4A93H

Rna polymerase ii elongation complex containing a cpd lesion
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Mechanism of Translesion Transcription by RNA Polymerase II and its Role in Cellular Resistance to DNA Damage.
pubmed doi rcsb
total genus 23
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a93H00
3WWVA 1YNXA 4JI0L 3U4ZA 5K36G 1MIUA 4HJ8A 1CUKA 3BZKA 3AYHB 2Q2TA 3G71A 1YZ6A 1W3SA 1WI5A 2VS1A 5GQOA 3ERSX 1N34Q 4UP9A 3S1NH 4MTNA 1K83H 3MXNB 2D0OA 3CC7A 4X62L 2HHHQ 1CSPA 1HZCA 2FXQA 2IX0A 4YWLA 1K73C 1A63A 2Q2UA 1OXSC 2HQLA 5IY0A 2VUMH 4DUZQ 1YJ9A 3KDFA 5EAYA 1J6QA 1G6PA 2I5MX 2JE6I 2ZTDA 1KC8C 3ICEA 3U58A 2K4KA 1IBML 2AMCB 1TWCH 3J81c 4GNXB 5C44H 1IBKL 1L0WA 3UDIA 4NXNL 4LFBQ 4DV6Q 5AJ3Q 4A3EH 2QGQA 4A3IH 2EIFA 2N8NA 3GTPH 2JK8A 1I6HH 5FJ8G 1BBWA 3G4SA 1R9TH 4LF7L 4H02A 3F2BA 4YCUA 1EQQA 1W2BA 4PMWA 1VQHA 4UY8C 4GOPC 1E1TA 1KHIA 2AKWB 4XTCS 3AEVA 3K7AH 4LFCL 3F2CA 1TWHH 3PUVA 1UE1A 1PH4A 1HNZL 2ES2A 4HJ7A 2UU9L 1I5FA 5IWAQ 4DV2L 2NN6I 1Q1EA 3PUZA 4JI6Q 2K75A 3HOWH 4NXMQ 2E8GA 3CQZH 1QZGA 1YHBA 2JQOA 2V1CC 5HGQA 3RR5A 5LMNL 3S15H 3K81C 2YU9H 1Z9FA 2A19A 4JBWA 2NVXH 4R1JA 1XMQQ 3CCLA 4K0KL 1SRUA 3AQQA 1IYJB 3CCSA 1L1OC 4HIKA 3Q8DA 4HJ9A 1N9WA 4DR1Q 4A3IG 1HR0L 4GLAC 4QGUA 2MNAA 1VQ5A 4A4IA 2UUCQ 4JI8L 4LUZA 1KAWA 4JI3Q 4JI4L 3CAMA 4P74A 3UE1A 3HKSA 3B6YA 1EOVA 3L2PA 4DR6L 1VQJA 1K0RA 5BR8L 2NZHA 4L5QA 4IPHA 2VQFL 1Q86C 1J5EL 4LF6Q 3S1MH 2IHEA 1U5KA 3K7UC 4APVA 4BA2I 3RLOA 4AYBE 4AIMA 1FJGL 2WB1E 3PO2H 4B3RQ 4LFAQ 4UPAA 1GD7A 2JEAI 3GDEA 3W1GA 3CCRA 1ASZA 4B3ML 3GTKH 4X65Q 4X66L 1HJPA 4GN4B 1XMOL 3J81i 3M7NA 2KCTA 2LSSA 2N49A 1PH6A 1YHQA 1IL2A 1TWAH 5M5WH 1EUJA 4A3KH 4LWCA 2UUAQ 3I4OA 4LF5L 4DR7L 2UXCQ 2KBNA 3W1BA 5M3MH 3SGIA 1UEBA 4DV1L 5IYDH 2Z6KA 3AFQA 2KENA 5LMUL 2Y0SE 3KLWA 4A3DH 4KHZA 2KCMA 1VQPA 3PUWA 4X64Q 4DV0Q 2YTVA 3TREA 1PH2A 1I94Q 3J7A5 3PO3H 4OO1G 1V1QA 1EYGA 4YWKA 2K5VA 4C3IH 1OXVA 1X65A 3OTOL 3T1HQ 1VQ8A 1I50H 4GNXA 4DPGA 2UXDL 2YV5A 1KRSA 3HOUH 4AQYQ 1X55A 1X3GA 2EXDA 3FHWA 4JI1Q 3RN5A 2NN6G 2JA9A 3OW2A 3FKIG 1BBUA 1NBWA 4TVAB 5FLXc 1KQSA 4GKKL 3HOXG 5FLMG 2ID0A 4A3KG 2E2IH 1SFOH 3NENA 1WCMG 4A3FH 4IFDJ 1O7IA 1VQBA 2JA5H 5IYDG 3GTOH 2JJQA 4IJLA 2CWAA 5C4JH 3STBC 5M5XH 3DLLA 2ZJRA 1M90C 1VQ7A 4DR2Q 3PF4A 1IXRA 1VQMA 4LF4L 4DNIA 4BBSH 1VQLA 3OYYA 5IP9H 3PIPA 2I0QA 3S14H 4JI2Q 1X9NA 3PUYA 1N34L 3H15A 4YY3Q 2VL6A 3F1ZA 5IE8A 1SE8A 3M85A 1ASYA 4LNQA 2B63H 4BXXG 2HHHL 4C3JH 3CMAA 2JA6G 3CPFA 1Z47A 5IP7H 3H0GH 1E22A 1S72A 4DR5L 4WJ4A 1HNXL 5DLQE 2KHJA 1N32L 3CP0A 1XPOA 4JOIA 4YHHL 3TQYA 3CCMA 3M4OH 2R7ZH 1E1OA 1UE7A 1SMXA 4DV4Q 3RLNA 2HT1A 1S3OA 4GOPB 3KOJA 3HOVG 2UXBQ 4YWMA 4L5TA 4FDBA 4A3LG 2IHFA 5C4XH 4LFBL 5AJ3L 3PIOA 4A3BH 4QY7A 3I4NH 2JA8H 2UUBL 1T9HA 3I7FA 4JYAQ 3TEHB 1VQFA 4P72A 4BBSG 1XPRA 1LTLA 1A62A 2I5HA 1NMGA 1OXTA 3DM3A 1K8AC 3G48A 1N33Q 4BA1I 4JV5Q 1K9MC 3PGZA 1EIYB 2B63G 2E2JH 1HNWQ 3CF5A 4NPSA 2MO1A 4JI5Q 1VQ6A 4BY7H 2Q2IA 1VQDA 4DAMA 2R6GA 4POGA 4P73A 1YIJA 2WAQG 1N36Q 4LF9Q 5IWAL 4LW1A 1HZ9A 1C7YA 2OQ0A 2D0PA 1XNQQ 1KIXA 4QQBX 4NXML 4XIGS 1UE6A 2A8VA 3HOYG 3U50C 2IY5B 4L5RC 2RHSB 2VUMG 4KHPL 2R7FA 4X62Q 4BBRH 3UE0A 3IRBA 2JA7H 3M4PA 2YTYA 3I2ZA 3PF5A 1P8LA 4JI3L 2ATWA 1VQNA 3S2DH 2VY3A 2CWPA 1BVSA 1UE5A 2KHIA 5C44G 1PA6A 3CCUA 4OONA 2C35B 3RN2A 5ELOA 1IBMQ 1YVCA 4A3EG 4DV7L 2VNUD 4LF6L 3JAMi 4EQ5A 4NXNQ 2K5NA 3L0OA 5C0XJ 3A74A 3ULLA 3HOYH 3ER0A 4B3RL 3I4MH 4DUYL 1B7YB 4QIWE 4LFAL 1XNRL 1E3PA 3S17H 4DV5Q 1PVOA 1Q1BA 2AWOA 1Y1WH 3K0XA 4OWWB 1Y1VH 3KFUA 1A8VA 4X65L 2BH8A 4ME3A 4WJ3M 1KRTA 1JJGA 4A3MH 4GN5A 1JMCA 4GNXC 1SROA 2UUAL 2UXCL 3TS2A 1WFQA 4DKAC 3STBD 3GTLH 1GO3E 2MO0A 4IOCA 5IYCH 3HOWG 1NE3A 2CCZA 4DK3C 1PHJA 1VQAA 5GROA 1QUQB 2B29A 3MEFA 4IFDI 3PSIA 1X56A 1Q82C 1EWIA 4X64L 4OX9Q 4GKJQ 4DV3L 4A3CH 3GTQH 4MNOA 2K5HA 3LGJA 4PG3A 2ASBA 1Y14B 4GOPA 3T1HL 3A5UA 1IBLQ 4B3SQ 1OXXK 2R92H 3CD6A 1Q8KA 1G291 4JI7L 2OTLA 2JEBI 4A93H 2AWNA 4HIDA 4UP8A 2VQEQ 3BZCA 4P75A 4JI4Q 3HOZH 2OQKA 2R93H 4QJFA 4A3JH 4L5SA 1QVGA 2RCNA 3M9BA 4O0AA 1X6OA 3KF6B 5J3BA 1KXLA 4KLKA 2PI2E 2VQFQ 1TWGH 2I5LX 2ZTEA 4DR3Q 3PO2G 1NY4A 4A3GH 3T1YQ 1YI2A 3W5OA 4LUVA 1I3QH 3HKZG 4DR2L 2L15A 3FP9A 1U0LA 1FJGQ 1L1OA 4GKJL 2ZM6L 1Q81C 3S2HH 2NVTH 4JI2L 3PUXA 4BY1H 4DR4Q 2PI2A 1PH5A 2WAQE 4B3MQ 4A75A 5M3MG 3CC4A 4IPDA 4P71A 4IO9A 3F8TA 2CQOA 1JJ2A 3RLFA 4AH6A 3KJOA 1PH8A 4GN3B 4EX5A 4A3DG 3ZJYC 3NBHB 4TQUS 1E7ZA 5IYBH 3CCVA 3PO3G 1XJVA 2R93G 4DV4L 1VQKA 3CC2A 1SR3A 4Y52H 1EFWA 1QVCA 3NELA 4GS3A 4B3TQ 3H3VI 4KI0A 1IZ6A 3E0EA 2WP8J 1TXYA 4A3GG 2LXKA 3HOUG 4DUZL 2F4VQ 3OTOQ 1K8GA 1HH2P 3K8AA 1GVPA 4RMFA 1PH1A 1JB7A 1YBYA 2E5LQ 1N33L 2MFIA 5H1SE 5JJLA 1CKOA 2H5XA 2RF4A 4GLXA 1G51A 4IFDG 2R7DA 5JEAJ 5GAGC 3A0JA 4A3FG 4JV5L 1S40A 4JBMA 4LF8Q 4DV6L 2B3GA 1EIFA 2JA5G 1HNWL 2K50A 1XPUA 4IPCA 4HJAA 3RNUA 4IOAA 2WB1G 1X3EA 1JT8A 1TWFH 1FGUA 3RZOH 1UWVA 5IP9G 1QZHA 1N36L 2WFWA 2VZAA 4LF9L 3UDXA 4LF4Q 1XNQL 1LYLA 5FJ8H 2K14A 4PZ7A 1BKBA 5IP7G 2NVQH 3H0GG 1L1OB 4DAYB 5C0XI 3ULPA 1OXUA 1P16A 2IX1A 3H3VH 5LMNW 1FL0A 1QUQA 3TRZA 1Q12A 5GAHC 2XGTA 2Y0SG 2HIVA 1DGSA 3I55A 2BA0A 2Q2HA 2R7ZG 3E9IA 4MZ9A 3CPWA 5M3FH 4DR5Q 1K3RA 1HNXQ 5IT9c 1V43A 4JI0Q 1N32Q 1MKHA 1HR0W 4JI6L 2OTJA 1YHAA 4YHHQ 4LUOA 5JEAG 4R4CA 1D8LA 3GTGH 1YJWA 3J81j 5C4XG 5M5YH 4A3BG 3VDYA 1XMQL 2JA8G 1VCIA 5HY6A 3I4NG 2HIXA 1HZBA 4JG2A 3CMEA 3CCEA 4DR1L 3KF8B 2UUCL 2QEXA 1YJNA 2UUBQ 4HJ5A 3KF6A 1CKNB 4OWXB 1WOCA 5GAEC 3EN2A 2VW9A 1GM5A 3GTMH 4J15A 4DV5L 4YCWA 5ELNA 3KJPA 4BY7G 1NTGA 1PH3A 3HKZE 1PFSA 4RG1A 3S24A 2Z6KC 3E9HA 1IBKQ 1B8AA 1YEZA 3PV0A 4OO1I 1C0AA 1PYSB 2IT1A 3GO5A 1H95A 3GD7A 1WJJA 3JC66 2AHOB 2ZTCA 1VQ9A 5M3FG 2LXJA 2F3IA 3GTJH 4LF7Q 1AE3A 4PZ6A 2N3SA 4R4TA 4C2MH 4A76A 3UDFA 2OWOA 1N8RC 4NB3A 5GADC 1M1KC 4OX9L 2ZJQA 2CFMA 3K80C 1VQIA 4BBRG 4R4IA 2JA7G 4JC0A 4POFA 4LFCQ 1XTDA 4KHPQ 1IBLL 4B3SL 1VQOA 5C3EH 2QA4A 1YITA 1PYBA 1HNZQ 3PCOB 2UU9Q 4DV2Q 2VQEL 1LM0A 3G6EA 4DV0L 2MQHA 1I94L 5LMNQ 3BU2A 4DK6C 1CKMA 2GN5A 3F2DA 3S1QH 3BJUA 3I56A 2GVBA 1MJEA 3KDFB 1Q7YC 2DGYA 1VQGA 5C0XG 3AFPA 4DV7Q 1PH9A 4K0KQ 1RIPA 3HFZB 4DR3L 1HR0Q 4JBJA 1V9PA 3T1YL 2E2HH 3J80c 4AQYL 3I4MG 1Q46A 4JI8Q 1Y1WG 1VQEA 3EBEA 1CSQA 1Y1VG 4JI1L 2YTXA 1WYDA 1A0IA 1B70B 1C9OA 1HZAA 2CKZB 4OWTB 4PZ8A 4QL5A 4DUYQ 4A3MG 1XNRQ 4DR4L 4DR6Q 5BR8Q 4O2DA 2PQAA 4OXPA 4C3HH 3FKIH 3L7ZC 1J5EQ 4R4OA 2NZOA 2F52A 3D31A 1FVIA 3NEMA 4IPGA 4JOIC 5FLMH 2D62A 3U4VA 3HOXH 5IYCG 1SN8A 1WCMH 5C3EG 3KYHC 4Y7NH 2BH2A 2A1AA 4HIOA 2K52A 3CCQA 3RZDH 1NJIC 4A3CG 4YY3L 3M4QA 1MJCA 1LUZA 4X66Q 1X3FA 2PNHA 1E24A 1VQ4A 5E7NA 1XMOQ 1OTCA 4B3TL 2DUDA 5JJKA 5JJIA 4YCVA 4DV3Q 2EQSA 4LF5Q 2R92G 4IJHA 4DR7Q 1L2FA 2XTIA 4A93G 2Z0SA 4JCVE 4DV1Q 4HIMA 2F4VL 2JA6H 3HOZG 4BXXH 5LMUQ 2YYZA 4A3JG 2E5LL 4GLVB 4JI7Q 2PMZE 2UXBL 2ALYB 3A5ZB 1QVFA 4X6AH 2GVAA 3ULJA 3CXCA 1KL9A 4LF8L 1CKNA 3S1RH 1D7QA 3HOVH 1VS0A 4JYAL 2RHQB 4A3LH 1JJCB 1JE5A 2N78A 3J7ZC 1PV4A 1EQRA 2ZJPA 2NVYH 2UXDQ 1X54A 3CCJA 4BY1G 4R4QA 1AE2A 3EIVA 4JBKA 4UP7A 4GKKQ 2ZM6Q 4ALPA 1KD1C 2OCEA 4JI5L 1PH7A 4AYBG 1RL2A 3CW2C 1VQCA 3M3YH 3S16H 3D0FA 1GKHA 2BA1A 1AH9A 5IYBG 1SLJA 3TS0A 3JAMc 2PQAB 3UDGA 3J80i 1NMFA
chains in the Genus database with same CATH superfamily
1YNXA 5A2QE 2PYKA 4AYBB 4HJ8A 1CUKA 3T4AC 3BZKA 4ME5A 2L9HA 1WI5A 1N34Q 3S1NH 5FO7B 3MXNB 5ELFA 1KLUD 2HHHQ 1WTRA 1V1PA 1NSNS 3Q6SA 5EAYA 3HOVB 4LK1C 2I5MX 1VMPA 2ZTDA 2EY6A 2BE5D 2K4KA 1Q3LA 4GNXB 1PLFA 5FLXE 1IBKL 4DV6Q 5AJ3Q 1NR4A 3PIP3 4A3IH 3GTPH 2N8NA 4NKLA 1SNQA 5FJ8G 1R9TH 2IJ0A 3A55A 5COYA 4C1NK 1W2BA 1EQQA 4PMWA 1D5ZC 2Q8TA 5CV9A 1E1TA 1KHIA 3DEOA 4FF3A 3AEVA 2RQXA 2WAQB 3K7AH 1W6JA 3PUVA 3R3OA 4PQXA 2L1BA 3L3OC 1I5FA 5IWAQ 2NN6I 2NTTA 3P20A 3PUZA 2A6ED 4DXFA 4JI6Q 2K75A 2E8GA 3S15H 3K81C 2A19A 3K58A 2KVMA 4K0KL 3AQQA 4GLAC 2MNAA 1VQ5A 2NB0A 3KUPA 4JI8L 1X32A 4LUZA 4JI3Q 1WTXA 3B6YA 2F0UA 4DR6L 1VQJA 3MVVA 2AQ2B 1I6HB 3TMEA 3NSWA 1AN8A 3S1MH 1PTOD 5JAVA 1KDBA 3BYYB 5NUCA 4AYBE 4AIMA 1FJGL 2LMCB 2JEAI 2KCNA 1ASZA 1I4RA 4X65Q 2XRQD 1HJPA 2XVSA 4X66L 1XMOL 3GTJB 2LSSA 1PH6A 3CHBD 1YHQA 1IL2A 5M5WH 2WKCA 3LX0A 4DR7L 3E3XA 3Q24A 3FVQA 2E74C 3AFQA 1C4QA 2PPBC 2B2UA 5LMUL 2Y0SE 2NVXB 4BS9A 3GP7A 1VQPA 4X64Q 3TREA 1QG7A 1D5MC 1V1QA 1HUNA 4KHVA 2DNCA 4CGYB 1TY0A 4AQYQ 1UNSA 3FHWA 4JI1Q 2NN6G 2JA9A 3FKIG 1KQSA 1NBWA 5FLXc 3NBIA 1J8IA 1R4PB 1FGBD 4IFDJ 2A69C 4A3FH 3SK8A 4Q0FA 4IJLA 3DLLA 3HP3A 1M90C 3C46A 1CFMA 5IP9H 3PUYA 1N34L 3F1ZA 3M85A 1LTTD 4LNQA 2HHHL 1LTBD 2OF1A 3BG3A 1Z47A 2EYJA 3VA7A 1AW7A 4YHHL 3GV6A 2R7ZH 3OW7A 3I70A 4DV4Q 4WFN3 2N55A 2JA6B 1DONA 5G3LF 4V0BA 5CGKA 2IHFA 1LTGD 5AJ3L 4QY7A 3I4NH 1T9HA 1SYDA 4JYAQ 4P72A 2JSOA 4BBSG 4HAEA 1NMGA 1K8AC 1BUVT 2K1BA 3CF5A 1EY9A 3J7AF 2Q8IB 3GQBA 2R6GA 3S14B 2AQ3B 4POGA 3PQIA 5KIXA 2D5DA 2B63B 2EJFC 1EL0A 1N36Q 5IWAL 1KIXA 2IY5B 3HG9A 2Z9HA 4ID6A 4WORA 5KNBA 4N9PA 2R7FA 4X62Q 4ILWA 5BN5A 1K83B 3NE5B 1P8LA 1TY2A 4JI3L 2ATWA 1PTOH 1VDZA 4S3SA 2V4DA 2VY3A 2CWPA 1UE5A 1PA6A 4GZYC 1IBMQ 3NPPA 3JAMi 2K5QA 4NXNQ 2B2VC 3HOYH 3I4MH 1B7YB 3S17H 1PVOA 1JWSD 1Q1BA 4OWWB 1Y1VH 4K2KA 4X65L 2G9DA 1YNJD 1F9PA 4ME3A 4WJ3M 1KRTA 4A3MH 1EY5A 1Y69U 1BBXC 3TS2A 3E0JA 5IYCH 2HCIA 3BDLA 1WTVA 3ZYYX 5IT9E 3MEFA 3PSIA 4BBRB 5CC4A 4XYOA 4X64L 4OX9Q 2F0QA 3GTQH 4MNOA 3CQZB 1H9SA 1Y14B 1CHQD 4B3SQ 2YU9B 