4A93H

Rna polymerase ii elongation complex containing a cpd lesion
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Mechanism of Translesion Transcription by RNA Polymerase II and its Role in Cellular Resistance to DNA Damage.
pubmed doi rcsb
molecule tags Transcription
total genus 23
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a93H00
3JAMi 3RLNA 1KD1C 3STBD 3KOJA 4DR4L 3FHWA 4JC0A 4X62Q 2WFWA 2RCNA 2ZM6L 3TS0A 4BY7H 4AH6A 1JT8A 4X62L 2AWNA 1M90C 3G71A 4DV7L 3PIPA 4DR7Q 4BXXG 2UXDL 4POFA 2Q2UA 4LFAL 4DK3C 3MXNB 4JI8Q 4DUYQ 4GNXA 4DR7L 4EX5A 5BR8Q 2PMZE 2LSSA 2Y0SG 1L0WA 1WCMG 1Q12A 4OWTB 4DV0L 1OXVA 4DR1L 3UDIA 1HR0Q 3CCUA 1IBMQ 4DUYL 4JYAQ 1LTLA 4HIOA 3K0XA 4PZ7A 1XPUA 3CAMA 1HR0L 3NELA 1YI2A 3HOZH 2E8GA 2BH8A 1XNRL 4JYAL 3AYHB 5C4XH 4R1JA 1VQ9A 4NXNQ 4A3DH 4GKKQ 3HKZG 4DNIA 5K36G 1X3EA 2WAQE 2JA5G 3TRZA 2N3SA 3CCMA 4OO1I 4NXNL 1C0AA 3K8AA 2I5LX 4YCWA 1QUQB 1EIYB 4GKKL 4YCVA 4A76A 4UPAA 1KL9A 2KBNA 1LM0A 4PMWA 4LF8Q 5JJKA 2B3GA 2Q2HA 2OQKA 3W1BA 3AEVA 4EQ5A 1IL2A 2LXKA 1Y1VG 3F2DA 3KF6A 3NEMA 4LF6Q 3CCQA 1IBKQ 2PQAA 4HJ9A 4A3IH 1NE3A 2EIFA 4JI4L 2QGQA 1IBKL 4A3LG 3EBEA 3LGJA 4OONA 4JI3L 1U5KA 4P73A 1PHJA 1VQ6A 3HOUH 4A3GH 1IBLQ 4DV4Q 1JJCB 1A0IA 4YY3Q 2VZAA 3ERSX 1VS0A 4YWLA 1WI5A 4DAYB 1IBLL 2OTJA 1H95A 3VDYA 2R6GA 1CSPA 3H0GH 4YY3L 1YJNA 1YEZA 5IP7G 1PH1A 1K3RA 5C44G 1KQSA 2CCZA 3J7A5 4XTCS 2F3IA 4KI0A 4O2DA 4A4IA 5IWAQ 1VQPA 3S2HH 2EXDA 4IPDA 4HJ8A 4GOPA 1QZHA 1G6PA 3M85A 4WJ4A 1GKHA 2BA0A 4B3TL 1UE1A 1PH6A 1W3SA 2ID0A 1K8GA 4BY1G 1HNWQ 1NBWA 4ALPA 1KC8C 3S1MH 1VQBA 3BZCA 2QA4A 1CSQA 2D0OA 4KHPL 2ZJRA 2N49A 4LF7Q 1HNWL 1RL2A 1S40A 1PH9A 1J5EQ 4LF5Q 2NVTH 1K83H 4DR2L 1PH7A 4FDBA 4LF7L 1EYGA 1QVGA 1N36L 2ATWA 3PO2G 4A3FH 2A19A 1EQQA 2UU9Q 3CCRA 4LF5L 4KLKA 5IYBH 2F4VQ 3HOXH 5LMNQ 3FP9A 4LF4Q 1VQ4A 4IPGA 2UU9L 5AJ3L 3RN2A 2KHJA 4JI2Q 1K0RA 5LMNL 4RG1A 2ZJQA 1HZBA 5GAEC 3E0EA 4DUZL 4YHHQ 1RIPA 4QIWE 4JI2L 3STBC 1PA6A 3U4ZA 3OTOQ 3G48A 1VQ8A 1O7IA 2HQLA 3PUYA 3UE0A 5M3MG 1VQGA 3OTOL 3CCLA 2B63H 2JA8H 4A3JG 4HJ7A 3JC66 3D31A 4JBJA 4A3MG 2R93G 1BVSA 3M4PA 4JI0Q 3A74A 5C4JH 4A93G 2D0PA 1E1OA 2Q2TA 3CF5A 1QVCA 1X54A 3AFQA 4JI0L 5JEAJ 1TXYA 3U50C 1P8LA 1C7YA 3GTOH 4GN5A 4A3BG 5H1SE 1ASZA 2PQAB 3RZDH 2E5LL 1WJJA 3HOYH 3PF4A 4BY7G 3NENA 1CKMA 2WAQG 4NB3A 3GTLH 3HOVH 3S17H 1HNZL 1EOVA 4JI7L 4JI1Q 2CKZB 1TWHH 2K50A 1YHAA 4LUVA 4B3RL 1L1OC 4R4OA 1IXRA 4X66Q 2XTIA 5M3FG 1S72A 1XMQQ 2GN5A 4AYBE 5C3EG 3PO3H 3RZOH 4X66L 3CMAA 2HHHQ 3PCOB 1SMXA 4L5QA 2DUDA 3RLFA 1XJVA 3S2DH 3GTJH 2R7FA 3M4OH 2HHHL 4MTNA 1NJIC 4OX9L 1B7YB 1V1QA 4X6AH 1SRUA 2IX0A 1N9WA 3NBHB 1QVFA 2UUCQ 1WOCA 1NY4A 4B3MQ 3H3VI 1VQHA 1PH4A 3CCSA 2PNHA 4J15A 1I6HH 1PYSB 1Y14B 1K73C 4TVAB 4MNOA 3RNUA 4A3IG 2VQFQ 4JV5Q 3GTQH 3WWVA 1WYDA 2CFMA 3J7ZC 3UDGA 4A3EH 1VQLA 2R92H 1DGSA 4DR5Q 1TWGH 3TEHB 3HOUG 1PH2A 4A3GG 1KIXA 4JBKA 4XIGS 2GVBA 5FLMH 1C9OA 4JI8L 5IE8A 2Z6KC 2NVXH 2NVYH 5BR8L 2VQEQ 2CQOA 1VQMA 1IBML 5M5WH 3H0GG 4C3HH 1JE5A 1HJPA 2VQEL 4IFDJ 2VNUD 4P71A 2AHOB 2K75A 5JEAG 1A62A 4Y52H 3S14H 5IYCG 1VQAA 5M5YH 3H3VH 4UY8C 4LFBQ 3CP0A 1AE2A 3RN5A 1K8AC 1E7ZA 3EN2A 1E24A 3UE1A 2YU9H 4LF8L 3KDFB 2VS1A 4LW1A 2NN6G 4PZ6A 1Z9FA 4DV1Q 4HJAA 1XMOQ 4RMFA 1N34Q 4LF6L 1OXTA 1TWCH 3PUVA 3PV0A 4A3KH 3PF5A 1PV4A 2UUAQ 1SFOH 2OQ0A 1XMOL 1ASYA 1X65A 2WP8J 4A3FG 1Y1WH 5IYBG 1OXXK 1WFQA 3HOXG 2UUBQ 1G291 2ZTDA 4DV4L 2I5MX 3PUXA 4BBRH 5FJ8H 1A8VA 3D0FA 2E2JH 2UUBL 1OXUA 2HIVA 3K81C 3PSIA 1GD7A 1VQJA 2FXQA 5M5XH 4YCUA 3AQQA 2JA6G 1P16A 4B3SQ 3KYHC 3ICEA 5IWAL 5GAHC 3FKIH 3PGZA 4BXXH 1S3OA 3CMEA 2K5NA 1KRTA 1PVOA 4UP9A 4DPGA 3I2ZA 3L0OA 1LUZA 1CKNB 3CCJA 4DKAC 4AYBG 1GM5A 3HKSA 4AQYQ 2PI2E 3EIVA 1L1OA 3T1YQ 3E9HA 3GD7A 3TQYA 5IP9H 1PH8A 3CC2A 4GN4B 4K0KQ 3G4SA 1AH9A 4A3CH 1J5EL 1SLJA 2CWPA 2YTVA 2VL6A 1AE3A 4R4IA 3M7NA 3S1QH 3HOWH 4IFDG 1N33Q 2JA5H 4K0KL 1IZ6A 2ES2A 4DV3Q 1E22A 4IPHA 4GNXB 2E2HH 4HIMA 1QZGA 1T9HA 3I4MH 2F4VL 1N33L 1X3FA 3CPFA 3KJOA 4LF4L 3M4QA 2K52A 4DV3L 2IY5B 5GQOA 4AIMA 1XPRA 2L15A 1EQRA 1VQCA 1Q86C 2JQOA 4YHHL 4QGUA 1XPOA 4A3LH 1FL0A 3G6EA 1Q82C 3S1NH 1YZ6A 3GO5A 1KAWA 3GDEA 4GS3A 3RR5A 4C3IH 2OCEA 4QL5A 4QY7A 3A5UA 4MZ9A 4DV2Q 1KXLA 2RHSB 1LYLA 3JAMc 1GO3E 1UE6A 2B29A 1VQDA 2YTXA 3KF6B 4JCVE 2Z6KA 3S1RH 2V1CC 1SROA 4TQUS 1JJ2A 4L5SA 2GVAA 4LFCQ 1HH2P 4A3EG 1CKOA 4JOIC 4LWCA 3SGIA 4NXMQ 2R92G 4WJ3M 2IHEA 3A0JA 1Q81C 3I4NH 4JI1L 3S16H 4POGA 3Q8DA 5FLMG 2BA1A 3MEFA 4NXML 2HIXA 1MJCA 3W5OA 4HIDA 4LNQA 5LMUQ 3HOZG 1UE5A 1XMQL 2I0QA 4DV6Q 4A3DG 2WB1E 5C4XG 4GOPB 4LUZA 5IYDH 2IX1A 1BBWA 3I4OA 3BZKA 3T1HQ 1VQNA 1FGUA 1Z47A 4R4QA 2MNAA 3L7ZC 1N32Q 2C35B 1PFSA 3T1HL 3OW2A 3CQZH 1FJGQ 4BA1I 5GADC 1EUJA 1KHIA 2H5XA 2UUCL 4KHZA 4DV5Q 4B3ML 2NZHA 1D7QA 2K5VA 1FJGL 1J6QA 4APVA 5EAYA 1YIJA 3M3YH 4A3KG 3PUZA 3CC7A 4DV5L 4JV5L 1XNQQ 1HNXQ 5HY6A 2VQFL 4IJLA 3J80c 3I56A 1VQEA 2BH2A 2VUMH 2JA9A 1BBUA 4DR4Q 2R93H 3F8TA 2KCTA 4X65Q 4DR5L 1HNXL 1XNQL 3CD6A 1Q7YC 5JJIA 4A93H 4DAMA 2ZM6Q 4BBRG 2HT1A 5FJ8G 2R7ZH 1X55A 3K80C 1TWFH 4X65L 2JA7H 4BBSH 4DV7Q 2RHQB 4A3BH 5C0XJ 3TREA 3H15A 5E7NA 1R9TH 4OO1G 2UXDQ 1VQFA 1XTDA 2YTYA 5J3BA 4LFAQ 3B6YA 3FKIG 4O0AA 3IRBA 1VQ5A 2MO0A 4DV0Q 1V43A 3J81c 3PIOA 3KJPA 4DR1Q 1EIFA 3GTMH 1NMGA 1SR3A 4LFBL 4QJFA 3KF8B 1A63A 2UXCQ 3CPWA 5M3FH 3ULJA 3U58A 1XNRQ 5C3EH 2AMCB 5DLQE 5HGQA 3I55A 4IJHA 5IP9G 2YYZA 4DV1L 1N34L 1SN8A 4GN3B 1KRSA 4IO9A 4A3CG 1JB7A 2UUAL 1IYJB 3HOWG 1PH5A 2IHFA 3TS2A 1HZCA 3KLWA 4L5TA 4ME3A 4GLVB 3I4MG 3CCVA 3K7UC 3F2CA 5GAGC 2A1AA 4JBWA 2N8NA 3U4VA 1B8AA 4DR6Q 4LF9Q 1M1KC 4P75A 1OXSC 4JI4Q 4JG2A 4IOCA 2AWOA 1I94Q 4JI3Q 4LF9L 4DR6L 1N8RC 2N78A 1VQOA 2B63G 4B3SL 1JJGA 2JA8G 2NN6I 1X3GA 1I94L 5ELOA 4OXPA 3J80i 1MKHA 3S15H 4PZ8A 4GLXA 1WCMH 1UEBA 4PG3A 1YJ9A 1I3QH 4JOIA 4L5RC 5IT9c 1YBYA 1Q1BA 3E9IA 3CW2C 4QQBX 3I7FA 1VQKA 3S24A 2WB1G 3DM3A 4AQYL 2K4KA 3HOYG 1BKBA 1SE8A 3HOVG 3T1YL 2IT1A 2KENA 4GNXC 4B3TQ 5C0XG 4YWMA 3ZJYC 3ULPA 4JBMA 1HZAA 2ALYB 3KFUA 1E3PA 1VQIA 5IYCH 1JMCA 2A8VA 2JJQA 2NVQH 1B70B 4R4CA 5IY0A 3J81i 4DK6C 2ZJPA 4OWWB 3BU2A 1HR0W 3I4NG 3L2PA 1YHQA 4KHPQ 3F1ZA 4OWXB 1Y1VH 2Y0SE 3BJUA 2VY3A 3F2BA 3RLOA 1MIUA 2CWAA 1U0LA 3PO3G 3ULLA 4Y7NH 1G51A 4UP7A 4DR2Q 2Z0SA 1N36Q 1K9MC 1EWIA 1D8LA 4P72A 3CC4A 3UDFA 5IYDG 3UDXA 1X9NA 1PH3A 1YHBA 3HKZE 2K14A 1TWAH 2YV5A 5GROA 5AJ3Q 1L2FA 2JEBI 1UWVA 3W1GA 1YVCA 4DUZQ 4IFDI 2JEAI 4DV2L 1Q8KA 5IP7H 5FLXc 1CUKA 4C2MH 5C0XI 5C44H 1Q1EA 3ER0A 1YITA 3AFPA 2XGTA 2JA6H 3DLLA 1X6OA 2MQHA 1HZ9A 1MJEA 2MO1A 4UP8A 2ZTEA 1V9PA 1QUQA 2Q2IA 2LXJA 3GTGH 4BY1H 2KCMA 4LFCL 2VUMG 1NMFA 2AKWB 1E1TA 1GVPA 4IOAA 4HIKA 3KDFA 1VQ7A 2UXBQ 2ASBA 4LUOA 2R7DA 3K7AH 4GOPC 2E5LQ 4YWKA 2JA7G 2R7ZG 4BBSG 3M9BA 2F52A 2I5HA 1OTCA 1EFWA 2NZOA 1VCIA 1YNXA 3A5ZB 1HNZQ 2OWOA 5LMUL 4H02A 3CXCA 4HJ5A 4JI6Q 4JI7Q 3PO2H 4BA2I 2UXBL 4DV6L 3J81j 2UXCL 2JK8A 4JI6L 3HFZB 2MFIA 4GKJQ 2PI2A 4A75A 5JJLA 4B3RQ 4C3JH 2ZTCA 4JI5Q 3GTPH 4GLAC 4GKJL 1N32L 1NTGA 4R4TA 4DR3Q 2JE6I 4JI5L 1W2BA 2D62A 1L1OB 2K5HA 1I5FA 2VW9A 3CCEA 1I50H 1X56A 4X64Q 2EQSA 1FVIA 2QEXA 1YJWA 2E2IH 4DR3L 2DGYA 3GTKH 3PUWA 5M3MH 2KHIA 4IPCA 1UE7A 4P74A 4OX9Q 1Y1WG 1PYBA 1Q46A 3OYYA 4X64L 4A3JH 4A3MH 5LMNW 4NPSA 5ELNA 2RF4A 1CKNA 2OTLA
chains in the Genus database with same CATH superfamily
3NXWA 3RLNA 3JAMi 4DR4L 2PZWA 4JC0A 1O7YA 4B9XA 3C3LA 4B08A 1WTHA 2RCNA 4XT1B 4RGNA 2CH4A 3PIPA 2Q2UA 2EJFC 5IOCA 2PMZE 2LSSA 2AQ1B 1IBMQ 2NVXB 1CFMA 1LTLA 4KY6A 4PZ7A 3A7AB 3CAMA 4IUTA 2E8GA 1PLFA 1QE6A 1NR2A 5CBAE 4DNIA 5K36G 1LT5D 2Z4IA 5M5YB 3TRZA 3SR1A 4F7XA 4UPAA 3AU7A 4PMWA 4LF8Q 2B3GA 1ENAA 3F2DA 3NEMA 5FO9B 2Z4HA 3TZDA 2K5WA 5EKLA 2B39A 1B3AA 4A3IB 4HJ9A 1JOKA 2EIFA 1H9SA 4A3LG 1SFOB 3EBEA 4JI3L 1PHJA 1BCPF 4XQQA 1IBLQ 2L11A 3LWEA 3VYRA 4YY3Q 2VZAA 3T53B 1IBLL 1CSPA 3H0GH 1FNWA 3C1FA 1JWMD 4YY3L 1K3RA 4CDEC 1STYA 4J8QA 3D3RA 3J7A5 4XTCS 2F3IA 4KI0A 4A4IA 1Z6HA 4IZ8A 1DOMA 3MAQA 4GOPA 4WJ4A 2EYOA 2BA0A 2PQEA 3X3NA 2XN9C 2PCFB 3S1MH 1CA6A 1CSQA 1BNZA 4LF7Q 1RL2A 1K83B 5ELCA 1J5EQ 4E6IA 4LF7L 2ATWA 3HG9A 1N36L 1I4PA 5EPLA 2UU9Q 3HOXB 2ZXOA 1PRTD 1G91A 2F4VQ 4LF4Q 1VQ4A 4IPGA 2L12A 3I72A 2UU9L 3RN2A 4JI2Q 3VA7A 1K0RA 2QF7A 2ZJQA 1HZBA 4DUZL 5C5MA 4JI2L 1QB5D 3QO2A 3EVQA 3K5LA 1I4RA 5JOBA 2JA8H 3MTSA 4P2CB 2R93G 1E2ZA 1HCZA 4JI0Q 4A93G 2D0PA 3U9SA 3HZXA 4XDXA 3AFQA 4H13C 5LL6S 4JI0L 1S5BD 3U50C 1C7YA 5C4ZA 1U4LA 3RZDH 2E5LL 3PF4A 4NB3A 3GTLH 1RCVD 1SNPA 1WTRA 1EWHA 2B2UC 4JI7L 4JI1Q 3NQIA 2QILA 1TWHH 3DWPA 3EFXD 1QILA 2K50A 4X3TA 3TP5A 4X66Q 1IHZA 3PO3B 4IN3A 4X66L 4KY7A 3CMAA 3GTJB 1ZEQX 3PCOB 1DJRD 4UAIA 3M4OH 4M1UB 4OX9L 1B7YB 1V1QA 1CQFA 1B4OA 1SRUA 3C1EA 2UUCQ 4RHSA 1NY4A 3VR6A 3MXGA 5CC4A 1J9OA 1VQHA 2HDLA 3GTQB 1F2ZA 4WJWA 2CFMA 3J7ZC 3UDGA 1VQLA 2R92H 1TWGH 1A15A 3FMCA 2OXPA 1C9OA 4JI8L 5IE8A 2NVXH 2VQEQ 1XX8A 2AUKA 1G2SA 1HJPA 2VQEL 5T1GA 2K75A 5JEAG 5HGTA 4Y52H 3TZUA 3PQIA 5KIXA 5M5YH 4LFBQ 3LNNA 5IT9L 1EY6A 1AE2A 3RN5A 2YU9B 1PRTC 2FJ2A 3D4RA 4KKSA 2M9VA 4ODGA 1Z9FA 4LAAA 1XMOQ 4PV1C 4RMFA 2J0TD 1ZKOA 3PUVA 1PV4A 1GXDC 2Z1CA 1SFOH 1XMOL 2F0IA 2F0QA 1HUNA 2UUBQ 2E2JH 2UUBL 2EYFA 3K81C 1EYCA 4YCUA 1P16A 4B3SQ 3RMHA 3VR5A 2QEJC 1RTOA 2K5NA 1JC7A 4O42A 4KJOA 1PDQA 4DPGA 3I2ZA 3L0OA 1CKNB 2JSOA 2B2UA 5FLXL 3HKSA 2RBMA 1ML0D 1WD0A 4F8MA 1SNQA 2O2LD 4R8NA 3P75A 3S1QB 4HSPA 3HKZB 1GHJA 4GN4B 4MIUA 