA 2K5HA 1PA6A 3I4NH 3EVQA 4RGOS 1ZXTA 4AYBE 1QG7A 3T53B 2IHFA 3RZDH 2B2WA 4DV6Q 2HDMA 4PMCA 3LWEA 2MFIA 1Z47A 4RGTA 3A5ZB 4QUFA 2EYFA 4JI1Q 2PO4A 4DV0L 1TS4A 2LXKA 4DUZL 4LF4L 1E1OA 2KHJA 1MBYA 4A3KH 1CSQA 2KA7A 5D65A 3C1EA 1Y14B 1PYBA 1XJVA 3TP6A 4DAVA 3I8ZA 1F9RA 3JC66 2KEDA 1A0IA 2L55A 1I94Q 4POFA 5IE8A 5CV9A 5C44G 3H94A 4OEMB 1PH5A 2ENBA 1EIHA 1L0YB 1GJXA 4O2DA 3H09A 4DF7A 1S3OA 4LFAQ 3F2UA 5FO7B 1NBWA 5A2QL 3HOUG 5FO8B 5JEAJ 2R7ZG 3I55A 4DV1L 1PHJA 3S15B 3GTOB 1SE3A 1XNQQ 1LV9A 1DXMA 1I3QB 3VYRA 1ZYRD 1CI3M 3KJPA 3ZJYC 4GKKL 1V1OA 4DR3Q 4CJ0B 5KEEA 4IALA 1UUPA 4RCOA 3N6RA 3A7AB 4HTHA 4EQOA 2CCZA 5I9OA 3VR4A 2K7VA 5FLXc 1B50A 4BBSG 2PI2A 3A8KE 4JI5Q 2I5MX 4F87A 2JA5B 1B7YB 1CUKA 1OXVA 5EQ0A 1SLJA 2Z6BA 3T56B 1KRSA 4NMZA 2RKSA 2JA9A 1VQPA 5FK9C 1CFMA 4RHRA 2UU9Q 2QCPX 1HQRD 2H5XA 2OF1A 4BA1I 2D0PA 2KCTA 2WIIB 3ERQA 2KHIA 1X56A 4K0KQ 3HOYB 5LL6X 5M5WB 3R3OA 4YWLA 4DR7Q 1K0SA 4C3IG 3V96A 5HURA 1WTHA 4A3EG 3SK6A 5C0XI 3DEPA 4KD4A 2QF7A 2F0DA 1F2MA 1PDQA 4DAYB 1EQTA 4GKJL 2X6LA 4Q5VA 2NN6G 4WFN3 2UXCQ 1PRTC 2B2TA 2PQAB 3K59A 1ET6A 2OEOA 1IBLQ 4F8MA 4HN7A 3S17H 5ISRA 3CW2C 1K83H 2HQLA 2HQEA 4CHTB 4PMBA 2PPBC 4K8IA 1VQ6A 4IFDH 2F0FA 3TZUA 1UE6A 3PUZA 3BYTB 4YWKA 4DXGA 4GLAC 4A93H 4A3GB 2E2JH 1XMQL 1J8IA 3DWPA 5F2DA 5EKIA 4NXNL 1KXLA 4XXEA 2I5HA 1HNZQ 3VYTA 4ZKBB 1XNRQ 3D31A 3SDZA 3C2PA 1YITA 1YHAA 2RVLA 3J80L 3IKJA 3M4YA 2K5NA 2XWJB 3K5NA 2Q2TA 1BR9A 3CRKC 4X62Q 1QILA 1JICA 2GN5A 2Z6KA 4YHHL 2VW9A 2Z4HA 2MO0A 2DY7A 3VR5A 1LTRD 3Q23A 2DJFC 2RDFA 3QIAA 1D1IA 1Q82C 2XWBB 1GUSA 4LFBQ 3LX0A 3HOVH 4K2LA 1LT3D 4JI3Q 3GTGB 4LF7L 3MFGA 2ZM6Q 1SYBA 5IOCA 4X66Q 5EJWA 2UUBQ 4XYQA 5C3WA 3S2HH 3J7YW 2GA4B 4DV2Q 1QUQB 1JJ2A 2M00A 5JVH3 4KI0A 4IUQA 1ONLA 4JG2A 2ZXRA 2SNMA 4B3ML 2AUKA 3NPPA 1T5XD 1LTLA 1BVSA 1PVOA 4KD3A 1IKMA 4V0BA 1SN8A 4A3JB 4IURA 4MN3A 1CZGA 4JOIA 4QMGA 1CTMA 3EN2A 3T1YL 1FYCA 1PH4A 1EU4A 3S1MH 1ZKOA 1BF4A 1H9RA 1R4QB 4R4CA 1QNUA 3HOWH 3CCEA 3L0OA 3KJOA 1S4ZA 4KHVA 3V05A 4FXKC 1B9NA 2YV5A 3P75A 1LUZA 1QUQA 1HR0W 3NBHA 2NVYH 3K7UC 1HZCA 1YHBA 2XRSD 5KNDA 1MI2A 4JV5Q 2AHOB 2JYOA 3J81E 4A3FG 1UEBA 1JOKA 3HRZC 3GTMH 1K28A 1K8OA 1MHWC 4X65Q 3ICEA 1EYCA 1TT2A 1HXYD 2D62A 5IIFA 1N34L 1X54A 1K3BC 4IJLA 5CR3A 2JA8H 3BYYB 3GDEA 4ZUJA 1E2ZA 1PRTD 5DLQE 1DONA 2DNCA 5LMNQ 1CQVA 4JK1C 4AIMA 2NUCA 4DN4M 3CCMA 2Y0SG 1Y8OB 4LF9L 2Q8TA 5IT9c 1N33Q 1FJGL 4DK6C 5C3EB 2MPMA 3KF8B 5C4HA 1D1KA 1PZJD 2O4XA 1O7IA 1IL8A 4V190 4KHZA 3CPWA 4DV6L 3OMGA 4ULLA 5C0XH 1L0WA 3PCOB 4JI1L 2FFKB 3M85A 3CU7A 1C7YA 2R93H 4H7BA 1IZ6A 1I5FA 1UE5A 4APVA 5CC4A 2E2HH 2F0SA 2LY7A 2VQFL 2UXDL 1LT4D 5BR8Q 4RMFA 3Q22A 4LF4Q 3H0GG 4JCVE 3F2DA 4UHVA 3MXPA 1I94L 3AB9A 4JI4L 4UY8C 4A3DH 1Y1WH 3KF8A 1R9TH 4LFAL 1HFNA 3HOZH 2EYJA 2F3IA 1XMOQ 2E2JB 1J6QA 4QF4A 2R92B 1LACA 5JEAG 2OWOA 1U4RA 3MXNB 5M3MB 3I72A 1KL9A 3I4MH 2N8NA 4DV7Q 1YHQA 1Z9FA 1J9OA 3OWFA 5KYLA 3A0JA 1CKNB 1SNQA 3I73A 2ZT9C 2C9OA 3D3RA 4HJ9A 2O5IC 4DV1Q 3ULJA 1FGBD 1G8ZD 4X3KA 1HFGA 3P1HA 3I56A 1VDZA 3S1RH 3DMUA 4RWSC 4B3SL 3E9HA 3PO3G 2I5LX 2IWHA 3KF6B 3VA5A 3KLSX 4U673 4ZLTF 1MGSA 1D5ZC 3U50C 5K36G 4DA2A 3HOVB 3HG9A 4IOAA 2F0VA 3GTLH 4E6IA 1OXUA 1K73C 4A3BB 2E75C 1W3SA 2CH4A 2RHQB 1SYDA 2WB1G 2LMCB 3Q6SA 4WJ4A 3FPPA 3S2HB 2JXMB 2UU9L 2K33A 1F9SA 1CA5A 2F0LA 5D3IB 2RBMA 4P2CB 1PRTB 1CKNA 5AJ3L 1BKBA 3FKIB 5J3BA 3HKZE 4K0KL 1HZAA 2QW7A 2R61A 4TRDA 3RNUA 4ALPA 3TRZA 3E9IA 4C56C 2BA1A 1E3PA 1TS3A 4DR7L 4IZ8A 2E74C 3RZOB 1SNPA 3W5OA 4RGNA 4JPBW 4DU9A 3MC0B 3TREA 3S1MB 2L0CA 1S40A 1E0BA 4IUTA 4QIWB 3TDQA 4A3MB 1YNJC 2HIVA 1WJJA 3F8TA 4EQPA 4DV5Q 2UXCL 5CV7A 3QJYA 1F9QA 3GTKH 1I6VC 3NTHA 1NMGA 2F0MA 5GROA 5IODA 3VR2A 3RN2A 1QVCA 2B2TC 2IW3A 4QB4A 2OQ0A 1ZEQX 3IFTA 4L5RC 4LWCA 1MSGA 4QQBX 1TY0A 3R8BA 1PFNA 1Q7YC 4TKOB 4JBMA 2VY3A 4N8X1 3Q24A 1VQCA 5J39A 3GTJB 1HNZL 3S1NH 1I4QA 1GM5A 4XQJA 4BY7H 1TS2A 4HAEA 3NQIA 1XPOA 1XMQQ 2D2CC 2EJFC 4UDUC 2BE5C 1HUNA 2K75A 3CCRA 3S15H 3SGIA 3GTOH 4X62L 1CKMA 4KN7C 1QCBD 4IFDJ 4IQZA 4HJ8A 1HJPA 3AU7A 3H91A 2Z6KC 3H15A 3ERSX 2IJ0A 1YJ9A 4HIKA 1SDFA 1WD1A 1KNEA 4L5SA 1HHVA 2GVBA 2Z1CA 2XSCA 1SE8A 5ELFA 2QEJC 5JJZA 3P20A 3Q0AA 4DUYL 2BDOA 4P72A 2JA5H 4C3HG 2R93B 1KLGD 3SXHA 1K8AC 2UUBL 5I2YA 2E2HB 1BCPC 1LM0A 4IUUA 3PO2B 1RJTA 4LF7Q 2F0JA 3TS0A 1UNSA 1GOZA 4R1JA 1XX8A 3U4ZA 1HNWQ 1EYAA 1JMCA 1TWFH 3NTIA 3BS1A 3J80E 2HT1A 1R9TB 1W6KA 1S5CD 5EGTA 4RAUC 4JYAQ 3HOYH 4B3MQ 1WTOA 3X3MA 2NBFA 2IHEA 3URYA 1I4PA 5A35A 2AWNA 3W2DA 5M5WH 1WTRA 1KC8C 4JOIC 1YIJA 2QEXA 3I4MB 5ELNA 1Q3LA 2IY5B 1S72A 4NXMQ 4K14A 5CYUA 3UDIA 2RHSB 3PUXA 2DUDA 2ICIA 4Y52H 1HZBA 2QILA 3C3LA 4OELB 5I4DA 4GLXA 4GOPC 2PZUA 4C1NK 5DAUA 1KQSA 5M5XB 2BOSA 4XYOA 1V9PA 4X65L 3ER0A 2WINB 3R2IA 4XDXA 4X3SA 2A69C 1STYA 2Q8RE 4BBRG 2B2UA 2CH4W 3BVMA 2JA7G 4LNQA 5DEHA 1ICWA 4YCVA 2H4OA 1SNMA 1NY4A 1Y1VB 2NTTA 5IYCG 5IYBG 3D6CA 3R93A 2HUGA 1RODA 3PUYA 1N9WA 3EFXD 2EYHA 1N34Q 2EDGA 5BN4A 2RSOA 1VQBA 3PIOA 2WB1E 1EU3A 4LUZA 1N33L 2DNEA 3SK5A 2PYKA 3FHWA 4AQYQ 1N32Q 4FF2A 1LLRD 4LF9Q 3DUZA 5IYDH 4MHEA 2KBNA 4QGUA 4I7AA 3RUZA 1FJGQ 2F0QA 3CQZH 2R3ZA 3K0YA 3PMFA 1CSPA 1P8LA 4AYBB 1Q86C 3FVQA 2CKZB 4IUPA 4X6AH 4PV1C 4IPCA 5LHY1 4BA2I 5IGGA 2RCNA 4A3IH 3GTKB 3GTGH 4M1UB 5BR8L 1GD7A 1B8AA 2VL6A 1A3UA 1HUMA 1L2FA 4L5TA 1NAPA 2SNSA 1VQEA 2OT2A 3GO5A 3T16A 2UXDQ 2XNAC 2VQFQ 3I4NG 1X32A 4A3CH 3NWSA 2XN9C 5C0XJ 2JA6B 1VMCA 3L3OC 1B3QA 2I07B 4DV4L
chains in the Genus database with same CATH topology
2EE1A 4DNTB 2B63B 3S16B 4JBWA 5I6YA 1BCPD 1ILPA 3I3CA 4S3SA 4CKCA 3S1NB 4EVOA 4BY7B 1STHA 3D8GA 4RH6A 1G291 1JC7A 2EY2A 3BZDB 3G7LA 3K7AB 3MWYW 1AP0A 5TSSA 3OWEB 1AFPA 1II3A 1S5FD 4Q0FA 5FOBB 5J22A 1WTVA 1I50B 4RFBA 2K32A 2F0UA 3BVGA 1JE4A 1FD7D 1JR0D 1DOKA 2L5TA 2WKCA 3PIO3 1TWFB 4OGQC 2A69D 2JP1A 3D4DA 2NTSA 4YIJA 4Z9CB 5LL6S 3X3NA 3NUCA 4N9PA 2F0TA 2A6EC 3M4OB 3GV6A 5BN3A 1SNOA 4WJWA 4FYDA 4K2KA 1EY6A 1O7YA 3CKIB 1PTOC 3QO2A 1JWSD 3MAQA 3QWNA 1IYUA 5M3FB 1B9MA 2B2YA 1OXTA 1Y8NB 4C3JB 4G7ZC 1F2LA 1L0XB 2J0TD 1V1PA 3RD4A 5IGCA 4H0LC 3EJIA 2WAQB 3OIPA 1G2SA 5EPJA 2MJ8A 3MFYA 3I4LA 4IUNA 1KLUD 4HSPA 1M8AA 3DXJC 4PMWA 1EWHA 4J8QA 1BCPB 2JEAI 3NQTA 2IX3A 3NTKA 3UI2A 2ZXOA 4C2MB 1TWCB 2KEEA 1B44D 4J6HA 2KECA 4IFDG 2JEBI 3GD7A 1NUCA 3SEBA 3CRLC 3TP5A 3ZYYX 4TSSA 3CQZB 1MD2D 3C1FA 1GUTA 1O78A 3KK7A 2MGSA 1WTWA 2MHVA 4A3IB 3HS0C 3AMUA 5T1GA 3SK8A 3J7AV 2QDBA 4PNYA 4FO2A 1HQMC 2FMMA 3H6MA 3TSSA 5M9OA 5FKAC 5DM63 1X3QA 2K28A 1JORA 4KV6A 2AUJD 5C44B 1STAA 1GUWA 2VB3X 1PRTF 2L11A 2F0NA 2L12A 1VF7A 3K5MA 1EWCA 3P7JA 1CHQD 3GTQB 2WP8J 2K5DA 2K03A 