1WOCA

Crystal structure of prib
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
99
structure length
99
Chain Sequence
TNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Primosomal replication protein n
publication title Crystal structure of a biologically functional form of PriB from Escherichia coli reveals a potential single-stranded DNA-binding site
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 12
structure length 99
sequence length 99
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1wocA00
4B3RL 2NVYH 3A0JA 4JI0L 2ZJPA 2AMCB 3JAMc 2VNUD 2YV5A 4JOIA 2Z6KA 4OONA 1XTDA 3RR5A 4B3SQ 4GKJL 1QUQB 4Y7NH 3W5OA 3J7A5 1VQHA 3K81C 1IYJB 2LXKA 1Y1VG 1Z9FA 4LW1A 4Y52H 2E5LL 4H02A 1YI2A 1Y1VH 1NMFA 3M3YH 4MNOA 4DPGA 1X9NA 2AKWB 5M5XH 4PZ6A 1O7IA 4JV5Q 4DAMA 4LF8Q 4BA2I 1B70B 2R92H 1CSQA 2C35B 4NXML 1VQCA 4A3IG 4MTNA 4B3SL 4AQYQ 5FLXc 2KENA 3L7ZC 3E0EA 4A3IH 3GTKH 3UE0A 2WAQG 2IX0A 4A3KG 1HZAA 1HNXQ 3S1QH 4DV5Q 1Q82C 1VQLA 1PH9A 4QQBX 1OXXK 4A3KH 3U4ZA 1HZCA 2E2IH 4A76A 2F3IA 2VW9A 4JI1Q 5JEAG 2KCMA 4LF8L 1Y1WH 3M7NA 4HIKA 4DNIA 2JEAI 5JJIA 5GAHC 3S16H 3FKIG 4AQYL 4JI7Q 4NB3A 3NELA 2ZJRA 2E2HH 1JJCB 2ATWA 5JEAJ 4L5TA 1HNXL 2IT1A 4DV5L 4ME3A 3A74A 3OYYA 1C9OA 3J80i 4P74A 4DV1Q 2D0OA 3CCSA 1A62A 4R4TA 4R4QA 4JI1L 3ULPA 2VL6A 2E8GA 3ERSX 4LUZA 1T9HA 2PI2E 3KDFA 4JCVE 1SE8A 4YCUA 1W2BA 1A0IA 3HFZB 5AJ3Q 4JI7L 3PUZA 4JBWA 1E24A 1VQ6A 3RNUA 3SGIA 1VQBA 4O2DA 3CCVA 1J5EQ 2DUDA 4A3DG 4DV1L 2XTIA 5LMNQ 3GTJH 2IY5B 4X64Q 4A3DH 3ZJYC 3I4OA 5IE8A 5M3MH 3AQQA 3PSIA 4GOPA 5AJ3L 4GLVB 4EX5A 4IPGA 1KRTA 1I6HH 2Y0SE 1J5EL 4YWLA 3F2DA 4LFBQ 4UP8A 3CD6A 4X64L 3CCUA 1OTCA 1OXUA 1VQ9A 3L0OA 1XPRA 1WFQA 4BA1I 1D8LA 5M5YH 3M9BA 2Z6KC 3IRBA 3EIVA 4R4CA 1PH1A 4GNXB 4POGA 3CP0A 4LFBL 4A93G 1OXVA 2ALYB 1PH2A 4BBRH 1CKNA 1EIFA 4IO9A 4A93H 1YIJA 3J80c 3BZKA 4GS3A 1EOVA 4L5RC 3M4QA 2I0QA 2VQFQ 1N9WA 1WI5A 1IBMQ 5BR8Q 3I4NG 1HR0Q 4BY1G 5IYCG 2D62A 1PA6A 1X54A 5IYBG 3I4NH 4BY1H 4YCVA 5IYCH 3ER0A 4R4OA 5IYBH 1EIYB 1GKHA 4KHPQ 1XNRQ 4NXNQ 2KHJA 4GN3B 3S15H 3S1RH 3F8TA 1K73C 3UDIA 1V9PA 4HIDA 4JI6Q 2K5HA 3OW2A 2JE6I 4AIMA 1GD7A 2VQFL 1XPOA 1PH5A 5BR8L 4IPDA 2VQEQ 1R9TH 1K9MC 1IXRA 1HR0L 4X62Q 4K0KQ 1I5FA 2ID0A 2I5HA 1JJGA 2Q2HA 4QL5A 1XMOQ 2WB1E 4P71A 4GLXA 1UEBA 2KBNA 1XNRL 4NXNL 1I3QH 2FXQA 3STBD 4GN4B 3RN5A 1XMQQ 1NMGA 1NJIC 3G4SA 3UDXA 1K8AC 1WYDA 5LMUQ 3K7AH 4JI6L 2JJQA 1X3EA 3K7UC 4DKAC 3A5UA 1Q8KA 4A3MG 2VQEL 3KF8B 1K3RA 4K0KL 4X62L 4BY7G 4A3MH 2BH2A 1KRSA 4LFAQ 5ELOA 4C3IH 3CCRA 4HJ7A 4BY7H 1JT8A 1XMOL 2EIFA 2VUMG 4GN5A 2KHIA 4KI0A 3MXNB 3F1ZA 1IBML 1XMQL 2UUBQ 1SRUA 1QVCA 1UE5A 2A1AA 2CWAA 4C3JH 5LMUL 4DV3Q 1WOCA 1EQRA 2JA9A 2K5NA 3G48A 4C3HH 5GAGC 2I5LX 2K14A 3FP9A 4GOPC 4HJ9A 3WWVA 1EWIA 4FDBA 4YY3Q 1JMCA 3HOUH 1UE7A 3TS2A 4LFAL 3CF5A 4A75A 4AYBE 2MNAA 1TWFH 3PIPA 5IT9c 3UDFA 2GVAA 2R7DA 3PUWA 4AH6A 5FLMG 4DR7Q 2CFMA 4DV6Q 2UUBL 4XTCS 4DV3L 4IOAA 1QUQA 3TRZA 2R6GA 3S2DH 2NVXH 1TWGH 3UE1A 1N33Q 3GD7A 2UXCL 1I94Q 2Q2IA 4O0AA 5EAYA 4YY3L 4JYAQ 3EN2A 1B8AA 4YWMA 2OWOA 2Y0SG 2R7FA 2EQSA 2HQLA 1OXSC 2JQOA 1SN8A 4DV6L 3OTOQ 3G6EA 1K83H 3CC4A 2ZTEA 2MO0A 1N33L 1H95A 2UXBQ 1GVPA 1E1TA 5DLQE 1I94L 4EQ5A 3I55A 1AH9A 4JYAL 2CWPA 1RIPA 4LF4Q 1PH6A 4A4IA 1Q81C 4JV5L 4OO1G 2QA4A 4A3EG 3NEMA 3CMEA 1NY4A 2VS1A 3OTOL 2ZTCA 1X6OA 1X65A 2UXBL 1PFSA 1TWHH 3J81c 2GVBA 2CQOA 3FKIH 1JB7A 1C7YA 1IBLQ 2UUCQ 4JBMA 1L1OC 4X66Q 1U0LA 4DR3Q 3DLLA 1XJVA 1P16A 3BU2A 4LF4L 5J3BA 4GKKQ 2MO1A 1G51A 2WFWA 3BJUA 2DGYA 2R93G 5E7NA 5IWAQ 2BA1A 3KFUA 1AE3A 3RZOH 2UUCL 3GTGH 1PH3A 2RF4A 1QZGA 1IBLL 1B7YB 3STBC 4IPCA 4X66L 4DR3L 1KL9A 3W1BA 4HJ8A 1E1OA 3AYHB 4GKKL 4OWXB 4OX9Q 3HOUG 1L2FA 3W1GA 4LF6Q 5IWAL 2N3SA 1NTGA 2PI2A 1E22A 4HJ5A 1X3GA 1N8RC 1N32Q 4NPSA 2OQ0A 1WJJA 2PQAA 2UXDQ 5LMNL 3AEVA 3KDFB 4B3TQ 1S3OA 5IYDG 3K8AA 1TWAH 2UU9Q 4JBJA 4LF6L 3M85A 1YHBA 2HIVA 3RZDH 5IYDH 4DV4Q 1UE6A 2OCEA 2A19A 5ELNA 3HKZG 4JI3Q 3A5ZB 1N32L 1WCMG 3RLFA 1VQDA 2UXDL 1HNZQ 1WCMH 2ASBA 2IHEA 4X65Q 4B3TL 4WJ3M 2PNHA 1IBKQ 1CKOA 1OXTA 2GN5A 1Z47A 1Q1EA 1G291 1YJNA 1GM5A 1FGUA 2UU9L 1X56A 4LF5Q 4IFDJ 1SROA 1M90C 4DV4L 3AFQA 3K0XA 4B3MQ 1A63A 5GADC 4L5QA 3KYHC 3LGJA 4JI3L 4JI4Q 4PZ7A 2WAQE 4PZ8A 4HIOA 2XGTA 3I56A 3RN2A 1HNZL 1YBYA 4X65L 3PO2G 4A3LG 2MFIA 4IJHA 3TREA 1VQNA 3BZCA 3PO2H 4LF5L 4DR4Q 3I7FA 1E3PA 1L1OA 1LUZA 1X55A 3H0GG 4DR1Q 1XNQQ 4B3ML 1BVSA 1PH7A 3CCJA 3EBEA 3H0GH 4JI4L 4KHPL 2B63G 2JA8G 2RHSB 3PO3G 4YCWA 2B63H 2JA8H 4IJLA 4LWCA 2JA7G 3KJPA 5M3FG 3HOWG 3PO3H 4DUZQ 3PGZA 1MJCA 3RLNA 2Z0SA 4YWKA 5M3FH 3HOWH 1Q1BA 1AE2A 1KHIA 1UE1A 4RG1A 4DR4L 4R1JA 3HOYG 3E9IA 4DR1L 1XNQL 1SLJA 1YJWA 2K5VA 3CPWA 1YVCA 2YTXA 1SR3A 1FJGQ 3KF6B 4A3FG 4BBSG 3RLOA 4C2MH 2VUMH 4A3FH 4BBSH 1PYSB 4DUZL 3M4PA 4MZ9A 4UP9A 2R93H 1V1QA 3PF4A 4DV0Q 1A8VA 2K50A 4LNQA 1UWVA 4JI2Q 3B6YA 1PV4A 1JJ2A 1HR0W 3PV0A 4OWWB 4POFA 1FJGL 3DM3A 2VZAA 3U50C 1IZ6A 2E2JH 1N34Q 5M5WH 1M1KC 5FLMH 4JBKA 2HHHQ 1U5KA 1MJEA 4UP7A 4DR5Q 2ES2A 4B3RQ 3NENA 4DV0L 4GNXC 1Q7YC 3GTPH 3HOZG 3F2CA 3GTLH 2OQKA 1I50H 4JI2L 3KJOA 5C0XG 4LF9Q 3HOZH 1L0WA 1BKBA 5C3EG 1FVIA 2JA5G 1VQIA 2NN6G 5IP7G 4DV7Q 1CKMA 3D31A 5IP9G 5C3EH 1N34L 2JA5H 4DUYQ 4DR7L 2OTJA 3F2BA 1SFOH 1IL2A 5C0XJ 4GLAC 5IP9H 2YYZA 2HHHL 4BXXG 2NN6I 1X3FA 5GROA 5FJ8G 1HZBA 1PH8A 4A3BG 4BXXH 2RHQB 3GTMH 5FJ8H 4TQUS 1PYBA 4A3BH 5JJKA 4LF9L 2B29A 3J81j 4KHZA 4DR6Q 2CKZB 3S1NH 2RCNA 3KLWA 4RMFA 4DV7L 2JA6G 3GTQH 1BBUA 1VQEA 3MEFA 4DUYL 2HT1A 1D7QA 5H1SE 4A3EH 4LUVA 4KLKA 1YITA 1ASZA 4OXPA 2I5MX 2JA6H 4OO1I 2CCZA 1VQ5A 2R92G 3FHWA 3ULJA 3JC66 1G6PA 2ZTDA 4R4IA 4P73A 4DR6L 3CCMA 2BH8A 3T1HQ 1VQ8A 3K80C 1NBWA 1VQFA 2K4KA 2N8NA 1TWCH 1LTLA 2BA0A 4A3GG 3PUVA 2KCTA 4DR2Q 4A3GH 1Y1WG 1LM0A 1KIXA 3TQYA 2YU9H 4JI8Q 1KAWA 1YEZA 4X6AH 3T1HL 3U58A 2AHOB 2D0PA 2AWOA 2WB1G 3CC7A 4LFCQ 4OWTB 4APVA 1KQSA 1YJ9A 3CCEA 1LYLA 2F52A 3Q8DA 4DR2L 1VQAA 2A8VA 1VQJA 1QVFA 2YTYA 3PUYA 4JI8L 1VQMA 1PH4A 3ULLA 1KC8C 1RL2A 3GTOH 1YHAA 2K75A 4OX9L 2OTLA 3I2ZA 4LFCL 2LSSA 4UPAA 4A3CG 2YTVA 1JE5A 3CMAA 4GNXA 2F4VQ 4WJ4A 1VS0A 1S40A 1VQ7A 3S17H 4A3CH 3E9HA 4LUOA 4P72A 1EFWA 5M3MG 5K36G 4TVAB 2PMZE 1EQQA 1CUKA 4IFDG 4PG3A 3U4VA 4AYBG 4GOPB 3G71A 1C0AA 1VQKA 2Q2UA 3PF5A 5HGQA 4IOCA 2QEXA 4IFDI 5C4JH 5IY0A 2NZHA 4DK3C 3HOXG 1W3SA 4LF7Q 2NVQH 1K0RA 3KOJA 2F4VL 2V1CC 2QGQA 2VY3A 2B3GA 3HOXH 1HNWQ 1DGSA 2PQAB 2LXJA 1Q12A 1J6QA 1CSPA 1SMXA 2R7ZG 3T1YQ 4IPHA 1MKHA 1FL0A 1YNXA 4JOIC 3D0FA 4QIWE 4QY7A 1S72A 2R7ZH 4QJFA 2HIXA 4YHHQ 5GAEC 3CW2C 1IBKL 3H15A 4BBRG 1HJPA 2IX1A 5LMNW 4LF7L 1VQPA 1QZHA 4A3LH 5HY6A 1K8GA 4HJAA 1KXLA 4UY8C 1HNWL 1Q46A 1Q86C 1CKNB 1N36Q 3GDEA 1HH2P 4J15A 1YZ6A 1EYGA 2K52A 4DK6C 2Q2TA 1NE3A 3CQZH 3T1YL 2ZJQA 3CPFA 3CCLA 2UXCQ 2ZM6Q 3ICEA 2N78A 1TXYA 4YHHL 2EXDA 3PUXA 4XIGS 3S14H 5GQOA 2JA7H 1EUJA 1QVGA 3CC2A 5JJLA 1N36L 2JEBI 3JAMi 2NZOA 3VDYA 5C44G 3NBHB 3HOYH 4JI5Q 3KF6A 1KD1C 5C44H 3J7ZC 2ZM6L 1VQOA 1E7ZA 3AFPA 2NVTH 4DV2Q 2N49A 2MQHA 1L1OB 1YHQA 3S24A 1VQ4A 2H5XA 2UUAQ 3GO5A 3I4MG 3CCQA 1Y14B 4JI5L 1PVOA 3TS0A 4JG2A 4QGUA 3UDGA 3I4MH 1ASYA 3CAMA 3TEHB 3PCOB 4PMWA 1VCIA 2L15A 3L2PA 4A3JG 3HOVG 3H3VH 3M4OH 4DV2L 4L5SA 2JK8A 4NXMQ 4A3JH 3H3VI 1HZ9A 3HOVH 4JI0Q 1BBWA 2UUAL 4JC0A 1V43A 1XPUA 2WP8J 1P8LA 4GKJQ 1VQGA 3CXCA 4DAYB 1PHJA 4ALPA 3HKZE 3J81i 1MIUA 4P75A 5C0XI 2AWNA 3S1MH 4HIMA 1GO3E 5IP7H 5C4XG 2E5LQ 3S2HH 2IHFA 3HKSA 3PIOA 4DR5L 5C4XH
chains in the Genus database with same CATH superfamily
4B3RL 3H6MA 1CQFA 3BVGA 5CYUA 3GTOB 3TP8A 3JAMc 1VMPA 2YV5A 2VNUD 4JOIA 5G3LF 3BYYB 1QG7A 2I07B 1PRTD 4HEDA 2E5LL 1NMFA 4MNOA 1LTSD 4PMCA 1D2BA 3D4RA 5C5LA 1CSQA 4ZLTF 3T56B 1F9PA 4MTNA 4B3SL 2K5QA 1PTOH 2B8FA 1NR2A 1G8ZD 3NUCA 3S1QH 1VQLA 2VW9A 4LMQD 4LF8L 1Y1WH 5GAHC 1JE4A 1JJCB 5JEAJ 2A69D 1SYEA 4DK1A 4DV5L 2K04A 3OYYA 1C9OA 3CQZB 1A62A 4R4TA 1CI3M 4R4QA 4JI1L 3D6CA 3ULPA 4I65A 3WOFA 2PI2E 2JA7B 3H09A 4P2CB 3SGIA 1VQBA 4O2DA 3CCVA 5JVG3 1HA5A 4A3DG 2XTIA 2HQEA 4A3FB 3ZJYC 2NVTB 1A3VA 4ID6A 5M3MH 4GOPA 1CK1A 1D5ZC 1SNMA 5AJ3L 2KCCA 1JOKA 4CKBA 4IPGA 1KRTA 4LFBQ 4IZ8A 1EYAA 1TY0A 5CV6A 3CCUA 4IUUA 1OXUA 5M5YH 3M9BA 1Q8IA 3GTPB 4POGA 4RWSC 4BBRH 2QCPX 3DM1A 5C3EB 2I0QA 1CHQD 4BY1G 3P20A 3I4NH 4XT1B 1DONA 3BYTB 4YCVA 3ER0A 3TSSA 5IYBH 4KHPQ 1FD7D 1XNRQ 1B4OA 4GZYC 1GUTA 1TS2A 3S1RH 1EYCA 3A7LA 4JI6Q 3OW2A 4XDXA 1Y1VB 1CA6A 4KN7C 1KAAA 1XTCD 4FO2A 5ELFA 4K0KQ 2ID0A 2IW3A 2A73B 2B2VC 2Q2HA 2WB1E 4FXGC 2MGSA 4NXNL 3MZ5A 1NMGA 3E0JA 3K7AH 5LMUQ 2JJQA 3A5UA 2VQEL 3KF8B 1K3RA 2E2IB 4KTAA 4K5XA 4A3MH 4LFAQ 2O5JC 5ELOA 4C3IH 4BY7H 1JT8A 1LABA 3NQIA 3Q24A 1DM0B 2EIFA 3S16B 4KI0A 4WORA 2F0GA 3F1ZA 1IBML 1XMQL 1F2MA 1IHZA 4HIDA 2AUKA 2WB1B 2CWAA 3R93A 2HD3A 4C3JH 4DAYA 1ICFB 2PZUA 4C3HH 2I5LX 2OEOA 2UXCQ 1JOQA 3LNNA 3WWVA 1JMCA 4KMUC 1LTAD 5BN3A 1PMRA 1F77A 3K5OA 4AYBE 1UUPA 4FP5D 4OELB 2NVXH 1S4ZA 1MSHA 4LK1C 1QNUA 4YY3L 2VXWA 3TZUA 2EJFC 2ICEC 1Y69U 5IGEA 3SK6A 1IW7C 1O7ZA 5BN5A 3IAYA 2R7FA 2EQSA 4AYBB 4DV6L 1SEBD 1N33L 2KQ3A 3MA2B 5DLQE 4EQ5A 1WTWA 1PH6A 1Q81C 4B9XA 3L9AX 4A3EG 1TU2B 2RA4A 3NEMA 3DWQA 2VS1A 3OTOL 1IKMA 2M00A 2UXBL 2CQOA 1C7YA 1IBLQ 4JBMA 1WTVA 1L1OC 2QEJC 4DR3Q 1ICWA 4LF4L 3C46A 2DN8A 4QUFA 2WFWA 2C5CA 3BJUA 3RMHA 1AN8A 1ZEQX 1ONLA 3SVMA 3RZOH 3S15B 1PH3A 2RF4A 2F0DA 2F0UA 1EZ6A 2F1MA 4IPCA 4X66L 1KL9A 2FMMA 2DJFC 1E1OA 5BN4A 1R9TB 3EJIA 1L2FA 3W1GA 