1WOCA

Crystal structure of prib
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
99
structure length
99
Chain Sequence
TNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Primosomal replication protein n
publication title Crystal structure of a biologically functional form of PriB from Escherichia coli reveals a potential single-stranded DNA-binding site
pubmed doi rcsb
source organism Escherichia coli
total genus 12
structure length 99
sequence length 99
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1wocA00
2VZAA 2A8VA 4X65L 4OO1G 4DNIA 3F2DA 2UUCL 3A5UA 2C35B 1UE5A 1FJGL 3HOZG 2K4KA 2PMZE 3NEMA 5GQOA 2LSSA 1VQCA 2R6GA 1UWVA 4GN5A 2R7FA 1JJCB 1NMGA 4NXNL 2QGQA 3M4QA 4O0AA 2BA0A 4A3MH 4LW1A 2YTVA 4PZ7A 4LF6Q 3PIPA 3M7NA 2JA6H 4A3JG 1IYJB 4OX9Q 2H5XA 4NXMQ 1XNQQ 1LYLA 2GVAA 1PHJA 5C44G 4DV4Q 1N8RC 1SROA 2KENA 2NVTH 4GKKL 1P16A 3U4VA 3K80C 1I5FA 4IFDI 4KHPQ 2R7ZH 4AIMA 1HNXQ 1C0AA 2F52A 2OQ0A 4JOIC 3SGIA 3KJOA 1RL2A 3M4PA 1CUKA 2GN5A 4DV3L 3CXCA 2E5LL 4JI0Q 2I0QA 4BXXG 4A3BG 4DV0Q 3OTOQ 3HOUG 1K73C 1E1OA 1X54A 3G6EA 2YTXA 1B7YB 3CPFA 2ZJQA 1E24A 4HJ5A 1CSQA 3AQQA 4R4QA 4X62L 3L2PA 3CMAA 1XPRA 4IPDA 3HOZH 2DUDA 5ELOA 3L0OA 3GTKH 3K0XA 4APVA 1ASZA 4NB3A 1SR3A 3I56A 2HHHL 4JI2L 4JI1Q 4QL5A 1W3SA 3NBHB 2UXCL 3K8AA 3WWVA 4YCUA 4A3JH 4A3LG 1GKHA 3I4OA 3CF5A 4IPGA 3F2BA 1B70B 3G48A 5C44H 4K0KL 1CKNB 3HOWG 1I6HH 1N32Q 3PSIA 4YCVA 1XTDA 1VS0A 1Q1EA 1E7ZA 1JJ2A 3RR5A 2UU9L 3H3VI 4GKJL 1T9HA 3S2HH 1HR0L 2D62A 3PIOA 3ERSX 4BXXH 4A3EG 1IBKL 2K5NA 2ZJRA 4A3BH 2Q2HA 1GO3E 1I3QH 3HOUH 4X65Q 1R9TH 1RIPA 5K36G 2VS1A 4DR1L 1G291 3HOYG 2ZM6L 2HT1A 2UUCQ 2QA4A 3S17H 3F1ZA 3TS2A 1WCMG 2D0PA 1FJGQ 1CSPA 1HNZL 1I50H 5IP7G 2Z6KA 4LF8L 4A3IG 4A3GG 2R7DA 5IT9c 2YYZA 3ULJA 1U5KA 5BR8L 1QUQA 2RHQB 4DAMA 1IBMQ 4FDBA 3KYHC 4IPCA 4J15A 5IYCG 4IFDG 4DR4Q 4GKKQ 1Q1BA 3KJPA 3PGZA 4UPAA 3NENA 3M4OH 4A3LH 3HOWH 1NY4A 2Y0SE 1TXYA 5IP9G 1KAWA 4HJ7A 2A19A 5LMNL 3W1BA 3T1YL 1MIUA 2IX0A 4DV3Q 4GNXB 3K7AH 4JI5Q 1PH1A 4A75A 3UE1A 3CCRA 3HKZG 3TQYA 1TWCH 3J81j 4HIMA 4A3EH 1Z47A 2WAQG 4LUZA 2Q2TA 2F4VQ 4HIKA 2VUMG 4QY7A 2WB1G 4DK6C 3HOYH 4IFDJ 2Z6KC 4AQYL 4HIDA 1S3OA 1WCMH 4H02A 1PYBA 1S72A 4RG1A 1HZ9A 4GLAC 5IP7H 1TWAH 4AYBE 2MO0A 4A3IH 1SN8A 3PV0A 2HHHQ 4JI2Q 4B3TQ 2PNHA 3FP9A 1N33L 4BBSG 4A3GH 2UXDL 1TWGH 4DK3C 1V9PA 1HZAA 3F2CA 3G4SA 4BY7G 1VQ9A 5IYCH 3RLFA 2BA1A 1PH3A 4LFCL 1D8LA 1PH9A 1HH2P 4ME3A 2K50A 4UP8A 5IP9H 1QZGA 2UU9Q 2R92G 2AHOB 1HR0Q 1N36L 1VQKA 4POFA 2PQAB 1KXLA 2WP8J 4GOPA 4P73A 2KCMA 1Q81C 1KL9A 2UXBL 5JJLA 1V43A 4JI4L 4DR1Q 1XMQL 1EIYB 1HNWL 3GTOH 2CQOA 1XMOQ 2ZM6Q 2VUMH 5IWAL 2F3IA 4QQBX 2LXJA 5IYBG 4LF5L 1PH4A 4Y7NH 2JEAI 2V1CC 2YV5A 4LF8Q 1VCIA 5LMUL 3S14H 5M5YH 1VQAA 3CW2C 3KLWA 4JI7L 2RCNA 4L5SA 3I4NG 5BR8Q 2BH8A 3UDXA 1FGUA 2EXDA 3JAMc 4BBSH 2JQOA 1BKBA 4C3IH 2CKZB 4DV5Q 1PH2A 1K8GA 3RN5A 1YHAA 4R4TA 3TEHB 4YY3L 4BY7H 2L15A 1M90C 2MFIA 4YHHL 3JAMi 3H3VH 3RZOH 3GTLH 5LMNQ 4DR6Q 3T1YQ 4DR7L 4GOPC 2R92H 1MJCA 3PUVA 1U0LA 1WJJA 1M1KC 3H15A 1VQLA 2MNAA 4B3RQ 4DR5L 4B3SL 1C7YA 1K0RA 3RZDH 4QGUA 4JI8L 3U50C 2K5VA 3K81C 2QEXA 4JI6Q 3GTQH 4DV6L 3GO5A 3CCMA 1VQEA 5IYBH 3ULLA 2A1AA 1NMFA 3S16H 2EQSA 2OQKA 3GD7A 3A74A 2VQFL 3FKIG 4LNQA 3S15H 1K3RA 1UEBA 3BJUA 1NE3A 3KFUA 4DKAC 3I4NH 2PI2E 5DLQE 2UXDQ 1K8AC 3CC4A 2XGTA 5GAGC 3HOVG 3CC7A 2RHSB 1OTCA 2B3GA 1QVCA 1V1QA 4LFCQ 4QIWE 1C9OA 3HFZB 5M5WH 1IXRA 4GLVB 2VQEL 3I4MG 1N36Q 1KRTA 4O2DA 2NVQH 2UXBQ 3LGJA 4LUOA 2AMCB 2VNUD 1XNRL 1LUZA 3KF6A 3J7ZC 1VQ5A 4JI4Q 1XMQQ 3CQZH 5IY0A 1X55A 3S1RH 4LF9L 4DV7L 4POGA 1HNWQ 4OWXB 1X6OA 2MQHA 1D7QA 2B29A 4TQUS 5IE8A 3CD6A 4LF5Q 2EIFA 1BBWA 1VQPA 2N3SA 2OCEA 3MXNB 3U58A 5LMUQ 4RMFA 3S2DH 4JI7Q 1YJWA 1K83H 3FKIH 1QUQB 4DV2L 4DR3L 3J7A5 3UDIA 1FVIA 3CC2A 1HZCA 3ZJYC 4A93H 1AE2A 4IOAA 2I5MX 1OXSC 2MO1A 2NVYH 4YY3Q 3CCSA 3KDFB 4JBWA 1QVGA 3HOVH 1ASYA 1G51A 1L1OA 4YHHQ 5AJ3L 2ZJPA 4BBRG 4NXNQ 1DGSA 1EUJA 1PFSA 3RNUA 1J6QA 2JA7G 5M5XH 4DR7Q 1JJGA 1XPUA 2WFWA 2E2IH 1NJIC 4OWTB 4HJ8A 1YIJA 3I4MH 3E9HA 1N34L 3KDFA 4B3SQ 4DUZL 1YZ6A 3KF8B 3RN2A 3J81c 2HIVA 2K52A 4IJHA 4QJFA 5C0XI 4JI8Q 1IBLL 5E7NA 2N49A 1JT8A 4A3DG 5C4XG 4KI0A 4R4OA 1OXTA 4DV6Q 2E5LQ 3GTPH 1YEZA 3J81i 4YWKA 2VQFQ 3CPWA 2JA8G 4JYAL 2HIXA 3BZKA 3D0FA 3CCLA 1K9MC 2VL6A 1IL2A 3GDEA 1SRUA 1P8LA 4UY8C 4X62Q 4IJLA 1L1OC 2NN6I 3VDYA 5FLMG 1NBWA 1YITA 1EIFA 2AKWB 4B3ML 2E2JH 3CCEA 2IT1A 3I55A 4KLKA 5M3MG 1KHIA 1EWIA 4BBRH 4JV5L 3HOXG 4LF6L 2JA7H 4LF7L 3ICEA 2UXCQ 2ID0A 4GOPB 1S40A 1PH8A 1XNQL 1XNRQ 4K0KQ 1PH5A 4DR2L 4LF9Q 4OWWB 4DV7Q 4GN4B 2CWAA 2Q2UA 4GKJQ 2ZTCA 2K14A 1WI5A 1WFQA 1YNXA 1HNXL 4A3DH 1AH9A 5C4XH 4P71A 4JBKA 3W1GA 1IBKQ 1X65A 2JJQA 3UDGA 5GADC 2ASBA 5GAEC 3OW2A 2JA8H 1A8VA 3PO2G 1VQ4A 2IY5B 3FHWA 4OONA 2OTJA 2CWPA 3GTGH 2VY3A 2IHEA 3S24A 5C3EG 1VQIA 1QZHA 4JBJA 2JA5G 1EOVA 3RLOA 1HNZQ 4GS3A 3HKSA 4PMWA 5FLMH 4MTNA 2Y0SG 4IOCA 4KHZA 2KHIA 3E9IA 3PUZA 1O7IA 5M3MH 1UE7A 3S1QH 2B63G 3HOXH 2LXKA 1SMXA 4JI1L 3PCOB 1X56A 3PO3G 3KOJA 4C3JH 5C0XG 1EFWA 1BVSA 1OXVA 1E22A 1EQQA 3EN2A 3J80i 5H1SE 3CP0A 1IBLQ 4YWLA 1N32L 4A3KH 1Z9FA 4PG3A 1GM5A 2D0OA 4MNOA 4A3FG 4P72A 1YVCA 2N8NA 1YHBA 3G71A 4XIGS 4JYAQ 4Y52H 1YJ9A 1LM0A 2OTLA 1SE8A 1VQBA 1UE1A 3W5OA 5GAHC 2FXQA 5GROA 4HJ9A 2NN6G 2N78A 4P75A 3PO2H 3GTJH 4YWMA 2CFMA 4GLXA 3PUWA 4EX5A 3UE0A 4AQYQ 3BZCA 1KC8C 3F8TA 5C3EH 5C0XJ 1EYGA 1YI2A 1JMCA 4B3MQ 2JA5H 3M3YH 2Z0SA 1HZBA 4XTCS 4JV5Q 1TWFH 1N33Q 3EBEA 4LF7Q 4P74A 4A93G 1E3PA 1KD1C 3S1NH 1IBML 1LTLA 2B63H 4C2MH 2NZHA 3PO3H 1MKHA 3KF6B 2CCZA 2BH2A 2KCTA 4DR2Q 4DR4L 3UDFA 1Q86C 2KBNA 1VQNA 5JJKA 1FL0A 1PV4A 1A63A 1PYSB 4PZ6A 4A3FH 3JC66 4DV1L 1Y1VG 4JI5L 1UE6A 3DLLA 2IX1A 1VQMA 1X3EA 1Q12A 2RF4A 4GN3B 3EIVA 3T1HL 5IWAQ 2F4VL 4LF4L 4X64L 2I5HA 1GVPA 3STBC 1XPOA 1QVFA 4L5QA 3CCUA 1TWHH 4A4IA 4NPSA 1X9NA 2YU9H 4LUVA 1VQGA 1L1OB 1KRSA 1OXUA 1YBYA 3HKZE 4DUYL 4JC0A 5HY6A 2WAQE 4BA1I 1PH6A 1VQFA 3PF4A 4B3TL 1VQHA 2WB1E 1PA6A 3DM3A 1Y1WG 4OXPA 4X66L 3I7FA 3TRZA 4TVAB 1J5EL 1A0IA 3Q8DA 4JCVE 2UUBL 3PUYA 4R1JA 1SLJA 4LFBL 1VQ8A 3B6YA 1Q46A 3ER0A 4UP7A 3IRBA 1VQ7A 1HR0W 4IPHA 4EQ5A 1X3FA 1SFOH 5FLXc 4DR5Q 4HJAA 4LFAL 1Y1VH 5FJ8G 2ATWA 1VQ6A 1CKNA 3OYYA 4DAYB 4BY1G 5IYDG 4WJ4A 3NELA 3MEFA 2E8GA 3PUXA 5C4JH 1XMOL 4JI3L 3STBD 3AEVA 3BU2A 3K7UC 1YHQA 1WYDA 3ULPA 1N9WA 2UUAL 1H95A 1JB7A 1B8AA 2R93G 3H0GG 1JE5A 4YCWA 3M85A 1I94L 1CKOA 3CAMA 3TREA 3A0JA 1Y14B 2Q2IA 2VW9A 4R4CA 5ELNA 2OWOA 2I5LX 2NZOA 4OO1I 1WOCA 2AWNA 4DV5L 3E0EA 2JK8A 1PH7A 1Y1WH 1OXXK 1KQSA 3U4ZA 2ES2A 2JEBI 2GVBA 2ZTDA 3CCJA 3RLNA 1IZ6A 4LWCA 3AFQA 2VQEQ 5LMNW 1VQDA 1W2BA 1X3GA 4DR6L 4DV1Q 4OX9L 3L7ZC 3D31A 4NXML 3AYHB 1XJVA 3A5ZB 1L2FA 4L5TA 3CMEA 4L5RC 4DV4L 1CKMA 4ALPA 5J3BA 1YJNA 1MJEA 4A3KG 3GTMH 4B3RL 5JJIA 3T1HQ 5FJ8H 4A76A 2NVXH 4LF4Q 3S1MH 4KHPL 4X64Q 4BY1H 1HJPA 5IYDH 1Q7YC 3PF5A 4AH6A 4BA2I 4GNXA 4A3CG 4JI6L 3AFPA 1L0WA 5M3FG 4JG2A 4JI0L 2AWOA 4DV0L 4R4IA 2K75A 3OTOL 4DUYQ 2IHFA 4DR3Q 2JE6I 2ZTEA 4DV2Q 2R93H 3H0GH 2JA9A 5HGQA 1VQOA 4JBMA 1G6PA 2ALYB 4X66Q 4WJ3M 1J5EQ 4X6AH 2YTYA 1BBUA 5AJ3Q 2UUBQ 1A62A 4MZ9A 4PZ8A 4C3HH 5JEAG 4A3MG 4LFBQ 2K5HA 3J80c 1EQRA 1E1TA 1PVOA 1KIXA 2JA6G 1VQJA 4HIOA 1N34Q 4LFAQ 4DPGA 4DUZQ 2KHJA 3CCVA 5EAYA 1Q82C 1NTGA 2R7ZG 2E2HH 2HQLA 4UP9A 4GNXC 2XTIA 1Q8KA 4JI3Q 3I2ZA 1AE3A 3TS0A 3M9BA 4JOIA 3CCQA 4IO9A 2PI2A 2UUAQ 2PQAA 4A3CH 1GD7A 5JEAJ 5M3FH 4AYBG 1I94Q 2DGYA
chains in the Genus database with same CATH superfamily
4B08A 4OO1G 4X3KA 2UUCL 2G9DA 2LSSA 4GN5A 2R7FA 1NMGA 3M4QA 2VB2X 2BA0A 3OWEB 4A3KB 4J1MA 1XNQQ 5C44G 1DJRD 3GQBA 5ELBA 4IFDI 1LTSD 2CH4W 1I4QA 4AIMA 1C0AA 2F52A 3EQLC 3P7JA 3SGIA 1RL2A 4JI0Q 1QWYA 3VYRA 1G8ZD 4L8JA 3J7AF 1SJHD 3CPFA 1E24A 1EU4A 3TZDA 1E2WA 4R4QA 2L12A 1Q90A 4QUCA 2Q8IB 5FLXE 5I6WA 3EFXD 5C3XA 2DUDA 2IX3A 2K5QA 2KOLA 1D5XC 1SR3A 3I56A 3NBHB 1F9RA 2E76C 4A3JH 4CDFC 4FF1A 4A3LG 1CFMA 3CF5A 3I4OA 2F1MA 3MHBA 4IPGA 1B70B 1I6HH 1E7ZA 3RR5A 2L55A 1RTOA 5KEEA 2O5IC 3S2HH 3DWAA 2H1EA 5C5LA 1HR0L 1BO0A 2K5NA 4A3BH 1GO3E 1RDPD 5K36G 2VS1A 2ZM6L 2UUCQ 3S17H 3F1ZA 2X6LA 5IP7G 4LF8L 4G7ZC 4ZRZA 2WKCA 5KGUA 2XRQD 4C1NK 1GUOA 2R61A 1PZKD 3BZDB 4MHEA 1UAPA 1FYCA 1I3QB 3HOUB 3QO2A 3W1BA 1R9TB 3K7AH 1C8CA 2EY5A 3HZXA 1PH1A 2KCCA 1PZJD 3HKZG 1TWCH 1EY0A 3V2TA 4A3EH 4NMZA 1Z47A 4LUZA 5FOBB 4J6HA 2WB1G 1BQQT 3J7AV 2Z6KC 2H4OA 4AQYL 1EZ8A 3M4OB 4C3IG 4A3GH 3NPPA 1HZAA 3F2CA 4BY7G 4IFDH 2BA1A 3A7AB 4LFCL 3OW7A 2O2LD 1D8LA 2O5JC 3A56A 4J8QA 2F0KA 1HR0Q 1N36L 1VQKA 1KXLA 2KCMA 1Q81C 3HOYB 2UXBL 1VMPA 2EY1A 1XMQL 2CQOA 1XMOQ 2ZM6Q 4QIWB 1TWAB 4QQBX 1PH4A 2YV5A 3H09A 4LF8Q 3S14H 5M5YH 3KLWA 1Q3LA 2M00A 4KY5A 2BH8A 3JAMc 1S5ED 2JQOA 2M9VA 4DNTB 4G7OC 1YHAA 2EJGC 4YHHL 5K5PA 1JWUD 5IGCA 2K01A 1MJCA 3MEHA 3PUVA 1U0LA 3GTOB 1A6XA 4IQZA 1BCPF 4B3RQ 4DR5L 2AUJD 1C7YA 1K0RA 1SJED 5J22A 2TMPA 4DV6L 3GO5A 2B2YA 5IYBH 2F0LA 3NHHA 2EQSA 1PRTC 2VQFL 3FKIG 4FXDA 5CORA 1K3RA 1NE3A 5DLQE 3HOVG 1X3QA 2R92B 3C2PA 1RD9D 2EYLA 4LFCQ 1V1QA 2MGSA 3X3MA 1TT2A 1IXRA 4GLVB 4WRDA 2VQEL 1F2MA 1N36Q 1EZ6A 4FYDA 4O2DA 2UXBQ 1F2YA 4LUOA 1AEXA 1I4HA 1VQ5A 1XMQQ 5IY0A 3S16B 4LF9L 4DV7L 4POGA 4OWXB 1X6OA 2MQHA 3S15B 4TQUS 5IE8A 3CD6A 3BVGA 1K83H 1LTBD 1S5CD 3R3OA 4KJOA 4DR3L 1FVIA 4E6IA 1AE2A 3T13A 4IOAA 1E2VA 2MO1A 2F0JA 3KDFB 1ASYA 4YHHQ 3VR3A 4NXNQ 3CHBD 5J39A 5JPMC 2BOSA 2E2IH 3CQZB 1XPUA 