2R92H 1LT5D 4JI7L 2OTLA 2JEBI 4A93H 2AWNA 2VQEQ 3BZCA 4P75A 4JI4Q 2VXWA 4QJFA 4A3JH 1GUNA 1QVGA 2RCNA 3QR8A 2VQFQ 1TWGH 4A3GH 2EYFA 3W5OA 1HFNA 1LLRD 1U0LA 4RFBA 4DAPA 2ZM6L 2PCFB 3S2HH 2NVTH 1TU2B 3SDZA 4IUUA 4A75A 3HKZB 3CC4A 4IPDA 1RF2D 4P71A 4H0LC 5IGBA 1XTCD 2B2TC 3SEBA 4TQUS 2XN9C 1JWMD 1XJVA 2R93G 4DV4L 1VQKA 3CC2A 4Y52H 1EFWA 2K28A 4DGZA 4EQNA 4FXGC 4B3TQ 1SNCA 3NQIA 1WVLA 2E76C 1YBYA 2MFIA 5JJLA 1GUGA 2WACA 2RF4A 1BQQT 3HOUB 2R7DA 2DNEA 5GAGC 3A0JA 4A3FG 2VNUD 1ILQA 2WB1G 1JT8A 1TWFH 4HSPA 2R3ZA 3RZOH 2K32A 5IP9G 1NCVA 1HFGA 1N36L 4KY7A 1O7LA 1LYLA 4G7ZC 3FRPB 1GOZA 2IPKD 1GUWA 1OXUA 1P16A 2IX1A 3TRZA 1Q12A 3QG1A 2RVLA 2R7ZG 4JI0Q 1K3RA 5IT9c 3T51B 4LUOA 4R4CA 3GTGH 3J81j 1IKLA 3DHQA 3I4NG 3HGBA 2HIXA 3CMEA 2AUKA 1YJNA 1H9MA 3KF6A 1WOCA 2JA8B 1ESFA 3HKZE 1PFSA 1Y8OB 1ZKOA 5JJZA 1YNNC 2Z6KC 3IFDA 1YEZA 2D2CC 3PV0A 4KV6A 2IT1A 3GO5A 3JC66 2ZTCA 3GTJH 1F9SA 2NVQB 1SE3A 2N3SA 4C2MH 4KTAA 3VR5A 3NUCA 2PZUA 3SR1A 4OX9L 2ZJQA 3K80C 5M3FB 3ERQA 3SK4A 4LFCQ 4RAUC 4WJWA 2F0KA 1HNZQ 4B3SL 1DOLA 1YITA 5I9OA 2VQEL 2JYOA 4DV0L 2MQHA 1I94L 4UAIA 3F2DA 3H91A 1ET6A 4XQQA 3BJUA 1MJEA 3J81E 5EKKA 3S2DB 1VQGA 4OO1H 3HOYG 1HR0Q 3HEJA 3I4MG 5EKIA 2EPBA 4UHVA 1Y1VG 2YTXA 1WYDA 3FEWX 1B70B 2CKZB 1HZAA 4PZ8A 4QL5A 1XNRQ 4A3MG 2F0FA 4RHRA 2PQAA 3L7ZC 1J5EQ 1Y1WB 1FVIA 4IPGA 5IYCG 5C3EG 2A1AA 1SYCA 2QCPX 1MSGA 3HS0C 2Z1CA 1LUZA 1ENFA 4CJ0B 4B3TL 1JE4A 5EPKA 4DV3Q 2D9UA 4JVZA 2R92G 3BS1A 1GXDC 1CTMA 1EYCA 2RCFA 4HIMA 4DV1Q 4A93G 2JA6H 4U68A 4A3JG 3QB3A 2UXBL 1BCPB 2IWHA 2Z4HA 1HHVA 1CKNA 1AZPA 1VS0A 2RHQB 2N78A 1LTAD 2DN8A 1PV4A 3CCJA 3VR6A 3EIVA 4DN4M 4JBKA 1ICFB 4ALPA 1KD1C 2OCEA 3I90A 4JI5L 1PH7A 4AYBG 1PFMA 1EOTA 3CW2C 4XQNA 2KUMA 3JAMc 3J80i 4JI0L 1SMYC 1IYVA 1B4OA 4UP9A 1BDOA 1K83H 1IL8A 2FMMA 3CC7A 1GHKA 1K0SA 3K5LA 1A63A 2Q2UA 3KLRA 2ZXPA 3EROA 3NWTA 4DUZQ 3I73A 1YJ9A 3S1RB 1J6QA 1G6PA 2EZVA 1KC8C 1R4QB 4K5WA 1IKMA 3EVQA 2EYLA 1TWCH 3J81c 2PNRC 2NVYB 5C44H 3V2TA 3UDIA 3QO2A 3I3CA 2EDGA 3CU7A 3G4SA 4H02A 1EWHA 3V96A 1VQHA 4UY8C 4DA2A 3ND8A 4FXKC 5EBCA 2FHTA 4LFCL 5IGFA 3ITPA 1PZID 4LMQD 3DWPA 1QNUA 4MN3A 1HNZL 3SXHA 2L0CA 1UEAB 1B44D 1QZGA 3CQZH 1W6KA 1SJHD 3RR5A 1K8OA 4KN7C 2YU9H 1Z9FA 4JBWA 3JAML 4R1JA 5T1IA 1XMQQ 4DR1Q 1L1OC 4HJ9A 1HR0L 4A4IA 3CAMA 2B2WA 5CYUA 1M8AA 1K0RA 3P75A 2NZHA 3QWNA 5E4WC 1Q86C 1J5EL 1ENAA 4BA2I 1LABA 4FO2A 4CDFC 1SBBB 1Z6HA 1ET9A 1U4LA 2WB1E 5CV8A 2F0JA 5JOBA 4UPAA 4LFAQ 4R8IA 3GDEA 3CCRA 4NMZA 3GTKH 2NN6H 3TP5A 1LO5D 4MIUA 3FPUB 2DY8A 1SSOA 3K6OA 3D4DA 2UUAQ 3KLSA 1STAA 1STYA 2KBNA 4DV1L 1DOMA 5E4XA 3SK6A 1JOOA 3PUWA 2YTVA 1PH2A 4OO1G 1VMCA 4OELB 2GA4B 1OXVA 1X65A 2G5DA 5IODA 3HOUH 1KRSA 1IYUA 1X3GA 3A8KE 3RN5A 2E2HB 3OW2A 4TVAB 5DNFA 2ID0A 2EYOA 3MWYW 5D3DA 1O7IA 5IYDG 2K04A 4L6TB 1IXRA 4BBSH 4A3KB 2SNSA 3BVMA 3OYYA 2I0QA 1X9NA 3BDOA 4YY3Q 2VL6A 3NTHA 1SE8A 1ASYA 2JA6G 2KOLA 1CZWA 3H0GH 1S72A 3ND9A 4WJ4A 1SNOA 1HNXL 3PO3B 4JOIA 4YIJA 3CCMA 3X3NA 4C3IB 3M4OH 3DUZA 1BR9A 3AU7A 5T1GA 1SMXA 3WOFA 3KOJA 4DU9A 5JEAH 1SAPA 2J7ZA 4LJZC 2Z6BA 2JA8H 1CK1A 3NK9A 2F1MA 1LTLA 1N33Q 1S5BD 3DM3A 4BA1I 3X3MA 3GTOB 1K9MC 2B63G 3HRZC 1VQ6A 1VQDA 5LL6X 4DAMA 1FNUA 1HUMA 3DMUA 1YIJA 2B2WC 5JVG3 3S16B 4HR7B 1ONLA 4LW1A 1F2LA 1HZ9A 4C3JB 2OQ0A 3GV3A 2IX3A 2F0GA 4IN3A 1MHWC 2F0MA 4XIGS 3RMHA 2A8VA 3U50C 5KYLA 2DY7A 5J39A 3I8ZA 5EPLA 2TMPA 4KHPL 1RCVD 3UE0A 3IRBA 2OEOA 2YTYA 3PF5A 3S2DH 4F7XA 2KHIA 5C44G 2C35B 3RN2A 5ELOA 1KNAA 1ESRA 1F2YA 5EKLA 2HDMA 2F3VA 4EQ5A 1RD9D 3NTIA 5EGTA 5C0XH 4K8JA 2EYHA 4RKBA 4ABNA 4QIWE 4LFAL 3CKIB 4BY7B 1BNZA 1Y1WH 3K0XA 4QB4A 2IW3A 2BH8A 1JJGA 2UUAL 1SROA 4B08A 3UI2A 3VYUA 4DKAC 3STBD 1GO3E 1QNKA 4TKOB 3MXUA 4N8X1 2CCZA 3QOLA 1TWHB 2SDFA 5CORA 5I9PA 2AUJD 1EWIA 2NZ1D 3W2DA 4GKJQ 4A3CH 2LY7A 3URYA 1PRTC 3HOWB 4QF4A 3H09A 2ASBA 4GOPA 1IBLQ 4XDXA 2NTSA 1G291 3W3AA 1EQTA 1SNDA 2OQKA 2R93H 3M9BA 3KF6B 3TDQA 1KNEA 3M7GA 2WKDA 4LUVA 1L0YB 3HKZG 5I6YA 2L15A 1Q81C 4DR4Q 1ILPA 1PH5A 2WAQE 4B3MQ 3PO2B 4KKSA 3DWAA 2B8FA 3F8TA 2CQOA 3RLFA 4AH6A 2I07B 4EX5A 3CCVA 1CZGA 1ZXTA 1IW7C 4CKEA 5M3MB 3BVGA 5K36H 3NELA 1X3PA 4A3DB 1RJTA 1ML0D 1XXGA 2WP8J 4PMBA 3HOUG 5CBEE 5HURA 2F4VQ 3OTOQ 1NUCA 1K8GA 1XX8A 1HH2P 2KHSA 3Q0AA 2HUGA 1N33L 5H1SE 1I50B 4O42A 1G51A 4DV6L 2B3GA 1YNND 3MXGA 4IPCA 1SYEA 4IOAA 3J80L 1SNMA 4CJ1B 3OWFA 2VZAA 1LV9A 2JA5B 4RGNA 3UDXA 1STEA 5FO8B 4LF4Q 5M5XB 4PZ7A 5KRUA 1BCPC 4O1NA 3H0GG 1L1OB 1WTPA 5C0XI 3ULPA 1QUQA 2CH4A 5GAHC 2XGTA 4LAAA 1DGSA 1HA6A 4DR5Q 1N32Q 3H6MA 4JI6L 1YHAA 4JPBW 5JEAG 1DOKA 1D8LA 2RDFA 1YJWA 5M5YH 3VDYA 2JA8G 1VCIA 3CCEA 2A68D 2QEXA 2H4OA 2QEJC 1EYAA 2UUBQ 4HJ5A 4OWXB 1CKNB 4KY5A 5GAEC 1GM5A 3GTMH 3D6WA 5ELNA 1A3VA 2PW5A 2EOTA 5C5MA 3KJPA 1PH3A 5KGUA 3DEPA 3E9HA 4IUNA 2B2UC 1K8MA 4K6DA 1WJJA 2E2JB 1VQ9A 5M3FG 1JCKB 1I4XA 2RA4A 3F2UA 4PZ6A 5I6WA 4R4TA 4A76A 1DZ1A 1A15A 2Z8LA 2KJXA 4EQPA 2K6AA 3CRLC 3RD4A 5GADC 2K33A 3NBHA 2F0NA 4JC0A 4G4KA 5CMDA 4FXDA 2EE1A 1IBLL 3EQLC 5C3EH 2QA4A 1NNXA 1PYBA 3O13A 5A35A 5AFWA 4CKCA 1O7YA 5C5LA 5IGGA 3SVMA 3G6EA 2BE5C 2OT2A 2OXPA 2QDLA 3BU2A 5FKAC 4DK6C 5LMNQ 1RTOA 3C1FA 5JPMC 3S1QH 2GVBA 1IHZA 2DGYA 5C0XG 4DV7Q 3D4WA 1RIPA 4IUTA 2O2LD 4JBJA 2E2HH 1ZEQX 4AQYL 4IURA 1Y1WG 1CSQA 4JI1L 3T16A 2VB3X 1Y8PB 1C9OA 4DUYQ 4DR4L 5BR8Q 2JXMB 4O2DA 3A54A 1Y8NB 3P7JA 3R2IA 4X3SA 2F52A 3NEMA 5FLMH 3HOXH 4B9XA 4IUVA 2NBFA 1SN8A 2BH2A 2F0TA 1HQMC 4Y7NH 4DAYA 1HRJA 1MD2D 1SMYD 2CVRA 4N9TA 3KK7A 2X6GA 1KTKA 1WTQA 3GTLB 4A3CG 3M4QA 1MJCA 1OTCA 5E7NA 2DUDA 5JJKA 4PMCA 1TR5A 4IJHA 4C56C 1E0BA 4JCVE 2F4VL 3G7LA 1G2TA 2FMCA 2YYZA 3MZ5A 3TSSA 3A5ZB 3KF8A 2EJGC 4ZCKA 3ULJA 3CXCA 1PZJD 3HOVH 1SE2A 4F87A 4JYAL 1PFNA 2UXDQ 1F9QA 2PQEA 3BVZA 4GKKQ 5J1ZA 2C9OA 4K5VA 1VQCA 3S16H 4ODGA 3VR2A 1AH9A 1SLJA 3TS0A 1VQLA 3UDGA 4BXXG 3WWVA 3VA5A 3U4ZA 5K36G 4ZYSA 1JC7A 1Z7TA 3AYHB 3G71A 5D3IB 5GQOA 3ERSX 1SNPA 2F0IA 2D0OA 4X62L 1CSPA 2F0DA 1HZCA 2IX0A 4H13C 2L11A 2QW7A 4YWLA 3WDNA 2RSOA 3BZDB 3A56A 3ICEA 4RWSC 3A7LA 1IBML 3EJIA 5C4ZA 2EY1A 2AMCB 1HXYD 4NXNL 4LFBQ 1STGA 4H44C 2KQ3A 2EIFA 4XYQA 4HSVA 1I6HH 2HD3A 1BBWA 4ZQ3A 3F2BA 3K0YA 1KABA 1B50A 1PRTB 3M4YA 4ZUIA 4K5XA 1RHPA 4XTCS 3F2CA 1TWHH 4NDXA 3JAME 3S1NB 1PH4A 3N52A 1ICWA 1RDPD 4HJ7A 2Q8RE 1Q1EA 1TKWB 3HOWH 2SOBA 4NXMQ 2JQOA 2V1CC 5LMNL 1LACA 5IGDA 2NVXH 4RA8A 1U4MA 4HEDA 3CCLA 5IIFA 3Q8DA 3OMGA 4CJ2C 4QGUA 1XWEA 2UUCQ 3MXPA 3BYTB 4IUQA 4JI4L 4P74A 3TP8A 3UE1A 1EOVA 2F3WA 1V1PB 1C48A 3TBIB 4A3IB 5BR8L 3GTPB 4ZKBB 1SDFA 4IPHA 4RHSA 2VQFL 1R9TB 4LF6Q 2AQ1B 3K7UC 1U5KA 4APVA 2F0HA 3RLOA 4OL7A 3K57A 2DJGC 3PO2H 4B3RQ 3W1GA 3OIQA 1I4PA 2KCTA 2N49A 1I4GA 1EUJA 4LWCA 3I4OA 3W1BA 5M3MH 3SGIA 5IYDH 4KMUC 1CA5A 3S15B 4X3KA 1DD2A 2XRSD 3KLWA 4A3DH 4KHZA 2K01A 2M00A 1CT1D 4YWKA 2K5VA 2F0EA 3TN2A 1I50H 4DPGA 2UXDL 2YV5A 2EXDA 1EIGA 2G9HD 1TQOA 3S1MB 4GKKL 3NP8A 3HOXG 5FLMG 4ZK9B 1YNJC 3NHHA 1CM9A 4KK7A 4A3KG 1TS4A 3MFGA 3NENA 1LTID 2JA5H 4C3HB 2CWAA 2L4NA 3SHLA 5M5XH 3PF4A 1VQMA 5M5WB 1B3QA 3IAYA 1WCMB 3S14H 4JI2Q 5CV4A 2B63H 3RZDB 1WTHA 4ZRZA 3CPFA 5IP7H 1QOHA 3K59A 5ELDA 5DLQE 2KHJA 3CP0A 4IZ8A 3TQYA 1KDAA 1E1OA 1UE7A 1DJRD 3J7YW 2HT1A 3RLNA 1S3OA 4GOPB 3HOVG 4YWMA 4L5TA 1O7ZA 4FDBA 1O78A 4KY6A 4LFBL 1F2MA 3PIOA 1U9RA 2ICIA 1VQFA 3TEHB 4MTKA 2EXZA 3I72A 1XPRA 1A62A 3WOEA 1FD7D 1H9JA 1F9RA 2FJ2A 3PGZA 1EIYB 2E2JH 1HNWQ 4NPSA 2MO1A 4XT1B 4BWGB 1AZQA 4C3JG 2Q2IA 2XNAC 4F88A 1NAPA 1SXTA 2WAQG 2XIWA 4L63B 2O5IC 2F0LA 3C2PA 4QQBX 4NXML 4DFAA 4L5RC 5I4DA 5C6AA 4BBRH 2F0WA 3M4PA 3J7AV 1BVSA 3KBXA 3I4NB 2VUMB 4OONA 4OIJA 1YVCA 4FVMA 4EVOA 1D1KA 5KNDA 4LF6L 1I4HA 2FFKB 3LWEA 3L0OA 5C0XJ 3A74A 3ULLA 2O5JC 4B3RL 1XNRL 4A3EB 2M2LA 1E3PA 4DK0A 5FOBB 3KFUA 2AWOA 5EJWA 4Z9CB 4PNYA 2A69D 1A3TA 1JMCA 2ZXRA 2CHBD 2F0SA 2WV6D 3GTLH 3HOWG 1QE6A 5DM73 1VQAA 5GROA 1QUQB 2B29A 1X56A 1Q82C 4C1NI 4DV3L 1S4ZA 4B9WA 1PTOB 2K5HA 2QILA 3LGJA 4PG3A 1U4PA 2RBMA 3CD6A 1OXXK 1WTWA 1RTNA 1UUPA 3H3VC 1LTSD 4RGOS 5LL6S 5J3BA 4DK1A 1KXLA 4KLKA 1BOSA 1I4QA 4DR3Q 3PO2G 1NY4A 4TSSA 3T1YQ 1YI2A 3I4LA 4A3MB 1FJGQ 2A6HC 5C3WA 5K5PA 3OSOA 4JI2L 3KLSX 3PUXA 4KJNA 2PI2A 5CV7A 1EEFD 3A7AB 3TP6A 1F2ZA 2O4XA 5ISRA 1BCPD 1EEID 2N88A 2J0TD 3QJYA 5M3MG 4ZAIA 4CHTB 2F0OA 2CW0C 1JJ2A 4A3DG 3KJOA 4GN3B 1TWAB 3ZJYC 3NBHB 5IYBH 3CRKC 3QIAA 1C8CA 1QVCA 4GS3A 3C1EA 4K14A 3H3VI 4A93B 1TXYA 4HN7A 4DUZL 1DXMA 3K8AA 3J80E 4RMFA 1PH1A 1JB7A 1G6ZA 2E5LQ 1H9SB 2WINB 3SE0A 1CKOA 1TWGB 1JOKA 4GLXA 4A3GB 2JN4A 1S40A 4JBMA 1HNWL 1EIFA 1JWUD 2JA5G 4HJAA 3RNUA 1X3EA 2NVTB 1EY7A 1FGUA 2E2IB 3DM1A 1SFOB 1QZHA 1DCZA 2WFWA 2KEDA 3QOJA 4OGQC 5C4JB 2NUCA 1XYIA 1SE4A 5IP7G 4NP5A 2NVQH 4DAYB 5JPNC 1HTPA 5BN4A 3RUZA 1II3A 2BA0A 2Q2HA 3E9IA 5M3FH 1HR0W 1I6VC 4YHHQ 1WD0A 5IGCA 2Y0SB 1XMQL 4JG2A 4DR1L 2KECA 1EWCA 3KF8B 5C4XB 1EU4A 2SEBD 1TS3A 3EN2A 4A3BB 2I46A 4J15A 3S9WA 2K5WA 4DNTB 1NTGA 1TWFB 3NQTA 2PMZB 4RG1A 3RZOB 2DJFC 4M1UB 2A73B 1GUOA 1PYSB 1H95A 3GD7A 2H1EA 2AHOB 2LXJA 1FYCA 1ZYRC 2F3IA 1QILA 4LF7Q 2ZXOA 4J8QA 3IFTA 2MJ8A 2MP1A 3UDFA 1N8RC 2RKSA 4NB3A 1M1KC 2CFMA 1VQIA 4BBRG 4R4IA 4H7BA 3TP7A 4FF2A 3GTGB 4IALA 1VQOA 3PCOB 2UU9Q 4DV2Q 1LM0A 3VYTA 2JA7B 2BDNA 5IGEA 5EBDA 1Q7YC 2A5HA 3AFPA 4DR3L 1V9PA 3T1YL 3J80c 3NWSA 4XXEA 1Q46A 1VQEA 3E5SA 5CV5A 1PZKD 1A0IA 1PXUA 2EYMA 4OXPA 4C3HH 1D2BA 3D31A 4JOIC 4C2MB 2F03A 2D62A 3U4VA 1WCMH 1Q90A 