1QZHA

Crystal structure of pot1 (protection of telomere)- ssdna complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
170
structure length
170
Chain Sequence
VIDSLQLNELLNAGEYKIGELTFQSIRSSQELQKKNTIVNLFGIVKDFTPSRQSLHGTKDWVTTVYLWDPTCDTSSIGLQIHLFSKQGNDLPVIKQVGQPLLLHQITLRSYRDRTQGLSKDQFRYALWPDFSSNSKDTLCPQPMPRLMKTGDKEEQFALLLNKIWDEQTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords telomeric single-stranded DNA
publication title DNA self-recognition in the structure of Pot1 bound to telomeric single-stranded DNA
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein/dna
total genus 43
structure length 170
sequence length 170
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02765 POT1 Telomeric single stranded DNA binding POT1/CDC13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1qzhA00
4C3IH 2BA1A 2IHFA 1HNWQ 3JC66 1Q46A 1AE2A 1VQFA 4GS3A 4A3MH 3PSIA 2HHHL 1TXYA 2KBNA 3CC7A 3U50C 4GNXA 3M3YH 5GAGC 5JJLA 2IY5B 4Y7NH 3PUYA 5E7NA 5HY6A 2QA4A 4AYBG 1YJWA 1TWFH 2LSSA 1V9PA 5IP7H 1PH1A 2GVBA 4QQBX 1X6OA 3A74A 1Q8KA 2F4VL 1YBYA 4DV4L 1O7IA 5IYBH 3HOUH 2C35B 4PZ7A 4AYBE 3S1RH 4BA1I 1VQLA 3DLLA 4JI3Q 2HT1A 3GTPH 5M3FH 5IYDH 4HIMA 4DR3Q 1EOVA 3PUWA 1CSPA 1PH7A 3F2CA 4DAMA 1IBML 4GN5A 1U5KA 2ZJRA 3I56A 4PZ6A 4NXNQ 2PI2A 3CC4A 3TQYA 1Z47A 2HIXA 2XTIA 2B29A 2R93H 1HNXQ 2KCTA 4JBJA 4QY7A 1I50H 1D7QA 4DR6L 4X62Q 3J7ZC 2UXBQ 1SR3A 1B8AA 1VQBA 3M9BA 5FLMH 4BXXH 4IPDA 4X64Q 4JI5L 4DV3L 1VQIA 3FP9A 3G4SA 4POFA 3K8AA 4A3GH 4JYAL 1PH5A 4LFBL 1QUQB 1A0IA 1I94L 1K0RA 1RL2A 4JBWA 2KCMA 4P71A 4PMWA 4QIWE 4LF8Q 4OXPA 3HOYH 3J81c 2ATWA 1Q1EA 3BJUA 2QGQA 1CUKA 1QZGA 3GTKH 1K8AC 2HIVA 4OO1G 4P74A 2VNUD 1HNWL 1U0LA 4A3IG 1Y1WG 1BKBA 1AH9A 1VQGA 4C2MH 1KQSA 2UUBQ 3H3VH 2BH8A 2AMCB 1Y1VH 4NB3A 4TVAB 4HJ5A 1P8LA 1PH9A 4K0KQ 2K50A 5IP9G 4GOPC 4BY7G 4DV2Q 5K36G 3PF4A 4GKKQ 1E7ZA 3LGJA 2BH2A 3PO3G 2RCNA 2E5LL 2MQHA 1JJCB 4JI3L 4YY3L 1UWVA 4GNXB 2F52A 4DR3L 4DV0L 5M5YH 4NXNL 5IP7G 5J3BA 4BA2I 3J81i 2B3GA 1Q1BA 1XMQL 4LFCQ 4BY1G 3OTOQ 1FVIA 4IPCA 4KI0A 4R4CA 4JI6Q 3HOUG 2UXDQ 4Y52H 3AEVA 1Q12A 1OXTA 2EIFA 1HNXL 5AJ3Q 3RR5A 3RZOH 3M4OH 3J80i 2NVXH 2UUCQ 1E22A 2R7ZG 1ASZA 4X62L 1KAWA 2UXBL 4IJHA 1PYSB 2A19A 1X54A 3K7AH 5JEAG 1VQ5A 5M3MG 4DKAC 4GN3B 3PO2G 4PZ8A 1EQQA 2ZTDA 4GOPB 1E3PA 2HHHQ 2MFIA 3F1ZA 1OXSC 1K73C 4IOAA 4IO9A 2YU9H 3F2BA 3T1YQ 4UPAA 1Q7YC 1C0AA 2UU9L 3U4VA 3M7NA 3H3VI 4GLAC 1SLJA 3STBD 3KLWA 4WJ4A 4LFAL 4DV4Q 2PMZE 1IXRA 1NY4A 1S3OA 3HOWG 4YWMA 4R4QA 4DR1L 1IBMQ 2AKWB 2NN6G 4L5TA 4JI0L 2BA0A 2NZHA 5C0XG 5GQOA 3M4QA 1HZCA 4AH6A 4J15A 3CF5A 1BVSA 3A5UA 2ZM6Q 2R92G 2JJQA 3BU2A 5GAEC 5M5XH 3EBEA 4JG2A 4JOIA 3TEHB 4JI4L 1UE1A 4BBSH 2MO0A 3PUXA 4A3CG 1SROA 1Y1VG 4DR6Q 2R7FA 2HQLA 4UY8C 3CPWA 1GO3E 3K7UC 4IPHA 3KOJA 3M85A 1SN8A 1YVCA 4JCVE 1K8GA 1PVOA 1UE5A 3CCMA 2MO1A 4DV3Q 4JI5Q 1OXVA 4LF5L 3S1QH 4IOCA 5C4XG 1E1TA 2OQKA 4YHHL 4DPGA 4JI1L 4C3JH 4GLXA 2ZTCA 3HOXG 4LF7L 4R4OA 4JYAQ 4AQYQ 4LFBQ 3L7ZC 2JA9A 1I94Q 2WB1G 3I7FA 2JE6I 5IWAL 2OTJA 1GKHA 2VY3A 4NPSA 1FJGL 2JEAI 3KFUA 2EQSA 3PV0A 3BZCA 2PI2E 3HKSA 1XJVA 4JV5Q 2ZJPA 2WB1E 3TREA 5IP9H 1NJIC 4BY7H 3CW2C 3Q8DA 3S1NH 4UP8A 4B3RQ 3KJPA 2Q2IA 2WFWA 1KXLA 1NTGA 1VQOA 3PO3H 2A1AA 4MZ9A 1MIUA 1SE8A 1KD1C 3T1YL 4L5SA 2AWNA 2V1CC 3UDFA 1WI5A 1QZHA 1FGUA 2CFMA 1W3SA 1PH4A 1EYGA 4JI7L 1NE3A 4ALPA 4BY1H 2E5LQ 1HJPA 2ZJQA 1VQ6A 4YY3Q 4JI8L 3J81j 3CCEA 2EXDA 4DV7Q 1QVFA 3MXNB 4DV0Q 4XTCS 3D0FA 3AYHB 1GM5A 1VCIA 2R7ZH 1GVPA 1XMQQ 1WOCA 1G51A 5EAYA 2RF4A 2ZM6L 5ELNA 2PQAB 1GD7A 4UP9A 5M3MH 3JAMc 3CCLA 5HGQA 3PO2H 4H02A 4HIDA 1CKNB 1IBKL 2ALYB 4O0AA 2WP8J 5BR8L 1LM0A 5FJ8G 2VQEL 3RN5A 4DUYQ 1C7YA 1PA6A 3ICEA 4OO1I 3HFZB 3HKZG 2K75A 1G6PA 4QJFA 4EQ5A 4YCWA 1C9OA 2E2HH 1E24A 1S40A 4BBSG 3GDEA 2KENA 3HKZE 4YCVA 4GNXC 1L1OA 4TQUS 5LMUQ 4AQYL 3HOWH 3B6YA 3S14H 4APVA 5DLQE 4QGUA 2I5MX 2ES2A 4X66L 2UU9Q 1X65A 3G48A 2RHSB 2YYZA 4MTNA 2UUAQ 1SRUA 4GLVB 3RLOA 4DK6C 4LFAQ 4JV5L 4R4TA 4B3SL 3UDXA 2R92H 2VZAA 4IFDI 4KHPL 4B3RL 1RIPA 5ELOA 3JAMi 4DR1Q 4NXMQ 2VL6A 5GADC 3E0EA 1VQ4A 4A3EG 1PH3A 1EIYB 4JI0Q 4OWWB 1I5FA 4A3CH 1TWCH 3PIOA 3CCUA 3KYHC 1NBWA 5C4XH 3PIPA 4HJ8A 4JI4Q 2CKZB 1YHAA 1S72A 3HOXH 3TRZA 1I3QH 1KHIA 4DV7L 4DV5L 4IFDG 4LF5Q 1PH8A 1UE6A 2I5HA 1BBUA 3KDFA 2WAQG 3CC2A 4HIKA 3PUVA 4YHHQ 4A3FG 4JI1Q 1PHJA 1J5EL 4LF7Q 1XPUA 2UXCQ 4A3KG 1K9MC 3KF6A 3H0GG 1YJNA 2WAQE 2Z6KA 2Q2TA 2D0PA 3CP0A 5IWAQ 5LMNQ 4DR5Q 4B3TQ 1FJGQ 1LUZA 1VQDA 3E9HA 1XNRL 1B70B 1DGSA 1HZBA 3E9IA 1EIFA 4DUYL 2NVTH 1EUJA 4BBRG 1EFWA 2K14A 2FXQA 2NN6I 3GO5A 1YHBA 3W5OA 3KJOA 3H15A 2OQ0A 1IZ6A 5C0XI 1TWGH 4LF4L 1N8RC 2AHOB 2JEBI 2E2IH 3AFQA 5LMUL 4ME3A 4LF6Q 1XNQL 4JBKA 3HOVG 4RG1A 1WCMG 2JA5G 4DR7L 4MNOA 1MKHA 2E8GA 2UUAL 4A3BG 5JJIA 1VQKA 4YCUA 4JI7Q 3NEMA 4JI2Q 1K83H 1T9HA 4RMFA 3FKIG 4UP7A 1CKMA 2L15A 3K81C 4JI8Q 2R6GA 1IBLL 3EN2A 4B3ML 3GTMH 3J7A5 1HH2P 2YTYA 4NXML 3TS2A 2I0QA 2CCZA 2JK8A 3PGZA 1HNZQ 5FJ8H 3UDGA 3I4NG 2R7DA 5C3EG 2IHEA 4R1JA 4WJ3M 1K3RA 1VQJA 2I5LX 3MEFA 5LMNW 3UDIA 4DNIA 2ID0A 4LUVA 4DR4L 1L0WA 1VQAA 1AE3A 4C3HH 3G6EA 1IBKQ 5BR8Q 4LF9Q 2VQEQ 4JBMA 1PH2A 1MJCA 1JJ2A 4LF9L 1D8LA 1VQNA 4A3LH 3S2HH 4KHZA 1VQCA 1P16A 4OWTB 1YHQA 2N78A 2Y0SG 1V1QA 2LXKA 4HJ7A 2OTLA 4HJ9A 4A93G 3GTGH 3NBHB 2DUDA 4LNQA 2UXCL 4GKJL 2Y0SE 4IJLA 5LMNL 4DR5L 1VQ8A 1X9NA 4B3TL 4X66Q 4A3EH 4A76A 4A3JG 2VQFL 1A8VA 1W2BA 1SFOH 1PYBA 3KDFB 4B3SQ 4L5RC 4KLKA 4OWXB 2GN5A 3GTOH 3OW2A 3S16H 4KHPQ 2JA7G 2OWOA 2DGYA 5C4JH 3ULLA 3K0XA 3S15H 3F8TA 4PG3A 1Q81C 1HR0Q 1N33L 4QL5A 4LF6L 2XGTA 3G71A 3RZDH 2D0OA 3M4PA 1V43A 2MNAA 1TWAH 4JOIC 5IY0A 3T1HQ 4A3FH 2JA6G 4JI2L 1VQPA 4A3KH 2AWOA 1CSQA 2YTVA 3CCJA 3H0GH 4HJAA 1N36Q 2D62A 5H1SE 4DAYB 3RLFA 2RHQB 5FLXc 2K5NA 4DV5Q 5M5WH 1X56A 2IX1A 2Q2HA 3UE1A 1HNZL 1FL0A 1HZAA 4OX9L 1J5EQ 4XIGS 4BBRH 1A62A 2JQOA 2KHIA 2NZOA 1YIJA 3S24A 1UE7A 4X6AH 3U58A 1XNRQ 2K4KA 3ERSX 1NMFA 1NMGA 1IYJB 4DR2L 4DUZQ 4X65L 1X3EA 3OYYA 3I55A 3HOVH 1H95A 1PH6A 3CCSA 2JA8G 1WCMH 2JA5H 1HR0W 1WYDA 4A3BH 1EQRA 3GTQH 4AIMA 1XMOQ 4LF4Q 1L2FA 2CWAA 4YWLA 1LYLA 3FKIH 3GTLH 1I6HH 4FDBA 5C44G 1XNQQ 4P75A 4A3LG 2ASBA 4A75A 2H5XA 1X55A 3NELA 4DR7Q 4DV6L 3I4NH 4GOPA 5C3EH 2IT1A 1N32L 4JC0A 4B3MQ 3L0OA 5IYCG 2GVAA 1IBLQ 1KRTA 1XPRA 1KL9A 3KF8B 1N34Q 2VUMG 1PFSA 4DV1Q 3S1MH 3AQQA 5IT9c 1HR0L 2CWPA 2N8NA 4GN4B 3F2DA 3CCVA 1R9TH 4DR4Q 3U4ZA 1WFQA 2B63G 3D31A 2VS1A 3RN2A 3I4MG 4A93H 3T1HL 3EIVA 4LW1A 1XPOA 1N36L 2VW9A 4A3DH 2E2JH 1VQ7A 4LUZA 1VQHA 1XTDA 2YV5A 1KRSA 4A3JH 4O2DA 3W1GA 1Y14B 3J80c 1JE5A 1YI2A 1L1OC 3ZJYC 4A4IA 1Q82C 2JA7H 4GKJQ 1PV4A 3PUZA 3TS0A 1TWHH 3VDYA 1YJ9A 2CQOA 2VQFQ 3CD6A 1Q86C 1CKOA 4DUZL 3PCOB 1VQEA 3S2DH 1JJGA 4A3MG 3K80C 3I2ZA 1EWIA 4IPGA 2QEXA 1A63A 3CMEA 1QVGA 2JA6H 5JJKA 2ZTEA 3ULJA 1XMOL 1N33Q 2F3IA 1QVCA 4LUOA 4POGA 3CMAA 4EX5A 2N3SA 5IYBG 3HOZG 1YITA 1SMXA 3A5ZB 2KHJA 5IYDG 3WWVA 5M3FG 1YZ6A 3PF5A 3CXCA 2N49A 1L1OB 1N34L 1VS0A 3ULPA 4IFDJ 3BZKA 4DV1L 2YTXA 2NVQH 2Q2UA 4OX9Q 3DM3A 4X64L 1JB7A 2R93G 1X3FA 2JA8H 1VQMA 2Z0SA 3FHWA 5GAHC 1B7YB 2Z6KC 3STBC 2PNHA 1LTLA 5FLMG 4DR2Q 1OXXK 1VQ9A 4X65Q 1KC8C 4LF8L 5C44H 4BXXG 1JT8A 5JEAJ 2PQAA 4YWKA 2F4VQ 3RLNA 3CCQA 2OCEA 3A0JA 2LXJA 4A3GG 3GD7A 1HZ9A 4DK3C 1CKNA 2K52A 1MJEA 3S17H 5IYCH 3CAMA 3HOYG 2UUBL 1OTCA 3CQZH 3NENA 4A3DG 1YEZA 2VUMH 3I4OA 3W1BA 4HIOA 3RNUA 4K0KL 4DV6Q 1YNXA 3IRBA 4DV2L 1N32Q 4P73A 3AFPA 3L2PA 2K5HA 5GROA 4GKKL 1QUQA 3UE0A 2B63H 2NVYH 3CCRA 1BBWA 3I4MH 3HOZH 1IL2A 3KF6B 4R4IA 1JMCA 3ER0A 5C0XJ 5IE8A 1KIXA 2A8VA 4L5QA 3GTJH 1M1KC 1J6QA 4LFCL 3OTOL 4JI6L 2K5VA 4OONA 2UXDL 1ASYA 1X3GA 1OXUA 4A3IH 1Y1WH 1M90C 2IX0A 1E1OA 1N9WA 1Z9FA 3CPFA 5AJ3L 1UEBA 1G291 4P72A 2UUCL 3SGIA 1WJJA 4LWCA
chains in the Genus database with same CATH superfamily
4C3IH 2NVYB 2B63B 2BA1A 3I4MB 5E1FA 5EBCA 4DK0A 1LO5D 2KBNA 3U50C 1U4PA 2MGSA 4GNXA 3V2TA 4Y7NH 4L63B 3PUYA 1A6XA 4AYBG 1WTQA 5IYBH 2C35B 2OT2A 3MHBA 4PZ7A 4JI3Q 3HOZH 3DLLA 4QCLA 5IYDH 2E75C 1DOLA 2I07B 4HIMA 3PUWA 3F2CA 3A7AB 2ZJRA 4PZ6A 4UAIA 3E5SA 2B8FA 1EL0A 1E2WA 1BCPF 4FF3A 4DR6L 2O2LD 2PW5A 1SR3A 1VQBA 2F03A 3S1RB 3SK4A 4DV3L 1YNNC 1R4PB 4A3GH 5ELDA 1STGA 3C2PA 2KCMA 2NBFA 3BJUA 1NR4A 2E76C 4B9XA 1I50B 3I4LA 2HIVA 2VNUD 3V05A 4FF4A 1U0LA 3H94A 4A3IG 1Y1WG 1BKBA 1LLRD 4C2MH 3H3VH 4NB3A 4J6HA 1PH9A 5CORA 3A56A 1U4LA 2DJFC 3LGJA 2BH2A 2RCNA 2E5LL 1ILQA 1TS4A 4YY3L 1AW7A 4DR3L 3T16A 4K5XA 3RUZA 1BR9A 5J3BA 2B3GA 5J39A 1O7YA 1PTOC 3TP7A 3AEVA 1ET6A 3SEBA 3URYA 1HNXL 2F0HA 3QG1A 3RR5A 1LTRD 4N8X1 4FNFA 2NVXH 1E22A 5I6WA 1ASZA 4IJHA 1BQQT 4K5WA 4KKUA 5JEAG 4FVMA 2EZVA 1LABA 1OXSC 1K73C 2YU9H 3F2BA 2F0SA 3T1YQ 3U9SA 2UU9L 3U4VA 3M7NA 1SLJA 3OWFA 3KLWA 3D4WA 4KY6A 4DV4Q 1S3OA 1LTGD 3HOWG 4F7XA 4DR1L 2LKVA 4L5TA 4AH6A 4J15A 2ZM6Q 2AUJD 3J7YW 4Q5VA 5DM73 1Y8PB 4FF1A 3PUXA 4A3CG 1GO3E 2EYHA 3K7UC 3NQTA 1YVCA 4JCVE 2B39A 3CCMA 4JI5Q 5C4XG 3S1QH 2F3WA 2OQKA 4YHHL 4C3JH 4OO1H 3KF8A 4JYAQ 4LFBQ 2F0PA 1CI3M 1NNXA 1GJXA 3SR1A 2VY3A 2JEAI 1S5ED 3K58A 1PFNA 5FLXL 2ZJPA 5IP9H 1XJVA 2PZTA 3A55A 3CW2C 4UP8A 5CBAE 3KJPA 2WFWA 4BS9A 1KXLA 4KY7A 3PO3H 1D5XC 1MIUA 4DK1A 2V1CC 1NCVA 3UDFA 3EA6A 1FGUA 3QB3A 1CM9A 3D8GA 5ELEA 4ALPA 1DOKA 1HJPA 1O80A 2ZJQA 1VQ6A 3J81j 3MXNB 2ICIA 1VCIA 5CV7A 1MGSA 1GVPA 2BDNA 3M3YH 2RF4A 4UP9A 5M3MH 4ILWA 3K57A 1CKNB 4LF9L 2VQEL 2ENBA 4DUYQ 1PA6A 4KHVA 1B44D 2K75A 5EGTA 1G6PA 4QUCA 4QJFA 5M3FB 5IT9L 