1QZHA

Crystal structure of pot1 (protection of telomere)- ssdna complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
170
structure length
170
Chain Sequence
b'VIDSLQLNELLNAGEYKIGELTFQSIRSSQELQKKNTIVNLFGIVKDFTPSRQSLHGTKDWVTTVYLWDPTCDTSSIGLQIHLFSKQGNDLPVIKQVGQPLLLHQITLRSYRDRTQGLSKDQFRYALWPDFSSNSKDTLCPQPMPRLMKTGDKEEQFALLLNKIWDEQTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords telomeric single-stranded DNA
publication title DNA self-recognition in the structure of Pot1 bound to telomeric single-stranded DNA
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein/dna
total genus 43
structure length 170
sequence length 170
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02765 POT1 Telomeric single stranded DNA binding POT1/CDC13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1qzhA00
4L5QA 2D0PA 4AIMA 1UEBA 4YCVA 1YJWA 4P75A 1IBLQ 1IBLL 2QEXA 3UDGA 4POFA 2MNAA 1HZCA 4GKKQ 4C3JH 4A3EH 4GKKL 3AFPA 1Y1WG 3I2ZA 1E7ZA 3HOXH 3CAMA 3PO2H 1Q81C 1EQRA 4WJ4A 4L5RC 4LF5Q 4KI0A 4LF5L 1L1OA 1Z47A 4A3GH 1FGUA 2K4KA 5IYDH 3CCUA 1I94Q 2IY5B 1B8AA 2V1CC 3EIVA 4JI2Q 1I94L 3CC4A 1GM5A 4JI2L 4OX9Q 4A4IA 1PYSB 4OX9L 4FDBA 4JV5Q 4HIMA 4JV5L 5JJKA 4GOPB 4P72A 4DAYB 1GKHA 3PO3H 2AWOA 1IYJB 3KDFB 4JI5L 2UUCQ 1R9TH 3AYHB 4LUOA 2D62A 2IX1A 1NMGA 2KHJA 4HJAA 4JI0Q 2UXBQ 1KD1C 4JI0L 1QVFA 2UXBL 4UY8C 2B3GA 4ALPA 3NEMA 4LNQA 1LYLA 4A3BG 1NJIC 5J3BA 2VUMH 4Y52H 3TQYA 1IZ6A 1VQCA 2EIFA 4GN5A 5IWAQ 2RHSB 5IWAL 4DV1Q 1QUQB 1P16A 1XPUA 3HOUG 3I4MH 2HIXA 1SN8A 1DGSA 1YBYA 1VQ7A 4OO1I 4L5TA 3G48A 2AKWB 1K0RA 4LFAQ 3TRZA 3OW2A 4LFAL 1VCIA 3PUXA 2XTIA 1KAWA 4JBWA 2RHQB 4R4IA 2VQEL 1PHJA 2JA7H 3AFQA 1Q86C 3CCEA 3NENA 2JA9A 3PUWA 2N78A 5GROA 1QZGA 1TWAH 4QY7A 4GN3B 2OQKA 1X3FA 3KOJA 4A3JG 1QVCA 1PH7A 1VQ5A 1VQBA 4GLVB 4LF6Q 3GTQH 4R4CA 4LF6L 3A5ZB 2N49A 1Y1VG 3HFZB 1PH6A 5IYBH 4GOPC 2JA5H 1IL2A 1VQNA 3CD6A 3S14H 3G4SA 4B3MQ 2CFMA 2F3IA 4OO1G 3A0JA 2JEBI 3Q8DA 5IP9H 3CCVA 3KFUA 3TEHB 1VQMA 1K3RA 3MXNB 3J81c 4GKJQ 1FVIA 1HH2P 2AMCB 5C0XG 1OTCA 2Q2UA 3S2HH 1B7YB 1OXUA 1N32Q 5JJLA 4DV5Q 1PA6A 2R7ZG 1N32L 4DV5L 2N8NA 5LMUQ 2BH2A 5LMUL 3PSIA 1O7IA 4A3CG 1PYBA 3CP0A 4A3MH 2WAQG 2Q2HA 5LMNQ 1I50H 5LMNL 4A3FH 2B63G 4LF7Q 1CKNA 3HOZH 2AHOB 3W5OA 1IBML 1OXXK 4C3IH 2ZTDA 3UDFA 5C0XJ 3ICEA 1VQ9A 4JYAQ 1NMFA 4NPSA 4DUYL 4BY7H 4A75A 2MQHA 4X66Q 2JA8H 4X66L 1SE8A 4UPAA 4DV7Q 5HGQA 4LWCA 5M3MG 3KJOA 4DV7L 1J5EQ 3PUYA 1UE6A 1J5EL 1V9PA 2R92H 4JI8Q 5IP7H 1KIXA 4JI8L 3W1BA 2OWOA 3JAMi 1VQIA 3UE0A 4A3IG 4HJ7A 1UWVA 3S24A 2Y0SE 3CPFA 3CXCA 3S16H 3S15H 2CWAA 4YWLA 3GTKH 4GNXA 4A3EG 4LF4Q 3I4NG 2WP8J 1QZHA 3GTOH 2A19A 3F8TA 4QGUA 1PH1A 4NB3A 5BR8Q 4KHPQ 5BR8L 4KHPL 5FLMH 3L2PA 1UE5A 3K7UC 3RN2A 1SR3A 4A3GG 4J15A 5IYDG 4DR2Q 4O2DA 4DR2L 4NXMQ 3NBHB 2ZM6Q 4NXML 2ZM6L 5M5XH 4HIKA 2BH8A 2Q2TA 4LW1A 3PO3G 4PG3A 2FXQA 3ER0A 4B3SQ 5GAEC 3RLNA 1KQSA 3VDYA 3KF6A 2PQAA 3M9BA 1CKMA 4OWTB 3U50C 4DV6Q 4DV6L 3TS2A 3RLOA 5IYCH 3CMEA 4DR6Q 4IJLA 4DR6L 1E24A 3M3YH 2UXCQ 4YWKA 5M5YH 2UXCL 1FL0A 2YTXA 4DPGA 1K9MC 1YEZA 2ZJPA 4A3KH 1Q1BA 1EQQA 3KF8B 2VUMG 1CSQA 4RMFA 3HKZE 3I4MG 1VQKA 4IO9A 2XGTA 2D0OA 4A93H 5IY0A 3AQQA 2ZTEA 5IE8A 2BA0A 2JA7G 5GADC 2KBNA 3D31A 4YCUA 1YHBA 4ME3A 4JI1Q 1VQ4A 1N34Q 4JI1L 1HNWQ 1J6QA 1UE7A 1N34L 1HNWL 1E1TA 1MKHA 4DR3Q 3TS0A 4DNIA 2MO0A 1S3OA 2JK8A 4DR3L 1MJCA 1AE3A 1GO3E 3EBEA 4H02A 1GVPA 3RLFA 5E7NA 1TWFH 2VNUD 2R93H 1X6OA 2E2HH 2K52A 5IYBG 1K8AC 2JA5G 2F52A 3FHWA 2GVBA 2K50A 4P71A 4X65Q 4JI3Q 2PI2A 1YZ6A 4JI3L 5IT9c 4X65L 3PIOA 1G51A 3OTOQ 3T1YQ 1JJCB 3B6YA 3OTOL 3T1YL 4TQUS 1EFWA 1JE5A 5GAGC 4JI5Q 5FJ8G 4PZ6A 3G6EA 3M7NA 1K73C 1T9HA 2E8GA 1XMQQ 1JMCA 1XMQL 4O0AA 4DR5Q 3HOWH 1Q12A 3J80i 4DR5L 1N33Q 3HOYG 3PV0A 1N33L 5ELNA 4PMWA 1KC8C 2N3SA 2QA4A 3S1QH 4DAMA 3UE1A 1L0WA 4JBKA 4A3MG 2MO1A 1JJ2A 3K7AH 3RZDH 3GTLH 3HOZG 4DKAC 4A3FG 1D7QA 1PH9A 4UP8A 3CQZH 1QVGA 3A5UA 2HIVA 1Z9FA 3H0GG 1PH8A 4BY7G 2CWPA 3L0OA 4LF8Q 4LF8L 2JA8G 3OYYA 2VQEQ 3HOVH 2IT1A 1BBWA 2JEAI 3I4OA 3JAMc 5C0XI 2R92G 3S2DH 2WB1G 2K5NA 5IP7G 1SLJA 1E1OA 1WFQA 1FJGQ 3U4ZA 1A62A 1FJGL 1CKNB 2DUDA 4EX5A 1VQJA 4X64L 1EIFA 3I7FA 2AWNA 3CW2C 1ASZA 4UP7A 2LXKA 5GQOA 2OTLA 3H3VI 1YIJA 4IPCA 5M3FH 1M1KC 1KRTA 1XMOQ 3RZOH 1XMOL 3GD7A 2HHHQ 3G71A 2KHIA 4B3TQ 1BKBA 1E22A 2YTYA 3L7ZC 3PCOB 2HHHL 4B3TL 1JJGA 5FLMG 3F2BA 4R4QA 5JJIA 2Z6KA 4GOPA 2YYZA 3HKSA 1TWCH 1N36L 3CCLA 1YHAA 3ULJA 2NN6I 1LM0A 4GN4B 3CCMA 3RN5A 3S1RH 3PUVA 1AE2A 1YITA 4LFCL 1ASYA 2I5MX 5GAHC 1IBMQ 4AYBG 1V43A 1PV4A 4DV4Q 4DV4L 2UU9L 4DUZQ 1N9WA 2R6GA 4DUYQ 4DUZL 2ATWA 1TWGH 3FKIH 4GLXA 3RR5A 2E5LQ 1QUQA 1W3SA 2E5LL 4A3KG 4JYAL 1BVSA 1VQ6A 4GKJL 4BY1H 2L15A 2YV5A 4IFDG 2PI2E 2KCTA 4JBMA 1VQOA 2ZTCA 2NN6G 1TXYA 1M90C 1Q46A 4LUZA 4BA1I 1V1QA 3KF6B 2PQAB 2VZAA 1HR0W 2YU9H 2GVAA 3S1MH 4BBRH 4DR1Q 4DR1L 2OTJA 1S40A 1HZBA 2K5HA 4IFDJ 2ES2A 4A3DG 1WCMH 3E9HA 3KLWA 1A8VA 3TREA 2ASBA 3CCSA 3HOXG 1YJ9A 2H5XA 3PO2G 2GN5A 4DR4Q 1SROA 1HR0L 4DR4L 1X3GA 1SRUA 3FP9A 2R93G 4MZ9A 4JOIC 2A8VA 3U4VA 3BJUA 3GTPH 1C7YA 3UDXA 4C3HH 4XIGS 4LF9Q 3BU2A 1HNZQ 4LF9L 1XPRA 1HNZL 3U58A 5C3EH 4JI4Q 1HZAA 1WJJA 4IPGA 1Y1VH 5JEAG 3J80c 4JI4L 3SGIA 4JCVE 1C9OA 4XTCS 4BBSH 4K0KQ 4QQBX 4K0KL 1L1OB 1OXTA 2VS1A 5FLXc 1PH3A 2ZJQA 3CC2A 2JE6I 5JEAJ 5C4XG 1WOCA 2HT1A 2NVTH 4R4OA 1G6PA 1UE1A 2RF4A 4BA2I 2BA1A 1EIYB 4IPDA 3BZKA 3CC7A 3ZJYC 2EQSA 4R1JA 3M85A 3M4OH 1NTGA 1KHIA 4LUVA 4DV3Q 1X54A 2VL6A 4DV3L 1VQ8A 2I0QA 2NZOA 4L5SA 2JQOA 1NBWA 2R7FA 5C44H 5M3MH 1X65A 5K36G 2I5LX 5M3FG 2F4VQ 2F4VL 2WAQE 1VQFA 3PUZA 3AEVA 5IP9G 1VQAA 4A3LH 1RL2A 4X6AH 1YNXA 2ALYB 2NZHA 1XTDA 1PH2A 3PF4A 1L1OC 1PH4A 3S17H 4HJ8A 2VY3A 1X56A 3E9IA 3GTMH 1XPOA 2CQOA 3I4NH 1JT8A 3PIPA 4X62Q 3CCRA 3RNUA 2E2JH 4X62L 1Q7YC 1XNQQ 2ID0A 3K81C 1VQPA 1XNQL 2E2IH 2OCEA 2NVYH 1YVCA 2Q2IA 3NELA 4BXXH 4JI7Q 1CSPA 2Y0SG 4JI7L 2HQLA 1IBKQ 1IBKL 3EN2A 1HNXQ 3CPWA 1HNXL 3FKIG 5C4XH 4YY3Q 4YY3L 2JA6H 3PF5A 4BY1G 4IOCA 3H15A 1CUKA 1Q1EA 1LUZA 2UUAQ 2UUAL 2UUCL 1I6HH 1AH9A 1G291 5EAYA 1H95A 3I56A 2IHFA 3ERSX 1OXSC 2LXJA 1OXVA 4X64Q 4HIDA 1I5FA 5DLQE 2WFWA 4RG1A 4BBRG 4AQYQ 4AQYL 3F2DA 1EOVA 4YWMA 1A63A 1WYDA 4P74A 2UXDQ 2UXDL 1WCMG 3BZCA 2RCNA 4OONA 4QJFA 4HIOA 3GO5A 4DV1L 2CCZA 4Y7NH 4A3DH 4DK6C 1P8LA 3W1GA 3M4QA 4PZ7A 5AJ3Q 5AJ3L 4C2MH 2NVQH 2VQFQ 1VQEA 1X9NA 4IFDI 2VQFL 3KDFA 1N36Q 1Y1WH 4DV2Q 4AH6A 4TVAB 1U0LA 4DV2L 4LFCQ 5C4JH 2YTVA 1C0AA 3HKZG 4GNXB 4DV0Q 1MIUA 1LTLA 3STBC 4DV0L 4B3RQ 4B3RL 5C3EG 3GTJH 2EXDA 4UP9A 1E3PA 4EQ5A 2UU9Q 2Z6KC 2UUBQ 1XJVA 5IYCG 5HY6A 2UUBL 4BBSG 1HZ9A 2KENA 1KXLA 1K8GA 2DGYA 4B3ML 4IOAA 4KLKA 3M4PA 2B29A 5H1SE 5FJ8H 5LMNW 2CKZB 4JG2A 1EYGA 4HJ5A 1Y14B 2R7DA 4IPHA 3CCJA 3CF5A 4OWWB 1VQGA 2A1AA 3HOYH 4JBJA 4A93G 1U5KA 4APVA 1PH5A 2K75A 4LFBQ 3DM3A 4LFBL 4QIWE 3PGZA 4P73A 1MJEA 4A3BH 4A76A 1XNRQ 4LF7L 2PNHA 2MFIA 3MEFA 1VQLA 4QL5A 1XNRL 1IXRA 1YHQA 3JC66 5M5WH 3HOUH 4YHHQ 4YHHL 4NXNQ 3H0GH 3LGJA 4NXNL 2ZJRA 1HR0Q 3I55A 3GDEA 1HJPA 5C44G 2I5HA 3WWVA 1YJNA 3GTGH 3KJPA 1EUJA 1GD7A 3D0FA 4WJ3M 1I3QH 4GNXC 4YCWA 1SFOH 1VQHA 4R4TA 1Q82C 2Z0SA 3CMAA 4A3LG 1CKOA 4A3JH 1WI5A 1VS0A 1L2FA 4DR7Q 4IJHA 4HJ9A 4DR7L 1K83H 3E0EA 4JOIA 1D8LA 3STBD 3HOWG 2LSSA 1TWHH 1X55A 1N8RC 4LF4L 2IHEA 1Q8KA 3J7A5 2C35B 4PZ8A 4MTNA 1W2BA 3J7ZC 2WB1E 2K14A 1BBUA 4OXPA 5ELOA 1RIPA 3KYHC 4BXXG 2NVXH 3S1NH 1SMXA 3ULPA 3J81i 1NE3A 1X3EA 3K8AA 2R7ZH 4GLAC 2OQ0A 1NY4A 1VQDA 4KHZA 1PVOA 4A3CH 1KL9A 4MNOA 2IX0A 4GS3A 3T1HQ 2B63H 3T1HL 4JC0A 4B3SL 2JA6G 3HOVG 3ULLA 2PMZE 3F1ZA 1KRSA 3H3VH 1S72A 4DK3C 3A74A 2JJQA 3DLLA 1B70B 2KCMA 3IRBA 3J81j 2QGQA 2K5VA 4OWXB 1JB7A 4POGA 2VW9A 4JI6Q 4JI6L 3UDIA 3K80C 3F2CA 3K0XA 1EWIA 1A0IA 1YI2A 3CCQA 1PFSA 4A3IH 4AYBE
chains in the Genus database with same CATH superfamily
3MZ5A 2PW7A 1YJWA 1J9OA 1IBLL 1BCPF 1JOKA 1KDAA 4BY7B 4GKKQ 3AFPA 2F0PA 3K57A 5EKLA 4L5RC 3H94A 4LF5L 1L1OA 4A3GH 1FGUA 5IYDH 1J8IA 4RKLA 1GM5A 4JI2L 1EY8A 1E2VA 4HIMA 1LO5D 5JJKA 3S15B 4BS9A 1IYJB 2B2UA 5F2DA 3AYHB 4CKBA 1EZ6A 1LT4D 3G6JB 2UXBL 4UY8C 3M4YA 4ALPA 3TZDA 4GN5A 1EEFD 2RHSB 5C3XA 1XPUA 1SN8A 1DGSA 1YBYA 4LFAQ 3TRZA 1D1IA 1VCIA 1G91A 2WKDA 2RDFA 2K1BA 2XTIA 4JBWA 1HUNA 5M5YB 1S5ED 5A2QL 4A3KB 2OT2A 4GN3B 3JAME 1PH7A 1G2TA 4JPBW 1QVCA 2QF7A 4GLVB 2EYFA 4M1UB 5IYBH 1TS5A 3BVGA 3CD6A 2D5DA 4B3MQ 3T13A 2RVLA 2JEBI 4C56C 3Q8DA 3I72A 5IP9H 4FF3A 3MXNB 5JVG3 4IN3A 3S2HH 2Q2UA 3T56B 1N32Q 5IGGA 5JJLA 4DV5Q 1PA6A 2RSOA 1TWFB 1ENFA 1H9MA 2OF1A 2Q2HA 4RKBA 3W5OA 4ILWA 1EIGA 1O78A 2L1BA 4TKOB 1NMFA 3URYA 2XVSA 4XT1B 1STEA 4RGOS 2JA8H 1EZ8A 5I2YA 5M3MG 1J5EL 1V9PA 3RZDB 3GTLB 3JAMi 3DM1A 1UWVA 4OELB 4FYDA 3CPFA 4G57A 4YWLA 3P75A 2XIWA 3V2TA 3VYRA 1PH1A 3F8TA 4NB3A 5BR8Q 1B2TA 3K7UC 3RN2A 3SR1A 4J15A 4DR2L 3NBHB 2ZM6Q 2HQEA 4HIKA 2CHBD 2TMPA 1A2TA 4LW1A 3NQIA 3V96A 2NTSA 3MA2B 2PQAA 1CKMA 4DV6L 1ZYRD 1D2BA 4IUVA 2KJXA 1B3AA 4DR6L 1Q3LA 1UNSA 2EOTA 2UXCL 2YTXA 3A54A 2ZJPA 4MN3A 1NCVA 2RBMA 2HDLA 2VUMG 1I4GA 2QEJC 3SVMA 1SE2A 2ZTEA 1NAPA 4MIUA 3KBXA 1F2ZA 5IE8A 4YCUA 1N34Q 1J6QA 1HNWL 1E1TA 1EY4A 4DNIA 4CKCA 4DR3L 1GO3E 2VNUD 3RLFA 4WORA 1X6OA 2K52A 2RKSA 2JA5G 2GVBA 4JI3Q 2PI2A 1YZ6A 1BO0A 1G51A 3KK7A 1EFWA 4TQUS 1JE5A 5GAGC 4B9WA 3SHLA 3G6EA 1XMQQ 2E8GA 1JMCA 1RKNA 3HOYG 5ELNA 1KC8C 2QA4A 3GTPB 1D7QA 1STBA 4A3FG 4K8JA 3NWTA 2R61A 2K04A 4QUCA 4C3IG 4CDEC 1F9QA 2HIVA 3EROA 3L0OA 2Q8IB 3Q24A 3OYYA 2VQEQ 3HOVH 1FNVA 