2K52A 4QMGA 3RZDH 2B2VA 1X3QA 4YY3L 1E24A 4TRDA 1EY8A 5L37A 2P5ZX 1UAPA 4QCLA 5JJIA 3MAQA 2EQSA 4LF5Q 1L2FA 2XTIA 2Z0SA 2CQAA 4BXXH 4OEMB 3ONAB 1NR2A 4GLVB 1EY4A 2E5LL 2PMZE 2L5TA 4JI7Q 1QVFA 4MHEA 3DWQA 5E1FA 2GVAA 1D7QA 1SYBA 3S1RH 1HPCA 3HOZB 3IL8A 1OO9B 4A3LH 1JJCB 4I7ZC 1EQRA 2ZJPA 2NVYH 1JOQA 4F8MA 2WIIB 4R4QA 4UP7A 2ZM6Q 1I3QB 1WD1A 2PW7A 1HQRD 1RL2A 4BY1B 2LKVA 2BA1A 3KBGA 5IYBG 2PQAB 1GJXA 1S5ED 1NMFA 4IQZA 5KYIA 1B2TA 1MIUA 2Q2TA 1YZ6A 4RH6A 1W3SA 2VS1A 2EY2A 1QCBD 1SJED 1A2UA 4MTNA 2FXQA 5A2QL 1K73C 1OXSC 2XWBB 2HQLA 5IY0A 2VUMH 3KDFA 1EIHA 2JE6I 2B2TA 3U58A 1D5XC 4X3TA 2IL8A 1CA6A 4RCOA 4NW2A 1L0WA 4I7AA 2MHVA 4A3EH 1JICA 5I2XA 2QGQA 3T53B 2JK8A 3OIPA 4LF7L 4YCUA 5FLXL 1HA5A 1B3AA 4HMJA 4CKBA 2JP1A 2K5DA 3Q22A 4FYDA 1H9RA 4GOPC 3P1HA 1A6XA 4J6HA 1PDQA 2AKWB 4XT3B 1MBYA 1KDCA 1UE1A 3OMCA 2ES2A 2KEEA 3BDCA 2UU9L 4DV2L 3PIO3 4GKJL 1A2TA 1STHA 1YHBA 3L9AX 5HGQA 4JW0A 1SRUA 3CCSA 1IYJB 4HIKA 4A3IG 5CR3A 1B9MA 1N9WA 1PMRA 2MUYA 1L0XB 3U9OA 1TWCB 5C4HA 2F0VA 1KAWA 5C44B 3D8GA 3HKSA 3L2PA 1LT3D 1CQVA 5I2YA 4L5QA 2IHEA 3A8JE 2QF7A 3MFYA 1EZ6A 1A3UA 5TSSA 4Q5VA 1JORA 1T5XD 1GD7A 1T5EA 4B3ML 4GN4B 1EY6A 3J81i 3M7NA 4ZUJA 1TWAH 4A3KH 3LWUA 3N6RA 4LF5L 2UXCQ 1QWYA 1UEBA 2Z6KA 3MHBA 1JQYD 4ZLTF 3MXNA 2KENA 2NYZD 2A6EC 2MGSA 2KCMA 4HCEA 2BCOA 4DV0Q 3PO3H 1I94Q 3J7A5 1S5CD 1EYGA 4K8IA 4C3IH 1M4VA 1CI3M 3VR3A 1EY0A 3OTOL 3T1HQ 1VQ8A 4GNXA 4RGMA 1CHPD 5DAUA 1PRTF 1X55A 2SNMA 3K5OA 4U673 1TS2A 1MGSA 4C3HG 1BBUA 1EU3A 1AP0A 4IFDH 2E2IH 3DXJC 1SFOH 1WCMG 1PFBA 1PTOC 1VQBA 4HCSA 1HTLD 3Q23A 3GTKB 3GTOH 4UDUC 2JJQA 3FKIB 5C4JH 2X6LA 3STBC 3NTKA 2ZJRA 1VF7A 4G7HC 4DR2Q 1VQ7A 1LT6D 4LF4L 4DNIA 2CH4W 3PIPA 3AMUA 3H15A 5IE8A 4EQOA 3R93A 3FPPA 1TVXA 4K2LA 4EGVA 4C3JH 1BO0A 5FK9C 3CMAA 2RSNA 1U4RA 1E22A 4DR5L 1N32L 2RDGA 1FR3A 3EFXD 4QUCA 3K5NA 1XPOA 2B8GA 4HMIA 3H94A 5D65A 2EY5A 3HZXA 2M9VA 4IUPA 2UXBQ 2EVBA 1E2VA 1DYQA 4A3LG 1K3BC 5C4XH 3OHXC 3SK5A 4X3UA 4ULLA 4A3BH 1AEXA 1GHJA 2UUBL 3I7FA 1EQVA 4OHJA 1B9NA 2I5HA 1OXTA 2RDHA 3G48A 4JV5Q 4JI5Q 1BF4A 4BY7H 4BBSB 2HQEA 1ENCA 4P73A 5ELEA 3M3YB 2B39A 2L12A 4LF9Q 5CV6A 4XQJA 1C7YA 4PV1C 2D0PA 1XNQQ 3H0GB 1UE6A 4FNFA 3OOCA 1S5DD 1Q8IA 5EQ0A 2RHSB 4E6IA 3M4OB 2VUMG 3R8BA 3C3LA 1BCPF 2JA7H 3I2ZA 1VQNA 1B1ZA 4KD4A 4CDDC 4JK1C 4OIKA 3CCUA 4QUFA 2QKIC 4A3EG 1KAAA 4DV7L 1GUSA 4HTHA 2J4XA 1JB3A 1FNWA 2K5NA 4ZKCB 3ER0A 4DUYL 4FP5D 3T13A 1EFID 2K05A 4DV5Q 5D14A 2A6HD 2HCCA 1A8VA 4I65A 4N8FA 4V190 4G7OC 5M9OA 4GN5A 4KD3A 5IOCA 4GNXC 5FO9B 2UXCL 1WFQA 1QB5D 2CW0D 2MO0A 4IOCA 5G3LD 1NE3A 4DK3C 1PHJA 3K7AB 2KA7A 3D6CA 4KKTA 4R8NA 3TZUA 4IFDI 2TSSA 1B53A 4J1MA 3T1HL 2A68C 3A5UA 5IT9L 1Q8KA 1TIID 4HIDA 4UP8A 3HOZH 2B2YA 1D1IA 2L55A 5DM63 4CBVA 4L5SA 3OPOA 4O0AA 1X6OA 1E2ZA 2BOSA 3VYRA 5ELBA 2PI2E 2I5LX 2ZTEA 4RKLA 1I3QH 1E2WA 3FP9A 4DR2L 1L1OA 3OWEB 4BY1H 2F4IA 2XSCA 4IO9A 2QDBA 3U9SA 3EA6A 1E7ZA 3PO3G 2KCCA 2LFNA 1QJOA 1SR3A 4C3IG 1G8ZD 2K03A 4KI0A 1IZ6A 3FMCA 2E75C 3E0EA 2Z4IA 4A3GG 2LXKA 2R93B 3I91A 1GVPA 2VB2X 1V1OA 2FINB 3VR4A 2H5XA 4DF7A 4IFDG 1H9KA 1STBA 5JEAJ 4JV5L 4LF8Q 1J9OA 2K50A 2K7VA 1XPUA 2A74C 2ZT9C 1EYDA 3AB9A 3NXWA 4FF1A 1UWVA 4A3FB 1ZYRD 3VYSA 4RGTA 2X69A 4LF9L 1G91A 3MTSA 3D4RA 1XNQL 2HDLA 1PTOF 4L8JA 2K14A 5FJ8H 2WB1B 1BKBA 1RODA 3IKJA 1K28A 3H3VH 2XWJB 5ELCA 5LMNW 1FL0A 2Y0SG 2HIVA 3I55A 1SYGA 2EYPA 4MZ9A 3CPWA 3G6JB 1SEBD 1V43A 4DNRB 1HNXQ 1MKHA 2OTJA 5DEHA 4M8AA 3MC0B 5C4XG 4A3BG 1PRTD 2R7ZB 5HY6A 2LS01 1HZBA 5LHY1 1D6EC 2UUCL 3TZDA 5F2DA 1MSHA 3E6ZX 2VW9A 4DV5L 4YCWA 2BDOA 4BY7G 3K5MA 2ICEC 4CDCC 3S24A 5J22A 1IBKQ 1B8AA 1C0AA 4OO1I 5CBAE 1O80A 2B2YC 1AE3A 5KNCA 5E3FA 2OWOA 2PO4A 1STNA 1TT2A 1V8QA 1PYWD 2JA7G 4POFA 3MEHA 3V05A 1XTDA 4FF4A 4KHPQ 1VF5C 3T56B 1CQFA 5M5YB 3MA2B 1IW7D 4P2CB 5BN3A 2F0PA 1WTOA 5C3XA 1CKMA 2GN5A 3I56A 3KDFB 1PH9A 3GTMB 4K0KQ 2MPMA 3HFZB 1DM0B 4RCNA 4JI8Q 3EBEA 4OWTB 4DR6Q 1JR0D 3J81L 3HOYB 3I4MB 3S17B 1GUTA 3FKIH 1MI2A 5KEEA 1BXTA 2NZOA 4R4OA 1Y1VB 4R9WA 3KYHC 5EPJA 1HCZA 4HIOA 3CCQA 1NJIC 4X66Q 1VQ4A 1XMOQ 1X3FA 2PNHA 2PZWA 4DXGA 5C3EB 2ENBA 3D3RA 4YCVA 4DR7Q 4WRDA 1TS5A 1G2SA 1S5FD 3GTQB 3R2TA 4KJOA 3HOZG 1FNVA 1EZ8A 3S1QB 5LMUQ 2C5CA 2ALYB 3A8IE 2R92B 4X6AH 2E2DC 4DAVA 5JVH3 1KL9A 4LF8L 1F77A 4A3JB 1SYFA 1JE5A 2R61A 4KKUA 3J7ZC 1X54A 4K6LA 4BY1G 3HOXB 1LTRD 1AE2A 4G57A 3FDTA 3PMFA 4KN4C 4Y7NB 4QIWB 1AFPA 1KLGD 1RKNA 4CDEC 5HGTA 2NWGA 3S2HB 3M3YH 1LT4D 3LNNA 3D0FA 1GKHA 1PH8A 2EJMA 2PZTA
chains in the Genus database with same CATH topology
3WWVA 1YNXA 4JI0L 3U4ZA 5K36G 1MIUA 4HJ8A 1CUKA 3BZKA 3AYHB 2Q2TA 3G71A 1YZ6A 1W3SA 1WI5A 2VS1A 5GQOA 3ERSX 1N34Q 4UP9A 3S1NH 4MTNA 1K83H 3MXNB 2D0OA 3CC7A 4X62L 2HHHQ 1CSPA 1HZCA 2FXQA 2IX0A 4YWLA 1K73C 1A63A 2Q2UA 1OXSC 2HQLA 5IY0A 2VUMH 4DUZQ 1YJ9A 3KDFA 5EAYA 1J6QA 1G6PA 2I5MX 2JE6I 2ZTDA 1KC8C 3ICEA 3U58A 2K4KA 1IBML 2AMCB 1TWCH 3J81c 4GNXB 5C44H 1IBKL 1L0WA 3UDIA 4NXNL 4LFBQ 4DV6Q 5AJ3Q 4A3EH 2QGQA 4A3IH 2EIFA 2N8NA 3GTPH 2JK8A 1I6HH 5FJ8G 1BBWA 3G4SA 1R9TH 4LF7L 4H02A 3F2BA 4YCUA 1EQQA 1W2BA 4PMWA 1VQHA 4UY8C 4GOPC 1E1TA 1KHIA 2AKWB 4XTCS 3AEVA 3K7AH 4LFCL 3F2CA 1TWHH 3PUVA 1UE1A 1PH4A 1HNZL 2ES2A 4HJ7A 2UU9L 1I5FA 5IWAQ 4DV2L 2NN6I 1Q1EA 3PUZA 4JI6Q 2K75A 3HOWH 4NXMQ 2E8GA 3CQZH 1QZGA 1YHBA 2JQOA 2V1CC 5HGQA 3RR5A 5LMNL 3S15H 3K81C 2YU9H 1Z9FA 2A19A 4JBWA 2NVXH 4R1JA 1XMQQ 3CCLA 4K0KL 1SRUA 3AQQA 1IYJB 3CCSA 1L1OC 4HIKA 3Q8DA 4HJ9A 1N9WA 4DR1Q 4A3IG 1HR0L 4GLAC 4QGUA 2MNAA 1VQ5A 4A4IA 2UUCQ 4JI8L 4LUZA 1KAWA 4JI3Q 4JI4L 3CAMA 4P74A 3UE1A 3HKSA 3B6YA 1EOVA 3L2PA 4DR6L 1VQJA 1K0RA 5BR8L 2NZHA 4L5QA 4IPHA 2VQFL 1Q86C 1J5EL 4LF6Q 3S1MH 2IHEA 1U5KA 3K7UC 4APVA 4BA2I 3RLOA 4AYBE 4AIMA 1FJGL 2WB1E 3PO2H 4B3RQ 4LFAQ 4UPAA 1GD7A 2JEAI 3GDEA 3W1GA 3CCRA 1ASZA 4B3ML 3GTKH 4X65Q 4X66L 1HJPA 4GN4B 1XMOL 3J81i 3M7NA 2KCTA 2LSSA 2N49A 1PH6A 1YHQA 1IL2A 1TWAH 5M5WH 1EUJA 4A3KH 4LWCA 2UUAQ 3I4OA 4LF5L 4DR7L 2UXCQ 2KBNA 3W1BA 5M3MH 3SGIA 1UEBA 4DV1L 5IYDH 2Z6KA 3AFQA 2KENA 5LMUL 2Y0SE 3KLWA 4A3DH 4KHZA 2KCMA 1VQPA 3PUWA 4X64Q 4DV0Q 2YTVA 3TREA 1PH2A 1I94Q 3J7A5 3PO3H 4OO1G 1V1QA 1EYGA 4YWKA 2K5VA 4C3IH 1OXVA 1X65A 3OTOL 3T1HQ 1VQ8A 1I50H 4GNXA 4DPGA 2UXDL 2YV5A 1KRSA 3HOUH 4AQYQ 1X55A 1X3GA 2EXDA 3FHWA 4JI1Q 3RN5A 2NN6G 2JA9A 3OW2A 3FKIG 1BBUA 1NBWA 4TVAB 5FLXc 1KQSA 4GKKL 3HOXG 5FLMG 2ID0A 4A3KG 2E2IH 1SFOH 3NENA 1WCMG 4A3FH 4IFDJ 1O7IA 1VQBA 2JA5H 5IYDG 3GTOH 2JJQA 4IJLA 2CWAA 5C4JH 3STBC 5M5XH 3DLLA 2ZJRA 1M90C 1VQ7A 4DR2Q 3PF4A 1IXRA 1VQMA 4LF4L 4DNIA 4BBSH 1VQLA 3OYYA 5IP9H 3PIPA 2I0QA 3S14H 4JI2Q 1X9NA 3PUYA 1N34L 3H15A 4YY3Q 2VL6A 3F1ZA 5IE8A 1SE8A 3M85A 1ASYA 4LNQA 2B63H 4BXXG 2HHHL 4C3JH 3CMAA 2JA6G 3CPFA 1Z47A 5IP7H 3H0GH 1E22A 1S72A 4DR5L 4WJ4A 1HNXL 5DLQE 2KHJA 1N32L 3CP0A 1XPOA 4JOIA 4YHHL 3TQYA 3CCMA 3M4OH 2R7ZH 1E1OA 1UE7A 1SMXA 4DV4Q 3RLNA 2HT1A 1S3OA 4GOPB 3KOJA 3HOVG 2UXBQ 4YWMA 4L5TA 4FDBA 4A3LG 2IHFA 5C4XH 4LFBL 5AJ3L 3PIOA 4A3BH 4QY7A 3I4NH 2JA8H 2UUBL 1T9HA 3I7FA 4JYAQ 3TEHB 1VQFA 4P72A 4BBSG 1XPRA 1LTLA 1A62A 2I5HA 1NMGA 1OXTA 3DM3A 1K8AC 3G48A 1N33Q 4BA1I 4JV5Q 1K9MC 3PGZA 1EIYB 2B63G 2E2JH 1HNWQ 3CF5A 4NPSA 2MO1A 4JI5Q 1VQ6A 4BY7H 2Q2IA 1VQDA 4DAMA 2R6GA 4POGA 4P73A 1YIJA 2WAQG 1N36Q 4LF9Q 5IWAL 4LW1A 1HZ9A 1C7YA 2OQ0A 2D0PA 1XNQQ 1KIXA 4QQBX 4NXML 4XIGS 1UE6A 2A8VA 3HOYG 3U50C 2IY5B 4L5RC 2RHSB 2VUMG 4KHPL 2R7FA 4X62Q 4BBRH 3UE0A 3IRBA 2JA7H 3M4PA 2YTYA 3I2ZA 3PF5A 1P8LA 4JI3L 2ATWA 1VQNA 3S2DH 2VY3A 2CWPA 1BVSA 1UE5A 2KHIA 5C44G 1PA6A 3CCUA 4OONA 2C35B 3RN2A 5ELOA 1IBMQ 1YVCA 4A3EG 4DV7L 2VNUD 4LF6L 3JAMi 4EQ5A 4NXNQ 2K5NA 3L0OA 5C0XJ 3A74A 3ULLA 3HOYH 3ER0A 4B3RL 3I4MH 4DUYL 1B7YB 4QIWE 4LFAL 1XNRL 1E3PA 3S17H 4DV5Q 1PVOA 1Q1BA 2AWOA 1Y1WH 3K0XA 4OWWB 1Y1VH 3KFUA 1A8VA 4X65L 2BH8A 4ME3A 4WJ3M 1KRTA 1JJGA 4A3MH 4GN5A 1JMCA 4GNXC 1SROA 2UUAL 2UXCL 3TS2A 1WFQA 4DKAC 3STBD 3GTLH 1GO3E 2MO0A 4IOCA 5IYCH 3HOWG 1NE3A 2CCZA 4DK3C 1PHJA 1VQAA 5GROA 1QUQB 2B29A 3MEFA 4IFDI 3PSIA 1X56A 1Q82C 1EWIA 4X64L 4OX9Q 4GKJQ 4DV3L 4A3CH 3GTQH 4MNOA 2K5HA 3LGJA 4PG3A 2ASBA 1Y14B 4GOPA 3T1HL 3A5UA 1IBLQ 4B3SQ 1OXXK 2R92H 3CD6A 1Q8KA 1G291 4JI7L 2OTLA 2JEBI 4A93H 2AWNA 4HIDA 4UP8A 2VQEQ 3BZCA 4P75A 4JI4Q 3HOZH 2OQKA 2R93H 4QJFA 4A3JH 4L5SA 1QVGA 2RCNA 3M9BA 4O0AA 1X6OA 3KF6B 5J3BA 1KXLA 4KLKA 2PI2E 2VQFQ 1TWGH 2I5LX 2ZTEA 4DR3Q 3PO2G 1NY4A 4A3GH 3T1YQ 1YI2A 3W5OA 4LUVA 1I3QH 3HKZG 4DR2L 2L15A 3FP9A 1U0LA 1FJGQ 1L1OA 4GKJL 2ZM6L 1Q81C 3S2HH 2NVTH 4JI2L 3PUXA 4BY1H 4DR4Q 2PI2A 1PH5A 2WAQE 4B3MQ 4A75A 5M3MG 3CC4A 4IPDA 4P71A 4IO9A 3F8TA 2CQOA 1JJ2A 3RLFA 4AH6A 3KJOA 1PH8A 4GN3B 4EX5A 4A3DG 3ZJYC 3NBHB 4TQUS 1E7ZA 5IYBH 3CCVA 3PO3G 1XJVA 2R93G 4DV4L 1VQKA 3CC2A 1SR3A 4Y52H 1EFWA 1QVCA 3NELA 4GS3A 4B3TQ 3H3VI 4KI0A 1IZ6A 3E0EA 2WP8J 1TXYA 4A3GG 2LXKA 3HOUG 4DUZL 2F4VQ 3OTOQ 1K8GA 1HH2P 3K8AA 1GVPA 4RMFA 1PH1A 1JB7A 1YBYA 2E5LQ 1N33L 2MFIA 5H1SE 5JJLA 1CKOA 2H5XA 2RF4A 4GLXA 1G51A 4IFDG 2R7DA 5JEAJ 5GAGC 3A0JA 4A3FG 4JV5L 1S40A 4JBMA 4LF8Q 4DV6L 2B3GA 1EIFA 2JA5G 1HNWL 2K50A 1XPUA 4IPCA 4HJAA 3RNUA 4IOAA 2WB1G 1X3EA 1JT8A 1TWFH 1FGUA 3RZOH 1UWVA 5IP9G 1QZHA 1N36L 2WFWA 2VZAA 4LF9L 3UDXA 4LF4Q 1XNQL 1LYLA 5FJ8H 2K14A 4PZ7A 1BKBA 5IP7G 2NVQH 3H0GG 1L1OB 4DAYB 5C0XI 3ULPA 1OXUA 1P16A 2IX1A 3H3VH 5LMNW 1FL0A 1QUQA 3TRZA 1Q12A 5GAHC 2XGTA 2Y0SG 2HIVA 1DGSA 3I55A 