1WOCA

Crystal structure of prib
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
99
structure length
99
Chain Sequence
TNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a biologically functional form of PriB from Escherichia coli reveals a potential single-stranded DNA-binding site
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords Primosomal replication protein n
total genus 12
structure length 99
sequence length 99
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1wocA00
2JA7H 4C3IH 4JI5Q 1H95A 1LTLA 3HKSA 4P71A 4X66L 4OO1G 4DV4Q 3A74A 3PIOA 4DV0Q 5IE8A 1MIUA 1YVCA 2R93G 4AIMA 1PH2A 2NVQH 1EOVA 4B3TL 1E22A 1QVCA 2ID0A 1JJCB 3AQQA 4DV2L 4JI6L 3CC4A 4LFCQ 2UU9L 4GN5A 4JYAL 4LF7L 2BA1A 1KRSA 1SN8A 2D62A 1HNZL 1BKBA 2LXKA 3BZCA 1FVIA 4GKKQ 1P8LA 3W5OA 1HH2P 2I5MX 3UE0A 4X65L 5C44G 3UDXA 4YHHL 1X9NA 4DR4Q 2UXCL 2K5NA 4DV4L 1S40A 1YHQA 4X66Q 3KF8B 4YCWA 1PH6A 4LW1A 3PUZA 2E8GA 1X56A 4A3LH 2R6GA 4DV1Q 4JI0Q 1JMCA 1Z47A 4A75A 3CCMA 3S17H 3K8AA 1NMFA 4DAYB 3FKIH 4GLXA 1NTGA 2Z6KA 1J5EL 3CC2A 1UWVA 3HOUG 5M5YH 4DUZQ 1IBLL 4A3EH 2C35B 3I4OA 4X62L 1XMQQ 2UXDQ 3S1NH 2A19A 1EFWA 2YTVA 2K5HA 3GTQH 1Q8KA 2E2IH 2MFIA 2N49A 1SMXA 1PH5A 4A3CG 1ASZA 3W1GA 4C3HH 2VUMG 4JI7Q 1XNRL 2I5HA 4LFAL 5M3FH 2R7ZH 3KF6A 4DR7L 1IXRA 3ULPA 4DV7L 2N8NA 2GVBA 4A3DG 1D7QA 1M90C 4Y7NH 3K7UC 1VQMA 2D0PA 5ELNA 1OXXK 2AMCB 1Q46A 3OTOQ 3HOWH 2DUDA 2Q2IA 1X65A 1MJCA 4KHZA 2NN6G 3M7NA 3BU2A 3CW2C 4NXNL 3TEHB 1JJ2A 1KHIA 3D31A 1VQCA 4TVAB 2OQKA 4DKAC 3RN5A 4LF5Q 2B29A 1B70B 3NENA 1CKOA 2KENA 3S24A 3ZJYC 3PUWA 4AQYL 4LF4L 2NZHA 4HIMA 2L15A 3A5ZB 4HJ9A 3H3VH 4JBJA 2BH8A 3PF5A 1YZ6A 5FJ8G 4JV5L 1Q7YC 1J6QA 1X54A 2KCMA 1KIXA 1EYGA 1VQ5A 3L7ZC 5DLQE 2F4VQ 3I4MH 4L5TA 1L1OB 3GD7A 2NVXH 4JG2A 2BH2A 3HOYG 1OXSC 5M5XH 4IPDA 5C0XG 1I5FA 2VQEQ 2E2HH 5LMNL 5K36G 5JJKA 4A3JH 3OYYA 1BBUA 1VQKA 2JEAI 4H02A 1VQJA 2MO0A 2KCTA 1X55A 1CSPA 1G291 3PGZA 4O0AA 4R1JA 5LMUL 3M4OH 4GKKL 3CAMA 5C4XG 1HNZQ 1K8AC 4LF9L 5C4JH 3I4NG 4R4QA 5IYDG 3F2DA 1G6PA 1AE2A 4IO9A 1V9PA 4JOIC 3U4ZA 3TS2A 4A3BG 4P72A 1VQFA 2AKWB 1LYLA 5FJ8H 5LMNQ 1XPOA 3S14H 4GN4B 1E1TA 1WCMG 4DR6L 4A76A 2GN5A 2ZTDA 1N34Q 2JK8A 3KYHC 1HZ9A 3NBHB 1K8GA 4UY8C 2VY3A 2JE6I 1N36L 3E9HA 3NELA 4LWCA 1K9MC 2EQSA 1X6OA 1XTDA 3PV0A 1KXLA 2Z6KC 2ZJPA 2CWAA 4EX5A 1VQ4A 3GO5A 4DK6C 4IOAA 4BBRH 3M85A 4LF6Q 3BJUA 5M3FG 4DR2L 4X62Q 1XMQL 4YWKA 4A3KH 4DPGA 1IBKQ 1JE5A 1FGUA 2K4KA 4KHPQ 1YHAA 3CC7A 1WFQA 4BBSH 2IHEA 2Q2HA 1N34L 1Y1VG 1TXYA 1HZCA 2NN6I 4JBWA 4GOPA 4IPGA 3KDFA 5HY6A 2RHQB 4GNXA 1YJWA 1OXUA 3AFPA 4DR4L 1GM5A 1VQEA 3CF5A 4OX9L 3J81i 3A5UA 1PV4A 3OW2A 5GADC 1K73C 4LF6L 2Q2TA 5IP9G 4LF9Q 3CQZH 5GAGC 4WJ3M 5ELOA 3F8TA 4KLKA 2YTXA 4JI1L 1VQGA 2UUAQ 1A0IA 4DR6Q 3CCEA 2WP8J 1P16A 2ZTCA 4KHPL 2JJQA 4NXMQ 1GO3E 4JI4Q 4AQYQ 1X3FA 1KQSA 2UU9Q 5JEAG 3AEVA 2DGYA 4K0KL 2GVAA 2CKZB 2V1CC 4XTCS 2HHHQ 2IX1A 4C3JH 3S1QH 1TWHH 2ALYB 4X64Q 3K81C 4DV6L 4A3JG 3HOUH 1VQOA 4OWWB 4POFA 3PO3H 4OWTB 4Y52H 4P74A 1Y1WH 1S72A 3K7AH 3U58A 2BA0A 1VQDA 4JI8Q 1XNQQ 3LGJA 3HOXH 4DUYQ 2IX0A 3E9IA 2OQ0A 1A8VA 1SRUA 1HZBA 1LM0A 4O2DA 4TQUS 3J80i 1EWIA 4HIDA 2UXBQ 1TWGH 3RLOA 1TWCH 3HOVG 5LMNW 3KDFB 4QIWE 5EAYA 1CKMA 2N3SA 4DV5L 2K50A 1QZHA 3ERSX 4GOPB 1FJGQ 5JJLA 2Y0SE 4LF5L 3UE1A 2UUBL 5JJIA 1PVOA 3H0GH 1YIJA 1RIPA 2JA6H 3HOZG 1AE3A 4DR5Q 3GTOH 3S16H 2K14A 4GS3A 4JOIA 4GOPC 5IP7G 5IYCH 1UE6A 1VQPA 3HOWG 3I4NH 3S2DH 4BA2I 1VQIA 1VQBA 2JA5H 4LFBL 3M9BA 3W1BA 4POGA 4JI2Q 5HGQA 5AJ3L 2E5LL 4C2MH 4A4IA 2IHFA 1G51A 3UDGA 1PFSA 3RLNA 2N78A 2XTIA 2JA8G 1YI2A 1NJIC 3PO2H 3PIPA 1Y1VH 4GN3B 4DR1L 2QGQA 1FJGL 1QVFA 1DGSA 4K0KQ 4DV5Q 1VQ7A 1EUJA 3HKZG 3CCRA 3GTLH 4UPAA 4R4TA 3J7ZC 4RMFA 3FKIG 4NXNQ 1Z9FA 4MNOA 3T1YQ 3RZOH 1Q1BA 3CPWA 4QQBX 2I0QA 2HT1A 4A3FG 3S1MH 3L0OA 1Q86C 2HIXA 5LMUQ 1XMOQ 4DV1L 5BR8L 3WWVA 5IYBH 5AJ3Q 2E5LQ 4JI2L 2NVYH 1A62A 4MZ9A 3H0GG 1KD1C 1EIYB 4A3LG 1W3SA 3U50C 3S2HH 1VCIA 3KFUA 1L1OC 1SLJA 1HNWQ 3G71A 3ICEA 4MTNA 3GDEA 5IYDH 2UXBL 2ES2A 2RCNA 4A3EG 3NEMA 1V43A 5IT9c 4HIOA 2K5VA 4JBKA 1VQ9A 4NXML 4A93G 1PYSB 4R4IA 4DR5L 2Z0SA 5GAEC 1EQRA 1HR0L 4IFDI 1ASYA 4L5SA 2PQAB 4JI1Q 1PH1A 4IOCA 1YJ9A 1L1OA 4HJ7A 3FP9A 3TS0A 1N36Q 1V1QA 4GLAC 4LUVA 3UDIA 3MXNB 1GKHA 4BA1I 3S1RH 2AWOA 1IBML 2Y0SG 2R7ZG 3J81j 1I50H 1PH9A 1U0LA 2IY5B 1UE1A 3CD6A 3OTOL 2AWNA 2PQAA 1NBWA 1UEBA 1E24A 1IZ6A 2JA8H 4YWLA 1CKNA 4JC0A 2HIVA 1OXTA 1N33Q 4JI8L 2FXQA 1XNQL 2B63H 3ULLA 1R9TH 3F1ZA 2VZAA 2WFWA 1HR0Q 1YEZA 2JA9A 1FL0A 4A3BH 1N32L 3I56A 3EIVA 2CWPA 2XGTA 1WOCA 1BBWA 2WB1E 4OONA 1E3PA 3CP0A 4QJFA 4ALPA 2YV5A 3T1HL 4A3IH 3RLFA 3J81c 4UP7A 2UUCQ 4B3TQ 1CSQA 2UUBQ 3HKZE 5FLXc 1IBMQ 2EIFA 1VQ6A 2VUMH 4LF7Q 1B8AA 1YJNA 4GKJL 3PUXA 1KRTA 3CCUA 3GTKH 4X6AH 4PZ8A 2MO1A 2PI2E 3KJOA 2JA5G 3FHWA 2UUAL 3KLWA 1HNWL 2PI2A 1NY4A 2R93H 3B6YA 3EN2A 4LFBQ 2RHSB 3JAMi 4DR3Q 1E7ZA 4A3KG 5IY0A 3UDFA 4DV3Q 1KL9A 4YCUA 1OXVA 1N9WA 1L0WA 4JI3L 4EQ5A 2R92G 1PH8A 4QL5A 1MJEA 3STBC 4PZ6A 4A93H 2CQOA 3ULJA 1T9HA 4WJ4A 4DNIA 3I4MG 4UP9A 3EBEA 3G4SA 3CCVA 1PH3A 4L5QA 2JA7G 4DR1Q 3PUYA 2Q2UA 3CCQA 3CCLA 2LXJA 1JB7A 1KC8C 3VDYA 4LNQA 1IYJB 2VQFQ 2WAQE 3IRBA 4L5RC 2UXDL 2RF4A 3M4PA 5C3EG 3H15A 4IJHA 4QGUA 4OWXB 4A3MG 1TWFH 3DM3A 1HZAA 1I3QH 1VQ8A 3HOYH 4NB3A 3HOXG 3KJPA 2ZJQA 1MKHA 4DV3L 2OTJA 1N32Q 2F4VL 4JI3Q 1NMGA 1YITA 1Y1WG 5GQOA 4APVA 2K75A 5C3EH 1XNRQ 1A63A 1CUKA 4BY7H 4DR7Q 1Y14B 4B3SQ 2VL6A 5IWAL 1E1OA 1QUQA 1I94Q 2E2JH 4B3RQ 3L2PA 4GKJQ 2D0OA 1O7IA 4OXPA 5J3BA 4X65Q 4YHHQ 4A3CH 1IBKL 4XIGS 3F2CA 3I55A 2QA4A 5E7NA 4QY7A 5FLMH 3DLLA 1X3GA 2I5LX 4LF8Q 1LUZA 4KI0A 2JA6G 3HOZH 2MNAA 1JT8A 2A1AA 1GVPA 2AHOB 4PG3A 2F52A 4A3MH 4R4CA 1AH9A 1C0AA 3ER0A 4DV0L 4PMWA 2HQLA 4YWMA 5IWAQ 3KOJA 1N33L 4FDBA 4B3SL 4OX9Q 2CFMA 2ZM6Q 4B3RL 3G6EA 4JCVE 2R7FA 5GAHC 3G48A 3GTJH 1I94L 1C9OA 4IPHA 4YY3Q 4HIKA 2ZJRA 1IL2A 4A3GG 1XMOL 4R4OA 1VQHA 1XPRA 1U5KA 1M1KC 4BBRG 3JC66 4HJ8A 2UXCQ 4JI4L 2YTYA 3JAMc 2EXDA 3RR5A 2YYZA 4DK3C 2OTLA 1CKNB 4GNXB 2A8VA 2YU9H 1B7YB 3CPFA 1EQQA 2LSSA 5JEAJ 1Q12A 3BZKA 1K3RA 4B3MQ 4JI0L 4OO1I 4BXXH 1PHJA 4YY3L 4GNXC 4HJ5A 4GLVB 1TWAH 1JJGA 2R7DA 1SROA 2ATWA 1L2FA 2VNUD 4BBSG 4HJAA 1Q1EA 1WCMH 5BR8Q 1HR0W 1PH7A 1YBYA 4A3FH 4DR3L 3U4VA 1VQNA 1HJPA 2NVTH 3TQYA 2VS1A 4DAMA 5M3MG 2ZTEA 3M4QA 2MQHA 3D0FA 4RG1A 3K0XA 2VW9A 2PMZE 3CMAA 4DV2Q 4JI7L 4JV5Q 2VQFL 3PF4A 3J80c 1K83H 2B63G 1SE8A 3PCOB 3KF6B 4BXXG 2OCEA 2KHJA 1D8LA 5H1SE 3I2ZA 4DR2Q 4IJLA 4BY7G 2VQEL 2KHIA 3PSIA 1BVSA 4BY1H 1I6HH 1C7YA 3RNUA 5IP7H 5IYCG 3GTGH 3H3VI 3TRZA 1Q82C 3S15H 2JEBI 5C44H 4A3DH 4AH6A 4IFDJ 1WJJA 2JQOA 3I7FA 1HNXL 4BY1G 1WI5A 2ASBA 3PO3G 1VQLA 5FLMG 4AYBG 1QZGA 3GTPH 1QUQB 3HOVH 1VQAA 4B3ML 3J7A5 1EIFA 3T1YL 1PA6A 1YHBA 2WB1G 2B3GA 4P75A 2OWOA 2QEXA 4A3GH 4DUZL 5M3MH 1IBLQ 2H5XA 4YCVA 1SFOH 3RZDH 3GTMH 3F2BA 4IPCA 1PYBA 4LUZA 4LFCL 3T1HQ 4LF8L 2UUCL 1XPUA 5C4XH 3AYHB 1VS0A 2ZM6L 4A3IG 1Q81C 1K0RA 2K52A 2PNHA 4ME3A 5C0XJ 2NZOA 1W2BA 1N8RC 1HNXQ 2IT1A 1UE5A 3E0EA 3HFZB 2R92H 1OTCA 4LFAQ 3SGIA 1SR3A 4J15A 1UE7A 3K80C 5M5WH 4JBMA 4X64L 4NPSA 4DV7Q 4AYBE 3STBD 3CCJA 2KBNA 3A0JA 4DV6Q 3PO2G 3Q8DA 5GROA 4UP8A 4JI5L 3CCSA 1WYDA 4LF4Q 1XJVA 1QVGA 4LUOA 3CMEA 5IYBG 3CXCA 4DUYL 4PZ7A 1RL2A 1PH4A 2HHHL 2F3IA 1X3EA 4JI6Q 1J5EQ 4JYAQ 1S3OA 5C0XI 1GD7A 2CCZA 3M3YH 3TREA 1KAWA 3PUVA 2WAQG 4P73A 1YNXA 5IP9H 1NE3A 4IFDG 3AFQA 3RN2A 3MEFA
chains in the Genus database with same CATH superfamily
3FPUB 4JI5Q 4BBRB 2FHTA 1JE4A 1HXYD 3A74A 1PH2A 1AP0A 1EOVA 4DV2L 3TP5A 1JR0D 3DWPA 4JI6L 1JWUD 2BA1A 1KRSA 1SN8A 2PO4A 2D62A 3U9SA 4WFN3 1FVIA 2AQ2B 1ESFA 5ELEA 3W5OA 1A6XA 4X65L 3OIPA 1SNQA 2KA7A 1BUVT 4YCWA 4LW1A 1U4RA 1Z47A 3CCMA 2EYFA 5NUCA 4DAYB 3FKIH 3MFGA 4GLXA 1EIHA 1UWVA 3WDNA 5M5YH 1B9MA 3I4OA 2YU9B 2UXDQ 2A19A 1EFWA 2YTVA 2K5HA 2R92B 1V8QA 2MFIA 2HD3A 2DJGC 3SK6A 1EYCA 2VUMG 2NVTB 1B3AA 2F0TA 3H0GB 4LFAL 1PFNA 3K5NA 4DR7L 3ULPA 1PTOH 4EQNA 2CW0D 1D7QA 2BOSA 5CV4A 4Y7NH 1DOLA 3K7UC 1JOKA 1A2TA 1X3QA 2AUJD 4NXNL 1KHIA 1VQCA 3RN5A 2B29A 3NENA 1FGBD 4DNTB 1STGA 2L15A 4HJ9A 3H3VH 1HA6A 1H9JA 1FR3A 2BH8A 1WCMB 1YZ6A 5FJ8G 4JV5L 1JOOA 1LACA 3FRPB 2NVXH 5CMDA 2C5CA 3JAML 2EYPA 1DOKA 1WTRA 2E2HH 1OO9B 1QCBD 5K36G 4A3JH 2ZXOA 3HGBA 3OYYA 2QDBA 1EL0A 1VQJA 2KCTA 1XX8A 3M4OH 4R1JA 5CV7A 1B4OA 1A2UA 1HNZQ 4R4QA 4R9WA 3KLSA 4XXEA 1RDPD 4IO9A 1V9PA 1O78A 1LYLA 1B3QA 1KLUD 3NWSA 5LMNQ 1HRJA 3K0YA 1EU4A 2TMPA 1E1TA 4RCNA 4DR6L 4A76A 4CJ0B 2GN5A 1WTHA 3OMGA 4GZYC 3HOWB 4NMZA 1B9NA 3EROA 4LAAA 1S5FD 1DXMA 3NELA 4DAYA 4RA8A 1XTDA 5FO8B 3MC0B 4LF6Q 4IN3A 5IGGA 4X62Q 1XMQL 2B2YA 1BXTA 4WRDA 1STNA 4KHPQ 1YHAA 2Q2HA 1TXYA 4JBWA 4J8QA 4GNXA 4EQOA 1OXUA 4DR4L 5E3FA 1GM5A 3J81i 1R9TB 1QNUA 3OW2A 2DNEA 2Q2TA 1EY6A 1STEA 4LF9Q 3CQZH 4WJ3M 1IYUA 4KLKA 1L0XB 1YNJC 3CCEA 2N55A 4JI4Q 1KQSA 2UU9Q 1TU2B 2DGYA 4K0KL 2GVAA 2F0FA 2A73B 4C3JH 1TWHH 3T16A 2B2WA 2MGSA 5EKLA 2RSOA 1S5CD 4OWTB 5C5LA 4P74A 1RKNA 1WTVA 5E1FA 2IX0A 2OQ0A 5D65A 2UXBQ 4O2DA 5KEEA 1TWCH 2TSSA 4QMGA 4KJOA 1G6ZA 1CKMA 1MSHA 2B2YC 3G7LA 3O13A 4IALA 1SDFA 2UUBL 1FJGQ 2G5DA 3H0GH 2D2CC 2JA6H 2B2TA 1EIGA 2DNCA 1AZQA 5IYCH 3QJYA 1VQPA 4N9PA 1KDBA 1VQBA 2EJGC 3K7AB 1BCPF 2RKSA 2JA5H 3QR8A 1O80A 1WTXA 4POGA 5HGQA 4C2MH 2LMCB 4A4IA 3UDGA 3RLNA 1NJIC 3PO2H 4DR1L 5FO9B 5ELBA 1VQ7A 4IFDH 1PRTF 4UPAA 2B63B 5BN3A 4MNOA 3T1YQ 3RZOH 3CPWA 1JOQA 2HIXA 