4LF6Q 2N3SA 1EFID 2PI2A 4KJOA 1X3GA 1ZYRD 2HDLA 3X3NA 3IKJA 1FYCA 5CV5A 1ILPA 3KDFB 2A74C 3ND8A 1LACA 1U4RA 1PZKD 4JBJA 1YHBA 1EWCA 3WOEA 2BCOA 5I6WA 4JI3Q 3A5ZB 1SYFA 2QW7A 2UXDL 2B2WA 2QF7A 4WJ3M 5KGUA 2GN5A 1Q1EA 1FGUA 2JYOA 3AFQA 4MHEA 1BXTA 1F2LA 1V1PA 3SR1A 4PZ7A 3S2DB 2WAQE 2RBMA 4OIKA 4HMIA 4HSPA 1YBYA 3QO2A 4RGOS 2EJMA 2MFIA 5IIFA 1X55A 1L1OA 4XT3B 5E4XA 3TMEA 4K6LA 1BVSA 4KHPL 1K83B 2B63G 1PTOB 5JVH3 1KDBA 3DEOA 3A8JE 1D5MC 2JA7G 3TZDA 3PGZA 2WAQB 3RLNA 2D9UA 1AE2A 2LKVA 4DR4L 4N8X1 1TR5A 1YVCA 2YTXA 4PMBA 4CDDC 4A3FG 1GUSA 1SNDA 4C2MH 1TWHB 1JWUD 3FKIB 2IPKD 1PYSB 2XIWA 2F0KA 3EFXD 4PV1C 4DV0Q 1A8VA 2Z6BA 2E75C 2RQXA 2KOLA 1PV4A 5LL6S 3PV0A 4OWWB 1PZJD 3RUZA 1MI2A 1IZ6A 4OGQC 1LTBD 3R2TA 2EVBA 2G9DA 4CJ1B 2EYHA 5C4HA 3D3RA 1MJEA 4DNTB 4UP7A 4C1NI 4FF1A 1B1ZA 4L63B 5C3EG 2SDFA 1VQIA 2NN6G 4DV7Q 3D31A 2A6ED 4ZCKA 1N34L 2OTJA 5IP9H 4BXXG 2LY7A 1B44D 1X3FA 2SEBD 4HCEA 5FJ8G 1ZXTA 2RHQB 1PYBA 4OIJA 4KHZA 1B53A 4Z9CB 5KNCA 1Q3LA 5C3XA 4A3EH 1YITA 2BDNA 2KUMA 2JA6H 2CCZA 3HKZB 1VQ5A 1CFMA 3FHWA 3JC66 3HP3A 1G6PA 4R4IA 3CCMA 3K80C 3NK9A 1M4VA 1VQFA 2K4KA 2N8NA 1LO5D 2K05A 1IYUA 2N55A 3QG1A 3QOLA 1BQQT 3SEBA 2KCTA 1CHPD 1LM0A 1KIXA 2YU9H 4JI8Q 4LAAA 4CHTB 1PZID 1DJRD 2HCCA 5DM73 5CV7A 1H9MA 3PO2B 2WB1G 1IKLA 2A6HC 5E4WC 3CC7A 1RD9D 3OWEB 1LYLA 3H0GB 1LTTD 3LWUA 1WTXA 2K7VA 2YTYA 3K5MA 1LT3D 3GTOH 3DEPA 2K75A 5EKKA 1JICA 4U68A 3VR5A 1VMCA 4YIJA 5CV4A 4A3CH 2M9VA 2C9OA 5K36G 2VUMB 3K5LA 1EQQA 4IFDG 4PG3A 3SHLA 4AYBG 2EZVA 1R4QB 1VQKA 5L37A 3PF5A 2Q2UA 2BDOA 5IY0A 2NZHA 4DK3C 4LF7Q 2NVQH 2SNSA 1K0RA 1G6ZA 1PTOF 2Q8RE 2QGQA 4K6DA 4RA8A 2L9HA 2PQAB 3R8BA 4CJ2C 2E2JB 1BBXC 5FK9C 3A55A 3DMUA 4QY7A 3D0FA 4UHVA 1K0SA 4QJFA 4TSSA 5GAEC 4K2KA 1ENFA 2NTSA 4NP5A 1QZHA 3VYUA 5HY6A 1PFNA 4G57A 4FYDA 1YZ6A 4ILWA 2K52A 4DK6C 1GUGA 3CQZH 4KHVA 2ZJQA 5T1IA 2N78A 1TXYA 4JPBW 4YHHL 1AZQA 2EXDA 4XIGS 5IT9L 2JA7H 1EQTA 2L5TA 3S1NB 2VB3X 4IURA 2NZOA 1KD1C 1Z7TA 3J7ZC 1TIID 3AFPA 2NVTH 2N49A 1H9SB 5CC4A 4N9PA 1U4LA 4JVZA 4UAIA 2H5XA 1DXMA 3DWPA 3CCQA 4MN3A 5CGKA 4JI5L 1TWCB 1PVOA 3TS0A 1EOTA 4RGNA 5I4DA 1VCIA 3NTKA 1S5CD 4L5SA 5DAUA 2O4XA 2Z9HA 3H91A 2UUAL 1XPUA 2CH4W 2WP8J 3J80E 2ENBA 4N8FA 3F2UA 2F0JA 1GO3E 2E5LQ 1FGBD 3HKSA 1KLGD 3A0JA 2AMCB 5DM63 2Z6KA 1F2ZA 3RR5A 4B3SQ 3J7YW 3EQLC 1Z9FA 2RDHA 4LW1A 1Y1VH 1GHKA 5HGTA 2PW7A 2F0LA 1X9NA 1O7IA 4DAMA 4LF8Q 2RSOA 5ELBA 2C35B 2E2DC 3E0EA 3IL8A 3HOXB 3UE0A 2WAQG 5EJWA 4DV5Q 2PNRC 1PH9A 1BCPC 4A3KH 5JPNC 1CZGA 1HRJA 2E2IH 2F3IA 4JI1Q 4KKUA 2JEAI 4DU9A 5JEAH 5EPKA 3S16H 3FKIG 4NB3A 3NELA 2ZJRA 2ATWA 1Y8OB 1HNXL 4KJNA 4ME3A 3J80i 3CCSA 2VL6A 4R9WA 1TS5A 5IGGA 1W2BA 1EY0A 1LT5D 3IFDA 5AJ3Q 3S14B 3QR8A 3N6RA 1F9SA 4JI7L 2Z1CA 1VQ6A 2O2LD 4ZAIA 3KBGA 5CORA 4DV1L 1ILQA 3FDTA 4DA2A 1XWEA 1MHWC 3AQQA 3SXHA 1SAPA 1JWSD 1AFPA 3C1FA 1J5EL 3F2DA 5JAVA 2R3ZA 2BE5C 1SJED 1HQRD 3CD6A 1IW7D 4QUCA 1VQ9A 1BCPF 4BA1I 1D8LA 2XRSD 3IRBA 3EIVA 1PH1A 3CP0A 2ALYB 3W2DA 1EY5A 1PH2A 4IO9A 3BZKA 3V96A 4QCLA 3NP8A 4ZK9B 3I73A 3S2HB 3I4NG 2F0IA 5C4XB 2NVYB 1X54A 5IYBG 2K1BA 1I4PA 5IYCH 1GHJA 4MIUA 4R4OA 1GKHA 4NXNQ 2KHJA 1UNSA 3S15H 1K73C 1KNAA 2MHVA 2K5HA 4ODGA 3VA5A 4AIMA 2VQFL 1SNOA 2VQEQ 1R9TH 1K9MC 1IXRA 1HR0L 2EYPA 2R92B 2ZXRA 1IBMQ 1XMQQ 4TRDA 1NJIC 4A3IB 1K8AC 3GTKB 1RKNA 3FPPA 4DKAC 4A3MG 4RCOA 4C3IG 4X62L 4BY7G 2BH2A 3CCRA 1XMOL 4WRDA 4EQNA 2VUMG 2F0TA 3MXNB 4C3JG 2F4IA 3HGBA 2E2HB 4C3HG 1STAA 1QVCA 1UE5A 3FP9A 4GOPC 4FDBA 4YY3Q 1UE7A 1TWFH 5IT9c 1A2TA 2GVAA 1WTOA 1AZPA 2CVRA 4DV6Q 5HURA 2UUBL 3T51B 2R6GA 3S2DH 1N33Q 2AQ1B 4F7XA 4CJ0B 2Q2IA 2I46A 4O0AA 1A3TA 3EN2A 4K2LA 5D65A 4YWMA 1BOSA 1T5XD 3U9OA 1OXSC 1A3UA 3OTOQ 2NVQB 1K83H 2ZTEA 2MO0A 4HAEA 2UXBQ 1GVPA 1I94L 4JW0A 5CV9A 2WINB 2NYZD 4LF4Q 3CRLC 3QJYA 3KBXA 4OO1H 4RFBA 3I91A 1DCZA 1X65A 4F8MA 3TN2A 4A93B 1TWHH 2KCNA 2GVBA 3FKIH 1VDZA 2KEDA 5TSSA 1JB7A 2OXPA 4X66Q 1U0LA 3DLLA 1XJVA 1GUWA 3BU2A 1XXGA 5J3BA 4XXEA 3M4YA 1Y8PB 5E7NA 1HA6A 2BA1A 4HSVA 3KFUA 4FF2A 2FINB 2UUCL 1GUOA 1KDCA 4KD3A 3W1BA 4HJ8A 2PZWA 4GKKL 4OX9Q 3LX0A 5ISRA 3ZYYX 5IWAL 1E22A 3OHXC 3SE0A 4B08A 1DZ1A 3T16A 1NNXA 4NPSA 2UXDQ 5KEEA 5LHY1 3JAME 4IUTA 4M8AA 4Q0FA 2EDGA 4RGTA 5IYDH 2OCEA 1HFNA 3I8ZA 2Q8IB 1N32L 1VQDA 4KKTA 3HOUB 2ASBA 2G5DA 4K5VA 1BUVT 5KIXA 4IFDJ 4DV4L 1L0YB 1HFGA 1B9MA 1QB5D 5GADC 4L5QA 1SJHD 1FNWA 2XGTA 3RN2A 1SMYC 3SK5A 4CGYB 4X65L 4A3LG 1PTOD 3PO2H 4DR4Q 3I7FA 2O5IC 1VF7A 2L11A 4X3SA 4B3ML 1PH7A 3H0GH 4JI4L 5IODA 2JA8H 4IJLA 4LWCA 3VR4A 5FO8B 2E76C 2A6HD 4A3KB 5IGFA 4QIWB 1Q1BA 4RG1A 3E9IA 1XNQL 1SLJA 3BG3A 1WD0A 3MXNA 1QNKA 3R3OA 2VUMH 4BBSH 1G91A 4DUZL 4UP9A 1V1QA 3J7AF 1RHPA 3TBIB 1UAPA 1SYDA 2CW0C 1HR0W 5EBDA 1D6EC 4POFA 1FJGL 2VZAA 3QIAA 2E2JH 2FJ2A 1N34Q 3GTGB 4I7AA 1U5KA 4MTKA 4LJZC 1JWMD 2RKSA 4DR5Q 3C3LA 1Q7YC 3F2CA 3GTLH 1L0XB 4JI2L 5C0XG 3MEHA 2D2CC 4HMJA 2B2WC 1CKMA 5IP9G 4L6TB 2JA5H 2KHSA 3QWNA 3F2BA 1IL2A 3BZDB 3HS0C 4GLAC 2HHHL 1E2ZA 2ZXPA 1WTHA 4QMGA 3KLRA 4TQUS 5J39A 4LF9L 3J81j 1WTQA 3OPOA 2CKZB 4XYQA 5JJZA 3S1NH 1LTGD 1PFMA 3RZDB 2JA6G 4DUYL 4CKCA 5J22A 5H1SE 1IYVA 4KLKA 3NWTA 3GV3A 1WCMB 2R92G 1PRTB 4P73A 3FEWX 3PIO3 4KY7A 1VQ8A 4DR6L 2XWJB 1S5ED 1TWCH 1LTLA 3WDNA 4J1MA 5EGTA 1KAWA 1BNZA 4DFAA 1LTRD 4APVA 4WJWA 2A68C 2WKCA 3Q8DA 2EY5A 3J80L 1VQAA 1F9QA 1HTPA 3A56A 1KC8C 5D3IB 5M3FB 4OX9L 2OTLA 1GUNA 3I2ZA 4LFCL 2D5DA 4A3CG 5IGCA 1ENCA 3CMAA 5LL6X 1VS0A 1VQ7A 1STYA 1EFWA 3SK4A 4ULLA 1CUKA 4DK0A 3U4VA 4KY5A 2R93B 3Q0AA 1QJOA 5ELEA 5FLXE 1TWFB 1W3SA 1D1KA 2F4VL 2V1CC 5F2DA 3HOXH 4QF4A 1DGSA 2N88A 2LXJA 1Q12A 5A35A 1O80A 4IPHA 4KK7A 1S72A 4DNRB 3P1HA 2HIXA 4YHHQ 3EVQA 3BDLA 1HJPA 2EYOA 3C1EA 3HOZB 4A3LH 1CKNB 4F88A 1BCPD 1HH2P 2Y0SB 3NWSA 1EYGA 2V4DA 1SFOB 2WIIB 2B2UC 3CPFA 2DY7A 3ICEA 1STHA 1FR3A 3SK8A 4ZKCB 3KF8A 3GTMB 3S14H 1QVGA 5I6YA 3GTQB 3NBHB 4JI5Q 1D1IA 5C44H 1C48A 2ZM6L 1VQOA 1E7ZA 3A8KE 5M9OA 2RDGA 2IL8A 1VQ4A 3ND9A 1V8QA 2UUAQ 3GO5A 1V1OA 5EBCA 4JG2A 3I4MH 1ASYA 3T53B 4A3GB 2GA4B 3H3VH 1CZWA 4A3JH 3H3VI 2E74C 3T4AC 1BBWA 2BE5D 1P8LA 3CXCA 5C0XH 1PHJA 1LTID 3HKZE 3J81L 5C0XI 4HIMA 5FO7B 3S2HH 4NXML 4DR5L 5C4XH 1TS3A 2EOTA 2NVYH 3A8IE 3NE5B 5E1FA 4JI0L 2ZJPA 3A54A 1XTDA 2K32A 3OIQA 4GKJL 1QUQB 3OSOA 4NDXA 3W5OA 3J7A5 1VQHA 1Y1VG 5E3FA 4Y52H 5KYLA 3BS1A 3M3YH 4DPGA 2AKWB 4PZ6A 5G3LD 4JV5Q 1EL0A 2B2UA 3DWAA 2R92H 2Z4IA 1VQCA 1PTOC 1DYQA 2F3WA 2J0TD 2KENA 3L7ZC 4DGZA 1HQMC 2SOBA 4A3IH 3GTKH 4A3KG 1HNXQ 1Q82C 1OXXK 3NXWA 1SE2A 5JEAG 3QOJA 1EU4A 3M7NA 4HIKA 5JJIA 4AQYL 4JI7Q 4CDEC 2E2HH 4L5TA 2F0OA 1FNUA 3A74A 1QOHA 5A2QE 4DV1Q 2D0OA 3HRZC 3V05A 2JA8B 3ERSX 4JCVE 3KDFA 4K8IA 3HFZB 3PUZA 1E24A 4IQZA 3T13A 1J5EQ 1MD2D 2DUDA 1EIHA 3GTJH 1H9KA 1KLUD 2J4XA 2P5ZX 4BBSB 5IE8A 3PSIA 1AEXA 1J8IA 1U4MA 4GLVB 4EX5A 5FO9B 4YWLA 4XYOA 2F0MA 4X64L 3MVVA 4BS9A 1OTCA 3M4OB 1XPRA 4WFN3 2Z6KC 3HOVB 3Q22A 4R4CA 3OMGA 4GNXB 2KVMA 1G2TA 1D5XC 1EWHA 3GTLB 1SYBA 1CKNA 3MTSA 4EGVA 4A93H 1EY9A 1YIJA 2KA7A 1STBA 3J80c 3NTHA 4C1NK 3S1MB 2JA5B 1DOLA 5EPJA 2VQFQ 1WI5A 1W6KA 2X69A 1HR0Q 2NTTA 5IYCG 2D62A 1SYGA 3FRPB 1RTNA 2FMCA 3W3AA 1EIYB 4GN3B 1STNA 2EXZA 2JE6I 2F3VA 5BR8L 1MGSA 4FXDA 2EYLA 3M7GA 4X62Q 4EQPA 1I5FA 5M5XB 5FKAC 2H1EA 1JJGA 1PFBA 4QL5A 1XMOQ 5EQ0A 4P71A 3R2IA 4H7BA 3RN5A 1AP0A 3UDXA 4O42A 3K7UC 1KTKA 1Q8KA 1DOMA 4ABNA 1O7YA 2UUBQ 1SRUA 2R93G 1WOCA 2JA9A 1SSOA 3HOUH 4HJ9A 1EWIA 4CDCC 3TS2A 2XSCA 3OWFA 3ERQA 2EY6A 1K8MA 4TKOB 1PYWD 3PUWA 4AH6A 5FLMG 4G7ZC 2CFMA 3AB9A 3UI2A 4DV3L 4IOAA 1QUQA 3TRZA 2AQ3B 2QDLA 3UE1A 3GD7A 1I94Q 2H4OA 4A3DB 2EYJA 2OWOA 2Y0SG 2HQLA 3DXJC 3TP6A 1K28A 1WVLA 1I6HB 2L12A 1SMYD 2EY1A 4FF4A 1AH9A 4JYAL 3K58A 1JC7A 2CWPA 4FNFA 4JV5L 5DEHA 4OO1G 1YNNC 5EKLA 1LT6D 2ZTCA 3U9SA 1X6OA 3OW7A 1PFSA 3NPPA 3J81c 2RCFA 2UUCQ 4PNYA 1A2UA 4GKKQ 3OOCA 2MO1A 1RCVD 1G51A 3N52A 2DGYA 3D4WA 5IWAQ 5IOCA 4ZUIA 1EIGA 2XWBB 3GTGH 1QZGA 1B7YB 3STBC 1J9OA 5C44B 3AYHB 2CW0D 5EPLA 1NTGA 1YNJC 4ME5A 4HJ5A 1I3QB 1N8RC 1N32Q 4L8JA 2OQ0A 2PQAA 3I4MB 3AEVA 1VF5C 1S3OA 5IYDG 5AFWA 4Q5VA 4A3JB 3M85A 3RZDH 4DV4Q 3VYSA 2A19A 3HKZG 4DXGA 4F87A 1B9NA 3AU7A 1WCMH 2IHEA 5FOBB 4OHJA 4X65Q 4B3TL 2PNHA 1IBKQ 2JP1A 1CKOA 1Z47A 2UU9L 1SROA 4B3MQ 5IGDA 2KJXA 4FXKC 4JI4Q 2XN9C 4ZUJA 5C3WA 1TWGB 1HNZL 2ICIA 1BDOA 2PMZB 3PO2G 3BVMA 3TREA 3BZCA 4KY6A 5JOBA 4CKEA 4LF5L 3M3YB 1H9SA 4DAVA 1LUZA 2L1BA 3H0GG 1XNQQ 4XQNA 1NR4A 3EBEA 3CCJA 2JA8G 2PPBC 1S5DD 1H9RA 2QKIC 1AW7A 3NBIA 3PO3H 4DUZQ 1MJCA 2DJGC 2Z0SA 4YWKA 5M3FH 3HOWH 1KHIA 3KUPA 2A68D 4DR1L 3CPWA 4FVMA 2B8GA 5KNDA 5ELDA 1FJGQ 3KF6B 4BBSG 1ZKOA 3RLOA 1SBBB 3CU7A 4MZ9A 2R93H 3SDZA 5I9PA 2K50A 4K8JA 4JI2Q 4K14A 3B6YA 1JJ2A 3DHQA 5FLXL 4DAPA 2Z4HA 5M5WH 1MBYA 5FLMH 1M1KC 4JBKA 3H3VC 1K8OA 2K5WA 2HHHQ 4DN4M 1B50A 2ES2A 2NZ1D 3GTJB 1ESRA 1WD1A 2OQKA 4LF9Q 3HOZH 1NCVA 1L0WA 1BKBA 2JA5G 1H9JA 5IP7G 1CA5A 4KD4A 4DUYQ 1SFOH 4DXFA 5C5MA 2YYZA 3E6ZX 1PH8A 2KEEA 3GTMH 1SE3A 1WTPA 4A3BH 4DR6Q 4O1NA 1TWAB 1I4QA 4RMFA 1R4PB 3G6JB 2F0QA 3GTQH 1BBUA 1VQEA 2MPMA 2HT1A 4HCSA 3D8GA 4OXPA 3MFYA 1ASZA 4OO1I 2BH8A 1HCZA 3TDQA 3E3XA 2RDFA 2BA0A 2HDMA 3PUVA 1JR0D 3DUZA 4A3GH 1EY8A 2X6LA 3CHBD 3OIPA 3T1HL 1SNPA 3U58A 2D0PA 2AWOA 3A7AB 1TKWB 4LFCQ 4OWTB 1KQSA 2F0PA 3MXGA 1I4HA 2F52A 3L3OC 4DR2L 3VR3A 1VQJA 5IT9E 2B63B 1VQMA 1EY7A 2JSOA 2VB2X 4CDFC 3ULLA 2F03A 1YHAA 2B2YC 2HCIA 2K33A 2LSSA 4UPAA 1JE5A 2F4VQ 4WJ4A 3S17H 