1WOCA

Crystal structure of prib
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
99
structure length
99
Chain Sequence
TNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Primosomal replication protein n
publication title Crystal structure of a biologically functional form of PriB from Escherichia coli reveals a potential single-stranded DNA-binding site
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 12
structure length 99
sequence length 99
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1wocA00
3H3VH 1SROA 1ASYA 2ZM6Q 1K0RA 5C44G 4JI4Q 4LFBL 4IPDA 2VQEL 1QUQB 1NBWA 4LUVA 2VY3A 3HOXG 3U58A 3HOWH 4IJHA 3K7AH 4AH6A 4NXML 4WJ3M 3PO3H 1TXYA 1WCMG 1KD1C 3CC4A 1MKHA 1Z47A 3ER0A 2ZM6L 2QEXA 1VQHA 3HKZE 4JI4L 5C4XH 4YY3L 3J80c 1IBLQ 4KLKA 2PNHA 2F3IA 1Y1VH 4IFDJ 3IRBA 2VUMG 4YHHL 1OXTA 2K4KA 3HOVG 3KFUA 1HNWQ 4GLXA 1AE2A 2WAQG 3OYYA 2YTVA 2N3SA 3GTJH 3DLLA 1IL2A 1XMOQ 1IBLL 4OX9L 1CSPA 5IP9G 1MJEA 3FKIG 2UXCL 3U4ZA 4IFDG 3E0EA 1VQMA 4BXXG 2CCZA 4IPHA 4XIGS 1PH4A 4DV1Q 4NB3A 4DV7Q 3F8TA 3HOZH 3PF5A 5ELOA 2OTJA 2GVAA 3PIPA 1P8LA 1B8AA 3CCRA 1XMOL 4BA2I 4OXPA 2ZTDA 2PI2E 4HJAA 5M5XH 4DUYQ 1PHJA 1YEZA 2EXDA 4HJ9A 3HOYH 3CP0A 3CAMA 1U5KA 2B29A 2AHOB 1Z9FA 1EUJA 2IHFA 4DV1L 1QZGA 2YYZA 3RLFA 3M7NA 5C3EH 4DV7L 4B3TL 3G71A 2RCNA 2IX1A 1SE8A 1X54A 2WFWA 2YTYA 3BZCA 1S3OA 1L2FA 2CQOA 1VQCA 4PZ6A 1EIYB 4DUYL 4JBJA 4O2DA 3PIOA 3GTKH 2V1CC 4IPGA 1X3EA 4A76A 2I5HA 4JI3L 1J6QA 4HIKA 1HNZQ 3RN5A 1CKNB 4BY7G 5FLMH 4GS3A 2UUBL 3H0GH 3HOUH 2WAQE 2ASBA 5JJKA 5HGQA 1YHAA 4EQ5A 2E2JH 1KAWA 3UE1A 3HOVH 3STBD 2VNUD 2FXQA 2UXBL 1N33L 1YNXA 4DV3Q 1Q12A 1HZAA 4X64Q 4R4OA 4DAMA 4KHZA 1E7ZA 2ALYB 2BA0A 1X9NA 1SLJA 4P72A 3K7UC 1HNZL 1I50H 3UDXA 2NN6G 3FKIH 4NPSA 1VQBA 1LUZA 2PQAA 2R7DA 1A63A 3F1ZA 1OXXK 2D62A 5LMNW 2C35B 5J3BA 3ICEA 2K50A 2H5XA 1KXLA 1PH7A 3PSIA 4YWLA 3KDFA 1YHQA 2MO1A 4L5SA 4DV3L 1KC8C 1PV4A 1IBKQ 4DR2Q 3PV0A 1IBMQ 1VCIA 2XGTA 3HOWG 2Y0SE 4GOPB 1A8VA 3M9BA 1O7IA 4DNIA 3CF5A 3PO3G 1YIJA 1PA6A 4DK3C 1OTCA 1VQAA 3M4QA 4Y7NH 3D0FA 1JE5A 1K73C 1TWGH 1D7QA 3CCJA 3I2ZA 1L1OA 4JI1Q 5GAHC 1GD7A 4GNXB 1JB7A 5C4XG 4BBRG 2UXDQ 3J81j 2PI2A 4A3IH 5IYCH 1Y1VG 1IBKL 4DR2L 3I4OA 1IBML 1NTGA 3GTOH 3PUZA 1K8GA 3U4VA 5FLXc 3CMEA 2K5VA 1AH9A 3S15H 1TWHH 2WP8J 1HZ9A 3I4MH 4OWXB 2JA7H 4X65Q 5E7NA 1E3PA 4A75A 4OWWB 3S1MH 3CCVA 4LFAQ 2Q2IA 4TVAB 4DV0Q 2UXDL 5DLQE 3KOJA 4HJ5A 1I6HH 3KF8B 2R93H 4HIOA 1QVGA 1HR0Q 3S1NH 3K80C 2RF4A 1VQ5A 1UEBA 2JQOA 2KHIA 1NJIC 4DR1Q 3KF6B 1VQ8A 4DR6Q 1VQIA 4LF6Q 2JA5H 1B7YB 2N8NA 2NVQH 3HOZG 4JBKA 1YBYA 4PMWA 4YWKA 3CXCA 1X3GA 1C7YA 1RL2A 2K52A 3J7A5 4LFAL 1GVPA 4DV0L 4LNQA 3BU2A 3E9HA 2Q2HA 4JOIA 1Q1BA 5GADC 2IT1A 1HR0L 1KRTA 3W5OA 2E2HH 3HOYG 1XMQQ 4DR1L 2WB1E 4DR6L 5IWAL 1JT8A 5C3EG 4JI7Q 1DGSA 1PYBA 4Y52H 1PVOA 1PH5A 3GTPH 1VQPA 3AEVA 3AQQA 1OXUA 4JV5Q 4UP8A 2KBNA 2HT1A 3FHWA 3S17H 2CKZB 1V1QA 3T1YQ 4UP9A 4BBRH 1VQNA 4OONA 5IE8A 5FLMG 4LF9Q 1SFOH 3H0GG 4POFA 3HOUG 3NBHB 4JI5Q 1IYJB 4JI7L 2KCTA 3UE0A 2NN6I 3NENA 1AE3A 3EN2A 3PCOB 1PH6A 4JV5L 4P71A 1HNXQ 3H3VI 2IX0A 4A3EG 4UP7A 2AMCB 1VQ4A 4A3GH 1S72A 3T1YL 1L1OC 2Q2UA 2KENA 3T1HQ 4LUZA 4AIMA 3HKSA 2VZAA 3LGJA 4A4IA 4IOAA 4LF9L 3UDGA 2B3GA 4DV2Q 1E22A 4LWCA 3A5ZB 1WYDA 1WI5A 4JI5L 1YJNA 3I7FA 3VDYA 4ME3A 1HNWL 3NEMA 4A93H 4IPCA 3J7ZC 1HNXL 1Q7YC 2CWPA 4X62Q 4A3LH 1Y14B 1V43A 1J5EQ 3T1HL 2A1AA 2JJQA 2VQFQ 1QUQA 4JI6Q 4DV2L 5C0XJ 2JE6I 5BR8Q 1G51A 4R4CA 3Q8DA 1H95A 3J81i 4LF4Q 4JYAQ 4QIWE 4RG1A 1L0WA 2IY5B 1VQFA 5IYCG 4A3IG 2Z6KA 2KHJA 1J5EL 4C2MH 3PUYA 2VQFL 2PMZE 1YZ6A 2JA8H 2JK8A 4JOIC 4JI6L 3I4MG 5C0XG 5H1SE 2JA7G 4KI0A 1P16A 4LF8Q 2OQ0A 3TS2A 2LSSA 1MIUA 1MJCA 3PUWA 3U50C 5BR8L 2BH8A 4LF4L 4JYAL 2R93G 2EQSA 5IP7H 5M3FH 3GTMH 1VQ7A 4DAYB 3SGIA 3W1BA 5M3MG 1CKMA 1NMGA 1LYLA 4YCVA 2RHSB 1XJVA 1K3RA 4A3EH 2D0PA 1A62A 2JA6H 3AYHB 3JC66 2JA5G 3CCMA 2UUAQ 4HIDA 1A0IA 3EIVA 1BKBA 3L0OA 5FJ8H 4LF8L 3J81c 4BBSH 2E5LQ 3K8AA 2ZTEA 1SN8A 4B3RQ 2AWOA 1V9PA 4APVA 2JEAI 1EQRA 3DM3A 1NY4A 3K0XA 1QVFA 1C9OA 4DV6Q 4C3IH 2R92G 4YWMA 3RLNA 4R4QA 4A3FH 2ZJRA 4X64L 4OO1G 1HH2P 1HJPA 1EYGA 4QL5A 2UUAL 3CD6A 1KL9A 3L7ZC 3RNUA 1BVSA 2YU9H 3M4OH 2E5LL 4QQBX 5LMUQ 4B3RL 1CUKA 3ULPA 4AYBG 2A19A 5LMNQ 1I94Q 1YI2A 4NXNQ 5IYDH 2VS1A 1PFSA 3B6YA 4JI2Q 3PF4A 1XNQQ 1PH1A 5JJLA 4OWTB 3ZJYC 3F2DA 1X55A 2AKWB 1T9HA 4A3KH 3F2BA 3G4SA 4K0KQ 3AFQA 1E1TA 1N36Q 1GKHA 5C4JH 4IOCA 2UU9Q 4IFDI 1IXRA 3UDIA 5LMUL 1VS0A 2BH2A 3H15A 1JJ2A 3A5UA 5LMNL 1EFWA 4A3GG 3E9IA 1K83H 2YTXA 4NXNL 4JI1L 3RZOH 4JI2L 2OWOA 1TWCH 3PUXA 3RLOA 1YJ9A 4RMFA 4JC0A 3CQZH 1XNRQ 4GKJQ 3A74A 2Z6KC 5M3MH 1TWFH 4K0KL 3GD7A 3NELA 5AJ3Q 1X65A 1N36L 4A93G 1Q46A 1X6OA 3HKZG 3OTOQ 4P74A 3S1RH 2ZJQA 4X65L 3GTLH 3F2CA 3PGZA 4A3LG 1CSQA 3TRZA 1QVCA 4DKAC 3ULJA 1GM5A 4JI8Q 2K5NA 3TEHB 1SR3A 1PH8A 4DR3Q 4GOPA 1XNRL 2R92H 1FL0A 1JMCA 4X66Q 4DUZQ 5C0XI 4LF6L 4LF7Q 1RIPA 1LTLA 1Q8KA 5GAEC 2QA4A 4GNXA 4LFBQ 4MZ9A 1G291 5IT9c 2HIVA 2K14A 1VQDA 4JI0Q 4KHPQ 1WJJA 2JA8G 4JI8L 4DR3L 3W1GA 1XMQL 2MO0A 2N49A 3GDEA 4R1JA 2L15A 4X66L 4DV4Q 4L5QA 4HIMA 3M3YH 1UE7A 2DGYA 4LF7L 1G6PA 2HIXA 5IP7G 5M3FG 1IZ6A 5EAYA 1Q82C 3CCUA 4C3HH 3PUVA 5JEAJ 4YY3Q 1Q86C 3TREA 5IYBH 2D0OA 4JI0L 1E1OA 4KHPL 1M1KC 2JA6G 4JCVE 4YHHQ 2RHQB 1K8AC 3G6EA 1HZBA 3KF6A 3BJUA 4GLAC 5FJ8G 5M5WH 4ALPA 4BBSG 4A3CH 2MNAA 4DV4L 3S2DH 4OO1I 2R7FA 2N78A 1KRSA 1LM0A 5JEAG 4DV5Q 2B63G 1YJWA 1SRUA 4OX9Q 1VQKA 2UXCQ 4A3FG 1CKOA 1N34Q 1N32Q 2EIFA 2DUDA 3MEFA 2ZJPA 3STBC 4A3BH 4MNOA 4A3MH 3I56A 5K36G 1Q1EA 1I5FA 4A3DG 4JBMA 3RN2A 2ES2A 1VQEA 1UE1A 3RZDH 1XPOA 4B3SQ 5ELNA 1WFQA 4LW1A 2F52A 4BA1I 2I0QA 4DV5L 1VQGA 5IYDG 4AQYQ 1XPRA 1KIXA 1VQ6A 2K5HA 1FGUA 2XTIA 3S16H 1N9WA 1QZHA 4X62L 2R6GA 1N34L 1VQ9A 2ZTCA 4O0AA 1N32L 4GKKQ 2I5LX 2VW9A 3MXNB 3KYHC 4TQUS 3KJOA 4IO9A 4A3KG 1EOVA 1PYSB 2VL6A 5HY6A 4GN3B 4A3JH 4BY1H 3M4PA 4B3TQ 3PO2H 2PQAB 2BA1A 1B70B 4GLVB 3CPWA 1UE5A 4GOPC 5GROA 1XTDA 4B3SL 4QGUA 4AQYL 2R7ZH 3I4NG 4DR5Q 3KDFB 5IY0A 5C44H 1SMXA 2Y0SG 5GQOA 3BZKA 4GNXC 3D31A 4JI3Q 4LFCQ 4GKKL 2AWNA 3WWVA 1C0AA 4UPAA 2HHHQ 2UUBQ 1EQQA 2ATWA 3KLWA 3I55A 4XTCS 3HOXH 1OXVA 1X56A 1KHIA 2YV5A 3S2HH 1OXSC 2MFIA 1L1OB 1E24A 2Q2TA 1N33Q 2QGQA 2UXBQ 1WCMH 1I3QH 4DR5L 1VQOA 3UDFA 1ASZA 3A0JA 4DK6C 1PH2A 1S40A 1Y1WG 3L2PA 2I5MX 2B63H 4LFCL 4YCWA 2CWAA 3CCQA 2NVYH 2HQLA 2MQHA 4MTNA 2NVTH 1JJGA 4L5TA 3GTGH 2HHHL 1YHBA 2VUMH 3CCLA 2LXJA 1FVIA 4P73A 4QY7A 2UUCQ 5JJIA 4A3DH 1N8RC 4PZ8A 4LF5Q 1UE6A 4HJ8A 1VQJA 4LUOA 2GVBA 4IJLA 4PG3A 2CFMA 2IHEA 4DV6L 5IP9H 3HFZB 4L5RC 2F4VQ 1X3FA 4X6AH 4GN5A 1XPUA 4BXXH 1CKNA 4POGA 4J15A 2UUCL 1W2BA 4C3JH 1D8LA 2NVXH 4FDBA 5IYBG 4UY8C 3K81C 4H02A 2E8GA 1YVCA 2NZOA 4LF5L 1I94L 3CCEA 4HJ7A 4WJ4A 3FP9A 3AFPA 2LXKA 3ULLA 2E2IH 4JG2A 5GAGC 3I4NH 2WB1G 1NE3A 4PZ7A 1EWIA 3CC2A 1XNQL 4GN4B 4YCUA 1PH9A 4JBWA 4A3CG 3M85A 2F4VL 3S14H 3JAMi 3RR5A 3GO5A 1EIFA 1FJGQ 2UU9L 3EBEA 3CPFA 3S24A 1HR0W 4DR7Q 2NZHA 3OW2A 4DR4Q 3KJPA 2GN5A 4A3BG 4A3MG 1R9TH 3TS0A 1BBWA 2Z0SA 1UWVA 1VQLA 2JEBI 1Y1WH 4GKJL 1GO3E 3CW2C 1TWAH 4B3MQ 4BY7H 1FJGL 3TQYA 2KCMA 4P75A 4DPGA 5AJ3L 4QJFA 5M5YH 1WOCA 2K75A 3OTOL 4DR7L 1NMFA 4AYBE 1K9MC 4DR4L 2OCEA 3CCSA 3J80i 2ID0A 4R4TA 2VQEQ 1PH3A 5IWAQ 3S1QH 3ERSX 2OQKA 3CC7A 4A3JG 1HZCA 2JA9A 1U0LA 1KQSA 4BY1G 2OTLA 3CMAA 3JAMc 3PO2G 1M90C 4NXMQ 1W3SA 1Q81C 3G48A 4B3ML 3GTQH 1JJCB 1BBUA 2R7ZG 4DUZL 1YITA 2A8VA 4R4IA 4EX5A
chains in the Genus database with same CATH superfamily
4JI4Q 1HPCA 2WKCA 4MTKA 4LFBL 4DNRB 1D5ZC 1U4LA 4OIJA 1QUQB 2WIIB 4KD4A 4LUVA 3U58A 4PMBA 3E6ZX 3K7AH 3IKJA 1WCMG 3CC4A 5G3LD 1Z47A 4WRDA 2ZM6L 1BCPB 1Y1VH 2EE1A 3IRBA 1PDQA 3P1HA 1OXTA 3S2DB 3HOVG 4RWSC 1HUNA 3OYYA 2B2WA 4KY5A 3NTHA 1IL2A 1XMOQ 2BE5D 4OX9L 5IP9G 2UXCL 4IFDG 1VMCA 3P75A 3VR3A 4IPHA 3LX0A 4DV1Q 3FMCA 1LO5D 3D6CA 4DV7Q 1B9NA 3PF5A 3PIPA 1BBXC 1B8AA 3CCRA 2Z4HA 4OXPA 2ZTDA 2PI2E 3TZDA 1PHJA 2G5DA 1AZPA 1YEZA 3HOYH 4A3JB 5A2QE 3HOZB 3MFYA 5C3EH 1NCVA 1ENAA 2RCNA 2IX1A 3SK8A 1F77A 3K5LA 3BZCA 3S9WA 3V96A 2V1CC 4A76A 2I5HA 4CGYB 3RN5A 4BY7G 2A5HA 4ZCKA 1G2TA 2VNUD 4ZKCB 2A6HD 3STBD 5LHY1 1PTOC 3GTKB 1N33L 3HZXA 1YNXA 1Q12A 1TR5A 4X64Q 3DUZA 4KHZA 2PMZB 2NVTB 1E7ZA 1SLJA 2NN6G 2E2JB 3SE0A 1K3BC 1EWHA 2TSSA 3ICEA 2K50A 3KDFA 4DV3L 1X3QA 1VCIA 1I50B 2E74C 2Y0SE 3R93A 1ZXTA 1QOHA 1PA6A 3MXGA 1JE5A 1K73C 1ET9A 3I2ZA 3OIQA 5JVH3 2M00A 2UXDQ 2PI2A 1Y1VG 1IBKL 4B9XA 1IBML 1A3UA 3CMEA 5FLXc 2K5VA 1XX8A 2B2UC 2VB3X 4OWXB 3VYUA 4F88A 5C0XH 1PTOH 5E7NA 1WTHA 3K58A 4A75A 3CCVA 4LFAQ 2Q2IA 3OHXC 5CC4A 3GTOB 1QVGA 1S5FD 1D6EC 1TT2A 1UEBA 2JQOA 3I4MB 4DR6Q 1VQIA 1K0SA 1VF5C 2N8NA 1TWAB 3NK9A 4BS9A 3S1MB 3CXCA 2R93B 2KEDA 1KDBA 3CRKC 3J7A5 1DZ1A 5GADC 4DXFA 4FP5D 3HOYG 3TBIB 1ILQA 2WB1E 1PTOF 5C3EG 3TSSA 1LTID 4IURA 1PH5A 1VQPA 1YNND 5DNFA 2J4XA 3K5NA 1WTVA 2PW5A 3FHWA 2CKZB 2E76C 4UP9A 4BBRH 3V2TA 1ESRA 4PV1C 1GHJA 4ME5A 2B8FA 1SFOH 4POFA 4JI5Q 1IYJB 4CKEA 3UE0A 3PO3B 4JV5L 1AE3A 2KECA 3EN2A 4K6LA 1PH6A 3DEOA 1JORA 2LY7A 3H3VI 1DXMA 2IX0A 1CI3M 1VQ4A 3Q24A 2QCPX 2JXMB 1STGA 3UDGA 4LAAA 3A5ZB 4L63B 1YJNA 1WI5A 4ME3A 3NEMA 4IPCA 2CWPA 4B08A 1HA6A 3DWAA 2EYOA 4JI6Q 5IT9L 2JYOA 2JE6I 5BR8Q 3C2PA 3Q8DA 4A93B 2D9UA 2F0HA 4LF4Q 4JYAQ 2B2YA 2Z6KA 2E2DC 5M5XB 2R3ZA 1UUPA 4G7OC 1J5EL 4C2MH 3PUYA 2VQFL 3DM1A 3TDQA 2JA8H 1FNWA 2JK8A 2PPBC 5C0XG 5H1SE 1CQFA 1MIUA 3PUWA 3KUPA 