3HS0C 2AQ1B 1STNA 2B2UC 4PMCA 5E7NA 2N49A 5A2QL 4DV6Q 2E5LQ 1ZYRD 2NTTA 3KBGA 2F0VA 4H44C 2VQFQ 1TY2A 1Z7TA 3D0FA 2QF7A 2VL6A 2AQ2B 2NN6I 4EVOA 5M5XB 5FLMG 1EIFA 3MFGA 4N9TA 3CCEA 3I4MB 5M3MG 4QMGA 1JOKA 2JA7H 4LF7L 4XT3B 2UXCQ 2ID0A 1PH8A 3T16A 1ET9A 3MXGA 2LKVA 3GTPB 4DR2L 4LF9Q 1I4XA 2JN4A 4DV7Q 4GKJQ 2ZTCA 1MGSA 4HTHA 2A73B 3MZ5A 1DXMA 4P71A 5C4XH 5KRUA 4JBKA 3T53B 2JJQA 4UAIA 1YNNC 2JA8H 1ICWA 4KKUA 3FHWA 5D14A 2OTJA 2CWPA 2PCFB 4QB4A 1BCPC 4BS9A 3S24A 1JB3A 4JBJA 4BBRB 3RLOA 4PMWA 5EBCA 3E9IA 3PUZA 1UE7A 3S1QH 2B63G 1AN8A 1SMXA 3TMEA 3G7LA 2CH4A 3PO3G 1K28A 5C0XG 1OXVA 4A3DB 1IYVA 1EQQA 3EN2A 3J80i 3V05A 4NW2A 1STHA 5E3FA 4A3KH 1Z9FA 4PG3A 2D0OA 3I4LA 4MNOA 4A3FG 4RWSC 5JPNC 1FR3A 4XIGS 1LTRD 4P2CB 2R3ZA 1VQBA 1UE1A 2X69A 1PTOD 3DMUA 5GROA 1FNWA 2N78A 3HG9A 2LS01 4YWMA 1DYQA 3VR4A 2A6EC 4KY7A 5EKKA 5C0XJ 4C3IB 3HOXB 3Q23A 2Z0SA 1HUNA 2WKDA 4O42A 3AMUA 5E4WC 1TWFH 1N33Q 3EBEA 4K14A 4P74A 4LF7Q 1VF5C 3S1NH 3OIQA 1EQVA 4C2MH 3DWQA 4CDCC 1GUNA 2CCZA 2KCTA 4DR2Q 4X3SA 2KBNA 1WTQA 3NBIA 1FL0A 4H0LC 1PV4A 3MVVA 3RZDB 4DAVA 4OIKA 3GTJB 3JC66 4DV1L 1MSHA 1Y1VG 4JI5L 3SHLA 1X3EA 2JXMB 1O7LA 2EY2A 5IWAQ 2PPBC 2NN6H 2F0GA 4L5QA 1S4ZA 2B2WC 2YU9H 3K57A 1KTKA 4DUYL 2NTSA 5COYA 4JC0A 2B2VA 5HY6A 3I8ZA 3VYTA 4B3TL 1PFNA 1PA6A 3DM3A 4X66L 1J5EL 2KECA 1GUGA 1A2UA 3DEOA 3ER0A 3MFYA 4HN7A 1HR0W 1CHPD 2F0UA 4HJAA 5FJ8G 4WJWA 4ZUJA 1ILPA 3NELA 3PUXA 4PV1C 5IGEA 2VXWA 2RBMA 3STBD 3AEVA 2K03A 5BN5A 1EY7A 1H95A 1B8AA 2R93G 3H0GG 2VW9A 5JJZA 4OO1I 4RGTA 3KBXA 4DV5L 2JK8A 1I4RA 1OXXK 2GVBA 4X3TA 2KUMA 1EYCA 1IZ6A 4DV1Q 1W6JA 3D31A 5C4JB 3AYHB 3A5ZB 4G7HC 1HFNA 1LT4D 1HA5A 5J3BA 5DM73 4A3KG 1MJEA 1HCZA 2XVSA 2CW0D 1MSGA 4KHPL 4BY1H 5DEHA 4JI6L 4DV0L 4R4IA 2K75A 4YIJA 4DUYQ 1NSNS 5CV4A 3E5SA 1MI2A 1VQOA 3SK4A 4X66Q 2A6HC 1J5EQ 1BBUA 5AJ3Q 4PZ8A 4C3HH 2LFNA 1EQRA 1PVOA 4FXKC 3GTMB 3QJYA 1VQJA 4HIOA 3S1MB 1N34Q 5EAYA 2EOTA 3ERQA 4UP9A 4KKTA 1Q8KA 4JOIA 4EQNA 3CCQA 4K8JA 4DK1A 5M3FH 2FMCA 1CA5A 4RKBA 2DGYA 4NP5A 5M3MB 1WTWA 4C1NI 1FJGL 5C4ZA 2PMZE 5GQOA 4IUVA 1WTOA 4DK0A 2QGQA 5CGKA 4A3MH 1J9OA 3PIPA 3VR5A 1LV9A 2K04A 4I65A 4XQJA 2F0NA 2KENA 2NVTH 2SNMA 3D6WA 1F2ZA 2RDFA 3U4VA 3K80C 4KHPQ 2R7ZH 4HMIA 5KYLA 3TP5A 1HNXQ 2QDBA 1CUKA 2GN5A 3CXCA 4DV0Q 3HOUG 1K73C 1F2LA 1X54A 2YTXA 4OO1H 4HJ5A 1CSQA 3OMCA 4KD4A 1XPRA 2JA6B 4IPDA 3J81L 1EYDA 1ASZA 4NB3A 4ILWA 4JI1Q 3KLRA 4QL5A 3QOLA 4TKOB 3K8AA 3WWVA 4YCUA 1GKHA 4H7BA 5C44H 3G48A 1N32Q 1PDQA 1XTDA 1VS0A 1Q1EA 1JJ2A 5EPKA 2D62A 1JOOA 4K6DA 1IBKL 4ZKCB 2ZJRA 2Q2HA 3OIPA 2CW0C 1O78A 4HCEA 4UDUC 1ML0D 4OHJA 2EZVA 4MN3A 3HOZB 1G291 3HOYG 3GTKB 2QA4A 2EYHA 4KD3A 3TS2A 1FJGQ 1CSPA 1GXDC 3MXNA 1I50H 3M7GA 4A3IG 1EWCA 2YYZA 1TS4A 4JPBW 3H3VC 2RHQB 5EGTA 1IBMQ 4IPCA 4J15A 4L63B 1F77A 2E75C 3KJPA 2N88A 3L3OC 2XSCA 4UPAA 4A3LH 1H9MA 2EJMA 1NY4A 5IP9G 1HFGA 1Y1VB 4HJ7A 2A19A 4HAEA 3T1YL 1BDOA 3SK8A 1BOSA 4QCLA 1CHQD 3GV3A 1AP0A 2WACA 3KF8A 5K36H 2L9HA 5C5MA 3TP7A 2SNSA 4PMBA 4G57A 1GUTA 1A3VA 5E4XA 3PQIA 4RG1A 1HZ9A 3D4DA 5IP7H 2Z4IA 1TVXA 2MO0A 2PNHA 3HOWB 2UXDL 1TWGH 2KEDA 2NYZD 1LLRD 1VQ9A 4XYOA 4RGNA 1JICA 1PH3A 2NB0A 2QW7A 2AUKA 4DAPA 2K50A 2R92G 4JVZA 4RFBA 3QB3A 2AHOB 2L1BA 3BS1A 1X3PA 1QOHA 4GOPA 5JJLA 5CMDA 1WCMB 4O1NA 1NUCA 3ONAB 2LXJA 4LF5L 4Y7NH 2JEAI 1D5ZC 2PZTA 1AH9A 1QCBD 2EPBA 4RHRA 5LMUL 2F03A 1VQAA 2RCNA 3NWTA 1JORA 1ENFA 3UDXA 3CRLC 3G6JB 2O4XA 1FGUA 4M8AA 3I70A 4C3IH 1D2BA 2E2DC 2E74C 4HSVA 4R4TA 2EJFC 3TEHB 1IHZA 4BY7H 1M90C 1QILA 1DOLA 3RZOH 1B53A 4DR6Q 3T1YQ 4DR7L 2E2HB 1BXTA 1WJJA 3OOCA 2VUMB 1VQLA 3RZDH 4QGUA 3U50C 4RCOA 2K5VA 5AFWA 2QEXA 1AW7A 2N55A 3EJIA 4BBSB 3K5MA 4ZLTF 1UEBA 3BJUA 3ND9A 3KFUA 4DXFA 2UXDQ 2K5WA 5I2YA 2XGTA 5GAGC 3GTLB 1QB5D 1B3QA 3CC7A 4HR7B 1HTPA 4PNYA 1TIID 3OWFA 2A69C 1C9OA 2EYMA 2F0OA 3I4MG 3PMFA 4LJZC 1KRTA 2NVQH 3ZYYX 1XNRL 3GTQB 1B4OA 5D3IB 1X55A 1PRTF 1QNUA 2B2YC 1D7QA 2B29A 4LF5Q 1VQPA 2N3SA 2OCEA 3I4NB 3MXNB 4R8NA 5LMUQ 1WD1A 1PRTD 4IUPA 1SYFA 2L4NA 1YJWA 3FKIH 4PQXA 4IUNA 1FNUA 1GHKA 3J7A5 3R8BA 2EXZA 2I5MX 5M5WB 3HOVH 2XWJB 4OGQC 2ZJPA 4BBRG 3E6ZX 4DR7Q 4RKLA 3S1RB 3U9SA 5JVH3 1AZPA 4FF4A 2F0MA 4MIUA 4K2LA 1D5MC 3KDFA 1DM0B 1YZ6A 3KF8B 3P75A 3J81c 3RN2A 2HIVA 5C0XI 1IBLL 1PTOB 1U4LA 3S2DB 4A3DG 1KNAA 1HRJA 4KI0A 1BNZA 3KUPA 1B1ZA 1YEZA 4JYAL 4ME5A 3A7LA 2EVBA 2HIXA 1M8AA 2NVYB 3J80E 1K9MC 1SRUA 2CVRA 3W3AA 1YITA 2AKWB 4B3ML 2F0WA 1KHIA 1EWIA 4JV5L 4KKSA 3HOXG 4HEDA 4LF6L 4Q0FA 4GOPB 1B2TA 1TS2A 2M2LA 1XNRQ 2IPKD 2PZUA 3SR1A 1JC7A 1I4PA 1YNXA 3A8KE 1ET6A 2SDFA 3ND8A 2XIWA 4ZQ3A 1EY4A 3UDGA 1A8VA 1VQ4A 2E2JB 2FINB 4OONA 1AFPA 3GTGH 1SNQA 4A3IB 4DA2A 1CQFA 2IW3A 5FLMH 1RKNA 4MTNA 1EEID 1F9SA 1O7IA 5M3MH 1IW7C 3EVQA 1PMRA 2SOBA 2XRSD 2KHSA 3PCOB 4IN3A 5L37A 3KOJA 4R9WA 1E22A 4WFN3 5H1SE 1IBLQ 4JW0A 3BYYB 3N6RA 1L0XB 1SNOA 4JYAQ 1B50A 4K5VA 1YJ9A 1YNND 5GAHC 2X6GA 4HJ9A 3KK7A 3PUWA 1BCPD 4EX5A 1WD0A 4AQYQ 3BZCA 1JWMD 1KAAA 1RHPA 3F8TA 3GP7A 3R93A 1EYGA 1JMCA 4B3MQ 1IKLA 5KNBA 2EY6A 4C3JB 4JV5Q 1E3PA 1STYA 1KDAA 4L6TB 3I3CA 2B63H 5T1GA 3PO3H 3DHQA 1TQOA 5C0XH 4DR4L 3NUCA 5CYUA 5CBEE 3UDFA 1Y8PB 1VQNA 1A63A 3PO2B 4PZ6A 4A3FH 1SMYC 3VA7A 5CV5A 1TKWB 2CHBD 1HQRD 5C3EB 3M3YB 5IT9L 2JA5B 3EIVA 1GUWA 2F4VL 1XPOA 1QVFA 1GVPA 2A6ED 1TWHH 3SK5A 1X9NA 4DN4M 2ZXPA 1YBYA 4V190 2F0EA 3PF4A 4RH6A 1SSOA 3AB9A 3T51B 4CDEC 3T4AC 2A68C 1EY5A 1CK1A 4TVAB 2PZWA 4JCVE 3PUYA 3QIAA 3PIO3 4LFBL 1Q46A 4I7AA 3IRBA 5I9PA 1R4QB 2RKSA 2F0QA 4DR5Q 1Y1VH 2ATWA 3C46A 3UI2A 4GZYC 2E8GA 4JI3L 4HSPA 1YHQA 2UUAL 2B2VC 4B9XA 3IFDA 4YCWA 1LTID 2C9OA 2HUGA 1YNJC 5M9OA 2Q2IA 5CC4A 2RDHA 5BN3A 2OWOA 2I5LX 2AWNA 3E0EA 1QJOA 1C48A 2JEBI 4LMQD 4RA8A 5I4DA 2ZTDA 1LABA 3SEBA 3RLNA 4LWCA 2VQEQ 1VQDA 3T56B 2DJGC 3L7ZC 4NXML 1LACA 4L5RC 1SE4A 1CKMA 5I9OA 1LT3D 2PMZB 3H91A 5FJ8H 2NVXH 5EQ0A 3JAME 2G9HD 2C5CA 1A3UA 1L0WA 4JG2A 3HRZC 1BBXC 3NSWA 1SXTA 3OTOL 4DR3Q 2JE6I 1Y1WB 3BVMA 4FF2A 1KLUD 3H0GH 2R93H 5JOBA 2ZT9C 4JBMA 1LT5D 2WV6D 4WJ3M 4KV6A 2YTYA 2K6AA 5JEAG 4LFBQ 2K5HA 4FNFA 1E1TA 1KIXA 2JA6G 2F0FA 3E3XA 1Q82C 1NTGA 4CHTB 2E2HH 4CKEA 5IOCA 3OHXC 4JI3Q 3I2ZA 1PFMA 1IYUA 3M9BA 2UUAQ 3BDCA 5JEAJ 2F3WA 4KMUC 1KDBA 4DNIA 3BVZA 3F2DA 2D9UA 1STGA 2C35B 1UE5A 2A6HD 1WTXA 3HOZG 1EU3A 1VQCA 1JJCB 1E2ZA 1V1OA 3D6CA 4O0AA 4LW1A 5C4HA 3M7NA 4NXMQ 2GVAA 1PHJA 4GKKL 1S5BD 1P16A 2RQXA 1Z6HA 5EKLA 1I5FA 4DF7A 4JOIC 3KJOA 1PZID 1NNXA 4BXXG 3IKJA 5I6YA 5CR3A 3OTOQ 1I6VC 4ZYSA 1D1IA 5LL6S 1B7YB 1WTPA 3IFTA 1ONLA 3AQQA 4X62L 1CQVA 1EY8A 1SE2A 3FDTA 3Q22A 5ELOA 3R2IA 3K0XA 4JI2L 1W3SA 3F2BA 1Y69U 4K0KL 3HOWG 1JE4A 1O7ZA 4WORA 3PSIA 4ZAIA 3H3VI 2UU9L 3K6OA 1I3QH 3HOUH 1R9TH 1RIPA 1SEBD 4DR1L 2HCIA 3MC0B 1WTHA 3DM1A 5J1ZA 1WCMG 4TRDA 2D0PA 1HNZL 2HD3A 2ENBA 2RSOA 1K8MA 4ODGA 4RGMA 5IT9c 2EYFA 1I6HB 4DAMA 3FPPA 4FDBA 2JYOA 4ULLA 5FO7B 2MHVA 4DNRB 5IYCG 1Y8OB 4GKKQ 3S2HB 4K6LA 1SFOB 2Z4HA 3M4OH 1GOZA 4A3BB 1KAWA 5KIXA 5LMNL 1MIUA 4JI5Q 1EYAA 1K3BC 3QR8A 4A75A 3S17B 3UE1A 3CCRA 4HIMA 3J81j 1IL8A 3DWPA 2Q2TA 4HIKA 2VUMG 1SNDA 4DK6C 4X3UA 3HOYH 3OSOA 3MWYW 1CZWA 4HIDA 1S3OA 2ICEC 4H02A 1S72A 4GLAC 4RAUC 1TWAH 1D6EC 4AYBE 4A3IH 3PV0A 4V0BA 4B3TQ 4JI2Q 4BBSG 2TSSA 3FP9A 4DK3C 1V9PA 2IL8A 2AQ3B 3RLFA 3K7AB 1TWCB 4A3EB 1PH9A 3NWSA 4UP8A 5IP9H 2UU9Q 4B9WA 5JVG3 2L11A 2JSOA 4DFAA 4CGYB 1G2SA 2WP8J 4P73A 4DR1Q 1O80A 1EIYB 3GTOH 1ESFA 2F3IA 1SYBA 3D4WA 4A3GB 1D1KA 2BCOA 1VCIA 4L5SA 3CW2C 4N9PA 4JI7L 3I4NG 2EXDA 1BKBA 4DV5Q 4XT1B 2L15A 2MFIA 1M4VA 3JAMi 5CV9A 3H3VH 5LMNQ 3DUZA 4GOPC 2R92H 2WAQB 2PQEA 5FKAC 2K33A 1M1KC 5CBAE 4B3SL 2P5ZX 3VA5A 5IGBA 1V1PB 3S14B 2FHTA 2K5DA 3TBIB 1XTCD 4JI6Q 3CCMA 1VQEA 5IGFA 3ULLA 2A1AA 3S16H 3SVMA 2OQKA 4LNQA 2Z6BA 3S15H 4MTKA 5HURA 3U9OA 3ITPA 1S5DD 2PI2E 1K8AC 1SYCA 1CT1D 1QG7A 2F0HA 2RHSB 4ABNA 2CQAA 1OTCA 2B3GA 1QVCA 1DOMA 5EJWA 3HFZB 2MJ8A 3LGJA 2AMCB 3J7ZC 3CQZH 5TSSA 2EIFA 2Z9HA 1QNKA 5DM63 4OEMB 4RMFA 4CBVA 4JI7Q 4LAAA 4DV2L 2EYJA 4XQQA 3UDIA 1XX8A 1HZCA 2BE5C 3I73A 1OXSC 1QVGA 1G51A 1L1OA 5DNFA 1TU2B 1J6QA 2A69D 5M5XH 3V96A 3D8GA 2GA4B 4HJ8A 1F9PA 1YIJA 2J0TD 3I4MH 1B9MA 3E9HA 4B3SQ 2DJFC 4HMJA 4DUZL 4IJHA 3QG1A 2B2TA 4KY6A 3TP8A 5A2QE 1K83B 2JP1A 2LY7A 1OXTA 2OEOA 1BCPB 3GTPH 3OMGA 3BZKA 3CCLA 4DAYA 4U68A 2KEEA 1IL2A 4ZCKA 5A35A 4UY8C 3C1FA 1NBWA 1STAA 3M4YA 1HHVA 5EBDA 1IKMA 2IT1A 4KLKA 1LTGD 4BBRH 2WINB 3LWEA 3I72A 3URYA 4C3JG 2BDOA 2XNAC 2QEJC 2Z1CA 1S40A 3BG3A 1XNQL 1GJXA 3O13A 4I7ZC 1WI5A 4NDXA 1ILQA 1S5FD 4A3DH 3SE0A 4K2KA 3W1GA 1IBKQ 1B9NA 1O7YA 4ID6A 5GADC 2ASBA 2V4DA 5GAEC 3PO2G 1TS3A 2IY5B 2RSNA 3NK9A 5C3EG 2JA5G 1TY0A 2JA7B 1BF4A 2J4XA 2DNEA 2FJ2A 3Q24A 1SYEA 4FXGC 4ZUIA 1JR0D 3HOXH 2LXKA 1LT6D 1X56A 3RMHA 5C4XB 4YWLA 3AU7A 2JA8B 1CTMA 4IURA 3K0YA 1GHJA 2N8NA 4H13C 4Y52H 2EYPA 1LM0A 2OTLA 1EIHA 1SE8A 3W5OA 1CM9A 3GTJH 1K8OA 3MA2B 3LNNA 3LX0A 3UE0A 1KC8C 4IALA 4IUQA 3S1QB 4OL7A 4XTCS 4U673 1KNEA 2HQEA 5E1FA 1IW7D 1EY9A 1JOQA 2OXPA 1DOKA 5ELDA 4QF4A 1A2TA 2NZHA 2DY8A 2BH2A 2IJ0A 1LTTD 1Q86C 4KN4C 3TZUA 1PYSB 3BYTB 2KA7A 1EOTA 3DLLA 1VQMA 2XWBB 1Q12A 2RF4A 3L9AX 4GN3B 2K05A 3D4RA 3A8JE 4X64L 2I5HA 1CZGA 4C56C 2HDLA 1TWFB 2Y0SB 3CCUA 1ENAA 4NPSA 3S1NB 1MD2D 1K0SA 1L1OB 1II3A 4C2MB 4XQNA 1PH6A 2WAQE 5C3WA 1VQHA 3RUZA 1Y1WG 4OXPA 3Q8DA 2UUBL 2RDGA 1SLJA 3FPUB 2EDGA 3MXUA 4CKBA 1VQ7A 3CKIB 4IPHA 1SFOH 1SMYD 4LFAL 3K5LA 2OT2A 2RA4A 2YU9B 1CKNA 3NP8A 