2BA0A 2Q2HA 2R7ZG 3E9IA 4MZ9A 3CPWA 5M3FH 4DR5Q 1K3RA 1HNXQ 5IT9c 1V43A 4JI0Q 1N32Q 1MKHA 1HR0W 4JI6L 2OTJA 1YHAA 4YHHQ 4LUOA 5JEAG 4R4CA 1D8LA 3GTGH 1YJWA 3J81j 5C4XG 5M5YH 4A3BG 3VDYA 1XMQL 2JA8G 1VCIA 5HY6A 3I4NG 2HIXA 1HZBA 4JG2A 3CMEA 3CCEA 4DR1L 3KF8B 2UUCL 2QEXA 1YJNA 2UUBQ 4HJ5A 3KF6A 1CKNB 4OWXB 1WOCA 5GAEC 3EN2A 2VW9A 1GM5A 3GTMH 4J15A 4DV5L 4YCWA 5ELNA 3KJPA 4BY7G 1NTGA 1PH3A 3HKZE 1PFSA 4RG1A 3S24A 2Z6KC 3E9HA 1IBKQ 1B8AA 1YEZA 3PV0A 4OO1I 1C0AA 1PYSB 2IT1A 3GO5A 1H95A 3GD7A 1WJJA 3JC66 2AHOB 2ZTCA 1VQ9A 5M3FG 2LXJA 2F3IA 3GTJH 4LF7Q 1AE3A 4PZ6A 2N3SA 4R4TA 4C2MH 4A76A 3UDFA 2OWOA 1N8RC 4NB3A 5GADC 1M1KC 4OX9L 2ZJQA 2CFMA 3K80C 1VQIA 4BBRG 4R4IA 2JA7G 4JC0A 4POFA 4LFCQ 1XTDA 4KHPQ 1IBLL 4B3SL 1VQOA 5C3EH 2QA4A 1YITA 1PYBA 1HNZQ 3PCOB 2UU9Q 4DV2Q 2VQEL 1LM0A 3G6EA 4DV0L 2MQHA 1I94L 5LMNQ 3BU2A 4DK6C 1CKMA 2GN5A 3F2DA 3S1QH 3BJUA 3I56A 2GVBA 1MJEA 3KDFB 1Q7YC 2DGYA 1VQGA 5C0XG 3AFPA 4DV7Q 1PH9A 4K0KQ 1RIPA 3HFZB 4DR3L 1HR0Q 4JBJA 1V9PA 3T1YL 2E2HH 3J80c 4AQYL 3I4MG 1Q46A 4JI8Q 1Y1WG 1VQEA 3EBEA 1CSQA 1Y1VG 4JI1L 2YTXA 1WYDA 1A0IA 1B70B 1C9OA 1HZAA 2CKZB 4OWTB 4PZ8A 4QL5A 4DUYQ 4A3MG 1XNRQ 4DR4L 4DR6Q 5BR8Q 4O2DA 2PQAA 4OXPA 4C3HH 3FKIH 3L7ZC 1J5EQ 4R4OA 2NZOA 2F52A 3D31A 1FVIA 3NEMA 4IPGA 4JOIC 5FLMH 2D62A 3U4VA 3HOXH 5IYCG 1SN8A 1WCMH 5C3EG 3KYHC 4Y7NH 2BH2A 2A1AA 4HIOA 2K52A 3CCQA 3RZDH 1NJIC 4A3CG 4YY3L 3M4QA 1MJCA 1LUZA 4X66Q 1X3FA 2PNHA 1E24A 1VQ4A 5E7NA 1XMOQ 1OTCA 4B3TL 2DUDA 5JJKA 5JJIA 4YCVA 4DV3Q 2EQSA 4LF5Q 2R92G 4IJHA 4DR7Q 1L2FA 2XTIA 4A93G 2Z0SA 4JCVE 4DV1Q 4HIMA 2F4VL 2JA6H 3HOZG 4BXXH 5LMUQ 2YYZA 4A3JG 2E5LL 4GLVB 4JI7Q 2PMZE 2UXBL 2ALYB 3A5ZB 1QVFA 4X6AH 2GVAA 3ULJA 3CXCA 1KL9A 4LF8L 1CKNA 3S1RH 1D7QA 3HOVH 1VS0A 4JYAL 2RHQB 4A3LH 1JJCB 1JE5A 2N78A 3J7ZC 1PV4A 1EQRA 2ZJPA 2NVYH 2UXDQ 1X54A 3CCJA 4BY1G 4R4QA 1AE2A 3EIVA 4JBKA 4UP7A 4GKKQ 2ZM6Q 4ALPA 1KD1C 2OCEA 4JI5L 1PH7A 4AYBG 1RL2A 3CW2C 1VQCA 3M3YH 3S16H 3D0FA 1GKHA 2BA1A 1AH9A 5IYBG 1SLJA 3TS0A 3JAMc 2PQAB 3UDGA 3J80i 1NMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WWV A;  1YNX A;  4JI0 L;  3U4Z A;  5K36 G;  1MIU A;  4HJ8 A;  1CUK A;  3BZK A;  3AYH B;  2Q2T A;  3G71 A;  1YZ6 A;  1W3S A;  1WI5 A;  2VS1 A;  5GQO A;  3ERS X;  1N34 Q;  4UP9 A;  3S1N H;  4MTN A;  1K83 H;  3MXN B;  2D0O A;  3CC7 A;  4X62 L;  2HHH Q;  1CSP A;  1HZC A;  2FXQ A;  2IX0 A;  4YWL A;  1K73 C;  1A63 A;  2Q2U A;  1OXS C;  2HQL A;  5IY0 A;  2VUM H;  4DUZ Q;  1YJ9 A;  3KDF A;  5EAY A;  1J6Q A;  1G6P A;  2I5M X;  2JE6 I;  2ZTD A;  1KC8 C;  3ICE A;  3U58 A;  2K4K A;  1IBM L;  2AMC B;  1TWC H;  3J81 c;  4GNX B;  5C44 H;  1IBK L;  1L0W A;  3UDI A;  4NXN L;  4LFB Q;  4DV6 Q;  5AJ3 Q;  4A3E H;  2QGQ A;  4A3I H;  2EIF A;  2N8N A;  3GTP H;  2JK8 A;  1I6H H;  5FJ8 G;  1BBW A;  3G4S A;  1R9T H;  4LF7 L;  4H02 A;  3F2B A;  4YCU A;  1EQQ A;  1W2B A;  4PMW A;  1VQH A;  4UY8 C;  4GOP C;  1E1T A;  1KHI A;  2AKW B;  4XTC S;  3AEV A;  3K7A H;  4LFC L;  3F2C A;  1TWH H;  3PUV A;  1UE1 A;  1PH4 A;  1HNZ L;  2ES2 A;  4HJ7 A;  2UU9 L;  1I5F A;  5IWA Q;  4DV2 L;  2NN6 I;  1Q1E A;  3PUZ A;  4JI6 Q;  2K75 A;  3HOW H;  4NXM Q;  2E8G A;  3CQZ H;  1QZG A;  1YHB A;  2JQO A;  2V1C C;  5HGQ A;  3RR5 A;  5LMN L;  3S15 H;  3K81 C;  2YU9 H;  1Z9F A;  2A19 A;  4JBW A;  2NVX H;  4R1J A;  1XMQ Q;  3CCL A;  4K0K L;  1SRU A;  3AQQ A;  1IYJ B;  3CCS A;  1L1O C;  4HIK A;  3Q8D A;  4HJ9 A;  1N9W A;  4DR1 Q;  4A3I G;  1HR0 L;  4GLA C;  4QGU A;  2MNA A;  1VQ5 A;  4A4I A;  2UUC Q;  4JI8 L;  4LUZ A;  1KAW A;  4JI3 Q;  4JI4 L;  3CAM A;  4P74 A;  3UE1 A;  3HKS A;  3B6Y A;  1EOV A;  3L2P A;  4DR6 L;  1VQJ A;  1K0R A;  5BR8 L;  2NZH A;  4L5Q A;  4IPH A;  2VQF L;  1Q86 C;  1J5E L;  4LF6 Q;  3S1M H;  2IHE A;  1U5K A;  3K7U C;  4APV A;  4BA2 I;  3RLO A;  4AYB E;  4AIM A;  1FJG L;  2WB1 E;  3PO2 H;  4B3R Q;  4LFA Q;  4UPA A;  1GD7 A;  2JEA I;  3GDE A;  3W1G A;  3CCR A;  1ASZ A;  4B3M L;  3GTK H;  4X65 Q;  4X66 L;  1HJP A;  4GN4 B;  1XMO L;  3J81 i;  3M7N A;  2KCT A;  2LSS A;  2N49 A;  1PH6 A;  1YHQ A;  1IL2 A;  1TWA H;  5M5W H;  1EUJ A;  4A3K H;  4LWC A;  2UUA Q;  3I4O A;  4LF5 L;  4DR7 L;  2UXC Q;  2KBN A;  3W1B A;  5M3M H;  3SGI A;  1UEB A;  4DV1 L;  5IYD H;  2Z6K A;  3AFQ A;  2KEN A;  5LMU L;  2Y0S E;  3KLW A;  4A3D H;  4KHZ A;  2KCM A;  1VQP A;  3PUW A;  4X64 Q;  4DV0 Q;  2YTV A;  3TRE A;  1PH2 A;  1I94 Q;  3J7A 5;  3PO3 H;  4OO1 G;  1V1Q A;  1EYG A;  4YWK A;  2K5V A;  4C3I H;  1OXV A;  1X65 A;  3OTO L;  3T1H Q;  1VQ8 A;  1I50 H;  4GNX A;  4DPG A;  2UXD L;  2YV5 A;  1KRS A;  3HOU H;  4AQY Q;  1X55 A;  1X3G A;  2EXD A;  3FHW A;  4JI1 Q;  3RN5 A;  2NN6 G;  2JA9 A;  3OW2 A;  3FKI G;  1BBU A;  1NBW A;  4TVA B;  5FLX c;  1KQS A;  4GKK L;  3HOX G;  5FLM G;  2ID0 A;  4A3K G;  2E2I H;  1SFO H;  3NEN A;  1WCM G;  4A3F H;  4IFD J;  1O7I A;  1VQB A;  2JA5 H;  5IYD G;  3GTO H;  2JJQ A;  4IJL A;  2CWA A;  5C4J H;  3STB C;  5M5X H;  3DLL A;  2ZJR A;  1M90 C;  1VQ7 A;  4DR2 Q;  3PF4 A;  1IXR A;  1VQM A;  4LF4 L;  4DNI A;  4BBS H;  1VQL A;  3OYY A;  5IP9 H;  3PIP A;  2I0Q A;  3S14 H;  4JI2 Q;  1X9N A;  3PUY A;  1N34 L;  3H15 A;  4YY3 Q;  2VL6 A;  3F1Z A;  5IE8 A;  1SE8 A;  3M85 A;  1ASY A;  4LNQ A;  2B63 H;  4BXX G;  2HHH L;  4C3J H;  3CMA A;  2JA6 G;  3CPF A;  1Z47 A;  5IP7 H;  3H0G H;  1E22 A;  1S72 A;  4DR5 L;  4WJ4 A;  1HNX L;  5DLQ E;  2KHJ A;  1N32 L;  3CP0 A;  1XPO A;  4JOI A;  4YHH L;  3TQY A;  3CCM A;  3M4O H;  2R7Z H;  1E1O A;  1UE7 A;  1SMX A;  4DV4 Q;  3RLN A;  2HT1 A;  1S3O A;  4GOP B;  3KOJ A;  3HOV G;  2UXB Q;  4YWM A;  4L5T A;  4FDB A;  4A3L G;  2IHF A;  5C4X H;  4LFB L;  5AJ3 L;  3PIO A;  4A3B H;  4QY7 A;  3I4N H;  2JA8 H;  2UUB L;  1T9H A;  3I7F A;  4JYA Q;  3TEH B;  1VQF A;  4P72 A;  4BBS G;  1XPR A;  1LTL A;  1A62 A;  2I5H A;  1NMG A;  1OXT A;  3DM3 A;  1K8A C;  3G48 A;  1N33 Q;  4BA1 I;  4JV5 Q;  1K9M C;  3PGZ A;  1EIY B;  2B63 G;  2E2J H;  1HNW Q;  3CF5 A;  4NPS A;  2MO1 A;  4JI5 Q;  1VQ6 A;  4BY7 H;  2Q2I A;  1VQD A;  4DAM A;  2R6G A;  4POG A;  4P73 A;  1YIJ A;  2WAQ G;  1N36 Q;  4LF9 Q;  5IWA L;  4LW1 A;  1HZ9 A;  1C7Y A;  2OQ0 A;  2D0P A;  1XNQ Q;  1KIX A;  4QQB X;  4NXM L;  4XIG S;  1UE6 A;  2A8V A;  3HOY G;  3U50 C;  2IY5 B;  4L5R C;  2RHS B;  2VUM G;  4KHP L;  2R7F A;  4X62 Q;  4BBR H;  3UE0 A;  3IRB A;  2JA7 H;  3M4P A;  2YTY A;  3I2Z A;  3PF5 A;  1P8L A;  4JI3 L;  2ATW A;  1VQN A;  3S2D H;  2VY3 A;  2CWP A;  1BVS A;  1UE5 A;  2KHI A;  5C44 G;  1PA6 A;  3CCU A;  4OON A;  2C35 B;  3RN2 A;  5ELO A;  1IBM Q;  1YVC A;  4A3E G;  4DV7 L;  2VNU D;  4LF6 L;  3JAM i;  4EQ5 A;  4NXN Q;  2K5N A;  3L0O A;  5C0X J;  3A74 A;  3ULL A;  3HOY H;  3ER0 A;  4B3R L;  3I4M H;  4DUY L;  1B7Y B;  4QIW E;  4LFA L;  1XNR L;  1E3P A;  3S17 H;  4DV5 Q;  1PVO A;  1Q1B A;  2AWO A;  1Y1W H;  3K0X A;  4OWW B;  1Y1V H;  3KFU A;  1A8V A;  4X65 L;  2BH8 A;  4ME3 A;  4WJ3 M;  1KRT A;  1JJG A;  4A3M H;  4GN5 A;  1JMC A;  4GNX C;  1SRO A;  2UUA L;  2UXC L;  3TS2 A;  1WFQ A;  4DKA C;  3STB D;  3GTL H;  1GO3 E;  2MO0 A;  4IOC A;  5IYC H;  3HOW G;  1NE3 A;  2CCZ A;  4DK3 C;  1PHJ A;  1VQA A;  5GRO A;  1QUQ B;  2B29 A;  3MEF A;  4IFD I;  3PSI A;  1X56 A;  1Q82 C;  1EWI A;  4X64 L;  4OX9 Q;  4GKJ Q;  4DV3 L;  4A3C H;  3GTQ H;  4MNO A;  2K5H A;  3LGJ A;  4PG3 A;  2ASB A;  1Y14 B;  4GOP A;  3T1H L;  3A5U A;  1IBL Q;  4B3S Q;  1OXX K;  2R92 H;  3CD6 A;  1Q8K A;  1G29 1;  4JI7 L;  2OTL A;  2JEB I;  4A93 H;  2AWN A;  4HID A;  4UP8 A;  2VQE Q;  3BZC A;  4P75 A;  4JI4 Q;  3HOZ H;  2OQK A;  2R93 H;  4QJF A;  4A3J H;  4L5S A;  1QVG A;  2RCN A;  3M9B A;  4O0A A;  1X6O A;  3KF6 B;  5J3B A;  1KXL A;  4KLK A;  2PI2 E;  2VQF Q;  1TWG H;  2I5L X;  2ZTE A;  4DR3 Q;  3PO2 G;  1NY4 A;  4A3G H;  3T1Y Q;  1YI2 A;  3W5O A;  4LUV A;  1I3Q H;  3HKZ G;  4DR2 L;  2L15 A;  3FP9 A;  1U0L A;  1FJG Q;  1L1O A;  4GKJ L;  2ZM6 L;  1Q81 C;  3S2H H;  2NVT H;  4JI2 L;  3PUX A;  4BY1 H;  4DR4 Q;  2PI2 A;  1PH5 A;  2WAQ E;  4B3M Q;  4A75 A;  5M3M G;  3CC4 A;  4IPD A;  4P71 A;  4IO9 A;  3F8T A;  2CQO A;  1JJ2 A;  3RLF A;  4AH6 A;  3KJO A;  1PH8 A;  4GN3 B;  4EX5 A;  4A3D G;  3ZJY C;  3NBH B;  4TQU S;  1E7Z A;  5IYB H;  3CCV A;  3PO3 G;  1XJV A;  2R93 G;  4DV4 L;  1VQK A;  3CC2 A;  1SR3 A;  4Y52 H;  1EFW A;  1QVC A;  3NEL A;  4GS3 A;  4B3T Q;  3H3V I;  4KI0 A;  1IZ6 A;  3E0E A;  2WP8 J;  1TXY A;  4A3G G;  2LXK A;  3HOU G;  4DUZ L;  2F4V Q;  3OTO Q;  1K8G A;  1HH2 P;  3K8A A;  1GVP A;  4RMF A;  1PH1 A;  1JB7 A;  1YBY A;  2E5L Q;  1N33 L;  2MFI A;  5H1S E;  5JJL A;  1CKO A;  2H5X A;  2RF4 A;  4GLX A;  1G51 A;  4IFD G;  2R7D A;  5JEA J;  5GAG C;  3A0J A;  4A3F G;  4JV5 L;  1S40 A;  4JBM A;  4LF8 Q;  4DV6 L;  2B3G A;  1EIF A;  2JA5 G;  1HNW L;  2K50 A;  1XPU A;  4IPC A;  4HJA A;  3RNU A;  4IOA A;  2WB1 G;  1X3E A;  1JT8 A;  1TWF H;  1FGU A;  3RZO H;  1UWV A;  5IP9 G;  1QZH A;  1N36 L;  2WFW A;  2VZA A;  4LF9 L;  3UDX A;  4LF4 Q;  1XNQ L;  1LYL A;  5FJ8 H;  2K14 A;  4PZ7 A;  1BKB A;  5IP7 G;  2NVQ H;  3H0G G;  1L1O B;  4DAY B;  5C0X I;  3ULP A;  1OXU A;  1P16 A;  2IX1 A;  3H3V H;  5LMN W;  1FL0 A;  1QUQ A;  3TRZ A;  1Q12 A;  5GAH C;  2XGT A;  2Y0S G;  2HIV A;  1DGS A;  3I55 A;  2BA0 A;  2Q2H A;  2R7Z G;  3E9I