4K6DA 4DV1L 3WWVA 2FJ2A 5IYBH 5AJ3Q 4A3LG 1SNCA 2NVYB 3H0GG 1W3SA 4A3DB 3P1HA 3S2HH 1L1OC 1HFGA 2VB2X 1Y1WB 1HNWQ 4BY1B 3ICEA 1HHVA 2KVMA 3BVMA 2ES2A 1HCZA 4A3EG 1V43A 4RHSA 4JBKA 3I72A 2IPKD 1VQ9A 4L5SA 1PH1A 3P75A 4JI1Q 3TS0A 1G2SA 1HTLD 3KF8A 3MXNB 2JP1A 2Y0SG 3ITPA 1PLFA 4Q5VA 1U0LA 3D4DA 1UE1A 1WD0A 3S16B 4IUTA 1D5XC 3M4YA 4YWLA 1CKNA 4JC0A 4DFAA 2B63H 1H9KA 4JI8L 3F1ZA 2WFWA 4L8JA 2JA9A 2CWPA 2XGTA 3A7LA 2ENBA 2WB1E 3CP0A 3HP3A 3RLFA 4UP7A 2UUCQ 3QO2A 4C3HG 2XWBB 4LF7Q 4DXGA 1B8AA 4TKOB 3A55A 3PUXA 4JW0A 4X6AH 2PI2E 1DM0B 4FXKC 2UUAL 1HNWL 1GUNA 2RHSB 2M2LA 3JAMi 4DR3Q 4A3GB 3M7GA 4WJWA 1TY0A 2XIWA 3T13A 3UDFA 3SK5A 3A7AB 3MFYA 1L0WA 1OXVA 1DJRD 1N9WA 2R92G 1B50A 1K8OA 4QL5A 1TS5A 4Q0FA 1GOZA 3TZDA 4UP9A 3C1EA 3G4SA 4C3JG 3CCVA 5DM73 2JA7G 4KD4A 2WINB 4DR1Q 4KHVA 2NTSA 3PUYA 2Q2UA 3PO3B 1PZJD 1KAAA 1KC8C 4LNQA 3CKIB 1IYJB 4HEDA 4L5RC 3NQTA 3H15A 2UXBL 4C3JB 4QGUA 1TWFH 1VQ8A 1I3QH 2F0GA 1LLRD 3MWYW 3HOYH 2XWJB 1MKHA 1A3TA 4DV3L 4DU9A 4JI3Q 5KYIA 1XYIA 1ILQA 1Y14B 4DR7Q 4KY7A 2F0KA 4OO1H 1I94Q 2EYMA 5F2DA 2E2JH 2D0OA 1O7IA 2ICEC 4OXPA 3TN2A 3DEOA 4C56C 2QA4A 5E7NA 4RGTA 4KI0A 2JA6G 2MNAA 1JT8A 2IW3A 1GVPA 1D6EC 4A3MH 2F52A 1SYBA 3I4LA 1C0AA 4B9XA 3ER0A 3HG9A 4BBSB 4DV0L 5C5MA 5IWAQ 1N33L 4B3SL 2CFMA 2EJFC 5GAHC 5C3EB 4HIKA 4A3GG 2D9UA 3J80E 1S5BD 1Q90A 2NN6H 2F0JA 4BBRG 1FNWA 4JI4L 3JAMc 3RR5A 5J1ZA 2OTLA 3S2HB 1CKNB 4GNXB 3CPFA 5CBEE 2B2UA 3D4RA 3C3LA 2G9DA 4OO1I 1D2BA 4ZLTF 1PHJA 2QEJC 1KABA 1PTOB 4QUCA 2PQEA 1UEAB 2R7DA 2ATWA 1HPCA 1EYAA 1W6KA 3TBIB 1BO0A 2EE1A 4HJAA 1Q1EA 4AYBB 4TSSA 1PTOC 4HN7A 5BR8Q 1ZKOA 4A3FH 2A69D 1GJXA 1RF2D 3K5MA 1HJPA 4OELB 2F0HA 4Z9CB 1UUPA 3SK8A 2VS1A 5DM63 1YJNA 3D0FA 1PTOF 3CMAA 1PFMA 4DV2Q 1EFID 4PMBA 3J80c 2B63G 3U9OA 3PCOB 2KHJA 4RKBA 1QILA 5KNBA 2VQEL 1RD9D 2NTTA 4BY1H 1KDAA 3R2TA 5IP7H 3H3VI 2BDOA 3S15H 1VF7A 1EWCA 2BDNA 3I7FA 2R93B 1V1PB 3PIO3 1LT3D 5FLMG 3A56A 2BCOA 4B3ML 2DJFC 4JVZA 1YHBA 2B3GA 5M3MH 3HOUB 1SFOH 3RZDH 2RDFA 3F2BA 2D5DA 4LUZA 3T1HQ 5LL6S 1XPUA 3AYHB 1Q81C 4ME3A 1UNSA 5C0XJ 1YNNC 1UE5A 2ZT9C 5M5WH 1UE7A 4X64L 3NSWA 4AYBE 3A0JA 4JI5L 3OMCA 4A3BB 4LF4Q 4WORA 3NP8A 2F0EA 4LUOA 2WV6D 3CXCA 3K6OA 3SK4A 1PH4A 2RSNA 4FP5D 5FO7B 4DK1A 4JI6Q 1J5EQ 5C0XI 3C1FA 2CCZA 3TREA 2JSOA 1Z6HA 3D8GA 1S4ZA 4LWCA 3MEFA 4FXGC 2JA7H 1H95A 1EY8A 3SEBA 4DV4Q 4DV0Q 3PIOA 5IE8A 3H94A 2QF7A 1E22A 1QVCA 3AQQA 1JJCB 3DEPA 3MVVA 4XT3B 4HSPA 3V2TA 3BZCA 4GKKQ 1HH2P 2I5MX 4PV1C 2CH4A 4YHHL 5C44G 4L63B 1X9NA 1CZWA 1B53A 2K5NA 1YHQA 4X66Q 2XNAC 4FO2A 1QE6A 1D1IA 4A3LH 4FYDA 4JI0Q 1UAPA 1Z7TA 4KJNA 2A68D 1GUOA 2RBMA 3BG3A 2A6HD 3S9WA 1NMFA 2X6GA 1NTGA 1J5EL 4FF3A 1QWYA 1H9SB 2K7VA 4IUQA 3S1NH 2EYLA 5M5XB 3GTQH 1Q8KA 5ELFA 4A3FB 2N49A 1SMXA 2HQEA 1TS4A 1RCVD 3KF6A 3GTGB 1IXRA 1QB5D 1VQMA 4IQZA 2D0PA 5ELNA 1OXXK 2AMCB 1Q46A 2E2HB 1DZ1A 3F2UA 3HOWH 2DUDA 1X65A 1MJCA 1W6JA 3IFDA 3M7NA 3CW2C 3HOXB 3D31A 4IZ8A 2K33A 2KENA 5C4HA 2E76C 2O2LD 4XQJA 1LT4D 4JBJA 3HS0C 3VR2A 2KCMA 1KIXA 1VQ5A 3I4MH 3L7ZC 2F4VQ 2QDLA 3ONAB 3HOYG 3NPPA 1KNEA 4N8X1 4IPDA 2VXWA 1PRTC 5C0XG 3AMUA 1I5FA 4KKSA 1ZYRD 3SHLA 3DUZA 2QCPX 1STHA 3VYSA 5C0XH 1HUNA 2MO0A 1X55A 1G291 1ENAA 3BDOA 5C4XG 1R4PB 4U673 2J4XA 4K8IA 4JOIC 2R61A 4DN4M 1VQFA 2AKWB 1XPOA 3S14H 5I6WA 5EKKA 2JK8A 4UY8C 2ICIA 2JE6I 4ABNA 1N36L 3E9HA 3AB9A 2EQSA 2KJXA 3PV0A 4K14A 1KXLA 2VB3X 2ZJPA 4EX5A 5IT9E 3EFXD 1NCVA 3TP6A 5M3FG 1JE5A 1FGUA 2L4NA 3CC7A 4IUNA 4BBSH 1N34L 4J1MA 1Y1VG 4R8NA 5BN5A 4N8FA 3KK7A 2F4IA 2SNSA 3CRKC 1K73C 4LF6L 5AFWA 5ELOA 3DWQA 2F0WA 4JI1L 1EY7A 5C6AA 3I90A 1CT1D 1NSNS 2ZTCA 1CHPD 3H91A 5JEAG 1M4VA 5C4XB 2V1CC 2DN8A 3I4MB 3S1QH 2ALYB 4S3SA 1SE4A 4DV6L 3OW7A 4QUFA 1VQOA 3MAQA 4YIJA 2K03A 2MUYA 1Y1WH 1S72A 3U58A 1A3UA 2BA0A 1EZ6A 1XNQQ 1MHWC 3LGJA 3OWFA 3E9IA 2KOLA 4TQUS 1HZBA 4HIDA 3MEHA 1TWGH 1RODA 3RLOA 5LMNW 4QIWE 2K6AA 2N88A 3ERSX 5JJIA 2Y0SE 3J81L 3UE1A 4HCEA 4H0LC 4RFBA 1PFBA 4DR5Q 3X3NA 2K14A 4GS3A 1I4XA 4KN4C 5IP7G 1JCKB 3HOWG 2Q8IB 4RAUC 4F88A 1VQIA 3S2DB 3ND9A 4G7OC 4G4KA 4KY5A 4LFBL 4KMUC 1BDOA 5AJ3L 4B9WA 2F4VL 2IHFA 1G51A 1PDQA 1PFSA 2N78A 3PIPA 4GN3B 1QVFA 1FJGL 1TT2A 4K5XA 3GTLH 5DAUA 5C4ZA 4ILWA 4A3FG 4C1NK 3L0OA 4RHRA 1XMOQ 2OEOA 3U50C 5FLXE 2CVRA 2F0PA 1VCIA 3VR3A 3KBGA 3E5SA 1SLJA 3G71A 4X3TA 2XSCA 3N6RA 2K5QA 2RCNA 3C46A 3NEMA 1ENFA 4HIOA 2K5VA 4DNRB 1PYSB 4DR5L 5GAEC 1HR0L 3LWEA 1TWCB 1YJ9A 4HJ7A 3FP9A 1V1QA 3WOFA 4OIKA 2R7ZG 3MXNA 2IY5B 3A8IE 5T1IA 1NBWA 2PPBC 2Z4HA 2JA8H 2HIVA 1XNQL 5C44B 3ULLA 1E2ZA 2Y0SB 2VZAA 4IUUA 1HR0Q 1N32L 1WOCA 2V4DA 4OONA 1F9QA 5A2QE 3T1HL 5JVH3 1CSQA 2UUBQ 1VQ6A 1LTTD 4KD3A 2HCCA 1I6VC 1KRTA 4A3KB 4PZ8A 2MO1A 3KJOA 2O5JC 3FHWA 3KLWA 1NY4A 1TWAB 3Q0AA 3B6YA 2B2TC 3GTJB 5IGCA 4KKUA 5CV5A 5EBCA 1MJEA 3STBC 4PZ6A 4A93H 1SBBB 1T9HA 3ULJA 4DNIA 4CDFC 4ZRZA 1PH3A 1Y8NB 4L5QA 3CCQA 2LXJA 3VDYA 2VQFQ 2WAQE 2RF4A 5C3EG 3OSOA 4A3MG 4IJHA 1EYGA 2WIIB 4OWXB 3S1QB 5EPLA 3HOXG 3LX0A 3KJPA 2ZJQA 2X6LA 1K83B 5GQOA 1MD2D 4APVA 5C3EH 1A63A 3T56B 5FLXL 1CUKA 2OXPA 2VL6A 3TP7A 4KKTA 1QUQA 4GKJQ 5J3BA 2IX3A 3H3VC 1CA5A 2EJMA 4QY7A 5FLMH 5DNFA 5HURA 2QILA 3I70A 2KUMA 1WD1A 5D3DA 4YWMA 3KOJA 4E6IA 3FMCA 4DK0A 4PQXA 4OX9Q 1AN8A 4JCVE 3R2IA 3G48A 1BBXC 1IL2A 1VF5C 1H9MA 1VQHA 1MGSA 2QKIC 2O4XA 5JVG3 2F0MA 4K2LA 4DA2A 5I4DA 3FDTA 1B7YB 3OPOA 1EQQA 2LSSA 4EQPA 2XVSA 1A3VA 4CDEC 1K3RA 4B3MQ 2L5TA 3FKIB 4ZYSA 4GNXC 4F87A 3Q22A 1DYQA 4LMQD 3HRZC 1TWAH 4GLVB 4BBSG 1JB3A 5EPJA 5EQ0A 2VUMB 4HTHA 4UAIA 3NUCA 2BE5C 4DAMA 5M3MG 2ZTEA 3M4QA 3K0XA 5I9OA 4JV5Q 3NBIA 3HKZB 3PF4A 2GA4B 5CC4A 4BXXG 2OCEA 2JA6B 1D8LA 3J7AV 4DR2Q 4BY7G 4LJZC 2KHIA 5ELDA 4CJ1B 3MHBA 3DM1A 1SNDA 1Q82C 2PMZB 5C44H 4AH6A 1O7YA 1WJJA 1WI5A 2WKCA 2ASBA 5JJZA 3GV3A 1QUQB 1JICA 3HOVH 1VQAA 4A3EB 4HSVA 2WB1G 4MIUA 4X3UA 2QEXA 4DUZL 4YCVA 2LKVA 3GTMB 1SNMA 4RWSC 3TSSA 2EY6A 1F9PA 2MP1A 1VS0A 1K0RA 2PNHA 5CV8A 1W2BA 1N8RC 3I3CA 4X3KA 1S5DD 2WACA 2R92H 4X3SA 2Z1CA 1OTCA 4J15A 4DV7Q 3STBD 4DV6Q 2KBNA 3Q8DA 3P7JA 3D4WA 1I4PA 3CCSA 5FK9C 4RCOA 4ME5A 2DY7A 3FVQA 3Q24A 2F3IA 1X3EA 5KIXA 1PZKD 1S3OA 1KTKA 2F0OA 2A69C 1NE3A 4RGNA 3AFQA 3BYTB 3RN2A 1EWHA 4C3IH 1SMYC 4QF4A 4OO1G 3I4NB 4ODGA 2R93G 4DAVA 4AIMA 3VYUA 4B3TL 3H09A 3OWEB 4LFCQ 4LF7L 3BVZA 3K57A 2Q8RE 1BKBA 2B2VC 1HQRD 2LXKA 4F7XA 3IAYA 2SEBD 4DR4Q 5EBDA 3PQIA 5E4WC 3DWAA 1PH6A 3PUZA 4DV1Q 1JMCA 1G8ZD 1AFPA 3S17H 3K8AA 1Y1VB 2B8FA 4K5WA 2Z6KA 1IBLL 3BDCA 1TS3A 2C35B 4A3EH 5KNDA 2K5WA 2E2IH 3GTPB 2F0VA 4OL7A 1GHJA 4A3CG 3W1GA 1BF4A 4C3HH 1XNRL 2I5HA 2R7ZH 4IURA 4DV7L 1JQYD 2GVBA 1M90C 1LT6D 1EEFD 2F0NA 1H9SA 1K8MA 1F9RA 1PXUA 3EA6A 2Q2IA 1QG7A 4KHZA 2G9HD 1JJ2A 3HEJA 3QOJA 4TVAB 2OQKA 4DKAC 4LF5Q 1B70B 1CK1A 3PUWA 4LF4L 2JN4A 1GUWA 1YNJD 5EPKA 4NW2A 1STBA 2IWHA 1F77A 2F0QA 1Q7YC 4ZAIA 1SYCA 1L1OB 2Z4IA 1U4LA 4JG2A 1X32A 1OXSC 4CKEA 2H4OA 3E0JA 3K5LA 2F1MA 1GXDC 3KUPA 5JPNC 2KQ3A 4RGOS 1SAPA 4H02A 3PGZA 4O0AA 3R3OA 1BNZA 2OF1A 1NR4A 1EY4A 3CAMA 1D1KA 3I4NG 2FMCA 1G2TA 2PYKA 2KEDA 4I7ZC 2E2JB 3QB3A 4A3BG 3NTIA 3PMFA 1AW7A 5CYUA 4R8IA 4JK1C 1WCMG 3MA2B 2ZTDA 1N34Q 1CZGA 3KYHC 1K8GA 1HZ9A 1T5EA 1MI2A 2VY3A 1E2WA 3I8ZA 4PMCA 1EY9A 1K9MC 1X6OA 2Z6BA 2Z6KC 1VQ4A 4IOAA 4BBRH 2I46A 2C9OA 2Z8LA 5IGDA 4A3KH 1IBKQ 1IW7D 4I65A 2K4KA 3LNNA 1ILPA 2IHEA 4GOPA 4BWGB 4C1NI 4IPGA 1YJWA 5K5PA 4I7AA 1VQEA 3CF5A 4KY6A 1ML0D 2IL8A 3A5UA 5GADC 5IP9G 4FF2A 3BYYB 3F8TA 2UUAQ 4L6TB 2WP8J 1CI3M 4KHPL 1I4RA 2JJQA 2NWGA 5D3IB 3FPPA 3GP7A 2CKZB 2IX1A 1SYGA 4A3JG 5M3MB 3HOUH 5L37A 4POFA 4F8MA 3PO3H 3T51B 3TP8A 2B2VA 4UDUC 1LTRD 3C2PA 4JI8Q 3HOXH 4A93B 1A8VA 1SRUA 1DOMA 3J80i 4MN3A 3P20A 5EKIA 3HOVG 3KDFB 3S15B 2N3SA 2K50A 1QZHA 5JJLA 5EJWA 1RIPA 3HOZG 2JA7B 2M00A 2F0IA 4JOIA 4BA2I 3GTQB 1KLGD 2E2DC 2L55A 3TMEA 3DHQA 3NHHA 3M9BA 4FVMA 5M9OA 4DR6Q 4FNFA 2XTIA 2F0DA 1YI2A 2MPMA 4FF1A 1Y1VH 2KCNA 4ZQ3A 1DGSA 1JWSD 4DV5Q 4K0KQ 1EUJA 3HKZG 4QIWB 3CCRA 1S5ED 4R4TA 3BS1A 1O7LA 4RMFA 4NXNQ 1Z9FA 1Q1BA 5A2QL 4QQBX 5C3WA 3S1MH 1Q86C 2PZTA 1TS2A 2E5LQ 4JI2L 1A62A 2NVYH 1KD1C 4DAPA 3L3OC 4MHEA 4MTNA 3GDEA 4J6HA 4OIJA 4XQQA 5IT9c 3PIP3 1QJOA 4NXML 4A93G 1EQVA 5TSSA 1R4QB 2Z0SA 4IFDI 2PQAB 1BCPB 3NE5B 1PYWD 1J8IA 4LUVA 1GKHA 1DONA 5FKAC 1IBML 1F2MA 3J81j 1I50H 3X3MA 3MXPA 2AWNA 1SXTA 2L9HA 2FXQA 1K0SA 1EZ8A 1TWHB 4ID6A 1YEZA 4A3BH 1CFMA 1Y8PB 2YV5A 3J81c 4U68A 1ESRA 1IBMQ 1STYA 2VUMH 5JEAH 4GKJL 2KCCA 3GTKH 3VYRA 2JA5G 4XYOA 4LFBQ 2LS01 4A3KG 2RVLA 5G3LF 1SE2A 4DV3Q 1KL9A 4YCUA 4RH6A 4BY7B 1PH8A 1XTCD 1QNKA 3OOCA 3EBEA 1TR5A 2K28A 3QOLA 2PZWA 2L11A 4ZUIA 3I73A 5C4JB 2UXDL 3M4PA 2BE5D 1EU3A 4C3HB 1B2TA 1BCPD 3DM3A 4NB3A 4P2CB 2WB1B 2RCFA 2B8GA 2M9VA 3M4OB 1EY0A 1NMGA 1YITA 5DEHA 1Y1WG 3VA7A 1XNRQ 5G3LD 4UHVA 4B3SQ 1FD7D 1LTBD 5C3XA 1SYDA 5T1GA 5KRUA 5IWAL 3NK9A 2CH4W 1V1PA 2EYJA 4C3IG 2EY1A 4YHHQ 4G7HC 4A3CH 1X3PA 3F2CA 1X3GA 2I5LX 3D6WA 3HOZH 2PW5A 1D5MC 2AHOB 1SSOA 5IGBA 4NP5A 4PMWA 2HQLA 4A3JB 5I2XA 4FDBA 2J0TD 2ZM6Q 2LFNA 3SR1A 2R7FA 3URYA 3GTJH 1C9OA 2ZJRA 3BVGA 1XMOL 1I3QB 1U5KA 3DMUA 3EJIA 1M1KC 4XYQA 1K28A 2PNRC 2EYOA 2EXDA 4DK3C 3NQIA 3S1RB 5JEAJ 2EZVA 1LABA 1Q12A 3BZKA 4O1NA 4YY3L 4HJ5A 1JJGA 1SROA 3MTSA 1VDZA 2XRSD 1RHPA 4KV6A 3CRLC 3IL8A 2WAQB 1PH7A 1YBYA 1I4HA 4DR3L 2K01A 2JXMB 1AEXA 4K2KA 1B44D 1IW7C 3VR5A 2HUGA 3TQYA 2RDGA 2MQHA 2VW9A 3N52A 2I07B 2JYOA 2VQFL 1C48A 4H7BA 2CW0C 3RZOB 4NDXA 3KF6B 