4DAYB 2I46A 2PW5A 5KNCA 4QUFA 5IYDG 4WJ4A 5C4JH 3MEFA 4RGOS 1XMOL 1EL0A 1UUPA 3NTIA 3ULPA 5ELEA 4A93B 1I94L 1CKOA 2A74C 5IIFA 3QWNA 2J7ZA 2A68D 3RD4A 2MP1A 2L0CA 5LMNW 1W2BA 3H6MA 4OX9L 1XJVA 1L2FA 4L5TA 1KLGD 4DV4L 1YJNA 3GTMH 4B3RL 5G3LF 4BWGB 5JJIA 1HPCA 5BN4A 3S1MH 4X64Q 3NXWA 1I4GA 1AZQA 3HP3A 3PF5A 4AH6A 4BA2I 4GNXA 4A3CG 4KN7C 3AFPA 5G3LD 2AWOA 2ZTEA 5CV8A 2JA9A 5HGQA 1YNJD 3IAYA 2QILA 1B44D 2UUBQ 3NTHA 1A62A 4MZ9A 3DEPA 3HGBA 4K8IA 5IGGA 4DXGA 1HA6A 4BY1B 4LFAQ 1DONA 4EQOA 2F0PA 1ZEQX 2ZXRA 1VMCA 4IO9A 2PI2A 2PQAA 4KHVA 1GD7A 3NQIA 5CV7A 4ZK9B 2VB3X 1I94Q 3P1HA 4IUTA 2VZAA 2G5DA 4X65L 2A8VA 1ESRA 2XN9C 4C3HB 1KDCA 2PNRC 3TN2A 3A5UA 2K4KA 3NEMA 2R6GA 1UWVA 5EPLA 3K59A 4NXNL 1QE6A 3KLSX 5JEAH 4LF6Q 4RCNA 1ENCA 2YTVA 4PZ7A 2JA6H 4A3JG 1IYJB 4OX9Q 2H5XA 1LYLA 4DV4Q 4LK1C 1V8QA 1N8RC 1SROA 3MXPA 5JAVA 5M3FB 2OQ0A 3BDLA 3M4PA 4DV3L 3F2UA 2E5LL 2I0QA 3HEJA 4A3BG 1HXYD 1E0BA 4N8FA 1E1OA 3A54A 3G6EA 1ICFB 2ZJQA 4A3MB 2FFKB 2B39A 3L2PA 3CMAA 4KTAA 2I07B 5DAUA 4CJ0B 3HOZH 4CDDC 3J81E 1J8IA 3L0OA 3GTKH 1PYWD 4NKLA 4APVA 2NVTB 2LMCB 2HHHL 1VDZA 2KCNA 2R7ZB 2UXCL 1BR9A 4CJ2C 1T5EA 4OIJA 1NCVA 1CKNB 1XWEA 4YCVA 1JCKB 4AYBB 4GKJL 2PW7A 1T9HA 3NTKA 3PIOA 3ERSX 4BXXH 5FK9C 4A3EG 5LL6X 1RODA 4X65Q 5D65A 1Q8IA 2BDNA 2HT1A 5IGDA 3N52A 3C3LA 1XYIA 4FO2A 2DN8A 2Z6KA 4A3GG 2R7DA 3I90A 3ULJA 5C44B 1U5KA 4Z9CB 5BR8L 1QUQA 1FD7D 5ISRA 3KYHC 3OPOA 3VYSA 4EQPA 3VYUA 4CKCA 4IFDG 4S3SA 4FF3A 4DR4Q 1Q1BA 3PGZA 1EWHA 3NENA 4FVMA 3HOWH 3TSSA 2Y0SE 1TXYA 2D5DA 3MAQA 2QKIC 2IX0A 4DV3Q 4GNXB 4K5WA 2F0DA 3SK6A 2F0IA 3TQYA 5ELCA 3X3NA 2WAQG 3SDZA 2F4VQ 1I50B 4QY7A 2NBFA 3FEWX 4IFDJ 4KK7A 1WCMH 1PYBA 1KABA 1SN8A 1XXGA 2HHHQ 1N33L 3G4SA 5T1IA 4OELB 5IYCH 3W2DA 2D2CC 4HCSA 1HH2P 4ME3A 1QZGA 2FMMA 4POFA 2PQAB 5HGTA 1GUSA 1KL9A 1PFBA 4F87A 1V43A 4JI4L 1HNWL 1LO5D 1RJTA 4JK1C 5IWAL 2VUMH 4F8MA 5IYBG 2ZXOA 2WIIB 1TWGB 2V1CC 3S9WA 3NE5B 5BR8Q 1SAPA 4BBSH 1MBYA 2CKZB 1PH2A 1K8GA 3RN5A 1FNVA 4YY3L 2A5HA 1B3AA 2MUYA 1C4QA 3GTLH 1PTOF 3HKZB 1SNCA 4K5XA 1EFID 3H15A 2WB1B 2MNAA 4TSSA 4Y7NB 1NR4A 1WVLA 1U4PA 1PXUA 4JI8L 3K81C 3GTQH 5EKIA 1NMFA 3EROA 3GD7A 3A74A 1EY6A 1RTNA 4BY7B 1V1PA 4DKAC 3I4NH 1G91A 3RZOB 3CC4A 5FLXL 3VR2A 1SDFA 1FGBD 4QIWE 1TR5A 3VR6A 5M5WH 3EA6A 1PLFA 5C6AA 2VNUD 1LUZA 3KF6A 4JI4Q 1HNWQ 3S1RH 2MPMA 2B2UA 3WOEA 1BBWA 1H9SA 1ZYRC 3J7YW 3H94A 3U58A 2F0TA 3K5NA 1PTOH 3S2DH 1QUQB 1U4MA 2QDLA 3CC2A 3ZJYC 4A93H 2Z8LA 2NVYH 3CCSA 4YY3Q 4CJ1B 4JBWA 4XYQA 1HQMC 5AJ3L 4A3JB 2NVQB 1DGSA 1EUJA 1PFSA 3RNUA 2JA7G 5I2XA 1JJGA 2WFWA 1NJIC 4OWTB 4RHSA 4XDXA 1N34L 4F7XA 1JT8A 1JQYD 2K52A 4QJFA 4JI8Q 2IWHA 5CV6A 2NUCA 1SNPA 5C4XG 3FKIB 2KVMA 4R4OA 3FMCA 3MTSA 2F3VA 3J81i 2JA8G 4YWKA 3CPWA 1MHWC 3J80L 2F4IA 3HOVB 1SBBB 3GDEA 1P8LA 4X62Q 2F0SA 1L1OC 3A8IE 4IJLA 3VDYA 2BE5D 2E2JH 2QCPX 1HTLD 1T5XD 3I55A 1EIGA 3CU7A 2Q8TA 2ICIA 3CRKC 3ICEA 1UNSA 4K0KQ 2B2TC 1PH5A 4OWWB 4GN4B 2CWAA 2Q2UA 2K14A 1HNXL 1WFQA 1ZKOA 1BUVT 1X65A 1PTOC 3OW2A 1PRTB 1STEA 1U4RA 1DZ1A 2VY3A 1NAPA 2IHEA 3K58A 1QZHA 1VQIA 1RCVD 1X32A 1EOVA 1H9RA 3C1EA 1HNZQ 2NWGA 4GS3A 3HKSA 2Y0SG 4IOCA 4KHZA 2KHIA 2KJXA 3GV6A 3Q6SA 1WTRA 4JI1L 5EPJA 4C3JH 1EFWA 1BVSA 1UEAB 2RCFA 1Y8NB 3CP0A 3FRPB 1N32L 5FO8B 1A3TA 3WOFA 1GM5A 4P72A 2RVLA 1YVCA 3GTGB 1YHBA 3G71A 1H9KA 2DNCA 2Q8RE 2FXQA 1VF7A 4G4KA 1JWSD 2NN6G 3BDOA 4P75A 3PO2H 5M5YB 2CFMA 4GLXA 1SYGA 1H9JA 3K5OA 5C3EH 3M3YH 2PYKA 5ELFA 1YI2A 2JA5H 3PIP3 5IODA 1HZBA 2B2WA 3R2TA 3WDNA 4A93G 1KD1C 1IBML 1LTLA 4KJNA 1MKHA 3KF6B 2L5TA 1RF2D 2OF1A 5JJKA 4IZ8A 1H9SB 1TS5A 1WTVA 4IUUA 1UE6A 2IX1A 1EQTA 5IT9E 3T1HL 4LF4L 5LHY1 3STBC 4A4IA 1LTAD 3Q0AA 4UHVA 4LUVA 1L0YB 1VQGA 5F2DA 4DGZA 1KRSA 2B63B 1OXUA 3HKZE 3PO3B 4BA1I 1VQFA 2WB1E 2B8GA 3TRZA 3I7FA 3D3RA 1SE3A 3I91A 1A0IA 4A3FB 4R1JA 4M1UB 1VQ8A 3B6YA 4UP7A 3FVQA 4EQ5A 1X3FA 1SYDA 3NBHA 5FLXc 4N8X1 1TWHB 1CA6A 1VQ6A 3OYYA 4BY1G 2KQ3A 3BU2A 3K7UC 1R4PB 3TP6A 1WYDA 1N9WA 2K7VA 1JB7A 3TDQA 3SXHA 1JE5A 3M85A 3CAMA 3TREA 3A0JA 4R8IA 1Y14B 3A55A 4R4CA 5ELNA 4FP5D 2NZOA 2K28A 1WOCA 1PH7A 2E2IB 1F9QA 4C3HG 1Y1WH 1W6KA 4F88A 1KQSA 3U4ZA 2ES2A 3QOJA 3CCJA 1G6ZA 3AFQA 2SEBD 2NZ1D 4DR6L 1X3GA 4DU9A 3CMEA 4ALPA 2K32A 2K1BA 4ZKBB 3LWUA 2EE1A 3T1HQ 4Q5VA 3JAML 4A76A 4LF4Q 1HJPA 2HCCA 1Q7YC 5IYDH 1HUMA 1ZXTA 1U9RA 1DD2A 5M3FG 4JI0L 3NQTA 2B8FA 1CI3M 2PO4A 2IHFA 4DV2Q 3P20A 3DXJC 1G6PA 4XXEA 2ALYB 1STBA 2EYOA 4X6AH 2DY7A 4A3MG 3J80c 1A15A 2NVXB 4EGVA 3KLSA 1DCZA 4DPGA 4DUZQ 2KHJA 3CCVA 1EEFD 2HDMA 5NUCA 2R7ZG 3IL8A 2HQLA 3E0JA 4GNXC 2XTIA 1SNMA 1AE3A 5D3DA 1NR2A 2R93B 3H0GB 3TS0A 1G2TA 5KNDA 4A3CH 4AYBG 5FO9B 5KYIA 1OO9B
chains in the Genus database with same CATH topology
2VZAA 2A8VA 4X65L 4OO1G 4DNIA 3F2DA 2UUCL 3A5UA 2C35B 1UE5A 1FJGL 3HOZG 2K4KA 2PMZE 3NEMA 5GQOA 2LSSA 1VQCA 2R6GA 1UWVA 4GN5A 2R7FA 1JJCB 1NMGA 4NXNL 2QGQA 3M4QA 4O0AA 2BA0A 4A3MH 4LW1A 2YTVA 4PZ7A 4LF6Q 3PIPA 3M7NA 2JA6H 4A3JG 1IYJB 4OX9Q 2H5XA 4NXMQ 1XNQQ 1LYLA 2GVAA 1PHJA 5C44G 4DV4Q 1N8RC 1SROA 2KENA 2NVTH 4GKKL 1P16A 3U4VA 3K80C 1I5FA 4IFDI 4KHPQ 2R7ZH 4AIMA 1HNXQ 1C0AA 2F52A 2OQ0A 4JOIC 3SGIA 3KJOA 1RL2A 3M4PA 1CUKA 2GN5A 4DV3L 3CXCA 2E5LL 4JI0Q 2I0QA 4BXXG 4A3BG 4DV0Q 3OTOQ 3HOUG 1K73C 1E1OA 1X54A 3G6EA 2YTXA 1B7YB 3CPFA 2ZJQA 1E24A 4HJ5A 1CSQA 3AQQA 4R4QA 4X62L 3L2PA 3CMAA 1XPRA 4IPDA 3HOZH 2DUDA 5ELOA 3L0OA 3GTKH 3K0XA 4APVA 1ASZA 4NB3A 1SR3A 3I56A 2HHHL 4JI2L 4JI1Q 4QL5A 1W3SA 3NBHB 2UXCL 3K8AA 3WWVA 4YCUA 4A3JH 4A3LG 1GKHA 3I4OA 3CF5A 4IPGA 3F2BA 1B70B 3G48A 5C44H 4K0KL 1CKNB 3HOWG 1I6HH 1N32Q 3PSIA 4YCVA 1XTDA 1VS0A 1Q1EA 1E7ZA 1JJ2A 3RR5A 2UU9L 3H3VI 4GKJL 1T9HA 3S2HH 1HR0L 2D62A 3PIOA 3ERSX 4BXXH 4A3EG 1IBKL 2K5NA 2ZJRA 4A3BH 2Q2HA 1GO3E 1I3QH 3HOUH 4X65Q 1R9TH 1RIPA 5K36G 2VS1A 4DR1L 1G291 3HOYG 2ZM6L 2HT1A 2UUCQ 2QA4A 3S17H 3F1ZA 3TS2A 1WCMG 2D0PA 1FJGQ 1CSPA 1HNZL 1I50H 5IP7G 2Z6KA 4LF8L 4A3IG 4A3GG 2R7DA 5IT9c 2YYZA 3ULJA 1U5KA 5BR8L 1QUQA 2RHQB 4DAMA 1IBMQ 4FDBA 3KYHC 4IPCA 4J15A 5IYCG 4IFDG 4DR4Q 4GKKQ 1Q1BA 3KJPA 3PGZA 4UPAA 3NENA 3M4OH 4A3LH 3HOWH 1NY4A 2Y0SE 1TXYA 5IP9G 1KAWA 4HJ7A 2A19A 5LMNL 3W1BA 3T1YL 1MIUA 2IX0A 4DV3Q 4GNXB 3K7AH 4JI5Q 1PH1A 4A75A 3UE1A 3CCRA 3HKZG 3TQYA 1TWCH 3J81j 4HIMA 4A3EH 1Z47A 2WAQG 4LUZA 2Q2TA 2F4VQ 4HIKA 2VUMG 4QY7A 2WB1G 4DK6C 3HOYH 4IFDJ 2Z6KC 4AQYL 4HIDA 1S3OA 1WCMH 4H02A 1PYBA 1S72A 4RG1A 1HZ9A 4GLAC 5IP7H 1TWAH 4AYBE 2MO0A 4A3IH 1SN8A 3PV0A 2HHHQ 4JI2Q 4B3TQ 2PNHA 3FP9A 1N33L 4BBSG 4A3GH 2UXDL 1TWGH 4DK3C 1V9PA 1HZAA 3F2CA 3G4SA 4BY7G 1VQ9A 5IYCH 3RLFA 2BA1A 1PH3A 4LFCL 1D8LA 1PH9A 1HH2P 4ME3A 2K50A 4UP8A 5IP9H 1QZGA 2UU9Q 2R92G 2AHOB 1HR0Q 1N36L 1VQKA 4POFA 2PQAB 1KXLA 2WP8J 4GOPA 4P73A 2KCMA 1Q81C 1KL9A 2UXBL 5JJLA 1V43A 4JI4L 4DR1Q 1XMQL 1EIYB 1HNWL 3GTOH 2CQOA 1XMOQ 2ZM6Q 2VUMH 5IWAL 2F3IA 4QQBX 2LXJA 5IYBG 4LF5L 1PH4A 4Y7NH 2JEAI 2V1CC 2YV5A 4LF8Q 1VCIA 5LMUL 3S14H 5M5YH 1VQAA 3CW2C 3KLWA 4JI7L 2RCNA 4L5SA 3I4NG 5BR8Q 2BH8A 3UDXA 1FGUA 2EXDA 3JAMc 4BBSH 2JQOA 1BKBA 4C3IH 2CKZB 4DV5Q 1PH2A 1K8GA 3RN5A 1YHAA 4R4TA 3TEHB 4YY3L 4BY7H 2L15A 1M90C 2MFIA 4YHHL 3JAMi 3H3VH 3RZOH 3GTLH 5LMNQ 4DR6Q 3T1YQ 4DR7L 4GOPC 2R92H 1MJCA 3PUVA 1U0LA 1WJJA 1M1KC 3H15A 1VQLA 2MNAA 4B3RQ 4DR5L 4B3SL 1C7YA 1K0RA 3RZDH 4QGUA 4JI8L 3U50C 2K5VA 3K81C 2QEXA 4JI6Q 3GTQH 4DV6L 3GO5A 3CCMA 1VQEA 5IYBH 3ULLA 2A1AA 1NMFA 3S16H 2EQSA 2OQKA 3GD7A 3A74A 2VQFL 3FKIG 4LNQA 3S15H 1K3RA 1UEBA 3BJUA 1NE3A 3KFUA 4DKAC 3I4NH 2PI2E 5DLQE 2UXDQ 1K8AC 3CC4A 2XGTA 5GAGC 3HOVG 3CC7A 2RHSB 1OTCA 2B3GA 1QVCA 1V1QA 4LFCQ 4QIWE 1C9OA 3HFZB 5M5WH 1IXRA 4GLVB 2VQEL 3I4MG 1N36Q 1KRTA 4O2DA 2NVQH 2UXBQ 3LGJA 4LUOA 2AMCB 2VNUD 1XNRL 1LUZA 3KF6A 3J7ZC 1VQ5A 4JI4Q 1XMQQ 3CQZH 5IY0A 1X55A 3S1RH 4LF9L 4DV7L 4POGA 1HNWQ 4OWXB 1X6OA 2MQHA 1D7QA 2B29A 4TQUS 5IE8A 3CD6A 4LF5Q 2EIFA 1BBWA 1VQPA 2N3SA 2OCEA 3MXNB 3U58A 5LMUQ 4RMFA 3S2DH 4JI7Q 1YJWA 1K83H 3FKIH 1QUQB 4DV2L 4DR3L 3J7A5 3UDIA 1FVIA 3CC2A 1HZCA 3ZJYC 4A93H 1AE2A 4IOAA 2I5MX 1OXSC 2MO1A 2NVYH 4YY3Q 3CCSA 3KDFB 4JBWA 1QVGA 3HOVH 1ASYA 1G51A 1L1OA 4YHHQ 5AJ3L 2ZJPA 4BBRG 4NXNQ 1DGSA 1EUJA 1PFSA 3RNUA 1J6QA 2JA7G 5M5XH 4DR7Q 1JJGA 1XPUA 2WFWA 2E2IH 1NJIC 4OWTB 4HJ8A 1YIJA 3I4MH 3E9HA 1N34L 3KDFA 4B3SQ 4DUZL 1YZ6A 3KF8B 3RN2A 3J81c 2HIVA 2K52A 4IJHA 4QJFA 5C0XI 4JI8Q 1IBLL 5E7NA 2N49A 1JT8A 4A3DG 5C4XG 4KI0A 4R4OA 1OXTA 4DV6Q 2E5LQ 3GTPH 1YEZA 3J81i 4YWKA 2VQFQ 3CPWA 2JA8G 4JYAL 2HIXA 3BZKA 3D0FA 3CCLA 1K9MC 2VL6A 1IL2A 3GDEA 1SRUA 1P8LA 4UY8C 4X62Q 4IJLA 1L1OC 2NN6I 3VDYA 5FLMG 1NBWA 1YITA 1EIFA 2AKWB 4B3ML 2E2JH 3CCEA 2IT1A 3I55A 4KLKA 5M3MG 1KHIA 1EWIA 4BBRH 4JV5L 3HOXG 4LF6L 2JA7H 4LF7L 3ICEA 2UXCQ 2ID0A 4GOPB 1S40A 1PH8A 1XNQL 1XNRQ 4K0KQ 1PH5A 4DR2L 4LF9Q 4OWWB 4DV7Q 4GN4B 2CWAA 2Q2UA 4GKJQ 2ZTCA 2K14A 1WI5A 1WFQA 1YNXA 1HNXL 4A3DH 1AH9A 5C4XH 4P71A 4JBKA 3W1GA 1IBKQ 1X65A 2JJQA 3UDGA 5GADC 2ASBA 5GAEC 3OW2A 2JA8H 1A8VA 3PO2G 1VQ4A 2IY5B 3FHWA 4OONA 2OTJA 2CWPA 3GTGH 2VY3A 2IHEA 3S24A 5C3EG 1VQIA 1QZHA 4JBJA 2JA5G 1EOVA 3RLOA 1HNZQ 4GS3A 3HKSA 4PMWA 5FLMH 4MTNA 2Y0SG 4IOCA 4KHZA 2KHIA 3E9IA 3PUZA 1O7IA 5M3MH 1UE7A 3S1QH 2B63G 3HOXH 2LXKA 1SMXA 4JI1L 3PCOB 1X56A 3PO3G 3KOJA 4C3JH 5C0XG 1EFWA 1BVSA 1OXVA 1E22A 1EQQA 3EN2A 3J80i 5H1SE 3CP0A 1IBLQ 4YWLA 1N32L 4A3KH 1Z9FA 4PG3A 1GM5A 2D0OA 4MNOA 4A3FG 4P72A 1YVCA 2N8NA 1YHBA 3G71A 4XIGS 4JYAQ 4Y52H 1YJ9A 1LM0A 