1SDFA 2CHBD 1S40A 2AUJD 3E9HA 3PQIA 2CQAA 1C0AA 2CH4A 5HGQA 4IOCA 3HOXG 3KOJA 4IALA 4U673 2B3GA 1SMXA 4HR7B 1KABA 3K57A 1MKHA 3MWYW 4QIWE 2R7ZH 5I2YA 2XNAC 3FMCA 1IBKL 3H15A 2IX1A 1JQYD 3Q23A 1I50B 3I90A 1KXLA 4HJAA 4UY8C 1T5EA 1Q46A 1Q86C 1HNWL 3GDEA 4J15A 1QILA 2Q2TA 3T1YL 2ZM6Q 2LS01 5A2QL 3PUXA 4M1UB 3TP5A 5GQOA 1EY6A 4RAUC 3CC2A 5JJLA 1V1PB 2JEBI 1N36L 3JAMi 4FF3A 2F0EA 5C44G 3KF6A 3E5SA 1EEID 3K59A 2JN4A 1L1OB 3G7LA 1SYCA 3S24A 3P7JA 3I4MG 2F0NA 3CAMA 3QB3A 5IGBA 4IUVA 2B2YA 3I70A 2L15A 3L2PA 4A3JG 1II3A 3M4OH 4DV2L 4IUQA 2JK8A 4NXMQ 2NUCA 2BOSA 1HZ9A 3HOVH 4XQQA 4JI0Q 1HPCA 3Q6SA 1V43A 4JC0A 1CT1D 1DOKA 4GKJQ 2NWGA 1RJTA 4ALPA 4RCNA 3S1MH 2AWNA 4NKLA 5IP7H 1PDQA 5C4XG 3D4DA 1WTRA 2IHFA 1GOZA 2TMPA 2K6AA 1CM9A 4OONA 4Y7NH 5DNFA 3K81C 1IYJB 2LXKA 5KYIA 5C4ZA 4H02A 1YI2A 2A5HA 3K0YA 5M5XH 4BA2I 3FPUB 1B70B 3MXUA 1XX8A 5C4JB 4A3IG 2RVLA 4AQYQ 1ESFA 5FLXc 2IX0A 1HZAA 1M8AA 4QQBX 5I9OA 3U4ZA 1HZCA 4A76A 2KCMA 1KDAA 4DNIA 4KN4C 3GV6A 4RKBA 2PO4A 3IFTA 1CTMA 2B2VA 3ONAB 1E2VA 2IT1A 1A15A 4P74A 1JCKB 2FHTA 3PO3B 2E8GA 4YCUA 4LUZA 1T9HA 1SE8A 4IUNA 1TY2A 1A0IA 3HOWB 1EQVA 4JBWA 3RNUA 2MP1A 2TSSA 3HOYB 5LMNQ 2IY5B 4X64Q 4A3DH 4K5WA 5KRUA 3I4OA 3FVQA 1PXUA 1I6HH 3VYTA 2Y0SE 1NAPA 4UP8A 1EEFD 3C2PA 5M5WB 1W6JA 2XVSA 3L0OA 1WFQA 3TP7A 2L55A 4LFBL 4A93G 1OXVA 3OMCA 2HUGA 1EIFA 3GP7A 1IL8A 3X3MA 5C6AA 4GS3A 1EOVA 4L5RC 1PRTC 3M4QA 5CV8A 2MJ8A 1N9WA 2SNMA 5BR8Q 1YNND 5NUCA 1PA6A 2NBFA 3D6WA 4BY1H 4A3BB 3VA7A 3HG9A 2EPBA 3F8TA 3UDIA 1V9PA 4RHSA 1GD7A 3MHBA 1XPOA 1XYIA 1PH5A 4IPDA 1GXDC 4C56C 2PQEA 2I5HA 5JPMC 1UEBA 2KBNA 4GLXA 1SNCA 3EROA 1XNRL 1I3QH 2FXQA 3STBD 4GN4B 3LWEA 3G4SA 3AMUA 1WYDA 4JI6L 3S1QB 1X3EA 1PLFA 2A69C 5CBEE 4RKLA 3ITPA 4K0KL 5COYA 1KRSA 4NW2A 2OT2A 4V0BA 4HJ7A 1Y1WB 1YNJD 4GN5A 2KHIA 1B3AA 1LV9A 3KK7A 4DV3Q 5LMUL 2A1AA 3HOUG 5GAGC 1EQRA 2K5NA 3G48A 2IJ0A 2K14A 2QILA 3MAQA 3I72A 2M2LA 4LFAL 1PRTF 2LFNA 3CF5A 2MNAA 4A75A 3PIPA 3UDFA 2IX3A 2L0CA 2R7DA 3VYRA 1QCBD 4DR7Q 4XTCS 5CR3A 4G7OC 1TWGH 1TQOA 2UXCL 2K28A 3S17B 5EAYA 2F0WA 4JYAQ 1ENAA 1B8AA 5M3MB 1U9RA 2JQOA 1SN8A 3G6EA 4N9TA 3CC4A 1H95A 3VR2A 1B3QA 3MC0B 1E1TA 3I55A 3S9WA 4UDUC 1RIPA 2R7ZB 5M5YB 1CQVA 4A4IA 2QA4A 2PW5A 4R8IA 3CMEA 1TS4A 1NY4A 1X3QA 4BBRB 1SE4A 4H44C 1P16A 2IWHA 1LLRD 3I4NB 3O13A 1ET6A 1AE3A 3MFGA 2KECA 1IBLL 3S1RB 1Q90A 4DR3L 1B2TA 4OWXB 3NHHA 1G2SA 5J1ZA 1HXYD 5CMDA 1S5BD 2PZTA 1RDPD 5I2XA 5T1GA 1TVXA 1I4RA 3K7AB 1WJJA 3V2TA 5LMNL 1QWYA 4B3TQ 4A3MB 2J7ZA 3K8AA 4C3IB 4BY7B 1TWAH 3MXPA 2UU9Q 4LF6L 2B2TC 2HIVA 4BWGB 1UE6A 1F2YA 5ELNA 1O7LA 1SXTA 1WCMG 3RLFA 4C3JB 2R61A 1JB3A 4C3HB 1HNZQ 1O78A 2MUYA 1OXTA 1EY4A 3URYA 3VR6A 1YJNA 1OO9B 1G291 1GM5A 2PCFB 5D3DA 4LF5Q 1X56A 4ZRZA 1M90C 3K0XA 1S5FD 1A63A 3KYHC 3LGJA 4JI3L 5K5PA 4PZ8A 2NVXB 3NBHA 3BDCA 4Y7NB 3I4LA 3I56A 2EYMA 4HIOA 4J6HA 4G4KA 3J7AV 1HUMA 4IJHA 1KNEA 2RSNA 1VQNA 1EU3A 2DY8A 4KKSA 1E3PA 4DR1Q 2RHSB 5ELCA 3PO3G 4YCWA 2B63H 3HOWG 3KJPA 1EYDA 5M3FG 1Y8NB 1BCPB 1MSGA 2QDBA 3BVZA 1UE1A 1LT4D 3P75A 4R1JA 5CBAE 3HOYG 1GJXA 1YJWA 3JAML 2K5VA 3HZXA 1SR3A 2ZXOA 5D14A 3H94A 4A3FH 4PQXA 3HEJA 3BDOA 1ET9A 2EY2A 3M4PA 1RTOA 3PF4A 4R8NA 4LNQA 2G9HD 1UWVA 4J8QA 2K5DA 3DM3A 1C4QA 3U50C 2DNEA 4EQOA 3RZOB 2B2TA 4B9WA 3KLSA 1ZYRC 4EVOA 4RH6A 2EJGC 1HUNA 4B3RQ 3NENA 4DV0L 1EZ8A 4GNXC 3GTPH 1JOOA 1U4PA 3HOZG 4I7ZC 1I50H 3KJOA 4JK1C 1FVIA 4DR7L 2ZT9C 5C3EH 2NN6H 2L4NA 4HN7A 5C0XJ 2NN6I 5GROA 1F9RA 1HZBA 3KLSX 4A3BG 4BXXH 5FJ8H 5JJKA 1JORA 2B29A 4X3TA 1SNQA 2RCNA 3KLWA 4G7HC 4DV7L 1BO0A 3MEFA 2OF1A 1D7QA 4LUVA 2I5MX 3CRKC 4HTHA 3ULJA 2ZTDA 3GQBA 3PIP3 5EKIA 1X32A 3T1HQ 3K6OA 1BF4A 1NBWA 2EE1A 4BY1B 4A3GG 4DR2Q 1Y1WG 3TQYA 2K01A 4X6AH 1YEZA 2Q8TA 5KNBA 2AHOB 1I4XA 2K03A 4RHRA 2NB0A 1DD2A 2JXMB 1YJ9A 3CCEA 3I3CA 1STGA 2A8VA 1QVFA 3PUYA 4JI8L 1QE6A 1PH4A 4NMZA 4ZQ3A 1RL2A 2F0VA 1K3BC 4CBVA 4XQJA 1X3PA 2YTVA 4GNXA 2DNCA 4LUOA 4P72A 5M3MG 4C2MB 4TVAB 4ZKBB 2PMZE 2F0FA 4H0LC 5K36H 2F0SA 4E6IA 1HHVA 4GOPB 3G71A 4IFDH 4IUPA 2EYFA 2Z8LA 4H13C 2XRQD 4X3UA 5C4JH 2QEXA 4IFDI 1NSNS 3NQTA 2X6GA 2VY3A 1HNWQ 2WKDA 1J6QA 1CSPA 3RD4A 2R7ZG 2A6EC 3T1YQ 1A6XA 1FL0A 1YNXA 4JOIC 4IN3A 4QB4A 3CW2C 2WV6D 4BBRG 5LMNW 1STEA 1E0BA 4LF7L 1VQPA 3CKIB 1K8GA 3J81E 1N36Q 1I6VC 4KV6A 4V190 1NE3A 1FNVA 4OL7A 3CCLA 1E2WA 1I4GA 4RGMA 4ZYSA 3EA6A 1EUJA 3NSWA 4DF7A 3VDYA 1HTLD 3HOYH 1RF2D 4A3EB 1TT2A 2JA6B 3K5NA 2F0HA 4DV2Q 2MQHA 2FFKB 1YHQA 1BR9A 3NTIA 1Y14B 2PYKA 4OEMB 4QGUA 3UDGA 3TEHB 3PCOB 4PMWA 4X3KA 1NUCA 3HOVG 2AQ2B 2B39A 1ML0D 1Z6HA 2YU9B 1UEAB 1C8CA 2LMCB 4S3SA 1VQGA 4DAYB 3J81i 1RODA 1MIUA 4P75A 2WACA 3PMFA 3PIOA
chains in the Genus database with same CATH topology
4B3RL 2NVYH 3A0JA 4JI0L 2ZJPA 2AMCB 3JAMc 2VNUD 2YV5A 4JOIA 2Z6KA 4OONA 1XTDA 3RR5A 4B3SQ 4GKJL 1QUQB 4Y7NH 3W5OA 3J7A5 1VQHA 3K81C 1IYJB 2LXKA 1Y1VG 1Z9FA 4LW1A 4Y52H 2E5LL 4H02A 1YI2A 1Y1VH 1NMFA 3M3YH 4MNOA 4DPGA 1X9NA 2AKWB 5M5XH 4PZ6A 1O7IA 4JV5Q 4DAMA 4LF8Q 4BA2I 1B70B 2R92H 1CSQA 2C35B 4NXML 1VQCA 4A3IG 4MTNA 4B3SL 4AQYQ 5FLXc 2KENA 3L7ZC 3E0EA 4A3IH 3GTKH 3UE0A 2WAQG 2IX0A 4A3KG 1HZAA 1HNXQ 3S1QH 4DV5Q 1Q82C 1VQLA 1PH9A 4QQBX 1OXXK 4A3KH 3U4ZA 1HZCA 2E2IH 4A76A 2F3IA 2VW9A 4JI1Q 5JEAG 2KCMA 4LF8L 1Y1WH 3M7NA 4HIKA 4DNIA 2JEAI 5JJIA 5GAHC 3S16H 3FKIG 4AQYL 4JI7Q 4NB3A 3NELA 2ZJRA 2E2HH 1JJCB 2ATWA 5JEAJ 4L5TA 1HNXL 2IT1A 4DV5L 4ME3A 3A74A 3OYYA 1C9OA 3J80i 4P74A 4DV1Q 2D0OA 3CCSA 1A62A 4R4TA 4R4QA 4JI1L 3ULPA 2VL6A 2E8GA 3ERSX 4LUZA 1T9HA 2PI2E 3KDFA 4JCVE 1SE8A 4YCUA 1W2BA 1A0IA 3HFZB 5AJ3Q 4JI7L 3PUZA 4JBWA 1E24A 1VQ6A 3RNUA 3SGIA 1VQBA 4O2DA 3CCVA 1J5EQ 2DUDA 4A3DG 4DV1L 2XTIA 5LMNQ 3GTJH 2IY5B 4X64Q 4A3DH 3ZJYC 3I4OA 5IE8A 5M3MH 3AQQA 3PSIA 4GOPA 5AJ3L 4GLVB 4EX5A 4IPGA 1KRTA 1I6HH 2Y0SE 1J5EL 4YWLA 3F2DA 4LFBQ 4UP8A 3CD6A 4X64L 3CCUA 1OTCA 1OXUA 1VQ9A 3L0OA 1XPRA 1WFQA 4BA1I 1D8LA 5M5YH 3M9BA 2Z6KC 3IRBA 3EIVA 4R4CA 1PH1A 4GNXB 4POGA 3CP0A 4LFBL 4A93G 1OXVA 2ALYB 1PH2A 4BBRH 1CKNA 1EIFA 4IO9A 4A93H 1YIJA 3J80c 3BZKA 4GS3A 1EOVA 4L5RC 3M4QA 2I0QA 2VQFQ 1N9WA 1WI5A 1IBMQ 5BR8Q 3I4NG 1HR0Q 4BY1G 5IYCG 2D62A 1PA6A 1X54A 5IYBG 3I4NH 4BY1H 4YCVA 5IYCH 3ER0A 4R4OA 5IYBH 1EIYB 1GKHA 4KHPQ 1XNRQ 4NXNQ 2KHJA 4GN3B 3S15H 3S1RH 3F8TA 1K73C 3UDIA 1V9PA 4HIDA 4JI6Q 2K5HA 3OW2A 2JE6I 4AIMA 1GD7A 2VQFL 1XPOA 1PH5A 5BR8L 4IPDA 2VQEQ 1R9TH 1K9MC 1IXRA 1HR0L 4X62Q 4K0KQ 1I5FA 2ID0A 2I5HA 1JJGA 2Q2HA 4QL5A 1XMOQ 2WB1E 4P71A 4GLXA 1UEBA 2KBNA 1XNRL 4NXNL 1I3QH 2FXQA 3STBD 4GN4B 3RN5A 1XMQQ 1NMGA 1NJIC 3G4SA 3UDXA 1K8AC 1WYDA 5LMUQ 3K7AH 4JI6L 2JJQA 1X3EA 3K7UC 4DKAC 3A5UA 1Q8KA 4A3MG 2VQEL 3KF8B 1K3RA 4K0KL 4X62L 4BY7G 4A3MH 2BH2A 1KRSA 4LFAQ 5ELOA 4C3IH 3CCRA 4HJ7A 4BY7H 1JT8A 1XMOL 2EIFA 2VUMG 4GN5A 2KHIA 4KI0A 3MXNB 3F1ZA 1IBML 1XMQL 2UUBQ 1SRUA 1QVCA 1UE5A 2A1AA 2CWAA 4C3JH 5LMUL 4DV3Q 1WOCA 1EQRA 2JA9A 2K5NA 3G48A 4C3HH 5GAGC 2I5LX 2K14A 3FP9A 4GOPC 4HJ9A 3WWVA 1EWIA 4FDBA 4YY3Q 1JMCA 3HOUH 1UE7A 3TS2A 4LFAL 3CF5A 4A75A 4AYBE 2MNAA 1TWFH 3PIPA 5IT9c 3UDFA 2GVAA 2R7DA 3PUWA 4AH6A 5FLMG 4DR7Q 2CFMA 4DV6Q 2UUBL 4XTCS 4DV3L 4IOAA 1QUQA 3TRZA 2R6GA 3S2DH 2NVXH 1TWGH 3UE1A 1N33Q 3GD7A 2UXCL 1I94Q 2Q2IA 4O0AA 5EAYA 4YY3L 4JYAQ 3EN2A 1B8AA 4YWMA 2OWOA 2Y0SG 2R7FA 2EQSA 2HQLA 1OXSC 2JQOA 1SN8A 4DV6L 3OTOQ 3G6EA 1K83H 3CC4A 2ZTEA 2MO0A 1N33L 1H95A 2UXBQ 1GVPA 1E1TA 5DLQE 1I94L 4EQ5A 3I55A 1AH9A 4JYAL 2CWPA 1RIPA 4LF4Q 1PH6A 4A4IA 1Q81C 4JV5L 4OO1G 2QA4A 4A3EG 3NEMA 3CMEA 1NY4A 2VS1A 3OTOL 2ZTCA 1X6OA 1X65A 2UXBL 1PFSA 1TWHH 3J81c 2GVBA 2CQOA 3FKIH 1JB7A 1C7YA 1IBLQ 2UUCQ 4JBMA 1L1OC 4X66Q 1U0LA 4DR3Q 3DLLA 1XJVA 1P16A 3BU2A 4LF4L 5J3BA 4GKKQ 2MO1A 1G51A 2WFWA 3BJUA 2DGYA 2R93G 5E7NA 5IWAQ 2BA1A 3KFUA 1AE3A 3RZOH 2UUCL 3GTGH 1PH3A 2RF4A 1QZGA 1IBLL 1B7YB 3STBC 4IPCA 4X66L 4DR3L 1KL9A 3W1BA 4HJ8A 1E1OA 3AYHB 4GKKL 4OWXB 4OX9Q 3HOUG 1L2FA 3W1GA 4LF6Q 5IWAL 2N3SA 1NTGA 2PI2A 1E22A 4HJ5A 1X3GA 1N8RC 1N32Q 4NPSA 2OQ0A 1WJJA 2PQAA 2UXDQ 5LMNL 3AEVA 3KDFB 4B3TQ 1S3OA 5IYDG 3K8AA 1TWAH 2UU9Q 4JBJA 4LF6L 3M85A 1YHBA 2HIVA 3RZDH 5IYDH 4DV4Q 1UE6A 2OCEA 2A19A 5ELNA 3HKZG 4JI3Q 3A5ZB 1N32L 1WCMG 3RLFA 1VQDA 2UXDL 1HNZQ 1WCMH 2ASBA 2IHEA 4X65Q 4B3TL 4WJ3M 2PNHA 1IBKQ 1CKOA 1OXTA 2GN5A 1Z47A 1Q1EA 1G291 1YJNA 1GM5A 1FGUA 2UU9L 1X56A 4LF5Q 4IFDJ 1SROA 1M90C 4DV4L 3AFQA 3K0XA 4B3MQ 1A63A 5GADC 4L5QA 3KYHC 3LGJA 4JI3L 4JI4Q 4PZ7A 2WAQE 4PZ8A 4HIOA 2XGTA 3I56A 3RN2A 1HNZL 1YBYA 4X65L 3PO2G 4A3LG 2MFIA 4IJHA 3TREA 1VQNA 3BZCA 3PO2H 4LF5L 4DR4Q 3I7FA 1E3PA 1L1OA 1LUZA 1X55A 3H0GG 4DR1Q 1XNQQ 4B3ML 1BVSA 1PH7A 3CCJA 3EBEA 3H0GH 4JI4L 4KHPL 2B63G 2JA8G 2RHSB 3PO3G 4YCWA 2B63H 2JA8H 4IJLA 4LWCA 2JA7G 3KJPA 5M3FG 3HOWG 3PO3H 4DUZQ 3PGZA 1MJCA 3RLNA 2Z0SA 4YWKA 5M3FH 3HOWH 1Q1BA 1AE2A 1KHIA 1UE1A 4RG1A 4DR4L 4R1JA 3HOYG 3E9IA 4DR1L 1XNQL 1SLJA 1YJWA 2K5VA 3CPWA 1YVCA 2YTXA 1SR3A 1FJGQ 3KF6B 4A3FG 4BBSG 3RLOA 4C2MH 2VUMH 4A3FH 4BBSH 1PYSB 4DUZL 3M4PA 4MZ9A 4UP9A 2R93H 1V1QA 3PF4A 4DV0Q 1A8VA 2K50A 4LNQA 1UWVA 4JI2Q 3B6YA 1PV4A 1JJ2A 1HR0W 3PV0A 4OWWB 4POFA 1FJGL 3DM3A 2VZAA 3U50C 1IZ6A 2E2JH 1N34Q 5M5WH 1M1KC 5FLMH 4JBKA 2HHHQ 1U5KA 1MJEA 4UP7A 4DR5Q 2ES2A 4B3RQ 3NENA 4DV0L 4GNXC 1Q7YC 3GTPH 3HOZG 3F2CA 3GTLH 2OQKA 1I50H 4JI2L 3KJOA 5C0XG 4LF9Q 3HOZH 1L0WA 1BKBA 5C3EG 1FVIA 2JA5G 1VQIA 2NN6G 5IP7G 4DV7Q 1CKMA 3D31A 5IP9G 5C3EH 1N34L 2JA5H 4DUYQ 4DR7L 2OTJA 3F2BA 