1WOCA

Crystal structure of prib
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
99
structure length
99
Chain Sequence
b'TNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Primosomal replication protein n
publication title Crystal structure of a biologically functional form of PriB from Escherichia coli reveals a potential single-stranded DNA-binding site
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 12
structure length 99
sequence length 99
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1wocA00
1HJPA 4APVA 4GOPA 1E3PA 2AWNA 1YHBA 3GTLH 2CKZB 5FLMH 4IFDI 1VQ4A 2E5LQ 2JA5G 3STBC 4HJ8A 4DR2Q 3HOXH 1C0AA 4LFCQ 1A8VA 1TWHH 3D0FA 4AH6A 2HHHL 4A3KH 1XPRA 5IYDG 3GDEA 5GQOA 1JB7A 4LF5L 3RN5A 2MNAA 1SR3A 1YBYA 3UDXA 5FLMG 4B3TL 1K73C 1JMCA 3G48A 1WJJA 2VY3A 2KCMA 3PGZA 4C2MH 1J6QA 1YI2A 1I94L 4JV5L 4A3KG 4IOCA 5HGQA 1KAWA 5M5YH 1TWGH 3HFZB 4A3FH 4IOAA 3K7UC 3MEFA 2IX0A 3CP0A 1W2BA 2PI2A 1VQNA 2I5HA 1Q81C 3ER0A 3W5OA 1XNQL 1YJNA 2V1CC 4A75A 4EX5A 5IWAL 3RZOH 5E7NA 4OWTB 3J80c 4A3FG 4B3SQ 4GNXA 4DUZQ 4AQYQ 1EYGA 4LF4Q 1FJGQ 1YHQA 1JT8A 3GTPH 3RLOA 3KDFB 2QA4A 4DV1L 4LF8Q 1C7YA 4JI1Q 5ELNA 2HIXA 3K81C 3M4QA 4QL5A 1VQJA 2GN5A 3SGIA 4PG3A 1VQ5A 1PH5A 1E1TA 4DV4L 2IHEA 1W3SA 2Z6KA 4JI7Q 3S1RH 2WAQE 4LF7Q 1PH2A 2BH2A 4GOPB 2HIVA 1AE3A 1VQCA 3CMEA 3J81c 4B3RL 1GD7A 2K75A 3K8AA 4LWCA 3KOJA 3L0OA 5IP9H 3Q8DA 4FDBA 2VZAA 4GN4B 1XMOQ 4POGA 5GAEC 3HOWH 3HOYH 3ULJA 2E5LL 4DR2L 1MJEA 2MO0A 1KHIA 2AKWB 4MZ9A 4UP9A 2D0PA 4LFCL 1YEZA 1NBWA 2YTVA 4UP7A 5IYCG 4X64L 2OQ0A 1K83H 3FHWA 3AFPA 3M85A 2ZM6L 1Y1WG 3RLNA 3TS2A 4LFBQ 3HOYG 2N3SA 4GN3B 3JAMi 2JA7H 2R7ZH 4P74A 1IBLL 3HOWG 4IPHA 1EOVA 3H3VH 1HNZQ 3J7ZC 3PO2H 5LMNW 3PUXA 2R7ZG 4DR1L 1L1OC 4GNXB 1VQ6A 4A3CH 2YU9H 5C3EH 2YTYA 4B3SL 4KLKA 2DUDA 4DUZL 2VS1A 2B29A 3UDFA 4AQYL 1NTGA 3RLFA 2NVXH 4KHPQ 1X3EA 1FL0A 3CCSA 4JI1L 1XMQQ 3CF5A 4X62L 3CCMA 1XPUA 1B7YB 4GLVB 4A3EH 1VQIA 1A0IA 1SLJA 2R6GA 4UY8C 3KJOA 1XJVA 3GTJH 1A62A 1N32L 3VDYA 2K14A 2I0QA 1X6OA 4JOIA 2Q2IA 4DV3Q 3S1NH 4A3EG 4LFAQ 2HHHQ 3L7ZC 1H95A 1TWCH 2F3IA 1K0RA 4C3JH 2IT1A 1HR0W 4LF5Q 2HT1A 4OO1G 1VQLA 2AWOA 2BH8A 4LUOA 1NJIC 1E22A 2VUMH 1EQRA 2IHFA 2JJQA 2JA9A 3S17H 4JYAQ 5M3FH 2WFWA 1L0WA 5C44H 2E2IH 3K0XA 4IPDA 4LNQA 4DR6Q 1EIFA 3A5UA 2UXBL 1A63A 4JI6Q 2ATWA 1TXYA 1OXSC 1UE1A 2KHIA 2QEXA 1JE5A 3MXNB 2VUMG 1HNWL 1JJGA 2B63G 3GTKH 4DV2L 4YY3Q 5M3FG 1Q1BA 4HJAA 3I7FA 1Q7YC 5C44G 5IWAQ 4HJ5A 3B6YA 1G6PA 5FJ8H 2Y0SG 4RG1A 2NN6I 1U5KA 1VQBA 2NZHA 1YITA 2NN6G 1VQHA 1GO3E 4A3IH 1Y1VH 3E0EA 4EQ5A 3EBEA 1GKHA 3TEHB 1JJCB 4QIWE 3I4NH 1L2FA 2JA6H 2JA8H 1FVIA 4JI4Q 1MIUA 3A74A 4JG2A 4ME3A 4R4QA 1XMQL 1EIYB 1QVFA 1LTLA 2ES2A 5J3BA 1QVCA 1GM5A 3GTMH 4R4IA 4B3RQ 1RIPA 1Z9FA 4QGUA 4DR3L 2JA8G 3GTGH 1U0LA 3NELA 4QY7A 3S2HH 4JBMA 3I4MH 4A3BH 2OCEA 3PUVA 3F2DA 1BBWA 4DV3L 3OW2A 1OXTA 4POFA 2Q2UA 4GN5A 3CCEA 1QZHA 4LFAL 3AFQA 5JEAJ 3NBHB 5M3MG 4X64Q 4DUYL 4DV6L 4Y52H 2YTXA 1HZBA 3CPFA 3E9HA 2K5HA 3FKIH 5M5XH 2ZM6Q 1NY4A 3D31A 2C35B 3I4MG 2R93H 3PF4A 2JE6I 3DM3A 1LYLA 4GLAC 3HOXG 3CPWA 1G51A 1IBLQ 4JYAL 1D8LA 1RL2A 3GD7A 3PUYA 2FXQA 3BU2A 1MKHA 5H1SE 1S40A 4DR6L 3PO3H 1BKBA 4JI6L 2R93G 2JQOA 1OXUA 1WOCA 3HKZE 2EXDA 1T9HA 3U4ZA 5C4XH 2ZJRA 1PH7A 1HNXQ 5JEAG 4DR1Q 3CC4A 1VQFA 2D62A 4YY3L 2LSSA 2Y0SE 1YIJA 4PMWA 3PO3G 2K5NA 2AHOB 2UU9Q 2CQOA 1I6HH 1IXRA 4BBRH 2ZJQA 5C4XG 1CUKA 3J81j 2MO1A 4BY7H 4OXPA 4KI0A 2RHSB 4X62Q 1SROA 1AE2A 5C0XJ 3CCQA 4JI0L 4A93H 4BXXH 1SRUA 3U4VA 4AIMA 4UP8A 2KBNA 3RN2A 1P8LA 1LUZA 4JI4L 4JBWA 1TWFH 4BBRG 5GAHC 4P71A 4BY7G 1VQDA 3AYHB 3M9BA 1N32Q 2UUCQ 4X65L 1N8RC 3M3YH 1XNRQ 1CKOA 4DR7L 2PI2E 1J5EQ 3I2ZA 4O0AA 4BXXG 3M4OH 2N78A 1I5FA 1Z47A 3EIVA 1X56A 4P73A 2RF4A 4DV0L 1QVGA 1K8AC 2N8NA 4UPAA 3I56A 1Y14B 2MFIA 3CCJA 3PV0A 1HZAA 4HIMA 1PYBA 1EFWA 5C0XG 1OTCA 1VCIA 1MJCA 1UE5A 3BZKA 4XTCS 2ALYB 1KRTA 3F2BA 5IP9G 1N33Q 2A19A 5GADC 4NXNQ 2OTJA 1L1OA 2UXBQ 3RZDH 4J15A 1PV4A 4PZ6A 1HZCA 1HNWQ 2CWAA 3STBD 4DV2Q 2JEBI 2VW9A 2I5LX 5AJ3L 2WP8J 1CKNA 5IYBH 4YCUA 4DK6C 1K3RA 1M1KC 1HNXL 1QUQA 2JA7G 3H3VI 1HZ9A 2PNHA 1PH9A 2Z6KC 4B3ML 2UU9L 2ZJPA 1VQ7A 4DR4Q 2UXDL 3PO2G 4A3JH 4BA2I 2IY5B 3K7AH 4TQUS 5FLXc 4A3CG 4H02A 3GTOH 5C3EG 4OX9Q 4A3DH 2CFMA 4OWXB 4YWLA 2WB1G 3RNUA 3HKSA 4HJ9A 4DNIA 1EQQA 4RMFA 1I3QH 3W1GA 4A3JG 4DR3Q 1VQ9A 4BBSH 5C4JH 4DR5L 2UUCL 1XNRL 4A3DG 1J5EL 1WYDA 1FGUA 3H0GH 5DLQE 4DKAC 4K0KQ 2OTLA 4NXML 3KJPA 2EIFA 5IT9c 4DV6Q 4DUYQ 2JEAI 2R7DA 3PCOB 4OO1I 1TWAH 2UUBL 2K4KA 4BBSG 1E1OA 3H0GG 1X9NA 3GTQH 1VS0A 4DV7L 1N33L 3T1HL 5HY6A 4NXNL 4QQBX 4TVAB 4LUVA 3J81i 3CAMA 4OWWB 4A3LH 3M4PA 3K80C 1CKNB 1PH6A 1CSQA 1IYJB 5LMNQ 1QUQB 2VNUD 2BA1A 1X65A 2AMCB 3OTOL 3U58A 1IBMQ 1Q1EA 3JC66 1UE7A 3H15A 4A3LG 1PH3A 4A3GH 4YWKA 2UXCQ 2MQHA 5LMUL 2NVQH 4JI5L 1YJWA 2F4VL 4DR4L 3KLWA 2PQAA 3CCVA 4JI0Q 3UE0A 3CCUA 4GKJL 4JI3Q 1VQAA 5FJ8G 4MNOA 3G4SA 3HOZH 4IPGA 2HQLA 3HOVH 1Q86C 4OX9L 4C3HH 2WB1E 4A3IG 1Y1VG 4NPSA 4GLXA 3A0JA 1IL2A 4X65Q 1D7QA 2Q2TA 3I4NG 4DR7Q 2XGTA 3CW2C 2JA6G 3HOZG 4DV0Q 4JBJA 1PH8A 1IBKQ 3NENA 4K0KL 4R4OA 4DK3C 3ULLA 5M5WH 3CCRA 3CC2A 2JK8A 3KF6A 4IFDJ 3AEVA 4HIOA 4A3BG 1R9TH 1KD1C 3PIOA 1VQKA 1HH2P 4GS3A 2F52A 3I4OA 1X3GA 1UE6A 2B3GA 1X54A 2JA5H 1OXVA 3FKIG 3HOUH 2R7FA 2R92H 5BR8Q 3JAMc 2OWOA 2H5XA 1KXLA 5AJ3Q 4L5TA 5IYDH 1N36Q 3CC7A 1QZGA 4R1JA 5LMNL 4JI8Q 3WWVA 4LUZA 1Q12A 2GVBA 4PZ7A 3LGJA 4JI2Q 4YHHL 4DV5L 1YZ6A 1EWIA 3AQQA 1IBML 4B3MQ 2R92G 1WFQA 4IFDG 2UXDQ 2NVYH 2I5MX 1VQOA 2PQAB 5GAGC 3CMAA 2UXCL 5JJLA 2NVTH 4GOPC 1B8AA 3PUZA 1M90C 1VQEA 4JI3L 1CSPA 4X66Q 4L5QA 4JCVE 2ZTDA 3OYYA 2ID0A 4DR5Q 4LF6Q 4A93G 3I55A 2VQFL 4LW1A 3J7A5 5GROA 4IJLA 4NXMQ 3KYHC 4JC0A 2A8VA 3S16H 2N49A 1S3OA 1YHAA 4C3IH 1IBKL 1Q82C 4JBKA 3ICEA 4A76A 1AH9A 3F2CA 2UUBQ 3KF6B 4P72A 5C0XI 1KC8C 2E2HH 1E7ZA 1HR0L 3BJUA 4GKKQ 1UWVA 4DV7Q 1K8GA 1C9OA 3T1HQ 2K50A 1ASYA 2CCZA 1ASZA 2UUAL 3PUWA 1P16A 3TQYA 3CXCA 5ELOA 3UDIA 2K52A 2IX1A 4GNXC 1S72A 1E24A 4OONA 5BR8L 5JJKA 1PYSB 5IYCH 3OTOQ 2VQEQ 1N36L 3RR5A 2A1AA 1Y1WH 3PIPA 3CD6A 4NB3A 4JI8L 3EN2A 2ASBA 3UE1A 5LMUQ 4JI2L 2KHJA 4X6AH 3DLLA 4JI5Q 3CQZH 2F4VQ 3FP9A 1PH1A 4GKJQ 3GO5A 5IYBG 4YCWA 1XPOA 1CKMA 2K5VA 1SFOH 3CCLA 4WJ3M 5K36G 1SN8A 4YCVA 5EAYA 1IZ6A 3PF5A 2YV5A 1JJ2A 1NE3A 3F8TA 3T1YQ 4AYBG 1Q8KA 2E8GA 3PSIA 4XIGS 2OQKA 4LF6L 1PVOA 4L5RC 3J80i 1WCMH 1EUJA 1K9MC 2EQSA 1XTDA 4PZ8A 1V43A 4DPGA 1B70B 3KFUA 1KL9A 3IRBA 4LF4L 4IO9A 1I50H 4A4IA 1N34Q 1NMGA 1N9WA 4KHZA 4R4CA 1X3FA 3NEMA 1KIXA 1FJGL 2D0OA 1YVCA 1WCMG 3A5ZB 4MTNA 3ULPA 4A3MH 2XTIA 4LF8L 1L1OB 3S15H 4GKKL 3U50C 3W1BA 1O7IA 1G291 2QGQA 4HJ7A 5JJIA 1VQGA 4O2DA 1GVPA 3S1MH 4YWMA 3L2PA 3G71A 1BVSA 2ZTCA 4WJ4A 4A3MG 3BZCA 4HIKA 4JI7L 3KF8B 5IY0A 4LF7L 1KRSA 1X55A 2CWPA 4R4TA 2PMZE 2VL6A 1NMFA 4YHHQ 2LXJA 4DV5Q 1BBUA 4BA1I 2VQEL 1VQPA 1YJ9A 3S24A 4Y7NH 4HIDA 3TRZA 1XMOL 3G6EA 1PFSA 3HOUG 4LF9Q 2GVAA 1V9PA 4X66L 5IE8A 4LF9L 5IP7H 4B3TQ 2KENA 2E2JH 1I94Q 1YNXA 4JOIC 4L5SA 2B63H 3TS0A 4JV5Q 4LFBL 4DAYB 4A3GG 3UDGA 4ALPA 3S14H 2Z0SA 4AYBE 5IP7G 2ZTEA 4DAMA 1V1QA 3T1YL 3S2DH 2VQFQ 3F1ZA 3HKZG 2NZOA 1XNQQ 4QJFA 2RCNA 1HNZL 3M7NA 3HOVG 3ERSX 2YYZA 2BA0A 1KQSA 1DGSA 1VQ8A 1VQMA 2Q2HA 2DGYA 3ZJYC 2RHQB 1HR0Q 3E9IA 4P75A 4DV1Q 1UEBA 1Q46A 1N34L 3TREA 4KHPL 1WI5A 1LM0A 1SMXA 3KDFA 2UUAQ 4BY1H 4IJHA 4DV4Q 1SE8A 2L15A 2LXKA 3S1QH 1PA6A 1PH4A 1PHJA 2WAQG 1OXXK 5M3MH 4IPCA 2KCTA 4BY1G
chains in the Genus database with same CATH superfamily
4GOPA 1E3PA 3L9AX 3GTLH 2CKZB 1A15A 3J80E 3STBC 3OMGA 4EGVA 3HOXH 1CHPD 4QIWB 3CRKC 5GQOA 1JB7A 2B2VC 1F9QA 4EQNA 2JN4A 1YBYA 5FLMG 1K73C 2VY3A 1I94L 2KCMA 1YI2A 4X6AH 4JV5L 4A3MB 4M8AA 3HFZB 2A68D 3VYUA 1KNAA 1W2BA 1DOMA 4RH6A 5EKKA 4FF4A 3ER0A 2V1CC 4ILWA 4EX5A 5E7NA 1ZEQX 4AQYQ 4K5VA 1FJGQ 1EYGA 1JT8A 3RLOA 3KDFB 2EYHA 4LF8Q 1C7YA 1X3PA 4DAPA 3HG9A 1E1TA 2IHEA 3KBXA 1GXDC 2B63B 3S17B 1AE3A 1DONA 1GD7A 2K75A 3S14B 2EDGA 1A3TA 3Q8DA 2VZAA 3S2DB 4DA2A 4POGA 2E5LL 3P20A 2RDFA 2YTVA 5IYCG 1K83H 2ZM6L 4J6HA 1RF2D 2B2UA 4GN3B 1B53A 1TS4A 4XYOA 2R7ZH 3FRPB 1IBLL 3C1FA 3H3VH 3J7ZC 1KAAA 3PUXA 5M3MB 4DR1L 1L1OC 4OIJA 1VQ6A 1NSNS 2YTYA 4KLKA 2DUDA 2VS1A 3MZ5A 3UDFA 2OF1A 1NTGA 1DZ1A 1X3EA 3CCSA 3IL8A 1XMQQ 4A3KB 3K59A 4X62L 4A3EH 5BN5A 1SLJA 4J1MA 4UY8C 4DN4M 3MWYW 3QWNA 3GTJH 5C5LA 1H9KA 4JOIA 1TWGB 4DV3Q 3S1NH 3NWTA 4EQOA 2HHHQ 1RDPD 3NBHA 1VQLA 2EYJA 2BH8A 1JC7A 1XTCD 2F0MA 4X3TA 3HS0C 2JJQA 3A7LA 3GTPB 2F0NA 1WTXA 2E2IH 5BN4A 3A5UA 3DEOA 2EJGC 2QEXA 1ONLA 3X3NA 4HJAA 1Q1BA 4ZQ3A 1SNPA 3B6YA 5EQ0A 4RG1A 1VQBA 4A3IH 2D2CC 2EYLA 1SJED 4DK1A 5IGGA 1JJCB 4L6TB 4QIWE 3I4NH 3QB3A 2IWHA 4F7XA 4FO2A 5HURA 1WTVA 1ESRA 2Q8RE 1IKLA 2L55A 1QVCA 1IW7D 2A6EC 3GTMH 4B3RQ 3VR4A 4QGUA 4DR3L 1SNCA 1U0LA 2CH4W 4ZAIA 2O2LD 1AP0A 3I4MH 3PUVA 3OW2A 2L11A 1I4GA 2YTXA 3E9HA 1YNJD 1UAPA 3OIQA 3H91A 3D3RA 4CKEA 2JE6I 1LTBD 3HOXG 4JYAL 1D8LA 1A3VA 3GD7A 2FXQA 3K7AB 2Z9HA 4CJ1B 1A6XA 2R93G 4KD4A 4V190 1OXUA 1PH7A 2F0DA 5C4XH 2RKSA 1F9RA 3QG1A 2OT2A 2NB0A 4PMWA 2K5NA 2AHOB 4BBRH 2G9HD 2ZJQA 1LO5D 1JOOA 3CHBD 3KLSA 4KI0A 1TWCB 1AE2A 4BXXH 1SRUA 2SDFA 4AIMA 3RN2A 1P8LA 4JI4L 2B2YA 1TWFH 1KTKA 4GZYC 4BY7G 1FGBD 2VUMB 4JW0A 4PNYA 1N8RC 2UUCQ 4I7ZC 4O0AA 5KRUA 5IGBA 2N78A 1Z47A 2CH4A 1X56A 1CQVA 2QDLA 2MFIA 1BCPC 1IHZA 3MXUA 1PYBA 5JOBA 3QJYA 4F8MA 2ALYB 3D8GA 5FLXE 2N55A 1I4PA 5JVH3 3Q23A 2CQAA 