3G4SA 3BS1A 2KEEA 2JA5B 1SBBB 3FPPA 5K36H 1I4QA 1N33Q 1ICFB 3I90A 4Q5VA 1JORA 1E22A 4IPHA 1QZGA 1T9HA 2A74C 1N33L 2F0UA 2IY5B 4Y7NB 1XPRA 3SK4A 3HRZC 1SDFA 1EQRA 4ZRZA 2DY8A 2JQOA 4A3LH 1LTBD 3S1NH 3MXNA 4DAPA 1JICA 1GUWA 3J80E 4MZ9A 4DV2Q 1DZ1A 1KXLA 2RHSB 1LYLA 4HCEA 1UE6A 5C44B 1VQDA 2IW3A 3D4WA 4JCVE 5ELBA 3BDCA 3CU7A 3OW7A 4NKLA 4YIJA 3PIO3 4NXMQ 4BY1B 2IHEA 3A0JA 1H9JA 4POGA 3GQBA 2BA1A 4NXML 2DNEA 2R61A 3SK5A 4LNQA 4HIDA 4C3HG 5LMUQ 4JW0A 3HOZG 3PO2B 5C4XG 1T5EA 1SNOA 2MHVA 3I4OA 1Y8OB 3BZKA 4O1NA 2QKIC 4R4QA 4C3JB 3L7ZC 2GA4B 3CQZB 4MHEA 4BA1I 2DJFC 4KHZA 1GUNA 1D7QA 2K5VA 4NDXA 5EAYA 2P5ZX 3M3YH 2HCIA 4A3KG 2A6HD 1XNQQ 1YNJD 5JVH3 1O7LA 4IJLA 3J80c 3TSSA 1VQEA 1S5ED 2R93H 2F0NA 1I4GA 3OMGA 2KCTA 4X65Q 1XNQL 1Q7YC 4A93H 2JA7B 1U4MA 2RCFA 1QJOA 4OHJA 4DNTB 5FJ8G 4X65L 4A3BB 1KDCA 4BY7B 5KGUA 4OO1G 3VR2A 3TREA 3H3VC 1VQFA 1XTDA 4LFAQ 4JK1C 4DR1Q 1SR3A 1S5DD 3K6OA 4QJFA 5KNBA 1CZGA 3BDLA 3ULJA 3U58A 3I55A 1C8CA 5IP9G 4GN3B 4IO9A 1JB7A 4HAEA 2FFKB 2UUAL 3HOWG 3S9WA 4XXEA 4GLVB 3I4MG 3CCVA 3F2CA 3M7GA 3U4VA 1B8AA 4ZKCB 1M1KC 4P75A 3NUCA 4K6LA 4IOCA 2CW0D 1GUGA 2IWHA 1VQOA 4TSSA 3HOUB 4A3GB 2F0PA 1B2TA 3Q23A 2F0HA 1I3QB 1UEBA 1F2YA 4C56C 1C4QA 4U673 4RGMA 1YBYA 4H44C 1KNEA 4QQBX 4AQYL 2K4KA 3HOYG 3HOVG 1MHWC 4GNXC 2EY5A 5JEAH 3KK7A 3ZJYC 5E4XA 1F77A 5CMDA 4IUVA 3WOEA 5IGFA 3MXPA 4DK6C 4OWWB 3BU2A 1HR0W 1YHQA 4OWXB 3BJUA 2LFNA 4FF1A 3D8GA 1U0LA 3C2PA 4Y7NH 5TSSA 4DR2Q 3QJYA 2Z0SA 1K9MC 4G4KA 2NVTB 1EWIA 1D8LA 3VA5A 1QOHA 3MVVA 1PH3A 3HKZE 2YV5A 5GROA 1AN8A 5AJ3Q 4RKBA 2B8FA 4QCLA 2F0MA 4RA8A 5CV8A 1YNJC 1HQRD 1Q8KA 1V8QA 5IGCA 5C44H 1PTOD 1STAA 1YITA 1JOOA 2WINB 4N9TA 2LXJA 5J1ZA 2EOTA 4BY1H 2KCMA 4AYBB 4MTKA 5FO8B 1ZYRD 4IOAA 1CZWA 2R7ZG 2A68D 4BBSG 1STNA 4JI6Q 2OWOA 4BA2I 3PO2H 3CXCA 4HJ5A 3J81j 2JK8A 4JI6L 2A6ED 2PI2A 4C3JH 1E2WA 1NTGA 3CKIB 3NPPA 2JE6I 4IUPA 4L8JA 3HGBA 2VW9A 1I5FA 1I50H 1FVIA 2RDFA 3GTKH 2WV6D 2KHIA 4IPCA 1UE7A 4P74A 1Y1WG 1I4XA 2CW0C 2KVMA 5LMNW 1E0BA 3K5NA 2B2WC 5IGGA 2RF4A 1PZJD 4N8FA 2SNMA 5E3FA 3NHHA 5KYIA 4BY7H 4C1NK 1DM0B 3T16A 4DV7L 1PXUA 2UXDL 4DR7Q 5CV6A 4DK3C 2ENBA 1EIGA 4GNXA 4DR7L 5BR8Q 1PFBA 3EROA 2Y0SG 4OWTB 1OXVA 2NVYB 4UDUC 4G57A 1QG7A 5DAUA 3K0XA 1XPUA 1YI2A 2RSNA 3HOZH 5C4XH 1VQ9A 3QR8A 2IJ0A 4GKKQ 1FGBD 4FNFA 1TVXA 2WAQE 3CCMA 5A2QE 1LTRD 5CV4A 4YCWA 1EIYB 4GKKL 4OIJA 2KBNA 1LM0A 3OIQA 3OOCA 5JJKA 1CT1D 2OQKA 1SYCA 4PNYA 2LXKA 1Y1VG 3KF6A 1CTMA 1NE3A 1PTOC 1SAPA 2X6LA 4P73A 3HOUH 4A3GH 4DV4Q 1CM9A 1QWYA 1VF7A 4JVZA 5E1FA 1F9PA 3VDYA 1YJNA 1EYDA 1YEZA 2CCZA 2HD3A 5M5XB 4O2DA 5IWAQ 3S2HH 4OO1H 1MSGA 4DK0A 2EXZA 3M85A 4ZYSA 5EBDA 1GKHA 4B3TL 1UE1A 1PTOF 1SEBD 1PH6A 3S1MB 1HNWQ 4ABNA 2A6EC 2QA4A 1X3QA 2NN6H 2N49A 2IX3A 1HNWL 2G9HD 4QB4A 2NVTH 4R9WA 2VB2X 1HPCA 2Z8LA 1QVGA 1EYGA 3DWQA 4A3FH 4LJZC 3CCRA 5IYBH 1K0SA 5C3XA 1WTPA 4XQNA 3SEBA 1Q8IA 2KHJA 3TP7A 2EZVA 4RHRA 2B2WA 4ZQ3A 4YHHQ 2K1BA 3NBIA 3G48A 1VQ8A 2JA8B 2HQLA 1VQGA 4BWGB 4V0BA 3MFGA 3JC66 3D31A 1BVSA 2RKSA 1QVCA 3K5MA 5JEAJ 3GTOH 1SYBA 3K59A 1JWUD 4EQOA 5H1SE 3GTLB 3HOYH 1HQMC 3NENA 3HOVH 3J80L 3NQTA 4IUUA 3TN2A 2L0CA 4IQZA 4RH6A 1TWHB 3EA6A 5I9PA 3MXUA 4OELB 4F88A 1LTSD 2F0WA 4KMUC 4LUVA 4B3RL 4R4OA 4KN4C 4AYBE 4JPBW 4KK7A 5C3EG 4NMZA 2O4XA 3RZOH 5COYA 4ULLA 1ENCA 4L5QA 3RLFA 4EQPA 3QB3A 1XXGA 3AMUA 3FDTA 2IX0A 3NBHB 1QVFA 1OO9B 4B3MQ 2B2VC 2PNRC 3H09A 2EYJA 1I6HH 1ILQA 4MNOA 2R92B 4A3IG 2VQFQ 1UAPA 3WWVA 1WYDA 1TWGB 4A3EH 1MGSA 2VUMB 5CORA 2WIIB 4JBKA 4DXGA 5FLMH 1HUMA 2NVYH 5J22A 2L4NA 1IBML 2FMMA 1D5XC 1LT3D 1R9TB 1PMRA 2VNUD 2AHOB 2J7ZA 1ZXTA 4HN7A 3H3VH 5T1IA 3VYUA 4X3UA 3QIAA 4DFAA 2F0KA 1WTWA 5NUCA 1Y69U 4LF8L 2VS1A 3UI2A 1BDOA 4DV1Q 4DXFA 1OXTA 1DXMA 4RFBA 1Y1WH 3HOXG 4PMBA 1VMPA 2ZTDA 2C5CA 2E2JB 4BBRH 1SSOA 3JAME 1SYFA 2FINB 2HDMA 2FXQA 3IFTA 4ZCKA 5M5XH 3AQQA 3IL8A 2JA6G 3KYHC 5GAHC 3FKIH 3CMEA 1PVOA 1GM5A 3A56A 4DU9A 2PI2E 1B3QA 3T1YQ 1HRJA 3GD7A 1PH8A 3CC2A 3I8ZA 1HFGA 3T56B 4K0KQ 4X3SA 1J5EL 2VL6A 1AE3A 1RTNA 3KLSX 4IFDG 3TBIB 2F3VA 4K0KL 5ISRA 1IZ6A 2DN8A 4DV3Q 4HIMA 2F4VL 3LX0A 2L55A 4I7AA 5A35A 4LF4L 2AQ2B 4DV3L 5GQOA 1A3UA 2EY2A 1KNAA 1Q86C 1WTVA 5IGDA 2KUMA 3S1NB 4WRDA 1Q82C 3Q24A 3RR5A 1KAWA 3RD4A 4QL5A 4QY7A 1U9RA 1A6XA 3A7LA 4KY5A 3JAMc 1RHPA 4K2LA 3QOJA 2V1CC 1CHQD 2X6GA 1SROA 1H9SB 2EYMA 4L5SA 3E0JA 3I4NH 4JI1L 4GZYC 2XWBB 4L63B 1VMCA 1UE5A 2D5DA 4DA2A 2I0QA 4DV6Q 4A3DG 4GOPB 1FD7D 1BR9A 1UEAB 1AFPA 1Z47A 1DOLA 1PFSA 3C46A 3Q0AA 1FJGQ 1DD2A 2UUCL 1JQYD 3MWYW 2K6AA 3M3YB 1FJGL 5EQ0A 3VYTA 3N52A 4S3SA 2R93B 2VUMH 1PZID 5EJWA 1MD2D 3F8TA 1HTPA 3VR3A 4A93B 3CD6A 1BUVT 2ZM6Q 2HT1A 1TWFH 4KHVA 1R9TH 4RWSC 1CHPD 4RAUC 1D6EC 3E3XA 2YTYA 3B6YA 1CQVA 4O0AA 1VQ5A 2RQXA 4DV0Q 3R2TA 3KJPA 1XYIA 4LFBL 4CKEA 1A63A 4KTAA 3CPWA 1XNRQ 2KCNA 2AMCB 5C3EH 5HGQA 2RA4A 4I7ZC 1O80A 1KRSA 4A3CG 1G6ZA 3A54A 1BCPB 4ZK9B 2K7VA 3R2IA 3KLWA 1Z7TA 3K7UC 2A1AA 2N8NA 1PRTF 2O5IC 1NNXA 4JI4Q 1LV9A 4JG2A 2AWOA 3IFDA 5A2QL 5KEEA 2B63G 4B3SL 2NN6I 3G7LA 3D6WA 4CHTB 5ELOA 3J80i 4C3IG 1MKHA 4PZ8A 4GLXA 5IIFA 1PTOH 5I2YA 1Y8NB 3E9IA 3IAYA 4QMGA 2WB1G 3NWTA 4IUQA 1SE8A 4DAVA 4YWMA 4JBMA 1HZAA 2ALYB 4PMCA 3W3AA 1VQIA 1BF4A 2JJQA 4H7BA 3Q6SA 2ZJPA 4KHPQ 4QIWB 3F1ZA 1TS4A 4G7OC 3RLOA 1MIUA 1FR3A 1G51A 5G3LD 1EOTA 5IYDG 1SNMA 1SE2A 1TWAH 2JEBI 2ZXRA 5I9OA 4NP5A 1UWVA 3R93A 3W1GA 1YVCA 2PZUA 4DV2L 2JEAI 1CUKA 2XRQD 2A5HA 3PIP3 1A2TA 2JA6H 3DLLA 1X6OA 1MJEA 1S4ZA 3CRKC 2MO1A 1QCBD 4IURA 1MI2A 2Q2IA 3GTGH 1WTQA 3ZYYX 1BOSA 3KDFA 2UXBQ 1YNND 2ASBA 4YWKA 2JA7G 2JP1A 2KHSA 2F52A 2I5HA 2UXCQ 1HNZQ 2UXBL 5LMUL 2UXCL 2CVRA 4QF4A 2MFIA 4HEDA 1JOQA 2XIWA 4ILWA 1GOZA 3HS0C 3GTPH 1JCKB 2F0LA 3KUPA 1I50B 3T4AC 3J7AV 1W2BA 2D62A 4CGYB 5C3WA 3GTKB 4XYOA 1X56A 2QEXA 1YJWA 3OMCA 2DGYA 2SOBA 2MP1A 3P1HA 3L3OC 2SEBD 4WFN3 4HCSA 4XYQA 1SNDA 2O5JC 1KD1C 3STBD 3KOJA 3FHWA 1AP0A 2NWGA 2WFWA 3K0YA 1TKWB 2WAQB 1MSHA 4AH6A 4FO2A 2AWNA 4ZLTF 1M90C 3KLRA 3G71A 4BXXG 4LFAL 2Q8IB 3MXNB 3J7YW 4DUYQ 4ME5A 1L0WA 1WCMG 4QUCA 4DR1L 3UDIA 2LY7A 4DUYL 2EPBA 4C3HB 3HOZB 2NBFA 4HIOA 1S5FD 5C4XB 1KDBA 2BH8A 2ICEC 2MUYA 4A3DH 3D6CA 4FF2A 1X3EA 3S14B 1DOKA 1I4HA 4YCVA 4A76A 1KL9A 2EE1A 3W1BA 1WTOA 3AEVA 1IL2A 1D2BA 4LF6Q 3CCQA 1PRTB 2JYOA 2PQAA 1IBKQ 1TWCB 4A3KB 3SE0A 2QGQA 1IBKL 4OONA 1U5KA 1E2VA 1JJCB 1A0IA 3L9AX 4ZUIA 1SXTA 1CK1A 1KTKA 1QNUA 5CBEE 4YWLA 1WI5A 3CRLC 2R6GA 4HSVA 5D3DA 4FYDA 2M00A 5IP7G 3I73A 3S2HB 1VQPA 4RGTA 2EXDA 1STBA 1YNNC 4HJ8A 2OF1A 3NP8A 3R3OA 3T13A 1G6PA 1SYDA 2WACA 2F1MA 2ID0A 2CQAA 3JAML 1K8GA 1NBWA 2D0OA 2ZJRA 1S40A 1PH9A 4LF5Q 2XVSA 4A3FB 3H6MA 4DR2L 5DM63 1JE4A 2OT2A 4LF5L 4KLKA 2A6HC 3I4MB 2E2HB 4M8AA 2G9DA 5AJ3L 1IW7D 4G7HC 1EQVA 3E0EA 1RIPA 4QIWE 1WVLA 3STBC 4X3KA 3OTOQ 4CDCC 3UE0A 5M3MG 1RD9D 3OTOL 2F0VA 3CCLA 2B63H 5EPJA 4A3JG 4HJ7A 4K8IA 4A3MG 2L1BA 3V05A 3M4PA 3A74A 5C4JH 1E1OA 3CF5A 3GTOB 2N55A 3S1RB 3HOYB 1ICWA 1O78A 4GN5A 3HOVB 2PQAB 1F2LA 3S17H 1SYEA 1AZPA 3S16B 2KQ3A 1YHAA 1L1OC 1S72A 5M3FG 1XMQQ 2GN5A 2AQ3B 2K03A 3RZOB 2HUGA 1K3BC 2QCPX 4RGOS 4UHVA 3TDQA 1FNVA 2DUDA 4OEMB 3S2DH 1UNSA 4CJ1B 5FKAC 2PZTA 1NJIC 2LS01 3I91A 4X6AH 5I4DA 3FEWX 5JPMC 4ZKBB 5JVG3 2K01A 1TR5A 1I6HB 1PH4A 3MHBA 3CCSA 1EU3A 4JV5Q 1Y14B 4A3EB 1EIHA 1V1OA 5FK9C 2NB0A 4DR5Q 3TEHB 5CGKA 1KIXA 5C6AA 2I46A 3R8BA 2Z6KC 3DWAA 5BR8L 2PYKA 2HQEA 5M5WH 3H0GG 4C3HH 4IFDJ 3M4YA 1A62A 1B9MA 3S14H 5IYCG 1VQAA 4UY8C 3CP0A 1K8AC 5F2DA 1EY8A 3A55A 2TMPA 3EN2A 1E24A 1S5CD 2NTSA 1IW7C 4LK1C 4PZ6A 2K33A 2KJXA 1N34Q 1TWCH 3PV0A 4A3KH 3PF5A 1Y1WB 2OQ0A 1X65A 2WP8J 1OXXK 2B2YC 4BBRB 2N88A 1STGA 4DV4L 2EJMA 3PUXA 1O7ZA 5FJ8H 3D0FA 1EEID 1OXUA 1ZYRC 3MA2B 2R3ZA 3FKIB 2A68C 5IWAL 3PGZA 4BXXH 1S3OA 1BBXC 1IYUA 4UP9A 2Y0SB 1LUZA 2XSCA 3EIVA 5CV9A 1L1OA 3E9HA 5IP9H 1AH9A 1SLJA 2CWPA 3M7NA 3HOWH 1H9RA 4GNXB 3I4MH 2QDLA 2E2HH 1Y1VB 3CPFA 3KJOA 2K52A 1EYAA 4AIMA 1BCPD 2KCCA 1VQCA 4YHHL 2CHBD 4QGUA 1XPOA 3G6EA 2VB3X 1YZ6A 3GO5A 1TU2B 3J7AF 4R8IA 4XT3B 2H1EA 3KF8A 1AEXA 4C2MB 2B29A 3KF6B 2Z6KA 3S1RH 2PPBC 2F0FA 5I6YA 2GVAA 4LFCQ 1HH2P 1G8ZD 1CKOA 2BDNA 2R92G 3I4NB 4K2KA 3MFYA 1TS2A 3J81E 3S16H 1GUTA 5D14A 2V4DA 5C4HA 1TS3A 2HIXA 3W5OA 4K5WA 4LUZA 4CJ2C 1BBWA 3KBXA 2A69D 1VQNA 1WTXA 1FGUA 4RKLA 1N32Q 2C35B 4IALA 1LTGD 2B2YA 5GADC 2WKCA 1AW7A 4DV5Q 3E5SA 2NZHA 4B3ML 1YIJA 2E2IB 1D5ZC 4DV5L 1X3PA 5DNFA 1AZQA 2VQFL 3SVMA 3I56A 1Q3LA 1EWCA 2BH2A 5JPNC 4DR4Q 1BBUA 5JJIA 3DXJC 3G6JB 4EVOA 1TWFB 4DAMA 1RKNA 2R7ZH 2I07B 1X55A 3K80C 4BBSH 2JN4A 2RHQB 1EY0A 3H15A 1F9SA 3ND9A 5J3BA 1EY7A 3X3MA 3IRBA 2MO0A 1V43A 3J81c 3PIOA 3GTMH 4OGQC 2Q8TA 3KF8B 3BVZA 3WDNA 5C3EB 5M3FH 5ELEA 2HCCA 5DLQE 4TRDA 3H94A 4DV1L 1TT2A 1BCPC 1SN8A 1EY9A 1IYJB 2F3WA 4KD3A 2RSOA 3CHBD 2EDGA 1KABA 4DR6Q 5C5LA 5EGTA 3OHXC 1JB3A 4DR6L 1I94Q 4JI3Q 2F0GA 2N78A 3FPUB 1JJGA 1I94L 4BS9A 1PTOB 4OXPA 1B44D 3NE5B 3GP7A 4FF4A 2SNSA 2Z6BA 1SJED 4DGZA 2BCOA 1A3TA 1X32A 1BKBA 3T1YL 2IT1A 2KENA 2EYHA 3BG3A 3BVMA 4K5VA 5C0XG 1SNCA 1DCZA 5IYCH 3I3CA 2NVQH 1B70B 1R4QB 5IY0A 3GV3A 2VXWA 4LMQD 4Z9CB 2A69C 1Y1VH 2Y0SE 4CDDC 3F2BA 3PO3G 1U4RA 1HHVA 4UP7A 2B2VA 1N36Q 2MPMA 3TMEA 4P72A 1V1PA 3CC4A 1Q90A 4K8JA 3UDFA 1TWAB 2X69A 4DK1A 4FXKC 4DUZQ 2AUJD 4C2MH 2XNAC 2ZT9C 2MJ8A 5E4WC 1LO5D 2JA6B 3K5OA 2K32A 3AFPA 2E74C 2XGTA 4KJNA 3Q22A 2MQHA 5JAVA 1HZ9A 3GTGB 2ZTEA 1QUQA 1L0YB 1KAAA 3HP3A 1NMFA 1E1TA 