1QZHA

Crystal structure of pot1 (protection of telomere)- ssdna complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
170
structure length
170
Chain Sequence
VIDSLQLNELLNAGEYKIGELTFQSIRSSQELQKKNTIVNLFGIVKDFTPSRQSLHGTKDWVTTVYLWDPTCDTSSIGLQIHLFSKQGNDLPVIKQVGQPLLLHQITLRSYRDRTQGLSKDQFRYALWPDFSSNSKDTLCPQPMPRLMKTGDKEEQFALLLNKIWDEQTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords telomeric single-stranded DNA
publication title DNA self-recognition in the structure of Pot1 bound to telomeric single-stranded DNA
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 43
structure length 170
sequence length 170
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02765 POT1 Telomeric single stranded DNA binding POT1/CDC13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1qzhA00
1VQ6A 4QQBX 3KDFB 5IYBH 2GN5A 1JB7A 2BH2A 4A93G 1E1OA 1JE5A 4B3TL 4LF5L 3RLFA 3CF5A 1XMQQ 2JA5H 2ES2A 1YVCA 3S17H 3L7ZC 4A3GG 2WAQE 1N34Q 5C0XI 3JC66 4GNXB 4DV3L 2ALYB 2R7ZG 2D62A 3ULLA 4NXMQ 2R92G 4BXXH 1UE6A 1X3EA 1QUQB 4A3IG 4A3KH 2V1CC 4JCVE 5LMNL 4UPAA 3GTPH 4A3DG 4K0KQ 4XTCS 4DV0Q 4X64L 1NY4A 1X55A 4JBJA 2R7DA 3TS2A 3NEMA 2UUBQ 1XMOQ 3SGIA 4ALPA 1VQFA 4O2DA 1R9TH 1PH1A 5IYCH 1I6HH 3L2PA 2UUCQ 4UP8A 1Y1VG 1J5EQ 4DR7L 2UXCQ 3JAMi 2OWOA 4AYBE 4JI7L 2Y0SG 5C44G 2EXDA 5M5WH 2UXBQ 2Z6KC 3PUYA 1SE8A 4POGA 4EQ5A 1E22A 4A3LH 2R6GA 4DUZQ 1QVGA 3I55A 3PF5A 2ATWA 3GTQH 2PI2A 1IBKQ 4B3SL 4AH6A 3PV0A 5BR8Q 3HOYG 4BY7H 2ZM6Q 2RCNA 4GNXC 5HGQA 1WI5A 3J81c 4BA2I 3IRBA 1CKNA 4DV2Q 2Q2IA 3UDIA 2JK8A 5IP7G 3S1MH 1Z47A 1MIUA 1KRTA 1NMFA 4OX9Q 1XPOA 1KC8C 1AH9A 3T1HL 3I2ZA 1KXLA 2VQFQ 3RN2A 2Z6KA 1I94L 5LMNW 3PSIA 3E0EA 2VS1A 1PA6A 3HOZH 2YU9H 2UU9L 2NVTH 1Q86C 4JBKA 4DK6C 2UUAQ 3DLLA 4B3RL 3HOUH 3PUWA 1Q8KA 3PO2H 3OW2A 1G6PA 2NZOA 4LFCL 1BBWA 4A3FG 1QUQA 1TXYA 1VQCA 2OTLA 4PG3A 1Q46A 2JA6H 2L15A 4HIOA 1NBWA 2GVBA 2IHFA 1P16A 2Q2HA 3GTGH 4LWCA 1QZHA 1O7IA 2PQAA 2E2IH 3CC4A 4JI0Q 1L1OB 4X66L 2QA4A 2CWPA 4JBMA 5GROA 4RMFA 1IBMQ 1TWHH 2A1AA 2H5XA 1WFQA 1N32L 4R4CA 4HJ5A 2BA0A 4PZ8A 3CCLA 1VQOA 1X56A 4QJFA 3S1NH 2IX0A 4LF4L 2JEAI 3I4MG 4JI7Q 4A3JH 1V9PA 3G4SA 2KBNA 2JA7G 3J81j 3PCOB 4DAMA 1S3OA 3FP9A 2QEXA 1OXSC 2RHSB 1Y1WG 1HNXL 1YNXA 3E9HA 1EIFA 4P75A 1K0RA 4A3BG 2IHEA 3OTOQ 4NXNL 1V43A 4YHHL 3A5UA 2K52A 2HT1A 2IX1A 4JI6Q 3RR5A 3VDYA 2N78A 2JE6I 2EIFA 2YYZA 3I4NG 2VUMG 2K50A 4BBRG 2HIXA 1CSQA 1D7QA 1K8GA 1KIXA 1M90C 4A93H 4GLVB 4LF8Q 1PH5A 2ID0A 4P72A 4OWWB 4A3GH 2GVAA 2E5LL 1KHIA 3AFQA 2ZJPA 4GKKQ 2CCZA 2R7ZH 2Y0SE 2RHQB 2UU9Q 1LTLA 2R92H 1PH7A 5M3FG 4A3IH 4L5TA 4BY1G 4DR6L 4A3DH 1X65A 4J15A 1QZGA 3G71A 4IJHA 1PH3A 3CCSA 1VQJA 3M4OH 2F4VL 2E2JH 3HOWG 3H0GG 4DR5Q 2K5NA 4UP9A 5M5YH 5FLXc 1FGUA 3J7ZC 4DK3C 3H15A 3CCUA 4LFCQ 1VQNA 4IFDI 4GKJL 4KHPL 1FL0A 2NN6G 2ZTCA 4DR1L 4BBSG 2CWAA 3F1ZA 1CKNB 1Y1VH 4JC0A 4DR4Q 4C3IH 1TWAH 1YZ6A 3W1BA 2VQEL 4DV6L 1K9MC 4AIMA 5LMUQ 2AKWB 5C44H 3CMAA 1J6QA 2KHIA 2N8NA 1PHJA 1EYGA 3S16H 1HZAA 4JI5L 1SR3A 3STBD 2QGQA 2HIVA 3BJUA 3K8AA 5IWAQ 1XPRA 4X65Q 2JA8G 4DNIA 4B3MQ 1SRUA 4DR3L 3PF4A 3W1GA 1VQEA 1OXTA 3KJPA 1HNZQ 5M3MG 4LF6L 1C9OA 5C4XG 4X62L 2DUDA 5K36G 2VW9A 2A19A 2KCMA 4NPSA 3HOYH 4GOPA 4WJ4A 2N3SA 4MTNA 4H02A 4TVAB 4XIGS 5IP9G 3I7FA 2KCTA 1PH2A 5IP7H 4QGUA 3I56A 1PV4A 4OONA 4IOCA 1N36L 2YV5A 4MZ9A 4R4OA 2PQAB 2N49A 4GN3B 1KQSA 3ICEA 3PIOA 4C3HH 1XJVA 3PUXA 1PH8A 3EN2A 1X3GA 2OCEA 1HNWL 4WJ3M 4HJ9A 3U50C 1WYDA 1AE2A 1FVIA 3KF6A 2Q2TA 4JI3Q 1Z9FA 1TWCH 4KHZA 1EUJA 4P73A 4YCWA 4HIKA 1XPUA 5DLQE 3CC7A 1NJIC 3D31A 4A3FH 3PUZA 4A3CG 4JYAQ 1B70B 1KAWA 2E5LQ 3ULPA 3HOVG 3I4OA 4YY3Q 1XNQQ 2NVQH 3CCVA 4DV7L 3CW2C 4DR6Q 1Q81C 3CMEA 3PO3G 3A74A 1A8VA 3DM3A 4JI4L 4QL5A 3MXNB 2NZHA 2R93G 5JJIA 1S72A 1PVOA 3KF8B 3LGJA 4JOIC 1YBYA 3S2DH 2UXDL 4GKJQ 4JI8L 4KHPQ 3CCJA 1GO3E 3F2DA 5C3EG 3RNUA 1K83H 2B3GA 2HHHQ 2OQ0A 4JI2L 2LSSA 3ULJA 4LF7Q 1GKHA 2PMZE 3STBC 3I4MH 1WOCA 4YWLA 3PGZA 1BVSA 4LFAL 2JA7H 4JI5Q 1K8AC 1B7YB 4PZ6A 4LW1A 1VQBA 1PYBA 2JEBI 3KFUA 1Q1EA 1Y1WH 5JJKA 4IJLA 3J80i 4A3BH 2KHJA 1VCIA 2MNAA 1W2BA 3GTJH 4X62Q 4B3TQ 4LF5Q 4JOIA 4LF6Q 4HJ8A 1VQ8A 3CCRA 1YI2A 4DV3Q 3I4NH 5FJ8G 3ZJYC 3UDGA 3S1RH 4BBRH 4DV4L 1YJWA 2VUMH 4GN4B 4FDBA 4DAYB 4YCVA 5LMNQ 1XNRL 2B63G 5GQOA 1UE5A 3M3YH 3CQZH 3J7A5 4GS3A 4X64Q 1GM5A 3ERSX 4IO9A 3TS0A 3T1YL 2R7FA 1HR0L 3KOJA 3KYHC 3U4VA 3CP0A 5M3FH 3FKIG 3U58A 4BY1H 4DUYL 4DR7Q 1FJGL 5C4JH 4LF9L 1K3RA 3RLNA 1W3SA 1IZ6A 1N33L 3S1QH 3HOWH 3M85A 3H0GH 2OTJA 1N9WA 1D8LA 2EQSA 3NBHB 3U4ZA 5GAHC 1EQQA 4JV5L 3CPFA 4DKAC 4GOPB 4DR2L 3RZDH 1HZCA 4HJAA 4BBSH 4C3JH 5GAGC 4DV5L 4APVA 3S24A 2HQLA 3GD7A 3AFPA 1UE7A 4IPDA 3K0XA 4B3SQ 2BA1A 4JI4Q 1IYJB 3B6YA 4AYBG 4L5RC 2JA8H 1XMQL 4IPHA 1YJNA 3TREA 5M3MH 1N34L 1BKBA 1MJCA 5C4XH 3F2CA 1EFWA 3KF6B 1I3QH 3T1HQ 2KENA 4OO1G 4L5QA 3S15H 1I94Q 4PMWA 1YITA 1N8RC 2XGTA 3G48A 1SROA 1U0LA 2PI2E 1CUKA 5IP9H 1VQPA 4DV0L 3CCMA 4UP7A 2UUBL 1GVPA 1XMOL 4IPGA 3RLOA 4B3RQ 1JT8A 4R1JA 3K7UC 1HR0W 2JQOA 4O0AA 1SLJA 1YHAA 3Q8DA 2UUCL 2VL6A 3J81i 1G291 1VQHA 3HKSA 4AQYL 1J5EL 1BBUA 1XTDA 4GN5A 4GOPC 2UXCL 3EIVA 3TQYA 3HOXG 1V1QA 3NELA 2C35B 4NB3A 1Q7YC 1YHQA 1SMXA 3G6EA 4DV1L 1YEZA 2I5HA 1TWFH 2WB1G 1EIYB 1XNRQ 3RZOH 4IFDG 4X66Q 4LFBL 1VQ7A 1PYSB 1C0AA 2OQKA 4A3CH 1OXVA 4DUZL 3GO5A 2BH8A 3AYHB 4RG1A 5H1SE 3HOVH 3MEFA 1N32Q 1IBKL 2NN6I 1YHBA 4JI1L 1E7ZA 5BR8L 1WJJA 2ZM6L 2CFMA 4A75A 1YJ9A 1LM0A 1JJ2A 3PO3H 2MQHA 3M9BA 4A3JG 4DV2L 5J3BA 1N33Q 4LF4Q 4OX9L 1CKMA 3UE1A 2DGYA 5FLMG 1ASYA 2JA9A 1L0WA 2D0PA 3WWVA 2A8VA 5C0XG 1P8LA 3HKZG 4MNOA 5C3EH 3GTKH 1TWGH 4Y7NH 1HNXQ 5IT9c 4ME3A 1SN8A 4NXNQ 2FXQA 3PUVA 3UDFA 4YHHQ 3BZCA 1X9NA 5EAYA 2UUAL 5IE8A 4P74A 3K7AH 4QIWE 3AEVA 3M4QA 1G51A 1EOVA 2LXJA 1VQMA 2CKZB 3K80C 1MJEA 1X54A 1MKHA 4IPCA 1KRSA 3PIPA 3E9IA 5IYDG 1I50H 4GLXA 4PZ7A 1Q12A 1S40A 1UWVA 4JI0L 2YTXA 3M4PA 4R4IA 5FJ8H 1A63A 1X6OA 3GTLH 4EX5A 3GTOH 1CKOA 1IXRA 2B63H 4IOAA 1VQAA 1IBML 1Y14B 1IBLL 3KJOA 2E2HH 4A3EG 2F4VQ 4YWMA 1SFOH 1JJGA 3GTMH 4A3MG 1DGSA 3TRZA 1RL2A 3CXCA 4AQYQ 1B8AA 1VQ4A 2NVXH 3D0FA 2AWNA 3FKIH 4DR1Q 1WCMG 1VQGA 1U5KA 4R4QA 2VQEQ 4DV6Q 1PH4A 2YTYA 1EQRA 2K75A 4DV1Q 4QY7A 1HH2P 1X3FA 4LFBQ 1YIJA 3F2BA 5IYBG 3CCEA 4A4IA 1H95A 1LUZA 1HZ9A 2XTIA 4Y52H 1VQIA 1HJPA 3OTOL 2ZJRA 2CQOA 3BZKA 4LUOA 4DR3Q 1JMCA 2JA5G 3UE0A 2Q2UA 3CAMA 4JI6L 4JI1Q 2Z0SA 4OWTB 1RIPA 1QVFA 4BXXG 1OXXK 1M1KC 4A3KG 2ASBA 1A62A 4LF8L 2K14A 2LXKA 2I5MX 5AJ3L 1N36Q 2NVYH 2MO1A 1NE3A 4GKKL 3H3VH 4LUVA 5IYCG 3KDFA 4L5SA 1VQKA 5ELOA 2WB1E 1E1TA 1IL2A 2WAQG 1Q1BA 1HNWQ 1OTCA 1UEBA 3W5OA 5IY0A 1EWIA 2E8GA 4GNXA 4DR5L 1KD1C 1Q82C 4HJ7A 2YTVA 2MFIA 3TEHB 4A3LG 1PH6A 3F8TA 3AQQA 4DR4L 2WP8J 3HOXH 1C7YA 5LMUL 4DV7Q 4BY7G 4BA1I 4KLKA 3L0OA 5IWAL 3CC2A 1QVCA 1VS0A 3OYYA 5E7NA 3HKZE 4X65L 1IBLQ 2ZTDA 2ZJQA 4B3ML 3FHWA 4OXPA 1HNZL 2I0QA 3KLWA 2UXDQ 4X6AH 1PFSA 1GD7A 4JI8Q 3JAMc 2AMCB 1HZBA 5HY6A 2AHOB 4OWXB 4JBWA 3HOZG 4NXML 1VQ9A 3CPWA 4JI2Q 4K0KL 1K73C 4HIMA 1NMGA 4LFAQ 2K5HA 1OXUA 5ELNA 1E3PA 4C2MH 5FLMH 4TQUS 3CD6A 3HOUG 3S14H 3PO2G 3A5ZB 2K4KA 4R4TA 1AE3A 1E24A 5JEAG 2ZTEA 1L2FA 1T9HA 3BU2A 4LNQA 5JEAJ 2F3IA 1ASZA 3A0JA 4A76A 2JA6G 4OO1I 1NTGA 3EBEA 5M5XH 1VQLA 3H3VI 5GAEC 3M7NA 4JI3L 4YCUA 4DV4Q 1L1OC 2WFWA 1UE1A 4JYAL 2UXBL 3UDXA 5AJ3Q 2VNUD 4GLAC 1VQDA 4YWKA 2I5LX 4IFDJ 2JJQA 4POFA 2VY3A 5IYDH 2IT1A 4YY3L 3ER0A 1JJCB 2VZAA 1XNQL 4DPGA 3T1YQ 1CSPA 5JJLA 3S2HH 4JG2A 1I5FA 2B29A 3HFZB 1HR0Q 1A0IA 2F52A 3J80c 2D0OA 4DUYQ 1KL9A 4LF9Q 1FJGQ 2RF4A 4LUZA 4A3EH 4P71A 2AWOA 3NENA 5GADC 4A3MH 2R93H 1PH9A 2PNHA 2IY5B 1VQ5A 1LYLA 4JV5Q 1L1OA 2VQFL 3K81C 3CCQA 2HHHL 4DR2Q 4LF7L 3GDEA 4UY8C 1WCMH 4DV5Q 4HIDA 2K5VA 3RN5A 2MO0A 5C0XJ 4KI0A
chains in the Genus database with same CATH superfamily
3HOYB 1S4ZA 3DXJC 2BH2A 1JE5A 1L0YB 1XMQQ 5ELEA 2ES2A 5C0XI 3JC66 4DV3L 4UHVA 3ULLA 2R92G 4C3HB 1X3EA 4A3IG 5BN4A 1X55A 4HCEA 4ALPA 1VQFA 1VMPA 2EVBA 1PH1A 3D4RA 3MFGA 3L2PA 3SXHA 1LT4D 3KK7A 3JAMi 2OWOA 4JI7L 5C44G 2UXBQ 4POGA 4C1NK 1E22A 3AMUA 2R6GA 1DD2A 1RD9D 1AEXA 1CZGA 4KJNA 4AH6A 4IUTA 5HGQA 3J81c 3IRBA 3I4MB 2Q2IA 4B9XA 4CHTB 3S1MH 1Z47A 1MIUA 1GHJA 1AH9A 1SE3A 3I2ZA 1U4MA 1GUGA 1LTID 1NNXA 4JBKA 3P1HA 2UUAQ 3I4NB 2Z9HA 1RJTA 2NZOA 5JEAH 2Z8LA 1QUQA 1HCZA 4K8JA 2CQAA 1SXTA 3MHBA 3OSOA 4HIOA 1NBWA 2GVBA 3GTGH 4BS9A 1QZHA 2PQAA 2E2IH 4PMCA 2J0TD 2QA4A 1QILA 2K5DA 1PRTF 3E0JA 4IUVA 3D4DA 2A1AA 2L1BA 1WVLA 1WFQA 3HEJA 4R4CA 4HJ5A 5EQ0A 4QJFA 3S1NH 2CH4W 4JI7Q 2EJGC 1V9PA 2Z4HA 3DWQA 1S3OA 1RF2D 3FP9A 2QEXA 1K28A 2IJ0A 4IURA 2C9OA 2K03A 1K0RA 2IHEA 3OTOQ 1V43A 4YHHL 2B2YA 2F0GA 2K05A 2N78A 5D3DA 2E75C 2K50A 2VUMG 4BBRG 2HIXA 1D7QA 1K8GA 1DZ1A 2EXZA 1M90C 4GLVB 1JWMD 4OWWB 1M8AA 1LT3D 4GKKQ 4RGTA 4CJ1B 1PH7A 4DR6L 3EJIA 1SNCA 4A3DH 4J15A 2F0VA 2E2JH 3BDCA 3CCUA 3H15A 1FL0A 4DAYA 3X3NA 5DM73 4DR4Q 4C3IH 1TWAH 2F0FA 1LTBD 4TSSA 1QWYA 1J6QA 4RGNA 1WTVA 3PO3B 3S16H 2PO4A 1KNEA 1EIGA 2AQ3B 5JPMC 4LF6L 1C9OA 2F3VA 4X62L 2A19A 3HOYH 1IW7D 5A2QL 1I4GA 5IP9G 1V1PB 3I56A 4MZ9A 1A3UA 3OIPA 3OPOA 3C2PA 3E5SA 2N49A 3ICEA 4KY6A 4C3HH 1EWHA 1I4RA 1STEA 1HNWL 4HJ9A 1I50B 1JOKA 2RBMA 4CDEC 2LFNA 3KF6A 1UUPA 4KHZA 4YCWA 3TZDA 1XPUA 1NJIC 3D31A 2L11A 3PUZA 4RGOS 3HOVG 3GTMB 3I4OA 3N6RA 3CW2C 5EPJA 4DR6Q 2BDNA 2OXPA 1ENCA 1A8VA 3FKIB 5EKKA 5JJZA 1PTOF 2G5DA 1B3QA 1F9PA 2R93G 5JJIA 1S72A 3KF8B 1C4QA 3LGJA 1FNWA 1PRTB 3S2DH 4JI8L 1GO3E 1G91A 5C3EG 