1D1KA

Mutated shiga-like toxin b subunit (d17e/w34a) complexed with receptor gb3 analogue
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDEDTFTVKVGDKELFTNRANLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Toxin
molecule keywords SHIGA-LIKE TOXIN I SUBUNIT B
publication title Mutated Shiga-like toxin B subunit (D17E/W34A) complexed with receptor Gb3 analogue
rcsb
source organism Phage h30
total genus 16
structure length 69
sequence length 69
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 1999-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d1kA00
1QOHA 2BOSA 2XSCA 1D1KA 1DM0B 3MXGA 1R4PB 1CQFA 4ULLA 1BOSA 1D1IA 1C4QA 4M1UB 1CZWA 1QNUA 4P2CB 1R4QB 2C5CA 2GA4B 1CZGA 1C48A
chains in the Genus database with same CATH superfamily
3PO3B 4NXML 4KY5A 1C8CA 4RAUC 3HOUB 5KNDA 1GKHA 4CDEC 1ENFA 5JVH3 1D5XC 2G9DA 1E22A 4DF7A 1N9WA 1V43A 1HFGA 4BA1I 4UP9A 4EQPA 1V9PA 2Z8LA 3TZDA 1I6HB 3PUVA 2PW5A 1NJIC 3PCOB 4P74A 4Y7NB 2JA5G 4NXMQ 3M7GA 1S5CD 5KYIA 2XTIA 4WORA 4JV5L 3FMCA 1PFSA 2MGSA 2KVMA 1AZPA 1K9MC 4DV7Q 3JC66 2QILA 4QY7A 1KNEA 1TR5A 1KAAA 1JOQA 1O7IA 3MVVA 4P71A 1ZXTA 4ALPA 2L11A 3IFTA 1CA6A 3K57A 3K7AB 1XPOA 4DK0A 1NBWA 1S5FD 2B39A 3IFDA 3V96A 4JV5Q 4RHRA 2LMCB 5EGTA 2ASBA 1LTLA 3K5OA 5FLXE 5IP7H 4A93B 1YI2A 5I6WA 4ZKCB 3ND9A 1A3UA 1Q12A 2IY5B 4LFBL 1CKNB 5DM63 1OXUA 1LTBD 3M3YB 4RGMA 1BCPD 2JYOA 2DNCA 2E2JB 1SE3A 3GDEA 3W1BA 3KLWA 5C0XG 5C4XG 2AHOB 5M3FG 2JXMB 3TS0A 3EA6A 3I70A 2E2IB 5KEEA 3CCVA 4LFBQ 3J81L 1N33L 4DR6L 2I46A 2F0EA 1F2YA 1TS3A 2HD3A 3ITPA 3URYA 2RCFA 3QR8A 2ZTEA 5CV9A 5IP9H 3MZ5A 1F2LA 1VF7A 2Y0SE 2HIVA 3TQYA 3J80L 2XNAC 1AE3A 2R3ZA 3T13A 1A2UA 2B2WA 4A3KB 1N33Q 4DR6Q 2D0OA 1IYUA 1PRTD 3I4LA 5M5YH 3S1RH 2RF4A 2RVLA 4C2MH 4K6DA 4C1NI 1HQRD 2LSSA 1NMGA 1VQJA 4AYBB 1VCIA 1X65A 1L1OA 2R93H 3C3LA 4KHPL 3STBD 3WOEA 4I7ZC 4DPGA 3QIAA 1MJCA 5FK9C 4PV1C 2I5MX 5C3WA 1M90C 3ZJYC 4JG2A 4IPCA 3P1HA 3HOVH 1OO9B 4GN3B 2R61A 4KLKA 1JMCA 2NVQB 1NTGA 2HDLA 2IX0A 4K8IA 3OPOA 3RLFA 3X3MA 3EROA 5C3EH 4WFN3 3KBXA 2WV6D 1GUWA 3AEVA 2LY7A 5D14A 4JW0A 1AFPA 3S17B 1NAPA 3TREA 1U4RA 3S15B 4C3HH 1HJPA 2VW9A 3DWAA 1CT1D 2N49A 4YCWA 1TVXA 2C35B 3TSSA 2A6HD 2VB3X 3MWYW 2A73B 3ONAB 3JAMi 3H0GH 1SMYD 4A3GB 2XRSD 1HZAA 5E3FA 3EIVA 4MZ9A 2F4VQ 4CHTB 2XWBB 1M8AA 1L1OB 2FINB 1PH3A 3VR6A 5IP7G 4HSVA 3BYTB 1CM9A 3MXUA 4XIGS 3ERQA 5E4WC 2DN8A 2RQXA 4ZLTF 2ENBA 4EVOA 5DM73 4MIUA 3J81i 4HJ5A 2EXDA 1I4GA 3A8JE 2RHSB 3H09A 1RTNA 4IUUA 4HCEA 1JQYD 4HMJA 3DM3A 4KY6A 4UHVA 4GOPA 5EKLA 1LO5D 3RR5A 3SK6A 3T4AC 4A3IH 4A3MB 1SYEA 2E2HH 1ICFB 4X66L 3S16B 3GQBA 1BQQT 2NB0A 3C46A 4I7AA 5J22A 2FMCA 4XQQA 4Y52H 1AN8A 1QOHA 1KDAA 1STYA 2K05A 5NUCA 3NEMA 2K03A 1YEZA 2IPKD 2Z9HA 5IP9G 3JAMc 3BJUA 4BBRB 1KLGD 3OMCA 3GTOB 4IPDA 1L0WA 5L37A 4X66Q 2JSOA 1LYLA 3MXNA 2A5HA 2IJ0A 3E5SA 3SEBA 2P5ZX 1KRTA 2KQ3A 3TP7A 3X3NA 5JPMC 4B9XA 1F77A 3P20A 2R93G 2PMZE 2Y0SG 2MJ8A 2SDFA 3A7AB 1EQTA 5IYDH 1B8AA 1ASZA 3L2PA 3Q0AA 2NBFA 5EQ0A 4XQNA 2YYZA 1LT5D 1EY8A 5DEHA 1Y8OB 2R92B 2OXPA 1VS0A 4C3JB 1VF5C 2BH8A 3KOJA 2K5HA 4APVA 1S4ZA 3J7AF 4HIMA 3HOVG 1MI2A 2JA7H 1VQEA 5IY0A 4P75A 4KD3A 2YTVA 2XVSA 5C3EG 4A3EH 4JI0L 3OW7A 2IX3A 3KJPA 1X3QA 1XWEA 3V05A 2ZJQA 4LK1C 1B53A 2F0NA 3AMUA 2CQOA 1YHQA 1SLJA 3OYYA 1Y1WB 2RDHA 1OXSC 3R2TA 3RZOB 2KENA 5IIFA 1XYIA 4CJ0B 4C3HG 2WACA 1VQ9A 1A3VA 1V1PA 1N32L 2KECA 4GNXB 3MXNB 3CCQA 2ZTDA 1LTTD 1Q8IA 3OMGA 5C5MA 3H0GG 4RA8A 4XTCS 2K04A 1WD1A 1RHPA 4M1UB 1G6ZA 4BXXH 1NSNS 1HFNA 5GQOA 1NR2A 3CHBD 3I90A 1SROA 2AQ3B 4BY7H 5FLXc 1IXRA 4XT3B 3RZDB 1N32Q 2ICEC 1GUSA 1JORA 1TY2A 4L8JA 4UP7A 2JA6H 1II3A 4BA2I 1A62A 3PGZA 5ELBA 1WOCA 3NQTA 3WWVA 2MFIA 1X9NA 2JK8A 1X3PA 3NTKA 4NXNL 4DR2L 3GTPH 4A3IG 4LFAL 3B6YA 1HPCA 1VQ7A 1Q86C 3NTIA 2BA1A 2G5DA 1PH4A 3I4MB 3E9HA 2VQEL 1LACA 4IALA 3CMAA 1UE5A 3M9BA 2QGQA 2EYHA 3CPWA 2AUKA 5C4ZA 4DR2Q 4YWMA 4LFAQ 3S1NH 3MXPA 1IYJB 4LNQA 4DUYL 2EY1A 1SE2A 2VQEQ 1JOKA 1YNXA 1BBUA 2PZTA 5TSSA 2BH2A 4PQXA 3PO3H 3A5UA 3MTSA 2XN9C 5GROA 1M1KC 1DJRD 2Q2TA 3HOUH 5IYDG 1N34L 4QUFA 2Q2HA 5EPLA 4DUYQ 1CK1A 2YTYA 4LF9L 1VQMA 1VQBA 1GOZA 4DK3C 1PFNA 5T1IA 3D4DA 3TP6A 1KDBA 1I6HH 1TS2A 4L6TB 4OEMB 4POGA 1GUTA 3Q8DA 4JBWA 2HIXA 2UUCL 1QVFA 2KEDA 1VQLA 1B3QA 3C1EA 2VL6A 1MHWC 4IFDI 5AJ3L 2JEBI 1N34Q 3S14B 1YVCA 1Z47A 2JA7G 3AYHB 2LFNA 3F1ZA 4JI6L 1BNZA 4DV5L 4LF9Q 1G51A 1A6XA 1VQDA 3R8BA 4A3EG 2OWOA 2KCNA 4QL5A 2E8GA 1O78A 1VQIA 2WKCA 3NTHA 3KLSA 5FO8B 2ZM6L 3G6JB 1HNWL 2UUCQ 1B50A 1GHKA 3K7AH 3VYTA 2K5NA 5AJ3Q 3DHQA 1RD9D 4DR3L 4JI8L 2J0TD 4YY3L 1YNNC 4HJ7A 4JI6Q 4DV5Q 2PZUA 1FD7D 4A93H 2NWGA 2F0SA 1Q90A 1TWAB 4O42A 5C44H 1I4PA 3ICEA 4ULLA 3HZXA 3M3YH 4K0KL 2ZM6Q 2EZVA 4BXXG 4WJ3M 2RHQB 5M9OA 1X3EA 4O0AA 3ULLA 1LUZA 2E2JH 2F0UA 3HG9A 4BY7G 5FO9B 3PO2H 4DR3Q 4JI8Q 4YY3Q 3J7ZC 1MSGA 2F0GA 3CCMA 4CBVA 2GA4B 3RNUA 5GAGC 3WOFA 2JA6G 1VQ6A 3NHHA 1PV4A 2E2IH 2F0VA 2YU9B 3LGJA 1PDQA 1ZYRC 3W2DA 3NUCA 2JQOA 1KLUD 1JWSD 2NVYB 2DY8A 3CKIB 4JI5L 5CV7A 4GKKL 2MNAA 1IBML 1IHZA 4AYBE 2Z0SA 4YWLA 3H15A 2R6GA 4K6LA 2GVAA 2JA8B 5HGQA 4OWXB 3ULPA 4A3KH 5DLQE 1EFWA 2AQ1B 2D5DA 3GTMB 4XDXA 3OTOL 2L4NA 4GKKQ 3E9IA 4GLXA 4NP5A 1IBMQ 4J1MA 1SYCA 4IUPA 1R4PB 2D2CC 4NMZA 1XMQL 1DONA 2L1BA 4FXGC 3ZYYX 2H4OA 2Z1CA 2YTXA 3L3OC 5IYBH 2NN6I 2K1BA 3ND8A 1DD2A 2N8NA 4HTHA 1X54A 5D65A 5J1ZA 4HJ8A 1GXDC 1PZID 2A6EC 3VA5A 3OTOQ 1XMOL 1XXGA 2QCPX 3NENA 3L9AX 3GTQB 3PO3G 1K83B 4GOPC 5JEAH 1XMQQ 4A76A 1HA6A 3G6EA 1CQFA 1CA5A 2A68C 4PZ8A 3BZCA 2EYMA 2M9VA 3ER0A 5ELOA 4J15A 1T9HA 2NVQH 4IUTA 1HUMA 4RFBA 1XMOQ 2Z4IA 1BR9A 2L12A 4OIJA 1V1QA 1J6QA 2B2YC 1BKBA 4UAIA 1IL2A 1C48A 4LF5L 3S1MH 3S17H 1Y14B 4GN5A 3S9WA 1HHVA 5CBEE 5KNCA 3HOZB 5F2DA 3S15H 2N3SA 3EVQA 2VZAA 5BN4A 2ID0A 5HGTA 3QOLA 3P75A 1JJGA 3M4PA 4A3GH 3QG1A 2EJGC 1LM0A 1JWUD 1VQOA 4LF5Q 4FP5D 4A93G 5IWAL 4DXFA 3CC4A 5EBDA 2J4XA 1A2TA 2ZT9C 1D2BA 3KDFA 5C44G 2I5LX 2RA4A 1EY7A 1U5KA 5G3LD 1PH7A 1D7QA 2UUAQ 1T5EA 3LWUA 3RUZA 1ET6A 1IL8A 4QB4A 3PO2G 4RCNA 1JICA 1UE7A 1J5EL 1VQKA 4AQYL 5EBCA 1Y1VB 5IWAQ 1C9OA 2B63B 3WDNA 4K14A 3NBHA 4A3MH 4LF7L 2NTTA 3H3VC 3S16H 4BWGB 1Z7TA 2HDMA 4LW1A 1PVOA 2FMMA 4XQJA 1JE4A 4QJFA 3T51B 5D3IB 4JBMA 1STNA 3KYHC 3VR2A 4LAAA 1J5EQ 4AQYQ 1FJGL 1H9SA 2SOBA 3AFPA 1CZWA 4BBRH 5FOBB 4H02A 3GTOH 4LF7Q 1RIPA 1G2SA 3DM1A 4A3KG 4RGTA 5E4XA 4X64L 2CVRA 3L7ZC 1PH5A 1B1ZA 1RL2A 2EY6A 5M3MB 4DNIA 2WB1B 3F2UA 1SBBB 1S40A 2O2LD 4AYBG 2E2DC 3MEFA 1SNCA 3JAML 4IOCA 1K3BC 3T56B 1FJGQ 2ZTCA 2OEOA 5IGGA 3A8IE 5IYBG 3KDFB 3U4VA 4X64Q 1G6PA 2QA4A 2R7FA 2TMPA 1QCBD 3CMEA 5JJIA 1EU4A 1PH1A 4QCLA 4LF8L 2R92H 4V190 5JEAG 4FF4A 2F0KA 4C3JH 1AZQA 3E3XA 1T5XD 4IO9A 3G71A 1WYDA 4K8JA 2BOSA 2L0CA 4EQNA 1QVCA 3HOXH 1KC8C 5M5XH 3NBHB 3C2PA 1B2TA 1NCVA 1BOSA 1D1IA 3BDOA 4OHJA 1HCZA 3RLNA 3CQZB 4RGNA 2OTLA 4FNFA 1E0BA 4X3UA 1EY0A 2JN4A 4LF8Q 3FKIH 4E6IA 1PH8A 2QW7A 2JA5B 1QG7A 1WTVA 3J7A5 1Z9FA 3GTGB 5EKIA 1B3AA 3HEJA 1H9SB 3E0JA 1STBA 2D0PA 1Y1WH 3A5ZB 1FVIA 1EYDA 1UNSA 2IHFA 3R93A 1AE2A 1HUNA 1SYDA 1U4LA 4DK1A 3BS1A 1HZBA 4TSSA 3QO2A 4HCSA 4X3KA 4H0LC 1QUQA 4A3GG 3DEPA 3I73A 1IBLL 4KJNA 1JC7A 3TP5A 5KYLA 3F2BA 2KA7A 4ME5A 4UPAA 3KF6A 4TRDA 2BDOA 1JE5A 1X3GA 3E6ZX 4X3SA 4PMWA 4WJWA 4DR4L 1H9MA 1QZHA 1BVSA 4FYDA 2SNSA 4KHPQ 1VQ8A 3GTJB 1IYVA 1IBLQ 1WTWA 1GUNA 3M4YA 4XXEA 1VQPA 2UU9L 1C0AA 1K8MA 3OWEB 1CI3M 1I4QA 5FLXL 4A3MG 1CHPD 4CDFC 1VDZA 4DR4Q 1PYWD 2K32A 4IFDJ 3RN5A 3A7LA 1V8QA 1Q7YC 2RSNA 3KFUA 1GHJA 5H1SE 4IURA 1PYBA 3U4ZA 4KV6A 1L0YB 4B9WA 2UU9Q 3PUWA 2LS01 1TS4A 3RD4A 4DV1L 3DUZA 4K5XA 4UDUC 5CV8A 4BBRG 2EYLA 4UP8A 1HA5A 4MTNA 1QILA 2A69C 3IRBA 3CCUA 4YCVA 1TWFB 1EU3A 2CKZB 4FF3A 1PTOF 4M8AA 3A54A 1QUQB 5IGDA 2E5LL 4PMCA 2SEBD 3CD6A 1GUOA 2NVXH 4DV1Q 2EY2A 4F88A 4L5RC 1EFID 1B4OA 2LKVA 4FF1A 2F3IA 4RH6A 4LJZC 2VB2X 1CKOA 2Q8RE 2RDFA 2WAQB 1EIFA 3KF6B 3QWNA 5IGBA 1X3FA 4QIWE 1EY4A 1FL0A 3MAQA 4Z9CB 3PF5A 3OOCA 1DGSA 3G4SA 2E5LQ 2R92G 4HSPA 1ET9A 4I65A 4C3JG 1TWGB 1N36L 4A3DB 2V1CC 1E7ZA 4KY7A 