1GVPA 2B8GA 2D9UA 4HIKA 1VQ7A 1LTID 2R7DA 3K7AH 2E5LQ 1TIID 3M9BA 1OTCA 1PFMA 3A5ZB 1XWEA 4H02A 3K57A 4JI7Q 2Z9HA 4DV6L 4A75A 3GTPB 2ZTCA 4DAYA 1K8MA 1IKLA 2F0SA 2KOLA 4R4TA 2ICIA 4DR3Q 1MBYA 3AB9A 2K5HA 2KECA 2EQSA 1EQTA 1LTTD 2E2IH 1SYGA 4DR3L 3PUWA 4CKBA 4OX9Q 4K6DA 2K5QA 4PQXA 4HTHA 1U4PA 2F0TA 1CKNA 4N8X1 5L37A 1CA5A 4X62Q 1LTAD 2J4XA 2K04A 2ZM6L 4KN7C 3TS0A 2XWJB 1A2UA 1JT8A 4X62L 1IYVA 1LT4D 2K28A 1V1PB 4POFA 4CBVA 4JI8Q 4EX5A 4DV0L 1Q12A 1HR0Q 3CCUA 4JYAQ 3QWNA 2CH4W 1HR0L 3NELA 4A3DB 4CKCA 4JYAL 1XNRL 1T5XD 3AYHB 4R1JA 5LL6X 4NXNQ 3HKZG 2OEOA 2JA5G 2N3SA 4OO1I 4NXNL 1C0AA 3K8AA 2EYPA 2I5LX 1QUQB 4RCOA 4N9PA 2Q2HA 4EQ5A 1NCVA 1F2MA 2Q8RE 4Q0FA 4A3IH 1PYWD 2D2CC 4JI4L 1VQ6A 3LGJA 3NWSA 1F9RA 4DN4M 1EL0A 3ERSX 1VS0A 2OTJA 4DAYB 1H95A 3F2UA 3A8JE 1PH1A 5C44G 1KQSA 2NUCA 4EQNA 4IPDA 1QZHA 1BO0A 1DONA 3IKJA 1W3SA 4KKUA 3NK9A 4BY1G 4ALPA 1KC8C 1VQBA 3BZCA 4KHPL 1W6KA 3A8KE 1ESRA 1K83H 2C9OA 3KBGA 3E6ZX 2EY1A 4FDBA 1PH7A 3PO2G 3EQLC 3LWUA 2L9HA 2A19A 1EQQA 1PFNA 3HOXH 5LMNQ 3FP9A 4C3JG 1H9MA 4KD4A 4C1NI 5LHY1 5LMNL 4RG1A 2B2TC 2NZ1D 5GAEC 1VF5C 4HMJA 1PA6A 3U4ZA 3URYA 2B63B 2K5DA 3NTKA 1O7IA 3PUYA 3U9OA 4C3IB 2RVLA 4JBJA 5C4JB 2BDOA 1HA6A 2Q2TA 1X54A 2WB1B 1TS5A 1TXYA 1P8LA 4NW2A 4A3BG 3S17B 5FO7B 1ASZA 3V2TA 3QG1A 1WJJA 4BY7G 1CKMA 1DYQA 2WAQG 1HNZL 1QNKA 3ND8A 4J1MA 4IFDH 5C0XH 1EOVA 4HR7B 2CKZB 5KNCA 4U68A 2EJGC 1ONLA 1IXRA 2XTIA 1KDAA 1IKMA 2NTTA 1FNUA 3PO3H 5CV5A 3S2DB 2HHHQ 1SMXA 1XJVA 3GTJH 2R7FA 2LMCB 3J81L 2HHHL 4MTNA 5EBCA 1N9WA 1WOCA 1BQQT 3BYTB 3FRPB 2A73B 5IGEA 3H3VI 5CV7A 3GV6A 2PNHA 4J15A 1PYSB 1K73C 4TVAB 3RNUA 4XQJA 1J8IA 3GTQH 3PMFA 2PW7A 3ERQA 1DGSA 3HOUG 4A3GG 1PH2A 4XIGS 1EY4A 2GVBA 3BDOA 5M5WB 2BE5D 4V190 2CQOA 1VQMA 1JE5A 1SMYD 1LLRD 1ILPA 2DNCA 4P71A 3HEJA 3ONAB 2EYLA 3T51B 1NSNS 4RCNA 1STHA 1B50A 2E75C 1E7ZA 3UE1A 2YU9H 2F0OA 3KDFB 2FHTA 4LW1A 2NN6G 5HURA 5I6WA 5D65A 1I6VC 4LF6L 4HJAA 1M4VA 2B2TA 2UUAQ 1ASYA 2F0EA 4A3FG 5G3LF 5IYBG 1WFQA 1G291 1HTLD 2EVBA 2DY7A 2I5MX 3DHQA 1A8VA 2HIVA 3MEHA 3PSIA 1GD7A 1VQJA 4CDFC 1G2TA 2NYZD 3ICEA 4K14A 3OWEB 1KRTA 3S15B 2KEDA 4H0LC 1WCMB 1GUOA 3W2DA 3CCJA 4DKAC 4AYBG 1K8OA 3SDZA 4AQYQ 3NTHA 4KKTA 1EU4A 4ID6A 1ENFA 5I2XA 1D5MC 3TQYA 3HOWB 4A3CH 2YTVA 4K5XA 4R4IA 3S1QH 1EFID 2JA5H 1ET9A 2BOSA 2ES2A 2DJGC 3BZDB 3P20A 3P7JA 1X3FA 3M4QA 2IL8A 2L15A 3NTIA 3SK8A 1RJTA 5KNDA 3OPOA 1FL0A 4WORA 1RF2D 1L0XB 1GUSA 4C3IH 3GDEA 4GS3A 1NAPA 2OCEA 3DM1A 3A5UA 1R4PB 1II3A 3VR4A 1GO3E 5AFWA 2YTXA 2XRSD 3DEOA 5IGBA 1EY5A 2BE5C 1VDZA 3A8IE 4TQUS 1JJ2A 1SMYC 1A3VA 5EPKA 3V96A 2F4IA 4FF3A 4A3EG 3SGIA 4JOIC 4LWCA 4WJ3M 1NR4A 1Q81C 1ET6A 3Q8DA 4FXGC 5FLMG 3MEFA 4L6TB 2L5TA 1MJCA 4QUFA 3D4DA 4CJ0B 1XMQL 4ZAIA 2M2LA 2WB1E 4I65A 3K58A 1LABA 5IYDH 2IX1A 1CI3M 3T1HQ 1GHKA 2MNAA 3TP8A 3T1HL 1KLGD 3OW2A 3CQZH 1XTCD 1EUJA 1KHIA 1M8AA 2H5XA 1ESFA 3I4LA 5D3IB 4TKOB 3SK6A 2FMCA 3DUZA 5CYUA 1SJHD 1J6QA 4APVA 5J39A 1EZ6A 5ELFA 1NUCA 5M3MB 3PUZA 3CC7A 1C48A 1B1ZA 2PMZB 4A3JB 1HNXQ 5HY6A 4A3MB 4JV5L 2QW7A 1TY2A 4OL7A 5M9OA 2JA9A 3DMUA 3RUZA 4DR5L 1HNXL 1B53A 2R7ZB 3O13A 1TY0A 4BBSB 4BBRG 5IT9E 2JA7H 1JR0D 4DV7Q 4A3BH 5C0XJ 2UXDQ 5E7NA 2QDBA 1UUPA 5DEHA 1D1KA 1EZ8A 4B9WA 4ZUJA 3FKIG 1KLUD 3GTMB 1EIFA 2ZXPA 1NMGA 5IODA 5M3FB 1GJXA 5ELDA 2TSSA 2EY6A 3MZ5A 2PO4A 4IJHA 4EGVA 2F0JA 3OIPA 1Y8PB 2YYZA 1N34L 1EEFD 3VYSA 1PH5A 1HXYD 2IHFA 3TS2A 1HZCA 4L5TA 4ME3A 4IUNA 4FVMA 5BN4A 5GAGC 4JBWA 2F03A 5KRUA 3KLSA 4LF9Q 5CR3A 5FLXE 1OXSC 2JXMB 1LT6D 3OSOA 4LF9L 1N8RC 2RDHA 2WKDA 2JA8G 1BXTA 1X3GA 3I70A 5DM73 3S15H 4G7ZC 1WCMH 4PG3A 1SE3A 3SHLA 5BN3A 1YJ9A 1I3QH 4JOIA 2RDGA 5IT9c 3H0GB 4L5RC 1Q1BA 4DNRB 1H9KA 3CW2C 3I7FA 3EJIA 3S24A 3DM3A 1VQKA 3MC0B 1HFNA 3NSWA 4OIKA 5JJZA 2PW5A 4B3TQ 5FOBB 3ULPA 3KFUA 2E76C 2NVQB 1E3PA 2MGSA 1JMCA 2A8VA 5EKKA 4R4CA 3J81i 2F0DA 3NBHA 3I4NG 3L2PA 1RODA 2H4OA 2VY3A 3TP6A 1FYCA 2CWAA 3ULLA 4F87A 1LACA 4J6HA 2G5DA 3UDXA 1X9NA 1YHBA 4MN3A 2K14A 2K05A 1L2FA 4HMIA 2E2DC 3OWFA 1F9QA 4IFDI 1D1IA 3ITPA 5IP7H 5FLXc 5C0XI 1B9NA 1Q1EA 2LKVA 3ER0A 3BVGA 1HA5A 5K5PA 4UP8A 1V9PA 1JWSD 4LFCL 2VUMG 5EKIA 2AKWB 2IPKD 1STEA 3K7AB 3N6RA 1WD1A 4LUOA 4GOPC 3RZDB 1EFWA 2NZOA 1VCIA 1YNXA 5BN5A 1SE4A 1PZKD 1RDPD 3SXHA 3H91A 3BYYB 3HFZB 4GKJQ 5JJLA 4B3RQ 4KV6A 3QOLA 5KYLA 4JI5Q 4GLAC 4GKJL 1N32L 1K28A 3FVQA 4FP5D 4DF7A 4JI5L 4FXDA 1L1OB 3CCEA 2SDFA 3DEPA 4X64Q 5M3MH 3M4OB 1IL8A 1PYBA 1Q46A 2KA7A 3OYYA 3WOFA 4X64L 4A3JH 4A3MH 4NPSA 1W6JA 5ELNA 1TQOA 2OTLA
chains in the Genus database with same CATH topology
3JAMi 3RLNA 1KD1C 3STBD 3KOJA 4DR4L 3FHWA 4JC0A 4X62Q 2WFWA 2RCNA 2ZM6L 3TS0A 4BY7H 4AH6A 1JT8A 4X62L 2AWNA 1M90C 3G71A 4DV7L 3PIPA 4DR7Q 4BXXG 2UXDL 4POFA 2Q2UA 4LFAL 4DK3C 3MXNB 4JI8Q 4DUYQ 4GNXA 4DR7L 4EX5A 5BR8Q 2PMZE 2LSSA 2Y0SG 1L0WA 1WCMG 1Q12A 4OWTB 4DV0L 1OXVA 4DR1L 3UDIA 1HR0Q 3CCUA 1IBMQ 4DUYL 4JYAQ 1LTLA 4HIOA 3K0XA 4PZ7A 1XPUA 3CAMA 1HR0L 3NELA 1YI2A 3HOZH 2E8GA 2BH8A 1XNRL 4JYAL 3AYHB 5C4XH 4R1JA 1VQ9A 4NXNQ 4A3DH 4GKKQ 3HKZG 4DNIA 5K36G 1X3EA 2WAQE 2JA5G 3TRZA 2N3SA 3CCMA 4OO1I 4NXNL 1C0AA 3K8AA 2I5LX 4YCWA 1QUQB 1EIYB 4GKKL 4YCVA 4A76A 4UPAA 1KL9A 2KBNA 1LM0A 4PMWA 4LF8Q 5JJKA 2B3GA 2Q2HA 2OQKA 3W1BA 3AEVA 4EQ5A 1IL2A 2LXKA 1Y1VG 3F2DA 3KF6A 3NEMA 4LF6Q 3CCQA 1IBKQ 2PQAA 4HJ9A 4A3IH 1NE3A 2EIFA 4JI4L 2QGQA 1IBKL 4A3LG 3EBEA 3LGJA 4OONA 4JI3L 1U5KA 4P73A 1PHJA 1VQ6A 3HOUH 4A3GH 1IBLQ 4DV4Q 1JJCB 1A0IA 4YY3Q 2VZAA 3ERSX 1VS0A 4YWLA 1WI5A 4DAYB 1IBLL 2OTJA 1H95A 3VDYA 2R6GA 1CSPA 3H0GH 4YY3L 1YJNA 1YEZA 5IP7G 1PH1A 1K3RA 5C44G 1KQSA 2CCZA 3J7A5 4XTCS 2F3IA 4KI0A 4O2DA 4A4IA 5IWAQ 1VQPA 3S2HH 2EXDA 4IPDA 4HJ8A 4GOPA 1QZHA 1G6PA 3M85A 4WJ4A 1GKHA 2BA0A 4B3TL 1UE1A 1PH6A 1W3SA 2ID0A 1K8GA 4BY1G 1HNWQ 1NBWA 4ALPA 1KC8C 3S1MH 1VQBA 3BZCA 2QA4A 1CSQA 2D0OA 4KHPL 2ZJRA 2N49A 4LF7Q 1HNWL 1RL2A 1S40A 1PH9A 1J5EQ 4LF5Q 2NVTH 1K83H 4DR2L 1PH7A 4FDBA 4LF7L 1EYGA 1QVGA 1N36L 2ATWA 3PO2G 4A3FH 2A19A 1EQQA 2UU9Q 3CCRA 4LF5L 4KLKA 5IYBH 2F4VQ 3HOXH 5LMNQ 3FP9A 4LF4Q 1VQ4A 4IPGA 2UU9L 5AJ3L 3RN2A 2KHJA 4JI2Q 1K0RA 5LMNL 4RG1A 2ZJQA 1HZBA 5GAEC 3E0EA 4DUZL 4YHHQ 1RIPA 4QIWE 4JI2L 3STBC 1PA6A 3U4ZA 3OTOQ 3G48A 1VQ8A 1O7IA 2HQLA 3PUYA 3UE0A 5M3MG 1VQGA 3OTOL 3CCLA 2B63H 2JA8H 4A3JG 4HJ7A 3JC66 3D31A 4JBJA 4A3MG 2R93G 1BVSA 3M4PA 4JI0Q 3A74A 5C4JH 4A93G 2D0PA 1E1OA 2Q2TA 3CF5A 1QVCA 1X54A 3AFQA 4JI0L 5JEAJ 1TXYA 3U50C 1P8LA 1C7YA 3GTOH 4GN5A 4A3BG 5H1SE 1ASZA 2PQAB 3RZDH 2E5LL 1WJJA 3HOYH 3PF4A 4BY7G 3NENA 1CKMA 2WAQG 4NB3A 3GTLH 3HOVH 3S17H 1HNZL 1EOVA 4JI7L 4JI1Q 2CKZB 1TWHH 2K50A 1YHAA 4LUVA 4B3RL 1L1OC 4R4OA 1IXRA 4X66Q 2XTIA 5M3FG 1S72A 1XMQQ 2GN5A 4AYBE 5C3EG 3PO3H 3RZOH 4X66L 3CMAA 2HHHQ 3PCOB 1SMXA 4L5QA 2DUDA 3RLFA 1XJVA 3S2DH 3GTJH 2R7FA 3M4OH 2HHHL 4MTNA 1NJIC 4OX9L 1B7YB 1V1QA 4X6AH 1SRUA 2IX0A 1N9WA 3NBHB 1QVFA 2UUCQ 1WOCA 1NY4A 4B3MQ 3H3VI 1VQHA 1PH4A 3CCSA 2PNHA 4J15A 1I6HH 1PYSB 1Y14B 1K73C 4TVAB 4MNOA 3RNUA 4A3IG 2VQFQ 4JV5Q 3GTQH 3WWVA 1WYDA 2CFMA 3J7ZC 3UDGA 4A3EH 1VQLA 2R92H 1DGSA 4DR5Q 1TWGH 3TEHB 3HOUG 1PH2A 4A3GG 1KIXA 4JBKA 4XIGS 2GVBA 5FLMH 1C9OA 4JI8L 5IE8A 2Z6KC 2NVXH 2NVYH 5BR8L 2VQEQ 2CQOA 1VQMA 1IBML 5M5WH 3H0GG 4C3HH 1JE5A 1HJPA 2VQEL 4IFDJ 2VNUD 4P71A 2AHOB 2K75A 5JEAG 1A62A 4Y52H 3S14H 5IYCG 1VQAA 5M5YH 3H3VH 4UY8C 4LFBQ 3CP0A 1AE2A 3RN5A 1K8AC 1E7ZA 3EN2A 1E24A 3UE1A 2YU9H 4LF8L 3KDFB 2VS1A 4LW1A 2NN6G 4PZ6A 1Z9FA 4DV1Q 4HJAA 1XMOQ 4RMFA 1N34Q 4LF6L 1OXTA 1TWCH 3PUVA 3PV0A 4A3KH 3PF5A 1PV4A 2UUAQ 1SFOH 2OQ0A 1XMOL 1ASYA 1X65A 2WP8J 4A3FG 1Y1WH 5IYBG 1OXXK 1WFQA 3HOXG 2UUBQ 1G291 2ZTDA 4DV4L 2I5MX 3PUXA 4BBRH 5FJ8H 1A8VA 3D0FA 2E2JH 2UUBL 1OXUA 2HIVA 3K81C 3PSIA 1GD7A 1VQJA 2FXQA 5M5XH 4YCUA 3AQQA 2JA6G 1P16A 4B3SQ 3KYHC 3ICEA 5IWAL 5GAHC 3FKIH 3PGZA 4BXXH 1S3OA 3CMEA 2K5NA 1KRTA 1PVOA 4UP9A 4DPGA 3I2ZA 3L0OA 1LUZA 1CKNB 3CCJA 4DKAC 4AYBG 1GM5A 3HKSA 4AQYQ 2PI2E 3EIVA 1L1OA 3T1YQ 3E9HA 3GD7A 3TQYA 5IP9H 1PH8A 3CC2A 4GN4B 4K0KQ 3G4SA 1AH9A 4A3CH 1J5EL 1SLJA 2CWPA 2YTVA 2VL6A 1AE3A 4R4IA 3M7NA 3S1QH 3HOWH 4IFDG 1N33Q 2JA5H 4K0KL 1IZ6A 2ES2A 4DV3Q 1E22A 4IPHA 4GNXB 2E2HH 4HIMA 1QZGA 1T9HA 3I4MH 2F4VL 1N33L 1X3FA 3CPFA 3KJOA 4LF4L 3M4QA 2K52A 4DV3L 2IY5B 5GQOA 4AIMA 1XPRA 2L15A 1EQRA 1VQCA 1Q86C 2JQOA 4YHHL 4QGUA 1XPOA 4A3LH 1FL0A 3G6EA 1Q82C 3S1NH 1YZ6A 3GO5A 1KAWA 3GDEA 4GS3A 3RR5A 4C3IH 2OCEA 4QL5A 4QY7A 3A5UA 4MZ9A 4DV2Q 1KXLA 2RHSB 1LYLA 3JAMc 1GO3E 1UE6A 2B29A 1VQDA 2YTXA 3KF6B 4JCVE 2Z6KA 3S1RH 2V1CC 1SROA 4TQUS 1JJ2A 4L5SA 2GVAA 4LFCQ 1HH2P 4A3EG 1CKOA 4JOIC 4LWCA 3SGIA 4NXMQ 2R92G 4WJ3M 2IHEA 3A0JA 1Q81C 3I4NH 4JI1L 3S16H 4POGA 3Q8DA 5FLMG 2BA1A 3MEFA 4NXML 2HIXA 1MJCA 3W5OA 4HIDA 4LNQA 5LMUQ 3HOZG 1UE5A 1XMQL 2I0QA 4DV6Q 4A3DG 2WB1E 5C4XG 4GOPB 4LUZA 5IYDH 2IX1A 1BBWA 3I4OA 3BZKA 3T1HQ 1VQNA 1FGUA 1Z47A 4R4QA 2MNAA 3L7ZC 1N32Q 2C35B 1PFSA 3T1HL 3OW2A 3CQZH 1FJGQ 4BA1I 5GADC 1EUJA 1KHIA 2H5XA 2UUCL 4KHZA 4DV5Q 4B3ML 2NZHA 1D7QA 2K5VA 1FJGL 1J6QA 4APVA 5EAYA 1YIJA 3M3YH 4A3KG 3PUZA 3CC7A 4DV5L 4JV5L 1XNQQ 1HNXQ 5HY6A 2VQFL 4IJLA 3J80c 3I56A 1VQEA 2BH2A 2VUMH 2JA9A 1BBUA 4DR4Q 2R93H 3F8TA 2KCTA 4X65Q 4DR5L 1HNXL 1XNQL 3CD6A 1Q7YC 5JJIA 4A93H 4DAMA 2ZM6Q 4BBRG 2HT1A 5FJ8G 2R7ZH 1X55A 3K80C 1TWFH 4X65L 2JA7H 4BBSH 4DV7Q 2RHQB 4A3BH 5C0XJ 3TREA 3H15A 5E7NA 1R9TH 4OO1G 2UXDQ 1VQFA 1XTDA 2YTYA 5J3BA 4LFAQ 