3J7AF 5CV4A 3TZUA 2B3GA 2EYPA 1ET6A 3I4MH 4LFAL 3QWNA 1K8AC 1QCBD 4PZ6A 2B2WC 1VQBA 1GUOA 1Q1EA 1GHKA 4IJLA 4NMZA 2KHJA 4LF6Q 4B3TQ 4X62Q 2GA4B 4JOIA 3SEBA 1LTAD 2RQXA 5CMDA 3I4NH 1QOHA 3ZJYC 5IGFA 4DV4L 1SYDA 4GN4B 1XNRL 4YCVA 1UE5A 1SSOA 2C5CA 4GS3A 5CV7A 4X64Q 2RVLA 3ERSX 3CU7A 2B2YC 3FRPB 3KYHC 5KYLA 4DR7Q 1TS2A 1K3RA 1EQTA 1N33L 1WTHA 3NBHB 5GAHC 1EQQA 4G7ZC 1DXMA 4DKAC 5KEEA 4DR2L 4GOPB 1HZCA 1X3QA 5GAGC 1BQQT 2PW7A 4IPDA 5E4XA 1HUMA 3B6YA 4RCNA 1BCPC 1MJCA 3OMGA 1TR5A 1EU3A 1JC7A 4N8FA 1SROA 4MIUA 1B4OA 4U68A 2UUBL 1GVPA 4RGMA 2JQOA 3V2TA 2K28A 1BF4A 3A56A 1VQHA 2KEEA 4AQYL 1XTDA 1CFMA 4MN3A 4CKCA 2EY2A 2EY5A 2EOTA 2C35B 4NB3A 1Q7YC 2M00A 3G6EA 1XNRQ 3H6MA 2WB1G 3QJYA 1WTWA 3DHQA 1Y69U 1BXTA 1OXVA 4RAUC 1EEID 3MEFA 1N32Q 1Y8OB 1S5FD 1E7ZA 1D2BA 1WJJA 3PO3H 2CFMA 1WCMB 4XXEA 1N33Q 4ZLTF 1PTOB 1F9QA 1ASYA 4K2LA 1XYIA 1PZJD 2D0PA 2B2TC 3MWYW 3WWVA 3FPPA 4MNOA 4MTKA 3S17B 2F0DA 2JA5B 4NXNQ 4HN7A 5DM63 3BZCA 3DEPA 4P74A 3AEVA 4QUFA 2DJFC 3MC0B 1EOVA 1TT2A 3OW7A 4F87A 3JAML 1ICWA 1E2VA 3NQTA 1R9TB 3E9IA 1I50H 4GLXA 2YTXA 3M4PA 1A63A 1CKOA 4CBVA 2WAQB 4A3EG 1LV9A 1JJGA 3GTMH 1SJHD 5M5WB 2IW3A 4N8X1 4IZ8A 3CXCA 4AQYQ 1O7ZA 3QIAA 3FKIH 3EFXD 1U5KA 4E6IA 4R4QA 2VQEQ 2L0CA 4DV6Q 4HMJA 1TIID 4QY7A 1X3FA 2WIIB 4H13C 3GQBA 3F2BA 3C46A 1LUZA 4AYBB 3J81E 4DR3Q 5J39A 5TSSA 1ESFA 1IW7C 2Z0SA 1RIPA 5KIXA 3BVMA 1OXXK 5JOBA 4A3KG 2NVTB 1HUNA 1ESRA 4V0BA 2LY7A 3KLSA 3Q6SA 2K14A 2HD3A 3PO2B 3H3VH 1PFMA 2X6LA 2QEJC 4V190 3VR6A 1Q1BA 3N52A 1UEBA 2E8GA 4XQNA 1QNUA 4FF3A 3EROA 3VR4A 4HJ7A 1F2MA 5A35A 4RWSC 1H9RA 4L8JA 3F8TA 3A8IE 1ILPA 4C1NI 2K01A 4DV7Q 1VMCA 3L0OA 5IWAL 3CC2A 5E7NA 3OYYA 1PZKD 4X65L 2ZJQA 4DAPA 4B3ML 4A3JB 3NE5B 3T4AC 4FYDA 5I2XA 4X6AH 1PFSA 1AZQA 2JXMB 3R2TA 4OWXB 3KLRA 4NXML 3CPWA 1EYCA 2F0QA 4K0KL 2F0MA 3I91A 3J7AV 5ELNA 3HOUG 1E3PA 1M4VA 1MI2A 4R4TA 4O42A 2ZTEA 1T9HA 2EY1A 4LNQA 4PNYA 1ASZA 5D3IB 3H09A 1VQLA 3EBEA 3HRZC 2QILA 2R92B 4A3IB 2WFWA 4JYAL 3VYSA 3M4OB 1UAPA 3BYYB 4IFDJ 4POFA 2VY3A 4JK1C 5IYDH 5M5YB 2H4OA 2IT1A 4YY3L 1XNQL 4FF1A 2FFKB 4JG2A 1HR0Q 3J80c 5C3WA 4DUYQ 1KL9A 3UI2A 1FJGQ 4IALA 5C44B 2PZTA 1MSHA 2AWOA 2EYLA 2VQFL 2HHHL 3CCQA 1SYGA 4KK7A 4LF7L 4UY8C 1WCMH 1TVXA 3G7LA 4HIDA 3MTSA 1JOQA 1PTOH 3SDZA 2IX3A 2B8FA 1SNMA 2GN5A 3HP3A 4XT3B 1JB7A 4A93G 3T16A 4LF5L 3S17H 2JA5H 4A3GG 2WAQE 4GNXB 2ALYB 2MUYA 4NXMQ 5I6WA 3K0YA 1QUQB 4K0KQ 2V1CC 4JCVE 5LMNL 4UPAA 4DV0Q 2VB3X 3CKIB 1SMYD 4RCOA 1R9TH 1SYFA 2A68C 1ZYRD 5IYCH 3T13A 4EQOA 1T5XD 1Y1VG 1J5EQ 1RDPD 4AYBE 2RA4A 2Y0SG 1II3A 4R8NA 5M5WH 3PUYA 2RCFA 1B1ZA 1SE8A 5FK9C 1B9NA 4A3LH 3TP7A 1Q3LA 3VA5A 2QF7A 3I55A 3TP8A 2ATWA 2B39A 4OEMB 5BR8Q 2ZM6Q 2RCNA 4DFAA 1E0BA 5T1IA 4BA2I 1CKNA 2RSOA 4I65A 3UDIA 5FLXL 2F0IA 1E2WA 2JK8A 5IP7G 2HCIA 4OX9Q 3SK6A 3GP7A 3T1HL 1KXLA 2VQFQ 1C48A 1I94L 4QMGA 5LMNW 5HGTA 3FEWX 1PA6A 2NVTH 5FOBB 1Q86C 2OEOA 4DK6C 2V4DA 3I72A 3DLLA 4B3RL 3MVVA 2VUMB 4BBRB 3PO2H 3OW2A 4BWGB 1G6PA 2PMZB 2D2CC 1BBWA 4A3FG 1TXYA 5C5MA 2NTTA 1Q46A 4WORA 2NWGA 2Q2HA 2ZT9C 1HPCA 2CW0C 3OHXC 2CWPA 2IL8A 5C4JB 5EPLA 2H5XA 1PRTC 1A3VA 2WV6D 3LWUA 2XNAC 3RZDB 3QO2A 4KD3A 3GV3A 5I9PA 1B2TA 1X56A 4LF4L 1EU4A 4A3JH 3G4SA 2QCPX 1JORA 2I07B 5AFWA 1EY0A 1Y1WG 1CZWA 1YNXA 3MXNA 2TMPA 1BNZA 1HNXL 1NR4A 1W6KA 1XX8A 2NBFA 2LKVA 2IX1A 1I3QB 3H3VC 3VDYA 2JE6I 2YYZA 1H9SA 2AUJD 3TP6A 1B3AA 2SNMA 4LF8Q 5DEHA 1VF5C 2X69A 1KHIA 2SEBD 3PIO3 1KDAA 2RHQB 2R92H 5M3FG 4A3IH 2WINB 5CR3A 5FLXE 5EBDA 3M4OH 1PH3A 3CCSA 2F4VL 3QG1A 5M5YH 1TKWB 3J7ZC 1VQNA 3RZOB 4GKJL 4KHPL 2NN6G 4ME5A 3HOVB 1YZ6A 3ERQA 5LMUQ 5BN5A 5C44H 2N8NA 1SR3A 4ZAIA 1WTRA 2HIVA 3K8AA 1XPRA 4HSVA 4K8IA 4DNIA 3NUCA 1SRUA 4ZKCB 2F03A 1OXTA 1JQYD 5C4XG 3ND9A 4RFBA 1FNUA 1UNSA 2VW9A 1UEAB 4NPSA 5C3EB 3GTKB 1EZ8A 5K36G 1TWGB 4Y7NB 2N3SA 5L37A 3I7FA 1N36L 4I7AA 4OONA 4IOCA 3K7AB 2AUKA 1O7YA 4QF4A 4R4OA 1HFNA 3ITPA 3PIOA 1XJVA 3EN2A 1X3GA 4N9PA 3CRKC 3IL8A 1FVIA 2Q2TA 4JI3Q 1H9JA 4LMQD 4DU9A 1SNOA 2Z1CA 4HIKA 3NP8A 4OL7A 5DLQE 3CC7A 4A3CG 1B70B 1KAWA 4QIWB 4CKBA 1SFOB 3BZDB 1FR3A 2MP1A 1EY4A 2A6HC 3CHBD 3S2DB 3CMEA 1X32A 3DM3A 3TMEA 1PTOC 5I4DA 1YBYA 3HG9A 2UXDL 4GKJQ 4KHPQ 4G57A 1BCPD 5G3LF 2OQ0A 2O2LD 3ULJA 1GKHA 2PMZE 4KHVA 1I4HA 1BVSA 3LNNA 1B7YB 4GZYC 4LW1A 1EZ6A 1PYBA 5FO9B 2MNAA 1CI3M 5CV5A 1VQ8A 4P2CB 2DY8A 2A73B 3O13A 4DV3Q 5FJ8G 3UDGA 2VUMH 4BBRH 4HTHA 2B63G 3MAQA 3J7A5 2M9VA 1SMYC 4X3UA 1ZYRC 4IO9A 2B2WA 3T1YL 1S5BD 2F1MA 1D5MC 4DK0A 4XYQA 3K5MA 5C4JH 4LF9L 2SOBA 1W3SA 3RD4A 3M85A 3T53B 1N9WA 4PMBA 2EQSA 2WB1B 3SVMA 3U4ZA 3DWAA 3RZDH 4HJAA 4DV5L 2HQLA 3K0XA 1JE4A 1IYJB 1U4PA 4CKEA 2SNSA 4FF4A 1N34L 1BKBA 2L5TA 1XWEA 1PXUA 4OO1G 1I3QH 1O78A 2KENA 2XGTA 5IGDA 3TBIB 2PI2E 5IP9H 4UP7A 3A55A 1XMOL 2N55A 2L4NA 3RLOA 2QDLA 1JT8A 3R3OA 4R1JA 4L63B 1SLJA 1YHAA 1GOZA 2UUCL 1B53A 3H91A 1MSGA 2VL6A 1HXYD 2UXCL 4CDDC 3EIVA 4MHEA 3TQYA 1E2ZA 3S2HB 1YHQA 1YEZA 3RZOH 3NWTA 5IGCA 1VQ7A 1PYSB 1C0AA 3J80E 5IODA 4A3EB 4DUZL 2BH8A 2HUGA 4RG1A 1W6JA 3HOVH 5EBCA 1IBKL 1WD0A 4A75A 4IUPA 1JJ2A 2MQHA 1STYA 4DV2L 5J3BA 4ZK9B 4U673 1SNQA 1SNDA 1STAA 3UE1A 1VF7A 5FLMG 2JA9A 1DOMA 3IFTA 2A8VA 5C0XG 3HKZG 5C3EH 3GTKH 1TWGH 4Y7NH 4RA8A 1ZXTA 5IT9c 4ME3A 1R4PB 5I6YA 2FXQA 3PUVA 3UDFA 4YHHQ 1X9NA 2FJ2A 3K7AH 4QIWE 4A3KB 1QE6A 3GTPB 2CKZB 3T56B 2PPBC 1X54A 4JPBW 1F2ZA 3VYRA 1MKHA 4IPCA 3LX0A 1KRSA 4PZ7A 1S40A 1L0XB 1UWVA 2B2TA 4KKUA 4JI0L 4R4IA 1I6HB 1X6OA 4EX5A 3K5NA 1IXRA 3IFDA 1D5XC 1FYCA 1IBML 4HR7B 2G9HD 2X6GA 1SFOH 5ISRA 1ZEQX 2DNEA 1VQ4A 1RTOA 3D0FA 4DK1A 4UDUC 3GTQB 1A3TA 1EQRA 2K75A 4YIJA 3FVQA 2HDMA 3NSWA 5IYBG 3CCEA 3F2UA 2ZJRA 2CQOA 2P5ZX 3BZKA 1JMCA 1SBBB 4KKSA 3CAMA 4JI6L 4ZRZA 4DN4M 2CH4A 4BXXG 4J8QA 1M1KC 4FXDA 4ZUJA 3HOUB 2QDBA 1JWSD 2EJMA 1D6EC 2WB1E 4TKOB 1E1TA 3I8ZA 1IL2A 4PV1C 1HNWQ 4JW0A 1OTCA 2EYJA 4DR5L 1EWIA 1KD1C 3E6ZX 3FDTA 3TEHB 1TWHB 3AQQA 2M2LA 4LJZC 1WTPA 4FVMA 1CQVA 2VB2X 4BY7G 4BA1I 2LS01 2EDGA 1QVCA 1VS0A 3A8JE 2ZTDA 2L55A 1HNZL 2E74C 5C5LA 4JI8Q 2EJFC 3Q24A 2OF1A 1HZBA 4IN3A 3HOZG 3Q22A 3V05A 4LFAQ 3CD6A 3A5ZB 4A93B 4KV6A 2A68D 5KRUA 4A76A 2JA6G 4A3GB 2F0SA 1NTGA 3H3VI 1EY9A 3J81L 1FD7D 1K8OA 3NK9A 1IKLA 4DV4Q 3K58A 5IGEA 5EKIA 1TU2B 4GLAC 2Q8IB 1SYBA 2FINB 5JJLA 4DPGA 3S2HH 2B29A 1Y1VB 1I6VC 4LUZA 4A3EH 2Y0SB 3K5LA 2F0OA 2ZXRA 2JP1A 4P71A 3NENA 5GADC 2IY5B 2PNHA 1LYLA 3K81C 4DR2Q 5COYA 3KBXA 1MGSA 4ZQ3A 3L3OC 3KDFB 1CTMA 1E1OA 3CF5A 1LTSD 4IUUA 1CHQD 2R7ZG 2D62A 2RDGA 1ILQA 1UE6A 1D5ZC 4A3KH 4O1NA 3SR1A 3GTPH 4WRDA 2CW0D 3TS2A 3NEMA 2UUBQ 3SGIA 1CQFA 2H1EA 4O2DA 1TS3A 3SK4A 1I6HH 4A3FB 1PRTD 3WDNA 1HQMC 4KD4A 5ELDA 3EQLC 2NVQB 1TY2A 4KY7A 2EXDA 4Q5VA 1TS4A 2Z6KC 2XIWA 1S5ED 2A5HA 2F0LA 3GTQH 5M9OA 4B3SL 3PV0A 4XT1B 1SDFA 4DA2A 4RKBA 1SJED 3OWEB 1NMFA 1GUNA 3PSIA 3E0EA 1Y1WB 2VS1A 5EGTA 3NTKA 1U4LA 1KABA 3P7JA 3D6CA 3HOUH 1Q8KA 1YNJD 3T51B 1HA5A 4LFCL 1CK1A 1V1PA 3CQZB 4K6DA 1VQCA 2OTLA 1GUWA 2IHFA 1P16A 2CVRA 3G6JB 4DAVA 2E76C 5M3FB 1L1OB 4X66L 4IFDH 2R3ZA 1TWHH 1BR9A 1DOLA 3IAYA 3S1QB 1QJOA 4JVZA 2BA0A 4PZ8A 3DM1A 1VQOA 4RHSA 1F2YA 2IX0A 2JEAI 2RKSA 2KBNA 2JA7G 3VA7A 3J81j 3PCOB 1AZPA 4ZYSA 1OXSC 3BS1A 3Q0AA 5IIFA 4A3BG 2KHSA 3OOCA 4OGQC 2HT1A 2K52A 5C4XB 3KLSX 3LWEA 1CM9A 1EIHA 3S15B 4ID6A 2F0EA 3P20A 2EY6A 1KIXA 2A6ED 2F4IA 2KJXA 4A93H 5CYUA 1BDOA 4J1MA 2GVAA 4A3GH 2E5LL 3AFQA 2ZJPA 2KCCA 2CCZA 1EYDA 2Y0SE 4I7ZC 1LTLA 1LTRD 4BY1G 2A6HD 4IJHA 4QB4A 1VQJA 3M7GA 1G2TA 3HOWG 2B2VA 3H0GG 1LACA 4UP9A 5JVG3 1FGUA 4LFCQ 4DK3C 3OIQA 1PTOD 4DR1L 4F88A 5C3XA 4BBSG 2CWAA 4C3JG 1Y1VH 1QNKA 4AIMA 3SK8A 3CMAA 2KHIA 2NYZD 1EYGA 1HZAA 1WTXA 2QGQA 5IWAQ 4EVOA 2JA8G 4K5VA 4X65Q 4B3MQ 2JN4A 3PF4A 3SE0A 3KJPA 5M3MG 2DUDA 3NBHA 3PMFA 2KCMA 1IYVA 3BDOA 3EVQA 4GOPA 4WJ4A 1PYWD 4XQJA 4XIGS 3A7AB 2L9HA 1F9SA 1PH2A 1U4RA 1V1OA 5IP7H 4F8MA 5IT9E 1PV4A 2PQAB 4GN3B 1KQSA 1PH8A 1J9OA 1ONLA 1WYDA 1AE2A 1Y8PB 1TY0A 1Z9FA 4IQZA 1EUJA 4P73A 2B63B 2ICIA 4JYAQ 4A3FH 2E2HB 4CDFC 1DONA 2E5LQ 1TQOA 3ULPA 5E3FA 4YY3Q 1XNQQ 2NVQH 3I90A 1Q81C 2NVXB 4QL5A 1F2LA 2NZHA 2F0NA 1WD1A 1PVOA 4ILWA 1V8QA 3CCJA 3TDQA 1EWCA 3FMCA 4R9WA 1AN8A 2HHHQ 4JI2L 4LF7Q 3STBC 1RCVD 4YWLA 3PGZA 1EFID 2PZUA 5KNCA 2JEBI 2K04A 1Y1WH 1VCIA 1W2BA 4LF5Q 2NVYB 1R4QB 3CCRA 1YNND 3R8BA 1NAPA 1RKNA 1YJWA 5E1FA 4L6TB 4FDBA 1BCPB 4KN4C 4DAYB 5C4ZA 5LMNQ 5GQOA 3CQZH 3A7LA 3TS0A 1S5DD 2EE1A 1O80A 3U4VA 3CP0A 5EKLA 2J7ZA 5M3FH 3U58A 3RLNA 1IZ6A 3S1QH 2OTJA 1D8LA 2ENBA 4JV5L 5I2YA 1KAAA 2NUCA 1SYCA 3TP5A 2NN6H 1SE2A 1EY5A 4HMIA 1QG7A 3GD7A 3AFPA 1UE7A 2BA1A 2B2VC 4AYBG 1DCZA 1XMQL 1YJNA 4C2MB 2EZVA 3S14B 5C4XH 3F2CA 1EFWA 2MHVA 5K36H 3KF6B 3T1HQ 3HKZB 3S15H 1I94Q 4PMWA 4CDCC 1N8RC 1XTCD 4FXGC 1VQPA 1A6XA 5M5XB 3QOJA 4K6LA 1YNJC 4B3RQ 4O0AA 3MXUA 1EYAA 3J81i 3HKSA 1BBUA 4GN5A 2PYKA 4GOPC 1X3PA 1I4XA 3HOXG 4DNTB 3C1EA 1SMXA 4DV1L 2I5HA 1PMRA 4LFBL 1D1KA 4B9WA 4A3CH 3GV6A 2R93B 3ND8A 1YHBA 4JI1L 4Q0FA 1KTKA 1LM0A 4A3JG 4LF4Q 2K1BA 1CKMA 2IWHA 1L0WA 3Q23A 4FF2A 1P8LA 1HNXQ 1JOOA 1SN8A 2UUAL 2RSNA 1Z7TA 4X3KA 5ELCA 1G51A 4ZUIA 2A6EC 2LXJA 3D4WA 1MHWC 1MJEA 3PIPA 4EGVA 1Q12A 5IGGA 1ICFB 5FJ8H 2F0HA 1F77A 2R61A 2B63H 2KVMA 2QW7A 1Y14B 2E2HH 2F4VQ 4YWMA 4A3MG 1KLUD 2DN8A 1DGSA 2BE5C 3VR5A 1RL2A 2NVXH 2PW5A 2JSOA 1I4PA 1VQGA 2NTSA 3DEOA 5F2DA 1CA5A 1PH4A 4DV1Q 4BY7B 5IOCA 1HH2P 4LFBQ 1YIJA 1LT5D 2O5IC 4A4IA 2KCNA 5EPKA 1VQIA 1HJPA 3OTOL 4Y52H 2A69C 4LUOA 3K6OA 2RDHA 4JI1Q 3J80L 