2EQSA

Solution structure of the s1 rna binding domain of human atp-dependent rna helicase dhx8
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
103
structure length
103
Chain Sequence
GSSGSSGEEPTIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-dependent RNA helicase DHX8
publication title Solution structure of the S1 RNA binding domain of human ATP-dependent RNA helicase DHX8
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 9
structure length 103
sequence length 103
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2eqsA01
1Z47A 3PO2G 1HNZL 3GD7A 4A3KG 1OXTA 3AYHB 1NMGA 3J81c 2V1CC 4A3JG 1VQKA 5IP9G 1CSPA 2ID0A 1VQMA 4JI7L 4PZ7A 4JBJA 1EIYB 5IYDG 4GKKL 4JI8Q 3I4NG 1E1OA 4O2DA 3FP9A 3CCEA 1YHQA 4A3CG 1Y1WH 4C2MH 1YJNA 4BA2I 1HJPA 1TWGH 3FHWA 3H3VI 1XNQL 1JJGA 4HIMA 1QUQB 1E3PA 1GKHA 2NVYH 5IWAL 1EOVA 2ZTCA 3GTLH 4P74A 4JOIC 4BA1I 1BBWA 2JA6G 4JYAQ 4GOPC 1PV4A 1SLJA 4LF9Q 4X65L 3K81C 3F2BA 4GKKQ 2VL6A 4R4QA 2VUMH 1U5KA 3Q8DA 1J5EL 1K8GA 4GNXC 3GTQH 3RN2A 1JJCB 3E9HA 4DV4L 2VQFL 1PH4A 3RZOH 1E24A 4JI3Q 2IT1A 4C3IH 1VQ8A 2UUCL 3MEFA 1YIJA 3S1NH 2A19A 4GLVB 4LUZA 1JT8A 2R7ZG 3M3YH 4JBWA 2JEAI 2UXBL 4IFDI 4A3EG 4L5QA 1X3FA 2WP8J 3CCSA 3KFUA 2LSSA 5IP7G 2RHSB 3CW2C 4OWWB 2F4VL 5GROA 3ICEA 1A62A 4DR5Q 4B3ML 4POGA 4BY1G 1GVPA 3T1YQ 2JEBI 4YHHL 1I5FA 1AE2A 3I56A 4DV4Q 3HOYG 2VQFQ 2PQAB 4BY7H 1S3OA 1OXSC 3A5UA 3PO3H 2UUCQ 5C44G 2BH8A 5M5WH 1N34L 2LXJA 5M5XH 2R6GA 3CF5A 3H3VH 4A3GH 4YY3Q 2UXBQ 3CQZH 2L15A 5EAYA 4NB3A 1PH1A 5IYCG 4B3MQ 2DGYA 2YTXA 4DK6C 3D0FA 2UXCL 1KHIA 5C0XJ 1Q46A 4IJLA 3CC4A 4LF5L 2D0PA 3D31A 4DPGA 4X66L 4POFA 2NN6I 3UDGA 4C3HH 4LF7L 4LFBL 4DV6L 5K36G 1KL9A 2E2HH 3UE1A 3AFQA 3RN5A 1XPRA 1NTGA 1XMQL 1IBLL 4IFDG 2VW9A 1PH3A 4QGUA 4LF8L 2CWPA 5J3BA 4PG3A 2UXCQ 1LUZA 1L2FA 4EX5A 4LF5Q 4HJ7A 4X66Q 4GS3A 5GAHC 1YJWA 1L1OC 1AH9A 4RG1A 