4A93H

Rna polymerase ii elongation complex containing a cpd lesion
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Mechanism of Translesion Transcription by RNA Polymerase II and its Role in Cellular Resistance to DNA Damage.
pubmed doi rcsb
molecule tags Transcription
total genus 23
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a93H00
2HHHL 1XTDA 1EQRA 5IWAL 5C3EG 4DAYB 3S15H 4A3GH 4A3JH 3M9BA 4HJ5A 2JA7G 4UP8A 5FLXc 2IT1A 5E7NA 5C0XJ 3F2BA 2UUCL 3AQQA 4GKKL 2B3GA 4LFCQ 4A3CG 1PA6A 1TWFH 5M5XH 4DV3Q 3WWVA 3CXCA 1K83H 3J80c 3G4SA 1HNXL 1U0LA 3I7FA 1XNRQ 4KHPL 3D0FA 4PZ8A 3MEFA 1C0AA 2D0OA 4HJ9A 4IO9A 1P8LA 4IJHA 1Q46A 4AQYQ 3U58A 1K73C 1YJ9A 4JI3Q 3S1NH 3UE0A 2XTIA 2JEAI 3A5UA 1VQMA 2VS1A 4NXMQ 4X66L 4B3RL 1L2FA 1OXVA 3MXNB 3K80C 3PCOB 1HZAA 3AYHB 1UE6A 5DLQE 5FJ8H 1OXSC 3CCEA 1WOCA 1Q86C 5ELOA 3GO5A 4JI8Q 5IP9H 4DV4Q 1SLJA 5IYBG 1SFOH 1VQ4A 3KLWA 5FLMH 3M4QA 4DV7Q 4JCVE 3HOYG 5IE8A 4A3BH 4YWMA 3T1YL 4LF7Q 1I6HH 1S72A 4KLKA 1VQIA 2JA9A 3CMAA 4B3SQ 2F52A 1Y1VH 4BBSG 3CAMA 3PIPA 4JYAL 1H95A 3GTGH 1PH3A 2A19A 1NE3A 1PH7A 3FKIH 2BH2A 3W5OA 1UE1A 4JI2Q 2MFIA 3SGIA 1Y1WH 4DR2L 4R4TA 2VQFL 1YIJA 1UEBA 2ID0A 4UPAA 3IRBA 4GLAC 4NXNL 4PMWA 1L1OB 2VW9A 2ATWA 1LUZA 2K14A 3K0XA 4TQUS 3J81c 3AFPA 4QY7A 2ALYB 2E5LQ 1N8RC 4LFBL 1WFQA 1CKOA 4DR1L 3A0JA 5JEAJ 2Z0SA 1S3OA 4GOPB 3S1RH 1QVCA 3D31A 5LMUL 1B8AA 2Y0SE 4DV6Q 1S40A 4A3JG 1ASZA 2IHFA 2D62A 3CCLA 4B3TQ 1XNQL 1HR0W 3CQZH 3HKZE 4WJ3M 3DLLA 3TS2A 4DV2Q 1QVGA 1T9HA 2RHSB 1Q8KA 2R6GA 4NB3A 2ZM6Q 2N78A 1HR0L 1JJCB 4JI0Q 3ZJYC 3KJOA 1YZ6A 2K5NA 4X64Q 1VQPA 1XPRA 2OWOA 3BU2A 4A3FG 3E9IA 1J5EQ 4YHHL 4LF4Q 4UY8C 4UP7A 1IYJB 5GAHC 1LYLA 2JA5G 4C3IH 2IX0A 1HZCA 3TS0A 1PH1A 2PQAB 5C4XH 1HNWQ 1XMOL 3PGZA 4R4QA 4LF8Q 4X62Q 5FJ8G 3H0GH 3M4PA 1PH9A 1WCMH 2VNUD 3RR5A 2R7DA 4LWCA 4GS3A 5IP9G 5AJ3L 5GQOA 1A62A 1X3GA 4B3MQ 4LF9L 3I2ZA 3HOWH 1HNZL 3K8AA 4R1JA 4A3BG 1KHIA 2WB1E 2ZTEA 1VQJA 1K8GA 3CCUA 3PO2H 4KI0A 4BY7H 2Z6KA 2NVYH 2KHJA 3STBC 5K36G 4X62L 5M3FH 1Y1VG 2HT1A 1OXTA 5M3MG 3G6EA 3S14H 4LF5Q 4DR7L 1VQ9A 3ULLA 4C3JH 3FKIG 1X3FA 5HY6A 4EQ5A 3GTJH 1G291 1PH4A 2ZTCA 2V1CC 1JJ2A 2IHEA 2EQSA 2HIVA 2Q2TA 4GLVB 3H15A 1IBML 3PUWA 1VQCA 2NN6G 4P72A 4PZ6A 3UDGA 4HIMA 1N33Q 3U4ZA 4L5QA 3RN2A 1K0RA 1E1OA 1KD1C 1VQLA 1TWGH 1V43A 2CWAA 1KC8C 2R7ZH 3PUVA 1G6PA 1LTLA 3H3VH 4QGUA 2H5XA 3ER0A 2B63H 2NN6I 2Q2IA 3NENA 2HHHQ 2VUMH 1PYSB 1TXYA 5C44H 4OWXB 5GAEC 1FJGL 2E2IH 1KRTA 4A3MH 1YITA 2UXBL 4JBWA 1VQ6A 3GTMH 4O0AA 5M5YH 3GTLH 1N36L 4GKKQ 1N32L 1HNXQ 4LFAL 3STBD 1GO3E 1CSQA 1VQNA 3KF6B 3AFQA 4P73A 5IY0A 1IBLL 3UE1A 2CFMA 1WI5A 3KDFB 1Q81C 2UXCL 2OQKA 4A3KG 3GTKH 3RN5A 1UWVA 4X66Q 3KJPA 4B3RQ 5C4JH 2OTJA 5C4XG 1B70B 1PH6A 4JI7L 4A75A 3H0GG 1NMFA 2KCMA 1U5KA 1WCMG 4TVAB 1WYDA 4PG3A 3CCRA 1X3EA 2ZJQA 1AE3A 2JA8H 2IY5B 1A0IA 1PH5A 4YCUA 2WAQG 3J80i 3HOWG 4BXXG 3KOJA 3UDIA 1YJWA 2BA1A 3T1YQ 1VQGA 3PUYA 4PZ7A 1YBYA 3PO2G 2E2HH 1KIXA 4BY7G 1VQFA 4GN3B 3F2DA 5IYCH 3BZKA 1KL9A 5LMNW 1FGUA 1YHBA 3A5ZB 3EBEA 3L7ZC 3OTOL 3T1HL 4DUYL 1M1KC 4JYAQ 4JV5L 1QUQB 2A8VA 4WJ4A 1AH9A 3S16H 3EIVA 2ES2A 1C7YA 3K7AH 4JI1L 4DR3L 1YEZA 5LMNL 2VY3A 4DR2Q 2VQFQ 1VQ7A 4MZ9A 3Q8DA 2E2JH 4DV5L 4JBKA 3ERSX 4NXNQ 3HOUG 1SN8A 1EUJA 2VQEL 4A3GG 1PH8A 4IPHA 2HIXA 1I5FA 2UUAL 2R7ZG 4LFBQ 2OTLA 4YCVA 2GVBA 2R7FA 4XTCS 4JI4L 4A3LG 4BA1I 2B63G 3B6YA 4C3HH 1JE5A 1XPOA 4DR1Q 2UU9Q 2VUMG 2CKZB 5C44G 1RL2A 5LMUQ 3F2CA 2F4VL 2LXJA 1XNQQ 1VQDA 5JJKA 5J3BA 4A3MG 1K8AC 2QEXA 1SR3A 1KRSA 2MO1A 3W1GA 5M5WH 2R92H 4ALPA 3FP9A 2MO0A 2K50A 2BH8A 2E8GA 3JAMc 1X56A 1HR0Q 3TREA 3L2PA 1L1OC 4P75A 3TQYA 2PI2A 3UDFA 1I94L 2UU9L 1VQ8A 2NVTH 3U50C 4YHHQ 2EXDA 1GVPA 1GM5A 1Q7YC 1XMOQ 1JT8A 4JBJA 2NZHA 2KCTA 4GOPC 3NBHB 3M85A 4X65L 2L15A 3GTQH 3KFUA 1C9OA 1Q1BA 5AJ3Q 4LF9Q 3U4VA 4POFA 3CPWA 3E0EA 4AH6A 1HNZQ 1TWHH 4BY1H 1QUQA 2MNAA 3CC2A 2AWOA 4DUZL 1W3SA 2AMCB 2VL6A 5IYCG 4POGA 2N8NA 2Y0SG 1OTCA 4L5TA 3GTOH 4JOIC 4HIDA 3AEVA 3S2DH 4DR7Q 2NVQH 4O2DA 2PNHA 1J6QA 3FHWA 1D8LA 1KAWA 4JC0A 5FLMG 2JA6H 3HOVH 1X55A 1N9WA 4LNQA 4Y52H 2YTXA 4NPSA 2YYZA 1IBMQ 1E24A 1EIFA 3A74A 4L5SA 3HOUH 5C3EH 4IOCA 2UXDL 4UP9A 4IPDA 2JA7H 1YI2A 1L1OA 3DM3A 1D7QA 4DKAC 2D0PA 2JQOA 1X9NA 3VDYA 1Y1WG 4R4CA 4R4IA 1FJGQ 1V9PA 1DGSA 1LM0A 4GNXB 1E3PA 4GOPA 3HKSA 2OQ0A 3HOZH 3GD7A 2UXBQ 2PMZE 2WB1G 1FVIA 3CCSA 1N36Q 2AWNA 4GN5A 2R92G 1N32Q 4QQBX 4AYBG 4LFAQ 3CCMA 5BR8L 4GNXC 3J7A5 3S17H 3E9HA 4A3DH 1UE7A 1IBLQ 5ELNA 4JI6L 2UXCQ 3CCJA 5IT9c 4JI5L 1SRUA 3S24A 2ZJPA 1IL2A 3TRZA 4JI7Q 1GKHA 4JOIA 4HJAA 3K81C 1XMQQ 4Y7NH 1QZGA 4P71A 3M4OH 1MIUA 2PQAA 1SMXA 2ZTDA 3RLNA 4DR5L 3NELA 2K5HA 4IPCA 1PHJA 1KXLA 1A63A 4X6AH 1A8VA 1VQ5A 2JJQA 1JB7A 4YY3L 1BVSA 4R4OA 3HFZB 3G71A 3PSIA 3PUXA 1XMQL 4AIMA 5EAYA 3T1HQ 1X6OA 3OTOQ 4JV5Q 4DUYQ 1X65A 2NVXH 2MQHA 1TWAH 3W1BA 1WJJA 2F3IA 1L0WA 1G51A 1VQAA 2B29A 4JI1Q 5LMNQ 2CWPA 4DR3Q 1HH2P 4L5RC 1VCIA 1TWCH 2WAQE 1EYGA 3CW2C 4K0KL 3HOXH 4DV5Q 3JC66 2VQEQ 4HJ7A 1VQOA 4QIWE 1MJCA 3GTPH 3KF8B 5M3FG 4BA2I 3PO3H 2UUAQ 4YCWA 1IBKL 4IJLA 1BKBA 4JBMA 4GNXA 1R9TH 4IOAA 4JI4Q 4APVA 1Q1EA 2JK8A 1CKNB 3G48A 4BBRH 3S1QH 4HIKA 4IFDG 4J15A 3BJUA 5JJIA 2DGYA 4DV1L 4DV0Q 2F4VQ 4GKJL 1W2BA 1VS0A 3GDEA 2EIFA 3HOZG 4A3FH 1UE5A 2LXKA 4HJ8A 4IFDI 2JA5H 3I4NH 1HZ9A 3PUZA 1M90C 2RF4A 1KQSA 3L0OA 2BA0A 3I4OA 4LFCL 1I94Q 4YWLA 4A3DG 4DV3L 4HIOA 3PIOA 1K3RA 4DV0L 1E7ZA 3KF6A 1BBWA 3J81j 1XNRL 1PFSA 2CCZA 2PI2E 1QZHA 3H3VI 3KDFA 4JI3L 1EWIA 1BBUA 4AQYL 2JEBI 4X65Q 2GN5A 5H1SE 2QA4A 2HQLA 1PV4A 3J81i 4NXML 2R93H 2XGTA 3ULJA 3CF5A 3NEMA 4C2MH 1HZBA 4RMFA 4A4IA 3JAMi 2GVAA 5IYDH 2K5VA 5M3MH 2YTYA 4DK6C 1N34Q 4JI8L 3J7ZC 4DV4L 4A3IH 4A3EH 1Q12A 4DUZQ 3M7NA 2JE6I 2KBNA 3I56A 4DV7L 4GLXA 2ASBA 3S1MH 4LF7L 1EIYB 4A93H 1YHQA 1CKMA 1X54A 4RG1A 1EFWA 1JJGA 2WFWA 2JA8G 4B3SL 4YWKA 4LW1A 1OXUA 2Z6KC 2ZJRA 4DR4Q 2NZOA 1CUKA 2A1AA 1SROA 1N34L 3HOXG 1B7YB 1CKNA 4JI2L 3F1ZA 5HGQA 4GN4B 4OWTB 1YHAA 2I5LX 1Z9FA 3PO3G 3K7UC 4DR6Q 2RCNA 4OX9Q 2UXDQ 1OXXK 4QJFA 3HKZG 1I50H 1MKHA 4MTNA 1YVCA 4OWWB 2IX1A 1JMCA 4BBRG 2DUDA 2QGQA 3KYHC 4XIGS 2E5LL 4LF6Q 4DR4L 1CSPA 4DK3C 4DNIA 2K52A 2LSSA 3OYYA 4H02A 4EX5A 3I4MH 4QL5A 5IP7H 4IFDJ 1NTGA 1V1QA 1I3QH 4OXPA 2AKWB 3ULPA 1VQEA 4MNOA 2CQOA 4JG2A 5C0XG 3RLOA 4OX9L 4DR6L 4A3KH 4DV6L 3I4NG 1IXRA 2I5MX 2I0QA 1PVOA 1IZ6A 4B3TL 1QVFA 2RHQB 4LUOA 5BR8Q 3RLFA 4DV2L 4A3CH 4P74A 5JJLA 4LF6L 5C0XI 1VQBA 3F8TA 4JI6Q 2YTVA 2ZM6L 3CCVA 1NBWA 4JI5Q 1K9MC 4JI0L 1Z47A 3S2HH 4X64L 4BXXH 1J5EL 4LF4L 3PF5A 1EQQA 1Y14B 4DAMA 3RZDH 3ICEA 4LUZA 1HNWL 1GD7A 1VQHA 3CPFA 2R93G 4IPGA 4FDBA 3UDXA 4AYBE 4DR5Q 4LF8L 4DPGA 3LGJA 5IYDG 4YY3Q 1NMGA 2KENA 1YJNA 1RIPA 5IYBH 4A3IG 4A3EG 1PH2A 4B3ML 5GADC 3RNUA 3CCQA 4KHZA 1XPUA 5GROA 4LUVA 3HOYH 1VQKA 1P16A 4A93G 2YU9H 2WP8J 3PV0A 3RZOH 2FXQA 2YV5A 1NJIC 2K75A 3CMEA 3OW2A 2KHIA 1E22A 4BBSH 3CD6A 1EOVA 1E1TA 1O7IA 3CC7A 4BY1G 2AHOB 2K4KA 4ME3A 2UUBQ 2Q2UA 4LF5L 4A76A 1PYBA 1HJPA 1XJVA 1ASYA 1SE8A 4K0KQ 2Q2HA 5GAGC 4A3LH 2OCEA 3TEHB 2VZAA 5IWAQ 1AE2A 3CP0A 2C35B 4OONA 3CC4A 1IBKQ 1FL0A 1N33L 4OO1G 2UUCQ 1MJEA 2N49A 1Q82C 2JA6G 3I55A 3HOVG 3EN2A 2UUBL 3PF4A 3BZCA 5JEAG 4DV1Q 2I5HA 3I4MG 3M3YH 5IP7G 4GKJQ 4KHPQ 1NY4A 2N3SA 1YNXA 4OO1I
chains in the Genus database with same CATH superfamily
5ELFA 2K1BA 4HJ5A 2JA7G 5C0XJ 1KNAA 2VUMB 5HGTA 1PTOD 1PRTF 1TWFH 3MXGA 3WWVA 4RKBA 3J80c 3G4SA 1HNXL 3I7FA 2KJXA 2B2VC 1GUGA 4PZ8A 4J8QA 5KRUA 2D0OA 2Z4HA 4JI3Q 1Q46A 2CHBD 1WTQA 4ZKBB 2F4IA 4B3RL 1AZQA 3AYHB 5F2DA 5FO8B 3HG9A 3CCEA 3N52A 4ZYSA 3OMCA 1LT4D 2PZWA 3M4QA 4JCVE 1K8OA 5IE8A 1PYWD 2DY8A 4DNRB 2FMCA 3MVVA 5K36H 4K5XA 3D6CA 3S1NB 1Y1VH 4BBSG 3PIPA 4ABNA 3QOJA 2A19A 2Y0SB 5JPNC 2L0CA 2HQEA 1KAAA 3FVQA 3TSSA 2VQFL 3D3RA 1UEBA 5CGKA 2ID0A 3G7LA 4NXNL 5K5PA 4DAYA 4TQUS 2RDGA 1A2UA 1TT2A 1N8RC 2B2VA 1DCZA 1WFQA 5FLXL 4RCOA 1EQTA 1EQVA 1GHJA 4DNTB 4GOPB 2B2TA 2IJ0A 1EYCA 3D31A 2Y0SE 2IHFA 1STBA 1XNQL 2M9VA 1Y1WB 3CQZH 2RCFA 3QG1A 1X3QA 2CH4A 5JJZA 2RBMA 3TZDA 1HCZA 2A6ED 4NB3A 4NDXA 3KUPA 5ELCA 4TRDA 2OWOA 3BU2A 1J5EQ 5GAHC 2O2LD 2IX0A 1PH1A 5C4XH 4IUTA 3PGZA 4R4QA 3S1RB 4LF8Q 5FJ8G 1MD2D 1WCMH 2TMPA 4LWCA 4U673 1E0BA 3SK4A 5IP9G 1A62A 1TIID 3I2ZA 1RD9D 2F0KA 1I4RA 2F03A 4R1JA 4K6LA 1KHIA 2ZTEA 3KLSA 1VQJA 1K8GA 2L11A 3VYSA 2WACA 1KDAA 2PW7A 2A69C 2QKIC 2MP1A 1JWMD 4C3JH 3OSOA 1X3FA 2V1CC 1JJ2A 2IHEA 3QOLA 4WFN3 2HDLA 1BBXC 1IBML 3Q6SA 2NVQB 4X3UA 2EYOA 4P72A 4PZ6A 3RN2A 1E1OA 1KD1C 3NTKA 2R7ZH 1V43A 2Z1CA 3PUVA 1LTLA 2RDFA 2QILA 2NN6I 3QO2A 4KKTA 1LO5D 1SAPA 1EU3A 2VUMH 3S14B 4OWXB 1KRTA 1EZ8A 4JBWA 4GKKQ 1N36L 2XWBB 1N32L 3Q23A 3STBD 5D3DA 1GO3E 3T56B 1MSGA 3F2UA 3I4LA 1WI5A 4N9TA 1Q81C 2M00A 3OWEB 3RN5A 1UWVA 2F0VA 3U9SA 1PH6A 2F0TA 2E2IB 1NMFA 2KCMA 2ZJQA 1X3EA 1SE2A 4FF3A 1LABA 3GTLB 5M5YB 2O5IC 5EPKA 3M4OB 5LHY1 2XRSD 3HOWG 2BA1A 2P5ZX 2F3WA 2AQ2B 1VQGA 3T1YQ 3DXJC 1PXUA 2XNAC 1O7ZA 5IYCH 3BZKA 1ILPA 1KL9A 1FGUA 3A5ZB 3T1HL 3EBEA 4JYAQ 2FMMA 4DAPA 4WJ4A 1AH9A 3DWAA 3EIVA 3GV6A 3S16H 1IKMA 4JI1L 2VY3A 4DR2Q 3KBGA 5AFWA 3Q8DA 4JBKA 1EUJA 3PMFA 4CDDC 1PH8A 4IPHA 1XX8A 2MHVA 4XT1B 2HIXA 1I5FA 2UUAL 2EYMA 1EEFD 2R7FA 4A3LG 3GTPB 4BA1I 2B63G 3BYYB 2OF1A 3B6YA 1JE5A 1XPOA 4DR1Q 5C44G 5LMUQ 2EPBA 2F4VL 5JJKA 5J3BA 1K8AC 3W1GA 2E2JB 2C9OA 4ALPA 1TS2A 2EYJA 2BH8A 3VYUA 3L2PA 1L1OC 1H9JA 4KD3A 4YHHQ 2EXDA 