4DAYA 1JJCB 2EYPA 3MA2B 1BDOA 1RKNA 3HOXG 1U4MA 4KK7A 4NDXA 1WVLA 2OT2A 4G4KA 1EZ6A 2CW0C 5ELDA 1Q1EA 1I4RA 2IT1A 3HS0C 3FKIG 5I9PA 1N36Q 2B2YA 4A4IA 4CKBA 4P2CB 4RKBA 2CCZA 4DR7L 4JI1L 2Z4HA 1W3SA 1Y1WG 1SFOB 1YHBA 4KKUA 1K28A 1STGA 3G7LA 3FRPB 2CFMA 3PUXA 3I3CA 1PMRA 4OXPA 3H3VI 1KNAA 5EJWA 2ATWA 2HT1A 2I5HA 3KUPA 1TWAH 2RDGA 2L15A 4JK1C 1BF4A 2PCFB 4DR7Q 4JI1Q 4G7ZC 4U673 3BG3A 1W2BA 1RJTA 2KHIA 4YHHL 5C4JB 3HOWH 1H95A 2WIIB 4DA2A 1VQ4A 1EIHA 4B3TL 2EPBA 1KHIA 3NK9A 3Q22A 2NZHA 1E3PA 1NNXA 4GOPB 2YU9H 3NE5B 4DAYB 4KN4C 1BUVT 2NVYH 4ZAIA 1H9KA 4R4CA 1O7LA 4YHHQ 3PIP3 2PPBC 3S24A 1SYBA 1QNUA 2K14A 4L63B 3SDZA 5JJKA 2JA8H 1YHAA 4B3TQ 5C4HA 1IBKL 3R3OA 4GLVB 3GTMH 1I3QB 1HQMC 1YJNA 3EJIA 3FHWA 3HKZB 4YIJA 1EY9A 2MP1A 2K5DA 1LT4D 2J7ZA 1E2VA 2N88A 3CU7A 5KRUA 3MFGA 4A3FB 1WI5A 1WTPA 4IUVA 1LTID 1PTOC 1G91A 1WTOA 1QNKA 4FF2A 2WKDA 1TU2B 3TRZA 2HCCA 2UXDL 1VQ5A 1EOVA 2MUYA 1IBKQ 4G57A 3K0XA 3NXWA 3O13A 4DUZL 1U9RA 3NQIA 1CQVA 5ELNA 3GTQH 1K83H 2PO4A 4Q0FA 5E1FA 1DOLA 4IFDH 4PMBA 4C3IH 1UE6A 5JJLA 2XSCA 2M2LA 3TN2A 2EVBA 5IYCH 2EOTA 1CSQA 4TVAB 1PXUA 2NUCA 4KTAA 1DYQA 2F3VA 5JJZA 3I4NH 1WCMB 4HJAA 4DUZQ 2EYFA 1JB7A 1YNJD 3FP9A 4ME3A 1SNQA 2K6AA 4HJ9A 4JI4L 1G2TA 3VYUA 1KRSA 4K5WA 1R9TB 4GS3A 3HOVB 3HOZH 4R4OA 1S5BD 3FPUB 2JJQA 4DNTB 3D4RA 2B3GA 1LLRD 1YZ6A 1KQSA 1YITA 2MO0A 4NXNQ 1TQOA 1V1PB 3U50C 2K75A 3CC2A 3TP8A 4JI4Q 3PIO3 4A3JB 1SXTA 5LMNL 3NBIA 5CBAE 1EOTA 2ZJRA 1SE4A 1RTOA 4GLAC 1ZYRD 1DOKA 1TWCB 4HIKA 1SYGA 1KABA 3EBEA 1I4HA 3UI2A 4PG3A 3T1HL 1PH9A 4BY1B 1Q46A 3KLRA 2DY7A 5EAYA 3K0YA 4EGVA 4HEDA 2B2UC 2JA9A 1MSHA 2EY5A 4OX9L 1EQQA 4JYAL 1XTCD 5C6AA 4R4TA 3HOWG 2O5JC 4RHSA 1Y1VH 1D5ZC 4Y7NH 3T1HQ 1IKMA 1IW7C 5ELFA 2A8VA 1HNXL 2FJ2A 1YJWA 3GV6A 2GVBA 1IKLA 2H5XA 3PUYA 1VQCA 3SR1A 4DV2L 3U9SA 1D1KA 1XNRL 5CV4A 1WTHA 2WB1E 4MNOA 4JYAQ 1Y8PB 4OO1I 2A6ED 3KJOA 4IJLA 2EDGA 3BYYB 2VQFL 2JA8G 2E2HB 1UUPA 4F8MA 4AIMA 2AWNA 1ILPA 1EY6A 4DV2Q 3J7YW 1XNRQ 5LL6S 3LNNA 5M3MH 2A68D 2F1MA 4S3SA 4QQBX 3H6MA 2L5TA 2BE5D 4L5QA 1PH2A 1MKHA 2VQFQ 5T1GA 1HNWQ 5FLMH 4X65L 3CCSA 4H7BA 4N9TA 2KHSA 2K01A 1D8LA 2I0QA 2QEXA 2K28A 3A55A 2ZXOA 1TXYA 1E24A 4RMFA 5CV6A 4IFDG 1UE1A 4C3IG 1K73C 3GTLB 2F0PA 5IGEA 5IYCG 1JOOA 3HKSA 4DKAC 5LMNW 3OHXC 3M4OB 4K0KQ 4X65Q 2NZOA 3K5MA 2EJMA 3MC0B 1C4QA 2HCIA 3I4NG 5KNBA 3CQZH 5FKAC 3TEHB 4LUOA 3P7JA 5M5WB 4DAMA 2AQ2B 4KKSA 4BBSB 1WFQA 3PQIA 1TS5A 4K2LA 4YWKA 3GTGH 3DWQA 2PMZB 4LFCL 1VQGA 2BDNA 5JPNC 3K7UC 4UY8C 4ZK9B 3HOZG 5I4DA 4A3CH 4JI5Q 5CGKA 3HOYB 3TMEA 4JC0A 2F0DA 5IT9c 3PUZA 4A3EB 3AB9A 1ENAA 5C5LA 2E74C 3K6OA 2B8GA 3W5OA 4CKEA 1JCKB 3K81C 1RDPD 2PW7A 2ZXRA 4LFCQ 1NR4A 1E1OA 5LL6X 1FYCA 2KCMA 5I6YA 3VR3A 2KHJA 4RKLA 4DGZA 3I8ZA 2ZXPA 1ASYA 2O4XA 1L0XB 4X62L 1SNMA 3HOUG 1HNZL 2CH4A 1IZ6A 2VUMB 1XJVA 2EQSA 4FVMA 2IW3A 1F9QA 1LTRD 4A3BB 3GTJH 1H9JA 1H9RA 3BVGA 1ILQA 3S2HB 1NMFA 3I91A 4DV0L 4BY7B 1ESRA 1Y1VG 1KDCA 1WTRA 1GO3E 1BO0A 3FDTA 3M85A 4X62Q 2OF1A 1HNZQ 3RMHA 2V4DA 3I2ZA 2B2TC 5IGFA 1I50B 1RF2D 2LXKA 4LWCA 2AKWB 1VQAA 2F0QA 4IQZA 3A8KE 3IAYA 4DV0Q 4YCUA 3VYSA 3S2DB 3UDGA 2NVTB 3GTPB 2WAQE 1P8LA 2PZWA 3D3RA 5HY6A 3VYRA 3F2CA 4R1JA 3CF5A 5CMDA 1MBYA 2CHBD 2UXBL 2Q2IA 3FPPA 1HR0W 2K5QA 4J8QA 2A74C 2EXZA 5M3MG 1CSPA 1EIGA 2KJXA 2WB1G 3NWSA 4TKOB 1L2FA 1QB5D 2RCNA 4JOIC 5FLMG 2KUMA 3SE0A 4EQ5A 3DLLA 5LMUL 4KI0A 4XT1B 3M7NA 2UXBQ 1PZJD 5CYUA 1F9PA 1CKNA 2EYJA 1TWGH 3J80E 2D9UA 4A3DH 5EPJA 4KKTA 4HIOA 2R7ZB 2WINB 3CW2C 3SGIA 3GD7A 2Q8IB 1EUJA 5LMUQ 4DV7L 2JE6I 2OQKA 2F0FA 1ZEQX 3KK7A 1TKWB 5J39A 1OXTA 3ERSX 4XYQA 1FGUA 3LWEA 4ZQ3A 1AEXA 3D4WA 5C0XI 3W1GA 1FGBD 1BCPF 3CCEA 1SFOH 4RWSC 2HHHL 1STEA 2VS1A 4IN3A 4A75A 1B70B 4A3CG 4HAEA 1A3TA 3K5NA 4KD4A 3K8AA 3J7AV 1TWHB 3L0OA 1JWMD 1CTMA 4MN3A 4G7OC 1CFMA 4DV6L 4LF6L 4ZUJA 5FO7B 1HTPA 2HHHQ 1PTOB 4POFA 1JT8A 1ESFA 1VQFA 3TBIB 3HP3A 5C4JH 2PNHA 1SN8A 1PH6A 3MHBA 1CUKA 4R9WA 1EIYB 3BVZA 5C44B 1E2WA 2Z6BA 1BBXC 3E0EA 4IJHA 1WTQA 3HKZE 2B2UA 2A69D 4DV6Q 1PRTF 2L55A 3UDIA 4LF6Q 1MIUA 1ZKOA 2PNRC 3PO2B 5D3DA 1E1TA 3DXJC 2E76C 2FXQA 2RBMA 1UAPA 2F0HA 3K5LA 2GN5A 1LT3D 3I7FA 3GTKB 3CP0A 3HGBA 3RZOH 1I3QH 5KIXA 2EYOA 4DV3L 3ULJA 1DM0B 3T16A 2B8FA 2SNMA 3K58A 1TY0A 3F2DA 3OSOA 3MFYA 2UXCL 1QZGA 2WFWA 1YBYA 4A3FH 3UE1A 3CXCA 3W3AA 1BBWA 2JP1A 4MHEA 3A74A 1NUCA 4ODGA 4CDDC 2PI2A 3I4OA 1A63A 4TQUS 2DNEA 1GJXA 1EWHA 3VR5A 5FJ8H 2EIFA 4DV3Q 3Q24A 3RZDH 2QDBA 3SHLA 3H94A 2CW0D 1SYFA 3HRZC 4WRDA 2UXCQ 2WAQG 1F2MA 1SNDA 1UEAB 1D6EC 3A56A 1XX8A 1A15A 2XGTA 3NPPA 2HQLA 1RODA 1WCMH 2ZJPA 4OL7A 1SNOA 4CGYB 4IOAA 4U68A 1R4QB 1SDFA 2B2VA 4DU9A 2XWJB 4A3DG 4QUCA 5C4XB 4GZYC 1UWVA 5M3FB 1VQHA 3VA7A 4F7XA 3I4MH 1KXLA 4B3SL 1P16A 1G291 2F0LA 1R9TH 2D62A 1KTKA 3H3VH 3V2TA 1EQRA 1KAWA 2DUDA 1GUGA 1EY5A 1B9MA 1I6VC 1EZ8A 1EYAA 4JPBW 5IE8A 3NELA 2IX1A 1BCPC 1Q82C 1CHQD 3GO5A 4CJ2C 4PZ7A 2F4VL 2L9HA 2OCEA 3KBGA 4A3JH 4B3SQ 1O7ZA 3S1MB 4KHVA 3SVMA 1K0RA 4CDCC 2F03A 1TWCH 3S1QB 3VDYA 3D31A 4L5TA 4RG1A 4BY1H 3OIPA 2VY3A 1PZKD 2M00A 4KJOA 4PNYA 4KMUC 1FNUA 5GAEC 2FFKB 2K4KA 5E7NA 1S5DD 4A3LH 4JVZA 3NWTA 4XYOA 1QJOA 2MQHA 2VNUD 2PQAA 4DK6C 3DEOA 1AW7A 3T1YL 1AH9A 4FXKC 1PRTC 4H13C 1BXTA 1F9SA 3T53B 1PA6A 3G48A 3PIPA 3S14H 2QDLA 4OIKA 1SNPA 1PTOD 2PQEA 5K5PA 4JI7L 2CWAA 3D0FA 3CRLC 2AUJD 3CPFA 5IT9E 3SXHA 3STBC 2X6GA 2OQ0A 1U0LA 4NKLA 3J80i 3T1YQ 2E75C 4LMQD 2B2TA 3VR4A 4ZCKA 1SSOA 3Q23A 2QKIC 3HKZG 4JI7Q 4V0BA 1LT6D 4CKCA 4G7HC 3K80C 4BS9A 1X56A 2B29A 1HRJA 2IHEA 4A3FG 4IPGA 1J8IA 3GV3A 3I55A 1F9RA 5CR3A 1FNVA 1M4VA 2XRQD 2O5IC 1A0IA 4DV4L 1I4XA 4GNXA 5CORA 5FJ8G 1J9OA 3BU2A 1QVGA 1X32A 5ELCA 1TIID 1EWIA 1QWYA 4R8IA 4C56C 4K2KA 4O2DA 1I5FA 1A8VA 1GVPA 3J81c 5K36H 3GTLH 4P72A 4JOIA 4OELB 4JI2L 1HH2P 3M4OH 2K33A 2PQAB 4HMIA 4FDBA 5I9OA 2KCTA 1WCMG 4HR7B 4DV4Q 4J6HA 2A6HC 3OIQA 4LF4L 4DN4M 1VMPA 2Z6KC 2H1EA 2I07B 1SMYC 5M5WH 3J80c 4BBSH 4FO2A 3I4MG 2F3WA 1SEBD 2K52A 4JI2Q 3CAMA 3HOXB 3N6RA 5M5XB 2Q8TA 5EPKA 4X3TA 2F0MA 3EQLC 3FEWX 4LUZA 3QOJA 2N55A 3HOYH 4K5VA 3NP8A 1V1OA 3PIOA 1HTLD 4LF4Q 3KF8A 3FKIB 3I56A 3CCJA 4QGUA 3R2IA 4C1NK 1EEFD 2HQEA 1DCZA 2MPMA 4A3JG 1IW7D 5A35A 5M5YB 3S1RB 4OGQC 1K8AC 4IUQA 4C2MB 1PLFA 4OWTB 1W6JA 3AFQA 2TSSA 4L5SA 4BY1G 1XPRA 5DNFA 1ENCA 2HUGA 2X69A 2R93B 5IT9L 2VUMH 3CCRA 2Y0SB 1Q1BA 1S5ED 5HURA 1ML0D 5GAHC 1LTAD 3F8TA 3BZDB 1RCVD 4A3BH 2UXDQ 3NSWA 4A3LG 4OO1H 2BCOA 4OWWB 2OTJA 3S2HH 2F0WA 2QEJC 3HFZB 4ABNA 3CC7A 1YNND 1ONLA 2VXWA 4QMGA 2UUBL 1OXVA 2RSOA 2CWPA 2K5VA 5IGCA 5JOBA 4N8X1 3UDFA 1I50H 3TZUA 2MO1A 1U4PA 2NZ1D 2F0TA 1Y8NB 4B3ML 3AQQA 1YJ9A 4HN7A 3S2DH 3OWFA 3DWPA 5IODA 5C3EB 2NVTH 5AFWA 3U58A 4DR5L 5C0XJ 5ISRA 4NW2A 4DXGA 3RN2A 4ILWA 5JEAJ 5A2QE 2K7VA 2UUBQ 1CKMA 2DJGC 4ZRZA 2X6LA 4RCOA 3KF8B 2K50A 2IL8A 3FVQA 4R4QA 4C3HB 4GKJL 1I94L 4B3MQ 1O80A 2DJFC 2F52A 3PMFA 1QE6A 3QJYA 1B9NA 1NY4A 4DR5Q 3H0GB 3K59A 1EL0A 3BZKA 2PYKA 5I2YA 1EQVA 5LMNQ 4X6AH 3QB3A 4R8NA 4DR1L 4H44C 1HXYD 2C5CA 1SJHD 2NTSA 1CZGA 4DAVA 2NVXB 4ZKBB 3D6WA 1I94Q 4GKJQ 2B63H 4FXDA 3OW2A 5K36G 5BN5A 5J3BA 2N78A 2KOLA 4R4IA 2R7ZH 4DFAA 3IKJA 1N8RC 1B44D 1STAA 4JI0Q 1D5MC 4OX9Q 2RKSA 1K3RA 3D8GA 5CC4A 3SK8A 4DR1Q 1EYGA 4N8FA 2Q2UA 4BBSG 4A3IB 4F87A 2NN6H 1PYSB 1HNXQ 2B2WC 2G9HD 1B7YB 4P73A 3AU7A 1VMCA 1TT2A 3A0JA 4QIWB 3PSIA 3HOYG 1EWCA 5LHY1 4EX5A 1LTGD 1OXXK 1XPUA 1TWHH 3GP7A 4DNRB 1PFMA 1SRUA 4Q5VA 1L1OC 2F0OA 4O1NA 2DGYA 4PZ6A 3RLOA 1NE3A 1KD1C 4IZ8A 2R7DA 1G8ZD 2MHVA 3I72A 1WTXA 2F0JA 5KGUA 1PTOH 5GADC 1SAPA 1YNJC 3EN2A 1Q81C 2B2VC 1YIJA 5CV5A 2AWOA 2EJFC 5COYA 2VUMG 1WD0A 4ID6A 4HIDA 3IL8A 4A3BG 3C1FA 5A2QL 2BA0A 2IWHA 4OO1G 1X6OA 1HZCA 5BR8L 1HR0L 1Z6HA 3CRKC 3HOWB 3D6CA 1GM5A 1AP0A 1SMXA 3PV0A 2JA5H 4QF4A 1SJED 2C9OA 2WP8J 3GTKH 4JCVE 1JB3A 4JI3L 2JA7B 3M4QA 3TS2A 3MXGA 1KIXA 5BR8Q 5BN3A 2ALYB 4ZUIA 1HR0Q 2FHTA 3N52A 1K0SA 2KBNA 4ZYSA 2KCCA 1LABA 2EE1A 2CQAA 2AMCB 3MEHA 4LUVA 1BCPB 4CJ1B 3Q6SA 5EKKA 4JI3Q 3BDCA 5JAVA 4B3RL 3LX0A 5DAUA 4NB3A 1E2ZA 1ICWA 2XIWA 4NPSA 5I2XA 1SE8A 1PHJA 5C3XA 1STHA 2JEAI 1MJEA 4GN4B 1O7YA 1Q3LA 3SK4A 2F0IA 1S72A 4B3RQ 1EYCA 1MGSA 2K5WA 3UE0A 1JJ2A 1LV9A 2B63G 5C0XH 5C4XH 1SR3A 3BVMA 1OTCA 2JA6B 2R7ZG 5M3FH 4C3IB 4KN7C 1JR0D 1C7YA 1K8GA 4JBJA 4AH6A 3J81j 1PRTB 1VQNA 1X55A 2PI2E 4B08A 3I4NB 4KHZA 5ELEA 2BE5C 3CCLA 4IUNA 3JAME 3TDQA 1PFBA 2Z6KA 1W6KA 4WJ4A 2NN6G 5IOCA 4DAPA 5G3LF 1DZ1A 5JVG3 1TWFH 1DXMA 2ICIA 2KEEA 2CH4W 2A1AA 3BDLA 3U9OA 4JBKA 1XNQL 3H91A 1EEID 3EFXD 2F4IA 4GNXC 4IPHA 4EQOA 1Y69U 2ES2A 3DMUA 4MTKA 1S3OA 1UEBA 4RGOS 3S1QH 1WJJA 1XTDA 3KLSX 3J81E 4OONA 2NYZD 3S1NB 1MD2D 1DOMA 3PF4A 1FNWA 4N9PA 2UUAL 1KL9A 1GD7A 1HZ9A 1K8OA 1XNQQ 2A19A 1F2ZA 3UDXA 1LTSD 3SK5A 2YV5A 2QF7A 1FR3A 1Q8KA 2LXJA