2K5NA 4JI1Q 4Y7NH 1X6OA 3ER0A 4EQ5A 3HOXH 1PH8A 1RL2A 3RZDH 1VQCA 2FXQA 1DGSA 4P71A 2VS1A 4KI0A 3PF4A 4BXXH 2KHJA 2YTVA 1XMQQ 1KRTA 1IBKL 1HNWQ 3PGZA 2N3SA 4KHPQ 1HZCA 2XTIA 1B8AA 3FKIH 1WCMH 1CSQA 2K5VA 4UP9A 4DAMA 3K7UC 2NVXH 4OWXB 3RLOA 3M4OH 1WYDA 1ASYA 2OQKA 1BVSA 2R92H 3NEMA 3M4QA 2K75A 3I2ZA 2E8GA 4GNXB 2QEXA 1TWCH 4UPAA 1KRSA 4A93H 2YV5A 3CC2A 4A3IH 2OTLA 4DR4L 2ALYB 1PH5A 2JA5H 1YITA 2ZJQA 5FLXc 3NENA 5AJ3L 5JEAG 3W5OA 1EQRA 3TRZA 4YWKA 1CKOA 1PYSB 3KF6A 4HIOA 1QZHA 4B3SL 3CAMA 3HOVG 3TS2A 5M3MH 1YVCA 3T1HL 4DV0Q 3RNUA 1G291 3G48A 3AEVA 3G4SA 1UEBA 1VQ6A 3HOVH 3HOZG 4JG2A 4A3BG 5C3EH 3HOUG 1GD7A 4L5TA 1VQLA 4DR7Q 3ZJYC 2B63H 1EUJA 1W3SA 1XJVA 5C4JH 4R4OA 1K3RA 1NJIC 4DK3C 1HNXQ 1V43A 2N78A 1S72A 1N36Q 2MNAA 4JI5Q 2KENA 1OXVA 2WAQE 1JE5A 3KF6B 1B70B 5H1SE 3T1HQ 2R93H 2IHEA 1Q1BA 2VY3A 4BBRH 4AQYL 3HOWH 1EQQA 3TS0A 4A3LG 1N33Q 5E7NA 2HT1A 4JBMA 1S40A 4UP7A 4A3MG 1FGUA 3NBHB 4JYAL 3PO2H 4A3KH 4LF9L 4AH6A 4LF6L 5HGQA 3J7A5 1UE7A 3STBD 1VQNA 4A3JH 4P73A 4JCVE 5IP9H 5GAEC 1U0LA 1K0RA 4JV5Q 3CMAA 5IYDH 4AQYQ 2F3IA 4XTCS 1VS0A 2Z6KA 4JI3L 1XPUA 2JA9A 3I4NH 4A3FG 4A3CH 3UDFA 1VQAA 3TREA 1B7YB 4KHZA 2ASBA 3GTGH 4JI6Q 4NPSA 4PZ6A 1MJCA 1L1OB 4AIMA 4IFDJ 1KAWA 4A4IA 4HJ8A 1XMOQ 2C35B 4LF6Q 4DV2L 3STBC 2WAQG 4GN3B 4IOCA 4A75A 2JA6H 4DR5L 4LFAQ 2PQAA 4X64Q 1PVOA 5ELOA 3T1YL 1KXLA 4OWTB 5GQOA 1C9OA 2IX0A 2JK8A 3CPFA 2HHHL 3JAMi 1YHBA 3PV0A 4WJ4A 3CPWA 1UE6A 3IRBA 1EIFA 2AMCB 3PUVA 2EXDA 5IE8A 1I50H 1GM5A 4YY3L 1SE8A 1KC8C 5JJKA 4YCVA 4DV2Q 3LGJA 3L7ZC 1SFOH 2IHFA 3EIVA 2R7ZH 2ZTEA 2VQEQ 1YBYA 4B3TL 4A3EH 4DR6Q 1JJ2A 3CMEA 1OXXK 2KBNA 1EFWA 5IYBG 4LUOA 5IP7H 1CKMA 1SN8A 2OCEA 2RCNA 4OONA 3J81j 1MJEA 1HR0Q 4L5SA 2JE6I 3I4OA 3KYHC 3CC7A 1EYGA 4GN4B 1VQFA 2HHHQ 4BY1H 2D0OA 1PHJA 3HOYH 2CKZB 4HJAA 2N8NA 3U4ZA 1UE5A 5C44H 4QJFA 3KJOA 4DR1Q 3PUXA 3KLWA 5GAGC 3CCLA 