2OTLA 1SE8A 1VQBA 1UE1A 3W5OA 5GAHC 2FXQA 5GROA 4HJ9A 2NN6G 2N78A 4P75A 3PO2H 3GTJH 4YWMA 2CFMA 4GLXA 3PUWA 4EX5A 3UE0A 4AQYQ 3BZCA 1KC8C 3F8TA 5C3EH 5C0XJ 1EYGA 1YI2A 1JMCA 4B3MQ 2JA5H 3M3YH 2Z0SA 1HZBA 4XTCS 4JV5Q 1TWFH 1N33Q 3EBEA 4LF7Q 4P74A 4A93G 1E3PA 1KD1C 3S1NH 1IBML 1LTLA 2B63H 4C2MH 2NZHA 3PO3H 1MKHA 3KF6B 2CCZA 2BH2A 2KCTA 4DR2Q 4DR4L 3UDFA 1Q86C 2KBNA 1VQNA 5JJKA 1FL0A 1PV4A 1A63A 1PYSB 4PZ6A 4A3FH 3JC66 4DV1L 1Y1VG 4JI5L 1UE6A 3DLLA 2IX1A 1VQMA 1X3EA 1Q12A 2RF4A 4GN3B 3EIVA 3T1HL 5IWAQ 2F4VL 4LF4L 4X64L 2I5HA 1GVPA 3STBC 1XPOA 1QVFA 4L5QA 3CCUA 1TWHH 4A4IA 4NPSA 1X9NA 2YU9H 4LUVA 1VQGA 1L1OB 1KRSA 1OXUA 1YBYA 3HKZE 4DUYL 4JC0A 5HY6A 2WAQE 4BA1I 1PH6A 1VQFA 3PF4A 4B3TL 1VQHA 2WB1E 1PA6A 3DM3A 1Y1WG 4OXPA 4X66L 3I7FA 3TRZA 4TVAB 1J5EL 1A0IA 3Q8DA 4JCVE 2UUBL 3PUYA 4R1JA 1SLJA 4LFBL 1VQ8A 3B6YA 1Q46A 3ER0A 4UP7A 3IRBA 1VQ7A 1HR0W 4IPHA 4EQ5A 1X3FA 1SFOH 5FLXc 4DR5Q 4HJAA 4LFAL 1Y1VH 5FJ8G 2ATWA 1VQ6A 1CKNA 3OYYA 4DAYB 4BY1G 5IYDG 4WJ4A 3NELA 3MEFA 2E8GA 3PUXA 5C4JH 1XMOL 4JI3L 3STBD 3AEVA 3BU2A 3K7UC 1YHQA 1WYDA 3ULPA 1N9WA 2UUAL 1H95A 1JB7A 1B8AA 2R93G 3H0GG 1JE5A 4YCWA 3M85A 1I94L 1CKOA 3CAMA 3TREA 3A0JA 1Y14B 2Q2IA 2VW9A 4R4CA 5ELNA 2OWOA 2I5LX 2NZOA 4OO1I 1WOCA 2AWNA 4DV5L 3E0EA 2JK8A 1PH7A 1Y1WH 1OXXK 1KQSA 3U4ZA 2ES2A 2JEBI 2GVBA 2ZTDA 3CCJA 3RLNA 1IZ6A 4LWCA 3AFQA 2VQEQ 5LMNW 1VQDA 1W2BA 1X3GA 4DR6L 4DV1Q 4OX9L 3L7ZC 3D31A 4NXML 3AYHB 1XJVA 3A5ZB 1L2FA 4L5TA 3CMEA 4L5RC 4DV4L 1CKMA 4ALPA 5J3BA 1YJNA 1MJEA 4A3KG 3GTMH 4B3RL 5JJIA 3T1HQ 5FJ8H 4A76A 2NVXH 4LF4Q 3S1MH 4KHPL 4X64Q 4BY1H 1HJPA 5IYDH 1Q7YC 3PF5A 4AH6A 4BA2I 4GNXA 4A3CG 4JI6L 3AFPA 1L0WA 5M3FG 4JG2A 4JI0L 2AWOA 4DV0L 4R4IA 2K75A 3OTOL 4DUYQ 2IHFA 4DR3Q 2JE6I 2ZTEA 4DV2Q 2R93H 3H0GH 2JA9A 5HGQA 1VQOA 4JBMA 1G6PA 2ALYB 4X66Q 4WJ3M 1J5EQ 4X6AH 2YTYA 1BBUA 5AJ3Q 2UUBQ 1A62A 4MZ9A 4PZ8A 4C3HH 5JEAG 4A3MG 4LFBQ 2K5HA 3J80c 1EQRA 1E1TA 1PVOA 1KIXA 2JA6G 1VQJA 4HIOA 1N34Q 4LFAQ 4DPGA 4DUZQ 2KHJA 3CCVA 5EAYA 1Q82C 1NTGA 2R7ZG 2E2HH 2HQLA 4UP9A 4GNXC 2XTIA 1Q8KA 4JI3Q 3I2ZA 1AE3A 3TS0A 3M9BA 4JOIA 3CCQA 4IO9A 2PI2A 2UUAQ 2PQAA 4A3CH 1GD7A 5JEAJ 5M3FH 4AYBG 1I94Q 2DGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VZA A;  2A8V A;  4X65 L;  4OO1 G;  4DNI A;  3F2D A;  2UUC L;  3A5U A;  2C35 B;  1UE5 A;  1FJG L;  3HOZ G;  2K4K A;  2PMZ E;  3NEM A;  5GQO A;  2LSS A;  1VQC A;  2R6G A;  1UWV A;  4GN5 A;  2R7F A;  1JJC B;  1NMG A;  4NXN L;  2QGQ A;  3M4Q A;  4O0A A;  2BA0 A;  4A3M H;  4LW1 A;  2YTV A;  4PZ7 A;  4LF6 Q;  3PIP A;  3M7N A;  2JA6 H;  4A3J G;  1IYJ B;  4OX9 Q;  2H5X A;  4NXM Q;  1XNQ Q;  1LYL A;  2GVA A;  1PHJ A;  5C44 G;  4DV4 Q;  1N8R C;  1SRO A;  2KEN A;  2NVT H;  4GKK L;  1P16 A;  3U4V A;  3K80 C;  1I5F A;  4IFD I;  4KHP Q;  2R7Z H;  4AIM A;  1HNX Q;  1C0A A;  2F52 A;  2OQ0 A;  4JOI C;  3SGI A;  3KJO A;  1RL2 A;  3M4P A;  1CUK A;  2GN5 A;  4DV3 L;  3CXC A;  2E5L L;  4JI0 Q;  2I0Q A;  4BXX G;  4A3B G;  4DV0 Q;  3OTO Q;  3HOU G;  1K73 C;  1E1O A;  1X54 A;  3G6E A;  2YTX A;  1B7Y B;  3CPF A;  2ZJQ A;  1E24 A;  4HJ5 A;  1CSQ A;  3AQQ A;  4R4Q A;  4X62 L;  3L2P A;  3CMA A;  1XPR A;  4IPD A;  3HOZ H;  2DUD A;  5ELO A;  3L0O A;  3GTK H;  3K0X A;  4APV A;  1ASZ A;  4NB3 A;  1SR3 A;  3I56 A;  2HHH L;  4JI2 L;  4JI1 Q;  4QL5 A;  1W3S A;  3NBH B;  2UXC L;  3K8A A;  3WWV A;  4YCU A;  4A3J H;  4A3L G;  1GKH A;  3I4O A;  3CF5 A;  4IPG A;  3F2B A;  1B70 B;  3G48 A;  5C44 H;  4K0K L;  1CKN B;  3HOW G;  1I6H H;  1N32 Q;  3PSI A;  4YCV A;  1XTD A;  1VS0 A;  1Q1E A;  1E7Z A;  1JJ2 A;  3RR5 A;  2UU9 L;  3H3V I;  4GKJ L;  1T9H A;  3S2H H;  1HR0 L;  2D62 A;  3PIO A;  3ERS X;  4BXX H;  4A3E G;  1IBK L;  2K5N A;  2ZJR A;  4A3B H;  2Q2H A;  1GO3 E;  1I3Q H;  3HOU H;  4X65 Q;  1R9T H;  1RIP A;  5K36 G;  2VS1 A;  4DR1 L;  1G29 1;  3HOY G;  2ZM6 L;  2HT1 A;  2UUC Q;  2QA4 A;  3S17 H;  3F1Z A;  3TS2 A;  1WCM G;  2D0P A;  1FJG Q;  1CSP A;  1HNZ L;  1I50 H;  5IP7 G;  2Z6K A;  4LF8 L;  4A3I G;  4A3G G;  2R7D A;  5IT9 c;  2YYZ A;  3ULJ A;  1U5K A;  5BR8 L;  1QUQ A;  2RHQ B;  4DAM A;  1IBM Q;  4FDB A;  3KYH C;  4IPC A;  4J15 A;  5IYC G;  4IFD G;  4DR4 Q;  4GKK Q;  1Q1B A;  3KJP A;  3PGZ A;  4UPA A;  3NEN A;  3M4O H;  4A3L H;  3HOW H;  1NY4 A;  2Y0S E;  1TXY A;  5IP9 G;  1KAW A;  4HJ7 A;  2A19 A;  5LMN L;  3W1B A;  3T1Y L;  1MIU A;  2IX0 A;  4DV3 Q;  4GNX B;  3K7A H;  4JI5 Q;  1PH1 A;  4A75 A;  3UE1 A;  3CCR A;  3HKZ G;  3TQY A;  1TWC H;  3J81 j;  4HIM A;  4A3E H;  1Z47 A;  2WAQ G;  4LUZ A;  2Q2T A;  2F4V Q;  4HIK A;  2VUM G;  4QY7 A;  2WB1 G;  4DK6 C;  3HOY H;  4IFD J;  2Z6K C;  4AQY L;  4HID A;  1S3O A;  1WCM H;  4H02 A;  1PYB A;  1S72 A;  4RG1 A;  1HZ9 A;  4GLA C;  5IP7 H;  1TWA H;  4AYB E;  2MO0 A;  4A3I H;  1SN8 A;  3PV0 A;  2HHH Q;  4JI2 Q;  4B3T Q;  2PNH A;  3FP9 A;  1N33 L;  4BBS G;  4A3G H;  2UXD L;  1TWG H;  4DK3 C;  1V9P A;  1HZA A;  3F2C A;  3G4S A;  4BY7 G;  1VQ9 A;  5IYC H;  3RLF A;  2BA1 A;  1PH3 A;  4LFC L;  1D8L A;  1PH9 A;  1HH2 P;  4ME3 A;  2K50 A;  4UP8 A;  5IP9 H;  1QZG A;  2UU9 Q;  2R92 G;  2AHO B;  1HR0 Q;  1N36 L;  1VQK A;  4POF A;  2PQA B;  1KXL A;  2WP8 J;  4GOP A;  4P73 A;  2KCM A;  1Q81 C;  1KL9 A;  2UXB L;  5JJL A;  1V43 A;  4JI4 L;  4DR1 Q;  1XMQ L;  1EIY B;  1HNW L;  3GTO H;  2CQO A;  1XMO Q;  2ZM6 Q;  2VUM H;  5IWA L;  2F3I A;  4QQB X;  2LXJ A;  5IYB G;  4LF5 L;  1PH4 A;  4Y7N H;  2JEA I;  2V1C C;  2YV5 A;  4LF8 Q;  1VCI A;  5LMU L;  3S14 H;  5M5Y H;  1VQA A;  3CW2 C;  3KLW A;  4JI7 L;  2RCN A;  4L5S A;  3I4N G;  5BR8 Q;  2BH8 A;  3UDX A;  1FGU A;  2EXD A;  3JAM c;  4BBS H;  2JQO A;  1BKB A;  4C3I H;  2CKZ B;  4DV5 Q;  1PH2 A;  1K8G A;  3RN5 A;  1YHA A;  4R4T A;  3TEH B;  4YY3 L;  4BY7 H;  2L15 A;  1M90 C;  2MFI A;  4YHH L;  3JAM i;  3H3V H;  3RZO H;  3GTL H;  5LMN Q;  4DR6 Q;  3T1Y Q;  4DR7 L;  4GOP C;  2R92 H;  1MJC A;  3PUV A;  1U0L A;  1WJJ A;  1M1K C;  3H15 A;  1VQL A;  2MNA A;  4B3R Q;  4DR5 L;  4B3S L;  1C7Y A;  1K0R A;  3RZD H;  4QGU A;  4JI8 L;  3U50 C;  2K5V A;  3K81 C;  2QEX A;  4JI6 Q;  3GTQ H;  4DV6 L;  3GO5 A;  3CCM A;  1VQE A;  5IYB H;  3ULL A;  2A1A A;  1NMF A;  3S16 H;  2EQS A;  2OQK A;  3GD7 A;  3A74 A;  2VQF L;  3FKI G;  4LNQ A;  3S15 H;  1K3R A;  1UEB A;  3BJU A;  1NE3 A;  3KFU A;  4DKA C;  3I4N H;  2PI2 E;  5DLQ E;  2UXD Q;  1K8A C;  3CC4 A;  2XGT A;  5GAG C;  3HOV G;  3CC7 A;  2RHS B;  1OTC A;  2B3G A;  1QVC A;  1V1Q A;  4LFC Q;  4QIW E;  1C9O A;  3HFZ B;  5M5W H;  1IXR A;  4GLV B;  2VQE L;  3I4M G;  1N36 Q;  1KRT A;  4O2D A;  2NVQ H;  2UXB Q;  3LGJ A;  4LUO A;  2AMC B;  2VNU D;  1XNR L;  1LUZ A;  3KF6 A;  3J7Z C;  1VQ5 A;  4JI4 Q;  1XMQ Q;  3CQZ H;  5IY0 A;  1X55 A;  3S1R H;  4LF9 L;  4DV7 L;  4POG A;  1HNW Q;  4OWX B;  1X6O A;  2MQH A;  1D7Q A;  2B29 A;  4TQU S;  5IE8 A;  3CD6 A;  4LF5 Q;  2EIF A;  1BBW A;  1VQP A;  2N3S A;  2OCE A;  3MXN B;  3U58 A;  5LMU Q;  4RMF A;  3S2D H;  4JI7 Q;  1YJW A;  1K83 H;  3FKI H;  1QUQ B;  4DV2 L;  4DR3 L;  3J7A 5;  3UDI A;  1FVI A;  3CC2 A;  1HZC A;  3ZJY C;  4A93 H;  1AE2 A;  4IOA A;  2I5M X;  1OXS C;  2MO1 A;  2NVY H;  4YY3 Q;  3CCS A;  3KDF B;  4JBW A;  1QVG A;  3HOV H;  1ASY A;  1G51 A;  1L1O A;  4YHH Q;  5AJ3 L;  2ZJP A;  4BBR G;  4NXN Q;  1DGS A;  1EUJ A;  1PFS A;  3RNU A;  1J6Q A;  2JA7 G;  5M5X H;  4DR7 Q;  1JJG A;  1XPU A;  2WFW A;  2E2I H;  1NJI C;  4OWT B;  4HJ8 A;  1YIJ A;  3I4M H;  3E9H A;  1N34 L;  3KDF A;  4B3S Q;  4DUZ L;  1YZ6 A;  3KF8 B;  3RN2 A;  3J81 c;  2HIV A;  2K52 A;  4IJH A;  4QJF A;  5C0X I;  4JI8 Q;  1IBL L;  5E7N A;  2N49 A;  1JT8 A;  4A3D G;  5C4X G;  4KI0 A;  4R4O A;  1OXT A;  4DV6 Q;  2E5L Q;  3GTP H;  1YEZ A;  3J81 i;  4YWK A;  2VQF Q;  3CPW A;  2JA8 G;  4JYA L;  2HIX A;  3BZK A;  3D0F A;  3CCL A;  1K9M C;  2VL6 A;  1IL2 A;  3GDE A;  1SRU A;  1P8L A;  4UY8 C;  4X62 Q;  4IJL A;  1L1O C;  2NN6 I;  3VDY A;  5FLM G;  1NBW A;  1YIT A;  1EIF A;  2AKW B;  4B3M L;  2E2J H;  3CCE A;  2IT1 A;  3I55 A;  4KLK A;  5M3M G;  1KHI A;  1EWI A;  4BBR H;  4JV5 L;  3HOX G;  4LF6 L;  2JA7 H;  4LF7 L;  3ICE A;  2UXC Q;  2ID0 A;  4GOP B;  1S40 A;  1PH8 A;  1XNQ L;  1XNR Q;  4K0K Q;  1PH5 A;  4DR2 L;  4LF9 Q;  4OWW B;  4DV7 Q;  4GN4 B;  2CWA A;  2Q2U A;  4GKJ Q;  2ZTC A;  2K14 A;  1WI5 A;  1WFQ A;  1YNX A;  1HNX L;  4A3D H;  1AH9 A;  5C4X H;  4P71 A;  4JBK A;  3W1G A;  1IBK Q;  1X65 A;  2JJQ A;  3UDG A;  5GAD C;  2ASB A;  5GAE C;  3OW2 A;  2JA8 H;  1A8V A;  3PO2 G;  1VQ4 A;  2IY5 B;  3FHW A;  4OON A;  2OTJ A;  2CWP A;  3GTG H;  2VY3 A;  2IHE A;  3S24 A;  5C3E G;  1VQI A;  1QZH A;  4JBJ A;  2JA5 G;  1EOV A;  3RLO A;  1HNZ Q;  4GS3 A;  3HKS A;  4PMW A;  5FLM H;  4MTN A;  2Y0S G;  4IOC A;  4KHZ A;  2KHI A;  3E9I A;  3PUZ A;  1O7I A;  5M3M H;  1UE7 A;  3S1Q H;  2B63 G;  3HOX H;  2LXK A;  1SMX A;  4JI1 L;  3PCO B;  1X56 A;  3PO3 G;  3KOJ A;  4C3J H;  5C0X G;  1EFW A;  1BVS A;  1OXV A;  1E22 A;  1EQQ A;  3EN2 A;  3J80 i;  5H1S E;  3CP0 A;  1IBL Q;  4YWL A;  1N32 L;  4A3K H;  1Z9F A;  4PG3 A;  1GM5 A;  2D0O A;  4MNO A;  4A3F G;  4P72 A;  1YVC A;  2N8N A;  1YHB A;  3G71 A;  4XIG S;  4JYA Q;  4Y52 H;  1YJ9 A;  1LM0 A;  2OTL A;  1SE8 A;  1VQB A;  1UE1 A;  3W5O A;  5GAH C;  2FXQ A;  5GRO A;  4HJ9 A;  2NN6 G;  2N78 A;  4P75 A;  3PO2 H;  3GTJ H;  