3MHBA 3FPPA 5IP7H 1BXTA 1NMGA 1XJVA 5TSSA 3Q23A 3MXUA 1XTCD 2D0PA 1A62A 2L4NA 3AYHB 4A3EH 2UUAQ 2JA6H 3MAQA 1A0IA 4LF8L 4BBSH 3H0GB 2E5LQ 3K8AA 3HOUB 2ZTEA 5M3FB 1SN8A 4B3RQ 3U9SA 2AWOA 4APVA 4HCSA 3DM3A 5JEAH 3K0XA 4DV6Q 1AN8A 1EOTA 1HH2P 2KJXA 1EYGA 1KL9A 1QB5D 1A2UA 1ONLA 1PRTB 4XXEA 5CBEE 1SYEA 1TY0A 1PH1A 2KVMA 1JE4A 3ZJYC 2Q8IB 4HCEA 1HCZA 1EEFD 3AFQA 1PFBA 1U4MA 3MA2B 1GKHA 3G4SA 4K0KQ 2UU9Q 1HXYD 3A5UA 5LMNL 1K83H 3H3VC 3HP3A 3A74A 2B2TC 3GD7A 1N36L 4QUCA 1SJHD 1Q46A 2ZJQA 1O80A 3S1RH 4X65L 3F2CA 1LLRD 1MBYA 2Y0SB 1GM5A 2ZXPA 3TEHB 4GOPA 4DN4M 1FL0A 3N6RA 2BE5C 3VR5A 2JA5B 5CV6A 2NVQB 1U4PA 5GAEC 2QA4A 4LFBQ 4MZ9A 1BDOA 2HIVA 1VQDA 4JI0Q 2JA8G 1XMQL 3A7AB 3IFDA 2H1EA 1UE7A 5IP7G 1Q86C 2A74C 1CHQD 4AYBB 1G2SA 2K5WA 1E1OA 5FK9C 2JA6G 1SNMA 3G6EA 3BJUA 4ALPA 4ZQ3A 4BBSG 3SXHA 2MNAA 4DV4L 1PFNA 4DGZA 4OO1I 4FXGC 4C3HB 2L1BA 1LM0A 5JEAG 2B63G 2G9HD 1YJWA 2K28A 4OX9Q 4A3GB 3K5OA 1O7YA 2UXCQ 1CKOA 2WB1B 2XNAC 3MEFA 3I8ZA 2A6HC 3STBC 5I9PA 4MNOA 4A3BH 2EPBA 2CH4A 4CDCC 4JBMA 3RN2A 1XPOA 4B3SQ 5G3LF 1RHPA 2K7VA 4DV5L 1VQGA 5E4XA 2WKDA 4IUPA 5EBCA 1KLUD 2XTIA 4X62L 2R6GA 1N32L 2ZTCA 4O0AA 3KYHC 2KQ3A 4UHVA 3NBHA 3CPWA 3L9AX 5GROA 3S16B 2R7ZH 3I4NG 4DR5Q 3D3RA 5C44H 1SMXA 2C9OA 4LFCQ 4Q5VA 2NB0A 5HGTA 3L3OC 1C0AA 4UPAA 4FNFA 1KHIA 3S2HH 2MFIA 1L1OB 1E24A 1N33Q 3J81E 1VQOA 2KCNA 3UDFA 3A0JA 4G7HC 1HRJA 3L2PA 4YCWA 2CWAA 2NVYH 2HQLA 2MQHA 4F8MA 1TS5A 3A7LA 3GTGH 2EXZA 3BVMA 2PQEA 2VUMH 4ABNA 1SAPA 1I3QB 2PYKA 4A3DH 5JJIA 1IKMA 1S5BD 3C3LA 1UE6A 1JWSD 1X3PA 2GVBA 3PQIA 4LUOA 2CFMA 3HFZB 4HSPA 1ML0D 5C4ZA 3DEPA 4XDXA 1XPUA 3M7GA 1AZQA 2NUCA 1CKNA 1M8AA 2IWHA 2F0DA 4DAYA 4JG2A 5GAGC 1YNNC 1NE3A 4PZ7A 4YCUA 4JBWA 5NUCA 5D3DA 3M85A 2F4VL 2QILA 3S14H 3JAMi 4R8NA 3FEWX 3CHBD 1EY4A 3A8KE 2K04A 4DR4Q 4N9TA 4A3BG 3FDTA 1D5XC 2HCCA 3CQZB 5K5PA 1UWVA 1TVXA 1QG7A 5CV9A 3DMUA 2AQ2B 3W3AA 3U9OA 4DNTB 3S1QH 2EJMA 3J80i 2VQEQ 2XN9C 1Y1WB 3ERSX 2OQKA 3OSOA 1O7ZA 1SE3A 1NSNS 4BY7B 5J39A 4B3ML 5DEHA 3GTQH 2R7ZG 1VQ6A 1YITA 2A8VA 1IL8A 1SROA 5C44G 4U68A 1HFGA 2D2CC 1NBWA 3HOWH 3J7AV 5CBAE 2EYJA 1TXYA 1KD1C 4G57A 3SVMA 4IQZA 5C4XH 5BN5A 4YY3L 1BCPD 4DXGA 1IBLQ 4KLKA 2PNHA 2O5IC 2F0JA 3P7JA 4IFDJ 3K7AB 2VUMG 4YHHL 4PQXA 1AE2A 2PZTA 4I7AA 2L9HA 2YTVA 3DLLA 1A2TA 2K33A 4ZK9B 2MPMA 3FKIG 3EROA 3U4ZA 4CDEC 1LTAD 3E0EA 1VQMA 4KJNA 1KDAA 2CCZA 4XIGS 1D1IA 3RZDB 4NB3A 5LL6S 2WACA 4KTAA 1ZKOA 4R9WA 5ELOA 2KOLA 2AQ1B 2B2UA 2A68D 4DUYQ 1H9SA 2O4XA 2EXDA 1BO0A 3CP0A 3CAMA 1U5KA 2B29A 2FMCA 2IHFA 4S3SA 4KK7A 2O2LD 1EY0A 4B3TL 1DJRD 1X54A 2KCCA 1I4QA 1L2FA 4JW0A 3BYYB 2HUGA 3TP6A 4HMJA 4JBJA 4O2DA 3PIOA 2O5JC 3SEBA 2F0MA 4JI3L 4HIKA 1CKNB 3M4YA 5KNCA 2ASBA 4EQ5A 3HOVH 3I4LA 3UE1A 3V05A 3BS1A 1JOOA 1ICWA 2VXWA 4J6HA 3BYTB 4N8X1 3MXNA 1B2TA 2ALYB 2E75C 1X9NA 4RGOS 2Q8TA 4P72A 3K7UC 2EYFA 1HNZL 2HQEA 3AB9A 3R3OA 3TZUA 2PQAA 2R7DA 1OXXK 5CV7A 2HDMA 2H5XA 3QOLA 1SYCA 2V4DA 3PSIA 1YHQA 4L5SA 3A55A 1KC8C 1PV4A 3HOWG 1YIJA 4DK3C 1VQAA 3CCJA 1R4PB 4GNXB 1STBA 2QF7A 4HMIA 1JB7A 1OO9B 1KNEA 1C8CA 3K59A 5C4XG 1H9JA 4DR2L 2EY1A 1NTGA 1LV9A 1BOSA 4V0BA 1H9RA 1HZ9A 2JA7H 3SK5A 4X65Q 1E3PA 2F0PA 4TVAB 4DV0Q 1I6HH 1EIGA 4K8JA 1EZ8A 1HHVA 4HIOA 3S1NH 3K80C 2RF4A 5F2DA 4TRDA 1R9TB 1VQ5A 4DR1Q 3KF6B 1LTTD 1IYUA 5IGCA 4UDUC 3K0YA 2L5TA 4YWKA 4PMWA 1X3GA 2K52A 4LNQA 4DA2A 3E9HA 2Q2HA 1Q1BA 2IT1A 1HR0L 2KHSA 3DWPA 1XMQQ 3FVQA 5IWAL 1JT8A 2IPKD 3MFGA 1DGSA 4JI7Q 1K28A 1PVOA 3GTPH 3AEVA 1OXUA 5JJZA 4UP8A 4ODGA 3T13A 3O13A 1H9MA 5IE8A 5C5LA 5JAVA 2K03A 4K14A 3SR1A 1CK1A 1ICFB 2JP1A 2C5CA 3BDOA 1AFPA 1IHZA 4BBRB 5ELEA 2NZ1D 3T1YL 4CJ2C 2KENA 3T1HQ 4AIMA 1SFOB 3LGJA 4A4IA 4LF9L 1EY9A 4DV2Q 1RODA 3LWEA 1E22A 1CT1D 2MHVA 3ND9A 3R8BA 3VDYA 1HNWL 1HNXL 1Y69U 4X62Q 1HFNA 1SYGA 2Q8RE 5CR3A 4NMZA 2A1AA 1EY7A 4NP5A 1ENCA 5C0XJ 1G51A 3J81i 1EZ6A 2F03A 1SMYD 1LT5D 2EY6A 2X6GA 4C1NK 1VQFA 1FYCA 4KN4C 3VYRA 5KNDA 4JOIC 1C48A 2JA7G 1P16A 3G7LA 2LSSA 3RD4A 1V1PB 3U50C 4PNYA 2RBMA 2X69A 4GZYC 2EQSA 4ZKBB 3W1BA 5M3MG 4C2MB 3E5SA 2MUYA 4Q0FA 4FF3A 1K8MA 1LYLA 2RHSB 1TS2A 2CW0D 3JC66 3CCMA 1I4RA 4HIDA 1BKBA 5FJ8H 1BR9A 1B1ZA 2RCFA 4PMCA 1V9PA 1NY4A 1QVFA 3TP5A 4C3IH 4UAIA 4A3EB 2R92G 2JA6B 2ZJRA 4QL5A 2WV6D 3KLRA 1PRTD 2YU9H 1B53A 2XIWA 4QQBX 5LMUQ 1CUKA 4M8AA 3ULPA 2A19A 4NXNQ 5IYDH 4CBVA 4OWTB 3BVZA 4A3KH 1HUMA 5A2QL 3F2BA 3AMUA 1E1TA 4Y7NB 5C4JH 1TWGB 1IXRA 3X3NA 4KY6A 5FLXE 4OIKA 3PIP3 1JJ2A 4L8JA 3RZOH 1TQOA 4JI1L 4JI2L 2OWOA 4A3IB 1HQMC 3PUXA 1YJ9A 1XNRQ 1TWFH 1BCPC 5IOCA 1K83B 1X6OA 3HKZG 1CSQA 3JAME 4JI8Q 1SR3A 1PH8A 4JPBW 3X3MA 1WTXA 4LF6L 5IGFA 1LTLA 1Q8KA 1JC7A 5IT9c 4G7ZC 4KHPQ 1WJJA 3EQLC 2E2HB 4DR3L 2FINB 4HSVA 3W1GA 2MO0A 2EY2A 2N49A 5ELFA 2A68C 4X66L 1D2BA 4RKBA 4HIMA 3J80E 3D6WA 3M3YH 4LF7L 1G6PA 5KYIA 1IZ6A 1M4VA 1Q82C 3PUVA 5JEAJ 4YY3Q 1G91A 2A6ED 3VR4A 3S17B 3TREA 2FMMA 3KF8A 4LMQD 4RH6A 1M1KC 4YHHQ 1K8AC 5FJ8G 5M5WH 4A3CH 3S2DH 3BDCA 3WOEA 4KKSA 2R7FA 3D4WA 1CQVA 1VDZA 2F0QA 3H91A 1WD1A 4C3IG 1SRUA 3I91A 3EFXD 1FNVA 1I5FA 4DF7A 3QO2A 4BA1I 2I0QA 2OF1A 5IYDG 1XPRA 3JAML 3FRPB 1N34L 2I5LX 2VW9A 3C1FA 4IO9A 4A3KG 1YNJD 5HY6A 4A3JH 4BY1H 3M4PA 4B3TQ 4RCOA 1B70B 4GLVB 1XTDA 2DNCA 4AQYL 3KDFB 4OHJA 4JI3Q 3D31A 4GKKL 4QB4A 2HHHQ 1EQQA 3J80L 5EQ0A 3HOXH 1X56A 2R7ZB 1OXSC 4KHVA 2Q2TA 1S5DD 5CV4A 1PH2A 4CJ1B 4NDXA 1S40A 2B63H 5C3WA 2NVTH 1JJGA 4L5TA 5BN3A 3S2HB 4QY7A 1FVIA 4P73A 2UUCQ 2F0GA 3LNNA 3QJYA 4PZ8A 4QMGA 4LF5Q 3IAYA 4EQNA 1F2ZA 2A69D 3WOFA 2IHEA 3GTGB 5KIXA 2VUMB 4GN5A 4K5XA 4BXXH 2F0OA 4A3DB 5ELBA 4POGA 5T1IA 1W2BA 4C3JH 1D8LA 2NVXH 4FDBA 3C46A 3I70A 1NR2A 4CDDC 2B39A 1YVCA 1WVLA 4HJ7A 3FP9A 2BOSA 2LXKA 4ZUIA 2E2IH 1X32A 3I4NH 1KNAA 1XNQL 4A3CG 2RSOA 3OWEB 4XQQA 3T56B 1JCKB 5I4DA 4X3UA 1EIFA 1FJGQ 1SNPA 2QW7A 3KLSA 2NZHA 3OW2A 1NR4A 3KJPA 2GN5A 1BBWA 2Z0SA 5D14A 3S14B 2OXPA 4JK1C 1F2LA 1GO3E 1TWAH 3ZYYX 1GUGA 3TQYA 2KCMA 4MHEA 4DPGA 5AJ3L 5CORA 3GTLB 1WOCA 3OTOL 4DR7L 1SJED 3CCSA 4R4TA 3NWTA 5IWAQ 2OTLA 4A3JG 1HZCA 1GOZA 1U0LA 1KQSA 4BY1G 1DYQA 1GJXA 3UI2A 1M90C 1I4GA 3G48A 1JJCB 4RGTA 4EX5A 3PF4A 3H3VH 2B2VA 2ZM6Q 1K0RA 1KDCA 4FVMA 3S1QB 2F1MA 2N55A 1SMYC 2A73B 3MXPA 3HOXG 1QWYA 4IJHA 5I2XA 4NXML 4WJ3M 3PO3H 1LABA 1A3TA 1S5CD 2QEXA 1VQHA 3HKZE 4JI4L 1F9PA 2DY8A 1R4QB 2F3IA 4LJZC 2PZWA 1HNWQ 4GLXA 1U9RA 3E3XA 2CW0C 4XT3B 3OWFA 1EIHA 2ENBA 3GTJH 1RTNA 2L55A 5FO8B 1CSPA 1B4OA 3CRLC 2NYZD 2HCIA 1LT6D 4BXXG 3I90A 1EY6A 2DY7A 5DAUA 4C3JG 2RA4A 4KMUC 1SNOA 2OTJA 3D8GA 1PZID 1XMOL 1JICA 1PRTC 5C6AA 5M5XH 3K5MA 3I73A 1MGSA 3TP8A 2AHOB 2RVLA 3KBGA 3VR6A 4DV1L 3RLFA 4OGQC 4DV7L 1TIID 4FF2A 4YIJA 3H6MA 4ZLTF 2WFWA 2I46A 1S3OA 2Z4IA 2CQOA 5KGUA 1WTOA 2F0TA 3GQBA 4PZ6A 5IIFA 1EIYB 1LACA 4EVOA 1J6QA 5CYUA 2UUBL 3GV3A 4K2KA 4F7XA 3H0GH 2XVSA 2WAQE 3HOUH 5JJKA 1QCBD 5HGQA 1YHAA 1WCMB 1H9KA 2NTTA 1FNUA 2UXBL 3ONAB 4DV3Q 1QNUA 3NTIA 2LKVA 4R4OA 4DAMA 5JPMC 3UDXA 1GUSA 2ICEC 3FKIH 4NPSA 1LUZA 1CFMA 3HOVB 1A63A 5C5MA 3F1ZA 5LMNW 1SYDA 2C35B 1WTPA 2BCOA 1GUWA 1KXLA 1PH7A 4YWLA 2RDGA 1G8ZD 2MO1A 1IBKQ 3PV0A 1IBMQ 2XGTA 2RDHA 4GOPB 1A8VA 2PNRC 3NPPA 3PO3G 4FF4A 1W6KA 2OEOA 3OPOA 1D7QA 1UAPA 4JI1Q 5GAHC 3SHLA 3QG1A 2PZUA 2A6EC 1K8GA 1GUOA 1TWHH 2WP8J 3S15H 3D4DA 4QCLA 2L0CA 2QDLA 2LMCB 3W2DA 1SNDA 1JWMD 2UXDL 5DLQE 4KN7C 5HURA 3J81L 4HJ5A 2RKSA 4CDFC 2RDFA 1NJIC 4FXKC 2JA7B 4LF6Q 2JA5H 1RD9D 4I7ZC 2NVQH 3J7AF 4JBKA 1I6HB 5M5YB 4LFAL 1GVPA 3S1NB 3A8JE 3BU2A 4JOIA 1KRTA 4CHTB 1XWEA 4DR6L 4OO1H 3J7YW 4Y52H 4JV5Q 3AQQA 3NQTA 1RKNA 1YNJC 1WTRA 2HT1A 1VQNA 4DAVA 2CH4W 2WINB 3H94A 1JOKA 4KKUA 4ZUJA 4NKLA 3GTPB 1ET6A 3H0GG 3HOUG 3NBHB 1JR0D 2KCTA 2Z9HA 2NN6I 3NENA 5CMDA 4P71A 4NW2A 4A3GH 2Q2UA 1L1OC 2PO4A 1Y1VB 4IOAA 2B3GA 2MJ8A 1LTGD 3ND8A 3T16A 2AQ3B 4JI5L 5IGGA 3K57A 3J7ZC 2F3WA 5EJWA 1V43A 1J5EQ 2VQFQ 2K1BA 1ZEQX 1QUQA 1MI2A 2K01A 4FXDA 2A69C 1QE6A 2I07B 3D4RA 4RG1A 4RCNA 1L0WA 2CHBD 3OOCA 4KV6A 1D5MC 2PMZE 3HOYB 4FYDA 4JI6L 3EA6A 4KI0A 4LF8Q 3TS2A 4ZAIA 4E6IA 5BR8L 3VYTA 5C3EB 4LF4L 4JYAL 1TS3A 3TN2A 3GTMH 1VQ7A 1SBBB 4DAYB 1TY2A 4YCVA 1K3RA 4H7BA 2JA5G 1DM0B 2M2LA 1RTOA 2XSCA 3EIVA 4RHRA 3L0OA 2F0KA 5EKKA 1C9OA 3HEJA 4R4QA 4A3FH 3F2UA 4OO1G 1JOQA 1HJPA 2UUAL 2ZXOA 3RNUA 1BVSA 3MZ5A 4J1MA 3M4OH 2E5LL 4B3RL 4AYBG 4C3IB 5LMNQ 1YI2A 2VS1A 5JJLA 1XNQQ 3RMHA 1RJTA 1WTQA 3NSWA 1WD0A 4HN7A 1N36Q 4IOCA 3UDIA 1VS0A 4A3GG 4KKTA 1FGBD 3E9IA 2YTXA 3KK7A 2SOBA 5ISRA 4HTHA 2FHTA 1TWCH 3I72A 3RLOA 4JC0A 3CQZH 4A3KB 1SXTA 5M3MH 1KAAA 5C4JB 2F0FA 4K0KL 3NELA 5AJ3Q 1PTOB 1X65A 1Y8OB 1TS4A 3RZOB 3OTOQ 1Z6HA 2DJGC 1CHPD 5E3FA 2EJFC 1SYBA 5LL6X 3ULJA 4KD3A 3A8IE 2K5NA 1TWFB 1I6VC 2R92H 1JMCA 4IN3A 2F0VA 5C0XI 5FKAC 1BUVT 1CTMA 3NBIA 3QOJA 4K5VA 5EPJA 4ZYSA 2BDNA 4DV4Q 4R1JA 2L15A 2EJGC 2HIXA 3Q6SA 3CCUA 2XWBB 5IYBH 4JI0L 3DWQA 1H9SB 2RHQB 1EU3A 2DN8A 1HZBA 5JVG3 5J22A 3M3YB 4K6DA 1DD2A 3H09A 1KRSA 4L6TB 1EEID 3IL8A 2Z8LA 4DV5Q 3T4AC 3OMCA 4X3TA 4A3FG 1N32Q 2EIFA 2FJ2A 5M5WB 3BZDB 4A3MH 5K36G 1MSGA 4ID6A 1Z7TA 1VQEA 1UE1A 3RZDH 2ES2A 5EBDA 2EYPA 1WFQA 4LW1A 4XYQA 1FGUA 4XQNA 1VQ9A 2B2TA 2F0SA 3MXNB 5DM73 3KJOA 1B44D 4ILWA 3PO2H 2PQAB 2BA1A 4B3SL 1AEXA 1DCZA 4QGUA 3N52A 1EYCA 2IL8A 2DNEA 4RGNA 5GQOA 3BZKA 4GNXC 2DJFC 1EYDA 5D65A 2JA8B 3R2TA 2QKIC 4BY1B 4K2LA 2UUBQ 2ATWA 3KLWA 3I55A 1E2ZA 2YV5A 3NWSA 5EKIA 2IX3A 1RF2D 5FOBB 2UXBQ 2QGQA 3OIPA 4DR5L 1ASZA 2K5DA 3Q0AA 1Y1WG 3TP7A 4LFCL 