2K01A 3RZDH 4J15A 1PV4A 4JK1C 3MC0B 1S5FD 2JA6B 1HZCA 2JA8B 2CWAA 2QEJC 1HNWQ 4DV2Q 1JB3A 5E4WC 3VYRA 1CKNA 1Q3LA 3TP7A 4DK6C 1K3RA 1QUQA 4NDXA 4IUNA 1PH9A 2JXMB 2Z6KC 2UU9L 2Z4IA 4A3BB 5G3LF 4K6LA 4A3JH 4BA2I 5JVG3 4A3DH 3FKIB 4ZKBB 1RHPA 4YWLA 2WB1G 4HJ9A 4ZYSA 1RJTA 4RMFA 5DAUA 3FEWX 4K0KQ 2OTLA 4HAEA 4DUYQ 4DXFA 1F77A 4BBSG 3WOEA 3SHLA 3R2TA 3H0GG 1X9NA 1KLGD 3GTQH 1N33L 3T1HL 1TT2A 3IAYA 4NXNL 3MXGA 4A93B 1JWMD 1EU4A 2EJFC 4FYDA 4XT3B 3A55A 1X65A 2AMCB 2KHSA 1M8AA 3TP6A 1VMCA 1Q1EA 3MXPA 5FO8B 2K28A 3H15A 1PH3A 1KABA 5LMUL 4IUQA 3TMEA 1YJWA 1TIID 4DR4L 3KLWA 4J8QA 1PLFA 4RKLA 1SXTA 2HQLA 1GUGA 4A3IG 3A7AB 3SEBA 4GLXA 3A0JA 1D7QA 2NTTA 2Q2TA 3I4NG 4DR7Q 2F0JA 4C3HG 4DK0A 1G2TA 5C4HA 3CC2A 4HEDA 2JK8A 1UEAB 3N52A 3P1HA 2QCPX 1K3BC 3PIOA 1VQKA 2A5HA 2F1MA 4AYBB 2EY1A 2JA5H 2K03A 4JVZA 3I73A 2R7FA 1D5MC 1JR0D 2B2WC 5IYDH 2M9VA 3WWVA 4PZ7A 1LLRD 1EYDA 1ZKOA 1EWIA 1SMYD 4E6IA 4B3MQ 2UXDQ 2PW7A 3RD4A 2NVTH 3PUZA 1EU3A 1SBBB 3F2UA 1UNSA 2NZ1D 1B1ZA 2LY7A 2ZXRA 5D3DA 2Z1CA 4RHSA 1BCPF 4LF6Q 5HGTA 1FNVA 1DD2A 1IBKL 1AH9A 3FMCA 3KF6B 1KC8C 4K14A 1E7ZA 4V0BA 4DV7Q 1C9OA 1LT5D 1ASYA 2CCZA 4RKBA 2UUAL 2M00A 3CXCA 5ELOA 2IJ0A 5CBEE 3UI2A 3QO2A 1AFPA 1TU2B 3KLSX 1PYSB 1S5ED 1I4HA 4HSPA 2DNCA 3OTOQ 3PIPA 4NB3A 4JI8L 3TZUA 3EN2A 2H1EA 1E2WA 2KHJA 2V4DA 1T5EA 1D1IA 2B2TC 2E76C 4N9TA 4GKJQ 3GO5A 1SFOH 3CCLA 4F87A 4YCVA 3I91A 2YV5A 4MN3A 1Q8KA 2CVRA 2M2LA 2E8GA 1PTOB 2OQKA 5NUCA 2Z6BA 3HOUB 1EUJA 4DPGA 4FXGC 4IO9A 1FJGL 1JICA 3GTLB 1AEXA 5I2XA 3ITPA 3ULPA 1TS2A 4LF8L 4HR7B 5JJIA 2ENBA 1G2SA 3EJIA 4O2DA 1TVXA 3L2PA 3G71A 4WJ4A 1Y8OB 4A3MG 2CWPA 4R4TA 5DM63 2PMZE 1NMFA 1BBUA 3BDLA 2VQEL 1Y69U 3S24A 5IGFA 4Z9CB 1TY2A 3G6EA 1V9PA 3K0YA 2JP1A 5IE8A 1ILQA 5IGCA 2K05A 2E2JH 2KVMA 2E2HB 1GJXA 2F4IA 1STYA 2K33A 4ZUIA 1EEID 1CK1A 1HA5A 1I4XA 1STHA 2Z0SA 4AYBE 5C3XA 4ZK9B 4DAMA 5IP7G 1V1QA 3ND9A 2F0IA 3F1ZA 3M7NA 2BA0A 3MVVA 1SYBA 1DGSA 3H6MA 2DGYA 3ZJYC 2RHQB 3E9IA 4DV1Q 1Y1WB 1Q46A 1N34L 3TREA 1A2UA 4BY1H 1HCZA 3DWAA 2EYFA 4FXKC 1V1PB 4C1NI 4DV4Q 2L15A 5LL6S 4I65A 1PA6A 1PHJA 1U9RA 1OXXK 1HJPA 2R7ZB 2MGSA 5FLMH 1TS5A 1VQ4A 2JA5G 2A6HD 3G7LA 4DR2Q 4LFCQ 3D0FA 2HHHL 4CDDC 1FYCA 1XPRA 1WCMB 5E3FA 5IYDG 4H44C 1O7YA 1L0YB 1F9PA 1WJJA 3LWUA 1R4PB 3MFGA 3PGZA 4A3KG 4IOCA 5M5YH 1KAWA 2RDHA 4UAIA 2F0HA 2IX0A 2MP1A 3CP0A 1VQNA 1YNNC 3S1MB 1YJNA 3FPUB 3C2PA 4A75A 2EE1A 3RZOH 4A3FG 4OWTB 4GNXA 2D5DA 2QA4A 2E74C 3A8JE 4JI1Q 5ELNA 3I72A 3M4QA 2ICIA 2F3VA 1VQ5A 1PH5A 4EVOA 1ET9A 1W3SA 4LF7Q 3HKZB 3EQLC 4GOPB 2EY5A 4JPBW 1GHJA 4B3RL 2HUGA 2Y0SB 4LWCA 3L0OA 5IP9H 1HUMA 2WV6D 1PFMA 3OW7A 3EFXD 5EJWA 5GAEC 2AKWB 4LF9Q 4UP9A 1F2MA 1YEZA 4UP7A 2OQ0A 3FHWA 4ID6A 3TS2A 2DNEA 4N8FA 4LFBQ 3HOYG 4QMGA 4RWSC 2JA7H 2EYOA 4IPHA 2KECA 3NHHA 1HNZQ 2L1BA 3S1QB 1ILPA 3VR5A 2J7ZA 1NUCA 1QNUA 3MTSA 5C3EH 4IZ8A 4B3SL 3I4MB 4DUZL 4KHPQ 1QILA 4EQPA 1FL0A 1TWHB 3PIO3 3HRZC 1B7YB 1D6EC 2R6GA 2FHTA 1XJVA 1A62A 4C2MB 2I0QA 5IT9L 4O42A 4FF2A 2F3IA 5EPKA 1PTOD 4MIUA 1Y8PB 4OO1G 2FMCA 1WTRA 1NJIC 5TSSA 1EZ6A 2JA9A 1L0WA 2PW5A 1EIFA 4JI6Q 4QF4A 1OXSC 1IYVA 2F0QA 1HNWL 2VUMG 3GTKH 4DV2L 1Q7YC 5M3FG 5IWAQ 4HJ5A 2NN6I 1VQHA 1GO3E 4DNTB 1Y1VH 1B4OA 1O7LA 3EBEA 1RTOA 2X6LA 1DCZA 1L2FA 4H13C 1WTQA 4ME3A 5EPLA 1PZKD 1EIYB 1D2BA 5DEHA 1GM5A 2B2VA 3GV3A 2JA8G 1LTRD 3NELA 3GTGH 3S2HH 4JBMA 2F0FA 1NR2A 2Q2UA 1BBWA 4RCNA 1XPUA 4LFAL 4DUYL 3NBHB 4X64Q 3PO2B 1HZBA 5M5XH 2QDBA 2R93H 3TZDA 1WTPA 3DM3A 1LYLA 4GLAC 4RGNA 2NVXB 4OIKA 1RL2A 4A3JB 3BU2A 3JAML 4DR6L 5J1ZA 2JQOA 3HKZE 2EXDA 2ZJRA 1HNXQ 4PMCA 4YY3L 2Y0SE 5KYIA 3PO3G 4RA8A 1I6HH 1CUKA 4BY7H 1O80A 2RHSB 4PMBA 1SROA 4C3JB 2KBNA 4JBWA 3T56B 1EL0A 4P71A 3M3YH 3FVQA 4DR7L 1J5EQ 1SE3A 5C44B 1V1OA 4P73A 2RF4A 2C9OA 1QVGA 2IX3A 2N8NA 3PV0A 1EFWA 1OTCA 1KDCA 3RMHA 1SJHD 5IP9G 2VXWA 2A19A 1QWYA 2XRQD 1L1OA 1NAPA 4WJWA 5CV6A 4CBVA 2UXBQ 4S3SA 2A69D 5KEEA 1CHQD 3BYTB 2DJGC 4KK7A 3STBD 2VW9A 2I5LX 1JQYD 2BE5C 5IYBH 3BG3A 4YCUA 3A8KE 1M1KC 1PRTB 2JA7G 2EJMA 1CI3M 4B3ML 4X3UA 1VQ7A 2UXDL 1U4LA 1ENAA 3I8ZA 2IY5B 3GTOH 5C3EG 3P75A 2A73B 2KEEA 3RNUA 1O7ZA 3HKSA 3W1GA 1NCVA 4BBSH 5C4JH 1XNRL 3H0GH 3KJPA 1IW7C 5LHY1 4DV6Q 3NSWA 1TQOA 4OO1I 1TWAH 1E1OA 1SSOA 1VS0A 4DV7L 4PV1C 2XSCA 5HY6A 2NVTB 5EGTA 1DM0B 4BS9A 2ICEC 3CAMA 3MHBA 3OHXC 1HHVA 3E0JA 2RQXA 3IFDA 2CW0C 1STEA 1CKNB 2XWJB 1CSQA 3C1EA 2B39A 3K80C 4LMQD 1IYJB 5LMNQ 1QUQB 4OGQC 2VNUD 5IGDA 3OTOL 3U58A 1UE7A 5C4ZA 3Q24A 4A3GH 3M4OB 2UXCQ 2MQHA 2EOTA 3CCVA 4GKJL 3NPPA 4IPGA 2LMCB 3SK4A 4C3HH 4OX9L 1Y1VG 1RTNA 2QKIC 4X65Q 4YIJA 2XGTA 3CW2C 3WDNA 2FFKB 3SE0A 1PH8A 1GOZA 1ZYRD 2OXPA 3SK5A 2PNRC 4N8X1 4DK3C 5M5WH 2I46A 1II3A 2F0SA 1HRJA 1CZWA 5G3LD 5I4DA 1U4RA 1R9TH 3DXJC 3GP7A 1S4ZA 2ZXPA 3VR3A 1PFNA 1SYFA 5BR8Q 5AJ3Q 1Q90A 4XT1B 2ZXOA 1I3QB 3HOUG 1IBML 3AQQA 2MJ8A 4IFDG 2KUMA 1WFQA 1EY7A 2EYPA 2I5MX 2NVYH 3S9WA 2SNMA 5GAGC 2EXZA 5JJLA 2KJXA 1STNA 4JI3L 3L3OC 2XIWA 2WIIB 1GUSA 2ZTDA 2ID0A 4DF7A 4DR5Q 4LW1A 5GROA 4NXMQ 2DY8A 4JC0A 3S16H 1S3OA 1YHAA 5ELBA 3J80L 3ICEA 1LT3D 3F2CA 3VA7A 4ME5A 3BJUA 5EKLA 3C46A 1WD1A 3OOCA 1UUPA 5E1FA 4GKKQ 1UWVA 3HP3A 3EA6A 4G57A 5ELDA 2A6ED 4C3IG 4MTKA 1P16A 3TQYA 5CV4A 3HOZB 1VDZA 1E24A 3J81L 3HOVB 5JJKA 2HCCA 3IKJA 4K5XA 3SK6A 1N36L 2A1AA 1LACA 1BXTA 1JCKB 4JI2L 1A3UA 3DLLA 1B3QA 3TP5A 3KLRA 2KA7A 3SDZA 1RCVD 3MFYA 5IYBG 1PH1A 5K36G 3OSOA 4WJ3M 4DAVA 5EAYA 1IZ6A 4IURA 3TN2A 1JJ2A 3T1YQ 3MEHA 3R8BA 1G91A 2L12A 4XIGS 4HCEA 1GUOA 1PVOA 1LTID 5A2QL 2R92B 2RA4A 1SE2A 1S5BD 1NMGA 1X3FA 3NEMA 2KOLA 4MTNA 1WCMG 1PRTD 2PZTA 3A5ZB 4A3MH 2XTIA 1WD0A 5EBDA 1IYUA 3W1BA 1O7IA 2QGQA 4ABNA 1GVPA 4KY5A 4NKLA 2E2DC 2K1BA 2ZTCA 3BZCA 4HIKA 1H9SA 4LF7L 2F0WA 2KCCA 1FNWA 4P2CB 5M5YB 4TSSA 2LS01 4DV5Q 2LXJA 4BA1I 4KY7A 3TRZA 3QOJA 1F2LA 4CJ2C 1PFSA 3LNNA 4LF9L 5IP7H 1L0XB 4B9WA 3PQIA 1I94Q 4HMIA 2B63H 3R2IA 3TS0A 4FF3A 4JV5Q 4A3GG 4LFBL 3K6OA 1BQQT 4B08A 4ALPA 3S14H 1B50A 5BN3A 2NN6H 3D6CA 2PMZB 3S2DH 4FVMA 3HKZG 2NZOA 1HNZL 3J7YW 3ERSX 1FNUA 1KQSA 3MAQA 2Q2HA 2B8GA 3ERQA 3W2DA 1HR0Q 4P75A 2B2WA 3IFTA 4KHPL 1WI5A 1LM0A 1SMXA 4XQJA 1QNKA 2GA4B 2RSOA 3CQZB 3VR2A 1EOTA 3BVGA 3QOLA 1WTOA 5M3MH 4IPCA 2MPMA 3HEJA 4APVA 1YHBA 5AFWA 4IFDI 2E5LQ 5JPMC 3A54A 4A3KH 4K5WA 3GDEA 4IN3A 4R9WA 4B3TL 1I50B 3G48A 3TP8A 1JMCA 1J6QA 3S15B 1TWGH 4A3FH 4IOAA 2PI2A 5CMDA 1XNQL 4F88A 3Q22A 5IWAL 4LF4Q 2FINB 4CKCA 3GTPH 4Y7NB 5CV9A 4G7OC 4KY6A 2HIXA 2L4NA 3K81C 2GN5A 1B9MA 3SGIA 1E0BA 2RVLA 1WVLA 2K04A 4JI7Q 2WAQE 1OO9B 1BUVT 3BYYB 3K8AA 1PZID 1K8OA 4IUVA 1CT1D 1CM9A 4FDBA 1XMOQ 3HOYH 5D65A 5IGEA 5CV8A 1MJEA 2MO0A 1KHIA 4OHJA 4MZ9A 4X64L 1CZGA 3M85A 1HQMC 3RLNA 1QB5D 1XXGA 2N3SA 3JAMi 5M9OA 1I6VC 1BDOA 3HOWG 1EOVA 2NWGA 4KKTA 1WTWA 1AZQA 3MXNA 4GNXB 4A3CH 2YU9H 2VB2X 4KKUA 4AQYL 1HFNA 3RLFA 1LTTD 5FLXL 1BBXC 3HOXB 4IQZA 1SNDA 3CF5A 3CCMA 5M5XB 3K57A 4GLVB 1EY9A 1VQIA 2R93B 3KJOA 2L5TA 1J9OA 4OO1H 3VDYA 2K14A 1X6OA 3N6RA 3T51B 3G6JB 3L7ZC 1TWCH 2IT1A 1HR0W 4LF5Q 2HT1A 1CQFA 2PQEA 3SK8A 4L8JA 4LUOA 5CV5A 4UDUC 2VUMH 2RBMA 4KKSA 4JYAQ 5M3FH 1O78A 4LNQA 2UXBL 1A63A 2ATWA 1TXYA 2NTSA 1KDAA 1EYCA 2B63G 3GQBA 3I7FA 1SDFA 5C44G 1H9RA 2L9HA 1J8IA 2NZHA 4CJ0B 3DMUA 5CORA 2NN6G 3U9SA 1LTAD 3E0EA 1GKHA 2JA6H 2JA8H 1M4VA 4JI4Q 2VB3X 4JG2A 4R4QA 1XMQL 1K83B 2QW7A 1LTLA 2ES2A 1S5DD 3JAME 1VMPA 4R4IA 1RIPA 4QY7A 4A3BH 3F2DA 4DV3L 3H94A 1SYDA 4PQXA 4GN5A 4Y52H 5M3MG 4DV6L 3FKIH 3D31A 5ISRA 2DN8A 2WB1B 3KUPA 3SVMA 3CPWA 1G51A 3PUYA 2O5IC 1MKHA 5H1SE 4ULLA 3PO3H 2E75C 1T9HA 3H09A 4A3EB 5JEAG 1SYEA 2D62A 3NQIA 2LSSA 1YIJA 3GTJB 4BBSB 5A35A 2UU9Q 2PPBC 2CQOA 3H0GB 1IXRA 3S1NB 1DXMA 1EY5A 2MO1A 4OXPA 4A93H 1TWAB 4KN7C 1HQRD 3U4VA 2MUYA 2J0TD 2X69A 5GAHC 3AYHB 1N32Q 4X65L 1CKOA 2K5QA 1U4MA 2E2IB 4K6DA 4HMJA 1RKNA 4RGMA 3OWFA 1G6ZA 3I56A 1Y14B 2HQEA 4HIMA 5C0XG 1MJCA 1TS3A 1UE5A 3BZKA 3KBGA 3F2BA 1N33Q 4ZLTF 5GADC 4FP5D 1PTOC 1FD7D 1QCBD 4A3IB 4NXNQ 2PO4A 3I4NB 1EIHA 3I70A 2CHBD 2JEBI 4C3HB 1LT6D 5AJ3L 3M4YA 3GTMB 2RCFA 5IOCA 3O13A 1HZ9A 4K2KA 4ZKCB 1K0SA 2KCNA 4R8NA 2ZJPA 5KYLA 4DR4Q 2EPBA 4A3CG 1EY4A 2CFMA 4OWXB 1EQTA 3NUCA 3HGBA 3K5LA 3E5SA 4DNIA 1EQQA 4Q5VA 1GUTA 2H4OA 1VF7A 5ELEA 1VQ9A 2UUCL 4DR5L 1B2TA 5I6WA 1WYDA 4DKAC 5DLQE 4NXML 2EIFA 4HCSA 5IT9c 2R3ZA 2HDMA 3M7GA 5C4XB 2K4KA 4R8IA 4FXDA 5I9OA 4BBRB 1JORA 4TVAB 1BOSA 4LUVA 1V1PA 3J81i 4CDCC 5CC4A 4OWWB 5KGUA 2R61A 3ONAB 2FMMA 3M4PA 4RHRA 1C48A 1TWFB 2Q8TA 2A68C 3K58A 3JC66 4A3LG 1R4QB 3DUZA 3R3OA 2NVQH 4WRDA 4QUFA 3CKIB 2DJFC 2PQAA 4JI0Q 3UE0A 1PMRA 3LWEA 5ELCA 1Q86C 3OWEB 2WB1E 4NPSA 3H3VC 1IL2A 2DY7A 1GHKA 4H7BA 3RZDB 2JA6G 1HXYD 3HOZG 2XRSD 2F0LA 4DV0Q 2PZUA 1HA6A 1IBKQ 3NENA 4K0KL 4G4KA 4R4OA 3PIP3 5JAVA 3ULLA 3CCRA 1QOHA 1QG7A 4IFDJ 3AEVA 4A3BG 2J4XA 1KD1C 2SEBD 1TR5A 4GS3A 3AMUA 1X3GA 2B3GA 3FKIG 3HOUH 4IFDH 2JSOA 4A3DB 3JAMc 2OWOA 2F0VA 1QZGA 3DHQA 3DWPA 2A69C 1Y8NB 3DM1A 3DWQA 2PYKA 4JI8Q 4LUZA 4XYQA 4DV5L 1YZ6A 2R92G 2IL8A 1BNZA 1B44D 3QR8A 2AUKA 4GOPC 1B8AA 2XWBB 1E2VA 1VF5C 1X3QA 1VQEA 4TRDA 5CBAE 4I7AA 3GTQB 4JCVE 3OYYA 4RAUC 3QIAA 3J81E 4A93G 3I55A 3J7A5 5I9PA 3KYHC 2F0TA 2N49A 4C3IH 4JBKA 1PTOF 3K5MA 4A76A 3D4RA 2UUBQ 5C0XI 4P72A 2E2HH 1IKMA 1HR0L 2BOSA 2F0KA 2K50A 1C8CA 1MI2A 3PUWA 5I2YA 3FDTA 3UDIA 2IX1A 1EY0A 2HDLA 2JYOA 1S72A 4OONA 1S5CD 3KF8A 2VQEQ 3I90A 4LK1C 5A2QE 1Y1WH 1Z6HA 5K36H 4JI5Q 1G8ZD 2F4VQ 4YCWA 5ELFA 1CKMA 1SN8A 