1JOQA 1EFID 2JEAI 3I4OA 2R92G 3S2DH 2K5NA 1LTSD 1SLJA 1A62A 1FJGL 2DUDA 3GV6A 3HG9A 1VQJA 3CW2C 3D8GA 4UP7A 5GQOA 3I3CA 3U9OA 1MBYA 5K36H 1YIJA 1KRTA 1XMOQ 3GD7A 2HHHQ 3L7ZC 1JQYD 5FLMG 1E2ZA 4R4QA 4JVZA 4TSSA 4IQZA 1TWCH 1YHAA 3ULJA 4GN4B 3S1RH 1AE2A 4LFCL 4KK7A 2A6ED 5GAHC 3A55A 2F0WA 2DJGC 1Q8IA 1XX8A 1Y8PB 3VA7A 3RUZA 4DUYQ 3BVMA 2ATWA 2BDNA 2KCNA 5ELEA 1BNZA 3GTMB 3FKIH 3RR5A 1QUQA 4K2KA 2E5LL 1VQ6A 3FVQA 2PI2E 4JBMA 4N9PA 3D6WA 2OEOA 4LUZA 4BA1I 1V1QA 2VZAA 3S1MH 2GVAA 4BBRH 3N6RA 1S40A 4L8JA 2ES2A 1SYBA 4K5VA 3E9HA 1IYUA 1B9NA 1A8VA 1S4ZA 2F0VA 1KTKA 3HOVB 5C4XB 2K5WA 1YJ9A 3PO2G 1BBXC 2MGSA 5IGBA 1X3GA 3FP9A 1K8OA 3WOEA 3BVZA 3PMFA 4C3HH 2NB0A 1XPRA 1ML0D 1I4XA 1WJJA 4JI4L 3C2PA 2EYHA 3H6MA 4BBSH 1LTID 1CZGA 2VS1A 2IJ0A 1C48A 3SE0A 5FLXc 1PH3A 3S1RB 2JE6I 1JC7A 2NVTH 2HT1A 1II3A 3IFDA 2BA1A 1HXYD 1F77A 1ET6A 1EIYB 1TIID 3QB3A 1CM9A 1NTGA 4LUVA 2VL6A 4FXGC 3DWQA 2R7FA 1ENCA 5D3DA 1UAPA 2F0JA 3S1MB 1CT1D 4ZUIA 2F4VQ 2EYLA 3V05A 1QNUA 3LX0A 3AEVA 1VQAA 3BDOA 3CRKC 1JWSD 1EY6A 1YNXA 3HOUB 2KOLA 1V8QA 2F0FA 1C8CA 1XPOA 4WJWA 1JT8A 4IUNA 4X62Q 2E2JH 3GTGB 2ID0A 4C1NI 1I3QB 4CDFC 2OCEA 4BXXH 4A3JB 4JI7L 2HQLA 1IBKQ 1GHKA 5I9PA 4PV1C 3CPWA 5KNDA 3A7AB 4YY3L 4BY1G 1AH9A 2UUAL 1BCPD 1I6HH 1G291 1KLGD 2QCPX 4ZQ3A 5EAYA 3C1FA 1S5DD 1OXVA 1SXTA 4CGYB 1KLUD 4AQYL 3F2DA 2NVTB 1WYDA 4P74A 1MGSA 2A68C 2UXDL 3I4LA 3VYSA 4Y7NH 4A3DH 3C3LA 1QB5D 5AJ3L 5G3LF 2VQFQ 1WTVA 1X9NA 5DNFA 3ND8A 1N36Q 5I4DA 4TVAB 3DMUA 4DNRB 4EQNA 4I7ZC 3MTSA 3MFGA 1DXMA 3KLRA 1QCBD 4UP9A 1E3PA 4EQ5A 4A3IB 2UU9Q 1DYQA 5IYCG 4KLKA 3M4PA 4B9XA 5H1SE 4C3JB 1I4HA 4A3EB 5LMNW 2CKZB 4JG2A 1EYGA 2B2WA 4IPHA 1VQGA 2A1AA 2KECA 3J81E 1PH5A 4CDCC 4ZYSA 4LFBQ 3I8ZA 4QIWE 2KEDA 1GUSA 4LF7L 2PNHA 2MFIA 1XNRL 3PO3B 4QL5A 5D65A 5FLXL 1IXRA 4ODGA 3JC66 2RQXA 5M5WH 1YHQA 1EWHA 3H91A 2F0SA 3H0GH 3HS0C 3OPOA 4NXNL 1TY0A 1X3QA 3QJYA 5C44G 4TRDA 4Z9CB 1YJNA 1WTXA 2FMMA 4EGVA 3EQLC 1EEID 1ICWA 1SYFA 3MVVA 1VQHA 4IURA 4KMUC 3CMAA 1SNDA 2D2CC 3CRLC 1SYDA 4A3LG 1EYDA 1WI5A 1V1PA 1VS0A 3I4MB 1BF4A 4Y7NB 2A6HD 1F9RA 2LSSA 3ZYYX 4LF4L 1GUWA 4B08A 2JA7B 2B2YC 3FPPA 2K14A 1BBUA 5ELOA 2L55A 1SNMA 5C0XH 1B44D 3J81i 3K8AA 1X3EA 2OQ0A 1NY4A 3G7LA 4A3CH 1YNJD 3VA5A 3MXGA 4MNOA 1PTOD 2IX0A 3T4AC 3NP8A 3T1HL 2HCIA 2JA6G 3H3VH 2PMZE 1EL0A 4DK3C 3A74A 2JJQA 1TS3A 2KCMA 4NP5A 4ME5A 1JB7A 5JJZA 2VW9A 4JI6L 3HP3A 4HTHA 2SDFA 1WD0A 3OWEB 1YI2A 3HOZB 2NN6H 1JICA 1UEBA 1IBLQ 4ULLA 3UDGA 3H0GB 4POFA 1MSHA 2F3WA 1QJOA 1SE4A 1Y1WG 2AUKA 3I2ZA 3HOXH 2RA4A 3CAMA 2Q8RE 1EQRA 4LF5Q 1Z47A 4J6HA 1BUVT 2K4KA 3HGBA 1B8AA 4JI2Q 4DK1A 3R8BA 3KF8A 4JV5L 4O42A 1ILQA 2AWOA 3GTKB 4IUTA 1JORA 2K7VA 3SK6A 2UUCQ 1STHA 2D62A 3VR3A 2IX1A 5EPLA 2UXBQ 4JI0L 1CZWA 4F87A 2B3GA 1PDQA 3NEMA 4LNQA 2BE5D 4A3BG 2PCFB 3TQYA 1VQCA 2EIFA 5IWAL 3H09A 1A3TA 4AYBB 4IUUA 3E3XA 3IL8A 2LMCB 2O4XA 4KKTA 4Q0FA 1HFGA 1X3FA 4U673 3I70A 1KDBA 4LF6L 3A5ZB 3HFZB 3N52A 3OOCA 1SMYD 1IL2A 4RGNA 1VQNA 2EPBA 3A0JA 3P7JA 1AP0A 1K3RA 2PYKA 2M2LA 5IGFA 3HOXB 1DCZA 1FVIA 5DM73 2AMCB 1OTCA 2R7ZG 5LMUL 2R93B 1CHQD 3CP0A 1YNND 4A3MH 3D6CA 2B63G 5LMNL 1D5MC 3LWUA 1IBML 2J7ZA 3H3VC 4K5XA 4BY7H 4A75A 4X66L 2ENBA 3W3AA 3W2DA 3X3MA 1WTOA 4LWCA 2F0QA 1U4RA 1J5EQ 3PUYA 1CI3M 1FNUA 5IP7H 2OWOA 3K7AB 1SNOA 5D14A 2F0DA 4HJ7A 2QDBA 4CBVA 3S15H 2CWAA 5NUCA 2ICEC 4DK0A 5AFWA 1DM0B 3R3OA 3I4NG 3GTOH 4QGUA 4KHPL 3L2PA 5ISRA 3AU7A 3K58A 4A3GG 5IYDG 5J22A 4DR2Q 2TSSA 2IX3A 4NXML 2Z4HA 2FXQA 4B3SQ 5M3FB 3RLNA 1KQSA 1EWCA 1V1OA 3KF6A 4DV6Q 4OWTB 3J7AF 4XT3B 4ZCKA 4X3KA 4KD4A 4DR6Q 2SEBD 2UXCQ 4YWKA 5M5YH 3J80E 1U4LA 1YEZA 4A3KH 1JCKB 3A8KE 1LTRD 1SNPA 2WKCA 5C3WA 4IFDH 5EBCA 5CORA 3AB9A 3BYTB 1GHJA 3AQQA 2F0MA 1TS4A 1LT5D 1Y69U 2BA0A 1BDOA 3D31A 4ZKCB 3IAYA 1YHBA 1HNWQ 4JI1L 1UE7A 3R93A 4DR3Q 2L11A 3TS0A 2JK8A 1MJCA 4H02A 2F0HA 2N55A 3P1HA 1GVPA 2FFKB 1TWFH 5E7NA 4IUPA 5IYBG 1K8AC 3FHWA 3M7GA 5IT9c 3T1YL 1JJCB 4RWSC 3OTOL 1LV9A 4JI5Q 1WCMB 3K0YA 5FJ8G 3GTOB 3M7NA 4CKEA 5JEAH 3KUPA 1PFMA 4O0AA 1Q12A 3J80i 2D9UA 1STAA 1N33L 1L0WA 4JBKA 3RZDH 3WOFA 3HEJA 3GTLH 1HQRD 1TS2A 2B2UC 4ZRZA 3CQZH 1QVGA 5C3EB 1L0XB 4X3UA 2CWPA 3DWAA 3J7YW 4LF8L 2JA8G 2FHTA 3K5MA 3PIP3 1EY0A 2WB1G 1JJGA 1K28A 1E1OA 1WFQA 2EY1A 1FJGQ 4EX5A 1B50A 4X64L 4FP5D 1EIFA 2B8GA 2OTLA 3P20A 3D4WA 4KTAA 4IPCA 1E22A 4B3TL 3PCOB 3QWNA 5CBAE 1AZQA 4FXDA 3F2BA 2MHVA 1E2WA 2Z6KA 1ESRA 1SYGA 4R8IA 4HSVA 2YYZA 3CCMA 1LM0A 4RH6A 3RN5A 3D3RA 4RCOA 1V43A 4DV4L 1PYWD 2CH4W 1N9WA 2R6GA 4DUZL 1PLFA 1KAAA 4EVOA 1TWGH 4GLXA 2E5LQ 2EYPA 4GKJL 3GP7A 1STGA 4NKLA 3R2TA 3NBIA 4ID6A 1E0BA 2PQAB 2YU9H 2X6LA 2LY7A 3NTKA 3CQZB 4DR1L 1HZBA 3QR8A 4V190 3OSOA 5A2QE 3KLWA 2MUYA 3K5NA 2A68D 2H5XA 1PRTB 1HR0L 2EZVA 3BG3A 4UHVA 5KRUA 1KABA 4MZ9A 4JOIC 5EPJA 3GTPH 1IYVA 3MXNA 3UDXA 2ZXPA 3BU2A 2DNEA 3A8IE 4JI4Q 2IW3A 3A7LA 5E4WC 4JCVE 4K0KL 4XQJA 4KN4C 1IW7C 3CC2A 3BZDB 5IT9L 1HUMA 3UI2A 5C4ZA 1FNWA 2AQ3B 1G6PA 2A69C 5CMDA 2F03A 1TWGB 3BZKA 1NR4A 2JXMB 3ZJYC 1PRTC 4R1JA 1VQ8A 1HTPA 2DJFC 2NZOA 4L5SA 3WDNA 4HMJA 1I4PA 5M3MH 5K36G 2YU9B 2I5LX 3Q22A 2ZXOA 4FXKC 1SNQA 3NBHA 2O5JC 2ALYB 1XTDA 1O7LA 3NTHA 4HCSA 3GTMH 3E6ZX 4XQNA 1RHPA 3FEWX 2AQ2B 3RNUA 1PRTF 5FO8B 4FNFA 1I4QA 2KQ3A 3AMUA 4FO2A 2E2IH 3MC0B 1DJRD 1A3VA 4JI7Q 2Y0SG 4IZ8A 2J0TD 1HNXL 3FKIG 1TWHB 5C4XH 4YY3Q 2F3VA 2QW7A 2UUAQ 1Q1EA 1LUZA 4PMCA 4I7AA 3I56A 1VMCA 3VYUA 1PMRA 4ZKBB 1I5FA 2NVXB 4ZAIA 4RG1A 4BBRG 4AQYQ 3SXHA 1WTRA 1EOVA 4YWMA 1WTQA 5L37A 2UXDQ 5LHY1 4OONA 4KHVA 2CCZA 1O80A 4DK6C 3W1GA 1D6EC 5AJ3Q 3RMHA 2EJFC 4E6IA 4DAYA 1VQEA 3KDFA 3K6OA 4MHEA 4O1NA 4C3HG 1U0LA 4DV2L 5M3MB 2CH4A 1C0AA 1Y8NB 3HKZG 4GNXB 3STBC 1BOSA 1RTNA 3BS1A 4B3RL 2EXDA 1XJVA 3NSWA 2UUBL 4BBSG 1K8GA 5EBDA 4B3ML 2B29A 3VR4A 2OXPA 1GOZA 4HJ5A 2X6GA 3K5LA 1G2SA 3CCJA 3L9AX 3CKIB 1JB3A 3HOYH 4JBJA 2L12A 4A93G 2E2IB 1IKLA 3OMGA 3TSSA 1W6KA 3DM3A 3PGZA 4P73A 1XNRQ 3MEFA 3SEBA 4UDUC 3HOUH 4YHHL 2QKIC 4NXNQ 2ZJRA 2JP1A 2BCOA 1X32A 4RFBA 2I5HA 3WWVA 1AZPA 3GTGH 1GD7A 5FOBB 4WFN3 2K28A 1I3QH 1ICFB 4GNXC 4R4TA 5HURA 2K33A 2VUMB 4A3JH 1O7YA 2XWJB 3CU7A 4IJHA 4HMIA 1K83H 3TN2A 1TR5A 3HOWG 1HA6A 4G7OC 2IHEA 1SSOA 3J7A5 2C35B 1S5CD 2PZTA 2P5ZX 2SNSA 4H7BA 2WB1E 1SJHD 2E75C 3KYHC 4BXXG 1SMXA 1CTMA 4FF4A 4U68A 2PPBC 1VQDA 4KHZA 5C5MA 3GTQB 5IGCA 4LAAA 2JA5B 4QIWB 3EFXD 3T1HQ 3S14B 3ITPA 3F1ZA 1KRSA 1EU4A 2R3ZA 3DLLA 1K3BC 4KY7A 4OEMB 5KGUA 2B2TC 3BDLA 4G4KA 4JI6Q 3HOYB 4K8IA 1H9SA 3K80C 3F2CA 4Q5VA 4OGQC 1I50B 5DEHA 4A3FB 4AH6A 4A3DG 4A3IH 2D0PA 4C3IB 3TP7A 2B39A 3NQTA 1DONA 3PQIA 2MNAA 1HZCA 4C3JH 4A3EH 1E7ZA 1PFBA 3PO2H 1LTGD 2HDMA 4KI0A 4PNYA 2R92B 3NK9A 3CCUA 4DGZA 2IY5B 1I94L 3NUCA 4A4IA 4OX9L 4JV5Q 1K83B 3RD4A 4GOPB 3S16B 3PO3H 4X3SA 2HD3A 2PMZB 4LJZC 2JN4A 4LUOA 1NMGA 2KHJA 4JI0Q 4LMQD 3R2IA 1KD1C 1QVFA 2QDLA 1RF2D 3CHBD 4KKSA 2WV6D 4RCNA 5T1IA 1FR3A 4HCEA 5BN5A 1LYLA 2V4DA 5M5XB 1IKMA 5IWAQ 3OW7A 1GUTA 4DV1Q 1P16A 3I4MH 4OO1I 4XXEA 4KY5A 1XYIA 3OW2A 4R4IA 2VQEL 1LLRD 2B8FA 2JA7H 1Q86C 3NENA 2JA9A 2M00A 4RHRA 5GROA 1QZGA 4QY7A 2OQKA 3KOJA 1QWYA 1VQBA 4LF6Q 1JWUD 1Y1VG 1PH6A 3FPUB 2L9HA 4GOPC 2RCFA 4OO1G 2CFMA 1CHPD 3DXJC 4DU9A 3LNNA 3CCVA 3TEHB 1VQMA 3SK4A 4CDDC 5I6YA 1ET9A 4M8AA 3PO2B 5C0XG 1V1PB 3I73A 2RSNA 5LMUQ 1O7IA 4A3CG 1VMPA 2E2HB 1ZYRC 2WAQG 5LMNQ 3HOZH 1DOKA 1CKNA 2AHOB 2ZTDA 1TVXA 3UDFA 5ELBA 4DUYL 1WTWA 4X66Q 5JAVA 1SE8A 1A15A 4K6DA 5HGQA 4DV7L 3TP5A 3KJOA 3S1QB 1SAPA 1UE6A 5CR3A 1PZKD 3ND9A 1KIXA 4JI8L 1BR9A 4EQPA 3UE0A 2RDHA 2Y0SE 2LFNA 4KV6A 4J8QA 5FO9B 3GTKH 2EVBA 1EY5A 2WP8J 2ZT9C 4C1NK 1QZHA 2A19A 1RODA 4QB4A 4KHPQ 1UE5A 4MTKA 3T51B 3SK5A 2PW5A 1I4RA 4NXMQ 2I07B 2Q2TA 4PG3A 1D5XC 1MHWC 5GAEC 3SK8A 3RZOB 3M9BA 3TS2A 3RLOA 5IYCH 4IJLA 3T16A 2Z4IA 1ILPA 4DPGA 1K9MC 4ZLTF 3TZUA 1CA5A 3KF8B 5FLXE 1CSQA 1H9JA 3GQBA 2FJ2A 3HKZE 1VQKA 1A6XA 1UUPA 2F0OA 2XGTA 2D0OA 2FMCA 5IY0A 4IO9A 4DN4M 3QOLA 4QF4A 1GJXA 4ME3A 4JI1Q 5KYIA 1VQ4A 3ONAB 2H1EA 4BY1B 1MKHA 2MO0A 1AE3A 1G6ZA 3TP8A 2R93H 2J4XA 2F52A 1OO9B 2K50A 4P71A 3MXPA 4X65L 3T1YQ 3OTOQ 2NTTA 4CHTB 3KLSX 4PZ6A 3EA6A 4DR5L 3BYYB 4R8NA 1N33Q 3PV0A 4PMWA 2N3SA 5JPNC 2DY7A 4GZYC 5COYA 3UE1A 2EY2A 4DA2A 5EPKA 4A3MG 4IALA 1JJ2A 3K7AH 3OHXC 4UP8A 3A5UA 2BOSA 1PH8A 2XRQD 2I46A 4BY7G 4LF8Q 2WACA 5CV7A 2F0UA 1BBWA 5HGTA 3JAMc 5IP7G 2K5DA 1U4PA 3I7FA 1ASZA 2LXKA 4OIJA 3QIAA 4L63B 1M1KC 5M3FH 5T1GA 1SYCA 3G71A 2KHIA 4B3TQ 1BKBA 1KNAA 5IGDA 3M4OB 2A73B 3HKSA 1N36L 5C44B 2I5MX 4X3TA 1ENAA 1PV4A 2C5CA 4DV4Q 2UU9L 4DUZQ 2B2VC 3Q6SA 5LL6S 4GKJQ 1W3SA 4JYAL 4DF7A 4A3KG 1BVSA 2L15A 2YV5A 2EYJA 4IFDG 3ERQA 1VQOA 5E3FA 1F2MA 2ZTCA 1TXYA 4NDXA 1Q46A 4FVMA 2NVYB 3KF6B 1HR0W 4DR1Q 2K03A 1WCMH 1BCPB 4YIJA 3TREA 2ASBA 3CCSA 2JA6B 5JPMC 2GN5A 1M4VA 4DR4L 1LTTD 2KVMA 1VDZA 2A8VA 4HSPA 3I90A 3K59A 4DFAA 4XIGS 4BWGB 5CV6A 4LF9L 1HNZL 3U58A 5C3EH 1HZAA 4IPGA 5JEAG 5LL6X 4KJNA 1C9OA 4K0KQ 1HRJA 1L1OB 4S3SA 5EKIA 4C2MB 2G9DA 1X3PA 5DM63 2ZJQA 5KYLA 1CQVA 1SE3A 1Y1WB 1K8MA 5C4JB 1QE6A 1WOCA 4KY6A 4JW0A 1EYAA 1Y8OB 4BA2I 3S9WA 1F9PA 5I6WA 1WTPA 3CC7A 2EQSA 4RGMA 1X54A 2Z6BA 4DV3L 1GXDC 1SNCA 1RCVD 1NBWA 2JQOA 1X65A 2DN8A 3C1EA 5JVH3 2A5HA 5CYUA 2WAQE 4A3BB 3I91A 1EYCA 5IP9G 1QILA 4X6AH 1RL2A 1STYA 2NZHA 1R4QB 3JAML 3OIPA 1L1OC 1PH4A 1X56A 2CQOA 3I4NH 3CCRA 2CQAA 1Q7YC 1MI2A 1VQPA 2KEEA 1XNQL 3A56A 4PMBA 1PFNA 2Q2IA 1SFOB 4N8FA 1JWMD 1CSPA 3J7AV 3MFYA 3EN2A 1HNXQ 4H0LC 3PF5A 4IOCA 1CUKA 