3CCQA 3URYA 4WFN3 3HOXB 1STHA 1LT4D 4RHSA 2J0TD 1PYWD 4BBSB 2EOTA 1MHWC 3HS0C 1N8RC 4TSSA 4HJ8A 2B63B 1VQJA 4PG3A 2R61A 4G4KA 4X3KA 2F4VQ 1X3FA 1IYVA 2LFNA 2X6LA 1ZYRD 3Q22A 4J15A 3VYSA 4HR7B 5IYBG 4F87A 4H02A 1A3VA 2E8GA 2NZOA 4XYOA 1I94L 4WJ4A 1C4QA 3ULLA 5EPLA 1G6ZA 1CM9A 1J8IA 1GHKA 4C3JB 2NVXB 3K6OA 1SE2A 3RR5A 3MVVA 4MN3A 3CPFA 1HR0W 2E2IB 3I4NB 3I3CA 2EY5A 1TKWB 1VF7A 4A3MG 1E2VA 2RQXA 1I4XA 3TS0A 1R9TH 3ERQA 3CU7A 1VQLA 2JN4A 4GKJL 1LTBD 1UNSA 2QDBA 4B3MQ 2ICIA 4P75A 3S1RB 2XRQD 2K75A 2K05A 1NMFA 4AYBE 4DR4L 4I65A 2ID0A 1PH3A 1NUCA 3CC7A 1AP0A 2Z6BA 5IT9E 1NAPA 3JAMc 3PO2G 3BG3A 2Z1CA 5I2YA 1W3SA 4IUQA 4EQOA 2IY5B 4DUZL 4IUNA 4H13C 1ASYA 2L12A 4IPDA 4K5WA 1Y8PB 2VQEL 5CGKA 1Q8IA 4OELB 2VY3A 1F9RA 1S5ED 4AH6A 3KLSX 2PW7A 1FR3A 2N88A 4M1UB 4QUFA 5FLXL 1MKHA 4H0LC 4N9PA 3ER0A 2FFKB 1BF4A 2J7ZA 3J80c 1ESFA 5E4WC 2F4IA 1Q3LA 2K4KA 3KFUA 1IW7D 5KRUA 2WAQG 1DOMA 4TKOB 5JOBA 4XQJA 1JQYD 2N3SA 4P2CB 1O7LA 5ELDA 1IBLL 1BCPF 1F2MA 1MJEA 2AUJD 3DXJC 2GA4B 4A3BB 4N8FA 5KNBA 1PH4A 5T1GA 3GTJB 3F8TA 3HOZH 4V190 1EU4A 2GVAA 1P8LA 5I6YA 4BA2I 1GUNA 4HJAA 5IGDA 1KTKA 4HJ9A 2EYHA 1Z9FA 1EUJA 1I4HA 1QZGA 2YYZA 3M7NA 3G71A 1SE8A 2YTYA 1E2WA 1LT3D 3KBXA 3RUZA 1VQCA 5C44B 4C1NI 4DUYL 3GTKH 3CKIB 1X3EA 4IPGA 3NQIA 4MIUA 3SK4A 1HNZQ 1L0XB 5FLMH 2EDGA 4GS3A 2E2JH 1F2YA 1KAWA 2FXQA 2AUKA 1HZAA 1SNCA 1DOLA 2NVYB 2BA0A 1Q90A 2NBFA 1I50H 3QWNA 1VQBA 5DM63 2D62A 1CA6A 4K8IA 5J3BA 5EGTA 4LK1C 2K6AA 3SK6A 2B2WC 4DR2Q 3SDZA 3FKIB 3M9BA 1O7IA 3HGBA 4DNIA 3CF5A 1PZJD 1OTCA 4Y7NH 3M4QA 2SNSA 3D0FA 1EYAA 1TWGH 1L1OA 3IFTA 1GD7A 4BBRG 1B50A 1NNXA 3J81j 4A3IH 5IYCH 1ENFA 3LWUA 3I4OA 3GTOH 3PUZA 1MD2D 3U4VA 1AH9A 1PFMA 3EVQA 3I4MH 1MSHA 3C1EA 1U4RA 1J9OA 4HAEA 4OWWB 4IUTA 3S1MH 4CKBA 5A35A 2R93H 1SNQA 1B3QA 3KOJA 3KF8B 1HR0Q 2NTSA 1EWCA 3S15B 1TWHB 2KHIA 4CKCA 1VQ8A 4BWGB 1B7YB 3HOZG 1YBYA 1C7YA 4DU9A 1WTWA 1EL0A 1RL2A 4QF4A 4DV0L 1EFID 3NXWA 1W6JA 3W5OA 2E2HH 3EJIA 4H44C 2KUMA 5EKLA 2HD3A 4DR1L 1LTSD 4ZRZA 4DK1A 1PYBA 1T5XD 3GTQB 1HTLD 1PXUA 3WDNA 2H4OA 4RKLA 4FF1A 2KBNA 3S17H 1STAA 1GXDC 1V1QA 3T1YQ 1HQRD 4OONA 4LF9Q 1CZGA 5FLMG 3HOWB 4JI7L 3PCOB 2IJ0A 1HNXQ 1F9SA 4A3EG 4UP7A 2AMCB 3ITPA 5C4XB 1S72A 4LUZA 3HKSA 2VZAA 1CA5A 2SDFA 2EZVA 1EY8A 4LWCA 5IODA 1WYDA 2SNMA 3I7FA 2F0WA 1CZWA 4A93H 1Q7YC 5KEEA 4A3LH 1BQQT 1Y14B 3T1HL 2JJQA 2QEJC 2F0NA 4DV2L 3A56A 1H95A 4R4CA 4IUUA 4QIWE 5L37A 5CV8A 1SEBD 4A3IG 5IYCG 4EQPA 1ZYRC 2KHJA 2OT2A 2EYMA 4KY7A 3VA7A 1YZ6A 3I4MG 3FPUB 4KJOA 2KEEA 5JPNC 2F0UA 2OQ0A 1MJCA 3OMGA 2BH8A 5AFWA 2R93G 3OW7A 4U673 5M3FH 4IZ8A 3SGIA 1PMRA 1S4ZA 1CKMA 4CJ0B 1QNKA 3BVGA 4FO2A 5CV5A 3J81c 1RDPD 3BDLA 3GTMB 1SE4A 2JEAI 3NP8A 3QR8A 1EQRA 1LTRD 5BN4A 4HEDA 1EQTA 3NE5B 1SDFA 4YWMA 3RLNA 1D1KA 1HTPA 4X64L 2MGSA 3CD6A 2XWJB 4ULLA 1FD7D 2BDOA 3L7ZC 1UEAB 3QB3A 3DHQA 1I94Q 1STEA 1PLFA 1B9MA 1XYIA 4JI2Q 1PFSA 2RSNA 3B6YA 4A3FB 1JB3A 3P20A 1KLGD 5IGEA 4O42A 3F2DA 3GV6A 5I9OA 1X55A 2AKWB 1T9HA 3M4OB 3PMFA 4DFAA 4IFDI 2K32A 1PRTF 5LMUL 2BH2A 3H15A 4O1NA 1EFWA 4NXNL 4WORA 5FO9B 1L0YB 2B2YC 2EYLA 4RMFA 4GKJQ 2Z6KC 1PTOD 2P5ZX 4A93G 3GTLH 4P74A 1TWCB 4A3LG 3PGZA 3TRZA 1QVCA 1IW7C 4OEMB 5C4HA 4DKAC 3NTKA 5M3MB 3R2IA 1XNRL 4DR3Q 2PCFB 5IGBA 4B9WA 2VB2X 1F9QA 4X66Q 4DUZQ 3G6JB 4LF7Q 1EQVA 1RIPA 1A6XA 4GNXA 2F3VA 1G291 2K14A 1HA5A 4RFBA 4JI8L 2R92B 2F0IA 3GDEA 3AU7A 1GUTA 4L5QA 3T51B 2DGYA 5M3FG 5EAYA 4C3HH 1V1OA 2D0OA 3MC0B 4KHPL 4IALA 2JSOA 4JCVE 1KABA 3KF6A 4GLAC 2EVBA 4DAPA 2N78A 2K5QA 1ILPA 1STYA 1VQKA 5C3XA 1N34Q 2DUDA 2ZJPA 2NWGA 4IUVA 4X3SA 3I56A 1EY5A 1Q1EA 3A54A 1DONA 4XT1B 4A3DG 1TU2B 2LS01 1B3AA 5ELNA 2CQAA 2F52A 1T5EA 1XXGA 3VA5A 1I4PA 2CVRA 4AQYQ 1KIXA 3HKZB 2K5HA 4RA8A 3S16H 1N9WA 1QZHA 2D5DA 4A3MB 4GKKQ 5FO7B 1DOKA 4TQUS 1EOVA 1PYSB 2VL6A 4GN3B 4J8QA 3HRZC 3TMEA 4GOPC 1UE5A 1V8QA 1Y8NB 1O78A 1K8OA 3HG9A 3GP7A 2XRSD 5IY0A 1AW7A 2Y0SG 1QILA 2AWNA 3WWVA 3PO2B 2F0LA 3NUCA 1STNA 4XTCS 1OXVA 1E0BA 3MTSA 1WCMH 1BNZA 1PZKD 1I3QH 4EGVA 1JWUD 4DK6C 5COYA 2B2VC 1IKLA 2I5MX 4MTNA 4JVZA 2HHHL 2F0EA 1YHBA 2HDLA 4QIWB 2ZT9C 1SSOA 3NHHA 2LXJA 5J1ZA 3CCLA 5K36H 5E1FA 4IJLA 4DV6L 2G9DA 5IP9H 4L5RC 4IFDH 2KA7A 4X6AH 1A15A 1II3A 4R8IA 1V1PA 2YU9B 2WAQB 4C3HG 2UUCL 4OL7A 4C56C 4UY8C 3K81C 4LF5L 4DK0A 2L11A 3CCEA 3AFPA 2WB1G 2MP1A 1RCVD 1EWIA 3MWYW 3CC2A 4GN4B 1PH9A 4RAUC 5ELCA 2IW3A 3VR2A 3GO5A 1QJOA 2TMPA 2UU9L 3EBEA 3S24A 4DR7Q 5EPKA 4RGMA 3E0JA 3PIO3 2JEBI 1Y1WH 4Z9CB 5I6WA 5M9OA 3CW2C 2SEBD 4BY7H 2ZXRA 5D3IB 1FJGL 3MEHA 4QJFA 5M5YH 1VMPA 4WJWA 5KYLA 1K9MC 2OCEA 2B8GA 2JA9A 3CMAA 3T53B 2M9VA 1SYFA 3QIAA 4NXMQ 2NN6H 1Q81C 1BBUA 4R4IA
chains in the Genus database with same CATH topology
3H3VH 1SROA 1ASYA 2ZM6Q 1K0RA 5C44G 4JI4Q 4LFBL 4IPDA 2VQEL 1QUQB 1NBWA 4LUVA 2VY3A 3HOXG 3U58A 3HOWH 4IJHA 3K7AH 4AH6A 4NXML 4WJ3M 3PO3H 1TXYA 1WCMG 1KD1C 3CC4A 1MKHA 1Z47A 3ER0A 2ZM6L 2QEXA 1VQHA 3HKZE 4JI4L 5C4XH 4YY3L 3J80c 1IBLQ 4KLKA 2PNHA 2F3IA 1Y1VH 4IFDJ 3IRBA 2VUMG 4YHHL 1OXTA 2K4KA 3HOVG 3KFUA 1HNWQ 4GLXA 1AE2A 2WAQG 3OYYA 2YTVA 2N3SA 3GTJH 3DLLA 1IL2A 1XMOQ 1IBLL 4OX9L 1CSPA 5IP9G 1MJEA 3FKIG 2UXCL 3U4ZA 4IFDG 3E0EA 1VQMA 4BXXG 2CCZA 4IPHA 4XIGS 1PH4A 4DV1Q 4NB3A 4DV7Q 3F8TA 3HOZH 3PF5A 5ELOA 2OTJA 2GVAA 3PIPA 1P8LA 1B8AA 3CCRA 1XMOL 4BA2I 4OXPA 2ZTDA 2PI2E 4HJAA 5M5XH 4DUYQ 1PHJA 1YEZA 2EXDA 4HJ9A 3HOYH 3CP0A 3CAMA 1U5KA 2B29A 2AHOB 1Z9FA 1EUJA 2IHFA 4DV1L 1QZGA 2YYZA 3RLFA 3M7NA 5C3EH 4DV7L 4B3TL 3G71A 2RCNA 2IX1A 1SE8A 1X54A 2WFWA 2YTYA 3BZCA 1S3OA 1L2FA 2CQOA 1VQCA 4PZ6A 1EIYB 4DUYL 4JBJA 4O2DA 3PIOA 3GTKH 2V1CC 4IPGA 1X3EA 4A76A 2I5HA 4JI3L 1J6QA 4HIKA 1HNZQ 3RN5A 1CKNB 4BY7G 5FLMH 4GS3A 2UUBL 3H0GH 3HOUH 2WAQE 2ASBA 5JJKA 5HGQA 1YHAA 4EQ5A 2E2JH 1KAWA 3UE1A 3HOVH 3STBD 2VNUD 2FXQA 2UXBL 1N33L 1YNXA 4DV3Q 1Q12A 1HZAA 4X64Q 4R4OA 4DAMA 4KHZA 1E7ZA 2ALYB 2BA0A 1X9NA 1SLJA 4P72A 3K7UC 1HNZL 1I50H 3UDXA 2NN6G 3FKIH 4NPSA 1VQBA 1LUZA 2PQAA 2R7DA 1A63A 3F1ZA 1OXXK 2D62A 5LMNW 2C35B 5J3BA 3ICEA 2K50A 2H5XA 1KXLA 1PH7A 3PSIA 4YWLA 3KDFA 1YHQA 2MO1A 4L5SA 4DV3L 1KC8C 1PV4A 1IBKQ 4DR2Q 3PV0A 1IBMQ 1VCIA 2XGTA 3HOWG 2Y0SE 4GOPB 1A8VA 3M9BA 1O7IA 4DNIA 3CF5A 3PO3G 1YIJA 1PA6A 4DK3C 1OTCA 1VQAA 3M4QA 4Y7NH 3D0FA 1JE5A 1K73C 1TWGH 1D7QA 3CCJA 3I2ZA 1L1OA 4JI1Q 5GAHC 1GD7A 4GNXB 1JB7A 5C4XG 4BBRG 2UXDQ 3J81j 2PI2A 4A3IH 5IYCH 1Y1VG 1IBKL 4DR2L 3I4OA 1IBML 1NTGA 3GTOH 3PUZA 1K8GA 3U4VA 5FLXc 3CMEA 2K5VA 1AH9A 3S15H 1TWHH 2WP8J 1HZ9A 3I4MH 4OWXB 2JA7H 4X65Q 5E7NA 1E3PA 4A75A 4OWWB 3S1MH 3CCVA 4LFAQ 2Q2IA 4TVAB 4DV0Q 2UXDL 5DLQE 3KOJA 4HJ5A 1I6HH 3KF8B 2R93H 4HIOA 1QVGA 1HR0Q 3S1NH 3K80C 2RF4A 1VQ5A 1UEBA 2JQOA 2KHIA 1NJIC 4DR1Q 3KF6B 1VQ8A 4DR6Q 1VQIA 4LF6Q 2JA5H 1B7YB 2N8NA 2NVQH 3HOZG 4JBKA 1YBYA 4PMWA 4YWKA 3CXCA 1X3GA 1C7YA 1RL2A 2K52A 3J7A5 4LFAL 1GVPA 4DV0L 4LNQA 3BU2A 3E9HA 2Q2HA 4JOIA 1Q1BA 5GADC 2IT1A 1HR0L 1KRTA 3W5OA 2E2HH 3HOYG 1XMQQ 4DR1L 2WB1E 4DR6L 5IWAL 1JT8A 5C3EG 4JI7Q 1DGSA 1PYBA 4Y52H 1PVOA 1PH5A 3GTPH 1VQPA 3AEVA 3AQQA 1OXUA 4JV5Q 4UP8A 2KBNA 2HT1A 3FHWA 3S17H 2CKZB 1V1QA 3T1YQ 4UP9A 4BBRH 1VQNA 4OONA 5IE8A 5FLMG 4LF9Q 1SFOH 3H0GG 4POFA 3HOUG 3NBHB 4JI5Q 1IYJB 4JI7L 2KCTA 3UE0A 2NN6I 3NENA 1AE3A 3EN2A 3PCOB 1PH6A 4JV5L 4P71A 1HNXQ 3H3VI 2IX0A 4A3EG 4UP7A 2AMCB 1VQ4A 4A3GH 1S72A 3T1YL 1L1OC 2Q2UA 2KENA 3T1HQ 4LUZA 4AIMA 3HKSA 2VZAA 3LGJA 4A4IA 4IOAA 4LF9L 3UDGA 2B3GA 4DV2Q 1E22A 4LWCA 3A5ZB 1WYDA 1WI5A 4JI5L 1YJNA 3I7FA 3VDYA 4ME3A 1HNWL 3NEMA 4A93H 4IPCA 3J7ZC 1HNXL 1Q7YC 2CWPA 4X62Q 4A3LH 1Y14B 1V43A 1J5EQ 3T1HL 2A1AA 2JJQA 2VQFQ 1QUQA 4JI6Q 4DV2L 5C0XJ 2JE6I 5BR8Q 1G51A 4R4CA 3Q8DA 1H95A 3J81i 4LF4Q 4JYAQ 4QIWE 4RG1A 1L0WA 2IY5B 1VQFA 5IYCG 4A3IG 2Z6KA 2KHJA 1J5EL 4C2MH 3PUYA 2VQFL 2PMZE 1YZ6A 2JA8H 2JK8A 4JOIC 4JI6L 3I4MG 5C0XG 5H1SE 2JA7G 4KI0A 1P16A 4LF8Q 2OQ0A 3TS2A 2LSSA 1MIUA 1MJCA 3PUWA 3U50C 5BR8L 2BH8A 4LF4L 4JYAL 2R93G 2EQSA 5IP7H 5M3FH 3GTMH 1VQ7A 4DAYB 3SGIA 3W1BA 5M3MG 1CKMA 1NMGA 1LYLA 4YCVA 2RHSB 1XJVA 1K3RA 4A3EH 2D0PA 1A62A 2JA6H 3AYHB 3JC66 2JA5G 3CCMA 2UUAQ 4HIDA 1A0IA 3EIVA 1BKBA 3L0OA 5FJ8H 4LF8L 3J81c 4BBSH 2E5LQ 3K8AA 2ZTEA 1SN8A 4B3RQ 2AWOA 1V9PA 4APVA 2JEAI 1EQRA 3DM3A 1NY4A 3K0XA 1QVFA 1C9OA 4DV6Q 4C3IH 2R92G 4YWMA 3RLNA 4R4QA 4A3FH 2ZJRA 4X64L 4OO1G 1HH2P 1HJPA 1EYGA 4QL5A 2UUAL 3CD6A 1KL9A 3L7ZC 3RNUA 1BVSA 2YU9H 3M4OH 2E5LL 4QQBX 5LMUQ 4B3RL 1CUKA 3ULPA 4AYBG 2A19A 5LMNQ 1I94Q 1YI2A 4NXNQ 5IYDH 2VS1A 1PFSA 3B6YA 4JI2Q 3PF4A 1XNQQ 1PH1A 5JJLA 4OWTB 3ZJYC 3F2DA 1X55A 2AKWB 1T9HA 4A3KH 3F2BA 3G4SA 4K0KQ 3AFQA 1E1TA 1N36Q 1GKHA 5C4JH 4IOCA 2UU9Q 4IFDI 1IXRA 3UDIA 5LMUL 1VS0A 2BH2A 3H15A 1JJ2A 3A5UA 5LMNL 1EFWA 4A3GG 3E9IA 1K83H 2YTXA 4NXNL 4JI1L 3RZOH 4JI2L 2OWOA 1TWCH 3PUXA 3RLOA 1YJ9A 4RMFA 4JC0A 3CQZH 1XNRQ 4GKJQ 3A74A 2Z6KC 5M3MH 1TWFH 4K0KL 3GD7A 3NELA 5AJ3Q 1X65A 1N36L 4A93G 1Q46A 1X6OA 3HKZG 3OTOQ 4P74A 3S1RH 2ZJQA 4X65L 3GTLH 3F2CA 3PGZA 4A3LG 1CSQA 3TRZA 1QVCA 4DKAC 3ULJA 1GM5A 4JI8Q 2K5NA 3TEHB 1SR3A 1PH8A 4DR3Q 4GOPA 1XNRL 2R92H 1FL0A 1JMCA 4X66Q 4DUZQ 5C0XI 4LF6L 4LF7Q 1RIPA 1LTLA 1Q8KA 5GAEC 2QA4A 4GNXA 4LFBQ 4MZ9A 1G291 5IT9c 2HIVA 2K14A 1VQDA 4JI0Q 4KHPQ 1WJJA 2JA8G 4JI8L 4DR3L 3W1GA 1XMQL 2MO0A 2N49A 3GDEA 4R1JA 2L15A 4X66L 4DV4Q 4L5QA 4HIMA 3M3YH 1UE7A 2DGYA 4LF7L 1G6PA 2HIXA 5IP7G 5M3FG 1IZ6A 5EAYA 1Q82C 3CCUA 4C3HH 3PUVA 5JEAJ 4YY3Q 1Q86C 3TREA 5IYBH 2D0OA 