1C9OA 2KENA 4TQUS 1O78A 3A8KE 1TVXA 4R8NA 2L5TA 2NN6H 3TN2A 5K5PA 2ES2A 3PO2B 3G48A 5KEEA 1LT3D 4MTNA 1SRUA 4GLVB 3W3AA 2F0MA 4LFAQ 4JV5L 1ENAA 1SBBB 3UDXA 2R92H 2VZAA 3CKIB 3DM1A 3E3XA 2F0WA 2VL6A 1VQ4A 4A3EG 1PH3A 1Z7TA 3J7AV 5K36H 4KY5A 3H6MA 3S14B 2IPKD 1KHIA 1K8OA 3IKJA 3NPPA 4DV7L 5COYA 4ZRZA 4LF5Q 1UE6A 2DY8A 2WAQG 3CC2A 4CDCC 5JPNC 3PUVA 4DXFA 4A3FG 4JI1Q 4CBVA 1Y1VB 1KDBA 4QMGA 4ZAIA 4A3KG 2UXCQ 4DR5Q 3CP0A 5IWAQ 1SNOA 2B2WA 1LUZA 3K5OA 1B70B 1DGSA 3NQIA 1EIFA 5I6YA 3HOXB 1I3QB 4BBRG 3GO5A 1YHBA 3H15A 2B2UA 2K05A 2OQ0A 1T5XD 5C0XI 1S5CD 2E2IH 3AFQA 5LMUL 4LF6Q 2L9HA 4RG1A 4DR7L 2E8GA 2FHTA 4JI7Q 2K5QA 3FKIG 4ME5A 2F0VA 2L15A 3QIAA 4JI8Q 4B3ML 1IBLL 4IUUA 4NXML 2I0QA 3HZXA 2JK8A 5BN4A 1MD2D 3I4NG 4LAAA 2R7DA 2IHEA 4R1JA 2SEBD 2IX3A 4DR4L 1L0WA 4C3HH 1TS2A 1KNAA 3L9AX 5KNBA 1UNSA 2KEDA 2F0DA 4A3LH 4KHZA 1VQCA 2VB3X 2B2TA 3FEWX 1V1QA 2LXKA 3KLRA 3GTGH 4LNQA 3Q6SA 1RJTA 5C5MA 1VQ8A 4B3TL 4X66Q 1B1ZA 1L0YB 1SFOH 4KLKA 2EVBA 1I4GA 2BCOA 3S2HB 5C4JH 3ULLA 3S15H 1C48A 4XYOA 1QJOA 2G9DA 2A6EC 3G71A 2Z4HA 2XNAC 3M4PA 4KD4A 4V190 1TWAH 4JOIC 1X32A 1CA6A 2JA6G 1BOSA 4JI2L 4DN4M 2AQ1B 4OIKA 2O5IC 1RKNA 2AWOA 4Q0FA 4XYQA 4HJAA 3H0GH 2IW3A 3RLFA 2RHQB 3MZ5A 3WOEA 5M5WH 2IX1A 4DU9A 4DXGA 2NZOA 4IURA 1I6VC 1K8MA 1V1PB 1NMFA 1NMGA 2ZT9C 4DUZQ 3K5MA 3I55A 2IJ0A 2JA5H 4A3BH 4C56C 4AIMA 3EFXD 4C3HG 2CWAA 1L0XB 1JR0D 1I6HH 1XNQQ 2EY2A 4A3LG 4X3TA 2ASBA 2H5XA 5C3EH 3KBGA 3J81L 4PV1C 2XIWA 1N34Q 3KF8B 1GHKA 1WCMB 4DV1Q 2K7VA 2E2HB 2P5ZX 2CWPA 2N8NA 3VYUA 1DYQA 1HQMC 3BYTB 2VS1A 4FXGC 1SE4A 1B9MA 1GUWA 2VW9A 2YV5A 2KQ3A 4O2DA 1SYCA 1TY0A 1Q82C 5C4ZA 3G6JB 4KV6A 1TWHH 5I2XA 3VDYA 2VQFQ 1V8QA 1HTPA 4A93B 1STEA 2DNCA 1A2UA 4DFAA 4A3MG 1JJGA 3I2ZA 1EWIA 4KJOA 2XWBB 4HN7A 5JJKA 1XMOL 1LTAD 4RHRA 4LUOA 3BDOA 2JA7B 4POGA 2WKCA 5FK9C 4IZ8A 1B50A 5M3FG 3C46A 2F0GA 3S2DB 4RCNA 2NVQH 2Q2UA 1PTOH 4PNYA 3DEOA 3DM3A 1JB7A 1A15A 2XVSA 3K6OA 2R93G 1GUTA 1U4MA 3VYSA 2Z0SA 3FHWA 1B7YB 1F2LA 3STBC 5E3FA 2PNHA 1RODA 1OXXK 1VQ9A 1GUGA 5I2YA 4YWKA 1GHJA 2B8GA 3I3CA 3GD7A 1HZ9A 3DWQA 4ABNA 1FNVA 3NENA 3IAYA 5FO9B 3TP5A 3I4OA 2EYOA 2K6AA 4NP5A 3W1BA 1TT2A 4DV2L 2NTTA 3NHHA 3L2PA 4GKKL 3UE0A 3CCRA 4RWSC 4R4IA 4O42A 5LHY1 1KIXA 2WINB 2DN8A 3GTJH 3S17B 3ND8A 3CQZB 4LFCL 1XX8A 1SNCA 1N9WA 3CPFA 5TSSA 5AJ3L 5D3IB 3SGIA 2XWJB 1CFMA 1YNJD 1JWMD 1AN8A 1QE6A 1JORA 1VQFA 2WV6D 2HHHL 2EY5A 3JAML 3EROA 2R3ZA 2IY5B 2PPBC 2EY1A 5LL6S 2LSSA 5IP7H 4QQBX 3PIO3 3A74A 1Q8KA 2F4VL 1B3AA 1O7IA 3PIP3 4C3IB 3NTKA 4IUVA 2RBMA 4DR3Q 1PH7A 1EOVA 1IBML 4MN3A 4GN5A 3T4AC 1U5KA 3CC4A 3TQYA 1HUNA 4JK1C 1OO9B 1Z47A 5HURA 2HIXA 2A73B 2FFKB 4Y7NB 1HNXQ 2KCTA 4JBJA 2EY6A 3MEHA 2L0CA 3GP7A 1WTWA 3J7ZC 1RD9D 4FF2A 5FLMH 4BXXH 4IPDA 3FP9A 2PCFB 4RKBA 1A0IA 5HGTA 5KYIA 3I90A 4P71A 4EQNA 4LF8Q 3HOYH 1DOMA 5ISRA 2F0UA 1EOTA 1CUKA 2QGQA 5JOBA 1QZGA 3GTKH 2N88A 4P74A 1C8CA 1HNWL 1FR3A 3EQLC 1BCPC 1KDAA 2F1MA 2UUBQ 2NZ1D 1P8LA 3SVMA 4IN3A 2K50A 1EY7A 4A3GB 1Z6HA 4BY7G 2XN9C 1EYDA 4A3DB 4CKBA 1JJCB 5G3LF 2GA4B 5C4HA 4DV0L 4CKCA 1IHZA 1NSNS 4NXNL 5IP7G 4C2MB 5JPMC 5I4DA 1XMQL 4BY1G 2EDGA 4KJNA 4ZKCB 3QWNA 1Q12A 1OXTA 3MFGA 3RZOH 3M4OH 3J80i 2UUCQ 5EPKA 4N9TA 2R7ZG 2UXBL 1H9SA 2B2YC 1BO0A 3K7AH 1H9JA 2KJXA 4DKAC 1EQQA 3MWYW 1BNZA 2MFIA 3OMCA 1F77A 4IOAA 2BE5D 1B2TA 4WFN3 2SOBA 3H3VI 3OSOA 4WJ4A 1SNDA 2NVXB 3ZYYX 5C3WA 2QDBA 1IXRA 1NY4A 1MSGA 1EWCA 3Q0AA 1CK1A 4CKEA 2EJGC 5L37A 5CV5A 4EQOA 2NZHA 2JA8B 1I4RA 2HUGA 1LV9A 2YU9B 3TEHB 4BBSH 3HG9A 2MJ8A 3M85A 1UE5A 2MO1A 4IOCA 2L11A 1E1TA 5JVH3 4R4OA 3NWSA 2KUMA 2JA9A 1I94Q 3I7FA 2JE6I 4R8IA 1GKHA 2EOTA 2HDLA 2PQEA 3HKSA 4JV5Q 3TREA 1STNA 3S1NH 5EJWA 1SYGA 2K33A 3W2DA 2H4OA 4KTAA 3S1QB 4C3JB 2XSCA 1MSHA 1G6ZA 2AWNA 1WI5A 2MUYA 2CFMA 1W3SA 2H1EA 1PH4A 5JVG3 2HDMA 1EY9A 3FRPB 1QVFA 4DV7Q 1PRTF 3AYHB 1TKWB 3PO3B 4K8JA 1G51A 4N9PA 5ELNA 5JEAH 3CCLA 1JC7A 4HIDA 5BR8L 5FJ8G 3RN5A 1SYEA 4OO1I 4PMCA 3KLSX 3HOUB 3KUPA 4ZQ3A 2KHSA 3QOJA 3IFTA 4EQ5A 1FNWA 3NE5B 4YCWA 4BBSG 3LWEA 2NWGA 4YCVA 1L1OA 4GNXC 5LMUQ 4AQYL 1HHVA 4C1NK 3B6YA 3HOWH 3M3YB 5EBDA 1I4HA 2I5MX 1STBA 2RHSB 2YYZA 4O1NA 4QF4A 4DK6C 3E0JA 4JW0A 3A8IE 3VR3A 5CGKA 2PMZB 4B3RL 5ELOA 4NXMQ 2CH4A 4ZKBB 4XQJA 1VF7A 4JI0Q 5IGEA 1EIYB 4OWWB 4A3CH 1TWCH 1HUMA 1D5ZC 1SE3A 2EJMA 5EPJA 1NBWA 5C4XH 4IUQA 4JI4Q 2CKZB 1S72A 2DJGC 2KECA 3TRZA 2R92B 1MHWC 4IFDG 1PRTB 1KLUD 3A8JE 4HIKA 4F8MA 5IIFA 2QF7A 1PHJA 1J5EL 1CZWA 4LF7Q 1XPUA 3GV6A 1I4PA 3KF6A 5CV6A 4FO2A 2Z6KA 1EY4A 5CV9A 4B3TQ 1EQTA 1FJGQ 1XNRL 4MHEA 1HZBA 1PTOD 1RDPD 1QG7A 2EPBA 2K14A 3NXWA 1EFWA 2NN6I 2WB1B 5D65A 1IZ6A 2LFNA 1VMCA 3HOVG 3MXGA 2K04A 2UUAL 2D2CC 1HPCA 4YCUA 4JI2Q 1K83H 2A69C 4RMFA 3GTMH 3EN2A 1V1PA 1ONLA 3TS2A 2CCZA 1KLGD 1X3PA 3TP6A 3UDGA 4U673 1VQJA 3D4DA 4DNIA 1VQAA 3G6EA 1SEBD 1IBKQ 2FMMA 1D8LA 1IYVA 2K5WA 3VR6A 4HJ9A 1EWHA 4G7OC 3NBHB 4LMQD 2Q8IB 3HKZB 2Z1CA 5KYLA 4IJLA 5LMNL 4A3EH 3DEPA 4A3JG 3OHXC 1Y8OB 1W2BA 4B3SQ 3KDFB 3S16H 4KHPQ 2OWOA 1U4RA 2DGYA 4X3SA 3BG3A 3D3RA 4QL5A 3GTGB 2XRSD 2F0FA 3RZDH 4OIJA 1H9SB 2MNAA 5IY0A 4A3FH 4A3KH 2YTVA 3CCJA 1SJHD 2V4DA 3BVGA 1SFOB 5FLXc 4HR7B 4DV5Q 4B08A 2F0TA 2J7ZA 3UE1A 3VA7A 5C4JB 3S15B 4OX9L 4XIGS 4BBRH 4X6AH 3TZUA 5BN3A 4X3UA 4DR2L 4X65L 1X3EA 3OYYA 1H95A 1ILPA 3H0GB 2JA8G 1F9RA 1EQRA 5M5WB 1XMOQ 4LF4Q 1L2FA 1WTHA 4RA8A 3FKIH 1SE2A 5C44G 4EVOA 1X3QA 3I4NH 4GOPA 2IT1A 1BF4A 2F0EA 5CBEE 3I70A 5DEHA 1QOHA 3L0OA 1ENFA 1KRTA 4WORA 2VUMG 4MTKA 2JA5B 1PFSA 4IQZA 4A3BB 3S1MH 5EPLA 3AQQA 5IT9c 1HR0L 4CGYB 4IUTA 1I6HB 3U4ZA 2B63G 1XYIA 3I4MG 3T1HL 1DXMA 4LW1A 5C3EB 1N36L 1VF5C 1FNUA 1JOOA 2B2VA 1VQ7A 1SNPA 4LUZA 3J80E 1CA5A 4Z9CB 3R3OA 4DF7A 2X6LA 1Y14B 1YI2A 4A4IA 4GKJQ 2WACA 3CD6A 2Y0SB 1CKOA 2CW0C 1VQEA 3K80C 1S4ZA 4IPGA 2QEXA 3CMEA 1QVGA 2JA6H 2ZTEA 3ULJA 1SDFA 1N33Q 1QVCA 5IGCA 1F9QA 3MA2B 2SNMA 3LX0A 1YITA 2KHJA 2NVTB 2Z4IA 1YZ6A 3N6RA 3CXCA 1L1OB 1CT1D 4IFDJ 3BZKA 4FXDA 2F4IA 2YTXA 3ND9A 3R2TA 4CDEC 4ID6A 1TWGB 1SSOA 2G9HD 3K5LA 1C4QA 2B2WC 1Q3LA 1LTLA 5J1ZA 1GUOA 2A68D 1HRJA 1EZ6A 1G2TA 1GOZA 5JEAJ 2PQAA 3Q23A 2F4VQ 2B2UC 4HMIA 1BUVT 1DJRD 2NVQB 3RNUA 3X3NA 1II3A 4DV6Q 3I91A 3GQBA 5EQ0A 1N32Q 2IWHA 4HMJA 2VB2X 4U68A 4HSPA 3KF6B 2JN4A 1Q90A 2JXMB 2OEOA 1PFMA 1ASYA 1X3GA 1OXUA 2A6ED 1F9SA 2WIIB 1B53A 3GTOB 1G291 4P72A 1QCBD 1WJJA 2MP1A 3VR5A 4ULLA 2B2TC 1PXUA 1HNWQ 1IW7C 1Q46A 1AE2A 4A3MH 1LACA 3TP8A 1TXYA 3GTJB 1A3VA 3K0YA 3S9WA 5JJLA 2L4NA 5HY6A 2QA4A 3R8BA 1YJWA 1TWFH 1V9PA 1ZEQX 2ZXRA 1PH1A 1X6OA 1MI2A 1JOKA 1YBYA 4DV4L 2HT1A 1VQLA 4BA1I 3GTPH 5M3FH 1CSPA 4NXNQ 3I56A 2PI2A 4YIJA 4M1UB 5ELBA 2C9OA 3OOCA 2XTIA 2R93H 4QY7A 3KK7A 1UEAB 1D7QA 2UXBQ 1LTSD 2A6HC 4RHSA 4X64Q 4JI5L 2R61A 2PW7A 3K8AA 4JYAL 1PH5A 3V96A 4LFBL 1K0RA 2F0QA 4JBWA 4OXPA 3H09A 3J81c 2ATWA 2LY7A 2KCCA 4ZYSA 1K8AC 1QILA 5IODA 2ICEC 1KQSA 1T5EA 1IL8A 2BH8A 2AMCB 1Y1VH 1MBYA 4TVAB 2HD3A 4HJ5A 4K0KQ 1O7LA 1TS3A 1HA5A 1EY5A 2ZXOA 4KN7C 1JB3A 3HOYB 5NUCA 4JVZA 1RTNA 2MQHA 4N8FA 3GTKB 1R4QB 2PYKA 3OIQA 3OPOA 5M5YH 3J81i 1Q1BA 4LK1C 3OTOQ 1KTKA 1FVIA 4JI6Q 2UXDQ 4R4CA 4UHVA 2EIFA 4X62L 1KAWA 1PYSB 1X54A 1JCKB 2RA4A 1VQ5A 4GN3B 3PO2G 2Q8RE 4PZ8A 4GOPB 1E3PA 1QNKA 2BOSA 3F1ZA 1UUPA 1HQRD 3CU7A 4UPAA 4CJ2C 2F0NA 4R9WA 3STBD 3RZOB 4LFAL 1LTID 2PMZE 3QR8A 4YWMA 3K7AB 5T1GA 4R4QA 4AYBB 2AKWB 1LTBD 5C0XG 5GQOA 2LS01 3M4QA 1BVSA 1BBXC 2JJQA 4KKTA 3T13A 1SMYC 5GAEC 5M5XH 4JG2A 4RGNA 1I4XA 1JE4A 2MO0A 2AUKA 4J1MA 1SROA 1Y1VG 3NK9A 2Q8TA 1EY8A 2R7FA 4UY8C 4DR6Q 3MVVA 3ITPA 4IPHA 1M8AA 4LF5L 4DNTB 1STYA 4DV3Q 2Z8LA 4CDDC 1PYWD 4NMZA 4JI1L 4BWGB 3HOXG 1PFBA 2NTSA 4TKOB 4AQYQ 1F9PA 3U9OA 4K14A 5IWAL 2OTJA 1I4QA 2EXZA 3KFUA 2X6GA 1KAAA 4QIWB 5CYUA 1EZ8A 2WB1E 2RDFA 4H0LC 4BY7H 4B3RQ 2L55A 1F2ZA 1LT6D 3C3LA 1ZXTA 4MZ9A 2VXWA 1SE8A 3IL8A 1KD1C 4RGTA 4A3IB 1Y1WB 2SNSA 1EYGA 4JI7L 4BY1H 4H7BA 2E5LQ 1YNJC 4JI8L 4YY3Q 5BN5A 1EYAA 4ZLTF 3S1NB 2K03A 1K28A 3D0FA 1GM5A 2R7ZH 3VA5A 4DGZA 2RDGA 3U58A 2F3VA 2PQAB 3JAMc 4L6TB 2X69A 4JPBW 4H02A 3T51B 4O0AA 2WP8J 1LM0A 3ICEA 3HFZB 3HOZB 3SHLA 2E2HH 1E24A 1D1KA 1S40A 1ZKOA 3HKZE 3BVMA 5CR3A 1PRTC 2Z9HA 5D14A 5DLQE 3MTSA 2UU9Q 4X66L 5A35A 1X65A 5C5LA 2UUAQ 2EYFA 2K32A 4R4TA 4FYDA 2L1BA 1E2ZA 5IT9E 4IFDI 1TR5A 4DR1Q 1SXTA 3JAMi 5C6AA 1ZYRC 1ICWA 3J80L 5T1IA 3FVQA 3QJYA 3R93A 4CJ1B 1BCPD 3CCUA 1WTOA 3HOWB 1HXYD 3NBHA 3SK8A 4HJ8A 2K01A 4RKLA 4GZYC 2IL8A 2EYMA 4ZUIA 1PH8A 2I5HA 1B3QA 3KDFA 2KEEA 4YHHQ 1TWCB 3EVQA 2E74C 3P7JA 2Q2TA 2D0PA 5LMNQ 5C4XB 1EUJA 2TMPA 3KJOA 4WJWA 3DUZA 4H13C 1WTVA 4ME3A 1HTLD 1XNQL 4FP5D 2J0TD 4XQQA 1WCMG 4MNOA 5JJIA 3NEMA 2SDFA 3VYTA 3SDZA 4HTHA 4UP7A 1SNQA 3J7A5 1W6JA 2R6GA 3PGZA 5FJ8H 5A2QE 4WJ3M 2BE5C 2Z6BA 3UDIA 1SYFA 5E4XA 2ID0A 5EKIA 2K1BA 4TSSA 3BS1A 1WVLA 4LF9Q 2VQEQ 3NTIA 5DNFA 1VQNA 5CC4A 1QB5D 1GXDC 3UI2A 4OWTB 3GTMB 1YHQA 2N78A 1LT4D 4A93G 1WTPA 3NSWA 2DUDA 1PLFA 1LT5D 2Y0SE 2RVLA 2CH4W 4A76A 1TQOA 3TMEA 2VQFL 4RH6A 1A8VA 1PYBA 2EJFC 1UAPA 4RFBA 1JWSD 2JA7G 2M00A 3K0XA 1DD2A 1EY6A 3F8TA 4PG3A 1HR0Q 4I7AA 2CHBD 2XGTA 1K3BC 1S5BD 1FGBD 4IFDH 3DMUA 1V43A 4WRDA 3AU7A 5IGBA 1ML0D 3T1HQ 4A3EB 3BDCA 1EU3A 1CSQA 4F87A 1N36Q 3N52A 2D62A 2MPMA 3NTHA 5H1SE 1G2SA 3S16B 2JYOA 1HNZL 1FL0A 1B9NA 1A62A 2KHIA 4HAEA 1FD7D 1STAA 3GV3A 3RZDB 3Q24A 1UE7A 3P1HA 2WAQB 3DHQA 1WD0A 1IYJB 4A3FB 2A5HA 4A3KB 3HOVH 1WYDA 4ODGA 3GTQH 5IGDA 4YWLA 3BDLA 1ESRA 3GTLH 4CDFC 4BBRB 1YNND 5M3MB 4A75A 2D5DA 1X55A 