3B6YA 3FKIG 4O0AA 3IRBA 1VQ5A 2MO0A 4DV0Q 1V43A 3J81c 3PIOA 3KJPA 4DR1Q 1EIFA 3GTMH 1NMGA 1SR3A 4LFBL 4QJFA 3KF8B 1A63A 2UXCQ 3CPWA 5M3FH 3ULJA 3U58A 1XNRQ 5C3EH 2AMCB 5DLQE 5HGQA 3I55A 4IJHA 5IP9G 2YYZA 4DV1L 1N34L 1SN8A 4GN3B 1KRSA 4IO9A 4A3CG 1JB7A 2UUAL 1IYJB 3HOWG 1PH5A 2IHFA 3TS2A 1HZCA 3KLWA 4L5TA 4ME3A 4GLVB 3I4MG 3CCVA 3K7UC 3F2CA 5GAGC 2A1AA 4JBWA 2N8NA 3U4VA 1B8AA 4DR6Q 4LF9Q 1M1KC 4P75A 1OXSC 4JI4Q 4JG2A 4IOCA 2AWOA 1I94Q 4JI3Q 4LF9L 4DR6L 1N8RC 2N78A 1VQOA 2B63G 4B3SL 1JJGA 2JA8G 2NN6I 1X3GA 1I94L 5ELOA 4OXPA 3J80i 1MKHA 3S15H 4PZ8A 4GLXA 1WCMH 1UEBA 4PG3A 1YJ9A 1I3QH 4JOIA 4L5RC 5IT9c 1YBYA 1Q1BA 3E9IA 3CW2C 4QQBX 3I7FA 1VQKA 3S24A 2WB1G 3DM3A 4AQYL 2K4KA 3HOYG 1BKBA 1SE8A 3HOVG 3T1YL 2IT1A 2KENA 4GNXC 4B3TQ 5C0XG 4YWMA 3ZJYC 3ULPA 4JBMA 1HZAA 2ALYB 3KFUA 1E3PA 1VQIA 5IYCH 1JMCA 2A8VA 2JJQA 2NVQH 1B70B 4R4CA 5IY0A 3J81i 4DK6C 2ZJPA 4OWWB 3BU2A 1HR0W 3I4NG 3L2PA 1YHQA 4KHPQ 3F1ZA 4OWXB 1Y1VH 2Y0SE 3BJUA 2VY3A 3F2BA 3RLOA 1MIUA 2CWAA 1U0LA 3PO3G 3ULLA 4Y7NH 1G51A 4UP7A 4DR2Q 2Z0SA 1N36Q 1K9MC 1EWIA 1D8LA 4P72A 3CC4A 3UDFA 5IYDG 3UDXA 1X9NA 1PH3A 1YHBA 3HKZE 2K14A 1TWAH 2YV5A 5GROA 5AJ3Q 1L2FA 2JEBI 1UWVA 3W1GA 1YVCA 4DUZQ 4IFDI 2JEAI 4DV2L 1Q8KA 5IP7H 5FLXc 1CUKA 4C2MH 5C0XI 5C44H 1Q1EA 3ER0A 1YITA 3AFPA 2XGTA 2JA6H 3DLLA 1X6OA 2MQHA 1HZ9A 1MJEA 2MO1A 4UP8A 2ZTEA 1V9PA 1QUQA 2Q2IA 2LXJA 3GTGH 4BY1H 2KCMA 4LFCL 2VUMG 1NMFA 2AKWB 1E1TA 1GVPA 4IOAA 4HIKA 3KDFA 1VQ7A 2UXBQ 2ASBA 4LUOA 2R7DA 3K7AH 4GOPC 2E5LQ 4YWKA 2JA7G 2R7ZG 4BBSG 3M9BA 2F52A 2I5HA 1OTCA 1EFWA 2NZOA 1VCIA 1YNXA 3A5ZB 1HNZQ 2OWOA 5LMUL 4H02A 3CXCA 4HJ5A 4JI6Q 4JI7Q 3PO2H 4BA2I 2UXBL 4DV6L 3J81j 2UXCL 2JK8A 4JI6L 3HFZB 2MFIA 4GKJQ 2PI2A 4A75A 5JJLA 4B3RQ 4C3JH 2ZTCA 4JI5Q 3GTPH 4GLAC 4GKJL 1N32L 1NTGA 4R4TA 4DR3Q 2JE6I 4JI5L 1W2BA 2D62A 1L1OB 2K5HA 1I5FA 2VW9A 3CCEA 1I50H 1X56A 4X64Q 2EQSA 1FVIA 2QEXA 1YJWA 2E2IH 4DR3L 2DGYA 3GTKH 3PUWA 5M3MH 2KHIA 4IPCA 1UE7A 4P74A 4OX9Q 1Y1WG 1PYBA 1Q46A 3OYYA 4X64L 4A3JH 4A3MH 5LMNW 4NPSA 5ELNA 2RF4A 1CKNA 2OTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM i;  3RLN A;  1KD1 C;  3STB D;  3KOJ A;  4DR4 L;  3FHW A;  4JC0 A;  4X62 Q;  2WFW A;  2RCN A;  2ZM6 L;  3TS0 A;  4BY7 H;  4AH6 A;  1JT8 A;  4X62 L;  2AWN A;  1M90 C;  3G71 A;  4DV7 L;  3PIP A;  4DR7 Q;  4BXX G;  2UXD L;  4POF A;  2Q2U A;  4LFA L;  4DK3 C;  3MXN B;  4JI8 Q;  4DUY Q;  4GNX A;  4DR7 L;  4EX5 A;  5BR8 Q;  2PMZ E;  2LSS A;  2Y0S G;  1L0W A;  1WCM G;  1Q12 A;  4OWT B;  4DV0 L;  1OXV A;  4DR1 L;  3UDI A;  1HR0 Q;  3CCU A;  1IBM Q;  4DUY L;  4JYA Q;  1LTL A;  4HIO A;  3K0X A;  4PZ7 A;  1XPU A;  3CAM A;  1HR0 L;  3NEL A;  1YI2 A;  3HOZ H;  2E8G A;  2BH8 A;  1XNR L;  4JYA L;  3AYH B;  5C4X H;  4R1J A;  1VQ9 A;  4NXN Q;  4A3D H;  4GKK Q;  3HKZ G;  4DNI A;  5K36 G;  1X3E A;  2WAQ E;  2JA5 G;  3TRZ A;  2N3S A;  3CCM A;  4OO1 I;  4NXN L;  1C0A A;  3K8A A;  2I5L X;  4YCW A;  1QUQ B;  1EIY B;  4GKK L;  4YCV A;  4A76 A;  4UPA A;  1KL9 A;  2KBN A;  1LM0 A;  4PMW A;  4LF8 Q;  5JJK A;  2B3G A;  2Q2H A;  2OQK A;  3W1B A;  3AEV A;  4EQ5 A;  1IL2 A;  2LXK A;  1Y1V G;  3F2D A;  3KF6 A;  3NEM A;  4LF6 Q;  3CCQ A;  1IBK Q;  2PQA A;  4HJ9 A;  4A3I H;  1NE3 A;  2EIF A;  4JI4 L;  2QGQ A;  1IBK L;  4A3L G;  3EBE A;  3LGJ A;  4OON A;  4JI3 L;  1U5K A;  4P73 A;  1PHJ A;  1VQ6 A;  3HOU H;  4A3G H;  1IBL Q;  4DV4 Q;  1JJC B;  1A0I A;  4YY3 Q;  2VZA A;  3ERS X;  1VS0 A;  4YWL A;  1WI5 A;  4DAY B;  1IBL L;  2OTJ A;  1H95 A;  3VDY A;  2R6G A;  1CSP A;  3H0G H;  4YY3 L;  1YJN A;  1YEZ A;  5IP7 G;  1PH1 A;  1K3R A;  5C44 G;  1KQS A;  2CCZ A;  3J7A 5;  4XTC S;  2F3I A;  4KI0 A;  4O2D A;  4A4I A;  5IWA Q;  1VQP A;  3S2H H;  2EXD A;  4IPD A;  4HJ8 A;  4GOP A;  1QZH A;  1G6P A;  3M85 A;  4WJ4 A;  1GKH A;  2BA0 A;  4B3T L;  1UE1 A;  1PH6 A;  1W3S A;  2ID0 A;  1K8G A;  4BY1 G;  1HNW Q;  1NBW A;  4ALP A;  1KC8 C;  3S1M H;  1VQB A;  3BZC A;  2QA4 A;  1CSQ A;  2D0O A;  4KHP L;  2ZJR A;  2N49 A;  4LF7 Q;  1HNW L;  1RL2 A;  1S40 A;  1PH9 A;  1J5E Q;  4LF5 Q;  2NVT H;  1K83 H;  4DR2 L;  1PH7 A;  4FDB A;  4LF7 L;  1EYG A;  1QVG A;  1N36 L;  2ATW A;  3PO2 G;  4A3F H;  2A19 A;  1EQQ A;  2UU9 Q;  3CCR A;  4LF5 L;  4KLK A;  5IYB H;  2F4V Q;  3HOX H;  5LMN Q;  3FP9 A;  4LF4 Q;  1VQ4 A;  4IPG A;  2UU9 L;  5AJ3 L;  3RN2 A;  2KHJ A;  4JI2 Q;  1K0R A;  5LMN L;  4RG1 A;  2ZJQ A;  1HZB A;  5GAE C;  3E0E A;  4DUZ L;  4YHH Q;  1RIP A;  4QIW E;  4JI2 L;  3STB C;  1PA6 A;  3U4Z A;  3OTO Q;  3G48 A;  1VQ8 A;  1O7I A;  2HQL A;  3PUY A;  3UE0 A;  5M3M G;  1VQG A;  3OTO L;  3CCL A;  2B63 H;  2JA8 H;  4A3J G;  4HJ7 A;  3JC6 6;  3D31 A;  4JBJ A;  4A3M G;  2R93 G;  1BVS A;  3M4P A;  4JI0 Q;  3A74 A;  5C4J H;  4A93 G;  2D0P A;  1E1O A;  2Q2T A;  3CF5 A;  1QVC A;  1X54 A;  3AFQ A;  4JI0 L;  5JEA J;  1TXY A;  3U50 C;  1P8L A;  1C7Y A;  3GTO H;  4GN5 A;  4A3B G;  5H1S E;  1ASZ A;  2PQA B;  3RZD H;  2E5L L;  1WJJ A;  3HOY H;  3PF4 A;  4BY7 G;  3NEN A;  1CKM A;  2WAQ G;  4NB3 A;  3GTL H;  3HOV H;  3S17 H;  1HNZ L;  1EOV A;  4JI7 L;  4JI1 Q;  2CKZ B;  1TWH H;  2K50 A;  1YHA A;  4LUV A;  4B3R L;  1L1O C;  4R4O A;  1IXR A;  4X66 Q;  2XTI A;  5M3F G;  1S72 A;  1XMQ Q;  2GN5 A;  4AYB E;  5C3E G;  3PO3 H;  3RZO H;  4X66 L;  3CMA A;  2HHH Q;  3PCO B;  1SMX A;  4L5Q A;  2DUD A;  3RLF A;  1XJV A;  3S2D H;  3GTJ H;  2R7F A;  3M4O H;  2HHH L;  4MTN A;  1NJI C;  4OX9 L;  1B7Y B;  1V1Q A;  4X6A H;  1SRU A;  2IX0 A;  1N9W A;  3NBH B;  1QVF A;  2UUC Q;  1WOC A;  1NY4 A;  4B3M Q;  3H3V I;  1VQH A;  1PH4 A;  3CCS A;  2PNH A;  4J15 A;  1I6H H;  1PYS B;  1Y14 B;  1K73 C;  4TVA B;  4MNO A;  3RNU A;  4A3I G;  2VQF Q;  4JV5 Q;  3GTQ H;  3WWV A;  1WYD A;  2CFM A;  3J7Z C;  3UDG A;  4A3E H;  1VQL A;  2R92 H;  1DGS A;  4DR5 Q;  1TWG H;  3TEH B;  3HOU G;  1PH2 A;  4A3G G;  1KIX A;  4JBK A;  4XIG S;  2GVB A;  5FLM H;  1C9O A;  4JI8 L;  5IE8 A;  2Z6K C;  2NVX H;  2NVY H;  5BR8 L;  2VQE Q;  2CQO A;  1VQM A;  1IBM L;  5M5W H;  3H0G G;  4C3H H;  1JE5 A;  1HJP A;  2VQE L;  4IFD J;  2VNU D;  4P71 A;  2AHO B;  2K75 A;  5JEA G;  1A62 A;  4Y52 H;  3S14 H;  5IYC G;  1VQA A;  5M5Y H;  3H3V H;  4UY8 C;  4LFB Q;  3CP0 A;  1AE2 A;  3RN5 A;  1K8A C;  1E7Z A;  3EN2 A;  1E24 A;  3UE1 A;  2YU9 H;  4LF8 L;  3KDF B;  2VS1 A;  4LW1 A;  2NN6 G;  4PZ6 A;  1Z9F A;  4DV1 Q;  4HJA A;  1XMO Q;  4RMF A;  1N34 Q;  4LF6 L;  1OXT A;  1TWC H;  3PUV A;  3PV0 A;  4A3K H;  3PF5 A;  1PV4 A;  2UUA Q;  1SFO H;  2OQ0 A;  1XMO L;  1ASY A;  1X65 A;  2WP8 J;  4A3F G;  1Y1W H;  5IYB G;  1OXX K;  1WFQ A;  3HOX G;  2UUB Q;  1G29 1;  2ZTD A;  4DV4 L;  2I5M X;  3PUX A;  4BBR H;  5FJ8 H;  1A8V A;  3D0F A;  2E2J H;  2UUB L;  1OXU A;  2HIV A;  3K81 C;  3PSI A;  1GD7 A;  1VQJ A;  2FXQ A;  5M5X H;  4YCU A;  3AQQ A;  2JA6 G;  1P16 A;  4B3S Q;  3KYH C;  3ICE A;  5IWA L;  5GAH C;  3FKI H;  3PGZ A;  4BXX H;  1S3O A;  3CME A;  2K5N A;  1KRT A;  1PVO A;  4UP9 A;  4DPG A;  3I2Z A;  3L0O A;  1LUZ A;  1CKN B;  3CCJ A;  4DKA C;  4AYB G;  1GM5 A;  3HKS A;  4AQY Q;  2PI2 E;  3EIV A;  1L1O A;  3T1Y Q;  3E9H A;  3GD7 A;  3TQY A;  5IP9 H;  1PH8 A;  3CC2 A;  4GN4 B;  4K0K Q;  3G4S A;  1AH9 A;  4A3C H;  1J5E L;  1SLJ A;  2CWP A;  2YTV A;  2VL6 A;  1AE3 A;  4R4I A;  3M7N A;  3S1Q H;  3HOW H;  4IFD G;  1N33 Q;  2JA5 H;  4K0K L;  1IZ6 A;  2ES2 A;  4DV3 Q;  1E22 A;  4IPH A;  4GNX B;  2E2H H;  4HIM A;  1QZG A;  1T9H A;  3I4M H;  2F4V L;  1N33 L;  1X3F A;  3CPF A;  3KJO A;  4LF4 L;  3M4Q A;  2K52 A;  4DV3 L;  2IY5 B;  5GQO A;  4AIM A;  1XPR A;  2L15 A;  1EQR A;  1VQC A;  1Q86 C;  2JQO A;  4YHH L;  4QGU A;  1XPO A;  4A3L H;  1FL0 A;  3G6E A;  1Q82 C;  3S1N H;  1YZ6 A;  3GO5 A;  1KAW A;  3GDE A;  4GS3 A;  3RR5 A;  4C3I H;  2OCE A;  4QL5 A;  4QY7 A;  3A5U A;  4MZ9 A;  4DV2 Q;  1KXL A;  2RHS B;  1LYL A;  3JAM c;  1GO3 E;  1UE6 A;  2B29 A;  1VQD A;  2YTX A;  3KF6 B;  4JCV E;  2Z6K A;  3S1R H;  2V1C C;  1SRO A;  4TQU S;  1JJ2 A;  4L5S A;  2GVA A;  4LFC Q;  1HH2 P;  4A3E G;  1CKO A;  4JOI C;  4LWC A;  3SGI A;  4NXM Q;  2R92 G;  4WJ3 M;  2IHE A;  3A0J A;  1Q81 C;  3I4N H;  4JI1 L;  3S16 H;  4POG A;  3Q8D A;  5FLM G;  2BA1 A;  3MEF A;  4NXM L;  2HIX A;  1MJC A;  3W5O A;  4HID A;  4LNQ A;  5LMU Q;  3HOZ G;  1UE5 A;  1XMQ L;  2I0Q A;  4DV6 Q;  4A3D G;  2WB1 E;  5C4X G;  4GOP B;  4LUZ A;  5IYD H;  2IX1 A;  1BBW A;  3I4O A;  3BZK A;  3T1H Q;  1VQN A;  1FGU A;  1Z47 A;  4R4Q A;  2MNA A;  3L7Z C;  1N32 Q;  2C35 B;  1PFS A;  3T1H L;  3OW2 A;  3CQZ H;  1FJG Q;  4BA1 I;  5GAD C;  1EUJ A;  1KHI A;  2H5X A;  2UUC L;  4KHZ A;  4DV5 Q;  4B3M L;  2NZH A;  1D7Q A;  2K5V A;  1FJG L;  1J6Q A;  4APV A;  5EAY A;  1YIJ A;  3M3Y H;  4A3K G;  3PUZ A;  3CC7 A;  4DV5 L;  4JV5 L;  1XNQ Q;  1HNX Q;  5HY6 A;  2VQF L;  4IJL A;  3J80 c;  3I56 A;  1VQE A;  2BH2 A;  2VUM H;  2JA9 A;  1BBU A;  4DR4 Q;  2R93 H;  3F8T A;  2KCT A;  4X65 Q;  4DR5 L;  1HNX L;  1XNQ L;  3CD6 A;  1Q7Y C;  5JJI A;  4A93 H;  4DAM A;  2ZM6 Q;  4BBR G;  2HT1 A;  5FJ8 G;  2R7Z H;  1X55 A;  3K80 C;  1TWF H;  4X65 L;  2JA7 H;  4BBS H;  4DV7 Q;  2RHQ B;  4A3B H;  5C0X J;  3TRE A;  3H15 A;  5E7N A;  1R9T H;  4OO1 G;  2UXD Q;  1VQF A;  1XTD A;  2YTY A;  5J3B A;  4LFA Q;  3B6Y A;  3FKI G;  4O0A A;  3IRB A;  1VQ5 A;  