3Q23A 4IJLA 3QWNA 1TIID 1I6HH 3RMHA 3RNUA 1C7YA 5EGTA 1V1OA 2Z9HA 1BQQT 2R7ZB 4A3DH 4H13C 4IFDJ 2JQOA 4CHTB 2F03A 5I9PA 1VQLA 3V05A 1QZGA 3M3YB 3K59A 1EIFA 3T1YL 1PA6A 1E2VA 3OHXC 3VYTA 5IGEA 4P75A 1FNUA 2A5HA 4A3GH 1IBLQ 3CU7A 1PYBA 4B08A 4LF8L 1MSGA 2HHHQ 1TY2A 4A3IG 2K52A 4V0BA 3GTLB 1HNXQ 2NZOA 2IT1A 3HFZB 1PTOD 3K80C 1JWMD 1JC7A 4NPSA 4C2MB 3CCJA 4KN7C 5GROA 2F0LA 1XJVA 1QVGA 1U4PA 3CMEA 1I6HB 5IYBG 4DUYL 4ZCKA 1MBYA 1RL2A 3BDLA 2HHHL 1YNND 5ISRA 3K58A 4JYAQ 2RQXA 1GD7A 3M3YH 1KAWA 3PUVA 2WAQG 5IP9H 4IFDG 1A15A 1QOHA 1SJED 2PZUA 1L0YB 5LL6X 4CKCA 1WTQA 1ZYRC 1LTLA 3HKSA 4P71A 4X66L 4CBVA 3NTHA 1CQFA 2AUKA 1MIUA 1YVCA 2NVQH 1EYDA 2NBFA 3KLSX 2ID0A 3SXHA 1PRTB 3CC4A 2UU9L 4GN5A 4JYAL 3HOVB 1HNZL 4M8AA 4H44C 1KNAA 3IFTA 1P8LA 3UE0A 3UDXA 2UXCL 1WTOA 1HUMA 1SYFA 2B2UC 4DV4L 1S40A 3KF8B 2FMMA 4M1UB 5CORA 2F3VA 2E8GA 1X56A 4ZK9B 2R6GA 2NYZD 3TZUA 3SE0A 4A75A 3A8KE 3SVMA 5IGFA 1ZXTA 1H9RA 2HCIA 3S14B 3ZYYX 3CC2A 3HOUG 4DUZQ 1RJTA 5IIFA 4X62L 1XMQQ 1IKLA 2SOBA 4CDCC 3ERQA 1F2ZA 1T5XD 3V96A 1HTPA 3W3AA 2Q8TA 5J22A 1PH5A 1BR9A 3D6CA 3RUZA 1BOSA 4JI7Q 5M3FH 2N8NA 2R3ZA 2L1BA 1GUGA 1SFOB 4A3DG 4OGQC 1SNPA 5CV9A 3A8JE 4OHJA 1IHZA 3OTOQ 1SEBD 2NN6G 2CQAA 3BU2A 1TQOA 2QW7A 4K8JA 3MZ5A 3TEHB 1FNVA 3S24A 1CKOA 3ZJYC 4AQYL 2NZHA 4HIMA 1EOTA 3A5ZB 2EOTA 1Q8IA 2MHVA 2EY5A 3KLRA 3PF5A 4ZUJA 1J6QA 1X54A 1F9SA 3L9AX 5CBAE 5DLQE 4L5TA 3RD4A 3GD7A 2BH2A 5M5XH 4K5VA 2VQEQ 5LMNL 4EVOA 3HOZB 3LWUA 5JJKA 5D14A 2OT2A 3I91A 1II3A 1BBUA 1VQKA 4FF4A 2JEAI 2E74C 5M3FB 1CSPA 4GKKL 5LMUL 1BCPC 5K36H 5KNCA 5COYA 1Y69U 2K5DA 1K8AC 4LF9L 5C4JH 2NUCA 5E4XA 4ZKBB 5IYDG 3G6JB 3F2DA 1G6PA 4HMIA 4CGYB 1AE2A 4KK7A 1STAA 3U4ZA 3TS2A 2A74C 1F2YA 4P72A 1TVXA 5FJ8H 5KGUA 4FXDA 4GN4B 5J39A 2ZXRA 2EYHA 3NBHB 1CM9A 5CGKA 1EEID 1SMYD 2CWAA 2X69A 3GO5A 4IUVA 4DK6C 4ULLA 3M85A 1M8AA 3BJUA 2KECA 4DR2L 4YWKA 4DPGA 1D5ZC 1ONLA 1JORA 3W2DA 1WFQA 2A68C 3VR4A 1C4QA 1I4QA 2NN6I 1HZCA 4A3IB 3KDFA 5HY6A 2RHQB 3AFPA 1PMRA 4HMJA 4OX9L 1WTPA 1I50B 1PV4A 3PO2B 2IJ0A 2L0CA 2HDMA 5GAGC 2K1BA 2YTXA 1VQGA 1A0IA 1CTMA 1P16A 4NXMQ 1GO3E 4AQYQ 1X3FA 3AEVA 3A54A 4XTCS 1TWFB 3HOYB 4X64Q 3K81C 3J80L 1Q3LA 2DY8A 4DF7A 4OWWB 3BZDB 1C8CA 4Y52H 2P5ZX 3GTKB 3AU7A 2E75C 3K7AH 2XRQD 2JA5B 1GUSA 1VQDA 2K04A 3GQBA 3E6ZX 3EVQA 4DUYQ 5IOCA 1LM0A 1SJHD 1E0BA 1FYCA 1EWIA 1GHKA 2A6ED 1PZID 5EAYA 2A6EC 4PNYA 1I4GA 4DV5L 3S17B 4GOPB 4LF5L 3IKJA 2RA4A 1PVOA 1YIJA 4CDDC 1NAPA 1AE3A 3GTOH 3S16H 4GOPC 1UE6A 3I4NH 3S2DH 1LTGD 2WKDA 5LHY1 3W1BA 4JI2Q 3KBXA 2E5LL 2JA8G 1VMPA 1CQVA 3D3RA 2QGQA 1ICFB 3K5OA 1PRTD 3MXGA 3J7ZC 2JA8B 3HZXA 3FKIG 4IUPA 2I0QA 3RZDB 1KDCA 2HT1A 3R93A 5LMUQ 5BR8L 4LK1C 4MZ9A 4N9TA 2B2WC 1EIYB 4DGZA 1HA5A 3WOEA 4EGVA 1IL8A 3KFUA 2H1EA 1NNXA 3CHBD 5IYDH 1ICWA 1NR2A 3E3XA 4RGMA 3NWTA 4R4IA 1EQRA 2PW7A 3JAME 1WTWA 1ASYA 2MJ8A 4IOCA 1N36Q 1L1OA 2R93H 4GLAC 3UDIA 3QIAA 4BA1I 3S1RH 2AWOA 2AQ1B 1PH9A 1U4MA 4V190 3DXJC 3CD6A 3OTOL 1O7ZA 2PQAA 1UEBA 3CQZB 1E24A 1IZ6A 1OXTA 1N33Q 1R9TH 2RDHA 1XWEA 2XN9C 4HCSA 1FL0A 3H6MA 3I56A 3EIVA 2K05A 4HAEA 1BBWA 3NBHA 4CKBA 4ALPA 1E3PA 4QJFA 4A3IH 1LT5D 4G57A 1HQMC 4B3TQ 3HKZE 5FLXc 5M5WB 2EIFA 4A3MB 3NXWA 1U9RA 2J7ZA 3CCUA 4MTKA 2EDGA 2PI2A 1F2LA 2HDLA 2LY7A 3EN2A 1J9OA 2SNMA 1E7ZA 2PCFB 3FEWX 5IY0A 2EVBA 3T53B 1LTSD 4JI3L 1SYEA 4EQ5A 4NKLA 1G91A 2CQOA 3R8BA 1ZEQX 1XXGA 3EQLC 4WJ4A 3I4MG 3UI2A 1WVLA 1IKMA 3CCLA 1JB7A 1LO5D 3IRBA 5IODA 5A35A 2ZXPA 1HZAA 4JPBW 2OTJA 5BN4A 1N32Q 2K32A 5FOBB 1EY5A 2K75A 3NTKA 1LTAD 4BY7H 5IT9L 2EY2A 1LV9A 1E1OA 1ET9A 4B3RQ 2KEEA 2O5IC 2EPBA 3L2PA 2AQ3B 5I2YA 4X65Q 4OEMB 4XIGS 1IBKL 3I55A 3Q6SA 1EQTA 3DLLA 3ND8A 4LF8Q 1LUZA 2A1AA 4PG3A 1DCZA 4R4CA 1AH9A 2CHBD 4XT1B 4TRDA 2B39A 1SNOA 3OIQA 4B3RL 3G6EA 1I94L 4IPHA 4YY3Q 4R4OA 2L12A 1XPRA 3JC66 4HJ8A 2UXCQ 2YTYA 2YYZA 3S1NB 2A8VA 2YU9H 4C3IB 4JI0L 4BXXH 5CV6A 1Y8OB 1AZPA 2KHSA 2NVXB 4G7ZC 5M5YB 1L2FA 2F0SA 2F3WA 5I6YA 2VNUD 4BS9A 4RKLA 4Y7NB 1WCMH 3QG1A 1HR0W 3U4VA 1VQNA 5CR3A 2F0UA 2NVTH 5KYLA 3J81E 3J7YW 4RG1A 1RTNA 2PMZE 3MXUA 4JI7L 4DXFA 5JPMC 1K83H 1HFNA 1SE8A 3VR6A 2NB0A 5H1SE 3I2ZA 1CHQD 4QB4A 2NVQB 3PSIA 1BVSA 5IYCG 1CA6A 3GTGH 3TRZA 2JEBI 2FINB 2NZ1D 1HNXL 4BY1G 4K6LA 5JAVA 3PO3G 3GTPH 4AYBG 2E2IB 4KTAA 1ENCA 4ZKCB 5JOBA 3J7A5 3GTOB 4O42A 2OWOA 2A6HC 1ET6A 2H5XA 3TDQA 3S1MB 3GTMH 4IPCA 2FFKB 4LFCL 4HR7B 2UUCL 1DD2A 5C4XH 2ZM6L 1NUCA 4XDXA 1K3BC 3E0EA 3T4AC 3GV6A 4LFAQ 3SGIA 1SR3A 4JBMA 3PO2G 3SDZA 4XQNA 4UP8A 2EXZA 1WYDA 1RTOA 1IYVA 3VA5A 1TKWB 4PZ7A 1TWGB 5HGTA 3J7AF 1GUTA 1B1ZA 5ELCA 2SDFA 1SE3A 1LTID 4CJ2C 4P73A 1VMCA 1YNXA 4QCLA 1ASZA
chains in the Genus database with same CATH topology
2JA7H 4C3IH 4JI5Q 1H95A 1LTLA 3HKSA 4P71A 4X66L 4OO1G 4DV4Q 3A74A 3PIOA 4DV0Q 5IE8A 1MIUA 1YVCA 2R93G 4AIMA 1PH2A 2NVQH 1EOVA 4B3TL 1E22A 1QVCA 2ID0A 1JJCB 3AQQA 4DV2L 4JI6L 3CC4A 4LFCQ 2UU9L 4GN5A 4JYAL 4LF7L 2BA1A 1KRSA 1SN8A 2D62A 1HNZL 1BKBA 2LXKA 3BZCA 1FVIA 4GKKQ 1P8LA 3W5OA 1HH2P 2I5MX 3UE0A 4X65L 5C44G 3UDXA 4YHHL 1X9NA 4DR4Q 2UXCL 2K5NA 4DV4L 1S40A 1YHQA 4X66Q 3KF8B 4YCWA 1PH6A 4LW1A 3PUZA 2E8GA 1X56A 4A3LH 2R6GA 4DV1Q 4JI0Q 1JMCA 1Z47A 4A75A 3CCMA 3S17H 3K8AA 1NMFA 4DAYB 3FKIH 4GLXA 1NTGA 2Z6KA 1J5EL 3CC2A 1UWVA 3HOUG 5M5YH 4DUZQ 1IBLL 4A3EH 2C35B 3I4OA 4X62L 1XMQQ 2UXDQ 3S1NH 2A19A 1EFWA 2YTVA 2K5HA 3GTQH 1Q8KA 2E2IH 2MFIA 2N49A 1SMXA 1PH5A 4A3CG 1ASZA 3W1GA 4C3HH 2VUMG 4JI7Q 1XNRL 2I5HA 4LFAL 5M3FH 2R7ZH 3KF6A 4DR7L 1IXRA 3ULPA 4DV7L 2N8NA 2GVBA 4A3DG 1D7QA 1M90C 4Y7NH 3K7UC 1VQMA 2D0PA 5ELNA 1OXXK 2AMCB 1Q46A 3OTOQ 3HOWH 2DUDA 2Q2IA 1X65A 1MJCA 4KHZA 2NN6G 3M7NA 3BU2A 3CW2C 4NXNL 3TEHB 1JJ2A 1KHIA 3D31A 1VQCA 4TVAB 2OQKA 4DKAC 3RN5A 4LF5Q 2B29A 1B70B 3NENA 1CKOA 2KENA 3S24A 3ZJYC 3PUWA 4AQYL 4LF4L 2NZHA 4HIMA 2L15A 3A5ZB 4HJ9A 3H3VH 4JBJA 2BH8A 3PF5A 1YZ6A 5FJ8G 4JV5L 1Q7YC 1J6QA 1X54A 2KCMA 1KIXA 1EYGA 1VQ5A 3L7ZC 5DLQE 2F4VQ 3I4MH 4L5TA 1L1OB 3GD7A 2NVXH 4JG2A 2BH2A 3HOYG 1OXSC 5M5XH 4IPDA 5C0XG 1I5FA 2VQEQ 2E2HH 5LMNL 5K36G 5JJKA 4A3JH 3OYYA 1BBUA 1VQKA 2JEAI 4H02A 1VQJA 2MO0A 2KCTA 1X55A 1CSPA 1G291 3PGZA 4O0AA 4R1JA 5LMUL 3M4OH 4GKKL 3CAMA 5C4XG 1HNZQ 1K8AC 4LF9L 5C4JH 3I4NG 4R4QA 5IYDG 3F2DA 1G6PA 1AE2A 4IO9A 1V9PA 4JOIC 3U4ZA 3TS2A 4A3BG 4P72A 1VQFA 2AKWB 1LYLA 5FJ8H 5LMNQ 1XPOA 3S14H 4GN4B 1E1TA 1WCMG 4DR6L 4A76A 2GN5A 2ZTDA 1N34Q 2JK8A 3KYHC 1HZ9A 3NBHB 1K8GA 4UY8C 2VY3A 2JE6I 1N36L 3E9HA 3NELA 4LWCA 1K9MC 2EQSA 1X6OA 1XTDA 3PV0A 1KXLA 2Z6KC 2ZJPA 2CWAA 4EX5A 1VQ4A 3GO5A 4DK6C 4IOAA 4BBRH 3M85A 4LF6Q 3BJUA 5M3FG 4DR2L 4X62Q 1XMQL 4YWKA 4A3KH 4DPGA 1IBKQ 1JE5A 1FGUA 2K4KA 4KHPQ 1YHAA 3CC7A 1WFQA 4BBSH 2IHEA 2Q2HA 1N34L 1Y1VG 1TXYA 1HZCA 2NN6I 4JBWA 4GOPA 4IPGA 3KDFA 5HY6A 2RHQB 4GNXA 1YJWA 1OXUA 3AFPA 4DR4L 1GM5A 1VQEA 3CF5A 4OX9L 3J81i 3A5UA 1PV4A 3OW2A 5GADC 1K73C 4LF6L 2Q2TA 5IP9G 4LF9Q 3CQZH 5GAGC 4WJ3M 5ELOA 3F8TA 4KLKA 2YTXA 4JI1L 1VQGA 2UUAQ 1A0IA 4DR6Q 3CCEA 2WP8J 1P16A 2ZTCA 4KHPL 2JJQA 4NXMQ 1GO3E 4JI4Q 4AQYQ 1X3FA 1KQSA 2UU9Q 5JEAG 3AEVA 2DGYA 4K0KL 2GVAA 2CKZB 2V1CC 4XTCS 2HHHQ 2IX1A 4C3JH 3S1QH 1TWHH 2ALYB 4X64Q 3K81C 4DV6L 4A3JG 3HOUH 1VQOA 4OWWB 4POFA 3PO3H 4OWTB 4Y52H 4P74A 1Y1WH 1S72A 3K7AH 3U58A 2BA0A 1VQDA 4JI8Q 1XNQQ 3LGJA 3HOXH 4DUYQ 2IX0A 3E9IA 2OQ0A 1A8VA 1SRUA 1HZBA 1LM0A 4O2DA 4TQUS 3J80i 1EWIA 4HIDA 2UXBQ 1TWGH 3RLOA 1TWCH 3HOVG 5LMNW 3KDFB 4QIWE 5EAYA 1CKMA 2N3SA 4DV5L 2K50A 1QZHA 3ERSX 4GOPB 1FJGQ 5JJLA 2Y0SE 4LF5L 3UE1A 2UUBL 5JJIA 1PVOA 3H0GH 1YIJA 1RIPA 2JA6H 3HOZG 1AE3A 4DR5Q 3GTOH 3S16H 2K14A 4GS3A 4JOIA 4GOPC 5IP7G 5IYCH 1UE6A 1VQPA 3HOWG 3I4NH 3S2DH 4BA2I 1VQIA 1VQBA 2JA5H 4LFBL 3M9BA 3W1BA 4POGA 4JI2Q 5HGQA 5AJ3L 2E5LL 4C2MH 4A4IA 2IHFA 1G51A 3UDGA 1PFSA 3RLNA 2N78A 2XTIA 2JA8G 1YI2A 1NJIC 3PO2H 3PIPA 1Y1VH 4GN3B 4DR1L 2QGQA 1FJGL 1QVFA 1DGSA 4K0KQ 4DV5Q 1VQ7A 1EUJA 3HKZG 3CCRA 3GTLH 4UPAA 4R4TA 3J7ZC 4RMFA 3FKIG 4NXNQ 1Z9FA 4MNOA 3T1YQ 3RZOH 1Q1BA 3CPWA 4QQBX 2I0QA 2HT1A 4A3FG 3S1MH 3L0OA 1Q86C 2HIXA 5LMUQ 1XMOQ 4DV1L 5BR8L 3WWVA 5IYBH 5AJ3Q 2E5LQ 4JI2L 2NVYH 1A62A 4MZ9A 3H0GG 1KD1C 1EIYB 4A3LG 1W3SA 3U50C 3S2HH 1VCIA 3KFUA 1L1OC 1SLJA 1HNWQ 3G71A 3ICEA 4MTNA 3GDEA 5IYDH 2UXBL 2ES2A 2RCNA 4A3EG 3NEMA 1V43A 5IT9c 4HIOA 2K5VA 4JBKA 1VQ9A 4NXML 4A93G 1PYSB 4R4IA 4DR5L 2Z0SA 5GAEC 1EQRA 1HR0L 4IFDI 1ASYA 4L5SA 2PQAB 4JI1Q 1PH1A 4IOCA 1YJ9A 1L1OA 4HJ7A 3FP9A 3TS0A 1N36Q 1V1QA 4GLAC 4LUVA 3UDIA 3MXNB 1GKHA 4BA1I 3S1RH 2AWOA 1IBML 2Y0SG 2R7ZG 3J81j 1I50H 1PH9A 1U0LA 2IY5B 1UE1A 3CD6A 3OTOL 2AWNA 2PQAA 1NBWA 1UEBA 1E24A 1IZ6A 2JA8H 4YWLA 1CKNA 4JC0A 2HIVA 1OXTA 1N33Q 4JI8L 2FXQA 1XNQL 2B63H 3ULLA 1R9TH 3F1ZA 2VZAA 2WFWA 1HR0Q 1YEZA 2JA9A 1FL0A 4A3BH 1N32L 3I56A 3EIVA 2CWPA 2XGTA 1WOCA 1BBWA 2WB1E 4OONA 1E3PA 3CP0A 4QJFA 4ALPA 2YV5A 3T1HL 4A3IH 3RLFA 3J81c 4UP7A 2UUCQ 4B3TQ 1CSQA 2UUBQ 3HKZE 5FLXc 1IBMQ 2EIFA 1VQ6A 2VUMH 4LF7Q 1B8AA 1YJNA 4GKJL 3PUXA 1KRTA 3CCUA 3GTKH 4X6AH 4PZ8A 2MO1A 2PI2E 3KJOA 2JA5G 3FHWA 2UUAL 3KLWA 1HNWL 2PI2A 1NY4A 2R93H 3B6YA 3EN2A 4LFBQ 2RHSB 3JAMi 4DR3Q 1E7ZA 4A3KG 5IY0A 3UDFA 4DV3Q 1KL9A 4YCUA 1OXVA 1N9WA 1L0WA 4JI3L 4EQ5A 2R92G 1PH8A 4QL5A 1MJEA 3STBC 4PZ6A 4A93H 2CQOA 3ULJA 1T9HA 4WJ4A 4DNIA 3I4MG 4UP9A 3EBEA 3G4SA 3CCVA 1PH3A 4L5QA 2JA7G 4DR1Q 3PUYA 2Q2UA 3CCQA 3CCLA 2LXJA 1JB7A 1KC8C 3VDYA 4LNQA 1IYJB 2VQFQ 2WAQE 3IRBA 4L5RC 2UXDL 2RF4A 3M4PA 5C3EG 3H15A 