2NWGA 2UUCL 5CGKA 2F0GA 2LXJA 4HIDA 5DLQE 2WFWA 4HR7B 1PTOB 2R7ZB 1A63A 2G9HD 3EVQA 4ZK9B 4QJFA 3GO5A 2B63B 3EJIA 1H9RA 4DNTB 1S5BD 5I9OA 1RD9D 1A3UA 4DV2Q 4F7XA 4LFCQ 2A6HC 2EY6A 2IL8A 4XYQA 4B3RQ 4DV0L 3O13A 2Z6KC 2UUBQ 3IFTA 1HZ9A 2KENA 3NTIA 4IUQA 1KXLA 2EJGC 1EY7A 4QMGA 3I4NB 5FJ8H 2MJ8A 1Y14B 5G3LD 1EQVA 2CW0C 2M9VA 1PXUA 1YNJC 5KNBA 1PTOC 1U5KA 3E5SA 4A3GB 2XN9C 2SOBA 2EXZA 1SBBB 1MJEA 4A76A 2XWBB 5EKKA 2NYZD 4YHHQ 1LT3D 3LGJA 3I55A 3GDEA 1HJPA 3QG1A 1EUJA 4WJ3M 1ONLA 4YCWA 1Q82C 2Z0SA 3LWEA 2JSOA 1CKOA 2NZ1D 1TT2A 1PTOF 1L2FA 1Z6HA 4HJ9A 2VB2X 4DR7L 3E0EA 4JOIA 1D8LA 1TWHH 1N8RC 5IGEA 2IWHA 1Q8KA 2VXWA 1UEAB 4MTNA 1W2BA 2HCCA 4OXPA 2O2LD 2NVXH 1IL8A 5D3IB 5I2XA 3S1NH 1NE3A 4GLAC 1PVOA 1KL9A 1RJTA 3HOVG 2F0TA 5C4XG 4B3SL 4JC0A 3ULLA 2F0EA 2L5TA 1H9KA 3OWFA 4EQOA 1B70B 2BE5C 3IRBA 3J81j 2QGQA 3S2HB 4POGA 2SNMA 3UDIA 1EWIA 1A0IA 4RGTA 1PFSA 4L5QA 4AIMA 2K5QA 5J1ZA 4YCVA 4ZUJA 2ICIA 4P75A 2QEXA 2F4IA 4CJ0B 4DAPA 2PNRC 1WVLA 4N9TA 1FD7D 4GKKL 2JA8B 2XRSD 3NXWA 4OL7A 1Q81C 4WJ4A 2WB1B 1SMYC 2WIIB 3TMEA 1I94Q 2V1CC 3EIVA 3CC4A 1ZKOA 4OX9Q 2NBFA 2N88A 1PYSB 4FDBA 1SEBD 5FKAC 5ELCA 4P72A 4DAYB 1GKHA 3KDFB 4JI5L 4OHJA 1GUOA 5IT9E 1R9TH 4K5WA 2XNAC 1EIHA 4HJAA 1YNNC 3S1NB 3SDZA 1HA5A 1NJIC 2LKVA 4K6LA 5J3BA 2VUMH 4Y52H 1IZ6A 1QUQB 3X3NA 5IIFA 3HOUG 1HCZA 2HIXA 3VR2A 1CFMA 1VQ7A 4L5TA 3G48A 2AQ1B 2AKWB 1K0RA 2WINB 4LFAL 3PUXA 3D4RA 1KAWA 1PHJA 1NSNS 2RHQB 1Z7TA 1ZXTA 3MAQA 3AFQA 3NE5B 3CCEA 4HN7A 1F9SA 3PUWA 5BN4A 2N78A 1VF7A 4XYOA 1TWAH 1M8AA 2A74C 4A3JG 1VQ5A 3GTQH 4R4CA 1B4OA 2N49A 2JA5H 2CVRA 1A2UA 2Q8TA 4RHSA 3S14H 3G4SA 2MP1A 2F3IA 3KFUA 2ZXRA 5C6AA 3J81c 1HH2P 2EY5A 1B7YB 1OXUA 1AW7A 1N32L 4DV5L 2N8NA 2EE1A 2BH2A 3PSIA 1PYBA 5KNCA 3FMCA 1HPCA 1I50H 4A3FH 4LF7Q 4G7ZC 1OXXK 4C3IH 5C0XJ 3ICEA 1VQ9A 4NPSA 4NW2A 1R9TB 1PZID 2MQHA 2E2DC 4DV7Q 4UPAA 5CC4A 4KN7C 1HQMC 2R92H 4JI8Q 3W1BA 1VQIA 5ELDA 4A3IG 4J1MA 2EYOA 3OIQA 3S24A 3CXCA 2QILA 4L6TB 1ZEQX 3S16H 4C3JG 4GNXA 4A3EG 4CJ1B 4LF4Q 1F2YA 1AEXA 3IKJA 1H9SB 5BR8L 5FLMH 3S2DB 3OMCA 1SR3A 1EOTA 1TWAB 3F2UA 4O2DA 1TY2A 2ZM6L 4R9WA 5M5XH 5CBEE 2BH8A 3PO3G 3ER0A 2RDGA 3VDYA 1SJED 2JYOA 3U50C 4QUFA 4RA8A 1U4MA 3NWSA 3CMEA 1NR2A 1E24A 3M3YH 1FL0A 4KJOA 1Q1BA 1TWCB 2Z1CA 1EQQA 2KCCA 2KUMA 4RMFA 3KBGA 3I4MG 4A93H 1GUGA 2XSCA 2B2TA 2Y0SB 5CV4A 4UAIA 5GADC 2JA7G 2KBNA 3FKIB 1N34L 2FINB 1TU2B 1XXGA 1LACA 1S3OA 3EBEA 3VR5A 2E2HH 2E76C 4BBRB 4X65Q 4JI3L 3VR6A 1DD2A 3PIOA 1R4PB 3B6YA 2EDGA 3D4DA 4JK1C 4KD3A 1K73C 1T9HA 1XMQL 3TP6A 4DR5Q 3HOWH 2EJMA 5IODA 3S1QH 5FO7B 4DAMA 1EQTA 2MO1A 3HOZG 4DKAC 4C3HB 4RAUC 1PH9A 1CK1A 3HKZB 4NMZA 2G5DA 2GA4B 1RDPD 1Z9FA 3H0GG 3GV3A 3J81L 1XWEA 4BBSB 2IT1A 3M3YB 1RTOA 2F0IA 5C0XI 4K14A 4V0BA 3U4ZA 1CKNB 2EYMA 1MD2D 1SYEA 1BXTA 2AWNA 1CA6A 4A93B 3H3VI 3RZOH 1XMOL 2HHHL 1FYCA 2YTYA 1DZ1A 1IHZA 5JJIA 4GOPA 4KKUA 1DOMA 1EU3A 3CCLA 3DWPA 2NN6I 1YITA 3PUVA 3DEOA 1ASYA 1F2LA 2E74C 5CV8A 1IBMQ 4AYBG 3MXUA 2B2WC 1VF5C 2F1MA 1LABA 3QOJA 2X69A 5IOCA 3HOWB 2L0CA 5EQ0A 4JYAQ 5FK9C 4BY1H 1U9RA 2KCTA 2E2JB 3A8JE 2NN6G 1M90C 5C5LA 2KHSA 4I65A 5DAUA 1LTAD 2OTJA 2K5HA 4IFDJ 1FGBD 1WTHA 3K5OA 2IPKD 3KLSA 3BDCA 3QO2A 3HOXG 5CV5A 2F0LA 4DR4Q 1I6HB 1SROA 4DAVA 1SRUA 2R93G 1BQQT 2F0KA 3T53B 3U4VA 3BJUA 4DXFA 1C7YA 1D5ZC 1KNEA 2PZUA 4LF9Q 2B2YA 1HNZQ 1LT6D 4A3DB 3J80c 1Y1VH 1TQOA 3SGIA 2PO4A 4XTCS 4QQBX 4OO1H 1OXTA 1AFPA 2AUJD 1QOHA 5JEAJ 1T5XD 2CW0D 2LS01 4R4OA 1UE1A 2RF4A 1W6JA 4WRDA 1PZJD 4IPDA 4DXGA 3M85A 3M4OH 2K6AA 1KHIA 4LK1C 4DV3Q 4FF1A 2I0QA 5BN3A 2MPMA 1B1ZA 5C44H 4P2CB 1T5EA 1JR0D 5TSSA 1C4QA 1JE4A 5M3FG 4OIKA 2F4VL 1B3QA 4F88A 3VYTA 1HFNA 1VQFA 3PUZA 4A3LH 1TKWB 4PQXA 5CV9A 5M5WB 4N8X1 1PH2A 3PF4A 4H13C 3S17H 4HJ8A 2VY3A 3E9IA 2PQEA 2L4NA 2A6EC 3PIPA 4HAEA 4X62L 1XNQQ 3K81C 1MSGA 3MEHA 3NELA 2NVYH 1YVCA 4XQQA 1I6VC 1IW7D 1B9MA 1XTCD 4ABNA 1IBKL 1Y1VB 1STNA 3FDTA 2JA6H 2A69D 3H15A 3NHHA 2Z9HA 1H95A 2IHFA 3ERSX 5E4XA 1OXSC 4X64Q 1PRTD 3L3OC 1S5FD 1QNKA 1QG7A 1NUCA 1WCMG 3BZCA 2RCNA 3PIO3 4HIOA 3HRZC 2WAQB 4DV1L 1P8LA 2PZWA 3M4QA 4PZ7A 1SDFA 1KDCA 2KA7A 2BDOA 5EGTA 4C2MH 2NVQH 4IFDI 1K0SA 3MHBA 2VQFL 1D1KA 5A35A 1Y1WH 1GUNA 5C4JH 2YTVA 4DV0Q 1MIUA 1LTLA 5C3EG 3DUZA 3GTJH 3Q0AA 3TBIB 1HHVA 2H4OA 3HZXA 5HY6A 3E0JA 3NPPA 3U9SA 2DGYA 2DY8A 4IOAA 3S17B 4XDXA 5JOBA 2F0NA 3MWYW 2C9OA 2R7DA 3CF5A 2Z8LA 2B2VA 4OWWB 1JOOA 5E1FA 4APVA 5J39A 3J80L 2K75A 4LFBL 5K5PA 4A3BH 1CQFA 3TDQA 1DOLA 1VQLA 2DNCA 4K2LA 1HR0Q 2O5IC 4G7HC 2K05A 4FF2A 3FRPB 5C4HA 1AN8A 5ELFA 3D0FA 3KJPA 4HEDA 1SFOH 4DR7Q 3DHQA 4H44C 2VB3X 4F8MA 3STBD 1X55A 1LTBD 4CJ2C 2NVQB 4PZ8A 1B53A 4QCLA 3J7ZC 5M9OA 1RIPA 3DEPA 3ULPA 1PTOH 2R7ZH 2HUGA 3GTJB 1WD1A 1Q90A 2NUCA 3C46A 1BCPC 4GS3A 2B63H 1G8ZD 1HTLD 1S72A 1ESFA 5EJWA 5KEEA 2K5VA 4OWXB 2K01A 3Q23A 1O7ZA 1NNXA 5KIXA 1EY9A 3K0XA 4A3MB 1L0YB 3CCQA 2K32A 4AYBE
chains in the Genus database with same CATH topology
4L5QA 2D0PA 4AIMA 1UEBA 4YCVA 1YJWA 4P75A 1IBLQ 1IBLL 2QEXA 3UDGA 4POFA 2MNAA 1HZCA 4GKKQ 4C3JH 4A3EH 4GKKL 3AFPA 1Y1WG 3I2ZA 1E7ZA 3HOXH 3CAMA 3PO2H 1Q81C 1EQRA 4WJ4A 4L5RC 4LF5Q 4KI0A 4LF5L 1L1OA 1Z47A 4A3GH 1FGUA 2K4KA 5IYDH 3CCUA 1I94Q 2IY5B 1B8AA 2V1CC 3EIVA 4JI2Q 1I94L 3CC4A 1GM5A 4JI2L 4OX9Q 4A4IA 1PYSB 4OX9L 4FDBA 4JV5Q 4HIMA 4JV5L 5JJKA 4GOPB 4P72A 4DAYB 1GKHA 3PO3H 2AWOA 1IYJB 3KDFB 4JI5L 2UUCQ 1R9TH 3AYHB 4LUOA 2D62A 2IX1A 1NMGA 2KHJA 4HJAA 4JI0Q 2UXBQ 1KD1C 4JI0L 1QVFA 2UXBL 4UY8C 2B3GA 4ALPA 3NEMA 4LNQA 1LYLA 4A3BG 1NJIC 5J3BA 2VUMH 4Y52H 3TQYA 1IZ6A 1VQCA 2EIFA 4GN5A 5IWAQ 2RHSB 5IWAL 4DV1Q 1QUQB 1P16A 1XPUA 3HOUG 3I4MH 2HIXA 1SN8A 1DGSA 1YBYA 1VQ7A 4OO1I 4L5TA 3G48A 2AKWB 1K0RA 4LFAQ 3TRZA 3OW2A 4LFAL 1VCIA 3PUXA 2XTIA 1KAWA 4JBWA 2RHQB 4R4IA 2VQEL 1PHJA 2JA7H 3AFQA 1Q86C 3CCEA 3NENA 2JA9A 3PUWA 2N78A 5GROA 1QZGA 1TWAH 4QY7A 4GN3B 2OQKA 1X3FA 3KOJA 4A3JG 1QVCA 1PH7A 1VQ5A 1VQBA 4GLVB 4LF6Q 3GTQH 4R4CA 4LF6L 3A5ZB 2N49A 1Y1VG 3HFZB 1PH6A 5IYBH 4GOPC 2JA5H 1IL2A 1VQNA 3CD6A 3S14H 3G4SA 4B3MQ 2CFMA 2F3IA 4OO1G 3A0JA 2JEBI 3Q8DA 5IP9H 3CCVA 3KFUA 3TEHB 1VQMA 1K3RA 3MXNB 3J81c 4GKJQ 1FVIA 1HH2P 2AMCB 5C0XG 1OTCA 2Q2UA 3S2HH 1B7YB 1OXUA 1N32Q 5JJLA 4DV5Q 1PA6A 2R7ZG 1N32L 4DV5L 2N8NA 5LMUQ 2BH2A 5LMUL 3PSIA 1O7IA 4A3CG 1PYBA 3CP0A 4A3MH 2WAQG 2Q2HA 5LMNQ 1I50H 5LMNL 4A3FH 2B63G 4LF7Q 1CKNA 3HOZH 2AHOB 3W5OA 1IBML 1OXXK 4C3IH 2ZTDA 3UDFA 5C0XJ 3ICEA 1VQ9A 4JYAQ 1NMFA 4NPSA 4DUYL 4BY7H 4A75A 2MQHA 4X66Q 2JA8H 4X66L 1SE8A 4UPAA 4DV7Q 5HGQA 4LWCA 5M3MG 3KJOA 4DV7L 1J5EQ 3PUYA 1UE6A 1J5EL 1V9PA 2R92H 4JI8Q 5IP7H 1KIXA 4JI8L 3W1BA 2OWOA 3JAMi 1VQIA 3UE0A 4A3IG 4HJ7A 1UWVA 3S24A 2Y0SE 3CPFA 3CXCA 3S16H 3S15H 2CWAA 4YWLA 3GTKH 4GNXA 4A3EG 4LF4Q 3I4NG 2WP8J 1QZHA 3GTOH 2A19A 3F8TA 4QGUA 1PH1A 4NB3A 5BR8Q 4KHPQ 5BR8L 4KHPL 5FLMH 3L2PA 1UE5A 3K7UC 3RN2A 1SR3A 4A3GG 4J15A 5IYDG 4DR2Q 4O2DA 4DR2L 4NXMQ 3NBHB 2ZM6Q 4NXML 2ZM6L 5M5XH 4HIKA 2BH8A 2Q2TA 4LW1A 3PO3G 4PG3A 2FXQA 3ER0A 4B3SQ 5GAEC 3RLNA 1KQSA 3VDYA 3KF6A 2PQAA 3M9BA 1CKMA 4OWTB 3U50C 4DV6Q 4DV6L 3TS2A 3RLOA 5IYCH 3CMEA 4DR6Q 4IJLA 4DR6L 1E24A 3M3YH 2UXCQ 4YWKA 5M5YH 2UXCL 1FL0A 2YTXA 4DPGA 1K9MC 1YEZA 2ZJPA 4A3KH 1Q1BA 1EQQA 3KF8B 2VUMG 1CSQA 4RMFA 3HKZE 3I4MG 1VQKA 4IO9A 2XGTA 2D0OA 4A93H 5IY0A 3AQQA 2ZTEA 5IE8A 2BA0A 2JA7G 5GADC 2KBNA 3D31A 4YCUA 1YHBA 4ME3A 4JI1Q 1VQ4A 1N34Q 4JI1L 1HNWQ 1J6QA 1UE7A 1N34L 1HNWL 1E1TA 1MKHA 4DR3Q 3TS0A 4DNIA 2MO0A 1S3OA 2JK8A 4DR3L 1MJCA 1AE3A 1GO3E 3EBEA 4H02A 1GVPA 3RLFA 5E7NA 1TWFH 2VNUD 2R93H 1X6OA 2E2HH 2K52A 5IYBG 1K8AC 2JA5G 2F52A 3FHWA 2GVBA 2K50A 4P71A 4X65Q 4JI3Q 2PI2A 1YZ6A 4JI3L 5IT9c 4X65L 3PIOA 1G51A 3OTOQ 3T1YQ 1JJCB 3B6YA 3OTOL 3T1YL 4TQUS 1EFWA 1JE5A 5GAGC 4JI5Q 5FJ8G 4PZ6A 3G6EA 3M7NA 1K73C 1T9HA 2E8GA 1XMQQ 1JMCA 1XMQL 4O0AA 4DR5Q 3HOWH 1Q12A 3J80i 4DR5L 1N33Q 3HOYG 3PV0A 1N33L 5ELNA 4PMWA 1KC8C 2N3SA 2QA4A 3S1QH 4DAMA 3UE1A 1L0WA 4JBKA 4A3MG 2MO1A 1JJ2A 3K7AH 3RZDH 3GTLH 3HOZG 4DKAC 4A3FG 1D7QA 1PH9A 4UP8A 3CQZH 1QVGA 3A5UA 2HIVA 1Z9FA 3H0GG 1PH8A 4BY7G 2CWPA 3L0OA 4LF8Q 4LF8L 2JA8G 3OYYA 2VQEQ 3HOVH 2IT1A 1BBWA 2JEAI 3I4OA 3JAMc 5C0XI 2R92G 3S2DH 2WB1G 2K5NA 5IP7G 1SLJA 1E1OA 1WFQA 1FJGQ 3U4ZA 1A62A 1FJGL 1CKNB 2DUDA 4EX5A 1VQJA 4X64L 1EIFA 3I7FA 2AWNA 3CW2C 1ASZA 4UP7A 2LXKA 5GQOA 2OTLA 3H3VI 1YIJA 4IPCA 5M3FH 1M1KC 1KRTA 1XMOQ 3RZOH 1XMOL 3GD7A 2HHHQ 3G71A 2KHIA 4B3TQ 1BKBA 1E22A 2YTYA 3L7ZC 3PCOB 2HHHL 4B3TL 1JJGA 5FLMG 3F2BA 4R4QA 5JJIA 2Z6KA 4GOPA 2YYZA 3HKSA 1TWCH 1N36L 3CCLA 1YHAA 3ULJA 2NN6I 1LM0A 4GN4B 3CCMA 3RN5A 3S1RH 3PUVA 1AE2A 1YITA 4LFCL 1ASYA 2I5MX 5GAHC 1IBMQ 4AYBG 1V43A 1PV4A 4DV4Q 4DV4L 2UU9L 4DUZQ 1N9WA 2R6GA 4DUYQ 4DUZL 2ATWA 1TWGH 3FKIH 4GLXA 3RR5A 2E5LQ 1QUQA 1W3SA 2E5LL 4A3KG 4JYAL 1BVSA 1VQ6A 4GKJL 4BY1H 2L15A 2YV5A 4IFDG 2PI2E 2KCTA 4JBMA 1VQOA 2ZTCA 2NN6G 1TXYA 1M90C 1Q46A 4LUZA 4BA1I 1V1QA 3KF6B 2PQAB 2VZAA 1HR0W 2YU9H 2GVAA 3S1MH 4BBRH 4DR1Q 4DR1L 2OTJA 1S40A 1HZBA 2K5HA 4IFDJ 2ES2A 4A3DG 1WCMH 3E9HA 3KLWA 1A8VA 3TREA 2ASBA 3CCSA 3HOXG 1YJ9A 2H5XA 3PO2G 2GN5A 4DR4Q 1SROA 1HR0L 4DR4L 1X3GA 1SRUA 3FP9A 2R93G 4MZ9A 4JOIC 2A8VA 3U4VA 3BJUA 3GTPH 1C7YA 3UDXA 4C3HH 4XIGS 4LF9Q 3BU2A 1HNZQ 4LF9L 1XPRA 1HNZL 3U58A 5C3EH 4JI4Q 1HZAA 1WJJA 4IPGA 1Y1VH 5JEAG 3J80c 4JI4L 3SGIA 4JCVE 1C9OA 4XTCS 4BBSH 4K0KQ 4QQBX 4K0KL 1L1OB 1OXTA 2VS1A 5FLXc 1PH3A 2ZJQA 3CC2A 2JE6I 5JEAJ 5C4XG 1WOCA 2HT1A 2NVTH 4R4OA 1G6PA 1UE1A 2RF4A 