4LWCA 1Q81C 1N32L 2A1AA 4IPCA 3I4MG 4B3TQ 1FL0A 5DLQE 2NVQH 1V1QA 3HKZE 4OX9Q 5IYCH 5LMUQ 1VQ5A 1VQOA 2EIFA 2ATWA 1UE1A 1A63A 1WJJA 2KCTA 4JI1L 3ULLA 2RF4A 4DV5L 3CCQA 2AWNA 1KIXA 3A5ZB 3CCVA 4P75A 2UXDQ 1K73C 1QVFA 1VQDA 4JOIA 1HR0W 2BA1A 1PFSA 4KLKA 4RMFA 4C3JH 3S14H 4GOPA 1N32Q 1HNWL 4KHPL 4H02A 2JJQA 4QL5A 3BJUA 1BKBA 2XGTA 2IY5B 3UDIA 1Q7YC 1HZ9A 2CFMA 3MXNB 4YCWA 3BZCA 3PUYA 5IT9c 4GNXA 4IPHA 1WI5A 2KHIA 4DV5Q 4HJ5A 2DUDA 2QA4A 2CCZA 1VQHA 4O0AA 5BR8Q 1QZGA 3PIPA 1KQSA 3HFZB 3J80c 1JMCA 1BBUA 2I5LX 3HKZG 1PH2A 1IZ6A 4GOPB 2JA7G 3F2DA 4HJ9A 3KF8B 4DV0L 3GTJH 1SR3A 3W1BA 3H15A 4UY8C 1X65A 4DUZQ 2AWOA 1VCIA 3TEHB 2NZHA 4DR7L 4JI2Q 1YJ9A 4LF4L 4IJHA 1Q12A 3GO5A 4IO9A 1IL2A 5C4XG 1I3QH 3OTOQ 4YWLA 4JI4Q 3U4VA 1HNXL 1HH2P 2CQOA 1N36L 3BZKA 4LUVA 4GKJL 1NE3A 1P8LA 4JI5L 2JA8G 5LMNQ 4DV7Q 1E7ZA 2YTYA 1X3GA 3E0EA 4DUYL 1X55A 3F2CA 1N33L 4HIDA 4K0KQ 3A74A 4LF4Q 1R9TH 2K4KA 1NY4A 3B6YA 3HOZH 1M1KC 3HOUH 3M7NA 4A3BH 2EQSA 1YZ6A 5FJ8G 2OQ0A 1SROA 4XIGS 3RLNA 3S1RH 4GKJQ 1X9NA 4JV5L 1VQ7A 3U58A 4Y52H 1JB7A 4X6AH 4DUYQ 2I0QA 1X56A 3K0XA 2ZTDA 4WJ3M 2BA0A 1L1OA 3L2PA 2N49A 3PUZA 5C0XG 4JI6L 5M3FG 4DNIA 3JAMc 1TXYA 4OX9L 5LMNW 1TWHH 4A3LH 2UUBL 3S15H 2HIVA 5HY6A 1XMOL 1Y1VG 3H0GG 1ASZA 3CD6A 1Q1EA 4NXMQ 2CWAA 1K8AC 2I5MX 4ME3A 4A3MH 5JJLA 4R1JA 4LFAL 3W1GA 4X64L 1Y1VH 1J6QA 2MO0A 3CCUA 4A3DG 1WFQA 4DV3L 2I5HA 4YWMA 3GTOH 1X54A 1WOCA 2GVBA 4GN5A 1L0WA 3F1ZA 3UDXA 1D8LA 2E2IH 1XNRQ 4OO1I 2Q2IA 1AE3A 4R4CA 1K9MC 4A3FH 2UUBQ 3S2HH 4OXPA 4APVA 1MKHA 2PI2A 4DR2Q 4LNQA 2D62A 1A8VA 2GVAA 3L0OA 3RR5A 1YNXA 3DLLA 1VQ4A 2VQEL 3F8TA 3PSIA 4AYBE 4DV1Q 1Q86C 3S2DH 4DR3Q 4JBKA 4DR6L 1Y1WG 5GADC 4DV3Q 1HR0L 2UU9Q 4TVAB 2ES2A 2Q2UA 2MFIA 3PCOB 2B3GA 4NXNQ 2ZM6Q 2QGQA 1M90C 1XPOA 1I94Q 2F52A 2GN5A 1PA6A 4J15A 4IPGA 1K83H 1HNZQ 4DR1L 3AQQA 2AKWB 2OWOA 3GTKH 3KOJA 1P16A 1V9PA 2VZAA 