4JI0L 1E1OA 4KHPL 1M1KC 2JA6G 4JCVE 4YHHQ 2RHQB 1K8AC 3G6EA 1HZBA 3KF6A 3BJUA 4GLAC 5FJ8G 5M5WH 4ALPA 4BBSG 4A3CH 2MNAA 4DV4L 3S2DH 4OO1I 2R7FA 2N78A 1KRSA 1LM0A 5JEAG 4DV5Q 2B63G 1YJWA 1SRUA 4OX9Q 1VQKA 2UXCQ 4A3FG 1CKOA 1N34Q 1N32Q 2EIFA 2DUDA 3MEFA 2ZJPA 3STBC 4A3BH 4MNOA 4A3MH 3I56A 5K36G 1Q1EA 1I5FA 4A3DG 4JBMA 3RN2A 2ES2A 1VQEA 1UE1A 3RZDH 1XPOA 4B3SQ 5ELNA 1WFQA 4LW1A 2F52A 4BA1I 2I0QA 4DV5L 1VQGA 5IYDG 4AQYQ 1XPRA 1KIXA 1VQ6A 2K5HA 1FGUA 2XTIA 3S16H 1N9WA 1QZHA 4X62L 2R6GA 1N34L 1VQ9A 2ZTCA 4O0AA 1N32L 4GKKQ 2I5LX 2VW9A 3MXNB 3KYHC 4TQUS 3KJOA 4IO9A 4A3KG 1EOVA 1PYSB 2VL6A 5HY6A 4GN3B 4A3JH 4BY1H 3M4PA 4B3TQ 3PO2H 2PQAB 2BA1A 1B70B 4GLVB 3CPWA 1UE5A 4GOPC 5GROA 1XTDA 4B3SL 4QGUA 4AQYL 2R7ZH 3I4NG 4DR5Q 3KDFB 5IY0A 5C44H 1SMXA 2Y0SG 5GQOA 3BZKA 4GNXC 3D31A 4JI3Q 4LFCQ 4GKKL 2AWNA 3WWVA 1C0AA 4UPAA 2HHHQ 2UUBQ 1EQQA 2ATWA 3KLWA 3I55A 4XTCS 3HOXH 1OXVA 1X56A 1KHIA 2YV5A 3S2HH 1OXSC 2MFIA 1L1OB 1E24A 2Q2TA 1N33Q 2QGQA 2UXBQ 1WCMH 1I3QH 4DR5L 1VQOA 3UDFA 1ASZA 3A0JA 4DK6C 1PH2A 1S40A 1Y1WG 3L2PA 2I5MX 2B63H 4LFCL 4YCWA 2CWAA 3CCQA 2NVYH 2HQLA 2MQHA 4MTNA 2NVTH 1JJGA 4L5TA 3GTGH 2HHHL 1YHBA 2VUMH 3CCLA 2LXJA 1FVIA 4P73A 4QY7A 2UUCQ 5JJIA 4A3DH 1N8RC 4PZ8A 4LF5Q 1UE6A 4HJ8A 1VQJA 4LUOA 2GVBA 4IJLA 4PG3A 2CFMA 2IHEA 4DV6L 5IP9H 3HFZB 4L5RC 2F4VQ 1X3FA 4X6AH 4GN5A 1XPUA 4BXXH 1CKNA 4POGA 4J15A 2UUCL 1W2BA 4C3JH 1D8LA 2NVXH 4FDBA 5IYBG 4UY8C 3K81C 4H02A 2E8GA 1YVCA 2NZOA 4LF5L 1I94L 3CCEA 4HJ7A 4WJ4A 3FP9A 3AFPA 2LXKA 3ULLA 2E2IH 4JG2A 5GAGC 3I4NH 2WB1G 1NE3A 4PZ7A 1EWIA 3CC2A 1XNQL 4GN4B 4YCUA 1PH9A 4JBWA 4A3CG 3M85A 2F4VL 3S14H 3JAMi 3RR5A 3GO5A 1EIFA 1FJGQ 2UU9L 3EBEA 3CPFA 3S24A 1HR0W 4DR7Q 2NZHA 3OW2A 4DR4Q 3KJPA 2GN5A 4A3BG 4A3MG 1R9TH 3TS0A 1BBWA 2Z0SA 1UWVA 1VQLA 2JEBI 1Y1WH 4GKJL 1GO3E 3CW2C 1TWAH 4B3MQ 4BY7H 1FJGL 3TQYA 2KCMA 4P75A 4DPGA 5AJ3L 4QJFA 5M5YH 1WOCA 2K75A 3OTOL 4DR7L 1NMFA 4AYBE 1K9MC 4DR4L 2OCEA 3CCSA 3J80i 2ID0A 4R4TA 2VQEQ 1PH3A 5IWAQ 3S1QH 3ERSX 2OQKA 3CC7A 4A3JG 1HZCA 2JA9A 1U0LA 1KQSA 4BY1G 2OTLA 3CMAA 3JAMc 3PO2G 1M90C 4NXMQ 1W3SA 1Q81C 3G48A 4B3ML 3GTQH 1JJCB 1BBUA 2R7ZG 4DUZL 1YITA 2A8VA 4R4IA 4EX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3V H;  1SRO A;  1ASY A;  2ZM6 Q;  1K0R A;  5C44 G;  4JI4 Q;  4LFB L;  4IPD A;  2VQE L;  1QUQ B;  1NBW A;  4LUV A;  2VY3 A;  3HOX G;  3U58 A;  3HOW H;  4IJH A;  3K7A H;  4AH6 A;  4NXM L;  4WJ3 M;  3PO3 H;  1TXY A;  1WCM G;  1KD1 C;  3CC4 A;  1MKH A;  1Z47 A;  3ER0 A;  2ZM6 L;  2QEX A;  1VQH A;  3HKZ E;  4JI4 L;  5C4X H;  4YY3 L;  3J80 c;  1IBL Q;  4KLK A;  2PNH A;  2F3I A;  1Y1V H;  4IFD J;  3IRB A;  2VUM G;  4YHH L;  1OXT A;  2K4K A;  3HOV G;  3KFU A;  1HNW Q;  4GLX A;  1AE2 A;  2WAQ G;  3OYY A;  2YTV A;  2N3S A;  3GTJ H;  3DLL A;  1IL2 A;  1XMO Q;  1IBL L;  4OX9 L;  1CSP A;  5IP9 G;  1MJE A;  3FKI G;  2UXC L;  3U4Z A;  4IFD G;  3E0E A;  1VQM A;  4BXX G;  2CCZ A;  4IPH A;  4XIG S;  1PH4 A;  4DV1 Q;  4NB3 A;  4DV7 Q;  3F8T A;  3HOZ H;  3PF5 A;  5ELO A;  2OTJ A;  2GVA A;  3PIP A;  1P8L A;  1B8A A;  3CCR A;  1XMO L;  4BA2 I;  4OXP A;  2ZTD A;  2PI2 E;  4HJA A;  5M5X H;  4DUY Q;  1PHJ A;  1YEZ A;  2EXD A;  4HJ9 A;  3HOY H;  3CP0 A;  3CAM A;  1U5K A;  2B29 A;  2AHO B;  1Z9F A;  1EUJ A;  2IHF A;  4DV1 L;  1QZG A;  2YYZ A;  3RLF A;  3M7N A;  5C3E H;  4DV7 L;  4B3T L;  3G71 A;  2RCN A;  2IX1 A;  1SE8 A;  1X54 A;  2WFW A;  2YTY A;  3BZC A;  1S3O A;  1L2F A;  2CQO A;  1VQC A;  4PZ6 A;  1EIY B;  4DUY L;  4JBJ A;  4O2D A;  3PIO A;  3GTK H;  2V1C C;  4IPG A;  1X3E A;  4A76 A;  2I5H A;  4JI3 L;  1J6Q A;  4HIK A;  1HNZ Q;  3RN5 A;  1CKN B;  4BY7 G;  5FLM H;  4GS3 A;  2UUB L;  3H0G H;  3HOU H;  2WAQ E;  2ASB A;  5JJK A;  5HGQ A;  1YHA A;  4EQ5 A;  2E2J H;  1KAW A;  3UE1 A;  3HOV H;  3STB D;  2VNU D;  2FXQ A;  2UXB L;  1N33 L;  1YNX A;  4DV3 Q;  1Q12 A;  1HZA A;  4X64 Q;  4R4O A;  4DAM A;  4KHZ A;  1E7Z A;  2ALY B;  2BA0 A;  1X9N A;  1SLJ A;  4P72 A;  3K7U C;  1HNZ L;  1I50 H;  3UDX A;  2NN6 G;  3FKI H;  4NPS A;  1VQB A;  1LUZ A;  2PQA A;  2R7D A;  1A63 A;  3F1Z A;  1OXX K;  2D62 A;  5LMN W;  2C35 B;  5J3B A;  3ICE A;  2K50 A;  2H5X A;  1KXL A;  1PH7 A;  3PSI A;  4YWL A;  3KDF A;  1YHQ A;  2MO1 A;  4L5S A;  4DV3 L;  1KC8 C;  1PV4 A;  1IBK Q;  4DR2 Q;  3PV0 A;  1IBM Q;  1VCI A;  2XGT A;  3HOW G;  2Y0S E;  4GOP B;  1A8V A;  3M9B A;  1O7I A;  4DNI A;  3CF5 A;  3PO3 G;  1YIJ A;  1PA6 A;  4DK3 C;  1OTC A;  1VQA A;  3M4Q A;  4Y7N H;  3D0F A;  1JE5 A;  1K73 C;  1TWG H;  1D7Q A;  3CCJ A;  3I2Z A;  1L1O A;  4JI1 Q;  5GAH C;  1GD7 A;  4GNX B;  1JB7 A;  5C4X G;  4BBR G;  2UXD Q;  3J81 j;  2PI2 A;  4A3I H;  5IYC H;  1Y1V G;  1IBK L;  4DR2 L;  3I4O A;  1IBM L;  1NTG A;  3GTO H;  3PUZ A;  1K8G A;  3U4V A;  5FLX c;  3CME A;  2K5V A;  1AH9 A;  3S15 H;  1TWH H;  2WP8 J;  1HZ9 A;  3I4M H;  4OWX B;  2JA7 H;  4X65 Q;  5E7N A;  1E3P A;  4A75 A;  4OWW B;  3S1M H;  3CCV A;  4LFA Q;  2Q2I A;  4TVA B;  4DV0 Q;  2UXD L;  5DLQ E;  3KOJ A;  4HJ5 A;  1I6H H;  3KF8 B;  2R93 H;  4HIO A;  1QVG A;  1HR0 Q;  3S1N H;  3K80 C;  2RF4 A;  1VQ5 A;  1UEB A;  2JQO A;  2KHI A;  1NJI C;  4DR1 Q;  3KF6 B;  1VQ8 A;  4DR6 Q;  1VQI A;  4LF6 Q;  2JA5 H;  1B7Y B;  2N8N A;  2NVQ H;  3HOZ G;  4JBK A;  1YBY A;  4PMW A;  4YWK A;  3CXC A;  1X3G A;  1C7Y A;  1RL2 A;  2K52 A;  3J7A 5;  4LFA L;  1GVP A;  4DV0 L;  4LNQ A;  3BU2 A;  3E9H A;  2Q2H A;  4JOI A;  1Q1B A;  5GAD C;  2IT1 A;  1HR0 L;  1KRT A;  3W5O A;  2E2H H;  3HOY G;  1XMQ Q;  4DR1 L;  2WB1 E;  4DR6 L;  5IWA L;  1JT8 A;  5C3E G;  4JI7 Q;  1DGS A;  1PYB A;  4Y52 H;  1PVO A;  1PH5 A;  3GTP H;  1VQP A;  3AEV A;  3AQQ A;  1OXU A;  4JV5 Q;  4UP8 A;  2KBN A;  2HT1 A;  3FHW A;  3S17 H;  2CKZ B;  1V1Q A;  3T1Y Q;  4UP9 A;  4BBR H;  1VQN A;  4OON A;  5IE8 A;  5FLM G;  4LF9 Q;  1SFO H;  3H0G G;  4POF A;  3HOU G;  3NBH B;  4JI5 Q;  1IYJ B;  4JI7 L;  2KCT A;  3UE0 A;  2NN6 I;  3NEN A;  1AE3 A;  3EN2 A;  3PCO B;  1PH6 A;  4JV5 L;  4P71 A;  1HNX Q;  3H3V I;  2IX0 A;  4A3E G;  4UP7 A;  2AMC B;  1VQ4 A;  4A3G H;  1S72 A;  3T1Y L;  1L1O C;  2Q2U A;  2KEN A;  3T1H Q;  4LUZ A;  4AIM A;  3HKS A;  2VZA A;  3LGJ A;  4A4I A;  4IOA A;  4LF9 L;  3UDG A;  2B3G A;  4DV2 Q;  1E22 A;  4LWC A;  3A5Z B;  1WYD A;  1WI5 A;  4JI5 L;  1YJN A;  3I7F A;  3VDY A;  4ME3 A;  1HNW L;  3NEM A;  4A93 H;  4IPC A;  3J7Z C;  1HNX L;  1Q7Y C;  2CWP A;  4X62 Q;  4A3L H;  1Y14 B;  1V43 A;  1J5E Q;  3T1H L;  2A1A A;  2JJQ A;  2VQF Q;  1QUQ A;  4JI6 Q;  4DV2 L;  5C0X J;  2JE6 I;  5BR8 Q;  1G51 A;  4R4C A;  3Q8D A;  1H95 A;  3J81 i;  4LF4 Q;  4JYA Q;  4QIW E;  4RG1 A;  1L0W A;  2IY5 B;  1VQF A;  5IYC G;  4A3I G;  2Z6K A;  2KHJ A;  1J5E L;  4C2M H;  3PUY A;  2VQF L;  2PMZ E;  1YZ6 A;  2JA8 H;  2JK8 A;  4JOI C;  4JI6 L;  3I4M G;  5C0X G;  5H1S E;  2JA7 G;  4KI0 A;  1P16 A;  4LF8 Q;  2OQ0 A;  3TS2 A;  2LSS A;  1MIU A;  1MJC A;  3PUW A;  3U50 C;  5BR8 L;  2BH8 A;  4LF4 L;  4JYA L;  2R93 G;  2EQS A;  5IP7 H;  5M3F H;  3GTM H;  1VQ7 A;  4DAY B;  3SGI A;  3W1B A;  5M3M G;  1CKM A;  1NMG A;  1LYL A;  4YCV A;  2RHS B;  1XJV A;  1K3R A;  4A3E H;  2D0P A;  1A62 A;  2JA6 H;  3AYH B;  3JC6 6;  2JA5 G;  3CCM A;  2UUA Q;  4HID A;  1A0I A;  3EIV A;  1BKB A;  3L0O A;  5FJ8 H;  4LF8 L;  3J81 c;  4BBS H;  2E5L Q;  3K8A A;  2ZTE A;  1SN8 A;  4B3R Q;  2AWO A;  1V9P A;  4APV A;  2JEA I;  1EQR A;  3DM3 A;  1NY4 A;  3K0X A;  1QVF A;  1C9O A;  4DV6 Q;  4C3I H;  2R92 G;  4YWM A;  3RLN A;  4R4Q A;  4A3F H;  2ZJR A;  4X64 L;  4OO1 G;  1HH2 P;  1HJP A;  1EYG A;  4QL5 A;  2UUA L;  3CD6 A;  1KL9 A;  3L7Z C;  3RNU A;  1BVS A;  2YU9 H;  3M4O H;  2E5L L;  4QQB X;  5LMU Q;  4B3R L;  1CUK A;  3ULP A;  4AYB G;  2A19 A;  5LMN Q;  1I94 Q;  1YI2 A;  4NXN Q;  5IYD H;  2VS1 A;  1PFS A;  3B6Y A;  4JI2 Q;  3PF4 A;  1XNQ Q;  1PH1 A;  5JJL A;  4OWT B;  3ZJY C;  3F2D A;  1X55 A;  2AKW B;  1T9H A;  4A3K H;  3F2B A;  3G4S A;  4K0K Q;  3AFQ A;  1E1T A;  1N36 Q;  1GKH A;  5C4J H;  4IOC A;  2UU9 Q;  4IFD I;  1IXR A;  3UDI A;  5LMU L;  1VS0 A;  2BH2 A;  3H15 A;  1JJ2 A;  3A5U A;  5LMN L;  1EFW A;  4A3G G;  3E9I A;  1K83 H;  2YTX A;  4NXN L;  4JI1 L;  3RZO H;  4JI2 L;  2OWO A;  1TWC H;  3PUX A;  3RLO A;  1YJ9 A;  4RMF A;  4JC0 A;  3CQZ H;  1XNR Q;  4GKJ Q;  3A74 A;  2Z6K C;  5M3M H;  1TWF H;  4K0K L;  3GD7 A;  3NEL A;  5AJ3 Q;  1X65 A;  1N36 L;  4A93 G;  1Q46 A;  1X6O A;  3HKZ G;  3OTO Q;  4P74 A;  3S1R H;  2ZJQ A;  4X65 L;  3GTL H;  3F2C A;  3PGZ A;  4A3L G;  1CSQ A;  3TRZ A;  1QVC A;  4DKA C;  3ULJ A;  1GM5 A;  4JI8 Q;  2K5N A;  3TEH B;  1SR3 A;  1PH8 A;  4DR3 Q;  4GOP A;  1XNR L;  2R92 H;  1FL0 A;  1JMC A;  4X66 Q;  4DUZ Q;  5C0X I;  4LF6 L;  4LF7 Q;  1RIP A;  1LTL A;  1Q8K A;  5GAE C;  2QA4 A;  4GNX A;  4LFB Q;  4MZ9 A;  1G29 1;  5IT9 c;  2HIV A;  2K14 A;  1VQD A;  4JI0 Q;  4KHP Q;  1WJJ A;  2JA8 G;  4JI8 L;  4DR3 L;  3W1G A;  1XMQ L;  2MO0 A;  2N49 A;  3GDE A;  4R1J A;  2L15 A;  4X66 L;  4DV4 Q;  4L5Q A;  4HIM A;  3M3Y H;  1UE7 A;  2DGY A;  4LF7 L;  1G6P A;  2HIX A;  5IP7 G;  5M3F G;  1IZ6 A;  5EAY A;  1Q82 C;  3CCU A;  4C3H H;  3PUV A;  5JEA J;  4YY3 Q;  1Q86 C;  3TRE A;  5IYB H;  2D0O A;  4JI0 L;  1E1O A;  4KHP L;  1M1K C;  2JA6 G;  4JCV E;  4YHH Q;  2RHQ B;  1K8A C;  3G6E A;  1HZB A;  3KF6 A;  3BJU A;  