chains in the Genus database with same CATH topology
3PO3B 4KY5A 1C8CA 4RAUC 3HOUB 5KNDA 1ENFA 5JVH3 1D5XC 2G9DA 4DF7A 1V43A 1HFGA 4BA1I 4EQPA 2Z8LA 3TZDA 1I6HB 3PUVA 2PW5A 4Y7NB 3M7GA 1S5CD 5KYIA 4WORA 3FMCA 2MGSA 2KVMA 1AZPA 2QILA 1KNEA 1TR5A 1KAAA 1JOQA 3MVVA 1ZXTA 2L11A 3IFTA 1CA6A 3K57A 3K7AB 4DK0A 2B39A 1S5FD 3IFDA 3V96A 4RHRA 2LMCB 5EGTA 3K5OA 5FLXE 4A93B 5I6WA 4ZKCB 3ND9A 1A3UA 1Q12A 5DM63 1OXUA 1LTBD 3M3YB 4RGMA 1BCPD 2JYOA 2DNCA 2E2JB 1SE3A 5C0XG 2JXMB 3EA6A 3I70A 2E2IB 5KEEA 3J81L 2I46A 2F0EA 1F2YA 1TS3A 3ITPA 3URYA 5CV9A 3MZ5A 1F2LA 1VF7A 3J80L 2XNAC 2R3ZA 3T13A 1A2UA 2B2WA 4A3KB 1IYUA 1PRTD 3I4LA 2RVLA 4K6DA 4C1NI 1HQRD 4AYBB 1VCIA 3C3LA 3WOEA 4I7ZC 3QIAA 5FK9C 4PV1C 5C3WA 3P1HA 1OO9B 2R61A 2NVQB 2HDLA 2IX0A 4K8IA 3OPOA 3RLFA 3X3MA 3EROA 4WFN3 3KBXA 2WV6D 1GUWA 2LY7A 5D14A 1AFPA 3S17B 1NAPA 1U4RA 3S15B 3DWAA 1CT1D 1TVXA 3TSSA 2A6HD 2VB3X 3MWYW 2A73B 3ONAB 1SMYD 4A3GB 2XRSD 5E3FA 4CHTB 2XWBB 1M8AA 2FINB 3VR6A 4HSVA 3BYTB 1CM9A 3MXUA 4XIGS 3ERQA 5E4WC 2DN8A 2RQXA 4ZLTF 2ENBA 4EVOA 5DM73 4MIUA 1I4GA 3A8JE 3H09A 1RTNA 4IUUA 4HCEA 1JQYD 4HMJA 4KY6A 5EKLA 1LO5D 3SK6A 3T4AC 4A3MB 1SYEA 3S16B 3GQBA 1BQQT 2NB0A 3C46A 5J22A 2FMCA 4XQQA 1AN8A 1QOHA 1KDAA 1STYA 2K05A 5NUCA 2K03A 2IPKD 4BBRB 1KLGD 3OMCA 3GTOB 2JSOA 3MXNA 2A5HA 2IJ0A 3E5SA 3SEBA 2KQ3A 3TP7A 3X3NA 5JPMC 4B9XA 1F77A 3P20A 2MJ8A 2SDFA 3A7AB 1EQTA 3Q0AA 2NBFA 5EQ0A 4XQNA 2YYZA 1LT5D 1EY8A 5DEHA 1Y8OB 2R92B 2OXPA 4C3JB 1VF5C 1S4ZA 3J7AF 1MI2A 4KD3A 2XVSA 3OW7A 2IX3A 1X3QA 1XWEA 3V05A 4LK1C 1B53A 2F0NA 3AMUA 1Y1WB 2RDHA 1OXSC 3R2TA 3RZOB 5IIFA 1XYIA 4CJ0B 4C3HG 2WACA 1A3VA 1V1PA 2KECA 1LTTD 1Q8IA 3OMGA 5C5MA 4RA8A 4XTCS 2K04A 1WD1A 1RHPA 4M1UB 1G6ZA 1NSNS 1HFNA 1NR2A 3CHBD 3I90A 2AQ3B 4XT3B 3RZDB 2ICEC 1GUSA 1JORA 1TY2A 4L8JA 1II3A 4BA2I 5ELBA 3NQTA 3NTKA 1X3PA 1HPCA 3NTIA 2BA1A 3I4MB 1LACA 4IALA 2EYHA 2AUKA 5C4ZA 3MXPA 2EY1A 1SE2A 1JOKA 2PZTA 5TSSA 4PQXA 3MTSA 2XN9C 1DJRD 4QUFA 5EPLA 1CK1A 1GOZA 1PFNA 5T1IA 3D4DA 3TP6A 1KDBA 1TS2A 4L6TB 1GUTA 4JBWA 2KEDA 3C1EA 4IFDI 2JEBI 3S14B 1Z47A 2LFNA 1BNZA 1A6XA 3R8BA 2KCNA 1O78A 2WKCA 3NTHA 3KLSA 5FO8B 1B50A 3G6JB 1GHKA 3VYTA 3DHQA 1RD9D 2J0TD 1YNNC 2PZUA 1FD7D 2NWGA 2F0SA 1Q90A 1TWAB 4O42A 1I4PA 4ULLA 3HZXA 2EZVA 5M9OA 2F0UA 3HG9A 5FO9B 1MSGA 2F0GA 4CBVA 2GA4B 3WOFA 3NHHA 2F0VA 2YU9B 1PDQA 1ZYRC 3W2DA 3NUCA 2NVYB 1KLUD 1JWSD 3CKIB 2DY8A 5CV7A 1IHZA 2R6GA 4K6LA 2JA8B 2AQ1B 2D5DA 3GTMB 4XDXA 2L4NA 4NP5A 4J1MA 1SYCA 4IUPA 1R4PB 2D2CC 4NMZA 1DONA 2L1BA 4FXGC 3ZYYX 2H4OA 2Z1CA 3L3OC 2NN6I 2K1BA 3ND8A 1DD2A 4HTHA 5D65A 5J1ZA 1GXDC 1PZID 2A6EC 3VA5A 1XXGA 2QCPX 3L9AX 3GTQB 1K83B 5JEAH 1HA6A 1CQFA 1CA5A 2A68C 2EYMA 2M9VA 4IUTA 1HUMA 4RFBA 2Z4IA 1BR9A 2L12A 4OIJA 2B2YC 4UAIA 1C48A 3S9WA 1HHVA 5CBEE 5KNCA 3HOZB 5F2DA 3EVQA 5BN4A 2ID0A 5HGTA 3QOLA 3P75A 3QG1A 2EJGC 1JWUD 4FP5D 4DXFA 5EBDA 2J4XA 1A2TA 2ZT9C 1D2BA 2RA4A 1EY7A 5G3LD 1T5EA 3LWUA 3RUZA 1ET6A 1IL8A 4QB4A 4RCNA 1JICA 5EBCA 1Y1VB 2B63B 3WDNA 4K14A 3NBHA 2NTTA 3H3VC 4BWGB 1Z7TA 2HDMA 2FMMA 4XQJA 1JE4A 3T51B 5D3IB 1STNA 3VR2A 4LAAA 1H9SA 2SOBA 1CZWA 5FOBB 1G2SA 3DM1A 4RGTA 5E4XA 2CVRA 3L7ZC 1B1ZA 2EY6A 5M3MB 2WB1B 3F2UA 1SBBB 2O2LD 2E2DC 1SNCA 3JAML 3T56B 2OEOA 5IGGA 3A8IE 2TMPA 1QCBD 1EU4A 4QCLA 4V190 5JEAG 4FF4A 2F0KA 1AZQA 1T5XD 4K8JA 2BOSA 2L0CA 4EQNA 3C2PA 1B2TA 1NCVA 1BOSA 1D1IA 3BDOA 4OHJA 1HCZA 3CQZB 4RGNA 4FNFA 1E0BA 4X3UA 1EY0A 4E6IA 2JA5B 1QG7A 1WTVA 3GTGB 5EKIA 1B3AA 3HEJA 1H9SB 3E0JA 1STBA 1EYDA 1UNSA 3R93A 1HUNA 1SYDA 1U4LA 4DK1A 3BS1A 4TSSA 3QO2A 4HCSA 4X3KA 4H0LC 3DEPA 3I73A 4KJNA 1JC7A 3TP5A 5KYLA 2KA7A 4ME5A 4TRDA 2BDOA 3E6ZX 4X3SA 4PMWA 4WJWA 1H9MA 4FYDA 2SNSA 3GTJB 1IYVA 1WTWA 1GUNA 3M4YA 4XXEA 1K8MA 3OWEB 1CI3M 1I4QA 5FLXL 1CHPD 1VDZA 1PYWD 2K32A 4IFDJ 3A7LA 1V8QA 2RSNA 1GHJA 4IURA 4KV6A 1L0YB 4B9WA 3PUWA 2LS01 1TS4A 3RD4A 3DUZA 4K5XA 4UDUC 5CV8A 2EYLA 1HA5A 1QILA 2A69C 1TWFB 1EU3A 4FF3A 1PTOF 4M8AA 3A54A 5IGDA 4PMCA 2SEBD 1GUOA 2EY2A 4F88A 1EFID 1B4OA 2LKVA 4FF1A 4RH6A 4LJZC 2VB2X 5IGBA 2Q8RE 2RDFA 2WAQB 3QWNA 1EY4A 3MAQA 4Z9CB 3OOCA 4HSPA 1ET9A 4I65A 4C3JG 1TWGB 4A3DB 4KY7A 4DAYA 2EYPA 3MA2B 1BDOA 1RKNA 1U4MA 4KK7A 4NDXA 1WVLA 2OT2A 4G4KA 1EZ6A 2CW0C 5ELDA 1Q1EA 1I4RA 2IT1A 3HS0C 5I9PA 2B2YA 4CKBA 4P2CB 4RKBA 2Z4HA 1SFOB 4KKUA 1STGA 3G7LA 3FRPB 3PUXA 3I3CA 1PMRA 1KNAA 5EJWA 3KUPA 2RDGA 4JK1C 1BF4A 2PCFB 4G7ZC 4U673 3BG3A 1RJTA 5C4JB 2WIIB 4DA2A 1EIHA 2EPBA 3NK9A 3Q22A 3NE5B 4KN4C 1BUVT 4ZAIA 1H9KA 1O7LA 3PIP3 2PPBC 1SYBA 1QNUA 4L63B 3SDZA 5C4HA 3R3OA 1I3QB 1HQMC 3EJIA 3HKZB 4YIJA 1EY9A 2MP1A 2K5DA 1LT4D 2J7ZA 1E2VA 2N88A 3CU7A 5KRUA 3MFGA 4A3FB 1WTPA 4IUVA 1LTID 1PTOC 1G91A 1WTOA 1QNKA 4FF2A 2WKDA 1TU2B 2HCCA 2MUYA 4G57A 3NXWA 3O13A 1U9RA 3NQIA 1CQVA 2PO4A 4Q0FA 5E1FA 1DOLA 4IFDH 4PMBA 2XSCA 2M2LA 3TN2A 2EVBA 2EOTA 1PXUA 2NUCA 4KTAA 1DYQA 2F3VA 5JJZA 1WCMB 2EYFA 1YNJD 1SNQA 2K6AA 1G2TA 3VYUA 4K5WA 1R9TB 3HOVB 1S5BD 3FPUB 4DNTB 3D4RA 1LLRD 1TQOA 1V1PB 3TP8A 3PIO3 4A3JB 1SXTA 3NBIA 5CBAE 1EOTA 1SE4A 1RTOA 1ZYRD 1DOKA 1TWCB 1SYGA 1KABA 1I4HA 3UI2A 4BY1B 3KLRA 2DY7A 3K0YA 4EGVA 4HEDA 2B2UC 1MSHA 2EY5A 1XTCD 5C6AA 2O5JC 4RHSA 1D5ZC 1IKMA 1IW7C 5ELFA 2FJ2A 3GV6A 1IKLA 3SR1A 3PUYA 3U9SA 1D1KA 5CV4A 1Y8PB 4OO1I 2A6ED 2EDGA 3BYYB 2E2HB 1UUPA 4F8MA 2AWNA 1ILPA 1EY6A 3J7YW 5LL6S 3LNNA 2A68D 2F1MA 4S3SA 3H6MA 2L5TA 2BE5D 5T1GA 4H7BA 4N9TA 2KHSA 2K01A 2K28A 3A55A 2ZXOA 5CV6A 4IFDG 4C3IG 3GTLB 2F0PA 5IGEA 1JOOA 3OHXC 3M4OB 3K5MA 2EJMA 3MC0B 1C4QA 2HCIA 5KNBA 5FKAC 3P7JA 5M5WB 2AQ2B 4KKSA 4BBSB 1TS5A 4K2LA 3DWQA 2PMZB 2BDNA 5JPNC 4ZK9B 5I4DA 5CGKA 3HOYB 3TMEA 2F0DA 3PUZA 4A3EB 3AB9A 1ENAA 5C5LA 2E74C 3K6OA 2B8GA 4CKEA 1JCKB 1RDPD 2PW7A 2ZXRA 1NR4A 5LL6X 1FYCA 5I6YA 3VR3A 4RKLA 4DGZA 3I8ZA 2ZXPA 2O4XA 1L0XB 1SNMA 2VUMB 4FVMA 2IW3A 1F9QA 1LTRD 4A3BB 1H9JA 1H9RA 3BVGA 1ILQA 3S2HB 3I91A 4BY7B 1ESRA 1KDCA 1WTRA 1BO0A 3FDTA 3M85A 2OF1A 3RMHA 2V4DA 2B2TC 5IGFA 1I50B 1RF2D 2F0QA 4IQZA 3A8KE 3IAYA 3VYSA 3S2DB 2NVTB 3GTPB 2PZWA 3D3RA 3VYRA 5CMDA 1MBYA 2CHBD 3FPPA 2K5QA 4J8QA 2A74C 2EXZA 2KJXA 1EIGA 3NWSA 4TKOB 1QB5D 2KUMA 3SE0A 3M7NA 4KI0A 4XT1B 1PZJD 5CYUA 1F9PA 2EYJA 3J80E 2D9UA 5EPJA 4KKTA 2R7ZB 2WINB 3GD7A 2Q8IB 2JE6I 2F0FA 1ZEQX 3KK7A 1TKWB 5J39A 1OXTA 4XYQA 3LWEA 4ZQ3A 1AEXA 3D4WA 5C0XI 1FGBD 1BCPF 4RWSC 1STEA 4IN3A 4HAEA 1A3TA 3K5NA 4KD4A 3J7AV 1TWHB 1JWMD 1CTMA 4MN3A 4G7OC 1CFMA 4ZUJA 5FO7B 1HTPA 1PTOB 1ESFA 3TBIB 3HP3A 3MHBA 4R9WA 3BVZA 5C44B 1E2WA 1BBXC 1WTQA 2B2UA 2A69D 1PRTF 2L55A 1ZKOA 2PNRC 3PO2B 5D3DA 3DXJC 2E76C 2RBMA 1UAPA 2F0HA 3K5LA 1LT3D 3GTKB 3HGBA 5KIXA 2EYOA 1DM0B 3T16A 2B8FA 2SNMA 3K58A 1TY0A 3OSOA 3MFYA 3W3AA 2JP1A 4MHEA 1NUCA 4ODGA 4TQUS 2DNEA 1GJXA 1EWHA 3VR5A 3Q24A 2QDBA 3SHLA 3H94A 2CW0D 1SYFA 3HRZC 4WRDA 1F2MA 1SNDA 1UEAB 1D6EC 3A56A 1XX8A 1A15A 3NPPA 1RODA 4OL7A 1SNOA 4CGYB 4U68A 1R4QB 1SDFA 2B2VA 4DU9A 2XWJB 4QUCA 5C4XB 4GZYC 5M3FB 3VA7A 4F7XA 1G291 2F0LA 2D62A 1KTKA 3V2TA 1GUGA 1EY5A 1B9MA 1I6VC 1EZ8A 1EYAA 2IX1A 1BCPC 1CHQD 3GO5A 4CJ2C 2L9HA 3KBGA 1O7ZA 3S1MB 4KHVA 3SVMA 2F03A 3S1QB 3D31A 3OIPA 1PZKD 2M00A 4KJOA 4PNYA 4KMUC 1FNUA 2FFKB 1S5DD 3NWTA 4XYOA 1QJOA 2VNUD 3DEOA 1AW7A 4FXKC 1PRTC 4H13C 1BXTA 1F9SA 3T53B 4OIKA 1SNPA 1PTOD 2PQEA 5K5PA 3CRLC 2AUJD 5IT9E 3SXHA 2X6GA 4NKLA 2E75C 