2R7ZB 2N88A 1G91A 4HCSA 3E6ZX 3I91A 3NK9A 4ILWA 2FINB 1SEBD 2F4IA 1HA6A 1WCMB 2EYLA 1F9PA 3KLSA 3QG1A 4BBSB 1W6JA 2K1BA 1S5DD 2KOLA 4LJZC 2CW0C 2B2UC 1PTOD 1STBA 3FDTA 3GTPB 2XVSA 1B2TA 1DYQA 3H3VC 2A68C 5IGDA 2H1EA 3OIQA 4KJOA 1DCZA 2EYMA 5DM73 1TVXA 4XTCS 1SXTA 1PZID 1X3PA 1KDBA 2NYZD 4PQXA 1FNVA 1Q1BA 1DOLA 1JQYD 3E0JA 4KJNA 2NVXB 5CMDA 4A3EB 3OW7A 3HEJA 1QNKA 4FF1A 1NR2A 1LO5D 4RA8A 5C0XG 5CBAE 1WTXA 2N55A 3KUPA 4XQQA 3PV0A 2VB2X 4B9WA 4CJ2C 4L63B 4ZK9B 1A3VA 4C1NI 2XIWA 1A15A 5E4WC 2F3VA 5FO9B 4DFAA 1HA5A 3JAML 5JPMC 3LNNA 1AZPA 4RKLA 5CV5A 5KNBA 1TWGB 3PUWA 2EVBA 1HTPA 4EQNA 4K5VA 5C3XA 5JAVA 3EROA 1EY9A 5C5MA 3K5OA 1EY0A 4DK1A 1KABA 1MSHA 1IW7C 2Z4IA 3NP8A 2XRQD 3FEWX 3TMEA 1B1ZA 4IN3A 1XTCD 5CORA 1PTOB 4HSVA 1OO9B 3GV3A 4L6TB 1WTQA 2EJMA 4OO1I 2L4NA 3PIP3 1B3AA 1RKNA 2CW0D 1KDAA 2E2DC 1QE6A 3TZDA 1SYGA 5E4XA 1PZKD 1EL0A 1KNAA 2A5HA 4RGMA 4QUCA 2M9VA 3QOLA 3NHHA 1TWAB 1BDOA 2A68D 1SAPA 1DOMA 2J7ZA 3M7NA 1IYVA 1O80A 3HGBA 1Z7TA 2B2YC 3VA7A 2NVTB 5C4XB 4R8IA 1Y8PB 3RLFA 1JWUD 5EBCA 4A3FB 5IGFA 3K6OA 4H44C 1I4GA 3TP8A 5G3LD 2F3WA 3W3AA 2PW5A 5CBEE 4F7XA 3A54A 3FPUB 2EJGC 4H13C 3BDOA 3SR1A 1M4VA 1I4RA 4OIKA 1LTTD 1S5BD 4ZRZA 2NZ1D 1CM9A 5T1IA 1I4XA 1NCVA 3MHBA 3OSOA 2Y0SB 3QB3A 3WDNA 1A2UA 4OL7A 3DWQA 3VYSA 1OXXK 1BXTA 3T4AC 4K8JA 1ESRA 4TQUS 3TN2A 2WACA 1TWHB 3V2TA 1SE4A 1ESFA 1XXGA 1BOSA 4ODGA 3MXGA 4B08A 2ZXPA 1TIID 1LTGD 3MA2B 4NP5A 5FLXL 5D3DA 5D14A 2B39A 5NUCA 3H0GB 1RF2D 1LABA 1V43A 1FR3A 1SYEA 3VYUA 1RTOA 1UEAB 1Y69U 2KQ3A 4B9XA 1C8CA 2F0HA 5C4ZA 5CV4A 2FMCA 3L7ZC 5E1FA 1TY2A 3M3YB 1IKLA 2F0PA 2I46A 1CZWA 2KVMA 4IUVA 5KNCA 1E2VA 1D5MC 2TMPA 1G6ZA 2F0EA 3PO3B 2NN6I 2FJ2A 1SMYC 1PXUA 3C46A 1YNJD 3MVVA 2NVQB 1S5ED 3K5LA 3N52A 3KLRA 4CGYB 5JVG3 4OO1H 2M2LA 2MP1A 2KCNA 1SNDA 1PFBA 3KBXA 1EQVA 2CQAA 3D6WA 1BCPF 5C6AA 1RCVD 2C5CA 2MUYA 4IFDI 1D6EC 4FXGC 3ITPA 2BE5D 4QCLA 2SDFA 4BY1B 2ID0A 4Y7NB 4KKTA 2X69A 1G2TA 5EPLA 1OXSC 5C5LA 4ME5A 2IX1A 1F77A 1LTSD 1Q8IA 2B2VA 4KY5A 1STEA 5ELCA 2K5WA 2AQ1B 3K57A 2SEBD 1LT5D 1CHPD 1XWEA 3A56A 4KMUC 4N9TA 3S14B 1AEXA 1JB3A 1WD0A 1WVLA 4UAIA 3MTSA 4NKLA 2F1MA 2JSOA 5EBDA 1E2WA 1CA6A 1EY8A 1RDPD 1STGA 3A55A 3R2TA 3ND8A 2IX0A 4X3TA 1NSNS 3DM1A 4LAAA 5C4JB 2HCCA 1GXDC 1QOHA 1H9MA 4C3HB 3JAME 2DN8A 1AW7A 1BUVT 1V1PB 4RHSA 1GUGA 4O42A 5HGTA 3BG3A 1Q90A 1EFID 1SMYD 3BVZA 5CV6A 1VF5C 5ELDA 1A3TA 1D5XC 5CGKA 2A74C 1PMRA 2L1BA 2V4DA 2VXWA 1RD9D 4WORA 1JWMD 5IGEA 2FHTA 5IT9L 4G7HC 2VUMB 1SJHD 4HR7B 4DNRB 1ENFA 5EKLA 2DY8A 3S2DB 2RDHA 5J1ZA 1U9RA 1EEID 2BA0A 1Q12A 2NN6H 4KKSA 3LWUA 3TBIB 3RMHA 1KTKA 2F0KA 3K58A 4R9WA 2RQXA 5EKKA 4DK0A 5I2XA 5JOBA 4BBRB 1I6HB 2JA7B 4G4KA 1DJRD 3A7LA 2EY5A 1PYWD 4OIJA 3MXUA 1DD2A 4J1MA 2E2IB 3PUVA 2KUMA 3U9SA 4F88A 1H9KA 3NBIA 1VMPA 3I90A 1TQOA 4LK1C 1ENCA 2B8FA 4RCNA 2CVRA 2NWGA 1BBXC 3FRPB 5KGUA 3O13A 4DAYA 4FVMA 2WV6D 2L9HA 2WKDA 4DGZA 1PTOH 3D4RA 2ICEC 3I4NB 5JPNC 2PZTA 2JE6I 3OHXC 3RZDB 4XIGS 3ND9A 1PTOF 2EPBA 3FMCA 1JCKB 2LFNA 4I65A 1UAPA 1FNUA 1GHJA 1YNNC 1STNA 2F0GA 1HTLD 4A3KB 2EZVA 5IGBA 1DM0B 3DHQA 2PCFB 1ILQA 3M7GA 3HOUB 3L9AX 2AWOA 2A6HC 2E76C 3S1QB 3TP7A 2EOTA 3GQBA 1SE2A 1BO0A 1NR4A 1RHPA 5FLXE 4BS9A 1CT1D 2K01A 2AQ2B 2A6ED 3CHBD 2F0WA 2TSSA 1SYCA 4HMJA 1JOQA 4FF4A 1K8MA 4K5XA 3T51B 4HEDA 4KK7A 4KN4C 2EY6A 4K5WA 2HDLA 1LTBD 2SOBA 3NE5B 1WTPA 2KHSA 2F03A 1SJED 4CKEA 1BQQT 2D5DA 2LKVA 3QOJA 3SE0A 1F2YA 3OOCA 3EA6A 4X3UA 2PMZB 1SSOA 1SFOB 3MZ5A 1ENAA 2QKIC 3U9OA 4M8AA 3VR3A 3T13A 5KYIA 4C3IB 2IPKD 1KDCA 1V8QA 3WOEA 2NB0A 4K6DA 5ELBA 2CHBD 4KTAA 3HZXA 1SNCA 1AN8A 1EEFD 2B2VC 3IFDA 4XT1B 1A6XA 1HRJA 1EY4A 2EY1A 2K5QA 2B2WC 3NWTA 1SBBB 4K6LA 3IAYA 2AQ3B 3E5SA 3NXWA 5COYA 1TS5A 1EZ6A 2OXPA 2LS01 1Q1EA 5I9PA 5JEAH 3S17B 4WRDA 1K83B 3EQLC 4MIUA 2PNRC 2PW7A 5KRUA 2J4XA 3SK4A 2Q8IB 4G7OC 1EOTA 2PZWA 4ZYSA 1YNND 4A93B 4O1NA 3A8JE 2D9UA 2IT1A 1DZ1A 2YYZA 2B8GA 4LMQD 4G57A 2A6HD 1C4QA 5K36H 2K6AA 2F0IA 4FP5D 1PFMA 4XT3B 2EYPA 2RSNA 3HKZB 2G9HD 4ZKCB 1HPCA 1EY5A 1GUNA 4DXFA 4XQNA 1EZ8A 5G3LF 1HCZA 4NW2A 2PQEA 1A2TA 3HP3A 4BWGB 4L8JA 4KKUA 2Z8LA 3MXNA 2KCCA 3S9WA 1GHKA 1ML0D 3WOFA 5A2QE 1QB5D 4ID6A 2YU9B 3BDLA 4GZYC 4OHJA 1QWYA 1LTID 5KIXA 1EIGA 1B4OA 1BNZA 1U4LA 4R8NA 1XYIA 1CQFA 4ABNA 1O7LA 2G9DA 3HOWB 2X6GA 1U4PA 3KBGA 3I70A 1QJOA 3DWAA 3IL8A 5E3FA 2K05A 3VR6A 2O5JC 2NVYB 3SHLA 2IL8A 5IT9E 3GTMB 1O7ZA 1FNWA 3A8IE 1GUOA 3OMCA 3ONAB 4HCEA 2EYOA 4KY6A 2JA8B 1RTNA 3SVMA 1TKWB 4ZAIA 1JOOA 3DEOA 1Z6HA 2EXZA 1H9SB 4HMIA 1H9JA 3J7AF 4ZQ3A 4CKBA 4CJ1B 1IW7D 1U4MA 2R6GA 3NSWA 4ZUIA 3MEHA 2BDNA 1PLFA 5ELEA 1B53A 4FF3A 4I7ZC 4FNFA 3J81L 1AZQA 1H9SA 1C48A 4A3DB 4RKBA 1ET9A 1Y1WB 1ZYRC 3BDCA 1EY7A 5DNFA 2HCIA 1VCIA 3HOZB 5EPKA 2RA4A 3G6JB 1LT6D 1SYFA 4EGVA 1LTAD 5BN5A 2A73B 5M5YB 4NDXA 4KY7A 2F0OA 3GP7A 1R4PB 3HOXB 2VNUD 4U68A 2BCOA 4C3JG 1EYDA 3D4WA 3S1RB 2WB1B 5AFWA 2K04A 5K5PA 3GTLB 1T5EA 3OPOA 4OO1G 1I4HA 5I6WA 2KJXA 4DAPA 1D2BA 1KAAA 5CV8A 1IHZA 4CBVA 1TU2B 1F2ZA 2RDGA 1TR5A 1CK1A 4FXDA 2O2LD 3EVQA 4RGOS 1ZXTA 1QG7A 3T53B 2B2WA 2HDMA 4PMCA 3LWEA 1Z47A 4RGTA 4QUFA 2EYFA 2PO4A 1TS4A 1MBYA 2KA7A 5D65A 3C1EA 3TP6A 4DAVA 3I8ZA 1F9RA 2KEDA 2L55A 5CV9A 3H94A 2ENBA 1EIHA 1L0YB 1GJXA 3H09A 4DF7A 3F2UA 5FO7B 5A2QL 5FO8B 5JEAJ 3S15B 3GTOB 1SE3A 1LV9A 1DXMA 1I3QB 3VYRA 1ZYRD 1CI3M 1V1OA 4CJ0B 5KEEA 4IALA 1UUPA 4RCOA 3N6RA 3A7AB 4HTHA 4EQOA 5I9OA 3VR4A 2K7VA 1B50A 3A8KE 4F87A 2JA5B 1OXVA 5EQ0A 3T56B 4NMZA 2RKSA 5FK9C 1CFMA 4RHRA 2QCPX 1HQRD 2OF1A 4BA1I 2WIIB 3ERQA 3HOYB 5LL6X 5M5WB 3R3OA 4C3IG 3V96A 5HURA 3SK6A 5C0XI 3DEPA 4KD4A 2QF7A 2F0DA 1F2MA 1PDQA 1EQTA 2X6LA 4Q5VA 2NN6G 4WFN3 1PRTC 2B2TA 3K59A 1ET6A 2OEOA 4F8MA 4HN7A 5ISRA 4CHTB 2HQEA 4PMBA 2PPBC 4K8IA 4IFDH 2F0FA 3TZUA 3PUZA 3BYTB 4DXGA 4A3GB 1J8IA 3DWPA 5F2DA 5EKIA 4XXEA 3VYTA 4ZKBB 3D31A 3SDZA 3C2PA 2RVLA 3J80L 3IKJA 3M4YA 2XWJB 3K5NA 1BR9A 3CRKC 1QILA 1JICA 2Z4HA 2DY7A 3VR5A 1LTRD 3Q23A 2RDFA 3QIAA 1D1IA 2XWBB 1GUSA 3LX0A 4K2LA 1LT3D 3GTGB 3MFGA 1SYBA 5IOCA 5EJWA 4XYQA 5C3WA 3J7YW 2GA4B 2M00A 5JVH3 4KI0A 4IUQA 1ONLA 2ZXRA 2SNMA 2AUKA 3NPPA 1T5XD 4KD3A 1IKMA 4V0BA 4A3JB 4IURA 4MN3A 1CZGA 4QMGA 1CTMA 1FYCA 1EU4A 1ZKOA 1BF4A 1H9RA 1R4QB 1QNUA 1S4ZA 4KHVA 3V05A 4FXKC 1B9NA 3P75A 3NBHA 2XRSD 5KNDA 1MI2A 2JYOA 3J81E 1JOKA 3HRZC 1K8OA 1EYCA 1TT2A 1HXYD 2D62A 5IIFA 5CR3A 3BYYB 4ZUJA 1E2ZA 1PRTD 1DONA 2DNCA 1CQVA 4JK1C 2NUCA 4DN4M 1Y8OB 2Q8TA 5C3EB 2MPMA 5C4HA 1D1KA 1PZJD 2O4XA 1IL8A 4V190 4KHZA 3OMGA 4ULLA 5C0XH 2FFKB 3M85A 3CU7A 4H7BA 5CC4A 2F0SA 2LY7A 1LT4D 3Q22A 3MXPA 3AB9A 3KF8A 1HFNA 2EYJA 2E2JB 4QF4A 2R92B 