4BA2I 2BA1A 1EIYB 4IPDA 3BZKA 3CC7A 3ZJYC 2EQSA 4R1JA 3M85A 3M4OH 1NTGA 1KHIA 4LUVA 4DV3Q 1X54A 2VL6A 4DV3L 1VQ8A 2I0QA 2NZOA 4L5SA 2JQOA 1NBWA 2R7FA 5C44H 5M3MH 1X65A 5K36G 2I5LX 5M3FG 2F4VQ 2F4VL 2WAQE 1VQFA 3PUZA 3AEVA 5IP9G 1VQAA 4A3LH 1RL2A 4X6AH 1YNXA 2ALYB 2NZHA 1XTDA 1PH2A 3PF4A 1L1OC 1PH4A 3S17H 4HJ8A 2VY3A 1X56A 3E9IA 3GTMH 1XPOA 2CQOA 3I4NH 1JT8A 3PIPA 4X62Q 3CCRA 3RNUA 2E2JH 4X62L 1Q7YC 1XNQQ 2ID0A 3K81C 1VQPA 1XNQL 2E2IH 2OCEA 2NVYH 1YVCA 2Q2IA 3NELA 4BXXH 4JI7Q 1CSPA 2Y0SG 4JI7L 2HQLA 1IBKQ 1IBKL 3EN2A 1HNXQ 3CPWA 1HNXL 3FKIG 5C4XH 4YY3Q 4YY3L 2JA6H 3PF5A 4BY1G 4IOCA 3H15A 1CUKA 1Q1EA 1LUZA 2UUAQ 2UUAL 2UUCL 1I6HH 1AH9A 1G291 5EAYA 1H95A 3I56A 2IHFA 3ERSX 1OXSC 2LXJA 1OXVA 4X64Q 4HIDA 1I5FA 5DLQE 2WFWA 4RG1A 4BBRG 4AQYQ 4AQYL 3F2DA 1EOVA 4YWMA 1A63A 1WYDA 4P74A 2UXDQ 2UXDL 1WCMG 3BZCA 2RCNA 4OONA 4QJFA 4HIOA 3GO5A 4DV1L 2CCZA 4Y7NH 4A3DH 4DK6C 1P8LA 3W1GA 3M4QA 4PZ7A 5AJ3Q 5AJ3L 4C2MH 2NVQH 2VQFQ 1VQEA 1X9NA 4IFDI 2VQFL 3KDFA 1N36Q 1Y1WH 4DV2Q 4AH6A 4TVAB 1U0LA 4DV2L 4LFCQ 5C4JH 2YTVA 1C0AA 3HKZG 4GNXB 4DV0Q 1MIUA 1LTLA 3STBC 4DV0L 4B3RQ 4B3RL 5C3EG 3GTJH 2EXDA 4UP9A 1E3PA 4EQ5A 2UU9Q 2Z6KC 2UUBQ 1XJVA 5IYCG 5HY6A 2UUBL 4BBSG 1HZ9A 2KENA 1KXLA 1K8GA 2DGYA 4B3ML 4IOAA 4KLKA 3M4PA 2B29A 5H1SE 5FJ8H 5LMNW 2CKZB 4JG2A 1EYGA 4HJ5A 1Y14B 2R7DA 4IPHA 3CCJA 3CF5A 4OWWB 1VQGA 2A1AA 3HOYH 4JBJA 4A93G 1U5KA 4APVA 1PH5A 2K75A 4LFBQ 3DM3A 4LFBL 4QIWE 3PGZA 4P73A 1MJEA 4A3BH 4A76A 1XNRQ 4LF7L 2PNHA 2MFIA 3MEFA 1VQLA 4QL5A 1XNRL 1IXRA 1YHQA 3JC66 5M5WH 3HOUH 4YHHQ 4YHHL 4NXNQ 3H0GH 3LGJA 4NXNL 2ZJRA 1HR0Q 3I55A 3GDEA 1HJPA 5C44G 2I5HA 3WWVA 1YJNA 3GTGH 3KJPA 1EUJA 1GD7A 3D0FA 4WJ3M 1I3QH 4GNXC 4YCWA 1SFOH 1VQHA 4R4TA 1Q82C 2Z0SA 3CMAA 4A3LG 1CKOA 4A3JH 1WI5A 1VS0A 1L2FA 4DR7Q 4IJHA 4HJ9A 4DR7L 1K83H 3E0EA 4JOIA 1D8LA 3STBD 3HOWG 2LSSA 1TWHH 1X55A 1N8RC 4LF4L 2IHEA 1Q8KA 3J7A5 2C35B 4PZ8A 4MTNA 1W2BA 3J7ZC 2WB1E 2K14A 1BBUA 4OXPA 5ELOA 1RIPA 3KYHC 4BXXG 2NVXH 3S1NH 1SMXA 3ULPA 3J81i 1NE3A 1X3EA 3K8AA 2R7ZH 4GLAC 2OQ0A 1NY4A 1VQDA 4KHZA 1PVOA 4A3CH 1KL9A 4MNOA 2IX0A 4GS3A 3T1HQ 2B63H 3T1HL 4JC0A 4B3SL 2JA6G 3HOVG 3ULLA 2PMZE 3F1ZA 1KRSA 3H3VH 1S72A 4DK3C 3A74A 2JJQA 3DLLA 1B70B 2KCMA 3IRBA 3J81j 2QGQA 2K5VA 4OWXB 1JB7A 4POGA 2VW9A 4JI6Q 4JI6L 3UDIA 3K80C 3F2CA 3K0XA 1EWIA 1A0IA 1YI2A 3CCQA 1PFSA 4A3IH 4AYBE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L5Q A;  2D0P A;  4AIM A;  1UEB A;  4YCV A;  1YJW A;  4P75 A;  1IBL Q;  1IBL L;  2QEX A;  3UDG A;  4POF A;  2MNA A;  1HZC A;  4GKK Q;  4C3J H;  4A3E H;  4GKK L;  3AFP A;  1Y1W G;  3I2Z A;  1E7Z A;  3HOX H;  3CAM A;  3PO2 H;  1Q81 C;  1EQR A;  4WJ4 A;  4L5R C;  4LF5 Q;  4KI0 A;  4LF5 L;  1L1O A;  1Z47 A;  4A3G H;  1FGU A;  2K4K A;  5IYD H;  3CCU A;  1I94 Q;  2IY5 B;  1B8A A;  2V1C C;  3EIV A;  4JI2 Q;  1I94 L;  3CC4 A;  1GM5 A;  4JI2 L;  4OX9 Q;  4A4I A;  1PYS B;  4OX9 L;  4FDB A;  4JV5 Q;  4HIM A;  4JV5 L;  5JJK A;  4GOP B;  4P72 A;  4DAY B;  1GKH A;  3PO3 H;  2AWO A;  1IYJ B;  3KDF B;  4JI5 L;  2UUC Q;  1R9T H;  3AYH B;  4LUO A;  2D62 A;  2IX1 A;  1NMG A;  2KHJ A;  4HJA A;  4JI0 Q;  2UXB Q;  1KD1 C;  4JI0 L;  1QVF A;  2UXB L;  4UY8 C;  2B3G A;  4ALP A;  3NEM A;  4LNQ A;  1LYL A;  4A3B G;  1NJI C;  5J3B A;  2VUM H;  4Y52 H;  3TQY A;  1IZ6 A;  1VQC A;  2EIF A;  4GN5 A;  5IWA Q;  2RHS B;  5IWA L;  4DV1 Q;  1QUQ B;  1P16 A;  1XPU A;  3HOU G;  3I4M H;  2HIX A;  1SN8 A;  1DGS A;  1YBY A;  1VQ7 A;  4OO1 I;  4L5T A;  3G48 A;  2AKW B;  1K0R A;  4LFA Q;  3TRZ A;  3OW2 A;  4LFA L;  1VCI A;  3PUX A;  2XTI A;  1KAW A;  4JBW A;  2RHQ B;  4R4I A;  2VQE L;  1PHJ A;  2JA7 H;  3AFQ A;  1Q86 C;  3CCE A;  3NEN A;  2JA9 A;  3PUW A;  2N78 A;  5GRO A;  1QZG A;  1TWA H;  4QY7 A;  4GN3 B;  2OQK A;  1X3F A;  3KOJ A;  4A3J G;  1QVC A;  1PH7 A;  1VQ5 A;  1VQB A;  4GLV B;  4LF6 Q;  3GTQ H;  4R4C A;  4LF6 L;  3A5Z B;  2N49 A;  1Y1V G;  3HFZ B;  1PH6 A;  5IYB H;  4GOP C;  2JA5 H;  1IL2 A;  1VQN A;  3CD6 A;  3S14 H;  3G4S A;  4B3M Q;  2CFM A;  2F3I A;  4OO1 G;  3A0J A;  2JEB I;  3Q8D A;  5IP9 H;  3CCV A;  3KFU A;  3TEH B;  1VQM A;  1K3R A;  3MXN B;  3J81 c;  4GKJ Q;  1FVI A;  1HH2 P;  2AMC B;  5C0X G;  1OTC A;  2Q2U A;  3S2H H;  1B7Y B;  1OXU A;  1N32 Q;  5JJL A;  4DV5 Q;  1PA6 A;  2R7Z G;  1N32 L;  4DV5 L;  2N8N A;  5LMU Q;  2BH2 A;  5LMU L;  3PSI A;  1O7I A;  4A3C G;  1PYB A;  3CP0 A;  4A3M H;  2WAQ G;  2Q2H A;  5LMN Q;  1I50 H;  5LMN L;  4A3F H;  2B63 G;  4LF7 Q;  1CKN A;  3HOZ H;  2AHO B;  3W5O A;  1IBM L;  1OXX K;  4C3I H;  2ZTD A;  3UDF A;  5C0X J;  3ICE A;  1VQ9 A;  4JYA Q;  1NMF A;  4NPS A;  4DUY L;  4BY7 H;  4A75 A;  2MQH A;  4X66 Q;  2JA8 H;  4X66 L;  1SE8 A;  4UPA A;  4DV7 Q;  5HGQ A;  4LWC A;  5M3M G;  3KJO A;  4DV7 L;  1J5E Q;  3PUY A;  1UE6 A;  1J5E L;  1V9P A;  2R92 H;  4JI8 Q;  5IP7 H;  1KIX A;  4JI8 L;  3W1B A;  2OWO A;  3JAM i;  1VQI A;  3UE0 A;  4A3I G;  4HJ7 A;  1UWV A;  3S24 A;  2Y0S E;  3CPF A;  3CXC A;  3S16 H;  3S15 H;  2CWA A;  4YWL A;  3GTK H;  4GNX A;  4A3E G;  4LF4 Q;  3I4N G;  2WP8 J;  1QZH A;  3GTO H;  2A19 A;  3F8T A;  4QGU A;  1PH1 A;  4NB3 A;  5BR8 Q;  4KHP Q;  5BR8 L;  4KHP L;  5FLM H;  3L2P A;  1UE5 A;  3K7U C;  3RN2 A;  1SR3 A;  4A3G G;  4J15 A;  5IYD G;  4DR2 Q;  4O2D A;  4DR2 L;  4NXM Q;  3NBH B;  2ZM6 Q;  4NXM L;  2ZM6 L;  5M5X H;  4HIK A;  2BH8 A;  2Q2T A;  4LW1 A;  3PO3 G;  4PG3 A;  2FXQ A;  3ER0 A;  4B3S Q;  5GAE C;  3RLN A;  1KQS A;  3VDY A;  3KF6 A;  2PQA A;  3M9B A;  1CKM A;  4OWT B;  3U50 C;  4DV6 Q;  4DV6 L;  3TS2 A;  3RLO A;  5IYC H;  3CME A;  4DR6 Q;  4IJL A;  4DR6 L;  1E24 A;  3M3Y H;  2UXC Q;  4YWK A;  5M5Y H;  2UXC L;  1FL0 A;  2YTX A;  4DPG A;  1K9M C;  1YEZ A;  2ZJP A;  4A3K H;  1Q1B A;  1EQQ A;  3KF8 B;  2VUM G;  1CSQ A;  4RMF A;  3HKZ E;  3I4M G;  1VQK A;  4IO9 A;  2XGT A;  2D0O A;  4A93 H;  5IY0 A;  3AQQ A;  2ZTE A;  5IE8 A;  2BA0 A;  2JA7 G;  5GAD C;  2KBN A;  3D31 A;  4YCU A;  1YHB A;  4ME3 A;  4JI1 Q;  1VQ4 A;  1N34 Q;  4JI1 L;  1HNW Q;  1J6Q A;  1UE7 A;  1N34 L;  1HNW L;  1E1T A;  1MKH A;  4DR3 Q;  3TS0 A;  4DNI A;  2MO0 A;  1S3O A;  2JK8 A;  4DR3 L;  1MJC A;  1AE3 A;  1GO3 E;  3EBE A;  4H02 A;  1GVP A;  3RLF A;  5E7N A;  1TWF H;  2VNU D;  2R93 H;  1X6O A;  2E2H H;  2K52 A;  5IYB G;  1K8A C;  2JA5 G;  2F52 A;  3FHW A;  2GVB A;  2K50 A;  4P71 A;  4X65 Q;  4JI3 Q;  2PI2 A;  1YZ6 A;  4JI3 L;  5IT9 c;  4X65 L;  3PIO A;  1G51 A;  3OTO Q;  3T1Y Q;  1JJC B;  3B6Y A;  3OTO L;  3T1Y L;  4TQU S;  1EFW A;  1JE5 A;  5GAG C;  4JI5 Q;  5FJ8 G;  4PZ6 A;  3G6E A;  3M7N A;  1K73 C;  1T9H A;  2E8G A;  1XMQ Q;  1JMC A;  1XMQ L;  4O0A A;  4DR5 Q;  3HOW H;  1Q12 A;  3J80 i;  4DR5 L;  1N33 Q;  3HOY G;  3PV0 A;  1N33 L;  5ELN A;  4PMW A;  1KC8 C;  2N3S A;  2QA4 A;  3S1Q H;  4DAM A;  3UE1 A;  1L0W A;  4JBK A;  4A3M G;  2MO1 A;  1JJ2 A;  3K7A H;  3RZD H;  3GTL H;  3HOZ G;  4DKA C;  4A3F G;  1D7Q A;  1PH9 A;  4UP8 A;  3CQZ H;  1QVG A;  3A5U A;  2HIV A;  1Z9F A;  3H0G G;  1PH8 A;  4BY7 G;  2CWP A;  3L0O A;  4LF8 Q;  4LF8 L;  2JA8 G;  3OYY A;  2VQE Q;  3HOV H;  2IT1 A;  1BBW A;  2JEA I;  3I4O A;  3JAM c;  5C0X I;  2R92 G;  3S2D H;  2WB1 G;  2K5N A;  5IP7 G;  1SLJ A;  1E1O A;  1WFQ A;  1FJG Q;  3U4Z A;  1A62 A;  1FJG L;  1CKN B;  2DUD A;  4EX5 A;  1VQJ A;  4X64 L;  1EIF A;  3I7F A;  2AWN A;  3CW2 C;  1ASZ A;  4UP7 A;  2LXK A;  5GQO A;  2OTL A;  3H3V I;  1YIJ A;  4IPC A;  5M3F H;  1M1K C;  1KRT A;  1XMO Q;  3RZO H;  1XMO L;  3GD7 A;  2HHH Q;  3G71 A;  2KHI A;  4B3T Q;  1BKB A;  1E22 A;  2YTY A;  3L7Z C;  3PCO B;  2HHH L;  4B3T L;  1JJG A;  5FLM G;  3F2B A;  4R4Q A;  5JJI A;  2Z6K A;  4GOP A;  2YYZ A;  3HKS A;  1TWC H;  1N36 L;  3CCL A;  1YHA A;  3ULJ A;  2NN6 I;  1LM0 A;  4GN4 B;  3CCM A;  3RN5 A;  3S1R H;  3PUV A;  1AE2 A;  1YIT A;  4LFC L;  1ASY A;  2I5M X;  5GAH C;  1IBM Q;  4AYB G;  1V43 A;  1PV4 A;  4DV4 Q;  4DV4 L;  2UU9 L;  4DUZ Q;  1N9W A;  2R6G A;  4DUY Q;  4DUZ L;  2ATW A;  1TWG H;  3FKI H;  4GLX A;  3RR5 A;  2E5L Q;  1QUQ A;  1W3S A;  2E5L L;  4A3K G;  4JYA L;  1BVS A;  1VQ6 A;  4GKJ L;  4BY1 H;  2L15 A;  2YV5 A;  4IFD G;  2PI2 E;  2KCT A;  4JBM A;  1VQO A;  2ZTC A;  2NN6 G;  1TXY A;  1M90 C;  1Q46 A;  4LUZ A;  4BA1 I;  1V1Q A;  3KF6 B;  2PQA B;  2VZA A;  1HR0 W;  2YU9 H;  2GVA A;  3S1M H;  4BBR H;  4DR1 Q;  4DR1 L;  2OTJ A;  1S40 A;  1HZB A;  2K5H A;  4IFD J;  2ES2 A;  4A3D G;  1WCM H;  3E9H A;  3KLW A;  1A8V A;  3TRE A;  2ASB A;  3CCS A;  3HOX G;  1YJ9 A;  2H5X A;  3PO2 G;  2GN5 A;  4DR4 Q;  1SRO A;  1HR0 L;  4DR4 L;  1X3G A;  1SRU A;  3FP9 A;  2R93 G;  4MZ9 A;  4JOI C;  2A8V A;  3U4V A;  3BJU A;  3GTP H;  1C7Y A;  3UDX A;  4C3H H;  4XIG S;  4LF9 Q;  3BU2 A;  1HNZ Q;  4LF9 L;  1XPR A;  1HNZ L;  3U58 A;  5C3E H;  4JI4 Q;  1HZA A;  1WJJ A;  4IPG A;  1Y1V H;  5JEA G;  3J80 c;  4JI4 L;  3SGI A;  4JCV E;  1C9O A;  4XTC S;  4BBS H;  4K0K Q;  4QQB X;  4K0K L;  1L1O B;  1OXT A;  2VS1 A;  5FLX c;  1PH3 A;  2ZJQ A;  3CC2 A;  2JE6 I;  5JEA J;  5C4X G;  1WOC A;  2HT1 A;  2NVT H;  4R4O A;  1G6P A;  1UE1 A;  2RF4 A;  4BA2 I;  2BA1 A;  1EIY B;  4IPD A;  3BZK A;  3CC7 A;  3ZJY C;  2EQS A;  4R1J A;  3M85 A;  3M4O H;  1NTG A;  1KHI A;  4LUV A;  4DV3 Q;  1X54 A;  2VL6 A;  4DV3 L;  1VQ8 A;  2I0Q A;  2NZO A;  4L5S A;  2JQO A;  1NBW A;  2R7F A;  5C44 H;  5M3M H;  