2EVBA 1BF4A 2MHVA 3K5NA 1BCPB 1ENFA 2FJ2A 4KN4C 3PF5A 1NE3A 4DAYA 4AYBG 4TKOB 4Q0FA 3PSIA 3NWSA 4LF6L 1AZPA 4L5RC 2JA5B 3NTIA 1WCMH 2NBFA 5DNFA 2B2UC 2EQSA 4PZ8A 1V43A 1B70B 1MSGA 2D9UA 4XQQA 1KL9A 3IRBA 4LF4L 1N34Q 2XVSA 1KIXA 1ZYRC 3P7JA 4IUPA 3U50C 1G291 4RFBA 4HJ7A 1D5ZC 1SE4A 1YNJC 3BDCA 4HN7A 3FPPA 3S1MH 4YWMA 4JI7L 1HTPA 2X6GA 1MHWC 4DFAA 4YHHQ 4KMUC 4A3FB 3T13A 1VQPA 1YJ9A 4HIDA 5KNCA 1XMOL 2K6AA 1STBA 4XXEA 1HUNA 2WACA 2KENA 1KLUD 4JOIC 2O5JC 2KEDA 1Q8IA 2BE5D 4NMZA 3OMCA 2VQFQ 5E4XA 2RCNA 2RDGA 1AW7A 4XDXA 1K8MA 1VQMA 4ZCKA 4IUUA 1UEBA 3V05A 3SXHA 3HOYB 3KDFA 1ENCA 1B3AA 4IJHA 3NK9A 1SE8A 1SFOB 3S1QH 1H9SB 1LTSD 1PH4A 3Q6SA 1NR4A 2KCTA 1A2TA 1B9NA 2AWNA 3EROA 3NE5B 1ESFA 3X3MA 2F0PA 4HJ8A 1C0AA 1A8VA 1TWHH 4AH6A 4LF5L 3RN5A 2MNAA 1MGSA 1ZXTA 1D5XC 3D4WA 2YU9B 1SR3A 3UDXA 4U673 4HTHA 3W3AA 4CGYB 2CW0D 2G9DA 4QB4A 4C2MH 4M1UB 5HGQA 2K7VA 3K7UC 3MEFA 1XX8A 2I5HA 5C3WA 1Q81C 1H9JA 3RUZA 3W5OA 1SYCA 5F2DA 1ET6A 3J80c 4B3SQ 1PXUA 4DUZQ 1YHQA 4NP5A 2K32A 5D3IB 1MD2D 4DV1L 4WORA 2EY6A 4QL5A 1VQJA 4PG3A 4DV4L 1JWSD 1PRTC 2Z6KA 2E2JB 3S1RH 1PH2A 2BH2A 2HIVA 5M3FB 1VQCA 3CMEA 3J81c 1LT4D 3KOJA 3DEPA 4GN4B 4X3KA 2L0CA 2B2YC 3ULJA 1SNOA 4DR2L 1F9SA 4LFCL 4X66Q 1EIGA 2D0PA 2KQ3A 1NBWA 3HOWH 4XQNA 3AFPA 1Y1WG 5KNBA 4RGOS 2WAQB 4BWGB 4P74A 4BY1B 1C4QA 5KNDA 2IPKD 5C6AA 1BR9A 4CDFC 4KJNA 3PO2H 5LMNW 1ICFB 3TBIB 2R7ZG 1PYWD 3J7AF 3V2TA 1EWCA 2B29A 4CDEC 2NVXH 1EYAA 2O4XA 5JPNC 4JI1L 2EYMA 3VA5A 4FF1A 1A0IA 3EVQA 2WINB 1RD9D 1V8QA 1N32L 1BCPD 2Q2IA 1FR3A 5CGKA 3PO3B 4A3EG 4LFAQ 5K5PA 1K0RA 3GV6A 4C3JH 1JOQA 2AWOA 5T1GA 3RZOB 3D6WA 1SMYC 3SR1A 1E22A 1EQRA 2IHFA 3S17H 2WFWA 2F0UA 5C44H 3K0XA 4IPDA 4DR6Q 1EQVA 2C5CA 2RSNA 2TMPA 1UE1A 2KHIA 1JE5A 3MXNB 4QCLA 1JJGA 4YY3Q 2QILA 3J7AV 1CTMA 1G6PA 1QJOA 5FJ8H 1RODA 2Y0SG 1U5KA 2SOBA 1YITA 3AU7A 4KHVA 4EQ5A 3TEHB 2SNSA 4G7ZC 4NW2A 2BDOA 2AQ3B 3I3CA 1TY0A 1FVIA 1MIUA 3A74A 1IL8A 1D1KA 3NP8A 1QVFA 2F0EA 5J3BA 1Z9FA 2JA7B 4H0LC 4OEMB 3CRLC 2OCEA 1QE6A 1OXTA 4POFA 3CCEA 1QZHA 3AFQA 5JEAJ 3LX0A 1H9MA 3CPFA 4IALA 1Z7TA 2K5HA 2ZM6Q 1NY4A 2C35B 3I4MG 5C3EB 3BZDB 2F03A 5C5MA 3PF4A 4DXGA 3D4DA 5JEAH 1IBLQ 1S40A 1BKBA 1PZJD 3AB9A 4JI6L 1WOCA 3U4ZA 1SNQA 4DR1Q 4K8IA 3CC4A 1VQFA 1K28A 5J39A 5FO7B 2Z8LA 5C4XG 1GUWA 1PRTF 3J81j 3CCQA 4X62Q 5C0XJ 4JI0L 2N88A 3A8IE 4UP8A 1LUZA 1STAA 1W6JA 4BBRG 5L37A 4U68A 1VQDA 3M9BA 2B2TA 2IW3A 2PZWA 1XNRQ 2PI2E 3I2ZA 2K5WA 5C0XH 4BXXG 3M4OH 1I5FA 3EIVA 4DV0L 2A74C 1CA5A 1GUNA 5CYUA 1K8AC 4UPAA 4DNRB 2EZVA 3CCJA 1HZAA 3GTKB 1TKWB 4ZRZA 1VCIA 1JOKA 4XTCS 1KRTA 2XN9C 3NTKA 3T53B 1CFMA 5COYA 2NVQB 1Y1VB 4DGZA 1DYQA 2OTJA 3NTHA 4L63B 4OELB 5CR3A 1F2ZA 4PZ6A 4LAAA 5KIXA 2WP8J 5FO9B 1STGA 5IT9E 1HNXL 5EBCA 3H3VI 2WKCA 2PNHA 4RGTA 3GTGB 2XNAC 2AUJD 3S2HB 1JWUD 1AN8A 2EY2A 3PO2G 1LABA 3K7AH 4TQUS 5FLXc 4H02A 5LL6X 4OX9Q 3V96A 3A56A 4QUCA 4A3JG 1I3QH 1LV9A 2WKDA 5EPJA 4DR3Q 4RCOA 1LTGD 1XYIA 4A3DG 1J5EL 1FGUA 2JEAI 2R7DA 3PCOB 4LJZC 3VR6A 2LKVA 1KNEA 2UUBL 4CHTB 1MSHA 5FKAC 2A6HC 1I6HB 2Z4HA 3T4AC 4ZUJA 4C3JG 4BY7B 4QQBX 5D14A 5IODA 2PCFB 4A3LH 4WFN3 1PH6A 3TSSA 3NBIA 3TDQA 2TSSA 2BA1A 1IBMQ 3M3YB 2BCOA 4YWKA 3ND8A 4JI5L 4C3IB 2F4VL 5T1IA 3CCUA 4JI3Q 1VQAA 5FJ8G 4MNOA 3G4SA 3HOZH 4B9XA 3C3LA 3HOVH 3WOFA 1HPCA 1EZ8A 3KK7A 4JBJA 1KDBA 3KF6A 2P5ZX 3R93A 4MHEA 4HIOA 1ICWA 1EY8A 5JJZA 1HH2P 2F52A 3I4OA 4KV6A 1UE6A 1X54A 2AQ2B 1OXVA 3CU7A 2R92H 3GTOB 2I07B 1E2ZA 2H5XA 4X3SA 3ZYYX 1KXLA 4L5TA 3MA2B 1HFGA 1N36Q 3CC7A 4R1JA 5LMNL 4K8JA 4YHHL 1Q12A 2GVBA 4JI2Q 3LGJA 1H95A 5CV7A 5C4JB 1W6KA 1VQOA 2PQAB 3CMAA 2UXCL 1HTLD 4FNFA 1NNXA 1M90C 1CSPA 1I4QA 4L5QA 1T5XD 5EKIA 3T16A 2VQFL 4IJLA 4CKBA 2A8VA 4IUTA 1Q82C 2Q8IB 3Q0AA 4HSVA 1EY6A 1K8GA 4KJOA 3T1HQ 4A3GB 1EWHA 1ASZA 1XWEA 1F2YA 2F0OA 2K52A 2F3WA 4DU9A 3NQTA 4GNXC 3E6ZX 5BR8L 3U9OA 5IYCH 3RR5A 2BDNA 3CD6A 1U4PA 2ASBA 3UE1A 3K5OA 5LMUQ 2LFNA 3CQZH 5DM73 3FP9A 1XPOA 2K5VA 5I6YA 5M5WB 4G7HC 1WTHA 2NYZD 1YNND 3F8TA 1R9TB 3BVZA 4KTAA 3J80i 1K9MC 1XTDA 4C1NK 3OPOA 3KFUA 1DOLA 1I50H 4A4IA 4R4CA 1N9WA 4KHZA 2F0GA 2D0OA 1YVCA 4GKKL 3VYSA 3S15H 1L1OB 2NVYB 4C56C 4ODGA 3NXWA 2OEOA 5J22A 1ML0D 1VQGA 3HZXA 1SAPA 1BVSA 3KF8B 5IY0A 3BS1A 1KRSA 1X55A 4KD3A 2VL6A 5IIFA 4N9PA 2B8FA 4Y7NH 2NUCA 1SEBD 1MBYA 2HCIA 1PFBA 2GVAA 5FOBB 3S16B 4X66L 1CA6A 4B3TQ 1JE4A 5FK9C 1X32A 2AQ1B 1YNXA 4L5SA 3BDOA 4DAYB 3UDGA 3URYA 3OIPA 2ZTEA 3T1YL 3E3XA 2G5DA 1EEFD 1XNQQ 4QJFA 3VYTA 1I4RA 1SNMA 4OL7A 3HOVG 2YYZA 3S1RB 2ZT9C 4O1NA 2K5DA 1VQ8A 1EFID 1PDQA 4K2LA 3I4LA 1SYGA 1DJRD 1DOKA 2UUAQ 1BO0A 3BVMA 4UHVA 2HD3A 3HOWB 2QF7A 1PTOH 2LXKA 2WAQG 3PMFA 4BY1G
chains in the Genus database with same CATH topology
1HJPA 4APVA 4GOPA 1E3PA 2AWNA 1YHBA 3GTLH 2CKZB 5FLMH 4IFDI 1VQ4A 2E5LQ 2JA5G 3STBC 4HJ8A 4DR2Q 3HOXH 1C0AA 4LFCQ 1A8VA 1TWHH 3D0FA 4AH6A 2HHHL 4A3KH 1XPRA 5IYDG 3GDEA 5GQOA 1JB7A 4LF5L 3RN5A 2MNAA 1SR3A 1YBYA 3UDXA 5FLMG 4B3TL 1K73C 1JMCA 3G48A 1WJJA 2VY3A 2KCMA 3PGZA 4C2MH 1J6QA 1YI2A 1I94L 4JV5L 4A3KG 4IOCA 5HGQA 1KAWA 5M5YH 1TWGH 3HFZB 4A3FH 4IOAA 3K7UC 3MEFA 2IX0A 3CP0A 1W2BA 2PI2A 1VQNA 2I5HA 1Q81C 3ER0A 3W5OA 1XNQL 1YJNA 2V1CC 4A75A 4EX5A 5IWAL 3RZOH 5E7NA 4OWTB 3J80c 4A3FG 4B3SQ 4GNXA 4DUZQ 4AQYQ 1EYGA 4LF4Q 1FJGQ 1YHQA 1JT8A 3GTPH 3RLOA 3KDFB 2QA4A 4DV1L 4LF8Q 1C7YA 4JI1Q 5ELNA 2HIXA 3K81C 3M4QA 4QL5A 1VQJA 2GN5A 3SGIA 4PG3A 1VQ5A 1PH5A 1E1TA 4DV4L 2IHEA 1W3SA 2Z6KA 4JI7Q 3S1RH 2WAQE 4LF7Q 1PH2A 2BH2A 4GOPB 2HIVA 1AE3A 1VQCA 3CMEA 3J81c 4B3RL 1GD7A 2K75A 3K8AA 4LWCA 3KOJA 3L0OA 5IP9H 3Q8DA 4FDBA 2VZAA 4GN4B 1XMOQ 4POGA 5GAEC 3HOWH 3HOYH 3ULJA 2E5LL 4DR2L 1MJEA 2MO0A 1KHIA 2AKWB 4MZ9A 4UP9A 2D0PA 4LFCL 1YEZA 1NBWA 2YTVA 4UP7A 5IYCG 4X64L 2OQ0A 1K83H 3FHWA 3AFPA 3M85A 2ZM6L 1Y1WG 3RLNA 3TS2A 4LFBQ 3HOYG 2N3SA 4GN3B 3JAMi 2JA7H 2R7ZH 4P74A 1IBLL 3HOWG 4IPHA 1EOVA 3H3VH 1HNZQ 3J7ZC 3PO2H 5LMNW 3PUXA 2R7ZG 4DR1L 1L1OC 4GNXB 1VQ6A 4A3CH 2YU9H 5C3EH 2YTYA 4B3SL 4KLKA 2DUDA 4DUZL 2VS1A 2B29A 3UDFA 4AQYL 1NTGA 3RLFA 2NVXH 4KHPQ 1X3EA 1FL0A 3CCSA 4JI1L 1XMQQ 3CF5A 4X62L 3CCMA 1XPUA 1B7YB 4GLVB 4A3EH 1VQIA 1A0IA 1SLJA 2R6GA 4UY8C 3KJOA 1XJVA 3GTJH 1A62A 1N32L 3VDYA 2K14A 2I0QA 1X6OA 4JOIA 2Q2IA 4DV3Q 3S1NH 4A3EG 4LFAQ 2HHHQ 3L7ZC 1H95A 1TWCH 2F3IA 1K0RA 4C3JH 2IT1A 1HR0W 4LF5Q 2HT1A 4OO1G 1VQLA 2AWOA 2BH8A 4LUOA 1NJIC 1E22A 2VUMH 1EQRA 2IHFA 2JJQA 2JA9A 3S17H 4JYAQ 5M3FH 2WFWA 1L0WA 5C44H 2E2IH 3K0XA 4IPDA 4LNQA 4DR6Q 1EIFA 3A5UA 2UXBL 1A63A 4JI6Q 2ATWA 1TXYA 1OXSC 1UE1A 2KHIA 2QEXA 1JE5A 3MXNB 2VUMG 1HNWL 1JJGA 2B63G 3GTKH 4DV2L 4YY3Q 5M3FG 1Q1BA 4HJAA 3I7FA 1Q7YC 5C44G 5IWAQ 4HJ5A 3B6YA 1G6PA 5FJ8H 2Y0SG 4RG1A 2NN6I 1U5KA 1VQBA 2NZHA 1YITA 2NN6G 1VQHA 1GO3E 4A3IH 1Y1VH 3E0EA 4EQ5A 3EBEA 1GKHA 3TEHB 1JJCB 4QIWE 3I4NH 1L2FA 2JA6H 2JA8H 1FVIA 4JI4Q 1MIUA 3A74A 4JG2A 4ME3A 4R4QA 1XMQL 1EIYB 1QVFA 1LTLA 2ES2A 5J3BA 1QVCA 1GM5A 3GTMH 4R4IA 4B3RQ 1RIPA 1Z9FA 4QGUA 4DR3L 2JA8G 3GTGH 1U0LA 3NELA 4QY7A 3S2HH 4JBMA 3I4MH 4A3BH 2OCEA 3PUVA 3F2DA 1BBWA 4DV3L 3OW2A 1OXTA 4POFA 2Q2UA 4GN5A 3CCEA 1QZHA 4LFAL 3AFQA 5JEAJ 3NBHB 5M3MG 4X64Q 4DUYL 4DV6L 4Y52H 2YTXA 1HZBA 3CPFA 3E9HA 2K5HA 3FKIH 5M5XH 2ZM6Q 1NY4A 3D31A 2C35B 3I4MG 2R93H 3PF4A 2JE6I 3DM3A 1LYLA 4GLAC 3HOXG 3CPWA 1G51A 1IBLQ 4JYAL 1D8LA 1RL2A 3GD7A 3PUYA 2FXQA 3BU2A 1MKHA 5H1SE 1S40A 4DR6L 3PO3H 1BKBA 4JI6L 2R93G 2JQOA 1OXUA 1WOCA 3HKZE 2EXDA 1T9HA 3U4ZA 5C4XH 2ZJRA 1PH7A 1HNXQ 5JEAG 4DR1Q 3CC4A 1VQFA 2D62A 4YY3L 2LSSA 2Y0SE 1YIJA 4PMWA 3PO3G 2K5NA 2AHOB 2UU9Q 2CQOA 1I6HH 1IXRA 4BBRH 2ZJQA 5C4XG 1CUKA 3J81j 2MO1A 4BY7H 4OXPA 4KI0A 2RHSB 4X62Q 1SROA 1AE2A 5C0XJ 3CCQA 4JI0L 4A93H 4BXXH 1SRUA 3U4VA 4AIMA 4UP8A 2KBNA 3RN2A 1P8LA 1LUZA 4JI4L 4JBWA 1TWFH 4BBRG 5GAHC 4P71A 4BY7G 1VQDA 3AYHB 3M9BA 1N32Q 2UUCQ 4X65L 1N8RC 3M3YH 1XNRQ 1CKOA 4DR7L 2PI2E 1J5EQ 3I2ZA 4O0AA 4BXXG 3M4OH 2N78A 1I5FA 1Z47A 3EIVA 1X56A 4P73A 2RF4A 4DV0L 1QVGA 1K8AC 2N8NA 4UPAA 3I56A 1Y14B 2MFIA 3CCJA 3PV0A 1HZAA 4HIMA 1PYBA 1EFWA 5C0XG 1OTCA 1VCIA 1MJCA 1UE5A 3BZKA 4XTCS 2ALYB 1KRTA 3F2BA 5IP9G 1N33Q 2A19A 5GADC 4NXNQ 2OTJA 1L1OA 2UXBQ 3RZDH 4J15A 1PV4A 4PZ6A 1HZCA 1HNWQ 2CWAA 3STBD 4DV2Q 2JEBI 2VW9A 2I5LX 5AJ3L 2WP8J 1CKNA 5IYBH 4YCUA 4DK6C 1K3RA 1M1KC 1HNXL 1QUQA 2JA7G 3H3VI 1HZ9A 2PNHA 1PH9A 2Z6KC 4B3ML 2UU9L 2ZJPA 1VQ7A 4DR4Q 2UXDL 3PO2G 4A3JH 4BA2I 2IY5B 3K7AH 4TQUS 5FLXc 4A3CG 4H02A 3GTOH 5C3EG 4OX9Q 4A3DH 2CFMA 4OWXB 4YWLA 2WB1G 3RNUA 3HKSA 4HJ9A 4DNIA 1EQQA 4RMFA 1I3QH 3W1GA 4A3JG 4DR3Q 1VQ9A 4BBSH 5C4JH 4DR5L 2UUCL 1XNRL 4A3DG 1J5EL 1WYDA 1FGUA 3H0GH 5DLQE 4DKAC 4K0KQ 2OTLA 4NXML 3KJPA 2EIFA 5IT9c 4DV6Q 4DUYQ 2JEAI 2R7DA 3PCOB 4OO1I 1TWAH 2UUBL 2K4KA 4BBSG 1E1OA 3H0GG 1X9NA 3GTQH 1VS0A 4DV7L 1N33L 3T1HL 5HY6A 4NXNL 4QQBX 4TVAB 4LUVA 3J81i 3CAMA 4OWWB 4A3LH 3M4PA 3K80C 1CKNB 1PH6A 1CSQA 1IYJB 5LMNQ 1QUQB 2VNUD 2BA1A 1X65A 2AMCB 3OTOL 3U58A 1IBMQ 1Q1EA 3JC66 1UE7A 3H15A 4A3LG 1PH3A 4A3GH 4YWKA 2UXCQ 2MQHA 5LMUL 2NVQH 4JI5L 1YJWA 2F4VL 4DR4L 3KLWA 2PQAA 3CCVA 4JI0Q 3UE0A 3CCUA 4GKJL 4JI3Q 1VQAA 5FJ8G 4MNOA 3G4SA 3HOZH 4IPGA 2HQLA 3HOVH 1Q86C 4OX9L 4C3HH 2WB1E 4A3IG 1Y1VG 4NPSA 4GLXA 3A0JA 1IL2A 4X65Q 1D7QA 2Q2TA 3I4NG 4DR7Q 2XGTA 3CW2C 2JA6G 3HOZG 4DV0Q 4JBJA 1PH8A 1IBKQ 3NENA 4K0KL 4R4OA 4DK3C 3ULLA 5M5WH 3CCRA 3CC2A 2JK8A 3KF6A 4IFDJ 3AEVA 4HIOA 4A3BG 1R9TH 1KD1C 3PIOA 1VQKA 1HH2P 4GS3A 2F52A 3I4OA 1X3GA 