4IJHA 4QGUA 4OWXB 4A3MG 1TWFH 3DM3A 1HZAA 1I3QH 1VQ8A 3HOYH 4NB3A 3HOXG 3KJPA 2ZJQA 1MKHA 4DV3L 2OTJA 1N32Q 2F4VL 4JI3Q 1NMGA 1YITA 1Y1WG 5GQOA 4APVA 2K75A 5C3EH 1XNRQ 1A63A 1CUKA 4BY7H 4DR7Q 1Y14B 4B3SQ 2VL6A 5IWAL 1E1OA 1QUQA 1I94Q 2E2JH 4B3RQ 3L2PA 4GKJQ 2D0OA 1O7IA 4OXPA 5J3BA 4X65Q 4YHHQ 4A3CH 1IBKL 4XIGS 3F2CA 3I55A 2QA4A 5E7NA 4QY7A 5FLMH 3DLLA 1X3GA 2I5LX 4LF8Q 1LUZA 4KI0A 2JA6G 3HOZH 2MNAA 1JT8A 2A1AA 1GVPA 2AHOB 4PG3A 2F52A 4A3MH 4R4CA 1AH9A 1C0AA 3ER0A 4DV0L 4PMWA 2HQLA 4YWMA 5IWAQ 3KOJA 1N33L 4FDBA 4B3SL 4OX9Q 2CFMA 2ZM6Q 4B3RL 3G6EA 4JCVE 2R7FA 5GAHC 3G48A 3GTJH 1I94L 1C9OA 4IPHA 4YY3Q 4HIKA 2ZJRA 1IL2A 4A3GG 1XMOL 4R4OA 1VQHA 1XPRA 1U5KA 1M1KC 4BBRG 3JC66 4HJ8A 2UXCQ 4JI4L 2YTYA 3JAMc 2EXDA 3RR5A 2YYZA 4DK3C 2OTLA 1CKNB 4GNXB 2A8VA 2YU9H 1B7YB 3CPFA 1EQQA 2LSSA 5JEAJ 1Q12A 3BZKA 1K3RA 4B3MQ 4JI0L 4OO1I 4BXXH 1PHJA 4YY3L 4GNXC 4HJ5A 4GLVB 1TWAH 1JJGA 2R7DA 1SROA 2ATWA 1L2FA 2VNUD 4BBSG 4HJAA 1Q1EA 1WCMH 5BR8Q 1HR0W 1PH7A 1YBYA 4A3FH 4DR3L 3U4VA 1VQNA 1HJPA 2NVTH 3TQYA 2VS1A 4DAMA 5M3MG 2ZTEA 3M4QA 2MQHA 3D0FA 4RG1A 3K0XA 2VW9A 2PMZE 3CMAA 4DV2Q 4JI7L 4JV5Q 2VQFL 3PF4A 3J80c 1K83H 2B63G 1SE8A 3PCOB 3KF6B 4BXXG 2OCEA 2KHJA 1D8LA 5H1SE 3I2ZA 4DR2Q 4IJLA 4BY7G 2VQEL 2KHIA 3PSIA 1BVSA 4BY1H 1I6HH 1C7YA 3RNUA 5IP7H 5IYCG 3GTGH 3H3VI 3TRZA 1Q82C 3S15H 2JEBI 5C44H 4A3DH 4AH6A 4IFDJ 1WJJA 2JQOA 3I7FA 1HNXL 4BY1G 1WI5A 2ASBA 3PO3G 1VQLA 5FLMG 4AYBG 1QZGA 3GTPH 1QUQB 3HOVH 1VQAA 4B3ML 3J7A5 1EIFA 3T1YL 1PA6A 1YHBA 2WB1G 2B3GA 4P75A 2OWOA 2QEXA 4A3GH 4DUZL 5M3MH 1IBLQ 2H5XA 4YCVA 1SFOH 3RZDH 3GTMH 3F2BA 4IPCA 1PYBA 4LUZA 4LFCL 3T1HQ 4LF8L 2UUCL 1XPUA 5C4XH 3AYHB 1VS0A 2ZM6L 4A3IG 1Q81C 1K0RA 2K52A 2PNHA 4ME3A 5C0XJ 2NZOA 1W2BA 1N8RC 1HNXQ 2IT1A 1UE5A 3E0EA 3HFZB 2R92H 1OTCA 4LFAQ 3SGIA 1SR3A 4J15A 1UE7A 3K80C 5M5WH 4JBMA 4X64L 4NPSA 4DV7Q 4AYBE 3STBD 3CCJA 2KBNA 3A0JA 4DV6Q 3PO2G 3Q8DA 5GROA 4UP8A 4JI5L 3CCSA 1WYDA 4LF4Q 1XJVA 1QVGA 4LUOA 3CMEA 5IYBG 3CXCA 4DUYL 4PZ7A 1RL2A 1PH4A 2HHHL 2F3IA 1X3EA 4JI6Q 1J5EQ 4JYAQ 1S3OA 5C0XI 1GD7A 2CCZA 3M3YH 3TREA 1KAWA 3PUVA 2WAQG 4P73A 1YNXA 5IP9H 1NE3A 4IFDG 3AFQA 3RN2A 3MEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA7 H;  4C3I H;  4JI5 Q;  1H95 A;  1LTL A;  3HKS A;  4P71 A;  4X66 L;  4OO1 G;  4DV4 Q;  3A74 A;  3PIO A;  4DV0 Q;  5IE8 A;  1MIU A;  1YVC A;  2R93 G;  4AIM A;  1PH2 A;  2NVQ H;  1EOV A;  4B3T L;  1E22 A;  1QVC A;  2ID0 A;  1JJC B;  3AQQ A;  4DV2 L;  4JI6 L;  3CC4 A;  4LFC Q;  2UU9 L;  4GN5 A;  4JYA L;  4LF7 L;  2BA1 A;  1KRS A;  1SN8 A;  2D62 A;  1HNZ L;  1BKB A;  2LXK A;  3BZC A;  1FVI A;  4GKK Q;  1P8L A;  3W5O A;  1HH2 P;  2I5M X;  3UE0 A;  4X65 L;  5C44 G;  3UDX A;  4YHH L;  1X9N A;  4DR4 Q;  2UXC L;  2K5N A;  4DV4 L;  1S40 A;  1YHQ A;  4X66 Q;  3KF8 B;  4YCW A;  1PH6 A;  4LW1 A;  3PUZ A;  2E8G A;  1X56 A;  4A3L H;  2R6G A;  4DV1 Q;  4JI0 Q;  1JMC A;  1Z47 A;  4A75 A;  3CCM A;  3S17 H;  3K8A A;  1NMF A;  4DAY B;  3FKI H;  4GLX A;  1NTG A;  2Z6K A;  1J5E L;  3CC2 A;  1UWV A;  3HOU G;  5M5Y H;  4DUZ Q;  1IBL L;  4A3E H;  2C35 B;  3I4O A;  4X62 L;  1XMQ Q;  2UXD Q;  3S1N H;  2A19 A;  1EFW A;  2YTV A;  2K5H A;  3GTQ H;  1Q8K A;  2E2I H;  2MFI A;  2N49 A;  1SMX A;  1PH5 A;  4A3C G;  1ASZ A;  3W1G A;  4C3H H;  2VUM G;  4JI7 Q;  1XNR L;  2I5H A;  4LFA L;  5M3F H;  2R7Z H;  3KF6 A;  4DR7 L;  1IXR A;  3ULP A;  4DV7 L;  2N8N A;  2GVB A;  4A3D G;  1D7Q A;  1M90 C;  4Y7N H;  3K7U C;  1VQM A;  2D0P A;  5ELN A;  1OXX K;  2AMC B;  1Q46 A;  3OTO Q;  3HOW H;  2DUD A;  2Q2I A;  1X65 A;  1MJC A;  4KHZ A;  2NN6 G;  3M7N A;  3BU2 A;  3CW2 C;  4NXN L;  3TEH B;  1JJ2 A;  1KHI A;  3D31 A;  1VQC A;  4TVA B;  2OQK A;  4DKA C;  3RN5 A;  4LF5 Q;  2B29 A;  1B70 B;  3NEN A;  1CKO A;  2KEN A;  3S24 A;  3ZJY C;  3PUW A;  4AQY L;  4LF4 L;  2NZH A;  4HIM A;  2L15 A;  3A5Z B;  4HJ9 A;  3H3V H;  4JBJ A;  2BH8 A;  3PF5 A;  1YZ6 A;  5FJ8 G;  4JV5 L;  1Q7Y C;  1J6Q A;  1X54 A;  2KCM A;  1KIX A;  1EYG A;  1VQ5 A;  3L7Z C;  5DLQ E;  2F4V Q;  3I4M H;  4L5T A;  1L1O B;  3GD7 A;  2NVX H;  4JG2 A;  2BH2 A;  3HOY G;  1OXS C;  5M5X H;  4IPD A;  5C0X G;  1I5F A;  2VQE Q;  2E2H H;  5LMN L;  5K36 G;  5JJK A;  4A3J H;  3OYY A;  1BBU A;  1VQK A;  2JEA I;  4H02 A;  1VQJ A;  2MO0 A;  2KCT A;  1X55 A;  1CSP A;  1G29 1;  3PGZ A;  4O0A A;  4R1J A;  5LMU L;  3M4O H;  4GKK L;  3CAM A;  5C4X G;  1HNZ Q;  1K8A C;  4LF9 L;  5C4J H;  3I4N G;  4R4Q A;  5IYD G;  3F2D A;  1G6P A;  1AE2 A;  4IO9 A;  1V9P A;  4JOI C;  3U4Z A;  3TS2 A;  4A3B G;  4P72 A;  1VQF A;  2AKW B;  1LYL A;  5FJ8 H;  5LMN Q;  1XPO A;  3S14 H;  4GN4 B;  1E1T A;  1WCM G;  4DR6 L;  4A76 A;  2GN5 A;  2ZTD A;  1N34 Q;  2JK8 A;  3KYH C;  1HZ9 A;  3NBH B;  1K8G A;  4UY8 C;  2VY3 A;  2JE6 I;  1N36 L;  3E9H A;  3NEL A;  4LWC A;  1K9M C;  2EQS A;  1X6O A;  1XTD A;  3PV0 A;  1KXL A;  2Z6K C;  2ZJP A;  2CWA A;  4EX5 A;  1VQ4 A;  3GO5 A;  4DK6 C;  4IOA A;  4BBR H;  3M85 A;  4LF6 Q;  3BJU A;  5M3F G;  4DR2 L;  4X62 Q;  1XMQ L;  4YWK A;  4A3K H;  4DPG A;  1IBK Q;  1JE5 A;  1FGU A;  2K4K A;  4KHP Q;  1YHA A;  3CC7 A;  1WFQ A;  4BBS H;  2IHE A;  2Q2H A;  1N34 L;  1Y1V G;  1TXY A;  1HZC A;  2NN6 I;  4JBW A;  4GOP A;  4IPG A;  3KDF A;  5HY6 A;  2RHQ B;  4GNX A;  1YJW A;  1OXU A;  3AFP A;  4DR4 L;  1GM5 A;  1VQE A;  3CF5 A;  4OX9 L;  3J81 i;  3A5U A;  1PV4 A;  3OW2 A;  5GAD C;  1K73 C;  4LF6 L;  2Q2T A;  5IP9 G;  4LF9 Q;  3CQZ H;  5GAG C;  4WJ3 M;  5ELO A;  3F8T A;  4KLK A;  2YTX A;  4JI1 L;  1VQG A;  2UUA Q;  1A0I A;  4DR6 Q;  3CCE A;  2WP8 J;  1P16 A;  2ZTC A;  4KHP L;  2JJQ A;  4NXM Q;  1GO3 E;  4JI4 Q;  4AQY Q;  1X3F A;  1KQS A;  2UU9 Q;  5JEA G;  3AEV A;  2DGY A;  4K0K L;  2GVA A;  2CKZ B;  2V1C C;  4XTC S;  2HHH Q;  2IX1 A;  4C3J H;  3S1Q H;  1TWH H;  2ALY B;  4X64 Q;  3K81 C;  4DV6 L;  4A3J G;  3HOU H;  1VQO A;  4OWW B;  4POF A;  3PO3 H;  4OWT B;  4Y52 H;  4P74 A;  1Y1W H;  1S72 A;  3K7A H;  3U58 A;  2BA0 A;  1VQD A;  4JI8 Q;  1XNQ Q;  3LGJ A;  3HOX H;  4DUY Q;  2IX0 A;  3E9I A;  2OQ0 A;  1A8V A;  1SRU A;  1HZB A;  1LM0 A;  4O2D A;  4TQU S;  3J80 i;  1EWI A;  4HID A;  2UXB Q;  1TWG H;  3RLO A;  1TWC H;  3HOV G;  5LMN W;  3KDF B;  4QIW E;  5EAY A;  1CKM A;  2N3S A;  4DV5 L;  2K50 A;  1QZH A;  3ERS X;  4GOP B;  1FJG Q;  5JJL A;  2Y0S E;  4LF5 L;  3UE1 A;  2UUB L;  5JJI A;  1PVO A;  3H0G H;  1YIJ A;  1RIP A;  2JA6 H;  3HOZ G;  1AE3 A;  4DR5 Q;  3GTO H;  3S16 H;  2K14 A;  4GS3 A;  4JOI A;  4GOP C;  5IP7 G;  5IYC H;  1UE6 A;  1VQP A;  3HOW G;  3I4N H;  3S2D H;  4BA2 I;  1VQI A;  1VQB A;  2JA5 H;  4LFB L;  3M9B A;  3W1B A;  4POG A;  4JI2 Q;  5HGQ A;  5AJ3 L;  2E5L L;  4C2M H;  4A4I A;  2IHF A;  1G51 A;  3UDG A;  1PFS A;  3RLN A;  2N78 A;  2XTI A;  2JA8 G;  1YI2 A;  1NJI C;  3PO2 H;  3PIP A;  1Y1V H;  4GN3 B;  4DR1 L;  2QGQ A;  1FJG L;  1QVF A;  1DGS A;  4K0K Q;  4DV5 Q;  1VQ7 A;  1EUJ A;  3HKZ G;  3CCR A;  3GTL H;  4UPA A;  4R4T A;  3J7Z C;  4RMF A;  3FKI G;  4NXN Q;  1Z9F A;  4MNO A;  3T1Y Q;  3RZO H;  1Q1B A;  3CPW A;  4QQB X;  2I0Q A;  2HT1 A;  4A3F G;  3S1M H;  3L0O A;  1Q86 C;  2HIX A;  5LMU Q;  1XMO Q;  4DV1 L;  5BR8 L;  3WWV A;  5IYB H;  5AJ3 Q;  2E5L Q;  4JI2 L;  2NVY H;  1A62 A;  4MZ9 A;  3H0G G;  1KD1 C;  1EIY B;  4A3L G;  1W3S A;  3U50 C;  3S2H H;  1VCI A;  3KFU A;  1L1O C;  1SLJ A;  1HNW Q;  3G71 A;  3ICE A;  4MTN A;  3GDE A;  5IYD H;  2UXB L;  2ES2 A;  2RCN A;  4A3E G;  3NEM A;  1V43 A;  5IT9 c;  4HIO A;  2K5V A;  4JBK A;  1VQ9 A;  4NXM L;  4A93 G;  1PYS B;  4R4I A;  4DR5 L;  2Z0S A;  5GAE C;  1EQR A;  1HR0 L;  4IFD I;  1ASY A;  4L5S A;  2PQA B;  4JI1 Q;  1PH1 A;  4IOC A;  1YJ9 A;  1L1O A;  4HJ7 A;  3FP9 A;  3TS0 A;  1N36 Q;  1V1Q A;  4GLA C;  4LUV A;  3UDI A;  3MXN B;  1GKH A;  4BA1 I;  3S1R H;  2AWO A;  1IBM L;  2Y0S G;  2R7Z G;  3J81 j;  1I50 H;  1PH9 A;  1U0L A;  2IY5 B;  1UE1 A;  3CD6 A;  3OTO L;  2AWN A;  2PQA A;  1NBW A;  1UEB A;  1E24 A;  1IZ6 A;  2JA8 H;  4YWL A;  1CKN A;  4JC0 A;  2HIV A;  1OXT A;  1N33 Q;  4JI8 L;  2FXQ A;  1XNQ L;  2B63 H;  3ULL A;  1R9T H;  3F1Z A;  2VZA A;  2WFW A;  1HR0 Q;  1YEZ A;  2JA9 A;  1FL0 A;  4A3B H;  1N32 L;  3I56 A;  3EIV A;  2CWP A;  2XGT A;  1WOC A;  1BBW A;  2WB1 E;  4OON A;  1E3P A;  3CP0 A;  4QJF A;  4ALP A;  2YV5 A;  3T1H L;  4A3I H;  3RLF A;  3J81 c;  4UP7 A;  2UUC Q;  4B3T Q;  1CSQ A;  2UUB Q;  3HKZ E;  5FLX c;  1IBM Q;  2EIF A;  1VQ6 A;  2VUM H;  4LF7 Q;  1B8A A;  1YJN A;  4GKJ L;  3PUX A;  1KRT A;  3CCU A;  3GTK H;  4X6A H;  4PZ8 A;  2MO1 A;  2PI2 E;  3KJO A;  2JA5 G;  3FHW A;  2UUA L;  3KLW A;  1HNW L;  2PI2 A;  1NY4 A;  2R93 H;  3B6Y A;  3EN2 A;  4LFB Q;  2RHS B;  3JAM i;  4DR3 Q;  1E7Z A;  4A3K G;  5IY0 A;  3UDF A;  4DV3 Q;  1KL9 A;  4YCU A;  1OXV A;  1N9W A;  1L0W A;  4JI3 L;  4EQ5 A;  2R92 G;  1PH8 A;  4QL5 A;  1MJE A;  3STB C;  4PZ6 A;  4A93 H;  2CQO A;  3ULJ A;  1T9H A;  4WJ4 A;  4DNI A;  3I4M G;  4UP9 A;  3EBE A;  3G4S A;  3CCV A;  1PH3 A;  4L5Q A;  2JA7 G;  4DR1 Q;  3PUY A;  2Q2U A;  3CCQ A;  3CCL A;  2LXJ A;  1JB7 A;  1KC8 C;  3VDY A;  4LNQ A;  1IYJ B;  2VQF Q;  2WAQ E;  3IRB A;  4L5R C;  2UXD L;  2RF4 A;  3M4P A;  5C3E G;  3H15 A;  4IJH A;  4QGU A;  4OWX B;  4A3M G;  1TWF H;  3DM3 A;  1HZA A;  1I3Q H;  1VQ8 A;  3HOY H;  4NB3 A;  3HOX G;  3KJP