2MO0 A;  4DV0 Q;  1V43 A;  3J81 c;  3PIO A;  3KJP A;  4DR1 Q;  1EIF A;  3GTM H;  1NMG A;  1SR3 A;  4LFB L;  4QJF A;  3KF8 B;  1A63 A;  2UXC Q;  3CPW A;  5M3F H;  3ULJ A;  3U58 A;  1XNR Q;  5C3E H;  2AMC B;  5DLQ E;  5HGQ A;  3I55 A;  4IJH A;  5IP9 G;  2YYZ A;  4DV1 L;  1N34 L;  1SN8 A;  4GN3 B;  1KRS A;  4IO9 A;  4A3C G;  1JB7 A;  2UUA L;  1IYJ B;  3HOW G;  1PH5 A;  2IHF A;  3TS2 A;  1HZC A;  3KLW A;  4L5T A;  4ME3 A;  4GLV B;  3I4M G;  3CCV A;  3K7U C;  3F2C A;  5GAG C;  2A1A A;  4JBW A;  2N8N A;  3U4V A;  1B8A A;  4DR6 Q;  4LF9 Q;  1M1K C;  4P75 A;  1OXS C;  4JI4 Q;  4JG2 A;  4IOC A;  2AWO A;  1I94 Q;  4JI3 Q;  4LF9 L;  4DR6 L;  1N8R C;  2N78 A;  1VQO A;  2B63 G;  4B3S L;  1JJG A;  2JA8 G;  2NN6 I;  1X3G A;  1I94 L;  5ELO A;  4OXP A;  3J80 i;  1MKH A;  3S15 H;  4PZ8 A;  4GLX A;  1WCM H;  1UEB A;  4PG3 A;  1YJ9 A;  1I3Q H;  4JOI A;  4L5R C;  5IT9 c;  1YBY A;  1Q1B A;  3E9I A;  3CW2 C;  4QQB X;  3I7F A;  1VQK A;  3S24 A;  2WB1 G;  3DM3 A;  4AQY L;  2K4K A;  3HOY G;  1BKB A;  1SE8 A;  3HOV G;  3T1Y L;  2IT1 A;  2KEN A;  4GNX C;  4B3T Q;  5C0X G;  4YWM A;  3ZJY C;  3ULP A;  4JBM A;  1HZA A;  2ALY B;  3KFU A;  1E3P A;  1VQI A;  5IYC H;  1JMC A;  2A8V A;  2JJQ A;  2NVQ H;  1B70 B;  4R4C A;  5IY0 A;  3J81 i;  4DK6 C;  2ZJP A;  4OWW B;  3BU2 A;  1HR0 W;  3I4N G;  3L2P A;  1YHQ A;  4KHP Q;  3F1Z A;  4OWX B;  1Y1V H;  2Y0S E;  3BJU A;  2VY3 A;  3F2B A;  3RLO A;  1MIU A;  2CWA A;  1U0L A;  3PO3 G;  3ULL A;  4Y7N H;  1G51 A;  4UP7 A;  4DR2 Q;  2Z0S A;  1N36 Q;  1K9M C;  1EWI A;  1D8L A;  4P72 A;  3CC4 A;  3UDF A;  5IYD G;  3UDX A;  1X9N A;  1PH3 A;  1YHB A;  3HKZ E;  2K14 A;  1TWA H;  2YV5 A;  5GRO A;  5AJ3 Q;  1L2F A;  2JEB I;  1UWV A;  3W1G A;  1YVC A;  4DUZ Q;  4IFD I;  2JEA I;  4DV2 L;  1Q8K A;  5IP7 H;  5FLX c;  1CUK A;  4C2M H;  5C0X I;  5C44 H;  1Q1E A;  3ER0 A;  1YIT A;  3AFP A;  2XGT A;  2JA6 H;  3DLL A;  1X6O A;  2MQH A;  1HZ9 A;  1MJE A;  2MO1 A;  4UP8 A;  2ZTE A;  1V9P A;  1QUQ A;  2Q2I A;  2LXJ A;  3GTG H;  4BY1 H;  2KCM A;  4LFC L;  2VUM G;  1NMF A;  2AKW B;  1E1T A;  1GVP A;  4IOA A;  4HIK A;  3KDF A;  1VQ7 A;  2UXB Q;  2ASB A;  4LUO A;  2R7D A;  3K7A H;  4GOP C;  2E5L Q;  4YWK A;  2JA7 G;  2R7Z G;  4BBS G;  3M9B A;  2F52 A;  2I5H A;  1OTC A;  1EFW A;  2NZO A;  1VCI A;  1YNX A;  3A5Z B;  1HNZ Q;  2OWO A;  5LMU L;  4H02 A;  3CXC A;  4HJ5 A;  4JI6 Q;  4JI7 Q;  3PO2 H;  4BA2 I;  2UXB L;  4DV6 L;  3J81 j;  2UXC L;  2JK8 A;  4JI6 L;  3HFZ B;  2MFI A;  4GKJ Q;  2PI2 A;  4A75 A;  5JJL A;  4B3R Q;  4C3J H;  2ZTC A;  4JI5 Q;  3GTP H;  4GLA C;  4GKJ L;  1N32 L;  1NTG A;  4R4T A;  4DR3 Q;  2JE6 I;  4JI5 L;  1W2B A;  2D62 A;  1L1O B;  2K5H A;  1I5F A;  2VW9 A;  3CCE A;  1I50 H;  1X56 A;  4X64 Q;  2EQS A;  1FVI A;  2QEX A;  1YJW A;  2E2I H;  4DR3 L;  2DGY A;  3GTK H;  3PUW A;  5M3M H;  2KHI A;  4IPC A;  1UE7 A;  4P74 A;  4OX9 Q;  1Y1W G;  1PYB A;  1Q46 A;  3OYY A;  4X64 L;  4A3J H;  4A3M H;  5LMN W;  4NPS A;  5ELN A;  2RF4 A;  1CKN A;  2OTL A; 
#chains in the Genus database with same CATH topology
 3NXW A;  3RLN A;  3JAM i;  4DR4 L;  2PZW A;  4JC0 A;  1O7Y A;  4B9X A;  3C3L A;  4B08 A;  1WTH A;  2RCN A;  4XT1 B;  4RGN A;  2CH4 A;  3PIP A;  2Q2U A;  2EJF C;  5IOC A;  2PMZ E;  2LSS A;  2AQ1 B;  1IBM Q;  2NVX B;  1CFM A;  1LTL A;  4KY6 A;  4PZ7 A;  3A7A B;  3CAM A;  4IUT A;  2E8G A;  1PLF A;  1QE6 A;  1NR2 A;  5CBA E;  4DNI A;  5K36 G;  1LT5 D;  2Z4I A;  5M5Y B;  3TRZ A;  3SR1 A;  4F7X A;  4UPA A;  3AU7 A;  4PMW A;  4LF8 Q;  2B3G A;  1ENA A;  3F2D A;  3NEM A;  5FO9 B;  2Z4H A;  3TZD A;  2K5W A;  5EKL A;  2B39 A;  1B3A A;  4A3I B;  4HJ9 A;  1JOK A;  2EIF A;  1H9S A;  4A3L G;  1SFO B;  3EBE A;  4JI3 L;  1PHJ A;  1BCP F;  4XQQ A;  1IBL Q;  2L11 A;  3LWE A;  3VYR A;  4YY3 Q;  2VZA A;  3T53 B;  1IBL L;  1CSP A;  3H0G H;  1FNW A;  3C1F A;  1JWM D;  4YY3 L;  1K3R A;  4CDE C;  1STY A;  4J8Q A;  3D3R A;  3J7A 5;  4XTC S;  2F3I A;  4KI0 A;  4A4I A;  1Z6H A;  4IZ8 A;  1DOM A;  3MAQ A;  4GOP A;  4WJ4 A;  2EYO A;  2BA0 A;  2PQE A;  3X3N A;  2XN9 C;  2PCF B;  3S1M H;  1CA6 A;  1CSQ A;  1BNZ A;  4LF7 Q;  1RL2 A;  1K83 B;  5ELC A;  1J5E Q;  4E6I A;  4LF7 L;  2ATW A;  3HG9 A;  1N36 L;  1I4P A;  5EPL A;  2UU9 Q;  3HOX B;  2ZXO A;  1PRT D;  1G91 A;  2F4V Q;  4LF4 Q;  1VQ4 A;  4IPG A;  2L12 A;  3I72 A;  2UU9 L;  3RN2 A;  4JI2 Q;  3VA7 A;  1K0R A;  2QF7 A;  2ZJQ A;  1HZB A;  4DUZ L;  5C5M A;  4JI2 L;  1QB5 D;  3QO2 A;  3EVQ A;  3K5L A;  1I4R A;  5JOB A;  2JA8 H;  3MTS A;  4P2C B;  2R93 G;  1E2Z A;  1HCZ A;  4JI0 Q;  4A93 G;  2D0P A;  3U9S A;  3HZX A;  4XDX A;  3AFQ A;  4H13 C;  5LL6 S;  4JI0 L;  1S5B D;  3U50 C;  1C7Y A;  5C4Z A;  1U4L A;  3RZD H;  2E5L L;  3PF4 A;  4NB3 A;  3GTL H;  1RCV D;  1SNP A;  1WTR A;  1EWH A;  2B2U C;  4JI7 L;  4JI1 Q;  3NQI A;  2QIL A;  1TWH H;  3DWP A;  3EFX D;  1QIL A;  2K50 A;  4X3T A;  3TP5 A;  4X66 Q;  1IHZ A;  3PO3 B;  4IN3 A;  4X66 L;  4KY7 A;  3CMA A;  3GTJ B;  1ZEQ X;  3PCO B;  1DJR D;  4UAI A;  3M4O H;  4M1U B;  4OX9 L;  1B7Y B;  1V1Q A;  1CQF A;  1B4O A;  1SRU A;  3C1E A;  2UUC Q;  4RHS A;  1NY4 A;  3VR6 A;  3MXG A;  5CC4 A;  1J9O A;  1VQH A;  2HDL A;  3GTQ B;  1F2Z A;  4WJW A;  2CFM A;  3J7Z C;  3UDG A;  1VQL A;  2R92 H;  1TWG H;  1A15 A;  3FMC A;  2OXP A;  1C9O A;  4JI8 L;  5IE8 A;  2NVX H;  2VQE Q;  1XX8 A;  2AUK A;  1G2S A;  1HJP A;  2VQE L;  5T1G A;  2K75 A;  5JEA G;  5HGT A;  4Y52 H;  3TZU A;  3PQI A;  5KIX A;  5M5Y H;  4LFB Q;  3LNN A;  5IT9 L;  1EY6 A;  1AE2 A;  3RN5 A;  2YU9 B;  1PRT C;  2FJ2 A;  3D4R A;  4KKS A;  2M9V A;  4ODG A;  1Z9F A;  4LAA A;  1XMO Q;  4PV1 C;  4RMF A;  2J0T D;  1ZKO A;  3PUV A;  1PV4 A;  1GXD C;  2Z1C A;  1SFO H;  1XMO L;  2F0I A;  2F0Q A;  1HUN A;  2UUB Q;  2E2J H;  2UUB L;  2EYF A;  3K81 C;  1EYC A;  4YCU A;  1P16 A;  4B3S Q;  3RMH A;  3VR5 A;  2QEJ C;  1RTO A;  2K5N A;  1JC7 A;  4O42 A;  4KJO A;  1PDQ A;  4DPG A;  3I2Z A;  3L0O A;  1CKN B;  2JSO A;  2B2U A;  5FLX L;  3HKS A;  2RBM A;  1ML0 D;  1WD0 A;  4F8M A;  1SNQ A;  2O2L D;  4R8N A;  3P75 A;  3S1Q B;  4HSP A;  3HKZ B;  1GHJ A;  4GN4 B;  4MIU A;  3G4S A;  3BS1 A;  2KEE A;  2JA5 B;  1SBB B;  3FPP A;  5K36 H;  1I4Q A;  1N33 Q;  1ICF B;  3I90 A;  4Q5V A;  1JOR A;  1E22 A;  4IPH A;  1QZG A;  1T9H A;  2A74 C;  1N33 L;  2F0U A;  2IY5 B;  4Y7N B;  1XPR A;  3SK4 A;  3HRZ C;  1SDF A;  1EQR A;  4ZRZ A;  2DY8 A;  2JQO A;  4A3L H;  1LTB D;  3S1N H;  3MXN A;  4DAP A;  1JIC A;  1GUW A;  3J80 E;  4MZ9 A;  4DV2 Q;  1DZ1 A;  1KXL A;  2RHS B;  1LYL A;  4HCE A;  1UE6 A;  5C44 B;  1VQD A;  2IW3 A;  3D4W A;  4JCV E;  5ELB A;  3BDC A;  3CU7 A;  3OW7 A;  4NKL A;  4YIJ A;  3PIO 3;  4NXM Q;  4BY1 B;  2IHE A;  3A0J A;  1H9J A;  4POG A;  3GQB A;  2BA1 A;  4NXM L;  2DNE A;  2R61 A;  3SK5 A;  4LNQ A;  4HID A;  4C3H G;  5LMU Q;  4JW0 A;  3HOZ G;  3PO2 B;  5C4X G;  1T5E A;  1SNO A;  2MHV A;  3I4O A;  1Y8O B;  3BZK A;  4O1N A;  2QKI C;  4R4Q A;  4C3J B;  3L7Z C;  2GA4 B;  3CQZ B;  4MHE A;  4BA1 I;  2DJF C;  4KHZ A;  1GUN A;  1D7Q A;  2K5V A;  4NDX A;  5EAY A;  2P5Z X;  3M3Y H;  2HCI A;  4A3K G;  2A6H D;  1XNQ Q;  1YNJ D;  5JVH 3;  1O7L A;  4IJL A;  3J80 c;  3TSS A;  1VQE A;  1S5E D;  2R93 H;  2F0N A;  1I4G A;  3OMG A;  2KCT A;  4X65 Q;  1XNQ L;  1Q7Y C;  4A93 H;  2JA7 B;  1U4M A;  2RCF A;  1QJO A;  4OHJ A;  4DNT B;  5FJ8 G;  4X65 L;  4A3B B;  1KDC A;  4BY7 B;  5KGU A;  4OO1 G;  3VR2 A;  3TRE A;  3H3V C;  1VQF A;  1XTD A;  4LFA Q;  4JK1 C;  4DR1 Q;  1SR3 A;  1S5D D;  3K6O A;  4QJF A;  5KNB A;  1CZG A;  3BDL A;  3ULJ A;  3U58 A;  3I55 A;  1C8C A;  5IP9 G;  4GN3 B;  4IO9 A;  1JB7 A;  4HAE A;  2FFK B;  2UUA L;  3HOW G;  3S9W A;  4XXE A;  4GLV B;  3I4M G;  3CCV A;  3F2C A;  3M7G A;  3U4V A;  1B8A A;  4ZKC B;  1M1K C;  4P75 A;  3NUC A;  4K6L A;  4IOC A;  2CW0 D;  1GUG A;  2IWH A;  1VQO A;  4TSS A;  3HOU B;  4A3G B;  2F0P A;  1B2T A;  3Q23 A;  2F0H A;  1I3Q B;  1UEB A;  1F2Y A;  4C56 C;  1C4Q A;  4U67 3;  4RGM A;  1YBY A;  4H44 C;  1KNE A;  4QQB X;  4AQY L;  2K4K A;  3HOY G;  3HOV G;  1MHW C;  4GNX C;  2EY5 A;  5JEA H;  3KK7 A;  3ZJY C;  5E4X A;  1F77 A;  5CMD A;  4IUV A;  3WOE A;  5IGF A;  3MXP A;  4DK6 C;  4OWW B;  3BU2 A;  1HR0 W;  1YHQ A;  4OWX B;  3BJU A;  2LFN A;  4FF1 A;  3D8G A;  1U0L A;  3C2P A;  4Y7N H;  5TSS A;  4DR2 Q;  3QJY A;  2Z0S A;  1K9M C;  4G4K A;  2NVT B;  1EWI A;  1D8L A;  3VA5 A;  1QOH A;  3MVV A;  1PH3 A;  3HKZ E;  2YV5 A;  5GRO A;  1AN8 A;  5AJ3 Q;  4RKB A;  2B8F A;  4QCL A;  2F0M A;  4RA8 A;  5CV8 A;  1YNJ C;  1HQR D;  1Q8K A;  1V8Q A;  5IGC A;  5C44 H;  1PTO D;  1STA A;  1YIT A;  1JOO A;  2WIN B;  4N9T A;  2LXJ A;  5J1Z A;  2EOT A;  4BY1 H;  2KCM A;  4AYB B;  4MTK A;  5FO8 B;  1ZYR D;  4IOA A;  1CZW A;  2R7Z G;  2A68 D;  4BBS G;  1STN A;  4JI6 Q;  2OWO A;  4BA2 I;  3PO2 H;  3CXC A;  4HJ5 A;  3J81 j;  2JK8 A;  4JI6 L;  2A6E D;  2PI2 A;  4C3J H;  1E2W A;  1NTG A;  3CKI B;  3NPP A;  2JE6 I;  4IUP A;  4L8J A;  3HGB A;  2VW9 A;  1I5F A;  1I50 H;  1FVI A;  2RDF A;  3GTK H;  2WV6 D;  2KHI A;  4IPC A;  1UE7 A;  4P74 A;  1Y1W G;  1I4X A;  2CW0 C;  2KVM A;  5LMN W;  1E0B A;  3K5N A;  2B2W C;  5IGG A;  2RF4 A;  1PZJ D;  4N8F A;  2SNM A;  5E3F A;  3NHH A;  5KYI A;  4BY7 H;  