4GLA C;  5FJ8 G;  5M5W H;  4ALP A;  4BBS G;  4A3C H;  2MNA A;  4DV4 L;  3S2D H;  4OO1 I;  2R7F A;  2N78 A;  1KRS A;  1LM0 A;  5JEA G;  4DV5 Q;  2B63 G;  1YJW A;  1SRU A;  4OX9 Q;  1VQK A;  2UXC Q;  4A3F G;  1CKO A;  1N34 Q;  1N32 Q;  2EIF A;  2DUD A;  3MEF A;  2ZJP A;  3STB C;  4A3B H;  4MNO A;  4A3M H;  3I56 A;  5K36 G;  1Q1E A;  1I5F A;  4A3D G;  4JBM A;  3RN2 A;  2ES2 A;  1VQE A;  1UE1 A;  3RZD H;  1XPO A;  4B3S Q;  5ELN A;  1WFQ A;  4LW1 A;  2F52 A;  4BA1 I;  2I0Q A;  4DV5 L;  1VQG A;  5IYD G;  4AQY Q;  1XPR A;  1KIX A;  1VQ6 A;  2K5H A;  1FGU A;  2XTI A;  3S16 H;  1N9W A;  1QZH A;  4X62 L;  2R6G A;  1N34 L;  1VQ9 A;  2ZTC A;  4O0A A;  1N32 L;  4GKK Q;  2I5L X;  2VW9 A;  3MXN B;  3KYH C;  4TQU S;  3KJO A;  4IO9 A;  4A3K G;  1EOV A;  1PYS B;  2VL6 A;  5HY6 A;  4GN3 B;  4A3J H;  4BY1 H;  3M4P A;  4B3T Q;  3PO2 H;  2PQA B;  2BA1 A;  1B70 B;  4GLV B;  3CPW A;  1UE5 A;  4GOP C;  5GRO A;  1XTD A;  4B3S L;  4QGU A;  4AQY L;  2R7Z H;  3I4N G;  4DR5 Q;  3KDF B;  5IY0 A;  5C44 H;  1SMX A;  2Y0S G;  5GQO A;  3BZK A;  4GNX C;  3D31 A;  4JI3 Q;  4LFC Q;  4GKK L;  2AWN A;  3WWV A;  1C0A A;  4UPA A;  2HHH Q;  2UUB Q;  1EQQ A;  2ATW A;  3KLW A;  3I55 A;  4XTC S;  3HOX H;  1OXV A;  1X56 A;  1KHI A;  2YV5 A;  3S2H H;  1OXS C;  2MFI A;  1L1O B;  1E24 A;  2Q2T A;  1N33 Q;  2QGQ A;  2UXB Q;  1WCM H;  1I3Q H;  4DR5 L;  1VQO A;  3UDF A;  1ASZ A;  3A0J A;  4DK6 C;  1PH2 A;  1S40 A;  1Y1W G;  3L2P A;  2I5M X;  2B63 H;  4LFC L;  4YCW A;  2CWA A;  3CCQ A;  2NVY H;  2HQL A;  2MQH A;  4MTN A;  2NVT H;  1JJG A;  4L5T A;  3GTG H;  2HHH L;  1YHB A;  2VUM H;  3CCL A;  2LXJ A;  1FVI A;  4P73 A;  4QY7 A;  2UUC Q;  5JJI A;  4A3D H;  1N8R C;  4PZ8 A;  4LF5 Q;  1UE6 A;  4HJ8 A;  1VQJ A;  4LUO A;  2GVB A;  4IJL A;  4PG3 A;  2CFM A;  2IHE A;  4DV6 L;  5IP9 H;  3HFZ B;  4L5R C;  2F4V Q;  1X3F A;  4X6A H;  4GN5 A;  1XPU A;  4BXX H;  1CKN A;  4POG A;  4J15 A;  2UUC L;  1W2B A;  4C3J H;  1D8L A;  2NVX H;  4FDB A;  5IYB G;  4UY8 C;  3K81 C;  4H02 A;  2E8G A;  1YVC A;  2NZO A;  4LF5 L;  1I94 L;  3CCE A;  4HJ7 A;  4WJ4 A;  3FP9 A;  3AFP A;  2LXK A;  3ULL A;  2E2I H;  4JG2 A;  5GAG C;  3I4N H;  2WB1 G;  1NE3 A;  4PZ7 A;  1EWI A;  3CC2 A;  1XNQ L;  4GN4 B;  4YCU A;  1PH9 A;  4JBW A;  4A3C G;  3M85 A;  2F4V L;  3S14 H;  3JAM i;  3RR5 A;  3GO5 A;  1EIF A;  1FJG Q;  2UU9 L;  3EBE A;  3CPF A;  3S24 A;  1HR0 W;  4DR7 Q;  2NZH A;  3OW2 A;  4DR4 Q;  3KJP A;  2GN5 A;  4A3B G;  4A3M G;  1R9T H;  3TS0 A;  1BBW A;  2Z0S A;  1UWV A;  1VQL A;  2JEB I;  1Y1W H;  4GKJ L;  1GO3 E;  3CW2 C;  1TWA H;  4B3M Q;  4BY7 H;  1FJG L;  3TQY A;  2KCM A;  4P75 A;  4DPG A;  5AJ3 L;  4QJF A;  5M5Y H;  1WOC A;  2K75 A;  3OTO L;  4DR7 L;  1NMF A;  4AYB E;  1K9M C;  4DR4 L;  2OCE A;  3CCS A;  3J80 i;  2ID0 A;  4R4T A;  2VQE Q;  1PH3 A;  5IWA Q;  3S1Q H;  3ERS X;  2OQK A;  3CC7 A;  4A3J G;  1HZC A;  2JA9 A;  1U0L A;  1KQS A;  4BY1 G;  2OTL A;  3CMA A;  3JAM c;  3PO2 G;  1M90 C;  4NXM Q;  1W3S A;  1Q81 C;  3G48 A;  4B3M L;  3GTQ H;  1JJC B;  1BBU A;  2R7Z G;  4DUZ L;  1YIT A;  2A8V A;  4R4I A;  4EX5 A; 
#chains in the Genus database with same CATH topology
 4JI4 Q;  1HPC A;  2WKC A;  4MTK A;  4LFB L;  4DNR B;  1D5Z C;  1U4L A;  4OIJ A;  1QUQ B;  2WII B;  4KD4 A;  4LUV A;  3U58 A;  4PMB A;  3E6Z X;  3K7A H;  3IKJ A;  1WCM G;  3CC4 A;  5G3L D;  1Z47 A;  4WRD A;  2ZM6 L;  1BCP B;  1Y1V H;  2EE1 A;  3IRB A;  1PDQ A;  3P1H A;  1OXT A;  3S2D B;  3HOV G;  4RWS C;  1HUN A;  3OYY A;  2B2W A;  4KY5 A;  3NTH A;  1IL2 A;  1XMO Q;  2BE5 D;  4OX9 L;  5IP9 G;  2UXC L;  4IFD G;  1VMC A;  3P75 A;  3VR3 A;  4IPH A;  3LX0 A;  4DV1 Q;  3FMC A;  1LO5 D;  3D6C A;  4DV7 Q;  1B9N A;  3PF5 A;  3PIP A;  1BBX C;  1B8A A;  3CCR A;  2Z4H A;  4OXP A;  2ZTD A;  2PI2 E;  3TZD A;  1PHJ A;  2G5D A;  1AZP A;  1YEZ A;  3HOY H;  4A3J B;  5A2Q E;  3HOZ B;  3MFY A;  5C3E H;  1NCV A;  1ENA A;  2RCN A;  2IX1 A;  3SK8 A;  1F77 A;  3K5L A;  3BZC A;  3S9W A;  3V96 A;  2V1C C;  4A76 A;  2I5H A;  4CGY B;  3RN5 A;  4BY7 G;  2A5H A;  4ZCK A;  1G2T A;  2VNU D;  4ZKC B;  2A6H D;  3STB D;  5LHY 1;  1PTO C;  3GTK B;  1N33 L;  3HZX A;  1YNX A;  1Q12 A;  1TR5 A;  4X64 Q;  3DUZ A;  4KHZ A;  2PMZ B;  2NVT B;  1E7Z A;  1SLJ A;  2NN6 G;  2E2J B;  3SE0 A;  1K3B C;  1EWH A;  2TSS A;  3ICE A;  2K50 A;  3KDF A;  4DV3 L;  1X3Q A;  1VCI A;  1I50 B;  2E74 C;  2Y0S E;  3R93 A;  1ZXT A;  1QOH A;  1PA6 A;  3MXG A;  1JE5 A;  1K73 C;  1ET9 A;  3I2Z A;  3OIQ A;  5JVH 3;  2M00 A;  2UXD Q;  2PI2 A;  1Y1V G;  1IBK L;  4B9X A;  1IBM L;  1A3U A;  3CME A;  5FLX c;  2K5V A;  1XX8 A;  2B2U C;  2VB3 X;  4OWX B;  3VYU A;  4F88 A;  5C0X H;  1PTO H;  5E7N A;  1WTH A;  3K58 A;  4A75 A;  3CCV A;  4LFA Q;  2Q2I A;  3OHX C;  5CC4 A;  3GTO B;  1QVG A;  1S5F D;  1D6E C;  1TT2 A;  1UEB A;  2JQO A;  3I4M B;  4DR6 Q;  1VQI A;  1K0S A;  1VF5 C;  2N8N A;  1TWA B;  3NK9 A;  4BS9 A;  3S1M B;  3CXC A;  2R93 B;  2KED A;  1KDB A;  3CRK C;  3J7A 5;  1DZ1 A;  5GAD C;  4DXF A;  4FP5 D;  3HOY G;  3TBI B;  1ILQ A;  2WB1 E;  1PTO F;  5C3E G;  3TSS A;  1LTI D;  4IUR A;  1PH5 A;  1VQP A;  1YNN D;  5DNF A;  2J4X A;  3K5N A;  1WTV A;  2PW5 A;  3FHW A;  2CKZ B;  2E76 C;  4UP9 A;  4BBR H;  3V2T A;  1ESR A;  4PV1 C;  1GHJ A;  4ME5 A;  2B8F A;  1SFO H;  4POF A;  4JI5 Q;  1IYJ B;  4CKE A;  3UE0 A;  3PO3 B;  4JV5 L;  1AE3 A;  2KEC A;  3EN2 A;  4K6L A;  1PH6 A;  3DEO A;  1JOR A;  2LY7 A;  3H3V I;  1DXM A;  2IX0 A;  1CI3 M;  1VQ4 A;  3Q24 A;  2QCP X;  2JXM B;  1STG A;  3UDG A;  4LAA A;  3A5Z B;  4L63 B;  1YJN A;  1WI5 A;  4ME3 A;  3NEM A;  4IPC A;  2CWP A;  4B08 A;  1HA6 A;  3DWA A;  2EYO A;  4JI6 Q;  5IT9 L;  2JYO A;  2JE6 I;  5BR8 Q;  3C2P A;  3Q8D A;  4A93 B;  2D9U A;  2F0H A;  4LF4 Q;  4JYA Q;  2B2Y A;  2Z6K A;  2E2D C;  5M5X B;  2R3Z A;  1UUP A;  4G7O C;  1J5E L;  4C2M H;  3PUY A;  2VQF L;  3DM1 A;  3TDQ A;  2JA8 H;  1FNW A;  2JK8 A;  2PPB C;  5C0X G;  5H1S E;  1CQF A;  1MIU A;  3PUW A;  3KUP A;  3MHB A;  3FPP A;  5IP7 H;  1BXT A;  1NMG A;  1XJV A;  5TSS A;  3Q23 A;  3MXU A;  1XTC D;  2D0P A;  1A62 A;  2L4N A;  3AYH B;  4A3E H;  2UUA Q;  2JA6 H;  3MAQ A;  1A0I A;  4LF8 L;  4BBS H;  3H0G B;  2E5L Q;  3K8A A;  3HOU B;  2ZTE A;  5M3F B;  1SN8 A;  4B3R Q;  3U9S A;  2AWO A;  4APV A;  4HCS A;  3DM3 A;  5JEA H;  3K0X A;  4DV6 Q;  1AN8 A;  1EOT A;  1HH2 P;  2KJX A;  1EYG A;  1KL9 A;  1QB5 D;  1A2U A;  1ONL A;  1PRT B;  4XXE A;  5CBE E;  1SYE A;  1TY0 A;  1PH1 A;  2KVM A;  1JE4 A;  3ZJY C;  2Q8I B;  4HCE A;  1HCZ A;  1EEF D;  3AFQ A;  1PFB A;  1U4M A;  3MA2 B;  1GKH A;  3G4S A;  4K0K Q;  2UU9 Q;  1HXY D;  3A5U A;  5LMN L;  1K83 H;  3H3V C;  3HP3 A;  3A74 A;  2B2T C;  3GD7 A;  1N36 L;  4QUC A;  1SJH D;  1Q46 A;  2ZJQ A;  1O80 A;  3S1R H;  4X65 L;  3F2C A;  1LLR D;  1MBY A;  2Y0S B;  1GM5 A;  2ZXP A;  3TEH B;  4GOP A;  4DN4 M;  1FL0 A;  3N6R A;  2BE5 C;  3VR5 A;  2JA5 B;  5CV6 A;  2NVQ B;  1U4P A;  5GAE C;  2QA4 A;  4LFB Q;  4MZ9 A;  1BDO A;  2HIV A;  1VQD A;  4JI0 Q;  2JA8 G;  1XMQ L;  3A7A B;  3IFD A;  2H1E A;  1UE7 A;  5IP7 G;  1Q86 C;  2A74 C;  1CHQ D;  4AYB B;  1G2S A;  2K5W A;  1E1O A;  5FK9 C;  2JA6 G;  1SNM A;  3G6E A;  3BJU A;  4ALP A;  4ZQ3 A;  4BBS G;  3SXH A;  2MNA A;  4DV4 L;  1PFN A;  4DGZ A;  4OO1 I;  4FXG C;  4C3H B;  2L1B A;  1LM0 A;  5JEA G;  2B63 G;  2G9H D;  1YJW A;  2K28 A;  4OX9 Q;  4A3G B;  3K5O A;  1O7Y A;  2UXC Q;  1CKO A;  2WB1 B;  2XNA C;  3MEF A;  3I8Z A;  2A6H C;  3STB C;  5I9P A;  4MNO A;  4A3B H;  2EPB A;  2CH4 A;  4CDC C;  4JBM A;  3RN2 A;  1XPO A;  4B3S Q;  5G3L F;  1RHP A;  2K7V A;  4DV5 L;  1VQG A;  5E4X A;  2WKD A;  4IUP A;  5EBC A;  1KLU D;  2XTI A;  4X62 L;  2R6G A;  1N32 L;  2ZTC A;  4O0A A;  3KYH C;  2KQ3 A;  4UHV A;  3NBH A;  3CPW A;  3L9A X;  5GRO A;  3S16 B;  2R7Z H;  3I4N G;  4DR5 Q;  3D3R A;  5C44 H;  1SMX A;  2C9O A;  4LFC Q;  4Q5V A;  2NB0 A;  5HGT A;  3L3O C;  1C0A A;  4UPA A;  4FNF A;  1KHI A;  3S2H H;  2MFI A;  1L1O B;  1E24 A;  1N33 Q;  3J81 E;  1VQO A;  2KCN A;  3UDF A;  3A0J A;  4G7H C;  1HRJ A;  3L2P A;  4YCW A;  2CWA A;  2NVY H;  2HQL A;  2MQH A;  4F8M A;  1TS5 A;  3A7L A;  3GTG H;  2EXZ A;  3BVM A;  2PQE A;  2VUM H;  4ABN A;  1SAP A;  1I3Q B;  2PYK A;  4A3D H;  5JJI A;  1IKM A;  1S5B D;  3C3L A;  1UE6 A;  1JWS D;  1X3P A;  2GVB A;  3PQI A;  4LUO A;  2CFM A;  3HFZ B;  4HSP A;  1ML0 D;  5C4Z A;  3DEP A;  4XDX A;  1XPU A;  3M7G A;  1AZQ A;  2NUC A;  1CKN A;  1M8A A;  2IWH A;  2F0D A;  4DAY A;  4JG2 A;  5GAG C;  1YNN C;  1NE3 A;  4PZ7 A;  4YCU A;  4JBW A;  5NUC A;  5D3D A;  3M85 A;  2F4V L;  2QIL A;  3S14 H;  3JAM i;  4R8N A;  3FEW X;  3CHB D;  1EY4 A;  3A8K E;  2K04 A;  4DR4 Q;  4N9T A;  4A3B G;  3FDT A;  1D5X C;  2HCC A;  3CQZ B;  5K5P A;  1UWV A;  1TVX A;  1QG7 A;  5CV9 A;  3DMU A;  2AQ2 B;  3W3A A;  3U9O A;  4DNT B;  3S1Q H;  2EJM A;  3J80 i;  2VQE Q;  2XN9 C;  1Y1W B;  3ERS X;  2OQK A;  3OSO A;  1O7Z A;  1SE3 A;  1NSN S;  4BY7 B;  5J39 A;  4B3M L;  5DEH A;  3GTQ H;  2R7Z G;  1VQ6 A;  1YIT A;  2A8V A;  1IL8 A;  1SRO A;  5C44 G;  4U68 A;  1HFG A;  2D2C C;  1NBW A;  3HOW H;  3J7A V;  5CBA E;  2EYJ A;  1TXY A;  1KD1 C;  4G57 A;  3SVM A;  4IQZ A;  5C4X H;  5BN5 A;  4YY3 L;  1BCP D;  4DXG A;  1IBL Q;  4KLK A;  2PNH A;  