2WB1E 3BU2A 1Q8KA 1VQJA 4JI7Q 2KCMA 2VUMG 3G6EA 1PH7A 3EBEA 3M4PA 2PMZE 1LYLA 1VQIA 4MNOA 1SMXA 4P72A 3U50C 1CUKA 5LMUL 1QVCA 2R7DA 5IYBH 1O7IA 3OW2A 1FJGL 4OO1G 2Z0SA 2JQOA 3JC66 1XNQQ 2UXDL 1Z9FA 2Q2TA 5JEAJ 5IWAQ 3J81i 4AYBG 3EN2A 1FVIA 2VNUD 1SRUA 3ERSX 3S1QH 2K14A 4MZ9A 1A0IA 1TWFH 1XTDA 4X65Q 1X3EA 4BBSG 2E5LL 3I4MH 4BY7G 1TWAH 1J5EQ 1LTLA 1FJGQ 1N9WA 4BBSH 3PO3G 3S1MH 2NVTH 1NMFA 1C0AA 4A3GG 4UP8A 1OTCA 4A76A 1IBML 5BR8L 5ELNA 1KD1C 1VQPA 2WB1G 3PF5A 2K5HA 3G71A 4R4TA 3SGIA 3CP0A 2WFWA 2IX1A 1HZBA 3K7AH 3PUWA 3K8AA 2F4VQ 2E5LQ 1H95A 3ULPA 3KDFA 4YHHQ 2UUAL 3GTPH 3I7FA 4DUZL 4QQBX 4JI0L 1E1TA 1I6HH 4QIWE 4JI2L 2HIXA 1T9HA 1IBMQ 1CKNA 1N34Q 3OTOL 4JI4L 1OXUA 2E2JH 3DM3A 4IOAA 3UE0A 2OTJA 3RLFA 1EWIA 5LMNL 1VQBA 1YEZA 3ULJA 3CCRA 4DV7L 2YU9H 1G6PA 2H5XA 3GDEA 2UUAQ 2R7FA 2JA7H 4K0KL 4JI0Q 1RIPA 5C0XI 3KDFB 3AFPA 3S16H 3HOXG 3I55A 1PH6A 1IYJB 2K50A 2MQHA 2ZJPA 4IPDA 4BXXG 4LF7Q 4LFBQ 1IXRA 4MTNA 4DKAC 4DV6Q 2MO1A 2BH2A 1CKNB 2Y0SE 3FKIG 5C4XH 1WCMG 2Q2HA 3HKSA 4X62L 3CXCA 2ZJRA 1IBLQ 4DAYB 1GO3E 4LF8Q 4B3RL 3E9IA 2PNHA 4GLXA 2R92G 3CCJA 4JC0A 2JA8H 1N8RC 2Z6KC 1YHAA 1UWVA 1PH9A 3S17H 1VQEA 4GLAC 4A93G 5IY0A 4A3IG 2NN6G 1W2BA 4HIKA 3M9BA 2JA5G 1PYBA 2PI2E 3TQYA 4NXML 3M85A 5M5YH 1E22A 4TQUS 2K52A 1VQ9A 2B29A 5M3MG 4X62Q 1D7QA 2LXKA 2HQLA 2NZOA 5FJ8H 1IBKQ 4B3RQ 1HZAA 4FDBA 2YYZA 1G51A 2AHOB 3GTMH 5C3EG 4LFCL 1NBWA 1XNRL 3NELA 4LW1A 2B63G 1VQGA 1C7YA 4L5RC 3VDYA 4R4IA 1MIUA 5JJIA 4PZ8A 4QY7A 2Y0SG 3KJPA 5M3FH 4DR2L 2A8VA 3J80i 4DR4Q 1Y14B 3OYYA 4DV1L 3CCMA 4DR3L 3H0GH 5FLMG 5AJ3Q 1YI2A 2R93G 4PMWA 3S24A 4B3SQ 4BBRG 3HOWG 1Q82C 1QVGA 3K80C 4JI8L 2UU9L 3WWVA 5FLMH 1LM0A 4LFCQ 3A0JA 4A3DH 4NXNL 1QUQA 2ZM6L 4YCUA 1I94L 2RHQB 3PIOA 4ALPA 3J7ZC
chains in the Genus database with same CATH superfamily