4LMQD 2B2TA 3VR4A 1SSOA 3Q23A 2QKIC 4V0BA 1LT6D 4CKCA 4G7HC 4BS9A 1HRJA 1J8IA 3GV3A 1F9RA 5CR3A 1FNVA 1M4VA 2XRQD 2O5IC 1I4XA 5CORA 1J9OA 1X32A 5ELCA 1TIID 1QWYA 4R8IA 4C56C 4K2KA 5K36H 2K33A 4HMIA 5I9OA 4HR7B 4J6HA 2A6HC 3OIQA 4DN4M 1VMPA 2H1EA 2I07B 1SMYC 4FO2A 2F3WA 1SEBD 3HOXB 3N6RA 5M5XB 2Q8TA 5EPKA 4X3TA 2F0MA 3EQLC 3FEWX 3QOJA 2N55A 4K5VA 3NP8A 1V1OA 1HTLD 3KF8A 3FKIB 3R2IA 4C1NK 1EEFD 2HQEA 1DCZA 2MPMA 1IW7D 5A35A 5M5YB 3S1RB 4OGQC 4IUQA 4C2MB 1PLFA 1W6JA 2TSSA 5DNFA 1ENCA 2HUGA 2X69A 2R93B 5IT9L 2Y0SB 1Q1BA 1S5ED 5HURA 1ML0D 1LTAD 3BZDB 1RCVD 3NSWA 4OO1H 2BCOA 2F0WA 2QEJC 4ABNA 1YNND 1ONLA 2VXWA 4QMGA 1OXVA 2RSOA 5IGCA 5JOBA 3TZUA 1U4PA 2NZ1D 2F0TA 1Y8NB 4HN7A 3OWFA 3DWPA 5IODA 5C3EB 5AFWA 5C0XJ 5ISRA 4NW2A 4DXGA 4ILWA 5JEAJ 5A2QE 2K7VA 4ZRZA 2X6LA 4RCOA 2IL8A 3FVQA 4C3HB 1O80A 3PMFA 1QE6A 3QJYA 1B9NA 3H0GB 3K59A 1EL0A 2PYKA 5I2YA 1EQVA 3QB3A 4R8NA 4H44C 1HXYD 2C5CA 1SJHD 2NTSA 1CZGA 4DAVA 2NVXB 4ZKBB 3D6WA 4FXDA 5K36G 5BN5A 2KOLA 4DFAA 3IKJA 1B44D 1STAA 1D5MC 2RKSA 3D8GA 5CC4A 3SK8A 4A3IB 4F87A 2NN6H 2B2WC 2G9HD 3AU7A 1VMCA 1TT2A 4QIWB 1EWCA 5LHY1 1LTGD 1OXXK 3GP7A 4DNRB 1PFMA 4Q5VA 2F0OA 4O1NA 4IZ8A 1G8ZD 2MHVA 3I72A 1WTXA 2F0JA 5KGUA 1PTOH 1SAPA 1YNJC 2B2VC 5CV5A 2AWOA 2EJFC 5COYA 1WD0A 4ID6A 3IL8A 3C1FA 5A2QL 2BA0A 2IWHA 4OO1G 1Z6HA 3CRKC 3HOWB 3D6CA 1AP0A 3PV0A 4QF4A 1SJED 2C9OA 2WP8J 1JB3A 2JA7B 3MXGA 5BN3A 4ZUIA 2FHTA 3N52A 4ZYSA 2KCCA 1LABA 2EE1A 2CQAA 3MEHA 1BCPB 4CJ1B 3Q6SA 5EKKA 3BDCA 5JAVA 3LX0A 5DAUA 1E2ZA 1ICWA 2XIWA 5I2XA 5C3XA 1STHA 2JEAI 1O7YA 1Q3LA 3SK4A 2F0IA 1EYCA 1MGSA 2K5WA 1LV9A 5C0XH 3BVMA 2JA6B 4C3IB 4KN7C 1JR0D 1PRTB 4B08A 3I4NB 4KHZA 5ELEA 2BE5C 4IUNA 3JAME 3TDQA 1PFBA 1W6KA 2NN6G 5IOCA 4DAPA 5G3LF 1DZ1A 5JVG3 1DXMA 2ICIA 2KEEA 3BDLA 3U9OA 3H91A 1EEID 3EFXD 2F4IA 4EQOA 1Y69U 3DMUA 4RGOS 3KLSX 3J81E 2NYZD 3S1NB 1MD2D 1DOMA 1FNWA 4N9PA 1K8OA 1F2ZA 1LTSD 3SK5A 2QF7A 1FR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QOH A;  2BOS A;  2XSC A;  1D1K A;  1DM0 B;  3MXG A;  1R4P B;  1CQF A;  4ULL A;  1BOS A;  1D1I A;  1C4Q A;  4M1U B;  1CZW A;  1QNU A;  4P2C B;  1R4Q B;  2C5C A;  2GA4 B;  1CZG A;  1C48 A; 
#chains in the Genus database with same CATH topology
 3PO3 B;  4NXM L;  4KY5 A;  1C8C A;  4RAU C;  3HOU B;  5KND A;  1GKH A;  4CDE C;  1ENF A;  5JVH 3;  1D5X C;  2G9D A;  1E22 A;  4DF7 A;  1N9W A;  1V43 A;  1HFG A;  4BA1 I;  4UP9 A;  4EQP A;  1V9P A;  2Z8L A;  3TZD A;  1I6H B;  3PUV A;  2PW5 A;  1NJI C;  3PCO B;  4P74 A;  4Y7N B;  2JA5 G;  4NXM Q;  3M7G A;  1S5C D;  5KYI A;  2XTI A;  4WOR A;  4JV5 L;  3FMC A;  1PFS A;  2MGS A;  2KVM A;  1AZP A;  1K9M C;  4DV7 Q;  3JC6 6;  2QIL A;  4QY7 A;  1KNE A;  1TR5 A;  1KAA A;  1JOQ A;  1O7I A;  3MVV A;  4P71 A;  1ZXT A;  4ALP A;  2L11 A;  3IFT A;  1CA6 A;  3K57 A;  3K7A B;  1XPO A;  4DK0 A;  1NBW A;  1S5F D;  2B39 A;  3IFD A;  3V96 A;  4JV5 Q;  4RHR A;  2LMC B;  5EGT A;  2ASB A;  1LTL A;  3K5O A;  5FLX E;  5IP7 H;  4A93 B;  1YI2 A;  5I6W A;  4ZKC B;  3ND9 A;  1A3U A;  1Q12 A;  2IY5 B;  4LFB L;  1CKN B;  5DM6 3;  1OXU A;  1LTB D;  3M3Y B;  4RGM A;  1BCP D;  2JYO A;  2DNC A;  2E2J B;  1SE3 A;  3GDE A;  3W1B A;  3KLW A;  5C0X G;  5C4X G;  2AHO B;  5M3F G;  2JXM B;  3TS0 A;  3EA6 A;  3I70 A;  2E2I B;  5KEE A;  3CCV A;  4LFB Q;  3J81 L;  1N33 L;  4DR6 L;  2I46 A;  2F0E A;  1F2Y A;  1TS3 A;  2HD3 A;  3ITP A;  3URY A;  2RCF A;  3QR8 A;  2ZTE A;  5CV9 A;  5IP9 H;  3MZ5 A;  1F2L A;  1VF7 A;  2Y0S E;  2HIV A;  3TQY A;  3J80 L;  2XNA C;  1AE3 A;  2R3Z A;  3T13 A;  1A2U A;  2B2W A;  4A3K B;  1N33 Q;  4DR6 Q;  2D0O A;  1IYU A;  1PRT D;  3I4L A;  5M5Y H;  3S1R H;  2RF4 A;  2RVL A;  4C2M H;  4K6D A;  4C1N I;  1HQR D;  2LSS A;  1NMG A;  1VQJ A;  4AYB B;  1VCI A;  1X65 A;  1L1O A;  2R93 H;  3C3L A;  4KHP L;  3STB D;  3WOE A;  4I7Z C;  4DPG A;  3QIA A;  1MJC A;  5FK9 C;  4PV1 C;  2I5M X;  5C3W A;  1M90 C;  3ZJY C;  4JG2 A;  4IPC A;  3P1H A;  3HOV H;  1OO9 B;  4GN3 B;  2R61 A;  4KLK A;  1JMC A;  2NVQ B;  1NTG A;  2HDL A;  2IX0 A;  4K8I A;  3OPO A;  3RLF A;  3X3M A;  3ERO A;  5C3E H;  4WFN 3;  3KBX A;  2WV6 D;  1GUW A;  3AEV A;  2LY7 A;  5D14 A;  4JW0 A;  1AFP A;  3S17 B;  1NAP A;  3TRE A;  1U4R A;  3S15 B;  4C3H H;  1HJP A;  2VW9 A;  3DWA A;  1CT1 D;  2N49 A;  4YCW A;  1TVX A;  2C35 B;  3TSS A;  2A6H D;  2VB3 X;  3MWY W;  2A73 B;  3ONA B;  3JAM i;  3H0G H;  1SMY D;  4A3G B;  2XRS D;  1HZA A;  5E3F A;  3EIV A;  4MZ9 A;  2F4V Q;  4CHT B;  2XWB B;  1M8A A;  1L1O B;  2FIN B;  1PH3 A;  3VR6 A;  5IP7 G;  4HSV A;  3BYT B;  1CM9 A;  3MXU A;  4XIG S;  3ERQ A;  5E4W C;  2DN8 A;  2RQX A;  4ZLT F;  2ENB A;  4EVO A;  5DM7 3;  4MIU A;  3J81 i;  4HJ5 A;  2EXD A;  1I4G A;  3A8J E;  2RHS B;  3H09 A;  1RTN A;  4IUU A;  4HCE A;  1JQY D;  4HMJ A;  3DM3 A;  4KY6 A;  4UHV A;  4GOP A;  5EKL A;  1LO5 D;  3RR5 A;  3SK6 A;  3T4A C;  4A3I H;  4A3M B;  1SYE A;  2E2H H;  1ICF B;  4X66 L;  3S16 B;  3GQB A;  1BQQ T;  2NB0 A;  3C46 A;  4I7A A;  5J22 A;  2FMC A;  4XQQ A;  4Y52 H;  1AN8 A;  1QOH A;  1KDA A;  1STY A;  2K05 A;  5NUC A;  3NEM A;  2K03 A;  1YEZ A;  2IPK D;  2Z9H A;  5IP9 G;  3JAM c;  3BJU A;  4BBR B;  1KLG D;  3OMC A;  3GTO B;  4IPD A;  1L0W A;  5L37 A;  4X66 Q;  2JSO A;  1LYL A;  3MXN A;  2A5H A;  2IJ0 A;  3E5S A;  3SEB A;  2P5Z X;  1KRT A;  2KQ3 A;  3TP7 A;  3X3N A;  5JPM C;  4B9X A;  1F77 A;  3P20 A;  2R93 G;  2PMZ E;  2Y0S G;  2MJ8 A;  2SDF A;  3A7A B;  1EQT A;  5IYD H;  1B8A A;  1ASZ A;  3L2P A;  3Q0A A;  2NBF A;  5EQ0 A;  4XQN A;  2YYZ A;  1LT5 D;  1EY8 A;  5DEH A;  1Y8O B;  2R92 B;  2OXP A;  1VS0 A;  4C3J B;  1VF5 C;  2BH8 A;  3KOJ A;  2K5H A;  4APV A;  1S4Z A;  3J7A F;  4HIM A;  3HOV G;  1MI2 A;  2JA7 H;  1VQE A;  5IY0 A;  4P75 A;  4KD3 A;  2YTV A;  2XVS A;  5C3E G;  4A3E H;  4JI0 L;  3OW7 A;  2IX3 A;  3KJP A;  1X3Q A;  1XWE A;  3V05 A;  2ZJQ A;  4LK1 C;  1B53 A;  2F0N A;  3AMU A;  2CQO A;  1YHQ A;  1SLJ A;  3OYY A;  1Y1W B;  2RDH A;  1OXS C;  3R2T A;  3RZO B;  2KEN A;  5IIF A;  1XYI A;  4CJ0 B;  4C3H G;  2WAC A;  1VQ9 A;  1A3V A;  1V1P A;  1N32 L;  2KEC A;  4GNX B;  3MXN B;  3CCQ A;  2ZTD A;  1LTT D;  1Q8I A;  3OMG A;  5C5M A;  3H0G G;  4RA8 A;  4XTC S;  2K04 A;  1WD1 A;  1RHP A;  4M1U B;  1G6Z A;  4BXX H;  1NSN S;  1HFN A;  5GQO A;  1NR2 A;  3CHB D;  3I90 A;  1SRO A;  2AQ3 B;  4BY7 H;  5FLX c;  1IXR A;  4XT3 B;  3RZD B;  1N32 Q;  2ICE C;  1GUS A;  1JOR A;  1TY2 A;  4L8J A;  4UP7 A;  2JA6 H;  1II3 A;  4BA2 I;  1A62 A;  3PGZ A;  5ELB A;  1WOC A;  3NQT A;  3WWV A;  2MFI A;  1X9N A;  2JK8 A;  1X3P A;  3NTK A;  4NXN L;  4DR2 L;  3GTP H;  4A3I G;  4LFA L;  3B6Y A;  1HPC A;  1VQ7 A;  1Q86 C;  3NTI A;  2BA1 A;  2G5D A;  1PH4 A;  3I4M B;  3E9H A;  2VQE L;  1LAC A;  4IAL A;  3CMA A;  1UE5 A;  3M9B A;  2QGQ A;  2EYH A;  3CPW A;  2AUK A;  5C4Z A;  4DR2 Q;  4YWM A;  4LFA Q;  3S1N H;  3MXP A;  1IYJ B;  4LNQ A;  4DUY L;  2EY1 A;  1SE2 A;  2VQE Q;  1JOK A;  1YNX A;  1BBU A;  2PZT A;  5TSS A;  2BH2 A;  4PQX A;  3PO3 H;  3A5U A;  3MTS A;  2XN9 C;  5GRO A;  1M1K C;  1DJR D;  2Q2T A;  3HOU H;  5IYD G;  1N34 L;  4QUF A;  2Q2H A;  5EPL A;  4DUY Q;  1CK1 A;  2YTY A;  4LF9 L;  1VQM A;  1VQB A;  1GOZ A;  4DK3 C;  1PFN A;  5T1I A;  3D4D A;  3TP6 A;  1KDB A;  1I6H H;  1TS2 A;  4L6T B;  4OEM B;  4POG A;  1GUT A;  3Q8D A;  4JBW A;  2HIX A;  2UUC L;  1QVF A;  2KED A;  1VQL A;  1B3Q A;  3C1E A;  2VL6 A;  1MHW C;  4IFD I;  5AJ3 L;  2JEB I;  1N34 Q;  3S14 B;  1YVC A;  1Z47 A;  2JA7 G;  3AYH B;  2LFN A;  3F1Z A;  4JI6 L;  1BNZ A;  4DV5 L;  4LF9 Q;  1G51 A;  1A6X A;  1VQD A;  3R8B A;  4A3E G;  2OWO A;  2KCN A;  4QL5 A;  2E8G A;  1O78 A;  1VQI A;  2WKC A;  3NTH A;  3KLS A;  5FO8 B;  2ZM6 L;  3G6J B;  1HNW L;  2UUC Q;  1B50 A;  1GHK A;  3K7A H;  3VYT A;  2K5N A;  5AJ3 Q;  3DHQ A;  1RD9 D;  4DR3 L;  4JI8 L;  2J0T D;  4YY3 L;  1YNN C;  4HJ7 A;  4JI6 Q;  4DV5 Q;  2PZU A;  1FD7 D;  4A93 H;  2NWG A;  