1EEID 4DR7Q 3AMUA 4JC0A 4B3MQ 5IYCG 2GVAA 1IBLQ 5ELFA 1XPRA 1KL9A 3X3MA 4NW2A 2AQ2B 4GN4B 2E2DC 3FKIB 3CCVA 1R9TH 4DR4Q 3J81E 3RN2A 1H9RA 3OW7A 2QEJC 2RKSA 3I4NB 1XPOA 4A3DH 2E2JH 3D6CA 4DNRB 1XTDA 1KRSA 4KN4C 4A3JH 3S1MB 3FMCA 2F0JA 1KNEA 1L1OC 3RD4A 1PV4A 3T56B 1EIHA 4C3IG 2CQOA 3NWTA 5CMDA 4XXEA 3PCOB 4UDUC 1NR2A 3CRLC 4DAPA 5M9OA 1A63A 2F3IA 2G5DA 4XDXA 3CMAA 4EX5A 5IYBG 3HOZG 1AFPA 3A5ZB 5IYDG 3PF5A 1BCPB 1VMPA 1VS0A 3ULPA 4C1NI 2A69D 1CQFA 2KA7A 2JA6B 1D6EC 2E2IB 2JA8H 3BZDB 5GAHC 2Z6KC 1EY0A 2WKDA 1KC8C 4LF8L 3VR2A 5C44H 3WDNA 4XT3B 3RLNA 3CCQA 2OCEA 3A0JA 3CRKC 1J8IA 4A3GG 4DK3C 5E4WC 2K52A 4P2CB 2UUBL 1OTCA 4A3DG 1M4VA 2VUMH 3SXHA 4C3HB 4KKSA 3IRBA 4P73A 1WTXA 3NP8A 5GROA 5JJZA 2NVYH 2B63H 5FO7B 3I4MH 1STHA 4OELB 1JMCA 2A8VA 4KD3A 3DWPA 3LNNA 4LJZC 1M90C 5KIXA 1Z9FA 1UEBA 2UUCL 4LWCA 1JQYD 2IHFA 1O7ZA 3JC66 4GS3A 3PSIA 5LL6X 3CC7A 2RDHA 5GAGC 1TWAB 5E7NA 2XRQD 2N55A 2GVBA 2M2LA 1F2YA 3HOUH 2DNEA 4AYBE 3S1RH 2FJ2A 3JAME 4DAMA 3I72A 4CJ0B 4A3MB 1H9MA 3I8ZA 4KMUC 2B29A 4OL7A 2PZWA 1TS5A 1I50H 1TWFB 4X62Q 1B8AA 5CV4A 3M9BA 1XXGA 3GTPB 1VQIA 3G4SA 3CHBD 4PQXA 1CHPD 4POFA 1QUQB 1I94L 1RL2A 2FMCA 1CHQD 3ONAB 4QIWE 4PMWA 3HRZC 2R93B 1Y8NB 1Q1EA 4C3JG 1QWYA 4RGMA 1E2VA 5C3XA 1AP0A 4OO1G 3SE0A 3OIPA 1CQVA 1AH9A 1PTOF 1VQGA 3EJIA 5IP9G 3PMFA 4DAVA 4GOPC 4DV2Q 3PF4A 3MC0B 4GKKQ 1E7ZA 2F0KA 3PO3G 4QB4A 4JI3L 1UWVA 2CW0D 5DAUA 1G8ZD 3Q22A 4GNXB 2F52A 1RTOA 1F2MA 3VR4A 4BA2I 4HCEA 1HCZA 1AZQA 4LFCQ 4Y52H 4IPCA 1TWHB 4KI0A 3HOUG 4I7ZC 3H91A 4H44C 1WTRA 5AJ3Q 1SYBA 2K28A 2B2VC 2F0OA 2A74C 2A19A 4XT1B 2QKIC 2I46A 5M3MG 4CHTB 1BXTA 3R2IA 2ZTDA 3D6WA 2HHHQ 1TY2A 1J9OA 2JP1A 5M5YB 2PNRC 4DAYA 3P75A 4IO9A 1EIGA 5A2QL 1Q7YC 2RSNA 1C0AA 4GLAC 2C5CA 1SNMA 3SK6A 2NB0A 1PTOB 1IBMQ 1PZID 4E6IA 2NN6G 3LWUA 4JI0L 2BA0A 1TU2B 1E0BA 1QNUA 1HZCA 1PDQA 3CF5A 1IKMA 4IUPA 3A5UA 2R92G 3BU2A 3QOLA 2A68C 1V1OA 2CQAA 3EBEA 1Y69U 4JOIA 1G91A 4JI4L 1UE1A 1XWEA 2D9UA 2HQLA 3CPWA 3KOJA 4IALA 1SN8A 3TSSA 1PVOA 5K36G 1K8GA 1ET9A 1S5FD 1OXVA 4KK7A 4DPGA 3DWAA 1A3TA 2ZTCA 3O13A 4GLXA 4LF7L 1EYCA 5KNDA 3L7ZC 2WB1G 4NPSA 1FJGL 5M5XB 2EQSA 3PV0A 4V0BA 1PZJD 3BZCA 5FKAC 2PI2E 5J22A 3NUCA 1NJIC 3Q8DA 2Q2IA 1RF2D 1NTGA 1VQOA 2A1AA 2TSSA 1IW7D 1RCVD 4L5SA 3T1YL 3A7LA 2PO4A 1QZHA 1CTMA 1JWUD 1NE3A 2KVMA 2ZXPA 3CCEA 2EXDA 1HFNA 4BY7B 4DV0Q 4XTCS 1NUCA 1SYDA 1XMQQ 1WOCA 5EAYA 2ZM6L 1GD7A 1EQVA 1GUNA 2EYLA 4ZUJA 5HGQA 3PO2H 3A54A 1IBKL 2ALYB 3T53B 1C7YA 4BY1B 3HKZG 2F0IA 2A6HD 3DXJC 3AB9A 3GDEA 5AFWA 2R7ZB 3SK5A 1JICA 3S14H 4APVA 2L12A 4QGUA 3H3VC 4L8JA 5C0XH 3RLOA 1EU4A 1XTCD 4B3SL 1PZKD 2FINB 3VYRA 4KHPL 1RIPA 5GADC 3E0EA 3KBXA 1I5FA 4K2LA 3PIOA 3HP3A 1Q8IA 1WD1A 3KYHC 2J4XA 5I9OA 3PIPA 4OEMB 4TRDA 1YHAA 1U9RA 3PQIA 3HOXH 1I3QH 3OMGA 1D1IA 3HGBA 4DV5L 1BBUA 2KCNA 2PZUA 2NUCA 5KRUA 1DZ1A 1K9MC 2QCPX 3H0GG 1YJNA 2WAQE 1CZGA 1H9KA 1RHPA 1VQDA 3M4YA 3E9HA 3E9IA 4K2KA 2NVTH 4DUYL 1VDZA 4ZK9B 1A2TA 2FXQA 3W5OA 1K0SA 1ESFA 3TZDA 1TWGH 4LF4L 1N8RC 2AHOB 2JEBI 1D2BA 1D5MC 5IOCA 3IFDA 4JBKA 2JA5G 1MKHA 4A3BG 2CVRA 1VQKA 3M4OB 5G3LD 4J8QA 3FPPA 1JOQA 1T9HA 3FPUB 1CKMA 4HEDA 3K81C 4OHJA 1HH2P 2QILA 2YTYA 1HFGA 1HNZQ 5KGUA 5C3EG 4G7ZC 1K3RA 5F2DA 2I5LX 3MEFA 5LMNW 4LUVA 3HS0C 1AE3A 4G7HC 4FXKC 5BR8Q 2O4XA 4JBMA 1PH2A 1MJCA 1SMYD 1JJ2A 3S2HH 1P16A 2Y0SG 2OTLA 4HJ7A 2JSOA 3FDTA 2UXCL 4GKJL 4DR5L 1X9NA 4K6DA 2F0LA 4BBSB 3GTOH 4L5RC 4OWXB 2GN5A 3OW2A 4G4KA 2HCCA 1EFID 4M8AA 1Q81C 1N33L 4LF6L 4K5VA 2D0OA 3K5NA 1KABA 3NBIA 5FLXE 4K8IA 4HSVA 1VQPA 5JAVA 4DAYB 2MHVA 2K5NA 1X56A 2RSOA 2OXPA 2Q2HA 4RGOS 1HZAA 2LMCB 1J5EQ 2JQOA 1IKLA 4QUFA 3KLSA 4ZCKA 1YIJA 3S24A 3J7AF 2DY7A 2EYPA 3C1FA 1HA6A 5EKKA 5IGFA 4PMBA 1XNRQ 2K4KA 3ERSX 1W6KA 3QO2A 1PH6A 3CCSA 1WCMH 1HR0W 1BDOA 1PMRA 1FYCA 1LYLA 4FDBA 3P20A 5IGGA 4P75A 3K59A 5ELCA 3NELA 3E6ZX 4DV6L 3C1EA 1PRTD 3RMHA 3ERQA 1N32L 3MFYA 4MIUA 3HOVB 3G7LA 5KNCA 4B9WA 3F2UA 3HEJA 3GTQB 3MXPA 4OGQC 3F2DA 4IUNA 3GTLB 1ZYRD 1DCZA 1WFQA 4I65A 3D31A 4A93H 2K5DA 3EIVA 5I9PA 1TIID 1VQHA 2B2YA 3L3OC 4HCSA 4S3SA 1ENCA 1IYUA 5FOBB 3W1GA 3J80c 1JE5A 2RQXA 1DM0B 3ZJYC 2JA7H 1AEXA 3PUZA 5D3DA 3TS0A 1R9TB 4NDXA 1YJ9A 5CV8A 2NYZD 3WOFA 1Q86C 2HQEA 1LTTD 4DUZL 3S2DH 2E2JB 1NAPA 3OWEB 5EKLA 4A3JB 2QW7A 5FO8B 4G57A 2RCFA 4XQNA 3M7GA 2N3SA 5DM63 2QDLA 1SMXA 3WWVA 2KOLA 2N49A 3D4RA 4X3KA 1N34L 1AZPA 1B4OA 4DV1L 4OX9Q 4X64L 1X3FA 2O5JC 3TBIB 1VQMA 2EYJA 3MXNA 5FLMG 4DR2Q 3MAQA 3BVZA 4X65Q 4BXXG 1JT8A 1DONA 1K83B 2LXJA 1EEFD 1CKNA 1S5DD 3TDQA 2EE1A 1MJEA 3S17H 2BDOA 3CAMA 5IYCH 3HOYG 3CQZH 1YEZA 4HIOA 4K6LA 2M9VA 4K0KL 3BYYB 1YNXA 3AFPA 4F88A 2K5HA 5C44B 1KDCA 1QUQA 1BBWA 1SAPA 4RCOA 1SJED 4NKLA 1IL2A 4RAUC 3ER0A 5C0XJ 5IE8A 4L5QA 3MXUA 1A3UA 1M1KC 1J6QA 2OF1A 4EGVA 2HCIA 2K5VA 4OONA 3OTOL 4JI6L 2UXDL 2VUMB 4A3IH 1Y1WH 3I73A 2IX0A 1E1OA 2AQ3B 1ICFB 4DA2A 1GUSA 4EQPA
chains in the Genus database with same CATH topology
4C3IH 2BA1A 2IHFA 1HNWQ 3JC66 1Q46A 1AE2A 1VQFA 4GS3A 4A3MH 3PSIA 2HHHL 1TXYA 2KBNA 3CC7A 3U50C 4GNXA 3M3YH 5GAGC 5JJLA 2IY5B 4Y7NH 3PUYA 5E7NA 5HY6A 2QA4A 4AYBG 1YJWA 1TWFH 2LSSA 1V9PA 5IP7H 1PH1A 2GVBA 4QQBX 1X6OA 3A74A 1Q8KA 2F4VL 1YBYA 4DV4L 1O7IA 5IYBH 3HOUH 2C35B 4PZ7A 4AYBE 3S1RH 4BA1I 1VQLA 3DLLA 4JI3Q 2HT1A 3GTPH 5M3FH 5IYDH 4HIMA 4DR3Q 1EOVA 3PUWA 1CSPA 1PH7A 3F2CA 4DAMA 1IBML 4GN5A 1U5KA 2ZJRA 3I56A 4PZ6A 4NXNQ 2PI2A 3CC4A 3TQYA 1Z47A 2HIXA 2XTIA 2B29A 2R93H 1HNXQ 2KCTA 4JBJA 4QY7A 1I50H 1D7QA 4DR6L 4X62Q 3J7ZC 2UXBQ 1SR3A 1B8AA 1VQBA 3M9BA 5FLMH 4BXXH 4IPDA 4X64Q 4JI5L 4DV3L 1VQIA 3FP9A 3G4SA 4POFA 3K8AA 4A3GH 4JYAL 1PH5A 4LFBL 1QUQB 1A0IA 1I94L 1K0RA 1RL2A 4JBWA 2KCMA 4P71A 4PMWA 4QIWE 4LF8Q 4OXPA 3HOYH 3J81c 2ATWA 1Q1EA 3BJUA 2QGQA 1CUKA 1QZGA 3GTKH 1K8AC 2HIVA 4OO1G 4P74A 2VNUD 1HNWL 1U0LA 4A3IG 1Y1WG 1BKBA 1AH9A 1VQGA 4C2MH 1KQSA 2UUBQ 3H3VH 2BH8A 2AMCB 1Y1VH 4NB3A 4TVAB 4HJ5A 1P8LA 1PH9A 4K0KQ 2K50A 5IP9G 4GOPC 4BY7G 4DV2Q 5K36G 3PF4A 4GKKQ 1E7ZA 3LGJA 2BH2A 3PO3G 2RCNA 2E5LL 2MQHA 1JJCB 4JI3L 4YY3L 1UWVA 4GNXB 2F52A 4DR3L 4DV0L 5M5YH 4NXNL 5IP7G 5J3BA 4BA2I 3J81i 2B3GA 1Q1BA 1XMQL 4LFCQ 4BY1G 3OTOQ 1FVIA 4IPCA 4KI0A 4R4CA 4JI6Q 3HOUG 2UXDQ 4Y52H 3AEVA 1Q12A 1OXTA 2EIFA 1HNXL 5AJ3Q 3RR5A 3RZOH 3M4OH 3J80i 2NVXH 2UUCQ 1E22A 2R7ZG 1ASZA 4X62L 1KAWA 2UXBL 4IJHA 1PYSB 2A19A 1X54A 3K7AH 5JEAG 1VQ5A 5M3MG 4DKAC 4GN3B 3PO2G 4PZ8A 1EQQA 2ZTDA 4GOPB 1E3PA 2HHHQ 2MFIA 3F1ZA 1OXSC 1K73C 4IOAA 4IO9A 2YU9H 3F2BA 3T1YQ 4UPAA 1Q7YC 1C0AA 2UU9L 3U4VA 3M7NA 3H3VI 4GLAC 1SLJA 3STBD 3KLWA 4WJ4A 4LFAL 4DV4Q 2PMZE 1IXRA 1NY4A 1S3OA 3HOWG 4YWMA 4R4QA 4DR1L 1IBMQ 2AKWB 2NN6G 4L5TA 4JI0L 2BA0A 2NZHA 5C0XG 5GQOA 3M4QA 1HZCA 4AH6A 4J15A 3CF5A 1BVSA 3A5UA 2ZM6Q 2R92G 2JJQA 3BU2A 5GAEC 5M5XH 3EBEA 4JG2A 4JOIA 3TEHB 4JI4L 1UE1A 4BBSH 2MO0A 3PUXA 4A3CG 1SROA 1Y1VG 4DR6Q 2R7FA 2HQLA 4UY8C 3CPWA 1GO3E 3K7UC 4IPHA 3KOJA 3M85A 1SN8A 1YVCA 4JCVE 1K8GA 1PVOA 1UE5A 3CCMA 2MO1A 4DV3Q 4JI5Q 1OXVA 4LF5L 3S1QH 4IOCA 5C4XG 1E1TA 2OQKA 4YHHL 4DPGA 4JI1L 4C3JH 4GLXA 2ZTCA 3HOXG 4LF7L 4R4OA 4JYAQ 4AQYQ 4LFBQ 3L7ZC 2JA9A 1I94Q 2WB1G 3I7FA 2JE6I 5IWAL 2OTJA 1GKHA 2VY3A 4NPSA 1FJGL 2JEAI 3KFUA 2EQSA 3PV0A 3BZCA 2PI2E 3HKSA 1XJVA 4JV5Q 2ZJPA 2WB1E 3TREA 5IP9H 1NJIC 4BY7H 3CW2C 3Q8DA 3S1NH 4UP8A 4B3RQ 3KJPA 2Q2IA 2WFWA 1KXLA 1NTGA 1VQOA 3PO3H 2A1AA 4MZ9A 1MIUA 1SE8A 1KD1C 3T1YL 4L5SA 2AWNA 2V1CC 3UDFA 1WI5A 1QZHA 1FGUA 2CFMA 1W3SA 1PH4A 1EYGA 4JI7L 1NE3A 4ALPA 4BY1H 2E5LQ 1HJPA 2ZJQA 1VQ6A 4YY3Q 4JI8L 3J81j 3CCEA 2EXDA 4DV7Q 1QVFA 3MXNB 4DV0Q 4XTCS 3D0FA 3AYHB 1GM5A 1VCIA 2R7ZH 1GVPA 1XMQQ 1WOCA 1G51A 5EAYA 2RF4A 2ZM6L 5ELNA 2PQAB 1GD7A 4UP9A 5M3MH 3JAMc 3CCLA 5HGQA 3PO2H 4H02A 4HIDA 1CKNB 1IBKL 2ALYB 4O0AA 2WP8J 5BR8L 1LM0A 5FJ8G 2VQEL 3RN5A 4DUYQ 1C7YA 1PA6A 3ICEA 4OO1I 3HFZB 3HKZG 2K75A 1G6PA 4QJFA 4EQ5A 4YCWA 1C9OA 2E2HH 1E24A 1S40A 4BBSG 3GDEA 2KENA 3HKZE 4YCVA 4GNXC 1L1OA 4TQUS 5LMUQ 4AQYL 3HOWH 3B6YA 3S14H 4APVA 5DLQE 4QGUA 2I5MX 2ES2A 4X66L 2UU9Q 1X65A 3G48A 2RHSB 2YYZA 4MTNA 2UUAQ 1SRUA 4GLVB 3RLOA 4DK6C 4LFAQ 4JV5L 4R4TA 4B3SL 3UDXA 2R92H 2VZAA 4IFDI 4KHPL 4B3RL 1RIPA 5ELOA 3JAMi 4DR1Q 4NXMQ 2VL6A 5GADC 3E0EA 1VQ4A 4A3EG 1PH3A 1EIYB 4JI0Q 4OWWB 1I5FA 4A3CH 1TWCH 3PIOA 3CCUA 3KYHC 1NBWA 5C4XH 3PIPA 4HJ8A 4JI4Q 2CKZB 1YHAA 1S72A 3HOXH 3TRZA 1I3QH 1KHIA 4DV7L 4DV5L 4IFDG 4LF5Q 1PH8A 1UE6A 2I5HA 1BBUA 3KDFA 2WAQG 3CC2A 4HIKA 3PUVA 4YHHQ 4A3FG 4JI1Q 1PHJA 1J5EL 4LF7Q 1XPUA 2UXCQ 4A3KG 1K9MC 3KF6A 3H0GG 1YJNA 2WAQE 2Z6KA 2Q2TA 2D0PA 3CP0A 5IWAQ 5LMNQ 4DR5Q 4B3TQ 1FJGQ 1LUZA 1VQDA 3E9HA 1XNRL 1B70B 1DGSA 1HZBA 3E9IA 1EIFA 4DUYL 2NVTH 1EUJA 4BBRG 1EFWA 2K14A 2FXQA 2NN6I 3GO5A 1YHBA 3W5OA 3KJOA 3H15A 2OQ0A 1IZ6A 5C0XI 1TWGH 4LF4L 1N8RC 2AHOB 2JEBI 2E2IH 3AFQA 5LMUL 4ME3A 4LF6Q 1XNQL 4JBKA 3HOVG 4RG1A 1WCMG 2JA5G 4DR7L 4MNOA 1MKHA 2E8GA 2UUAL 4A3BG 5JJIA 1VQKA 4YCUA 4JI7Q 3NEMA 4JI2Q 1K83H 1T9HA 4RMFA 3FKIG 4UP7A 1CKMA 2L15A 3K81C 4JI8Q 2R6GA 1IBLL 3EN2A 4B3ML 3GTMH 3J7A5 1HH2P 2YTYA 4NXML 3TS2A 2I0QA 2CCZA 2JK8A 3PGZA 1HNZQ 5FJ8H 3UDGA 3I4NG 2R7DA 5C3EG 2IHEA 4R1JA 4WJ3M 1K3RA 1VQJA 2I5LX 3MEFA 5LMNW 3UDIA 4DNIA 2ID0A 4LUVA 4DR4L 1L0WA 1VQAA 1AE3A 4C3HH 3G6EA 1IBKQ 5BR8Q 4LF9Q 2VQEQ 4JBMA 1PH2A 1MJCA 1JJ2A 4LF9L 1D8LA 1VQNA 4A3LH 3S2HH 4KHZA 1VQCA 1P16A 4OWTB 1YHQA 2N78A 2Y0SG 1V1QA 2LXKA 4HJ7A 2OTLA 4HJ9A 4A93G 3GTGH 3NBHB 2DUDA 4LNQA 2UXCL 4GKJL 2Y0SE 4IJLA 5LMNL 4DR5L 1VQ8A 