4C1N K;  1DM0 B;  3T16 A;  4DV7 L;  1PXU A;  2UXD L;  4DR7 Q;  5CV6 A;  4DK3 C;  2ENB A;  1EIG A;  4GNX A;  4DR7 L;  5BR8 Q;  1PFB A;  3ERO A;  2Y0S G;  4OWT B;  1OXV A;  2NVY B;  4UDU C;  4G57 A;  1QG7 A;  5DAU A;  3K0X A;  1XPU A;  1YI2 A;  2RSN A;  3HOZ H;  5C4X H;  1VQ9 A;  3QR8 A;  2IJ0 A;  4GKK Q;  1FGB D;  4FNF A;  1TVX A;  2WAQ E;  3CCM A;  5A2Q E;  1LTR D;  5CV4 A;  4YCW A;  1EIY B;  4GKK L;  4OIJ A;  2KBN A;  1LM0 A;  3OIQ A;  3OOC A;  5JJK A;  1CT1 D;  2OQK A;  1SYC A;  4PNY A;  2LXK A;  1Y1V G;  3KF6 A;  1CTM A;  1NE3 A;  1PTO C;  1SAP A;  2X6L A;  4P73 A;  3HOU H;  4A3G H;  4DV4 Q;  1CM9 A;  1QWY A;  1VF7 A;  4JVZ A;  5E1F A;  1F9P A;  3VDY A;  1YJN A;  1EYD A;  1YEZ A;  2CCZ A;  2HD3 A;  5M5X B;  4O2D A;  5IWA Q;  3S2H H;  4OO1 H;  1MSG A;  4DK0 A;  2EXZ A;  3M85 A;  4ZYS A;  5EBD A;  1GKH A;  4B3T L;  1UE1 A;  1PTO F;  1SEB D;  1PH6 A;  3S1M B;  1HNW Q;  4ABN A;  2A6E C;  2QA4 A;  1X3Q A;  2NN6 H;  2N49 A;  2IX3 A;  1HNW L;  2G9H D;  4QB4 A;  2NVT H;  4R9W A;  2VB2 X;  1HPC A;  2Z8L A;  1QVG A;  1EYG A;  3DWQ A;  4A3F H;  4LJZ C;  3CCR A;  5IYB H;  1K0S A;  5C3X A;  1WTP A;  4XQN A;  3SEB A;  1Q8I A;  2KHJ A;  3TP7 A;  2EZV A;  4RHR A;  2B2W A;  4ZQ3 A;  4YHH Q;  2K1B A;  3NBI A;  3G48 A;  1VQ8 A;  2JA8 B;  2HQL A;  1VQG A;  4BWG B;  4V0B A;  3MFG A;  3JC6 6;  3D31 A;  1BVS A;  2RKS A;  1QVC A;  3K5M A;  5JEA J;  3GTO H;  1SYB A;  3K59 A;  1JWU D;  4EQO A;  5H1S E;  3GTL B;  3HOY H;  1HQM C;  3NEN A;  3HOV H;  3J80 L;  3NQT A;  4IUU A;  3TN2 A;  2L0C A;  4IQZ A;  4RH6 A;  1TWH B;  3EA6 A;  5I9P A;  3MXU A;  4OEL B;  4F88 A;  1LTS D;  2F0W A;  4KMU C;  4LUV A;  4B3R L;  4R4O A;  4KN4 C;  4AYB E;  4JPB W;  4KK7 A;  5C3E G;  4NMZ A;  2O4X A;  3RZO H;  5COY A;  4ULL A;  1ENC A;  4L5Q A;  3RLF A;  4EQP A;  3QB3 A;  1XXG A;  3AMU A;  3FDT A;  2IX0 A;  3NBH B;  1QVF A;  1OO9 B;  4B3M Q;  2B2V C;  2PNR C;  3H09 A;  2EYJ A;  1I6H H;  1ILQ A;  4MNO A;  2R92 B;  4A3I G;  2VQF Q;  1UAP A;  3WWV A;  1WYD A;  1TWG B;  4A3E H;  1MGS A;  2VUM B;  5COR A;  2WII B;  4JBK A;  4DXG A;  5FLM H;  1HUM A;  2NVY H;  5J22 A;  2L4N A;  1IBM L;  2FMM A;  1D5X C;  1LT3 D;  1R9T B;  1PMR A;  2VNU D;  2AHO B;  2J7Z A;  1ZXT A;  4HN7 A;  3H3V H;  5T1I A;  3VYU A;  4X3U A;  3QIA A;  4DFA A;  2F0K A;  1WTW A;  5NUC A;  1Y69 U;  4LF8 L;  2VS1 A;  3UI2 A;  1BDO A;  4DV1 Q;  4DXF A;  1OXT A;  1DXM A;  4RFB A;  1Y1W H;  3HOX G;  4PMB A;  1VMP A;  2ZTD A;  2C5C A;  2E2J B;  4BBR H;  1SSO A;  3JAM E;  1SYF A;  2FIN B;  2HDM A;  2FXQ A;  3IFT A;  4ZCK A;  5M5X H;  3AQQ A;  3IL8 A;  2JA6 G;  3KYH C;  5GAH C;  3FKI H;  3CME A;  1PVO A;  1GM5 A;  3A56 A;  4DU9 A;  2PI2 E;  1B3Q A;  3T1Y Q;  1HRJ A;  3GD7 A;  1PH8 A;  3CC2 A;  3I8Z A;  1HFG A;  3T56 B;  4K0K Q;  4X3S A;  1J5E L;  2VL6 A;  1AE3 A;  1RTN A;  3KLS X;  4IFD G;  3TBI B;  2F3V A;  4K0K L;  5ISR A;  1IZ6 A;  2DN8 A;  4DV3 Q;  4HIM A;  2F4V L;  3LX0 A;  2L55 A;  4I7A A;  5A35 A;  4LF4 L;  2AQ2 B;  4DV3 L;  5GQO A;  1A3U A;  2EY2 A;  1KNA A;  1Q86 C;  1WTV A;  5IGD A;  2KUM A;  3S1N B;  4WRD A;  1Q82 C;  3Q24 A;  3RR5 A;  1KAW A;  3RD4 A;  4QL5 A;  4QY7 A;  1U9R A;  1A6X A;  3A7L A;  4KY5 A;  3JAM c;  1RHP A;  4K2L A;  3QOJ A;  2V1C C;  1CHQ D;  2X6G A;  1SRO A;  1H9S B;  2EYM A;  4L5S A;  3E0J A;  3I4N H;  4JI1 L;  4GZY C;  2XWB B;  4L63 B;  1VMC A;  1UE5 A;  2D5D A;  4DA2 A;  2I0Q A;  4DV6 Q;  4A3D G;  4GOP B;  1FD7 D;  1BR9 A;  1UEA B;  1AFP A;  1Z47 A;  1DOL A;  1PFS A;  3C46 A;  3Q0A A;  1FJG Q;  1DD2 A;  2UUC L;  1JQY D;  3MWY W;  2K6A A;  3M3Y B;  1FJG L;  5EQ0 A;  3VYT A;  3N52 A;  4S3S A;  2R93 B;  2VUM H;  1PZI D;  5EJW A;  1MD2 D;  3F8T A;  1HTP A;  3VR3 A;  4A93 B;  3CD6 A;  1BUV T;  2ZM6 Q;  2HT1 A;  1TWF H;  4KHV A;  1R9T H;  4RWS C;  1CHP D;  4RAU C;  1D6E C;  3E3X A;  2YTY A;  3B6Y A;  1CQV A;  4O0A A;  1VQ5 A;  2RQX A;  4DV0 Q;  3R2T A;  3KJP A;  1XYI A;  4LFB L;  4CKE A;  1A63 A;  4KTA A;  3CPW A;  1XNR Q;  2KCN A;  2AMC B;  5C3E H;  5HGQ A;  2RA4 A;  4I7Z C;  1O80 A;  1KRS A;  4A3C G;  1G6Z A;  3A54 A;  1BCP B;  4ZK9 B;  2K7V A;  3R2I A;  3KLW A;  1Z7T A;  3K7U C;  2A1A A;  2N8N A;  1PRT F;  2O5I C;  1NNX A;  4JI4 Q;  1LV9 A;  4JG2 A;  2AWO A;  3IFD A;  5A2Q L;  5KEE A;  2B63 G;  4B3S L;  2NN6 I;  3G7L A;  3D6W A;  4CHT B;  5ELO A;  3J80 i;  4C3I G;  1MKH A;  4PZ8 A;  4GLX A;  5IIF A;  1PTO H;  5I2Y A;  1Y8N B;  3E9I A;  3IAY A;  4QMG A;  2WB1 G;  3NWT A;  4IUQ A;  1SE8 A;  4DAV A;  4YWM A;  4JBM A;  1HZA A;  2ALY B;  4PMC A;  3W3A A;  1VQI A;  1BF4 A;  2JJQ A;  4H7B A;  3Q6S A;  2ZJP A;  4KHP Q;  4QIW B;  3F1Z A;  1TS4 A;  4G7O C;  3RLO A;  1MIU A;  1FR3 A;  1G51 A;  5G3L D;  1EOT A;  5IYD G;  1SNM A;  1SE2 A;  1TWA H;  2JEB I;  2ZXR A;  5I9O A;  4NP5 A;  1UWV A;  3R93 A;  3W1G A;  1YVC A;  2PZU A;  4DV2 L;  2JEA I;  1CUK A;  2XRQ D;  2A5H A;  3PIP 3;  1A2T A;  2JA6 H;  3DLL A;  1X6O A;  1MJE A;  1S4Z A;  3CRK C;  2MO1 A;  1QCB D;  4IUR A;  1MI2 A;  2Q2I A;  3GTG H;  1WTQ A;  3ZYY X;  1BOS A;  3KDF A;  2UXB Q;  1YNN D;  2ASB A;  4YWK A;  2JA7 G;  2JP1 A;  2KHS A;  2F52 A;  2I5H A;  2UXC Q;  1HNZ Q;  2UXB L;  5LMU L;  2UXC L;  2CVR A;  4QF4 A;  2MFI A;  4HED A;  1JOQ A;  2XIW A;  4ILW A;  1GOZ A;  3HS0 C;  3GTP H;  1JCK B;  2F0L A;  3KUP A;  1I50 B;  3T4A C;  3J7A V;  1W2B A;  2D62 A;  4CGY B;  5C3W A;  3GTK B;  4XYO A;  1X56 A;  2QEX A;  1YJW A;  3OMC A;  2DGY A;  2SOB A;  2MP1 A;  3P1H A;  3L3O C;  2SEB D;  4WFN 3;  4HCS A;  4XYQ A;  1SND A;  2O5J C;  1KD1 C;  3STB D;  3KOJ A;  3FHW A;  1AP0 A;  2NWG A;  2WFW A;  3K0Y A;  1TKW B;  2WAQ B;  1MSH A;  4AH6 A;  4FO2 A;  2AWN A;  4ZLT F;  1M90 C;  3KLR A;  3G71 A;  4BXX G;  4LFA L;  2Q8I B;  3MXN B;  3J7Y W;  4DUY Q;  4ME5 A;  1L0W A;  1WCM G;  4QUC A;  4DR1 L;  3UDI A;  2LY7 A;  4DUY L;  2EPB A;  4C3H B;  3HOZ B;  2NBF A;  4HIO A;  1S5F D;  5C4X B;  1KDB A;  2BH8 A;  2ICE C;  2MUY A;  4A3D H;  3D6C A;  4FF2 A;  1X3E A;  3S14 B;  1DOK A;  1I4H A;  4YCV A;  4A76 A;  1KL9 A;  2EE1 A;  3W1B A;  1WTO A;  3AEV A;  1IL2 A;  1D2B A;  4LF6 Q;  3CCQ A;  1PRT B;  2JYO A;  2PQA A;  1IBK Q;  1TWC B;  4A3K B;  3SE0 A;  2QGQ A;  1IBK L;  4OON A;  1U5K A;  1E2V A;  1JJC B;  1A0I A;  3L9A X;  4ZUI A;  1SXT A;  1CK1 A;  1KTK A;  1QNU A;  5CBE E;  4YWL A;  1WI5 A;  3CRL C;  2R6G A;  4HSV A;  5D3D A;  4FYD A;  2M00 A;  5IP7 G;  3I73 A;  3S2H B;  1VQP A;  4RGT A;  2EXD A;  1STB A;  1YNN C;  4HJ8 A;  2OF1 A;  3NP8 A;  3R3O A;  3T13 A;  1G6P A;  1SYD A;  2WAC A;  2F1M A;  2ID0 A;  2CQA A;  3JAM L;  1K8G A;  1NBW A;  2D0O A;  2ZJR A;  1S40 A;  1PH9 A;  4LF5 Q;  2XVS A;  4A3F B;  3H6M A;  4DR2 L;  5DM6 3;  1JE4 A;  2OT2 A;  4LF5 L;  4KLK A;  2A6H C;  3I4M B;  2E2H B;  4M8A A;  2G9D A;  5AJ3 L;  1IW7 D;  4G7H C;  1EQV A;  3E0E A;  1RIP A;  4QIW E;  1WVL A;  3STB C;  4X3K A;  3OTO Q;  4CDC C;  3UE0 A;  5M3M G;  1RD9 D;  3OTO L;  2F0V A;  3CCL A;  2B63 H;  5EPJ A;  4A3J G;  4HJ7 A;  4K8I A;  4A3M G;  2L1B A;  3V05 A;  3M4P A;  3A74 A;  5C4J H;  1E1O A;  3CF5 A;  3GTO B;  2N55 A;  3S1R B;  3HOY B;  1ICW A;  1O78 A;  4GN5 A;  3HOV B;  2PQA B;  1F2L A;  3S17 H;  1SYE A;  1AZP A;  3S16 B;  2KQ3 A;  1YHA A;  1L1O C;  1S72 A;  5M3F G;  1XMQ Q;  2GN5 A;  2AQ3 B;  2K03 A;  3RZO B;  2HUG A;  1K3B C;  2QCP X;  4RGO S;  4UHV A;  3TDQ A;  1FNV A;  2DUD A;  4OEM B;  3S2D H;  1UNS A;  4CJ1 B;  5FKA C;  2PZT A;  1NJI C;  2LS0 1;  3I91 A;  4X6A H;  5I4D A;  3FEW X;  5JPM C;  4ZKB B;  5JVG 3;  2K01 A;  1TR5 A;  1I6H B;  1PH4 A;  3MHB A;  3CCS A;  1EU3 A;  4JV5 Q;  1Y14 B;  4A3E B;  1EIH A;  1V1O A;  5FK9 C;  2NB0 A;  4DR5 Q;  3TEH B;  5CGK A;  1KIX A;  5C6A A;  2I46 A;  3R8B A;  2Z6K C;  3DWA A;  5BR8 L;  2PYK A;  2HQE A;  5M5W H;  3H0G G;  4C3H H;  4IFD J;  3M4Y A;  1A62 A;  1B9M A;  3S14 H;  5IYC G;  1VQA A;  4UY8 C;  3CP0 A;  1K8A C;  5F2D A;  1EY8 A;  3A55 A;  2TMP A;  3EN2 A;  1E24 A;  1S5C D;  2NTS A;  1IW7 C;  4LK1 C;  4PZ6 A;  2K33 A;  2KJX A;  1N34 Q;  1TWC H;  3PV0 A;  4A3K H;  3PF5 A;  1Y1W B;  2OQ0 A;  1X65 A;  2WP8 J;  1OXX K;  2B2Y C;  4BBR B;  2N88 A;  1STG A;  4DV4 L;  2EJM A;  3PUX A;  1O7Z A;  5FJ8 H;  3D0F A;  1EEI D;  1OXU A;  1ZYR C;  3MA2 B;  2R3Z A;  3FKI B;  2A68 C;  5IWA L;  3PGZ A;  4BXX H;  1S3O A;  1BBX C;  1IYU A;  4UP9 A;  2Y0S B;  1LUZ A;  2XSC A;  3EIV A;  5CV9 A;  1L1O A;  3E9H A;  5IP9 H;  1AH9 A;  1SLJ A;  2CWP A;  3M7N A;  3HOW H;  1H9R A;  4GNX B;  3I4M H;  2QDL A;  2E2H H;  1Y1V B;  3CPF A;  3KJO A;  2K52 A;  1EYA A;  4AIM A;  1BCP D;  2KCC A;  1VQC A;  4YHH L;  2CHB D;  4QGU A;  1XPO A;  3G6E A;  2VB3 X;  1YZ6 A;  3GO5 A;  1TU2 B;  3J7A F;  4R8I A;  4XT3 B;  2H1E A;  3KF8 A;  1AEX A;  4C2M B;  2B29 A;  3KF6 B;  2Z6K A;  3S1R H;  2PPB C;  2F0F A;  5I6Y A;  2GVA A;  4LFC Q;  1HH2 P;  1G8Z D;  1CKO A;  2BDN A;  2R92 G;  3I4N B;  4K2K A;  3MFY A;  1TS2 A;  3J81 E;  3S16 H;  1GUT A;  5D14 A;  2V4D A;  5C4H A;  1TS3 A;  2HIX A;  3W5O A;  4K5W A;  4LUZ A;  4CJ2 C;  1BBW A;  3KBX A;  2A69 D;  1VQN A;  1WTX A;  1FGU A;  4RKL A;  1N32 Q;  2C35 B;  4IAL A;  1LTG D;  2B2Y A;  5GAD C;  2WKC A;  1AW7 A;  4DV5 Q;  3E5S A;  2NZH A;  4B3M L;  1YIJ A;  2E2I B;  1D5Z C;  4DV5 