4YWM A;  2CFM A;  4GLX A;  3PUW A;  4EX5 A;  3UE0 A;  4AQY Q;  3BZC A;  1KC8 C;  3F8T A;  5C3E H;  5C0X J;  1EYG A;  1YI2 A;  1JMC A;  4B3M Q;  2JA5 H;  3M3Y H;  2Z0S A;  1HZB A;  4XTC S;  4JV5 Q;  1TWF H;  1N33 Q;  3EBE A;  4LF7 Q;  4P74 A;  4A93 G;  1E3P A;  1KD1 C;  3S1N H;  1IBM L;  1LTL A;  2B63 H;  4C2M H;  2NZH A;  3PO3 H;  1MKH A;  3KF6 B;  2CCZ A;  2BH2 A;  2KCT A;  4DR2 Q;  4DR4 L;  3UDF A;  1Q86 C;  2KBN A;  1VQN A;  5JJK A;  1FL0 A;  1PV4 A;  1A63 A;  1PYS B;  4PZ6 A;  4A3F H;  3JC6 6;  4DV1 L;  1Y1V G;  4JI5 L;  1UE6 A;  3DLL A;  2IX1 A;  1VQM A;  1X3E A;  1Q12 A;  2RF4 A;  4GN3 B;  3EIV A;  3T1H L;  5IWA Q;  2F4V L;  4LF4 L;  4X64 L;  2I5H A;  1GVP A;  3STB C;  1XPO A;  1QVF A;  4L5Q A;  3CCU A;  1TWH H;  4A4I A;  4NPS A;  1X9N A;  2YU9 H;  4LUV A;  1VQG A;  1L1O B;  1KRS A;  1OXU A;  1YBY A;  3HKZ E;  4DUY L;  4JC0 A;  5HY6 A;  2WAQ E;  4BA1 I;  1PH6 A;  1VQF A;  3PF4 A;  4B3T L;  1VQH A;  2WB1 E;  1PA6 A;  3DM3 A;  1Y1W G;  4OXP A;  4X66 L;  3I7F A;  3TRZ A;  4TVA B;  1J5E L;  1A0I A;  3Q8D A;  4JCV E;  2UUB L;  3PUY A;  4R1J A;  1SLJ A;  4LFB L;  1VQ8 A;  3B6Y A;  1Q46 A;  3ER0 A;  4UP7 A;  3IRB A;  1VQ7 A;  1HR0 W;  4IPH A;  4EQ5 A;  1X3F A;  1SFO H;  5FLX c;  4DR5 Q;  4HJA A;  4LFA L;  1Y1V H;  5FJ8 G;  2ATW A;  1VQ6 A;  1CKN A;  3OYY A;  4DAY B;  4BY1 G;  5IYD G;  4WJ4 A;  3NEL A;  3MEF A;  2E8G A;  3PUX A;  5C4J H;  1XMO L;  4JI3 L;  3STB D;  3AEV A;  3BU2 A;  3K7U C;  1YHQ A;  1WYD A;  3ULP A;  1N9W A;  2UUA L;  1H95 A;  1JB7 A;  1B8A A;  2R93 G;  3H0G G;  1JE5 A;  4YCW A;  3M85 A;  1I94 L;  1CKO A;  3CAM A;  3TRE A;  3A0J A;  1Y14 B;  2Q2I A;  2VW9 A;  4R4C A;  5ELN A;  2OWO A;  2I5L X;  2NZO A;  4OO1 I;  1WOC A;  2AWN A;  4DV5 L;  3E0E A;  2JK8 A;  1PH7 A;  1Y1W H;  1OXX K;  1KQS A;  3U4Z A;  2ES2 A;  2JEB I;  2GVB A;  2ZTD A;  3CCJ A;  3RLN A;  1IZ6 A;  4LWC A;  3AFQ A;  2VQE Q;  5LMN W;  1VQD A;  1W2B A;  1X3G A;  4DR6 L;  4DV1 Q;  4OX9 L;  3L7Z C;  3D31 A;  4NXM L;  3AYH B;  1XJV A;  3A5Z B;  1L2F A;  4L5T A;  3CME A;  4L5R C;  4DV4 L;  1CKM A;  4ALP A;  5J3B A;  1YJN A;  1MJE A;  4A3K G;  3GTM H;  4B3R L;  5JJI A;  3T1H Q;  5FJ8 H;  4A76 A;  2NVX H;  4LF4 Q;  3S1M H;  4KHP L;  4X64 Q;  4BY1 H;  1HJP A;  5IYD H;  1Q7Y C;  3PF5 A;  4AH6 A;  4BA2 I;  4GNX A;  4A3C G;  4JI6 L;  3AFP A;  1L0W A;  5M3F G;  4JG2 A;  4JI0 L;  2AWO A;  4DV0 L;  4R4I A;  2K75 A;  3OTO L;  4DUY Q;  2IHF A;  4DR3 Q;  2JE6 I;  2ZTE A;  4DV2 Q;  2R93 H;  3H0G H;  2JA9 A;  5HGQ A;  1VQO A;  4JBM A;  1G6P A;  2ALY B;  4X66 Q;  4WJ3 M;  1J5E Q;  4X6A H;  2YTY A;  1BBU A;  5AJ3 Q;  2UUB Q;  1A62 A;  4MZ9 A;  4PZ8 A;  4C3H H;  5JEA G;  4A3M G;  4LFB Q;  2K5H A;  3J80 c;  1EQR A;  1E1T A;  1PVO A;  1KIX A;  2JA6 G;  1VQJ A;  4HIO A;  1N34 Q;  4LFA Q;  4DPG A;  4DUZ Q;  2KHJ A;  3CCV A;  5EAY A;  1Q82 C;  1NTG A;  2R7Z G;  2E2H H;  2HQL A;  4UP9 A;  4GNX C;  2XTI A;  1Q8K A;  4JI3 Q;  3I2Z A;  1AE3 A;  3TS0 A;  3M9B A;  4JOI A;  3CCQ A;  4IO9 A;  2PI2 A;  2UUA Q;  2PQA A;  4A3C H;  1GD7 A;  5JEA J;  5M3F H;  4AYB G;  1I94 Q;  2DGY A; 
#chains in the Genus database with same CATH topology
 4B08 A;  4OO1 G;  4X3K A;  2UUC L;  2G9D A;  2LSS A;  4GN5 A;  2R7F A;  1NMG A;  3M4Q A;  2VB2 X;  2BA0 A;  3OWE B;  4A3K B;  4J1M A;  1XNQ Q;  5C44 G;  1DJR D;  3GQB A;  5ELB A;  4IFD I;  1LTS D;  2CH4 W;  1I4Q A;  4AIM A;  1C0A A;  2F52 A;  3EQL C;  3P7J A;  3SGI A;  1RL2 A;  4JI0 Q;  1QWY A;  3VYR A;  1G8Z D;  4L8J A;  3J7A F;  1SJH D;  3CPF A;  1E24 A;  1EU4 A;  3TZD A;  1E2W A;  4R4Q A;  2L12 A;  1Q90 A;  4QUC A;  2Q8I B;  5FLX E;  5I6W A;  3EFX D;  5C3X A;  2DUD A;  2IX3 A;  2K5Q A;  2KOL A;  1D5X C;  1SR3 A;  3I56 A;  3NBH B;  1F9R A;  2E76 C;  4A3J H;  4CDF C;  4FF1 A;  4A3L G;  1CFM A;  3CF5 A;  3I4O A;  2F1M A;  3MHB A;  4IPG A;  1B70 B;  1I6H H;  1E7Z A;  3RR5 A;  2L55 A;  1RTO A;  5KEE A;  2O5I C;  3S2H H;  3DWA A;  2H1E A;  5C5L A;  1HR0 L;  1BO0 A;  2K5N A;  4A3B H;  1GO3 E;  1RDP D;  5K36 G;  2VS1 A;  2ZM6 L;  2UUC Q;  3S17 H;  3F1Z A;  2X6L A;  5IP7 G;  4LF8 L;  4G7Z C;  4ZRZ A;  2WKC A;  5KGU A;  2XRQ D;  4C1N K;  1GUO A;  2R61 A;  1PZK D;  3BZD B;  4MHE A;  1UAP A;  1FYC A;  1I3Q B;  3HOU B;  3QO2 A;  3W1B A;  1R9T B;  3K7A H;  1C8C A;  2EY5 A;  3HZX A;  1PH1 A;  2KCC A;  1PZJ D;  3HKZ G;  1TWC H;  1EY0 A;  3V2T A;  4A3E H;  4NMZ A;  1Z47 A;  4LUZ A;  5FOB B;  4J6H A;  2WB1 G;  1BQQ T;  3J7A V;  2Z6K C;  2H4O A;  4AQY L;  1EZ8 A;  3M4O B;  4C3I G;  4A3G H;  3NPP A;  1HZA A;  3F2C A;  4BY7 G;  4IFD H;  2BA1 A;  3A7A B;  4LFC L;  3OW7 A;  2O2L D;  1D8L A;  2O5J C;  3A56 A;  4J8Q A;  2F0K A;  1HR0 Q;  1N36 L;  1VQK A;  1KXL A;  2KCM A;  1Q81 C;  3HOY B;  2UXB L;  1VMP A;  2EY1 A;  1XMQ L;  2CQO A;  1XMO Q;  2ZM6 Q;  4QIW B;  1TWA B;  4QQB X;  1PH4 A;  2YV5 A;  3H09 A;  4LF8 Q;  3S14 H;  5M5Y H;  3KLW A;  1Q3L A;  2M00 A;  4KY5 A;  2BH8 A;  3JAM c;  1S5E D;  2JQO A;  2M9V A;  4DNT B;  4G7O C;  1YHA A;  2EJG C;  4YHH L;  5K5P A;  1JWU D;  5IGC A;  2K01 A;  1MJC A;  3MEH A;  3PUV A;  1U0L A;  3GTO B;  1A6X A;  4IQZ A;  1BCP F;  4B3R Q;  4DR5 L;  2AUJ D;  1C7Y A;  1K0R A;  1SJE D;  5J22 A;  2TMP A;  4DV6 L;  3GO5 A;  2B2Y A;  5IYB H;  2F0L A;  3NHH A;  2EQS A;  1PRT C;  2VQF L;  3FKI G;  4FXD A;  5COR A;  1K3R A;  1NE3 A;  5DLQ E;  3HOV G;  1X3Q A;  2R92 B;  3C2P A;  1RD9 D;  2EYL A;  4LFC Q;  1V1Q A;  2MGS A;  3X3M A;  1TT2 A;  1IXR A;  4GLV B;  4WRD A;  2VQE L;  1F2M A;  1N36 Q;  1EZ6 A;  4FYD A;  4O2D A;  2UXB Q;  1F2Y A;  4LUO A;  1AEX A;  1I4H A;  1VQ5 A;  1XMQ Q;  5IY0 A;  3S16 B;  4LF9 L;  4DV7 L;  4POG A;  4OWX B;  1X6O A;  2MQH A;  3S15 B;  4TQU S;  5IE8 A;  3CD6 A;  3BVG A;  1K83 H;  1LTB D;  1S5C D;  3R3O A;  4KJO A;  4DR3 L;  1FVI A;  4E6I A;  1AE2 A;  3T13 A;  4IOA A;  1E2V A;  2MO1 A;  2F0J A;  3KDF B;  1ASY A;  4YHH Q;  3VR3 A;  4NXN Q;  3CHB D;  5J39 A;  5JPM C;  2BOS A;  2E2I H;  3CQZ B;  1XPU A;  3HS0 C;  2AQ1 B;  1STN A;  2B2U C;  4PMC A;  5E7N A;  2N49 A;  5A2Q L;  4DV6 Q;  2E5L Q;  1ZYR D;  2NTT A;  3KBG A;  2F0V A;  4H44 C;  2VQF Q;  1TY2 A;  1Z7T A;  3D0F A;  2QF7 A;  2VL6 A;  2AQ2 B;  2NN6 I;  4EVO A;  5M5X B;  5FLM G;  1EIF A;  3MFG A;  4N9T A;  3CCE A;  3I4M B;  5M3M G;  4QMG A;  1JOK A;  2JA7 H;  4LF7 L;  4XT3 B;  2UXC Q;  2ID0 A;  1PH8 A;  3T16 A;  1ET9 A;  3MXG A;  2LKV A;  3GTP B;  4DR2 L;  4LF9 Q;  1I4X A;  2JN4 A;  4DV7 Q;  4GKJ Q;  2ZTC A;  1MGS A;  4HTH A;  2A73 B;  3MZ5 A;  1DXM A;  4P71 A;  5C4X H;  5KRU A;  4JBK A;  3T53 B;  2JJQ A;  4UAI A;  1YNN C;  2JA8 H;  1ICW A;  4KKU A;  3FHW A;  5D14 A;  2OTJ A;  2CWP A;  2PCF B;  4QB4 A;  1BCP C;  4BS9 A;  3S24 A;  1JB3 A;  4JBJ A;  4BBR B;  3RLO A;  4PMW A;  5EBC A;  3E9I A;  3PUZ A;  1UE7 A;  3S1Q H;  2B63 G;  1AN8 A;  1SMX A;  3TME A;  3G7L A;  2CH4 A;  3PO3 G;  1K28 A;  5C0X G;  1OXV A;  4A3D B;  1IYV A;  1EQQ A;  3EN2 A;  3J80 i;  3V05 A;  4NW2 A;  1STH A;  5E3F A;  4A3K H;  1Z9F A;  4PG3 A;  2D0O A;  3I4L A;  4MNO A;  4A3F G;  4RWS C;  5JPN C;  1FR3 A;  4XIG S;  1LTR D;  4P2C B;  2R3Z A;  1VQB A;  1UE1 A;  2X69 A;  1PTO D;  3DMU A;  5GRO A;  1FNW A;  2N78 A;  3HG9 A;  2LS0 1;  4YWM A;  1DYQ A;  3VR4 A;  2A6E C;  4KY7 A;  5EKK A;  5C0X J;  4C3I B;  3HOX B;  3Q23 A;  2Z0S A;  1HUN A;  2WKD A;  4O42 A;  3AMU A;  5E4W C;  1TWF H;  1N33 Q;  3EBE A;  4K14 A;  4P74 A;  4LF7 Q;  1VF5 C;  3S1N H;  3OIQ A;  1EQV A;  4C2M H;  3DWQ A;  4CDC C;  1GUN A;  2CCZ A;  2KCT A;  4DR2 Q;  4X3S A;  2KBN A;  1WTQ A;  3NBI A;  1FL0 A;  4H0L C;  1PV4 A;  3MVV A;  3RZD B;  4DAV A;  4OIK A;  3GTJ B;  3JC6 6;  4DV1 L;  1MSH A;  1Y1V G;  4JI5 L;  3SHL A;  1X3E A;  2JXM B;  1O7L A;  2EY2 A;  5IWA Q;  2PPB C;  2NN6 H;  2F0G A;  4L5Q A;  1S4Z A;  2B2W C;  2YU9 H;  3K57 A;  1KTK A;  4DUY L;  2NTS A;  5COY A;  4JC0 A;  2B2V A;  5HY6 A;  3I8Z A;  3VYT A;  4B3T L;  1PFN A;  1PA6 A;  3DM3 A;  4X66 L;  1J5E L;  2KEC A;  1GUG A;  1A2U A;  3DEO A;  3ER0 A;  3MFY A;  4HN7 A;  1HR0 W;  1CHP D;  2F0U A;  4HJA A;  5FJ8 G;  4WJW A;  4ZUJ A;  1ILP A;  3NEL A;  3PUX A;  4PV1 C;  5IGE A;  2VXW A;  2RBM A;  3STB D;  3AEV A;  2K03 A;  5BN5 A;  1EY7 A;  1H95 A;  1B8A A;  2R93 G;  3H0G G;  2VW9 A;  5JJZ A;  4OO1 I;  4RGT A;  3KBX A;  4DV5 L;  2JK8 A;  1I4R A;  1OXX K;  2GVB A;  4X3T A;  2KUM A;  1EYC A;  1IZ6 A;  4DV1 Q;  1W6J A;  3D31 A;  5C4J B;  3AYH B;  3A5Z B;  4G7H C;  1HFN A;  1LT4 D;  1HA5 A;  5J3B A;  5DM7 3;  4A3K G;  1MJE A;  1HCZ A;  2XVS A;  2CW0 D;  1MSG A;  4KHP L;  4BY1 H;  5DEH A;  4JI6 L;  4DV0 L;  4R4I A;  2K75 A;  4YIJ A;  4DUY Q;  1NSN S;  5CV4 A;  3E5S A;  1MI2 A;  1VQO A;  3SK4 A;  4X66 Q;  2A6H C;  1J5E Q;  1BBU A;  5AJ3 Q;  4PZ8 A;  4C3H H;  2LFN A;  1EQR A;  1PVO A;  4FXK C;  3GTM B;  3QJY A;  1VQJ A;  4HIO A;  3S1M B;  1N34 Q;  5EAY A;  2EOT A;  3ERQ A;  4UP9 A;  4KKT A;  1Q8K A;  4JOI A;  4EQN A;  3CCQ A;  4K8J A;  4DK1 A;  5M3F H;  2FMC A;  1CA5 A;  4RKB A;  2DGY A;  4NP5 A;  5M3M B;  1WTW A;  4C1N I;  1FJG L;  5C4Z A;  2PMZ E;  5GQO A;  4IUV A;  1WTO A;  4DK0 A;  2QGQ A;  5CGK A;  4A3M H;  1J9O A;  3PIP A;  3VR5 A;  1LV9 A;  2K04 A;  4I65 A;  4XQJ A;  2F0N A;  2KEN A;  2NVT H;  2SNM A;  3D6W A;  1F2Z A;  2RDF A;  3U4V