1GVPA 2A68C 1TVXA 1XMOQ 4JBJA 4PV1C 3NBHB 4NW2A 1C9OA 1IW7C 1A3UA 3CPWA 4AH6A 1HNZQ 1EYDA 1TWHH 1QUQA 3H6MA 3CC2A 1CQVA 3FDTA 4XQQA 4WJWA 1W3SA 1I4PA 3EJIA 4POGA 2N8NA 3NSWA 3X3NA 2XIWA 3DEPA 4QCLA 3AEVA 1GHKA 4PQXA 2NVQH 1J6QA 3FHWA 3GTQB 1KAWA 2PPBC 4A93B 2JA6H 1N9WA 1V1PA 4LJZC 4ZCKA 1SNMA 1V8QA 1E24A 3HOUH 1WTWA 4OEMB 1BDOA 4FF2A 4IPDA 3MA2B 1L1OA 3DM3A 2D0PA 2JQOA 4R4CA 5D65A 1DGSA 1LM0A 1ENAA 3HOVB 2UXBQ 3GD7A 2EYHA 2K32A 4RHSA 2AWNA 5M9OA 4GN5A 1D5XC 3S17H 1VDZA 2JA7B 4FVMA 3CCJA 5IODA 4K2LA 1GUNA 4JI5L 3S24A 4JI7Q 1GKHA 3E5SA 2BE5D 2Z4IA 3M4OH 2PQAA 1VQ5A 2Z9HA 3FPUB 3G71A 2GA4B 4CGYB 3P1HA 1EFID 2JXMB 3R2TA 3OTOQ 4DUYQ 1ET6A 4Q0FA 2XN9C 2F3IA 3QIAA 4DR3Q 4L5RC 3RZOB 4DV5Q 3JC66 4BBSB 4QIWE 3GTPH 4BA2I 1F2MA 4C3JG 4JI4Q 5E4WC 2K5QA 2JK8A 1CKNB 2A5HA 2DGYA 4DV1L 1EYAA 1W6KA 4A3FH 1PZID 2N88A 4HJ8A 2JA5H 3M3YB 1M90C 1RKNA 4KV6A 1EEID 4DK0A 1ZYRC 2BA0A 4A3DG 1D2BA 2HUGA 3R2IA 3KF6A 2CQAA 1EZ6A 2CCZA 1PRTC 1QZHA 3S1QB 1EL0A 2JEBI 4X65Q 3ULJA 1F2ZA 1IL8A 4LK1C 2YTYA 3A7LA 2ASBA 3S1MH 1WTHA 2F0PA 4HCEA 4A93H 4RG1A 3NBIA 4DF7A 2ZXRA 3KF8A 4MTKA 4YWKA 2IPKD 4LW1A 5KNDA 1OXUA 2NZOA 1CUKA 2A1AA 2I46A 5HGQA 2PQEA 1YHAA 2I5LX 4FP5D 4A3IB 1OXXK 3ZYYX 4QJFA 4A3EB 4OO1H 2IX1A 4BBRG 3KYHC 1HQRD 4DNIA 4EX5A 3OYYA 4M8AA 4K2KA 1YNNC 2EY2A 4C1NI 1C8CA 4MNOA 2HDMA 4JG2A 1F9PA 4DV6L 3I4NG 4B3TL 1DJRD 5BR8Q 3RLFA 3SK8A 3H91A 4M1UB 1I50B 2YTVA 4G7OC 1NBWA 3NHHA 1JICA 1SSOA 4JI0L 1Z47A 1PDQA 2PYKA 4LUZA 1GD7A 2R93G 1SYEA 4IPGA 4FDBA 5KNCA 4DXFA 1SYCA 4KY5A 5T1IA 4F8MA 1PTOB 1NMGA 5IT9E 5ISRA 1YJNA 1PH2A 3LNNA 4LUVA 1JCKB 5KYIA 3ONAB 3RZOH 1JWSD 2YV5A 3HOWB 5EQ0A 1IYVA 1O7YA 1E22A 4ME5A 1H9SB 3CD6A 4BBSH 1X32A 3CC7A 3E6ZX 2UUBQ 4LF5L 1UNSA 1XJVA 1HJPA 1ASYA 4IZ8A 1AE2A 3CP0A 1IBKQ 3HGBA 1FL0A 5TSSA 2C5CA 1CA5A 2UUCQ 4RGTA 2OXPA 2N49A 2YU9B 2JA6G 4QMGA 2UUBL 5JEAG 4KY7A 3M3YH 1NY4A 4RGOS 1YNXA 5FKAC 3HOUG 2HHHL 2A69D 1EQRA 2KOLA 4FNFA 2K33A 3I73A 3MTSA 4UP8A 2IT1A 3F2BA 3C1FA 3CRKC 2UUCL 5C44B 3K58A 5ELEA 4CKBA 2A6HC 3U9OA 3J80E 4DA2A 5A35A 3GTMB 1HFNA 3HZXA 1B3QA 3D0FA 4XT3B 1C0AA 4HJ9A 4IJHA 3PIO3 1YJ9A 2XTIA 5A2QE 3A5UA 5CV6A 3WOEA 4X66L 1L2FA 2K5WA 3K80C 3MXNB 3CRLC 2KA7A 5DLQE 5FJ8H 1S5FD 1AP0A 1EWCA 3TN2A 1Q86C 5ELOA 4B9WA 3GO5A 2Z8LA 4JI8Q 5IP9H 4XYOA 4DV4Q 1CZGA 1SLJA 3BDLA 1CFMA 4YWMA 3NTIA 4S3SA 4B3SQ 2Q8TA 4UAIA 1FYCA 4HAEA 1PH3A 1KLGD 3W5OA 1O78A 2MFIA 5EPJA 2SDFA 2F0SA 4PMWA 2ATWA 2F0FA 1LUZA 5FK9C 3AFPA 2ALYB 2J4XA 1FR3A 2E5LQ 4CHTB 4LFBL 1JWUD 1K28A 3G6JB 2AQ1B 4C1NK 1CKOA 1V1OA 4DXGA 1QVCA 4A3GG 2JP1A 4A3JG 3J80L 1SJED 3IAYA 4HMJA 3HKZE 4WJ3M 3DLLA 4DV2Q 1QVGA 5HURA 1AN8A 2O5JC 5IGCA 1LT5D 2PCFB 4XXEA 2B2YC 3ZJYC 4X64Q 3OW7A 4A3FG 4UY8C 3E0JA 2JA5G 1LYLA 1OO9B 1PTOH 1HNWQ 1HUNA 1KDCA 3FMCA 4X62Q 5EGTA 2F0JA 3CQZB 2R7DA 3RR5A 1PTOF 1VMPA 4JW0A 4B3MQ 3HOWH 3K8AA 4A3BG 2EE1A 4RWSC 1NCVA 2Z6KA 4X62L 5M3FH 2A68D 3KLSX 3QR8A 2E75C 2MPMA 4DR7L 3FKIG 1EY4A 5HY6A 4EQ5A 1G291 2ZTCA 2QDLA 1RDPD 3GTOB 1IW7D 1VQCA 3UDGA 3L9AX 1N33Q 3U4ZA 3OMGA 1K0RA 4OGQC 3W3AA 4KHVA 3SDZA 2B2YA 2B2WC 2B63H 5E1FA 2Q2IA 1PYSB 3V05A 1TXYA 5C44H 1FJGL 4C3JB 3CHBD 3T51B 1HA6A 5I9OA 3GTMH 1VQ6A 1HNXQ 1D1IA 2K05A 1CSQA 2EJGC 1CK1A 1VQNA 3TP8A 2D5DA 1B50A 3KDFB 1NR4A 2UXCL 4YIJA 5FLXE 4B3RQ 4A3DB 5C4JH 1B70B 3EROA 3H0GG 1R4PB 3H3VC 1WYDA 3CCRA 1AE3A 4RA8A 2IY5B 1PH5A 4YCUA 3GP7A 2WV6D 1YJWA 3PUYA 1LT3D 1RTOA 1YBYA 3PO2G 4BY7G 1G91A 4HN7A 4RH6A 3IL8A 1YHBA 4ZK9B 5FOBB 1LACA 4K5VA 3K7AH 3BG3A 4UDUC 1YEZA 1W6JA 4NKLA 2VQFQ 4MZ9A 1TWAB 1STNA 3ERSX 4NXNQ 4XDXA 2RSNA 5C0XH 4Z9CB 3M7GA 2OTLA 2GVBA 1EY8A 3QB3A 2F0OA 1Y69U 2CKZB 3S16B 1B9NA 2KQ3A 3K0YA 5ELDA 1XNQQ 1VQDA 1G6ZA 2MJ8A 4A3MG 3J81E 3BVMA 2QEXA 1KRSA 2MO1A 1Y8OB 5JOBA 4DGZA 5LL6X 1I6VC 3T4AC 1I94L 2NVTH 3NK9A 3I4NB 4FO2A 2F0GA 5BN3A 1Y8NB 2EZVA 2O4XA 1A6XA 1Q7YC 1F9SA 4KJNA 1EIGA 3NPPA 3KFUA 5JVG3 2PW5A 2QDBA 3U4VA 1TY2A 1NNXA 4BY1H 3WDNA 2R93B 1ZYRD 3OHXC 2AWOA 1TR5A 4DUZL 1FNUA 2BDOA 1OTCA 1AW7A 1U9RA 3AB9A 4HR7B 3GTOH 1LTSD 1SEBD 1PRTD 1M4VA 3T53B 1X55A 3BDOA 3C3LA 2PMZB 2YYZA 1IBMQ 1F77A 4L5SA 3QWNA 1TWHB 5C3EH 1RODA 1ML0D 1YI2A 4DKAC 5IGDA 1X9NA 2XSCA 3VDYA 3J81L 1XXGA 2JA6B 5JAVA 4FF4A 2PMZE 1N36Q 5IGEA 1BCPB 3MAQA 2R92G 1D6EC 3HOUB 1RHPA 4QQBX 1N32Q 1QCBD 3S9WA 1ENFA 1SE4A 1SNQA 2K04A 3CCMA 1NAPA 4A3DH 1QE6A 3KBXA 1SRUA 4J6HA 2ZJPA 2EJFC 3DHQA 5BN4A 1TY0A 4Y7NH 5IIFA 2FINB 1SMXA 1YNND 2K6AA 5CV5A 4IALA 4IUQA 1DYQA 4DR5L 2DNCA 3H09A 1SYBA 3MC0B 4YY3L 4R4OA 5C6AA 2DNEA 4ILWA 3S17B 1L0YB 3PUXA 5KIXA 1TS4A 3I91A 3T1HQ 1RF2D 4R8IA 2NVXH 1TWAH 1D5ZC 5LL6S 3MFGA 3TP5A 1L0WA 1G51A 1VQAA 4JI1Q 2F0NA 3W2DA 1VCIA 1QJOA 2SNMA 4TKOB 3RUZA 1VQOA 1TS5A 5M3FG 4G4KA 2UUAQ 4JBMA 4IOAA 5EBDA 1Q1EA 2PO4A 3FRPB 3VR5A 4BBRH 5DM73 1UEAB 1YNJC 3DWPA 2F4VQ 1W2BA 1VS0A 4IFDI 3I4NH 1BR9A 2SNSA 1KQSA 2WINB 3L0OA 3I4OA 1HTLD 4LFCL 1EY0A 4P2CB 4A3GB 4DV3L 4A3JB 4HIOA 3A55A 3PIOA 1E7ZA 1CT1D 3H3VI 1XNRL 3I8ZA 1EY6A 2ENBA 1CHPD 1K83B 1E2VA 1QNUA 4AQYL 5H1SE 2LMCB 2HQLA 3JAME 1PV4A 1CHQD 4NXML 3OIPA 5CMDA 3CF5A 2R93H 4A3FB 2KEEA 3NEMA 2JA5B 3JAMi 2GVAA 2K01A 4RFBA 4XYQA 4CDCC 3J7ZC 3M7NA 1G2TA 2JE6I 3LX0A 4DV7L 4LF7L 5IGBA 1EIYB 1HFGA 1WTRA 3BVGA 1X54A 3QJYA 4I7ZC 1MGSA 2EYFA 1HXYD 4A3BB 4DK1A 3NXWA 4ZUIA 1I4HA 2G9DA 3I70A 4ZRZA 3HOXG 2F0WA 4O42A 1B7YB 1CKNA 5KGUA 4JI2L 2CW0C 3HS0C 1Z9FA 2DN8A 3PO3G 4OX9Q 3FKIB 3HKZG 3TP6A 4MTNA 1LTAD 3S1MB 4OWWB 2IX3A 3SK5A 1SE3A 3SE0A 2KCCA 4XIGS 3OWFA 1CSPA 4DK3C 5C5LA 5JEAH 4H02A 3C2PA 4IFDJ 1NTGA 2QEJC 2KHSA 1I3QH 1S5DD 1VQEA 2HCCA 5EPLA 5C0XG 3RLOA 4OX9L 1PVOA 1IXRA 2I5MX 3D8GA 2I0QA 1IZ6A 1QNKA 3P20A 1BCPF 2VB2X 4B08A 2CH4W 1ONLA 1UUPA 1VQBA 2EYPA 2ZM6L 5J39A 3CCVA 4JI5Q 3JAML 1K9MC 1T5EA 4BXXH 4LF4L 3PF5A 3AMUA 3CPFA 4H7BA 4AYBE 4G57A 4DPGA 3LGJA 4N8X1 2KUMA 3AU7A 3H0GB 4KKSA 3K5NA 4LMQD 5GROA 4G7HC 1PTOC 3GV3A 4MN3A 1IYUA 4JVZA 1NJIC 2K75A 1SYGA 3DEOA 4G7ZC 3I90A 1EY7A 1M8AA 4L8JA 2EY1A 3SK6A 4BY1G 4QIWB 3PO2B 4BY7B 5GAGC 3TEHB 2VZAA 1DOMA 2C35B 3CC4A 2J7ZA 3GTJB 3IFDA 3FPPA 4K14A 1MJEA 1STYA 1UAPA 3PF4A 4DV1Q 5I6WA 1U4MA 5IP7G 2H4OA 4OO1I 1XTDA 5C3EG 4A3GH 4A3JH 4Q5VA 3A56A 5M5XH 1SYFA 1K83H 4A3MB 4F88A 3A8KE 3K5MA 2JN4A 4IO9A 2JSOA 2RDHA 2J0TD 4N9PA 2RKSA 2VS1A 1OXVA 4X3KA 3PCOB 3GTKB 1OXSC 5E4XA 3KLRA 4DFAA 3PIP3 3HOYG 4A3BH 1I6HH 4KLKA 2A6EC 3CMAA 2R3ZA 4OHJA 3CAMA 4MHEA 3GTGH 1V1PB 2KVMA 1NE3A 1PH7A 3FKIH 3A54A 3K5OA 1SMYC 1UE1A 4CJ2C 4R4TA 1YIJA 3BVZA 3IRBA 5E3FA 1WTVA 1L1OB 1BQQT 1Q8IA 3K0XA 4HSPA 4QY7A 3MFYA 1GUOA 3BS1A 1J9OA 1S3OA 4KD4A 3EA6A 1B8AA 1S40A 3MXUA 4DV6Q 2D62A 3CCLA 4B3TQ 4CKEA 1HR0W 4ULLA 3TS2A 3OPOA 4N8FA 1T9HA 1PMRA 2RHSB 1Q8KA 2N78A 3MXNA 3I3CA 1HR0L 1JJCB 4ZKCB 2AUJD 4JI0Q 3KJOA 1YZ6A 1JQYD 1IYJB 3LWEA 4C3IH 3L3OC 2PQAB 3NE5B 3H0GH 1PH9A 4GS3A 5AJ3L 4LF9L 1X3GA 1STGA 5J22A 4ID6A 3K6OA 4KK7A 3CCUA 3PO2H 4BY7H 3CKIB 1ET9A 2KHJA 3STBC 1LTBD 1OXTA 2IWHA 4LF5Q 3ULLA 3RMHA 3GTJH 4H0LC 1JOOA 2ICIA 2EQSA 2HIVA 1ENCA 5G3LD 4GLVB 4QF4A 3PUWA 1H9RA 2E2DC 2NN6G 5JVH3 4L5QA 4QUFA 3TMEA 1VQLA 1TWGH 2CWAA 1KC8C 1G6PA 4QGUA 2H5XA 3IFTA 4PMCA 1K3BC 5M3FB 3NENA 5T1GA 1A2TA 2HHHQ 2F3VA 5FO7B 1S4ZA 2DY7A 5CV8A 3D4WA 5JPMC 1PFNA 4A3MH 3J7AV 3TDQA 1YITA 1H9KA 4LFAL 3KF6B 1GXDC 5IY0A 1IBLL 3UE1A 4ZQ3A 3GTKH 2B63B 1B1ZA 4X66Q 1LTRD 2OTJA 1JOQA 5COYA 3O13A 4KY6A 4A75A 4K8JA 5KNBA 4PG3A 3NP8A 4RAUC 2JA8H 1A0IA 1X3PA 3J80i 1XYIA 1GOZA 4BXXG 3UDIA 2BCOA 2E2HH 3F2DA 1A15A 3ITPA 5LMNW 4JV5L 5C4JB 1STEA 2ES2A 1C7YA 3BDCA 5LMNL 1WTXA 1A3VA 1KDBA 2FFKB 1SN8A 2VQEL 2G5DA 1G8ZD 3HOXB 1G2SA 4GZYC 4LFBQ 4YCVA 2ZXPA 2NB0A 3BZDB 2UU9Q 1Q90A 2SEBD 3HKZB 1RL2A 2R61A 3K7AB 3F2CA 1SR3A 2WIIB 4BS9A 3VA5A 2R92H 2MUYA 2F1MA 3FP9A 2E8GA 1X56A 2E76C 1BUVT 3UDFA 2UU9L 1TKWB 1LLRD 1GM5A 1ILQA 1JT8A 2NZHA 4GOPC 5CORA 1YNJD 1HUMA 2L15A 3K57A 5NUCA 1CTMA 1TS3A 4POFA 3D6WA 3E0EA 3SHLA 2B2UC 2MNAA 2F0HA 2NVTB 1S5BD 2AMCB 1SNDA 2E74C 4NMZA 2IL8A 4JOIC 2K7VA 3S2DH 4DR7Q 2PNHA 1FGBD 4IN3A 4JC0A 4Y52H 3MZ5A 2BE5C 4WRDA 1SXTA 1EIFA 3A74A 4BY1B 4IOCA 5C3WA 2UXDL 5ELBA 4UP9A 1B9MA 2QW7A 4JK1C 1XWEA 2AQ3B 1D7QA 3TP7A 2F0LA 4C3HG 1J8IA 1U4PA 1FJGQ 1V9PA 5CBAE 4X3SA 4GNXB 4GOPA 3HKSA 2OQ0A 2WB1G 4F87A 1FVIA 3J7YW 3CCSA 1SDFA 1O80A 1LTGD 2PZUA 4AYBG 2CW0D 1DZ1A 5I9PA 5C3EB 1SYDA 3J7A5 2B2UA 1MI2A 2BOSA 3E9HA 1SNOA 1SNPA 4JI6L 4LAAA 2UXCQ 1BCPC 4KKUA 5IT9c 1IL2A 4CBVA 1ICWA 5C3XA 4JOIA 1QZGA 4P71A 5CV9A 1JB3A 2ZTDA 1CZWA 3S2HB 2Z6BA 3RLNA 4J1MA 3NELA 4IPCA 1PHJA 1KXLA 1A63A 2JJQA 3RZDB 1VF5C 3A8JE 1BVSA 4FXKC 4FXDA 4C3IG 5KYLA 2EDGA 3PSIA 4IURA 5EKIA 1S5ED 1X6OA 2MQHA 3W1BA 4DN4M 3HOYB 4Y7NB 3J7AF 2WAQE 4K0KL 4OIKA 3HOXH 5I6YA 4RCNA 4L63B 1MJCA 3PO3H 4YCWA 2B2WA 4IJLA 5EJWA 1R9TH 1L0XB 4KJOA 5CR3A 2N55A 4J15A 2NVXB 5JJIA 4OELB 4GKJL 2L55A 3VR4A 3GDEA 2EIFA 4HSVA 1PLFA 3HOZG 1UE5A 3ND8A 2B39A 3MXPA 1TQOA 2B2TC 4IUUA 2LFNA 1I4QA 3HEJA 1I94Q 3S15B 2FHTA 1CA6A 1BBWA 2L5TA 1IHZA 1PFSA 5CV4A 4BBRB 4JI3L 1I4XA 4KTAA 2GN5A 2QA4A 3DWQA 2XWJB 3J81i 2NUCA 4C2MH 2EVBA 3ERQA 5M3MH 4K6DA 2XVSA 4DUZQ 2KBNA 3I56A 4GLXA 3WOFA 4CKCA 1SFOB 2WFWA 2JA8G 3DMUA 3A7AB 3OOCA 4C56C 2ZJRA 1MBYA 1AEXA 1RTNA 3M4YA 3K7UC 4DR6Q 4H13C 3GQBA 1DOKA 1JMCA 1Z7TA 4H44C 4LF6Q 4OIJA 2M2LA 4DU9A 5IP7H 1V1QA 4OXPA 3ULPA 2CQOA 4DR6L 4A3KH 1SMYD 2WKCA 3K59A 2RHQB 4LUOA 5EKKA 1MSHA 1CQFA 1AZPA 4LF6L 3F8TA 