4OWTB 1QVFA 3C1FA 3HOZB 2YU9B 5IGBA 4IUQA 2ASBA 3NBIA 2KQ3A 4LK1C 1N36Q 2NVYH 2O4XA 1ML0D 2MO1A 3CRLC 4GKKL 4OO1H 5ELOA 2JA6B 1CHPD 2KEDA 2FMMA 3W5OA 5IY0A 4GNXA 3U9OA 2FMCA 4M1UB 1JCKB 1PH6A 4DR4L 1Q8IA 2WP8J 2F0KA 4QCLA 4K2KA 4KLKA 1DJRD 3HKZE 4OXPA 2K33A 3M4YA 2UXDQ 3JAMc 4G7OC 4ODGA 4DXFA 1AW7A 2AMCB 2AHOB 3IKJA 1GUSA 2IPKD 4RH6A 4ULLA 1K73C 1A15A 5CBEE 2K5HA 1OXUA 4C2MH 5FLMH 3S14H 2XWBB 4TQUS 4ZKBB 5C0XH 1AE3A 1E24A 5JEAG 3C3LA 5JEAJ 1YNNC 2F3IA 1A2UA 3A0JA 3NXWA 4HCSA 5M5XH 5GAEC 2R7ZB 4IUNA 4NDXA 2PZWA 3DMUA 4WFN3 5J22A 3NWSA 1L1OC 3UDXA 1FGBD 4YWKA 1RHPA 2I5LX 3ER0A 1JJCB 3T1YQ 1CSPA 1DYQA 1PDQA 3I4LA 1EQVA 1I5FA 3HFZB 2F52A 3NTIA 5KNDA 4LF9Q 2RF4A 1OO9B 2R93H 1PH9A 1I4QA 3J7YW 1VQ5A 3ZYYX 4K5XA 3GDEA 4DV5Q 1IYUA 3RN5A 2MO0A 5C0XJ 2B8GA 1JICA 4KI0A 4OELB 1VQ6A 4KKTA 1G2SA 4QQBX 5IYBH 4PQXA 4B3TL 3D8GA 3RLFA 2D9UA 1YVCA 5HURA 2ZXOA 3L7ZC 1K0SA 1N34Q 5D65A 4FP5D 1HTLD 4BXXH 1JB3A 1SAPA 4LAAA 4A3DG 3E3XA 4XTCS 2OT2A 1NY4A 4JBJA 4X64L 2R7DA 5T1GA 3A54A 1XMOQ 1ET9A 1TWCB 2UUCQ 3D3RA 4UP8A 4DR7L 4M8AA 2UXCQ 4C3IG 1ENFA 1LO5D 4ZCKA 3AU7A 5DAUA 3K5OA 4EQ5A 3FPUB 1SE4A 1EOTA 1KDBA 4DUZQ 3ONAB 1F9RA 1QVGA 2BOSA 3PF5A 1NUCA 2PI2A 1IBKQ 3SHLA 1K83B 1LTGD 3HOYG 4RKLA 1BOSA 2B2UA 4GNXC 4BY7H 1KLGD 4OIJA 1WI5A 1HTPA 4DV2Q 2JA7B 1KRTA 1XPOA 1KC8C 1ENAA 2MPMA 3RN2A 2Z6KA 4A3BB 4C3HG 3HOZH 2YU9H 2UU9L 3GTJB 2F0WA 3I3CA 3S1RB 3PUWA 1BBXC 2EYMA 5CC4A 3EA6A 4X3TA 3M3YB 2FHTA 1HQRD 4PG3A 2JA6H 2L15A 2VXWA 4HAEA 4LWCA 1O7IA 4JI0Q 5I9OA 3CC4A 2EYFA 4HEDA 4TRDA 5KGUA 4BY1B 5CORA 4JBMA 5GROA 4RMFA 1IBMQ 3HOWB 2F0PA 3H0GB 5CV6A 1N32L 5A2QE 1LTTD 2EPBA 3CCLA 4DXGA 3D6WA 4BBSB 1VDZA 2BDOA 4C3JB 4HSPA 3I4MG 4H44C 1MD2D 4DAMA 3HS0C 2JA8B 2RHSB 3S9WA 3E9HA 1EIFA 2K7VA 4P75A 4NXNL 5M3MB 3A5UA 2KOLA 3BG3A 4EQPA 4JI6Q 3RR5A 1HFGA 2EIFA 3I4NG 1Z6HA 1CSQA 2XSCA 3OWFA 1NSNS 2WACA 3BDLA 2K5QA 1PH5A 2ID0A 4P72A 4XYOA 3VYUA 1WTOA 3P75A 1HHVA 1PFNA 2R7ZH 2SDFA 2WKCA 2UU9Q 4C56C 4L5TA 1X65A 4NW2A 3G71A 1QZGA 3I70A 4ABNA 1JR0D 4DR5Q 2K5NA 2Z4IA 5ELFA 5FLXc 1TWFB 3NTHA 4IFDI 1D1IA 2ZTCA 5CGKA 5DNFA 1HA6A 3F1ZA 1CKNB 4JC0A 1K9MC 3W1BA 2VQEL 1NCVA 2HCCA 4DV6L 2AKWB 1PHJA 5G3LD 4JI5L 3STBD 3BJUA 4DR3L 3W1GA 1VQEA 4H7BA 1LABA 1HNZQ 2TSSA 5D14A 4RHRA 1KNAA 2XN9C 4MTNA 4H02A 4TVAB 3KBGA 2KCTA 3V96A 4QGUA 1K8MA 2YV5A 1EY7A 2DNCA 2K32A 1A2TA 2LMCB 1SEBD 1IKMA 3PUXA 2B2UC 5CBAE 2OCEA 4WJ3M 3U50C 1T5EA 5J1ZA 1B50A 3GTLB 1LT6D 3R2IA 3GTOB 1TWCH 4DF7A 1JWUD 4XDXA 1J8IA 2F0UA 1STGA 2PCFB 4KMUC 3CCVA 4DV7L 3BYTB 3PO3G 3A74A 3TSSA 4N9TA 3VYTA 1WTQA 4XQQA 4JI4L 3MXNB 2K5WA 4JOIC 2AQ2B 2ZXPA 1H9SB 3F2DA 3RNUA 1K83H 2LSSA 2HQEA 1WOCA 1O7LA 2JA7H 4JI5Q 4R8IA 3VR2A 3MXGA 4CJ0B 3KFUA 5JJKA 2Z6BA 3J80i 4A3BH 5CV9A 1H9MA 3TN2A 2HDLA 3GTJH 2EYOA 4HJ8A 3R93A 1YI2A 3S1RH 2XRQD 3NPPA 1GJXA 3M3YH 1GM5A 1SNPA 5IT9L 2F0TA 2QKIC 2R7FA 4OIKA 1HR0L 3KOJA 5JPNC 4S3SA 3FKIG 4BY1H 4DUYL 1CT1D 1B9MA 1FJGL 3HOXB 4KJOA 2Q8TA 3HOWH 3H0GH 2Q8RE 3CPFA 4UAIA 4BBSH 4C3JH 3RUZA 3S24A 4APVA 4FNFA 3AB9A 2WKDA 3KF8A 2XRSD 5EJWA 3MA2B 1RODA 1S5CD 5E4WC 3JAME 4B3SQ 4JI4Q 4L5RC 1BCPF 3W3AA 2JA8H 2KECA 2DY7A 2F3WA 4IPHA 3TREA 3MZ5A 5M3MH 5FO8B 4L5QA 1YITA 2E2DC 3G48A 1U0LA 2I46A 1CUKA 1STBA 4DV0L 3CCMA 4IPGA 5LL6S 3K7UC 4G4KA 1HR0W 3Q8DA 3SK5A 1G291 2K6AA 1J5EL 1HRJA 2BE5D 1IL8A 1V1QA 3NELA 4B08A 1G8ZD 4IFDG 1EIYB 4H0LC 1TWFH 4X66Q 2ICEC 1GXDC 2OQKA 3L9AX 5C6AA 3GO5A 3AYHB 5H1SE 2AQ1B 4QUCA 4A3MB 5LHY1 1IHZA 2NN6I 5BR8L 1SYEA 2A69D 2ZM6L 1YJ9A 3M9BA 3W2DA 4OX9L 4J6HA 2DGYA 3HGBA 2BCOA 2PNRC 2D5DA 3VR3A 1STHA 1TS5A 5EAYA 5IE8A 1EL0A 1NR2A 3M4QA 1VQMA 1EY8A 2O5JC 3K80C 3K57A 3RMHA 3DUZA 5NUCA 2L12A 5IYDG 2KA7A 4KTAA 3GTLH 3GTOH 4KN7C 4CJ2C 1PZID 4IOAA 1VQAA 2MGSA 1BUVT 2XVSA 3KJOA 1IBLL 4NKLA 3MXPA 3KUPA 3TRZA 1B8AA 3DWPA 3X3MA 4DR1Q 2AWNA 1WCMG 1FNVA 1ZKOA 2J4XA 3QB3A 2YTYA 5C4HA 1Q90A 2A74C 2RDFA 1H95A 2KUMA 1HZ9A 2XTIA 3WOEA 3S1MB 1RTNA 2JA5G 2PQEA 3UE0A 2Q2UA 3QOLA 1CA6A 1K3BC 2EYHA 3MFYA 1EY6A 1DM0B 4K5WA 3I73A 3K59A 1A62A 1LLRD 2XWJB 4DNRB 4LF8L 2LXKA 2I5MX 5AJ3L 5JAVA 3NQIA 1AP0A 1NE3A 4LUVA 5IYCG 3KDFA 4L5SA 3NHHA 1VQKA 4F7XA 5K5PA 2WAQG 3BVZA 3GTGB 2E2IB 1U9RA 5FO7B 1Q82C 3MEHA 2YTVA 2MFIA 1PLFA 4A3LG 3PQIA 2NZ1D 4X3SA 1H9KA 3U9SA 3HOXH 1C7YA 3A8KE 1QB5D 5FKAC 5LMUL 2MJ8A 5CV8A 4FO2A 3S1NB 1IBLQ 5BN3A 3FHWA 2CHBD 2I0QA 2NB0A 3KLWA 4NP5A 1DOKA 5ELBA 1AFPA 1B44D 1GD7A 4Z9CB 3URYA 4FXKC 5HY6A 4JBWA 1PFBA 1VQ9A 4EQNA 4JI2Q 4HIMA 4G7HC 1NMGA 2N88A 3PO2G 1C8CA 1G6ZA 1GUTA 2K4KA 3H94A 1STNA 4WJWA 5KNBA 1L2FA 1BO0A 3BU2A 3HZXA 4CGYB 3PIP3 2G9DA 2JYOA 4OO1I 3WOFA 3M7NA 4JI3L 4YCUA 3QR8A 1XXGA 1UE1A 4A3DB 2UXBL 5AJ3Q 2VNUD 1VQDA 2E2JB 2JJQA 1EEFD 1MBYA 2VZAA 5LL6X 4KY5A 1A0IA 2D0OA 1TWAB 4C3IB 4K14A 4OHJA 1KDCA 3S16B 4A3MH 3BVGA 5JVH3 4JV5Q 1L1OA 4DGZA 1Y8NB 2F0JA 2DJGC 2K5VA 5KYIA 3OMCA
chains in the Genus database with same CATH topology
1VQ6A 4QQBX 3KDFB 5IYBH 2GN5A 1JB7A 2BH2A 4A93G 1E1OA 1JE5A 4B3TL 4LF5L 3RLFA 3CF5A 1XMQQ 2JA5H 2ES2A 1YVCA 3S17H 3L7ZC 4A3GG 2WAQE 1N34Q 5C0XI 3JC66 4GNXB 4DV3L 2ALYB 2R7ZG 2D62A 3ULLA 4NXMQ 2R92G 4BXXH 1UE6A 1X3EA 1QUQB 4A3IG 4A3KH 2V1CC 4JCVE 5LMNL 4UPAA 3GTPH 4A3DG 4K0KQ 4XTCS 4DV0Q 4X64L 1NY4A 1X55A 4JBJA 2R7DA 3TS2A 3NEMA 2UUBQ 1XMOQ 3SGIA 4ALPA 1VQFA 4O2DA 1R9TH 1PH1A 5IYCH 1I6HH 3L2PA 2UUCQ 4UP8A 1Y1VG 1J5EQ 4DR7L 2UXCQ 3JAMi 2OWOA 4AYBE 4JI7L 2Y0SG 5C44G 2EXDA 5M5WH 2UXBQ 2Z6KC 3PUYA 1SE8A 4POGA 4EQ5A 1E22A 4A3LH 2R6GA 4DUZQ 1QVGA 3I55A 3PF5A 2ATWA 3GTQH 2PI2A 1IBKQ 4B3SL 4AH6A 3PV0A 5BR8Q 3HOYG 4BY7H 2ZM6Q 2RCNA 4GNXC 5HGQA 1WI5A 3J81c 4BA2I 3IRBA 1CKNA 4DV2Q 2Q2IA 3UDIA 2JK8A 5IP7G 3S1MH 1Z47A 1MIUA 1KRTA 1NMFA 4OX9Q 1XPOA 1KC8C 1AH9A 3T1HL 3I2ZA 1KXLA 2VQFQ 3RN2A 2Z6KA 1I94L 5LMNW 3PSIA 3E0EA 2VS1A 1PA6A 3HOZH 2YU9H 2UU9L 2NVTH 1Q86C 4JBKA 4DK6C 2UUAQ 3DLLA 4B3RL 3HOUH 3PUWA 1Q8KA 3PO2H 3OW2A 1G6PA 2NZOA 4LFCL 1BBWA 4A3FG 1QUQA 1TXYA 1VQCA 2OTLA 4PG3A 1Q46A 2JA6H 2L15A 4HIOA 1NBWA 2GVBA 2IHFA 1P16A 2Q2HA 3GTGH 4LWCA 1QZHA 1O7IA 2PQAA 2E2IH 3CC4A 4JI0Q 1L1OB 4X66L 2QA4A 2CWPA 4JBMA 5GROA 4RMFA 1IBMQ 1TWHH 2A1AA 2H5XA 1WFQA 1N32L 4R4CA 4HJ5A 2BA0A 4PZ8A 3CCLA 1VQOA 1X56A 4QJFA 3S1NH 2IX0A 4LF4L 2JEAI 3I4MG 4JI7Q 4A3JH 1V9PA 3G4SA 2KBNA 2JA7G 3J81j 3PCOB 4DAMA 1S3OA 3FP9A 2QEXA 1OXSC 2RHSB 1Y1WG 1HNXL 1YNXA 3E9HA 1EIFA 4P75A 1K0RA 4A3BG 2IHEA 3OTOQ 4NXNL 1V43A 4YHHL 3A5UA 2K52A 2HT1A 2IX1A 4JI6Q 3RR5A 3VDYA 2N78A 2JE6I 2EIFA 2YYZA 3I4NG 2VUMG 2K50A 4BBRG 2HIXA 1CSQA 1D7QA 1K8GA 1KIXA 1M90C 4A93H 4GLVB 4LF8Q 1PH5A 2ID0A 4P72A 4OWWB 4A3GH 2GVAA 2E5LL 1KHIA 3AFQA 2ZJPA 4GKKQ 2CCZA 2R7ZH 2Y0SE 2RHQB 2UU9Q 1LTLA 2R92H 1PH7A 5M3FG 4A3IH 4L5TA 4BY1G 4DR6L 4A3DH 1X65A 4J15A 1QZGA 3G71A 4IJHA 1PH3A 3CCSA 1VQJA 3M4OH 2F4VL 2E2JH 3HOWG 3H0GG 4DR5Q 2K5NA 4UP9A 5M5YH 5FLXc 1FGUA 3J7ZC 4DK3C 3H15A 3CCUA 4LFCQ 1VQNA 4IFDI 4GKJL 4KHPL 1FL0A 2NN6G 2ZTCA 4DR1L 4BBSG 2CWAA 3F1ZA 1CKNB 1Y1VH 4JC0A 4DR4Q 4C3IH 1TWAH 1YZ6A 3W1BA 2VQEL 4DV6L 1K9MC 4AIMA 5LMUQ 2AKWB 5C44H 3CMAA 1J6QA 2KHIA 2N8NA 1PHJA 1EYGA 3S16H 1HZAA 4JI5L 1SR3A 3STBD 2QGQA 2HIVA 3BJUA 3K8AA 5IWAQ 1XPRA 4X65Q 2JA8G 4DNIA 4B3MQ 1SRUA 4DR3L 3PF4A 3W1GA 1VQEA 1OXTA 3KJPA 1HNZQ 5M3MG 4LF6L 1C9OA 5C4XG 4X62L 2DUDA 5K36G 2VW9A 2A19A 2KCMA 4NPSA 3HOYH 4GOPA 4WJ4A 2N3SA 4MTNA 4H02A 4TVAB 4XIGS 5IP9G 3I7FA 2KCTA 1PH2A 5IP7H 4QGUA 3I56A 1PV4A 4OONA 4IOCA 1N36L 2YV5A 4MZ9A 4R4OA 2PQAB 2N49A 4GN3B 1KQSA 3ICEA 3PIOA 4C3HH 1XJVA 3PUXA 1PH8A 3EN2A 1X3GA 2OCEA 1HNWL 4WJ3M 4HJ9A 3U50C 1WYDA 1AE2A 1FVIA 3KF6A 2Q2TA 4JI3Q 1Z9FA 1TWCH 4KHZA 1EUJA 4P73A 4YCWA 4HIKA 1XPUA 5DLQE 3CC7A 1NJIC 3D31A 4A3FH 3PUZA 4A3CG 4JYAQ 1B70B 1KAWA 2E5LQ 3ULPA 3HOVG 3I4OA 4YY3Q 1XNQQ 2NVQH 3CCVA 4DV7L 3CW2C 4DR6Q 1Q81C 3CMEA 3PO3G 3A74A 1A8VA 3DM3A 4JI4L 4QL5A 3MXNB 2NZHA 2R93G 5JJIA 1S72A 1PVOA 3KF8B 3LGJA 4JOIC 1YBYA 3S2DH 2UXDL 4GKJQ 4JI8L 4KHPQ 3CCJA 1GO3E 3F2DA 5C3EG 3RNUA 1K83H 2B3GA 2HHHQ 2OQ0A 4JI2L 2LSSA 3ULJA 4LF7Q 1GKHA 2PMZE 3STBC 3I4MH 1WOCA 4YWLA 3PGZA 1BVSA 4LFAL 2JA7H 4JI5Q 1K8AC 1B7YB 4PZ6A 4LW1A 1VQBA 1PYBA 2JEBI 3KFUA 1Q1EA 1Y1WH 5JJKA 4IJLA 3J80i 4A3BH 2KHJA 1VCIA 2MNAA 1W2BA 3GTJH 4X62Q 4B3TQ 4LF5Q 4JOIA 4LF6Q 4HJ8A 1VQ8A 3CCRA 1YI2A 4DV3Q 3I4NH 5FJ8G 3ZJYC 3UDGA 3S1RH 4BBRH 4DV4L 1YJWA 2VUMH 4GN4B 4FDBA 4DAYB 4YCVA 5LMNQ 1XNRL 2B63G 5GQOA 1UE5A 3M3YH 3CQZH 3J7A5 4GS3A 4X64Q 1GM5A 3ERSX 4IO9A 3TS0A 3T1YL 2R7FA 1HR0L 3KOJA 3KYHC 3U4VA 3CP0A 5M3FH 3FKIG 3U58A 4BY1H 4DUYL 4DR7Q 1FJGL 5C4JH 4LF9L 1K3RA 3RLNA 1W3SA 1IZ6A 1N33L 3S1QH 3HOWH 3M85A 3H0GH 2OTJA 1N9WA 1D8LA 2EQSA 3NBHB 3U4ZA 5GAHC 1EQQA 4JV5L 3CPFA 4DKAC 4GOPB 4DR2L 3RZDH 1HZCA 4HJAA 4BBSH 4C3JH 5GAGC 4DV5L 4APVA 3S24A 2HQLA 3GD7A 3AFPA 1UE7A 4IPDA 3K0XA 4B3SQ 2BA1A 4JI4Q 1IYJB 3B6YA 4AYBG 4L5RC 2JA8H 1XMQL 4IPHA 1YJNA 3TREA 5M3MH 1N34L 1BKBA 1MJCA 5C4XH 3F2CA 1EFWA 3KF6B 1I3QH 3T1HQ 2KENA 4OO1G 4L5QA 3S15H 1I94Q 4PMWA 1YITA 1N8RC 2XGTA 3G48A 1SROA 1U0LA 2PI2E 1CUKA 5IP9H 1VQPA 4DV0L 3CCMA 4UP7A 2UUBL 1GVPA 1XMOL 4IPGA 3RLOA 4B3RQ 1JT8A 4R1JA 3K7UC 1HR0W 2JQOA 4O0AA 1SLJA 1YHAA 3Q8DA 2UUCL 2VL6A 3J81i 1G291 1VQHA 3HKSA 4AQYL 1J5EL 1BBUA 1XTDA 4GN5A 4GOPC 2UXCL 3EIVA 3TQYA 3HOXG 1V1QA 3NELA 2C35B 4NB3A 1Q7YC 1YHQA 1SMXA 3G6EA 4DV1L 1YEZA 2I5HA 1TWFH 2WB1G 1EIYB 1XNRQ 3RZOH 4IFDG 4X66Q 4LFBL 1VQ7A 1PYSB 1C0AA 2OQKA 4A3CH 1OXVA 4DUZL 3GO5A 2BH8A 3AYHB 4RG1A 5H1SE 3HOVH 