2O5I C;  2F0J A;  3P7J A;  4IFD J;  3K7A B;  2VUM G;  4YHH L;  4PQX A;  1AE2 A;  2PZT A;  4I7A A;  2L9H A;  2YTV A;  3DLL A;  1A2T A;  2K33 A;  4ZK9 B;  2MPM A;  3FKI G;  3ERO A;  3U4Z A;  4CDE C;  1LTA D;  3E0E A;  1VQM A;  4KJN A;  1KDA A;  2CCZ A;  4XIG S;  1D1I A;  3RZD B;  4NB3 A;  5LL6 S;  2WAC A;  4KTA A;  1ZKO A;  4R9W A;  5ELO A;  2KOL A;  2AQ1 B;  2B2U A;  2A68 D;  4DUY Q;  1H9S A;  2O4X A;  2EXD A;  1BO0 A;  3CP0 A;  3CAM A;  1U5K A;  2B29 A;  2FMC A;  2IHF A;  4S3S A;  4KK7 A;  2O2L D;  1EY0 A;  4B3T L;  1DJR D;  1X54 A;  2KCC A;  1I4Q A;  1L2F A;  4JW0 A;  3BYY B;  2HUG A;  3TP6 A;  4HMJ A;  4JBJ A;  4O2D A;  3PIO A;  2O5J C;  3SEB A;  2F0M A;  4JI3 L;  4HIK A;  1CKN B;  3M4Y A;  5KNC A;  2ASB A;  4EQ5 A;  3HOV H;  3I4L A;  3UE1 A;  3V05 A;  3BS1 A;  1JOO A;  1ICW A;  2VXW A;  4J6H A;  3BYT B;  4N8X 1;  3MXN A;  1B2T A;  2ALY B;  2E75 C;  1X9N A;  4RGO S;  2Q8T A;  4P72 A;  3K7U C;  2EYF A;  1HNZ L;  2HQE A;  3AB9 A;  3R3O A;  3TZU A;  2PQA A;  2R7D A;  1OXX K;  5CV7 A;  2HDM A;  2H5X A;  3QOL A;  1SYC A;  2V4D A;  3PSI A;  1YHQ A;  4L5S A;  3A55 A;  1KC8 C;  1PV4 A;  3HOW G;  1YIJ A;  4DK3 C;  1VQA A;  3CCJ A;  1R4P B;  4GNX B;  1STB A;  2QF7 A;  4HMI A;  1JB7 A;  1OO9 B;  1KNE A;  1C8C A;  3K59 A;  5C4X G;  1H9J A;  4DR2 L;  2EY1 A;  1NTG A;  1LV9 A;  1BOS A;  4V0B A;  1H9R A;  1HZ9 A;  2JA7 H;  3SK5 A;  4X65 Q;  1E3P A;  2F0P A;  4TVA B;  4DV0 Q;  1I6H H;  1EIG A;  4K8J A;  1EZ8 A;  1HHV A;  4HIO A;  3S1N H;  3K80 C;  2RF4 A;  5F2D A;  4TRD A;  1R9T B;  1VQ5 A;  4DR1 Q;  3KF6 B;  1LTT D;  1IYU A;  5IGC A;  4UDU C;  3K0Y A;  2L5T A;  4YWK A;  4PMW A;  1X3G A;  2K52 A;  4LNQ A;  4DA2 A;  3E9H A;  2Q2H A;  1Q1B A;  2IT1 A;  1HR0 L;  2KHS A;  3DWP A;  1XMQ Q;  3FVQ A;  5IWA L;  1JT8 A;  2IPK D;  3MFG A;  1DGS A;  4JI7 Q;  1K28 A;  1PVO A;  3GTP H;  3AEV A;  1OXU A;  5JJZ A;  4UP8 A;  4ODG A;  3T13 A;  3O13 A;  1H9M A;  5IE8 A;  5C5L A;  5JAV A;  2K03 A;  4K14 A;  3SR1 A;  1CK1 A;  1ICF B;  2JP1 A;  2C5C A;  3BDO A;  1AFP A;  1IHZ A;  4BBR B;  5ELE A;  2NZ1 D;  3T1Y L;  4CJ2 C;  2KEN A;  3T1H Q;  4AIM A;  1SFO B;  3LGJ A;  4A4I A;  4LF9 L;  1EY9 A;  4DV2 Q;  1ROD A;  3LWE A;  1E22 A;  1CT1 D;  2MHV A;  3ND9 A;  3R8B A;  3VDY A;  1HNW L;  1HNX L;  1Y69 U;  4X62 Q;  1HFN A;  1SYG A;  2Q8R E;  5CR3 A;  4NMZ A;  2A1A A;  1EY7 A;  4NP5 A;  1ENC A;  5C0X J;  1G51 A;  3J81 i;  1EZ6 A;  2F03 A;  1SMY D;  1LT5 D;  2EY6 A;  2X6G A;  4C1N K;  1VQF A;  1FYC A;  4KN4 C;  3VYR A;  5KND A;  4JOI C;  1C48 A;  2JA7 G;  1P16 A;  3G7L A;  2LSS A;  3RD4 A;  1V1P B;  3U50 C;  4PNY A;  2RBM A;  2X69 A;  4GZY C;  2EQS A;  4ZKB B;  3W1B A;  5M3M G;  4C2M B;  3E5S A;  2MUY A;  4Q0F A;  4FF3 A;  1K8M A;  1LYL A;  2RHS B;  1TS2 A;  2CW0 D;  3JC6 6;  3CCM A;  1I4R A;  4HID A;  1BKB A;  5FJ8 H;  1BR9 A;  1B1Z A;  2RCF A;  4PMC A;  1V9P A;  1NY4 A;  1QVF A;  3TP5 A;  4C3I H;  4UAI A;  4A3E B;  2R92 G;  2JA6 B;  2ZJR A;  4QL5 A;  2WV6 D;  3KLR A;  1PRT D;  2YU9 H;  1B53 A;  2XIW A;  4QQB X;  5LMU Q;  1CUK A;  4M8A A;  3ULP A;  2A19 A;  4NXN Q;  5IYD H;  4CBV A;  4OWT B;  3BVZ A;  4A3K H;  1HUM A;  5A2Q L;  3F2B A;  3AMU A;  1E1T A;  4Y7N B;  5C4J H;  1TWG B;  1IXR A;  3X3N A;  4KY6 A;  5FLX E;  4OIK A;  3PIP 3;  1JJ2 A;  4L8J A;  3RZO H;  1TQO A;  4JI1 L;  4JI2 L;  2OWO A;  4A3I B;  1HQM C;  3PUX A;  1YJ9 A;  1XNR Q;  1TWF H;  1BCP C;  5IOC A;  1K83 B;  1X6O A;  3HKZ G;  1CSQ A;  3JAM E;  4JI8 Q;  1SR3 A;  1PH8 A;  4JPB W;  3X3M A;  1WTX A;  4LF6 L;  5IGF A;  1LTL A;  1Q8K A;  1JC7 A;  5IT9 c;  4G7Z C;  4KHP Q;  1WJJ A;  3EQL C;  2E2H B;  4DR3 L;  2FIN B;  4HSV A;  3W1G A;  2MO0 A;  2EY2 A;  2N49 A;  5ELF A;  2A68 C;  4X66 L;  1D2B A;  4RKB A;  4HIM A;  3J80 E;  3D6W A;  3M3Y H;  4LF7 L;  1G6P A;  5KYI A;  1IZ6 A;  1M4V A;  1Q82 C;  3PUV A;  5JEA J;  4YY3 Q;  1G91 A;  2A6E D;  3VR4 A;  3S17 B;  3TRE A;  2FMM A;  3KF8 A;  4LMQ D;  4RH6 A;  1M1K C;  4YHH Q;  1K8A C;  5FJ8 G;  5M5W H;  4A3C H;  3S2D H;  3BDC A;  3WOE A;  4KKS A;  2R7F A;  3D4W A;  1CQV A;  1VDZ A;  2F0Q A;  3H91 A;  1WD1 A;  4C3I G;  1SRU A;  3I91 A;  3EFX D;  1FNV A;  1I5F A;  4DF7 A;  3QO2 A;  4BA1 I;  2I0Q A;  2OF1 A;  5IYD G;  1XPR A;  3JAM L;  3FRP B;  1N34 L;  2I5L X;  2VW9 A;  3C1F A;  4IO9 A;  4A3K G;  1YNJ D;  5HY6 A;  4A3J H;  4BY1 H;  3M4P A;  4B3T Q;  4RCO A;  1B70 B;  4GLV B;  1XTD A;  2DNC A;  4AQY L;  3KDF B;  4OHJ A;  4JI3 Q;  3D31 A;  4GKK L;  4QB4 A;  2HHH Q;  1EQQ A;  3J80 L;  5EQ0 A;  3HOX H;  1X56 A;  2R7Z B;  1OXS C;  4KHV A;  2Q2T A;  1S5D D;  5CV4 A;  1PH2 A;  4CJ1 B;  4NDX A;  1S40 A;  2B63 H;  5C3W A;  2NVT H;  1JJG A;  4L5T A;  5BN3 A;  3S2H B;  4QY7 A;  1FVI A;  4P73 A;  2UUC Q;  2F0G A;  3LNN A;  3QJY A;  4PZ8 A;  4QMG A;  4LF5 Q;  3IAY A;  4EQN A;  1F2Z A;  2A69 D;  3WOF A;  2IHE A;  3GTG B;  5KIX A;  2VUM B;  4GN5 A;  4K5X A;  4BXX H;  2F0O A;  4A3D B;  5ELB A;  4POG A;  5T1I A;  1W2B A;  4C3J H;  1D8L A;  2NVX H;  4FDB A;  3C46 A;  3I70 A;  1NR2 A;  4CDD C;  2B39 A;  1YVC A;  1WVL A;  4HJ7 A;  3FP9 A;  2BOS A;  2LXK A;  4ZUI A;  2E2I H;  1X32 A;  3I4N H;  1KNA A;  1XNQ L;  4A3C G;  2RSO A;  3OWE B;  4XQQ A;  3T56 B;  1JCK B;  5I4D A;  4X3U A;  1EIF A;  1FJG Q;  1SNP A;  2QW7 A;  3KLS A;  2NZH A;  3OW2 A;  1NR4 A;  3KJP A;  2GN5 A;  1BBW A;  2Z0S A;  5D14 A;  3S14 B;  2OXP A;  4JK1 C;  1F2L A;  1GO3 E;  1TWA H;  3ZYY X;  1GUG A;  3TQY A;  2KCM A;  4MHE A;  4DPG A;  5AJ3 L;  5COR A;  3GTL B;  1WOC A;  3OTO L;  4DR7 L;  1SJE D;  3CCS A;  4R4T A;  3NWT A;  5IWA Q;  2OTL A;  4A3J G;  1HZC A;  1GOZ A;  1U0L A;  1KQS A;  4BY1 G;  1DYQ A;  1GJX A;  3UI2 A;  1M90 C;  1I4G A;  3G48 A;  1JJC B;  4RGT A;  4EX5 A;  3PF4 A;  3H3V H;  2B2V A;  2ZM6 Q;  1K0R A;  1KDC A;  4FVM A;  3S1Q B;  2F1M A;  2N55 A;  1SMY C;  2A73 B;  3MXP A;  3HOX G;  1QWY A;  4IJH A;  5I2X A;  4NXM L;  4WJ3 M;  3PO3 H;  1LAB A;  1A3T A;  1S5C D;  2QEX A;  1VQH A;  3HKZ E;  4JI4 L;  1F9P A;  2DY8 A;  1R4Q B;  2F3I A;  4LJZ C;  2PZW A;  1HNW Q;  4GLX A;  1U9R A;  3E3X A;  2CW0 C;  4XT3 B;  3OWF A;  1EIH A;  2ENB A;  3GTJ H;  1RTN A;  2L55 A;  5FO8 B;  1CSP A;  1B4O A;  3CRL C;  2NYZ D;  2HCI A;  1LT6 D;  4BXX G;  3I90 A;  1EY6 A;  2DY7 A;  5DAU A;  4C3J G;  2RA4 A;  4KMU C;  1SNO A;  2OTJ A;  3D8G A;  1PZI D;  1XMO L;  1JIC A;  1PRT C;  5C6A A;  5M5X H;  3K5M A;  3I73 A;  1MGS A;  3TP8 A;  2AHO B;  2RVL A;  3KBG A;  3VR6 A;  4DV1 L;  3RLF A;  4OGQ C;  4DV7 L;  1TII D;  4FF2 A;  4YIJ A;  3H6M A;  4ZLT F;  2WFW A;  2I46 A;  1S3O A;  2Z4I A;  2CQO A;  5KGU A;  1WTO A;  2F0T A;  3GQB A;  4PZ6 A;  5IIF A;  1EIY B;  1LAC A;  4EVO A;  1J6Q A;  5CYU A;  2UUB L;  3GV3 A;  4K2K A;  4F7X A;  3H0G H;  2XVS A;  2WAQ E;  3HOU H;  5JJK A;  1QCB D;  5HGQ A;  1YHA A;  1WCM B;  1H9K A;  2NTT A;  1FNU A;  2UXB L;  3ONA B;  4DV3 Q;  1QNU A;  3NTI A;  2LKV A;  4R4O A;  4DAM A;  5JPM C;  3UDX A;  1GUS A;  2ICE C;  3FKI H;  4NPS A;  1LUZ A;  1CFM A;  3HOV B;  1A63 A;  5C5M A;  3F1Z A;  5LMN W;  1SYD A;  2C35 B;  1WTP A;  2BCO A;  1GUW A;  1KXL A;  1PH7 A;  4YWL A;  2RDG A;  1G8Z D;  2MO1 A;  1IBK Q;  3PV0 A;  1IBM Q;  2XGT A;  2RDH A;  4GOP B;  1A8V A;  2PNR C;  3NPP A;  3PO3 G;  4FF4 A;  1W6K A;  2OEO A;  3OPO A;  1D7Q A;  1UAP A;  4JI1 Q;  5GAH C;  3SHL A;  3QG1 A;  2PZU A;  2A6E C;  1K8G A;  1GUO A;  1TWH H;  2WP8 J;  3S15 H;  3D4D A;  4QCL A;  2L0C A;  2QDL A;  2LMC B;  3W2D A;  1SND A;  1JWM D;  2UXD L;  5DLQ E;  4KN7 C;  5HUR A;  3J81 L;  4HJ5 A;  2RKS A;  4CDF C;  2RDF A;  1NJI C;  4FXK C;  2JA7 B;  4LF6 Q;  2JA5 H;  1RD9 D;  4I7Z C;  2NVQ H;  3J7A F;  4JBK A;  1I6H B;  5M5Y B;  4LFA L;  1GVP A;  3S1N B;  3A8J E;  3BU2 A;  4JOI A;  1KRT A;  4CHT B;  1XWE A;  4DR6 L;  4OO1 H;  3J7Y W;  4Y52 H;  4JV5 Q;  3AQQ A;  3NQT A;  1RKN A;  1YNJ C;  1WTR A;  2HT1 A;  1VQN A;  4DAV A;  2CH4 W;  2WIN B;  3H94 A;  1JOK A;  4KKU A;  4ZUJ A;  4NKL A;  3GTP B;  1ET6 A;  3H0G G;  3HOU G;  3NBH B;  1JR0 D;  2KCT A;  2Z9H A;  2NN6 I;  3NEN A;  5CMD A;  4P71 A;  4NW2 A;  4A3G H;  2Q2U A;  1L1O C;  2PO4 A;  1Y1V B;  4IOA A;  2B3G A;  2MJ8 A;  1LTG D;  3ND8 A;  3T16 A;  2AQ3 B;  4JI5 L;  5IGG A;  3K57 A;  3J7Z C;  2F3W A;  5EJW A;  1V43 A;  1J5E Q;  2VQF Q;  2K1B A;  1ZEQ X;  1QUQ A;  1MI2 A;  2K01 A;  4FXD A;  2A69 C;  1QE6 A;  2I07 B;  3D4R A;  4RG1 A;  4RCN A;  1L0W A;  2CHB D;  3OOC A;  4KV6 A;  1D5M C;  2PMZ E;  3HOY B;  4FYD A;  4JI6 L;  3EA6 A;  4KI0 A;  4LF8 Q;  3TS2 A;  4ZAI A;  4E6I A;  5BR8 L;  3VYT A;  5C3E B;  4LF4 L;  4JYA L;  1TS3 A;  3TN2 A;  3GTM H;  1VQ7 A;  1SBB B;  4DAY B;  1TY2 A;  4YCV A;  1K3R A;  4H7B A;  2JA5 G;  1DM0 B;  2M2L A;  1RTO A;  2XSC A;  3EIV A;  4RHR A;  3L0O A;  2F0K A;  5EKK A;  1C9O A;  3HEJ A;  4R4Q A;  4A3F H;  3F2U A;  4OO1 G;  1JOQ A;  1HJP A;  2UUA L;  2ZXO A;  3RNU A;  1BVS A;  3MZ5 A;  4J1M A;  3M4O H;  2E5L L;  4B3R L;  4AYB G;  4C3I B;  5LMN Q;  1YI2 A;  2VS1 A;  5JJL A;  1XNQ Q;  3RMH A;  1RJT A;  1WTQ A;  3NSW A;  1WD0 A;  4HN7 A;  1N36 Q;  4IOC A;  3UDI A;  1VS0 A;  4A3G G;  4KKT A;  1FGB D;  3E9I A;  2YTX A;  3KK7 A;  2SOB A;  5ISR A;  4HTH A;  2FHT A;  1TWC H;  3I72 A;  3RLO A;  4JC0 A;  3CQZ H;  4A3K B;  1SXT A;  5M3M H;  