2F0IA 2L9HA 4HTHA 3S2HH 2RSOA 1J5EL 2LY7A 1S5CD 1Y14B 4DAMA 3RZDH 3ICEA 1VQHA 1I3QB 3FEWX 4LF8L 3TBIB 4DR5Q 3NBHA 2RQXA 4L6TB 2LS01 5IYDG 4YY3Q 5EBCA 1RIPA 4A3IG 4A3EG 5GADC 3RNUA 1HTPA 3CCQA 5DNFA 1XPUA 1BOSA 3PQIA 3HOYH 1P16A 4K5WA 2F0QA 1PZKD 5I4DA 2FXQA 3R8BA 2VB3X 3CMEA 1KLUD 1LV9A 1O7IA 2AHOB 2K4KA 2H1EA 3C46A 4A76A 2NVYB 1SE8A 5EKLA 4EGVA 3R93A 4KMUC 5IWAQ 3BYTB 4OONA 4IUPA 2IW3A 3MWYW 2A73B 3I55A 3BZCA 3I4MG 2I5HA 4KHPQ 2N3SA 3V2TA 5IWAL 4DAYB 3S15H 3M9BA 1I4GA 2TSSA 1B4OA 5FLXc 5E7NA 5I2YA 3AQQA 4GKKL 2B3GA 4LFCQ 1II3A 4A3CG 1WD0A 1A3TA 4DV3Q 1PA6A 3CXCA 1WTOA 5DM63 4V190 1U0LA 4KHPL 1XNRQ 1VMCA 3MEFA 1EWHA 1P8LA 3U58A 4I65A 4AQYQ 1K73C 2DJGC 4BWGB 3S1NH 3UE0A 2JEAI 1VQMA 4ZUJA 2RVLA 4NXMQ 3EFXD 1HZAA 1D5MC 1EY9A 1U4RA 1UE6A 4HEDA 2RA4A 1E2WA 1WOCA 4X3TA 3IKJA 5CBEE 3K5LA 4IQZA 4EQOA 1SNCA 5IYBG 1SFOH 1VQ4A 3KLWA 3NQTA 5M5XB 5FLMH 4DV7Q 1HPCA 3T1YL 4LF7Q 1S72A 1VQIA 2JA9A 2F52A 2AUKA 4JYAL 1H95A 1NUCA 3D4RA 2BH2A 4JI2Q 4UHVA 3SGIA 2A6HD 3E3XA 4DR2L 1Y1WH 4UPAA 4GLAC 5J1ZA 1GUWA 2NN6H 2VW9A 3NWTA 1GUTA 2K14A 3J81c 1I6HB 3VYTA 5C5MA 1ESRA 4DR1L 1B44D 3A0JA 5JEAJ 2PNRC 2Z0SA 3S1RH 3GTGB 4HMIA 5LMUL 1ASZA 4C3HB 2NTTA 4I7AA 1LT6D 2A74C 1PFBA 2R6GA 2ZM6Q 2QCPX 2WB1B 4FYDA 1XPRA 2K5NA 1VQPA 5M5WB 1PZJD 4LF4Q 3E9IA 4YHHL 4AYBB 4UP7A 3D4DA 1FNWA 1QB5D 1HZCA 3LWUA 3TS0A 1ZXTA 2D9UA 1XMOL 1XTCD 4NP5A 2BDNA 1DD2A 3M4PA 2L12A 2VNUD 1B2TA 4B9XA 1CI3M 5GQOA 1HNZL 1F9RA 2WB1E 3OIQA 4KI0A 4MIUA 4CDFC 2NVYH 5K36G 1Y1VG 2HT1A 4C3IB 5M3MG 3G6EA 3S14H 1ZEQX 5D14A 1VQ9A 1PH4A 1HHVA 4IFDH 1DOLA 2Q2TA 3H15A 4HIMA 5BN5A 1D1KA 1RCVD 3EVQA 3H3VH 2NTSA 3ER0A 1U4LA 3ND9A 1CM9A 5GAEC 2E2IH 5C4HA 2G9HD 2UXBL 3GTLH 1MHWC 4O0AA 3X3MA 5M5YH 2QF7A 2FJ2A 4HCSA 2Q8IB 1QWYA 3N6RA 3HOZB 5IOCA 3AFQA 1JORA 1C48A 1TWGB 4P73A 1FNVA 2CFMA 3T16A 2OQKA 4A3KG 3KJPA 5C4XG 4JI7L 1TU2B 4TVAB 1QG7A 1U5KA 1WCMG 4R8NA 4K8IA 3DUZA 2WAQG 3KOJA 4PZ7A 2JYOA 4DAVA 1KIXA 4GN3B 2V4DA 1BCPD 3OTOL 3L7ZC 1M1KC 4DUYL 3A8IE 1QUQB 4RGMA 2A8VA 1NR2A 2F0UA 3V96A 3H94A 1H9SA 4DR3L 4PNYA 1VQ7A 1K8MA 2E2JH 1BF4A 2JA8B 4DV5L 5L37A 1TWCB 2PZTA 3EQLC 4RHRA 3Q24A 2R7ZG 2E2HB 2F0EA 1LTID 4XTCS 4JI4L 4IUVA 4C3HH 4FF1A 1F9QA 4U68A 2VUMG 1IKLA 2L4NA 3P7JA 1KNEA 1ICFB 2EY5A 2LXJA 5G3LF 1JR0D 5M5WH 1WD1A 3VR6A 2ZT9C 1BO0A 2MO0A 2K50A 3JAMc 1HR0Q 3I72A 2LKVA 3TREA 1HQMC 4P75A 3TQYA 2PI2A 3NUCA 3SVMA 1O7LA 1VQ8A 3U50C 4PMBA 2NBFA 1BNZA 1FD7D 2KCTA 3M85A 1F2YA 4X65L 3GTQH 2ZXOA 1Q1BA 5AJ3Q 4LF9Q 1STAA 4ODGA 3SEBA 2R92B 1KTKA 5DAUA 4CJ0B 1AFPA 2ICEC 2VL6A 2I07B 5IYCG 5IGFA 2Y0SG 1C4QA 4L5TA 4HIDA 2KCNA 3SR1A 2OT2A 4O2DA 1RJTA 1D8LA 5FLMG 3HOVH 4LNQA 2YTXA 4NPSA 4XQNA 1F2LA 4F7XA 1LTTD 1BXTA 3Q0AA 1B3AA 3HP3A 2JA7H 5CC4A 3URYA 1Y1WG 1QOHA 4R4IA 3S2DB 3NTHA 4ZAIA 1EOTA 2EXZA 1E3PA 3HOZH 3I4MB 1JOKA 4LFAQ 4IUNA 2SOBA 5BR8L 4GNXC 1UE7A 1IBLQ 5ELNA 2OEOA 2NYZD 5C4ZA 2KECA 3TRZA 1QILA 4HJAA 1XMQQ 3K81C 4FXGC 1MIUA 2K5HA 1GUSA 4X6AH 1A8VA 2L1BA 1JB7A 3HFZB 1GJXA 1XMQL 4AIMA 4QB4A 5EAYA 4JV5Q 1X65A 2F0MA 3CU7A 2HCIA 1WJJA 2X6LA 4JPBW 2B29A 5LMNQ 2CWPA 1HH2P 1TWCH 1EYGA 3CW2C 5CYUA 3VR3A 3RD4A 3DM1A 5KEEA 2VQEQ 4HJ7A 2Q8RE 3KF8B 3C1EA 1T5XD 1IBKL 1BKBA 4GNXA 4APVA 1Y8PB 3G48A 3S1QH 4HIKA 2X69A 4IFDG 3BJUA 4DV0Q 4RGNA 1SJHD 5FO9B 3VA7A 2LXKA 1HZ9A 3PUZA 3UI2A 5IT9L 2RF4A 1WTPA 1PRTB 1HRJA 3PO3B 4CJ1B 4YWLA 1R9TB 1K3RA 2HD3A 4DV0L 3J81j 2PI2E 2CVRA 1TWFB 5IGGA 3KDFA 1EWIA 1BBUA 1ESFA 1DM0B 1EY5A 2XGTA 1HZBA 4TSSA 2K5DA 4RMFA 3TZUA 4A4IA 5IYDH 2K5VA 3NWSA 4KN7C 4DK6C 1N34Q 4JI8L 2DJFC 4DV4L 4A3IH 4A3EH 3NQIA 1Q12A 2NZ1D 4EVOA 2K03A 3R3OA 1YHQA 1CKMA 1EFWA 1JJGA 4EQPA 4B3SL 2Z6KC 4DR4Q 5CV7A 1VF7A 3MHBA 1SBBB 1SROA 1N34L 2EOTA 4C2MB 1Y1VB 3F1ZA 2B8FA 4GN4B 4OWTB 3VR2A 3VYRA 5M3MB 3Q22A 2UXDQ 2RCNA 1I50H 4EQNA 1MKHA 4ZLTF 1YVCA 4OL7A 1R4QB 3P75A 2DUDA 2QGQA 2E5LL 4DR4L 2B8GA 1JE4A 2K52A 2LSSA 3I4MH 4QL5A 2F0DA 5A2QL 1NSNS 2AKWB 5I2XA 4KN4C 2XRQD 2WKDA 4V0BA 1QVFA 5D3IB 4A3CH 4DV2L 2VXWA 4P74A 5JJLA 5C0XI 4JI6Q 1Q3LA 4RKLA 2EY6A 4WORA 4X64L 2D2CC 1HA5A 1WVLA 1EQQA 1STHA 2MGSA 1HNWL 3UDXA 2EYLA 3HRZC 4A3KB 3SXHA 1Z6HA 2KENA 5C4XB 4QUCA 5IYBH 4B3ML 4KHZA 1K0SA 1WCMB 2K28A 1VQKA 3KK7A 4A93G 2YU9H 2WP8J 3PV0A 4XQJA 4R9WA 2WAQB 1E2ZA 3OW2A 2KHIA 1EOVA 1E1TA 1DXMA 4ME3A 1EU4A 1KABA 4K0KQ 2Q2UA 1PYBA 1PFMA 2EJMA 2X6GA 4A3LH 2Q2HA 4O1NA 2OCEA 1B53A 2NWGA 1H9MA 1DONA 4E6IA 1N33L 4OO1G 5DEHA 1JC7A 3HOVG 3EN2A 1ZKOA 1EIHA 3MEHA 4GKJQ 3T13A 4CDEC 1Q82C 2KEDA 1VQFA 2R7ZB
chains in the Genus database with same CATH topology
2HHHL 1XTDA 1EQRA 5IWAL 5C3EG 4DAYB 3S15H 4A3GH 4A3JH 3M9BA 4HJ5A 2JA7G 4UP8A 5FLXc 2IT1A 5E7NA 5C0XJ 3F2BA 2UUCL 3AQQA 4GKKL 2B3GA 4LFCQ 4A3CG 1PA6A 1TWFH 5M5XH 4DV3Q 3WWVA 3CXCA 1K83H 3J80c 3G4SA 1HNXL 1U0LA 3I7FA 1XNRQ 4KHPL 3D0FA 4PZ8A 3MEFA 1C0AA 2D0OA 4HJ9A 4IO9A 1P8LA 4IJHA 1Q46A 4AQYQ 3U58A 1K73C 1YJ9A 4JI3Q 3S1NH 3UE0A 2XTIA 2JEAI 3A5UA 1VQMA 2VS1A 4NXMQ 4X66L 4B3RL 1L2FA 1OXVA 3MXNB 3K80C 3PCOB 1HZAA 3AYHB 1UE6A 5DLQE 5FJ8H 1OXSC 3CCEA 1WOCA 1Q86C 5ELOA 3GO5A 4JI8Q 5IP9H 4DV4Q 1SLJA 5IYBG 1SFOH 1VQ4A 3KLWA 5FLMH 3M4QA 4DV7Q 4JCVE 3HOYG 5IE8A 4A3BH 4YWMA 3T1YL 4LF7Q 1I6HH 1S72A 4KLKA 1VQIA 2JA9A 3CMAA 4B3SQ 2F52A 1Y1VH 4BBSG 3CAMA 3PIPA 4JYAL 1H95A 3GTGH 1PH3A 2A19A 1NE3A 1PH7A 3FKIH 2BH2A 3W5OA 1UE1A 4JI2Q 2MFIA 3SGIA 1Y1WH 4DR2L 4R4TA 2VQFL 1YIJA 1UEBA 2ID0A 4UPAA 3IRBA 4GLAC 4NXNL 4PMWA 1L1OB 2VW9A 2ATWA 1LUZA 2K14A 3K0XA 4TQUS 3J81c 3AFPA 4QY7A 2ALYB 2E5LQ 1N8RC 4LFBL 1WFQA 1CKOA 4DR1L 3A0JA 5JEAJ 2Z0SA 1S3OA 4GOPB 3S1RH 1QVCA 3D31A 5LMUL 1B8AA 2Y0SE 4DV6Q 1S40A 4A3JG 1ASZA 2IHFA 2D62A 3CCLA 4B3TQ 1XNQL 1HR0W 3CQZH 3HKZE 4WJ3M 3DLLA 3TS2A 4DV2Q 1QVGA 1T9HA 2RHSB 1Q8KA 2R6GA 4NB3A 2ZM6Q 2N78A 1HR0L 1JJCB 4JI0Q 3ZJYC 3KJOA 1YZ6A 2K5NA 4X64Q 1VQPA 1XPRA 2OWOA 3BU2A 4A3FG 3E9IA 1J5EQ 4YHHL 4LF4Q 4UY8C 4UP7A 1IYJB 5GAHC 1LYLA 2JA5G 4C3IH 2IX0A 1HZCA 3TS0A 1PH1A 2PQAB 5C4XH 1HNWQ 1XMOL 3PGZA 4R4QA 4LF8Q 4X62Q 5FJ8G 3H0GH 3M4PA 1PH9A 1WCMH 2VNUD 3RR5A 2R7DA 4LWCA 4GS3A 5IP9G 5AJ3L 5GQOA 1A62A 1X3GA 4B3MQ 4LF9L 3I2ZA 3HOWH 1HNZL 3K8AA 4R1JA 4A3BG 1KHIA 2WB1E 2ZTEA 1VQJA 1K8GA 3CCUA 3PO2H 4KI0A 4BY7H 2Z6KA 2NVYH 2KHJA 3STBC 5K36G 4X62L 5M3FH 1Y1VG 2HT1A 1OXTA 5M3MG 3G6EA 3S14H 4LF5Q 4DR7L 1VQ9A 3ULLA 4C3JH 3FKIG 1X3FA 5HY6A 4EQ5A 3GTJH 1G291 1PH4A 2ZTCA 2V1CC 1JJ2A 2IHEA 2EQSA 2HIVA 2Q2TA 4GLVB 3H15A 1IBML 3PUWA 1VQCA 2NN6G 4P72A 4PZ6A 3UDGA 4HIMA 1N33Q 3U4ZA 4L5QA 3RN2A 1K0RA 1E1OA 1KD1C 1VQLA 1TWGH 1V43A 2CWAA 1KC8C 2R7ZH 3PUVA 1G6PA 1LTLA 3H3VH 4QGUA 2H5XA 3ER0A 2B63H 2NN6I 2Q2IA 3NENA 2HHHQ 2VUMH 1PYSB 1TXYA 5C44H 4OWXB 5GAEC 1FJGL 2E2IH 1KRTA 4A3MH 1YITA 2UXBL 4JBWA 1VQ6A 3GTMH 4O0AA 5M5YH 3GTLH 1N36L 4GKKQ 1N32L 1HNXQ 4LFAL 3STBD 1GO3E 1CSQA 1VQNA 3KF6B 3AFQA 4P73A 5IY0A 1IBLL 3UE1A 2CFMA 1WI5A 3KDFB 1Q81C 2UXCL 2OQKA 4A3KG 3GTKH 3RN5A 1UWVA 4X66Q 3KJPA 4B3RQ 5C4JH 2OTJA 5C4XG 1B70B 1PH6A 4JI7L 4A75A 3H0GG 1NMFA 2KCMA 1U5KA 1WCMG 4TVAB 1WYDA 4PG3A 3CCRA 1X3EA 2ZJQA 1AE3A 2JA8H 2IY5B 1A0IA 1PH5A 4YCUA 2WAQG 3J80i 3HOWG 4BXXG 3KOJA 3UDIA 1YJWA 2BA1A 3T1YQ 1VQGA 3PUYA 4PZ7A 1YBYA 3PO2G 2E2HH 1KIXA 4BY7G 1VQFA 4GN3B 3F2DA 5IYCH 3BZKA 1KL9A 5LMNW 1FGUA 1YHBA 3A5ZB 3EBEA 3L7ZC 3OTOL 3T1HL 4DUYL 1M1KC 4JYAQ 4JV5L 1QUQB 2A8VA 4WJ4A 1AH9A 3S16H 3EIVA 2ES2A 1C7YA 3K7AH 4JI1L 4DR3L 1YEZA 5LMNL 2VY3A 4DR2Q 2VQFQ 1VQ7A 4MZ9A 3Q8DA 2E2JH 4DV5L 4JBKA 3ERSX 4NXNQ 3HOUG 1SN8A 1EUJA 2VQEL 4A3GG 1PH8A 4IPHA 2HIXA 1I5FA 2UUAL 2R7ZG 4LFBQ 2OTLA 4YCVA 2GVBA 2R7FA 4XTCS 4JI4L 4A3LG 4BA1I 2B63G 3B6YA 4C3HH 1JE5A 1XPOA 4DR1Q 2UU9Q 2VUMG 2CKZB 5C44G 1RL2A 5LMUQ 3F2CA 2F4VL 2LXJA 1XNQQ 1VQDA 5JJKA 5J3BA 4A3MG 1K8AC 2QEXA 1SR3A 1KRSA 2MO1A 3W1GA 5M5WH 2R92H 4ALPA 3FP9A 2MO0A 2K50A 2BH8A 2E8GA 3JAMc 1X56A 1HR0Q 3TREA 3L2PA 1L1OC 4P75A 3TQYA 2PI2A 3UDFA 1I94L 2UU9L 1VQ8A 2NVTH 3U50C 4YHHQ 2EXDA 1GVPA 1GM5A 1Q7YC 1XMOQ 1JT8A 4JBJA 2NZHA 2KCTA 4GOPC 3NBHB 3M85A 4X65L 2L15A 3GTQH 3KFUA 1C9OA 1Q1BA 5AJ3Q 4LF9Q 3U4VA 4POFA 3CPWA 3E0EA 4AH6A 1HNZQ 1TWHH 4BY1H 1QUQA 2MNAA 3CC2A 2AWOA 4DUZL 1W3SA 2AMCB 2VL6A 5IYCG 4POGA 2N8NA 2Y0SG 1OTCA 4L5TA 3GTOH 4JOIC 4HIDA 3AEVA 3S2DH 4DR7Q 2NVQH 4O2DA 2PNHA 1J6QA 3FHWA 1D8LA 1KAWA 4JC0A 5FLMG 2JA6H 3HOVH 1X55A 1N9WA 4LNQA 4Y52H 2YTXA 4NPSA 2YYZA 1IBMQ 1E24A 1EIFA 3A74A 4L5SA 3HOUH 5C3EH 4IOCA 2UXDL 4UP9A 4IPDA 2JA7H 1YI2A 1L1OA 3DM3A 1D7QA 4DKAC 2D0PA 2JQOA 1X9NA 3VDYA 1Y1WG 4R4CA 4R4IA 1FJGQ 1V9PA 1DGSA 1LM0A 4GNXB 1E3PA 4GOPA 3HKSA 2OQ0A 3HOZH 3GD7A 2UXBQ 2PMZE 2WB1G 1FVIA 3CCSA 1N36Q 2AWNA 4GN5A 2R92G 1N32Q 4QQBX 4AYBG 4LFAQ 3CCMA 5BR8L 4GNXC 3J7A5 3S17H 3E9HA 4A3DH 1UE7A 1IBLQ 5ELNA 4JI6L 2UXCQ 3CCJA 5IT9c 4JI5L 1SRUA 3S24A 2ZJPA 1IL2A 3TRZA 4JI7Q 1GKHA 4JOIA 4HJAA 3K81C 1XMQQ 4Y7NH 1QZGA 4P71A 3M4OH 1MIUA 2PQAA 1SMXA 2ZTDA 3RLNA 4DR5L 3NELA 2K5HA 4IPCA 1PHJA 1KXLA 1A63A 4X6AH 1A8VA 1VQ5A 2JJQA 1JB7A 4YY3L 1BVSA 4R4OA 3HFZB 3G71A 3PSIA 3PUXA 1XMQL 4AIMA 5EAYA 3T1HQ 1X6OA 3OTOQ 4JV5Q 4DUYQ 1X65A 2NVXH 2MQHA 1TWAH 3W1BA 1WJJA 2F3IA 1L0WA 1G51A 1VQAA 2B29A 4JI1Q 5LMNQ 2CWPA 4DR3Q 1HH2P 4L5RC 1VCIA 1TWCH 2WAQE 1EYGA 3CW2C 4K0KL 3HOXH 4DV5Q 3JC66 2VQEQ 4HJ7A 1VQOA 4QIWE 1MJCA 3GTPH 3KF8B 5M3FG 4BA2I 3PO3H 2UUAQ 4YCWA 1IBKL 4IJLA 1BKBA 4JBMA 4GNXA 1R9TH 4IOAA 4JI4Q 4APVA 1Q1EA 2JK8A 1CKNB 3G48A 4BBRH 3S1QH 4HIKA 4IFDG 