3MEFA 1N32Q 1IBKL 2NN6I 1YHBA 4JI1L 1E7ZA 5BR8L 1WJJA 2ZM6L 2CFMA 4A75A 1YJ9A 1LM0A 1JJ2A 3PO3H 2MQHA 3M9BA 4A3JG 4DV2L 5J3BA 1N33Q 4LF4Q 4OX9L 1CKMA 3UE1A 2DGYA 5FLMG 1ASYA 2JA9A 1L0WA 2D0PA 3WWVA 2A8VA 5C0XG 1P8LA 3HKZG 4MNOA 5C3EH 3GTKH 1TWGH 4Y7NH 1HNXQ 5IT9c 4ME3A 1SN8A 4NXNQ 2FXQA 3PUVA 3UDFA 4YHHQ 3BZCA 1X9NA 5EAYA 2UUAL 5IE8A 4P74A 3K7AH 4QIWE 3AEVA 3M4QA 1G51A 1EOVA 2LXJA 1VQMA 2CKZB 3K80C 1MJEA 1X54A 1MKHA 4IPCA 1KRSA 3PIPA 3E9IA 5IYDG 1I50H 4GLXA 4PZ7A 1Q12A 1S40A 1UWVA 4JI0L 2YTXA 3M4PA 4R4IA 5FJ8H 1A63A 1X6OA 3GTLH 4EX5A 3GTOH 1CKOA 1IXRA 2B63H 4IOAA 1VQAA 1IBML 1Y14B 1IBLL 3KJOA 2E2HH 4A3EG 2F4VQ 4YWMA 1SFOH 1JJGA 3GTMH 4A3MG 1DGSA 3TRZA 1RL2A 3CXCA 4AQYQ 1B8AA 1VQ4A 2NVXH 3D0FA 2AWNA 3FKIH 4DR1Q 1WCMG 1VQGA 1U5KA 4R4QA 2VQEQ 4DV6Q 1PH4A 2YTYA 1EQRA 2K75A 4DV1Q 4QY7A 1HH2P 1X3FA 4LFBQ 1YIJA 3F2BA 5IYBG 3CCEA 4A4IA 1H95A 1LUZA 1HZ9A 2XTIA 4Y52H 1VQIA 1HJPA 3OTOL 2ZJRA 2CQOA 3BZKA 4LUOA 4DR3Q 1JMCA 2JA5G 3UE0A 2Q2UA 3CAMA 4JI6L 4JI1Q 2Z0SA 4OWTB 1RIPA 1QVFA 4BXXG 1OXXK 1M1KC 4A3KG 2ASBA 1A62A 4LF8L 2K14A 2LXKA 2I5MX 5AJ3L 1N36Q 2NVYH 2MO1A 1NE3A 4GKKL 3H3VH 4LUVA 5IYCG 3KDFA 4L5SA 1VQKA 5ELOA 2WB1E 1E1TA 1IL2A 2WAQG 1Q1BA 1HNWQ 1OTCA 1UEBA 3W5OA 5IY0A 1EWIA 2E8GA 4GNXA 4DR5L 1KD1C 1Q82C 4HJ7A 2YTVA 2MFIA 3TEHB 4A3LG 1PH6A 3F8TA 3AQQA 4DR4L 2WP8J 3HOXH 1C7YA 5LMUL 4DV7Q 4BY7G 4BA1I 4KLKA 3L0OA 5IWAL 3CC2A 1QVCA 1VS0A 3OYYA 5E7NA 3HKZE 4X65L 1IBLQ 2ZTDA 2ZJQA 4B3ML 3FHWA 4OXPA 1HNZL 2I0QA 3KLWA 2UXDQ 4X6AH 1PFSA 1GD7A 4JI8Q 3JAMc 2AMCB 1HZBA 5HY6A 2AHOB 4OWXB 4JBWA 3HOZG 4NXML 1VQ9A 3CPWA 4JI2Q 4K0KL 1K73C 4HIMA 1NMGA 4LFAQ 2K5HA 1OXUA 5ELNA 1E3PA 4C2MH 5FLMH 4TQUS 3CD6A 3HOUG 3S14H 3PO2G 3A5ZB 2K4KA 4R4TA 1AE3A 1E24A 5JEAG 2ZTEA 1L2FA 1T9HA 3BU2A 4LNQA 5JEAJ 2F3IA 1ASZA 3A0JA 4A76A 2JA6G 4OO1I 1NTGA 3EBEA 5M5XH 1VQLA 3H3VI 5GAEC 3M7NA 4JI3L 4YCUA 4DV4Q 1L1OC 2WFWA 1UE1A 4JYAL 2UXBL 3UDXA 5AJ3Q 2VNUD 4GLAC 1VQDA 4YWKA 2I5LX 4IFDJ 2JJQA 4POFA 2VY3A 5IYDH 2IT1A 4YY3L 3ER0A 1JJCB 2VZAA 1XNQL 4DPGA 3T1YQ 1CSPA 5JJLA 3S2HH 4JG2A 1I5FA 2B29A 3HFZB 1HR0Q 1A0IA 2F52A 3J80c 2D0OA 4DUYQ 1KL9A 4LF9Q 1FJGQ 2RF4A 4LUZA 4A3EH 4P71A 2AWOA 3NENA 5GADC 4A3MH 2R93H 1PH9A 2PNHA 2IY5B 1VQ5A 1LYLA 4JV5Q 1L1OA 2VQFL 3K81C 3CCQA 2HHHL 4DR2Q 4LF7L 3GDEA 4UY8C 1WCMH 4DV5Q 4HIDA 2K5VA 3RN5A 2MO0A 5C0XJ 4KI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 A;  4QQB X;  3KDF B;  5IYB H;  2GN5 A;  1JB7 A;  2BH2 A;  4A93 G;  1E1O A;  1JE5 A;  4B3T L;  4LF5 L;  3RLF A;  3CF5 A;  1XMQ Q;  2JA5 H;  2ES2 A;  1YVC A;  3S17 H;  3L7Z C;  4A3G G;  2WAQ E;  1N34 Q;  5C0X I;  3JC6 6;  4GNX B;  4DV3 L;  2ALY B;  2R7Z G;  2D62 A;  3ULL A;  4NXM Q;  2R92 G;  4BXX H;  1UE6 A;  1X3E A;  1QUQ B;  4A3I G;  4A3K H;  2V1C C;  4JCV E;  5LMN L;  4UPA A;  3GTP H;  4A3D G;  4K0K Q;  4XTC S;  4DV0 Q;  4X64 L;  1NY4 A;  1X55 A;  4JBJ A;  2R7D A;  3TS2 A;  3NEM A;  2UUB Q;  1XMO Q;  3SGI A;  4ALP A;  1VQF A;  4O2D A;  1R9T H;  1PH1 A;  5IYC H;  1I6H H;  3L2P A;  2UUC Q;  4UP8 A;  1Y1V G;  1J5E Q;  4DR7 L;  2UXC Q;  3JAM i;  2OWO A;  4AYB E;  4JI7 L;  2Y0S G;  5C44 G;  2EXD A;  5M5W H;  2UXB Q;  2Z6K C;  3PUY A;  1SE8 A;  4POG A;  4EQ5 A;  1E22 A;  4A3L H;  2R6G A;  4DUZ Q;  1QVG A;  3I55 A;  3PF5 A;  2ATW A;  3GTQ H;  2PI2 A;  1IBK Q;  4B3S L;  4AH6 A;  3PV0 A;  5BR8 Q;  3HOY G;  4BY7 H;  2ZM6 Q;  2RCN A;  4GNX C;  5HGQ A;  1WI5 A;  3J81 c;  4BA2 I;  3IRB A;  1CKN A;  4DV2 Q;  2Q2I A;  3UDI A;  2JK8 A;  5IP7 G;  3S1M H;  1Z47 A;  1MIU A;  1KRT A;  1NMF A;  4OX9 Q;  1XPO A;  1KC8 C;  1AH9 A;  3T1H L;  3I2Z A;  1KXL A;  2VQF Q;  3RN2 A;  2Z6K A;  1I94 L;  5LMN W;  3PSI A;  3E0E A;  2VS1 A;  1PA6 A;  3HOZ H;  2YU9 H;  2UU9 L;  2NVT H;  1Q86 C;  4JBK A;  4DK6 C;  2UUA Q;  3DLL A;  4B3R L;  3HOU H;  3PUW A;  1Q8K A;  3PO2 H;  3OW2 A;  1G6P A;  2NZO A;  4LFC L;  1BBW A;  4A3F G;  1QUQ A;  1TXY A;  1VQC A;  2OTL A;  4PG3 A;  1Q46 A;  2JA6 H;  2L15 A;  4HIO A;  1NBW A;  2GVB A;  2IHF A;  1P16 A;  2Q2H A;  3GTG H;  4LWC A;  1QZH A;  1O7I A;  2PQA A;  2E2I H;  3CC4 A;  4JI0 Q;  1L1O B;  4X66 L;  2QA4 A;  2CWP A;  4JBM A;  5GRO A;  4RMF A;  1IBM Q;  1TWH H;  2A1A A;  2H5X A;  1WFQ A;  1N32 L;  4R4C A;  4HJ5 A;  2BA0 A;  4PZ8 A;  3CCL A;  1VQO A;  1X56 A;  4QJF A;  3S1N H;  2IX0 A;  4LF4 L;  2JEA I;  3I4M G;  4JI7 Q;  4A3J H;  1V9P A;  3G4S A;  2KBN A;  2JA7 G;  3J81 j;  3PCO B;  4DAM A;  1S3O A;  3FP9 A;  2QEX A;  1OXS C;  2RHS B;  1Y1W G;  1HNX L;  1YNX A;  3E9H A;  1EIF A;  4P75 A;  1K0R A;  4A3B G;  2IHE A;  3OTO Q;  4NXN L;  1V43 A;  4YHH L;  3A5U A;  2K52 A;  2HT1 A;  2IX1 A;  4JI6 Q;  3RR5 A;  3VDY A;  2N78 A;  2JE6 I;  2EIF A;  2YYZ A;  3I4N G;  2VUM G;  2K50 A;  4BBR G;  2HIX A;  1CSQ A;  1D7Q A;  1K8G A;  1KIX A;  1M90 C;  4A93 H;  4GLV B;  4LF8 Q;  1PH5 A;  2ID0 A;  4P72 A;  4OWW B;  4A3G H;  2GVA A;  2E5L L;  1KHI A;  3AFQ A;  2ZJP A;  4GKK Q;  2CCZ A;  2R7Z H;  2Y0S E;  2RHQ B;  2UU9 Q;  1LTL A;  2R92 H;  1PH7 A;  5M3F G;  4A3I H;  4L5T A;  4BY1 G;  4DR6 L;  4A3D H;  1X65 A;  4J15 A;  1QZG A;  3G71 A;  4IJH A;  1PH3 A;  3CCS A;  1VQJ A;  3M4O H;  2F4V L;  2E2J H;  3HOW G;  3H0G G;  4DR5 Q;  2K5N A;  4UP9 A;  5M5Y H;  5FLX c;  1FGU A;  3J7Z C;  4DK3 C;  3H15 A;  3CCU A;  4LFC Q;  1VQN A;  4IFD I;  4GKJ L;  4KHP L;  1FL0 A;  2NN6 G;  2ZTC A;  4DR1 L;  4BBS G;  2CWA A;  3F1Z A;  1CKN B;  1Y1V H;  4JC0 A;  4DR4 Q;  4C3I H;  1TWA H;  1YZ6 A;  3W1B A;  2VQE L;  4DV6 L;  1K9M C;  4AIM A;  5LMU Q;  2AKW B;  5C44 H;  3CMA A;  1J6Q A;  2KHI A;  2N8N A;  1PHJ A;  1EYG A;  3S16 H;  1HZA A;  4JI5 L;  1SR3 A;  3STB D;  2QGQ A;  2HIV A;  3BJU A;  3K8A A;  5IWA Q;  1XPR A;  4X65 Q;  2JA8 G;  4DNI A;  4B3M Q;  1SRU A;  4DR3 L;  3PF4 A;  3W1G A;  1VQE A;  1OXT A;  3KJP A;  1HNZ Q;  5M3M G;  4LF6 L;  1C9O A;  5C4X G;  4X62 L;  2DUD A;  5K36 G;  2VW9 A;  2A19 A;  2KCM A;  4NPS A;  3HOY H;  4GOP A;  4WJ4 A;  2N3S A;  4MTN A;  4H02 A;  4TVA B;  4XIG S;  5IP9 G;  3I7F A;  2KCT A;  1PH2 A;  5IP7 H;  4QGU A;  3I56 A;  1PV4 A;  4OON A;  4IOC A;  1N36 L;  2YV5 A;  4MZ9 A;  4R4O A;  2PQA B;  2N49 A;  4GN3 B;  1KQS A;  3ICE A;  3PIO A;  4C3H H;  1XJV A;  3PUX A;  1PH8 A;  3EN2 A;  1X3G A;  2OCE A;  1HNW L;  4WJ3 M;  4HJ9 A;  3U50 C;  1WYD A;  1AE2 A;  1FVI A;  3KF6 A;  2Q2T A;  4JI3 Q;  1Z9F A;  1TWC H;  4KHZ A;  1EUJ A;  4P73 A;  4YCW A;  4HIK A;  1XPU A;  5DLQ E;  3CC7 A;  1NJI C;  3D31 A;  4A3F H;  3PUZ A;  4A3C G;  4JYA Q;  1B70 B;  1KAW A;  2E5L Q;  3ULP A;  3HOV G;  3I4O A;  4YY3 Q;  1XNQ Q;  2NVQ H;  3CCV A;  4DV7 L;  3CW2 C;  4DR6 Q;  1Q81 C;  3CME A;  3PO3 G;  3A74 A;  1A8V A;  3DM3 A;  4JI4 L;  4QL5 A;  3MXN B;  2NZH A;  2R93 G;  5JJI A;  1S72 A;  1PVO A;  3KF8 B;  3LGJ A;  4JOI C;  1YBY A;  3S2D H;  2UXD L;  4GKJ Q;  4JI8 L;  4KHP Q;  3CCJ A;  1GO3 E;  3F2D A;  5C3E G;  3RNU A;  1K83 H;  2B3G A;  2HHH Q;  2OQ0 A;  4JI2 L;  2LSS A;  3ULJ A;  4LF7 Q;  1GKH A;  2PMZ E;  3STB C;  3I4M H;  1WOC A;  4YWL A;  3PGZ A;  1BVS A;  4LFA L;  2JA7 H;  4JI5 Q;  1K8A C;  1B7Y B;  4PZ6 A;  4LW1 A;  1VQB A;  1PYB A;  2JEB I;  3KFU A;  1Q1E A;  1Y1W H;  5JJK A;  4IJL A;  3J80 i;  4A3B H;  2KHJ A;  1VCI A;  2MNA A;  1W2B A;  3GTJ H;  4X62 Q;  4B3T Q;  4LF5 Q;  4JOI A;  4LF6 Q;  4HJ8 A;  1VQ8 A;  3CCR A;  1YI2 A;  4DV3 Q;  3I4N H;  5FJ8 G;  3ZJY C;  3UDG A;  3S1R H;  4BBR H;  4DV4 L;  1YJW A;  2VUM H;  4GN4 B;  4FDB A;  4DAY B;  4YCV A;  5LMN Q;  1XNR L;  2B63 G;  5GQO A;  1UE5 A;  3M3Y H;  3CQZ H;  3J7A 5;  4GS3 A;  4X64 Q;  1GM5 A;  3ERS X;  4IO9 A;  3TS0 A;  3T1Y L;  2R7F A;  1HR0 L;  3KOJ A;  3KYH C;  3U4V A;  3CP0 A;  5M3F H;  3FKI G;  3U58 A;  4BY1 H;  4DUY L;  4DR7 Q;  1FJG L;  5C4J H;  4LF9 L;  1K3R A;  3RLN A;  1W3S A;  1IZ6 A;  1N33 L;  3S1Q H;  3HOW H;  3M85 A;  3H0G H;  2OTJ A;  1N9W A;  1D8L A;  2EQS A;  3NBH B;  3U4Z A;  5GAH C;  1EQQ A;  4JV5 L;  3CPF A;  4DKA C;  4GOP B;  4DR2 L;  3RZD H;  1HZC A;  4HJA A;  4BBS H;  4C3J H;  5GAG C;  4DV5 L;  4APV A;  3S24 A;  2HQL A;  3GD7 A;  3AFP A;  1UE7 A;  4IPD A;  3K0X A;  4B3S Q;  2BA1 A;  4JI4 Q;  1IYJ B;  3B6Y A;  4AYB G;  4L5R C;  2JA8 H;  1XMQ L;  4IPH A;  1YJN A;  3TRE A;  5M3M H;  1N34 L;  1BKB A;  1MJC A;  5C4X H;  3F2C A;  1EFW A;  3KF6 B;  1I3Q H;  3T1H Q;  2KEN A;  4OO1 G;  4L5Q A;  3S15 H;  1I94 Q;  4PMW A;  1YIT A;  1N8R C;  2XGT A;  3G48 A;  1SRO A;  1U0L A;  2PI2 E;  1CUK A;  5IP9 H;  1VQP A;  4DV0 L;  3CCM A;  4UP7 A;  2UUB L;  1GVP A;  1XMO L;  4IPG A;  3RLO A;  4B3R Q;  1JT8 A;  4R1J A;  3K7U C;  1HR0 W;  2JQO A;  4O0A A;  1SLJ A;  1YHA A;  3Q8D A;  2UUC L;  2VL6 A;  3J81 i;  1G29 1;  1VQH A;  3HKS A;  4AQY L;  1J5E L;  1BBU A;  1XTD A;  4GN5 A;  4GOP C;  2UXC L;  3EIV A;  3TQY A;  3HOX G;  1V1Q A;  3NEL A;  2C35 B;  4NB3 A;  1Q7Y C;  1YHQ A;  1SMX A;  3G6E A;  4DV1 L;  1YEZ A;  2I5H A;  1TWF H;  2WB1 G;  1EIY B;  1XNR Q;  3RZO H;  4IFD G;  4X66 Q;  4LFB L;  1VQ7 A;  1PYS B;  1C0A A;  2OQK A;  4A3C H;  1OXV A;  4DUZ L;  3GO5 A;  2BH8 A;  3AYH B;  4RG1 A;  5H1S E;  3HOV H;  3MEF A;  1N32 Q;  1IBK L;  2NN6 I;  1YHB A;  4JI1 L;  1E7Z A;  5BR8 L;  1WJJ A;  2ZM6 L;  2CFM A;  4A75 A;  1YJ9 A;  1LM0 A;  1JJ2 A;  3PO3 H;  2MQH A;  3M9B A;  4A3J G;  4DV2 L;  5J3B A;  1N33 Q;  4LF4 Q;  4OX9 L;  1CKM A;  3UE1 A;  