A;  4MZ9 A;  3CPW A;  5M3F H;  4DR5 Q;  1K3R A;  1HNX Q;  5IT9 c;  1V43 A;  4JI0 Q;  1N32 Q;  1MKH A;  1HR0 W;  4JI6 L;  2OTJ A;  1YHA A;  4YHH Q;  4LUO A;  5JEA G;  4R4C A;  1D8L A;  3GTG H;  1YJW A;  3J81 j;  5C4X G;  5M5Y H;  4A3B G;  3VDY A;  1XMQ L;  2JA8 G;  1VCI A;  5HY6 A;  3I4N G;  2HIX A;  1HZB A;  4JG2 A;  3CME A;  3CCE A;  4DR1 L;  3KF8 B;  2UUC L;  2QEX A;  1YJN A;  2UUB Q;  4HJ5 A;  3KF6 A;  1CKN B;  4OWX B;  1WOC A;  5GAE C;  3EN2 A;  2VW9 A;  1GM5 A;  3GTM H;  4J15 A;  4DV5 L;  4YCW A;  5ELN A;  3KJP A;  4BY7 G;  1NTG A;  1PH3 A;  3HKZ E;  1PFS A;  4RG1 A;  3S24 A;  2Z6K C;  3E9H A;  1IBK Q;  1B8A A;  1YEZ A;  3PV0 A;  4OO1 I;  1C0A A;  1PYS B;  2IT1 A;  3GO5 A;  1H95 A;  3GD7 A;  1WJJ A;  3JC6 6;  2AHO B;  2ZTC A;  1VQ9 A;  5M3F G;  2LXJ A;  2F3I A;  3GTJ H;  4LF7 Q;  1AE3 A;  4PZ6 A;  2N3S A;  4R4T A;  4C2M H;  4A76 A;  3UDF A;  2OWO A;  1N8R C;  4NB3 A;  5GAD C;  1M1K C;  4OX9 L;  2ZJQ A;  2CFM A;  3K80 C;  1VQI A;  4BBR G;  4R4I A;  2JA7 G;  4JC0 A;  4POF A;  4LFC Q;  1XTD A;  4KHP Q;  1IBL L;  4B3S L;  1VQO A;  5C3E H;  2QA4 A;  1YIT A;  1PYB A;  1HNZ Q;  3PCO B;  2UU9 Q;  4DV2 Q;  2VQE L;  1LM0 A;  3G6E A;  4DV0 L;  2MQH A;  1I94 L;  5LMN Q;  3BU2 A;  4DK6 C;  1CKM A;  2GN5 A;  3F2D A;  3S1Q H;  3BJU A;  3I56 A;  2GVB A;  1MJE A;  3KDF B;  1Q7Y C;  2DGY A;  1VQG A;  5C0X G;  3AFP A;  4DV7 Q;  1PH9 A;  4K0K Q;  1RIP A;  3HFZ B;  4DR3 L;  1HR0 Q;  4JBJ A;  1V9P A;  3T1Y L;  2E2H H;  3J80 c;  4AQY L;  3I4M G;  1Q46 A;  4JI8 Q;  1Y1W G;  1VQE A;  3EBE A;  1CSQ A;  1Y1V G;  4JI1 L;  2YTX A;  1WYD A;  1A0I A;  1B70 B;  1C9O A;  1HZA A;  2CKZ B;  4OWT B;  4PZ8 A;  4QL5 A;  4DUY Q;  4A3M G;  1XNR Q;  4DR4 L;  4DR6 Q;  5BR8 Q;  4O2D A;  2PQA A;  4OXP A;  4C3H H;  3FKI H;  3L7Z C;  1J5E Q;  4R4O A;  2NZO A;  2F52 A;  3D31 A;  1FVI A;  3NEM A;  4IPG A;  4JOI C;  5FLM H;  2D62 A;  3U4V A;  3HOX H;  5IYC G;  1SN8 A;  1WCM H;  5C3E G;  3KYH C;  4Y7N H;  2BH2 A;  2A1A A;  4HIO A;  2K52 A;  3CCQ A;  3RZD H;  1NJI C;  4A3C G;  4YY3 L;  3M4Q A;  1MJC A;  1LUZ A;  4X66 Q;  1X3F A;  2PNH A;  1E24 A;  1VQ4 A;  5E7N A;  1XMO Q;  1OTC A;  4B3T L;  2DUD A;  5JJK A;  5JJI A;  4YCV A;  4DV3 Q;  2EQS A;  4LF5 Q;  2R92 G;  4IJH A;  4DR7 Q;  1L2F A;  2XTI A;  4A93 G;  2Z0S A;  4JCV E;  4DV1 Q;  4HIM A;  2F4V L;  2JA6 H;  3HOZ G;  4BXX H;  5LMU Q;  2YYZ A;  4A3J G;  2E5L L;  4GLV B;  4JI7 Q;  2PMZ E;  2UXB L;  2ALY B;  3A5Z B;  1QVF A;  4X6A H;  2GVA A;  3ULJ A;  3CXC A;  1KL9 A;  4LF8 L;  1CKN A;  3S1R H;  1D7Q A;  3HOV H;  1VS0 A;  4JYA L;  2RHQ B;  4A3L H;  1JJC B;  1JE5 A;  2N78 A;  3J7Z C;  1PV4 A;  1EQR A;  2ZJP A;  2NVY H;  2UXD Q;  1X54 A;  3CCJ A;  4BY1 G;  4R4Q A;  1AE2 A;  3EIV A;  4JBK A;  4UP7 A;  4GKK Q;  2ZM6 Q;  4ALP A;  1KD1 C;  2OCE A;  4JI5 L;  1PH7 A;  4AYB G;  1RL2 A;  3CW2 C;  1VQC A;  3M3Y H;  3S16 H;  3D0F A;  1GKH A;  2BA1 A;  1AH9 A;  5IYB G;  1SLJ A;  3TS0 A;  3JAM c;  2PQA B;  3UDG A;  3J80 i;  1NMF A; 
#chains in the Genus database with same CATH topology
 1YNX A;  5A2Q E;  2PYK A;  4AYB B;  4HJ8 A;  1CUK A;  3T4A C;  3BZK A;  4ME5 A;  2L9H A;  1WI5 A;  1N34 Q;  3S1N H;  5FO7 B;  3MXN B;  5ELF A;  1KLU D;  2HHH Q;  1WTR A;  1V1P A;  1NSN S;  3Q6S A;  5EAY A;  3HOV B;  4LK1 C;  2I5M X;  1VMP A;  2ZTD A;  2EY6 A;  2BE5 D;  2K4K A;  1Q3L A;  4GNX B;  1PLF A;  5FLX E;  1IBK L;  4DV6 Q;  5AJ3 Q;  1NR4 A;  3PIP 3;  4A3I H;  3GTP H;  2N8N A;  4NKL A;  1SNQ A;  5FJ8 G;  1R9T H;  2IJ0 A;  3A55 A;  5COY A;  4C1N K;  1W2B A;  1EQQ A;  4PMW A;  1D5Z C;  2Q8T A;  5CV9 A;  1E1T A;  1KHI A;  3DEO A;  4FF3 A;  3AEV A;  2RQX A;  2WAQ B;  3K7A H;  1W6J A;  3PUV A;  3R3O A;  4PQX A;  2L1B A;  3L3O C;  1I5F A;  5IWA Q;  2NN6 I;  2NTT A;  3P20 A;  3PUZ A;  2A6E D;  4DXF A;  4JI6 Q;  2K75 A;  2E8G A;  3S15 H;  3K81 C;  2A19 A;  3K58 A;  2KVM A;  4K0K L;  3AQQ A;  4GLA C;  2MNA A;  1VQ5 A;  2NB0 A;  3KUP A;  4JI8 L;  1X32 A;  4LUZ A;  4JI3 Q;  1WTX A;  3B6Y A;  2F0U A;  4DR6 L;  1VQJ A;  3MVV A;  2AQ2 B;  1I6H B;  3TME A;  3NSW A;  1AN8 A;  3S1M H;  1PTO D;  5JAV A;  1KDB A;  3BYY B;  5NUC A;  4AYB E;  4AIM A;  1FJG L;  2LMC B;  2JEA I;  2KCN A;  1ASZ A;  1I4R A;  4X65 Q;  2XRQ D;  1HJP A;  2XVS A;  4X66 L;  1XMO L;  3GTJ B;  2LSS A;  1PH6 A;  3CHB D;  1YHQ A;  1IL2 A;  5M5W H;  2WKC A;  3LX0 A;  4DR7 L;  3E3X A;  3Q24 A;  3FVQ A;  2E74 C;  3AFQ A;  1C4Q A;  2PPB C;  2B2U A;  5LMU L;  2Y0S E;  2NVX B;  4BS9 A;  3GP7 A;  1VQP A;  4X64 Q;  3TRE A;  1QG7 A;  1D5M C;  1V1Q A;  1HUN A;  4KHV A;  2DNC A;  4CGY B;  1TY0 A;  4AQY Q;  1UNS A;  3FHW A;  4JI1 Q;  2NN6 G;  2JA9 A;  3FKI G;  1KQS A;  1NBW A;  5FLX c;  3NBI A;  1J8I A;  1R4P B;  1FGB D;  4IFD J;  2A69 C;  4A3F H;  3SK8 A;  4Q0F A;  4IJL A;  3DLL A;  3HP3 A;  1M90 C;  3C46 A;  1CFM A;  5IP9 H;  3PUY A;  1N34 L;  3F1Z A;  3M85 A;  1LTT D;  4LNQ A;  2HHH L;  1LTB D;  2OF1 A;  3BG3 A;  1Z47 A;  2EYJ A;  3VA7 A;  1AW7 A;  4YHH L;  3GV6 A;  2R7Z H;  3OW7 A;  3I70 A;  4DV4 Q;  4WFN 3;  2N55 A;  2JA6 B;  1DON A;  5G3L F;  4V0B A;  5CGK A;  2IHF A;  1LTG D;  5AJ3 L;  4QY7 A;  3I4N H;  1T9H A;  1SYD A;  4JYA Q;  4P72 A;  2JSO A;  4BBS G;  4HAE A;  1NMG A;  1K8A C;  1BUV T;  2K1B A;  3CF5 A;  1EY9 A;  3J7A F;  2Q8I B;  3GQB A;  2R6G A;  3S14 B;  2AQ3 B;  4POG A;  3PQI A;  5KIX A;  2D5D A;  2B63 B;  2EJF C;  1EL0 A;  1N36 Q;  5IWA L;  1KIX A;  2IY5 B;  3HG9 A;  2Z9H A;  4ID6 A;  4WOR A;  5KNB A;  4N9P A;  2R7F A;  4X62 Q;  4ILW A;  5BN5 A;  1K83 B;  3NE5 B;  1P8L A;  1TY2 A;  4JI3 L;  2ATW A;  1PTO H;  1VDZ A;  4S3S A;  2V4D A;  2VY3 A;  2CWP A;  1UE5 A;  1PA6 A;  4GZY C;  1IBM Q;  3NPP A;  3JAM i;  2K5Q A;  4NXN Q;  2B2V C;  3HOY H;  3I4M H;  1B7Y B;  3S17 H;  1PVO A;  1JWS D;  1Q1B A;  4OWW B;  1Y1V H;  4K2K A;  4X65 L;  2G9D A;  1YNJ D;  1F9P A;  4ME3 A;  4WJ3 M;  1KRT A;  4A3M H;  1EY5 A;  1Y69 U;  1BBX C;  3TS2 A;  3E0J A;  5IYC H;  2HCI A;  3BDL A;  1WTV A;  3ZYY X;  5IT9 E;  3MEF A;  3PSI A;  4BBR B;  5CC4 A;  4XYO A;  4X64 L;  4OX9 Q;  2F0Q A;  3GTQ H;  4MNO A;  3CQZ B;  1H9S A;  1Y14 B;  1CHQ D;  4B3S Q;  2YU9 B;  2R92 H;  1LT5 D;  4JI7 L;  2OTL A;  2JEB I;  4A93 H;  2AWN A;  2VQE Q;  3BZC A;  4P75 A;  4JI4 Q;  2VXW A;  4QJF A;  4A3J H;  1GUN A;  1QVG A;  2RCN A;  3QR8 A;  2VQF Q;  1TWG H;  4A3G H;  2EYF A;  3W5O A;  1HFN A;  1LLR D;  1U0L A;  4RFB A;  4DAP A;  2ZM6 L;  2PCF B;  3S2H H;  2NVT H;  1TU2 B;  3SDZ A;  4IUU A;  4A75 A;  3HKZ B;  3CC4 A;  4IPD A;  1RF2 D;  4P71 A;  4H0L C;  5IGB A;  1XTC D;  2B2T C;  3SEB A;  4TQU S;  2XN9 C;  1JWM D;  1XJV A;  2R93 G;  4DV4 L;  1VQK A;  3CC2 A;  4Y52 H;  1EFW A;  2K28 A;  4DGZ A;  4EQN A;  4FXG C;  4B3T Q;  1SNC A;  3NQI A;  1WVL A;  2E76 C;  1YBY A;  2MFI A;  5JJL A;  1GUG A;  2WAC A;  2RF4 A;  1BQQ T;  3HOU B;  2R7D A;  2DNE A;  5GAG C;  3A0J A;  4A3F G;  2VNU D;  1ILQ A;  2WB1 G;  1JT8 A;  1TWF H;  4HSP A;  2R3Z A;  3RZO H;  2K32 A;  5IP9 G;  1NCV A;  1HFG A;  1N36 L;  4KY7 A;  1O7L A;  1LYL A;  4G7Z C;  3FRP B;  1GOZ A;  2IPK D;  1GUW A;  1OXU A;  1P16 A;  2IX1 A;  3TRZ A;  1Q12 A;  3QG1 A;  2RVL A;  2R7Z G;  4JI0 Q;  1K3R A;  5IT9 c;  3T51 B;  4LUO A;  4R4C A;  3GTG H;  3J81 j;  1IKL A;  3DHQ A;  3I4N G;  3HGB A;  2HIX A;  3CME A;  2AUK A;  1YJN A;  1H9M A;  3KF6 A;  1WOC A;  2JA8 B;  1ESF A;  3HKZ E;  1PFS A;  1Y8O B;  1ZKO A;  5JJZ A;  1YNN C;  2Z6K C;  3IFD A;  1YEZ A;  2D2C C;  3PV0 A;  4KV6 A;  2IT1 A;  3GO5 A;  3JC6 6;  2ZTC A;  3GTJ H;  1F9S A;  2NVQ B;  1SE3 A;  2N3S A;  4C2M H;  4KTA A;  3VR5 A;  3NUC A;  2PZU A;  3SR1 A;  4OX9 L;  2ZJQ A;  3K80 C;  5M3F B;  3ERQ A;  3SK4 A;  4LFC Q;  4RAU C;  4WJW A;  2F0K A;  1HNZ Q;  4B3S L;  1DOL A;  1YIT A;  5I9O A;  2VQE L;  2JYO A;  4DV0 L;  2MQH A;  1I94 L;  4UAI A;  3F2D A;  3H91 A;  1ET6 A;  4XQQ A;  3BJU A;  1MJE A;  3J81 E;  5EKK A;  3S2D B;  1VQG A;  4OO1 H;  3HOY G;  1HR0 Q;  3HEJ A;  3I4M G;  5EKI A;  2EPB A;  4UHV A;  1Y1V G;  2YTX A;  1WYD A;  3FEW X;  1B70 B;  2CKZ B;  1HZA A;  4PZ8 A;  4QL5 A;  1XNR Q;  4A3M G;  2F0F A;  4RHR A;  2PQA A;  3L7Z C;  1J5E Q;  1Y1W B;  1FVI A;  4IPG A;  5IYC G;  5C3E G;  2A1A A;  1SYC A;  2QCP X;  1MSG A;  3HS0 C;  2Z1C A;  1LUZ A;  1ENF A;  4CJ0 B;  4B3T L;  1JE4 A;  5EPK A;  4DV3 Q;  2D9U A;  4JVZ A;  2R92 G;  3BS1 A;  1GXD C;  1CTM A;  1EYC A;  2RCF A;  4HIM A;  4DV1 Q;  4A93 G;  2JA6 H;  4U68 A;  4A3J G;  3QB3 A;  2UXB L;  1BCP B;  2IWH A;  2Z4H A;  1HHV A;  1CKN A;  1AZP A;  1VS0 A;  2RHQ B;  2N78 A;  1LTA D;  2DN8 A;  1PV4 A;  3CCJ A;  3VR6 A;  3EIV A;  4DN4 M;  4JBK A;  1ICF B;  4ALP A;  1KD1 C;  2OCE A;  3I90 A;  4JI5 L;  1PH7 A;  4AYB G;  1PFM A;  1EOT A;  3CW2 C;  4XQN A;  2KUM A;  3JAM c;  3J80 i;  4JI0 L;  1SMY C;  1IYV A;  1B4O A;  4UP9 A;  1BDO A;  1K83 H;  1IL8 A;  2FMM A;  3CC7 A;  1GHK A;  1K0S A;  3K5L A;  1A63 A;  2Q2U A;  3KLR A;  2ZXP A;  3ERO A;  3NWT A;  4DUZ Q;  3I73 A;  1YJ9 A;  3S1R B;  1J6Q A;  1G6P A;  2EZV A;  1KC8 C;  1R4Q B;  4K5W A;  1IKM A;  3EVQ A;  2EYL A;  1TWC H;  3J81 c;  2PNR C;  2NVY B;  5C44 H;  3V2T A;  3UDI A;  3QO2 A;  3I3C A;  2EDG A;  3CU7 A;  3G4S A;  4H02 A;  1EWH A;  3V96 A;  1VQH A;  4UY8 C;  4DA2 A;  3ND8 