4J15A 3BJUA 5JJIA 2DGYA 4DV1L 4DV0Q 2F4VQ 4GKJL 1W2BA 1VS0A 3GDEA 2EIFA 3HOZG 4A3FH 1UE5A 2LXKA 4HJ8A 4IFDI 2JA5H 3I4NH 1HZ9A 3PUZA 1M90C 2RF4A 1KQSA 3L0OA 2BA0A 3I4OA 4LFCL 1I94Q 4YWLA 4A3DG 4DV3L 4HIOA 3PIOA 1K3RA 4DV0L 1E7ZA 3KF6A 1BBWA 3J81j 1XNRL 1PFSA 2CCZA 2PI2E 1QZHA 3H3VI 3KDFA 4JI3L 1EWIA 1BBUA 4AQYL 2JEBI 4X65Q 2GN5A 5H1SE 2QA4A 2HQLA 1PV4A 3J81i 4NXML 2R93H 2XGTA 3ULJA 3CF5A 3NEMA 4C2MH 1HZBA 4RMFA 4A4IA 3JAMi 2GVAA 5IYDH 2K5VA 5M3MH 2YTYA 4DK6C 1N34Q 4JI8L 3J7ZC 4DV4L 4A3IH 4A3EH 1Q12A 4DUZQ 3M7NA 2JE6I 2KBNA 3I56A 4DV7L 4GLXA 2ASBA 3S1MH 4LF7L 1EIYB 4A93H 1YHQA 1CKMA 1X54A 4RG1A 1EFWA 1JJGA 2WFWA 2JA8G 4B3SL 4YWKA 4LW1A 1OXUA 2Z6KC 2ZJRA 4DR4Q 2NZOA 1CUKA 2A1AA 1SROA 1N34L 3HOXG 1B7YB 1CKNA 4JI2L 3F1ZA 5HGQA 4GN4B 4OWTB 1YHAA 2I5LX 1Z9FA 3PO3G 3K7UC 4DR6Q 2RCNA 4OX9Q 2UXDQ 1OXXK 4QJFA 3HKZG 1I50H 1MKHA 4MTNA 1YVCA 4OWWB 2IX1A 1JMCA 4BBRG 2DUDA 2QGQA 3KYHC 4XIGS 2E5LL 4LF6Q 4DR4L 1CSPA 4DK3C 4DNIA 2K52A 2LSSA 3OYYA 4H02A 4EX5A 3I4MH 4QL5A 5IP7H 4IFDJ 1NTGA 1V1QA 1I3QH 4OXPA 2AKWB 3ULPA 1VQEA 4MNOA 2CQOA 4JG2A 5C0XG 3RLOA 4OX9L 4DR6L 4A3KH 4DV6L 3I4NG 1IXRA 2I5MX 2I0QA 1PVOA 1IZ6A 4B3TL 1QVFA 2RHQB 4LUOA 5BR8Q 3RLFA 4DV2L 4A3CH 4P74A 5JJLA 4LF6L 5C0XI 1VQBA 3F8TA 4JI6Q 2YTVA 2ZM6L 3CCVA 1NBWA 4JI5Q 1K9MC 4JI0L 1Z47A 3S2HH 4X64L 4BXXH 1J5EL 4LF4L 3PF5A 1EQQA 1Y14B 4DAMA 3RZDH 3ICEA 4LUZA 1HNWL 1GD7A 1VQHA 3CPFA 2R93G 4IPGA 4FDBA 3UDXA 4AYBE 4DR5Q 4LF8L 4DPGA 3LGJA 5IYDG 4YY3Q 1NMGA 2KENA 1YJNA 1RIPA 5IYBH 4A3IG 4A3EG 1PH2A 4B3ML 5GADC 3RNUA 3CCQA 4KHZA 1XPUA 5GROA 4LUVA 3HOYH 1VQKA 1P16A 4A93G 2YU9H 2WP8J 3PV0A 3RZOH 2FXQA 2YV5A 1NJIC 2K75A 3CMEA 3OW2A 2KHIA 1E22A 4BBSH 3CD6A 1EOVA 1E1TA 1O7IA 3CC7A 4BY1G 2AHOB 2K4KA 4ME3A 2UUBQ 2Q2UA 4LF5L 4A76A 1PYBA 1HJPA 1XJVA 1ASYA 1SE8A 4K0KQ 2Q2HA 5GAGC 4A3LH 2OCEA 3TEHB 2VZAA 5IWAQ 1AE2A 3CP0A 2C35B 4OONA 3CC4A 1IBKQ 1FL0A 1N33L 4OO1G 2UUCQ 1MJEA 2N49A 1Q82C 2JA6G 3I55A 3HOVG 3EN2A 2UUBL 3PF4A 3BZCA 5JEAG 4DV1Q 2I5HA 3I4MG 3M3YH 5IP7G 4GKJQ 4KHPQ 1NY4A 2N3SA 1YNXA 4OO1I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH L;  1XTD A;  1EQR A;  5IWA L;  5C3E G;  4DAY B;  3S15 H;  4A3G H;  4A3J H;  3M9B A;  4HJ5 A;  2JA7 G;  4UP8 A;  5FLX c;  2IT1 A;  5E7N A;  5C0X J;  3F2B A;  2UUC L;  3AQQ A;  4GKK L;  2B3G A;  4LFC Q;  4A3C G;  1PA6 A;  1TWF H;  5M5X H;  4DV3 Q;  3WWV A;  3CXC A;  1K83 H;  3J80 c;  3G4S A;  1HNX L;  1U0L A;  3I7F A;  1XNR Q;  4KHP L;  3D0F A;  4PZ8 A;  3MEF A;  1C0A A;  2D0O A;  4HJ9 A;  4IO9 A;  1P8L A;  4IJH A;  1Q46 A;  4AQY Q;  3U58 A;  1K73 C;  1YJ9 A;  4JI3 Q;  3S1N H;  3UE0 A;  2XTI A;  2JEA I;  3A5U A;  1VQM A;  2VS1 A;  4NXM Q;  4X66 L;  4B3R L;  1L2F A;  1OXV A;  3MXN B;  3K80 C;  3PCO B;  1HZA A;  3AYH B;  1UE6 A;  5DLQ E;  5FJ8 H;  1OXS C;  3CCE A;  1WOC A;  1Q86 C;  5ELO A;  3GO5 A;  4JI8 Q;  5IP9 H;  4DV4 Q;  1SLJ A;  5IYB G;  1SFO H;  1VQ4 A;  3KLW A;  5FLM H;  3M4Q A;  4DV7 Q;  4JCV E;  3HOY G;  5IE8 A;  4A3B H;  4YWM A;  3T1Y L;  4LF7 Q;  1I6H H;  1S72 A;  4KLK A;  1VQI A;  2JA9 A;  3CMA A;  4B3S Q;  2F52 A;  1Y1V H;  4BBS G;  3CAM A;  3PIP A;  4JYA L;  1H95 A;  3GTG H;  1PH3 A;  2A19 A;  1NE3 A;  1PH7 A;  3FKI H;  2BH2 A;  3W5O A;  1UE1 A;  4JI2 Q;  2MFI A;  3SGI A;  1Y1W H;  4DR2 L;  4R4T A;  2VQF L;  1YIJ A;  1UEB A;  2ID0 A;  4UPA A;  3IRB A;  4GLA C;  4NXN L;  4PMW A;  1L1O B;  2VW9 A;  2ATW A;  1LUZ A;  2K14 A;  3K0X A;  4TQU S;  3J81 c;  3AFP A;  4QY7 A;  2ALY B;  2E5L Q;  1N8R C;  4LFB L;  1WFQ A;  1CKO A;  4DR1 L;  3A0J A;  5JEA J;  2Z0S A;  1S3O A;  4GOP B;  3S1R H;  1QVC A;  3D31 A;  5LMU L;  1B8A A;  2Y0S E;  4DV6 Q;  1S40 A;  4A3J G;  1ASZ A;  2IHF A;  2D62 A;  3CCL A;  4B3T Q;  1XNQ L;  1HR0 W;  3CQZ H;  3HKZ E;  4WJ3 M;  3DLL A;  3TS2 A;  4DV2 Q;  1QVG A;  1T9H A;  2RHS B;  1Q8K A;  2R6G A;  4NB3 A;  2ZM6 Q;  2N78 A;  1HR0 L;  1JJC B;  4JI0 Q;  3ZJY C;  3KJO A;  1YZ6 A;  2K5N A;  4X64 Q;  1VQP A;  1XPR A;  2OWO A;  3BU2 A;  4A3F G;  3E9I A;  1J5E Q;  4YHH L;  4LF4 Q;  4UY8 C;  4UP7 A;  1IYJ B;  5GAH C;  1LYL A;  2JA5 G;  4C3I H;  2IX0 A;  1HZC A;  3TS0 A;  1PH1 A;  2PQA B;  5C4X H;  1HNW Q;  1XMO L;  3PGZ A;  4R4Q A;  4LF8 Q;  4X62 Q;  5FJ8 G;  3H0G H;  3M4P A;  1PH9 A;  1WCM H;  2VNU D;  3RR5 A;  2R7D A;  4LWC A;  4GS3 A;  5IP9 G;  5AJ3 L;  5GQO A;  1A62 A;  1X3G A;  4B3M Q;  4LF9 L;  3I2Z A;  3HOW H;  1HNZ L;  3K8A A;  4R1J A;  4A3B G;  1KHI A;  2WB1 E;  2ZTE A;  1VQJ A;  1K8G A;  3CCU A;  3PO2 H;  4KI0 A;  4BY7 H;  2Z6K A;  2NVY H;  2KHJ A;  3STB C;  5K36 G;  4X62 L;  5M3F H;  1Y1V G;  2HT1 A;  1OXT A;  5M3M G;  3G6E A;  3S14 H;  4LF5 Q;  4DR7 L;  1VQ9 A;  3ULL A;  4C3J H;  3FKI G;  1X3F A;  5HY6 A;  4EQ5 A;  3GTJ H;  1G29 1;  1PH4 A;  2ZTC A;  2V1C C;  1JJ2 A;  2IHE A;  2EQS A;  2HIV A;  2Q2T A;  4GLV B;  3H15 A;  1IBM L;  3PUW A;  1VQC A;  2NN6 G;  4P72 A;  4PZ6 A;  3UDG A;  4HIM A;  1N33 Q;  3U4Z A;  4L5Q A;  3RN2 A;  1K0R A;  1E1O A;  1KD1 C;  1VQL A;  1TWG H;  1V43 A;  2CWA A;  1KC8 C;  2R7Z H;  3PUV A;  1G6P A;  1LTL A;  3H3V H;  4QGU A;  2H5X A;  3ER0 A;  2B63 H;  2NN6 I;  2Q2I A;  3NEN A;  2HHH Q;  2VUM H;  1PYS B;  1TXY A;  5C44 H;  4OWX B;  5GAE C;  1FJG L;  2E2I H;  1KRT A;  4A3M H;  1YIT A;  2UXB L;  4JBW A;  1VQ6 A;  3GTM H;  4O0A A;  5M5Y H;  3GTL H;  1N36 L;  4GKK Q;  1N32 L;  1HNX Q;  4LFA L;  3STB D;  1GO3 E;  1CSQ A;  1VQN A;  3KF6 B;  3AFQ A;  4P73 A;  5IY0 A;  1IBL L;  3UE1 A;  2CFM A;  1WI5 A;  3KDF B;  1Q81 C;  2UXC L;  2OQK A;  4A3K G;  3GTK H;  3RN5 A;  1UWV A;  4X66 Q;  3KJP A;  4B3R Q;  5C4J H;  2OTJ A;  5C4X G;  1B70 B;  1PH6 A;  4JI7 L;  4A75 A;  3H0G G;  1NMF A;  2KCM A;  1U5K A;  1WCM G;  4TVA B;  1WYD A;  4PG3 A;  3CCR A;  1X3E A;  2ZJQ A;  1AE3 A;  2JA8 H;  2IY5 B;  1A0I A;  1PH5 A;  4YCU A;  2WAQ G;  3J80 i;  3HOW G;  4BXX G;  3KOJ A;  3UDI A;  1YJW A;  2BA1 A;  3T1Y Q;  1VQG A;  3PUY A;  4PZ7 A;  1YBY A;  3PO2 G;  2E2H H;  1KIX A;  4BY7 G;  1VQF A;  4GN3 B;  3F2D A;  5IYC H;  3BZK A;  1KL9 A;  5LMN W;  1FGU A;  1YHB A;  3A5Z B;  3EBE A;  3L7Z C;  3OTO L;  3T1H L;  4DUY L;  1M1K C;  4JYA Q;  4JV5 L;  1QUQ B;  2A8V A;  4WJ4 A;  1AH9 A;  3S16 H;  3EIV A;  2ES2 A;  1C7Y A;  3K7A H;  4JI1 L;  4DR3 L;  1YEZ A;  5LMN L;  2VY3 A;  4DR2 Q;  2VQF Q;  1VQ7 A;  4MZ9 A;  3Q8D A;  2E2J H;  4DV5 L;  4JBK A;  3ERS X;  4NXN Q;  3HOU G;  1SN8 A;  1EUJ A;  2VQE L;  4A3G G;  1PH8 A;  4IPH A;  2HIX A;  1I5F A;  2UUA L;  2R7Z G;  4LFB Q;  2OTL A;  4YCV A;  2GVB A;  2R7F A;  4XTC S;  4JI4 L;  4A3L G;  4BA1 I;  2B63 G;  3B6Y A;  4C3H H;  1JE5 A;  1XPO A;  4DR1 Q;  2UU9 Q;  2VUM G;  2CKZ B;  5C44 G;  1RL2 A;  5LMU Q;  3F2C A;  2F4V L;  2LXJ A;  1XNQ Q;  1VQD A;  5JJK A;  5J3B A;  4A3M G;  1K8A C;  2QEX A;  1SR3 A;  1KRS A;  2MO1 A;  3W1G A;  5M5W H;  2R92 H;  4ALP A;  3FP9 A;  2MO0 A;  2K50 A;  2BH8 A;  2E8G A;  3JAM c;  1X56 A;  1HR0 Q;  3TRE A;  3L2P A;  1L1O C;  4P75 A;  3TQY A;  2PI2 A;  3UDF A;  1I94 L;  2UU9 L;  1VQ8 A;  2NVT H;  3U50 C;  4YHH Q;  2EXD A;  1GVP A;  1GM5 A;  1Q7Y C;  1XMO Q;  1JT8 A;  4JBJ A;  2NZH A;  2KCT A;  4GOP C;  3NBH B;  3M85 A;  4X65 L;  2L15 A;  3GTQ H;  3KFU A;  1C9O A;  1Q1B A;  5AJ3 Q;  4LF9 Q;  3U4V A;  4POF A;  3CPW A;  3E0E A;  4AH6 A;  1HNZ Q;  1TWH H;  4BY1 H;  1QUQ A;  2MNA A;  3CC2 A;  2AWO A;  4DUZ L;  1W3S A;  2AMC B;  2VL6 A;  5IYC G;  4POG A;  2N8N A;  2Y0S G;  1OTC A;  4L5T A;  3GTO H;  4JOI C;  4HID A;  3AEV A;  3S2D H;  4DR7 Q;  2NVQ H;  4O2D A;  2PNH A;  1J6Q A;  3FHW A;  1D8L A;  1KAW A;  4JC0 A;  5FLM G;  2JA6 H;  3HOV H;  1X55 A;  1N9W A;  4LNQ A;  4Y52 H;  2YTX A;  4NPS A;  2YYZ A;  1IBM Q;  1E24 A;  1EIF A;  3A74 A;  4L5S A;  3HOU H;  5C3E H;  4IOC A;  2UXD L;  4UP9 A;  4IPD A;  2JA7 H;  1YI2 A;  1L1O A;  3DM3 A;  1D7Q A;  4DKA C;  2D0P A;  2JQO A;  1X9N A;  3VDY A;  1Y1W G;  4R4C A;  4R4I A;  1FJG Q;  1V9P A;  1DGS A;  1LM0 A;  4GNX B;  1E3P A;  4GOP A;  3HKS A;  2OQ0 A;  3HOZ H;  3GD7 A;  2UXB Q;  2PMZ E;  2WB1 G;  1FVI A;  3CCS A;  1N36 Q;  2AWN A;  4GN5 A;  2R92 G;  1N32 Q;  4QQB X;  4AYB G;  4LFA Q;  3CCM A;  5BR8 L;  4GNX C;  3J7A 5;  3S17 H;  3E9H A;  4A3D H;  1UE7 A;  1IBL Q;  5ELN A;  4JI6 L;  2UXC Q;  3CCJ A;  5IT9 c;  4JI5 L;  1SRU A;  3S24 A;  2ZJP A;  1IL2 A;  3TRZ A;  4JI7 Q;  1GKH A;  4JOI A;  4HJA A;  3K81 C;  1XMQ Q;  4Y7N H;  1QZG A;  4P71 A;  3M4O H;  1MIU A;  2PQA A;  1SMX A;  2ZTD A;  3RLN A;  4DR5 L;  3NEL A;  2K5H A;  4IPC A;  1PHJ A;  1KXL A;  1A63 A;  4X6A H;  1A8V A;  1VQ5 A;  2JJQ A;  1JB7 A;  4YY3 L;  1BVS A;  4R4O A;  3HFZ B;  3G71 A;  3PSI A;  3PUX A;  1XMQ L;  4AIM A;  5EAY A;  3T1H Q;  1X6O A;  3OTO Q;  4JV5 Q;  4DUY Q;  1X65 A;  2NVX H;  2MQH A;  1TWA H;  3W1B A;  1WJJ A;  2F3I A;  1L0W A;  1G51 A;  1VQA A;  2B29 A;  4JI1 Q;  5LMN Q;  2CWP A;  4DR3 Q;  1HH2 P;  4L5R C;  1VCI A;  1TWC H;  2WAQ E;  1EYG A;  3CW2 C;  4K0K L;  3HOX H;  4DV5 Q;  3JC6 6;  2VQE Q;  4HJ7 A;  1VQO A;  4QIW E;  1MJC A;  3GTP H;  3KF8 B;  5M3F G;  4BA2 I;  3PO3 H;  2UUA Q;  4YCW A;  1IBK L;  4IJL A;  1BKB A;  4JBM A;  4GNX A;  1R9T H;  4IOA A;  4JI4 Q;  4APV A;  1Q1E A;  2JK8 A;  1CKN B;  3G48 A;  4BBR H;  3S1Q H;  4HIK A;  4IFD G;  4J15 A;  3BJU A;  5JJI A;  2DGY A;  4DV1 L;  