A;  3K80 C;  4KHP Q;  2R7Z H;  4HMI A;  5KYL A;  3TP5 A;  1HNX Q;  2QDB A;  1CUK A;  2GN5 A;  3CXC A;  4DV0 Q;  3HOU G;  1K73 C;  1F2L A;  1X54 A;  2YTX A;  4OO1 H;  4HJ5 A;  1CSQ A;  3OMC A;  4KD4 A;  1XPR A;  2JA6 B;  4IPD A;  3J81 L;  1EYD A;  1ASZ A;  4NB3 A;  4ILW A;  4JI1 Q;  3KLR A;  4QL5 A;  3QOL A;  4TKO B;  3K8A A;  3WWV A;  4YCU A;  1GKH A;  4H7B A;  5C44 H;  3G48 A;  1N32 Q;  1PDQ A;  1XTD A;  1VS0 A;  1Q1E A;  1JJ2 A;  5EPK A;  2D62 A;  1JOO A;  4K6D A;  1IBK L;  4ZKC B;  2ZJR A;  2Q2H A;  3OIP A;  2CW0 C;  1O78 A;  4HCE A;  4UDU C;  1ML0 D;  4OHJ A;  2EZV A;  4MN3 A;  3HOZ B;  1G29 1;  3HOY G;  3GTK B;  2QA4 A;  2EYH A;  4KD3 A;  3TS2 A;  1FJG Q;  1CSP A;  1GXD C;  3MXN A;  1I50 H;  3M7G A;  4A3I G;  1EWC A;  2YYZ A;  1TS4 A;  4JPB W;  3H3V C;  2RHQ B;  5EGT A;  1IBM Q;  4IPC A;  4J15 A;  4L63 B;  1F77 A;  2E75 C;  3KJP A;  2N88 A;  3L3O C;  2XSC A;  4UPA A;  4A3L H;  1H9M A;  2EJM A;  1NY4 A;  5IP9 G;  1HFG A;  1Y1V B;  4HJ7 A;  2A19 A;  4HAE A;  3T1Y L;  1BDO A;  3SK8 A;  1BOS A;  4QCL A;  1CHQ D;  3GV3 A;  1AP0 A;  2WAC A;  3KF8 A;  5K36 H;  2L9H A;  5C5M A;  3TP7 A;  2SNS A;  4PMB A;  4G57 A;  1GUT A;  1A3V A;  5E4X A;  3PQI A;  4RG1 A;  1HZ9 A;  3D4D A;  5IP7 H;  2Z4I A;  1TVX A;  2MO0 A;  2PNH A;  3HOW B;  2UXD L;  1TWG H;  2KED A;  2NYZ D;  1LLR D;  1VQ9 A;  4XYO A;  4RGN A;  1JIC A;  1PH3 A;  2NB0 A;  2QW7 A;  2AUK A;  4DAP A;  2K50 A;  2R92 G;  4JVZ A;  4RFB A;  3QB3 A;  2AHO B;  2L1B A;  3BS1 A;  1X3P A;  1QOH A;  4GOP A;  5JJL A;  5CMD A;  1WCM B;  4O1N A;  1NUC A;  3ONA B;  2LXJ A;  4LF5 L;  4Y7N H;  2JEA I;  1D5Z C;  2PZT A;  1AH9 A;  1QCB D;  2EPB A;  4RHR A;  5LMU L;  2F03 A;  1VQA A;  2RCN A;  3NWT A;  1JOR A;  1ENF A;  3UDX A;  3CRL C;  3G6J B;  2O4X A;  1FGU A;  4M8A A;  3I70 A;  4C3I H;  1D2B A;  2E2D C;  2E74 C;  4HSV A;  4R4T A;  2EJF C;  3TEH B;  1IHZ A;  4BY7 H;  1M90 C;  1QIL A;  1DOL A;  3RZO H;  1B53 A;  4DR6 Q;  3T1Y Q;  4DR7 L;  2E2H B;  1BXT A;  1WJJ A;  3OOC A;  2VUM B;  1VQL A;  3RZD H;  4QGU A;  3U50 C;  4RCO A;  2K5V A;  5AFW A;  2QEX A;  1AW7 A;  2N55 A;  3EJI A;  4BBS B;  3K5M A;  4ZLT F;  1UEB A;  3BJU A;  3ND9 A;  3KFU A;  4DXF A;  2UXD Q;  2K5W A;  5I2Y A;  2XGT A;  5GAG C;  3GTL B;  1QB5 D;  1B3Q A;  3CC7 A;  4HR7 B;  1HTP A;  4PNY A;  1TII D;  3OWF A;  2A69 C;  1C9O A;  2EYM A;  2F0O A;  3I4M G;  3PMF A;  4LJZ C;  1KRT A;  2NVQ H;  3ZYY X;  1XNR L;  3GTQ B;  1B4O A;  5D3I B;  1X55 A;  1PRT F;  1QNU A;  2B2Y C;  1D7Q A;  2B29 A;  4LF5 Q;  1VQP A;  2N3S A;  2OCE A;  3I4N B;  3MXN B;  4R8N A;  5LMU Q;  1WD1 A;  1PRT D;  4IUP A;  1SYF A;  2L4N A;  1YJW A;  3FKI H;  4PQX A;  4IUN A;  1FNU A;  1GHK A;  3J7A 5;  3R8B A;  2EXZ A;  2I5M X;  5M5W B;  3HOV H;  2XWJ B;  4OGQ C;  2ZJP A;  4BBR G;  3E6Z X;  4DR7 Q;  4RKL A;  3S1R B;  3U9S A;  5JVH 3;  1AZP A;  4FF4 A;  2F0M A;  4MIU A;  4K2L A;  1D5M C;  3KDF A;  1DM0 B;  1YZ6 A;  3KF8 B;  3P75 A;  3J81 c;  3RN2 A;  2HIV A;  5C0X I;  1IBL L;  1PTO B;  1U4L A;  3S2D B;  4A3D G;  1KNA A;  1HRJ A;  4KI0 A;  1BNZ A;  3KUP A;  1B1Z A;  1YEZ A;  4JYA L;  4ME5 A;  3A7L A;  2EVB A;  2HIX A;  1M8A A;  2NVY B;  3J80 E;  1K9M C;  1SRU A;  2CVR A;  3W3A A;  1YIT A;  2AKW B;  4B3M L;  2F0W A;  1KHI A;  1EWI A;  4JV5 L;  4KKS A;  3HOX G;  4HED A;  4LF6 L;  4Q0F A;  4GOP B;  1B2T A;  1TS2 A;  2M2L A;  1XNR Q;  2IPK D;  2PZU A;  3SR1 A;  1JC7 A;  1I4P A;  1YNX A;  3A8K E;  1ET6 A;  2SDF A;  3ND8 A;  2XIW A;  4ZQ3 A;  1EY4 A;  3UDG A;  1A8V A;  1VQ4 A;  2E2J B;  2FIN B;  4OON A;  1AFP A;  3GTG H;  1SNQ A;  4A3I B;  4DA2 A;  1CQF A;  2IW3 A;  5FLM H;  1RKN A;  4MTN A;  1EEI D;  1F9S A;  1O7I A;  5M3M H;  1IW7 C;  3EVQ A;  1PMR A;  2SOB A;  2XRS D;  2KHS A;  3PCO B;  4IN3 A;  5L37 A;  3KOJ A;  4R9W A;  1E22 A;  4WFN 3;  5H1S E;  1IBL Q;  4JW0 A;  3BYY B;  3N6R A;  1L0X B;  1SNO A;  4JYA Q;  1B50 A;  4K5V A;  1YJ9 A;  1YNN D;  5GAH C;  2X6G A;  4HJ9 A;  3KK7 A;  3PUW A;  1BCP D;  4EX5 A;  1WD0 A;  4AQY Q;  3BZC A;  1JWM D;  1KAA A;  1RHP A;  3F8T A;  3GP7 A;  3R93 A;  1EYG A;  1JMC A;  4B3M Q;  1IKL A;  5KNB A;  2EY6 A;  4C3J B;  4JV5 Q;  1E3P A;  1STY A;  1KDA A;  4L6T B;  3I3C A;  2B63 H;  5T1G A;  3PO3 H;  3DHQ A;  1TQO A;  5C0X H;  4DR4 L;  3NUC A;  5CYU A;  5CBE E;  3UDF A;  1Y8P B;  1VQN A;  1A63 A;  3PO2 B;  4PZ6 A;  4A3F H;  1SMY C;  3VA7 A;  5CV5 A;  1TKW B;  2CHB D;  1HQR D;  5C3E B;  3M3Y B;  5IT9 L;  2JA5 B;  3EIV A;  1GUW A;  2F4V L;  1XPO A;  1QVF A;  1GVP A;  2A6E D;  1TWH H;  3SK5 A;  1X9N A;  4DN4 M;  2ZXP A;  1YBY A;  4V19 0;  2F0E A;  3PF4 A;  4RH6 A;  1SSO A;  3AB9 A;  3T51 B;  4CDE C;  3T4A C;  2A68 C;  1EY5 A;  1CK1 A;  4TVA B;  2PZW A;  4JCV E;  3PUY A;  3QIA A;  3PIO 3;  4LFB L;  1Q46 A;  4I7A A;  3IRB A;  5I9P A;  1R4Q B;  2RKS A;  2F0Q A;  4DR5 Q;  1Y1V H;  2ATW A;  3C46 A;  3UI2 A;  4GZY C;  2E8G A;  4JI3 L;  4HSP A;  1YHQ A;  2UUA L;  2B2V C;  4B9X A;  3IFD A;  4YCW A;  1LTI D;  2C9O A;  2HUG A;  1YNJ C;  5M9O A;  2Q2I A;  5CC4 A;  2RDH A;  5BN3 A;  2OWO A;  2I5L X;  2AWN A;  3E0E A;  1QJO A;  1C48 A;  2JEB I;  4LMQ D;  4RA8 A;  5I4D A;  2ZTD A;  1LAB A;  3SEB A;  3RLN A;  4LWC A;  2VQE Q;  1VQD A;  3T56 B;  2DJG C;  3L7Z C;  4NXM L;  1LAC A;  4L5R C;  1SE4 A;  1CKM A;  5I9O A;  1LT3 D;  2PMZ B;  3H91 A;  5FJ8 H;  2NVX H;  5EQ0 A;  3JAM E;  2G9H D;  2C5C A;  1A3U A;  1L0W A;  4JG2 A;  3HRZ C;  1BBX C;  3NSW A;  1SXT A;  3OTO L;  4DR3 Q;  2JE6 I;  1Y1W B;  3BVM A;  4FF2 A;  1KLU D;  3H0G H;  2R93 H;  5JOB A;  2ZT9 C;  4JBM A;  1LT5 D;  2WV6 D;  4WJ3 M;  4KV6 A;  2YTY A;  2K6A A;  5JEA G;  4LFB Q;  2K5H A;  4FNF A;  1E1T A;  1KIX A;  2JA6 G;  2F0F A;  3E3X A;  1Q82 C;  1NTG A;  4CHT B;  2E2H H;  4CKE A;  5IOC A;  3OHX C;  4JI3 Q;  3I2Z A;  1PFM A;  1IYU A;  3M9B A;  2UUA Q;  3BDC A;  5JEA J;  2F3W A;  4KMU C;  1KDB A;  4DNI A;  3BVZ A;  3F2D A;  2D9U A;  1STG A;  2C35 B;  1UE5 A;  2A6H D;  1WTX A;  3HOZ G;  1EU3 A;  1VQC A;  1JJC B;  1E2Z A;  1V1O A;  3D6C A;  4O0A A;  4LW1 A;  5C4H A;  3M7N A;  4NXM Q;  2GVA A;  1PHJ A;  4GKK L;  1S5B D;  1P16 A;  2RQX A;  1Z6H A;  5EKL A;  1I5F A;  4DF7 A;  4JOI C;  3KJO A;  1PZI D;  1NNX A;  4BXX G;  3IKJ A;  5I6Y A;  5CR3 A;  3OTO Q;  1I6V C;  4ZYS A;  1D1I A;  5LL6 S;  1B7Y B;  1WTP A;  3IFT A;  1ONL A;  3AQQ A;  4X62 L;  1CQV A;  1EY8 A;  1SE2 A;  3FDT A;  3Q22 A;  5ELO A;  3R2I A;  3K0X A;  4JI2 L;  1W3S A;  3F2B A;  1Y69 U;  4K0K L;  3HOW G;  1JE4 A;  1O7Z A;  4WOR A;  3PSI A;  4ZAI A;  3H3V I;  2UU9 L;  3K6O A;  1I3Q H;  3HOU H;  1R9T H;  1RIP A;  1SEB D;  4DR1 L;  2HCI A;  3MC0 B;  1WTH A;  3DM1 A;  5J1Z A;  1WCM G;  4TRD A;  2D0P A;  1HNZ L;  2HD3 A;  2ENB A;  2RSO A;  1K8M A;  4ODG A;  4RGM A;  5IT9 c;  2EYF A;  1I6H B;  4DAM A;  3FPP A;  4FDB A;  2JYO A;  4ULL A;  5FO7 B;  2MHV A;  4DNR B;  5IYC G;  1Y8O B;  4GKK Q;  3S2H B;  4K6L A;  1SFO B;  2Z4H A;  3M4O H;  1GOZ A;  4A3B B;  1KAW A;  5KIX A;  5LMN L;  1MIU A;  4JI5 Q;  1EYA A;  1K3B C;  3QR8 A;  4A75 A;  3S17 B;  3UE1 A;  3CCR A;  4HIM A;  3J81 j;  1IL8 A;  3DWP A;  2Q2T A;  4HIK A;  2VUM G;  1SND A;  4DK6 C;  4X3U A;  3HOY H;  3OSO A;  3MWY W;  1CZW A;  4HID A;  1S3O A;  2ICE C;  4H02 A;  1S72 A;  4GLA C;  4RAU C;  1TWA H;  1D6E C;  4AYB E;  4A3I H;  3PV0 A;  4V0B A;  4B3T Q;  4JI2 Q;  4BBS G;  2TSS A;  3FP9 A;  4DK3 C;  1V9P A;  2IL8 A;  2AQ3 B;  3RLF A;  3K7A B;  1TWC B;  4A3E B;  1PH9 A;  3NWS A;  4UP8 A;  5IP9 H;  2UU9 Q;  4B9W A;  5JVG 3;  2L11 A;  2JSO A;  4DFA A;  4CGY B;  1G2S A;  2WP8 J;  4P73 A;  4DR1 Q;  1O80 A;  1EIY B;  3GTO H;  1ESF A;  2F3I A;  1SYB A;  3D4W A;  4A3G B;  1D1K A;  2BCO A;  1VCI A;  4L5S A;  3CW2 C;  4N9P A;  4JI7 L;  3I4N G;  2EXD A;  1BKB A;  4DV5 Q;  4XT1 B;  2L15 A;  2MFI A;  1M4V A;  3JAM i;  5CV9 A;  3H3V H;  5LMN Q;  3DUZ A;  4GOP C;  2R92 H;  2WAQ B;  2PQE A;  5FKA C;  2K33 A;  1M1K C;  5CBA E;  4B3S L;  2P5Z X;  3VA5 A;  5IGB A;  1V1P B;  3S14 B;  2FHT A;  2K5D A;  3TBI B;  1XTC D;  4JI6 Q;  3CCM A;  1VQE A;  5IGF A;  3ULL A;  2A1A A;  3S16 H;  3SVM A;  2OQK A;  4LNQ A;  2Z6B A;  3S15 H;  4MTK A;  5HUR A;  3U9O A;  3ITP A;  1S5D D;  2PI2 E;  1K8A C;  1SYC A;  1CT1 D;  1QG7 A;  2F0H A;  2RHS B;  4ABN A;  2CQA A;  1OTC A;  2B3G A;  1QVC A;  1DOM A;  5EJW A;  3HFZ B;  2MJ8 A;  3LGJ A;  2AMC B;  3J7Z C;  3CQZ H;  5TSS A;  2EIF A;  2Z9H A;  1QNK A;  5DM6 3;  4OEM B;  4RMF A;  4CBV A;  4JI7 Q;  4LAA A;  4DV2 L;  2EYJ A;  4XQQ A;  3UDI A;  1XX8 A;  1HZC A;  2BE5 C;  3I73 A;  1OXS C;  1QVG A;  1G51 A;  1L1O A;  5DNF A;  1TU2 B;  1J6Q A;  2A69 D;  5M5X H;  3V96 A;  3D8G A;  2GA4 B;  4HJ8 A;  1F9P A;  1YIJ A;  2J0T D;  3I4M H;  1B9M A;  3E9H A;  4B3S Q;  2DJF C;  4HMJ A;  4DUZ L;  4IJH A;  3QG1 A;  2B2T A;  4KY6 A;  3TP8 A;  5A2Q E;  1K83 B;  2JP1 A;  2LY7 A;  1OXT A;  2OEO A;  1BCP B;  3GTP H;  3OMG A;  3BZK A;  3CCL A;  4DAY A;  4U68 A;  2KEE A;  1IL2 A;  4ZCK A;  5A35 A;  4UY8 C;  3C1F A;  1NBW A;  1STA A;  3M4Y A;  1HHV A;  5EBD A;  1IKM A;  2IT1 A;  4KLK A;  1LTG D;  4BBR H;  2WIN B;  3LWE A;  3I72 A;  3URY A;  4C3J G;  2BDO A;  2XNA C;  2QEJ C;  2Z1C A;  1S40 A;  3BG3 A;  1XNQ L;  1GJX A;  3O13 A;  4I7Z C;  1WI5 A;  4NDX A;  1ILQ A;  1S5F