A;  4FXK C;  5EBC A;  2FHT A;  4LFC L;  5IGF A;  3ITP A;  1PZI D;  4LMQ D;  3DWP A;  1QNU A;  4MN3 A;  1HNZ L;  3SXH A;  2L0C A;  1UEA B;  1B44 D;  1QZG A;  3CQZ H;  1W6K A;  1SJH D;  3RR5 A;  1K8O A;  4KN7 C;  2YU9 H;  1Z9F A;  4JBW A;  3JAM L;  4R1J A;  5T1I A;  1XMQ Q;  4DR1 Q;  1L1O C;  4HJ9 A;  1HR0 L;  4A4I A;  3CAM A;  2B2W A;  5CYU A;  1M8A A;  1K0R A;  3P75 A;  2NZH A;  3QWN A;  5E4W C;  1Q86 C;  1J5E L;  1ENA A;  4BA2 I;  1LAB A;  4FO2 A;  4CDF C;  1SBB B;  1Z6H A;  1ET9 A;  1U4L A;  2WB1 E;  5CV8 A;  2F0J A;  5JOB A;  4UPA A;  4LFA Q;  4R8I A;  3GDE A;  3CCR A;  4NMZ A;  3GTK H;  2NN6 H;  3TP5 A;  1LO5 D;  4MIU A;  3FPU B;  2DY8 A;  1SSO A;  3K6O A;  3D4D A;  2UUA Q;  3KLS A;  1STA A;  1STY A;  2KBN A;  4DV1 L;  1DOM A;  5E4X A;  3SK6 A;  1JOO A;  3PUW A;  2YTV A;  1PH2 A;  4OO1 G;  1VMC A;  4OEL B;  2GA4 B;  1OXV A;  1X65 A;  2G5D A;  5IOD A;  3HOU H;  1KRS A;  1IYU A;  1X3G A;  3A8K E;  3RN5 A;  2E2H B;  3OW2 A;  4TVA B;  5DNF A;  2ID0 A;  2EYO A;  3MWY W;  5D3D A;  1O7I A;  5IYD G;  2K04 A;  4L6T B;  1IXR A;  4BBS H;  4A3K B;  2SNS A;  3BVM A;  3OYY A;  2I0Q A;  1X9N A;  3BDO A;  4YY3 Q;  2VL6 A;  3NTH A;  1SE8 A;  1ASY A;  2JA6 G;  2KOL A;  1CZW A;  3H0G H;  1S72 A;  3ND9 A;  4WJ4 A;  1SNO A;  1HNX L;  3PO3 B;  4JOI A;  4YIJ A;  3CCM A;  3X3N A;  4C3I B;  3M4O H;  3DUZ A;  1BR9 A;  3AU7 A;  5T1G A;  1SMX A;  3WOF A;  3KOJ A;  4DU9 A;  5JEA H;  1SAP A;  2J7Z A;  4LJZ C;  2Z6B A;  2JA8 H;  1CK1 A;  3NK9 A;  2F1M A;  1LTL A;  1N33 Q;  1S5B D;  3DM3 A;  4BA1 I;  3X3M A;  3GTO B;  1K9M C;  2B63 G;  3HRZ C;  1VQ6 A;  1VQD A;  5LL6 X;  4DAM A;  1FNU A;  1HUM A;  3DMU A;  1YIJ A;  2B2W C;  5JVG 3;  3S16 B;  4HR7 B;  1ONL A;  4LW1 A;  1F2L A;  1HZ9 A;  4C3J B;  2OQ0 A;  3GV3 A;  2IX3 A;  2F0G A;  4IN3 A;  1MHW C;  2F0M A;  4XIG S;  3RMH A;  2A8V A;  3U50 C;  5KYL A;  2DY7 A;  5J39 A;  3I8Z A;  5EPL A;  2TMP A;  4KHP L;  1RCV D;  3UE0 A;  3IRB A;  2OEO A;  2YTY A;  3PF5 A;  3S2D H;  4F7X A;  2KHI A;  5C44 G;  2C35 B;  3RN2 A;  5ELO A;  1KNA A;  1ESR A;  1F2Y A;  5EKL A;  2HDM A;  2F3V A;  4EQ5 A;  1RD9 D;  3NTI A;  5EGT A;  5C0X H;  4K8J A;  2EYH A;  4RKB A;  4ABN A;  4QIW E;  4LFA L;  3CKI B;  4BY7 B;  1BNZ A;  1Y1W H;  3K0X A;  4QB4 A;  2IW3 A;  2BH8 A;  1JJG A;  2UUA L;  1SRO A;  4B08 A;  3UI2 A;  3VYU A;  4DKA C;  3STB D;  1GO3 E;  1QNK A;  4TKO B;  3MXU A;  4N8X 1;  2CCZ A;  3QOL A;  1TWH B;  2SDF A;  5COR A;  5I9P A;  2AUJ D;  1EWI A;  2NZ1 D;  3W2D A;  4GKJ Q;  4A3C H;  2LY7 A;  3URY A;  1PRT C;  3HOW B;  4QF4 A;  3H09 A;  2ASB A;  4GOP A;  1IBL Q;  4XDX A;  2NTS A;  1G29 1;  3W3A A;  1EQT A;  1SND A;  2OQK A;  2R93 H;  3M9B A;  3KF6 B;  3TDQ A;  1KNE A;  3M7G A;  2WKD A;  4LUV A;  1L0Y B;  3HKZ G;  5I6Y A;  2L15 A;  1Q81 C;  4DR4 Q;  1ILP A;  1PH5 A;  2WAQ E;  4B3M Q;  3PO2 B;  4KKS A;  3DWA A;  2B8F A;  3F8T A;  2CQO A;  3RLF A;  4AH6 A;  2I07 B;  4EX5 A;  3CCV A;  1CZG A;  1ZXT A;  1IW7 C;  4CKE A;  5M3M B;  3BVG A;  5K36 H;  3NEL A;  1X3P A;  4A3D B;  1RJT A;  1ML0 D;  1XXG A;  2WP8 J;  4PMB A;  3HOU G;  5CBE E;  5HUR A;  2F4V Q;  3OTO Q;  1NUC A;  1K8G A;  1XX8 A;  1HH2 P;  2KHS A;  3Q0A A;  2HUG A;  1N33 L;  5H1S E;  1I50 B;  4O42 A;  1G51 A;  4DV6 L;  2B3G A;  1YNN D;  3MXG A;  4IPC A;  1SYE A;  4IOA A;  3J80 L;  1SNM A;  4CJ1 B;  3OWF A;  2VZA A;  1LV9 A;  2JA5 B;  4RGN A;  3UDX A;  1STE A;  5FO8 B;  4LF4 Q;  5M5X B;  4PZ7 A;  5KRU A;  1BCP C;  4O1N A;  3H0G G;  1L1O B;  1WTP A;  5C0X I;  3ULP A;  1QUQ A;  2CH4 A;  5GAH C;  2XGT A;  4LAA A;  1DGS A;  1HA6 A;  4DR5 Q;  1N32 Q;  3H6M A;  4JI6 L;  1YHA A;  4JPB W;  5JEA G;  1DOK A;  1D8L A;  2RDF A;  1YJW A;  5M5Y H;  3VDY A;  2JA8 G;  1VCI A;  3CCE A;  2A68 D;  2QEX A;  2H4O A;  2QEJ C;  1EYA A;  2UUB Q;  4HJ5 A;  4OWX B;  1CKN B;  4KY5 A;  5GAE C;  1GM5 A;  3GTM H;  3D6W A;  5ELN A;  1A3V A;  2PW5 A;  2EOT A;  5C5M A;  3KJP A;  1PH3 A;  5KGU A;  3DEP A;  3E9H A;  4IUN A;  2B2U C;  1K8M A;  4K6D A;  1WJJ A;  2E2J B;  1VQ9 A;  5M3F G;  1JCK B;  1I4X A;  2RA4 A;  3F2U A;  4PZ6 A;  5I6W A;  4R4T A;  4A76 A;  1DZ1 A;  1A15 A;  2Z8L A;  2KJX A;  4EQP A;  2K6A A;  3CRL C;  3RD4 A;  5GAD C;  2K33 A;  3NBH A;  2F0N A;  4JC0 A;  4G4K A;  5CMD A;  4FXD A;  2EE1 A;  1IBL L;  3EQL C;  5C3E H;  2QA4 A;  1NNX A;  1PYB A;  3O13 A;  5A35 A;  5AFW A;  4CKC A;  1O7Y A;  5C5L A;  5IGG A;  3SVM A;  3G6E A;  2BE5 C;  2OT2 A;  2OXP A;  2QDL A;  3BU2 A;  5FKA C;  4DK6 C;  5LMN Q;  1RTO A;  3C1F A;  5JPM C;  3S1Q H;  2GVB A;  1IHZ A;  2DGY A;  5C0X G;  4DV7 Q;  3D4W A;  1RIP A;  4IUT A;  2O2L D;  4JBJ A;  2E2H H;  1ZEQ X;  4AQY L;  4IUR A;  1Y1W G;  1CSQ A;  4JI1 L;  3T16 A;  2VB3 X;  1Y8P B;  1C9O A;  4DUY Q;  4DR4 L;  5BR8 Q;  2JXM B;  4O2D A;  3A54 A;  1Y8N B;  3P7J A;  3R2I A;  4X3S A;  2F52 A;  3NEM A;  5FLM H;  3HOX H;  4B9X A;  4IUV A;  2NBF A;  1SN8 A;  2BH2 A;  2F0T A;  1HQM C;  4Y7N H;  4DAY A;  1HRJ A;  1MD2 D;  1SMY D;  2CVR A;  4N9T A;  3KK7 A;  2X6G A;  1KTK A;  1WTQ A;  3GTL B;  4A3C G;  3M4Q A;  1MJC A;  1OTC A;  5E7N A;  2DUD A;  5JJK A;  4PMC A;  1TR5 A;  4IJH A;  4C56 C;  1E0B A;  4JCV E;  2F4V L;  3G7L A;  1G2T A;  2FMC A;  2YYZ A;  3MZ5 A;  3TSS A;  3A5Z B;  3KF8 A;  2EJG C;  4ZCK A;  3ULJ A;  3CXC A;  1PZJ D;  3HOV H;  1SE2 A;  4F87 A;  4JYA L;  1PFN A;  2UXD Q;  1F9Q A;  2PQE A;  3BVZ A;  4GKK Q;  5J1Z A;  2C9O A;  4K5V A;  1VQC A;  3S16 H;  4ODG A;  3VR2 A;  1AH9 A;  1SLJ A;  3TS0 A;  1VQL A;  3UDG A;  4BXX G;  3WWV A;  3VA5 A;  3U4Z A;  5K36 G;  4ZYS A;  1JC7 A;  1Z7T A;  3AYH B;  3G71 A;  5D3I B;  5GQO A;  3ERS X;  1SNP A;  2F0I A;  2D0O A;  4X62 L;  1CSP A;  2F0D A;  1HZC A;  2IX0 A;  4H13 C;  2L11 A;  2QW7 A;  4YWL A;  3WDN A;  2RSO A;  3BZD B;  3A56 A;  3ICE A;  4RWS C;  3A7L A;  1IBM L;  3EJI A;  5C4Z A;  2EY1 A;  2AMC B;  1HXY D;  4NXN L;  4LFB Q;  1STG A;  4H44 C;  2KQ3 A;  2EIF A;  4XYQ A;  4HSV A;  1I6H H;  2HD3 A;  1BBW A;  4ZQ3 A;  3F2B A;  3K0Y A;  1KAB A;  1B50 A;  1PRT B;  3M4Y A;  4ZUI A;  4K5X A;  1RHP A;  4XTC S;  3F2C A;  1TWH H;  4NDX A;  3JAM E;  3S1N B;  1PH4 A;  3N52 A;  1ICW A;  1RDP D;  4HJ7 A;  2Q8R E;  1Q1E A;  1TKW B;  3HOW H;  2SOB A;  4NXM Q;  2JQO A;  2V1C C;  5LMN L;  1LAC A;  5IGD A;  2NVX H;  4RA8 A;  1U4M A;  4HED A;  3CCL A;  5IIF A;  3Q8D A;  3OMG A;  4CJ2 C;  4QGU A;  1XWE A;  2UUC Q;  3MXP A;  3BYT B;  4IUQ A;  4JI4 L;  4P74 A;  3TP8 A;  3UE1 A;  1EOV A;  2F3W A;  1V1P B;  1C48 A;  3TBI B;  4A3I B;  5BR8 L;  3GTP B;  4ZKB B;  1SDF A;  4IPH A;  4RHS A;  2VQF L;  1R9T B;  4LF6 Q;  2AQ1 B;  3K7U C;  1U5K A;  4APV A;  2F0H A;  3RLO A;  4OL7 A;  3K57 A;  2DJG C;  3PO2 H;  4B3R Q;  3W1G A;  3OIQ A;  1I4P A;  2KCT A;  2N49 A;  1I4G A;  1EUJ A;  4LWC A;  3I4O A;  3W1B A;  5M3M H;  3SGI A;  5IYD H;  4KMU C;  1CA5 A;  3S15 B;  4X3K A;  1DD2 A;  2XRS D;  3KLW A;  4A3D H;  4KHZ A;  2K01 A;  2M00 A;  1CT1 D;  4YWK A;  2K5V A;  2F0E A;  3TN2 A;  1I50 H;  4DPG A;  2UXD L;  2YV5 A;  2EXD A;  1EIG A;  2G9H D;  1TQO A;  3S1M B;  4GKK L;  3NP8 A;  3HOX G;  5FLM G;  4ZK9 B;  1YNJ C;  3NHH A;  1CM9 A;  4KK7 A;  4A3K G;  1TS4 A;  3MFG A;  3NEN A;  1LTI D;  2JA5 H;  4C3H B;  2CWA A;  2L4N A;  3SHL A;  5M5X H;  3PF4 A;  1VQM A;  5M5W B;  1B3Q A;  3IAY A;  1WCM B;  3S14 H;  4JI2 Q;  5CV4 A;  2B63 H;  3RZD B;  1WTH A;  4ZRZ A;  3CPF A;  5IP7 H;  1QOH A;  3K59 A;  5ELD A;  5DLQ E;  2KHJ A;  3CP0 A;  4IZ8 A;  3TQY A;  1KDA A;  1E1O A;  1UE7 A;  1DJR D;  3J7Y W;  2HT1 A;  3RLN A;  1S3O A;  4GOP B;  3HOV G;  4YWM A;  4L5T A;  1O7Z A;  4FDB A;  1O78 A;  4KY6 A;  4LFB L;  1F2M A;  3PIO A;  1U9R A;  2ICI A;  1VQF A;  3TEH B;  4MTK A;  2EXZ A;  3I72 A;  1XPR A;  1A62 A;  3WOE A;  1FD7 D;  1H9J A;  1F9R A;  2FJ2 A;  3PGZ A;  1EIY B;  2E2J H;  1HNW Q;  4NPS A;  2MO1 A;  4XT1 B;  4BWG B;  1AZQ A;  4C3J G;  2Q2I A;  2XNA C;  4F88 A;  1NAP A;  1SXT A;  2WAQ G;  2XIW A;  4L63 B;  2O5I C;  2F0L A;  3C2P A;  4QQB X;  4NXM L;  4DFA A;  4L5R C;  5I4D A;  5C6A A;  4BBR H;  2F0W A;  3M4P A;  3J7A V;  1BVS A;  3KBX A;  3I4N B;  2VUM B;  4OON A;  4OIJ A;  1YVC A;  4FVM A;  4EVO A;  1D1K A;  5KND A;  4LF6 L;  1I4H A;  2FFK B;  3LWE A;  3L0O A;  5C0X J;  3A74 A;  3ULL A;  2O5J C;  4B3R L;  1XNR L;  4A3E B;  2M2L A;  1E3P A;  4DK0 A;  5FOB B;  3KFU A;  2AWO A;  5EJW A;  4Z9C B;  4PNY A;  2A69 D;  1A3T A;  1JMC A;  2ZXR A;  2CHB D;  2F0S A;  2WV6 D;  3GTL H;  3HOW G;  1QE6 A;  5DM7 3;  1VQA A;  5GRO A;  1QUQ B;  2B29 A;  1X56 A;  1Q82 C;  4C1N I;  4DV3 L;  1S4Z A;  4B9W A;  1PTO B;  2K5H A;  2QIL A;  3LGJ A;  4PG3 A;  1U4P A;  2RBM A;  3CD6 A;  1OXX K;  1WTW A;  1RTN A;  1UUP A;  3H3V C;  1LTS D;  4RGO S;  5LL6 S;  5J3B A;  4DK1 A;  1KXL A;  4KLK A;  1BOS A;  1I4Q A;  4DR3 Q;  3PO2 G;  1NY4 A;  4TSS A;  3T1Y Q;  1YI2 A;  3I4L A;  4A3M B;  1FJG Q;  2A6H C;  5C3W A;  5K5P A;  3OSO A;  4JI2 L;  3KLS X;  3PUX A;  4KJN A;  2PI2 A;  5CV7 A;  1EEF D;  3A7A B;  3TP6 A;  1F2Z A;  2O4X A;  5ISR A;  1BCP D;  1EEI D;  2N88 A;  2J0T D;  3QJY A;  5M3M G;  4ZAI A;  4CHT B;  2F0O A;  2CW0 C;  1JJ2 A;  4A3D G;  3KJO A;  4GN3 B;  1TWA B;  3ZJY C;  3NBH B;  5IYB H;  3CRK C;  3QIA A;  1C8C A;  1QVC A;  4GS3 