1SFOH 1IL2A 5C0XJ 4GLAC 5IP9H 2YYZA 2HHHL 4BXXG 2NN6I 1X3FA 5GROA 5FJ8G 1HZBA 1PH8A 4A3BG 4BXXH 2RHQB 3GTMH 5FJ8H 4TQUS 1PYBA 4A3BH 5JJKA 4LF9L 2B29A 3J81j 4KHZA 4DR6Q 2CKZB 3S1NH 2RCNA 3KLWA 4RMFA 4DV7L 2JA6G 3GTQH 1BBUA 1VQEA 3MEFA 4DUYL 2HT1A 1D7QA 5H1SE 4A3EH 4LUVA 4KLKA 1YITA 1ASZA 4OXPA 2I5MX 2JA6H 4OO1I 2CCZA 1VQ5A 2R92G 3FHWA 3ULJA 3JC66 1G6PA 2ZTDA 4R4IA 4P73A 4DR6L 3CCMA 2BH8A 3T1HQ 1VQ8A 3K80C 1NBWA 1VQFA 2K4KA 2N8NA 1TWCH 1LTLA 2BA0A 4A3GG 3PUVA 2KCTA 4DR2Q 4A3GH 1Y1WG 1LM0A 1KIXA 3TQYA 2YU9H 4JI8Q 1KAWA 1YEZA 4X6AH 3T1HL 3U58A 2AHOB 2D0PA 2AWOA 2WB1G 3CC7A 4LFCQ 4OWTB 4APVA 1KQSA 1YJ9A 3CCEA 1LYLA 2F52A 3Q8DA 4DR2L 1VQAA 2A8VA 1VQJA 1QVFA 2YTYA 3PUYA 4JI8L 1VQMA 1PH4A 3ULLA 1KC8C 1RL2A 3GTOH 1YHAA 2K75A 4OX9L 2OTLA 3I2ZA 4LFCL 2LSSA 4UPAA 4A3CG 2YTVA 1JE5A 3CMAA 4GNXA 2F4VQ 4WJ4A 1VS0A 1S40A 1VQ7A 3S17H 4A3CH 3E9HA 4LUOA 4P72A 1EFWA 5M3MG 5K36G 4TVAB 2PMZE 1EQQA 1CUKA 4IFDG 4PG3A 3U4VA 4AYBG 4GOPB 3G71A 1C0AA 1VQKA 2Q2UA 3PF5A 5HGQA 4IOCA 2QEXA 4IFDI 5C4JH 5IY0A 2NZHA 4DK3C 3HOXG 1W3SA 4LF7Q 2NVQH 1K0RA 3KOJA 2F4VL 2V1CC 2QGQA 2VY3A 2B3GA 3HOXH 1HNWQ 1DGSA 2PQAB 2LXJA 1Q12A 1J6QA 1CSPA 1SMXA 2R7ZG 3T1YQ 4IPHA 1MKHA 1FL0A 1YNXA 4JOIC 3D0FA 4QIWE 4QY7A 1S72A 2R7ZH 4QJFA 2HIXA 4YHHQ 5GAEC 3CW2C 1IBKL 3H15A 4BBRG 1HJPA 2IX1A 5LMNW 4LF7L 1VQPA 1QZHA 4A3LH 5HY6A 1K8GA 4HJAA 1KXLA 4UY8C 1HNWL 1Q46A 1Q86C 1CKNB 1N36Q 3GDEA 1HH2P 4J15A 1YZ6A 1EYGA 2K52A 4DK6C 2Q2TA 1NE3A 3CQZH 3T1YL 2ZJQA 3CPFA 3CCLA 2UXCQ 2ZM6Q 3ICEA 2N78A 1TXYA 4YHHL 2EXDA 3PUXA 4XIGS 3S14H 5GQOA 2JA7H 1EUJA 1QVGA 3CC2A 5JJLA 1N36L 2JEBI 3JAMi 2NZOA 3VDYA 5C44G 3NBHB 3HOYH 4JI5Q 3KF6A 1KD1C 5C44H 3J7ZC 2ZM6L 1VQOA 1E7ZA 3AFPA 2NVTH 4DV2Q 2N49A 2MQHA 1L1OB 1YHQA 3S24A 1VQ4A 2H5XA 2UUAQ 3GO5A 3I4MG 3CCQA 1Y14B 4JI5L 1PVOA 3TS0A 4JG2A 4QGUA 3UDGA 3I4MH 1ASYA 3CAMA 3TEHB 3PCOB 4PMWA 1VCIA 2L15A 3L2PA 4A3JG 3HOVG 3H3VH 3M4OH 4DV2L 4L5SA 2JK8A 4NXMQ 4A3JH 3H3VI 1HZ9A 3HOVH 4JI0Q 1BBWA 2UUAL 4JC0A 1V43A 1XPUA 2WP8J 1P8LA 4GKJQ 1VQGA 3CXCA 4DAYB 1PHJA 4ALPA 3HKZE 3J81i 1MIUA 4P75A 5C0XI 2AWNA 3S1MH 4HIMA 1GO3E 5IP7H 5C4XG 2E5LQ 3S2HH 2IHFA 3HKSA 3PIOA 4DR5L 5C4XH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R L;  2NVY H;  3A0J A;  4JI0 L;  2ZJP A;  2AMC B;  3JAM c;  2VNU D;  2YV5 A;  4JOI A;  2Z6K A;  4OON A;  1XTD A;  3RR5 A;  4B3S Q;  4GKJ L;  1QUQ B;  4Y7N H;  3W5O A;  3J7A 5;  1VQH A;  3K81 C;  1IYJ B;  2LXK A;  1Y1V G;  1Z9F A;  4LW1 A;  4Y52 H;  2E5L L;  4H02 A;  1YI2 A;  1Y1V H;  1NMF A;  3M3Y H;  4MNO A;  4DPG A;  1X9N A;  2AKW B;  5M5X H;  4PZ6 A;  1O7I A;  4JV5 Q;  4DAM A;  4LF8 Q;  4BA2 I;  1B70 B;  2R92 H;  1CSQ A;  2C35 B;  4NXM L;  1VQC A;  4A3I G;  4MTN A;  4B3S L;  4AQY Q;  5FLX c;  2KEN A;  3L7Z C;  3E0E A;  4A3I H;  3GTK H;  3UE0 A;  2WAQ G;  2IX0 A;  4A3K G;  1HZA A;  1HNX Q;  3S1Q H;  4DV5 Q;  1Q82 C;  1VQL A;  1PH9 A;  4QQB X;  1OXX K;  4A3K H;  3U4Z A;  1HZC A;  2E2I H;  4A76 A;  2F3I A;  2VW9 A;  4JI1 Q;  5JEA G;  2KCM A;  4LF8 L;  1Y1W H;  3M7N A;  4HIK A;  4DNI A;  2JEA I;  5JJI A;  5GAH C;  3S16 H;  3FKI G;  4AQY L;  4JI7 Q;  4NB3 A;  3NEL A;  2ZJR A;  2E2H H;  1JJC B;  2ATW A;  5JEA J;  4L5T A;  1HNX L;  2IT1 A;  4DV5 L;  4ME3 A;  3A74 A;  3OYY A;  1C9O A;  3J80 i;  4P74 A;  4DV1 Q;  2D0O A;  3CCS A;  1A62 A;  4R4T A;  4R4Q A;  4JI1 L;  3ULP A;  2VL6 A;  2E8G A;  3ERS X;  4LUZ A;  1T9H A;  2PI2 E;  3KDF A;  4JCV E;  1SE8 A;  4YCU A;  1W2B A;  1A0I A;  3HFZ B;  5AJ3 Q;  4JI7 L;  3PUZ A;  4JBW A;  1E24 A;  1VQ6 A;  3RNU A;  3SGI A;  1VQB A;  4O2D A;  3CCV A;  1J5E Q;  2DUD A;  4A3D G;  4DV1 L;  2XTI A;  5LMN Q;  3GTJ H;  2IY5 B;  4X64 Q;  4A3D H;  3ZJY C;  3I4O A;  5IE8 A;  5M3M H;  3AQQ A;  3PSI A;  4GOP A;  5AJ3 L;  4GLV B;  4EX5 A;  4IPG A;  1KRT A;  1I6H H;  2Y0S E;  1J5E L;  4YWL A;  3F2D A;  4LFB Q;  4UP8 A;  3CD6 A;  4X64 L;  3CCU A;  1OTC A;  1OXU A;  1VQ9 A;  3L0O A;  1XPR A;  1WFQ A;  4BA1 I;  1D8L A;  5M5Y H;  3M9B A;  2Z6K C;  3IRB A;  3EIV A;  4R4C A;  1PH1 A;  4GNX B;  4POG A;  3CP0 A;  4LFB L;  4A93 G;  1OXV A;  2ALY B;  1PH2 A;  4BBR H;  1CKN A;  1EIF A;  4IO9 A;  4A93 H;  1YIJ A;  3J80 c;  3BZK A;  4GS3 A;  1EOV A;  4L5R C;  3M4Q A;  2I0Q A;  2VQF Q;  1N9W A;  1WI5 A;  1IBM Q;  5BR8 Q;  3I4N G;  1HR0 Q;  4BY1 G;  5IYC G;  2D62 A;  1PA6 A;  1X54 A;  5IYB G;  3I4N H;  4BY1 H;  4YCV A;  5IYC H;  3ER0 A;  4R4O A;  5IYB H;  1EIY B;  1GKH A;  4KHP Q;  1XNR Q;  4NXN Q;  2KHJ A;  4GN3 B;  3S15 H;  3S1R H;  3F8T A;  1K73 C;  3UDI A;  1V9P A;  4HID A;  4JI6 Q;  2K5H A;  3OW2 A;  2JE6 I;  4AIM A;  1GD7 A;  2VQF L;  1XPO A;  1PH5 A;  5BR8 L;  4IPD A;  2VQE Q;  1R9T H;  1K9M C;  1IXR A;  1HR0 L;  4X62 Q;  4K0K Q;  1I5F A;  2ID0 A;  2I5H A;  1JJG A;  2Q2H A;  4QL5 A;  1XMO Q;  2WB1 E;  4P71 A;  4GLX A;  1UEB A;  2KBN A;  1XNR L;  4NXN L;  1I3Q H;  2FXQ A;  3STB D;  4GN4 B;  3RN5 A;  1XMQ Q;  1NMG A;  1NJI C;  3G4S A;  3UDX A;  1K8A C;  1WYD A;  5LMU Q;  3K7A H;  4JI6 L;  2JJQ A;  1X3E A;  3K7U C;  4DKA C;  3A5U A;  1Q8K A;  4A3M G;  2VQE L;  3KF8 B;  1K3R A;  4K0K L;  4X62 L;  4BY7 G;  4A3M H;  2BH2 A;  1KRS A;  4LFA Q;  5ELO A;  4C3I H;  3CCR A;  4HJ7 A;  4BY7 H;  1JT8 A;  1XMO L;  2EIF A;  2VUM G;  4GN5 A;  2KHI A;  4KI0 A;  3MXN B;  3F1Z A;  1IBM L;  1XMQ L;  2UUB Q;  1SRU A;  1QVC A;  1UE5 A;  2A1A A;  2CWA A;  4C3J H;  5LMU L;  4DV3 Q;  1WOC A;  1EQR A;  2JA9 A;  2K5N A;  3G48 A;  4C3H H;  5GAG C;  2I5L X;  2K14 A;  3FP9 A;  4GOP C;  4HJ9 A;  3WWV A;  1EWI A;  4FDB A;  4YY3 Q;  1JMC A;  3HOU H;  1UE7 A;  3TS2 A;  4LFA L;  3CF5 A;  4A75 A;  4AYB E;  2MNA A;  1TWF H;  3PIP A;  5IT9 c;  3UDF A;  2GVA A;  2R7D A;  3PUW A;  4AH6 A;  5FLM G;  4DR7 Q;  2CFM A;  4DV6 Q;  2UUB L;  4XTC S;  4DV3 L;  4IOA A;  1QUQ A;  3TRZ A;  2R6G A;  3S2D H;  2NVX H;  1TWG H;  3UE1 A;  1N33 Q;  3GD7 A;  2UXC L;  1I94 Q;  2Q2I A;  4O0A A;  5EAY A;  4YY3 L;  4JYA Q;  3EN2 A;  1B8A A;  4YWM A;  2OWO A;  2Y0S G;  2R7F A;  2EQS A;  2HQL A;  1OXS C;  2JQO A;  1SN8 A;  4DV6 L;  3OTO Q;  3G6E A;  1K83 H;  3CC4 A;  2ZTE A;  2MO0 A;  1N33 L;  1H95 A;  2UXB Q;  1GVP A;  1E1T A;  5DLQ E;  1I94 L;  4EQ5 A;  3I55 A;  1AH9 A;  4JYA L;  2CWP A;  1RIP A;  4LF4 Q;  1PH6 A;  4A4I A;  1Q81 C;  4JV5 L;  4OO1 G;  2QA4 A;  4A3E G;  3NEM A;  3CME A;  1NY4 A;  2VS1 A;  3OTO L;  2ZTC A;  1X6O A;  1X65 A;  2UXB L;  1PFS A;  1TWH H;  3J81 c;  2GVB A;  2CQO A;  3FKI H;  1JB7 A;  1C7Y A;  1IBL Q;  2UUC Q;  4JBM A;  1L1O C;  4X66 Q;  1U0L A;  4DR3 Q;  3DLL A;  1XJV A;  1P16 A;  3BU2 A;  4LF4 L;  5J3B A;  4GKK Q;  2MO1 A;  1G51 A;  2WFW A;  3BJU A;  2DGY A;  2R93 G;  5E7N A;  5IWA Q;  2BA1 A;  3KFU A;  1AE3 A;  3RZO H;  2UUC L;  3GTG H;  1PH3 A;  2RF4 A;  1QZG A;  1IBL L;  1B7Y B;  3STB C;  4IPC A;  4X66 L;  4DR3 L;  1KL9 A;  3W1B A;  4HJ8 A;  1E1O A;  3AYH B;  4GKK L;  4OWX B;  4OX9 Q;  3HOU G;  1L2F A;  3W1G A;  4LF6 Q;  5IWA L;  2N3S A;  1NTG A;  2PI2 A;  1E22 A;  4HJ5 A;  1X3G A;  1N8R C;  1N32 Q;  4NPS A;  2OQ0 A;  1WJJ A;  2PQA A;  2UXD Q;  5LMN L;  3AEV A;  3KDF B;  4B3T Q;  1S3O A;  5IYD G;  3K8A A;  1TWA H;  2UU9 Q;  4JBJ A;  4LF6 L;  3M85 A;  1YHB A;  2HIV A;  3RZD H;  5IYD H;  4DV4 Q;  1UE6 A;  2OCE A;  2A19 A;  5ELN A;  3HKZ G;  4JI3 Q;  3A5Z B;  1N32 L;  1WCM G;  3RLF A;  1VQD A;  2UXD L;  1HNZ Q;  1WCM H;  2ASB A;  2IHE A;  4X65 Q;  4B3T L;  4WJ3 M;  2PNH A;  1IBK Q;  1CKO A;  1OXT A;  2GN5 A;  1Z47 A;  1Q1E A;  1G29 1;  1YJN A;  1GM5 A;  1FGU A;  2UU9 L;  1X56 A;  4LF5 Q;  4IFD J;  1SRO A;  1M90 C;  4DV4 L;  3AFQ A;  3K0X A;  4B3M Q;  1A63 A;  5GAD C;  4L5Q A;  3KYH C;  3LGJ A;  4JI3 L;  4JI4 Q;  4PZ7 A;  2WAQ E;  4PZ8 A;  4HIO A;  2XGT A;  3I56 A;  3RN2 A;  1HNZ L;  1YBY A;  4X65 L;  3PO2 G;  4A3L G;  2MFI A;  4IJH A;  3TRE A;  1VQN A;  3BZC A;  3PO2 H;  4LF5 L;  4DR4 Q;  3I7F A;  1E3P A;  1L1O A;  1LUZ A;  1X55 A;  3H0G G;  4DR1 Q;  1XNQ Q;  4B3M L;  1BVS A;  1PH7 A;  3CCJ A;  3EBE A;  3H0G H;  4JI4 L;  4KHP L;  2B63 G;  2JA8 G;  2RHS B;  3PO3 G;  4YCW A;  2B63 H;  2JA8 H;  4IJL A;  4LWC A;  2JA7 G;  3KJP A;  5M3F G;  3HOW G;  3PO3 H;  4DUZ Q;  3PGZ A;  1MJC A;  3RLN A;  2Z0S A;  4YWK A;  5M3F H;  3HOW H;  1Q1B A;  1AE2 A;  1KHI A;  1UE1 A;  4RG1 A;  4DR4 L;  4R1J A;  3HOY G;  3E9I A;  4DR1 L;  1XNQ L;  1SLJ A;  1YJW A;  2K5V A;  3CPW A;  1YVC A;  2YTX A;  1SR3 A;  1FJG Q;  3KF6 B;  4A3F G;  4BBS G;  3RLO A;  4C2M H;  2VUM H;  4A3F H;  4BBS H;  1PYS B;  4DUZ L;  3M4P A;  4MZ9 A;  4UP9 A;  2R93 H;  1V1Q A;  3PF4 A;  4DV0 Q;  1A8V A;  2K50 A;  4LNQ A;  1UWV A;  4JI2 Q;  3B6Y A;  1PV4 A;  1JJ2 A;  1HR0 W;  3PV0 A;  4OWW B;  4POF A;  1FJG L;  3DM3 A;  2VZA A;  3U50 C;  1IZ6 A;  2E2J H;  1N34 Q;  5M5W H;  1M1K C;  5FLM H;  4JBK A;  2HHH Q;  1U5K A;  1MJE A;  4UP7 A;  4DR5 Q;  2ES2 A;  4B3R Q;  3NEN A;  4DV0 L;  4GNX C;  1Q7Y C;  3GTP H;  3HOZ G;  3F2C A;  3GTL H;  2OQK A;  1I50 H;  4JI2 L;  3KJO A;  5C0X G;  4LF9 Q;  3HOZ H;  1L0W A;  1BKB A;  5C3E G;  1FVI A;  2JA5 G;  1VQI A;  2NN6 G;  5IP7 G;  4DV7 Q;  1CKM A;  3D31 A;  5IP9 G;  5C3E H;  1N34 L;  2JA5 H;  4DUY Q;  4DR7 L;  2OTJ A;  3F2B A;  1SFO H;  1IL2 A;  5C0X J;  4GLA C;  5IP9 H;  2YYZ A;  2HHH L;  4BXX G;  2NN6 I;  1X3F A;  5GRO A;  5FJ8 G;  1HZB A;  1PH8 