2F0S A;  1Q90 A;  1TWA B;  4O42 A;  5C44 H;  1I4P A;  3ICE A;  4ULL A;  3HZX A;  3M3Y H;  4K0K L;  2ZM6 Q;  2EZV A;  4BXX G;  4WJ3 M;  2RHQ B;  5M9O A;  1X3E A;  4O0A A;  3ULL A;  1LUZ A;  2E2J H;  2F0U A;  3HG9 A;  4BY7 G;  5FO9 B;  3PO2 H;  4DR3 Q;  4JI8 Q;  4YY3 Q;  3J7Z C;  1MSG A;  2F0G A;  3CCM A;  4CBV A;  2GA4 B;  3RNU A;  5GAG C;  3WOF A;  2JA6 G;  1VQ6 A;  3NHH A;  1PV4 A;  2E2I H;  2F0V A;  2YU9 B;  3LGJ A;  1PDQ A;  1ZYR C;  3W2D A;  3NUC A;  2JQO A;  1KLU D;  1JWS D;  2NVY B;  2DY8 A;  3CKI B;  4JI5 L;  5CV7 A;  4GKK L;  2MNA A;  1IBM L;  1IHZ A;  4AYB E;  2Z0S A;  4YWL A;  3H15 A;  2R6G A;  4K6L A;  2GVA A;  2JA8 B;  5HGQ A;  4OWX B;  3ULP A;  4A3K H;  5DLQ E;  1EFW A;  2AQ1 B;  2D5D A;  3GTM B;  4XDX A;  3OTO L;  2L4N A;  4GKK Q;  3E9I A;  4GLX A;  4NP5 A;  1IBM Q;  4J1M A;  1SYC A;  4IUP A;  1R4P B;  2D2C C;  4NMZ A;  1XMQ L;  1DON A;  2L1B A;  4FXG C;  3ZYY X;  2H4O A;  2Z1C A;  2YTX A;  3L3O C;  5IYB H;  2NN6 I;  2K1B A;  3ND8 A;  1DD2 A;  2N8N A;  4HTH A;  1X54 A;  5D65 A;  5J1Z A;  4HJ8 A;  1GXD C;  1PZI D;  2A6E C;  3VA5 A;  3OTO Q;  1XMO L;  1XXG A;  2QCP X;  3NEN A;  3L9A X;  3GTQ B;  3PO3 G;  1K83 B;  4GOP C;  5JEA H;  1XMQ Q;  4A76 A;  1HA6 A;  3G6E A;  1CQF A;  1CA5 A;  2A68 C;  4PZ8 A;  3BZC A;  2EYM A;  2M9V A;  3ER0 A;  5ELO A;  4J15 A;  1T9H A;  2NVQ H;  4IUT A;  1HUM A;  4RFB A;  1XMO Q;  2Z4I A;  1BR9 A;  2L12 A;  4OIJ A;  1V1Q A;  1J6Q A;  2B2Y C;  1BKB A;  4UAI A;  1IL2 A;  1C48 A;  4LF5 L;  3S1M H;  3S17 H;  1Y14 B;  4GN5 A;  3S9W A;  1HHV A;  5CBE E;  5KNC A;  3HOZ B;  5F2D A;  3S15 H;  2N3S A;  3EVQ A;  2VZA A;  5BN4 A;  2ID0 A;  5HGT A;  3QOL A;  3P75 A;  1JJG A;  3M4P A;  4A3G H;  3QG1 A;  2EJG C;  1LM0 A;  1JWU D;  1VQO A;  4LF5 Q;  4FP5 D;  4A93 G;  5IWA L;  4DXF A;  3CC4 A;  5EBD A;  2J4X A;  1A2T A;  2ZT9 C;  1D2B A;  3KDF A;  5C44 G;  2I5L X;  2RA4 A;  1EY7 A;  1U5K A;  5G3L D;  1PH7 A;  1D7Q A;  2UUA Q;  1T5E A;  3LWU A;  3RUZ A;  1ET6 A;  1IL8 A;  4QB4 A;  3PO2 G;  4RCN A;  1JIC A;  1UE7 A;  1J5E L;  1VQK A;  4AQY L;  5EBC A;  1Y1V B;  5IWA Q;  1C9O A;  2B63 B;  3WDN A;  4K14 A;  3NBH A;  4A3M H;  4LF7 L;  2NTT A;  3H3V C;  3S16 H;  4BWG B;  1Z7T A;  2HDM A;  4LW1 A;  1PVO A;  2FMM A;  4XQJ A;  1JE4 A;  4QJF A;  3T51 B;  5D3I B;  4JBM A;  1STN A;  3KYH C;  3VR2 A;  4LAA A;  1J5E Q;  4AQY Q;  1FJG L;  1H9S A;  2SOB A;  3AFP A;  1CZW A;  4BBR H;  5FOB B;  4H02 A;  3GTO H;  4LF7 Q;  1RIP A;  1G2S A;  3DM1 A;  4A3K G;  4RGT A;  5E4X A;  4X64 L;  2CVR A;  3L7Z C;  1PH5 A;  1B1Z A;  1RL2 A;  2EY6 A;  5M3M B;  4DNI A;  2WB1 B;  3F2U A;  1SBB B;  1S40 A;  2O2L D;  4AYB G;  2E2D C;  3MEF A;  1SNC A;  3JAM L;  4IOC A;  1K3B C;  3T56 B;  1FJG Q;  2ZTC A;  2OEO A;  5IGG A;  3A8I E;  5IYB G;  3KDF B;  3U4V A;  4X64 Q;  1G6P A;  2QA4 A;  2R7F A;  2TMP A;  1QCB D;  3CME A;  5JJI A;  1EU4 A;  1PH1 A;  4QCL A;  4LF8 L;  2R92 H;  4V19 0;  5JEA G;  4FF4 A;  2F0K A;  4C3J H;  1AZQ A;  3E3X A;  1T5X D;  4IO9 A;  3G71 A;  1WYD A;  4K8J A;  2BOS A;  2L0C A;  4EQN A;  1QVC A;  3HOX H;  1KC8 C;  5M5X H;  3NBH B;  3C2P A;  1B2T A;  1NCV A;  1BOS A;  1D1I A;  3BDO A;  4OHJ A;  1HCZ A;  3RLN A;  3CQZ B;  4RGN A;  2OTL A;  4FNF A;  1E0B A;  4X3U A;  1EY0 A;  2JN4 A;  4LF8 Q;  3FKI H;  4E6I A;  1PH8 A;  2QW7 A;  2JA5 B;  1QG7 A;  1WTV A;  3J7A 5;  1Z9F A;  3GTG B;  5EKI A;  1B3A A;  3HEJ A;  1H9S B;  3E0J A;  1STB A;  2D0P A;  1Y1W H;  3A5Z B;  1FVI A;  1EYD A;  1UNS A;  2IHF A;  3R93 A;  1AE2 A;  1HUN A;  1SYD A;  1U4L A;  4DK1 A;  3BS1 A;  1HZB A;  4TSS A;  3QO2 A;  4HCS A;  4X3K A;  4H0L C;  1QUQ A;  4A3G G;  3DEP A;  3I73 A;  1IBL L;  4KJN A;  1JC7 A;  3TP5 A;  5KYL A;  3F2B A;  2KA7 A;  4ME5 A;  4UPA A;  3KF6 A;  4TRD A;  2BDO A;  1JE5 A;  1X3G A;  3E6Z X;  4X3S A;  4PMW A;  4WJW A;  4DR4 L;  1H9M A;  1QZH A;  1BVS A;  4FYD A;  2SNS A;  4KHP Q;  1VQ8 A;  3GTJ B;  1IYV A;  1IBL Q;  1WTW A;  1GUN A;  3M4Y A;  4XXE A;  1VQP A;  2UU9 L;  1C0A A;  1K8M A;  3OWE B;  1CI3 M;  1I4Q A;  5FLX L;  4A3M G;  1CHP D;  4CDF C;  1VDZ A;  4DR4 Q;  1PYW D;  2K32 A;  4IFD J;  3RN5 A;  3A7L A;  1V8Q A;  1Q7Y C;  2RSN A;  3KFU A;  1GHJ A;  5H1S E;  4IUR A;  1PYB A;  3U4Z A;  4KV6 A;  1L0Y B;  4B9W A;  2UU9 Q;  3PUW A;  2LS0 1;  1TS4 A;  3RD4 A;  4DV1 L;  3DUZ A;  4K5X A;  4UDU C;  5CV8 A;  4BBR G;  2EYL A;  4UP8 A;  1HA5 A;  4MTN A;  1QIL A;  2A69 C;  3IRB A;  3CCU A;  4YCV A;  1TWF B;  1EU3 A;  2CKZ B;  4FF3 A;  1PTO F;  4M8A A;  3A54 A;  1QUQ B;  5IGD A;  2E5L L;  4PMC A;  2SEB D;  3CD6 A;  1GUO A;  2NVX H;  4DV1 Q;  2EY2 A;  4F88 A;  4L5R C;  1EFI D;  1B4O A;  2LKV A;  4FF1 A;  2F3I A;  4RH6 A;  4LJZ C;  2VB2 X;  1CKO A;  2Q8R E;  2RDF A;  2WAQ B;  1EIF A;  3KF6 B;  3QWN A;  5IGB A;  1X3F A;  4QIW E;  1EY4 A;  1FL0 A;  3MAQ A;  4Z9C B;  3PF5 A;  3OOC A;  1DGS A;  3G4S A;  2E5L Q;  2R92 G;  4HSP A;  1ET9 A;  4I65 A;  4C3J G;  1TWG B;  1N36 L;  4A3D B;  2V1C C;  1E7Z A;  4KY7 A;  4DAY A;  1JJC B;  2EYP A;  3MA2 B;  1BDO A;  1RKN A;  3HOX G;  1U4M A;  4KK7 A;  4NDX A;  1WVL A;  2OT2 A;  4G4K A;  1EZ6 A;  2CW0 C;  5ELD A;  1Q1E A;  1I4R A;  2IT1 A;  3HS0 C;  3FKI G;  5I9P A;  1N36 Q;  2B2Y A;  4A4I A;  4CKB A;  4P2C B;  4RKB A;  2CCZ A;  4DR7 L;  4JI1 L;  2Z4H A;  1W3S A;  1Y1W G;  1SFO B;  1YHB A;  4KKU A;  1K28 A;  1STG A;  3G7L A;  3FRP B;  2CFM A;  3PUX A;  3I3C A;  1PMR A;  4OXP A;  3H3V I;  1KNA A;  5EJW A;  2ATW A;  2HT1 A;  2I5H A;  3KUP A;  1TWA H;  2RDG A;  2L15 A;  4JK1 C;  1BF4 A;  2PCF B;  4DR7 Q;  4JI1 Q;  4G7Z C;  4U67 3;  3BG3 A;  1W2B A;  1RJT A;  2KHI A;  4YHH L;  5C4J B;  3HOW H;  1H95 A;  2WII B;  4DA2 A;  1VQ4 A;  1EIH A;  4B3T L;  2EPB A;  1KHI A;  3NK9 A;  3Q22 A;  2NZH A;  1E3P A;  1NNX A;  4GOP B;  2YU9 H;  3NE5 B;  4DAY B;  4KN4 C;  1BUV T;  2NVY H;  4ZAI A;  1H9K A;  4R4C A;  1O7L A;  4YHH Q;  3PIP 3;  2PPB C;  3S24 A;  1SYB A;  1QNU A;  2K14 A;  4L63 B;  3SDZ A;  5JJK A;  2JA8 H;  1YHA A;  4B3T Q;  5C4H A;  1IBK L;  3R3O A;  4GLV B;  3GTM H;  1I3Q B;  1HQM C;  1YJN A;  3EJI A;  3FHW A;  3HKZ B;  4YIJ A;  1EY9 A;  2MP1 A;  2K5D A;  1LT4 D;  2J7Z A;  1E2V A;  2N88 A;  3CU7 A;  5KRU A;  3MFG A;  4A3F B;  1WI5 A;  1WTP A;  4IUV A;  1LTI D;  1PTO C;  1G91 A;  1WTO A;  1QNK A;  4FF2 A;  2WKD A;  1TU2 B;  3TRZ A;  2HCC A;  2UXD L;  1VQ5 A;  1EOV A;  2MUY A;  1IBK Q;  4G57 A;  3K0X A;  3NXW A;  3O13 A;  4DUZ L;  1U9R A;  3NQI A;  1CQV A;  5ELN A;  3GTQ H;  1K83 H;  2PO4 A;  4Q0F A;  5E1F A;  1DOL A;  4IFD H;  4PMB A;  4C3I H;  1UE6 A;  5JJL A;  2XSC A;  2M2L A;  3TN2 A;  2EVB A;  5IYC H;  2EOT A;  1CSQ A;  4TVA B;  1PXU A;  2NUC A;  4KTA A;  1DYQ A;  2F3V A;  5JJZ A;  3I4N H;  1WCM B;  4HJA A;  4DUZ Q;  2EYF A;  1JB7 A;  1YNJ D;  3FP9 A;  4ME3 A;  1SNQ A;  2K6A A;  4HJ9 A;  4JI4 L;  1G2T A;  3VYU A;  1KRS A;  4K5W A;  1R9T B;  4GS3 A;  3HOV B;  3HOZ H;  4R4O A;  1S5B D;  3FPU B;  2JJQ A;  4DNT B;  3D4R A;  2B3G A;  1LLR D;  1YZ6 A;  1KQS A;  1YIT A;  2MO0 A;  4NXN Q;  1TQO A;  1V1P B;  3U50 C;  2K75 A;  3CC2 A;  3TP8 A;  4JI4 Q;  3PIO 3;  4A3J B;  1SXT A;  5LMN L;  3NBI A;  5CBA E;  1EOT A;  2ZJR A;  1SE4 A;  1RTO A;  4GLA C;  1ZYR D;  1DOK A;  1TWC B;  4HIK A;  1SYG A;  1KAB A;  3EBE A;  1I4H A;  3UI2 A;  4PG3 A;  3T1H L;  1PH9 A;  4BY1 B;  1Q46 A;  3KLR A;  2DY7 A;  5EAY A;  3K0Y A;  4EGV A;  4HED A;  2B2U C;  2JA9 A;  1MSH A;  2EY5 A;  4OX9 L;  1EQQ A;  4JYA L;  1XTC D;  5C6A A;  4R4T A;  3HOW G;  2O5J C;  4RHS A;  1Y1V H;  1D5Z C;  4Y7N H;  3T1H Q;  1IKM A;  1IW7 C;  5ELF A;  2A8V A;  1HNX L;  2FJ2 A;  1YJW A;  3GV6 A;  2GVB A;  1IKL A;  2H5X A;  3PUY A;  1VQC A;  3SR1 A;  4DV2 L;  3U9S A;  1D1K A;  1XNR L;  5CV4 A;  1WTH A;  2WB1 E;  4MNO A;  4JYA Q;  1Y8P B;  4OO1 I;  2A6E D;  3KJO A;  4IJL A;  2EDG A;  3BYY B;  2VQF L;  2JA8 G;  2E2H B;  1UUP A;  4F8M A;  4AIM A;  2AWN A;  1ILP A;  1EY6 