1LACA 5JEAG 1U4RA 5M3MB 3I72A 1J9OA 3OWFA 5KYLA 1SNQA 3I73A 2ZT9C 2C9OA 3D3RA 2O5IC 1FGBD 1G8ZD 4X3KA 1HFGA 3P1HA 1VDZA 3DMUA 4RWSC 2IWHA 3VA5A 3KLSX 4U673 4ZLTF 1MGSA 1D5ZC 5K36G 4DA2A 3HOVB 3HG9A 2F0VA 4E6IA 1OXUA 4A3BB 2E75C 1SYDA 2LMCB 3Q6SA 3FPPA 3S2HB 2JXMB 2K33A 1F9SA 1CA5A 2F0LA 5D3IB 2RBMA 4P2CB 1PRTB 3FKIB 2R61A 4TRDA 4C56C 2BA1A 1TS3A 4IZ8A 2E74C 3RZOB 1SNPA 4RGNA 4DU9A 3MC0B 3S1MB 2L0CA 1E0BA 4IUTA 4QIWB 3TDQA 4A3MB 1YNJC 4EQPA 5CV7A 3QJYA 1F9QA 1I6VC 3NTHA 2F0MA 5IODA 3VR2A 2B2TC 2IW3A 4QB4A 1ZEQX 3IFTA 1MSGA 1TY0A 3R8BA 1PFNA 4TKOB 3Q24A 5J39A 3GTJB 1I4QA 4XQJA 1TS2A 4HAEA 3NQIA 2D2CC 2EJFC 4UDUC 2BE5C 1HUNA 4KN7C 1QCBD 4IFDJ 4IQZA 3AU7A 3H91A 2IJ0A 1SDFA 1WD1A 1KNEA 1HHVA 2Z1CA 2XSCA 5ELFA 2QEJC 5JJZA 3P20A 3Q0AA 2BDOA 4C3HG 2R93B 1KLGD 3SXHA 5I2YA 2E2HB 1BCPC 4IUUA 3PO2B 1RJTA 2F0JA 1UNSA 1GOZA 1XX8A 1EYAA 3NTIA 3BS1A 3J80E 1R9TB 1W6KA 1S5CD 5EGTA 4RAUC 1WTOA 3X3MA 2NBFA 5A35A 3URYA 1I4PA 1WTRA 2AWNA 3W2DA 3I4MB 1Q3LA 4K14A 5CYUA 3PUXA 2ICIA 2QILA 3C3LA 5I4DA 2PZUA 4C1NK 5DAUA 5M5XB 2BOSA 4XYOA 2WINB 3R2IA 4XDXA 4X3SA 2A69C 1STYA 2Q8RE 2B2UA 3BVMA 5DEHA 1ICWA 2H4OA 1SNMA 1Y1VB 2NTTA 3D6CA 3R93A 2HUGA 1RODA 3PUYA 3EFXD 2EYHA 2EDGA 5BN4A 2RSOA 1EU3A 2DNEA 3SK5A 2PYKA 4FF2A 1LLRD 3DUZA 4MHEA 3RUZA 2F0QA 2R3ZA 3K0YA 3PMFA 4AYBB 3FVQA 4IUPA 4PV1C 5LHY1 4BA2I 5IGGA 3GTKB 4M1UB 1A3UA 1HUMA 1NAPA 2SNSA 2OT2A 3GO5A 3T16A 2XNAC 1X32A 3NWSA 2XN9C 5C0XJ 2JA6B 1VMCA 3L3OC 2I07B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DM0 B;  2GA4 B;  1BOS A;  1R4Q B;  1D1K A;  1QNU A;  3MXG A;  1C4Q A;  2BOS A;  1CQF A;  4M1U B;  1D1I A;  4ULL A;  2C5C A;  4P2C B;  1R4P B;  1CZG A;  1QOH A;  1C48 A;  1CZW A;  2XSC A; 
#chains in the Genus database with same CATH topology
 2KCM A;  2EE1 A;  4DNT B;  4JI4 Q;  2B63 B;  1XMO L;  3S16 B;  4JBW A;  3B6Y A;  4A3K G;  5I6Y A;  1OTC A;  1BCP D;  1ILP A;  4A3J H;  3D0F A;  1U5K A;  3I3C A;  4IPD A;  4S3S A;  4CKC A;  4DV7 L;  4EVO A;  3S1N B;  2V1C C;  4BY7 B;  3EBE A;  1STH A;  3D8G A;  4RH6 A;  1IXR A;  1G29 1;  1JC7 A;  1VQM A;  3J7A 5;  2EY2 A;  3BZD B;  3G7L A;  3K7A B;  3MWY W;  2R7Z H;  1AP0 A;  4B3R Q;  5TSS A;  1L1O A;  3OWE B;  1ASY A;  1JJG A;  1AFP A;  4R4Q A;  1II3 A;  1S5F D;  4OON A;  1WCM H;  4B3S Q;  4Q0F A;  3G71 A;  5FOB B;  5J22 A;  1WTV A;  1BBU A;  1I50 B;  4RFB A;  4DNI A;  2K32 A;  2F0U A;  4JI6 L;  1D8L A;  3BVG A;  3CC4 A;  5HY6 A;  1JE4 A;  1FD7 D;  1JR0 D;  3I4O A;  1PH7 A;  4YWM A;  1DOK A;  2C35 B;  3T1H L;  2L5T A;  2WKC A;  1P16 A;  3PIO 3;  1TWF B;  4OGQ C;  2A69 D;  2JP1 A;  3D4D A;  2NTS A;  4YIJ A;  5AJ3 Q;  3J81 c;  4Z9C B;  5LL6 S;  3X3N A;  3NUC A;  4N9P A;  5C3E H;  2F0T A;  2A6E C;  3M4O B;  3GV6 A;  5BN3 A;  4JBJ A;  1SNO A;  4WJW A;  4FYD A;  4K2K A;  1EY6 A;  1O7Y A;  2PNH A;  4DV5 L;  3CKI B;  3CPF A;  4X64 Q;  1PTO C;  3QO2 A;  1JWS D;  3MAQ A;  3QWN A;  1IYU A;  1WOC A;  5M3F B;  3WWV A;  3RLO A;  1A63 A;  1B9M A;  2B2Y A;  1OXT A;  1Y8N B;  4C3J B;  4G7Z C;  1F2L A;  4PZ6 A;  1L0X B;  2J0T D;  1EIY B;  1V1P A;  3RD4 A;  5FJ8 H;  4JC0 A;  1A8V A;  5IGC A;  2ZJP A;  4L5Q A;  3TEH B;  4H0L C;  1VQI A;  3EJI A;  2WAQ B;  3OIP A;  1G2S A;  5EPJ A;  2MJ8 A;  3MFY A;  3I4L A;  4IUN A;  1KLU D;  4HSP A;  1M8A A;  3DXJ C;  4PMW A;  2P5Z X;  1EWH A;  4J8Q A;  1BCP B;  2Q2U A;  2JEA I;  3NQT A;  2IX3 A;  3NTK A;  3UI2 A;  2R92 H;  2ZXO A;  4CDC C;  5M3M H;  4C2M B;  1TWC B;  2KEE A;  2MQH A;  1B44 D;  1D7Q A;  4HJ7 A;  4J6H A;  2KEC A;  1K3R A;  2JEB I;  3W1G A;  3GD7 A;  2E5L L;  4IFD G;  1NUC A;  2NZH A;  3SEB A;  4BXX H;  3CRL C;  4A93 G;  3TP5 A;  3ZYY X;  4TSS A;  1VQJ A;  3CQZ B;  1MD2 D;  1JT8 A;  1XTD A;  3C1F A;  1GUT A;  3PF5 A;  4KHP L;  1O78 A;  3KK7 A;  2MGS A;  1WTW A;  3K81 C;  2GVA A;  2MHV A;  4A3I B;  3HS0 C;  3AMU A;  4A3B H;  5T1G A;  3SK8 A;  4DUY Q;  4ME3 A;  4DK3 C;  3J7A V;  3AYH B;  2QDB A;  4PNY A;  3HKZ G;  1Q81 C;  4FO2 A;  1HQM C;  4DV3 Q;  2FMM A;  5HGQ A;  1HNW L;  3H6M A;  3NBH B;  3TSS A;  5M9O A;  4GOP B;  3HOV G;  2R7F A;  5FKA C;  5DM6 3;  3FKI H;  5IP7 H;  4JYA L;  1X3Q A;  2K28 A;  1JOR A;  2XGT A;  2AUJ D;  4KV6 A;  4A3L H;  4EQ5 A;  2Q2H A;  5C44 B;  1STA A;  3RZO H;  1GUW A;  2VB3 X;  1PRT F;  2L11 A;  2F0N A;  2L12 A;  1VF7 A;  4NXM L;  4R4I A;  3K5M A;  1EWC A;  3P7J A;  1CHQ D;  2DGY A;  3GTQ B;  2WP8 J;  4OWX B;  2K5D A;  1TWA H;  2K03 A;  1X3E A;  4A3M H;  4IPG A;  2R7Z B;  2N88 A;  2K14 A;  1JB7 A;  1G91 A;  4HCS A;  3E6Z X;  3I91 A;  3NK9 A;  5GAG C;  5JJI A;  4ILW A;  4R4T A;  1MJE A;  2FIN B;  1SEB D;  2F4I A;  5C4X H;  4GOP A;  1WCM B;  1HA6 A;  2EYL A;  4OWT B;  1F9P A;  3KLS A;  3HOW G;  3QG1 A;  4YCU A;  4BBS B;  1W6J A;  2Q2I A;  2K1B A;  2QGQ A;  1S5D D;  2KOL A;  4LJZ C;  2CW0 C;  2B2U C;  1PTO D;  1STB A;  3FDT A;  3UDX A;  4LFC L;  3GTP B;  3KDF A;  2XVS A;  4EX5 A;  1IBK Q;  1XPU A;  1B2T A;  1DYQ A;  3GTJ H;  2K4K A;  4CDD C;  3H3V C;  3PIP A;  4AQY L;  1N32 L;  2A68 C;  3HKS A;  5IGD A;  2H1E A;  3OIQ A;  4KJO A;  1DCZ A;  1V1Q A;  2EYM A;  4GN5 A;  5DM7 3;  4JW0 A;  1TVX A;  4XTC S;  2JA8 G;  1ASZ A;  1SXT A;  2PMZ E;  1PZI D;  1X3P A;  1KDB A;  2NYZ D;  4PQX A;  1PV4 A;  5GAH C;  1FNV A;  1Q1B A;  1DOL A;  1JQY D;  3E0J A;  4KJN A;  2NVX B;  5CMD A;  4A3E B;  4IO9 A;  1EIF A;  3OW7 A;  1G51 A;  3UE0 A;  1VQF A;  3HEJ A;  2QDL A;  3MEF A;  2FXQ A;  3CF5 A;  1QNK A;  1NJI C;  1NR2 A;  4FF1 A;  1LO5 D;  1UE1 A;  2VQE Q;  3PO2 H;  4PZ7 A;  4RA8 A;  1XPR A;  4R4O A;  5C0X G;  5FLM H;  5CBA E;  1WTX A;  2K50 A;  2N55 A;  3KUP A;  1PH9 A;  2R93 G;  4DR6 L;  4XQQ A;  3PV0 A;  4HJ5 A;  2VB2 X;  4B9W A;  3CCJ A;  5JJL A;  4CJ2 C;  4L63 B;  4ZK9 B;  1A3V A;  4DV4 Q;  4C1N I;  1KIX A;  2XIW A;  1A15 A;  5E4W C;  1K0R A;  2F3V A;  5FO9 B;  1X3F A;  3K80 C;  4DFA A;  1HA5 A;  3JAM L;  5JPM C;  3LNN A;  3OTO L;  1AZP A;  4RKL A;  1EFW A;  4A3D G;  5CV5 A;  5KNB A;  1HNX Q;  4B3R L;  1TWG B;  1Y1W G;  3PUW A;  2EVB A;  4A4I A;  1HTP A;  2VZA A;  4EQN A;  1VQA A;  2ATW A;  4K5V A;  2YTX A;  3HOZ G;  1TXY A;  5C3X A;  5JAV A;  1L1O C;  3J80 c;  4MTN A;  3ERO A;  1EY9 A;  5C5M A;  3K5O A;  1EY0 A;  4DK1 A;  1KAB A;  5M5X H;  1MSH A;  3EIV A;  2D0O A;  1IW7 C;  2Z4I A;  1PH3 A;  3HOX G;  3NP8 A;  1AH9 A;  2XRQ D;  3FEW X;  3TME A;  3F1Z A;  1B1Z A;  4IN3 A;  1XTC D;  5COR A;  2NVQ H;  1E24 A;  1PTO B;  4QY7 A;  4JI6 Q;  1Y1V H;  4HSV A;  1E22 A;  1OO9 B;  3GV3 A;  4L6T B;  1WTQ A;  3BZK