1UE6A 2B3GA 1X54A 2JA5H 1OXVA 3FKIG 3HOUH 2R7FA 2R92H 5BR8Q 3JAMc 2OWOA 2H5XA 1KXLA 5AJ3Q 4L5TA 5IYDH 1N36Q 3CC7A 1QZGA 4R1JA 5LMNL 4JI8Q 3WWVA 4LUZA 1Q12A 2GVBA 4PZ7A 3LGJA 4JI2Q 4YHHL 4DV5L 1YZ6A 1EWIA 3AQQA 1IBML 4B3MQ 2R92G 1WFQA 4IFDG 2UXDQ 2NVYH 2I5MX 1VQOA 2PQAB 5GAGC 3CMAA 2UXCL 5JJLA 2NVTH 4GOPC 1B8AA 3PUZA 1M90C 1VQEA 4JI3L 1CSPA 4X66Q 4L5QA 4JCVE 2ZTDA 3OYYA 2ID0A 4DR5Q 4LF6Q 4A93G 3I55A 2VQFL 4LW1A 3J7A5 5GROA 4IJLA 4NXMQ 3KYHC 4JC0A 2A8VA 3S16H 2N49A 1S3OA 1YHAA 4C3IH 1IBKL 1Q82C 4JBKA 3ICEA 4A76A 1AH9A 3F2CA 2UUBQ 3KF6B 4P72A 5C0XI 1KC8C 2E2HH 1E7ZA 1HR0L 3BJUA 4GKKQ 1UWVA 4DV7Q 1K8GA 1C9OA 3T1HQ 2K50A 1ASYA 2CCZA 1ASZA 2UUAL 3PUWA 1P16A 3TQYA 3CXCA 5ELOA 3UDIA 2K52A 2IX1A 4GNXC 1S72A 1E24A 4OONA 5BR8L 5JJKA 1PYSB 5IYCH 3OTOQ 2VQEQ 1N36L 3RR5A 2A1AA 1Y1WH 3PIPA 3CD6A 4NB3A 4JI8L 3EN2A 2ASBA 3UE1A 5LMUQ 4JI2L 2KHJA 4X6AH 3DLLA 4JI5Q 3CQZH 2F4VQ 3FP9A 1PH1A 4GKJQ 3GO5A 5IYBG 4YCWA 1XPOA 1CKMA 2K5VA 1SFOH 3CCLA 4WJ3M 5K36G 1SN8A 4YCVA 5EAYA 1IZ6A 3PF5A 2YV5A 1JJ2A 1NE3A 3F8TA 3T1YQ 4AYBG 1Q8KA 2E8GA 3PSIA 4XIGS 2OQKA 4LF6L 1PVOA 4L5RC 3J80i 1WCMH 1EUJA 1K9MC 2EQSA 1XTDA 4PZ8A 1V43A 4DPGA 1B70B 3KFUA 1KL9A 3IRBA 4LF4L 4IO9A 1I50H 4A4IA 1N34Q 1NMGA 1N9WA 4KHZA 4R4CA 1X3FA 3NEMA 1KIXA 1FJGL 2D0OA 1YVCA 1WCMG 3A5ZB 4MTNA 3ULPA 4A3MH 2XTIA 4LF8L 1L1OB 3S15H 4GKKL 3U50C 3W1BA 1O7IA 1G291 2QGQA 4HJ7A 5JJIA 1VQGA 4O2DA 1GVPA 3S1MH 4YWMA 3L2PA 3G71A 1BVSA 2ZTCA 4WJ4A 4A3MG 3BZCA 4HIKA 4JI7L 3KF8B 5IY0A 4LF7L 1KRSA 1X55A 2CWPA 4R4TA 2PMZE 2VL6A 1NMFA 4YHHQ 2LXJA 4DV5Q 1BBUA 4BA1I 2VQEL 1VQPA 1YJ9A 3S24A 4Y7NH 4HIDA 3TRZA 1XMOL 3G6EA 1PFSA 3HOUG 4LF9Q 2GVAA 1V9PA 4X66L 5IE8A 4LF9L 5IP7H 4B3TQ 2KENA 2E2JH 1I94Q 1YNXA 4JOIC 4L5SA 2B63H 3TS0A 4JV5Q 4LFBL 4DAYB 4A3GG 3UDGA 4ALPA 3S14H 2Z0SA 4AYBE 5IP7G 2ZTEA 4DAMA 1V1QA 3T1YL 3S2DH 2VQFQ 3F1ZA 3HKZG 2NZOA 1XNQQ 4QJFA 2RCNA 1HNZL 3M7NA 3HOVG 3ERSX 2YYZA 2BA0A 1KQSA 1DGSA 1VQ8A 1VQMA 2Q2HA 2DGYA 3ZJYC 2RHQB 1HR0Q 3E9IA 4P75A 4DV1Q 1UEBA 1Q46A 1N34L 3TREA 4KHPL 1WI5A 1LM0A 1SMXA 3KDFA 2UUAQ 4BY1H 4IJHA 4DV4Q 1SE8A 2L15A 2LXKA 3S1QH 1PA6A 1PH4A 1PHJA 2WAQG 1OXXK 5M3MH 4IPCA 2KCTA 4BY1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJP A;  4APV A;  4GOP A;  1E3P A;  2AWN A;  1YHB A;  3GTL H;  2CKZ B;  5FLM H;  4IFD I;  1VQ4 A;  2E5L Q;  2JA5 G;  3STB C;  4HJ8 A;  4DR2 Q;  3HOX H;  1C0A A;  4LFC Q;  1A8V A;  1TWH H;  3D0F A;  4AH6 A;  2HHH L;  4A3K H;  1XPR A;  5IYD G;  3GDE A;  5GQO A;  1JB7 A;  4LF5 L;  3RN5 A;  2MNA A;  1SR3 A;  1YBY A;  3UDX A;  5FLM G;  4B3T L;  1K73 C;  1JMC A;  3G48 A;  1WJJ A;  2VY3 A;  2KCM A;  3PGZ A;  4C2M H;  1J6Q A;  1YI2 A;  1I94 L;  4JV5 L;  4A3K G;  4IOC A;  5HGQ A;  1KAW A;  5M5Y H;  1TWG H;  3HFZ B;  4A3F H;  4IOA A;  3K7U C;  3MEF A;  2IX0 A;  3CP0 A;  1W2B A;  2PI2 A;  1VQN A;  2I5H A;  1Q81 C;  3ER0 A;  3W5O A;  1XNQ L;  1YJN A;  2V1C C;  4A75 A;  4EX5 A;  5IWA L;  3RZO H;  5E7N A;  4OWT B;  3J80 c;  4A3F G;  4B3S Q;  4GNX A;  4DUZ Q;  4AQY Q;  1EYG A;  4LF4 Q;  1FJG Q;  1YHQ A;  1JT8 A;  3GTP H;  3RLO A;  3KDF B;  2QA4 A;  4DV1 L;  4LF8 Q;  1C7Y A;  4JI1 Q;  5ELN A;  2HIX A;  3K81 C;  3M4Q A;  4QL5 A;  1VQJ A;  2GN5 A;  3SGI A;  4PG3 A;  1VQ5 A;  1PH5 A;  1E1T A;  4DV4 L;  2IHE A;  1W3S A;  2Z6K A;  4JI7 Q;  3S1R H;  2WAQ E;  4LF7 Q;  1PH2 A;  2BH2 A;  4GOP B;  2HIV A;  1AE3 A;  1VQC A;  3CME A;  3J81 c;  4B3R L;  1GD7 A;  2K75 A;  3K8A A;  4LWC A;  3KOJ A;  3L0O A;  5IP9 H;  3Q8D A;  4FDB A;  2VZA A;  4GN4 B;  1XMO Q;  4POG A;  5GAE C;  3HOW H;  3HOY H;  3ULJ A;  2E5L L;  4DR2 L;  1MJE A;  2MO0 A;  1KHI A;  2AKW B;  4MZ9 A;  4UP9 A;  2D0P A;  4LFC L;  1YEZ A;  1NBW A;  2YTV A;  4UP7 A;  5IYC G;  4X64 L;  2OQ0 A;  1K83 H;  3FHW A;  3AFP A;  3M85 A;  2ZM6 L;  1Y1W G;  3RLN A;  3TS2 A;  4LFB Q;  3HOY G;  2N3S A;  4GN3 B;  3JAM i;  2JA7 H;  2R7Z H;  4P74 A;  1IBL L;  3HOW G;  4IPH A;  1EOV A;  3H3V H;  1HNZ Q;  3J7Z C;  3PO2 H;  5LMN W;  3PUX A;  2R7Z G;  4DR1 L;  1L1O C;  4GNX B;  1VQ6 A;  4A3C H;  2YU9 H;  5C3E H;  2YTY A;  4B3S L;  4KLK A;  2DUD A;  4DUZ L;  2VS1 A;  2B29 A;  3UDF A;  4AQY L;  1NTG A;  3RLF A;  2NVX H;  4KHP Q;  1X3E A;  1FL0 A;  3CCS A;  4JI1 L;  1XMQ Q;  3CF5 A;  4X62 L;  3CCM A;  1XPU A;  1B7Y B;  4GLV B;  4A3E H;  1VQI A;  1A0I A;  1SLJ A;  2R6G A;  4UY8 C;  3KJO A;  1XJV A;  3GTJ H;  1A62 A;  1N32 L;  3VDY A;  2K14 A;  2I0Q A;  1X6O A;  4JOI A;  2Q2I A;  4DV3 Q;  3S1N H;  4A3E G;  4LFA Q;  2HHH Q;  3L7Z C;  1H95 A;  1TWC H;  2F3I A;  1K0R A;  4C3J H;  2IT1 A;  1HR0 W;  4LF5 Q;  2HT1 A;  4OO1 G;  1VQL A;  2AWO A;  2BH8 A;  4LUO A;  1NJI C;  1E22 A;  2VUM H;  1EQR A;  2IHF A;  2JJQ A;  2JA9 A;  3S17 H;  4JYA Q;  5M3F H;  2WFW A;  1L0W A;  5C44 H;  2E2I H;  3K0X A;  4IPD A;  4LNQ A;  4DR6 Q;  1EIF A;  3A5U A;  2UXB L;  1A63 A;  4JI6 Q;  2ATW A;  1TXY A;  1OXS C;  1UE1 A;  2KHI A;  2QEX A;  1JE5 A;  3MXN B;  2VUM G;  1HNW L;  1JJG A;  2B63 G;  3GTK H;  4DV2 L;  4YY3 Q;  5M3F G;  1Q1B A;  4HJA A;  3I7F A;  1Q7Y C;  5C44 G;  5IWA Q;  4HJ5 A;  3B6Y A;  1G6P A;  5FJ8 H;  2Y0S G;  4RG1 A;  2NN6 I;  1U5K A;  1VQB A;  2NZH A;  1YIT A;  2NN6 G;  1VQH A;  1GO3 E;  4A3I H;  1Y1V H;  3E0E A;  4EQ5 A;  3EBE A;  1GKH A;  3TEH B;  1JJC B;  4QIW E;  3I4N H;  1L2F A;  2JA6 H;  2JA8 H;  1FVI A;  4JI4 Q;  1MIU A;  3A74 A;  4JG2 A;  4ME3 A;  4R4Q A;  1XMQ L;  1EIY B;  1QVF A;  1LTL A;  2ES2 A;  5J3B A;  1QVC A;  1GM5 A;  3GTM H;  4R4I A;  4B3R Q;  1RIP A;  1Z9F A;  4QGU A;  4DR3 L;  2JA8 G;  3GTG H;  1U0L A;  3NEL A;  4QY7 A;  3S2H H;  4JBM A;  3I4M H;  4A3B H;  2OCE A;  3PUV A;  3F2D A;  1BBW A;  4DV3 L;  3OW2 A;  1OXT A;  4POF A;  2Q2U A;  4GN5 A;  3CCE A;  1QZH A;  4LFA L;  3AFQ A;  5JEA J;  3NBH B;  5M3M G;  4X64 Q;  4DUY L;  4DV6 L;  4Y52 H;  2YTX A;  1HZB A;  3CPF A;  3E9H A;  2K5H A;  3FKI H;  5M5X H;  2ZM6 Q;  1NY4 A;  3D31 A;  2C35 B;  3I4M G;  2R93 H;  3PF4 A;  2JE6 I;  3DM3 A;  1LYL A;  4GLA C;  3HOX G;  3CPW A;  1G51 A;  1IBL Q;  4JYA L;  1D8L A;  1RL2 A;  3GD7 A;  3PUY A;  2FXQ A;  3BU2 A;  1MKH A;  5H1S E;  1S40 A;  4DR6 L;  3PO3 H;  1BKB A;  4JI6 L;  2R93 G;  2JQO A;  1OXU A;  1WOC A;  3HKZ E;  2EXD A;  1T9H A;  3U4Z A;  5C4X H;  2ZJR A;  1PH7 A;  1HNX Q;  5JEA G;  4DR1 Q;  3CC4 A;  1VQF A;  2D62 A;  4YY3 L;  2LSS A;  2Y0S E;  1YIJ A;  4PMW A;  3PO3 G;  2K5N A;  2AHO B;  2UU9 Q;  2CQO A;  1I6H H;  1IXR A;  4BBR H;  2ZJQ A;  5C4X G;  1CUK A;  3J81 j;  2MO1 A;  4BY7 H;  4OXP A;  4KI0 A;  2RHS B;  4X62 Q;  1SRO A;  1AE2 A;  5C0X J;  3CCQ A;  4JI0 L;  4A93 H;  4BXX H;  1SRU A;  3U4V A;  4AIM A;  4UP8 A;  2KBN A;  3RN2 A;  1P8L A;  1LUZ A;  4JI4 L;  4JBW A;  1TWF H;  4BBR G;  5GAH C;  4P71 A;  4BY7 G;  1VQD A;  3AYH B;  3M9B A;  1N32 Q;  2UUC Q;  4X65 L;  1N8R C;  3M3Y H;  1XNR Q;  1CKO A;  4DR7 L;  2PI2 E;  1J5E Q;  3I2Z A;  4O0A A;  4BXX G;  3M4O H;  2N78 A;  1I5F A;  1Z47 A;  3EIV A;  1X56 A;  4P73 A;  2RF4 A;  4DV0 L;  1QVG A;  1K8A C;  2N8N A;  4UPA A;  3I56 A;  1Y14 B;  2MFI A;  3CCJ A;  3PV0 A;  1HZA A;  4HIM A;  1PYB A;  1EFW A;  5C0X G;  1OTC A;  1VCI A;  1MJC A;  1UE5 A;  3BZK A;  4XTC S;  2ALY B;  1KRT A;  3F2B A;  5IP9 G;  1N33 Q;  2A19 A;  5GAD C;  4NXN Q;  2OTJ A;  1L1O A;  2UXB Q;  3RZD H;  4J15 A;  1PV4 A;  4PZ6 A;  1HZC A;  1HNW Q;  2CWA A;  3STB D;  4DV2 Q;  2JEB I;  2VW9 A;  2I5L X;  5AJ3 L;  2WP8 J;  1CKN A;  5IYB H;  4YCU A;  4DK6 C;  1K3R A;  1M1K C;  1HNX L;  1QUQ A;  2JA7 G;  3H3V I;  1HZ9 A;  2PNH A;  1PH9 A;  2Z6K C;  4B3M L;  2UU9 L;  2ZJP A;  1VQ7 A;  4DR4 Q;  2UXD L;  3PO2 G;  4A3J H;  4BA2 I;  2IY5 B;  3K7A H;  4TQU S;  5FLX c;  4A3C G;  4H02 A;  3GTO H;  5C3E G;  4OX9 Q;  4A3D H;  2CFM A;  4OWX B;  4YWL A;  2WB1 G;  3RNU A;  3HKS A;  4HJ9 A;  4DNI A;  1EQQ A;  4RMF A;  1I3Q H;  3W1G A;  4A3J G;  4DR3 Q;  1VQ9 A;  4BBS H;  5C4J H;  4DR5 L;  2UUC L;  1XNR L;  4A3D G;  1J5E L;  1WYD A;  1FGU A;  3H0G H;  5DLQ E;  4DKA C;  4K0K Q;  2OTL A;  4NXM L;  3KJP A;  2EIF A;  5IT9 c;  4DV6 Q;  4DUY Q;  2JEA I;  2R7D A;  3PCO B;  4OO1 I;  1TWA H;  2UUB L;  2K4K A;  4BBS G;  1E1O A;  3H0G G;  1X9N A;  3GTQ H;  1VS0 A;  4DV7 L;  1N33 L;  3T1H L;  5HY6 A;  4NXN L;  4QQB X;  4TVA B;  4LUV A;  3J81 i;  3CAM A;  4OWW B;  4A3L H;  3M4P A;  3K80 C;  1CKN B;  1PH6 A;  1CSQ A;  1IYJ B;  5LMN Q;  1QUQ B;  2VNU D;  2BA1 A;  1X65 A;  2AMC B;  3OTO L;  3U58 A;  1IBM Q;  1Q1E A;  3JC6 6;  1UE7 A;  3H15 A;  4A3L G;  1PH3 A;  4A3G H;  4YWK A;  2UXC Q;  2MQH A;  5LMU L;  2NVQ H;  4JI5 L;  1YJW A;  2F4V L;  4DR4 L;  3KLW A;  2PQA A;  3CCV A;  4JI0 Q;  3UE0 A;  3CCU A;  4GKJ L;  4JI3 Q;  1VQA A;  5FJ8 G;  4MNO A;  3G4S A;  3HOZ H;  4IPG A;  2HQL A;  3HOV H;  1Q86 C;  4OX9 L;  4C3H H;  2WB1 E;  4A3I G;  1Y1V G;  4NPS A;  4GLX A;  3A0J A;  1IL2 A;  4X65 Q;  1D7Q A;  2Q2T A;  3I4N G;  4DR7 Q;  2XGT A;  3CW2 C;  2JA6 G;  3HOZ G;  4DV0 Q;  4JBJ A;  1PH8 A;  1IBK Q;  3NEN A;  4K0K L;  4R4O A;  4DK3 C;  3ULL A;  5M5W H;  3CCR A;  3CC2 A;  2JK8 A;  3KF6 A;  4IFD J;  3AEV A;  4HIO A;  4A3B G;  1R9T H;  1KD1 C;  3PIO A;  1VQK A;  1HH2 P;  4GS3 A;  2F52 A;  3I4O A;  1X3G A;  1UE6 A;  2B3G A;  1X54 A;  2JA5 H;  1OXV A;  3FKI G;  3HOU H;  2R7F A;  2R92 H;  5BR8 Q;  3JAM c;  2OWO A;  2H5X A;  