1X65 A;  5K36 G;  2I5L X;  5M3F G;  2F4V Q;  2F4V L;  2WAQ E;  1VQF A;  3PUZ A;  3AEV A;  5IP9 G;  1VQA A;  4A3L H;  1RL2 A;  4X6A H;  1YNX A;  2ALY B;  2NZH A;  1XTD A;  1PH2 A;  3PF4 A;  1L1O C;  1PH4 A;  3S17 H;  4HJ8 A;  2VY3 A;  1X56 A;  3E9I A;  3GTM H;  1XPO A;  2CQO A;  3I4N H;  1JT8 A;  3PIP A;  4X62 Q;  3CCR A;  3RNU A;  2E2J H;  4X62 L;  1Q7Y C;  1XNQ Q;  2ID0 A;  3K81 C;  1VQP A;  1XNQ L;  2E2I H;  2OCE A;  2NVY H;  1YVC A;  2Q2I A;  3NEL A;  4BXX H;  4JI7 Q;  1CSP A;  2Y0S G;  4JI7 L;  2HQL A;  1IBK Q;  1IBK L;  3EN2 A;  1HNX Q;  3CPW A;  1HNX L;  3FKI G;  5C4X H;  4YY3 Q;  4YY3 L;  2JA6 H;  3PF5 A;  4BY1 G;  4IOC A;  3H15 A;  1CUK A;  1Q1E A;  1LUZ A;  2UUA Q;  2UUA L;  2UUC L;  1I6H H;  1AH9 A;  1G29 1;  5EAY A;  1H95 A;  3I56 A;  2IHF A;  3ERS X;  1OXS C;  2LXJ A;  1OXV A;  4X64 Q;  4HID A;  1I5F A;  5DLQ E;  2WFW A;  4RG1 A;  4BBR G;  4AQY Q;  4AQY L;  3F2D A;  1EOV A;  4YWM A;  1A63 A;  1WYD A;  4P74 A;  2UXD Q;  2UXD L;  1WCM G;  3BZC A;  2RCN A;  4OON A;  4QJF A;  4HIO A;  3GO5 A;  4DV1 L;  2CCZ A;  4Y7N H;  4A3D H;  4DK6 C;  1P8L A;  3W1G A;  3M4Q A;  4PZ7 A;  5AJ3 Q;  5AJ3 L;  4C2M H;  2NVQ H;  2VQF Q;  1VQE A;  1X9N A;  4IFD I;  2VQF L;  3KDF A;  1N36 Q;  1Y1W H;  4DV2 Q;  4AH6 A;  4TVA B;  1U0L A;  4DV2 L;  4LFC Q;  5C4J H;  2YTV A;  1C0A A;  3HKZ G;  4GNX B;  4DV0 Q;  1MIU A;  1LTL A;  3STB C;  4DV0 L;  4B3R Q;  4B3R L;  5C3E G;  3GTJ H;  2EXD A;  4UP9 A;  1E3P A;  4EQ5 A;  2UU9 Q;  2Z6K C;  2UUB Q;  1XJV A;  5IYC G;  5HY6 A;  2UUB L;  4BBS G;  1HZ9 A;  2KEN A;  1KXL A;  1K8G A;  2DGY A;  4B3M L;  4IOA A;  4KLK A;  3M4P A;  2B29 A;  5H1S E;  5FJ8 H;  5LMN W;  2CKZ B;  4JG2 A;  1EYG A;  4HJ5 A;  1Y14 B;  2R7D A;  4IPH A;  3CCJ A;  3CF5 A;  4OWW B;  1VQG A;  2A1A A;  3HOY H;  4JBJ A;  4A93 G;  1U5K A;  4APV A;  1PH5 A;  2K75 A;  4LFB Q;  3DM3 A;  4LFB L;  4QIW E;  3PGZ A;  4P73 A;  1MJE A;  4A3B H;  4A76 A;  1XNR Q;  4LF7 L;  2PNH A;  2MFI A;  3MEF A;  1VQL A;  4QL5 A;  1XNR L;  1IXR A;  1YHQ A;  3JC6 6;  5M5W H;  3HOU H;  4YHH Q;  4YHH L;  4NXN Q;  3H0G H;  3LGJ A;  4NXN L;  2ZJR A;  1HR0 Q;  3I55 A;  3GDE A;  1HJP A;  5C44 G;  2I5H A;  3WWV A;  1YJN A;  3GTG H;  3KJP A;  1EUJ A;  1GD7 A;  3D0F A;  4WJ3 M;  1I3Q H;  4GNX C;  4YCW A;  1SFO H;  1VQH A;  4R4T A;  1Q82 C;  2Z0S A;  3CMA A;  4A3L G;  1CKO A;  4A3J H;  1WI5 A;  1VS0 A;  1L2F A;  4DR7 Q;  4IJH A;  4HJ9 A;  4DR7 L;  1K83 H;  3E0E A;  4JOI A;  1D8L A;  3STB D;  3HOW G;  2LSS A;  1TWH H;  1X55 A;  1N8R C;  4LF4 L;  2IHE A;  1Q8K A;  3J7A 5;  2C35 B;  4PZ8 A;  4MTN A;  1W2B A;  3J7Z C;  2WB1 E;  2K14 A;  1BBU A;  4OXP A;  5ELO A;  1RIP A;  3KYH C;  4BXX G;  2NVX H;  3S1N H;  1SMX A;  3ULP A;  3J81 i;  1NE3 A;  1X3E A;  3K8A A;  2R7Z H;  4GLA C;  2OQ0 A;  1NY4 A;  1VQD A;  4KHZ A;  1PVO A;  4A3C H;  1KL9 A;  4MNO A;  2IX0 A;  4GS3 A;  3T1H Q;  2B63 H;  3T1H L;  4JC0 A;  4B3S L;  2JA6 G;  3HOV G;  3ULL A;  2PMZ E;  3F1Z A;  1KRS A;  3H3V H;  1S72 A;  4DK3 C;  3A74 A;  2JJQ A;  3DLL A;  1B70 B;  2KCM A;  3IRB A;  3J81 j;  2QGQ A;  2K5V A;  4OWX B;  1JB7 A;  4POG A;  2VW9 A;  4JI6 Q;  4JI6 L;  3UDI A;  3K80 C;  3F2C A;  3K0X A;  1EWI A;  1A0I A;  1YI2 A;  3CCQ A;  1PFS A;  4A3I H;  4AYB E; 
#chains in the Genus database with same CATH topology
 3MZ5 A;  2PW7 A;  1YJW A;  1J9O A;  1IBL L;  1BCP F;  1JOK A;  1KDA A;  4BY7 B;  4GKK Q;  3AFP A;  2F0P A;  3K57 A;  5EKL A;  4L5R C;  3H94 A;  4LF5 L;  1L1O A;  4A3G H;  1FGU A;  5IYD H;  1J8I A;  4RKL A;  1GM5 A;  4JI2 L;  1EY8 A;  1E2V A;  4HIM A;  1LO5 D;  5JJK A;  3S15 B;  4BS9 A;  1IYJ B;  2B2U A;  5F2D A;  3AYH B;  4CKB A;  1EZ6 A;  1LT4 D;  3G6J B;  2UXB L;  4UY8 C;  3M4Y A;  4ALP A;  3TZD A;  4GN5 A;  1EEF D;  2RHS B;  5C3X A;  1XPU A;  1SN8 A;  1DGS A;  1YBY A;  4LFA Q;  3TRZ A;  1D1I A;  1VCI A;  1G91 A;  2WKD A;  2RDF A;  2K1B A;  2XTI A;  4JBW A;  1HUN A;  5M5Y B;  1S5E D;  5A2Q L;  4A3K B;  2OT2 A;  4GN3 B;  3JAM E;  1PH7 A;  1G2T A;  4JPB W;  1QVC A;  2QF7 A;  4GLV B;  2EYF A;  4M1U B;  5IYB H;  1TS5 A;  3BVG A;  3CD6 A;  2D5D A;  4B3M Q;  3T13 A;  2RVL A;  2JEB I;  4C56 C;  3Q8D A;  3I72 A;  5IP9 H;  4FF3 A;  3MXN B;  5JVG 3;  4IN3 A;  3S2H H;  2Q2U A;  3T56 B;  1N32 Q;  5IGG A;  5JJL A;  4DV5 Q;  1PA6 A;  2RSO A;  1TWF B;  1ENF A;  1H9M A;  2OF1 A;  2Q2H A;  4RKB A;  3W5O A;  4ILW A;  1EIG A;  1O78 A;  2L1B A;  4TKO B;  1NMF A;  3URY A;  2XVS A;  4XT1 B;  1STE A;  4RGO S;  2JA8 H;  1EZ8 A;  5I2Y A;  5M3M G;  1J5E L;  1V9P A;  3RZD B;  3GTL B;  3JAM i;  3DM1 A;  1UWV A;  4OEL B;  4FYD A;  3CPF A;  4G57 A;  4YWL A;  3P75 A;  2XIW A;  3V2T A;  3VYR A;  1PH1 A;  3F8T A;  4NB3 A;  5BR8 Q;  1B2T A;  3K7U C;  3RN2 A;  3SR1 A;  4J15 A;  4DR2 L;  3NBH B;  2ZM6 Q;  2HQE A;  4HIK A;  2CHB D;  2TMP A;  1A2T A;  4LW1 A;  3NQI A;  3V96 A;  2NTS A;  3MA2 B;  2PQA A;  1CKM A;  4DV6 L;  1ZYR D;  1D2B A;  4IUV A;  2KJX A;  1B3A A;  4DR6 L;  1Q3L A;  1UNS A;  2EOT A;  2UXC L;  2YTX A;  3A54 A;  2ZJP A;  4MN3 A;  1NCV A;  2RBM A;  2HDL A;  2VUM G;  1I4G A;  2QEJ C;  3SVM A;  1SE2 A;  2ZTE A;  1NAP A;  4MIU A;  3KBX A;  1F2Z A;  5IE8 A;  4YCU A;  1N34 Q;  1J6Q A;  1HNW L;  1E1T A;  1EY4 A;  4DNI A;  4CKC A;  4DR3 L;  1GO3 E;  2VNU D;  3RLF A;  4WOR A;  1X6O A;  2K52 A;  2RKS A;  2JA5 G;  2GVB A;  4JI3 Q;  2PI2 A;  1YZ6 A;  1BO0 A;  1G51 A;  3KK7 A;  1EFW A;  4TQU S;  1JE5 A;  5GAG C;  4B9W A;  3SHL A;  3G6E A;  1XMQ Q;  2E8G A;  1JMC A;  1RKN A;  3HOY G;  5ELN A;  1KC8 C;  2QA4 A;  3GTP B;  1D7Q A;  1STB A;  4A3F G;  4K8J A;  3NWT A;  2R61 A;  2K04 A;  4QUC A;  4C3I G;  4CDE C;  1F9Q A;  2HIV A;  3ERO A;  3L0O A;  2Q8I B;  3Q24 A;  3OYY A;  2VQE Q;  3HOV H;  1FNV A;  1JOQ A;  1EFI D;  2JEA I;  3I4O A;  2R92 G;  3S2D H;  2K5N A;  1LTS D;  1SLJ A;  1A62 A;  1FJG L;  2DUD A;  3GV6 A;  3HG9 A;  1VQJ A;  3CW2 C;  3D8G A;  4UP7 A;  5GQO A;  3I3C A;  3U9O A;  1MBY A;  5K36 H;  1YIJ A;  1KRT A;  1XMO Q;  3GD7 A;  2HHH Q;  3L7Z C;  1JQY D;  5FLM G;  1E2Z A;  4R4Q A;  4JVZ A;  4TSS A;  4IQZ A;  1TWC H;  1YHA A;  3ULJ A;  4GN4 B;  3S1R H;  1AE2 A;  4LFC L;  4KK7 A;  2A6E D;  5GAH C;  3A55 A;  2F0W A;  2DJG C;  1Q8I A;  1XX8 A;  1Y8P B;  3VA7 A;  3RUZ A;  4DUY Q;  3BVM A;  2ATW A;  2BDN A;  2KCN A;  5ELE A;  1BNZ A;  3GTM B;  3FKI H;  3RR5 A;  1QUQ A;  4K2K A;  2E5L L;  1VQ6 A;  3FVQ A;  2PI2 E;  4JBM A;  4N9P A;  3D6W A;  2OEO A;  4LUZ A;  4BA1 I;  1V1Q A;  2VZA A;  3S1M H;  2GVA A;  4BBR H;  3N6R A;  1S40 A;  4L8J A;  2ES2 A;  1SYB A;  4K5V A;  3E9H A;  1IYU A;  1B9N A;  1A8V A;  1S4Z A;  2F0V A;  1KTK A;  3HOV B;  5C4X B;  2K5W A;  1YJ9 A;  3PO2 G;  1BBX C;  2MGS A;  5IGB A;  1X3G A;  3FP9 A;  1K8O A;  3WOE A;  3BVZ A;  3PMF A;  4C3H H;  2NB0 A;  1XPR A;  1ML0 D;  1I4X A;  1WJJ A;  4JI4 L;  3C2P A;  2EYH A;  3H6M A;  4BBS H;  1LTI D;  1CZG A;  2VS1 A;  2IJ0 A;  1C48 A;  3SE0 A;  5FLX c;  1PH3 A;  3S1R B;  2JE6 I;  1JC7 A;  2NVT H;  2HT1 A;  1II3 A;  3IFD A;  2BA1 A;  1HXY D;  1F77 A;  1ET6 A;  1EIY B;  1TII D;  3QB3 A;  1CM9 A;  1NTG A;  4LUV A;  2VL6 A;  4FXG C;  3DWQ A;  2R7F A;  1ENC A;  5D3D A;  1UAP A;  2F0J A;  3S1M B;  1CT1 D;  4ZUI A;  2F4V Q;  2EYL A;  3V05 A;  1QNU A;  3LX0 A;  3AEV A;  1VQA A;  3BDO A;  3CRK C;  1JWS D;  1EY6 A;  1YNX A;  3HOU B;  2KOL A;  1V8Q A;  2F0F A;  1C8C A;  1XPO A;  4WJW A;  1JT8 A;  4IUN A;  4X62 Q;  2E2J H;  3GTG B;  2ID0 A;  4C1N I;  1I3Q B;  4CDF C;  2OCE A;  4BXX H;  4A3J B;  4JI7 L;  2HQL A;  1IBK Q;  1GHK A;  5I9P A;  4PV1 C;  3CPW A;  5KND A;  3A7A B;  4YY3 L;  4BY1 G;  1AH9 A;  2UUA L;  1BCP D;  1I6H H;  1G29 1;  1KLG D;  2QCP X;  4ZQ3 A;  5EAY A;  3C1F A;  1S5D D;  1OXV A;  1SXT A;  4CGY B;  1KLU D;  4AQY L;  3F2D A;  2NVT B;  1WYD A;  4P74 A;  1MGS A;  2A68 C;  2UXD L;  3I4L A;  3VYS A;  4Y7N H;  4A3D H;  3C3L A;  1QB5 D;  5AJ3 L;  5G3L F;  2VQF Q;  1WTV A;  1X9N A;  5DNF A;  3ND8 A;  1N36 Q;  5I4D A;  4TVA B;  3DMU A;  4DNR B;  4EQN A;  4I7Z C;  3MTS A;  3MFG A;  1DXM A;  3KLR A;  1QCB D;  4UP9 A;  1E3P A;  4EQ5 A;  4A3I B;  2UU9 Q;  1DYQ A;  5IYC G;  4KLK A;  3M4P A;  4B9X A;  5H1S E;  4C3J B;  1I4H A;  4A3E B;  5LMN W;  2CKZ B;  4JG2 A;  1EYG A;  2B2W A;  4IPH A;  1VQG A;  2A1A A;  2KEC A;  3J81 E;  1PH5 A;  4CDC C;  4ZYS A;  4LFB Q;  3I8Z A;  4QIW E;  2KED A;  1GUS A;  4LF7 L;  2PNH A;  2MFI A;  1XNR L;  3PO3 B;  4QL5 A;  5D65 A;  5FLX L;  1IXR A;  4ODG A;  3JC6 6;  2RQX A;  5M5W H;  1YHQ A;  1EWH A;  3H91 A;  2F0S A;  3H0G H;  3HS0 C;  3OPO A;  4NXN L;  1TY0 A;  1X3Q A;  3QJY A;  5C44 G;  4TRD A;  4Z9C B;  1YJN A;  1WTX A;  2FMM A;  4EGV A;  3EQL C;  1EEI D;  1ICW A;  1SYF A;  3MVV A;  1VQH A;  4IUR A;  4KMU C;  3CMA A;  1SND A;  2D2C C;  3CRL C;  1SYD A;  4A3L G;  1EYD A;  1WI5 A;  1V1P A;  1VS0 A;  3I4M B;  1BF4 A;  4Y7N B;  2A6H D;  1F9R A;  2LSS A;  3ZYY X;  4LF4 L;  1GUW A;  4B08 A;  2JA7 B;  2B2Y C;  3FPP A;  2K14 A;  1BBU A;  5ELO A;  2L55 A;  1SNM A;  5C0X H;  1B44 D;  3J81 i;  3K8A A;  1X3E A;  2OQ0 A;  1NY4 A;  3G7L A;  4A3C H;  1YNJ D;  3VA5 A;  3MXG A;  4MNO A;  1PTO D;  2IX0 A;  3T4A C;  3NP8 A;  3T1H L;  2HCI A;  2JA6 G;  3H3V H;  2PMZ E;  1EL0 A;  4DK3 C;  3A74 A;  2JJQ A;  1TS3 A;  2KCM A;  4NP5 A;  4ME5 A;  1JB7 A;  5JJZ A;  2VW9 A;  