1PFBA 5KEEA 1OXTA 1HTLD 2LMCB 2C5CA 1JE4A 2V1CC 1VQKA 4KJOA 1VQMA 1CHPD 2EYJA 4JBJA 4PZ7A 1EIYB 1DM0B 1DXMA 1E1OA 1PZID 1SNQA 3FP9A 4O2DA 5NUCA 2Q8TA 3CCEA 1YHQA 3FMCA 2K5WA 3H3VI 1JJGA 5JVG3 4HIMA 1QUQB 3WDNA 2EZVA 1ENCA 4JYAQ 1SLJA 4HTHA 3F2BA 1TS2A 1K8GA 4GNXC 4H7BA 1EY0A 2VQFL 5IGFA 2IT1A 2LS01 2EXZA 1H9KA 1QCBD 1YIJA 3S1NH 4DNTB 3M3YH 2UXBL 4IFDI 2WP8J 1VF7A 3CCSA 2LSSA 2RHSB 3CW2C 3ICEA 3F2UA 3M7GA 1NR2A 3HOYG 2VQFQ 5KIXA 1S3OA 2PYKA 3C46A 1N34L 5M5XH 4DK0A 1QE6A 2UXBQ 1KABA 5EAYA 4DK6C 2O2LD 4NDXA 1Q46A 4HR7B 3AMUA 1TVXA 3UDGA 1TY0A 3AFQA 1IBLL 1PH3A 5J3BA 3M3YB 1LUZA 4XXEA 5JVH3 1M8AA 1TS4A 1FYCA 1AH9A 3BVZA 2K5DA 4RG1A 4Y7NH 1PH8A 5E3FA 2FXQA 5CORA 4KI0A 3PF4A 1KRTA 2N3SA 4KHPQ 5M5XB 5D65A 4NP5A 5JOBA 1WYDA 2R92H 3SK4A 2E8GA 1TWCH 4UPAA 1KRSA 4A93H 4A3IH 1A3UA 2JA5H 2ZJQA 1D5ZC 2MP1A 3NENA 5JEAG 1PYSB 3I72A 4BWGB 1QZHA 3TS2A 2JSOA 3K5MA 1PTOC 4S3SA 1VQ6A 3HOUG 2XWJB 4L5TA 1VQLA 3ZJYC 1W3SA 4DFAA 5C4JH 2NYZD 5EGTA 1NJIC 2WKDA 4Y7NB 4JI5Q 1OXVA 1JE5A 3NK9A 1B70B 2R93H 2IHEA 1Q1BA 4BBRH 3HOWH 1C4QA 1N33Q 2HT1A 4HMIA 2DNCA 2F0PA 4ABNA 4RKLA 1KDAA 5EKIA 3PO2H 2R92B 3DXJC 3NTIA 4AH6A 2PZWA 3J7A5 4K6LA 4P73A 1DZ1A 4A93B 3BS1A 4A3IB 2F3IA 1XPUA 3I4NH 2EOTA 2JA9A 2F0KA 1VQAA 1HUNA 5J1ZA 3J81L 1Q8IA 4K5WA 1KAWA 4IUNA 4RWSC 2WAQG 4IOCA 4X64Q 3T56B 5ELOA 5C4JB 1C9OA 3CPFA 3BYYB 2HHHL 5M9OA 3JAMi 3TSSA 2R93B 3IRBA 2AMCB 1Y8PB 4OL7A 4BBRB 3Q0AA 3HOWB 4EQNA 5K5PA 1DOKA 1SE8A 1JORA 1JC7A 2VQEQ 2HUGA 4B3TL 4DR6Q 1OXXK 1SYDA 4LUOA 3PO2B 1LTSD 4OX9L 2RCNA 4L5SA 3KYHC 1EZ6A 2F0DA 2HHHQ 1VQFA 1U4PA 4HJAA 4B08A 1TWGB 1XWEA 3I4NB 5C44H 2Z9HA 3KLWA 1N32L 1B4OA 3I4MG 4B3TQ 5DLQE 4LAAA 3HZXA 1I4XA 4XQQA 2NVQH 4OX9Q 3KUPA 5LMUQ 1VQOA 2DN8A 1ZEQX 1HA5A 3CCQA 2R3ZA 1VQDA 2KECA 4C3JH 1PFSA 3T53B 2BE5D 1RF2D 3ONAB 4GOPA 1N32Q 2Z4HA 3KF8A 4H02A 2E2DC 1I4RA 1WTWA 1FD7D 1WI5A 2KOLA 1VQHA 4O0AA 5BR8Q 3R3OA 1KQSA 4ZUIA 3PO3B 2BE5C 3HFZB 4MN3A 