A;  4DV2 Q;  3J7Y W;  1XNR Q;  5LL6 S;  3LNN A;  5M3M H;  2A68 D;  2F1M A;  4S3S A;  4QQB X;  3H6M A;  2L5T A;  2BE5 D;  4L5Q A;  1PH2 A;  1MKH A;  2VQF Q;  5T1G A;  1HNW Q;  5FLM H;  4X65 L;  3CCS A;  4H7B A;  4N9T A;  2KHS A;  2K01 A;  1D8L A;  2I0Q A;  2QEX A;  2K28 A;  3A55 A;  2ZXO A;  1TXY A;  1E24 A;  4RMF A;  5CV6 A;  4IFD G;  1UE1 A;  4C3I G;  1K73 C;  3GTL B;  2F0P A;  5IGE A;  5IYC G;  1JOO A;  3HKS A;  4DKA C;  5LMN W;  3OHX C;  3M4O B;  4K0K Q;  4X65 Q;  2NZO A;  3K5M A;  2EJM A;  3MC0 B;  1C4Q A;  2HCI A;  3I4N G;  5KNB A;  3CQZ H;  5FKA C;  3TEH B;  4LUO A;  3P7J A;  5M5W B;  4DAM A;  2AQ2 B;  4KKS A;  4BBS B;  1WFQ A;  3PQI A;  1TS5 A;  4K2L A;  4YWK A;  3GTG H;  3DWQ A;  2PMZ B;  4LFC L;  1VQG A;  2BDN A;  5JPN C;  3K7U C;  4UY8 C;  4ZK9 B;  3HOZ G;  5I4D A;  4A3C H;  4JI5 Q;  5CGK A;  3HOY B;  3TME A;  4JC0 A;  2F0D A;  5IT9 c;  3PUZ A;  4A3E B;  3AB9 A;  1ENA A;  5C5L A;  2E74 C;  3K6O A;  2B8G A;  3W5O A;  4CKE A;  1JCK B;  3K81 C;  1RDP D;  2PW7 A;  2ZXR A;  4LFC Q;  1NR4 A;  1E1O A;  5LL6 X;  1FYC A;  2KCM A;  5I6Y A;  3VR3 A;  2KHJ A;  4RKL A;  4DGZ A;  3I8Z A;  2ZXP A;  1ASY A;  2O4X A;  1L0X B;  4X62 L;  1SNM A;  3HOU G;  1HNZ L;  2CH4 A;  1IZ6 A;  2VUM B;  1XJV A;  2EQS A;  4FVM A;  2IW3 A;  1F9Q A;  1LTR D;  4A3B B;  3GTJ H;  1H9J A;  1H9R A;  3BVG A;  1ILQ A;  3S2H B;  1NMF A;  3I91 A;  4DV0 L;  4BY7 B;  1ESR A;  1Y1V G;  1KDC A;  1WTR A;  1GO3 E;  1BO0 A;  3FDT A;  3M85 A;  4X62 Q;  2OF1 A;  1HNZ Q;  3RMH A;  2V4D A;  3I2Z A;  2B2T C;  5IGF A;  1I50 B;  1RF2 D;  2LXK A;  4LWC A;  2AKW B;  1VQA A;  2F0Q A;  4IQZ A;  3A8K E;  3IAY A;  4DV0 Q;  4YCU A;  3VYS A;  3S2D B;  3UDG A;  2NVT B;  3GTP B;  2WAQ E;  1P8L A;  2PZW A;  3D3R A;  5HY6 A;  3VYR A;  3F2C A;  4R1J A;  3CF5 A;  5CMD A;  1MBY A;  2CHB D;  2UXB L;  2Q2I A;  3FPP A;  1HR0 W;  2K5Q A;  4J8Q A;  2A74 C;  2EXZ A;  5M3M G;  1CSP A;  1EIG A;  2KJX A;  2WB1 G;  3NWS A;  4TKO B;  1L2F A;  1QB5 D;  2RCN A;  4JOI C;  5FLM G;  2KUM A;  3SE0 A;  4EQ5 A;  3DLL A;  5LMU L;  4KI0 A;  4XT1 B;  3M7N A;  2UXB Q;  1PZJ D;  5CYU A;  1F9P A;  1CKN A;  2EYJ A;  1TWG H;  3J80 E;  2D9U A;  4A3D H;  5EPJ A;  4KKT A;  4HIO A;  2R7Z B;  2WIN B;  3CW2 C;  3SGI A;  3GD7 A;  2Q8I B;  1EUJ A;  5LMU Q;  4DV7 L;  2JE6 I;  2OQK A;  2F0F A;  1ZEQ X;  3KK7 A;  1TKW B;  5J39 A;  1OXT A;  3ERS X;  4XYQ A;  1FGU A;  3LWE A;  4ZQ3 A;  1AEX A;  3D4W A;  5C0X I;  3W1G A;  1FGB D;  1BCP F;  3CCE A;  1SFO H;  4RWS C;  2HHH L;  1STE A;  2VS1 A;  4IN3 A;  4A75 A;  1B70 B;  4A3C G;  4HAE A;  1A3T A;  3K5N A;  4KD4 A;  3K8A A;  3J7A V;  1TWH B;  3L0O A;  1JWM D;  1CTM A;  4MN3 A;  4G7O C;  1CFM A;  4DV6 L;  4LF6 L;  4ZUJ A;  5FO7 B;  1HTP A;  2HHH Q;  1PTO B;  4POF A;  1JT8 A;  1ESF A;  1VQF A;  3TBI B;  3HP3 A;  5C4J H;  2PNH A;  1SN8 A;  1PH6 A;  3MHB A;  1CUK A;  4R9W A;  1EIY B;  3BVZ A;  5C44 B;  1E2W A;  2Z6B A;  1BBX C;  3E0E A;  4IJH A;  1WTQ A;  3HKZ E;  2B2U A;  2A69 D;  4DV6 Q;  1PRT F;  2L55 A;  3UDI A;  4LF6 Q;  1MIU A;  1ZKO A;  2PNR C;  3PO2 B;  5D3D A;  1E1T A;  3DXJ C;  2E76 C;  2FXQ A;  2RBM A;  1UAP A;  2F0H A;  3K5L A;  2GN5 A;  1LT3 D;  3I7F A;  3GTK B;  3CP0 A;  3HGB A;  3RZO H;  1I3Q H;  5KIX A;  2EYO A;  4DV3 L;  3ULJ A;  1DM0 B;  3T16 A;  2B8F A;  2SNM A;  3K58 A;  1TY0 A;  3F2D A;  3OSO A;  3MFY A;  2UXC L;  1QZG A;  2WFW A;  1YBY A;  4A3F H;  3UE1 A;  3CXC A;  3W3A A;  1BBW A;  2JP1 A;  4MHE A;  3A74 A;  1NUC A;  4ODG A;  4CDD C;  2PI2 A;  3I4O A;  1A63 A;  4TQU S;  2DNE A;  1GJX A;  1EWH A;  3VR5 A;  5FJ8 H;  2EIF A;  4DV3 Q;  3Q24 A;  3RZD H;  2QDB A;  3SHL A;  3H94 A;  2CW0 D;  1SYF A;  3HRZ C;  4WRD A;  2UXC Q;  2WAQ G;  1F2M A;  1SND A;  1UEA B;  1D6E C;  3A56 A;  1XX8 A;  1A15 A;  2XGT A;  3NPP A;  2HQL A;  1ROD A;  1WCM H;  2ZJP A;  4OL7 A;  1SNO A;  4CGY B;  4IOA A;  4U68 A;  1R4Q B;  1SDF A;  2B2V A;  4DU9 A;  2XWJ B;  4A3D G;  4QUC A;  5C4X B;  4GZY C;  1UWV A;  5M3F B;  1VQH A;  3VA7 A;  4F7X A;  3I4M H;  1KXL A;  4B3S L;  1P16 A;  1G29 1;  2F0L A;  1R9T H;  2D62 A;  1KTK A;  3H3V H;  3V2T A;  1EQR A;  1KAW A;  2DUD A;  1GUG A;  1EY5 A;  1B9M A;  1I6V C;  1EZ8 A;  1EYA A;  4JPB W;  5IE8 A;  3NEL A;  2IX1 A;  1BCP C;  1Q82 C;  1CHQ D;  3GO5 A;  4CJ2 C;  4PZ7 A;  2F4V L;  2L9H A;  2OCE A;  3KBG A;  4A3J H;  4B3S Q;  1O7Z A;  3S1M B;  4KHV A;  3SVM A;  1K0R A;  4CDC C;  2F03 A;  1TWC H;  3S1Q B;  3VDY A;  3D31 A;  4L5T A;  4RG1 A;  4BY1 H;  3OIP A;  2VY3 A;  1PZK D;  2M00 A;  4KJO A;  4PNY A;  4KMU C;  1FNU A;  5GAE C;  2FFK B;  2K4K A;  5E7N A;  1S5D D;  4A3L H;  4JVZ A;  3NWT A;  4XYO A;  1QJO A;  2MQH A;  2VNU D;  2PQA A;  4DK6 C;  3DEO A;  1AW7 A;  3T1Y L;  1AH9 A;  4FXK C;  1PRT C;  4H13 C;  1BXT A;  1F9S A;  3T53 B;  1PA6 A;  3G48 A;  3PIP A;  3S14 H;  2QDL A;  4OIK A;  1SNP A;  1PTO D;  2PQE A;  5K5P A;  4JI7 L;  2CWA A;  3D0F A;  3CRL C;  2AUJ D;  3CPF A;  5IT9 E;  3SXH A;  3STB C;  2X6G A;  2OQ0 A;  1U0L A;  4NKL A;  3J80 i;  3T1Y Q;  2E75 C;  4LMQ D;  2B2T A;  3VR4 A;  4ZCK A;  1SSO A;  3Q23 A;  2QKI C;  3HKZ G;  4JI7 Q;  4V0B A;  1LT6 D;  4CKC A;  4G7H C;  3K80 C;  4BS9 A;  1X56 A;  2B29 A;  1HRJ A;  2IHE A;  4A3F G;  4IPG A;  1J8I A;  3GV3 A;  3I55 A;  1F9R A;  5CR3 A;  1FNV A;  1M4V A;  2XRQ D;  2O5I C;  1A0I A;  4DV4 L;  1I4X A;  4GNX A;  5COR A;  5FJ8 G;  1J9O A;  3BU2 A;  1QVG A;  1X32 A;  5ELC A;  1TII D;  1EWI A;  1QWY A;  4R8I A;  4C56 C;  4K2K A;  4O2D A;  1I5F A;  1A8V A;  1GVP A;  3J81 c;  5K36 H;  3GTL H;  4P72 A;  4JOI A;  4OEL B;  4JI2 L;  1HH2 P;  3M4O H;  2K33 A;  2PQA B;  4HMI A;  4FDB A;  5I9O A;  2KCT A;  1WCM G;  4HR7 B;  4DV4 Q;  4J6H A;  2A6H C;  3OIQ A;  4LF4 L;  4DN4 M;  1VMP A;  2Z6K C;  2H1E A;  2I07 B;  1SMY C;  5M5W H;  3J80 c;  4BBS H;  4FO2 A;  3I4M G;  2F3W A;  1SEB D;  2K52 A;  4JI2 Q;  3CAM A;  3HOX B;  3N6R A;  5M5X B;  2Q8T A;  5EPK A;  4X3T A;  2F0M A;  3EQL C;  3FEW X;  4LUZ A;  3QOJ A;  2N55 A;  3HOY H;  4K5V A;  3NP8 A;  1V1O A;  3PIO A;  1HTL D;  4LF4 Q;  3KF8 A;  3FKI B;  3I56 A;  3CCJ A;  4QGU A;  3R2I A;  4C1N K;  1EEF D;  2HQE A;  1DCZ A;  2MPM A;  4A3J G;  1IW7 D;  5A35 A;  5M5Y B;  3S1R B;  4OGQ C;  1K8A C;  4IUQ A;  4C2M B;  1PLF A;  4OWT B;  1W6J A;  3AFQ A;  2TSS A;  4L5S A;  4BY1 G;  1XPR A;  5DNF A;  1ENC A;  2HUG A;  2X69 A;  2R93 B;  5IT9 L;  2VUM H;  3CCR A;  2Y0S B;  1Q1B A;  1S5E D;  5HUR A;  1ML0 D;  5GAH C;  1LTA D;  3F8T A;  3BZD B;  1RCV D;  4A3B H;  2UXD Q;  3NSW A;  4A3L G;  4OO1 H;  2BCO A;  4OWW B;  2OTJ A;  3S2H H;  2F0W A;  2QEJ C;  3HFZ B;  4ABN A;  3CC7 A;  1YNN D;  1ONL A;  2VXW A;  4QMG A;  2UUB L;  1OXV A;  2RSO A;  2CWP A;  2K5V A;  5IGC A;  5JOB A;  4N8X 1;  3UDF A;  1I50 H;  3TZU A;  2MO1 A;  1U4P A;  2NZ1 D;  2F0T A;  1Y8N B;  4B3M L;  3AQQ A;  1YJ9 A;  4HN7 A;  3S2D H;  3OWF A;  3DWP A;  5IOD A;  5C3E B;  2NVT H;  5AFW A;  3U58 A;  4DR5 L;  5C0X J;  5ISR A;  4NW2 A;  4DXG A;  3RN2 A;  4ILW A;  5JEA J;  5A2Q E;  2K7V A;  2UUB Q;  1CKM A;  2DJG C;  4ZRZ A;  2X6L A;  4RCO A;  3KF8 B;  2K50 A;  2IL8 A;  3FVQ A;  4R4Q A;  4C3H B;  4GKJ L;  1I94 L;  4B3M Q;  1O80 A;  2DJF C;  2F52 A;  3PMF A;  1QE6 A;  3QJY A;  1B9N A;  1NY4 A;  4DR5 Q;  3H0G B;  3K59 A;  1EL0 A;  3BZK A;  2PYK A;  5I2Y A;  1EQV A;  5LMN Q;  4X6A H;  3QB3 A;  4R8N A;  4DR1 L;  4H44 C;  1HXY D;  2C5C A;  1SJH D;  2NTS A;  1CZG A;  4DAV A;  2NVX B;  4ZKB B;  3D6W A;  1I94 Q;  4GKJ Q;  2B63 H;  4FXD A;  3OW2 A;  5K36 G;  5BN5 A;  5J3B A;  2N78 A;  2KOL A;  4R4I A;  2R7Z H;  4DFA A;  3IKJ A;  1N8R C;  1B44 D;  1STA A;  4JI0 Q;  1D5M C;  4OX9 Q;  2RKS A;  1K3R A;  3D8G A;  5CC4 A;  3SK8 A;  4DR1 Q;  1EYG A;  4N8F A;  2Q2U A;  4BBS G;  4A3I B;  4F87 A;  2NN6 H;  1PYS B;  1HNX Q;  2B2W C;  2G9H D;  1B7Y B;  4P73 A;  3AU7 A;  1VMC A;  1TT2 A;  3A0J A;  4QIW B;  3PSI A;  3HOY G;  1EWC A;  5LHY 