4JI6 L;  3HP3 A;  4HTH A;  2SDF A;  1WD0 A;  3OWE B;  1YI2 A;  3HOZ B;  2NN6 H;  1JIC A;  1UEB A;  1IBL Q;  4ULL A;  3UDG A;  3H0G B;  4POF A;  1MSH A;  2F3W A;  1QJO A;  1SE4 A;  1Y1W G;  2AUK A;  3I2Z A;  3HOX H;  2RA4 A;  3CAM A;  2Q8R E;  1EQR A;  4LF5 Q;  1Z47 A;  4J6H A;  1BUV T;  2K4K A;  3HGB A;  1B8A A;  4JI2 Q;  4DK1 A;  3R8B A;  3KF8 A;  4JV5 L;  4O42 A;  1ILQ A;  2AWO A;  3GTK B;  4IUT A;  1JOR A;  2K7V A;  3SK6 A;  2UUC Q;  1STH A;  2D62 A;  3VR3 A;  2IX1 A;  5EPL A;  2UXB Q;  4JI0 L;  1CZW A;  4F87 A;  2B3G A;  1PDQ A;  3NEM A;  4LNQ A;  2BE5 D;  4A3B G;  2PCF B;  3TQY A;  1VQC A;  2EIF A;  5IWA L;  3H09 A;  1A3T A;  4AYB B;  4IUU A;  3E3X A;  3IL8 A;  2LMC B;  2O4X A;  4KKT A;  4Q0F A;  1HFG A;  1X3F A;  4U67 3;  3I70 A;  1KDB A;  4LF6 L;  3A5Z B;  3HFZ B;  3N52 A;  3OOC A;  1SMY D;  1IL2 A;  4RGN A;  1VQN A;  2EPB A;  3A0J A;  3P7J A;  1AP0 A;  1K3R A;  2PYK A;  2M2L A;  5IGF A;  3HOX B;  1DCZ A;  1FVI A;  5DM7 3;  2AMC B;  1OTC A;  2R7Z G;  5LMU L;  2R93 B;  1CHQ D;  3CP0 A;  1YNN D;  4A3M H;  3D6C A;  2B63 G;  5LMN L;  1D5M C;  3LWU A;  1IBM L;  2J7Z A;  3H3V C;  4K5X A;  4BY7 H;  4A75 A;  4X66 L;  2ENB A;  3W3A A;  3W2D A;  3X3M A;  1WTO A;  4LWC A;  2F0Q A;  1U4R A;  1J5E Q;  3PUY A;  1CI3 M;  1FNU A;  5IP7 H;  2OWO A;  3K7A B;  1SNO A;  5D14 A;  2F0D A;  4HJ7 A;  2QDB A;  4CBV A;  3S15 H;  2CWA A;  5NUC A;  2ICE C;  4DK0 A;  5AFW A;  1DM0 B;  3R3O A;  3I4N G;  3GTO H;  4QGU A;  4KHP L;  3L2P A;  5ISR A;  3AU7 A;  3K58 A;  4A3G G;  5IYD G;  5J22 A;  4DR2 Q;  2TSS A;  2IX3 A;  4NXM L;  2Z4H A;  2FXQ A;  4B3S Q;  5M3F B;  3RLN A;  1KQS A;  1EWC A;  1V1O A;  3KF6 A;  4DV6 Q;  4OWT B;  3J7A F;  4XT3 B;  4ZCK A;  4X3K A;  4KD4 A;  4DR6 Q;  2SEB D;  2UXC Q;  4YWK A;  5M5Y H;  3J80 E;  1U4L A;  1YEZ A;  4A3K H;  1JCK B;  3A8K E;  1LTR D;  1SNP A;  2WKC A;  5C3W A;  4IFD H;  5EBC A;  5COR A;  3AB9 A;  3BYT B;  1GHJ A;  3AQQ A;  2F0M A;  1TS4 A;  1LT5 D;  1Y69 U;  2BA0 A;  1BDO A;  3D31 A;  4ZKC B;  3IAY A;  1YHB A;  1HNW Q;  4JI1 L;  1UE7 A;  3R93 A;  4DR3 Q;  2L11 A;  3TS0 A;  2JK8 A;  1MJC A;  4H02 A;  2F0H A;  2N55 A;  3P1H A;  1GVP A;  2FFK B;  1TWF H;  5E7N A;  4IUP A;  5IYB G;  1K8A C;  3FHW A;  3M7G A;  5IT9 c;  3T1Y L;  1JJC B;  4RWS C;  3OTO L;  1LV9 A;  4JI5 Q;  1WCM B;  3K0Y A;  5FJ8 G;  3GTO B;  3M7N A;  4CKE A;  5JEA H;  3KUP A;  1PFM A;  4O0A A;  1Q12 A;  3J80 i;  2D9U A;  1STA A;  1N33 L;  1L0W A;  4JBK A;  3RZD H;  3WOF A;  3HEJ A;  3GTL H;  1HQR D;  1TS2 A;  2B2U C;  4ZRZ A;  3CQZ H;  1QVG A;  5C3E B;  1L0X B;  4X3U A;  2CWP A;  3DWA A;  3J7Y W;  4LF8 L;  2JA8 G;  2FHT A;  3K5M A;  3PIP 3;  1EY0 A;  2WB1 G;  1JJG A;  1K28 A;  1E1O A;  1WFQ A;  2EY1 A;  1FJG Q;  4EX5 A;  1B50 A;  4X64 L;  4FP5 D;  1EIF A;  2B8G A;  2OTL A;  3P20 A;  3D4W A;  4KTA A;  4IPC A;  1E22 A;  4B3T L;  3PCO B;  3QWN A;  5CBA E;  1AZQ A;  4FXD A;  3F2B A;  2MHV A;  1E2W A;  2Z6K A;  1ESR A;  1SYG A;  4R8I A;  4HSV A;  2YYZ A;  3CCM A;  1LM0 A;  4RH6 A;  3RN5 A;  3D3R A;  4RCO A;  1V43 A;  4DV4 L;  1PYW D;  2CH4 W;  1N9W A;  2R6G A;  4DUZ L;  1PLF A;  1KAA A;  4EVO A;  1TWG H;  4GLX A;  2E5L Q;  2EYP A;  4GKJ L;  3GP7 A;  1STG A;  4NKL A;  3R2T A;  3NBI A;  4ID6 A;  1E0B A;  2PQA B;  2YU9 H;  2X6L A;  2LY7 A;  3NTK A;  3CQZ B;  4DR1 L;  1HZB A;  3QR8 A;  4V19 0;  3OSO A;  5A2Q E;  3KLW A;  2MUY A;  3K5N A;  2A68 D;  2H5X A;  1PRT B;  1HR0 L;  2EZV A;  3BG3 A;  4UHV A;  5KRU A;  1KAB A;  4MZ9 A;  4JOI C;  5EPJ A;  3GTP H;  1IYV A;  3MXN A;  3UDX A;  2ZXP A;  3BU2 A;  2DNE A;  3A8I E;  4JI4 Q;  2IW3 A;  3A7L A;  5E4W C;  4JCV E;  4K0K L;  4XQJ A;  4KN4 C;  1IW7 C;  3CC2 A;  3BZD B;  5IT9 L;  1HUM A;  3UI2 A;  5C4Z A;  1FNW A;  2AQ3 B;  1G6P A;  2A69 C;  5CMD A;  2F03 A;  1TWG B;  3BZK A;  1NR4 A;  2JXM B;  3ZJY C;  1PRT C;  4R1J A;  1VQ8 A;  1HTP A;  2DJF C;  2NZO A;  4L5S A;  3WDN A;  4HMJ A;  1I4P A;  5M3M H;  5K36 G;  2YU9 B;  2I5L X;  3Q22 A;  2ZXO A;  4FXK C;  1SNQ A;  3NBH A;  2O5J C;  2ALY B;  1XTD A;  1O7L A;  3NTH A;  4HCS A;  3GTM H;  3E6Z X;  4XQN A;  1RHP A;  3FEW X;  2AQ2 B;  3RNU A;  1PRT F;  5FO8 B;  4FNF A;  1I4Q A;  2KQ3 A;  3AMU A;  4FO2 A;  2E2I H;  3MC0 B;  1DJR D;  1A3V A;  4JI7 Q;  2Y0S G;  4IZ8 A;  2J0T D;  1HNX L;  3FKI G;  1TWH B;  5C4X H;  4YY3 Q;  2F3V A;  2QW7 A;  2UUA Q;  1Q1E A;  1LUZ A;  4PMC A;  4I7A A;  3I56 A;  1VMC A;  3VYU A;  1PMR A;  4ZKB B;  1I5F A;  2NVX B;  4ZAI A;  4RG1 A;  4BBR G;  4AQY Q;  3SXH A;  1WTR A;  1EOV A;  4YWM A;  1WTQ A;  5L37 A;  2UXD Q;  5LHY 1;  4OON A;  4KHV A;  2CCZ A;  1O80 A;  4DK6 C;  3W1G A;  1D6E C;  5AJ3 Q;  3RMH A;  2EJF C;  4E6I A;  4DAY A;  1VQE A;  3KDF A;  3K6O A;  4MHE A;  4O1N A;  4C3H G;  1U0L A;  4DV2 L;  5M3M B;  2CH4 A;  1C0A A;  1Y8N B;  3HKZ G;  4GNX B;  3STB C;  1BOS A;  1RTN A;  3BS1 A;  4B3R L;  2EXD A;  1XJV A;  3NSW A;  2UUB L;  4BBS G;  1K8G A;  5EBD A;  4B3M L;  2B29 A;  3VR4 A;  2OXP A;  1GOZ A;  4HJ5 A;  2X6G A;  3K5L A;  1G2S A;  3CCJ A;  3L9A X;  3CKI B;  1JB3 A;  3HOY H;  4JBJ A;  2L12 A;  4A93 G;  2E2I B;  1IKL A;  3OMG A;  3TSS A;  1W6K A;  3DM3 A;  3PGZ A;  4P73 A;  1XNR Q;  3MEF A;  3SEB A;  4UDU C;  3HOU H;  4YHH L;  2QKI C;  4NXN Q;  2ZJR A;  2JP1 A;  2BCO A;  1X32 A;  4RFB A;  2I5H A;  3WWV A;  1AZP A;  3GTG H;  1GD7 A;  5FOB B;  4WFN 3;  2K28 A;  1I3Q H;  1ICF B;  4GNX C;  4R4T A;  5HUR A;  2K33 A;  2VUM B;  4A3J H;  1O7Y A;  2XWJ B;  3CU7 A;  4IJH A;  4HMI A;  1K83 H;  3TN2 A;  1TR5 A;  3HOW G;  1HA6 A;  4G7O C;  2IHE A;  1SSO A;  3J7A 5;  2C35 B;  1S5C D;  2PZT A;  2P5Z X;  2SNS A;  4H7B A;  2WB1 E;  1SJH D;  2E75 C;  3KYH C;  4BXX G;  1SMX A;  1CTM A;  4FF4 A;  4U68 A;  2PPB C;  1VQD A;  4KHZ A;  5C5M A;  3GTQ B;  5IGC A;  4LAA A;  2JA5 B;  4QIW B;  3EFX D;  3T1H Q;  3S14 B;  3ITP A;  3F1Z A;  1KRS A;  1EU4 A;  2R3Z A;  3DLL A;  1K3B C;  4KY7 A;  4OEM B;  5KGU A;  2B2T C;  3BDL A;  4G4K A;  4JI6 Q;  3HOY B;  4K8I A;  1H9S A;  3K80 C;  3F2C A;  4Q5V A;  4OGQ C;  1I50 B;  5DEH A;  4A3F B;  4AH6 A;  4A3D G;  4A3I H;  2D0P A;  4C3I B;  3TP7 A;  2B39 A;  3NQT A;  1DON A;  3PQI A;  2MNA A;  1HZC A;  4C3J H;  4A3E H;  1E7Z A;  1PFB A;  3PO2 H;  1LTG D;  2HDM A;  4KI0 A;  4PNY A;  2R92 B;  3NK9 A;  3CCU A;  4DGZ A;  2IY5 B;  1I94 L;  3NUC A;  4A4I A;  4OX9 L;  4JV5 Q;  1K83 B;  3RD4 A;  4GOP B;  3S16 B;  3PO3 H;  4X3S A;  2HD3 A;  2PMZ B;  4LJZ C;  2JN4 A;  4LUO A;  1NMG A;  2KHJ A;  4JI0 Q;  4LMQ D;  3R2I A;  1KD1 C;  1QVF A;  2QDL A;  1RF2 D;  3CHB D;  4KKS A;  2WV6 D;  4RCN A;  5T1I A;  1FR3 A;  4HCE A;  5BN5 A;  1LYL A;  2V4D A;  5M5X B;  1IKM A;  5IWA Q;  3OW7 A;  1GUT A;  4DV1 Q;  1P16 A;  3I4M H;  4OO1 I;  4XXE A;  4KY5 A;  1XYI A;  3OW2 A;  4R4I A;  2VQE L;  1LLR D;  2B8F A;  2JA7 H;  1Q86 C;  3NEN A;  2JA9 A;  2M00 A;  4RHR A;  5GRO A;  1QZG A;  4QY7 A;  2OQK A;  3KOJ A;  1QWY A;  1VQB A;  4LF6 Q;  1JWU D;  1Y1V G;  1PH6 A;  3FPU B;  2L9H A;  4GOP C;  2RCF A;  4OO1 G;  2CFM A;  1CHP D;  3DXJ C;  4DU9 A;  3LNN A;  3CCV A;  3TEH B;  1VQM A;  3SK4 A;  4CDD C;  5I6Y A;  1ET9 A;  4M8A A;  3PO2 B;  5C0X G;  1V1P B;  3I73 A;  2RSN A;  5LMU Q;  1O7I A;  4A3C G;  1VMP A;  2E2H B;  1ZYR C;  2WAQ G;  5LMN Q;  3HOZ H;  1DOK A;  1CKN A;  2AHO B;  2ZTD A;  1TVX A;  3UDF A;  5ELB A;  4DUY L;  1WTW A;  4X66 Q;  5JAV A;  1SE8 A;  1A15 A;  4K6D A;  5HGQ A;  4DV7 L;  3TP5 A;  3KJO A;  3S1Q B;  1SAP A;  1UE6 A;  5CR3 A;  1PZK D;  3ND9 A;  1KIX A;  4JI8 L;  1BR9 A;  4EQP A;  3UE0 A;  2RDH A;  2Y0S E;  2LFN A;  4KV6 A;  4J8Q A;  5FO9 B;  3GTK H;  2EVB A;  1EY5 A;  2WP8 J;  2ZT9 C;  4C1N K;  1QZH A;  2A19 A;  1ROD A;  4QB4 A;  4KHP Q;  1UE5 A;  4MTK A;  3T51 B;  3SK5 A;  2PW5 A;  1I4R A;  4NXM Q;  2I07 B;  2Q2T A;  4PG3 A;  1D5X C;  1MHW C;  5GAE C;  3SK8 A;  3RZO B;  3M9B A;  3TS2 A;  3RLO A;  5IYC H;  4IJL A;  3T16 A;  2Z4I A;  1ILP A;  4DPG A;  1K9M C;  4ZLT F;  3TZU A;  1CA5 A;  3KF8 B;  5FLX E;  1CSQ A;  1H9J A;  3GQB A;  2FJ2 A;  3HKZ E;  1VQK A;  1A6X A;  1UUP A;  2F0O A;  2XGT A;  2D0O A;  2FMC A;  5IY0 A;  4IO9 A;  4DN4 M;  3QOL A;  4QF4 A;  1GJX A;  4ME3 A;  4JI1 Q;  5KYI A;  1VQ4 A;  3ONA B;  2H1E A;  4BY1 B;  1MKH A;  2MO0 A;  1AE3 A;  1G6Z A;  3TP8 A;  2R93 H;  2J4X A;  2F52 A;  1OO9 B;  2K50 A;  4P71 A;  3MXP A;  4X65 L;  3T1Y Q;  3OTO Q;  2NTT A;  4CHT B;  3KLS X;  4PZ6 A;  3EA6 A;  4DR5 L;  3BYY B;  4R8N A;  1N33 Q;  3PV0 A;  4PMW A;  2N3S A;  5JPN C;  2DY7 A;  4GZY C;  5COY A;  3UE1 A;  2EY2 A;  4DA2 A;  5EPK A;  4A3M G;  4IAL A;  1JJ2 A;  3K7A H;  3OHX C;  4UP8 A;  3A5U A;  2BOS A;  1PH8 A;  2XRQ D;  2I46 A;  4BY7 G;  4LF8 Q;  2WAC A;  5CV7 A;  2F0U A;  1BBW A;  5HGT A;  3JAM c;  5IP7 G;  2K5D A;  1U4P A;  3I7F A;  1ASZ A;  2LXK A;  4OIJ A;  3QIA A;  4L63 B;  1M1K C;  5M3F H;  5T1G A;  1SYC A;  3G71 A;  2KHI A;  4B3T Q;  1BKB A;  1KNA A;  5IGD A;  3M4O B;  2A73 B;  3HKS A;  1N36 L;  5C44 B;  2I5M X;  4X3T A;  1ENA A;  1PV4 A;  2C5C A;  4DV4 Q;  2UU9 L;  4DUZ Q;  2B2V C;  3Q6S A;  5LL6 S;  4GKJ Q;  1W3S A;  4JYA L;  4DF7 A;  4A3K G;  1BVS A;  2L15 A;  2YV5 A;  2EYJ A;  4IFD G;  3ERQ A;  1VQO A;  5E3F A;  1F2M A;  2ZTC A;  1TXY A;  4NDX A;  1Q46 A;  4FVM A;  2NVY B;  3KF6 B;  1HR0 W;  4DR1 Q;  2K03 A;  1WCM H;  