4DV0 Q;  2F4V Q;  4GKJ L;  1W2B A;  1VS0 A;  3GDE A;  2EIF A;  3HOZ G;  4A3F H;  1UE5 A;  2LXK A;  4HJ8 A;  4IFD I;  2JA5 H;  3I4N H;  1HZ9 A;  3PUZ A;  1M90 C;  2RF4 A;  1KQS A;  3L0O A;  2BA0 A;  3I4O A;  4LFC L;  1I94 Q;  4YWL A;  4A3D G;  4DV3 L;  4HIO A;  3PIO A;  1K3R A;  4DV0 L;  1E7Z A;  3KF6 A;  1BBW A;  3J81 j;  1XNR L;  1PFS A;  2CCZ A;  2PI2 E;  1QZH A;  3H3V I;  3KDF A;  4JI3 L;  1EWI A;  1BBU A;  4AQY L;  2JEB I;  4X65 Q;  2GN5 A;  5H1S E;  2QA4 A;  2HQL A;  1PV4 A;  3J81 i;  4NXM L;  2R93 H;  2XGT A;  3ULJ A;  3CF5 A;  3NEM A;  4C2M H;  1HZB A;  4RMF A;  4A4I A;  3JAM i;  2GVA A;  5IYD H;  2K5V A;  5M3M H;  2YTY A;  4DK6 C;  1N34 Q;  4JI8 L;  3J7Z C;  4DV4 L;  4A3I H;  4A3E H;  1Q12 A;  4DUZ Q;  3M7N A;  2JE6 I;  2KBN A;  3I56 A;  4DV7 L;  4GLX A;  2ASB A;  3S1M H;  4LF7 L;  1EIY B;  4A93 H;  1YHQ A;  1CKM A;  1X54 A;  4RG1 A;  1EFW A;  1JJG A;  2WFW A;  2JA8 G;  4B3S L;  4YWK A;  4LW1 A;  1OXU A;  2Z6K C;  2ZJR A;  4DR4 Q;  2NZO A;  1CUK A;  2A1A A;  1SRO A;  1N34 L;  3HOX G;  1B7Y B;  1CKN A;  4JI2 L;  3F1Z A;  5HGQ A;  4GN4 B;  4OWT B;  1YHA A;  2I5L X;  1Z9F A;  3PO3 G;  3K7U C;  4DR6 Q;  2RCN A;  4OX9 Q;  2UXD Q;  1OXX K;  4QJF A;  3HKZ G;  1I50 H;  1MKH A;  4MTN A;  1YVC A;  4OWW B;  2IX1 A;  1JMC A;  4BBR G;  2DUD A;  2QGQ A;  3KYH C;  4XIG S;  2E5L L;  4LF6 Q;  4DR4 L;  1CSP A;  4DK3 C;  4DNI A;  2K52 A;  2LSS A;  3OYY A;  4H02 A;  4EX5 A;  3I4M H;  4QL5 A;  5IP7 H;  4IFD J;  1NTG A;  1V1Q A;  1I3Q H;  4OXP A;  2AKW B;  3ULP A;  1VQE A;  4MNO A;  2CQO A;  4JG2 A;  5C0X G;  3RLO A;  4OX9 L;  4DR6 L;  4A3K H;  4DV6 L;  3I4N G;  1IXR A;  2I5M X;  2I0Q A;  1PVO A;  1IZ6 A;  4B3T L;  1QVF A;  2RHQ B;  4LUO A;  5BR8 Q;  3RLF A;  4DV2 L;  4A3C H;  4P74 A;  5JJL A;  4LF6 L;  5C0X I;  1VQB A;  3F8T A;  4JI6 Q;  2YTV A;  2ZM6 L;  3CCV A;  1NBW A;  4JI5 Q;  1K9M C;  4JI0 L;  1Z47 A;  3S2H H;  4X64 L;  4BXX H;  1J5E L;  4LF4 L;  3PF5 A;  1EQQ A;  1Y14 B;  4DAM A;  3RZD H;  3ICE A;  4LUZ A;  1HNW L;  1GD7 A;  1VQH A;  3CPF A;  2R93 G;  4IPG A;  4FDB A;  3UDX A;  4AYB E;  4DR5 Q;  4LF8 L;  4DPG A;  3LGJ A;  5IYD G;  4YY3 Q;  1NMG A;  2KEN A;  1YJN A;  1RIP A;  5IYB H;  4A3I G;  4A3E G;  1PH2 A;  4B3M L;  5GAD C;  3RNU A;  3CCQ A;  4KHZ A;  1XPU A;  5GRO A;  4LUV A;  3HOY H;  1VQK A;  1P16 A;  4A93 G;  2YU9 H;  2WP8 J;  3PV0 A;  3RZO H;  2FXQ A;  2YV5 A;  1NJI C;  2K75 A;  3CME A;  3OW2 A;  2KHI A;  1E22 A;  4BBS H;  3CD6 A;  1EOV A;  1E1T A;  1O7I A;  3CC7 A;  4BY1 G;  2AHO B;  2K4K A;  4ME3 A;  2UUB Q;  2Q2U A;  4LF5 L;  4A76 A;  1PYB A;  1HJP A;  1XJV A;  1ASY A;  1SE8 A;  4K0K Q;  2Q2H A;  5GAG C;  4A3L H;  2OCE A;  3TEH B;  2VZA A;  5IWA Q;  1AE2 A;  3CP0 A;  2C35 B;  4OON A;  3CC4 A;  1IBK Q;  1FL0 A;  1N33 L;  4OO1 G;  2UUC Q;  1MJE A;  2N49 A;  1Q82 C;  2JA6 G;  3I55 A;  3HOV G;  3EN2 A;  2UUB L;  3PF4 A;  3BZC A;  5JEA G;  4DV1 Q;  2I5H A;  3I4M G;  3M3Y H;  5IP7 G;  4GKJ Q;  4KHP Q;  1NY4 A;  2N3S A;  1YNX A;  4OO1 I; 
#chains in the Genus database with same CATH topology
 5ELF A;  2K1B A;  4HJ5 A;  2JA7 G;  5C0X J;  1KNA A;  2VUM B;  5HGT A;  1PTO D;  1PRT F;  1TWF H;  3MXG A;  3WWV A;  4RKB A;  3J80 c;  3G4S A;  1HNX L;  3I7F A;  2KJX A;  2B2V C;  1GUG A;  4PZ8 A;  4J8Q A;  5KRU A;  2D0O A;  2Z4H A;  4JI3 Q;  1Q46 A;  2CHB D;  1WTQ A;  4ZKB B;  2F4I A;  4B3R L;  1AZQ A;  3AYH B;  5F2D A;  5FO8 B;  3HG9 A;  3CCE A;  3N52 A;  4ZYS A;  3OMC A;  1LT4 D;  2PZW A;  3M4Q A;  4JCV E;  1K8O A;  5IE8 A;  1PYW D;  2DY8 A;  4DNR B;  2FMC A;  3MVV A;  5K36 H;  4K5X A;  3D6C A;  3S1N B;  1Y1V H;  4BBS G;  3PIP A;  4ABN A;  3QOJ A;  2A19 A;  2Y0S B;  5JPN C;  2L0C A;  2HQE A;  1KAA A;  3FVQ A;  3TSS A;  2VQF L;  3D3R A;  1UEB A;  5CGK A;  2ID0 A;  3G7L A;  4NXN L;  5K5P A;  4DAY A;  4TQU S;  2RDG A;  1A2U A;  1TT2 A;  1N8R C;  2B2V A;  1DCZ A;  1WFQ A;  5FLX L;  4RCO A;  1EQT A;  1EQV A;  1GHJ A;  4DNT B;  4GOP B;  2B2T A;  2IJ0 A;  1EYC A;  3D31 A;  2Y0S E;  2IHF A;  1STB A;  1XNQ L;  2M9V A;  1Y1W B;  3CQZ H;  2RCF A;  3QG1 A;  1X3Q A;  2CH4 A;  5JJZ A;  2RBM A;  3TZD A;  1HCZ A;  2A6E D;  4NB3 A;  4NDX A;  3KUP A;  5ELC A;  4TRD A;  2OWO A;  3BU2 A;  1J5E Q;  5GAH C;  2O2L D;  2IX0 A;  1PH1 A;  5C4X H;  4IUT A;  3PGZ A;  4R4Q A;  3S1R B;  4LF8 Q;  5FJ8 G;  1MD2 D;  1WCM H;  2TMP A;  4LWC A;  4U67 3;  1E0B A;  3SK4 A;  5IP9 G;  1A62 A;  1TII D;  3I2Z A;  1RD9 D;  2F0K A;  1I4R A;  2F03 A;  4R1J A;  4K6L A;  1KHI A;  2ZTE A;  3KLS A;  1VQJ A;  1K8G A;  2L11 A;  3VYS A;  2WAC A;  1KDA A;  2PW7 A;  2A69 C;  2QKI C;  2MP1 A;  1JWM D;  4C3J H;  3OSO A;  1X3F A;  2V1C C;  1JJ2 A;  2IHE A;  3QOL A;  4WFN 3;  2HDL A;  1BBX C;  1IBM L;  3Q6S A;  2NVQ B;  4X3U A;  2EYO A;  4P72 A;  4PZ6 A;  3RN2 A;  1E1O A;  1KD1 C;  3NTK A;  2R7Z H;  1V43 A;  2Z1C A;  3PUV A;  1LTL A;  2RDF A;  2QIL A;  2NN6 I;  3QO2 A;  4KKT A;  1LO5 D;  1SAP A;  1EU3 A;  2VUM H;  3S14 B;  4OWX B;  1KRT A;  1EZ8 A;  4JBW A;  4GKK Q;  1N36 L;  2XWB B;  1N32 L;  3Q23 A;  3STB D;  5D3D A;  1GO3 E;  3T56 B;  1MSG A;  3F2U A;  3I4L A;  1WI5 A;  4N9T A;  1Q81 C;  2M00 A;  3OWE B;  3RN5 A;  1UWV A;  2F0V A;  3U9S A;  1PH6 A;  2F0T A;  2E2I B;  1NMF A;  2KCM A;  2ZJQ A;  1X3E A;  1SE2 A;  4FF3 A;  1LAB A;  3GTL B;  5M5Y B;  2O5I C;  5EPK A;  3M4O B;  5LHY 1;  2XRS D;  3HOW G;  2BA1 A;  2P5Z X;  2F3W A;  2AQ2 B;  1VQG A;  3T1Y Q;  3DXJ C;  1PXU A;  2XNA C;  1O7Z A;  5IYC H;  3BZK A;  1ILP A;  1KL9 A;  1FGU A;  3A5Z B;  3T1H L;  3EBE A;  4JYA Q;  2FMM A;  4DAP A;  4WJ4 A;  1AH9 A;  3DWA A;  3EIV A;  3GV6 A;  3S16 H;  1IKM A;  4JI1 L;  2VY3 A;  4DR2 Q;  3KBG A;  5AFW A;  3Q8D A;  4JBK A;  1EUJ A;  3PMF A;  4CDD C;  1PH8 A;  4IPH A;  1XX8 A;  2MHV A;  4XT1 B;  2HIX A;  1I5F A;  2UUA L;  2EYM A;  1EEF D;  2R7F A;  4A3L G;  3GTP B;  4BA1 I;  2B63 G;  3BYY B;  2OF1 A;  3B6Y A;  1JE5 A;  1XPO A;  4DR1 Q;  5C44 G;  5LMU Q;  2EPB A;  2F4V L;  5JJK A;  5J3B A;  1K8A C;  3W1G A;  2E2J B;  2C9O A;  4ALP A;  1TS2 A;  2EYJ A;  2BH8 A;  3VYU A;  3L2P A;  1L1O C;  1H9J A;  4KD3 A;  4YHH Q;  2EXD A;  1GVP A;  2A68 C;  1TVX A;  1XMO Q;  4JBJ A;  4PV1 C;  3NBH B;  4NW2 A;  1C9O A;  1IW7 C;  1A3U A;  3CPW A;  4AH6 A;  1HNZ Q;  1EYD A;  1TWH H;  1QUQ A;  3H6M A;  3CC2 A;  1CQV A;  3FDT A;  4XQQ A;  4WJW A;  1W3S A;  1I4P A;  3EJI A;  4POG A;  2N8N A;  3NSW A;  3X3N A;  2XIW A;  3DEP A;  4QCL A;  3AEV A;  1GHK A;  4PQX A;  2NVQ H;  1J6Q A;  3FHW A;  3GTQ B;  1KAW A;  2PPB C;  4A93 B;  2JA6 H;  1N9W A;  1V1P A;  4LJZ C;  4ZCK A;  1SNM A;  1V8Q A;  1E24 A;  3HOU H;  1WTW A;  4OEM B;  1BDO A;  4FF2 A;  4IPD A;  3MA2 B;  1L1O A;  3DM3 A;  2D0P A;  2JQO A;  4R4C A;  5D65 A;  1DGS A;  1LM0 A;  1ENA A;  3HOV B;  2UXB Q;  3GD7 A;  2EYH A;  2K32 A;  4RHS A;  2AWN A;  5M9O A;  4GN5 A;  1D5X C;  3S17 H;  1VDZ A;  2JA7 B;  4FVM A;  3CCJ A;  5IOD A;  4K2L A;  1GUN A;  4JI5 L;  3S24 A;  4JI7 Q;  1GKH A;  3E5S A;  2BE5 D;  2Z4I A;  3M4O H;  2PQA A;  1VQ5 A;  2Z9H A;  3FPU B;  3G71 A;  2GA4 B;  4CGY B;  3P1H A;  1EFI D;  2JXM B;  3R2T A;  3OTO Q;  4DUY Q;  1ET6 A;  4Q0F A;  2XN9 C;  2F3I A;  3QIA A;  4DR3 Q;  4L5R C;  3RZO B;  4DV5 Q;  3JC6 6;  4BBS B;  4QIW E;  3GTP H;  4BA2 I;  1F2M A;  4C3J G;  4JI4 Q;  5E4W C;  2K5Q A;  2JK8 A;  1CKN B;  2A5H A;  2DGY A;  4DV1 L;  1EYA A;  1W6K A;  4A3F H;  1PZI D;  2N88 A;  4HJ8 A;  2JA5 H;  3M3Y B;  1M90 C;  1RKN A;  4KV6 A;  1EEI D;  4DK0 A;  1ZYR C;  2BA0 A;  4A3D G;  1D2B A;  2HUG A;  3R2I A;  3KF6 A;  2CQA A;  1EZ6 A;  2CCZ A;  1PRT C;  1QZH A;  3S1Q B;  1EL0 A;  2JEB I;  4X65 Q;  3ULJ A;  1F2Z A;  1IL8 A;  4LK1 C;  2YTY A;  3A7L A;  2ASB A;  3S1M H;  1WTH A;  2F0P A;  4HCE A;  4A93 H;  4RG1 A;  3NBI A;  4DF7 A;  2ZXR A;  3KF8 A;  4MTK A;  4YWK A;  2IPK D;  4LW1 A;  5KND A;  1OXU A;  2NZO A;  1CUK A;  2A1A A;  2I46 A;  5HGQ A;  2PQE A;  1YHA A;  2I5L X;  4FP5 D;  4A3I B;  1OXX K;  3ZYY X;  4QJF A;  4A3E B;  4OO1 H;  2IX1 A;  4BBR G;  3KYH C;  1HQR D;  4DNI A;  4EX5 A;  3OYY A;  4M8A A;  4K2K A;  1YNN C;  2EY2 A;  4C1N I;  1C8C A;  4MNO A;  2HDM A;  4JG2 A;  1F9P A;  4DV6 L;  3I4N G;  4B3T L;  1DJR D;  5BR8 Q;  3RLF A;  3SK8 A;  3H91 A;  4M1U B;  1I50 B;  2YTV A;  4G7O C;  1NBW A;  3NHH A;  1JIC A;  1SSO A;  4JI0 L;  1Z47 A;  1PDQ A;  2PYK A;  4LUZ A;  1GD7 A;  2R93 G;  1SYE A;  4IPG A;  4FDB A;  5KNC A;  4DXF A;  1SYC A;  4KY5 A;  5T1I A;  4F8M A;  1PTO B;  1NMG A;  5IT9 E;  5ISR A;  1YJN A;  1PH2 A;  3LNN A;  4LUV A;  1JCK B;  5KYI A;  3ONA B;  3RZO H;  1JWS D;  2YV5 A;  3HOW B;  5EQ0 A;  1IYV A;  1O7Y A;  1E22 A;  4ME5 A;  1H9S B;  3CD6 A;  4BBS H;  1X32 A;  3CC7 A;  3E6Z X;  2UUB Q;  4LF5 L;  1UNS A;  1XJV A;  1HJP A;  1ASY A;  4IZ8 A;  1AE2 A;  3CP0 A;  1IBK Q;  3HGB A;  1FL0 A;  5TSS A;  2C5C A;  1CA5 A;  2UUC Q;  4RGT A;  2OXP A;  2N49 A;  2YU9 B;  2JA6 G;  4QMG A;  2UUB L;  5JEA G;  4KY7 A;  3M3Y H;  1NY4 A;  4RGO S;  1YNX A;  5FKA C;  3HOU G;  2HHH L;  2A69 D;  1EQR A;  2KOL A;  4FNF A;  2K33 A;  3I73 A;  3MTS A;  4UP8 A;  2IT1 A;  3F2B A;  3C1F A;  3CRK C;  2UUC L;  5C44 B;  3K58 A;  5ELE A;  4CKB A;  2A6H C;  3U9O A;  3J80 E;  4DA2 A;  5A35 A;  3GTM B;  1HFN A;  3HZX A;  1B3Q