1;  4EX5 A;  1LTG D;  1OXX K;  1XPU A;  1TWH H;  3GP7 A;  4DNR B;  1PFM A;  1SRU A;  4Q5V A;  1L1O C;  2F0O A;  4O1N A;  2DGY A;  4PZ6 A;  3RLO A;  1NE3 A;  1KD1 C;  4IZ8 A;  2R7D A;  1G8Z D;  2MHV A;  3I72 A;  1WTX A;  2F0J A;  5KGU A;  1PTO H;  5GAD C;  1SAP A;  1YNJ C;  3EN2 A;  1Q81 C;  2B2V C;  1YIJ A;  5CV5 A;  2AWO A;  2EJF C;  5COY A;  2VUM G;  1WD0 A;  4ID6 A;  4HID A;  3IL8 A;  4A3B G;  3C1F A;  5A2Q L;  2BA0 A;  2IWH A;  4OO1 G;  1X6O A;  1HZC A;  5BR8 L;  1HR0 L;  1Z6H A;  3CRK C;  3HOW B;  3D6C A;  1GM5 A;  1AP0 A;  1SMX A;  3PV0 A;  2JA5 H;  4QF4 A;  1SJE D;  2C9O A;  2WP8 J;  3GTK H;  4JCV E;  1JB3 A;  4JI3 L;  2JA7 B;  3M4Q A;  3TS2 A;  3MXG A;  1KIX A;  5BR8 Q;  5BN3 A;  2ALY B;  4ZUI A;  1HR0 Q;  2FHT A;  3N52 A;  1K0S A;  2KBN A;  4ZYS A;  2KCC A;  1LAB A;  2EE1 A;  2CQA A;  2AMC B;  3MEH A;  4LUV A;  1BCP B;  4CJ1 B;  3Q6S A;  5EKK A;  4JI3 Q;  3BDC A;  5JAV A;  4B3R L;  3LX0 A;  5DAU A;  4NB3 A;  1E2Z A;  1ICW A;  2XIW A;  4NPS A;  5I2X A;  1SE8 A;  1PHJ A;  5C3X A;  1STH A;  2JEA I;  1MJE A;  4GN4 B;  1O7Y A;  1Q3L A;  3SK4 A;  2F0I A;  1S72 A;  4B3R Q;  1EYC A;  1MGS A;  2K5W A;  3UE0 A;  1JJ2 A;  1LV9 A;  2B63 G;  5C0X H;  5C4X H;  1SR3 A;  3BVM A;  1OTC A;  2JA6 B;  2R7Z G;  5M3F H;  4C3I B;  4KN7 C;  1JR0 D;  1C7Y A;  1K8G A;  4JBJ A;  4AH6 A;  3J81 j;  1PRT B;  1VQN A;  1X55 A;  2PI2 E;  4B08 A;  3I4N B;  4KHZ A;  5ELE A;  2BE5 C;  3CCL A;  4IUN A;  3JAM E;  3TDQ A;  1PFB A;  2Z6K A;  1W6K A;  4WJ4 A;  2NN6 G;  5IOC A;  4DAP A;  5G3L F;  1DZ1 A;  5JVG 3;  1TWF H;  1DXM A;  2ICI A;  2KEE A;  2CH4 W;  2A1A A;  3BDL A;  3U9O A;  4JBK A;  1XNQ L;  3H91 A;  1EEI D;  3EFX D;  2F4I A;  4GNX C;  4IPH A;  4EQO A;  1Y69 U;  2ES2 A;  3DMU A;  4MTK A;  1S3O A;  1UEB A;  4RGO S;  3S1Q H;  1WJJ A;  1XTD A;  3KLS X;  3J81 E;  4OON A;  2NYZ D;  3S1N B;  1MD2 D;  1DOM A;  3PF4 A;  1FNW A;  4N9P A;  2UUA L;  1KL9 A;  1GD7 A;  1HZ9 A;  1K8O A;  1XNQ Q;  2A19 A;  1F2Z A;  3UDX A;  1LTS D;  3SK5 A;  2YV5 A;  2QF7 A;  1FR3 A;  1Q8K A;  2LXJ A; 
#chains in the Genus database with same CATH homology
 3PO3 B;  4KY5 A;  1C8C A;  4RAU C;  3HOU B;  5KND A;  1ENF A;  5JVH 3;  1D5X C;  2G9D A;  4DF7 A;  1V43 A;  1HFG A;  4BA1 I;  4EQP A;  2Z8L A;  3TZD A;  1I6H B;  3PUV A;  2PW5 A;  4Y7N B;  3M7G A;  1S5C D;  5KYI A;  4WOR A;  3FMC A;  2MGS A;  2KVM A;  1AZP A;  2QIL A;  1KNE A;  1TR5 A;  1KAA A;  1JOQ A;  3MVV A;  1ZXT A;  2L11 A;  3IFT A;  1CA6 A;  3K57 A;  3K7A B;  4DK0 A;  2B39 A;  1S5F D;  3IFD A;  3V96 A;  4RHR A;  2LMC B;  5EGT A;  3K5O A;  5FLX E;  4A93 B;  5I6W A;  4ZKC B;  3ND9 A;  1A3U A;  1Q12 A;  5DM6 3;  1OXU A;  1LTB D;  3M3Y B;  4RGM A;  1BCP D;  2JYO A;  2DNC A;  2E2J B;  1SE3 A;  5C0X G;  2JXM B;  3EA6 A;  3I70 A;  2E2I B;  5KEE A;  3J81 L;  2I46 A;  2F0E A;  1F2Y A;  1TS3 A;  3ITP A;  3URY A;  5CV9 A;  3MZ5 A;  1F2L A;  1VF7 A;  3J80 L;  2XNA C;  2R3Z A;  3T13 A;  1A2U A;  2B2W A;  4A3K B;  1IYU A;  1PRT D;  3I4L A;  2RVL A;  4K6D A;  4C1N I;  1HQR D;  4AYB B;  1VCI A;  3C3L A;  3WOE A;  4I7Z C;  3QIA A;  5FK9 C;  4PV1 C;  5C3W A;  3P1H A;  1OO9 B;  2R61 A;  2NVQ B;  2HDL A;  2IX0 A;  4K8I A;  3OPO A;  3RLF A;  3X3M A;  3ERO A;  4WFN 3;  3KBX A;  2WV6 D;  1GUW A;  2LY7 A;  5D14 A;  1AFP A;  3S17 B;  1NAP A;  1U4R A;  3S15 B;  3DWA A;  1CT1 D;  1TVX A;  3TSS A;  2A6H D;  2VB3 X;  3MWY W;  2A73 B;  3ONA B;  1SMY D;  4A3G B;  2XRS D;  5E3F A;  4CHT B;  2XWB B;  1M8A A;  2FIN B;  3VR6 A;  4HSV A;  3BYT B;  1CM9 A;  3MXU A;  4XIG S;  3ERQ A;  5E4W C;  2DN8 A;  2RQX A;  4ZLT F;  2ENB A;  4EVO A;  5DM7 3;  4MIU A;  1I4G A;  3A8J E;  3H09 A;  1RTN A;  4IUU A;  4HCE A;  1JQY D;  4HMJ A;  4KY6 A;  5EKL A;  1LO5 D;  3SK6 A;  3T4A C;  4A3M B;  1SYE A;  3S16 B;  3GQB A;  1BQQ T;  2NB0 A;  3C46 A;  5J22 A;  2FMC A;  4XQQ A;  1AN8 A;  1QOH A;  1KDA A;  1STY A;  2K05 A;  5NUC A;  2K03 A;  2IPK D;  4BBR B;  1KLG D;  3OMC A;  3GTO B;  2JSO A;  3MXN A;  2A5H A;  2IJ0 A;  3E5S A;  3SEB A;  2KQ3 A;  3TP7 A;  3X3N A;  5JPM C;  4B9X A;  1F77 A;  3P20 A;  2MJ8 A;  2SDF A;  3A7A B;  1EQT A;  3Q0A A;  2NBF A;  5EQ0 A;  4XQN A;  2YYZ A;  1LT5 D;  1EY8 A;  5DEH A;  1Y8O B;  2R92 B;  2OXP A;  4C3J B;  1VF5 C;  1S4Z A;  3J7A F;  1MI2 A;  4KD3 A;  2XVS A;  3OW7 A;  2IX3 A;  1X3Q A;  1XWE A;  3V05 A;  4LK1 C;  1B53 A;  2F0N A;  3AMU A;  1Y1W B;  2RDH A;  1OXS C;  3R2T A;  3RZO B;  5IIF A;  1XYI A;  4CJ0 B;  4C3H G;  2WAC A;  1A3V A;  1V1P A;  2KEC A;  1LTT D;  1Q8I A;  3OMG A;  5C5M A;  4RA8 A;  4XTC S;  2K04 A;  1WD1 A;  1RHP A;  4M1U B;  1G6Z A;  1NSN S;  1HFN A;  1NR2 A;  3CHB D;  3I90 A;  2AQ3 B;  4XT3 B;  3RZD B;  2ICE C;  1GUS A;  1JOR A;  1TY2 A;  4L8J A;  1II3 A;  4BA2 I;  5ELB A;  3NQT A;  3NTK A;  1X3P A;  1HPC A;  3NTI A;  2BA1 A;  3I4M B;  1LAC A;  4IAL A;  2EYH A;  2AUK A;  5C4Z A;  3MXP A;  2EY1 A;  1SE2 A;  1JOK A;  2PZT A;  5TSS A;  4PQX A;  3MTS A;  2XN9 C;  1DJR D;  4QUF A;  5EPL A;  1CK1 A;  1GOZ A;  1PFN A;  5T1I A;  3D4D A;  3TP6 A;  1KDB A;  1TS2 A;  4L6T B;  1GUT A;  4JBW A;  2KED A;  3C1E A;  4IFD I;  2JEB I;  3S14 B;  1Z47 A;  2LFN A;  1BNZ A;  1A6X A;  3R8B A;  2KCN A;  1O78 A;  2WKC A;  3NTH A;  3KLS A;  5FO8 B;  1B50 A;  3G6J B;  1GHK A;  3VYT A;  3DHQ A;  1RD9 D;  2J0T D;  1YNN C;  2PZU A;  1FD7 D;  2NWG A;  2F0S A;  1Q90 A;  1TWA B;  4O42 A;  1I4P A;  4ULL A;  3HZX A;  2EZV A;  5M9O A;  2F0U A;  3HG9 A;  5FO9 B;  1MSG A;  2F0G A;  4CBV A;  2GA4 B;  3WOF A;  3NHH A;  2F0V A;  2YU9 B;  1PDQ A;  1ZYR C;  3W2D A;  3NUC A;  2NVY B;  1KLU D;  1JWS D;  3CKI B;  2DY8 A;  5CV7 A;  1IHZ A;  2R6G A;  4K6L A;  2JA8 B;  2AQ1 B;  2D5D A;  3GTM B;  4XDX A;  2L4N A;  4NP5 A;  4J1M A;  1SYC A;  4IUP A;  1R4P B;  2D2C C;  4NMZ A;  1DON A;  2L1B A;  4FXG C;  3ZYY X;  2H4O A;  2Z1C A;  3L3O C;  2NN6 I;  2K1B A;  3ND8 A;  1DD2 A;  4HTH A;  5D65 A;  5J1Z A;  1GXD C;  1PZI D;  2A6E C;  3VA5 A;  1XXG A;  2QCP X;  3L9A X;  3GTQ B;  1K83 B;  5JEA H;  1HA6 A;  1CQF A;  1CA5 A;  2A68 C;  2EYM A;  2M9V A;  4IUT A;  1HUM A;  4RFB A;  2Z4I A;  1BR9 A;  2L12 A;  4OIJ A;  2B2Y C;  4UAI A;  1C48 A;  3S9W A;  1HHV A;  5CBE E;  5KNC A;  3HOZ B;  5F2D A;  3EVQ A;  5BN4 A;  2ID0 A;  5HGT A;  3QOL A;  3P75 A;  3QG1 A;  2EJG C;  1JWU D;  4FP5 D;  4DXF A;  5EBD A;  2J4X A;  1A2T A;  2ZT9 C;  1D2B A;  2RA4 A;  1EY7 A;  5G3L D;  1T5E A;  3LWU A;  3RUZ A;  1ET6 A;  1IL8 A;  4QB4 A;  4RCN A;  1JIC A;  5EBC A;  1Y1V B;  2B63 B;  3WDN A;  4K14 A;  3NBH A;  2NTT A;  3H3V C;  4BWG B;  1Z7T A;  2HDM A;  2FMM A;  4XQJ A;  1JE4 A;  3T51 B;  5D3I B;  1STN A;  3VR2 A;  4LAA A;  1H9S A;  2SOB A;  1CZW A;  5FOB B;  1G2S A;  3DM1 A;  4RGT A;  5E4X A;  2CVR A;  3L7Z C;  1B1Z A;  2EY6 A;  5M3M B;  2WB1 B;  3F2U A;  1SBB B;  2O2L D;  2E2D C;  1SNC A;  3JAM L;  3T56 B;  2OEO A;  5IGG A;  3A8I E;  2TMP A;  1QCB D;  1EU4 A;  4QCL A;  4V19 0;  5JEA G;  4FF4 A;  2F0K A;  1AZQ A;  1T5X D;  4K8J A;  2BOS A;  2L0C A;  4EQN A;  3C2P A;  1B2T A;  1NCV A;  1BOS A;  1D1I A;  3BDO A;  4OHJ A;  1HCZ A;  3CQZ B;  4RGN A;  4FNF A;  1E0B A;  4X3U A;  1EY0 A;  4E6I A;  2JA5 B;  1QG7 A;  1WTV A;  3GTG B;  5EKI A;  1B3A A;  3HEJ A;  1H9S B;  3E0J A;  1STB A;  1EYD A;  1UNS A;  3R93 A;  1HUN A;  1SYD A;  1U4L A;  4DK1 A;  3BS1 A;  4TSS A;  3QO2 A;  4HCS A;  4X3K A;  4H0L C;  3DEP A;  3I73 A;  4KJN A;  1JC7 A;  3TP5 A;  5KYL A;  2KA7 A;  4ME5 A;  4TRD A;  2BDO A;  3E6Z X;  4X3S A;  4PMW A;  4WJW A;  1H9M A;  4FYD A;  2SNS A;  3GTJ B;  1IYV A;  1WTW A;  1GUN A;  3M4Y A;  4XXE A;  1K8M A;  3OWE B;  1CI3 M;  1I4Q A;  5FLX L;  1CHP D;  1VDZ A;  1PYW D;  2K32 A;  4IFD J;  3A7L A;  1V8Q A;  2RSN A;  1GHJ A;  4IUR A;  4KV6 A;  1L0Y B;  4B9W A;  3PUW A;  2LS0 1;  1TS4 A;  3RD4 A;  3DUZ A;  4K5X A;  4UDU C;  5CV8 A;  2EYL A;  1HA5 A;  1QIL A;  2A69 C;  1TWF B;  1EU3 A;  4FF3 A;  1PTO