1BCP B;  4YIJ A;  3TRE A;  2ASB A;  3CCS A;  2JA6 B;  5JPM C;  2GN5 A;  1M4V A;  4DR4 L;  1LTT D;  2KVM A;  1VDZ A;  2A8V A;  4HSP A;  3I90 A;  3K59 A;  4DFA A;  4XIG S;  4BWG B;  5CV6 A;  4LF9 L;  1HNZ L;  3U58 A;  5C3E H;  1HZA A;  4IPG A;  5JEA G;  5LL6 X;  4KJN A;  1C9O A;  4K0K Q;  1HRJ A;  1L1O B;  4S3S A;  5EKI A;  4C2M B;  2G9D A;  1X3P A;  5DM6 3;  2ZJQ A;  5KYL A;  1CQV A;  1SE3 A;  1Y1W B;  1K8M A;  5C4J B;  1QE6 A;  1WOC A;  4KY6 A;  4JW0 A;  1EYA A;  1Y8O B;  4BA2 I;  3S9W A;  1F9P A;  5I6W A;  1WTP A;  3CC7 A;  2EQS A;  4RGM A;  1X54 A;  2Z6B A;  4DV3 L;  1GXD C;  1SNC A;  1RCV D;  1NBW A;  2JQO A;  1X65 A;  2DN8 A;  3C1E A;  5JVH 3;  2A5H A;  5CYU A;  2WAQ E;  4A3B B;  3I91 A;  1EYC A;  5IP9 G;  1QIL A;  4X6A H;  1RL2 A;  1STY A;  2NZH A;  1R4Q B;  3JAM L;  3OIP A;  1L1O C;  1PH4 A;  1X56 A;  2CQO A;  3I4N H;  3CCR A;  2CQA A;  1Q7Y C;  1MI2 A;  1VQP A;  2KEE A;  1XNQ L;  3A56 A;  4PMB A;  1PFN A;  2Q2I A;  1SFO B;  4N8F A;  1JWM D;  1CSP A;  3J7A V;  3MFY A;  3EN2 A;  1HNX Q;  4H0L C;  3PF5 A;  4IOC A;  1CUK A;  2NWG A;  2UUC L;  5CGK A;  2F0G A;  2LXJ A;  4HID A;  5DLQ E;  2WFW A;  4HR7 B;  1PTO B;  2R7Z B;  1A63 A;  2G9H D;  3EVQ A;  4ZK9 B;  4QJF A;  3GO5 A;  2B63 B;  3EJI A;  1H9R A;  4DNT B;  1S5B D;  5I9O A;  1RD9 D;  1A3U A;  4DV2 Q;  4F7X A;  4LFC Q;  2A6H C;  2EY6 A;  2IL8 A;  4XYQ A;  4B3R Q;  4DV0 L;  3O13 A;  2Z6K C;  2UUB Q;  3IFT A;  1HZ9 A;  2KEN A;  3NTI A;  4IUQ A;  1KXL A;  2EJG C;  1EY7 A;  4QMG A;  3I4N B;  5FJ8 H;  2MJ8 A;  1Y14 B;  5G3L D;  1EQV A;  2CW0 C;  2M9V A;  1PXU A;  1YNJ C;  5KNB A;  1PTO C;  1U5K A;  3E5S A;  4A3G B;  2XN9 C;  2SOB A;  2EXZ A;  1SBB B;  1MJE A;  4A76 A;  2XWB B;  5EKK A;  2NYZ D;  4YHH Q;  1LT3 D;  3LGJ A;  3I55 A;  3GDE A;  1HJP A;  3QG1 A;  1EUJ A;  4WJ3 M;  1ONL A;  4YCW A;  1Q82 C;  2Z0S A;  3LWE A;  2JSO A;  1CKO A;  2NZ1 D;  1TT2 A;  1PTO F;  1L2F A;  1Z6H A;  4HJ9 A;  2VB2 X;  4DR7 L;  3E0E A;  4JOI A;  1D8L A;  1TWH H;  1N8R C;  5IGE A;  2IWH A;  1Q8K A;  2VXW A;  1UEA B;  4MTN A;  1W2B A;  2HCC A;  4OXP A;  2O2L D;  2NVX H;  1IL8 A;  5D3I B;  5I2X A;  3S1N H;  1NE3 A;  4GLA C;  1PVO A;  1KL9 A;  1RJT A;  3HOV G;  2F0T A;  5C4X G;  4B3S L;  4JC0 A;  3ULL A;  2F0E A;  2L5T A;  1H9K A;  3OWF A;  4EQO A;  1B70 B;  2BE5 C;  3IRB A;  3J81 j;  2QGQ A;  3S2H B;  4POG A;  2SNM A;  3UDI A;  1EWI A;  1A0I A;  4RGT A;  1PFS A;  4L5Q A;  4AIM A;  2K5Q A;  5J1Z A;  4YCV A;  4ZUJ A;  2ICI A;  4P75 A;  2QEX A;  2F4I A;  4CJ0 B;  4DAP A;  2PNR C;  1WVL A;  4N9T A;  1FD7 D;  4GKK L;  2JA8 B;  2XRS D;  3NXW A;  4OL7 A;  1Q81 C;  4WJ4 A;  2WB1 B;  1SMY C;  2WII B;  3TME A;  1I94 Q;  2V1C C;  3EIV A;  3CC4 A;  1ZKO A;  4OX9 Q;  2NBF A;  2N88 A;  1PYS B;  4FDB A;  1SEB D;  5FKA C;  5ELC A;  4P72 A;  4DAY B;  1GKH A;  3KDF B;  4JI5 L;  4OHJ A;  1GUO A;  5IT9 E;  1R9T H;  4K5W A;  2XNA C;  1EIH A;  4HJA A;  1YNN C;  3S1N B;  3SDZ A;  1HA5 A;  1NJI C;  2LKV A;  4K6L A;  5J3B A;  2VUM H;  4Y52 H;  1IZ6 A;  1QUQ B;  3X3N A;  5IIF A;  3HOU G;  1HCZ A;  2HIX A;  3VR2 A;  1CFM A;  1VQ7 A;  4L5T A;  3G48 A;  2AQ1 B;  2AKW B;  1K0R A;  2WIN B;  4LFA L;  3PUX A;  3D4R A;  1KAW A;  1PHJ A;  1NSN S;  2RHQ B;  1Z7T A;  1ZXT A;  3MAQ A;  3AFQ A;  3NE5 B;  3CCE A;  4HN7 A;  1F9S A;  3PUW A;  5BN4 A;  2N78 A;  1VF7 A;  4XYO A;  1TWA H;  1M8A A;  2A74 C;  4A3J G;  1VQ5 A;  3GTQ H;  4R4C A;  1B4O A;  2N49 A;  2JA5 H;  2CVR A;  1A2U A;  2Q8T A;  4RHS A;  3S14 H;  3G4S A;  2MP1 A;  2F3I A;  3KFU A;  2ZXR A;  5C6A A;  3J81 c;  1HH2 P;  2EY5 A;  1B7Y B;  1OXU A;  1AW7 A;  1N32 L;  4DV5 L;  2N8N A;  2EE1 A;  2BH2 A;  3PSI A;  1PYB A;  5KNC A;  3FMC A;  1HPC A;  1I50 H;  4A3F H;  4LF7 Q;  4G7Z C;  1OXX K;  4C3I H;  5C0X J;  3ICE A;  1VQ9 A;  4NPS A;  4NW2 A;  1R9T B;  1PZI D;  2MQH A;  2E2D C;  4DV7 Q;  4UPA A;  5CC4 A;  4KN7 C;  1HQM C;  2R92 H;  4JI8 Q;  3W1B A;  1VQI A;  5ELD A;  4A3I G;  4J1M A;  2EYO A;  3OIQ A;  3S24 A;  3CXC A;  2QIL A;  4L6T B;  1ZEQ X;  3S16 H;  4C3J G;  4GNX A;  4A3E G;  4CJ1 B;  4LF4 Q;  1F2Y A;  1AEX A;  3IKJ A;  1H9S B;  5BR8 L;  5FLM H;  3S2D B;  3OMC A;  1SR3 A;  1EOT A;  1TWA B;  3F2U A;  4O2D A;  1TY2 A;  2ZM6 L;  4R9W A;  5M5X H;  5CBE E;  2BH8 A;  3PO3 G;  3ER0 A;  2RDG A;  3VDY A;  1SJE D;  2JYO A;  3U50 C;  4QUF A;  4RA8 A;  1U4M A;  3NWS A;  3CME A;  1NR2 A;  1E24 A;  3M3Y H;  1FL0 A;  4KJO A;  1Q1B A;  1TWC B;  2Z1C A;  1EQQ A;  2KCC A;  2KUM A;  4RMF A;  3KBG A;  3I4M G;  4A93 H;  1GUG A;  2XSC A;  2B2T A;  2Y0S B;  5CV4 A;  4UAI A;  5GAD C;  2JA7 G;  2KBN A;  3FKI B;  1N34 L;  2FIN B;  1TU2 B;  1XXG A;  1LAC A;  1S3O A;  3EBE A;  3VR5 A;  2E2H H;  2E76 C;  4BBR B;  4X65 Q;  4JI3 L;  3VR6 A;  1DD2 A;  3PIO A;  1R4P B;  3B6Y A;  2EDG A;  3D4D A;  4JK1 C;  4KD3 A;  1K73 C;  1T9H A;  1XMQ L;  3TP6 A;  4DR5 Q;  3HOW H;  2EJM A;  5IOD A;  3S1Q H;  5FO7 B;  4DAM A;  1EQT A;  2MO1 A;  3HOZ G;  4DKA C;  4C3H B;  4RAU C;  1PH9 A;  1CK1 A;  3HKZ B;  4NMZ A;  2G5D A;  2GA4 B;  1RDP D;  1Z9F A;  3H0G G;  3GV3 A;  3J81 L;  1XWE A;  4BBS B;  2IT1 A;  3M3Y B;  1RTO A;  2F0I A;  5C0X I;  4K14 A;  4V0B A;  3U4Z A;  1CKN B;  2EYM A;  1MD2 D;  1SYE A;  1BXT A;  2AWN A;  1CA6 A;  4A93 B;  3H3V I;  3RZO H;  1XMO L;  2HHH L;  1FYC A;  2YTY A;  1DZ1 A;  1IHZ A;  5JJI A;  4GOP A;  4KKU A;  1DOM A;  1EU3 A;  3CCL A;  3DWP A;  2NN6 I;  1YIT A;  3PUV A;  3DEO A;  1ASY A;  1F2L A;  2E74 C;  5CV8 A;  1IBM Q;  4AYB G;  3MXU A;  2B2W C;  1VF5 C;  2F1M A;  1LAB A;  3QOJ A;  2X69 A;  5IOC A;  3HOW B;  2L0C A;  5EQ0 A;  4JYA Q;  5FK9 C;  4BY1 H;  1U9R A;  2KCT A;  2E2J B;  3A8J E;  2NN6 G;  1M90 C;  5C5L A;  2KHS A;  4I65 A;  5DAU A;  1LTA D;  2OTJ A;  2K5H A;  4IFD J;  1FGB D;  1WTH A;  3K5O A;  2IPK D;  3KLS A;  3BDC A;  3QO2 A;  3HOX G;  5CV5 A;  2F0L A;  4DR4 Q;  1I6H B;  1SRO A;  4DAV A;  1SRU A;  2R93 G;  1BQQ T;  2F0K A;  3T53 B;  3U4V A;  3BJU A;  4DXF A;  1C7Y A;  1D5Z C;  1KNE A;  2PZU A;  4LF9 Q;  2B2Y A;  1HNZ Q;  1LT6 D;  4A3D B;  3J80 c;  1Y1V H;  1TQO A;  3SGI A;  2PO4 A;  4XTC S;  4QQB X;  4OO1 H;  1OXT A;  1AFP A;  2AUJ D;  1QOH A;  5JEA J;  1T5X D;  2CW0 D;  2LS0 1;  4R4O A;  1UE1 A;  2RF4 A;  1W6J A;  4WRD A;  1PZJ D;  4IPD A;  4DXG A;  3M85 A;  3M4O H;  2K6A A;  1KHI A;  4LK1 C;  4DV3 Q;  4FF1 A;  2I0Q A;  5BN3 A;  2MPM A;  1B1Z A;  5C44 H;  4P2C B;  1T5E A;  1JR0 D;  5TSS A;  1C4Q A;  1JE4 A;  5M3F G;  4OIK A;  2F4V L;  1B3Q A;  4F88 A;  3VYT A;  1HFN A;  1VQF A;  3PUZ A;  4A3L H;  1TKW B;  4PQX A;  5CV9 A;  5M5W B;  4N8X 1;  1PH2 A;  3PF4 A;  4H13 C;  3S17 H;  4HJ8 A;  2VY3 A;  3E9I A;  2PQE A;  2L4N A;  2A6E C;  3PIP A;  4HAE A;  4X62 L;  1XNQ Q;  3K81 C;  1MSG A;  3MEH A;  3NEL A;  2NVY H;  1YVC A;  4XQQ A;  1I6V C;  1IW7 D;  1B9M A;  1XTC D;  4ABN A;  1IBK L;  1Y1V B;  1STN A;  3FDT A;  2JA6 H;  2A69 D;  3H15 A;  3NHH A;  2Z9H A;  1H95 A;  2IHF A;  3ERS X;  5E4X A;  1OXS C;  4X64 Q;  1PRT D;  3L3O C;  1S5F D;  1QNK A;  1QG7 A;  1NUC A;  1WCM G;  3BZC A;  2RCN A;  3PIO 3;  4HIO A;  3HRZ C;  2WAQ B;  4DV1 L;  1P8L A;  2PZW A;  3M4Q A;  4PZ7 A;  1SDF A;  1KDC A;  2KA7 A;  2BDO A;  5EGT A;  4C2M H;  2NVQ H;  4IFD I;  1K0S A;  3MHB A;  2VQF L;  1D1K A;  5A35 A;  1Y1W H;  1GUN A;  5C4J H;  2YTV A;  4DV0 Q;  1MIU A;  1LTL A;  5C3E G;  3DUZ A;  3GTJ H;  3Q0A A;  3TBI B;  1HHV A;  2H4O A;  3HZX A;  5HY6 A;  3E0J A;  3NPP A;  3U9S A;  2DGY A;  2DY8 A;  4IOA A;  3S17 B;  4XDX A;  5JOB A;  2F0N A;  3MWY W;  2C9O A;  2R7D A;  3CF5 A;  2Z8L A;  2B2V A;  4OWW B;  1JOO A;  5E1F A;  4APV A;  5J39 A;  3J80 L;  2K75 A;  4LFB L;  5K5P A;  4A3B H;  1CQF A;  3TDQ A;  1DOL A;  1VQL A;  2DNC A;  4K2L A;  1HR0 Q;  2O5I C;  4G7H C;  2K05 A;  4FF2 A;  3FRP B;  5C4H A;  1AN8 A;  5ELF A;  3D0F A;  3KJP A;  4HED A;  1SFO H;  4DR7 Q;  3DHQ A;  4H44 C;  2VB3 X;  4F8M A;  3STB D;  1X55 A;  1LTB D;  4CJ2 C;  2NVQ B;  4PZ8 A;  1B53 A;  4QCL A;  3J7Z C;  5M9O A;  1RIP A;  3DEP A;  3ULP A;  1PTO H;  2R7Z H;  2HUG A;  3GTJ B;  1WD1 A;  1Q90 A;  2NUC A;  3C46 A;  1BCP C;  4GS3 A;  2B63 H;  1G8Z D;  1HTL D;  1S72 A;  1ESF A;  5EJW A;  5KEE A;  2K5V A;  4OWX B;  2K01 A;  3Q23 A;  1O7Z A;  1NNX A;  5KIX A;  1EY9 A;  3K0X A;  4A3M B;  1L0Y B;  3CCQ A;  2K32 A;  4AYB E; 
#chains in the Genus database with same CATH homology