3J80c 1AZQA 2B2WC 5C44B 3VA7A 3F2DA 5IGBA 1PLFA 5IODA 1SR3A 4UY8C 4IUTA 3TEHB 1EY8A 2NZHA 2NVQB 2CHBD 2RKSA 1B9NA 4KHVA 1S4ZA 3GO5A 2OXPA 3OTOQ 1HNXL 3BZKA 4LUVA 3T51B 2E2HB 1AW7A 1R4QB 1E7ZA 4KN7C 1F9SA 3DWAA 4FXDA 3F2CA 1IL8A 4HIDA 4K0KQ 2J7ZA 3A74A 1NY4A 1U4LA 3J7AF 2OQ0A 1EU4A 4JV5L 1K8MA 2EY1A 5C4ZA 5IGEA 2IW3A 1STEA 5C0XG 5JAVA 1TXYA 4IZ8A 3S15H 2HIVA 4WORA 3DMUA 2KA7A 1K8AC 4A3MH 2G9DA 4R1JA 3SK8A 3TZDA 1J6QA 1PTOH 2PW7A 2I5HA 4HCEA 1CA6A 3GTOH 1WOCA 3TN2A 2E2IH 1XNRQ 4JK1C 4OIJA 3NWSA 4R4CA 1AE3A 4A3FH 5EBCA 2AQ2B 1MKHA 3KLSA 3FPPA 3OHXC 4LNQA 1A8VA 3L0OA 3RR5A 3DLLA 4ZAIA 4AYBE 3PSIA 1O78A 4Q0FA 5GADC 3JAME 2XIWA 3MA2B 3NBIA 4RHRA 1HPCA 4NXNQ 3I4LA 1XPOA 4HMJA 2GN5A 4PQXA 3V96A 4N9TA 3X3NA 2OWOA 2VZAA 3R2IA 2VUMG 1PH7A 3V2TA 3S15B 1SMXA 3U50C 1QVCA 4A3MB 2R7DA 3OW2A 4OO1G 1PTOB 1SXTA 1I4HA 4UDUC 5I4DA 1Z9FA 3GTOB 3EN2A 3GTGB 3ERSX 4MZ9A 1A0IA 3MXNA 4A3FB 4X65Q 4BY7G 1TWAH 1QOHA 1J5EQ 3HRZC 1N9WA 4DXFA 2B2UC 3TDQA 1CI3M 1IBML 3OSOA 3OOCA 3IFTA 4UAIA 1BR9A 1EOTA 2IX1A 3DEOA 1MSHA 1WTQA 3K7AH 3PUWA 2M2LA 5C6AA 1NCVA 1Z7TA 5KRUA 4DUZL 4QQBX 1E1TA 1JWUD 1T9HA 2L1BA 1IBMQ 1MI2A 2O5JC 4O42A 4O1NA 4IOAA 1OXUA 4DAYA 3RLFA 3A55A 1ML0D 1I4QA 5IT9L 3CCRA 1G6PA 2JA7H 1SNCA 2ZXRA 4EVOA 4XQNA 2MGSA 3HOXG 3I55A 4IPDA 2L4NA 4LFBQ 1SMYC 3HS0C 4DV6Q 2BH2A 1SNPA 3FKIG 5C4XH 3HKSA 2PO4A 1SBBB 3RD4A 2B2YA 2JP1A 2JA8H 2Z6KC 1YHAA 1UWVA 4TKOB 3K7AB 3S17H 1VQEA 5IY0A 1JWSD 3OIQA 1ZXTA 3M9BA 1HFNA 2ZXOA 2K52A 4KD4A 2NZOA 2QDBA 2DJGC 3GTMH 2AHOB 3MTSA 5C3EG 3SEBA 1XYIA 3BDOA 4L5RC 2JA7B 3J80i 4DR4Q 3TP7A 2L5TA 3OYYA 3VR5A 4DR3L 4QCLA 5FLMG 1YI2A 1X3QA 4B3SQ 3HP3A 5FK9C 5FLMH 3NXWA 4A3DH 5JPNC 5C4XB 4X3KA 3T16A 4R9WA 2NB0A 3IKJA 3PIOA 2PPBC 4G7OC 1JCKB 1PFMA 5BN4A 1HNZL 2JA8B 4A3KG 5KNBA 2RQXA 3J81c 3HGBA 3NE5B 4A3JG 1AZPA 5IP9G 1CSPA 2ID0A 3S17B 4LJZC 5IYDG 2JN4A 1RHPA 