2DGY A;  5FLM G;  1ASY A;  2JA9 A;  1L0W A;  2D0P A;  3WWV A;  2A8V A;  5C0X G;  1P8L A;  3HKZ G;  4MNO A;  5C3E H;  3GTK H;  1TWG H;  4Y7N H;  1HNX Q;  5IT9 c;  4ME3 A;  1SN8 A;  4NXN Q;  2FXQ A;  3PUV A;  3UDF A;  4YHH Q;  3BZC A;  1X9N A;  5EAY A;  2UUA L;  5IE8 A;  4P74 A;  3K7A H;  4QIW E;  3AEV A;  3M4Q A;  1G51 A;  1EOV A;  2LXJ A;  1VQM A;  2CKZ B;  3K80 C;  1MJE A;  1X54 A;  1MKH A;  4IPC A;  1KRS A;  3PIP A;  3E9I A;  5IYD G;  1I50 H;  4GLX A;  4PZ7 A;  1Q12 A;  1S40 A;  1UWV A;  4JI0 L;  2YTX A;  3M4P A;  4R4I A;  5FJ8 H;  1A63 A;  1X6O A;  3GTL H;  4EX5 A;  3GTO H;  1CKO A;  1IXR A;  2B63 H;  4IOA A;  1VQA A;  1IBM L;  1Y14 B;  1IBL L;  3KJO A;  2E2H H;  4A3E G;  2F4V Q;  4YWM A;  1SFO H;  1JJG A;  3GTM H;  4A3M G;  1DGS A;  3TRZ A;  1RL2 A;  3CXC A;  4AQY Q;  1B8A A;  1VQ4 A;  2NVX H;  3D0F A;  2AWN A;  3FKI H;  4DR1 Q;  1WCM G;  1VQG A;  1U5K A;  4R4Q A;  2VQE Q;  4DV6 Q;  1PH4 A;  2YTY A;  1EQR A;  2K75 A;  4DV1 Q;  4QY7 A;  1HH2 P;  1X3F A;  4LFB Q;  1YIJ A;  3F2B A;  5IYB G;  3CCE A;  4A4I A;  1H95 A;  1LUZ A;  1HZ9 A;  2XTI A;  4Y52 H;  1VQI A;  1HJP A;  3OTO L;  2ZJR A;  2CQO A;  3BZK A;  4LUO A;  4DR3 Q;  1JMC A;  2JA5 G;  3UE0 A;  2Q2U A;  3CAM A;  4JI6 L;  4JI1 Q;  2Z0S A;  4OWT B;  1RIP A;  1QVF A;  4BXX G;  1OXX K;  1M1K C;  4A3K G;  2ASB A;  1A62 A;  4LF8 L;  2K14 A;  2LXK A;  2I5M X;  5AJ3 L;  1N36 Q;  2NVY H;  2MO1 A;  1NE3 A;  4GKK L;  3H3V H;  4LUV A;  5IYC G;  3KDF A;  4L5S A;  1VQK A;  5ELO A;  2WB1 E;  1E1T A;  1IL2 A;  2WAQ G;  1Q1B A;  1HNW Q;  1OTC A;  1UEB A;  3W5O A;  5IY0 A;  1EWI A;  2E8G A;  4GNX A;  4DR5 L;  1KD1 C;  1Q82 C;  4HJ7 A;  2YTV A;  2MFI A;  3TEH B;  4A3L G;  1PH6 A;  3F8T A;  3AQQ A;  4DR4 L;  2WP8 J;  3HOX H;  1C7Y A;  5LMU L;  4DV7 Q;  4BY7 G;  4BA1 I;  4KLK A;  3L0O A;  5IWA L;  3CC2 A;  1QVC A;  1VS0 A;  3OYY A;  5E7N A;  3HKZ E;  4X65 L;  1IBL Q;  2ZTD A;  2ZJQ A;  4B3M L;  3FHW A;  4OXP A;  1HNZ L;  2I0Q A;  3KLW A;  2UXD Q;  4X6A H;  1PFS A;  1GD7 A;  4JI8 Q;  3JAM c;  2AMC B;  1HZB A;  5HY6 A;  2AHO B;  4OWX B;  4JBW A;  3HOZ G;  4NXM L;  1VQ9 A;  3CPW A;  4JI2 Q;  4K0K L;  1K73 C;  4HIM A;  1NMG A;  4LFA Q;  2K5H A;  1OXU A;  5ELN A;  1E3P A;  4C2M H;  5FLM H;  4TQU S;  3CD6 A;  3HOU G;  3S14 H;  3PO2 G;  3A5Z B;  2K4K A;  4R4T A;  1AE3 A;  1E24 A;  5JEA G;  2ZTE A;  1L2F A;  1T9H A;  3BU2 A;  4LNQ A;  5JEA J;  2F3I A;  1ASZ A;  3A0J A;  4A76 A;  2JA6 G;  4OO1 I;  1NTG A;  3EBE A;  5M5X H;  1VQL A;  3H3V I;  5GAE C;  3M7N A;  4JI3 L;  4YCU A;  4DV4 Q;  1L1O C;  2WFW A;  1UE1 A;  4JYA L;  2UXB L;  3UDX A;  5AJ3 Q;  2VNU D;  4GLA C;  1VQD A;  4YWK A;  2I5L X;  4IFD J;  2JJQ A;  4POF A;  2VY3 A;  5IYD H;  2IT1 A;  4YY3 L;  3ER0 A;  1JJC B;  2VZA A;  1XNQ L;  4DPG A;  3T1Y Q;  1CSP A;  5JJL A;  3S2H H;  4JG2 A;  1I5F A;  2B29 A;  3HFZ B;  1HR0 Q;  1A0I A;  2F52 A;  3J80 c;  2D0O A;  4DUY Q;  1KL9 A;  4LF9 Q;  1FJG Q;  2RF4 A;  4LUZ A;  4A3E H;  4P71 A;  2AWO A;  3NEN A;  5GAD C;  4A3M H;  2R93 H;  1PH9 A;  2PNH A;  2IY5 B;  1VQ5 A;  1LYL A;  4JV5 Q;  1L1O A;  2VQF L;  3K81 C;  3CCQ A;  2HHH L;  4DR2 Q;  4LF7 L;  3GDE A;  4UY8 C;  1WCM H;  4DV5 Q;  4HID A;  2K5V A;  3RN5 A;  2MO0 A;  5C0X J;  4KI0 A; 
#chains in the Genus database with same CATH topology
 3HOY B;  1S4Z A;  3DXJ C;  2BH2 A;  1JE5 A;  1L0Y B;  1XMQ Q;  5ELE A;  2ES2 A;  5C0X I;  3JC6 6;  4DV3 L;  4UHV A;  3ULL A;  2R92 G;  4C3H B;  1X3E A;  4A3I G;  5BN4 A;  1X55 A;  4HCE A;  4ALP A;  1VQF A;  1VMP A;  2EVB A;  1PH1 A;  3D4R A;  3MFG A;  3L2P A;  3SXH A;  1LT4 D;  3KK7 A;  3JAM i;  2OWO A;  4JI7 L;  5C44 G;  2UXB Q;  4POG A;  4C1N K;  1E22 A;  3AMU A;  2R6G A;  1DD2 A;  1RD9 D;  1AEX A;  1CZG A;  4KJN A;  4AH6 A;  4IUT A;  5HGQ A;  3J81 c;  3IRB A;  3I4M B;  2Q2I A;  4B9X A;  4CHT B;  3S1M H;  1Z47 A;  1MIU A;  1GHJ A;  1AH9 A;  1SE3 A;  3I2Z A;  1U4M A;  1GUG A;  1LTI D;  1NNX A;  4JBK A;  3P1H A;  2UUA Q;  3I4N B;  2Z9H A;  1RJT A;  2NZO A;  5JEA H;  2Z8L A;  1QUQ A;  1HCZ A;  4K8J A;  2CQA A;  1SXT A;  3MHB A;  3OSO A;  4HIO A;  1NBW A;  2GVB A;  3GTG H;  4BS9 A;  1QZH A;  2PQA A;  2E2I H;  4PMC A;  2J0T D;  2QA4 A;  1QIL A;  2K5D A;  1PRT F;  3E0J A;  4IUV A;  3D4D A;  2A1A A;  2L1B A;  1WVL A;  1WFQ A;  3HEJ A;  4R4C A;  4HJ5 A;  5EQ0 A;  4QJF A;  3S1N H;  2CH4 W;  4JI7 Q;  2EJG C;  1V9P A;  2Z4H A;  3DWQ A;  1S3O A;  1RF2 D;  3FP9 A;  2QEX A;  1K28 A;  2IJ0 A;  4IUR A;  2C9O A;  2K03 A;  1K0R A;  2IHE A;  3OTO Q;  1V43 A;  4YHH L;  2B2Y A;  2F0G A;  2K05 A;  2N78 A;  5D3D A;  2E75 C;  2K50 A;  2VUM G;  4BBR G;  2HIX A;  1D7Q A;  1K8G A;  1DZ1 A;  2EXZ A;  1M90 C;  4GLV B;  1JWM D;  4OWW B;  1M8A A;  1LT3 D;  4GKK Q;  4RGT A;  4CJ1 B;  1PH7 A;  4DR6 L;  3EJI A;  1SNC A;  4A3D H;  4J15 A;  2F0V A;  2E2J H;  3BDC A;  3CCU A;  3H15 A;  1FL0 A;  4DAY A;  3X3N A;  5DM7 3;  4DR4 Q;  4C3I H;  1TWA H;  2F0F A;  1LTB D;  4TSS A;  1QWY A;  1J6Q A;  4RGN A;  1WTV A;  3PO3 B;  3S16 H;  2PO4 A;  1KNE A;  1EIG A;  2AQ3 B;  5JPM C;  4LF6 L;  1C9O A;  2F3V A;  4X62 L;  2A19 A;  3HOY H;  1IW7 D;  5A2Q L;  1I4G A;  5IP9 G;  1V1P B;  3I56 A;  4MZ9 A;  1A3U A;  3OIP A;  3OPO A;  3C2P A;  3E5S A;  2N49 A;  3ICE A;  4KY6 A;  4C3H H;  1EWH A;  1I4R A;  1STE A;  1HNW L;  4HJ9 A;  1I50 B;  1JOK A;  2RBM A;  4CDE C;  2LFN A;  3KF6 A;  1UUP A;  4KHZ A;  4YCW A;  3TZD A;  1XPU A;  1NJI C;  3D31 A;  2L11 A;  3PUZ A;  4RGO S;  3HOV G;  3GTM B;  3I4O A;  3N6R A;  3CW2 C;  5EPJ A;  4DR6 Q;  2BDN A;  2OXP A;  1ENC A;  1A8V A;  3FKI B;  5EKK A;  5JJZ A;  1PTO F;  2G5D A;  1B3Q A;  1F9P A;  2R93 G;  5JJI A;  1S72 A;  3KF8 B;  1C4Q A;  3LGJ A;  1FNW A;  1PRT B;  3S2D H;  4JI8 L;  1GO3 E;  1G91 A;  5C3E G;  3J7A F;  5CV4 A;  3TZU A;  2B3G A;  2EYP A;  1ET6 A;  3I4M H;  4LFA L;  3QWN A;  1K8A C;  1QCB D;  4PZ6 A;  2B2W C;  1VQB A;  1GUO A;  1Q1E A;  1GHK A;  4IJL A;  4NMZ A;  2KHJ A;  4LF6 Q;  4B3T Q;  4X62 Q;  2GA4 B;  4JOI A;  3SEB A;  1LTA D;  2RQX A;  5CMD A;  3I4N H;  1QOH A;  3ZJY C;  5IGF A;  4DV4 L;  1SYD A;  4GN4 B;  1XNR L;  4YCV A;  1UE5 A;  1SSO A;  2C5C A;  4GS3 A;  5CV7 A;  4X64 Q;  2RVL A;  3ERS X;  3CU7 A;  2B2Y C;  3FRP B;  3KYH C;  5KYL A;  4DR7 Q;  1TS2 A;  1K3R A;  1EQT A;  1N33 L;  1WTH A;  3NBH B;  5GAH C;  1EQQ A;  4G7Z C;  1DXM A;  4DKA C;  5KEE A;  4DR2 L;  4GOP B;  1HZC A;  1X3Q A;  5GAG C;  1BQQ T;  2PW7 A;  4IPD A;  5E4X A;  1HUM A;  3B6Y A;  4RCN A;  1BCP C;  1MJC A;  3OMG A;  1TR5 A;  1EU3 A;  1JC7 A;  4N8F A;  1SRO A;  4MIU A;  1B4O A;  4U68 A;  2UUB L;  1GVP A;  4RGM A;  2JQO A;  3V2T A;  2K28 A;  1BF4 A;  3A56 A;  1VQH A;  2KEE A;  4AQY L;  1XTD A;  1CFM A;  4MN3 A;  4CKC A;  2EY2 A;  2EY5 A;  2EOT A;  2C35 B;  4NB3 A;  1Q7Y C;  2M00 A;  3G6E A;  1XNR Q;  3H6M A;  2WB1 G;  3QJY A;  1WTW A;  3DHQ A;  1Y69 U;  1BXT A;  1OXV A;  4RAU C;  1EEI D;  3MEF A;  1N32 Q;  1Y8O B;  1S5F D;  1E7Z A;  1D2B A;  1WJJ A;  3PO3 H;  2CFM A;  1WCM B;  4XXE A;  1N33 Q;  4ZLT F;  1PTO B;  1F9Q A;  1ASY A;  4K2L A;  1XYI A;  1PZJ D;  2D0P A;  2B2T C;  3MWY W;  3WWV A;  3FPP A;  4MNO A;  4MTK A;  3S17 B;  2F0D A;  2JA5 B;  4NXN Q;  4HN7 A;  5DM6 3;  3BZC A;  3DEP A;  4P74 A;  3AEV A;  4QUF A;  2DJF C;  3MC0 B;  1EOV A;  1TT2 A;  3OW7 A;  4F87 A;  3JAM L;  1ICW A;  1E2V A;  3NQT A;  1R9T B;  3E9I A;  1I50 H;  4GLX A;  2YTX A;  3M4P A;  1A63 A;  1CKO A;  4CBV A;  2WAQ B;  4A3E G;  1LV9 A;  1JJG A;  3GTM H;  1SJH D;  5M5W B;  2IW3 A;  4N8X 1;  4IZ8 A;  3CXC A;  4AQY Q;  1O7Z A;  3QIA A;  3FKI H;  3EFX D;  1U5K A;  4E6I A;  4R4Q A;  2VQE Q;  2L0C A;  4DV6 Q;  4HMJ A;  1TII D;  4QY7 A;  1X3F A;  2WII B;  4H13 C;  3GQB A;  3F2B A;  3C46 A;  1LUZ A;  4AYB B;  3J81 E;  4DR3 Q;  5J39 A;  5TSS A;  1ESF A;  1IW7 C;  2Z0S A;  1RIP A;  5KIX A;  3BVM A;  1OXX K;  5JOB A;  4A3K G;  2NVT B;  1HUN A;  1ESR A;  4V0B A;  2LY7 A;  3KLS A;  3Q6S A;  2K14 A;  2HD3 A;  3PO2 B;  3H3V H;  1PFM A;  2X6L A;  2QEJ C;  4V19 0;  3VR6 A;  1Q1B A;  3N52 A;  1UEB A;  2E8G A;  4XQN A;  1QNU A;  4FF3 A;  3ERO A;  3VR4 A;  4HJ7 A;  1F2M A;  5A35 A;  4RWS C;  1H9R A;  4L8J A;  3F8T A;  3A8I E;  1ILP A;  4C1N I;  2K01 A;  4DV7 Q;  1VMC A;  3L0O A;  5IWA L;  3CC2 A;  5E7N A;  3OYY A;  1PZK D;  4X65 L;  2ZJQ A;  4DAP A;  4B3M L;  4A3J B;  3NE5 B;  3T4A C;  4FYD A;  5I2X A;  4X6A H;  1PFS A;  1AZQ A;  2JXM B;  3R2T A;  4OWX B;  3KLR A;  4NXM L;  3CPW A;  1EYC A;  2F0Q A;  4K0K L;  2F0M A;  3I91 A;  3J7A V;  5ELN A;  3HOU G;  1E3P A;  1M4V A;  1MI2 A;  4R4T A;  4O42 A;  2ZTE A;  1T9H A;  2EY1 A;  4LNQ A;  4PNY A;  1ASZ A;  5D3I B;  3H09 A;  1VQL A;  3EBE A;  3HRZ C;  2QIL A;  2R92 B;  4A3I B;  2WFW A;  4JYA L;  3VYS A;  3M4O B;  1UAP A;  3BYY B;  4IFD J;  4POF A;  2VY3 A;  4JK1 C;  5IYD H;  5M5Y B;  2H4O A;  2IT1 A;  4YY3 L;  1XNQ L;  4FF1 A;  2FFK B;  4JG2 A;  1HR0 Q;  3J80 c;  5C3W A;  4DUY Q;  1KL9 A;  3UI2 A;  1FJG Q;  4IAL A;  5C44 B;  2PZT A;  1MSH A;  2AWO A;  2EYL A;  2VQF L;  2HHH L;  3CCQ A;  1SYG A;  4KK7 A;  4LF7 L;  4UY8 C;  1WCM H;  1TVX A;  3G7L A;  4HID A;  3MTS A;  1JOQ A;  1PTO H;  3SDZ A;  2IX3 A;  2B8F A;  1SNM A;  2GN5 A;  3HP3 A;  4XT3 B;  1JB7 A;  4A93 G;  3T16 A;  4LF5 L;  3S17 H;  2JA5 H;  4A3G G;  2WAQ E;  4GNX B;  2ALY B;  