A;  3D0F A;  4XT3 B;  1C0A A;  4HJ9 A;  4IJH A;  3PIO 3;  1YJ9 A;  2XTI A;  5A2Q E;  3A5U A;  5CV6 A;  3WOE A;  4X66 L;  1L2F A;  2K5W A;  3K80 C;  3MXN B;  3CRL C;  2KA7 A;  5DLQ E;  5FJ8 H;  1S5F D;  1AP0 A;  1EWC A;  3TN2 A;  1Q86 C;  5ELO A;  4B9W A;  3GO5 A;  2Z8L A;  4JI8 Q;  5IP9 H;  4XYO A;  4DV4 Q;  1CZG A;  1SLJ A;  3BDL A;  1CFM A;  4YWM A;  3NTI A;  4S3S A;  4B3S Q;  2Q8T A;  4UAI A;  1FYC A;  4HAE A;  1PH3 A;  1KLG D;  3W5O A;  1O78 A;  2MFI A;  5EPJ A;  2SDF A;  2F0S A;  4PMW A;  2ATW A;  2F0F A;  1LUZ A;  5FK9 C;  3AFP A;  2ALY B;  2J4X A;  1FR3 A;  2E5L Q;  4CHT B;  4LFB L;  1JWU D;  1K28 A;  3G6J B;  2AQ1 B;  4C1N K;  1CKO A;  1V1O A;  4DXG A;  1QVC A;  4A3G G;  2JP1 A;  4A3J G;  3J80 L;  1SJE D;  3IAY A;  4HMJ A;  3HKZ E;  4WJ3 M;  3DLL A;  4DV2 Q;  1QVG A;  5HUR A;  1AN8 A;  2O5J C;  5IGC A;  1LT5 D;  2PCF B;  4XXE A;  2B2Y C;  3ZJY C;  4X64 Q;  3OW7 A;  4A3F G;  4UY8 C;  3E0J A;  2JA5 G;  1LYL A;  1OO9 B;  1PTO H;  1HNW Q;  1HUN A;  1KDC A;  3FMC A;  4X62 Q;  5EGT A;  2F0J A;  3CQZ B;  2R7D A;  3RR5 A;  1PTO F;  1VMP A;  4JW0 A;  4B3M Q;  3HOW H;  3K8A A;  4A3B G;  2EE1 A;  4RWS C;  1NCV A;  2Z6K A;  4X62 L;  5M3F H;  2A68 D;  3KLS X;  3QR8 A;  2E75 C;  2MPM A;  4DR7 L;  3FKI G;  1EY4 A;  5HY6 A;  4EQ5 A;  1G29 1;  2ZTC A;  2QDL A;  1RDP D;  3GTO B;  1IW7 D;  1VQC A;  3UDG A;  3L9A X;  1N33 Q;  3U4Z A;  3OMG A;  1K0R A;  4OGQ C;  3W3A A;  4KHV A;  3SDZ A;  2B2Y A;  2B2W C;  2B63 H;  5E1F A;  2Q2I A;  1PYS B;  3V05 A;  1TXY A;  5C44 H;  1FJG L;  4C3J B;  3CHB D;  3T51 B;  1HA6 A;  5I9O A;  3GTM H;  1VQ6 A;  1HNX Q;  1D1I A;  2K05 A;  1CSQ A;  2EJG C;  1CK1 A;  1VQN A;  3TP8 A;  2D5D A;  1B50 A;  3KDF B;  1NR4 A;  2UXC L;  4YIJ A;  5FLX E;  4B3R Q;  4A3D B;  5C4J H;  1B70 B;  3ERO A;  3H0G G;  1R4P B;  3H3V C;  1WYD A;  3CCR A;  1AE3 A;  4RA8 A;  2IY5 B;  1PH5 A;  4YCU A;  3GP7 A;  2WV6 D;  1YJW A;  3PUY A;  1LT3 D;  1RTO A;  1YBY A;  3PO2 G;  4BY7 G;  1G91 A;  4HN7 A;  4RH6 A;  3IL8 A;  1YHB A;  4ZK9 B;  5FOB B;  1LAC A;  4K5V A;  3K7A H;  3BG3 A;  4UDU C;  1YEZ A;  1W6J A;  4NKL A;  2VQF Q;  4MZ9 A;  1TWA B;  1STN A;  3ERS X;  4NXN Q;  4XDX A;  2RSN A;  5C0X H;  4Z9C B;  3M7G A;  2OTL A;  2GVB A;  1EY8 A;  3QB3 A;  2F0O A;  1Y69 U;  2CKZ B;  3S16 B;  1B9N A;  2KQ3 A;  3K0Y A;  5ELD A;  1XNQ Q;  1VQD A;  1G6Z A;  2MJ8 A;  4A3M G;  3J81 E;  3BVM A;  2QEX A;  1KRS A;  2MO1 A;  1Y8O B;  5JOB A;  4DGZ A;  5LL6 X;  1I6V C;  3T4A C;  1I94 L;  2NVT H;  3NK9 A;  3I4N B;  4FO2 A;  2F0G A;  5BN3 A;  1Y8N B;  2EZV A;  2O4X A;  1A6X A;  1Q7Y C;  1F9S A;  4KJN A;  1EIG A;  3NPP A;  3KFU A;  5JVG 3;  2PW5 A;  2QDB A;  3U4V A;  1TY2 A;  1NNX A;  4BY1 H;  3WDN A;  2R93 B;  1ZYR D;  3OHX C;  2AWO A;  1TR5 A;  4DUZ L;  1FNU A;  2BDO A;  1OTC A;  1AW7 A;  1U9R A;  3AB9 A;  4HR7 B;  3GTO H;  1LTS D;  1SEB D;  1PRT D;  1M4V A;  3T53 B;  1X55 A;  3BDO A;  3C3L A;  2PMZ B;  2YYZ A;  1IBM Q;  1F77 A;  4L5S A;  3QWN A;  1TWH B;  5C3E H;  1ROD A;  1ML0 D;  1YI2 A;  4DKA C;  5IGD A;  1X9N A;  2XSC A;  3VDY A;  3J81 L;  1XXG A;  2JA6 B;  5JAV A;  4FF4 A;  2PMZ E;  1N36 Q;  5IGE A;  1BCP B;  3MAQ A;  2R92 G;  1D6E C;  3HOU B;  1RHP A;  4QQB X;  1N32 Q;  1QCB D;  3S9W A;  1ENF A;  1SE4 A;  1SNQ A;  2K04 A;  3CCM A;  1NAP A;  4A3D H;  1QE6 A;  3KBX A;  1SRU A;  4J6H A;  2ZJP A;  2EJF C;  3DHQ A;  5BN4 A;  1TY0 A;  4Y7N H;  5IIF A;  2FIN B;  1SMX A;  1YNN D;  2K6A A;  5CV5 A;  4IAL A;  4IUQ A;  1DYQ A;  4DR5 L;  2DNC A;  3H09 A;  1SYB A;  3MC0 B;  4YY3 L;  4R4O A;  5C6A A;  2DNE A;  4ILW A;  3S17 B;  1L0Y B;  3PUX A;  5KIX A;  1TS4 A;  3I91 A;  3T1H Q;  1RF2 D;  4R8I A;  2NVX H;  1TWA H;  1D5Z C;  5LL6 S;  3MFG A;  3TP5 A;  1L0W A;  1G51 A;  1VQA A;  4JI1 Q;  2F0N A;  3W2D A;  1VCI A;  1QJO A;  2SNM A;  4TKO B;  3RUZ A;  1VQO A;  1TS5 A;  5M3F G;  4G4K A;  2UUA Q;  4JBM A;  4IOA A;  5EBD A;  1Q1E A;  2PO4 A;  3FRP B;  3VR5 A;  4BBR H;  5DM7 3;  1UEA B;  1YNJ C;  3DWP A;  2F4V Q;  1W2B A;  1VS0 A;  4IFD I;  3I4N H;  1BR9 A;  2SNS A;  1KQS A;  2WIN B;  3L0O A;  3I4O A;  1HTL D;  4LFC L;  1EY0 A;  4P2C B;  4A3G B;  4DV3 L;  4A3J B;  4HIO A;  3A55 A;  3PIO A;  1E7Z A;  1CT1 D;  3H3V I;  1XNR L;  3I8Z A;  1EY6 A;  2ENB A;  1CHP D;  1K83 B;  1E2V A;  1QNU A;  4AQY L;  5H1S E;  2LMC B;  2HQL A;  3JAM E;  1PV4 A;  1CHQ D;  4NXM L;  3OIP A;  5CMD A;  3CF5 A;  2R93 H;  4A3F B;  2KEE A;  3NEM A;  2JA5 B;  3JAM i;  2GVA A;  2K01 A;  4RFB A;  4XYQ A;  4CDC C;  3J7Z C;  3M7N A;  1G2T A;  2JE6 I;  3LX0 A;  4DV7 L;  4LF7 L;  5IGB A;  1EIY B;  1HFG A;  1WTR A;  3BVG A;  1X54 A;  3QJY A;  4I7Z C;  1MGS A;  2EYF A;  1HXY D;  4A3B B;  4DK1 A;  3NXW A;  4ZUI A;  1I4H A;  2G9D A;  3I70 A;  4ZRZ A;  3HOX G;  2F0W A;  4O42 A;  1B7Y B;  1CKN A;  5KGU A;  4JI2 L;  2CW0 C;  3HS0 C;  1Z9F A;  2DN8 A;  3PO3 G;  4OX9 Q;  3FKI B;  3HKZ G;  3TP6 A;  4MTN A;  1LTA D;  3S1M B;  4OWW B;  2IX3 A;  3SK5 A;  1SE3 A;  3SE0 A;  2KCC A;  4XIG S;  3OWF A;  1CSP A;  4DK3 C;  5C5L A;  5JEA H;  4H02 A;  3C2P A;  4IFD J;  1NTG A;  2QEJ C;  2KHS A;  1I3Q H;  1S5D D;  1VQE A;  2HCC A;  5EPL A;  5C0X G;  3RLO A;  4OX9 L;  1PVO A;  1IXR A;  2I5M X;  3D8G A;  2I0Q A;  1IZ6 A;  1QNK A;  3P20 A;  1BCP F;  2VB2 X;  4B08 A;  2CH4 W;  1ONL A;  1UUP A;  1VQB A;  2EYP A;  2ZM6 L;  5J39 A;  3CCV A;  4JI5 Q;  3JAM L;  1K9M C;  1T5E A;  4BXX H;  4LF4 L;  3PF5 A;  3AMU A;  3CPF A;  4H7B A;  4AYB E;  4G57 A;  4DPG A;  3LGJ A;  4N8X 1;  2KUM A;  3AU7 A;  3H0G B;  4KKS A;  3K5N A;  4LMQ D;  5GRO A;  4G7H C;  1PTO C;  3GV3 A;  4MN3 A;  1IYU A;  4JVZ A;  1NJI C;  2K75 A;  1SYG A;  3DEO A;  4G7Z C;  3I90 A;  1EY7 A;  1M8A A;  4L8J A;  2EY1 A;  3SK6 A;  4BY1 G;  4QIW B;  3PO2 B;  4BY7 B;  5GAG C;  3TEH B;  2VZA A;  1DOM A;  2C35 B;  3CC4 A;  2J7Z A;  3GTJ B;  3IFD A;  3FPP A;  4K14 A;  1MJE A;  1STY A;  1UAP A;  3PF4 A;  4DV1 Q;  5I6W A;  1U4M A;  5IP7 G;  2H4O A;  4OO1 I;  1XTD A;  5C3E G;  4A3G H;  4A3J H;  4Q5V A;  3A56 A;  5M5X H;  1SYF A;  1K83 H;  4A3M B;  4F88 A;  3A8K E;  3K5M A;  2JN4 A;  4IO9 A;  2JSO A;  2RDH A;  2J0T D;  4N9P A;  2RKS A;  2VS1 A;  1OXV A;  4X3K A;  3PCO B;  3GTK B;  1OXS C;  5E4X A;  3KLR A;  4DFA A;  3PIP 3;  3HOY G;  4A3B H;  1I6H H;  4KLK A;  2A6E C;  3CMA A;  2R3Z A;  4OHJ A;  3CAM A;  4MHE A;  3GTG H;  1V1P B;  2KVM A;  1NE3 A;  1PH7 A;  3FKI H;  3A54 A;  3K5O A;  1SMY C;  1UE1 A;  4CJ2 C;  4R4T A;  1YIJ A;  3BVZ A;  3IRB A;  5E3F A;  1WTV A;  1L1O B;  1BQQ T;  1Q8I A;  3K0X A;  4HSP A;  4QY7 A;  3MFY A;  1GUO A;  3BS1 A;  1J9O A;  1S3O A;  4KD4 A;  3EA6 A;  1B8A A;  1S40 A;  3MXU A;  4DV6 Q;  2D62 A;  3CCL A;  4B3T Q;  4CKE A;  1HR0 W;  4ULL A;  3TS2 A;  3OPO A;  4N8F A;  1T9H A;  1PMR A;  2RHS B;  1Q8K A;  2N78 A;  3MXN A;  3I3C A;  1HR0 L;  1JJC B;  4ZKC B;  2AUJ D;  4JI0 Q;  3KJO A;  1YZ6 A;  1JQY D;  1IYJ B;  3LWE A;  4C3I H;  3L3O C;  2PQA B;  3NE5 B;  3H0G H;  1PH9 A;  4GS3 A;  5AJ3 L;  4LF9 L;  1X3G A;  1STG A;  5J22 A;  4ID6 A;  3K6O A;  4KK7 A;  3CCU A;  3PO2 H;  4BY7 H;  3CKI B;  1ET9 A;  2KHJ A;  3STB C;  1LTB D;  1OXT A;  2IWH A;  4LF5 Q;  3ULL A;  3RMH A;  3GTJ H;  4H0L C;  1JOO A;  2ICI A;  2EQS A;  2HIV A;  1ENC A;  5G3L D;  4GLV B;  4QF4 A;  3PUW A;  1H9R A;  2E2D C;  2NN6 G;  5JVH 3;  4L5Q A;  4QUF A;  3TME A;  1VQL A;  1TWG H;  2CWA A;  1KC8 C;  1G6P A;  4QGU A;  2H5X A;  3IFT A;  4PMC A;  1K3B C;  5M3F B;  3NEN A;  5T1G A;  1A2T A;  2HHH Q;  2F3V A;  5FO7 B;  1S4Z A;  2DY7 A;  5CV8 A;  3D4W A;  5JPM C;  1PFN A;  4A3M H;  3J7A V;  3TDQ A;  1YIT A;  1H9K A;  4LFA L;  3KF6 B;  1GXD C;  5IY0 A;  1IBL L;  3UE1 A;  4ZQ3 A;  3GTK H;  2B63 B;  1B1Z A;  4X66 Q;  1LTR D;  2OTJ A;  1JOQ A;  5COY A;  3O13 A;  4KY6 A;  4A75 A;  4K8J A;  5KNB A;  4PG3 A;  3NP8 A;  4RAU C;  2JA8 H;  1A0I A;  1X3P A;  3J80 i;  1XYI A;  1GOZ A;  4BXX G;  3UDI A;  2BCO A;  2E2H H;  3F2D A;  1A15 A;  3ITP A;  5LMN W;  4JV5 L;  5C4J B;  1STE A;  2ES2 A;  1C7Y A;  3BDC A;  5LMN L;  1WTX A;  1A3V A;  1KDB A;  2FFK B;  1SN8 A;  2VQE L;  2G5D A;  1G8Z D;  3HOX B;  1G2S A;  4GZY C;  4LFB Q;  4YCV A;  2ZXP A;  2NB0 A;  3BZD B;  2UU9 Q;  1Q90 A;  2SEB D;  3HKZ B;  1RL2 A;  2R61 A;  3K7A B;  3F2C A;  1SR3 A;  2WII B;  4BS9 A;  3VA5 A;  2R92 H;  2MUY A;  2F1M A;  3FP9 A;  2E8G A;  1X56 A;  2E76 C;  1BUV T;  3UDF A;  2UU9 L;  1TKW B;  1LLR D;  1GM5 A;  1ILQ A;  1JT8 A;  2NZH A;  4GOP C;  5COR A;  1YNJ D;  1HUM A;  2L15 A;  3K57 A;  5NUC A;  1CTM A;  1TS3 A;  4POF A;  3D6W A;  3E0E A;  3SHL A;  2B2U C;  2MNA A;  2F0H A;  2NVT B;  1S5B D;  2AMC B;  1SND A;  2E74 C;  4NMZ A;  2IL8 A;  4JOI C;  2K7V A;  3S2D H;  4DR7 Q;  2PNH A;  1FGB D;  4IN3 A;  4JC0 A;  4Y52 H;  3MZ5 A;  2BE5 C;  4WRD A;  1SXT A;  1EIF A;  3A74 A;  4BY1 B;  4IOC A;  5C3W A;  2UXD L;  5ELB A;  4UP9 A;  1B9M A;  2QW7 A;  4JK1 C;  1XWE A;  2AQ3 B;  1D7Q A;  3TP7 A;  2F0L A;  4C3H G;  1J8I A;  1U4P A;  1FJG Q;  1V9P A;  5CBA E;  4X3S A;  4GNX B;  4GOP A;  3HKS A;  2OQ0 A;  2WB1 G;  4F87 A;  1FVI A;  3J7Y W;  3CCS A;  1SDF A;  1O80 A;  1LTG D;  2PZU A;  4AYB G;  2CW0 D;  1DZ1 A;  5I9P A;  5C3E B;  1SYD A;  3J7A 5;  2B2U A;  1MI2 A;  2BOS A;  3E9H A;  1SNO A;  