4CGYB 4EQOA 1YJNA 3D6WA 3N52A 1XNQL 1E3PA 2EVBA 3GTMB 1EOVA 3ND8A 1BOSA 2ZTCA 4P74A 5A35A 1IHZA 1BF4A 4BA1I 1PV4A 3K81C 4KY7A 2N55A 3U9SA 1GUGA 1U5KA 3NSWA 1QILA 1Y1VB 3E9HA 4NMZA 2ENBA 1E24A 4C3IH 1STYA 4IURA 5EBDA 2FINB 4IUUA 4A3DB 2A19A 3BDLA 3D8GA 4LUZA 1TIID 4JBWA 3HG9A 4IQZA 4OWWB 4K2LA 4DR5Q 3I56A 1OXSC 3PIP3 2RCFA 5FO8B 2LXJA 1EEFD 2R6GA 2V4DA 4YY3Q 2NTSA 3CQZH 5HGTA 1L0YB 2E75C 4NB3A 2F0QA 5IYCG 1ILQA 1CM9A 3IFDA 1LTBD 1KHIA 3CC4A 4IJLA 4DPGA 4X66L 5EPJA 1F2YA 4C3HH 4LF7L 3SXHA 1RTNA 1DOMA 4ZKBB 3NQTA 2QDLA 3TZUA 4C3IB 3Q23A 4FF2A 4UHVA 1XMQL 1XPRA 3W3AA 2KVMA 5CC4A 2EYMA 3TMEA 3PMFA 4C56C 3CKIB 4WFN3 4G57A 4AYBB 4EX5A 4X66Q 4GS3A 5GAHC 2D5DA 5ELBA 4KMUC 4BBSB 1X6OA 1RL2A 4BXXH 2YTVA 1XMQQ 4K6DA 1IBKL 2RA4A 3MXGA 2K32A 4ZCKA 4DGZA 4ZRZA 1SAPA 4UP9A 4J8QA 3CQZB 4CJ0B 1TT2A 2K5QA 1ASYA 3OMCA 1B53A 4DF7A 2K75A 4CDEC 3AU7A 4LMQD 2NN6H 2ALYB 1KNAA 5FLXc 5AJ3L 3TRZA 3W5OA 5ELDA 4C3HB 4YWKA 1CKOA 3HOVG 3CAMA 1YVCA 1KNEA 1LT6D 3RNUA 3G48A 3HOVH 4A3BG 1GD7A 2ICIA 3S9WA 3J80E 4DR7Q 5C3WA 3S16B 1GUWA 1XJVA 4KY5A 1K3RA 4DK3C 1N36Q 1BXTA 2WAQE 3KF6B 4AQYL 3KK7A 1TKWB 1ET6A 2AQ1B 3FEWX 1TU2B 4RGMA 1A2TA 1FGUA 4JYAL 4E6IA 3RMHA 1UE7A 1GUNA 5A2QL 1LT3D 5M5YB 1U0LA 4F88A 3DUZA 3CMAA 3NTKA 3P75A 4AQYQ 3UDFA 3TREA 3UI2A 2F0JA 4JI6Q 4PZ6A 4K8IA 3R8BA 4AIMA 1F2MA 4HJ8A 1XMOQ 5I2YA 4DV2L 4GN3B 4A75A 2RDHA 4LFAQ 1PVOA 1KXLA 2IX0A 2JK8A 3GV6A 4IN3A 3PV0A 3CPWA 1EIFA 3PUVA 5IGDA 1QJOA 5IE8A 1I50H 1KC8C 4WJWA 5JJKA 3D4RA 5C5LA 1BQQT 4YCVA 4DV2Q 3L7ZC 1SFOH 5CMDA 3MXPA 3VYTA 2Q8RE 3ND9A 5E4XA 1LTAD 5CBEE 1JJ2A 1G2SA 1SN8A 4OONA 3J81j 1HR0Q 3EVQA 1EYGA 4GN4B 1DYQA 3HOYH 1BBXC 4B9XA 3KJOA 3PUXA 5GAGC 3QOLA 1T5XD 1LT4D 4X3SA 2B2TA 1F77A 3DEPA 1VQ5A 1CFMA 1S5FD 1H9SA 4OGQC 1WJJA 4RFBA 2AWNA 1JQYD 3A5ZB 3I91A 3CCVA 2UXDQ 1LACA 4JOIA 5FO9B 4KKUA 4DNRB 1BCPB 3S1NB 4KHPL 2JJQA 