1X9NA 4B3TL 4X66Q 4A3EH 4A76A 4A3JG 2VQFL 1A8VA 1W2BA 1SFOH 1PYBA 3KDFB 4B3SQ 4L5RC 4KLKA 4OWXB 2GN5A 3GTOH 3OW2A 3S16H 4KHPQ 2JA7G 2OWOA 2DGYA 5C4JH 3ULLA 3K0XA 3S15H 3F8TA 4PG3A 1Q81C 1HR0Q 1N33L 4QL5A 4LF6L 2XGTA 3G71A 3RZDH 2D0OA 3M4PA 1V43A 2MNAA 1TWAH 4JOIC 5IY0A 3T1HQ 4A3FH 2JA6G 4JI2L 1VQPA 4A3KH 2AWOA 1CSQA 2YTVA 3CCJA 3H0GH 4HJAA 1N36Q 2D62A 5H1SE 4DAYB 3RLFA 2RHQB 5FLXc 2K5NA 4DV5Q 5M5WH 1X56A 2IX1A 2Q2HA 3UE1A 1HNZL 1FL0A 1HZAA 4OX9L 1J5EQ 4XIGS 4BBRH 1A62A 2JQOA 2KHIA 2NZOA 1YIJA 3S24A 1UE7A 4X6AH 3U58A 1XNRQ 2K4KA 3ERSX 1NMFA 1NMGA 1IYJB 4DR2L 4DUZQ 4X65L 1X3EA 3OYYA 3I55A 3HOVH 1H95A 1PH6A 3CCSA 2JA8G 1WCMH 2JA5H 1HR0W 1WYDA 4A3BH 1EQRA 3GTQH 4AIMA 1XMOQ 4LF4Q 1L2FA 2CWAA 4YWLA 1LYLA 3FKIH 3GTLH 1I6HH 4FDBA 5C44G 1XNQQ 4P75A 4A3LG 2ASBA 4A75A 2H5XA 1X55A 3NELA 4DR7Q 4DV6L 3I4NH 4GOPA 5C3EH 2IT1A 1N32L 4JC0A 4B3MQ 3L0OA 5IYCG 2GVAA 1IBLQ 1KRTA 1XPRA 1KL9A 3KF8B 1N34Q 2VUMG 1PFSA 4DV1Q 3S1MH 3AQQA 5IT9c 1HR0L 2CWPA 2N8NA 4GN4B 3F2DA 3CCVA 1R9TH 4DR4Q 3U4ZA 1WFQA 2B63G 3D31A 2VS1A 3RN2A 3I4MG 4A93H 3T1HL 3EIVA 4LW1A 1XPOA 1N36L 2VW9A 4A3DH 2E2JH 1VQ7A 4LUZA 1VQHA 1XTDA 2YV5A 1KRSA 4A3JH 4O2DA 3W1GA 1Y14B 3J80c 1JE5A 1YI2A 1L1OC 3ZJYC 4A4IA 1Q82C 2JA7H 4GKJQ 1PV4A 3PUZA 3TS0A 1TWHH 3VDYA 1YJ9A 2CQOA 2VQFQ 3CD6A 1Q86C 1CKOA 4DUZL 3PCOB 1VQEA 3S2DH 1JJGA 4A3MG 3K80C 3I2ZA 1EWIA 4IPGA 2QEXA 1A63A 3CMEA 1QVGA 2JA6H 5JJKA 2ZTEA 3ULJA 1XMOL 1N33Q 2F3IA 1QVCA 4LUOA 4POGA 3CMAA 4EX5A 2N3SA 5IYBG 3HOZG 1YITA 1SMXA 3A5ZB 2KHJA 5IYDG 3WWVA 5M3FG 1YZ6A 3PF5A 3CXCA 2N49A 1L1OB 1N34L 1VS0A 3ULPA 4IFDJ 3BZKA 4DV1L 2YTXA 2NVQH 2Q2UA 4OX9Q 3DM3A 4X64L 1JB7A 2R93G 1X3FA 2JA8H 1VQMA 2Z0SA 3FHWA 5GAHC 1B7YB 2Z6KC 3STBC 2PNHA 1LTLA 5FLMG 4DR2Q 1OXXK 1VQ9A 4X65Q 1KC8C 4LF8L 5C44H 4BXXG 1JT8A 5JEAJ 2PQAA 4YWKA 2F4VQ 3RLNA 3CCQA 2OCEA 3A0JA 2LXJA 4A3GG 3GD7A 1HZ9A 4DK3C 1CKNA 2K52A 1MJEA 3S17H 5IYCH 3CAMA 3HOYG 2UUBL 1OTCA 3CQZH 3NENA 4A3DG 1YEZA 2VUMH 3I4OA 3W1BA 4HIOA 3RNUA 4K0KL 4DV6Q 1YNXA 3IRBA 4DV2L 1N32Q 4P73A 3AFPA 3L2PA 2K5HA 5GROA 4GKKL 1QUQA 3UE0A 2B63H 2NVYH 3CCRA 1BBWA 3I4MH 3HOZH 1IL2A 3KF6B 4R4IA 1JMCA 3ER0A 5C0XJ 5IE8A 1KIXA 2A8VA 4L5QA 3GTJH 1M1KC 1J6QA 4LFCL 3OTOL 4JI6L 2K5VA 4OONA 2UXDL 1ASYA 1X3GA 1OXUA 4A3IH 1Y1WH 1M90C 2IX0A 1E1OA 1N9WA 1Z9FA 3CPFA 5AJ3L 1UEBA 1G291 4P72A 2UUCL 3SGIA 1WJJA 4LWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3I H;  2BA1 A;  2IHF A;  1HNW Q;  3JC6 6;  1Q46 A;  1AE2 A;  1VQF A;  4GS3 A;  4A3M H;  3PSI A;  2HHH L;  1TXY A;  2KBN A;  3CC7 A;  3U50 C;  4GNX A;  3M3Y H;  5GAG C;  5JJL A;  2IY5 B;  4Y7N H;  3PUY A;  5E7N A;  5HY6 A;  2QA4 A;  4AYB G;  1YJW A;  1TWF H;  2LSS A;  1V9P A;  5IP7 H;  1PH1 A;  2GVB A;  4QQB X;  1X6O A;  3A74 A;  1Q8K A;  2F4V L;  1YBY A;  4DV4 L;  1O7I A;  5IYB H;  3HOU H;  2C35 B;  4PZ7 A;  4AYB E;  3S1R H;  4BA1 I;  1VQL A;  3DLL A;  4JI3 Q;  2HT1 A;  3GTP H;  5M3F H;  5IYD H;  4HIM A;  4DR3 Q;  1EOV A;  3PUW A;  1CSP A;  1PH7 A;  3F2C A;  4DAM A;  1IBM L;  4GN5 A;  1U5K A;  2ZJR A;  3I56 A;  4PZ6 A;  4NXN Q;  2PI2 A;  3CC4 A;  3TQY A;  1Z47 A;  2HIX A;  2XTI A;  2B29 A;  2R93 H;  1HNX Q;  2KCT A;  4JBJ A;  4QY7 A;  1I50 H;  1D7Q A;  4DR6 L;  4X62 Q;  3J7Z C;  2UXB Q;  1SR3 A;  1B8A A;  1VQB A;  3M9B A;  5FLM H;  4BXX H;  4IPD A;  4X64 Q;  4JI5 L;  4DV3 L;  1VQI A;  3FP9 A;  3G4S A;  4POF A;  3K8A A;  4A3G H;  4JYA L;  1PH5 A;  4LFB L;  1QUQ B;  1A0I A;  1I94 L;  1K0R A;  1RL2 A;  4JBW A;  2KCM A;  4P71 A;  4PMW A;  4QIW E;  4LF8 Q;  4OXP A;  3HOY H;  3J81 c;  2ATW A;  1Q1E A;  3BJU A;  2QGQ A;  1CUK A;  1QZG A;  3GTK H;  1K8A C;  2HIV A;  4OO1 G;  4P74 A;  2VNU D;  1HNW L;  1U0L A;  4A3I G;  1Y1W G;  1BKB A;  1AH9 A;  1VQG A;  4C2M H;  1KQS A;  2UUB Q;  3H3V H;  2BH8 A;  2AMC B;  1Y1V H;  4NB3 A;  4TVA B;  4HJ5 A;  1P8L A;  1PH9 A;  4K0K Q;  2K50 A;  5IP9 G;  4GOP C;  4BY7 G;  4DV2 Q;  5K36 G;  3PF4 A;  4GKK Q;  1E7Z A;  3LGJ A;  2BH2 A;  3PO3 G;  2RCN A;  2E5L L;  2MQH A;  1JJC B;  4JI3 L;  4YY3 L;  1UWV A;  4GNX B;  2F52 A;  4DR3 L;  4DV0 L;  5M5Y H;  4NXN L;  5IP7 G;  5J3B A;  4BA2 I;  3J81 i;  2B3G A;  1Q1B A;  1XMQ L;  4LFC Q;  4BY1 G;  3OTO Q;  1FVI A;  4IPC A;  4KI0 A;  4R4C A;  4JI6 Q;  3HOU G;  2UXD Q;  4Y52 H;  3AEV A;  1Q12 A;  1OXT A;  2EIF A;  1HNX L;  5AJ3 Q;  3RR5 A;  3RZO H;  3M4O H;  3J80 i;  2NVX H;  2UUC Q;  1E22 A;  2R7Z G;  1ASZ A;  4X62 L;  1KAW A;  2UXB L;  4IJH A;  1PYS B;  2A19 A;  1X54 A;  3K7A H;  5JEA G;  1VQ5 A;  5M3M G;  4DKA C;  4GN3 B;  3PO2 G;  4PZ8 A;  1EQQ A;  2ZTD A;  4GOP B;  1E3P A;  2HHH Q;  2MFI A;  3F1Z A;  1OXS C;  1K73 C;  4IOA A;  4IO9 A;  2YU9 H;  3F2B A;  3T1Y Q;  4UPA A;  1Q7Y C;  1C0A A;  2UU9 L;  3U4V A;  3M7N A;  3H3V I;  4GLA C;  1SLJ A;  3STB D;  3KLW A;  4WJ4 A;  4LFA L;  4DV4 Q;  2PMZ E;  1IXR A;  1NY4 A;  1S3O A;  3HOW G;  4YWM A;  4R4Q A;  4DR1 L;  1IBM Q;  2AKW B;  2NN6 G;  4L5T A;  4JI0 L;  2BA0 A;  2NZH A;  5C0X G;  5GQO A;  3M4Q A;  1HZC A;  4AH6 A;  4J15 A;  3CF5 A;  1BVS A;  3A5U A;  2ZM6 Q;  2R92 G;  2JJQ A;  3BU2 A;  5GAE C;  5M5X H;  3EBE A;  4JG2 A;  4JOI A;  3TEH B;  4JI4 L;  1UE1 A;  4BBS H;  2MO0 A;  3PUX A;  4A3C G;  1SRO A;  1Y1V G;  4DR6 Q;  2R7F A;  2HQL A;  4UY8 C;  3CPW A;  1GO3 E;  3K7U C;  4IPH A;  3KOJ A;  3M85 A;  1SN8 A;  1YVC A;  4JCV E;  1K8G A;  1PVO A;  1UE5 A;  3CCM A;  2MO1 A;  4DV3 Q;  4JI5 Q;  1OXV A;  4LF5 L;  3S1Q H;  4IOC A;  5C4X G;  1E1T A;  2OQK A;  4YHH L;  4DPG A;  4JI1 L;  4C3J H;  4GLX A;  2ZTC A;  3HOX G;  4LF7 L;  4R4O A;  4JYA Q;  4AQY Q;  4LFB Q;  3L7Z C;  2JA9 A;  1I94 Q;  2WB1 G;  3I7F A;  2JE6 I;  5IWA L;  2OTJ A;  1GKH A;  2VY3 A;  4NPS A;  1FJG L;  2JEA I;  3KFU A;  2EQS A;  3PV0 A;  3BZC A;  2PI2 E;  3HKS A;  1XJV A;  4JV5 Q;  2ZJP A;  2WB1 E;  3TRE A;  5IP9 H;  1NJI C;  4BY7 H;  3CW2 C;  3Q8D A;  3S1N H;  4UP8 A;  4B3R Q;  3KJP A;  2Q2I A;  2WFW A;  1KXL A;  1NTG A;  1VQO A;  3PO3 H;  2A1A A;  4MZ9 A;  1MIU A;  1SE8 A;  1KD1 C;  3T1Y L;  4L5S A;  2AWN A;  2V1C C;  3UDF A;  1WI5 A;  1QZH A;  1FGU A;  2CFM A;  1W3S A;  1PH4 A;  1EYG A;  4JI7 L;  1NE3 A;  4ALP A;  4BY1 H;  2E5L Q;  1HJP A;  2ZJQ A;  1VQ6 A;  4YY3 Q;  4JI8 L;  3J81 j;  3CCE A;  2EXD A;  4DV7 Q;  1QVF A;  3MXN B;  4DV0 Q;  4XTC S;  3D0F A;  3AYH B;  1GM5 A;  1VCI A;  2R7Z H;  1GVP A;  1XMQ Q;  1WOC A;  1G51 A;  5EAY A;  2RF4 A;  2ZM6 L;  5ELN A;  2PQA B;  1GD7 A;  4UP9 A;  5M3M H;  3JAM c;  3CCL A;  5HGQ A;  3PO2 H;  4H02 A;  4HID A;  1CKN B;  1IBK L;  2ALY B;  4O0A A;  2WP8 J;  5BR8 L;  1LM0 A;  5FJ8 G;  2VQE L;  3RN5 A;  4DUY Q;  1C7Y A;  1PA6 A;  3ICE A;  4OO1 I;  3HFZ B;  3HKZ G;  2K75 A;  1G6P A;  4QJF A;  4EQ5 A;  4YCW A;  1C9O A;  2E2H H;  1E24 A;  1S40 A;  4BBS G;  3GDE A;  2KEN A;  3HKZ E;  4YCV A;  4GNX C;  1L1O A;  4TQU S;  5LMU Q;  4AQY L;  3HOW H;  3B6Y A;  3S14 H;  4APV A;  5DLQ E;  4QGU A;  2I5M X;  2ES2 A;  4X66 L;  2UU9 Q;  1X65 A;  3G48 A;  2RHS B;  2YYZ A;  4MTN A;  2UUA Q;  1SRU A;  4GLV B;  3RLO A;  4DK6 C;  4LFA Q;  4JV5 L;  4R4T A;  4B3S L;  3UDX A;  2R92 H;  2VZA A;  4IFD I;  4KHP L;  4B3R L;  1RIP A;  5ELO A;  3JAM i;  4DR1 Q;  4NXM Q;  2VL6 A;  5GAD C;  3E0E A;  1VQ4 A;  4A3E G;  1PH3 A;  1EIY B;  4JI0 Q;  4OWW B;  1I5F A;  4A3C H;  1TWC H;  3PIO A;  3CCU A;  3KYH C;  1NBW A;  5C4X H;  3PIP A;  4HJ8 A;  4JI4 Q;  2CKZ B;  1YHA A;  1S72 A;  3HOX H;  3TRZ A;  1I3Q H;  1KHI A;  4DV7 L;  4DV5 L;  4IFD G;  4LF5 Q;  1PH8 A;  1UE6 A;  2I5H A;  1BBU A;  3KDF A;  2WAQ G;  3CC2 A;  4HIK A;  3PUV A;  4YHH Q;  4A3F G;  4JI1 Q;  1PHJ A;  1J5E L;  4LF7 Q;  1XPU A;  2UXC Q;  4A3K G;  1K9M C;  3KF6 A;  3H0G G;  1YJN A;  2WAQ E;  2Z6K A;  2Q2T A;  2D0P A;  3CP0 A;  5IWA Q;  5LMN Q;  4DR5 Q;  4B3T Q;  1FJG Q;  1LUZ A;  1VQD A;  3E9H A;  1XNR L;  1B70 B;  1DGS A;  1HZB A;  3E9I A;  1EIF A;  4DUY L;  2NVT H;  1EUJ A;  4BBR G;  1EFW A;  2K14 A;  2FXQ A;  2NN6 I;  3GO5 A;  1YHB A;  3W5O A;  3KJO A;  3H15 A;  2OQ0 A;  1IZ6 A;  5C0X I;  1TWG H;  4LF4 L;  1N8R C;  2AHO B;  2JEB I;  2E2I H;  3AFQ A;  5LMU L;  4ME3 A;  4LF6 Q;  1XNQ L;  4JBK A;  3HOV G;  4RG1 A;  1WCM G;  2JA5 G;  4DR7 L;  4MNO A;  1MKH A;  2E8G A;  2UUA L;  4A3B G;  5JJI A;  1VQK A;  4YCU A;  4JI7 Q;  3NEM A;  4JI2 Q;  1K83 H;  1T9H A;  4RMF A;  3FKI G;  4UP7 A;  1CKM A;  2L15 A;  3K81 C;  4JI8 Q;  2R6G A;  1IBL L;  3EN2 A;  4B3M L;  3GTM H;  3J7A 5;  1HH2 P;  2YTY A;  4NXM L;  3TS2 A;  2I0Q A;  2CCZ A;  2JK8 A;  3PGZ A;  1HNZ Q;  5FJ8 H;  3UDG A;  3I4N G;  2R7D A;  5C3E G;  2IHE A;  4R1J A;  4WJ3 M;  1K3R A;  1VQJ A;  2I5L X;  3MEF A;  5LMN W;  3UDI A;  4DNI A;  2ID0 A;  4LUV A;  4DR4 L;  1L0W A;  1VQA A;  1AE3 A;  4C3H H;  3G6E A;  1IBK Q;  5BR8 Q;  4LF9 Q;  2VQE Q;  4JBM A;  1PH2 A;  1MJC A;  1JJ2 A;  4LF9 L;  1D8L A;  1VQN A;  4A3L H;  3S2H H;  4KHZ A;  1VQC A;  1P16 A;  4OWT B;  1YHQ A;  2N78 A;  2Y0S G;  1V1Q A;  2LXK A;  4HJ7 A;  2OTL A;  4HJ9 A;  4A93 G;  3GTG H;  3NBH B;  2DUD A;  4LNQ A;  2UXC L;  4GKJ L;  2Y0S E;  4IJL A;  5LMN L;  4DR5 L;  1VQ8 A;  1X9N A;  4B3T L;  4X66 Q;  4A3E H;  4A76 A;  4A3J G;  2VQF L;  1A8V A;  1W2B A;  1SFO H;  1PYB A;  3KDF B;  4B3S Q;  4L5R C;  4KLK A;  4OWX B;  2GN5 A;  3GTO H;  3OW2 A;  3S16 H;  4KHP Q;  2JA7 G;  2OWO A;  2DGY A;  5C4J H;  3ULL A;  3K0X A;  