1KXL A;  5AJ3 Q;  4L5T A;  5IYD H;  1N36 Q;  3CC7 A;  1QZG A;  4R1J A;  5LMN L;  4JI8 Q;  3WWV A;  4LUZ A;  1Q12 A;  2GVB A;  4PZ7 A;  3LGJ A;  4JI2 Q;  4YHH L;  4DV5 L;  1YZ6 A;  1EWI A;  3AQQ A;  1IBM L;  4B3M Q;  2R92 G;  1WFQ A;  4IFD G;  2UXD Q;  2NVY H;  2I5M X;  1VQO A;  2PQA B;  5GAG C;  3CMA A;  2UXC L;  5JJL A;  2NVT H;  4GOP C;  1B8A A;  3PUZ A;  1M90 C;  1VQE A;  4JI3 L;  1CSP A;  4X66 Q;  4L5Q A;  4JCV E;  2ZTD A;  3OYY A;  2ID0 A;  4DR5 Q;  4LF6 Q;  4A93 G;  3I55 A;  2VQF L;  4LW1 A;  3J7A 5;  5GRO A;  4IJL A;  4NXM Q;  3KYH C;  4JC0 A;  2A8V A;  3S16 H;  2N49 A;  1S3O A;  1YHA A;  4C3I H;  1IBK L;  1Q82 C;  4JBK A;  3ICE A;  4A76 A;  1AH9 A;  3F2C A;  2UUB Q;  3KF6 B;  4P72 A;  5C0X I;  1KC8 C;  2E2H H;  1E7Z A;  1HR0 L;  3BJU A;  4GKK Q;  1UWV A;  4DV7 Q;  1K8G A;  1C9O A;  3T1H Q;  2K50 A;  1ASY A;  2CCZ A;  1ASZ A;  2UUA L;  3PUW A;  1P16 A;  3TQY A;  3CXC A;  5ELO A;  3UDI A;  2K52 A;  2IX1 A;  4GNX C;  1S72 A;  1E24 A;  4OON A;  5BR8 L;  5JJK A;  1PYS B;  5IYC H;  3OTO Q;  2VQE Q;  1N36 L;  3RR5 A;  2A1A A;  1Y1W H;  3PIP A;  3CD6 A;  4NB3 A;  4JI8 L;  3EN2 A;  2ASB A;  3UE1 A;  5LMU Q;  4JI2 L;  2KHJ A;  4X6A H;  3DLL A;  4JI5 Q;  3CQZ H;  2F4V Q;  3FP9 A;  1PH1 A;  4GKJ Q;  3GO5 A;  5IYB G;  4YCW A;  1XPO A;  1CKM A;  2K5V A;  1SFO H;  3CCL A;  4WJ3 M;  5K36 G;  1SN8 A;  4YCV A;  5EAY A;  1IZ6 A;  3PF5 A;  2YV5 A;  1JJ2 A;  1NE3 A;  3F8T A;  3T1Y Q;  4AYB G;  1Q8K A;  2E8G A;  3PSI A;  4XIG S;  2OQK A;  4LF6 L;  1PVO A;  4L5R C;  3J80 i;  1WCM H;  1EUJ A;  1K9M C;  2EQS A;  1XTD A;  4PZ8 A;  1V43 A;  4DPG A;  1B70 B;  3KFU A;  1KL9 A;  3IRB A;  4LF4 L;  4IO9 A;  1I50 H;  4A4I A;  1N34 Q;  1NMG A;  1N9W A;  4KHZ A;  4R4C A;  1X3F A;  3NEM A;  1KIX A;  1FJG L;  2D0O A;  1YVC A;  1WCM G;  3A5Z B;  4MTN A;  3ULP A;  4A3M H;  2XTI A;  4LF8 L;  1L1O B;  3S15 H;  4GKK L;  3U50 C;  3W1B A;  1O7I A;  1G29 1;  2QGQ A;  4HJ7 A;  5JJI A;  1VQG A;  4O2D A;  1GVP A;  3S1M H;  4YWM A;  3L2P A;  3G71 A;  1BVS A;  2ZTC A;  4WJ4 A;  4A3M G;  3BZC A;  4HIK A;  4JI7 L;  3KF8 B;  5IY0 A;  4LF7 L;  1KRS A;  1X55 A;  2CWP A;  4R4T A;  2PMZ E;  2VL6 A;  1NMF A;  4YHH Q;  2LXJ A;  4DV5 Q;  1BBU A;  4BA1 I;  2VQE L;  1VQP A;  1YJ9 A;  3S24 A;  4Y7N H;  4HID A;  3TRZ A;  1XMO L;  3G6E A;  1PFS A;  3HOU G;  4LF9 Q;  2GVA A;  1V9P A;  4X66 L;  5IE8 A;  4LF9 L;  5IP7 H;  4B3T Q;  2KEN A;  2E2J H;  1I94 Q;  1YNX A;  4JOI C;  4L5S A;  2B63 H;  3TS0 A;  4JV5 Q;  4LFB L;  4DAY B;  4A3G G;  3UDG A;  4ALP A;  3S14 H;  2Z0S A;  4AYB E;  5IP7 G;  2ZTE A;  4DAM A;  1V1Q A;  3T1Y L;  3S2D H;  2VQF Q;  3F1Z A;  3HKZ G;  2NZO A;  1XNQ Q;  4QJF A;  2RCN A;  1HNZ L;  3M7N A;  3HOV G;  3ERS X;  2YYZ A;  2BA0 A;  1KQS A;  1DGS A;  1VQ8 A;  1VQM A;  2Q2H A;  2DGY A;  3ZJY C;  2RHQ B;  1HR0 Q;  3E9I A;  4P75 A;  4DV1 Q;  1UEB A;  1Q46 A;  1N34 L;  3TRE A;  4KHP L;  1WI5 A;  1LM0 A;  1SMX A;  3KDF A;  2UUA Q;  4BY1 H;  4IJH A;  4DV4 Q;  1SE8 A;  2L15 A;  2LXK A;  3S1Q H;  1PA6 A;  1PH4 A;  1PHJ A;  2WAQ G;  1OXX K;  5M3M H;  4IPC A;  2KCT A;  4BY1 G; 
#chains in the Genus database with same CATH topology
 4GOP A;  1E3P A;  3L9A X;  3GTL H;  2CKZ B;  1A15 A;  3J80 E;  3STB C;  3OMG A;  4EGV A;  3HOX H;  1CHP D;  4QIW B;  3CRK C;  5GQO A;  1JB7 A;  2B2V C;  1F9Q A;  4EQN A;  2JN4 A;  1YBY A;  5FLM G;  1K73 C;  2VY3 A;  1I94 L;  2KCM A;  1YI2 A;  4X6A H;  4JV5 L;  4A3M B;  4M8A A;  3HFZ B;  2A68 D;  3VYU A;  1KNA A;  1W2B A;  1DOM A;  4RH6 A;  5EKK A;  4FF4 A;  3ER0 A;  2V1C C;  4ILW A;  4EX5 A;  5E7N A;  1ZEQ X;  4AQY Q;  4K5V A;  1FJG Q;  1EYG A;  1JT8 A;  3RLO A;  3KDF B;  2EYH A;  4LF8 Q;  1C7Y A;  1X3P A;  4DAP A;  3HG9 A;  1E1T A;  2IHE A;  3KBX A;  1GXD C;  2B63 B;  3S17 B;  1AE3 A;  1DON A;  1GD7 A;  2K75 A;  3S14 B;  2EDG A;  1A3T A;  3Q8D A;  2VZA A;  3S2D B;  4DA2 A;  4POG A;  2E5L L;  3P20 A;  2RDF A;  2YTV A;  5IYC G;  1K83 H;  2ZM6 L;  4J6H A;  1RF2 D;  2B2U A;  4GN3 B;  1B53 A;  1TS4 A;  4XYO A;  2R7Z H;  3FRP B;  1IBL L;  3C1F A;  3H3V H;  3J7Z C;  1KAA A;  3PUX A;  5M3M B;  4DR1 L;  1L1O C;  4OIJ A;  1VQ6 A;  1NSN S;  2YTY A;  4KLK A;  2DUD A;  2VS1 A;  3MZ5 A;  3UDF A;  2OF1 A;  1NTG A;  1DZ1 A;  1X3E A;  3CCS A;  3IL8 A;  1XMQ Q;  4A3K B;  3K59 A;  4X62 L;  4A3E H;  5BN5 A;  1SLJ A;  4J1M A;  4UY8 C;  4DN4 M;  3MWY W;  3QWN A;  3GTJ H;  5C5L A;  1H9K A;  4JOI A;  1TWG B;  4DV3 Q;  3S1N H;  3NWT A;  4EQO A;  2HHH Q;  1RDP D;  3NBH A;  1VQL A;  2EYJ A;  2BH8 A;  1JC7 A;  1XTC D;  2F0M A;  4X3T A;  3HS0 C;  2JJQ A;  3A7L A;  3GTP B;  2F0N A;  1WTX A;  2E2I H;  5BN4 A;  3A5U A;  3DEO A;  2EJG C;  2QEX A;  1ONL A;  3X3N A;  4HJA A;  1Q1B A;  4ZQ3 A;  1SNP A;  3B6Y A;  5EQ0 A;  4RG1 A;  1VQB A;  4A3I H;  2D2C C;  2EYL A;  1SJE D;  4DK1 A;  5IGG A;  1JJC B;  4L6T B;  4QIW E;  3I4N H;  3QB3 A;  2IWH A;  4F7X A;  4FO2 A;  5HUR A;  1WTV A;  1ESR A;  2Q8R E;  1IKL A;  2L55 A;  1QVC A;  1IW7 D;  2A6E C;  3GTM H;  4B3R Q;  3VR4 A;  4QGU A;  4DR3 L;  1SNC A;  1U0L A;  2CH4 W;  4ZAI A;  2O2L D;  1AP0 A;  3I4M H;  3PUV A;  3OW2 A;  2L11 A;  1I4G A;  2YTX A;  3E9H A;  1YNJ D;  1UAP A;  3OIQ A;  3H91 A;  3D3R A;  4CKE A;  2JE6 I;  1LTB D;  3HOX G;  4JYA L;  1D8L A;  1A3V A;  3GD7 A;  2FXQ A;  3K7A B;  2Z9H A;  4CJ1 B;  1A6X A;  2R93 G;  4KD4 A;  4V19 0;  1OXU A;  1PH7 A;  2F0D A;  5C4X H;  2RKS A;  1F9R A;  3QG1 A;  2OT2 A;  2NB0 A;  4PMW A;  2K5N A;  2AHO B;  4BBR H;  2G9H D;  2ZJQ A;  1LO5 D;  1JOO A;  3CHB D;  3KLS A;  4KI0 A;  1TWC B;  1AE2 A;  4BXX H;  1SRU A;  2SDF A;  4AIM A;  3RN2 A;  1P8L A;  4JI4 L;  2B2Y A;  1TWF H;  1KTK A;  4GZY C;  4BY7 G;  1FGB D;  2VUM B;  4JW0 A;  4PNY A;  1N8R C;  2UUC Q;  4I7Z C;  4O0A A;  5KRU A;  5IGB A;  2N78 A;  1Z47 A;  2CH4 A;  1X56 A;  1CQV A;  2QDL A;  2MFI A;  1BCP C;  1IHZ A;  3MXU A;  1PYB A;  5JOB A;  3QJY A;  4F8M A;  2ALY B;  3D8G A;  5FLX E;  2N55 A;  1I4P A;  5JVH 3;  3Q23 A;  2CQA A;  2K01 A;  3RZD H;  4J15 A;  1PV4 A;  4JK1 C;  3MC0 B;  1S5F D;  2JA6 B;  1HZC A;  2JA8 B;  2CWA A;  2QEJ C;  1HNW Q;  4DV2 Q;  1JB3 A;  5E4W C;  3VYR A;  1CKN A;  1Q3L A;  3TP7 A;  4DK6 C;  1K3R A;  1QUQ A;  4NDX A;  4IUN A;  1PH9 A;  2JXM B;  2Z6K C;  2UU9 L;  2Z4I A;  4A3B B;  5G3L F;  4K6L A;  4A3J H;  4BA2 I;  5JVG 3;  4A3D H;  3FKI B;  4ZKB B;  1RHP A;  4YWL A;  2WB1 G;  4HJ9 A;  4ZYS A;  1RJT A;  4RMF A;  5DAU A;  3FEW X;  4K0K Q;  2OTL A;  4HAE A;  4DUY Q;  4DXF A;  1F77 A;  4BBS G;  3WOE A;  3SHL A;  3R2T A;  3H0G G;  1X9N A;  1KLG D;  3GTQ H;  1N33 L;  3T1H L;  1TT2 A;  3IAY A;  4NXN L;  3MXG A;  4A93 B;  1JWM D;  1EU4 A;  2EJF C;  4FYD A;  4XT3 B;  3A55 A;  1X65 A;  2AMC B;  2KHS A;  1M8A A;  3TP6 A;  1VMC A;  1Q1E A;  3MXP A;  5FO8 B;  2K28 A;  3H15 A;  1PH3 A;  1KAB A;  5LMU L;  4IUQ A;  3TME A;  1YJW A;  1TII D;  4DR4 L;  3KLW A;  4J8Q A;  1PLF A;  4RKL A;  1SXT A;  2HQL A;  1GUG A;  4A3I G;  3A7A B;  3SEB A;  4GLX A;  3A0J A;  1D7Q A;  2NTT A;  2Q2T A;  3I4N G;  4DR7 Q;  2F0J A;  4C3H G;  4DK0 A;  1G2T A;  5C4H A;  3CC2 A;  4HED A;  2JK8 A;  1UEA B;  3N52 A;  3P1H A;  2QCP X;  1K3B C;  3PIO A;  1VQK A;  2A5H A;  2F1M A;  4AYB B;  2EY1 A;  2JA5 H;  2K03 A;  4JVZ A;  3I73 A;  2R7F A;  1D5M C;  1JR0 D;  2B2W C;  5IYD H;  2M9V A;  3WWV A;  4PZ7 A;  1LLR D;  1EYD A;  1ZKO A;  1EWI A;  1SMY D;  4E6I A;  4B3M Q;  2UXD Q;  2PW7 A;  3RD4 A;  2NVT H;  3PUZ A;  1EU3 A;  1SBB B;  3F2U A;  1UNS A;  2NZ1 D;  1B1Z A;  2LY7 A;  2ZXR A;  5D3D A;  2Z1C A;  4RHS A;  1BCP F;  4LF6 Q;  5HGT A;  1FNV A;  1DD2 A;  1IBK L;  1AH9 A;  3FMC A;  3KF6 B;  1KC8 C;  4K14 A;  1E7Z A;  4V0B A;  4DV7 Q;  1C9O A;  1LT5 D;  1ASY A;  2CCZ A;  4RKB A;  2UUA L;  2M00 A;  3CXC A;  5ELO A;  2IJ0 A;  5CBE E;  3UI2 A;  3QO2 A;  1AFP A;  1TU2 B;  3KLS X;  1PYS B;  1S5E D;  1I4H A;  4HSP A;  2DNC A;  3OTO Q;  3PIP A;  4NB3 A;  4JI8 L;  3TZU A;  3EN2 A;  2H1E A;  1E2W A;  2KHJ A;  2V4D A;  1T5E A;  1D1I A;  2B2T C;  2E76 C;  4N9T A;  4GKJ Q;  3GO5 A;  1SFO H;  3CCL A;  4F87 A;  4YCV A;  3I91 A;  2YV5 A;  4MN3 A;  1Q8K A;  2CVR A;  2M2L A;  2E8G A;  1PTO B;  2OQK A;  5NUC A;  2Z6B A;  3HOU B;  1EUJ A;  4DPG A;  4FXG C;  4IO9 A;  1FJG L;  1JIC A;  3GTL B;  1AEX A;  5I2X A;  3ITP A;  3ULP A;  1TS2 A;  4LF8 L;  4HR7 B;  5JJI A;  2ENB A;  1G2S A;  3EJI A;  4O2D A;  1TVX A;  3L2P A;  3G71 A;  4WJ4 A;  1Y8O B;  4A3M G;  2CWP A;  4R4T A;  5DM6 3;  2PMZ E;  1NMF A;  1BBU A;  3BDL A;  2VQE L;  1Y69 U;  3S24 A;  5IGF A;  4Z9C B;  1TY2 A;  3G6E A;  1V9P A;  3K0Y A;  2JP1 A;  5IE8 A;  1ILQ A;  5IGC A;  2K05 A;  2E2J H;  2KVM A;  2E2H B;  1GJX A;  2F4I A;  1STY A;  2K33 A;  4ZUI A;  1EEI D;  1CK1 A;  1HA5 A;  1I4X A;  1STH A;  2Z0S A;  4AYB E;  5C3X A;  4ZK9 B;  4DAM A;  5IP7 G;  1V1Q A;  3ND9 A;  2F0I A;  3F1Z A;  3M7N A;  2BA0 A;  3MVV A;  1SYB A;  1DGS A;  3H6M A;  2DGY A;  3ZJY C;  2RHQ B;  3E9I A;  4DV1 Q;  1Y1W B;  1Q46 A;  1N34 L;  3TRE A;  1A2U A;  4BY1 H;  1HCZ A;  3DWA A;  2EYF A;  4FXK C;  1V1P B;  4C1N I;  4DV4 Q;  2L15 A;  5LL6 S;  4I65 A;  1PA6 A;  1PHJ A;  1U9R A;  1OXX K;  1HJP A;  2R7Z B;  2MGS A;  5FLM H;  1TS5 A;  1VQ4 A;  2JA5 G;  2A6H D;  3G7L A;  4DR2 Q;  4LFC Q;  3D0F A;  2HHH L;  4CDD C;  