D;  4A3D H;  3SE0 A;  4K2K A;  3W1G A;  1IBK Q;  1B9N A;  1O7Y A;  4ID6 A;  5GAD C;  2ASB A;  2V4D A;  5GAE C;  3PO2 G;  1TS3 A;  2IY5 B;  2RSN A;  3NK9 A;  5C3E G;  2JA5 G;  1TY0 A;  2JA7 B;  1BF4 A;  2J4X A;  2DNE A;  2FJ2 A;  3Q24 A;  1SYE A;  4FXG C;  4ZUI A;  1JR0 D;  3HOX H;  2LXK A;  1LT6 D;  1X56 A;  3RMH A;  5C4X B;  4YWL A;  3AU7 A;  2JA8 B;  1CTM A;  4IUR A;  3K0Y A;  1GHJ A;  2N8N A;  4H13 C;  4Y52 H;  2EYP A;  1LM0 A;  2OTL A;  1EIH A;  1SE8 A;  3W5O A;  1CM9 A;  3GTJ H;  1K8O A;  3MA2 B;  3LNN A;  3LX0 A;  3UE0 A;  1KC8 C;  4IAL A;  4IUQ A;  3S1Q B;  4OL7 A;  4XTC S;  4U67 3;  1KNE A;  2HQE A;  5E1F A;  1IW7 D;  1EY9 A;  1JOQ A;  2OXP A;  1DOK A;  5ELD A;  4QF4 A;  1A2T A;  2NZH A;  2DY8 A;  2BH2 A;  2IJ0 A;  1LTT D;  1Q86 C;  4KN4 C;  3TZU A;  1PYS B;  3BYT B;  2KA7 A;  1EOT A;  3DLL A;  1VQM A;  2XWB B;  1Q12 A;  2RF4 A;  3L9A X;  4GN3 B;  2K05 A;  3D4R A;  3A8J E;  4X64 L;  2I5H A;  1CZG A;  4C56 C;  2HDL A;  1TWF B;  2Y0S B;  3CCU A;  1ENA A;  4NPS A;  3S1N B;  1MD2 D;  1K0S A;  1L1O B;  1II3 A;  4C2M B;  4XQN A;  1PH6 A;  2WAQ E;  5C3W A;  1VQH A;  3RUZ A;  1Y1W G;  4OXP A;  3Q8D A;  2UUB L;  2RDG A;  1SLJ A;  3FPU B;  2EDG A;  3MXU A;  4CKB A;  1VQ7 A;  3CKI B;  4IPH A;  1SFO H;  1SMY D;  4LFA L;  3K5L A;  2OT2 A;  2RA4 A;  2YU9 B;  1CKN A;  3NP8 A;  4DAY B;  2I46 A;  2PW5 A;  5KNC A;  4QUF A;  5IYD G;  4WJ4 A;  5C4J H;  3MEF A;  4RGO S;  1XMO L;  1EL0 A;  1UUP A;  3NTI A;  3ULP A;  5ELE A;  4A93 B;  1I94 L;  1CKO A;  2A74 C;  5IIF A;  3QWN A;  2J7Z A;  2A68 D;  3RD4 A;  2MP1 A;  2L0C A;  5LMN W;  1W2B A;  3H6M A;  4OX9 L;  1XJV A;  1L2F A;  4L5T A;  1KLG D;  4DV4 L;  1YJN A;  3GTM H;  4B3R L;  5G3L F;  4BWG B;  5JJI A;  1HPC A;  5BN4 A;  3S1M H;  4X64 Q;  3NXW A;  1I4G A;  1AZQ A;  3HP3 A;  3PF5 A;  4AH6 A;  4BA2 I;  4GNX A;  4A3C G;  4KN7 C;  3AFP A;  5G3L D;  2AWO A;  2ZTE A;  5CV8 A;  2JA9 A;  5HGQ A;  1YNJ D;  3IAY A;  2QIL A;  1B44 D;  2UUB Q;  3NTH A;  1A62 A;  4MZ9 A;  3DEP A;  3HGB A;  4K8I A;  5IGG A;  4DXG A;  1HA6 A;  4BY1 B;  4LFA Q;  1DON A;  4EQO A;  2F0P A;  1ZEQ X;  2ZXR A;  1VMC A;  4IO9 A;  2PI2 A;  2PQA A;  4KHV A;  1GD7 A;  3NQI A;  5CV7 A;  4ZK9 B;  2VB3 X;  1I94 Q;  3P1H A;  4IUT A;  2VZA A;  2G5D A;  4X65 L;  2A8V A;  1ESR A;  2XN9 C;  4C3H B;  1KDC A;  2PNR C;  3TN2 A;  3A5U A;  2K4K A;  3NEM A;  2R6G A;  1UWV A;  5EPL A;  3K59 A;  4NXN L;  1QE6 A;  3KLS X;  5JEA H;  4LF6 Q;  4RCN A;  1ENC A;  2YTV A;  4PZ7 A;  2JA6 H;  4A3J G;  1IYJ B;  4OX9 Q;  2H5X A;  1LYL A;  4DV4 Q;  4LK1 C;  1V8Q A;  1N8R C;  1SRO A;  3MXP A;  5JAV A;  5M3F B;  2OQ0 A;  3BDL A;  3M4P A;  4DV3 L;  3F2U A;  2E5L L;  2I0Q A;  3HEJ A;  4A3B G;  1HXY D;  1E0B A;  4N8F A;  1E1O A;  3A54 A;  3G6E A;  1ICF B;  2ZJQ A;  4A3M B;  2FFK B;  2B39 A;  3L2P A;  3CMA A;  4KTA A;  2I07 B;  5DAU A;  4CJ0 B;  3HOZ H;  4CDD C;  3J81 E;  1J8I A;  3L0O A;  3GTK H;  1PYW D;  4NKL A;  4APV A;  2NVT B;  2LMC B;  2HHH L;  1VDZ A;  2KCN A;  2R7Z B;  2UXC L;  1BR9 A;  4CJ2 C;  1T5E A;  4OIJ A;  1NCV A;  1CKN B;  1XWE A;  4YCV A;  1JCK B;  4AYB B;  4GKJ L;  2PW7 A;  1T9H A;  3NTK A;  3PIO A;  3ERS X;  4BXX H;  5FK9 C;  4A3E G;  5LL6 X;  1ROD A;  4X65 Q;  5D65 A;  1Q8I A;  2BDN A;  2HT1 A;  5IGD A;  3N52 A;  3C3L A;  1XYI A;  4FO2 A;  2DN8 A;  2Z6K A;  4A3G G;  2R7D A;  3I90 A;  3ULJ A;  5C44 B;  1U5K A;  4Z9C B;  5BR8 L;  1QUQ A;  1FD7 D;  5ISR A;  3KYH C;  3OPO A;  3VYS A;  4EQP A;  3VYU A;  4CKC A;  4IFD G;  4S3S A;  4FF3 A;  4DR4 Q;  1Q1B A;  3PGZ A;  1EWH A;  3NEN A;  4FVM A;  3HOW H;  3TSS A;  2Y0S E;  1TXY A;  2D5D A;  3MAQ A;  2QKI C;  2IX0 A;  4DV3 Q;  4GNX B;  4K5W A;  2F0D A;  3SK6 A;  2F0I A;  3TQY A;  5ELC A;  3X3N A;  2WAQ G;  3SDZ A;  2F4V Q;  1I50 B;  4QY7 A;  2NBF A;  3FEW X;  4IFD J;  4KK7 A;  1WCM H;  1PYB A;  1KAB A;  1SN8 A;  1XXG A;  2HHH Q;  1N33 L;  3G4S A;  5T1I A;  4OEL B;  5IYC H;  3W2D A;  2D2C C;  4HCS A;  1HH2 P;  4ME3 A;  1QZG A;  2FMM A;  4POF A;  2PQA B;  5HGT A;  1GUS A;  1KL9 A;  1PFB A;  4F87 A;  1V43 A;  4JI4 L;  1HNW L;  1LO5 D;  1RJT A;  4JK1 C;  5IWA L;  2VUM H;  4F8M A;  5IYB G;  2ZXO A;  2WII B;  1TWG B;  2V1C C;  3S9W A;  3NE5 B;  5BR8 Q;  1SAP A;  4BBS H;  1MBY A;  2CKZ B;  1PH2 A;  1K8G A;  3RN5 A;  1FNV A;  4YY3 L;  2A5H A;  1B3A A;  2MUY A;  1C4Q A;  3GTL H;  1PTO F;  3HKZ B;  1SNC A;  4K5X A;  1EFI D;  3H15 A;  2WB1 B;  2MNA A;  4TSS A;  4Y7N B;  1NR4 A;  1WVL A;  1U4P A;  1PXU A;  4JI8 L;  3K81 C;  3GTQ H;  5EKI A;  1NMF A;  3ERO A;  3GD7 A;  3A74 A;  1EY6 A;  1RTN A;  4BY7 B;  1V1P A;  4DKA C;  3I4N H;  1G91 A;  3RZO B;  3CC4 A;  5FLX L;  3VR2 A;  1SDF A;  1FGB D;  4QIW E;  1TR5 A;  3VR6 A;  5M5W H;  3EA6 A;  1PLF A;  5C6A A;  2VNU D;  1LUZ A;  3KF6 A;  4JI4 Q;  1HNW Q;  3S1R H;  2MPM A;  2B2U A;  3WOE A;  1BBW A;  1H9S A;  1ZYR C;  3J7Y W;  3H94 A;  3U58 A;  2F0T A;  3K5N A;  1PTO H;  3S2D H;  1QUQ B;  1U4M A;  2QDL A;  3CC2 A;  3ZJY C;  4A93 H;  2Z8L A;  2NVY H;  3CCS A;  4YY3 Q;  4CJ1 B;  4JBW A;  4XYQ A;  1HQM C;  5AJ3 L;  4A3J B;  2NVQ B;  1DGS A;  1EUJ A;  1PFS A;  3RNU A;  2JA7 G;  5I2X A;  1JJG A;  2WFW A;  1NJI C;  4OWT B;  4RHS A;  4XDX A;  1N34 L;  4F7X A;  1JT8 A;  1JQY D;  2K52 A;  4QJF A;  4JI8 Q;  2IWH A;  5CV6 A;  2NUC A;  1SNP A;  5C4X G;  3FKI B;  2KVM A;  4R4O A;  3FMC A;  3MTS A;  2F3V A;  3J81 i;  2JA8 G;  4YWK A;  3CPW A;  1MHW C;  3J80 L;  2F4I A;  3HOV B;  1SBB B;  3GDE A;  1P8L A;  4X62 Q;  2F0S A;  1L1O C;  3A8I E;  4IJL A;  3VDY A;  2BE5 D;  2E2J H;  2QCP X;  1HTL D;  1T5X D;  3I55 A;  1EIG A;  3CU7 A;  2Q8T A;  2ICI A;  3CRK C;  3ICE A;  1UNS A;  4K0K Q;  2B2T C;  1PH5 A;  4OWW B;  4GN4 B;  2CWA A;  2Q2U A;  2K14 A;  1HNX L;  1WFQ A;  1ZKO A;  1BUV T;  1X65 A;  1PTO C;  3OW2 A;  1PRT B;  1STE A;  1U4R A;  1DZ1 A;  2VY3 A;  1NAP A;  2IHE A;  3K58 A;  1QZH A;  1VQI A;  1RCV D;  1X32 A;  1EOV A;  1H9R A;  3C1E A;  1HNZ Q;  2NWG A;  4GS3 A;  3HKS A;  2Y0S G;  4IOC A;  4KHZ A;  2KHI A;  2KJX A;  3GV6 A;  3Q6S A;  1WTR A;  4JI1 L;  5EPJ A;  4C3J H;  1EFW A;  1BVS A;  1UEA B;  2RCF A;  1Y8N B;  3CP0 A;  3FRP B;  1N32 L;  5FO8 B;  1A3T A;  3WOF A;  1GM5 A;  4P72 A;  2RVL A;  1YVC A;  3GTG B;  1YHB A;  3G71 A;  1H9K A;  2DNC A;  2Q8R E;  2FXQ A;  1VF7 A;  4G4K A;  1JWS D;  2NN6 G;  3BDO A;  4P75 A;  3PO2 H;  5M5Y B;  2CFM A;  4GLX A;  1SYG A;  1H9J A;  3K5O A;  5C3E H;  3M3Y H;  2PYK A;  5ELF A;  1YI2 A;  2JA5 H;  3PIP 3;  5IOD A;  1HZB A;  2B2W A;  3R2T A;  3WDN A;  4A93 G;  1KD1 C;  1IBM L;  1LTL A;  4KJN A;  1MKH A;  3KF6 B;  2L5T A;  1RF2 D;  2OF1 A;  5JJK A;  4IZ8 A;  1H9S B;  1TS5 A;  1WTV A;  4IUU A;  1UE6 A;  2IX1 A;  1EQT A;  5IT9 E;  3T1H L;  4LF4 L;  5LHY 1;  3STB C;  4A4I A;  1LTA D;  3Q0A A;  4UHV A;  4LUV A;  1L0Y B;  1VQG A;  5F2D A;  4DGZ A;  1KRS A;  2B63 B;  1OXU A;  3HKZ E;  3PO3 B;  4BA1 I;  1VQF A;  2WB1 E;  2B8G A;  3TRZ A;  3I7F A;  3D3R A;  1SE3 A;  3I91 A;  1A0I A;  4A3F B;  4R1J A;  4M1U B;  1VQ8 A;  3B6Y A;  4UP7 A;  3FVQ A;  4EQ5 A;  1X3F A;  1SYD A;  3NBH A;  5FLX c;  4N8X 1;  1TWH B;  1CA6 A;  1VQ6 A;  3OYY A;  4BY1 G;  2KQ3 A;  3BU2 A;  3K7U C;  1R4P B;  3TP6 A;  1WYD A;  1N9W A;  2K7V A;  1JB7 A;  3TDQ A;  3SXH A;  1JE5 A;  3M85 A;  3CAM A;  3TRE A;  3A0J A;  4R8I A;  1Y14 B;  3A55 A;  4R4C A;  5ELN A;  4FP5 D;  2NZO A;  2K28 A;  1WOC A;  1PH7 A;  2E2I B;  1F9Q A;  4C3H G;  1Y1W H;  1W6K A;  4F88 A;  1KQS A;  3U4Z A;  2ES2 A;  3QOJ A;  3CCJ A;  1G6Z A;  3AFQ A;  2SEB D;  2NZ1 D;  4DR6 L;  1X3G A;  4DU9 A;  3CME A;  4ALP A;  2K32 A;  2K1B A;  4ZKB B;  3LWU A;  2EE1 A;  3T1H Q;  4Q5V A;  3JAM L;  4A76 A;  4LF4 Q;  1HJP A;  2HCC A;  1Q7Y C;  5IYD H;  1HUM A;  1ZXT A;  1U9R A;  1DD2 A;  5M3F G;  4JI0 L;  3NQT A;  2B8F A;  1CI3 M;  2PO4 A;  2IHF A;  4DV2 Q;  3P20 A;  3DXJ C;  1G6P A;  4XXE A;  2ALY B;  1STB A;  2EYO A;  4X6A H;  2DY7 A;  4A3M G;  3J80 c;  1A15 A;  2NVX B;  4EGV A;  3KLS A;  1DCZ A;  4DPG A;  4DUZ Q;  2KHJ A;  3CCV A;  1EEF D;  2HDM A;  5NUC A;  2R7Z G;  3IL8 A;  2HQL A;  3E0J A;  4GNX C;  2XTI A;  1SNM A;  1AE3 A;  5D3D A;  1NR2 A;  2R93 B;  3H0G B;  3TS0 A;  1G2T A;  5KND A;  4A3C H;  4AYB G;  5FO9 B;  5KYI A;  1OO9 B; 
#chains in the Genus database with same CATH homology