A;  4A3B G;  4BXX H;  2RHQ B;  3GTM H;  5FJ8 H;  4TQU S;  1PYB A;  4A3B H;  5JJK A;  4LF9 L;  2B29 A;  3J81 j;  4KHZ A;  4DR6 Q;  2CKZ B;  3S1N H;  2RCN A;  3KLW A;  4RMF A;  4DV7 L;  2JA6 G;  3GTQ H;  1BBU A;  1VQE A;  3MEF A;  4DUY L;  2HT1 A;  1D7Q A;  5H1S E;  4A3E H;  4LUV A;  4KLK A;  1YIT A;  1ASZ A;  4OXP A;  2I5M X;  2JA6 H;  4OO1 I;  2CCZ A;  1VQ5 A;  2R92 G;  3FHW A;  3ULJ A;  3JC6 6;  1G6P A;  2ZTD A;  4R4I A;  4P73 A;  4DR6 L;  3CCM A;  2BH8 A;  3T1H Q;  1VQ8 A;  3K80 C;  1NBW A;  1VQF A;  2K4K A;  2N8N A;  1TWC H;  1LTL A;  2BA0 A;  4A3G G;  3PUV A;  2KCT A;  4DR2 Q;  4A3G H;  1Y1W G;  1LM0 A;  1KIX A;  3TQY A;  2YU9 H;  4JI8 Q;  1KAW A;  1YEZ A;  4X6A H;  3T1H L;  3U58 A;  2AHO B;  2D0P A;  2AWO A;  2WB1 G;  3CC7 A;  4LFC Q;  4OWT B;  4APV A;  1KQS A;  1YJ9 A;  3CCE A;  1LYL A;  2F52 A;  3Q8D A;  4DR2 L;  1VQA A;  2A8V A;  1VQJ A;  1QVF A;  2YTY A;  3PUY A;  4JI8 L;  1VQM A;  1PH4 A;  3ULL A;  1KC8 C;  1RL2 A;  3GTO H;  1YHA A;  2K75 A;  4OX9 L;  2OTL A;  3I2Z A;  4LFC L;  2LSS A;  4UPA A;  4A3C G;  2YTV A;  1JE5 A;  3CMA A;  4GNX A;  2F4V Q;  4WJ4 A;  1VS0 A;  1S40 A;  1VQ7 A;  3S17 H;  4A3C H;  3E9H A;  4LUO A;  4P72 A;  1EFW A;  5M3M G;  5K36 G;  4TVA B;  2PMZ E;  1EQQ A;  1CUK A;  4IFD G;  4PG3 A;  3U4V A;  4AYB G;  4GOP B;  3G71 A;  1C0A A;  1VQK A;  2Q2U A;  3PF5 A;  5HGQ A;  4IOC A;  2QEX A;  4IFD I;  5C4J H;  5IY0 A;  2NZH A;  4DK3 C;  3HOX G;  1W3S A;  4LF7 Q;  2NVQ H;  1K0R A;  3KOJ A;  2F4V L;  2V1C C;  2QGQ A;  2VY3 A;  2B3G A;  3HOX H;  1HNW Q;  1DGS A;  2PQA B;  2LXJ A;  1Q12 A;  1J6Q A;  1CSP A;  1SMX A;  2R7Z G;  3T1Y Q;  4IPH A;  1MKH A;  1FL0 A;  1YNX A;  4JOI C;  3D0F A;  4QIW E;  4QY7 A;  1S72 A;  2R7Z H;  4QJF A;  2HIX A;  4YHH Q;  5GAE C;  3CW2 C;  1IBK L;  3H15 A;  4BBR G;  1HJP A;  2IX1 A;  5LMN W;  4LF7 L;  1VQP A;  1QZH A;  4A3L H;  5HY6 A;  1K8G A;  4HJA A;  1KXL A;  4UY8 C;  1HNW L;  1Q46 A;  1Q86 C;  1CKN B;  1N36 Q;  3GDE A;  1HH2 P;  4J15 A;  1YZ6 A;  1EYG A;  2K52 A;  4DK6 C;  2Q2T A;  1NE3 A;  3CQZ H;  3T1Y L;  2ZJQ A;  3CPF A;  3CCL A;  2UXC Q;  2ZM6 Q;  3ICE A;  2N78 A;  1TXY A;  4YHH L;  2EXD A;  3PUX A;  4XIG S;  3S14 H;  5GQO A;  2JA7 H;  1EUJ A;  1QVG A;  3CC2 A;  5JJL A;  1N36 L;  2JEB I;  3JAM i;  2NZO A;  3VDY A;  5C44 G;  3NBH B;  3HOY H;  4JI5 Q;  3KF6 A;  1KD1 C;  5C44 H;  3J7Z C;  2ZM6 L;  1VQO A;  1E7Z A;  3AFP A;  2NVT H;  4DV2 Q;  2N49 A;  2MQH A;  1L1O B;  1YHQ A;  3S24 A;  1VQ4 A;  2H5X A;  2UUA Q;  3GO5 A;  3I4M G;  3CCQ A;  1Y14 B;  4JI5 L;  1PVO A;  3TS0 A;  4JG2 A;  4QGU A;  3UDG A;  3I4M H;  1ASY A;  3CAM A;  3TEH B;  3PCO B;  4PMW A;  1VCI A;  2L15 A;  3L2P A;  4A3J G;  3HOV G;  3H3V H;  3M4O H;  4DV2 L;  4L5S A;  2JK8 A;  4NXM Q;  4A3J H;  3H3V I;  1HZ9 A;  3HOV H;  4JI0 Q;  1BBW A;  2UUA L;  4JC0 A;  1V43 A;  1XPU A;  2WP8 J;  1P8L A;  4GKJ Q;  1VQG A;  3CXC A;  4DAY B;  1PHJ A;  4ALP A;  3HKZ E;  3J81 i;  1MIU A;  4P75 A;  5C0X I;  2AWN A;  3S1M H;  4HIM A;  1GO3 E;  5IP7 H;  5C4X G;  2E5L Q;  3S2H H;  2IHF A;  3HKS A;  3PIO A;  4DR5 L;  5C4X H; 
#chains in the Genus database with same CATH topology
 4B3R L;  3H6M A;  1CQF A;  3BVG A;  5CYU A;  3GTO B;  3TP8 A;  3JAM c;  1VMP A;  2YV5 A;  2VNU D;  4JOI A;  5G3L F;  3BYY B;  1QG7 A;  2I07 B;  1PRT D;  4HED A;  2E5L L;  1NMF A;  4MNO A;  1LTS D;  4PMC A;  1D2B A;  3D4R A;  5C5L A;  1CSQ A;  4ZLT F;  3T56 B;  1F9P A;  4MTN A;  4B3S L;  2K5Q A;  1PTO H;  2B8F A;  1NR2 A;  1G8Z D;  3NUC A;  3S1Q H;  1VQL A;  2VW9 A;  4LMQ D;  4LF8 L;  1Y1W H;  5GAH C;  1JE4 A;  1JJC B;  5JEA J;  2A69 D;  1SYE A;  4DK1 A;  4DV5 L;  2K04 A;  3OYY A;  1C9O A;  3CQZ B;  1A62 A;  4R4T A;  1CI3 M;  4R4Q A;  4JI1 L;  3D6C A;  3ULP A;  4I65 A;  3WOF A;  2PI2 E;  2JA7 B;  3H09 A;  4P2C B;  3SGI A;  1VQB A;  4O2D A;  3CCV A;  5JVG 3;  1HA5 A;  4A3D G;  2XTI A;  2HQE A;  4A3F B;  3ZJY C;  2NVT B;  1A3V A;  4ID6 A;  5M3M H;  4GOP A;  1CK1 A;  1D5Z C;  1SNM A;  5AJ3 L;  2KCC A;  1JOK A;  4CKB A;  4IPG A;  1KRT A;  4LFB Q;  4IZ8 A;  1EYA A;  1TY0 A;  5CV6 A;  3CCU A;  4IUU A;  1OXU A;  5M5Y H;  3M9B A;  1Q8I A;  3GTP B;  4POG A;  4RWS C;  4BBR H;  2QCP X;  3DM1 A;  5C3E B;  2I0Q A;  1CHQ D;  4BY1 G;  3P20 A;  3I4N H;  4XT1 B;  1DON A;  3BYT B;  4YCV A;  3ER0 A;  3TSS A;  5IYB H;  4KHP Q;  1FD7 D;  1XNR Q;  1B4O A;  4GZY C;  1GUT A;  1TS2 A;  3S1R H;  1EYC A;  3A7L A;  4JI6 Q;  3OW2 A;  4XDX A;  1Y1V B;  1CA6 A;  4KN7 C;  1KAA A;  1XTC D;  4FO2 A;  5ELF A;  4K0K Q;  2ID0 A;  2IW3 A;  2A73 B;  2B2V C;  2Q2H A;  2WB1 E;  4FXG C;  2MGS A;  4NXN L;  3MZ5 A;  1NMG A;  3E0J A;  3K7A H;  5LMU Q;  2JJQ A;  3A5U A;  2VQE L;  3KF8 B;  1K3R A;  2E2I B;  4KTA A;  4K5X A;  4A3M H;  4LFA Q;  2O5J C;  5ELO A;  4C3I H;  4BY7 H;  1JT8 A;  1LAB A;  3NQI A;  3Q24 A;  1DM0 B;  2EIF A;  3S16 B;  4KI0 A;  4WOR A;  2F0G A;  3F1Z A;  1IBM L;  1XMQ L;  1F2M A;  1IHZ A;  4HID A;  2AUK A;  2WB1 B;  2CWA A;  3R93 A;  2HD3 A;  4C3J H;  4DAY A;  1ICF B;  2PZU A;  4C3H H;  2I5L X;  2OEO A;  2UXC Q;  1JOQ A;  3LNN A;  3WWV A;  1JMC A;  4KMU C;  1LTA D;  5BN3 A;  1PMR A;  1F77 A;  3K5O A;  4AYB E;  1UUP A;  4FP5 D;  4OEL B;  2NVX H;  1S4Z A;  1MSH A;  4LK1 C;  1QNU A;  4YY3 L;  2VXW A;  3TZU A;  2EJF C;  2ICE C;  1Y69 U;  5IGE A;  3SK6 A;  1IW7 C;  1O7Z A;  5BN5 A;  3IAY A;  2R7F A;  2EQS A;  4AYB B;  4DV6 L;  1SEB D;  1N33 L;  2KQ3 A;  3MA2 B;  5DLQ E;  4EQ5 A;  1WTW A;  1PH6 A;  1Q81 C;  4B9X A;  3L9A X;  4A3E G;  1TU2 B;  2RA4 A;  3NEM A;  3DWQ A;  2VS1 A;  3OTO L;  1IKM A;  2M00 A;  2UXB L;  2CQO A;  1C7Y A;  1IBL Q;  4JBM A;  1WTV A;  1L1O C;  2QEJ C;  4DR3 Q;  1ICW A;  4LF4 L;  3C46 A;  2DN8 A;  4QUF A;  2WFW A;  2C5C A;  3BJU A;  3RMH A;  1AN8 A;  1ZEQ X;  1ONL A;  3SVM A;  3RZO H;  3S15 B;  1PH3 A;  2RF4 A;  2F0D A;  2F0U A;  1EZ6 A;  2F1M A;  4IPC A;  4X66 L;  1KL9 A;  2FMM A;  2DJF C;  1E1O A;  5BN4 A;  1R9T B;  3EJI A;  1L2F A;  3W1G A;  4LF6 Q;  2N3S A;  1EFI D;  2PI2 A;  4KJO A;  1X3G A;  1ZYR D;  2HDL A;  3X3N A;  3IKJ A;  1FYC A;  5CV5 A;  1ILP A;  3KDF B;  2A74 C;  3ND8 A;  1LAC A;  1U4R A;  1PZK D;  4JBJ A;  1YHB A;  1EWC A;  3WOE A;  2BCO A;  5I6W A;  4JI3 Q;  3A5Z B;  1SYF A;  2QW7 A;  2UXD L;  2B2W A;  2QF7 A;  4WJ3 M;  5KGU A;  2GN5 A;  1Q1E A;  1FGU A;  2JYO A;  3AFQ A;  4MHE A;  1BXT A;  1F2L A;  1V1P A;  3SR1 A;  4PZ7 A;  3S2D B;  2WAQ E;  2RBM A;  4OIK A;  4HMI A;  4HSP A;  1YBY A;  3QO2 A;  4RGO S;  2EJM A;  2MFI A;  5IIF A;  1X55 A;  1L1O A;  4XT3 B;  5E4X A;  3TME A;  4K6L A;  1BVS A;  4KHP L;  1K83 B;  2B63 G;  1PTO B;  5JVH 3;  1KDB A;  3DEO A;  3A8J E;  1D5M C;  2JA7 G;  3TZD A;  3PGZ A;  2WAQ B;  3RLN A;  2D9U A;  1AE2 A;  2LKV A;  4DR4 L;  4N8X 1;  1TR5 A;  1YVC A;  2YTX A;  4PMB A;  4CDD C;  4A3F G;  1GUS A;  1SND A;  4C2M H;  1TWH B;  1JWU D;  3FKI B;  2IPK D;  1PYS B;  2XIW A;  2F0K A;  3EFX D;  4PV1 C;  4DV0 Q;  1A8V A;  2Z6B A;  2E75 C;  2RQX A;  2KOL A;  1PV4 A;  5LL6 S;  3PV0 A;  4OWW B;  1PZJ D;  3RUZ A;  1MI2 A;  1IZ6 A;  4OGQ C;  1LTB D;  3R2T A;  2EVB A;  2G9D A;  4CJ1 B;  2EYH A;  5C4H A;  3D3R A;  1MJE A;  4DNT B;  4UP7 A;  4C1N I;  4FF1 A;  1B1Z A;  4L63 B;  5C3E G;  2SDF A;  1VQI A;  2NN6 G;  4DV7 Q;  3D31 A;  2A6E D;  4ZCK A;  1N34 L;  2OTJ A;  5IP9 H;  4BXX G;  2LY7 A;  1B44 D;  1X3F A;  2SEB D;  4HCE A;  5FJ8 G;  1ZXT A;  2RHQ B;  1PYB A;  4OIJ A;  4KHZ A;  1B53 A;  4Z9C B;  5KNC A;  1Q3L A;  5C3X A;  4A3E H;  1YIT A;  2BDN A;  2KUM A;  2JA6 H;  2CCZ A;  3HKZ B;  1VQ5 A;  1CFM A;  3FHW A;  3JC6 6;  3HP3 A;  1G6P A;  4R4I A;  3CCM A;  3K80 C;  3NK9 A;  1M4V A;  1VQF A;  2K4K A;  2N8N A;  1LO5 D;  2K05 A;  1IYU A;  2N55 A;  3QG1 A;  3QOL A;  1BQQ T;  3SEB A;  2KCT A;  1CHP D;  1LM0 A;  1KIX A;  2YU9 H;  4JI8 Q;  4LAA A;  4CHT B;  1PZI D;  1DJR D;  2HCC A;  5DM7 3;  5CV7 A;  1H9M A;  3PO2 B;  2WB1 G;  1IKL A;  2A6H C;  5E4W C;  3CC7 A;  1RD9 D;  3OWE B;  1LYL A;  3H0G B;  1LTT D;  3LWU A;  1WTX A;  2K7V A;  2YTY A;  3K5M A;  1LT3 D;  3GTO H;  3DEP A;  2K75 A;  5EKK A;  1JIC A;  4U68 A;  3VR5 A;  1VMC A;  4YIJ A;  5CV4 A;  4A3C H;  2M9V A;  2C9O A;  5K36 G;  2VUM B;  3K5L A;  1EQQ A;  4IFD G;  4PG3 A;  3SHL A;  4AYB G;  2EZV A;  1R4Q B;  1VQK A;  5L37 A;  3PF5 A;  2Q2U A;  2BDO A;  5IY0 A;  2NZH A;  4DK3 C;  4LF7 Q;  2NVQ H;  2SNS A;  1K0R A;  1G6Z A;  1PTO F;  2Q8R E;  2QGQ A;  4K6D A;  4RA8 A;  2L9H A;  2PQA B;  3R8B A;  4CJ2 C;  2E2J B;  1BBX C;  5FK9 C;  3A55 A;  3DMU A;  4QY7 A;  3D0F A;  4UHV A;  1K0S A;  4QJF A;  4TSS A;  5GAE C;  4K2K A;  1ENF A;  2NTS A;  4NP5 A;  1QZH A;  3VYU A;  5HY6 A;  1PFN A;  4G57 A;  4FYD A;  1YZ6 A;  4ILW A;  2K52 A;  4DK6 C;  1GUG A;  3CQZ H;  4KHV A;  2ZJQ A;  5T1I A;  2N78 A;  1TXY A;  4JPB W;  4YHH L;  1AZQ A;  2EXD A;  4XIG S;  5IT9 L;  2JA7 H;  1EQT A;  2L5T A;  3S1N B;  2VB3 X;  4IUR A;  2NZO A;  1KD1 C;  1Z7T A;  3J7Z C;  1TII D;  3AFP A;  2NVT H;  2N49 A;  1H9S B;  5CC4 A;  4N9P A;  1U4L A;  4JVZ A;  4UAI A;  2H5X A;  1DXM A;  3DWP A;  3CCQ A;  4MN3 A;  5CGK A;  4JI5 L;  1TWC B;  1PVO A;  3TS0 A;  1EOT A;  4RGN A;  5I4D A;  1VCI A;  3NTK A;  1S5C D;  4L5S A;  5DAU A;  2O4X A;  2Z9H A;  3H91 A;  2UUA L;  1XPU A;  2CH4 W;  