A;  2ZJQ A;  1MKH A;  4DV3 L;  2OTJ A;  1N32 Q;  2F4V L;  4JI3 Q;  1NMG A;  1YIT A;  1Y1W G;  5GQO A;  4APV A;  2K75 A;  5C3E H;  1XNR Q;  1A63 A;  1CUK A;  4BY7 H;  4DR7 Q;  1Y14 B;  4B3S Q;  2VL6 A;  5IWA L;  1E1O A;  1QUQ A;  1I94 Q;  2E2J H;  4B3R Q;  3L2P A;  4GKJ Q;  2D0O A;  1O7I A;  4OXP A;  5J3B A;  4X65 Q;  4YHH Q;  4A3C H;  1IBK L;  4XIG S;  3F2C A;  3I55 A;  2QA4 A;  5E7N A;  4QY7 A;  5FLM H;  3DLL A;  1X3G A;  2I5L X;  4LF8 Q;  1LUZ A;  4KI0 A;  2JA6 G;  3HOZ H;  2MNA A;  1JT8 A;  2A1A A;  1GVP A;  2AHO B;  4PG3 A;  2F52 A;  4A3M H;  4R4C A;  1AH9 A;  1C0A A;  3ER0 A;  4DV0 L;  4PMW A;  2HQL A;  4YWM A;  5IWA Q;  3KOJ A;  1N33 L;  4FDB A;  4B3S L;  4OX9 Q;  2CFM A;  2ZM6 Q;  4B3R L;  3G6E A;  4JCV E;  2R7F A;  5GAH C;  3G48 A;  3GTJ H;  1I94 L;  1C9O A;  4IPH A;  4YY3 Q;  4HIK A;  2ZJR A;  1IL2 A;  4A3G G;  1XMO L;  4R4O A;  1VQH A;  1XPR A;  1U5K A;  1M1K C;  4BBR G;  3JC6 6;  4HJ8 A;  2UXC Q;  4JI4 L;  2YTY A;  3JAM c;  2EXD A;  3RR5 A;  2YYZ A;  4DK3 C;  2OTL A;  1CKN B;  4GNX B;  2A8V A;  2YU9 H;  1B7Y B;  3CPF A;  1EQQ A;  2LSS A;  5JEA J;  1Q12 A;  3BZK A;  1K3R A;  4B3M Q;  4JI0 L;  4OO1 I;  4BXX H;  1PHJ A;  4YY3 L;  4GNX C;  4HJ5 A;  4GLV B;  1TWA H;  1JJG A;  2R7D A;  1SRO A;  2ATW A;  1L2F A;  2VNU D;  4BBS G;  4HJA A;  1Q1E A;  1WCM H;  5BR8 Q;  1HR0 W;  1PH7 A;  1YBY A;  4A3F H;  4DR3 L;  3U4V A;  1VQN A;  1HJP A;  2NVT H;  3TQY A;  2VS1 A;  4DAM A;  5M3M G;  2ZTE A;  3M4Q A;  2MQH A;  3D0F A;  4RG1 A;  3K0X A;  2VW9 A;  2PMZ E;  3CMA A;  4DV2 Q;  4JI7 L;  4JV5 Q;  2VQF L;  3PF4 A;  3J80 c;  1K83 H;  2B63 G;  1SE8 A;  3PCO B;  3KF6 B;  4BXX G;  2OCE A;  2KHJ A;  1D8L A;  5H1S E;  3I2Z A;  4DR2 Q;  4IJL A;  4BY7 G;  2VQE L;  2KHI A;  3PSI A;  1BVS A;  4BY1 H;  1I6H H;  1C7Y A;  3RNU A;  5IP7 H;  5IYC G;  3GTG H;  3H3V I;  3TRZ A;  1Q82 C;  3S15 H;  2JEB I;  5C44 H;  4A3D H;  4AH6 A;  4IFD J;  1WJJ A;  2JQO A;  3I7F A;  1HNX L;  4BY1 G;  1WI5 A;  2ASB A;  3PO3 G;  1VQL A;  5FLM G;  4AYB G;  1QZG A;  3GTP H;  1QUQ B;  3HOV H;  1VQA A;  4B3M L;  3J7A 5;  1EIF A;  3T1Y L;  1PA6 A;  1YHB A;  2WB1 G;  2B3G A;  4P75 A;  2OWO A;  2QEX A;  4A3G H;  4DUZ L;  5M3M H;  1IBL Q;  2H5X A;  4YCV A;  1SFO H;  3RZD H;  3GTM H;  3F2B A;  4IPC A;  1PYB A;  4LUZ A;  4LFC L;  3T1H Q;  4LF8 L;  2UUC L;  1XPU A;  5C4X H;  3AYH B;  1VS0 A;  2ZM6 L;  4A3I G;  1Q81 C;  1K0R A;  2K52 A;  2PNH A;  4ME3 A;  5C0X J;  2NZO A;  1W2B A;  1N8R C;  1HNX Q;  2IT1 A;  1UE5 A;  3E0E A;  3HFZ B;  2R92 H;  1OTC A;  4LFA Q;  3SGI A;  1SR3 A;  4J15 A;  1UE7 A;  3K80 C;  5M5W H;  4JBM A;  4X64 L;  4NPS A;  4DV7 Q;  4AYB E;  3STB D;  3CCJ A;  2KBN A;  3A0J A;  4DV6 Q;  3PO2 G;  3Q8D A;  5GRO A;  4UP8 A;  4JI5 L;  3CCS A;  1WYD A;  4LF4 Q;  1XJV A;  1QVG A;  4LUO A;  3CME A;  5IYB G;  3CXC A;  4DUY L;  4PZ7 A;  1RL2 A;  1PH4 A;  2HHH L;  2F3I A;  1X3E A;  4JI6 Q;  1J5E Q;  4JYA Q;  1S3O A;  5C0X I;  1GD7 A;  2CCZ A;  3M3Y H;  3TRE A;  1KAW A;  3PUV A;  2WAQ G;  4P73 A;  1YNX A;  5IP9 H;  1NE3 A;  4IFD G;  3AFQ A;  3RN2 A;  3MEF A; 
#chains in the Genus database with same CATH topology
 3FPU B;  4JI5 Q;  4BBR B;  2FHT A;  1JE4 A;  1HXY D;  3A74 A;  1PH2 A;  1AP0 A;  1EOV A;  4DV2 L;  3TP5 A;  1JR0 D;  3DWP A;  4JI6 L;  1JWU D;  2BA1 A;  1KRS A;  1SN8 A;  2PO4 A;  2D62 A;  3U9S A;  4WFN 3;  1FVI A;  2AQ2 B;  1ESF A;  5ELE A;  3W5O A;  1A6X A;  4X65 L;  3OIP A;  1SNQ A;  2KA7 A;  1BUV T;  4YCW A;  4LW1 A;  1U4R A;  1Z47 A;  3CCM A;  2EYF A;  5NUC A;  4DAY B;  3FKI H;  3MFG A;  4GLX A;  1EIH A;  1UWV A;  3WDN A;  5M5Y H;  1B9M A;  3I4O A;  2YU9 B;  2UXD Q;  2A19 A;  1EFW A;  2YTV A;  2K5H A;  2R92 B;  1V8Q A;  2MFI A;  2HD3 A;  2DJG C;  3SK6 A;  1EYC A;  2VUM G;  2NVT B;  1B3A A;  2F0T A;  3H0G B;  4LFA L;  1PFN A;  3K5N A;  4DR7 L;  3ULP A;  1PTO H;  4EQN A;  2CW0 D;  1D7Q A;  2BOS A;  5CV4 A;  4Y7N H;  1DOL A;  3K7U C;  1JOK A;  1A2T A;  1X3Q A;  2AUJ D;  4NXN L;  1KHI A;  1VQC A;  3RN5 A;  2B29 A;  3NEN A;  1FGB D;  4DNT B;  1STG A;  2L15 A;  4HJ9 A;  3H3V H;  1HA6 A;  1H9J A;  1FR3 A;  2BH8 A;  1WCM B;  1YZ6 A;  5FJ8 G;  4JV5 L;  1JOO A;  1LAC A;  3FRP B;  2NVX H;  5CMD A;  2C5C A;  3JAM L;  2EYP A;  1DOK A;  1WTR A;  2E2H H;  1OO9 B;  1QCB D;  5K36 G;  4A3J H;  2ZXO A;  3HGB A;  3OYY A;  2QDB A;  1EL0 A;  1VQJ A;  2KCT A;  1XX8 A;  3M4O H;  4R1J A;  5CV7 A;  1B4O A;  1A2U A;  1HNZ Q;  4R4Q A;  4R9W A;  3KLS A;  4XXE A;  1RDP D;  4IO9 A;  1V9P A;  1O78 A;  1LYL A;  1B3Q A;  1KLU D;  3NWS A;  5LMN Q;  1HRJ A;  3K0Y A;  1EU4 A;  2TMP A;  1E1T A;  4RCN A;  4DR6 L;  4A76 A;  4CJ0 B;  2GN5 A;  1WTH A;  3OMG A;  4GZY C;  3HOW B;  4NMZ A;  1B9N A;  3ERO A;  4LAA A;  1S5F D;  1DXM A;  3NEL A;  4DAY A;  4RA8 A;  1XTD A;  5FO8 B;  3MC0 B;  4LF6 Q;  4IN3 A;  5IGG A;  4X62 Q;  1XMQ L;  2B2Y A;  1BXT A;  4WRD A;  1STN A;  4KHP Q;  1YHA A;  2Q2H A;  1TXY A;  4JBW A;  4J8Q A;  4GNX A;  4EQO A;  1OXU A;  4DR4 L;  5E3F A;  1GM5 A;  3J81 i;  1R9T B;  1QNU A;  3OW2 A;  2DNE A;  2Q2T A;  1EY6 A;  1STE A;  4LF9 Q;  3CQZ H;  4WJ3 M;  1IYU A;  4KLK A;  1L0X B;  1YNJ C;  3CCE A;  2N55 A;  4JI4 Q;  1KQS A;  2UU9 Q;  1TU2 B;  2DGY A;  4K0K L;  2GVA A;  2F0F A;  2A73 B;  4C3J H;  1TWH H;  3T16 A;  2B2W A;  2MGS A;  5EKL A;  2RSO A;  1S5C D;  4OWT B;  5C5L A;  4P74 A;  1RKN A;  1WTV A;  5E1F A;  2IX0 A;  2OQ0 A;  5D65 A;  2UXB Q;  4O2D A;  5KEE A;  1TWC H;  2TSS A;  4QMG A;  4KJO A;  1G6Z A;  1CKM A;  1MSH A;  2B2Y C;  3G7L A;  3O13 A;  4IAL A;  1SDF A;  2UUB L;  1FJG Q;  2G5D A;  3H0G H;  2D2C C;  2JA6 H;  2B2T A;  1EIG A;  2DNC A;  1AZQ A;  5IYC H;  3QJY A;  1VQP A;  4N9P A;  1KDB A;  1VQB A;  2EJG C;  3K7A B;  1BCP F;  2RKS A;  2JA5 H;  3QR8 A;  1O80 A;  1WTX A;  4POG A;  5HGQ A;  4C2M H;  2LMC B;  4A4I A;  3UDG A;  3RLN A;  1NJI C;  3PO2 H;  4DR1 L;  5FO9 B;  5ELB A;  1VQ7 A;  4IFD H;  1PRT F;  4UPA A;  2B63 B;  5BN3 A;  4MNO A;  3T1Y Q;  3RZO H;  3CPW A;  1JOQ A;  2HIX A;  4K6D A;  4DV1 L;  3WWV A;  2FJ2 A;  5IYB H;  5AJ3 Q;  4A3L G;  1SNC A;  2NVY B;  3H0G G;  1W3S A;  4A3D B;  3P1H A;  3S2H H;  1L1O C;  1HFG A;  2VB2 X;  1Y1W B;  1HNW Q;  4BY1 B;  3ICE A;  1HHV A;  2KVM A;  3BVM A;  2ES2 A;  1HCZ A;  4A3E G;  1V43 A;  4RHS A;  4JBK A;  3I72 A;  2IPK D;  1VQ9 A;  4L5S A;  1PH1 A;  3P75 A;  4JI1 Q;  3TS0 A;  1G2S A;  1HTL D;  3KF8 A;  3MXN B;  2JP1 A;  2Y0S G;  3ITP A;  1PLF A;  4Q5V A;  1U0L A;  3D4D A;  1UE1 A;  1WD0 A;  3S16 B;  4IUT A;  1D5X C;  3M4Y A;  4YWL A;  1CKN A;  4JC0 A;  4DFA A;  2B63 H;  1H9K A;  4JI8 L;  3F1Z A;  2WFW A;  4L8J A;  2JA9 A;  2CWP A;  2XGT A;  3A7L A;  2ENB A;  2WB1 E;  3CP0 A;  3HP3 A;  3RLF A;  4UP7 A;  2UUC Q;  3QO2 A;  4C3H G;  2XWB B;  4LF7 Q;  4DXG A;  1B8A A;  4TKO B;  3A55 A;  3PUX A;  4JW0 A;  4X6A H;  2PI2 E;  1DM0 B;  4FXK C;  2UUA L;  1HNW L;  1GUN A;  2RHS B;  2M2L A;  3JAM i;  4DR3 Q;  4A3G B;  3M7G A;  4WJW A;  1TY0 A;  2XIW A;  3T13 A;  3UDF A;  3SK5 A;  3A7A B;  3MFY A;  1L0W A;  1OXV A;  1DJR D;  1N9W A;  2R92 G;  1B50 A;  1K8O A;  4QL5 A;  1TS5 A;  4Q0F A;  1GOZ A;  3TZD A;  4UP9 A;  3C1E A;  3G4S A;  4C3J G;  3CCV A;  5DM7 3;  2JA7 G;  4KD4 A;  2WIN B;  4DR1 Q;  4KHV A;  2NTS A;  3PUY A;  2Q2U A;  3PO3 B;  1PZJ D;  1KAA A;  1KC8 C;  4LNQ A;  3CKI B;  1IYJ B;  4HED A;  4L5R C;  3NQT A;  3H15 A;  2UXB L;  4C3J B;  4QGU A;  1TWF H;  1VQ8 A;  1I3Q H;  2F0G A;  1LLR D;  3MWY W;  3HOY H;  2XWJ B;  1MKH A;  1A3T A;  4DV3 L;  4DU9 A;  4JI3 Q;  5KYI A;  1XYI A;  1ILQ A;  1Y14 B;  4DR7 Q;  4KY7 A;  2F0K A;  4OO1 H;  1I94 Q;  2EYM A;  5F2D A;  2E2J H;  2D0O A;  1O7I A;  2ICE C;  4OXP A;  3TN2 A;  3DEO A;  4C56 C;  2QA4 A;  5E7N A;  4RGT A;  4KI0 A;  2JA6 G;  2MNA A;  1JT8 A;  2IW3 A;  1GVP A;  1D6E C;  4A3M H;  2F52 A;  1SYB A;  3I4L A;  1C0A A;  4B9X A;  3ER0 A;  3HG9 A;  4BBS B;  4DV0 L;  5C5M A;  5IWA Q;  1N33 L;  4B3S L;  2CFM A;  2EJF C;  5GAH C;  5C3E B;  4HIK A;  4A3G G;  2D9U A;  3J80 E;  1S5B D;  1Q90 A;  2NN6 H;  2F0J A;  4BBR G;  1FNW A;  4JI4 L;  3JAM c;  3RR5 A;  5J1Z A;  2OTL A;  3S2H B;  1CKN B;  4GNX B;  3CPF A;  5CBE E;  2B2U A;  3D4R A;  3C3L A;  2G9D A;  4OO1 I;  1D2B A;  4ZLT F;  1PHJ A;  2QEJ C;  1KAB A;  1PTO B;  4QUC A;  2PQE A;  1UEA B;  2R7D A;  2ATW A;  1HPC A;  1EYA A;  1W6K A;  3TBI B;  1BO0 A;  2EE1 A;  4HJA A;  1Q1E A;  4AYB B;  4TSS A;  1PTO C;  4HN7 A;  5BR8 Q;  1ZKO A;  4A3F H;  2A69 D;  1GJX A;  1RF2 D;  3K5M A;  1HJP A;  4OEL B;  2F0H A;  4Z9C B;  1UUP A;  3SK8 A;  2VS1 A;  5DM6 3;  1YJN A;  3D0F A;  1PTO F;  3CMA A;  1PFM A;  4DV2 Q;  1EFI D;  4PMB A;  3J80 c;  2B63 G;  3U9O A;  3PCO B;  2KHJ A;  4RKB A;  1QIL A;  5KNB A;  2VQE L;  1RD9 D;  2NTT A;  4BY1 H;  1KDA A;  3R2T A;  5IP7 H;  3H3V I;  2BDO A;  3S15 H;  1VF7 A;  1EWC A;  2BDN A;  3I7F A;  2R93 B;  1V1P B;  3PIO 3;  1LT3 D;  5FLM G;  3A56 A;  2BCO A;  4B3M L;  2DJF C;  4JVZ A;  1YHB A;  2B3G A;  5M3M H;  3HOU B;  1SFO H;  3RZD H;  2RDF A;  3F2B A;  2D5D A;  4LUZ A;  3T1H Q;  5LL6 S;  1XPU A;  3AYH B;  1Q81 C;  4ME3 A;  1UNS A;  5C0X J;  1YNN C;  1UE5 A;  2ZT9 C;  5M5W H;  1UE7 A;  4X64 L;  3NSW A;  4AYB E;  3A0J A;  4JI5 L;  3OMC A;  4A3B B;  4LF4 Q;  4WOR A;  3NP8 A;  2F0E A;  