A;  3C1E A;  4K14 A;  3H3V I;  4A93 B;  1TXY A;  4HN7 A;  4DUZ L;  1DXM A;  3K8A A;  3J80 E;  4RMF A;  1PH1 A;  1JB7 A;  1G6Z A;  2E5L Q;  1H9S B;  2WIN B;  3SE0 A;  1CKO A;  1TWG B;  1JOK A;  4GLX A;  4A3G B;  2JN4 A;  1S40 A;  4JBM A;  1HNW L;  1EIF A;  1JWU D;  2JA5 G;  4HJA A;  3RNU A;  1X3E A;  2NVT B;  1EY7 A;  1FGU A;  2E2I B;  3DM1 A;  1SFO B;  1QZH A;  1DCZ A;  2WFW A;  2KED A;  3QOJ A;  4OGQ C;  5C4J B;  2NUC A;  1XYI A;  1SE4 A;  5IP7 G;  4NP5 A;  2NVQ H;  4DAY B;  5JPN C;  1HTP A;  5BN4 A;  3RUZ A;  1II3 A;  2BA0 A;  2Q2H A;  3E9I A;  5M3F H;  1HR0 W;  1I6V C;  4YHH Q;  1WD0 A;  5IGC A;  2Y0S B;  1XMQ L;  4JG2 A;  4DR1 L;  2KEC A;  1EWC A;  3KF8 B;  5C4X B;  1EU4 A;  2SEB D;  1TS3 A;  3EN2 A;  4A3B B;  2I46 A;  4J15 A;  3S9W A;  2K5W A;  4DNT B;  1NTG A;  1TWF B;  3NQT A;  2PMZ B;  4RG1 A;  3RZO B;  2DJF C;  4M1U B;  2A73 B;  1GUO A;  1PYS B;  1H95 A;  3GD7 A;  2H1E A;  2AHO B;  2LXJ A;  1FYC A;  1ZYR C;  2F3I A;  1QIL A;  4LF7 Q;  2ZXO A;  4J8Q A;  3IFT A;  2MJ8 A;  2MP1 A;  3UDF A;  1N8R C;  2RKS A;  4NB3 A;  1M1K C;  2CFM A;  1VQI A;  4BBR G;  4R4I A;  4H7B A;  3TP7 A;  4FF2 A;  3GTG B;  4IAL A;  1VQO A;  3PCO B;  2UU9 Q;  4DV2 Q;  1LM0 A;  3VYT A;  2JA7 B;  2BDN A;  5IGE A;  5EBD A;  1Q7Y C;  2A5H A;  3AFP A;  4DR3 L;  1V9P A;  3T1Y L;  3J80 c;  3NWS A;  4XXE A;  1Q46 A;  1VQE A;  3E5S A;  5CV5 A;  1PZK D;  1A0I A;  1PXU A;  2EYM A;  4OXP A;  4C3H H;  1D2B A;  3D31 A;  4JOI C;  4C2M B;  2F03 A;  2D62 A;  3U4V A;  1WCM H;  1Q90 A;  2K52 A;  4QMG A;  3RZD H;  2B2V A;  1X3Q A;  4YY3 L;  1E24 A;  4TRD A;  1EY8 A;  5L37 A;  2P5Z X;  1UAP A;  4QCL A;  5JJI A;  3MAQ A;  2EQS A;  4LF5 Q;  1L2F A;  2XTI A;  2Z0S A;  2CQA A;  4BXX H;  4OEM B;  3ONA B;  1NR2 A;  4GLV B;  1EY4 A;  2E5L L;  2PMZ E;  2L5T A;  4JI7 Q;  1QVF A;  4MHE A;  3DWQ A;  5E1F A;  2GVA A;  1D7Q A;  1SYB A;  3S1R H;  1HPC A;  3HOZ B;  3IL8 A;  1OO9 B;  4A3L H;  1JJC B;  4I7Z C;  1EQR A;  2ZJP A;  2NVY H;  1JOQ A;  4F8M A;  2WII B;  4R4Q A;  4UP7 A;  2ZM6 Q;  1I3Q B;  1WD1 A;  2PW7 A;  1HQR D;  1RL2 A;  4BY1 B;  2LKV A;  2BA1 A;  3KBG A;  5IYB G;  2PQA B;  1GJX A;  1S5E D;  1NMF A;  4IQZ A;  5KYI A;  1B2T A;  1MIU A;  2Q2T A;  1YZ6 A;  4RH6 A;  1W3S A;  2VS1 A;  2EY2 A;  1QCB D;  1SJE D;  1A2U A;  4MTN A;  2FXQ A;  5A2Q L;  1K73 C;  1OXS C;  2XWB B;  2HQL A;  5IY0 A;  2VUM H;  3KDF A;  1EIH A;  2JE6 I;  2B2T A;  3U58 A;  1D5X C;  4X3T A;  2IL8 A;  1CA6 A;  4RCO A;  4NW2 A;  1L0W A;  4I7A A;  2MHV A;  4A3E H;  1JIC A;  5I2X A;  2QGQ A;  3T53 B;  2JK8 A;  3OIP A;  4LF7 L;  4YCU A;  5FLX L;  1HA5 A;  1B3A A;  4HMJ A;  4CKB A;  2JP1 A;  2K5D A;  3Q22 A;  4FYD A;  1H9R A;  4GOP C;  3P1H A;  1A6X A;  4J6H A;  1PDQ A;  2AKW B;  4XT3 B;  1MBY A;  1KDC A;  1UE1 A;  3OMC A;  2ES2 A;  2KEE A;  3BDC A;  2UU9 L;  4DV2 L;  3PIO 3;  4GKJ L;  1A2T A;  1STH A;  1YHB A;  3L9A X;  5HGQ A;  4JW0 A;  1SRU A;  3CCS A;  1IYJ B;  4HIK A;  4A3I G;  5CR3 A;  1B9M A;  1N9W A;  1PMR A;  2MUY A;  1L0X B;  3U9O A;  1TWC B;  5C4H A;  2F0V A;  1KAW A;  5C44 B;  3D8G A;  3HKS A;  3L2P A;  1LT3 D;  1CQV A;  5I2Y A;  4L5Q A;  2IHE A;  3A8J E;  2QF7 A;  3MFY A;  1EZ6 A;  1A3U A;  5TSS A;  4Q5V A;  1JOR A;  1T5X D;  1GD7 A;  1T5E A;  4B3M L;  4GN4 B;  1EY6 A;  3J81 i;  3M7N A;  4ZUJ A;  1TWA H;  4A3K H;  3LWU A;  3N6R A;  4LF5 L;  2UXC Q;  1QWY A;  1UEB A;  2Z6K A;  3MHB A;  1JQY D;  4ZLT F;  3MXN A;  2KEN A;  2NYZ D;  2A6E C;  2MGS A;  2KCM A;  4HCE A;  2BCO A;  4DV0 Q;  3PO3 H;  1I94 Q;  3J7A 5;  1S5C D;  1EYG A;  4K8I A;  4C3I H;  1M4V A;  1CI3 M;  3VR3 A;  1EY0 A;  3OTO L;  3T1H Q;  1VQ8 A;  4GNX A;  4RGM A;  1CHP D;  5DAU A;  1PRT F;  1X55 A;  2SNM A;  3K5O A;  4U67 3;  1TS2 A;  1MGS A;  4C3H G;  1BBU A;  1EU3 A;  1AP0 A;  4IFD H;  2E2I H;  3DXJ C;  1SFO H;  1WCM G;  1PFB A;  1PTO C;  1VQB A;  4HCS A;  1HTL D;  3Q23 A;  3GTK B;  3GTO H;  4UDU C;  2JJQ A;  3FKI B;  5C4J H;  2X6L A;  3STB C;  3NTK A;  2ZJR A;  1VF7 A;  4G7H C;  4DR2 Q;  1VQ7 A;  1LT6 D;  4LF4 L;  4DNI A;  2CH4 W;  3PIP A;  3AMU A;  3H15 A;  5IE8 A;  4EQO A;  3R93 A;  3FPP A;  1TVX A;  4K2L A;  4EGV A;  4C3J H;  1BO0 A;  5FK9 C;  3CMA A;  2RSN A;  1U4R A;  1E22 A;  4DR5 L;  1N32 L;  2RDG A;  1FR3 A;  3EFX D;  4QUC A;  3K5N A;  1XPO A;  2B8G A;  4HMI A;  3H94 A;  5D65 A;  2EY5 A;  3HZX A;  2M9V A;  4IUP A;  2UXB Q;  2EVB A;  1E2V A;  1DYQ A;  4A3L G;  1K3B C;  5C4X H;  3OHX C;  3SK5 A;  4X3U A;  4ULL A;  4A3B H;  1AEX A;  1GHJ A;  2UUB L;  3I7F A;  1EQV A;  4OHJ A;  1B9N A;  2I5H A;  1OXT A;  2RDH A;  3G48 A;  4JV5 Q;  4JI5 Q;  1BF4 A;  4BY7 H;  4BBS B;  2HQE A;  1ENC A;  4P73 A;  5ELE A;  3M3Y B;  2B39 A;  2L12 A;  4LF9 Q;  5CV6 A;  4XQJ A;  1C7Y A;  4PV1 C;  2D0P A;  1XNQ Q;  3H0G B;  1UE6 A;  4FNF A;  3OOC A;  1S5D D;  1Q8I A;  5EQ0 A;  2RHS B;  4E6I A;  3M4O B;  2VUM G;  3R8B A;  3C3L A;  1BCP F;  2JA7 H;  3I2Z A;  1VQN A;  1B1Z A;  4KD4 A;  4CDD C;  4JK1 C;  4OIK A;  3CCU A;  4QUF A;  2QKI C;  4A3E G;  1KAA A;  4DV7 L;  1GUS A;  4HTH A;  2J4X A;  1JB3 A;  1FNW A;  2K5N A;  4ZKC B;  3ER0 A;  4DUY L;  4FP5 D;  3T13 A;  1EFI D;  2K05 A;  4DV5 Q;  5D14 A;  2A6H D;  2HCC A;  1A8V A;  4I65 A;  4N8F A;  4V19 0;  4G7O C;  5M9O A;  4GN5 A;  4KD3 A;  5IOC A;  4GNX C;  5FO9 B;  2UXC L;  1WFQ A;  1QB5 D;  2CW0 D;  2MO0 A;  4IOC A;  5G3L D;  1NE3 A;  4DK3 C;  1PHJ A;  3K7A B;  2KA7 A;  3D6C A;  4KKT A;  4R8N A;  3TZU A;  4IFD I;  2TSS A;  1B53 A;  4J1M A;  3T1H L;  2A68 C;  3A5U A;  5IT9 L;  1Q8K A;  1TII D;  4HID A;  4UP8 A;  3HOZ H;  2B2Y A;  1D1I A;  2L55 A;  5DM6 3;  4CBV A;  4L5S A;  3OPO A;  4O0A A;  1X6O A;  1E2Z A;  2BOS A;  3VYR A;  5ELB A;  2PI2 E;  2I5L X;  2ZTE A;  4RKL A;  1I3Q H;  1E2W A;  3FP9 A;  4DR2 L;  1L1O A;  3OWE B;  4BY1 H;  2F4I A;  2XSC A;  4IO9 A;  2QDB A;  3U9S A;  3EA6 A;  1E7Z A;  3PO3 G;  2KCC A;  2LFN A;  1QJO A;  1SR3 A;  4C3I G;  1G8Z D;  2K03 A;  4KI0 A;  1IZ6 A;  3FMC A;  2E75 C;  3E0E A;  2Z4I A;  4A3G G;  2LXK A;  2R93 B;  3I91 A;  1GVP A;  2VB2 X;  1V1O A;  2FIN B;  3VR4 A;  2H5X A;  4DF7 A;  4IFD G;  1H9K A;  1STB A;  5JEA J;  4JV5 L;  4LF8 Q;  1J9O A;  2K50 A;  2K7V A;  1XPU A;  2A74 C;  2ZT9 C;  1EYD A;  3AB9 A;  3NXW A;  4FF1 A;  1UWV A;  4A3F B;  1ZYR D;  3VYS A;  4RGT A;  2X69 A;  4LF9 L;  1G91 A;  3MTS A;  3D4R A;  1XNQ L;  2HDL A;  1PTO F;  4L8J A;  2K14 A;  5FJ8 H;  2WB1 B;  1BKB A;  1ROD A;  3IKJ A;  1K28 A;  3H3V H;  2XWJ B;  5ELC A;  5LMN W;  1FL0 A;  2Y0S G;  2HIV A;  3I55 A;  1SYG A;  2EYP A;  4MZ9 A;  3CPW A;  3G6J B;  1SEB D;  1V43 A;  4DNR B;  1HNX Q;  1MKH A;  2OTJ A;  5DEH A;  4M8A A;  3MC0 B;  5C4X G;  4A3B G;  1PRT D;  2R7Z B;  5HY6 A;  2LS0 1;  1HZB A;  5LHY 1;  1D6E C;  2UUC L;  3TZD A;  5F2D A;  1MSH A;  3E6Z X;  2VW9 A;  4DV5 L;  4YCW A;  2BDO A;  4BY7 G;  3K5M A;  2ICE C;  4CDC C;  3S24 A;  5J22 A;  1IBK Q;  1B8A A;  1C0A A;  4OO1 I;  5CBA E;  1O80 A;  2B2Y C;  1AE3 A;  5KNC A;  5E3F A;  2OWO A;  2PO4 A;  1STN A;  1TT2 A;  1V8Q A;  1PYW D;  2JA7 G;  4POF A;  3MEH A;  3V05 A;  1XTD A;  4FF4 A;  4KHP Q;  1VF5 C;  3T56 B;  1CQF A;  5M5Y B;  3MA2 B;  1IW7 D;  4P2C B;  5BN3 A;  2F0P A;  1WTO A;  5C3X A;  1CKM A;  2GN5 A;  3I56 A;  3KDF B;  1PH9 A;  3GTM B;  4K0K Q;  2MPM A;  3HFZ B;  1DM0 B;  4RCN A;  4JI8 Q;  3EBE A;  4OWT B;  4DR6 Q;  1JR0 D;  3J81 L;  3HOY B;  3I4M B;  3S17 B;  1GUT A;  3FKI H;  1MI2 A;  5KEE A;  1BXT A;  2NZO A;  4R4O A;  1Y1V B;  4R9W A;  3KYH C;  5EPJ A;  1HCZ A;  4HIO A;  3CCQ A;  1NJI C;  4X66 Q;  1VQ4 A;  1XMO Q;  1X3F A;  2PNH A;  2PZW A;  4DXG A;  5C3E B;  2ENB A;  3D3R A;  4YCV A;  4DR7 Q;  4WRD A;  1TS5 A;  1G2S A;  1S5F D;  3GTQ B;  3R2T A;  4KJO A;  3HOZ G;  1FNV A;  1EZ8 A;  3S1Q B;  5LMU Q;  2C5C A;  2ALY B;  3A8I E;  2R92 B;  4X6A H;  2E2D C;  4DAV A;  5JVH 3;  1KL9 A;  4LF8 L;  1F77 A;  4A3J B;  1SYF A;  1JE5 A;  2R61 A;  4KKU A;  3J7Z C;  1X54 A;  4K6L A;  4BY1 G;  3HOX B;  1LTR D;  1AE2 A;  4G57 A;  3FDT A;  3PMF A;  4KN4 C;  4Y7N B;  4QIW B;  1AFP A;  1KLG D;  1RKN A;  4CDE C;  5HGT A;  2NWG A;  3S2H B;  3M3Y H;  1LT4 D;  3LNN A;  3D0F A;  1GKH A;  1PH8 A;  2EJM A;  2PZT A; 
#chains in the Genus database with same CATH homology