2WP8 J;  3J80 E;  2ENB A;  4N8F A;  3F2U A;  2F0J A;  1GO3 E;  2E5L Q;  1FGB D;  3HKS A;  1KLG D;  3A0J A;  2AMC B;  5DM6 3;  2Z6K A;  1F2Z A;  3RR5 A;  4B3S Q;  3J7Y W;  3EQL C;  1Z9F A;  2RDH A;  4LW1 A;  1Y1V H;  1GHK A;  5HGT A;  2PW7 A;  2F0L A;  1X9N A;  1O7I A;  4DAM A;  4LF8 Q;  2RSO A;  5ELB A;  2C35 B;  2E2D C;  3E0E A;  3IL8 A;  3HOX B;  3UE0 A;  2WAQ G;  5EJW A;  4DV5 Q;  2PNR C;  1PH9 A;  1BCP C;  4A3K H;  5JPN C;  1CZG A;  1HRJ A;  2E2I H;  2F3I A;  4JI1 Q;  4KKU A;  2JEA I;  4DU9 A;  5JEA H;  5EPK A;  3S16 H;  3FKI G;  4NB3 A;  3NEL A;  2ZJR A;  2ATW A;  1Y8O B;  1HNX L;  4KJN A;  4ME3 A;  3J80 i;  3CCS A;  2VL6 A;  4R9W A;  1TS5 A;  5IGG A;  1W2B A;  1EY0 A;  1LT5 D;  3IFD A;  5AJ3 Q;  3S14 B;  3QR8 A;  3N6R A;  1F9S A;  4JI7 L;  2Z1C A;  1VQ6 A;  2O2L D;  4ZAI A;  3KBG A;  5COR A;  4DV1 L;  1ILQ A;  3FDT A;  4DA2 A;  1XWE A;  1MHW C;  3AQQ A;  3SXH A;  1SAP A;  1JWS D;  1AFP A;  3C1F A;  1J5E L;  3F2D A;  5JAV A;  2R3Z A;  2BE5 C;  1SJE D;  1HQR D;  3CD6 A;  1IW7 D;  4QUC A;  1VQ9 A;  1BCP F;  4BA1 I;  1D8L A;  2XRS D;  3IRB A;  3EIV A;  1PH1 A;  3CP0 A;  2ALY B;  3W2D A;  1EY5 A;  1PH2 A;  4IO9 A;  3BZK A;  3V96 A;  4QCL A;  3NP8 A;  4ZK9 B;  3I73 A;  3S2H B;  3I4N G;  2F0I A;  5C4X B;  2NVY B;  1X54 A;  5IYB G;  2K1B A;  1I4P A;  5IYC H;  1GHJ A;  4MIU A;  4R4O A;  1GKH A;  4NXN Q;  2KHJ A;  1UNS A;  3S15 H;  1K73 C;  1KNA A;  2MHV A;  2K5H A;  4ODG A;  3VA5 A;  4AIM A;  2VQF L;  1SNO A;  2VQE Q;  1R9T H;  1K9M C;  1IXR A;  1HR0 L;  2EYP A;  2R92 B;  2ZXR A;  1IBM Q;  1XMQ Q;  4TRD A;  1NJI C;  4A3I B;  1K8A C;  3GTK B;  1RKN A;  3FPP A;  4DKA C;  4A3M G;  4RCO A;  4C3I G;  4X62 L;  4BY7 G;  2BH2 A;  3CCR A;  1XMO L;  4WRD A;  4EQN A;  2VUM G;  2F0T A;  3MXN B;  4C3J G;  2F4I A;  3HGB A;  2E2H B;  4C3H G;  1STA A;  1QVC A;  1UE5 A;  3FP9 A;  4GOP C;  4FDB A;  4YY3 Q;  1UE7 A;  1TWF H;  5IT9 c;  1A2T A;  2GVA A;  1WTO A;  1AZP A;  2CVR A;  4DV6 Q;  5HUR A;  2UUB L;  3T51 B;  2R6G A;  3S2D H;  1N33 Q;  2AQ1 B;  4F7X A;  4CJ0 B;  2Q2I A;  2I46 A;  4O0A A;  1A3T A;  3EN2 A;  4K2L A;  5D65 A;  4YWM A;  1BOS A;  1T5X D;  3U9O A;  1OXS C;  1A3U A;  3OTO Q;  2NVQ B;  1K83 H;  2ZTE A;  2MO0 A;  4HAE A;  2UXB Q;  1GVP A;  1I94 L;  4JW0 A;  5CV9 A;  2WIN B;  2NYZ D;  4LF4 Q;  3CRL C;  3QJY A;  3KBX A;  4OO1 H;  4RFB A;  3I91 A;  1DCZ A;  1X65 A;  4F8M A;  3TN2 A;  4A93 B;  1TWH H;  2KCN A;  2GVB A;  3FKI H;  1VDZ A;  2KED A;  5TSS A;  1JB7 A;  2OXP A;  4X66 Q;  1U0L A;  3DLL A;  1XJV A;  1GUW A;  3BU2 A;  1XXG A;  5J3B A;  4XXE A;  3M4Y A;  1Y8P B;  5E7N A;  1HA6 A;  2BA1 A;  4HSV A;  3KFU A;  4FF2 A;  2FIN B;  2UUC L;  1GUO A;  1KDC A;  4KD3 A;  3W1B A;  4HJ8 A;  2PZW A;  4GKK L;  4OX9 Q;  3LX0 A;  5ISR A;  3ZYY X;  5IWA L;  1E22 A;  3OHX C;  3SE0 A;  4B08 A;  1DZ1 A;  3T16 A;  1NNX A;  4NPS A;  2UXD Q;  5KEE A;  5LHY 1;  3JAM E;  4IUT A;  4M8A A;  4Q0F A;  2EDG A;  4RGT A;  5IYD H;  2OCE A;  1HFN A;  3I8Z A;  2Q8I B;  1N32 L;  1VQD A;  4KKT A;  3HOU B;  2ASB A;  2G5D A;  4K5V A;  1BUV T;  5KIX A;  4IFD J;  4DV4 L;  1L0Y B;  1HFG A;  1B9M A;  1QB5 D;  5GAD C;  4L5Q A;  1SJH D;  1FNW A;  2XGT A;  3RN2 A;  1SMY C;  3SK5 A;  4CGY B;  4X65 L;  4A3L G;  1PTO D;  3PO2 H;  4DR4 Q;  3I7F A;  2O5I C;  1VF7 A;  2L11 A;  4X3S A;  4B3M L;  1PH7 A;  3H0G H;  4JI4 L;  5IOD A;  2JA8 H;  4IJL A;  4LWC A;  3VR4 A;  5FO8 B;  2E76 C;  2A6H D;  4A3K B;  5IGF A;  4QIW B;  1Q1B A;  4RG1 A;  3E9I A;  1XNQ L;  1SLJ A;  3BG3 A;  1WD0 A;  3MXN A;  1QNK A;  3R3O A;  2VUM H;  4BBS H;  1G91 A;  4DUZ L;  4UP9 A;  1V1Q A;  3J7A F;  1RHP A;  3TBI B;  1UAP A;  1SYD A;  2CW0 C;  1HR0 W;  5EBD A;  1D6E C;  4POF A;  1FJG L;  2VZA A;  3QIA A;  2E2J H;  2FJ2 A;  1N34 Q;  3GTG B;  4I7A A;  1U5K A;  4MTK A;  4LJZ C;  1JWM D;  2RKS A;  4DR5 Q;  3C3L A;  1Q7Y C;  3F2C A;  3GTL H;  1L0X B;  4JI2 L;  5C0X G;  3MEH A;  2D2C C;  4HMJ A;  2B2W C;  1CKM A;  5IP9 G;  4L6T B;  2JA5 H;  2KHS A;  3QWN A;  3F2B A;  1IL2 A;  3BZD B;  3HS0 C;  4GLA C;  2HHH L;  1E2Z A;  2ZXP A;  1WTH A;  4QMG A;  3KLR A;  4TQU S;  5J39 A;  4LF9 L;  3J81 j;  1WTQ A;  3OPO A;  2CKZ B;  4XYQ A;  5JJZ A;  3S1N H;  1LTG D;  1PFM A;  3RZD B;  2JA6 G;  4DUY L;  4CKC A;  5J22 A;  5H1S E;  1IYV A;  4KLK A;  3NWT A;  3GV3 A;  1WCM B;  2R92 G;  1PRT B;  4P73 A;  3FEW X;  3PIO 3;  4KY7 A;  1VQ8 A;  4DR6 L;  2XWJ B;  1S5E D;  1TWC H;  1LTL A;  3WDN A;  4J1M A;  5EGT A;  1KAW A;  1BNZ A;  4DFA A;  1LTR D;  4APV A;  4WJW A;  2A68 C;  2WKC A;  3Q8D A;  2EY5 A;  3J80 L;  1VQA A;  1F9Q A;  1HTP A;  3A56 A;  1KC8 C;  5D3I B;  5M3F B;  4OX9 L;  2OTL A;  1GUN A;  3I2Z A;  4LFC L;  2D5D A;  4A3C G;  5IGC A;  1ENC A;  3CMA A;  5LL6 X;  1VS0 A;  1VQ7 A;  1STY A;  1EFW A;  3SK4 A;  4ULL A;  1CUK A;  4DK0 A;  3U4V A;  4KY5 A;  2R93 B;  3Q0A A;  1QJO A;  5ELE A;  5FLX E;  1TWF B;  1W3S A;  1D1K A;  2F4V L;  2V1C C;  5F2D A;  3HOX H;  4QF4 A;  1DGS A;  2N88 A;  2LXJ A;  1Q12 A;  5A35 A;  1O80 A;  4IPH A;  4KK7 A;  1S72 A;  4DNR B;  3P1H A;  2HIX A;  4YHH Q;  3EVQ A;  3BDL A;  1HJP A;  2EYO A;  3C1E A;  3HOZ B;  4A3L H;  1CKN B;  4F88 A;  1BCP D;  1HH2 P;  2Y0S B;  3NWS A;  1EYG A;  2V4D A;  1SFO B;  2WII B;  2B2U C;  3CPF A;  2DY7 A;  3ICE A;  1STH A;  1FR3 A;  3SK8 A;  4ZKC B;  3KF8 A;  3GTM B;  3S14 H;  1QVG A;  5I6Y A;  3GTQ B;  3NBH B;  4JI5 Q;  1D1I A;  5C44 H;  1C48 A;  2ZM6 L;  1VQO A;  1E7Z A;  3A8K E;  5M9O A;  2RDG A;  2IL8 A;  1VQ4 A;  3ND9 A;  1V8Q A;  2UUA Q;  3GO5 A;  1V1O A;  5EBC A;  4JG2 A;  3I4M H;  1ASY A;  3T53 B;  4A3G B;  2GA4 B;  3H3V H;  1CZW A;  4A3J H;  3H3V I;  2E74 C;  3T4A C;  1BBW A;  2BE5 D;  1P8L A;  3CXC A;  5C0X H;  1PHJ A;  1LTI D;  3HKZ E;  3J81 L;  5C0X I;  4HIM A;  5FO7 B;  3S2H H;  4NXM L;  4DR5 L;  5C4X H;  1TS3 A;  2EOT A;  2NVY H;  3A8I E;  3NE5 B;  5E1F A;  4JI0 L;  2ZJP A;  3A54 A;  1XTD A;  2K32 A;  3OIQ A;  4GKJ L;  1QUQ B;  3OSO A;  4NDX A;  3W5O A;  3J7A 5;  1VQH A;  1Y1V G;  5E3F A;  4Y52 H;  5KYL A;  3BS1 A;  3M3Y H;  4DPG A;  2AKW B;  4PZ6 A;  5G3L D;  4JV5 Q;  1EL0 A;  2B2U A;  3DWA A;  2R92 H;  2Z4I A;  1VQC A;  1PTO C;  1DYQ A;  2F3W A;  2J0T D;  2KEN A;  3L7Z C;  4DGZ A;  1HQM C;  2SOB A;  4A3I H;  3GTK H;  4A3K G;  1HNX Q;  1Q82 C;  1OXX K;  3NXW A;  1SE2 A;  5JEA G;  3QOJ A;  1EU4 A;  3M7N A;  4HIK A;  5JJI A;  4AQY L;  4JI7 Q;  4CDE C;  2E2H H;  4L5T A;  2F0O A;  1FNU A;  3A74 A;  1QOH A;  5A2Q E;  4DV1 Q;  2D0O A;  3HRZ C;  3V05 A;  2JA8 B;  3ERS X;  4JCV E;  3KDF A;  4K8I A;  3HFZ B;  3PUZ A;  1E24 A;  4IQZ A;  3T13 A;  1J5E Q;  1MD2 D;  2DUD A;  1EIH A;  3GTJ H;  1H9K A;  1KLU D;  2J4X A;  2P5Z X;  4BBS B;  5IE8 A;  3PSI A;  1AEX A;  1J8I A;  1U4M A;  4GLV B;  4EX5 A;  5FO9 B;  4YWL A;  4XYO A;  2F0M A;  4X64 L;  3MVV A;  4BS9 A;  1OTC A;  3M4O B;  1XPR A;  4WFN 3;  2Z6K C;  3HOV B;  3Q22 A;  4R4C A;  3OMG A;  4GNX B;  2KVM A;  1G2T A;  1D5X C;  1EWH A;  3GTL B;  1SYB A;  1CKN A;  3MTS A;  4EGV A;  4A93 H;  1EY9 A;  1YIJ A;  2KA7 A;  1STB A;  3J80 c;  3NTH A;  4C1N K;  3S1M B;  2JA5 B;  1DOL A;  5EPJ A;  2VQF Q;  1WI5 A;  1W6K A;  2X69 A;  1HR0 Q;  2NTT A;  5IYC G;  2D62 A;  1SYG A;  3FRP B;  1RTN A;  2FMC A;  3W3A A;  1EIY B;  4GN3 B;  1STN A;  2EXZ A;  2JE6 I;  2F3V A;  5BR8 L;  1MGS A;  4FXD A;  2EYL A;  3M7G A;  4X62 Q;  4EQP A;  1I5F A;  5M5X B;  5FKA C;  2H1E A;  1JJG A;  1PFB A;  4QL5 A;  1XMO Q;  5EQ0 A;  4P71 A;  3R2I A;  4H7B A;  3RN5 A;  1AP0 A;  3UDX A;  4O42 A;  3K7U C;  1KTK A;  1Q8K A;  1DOM A;  4ABN A;  1O7Y A;  2UUB Q;  1SRU A;  2R93 G;  1WOC A;  2JA9 A;  1SSO A;  3HOU H;  4HJ9 A;  1EWI A;  4CDC C;  3TS2 A;  2XSC A;  3OWF A;  3ERQ A;  2EY6 A;  1K8M A;  4TKO B;  1PYW D;  3PUW A;  4AH6 A;  5FLM G;  4G7Z C;  2CFM A;  3AB9 A;  3UI2 A;  4DV3 L;  4IOA A;  1QUQ A;  3TRZ A;  2AQ3 B;  2QDL A;  3UE1 A;  3GD7 A;  1I94 Q;  2H4O A;  4A3D B;  2EYJ A;  2OWO A;  2Y0S G;  2HQL A;  3DXJ C;  3TP6 A;  1K28 A;  1WVL A;  1I6H B;  2L12 A;  1SMY D;  2EY1 A;  4FF4 A;  1AH9 A;  4JYA L;  3K58 A;  1JC7 A;  2CWP A;  4FNF A;  4JV5 L;  5DEH A;  4OO1 G;  1YNN C;  5EKL A;  1LT6 D;  2ZTC A;  3U9S A;  1X6O A;  3OW7 A;  1PFS A;  3NPP A;  3J81 c;  2RCF A;  2UUC Q;  4PNY A;  1A2U A;  4GKK Q;  3OOC A;  2MO1 A;  1RCV D;  1G51 A;  3N52 A;  2DGY A;  3D4W A;  5IWA Q;  5IOC A;  4ZUI A;  1EIG A;  2XWB B;  3GTG H;  1QZG A;  1B7Y B;  3STB C;  1J9O A;  5C44 B;  3AYH B;  2CW0 D;  5EPL A;  1NTG A;  1YNJ C;  4ME5 A;  4HJ5 A;  1I3Q B;  1N8R C;  1N32 Q;  4L8J A;  2OQ0 A;  2PQA A;  3I4M B;  3AEV A;  1VF5 C;  1S3O A;  5IYD G;  5AFW A;  4Q5V A;  4A3J B;  3M85 A;  3RZD H;  4DV4 Q;  3VYS A;  2A19 A;  3HKZ G;  4DXG A;  4F87 A;  1B9N A;  3AU7 A;  1WCM H;  2IHE A;  5FOB B;  4OHJ A;  4X65 Q;  4B3T L;  2PNH A;  1IBK Q;  2JP1 A;  1CKO A;  1Z47 A;  2UU9 L;  1SRO A;  4B3M Q;  5IGD A;  2KJX A;  4FXK C;  4JI4 Q;  2XN9 C;  4ZUJ A;  5C3W A;  1TWG B;  1HNZ L;  2ICI A;  1BDO A;  2PMZ B;  3PO2 G;  3BVM A;  3TRE A;  3BZC A;  4KY6 A;  5JOB A;  4CKE A;  4LF5 L;  3M3Y B;  1H9S A;  4DAV A;  1LUZ A;  2L1B A;  3H0G G;  1XNQ Q;  4XQN A;  1NR4 A;  3EBE A;  3CCJ A;  2JA8 G;  2PPB C;  1S5D D;  1H9R A;  2QKI C;  1AW7 A;  3NBI A;  3PO3 H;  4DUZ Q;  1MJC A;  2DJG C;  