L;  1X3P A;  5DNF A;  1AZQ A;  2VQF L;  3SVM A;  3I56 A;  1Q3L A;  1EWC A;  2BH2 A;  5JPN C;  4DR4 Q;  1BBU A;  5JJI A;  3DXJ C;  3G6J B;  4EVO A;  1TWF B;  4DAM A;  1RKN A;  2R7Z H;  2I07 B;  1X55 A;  3K80 C;  4BBS H;  2JN4 A;  2RHQ B;  1EY0 A;  3H15 A;  1F9S A;  3ND9 A;  5J3B A;  1EY7 A;  3X3M A;  3IRB A;  2MO0 A;  1V43 A;  3J81 c;  3PIO A;  3GTM H;  4OGQ C;  2Q8T A;  3KF8 B;  3BVZ A;  3WDN A;  5C3E B;  5M3F H;  5ELE A;  2HCC A;  5DLQ E;  4TRD A;  3H94 A;  4DV1 L;  1TT2 A;  1BCP C;  1SN8 A;  1EY9 A;  1IYJ B;  2F3W A;  4KD3 A;  2RSO A;  3CHB D;  2EDG A;  1KAB A;  4DR6 Q;  5C5L A;  5EGT A;  3OHX C;  1JB3 A;  4DR6 L;  1I94 Q;  4JI3 Q;  2F0G A;  2N78 A;  3FPU B;  1JJG A;  1I94 L;  4BS9 A;  1PTO B;  4OXP A;  1B44 D;  3NE5 B;  3GP7 A;  4FF4 A;  2SNS A;  2Z6B A;  1SJE D;  4DGZ A;  2BCO A;  1A3T A;  1X32 A;  1BKB A;  3T1Y L;  2IT1 A;  2KEN A;  2EYH A;  3BG3 A;  3BVM A;  4K5V A;  5C0X G;  1SNC A;  1DCZ A;  5IYC H;  3I3C A;  2NVQ H;  1B70 B;  1R4Q B;  5IY0 A;  3GV3 A;  2VXW A;  4LMQ D;  4Z9C B;  2A69 C;  1Y1V H;  2Y0S E;  4CDD C;  3F2B A;  3PO3 G;  1U4R A;  1HHV A;  4UP7 A;  2B2V A;  1N36 Q;  2MPM A;  3TME A;  4P72 A;  1V1P A;  3CC4 A;  1Q90 A;  4K8J A;  3UDF A;  1TWA B;  2X69 A;  4DK1 A;  4FXK C;  4DUZ Q;  2AUJ D;  4C2M H;  2XNA C;  2ZT9 C;  2MJ8 A;  5E4W C;  1LO5 D;  2JA6 B;  3K5O A;  2K32 A;  3AFP A;  2E74 C;  2XGT A;  4KJN A;  3Q22 A;  2MQH A;  5JAV A;  1HZ9 A;  3GTG B;  2ZTE A;  1QUQ A;  1L0Y B;  1KAA A;  3HP3 A;  1NMF A;  1E1T A;  1GVP A;  2B8G A;  2D9U A;  4HIK A;  1VQ7 A;  1LTI D;  2R7D A;  3K7A H;  2E5L Q;  1TII D;  3M9B A;  1OTC A;  1PFM A;  3A5Z B;  1XWE A;  4H02 A;  3K57 A;  4JI7 Q;  2Z9H A;  4DV6 L;  4A75 A;  3GTP B;  2ZTC A;  4DAY A;  1K8M A;  1IKL A;  2F0S A;  2KOL A;  4R4T A;  2ICI A;  4DR3 Q;  1MBY A;  3AB9 A;  2K5H A;  2KEC A;  2EQS A;  1EQT A;  1LTT D;  2E2I H;  1SYG A;  4DR3 L;  3PUW A;  4CKB A;  4OX9 Q;  4K6D A;  2K5Q A;  4PQX A;  4HTH A;  1U4P A;  2F0T A;  1CKN A;  4N8X 1;  5L37 A;  1CA5 A;  4X62 Q;  1LTA D;  2J4X A;  2K04 A;  2ZM6 L;  4KN7 C;  3TS0 A;  2XWJ B;  1A2U A;  1JT8 A;  4X62 L;  1IYV A;  1LT4 D;  2K28 A;  1V1P B;  4POF A;  4CBV A;  4JI8 Q;  4EX5 A;  4DV0 L;  1Q12 A;  1HR0 Q;  3CCU A;  4JYA Q;  3QWN A;  2CH4 W;  1HR0 L;  3NEL A;  4A3D B;  4CKC A;  4JYA L;  1XNR L;  1T5X D;  3AYH B;  4R1J A;  5LL6 X;  4NXN Q;  3HKZ G;  2OEO A;  2JA5 G;  2N3S A;  4OO1 I;  4NXN L;  1C0A A;  3K8A A;  2EYP A;  2I5L X;  1QUQ B;  4RCO A;  4N9P A;  2Q2H A;  4EQ5 A;  1NCV A;  1F2M A;  2Q8R E;  4Q0F A;  4A3I H;  1PYW D;  2D2C C;  4JI4 L;  1VQ6 A;  3LGJ A;  3NWS A;  1F9R A;  4DN4 M;  1EL0 A;  3ERS X;  1VS0 A;  2OTJ A;  4DAY B;  1H95 A;  3F2U A;  3A8J E;  1PH1 A;  5C44 G;  1KQS A;  2NUC A;  4EQN A;  4IPD A;  1QZH A;  1BO0 A;  1DON A;  3IKJ A;  1W3S A;  4KKU A;  3NK9 A;  4BY1 G;  4ALP A;  1KC8 C;  1VQB A;  3BZC A;  4KHP L;  1W6K A;  3A8K E;  1ESR A;  1K83 H;  2C9O A;  3KBG A;  3E6Z X;  2EY1 A;  4FDB A;  1PH7 A;  3PO2 G;  3EQL C;  3LWU A;  2L9H A;  2A19 A;  1EQQ A;  1PFN A;  3HOX H;  5LMN Q;  3FP9 A;  4C3J G;  1H9M A;  4KD4 A;  4C1N I;  5LHY 1;  5LMN L;  4RG1 A;  2B2T C;  2NZ1 D;  5GAE C;  1VF5 C;  4HMJ A;  1PA6 A;  3U4Z A;  3URY A;  2B63 B;  2K5D A;  3NTK A;  1O7I A;  3PUY A;  3U9O A;  4C3I B;  2RVL A;  4JBJ A;  5C4J B;  2BDO A;  1HA6 A;  2Q2T A;  1X54 A;  2WB1 B;  1TS5 A;  1TXY A;  1P8L A;  4NW2 A;  4A3B G;  3S17 B;  5FO7 B;  1ASZ A;  3V2T A;  3QG1 A;  1WJJ A;  4BY7 G;  1CKM A;  1DYQ A;  2WAQ G;  1HNZ L;  1QNK A;  3ND8 A;  4J1M A;  4IFD H;  5C0X H;  1EOV A;  4HR7 B;  2CKZ B;  5KNC A;  4U68 A;  2EJG C;  1ONL A;  1IXR A;  2XTI A;  1KDA A;  1IKM A;  2NTT A;  1FNU A;  3PO3 H;  5CV5 A;  3S2D B;  2HHH Q;  1SMX A;  1XJV A;  3GTJ H;  2R7F A;  2LMC B;  3J81 L;  2HHH L;  4MTN A;  5EBC A;  1N9W A;  1WOC A;  1BQQ T;  3BYT B;  3FRP B;  2A73 B;  5IGE A;  3H3V I;  5CV7 A;  3GV6 A;  2PNH A;  4J15 A;  1PYS B;  1K73 C;  4TVA B;  3RNU A;  4XQJ A;  1J8I A;  3GTQ H;  3PMF A;  2PW7 A;  3ERQ A;  1DGS A;  3HOU G;  4A3G G;  1PH2 A;  4XIG S;  1EY4 A;  2GVB A;  3BDO A;  5M5W B;  2BE5 D;  4V19 0;  2CQO A;  1VQM A;  1JE5 A;  1SMY D;  1LLR D;  1ILP A;  2DNC A;  4P71 A;  3HEJ A;  3ONA B;  2EYL A;  3T51 B;  1NSN S;  4RCN A;  1STH A;  1B50 A;  2E75 C;  1E7Z A;  3UE1 A;  2YU9 H;  2F0O A;  3KDF B;  2FHT A;  4LW1 A;  2NN6 G;  5HUR A;  5I6W A;  5D65 A;  1I6V C;  4LF6 L;  4HJA A;  1M4V A;  2B2T A;  2UUA Q;  1ASY A;  2F0E A;  4A3F G;  5G3L F;  5IYB G;  1WFQ A;  1G29 1;  1HTL D;  2EVB A;  2DY7 A;  2I5M X;  3DHQ A;  1A8V A;  2HIV A;  3MEH A;  3PSI A;  1GD7 A;  1VQJ A;  4CDF C;  1G2T A;  2NYZ D;  3ICE A;  4K14 A;  3OWE B;  1KRT A;  3S15 B;  2KED A;  4H0L C;  1WCM B;  1GUO A;  3W2D A;  3CCJ A;  4DKA C;  4AYB G;  1K8O A;  3SDZ A;  4AQY Q;  3NTH A;  4KKT A;  1EU4 A;  4ID6 A;  1ENF A;  5I2X A;  1D5M C;  3TQY A;  3HOW B;  4A3C H;  2YTV A;  4K5X A;  4R4I A;  3S1Q H;  1EFI D;  2JA5 H;  1ET9 A;  2BOS A;  2ES2 A;  2DJG C;  3BZD B;  3P20 A;  3P7J A;  1X3F A;  3M4Q A;  2IL8 A;  2L15 A;  3NTI A;  3SK8 A;  1RJT A;  5KND A;  3OPO A;  1FL0 A;  4WOR A;  1RF2 D;  1L0X B;  1GUS A;  4C3I H;  3GDE A;  4GS3 A;  1NAP A;  2OCE A;  3DM1 A;  3A5U A;  1R4P B;  1II3 A;  3VR4 A;  1GO3 E;  5AFW A;  2YTX A;  2XRS D;  3DEO A;  5IGB A;  1EY5 A;  2BE5 C;  1VDZ A;  3A8I E;  4TQU S;  1JJ2 A;  1SMY C;  1A3V A;  5EPK A;  3V96 A;  2F4I A;  4FF3 A;  4A3E G;  3SGI A;  4JOI C;  4LWC A;  4WJ3 M;  1NR4 A;  1Q81 C;  1ET6 A;  3Q8D A;  4FXG C;  5FLM G;  3MEF A;  4L6T B;  2L5T A;  1MJC A;  4QUF A;  3D4D A;  4CJ0 B;  1XMQ L;  4ZAI A;  2M2L A;  2WB1 E;  4I65 A;  3K58 A;  1LAB A;  5IYD H;  2IX1 A;  1CI3 M;  3T1H Q;  1GHK A;  2MNA A;  3TP8 A;  3T1H L;  1KLG D;  3OW2 A;  3CQZ H;  1XTC D;  1EUJ A;  1KHI A;  1M8A A;  2H5X A;  1ESF A;  3I4L A;  5D3I B;  4TKO B;  3SK6 A;  2FMC A;  3DUZ A;  5CYU A;  1SJH D;  1J6Q A;  4APV A;  5J39 A;  1EZ6 A;  5ELF A;  1NUC A;  5M3M B;  3PUZ A;  3CC7 A;  1C48 A;  1B1Z A;  2PMZ B;  4A3J B;  1HNX Q;  5HY6 A;  4A3M B;  4JV5 L;  2QW7 A;  1TY2 A;  4OL7 A;  5M9O A;  2JA9 A;  3DMU A;  3RUZ A;  4DR5 L;  1HNX L;  1B53 A;  2R7Z B;  3O13 A;  1TY0 A;  4BBS B;  4BBR G;  5IT9 E;  2JA7 H;  1JR0 D;  4DV7 Q;  4A3B H;  5C0X J;  2UXD Q;  5E7N A;  2QDB A;  1UUP A;  5DEH A;  1D1K A;  1EZ8 A;  4B9W A;  4ZUJ A;  3FKI G;  1KLU D;  3GTM B;  1EIF A;  2ZXP A;  1NMG A;  5IOD A;  5M3F B;  1GJX A;  5ELD A;  2TSS A;  2EY6 A;  3MZ5 A;  2PO4 A;  4IJH A;  4EGV A;  2F0J A;  3OIP A;  1Y8P B;  2YYZ A;  1N34 L;  1EEF D;  3VYS A;  1PH5 A;  1HXY D;  2IHF A;  3TS2 A;  1HZC A;  4L5T A;  4ME3 A;  4IUN A;  4FVM A;  5BN4 A;  5GAG C;  4JBW A;  2F03 A;  5KRU A;  3KLS A;  4LF9 Q;  5CR3 A;  5FLX E;  1OXS C;  2JXM B;  1LT6 D;  3OSO A;  4LF9 L;  1N8R C;  2RDH A;  2WKD A;  2JA8 G;  1BXT A;  1X3G A;  3I70 A;  5DM7 3;  3S15 H;  4G7Z C;  1WCM H;  4PG3 A;  1SE3 A;  3SHL A;  5BN3 A;  1YJ9 A;  1I3Q H;  4JOI A;  2RDG A;  5IT9 c;  3H0G B;  4L5R C;  1Q1B A;  4DNR B;  1H9K A;  3CW2 C;  3I7F A;  3EJI A;  3S24 A;  3DM3 A;  1VQK A;  3MC0 B;  1HFN A;  3NSW A;  4OIK A;  5JJZ A;  2PW5 A;  4B3T Q;  5FOB B;  3ULP A;  3KFU A;  2E76 C;  2NVQ B;  1E3P A;  2MGS A;  1JMC A;  2A8V A;  5EKK A;  4R4C A;  3J81 i;  2F0D A;  3NBH A;  3I4N G;  3L2P A;  1ROD A;  2H4O A;  2VY3 A;  3TP6 A;  1FYC A;  2CWA A;  3ULL A;  4F87 A;  1LAC A;  4J6H A;  2G5D A;  3UDX A;  1X9N A;  1YHB A;  4MN3 A;  2K14 A;  2K05 A;  1L2F A;  4HMI A;  2E2D C;  3OWF A;  1F9Q A;  4IFD I;  1D1I A;  3ITP A;  5IP7 H;  5FLX c;  5C0X I;  1B9N A;  1Q1E A;  2LKV A;  3ER0 A;  3BVG A;  1HA5 A;  5K5P A;  4UP8 A;  1V9P A;  1JWS D;  4LFC L;  2VUM G;  5EKI A;  2AKW B;  2IPK D;  1STE A;  3K7A B;  3N6R A;  1WD1 A;  4LUO A;  4GOP C;  3RZD B;  1EFW A;  2NZO A;  1VCI A;  1YNX A;  5BN5 A;  1SE4 A;  1PZK D;  1RDP D;  3SXH A;  3H91 A;  3BYY B;  3HFZ B;  4GKJ Q;  5JJL A;  4B3R Q;  4KV6 A;  3QOL A;  5KYL A;  4JI5 Q;  4GLA C;  4GKJ L;  1N32 L;  1K28 A;  3FVQ A;  4FP5 D;  4DF7 A;  4JI5 L;  4FXD A;  1L1O B;  3CCE A;  2SDF A;  3DEP A;  4X64 Q;  5M3M H;  3M4O B;  1IL8 A;  1PYB A;  1Q46 A;  2KA7 A;  3OYY A;  3WOF A;  4X64 L;  4A3J H;  4A3M H;  4NPS A;  1W6J A;  5ELN A;  1TQO A;  2OTL A; 
#chains in the Genus database with same CATH homology