2MUY A;  4NXM Q;  5I6W A;  3K0Y A;  1QUQ B;  4K0K Q;  2V1C C;  4JCV E;  5LMN L;  4UPA A;  4DV0 Q;  2VB3 X;  3CKI B;  1SMY D;  4RCO A;  1R9T H;  1SYF A;  2A68 C;  1ZYR D;  5IYC H;  3T13 A;  4EQO A;  1T5X D;  1Y1V G;  1J5E Q;  1RDP D;  4AYB E;  2RA4 A;  2Y0S G;  1II3 A;  4R8N A;  5M5W H;  3PUY A;  2RCF A;  1B1Z A;  1SE8 A;  5FK9 C;  1B9N A;  4A3L H;  3TP7 A;  1Q3L A;  3VA5 A;  2QF7 A;  3I55 A;  3TP8 A;  2ATW A;  2B39 A;  4OEM B;  5BR8 Q;  2ZM6 Q;  2RCN A;  4DFA A;  1E0B A;  5T1I A;  4BA2 I;  1CKN A;  2RSO A;  4I65 A;  3UDI A;  5FLX L;  2F0I A;  1E2W A;  2JK8 A;  5IP7 G;  2HCI A;  4OX9 Q;  3SK6 A;  3GP7 A;  3T1H L;  1KXL A;  2VQF Q;  1C48 A;  1I94 L;  4QMG A;  5LMN W;  5HGT A;  3FEW X;  1PA6 A;  2NVT H;  5FOB B;  1Q86 C;  2OEO A;  4DK6 C;  2V4D A;  3I72 A;  3DLL A;  4B3R L;  3MVV A;  2VUM B;  4BBR B;  3PO2 H;  3OW2 A;  4BWG B;  1G6P A;  2PMZ B;  2D2C C;  1BBW A;  4A3F G;  1TXY A;  5C5M A;  2NTT A;  1Q46 A;  4WOR A;  2NWG A;  2Q2H A;  2ZT9 C;  1HPC A;  2CW0 C;  3OHX C;  2CWP A;  2IL8 A;  5C4J B;  5EPL A;  2H5X A;  1PRT C;  1A3V A;  2WV6 D;  3LWU A;  2XNA C;  3RZD B;  3QO2 A;  4KD3 A;  3GV3 A;  5I9P A;  1B2T A;  1X56 A;  4LF4 L;  1EU4 A;  4A3J H;  3G4S A;  2QCP X;  1JOR A;  2I07 B;  5AFW A;  1EY0 A;  1Y1W G;  1CZW A;  1YNX A;  3MXN A;  2TMP A;  1BNZ A;  1HNX L;  1NR4 A;  1W6K A;  1XX8 A;  2NBF A;  2LKV A;  2IX1 A;  1I3Q B;  3H3V C;  3VDY A;  2JE6 I;  2YYZ A;  1H9S A;  2AUJ D;  3TP6 A;  1B3A A;  2SNM A;  4LF8 Q;  5DEH A;  1VF5 C;  2X69 A;  1KHI A;  2SEB D;  3PIO 3;  1KDA A;  2RHQ B;  2R92 H;  5M3F G;  4A3I H;  2WIN B;  5CR3 A;  5FLX E;  5EBD A;  3M4O H;  1PH3 A;  3CCS A;  2F4V L;  3QG1 A;  5M5Y H;  1TKW B;  3J7Z C;  1VQN A;  3RZO B;  4GKJ L;  4KHP L;  2NN6 G;  4ME5 A;  3HOV B;  1YZ6 A;  3ERQ A;  5LMU Q;  5BN5 A;  5C44 H;  2N8N A;  1SR3 A;  4ZAI A;  1WTR A;  2HIV A;  3K8A A;  1XPR A;  4HSV A;  4K8I A;  4DNI A;  3NUC A;  1SRU A;  4ZKC B;  2F03 A;  1OXT A;  1JQY D;  5C4X G;  3ND9 A;  4RFB A;  1FNU A;  1UNS A;  2VW9 A;  1UEA B;  4NPS A;  5C3E B;  3GTK B;  1EZ8 A;  5K36 G;  1TWG B;  4Y7N B;  2N3S A;  5L37 A;  3I7F A;  1N36 L;  4I7A A;  4OON A;  4IOC A;  3K7A B;  2AUK A;  1O7Y A;  4QF4 A;  4R4O A;  1HFN A;  3ITP A;  3PIO A;  1XJV A;  3EN2 A;  1X3G A;  4N9P A;  3CRK C;  3IL8 A;  1FVI A;  2Q2T A;  4JI3 Q;  1H9J A;  4LMQ D;  4DU9 A;  1SNO A;  2Z1C A;  4HIK A;  3NP8 A;  4OL7 A;  5DLQ E;  3CC7 A;  4A3C G;  1B70 B;  1KAW A;  4QIW B;  4CKB A;  1SFO B;  3BZD B;  1FR3 A;  2MP1 A;  1EY4 A;  2A6H C;  3CHB D;  3S2D B;  3CME A;  1X32 A;  3DM3 A;  3TME A;  1PTO C;  5I4D A;  1YBY A;  3HG9 A;  2UXD L;  4GKJ Q;  4KHP Q;  4G57 A;  1BCP D;  5G3L F;  2OQ0 A;  2O2L D;  3ULJ A;  1GKH A;  2PMZ E;  4KHV A;  1I4H A;  1BVS A;  3LNN A;  1B7Y B;  4GZY C;  4LW1 A;  1EZ6 A;  1PYB A;  5FO9 B;  2MNA A;  1CI3 M;  5CV5 A;  1VQ8 A;  4P2C B;  2DY8 A;  2A73 B;  3O13 A;  4DV3 Q;  5FJ8 G;  3UDG A;  2VUM H;  4BBR H;  4HTH A;  2B63 G;  3MAQ A;  3J7A 5;  2M9V A;  1SMY C;  4X3U A;  1ZYR C;  4IO9 A;  2B2W A;  3T1Y L;  1S5B D;  2F1M A;  1D5M C;  4DK0 A;  4XYQ A;  3K5M A;  5C4J H;  4LF9 L;  2SOB A;  1W3S A;  3RD4 A;  3M85 A;  3T53 B;  1N9W A;  4PMB A;  2EQS A;  2WB1 B;  3SVM A;  3U4Z A;  3DWA A;  3RZD H;  4HJA A;  4DV5 L;  2HQL A;  3K0X A;  1JE4 A;  1IYJ B;  1U4P A;  4CKE A;  2SNS A;  4FF4 A;  1N34 L;  1BKB A;  2L5T A;  1XWE A;  1PXU A;  4OO1 G;  1I3Q H;  1O78 A;  2KEN A;  2XGT A;  5IGD A;  3TBI B;  2PI2 E;  5IP9 H;  4UP7 A;  3A55 A;  1XMO L;  2N55 A;  2L4N A;  3RLO A;  2QDL A;  1JT8 A;  3R3O A;  4R1J A;  4L63 B;  1SLJ A;  1YHA A;  1GOZ A;  2UUC L;  1B53 A;  3H91 A;  1MSG A;  2VL6 A;  1HXY D;  2UXC L;  4CDD C;  3EIV A;  4MHE A;  3TQY A;  1E2Z A;  3S2H B;  1YHQ A;  1YEZ A;  3RZO H;  3NWT A;  5IGC A;  1VQ7 A;  1PYS B;  1C0A A;  3J80 E;  5IOD A;  4A3E B;  4DUZ L;  2BH8 A;  2HUG A;  4RG1 A;  1W6J A;  3HOV H;  5EBC A;  1IBK L;  1WD0 A;  4A75 A;  4IUP A;  1JJ2 A;  2MQH A;  1STY A;  4DV2 L;  5J3B A;  4ZK9 B;  4U67 3;  1SNQ A;  1SND A;  1STA A;  3UE1 A;  1VF7 A;  5FLM G;  2JA9 A;  1DOM A;  3IFT A;  2A8V A;  5C0X G;  3HKZ G;  5C3E H;  3GTK H;  1TWG H;  4Y7N H;  4RA8 A;  1ZXT A;  5IT9 c;  4ME3 A;  1R4P B;  5I6Y A;  2FXQ A;  3PUV A;  3UDF A;  4YHH Q;  1X9N A;  2FJ2 A;  3K7A H;  4QIW E;  4A3K B;  1QE6 A;  3GTP B;  2CKZ B;  3T56 B;  2PPB C;  1X54 A;  4JPB W;  1F2Z A;  3VYR A;  1MKH A;  4IPC A;  3LX0 A;  1KRS A;  4PZ7 A;  1S40 A;  1L0X B;  1UWV A;  2B2T A;  4KKU A;  4JI0 L;  4R4I A;  1I6H B;  1X6O A;  4EX5 A;  3K5N A;  1IXR A;  3IFD A;  1D5X C;  1FYC A;  1IBM L;  4HR7 B;  2G9H D;  2X6G A;  1SFO H;  5ISR A;  1ZEQ X;  2DNE A;  1VQ4 A;  1RTO A;  3D0F A;  4DK1 A;  4UDU C;  3GTQ B;  1A3T A;  1EQR A;  2K75 A;  4YIJ A;  3FVQ A;  2HDM A;  3NSW A;  5IYB G;  3CCE A;  3F2U A;  2ZJR A;  2CQO A;  2P5Z X;  3BZK A;  1JMC A;  1SBB B;  4KKS A;  3CAM A;  4JI6 L;  4ZRZ A;  4DN4 M;  2CH4 A;  4BXX G;  4J8Q A;  1M1K C;  4FXD A;  4ZUJ A;  3HOU B;  2QDB A;  1JWS D;  2EJM A;  1D6E C;  2WB1 E;  4TKO B;  1E1T A;  3I8Z A;  1IL2 A;  4PV1 C;  1HNW Q;  4JW0 A;  1OTC A;  2EYJ A;  4DR5 L;  1EWI A;  1KD1 C;  3E6Z X;  3FDT A;  3TEH B;  1TWH B;  3AQQ A;  2M2L A;  4LJZ C;  1WTP A;  4FVM A;  1CQV A;  2VB2 X;  4BY7 G;  4BA1 I;  2LS0 1;  2EDG A;  1QVC A;  1VS0 A;  3A8J E;  2ZTD A;  2L55 A;  1HNZ L;  2E74 C;  5C5L A;  4JI8 Q;  2EJF C;  3Q24 A;  2OF1 A;  1HZB A;  4IN3 A;  3HOZ G;  3Q22 A;  3V05 A;  4LFA Q;  3CD6 A;  3A5Z B;  4A93 B;  4KV6 A;  2A68 D;  5KRU A;  4A76 A;  2JA6 G;  4A3G B;  2F0S A;  1NTG A;  3H3V I;  1EY9 A;  3J81 L;  1FD7 D;  1K8O A;  3NK9 A;  1IKL A;  4DV4 Q;  3K58 A;  5IGE A;  5EKI A;  1TU2 B;  4GLA C;  2Q8I B;  1SYB A;  2FIN B;  5JJL A;  4DPG A;  3S2H H;  2B29 A;  1Y1V B;  1I6V C;  4LUZ A;  4A3E H;  2Y0S B;  3K5L A;  2F0O A;  2ZXR A;  2JP1 A;  4P71 A;  3NEN A;  5GAD C;  2IY5 B;  2PNH A;  1LYL A;  3K81 C;  4DR2 Q;  5COY A;  3KBX A;  1MGS A;  4ZQ3 A;  3L3O C;  3KDF B;  1CTM A;  1E1O A;  3CF5 A;  1LTS D;  4IUU A;  1CHQ D;  2R7Z G;  2D62 A;  2RDG A;  1ILQ A;  1UE6 A;  1D5Z C;  4A3K H;  4O1N A;  3SR1 A;  3GTP H;  4WRD A;  2CW0 D;  3TS2 A;  3NEM A;  2UUB Q;  3SGI A;  1CQF A;  2H1E A;  4O2D A;  1TS3 A;  3SK4 A;  1I6H H;  4A3F B;  1PRT D;  3WDN A;  1HQM C;  4KD4 A;  5ELD A;  3EQL C;  2NVQ B;  1TY2 A;  4KY7 A;  2EXD A;  4Q5V A;  1TS4 A;  2Z6K C;  2XIW A;  1S5E D;  2A5H A;  2F0L A;  3GTQ H;  5M9O A;  4B3S L;  3PV0 A;  4XT1 B;  1SDF A;  4DA2 A;  4RKB A;  1SJE D;  3OWE B;  1NMF A;  1GUN A;  3PSI A;  3E0E A;  1Y1W B;  2VS1 A;  5EGT A;  3NTK A;  1U4L A;  1KAB A;  3P7J A;  3D6C A;  3HOU H;  1Q8K A;  1YNJ D;  3T51 B;  1HA5 A;  4LFC L;  1CK1 A;  1V1P A;  3CQZ B;  4K6D A;  1VQC A;  2OTL A;  1GUW A;  2IHF A;  1P16 A;  2CVR A;  3G6J B;  4DAV A;  2E76 C;  5M3F B;  1L1O B;  4X66 L;  4IFD H;  2R3Z A;  1TWH H;  1BR9 A;  1DOL A;  3IAY A;  3S1Q B;  1QJO A;  4JVZ A;  2BA0 A;  4PZ8 A;  3DM1 A;  1VQO A;  4RHS A;  1F2Y A;  2IX0 A;  2JEA I;  2RKS A;  2KBN A;  2JA7 G;  3VA7 A;  3J81 j;  3PCO B;  1AZP A;  4ZYS A;  1OXS C;  3BS1 A;  3Q0A A;  5IIF A;  4A3B G;  2KHS A;  3OOC A;  4OGQ C;  2HT1 A;  2K52 A;  5C4X B;  3KLS X;  3LWE A;  1CM9 A;  1EIH A;  3S15 B;  4ID6 A;  2F0E A;  3P20 A;  2EY6 A;  1KIX A;  2A6E D;  2F4I A;  2KJX A;  4A93 H;  5CYU A;  1BDO A;  4J1M A;  2GVA A;  4A3G H;  2E5L L;  3AFQ A;  2ZJP A;  2KCC A;  2CCZ A;  1EYD A;  2Y0S E;  4I7Z C;  1LTL A;  1LTR D;  4BY1 G;  2A6H D;  4IJH A;  4QB4 A;  1VQJ A;  3M7G A;  1G2T A;  3HOW G;  2B2V A;  3H0G G;  1LAC A;  4UP9 A;  5JVG 3;  1FGU A;  4LFC Q;  4DK3 C;  3OIQ A;  1PTO D;  4DR1 L;  4F88 A;  5C3X A;  4BBS G;  2CWA A;  4C3J G;  1Y1V H;  1QNK A;  4AIM A;  3SK8 A;  3CMA A;  2KHI A;  2NYZ D;  1EYG A;  1HZA A;  1WTX A;  2QGQ A;  5IWA Q;  4EVO A;  2JA8 G;  4K5V A;  4X65 Q;  4B3M Q;  2JN4 A;  3PF4 A;  3SE0 A;  3KJP A;  5M3M G;  2DUD A;  3NBH A;  3PMF A;  2KCM A;  1IYV A;  3BDO A;  3EVQ A;  4GOP A;  4WJ4 A;  1PYW D;  4XQJ A;  4XIG S;  3A7A B;  2L9H A;  1F9S A;  1PH2 A;  1U4R A;  1V1O A;  5IP7 H;  4F8M A;  5IT9 E;  1PV4 A;  2PQA B;  4GN3 B;  1KQS A;  1PH8 A;  1J9O A;  1ONL A;  1WYD A;  1AE2 A;  1Y8P B;  1TY0 A;  1Z9F A;  4IQZ A;  1EUJ A;  4P73 A;  2B63 B;  2ICI A;  4JYA Q;  4A3F H;  2E2H B;  4CDF C;  1DON A;  2E5L Q;  1TQO A;  3ULP A;  5E3F A;  4YY3 Q;  1XNQ Q;  2NVQ H;  3I90 A;  1Q81 C;  2NVX B;  4QL5 A;  1F2L A;  2NZH A;  2F0N A;  1WD1 A;  1PVO A;  4ILW A;  1V8Q A;  3CCJ A;  3TDQ A;  1EWC A;  3FMC A;  4R9W A;  1AN8 A;  2HHH Q;  4JI2 L;  4LF7 Q;  3STB C;  1RCV D;  4YWL A;  3PGZ A;  1EFI D;  2PZU A;  5KNC A;  2JEB I;  2K04 A;  1Y1W H;  1VCI A;  1W2B A;  4LF5 Q;  2NVY B;  1R4Q B;  3CCR A;  1YNN D;  3R8B A;  1NAP A;  1RKN A;  1YJW A;  5E1F A;  4L6T B;  4FDB A;  1BCP B;  4KN4 C;  4DAY B;  5C4Z A;  5LMN Q;  5GQO A;  3CQZ H;  3A7L A;  3TS0 A;  1S5D D;  2EE1 A;  1O80 A;  3U4V A;  3CP0 A;  5EKL A;  2J7Z A;  5M3F H;  3U58 A;  3RLN A;  1IZ6 A;  3S1Q H;  2OTJ A;  1D8L A;  2ENB A;  4JV5 L;  5I2Y A;  1KAA A;  2NUC A;  1SYC A;  3TP5 A;  2NN6 H;  1SE2 A;  1EY5 A;  4HMI A;  1QG7 A;  3GD7 A;  3AFP A;  1UE7 A;  2BA1 A;  2B2V C;  4AYB G;  1DCZ A;  1XMQ L;  1YJN A;  4C2M B;  2EZV A;  3S14 B;  5C4X H;  3F2C A;  1EFW A;  2MHV A;  5K36 H;  3KF6 B;  3T1H Q;  3HKZ B;  3S15 H;  1I94 Q;  4PMW A;  4CDC C;  1N8R