1FYC A;  1XPR A;  1WCM B;  5E3F A;  5IYD G;  4H44 C;  1O7Y A;  1L0Y B;  1F9P A;  1WJJ A;  3LWU A;  1R4P B;  3MFG A;  3PGZ A;  4A3K G;  4IOC A;  5M5Y H;  1KAW A;  2RDH A;  4UAI A;  2F0H A;  2IX0 A;  2MP1 A;  3CP0 A;  1VQN A;  1YNN C;  3S1M B;  1YJN A;  3FPU B;  3C2P A;  4A75 A;  2EE1 A;  3RZO H;  4A3F G;  4OWT B;  4GNX A;  2D5D A;  2QA4 A;  2E74 C;  3A8J E;  4JI1 Q;  5ELN A;  3I72 A;  3M4Q A;  2ICI A;  2F3V A;  1VQ5 A;  1PH5 A;  4EVO A;  1ET9 A;  1W3S A;  4LF7 Q;  3HKZ B;  3EQL C;  4GOP B;  2EY5 A;  4JPB W;  1GHJ A;  4B3R L;  2HUG A;  2Y0S B;  4LWC A;  3L0O A;  5IP9 H;  1HUM A;  2WV6 D;  1PFM A;  3OW7 A;  3EFX D;  5EJW A;  5GAE C;  2AKW B;  4LF9 Q;  4UP9 A;  1F2M A;  1YEZ A;  4UP7 A;  2OQ0 A;  3FHW A;  4ID6 A;  3TS2 A;  2DNE A;  4N8F A;  4LFB Q;  3HOY G;  4QMG A;  4RWS C;  2JA7 H;  2EYO A;  4IPH A;  2KEC A;  3NHH A;  1HNZ Q;  2L1B A;  3S1Q B;  1ILP A;  3VR5 A;  2J7Z A;  1NUC A;  1QNU A;  3MTS A;  5C3E H;  4IZ8 A;  4B3S L;  3I4M B;  4DUZ L;  4KHP Q;  1QIL A;  4EQP A;  1FL0 A;  1TWH B;  3PIO 3;  3HRZ C;  1B7Y B;  1D6E C;  2R6G A;  2FHT A;  1XJV A;  1A62 A;  4C2M B;  2I0Q A;  5IT9 L;  4O42 A;  4FF2 A;  2F3I A;  5EPK A;  1PTO D;  4MIU A;  1Y8P B;  4OO1 G;  2FMC A;  1WTR A;  1NJI C;  5TSS A;  1EZ6 A;  2JA9 A;  1L0W A;  2PW5 A;  1EIF A;  4JI6 Q;  4QF4 A;  1OXS C;  1IYV A;  2F0Q A;  1HNW L;  2VUM G;  3GTK H;  4DV2 L;  1Q7Y C;  5M3F G;  5IWA Q;  4HJ5 A;  2NN6 I;  1VQH A;  1GO3 E;  4DNT B;  1Y1V H;  1B4O A;  1O7L A;  3EBE A;  1RTO A;  2X6L A;  1DCZ A;  1L2F A;  4H13 C;  1WTQ A;  4ME3 A;  5EPL A;  1PZK D;  1EIY B;  1D2B A;  5DEH A;  1GM5 A;  2B2V A;  3GV3 A;  2JA8 G;  1LTR D;  3NEL A;  3GTG H;  3S2H H;  4JBM A;  2F0F A;  1NR2 A;  2Q2U A;  1BBW A;  4RCN A;  1XPU A;  4LFA L;  4DUY L;  3NBH B;  4X64 Q;  3PO2 B;  1HZB A;  5M5X H;  2QDB A;  2R93 H;  3TZD A;  1WTP A;  3DM3 A;  1LYL A;  4GLA C;  4RGN A;  2NVX B;  4OIK A;  1RL2 A;  4A3J B;  3BU2 A;  3JAM L;  4DR6 L;  5J1Z A;  2JQO A;  3HKZ E;  2EXD A;  2ZJR A;  1HNX Q;  4PMC A;  4YY3 L;  2Y0S E;  5KYI A;  3PO3 G;  4RA8 A;  1I6H H;  1CUK A;  4BY7 H;  1O80 A;  2RHS B;  4PMB A;  1SRO A;  4C3J B;  2KBN A;  4JBW A;  3T56 B;  1EL0 A;  4P71 A;  3M3Y H;  3FVQ A;  4DR7 L;  1J5E Q;  1SE3 A;  5C44 B;  1V1O A;  4P73 A;  2RF4 A;  2C9O A;  1QVG A;  2IX3 A;  2N8N A;  3PV0 A;  1EFW A;  1OTC A;  1KDC A;  3RMH A;  1SJH D;  5IP9 G;  2VXW A;  2A19 A;  1QWY A;  2XRQ D;  1L1O A;  1NAP A;  4WJW A;  5CV6 A;  4CBV A;  2UXB Q;  4S3S A;  2A69 D;  5KEE A;  1CHQ D;  3BYT B;  2DJG C;  4KK7 A;  3STB D;  2VW9 A;  2I5L X;  1JQY D;  2BE5 C;  5IYB H;  3BG3 A;  4YCU A;  3A8K E;  1M1K C;  1PRT B;  2JA7 G;  2EJM A;  1CI3 M;  4B3M L;  4X3U A;  1VQ7 A;  2UXD L;  1U4L A;  1ENA A;  3I8Z A;  2IY5 B;  3GTO H;  5C3E G;  3P75 A;  2A73 B;  2KEE A;  3RNU A;  1O7Z A;  3HKS A;  3W1G A;  1NCV A;  4BBS H;  5C4J H;  1XNR L;  3H0G H;  3KJP A;  1IW7 C;  5LHY 1;  4DV6 Q;  3NSW A;  1TQO A;  4OO1 I;  1TWA H;  1E1O A;  1SSO A;  1VS0 A;  4DV7 L;  4PV1 C;  2XSC A;  5HY6 A;  2NVT B;  5EGT A;  1DM0 B;  4BS9 A;  2ICE C;  3CAM A;  3MHB A;  3OHX C;  1HHV A;  3E0J A;  2RQX A;  3IFD A;  2CW0 C;  1STE A;  1CKN B;  2XWJ B;  1CSQ A;  3C1E A;  2B39 A;  3K80 C;  4LMQ D;  1IYJ B;  5LMN Q;  1QUQ B;  4OGQ C;  2VNU D;  5IGD A;  3OTO L;  3U58 A;  1UE7 A;  5C4Z A;  3Q24 A;  4A3G H;  3M4O B;  2UXC Q;  2MQH A;  2EOT A;  3CCV A;  4GKJ L;  3NPP A;  4IPG A;  2LMC B;  3SK4 A;  4C3H H;  4OX9 L;  1Y1V G;  1RTN A;  2QKI C;  4X65 Q;  4YIJ A;  2XGT A;  3CW2 C;  3WDN A;  2FFK B;  3SE0 A;  1PH8 A;  1GOZ A;  1ZYR D;  2OXP A;  3SK5 A;  2PNR C;  4N8X 1;  4DK3 C;  5M5W H;  2I46 A;  1II3 A;  2F0S A;  1HRJ A;  1CZW A;  5G3L D;  5I4D A;  1U4R A;  1R9T H;  3DXJ C;  3GP7 A;  1S4Z A;  2ZXP A;  3VR3 A;  1PFN A;  1SYF A;  5BR8 Q;  5AJ3 Q;  1Q90 A;  4XT1 B;  2ZXO A;  1I3Q B;  3HOU G;  1IBM L;  3AQQ A;  2MJ8 A;  4IFD G;  2KUM A;  1WFQ A;  1EY7 A;  2EYP A;  2I5M X;  2NVY H;  3S9W A;  2SNM A;  5GAG C;  2EXZ A;  5JJL A;  2KJX A;  1STN A;  4JI3 L;  3L3O C;  2XIW A;  2WII B;  1GUS A;  2ZTD A;  2ID0 A;  4DF7 A;  4DR5 Q;  4LW1 A;  5GRO A;  4NXM Q;  2DY8 A;  4JC0 A;  3S16 H;  1S3O A;  1YHA A;  5ELB A;  3J80 L;  3ICE A;  1LT3 D;  3F2C A;  3VA7 A;  4ME5 A;  3BJU A;  5EKL A;  3C46 A;  1WD1 A;  3OOC A;  1UUP A;  5E1F A;  4GKK Q;  1UWV A;  3HP3 A;  3EA6 A;  4G57 A;  5ELD A;  2A6E D;  4C3I G;  4MTK A;  1P16 A;  3TQY A;  5CV4 A;  3HOZ B;  1VDZ A;  1E24 A;  3J81 L;  3HOV B;  5JJK A;  2HCC A;  3IKJ A;  4K5X A;  3SK6 A;  1N36 L;  2A1A A;  1LAC A;  1BXT A;  1JCK B;  4JI2 L;  1A3U A;  3DLL A;  1B3Q A;  3TP5 A;  3KLR A;  2KA7 A;  3SDZ A;  1RCV D;  3MFY A;  5IYB G;  1PH1 A;  5K36 G;  3OSO A;  4WJ3 M;  4DAV A;  5EAY A;  1IZ6 A;  4IUR A;  3TN2 A;  1JJ2 A;  3T1Y Q;  3MEH A;  3R8B A;  1G91 A;  2L12 A;  4XIG S;  4HCE A;  1GUO A;  1PVO A;  1LTI D;  5A2Q L;  2R92 B;  2RA4 A;  1SE2 A;  1S5B D;  1NMG A;  1X3F A;  3NEM A;  2KOL A;  4MTN A;  1WCM G;  1PRT D;  2PZT A;  3A5Z B;  4A3M H;  2XTI A;  1WD0 A;  5EBD A;  1IYU A;  3W1B A;  1O7I A;  2QGQ A;  4ABN A;  1GVP A;  4KY5 A;  4NKL A;  2E2D C;  2K1B A;  2ZTC A;  3BZC A;  4HIK A;  1H9S A;  4LF7 L;  2F0W A;  2KCC A;  1FNW A;  4P2C B;  5M5Y B;  4TSS A;  2LS0 1;  4DV5 Q;  2LXJ A;  4BA1 I;  4KY7 A;  3TRZ A;  3QOJ A;  1F2L A;  4CJ2 C;  1PFS A;  3LNN A;  4LF9 L;  5IP7 H;  1L0X B;  4B9W A;  3PQI A;  1I94 Q;  4HMI A;  2B63 H;  3R2I A;  3TS0 A;  4FF3 A;  4JV5 Q;  4A3G G;  4LFB L;  3K6O A;  1BQQ T;  4B08 A;  4ALP A;  3S14 H;  1B50 A;  5BN3 A;  2NN6 H;  3D6C A;  2PMZ B;  3S2D H;  4FVM A;  3HKZ G;  2NZO A;  1HNZ L;  3J7Y W;  3ERS X;  1FNU A;  1KQS A;  3MAQ A;  2Q2H A;  2B8G A;  3ERQ A;  3W2D A;  1HR0 Q;  4P75 A;  2B2W A;  3IFT A;  4KHP L;  1WI5 A;  1LM0 A;  1SMX A;  4XQJ A;  1QNK A;  2GA4 B;  2RSO A;  3CQZ B;  3VR2 A;  1EOT A;  3BVG A;  3QOL A;  1WTO A;  5M3M H;  4IPC A;  2MPM A;  3HEJ A;  4APV A;  1YHB A;  5AFW A;  4IFD I;  2E5L Q;  5JPM C;  3A54 A;  4A3K H;  4K5W A;  3GDE A;  4IN3 A;  4R9W A;  4B3T L;  1I50 B;  3G48 A;  3TP8 A;  1JMC A;  1J6Q A;  3S15 B;  1TWG H;  4A3F H;  4IOA A;  2PI2 A;  5CMD A;  1XNQ L;  4F88 A;  3Q22 A;  5IWA L;  4LF4 Q;  2FIN B;  4CKC A;  3GTP H;  4Y7N B;  5CV9 A;  4G7O C;  4KY6 A;  2HIX A;  2L4N A;  3K81 C;  2GN5 A;  1B9M A;  3SGI A;  1E0B A;  2RVL A;  1WVL A;  2K04 A;  4JI7 Q;  2WAQ E;  1OO9 B;  1BUV T;  3BYY B;  3K8A A;  1PZI D;  1K8O A;  4IUV A;  1CT1 D;  1CM9 A;  4FDB A;  1XMO Q;  3HOY H;  5D65 A;  5IGE A;  5CV8 A;  1MJE A;  2MO0 A;  1KHI A;  4OHJ A;  4MZ9 A;  4X64 L;  1CZG A;  3M85 A;  1HQM C;  3RLN A;  1QB5 D;  1XXG A;  2N3S A;  3JAM i;  5M9O A;  1I6V C;  1BDO A;  3HOW G;  1EOV A;  2NWG A;  4KKT A;  1WTW A;  1AZQ A;  3MXN A;  4GNX B;  4A3C H;  2YU9 H;  2VB2 X;  4KKU A;  4AQY L;  1HFN A;  3RLF A;  1LTT D;  5FLX L;  1BBX C;  3HOX B;  4IQZ A;  1SND A;  3CF5 A;  3CCM A;  5M5X B;  3K57 A;  4GLV B;  1EY9 A;  1VQI A;  2R93 B;  3KJO A;  2L5T A;  1J9O A;  4OO1 H;  3VDY A;  2K14 A;  1X6O A;  3N6R A;  3T51 B;  3G6J B;  3L7Z C;  1TWC H;  2IT1 A;  1HR0 W;  4LF5 Q;  2HT1 A;  1CQF A;  2PQE A;  3SK8 A;  4L8J A;  4LUO A;  5CV5 A;  4UDU C;  2VUM H;  2RBM A;  4KKS A;  4JYA Q;  5M3F H;  1O78 A;  4LNQ A;  2UXB L;  1A63 A;  2ATW A;  1TXY A;  2NTS A;  1KDA A;  1EYC A;  2B63 G;  3GQB A;  3I7F A;  1SDF A;  5C44 G;  1H9R A;  2L9H A;  1J8I A;  2NZH A;  4CJ0 B;  3DMU A;  5COR A;  2NN6 G;  3U9S A;  1LTA D;  3E0E A;  1GKH A;  2JA6 H;  2JA8 H;  1M4V A;  4JI4 Q;  2VB3 X;  4JG2 A;  4R4Q A;  1XMQ L;  1K83 B;  2QW7 A;  1LTL A;  2ES2 A;  1S5D D;  3JAM E;  1VMP A;  4R4I A;  1RIP A;  4QY7 A;  4A3B H;  3F2D A;  4DV3 L;  3H94 A;  1SYD A;  4PQX A;  4GN5 A;  4Y52 H;  5M3M G;  4DV6 L;  3FKI H;  3D31 A;  5ISR A;  2DN8 A;  2WB1 B;  3KUP A;  3SVM A;  3CPW A;  1G51 A;  3PUY A;  2O5I C;  1MKH A;  5H1S E;  4ULL A;  3PO3 H;  2E75 C;  1T9H A;  3H09 A;  4A3E B;  5JEA G;  1SYE A;  2D62 A;  3NQI A;  2LSS A;  1YIJ A;  3GTJ B;  4BBS B;  5A35 A;  2UU9 Q;  2PPB C;  2CQO A;  3H0G B;  1IXR A;  3S1N B;  1DXM A;  1EY5 A;  2MO1 A;  4OXP A;  4A93 H;  1TWA B;  4KN7 C;  1HQR D;  3U4V A;  2MUY A;  2J0T D;  2X69 A;  5GAH C;  3AYH B;  1N32 Q;  4X65 L;  1CKO A;  2K5Q A;  1U4M A;  2E2I B;  4K6D A;  4HMJ A;  1RKN A;  4RGM A;  3OWF A;  1G6Z A;  3I56 A;  1Y14 B;  2HQE A;  4HIM A;  5C0X G;  1MJC A;  1TS3 A;  1UE5 A;  3BZK A;  3KBG A;  3F2B A;  1N33 Q;  4ZLT F;  5GAD C;  4FP5 D;  1PTO C;  1FD7 D;  1QCB D;  4A3I B;  4NXN Q;  2PO4 A;  3I4N B;  1EIH A;  3I70 A;  2CHB D;  2JEB I;  4C3H B;  1LT6 D;  5AJ3 L;  3M4Y A;  3GTM B;  2RCF A;  5IOC A;  3O13 A;  1HZ9 A;  4K2K A;  4ZKC B;  1K0S A;  2KCN A;  4R8N A;  2ZJP A;  5KYL A;  4DR4 Q;  2EPB A;  4A3C G;  1EY4 A;  2CFM A;  4OWX B;  1EQT A;  3NUC A;  3HGB A;  3K5L A;  3E5S A;  4DNI A;  1EQQ A;  4Q5V A;  1GUT A;  2H4O A;  1VF7 A;  5ELE A;  1VQ9 A;  2UUC L;  4DR5 L;  1B2T A;  5I6W A;  1WYD A;  4DKA C;  5DLQ E;  4NXM L;  2EIF A;  4HCS A;  5IT9 c;  2R3Z A;  2HDM A;  3M7G A;  5C4X B;  2K4K A;  4R8I A;  4FXD A;  5I9O A;  4BBR B;  1JOR A;  4TVA B;  1BOS A;  4LUV A;  1V1P A;  3J81 i;  4CDC C;  5CC4 A;  4OWW B;  5KGU A;  2R61 A;  3ONA B;  2FMM A;  3M4P A;  4RHR A;  1C48 A;  1TWF B;  2Q8T A;  2A68 C;  3K58 A;  3JC6 6;  4A3L G;  1R4Q B;  3DUZ A;  3R3O A;  