2Z0S A;  4YWK A;  5M3F H;  3HOW H;  1KHI A;  3KUP A;  2A68 D;  4DR1 L;  3CPW A;  4FVM A;  2B8G A;  5KND A;  5ELD A;  1FJG Q;  3KF6 B;  4BBS G;  1ZKO A;  3RLO A;  1SBB B;  3CU7 A;  4MZ9 A;  2R93 H;  3SDZ A;  5I9P A;  2K50 A;  4K8J A;  4JI2 Q;  4K14 A;  3B6Y A;  1JJ2 A;  3DHQ A;  5FLX L;  4DAP A;  2Z4H A;  5M5W H;  1MBY A;  5FLM H;  1M1K C;  4JBK A;  3H3V C;  1K8O A;  2K5W A;  2HHH Q;  4DN4 M;  1B50 A;  2ES2 A;  2NZ1 D;  3GTJ B;  1ESR A;  1WD1 A;  2OQK A;  4LF9 Q;  3HOZ H;  1NCV A;  1L0W A;  1BKB A;  2JA5 G;  1H9J A;  5IP7 G;  1CA5 A;  4KD4 A;  4DUY Q;  1SFO H;  4DXF A;  5C5M A;  2YYZ A;  3E6Z X;  1PH8 A;  2KEE A;  3GTM H;  1SE3 A;  1WTP A;  4A3B H;  4DR6 Q;  4O1N A;  1TWA B;  1I4Q A;  4RMF A;  1R4P B;  3G6J B;  2F0Q A;  3GTQ H;  1BBU A;  1VQE A;  2MPM A;  2HT1 A;  4HCS A;  3D8G A;  4OXP A;  3MFY A;  1ASZ A;  4OO1 I;  2BH8 A;  1HCZ A;  3TDQ A;  3E3X A;  2RDF A;  2BA0 A;  2HDM A;  3PUV A;  1JR0 D;  3DUZ A;  4A3G H;  1EY8 A;  2X6L A;  3CHB D;  3OIP A;  3T1H L;  1SNP A;  3U58 A;  2D0P A;  2AWO A;  3A7A B;  1TKW B;  4LFC Q;  4OWT B;  1KQS A;  2F0P A;  3MXG A;  1I4H A;  2F52 A;  3L3O C;  4DR2 L;  3VR3 A;  1VQJ A;  5IT9 E;  2B63 B;  1VQM A;  1EY7 A;  2JSO A;  2VB2 X;  4CDF C;  3ULL A;  2F03 A;  1YHA A;  2B2Y C;  2HCI A;  2K33 A;  2LSS A;  4UPA A;  1JE5 A;  2F4V Q;  4WJ4 A;  3S17 H;  1SDF A;  2CHB D;  1S40 A;  2AUJ D;  3E9H A;  3PQI A;  2CQA A;  1C0A A;  2CH4 A;  5HGQ A;  4IOC A;  3HOX G;  3KOJ A;  4IAL A;  4U67 3;  2B3G A;  1SMX A;  4HR7 B;  1KAB A;  3K57 A;  1MKH A;  3MWY W;  4QIW E;  2R7Z H;  5I2Y A;  2XNA C;  3FMC A;  1IBK L;  3H15 A;  2IX1 A;  1JQY D;  3Q23 A;  1I50 B;  3I90 A;  1KXL A;  4HJA A;  4UY8 C;  1T5E A;  1Q46 A;  1Q86 C;  1HNW L;  3GDE A;  4J15 A;  1QIL A;  2Q2T A;  3T1Y L;  2ZM6 Q;  2LS0 1;  5A2Q L;  3PUX A;  4M1U B;  3TP5 A;  5GQO A;  1EY6 A;  4RAU C;  3CC2 A;  5JJL A;  1V1P B;  2JEB I;  1N36 L;  3JAM i;  4FF3 A;  2F0E A;  5C44 G;  3KF6 A;  3E5S A;  1EEI D;  3K59 A;  2JN4 A;  1L1O B;  3G7L A;  1SYC A;  3S24 A;  3P7J A;  3I4M G;  2F0N A;  3CAM A;  3QB3 A;  5IGB A;  4IUV A;  2B2Y A;  3I70 A;  2L15 A;  3L2P A;  4A3J G;  1II3 A;  3M4O H;  4DV2 L;  4IUQ A;  2JK8 A;  4NXM Q;  2NUC A;  2BOS A;  1HZ9 A;  3HOV H;  4XQQ A;  4JI0 Q;  1HPC A;  3Q6S A;  1V43 A;  4JC0 A;  1CT1 D;  1DOK A;  4GKJ Q;  2NWG A;  1RJT A;  4ALP A;  4RCN A;  3S1M H;  2AWN A;  4NKL A;  5IP7 H;  1PDQ A;  5C4X G;  3D4D A;  1WTR A;  2IHF A;  1GOZ A;  2TMP A;  2K6A A;  1CM9 A;  4OON A;  4Y7N H;  5DNF A;  3K81 C;  1IYJ B;  2LXK A;  5KYI A;  5C4Z A;  4H02 A;  1YI2 A;  2A5H A;  3K0Y A;  5M5X H;  4BA2 I;  3FPU B;  1B70 B;  3MXU A;  1XX8 A;  5C4J B;  4A3I G;  2RVL A;  4AQY Q;  1ESF A;  5FLX c;  2IX0 A;  1HZA A;  1M8A A;  4QQB X;  5I9O A;  3U4Z A;  1HZC A;  4A76 A;  2KCM A;  1KDA A;  4DNI A;  4KN4 C;  3GV6 A;  4RKB A;  2PO4 A;  3IFT A;  1CTM A;  2B2V A;  3ONA B;  1E2V A;  2IT1 A;  1A15 A;  4P74 A;  1JCK B;  2FHT A;  3PO3 B;  2E8G A;  4YCU A;  4LUZ A;  1T9H A;  1SE8 A;  4IUN A;  1TY2 A;  1A0I A;  3HOW B;  1EQV A;  4JBW A;  3RNU A;  2MP1 A;  2TSS A;  3HOY B;  5LMN Q;  2IY5 B;  4X64 Q;  4A3D H;  4K5W A;  5KRU A;  3I4O A;  3FVQ A;  1PXU A;  1I6H H;  3VYT A;  2Y0S E;  1NAP A;  4UP8 A;  1EEF D;  3C2P A;  5M5W B;  1W6J A;  2XVS A;  3L0O A;  1WFQ A;  3TP7 A;  2L55 A;  4LFB L;  4A93 G;  1OXV A;  3OMC A;  2HUG A;  1EIF A;  3GP7 A;  1IL8 A;  3X3M A;  5C6A A;  4GS3 A;  1EOV A;  4L5R C;  1PRT C;  3M4Q A;  5CV8 A;  2MJ8 A;  1N9W A;  2SNM A;  5BR8 Q;  1YNN D;  5NUC A;  1PA6 A;  2NBF A;  3D6W A;  4BY1 H;  4A3B B;  3VA7 A;  3HG9 A;  2EPB A;  3F8T A;  3UDI A;  1V9P A;  4RHS A;  1GD7 A;  3MHB A;  1XPO A;  1XYI A;  1PH5 A;  4IPD A;  1GXD C;  4C56 C;  2PQE A;  2I5H A;  5JPM C;  1UEB A;  2KBN A;  4GLX A;  1SNC A;  3ERO A;  1XNR L;  1I3Q H;  2FXQ A;  3STB D;  4GN4 B;  3LWE A;  3G4S A;  3AMU A;  1WYD A;  4JI6 L;  3S1Q B;  1X3E A;  1PLF A;  2A69 C;  5CBE E;  4RKL A;  3ITP A;  4K0K L;  5COY A;  1KRS A;  4NW2 A;  2OT2 A;  4V0B A;  4HJ7 A;  1Y1W B;  1YNJ D;  4GN5 A;  2KHI A;  1B3A A;  1LV9 A;  3KK7 A;  4DV3 Q;  5LMU L;  2A1A A;  3HOU G;  5GAG C;  1EQR A;  2K5N A;  3G48 A;  2IJ0 A;  2K14 A;  2QIL A;  3MAQ A;  3I72 A;  2M2L A;  4LFA L;  1PRT F;  2LFN A;  3CF5 A;  2MNA A;  4A75 A;  3PIP A;  3UDF A;  2IX3 A;  2L0C A;  2R7D A;  3VYR A;  1QCB D;  4DR7 Q;  4XTC S;  5CR3 A;  4G7O C;  1TWG H;  1TQO A;  2UXC L;  2K28 A;  3S17 B;  5EAY A;  2F0W A;  4JYA Q;  1ENA A;  1B8A A;  5M3M B;  1U9R A;  2JQO A;  1SN8 A;  3G6E A;  4N9T A;  3CC4 A;  1H95 A;  3VR2 A;  1B3Q A;  3MC0 B;  1E1T A;  3I55 A;  3S9W A;  4UDU C;  1RIP A;  2R7Z B;  5M5Y B;  1CQV A;  4A4I A;  2QA4 A;  2PW5 A;  4R8I A;  3CME A;  1TS4 A;  1NY4 A;  1X3Q A;  4BBR B;  1SE4 A;  4H44 C;  1P16 A;  2IWH A;  1LLR D;  3I4N B;  3O13 A;  1ET6 A;  1AE3 A;  3MFG A;  2KEC A;  1IBL L;  3S1R B;  1Q90 A;  4DR3 L;  1B2T A;  4OWX B;  3NHH A;  1G2S A;  5J1Z A;  1HXY D;  5CMD A;  1S5B D;  2PZT A;  1RDP D;  5I2X A;  5T1G A;  1TVX A;  1I4R A;  3K7A B;  1WJJ A;  3V2T A;  5LMN L;  1QWY A;  4B3T Q;  4A3M B;  2J7Z A;  3K8A A;  4C3I B;  4BY7 B;  1TWA H;  3MXP A;  2UU9 Q;  4LF6 L;  2B2T C;  2HIV A;  4BWG B;  1UE6 A;  1F2Y A;  5ELN A;  1O7L A;  1SXT A;  1WCM G;  3RLF A;  4C3J B;  2R61 A;  1JB3 A;  4C3H B;  1HNZ Q;  1O78 A;  2MUY A;  1OXT A;  1EY4 A;  3URY A;  3VR6 A;  1YJN A;  1OO9 B;  1G29 1;  1GM5 A;  2PCF B;  5D3D A;  4LF5 Q;  1X56 A;  4ZRZ A;  1M90 C;  3K0X A;  1S5F D;  1A63 A;  3KYH C;  3LGJ A;  4JI3 L;  5K5P A;  4PZ8 A;  2NVX B;  3NBH A;  3BDC A;  4Y7N B;  3I4L A;  3I56 A;  2EYM A;  4HIO A;  4J6H A;  4G4K A;  3J7A V;  1HUM A;  4IJH A;  1KNE A;  2RSN A;  1VQN A;  1EU3 A;  2DY8 A;  4KKS A;  1E3P A;  4DR1 Q;  2RHS B;  5ELC A;  3PO3 G;  4YCW A;  2B63 H;  3HOW G;  3KJP A;  1EYD A;  5M3F G;  1Y8N B;  1BCP B;  1MSG A;  2QDB A;  3BVZ A;  1UE1 A;  1LT4 D;  3P75 A;  4R1J A;  5CBA E;  3HOY G;  1GJX A;  1YJW A;  3JAM L;  2K5V A;  3HZX A;  1SR3 A;  2ZXO A;  5D14 A;  3H94 A;  4A3F H;  4PQX A;  3HEJ A;  3BDO A;  1ET9 A;  2EY2 A;  3M4P A;  1RTO A;  3PF4 A;  4R8N A;  4LNQ A;  2G9H D;  1UWV A;  4J8Q A;  2K5D A;  3DM3 A;  1C4Q A;  3U50 C;  2DNE A;  4EQO A;  3RZO B;  2B2T A;  4B9W A;  3KLS A;  1ZYR C;  4EVO A;  4RH6 A;  2EJG C;  1HUN A;  4B3R Q;  3NEN A;  4DV0 L;  1EZ8 A;  4GNX C;  3GTP H;  1JOO A;  1U4P A;  3HOZ G;  4I7Z C;  1I50 H;  3KJO A;  4JK1 C;  1FVI A;  4DR7 L;  2ZT9 C;  5C3E H;  2NN6 H;  2L4N A;  4HN7 A;  5C0X J;  2NN6 I;  5GRO A;  1F9R A;  1HZB A;  3KLS X;  4A3B G;  4BXX H;  5FJ8 H;  5JJK A;  1JOR A;  2B29 A;  4X3T A;  1SNQ A;  2RCN A;  3KLW A;  4G7H C;  4DV7 L;  1BO0 A;  3MEF A;  2OF1 A;  1D7Q A;  4LUV A;  2I5M X;  3CRK C;  4HTH A;  3ULJ A;  2ZTD A;  3GQB A;  3PIP 3;  5EKI A;  1X32 A;  3T1H Q;  3K6O A;  1BF4 A;  1NBW A;  2EE1 A;  4BY1 B;  4A3G G;  4DR2 Q;  1Y1W G;  3TQY A;  2K01 A;  4X6A H;  1YEZ A;  2Q8T A;  5KNB A;  2AHO B;  1I4X A;  2K03 A;  4RHR A;  2NB0 A;  1DD2 A;  2JXM B;  1YJ9 A;  3CCE A;  3I3C A;  1STG A;  2A8V A;  1QVF A;  3PUY A;  4JI8 L;  1QE6 A;  1PH4 A;  4NMZ A;  4ZQ3 A;  1RL2 A;  2F0V A;  1K3B C;  4CBV A;  4XQJ A;  1X3P A;  2YTV A;  4GNX A;  2DNC A;  4LUO A;  4P72 A;  5M3M G;  4C2M B;  4TVA B;  4ZKB B;  2PMZ E;  2F0F A;  4H0L C;  5K36 H;  2F0S A;  4E6I A;  1HHV A;  4GOP B;  3G71 A;  4IFD H;  4IUP A;  2EYF A;  2Z8L A;  4H13 C;  2XRQ D;  4X3U A;  5C4J H;  2QEX A;  4IFD I;  1NSN S;  3NQT A;  2X6G A;  2VY3 A;  1HNW Q;  2WKD A;  1J6Q A;  1CSP A;  3RD4 A;  2R7Z G;  2A6E C;  3T1Y Q;  1A6X A;  1FL0 A;  1YNX A;  4JOI C;  4IN3 A;  4QB4 A;  3CW2 C;  2WV6 D;  4BBR G;  5LMN W;  1STE A;  1E0B A;  4LF7 L;  1VQP A;  3CKI B;  1K8G A;  3J81 E;  1N36 Q;  1I6V C;  4KV6 A;  4V19 0;  1NE3 A;  1FNV A;  4OL7 A;  3CCL A;  1E2W A;  1I4G A;  4RGM A;  4ZYS A;  3EA6 A;  1EUJ A;  3NSW A;  4DF7 A;  3VDY A;  1HTL D;  3HOY H;  1RF2 D;  4A3E B;  1TT2 A;  2JA6 B;  3K5N A;  2F0H A;  4DV2 Q;  2MQH A;  2FFK B;  1YHQ A;  1BR9 A;  3NTI A;  1Y14 B;  2PYK A;  4OEM B;  4QGU A;  3UDG A;  3TEH B;  3PCO B;  4PMW A;  4X3K A;  1NUC A;  3HOV G;  2AQ2 B;  2B39 A;  1ML0 D;  1Z6H A;  2YU9 B;  1UEA B;  1C8C A;  2LMC B;  4S3S A;  1VQG A;  4DAY B;  3J81 i;  1ROD A;  1MIU A;  4P75 A;  2WAC A;  3PMF A;  3PIO A; 
#chains in the Genus database with same CATH homology