C;  1XTC D;  4FXG C;  1VQP A;  1A6X A;  5M5X B;  3QOJ A;  4K6L A;  1YNJ C;  4B3R Q;  4O0A A;  3MXU A;  1EYA A;  3J81 i;  3HKS A;  1BBU A;  4GN5 A;  2PYK A;  4GOP C;  1X3P A;  1I4X A;  3HOX G;  4DNT B;  3C1E A;  1SMX A;  4DV1 L;  2I5H A;  1PMR A;  4LFB L;  1D1K A;  4B9W A;  4A3C H;  3GV6 A;  2R93 B;  3ND8 A;  1YHB A;  4JI1 L;  4Q0F A;  1KTK A;  1LM0 A;  4A3J G;  4LF4 Q;  2K1B A;  1CKM A;  2IWH A;  1L0W A;  3Q23 A;  4FF2 A;  1P8L A;  1HNX Q;  1JOO A;  1SN8 A;  2UUA L;  2RSN A;  1Z7T A;  4X3K A;  5ELC A;  1G51 A;  4ZUI A;  2A6E C;  2LXJ A;  3D4W A;  1MHW C;  1MJE A;  3PIP A;  4EGV A;  1Q12 A;  5IGG A;  1ICF B;  5FJ8 H;  2F0H A;  1F77 A;  2R61 A;  2B63 H;  2KVM A;  2QW7 A;  1Y14 B;  2E2H H;  2F4V Q;  4YWM A;  4A3M G;  1KLU D;  2DN8 A;  1DGS A;  2BE5 C;  3VR5 A;  1RL2 A;  2NVX H;  2PW5 A;  2JSO A;  1I4P A;  1VQG A;  2NTS A;  3DEO A;  5F2D A;  1CA5 A;  1PH4 A;  4DV1 Q;  4BY7 B;  5IOC A;  1HH2 P;  4LFB Q;  1YIJ A;  1LT5 D;  2O5I C;  4A4I A;  2KCN A;  5EPK A;  1VQI A;  1HJP A;  3OTO L;  4Y52 H;  2A69 C;  4LUO A;  3K6O A;  2RDH A;  4JI1 Q;  3J80 L;  4OWT B;  1QVF A;  3C1F A;  3HOZ B;  2YU9 B;  5IGB A;  4IUQ A;  2ASB A;  3NBI A;  2KQ3 A;  4LK1 C;  1N36 Q;  2NVY H;  2O4X A;  1ML0 D;  2MO1 A;  3CRL C;  4GKK L;  4OO1 H;  5ELO A;  2JA6 B;  1CHP D;  2KED A;  2FMM A;  3W5O A;  5IY0 A;  4GNX A;  3U9O A;  2FMC A;  4M1U B;  1JCK B;  1PH6 A;  4DR4 L;  1Q8I A;  2WP8 J;  2F0K A;  4QCL A;  4K2K A;  4KLK A;  1DJR D;  3HKZ E;  4OXP A;  2K33 A;  3M4Y A;  2UXD Q;  3JAM c;  4G7O C;  4ODG A;  4DXF A;  1AW7 A;  2AMC B;  2AHO B;  3IKJ A;  1GUS A;  2IPK D;  4RH6 A;  4ULL A;  1K73 C;  1A15 A;  5CBE E;  2K5H A;  1OXU A;  4C2M H;  5FLM H;  3S14 H;  2XWB B;  4TQU S;  4ZKB B;  5C0X H;  1AE3 A;  1E24 A;  5JEA G;  3C3L A;  5JEA J;  1YNN C;  2F3I A;  1A2U A;  3A0J A;  3NXW A;  4HCS A;  5M5X H;  5GAE C;  2R7Z B;  4IUN A;  4NDX A;  2PZW A;  3DMU A;  4WFN 3;  5J22 A;  3NWS A;  1L1O C;  3UDX A;  1FGB D;  4YWK A;  1RHP A;  2I5L X;  3ER0 A;  1JJC B;  3T1Y Q;  1CSP A;  1DYQ A;  1PDQ A;  3I4L A;  1EQV A;  1I5F A;  3HFZ B;  2F52 A;  3NTI A;  5KND A;  4LF9 Q;  2RF4 A;  1OO9 B;  2R93 H;  1PH9 A;  1I4Q A;  3J7Y W;  1VQ5 A;  3ZYY X;  4K5X A;  3GDE A;  4DV5 Q;  1IYU A;  3RN5 A;  2MO0 A;  5C0X J;  2B8G A;  1JIC A;  4KI0 A;  4OEL B;  1VQ6 A;  4KKT A;  1G2S A;  4QQB X;  5IYB H;  4PQX A;  4B3T L;  3D8G A;  3RLF A;  2D9U A;  1YVC A;  5HUR A;  2ZXO A;  3L7Z C;  1K0S A;  1N34 Q;  5D65 A;  4FP5 D;  1HTL D;  4BXX H;  1JB3 A;  1SAP A;  4LAA A;  4A3D G;  3E3X A;  4XTC S;  2OT2 A;  1NY4 A;  4JBJ A;  4X64 L;  2R7D A;  5T1G A;  3A54 A;  1XMO Q;  1ET9 A;  1TWC B;  2UUC Q;  3D3R A;  4UP8 A;  4DR7 L;  4M8A A;  2UXC Q;  4C3I G;  1ENF A;  1LO5 D;  4ZCK A;  3AU7 A;  5DAU A;  3K5O A;  4EQ5 A;  3FPU B;  1SE4 A;  1EOT A;  1KDB A;  4DUZ Q;  3ONA B;  1F9R A;  1QVG A;  2BOS A;  3PF5 A;  1NUC A;  2PI2 A;  1IBK Q;  3SHL A;  1K83 B;  1LTG D;  3HOY G;  4RKL A;  1BOS A;  2B2U A;  4GNX C;  4BY7 H;  1KLG D;  4OIJ A;  1WI5 A;  1HTP A;  4DV2 Q;  2JA7 B;  1KRT A;  1XPO A;  1KC8 C;  1ENA A;  2MPM A;  3RN2 A;  2Z6K A;  4A3B B;  4C3H G;  3HOZ H;  2YU9 H;  2UU9 L;  3GTJ B;  2F0W A;  3I3C A;  3S1R B;  3PUW A;  1BBX C;  2EYM A;  5CC4 A;  3EA6 A;  4X3T A;  3M3Y B;  2FHT A;  1HQR D;  4PG3 A;  2JA6 H;  2L15 A;  2VXW A;  4HAE A;  4LWC A;  1O7I A;  4JI0 Q;  5I9O A;  3CC4 A;  2EYF A;  4HED A;  4TRD A;  5KGU A;  4BY1 B;  5COR A;  4JBM A;  5GRO A;  4RMF A;  1IBM Q;  3HOW B;  2F0P A;  3H0G B;  5CV6 A;  1N32 L;  5A2Q E;  1LTT D;  2EPB A;  3CCL A;  4DXG A;  3D6W A;  4BBS B;  1VDZ A;  2BDO A;  4C3J B;  4HSP A;  3I4M G;  4H44 C;  1MD2 D;  4DAM A;  3HS0 C;  2JA8 B;  2RHS B;  3S9W A;  3E9H A;  1EIF A;  2K7V A;  4P75 A;  4NXN L;  5M3M B;  3A5U A;  2KOL A;  3BG3 A;  4EQP A;  4JI6 Q;  3RR5 A;  1HFG A;  2EIF A;  3I4N G;  1Z6H A;  1CSQ A;  2XSC A;  3OWF A;  1NSN S;  2WAC A;  3BDL A;  2K5Q A;  1PH5 A;  2ID0 A;  4P72 A;  4XYO A;  3VYU A;  1WTO A;  3P75 A;  1HHV A;  1PFN A;  2R7Z H;  2SDF A;  2WKC A;  2UU9 Q;  4C56 C;  4L5T A;  1X65 A;  4NW2 A;  3G71 A;  1QZG A;  3I70 A;  4ABN A;  1JR0 D;  4DR5 Q;  2K5N A;  2Z4I A;  5ELF A;  5FLX c;  1TWF B;  3NTH A;  4IFD I;  1D1I A;  2ZTC A;  5CGK A;  5DNF A;  1HA6 A;  3F1Z A;  1CKN B;  4JC0 A;  1K9M C;  3W1B A;  2VQE L;  1NCV A;  2HCC A;  4DV6 L;  2AKW B;  1PHJ A;  5G3L D;  4JI5 L;  3STB D;  3BJU A;  4DR3 L;  3W1G A;  1VQE A;  4H7B A;  1LAB A;  1HNZ Q;  2TSS A;  5D14 A;  4RHR A;  1KNA A;  2XN9 C;  4MTN A;  4H02 A;  4TVA B;  3KBG A;  2KCT A;  3V96 A;  4QGU A;  1K8M A;  2YV5 A;  1EY7 A;  2DNC A;  2K32 A;  1A2T A;  2LMC B;  1SEB D;  1IKM A;  3PUX A;  2B2U C;  5CBA E;  2OCE A;  4WJ3 M;  3U50 C;  1T5E A;  5J1Z A;  1B50 A;  3GTL B;  1LT6 D;  3R2I A;  3GTO B;  1TWC H;  4DF7 A;  1JWU D;  4XDX A;  1J8I A;  2F0U A;  1STG A;  2PCF B;  4KMU C;  3CCV A;  4DV7 L;  3BYT B;  3PO3 G;  3A74 A;  3TSS A;  4N9T A;  3VYT A;  1WTQ A;  4XQQ A;  4JI4 L;  3MXN B;  2K5W A;  4JOI C;  2AQ2 B;  2ZXP A;  1H9S B;  3F2D A;  3RNU A;  1K83 H;  2LSS A;  2HQE A;  1WOC A;  1O7L A;  2JA7 H;  4JI5 Q;  4R8I A;  3VR2 A;  3MXG A;  4CJ0 B;  3KFU A;  5JJK A;  2Z6B A;  3J80 i;  4A3B H;  5CV9 A;  1H9M A;  3TN2 A;  2HDL A;  3GTJ H;  2EYO A;  4HJ8 A;  3R93 A;  1YI2 A;  3S1R H;  2XRQ D;  3NPP A;  1GJX A;  3M3Y H;  1GM5 A;  1SNP A;  5IT9 L;  2F0T A;  2QKI C;  2R7F A;  4OIK A;  1HR0 L;  3KOJ A;  5JPN C;  4S3S A;  3FKI G;  4BY1 H;  4DUY L;  1CT1 D;  1B9M A;  1FJG L;  3HOX B;  4KJO A;  2Q8T A;  3HOW H;  3H0G H;  2Q8R E;  3CPF A;  4UAI A;  4BBS H;  4C3J H;  3RUZ A;  3S24 A;  4APV A;  4FNF A;  3AB9 A;  2WKD A;  3KF8 A;  2XRS D;  5EJW A;  3MA2 B;  1ROD A;  1S5C D;  5E4W C;  3JAM E;  4B3S Q;  4JI4 Q;  4L5R C;  1BCP F;  3W3A A;  2JA8 H;  2KEC A;  2DY7 A;  2F3W A;  4IPH A;  3TRE A;  3MZ5 A;  5M3M H;  5FO8 B;  4L5Q A;  1YIT A;  2E2D C;  3G48 A;  1U0L A;  2I46 A;  1CUK A;  1STB A;  4DV0 L;  3CCM A;  4IPG A;  5LL6 S;  3K7U C;  4G4K A;  1HR0 W;  3Q8D A;  3SK5 A;  1G29 1;  2K6A A;  1J5E L;  1HRJ A;  2BE5 D;  1IL8 A;  1V1Q A;  3NEL A;  4B08 A;  1G8Z D;  4IFD G;  1EIY B;  4H0L C;  1TWF H;  4X66 Q;  2ICE C;  1GXD C;  2OQK A;  3L9A X;  5C6A A;  3GO5 A;  3AYH B;  5H1S E;  2AQ1 B;  4QUC A;  4A3M B;  5LHY 1;  1IHZ A;  2NN6 I;  5BR8 L;  1SYE A;  2A69 D;  2ZM6 L;  1YJ9 A;  3M9B A;  3W2D A;  4OX9 L;  4J6H A;  2DGY A;  3HGB A;  2BCO A;  2PNR C;  2D5D A;  3VR3 A;  1STH A;  1TS5 A;  5EAY A;  5IE8 A;  1EL0 A;  1NR2 A;  3M4Q A;  1VQM A;  1EY8 A;  2O5J C;  3K80 C;  3K57 A;  3RMH A;  3DUZ A;  5NUC A;  2L12 A;  5IYD G;  2KA7 A;  4KTA A;  3GTL H;  3GTO H;  4KN7 C;  4CJ2 C;  1PZI D;  4IOA A;  1VQA A;  2MGS A;  1BUV T;  2XVS A;  3KJO A;  1IBL L;  4NKL A;  3MXP A;  3KUP A;  3TRZ A;  1B8A A;  3DWP A;  3X3M A;  4DR1 Q;  2AWN A;  1WCM G;  1FNV A;  1ZKO A;  2J4X A;  3QB3 A;  2YTY A;  5C4H A;  1Q90 A;  2A74 C;  2RDF A;  1H95 A;  2KUM A;  1HZ9 A;  2XTI A;  3WOE A;  3S1M B;  1RTN A;  2JA5 G;  2PQE A;  3UE0 A;  2Q2U A;  3QOL A;  1CA6 A;  1K3B C;  2EYH A;  3MFY A;  1EY6 A;  1DM0 B;  4K5W A;  3I73 A;  3K59 A;  1A62 A;  1LLR D;  2XWJ B;  4DNR B;  4LF8 L;  2LXK A;  2I5M X;  5AJ3 L;  5JAV A;  3NQI A;  1AP0 A;  1NE3 A;  4LUV A;  5IYC G;  3KDF A;  4L5S A;  3NHH A;  1VQK A;  4F7X A;  5K5P A;  2WAQ G;  3BVZ A;  3GTG B;  2E2I B;  1U9R A;  5FO7 B;  1Q82 C;  3MEH A;  2YTV A;  2MFI A;  1PLF A;  4A3L G;  3PQI A;  2NZ1 D;  4X3S A;  1H9K A;  3U9S A;  3HOX H;  1C7Y A;  3A8K E;  1QB5 D;  5FKA C;  5LMU L;  2MJ8 A;  5CV8 A;  4FO2 A;  3S1N B;  1IBL Q;  5BN3 A;  3FHW A;  2CHB D;  2I0Q A;  2NB0 A;  3KLW A;  4NP5 A;  1DOK A;  5ELB A;  1AFP A;  1B44 D;  1GD7 A;  4Z9C B;  3URY A;  4FXK C;  5HY6 A;  4JBW A;  1PFB A;  1VQ9 A;  4EQN A;  4JI2 Q;  4HIM A;  4G7H C;  1NMG A;  2N88 A;  3PO2 G;  1C8C A;  1G6Z A;  1GUT A;  2K4K A;  3H94 A;  1STN A;  4WJW A;  5KNB A;  1L2F A;  1BO0 A;  3BU2 A;  3HZX A;  4CGY B;  3PIP 3;  2G9D A;  2JYO A;  4OO1 I;  3WOF A;  3M7N A;  4JI3 L;  4YCU A;  3QR8 A;  1XXG A;  1UE1 A;  4A3D B;  2UXB L;  5AJ3 Q;  2VNU D;  1VQD A;  2E2J B;  2JJQ A;  1EEF D;  1MBY A;  2VZA A;  5LL6 X;  4KY5 A;  1A0I A;  2D0O A;  1TWA B;  4C3I B;  4K14 A;  4OHJ A;  1KDC A;  3S16 B;  4A3M H;  3BVG A;  5JVH 3;  4JV5 Q;  1L1O A;  4DGZ A;  1Y8N B;  2F0J A;  2DJG C;  2K5V A;  5KYI A;  3OMC A; 
#chains in the Genus database with same CATH homology