 2VZA A;  2A8V A;  4X65 L;  4OO1 G;  4DNI A;  3F2D A;  2UUC L;  3A5U A;  2C35 B;  1UE5 A;  1FJG L;  3HOZ G;  2K4K A;  2PMZ E;  3NEM A;  5GQO A;  2LSS A;  1VQC A;  2R6G A;  1UWV A;  4GN5 A;  2R7F A;  1JJC B;  1NMG A;  4NXN L;  2QGQ A;  3M4Q A;  4O0A A;  2BA0 A;  4A3M H;  4LW1 A;  2YTV A;  4PZ7 A;  4LF6 Q;  3PIP A;  3M7N A;  2JA6 H;  4A3J G;  1IYJ B;  4OX9 Q;  2H5X A;  4NXM Q;  1XNQ Q;  1LYL A;  2GVA A;  1PHJ A;  5C44 G;  4DV4 Q;  1N8R C;  1SRO A;  2KEN A;  2NVT H;  4GKK L;  1P16 A;  3U4V A;  3K80 C;  1I5F A;  4IFD I;  4KHP Q;  2R7Z H;  4AIM A;  1HNX Q;  1C0A A;  2F52 A;  2OQ0 A;  4JOI C;  3SGI A;  3KJO A;  1RL2 A;  3M4P A;  1CUK A;  2GN5 A;  4DV3 L;  3CXC A;  2E5L L;  4JI0 Q;  2I0Q A;  4BXX G;  4A3B G;  4DV0 Q;  3OTO Q;  3HOU G;  1K73 C;  1E1O A;  1X54 A;  3G6E A;  2YTX A;  1B7Y B;  3CPF A;  2ZJQ A;  1E24 A;  4HJ5 A;  1CSQ A;  3AQQ A;  4R4Q A;  4X62 L;  3L2P A;  3CMA A;  1XPR A;  4IPD A;  3HOZ H;  2DUD A;  5ELO A;  3L0O A;  3GTK H;  3K0X A;  4APV A;  1ASZ A;  4NB3 A;  1SR3 A;  3I56 A;  2HHH L;  4JI2 L;  4JI1 Q;  4QL5 A;  1W3S A;  3NBH B;  2UXC L;  3K8A A;  3WWV A;  4YCU A;  4A3J H;  4A3L G;  1GKH A;  3I4O A;  3CF5 A;  4IPG A;  3F2B A;  1B70 B;  3G48 A;  5C44 H;  4K0K L;  1CKN B;  3HOW G;  1I6H H;  1N32 Q;  3PSI A;  4YCV A;  1XTD A;  1VS0 A;  1Q1E A;  1E7Z A;  1JJ2 A;  3RR5 A;  2UU9 L;  3H3V I;  4GKJ L;  1T9H A;  3S2H H;  1HR0 L;  2D62 A;  3PIO A;  3ERS X;  4BXX H;  4A3E G;  1IBK L;  2K5N A;  2ZJR A;  4A3B H;  2Q2H A;  1GO3 E;  1I3Q H;  3HOU H;  4X65 Q;  1R9T H;  1RIP A;  5K36 G;  2VS1 A;  4DR1 L;  1G29 1;  3HOY G;  2ZM6 L;  2HT1 A;  2UUC Q;  2QA4 A;  3S17 H;  3F1Z A;  3TS2 A;  1WCM G;  2D0P A;  1FJG Q;  1CSP A;  1HNZ L;  1I50 H;  5IP7 G;  2Z6K A;  4LF8 L;  4A3I G;  4A3G G;  2R7D A;  5IT9 c;  2YYZ A;  3ULJ A;  1U5K A;  5BR8 L;  1QUQ A;  2RHQ B;  4DAM A;  1IBM Q;  4FDB A;  3KYH C;  4IPC A;  4J15 A;  5IYC G;  4IFD G;  4DR4 Q;  4GKK Q;  1Q1B A;  3KJP A;  3PGZ A;  4UPA A;  3NEN A;  3M4O H;  4A3L H;  3HOW H;  1NY4 A;  2Y0S E;  1TXY A;  5IP9 G;  1KAW A;  4HJ7 A;  2A19 A;  5LMN L;  3W1B A;  3T1Y L;  1MIU A;  2IX0 A;  4DV3 Q;  4GNX B;  3K7A H;  4JI5 Q;  1PH1 A;  4A75 A;  3UE1 A;  3CCR A;  3HKZ G;  3TQY A;  1TWC H;  3J81 j;  4HIM A;  4A3E H;  1Z47 A;  2WAQ G;  4LUZ A;  2Q2T A;  2F4V Q;  4HIK A;  2VUM G;  4QY7 A;  2WB1 G;  4DK6 C;  3HOY H;  4IFD J;  2Z6K C;  4AQY L;  4HID A;  1S3O A;  1WCM H;  4H02 A;  1PYB A;  1S72 A;  4RG1 A;  1HZ9 A;  4GLA C;  5IP7 H;  1TWA H;  4AYB E;  2MO0 A;  4A3I H;  1SN8 A;  3PV0 A;  2HHH Q;  4JI2 Q;  4B3T Q;  2PNH A;  3FP9 A;  1N33 L;  4BBS G;  4A3G H;  2UXD L;  1TWG H;  4DK3 C;  1V9P A;  1HZA A;  3F2C A;  3G4S A;  4BY7 G;  1VQ9 A;  5IYC H;  3RLF A;  2BA1 A;  1PH3 A;  4LFC L;  1D8L A;  1PH9 A;  1HH2 P;  4ME3 A;  2K50 A;  4UP8 A;  5IP9 H;  1QZG A;  2UU9 Q;  2R92 G;  2AHO B;  1HR0 Q;  1N36 L;  1VQK A;  4POF A;  2PQA B;  1KXL A;  2WP8 J;  4GOP A;  4P73 A;  2KCM A;  1Q81 C;  1KL9 A;  2UXB L;  5JJL A;  1V43 A;  4JI4 L;  4DR1 Q;  1XMQ L;  1EIY B;  1HNW L;  3GTO H;  2CQO A;  1XMO Q;  2ZM6 Q;  2VUM H;  5IWA L;  2F3I A;  4QQB X;  2LXJ A;  5IYB G;  4LF5 L;  1PH4 A;  4Y7N H;  2JEA I;  2V1C C;  2YV5 A;  4LF8 Q;  1VCI A;  5LMU L;  3S14 H;  5M5Y H;  1VQA A;  3CW2 C;  3KLW A;  4JI7 L;  2RCN A;  4L5S A;  3I4N G;  5BR8 Q;  2BH8 A;  3UDX A;  1FGU A;  2EXD A;  3JAM c;  4BBS H;  2JQO A;  1BKB A;  4C3I H;  2CKZ B;  4DV5 Q;  1PH2 A;  1K8G A;  3RN5 A;  1YHA A;  4R4T A;  3TEH B;  4YY3 L;  4BY7 H;  2L15 A;  1M90 C;  2MFI A;  4YHH L;  3JAM i;  3H3V H;  3RZO H;  3GTL H;  5LMN Q;  4DR6 Q;  3T1Y Q;  4DR7 L;  4GOP C;  2R92 H;  1MJC A;  3PUV A;  1U0L A;  1WJJ A;  1M1K C;  3H15 A;  1VQL A;  2MNA A;  4B3R Q;  4DR5 L;  4B3S L;  1C7Y A;  1K0R A;  3RZD H;  4QGU A;  4JI8 L;  3U50 C;  2K5V A;  3K81 C;  2QEX A;  4JI6 Q;  3GTQ H;  4DV6 L;  3GO5 A;  3CCM A;  1VQE A;  5IYB H;  3ULL A;  2A1A A;  1NMF A;  3S16 H;  2EQS A;  2OQK A;  3GD7 A;  3A74 A;  2VQF L;  3FKI G;  4LNQ A;  3S15 H;  1K3R A;  1UEB A;  3BJU A;  1NE3 A;  3KFU A;  4DKA C;  3I4N H;  2PI2 E;  5DLQ E;  2UXD Q;  1K8A C;  3CC4 A;  2XGT A;  5GAG C;  3HOV G;  3CC7 A;  2RHS B;  1OTC A;  2B3G A;  1QVC A;  1V1Q A;  4LFC Q;  4QIW E;  1C9O A;  3HFZ B;  5M5W H;  1IXR A;  4GLV B;  2VQE L;  3I4M G;  1N36 Q;  1KRT A;  4O2D A;  2NVQ H;  2UXB Q;  3LGJ A;  4LUO A;  2AMC B;  2VNU D;  1XNR L;  1LUZ A;  3KF6 A;  3J7Z C;  1VQ5 A;  4JI4 Q;  1XMQ Q;  3CQZ H;  5IY0 A;  1X55 A;  3S1R H;  4LF9 L;  4DV7 L;  4POG A;  1HNW Q;  4OWX B;  1X6O A;  2MQH A;  1D7Q A;  2B29 A;  4TQU S;  5IE8 A;  3CD6 A;  4LF5 Q;  2EIF A;  1BBW A;  1VQP A;  2N3S A;  2OCE A;  3MXN B;  3U58 A;  5LMU Q;  4RMF A;  3S2D H;  4JI7 Q;  1YJW A;  1K83 H;  3FKI H;  1QUQ B;  4DV2 L;  4DR3 L;  3J7A 5;  3UDI A;  1FVI A;  3CC2 A;  1HZC A;  3ZJY C;  4A93 H;  1AE2 A;  4IOA A;  2I5M X;  1OXS C;  2MO1 A;  2NVY H;  4YY3 Q;  3CCS A;  3KDF B;  4JBW A;  1QVG A;  3HOV H;  1ASY A;  1G51 A;  1L1O A;  4YHH Q;  5AJ3 L;  2ZJP A;  4BBR G;  4NXN Q;  1DGS A;  1EUJ A;  1PFS A;  3RNU A;  1J6Q A;  2JA7 G;  5M5X H;  4DR7 Q;  1JJG A;  1XPU A;  2WFW A;  2E2I H;  1NJI C;  4OWT B;  4HJ8 A;  1YIJ A;  3I4M H;  3E9H A;  1N34 L;  3KDF A;  4B3S Q;  4DUZ L;  1YZ6 A;  3KF8 B;  3RN2 A;  3J81 c;  2HIV A;  2K52 A;  4IJH A;  4QJF A;  5C0X I;  4JI8 Q;  1IBL L;  5E7N A;  2N49 A;  1JT8 A;  4A3D G;  5C4X G;  4KI0 A;  4R4O A;  1OXT A;  4DV6 Q;  2E5L Q;  3GTP H;  1YEZ A;  3J81 i;  4YWK A;  2VQF Q;  3CPW A;  2JA8 G;  4JYA L;  2HIX A;  3BZK A;  3D0F A;  3CCL A;  1K9M C;  2VL6 A;  1IL2 A;  3GDE A;  1SRU A;  1P8L A;  4UY8 C;  4X62 Q;  4IJL A;  1L1O C;  2NN6 I;  3VDY A;  5FLM G;  1NBW A;  1YIT A;  1EIF A;  2AKW B;  4B3M L;  2E2J H;  3CCE A;  2IT1 A;  3I55 A;  4KLK A;  5M3M G;  1KHI A;  1EWI A;  4BBR H;  4JV5 L;  3HOX G;  4LF6 L;  2JA7 H;  4LF7 L;  3ICE A;  2UXC Q;  2ID0 A;  4GOP B;  1S40 A;  1PH8 A;  1XNQ L;  1XNR Q;  4K0K Q;  1PH5 A;  4DR2 L;  4LF9 Q;  4OWW B;  4DV7 Q;  4GN4 B;  2CWA A;  2Q2U A;  4GKJ Q;  2ZTC A;  2K14 A;  1WI5 A;  1WFQ A;  1YNX A;  1HNX L;  4A3D H;  1AH9 A;  5C4X H;  4P71 A;  4JBK A;  3W1G A;  1IBK Q;  1X65 A;  2JJQ A;  3UDG A;  5GAD C;  2ASB A;  5GAE C;  3OW2 A;  2JA8 H;  1A8V A;  3PO2 G;  1VQ4 A;  2IY5 B;  3FHW A;  4OON A;  2OTJ A;  2CWP A;  3GTG H;  2VY3 A;  2IHE A;  3S24 A;  5C3E G;  1VQI A;  1QZH A;  4JBJ A;  2JA5 G;  1EOV A;  3RLO A;  1HNZ Q;  4GS3 A;  3HKS A;  4PMW A;  5FLM H;  4MTN A;  2Y0S G;  4IOC A;  4KHZ A;  2KHI A;  3E9I A;  3PUZ A;  1O7I A;  5M3M H;  1UE7 A;  3S1Q H;  2B63 G;  3HOX H;  2LXK A;  1SMX A;  4JI1 L;  3PCO B;  1X56 A;  3PO3 G;  3KOJ A;  4C3J H;  5C0X G;  1EFW A;  1BVS A;  1OXV A;  1E22 A;  1EQQ A;  3EN2 A;  3J80 i;  5H1S E;  3CP0 A;  1IBL Q;  4YWL A;  1N32 L;  4A3K H;  1Z9F A;  4PG3 A;  1GM5 A;  2D0O A;  4MNO A;  4A3F G;  4P72 A;  1YVC A;  2N8N A;  1YHB A;  3G71 A;  4XIG S;  4JYA Q;  4Y52 H;  1YJ9 A;  1LM0 A;  2OTL A;  1SE8 A;  1VQB A;  1UE1 A;  3W5O A;  5GAH C;  2FXQ A;  5GRO A;  4HJ9 A;  2NN6 G;  2N78 A;  4P75 A;  3PO2 H;  3GTJ H;  4YWM A;  2CFM A;  4GLX A;  3PUW A;  4EX5 A;  3UE0 A;  4AQY Q;  3BZC A;  1KC8 C;  3F8T A;  5C3E H;  5C0X J;  1EYG A;  1YI2 A;  1JMC A;  4B3M Q;  2JA5 H;  3M3Y H;  2Z0S A;  1HZB A;  4XTC S;  4JV5 Q;  1TWF H;  1N33 Q;  3EBE A;  4LF7 Q;  4P74 A;  4A93 G;  1E3P A;  1KD1 C;  3S1N H;  1IBM L;  1LTL A;  2B63 H;  4C2M H;  2NZH A;  3PO3 H;  1MKH A;  3KF6 B;  2CCZ A;  2BH2 A;  2KCT A;  4DR2 Q;  4DR4 L;  3UDF A;  1Q86 C;  2KBN A;  1VQN A;  5JJK A;  1FL0 A;  1PV4 A;  1A63 A;  1PYS B;  4PZ6 A;  4A3F H;  3JC6 6;  4DV1 L;  1Y1V G;  4JI5 L;  1UE6 A;  3DLL A;  2IX1 A;  1VQM A;  1X3E A;  1Q12 A;  2RF4 A;  4GN3 B;  3EIV A;  3T1H L;  5IWA Q;  2F4V L;  4LF4 L;  4X64 L;  2I5H A;  1GVP A;  3STB C;  1XPO A;  1QVF A;  4L5Q A;  3CCU A;  1TWH H;  4A4I A;  4NPS A;  1X9N A;  2YU9 H;  4LUV A;  1VQG A;  1L1O B;  1KRS A;  1OXU A;  1YBY A;  3HKZ E;  4DUY L;  4JC0 A;  5HY6 A;  2WAQ E;  4BA1 I;  1PH6 A;  1VQF A;  3PF4 A;  4B3T L;  1VQH A;  2WB1 E;  1PA6 A;  3DM3 A;  1Y1W G;  4OXP A;  4X66 L;  3I7F A;  3TRZ A;  4TVA B;  1J5E L;  1A0I A;  3Q8D A;  4JCV E;  2UUB L;  3PUY A;  4R1J A;  1SLJ A;  4LFB L;  1VQ8 A;  3B6Y A;  1Q46 A;  3ER0 A;  4UP7 A;  3IRB A;  1VQ7 A;  1HR0 W;  4IPH A;  4EQ5 A;  1X3F A;  1SFO H;  5FLX c;  4DR5 Q;  4HJA A;  4LFA L;  1Y1V H;  5FJ8 G;  2ATW A;  1VQ6 A;  1CKN A;  3OYY A;  4DAY B;  4BY1 G;  5IYD G;  4WJ4 A;  3NEL A;  3MEF A;  2E8G A;  3PUX A;  5C4J H;  1XMO L;  4JI3 L;  3STB D;  3AEV A;  3BU2 A;  3K7U C;  1YHQ A;  1WYD A;  3ULP A;  1N9W A;  2UUA L;  1H95 A;  1JB7 A;  1B8A A;  2R93 G;  3H0G G;  1JE5 A;  4YCW A;  3M85 A;  1I94 L;  1CKO A;  3CAM A;  3TRE A;  3A0J A;  1Y14 B;  2Q2I A;  2VW9 A;  4R4C A;  5ELN A;  2OWO A;  2I5L X;  2NZO A;  4OO1 I;  1WOC A;  2AWN A;  4DV5 L;  3E0E A;  2JK8 A;  1PH7 A;  1Y1W H;  1OXX K;  1KQS A;  3U4Z A;  2ES2 A;  2JEB I;  2GVB A;  2ZTD A;  3CCJ A;  3RLN A;  1IZ6 A;  4LWC A;  3AFQ A;  2VQE Q;  5LMN W;  1VQD A;  1W2B A;  1X3G A;  4DR6 L;  4DV1 Q;  4OX9 L;  3L7Z C;  3D31 A;  4NXM L;  3AYH B;  1XJV A;  3A5Z B;  1L2F A;  4L5T A;  3CME A;  4L5R C;  4DV4 L;  1CKM A;  4ALP A;  5J3B A;  1YJN A;  1MJE A;  4A3K G;  3GTM H;  4B3R L;  5JJI A;  3T1H Q;  5FJ8 H;  4A76 A;  2NVX H;  4LF4 Q;  3S1M H;  4KHP L;  4X64 Q;  4BY1 H;  1HJP A;  5IYD H;  1Q7Y C;  3PF5 A;  4AH6 A;  4BA2 I;  4GNX A;  4A3C G;  4JI6 L;  3AFP A;  1L0W A;  5M3F G;  4JG2 A;  4JI0 L;  2AWO A;  4DV0 L;  4R4I A;  2K75 A;  3OTO L;  4DUY Q;  2IHF A;  4DR3 Q;  2JE6 I;  2ZTE A;  4DV2 Q;  2R93 H;  3H0G H;  2JA9 A;  5HGQ A;  1VQO A;  4JBM A;  1G6P A;  2ALY B;  4X66 Q;  4WJ3 M;  1J5E Q;  4X6A H;  2YTY A;  1BBU A;  5AJ3 Q;  2UUB Q;  1A62 A;  4MZ9 A;  4PZ8 A;  4C3H H;  5JEA G;  4A3M G;  4LFB Q;  2K5H A;  3J80 c;  1EQR A;  1E1T A;  1PVO A;  1KIX A;  2JA6 G;  1VQJ A;  4HIO A;  1N34 Q;  4LFA Q;  4DPG A;  4DUZ Q;  2KHJ A;  3CCV A;  5EAY A;  1Q82 C;  1NTG A;  2R7Z G;  2E2H H;  2HQL A;  4UP9 A;  4GNX C;  2XTI A;  1Q8K A;  4JI3 Q;  3I2Z A;  1AE3 A;  3TS0 A;  3M9B A;  4JOI A;  3CCQ A;  4IO9 A;  2PI2 A;  2UUA Q;  2PQA A;  4A3C H;  1GD7 A;  5JEA J;  5M3F H;  4AYB G;  1I94 Q;  2DGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...