A;  2EJM A;  4OO1 I;  3PQI A;  4OX9 L;  2L4N A;  3PIP 3;  2A19 A;  4IPH A;  3T1H Q;  2UUC Q;  1B3A A;  1RKN A;  2CW0 D;  1KDA A;  2N49 A;  2E2D C;  1QE6 A;  3TZD A;  1SYG A;  5E4X A;  1PZK D;  1EL0 A;  1KNA A;  1N8R C;  2A5H A;  2UXB Q;  4RGM A;  2RCF A;  4QUC A;  2M9V A;  4X64 L;  3QOL A;  3NHH A;  1TWA B;  1X3G A;  1IYJ B;  1BDO A;  2A68 D;  1SAP A;  3CC2 A;  1DOM A;  2J7Z A;  3M7N A;  3OYY A;  4BY1 H;  1EWI A;  1IYV A;  1O80 A;  4Y7N H;  3HGB A;  1Z7T A;  2B2Y C;  1Q46 A;  1YVC A;  1JJC B;  3VA7 A;  2NVT B;  5C4X B;  1YBY A;  4O0A A;  4R8I A;  2EXD A;  2AMC B;  1Y8P B;  3RLF A;  1JWU D;  5EBC A;  2JA6 H;  4A3F B;  5IGF A;  3K6O A;  4WJ3 M;  4H44 C;  1I4G A;  3TP8 A;  5G3L D;  2G5D A;  2B63 H;  2F3W A;  3S16 H;  3W3A A;  2PW5 A;  5CBE E;  2ZTC A;  4F7X A;  3A54 A;  3FPU B;  2EJG C;  4H13 C;  3BDO A;  2MO1 A;  3SR1 A;  1EQR A;  1M4V A;  1I4R A;  4OIK A;  1LTT D;  1S5B D;  4ZRZ A;  2NZ1 D;  3J7Z C;  1CM9 A;  1SRO A;  3M4Q A;  3S14 H;  5T1I A;  3RN5 A;  1I4X A;  1NCV A;  3MHB A;  3OSO A;  3K7A H;  2Y0S B;  3QB3 A;  4IJH A;  2E5L Q;  3WDN A;  1A2U A;  4OL7 A;  3DWQ A;  3VYS A;  1OXX K;  4J15 A;  1FVI A;  5IP9 H;  4BY7 G;  1BXT A;  3NEL A;  3T4A C;  4K8J A;  1ESR A;  1VQG A;  4TQU S;  4P74 A;  3TN2 A;  4IOC A;  2WAC A;  1TWH B;  1SE4 A;  3V2T A;  2ZTD A;  1ESF A;  1XXG A;  1QVF A;  1BOS A;  1I50 H;  4ODG A;  3CME A;  3VDY A;  4KHP Q;  2B3G A;  3MXG A;  4B08 A;  2ZXP A;  1TII D;  1LTG D;  3MA2 B;  4DV3 L;  3E3X A;  4NP5 A;  2UUA Q;  5FLX L;  3NEN A;  5D3D A;  1SMX A;  5D14 A;  2B39 A;  3JAM i;  5NUC A;  3H0G B;  4GLV B;  1RF2 D;  2JA5 G;  1LAB A;  1V43 A;  2AKW B;  1FR3 A;  1SYE A;  3VYU A;  4DR5 L;  1RTO A;  1UEA B;  1Y69 U;  2KQ3 A;  4B9X A;  1C8C A;  2F0H A;  3U58 A;  1GKH A;  3M4O H;  5C4Z A;  5CV4 A;  2FMC A;  3L7Z C;  4QJF A;  5E1F A;  2VUM H;  1TY2 A;  3M3Y B;  4JI7 Q;  1IKL A;  1PH1 A;  2F0P A;  2I46 A;  5LMN W;  1CZW A;  1VQL A;  3RLN A;  2KVM A;  1NMF A;  3HOY G;  4PG3 A;  4IUV A;  5KNC A;  1E2V A;  5M3F H;  1D5M C;  2TMP A;  4C3J H;  1G6Z A;  2F0E A;  3PO3 B;  2NN6 I;  2FJ2 A;  1VQ9 A;  1SMY C;  1PXU A;  3C46 A;  1YNJ D;  3HFZ B;  3MVV A;  1AE2 A;  2NVQ B;  1FL0 A;  1S5E D;  4QL5 A;  1IBK L;  3K5L A;  2OTJ A;  3N52 A;  3KLR A;  4CGY B;  5JVG 3;  2JA7 H;  4LFC Q;  1JE5 A;  4OO1 H;  2M2L A;  3TQY A;  2MP1 A;  2KCN A;  1PH6 A;  4UP8 A;  1SND A;  2I0Q A;  2ES2 A;  4C2M H;  1TWC H;  1PFB A;  3KBX A;  1EQV A;  2CQA A;  3D6W A;  4GN3 B;  1EUJ A;  1BCP F;  5C6A A;  1VQ7 A;  1RCV D;  2Z9H A;  2C5C A;  1X55 A;  4A3G G;  3KLW A;  5EAY A;  3L2P A;  3AQQ A;  2MUY A;  4IFD I;  3PSI A;  3G4S A;  1D6E C;  1YNX A;  3M9B A;  2VS1 A;  1N36 Q;  4FXG C;  3ITP A;  2BE5 D;  3NEM A;  3G48 A;  4QCL A;  2SDF A;  4BY1 B;  2ID0 A;  4LUO A;  4Y7N B;  4KKT A;  5IYD G;  3ULL A;  2VQE L;  1W2B A;  2X69 A;  1G2T A;  5EPL A;  1OXS C;  5C5L A;  1HR0 Q;  4ME5 A;  1GVP A;  4YY3 Q;  2IX1 A;  3KFU A;  1F77 A;  1LTS D;  1L1O B;  1Q8I A;  2B2V A;  4KY5 A;  1STE A;  2OQK A;  4A3I G;  1EOV A;  4DR6 Q;  5ELC A;  2K5W A;  2AQ1 B;  3K57 A;  5C44 H;  3CCV A;  2SEB D;  1LT5 D;  4A3C G;  1CHP D;  1XWE A;  1QZG A;  1HNX L;  3A56 A;  5FJ8 G;  4KMU C;  3A5U A;  4POG A;  4N9T A;  3HOU H;  3S14 B;  3GTQ H;  3OTO Q;  1AEX A;  1JB3 A;  1WD0 A;  2YTY A;  1WVL A;  3S1Q H;  4UAI A;  1YJN A;  4A3J G;  3MTS A;  3PGZ A;  1PFS A;  2F1M A;  2JSO A;  4NKL A;  5EBD A;  1E2W A;  1CA6 A;  2PI2 E;  1WI5 A;  1EY8 A;  1U0L A;  1M90 C;  1RDP D;  1STG A;  3UDF A;  3A55 A;  3R2T A;  1YZ6 A;  3ND8 A;  1WYD A;  2RF4 A;  2ALY B;  2IX0 A;  4X3T A;  2HIX A;  1NSN S;  1SR3 A;  2OTL A;  4LF6 L;  3DM1 A;  4LAA A;  5C4J B;  4BBS H;  4NB3 A;  2HCC A;  3BU2 A;  1GXD C;  4JVZ A;  1QOH A;  1H9M A;  4C3H B;  3GTP H;  1B70 B;  1WCM G;  3JAM E;  2DN8 A;  1AW7 A;  1BUV T;  4HIM A;  2YTV A;  1V1P B;  4RHS A;  2UUC L;  1GUG A;  4O42 A;  5HGT A;  1IBM Q;  4N8F A;  3BG3 A;  3J81 i;  3KOJ A;  1Q90 A;  1EFI D;  1SMY D;  3BVZ A;  2JJQ A;  5CV6 A;  4OX9 Q;  1X9N A;  1MIU A;  1VF5 C;  5ELD A;  1A3T A;  2JN4 A;  5JJK A;  1D5X C;  5CGK A;  2UXB L;  2A74 C;  1SFO H;  1PMR A;  2L1B A;  2V4D A;  2VXW A;  1RD9 D;  4WOR A;  1JWM D;  5IGE A;  2A8V A;  2FHT A;  5IT9 L;  1CKO A;  4G7H C;  2R7D A;  1SJH D;  3AEV A;  2VUM B;  4HR7 B;  4DNR B;  4C3I H;  5GAD C;  2XTI A;  1ENF A;  2NVX H;  5EKL A;  4LF5 L;  2DY8 A;  4A3E H;  3S2D B;  3CCQ A;  2RDH A;  5C3E G;  5J1Z A;  1U9R A;  1EEI D;  2N78 A;  2BA0 A;  1Q12 A;  4DR4 L;  2NN6 H;  4KKS A;  3LWU A;  3TBI B;  2JK8 A;  3RMH A;  4JI2 L;  1KTK A;  4JI8 Q;  2F0K A;  4JI0 Q;  3K58 A;  4R9W A;  2RQX A;  5EKK A;  4DK0 A;  5I2X A;  3KYH C;  5JOB A;  4BBR B;  1I6H B;  2JA7 B;  4G4K A;  1DJR D;  3A7L A;  2EY5 A;  1PYW D;  5LMU Q;  4OIJ A;  3MXU A;  1X6O A;  1DD2 A;  1TWG H;  5IWA L;  4J1M A;  2E2I B;  3M4P A;  3PUV A;  3H3V I;  2KUM A;  2WAQ E;  3U9S A;  4F88 A;  1H9K A;  2R92 G;  3NBI A;  1VMP A;  3I90 A;  3QR8 A;  1TQO A;  1NE3 A;  4LK1 C;  2MNA A;  1ENC A;  2B8F A;  5M3M G;  4RCN A;  2CVR A;  3K0X A;  1UE7 A;  1LYL A;  2NWG A;  1BBX C;  3FRP B;  4BXX G;  5KGU A;  3O13 A;  4DAY A;  4FVM A;  2UUA L;  1BBW A;  2WV6 D;  2L9H A;  2WKD A;  4DGZ A;  1PTO H;  2DJG C;  2PQA A;  3D4R A;  2F4V Q;  2ICE C;  5IY0 A;  3I4N B;  1VQH A;  5JPN C;  2PZT A;  3CCS A;  2F52 A;  2JE6 I;  3OHX C;  3RZD B;  1A62 A;  3ND9 A;  4XIG S;  4DR2 Q;  4A3B G;  1PTO F;  2EPB A;  3FMC A;  4LF8 Q;  3PF4 A;  4NPS A;  2HHH Q;  1JCK B;  3BZC A;  1EYG A;  2LFN A;  4I65 A;  1YI2 A;  3AFQ A;  1UAP A;  1FNU A;  4DR5 Q;  1GHJ A;  1YNN C;  1STN A;  2F0G A;  1HTL D;  4A3K B;  2EZV A;  1YJW A;  2L15 A;  3KDF B;  5IGB A;  3E0E A;  4FDB A;  4JI7 L;  1DM0 B;  3DHQ A;  4DPG A;  2K5V A;  2PCF B;  1ILQ A;  3M7G A;  3FKI G;  5IP7 G;  3HOU B;  3L9A X;  4DAM A;  2AWO A;  2YU9 H;  2A6H C;  2E76 C;  4RG1 A;  4A3L G;  3S1Q B;  3TP7 A;  2EOT A;  3GQB A;  1SE2 A;  1BO0 A;  1NR4 A;  1AE3 A;  1RHP A;  1VQO A;  5FLX E;  4BS9 A;  1CT1 D;  2K01 A;  2AQ2 B;  2A6E D;  3CHB D;  2F0W A;  2TSS A;  1SYC A;  2NVT H;  1PH2 A;  4HMJ A;  3UE1 A;  1JOQ A;  3UDG A;  4A3M G;  4B3T L;  4FF4 A;  1K8M A;  4K5X A;  3T51 B;  4PZ8 A;  1K8G A;  4HED A;  4A3F H;  4GN4 B;  4KK7 A;  4KN4 C;  2EY6 A;  4K5W A;  1HZ9 A;  2HDL A;  1LTB D;  2SOB A;  3NE5 B;  1WTP A;  5C4X G;  2KHS A;  1K9M C;  2F03 A;  1SJE D;  4CKE A;  1BQQ T;  2D5D A;  2LKV A;  3QOJ A;  3SE0 A;  2QA4 A;  4LUV A;  1G6P A;  1F2Y A;  4DR1 L;  4MNO A;  3CCL A;  3OOC A;  1J5E L;  3EA6 A;  4X3U