1SNP A;  4JI6 L;  4LAA A;  2UXC Q;  1BCP C;  4KKU A;  5IT9 c;  1IL2 A;  4CBV A;  1ICW A;  5C3X A;  4JOI A;  1QZG A;  4P71 A;  5CV9 A;  1JB3 A;  2ZTD A;  1CZW A;  3S2H B;  2Z6B A;  3RLN A;  4J1M A;  3NEL A;  4IPC A;  1PHJ A;  1KXL A;  1A63 A;  2JJQ A;  3RZD B;  1VF5 C;  3A8J E;  1BVS A;  4FXK C;  4FXD A;  4C3I G;  5KYL A;  2EDG A;  3PSI A;  4IUR A;  5EKI A;  1S5E D;  1X6O A;  2MQH A;  3W1B A;  4DN4 M;  3HOY B;  4Y7N B;  3J7A F;  2WAQ E;  4K0K L;  4OIK A;  3HOX H;  5I6Y A;  4RCN A;  4L63 B;  1MJC A;  3PO3 H;  4YCW A;  2B2W A;  4IJL A;  5EJW A;  1R9T H;  1L0X B;  4KJO A;  5CR3 A;  2N55 A;  4J15 A;  2NVX B;  5JJI A;  4OEL B;  4GKJ L;  2L55 A;  3VR4 A;  3GDE A;  2EIF A;  4HSV A;  1PLF A;  3HOZ G;  1UE5 A;  3ND8 A;  2B39 A;  3MXP A;  1TQO A;  2B2T C;  4IUU A;  2LFN A;  1I4Q A;  3HEJ A;  1I94 Q;  3S15 B;  2FHT A;  1CA6 A;  1BBW A;  2L5T A;  1IHZ A;  1PFS A;  5CV4 A;  4BBR B;  4JI3 L;  1I4X A;  4KTA A;  2GN5 A;  2QA4 A;  3DWQ A;  2XWJ B;  3J81 i;  2NUC A;  4C2M H;  2EVB A;  3ERQ A;  5M3M H;  4K6D A;  2XVS A;  4DUZ Q;  2KBN A;  3I56 A;  4GLX A;  3WOF A;  4CKC A;  1SFO B;  2WFW A;  2JA8 G;  3DMU A;  3A7A B;  3OOC A;  4C56 C;  2ZJR A;  1MBY A;  1AEX A;  1RTN A;  3M4Y A;  3K7U C;  4DR6 Q;  4H13 C;  3GQB A;  1DOK A;  1JMC A;  1Z7T A;  4H44 C;  4LF6 Q;  4OIJ A;  2M2L A;  4DU9 A;  5IP7 H;  1V1Q A;  4OXP A;  3ULP A;  2CQO A;  4DR6 L;  4A3K H;  1SMY D;  2WKC A;  3K59 A;  2RHQ B;  4LUO A;  5EKK A;  1MSH A;  1CQF A;  1AZP A;  4LF6 L;  3F8T A;  2F0I A;  2L9H A;  4HTH A;  3S2H H;  2RSO A;  1J5E L;  2LY7 A;  1S5C D;  1Y14 B;  4DAM A;  3RZD H;  3ICE A;  1VQH A;  1I3Q B;  3FEW X;  4LF8 L;  3TBI B;  4DR5 Q;  3NBH A;  2RQX A;  4L6T B;  2LS0 1;  5IYD G;  4YY3 Q;  5EBC A;  1RIP A;  4A3I G;  4A3E G;  5GAD C;  3RNU A;  1HTP A;  3CCQ A;  5DNF A;  1XPU A;  1BOS A;  3PQI A;  3HOY H;  1P16 A;  4K5W A;  2F0Q A;  1PZK D;  5I4D A;  2FXQ A;  3R8B A;  2VB3 X;  3CME A;  1KLU D;  1LV9 A;  1O7I A;  2AHO B;  2K4K A;  2H1E A;  3C46 A;  4A76 A;  2NVY B;  1SE8 A;  5EKL A;  4EGV A;  3R93 A;  4KMU C;  5IWA Q;  3BYT B;  4OON A;  4IUP A;  2IW3 A;  3MWY W;  2A73 B;  3I55 A;  3BZC A;  3I4M G;  2I5H A;  4KHP Q;  2N3S A;  3V2T A;  5IWA L;  4DAY B;  3S15 H;  3M9B A;  1I4G A;  2TSS A;  1B4O A;  5FLX c;  5E7N A;  5I2Y A;  3AQQ A;  4GKK L;  2B3G A;  4LFC Q;  1II3 A;  4A3C G;  1WD0 A;  1A3T A;  4DV3 Q;  1PA6 A;  3CXC A;  1WTO A;  5DM6 3;  4V19 0;  1U0L A;  4KHP L;  1XNR Q;  1VMC A;  3MEF A;  1EWH A;  1P8L A;  3U58 A;  4I65 A;  4AQY Q;  1K73 C;  2DJG C;  4BWG B;  3S1N H;  3UE0 A;  2JEA I;  1VQM A;  4ZUJ A;  2RVL A;  4NXM Q;  3EFX D;  1HZA A;  1D5M C;  1EY9 A;  1U4R A;  1UE6 A;  4HED A;  2RA4 A;  1E2W A;  1WOC A;  4X3T A;  3IKJ A;  5CBE E;  3K5L A;  4IQZ A;  4EQO A;  1SNC A;  5IYB G;  1SFO H;  1VQ4 A;  3KLW A;  3NQT A;  5M5X B;  5FLM H;  4DV7 Q;  1HPC A;  3T1Y L;  4LF7 Q;  1S72 A;  1VQI A;  2JA9 A;  2F52 A;  2AUK A;  4JYA L;  1H95 A;  1NUC A;  3D4R A;  2BH2 A;  4JI2 Q;  4UHV A;  3SGI A;  2A6H D;  3E3X A;  4DR2 L;  1Y1W H;  4UPA A;  4GLA C;  5J1Z A;  1GUW A;  2NN6 H;  2VW9 A;  3NWT A;  1GUT A;  2K14 A;  3J81 c;  1I6H B;  3VYT A;  5C5M A;  1ESR A;  4DR1 L;  1B44 D;  3A0J A;  5JEA J;  2PNR C;  2Z0S A;  3S1R H;  3GTG B;  4HMI A;  5LMU L;  1ASZ A;  4C3H B;  2NTT A;  4I7A A;  1LT6 D;  2A74 C;  1PFB A;  2R6G A;  2ZM6 Q;  2QCP X;  2WB1 B;  4FYD A;  1XPR A;  2K5N A;  1VQP A;  5M5W B;  1PZJ D;  4LF4 Q;  3E9I A;  4YHH L;  4AYB B;  4UP7 A;  3D4D A;  1FNW A;  1QB5 D;  1HZC A;  3LWU A;  3TS0 A;  1ZXT A;  2D9U A;  1XMO L;  1XTC D;  4NP5 A;  2BDN A;  1DD2 A;  3M4P A;  2L12 A;  2VNU D;  1B2T A;  4B9X A;  1CI3 M;  5GQO A;  1HNZ L;  1F9R A;  2WB1 E;  3OIQ A;  4KI0 A;  4MIU A;  4CDF C;  2NVY H;  5K36 G;  1Y1V G;  2HT1 A;  4C3I B;  5M3M G;  3G6E A;  3S14 H;  1ZEQ X;  5D14 A;  1VQ9 A;  1PH4 A;  1HHV A;  4IFD H;  1DOL A;  2Q2T A;  3H15 A;  4HIM A;  5BN5 A;  1D1K A;  1RCV D;  3EVQ A;  3H3V H;  2NTS A;  3ER0 A;  1U4L A;  3ND9 A;  1CM9 A;  5GAE C;  2E2I H;  5C4H A;  2G9H D;  2UXB L;  3GTL H;  1MHW C;  4O0A A;  3X3M A;  5M5Y H;  2QF7 A;  2FJ2 A;  4HCS A;  2Q8I B;  1QWY A;  3N6R A;  3HOZ B;  5IOC A;  3AFQ A;  1JOR A;  1C48 A;  1TWG B;  4P73 A;  1FNV A;  2CFM A;  3T16 A;  2OQK A;  4A3K G;  3KJP A;  5C4X G;  4JI7 L;  1TU2 B;  4TVA B;  1QG7 A;  1U5K A;  1WCM G;  4R8N A;  4K8I A;  3DUZ A;  2WAQ G;  3KOJ A;  4PZ7 A;  2JYO A;  4DAV A;  1KIX A;  4GN3 B;  2V4D A;  1BCP D;  3OTO L;  3L7Z C;  1M1K C;  4DUY L;  3A8I E;  1QUQ B;  4RGM A;  2A8V A;  1NR2 A;  2F0U A;  3V96 A;  3H94 A;  1H9S A;  4DR3 L;  4PNY A;  1VQ7 A;  1K8M A;  2E2J H;  1BF4 A;  2JA8 B;  4DV5 L;  5L37 A;  1TWC B;  2PZT A;  3EQL C;  4RHR A;  3Q24 A;  2R7Z G;  2E2H B;  2F0E A;  1LTI D;  4XTC S;  4JI4 L;  4IUV A;  4C3H H;  4FF1 A;  1F9Q A;  4U68 A;  2VUM G;  1IKL A;  2L4N A;  3P7J A;  1KNE A;  1ICF B;  2EY5 A;  2LXJ A;  5G3L F;  1JR0 D;  5M5W H;  1WD1 A;  3VR6 A;  2ZT9 C;  1BO0 A;  2MO0 A;  2K50 A;  3JAM c;  1HR0 Q;  3I72 A;  2LKV A;  3TRE A;  1HQM C;  4P75 A;  3TQY A;  2PI2 A;  3NUC A;  3SVM A;  1O7L A;  1VQ8 A;  3U50 C;  4PMB A;  2NBF A;  1BNZ A;  1FD7 D;  2KCT A;  3M85 A;  1F2Y A;  4X65 L;  3GTQ H;  2ZXO A;  1Q1B A;  5AJ3 Q;  4LF9 Q;  1STA A;  4ODG A;  3SEB A;  2R92 B;  1KTK A;  5DAU A;  4CJ0 B;  1AFP A;  2ICE C;  2VL6 A;  2I07 B;  5IYC G;  5IGF A;  2Y0S G;  1C4Q A;  4L5T A;  4HID A;  2KCN A;  3SR1 A;  2OT2 A;  4O2D A;  1RJT A;  1D8L A;  5FLM G;  3HOV H;  4LNQ A;  2YTX A;  4NPS A;  4XQN A;  1F2L A;  4F7X A;  1LTT D;  1BXT A;  3Q0A A;  1B3A A;  3HP3 A;  2JA7 H;  5CC4 A;  3URY A;  1Y1W G;  1QOH A;  4R4I A;  3S2D B;  3NTH A;  4ZAI A;  1EOT A;  2EXZ A;  1E3P A;  3HOZ H;  3I4M B;  1JOK A;  4LFA Q;  4IUN A;  2SOB A;  5BR8 L;  4GNX C;  1UE7 A;  1IBL Q;  5ELN A;  2OEO A;  2NYZ D;  5C4Z A;  2KEC A;  3TRZ A;  1QIL A;  4HJA A;  1XMQ Q;  3K81 C;  4FXG C;  1MIU A;  2K5H A;  1GUS A;  4X6A H;  1A8V A;  2L1B A;  1JB7 A;  3HFZ B;  1GJX A;  1XMQ L;  4AIM A;  4QB4 A;  5EAY A;  4JV5 Q;  1X65 A;  2F0M A;  3CU7 A;  2HCI A;  1WJJ A;  2X6L A;  4JPB W;  2B29 A;  5LMN Q;  2CWP A;  1HH2 P;  1TWC H;  1EYG A;  3CW2 C;  5CYU A;  3VR3 A;  3RD4 A;  3DM1 A;  5KEE A;  2VQE Q;  4HJ7 A;  2Q8R E;  3KF8 B;  3C1E A;  1T5X D;  1IBK L;  1BKB A;  4GNX A;  4APV A;  1Y8P B;  3G48 A;  3S1Q H;  4HIK A;  2X69 A;  4IFD G;  3BJU A;  4DV0 Q;  4RGN A;  1SJH D;  5FO9 B;  3VA7 A;  2LXK A;  1HZ9 A;  3PUZ A;  3UI2 A;  5IT9 L;  2RF4 A;  1WTP A;  1PRT B;  1HRJ A;  3PO3 B;  4CJ1 B;  4YWL A;  1R9T B;  1K3R A;  2HD3 A;  4DV0 L;  3J81 j;  2PI2 E;  2CVR A;  1TWF B;  5IGG A;  3KDF A;  1EWI A;  1BBU A;  1ESF A;  1DM0 B;  1EY5 A;  2XGT A;  1HZB A;  4TSS A;  2K5D A;  4RMF A;  3TZU A;  4A4I A;  5IYD H;  2K5V A;  3NWS A;  4KN7 C;  4DK6 C;  1N34 Q;  4JI8 L;  2DJF C;  4DV4 L;  4A3I H;  4A3E H;  3NQI A;  1Q12 A;  2NZ1 D;  4EVO A;  2K03 A;  3R3O A;  1YHQ A;  1CKM A;  1EFW A;  1JJG A;  4EQP A;  4B3S L;  2Z6K C;  4DR4 Q;  5CV7 A;  1VF7 A;  3MHB A;  1SBB B;  1SRO A;  1N34 L;  2EOT A;  4C2M B;  1Y1V B;  3F1Z A;  2B8F A;  4GN4 B;  4OWT B;  3VR2 A;  3VYR A;  5M3M B;  3Q22 A;  2UXD Q;  2RCN A;  1I50 H;  4EQN A;  1MKH A;  4ZLT F;  1YVC A;  4OL7 A;  1R4Q B;  3P75 A;  2DUD A;  2QGQ A;  2E5L L;  4DR4 L;  2B8G A;  1JE4 A;  2K52 A;  2LSS A;  3I4M H;  4QL5 A;  2F0D A;  5A2Q L;  1NSN S;  2AKW B;  5I2X A;  4KN4 C;  2XRQ D;  2WKD A;  4V0B A;  1QVF A;  5D3I B;  4A3C H;  4DV2 L;  2VXW A;  4P74 A;  5JJL A;  5C0X I;  4JI6 Q;  1Q3L A;  4RKL A;  2EY6 A;  4WOR A;  4X64 L;  2D2C C;  1HA5 A;  1WVL A;  1EQQ A;  1STH A;  2MGS A;  1HNW L;  3UDX A;  2EYL A;  3HRZ C;  4A3K B;  3SXH A;  1Z6H A;  2KEN A;  5C4X B;  4QUC A;  5IYB H;  4B3M L;  4KHZ A;  1K0S A;  1WCM B;  2K28 A;  1VQK A;  3KK7 A;  4A93 G;  2YU9 H;  2WP8 J;  3PV0 A;  4XQJ A;  4R9W A;  2WAQ B;  1E2Z A;  3OW2 A;  2KHI A;  1EOV A;  1E1T A;  1DXM A;  4ME3 A;  1EU4 A;  1KAB A;  4K0K Q;  2Q2U A;  1PYB A;  1PFM A;  2EJM A;  2X6G A;  4A3L H;  2Q2H A;  4O1N A;  2OCE A;  1B53 A;  2NWG A;  1H9M A;  1DON A;  4E6I A;  1N33 L;  4OO1 G;  5DEH A;  1JC7 A;  3HOV G;  3EN2 A;  1ZKO A;  1EIH A;  3MEH A;  4GKJ Q;  3T13 A;  4CDE C;  1Q82 C;  2KED A;  1VQF A;  2R7Z B; 
#chains in the Genus database with same CATH homology