4LUO A;  2WV6 D;  3CXC A;  3K6O A;  3SK4 A;  1PH4 A;  2RSN A;  4FP5 D;  5FO7 B;  4DK1 A;  4JI6 Q;  1J5E Q;  5C0X I;  3C1F A;  2CCZ A;  3TRE A;  2JSO A;  1Z6H A;  3D8G A;  1S4Z A;  4LWC A;  3MEF A;  4FXG C;  2JA7 H;  1H95 A;  1EY8 A;  3SEB A;  4DV4 Q;  4DV0 Q;  3PIO A;  5IE8 A;  3H94 A;  2QF7 A;  1E22 A;  1QVC A;  3AQQ A;  1JJC B;  3DEP A;  3MVV A;  4XT3 B;  4HSP A;  3V2T A;  3BZC A;  4GKK Q;  1HH2 P;  2I5M X;  4PV1 C;  2CH4 A;  4YHH L;  5C44 G;  4L63 B;  1X9N A;  1CZW A;  1B53 A;  2K5N A;  1YHQ A;  4X66 Q;  2XNA C;  4FO2 A;  1QE6 A;  1D1I A;  4A3L H;  4FYD A;  4JI0 Q;  1UAP A;  1Z7T A;  4KJN A;  2A68 D;  1GUO A;  2RBM A;  3BG3 A;  2A6H D;  3S9W A;  1NMF A;  2X6G A;  1NTG A;  1J5E L;  4FF3 A;  1QWY A;  1H9S B;  2K7V A;  4IUQ A;  3S1N H;  2EYL A;  5M5X B;  3GTQ H;  1Q8K A;  5ELF A;  4A3F B;  2N49 A;  1SMX A;  2HQE A;  1TS4 A;  1RCV D;  3KF6 A;  3GTG B;  1IXR A;  1QB5 D;  1VQM A;  4IQZ A;  2D0P A;  5ELN A;  1OXX K;  2AMC B;  1Q46 A;  2E2H B;  1DZ1 A;  3F2U A;  3HOW H;  2DUD A;  1X65 A;  1MJC A;  1W6J A;  3IFD A;  3M7N A;  3CW2 C;  3HOX B;  3D31 A;  4IZ8 A;  2K33 A;  2KEN A;  5C4H A;  2E76 C;  2O2L D;  4XQJ A;  1LT4 D;  4JBJ A;  3HS0 C;  3VR2 A;  2KCM A;  1KIX A;  1VQ5 A;  3I4M H;  3L7Z C;  2F4V Q;  2QDL A;  3ONA B;  3HOY G;  3NPP A;  1KNE A;  4N8X 1;  4IPD A;  2VXW A;  1PRT C;  5C0X G;  3AMU A;  1I5F A;  4KKS A;  1ZYR D;  3SHL A;  3DUZ A;  2QCP X;  1STH A;  3VYS A;  5C0X H;  1HUN A;  2MO0 A;  1X55 A;  1G29 1;  1ENA A;  3BDO A;  5C4X G;  1R4P B;  4U67 3;  2J4X A;  4K8I A;  4JOI C;  2R61 A;  4DN4 M;  1VQF A;  2AKW B;  1XPO A;  3S14 H;  5I6W A;  5EKK A;  2JK8 A;  4UY8 C;  2ICI A;  2JE6 I;  4ABN A;  1N36 L;  3E9H A;  3AB9 A;  2EQS A;  2KJX A;  3PV0 A;  4K14 A;  1KXL A;  2VB3 X;  2ZJP A;  4EX5 A;  5IT9 E;  3EFX D;  1NCV A;  3TP6 A;  5M3F G;  1JE5 A;  1FGU A;  2L4N A;  3CC7 A;  4IUN A;  4BBS H;  1N34 L;  4J1M A;  1Y1V G;  4R8N A;  5BN5 A;  4N8F A;  3KK7 A;  2F4I A;  2SNS A;  3CRK C;  1K73 C;  4LF6 L;  5AFW A;  5ELO A;  3DWQ A;  2F0W A;  4JI1 L;  1EY7 A;  5C6A A;  3I90 A;  1CT1 D;  1NSN S;  2ZTC A;  1CHP D;  3H91 A;  5JEA G;  1M4V A;  5C4X B;  2V1C C;  2DN8 A;  3I4M B;  3S1Q H;  2ALY B;  4S3S A;  1SE4 A;  4DV6 L;  3OW7 A;  4QUF A;  1VQO A;  3MAQ A;  4YIJ A;  2K03 A;  2MUY A;  1Y1W H;  1S72 A;  3U58 A;  1A3U A;  2BA0 A;  1EZ6 A;  1XNQ Q;  1MHW C;  3LGJ A;  3OWF A;  3E9I A;  2KOL A;  4TQU S;  1HZB A;  4HID A;  3MEH A;  1TWG H;  1ROD A;  3RLO A;  5LMN W;  4QIW E;  2K6A A;  2N88 A;  3ERS X;  5JJI A;  2Y0S E;  3J81 L;  3UE1 A;  4HCE A;  4H0L C;  4RFB A;  1PFB A;  4DR5 Q;  3X3N A;  2K14 A;  4GS3 A;  1I4X A;  4KN4 C;  5IP7 G;  1JCK B;  3HOW G;  2Q8I B;  4RAU C;  4F88 A;  1VQI A;  3S2D B;  3ND9 A;  4G7O C;  4G4K A;  4KY5 A;  4LFB L;  4KMU C;  1BDO A;  5AJ3 L;  4B9W A;  2F4V L;  2IHF A;  1G51 A;  1PDQ A;  1PFS A;  2N78 A;  3PIP A;  4GN3 B;  1QVF A;  1FJG L;  1TT2 A;  4K5X A;  3GTL H;  5DAU A;  5C4Z A;  4ILW A;  4A3F G;  4C1N K;  3L0O A;  4RHR A;  1XMO Q;  2OEO A;  3U50 C;  5FLX E;  2CVR A;  2F0P A;  1VCI A;  3VR3 A;  3KBG A;  3E5S A;  1SLJ A;  3G71 A;  4X3T A;  2XSC A;  3N6R A;  2K5Q A;  2RCN A;  3C46 A;  3NEM A;  1ENF A;  4HIO A;  2K5V A;  4DNR B;  1PYS B;  4DR5 L;  5GAE C;  1HR0 L;  3LWE A;  1TWC B;  1YJ9 A;  4HJ7 A;  3FP9 A;  1V1Q A;  3WOF A;  4OIK A;  2R7Z G;  3MXN A;  2IY5 B;  3A8I E;  5T1I A;  1NBW A;  2PPB C;  2Z4H A;  2JA8 H;  2HIV A;  1XNQ L;  5C44 B;  3ULL A;  1E2Z A;  2Y0S B;  2VZA A;  4IUU A;  1HR0 Q;  1N32 L;  1WOC A;  2V4D A;  4OON A;  1F9Q A;  5A2Q E;  3T1H L;  5JVH 3;  1CSQ A;  2UUB Q;  1VQ6 A;  1LTT D;  4KD3 A;  2HCC A;  1I6V C;  1KRT A;  4A3K B;  4PZ8 A;  2MO1 A;  3KJO A;  2O5J C;  3FHW A;  3KLW A;  1NY4 A;  1TWA B;  3Q0A A;  3B6Y A;  2B2T C;  3GTJ B;  5IGC A;  4KKU A;  5CV5 A;  5EBC A;  1MJE A;  3STB C;  4PZ6 A;  4A93 H;  1SBB B;  1T9H A;  3ULJ A;  4DNI A;  4CDF C;  4ZRZ A;  1PH3 A;  1Y8N B;  4L5Q A;  3CCQ A;  2LXJ A;  3VDY A;  2VQF Q;  2WAQ E;  2RF4 A;  5C3E G;  3OSO A;  4A3M G;  4IJH A;  1EYG A;  2WII B;  4OWX B;  3S1Q B;  5EPL A;  3HOX G;  3LX0 A;  3KJP A;  2ZJQ A;  2X6L A;  1K83 B;  5GQO A;  1MD2 D;  4APV A;  5C3E H;  1A63 A;  3T56 B;  5FLX L;  1CUK A;  2OXP A;  2VL6 A;  3TP7 A;  4KKT A;  1QUQ A;  4GKJ Q;  5J3B A;  2IX3 A;  3H3V C;  1CA5 A;  2EJM A;  4QY7 A;  5FLM H;  5DNF A;  5HUR A;  2QIL A;  3I70 A;  2KUM A;  1WD1 A;  5D3D A;  4YWM A;  3KOJ A;  4E6I A;  3FMC A;  4DK0 A;  4PQX A;  4OX9 Q;  1AN8 A;  4JCV E;  3R2I A;  3G48 A;  1BBX C;  1IL2 A;  1VF5 C;  1H9M A;  1VQH A;  1MGS A;  2QKI C;  2O4X A;  5JVG 3;  2F0M A;  4K2L A;  4DA2 A;  5I4D A;  3FDT A;  1B7Y B;  3OPO A;  1EQQ A;  2LSS A;  4EQP A;  2XVS A;  1A3V A;  4CDE C;  1K3R A;  4B3M Q;  2L5T A;  3FKI B;  4ZYS A;  4GNX C;  4F87 A;  3Q22 A;  1DYQ A;  4LMQ D;  3HRZ C;  1TWA H;  4GLV B;  4BBS G;  1JB3 A;  5EPJ A;  5EQ0 A;  2VUM B;  4HTH A;  4UAI A;  3NUC A;  2BE5 C;  4DAM A;  5M3M G;  2ZTE A;  3M4Q A;  3K0X A;  5I9O A;  4JV5 Q;  3NBI A;  3HKZ B;  3PF4 A;  2GA4 B;  5CC4 A;  4BXX G;  2OCE A;  2JA6 B;  1D8L A;  3J7A V;  4DR2 Q;  4BY7 G;  4LJZ C;  2KHI A;  5ELD A;  4CJ1 B;  3MHB A;  3DM1 A;  1SND A;  1Q82 C;  2PMZ B;  5C44 H;  4AH6 A;  1O7Y A;  1WJJ A;  1WI5 A;  2WKC A;  2ASB A;  5JJZ A;  3GV3 A;  1QUQ B;  1JIC A;  3HOV H;  1VQA A;  4A3E B;  4HSV A;  2WB1 G;  4MIU A;  4X3U A;  2QEX A;  4DUZ L;  4YCV A;  2LKV A;  3GTM B;  1SNM A;  4RWS C;  3TSS A;  2EY6 A;  1F9P A;  2MP1 A;  1VS0 A;  1K0R A;  2PNH A;  5CV8 A;  1W2B A;  1N8R C;  3I3C A;  4X3K A;  1S5D D;  2WAC A;  2R92 H;  4X3S A;  2Z1C A;  1OTC A;  4J15 A;  4DV7 Q;  3STB D;  4DV6 Q;  2KBN A;  3Q8D A;  3P7J A;  3D4W A;  1I4P A;  3CCS A;  5FK9 C;  4RCO A;  4ME5 A;  2DY7 A;  3FVQ A;  3Q24 A;  2F3I A;  1X3E A;  5KIX A;  1PZK D;  1S3O A;  1KTK A;  2F0O A;  2A69 C;  1NE3 A;  4RGN A;  3AFQ A;  3BYT B;  3RN2 A;  1EWH A;  4C3I H;  1SMY C;  4QF4 A;  4OO1 G;  3I4N B;  4ODG A;  2R93 G;  4DAV A;  4AIM A;  3VYU A;  4B3T L;  3H09 A;  3OWE B;  4LFC Q;  4LF7 L;  3BVZ A;  3K57 A;  2Q8R E;  1BKB A;  2B2V C;  1HQR D;  2LXK A;  4F7X A;  3IAY A;  2SEB D;  4DR4 Q;  5EBD A;  3PQI A;  5E4W C;  3DWA A;  1PH6 A;  3PUZ A;  4DV1 Q;  1JMC A;  1G8Z D;  1AFP A;  3S17 H;  3K8A A;  1Y1V B;  2B8F A;  4K5W A;  2Z6K A;  1IBL L;  3BDC A;  1TS3 A;  2C35 B;  4A3E H;  5KND A;  2K5W A;  2E2I H;  3GTP B;  2F0V A;  4OL7 A;  1GHJ A;  4A3C G;  3W1G A;  1BF4 A;  4C3H H;  1XNR L;  2I5H A;  2R7Z H;  4IUR A;  4DV7 L;  1JQY D;  2GVB A;  1M90 C;  1LT6 D;  1EEF D;  2F0N A;  1H9S A;  1K8M A;  1F9R A;  1PXU A;  3EA6 A;  2Q2I A;  1QG7 A;  4KHZ A;  2G9H D;  1JJ2 A;  3HEJ A;  3QOJ A;  4TVA B;  2OQK A;  4DKA C;  4LF5 Q;  1B70 B;  1CK1 A;  3PUW A;  4LF4 L;  2JN4 A;  1GUW A;  1YNJ D;  5EPK A;  4NW2 A;  1STB A;  2IWH A;  1F77 A;  2F0Q A;  1Q7Y C;  4ZAI A;  1SYC A;  1L1O B;  2Z4I A;  1U4L A;  4JG2 A;  1X32 A;  1OXS C;  4CKE A;  2H4O A;  3E0J A;  3K5L A;  2F1M A;  1GXD C;  3KUP A;  5JPN C;  2KQ3 A;  4RGO S;  1SAP A;  4H02 A;  3PGZ A;  4O0A A;  3R3O A;  1BNZ A;  2OF1 A;  1NR4 A;  1EY4 A;  3CAM A;  1D1K A;  3I4N G;  2FMC A;  1G2T A;  2PYK A;  2KED A;  4I7Z C;  2E2J B;  3QB3 A;  4A3B G;  3NTI A;  3PMF A;  1AW7 A;  5CYU A;  4R8I A;  4JK1 C;  1WCM G;  3MA2 B;  2ZTD A;  1N34 Q;  1CZG A;  3KYH C;  1K8G A;  1HZ9 A;  1T5E A;  1MI2 A;  2VY3 A;  1E2W A;  3I8Z A;  4PMC A;  1EY9 A;  1K9M C;  1X6O A;  2Z6B A;  2Z6K C;  1VQ4 A;  4IOA A;  4BBR H;  2I46 A;  2C9O A;  2Z8L A;  5IGD A;  4A3K H;  1IBK Q;  1IW7 D;  4I65 A;  2K4K A;  3LNN A;  1ILP A;  2IHE A;  4GOP A;  4BWG B;  4C1N I;  4IPG A;  1YJW A;  5K5P A;  4I7A A;  1VQE A;  3CF5 A;  4KY6 A;  1ML0 D;  2IL8 A;  3A5U A;  5GAD C;  5IP9 G;  4FF2 A;  3BYY B;  3F8T A;  2UUA Q;  4L6T B;  2WP8 J;  1CI3 M;  4KHP L;  1I4R A;  2JJQ A;  2NWG A;  5D3I B;  3FPP A;  3GP7 A;  2CKZ B;  2IX1 A;  1SYG A;  4A3J G;  5M3M B;  3HOU H;  5L37 A;  4POF A;  4F8M A;  3PO3 H;  3T51 B;  3TP8 A;  2B2V A;  4UDU C;  1LTR D;  3C2P A;  4JI8 Q;  3HOX H;  4A93 B;  1A8V A;  1SRU A;  1DOM A;  3J80 i;  4MN3 A;  3P20 A;  5EKI A;  3HOV G;  3KDF B;  3S15 B;  2N3S A;  2K50 A;  1QZH A;  5JJL A;  5EJW A;  1RIP A;  3HOZ G;  2JA7 B;  2M00 A;  2F0I A;  4JOI A;  4BA2 I;  3GTQ B;  1KLG D;  2E2D C;  2L55 A;  3TME A;  3DHQ A;  3NHH A;  3M9B A;  4FVM A;  5M9O A;  4DR6 Q;  4FNF A;  2XTI A;  2F0D A;  1YI2 A;  2MPM A;  4FF1 A;  1Y1V H;  2KCN A;  4ZQ3 A;  1DGS A;  1JWS D;  4DV5 Q;  4K0K Q;  1EUJ A;  3HKZ G;  4QIW B;  3CCR A;  1S5E D;  4R4T A;  3BS1 A;  1O7L A;  4RMF A;  4NXN Q;  1Z9F A;  1Q1B A;  5A2Q L;  4QQB X;  5C3W A;  3S1M H;  1Q86 C;  2PZT A;  1TS2 A;  2E5L Q;  4JI2 L;  1A62 A;  2NVY H;  1KD1 C;  4DAP A;  3L3O C;  4MHE A;  4MTN A;  3GDE A;  4J6H A;  4OIJ A;  4XQQ A;  5IT9 c;  3PIP 3;  1QJO A;  4NXM L;  4A93 G;  1EQV A;  5TSS A;  1R4Q B;  2Z0S A;  4IFD I;  2PQA B;  1BCP B;  3NE5 B;  1PYW D;  1J8I A;  4LUV A;  1GKH A;  1DON A;  5FKA C;  1IBM L;  1F2M A;  3J81 j;  1I50 H;  3X3M A;  3MXP A;  2AWN A;  1SXT A;  2L9H A;  2FXQ A;  1K0S A;  1EZ8 A;  1TWH B;  4ID6 A;  1YEZ A;  4A3B H;  1CFM A;  1Y8P B;  2YV5 A;  3J81 c;  4U68 A;  1ESR A;  1IBM Q;  1STY A;  2VUM H;  5JEA H;  4GKJ L;  2KCC A;  3GTK H;  3VYR A;  2JA5 G;  4XYO A;  4LFB Q;  2LS0 1;  4A3K G;  2RVL