F;  4M8A A;  3A54 A;  5IGD A;  4PMC A;  2SEB D;  1GUO A;  2EY2 A;  4F88 A;  1EFI D;  1B4O A;  2LKV A;  4FF1 A;  4RH6 A;  4LJZ C;  2VB2 X;  5IGB A;  2Q8R E;  2RDF A;  2WAQ B;  3QWN A;  1EY4 A;  3MAQ A;  4Z9C B;  3OOC A;  4HSP A;  1ET9 A;  4I65 A;  4C3J G;  1TWG B;  4A3D B;  4KY7 A;  4DAY A;  2EYP A;  3MA2 B;  1BDO A;  1RKN A;  1U4M A;  4KK7 A;  4NDX A;  1WVL A;  2OT2 A;  4G4K A;  1EZ6 A;  2CW0 C;  5ELD A;  1Q1E A;  1I4R A;  2IT1 A;  3HS0 C;  5I9P A;  2B2Y A;  4CKB A;  4P2C B;  4RKB A;  2Z4H A;  1SFO B;  4KKU A;  1STG A;  3G7L A;  3FRP B;  3PUX A;  3I3C A;  1PMR A;  1KNA A;  5EJW A;  3KUP A;  2RDG A;  4JK1 C;  1BF4 A;  2PCF B;  4G7Z C;  4U67 3;  3BG3 A;  1RJT A;  5C4J B;  2WII B;  4DA2 A;  1EIH A;  2EPB A;  3NK9 A;  3Q22 A;  3NE5 B;  4KN4 C;  1BUV T;  4ZAI A;  1H9K A;  1O7L A;  3PIP 3;  2PPB C;  1SYB A;  1QNU A;  4L63 B;  3SDZ A;  5C4H A;  3R3O A;  1I3Q B;  1HQM C;  3EJI A;  3HKZ B;  4YIJ A;  1EY9 A;  2MP1 A;  2K5D A;  1LT4 D;  2J7Z A;  1E2V A;  2N88 A;  3CU7 A;  5KRU A;  3MFG A;  4A3F B;  1WTP A;  4IUV A;  1LTI D;  1PTO C;  1G91 A;  1WTO A;  1QNK A;  4FF2 A;  2WKD A;  1TU2 B;  2HCC A;  2MUY A;  4G57 A;  3NXW A;  3O13 A;  1U9R A;  3NQI A;  1CQV A;  2PO4 A;  4Q0F A;  5E1F A;  1DOL A;  4IFD H;  4PMB A;  2XSC A;  2M2L A;  3TN2 A;  2EVB A;  2EOT A;  1PXU A;  2NUC A;  4KTA A;  1DYQ A;  2F3V A;  5JJZ A;  1WCM B;  2EYF A;  1YNJ D;  1SNQ A;  2K6A A;  1G2T A;  3VYU A;  4K5W A;  1R9T B;  3HOV B;  1S5B D;  3FPU B;  4DNT B;  3D4R A;  1LLR D;  1TQO A;  1V1P B;  3TP8 A;  3PIO 3;  4A3J B;  1SXT A;  3NBI A;  5CBA E;  1EOT A;  1SE4 A;  1RTO A;  1ZYR D;  1DOK A;  1TWC B;  1SYG A;  1KAB A;  1I4H A;  3UI2 A;  4BY1 B;  3KLR A;  2DY7 A;  3K0Y A;  4EGV A;  4HED A;  2B2U C;  1MSH A;  2EY5 A;  1XTC D;  5C6A A;  2O5J C;  4RHS A;  1D5Z C;  1IKM A;  1IW7 C;  5ELF A;  2FJ2 A;  3GV6 A;  1IKL A;  3SR1 A;  3PUY A;  3U9S A;  1D1K A;  5CV4 A;  1Y8P B;  4OO1 I;  2A6E D;  2EDG A;  3BYY B;  2E2H B;  1UUP A;  4F8M A;  2AWN A;  1ILP A;  1EY6 A;  3J7Y W;  5LL6 S;  3LNN A;  2A68 D;  2F1M A;  4S3S A;  3H6M A;  2L5T A;  2BE5 D;  5T1G A;  4H7B A;  4N9T A;  2KHS A;  2K01 A;  2K28 A;  3A55 A;  2ZXO A;  5CV6 A;  4IFD G;  4C3I G;  3GTL B;  2F0P A;  5IGE A;  1JOO A;  3OHX C;  3M4O B;  3K5M A;  2EJM A;  3MC0 B;  1C4Q A;  2HCI A;  5KNB A;  5FKA C;  3P7J A;  5M5W B;  2AQ2 B;  4KKS A;  4BBS B;  1TS5 A;  4K2L A;  3DWQ A;  2PMZ B;  2BDN A;  5JPN C;  4ZK9 B;  5I4D A;  5CGK A;  3HOY B;  3TME A;  2F0D A;  3PUZ A;  4A3E B;  3AB9 A;  1ENA A;  5C5L A;  2E74 C;  3K6O A;  2B8G A;  4CKE A;  1JCK B;  1RDP D;  2PW7 A;  2ZXR A;  1NR4 A;  5LL6 X;  1FYC A;  5I6Y A;  3VR3 A;  4RKL A;  4DGZ A;  3I8Z A;  2ZXP A;  2O4X A;  1L0X B;  1SNM A;  2VUM B;  4FVM A;  2IW3 A;  1F9Q A;  1LTR D;  4A3B B;  1H9J A;  1H9R A;  3BVG A;  1ILQ A;  3S2H B;  3I91 A;  4BY7 B;  1ESR A;  1KDC A;  1WTR A;  1BO0 A;  3FDT A;  3M85 A;  2OF1 A;  3RMH A;  2V4D A;  2B2T C;  5IGF A;  1I50 B;  1RF2 D;  2F0Q A;  4IQZ A;  3A8K E;  3IAY A;  3VYS A;  3S2D B;  2NVT B;  3GTP B;  2PZW A;  3D3R A;  3VYR A;  5CMD A;  1MBY A;  2CHB D;  3FPP A;  2K5Q A;  4J8Q A;  2A74 C;  2EXZ A;  2KJX A;  1EIG A;  3NWS A;  4TKO B;  1QB5 D;  2KUM A;  3SE0 A;  3M7N A;  4KI0 A;  4XT1 B;  1PZJ D;  5CYU A;  1F9P A;  2EYJ A;  3J80 E;  2D9U A;  5EPJ A;  4KKT A;  2R7Z B;  2WIN B;  3GD7 A;  2Q8I B;  2JE6 I;  2F0F A;  1ZEQ X;  3KK7 A;  1TKW B;  5J39 A;  1OXT A;  4XYQ A;  3LWE A;  4ZQ3 A;  1AEX A;  3D4W A;  5C0X I;  1FGB D;  1BCP F;  4RWS C;  1STE A;  4IN3 A;  4HAE A;  1A3T A;  3K5N A;  4KD4 A;  3J7A V;  1TWH B;  1JWM D;  1CTM A;  4MN3 A;  4G7O C;  1CFM A;  4ZUJ A;  5FO7 B;  1HTP A;  1PTO B;  1ESF A;  3TBI B;  3HP3 A;  3MHB A;  4R9W A;  3BVZ A;  5C44 B;  1E2W A;  1BBX C;  1WTQ A;  2B2U A;  2A69 D;  1PRT F;  2L55 A;  1ZKO A;  2PNR C;  3PO2 B;  5D3D A;  3DXJ C;  2E76 C;  2RBM A;  1UAP A;  2F0H A;  3K5L A;  1LT3 D;  3GTK B;  3HGB A;  5KIX A;  2EYO A;  1DM0 B;  3T16 A;  2B8F A;  2SNM A;  3K58 A;  1TY0 A;  3OSO A;  3MFY A;  3W3A A;  2JP1 A;  4MHE A;  1NUC A;  4ODG A;  4TQU S;  2DNE A;  1GJX A;  1EWH A;  3VR5 A;  3Q24 A;  2QDB A;  3SHL A;  3H94 A;  2CW0 D;  1SYF A;  3HRZ C;  4WRD A;  1F2M A;  1SND A;  1UEA B;  1D6E C;  3A56 A;  1XX8 A;  1A15 A;  3NPP A;  1ROD A;  4OL7 A;  1SNO A;  4CGY B;  4U68 A;  1R4Q B;  1SDF A;  2B2V A;  4DU9 A;  2XWJ B;  4QUC A;  5C4X B;  4GZY C;  5M3F B;  3VA7 A;  4F7X A;  1G29 1;  2F0L A;  2D62 A;  1KTK A;  3V2T A;  1GUG A;  1EY5 A;  1B9M A;  1I6V C;  1EZ8 A;  1EYA A;  2IX1 A;  1BCP C;  1CHQ D;  3GO5 A;  4CJ2 C;  2L9H A;  3KBG A;  1O7Z A;  3S1M B;  4KHV A;  3SVM A;  2F03 A;  3S1Q B;  3D31 A;  3OIP A;  1PZK D;  2M00 A;  4KJO A;  4PNY A;  4KMU C;  1FNU A;  2FFK B;  1S5D D;  3NWT A;  4XYO A;  1QJO A;  2VNU D;  3DEO A;  1AW7 A;  4FXK C;  1PRT C;  4H13 C;  1BXT A;  1F9S A;  3T53 B;  4OIK A;  1SNP A;  1PTO D;  2PQE A;  5K5P A;  3CRL C;  2AUJ D;  5IT9 E;  3SXH A;  2X6G A;  4NKL A;  2E75 C;  4LMQ D;  2B2T A;  3VR4 A;  1SSO A;  3Q23 A;  2QKI C;  4V0B A;  1LT6 D;  4CKC A;  4G7H C;  4BS9 A;  1HRJ A;  1J8I A;  3GV3 A;  1F9R A;  5CR3 A;  1FNV A;  1M4V A;  2XRQ D;  2O5I C;  1I4X A;  5COR A;  1J9O A;  1X32 A;  5ELC A;  1TII D;  1QWY A;  4R8I A;  4C56 C;  4K2K A;  5K36 H;  2K33 A;  4HMI A;  5I9O A;  4HR7 B;  4J6H A;  2A6H C;  3OIQ A;  4DN4 M;  1VMP A;  2H1E A;  2I07 B;  1SMY C;  4FO2 A;  2F3W A;  1SEB D;  3HOX B;  3N6R A;  5M5X B;  2Q8T A;  5EPK A;  4X3T A;  2F0M A;  3EQL C;  3FEW X;  3QOJ A;  2N55 A;  4K5V A;  3NP8 A;  1V1O A;  1HTL D;  3KF8 A;  3FKI B;  3R2I A;  4C1N K;  1EEF D;  2HQE A;  1DCZ A;  2MPM A;  1IW7 D;  5A35 A;  5M5Y B;  3S1R B;  4OGQ C;  4IUQ A;  4C2M B;  1PLF A;  1W6J A;  2TSS A;  5DNF A;  1ENC A;  2HUG A;  2X69 A;  2R93 B;  5IT9 L;  2Y0S B;  1Q1B A;  1S5E D;  5HUR A;  1ML0 D;  1LTA D;  3BZD B;  1RCV D;  3NSW A;  4OO1 H;  2BCO A;  2F0W A;  2QEJ C;  4ABN A;  1YNN D;  1ONL A;  2VXW A;  4QMG A;  1OXV A;  2RSO A;  5IGC A;  5JOB A;  3TZU A;  1U4P A;  2NZ1 D;  2F0T A;  1Y8N B;  4HN7 A;  3OWF A;  3DWP A;  5IOD A;  5C3E B;  5AFW A;  5C0X J;  5ISR A;  4NW2 A;  4DXG A;  4ILW A;  5JEA J;  5A2Q E;  2K7V A;  4ZRZ A;  2X6L A;  4RCO A;  2IL8 A;  3FVQ A;  4C3H B;  1O80 A;  3PMF A;  1QE6 A;  3QJY A;  1B9N A;  3H0G B;  3K59 A;  1EL0 A;  2PYK A;  5I2Y A;  1EQV A;  3QB3 A;  4R8N A;  4H44 C;  1HXY D;  2C5C A;  1SJH D;  2NTS A;  1CZG A;  4DAV A;  2NVX B;  4ZKB B;  3D6W A;  4FXD A;  5K36 G;  5BN5 A;  2KOL A;  4DFA A;  3IKJ A;  1B44 D;  1STA A;  1D5M C;  2RKS A;  3D8G A;  5CC4 A;  3SK8 A;  4A3I B;  4F87 A;  2NN6 H;  2B2W C;  2G9H D;  3AU7 A;  1VMC A;  1TT2 A;  4QIW B;  1EWC A;  5LHY 1;  1LTG D;  1OXX K;  3GP7 A;  4DNR B;  1PFM A;  4Q5V A;  2F0O A;  4O1N A;  4IZ8 A;  1G8Z D;  2MHV A;  3I72 A;  1WTX A;  2F0J A;  5KGU A;  1PTO H;  1SAP A;  1YNJ C;  2B2V C;  5CV5 A;  2AWO A;  2EJF C;  5COY A;  1WD0 A;  4ID6 A;  3IL8 A;  3C1F A;  5A2Q L;  2BA0 A;  2IWH A;  4OO1 G;  1Z6H A;  3CRK C;  3HOW B;  3D6C A;  1AP0 A;  3PV0 A;  4QF4 A;  1SJE D;  2C9O A;  2WP8 J;  1JB3 A;  2JA7 B;  3MXG A;  5BN3 A;  4ZUI A;  2FHT A;  3N52 A;  4ZYS A;  2KCC A;  1LAB A;  2EE1 A;  2CQA A;  3MEH A;  1BCP B;  4CJ1 B;  3Q6S A;  5EKK A;  3BDC A;  5JAV A;  3LX0 A;  5DAU A;  1E2Z A;  1ICW A;  2XIW A;  5I2X A;  5C3X A;  1STH A;  2JEA I;  1O7Y A;  1Q3L A;  3SK4 A;  2F0I A;  1EYC A;  1MGS A;  2K5W A;  1LV9 A;  5C0X H;  3BVM A;  2JA6 B;  4C3I B;  4KN7 C;  1JR0 D;  1PRT B;  4B08 A;  3I4N B;  4KHZ A;  5ELE A;  2BE5 C;  4IUN A;  3JAM E;  3TDQ A;  1PFB A;  1W6K A;  2NN6 G;  5IOC A;  4DAP A;  5G3L F;  1DZ1 A;  5JVG 3;  1DXM A;  2ICI A;  2KEE A;  3BDL A;  3U9O A;  3H91 A;  1EEI D;  3EFX D;  2F4I A;  4EQO A;  1Y69 U;  3DMU A;  4RGO S;  3KLS X;  3J81 E;  2NYZ D;  3S1N B;  1MD2 D;  1DOM A;  1FNW A;  4N9P A;  1K8O A;  1F2Z A;  1LTS D;  3SK5 A;  2QF7 A;  1FR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...