3S15 H;  3F8T A;  4PG3 A;  1Q81 C;  1HR0 Q;  1N33 L;  4QL5 A;  4LF6 L;  2XGT A;  3G71 A;  3RZD H;  2D0O A;  3M4P A;  1V43 A;  2MNA A;  1TWA H;  4JOI C;  5IY0 A;  3T1H Q;  4A3F H;  2JA6 G;  4JI2 L;  1VQP A;  4A3K H;  2AWO A;  1CSQ A;  2YTV A;  3CCJ A;  3H0G H;  4HJA A;  1N36 Q;  2D62 A;  5H1S E;  4DAY B;  3RLF A;  2RHQ B;  5FLX c;  2K5N A;  4DV5 Q;  5M5W H;  1X56 A;  2IX1 A;  2Q2H A;  3UE1 A;  1HNZ L;  1FL0 A;  1HZA A;  4OX9 L;  1J5E Q;  4XIG S;  4BBR H;  1A62 A;  2JQO A;  2KHI A;  2NZO A;  1YIJ A;  3S24 A;  1UE7 A;  4X6A H;  3U58 A;  1XNR Q;  2K4K A;  3ERS X;  1NMF A;  1NMG A;  1IYJ B;  4DR2 L;  4DUZ Q;  4X65 L;  1X3E A;  3OYY A;  3I55 A;  3HOV H;  1H95 A;  1PH6 A;  3CCS A;  2JA8 G;  1WCM H;  2JA5 H;  1HR0 W;  1WYD A;  4A3B H;  1EQR A;  3GTQ H;  4AIM A;  1XMO Q;  4LF4 Q;  1L2F A;  2CWA A;  4YWL A;  1LYL A;  3FKI H;  3GTL H;  1I6H H;  4FDB A;  5C44 G;  1XNQ Q;  4P75 A;  4A3L G;  2ASB A;  4A75 A;  2H5X A;  1X55 A;  3NEL A;  4DR7 Q;  4DV6 L;  3I4N H;  4GOP A;  5C3E H;  2IT1 A;  1N32 L;  4JC0 A;  4B3M Q;  3L0O A;  5IYC G;  2GVA A;  1IBL Q;  1KRT A;  1XPR A;  1KL9 A;  3KF8 B;  1N34 Q;  2VUM G;  1PFS A;  4DV1 Q;  3S1M H;  3AQQ A;  5IT9 c;  1HR0 L;  2CWP A;  2N8N A;  4GN4 B;  3F2D A;  3CCV A;  1R9T H;  4DR4 Q;  3U4Z A;  1WFQ A;  2B63 G;  3D31 A;  2VS1 A;  3RN2 A;  3I4M G;  4A93 H;  3T1H L;  3EIV A;  4LW1 A;  1XPO A;  1N36 L;  2VW9 A;  4A3D H;  2E2J H;  1VQ7 A;  4LUZ A;  1VQH A;  1XTD A;  2YV5 A;  1KRS A;  4A3J H;  4O2D A;  3W1G A;  1Y14 B;  3J80 c;  1JE5 A;  1YI2 A;  1L1O C;  3ZJY C;  4A4I A;  1Q82 C;  2JA7 H;  4GKJ Q;  1PV4 A;  3PUZ A;  3TS0 A;  1TWH H;  3VDY A;  1YJ9 A;  2CQO A;  2VQF Q;  3CD6 A;  1Q86 C;  1CKO A;  4DUZ L;  3PCO B;  1VQE A;  3S2D H;  1JJG A;  4A3M G;  3K80 C;  3I2Z A;  1EWI A;  4IPG A;  2QEX A;  1A63 A;  3CME A;  1QVG A;  2JA6 H;  5JJK A;  2ZTE A;  3ULJ A;  1XMO L;  1N33 Q;  2F3I A;  1QVC A;  4LUO A;  4POG A;  3CMA A;  4EX5 A;  2N3S A;  5IYB G;  3HOZ G;  1YIT A;  1SMX A;  3A5Z B;  2KHJ A;  5IYD G;  3WWV A;  5M3F G;  1YZ6 A;  3PF5 A;  3CXC A;  2N49 A;  1L1O B;  1N34 L;  1VS0 A;  3ULP A;  4IFD J;  3BZK A;  4DV1 L;  2YTX A;  2NVQ H;  2Q2U A;  4OX9 Q;  3DM3 A;  4X64 L;  1JB7 A;  2R93 G;  1X3F A;  2JA8 H;  1VQM A;  2Z0S A;  3FHW A;  5GAH C;  1B7Y B;  2Z6K C;  3STB C;  2PNH A;  1LTL A;  5FLM G;  4DR2 Q;  1OXX K;  1VQ9 A;  4X65 Q;  1KC8 C;  4LF8 L;  5C44 H;  4BXX G;  1JT8 A;  5JEA J;  2PQA A;  4YWK A;  2F4V Q;  3RLN A;  3CCQ A;  2OCE A;  3A0J A;  2LXJ A;  4A3G G;  3GD7 A;  1HZ9 A;  4DK3 C;  1CKN A;  2K52 A;  1MJE A;  3S17 H;  5IYC H;  3CAM A;  3HOY G;  2UUB L;  1OTC A;  3CQZ H;  3NEN A;  4A3D G;  1YEZ A;  2VUM H;  3I4O A;  3W1B A;  4HIO A;  3RNU A;  4K0K L;  4DV6 Q;  1YNX A;  3IRB A;  4DV2 L;  1N32 Q;  4P73 A;  3AFP A;  3L2P A;  2K5H A;  5GRO A;  4GKK L;  1QUQ A;  3UE0 A;  2B63 H;  2NVY H;  3CCR A;  1BBW A;  3I4M H;  3HOZ H;  1IL2 A;  3KF6 B;  4R4I A;  1JMC A;  3ER0 A;  5C0X J;  5IE8 A;  1KIX A;  2A8V A;  4L5Q A;  3GTJ H;  1M1K C;  1J6Q A;  4LFC L;  3OTO L;  4JI6 L;  2K5V A;  4OON A;  2UXD L;  1ASY A;  1X3G A;  1OXU A;  4A3I H;  1Y1W H;  1M90 C;  2IX0 A;  1E1O A;  1N9W A;  1Z9F A;  3CPF A;  5AJ3 L;  1UEB A;  1G29 1;  4P72 A;  2UUC L;  3SGI A;  1WJJ A;  4LWC A; 
#chains in the Genus database with same CATH topology
 4C3I H;  2NVY B;  2B63 B;  2BA1 A;  3I4M B;  5E1F A;  5EBC A;  4DK0 A;  1LO5 D;  2KBN A;  3U50 C;  1U4P A;  2MGS A;  4GNX A;  3V2T A;  4Y7N H;  4L63 B;  3PUY A;  1A6X A;  4AYB G;  1WTQ A;  5IYB H;  2C35 B;  2OT2 A;  3MHB A;  4PZ7 A;  4JI3 Q;  3HOZ H;  3DLL A;  4QCL A;  5IYD H;  2E75 C;  1DOL A;  2I07 B;  4HIM A;  3PUW A;  3F2C A;  3A7A B;  2ZJR A;  4PZ6 A;  4UAI A;  3E5S A;  2B8F A;  1EL0 A;  1E2W A;  1BCP F;  4FF3 A;  4DR6 L;  2O2L D;  2PW5 A;  1SR3 A;  1VQB A;  2F03 A;  3S1R B;  3SK4 A;  4DV3 L;  1YNN C;  1R4P B;  4A3G H;  5ELD A;  1STG A;  3C2P A;  2KCM A;  2NBF A;  3BJU A;  1NR4 A;  2E76 C;  4B9X A;  1I50 B;  3I4L A;  2HIV A;  2VNU D;  3V05 A;  4FF4 A;  1U0L A;  3H94 A;  4A3I G;  1Y1W G;  1BKB A;  1LLR D;  4C2M H;  3H3V H;  4NB3 A;  4J6H A;  1PH9 A;  5COR A;  3A56 A;  1U4L A;  2DJF C;  3LGJ A;  2BH2 A;  2RCN A;  2E5L L;  1ILQ A;  1TS4 A;  4YY3 L;  1AW7 A;  4DR3 L;  3T16 A;  4K5X A;  3RUZ A;  1BR9 A;  5J3B A;  2B3G A;  5J39 A;  1O7Y A;  1PTO C;  3TP7 A;  3AEV A;  1ET6 A;  3SEB A;  3URY A;  1HNX L;  2F0H A;  3QG1 A;  3RR5 A;  1LTR D;  4N8X 1;  4FNF A;  2NVX H;  1E22 A;  5I6W A;  1ASZ A;  4IJH A;  1BQQ T;  4K5W A;  4KKU A;  5JEA G;  4FVM A;  2EZV A;  1LAB A;  1OXS C;  1K73 C;  2YU9 H;  3F2B A;  2F0S A;  3T1Y Q;  3U9S A;  2UU9 L;  3U4V A;  3M7N A;  1SLJ A;  3OWF A;  3KLW A;  3D4W A;  4KY6 A;  4DV4 Q;  1S3O A;  1LTG D;  3HOW G;  4F7X A;  4DR1 L;  2LKV A;  4L5T A;  4AH6 A;  4J15 A;  2ZM6 Q;  2AUJ D;  3J7Y W;  4Q5V A;  5DM7 3;  1Y8P B;  4FF1 A;  3PUX A;  4A3C G;  1GO3 E;  2EYH A;  3K7U C;  3NQT A;  1YVC A;  4JCV E;  2B39 A;  3CCM A;  4JI5 Q;  5C4X G;  3S1Q H;  2F3W A;  2OQK A;  4YHH L;  4C3J H;  4OO1 H;  3KF8 A;  4JYA Q;  4LFB Q;  2F0P A;  1CI3 M;  1NNX A;  1GJX A;  3SR1 A;  2VY3 A;  2JEA I;  1S5E D;  3K58 A;  1PFN A;  5FLX L;  2ZJP A;  5IP9 H;  1XJV A;  2PZT A;  3A55 A;  3CW2 C;  4UP8 A;  5CBA E;  3KJP A;  2WFW A;  4BS9 A;  1KXL A;  4KY7 A;  3PO3 H;  1D5X C;  1MIU A;  4DK1 A;  2V1C C;  1NCV A;  3UDF A;  3EA6 A;  1FGU A;  3QB3 A;  1CM9 A;  3D8G A;  5ELE A;  4ALP A;  1DOK A;  1HJP A;  1O80 A;  2ZJQ A;  1VQ6 A;  3J81 j;  3MXN B;  2ICI A;  1VCI A;  5CV7 A;  1MGS A;  1GVP A;  2BDN A;  3M3Y H;  2RF4 A;  4UP9 A;  5M3M H;  4ILW A;  3K57 A;  1CKN B;  4LF9 L;  2VQE L;  2ENB A;  4DUY Q;  1PA6 A;  4KHV A;  1B44 D;  2K75 A;  5EGT A;  1G6P A;  4QUC A;  4QJF A;  5M3F B;  5IT9 L;  1C9O A;  2KEN A;  4TQU S;  1O78 A;  3A8K E;  1TVX A;  4R8N A;  2L5T A;  2NN6 H;  3TN2 A;  5K5P A;  2ES2 A;  3PO2 B;  3G48 A;  5KEE A;  1LT3 D;  4MTN A;  1SRU A;  4GLV B;  3W3A A;  2F0M A;  4LFA Q;  4JV5 L;  1ENA A;  1SBB B;  3UDX A;  2R92 H;  2VZA A;  3CKI B;  3DM1 A;  3E3X A;  2F0W A;  2VL6 A;  1VQ4 A;  4A3E G;  1PH3 A;  1Z7T A;  3J7A V;  5K36 H;  4KY5 A;  3H6M A;  3S14 B;  2IPK D;  1KHI A;  1K8O A;  3IKJ A;  3NPP A;  4DV7 L;  5COY A;  4ZRZ A;  4LF5 Q;  1UE6 A;  2DY8 A;  2WAQ G;  3CC2 A;  4CDC C;  5JPN C;  3PUV A;  4DXF A;  4A3F G;  4JI1 Q;  4CBV A;  1Y1V B;  1KDB A;  4QMG A;  4ZAI A;  4A3K G;  2UXC Q;  4DR5 Q;  3CP0 A;  5IWA Q;  1SNO A;  2B2W A;  1LUZ A;  3K5O A;  1B70 B;  1DGS A;  3NQI A;  1EIF A;  5I6Y A;  3HOX B;  1I3Q B;  4BBR G;  3GO5 A;  1YHB A;  3H15 A;  2B2U A;  2K05 A;  2OQ0 A;  1T5X D;  5C0X I;  1S5C D;  2E2I H;  3AFQ A;  5LMU L;  4LF6 Q;  2L9H A;  4RG1 A;  4DR7 L;  2E8G A;  2FHT A;  4JI7 Q;  2K5Q A;  3FKI G;  4ME5 A;  2F0V A;  2L15 A;  3QIA A;  4JI8 Q;  4B3M L;  1IBL L;  4IUU A;  4NXM L;  2I0Q A;  3HZX A;  2JK8 A;  5BN4 A;  1MD2 D;  3I4N G;  4LAA A;  2R7D A;  2IHE A;  4R1J A;  2SEB D;  2IX3 A;  4DR4 L;  1L0W A;  4C3H H;  1TS2 A;  1KNA A;  3L9A X;  5KNB A;  1UNS A;  2KED A;  2F0D A;  4A3L H;  4KHZ A;  1VQC A;  2VB3 X;  2B2T A;  3FEW X;  1V1Q A;  2LXK A;  3KLR A;  3GTG H;  4LNQ A;  3Q6S A;  1RJT A;  5C5M A;  1VQ8 A;  4B3T L;  4X66 Q;  1B1Z A;  1L0Y B;  1SFO H;  4KLK A;  2EVB A;  1I4G A;  2BCO A;  3S2H B;  5C4J H;  3ULL A;  3S15 H;  1C48 A;  4XYO A;  1QJO A;  2G9D A;  2A6E C;  3G71 A;  2Z4H A;  2XNA C;  3M4P A;  4KD4 A;  4V19 0;  1TWA H;  4JOI C;  1X32 A;  1CA6 A;  2JA6 G;  1BOS A;  4JI2 L;  4DN4 M;  2AQ1 B;  4OIK A;  2O5I C;  1RKN A;  2AWO A;  4Q0F A;  4XYQ A;  4HJA A;  3H0G H;  2IW3 A;  3RLF A;  2RHQ B;  3MZ5 A;  3WOE A;  5M5W H;  2IX1 A;  4DU9 A;  4DXG A;  2NZO A;  4IUR A;  1I6V C;  1K8M A;  1V1P B;  1NMF A;  1NMG A;  2ZT9 C;  4DUZ Q;  3K5M A;  3I55 A;  2IJ0 A;  2JA5 H;  4A3B H;  4C56 C;  4AIM A;  3EFX D;  4C3H G;  2CWA A;  1L0X B;  1JR0 D;  1I6H H;  1XNQ Q;  2EY2 A;  4A3L G;  4X3T A;  2ASB A;  2H5X A;  5C3E H;  3KBG A;  3J81 L;  4PV1 C;  2XIW A;  1N34 Q;  3KF8 B;  1GHK A;  1WCM B;  4DV1 Q;  2K7V A;  2E2H B;  2P5Z X;  2CWP A;  2N8N A;  3VYU A;  1DYQ A;  1HQM C;  3BYT B;  2VS1 A;  4FXG C;  1SE4 A;  1B9M A;  1GUW A;  2VW9 A;  2YV5 A;  2KQ3 A;  4O2D A;  1SYC A;  1TY0 A;  1Q82 C;  5C4Z A;  3G6J B;  4KV6 A;  1TWH H;  5I2X A;  3VDY A;  2VQF Q;  1V8Q A;  1HTP A;  4A93 B;  1STE A;  2DNC A;  1A2U A;  4DFA A;  4A3M G;  1JJG A;  3I2Z A;  1EWI A;  4KJO A;  2XWB B;  4HN7 A;  5JJK A;  1XMO L;  1LTA D;  4RHR A;  4LUO A;  3BDO A;  2JA7 B;  4POG A;  2WKC A;  5FK9 C;  4IZ8 A;  1B50 A;  5M3F G;  3C46 A;  2F0G A;  3S2D B;  4RCN A;  2NVQ H;  2Q2U A;  1PTO H;  4PNY A;  3DEO A;  3DM3 A;  1JB7 A;  1A15 A;  2XVS A;  3K6O A;  2R93 G;  1GUT A;  1U4M A;  3VYS A;  2Z0S A;  3FHW A;  1B7Y B;  1F2L A;  3STB C;  5E3F A;  2PNH A;  1ROD A;  1OXX K;  1VQ9 A;  1GUG A;  5I2Y A;  4YWK A;  1GHJ A;  2B8G A;  3I3C A;  3GD7 A;  1HZ9 A;  3DWQ A;  4ABN A;  1FNV A;  3NEN A;  3IAY A;  5FO9 B;  3TP5 A;  3I4O A;  2EYO A;  2K6A A;  4NP5 A;  3W1B A;  1TT2 A;  4DV2 L;  2NTT A;  3NHH A;  3L2P A;  4GKK L;  3UE0 A;  3CCR A;  4RWS C;  4R4I A;  4O42 A;  5LHY 1;  1KIX A;  2WIN B;  2DN8 A;  3GTJ H;  3S17 B;  3ND8 A;  3CQZ B;  4LFC L;  1XX8 A;  1SNC A;  1N9W A;  3CPF A;  5TSS A;  5AJ3 L;  5D3I B;  3SGI A;  2XWJ B;  1CFM A;  1YNJ D;  1JWM D;  1AN8 A;  1QE6 A;  1JOR A;  1VQF A;  