A;  5G3L F;  1SE2 A;  4DV3 Q;  1KL9 A;  4YCU A;  4RH6 A;  4BY7 B;  1PH8 A;  1XTC D;  1QNK A;  3OOC A;  3EBE A;  1TR5 A;  2K28 A;  3QOL A;  2PZW A;  2L11 A;  4ZUI A;  3I73 A;  5C4J B;  2UXD L;  3M4P A;  2BE5 D;  1EU3 A;  4C3H B;  1B2T A;  1BCP D;  3DM3 A;  4NB3 A;  4P2C B;  2WB1 B;  2RCF A;  2B8G A;  2M9V A;  3M4O B;  1EY0 A;  1NMG A;  1YIT A;  5DEH A;  1Y1W G;  3VA7 A;  1XNR Q;  5G3L D;  4UHV A;  4B3S Q;  1FD7 D;  1LTB D;  5C3X A;  1SYD A;  5T1G A;  5KRU A;  5IWA L;  3NK9 A;  2CH4 W;  1V1P A;  2EYJ A;  4C3I G;  2EY1 A;  4YHH Q;  4G7H C;  4A3C H;  1X3P A;  3F2C A;  1X3G A;  2I5L X;  3D6W A;  3HOZ H;  2PW5 A;  1D5M C;  2AHO B;  1SSO A;  5IGB A;  4NP5 A;  4PMW A;  2HQL A;  4A3J B;  5I2X A;  4FDB A;  2J0T D;  2ZM6 Q;  2LFN A;  3SR1 A;  2R7F A;  3URY A;  3GTJ H;  1C9O A;  2ZJR A;  3BVG A;  1XMO L;  1I3Q B;  1U5K A;  3DMU A;  3EJI A;  1M1K C;  4XYQ A;  1K28 A;  2PNR C;  2EYO A;  2EXD A;  4DK3 C;  3NQI A;  3S1R B;  5JEA J;  2EZV A;  1LAB A;  1Q12 A;  3BZK A;  4O1N A;  4YY3 L;  4HJ5 A;  1JJG A;  1SRO A;  3MTS A;  1VDZ A;  2XRS D;  1RHP A;  4KV6 A;  3CRL C;  3IL8 A;  2WAQ B;  1PH7 A;  1YBY A;  1I4H A;  4DR3 L;  2K01 A;  2JXM B;  1AEX A;  4K2K A;  1B44 D;  1IW7 C;  3VR5 A;  2HUG A;  3TQY A;  2RDG A;  2MQH A;  2VW9 A;  3N52 A;  2I07 B;  2JYO A;  2VQF L;  1C48 A;  4H7B A;  2CW0 C;  3RZO B;  4NDX A;  3KF6 B;  3Q23 A;  4IJL A;  3QWN A;  1TII D;  1I6H H;  3RMH A;  3RNU A;  1C7Y A;  5EGT A;  1V1O A;  2Z9H A;  1BQQ T;  2R7Z B;  4A3D H;  4H13 C;  4IFD J;  2JQO A;  4CHT B;  2F03 A;  5I9P A;  1VQL A;  3V05 A;  1QZG A;  3M3Y B;  3K59 A;  1EIF A;  3T1Y L;  1PA6 A;  1E2V A;  3OHX C;  3VYT A;  5IGE A;  4P75 A;  1FNU A;  2A5H A;  4A3G H;  1IBL Q;  3CU7 A;  1PYB A;  4B08 A;  4LF8 L;  1MSG A;  2HHH Q;  1TY2 A;  4A3I G;  2K52 A;  4V0B A;  3GTL B;  1HNX Q;  2NZO A;  2IT1 A;  3HFZ B;  1PTO D;  3K80 C;  1JWM D;  1JC7 A;  4NPS A;  4C2M B;  3CCJ A;  4KN7 C;  5GRO A;  2F0L A;  1XJV A;  1QVG A;  1U4P A;  3CME A;  1I6H B;  5IYB G;  4DUY L;  4ZCK A;  1MBY A;  1RL2 A;  3BDL A;  2HHH L;  1YNN D;  5ISR A;  3K58 A;  4JYA Q;  2RQX A;  1GD7 A;  3M3Y H;  1KAW A;  3PUV A;  2WAQ G;  5IP9 H;  4IFD G;  1A15 A;  1QOH A;  1SJE D;  2PZU A;  1L0Y B;  5LL6 X;  4CKC A;  1WTQ A;  1ZYR C;  1LTL A;  3HKS A;  4P71 A;  4X66 L;  4CBV A;  3NTH A;  1CQF A;  2AUK A;  1MIU A;  1YVC A;  2NVQ H;  1EYD A;  2NBF A;  3KLS X;  2ID0 A;  3SXH A;  1PRT B;  3CC4 A;  2UU9 L;  4GN5 A;  4JYA L;  3HOV B;  1HNZ L;  4M8A A;  4H44 C;  1KNA A;  3IFT A;  1P8L A;  3UE0 A;  3UDX A;  2UXC L;  1WTO A;  1HUM A;  1SYF A;  2B2U C;  4DV4 L;  1S40 A;  3KF8 B;  2FMM A;  4M1U B;  5COR A;  2F3V A;  2E8G A;  1X56 A;  4ZK9 B;  2R6G A;  2NYZ D;  3TZU A;  3SE0 A;  4A75 A;  3A8K E;  3SVM A;  5IGF A;  1ZXT A;  1H9R A;  2HCI A;  3S14 B;  3ZYY X;  3CC2 A;  3HOU G;  4DUZ Q;  1RJT A;  5IIF A;  4X62 L;  1XMQ Q;  1IKL A;  2SOB A;  4CDC C;  3ERQ A;  1F2Z A;  1T5X D;  3V96 A;  1HTP A;  3W3A A;  2Q8T A;  5J22 A;  1PH5 A;  1BR9 A;  3D6C A;  3RUZ A;  1BOS A;  4JI7 Q;  5M3F H;  2N8N A;  2R3Z A;  2L1B A;  1GUG A;  1SFO B;  4A3D G;  4OGQ C;  1SNP A;  5CV9 A;  3A8J E;  4OHJ A;  1IHZ A;  3OTO Q;  1SEB D;  2NN6 G;  2CQA A;  3BU2 A;  1TQO A;  2QW7 A;  4K8J A;  3MZ5 A;  3TEH B;  1FNV A;  3S24 A;  1CKO A;  3ZJY C;  4AQY L;  2NZH A;  4HIM A;  1EOT A;  3A5Z B;  2EOT A;  1Q8I A;  2MHV A;  2EY5 A;  3KLR A;  3PF5 A;  4ZUJ A;  1J6Q A;  1X54 A;  1F9S A;  3L9A X;  5CBA E;  5DLQ E;  4L5T A;  3RD4 A;  3GD7 A;  2BH2 A;  5M5X H;  4K5V A;  2VQE Q;  5LMN L;  4EVO A;  3HOZ B;  3LWU A;  5JJK A;  5D14 A;  2OT2 A;  3I91 A;  1II3 A;  1BBU A;  1VQK A;  4FF4 A;  2JEA I;  2E74 C;  5M3F B;  1CSP A;  4GKK L;  5LMU L;  1BCP C;  5K36 H;  5KNC A;  5COY A;  1Y69 U;  2K5D A;  1K8A C;  4LF9 L;  5C4J H;  2NUC A;  5E4X A;  4ZKB B;  5IYD G;  3G6J B;  3F2D A;  1G6P A;  4HMI A;  4CGY B;  1AE2 A;  4KK7 A;  1STA A;  3U4Z A;  3TS2 A;  2A74 C;  1F2Y A;  4P72 A;  1TVX A;  5FJ8 H;  5KGU A;  4FXD A;  4GN4 B;  5J39 A;  2ZXR A;  2EYH A;  3NBH B;  1CM9 A;  5CGK A;  1EEI D;  1SMY D;  2CWA A;  2X69 A;  3GO5 A;  4IUV A;  4DK6 C;  4ULL A;  3M85 A;  1M8A A;  3BJU A;  2KEC A;  4DR2 L;  4YWK A;  4DPG A;  1D5Z C;  1ONL A;  1JOR A;  3W2D A;  1WFQ A;  2A68 C;  3VR4 A;  1C4Q A;  1I4Q A;  2NN6 I;  1HZC A;  4A3I B;  3KDF A;  5HY6 A;  2RHQ B;  3AFP A;  1PMR A;  4HMJ A;  4OX9 L;  1WTP A;  1I50 B;  1PV4 A;  3PO2 B;  2IJ0 A;  2L0C A;  2HDM A;  5GAG C;  2K1B A;  2YTX A;  1VQG A;  1A0I A;  1CTM A;  1P16 A;  4NXM Q;  1GO3 E;  4AQY Q;  1X3F A;  3AEV A;  3A54 A;  4XTC S;  1TWF B;  3HOY B;  4X64 Q;  3K81 C;  3J80 L;  1Q3L A;  2DY8 A;  4DF7 A;  4OWW B;  3BZD B;  1C8C A;  4Y52 H;  2P5Z X;  3GTK B;  3AU7 A;  2E75 C;  3K7A H;  2XRQ D;  2JA5 B;  1GUS A;  1VQD A;  2K04 A;  3GQB A;  3E6Z X;  3EVQ A;  4DUY Q;  5IOC A;  1LM0 A;  1SJH D;  1E0B A;  1FYC A;  1EWI A;  1GHK A;  2A6E D;  1PZI D;  5EAY A;  2A6E C;  4PNY A;  1I4G A;  4DV5 L;  3S17 B;  4GOP B;  4LF5 L;  3IKJ A;  2RA4 A;  1PVO A;  1YIJ A;  4CDD C;  1NAP A;  1AE3 A;  3GTO H;  3S16 H;  4GOP C;  1UE6 A;  3I4N H;  3S2D H;  1LTG D;  2WKD A;  5LHY 1;  3W1B A;  4JI2 Q;  3KBX A;  2E5L L;  2JA8 G;  1VMP A;  1CQV A;  3D3R A;  2QGQ A;  1ICF B;  3K5O A;  1PRT D;  3MXG A;  3J7Z C;  2JA8 B;  3HZX A;  3FKI G;  4IUP A;  2I0Q A;  3RZD B;  1KDC A;  2HT1 A;  3R93 A;  5LMU Q;  5BR8 L;  4LK1 C;  4MZ9 A;  4N9T A;  2B2W C;  1EIY B;  4DGZ A;  1HA5 A;  3WOE A;  4EGV A;  1IL8 A;  3KFU A;  2H1E A;  1NNX A;  3CHB D;  5IYD H;  1ICW A;  1NR2 A;  3E3X A;  4RGM A;  3NWT A;  4R4I A;  1EQR A;  2PW7 A;  3JAM E;  1WTW A;  1ASY A;  2MJ8 A;  4IOC A;  1N36 Q;  1L1O A;  2R93 H;  4GLA C;  3UDI A;  3QIA A;  4BA1 I;  3S1R H;  2AWO A;  2AQ1 B;  1PH9 A;  1U4M A;  4V19 0;  3DXJ C;  3CD6 A;  3OTO L;  1O7Z A;  2PQA A;  1UEB A;  3CQZ B;  1E24 A;  1IZ6 A;  1OXT A;  1N33 Q;  1R9T H;  2RDH A;  1XWE A;  2XN9 C;  4HCS A;  1FL0 A;  3H6M A;  3I56 A;  3EIV A;  2K05 A;  4HAE A;  1BBW A;  3NBH A;  4CKB A;  4ALP A;  1E3P A;  4QJF A;  4A3I H;  1LT5 D;  4G57 A;  1HQM C;  4B3T Q;  3HKZ E;  5FLX c;  5M5W B;  2EIF A;  4A3M B;  3NXW A;  1U9R A;  2J7Z A;  3CCU A;  4MTK A;  2EDG A;  2PI2 A;  1F2L A;  2HDL A;  2LY7 A;  3EN2 A;  1J9O A;  2SNM A;  1E7Z A;  2PCF B;  3FEW X;  5IY0 A;  2EVB A;  3T53 B;  1LTS D;  4JI3 L;  1SYE A;  4EQ5 A;  4NKL A;  1G91 A;  2CQO A;  3R8B A;  1ZEQ X;  1XXG A;  3EQL C;  4WJ4 A;  3I4M G;  3UI2 A;  1WVL A;  1IKM A;  3CCL A;  1JB7 A;  1LO5 D;  3IRB A;  5IOD A;  5A35 A;  2ZXP A;  1HZA A;  4JPB W;  2OTJ A;  5BN4 A;  1N32 Q;  2K32 A;  5FOB B;  1EY5 A;  2K75 A;  3NTK A;  1LTA D;  4BY7 H;  5IT9 L;  2EY2 A;  1LV9 A;  1E1O A;  1ET9 A;  4B3R Q;  2KEE A;  2O5I C;  2EPB A;  3L2P A;  2AQ3 B;  5I2Y A;  4X65 Q;  4OEM B;  4XIG S;  1IBK L;  3I55 A;  3Q6S A;  1EQT A;  3DLL A;  3ND8 A;  4LF8 Q;  1LUZ A;  2A1A A;  4PG3 A;  1DCZ A;  4R4C A;  1AH9 A;  2CHB D;  4XT1 B;  4TRD A;  2B39 A;  1SNO A;  3OIQ A;  4B3R L;  3G6E A;  1I94 L;  4IPH A;  4YY3 Q;  4R4O A;  2L12 A;  1XPR A;  3JC6 6;  4HJ8 A;  2UXC Q;  2YTY A;  2YYZ A;  3S1N B;  2A8V A;  2YU9 H;  4C3I B;  4JI0 L;  4BXX H;  5CV6 A;  1Y8O B;  1AZP A;  2KHS A;  2NVX B;  4G7Z C;  5M5Y B;  1L2F A;  2F0S A;  2F3W A;  5I6Y A;  2VNU D;  4BS9 A;  4RKL A;  4Y7N B;  1WCM H;  3QG1 A;  1HR0 W;  3U4V A;  1VQN A;  5CR3 A;  2F0U A;  2NVT H;  5KYL A;  3J81 E;  3J7Y W;  4RG1 A;  1RTN A;  2PMZ E;  3MXU A;  4JI7 L;  4DXF A;  5JPM C;  1K83 H;  1HFN A;  1SE8 A;  3VR6 A;  2NB0 A;  5H1S E;  3I2Z A;  1CHQ D;  4QB4 A;  2NVQ B;  3PSI A;  1BVS A;  5IYC G;  1CA6 A;  3GTG H;  3TRZ A;  2JEB I;  2FIN B;  2NZ1 D;  1HNX L;  4BY1 G;  4K6L A;  5JAV A;  3PO3 G;  3GTP H;  4AYB G;  2E2I B;  4KTA A;  1ENC A;  4ZKC B;  5JOB A;  3J7A 5;  3GTO B;  4O42 A;  2OWO A;  2A6H C;  1ET6 A;  2H5X A;  3TDQ A;  3S1M B;  3GTM H;  4IPC A;  2FFK B;  4LFC L;  4HR7 B;  2UUC L;  1DD2 A;  5C4X H;  2ZM6 L;  1NUC A;  4XDX A;  1K3B C;  3E0E A;  3T4A C;  3GV6 A;  4LFA Q;  3SGI A;  1SR3 A;  4JBM A;  3PO2 G;  3SDZ A;  4XQN A;  4UP8 A;  2EXZ A;  1WYD A;  1RTO A;  1IYV A;  3VA5 A;  1TKW B;  4PZ7 A;  1TWG B;  5HGT A;  3J7A F;  1GUT A;  1B1Z A;  5ELC A;  2SDF A;  1SE3 A;  1LTI D;  4CJ2 C;  4P73 A;  1VMC A;  1YNX A;  4QCL A;  1ASZ A; 
#chains in the Genus database with same CATH homology