2NVQ H;  4WRD A;  4QUF A;  3CKI B;  2DJF C;  2PQA A;  4JI0 Q;  3UE0 A;  1PMR A;  3LWE A;  5ELC A;  1Q86 C;  3OWE B;  2WB1 E;  4NPS A;  3H3V C;  1IL2 A;  2DY7 A;  1GHK A;  4H7B A;  3RZD B;  2JA6 G;  1HXY D;  3HOZ G;  2XRS D;  2F0L A;  4DV0 Q;  2PZU A;  1HA6 A;  1IBK Q;  3NEN A;  4K0K L;  4G4K A;  4R4O A;  3PIP 3;  5JAV A;  3ULL A;  3CCR A;  1QOH A;  1QG7 A;  4IFD J;  3AEV A;  4A3B G;  2J4X A;  1KD1 C;  2SEB D;  1TR5 A;  4GS3 A;  3AMU A;  1X3G A;  2B3G A;  3FKI G;  3HOU H;  4IFD H;  2JSO A;  4A3D B;  3JAM c;  2OWO A;  2F0V A;  1QZG A;  3DHQ A;  3DWP A;  2A69 C;  1Y8N B;  3DM1 A;  3DWQ A;  2PYK A;  4JI8 Q;  4LUZ A;  4XYQ A;  4DV5 L;  1YZ6 A;  2R92 G;  2IL8 A;  1BNZ A;  1B44 D;  3QR8 A;  2AUK A;  4GOP C;  1B8A A;  2XWB B;  1E2V A;  1VF5 C;  1X3Q A;  1VQE A;  4TRD A;  5CBA E;  4I7A A;  3GTQ B;  4JCV E;  3OYY A;  4RAU C;  3QIA A;  3J81 E;  4A93 G;  3I55 A;  3J7A 5;  5I9P A;  3KYH C;  2F0T A;  2N49 A;  4C3I H;  4JBK A;  1PTO F;  3K5M A;  4A76 A;  3D4R A;  2UUB Q;  5C0X I;  4P72 A;  2E2H H;  1IKM A;  1HR0 L;  2BOS A;  2F0K A;  2K50 A;  1C8C A;  1MI2 A;  3PUW A;  5I2Y A;  3FDT A;  3UDI A;  2IX1 A;  1EY0 A;  2HDL A;  2JYO A;  1S72 A;  4OON A;  1S5C D;  3KF8 A;  2VQE Q;  3I90 A;  4LK1 C;  5A2Q E;  1Y1W H;  1Z6H A;  5K36 H;  4JI5 Q;  1G8Z D;  2F4V Q;  4YCW A;  5ELF A;  1CKM A;  1SN8 A;  2EVB A;  1BF4 A;  2MHV A;  3K5N A;  1BCP B;  1ENF A;  2FJ2 A;  4KN4 C;  3PF5 A;  1NE3 A;  4DAY A;  4AYB G;  4TKO B;  4Q0F A;  3PSI A;  3NWS A;  4LF6 L;  1AZP A;  4L5R C;  2JA5 B;  3NTI A;  1WCM H;  2NBF A;  5DNF A;  2B2U C;  2EQS A;  4PZ8 A;  1V43 A;  1B70 B;  1MSG A;  2D9U A;  4XQQ A;  1KL9 A;  3IRB A;  4LF4 L;  1N34 Q;  2XVS A;  1KIX A;  1ZYR C;  3P7J A;  4IUP A;  3U50 C;  1G29 1;  4RFB A;  4HJ7 A;  1D5Z C;  1SE4 A;  1YNJ C;  3BDC A;  4HN7 A;  3FPP A;  3S1M H;  4YWM A;  4JI7 L;  1HTP A;  2X6G A;  1MHW C;  4DFA A;  4YHH Q;  4KMU C;  4A3F B;  3T13 A;  1VQP A;  1YJ9 A;  4HID A;  5KNC A;  1XMO L;  2K6A A;  1STB A;  4XXE A;  1HUN A;  2WAC A;  2KEN A;  1KLU D;  4JOI C;  2O5J C;  2KED A;  1Q8I A;  2BE5 D;  4NMZ A;  3OMC A;  2VQF Q;  5E4X A;  2RCN A;  2RDG A;  1AW7 A;  4XDX A;  1K8M A;  1VQM A;  4ZCK A;  4IUU A;  1UEB A;  3V05 A;  3SXH A;  3HOY B;  3KDF A;  1ENC A;  1B3A A;  4IJH A;  3NK9 A;  1SE8 A;  1SFO B;  3S1Q H;  1H9S B;  1LTS D;  1PH4 A;  3Q6S A;  1NR4 A;  2KCT A;  1A2T A;  1B9N A;  2AWN A;  3ERO A;  3NE5 B;  1ESF A;  3X3M A;  2F0P A;  4HJ8 A;  1C0A A;  1A8V A;  1TWH H;  4AH6 A;  4LF5 L;  3RN5 A;  2MNA A;  1MGS A;  1ZXT A;  1D5X C;  3D4W A;  2YU9 B;  1SR3 A;  3UDX A;  4U67 3;  4HTH A;  3W3A A;  4CGY B;  2CW0 D;  2G9D A;  4QB4 A;  4C2M H;  4M1U B;  5HGQ A;  2K7V A;  3K7U C;  3MEF A;  1XX8 A;  2I5H A;  5C3W A;  1Q81 C;  1H9J A;  3RUZ A;  3W5O A;  1SYC A;  5F2D A;  1ET6 A;  3J80 c;  4B3S Q;  1PXU A;  4DUZ Q;  1YHQ A;  4NP5 A;  2K32 A;  5D3I B;  1MD2 D;  4DV1 L;  4WOR A;  2EY6 A;  4QL5 A;  1VQJ A;  4PG3 A;  4DV4 L;  1JWS D;  1PRT C;  2Z6K A;  2E2J B;  3S1R H;  1PH2 A;  2BH2 A;  2HIV A;  5M3F B;  1VQC A;  3CME A;  3J81 c;  1LT4 D;  3KOJ A;  3DEP A;  4GN4 B;  4X3K A;  2L0C A;  2B2Y C;  3ULJ A;  1SNO A;  4DR2 L;  1F9S A;  4LFC L;  4X66 Q;  1EIG A;  2D0P A;  2KQ3 A;  1NBW A;  3HOW H;  4XQN A;  3AFP A;  1Y1W G;  5KNB A;  4RGO S;  2WAQ B;  4BWG B;  4P74 A;  4BY1 B;  1C4Q A;  5KND A;  2IPK D;  5C6A A;  1BR9 A;  4CDF C;  4KJN A;  3PO2 H;  5LMN W;  1ICF B;  3TBI B;  2R7Z G;  1PYW D;  3J7A F;  3V2T A;  1EWC A;  2B29 A;  4CDE C;  2NVX H;  1EYA A;  2O4X A;  5JPN C;  4JI1 L;  2EYM A;  3VA5 A;  4FF1 A;  1A0I A;  3EVQ A;  2WIN B;  1RD9 D;  1V8Q A;  1N32 L;  1BCP D;  2Q2I A;  1FR3 A;  5CGK A;  3PO3 B;  4A3E G;  4LFA Q;  5K5P A;  1K0R A;  3GV6 A;  4C3J H;  1JOQ A;  2AWO A;  5T1G A;  3RZO B;  3D6W A;  1SMY C;  3SR1 A;  1E22 A;  1EQR A;  2IHF A;  3S17 H;  2WFW A;  2F0U A;  5C44 H;  3K0X A;  4IPD A;  4DR6 Q;  1EQV A;  2C5C A;  2RSN A;  2TMP A;  1UE1 A;  2KHI A;  1JE5 A;  3MXN B;  4QCL A;  1JJG A;  4YY3 Q;  2QIL A;  3J7A V;  1CTM A;  1G6P A;  1QJO A;  5FJ8 H;  1ROD A;  2Y0S G;  1U5K A;  2SOB A;  1YIT A;  3AU7 A;  4KHV A;  4EQ5 A;  3TEH B;  2SNS A;  4G7Z C;  4NW2 A;  2BDO A;  2AQ3 B;  3I3C A;  1TY0 A;  1FVI A;  1MIU A;  3A74 A;  1IL8 A;  1D1K A;  3NP8 A;  1QVF A;  2F0E A;  5J3B A;  1Z9F A;  2JA7 B;  4H0L C;  4OEM B;  3CRL C;  2OCE A;  1QE6 A;  1OXT A;  4POF A;  3CCE A;  1QZH A;  3AFQ A;  5JEA J;  3LX0 A;  1H9M A;  3CPF A;  4IAL A;  1Z7T A;  2K5H A;  2ZM6 Q;  1NY4 A;  2C35 B;  3I4M G;  5C3E B;  3BZD B;  2F03 A;  5C5M A;  3PF4 A;  4DXG A;  3D4D A;  5JEA H;  1IBL Q;  1S40 A;  1BKB A;  1PZJ D;  3AB9 A;  4JI6 L;  1WOC A;  3U4Z A;  1SNQ A;  4DR1 Q;  4K8I A;  3CC4 A;  1VQF A;  1K28 A;  5J39 A;  5FO7 B;  2Z8L A;  5C4X G;  1GUW A;  1PRT F;  3J81 j;  3CCQ A;  4X62 Q;  5C0X J;  4JI0 L;  2N88 A;  3A8I E;  4UP8 A;  1LUZ A;  1STA A;  1W6J A;  4BBR G;  5L37 A;  4U68 A;  1VQD A;  3M9B A;  2B2T A;  2IW3 A;  2PZW A;  1XNR Q;  2PI2 E;  3I2Z A;  2K5W A;  5C0X H;  4BXX G;  3M4O H;  1I5F A;  3EIV A;  4DV0 L;  2A74 C;  1CA5 A;  1GUN A;  5CYU A;  1K8A C;  4UPA A;  4DNR B;  2EZV A;  3CCJ A;  1HZA A;  3GTK B;  1TKW B;  4ZRZ A;  1VCI A;  1JOK A;  4XTC S;  1KRT A;  2XN9 C;  3NTK A;  3T53 B;  1CFM A;  5COY A;  2NVQ B;  1Y1V B;  4DGZ A;  1DYQ A;  2OTJ A;  3NTH A;  4L63 B;  4OEL B;  5CR3 A;  1F2Z A;  4PZ6 A;  4LAA A;  5KIX A;  2WP8 J;  5FO9 B;  1STG A;  5IT9 E;  1HNX L;  5EBC A;  3H3V I;  2WKC A;  2PNH A;  4RGT A;  3GTG B;  2XNA C;  2AUJ D;  3S2H B;  1JWU D;  1AN8 A;  2EY2 A;  3PO2 G;  1LAB A;  3K7A H;  4TQU S;  5FLX c;  4H02 A;  5LL6 X;  4OX9 Q;  3V96 A;  3A56 A;  4QUC A;  4A3J G;  1I3Q H;  1LV9 A;  2WKD A;  5EPJ A;  4DR3 Q;  4RCO A;  1LTG D;  1XYI A;  4A3D G;  1J5E L;  1FGU A;  2JEA I;  2R7D A;  3PCO B;  4LJZ C;  3VR6 A;  2LKV A;  1KNE A;  2UUB L;  4CHT B;  1MSH A;  5FKA C;  2A6H C;  1I6H B;  2Z4H A;  3T4A C;  4ZUJ A;  4C3J G;  4BY7 B;  4QQB X;  5D14 A;  5IOD A;  2PCF B;  4A3L H;  4WFN 3;  1PH6 A;  3TSS A;  3NBI A;  3TDQ A;  2TSS A;  2BA1 A;  1IBM Q;  3M3Y B;  2BCO A;  4YWK A;  3ND8 A;  4JI5 L;  4C3I B;  2F4V L;  5T1I A;  3CCU A;  4JI3 Q;  1VQA A;  5FJ8 G;  4MNO A;  3G4S A;  3HOZ H;  4B9X A;  3C3L A;  3HOV H;  3WOF A;  1HPC A;  1EZ8 A;  3KK7 A;  4JBJ A;  1KDB A;  3KF6 A;  2P5Z X;  3R93 A;  4MHE A;  4HIO A;  1ICW A;  1EY8 A;  5JJZ A;  1HH2 P;  2F52 A;  3I4O A;  4KV6 A;  1UE6 A;  1X54 A;  2AQ2 B;  1OXV A;  3CU7 A;  2R92 H;  3GTO B;  2I07 B;  1E2Z A;  2H5X A;  4X3S A;  3ZYY X;  1KXL A;  4L5T A;  3MA2 B;  1HFG A;  1N36 Q;  3CC7 A;  4R1J A;  5LMN L;  4K8J A;  4YHH L;  1Q12 A;  2GVB A;  4JI2 Q;  3LGJ A;  1H95 A;  5CV7 A;  5C4J B;  1W6K A;  1VQO A;  2PQA B;  3CMA A;  2UXC L;  1HTL D;  4FNF A;  1NNX A;  1M90 C;  1CSP A;  1I4Q A;  4L5Q A;  1T5X D;  5EKI A;  3T16 A;  2VQF L;  4IJL A;  4CKB A;  2A8V A;  4IUT A;  1Q82 C;  2Q8I B;  3Q0A A;  4HSV A;  1EY6 A;  1K8G A;  4KJO A;  3T1H Q;  4A3G B;  1EWH A;  1ASZ A;  1XWE A;  1F2Y A;  2F0O A;  2K52 A;  2F3W A;  4DU9 A;  3NQT A;  4GNX C;  3E6Z X;  5BR8 L;  3U9O A;  5IYC H;  3RR5 A;  2BDN A;  3CD6 A;  1U4P A;  2ASB A;  3UE1 A;  3K5O A;  5LMU Q;  2LFN A;  3CQZ H;  5DM7 3;  3FP9 A;  1XPO A;  2K5V A;  5I6Y A;  5M5W B;  4G7H C;  1WTH A;  2NYZ D;  1YNN D;  3F8T A;  1R9T B;  3BVZ A;  4KTA A;  3J80 i;  1K9M C;  1XTD A;  4C1N K;  3OPO A;  3KFU A;  1DOL A;  1I50 H;  4A4I A;  4R4C A;  1N9W A;  4KHZ A;  2F0G A;  2D0O A;  1YVC A;  4GKK L;  3VYS A;  3S15 H;  1L1O B;  2NVY B;  4C56 C;  4ODG A;  3NXW A;  2OEO A;  5J22 A;  1ML0 D;  1VQG A;  3HZX A;  1SAP A;  1BVS A;  3KF8 B;  5IY0 A;  3BS1 A;  1KRS A;  1X55 A;  4KD3 A;  2VL6 A;  5IIF A;  4N9P A;  2B8F A;  4Y7N H;  2NUC A;  1SEB D;  1MBY A;  2HCI A;  1PFB A;  2GVA A;  5FOB B;  3S16 B;  4X66 L;  1CA6 A;  4B3T Q;  1JE4 A;  5FK9 C;  1X32 A;  2AQ1 B;  1YNX A;  4L5S A;  3BDO A;  4DAY B;  3UDG A;  3URY A;  3OIP A;  2ZTE A;  3T1Y L;  3E3X A;  2G5D A;  1EEF D;  1XNQ Q;  4QJF A;  3VYT A;  1I4R A;  1SNM A;  4OL7 A;  3HOV G;  2YYZ A;  3S1R B;  2ZT9 C;  4O1N A;  2K5D A;  1VQ8 A;  1EFI D;  1PDQ A;  4K2L A;  3I4L A;  1SYG A;  1DJR D;  1DOK A;  2UUA Q;  1BO0 A;  3BVM A;  4UHV A;  2HD3 A;  3HOW B;  2QF7 A;  1PTO H;  2LXK A;  2WAQ G;  3PMF A;  4BY1 G; 
#chains in the Genus database with same CATH homology