2WV6 D;  2HHH L;  2EY5 A;  3JAM L;  3ERO A;  2R3Z A;  2IY5 B;  2PPB C;  2EY1 A;  5LL6 S;  2LSS A;  5IP7 H;  4QQB X;  3PIO 3;  3A74 A;  1Q8K A;  2F4V L;  1B3A A;  1O7I A;  3PIP 3;  4C3I B;  3NTK A;  4IUV A;  2RBM A;  4DR3 Q;  1PH7 A;  1EOV A;  1IBM L;  4MN3 A;  4GN5 A;  3T4A C;  1U5K A;  3CC4 A;  3TQY A;  1HUN A;  4JK1 C;  1OO9 B;  1Z47 A;  5HUR A;  2HIX A;  2A73 B;  2FFK B;  4Y7N B;  1HNX Q;  2KCT A;  4JBJ A;  2EY6 A;  3MEH A;  2L0C A;  3GP7 A;  1WTW A;  3J7Z C;  1RD9 D;  4FF2 A;  5FLM H;  4BXX H;  4IPD A;  3FP9 A;  2PCF B;  4RKB A;  1A0I A;  5HGT A;  5KYI A;  3I90 A;  4P71 A;  4EQN A;  4LF8 Q;  3HOY H;  1DOM A;  5ISR A;  2F0U A;  1EOT A;  1CUK A;  2QGQ A;  5JOB A;  1QZG A;  3GTK H;  2N88 A;  4P74 A;  1C8C A;  1HNW L;  1FR3 A;  3EQL C;  1BCP C;  1KDA A;  2F1M A;  2UUB Q;  2NZ1 D;  1P8L A;  3SVM A;  4IN3 A;  2K50 A;  1EY7 A;  4A3G B;  1Z6H A;  4BY7 G;  2XN9 C;  1EYD A;  4A3D B;  4CKB A;  1JJC B;  5G3L F;  2GA4 B;  5C4H A;  4DV0 L;  4CKC A;  1IHZ A;  1NSN S;  4NXN L;  5IP7 G;  4C2M B;  5JPM C;  5I4D A;  1XMQ L;  4BY1 G;  2EDG A;  4KJN A;  4ZKC B;  3QWN A;  1Q12 A;  1OXT A;  3MFG A;  3RZO H;  3M4O H;  3J80 i;  2UUC Q;  5EPK A;  4N9T A;  2R7Z G;  2UXB L;  1H9S A;  2B2Y C;  1BO0 A;  3K7A H;  1H9J A;  2KJX A;  4DKA C;  1EQQ A;  3MWY W;  1BNZ A;  2MFI A;  3OMC A;  1F77 A;  4IOA A;  2BE5 D;  1B2T A;  4WFN 3;  2SOB A;  3H3V I;  3OSO A;  4WJ4 A;  1SND A;  2NVX B;  3ZYY X;  5C3W A;  2QDB A;  1IXR A;  1NY4 A;  1MSG A;  1EWC A;  3Q0A A;  1CK1 A;  4CKE A;  2EJG C;  5L37 A;  5CV5 A;  4EQO A;  2NZH A;  2JA8 B;  1I4R A;  2HUG A;  1LV9 A;  2YU9 B;  3TEH B;  4BBS H;  3HG9 A;  2MJ8 A;  3M85 A;  1UE5 A;  2MO1 A;  4IOC A;  2L11 A;  1E1T A;  5JVH 3;  4R4O A;  3NWS A;  2KUM A;  2JA9 A;  1I94 Q;  3I7F A;  2JE6 I;  4R8I A;  1GKH A;  2EOT A;  2HDL A;  2PQE A;  3HKS A;  4JV5 Q;  3TRE A;  1STN A;  3S1N H;  5EJW A;  1SYG A;  2K33 A;  3W2D A;  2H4O A;  4KTA A;  3S1Q B;  4C3J B;  2XSC A;  1MSH A;  1G6Z A;  2AWN A;  1WI5 A;  2MUY A;  2CFM A;  1W3S A;  2H1E A;  1PH4 A;  5JVG 3;  2HDM A;  1EY9 A;  3FRP B;  1QVF A;  4DV7 Q;  1PRT F;  3AYH B;  1TKW B;  3PO3 B;  4K8J A;  1G51 A;  4N9P A;  5ELN A;  5JEA H;  3CCL A;  1JC7 A;  4HID A;  5BR8 L;  5FJ8 G;  3RN5 A;  1SYE A;  4OO1 I;  4PMC A;  3KLS X;  3HOU B;  3KUP A;  4ZQ3 A;  2KHS A;  3QOJ A;  3IFT A;  4EQ5 A;  1FNW A;  3NE5 B;  4YCW A;  4BBS G;  3LWE A;  2NWG A;  4YCV A;  1L1O A;  4GNX C;  5LMU Q;  4AQY L;  1HHV A;  4C1N K;  3B6Y A;  3HOW H;  3M3Y B;  5EBD A;  1I4H A;  2I5M X;  1STB A;  2RHS B;  2YYZ A;  4O1N A;  4QF4 A;  4DK6 C;  3E0J A;  4JW0 A;  3A8I E;  3VR3 A;  5CGK A;  2PMZ B;  4B3R L;  5ELO A;  4NXM Q;  2CH4 A;  4ZKB B;  4XQJ A;  1VF7 A;  4JI0 Q;  5IGE A;  1EIY B;  4OWW B;  4A3C H;  1TWC H;  1HUM A;  1D5Z C;  1SE3 A;  2EJM A;  5EPJ A;  1NBW A;  5C4X H;  4IUQ A;  4JI4 Q;  2CKZ B;  1S72 A;  2DJG C;  2KEC A;  3TRZ A;  2R92 B;  1MHW C;  4IFD G;  1PRT B;  1KLU D;  3A8J E;  4HIK A;  4F8M A;  5IIF A;  2QF7 A;  1PHJ A;  1J5E L;  1CZW A;  4LF7 Q;  1XPU A;  3GV6 A;  1I4P A;  3KF6 A;  5CV6 A;  4FO2 A;  2Z6K A;  1EY4 A;  5CV9 A;  4B3T Q;  1EQT A;  1FJG Q;  1XNR L;  4MHE A;  1HZB A;  1PTO D;  1RDP D;  1QG7 A;  2EPB A;  2K14 A;  3NXW A;  1EFW A;  2NN6 I;  2WB1 B;  5D65 A;  1IZ6 A;  2LFN A;  1VMC A;  3HOV G;  3MXG A;  2K04 A;  2UUA L;  2D2C C;  1HPC A;  4YCU A;  4JI2 Q;  1K83 H;  2A69 C;  4RMF A;  3GTM H;  3EN2 A;  1V1P A;  1ONL A;  3TS2 A;  2CCZ A;  1KLG D;  1X3P A;  3TP6 A;  3UDG A;  4U67 3;  1VQJ A;  3D4D A;  4DNI A;  1VQA A;  3G6E A;  1SEB D;  1IBK Q;  2FMM A;  1D8L A;  1IYV A;  2K5W A;  3VR6 A;  4HJ9 A;  1EWH A;  4G7O C;  3NBH B;  4LMQ D;  2Q8I B;  3HKZ B;  2Z1C A;  5KYL A;  4IJL A;  5LMN L;  4A3E H;  3DEP A;  4A3J G;  3OHX C;  1Y8O B;  1W2B A;  4B3S Q;  3KDF B;  3S16 H;  4KHP Q;  2OWO A;  1U4R A;  2DGY A;  4X3S A;  3BG3 A;  3D3R A;  4QL5 A;  3GTG B;  2XRS D;  2F0F A;  3RZD H;  4OIJ A;  1H9S B;  2MNA A;  5IY0 A;  4A3F H;  4A3K H;  2YTV A;  3CCJ A;  1SJH D;  2V4D A;  3BVG A;  1SFO B;  5FLX c;  4HR7 B;  4DV5 Q;  4B08 A;  2F0T A;  2J7Z A;  3UE1 A;  3VA7 A;  5C4J B;  3S15 B;  4OX9 L;  4XIG S;  4BBR H;  4X6A H;  3TZU A;  5BN3 A;  4X3U A;  4DR2 L;  4X65 L;  1X3E A;  3OYY A;  1H95 A;  1ILP A;  3H0G B;  2JA8 G;  1F9R A;  1EQR A;  5M5W B;  1XMO Q;  4LF4 Q;  1L2F A;  1WTH A;  4RA8 A;  3FKI H;  1SE2 A;  5C44 G;  4EVO A;  1X3Q A;  3I4N H;  4GOP A;  2IT1 A;  1BF4 A;  2F0E A;  5CBE E;  3I70 A;  5DEH A;  1QOH A;  3L0O A;  1ENF A;  1KRT A;  4WOR A;  2VUM G;  4MTK A;  2JA5 B;  1PFS A;  4IQZ A;  4A3B B;  3S1M H;  5EPL A;  3AQQ A;  5IT9 c;  1HR0 L;  4CGY B;  4IUT A;  1I6H B;  3U4Z A;  2B63 G;  1XYI A;  3I4M G;  3T1H L;  1DXM A;  4LW1 A;  5C3E B;  1N36 L;  1VF5 C;  1FNU A;  1JOO A;  2B2V A;  1VQ7 A;  1SNP A;  4LUZ A;  3J80 E;  1CA5 A;  4Z9C B;  3R3O A;  4DF7 A;  2X6L A;  1Y14 B;  1YI2 A;  4A4I A;  4GKJ Q;  2WAC A;  3CD6 A;  2Y0S B;  1CKO A;  2CW0 C;  1VQE A;  3K80 C;  1S4Z A;  4IPG A;  2QEX A;  3CME A;  1QVG A;  2JA6 H;  2ZTE A;  3ULJ A;  1SDF A;  1N33 Q;  1QVC A;  5IGC A;  1F9Q A;  3MA2 B;  2SNM A;  3LX0 A;  1YIT A;  2KHJ A;  2NVT B;  2Z4I A;  1YZ6 A;  3N6R A;  3CXC A;  1L1O B;  1CT1 D;  4IFD J;  3BZK A;  4FXD A;  2F4I A;  2YTX A;  3ND9 A;  3R2T A;  4CDE C;  4ID6 A;  1TWG B;  1SSO A;  2G9H D;  3K5L A;  1C4Q A;  2B2W C;  1Q3L A;  1LTL A;  5J1Z A;  1GUO A;  2A68 D;  1HRJ A;  1EZ6 A;  1G2T A;  1GOZ A;  5JEA J;  2PQA A;  3Q23 A;  2F4V Q;  2B2U C;  4HMI A;  1BUV T;  1DJR D;  2NVQ B;  3RNU A;  3X3N A;  1II3 A;  4DV6 Q;  3I91 A;  3GQB A;  5EQ0 A;  1N32 Q;  2IWH A;  4HMJ A;  2VB2 X;  4U68 A;  4HSP A;  3KF6 B;  2JN4 A;  1Q90 A;  2JXM B;  2OEO A;  1PFM A;  1ASY A;  1X3G A;  1OXU A;  2A6E D;  1F9S A;  2WII B;  1B53 A;  3GTO B;  1G29 1;  4P72 A;  1QCB D;  1WJJ A;  2MP1 A;  3VR5 A;  4ULL A;  2B2T C;  1PXU A;  1HNW Q;  1IW7 C;  1Q46 A;  1AE2 A;  4A3M H;  1LAC A;  3TP8 A;  1TXY A;  3GTJ B;  1A3V A;  3K0Y A;  3S9W A;  5JJL A;  2L4N A;  5HY6 A;  2QA4 A;  3R8B A;  1YJW A;  1TWF H;  1V9P A;  1ZEQ X;  2ZXR A;  1PH1 A;  1X6O A;  1MI2 A;  1JOK A;  1YBY A;  4DV4 L;  2HT1 A;  1VQL A;  4BA1 I;  3GTP H;  5M3F H;  1CSP A;  4NXN Q;  3I56 A;  2PI2 A;  4YIJ A;  4M1U B;  5ELB A;  2C9O A;  3OOC A;  2XTI A;  2R93 H;  4QY7 A;  3KK7 A;  1UEA B;  1D7Q A;  2UXB Q;  1LTS D;  2A6H C;  4RHS A;  4X64 Q;  4JI5 L;  2R61 A;  2PW7 A;  3K8A A;  4JYA L;  1PH5 A;  3V96 A;  4LFB L;  1K0R A;  2F0Q A;  4JBW A;  4OXP A;  3H09 A;  3J81 c;  2ATW A;  2LY7 A;  2KCC A;  4ZYS A;  1K8A C;  1QIL A;  5IOD A;  2ICE C;  1KQS A;  1T5E A;  1IL8 A;  2BH8 A;  2AMC B;  1Y1V H;  1MBY A;  4TVA B;  2HD3 A;  4HJ5 A;  4K0K Q;  1O7L A;  1TS3 A;  1HA5 A;  1EY5 A;  2ZXO A;  4KN7 C;  1JB3 A;  3HOY B;  5NUC A;  4JVZ A;  1RTN A;  2MQH A;  4N8F A;  3GTK B;  1R4Q B;  2PYK A;  3OIQ A;  3OPO A;  5M5Y H;  3J81 i;  1Q1B A;  4LK1 C;  3OTO Q;  1KTK A;  1FVI A;  4JI6 Q;  2UXD Q;  4R4C A;  4UHV A;  2EIF A;  4X62 L;  1KAW A;  1PYS B;  1X54 A;  1JCK B;  2RA4 A;  1VQ5 A;  4GN3 B;  3PO2 G;  2Q8R E;  4PZ8 A;  4GOP B;  1E3P A;  1QNK A;  2BOS A;  3F1Z A;  1UUP A;  1HQR D;  3CU7 A;  4UPA A;  4CJ2 C;  2F0N A;  4R9W A;  3STB D;  3RZO B;  4LFA L;  1LTI D;  2PMZ E;  3QR8 A;  4YWM A;  3K7A B;  5T1G A;  4R4Q A;  4AYB B;  2AKW B;  1LTB D;  5C0X G;  5GQO A;  2LS0 1;  3M4Q A;  1BVS A;  1BBX C;  2JJQ A;  4KKT A;  3T13 A;  1SMY C;  5GAE C;  5M5X H;  4JG2 A;  4RGN A;  1I4X A;  1JE4 A;  2MO0 A;  2AUK A;  4J1M A;  1SRO A;  1Y1V G;  3NK9 A;  2Q8T A;  1EY8 A;  2R7F A;  4UY8 C;  4DR6 Q;  3MVV A;  3ITP A;  4IPH A;  1M8A A;  4LF5 L;  4DNT B;  1STY A;  4DV3 Q;  2Z8L A;  4CDD C;  1PYW D;  4NMZ A;  4JI1 L;  4BWG B;  3HOX G;  1PFB A;  2NTS A;  4TKO B;  4AQY Q;  1F9P A;  3U9O A;  4K14 A;  5IWA L;  2OTJ A;  1I4Q A;  2EXZ A;  3KFU A;  2X6G A;  1KAA A;  4QIW B;  5CYU A;  1EZ8 A;  2WB1 E;  2RDF A;  4H0L C;  4BY7 H;  4B3R Q;  2L55 A;  1F2Z A;  1LT6 D;  3C3L A;  1ZXT A;  4MZ9 A;  2VXW A;  1SE8 A;  3IL8 A;  1KD1 C;  4RGT A;  4A3I B;  1Y1W B;  2SNS A;  1EYG A;  4JI7 L;  4BY1 H;  4H7B A;  2E5L Q;  1YNJ C;  4JI8 L;  4YY3 Q;  5BN5 A;  1EYA A;  4ZLT F;  3S1N B;  2K03 A;  1K28 A;  3D0F A;  1GM5 A;  2R7Z H;  3VA5 A;  4DGZ A;  2RDG A;  3U58 A;  2F3V A;  2PQA B;  3JAM c;  4L6T B;  2X69 A;  4JPB W;  4H02 A;  3T51 B;  4O0A A;  2WP8 J;  1LM0 A;  3ICE A;  3HFZ B;  3HOZ B;  3SHL A;  2E2H H;  1E24 A;  1D1K A;  1S40 A;  1ZKO A;  3HKZ E;  3BVM A;  5CR3 A;  1PRT C;  2Z9H A;  5D14 A;  5DLQ E;  3MTS A;  2UU9 Q;  4X66 L;  5A35 A;  1X65 A;  5C5L A;  2UUA Q;  2EYF A;  2K32 A;  4R4T A;  4FYD A;  2L1B A;  1E2Z A;  5IT9 E;  4IFD I;  1TR5 A;  4DR1 Q;  1SXT A;  3JAM i;  5C6A A;  1ZYR C;  1ICW A;  3J80 L;  5T1I A;  3FVQ A;  3QJY A;  3R93 A;  4CJ1 B;  1BCP D;  3CCU A;  1WTO A;  3HOW B;  1HXY D;  3NBH A;  3SK8 A;  4HJ8 A;  2K01 A;  4RKL A;  4GZY C;  2IL8 A;  2EYM A;  4ZUI A;  1PH8 A;  2I5H A;  1B3Q A;  3KDF A;  2KEE A;  4YHH Q;  1TWC B;  3EVQ A;  2E74 C;  3P7J A;  2Q2T A;  2D0P A;  5LMN Q;  5C4X B;  1EUJ A;  2TMP A;  3KJO A;  4WJW A;  3DUZ A;  4H13 C;  1WTV A;  4ME3 A;  1HTL D;  1XNQ L;  4FP5 D;  2J0T D;  4XQQ A;  1WCM G;  4MNO A;  5JJI A;  3NEM A;  2SDF A;  3VYT A;  3SDZ A;  4HTH A;  4UP7 A;  1SNQ A;  3J7A 5;  1W6J A;  2R6G A;  3PGZ A;  5FJ8 H;  5A2Q E;  4WJ3 M;  2BE5 C;  