 3WWV A;  1YNX A;  4JI0 L;  3U4Z A;  5K36 G;  1MIU A;  4HJ8 A;  1CUK A;  3BZK A;  3AYH B;  2Q2T A;  3G71 A;  1YZ6 A;  1W3S A;  1WI5 A;  2VS1 A;  5GQO A;  3ERS X;  1N34 Q;  4UP9 A;  3S1N H;  4MTN A;  1K83 H;  3MXN B;  2D0O A;  3CC7 A;  4X62 L;  2HHH Q;  1CSP A;  1HZC A;  2FXQ A;  2IX0 A;  4YWL A;  1K73 C;  1A63 A;  2Q2U A;  1OXS C;  2HQL A;  5IY0 A;  2VUM H;  4DUZ Q;  1YJ9 A;  3KDF A;  5EAY A;  1J6Q A;  1G6P A;  2I5M X;  2JE6 I;  2ZTD A;  1KC8 C;  3ICE A;  3U58 A;  2K4K A;  1IBM L;  2AMC B;  1TWC H;  3J81 c;  4GNX B;  5C44 H;  1IBK L;  1L0W A;  3UDI A;  4NXN L;  4LFB Q;  4DV6 Q;  5AJ3 Q;  4A3E H;  2QGQ A;  4A3I H;  2EIF A;  2N8N A;  3GTP H;  2JK8 A;  1I6H H;  5FJ8 G;  1BBW A;  3G4S A;  1R9T H;  4LF7 L;  4H02 A;  3F2B A;  4YCU A;  1EQQ A;  1W2B A;  4PMW A;  1VQH A;  4UY8 C;  4GOP C;  1E1T A;  1KHI A;  2AKW B;  4XTC S;  3AEV A;  3K7A H;  4LFC L;  3F2C A;  1TWH H;  3PUV A;  1UE1 A;  1PH4 A;  1HNZ L;  2ES2 A;  4HJ7 A;  2UU9 L;  1I5F A;  5IWA Q;  4DV2 L;  2NN6 I;  1Q1E A;  3PUZ A;  4JI6 Q;  2K75 A;  3HOW H;  4NXM Q;  2E8G A;  3CQZ H;  1QZG A;  1YHB A;  2JQO A;  2V1C C;  5HGQ A;  3RR5 A;  5LMN L;  3S15 H;  3K81 C;  2YU9 H;  1Z9F A;  2A19 A;  4JBW A;  2NVX H;  4R1J A;  1XMQ Q;  3CCL A;  4K0K L;  1SRU A;  3AQQ A;  1IYJ B;  3CCS A;  1L1O C;  4HIK A;  3Q8D A;  4HJ9 A;  1N9W A;  4DR1 Q;  4A3I G;  1HR0 L;  4GLA C;  4QGU A;  2MNA A;  1VQ5 A;  4A4I A;  2UUC Q;  4JI8 L;  4LUZ A;  1KAW A;  4JI3 Q;  4JI4 L;  3CAM A;  4P74 A;  3UE1 A;  3HKS A;  3B6Y A;  1EOV A;  3L2P A;  4DR6 L;  1VQJ A;  1K0R A;  5BR8 L;  2NZH A;  4L5Q A;  4IPH A;  2VQF L;  1Q86 C;  1J5E L;  4LF6 Q;  3S1M H;  2IHE A;  1U5K A;  3K7U C;  4APV A;  4BA2 I;  3RLO A;  4AYB E;  4AIM A;  1FJG L;  2WB1 E;  3PO2 H;  4B3R Q;  4LFA Q;  4UPA A;  1GD7 A;  2JEA I;  3GDE A;  3W1G A;  3CCR A;  1ASZ A;  4B3M L;  3GTK H;  4X65 Q;  4X66 L;  1HJP A;  4GN4 B;  1XMO L;  3J81 i;  3M7N A;  2KCT A;  2LSS A;  2N49 A;  1PH6 A;  1YHQ A;  1IL2 A;  1TWA H;  5M5W H;  1EUJ A;  4A3K H;  4LWC A;  2UUA Q;  3I4O A;  4LF5 L;  4DR7 L;  2UXC Q;  2KBN A;  3W1B A;  5M3M H;  3SGI A;  1UEB A;  4DV1 L;  5IYD H;  2Z6K A;  3AFQ A;  2KEN A;  5LMU L;  2Y0S E;  3KLW A;  4A3D H;  4KHZ A;  2KCM A;  1VQP A;  3PUW A;  4X64 Q;  4DV0 Q;  2YTV A;  3TRE A;  1PH2 A;  1I94 Q;  3J7A 5;  3PO3 H;  4OO1 G;  1V1Q A;  1EYG A;  4YWK A;  2K5V A;  4C3I H;  1OXV A;  1X65 A;  3OTO L;  3T1H Q;  1VQ8 A;  1I50 H;  4GNX A;  4DPG A;  2UXD L;  2YV5 A;  1KRS A;  3HOU H;  4AQY Q;  1X55 A;  1X3G A;  2EXD A;  3FHW A;  4JI1 Q;  3RN5 A;  2NN6 G;  2JA9 A;  3OW2 A;  3FKI G;  1BBU A;  1NBW A;  4TVA B;  5FLX c;  1KQS A;  4GKK L;  3HOX G;  5FLM G;  2ID0 A;  4A3K G;  2E2I H;  1SFO H;  3NEN A;  1WCM G;  4A3F H;  4IFD J;  1O7I A;  1VQB A;  2JA5 H;  5IYD G;  3GTO H;  2JJQ A;  4IJL A;  2CWA A;  5C4J H;  3STB C;  5M5X H;  3DLL A;  2ZJR A;  1M90 C;  1VQ7 A;  4DR2 Q;  3PF4 A;  1IXR A;  1VQM A;  4LF4 L;  4DNI A;  4BBS H;  1VQL A;  3OYY A;  5IP9 H;  3PIP A;  2I0Q A;  3S14 H;  4JI2 Q;  1X9N A;  3PUY A;  1N34 L;  3H15 A;  4YY3 Q;  2VL6 A;  3F1Z A;  5IE8 A;  1SE8 A;  3M85 A;  1ASY A;  4LNQ A;  2B63 H;  4BXX G;  2HHH L;  4C3J H;  3CMA A;  2JA6 G;  3CPF A;  1Z47 A;  5IP7 H;  3H0G H;  1E22 A;  1S72 A;  4DR5 L;  4WJ4 A;  1HNX L;  5DLQ E;  2KHJ A;  1N32 L;  3CP0 A;  1XPO A;  4JOI A;  4YHH L;  3TQY A;  3CCM A;  3M4O H;  2R7Z H;  1E1O A;  1UE7 A;  1SMX A;  4DV4 Q;  3RLN A;  2HT1 A;  1S3O A;  4GOP B;  3KOJ A;  3HOV G;  2UXB Q;  4YWM A;  4L5T A;  4FDB A;  4A3L G;  2IHF A;  5C4X H;  4LFB L;  5AJ3 L;  3PIO A;  4A3B H;  4QY7 A;  3I4N H;  2JA8 H;  2UUB L;  1T9H A;  3I7F A;  4JYA Q;  3TEH B;  1VQF A;  4P72 A;  4BBS G;  1XPR A;  1LTL A;  1A62 A;  2I5H A;  1NMG A;  1OXT A;  3DM3 A;  1K8A C;  3G48 A;  1N33 Q;  4BA1 I;  4JV5 Q;  1K9M C;  3PGZ A;  1EIY B;  2B63 G;  2E2J H;  1HNW Q;  3CF5 A;  4NPS A;  2MO1 A;  4JI5 Q;  1VQ6 A;  4BY7 H;  2Q2I A;  1VQD A;  4DAM A;  2R6G A;  4POG A;  4P73 A;  1YIJ A;  2WAQ G;  1N36 Q;  4LF9 Q;  5IWA L;  4LW1 A;  1HZ9 A;  1C7Y A;  2OQ0 A;  2D0P A;  1XNQ Q;  1KIX A;  4QQB X;  4NXM L;  4XIG S;  1UE6 A;  2A8V A;  3HOY G;  3U50 C;  2IY5 B;  4L5R C;  2RHS B;  2VUM G;  4KHP L;  2R7F A;  4X62 Q;  4BBR H;  3UE0 A;  3IRB A;  2JA7 H;  3M4P A;  2YTY A;  3I2Z A;  3PF5 A;  1P8L A;  4JI3 L;  2ATW A;  1VQN A;  3S2D H;  2VY3 A;  2CWP A;  1BVS A;  1UE5 A;  2KHI A;  5C44 G;  1PA6 A;  3CCU A;  4OON A;  2C35 B;  3RN2 A;  5ELO A;  1IBM Q;  1YVC A;  4A3E G;  4DV7 L;  2VNU D;  4LF6 L;  3JAM i;  4EQ5 A;  4NXN Q;  2K5N A;  3L0O A;  5C0X J;  3A74 A;  3ULL A;  3HOY H;  3ER0 A;  4B3R L;  3I4M H;  4DUY L;  1B7Y B;  4QIW E;  4LFA L;  1XNR L;  1E3P A;  3S17 H;  4DV5 Q;  1PVO A;  1Q1B A;  2AWO A;  1Y1W H;  3K0X A;  4OWW B;  1Y1V H;  3KFU A;  1A8V A;  4X65 L;  2BH8 A;  4ME3 A;  4WJ3 M;  1KRT A;  1JJG A;  4A3M H;  4GN5 A;  1JMC A;  4GNX C;  1SRO A;  2UUA L;  2UXC L;  3TS2 A;  1WFQ A;  4DKA C;  3STB D;  3GTL H;  1GO3 E;  2MO0 A;  4IOC A;  5IYC H;  3HOW G;  1NE3 A;  2CCZ A;  4DK3 C;  1PHJ A;  1VQA A;  5GRO A;  1QUQ B;  2B29 A;  3MEF A;  4IFD I;  3PSI A;  1X56 A;  1Q82 C;  1EWI A;  4X64 L;  4OX9 Q;  4GKJ Q;  4DV3 L;  4A3C H;  3GTQ H;  4MNO A;  2K5H A;  3LGJ A;  4PG3 A;  2ASB A;  1Y14 B;  4GOP A;  3T1H L;  3A5U A;  1IBL Q;  4B3S Q;  1OXX K;  2R92 H;  3CD6 A;  1Q8K A;  1G29 1;  4JI7 L;  2OTL A;  2JEB I;  4A93 H;  2AWN A;  4HID A;  4UP8 A;  2VQE Q;  3BZC A;  4P75 A;  4JI4 Q;  3HOZ H;  2OQK A;  2R93 H;  4QJF A;  4A3J H;  4L5S A;  1QVG A;  2RCN A;  3M9B A;  4O0A A;  1X6O A;  3KF6 B;  5J3B A;  1KXL A;  4KLK A;  2PI2 E;  2VQF Q;  1TWG H;  2I5L X;  2ZTE A;  4DR3 Q;  3PO2 G;  1NY4 A;  4A3G H;  3T1Y Q;  1YI2 A;  3W5O A;  4LUV A;  1I3Q H;  3HKZ G;  4DR2 L;  2L15 A;  3FP9 A;  1U0L A;  1FJG Q;  1L1O A;  4GKJ L;  2ZM6 L;  1Q81 C;  3S2H H;  2NVT H;  4JI2 L;  3PUX A;  4BY1 H;  4DR4 Q;  2PI2 A;  1PH5 A;  2WAQ E;  4B3M Q;  4A75 A;  5M3M G;  3CC4 A;  4IPD A;  4P71 A;  4IO9 A;  3F8T A;  2CQO A;  1JJ2 A;  3RLF A;  4AH6 A;  3KJO A;  1PH8 A;  4GN3 B;  4EX5 A;  4A3D G;  3ZJY C;  3NBH B;  4TQU S;  1E7Z A;  5IYB H;  3CCV A;  3PO3 G;  1XJV A;  2R93 G;  4DV4 L;  1VQK A;  3CC2 A;  1SR3 A;  4Y52 H;  1EFW A;  1QVC A;  3NEL A;  4GS3 A;  4B3T Q;  3H3V I;  4KI0 A;  1IZ6 A;  3E0E A;  2WP8 J;  1TXY A;  4A3G G;  2LXK A;  3HOU G;  4DUZ L;  2F4V Q;  3OTO Q;  1K8G A;  1HH2 P;  3K8A A;  1GVP A;  4RMF A;  1PH1 A;  1JB7 A;  1YBY A;  2E5L Q;  1N33 L;  2MFI A;  5H1S E;  5JJL A;  1CKO A;  2H5X A;  2RF4 A;  4GLX A;  1G51 A;  4IFD G;  2R7D A;  5JEA J;  5GAG C;  3A0J A;  4A3F G;  4JV5 L;  1S40 A;  4JBM A;  4LF8 Q;  4DV6 L;  2B3G A;  1EIF A;  2JA5 G;  1HNW L;  2K50 A;  1XPU A;  4IPC A;  4HJA A;  3RNU A;  4IOA A;  2WB1 G;  1X3E A;  1JT8 A;  1TWF H;  1FGU A;  3RZO H;  1UWV A;  5IP9 G;  1QZH A;  1N36 L;  2WFW A;  2VZA A;  4LF9 L;  3UDX A;  4LF4 Q;  1XNQ L;  1LYL A;  5FJ8 H;  2K14 A;  4PZ7 A;  1BKB A;  5IP7 G;  2NVQ H;  3H0G G;  1L1O B;  4DAY B;  5C0X I;  3ULP A;  1OXU A;  1P16 A;  2IX1 A;  3H3V H;  5LMN W;  1FL0 A;  1QUQ A;  3TRZ A;  1Q12 A;  5GAH C;  2XGT A;  2Y0S G;  2HIV A;  1DGS A;  3I55 A;  2BA0 A;  2Q2H A;  2R7Z G;  3E9I A;  4MZ9 A;  3CPW A;  5M3F H;  4DR5 Q;  1K3R A;  1HNX Q;  5IT9 c;  1V43 A;  4JI0 Q;  1N32 Q;  1MKH A;  1HR0 W;  4JI6 L;  2OTJ A;  1YHA A;  4YHH Q;  4LUO A;  5JEA G;  4R4C A;  1D8L A;  3GTG H;  1YJW A;  3J81 j;  5C4X G;  5M5Y H;  4A3B G;  3VDY A;  1XMQ L;  2JA8 G;  1VCI A;  5HY6 A;  3I4N G;  2HIX A;  1HZB A;  4JG2 A;  3CME A;  3CCE A;  4DR1 L;  3KF8 B;  2UUC L;  2QEX A;  1YJN A;  2UUB Q;  4HJ5 A;  3KF6 A;  1CKN B;  4OWX B;  1WOC A;  5GAE C;  3EN2 A;  2VW9 A;  1GM5 A;  3GTM H;  4J15 A;  4DV5 L;  4YCW A;  5ELN A;  3KJP A;  4BY7 G;  1NTG A;  1PH3 A;  3HKZ E;  1PFS A;  4RG1 A;  3S24 A;  2Z6K C;  3E9H A;  1IBK Q;  1B8A A;  1YEZ A;  3PV0 A;  4OO1 I;  1C0A A;  1PYS B;  2IT1 A;  3GO5 A;  1H95 A;  3GD7 A;  1WJJ A;  3JC6 6;  2AHO B;  2ZTC A;  1VQ9 A;  5M3F G;  2LXJ A;  2F3I A;  3GTJ H;  4LF7 Q;  1AE3 A;  4PZ6 A;  2N3S A;  4R4T A;  4C2M H;  4A76 A;  3UDF A;  2OWO A;  1N8R C;  4NB3 A;  5GAD C;  1M1K C;  4OX9 L;  2ZJQ A;  2CFM A;  3K80 C;  1VQI A;  4BBR G;  4R4I A;  2JA7 G;  4JC0 A;  4POF A;  4LFC Q;  1XTD A;  4KHP Q;  1IBL L;  4B3S L;  1VQO A;  5C3E H;  2QA4 A;  1YIT A;  1PYB A;  1HNZ Q;  3PCO B;  2UU9 Q;  4DV2 Q;  2VQE L;  1LM0 A;  3G6E A;  4DV0 L;  2MQH A;  1I94 L;  5LMN Q;  3BU2 A;  4DK6 C;  1CKM A;  2GN5 A;  3F2D A;  3S1Q H;  3BJU A;  3I56 A;  2GVB A;  1MJE A;  3KDF B;  1Q7Y C;  2DGY A;  1VQG A;  5C0X G;  3AFP A;  4DV7 Q;  1PH9 A;  4K0K Q;  1RIP A;  3HFZ B;  4DR3 L;  1HR0 Q;  4JBJ A;  1V9P A;  3T1Y L;  2E2H H;  3J80 c;  4AQY L;  3I4M G;  1Q46 A;  4JI8 Q;  1Y1W G;  1VQE A;  3EBE A;  1CSQ A;  1Y1V G;  4JI1 L;  2YTX A;  1WYD A;  1A0I A;  1B70 B;  1C9O A;  1HZA A;  2CKZ B;  4OWT B;  4PZ8 A;  4QL5 A;  4DUY Q;  4A3M G;  1XNR Q;  4DR4 L;  4DR6 Q;  5BR8 Q;  4O2D A;  2PQA A;  4OXP A;  4C3H H;  3FKI H;  3L7Z C;  1J5E Q;  4R4O A;  2NZO A;  2F52 A;  3D31 A;  1FVI A;  3NEM A;  4IPG A;  4JOI C;  5FLM H;  2D62 A;  3U4V A;  3HOX H;  5IYC G;  1SN8 A;  1WCM H;  5C3E G;  3KYH C;  4Y7N H;  2BH2 A;  2A1A A;  4HIO A;  2K52 A;  3CCQ A;  3RZD H;  1NJI C;  4A3C G;  4YY3 L;  3M4Q A;  1MJC A;  1LUZ A;  4X66 Q;  1X3F A;  2PNH A;  1E24 A;  1VQ4 A;  5E7N A;  1XMO Q;  1OTC A;  4B3T L;  2DUD A;  5JJK A;  5JJI A;  4YCV A;  4DV3 Q;  2EQS A;  4LF5 Q;  2R92 G;  4IJH A;  4DR7 Q;  1L2F A;  2XTI A;  4A93 G;  2Z0S A;  4JCV E;  4DV1 Q;  4HIM A;  2F4V L;  2JA6 H;  3HOZ G;  4BXX H;  5LMU Q;  2YYZ A;  4A3J G;  2E5L L;  4GLV B;  4JI7 Q;  2PMZ E;  2UXB L;  2ALY B;  3A5Z B;  1QVF A;  4X6A H;  2GVA A;  3ULJ A;  3CXC A;  1KL9 A;  4LF8 L;  1CKN A;  3S1R H;  1D7Q A;  3HOV H;  1VS0 A;  4JYA L;  2RHQ B;  4A3L H;  1JJC B;  1JE5 A;  2N78 A;  3J7Z C;  1PV4 A;  1EQR A;  2ZJP A;  2NVY H;  2UXD Q;  1X54 A;  3CCJ A;  4BY1 G;  4R4Q A;  1AE2 A;  3EIV A;  4JBK A;  4UP7 A;  4GKK Q;  2ZM6 Q;  4ALP A;  1KD1 C;  2OCE A;  4JI5 L;  1PH7 A;  4AYB G;  1RL2 A;  3CW2 C;  1VQC A;  3M3Y H;  3S16 H;  3D0F A;  1GKH A;  2BA1 A;  1AH9 A;  5IYB G;  1SLJ A;  3TS0 A;  3JAM c;  2PQA B;  3UDG A;  3J80 i;  1NMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...