 4L5Q A;  2D0P A;  4AIM A;  1UEB A;  4YCV A;  1YJW A;  4P75 A;  1IBL Q;  1IBL L;  2QEX A;  3UDG A;  4POF A;  2MNA A;  1HZC A;  4GKK Q;  4C3J H;  4A3E H;  4GKK L;  3AFP A;  1Y1W G;  3I2Z A;  1E7Z A;  3HOX H;  3CAM A;  3PO2 H;  1Q81 C;  1EQR A;  4WJ4 A;  4L5R C;  4LF5 Q;  4KI0 A;  4LF5 L;  1L1O A;  1Z47 A;  4A3G H;  1FGU A;  2K4K A;  5IYD H;  3CCU A;  1I94 Q;  2IY5 B;  1B8A A;  2V1C C;  3EIV A;  4JI2 Q;  1I94 L;  3CC4 A;  1GM5 A;  4JI2 L;  4OX9 Q;  4A4I A;  1PYS B;  4OX9 L;  4FDB A;  4JV5 Q;  4HIM A;  4JV5 L;  5JJK A;  4GOP B;  4P72 A;  4DAY B;  1GKH A;  3PO3 H;  2AWO A;  1IYJ B;  3KDF B;  4JI5 L;  2UUC Q;  1R9T H;  3AYH B;  4LUO A;  2D62 A;  2IX1 A;  1NMG A;  2KHJ A;  4HJA A;  4JI0 Q;  2UXB Q;  1KD1 C;  4JI0 L;  1QVF A;  2UXB L;  4UY8 C;  2B3G A;  4ALP A;  3NEM A;  4LNQ A;  1LYL A;  4A3B G;  1NJI C;  5J3B A;  2VUM H;  4Y52 H;  3TQY A;  1IZ6 A;  1VQC A;  2EIF A;  4GN5 A;  5IWA Q;  2RHS B;  5IWA L;  4DV1 Q;  1QUQ B;  1P16 A;  1XPU A;  3HOU G;  3I4M H;  2HIX A;  1SN8 A;  1DGS A;  1YBY A;  1VQ7 A;  4OO1 I;  4L5T A;  3G48 A;  2AKW B;  1K0R A;  4LFA Q;  3TRZ A;  3OW2 A;  4LFA L;  1VCI A;  3PUX A;  2XTI A;  1KAW A;  4JBW A;  2RHQ B;  4R4I A;  2VQE L;  1PHJ A;  2JA7 H;  3AFQ A;  1Q86 C;  3CCE A;  3NEN A;  2JA9 A;  3PUW A;  2N78 A;  5GRO A;  1QZG A;  1TWA H;  4QY7 A;  4GN3 B;  2OQK A;  1X3F A;  3KOJ A;  4A3J G;  1QVC A;  1PH7 A;  1VQ5 A;  1VQB A;  4GLV B;  4LF6 Q;  3GTQ H;  4R4C A;  4LF6 L;  3A5Z B;  2N49 A;  1Y1V G;  3HFZ B;  1PH6 A;  5IYB H;  4GOP C;  2JA5 H;  1IL2 A;  1VQN A;  3CD6 A;  3S14 H;  3G4S A;  4B3M Q;  2CFM A;  2F3I A;  4OO1 G;  3A0J A;  2JEB I;  3Q8D A;  5IP9 H;  3CCV A;  3KFU A;  3TEH B;  1VQM A;  1K3R A;  3MXN B;  3J81 c;  4GKJ Q;  1FVI A;  1HH2 P;  2AMC B;  5C0X G;  1OTC A;  2Q2U A;  3S2H H;  1B7Y B;  1OXU A;  1N32 Q;  5JJL A;  4DV5 Q;  1PA6 A;  2R7Z G;  1N32 L;  4DV5 L;  2N8N A;  5LMU Q;  2BH2 A;  5LMU L;  3PSI A;  1O7I A;  4A3C G;  1PYB A;  3CP0 A;  4A3M H;  2WAQ G;  2Q2H A;  5LMN Q;  1I50 H;  5LMN L;  4A3F H;  2B63 G;  4LF7 Q;  1CKN A;  3HOZ H;  2AHO B;  3W5O A;  1IBM L;  1OXX K;  4C3I H;  2ZTD A;  3UDF A;  5C0X J;  3ICE A;  1VQ9 A;  4JYA Q;  1NMF A;  4NPS A;  4DUY L;  4BY7 H;  4A75 A;  2MQH A;  4X66 Q;  2JA8 H;  4X66 L;  1SE8 A;  4UPA A;  4DV7 Q;  5HGQ A;  4LWC A;  5M3M G;  3KJO A;  4DV7 L;  1J5E Q;  3PUY A;  1UE6 A;  1J5E L;  1V9P A;  2R92 H;  4JI8 Q;  5IP7 H;  1KIX A;  4JI8 L;  3W1B A;  2OWO A;  3JAM i;  1VQI A;  3UE0 A;  4A3I G;  4HJ7 A;  1UWV A;  3S24 A;  2Y0S E;  3CPF A;  3CXC A;  3S16 H;  3S15 H;  2CWA A;  4YWL A;  3GTK H;  4GNX A;  4A3E G;  4LF4 Q;  3I4N G;  2WP8 J;  1QZH A;  3GTO H;  2A19 A;  3F8T A;  4QGU A;  1PH1 A;  4NB3 A;  5BR8 Q;  4KHP Q;  5BR8 L;  4KHP L;  5FLM H;  3L2P A;  1UE5 A;  3K7U C;  3RN2 A;  1SR3 A;  4A3G G;  4J15 A;  5IYD G;  4DR2 Q;  4O2D A;  4DR2 L;  4NXM Q;  3NBH B;  2ZM6 Q;  4NXM L;  2ZM6 L;  5M5X H;  4HIK A;  2BH8 A;  2Q2T A;  4LW1 A;  3PO3 G;  4PG3 A;  2FXQ A;  3ER0 A;  4B3S Q;  5GAE C;  3RLN A;  1KQS A;  3VDY A;  3KF6 A;  2PQA A;  3M9B A;  1CKM A;  4OWT B;  3U50 C;  4DV6 Q;  4DV6 L;  3TS2 A;  3RLO A;  5IYC H;  3CME A;  4DR6 Q;  4IJL A;  4DR6 L;  1E24 A;  3M3Y H;  2UXC Q;  4YWK A;  5M5Y H;  2UXC L;  1FL0 A;  2YTX A;  4DPG A;  1K9M C;  1YEZ A;  2ZJP A;  4A3K H;  1Q1B A;  1EQQ A;  3KF8 B;  2VUM G;  1CSQ A;  4RMF A;  3HKZ E;  3I4M G;  1VQK A;  4IO9 A;  2XGT A;  2D0O A;  4A93 H;  5IY0 A;  3AQQ A;  2ZTE A;  5IE8 A;  2BA0 A;  2JA7 G;  5GAD C;  2KBN A;  3D31 A;  4YCU A;  1YHB A;  4ME3 A;  4JI1 Q;  1VQ4 A;  1N34 Q;  4JI1 L;  1HNW Q;  1J6Q A;  1UE7 A;  1N34 L;  1HNW L;  1E1T A;  1MKH A;  4DR3 Q;  3TS0 A;  4DNI A;  2MO0 A;  1S3O A;  2JK8 A;  4DR3 L;  1MJC A;  1AE3 A;  1GO3 E;  3EBE A;  4H02 A;  1GVP A;  3RLF A;  5E7N A;  1TWF H;  2VNU D;  2R93 H;  1X6O A;  2E2H H;  2K52 A;  5IYB G;  1K8A C;  2JA5 G;  2F52 A;  3FHW A;  2GVB A;  2K50 A;  4P71 A;  4X65 Q;  4JI3 Q;  2PI2 A;  1YZ6 A;  4JI3 L;  5IT9 c;  4X65 L;  3PIO A;  1G51 A;  3OTO Q;  3T1Y Q;  1JJC B;  3B6Y A;  3OTO L;  3T1Y L;  4TQU S;  1EFW A;  1JE5 A;  5GAG C;  4JI5 Q;  5FJ8 G;  4PZ6 A;  3G6E A;  3M7N A;  1K73 C;  1T9H A;  2E8G A;  1XMQ Q;  1JMC A;  1XMQ L;  4O0A A;  4DR5 Q;  3HOW H;  1Q12 A;  3J80 i;  4DR5 L;  1N33 Q;  3HOY G;  3PV0 A;  1N33 L;  5ELN A;  4PMW A;  1KC8 C;  2N3S A;  2QA4 A;  3S1Q H;  4DAM A;  3UE1 A;  1L0W A;  4JBK A;  4A3M G;  2MO1 A;  1JJ2 A;  3K7A H;  3RZD H;  3GTL H;  3HOZ G;  4DKA C;  4A3F G;  1D7Q A;  1PH9 A;  4UP8 A;  3CQZ H;  1QVG A;  3A5U A;  2HIV A;  1Z9F A;  3H0G G;  1PH8 A;  4BY7 G;  2CWP A;  3L0O A;  4LF8 Q;  4LF8 L;  2JA8 G;  3OYY A;  2VQE Q;  3HOV H;  2IT1 A;  1BBW A;  2JEA I;  3I4O A;  3JAM c;  5C0X I;  2R92 G;  3S2D H;  2WB1 G;  2K5N A;  5IP7 G;  1SLJ A;  1E1O A;  1WFQ A;  1FJG Q;  3U4Z A;  1A62 A;  1FJG L;  1CKN B;  2DUD A;  4EX5 A;  1VQJ A;  4X64 L;  1EIF A;  3I7F A;  2AWN A;  3CW2 C;  1ASZ A;  4UP7 A;  2LXK A;  5GQO A;  2OTL A;  3H3V I;  1YIJ A;  4IPC A;  5M3F H;  1M1K C;  1KRT A;  1XMO Q;  3RZO H;  1XMO L;  3GD7 A;  2HHH Q;  3G71 A;  2KHI A;  4B3T Q;  1BKB A;  1E22 A;  2YTY A;  3L7Z C;  3PCO B;  2HHH L;  4B3T L;  1JJG A;  5FLM G;  3F2B A;  4R4Q A;  5JJI A;  2Z6K A;  4GOP A;  2YYZ A;  3HKS A;  1TWC H;  1N36 L;  3CCL A;  1YHA A;  3ULJ A;  2NN6 I;  1LM0 A;  4GN4 B;  3CCM A;  3RN5 A;  3S1R H;  3PUV A;  1AE2 A;  1YIT A;  4LFC L;  1ASY A;  2I5M X;  5GAH C;  1IBM Q;  4AYB G;  1V43 A;  1PV4 A;  4DV4 Q;  4DV4 L;  2UU9 L;  4DUZ Q;  1N9W A;  2R6G A;  4DUY Q;  4DUZ L;  2ATW A;  1TWG H;  3FKI H;  4GLX A;  3RR5 A;  2E5L Q;  1QUQ A;  1W3S A;  2E5L L;  4A3K G;  4JYA L;  1BVS A;  1VQ6 A;  4GKJ L;  4BY1 H;  2L15 A;  2YV5 A;  4IFD G;  2PI2 E;  2KCT A;  4JBM A;  1VQO A;  2ZTC A;  2NN6 G;  1TXY A;  1M90 C;  1Q46 A;  4LUZ A;  4BA1 I;  1V1Q A;  3KF6 B;  2PQA B;  2VZA A;  1HR0 W;  2YU9 H;  2GVA A;  3S1M H;  4BBR H;  4DR1 Q;  4DR1 L;  2OTJ A;  1S40 A;  1HZB A;  2K5H A;  4IFD J;  2ES2 A;  4A3D G;  1WCM H;  3E9H A;  3KLW A;  1A8V A;  3TRE A;  2ASB A;  3CCS A;  3HOX G;  1YJ9 A;  2H5X A;  3PO2 G;  2GN5 A;  4DR4 Q;  1SRO A;  1HR0 L;  4DR4 L;  1X3G A;  1SRU A;  3FP9 A;  2R93 G;  4MZ9 A;  4JOI C;  2A8V A;  3U4V A;  3BJU A;  3GTP H;  1C7Y A;  3UDX A;  4C3H H;  4XIG S;  4LF9 Q;  3BU2 A;  1HNZ Q;  4LF9 L;  1XPR A;  1HNZ L;  3U58 A;  5C3E H;  4JI4 Q;  1HZA A;  1WJJ A;  4IPG A;  1Y1V H;  5JEA G;  3J80 c;  4JI4 L;  3SGI A;  4JCV E;  1C9O A;  4XTC S;  4BBS H;  4K0K Q;  4QQB X;  4K0K L;  1L1O B;  1OXT A;  2VS1 A;  5FLX c;  1PH3 A;  2ZJQ A;  3CC2 A;  2JE6 I;  5JEA J;  5C4X G;  1WOC A;  2HT1 A;  2NVT H;  4R4O A;  1G6P A;  1UE1 A;  2RF4 A;  4BA2 I;  2BA1 A;  1EIY B;  4IPD A;  3BZK A;  3CC7 A;  3ZJY C;  2EQS A;  4R1J A;  3M85 A;  3M4O H;  1NTG A;  1KHI A;  4LUV A;  4DV3 Q;  1X54 A;  2VL6 A;  4DV3 L;  1VQ8 A;  2I0Q A;  2NZO A;  4L5S A;  2JQO A;  1NBW A;  2R7F A;  5C44 H;  5M3M H;  1X65 A;  5K36 G;  2I5L X;  5M3F G;  2F4V Q;  2F4V L;  2WAQ E;  1VQF A;  3PUZ A;  3AEV A;  5IP9 G;  1VQA A;  4A3L H;  1RL2 A;  4X6A H;  1YNX A;  2ALY B;  2NZH A;  1XTD A;  1PH2 A;  3PF4 A;  1L1O C;  1PH4 A;  3S17 H;  4HJ8 A;  2VY3 A;  1X56 A;  3E9I A;  3GTM H;  1XPO A;  2CQO A;  3I4N H;  1JT8 A;  3PIP A;  4X62 Q;  3CCR A;  3RNU A;  2E2J H;  4X62 L;  1Q7Y C;  1XNQ Q;  2ID0 A;  3K81 C;  1VQP A;  1XNQ L;  2E2I H;  2OCE A;  2NVY H;  1YVC A;  2Q2I A;  3NEL A;  4BXX H;  4JI7 Q;  1CSP A;  2Y0S G;  4JI7 L;  2HQL A;  1IBK Q;  1IBK L;  3EN2 A;  1HNX Q;  3CPW A;  1HNX L;  3FKI G;  5C4X H;  4YY3 Q;  4YY3 L;  2JA6 H;  3PF5 A;  4BY1 G;  4IOC A;  3H15 A;  1CUK A;  1Q1E A;  1LUZ A;  2UUA Q;  2UUA L;  2UUC L;  1I6H H;  1AH9 A;  1G29 1;  5EAY A;  1H95 A;  3I56 A;  2IHF A;  3ERS X;  1OXS C;  2LXJ A;  1OXV A;  4X64 Q;  4HID A;  1I5F A;  5DLQ E;  2WFW A;  4RG1 A;  4BBR G;  4AQY Q;  4AQY L;  3F2D A;  1EOV A;  4YWM A;  1A63 A;  1WYD A;  4P74 A;  2UXD Q;  2UXD L;  1WCM G;  3BZC A;  2RCN A;  4OON A;  4QJF A;  4HIO A;  3GO5 A;  4DV1 L;  2CCZ A;  4Y7N H;  4A3D H;  4DK6 C;  1P8L A;  3W1G A;  3M4Q A;  4PZ7 A;  5AJ3 Q;  5AJ3 L;  4C2M H;  2NVQ H;  2VQF Q;  1VQE A;  1X9N A;  4IFD I;  2VQF L;  3KDF A;  1N36 Q;  1Y1W H;  4DV2 Q;  4AH6 A;  4TVA B;  1U0L A;  4DV2 L;  4LFC Q;  5C4J H;  2YTV A;  1C0A A;  3HKZ G;  4GNX B;  4DV0 Q;  1MIU A;  1LTL A;  3STB C;  4DV0 L;  4B3R Q;  4B3R L;  5C3E G;  3GTJ H;  2EXD A;  4UP9 A;  1E3P A;  4EQ5 A;  2UU9 Q;  2Z6K C;  2UUB Q;  1XJV A;  5IYC G;  5HY6 A;  2UUB L;  4BBS G;  1HZ9 A;  2KEN A;  1KXL A;  1K8G A;  2DGY A;  4B3M L;  4IOA A;  4KLK A;  3M4P A;  2B29 A;  5H1S E;  5FJ8 H;  5LMN W;  2CKZ B;  4JG2 A;  1EYG A;  4HJ5 A;  1Y14 B;  2R7D A;  4IPH A;  3CCJ A;  3CF5 A;  4OWW B;  1VQG A;  2A1A A;  3HOY H;  4JBJ A;  4A93 G;  1U5K A;  4APV A;  1PH5 A;  2K75 A;  4LFB Q;  3DM3 A;  4LFB L;  4QIW E;  3PGZ A;  4P73 A;  1MJE A;  4A3B H;  4A76 A;  1XNR Q;  4LF7 L;  2PNH A;  2MFI A;  3MEF A;  1VQL A;  4QL5 A;  1XNR L;  1IXR A;  1YHQ A;  3JC6 6;  5M5W H;  3HOU H;  4YHH Q;  4YHH L;  4NXN Q;  3H0G H;  3LGJ A;  4NXN L;  2ZJR A;  1HR0 Q;  3I55 A;  3GDE A;  1HJP A;  5C44 G;  2I5H A;  3WWV A;  1YJN A;  3GTG H;  3KJP A;  1EUJ A;  1GD7 A;  3D0F A;  4WJ3 M;  1I3Q H;  4GNX C;  4YCW A;  1SFO H;  1VQH A;  4R4T A;  1Q82 C;  2Z0S A;  3CMA A;  4A3L G;  1CKO A;  4A3J H;  1WI5 A;  1VS0 A;  1L2F A;  4DR7 Q;  4IJH A;  4HJ9 A;  4DR7 L;  1K83 H;  3E0E A;  4JOI A;  1D8L A;  3STB D;  3HOW G;  2LSS A;  1TWH H;  1X55 A;  1N8R C;  4LF4 L;  2IHE A;  1Q8K A;  3J7A 5;  2C35 B;  4PZ8 A;  4MTN A;  1W2B A;  3J7Z C;  2WB1 E;  2K14 A;  1BBU A;  4OXP A;  5ELO A;  1RIP A;  3KYH C;  4BXX G;  2NVX H;  3S1N H;  1SMX A;  3ULP A;  3J81 i;  1NE3 A;  1X3E A;  3K8A A;  2R7Z H;  4GLA C;  2OQ0 A;  1NY4 A;  1VQD A;  4KHZ A;  1PVO A;  4A3C H;  1KL9 A;  4MNO A;  2IX0 A;  4GS3 A;  3T1H Q;  2B63 H;  3T1H L;  4JC0 A;  4B3S L;  2JA6 G;  3HOV G;  3ULL A;  2PMZ E;  3F1Z A;  1KRS A;  3H3V H;  1S72 A;  4DK3 C;  3A74 A;  2JJQ A;  3DLL A;  1B70 B;  2KCM A;  3IRB A;  3J81 j;  2QGQ A;  2K5V A;  4OWX B;  1JB7 A;  4POG A;  2VW9 A;  4JI6 Q;  4JI6 L;  3UDI A;  3K80 C;  3F2C A;  3K0X A;  1EWI A;  1A0I A;  1YI2 A;  3CCQ A;  1PFS A;  4A3I H;  4AYB E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...