A;  2PMZ B;  1SSO A;  1SFO B;  1X65 A;  3MZ5 A;  1ENA A;  2QKI C;  3U9O A;  4M8A A;  3VR3 A;  3T13 A;  1N36 L;  5KYI A;  1M1K C;  1TWH H;  4C3I B;  4OWW B;  2BH2 A;  2IPK D;  3U4V A;  1KD1 C;  1KDC A;  1HH2 P;  1V8Q A;  3WOE A;  1HR0 L;  2NB0 A;  2K52 A;  4K6D A;  5ELB A;  4YY3 L;  2CHB D;  1IL2 A;  4OXP A;  4KTA A;  3HZX A;  1SNC A;  1AN8 A;  3CXC A;  3F2C A;  3TS2 A;  1EEF D;  2B2V C;  3IFD A;  3CCU A;  4GNX C;  4XT1 B;  1A6X A;  3H0G H;  1HRJ A;  2OCE A;  2ZTE A;  3CMA A;  1EQQ A;  1EY4 A;  2EY1 A;  2K5Q A;  1MJC A;  2B2W C;  3NWT A;  1SBB B;  4K6L A;  3IAY A;  3OW2 A;  3PO2 G;  2AQ3 B;  1KRT A;  3E5S A;  5FLM G;  4DV0 Q;  3NXW A;  5COY A;  1TS5 A;  1EZ6 A;  2OXP A;  4DUZ Q;  2LS0 1;  1Q1E A;  5I9P A;  5JEA H;  3S17 B;  3M3Y H;  4WRD A;  1K83 B;  3H3V H;  3EQL C;  5H1S E;  4ZCK A;  1ICF B;  4MIU A;  2Z0S A;  2PNR C;  2ZJR A;  2PW7 A;  5KRU A;  2J4X A;  3SK4 A;  4CDE C;  4MZ9 A;  3J80 i;  2Q8I B;  4G7O C;  1EOT A;  1PH8 A;  2PZW A;  1QVG A;  4ZYS A;  1YNN D;  4A93 B;  4O1N A;  4TVA B;  2N3S A;  4LW1 A;  3I4M G;  3A8J E;  2D9U A;  2IT1 A;  1DZ1 A;  2YYZ A;  5M5Y H;  4A76 A;  3PO3 H;  2B8G A;  1XNQ L;  4LMQ D;  4G57 A;  2A6H D;  1C4Q A;  5K36 H;  3HOX H;  4DR3 L;  4LF6 Q;  2EIF A;  4P73 A;  2K6A A;  2F0I A;  4FP5 D;  1VS0 A;  1PFM A;  3AFP A;  4XT3 B;  2EYP A;  4JI5 L;  2RSN A;  3HKZ B;  4UPA A;  1IBM L;  4GKK Q;  2G9H D;  4ZKC B;  1HPC A;  1EY5 A;  1GUN A;  4DXF A;  1QZH A;  4XQN A;  1KHI A;  1EZ8 A;  5G3L F;  3CAM A;  1HCZ A;  4NW2 A;  2PQE A;  1Y1V G;  1A2T A;  3HP3 A;  4BWG B;  4L8J A;  4KKU A;  4JBK A;  2Z8L A;  1NTG A;  3MXN A;  2KCC A;  3S9W A;  1GHK A;  1ML0 D;  3WOF A;  5A2Q E;  1QB5 D;  2LXJ A;  4ID6 A;  2YU9 B;  3BDL A;  2JQO A;  1SRU A;  4DKA C;  3S24 A;  4GZY C;  4LF5 Q;  4UP7 A;  3STB C;  2ASB A;  4OHJ A;  1QWY A;  4AYB G;  1LTI D;  3FP9 A;  2E8G A;  5KIX A;  1EIG A;  3KF6 A;  1E7Z A;  1B4O A;  1RL2 A;  4JI8 L;  1BNZ A;  1U4L A;  4R8N A;  1XYI A;  4JI0 L;  1CQF A;  4ABN A;  1O7L A;  1NNX A;  2G9D A;  4DR4 Q;  4BY1 G;  3HOW B;  1VQ4 A;  2X6G A;  4JI2 Q;  3Q8D A;  1U4P A;  3KBG A;  3I70 A;  1QJO A;  4QIW E;  4A75 A;  3DWA A;  3IL8 A;  5E3F A;  2K05 A;  3VR6 A;  5LMU L;  1IBL L;  2O5J C;  2NVY B;  3SHL A;  4GKJ Q;  2IL8 A;  1VQ5 A;  5IT9 E;  2JA6 G;  1VQ8 A;  3GTM B;  1O7Z A;  1C9O A;  1FNW A;  3A8I E;  1GUO A;  2B63 G;  4AH6 A;  3OMC A;  3ONA B;  4CDF C;  1KAW A;  4HCE A;  5IWA Q;  1MKH A;  2EYO A;  2CFM A;  1GO3 E;  4KY6 A;  2JA8 B;  1RTN A;  3SVM A;  1TKW B;  4KLK A;  4ZAI A;  1JOO A;  1XNR L;  1RIP A;  3DEO A;  5GQO A;  1Z6H A;  3CP0 A;  4P71 A;  4NXN Q;  5C4J H;  2EXZ A;  1WFQ A;  1H9S B;  2F4V L;  4HMI A;  1C0A A;  4C3H H;  1I3Q H;  1H9J A;  5ELO A;  5IP9 G;  3CC7 A;  2BH8 A;  2Y0S E;  3I2Z A;  2HD3 A;  3J7A F;  4ZQ3 A;  4CKB A;  4LFB L;  4DR2 L;  4YHH Q;  4CJ1 B;  4HIO A;  4LF8 L;  4MTK A;  2HHH L;  4JI3 L;  1IW7 D;  2ZM6 L;  4HJA A;  3F2B A;  1U4M A;  4X66 L;  1VQN A;  2R6G A;  3J81 j;  3NSW A;  4ZUI A;  3W1B A;  4DV2 L;  3BJU A;  3K8A A;  3MEH A;  1T9H A;  2BDN A;  1PLF A;  1VQD A;  5ELE A;  1B53 A;  4FF3 A;  4I7Z C;  4FNF A;  3J81 L;  2EQS A;  1AZQ A;  3JAM c;  1H9S A;  1C48 A;  4A3D B;  4RKB A;  1ET9 A;  1Y1W B;  3S2D H;  1ZYR C;  3BDC A;  1EY7 A;  5DNF A;  2HCI A;  3I7F A;  1VCI A;  3HOZ B;  5EPK A;  2RA4 A;  3G6J B;  1LT6 D;  1SYF A;  4H02 A;  4EGV A;  2KEN A;  3DLL A;  2VUM G;  1LTA D;  5BN5 A;  2CQO A;  2A73 B;  5M5Y B;  2CWP A;  4NDX A;  1E1T A;  2CWA A;  5E7N A;  4KY7 A;  2LSS A;  2F0O A;  2A1A A;  3T1Y Q;  3GP7 A;  1R4P B;  4B3T Q;  3HOX B;  2VNU D;  4U68 A;  5M3F G;  1H95 A;  2BCO A;  4C3J G;  1EYD A;  5GAE C;  3G6E A;  1I6H H;  4BBR H;  3D4W A;  1PYS B;  2NZO A;  3STB D;  3LGJ A;  3S1R B;  2WB1 B;  3CD6 A;  4JV5 L;  1FGU A;  5IYC H;  5IYB H;  5AFW A;  2K04 A;  4YCW A;  2WAQ G;  3ULP A;  1DGS A;  4GNX B;  2WFW A;  1YEZ A;  1VQK A;  1UWV A;  5K5P A;  3GTL B;  1T5E A;  4DR1 Q;  1Q8K A;  2E2I H;  3OPO A;  1J5E Q;  4OO1 G;  3A74 A;  2B29 A;  1I4H A;  4A3G H;  5LMN L;  5I6W A;  4UP9 A;  2KJX A;  4GS3 A;  4DAP A;  1D2B A;  1KAA A;  5CV8 A;  2ZJQ A;  3DM3 A;  5L37 A;  1IHZ A;  4CBV A;  1TU2 B;  3RR5 A;  3IRB A;  1F2Z A;  2RDG A;  1TR5 A;  4HID A;  1CK1 A;  4FXD A;  2O2L D;  4P75 A;  4GNX A;  2K5H A;  1PA6 A;  3I4N H;  3EVQ A;  4RGO S;  1ZXT A;  4AYB E;  1QG7 A;  3T53 B;  2IHF A;  3RZD H;  2B2W A;  4DV6 Q;  2HDM A;  4PMC A;  3LWE A;  2MFI A;  1Z47 A;  4RGT A;  3A5Z B;  4QUF A;  2EYF A;  4JI1 Q;  2PO4 A;  4DV0 L;  1TS4 A;  2LXK A;  4DUZ L;  4LF4 L;  1E1O A;  2KHJ A;  1MBY A;  4A3K H;  1CSQ A;  2KA7 A;  5D65 A;  3C1E A;  1Y14 B;  1PYB A;  1XJV A;  3TP6 A;  4DAV A;  3I8Z A;  1F9R A;  3JC6 6;  2KED A;  1A0I A;  2L55 A;  1I94 Q;  4POF A;  5IE8 A;  5CV9 A;  5C44 G;  3H94 A;  4OEM B;  1PH5 A;  2ENB A;  1EIH A;  1L0Y B;  1GJX A;  4O2D A;  3H09 A;  4DF7 A;  1S3O A;  4LFA Q;  3F2U A;  5FO7 B;  1NBW A;  5A2Q L;  3HOU G;  5FO8 B;  5JEA J;  2R7Z G;  3I55 A;  4DV1 L;  1PHJ A;  3S15 B;  3GTO B;  1SE3 A;  1XNQ Q;  1LV9 A;  1DXM A;  1I3Q B;  3VYR A;  1ZYR D;  1CI3 M;  3KJP A;  3ZJY C;  4GKK L;  1V1O A;  4DR3 Q;  4CJ0 B;  5KEE A;  4IAL A;  1UUP A;  4RCO A;  3N6R A;  3A7A B;  4HTH A;  4EQO A;  2CCZ A;  5I9O A;  3VR4 A;  2K7V A;  5FLX c;  1B50 A;  4BBS G;  2PI2 A;  3A8K E;  4JI5 Q;  2I5M X;  4F87 A;  2JA5 B;  1B7Y B;  1CUK A;  1OXV A;  5EQ0 A;  1SLJ A;  2Z6B A;  3T56 B;  1KRS A;  4NMZ A;  2RKS A;  2JA9 A;  1VQP A;  5FK9 C;  1CFM A;  4RHR A;  2UU9 Q;  2QCP X;  1HQR D;  2H5X A;  2OF1 A;  4BA1 I;  2D0P A;  2KCT A;  2WII B;  3ERQ A;  2KHI A;  1X56 A;  4K0K Q;  3HOY B;  5LL6 X;  5M5W B;  3R3O A;  4YWL A;  4DR7 Q;  1K0S A;  4C3I G;  3V96 A;  5HUR A;  1WTH A;  4A3E G;  3SK6 A;  5C0X I;  3DEP A;  4KD4 A;  2QF7 A;  2F0D A;  1F2M A;  1PDQ A;  4DAY B;  1EQT A;  4GKJ L;  2X6L A;  4Q5V A;  2NN6 G;  4WFN 3;  2UXC Q;  1PRT C;  2B2T A;  2PQA B;  3K59 A;  1ET6 A;  2OEO A;  1IBL Q;  4F8M A;  4HN7 A;  3S17 H;  5ISR A;  3CW2 C;  1K83 H;  2HQL A;  2HQE A;  4CHT B;  4PMB A;  2PPB C;  4K8I A;  1VQ6 A;  4IFD H;  2F0F A;  3TZU A;  1UE6 A;  3PUZ A;  3BYT B;  4YWK A;  4DXG A;  4GLA C;  4A93 H;  4A3G B;  2E2J H;  1XMQ L;  1J8I A;  3DWP A;  5F2D A;  5EKI A;  4NXN L;  1KXL A;  4XXE A;  2I5H A;  1HNZ Q;  3VYT A;  4ZKB B;  1XNR Q;  3D31 A;  3SDZ A;  3C2P A;  1YIT A;  1YHA A;  2RVL A;  3J80 L;  3IKJ A;  3M4Y A;  2K5N A;  2XWJ B;  3K5N A;  2Q2T A;  1BR9 A;  3CRK C;  4X62 Q;  1QIL A;  1JIC A;  2GN5 A;  2Z6K A;  4YHH L;  2VW9 A;  2Z4H A;  