2Z6B A;  3UDI A;  1SYF A;  5E4X A;  2ID0 A;  5EKI A;  2K1B A;  4TSS A;  3BS1 A;  1WVL A;  4LF9 Q;  2VQE Q;  3NTI A;  5DNF A;  1VQN A;  5CC4 A;  1QB5 D;  1GXD C;  3UI2 A;  4OWT B;  3GTM B;  1YHQ A;  2N78 A;  1LT4 D;  4A93 G;  1WTP A;  3NSW A;  2DUD A;  1PLF A;  1LT5 D;  2Y0S E;  2RVL A;  2CH4 W;  4A76 A;  1TQO A;  3TME A;  2VQF L;  4RH6 A;  1A8V A;  1PYB A;  2EJF C;  1UAP A;  4RFB A;  1JWS D;  2JA7 G;  2M00 A;  3K0X A;  1DD2 A;  1EY6 A;  3F8T A;  4PG3 A;  1HR0 Q;  4I7A A;  2CHB D;  2XGT A;  1K3B C;  1S5B D;  1FGB D;  4IFD H;  3DMU A;  1V43 A;  4WRD A;  3AU7 A;  5IGB A;  1ML0 D;  3T1H Q;  4A3E B;  3BDC A;  1EU3 A;  1CSQ A;  4F87 A;  1N36 Q;  3N52 A;  2D62 A;  2MPM A;  3NTH A;  5H1S E;  1G2S A;  3S16 B;  2JYO A;  1HNZ L;  1FL0 A;  1B9N A;  1A62 A;  2KHI A;  4HAE A;  1FD7 D;  1STA A;  3GV3 A;  3RZD B;  3Q24 A;  1UE7 A;  3P1H A;  2WAQ B;  3DHQ A;  1WD0 A;  1IYJ B;  4A3F B;  2A5H A;  4A3K B;  3HOV H;  1WYD A;  4ODG A;  3GTQ H;  5IGD A;  4YWL A;  3BDL A;  1ESR A;  3GTL H;  4CDF C;  4BBR B;  1YNN D;  5M3M B;  4A75 A;  2D5D A;  1X55 A;  1EEI D;  4DR7 Q;  3AMU A;  4JC0 A;  4B3M Q;  5IYC G;  2GVA A;  1IBL Q;  5ELF A;  1XPR A;  1KL9 A;  3X3M A;  4NW2 A;  2AQ2 B;  4GN4 B;  2E2D C;  3FKI B;  3CCV A;  1R9T H;  4DR4 Q;  3J81 E;  3RN2 A;  1H9R A;  3OW7 A;  2QEJ C;  2RKS A;  3I4N B;  1XPO A;  4A3D H;  2E2J H;  3D6C A;  4DNR B;  1XTD A;  1KRS A;  4KN4 C;  4A3J H;  3S1M B;  3FMC A;  2F0J A;  1KNE A;  1L1O C;  3RD4 A;  1PV4 A;  3T56 B;  1EIH A;  4C3I G;  2CQO A;  3NWT A;  5CMD A;  4XXE A;  3PCO B;  4UDU C;  1NR2 A;  3CRL C;  4DAP A;  5M9O A;  1A63 A;  2F3I A;  2G5D A;  4XDX A;  3CMA A;  4EX5 A;  5IYB G;  3HOZ G;  1AFP A;  3A5Z B;  5IYD G;  3PF5 A;  1BCP B;  1VMP A;  1VS0 A;  3ULP A;  4C1N I;  2A69 D;  1CQF A;  2KA7 A;  2JA6 B;  1D6E C;  2E2I B;  2JA8 H;  3BZD B;  5GAH C;  2Z6K C;  1EY0 A;  2WKD A;  1KC8 C;  4LF8 L;  3VR2 A;  5C44 H;  3WDN A;  4XT3 B;  3RLN A;  3CCQ A;  2OCE A;  3A0J A;  3CRK C;  1J8I A;  4A3G G;  4DK3 C;  5E4W C;  2K52 A;  4P2C B;  2UUB L;  1OTC A;  4A3D G;  1M4V A;  2VUM H;  3SXH A;  4C3H B;  4KKS A;  3IRB A;  4P73 A;  1WTX A;  3NP8 A;  5GRO A;  5JJZ A;  2NVY H;  2B63 H;  5FO7 B;  3I4M H;  1STH A;  4OEL B;  1JMC A;  2A8V A;  4KD3 A;  3DWP A;  3LNN A;  4LJZ C;  1M90 C;  5KIX A;  1Z9F A;  1UEB A;  2UUC L;  4LWC A;  1JQY D;  2IHF A;  1O7Z A;  3JC6 6;  4GS3 A;  3PSI A;  5LL6 X;  3CC7 A;  2RDH A;  5GAG C;  1TWA B;  5E7N A;  2XRQ D;  2N55 A;  2GVB A;  2M2L A;  1F2Y A;  3HOU H;  2DNE A;  4AYB E;  3S1R H;  2FJ2 A;  3JAM E;  4DAM A;  3I72 A;  4CJ0 B;  4A3M B;  1H9M A;  3I8Z A;  4KMU C;  2B29 A;  4OL7 A;  2PZW A;  1TS5 A;  1I50 H;  1TWF B;  4X62 Q;  1B8A A;  5CV4 A;  3M9B A;  1XXG A;  3GTP B;  1VQI A;  3G4S A;  3CHB D;  4PQX A;  1CHP D;  4POF A;  1QUQ B;  1I94 L;  1RL2 A;  2FMC A;  1CHQ D;  3ONA B;  4QIW E;  4PMW A;  3HRZ C;  2R93 B;  1Y8N B;  1Q1E A;  4C3J G;  1QWY A;  4RGM A;  1E2V A;  5C3X A;  1AP0 A;  4OO1 G;  3SE0 A;  3OIP A;  1CQV A;  1AH9 A;  1PTO F;  1VQG A;  3EJI A;  5IP9 G;  3PMF A;  4DAV A;  4GOP C;  4DV2 Q;  3PF4 A;  3MC0 B;  4GKK Q;  1E7Z A;  2F0K A;  3PO3 G;  4QB4 A;  4JI3 L;  1UWV A;  2CW0 D;  5DAU A;  1G8Z D;  3Q22 A;  4GNX B;  2F52 A;  1RTO A;  1F2M A;  3VR4 A;  4BA2 I;  4HCE A;  1HCZ A;  1AZQ A;  4LFC Q;  4Y52 H;  4IPC A;  1TWH B;  4KI0 A;  3HOU G;  4I7Z C;  3H91 A;  4H44 C;  1WTR A;  5AJ3 Q;  1SYB A;  2K28 A;  2B2V C;  2F0O A;  2A74 C;  2A19 A;  4XT1 B;  2QKI C;  2I46 A;  5M3M G;  4CHT B;  1BXT A;  3R2I A;  2ZTD A;  3D6W A;  2HHH Q;  1TY2 A;  1J9O A;  2JP1 A;  5M5Y B;  2PNR C;  4DAY A;  3P75 A;  4IO9 A;  1EIG A;  5A2Q L;  1Q7Y C;  2RSN A;  1C0A A;  4GLA C;  2C5C A;  1SNM A;  3SK6 A;  2NB0 A;  1PTO B;  1IBM Q;  1PZI D;  4E6I A;  2NN6 G;  3LWU A;  4JI0 L;  2BA0 A;  1TU2 B;  1E0B A;  1QNU A;  1HZC A;  1PDQ A;  3CF5 A;  1IKM A;  4IUP A;  3A5U A;  2R92 G;  3BU2 A;  3QOL A;  2A68 C;  1V1O A;  2CQA A;  3EBE A;  1Y69 U;  4JOI A;  1G91 A;  4JI4 L;  1UE1 A;  1XWE A;  2D9U A;  2HQL A;  3CPW A;  3KOJ A;  4IAL A;  1SN8 A;  3TSS A;  1PVO A;  5K36 G;  1K8G A;  1ET9 A;  1S5F D;  1OXV A;  4KK7 A;  4DPG A;  3DWA A;  1A3T A;  2ZTC A;  3O13 A;  4GLX A;  4LF7 L;  1EYC A;  5KND A;  3L7Z C;  2WB1 G;  4NPS A;  1FJG L;  5M5X B;  2EQS A;  3PV0 A;  4V0B A;  1PZJ D;  3BZC A;  5FKA C;  2PI2 E;  5J22 A;  3NUC A;  1NJI C;  3Q8D A;  2Q2I A;  1RF2 D;  1NTG A;  1VQO A;  2A1A A;  2TSS A;  1IW7 D;  1RCV D;  4L5S A;  3T1Y L;  3A7L A;  2PO4 A;  1QZH A;  1CTM A;  1JWU D;  1NE3 A;  2KVM A;  2ZXP A;  3CCE A;  2EXD A;  1HFN A;  4BY7 B;  4DV0 Q;  4XTC S;  1NUC A;  1SYD A;  1XMQ Q;  1WOC A;  5EAY A;  2ZM6 L;  1GD7 A;  1EQV A;  1GUN A;  2EYL A;  4ZUJ A;  5HGQ A;  3PO2 H;  3A54 A;  1IBK L;  2ALY B;  3T53 B;  1C7Y A;  4BY1 B;  3HKZ G;  2F0I A;  2A6H D;  3DXJ C;  3AB9 A;  3GDE A;  5AFW A;  2R7Z B;  3SK5 A;  1JIC A;  3S14 H;  4APV A;  2L12 A;  4QGU A;  3H3V C;  4L8J A;  5C0X H;  3RLO A;  1EU4 A;  1XTC D;  4B3S L;  1PZK D;  2FIN B;  3VYR A;  4KHP L;  1RIP A;  5GAD C;  3E0E A;  3KBX A;  1I5F A;  4K2L A;  3PIO A;  3HP3 A;  1Q8I A;  1WD1 A;  3KYH C;  2J4X A;  5I9O A;  3PIP A;  4OEM B;  4TRD A;  1YHA A;  1U9R A;  3PQI A;  3HOX H;  1I3Q H;  3OMG A;  1D1I A;  3HGB A;  4DV5 L;  1BBU A;  2KCN A;  2PZU A;  2NUC A;  5KRU A;  1DZ1 A;  1K9M C;  2QCP X;  3H0G G;  1YJN A;  2WAQ E;  1CZG A;  1H9K A;  1RHP A;  1VQD A;  3M4Y A;  3E9H A;  3E9I A;  4K2K A;  2NVT H;  4DUY L;  1VDZ A;  4ZK9 B;  1A2T A;  2FXQ A;  3W5O A;  1K0S A;  1ESF A;  3TZD A;  1TWG H;  4LF4 L;  1N8R C;  2AHO B;  2JEB I;  1D2B A;  1D5M C;  5IOC A;  3IFD A;  4JBK A;  2JA5 G;  1MKH A;  4A3B G;  2CVR A;  1VQK A;  3M4O B;  5G3L D;  4J8Q A;  3FPP A;  1JOQ A;  1T9H A;  3FPU B;  1CKM A;  4HED A;  3K81 C;  4OHJ A;  1HH2 P;  2QIL A;  2YTY A;  1HFG A;  1HNZ Q;  5KGU A;  5C3E G;  4G7Z C;  1K3R A;  5F2D A;  2I5L X;  3MEF A;  5LMN W;  4LUV A;  3HS0 C;  1AE3 A;  4G7H C;  4FXK C;  5BR8 Q;  2O4X A;  4JBM A;  1PH2 A;  1MJC A;  1SMY D;  1JJ2 A;  3S2H H;  1P16 A;  2Y0S G;  2OTL A;  4HJ7 A;  2JSO A;  3FDT A;  2UXC L;  4GKJ L;  4DR5 L;  1X9N A;  4K6D A;  2F0L A;  4BBS B;  3GTO H;  4L5R C;  4OWX B;  2GN5 A;  3OW2 A;  4G4K A;  2HCC A;  1EFI D;  4M8A A;  1Q81 C;  1N33 L;  4LF6 L;  4K5V A;  2D0O A;  3K5N A;  1KAB A;  3NBI A;  5FLX E;  4K8I A;  4HSV A;  1VQP A;  5JAV A;  4DAY B;  2MHV A;  2K5N A;  1X56 A;  2RSO A;  2OXP A;  2Q2H A;  4RGO S;  1HZA A;  2LMC B;  1J5E Q;  2JQO A;  1IKL A;  4QUF A;  3KLS A;  4ZCK A;  1YIJ A;  3S24 A;  3J7A F;  2DY7 A;  2EYP A;  3C1F A;  1HA6 A;  5EKK A;  5IGF A;  4PMB A;  1XNR Q;  2K4K A;  3ERS X;  1W6K A;  3QO2 A;  1PH6 A;  3CCS A;  1WCM H;  1HR0 W;  1BDO A;  1PMR A;  1FYC A;  1LYL A;  4FDB A;  3P20 A;  5IGG A;  4P75 A;  3K59 A;  5ELC A;  3NEL A;  3E6Z X;  4DV6 L;  3C1E A;  1PRT D;  3RMH A;  3ERQ A;  1N32 L;  3MFY A;  4MIU A;  3HOV B;  3G7L A;  5KNC A;  4B9W A;  3F2U A;  3HEJ A;  3GTQ B;  3MXP A;  4OGQ C;  3F2D A;  4IUN A;  3GTL B;  1ZYR D;  1DCZ A;  1WFQ A;  4I65 A;  3D31 A;  4A93 H;  2K5D A;  3EIV A;  5I9P A;  1TII D;  1VQH A;  2B2Y A;  3L3O C;  4HCS A;  4S3S A;  1ENC A;  1IYU A;  5FOB B;  3W1G A;  3J80 c;  1JE5 A;  2RQX A;  1DM0 B;  3ZJY C;  2JA7 H;  1AEX A;  3PUZ A;  5D3D A;  3TS0 A;  1R9T B;  4NDX A;  1YJ9 A;  5CV8 A;  2NYZ D;  3WOF A;  1Q86 C;  2HQE A;  1LTT D;  4DUZ L;  3S2D H;  2E2J B;  1NAP A;  3OWE B;  5EKL A;  4A3J B;  2QW7 A;  5FO8 B;  4G57 A;  2RCF A;  4XQN A;  3M7G A;  2N3S A;  5DM6 3;  2QDL A;  1SMX A;  3WWV A;  2KOL A;  2N49 A;  3D4R A;  4X3K A;  1N34 L;  1AZP A;  1B4O A;  4DV1 L;  4OX9 Q;  4X64 L;  1X3F A;  2O5J C;  3TBI B;  1VQM A;  2EYJ A;  3MXN A;  5FLM G;  4DR2 Q;  3MAQ A;  3BVZ A;  4X65 Q;  4BXX G;  1JT8 A;  1DON A;  1K83 B;  2LXJ A;  1EEF D;  1CKN A;  1S5D D;  3TDQ A;  2EE1 A;  1MJE A;  3S17 H;  2BDO A;  3CAM A;  5IYC H;  3HOY G;  3CQZ H;  1YEZ A;  4HIO A;  4K6L A;  2M9V A;  4K0K L;  3BYY B;  1YNX A;  3AFP A;  4F88 A;  2K5H A;  5C44 B;  1KDC A;  1QUQ A;  1BBW A;  1SAP A;  4RCO A;  1SJE D;  4NKL A;  1IL2 A;  4RAU C;  3ER0 A;  5C0X J;  5IE8 A;  4L5Q A;  3MXU A;  1A3U A;  1M1K C;  1J6Q A;  2OF1 A;  4EGV A;  2HCI A;  2K5V A;  4OON A;  3OTO L;  4JI6 L;  2UXD L;  2VUM B;  4A3I H;  1Y1W H;  3I73 A;  2IX0 A;  1E1O A;  2AQ3 B;  1ICF B;  4DA2 A;  1GUS A;  4EQP A; 
#chains in the Genus database with same CATH homology