 1HJP A;  4APV A;  4GOP A;  1E3P A;  2AWN A;  1YHB A;  3GTL H;  2CKZ B;  5FLM H;  4IFD I;  1VQ4 A;  2E5L Q;  2JA5 G;  3STB C;  4HJ8 A;  4DR2 Q;  3HOX H;  1C0A A;  4LFC Q;  1A8V A;  1TWH H;  3D0F A;  4AH6 A;  2HHH L;  4A3K H;  1XPR A;  5IYD G;  3GDE A;  5GQO A;  1JB7 A;  4LF5 L;  3RN5 A;  2MNA A;  1SR3 A;  1YBY A;  3UDX A;  5FLM G;  4B3T L;  1K73 C;  1JMC A;  3G48 A;  1WJJ A;  2VY3 A;  2KCM A;  3PGZ A;  4C2M H;  1J6Q A;  1YI2 A;  1I94 L;  4JV5 L;  4A3K G;  4IOC A;  5HGQ A;  1KAW A;  5M5Y H;  1TWG H;  3HFZ B;  4A3F H;  4IOA A;  3K7U C;  3MEF A;  2IX0 A;  3CP0 A;  1W2B A;  2PI2 A;  1VQN A;  2I5H A;  1Q81 C;  3ER0 A;  3W5O A;  1XNQ L;  1YJN A;  2V1C C;  4A75 A;  4EX5 A;  5IWA L;  3RZO H;  5E7N A;  4OWT B;  3J80 c;  4A3F G;  4B3S Q;  4GNX A;  4DUZ Q;  4AQY Q;  1EYG A;  4LF4 Q;  1FJG Q;  1YHQ A;  1JT8 A;  3GTP H;  3RLO A;  3KDF B;  2QA4 A;  4DV1 L;  4LF8 Q;  1C7Y A;  4JI1 Q;  5ELN A;  2HIX A;  3K81 C;  3M4Q A;  4QL5 A;  1VQJ A;  2GN5 A;  3SGI A;  4PG3 A;  1VQ5 A;  1PH5 A;  1E1T A;  4DV4 L;  2IHE A;  1W3S A;  2Z6K A;  4JI7 Q;  3S1R H;  2WAQ E;  4LF7 Q;  1PH2 A;  2BH2 A;  4GOP B;  2HIV A;  1AE3 A;  1VQC A;  3CME A;  3J81 c;  4B3R L;  1GD7 A;  2K75 A;  3K8A A;  4LWC A;  3KOJ A;  3L0O A;  5IP9 H;  3Q8D A;  4FDB A;  2VZA A;  4GN4 B;  1XMO Q;  4POG A;  5GAE C;  3HOW H;  3HOY H;  3ULJ A;  2E5L L;  4DR2 L;  1MJE A;  2MO0 A;  1KHI A;  2AKW B;  4MZ9 A;  4UP9 A;  2D0P A;  4LFC L;  1YEZ A;  1NBW A;  2YTV A;  4UP7 A;  5IYC G;  4X64 L;  2OQ0 A;  1K83 H;  3FHW A;  3AFP A;  3M85 A;  2ZM6 L;  1Y1W G;  3RLN A;  3TS2 A;  4LFB Q;  3HOY G;  2N3S A;  4GN3 B;  3JAM i;  2JA7 H;  2R7Z H;  4P74 A;  1IBL L;  3HOW G;  4IPH A;  1EOV A;  3H3V H;  1HNZ Q;  3J7Z C;  3PO2 H;  5LMN W;  3PUX A;  2R7Z G;  4DR1 L;  1L1O C;  4GNX B;  1VQ6 A;  4A3C H;  2YU9 H;  5C3E H;  2YTY A;  4B3S L;  4KLK A;  2DUD A;  4DUZ L;  2VS1 A;  2B29 A;  3UDF A;  4AQY L;  1NTG A;  3RLF A;  2NVX H;  4KHP Q;  1X3E A;  1FL0 A;  3CCS A;  4JI1 L;  1XMQ Q;  3CF5 A;  4X62 L;  3CCM A;  1XPU A;  1B7Y B;  4GLV B;  4A3E H;  1VQI A;  1A0I A;  1SLJ A;  2R6G A;  4UY8 C;  3KJO A;  1XJV A;  3GTJ H;  1A62 A;  1N32 L;  3VDY A;  2K14 A;  2I0Q A;  1X6O A;  4JOI A;  2Q2I A;  4DV3 Q;  3S1N H;  4A3E G;  4LFA Q;  2HHH Q;  3L7Z C;  1H95 A;  1TWC H;  2F3I A;  1K0R A;  4C3J H;  2IT1 A;  1HR0 W;  4LF5 Q;  2HT1 A;  4OO1 G;  1VQL A;  2AWO A;  2BH8 A;  4LUO A;  1NJI C;  1E22 A;  2VUM H;  1EQR A;  2IHF A;  2JJQ A;  2JA9 A;  3S17 H;  4JYA Q;  5M3F H;  2WFW A;  1L0W A;  5C44 H;  2E2I H;  3K0X A;  4IPD A;  4LNQ A;  4DR6 Q;  1EIF A;  3A5U A;  2UXB L;  1A63 A;  4JI6 Q;  2ATW A;  1TXY A;  1OXS C;  1UE1 A;  2KHI A;  2QEX A;  1JE5 A;  3MXN B;  2VUM G;  1HNW L;  1JJG A;  2B63 G;  3GTK H;  4DV2 L;  4YY3 Q;  5M3F G;  1Q1B A;  4HJA A;  3I7F A;  1Q7Y C;  5C44 G;  5IWA Q;  4HJ5 A;  3B6Y A;  1G6P A;  5FJ8 H;  2Y0S G;  4RG1 A;  2NN6 I;  1U5K A;  1VQB A;  2NZH A;  1YIT A;  2NN6 G;  1VQH A;  1GO3 E;  4A3I H;  1Y1V H;  3E0E A;  4EQ5 A;  3EBE A;  1GKH A;  3TEH B;  1JJC B;  4QIW E;  3I4N H;  1L2F A;  2JA6 H;  2JA8 H;  1FVI A;  4JI4 Q;  1MIU A;  3A74 A;  4JG2 A;  4ME3 A;  4R4Q A;  1XMQ L;  1EIY B;  1QVF A;  1LTL A;  2ES2 A;  5J3B A;  1QVC A;  1GM5 A;  3GTM H;  4R4I A;  4B3R Q;  1RIP A;  1Z9F A;  4QGU A;  4DR3 L;  2JA8 G;  3GTG H;  1U0L A;  3NEL A;  4QY7 A;  3S2H H;  4JBM A;  3I4M H;  4A3B H;  2OCE A;  3PUV A;  3F2D A;  1BBW A;  4DV3 L;  3OW2 A;  1OXT A;  4POF A;  2Q2U A;  4GN5 A;  3CCE A;  1QZH A;  4LFA L;  3AFQ A;  5JEA J;  3NBH B;  5M3M G;  4X64 Q;  4DUY L;  4DV6 L;  4Y52 H;  2YTX A;  1HZB A;  3CPF A;  3E9H A;  2K5H A;  3FKI H;  5M5X H;  2ZM6 Q;  1NY4 A;  3D31 A;  2C35 B;  3I4M G;  2R93 H;  3PF4 A;  2JE6 I;  3DM3 A;  1LYL A;  4GLA C;  3HOX G;  3CPW A;  1G51 A;  1IBL Q;  4JYA L;  1D8L A;  1RL2 A;  3GD7 A;  3PUY A;  2FXQ A;  3BU2 A;  1MKH A;  5H1S E;  1S40 A;  4DR6 L;  3PO3 H;  1BKB A;  4JI6 L;  2R93 G;  2JQO A;  1OXU A;  1WOC A;  3HKZ E;  2EXD A;  1T9H A;  3U4Z A;  5C4X H;  2ZJR A;  1PH7 A;  1HNX Q;  5JEA G;  4DR1 Q;  3CC4 A;  1VQF A;  2D62 A;  4YY3 L;  2LSS A;  2Y0S E;  1YIJ A;  4PMW A;  3PO3 G;  2K5N A;  2AHO B;  2UU9 Q;  2CQO A;  1I6H H;  1IXR A;  4BBR H;  2ZJQ A;  5C4X G;  1CUK A;  3J81 j;  2MO1 A;  4BY7 H;  4OXP A;  4KI0 A;  2RHS B;  4X62 Q;  1SRO A;  1AE2 A;  5C0X J;  3CCQ A;  4JI0 L;  4A93 H;  4BXX H;  1SRU A;  3U4V A;  4AIM A;  4UP8 A;  2KBN A;  3RN2 A;  1P8L A;  1LUZ A;  4JI4 L;  4JBW A;  1TWF H;  4BBR G;  5GAH C;  4P71 A;  4BY7 G;  1VQD A;  3AYH B;  3M9B A;  1N32 Q;  2UUC Q;  4X65 L;  1N8R C;  3M3Y H;  1XNR Q;  1CKO A;  4DR7 L;  2PI2 E;  1J5E Q;  3I2Z A;  4O0A A;  4BXX G;  3M4O H;  2N78 A;  1I5F A;  1Z47 A;  3EIV A;  1X56 A;  4P73 A;  2RF4 A;  4DV0 L;  1QVG A;  1K8A C;  2N8N A;  4UPA A;  3I56 A;  1Y14 B;  2MFI A;  3CCJ A;  3PV0 A;  1HZA A;  4HIM A;  1PYB A;  1EFW A;  5C0X G;  1OTC A;  1VCI A;  1MJC A;  1UE5 A;  3BZK A;  4XTC S;  2ALY B;  1KRT A;  3F2B A;  5IP9 G;  1N33 Q;  2A19 A;  5GAD C;  4NXN Q;  2OTJ A;  1L1O A;  2UXB Q;  3RZD H;  4J15 A;  1PV4 A;  4PZ6 A;  1HZC A;  1HNW Q;  2CWA A;  3STB D;  4DV2 Q;  2JEB I;  2VW9 A;  2I5L X;  5AJ3 L;  2WP8 J;  1CKN A;  5IYB H;  4YCU A;  4DK6 C;  1K3R A;  1M1K C;  1HNX L;  1QUQ A;  2JA7 G;  3H3V I;  1HZ9 A;  2PNH A;  1PH9 A;  2Z6K C;  4B3M L;  2UU9 L;  2ZJP A;  1VQ7 A;  4DR4 Q;  2UXD L;  3PO2 G;  4A3J H;  4BA2 I;  2IY5 B;  3K7A H;  4TQU S;  5FLX c;  4A3C G;  4H02 A;  3GTO H;  5C3E G;  4OX9 Q;  4A3D H;  2CFM A;  4OWX B;  4YWL A;  2WB1 G;  3RNU A;  3HKS A;  4HJ9 A;  4DNI A;  1EQQ A;  4RMF A;  1I3Q H;  3W1G A;  4A3J G;  4DR3 Q;  1VQ9 A;  4BBS H;  5C4J H;  4DR5 L;  2UUC L;  1XNR L;  4A3D G;  1J5E L;  1WYD A;  1FGU A;  3H0G H;  5DLQ E;  4DKA C;  4K0K Q;  2OTL A;  4NXM L;  3KJP A;  2EIF A;  5IT9 c;  4DV6 Q;  4DUY Q;  2JEA I;  2R7D A;  3PCO B;  4OO1 I;  1TWA H;  2UUB L;  2K4K A;  4BBS G;  1E1O A;  3H0G G;  1X9N A;  3GTQ H;  1VS0 A;  4DV7 L;  1N33 L;  3T1H L;  5HY6 A;  4NXN L;  4QQB X;  4TVA B;  4LUV A;  3J81 i;  3CAM A;  4OWW B;  4A3L H;  3M4P A;  3K80 C;  1CKN B;  1PH6 A;  1CSQ A;  1IYJ B;  5LMN Q;  1QUQ B;  2VNU D;  2BA1 A;  1X65 A;  2AMC B;  3OTO L;  3U58 A;  1IBM Q;  1Q1E A;  3JC6 6;  1UE7 A;  3H15 A;  4A3L G;  1PH3 A;  4A3G H;  4YWK A;  2UXC Q;  2MQH A;  5LMU L;  2NVQ H;  4JI5 L;  1YJW A;  2F4V L;  4DR4 L;  3KLW A;  2PQA A;  3CCV A;  4JI0 Q;  3UE0 A;  3CCU A;  4GKJ L;  4JI3 Q;  1VQA A;  5FJ8 G;  4MNO A;  3G4S A;  3HOZ H;  4IPG A;  2HQL A;  3HOV H;  1Q86 C;  4OX9 L;  4C3H H;  2WB1 E;  4A3I G;  1Y1V G;  4NPS A;  4GLX A;  3A0J A;  1IL2 A;  4X65 Q;  1D7Q A;  2Q2T A;  3I4N G;  4DR7 Q;  2XGT A;  3CW2 C;  2JA6 G;  3HOZ G;  4DV0 Q;  4JBJ A;  1PH8 A;  1IBK Q;  3NEN A;  4K0K L;  4R4O A;  4DK3 C;  3ULL A;  5M5W H;  3CCR A;  3CC2 A;  2JK8 A;  3KF6 A;  4IFD J;  3AEV A;  4HIO A;  4A3B G;  1R9T H;  1KD1 C;  3PIO A;  1VQK A;  1HH2 P;  4GS3 A;  2F52 A;  3I4O A;  1X3G A;  1UE6 A;  2B3G A;  1X54 A;  2JA5 H;  1OXV A;  3FKI G;  3HOU H;  2R7F A;  2R92 H;  5BR8 Q;  3JAM c;  2OWO A;  2H5X A;  1KXL A;  5AJ3 Q;  4L5T A;  5IYD H;  1N36 Q;  3CC7 A;  1QZG A;  4R1J A;  5LMN L;  4JI8 Q;  3WWV A;  4LUZ A;  1Q12 A;  2GVB A;  4PZ7 A;  3LGJ A;  4JI2 Q;  4YHH L;  4DV5 L;  1YZ6 A;  1EWI A;  3AQQ A;  1IBM L;  4B3M Q;  2R92 G;  1WFQ A;  4IFD G;  2UXD Q;  2NVY H;  2I5M X;  1VQO A;  2PQA B;  5GAG C;  3CMA A;  2UXC L;  5JJL A;  2NVT H;  4GOP C;  1B8A A;  3PUZ A;  1M90 C;  1VQE A;  4JI3 L;  1CSP A;  4X66 Q;  4L5Q A;  4JCV E;  2ZTD A;  3OYY A;  2ID0 A;  4DR5 Q;  4LF6 Q;  4A93 G;  3I55 A;  2VQF L;  4LW1 A;  3J7A 5;  5GRO A;  4IJL A;  4NXM Q;  3KYH C;  4JC0 A;  2A8V A;  3S16 H;  2N49 A;  1S3O A;  1YHA A;  4C3I H;  1IBK L;  1Q82 C;  4JBK A;  3ICE A;  4A76 A;  1AH9 A;  3F2C A;  2UUB Q;  3KF6 B;  4P72 A;  5C0X I;  1KC8 C;  2E2H H;  1E7Z A;  1HR0 L;  3BJU A;  4GKK Q;  1UWV A;  4DV7 Q;  1K8G A;  1C9O A;  3T1H Q;  2K50 A;  1ASY A;  2CCZ A;  1ASZ A;  2UUA L;  3PUW A;  1P16 A;  3TQY A;  3CXC A;  5ELO A;  3UDI A;  2K52 A;  2IX1 A;  4GNX C;  1S72 A;  1E24 A;  4OON A;  5BR8 L;  5JJK A;  1PYS B;  5IYC H;  3OTO Q;  2VQE Q;  1N36 L;  3RR5 A;  2A1A A;  1Y1W H;  3PIP A;  3CD6 A;  4NB3 A;  4JI8 L;  3EN2 A;  2ASB A;  3UE1 A;  5LMU Q;  4JI2 L;  2KHJ A;  4X6A H;  3DLL A;  4JI5 Q;  3CQZ H;  2F4V Q;  3FP9 A;  1PH1 A;  4GKJ Q;  3GO5 A;  5IYB G;  4YCW A;  1XPO A;  1CKM A;  2K5V A;  1SFO H;  3CCL A;  4WJ3 M;  5K36 G;  1SN8 A;  4YCV A;  5EAY A;  1IZ6 A;  3PF5 A;  2YV5 A;  1JJ2 A;  1NE3 A;  3F8T A;  3T1Y Q;  4AYB G;  1Q8K A;  2E8G A;  3PSI A;  4XIG S;  2OQK A;  4LF6 L;  1PVO A;  4L5R C;  3J80 i;  1WCM H;  1EUJ A;  1K9M C;  2EQS A;  1XTD A;  4PZ8 A;  1V43 A;  4DPG A;  1B70 B;  3KFU A;  1KL9 A;  3IRB A;  4LF4 L;  4IO9 A;  1I50 H;  4A4I A;  1N34 Q;  1NMG A;  1N9W A;  4KHZ A;  4R4C A;  1X3F A;  3NEM A;  1KIX A;  1FJG L;  2D0O A;  1YVC A;  1WCM G;  3A5Z B;  4MTN A;  3ULP A;  4A3M H;  2XTI A;  4LF8 L;  1L1O B;  3S15 H;  4GKK L;  3U50 C;  3W1B A;  1O7I A;  1G29 1;  2QGQ A;  4HJ7 A;  5JJI A;  1VQG A;  4O2D A;  1GVP A;  3S1M H;  4YWM A;  3L2P A;  3G71 A;  1BVS A;  2ZTC A;  4WJ4 A;  4A3M G;  3BZC A;  4HIK A;  4JI7 L;  3KF8 B;  5IY0 A;  4LF7 L;  1KRS A;  1X55 A;  2CWP A;  4R4T A;  2PMZ E;  2VL6 A;  1NMF A;  4YHH Q;  2LXJ A;  4DV5 Q;  1BBU A;  4BA1 I;  2VQE L;  1VQP A;  1YJ9 A;  3S24 A;  4Y7N H;  4HID A;  3TRZ A;  1XMO L;  3G6E A;  1PFS A;  3HOU G;  4LF9 Q;  2GVA A;  1V9P A;  4X66 L;  5IE8 A;  4LF9 L;  5IP7 H;  4B3T Q;  2KEN A;  2E2J H;  1I94 Q;  1YNX A;  4JOI C;  4L5S A;  2B63 H;  3TS0 A;  4JV5 Q;  4LFB L;  4DAY B;  4A3G G;  3UDG A;  4ALP A;  3S14 H;  2Z0S A;  4AYB E;  5IP7 G;  2ZTE A;  4DAM A;  1V1Q A;  3T1Y L;  3S2D H;  2VQF Q;  3F1Z A;  3HKZ G;  2NZO A;  1XNQ Q;  4QJF A;  2RCN A;  1HNZ L;  3M7N A;  3HOV G;  3ERS X;  2YYZ A;  2BA0 A;  1KQS A;  1DGS A;  1VQ8 A;  1VQM A;  2Q2H A;  2DGY A;  3ZJY C;  2RHQ B;  1HR0 Q;  3E9I A;  4P75 A;  4DV1 Q;  1UEB A;  1Q46 A;  1N34 L;  3TRE A;  4KHP L;  1WI5 A;  1LM0 A;  1SMX A;  3KDF A;  2UUA Q;  4BY1 H;  4IJH A;  4DV4 Q;  1SE8 A;  2L15 A;  2LXK A;  3S1Q H;  1PA6 A;  1PH4 A;  1PHJ A;  2WAQ G;  1OXX K;  5M3M H;  4IPC A;  2KCT A;  4BY1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...