 2HHH L;  1XTD A;  1EQR A;  5IWA L;  5C3E G;  4DAY B;  3S15 H;  4A3G H;  4A3J H;  3M9B A;  4HJ5 A;  2JA7 G;  4UP8 A;  5FLX c;  2IT1 A;  5E7N A;  5C0X J;  3F2B A;  2UUC L;  3AQQ A;  4GKK L;  2B3G A;  4LFC Q;  4A3C G;  1PA6 A;  1TWF H;  5M5X H;  4DV3 Q;  3WWV A;  3CXC A;  1K83 H;  3J80 c;  3G4S A;  1HNX L;  1U0L A;  3I7F A;  1XNR Q;  4KHP L;  3D0F A;  4PZ8 A;  3MEF A;  1C0A A;  2D0O A;  4HJ9 A;  4IO9 A;  1P8L A;  4IJH A;  1Q46 A;  4AQY Q;  3U58 A;  1K73 C;  1YJ9 A;  4JI3 Q;  3S1N H;  3UE0 A;  2XTI A;  2JEA I;  3A5U A;  1VQM A;  2VS1 A;  4NXM Q;  4X66 L;  4B3R L;  1L2F A;  1OXV A;  3MXN B;  3K80 C;  3PCO B;  1HZA A;  3AYH B;  1UE6 A;  5DLQ E;  5FJ8 H;  1OXS C;  3CCE A;  1WOC A;  1Q86 C;  5ELO A;  3GO5 A;  4JI8 Q;  5IP9 H;  4DV4 Q;  1SLJ A;  5IYB G;  1SFO H;  1VQ4 A;  3KLW A;  5FLM H;  3M4Q A;  4DV7 Q;  4JCV E;  3HOY G;  5IE8 A;  4A3B H;  4YWM A;  3T1Y L;  4LF7 Q;  1I6H H;  1S72 A;  4KLK A;  1VQI A;  2JA9 A;  3CMA A;  4B3S Q;  2F52 A;  1Y1V H;  4BBS G;  3CAM A;  3PIP A;  4JYA L;  1H95 A;  3GTG H;  1PH3 A;  2A19 A;  1NE3 A;  1PH7 A;  3FKI H;  2BH2 A;  3W5O A;  1UE1 A;  4JI2 Q;  2MFI A;  3SGI A;  1Y1W H;  4DR2 L;  4R4T A;  2VQF L;  1YIJ A;  1UEB A;  2ID0 A;  4UPA A;  3IRB A;  4GLA C;  4NXN L;  4PMW A;  1L1O B;  2VW9 A;  2ATW A;  1LUZ A;  2K14 A;  3K0X A;  4TQU S;  3J81 c;  3AFP A;  4QY7 A;  2ALY B;  2E5L Q;  1N8R C;  4LFB L;  1WFQ A;  1CKO A;  4DR1 L;  3A0J A;  5JEA J;  2Z0S A;  1S3O A;  4GOP B;  3S1R H;  1QVC A;  3D31 A;  5LMU L;  1B8A A;  2Y0S E;  4DV6 Q;  1S40 A;  4A3J G;  1ASZ A;  2IHF A;  2D62 A;  3CCL A;  4B3T Q;  1XNQ L;  1HR0 W;  3CQZ H;  3HKZ E;  4WJ3 M;  3DLL A;  3TS2 A;  4DV2 Q;  1QVG A;  1T9H A;  2RHS B;  1Q8K A;  2R6G A;  4NB3 A;  2ZM6 Q;  2N78 A;  1HR0 L;  1JJC B;  4JI0 Q;  3ZJY C;  3KJO A;  1YZ6 A;  2K5N A;  4X64 Q;  1VQP A;  1XPR A;  2OWO A;  3BU2 A;  4A3F G;  3E9I A;  1J5E Q;  4YHH L;  4LF4 Q;  4UY8 C;  4UP7 A;  1IYJ B;  5GAH C;  1LYL A;  2JA5 G;  4C3I H;  2IX0 A;  1HZC A;  3TS0 A;  1PH1 A;  2PQA B;  5C4X H;  1HNW Q;  1XMO L;  3PGZ A;  4R4Q A;  4LF8 Q;  4X62 Q;  5FJ8 G;  3H0G H;  3M4P A;  1PH9 A;  1WCM H;  2VNU D;  3RR5 A;  2R7D A;  4LWC A;  4GS3 A;  5IP9 G;  5AJ3 L;  5GQO A;  1A62 A;  1X3G A;  4B3M Q;  4LF9 L;  3I2Z A;  3HOW H;  1HNZ L;  3K8A A;  4R1J A;  4A3B G;  1KHI A;  2WB1 E;  2ZTE A;  1VQJ A;  1K8G A;  3CCU A;  3PO2 H;  4KI0 A;  4BY7 H;  2Z6K A;  2NVY H;  2KHJ A;  3STB C;  5K36 G;  4X62 L;  5M3F H;  1Y1V G;  2HT1 A;  1OXT A;  5M3M G;  3G6E A;  3S14 H;  4LF5 Q;  4DR7 L;  1VQ9 A;  3ULL A;  4C3J H;  3FKI G;  1X3F A;  5HY6 A;  4EQ5 A;  3GTJ H;  1G29 1;  1PH4 A;  2ZTC A;  2V1C C;  1JJ2 A;  2IHE A;  2EQS A;  2HIV A;  2Q2T A;  4GLV B;  3H15 A;  1IBM L;  3PUW A;  1VQC A;  2NN6 G;  4P72 A;  4PZ6 A;  3UDG A;  4HIM A;  1N33 Q;  3U4Z A;  4L5Q A;  3RN2 A;  1K0R A;  1E1O A;  1KD1 C;  1VQL A;  1TWG H;  1V43 A;  2CWA A;  1KC8 C;  2R7Z H;  3PUV A;  1G6P A;  1LTL A;  3H3V H;  4QGU A;  2H5X A;  3ER0 A;  2B63 H;  2NN6 I;  2Q2I A;  3NEN A;  2HHH Q;  2VUM H;  1PYS B;  1TXY A;  5C44 H;  4OWX B;  5GAE C;  1FJG L;  2E2I H;  1KRT A;  4A3M H;  1YIT A;  2UXB L;  4JBW A;  1VQ6 A;  3GTM H;  4O0A A;  5M5Y H;  3GTL H;  1N36 L;  4GKK Q;  1N32 L;  1HNX Q;  4LFA L;  3STB D;  1GO3 E;  1CSQ A;  1VQN A;  3KF6 B;  3AFQ A;  4P73 A;  5IY0 A;  1IBL L;  3UE1 A;  2CFM A;  1WI5 A;  3KDF B;  1Q81 C;  2UXC L;  2OQK A;  4A3K G;  3GTK H;  3RN5 A;  1UWV A;  4X66 Q;  3KJP A;  4B3R Q;  5C4J H;  2OTJ A;  5C4X G;  1B70 B;  1PH6 A;  4JI7 L;  4A75 A;  3H0G G;  1NMF A;  2KCM A;  1U5K A;  1WCM G;  4TVA B;  1WYD A;  4PG3 A;  3CCR A;  1X3E A;  2ZJQ A;  1AE3 A;  2JA8 H;  2IY5 B;  1A0I A;  1PH5 A;  4YCU A;  2WAQ G;  3J80 i;  3HOW G;  4BXX G;  3KOJ A;  3UDI A;  1YJW A;  2BA1 A;  3T1Y Q;  1VQG A;  3PUY A;  4PZ7 A;  1YBY A;  3PO2 G;  2E2H H;  1KIX A;  4BY7 G;  1VQF A;  4GN3 B;  3F2D A;  5IYC H;  3BZK A;  1KL9 A;  5LMN W;  1FGU A;  1YHB A;  3A5Z B;  3EBE A;  3L7Z C;  3OTO L;  3T1H L;  4DUY L;  1M1K C;  4JYA Q;  4JV5 L;  1QUQ B;  2A8V A;  4WJ4 A;  1AH9 A;  3S16 H;  3EIV A;  2ES2 A;  1C7Y A;  3K7A H;  4JI1 L;  4DR3 L;  1YEZ A;  5LMN L;  2VY3 A;  4DR2 Q;  2VQF Q;  1VQ7 A;  4MZ9 A;  3Q8D A;  2E2J H;  4DV5 L;  4JBK A;  3ERS X;  4NXN Q;  3HOU G;  1SN8 A;  1EUJ A;  2VQE L;  4A3G G;  1PH8 A;  4IPH A;  2HIX A;  1I5F A;  2UUA L;  2R7Z G;  4LFB Q;  2OTL A;  4YCV A;  2GVB A;  2R7F A;  4XTC S;  4JI4 L;  4A3L G;  4BA1 I;  2B63 G;  3B6Y A;  4C3H H;  1JE5 A;  1XPO A;  4DR1 Q;  2UU9 Q;  2VUM G;  2CKZ B;  5C44 G;  1RL2 A;  5LMU Q;  3F2C A;  2F4V L;  2LXJ A;  1XNQ Q;  1VQD A;  5JJK A;  5J3B A;  4A3M G;  1K8A C;  2QEX A;  1SR3 A;  1KRS A;  2MO1 A;  3W1G A;  5M5W H;  2R92 H;  4ALP A;  3FP9 A;  2MO0 A;  2K50 A;  2BH8 A;  2E8G A;  3JAM c;  1X56 A;  1HR0 Q;  3TRE A;  3L2P A;  1L1O C;  4P75 A;  3TQY A;  2PI2 A;  3UDF A;  1I94 L;  2UU9 L;  1VQ8 A;  2NVT H;  3U50 C;  4YHH Q;  2EXD A;  1GVP A;  1GM5 A;  1Q7Y C;  1XMO Q;  1JT8 A;  4JBJ A;  2NZH A;  2KCT A;  4GOP C;  3NBH B;  3M85 A;  4X65 L;  2L15 A;  3GTQ H;  3KFU A;  1C9O A;  1Q1B A;  5AJ3 Q;  4LF9 Q;  3U4V A;  4POF A;  3CPW A;  3E0E A;  4AH6 A;  1HNZ Q;  1TWH H;  4BY1 H;  1QUQ A;  2MNA A;  3CC2 A;  2AWO A;  4DUZ L;  1W3S A;  2AMC B;  2VL6 A;  5IYC G;  4POG A;  2N8N A;  2Y0S G;  1OTC A;  4L5T A;  3GTO H;  4JOI C;  4HID A;  3AEV A;  3S2D H;  4DR7 Q;  2NVQ H;  4O2D A;  2PNH A;  1J6Q A;  3FHW A;  1D8L A;  1KAW A;  4JC0 A;  5FLM G;  2JA6 H;  3HOV H;  1X55 A;  1N9W A;  4LNQ A;  4Y52 H;  2YTX A;  4NPS A;  2YYZ A;  1IBM Q;  1E24 A;  1EIF A;  3A74 A;  4L5S A;  3HOU H;  5C3E H;  4IOC A;  2UXD L;  4UP9 A;  4IPD A;  2JA7 H;  1YI2 A;  1L1O A;  3DM3 A;  1D7Q A;  4DKA C;  2D0P A;  2JQO A;  1X9N A;  3VDY A;  1Y1W G;  4R4C A;  4R4I A;  1FJG Q;  1V9P A;  1DGS A;  1LM0 A;  4GNX B;  1E3P A;  4GOP A;  3HKS A;  2OQ0 A;  3HOZ H;  3GD7 A;  2UXB Q;  2PMZ E;  2WB1 G;  1FVI A;  3CCS A;  1N36 Q;  2AWN A;  4GN5 A;  2R92 G;  1N32 Q;  4QQB X;  4AYB G;  4LFA Q;  3CCM A;  5BR8 L;  4GNX C;  3J7A 5;  3S17 H;  3E9H A;  4A3D H;  1UE7 A;  1IBL Q;  5ELN A;  4JI6 L;  2UXC Q;  3CCJ A;  5IT9 c;  4JI5 L;  1SRU A;  3S24 A;  2ZJP A;  1IL2 A;  3TRZ A;  4JI7 Q;  1GKH A;  4JOI A;  4HJA A;  3K81 C;  1XMQ Q;  4Y7N H;  1QZG A;  4P71 A;  3M4O H;  1MIU A;  2PQA A;  1SMX A;  2ZTD A;  3RLN A;  4DR5 L;  3NEL A;  2K5H A;  4IPC A;  1PHJ A;  1KXL A;  1A63 A;  4X6A H;  1A8V A;  1VQ5 A;  2JJQ A;  1JB7 A;  4YY3 L;  1BVS A;  4R4O A;  3HFZ B;  3G71 A;  3PSI A;  3PUX A;  1XMQ L;  4AIM A;  5EAY A;  3T1H Q;  1X6O A;  3OTO Q;  4JV5 Q;  4DUY Q;  1X65 A;  2NVX H;  2MQH A;  1TWA H;  3W1B A;  1WJJ A;  2F3I A;  1L0W A;  1G51 A;  1VQA A;  2B29 A;  4JI1 Q;  5LMN Q;  2CWP A;  4DR3 Q;  1HH2 P;  4L5R C;  1VCI A;  1TWC H;  2WAQ E;  1EYG A;  3CW2 C;  4K0K L;  3HOX H;  4DV5 Q;  3JC6 6;  2VQE Q;  4HJ7 A;  1VQO A;  4QIW E;  1MJC A;  3GTP H;  3KF8 B;  5M3F G;  4BA2 I;  3PO3 H;  2UUA Q;  4YCW A;  1IBK L;  4IJL A;  1BKB A;  4JBM A;  4GNX A;  1R9T H;  4IOA A;  4JI4 Q;  4APV A;  1Q1E A;  2JK8 A;  1CKN B;  3G48 A;  4BBR H;  3S1Q H;  4HIK A;  4IFD G;  4J15 A;  3BJU A;  5JJI A;  2DGY A;  4DV1 L;  4DV0 Q;  2F4V Q;  4GKJ L;  1W2B A;  1VS0 A;  3GDE A;  2EIF A;  3HOZ G;  4A3F H;  1UE5 A;  2LXK A;  4HJ8 A;  4IFD I;  2JA5 H;  3I4N H;  1HZ9 A;  3PUZ A;  1M90 C;  2RF4 A;  1KQS A;  3L0O A;  2BA0 A;  3I4O A;  4LFC L;  1I94 Q;  4YWL A;  4A3D G;  4DV3 L;  4HIO A;  3PIO A;  1K3R A;  4DV0 L;  1E7Z A;  3KF6 A;  1BBW A;  3J81 j;  1XNR L;  1PFS A;  2CCZ A;  2PI2 E;  1QZH A;  3H3V I;  3KDF A;  4JI3 L;  1EWI A;  1BBU A;  4AQY L;  2JEB I;  4X65 Q;  2GN5 A;  5H1S E;  2QA4 A;  2HQL A;  1PV4 A;  3J81 i;  4NXM L;  2R93 H;  2XGT A;  3ULJ A;  3CF5 A;  3NEM A;  4C2M H;  1HZB A;  4RMF A;  4A4I A;  3JAM i;  2GVA A;  5IYD H;  2K5V A;  5M3M H;  2YTY A;  4DK6 C;  1N34 Q;  4JI8 L;  3J7Z C;  4DV4 L;  4A3I H;  4A3E H;  1Q12 A;  4DUZ Q;  3M7N A;  2JE6 I;  2KBN A;  3I56 A;  4DV7 L;  4GLX A;  2ASB A;  3S1M H;  4LF7 L;  1EIY B;  4A93 H;  1YHQ A;  1CKM A;  1X54 A;  4RG1 A;  1EFW A;  1JJG A;  2WFW A;  2JA8 G;  4B3S L;  4YWK A;  4LW1 A;  1OXU A;  2Z6K C;  2ZJR A;  4DR4 Q;  2NZO A;  1CUK A;  2A1A A;  1SRO A;  1N34 L;  3HOX G;  1B7Y B;  1CKN A;  4JI2 L;  3F1Z A;  5HGQ A;  4GN4 B;  4OWT B;  1YHA A;  2I5L X;  1Z9F A;  3PO3 G;  3K7U C;  4DR6 Q;  2RCN A;  4OX9 Q;  2UXD Q;  1OXX K;  4QJF A;  3HKZ G;  1I50 H;  1MKH A;  4MTN A;  1YVC A;  4OWW B;  2IX1 A;  1JMC A;  4BBR G;  2DUD A;  2QGQ A;  3KYH C;  4XIG S;  2E5L L;  4LF6 Q;  4DR4 L;  1CSP A;  4DK3 C;  4DNI A;  2K52 A;  2LSS A;  3OYY A;  4H02 A;  4EX5 A;  3I4M H;  4QL5 A;  5IP7 H;  4IFD J;  1NTG A;  1V1Q A;  1I3Q H;  4OXP A;  2AKW B;  3ULP A;  1VQE A;  4MNO A;  2CQO A;  4JG2 A;  5C0X G;  3RLO A;  4OX9 L;  4DR6 L;  4A3K H;  4DV6 L;  3I4N G;  1IXR A;  2I5M X;  2I0Q A;  1PVO A;  1IZ6 A;  4B3T L;  1QVF A;  2RHQ B;  4LUO A;  5BR8 Q;  3RLF A;  4DV2 L;  4A3C H;  4P74 A;  5JJL A;  4LF6 L;  5C0X I;  1VQB A;  3F8T A;  4JI6 Q;  2YTV A;  2ZM6 L;  3CCV A;  1NBW A;  4JI5 Q;  1K9M C;  4JI0 L;  1Z47 A;  3S2H H;  4X64 L;  4BXX H;  1J5E L;  4LF4 L;  3PF5 A;  1EQQ A;  1Y14 B;  4DAM A;  3RZD H;  3ICE A;  4LUZ A;  1HNW L;  1GD7 A;  1VQH A;  3CPF A;  2R93 G;  4IPG A;  4FDB A;  3UDX A;  4AYB E;  4DR5 Q;  4LF8 L;  4DPG A;  3LGJ A;  5IYD G;  4YY3 Q;  1NMG A;  2KEN A;  1YJN A;  1RIP A;  5IYB H;  4A3I G;  4A3E G;  1PH2 A;  4B3M L;  5GAD C;  3RNU A;  3CCQ A;  4KHZ A;  1XPU A;  5GRO A;  4LUV A;  3HOY H;  1VQK A;  1P16 A;  4A93 G;  2YU9 H;  2WP8 J;  3PV0 A;  3RZO H;  2FXQ A;  2YV5 A;  1NJI C;  2K75 A;  3CME A;  3OW2 A;  2KHI A;  1E22 A;  4BBS H;  3CD6 A;  1EOV A;  1E1T A;  1O7I A;  3CC7 A;  4BY1 G;  2AHO B;  2K4K A;  4ME3 A;  2UUB Q;  2Q2U A;  4LF5 L;  4A76 A;  1PYB A;  1HJP A;  1XJV A;  1ASY A;  1SE8 A;  4K0K Q;  2Q2H A;  5GAG C;  4A3L H;  2OCE A;  3TEH B;  2VZA A;  5IWA Q;  1AE2 A;  3CP0 A;  2C35 B;  4OON A;  3CC4 A;  1IBK Q;  1FL0 A;  1N33 L;  4OO1 G;  2UUC Q;  1MJE A;  2N49 A;  1Q82 C;  2JA6 G;  3I55 A;  3HOV G;  3EN2 A;  2UUB L;  3PF4 A;  3BZC A;  5JEA G;  4DV1 Q;  2I5H A;  3I4M G;  3M3Y H;  5IP7 G;  4GKJ Q;  4KHP Q;  1NY4 A;  2N3S A;  1YNX A;  4OO1 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...