 3JAM i;  3RLN A;  1KD1 C;  3STB D;  3KOJ A;  4DR4 L;  3FHW A;  4JC0 A;  4X62 Q;  2WFW A;  2RCN A;  2ZM6 L;  3TS0 A;  4BY7 H;  4AH6 A;  1JT8 A;  4X62 L;  2AWN A;  1M90 C;  3G71 A;  4DV7 L;  3PIP A;  4DR7 Q;  4BXX G;  2UXD L;  4POF A;  2Q2U A;  4LFA L;  4DK3 C;  3MXN B;  4JI8 Q;  4DUY Q;  4GNX A;  4DR7 L;  4EX5 A;  5BR8 Q;  2PMZ E;  2LSS A;  2Y0S G;  1L0W A;  1WCM G;  1Q12 A;  4OWT B;  4DV0 L;  1OXV A;  4DR1 L;  3UDI A;  1HR0 Q;  3CCU A;  1IBM Q;  4DUY L;  4JYA Q;  1LTL A;  4HIO A;  3K0X A;  4PZ7 A;  1XPU A;  3CAM A;  1HR0 L;  3NEL A;  1YI2 A;  3HOZ H;  2E8G A;  2BH8 A;  1XNR L;  4JYA L;  3AYH B;  5C4X H;  4R1J A;  1VQ9 A;  4NXN Q;  4A3D H;  4GKK Q;  3HKZ G;  4DNI A;  5K36 G;  1X3E A;  2WAQ E;  2JA5 G;  3TRZ A;  2N3S A;  3CCM A;  4OO1 I;  4NXN L;  1C0A A;  3K8A A;  2I5L X;  4YCW A;  1QUQ B;  1EIY B;  4GKK L;  4YCV A;  4A76 A;  4UPA A;  1KL9 A;  2KBN A;  1LM0 A;  4PMW A;  4LF8 Q;  5JJK A;  2B3G A;  2Q2H A;  2OQK A;  3W1B A;  3AEV A;  4EQ5 A;  1IL2 A;  2LXK A;  1Y1V G;  3F2D A;  3KF6 A;  3NEM A;  4LF6 Q;  3CCQ A;  1IBK Q;  2PQA A;  4HJ9 A;  4A3I H;  1NE3 A;  2EIF A;  4JI4 L;  2QGQ A;  1IBK L;  4A3L G;  3EBE A;  3LGJ A;  4OON A;  4JI3 L;  1U5K A;  4P73 A;  1PHJ A;  1VQ6 A;  3HOU H;  4A3G H;  1IBL Q;  4DV4 Q;  1JJC B;  1A0I A;  4YY3 Q;  2VZA A;  3ERS X;  1VS0 A;  4YWL A;  1WI5 A;  4DAY B;  1IBL L;  2OTJ A;  1H95 A;  3VDY A;  2R6G A;  1CSP A;  3H0G H;  4YY3 L;  1YJN A;  1YEZ A;  5IP7 G;  1PH1 A;  1K3R A;  5C44 G;  1KQS A;  2CCZ A;  3J7A 5;  4XTC S;  2F3I A;  4KI0 A;  4O2D A;  4A4I A;  5IWA Q;  1VQP A;  3S2H H;  2EXD A;  4IPD A;  4HJ8 A;  4GOP A;  1QZH A;  1G6P A;  3M85 A;  4WJ4 A;  1GKH A;  2BA0 A;  4B3T L;  1UE1 A;  1PH6 A;  1W3S A;  2ID0 A;  1K8G A;  4BY1 G;  1HNW Q;  1NBW A;  4ALP A;  1KC8 C;  3S1M H;  1VQB A;  3BZC A;  2QA4 A;  1CSQ A;  2D0O A;  4KHP L;  2ZJR A;  2N49 A;  4LF7 Q;  1HNW L;  1RL2 A;  1S40 A;  1PH9 A;  1J5E Q;  4LF5 Q;  2NVT H;  1K83 H;  4DR2 L;  1PH7 A;  4FDB A;  4LF7 L;  1EYG A;  1QVG A;  1N36 L;  2ATW A;  3PO2 G;  4A3F H;  2A19 A;  1EQQ A;  2UU9 Q;  3CCR A;  4LF5 L;  4KLK A;  5IYB H;  2F4V Q;  3HOX H;  5LMN Q;  3FP9 A;  4LF4 Q;  1VQ4 A;  4IPG A;  2UU9 L;  5AJ3 L;  3RN2 A;  2KHJ A;  4JI2 Q;  1K0R A;  5LMN L;  4RG1 A;  2ZJQ A;  1HZB A;  5GAE C;  3E0E A;  4DUZ L;  4YHH Q;  1RIP A;  4QIW E;  4JI2 L;  3STB C;  1PA6 A;  3U4Z A;  3OTO Q;  3G48 A;  1VQ8 A;  1O7I A;  2HQL A;  3PUY A;  3UE0 A;  5M3M G;  1VQG A;  3OTO L;  3CCL A;  2B63 H;  2JA8 H;  4A3J G;  4HJ7 A;  3JC6 6;  3D31 A;  4JBJ A;  4A3M G;  2R93 G;  1BVS A;  3M4P A;  4JI0 Q;  3A74 A;  5C4J H;  4A93 G;  2D0P A;  1E1O A;  2Q2T A;  3CF5 A;  1QVC A;  1X54 A;  3AFQ A;  4JI0 L;  5JEA J;  1TXY A;  3U50 C;  1P8L A;  1C7Y A;  3GTO H;  4GN5 A;  4A3B G;  5H1S E;  1ASZ A;  2PQA B;  3RZD H;  2E5L L;  1WJJ A;  3HOY H;  3PF4 A;  4BY7 G;  3NEN A;  1CKM A;  2WAQ G;  4NB3 A;  3GTL H;  3HOV H;  3S17 H;  1HNZ L;  1EOV A;  4JI7 L;  4JI1 Q;  2CKZ B;  1TWH H;  2K50 A;  1YHA A;  4LUV A;  4B3R L;  1L1O C;  4R4O A;  1IXR A;  4X66 Q;  2XTI A;  5M3F G;  1S72 A;  1XMQ Q;  2GN5 A;  4AYB E;  5C3E G;  3PO3 H;  3RZO H;  4X66 L;  3CMA A;  2HHH Q;  3PCO B;  1SMX A;  4L5Q A;  2DUD A;  3RLF A;  1XJV A;  3S2D H;  3GTJ H;  2R7F A;  3M4O H;  2HHH L;  4MTN A;  1NJI C;  4OX9 L;  1B7Y B;  1V1Q A;  4X6A H;  1SRU A;  2IX0 A;  1N9W A;  3NBH B;  1QVF A;  2UUC Q;  1WOC A;  1NY4 A;  4B3M Q;  3H3V I;  1VQH A;  1PH4 A;  3CCS A;  2PNH A;  4J15 A;  1I6H H;  1PYS B;  1Y14 B;  1K73 C;  4TVA B;  4MNO A;  3RNU A;  4A3I G;  2VQF Q;  4JV5 Q;  3GTQ H;  3WWV A;  1WYD A;  2CFM A;  3J7Z C;  3UDG A;  4A3E H;  1VQL A;  2R92 H;  1DGS A;  4DR5 Q;  1TWG H;  3TEH B;  3HOU G;  1PH2 A;  4A3G G;  1KIX A;  4JBK A;  4XIG S;  2GVB A;  5FLM H;  1C9O A;  4JI8 L;  5IE8 A;  2Z6K C;  2NVX H;  2NVY H;  5BR8 L;  2VQE Q;  2CQO A;  1VQM A;  1IBM L;  5M5W H;  3H0G G;  4C3H H;  1JE5 A;  1HJP A;  2VQE L;  4IFD J;  2VNU D;  4P71 A;  2AHO B;  2K75 A;  5JEA G;  1A62 A;  4Y52 H;  3S14 H;  5IYC G;  1VQA A;  5M5Y H;  3H3V H;  4UY8 C;  4LFB Q;  3CP0 A;  1AE2 A;  3RN5 A;  1K8A C;  1E7Z A;  3EN2 A;  1E24 A;  3UE1 A;  2YU9 H;  4LF8 L;  3KDF B;  2VS1 A;  4LW1 A;  2NN6 G;  4PZ6 A;  1Z9F A;  4DV1 Q;  4HJA A;  1XMO Q;  4RMF A;  1N34 Q;  4LF6 L;  1OXT A;  1TWC H;  3PUV A;  3PV0 A;  4A3K H;  3PF5 A;  1PV4 A;  2UUA Q;  1SFO H;  2OQ0 A;  1XMO L;  1ASY A;  1X65 A;  2WP8 J;  4A3F G;  1Y1W H;  5IYB G;  1OXX K;  1WFQ A;  3HOX G;  2UUB Q;  1G29 1;  2ZTD A;  4DV4 L;  2I5M X;  3PUX A;  4BBR H;  5FJ8 H;  1A8V A;  3D0F A;  2E2J H;  2UUB L;  1OXU A;  2HIV A;  3K81 C;  3PSI A;  1GD7 A;  1VQJ A;  2FXQ A;  5M5X H;  4YCU A;  3AQQ A;  2JA6 G;  1P16 A;  4B3S Q;  3KYH C;  3ICE A;  5IWA L;  5GAH C;  3FKI H;  3PGZ A;  4BXX H;  1S3O A;  3CME A;  2K5N A;  1KRT A;  1PVO A;  4UP9 A;  4DPG A;  3I2Z A;  3L0O A;  1LUZ A;  1CKN B;  3CCJ A;  4DKA C;  4AYB G;  1GM5 A;  3HKS A;  4AQY Q;  2PI2 E;  3EIV A;  1L1O A;  3T1Y Q;  3E9H A;  3GD7 A;  3TQY A;  5IP9 H;  1PH8 A;  3CC2 A;  4GN4 B;  4K0K Q;  3G4S A;  1AH9 A;  4A3C H;  1J5E L;  1SLJ A;  2CWP A;  2YTV A;  2VL6 A;  1AE3 A;  4R4I A;  3M7N A;  3S1Q H;  3HOW H;  4IFD G;  1N33 Q;  2JA5 H;  4K0K L;  1IZ6 A;  2ES2 A;  4DV3 Q;  1E22 A;  4IPH A;  4GNX B;  2E2H H;  4HIM A;  1QZG A;  1T9H A;  3I4M H;  2F4V L;  1N33 L;  1X3F A;  3CPF A;  3KJO A;  4LF4 L;  3M4Q A;  2K52 A;  4DV3 L;  2IY5 B;  5GQO A;  4AIM A;  1XPR A;  2L15 A;  1EQR A;  1VQC A;  1Q86 C;  2JQO A;  4YHH L;  4QGU A;  1XPO A;  4A3L H;  1FL0 A;  3G6E A;  1Q82 C;  3S1N H;  1YZ6 A;  3GO5 A;  1KAW A;  3GDE A;  4GS3 A;  3RR5 A;  4C3I H;  2OCE A;  4QL5 A;  4QY7 A;  3A5U A;  4MZ9 A;  4DV2 Q;  1KXL A;  2RHS B;  1LYL A;  3JAM c;  1GO3 E;  1UE6 A;  2B29 A;  1VQD A;  2YTX A;  3KF6 B;  4JCV E;  2Z6K A;  3S1R H;  2V1C C;  1SRO A;  4TQU S;  1JJ2 A;  4L5S A;  2GVA A;  4LFC Q;  1HH2 P;  4A3E G;  1CKO A;  4JOI C;  4LWC A;  3SGI A;  4NXM Q;  2R92 G;  4WJ3 M;  2IHE A;  3A0J A;  1Q81 C;  3I4N H;  4JI1 L;  3S16 H;  4POG A;  3Q8D A;  5FLM G;  2BA1 A;  3MEF A;  4NXM L;  2HIX A;  1MJC A;  3W5O A;  4HID A;  4LNQ A;  5LMU Q;  3HOZ G;  1UE5 A;  1XMQ L;  2I0Q A;  4DV6 Q;  4A3D G;  2WB1 E;  5C4X G;  4GOP B;  4LUZ A;  5IYD H;  2IX1 A;  1BBW A;  3I4O A;  3BZK A;  3T1H Q;  1VQN A;  1FGU A;  1Z47 A;  4R4Q A;  2MNA A;  3L7Z C;  1N32 Q;  2C35 B;  1PFS A;  3T1H L;  3OW2 A;  3CQZ H;  1FJG Q;  4BA1 I;  5GAD C;  1EUJ A;  1KHI A;  2H5X A;  2UUC L;  4KHZ A;  4DV5 Q;  4B3M L;  2NZH A;  1D7Q A;  2K5V A;  1FJG L;  1J6Q A;  4APV A;  5EAY A;  1YIJ A;  3M3Y H;  4A3K G;  3PUZ A;  3CC7 A;  4DV5 L;  4JV5 L;  1XNQ Q;  1HNX Q;  5HY6 A;  2VQF L;  4IJL A;  3J80 c;  3I56 A;  1VQE A;  2BH2 A;  2VUM H;  2JA9 A;  1BBU A;  4DR4 Q;  2R93 H;  3F8T A;  2KCT A;  4X65 Q;  4DR5 L;  1HNX L;  1XNQ L;  3CD6 A;  1Q7Y C;  5JJI A;  4A93 H;  4DAM A;  2ZM6 Q;  4BBR G;  2HT1 A;  5FJ8 G;  2R7Z H;  1X55 A;  3K80 C;  1TWF H;  4X65 L;  2JA7 H;  4BBS H;  4DV7 Q;  2RHQ B;  4A3B H;  5C0X J;  3TRE A;  3H15 A;  5E7N A;  1R9T H;  4OO1 G;  2UXD Q;  1VQF A;  1XTD A;  2YTY A;  5J3B A;  4LFA Q;  3B6Y A;  3FKI G;  4O0A A;  3IRB A;  1VQ5 A;  2MO0 A;  4DV0 Q;  1V43 A;  3J81 c;  3PIO A;  3KJP A;  4DR1 Q;  1EIF A;  3GTM H;  1NMG A;  1SR3 A;  4LFB L;  4QJF A;  3KF8 B;  1A63 A;  2UXC Q;  3CPW A;  5M3F H;  3ULJ A;  3U58 A;  1XNR Q;  5C3E H;  2AMC B;  5DLQ E;  5HGQ A;  3I55 A;  4IJH A;  5IP9 G;  2YYZ A;  4DV1 L;  1N34 L;  1SN8 A;  4GN3 B;  1KRS A;  4IO9 A;  4A3C G;  1JB7 A;  2UUA L;  1IYJ B;  3HOW G;  1PH5 A;  2IHF A;  3TS2 A;  1HZC A;  3KLW A;  4L5T A;  4ME3 A;  4GLV B;  3I4M G;  3CCV A;  3K7U C;  3F2C A;  5GAG C;  2A1A A;  4JBW A;  2N8N A;  3U4V A;  1B8A A;  4DR6 Q;  4LF9 Q;  1M1K C;  4P75 A;  1OXS C;  4JI4 Q;  4JG2 A;  4IOC A;  2AWO A;  1I94 Q;  4JI3 Q;  4LF9 L;  4DR6 L;  1N8R C;  2N78 A;  1VQO A;  2B63 G;  4B3S L;  1JJG A;  2JA8 G;  2NN6 I;  1X3G A;  1I94 L;  5ELO A;  4OXP A;  3J80 i;  1MKH A;  3S15 H;  4PZ8 A;  4GLX A;  1WCM H;  1UEB A;  4PG3 A;  1YJ9 A;  1I3Q H;  4JOI A;  4L5R C;  5IT9 c;  1YBY A;  1Q1B A;  3E9I A;  3CW2 C;  4QQB X;  3I7F A;  1VQK A;  3S24 A;  2WB1 G;  3DM3 A;  4AQY L;  2K4K A;  3HOY G;  1BKB A;  1SE8 A;  3HOV G;  3T1Y L;  2IT1 A;  2KEN A;  4GNX C;  4B3T Q;  5C0X G;  4YWM A;  3ZJY C;  3ULP A;  4JBM A;  1HZA A;  2ALY B;  3KFU A;  1E3P A;  1VQI A;  5IYC H;  1JMC A;  2A8V A;  2JJQ A;  2NVQ H;  1B70 B;  4R4C A;  5IY0 A;  3J81 i;  4DK6 C;  2ZJP A;  4OWW B;  3BU2 A;  1HR0 W;  3I4N G;  3L2P A;  1YHQ A;  4KHP Q;  3F1Z A;  4OWX B;  1Y1V H;  2Y0S E;  3BJU A;  2VY3 A;  3F2B A;  3RLO A;  1MIU A;  2CWA A;  1U0L A;  3PO3 G;  3ULL A;  4Y7N H;  1G51 A;  4UP7 A;  4DR2 Q;  2Z0S A;  1N36 Q;  1K9M C;  1EWI A;  1D8L A;  4P72 A;  3CC4 A;  3UDF A;  5IYD G;  3UDX A;  1X9N A;  1PH3 A;  1YHB A;  3HKZ E;  2K14 A;  1TWA H;  2YV5 A;  5GRO A;  5AJ3 Q;  1L2F A;  2JEB I;  1UWV A;  3W1G A;  1YVC A;  4DUZ Q;  4IFD I;  2JEA I;  4DV2 L;  1Q8K A;  5IP7 H;  5FLX c;  1CUK A;  4C2M H;  5C0X I;  5C44 H;  1Q1E A;  3ER0 A;  1YIT A;  3AFP A;  2XGT A;  2JA6 H;  3DLL A;  1X6O A;  2MQH A;  1HZ9 A;  1MJE A;  2MO1 A;  4UP8 A;  2ZTE A;  1V9P A;  1QUQ A;  2Q2I A;  2LXJ A;  3GTG H;  4BY1 H;  2KCM A;  4LFC L;  2VUM G;  1NMF A;  2AKW B;  1E1T A;  1GVP A;  4IOA A;  4HIK A;  3KDF A;  1VQ7 A;  2UXB Q;  2ASB A;  4LUO A;  2R7D A;  3K7A H;  4GOP C;  2E5L Q;  4YWK A;  2JA7 G;  2R7Z G;  4BBS G;  3M9B A;  2F52 A;  2I5H A;  1OTC A;  1EFW A;  2NZO A;  1VCI A;  1YNX A;  3A5Z B;  1HNZ Q;  2OWO A;  5LMU L;  4H02 A;  3CXC A;  4HJ5 A;  4JI6 Q;  4JI7 Q;  3PO2 H;  4BA2 I;  2UXB L;  4DV6 L;  3J81 j;  2UXC L;  2JK8 A;  4JI6 L;  3HFZ B;  2MFI A;  4GKJ Q;  2PI2 A;  4A75 A;  5JJL A;  4B3R Q;  4C3J H;  2ZTC A;  4JI5 Q;  3GTP H;  4GLA C;  4GKJ L;  1N32 L;  1NTG A;  4R4T A;  4DR3 Q;  2JE6 I;  4JI5 L;  1W2B A;  2D62 A;  1L1O B;  2K5H A;  1I5F A;  2VW9 A;  3CCE A;  1I50 H;  1X56 A;  4X64 Q;  2EQS A;  1FVI A;  2QEX A;  1YJW A;  2E2I H;  4DR3 L;  2DGY A;  3GTK H;  3PUW A;  5M3M H;  2KHI A;  4IPC A;  1UE7 A;  4P74 A;  4OX9 Q;  1Y1W G;  1PYB A;  1Q46 A;  3OYY A;  4X64 L;  4A3J H;  4A3M H;  5LMN W;  4NPS A;  5ELN A;  2RF4 A;  1CKN A;  2OTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...