 4C3I H;  2BA1 A;  2IHF A;  1HNW Q;  3JC6 6;  1Q46 A;  1AE2 A;  1VQF A;  4GS3 A;  4A3M H;  3PSI A;  2HHH L;  1TXY A;  2KBN A;  3CC7 A;  3U50 C;  4GNX A;  3M3Y H;  5GAG C;  5JJL A;  2IY5 B;  4Y7N H;  3PUY A;  5E7N A;  5HY6 A;  2QA4 A;  4AYB G;  1YJW A;  1TWF H;  2LSS A;  1V9P A;  5IP7 H;  1PH1 A;  2GVB A;  4QQB X;  1X6O A;  3A74 A;  1Q8K A;  2F4V L;  1YBY A;  4DV4 L;  1O7I A;  5IYB H;  3HOU H;  2C35 B;  4PZ7 A;  4AYB E;  3S1R H;  4BA1 I;  1VQL A;  3DLL A;  4JI3 Q;  2HT1 A;  3GTP H;  5M3F H;  5IYD H;  4HIM A;  4DR3 Q;  1EOV A;  3PUW A;  1CSP A;  1PH7 A;  3F2C A;  4DAM A;  1IBM L;  4GN5 A;  1U5K A;  2ZJR A;  3I56 A;  4PZ6 A;  4NXN Q;  2PI2 A;  3CC4 A;  3TQY A;  1Z47 A;  2HIX A;  2XTI A;  2B29 A;  2R93 H;  1HNX Q;  2KCT A;  4JBJ A;  4QY7 A;  1I50 H;  1D7Q A;  4DR6 L;  4X62 Q;  3J7Z C;  2UXB Q;  1SR3 A;  1B8A A;  1VQB A;  3M9B A;  5FLM H;  4BXX H;  4IPD A;  4X64 Q;  4JI5 L;  4DV3 L;  1VQI A;  3FP9 A;  3G4S A;  4POF A;  3K8A A;  4A3G H;  4JYA L;  1PH5 A;  4LFB L;  1QUQ B;  1A0I A;  1I94 L;  1K0R A;  1RL2 A;  4JBW A;  2KCM A;  4P71 A;  4PMW A;  4QIW E;  4LF8 Q;  4OXP A;  3HOY H;  3J81 c;  2ATW A;  1Q1E A;  3BJU A;  2QGQ A;  1CUK A;  1QZG A;  3GTK H;  1K8A C;  2HIV A;  4OO1 G;  4P74 A;  2VNU D;  1HNW L;  1U0L A;  4A3I G;  1Y1W G;  1BKB A;  1AH9 A;  1VQG A;  4C2M H;  1KQS A;  2UUB Q;  3H3V H;  2BH8 A;  2AMC B;  1Y1V H;  4NB3 A;  4TVA B;  4HJ5 A;  1P8L A;  1PH9 A;  4K0K Q;  2K50 A;  5IP9 G;  4GOP C;  4BY7 G;  4DV2 Q;  5K36 G;  3PF4 A;  4GKK Q;  1E7Z A;  3LGJ A;  2BH2 A;  3PO3 G;  2RCN A;  2E5L L;  2MQH A;  1JJC B;  4JI3 L;  4YY3 L;  1UWV A;  4GNX B;  2F52 A;  4DR3 L;  4DV0 L;  5M5Y H;  4NXN L;  5IP7 G;  5J3B A;  4BA2 I;  3J81 i;  2B3G A;  1Q1B A;  1XMQ L;  4LFC Q;  4BY1 G;  3OTO Q;  1FVI A;  4IPC A;  4KI0 A;  4R4C A;  4JI6 Q;  3HOU G;  2UXD Q;  4Y52 H;  3AEV A;  1Q12 A;  1OXT A;  2EIF A;  1HNX L;  5AJ3 Q;  3RR5 A;  3RZO H;  3M4O H;  3J80 i;  2NVX H;  2UUC Q;  1E22 A;  2R7Z G;  1ASZ A;  4X62 L;  1KAW A;  2UXB L;  4IJH A;  1PYS B;  2A19 A;  1X54 A;  3K7A H;  5JEA G;  1VQ5 A;  5M3M G;  4DKA C;  4GN3 B;  3PO2 G;  4PZ8 A;  1EQQ A;  2ZTD A;  4GOP B;  1E3P A;  2HHH Q;  2MFI A;  3F1Z A;  1OXS C;  1K73 C;  4IOA A;  4IO9 A;  2YU9 H;  3F2B A;  3T1Y Q;  4UPA A;  1Q7Y C;  1C0A A;  2UU9 L;  3U4V A;  3M7N A;  3H3V I;  4GLA C;  1SLJ A;  3STB D;  3KLW A;  4WJ4 A;  4LFA L;  4DV4 Q;  2PMZ E;  1IXR A;  1NY4 A;  1S3O A;  3HOW G;  4YWM A;  4R4Q A;  4DR1 L;  1IBM Q;  2AKW B;  2NN6 G;  4L5T A;  4JI0 L;  2BA0 A;  2NZH A;  5C0X G;  5GQO A;  3M4Q A;  1HZC A;  4AH6 A;  4J15 A;  3CF5 A;  1BVS A;  3A5U A;  2ZM6 Q;  2R92 G;  2JJQ A;  3BU2 A;  5GAE C;  5M5X H;  3EBE A;  4JG2 A;  4JOI A;  3TEH B;  4JI4 L;  1UE1 A;  4BBS H;  2MO0 A;  3PUX A;  4A3C G;  1SRO A;  1Y1V G;  4DR6 Q;  2R7F A;  2HQL A;  4UY8 C;  3CPW A;  1GO3 E;  3K7U C;  4IPH A;  3KOJ A;  3M85 A;  1SN8 A;  1YVC A;  4JCV E;  1K8G A;  1PVO A;  1UE5 A;  3CCM A;  2MO1 A;  4DV3 Q;  4JI5 Q;  1OXV A;  4LF5 L;  3S1Q H;  4IOC A;  5C4X G;  1E1T A;  2OQK A;  4YHH L;  4DPG A;  4JI1 L;  4C3J H;  4GLX A;  2ZTC A;  3HOX G;  4LF7 L;  4R4O A;  4JYA Q;  4AQY Q;  4LFB Q;  3L7Z C;  2JA9 A;  1I94 Q;  2WB1 G;  3I7F A;  2JE6 I;  5IWA L;  2OTJ A;  1GKH A;  2VY3 A;  4NPS A;  1FJG L;  2JEA I;  3KFU A;  2EQS A;  3PV0 A;  3BZC A;  2PI2 E;  3HKS A;  1XJV A;  4JV5 Q;  2ZJP A;  2WB1 E;  3TRE A;  5IP9 H;  1NJI C;  4BY7 H;  3CW2 C;  3Q8D A;  3S1N H;  4UP8 A;  4B3R Q;  3KJP A;  2Q2I A;  2WFW A;  1KXL A;  1NTG A;  1VQO A;  3PO3 H;  2A1A A;  4MZ9 A;  1MIU A;  1SE8 A;  1KD1 C;  3T1Y L;  4L5S A;  2AWN A;  2V1C C;  3UDF A;  1WI5 A;  1QZH A;  1FGU A;  2CFM A;  1W3S A;  1PH4 A;  1EYG A;  4JI7 L;  1NE3 A;  4ALP A;  4BY1 H;  2E5L Q;  1HJP A;  2ZJQ A;  1VQ6 A;  4YY3 Q;  4JI8 L;  3J81 j;  3CCE A;  2EXD A;  4DV7 Q;  1QVF A;  3MXN B;  4DV0 Q;  4XTC S;  3D0F A;  3AYH B;  1GM5 A;  1VCI A;  2R7Z H;  1GVP A;  1XMQ Q;  1WOC A;  1G51 A;  5EAY A;  2RF4 A;  2ZM6 L;  5ELN A;  2PQA B;  1GD7 A;  4UP9 A;  5M3M H;  3JAM c;  3CCL A;  5HGQ A;  3PO2 H;  4H02 A;  4HID A;  1CKN B;  1IBK L;  2ALY B;  4O0A A;  2WP8 J;  5BR8 L;  1LM0 A;  5FJ8 G;  2VQE L;  3RN5 A;  4DUY Q;  1C7Y A;  1PA6 A;  3ICE A;  4OO1 I;  3HFZ B;  3HKZ G;  2K75 A;  1G6P A;  4QJF A;  4EQ5 A;  4YCW A;  1C9O A;  2E2H H;  1E24 A;  1S40 A;  4BBS G;  3GDE A;  2KEN A;  3HKZ E;  4YCV A;  4GNX C;  1L1O A;  4TQU S;  5LMU Q;  4AQY L;  3HOW H;  3B6Y A;  3S14 H;  4APV A;  5DLQ E;  4QGU A;  2I5M X;  2ES2 A;  4X66 L;  2UU9 Q;  1X65 A;  3G48 A;  2RHS B;  2YYZ A;  4MTN A;  2UUA Q;  1SRU A;  4GLV B;  3RLO A;  4DK6 C;  4LFA Q;  4JV5 L;  4R4T A;  4B3S L;  3UDX A;  2R92 H;  2VZA A;  4IFD I;  4KHP L;  4B3R L;  1RIP A;  5ELO A;  3JAM i;  4DR1 Q;  4NXM Q;  2VL6 A;  5GAD C;  3E0E A;  1VQ4 A;  4A3E G;  1PH3 A;  1EIY B;  4JI0 Q;  4OWW B;  1I5F A;  4A3C H;  1TWC H;  3PIO A;  3CCU A;  3KYH C;  1NBW A;  5C4X H;  3PIP A;  4HJ8 A;  4JI4 Q;  2CKZ B;  1YHA A;  1S72 A;  3HOX H;  3TRZ A;  1I3Q H;  1KHI A;  4DV7 L;  4DV5 L;  4IFD G;  4LF5 Q;  1PH8 A;  1UE6 A;  2I5H A;  1BBU A;  3KDF A;  2WAQ G;  3CC2 A;  4HIK A;  3PUV A;  4YHH Q;  4A3F G;  4JI1 Q;  1PHJ A;  1J5E L;  4LF7 Q;  1XPU A;  2UXC Q;  4A3K G;  1K9M C;  3KF6 A;  3H0G G;  1YJN A;  2WAQ E;  2Z6K A;  2Q2T A;  2D0P A;  3CP0 A;  5IWA Q;  5LMN Q;  4DR5 Q;  4B3T Q;  1FJG Q;  1LUZ A;  1VQD A;  3E9H A;  1XNR L;  1B70 B;  1DGS A;  1HZB A;  3E9I A;  1EIF A;  4DUY L;  2NVT H;  1EUJ A;  4BBR G;  1EFW A;  2K14 A;  2FXQ A;  2NN6 I;  3GO5 A;  1YHB A;  3W5O A;  3KJO A;  3H15 A;  2OQ0 A;  1IZ6 A;  5C0X I;  1TWG H;  4LF4 L;  1N8R C;  2AHO B;  2JEB I;  2E2I H;  3AFQ A;  5LMU L;  4ME3 A;  4LF6 Q;  1XNQ L;  4JBK A;  3HOV G;  4RG1 A;  1WCM G;  2JA5 G;  4DR7 L;  4MNO A;  1MKH A;  2E8G A;  2UUA L;  4A3B G;  5JJI A;  1VQK A;  4YCU A;  4JI7 Q;  3NEM A;  4JI2 Q;  1K83 H;  1T9H A;  4RMF A;  3FKI G;  4UP7 A;  1CKM A;  2L15 A;  3K81 C;  4JI8 Q;  2R6G A;  1IBL L;  3EN2 A;  4B3M L;  3GTM H;  3J7A 5;  1HH2 P;  2YTY A;  4NXM L;  3TS2 A;  2I0Q A;  2CCZ A;  2JK8 A;  3PGZ A;  1HNZ Q;  5FJ8 H;  3UDG A;  3I4N G;  2R7D A;  5C3E G;  2IHE A;  4R1J A;  4WJ3 M;  1K3R A;  1VQJ A;  2I5L X;  3MEF A;  5LMN W;  3UDI A;  4DNI A;  2ID0 A;  4LUV A;  4DR4 L;  1L0W A;  1VQA A;  1AE3 A;  4C3H H;  3G6E A;  1IBK Q;  5BR8 Q;  4LF9 Q;  2VQE Q;  4JBM A;  1PH2 A;  1MJC A;  1JJ2 A;  4LF9 L;  1D8L A;  1VQN A;  4A3L H;  3S2H H;  4KHZ A;  1VQC A;  1P16 A;  4OWT B;  1YHQ A;  2N78 A;  2Y0S G;  1V1Q A;  2LXK A;  4HJ7 A;  2OTL A;  4HJ9 A;  4A93 G;  3GTG H;  3NBH B;  2DUD A;  4LNQ A;  2UXC L;  4GKJ L;  2Y0S E;  4IJL A;  5LMN L;  4DR5 L;  1VQ8 A;  1X9N A;  4B3T L;  4X66 Q;  4A3E H;  4A76 A;  4A3J G;  2VQF L;  1A8V A;  1W2B A;  1SFO H;  1PYB A;  3KDF B;  4B3S Q;  4L5R C;  4KLK A;  4OWX B;  2GN5 A;  3GTO H;  3OW2 A;  3S16 H;  4KHP Q;  2JA7 G;  2OWO A;  2DGY A;  5C4J H;  3ULL A;  3K0X A;  3S15 H;  3F8T A;  4PG3 A;  1Q81 C;  1HR0 Q;  1N33 L;  4QL5 A;  4LF6 L;  2XGT A;  3G71 A;  3RZD H;  2D0O A;  3M4P A;  1V43 A;  2MNA A;  1TWA H;  4JOI C;  5IY0 A;  3T1H Q;  4A3F H;  2JA6 G;  4JI2 L;  1VQP A;  4A3K H;  2AWO A;  1CSQ A;  2YTV A;  3CCJ A;  3H0G H;  4HJA A;  1N36 Q;  2D62 A;  5H1S E;  4DAY B;  3RLF A;  2RHQ B;  5FLX c;  2K5N A;  4DV5 Q;  5M5W H;  1X56 A;  2IX1 A;  2Q2H A;  3UE1 A;  1HNZ L;  1FL0 A;  1HZA A;  4OX9 L;  1J5E Q;  4XIG S;  4BBR H;  1A62 A;  2JQO A;  2KHI A;  2NZO A;  1YIJ A;  3S24 A;  1UE7 A;  4X6A H;  3U58 A;  1XNR Q;  2K4K A;  3ERS X;  1NMF A;  1NMG A;  1IYJ B;  4DR2 L;  4DUZ Q;  4X65 L;  1X3E A;  3OYY A;  3I55 A;  3HOV H;  1H95 A;  1PH6 A;  3CCS A;  2JA8 G;  1WCM H;  2JA5 H;  1HR0 W;  1WYD A;  4A3B H;  1EQR A;  3GTQ H;  4AIM A;  1XMO Q;  4LF4 Q;  1L2F A;  2CWA A;  4YWL A;  1LYL A;  3FKI H;  3GTL H;  1I6H H;  4FDB A;  5C44 G;  1XNQ Q;  4P75 A;  4A3L G;  2ASB A;  4A75 A;  2H5X A;  1X55 A;  3NEL A;  4DR7 Q;  4DV6 L;  3I4N H;  4GOP A;  5C3E H;  2IT1 A;  1N32 L;  4JC0 A;  4B3M Q;  3L0O A;  5IYC G;  2GVA A;  1IBL Q;  1KRT A;  1XPR A;  1KL9 A;  3KF8 B;  1N34 Q;  2VUM G;  1PFS A;  4DV1 Q;  3S1M H;  3AQQ A;  5IT9 c;  1HR0 L;  2CWP A;  2N8N A;  4GN4 B;  3F2D A;  3CCV A;  1R9T H;  4DR4 Q;  3U4Z A;  1WFQ A;  2B63 G;  3D31 A;  2VS1 A;  3RN2 A;  3I4M G;  4A93 H;  3T1H L;  3EIV A;  4LW1 A;  1XPO A;  1N36 L;  2VW9 A;  4A3D H;  2E2J H;  1VQ7 A;  4LUZ A;  1VQH A;  1XTD A;  2YV5 A;  1KRS A;  4A3J H;  4O2D A;  3W1G A;  1Y14 B;  3J80 c;  1JE5 A;  1YI2 A;  1L1O C;  3ZJY C;  4A4I A;  1Q82 C;  2JA7 H;  4GKJ Q;  1PV4 A;  3PUZ A;  3TS0 A;  1TWH H;  3VDY A;  1YJ9 A;  2CQO A;  2VQF Q;  3CD6 A;  1Q86 C;  1CKO A;  4DUZ L;  3PCO B;  1VQE A;  3S2D H;  1JJG A;  4A3M G;  3K80 C;  3I2Z A;  1EWI A;  4IPG A;  2QEX A;  1A63 A;  3CME A;  1QVG A;  2JA6 H;  5JJK A;  2ZTE A;  3ULJ A;  1XMO L;  1N33 Q;  2F3I A;  1QVC A;  4LUO A;  4POG A;  3CMA A;  4EX5 A;  2N3S A;  5IYB G;  3HOZ G;  1YIT A;  1SMX A;  3A5Z B;  2KHJ A;  5IYD G;  3WWV A;  5M3F G;  1YZ6 A;  3PF5 A;  3CXC A;  2N49 A;  1L1O B;  1N34 L;  1VS0 A;  3ULP A;  4IFD J;  3BZK A;  4DV1 L;  2YTX A;  2NVQ H;  2Q2U A;  4OX9 Q;  3DM3 A;  4X64 L;  1JB7 A;  2R93 G;  1X3F A;  2JA8 H;  1VQM A;  2Z0S A;  3FHW A;  5GAH C;  1B7Y B;  2Z6K C;  3STB C;  2PNH A;  1LTL A;  5FLM G;  4DR2 Q;  1OXX K;  1VQ9 A;  4X65 Q;  1KC8 C;  4LF8 L;  5C44 H;  4BXX G;  1JT8 A;  5JEA J;  2PQA A;  4YWK A;  2F4V Q;  3RLN A;  3CCQ A;  2OCE A;  3A0J A;  2LXJ A;  4A3G G;  3GD7 A;  1HZ9 A;  4DK3 C;  1CKN A;  2K52 A;  1MJE A;  3S17 H;  5IYC H;  3CAM A;  3HOY G;  2UUB L;  1OTC A;  3CQZ H;  3NEN A;  4A3D G;  1YEZ A;  2VUM H;  3I4O A;  3W1B A;  4HIO A;  3RNU A;  4K0K L;  4DV6 Q;  1YNX A;  3IRB A;  4DV2 L;  1N32 Q;  4P73 A;  3AFP A;  3L2P A;  2K5H A;  5GRO A;  4GKK L;  1QUQ A;  3UE0 A;  2B63 H;  2NVY H;  3CCR A;  1BBW A;  3I4M H;  3HOZ H;  1IL2 A;  3KF6 B;  4R4I A;  1JMC A;  3ER0 A;  5C0X J;  5IE8 A;  1KIX A;  2A8V A;  4L5Q A;  3GTJ H;  1M1K C;  1J6Q A;  4LFC L;  3OTO L;  4JI6 L;  2K5V A;  4OON A;  2UXD L;  1ASY A;  1X3G A;  1OXU A;  4A3I H;  1Y1W H;  1M90 C;  2IX0 A;  1E1O A;  1N9W A;  1Z9F A;  3CPF A;  5AJ3 L;  1UEB A;  1G29 1;  4P72 A;  2UUC L;  3SGI A;  1WJJ A;  4LWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...