2MO0 A;  2DY7 A;  3VR5 A;  1LTR D;  3Q23 A;  2DJF C;  2RDF A;  3QIA A;  1D1I A;  1Q82 C;  2XWB B;  1GUS A;  4LFB Q;  3LX0 A;  3HOV H;  4K2L A;  1LT3 D;  4JI3 Q;  3GTG B;  4LF7 L;  3MFG A;  2ZM6 Q;  1SYB A;  5IOC A;  4X66 Q;  5EJW A;  2UUB Q;  4XYQ A;  5C3W A;  3S2H H;  3J7Y W;  2GA4 B;  4DV2 Q;  1QUQ B;  1JJ2 A;  2M00 A;  5JVH 3;  4KI0 A;  4IUQ A;  1ONL A;  4JG2 A;  2ZXR A;  2SNM A;  4B3M L;  2AUK A;  3NPP A;  1T5X D;  1LTL A;  1BVS A;  1PVO A;  4KD3 A;  1IKM A;  4V0B A;  1SN8 A;  4A3J B;  4IUR A;  4MN3 A;  1CZG A;  4JOI A;  4QMG A;  1CTM A;  3EN2 A;  3T1Y L;  1FYC A;  1PH4 A;  1EU4 A;  3S1M H;  1ZKO A;  1BF4 A;  1H9R A;  1R4Q B;  4R4C A;  1QNU A;  3HOW H;  3CCE A;  3L0O A;  3KJO A;  1S4Z A;  4KHV A;  3V05 A;  4FXK C;  1B9N A;  2YV5 A;  3P75 A;  1LUZ A;  1QUQ A;  1HR0 W;  3NBH A;  2NVY H;  3K7U C;  1HZC A;  1YHB A;  2XRS D;  5KND A;  1MI2 A;  4JV5 Q;  2AHO B;  2JYO A;  3J81 E;  4A3F G;  1UEB A;  1JOK A;  3HRZ C;  3GTM H;  1K28 A;  1K8O A;  1MHW C;  4X65 Q;  3ICE A;  1EYC A;  1TT2 A;  1HXY D;  2D62 A;  5IIF A;  1N34 L;  1X54 A;  1K3B C;  4IJL A;  5CR3 A;  2JA8 H;  3BYY B;  3GDE A;  4ZUJ A;  1E2Z A;  1PRT D;  5DLQ E;  1DON A;  2DNC A;  5LMN Q;  1CQV A;  4JK1 C;  4AIM A;  2NUC A;  4DN4 M;  3CCM A;  2Y0S G;  1Y8O B;  4LF9 L;  2Q8T A;  5IT9 c;  1N33 Q;  1FJG L;  4DK6 C;  5C3E B;  2MPM A;  3KF8 B;  5C4H A;  1D1K A;  1PZJ D;  2O4X A;  1O7I A;  1IL8 A;  4V19 0;  4KHZ A;  3CPW A;  4DV6 L;  3OMG A;  4ULL A;  5C0X H;  1L0W A;  3PCO B;  4JI1 L;  2FFK B;  3M85 A;  3CU7 A;  1C7Y A;  2R93 H;  4H7B A;  1IZ6 A;  1I5F A;  1UE5 A;  4APV A;  5CC4 A;  2E2H H;  2F0S A;  2LY7 A;  2VQF L;  2UXD L;  1LT4 D;  5BR8 Q;  4RMF A;  3Q22 A;  4LF4 Q;  3H0G G;  4JCV E;  3F2D A;  4UHV A;  3MXP A;  1I94 L;  3AB9 A;  4JI4 L;  4UY8 C;  4A3D H;  1Y1W H;  3KF8 A;  1R9T H;  4LFA L;  1HFN A;  3HOZ H;  2EYJ A;  2F3I A;  1XMO Q;  2E2J B;  1J6Q A;  4QF4 A;  2R92 B;  1LAC A;  5JEA G;  2OWO A;  1U4R A;  3MXN B;  5M3M B;  3I72 A;  1KL9 A;  3I4M H;  2N8N A;  4DV7 Q;  1YHQ A;  1Z9F A;  1J9O A;  3OWF A;  5KYL A;  3A0J A;  1CKN B;  1SNQ A;  3I73 A;  2ZT9 C;  2C9O A;  3D3R A;  4HJ9 A;  2O5I C;  4DV1 Q;  3ULJ A;  1FGB D;  1G8Z D;  4X3K A;  1HFG A;  3P1H A;  3I56 A;  1VDZ A;  3S1R H;  3DMU A;  4RWS C;  4B3S L;  3E9H A;  3PO3 G;  2I5L X;  2IWH A;  3KF6 B;  3VA5 A;  3KLS X;  4U67 3;  4ZLT F;  1MGS A;  1D5Z C;  3U50 C;  5K36 G;  4DA2 A;  3HOV B;  3HG9 A;  4IOA A;  2F0V A;  3GTL H;  4E6I A;  1OXU A;  1K73 C;  4A3B B;  2E75 C;  1W3S A;  2CH4 A;  2RHQ B;  1SYD A;  2WB1 G;  2LMC B;  3Q6S A;  4WJ4 A;  3FPP A;  3S2H B;  2JXM B;  2UU9 L;  2K33 A;  1F9S A;  1CA5 A;  2F0L A;  5D3I B;  2RBM A;  4P2C B;  1PRT B;  1CKN A;  5AJ3 L;  1BKB A;  3FKI B;  5J3B A;  3HKZ E;  4K0K L;  1HZA A;  2QW7 A;  2R61 A;  4TRD A;  3RNU A;  4ALP A;  3TRZ A;  3E9I A;  4C56 C;  2BA1 A;  1E3P A;  1TS3 A;  4DR7 L;  4IZ8 A;  2E74 C;  3RZO B;  1SNP A;  3W5O A;  4RGN A;  4JPB W;  4DU9 A;  3MC0 B;  3TRE A;  3S1M B;  2L0C A;  1S40 A;  1E0B A;  4IUT A;  4QIW B;  3TDQ A;  4A3M B;  1YNJ C;  2HIV A;  1WJJ A;  3F8T A;  4EQP A;  4DV5 Q;  2UXC L;  5CV7 A;  3QJY A;  1F9Q A;  3GTK H;  1I6V C;  3NTH A;  1NMG A;  2F0M A;  5GRO A;  5IOD A;  3VR2 A;  3RN2 A;  1QVC A;  2B2T C;  2IW3 A;  4QB4 A;  2OQ0 A;  1ZEQ X;  3IFT A;  4L5R C;  4LWC A;  1MSG A;  4QQB X;  1TY0 A;  3R8B A;  1PFN A;  1Q7Y C;  4TKO B;  4JBM A;  2VY3 A;  4N8X 1;  3Q24 A;  1VQC A;  5J39 A;  3GTJ B;  1HNZ L;  3S1N H;  1I4Q A;  1GM5 A;  4XQJ A;  4BY7 H;  1TS2 A;  4HAE A;  3NQI A;  1XPO A;  1XMQ Q;  2D2C C;  2EJF C;  4UDU C;  2BE5 C;  1HUN A;  2K75 A;  3CCR A;  3S15 H;  3SGI A;  3GTO H;  4X62 L;  1CKM A;  4KN7 C;  1QCB D;  4IFD J;  4IQZ A;  4HJ8 A;  1HJP A;  3AU7 A;  3H91 A;  2Z6K C;  3H15 A;  3ERS X;  2IJ0 A;  1YJ9 A;  4HIK A;  1SDF A;  1WD1 A;  1KNE A;  4L5S A;  1HHV A;  2GVB A;  2Z1C A;  2XSC A;  1SE8 A;  5ELF A;  2QEJ C;  5JJZ A;  3P20 A;  3Q0A A;  4DUY L;  2BDO A;  4P72 A;  2JA5 H;  4C3H G;  2R93 B;  1KLG D;  3SXH A;  1K8A C;  2UUB L;  5I2Y A;  2E2H B;  1BCP C;  1LM0 A;  4IUU A;  3PO2 B;  1RJT A;  4LF7 Q;  2F0J A;  3TS0 A;  1UNS A;  1GOZ A;  4R1J A;  1XX8 A;  3U4Z A;  1HNW Q;  1EYA A;  1JMC A;  1TWF H;  3NTI A;  3BS1 A;  3J80 E;  2HT1 A;  1R9T B;  1W6K A;  1S5C D;  5EGT A;  4RAU C;  4JYA Q;  3HOY H;  4B3M Q;  1WTO A;  3X3M A;  2NBF A;  2IHE A;  3URY A;  1I4P A;  5A35 A;  2AWN A;  3W2D A;  5M5W H;  1WTR A;  1KC8 C;  4JOI C;  1YIJ A;  2QEX A;  3I4M B;  5ELN A;  1Q3L A;  2IY5 B;  1S72 A;  4NXM Q;  4K14 A;  5CYU A;  3UDI A;  2RHS B;  3PUX A;  2DUD A;  2ICI A;  4Y52 H;  1HZB A;  2QIL A;  3C3L A;  4OEL B;  5I4D A;  4GLX A;  4GOP C;  2PZU A;  4C1N K;  5DAU A;  1KQS A;  5M5X B;  2BOS A;  4XYO A;  1V9P A;  4X65 L;  3ER0 A;  2WIN B;  3R2I A;  4XDX A;  4X3S A;  2A69 C;  1STY A;  2Q8R E;  4BBR G;  2B2U A;  2CH4 W;  3BVM A;  2JA7 G;  4LNQ A;  5DEH A;  1ICW A;  4YCV A;  2H4O A;  1SNM A;  1NY4 A;  1Y1V B;  2NTT A;  5IYC G;  5IYB G;  3D6C A;  3R93 A;  2HUG A;  1ROD A;  3PUY A;  1N9W A;  3EFX D;  2EYH A;  1N34 Q;  2EDG A;  5BN4 A;  2RSO A;  1VQB A;  3PIO A;  2WB1 E;  1EU3 A;  4LUZ A;  1N33 L;  2DNE A;  3SK5 A;  2PYK A;  3FHW A;  4AQY Q;  1N32 Q;  4FF2 A;  1LLR D;  4LF9 Q;  3DUZ A;  5IYD H;  4MHE A;  2KBN A;  4QGU A;  4I7A A;  3RUZ A;  1FJG Q;  2F0Q A;  3CQZ H;  2R3Z A;  3K0Y A;  3PMF A;  1CSP A;  1P8L A;  4AYB B;  1Q86 C;  3FVQ A;  2CKZ B;  4IUP A;  4X6A H;  4PV1 C;  4IPC A;  5LHY 1;  4BA2 I;  5IGG A;  2RCN A;  4A3I H;  3GTK B;  3GTG H;  4M1U B;  5BR8 L;  1GD7 A;  1B8A A;  2VL6 A;  1A3U A;  1HUM A;  1L2F A;  4L5T A;  1NAP A;  2SNS A;  1VQE A;  2OT2 A;  3GO5 A;  3T16 A;  2UXD Q;  2XNA C;  2VQF Q;  3I4N G;  1X32 A;  4A3C H;  3NWS A;  2XN9 C;  5C0X J;  2JA6 B;  1VMC A;  3L3O C;  1B3Q A;  2I07 B;  4DV4 L; 
#chains in the Genus database with same CATH homology