 2JA7 H;  4C3I H;  4JI5 Q;  1H95 A;  1LTL A;  3HKS A;  4P71 A;  4X66 L;  4OO1 G;  4DV4 Q;  3A74 A;  3PIO A;  4DV0 Q;  5IE8 A;  1MIU A;  1YVC A;  2R93 G;  4AIM A;  1PH2 A;  2NVQ H;  1EOV A;  4B3T L;  1E22 A;  1QVC A;  2ID0 A;  1JJC B;  3AQQ A;  4DV2 L;  4JI6 L;  3CC4 A;  4LFC Q;  2UU9 L;  4GN5 A;  4JYA L;  4LF7 L;  2BA1 A;  1KRS A;  1SN8 A;  2D62 A;  1HNZ L;  1BKB A;  2LXK A;  3BZC A;  1FVI A;  4GKK Q;  1P8L A;  3W5O A;  1HH2 P;  2I5M X;  3UE0 A;  4X65 L;  5C44 G;  3UDX A;  4YHH L;  1X9N A;  4DR4 Q;  2UXC L;  2K5N A;  4DV4 L;  1S40 A;  1YHQ A;  4X66 Q;  3KF8 B;  4YCW A;  1PH6 A;  4LW1 A;  3PUZ A;  2E8G A;  1X56 A;  4A3L H;  2R6G A;  4DV1 Q;  4JI0 Q;  1JMC A;  1Z47 A;  4A75 A;  3CCM A;  3S17 H;  3K8A A;  1NMF A;  4DAY B;  3FKI H;  4GLX A;  1NTG A;  2Z6K A;  1J5E L;  3CC2 A;  1UWV A;  3HOU G;  5M5Y H;  4DUZ Q;  1IBL L;  4A3E H;  2C35 B;  3I4O A;  4X62 L;  1XMQ Q;  2UXD Q;  3S1N H;  2A19 A;  1EFW A;  2YTV A;  2K5H A;  3GTQ H;  1Q8K A;  2E2I H;  2MFI A;  2N49 A;  1SMX A;  1PH5 A;  4A3C G;  1ASZ A;  3W1G A;  4C3H H;  2VUM G;  4JI7 Q;  1XNR L;  2I5H A;  4LFA L;  5M3F H;  2R7Z H;  3KF6 A;  4DR7 L;  1IXR A;  3ULP A;  4DV7 L;  2N8N A;  2GVB A;  4A3D G;  1D7Q A;  1M90 C;  4Y7N H;  3K7U C;  1VQM A;  2D0P A;  5ELN A;  1OXX K;  2AMC B;  1Q46 A;  3OTO Q;  3HOW H;  2DUD A;  2Q2I A;  1X65 A;  1MJC A;  4KHZ A;  2NN6 G;  3M7N A;  3BU2 A;  3CW2 C;  4NXN L;  3TEH B;  1JJ2 A;  1KHI A;  3D31 A;  1VQC A;  4TVA B;  2OQK A;  4DKA C;  3RN5 A;  4LF5 Q;  2B29 A;  1B70 B;  3NEN A;  1CKO A;  2KEN A;  3S24 A;  3ZJY C;  3PUW A;  4AQY L;  4LF4 L;  2NZH A;  4HIM A;  2L15 A;  3A5Z B;  4HJ9 A;  3H3V H;  4JBJ A;  2BH8 A;  3PF5 A;  1YZ6 A;  5FJ8 G;  4JV5 L;  1Q7Y C;  1J6Q A;  1X54 A;  2KCM A;  1KIX A;  1EYG A;  1VQ5 A;  3L7Z C;  5DLQ E;  2F4V Q;  3I4M H;  4L5T A;  1L1O B;  3GD7 A;  2NVX H;  4JG2 A;  2BH2 A;  3HOY G;  1OXS C;  5M5X H;  4IPD A;  5C0X G;  1I5F A;  2VQE Q;  2E2H H;  5LMN L;  5K36 G;  5JJK A;  4A3J H;  3OYY A;  1BBU A;  1VQK A;  2JEA I;  4H02 A;  1VQJ A;  2MO0 A;  2KCT A;  1X55 A;  1CSP A;  1G29 1;  3PGZ A;  4O0A A;  4R1J A;  5LMU L;  3M4O H;  4GKK L;  3CAM A;  5C4X G;  1HNZ Q;  1K8A C;  4LF9 L;  5C4J H;  3I4N G;  4R4Q A;  5IYD G;  3F2D A;  1G6P A;  1AE2 A;  4IO9 A;  1V9P A;  4JOI C;  3U4Z A;  3TS2 A;  4A3B G;  4P72 A;  1VQF A;  2AKW B;  1LYL A;  5FJ8 H;  5LMN Q;  1XPO A;  3S14 H;  4GN4 B;  1E1T A;  1WCM G;  4DR6 L;  4A76 A;  2GN5 A;  2ZTD A;  1N34 Q;  2JK8 A;  3KYH C;  1HZ9 A;  3NBH B;  1K8G A;  4UY8 C;  2VY3 A;  2JE6 I;  1N36 L;  3E9H A;  3NEL A;  4LWC A;  1K9M C;  2EQS A;  1X6O A;  1XTD A;  3PV0 A;  1KXL A;  2Z6K C;  2ZJP A;  2CWA A;  4EX5 A;  1VQ4 A;  3GO5 A;  4DK6 C;  4IOA A;  4BBR H;  3M85 A;  4LF6 Q;  3BJU A;  5M3F G;  4DR2 L;  4X62 Q;  1XMQ L;  4YWK A;  4A3K H;  4DPG A;  1IBK Q;  1JE5 A;  1FGU A;  2K4K A;  4KHP Q;  1YHA A;  3CC7 A;  1WFQ A;  4BBS H;  2IHE A;  2Q2H A;  1N34 L;  1Y1V G;  1TXY A;  1HZC A;  2NN6 I;  4JBW A;  4GOP A;  4IPG A;  3KDF A;  5HY6 A;  2RHQ B;  4GNX A;  1YJW A;  1OXU A;  3AFP A;  4DR4 L;  1GM5 A;  1VQE A;  3CF5 A;  4OX9 L;  3J81 i;  3A5U A;  1PV4 A;  3OW2 A;  5GAD C;  1K73 C;  4LF6 L;  2Q2T A;  5IP9 G;  4LF9 Q;  3CQZ H;  5GAG C;  4WJ3 M;  5ELO A;  3F8T A;  4KLK A;  2YTX A;  4JI1 L;  1VQG A;  2UUA Q;  1A0I A;  4DR6 Q;  3CCE A;  2WP8 J;  1P16 A;  2ZTC A;  4KHP L;  2JJQ A;  4NXM Q;  1GO3 E;  4JI4 Q;  4AQY Q;  1X3F A;  1KQS A;  2UU9 Q;  5JEA G;  3AEV A;  2DGY A;  4K0K L;  2GVA A;  2CKZ B;  2V1C C;  4XTC S;  2HHH Q;  2IX1 A;  4C3J H;  3S1Q H;  1TWH H;  2ALY B;  4X64 Q;  3K81 C;  4DV6 L;  4A3J G;  3HOU H;  1VQO A;  4OWW B;  4POF A;  3PO3 H;  4OWT B;  4Y52 H;  4P74 A;  1Y1W H;  1S72 A;  3K7A H;  3U58 A;  2BA0 A;  1VQD A;  4JI8 Q;  1XNQ Q;  3LGJ A;  3HOX H;  4DUY Q;  2IX0 A;  3E9I A;  2OQ0 A;  1A8V A;  1SRU A;  1HZB A;  1LM0 A;  4O2D A;  4TQU S;  3J80 i;  1EWI A;  4HID A;  2UXB Q;  1TWG H;  3RLO A;  1TWC H;  3HOV G;  5LMN W;  3KDF B;  4QIW E;  5EAY A;  1CKM A;  2N3S A;  4DV5 L;  2K50 A;  1QZH A;  3ERS X;  4GOP B;  1FJG Q;  5JJL A;  2Y0S E;  4LF5 L;  3UE1 A;  2UUB L;  5JJI A;  1PVO A;  3H0G H;  1YIJ A;  1RIP A;  2JA6 H;  3HOZ G;  1AE3 A;  4DR5 Q;  3GTO H;  3S16 H;  2K14 A;  4GS3 A;  4JOI A;  4GOP C;  5IP7 G;  5IYC H;  1UE6 A;  1VQP A;  3HOW G;  3I4N H;  3S2D H;  4BA2 I;  1VQI A;  1VQB A;  2JA5 H;  4LFB L;  3M9B A;  3W1B A;  4POG A;  4JI2 Q;  5HGQ A;  5AJ3 L;  2E5L L;  4C2M H;  4A4I A;  2IHF A;  1G51 A;  3UDG A;  1PFS A;  3RLN A;  2N78 A;  2XTI A;  2JA8 G;  1YI2 A;  1NJI C;  3PO2 H;  3PIP A;  1Y1V H;  4GN3 B;  4DR1 L;  2QGQ A;  1FJG L;  1QVF A;  1DGS A;  4K0K Q;  4DV5 Q;  1VQ7 A;  1EUJ A;  3HKZ G;  3CCR A;  3GTL H;  4UPA A;  4R4T A;  3J7Z C;  4RMF A;  3FKI G;  4NXN Q;  1Z9F A;  4MNO A;  3T1Y Q;  3RZO H;  1Q1B A;  3CPW A;  4QQB X;  2I0Q A;  2HT1 A;  4A3F G;  3S1M H;  3L0O A;  1Q86 C;  2HIX A;  5LMU Q;  1XMO Q;  4DV1 L;  5BR8 L;  3WWV A;  5IYB H;  5AJ3 Q;  2E5L Q;  4JI2 L;  2NVY H;  1A62 A;  4MZ9 A;  3H0G G;  1KD1 C;  1EIY B;  4A3L G;  1W3S A;  3U50 C;  3S2H H;  1VCI A;  3KFU A;  1L1O C;  1SLJ A;  1HNW Q;  3G71 A;  3ICE A;  4MTN A;  3GDE A;  5IYD H;  2UXB L;  2ES2 A;  2RCN A;  4A3E G;  3NEM A;  1V43 A;  5IT9 c;  4HIO A;  2K5V A;  4JBK A;  1VQ9 A;  4NXM L;  4A93 G;  1PYS B;  4R4I A;  4DR5 L;  2Z0S A;  5GAE C;  1EQR A;  1HR0 L;  4IFD I;  1ASY A;  4L5S A;  2PQA B;  4JI1 Q;  1PH1 A;  4IOC A;  1YJ9 A;  1L1O A;  4HJ7 A;  3FP9 A;  3TS0 A;  1N36 Q;  1V1Q A;  4GLA C;  4LUV A;  3UDI A;  3MXN B;  1GKH A;  4BA1 I;  3S1R H;  2AWO A;  1IBM L;  2Y0S G;  2R7Z G;  3J81 j;  1I50 H;  1PH9 A;  1U0L A;  2IY5 B;  1UE1 A;  3CD6 A;  3OTO L;  2AWN A;  2PQA A;  1NBW A;  1UEB A;  1E24 A;  1IZ6 A;  2JA8 H;  4YWL A;  1CKN A;  4JC0 A;  2HIV A;  1OXT A;  1N33 Q;  4JI8 L;  2FXQ A;  1XNQ L;  2B63 H;  3ULL A;  1R9T H;  3F1Z A;  2VZA A;  2WFW A;  1HR0 Q;  1YEZ A;  2JA9 A;  1FL0 A;  4A3B H;  1N32 L;  3I56 A;  3EIV A;  2CWP A;  2XGT A;  1WOC A;  1BBW A;  2WB1 E;  4OON A;  1E3P A;  3CP0 A;  4QJF A;  4ALP A;  2YV5 A;  3T1H L;  4A3I H;  3RLF A;  3J81 c;  4UP7 A;  2UUC Q;  4B3T Q;  1CSQ A;  2UUB Q;  3HKZ E;  5FLX c;  1IBM Q;  2EIF A;  1VQ6 A;  2VUM H;  4LF7 Q;  1B8A A;  1YJN A;  4GKJ L;  3PUX A;  1KRT A;  3CCU A;  3GTK H;  4X6A H;  4PZ8 A;  2MO1 A;  2PI2 E;  3KJO A;  2JA5 G;  3FHW A;  2UUA L;  3KLW A;  1HNW L;  2PI2 A;  1NY4 A;  2R93 H;  3B6Y A;  3EN2 A;  4LFB Q;  2RHS B;  3JAM i;  4DR3 Q;  1E7Z A;  4A3K G;  5IY0 A;  3UDF A;  4DV3 Q;  1KL9 A;  4YCU A;  1OXV A;  1N9W A;  1L0W A;  4JI3 L;  4EQ5 A;  2R92 G;  1PH8 A;  4QL5 A;  1MJE A;  3STB C;  4PZ6 A;  4A93 H;  2CQO A;  3ULJ A;  1T9H A;  4WJ4 A;  4DNI A;  3I4M G;  4UP9 A;  3EBE A;  3G4S A;  3CCV A;  1PH3 A;  4L5Q A;  2JA7 G;  4DR1 Q;  3PUY A;  2Q2U A;  3CCQ A;  3CCL A;  2LXJ A;  1JB7 A;  1KC8 C;  3VDY A;  4LNQ A;  1IYJ B;  2VQF Q;  2WAQ E;  3IRB A;  4L5R C;  2UXD L;  2RF4 A;  3M4P A;  5C3E G;  3H15 A;  4IJH A;  4QGU A;  4OWX B;  4A3M G;  1TWF H;  3DM3 A;  1HZA A;  1I3Q H;  1VQ8 A;  3HOY H;  4NB3 A;  3HOX G;  3KJP A;  2ZJQ A;  1MKH A;  4DV3 L;  2OTJ A;  1N32 Q;  2F4V L;  4JI3 Q;  1NMG A;  1YIT A;  1Y1W G;  5GQO A;  4APV A;  2K75 A;  5C3E H;  1XNR Q;  1A63 A;  1CUK A;  4BY7 H;  4DR7 Q;  1Y14 B;  4B3S Q;  2VL6 A;  5IWA L;  1E1O A;  1QUQ A;  1I94 Q;  2E2J H;  4B3R Q;  3L2P A;  4GKJ Q;  2D0O A;  1O7I A;  4OXP A;  5J3B A;  4X65 Q;  4YHH Q;  4A3C H;  1IBK L;  4XIG S;  3F2C A;  3I55 A;  2QA4 A;  5E7N A;  4QY7 A;  5FLM H;  3DLL A;  1X3G A;  2I5L X;  4LF8 Q;  1LUZ A;  4KI0 A;  2JA6 G;  3HOZ H;  2MNA A;  1JT8 A;  2A1A A;  1GVP A;  2AHO B;  4PG3 A;  2F52 A;  4A3M H;  4R4C A;  1AH9 A;  1C0A A;  3ER0 A;  4DV0 L;  4PMW A;  2HQL A;  4YWM A;  5IWA Q;  3KOJ A;  1N33 L;  4FDB A;  4B3S L;  4OX9 Q;  2CFM A;  2ZM6 Q;  4B3R L;  3G6E A;  4JCV E;  2R7F A;  5GAH C;  3G48 A;  3GTJ H;  1I94 L;  1C9O A;  4IPH A;  4YY3 Q;  4HIK A;  2ZJR A;  1IL2 A;  4A3G G;  1XMO L;  4R4O A;  1VQH A;  1XPR A;  1U5K A;  1M1K C;  4BBR G;  3JC6 6;  4HJ8 A;  2UXC Q;  4JI4 L;  2YTY A;  3JAM c;  2EXD A;  3RR5 A;  2YYZ A;  4DK3 C;  2OTL A;  1CKN B;  4GNX B;  2A8V A;  2YU9 H;  1B7Y B;  3CPF A;  1EQQ A;  2LSS A;  5JEA J;  1Q12 A;  3BZK A;  1K3R A;  4B3M Q;  4JI0 L;  4OO1 I;  4BXX H;  1PHJ A;  4YY3 L;  4GNX C;  4HJ5 A;  4GLV B;  1TWA H;  1JJG A;  2R7D A;  1SRO A;  2ATW A;  1L2F A;  2VNU D;  4BBS G;  4HJA A;  1Q1E A;  1WCM H;  5BR8 Q;  1HR0 W;  1PH7 A;  1YBY A;  4A3F H;  4DR3 L;  3U4V A;  1VQN A;  1HJP A;  2NVT H;  3TQY A;  2VS1 A;  4DAM A;  5M3M G;  2ZTE A;  3M4Q A;  2MQH A;  3D0F A;  4RG1 A;  3K0X A;  2VW9 A;  2PMZ E;  3CMA A;  4DV2 Q;  4JI7 L;  4JV5 Q;  2VQF L;  3PF4 A;  3J80 c;  1K83 H;  2B63 G;  1SE8 A;  3PCO B;  3KF6 B;  4BXX G;  2OCE A;  2KHJ A;  1D8L A;  5H1S E;  3I2Z A;  4DR2 Q;  4IJL A;  4BY7 G;  2VQE L;  2KHI A;  3PSI A;  1BVS A;  4BY1 H;  1I6H H;  1C7Y A;  3RNU A;  5IP7 H;  5IYC G;  3GTG H;  3H3V I;  3TRZ A;  1Q82 C;  3S15 H;  2JEB I;  5C44 H;  4A3D H;  4AH6 A;  4IFD J;  1WJJ A;  2JQO A;  3I7F A;  1HNX L;  4BY1 G;  1WI5 A;  2ASB A;  3PO3 G;  1VQL A;  5FLM G;  4AYB G;  1QZG A;  3GTP H;  1QUQ B;  3HOV H;  1VQA A;  4B3M L;  3J7A 5;  1EIF A;  3T1Y L;  1PA6 A;  1YHB A;  2WB1 G;  2B3G A;  4P75 A;  2OWO A;  2QEX A;  4A3G H;  4DUZ L;  5M3M H;  1IBL Q;  2H5X A;  4YCV A;  1SFO H;  3RZD H;  3GTM H;  3F2B A;  4IPC A;  1PYB A;  4LUZ A;  4LFC L;  3T1H Q;  4LF8 L;  2UUC L;  1XPU A;  5C4X H;  3AYH B;  1VS0 A;  2ZM6 L;  4A3I G;  1Q81 C;  1K0R A;  2K52 A;  2PNH A;  4ME3 A;  5C0X J;  2NZO A;  1W2B A;  1N8R C;  1HNX Q;  2IT1 A;  1UE5 A;  3E0E A;  3HFZ B;  2R92 H;  1OTC A;  4LFA Q;  3SGI A;  1SR3 A;  4J15 A;  1UE7 A;  3K80 C;  5M5W H;  4JBM A;  4X64 L;  4NPS A;  4DV7 Q;  4AYB E;  3STB D;  3CCJ A;  2KBN A;  3A0J A;  4DV6 Q;  3PO2 G;  3Q8D A;  5GRO A;  4UP8 A;  4JI5 L;  3CCS A;  1WYD A;  4LF4 Q;  1XJV A;  1QVG A;  4LUO A;  3CME A;  5IYB G;  3CXC A;  4DUY L;  4PZ7 A;  1RL2 A;  1PH4 A;  2HHH L;  2F3I A;  1X3E A;  4JI6 Q;  1J5E Q;  4JYA Q;  1S3O A;  5C0X I;  1GD7 A;  2CCZ A;  3M3Y H;  3TRE A;  1KAW A;  3PUV A;  2WAQ G;  4P73 A;  1YNX A;  5IP9 H;  1NE3 A;  4IFD G;  3AFQ A;  3RN2 A;  3MEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...