1KAA A;  5C4J B;  2F0F A;  4K0K L;  3NEL A;  5AJ3 Q;  1PTO B;  1X65 A;  1Y8O B;  1TS4 A;  3RZO B;  3OTO Q;  1Z6H A;  2DJG C;  1CHP D;  5E3F A;  2EJF C;  1SYB A;  5LL6 X;  3ULJ A;  4KD3 A;  3A8I E;  2K5N A;  1TWF B;  1I6V C;  2R92 H;  1JMC A;  4IN3 A;  2F0V A;  5C0X I;  5FKA C;  1BUV T;  1CTM A;  3NBI A;  3QOJ A;  4K5V A;  5EPJ A;  4ZYS A;  2BDN A;  4DV4 Q;  4R1J A;  2L15 A;  2EJG C;  2HIX A;  3Q6S A;  3CCU A;  2XWB B;  5IYB H;  4JI0 L;  3DWQ A;  1H9S B;  2RHQ B;  1EU3 A;  2DN8 A;  1HZB A;  5JVG 3;  5J22 A;  3M3Y B;  4K6D A;  1DD2 A;  3H09 A;  1KRS A;  4L6T B;  1EEI D;  3IL8 A;  2Z8L A;  4DV5 Q;  3T4A C;  3OMC A;  4X3T A;  4A3F G;  1N32 Q;  2EIF A;  2FJ2 A;  5M5W B;  3BZD B;  4A3M H;  5K36 G;  1MSG A;  4ID6 A;  1Z7T A;  1VQE A;  1UE1 A;  3RZD H;  2ES2 A;  5EBD A;  2EYP A;  1WFQ A;  4LW1 A;  4XYQ A;  1FGU A;  4XQN A;  1VQ9 A;  2B2T A;  2F0S A;  3MXN B;  5DM7 3;  3KJO A;  1B44 D;  4ILW A;  3PO2 H;  2PQA B;  2BA1 A;  4B3S L;  1AEX A;  1DCZ A;  4QGU A;  3N52 A;  1EYC A;  2IL8 A;  2DNE A;  4RGN A;  5GQO A;  3BZK A;  4GNX C;  2DJF C;  1EYD A;  5D65 A;  2JA8 B;  3R2T A;  2QKI C;  4BY1 B;  4K2L A;  2UUB Q;  2ATW A;  3KLW A;  3I55 A;  1E2Z A;  2YV5 A;  3NWS A;  5EKI A;  2IX3 A;  1RF2 D;  5FOB B;  2UXB Q;  2QGQ A;  3OIP A;  4DR5 L;  1ASZ A;  2K5D A;  3Q0A A;  1Y1W G;  3TP7 A;  4LFC L;  3CCQ A;  3URY A;  4WFN 3;  3HOX B;  1STH A;  1LT4 D;  4RHS A;  2J0T D;  1PYW D;  4BBS B;  2EOT A;  1MHW C;  3HS0 C;  1N8R C;  4TSS A;  4HJ8 A;  2B63 B;  1VQJ A;  4PG3 A;  2R61 A;  4G4K A;  4X3K A;  2F4V Q;  1X3F A;  1IYV A;  2LFN A;  2X6L A;  1ZYR D;  3Q22 A;  4J15 A;  3VYS A;  4HR7 B;  5IYB G;  4F87 A;  4H02 A;  1A3V A;  2E8G A;  2NZO A;  4XYO A;  1I94 L;  4WJ4 A;  1C4Q A;  3ULL A;  5EPL A;  1G6Z A;  1CM9 A;  1J8I A;  1GHK A;  4C3J B;  2NVX B;  3K6O A;  1SE2 A;  3RR5 A;  3MVV A;  4MN3 A;  3CPF A;  1HR0 W;  2E2I B;  3I4N B;  3I3C A;  2EY5 A;  1TKW B;  1VF7 A;  4A3M G;  1E2V A;  2RQX A;  1I4X A;  3TS0 A;  1R9T H;  3ERQ A;  3CU7 A;  1VQL A;  2JN4 A;  4GKJ L;  1LTB D;  1UNS A;  2QDB A;  4B3M Q;  2ICI A;  4P75 A;  3S1R B;  2XRQ D;  2K75 A;  2K05 A;  1NMF A;  4AYB E;  4DR4 L;  4I65 A;  2ID0 A;  1PH3 A;  1NUC A;  3CC7 A;  1AP0 A;  2Z6B A;  5IT9 E;  1NAP A;  3JAM c;  3PO2 G;  3BG3 A;  2Z1C A;  5I2Y A;  1W3S A;  4IUQ A;  4EQO A;  2IY5 B;  4DUZ L;  4IUN A;  4H13 C;  1ASY A;  2L12 A;  4IPD A;  4K5W A;  1Y8P B;  2VQE L;  5CGK A;  1Q8I A;  4OEL B;  2VY3 A;  1F9R A;  1S5E D;  4AH6 A;  3KLS X;  2PW7 A;  1FR3 A;  2N88 A;  4M1U B;  4QUF A;  5FLX L;  1MKH A;  4H0L C;  4N9P A;  3ER0 A;  2FFK B;  1BF4 A;  2J7Z A;  3J80 c;  1ESF A;  5E4W C;  2F4I A;  1Q3L A;  2K4K A;  3KFU A;  1IW7 D;  5KRU A;  2WAQ G;  1DOM A;  4TKO B;  5JOB A;  4XQJ A;  1JQY D;  2N3S A;  4P2C B;  1O7L A;  5ELD A;  1IBL L;  1BCP F;  1F2M A;  1MJE A;  2AUJ D;  3DXJ C;  2GA4 B;  4A3B B;  4N8F A;  5KNB A;  1PH4 A;  5T1G A;  3GTJ B;  3F8T A;  3HOZ H;  4V19 0;  1EU4 A;  2GVA A;  1P8L A;  5I6Y A;  4BA2 I;  1GUN A;  4HJA A;  5IGD A;  1KTK A;  4HJ9 A;  2EYH A;  1Z9F A;  1EUJ A;  1I4H A;  1QZG A;  2YYZ A;  3M7N A;  3G71 A;  1SE8 A;  2YTY A;  1E2W A;  1LT3 D;  3KBX A;  3RUZ A;  1VQC A;  5C44 B;  4C1N I;  4DUY L;  3GTK H;  3CKI B;  1X3E A;  4IPG A;  3NQI A;  4MIU A;  3SK4 A;  1HNZ Q;  1L0X B;  5FLM H;  2EDG A;  4GS3 A;  2E2J H;  1F2Y A;  1KAW A;  2FXQ A;  2AUK A;  1HZA A;  1SNC A;  1DOL A;  2NVY B;  2BA0 A;  1Q90 A;  2NBF A;  1I50 H;  3QWN A;  1VQB A;  5DM6 3;  2D62 A;  1CA6 A;  4K8I A;  5J3B A;  5EGT A;  4LK1 C;  2K6A A;  3SK6 A;  2B2W C;  4DR2 Q;  3SDZ A;  3FKI B;  3M9B A;  1O7I A;  3HGB A;  4DNI A;  3CF5 A;  1PZJ D;  1OTC A;  4Y7N H;  3M4Q A;  2SNS A;  3D0F A;  1EYA A;  1TWG H;  1L1O A;  3IFT A;  1GD7 A;  4BBR G;  1B50 A;  1NNX A;  3J81 j;  4A3I H;  5IYC H;  1ENF A;  3LWU A;  3I4O A;  3GTO H;  3PUZ A;  1MD2 D;  3U4V A;  1AH9 A;  1PFM A;  3EVQ A;  3I4M H;  1MSH A;  3C1E A;  1U4R A;  1J9O A;  4HAE A;  4OWW B;  4IUT A;  3S1M H;  4CKB A;  5A35 A;  2R93 H;  1SNQ A;  1B3Q A;  3KOJ A;  3KF8 B;  1HR0 Q;  2NTS A;  1EWC A;  3S15 B;  1TWH B;  2KHI A;  4CKC A;  1VQ8 A;  4BWG B;  1B7Y B;  3HOZ G;  1YBY A;  1C7Y A;  4DU9 A;  1WTW A;  1EL0 A;  1RL2 A;  4QF4 A;  4DV0 L;  1EFI D;  3NXW A;  1W6J A;  3W5O A;  2E2H H;  3EJI A;  4H44 C;  2KUM A;  5EKL A;  2HD3 A;  4DR1 L;  1LTS D;  4ZRZ A;  4DK1 A;  1PYB A;  1T5X D;  3GTQ B;  1HTL D;  1PXU A;  3WDN A;  2H4O A;  4RKL A;  4FF1 A;  2KBN A;  3S17 H;  1STA A;  1GXD C;  1V1Q A;  3T1Y Q;  1HQR D;  4OON A;  4LF9 Q;  1CZG A;  5FLM G;  3HOW B;  4JI7 L;  3PCO B;  2IJ0 A;  1HNX Q;  1F9S A;  4A3E G;  4UP7 A;  2AMC B;  3ITP A;  5C4X B;  1S72 A;  4LUZ A;  3HKS A;  2VZA A;  1CA5 A;  2SDF A;  2EZV A;  1EY8 A;  4LWC A;  5IOD A;  1WYD A;  2SNM A;  3I7F A;  2F0W A;  1CZW A;  4A93 H;  1Q7Y C;  5KEE A;  4A3L H;  1BQQ T;  1Y14 B;  3T1H L;  2JJQ A;  2QEJ C;  2F0N A;  4DV2 L;  3A56 A;  1H95 A;  4R4C A;  4IUU A;  4QIW E;  5L37 A;  5CV8 A;  1SEB D;  4A3I G;  5IYC G;  4EQP A;  1ZYR C;  2KHJ A;  2OT2 A;  2EYM A;  4KY7 A;  3VA7 A;  1YZ6 A;  3I4M G;  3FPU B;  4KJO A;  2KEE A;  5JPN C;  2F0U A;  2OQ0 A;  1MJC A;  3OMG A;  2BH8 A;  5AFW A;  2R93 G;  3OW7 A;  4U67 3;  5M3F H;  4IZ8 A;  3SGI A;  1PMR A;  1S4Z A;  1CKM A;  4CJ0 B;  1QNK A;  3BVG A;  4FO2 A;  5CV5 A;  3J81 c;  1RDP D;  3BDL A;  3GTM B;  1SE4 A;  2JEA I;  3NP8 A;  3QR8 A;  1EQR A;  1LTR D;  5BN4 A;  4HED A;  1EQT A;  3NE5 B;  1SDF A;  4YWM A;  3RLN A;  1D1K A;  1HTP A;  4X64 L;  2MGS A;  3CD6 A;  2XWJ B;  4ULL A;  1FD7 D;  2BDO A;  3L7Z C;  1UEA B;  3QB3 A;  3DHQ A;  1I94 Q;  1STE A;  1PLF A;  1B9M A;  1XYI A;  4JI2 Q;  1PFS A;  2RSN A;  3B6Y A;  4A3F B;  1JB3 A;  3P20 A;  1KLG D;  5IGE A;  4O42 A;  3F2D A;  3GV6 A;  5I9O A;  1X55 A;  2AKW B;  1T9H A;  3M4O B;  3PMF A;  4DFA A;  4IFD I;  2K32 A;  1PRT F;  5LMU L;  2BH2 A;  3H15 A;  4O1N A;  1EFW A;  4NXN L;  4WOR A;  5FO9 B;  1L0Y B;  2B2Y C;  2EYL A;  4RMF A;  4GKJ Q;  2Z6K C;  1PTO D;  2P5Z X;  4A93 G;  3GTL H;  4P74 A;  1TWC B;  4A3L G;  3PGZ A;  3TRZ A;  1QVC A;  1IW7 C;  4OEM B;  5C4H A;  4DKA C;  3NTK A;  5M3M B;  3R2I A;  1XNR L;  4DR3 Q;  2PCF B;  5IGB A;  4B9W A;  2VB2 X;  1F9Q A;  4X66 Q;  4DUZ Q;  3G6J B;  4LF7 Q;  1EQV A;  1RIP A;  1A6X A;  4GNX A;  2F3V A;  1G29 1;  2K14 A;  1HA5 A;  4RFB A;  4JI8 L;  2R92 B;  2F0I A;  3GDE A;  3AU7 A;  1GUT A;  4L5Q A;  3T51 B;  2DGY A;  5M3F G;  5EAY A;  4C3H H;  1V1O A;  2D0O A;  3MC0 B;  4KHP L;  4IAL A;  2JSO A;  4JCV E;  1KAB A;  3KF6 A;  4GLA C;  2EVB A;  4DAP A;  2N78 A;  2K5Q A;  1ILP A;  1STY A;  1VQK A;  5C3X A;  1N34 Q;  2DUD A;  2ZJP A;  2NWG A;  4IUV A;  4X3S A;  3I56 A;  1EY5 A;  1Q1E A;  3A54 A;  1DON A;  4XT1 B;  4A3D G;  1TU2 B;  2LS0 1;  1B3A A;  5ELN A;  2CQA A;  2F52 A;  1T5E A;  1XXG A;  3VA5 A;  1I4P A;  2CVR A;  4AQY Q;  1KIX A;  3HKZ B;  2K5H A;  4RA8 A;  3S16 H;  1N9W A;  1QZH A;  2D5D A;  4A3M B;  4GKK Q;  5FO7 B;  1DOK A;  4TQU S;  1EOV A;  1PYS B;  2VL6 A;  4GN3 B;  4J8Q A;  3HRZ C;  3TME A;  4GOP C;  1UE5 A;  1V8Q A;  1Y8N B;  1O78 A;  1K8O A;  3HG9 A;  3GP7 A;  2XRS D;  5IY0 A;  1AW7 A;  2Y0S G;  1QIL A;  2AWN A;  3WWV A;  3PO2 B;  2F0L A;  3NUC A;  1STN A;  4XTC S;  1OXV A;  1E0B A;  3MTS A;  1WCM H;  1BNZ A;  1PZK D;  1I3Q H;  4EGV A;  1JWU D;  4DK6 C;  5COY A;  2B2V C;  1IKL A;  2I5M X;  4MTN A;  4JVZ A;  2HHH L;  2F0E A;  1YHB A;  2HDL A;  4QIW B;  2ZT9 C;  1SSO A;  3NHH A;  2LXJ A;  5J1Z A;  3CCL A;  5K36 H;  5E1F A;  4IJL A;  4DV6 L;  2G9D A;  5IP9 H;  4L5R C;  4IFD H;  2KA7 A;  4X6A H;  1A15 A;  1II3 A;  4R8I A;  1V1P A;  2YU9 B;  2WAQ B;  4C3H G;  2UUC L;  4OL7 A;  4C56 C;  4UY8 C;  3K81 C;  4LF5 L;  4DK0 A;  2L11 A;  3CCE A;  3AFP A;  2WB1 G;  2MP1 A;  1RCV D;  1EWI A;  3MWY W;  3CC2 A;  4GN4 B;  1PH9 A;  4RAU C;  5ELC A;  2IW3 A;  3VR2 A;  3GO5 A;  1QJO A;  2TMP A;  2UU9 L;  3EBE A;  3S24 A;  4DR7 Q;  5EPK A;  4RGM A;  3E0J A;  3PIO 3;  2JEB I;  1Y1W H;  4Z9C B;  5I6W A;  5M9O A;  3CW2 C;  2SEB D;  4BY7 H;  2ZXR A;  5D3I B;  1FJG L;  3MEH A;  4QJF A;  5M5Y H;  1VMP A;  4WJW A;  5KYL A;  1K9M C;  2OCE A;  2B8G A;  2JA9 A;  3CMA A;  3T53 B;  2M9V A;  1SYF A;  3QIA A;  4NXM Q;  2NN6 H;  1Q81 C;  1BBU A;  4R4I A; 
#chains in the Genus database with same CATH homology