 2EE1 A;  4DNT B;  2B63 B;  3S16 B;  4JBW A;  5I6Y A;  1BCP D;  1ILP A;  3I3C A;  4S3S A;  4CKC A;  3S1N B;  4EVO A;  4BY7 B;  1STH A;  3D8G A;  4RH6 A;  1G29 1;  1JC7 A;  2EY2 A;  3BZD B;  3G7L A;  3K7A B;  3MWY W;  1AP0 A;  5TSS A;  3OWE B;  1AFP A;  1II3 A;  1S5F D;  4Q0F A;  5FOB B;  5J22 A;  1WTV A;  1I50 B;  4RFB A;  2K32 A;  2F0U A;  3BVG A;  1JE4 A;  1FD7 D;  1JR0 D;  1DOK A;  2L5T A;  2WKC A;  3PIO 3;  1TWF B;  4OGQ C;  2A69 D;  2JP1 A;  3D4D A;  2NTS A;  4YIJ A;  4Z9C B;  5LL6 S;  3X3N A;  3NUC A;  4N9P A;  2F0T A;  2A6E C;  3M4O B;  3GV6 A;  5BN3 A;  1SNO A;  4WJW A;  4FYD A;  4K2K A;  1EY6 A;  1O7Y A;  3CKI B;  1PTO C;  3QO2 A;  1JWS D;  3MAQ A;  3QWN A;  1IYU A;  5M3F B;  1B9M A;  2B2Y A;  1OXT A;  1Y8N B;  4C3J B;  4G7Z C;  1F2L A;  1L0X B;  2J0T D;  1V1P A;  3RD4 A;  5IGC A;  4H0L C;  3EJI A;  2WAQ B;  3OIP A;  1G2S A;  5EPJ A;  2MJ8 A;  3MFY A;  3I4L A;  4IUN A;  1KLU D;  4HSP A;  1M8A A;  3DXJ C;  4PMW A;  1EWH A;  4J8Q A;  1BCP B;  2JEA I;  3NQT A;  2IX3 A;  3NTK A;  3UI2 A;  2ZXO A;  4C2M B;  1TWC B;  2KEE A;  1B44 D;  4J6H A;  2KEC A;  4IFD G;  2JEB I;  3GD7 A;  1NUC A;  3SEB A;  3CRL C;  3TP5 A;  3ZYY X;  4TSS A;  3CQZ B;  1MD2 D;  3C1F A;  1GUT A;  1O78 A;  3KK7 A;  2MGS A;  1WTW A;  2MHV A;  4A3I B;  3HS0 C;  3AMU A;  5T1G A;  3SK8 A;  3J7A V;  2QDB A;  4PNY A;  4FO2 A;  1HQM C;  2FMM A;  3H6M A;  3TSS A;  5M9O A;  5FKA C;  5DM6 3;  1X3Q A;  2K28 A;  1JOR A;  4KV6 A;  2AUJ D;  5C44 B;  1STA A;  1GUW A;  2VB3 X;  1PRT F;  2L11 A;  2F0N A;  2L12 A;  1VF7 A;  3K5M A;  1EWC A;  3P7J A;  1CHQ D;  3GTQ B;  2WP8 J;  2K5D A;  2K03 A;  2R7Z B;  2N88 A;  1G91 A;  4HCS A;  3E6Z X;  3I91 A;  3NK9 A;  4ILW A;  2FIN B;  1SEB D;  2F4I A;  1HA6 A;  1WCM B;  2EYL A;  1F9P A;  3KLS A;  3QG1 A;  4BBS B;  1W6J A;  2K1B A;  1S5D D;  2KOL A;  4LJZ C;  2CW0 C;  2B2U C;  1PTO D;  1STB A;  3FDT A;  3GTP B;  2XVS A;  1B2T A;  1DYQ A;  3H3V C;  2A68 C;  5IGD A;  2H1E A;  3OIQ A;  4KJO A;  1DCZ A;  2EYM A;  5DM7 3;  1TVX A;  4XTC S;  1SXT A;  1PZI D;  1X3P A;  1KDB A;  2NYZ D;  4PQX A;  1FNV A;  1Q1B A;  1DOL A;  1JQY D;  3E0J A;  4KJN A;  2NVX B;  5CMD A;  4A3E B;  3OW7 A;  3HEJ A;  1QNK A;  4FF1 A;  1NR2 A;  1LO5 D;  4RA8 A;  5C0X G;  5CBA E;  1WTX A;  2N55 A;  3KUP A;  4XQQ A;  3PV0 A;  2VB2 X;  4B9W A;  4CJ2 C;  4L63 B;  4ZK9 B;  1A3V A;  4C1N I;  2XIW A;  1A15 A;  5E4W C;  2F3V A;  5FO9 B;  4DFA A;  1HA5 A;  3JAM L;  5JPM C;  3LNN A;  1AZP A;  4RKL A;  5CV5 A;  5KNB A;  1TWG B;  3PUW A;  2EVB A;  1HTP A;  4EQN A;  4K5V A;  5C3X A;  5JAV A;  3ERO A;  1EY9 A;  5C5M A;  3K5O A;  1EY0 A;  4DK1 A;  1KAB A;  1MSH A;  1IW7 C;  2Z4I A;  3NP8 A;  2XRQ D;  3FEW X;  3TME A;  1B1Z A;  4IN3 A;  1XTC D;  5COR A;  1PTO B;  4HSV A;  1OO9 B;  3GV3 A;  4L6T B;  1WTQ A;  2EJM A;  4OO1 I;  2L4N A;  3PIP 3;  1B3A A;  1RKN A;  2CW0 D;  1KDA A;  2E2D C;  1QE6 A;  3TZD A;  1SYG A;  5E4X A;  1PZK D;  1EL0 A;  1KNA A;  2A5H A;  4RGM A;  4QUC A;  2M9V A;  3QOL A;  3NHH A;  1TWA B;  1BDO A;  2A68 D;  1SAP A;  1DOM A;  2J7Z A;  3M7N A;  1IYV A;  1O80 A;  3HGB A;  1Z7T A;  2B2Y C;  3VA7 A;  2NVT B;  5C4X B;  4R8I A;  1Y8P B;  3RLF A;  1JWU D;  5EBC A;  4A3F B;  5IGF A;  3K6O A;  4H44 C;  1I4G A;  3TP8 A;  5G3L D;  2F3W A;  3W3A A;  2PW5 A;  5CBE E;  4F7X A;  3A54 A;  3FPU B;  2EJG C;  4H13 C;  3BDO A;  3SR1 A;  1M4V A;  1I4R A;  4OIK A;  1LTT D;  1S5B D;  4ZRZ A;  2NZ1 D;  1CM9 A;  5T1I A;  1I4X A;  1NCV A;  3MHB A;  3OSO A;  2Y0S B;  3QB3 A;  3WDN A;  1A2U A;  4OL7 A;  3DWQ A;  3VYS A;  1OXX K;  1BXT A;  3T4A C;  4K8J A;  1ESR A;  4TQU S;  3TN2 A;  2WAC A;  1TWH B;  3V2T A;  1SE4 A;  1ESF A;  1XXG A;  1BOS A;  4ODG A;  3MXG A;  4B08 A;  2ZXP A;  1TII D;  1LTG D;  3MA2 B;  4NP5 A;  5FLX L;  5D3D A;  5D14 A;  2B39 A;  5NUC A;  3H0G B;  1RF2 D;  1LAB A;  1V43 A;  1FR3 A;  1SYE A;  3VYU A;  1RTO A;  1UEA B;  1Y69 U;  2KQ3 A;  4B9X A;  1C8C A;  2F0H A;  5C4Z A;  5CV4 A;  2FMC A;  3L7Z C;  5E1F A;  1TY2 A;  3M3Y B;  1IKL A;  2F0P A;  2I46 A;  1CZW A;  2KVM A;  4IUV A;  5KNC A;  1E2V A;  1D5M C;  2TMP A;  1G6Z A;  2F0E A;  3PO3 B;  2NN6 I;  2FJ2 A;  1SMY C;  1PXU A;  3C46 A;  1YNJ D;  3MVV A;  2NVQ B;  1S5E D;  3K5L A;  3N52 A;  3KLR A;  4CGY B;  5JVG 3;  4OO1 H;  2M2L A;  2MP1 A;  2KCN A;  1SND A;  1PFB A;  3KBX A;  1EQV A;  2CQA A;  3D6W A;  1BCP F;  5C6A A;  1RCV D;  2C5C A;  2MUY A;  4IFD I;  1D6E C;  4FXG C;  3ITP A;  2BE5 D;  4QCL A;  2SDF A;  4BY1 B;  2ID0 A;  4Y7N B;  4KKT A;  2X69 A;  1G2T A;  5EPL A;  1OXS C;  5C5L A;  4ME5 A;  2IX1 A;  1F77 A;  1LTS D;  1Q8I A;  2B2V A;  4KY5 A;  1STE A;  5ELC A;  2K5W A;  2AQ1 B;  3K57 A;  2SEB D;  1LT5 D;  1CHP D;  1XWE A;  3A56 A;  4KMU C;  4N9T A;  3S14 B;  1AEX A;  1JB3 A;  1WD0 A;  1WVL A;  4UAI A;  3MTS A;  4NKL A;  2F1M A;  2JSO A;  5EBD A;  1E2W A;  1CA6 A;  1EY8 A;  1RDP D;  1STG A;  3A55 A;  3R2T A;  3ND8 A;  2IX0 A;  4X3T A;  1NSN S;  3DM1 A;  4LAA A;  5C4J B;  2HCC A;  1GXD C;  1QOH A;  1H9M A;  4C3H B;  3JAM E;  2DN8 A;  1AW7 A;  1BUV T;  1V1P B;  4RHS A;  1GUG A;  4O42 A;  5HGT A;  3BG3 A;  1Q90 A;  1EFI D;  1SMY D;  3BVZ A;  5CV6 A;  1VF5 C;  5ELD A;  1A3T A;  1D5X C;  5CGK A;  2A74 C;  1PMR A;  2L1B A;  2V4D A;  2VXW A;  1RD9 D;  4WOR A;  1JWM D;  5IGE A;  2FHT A;  5IT9 L;  4G7H C;  2VUM B;  1SJH D;  4HR7 B;  4DNR B;  1ENF A;  5EKL A;  2DY8 A;  3S2D B;  2RDH A;  5J1Z A;  1U9R A;  1EEI D;  2BA0 A;  1Q12 A;  2NN6 H;  4KKS A;  3LWU A;  3TBI B;  3RMH A;  1KTK A;  2F0K A;  3K58 A;  4R9W A;  2RQX A;  5EKK A;  4DK0 A;  5I2X A;  5JOB A;  4BBR B;  1I6H B;  2JA7 B;  4G4K A;  1DJR D;  3A7L A;  2EY5 A;  1PYW D;  4OIJ A;  3MXU A;  1DD2 A;  4J1M A;  2E2I B;  3PUV A;  2KUM A;  3U9S A;  4F88 A;  1H9K A;  3NBI A;  1VMP A;  3I90 A;  1TQO A;  4LK1 C;  1ENC A;  2B8F A;  4RCN A;  2CVR A;  2NWG A;  1BBX C;  3FRP B;  5KGU A;  3O13 A;  4DAY A;  4FVM A;  2WV6 D;  2L9H A;  2WKD A;  4DGZ A;  1PTO H;  3D4R A;  2ICE C;  3I4N B;  5JPN C;  2PZT A;  2JE6 I;  3OHX C;  3RZD B;  4XIG S;  3ND9 A;  1PTO F;  2EPB A;  3FMC A;  1JCK B;  2LFN A;  4I65 A;  1UAP A;  1FNU A;  1GHJ A;  1YNN C;  1STN A;  2F0G A;  1HTL D;  4A3K B;  2EZV A;  5IGB A;  1DM0 B;  3DHQ A;  2PCF B;  1ILQ A;  3M7G A;  3HOU B;  3L9A X;  2AWO A;  2A6H C;  2E76 C;  3S1Q B;  3TP7 A;  2EOT A;  3GQB A;  1SE2 A;  1BO0 A;  1NR4 A;  1RHP A;  5FLX E;  4BS9 A;  1CT1 D;  2K01 A;  2AQ2 B;  2A6E D;  3CHB D;  2F0W A;  2TSS A;  1SYC A;  4HMJ A;  1JOQ A;  4FF4 A;  1K8M A;  4K5X A;  3T51 B;  4HED A;  4KK7 A;  4KN4 C;  2EY6 A;  4K5W A;  2HDL A;  1LTB D;  2SOB A;  3NE5 B;  1WTP A;  2KHS A;  2F03 A;  1SJE D;  4CKE A;  1BQQ T;  2D5D A;  2LKV A;  3QOJ A;  3SE0 A;  1F2Y A;  3OOC A;  3EA6 A;  4X3U A;  2PMZ B;  1SSO A;  1SFO B;  3MZ5 A;  1ENA A;  2QKI C;  3U9O A;  4M8A A;  3VR3 A;  3T13 A;  5KYI A;  4C3I B;  2IPK D;  1KDC A;  1V8Q A;  3WOE A;  2NB0 A;  4K6D A;  5ELB A;  2CHB D;  4KTA A;  3HZX A;  1SNC A;  1AN8 A;  1EEF D;  2B2V C;  3IFD A;  4XT1 B;  1A6X A;  1HRJ A;  1EY4 A;  2EY1 A;  2K5Q A;  2B2W C;  3NWT A;  1SBB B;  4K6L A;  3IAY A;  2AQ3 B;  3E5S A;  3NXW A;  5COY A;  1TS5 A;  1EZ6 