 4B3R L;  2NVY H;  3A0J A;  4JI0 L;  2ZJP A;  2AMC B;  3JAM c;  2VNU D;  2YV5 A;  4JOI A;  2Z6K A;  4OON A;  1XTD A;  3RR5 A;  4B3S Q;  4GKJ L;  1QUQ B;  4Y7N H;  3W5O A;  3J7A 5;  1VQH A;  3K81 C;  1IYJ B;  2LXK A;  1Y1V G;  1Z9F A;  4LW1 A;  4Y52 H;  2E5L L;  4H02 A;  1YI2 A;  1Y1V H;  1NMF A;  3M3Y H;  4MNO A;  4DPG A;  1X9N A;  2AKW B;  5M5X H;  4PZ6 A;  1O7I A;  4JV5 Q;  4DAM A;  4LF8 Q;  4BA2 I;  1B70 B;  2R92 H;  1CSQ A;  2C35 B;  4NXM L;  1VQC A;  4A3I G;  4MTN A;  4B3S L;  4AQY Q;  5FLX c;  2KEN A;  3L7Z C;  3E0E A;  4A3I H;  3GTK H;  3UE0 A;  2WAQ G;  2IX0 A;  4A3K G;  1HZA A;  1HNX Q;  3S1Q H;  4DV5 Q;  1Q82 C;  1VQL A;  1PH9 A;  4QQB X;  1OXX K;  4A3K H;  3U4Z A;  1HZC A;  2E2I H;  4A76 A;  2F3I A;  2VW9 A;  4JI1 Q;  5JEA G;  2KCM A;  4LF8 L;  1Y1W H;  3M7N A;  4HIK A;  4DNI A;  2JEA I;  5JJI A;  5GAH C;  3S16 H;  3FKI G;  4AQY L;  4JI7 Q;  4NB3 A;  3NEL A;  2ZJR A;  2E2H H;  1JJC B;  2ATW A;  5JEA J;  4L5T A;  1HNX L;  2IT1 A;  4DV5 L;  4ME3 A;  3A74 A;  3OYY A;  1C9O A;  3J80 i;  4P74 A;  4DV1 Q;  2D0O A;  3CCS A;  1A62 A;  4R4T A;  4R4Q A;  4JI1 L;  3ULP A;  2VL6 A;  2E8G A;  3ERS X;  4LUZ A;  1T9H A;  2PI2 E;  3KDF A;  4JCV E;  1SE8 A;  4YCU A;  1W2B A;  1A0I A;  3HFZ B;  5AJ3 Q;  4JI7 L;  3PUZ A;  4JBW A;  1E24 A;  1VQ6 A;  3RNU A;  3SGI A;  1VQB A;  4O2D A;  3CCV A;  1J5E Q;  2DUD A;  4A3D G;  4DV1 L;  2XTI A;  5LMN Q;  3GTJ H;  2IY5 B;  4X64 Q;  4A3D H;  3ZJY C;  3I4O A;  5IE8 A;  5M3M H;  3AQQ A;  3PSI A;  4GOP A;  5AJ3 L;  4GLV B;  4EX5 A;  4IPG A;  1KRT A;  1I6H H;  2Y0S E;  1J5E L;  4YWL A;  3F2D A;  4LFB Q;  4UP8 A;  3CD6 A;  4X64 L;  3CCU A;  1OTC A;  1OXU A;  1VQ9 A;  3L0O A;  1XPR A;  1WFQ A;  4BA1 I;  1D8L A;  5M5Y H;  3M9B A;  2Z6K C;  3IRB A;  3EIV A;  4R4C A;  1PH1 A;  4GNX B;  4POG A;  3CP0 A;  4LFB L;  4A93 G;  1OXV A;  2ALY B;  1PH2 A;  4BBR H;  1CKN A;  1EIF A;  4IO9 A;  4A93 H;  1YIJ A;  3J80 c;  3BZK A;  4GS3 A;  1EOV A;  4L5R C;  3M4Q A;  2I0Q A;  2VQF Q;  1N9W A;  1WI5 A;  1IBM Q;  5BR8 Q;  3I4N G;  1HR0 Q;  4BY1 G;  5IYC G;  2D62 A;  1PA6 A;  1X54 A;  5IYB G;  3I4N H;  4BY1 H;  4YCV A;  5IYC H;  3ER0 A;  4R4O A;  5IYB H;  1EIY B;  1GKH A;  4KHP Q;  1XNR Q;  4NXN Q;  2KHJ A;  4GN3 B;  3S15 H;  3S1R H;  3F8T A;  1K73 C;  3UDI A;  1V9P A;  4HID A;  4JI6 Q;  2K5H A;  3OW2 A;  2JE6 I;  4AIM A;  1GD7 A;  2VQF L;  1XPO A;  1PH5 A;  5BR8 L;  4IPD A;  2VQE Q;  1R9T H;  1K9M C;  1IXR A;  1HR0 L;  4X62 Q;  4K0K Q;  1I5F A;  2ID0 A;  2I5H A;  1JJG A;  2Q2H A;  4QL5 A;  1XMO Q;  2WB1 E;  4P71 A;  4GLX A;  1UEB A;  2KBN A;  1XNR L;  4NXN L;  1I3Q H;  2FXQ A;  3STB D;  4GN4 B;  3RN5 A;  1XMQ Q;  1NMG A;  1NJI C;  3G4S A;  3UDX A;  1K8A C;  1WYD A;  5LMU Q;  3K7A H;  4JI6 L;  2JJQ A;  1X3E A;  3K7U C;  4DKA C;  3A5U A;  1Q8K A;  4A3M G;  2VQE L;  3KF8 B;  1K3R A;  4K0K L;  4X62 L;  4BY7 G;  4A3M H;  2BH2 A;  1KRS A;  4LFA Q;  5ELO A;  4C3I H;  3CCR A;  4HJ7 A;  4BY7 H;  1JT8 A;  1XMO L;  2EIF A;  2VUM G;  4GN5 A;  2KHI A;  4KI0 A;  3MXN B;  3F1Z A;  1IBM L;  1XMQ L;  2UUB Q;  1SRU A;  1QVC A;  1UE5 A;  2A1A A;  2CWA A;  4C3J H;  5LMU L;  4DV3 Q;  1WOC A;  1EQR A;  2JA9 A;  2K5N A;  3G48 A;  4C3H H;  5GAG C;  2I5L X;  2K14 A;  3FP9 A;  4GOP C;  4HJ9 A;  3WWV A;  1EWI A;  4FDB A;  4YY3 Q;  1JMC A;  3HOU H;  1UE7 A;  3TS2 A;  4LFA L;  3CF5 A;  4A75 A;  4AYB E;  2MNA A;  1TWF H;  3PIP A;  5IT9 c;  3UDF A;  2GVA A;  2R7D A;  3PUW A;  4AH6 A;  5FLM G;  4DR7 Q;  2CFM A;  4DV6 Q;  2UUB L;  4XTC S;  4DV3 L;  4IOA A;  1QUQ A;  3TRZ A;  2R6G A;  3S2D H;  2NVX H;  1TWG H;  3UE1 A;  1N33 Q;  3GD7 A;  2UXC L;  1I94 Q;  2Q2I A;  4O0A A;  5EAY A;  4YY3 L;  4JYA Q;  3EN2 A;  1B8A A;  4YWM A;  2OWO A;  2Y0S G;  2R7F A;  2EQS A;  2HQL A;  1OXS C;  2JQO A;  1SN8 A;  4DV6 L;  3OTO Q;  3G6E A;  1K83 H;  3CC4 A;  2ZTE A;  2MO0 A;  1N33 L;  1H95 A;  2UXB Q;  1GVP A;  1E1T A;  5DLQ E;  1I94 L;  4EQ5 A;  3I55 A;  1AH9 A;  4JYA L;  2CWP A;  1RIP A;  4LF4 Q;  1PH6 A;  4A4I A;  1Q81 C;  4JV5 L;  4OO1 G;  2QA4 A;  4A3E G;  3NEM A;  3CME A;  1NY4 A;  2VS1 A;  3OTO L;  2ZTC A;  1X6O A;  1X65 A;  2UXB L;  1PFS A;  1TWH H;  3J81 c;  2GVB A;  2CQO A;  3FKI H;  1JB7 A;  1C7Y A;  1IBL Q;  2UUC Q;  4JBM A;  1L1O C;  4X66 Q;  1U0L A;  4DR3 Q;  3DLL A;  1XJV A;  1P16 A;  3BU2 A;  4LF4 L;  5J3B A;  4GKK Q;  2MO1 A;  1G51 A;  2WFW A;  3BJU A;  2DGY A;  2R93 G;  5E7N A;  5IWA Q;  2BA1 A;  3KFU A;  1AE3 A;  3RZO H;  2UUC L;  3GTG H;  1PH3 A;  2RF4 A;  1QZG A;  1IBL L;  1B7Y B;  3STB C;  4IPC A;  4X66 L;  4DR3 L;  1KL9 A;  3W1B A;  4HJ8 A;  1E1O A;  3AYH B;  4GKK L;  4OWX B;  4OX9 Q;  3HOU G;  1L2F A;  3W1G A;  4LF6 Q;  5IWA L;  2N3S A;  1NTG A;  2PI2 A;  1E22 A;  4HJ5 A;  1X3G A;  1N8R C;  1N32 Q;  4NPS A;  2OQ0 A;  1WJJ A;  2PQA A;  2UXD Q;  5LMN L;  3AEV A;  3KDF B;  4B3T Q;  1S3O A;  5IYD G;  3K8A A;  1TWA H;  2UU9 Q;  4JBJ A;  4LF6 L;  3M85 A;  1YHB A;  2HIV A;  3RZD H;  5IYD H;  4DV4 Q;  1UE6 A;  2OCE A;  2A19 A;  5ELN A;  3HKZ G;  4JI3 Q;  3A5Z B;  1N32 L;  1WCM G;  3RLF A;  1VQD A;  2UXD L;  1HNZ Q;  1WCM H;  2ASB A;  2IHE A;  4X65 Q;  4B3T L;  4WJ3 M;  2PNH A;  1IBK Q;  1CKO A;  1OXT A;  2GN5 A;  1Z47 A;  1Q1E A;  1G29 1;  1YJN A;  1GM5 A;  1FGU A;  2UU9 L;  1X56 A;  4LF5 Q;  4IFD J;  1SRO A;  1M90 C;  4DV4 L;  3AFQ A;  3K0X A;  4B3M Q;  1A63 A;  5GAD C;  4L5Q A;  3KYH C;  3LGJ A;  4JI3 L;  4JI4 Q;  4PZ7 A;  2WAQ E;  4PZ8 A;  4HIO A;  2XGT A;  3I56 A;  3RN2 A;  1HNZ L;  1YBY A;  4X65 L;  3PO2 G;  4A3L G;  2MFI A;  4IJH A;  3TRE A;  1VQN A;  3BZC A;  3PO2 H;  4LF5 L;  4DR4 Q;  3I7F A;  1E3P A;  1L1O A;  1LUZ A;  1X55 A;  3H0G G;  4DR1 Q;  1XNQ Q;  4B3M L;  1BVS A;  1PH7 A;  3CCJ A;  3EBE A;  3H0G H;  4JI4 L;  4KHP L;  2B63 G;  2JA8 G;  2RHS B;  3PO3 G;  4YCW A;  2B63 H;  2JA8 H;  4IJL A;  4LWC A;  2JA7 G;  3KJP A;  5M3F G;  3HOW G;  3PO3 H;  4DUZ Q;  3PGZ A;  1MJC A;  3RLN A;  2Z0S A;  4YWK A;  5M3F H;  3HOW H;  1Q1B A;  1AE2 A;  1KHI A;  1UE1 A;  4RG1 A;  4DR4 L;  4R1J A;  3HOY G;  3E9I A;  4DR1 L;  1XNQ L;  1SLJ A;  1YJW A;  2K5V A;  3CPW A;  1YVC A;  2YTX A;  1SR3 A;  1FJG Q;  3KF6 B;  4A3F G;  4BBS G;  3RLO A;  4C2M H;  2VUM H;  4A3F H;  4BBS H;  1PYS B;  4DUZ L;  3M4P A;  4MZ9 A;  4UP9 A;  2R93 H;  1V1Q A;  3PF4 A;  4DV0 Q;  1A8V A;  2K50 A;  4LNQ A;  1UWV A;  4JI2 Q;  3B6Y A;  1PV4 A;  1JJ2 A;  1HR0 W;  3PV0 A;  4OWW B;  4POF A;  1FJG L;  3DM3 A;  2VZA A;  3U50 C;  1IZ6 A;  2E2J H;  1N34 Q;  5M5W H;  1M1K C;  5FLM H;  4JBK A;  2HHH Q;  1U5K A;  1MJE A;  4UP7 A;  4DR5 Q;  2ES2 A;  4B3R Q;  3NEN A;  4DV0 L;  4GNX C;  1Q7Y C;  3GTP H;  3HOZ G;  3F2C A;  3GTL H;  2OQK A;  1I50 H;  4JI2 L;  3KJO A;  5C0X G;  4LF9 Q;  3HOZ H;  1L0W A;  1BKB A;  5C3E G;  1FVI A;  2JA5 G;  1VQI A;  2NN6 G;  5IP7 G;  4DV7 Q;  1CKM A;  3D31 A;  5IP9 G;  5C3E H;  1N34 L;  2JA5 H;  4DUY Q;  4DR7 L;  2OTJ A;  3F2B A;  1SFO H;  1IL2 A;  5C0X J;  4GLA C;  5IP9 H;  2YYZ A;  2HHH L;  4BXX G;  2NN6 I;  1X3F A;  5GRO A;  5FJ8 G;  1HZB A;  1PH8 A;  4A3B G;  4BXX H;  2RHQ B;  3GTM H;  5FJ8 H;  4TQU S;  1PYB A;  4A3B H;  5JJK A;  4LF9 L;  2B29 A;  3J81 j;  4KHZ A;  4DR6 Q;  2CKZ B;  3S1N H;  2RCN A;  3KLW A;  4RMF A;  4DV7 L;  2JA6 G;  3GTQ H;  1BBU A;  1VQE A;  3MEF A;  4DUY L;  2HT1 A;  1D7Q A;  5H1S E;  4A3E H;  4LUV A;  4KLK A;  1YIT A;  1ASZ A;  4OXP A;  2I5M X;  2JA6 H;  4OO1 I;  2CCZ A;  1VQ5 A;  2R92 G;  3FHW A;  3ULJ A;  3JC6 6;  1G6P A;  2ZTD A;  4R4I A;  4P73 A;  4DR6 L;  3CCM A;  2BH8 A;  3T1H Q;  1VQ8 A;  3K80 C;  1NBW A;  1VQF A;  2K4K A;  2N8N A;  1TWC H;  1LTL A;  2BA0 A;  4A3G G;  3PUV A;  2KCT A;  4DR2 Q;  4A3G H;  1Y1W G;  1LM0 A;  1KIX A;  3TQY A;  2YU9 H;  4JI8 Q;  1KAW A;  1YEZ A;  4X6A H;  3T1H L;  3U58 A;  2AHO B;  2D0P A;  2AWO A;  2WB1 G;  3CC7 A;  4LFC Q;  4OWT B;  4APV A;  1KQS A;  1YJ9 A;  3CCE A;  1LYL A;  2F52 A;  3Q8D A;  4DR2 L;  1VQA A;  2A8V A;  1VQJ A;  1QVF A;  2YTY A;  3PUY A;  4JI8 L;  1VQM A;  1PH4 A;  3ULL A;  1KC8 C;  1RL2 A;  3GTO H;  1YHA A;  2K75 A;  4OX9 L;  2OTL A;  3I2Z A;  4LFC L;  2LSS A;  4UPA A;  4A3C G;  2YTV A;  1JE5 A;  3CMA A;  4GNX A;  2F4V Q;  4WJ4 A;  1VS0 A;  1S40 A;  1VQ7 A;  3S17 H;  4A3C H;  3E9H A;  4LUO A;  4P72 A;  1EFW A;  5M3M G;  5K36 G;  4TVA B;  2PMZ E;  1EQQ A;  1CUK A;  4IFD G;  4PG3 A;  3U4V A;  4AYB G;  4GOP B;  3G71 A;  1C0A A;  1VQK A;  2Q2U A;  3PF5 A;  5HGQ A;  4IOC A;  2QEX A;  4IFD I;  5C4J H;  5IY0 A;  2NZH A;  4DK3 C;  3HOX G;  1W3S A;  4LF7 Q;  2NVQ H;  1K0R A;  3KOJ A;  2F4V L;  2V1C C;  2QGQ A;  2VY3 A;  2B3G A;  3HOX H;  1HNW Q;  1DGS A;  2PQA B;  2LXJ A;  1Q12 A;  1J6Q A;  1CSP A;  1SMX A;  2R7Z G;  3T1Y Q;  4IPH A;  1MKH A;  1FL0 A;  1YNX A;  4JOI C;  3D0F A;  4QIW E;  4QY7 A;  1S72 A;  2R7Z H;  4QJF A;  2HIX A;  4YHH Q;  5GAE C;  3CW2 C;  1IBK L;  3H15 A;  4BBR G;  1HJP A;  2IX1 A;  5LMN W;  4LF7 L;  1VQP A;  1QZH A;  4A3L H;  5HY6 A;  1K8G A;  4HJA A;  1KXL A;  4UY8 C;  1HNW L;  1Q46 A;  1Q86 C;  1CKN B;  1N36 Q;  3GDE A;  1HH2 P;  4J15 A;  1YZ6 A;  1EYG A;  2K52 A;  4DK6 C;  2Q2T A;  1NE3 A;  3CQZ H;  3T1Y L;  2ZJQ A;  3CPF A;  3CCL A;  2UXC Q;  2ZM6 Q;  3ICE A;  2N78 A;  1TXY A;  4YHH L;  2EXD A;  3PUX A;  4XIG S;  3S14 H;  5GQO A;  2JA7 H;  1EUJ A;  1QVG A;  3CC2 A;  5JJL A;  1N36 L;  2JEB I;  3JAM i;  2NZO A;  3VDY A;  5C44 G;  3NBH B;  3HOY H;  4JI5 Q;  3KF6 A;  1KD1 C;  5C44 H;  3J7Z C;  2ZM6 L;  1VQO A;  1E7Z A;  3AFP A;  2NVT H;  4DV2 Q;  2N49 A;  2MQH A;  1L1O B;  1YHQ A;  3S24 A;  1VQ4 A;  2H5X A;  2UUA Q;  3GO5 A;  3I4M G;  3CCQ A;  1Y14 B;  4JI5 L;  1PVO A;  3TS0 A;  4JG2 A;  4QGU A;  3UDG A;  3I4M H;  1ASY A;  3CAM A;  3TEH B;  3PCO B;  4PMW A;  1VCI A;  2L15 A;  3L2P A;  4A3J G;  3HOV G;  3H3V H;  3M4O H;  4DV2 L;  4L5S A;  2JK8 A;  4NXM Q;  4A3J H;  3H3V I;  1HZ9 A;  3HOV H;  4JI0 Q;  1BBW A;  2UUA L;  4JC0 A;  1V43 A;  1XPU A;  2WP8 J;  1P8L A;  4GKJ Q;  1VQG A;  3CXC A;  4DAY B;  1PHJ A;  4ALP A;  3HKZ E;  3J81 i;  1MIU A;  4P75 A;  5C0X I;  2AWN A;  3S1M H;  4HIM A;  1GO3 E;  5IP7 H;  5C4X G;  2E5L Q;  3S2H H;  2IHF A;  3HKS A;  3PIO A;  4DR5 L;  5C4X H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...