 3H3V H;  1SRO A;  1ASY A;  2ZM6 Q;  1K0R A;  5C44 G;  4JI4 Q;  4LFB L;  4IPD A;  2VQE L;  1QUQ B;  1NBW A;  4LUV A;  2VY3 A;  3HOX G;  3U58 A;  3HOW H;  4IJH A;  3K7A H;  4AH6 A;  4NXM L;  4WJ3 M;  3PO3 H;  1TXY A;  1WCM G;  1KD1 C;  3CC4 A;  1MKH A;  1Z47 A;  3ER0 A;  2ZM6 L;  2QEX A;  1VQH A;  3HKZ E;  4JI4 L;  5C4X H;  4YY3 L;  3J80 c;  1IBL Q;  4KLK A;  2PNH A;  2F3I A;  1Y1V H;  4IFD J;  3IRB A;  2VUM G;  4YHH L;  1OXT A;  2K4K A;  3HOV G;  3KFU A;  1HNW Q;  4GLX A;  1AE2 A;  2WAQ G;  3OYY A;  2YTV A;  2N3S A;  3GTJ H;  3DLL A;  1IL2 A;  1XMO Q;  1IBL L;  4OX9 L;  1CSP A;  5IP9 G;  1MJE A;  3FKI G;  2UXC L;  3U4Z A;  4IFD G;  3E0E A;  1VQM A;  4BXX G;  2CCZ A;  4IPH A;  4XIG S;  1PH4 A;  4DV1 Q;  4NB3 A;  4DV7 Q;  3F8T A;  3HOZ H;  3PF5 A;  5ELO A;  2OTJ A;  2GVA A;  3PIP A;  1P8L A;  1B8A A;  3CCR A;  1XMO L;  4BA2 I;  4OXP A;  2ZTD A;  2PI2 E;  4HJA A;  5M5X H;  4DUY Q;  1PHJ A;  1YEZ A;  2EXD A;  4HJ9 A;  3HOY H;  3CP0 A;  3CAM A;  1U5K A;  2B29 A;  2AHO B;  1Z9F A;  1EUJ A;  2IHF A;  4DV1 L;  1QZG A;  2YYZ A;  3RLF A;  3M7N A;  5C3E H;  4DV7 L;  4B3T L;  3G71 A;  2RCN A;  2IX1 A;  1SE8 A;  1X54 A;  2WFW A;  2YTY A;  3BZC A;  1S3O A;  1L2F A;  2CQO A;  1VQC A;  4PZ6 A;  1EIY B;  4DUY L;  4JBJ A;  4O2D A;  3PIO A;  3GTK H;  2V1C C;  4IPG A;  1X3E A;  4A76 A;  2I5H A;  4JI3 L;  1J6Q A;  4HIK A;  1HNZ Q;  3RN5 A;  1CKN B;  4BY7 G;  5FLM H;  4GS3 A;  2UUB L;  3H0G H;  3HOU H;  2WAQ E;  2ASB A;  5JJK A;  5HGQ A;  1YHA A;  4EQ5 A;  2E2J H;  1KAW A;  3UE1 A;  3HOV H;  3STB D;  2VNU D;  2FXQ A;  2UXB L;  1N33 L;  1YNX A;  4DV3 Q;  1Q12 A;  1HZA A;  4X64 Q;  4R4O A;  4DAM A;  4KHZ A;  1E7Z A;  2ALY B;  2BA0 A;  1X9N A;  1SLJ A;  4P72 A;  3K7U C;  1HNZ L;  1I50 H;  3UDX A;  2NN6 G;  3FKI H;  4NPS A;  1VQB A;  1LUZ A;  2PQA A;  2R7D A;  1A63 A;  3F1Z A;  1OXX K;  2D62 A;  5LMN W;  2C35 B;  5J3B A;  3ICE A;  2K50 A;  2H5X A;  1KXL A;  1PH7 A;  3PSI A;  4YWL A;  3KDF A;  1YHQ A;  2MO1 A;  4L5S A;  4DV3 L;  1KC8 C;  1PV4 A;  1IBK Q;  4DR2 Q;  3PV0 A;  1IBM Q;  1VCI A;  2XGT A;  3HOW G;  2Y0S E;  4GOP B;  1A8V A;  3M9B A;  1O7I A;  4DNI A;  3CF5 A;  3PO3 G;  1YIJ A;  1PA6 A;  4DK3 C;  1OTC A;  1VQA A;  3M4Q A;  4Y7N H;  3D0F A;  1JE5 A;  1K73 C;  1TWG H;  1D7Q A;  3CCJ A;  3I2Z A;  1L1O A;  4JI1 Q;  5GAH C;  1GD7 A;  4GNX B;  1JB7 A;  5C4X G;  4BBR G;  2UXD Q;  3J81 j;  2PI2 A;  4A3I H;  5IYC H;  1Y1V G;  1IBK L;  4DR2 L;  3I4O A;  1IBM L;  1NTG A;  3GTO H;  3PUZ A;  1K8G A;  3U4V A;  5FLX c;  3CME A;  2K5V A;  1AH9 A;  3S15 H;  1TWH H;  2WP8 J;  1HZ9 A;  3I4M H;  4OWX B;  2JA7 H;  4X65 Q;  5E7N A;  1E3P A;  4A75 A;  4OWW B;  3S1M H;  3CCV A;  4LFA Q;  2Q2I A;  4TVA B;  4DV0 Q;  2UXD L;  5DLQ E;  3KOJ A;  4HJ5 A;  1I6H H;  3KF8 B;  2R93 H;  4HIO A;  1QVG A;  1HR0 Q;  3S1N H;  3K80 C;  2RF4 A;  1VQ5 A;  1UEB A;  2JQO A;  2KHI A;  1NJI C;  4DR1 Q;  3KF6 B;  1VQ8 A;  4DR6 Q;  1VQI A;  4LF6 Q;  2JA5 H;  1B7Y B;  2N8N A;  2NVQ H;  3HOZ G;  4JBK A;  1YBY A;  4PMW A;  4YWK A;  3CXC A;  1X3G A;  1C7Y A;  1RL2 A;  2K52 A;  3J7A 5;  4LFA L;  1GVP A;  4DV0 L;  4LNQ A;  3BU2 A;  3E9H A;  2Q2H A;  4JOI A;  1Q1B A;  5GAD C;  2IT1 A;  1HR0 L;  1KRT A;  3W5O A;  2E2H H;  3HOY G;  1XMQ Q;  4DR1 L;  2WB1 E;  4DR6 L;  5IWA L;  1JT8 A;  5C3E G;  4JI7 Q;  1DGS A;  1PYB A;  4Y52 H;  1PVO A;  1PH5 A;  3GTP H;  1VQP A;  3AEV A;  3AQQ A;  1OXU A;  4JV5 Q;  4UP8 A;  2KBN A;  2HT1 A;  3FHW A;  3S17 H;  2CKZ B;  1V1Q A;  3T1Y Q;  4UP9 A;  4BBR H;  1VQN A;  4OON A;  5IE8 A;  5FLM G;  4LF9 Q;  1SFO H;  3H0G G;  4POF A;  3HOU G;  3NBH B;  4JI5 Q;  1IYJ B;  4JI7 L;  2KCT A;  3UE0 A;  2NN6 I;  3NEN A;  1AE3 A;  3EN2 A;  3PCO B;  1PH6 A;  4JV5 L;  4P71 A;  1HNX Q;  3H3V I;  2IX0 A;  4A3E G;  4UP7 A;  2AMC B;  1VQ4 A;  4A3G H;  1S72 A;  3T1Y L;  1L1O C;  2Q2U A;  2KEN A;  3T1H Q;  4LUZ A;  4AIM A;  3HKS A;  2VZA A;  3LGJ A;  4A4I A;  4IOA A;  4LF9 L;  3UDG A;  2B3G A;  4DV2 Q;  1E22 A;  4LWC A;  3A5Z B;  1WYD A;  1WI5 A;  4JI5 L;  1YJN A;  3I7F A;  3VDY A;  4ME3 A;  1HNW L;  3NEM A;  4A93 H;  4IPC A;  3J7Z C;  1HNX L;  1Q7Y C;  2CWP A;  4X62 Q;  4A3L H;  1Y14 B;  1V43 A;  1J5E Q;  3T1H L;  2A1A A;  2JJQ A;  2VQF Q;  1QUQ A;  4JI6 Q;  4DV2 L;  5C0X J;  2JE6 I;  5BR8 Q;  1G51 A;  4R4C A;  3Q8D A;  1H95 A;  3J81 i;  4LF4 Q;  4JYA Q;  4QIW E;  4RG1 A;  1L0W A;  2IY5 B;  1VQF A;  5IYC G;  4A3I G;  2Z6K A;  2KHJ A;  1J5E L;  4C2M H;  3PUY A;  2VQF L;  2PMZ E;  1YZ6 A;  2JA8 H;  2JK8 A;  4JOI C;  4JI6 L;  3I4M G;  5C0X G;  5H1S E;  2JA7 G;  4KI0 A;  1P16 A;  4LF8 Q;  2OQ0 A;  3TS2 A;  2LSS A;  1MIU A;  1MJC A;  3PUW A;  3U50 C;  5BR8 L;  2BH8 A;  4LF4 L;  4JYA L;  2R93 G;  2EQS A;  5IP7 H;  5M3F H;  3GTM H;  1VQ7 A;  4DAY B;  3SGI A;  3W1B A;  5M3M G;  1CKM A;  1NMG A;  1LYL A;  4YCV A;  2RHS B;  1XJV A;  1K3R A;  4A3E H;  2D0P A;  1A62 A;  2JA6 H;  3AYH B;  3JC6 6;  2JA5 G;  3CCM A;  2UUA Q;  4HID A;  1A0I A;  3EIV A;  1BKB A;  3L0O A;  5FJ8 H;  4LF8 L;  3J81 c;  4BBS H;  2E5L Q;  3K8A A;  2ZTE A;  1SN8 A;  4B3R Q;  2AWO A;  1V9P A;  4APV A;  2JEA I;  1EQR A;  3DM3 A;  1NY4 A;  3K0X A;  1QVF A;  1C9O A;  4DV6 Q;  4C3I H;  2R92 G;  4YWM A;  3RLN A;  4R4Q A;  4A3F H;  2ZJR A;  4X64 L;  4OO1 G;  1HH2 P;  1HJP A;  1EYG A;  4QL5 A;  2UUA L;  3CD6 A;  1KL9 A;  3L7Z C;  3RNU A;  1BVS A;  2YU9 H;  3M4O H;  2E5L L;  4QQB X;  5LMU Q;  4B3R L;  1CUK A;  3ULP A;  4AYB G;  2A19 A;  5LMN Q;  1I94 Q;  1YI2 A;  4NXN Q;  5IYD H;  2VS1 A;  1PFS A;  3B6Y A;  4JI2 Q;  3PF4 A;  1XNQ Q;  1PH1 A;  5JJL A;  4OWT B;  3ZJY C;  3F2D A;  1X55 A;  2AKW B;  1T9H A;  4A3K H;  3F2B A;  3G4S A;  4K0K Q;  3AFQ A;  1E1T A;  1N36 Q;  1GKH A;  5C4J H;  4IOC A;  2UU9 Q;  4IFD I;  1IXR A;  3UDI A;  5LMU L;  1VS0 A;  2BH2 A;  3H15 A;  1JJ2 A;  3A5U A;  5LMN L;  1EFW A;  4A3G G;  3E9I A;  1K83 H;  2YTX A;  4NXN L;  4JI1 L;  3RZO H;  4JI2 L;  2OWO A;  1TWC H;  3PUX A;  3RLO A;  1YJ9 A;  4RMF A;  4JC0 A;  3CQZ H;  1XNR Q;  4GKJ Q;  3A74 A;  2Z6K C;  5M3M H;  1TWF H;  4K0K L;  3GD7 A;  3NEL A;  5AJ3 Q;  1X65 A;  1N36 L;  4A93 G;  1Q46 A;  1X6O A;  3HKZ G;  3OTO Q;  4P74 A;  3S1R H;  2ZJQ A;  4X65 L;  3GTL H;  3F2C A;  3PGZ A;  4A3L G;  1CSQ A;  3TRZ A;  1QVC A;  4DKA C;  3ULJ A;  1GM5 A;  4JI8 Q;  2K5N A;  3TEH B;  1SR3 A;  1PH8 A;  4DR3 Q;  4GOP A;  1XNR L;  2R92 H;  1FL0 A;  1JMC A;  4X66 Q;  4DUZ Q;  5C0X I;  4LF6 L;  4LF7 Q;  1RIP A;  1LTL A;  1Q8K A;  5GAE C;  2QA4 A;  4GNX A;  4LFB Q;  4MZ9 A;  1G29 1;  5IT9 c;  2HIV A;  2K14 A;  1VQD A;  4JI0 Q;  4KHP Q;  1WJJ A;  2JA8 G;  4JI8 L;  4DR3 L;  3W1G A;  1XMQ L;  2MO0 A;  2N49 A;  3GDE A;  4R1J A;  2L15 A;  4X66 L;  4DV4 Q;  4L5Q A;  4HIM A;  3M3Y H;  1UE7 A;  2DGY A;  4LF7 L;  1G6P A;  2HIX A;  5IP7 G;  5M3F G;  1IZ6 A;  5EAY A;  1Q82 C;  3CCU A;  4C3H H;  3PUV A;  5JEA J;  4YY3 Q;  1Q86 C;  3TRE A;  5IYB H;  2D0O A;  4JI0 L;  1E1O A;  4KHP L;  1M1K C;  2JA6 G;  4JCV E;  4YHH Q;  2RHQ B;  1K8A C;  3G6E A;  1HZB A;  3KF6 A;  3BJU A;  4GLA C;  5FJ8 G;  5M5W H;  4ALP A;  4BBS G;  4A3C H;  2MNA A;  4DV4 L;  3S2D H;  4OO1 I;  2R7F A;  2N78 A;  1KRS A;  1LM0 A;  5JEA G;  4DV5 Q;  2B63 G;  1YJW A;  1SRU A;  4OX9 Q;  1VQK A;  2UXC Q;  4A3F G;  1CKO A;  1N34 Q;  1N32 Q;  2EIF A;  2DUD A;  3MEF A;  2ZJP A;  3STB C;  4A3B H;  4MNO A;  4A3M H;  3I56 A;  5K36 G;  1Q1E A;  1I5F A;  4A3D G;  4JBM A;  3RN2 A;  2ES2 A;  1VQE A;  1UE1 A;  3RZD H;  1XPO A;  4B3S Q;  5ELN A;  1WFQ A;  4LW1 A;  2F52 A;  4BA1 I;  2I0Q A;  4DV5 L;  1VQG A;  5IYD G;  4AQY Q;  1XPR A;  1KIX A;  1VQ6 A;  2K5H A;  1FGU A;  2XTI A;  3S16 H;  1N9W A;  1QZH A;  4X62 L;  2R6G A;  1N34 L;  1VQ9 A;  2ZTC A;  4O0A A;  1N32 L;  4GKK Q;  2I5L X;  2VW9 A;  3MXN B;  3KYH C;  4TQU S;  3KJO A;  4IO9 A;  4A3K G;  1EOV A;  1PYS B;  2VL6 A;  5HY6 A;  4GN3 B;  4A3J H;  4BY1 H;  3M4P A;  4B3T Q;  3PO2 H;  2PQA B;  2BA1 A;  1B70 B;  4GLV B;  3CPW A;  1UE5 A;  4GOP C;  5GRO A;  1XTD A;  4B3S L;  4QGU A;  4AQY L;  2R7Z H;  3I4N G;  4DR5 Q;  3KDF B;  5IY0 A;  5C44 H;  1SMX A;  2Y0S G;  5GQO A;  3BZK A;  4GNX C;  3D31 A;  4JI3 Q;  4LFC Q;  4GKK L;  2AWN A;  3WWV A;  1C0A A;  4UPA A;  2HHH Q;  2UUB Q;  1EQQ A;  2ATW A;  3KLW A;  3I55 A;  4XTC S;  3HOX H;  1OXV A;  1X56 A;  1KHI A;  2YV5 A;  3S2H H;  1OXS C;  2MFI A;  1L1O B;  1E24 A;  2Q2T A;  1N33 Q;  2QGQ A;  2UXB Q;  1WCM H;  1I3Q H;  4DR5 L;  1VQO A;  3UDF A;  1ASZ A;  3A0J A;  4DK6 C;  1PH2 A;  1S40 A;  1Y1W G;  3L2P A;  2I5M X;  2B63 H;  4LFC L;  4YCW A;  2CWA A;  3CCQ A;  2NVY H;  2HQL A;  2MQH A;  4MTN A;  2NVT H;  1JJG A;  4L5T A;  3GTG H;  2HHH L;  1YHB A;  2VUM H;  3CCL A;  2LXJ A;  1FVI A;  4P73 A;  4QY7 A;  2UUC Q;  5JJI A;  4A3D H;  1N8R C;  4PZ8 A;  4LF5 Q;  1UE6 A;  4HJ8 A;  1VQJ A;  4LUO A;  2GVB A;  4IJL A;  4PG3 A;  2CFM A;  2IHE A;  4DV6 L;  5IP9 H;  3HFZ B;  4L5R C;  2F4V Q;  1X3F A;  4X6A H;  4GN5 A;  1XPU A;  4BXX H;  1CKN A;  4POG A;  4J15 A;  2UUC L;  1W2B A;  4C3J H;  1D8L A;  2NVX H;  4FDB A;  5IYB G;  4UY8 C;  3K81 C;  4H02 A;  2E8G A;  1YVC A;  2NZO A;  4LF5 L;  1I94 L;  3CCE A;  4HJ7 A;  4WJ4 A;  3FP9 A;  3AFP A;  2LXK A;  3ULL A;  2E2I H;  4JG2 A;  5GAG C;  3I4N H;  2WB1 G;  1NE3 A;  4PZ7 A;  1EWI A;  3CC2 A;  1XNQ L;  4GN4 B;  4YCU A;  1PH9 A;  4JBW A;  4A3C G;  3M85 A;  2F4V L;  3S14 H;  3JAM i;  3RR5 A;  3GO5 A;  1EIF A;  1FJG Q;  2UU9 L;  3EBE A;  3CPF A;  3S24 A;  1HR0 W;  4DR7 Q;  2NZH A;  3OW2 A;  4DR4 Q;  3KJP A;  2GN5 A;  4A3B G;  4A3M G;  1R9T H;  3TS0 A;  1BBW A;  2Z0S A;  1UWV A;  1VQL A;  2JEB I;  1Y1W H;  4GKJ L;  1GO3 E;  3CW2 C;  1TWA H;  4B3M Q;  4BY7 H;  1FJG L;  3TQY A;  2KCM A;  4P75 A;  4DPG A;  5AJ3 L;  4QJF A;  5M5Y H;  1WOC A;  2K75 A;  3OTO L;  4DR7 L;  1NMF A;  4AYB E;  1K9M C;  4DR4 L;  2OCE A;  3CCS A;  3J80 i;  2ID0 A;  4R4T A;  2VQE Q;  1PH3 A;  5IWA Q;  3S1Q H;  3ERS X;  2OQK A;  3CC7 A;  4A3J G;  1HZC A;  2JA9 A;  1U0L A;  1KQS A;  4BY1 G;  2OTL A;  3CMA A;  3JAM c;  3PO2 G;  1M90 C;  4NXM Q;  1W3S A;  1Q81 C;  3G48 A;  4B3M L;  3GTQ H;  1JJC B;  1BBU A;  2R7Z G;  4DUZ L;  1YIT A;  2A8V A;  4R4I A;  4EX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...