A;  2OXP A;  2LS0 1;  1Q1E A;  5I9P A;  5JEA H;  3S17 B;  4WRD A;  1K83 B;  3EQL C;  4MIU A;  2PNR C;  2PW7 A;  5KRU A;  2J4X A;  3SK4 A;  2Q8I B;  4G7O C;  1EOT A;  2PZW A;  4ZYS A;  1YNN D;  4A93 B;  4O1N A;  3A8J E;  2D9U A;  2IT1 A;  1DZ1 A;  2YYZ A;  2B8G A;  4LMQ D;  4G57 A;  2A6H D;  1C4Q A;  5K36 H;  2K6A A;  2F0I A;  4FP5 D;  1PFM A;  4XT3 B;  2EYP A;  2RSN A;  3HKZ B;  2G9H D;  4ZKC B;  1HPC A;  1EY5 A;  1GUN A;  4DXF A;  4XQN A;  1EZ8 A;  5G3L F;  1HCZ A;  4NW2 A;  2PQE A;  1A2T A;  3HP3 A;  4BWG B;  4L8J A;  4KKU A;  2Z8L A;  3MXN A;  2KCC A;  3S9W A;  1GHK A;  1ML0 D;  3WOF A;  5A2Q E;  1QB5 D;  4ID6 A;  2YU9 B;  3BDL A;  4GZY C;  4OHJ A;  1QWY A;  1LTI D;  5KIX A;  1EIG A;  1B4O A;  1BNZ A;  1U4L A;  4R8N A;  1XYI A;  1CQF A;  4ABN A;  1O7L A;  2G9D A;  3HOW B;  2X6G A;  1U4P A;  3KBG A;  3I70 A;  1QJO A;  3DWA A;  3IL8 A;  5E3F A;  2K05 A;  3VR6 A;  2O5J C;  2NVY B;  3SHL A;  2IL8 A;  5IT9 E;  3GTM B;  1O7Z A;  1FNW A;  3A8I E;  1GUO A;  3OMC A;  3ONA B;  4HCE A;  2EYO A;  4KY6 A;  2JA8 B;  1RTN A;  3SVM A;  1TKW B;  4ZAI A;  1JOO A;  3DEO A;  1Z6H A;  2EXZ A;  1H9S B;  4HMI A;  1H9J A;  3J7A F;  4ZQ3 A;  4CKB A;  4CJ1 B;  1IW7 D;  1U4M A;  2R6G A;  3NSW A;  4ZUI A;  3MEH A;  2BDN A;  1PLF A;  5ELE A;  1B53 A;  4FF3 A;  4I7Z C;  4FNF A;  3J81 L;  1AZQ A;  1H9S A;  1C48 A;  4A3D B;  4RKB A;  1ET9 A;  1Y1W B;  1ZYR C;  3BDC A;  1EY7 A;  5DNF A;  2HCI A;  1VCI A;  3HOZ B;  5EPK A;  2RA4 A;  3G6J B;  1LT6 D;  1SYF A;  4EGV A;  1LTA D;  5BN5 A;  2A73 B;  5M5Y B;  4NDX A;  4KY7 A;  2F0O A;  3GP7 A;  1R4P B;  3HOX B;  2VNU D;  4U68 A;  2BCO A;  4C3J G;  1EYD A;  3D4W A;  3S1R B;  2WB1 B;  5AFW A;  2K04 A;  5K5P A;  3GTL B;  1T5E A;  3OPO A;  4OO1 G;  1I4H A;  5I6W A;  2KJX A;  4DAP A;  1D2B A;  1KAA A;  5CV8 A;  1IHZ A;  4CBV A;  1TU2 B;  1F2Z A;  2RDG A;  1TR5 A;  1CK1 A;  4FXD A;  2O2L D;  3EVQ A;  4RGO S;  1ZXT A;  1QG7 A;  3T53 B;  2B2W A;  2HDM A;  4PMC A;  3LWE A;  1Z47 A;  4RGT A;  4QUF A;  2EYF A;  2PO4 A;  1TS4 A;  1MBY A;  2KA7 A;  5D65 A;  3C1E A;  3TP6 A;  4DAV A;  3I8Z A;  1F9R A;  2KED A;  2L55 A;  5CV9 A;  3H94 A;  2ENB A;  1EIH A;  1L0Y B;  1GJX A;  3H09 A;  4DF7 A;  3F2U A;  5FO7 B;  5A2Q L;  5FO8 B;  5JEA J;  3S15 B;  3GTO B;  1SE3 A;  1LV9 A;  1DXM A;  1I3Q B;  3VYR A;  1ZYR D;  1CI3 M;  1V1O A;  4CJ0 B;  5KEE A;  4IAL A;  1UUP A;  4RCO A;  3N6R A;  3A7A B;  4HTH A;  4EQO A;  5I9O A;  3VR4 A;  2K7V A;  1B50 A;  3A8K E;  4F87 A;  2JA5 B;  1OXV A;  5EQ0 A;  3T56 B;  4NMZ A;  2RKS A;  5FK9 C;  1CFM A;  4RHR A;  2QCP X;  1HQR D;  2OF1 A;  4BA1 I;  2WII B;  3ERQ A;  3HOY B;  5LL6 X;  5M5W B;  3R3O A;  4C3I G;  3V96 A;  5HUR A;  3SK6 A;  5C0X I;  3DEP A;  4KD4 A;  2QF7 A;  2F0D A;  1F2M A;  1PDQ A;  1EQT A;  2X6L A;  4Q5V A;  2NN6 G;  4WFN 3;  1PRT C;  2B2T A;  3K59 A;  1ET6 A;  2OEO A;  4F8M A;  4HN7 A;  5ISR A;  4CHT B;  2HQE A;  4PMB A;  2PPB C;  4K8I A;  4IFD H;  2F0F A;  3TZU A;  3PUZ A;  3BYT B;  4DXG A;  4A3G B;  1J8I A;  3DWP A;  5F2D A;  5EKI A;  4XXE A;  3VYT A;  4ZKB B;  3D31 A;  3SDZ A;  3C2P A;  2RVL A;  3J80 L;  3IKJ A;  3M4Y A;  2XWJ B;  3K5N A;  1BR9 A;  3CRK C;  1QIL A;  1JIC A;  2Z4H A;  2DY7 A;  3VR5 A;  1LTR D;  3Q23 A;  2RDF A;  3QIA A;  1D1I A;  2XWB B;  1GUS A;  3LX0 A;  4K2L A;  1LT3 D;  3GTG B;  3MFG A;  1SYB A;  5IOC A;  5EJW A;  4XYQ A;  5C3W A;  3J7Y W;  2GA4 B;  2M00 A;  5JVH 3;  4KI0 A;  4IUQ A;  1ONL A;  2ZXR A;  2SNM A;  2AUK A;  3NPP A;  1T5X D;  4KD3 A;  1IKM A;  4V0B A;  4A3J B;  4IUR A;  4MN3 A;  1CZG A;  4QMG A;  1CTM A;  1FYC A;  1EU4 A;  1ZKO A;  1BF4 A;  1H9R A;  1R4Q B;  1QNU A;  1S4Z A;  4KHV A;  3V05 A;  4FXK C;  1B9N A;  3P75 A;  3NBH A;  2XRS D;  5KND A;  1MI2 A;  2JYO A;  3J81 E;  1JOK A;  3HRZ C;  1K8O A;  1EYC A;  1TT2 A;  1HXY D;  2D62 A;  5IIF A;  5CR3 A;  3BYY B;  4ZUJ A;  1E2Z A;  1PRT D;  1DON A;  2DNC A;  1CQV A;  4JK1 C;  2NUC A;  4DN4 M;  1Y8O B;  2Q8T A;  5C3E B;  2MPM A;  5C4H A;  1D1K A;  1PZJ D;  2O4X A;  1IL8 A;  4V19 0;  4KHZ A;  3OMG A;  4ULL A;  5C0X H;  2FFK B;  3M85 A;  3CU7 A;  4H7B A;  5CC4 A;  2F0S A;  2LY7 A;  1LT4 D;  3Q22 A;  3MXP A;  3AB9 A;  3KF8 A;  1HFN A;  2EYJ A;  2E2J B;  4QF4 A;  2R92 B;  1LAC A;  5JEA G;  1U4R A;  5M3M B;  3I72 A;  1J9O A;  3OWF A;  5KYL A;  1SNQ A;  3I73 A;  2ZT9 C;  2C9O A;  3D3R A;  2O5I C;  1FGB D;  1G8Z D;  4X3K A;  1HFG A;  3P1H A;  1VDZ A;  3DMU A;  4RWS C;  2IWH A;  3VA5 A;  3KLS X;  4U67 3;  4ZLT F;  1MGS A;  1D5Z C;  5K36 G;  4DA2 A;  3HOV B;  3HG9 A;  2F0V A;  4E6I A;  1OXU A;  4A3B B;  2E75 C;  1SYD A;  2LMC B;  3Q6S A;  3FPP A;  3S2H B;  2JXM B;  2K33 A;  1F9S A;  1CA5 A;  2F0L A;  5D3I B;  2RBM A;  4P2C B;  1PRT B;  3FKI B;  2R61 A;  4TRD A;  4C56 C;  2BA1 A;  1TS3 A;  4IZ8 A;  2E74 C;  3RZO B;  1SNP A;  4RGN A;  4DU9 A;  3MC0 B;  3S1M B;  2L0C A;  1E0B A;  4IUT A;  4QIW B;  3TDQ A;  4A3M B;  1YNJ C;  4EQP A;  5CV7 A;  3QJY A;  1F9Q A;  1I6V C;  3NTH A;  2F0M A;  5IOD A;  3VR2 A;  2B2T C;  2IW3 A;  4QB4 A;  1ZEQ X;  3IFT A;  1MSG A;  1TY0 A;  3R8B A;  1PFN A;  4TKO B;  3Q24 A;  5J39 A;  3GTJ B;  1I4Q A;  4XQJ A;  1TS2 A;  4HAE A;  3NQI A;  2D2C C;  2EJF C;  4UDU C;  2BE5 C;  1HUN A;  4KN7 C;  1QCB D;  4IFD J;  4IQZ A;  3AU7 A;  3H91 A;  2IJ0 A;  1SDF A;  1WD1 A;  1KNE A;  1HHV A;  2Z1C A;  2XSC A;  5ELF A;  2QEJ C;  5JJZ A;  3P20 A;  3Q0A A;  2BDO A;  4C3H G;  2R93 B;  1KLG D;  3SXH A;  5I2Y A;  2E2H B;  1BCP C;  4IUU A;  3PO2 B;  1RJT A;  2F0J A;  1UNS A;  1GOZ A;  1XX8 A;  1EYA A;  3NTI A;  3BS1 A;  3J80 E;  1R9T B;  1W6K A;  1S5C D;  5EGT A;  4RAU C;  1WTO A;  3X3M A;  2NBF A;  5A35 A;  3URY A;  1I4P A;  1WTR A;  2AWN A;  3W2D A;  3I4M B;  1Q3L A;  4K14 A;  5CYU A;  3PUX A;  2ICI A;  2QIL A;  3C3L A;  5I4D A;  2PZU A;  4C1N K;  5DAU A;  5M5X B;  2BOS A;  4XYO A;  2WIN B;  3R2I A;  4XDX A;  4X3S A;  2A69 C;  1STY A;  2Q8R E;  2B2U A;  3BVM A;  5DEH A;  1ICW A;  2H4O A;  1SNM A;  1Y1V B;  2NTT A;  3D6C A;  3R93 A;  2HUG A;  1ROD A;  3PUY A;  3EFX D;  2EYH A;  2EDG A;  5BN4 A;  2RSO A;  1EU3 A;  2DNE A;  3SK5 A;  2PYK A;  4FF2 A;  1LLR D;  3DUZ A;  4MHE A;  3RUZ A;  2F0Q A;  2R3Z A;  3K0Y A;  3PMF A;  4AYB B;  3FVQ A;  4IUP A;  4PV1 C;  5LHY 1;  4BA2 I;  5IGG A;  3GTK B;  4M1U B;  1A3U A;  1HUM A;  1NAP A;  2SNS A;  2OT2 A;  3GO5 A;  3T16 A;  2XNA C;  1X32 A;  3NWS A;  2XN9 C;  5C0X J;  2JA6 B;  1VMC A;  3L3O C;  2I07 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...