 1VQ6 A;  4QQB X;  3KDF B;  5IYB H;  2GN5 A;  1JB7 A;  2BH2 A;  4A93 G;  1E1O A;  1JE5 A;  4B3T L;  4LF5 L;  3RLF A;  3CF5 A;  1XMQ Q;  2JA5 H;  2ES2 A;  1YVC A;  3S17 H;  3L7Z C;  4A3G G;  2WAQ E;  1N34 Q;  5C0X I;  3JC6 6;  4GNX B;  4DV3 L;  2ALY B;  2R7Z G;  2D62 A;  3ULL A;  4NXM Q;  2R92 G;  4BXX H;  1UE6 A;  1X3E A;  1QUQ B;  4A3I G;  4A3K H;  2V1C C;  4JCV E;  5LMN L;  4UPA A;  3GTP H;  4A3D G;  4K0K Q;  4XTC S;  4DV0 Q;  4X64 L;  1NY4 A;  1X55 A;  4JBJ A;  2R7D A;  3TS2 A;  3NEM A;  2UUB Q;  1XMO Q;  3SGI A;  4ALP A;  1VQF A;  4O2D A;  1R9T H;  1PH1 A;  5IYC H;  1I6H H;  3L2P A;  2UUC Q;  4UP8 A;  1Y1V G;  1J5E Q;  4DR7 L;  2UXC Q;  3JAM i;  2OWO A;  4AYB E;  4JI7 L;  2Y0S G;  5C44 G;  2EXD A;  5M5W H;  2UXB Q;  2Z6K C;  3PUY A;  1SE8 A;  4POG A;  4EQ5 A;  1E22 A;  4A3L H;  2R6G A;  4DUZ Q;  1QVG A;  3I55 A;  3PF5 A;  2ATW A;  3GTQ H;  2PI2 A;  1IBK Q;  4B3S L;  4AH6 A;  3PV0 A;  5BR8 Q;  3HOY G;  4BY7 H;  2ZM6 Q;  2RCN A;  4GNX C;  5HGQ A;  1WI5 A;  3J81 c;  4BA2 I;  3IRB A;  1CKN A;  4DV2 Q;  2Q2I A;  3UDI A;  2JK8 A;  5IP7 G;  3S1M H;  1Z47 A;  1MIU A;  1KRT A;  1NMF A;  4OX9 Q;  1XPO A;  1KC8 C;  1AH9 A;  3T1H L;  3I2Z A;  1KXL A;  2VQF Q;  3RN2 A;  2Z6K A;  1I94 L;  5LMN W;  3PSI A;  3E0E A;  2VS1 A;  1PA6 A;  3HOZ H;  2YU9 H;  2UU9 L;  2NVT H;  1Q86 C;  4JBK A;  4DK6 C;  2UUA Q;  3DLL A;  4B3R L;  3HOU H;  3PUW A;  1Q8K A;  3PO2 H;  3OW2 A;  1G6P A;  2NZO A;  4LFC L;  1BBW A;  4A3F G;  1QUQ A;  1TXY A;  1VQC A;  2OTL A;  4PG3 A;  1Q46 A;  2JA6 H;  2L15 A;  4HIO A;  1NBW A;  2GVB A;  2IHF A;  1P16 A;  2Q2H A;  3GTG H;  4LWC A;  1QZH A;  1O7I A;  2PQA A;  2E2I H;  3CC4 A;  4JI0 Q;  1L1O B;  4X66 L;  2QA4 A;  2CWP A;  4JBM A;  5GRO A;  4RMF A;  1IBM Q;  1TWH H;  2A1A A;  2H5X A;  1WFQ A;  1N32 L;  4R4C A;  4HJ5 A;  2BA0 A;  4PZ8 A;  3CCL A;  1VQO A;  1X56 A;  4QJF A;  3S1N H;  2IX0 A;  4LF4 L;  2JEA I;  3I4M G;  4JI7 Q;  4A3J H;  1V9P A;  3G4S A;  2KBN A;  2JA7 G;  3J81 j;  3PCO B;  4DAM A;  1S3O A;  3FP9 A;  2QEX A;  1OXS C;  2RHS B;  1Y1W G;  1HNX L;  1YNX A;  3E9H A;  1EIF A;  4P75 A;  1K0R A;  4A3B G;  2IHE A;  3OTO Q;  4NXN L;  1V43 A;  4YHH L;  3A5U A;  2K52 A;  2HT1 A;  2IX1 A;  4JI6 Q;  3RR5 A;  3VDY A;  2N78 A;  2JE6 I;  2EIF A;  2YYZ A;  3I4N G;  2VUM G;  2K50 A;  4BBR G;  2HIX A;  1CSQ A;  1D7Q A;  1K8G A;  1KIX A;  1M90 C;  4A93 H;  4GLV B;  4LF8 Q;  1PH5 A;  2ID0 A;  4P72 A;  4OWW B;  4A3G H;  2GVA A;  2E5L L;  1KHI A;  3AFQ A;  2ZJP A;  4GKK Q;  2CCZ A;  2R7Z H;  2Y0S E;  2RHQ B;  2UU9 Q;  1LTL A;  2R92 H;  1PH7 A;  5M3F G;  4A3I H;  4L5T A;  4BY1 G;  4DR6 L;  4A3D H;  1X65 A;  4J15 A;  1QZG A;  3G71 A;  4IJH A;  1PH3 A;  3CCS A;  1VQJ A;  3M4O H;  2F4V L;  2E2J H;  3HOW G;  3H0G G;  4DR5 Q;  2K5N A;  4UP9 A;  5M5Y H;  5FLX c;  1FGU A;  3J7Z C;  4DK3 C;  3H15 A;  3CCU A;  4LFC Q;  1VQN A;  4IFD I;  4GKJ L;  4KHP L;  1FL0 A;  2NN6 G;  2ZTC A;  4DR1 L;  4BBS G;  2CWA A;  3F1Z A;  1CKN B;  1Y1V H;  4JC0 A;  4DR4 Q;  4C3I H;  1TWA H;  1YZ6 A;  3W1B A;  2VQE L;  4DV6 L;  1K9M C;  4AIM A;  5LMU Q;  2AKW B;  5C44 H;  3CMA A;  1J6Q A;  2KHI A;  2N8N A;  1PHJ A;  1EYG A;  3S16 H;  1HZA A;  4JI5 L;  1SR3 A;  3STB D;  2QGQ A;  2HIV A;  3BJU A;  3K8A A;  5IWA Q;  1XPR A;  4X65 Q;  2JA8 G;  4DNI A;  4B3M Q;  1SRU A;  4DR3 L;  3PF4 A;  3W1G A;  1VQE A;  1OXT A;  3KJP A;  1HNZ Q;  5M3M G;  4LF6 L;  1C9O A;  5C4X G;  4X62 L;  2DUD A;  5K36 G;  2VW9 A;  2A19 A;  2KCM A;  4NPS A;  3HOY H;  4GOP A;  4WJ4 A;  2N3S A;  4MTN A;  4H02 A;  4TVA B;  4XIG S;  5IP9 G;  3I7F A;  2KCT A;  1PH2 A;  5IP7 H;  4QGU A;  3I56 A;  1PV4 A;  4OON A;  4IOC A;  1N36 L;  2YV5 A;  4MZ9 A;  4R4O A;  2PQA B;  2N49 A;  4GN3 B;  1KQS A;  3ICE A;  3PIO A;  4C3H H;  1XJV A;  3PUX A;  1PH8 A;  3EN2 A;  1X3G A;  2OCE A;  1HNW L;  4WJ3 M;  4HJ9 A;  3U50 C;  1WYD A;  1AE2 A;  1FVI A;  3KF6 A;  2Q2T A;  4JI3 Q;  1Z9F A;  1TWC H;  4KHZ A;  1EUJ A;  4P73 A;  4YCW A;  4HIK A;  1XPU A;  5DLQ E;  3CC7 A;  1NJI C;  3D31 A;  4A3F H;  3PUZ A;  4A3C G;  4JYA Q;  1B70 B;  1KAW A;  2E5L Q;  3ULP A;  3HOV G;  3I4O A;  4YY3 Q;  1XNQ Q;  2NVQ H;  3CCV A;  4DV7 L;  3CW2 C;  4DR6 Q;  1Q81 C;  3CME A;  3PO3 G;  3A74 A;  1A8V A;  3DM3 A;  4JI4 L;  4QL5 A;  3MXN B;  2NZH A;  2R93 G;  5JJI A;  1S72 A;  1PVO A;  3KF8 B;  3LGJ A;  4JOI C;  1YBY A;  3S2D H;  2UXD L;  4GKJ Q;  4JI8 L;  4KHP Q;  3CCJ A;  1GO3 E;  3F2D A;  5C3E G;  3RNU A;  1K83 H;  2B3G A;  2HHH Q;  2OQ0 A;  4JI2 L;  2LSS A;  3ULJ A;  4LF7 Q;  1GKH A;  2PMZ E;  3STB C;  3I4M H;  1WOC A;  4YWL A;  3PGZ A;  1BVS A;  4LFA L;  2JA7 H;  4JI5 Q;  1K8A C;  1B7Y B;  4PZ6 A;  4LW1 A;  1VQB A;  1PYB A;  2JEB I;  3KFU A;  1Q1E A;  1Y1W H;  5JJK A;  4IJL A;  3J80 i;  4A3B H;  2KHJ A;  1VCI A;  2MNA A;  1W2B A;  3GTJ H;  4X62 Q;  4B3T Q;  4LF5 Q;  4JOI A;  4LF6 Q;  4HJ8 A;  1VQ8 A;  3CCR A;  1YI2 A;  4DV3 Q;  3I4N H;  5FJ8 G;  3ZJY C;  3UDG A;  3S1R H;  4BBR H;  4DV4 L;  1YJW A;  2VUM H;  4GN4 B;  4FDB A;  4DAY B;  4YCV A;  5LMN Q;  1XNR L;  2B63 G;  5GQO A;  1UE5 A;  3M3Y H;  3CQZ H;  3J7A 5;  4GS3 A;  4X64 Q;  1GM5 A;  3ERS X;  4IO9 A;  3TS0 A;  3T1Y L;  2R7F A;  1HR0 L;  3KOJ A;  3KYH C;  3U4V A;  3CP0 A;  5M3F H;  3FKI G;  3U58 A;  4BY1 H;  4DUY L;  4DR7 Q;  1FJG L;  5C4J H;  4LF9 L;  1K3R A;  3RLN A;  1W3S A;  1IZ6 A;  1N33 L;  3S1Q H;  3HOW H;  3M85 A;  3H0G H;  2OTJ A;  1N9W A;  1D8L A;  2EQS A;  3NBH B;  3U4Z A;  5GAH C;  1EQQ A;  4JV5 L;  3CPF A;  4DKA C;  4GOP B;  4DR2 L;  3RZD H;  1HZC A;  4HJA A;  4BBS H;  4C3J H;  5GAG C;  4DV5 L;  4APV A;  3S24 A;  2HQL A;  3GD7 A;  3AFP A;  1UE7 A;  4IPD A;  3K0X A;  4B3S Q;  2BA1 A;  4JI4 Q;  1IYJ B;  3B6Y A;  4AYB G;  4L5R C;  2JA8 H;  1XMQ L;  4IPH A;  1YJN A;  3TRE A;  5M3M H;  1N34 L;  1BKB A;  1MJC A;  5C4X H;  3F2C A;  1EFW A;  3KF6 B;  1I3Q H;  3T1H Q;  2KEN A;  4OO1 G;  4L5Q A;  3S15 H;  1I94 Q;  4PMW A;  1YIT A;  1N8R C;  2XGT A;  3G48 A;  1SRO A;  1U0L A;  2PI2 E;  1CUK A;  5IP9 H;  1VQP A;  4DV0 L;  3CCM A;  4UP7 A;  2UUB L;  1GVP A;  1XMO L;  4IPG A;  3RLO A;  4B3R Q;  1JT8 A;  4R1J A;  3K7U C;  1HR0 W;  2JQO A;  4O0A A;  1SLJ A;  1YHA A;  3Q8D A;  2UUC L;  2VL6 A;  3J81 i;  1G29 1;  1VQH A;  3HKS A;  4AQY L;  1J5E L;  1BBU A;  1XTD A;  4GN5 A;  4GOP C;  2UXC L;  3EIV A;  3TQY A;  3HOX G;  1V1Q A;  3NEL A;  2C35 B;  4NB3 A;  1Q7Y C;  1YHQ A;  1SMX A;  3G6E A;  4DV1 L;  1YEZ A;  2I5H A;  1TWF H;  2WB1 G;  1EIY B;  1XNR Q;  3RZO H;  4IFD G;  4X66 Q;  4LFB L;  1VQ7 A;  1PYS B;  1C0A A;  2OQK A;  4A3C H;  1OXV A;  4DUZ L;  3GO5 A;  2BH8 A;  3AYH B;  4RG1 A;  5H1S E;  3HOV H;  3MEF A;  1N32 Q;  1IBK L;  2NN6 I;  1YHB A;  4JI1 L;  1E7Z A;  5BR8 L;  1WJJ A;  2ZM6 L;  2CFM A;  4A75 A;  1YJ9 A;  1LM0 A;  1JJ2 A;  3PO3 H;  2MQH A;  3M9B A;  4A3J G;  4DV2 L;  5J3B A;  1N33 Q;  4LF4 Q;  4OX9 L;  1CKM A;  3UE1 A;  2DGY A;  5FLM G;  1ASY A;  2JA9 A;  1L0W A;  2D0P A;  3WWV A;  2A8V A;  5C0X G;  1P8L A;  3HKZ G;  4MNO A;  5C3E H;  3GTK H;  1TWG H;  4Y7N H;  1HNX Q;  5IT9 c;  4ME3 A;  1SN8 A;  4NXN Q;  2FXQ A;  3PUV A;  3UDF A;  4YHH Q;  3BZC A;  1X9N A;  5EAY A;  2UUA L;  5IE8 A;  4P74 A;  3K7A H;  4QIW E;  3AEV A;  3M4Q A;  1G51 A;  1EOV A;  2LXJ A;  1VQM A;  2CKZ B;  3K80 C;  1MJE A;  1X54 A;  1MKH A;  4IPC A;  1KRS A;  3PIP A;  3E9I A;  5IYD G;  1I50 H;  4GLX A;  4PZ7 A;  1Q12 A;  1S40 A;  1UWV A;  4JI0 L;  2YTX A;  3M4P A;  4R4I A;  5FJ8 H;  1A63 A;  1X6O A;  3GTL H;  4EX5 A;  3GTO H;  1CKO A;  1IXR A;  2B63 H;  4IOA A;  1VQA A;  1IBM L;  1Y14 B;  1IBL L;  3KJO A;  2E2H H;  4A3E G;  2F4V Q;  4YWM A;  1SFO H;  1JJG A;  3GTM H;  4A3M G;  1DGS A;  3TRZ A;  1RL2 A;  3CXC A;  4AQY Q;  1B8A A;  1VQ4 A;  2NVX H;  3D0F A;  2AWN A;  3FKI H;  4DR1 Q;  1WCM G;  1VQG A;  1U5K A;  4R4Q A;  2VQE Q;  4DV6 Q;  1PH4 A;  2YTY A;  1EQR A;  2K75 A;  4DV1 Q;  4QY7 A;  1HH2 P;  1X3F A;  4LFB Q;  1YIJ A;  3F2B A;  5IYB G;  3CCE A;  4A4I A;  1H95 A;  1LUZ A;  1HZ9 A;  2XTI A;  4Y52 H;  1VQI A;  1HJP A;  3OTO L;  2ZJR A;  2CQO A;  3BZK A;  4LUO A;  4DR3 Q;  1JMC A;  2JA5 G;  3UE0 A;  2Q2U A;  3CAM A;  4JI6 L;  4JI1 Q;  2Z0S A;  4OWT B;  1RIP A;  1QVF A;  4BXX G;  1OXX K;  1M1K C;  4A3K G;  2ASB A;  1A62 A;  4LF8 L;  2K14 A;  2LXK A;  2I5M X;  5AJ3 L;  1N36 Q;  2NVY H;  2MO1 A;  1NE3 A;  4GKK L;  3H3V H;  4LUV A;  5IYC G;  3KDF A;  4L5S A;  1VQK A;  5ELO A;  2WB1 E;  1E1T A;  1IL2 A;  2WAQ G;  1Q1B A;  1HNW Q;  1OTC A;  1UEB A;  3W5O A;  5IY0 A;  1EWI A;  2E8G A;  4GNX A;  4DR5 L;  1KD1 C;  1Q82 C;  4HJ7 A;  2YTV A;  2MFI A;  3TEH B;  4A3L G;  1PH6 A;  3F8T A;  3AQQ A;  4DR4 L;  2WP8 J;  3HOX H;  1C7Y A;  5LMU L;  4DV7 Q;  4BY7 G;  4BA1 I;  4KLK A;  3L0O A;  5IWA L;  3CC2 A;  1QVC A;  1VS0 A;  3OYY A;  5E7N A;  3HKZ E;  4X65 L;  1IBL Q;  2ZTD A;  2ZJQ A;  4B3M L;  3FHW A;  4OXP A;  1HNZ L;  2I0Q A;  3KLW A;  2UXD Q;  4X6A H;  1PFS A;  1GD7 A;  4JI8 Q;  3JAM c;  2AMC B;  1HZB A;  5HY6 A;  2AHO B;  4OWX B;  4JBW A;  3HOZ G;  4NXM L;  1VQ9 A;  3CPW A;  4JI2 Q;  4K0K L;  1K73 C;  4HIM A;  1NMG A;  4LFA Q;  2K5H A;  1OXU A;  5ELN A;  1E3P A;  4C2M H;  5FLM H;  4TQU S;  3CD6 A;  3HOU G;  3S14 H;  3PO2 G;  3A5Z B;  2K4K A;  4R4T A;  1AE3 A;  1E24 A;  5JEA G;  2ZTE A;  1L2F A;  1T9H A;  3BU2 A;  4LNQ A;  5JEA J;  2F3I A;  1ASZ A;  3A0J A;  4A76 A;  2JA6 G;  4OO1 I;  1NTG A;  3EBE A;  5M5X H;  1VQL A;  3H3V I;  5GAE C;  3M7N A;  4JI3 L;  4YCU A;  4DV4 Q;  1L1O C;  2WFW A;  1UE1 A;  4JYA L;  2UXB L;  3UDX A;  5AJ3 Q;  2VNU D;  4GLA C;  1VQD A;  4YWK A;  2I5L X;  4IFD J;  2JJQ A;  4POF A;  2VY3 A;  5IYD H;  2IT1 A;  4YY3 L;  3ER0 A;  1JJC B;  2VZA A;  1XNQ L;  4DPG A;  3T1Y Q;  1CSP A;  5JJL A;  3S2H H;  4JG2 A;  1I5F A;  2B29 A;  3HFZ B;  1HR0 Q;  1A0I A;  2F52 A;  3J80 c;  2D0O A;  4DUY Q;  1KL9 A;  4LF9 Q;  1FJG Q;  2RF4 A;  4LUZ A;  4A3E H;  4P71 A;  2AWO A;  3NEN A;  5GAD C;  4A3M H;  2R93 H;  1PH9 A;  2PNH A;  2IY5 B;  1VQ5 A;  1LYL A;  4JV5 Q;  1L1O A;  2VQF L;  3K81 C;  3CCQ A;  2HHH L;  4DR2 Q;  4LF7 L;  3GDE A;  4UY8 C;  1WCM H;  4DV5 Q;  4HID A;  2K5V A;  3RN5 A;  2MO0 A;  5C0X J;  4KI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...