1Q7YC 1IYUA 2CFMA 3MXNB 2D9UA 3BZCA 4YCWA 2E74C 3PUYA 5IT9c 1SFOB 2PZUA 2MPMA 4HJ5A 4OIKA 2DUDA 2QA4A 5EJWA 2CCZA 2E76C 1CA5A 2NUCA 3OWEB 1EY6A 2F0HA 4FF4A 2N88A 1Q3LA 2I5LX 3HKZG 3CRLC 2C9OA 1PTOD 5TSSA 1ICWA 1X65A 2B2VC 4JI2Q 4IJHA 4LK1C 4IO9A 2BDNA 1IL2A 1I3QH 2XNAC 3U4VA 3I70A 1HH2P 2ICEC 4GKJL 4JI5L 3OMGA 5JEAH 4JVZA 1DD2A 1VF5C 2DNEA 4MIUA 2YTYA 1X3GA 1N33L 5ELCA 3NBHA 1RD9D 1G6ZA 3VA5A 2F4IA 1R9TH 3QR8A 3HOUH 2EQSA 2EPBA 1YZ6A 5FJ8G 3RLNA 4GKJQ 3MEHA 1X9NA 1SNMA 1PYWD 5EPLA 3GQBA 1JB7A 1ESFA 3K0XA 1JICA 1L1OA 3NPPA 5M3FG 4DNIA 2Z8LA 5HY6A 3OWFA 3H0GG 1E2VA 2I5MX 1TWCB 4L8JA 4M1UB 3W1GA 4X64L 2JA5B 1I3QB 3J7YW 4HCSA 2XRSD 1X54A 4ZYSA 4G4KA 1D8LA 4DN4M 4KV6A 1ONLA 2Q2IA 1K9MC 5I6WA 1EWHA 3S2HH 1EEID 4DR2Q 2GVAA 1PXUA 1PZJD 1YNXA 2VQEL 1R9TB 4DV1Q 4DR6L 4I7ZC 1S5BD 3HOUB 1Y1WG 1V1PA 2Y0SB 1EL0A 3R93A 4TVAB 2Q2UA 4FXKC 1A15A 1LTRD 2MFIA 2ZM6Q 1I94Q 2CQAA 4IPGA 3GTKH 1V9PA 4JI7Q 2KCMA 1EU3A 1STHA 3M4PA 1JOQA 4P72A 1VQIA 5LMUL 2HCCA 1FJGL 2Z0SA 2JQOA 3JC66 3VYRA 1GUTA 5IWAQ 1FVIA 2ZXPA 5L37A 1TWFH 1XTDA 1BCPF 4RKBA 3S2HB 2E5LL 3I4MH 1FJGQ 5IGCA 3PO3G 1D6EC 3A7AB 2WAQB 4A3GG 3NP8A 1OTCA 1F2ZA 3HEJA 4I65A 5BR8L 1KD1C 1HRJA 2WB1G 2K5HA 3G71A 1FNVA 2FMMA 3CP0A 3SGIA 2RSNA 1T5EA 2F4VQ 2E5LQ 1H95A 2EYFA 3GTKB 3KDFA 4YHHQ 1W6KA 4QIWE 5IGGA 1I4GA 2X69A 1SYCA 3KLRA 3OTOL 2OT2A 1Y8OB 2HDLA 1VQBA 2YU9H 2H5XA 4K0KL 4L6TB 3Q6SA 1R4PB 3DWPA 3I4MB 2K50A 1CKNB 1K28A 1H9MA 1NNXA 1WCMG 4X62L 2KEEA 4C3JB 4LF8Q 3E9IA 2EYHA 3NHHA 4GLXA 4H0LC 1N8RC 1HQMC 2F0WA 3A54A 1PH9A 2A69D 5FKAC 1PYBA 5DM63 1C48A 4TQUS 1SDFA 2F0SA 1VQ9A 2B29A 5M3MG 4X62Q 2LXKA 1HZAA 2K05A 4G7HC 5BN3A 1NBWA 1XNRL 3NELA 2H1EA 2A69C 2B63G 2YU9B 2O5IC 5DEHA 4G7ZC 3VDYA 4R4IA 1MIUA 2OF1A 2F0UA 5C0XH 3KJPA 2L0CA 3VR6A 1LT5D 4F8MA 1W6JA 2F0MA 2KCCA 3P7JA 4JI8L 2PQEA 1LM0A 4NXNL 1QUQA 4CJ1B 3JAML 2K6AA 1SE3A 4KY6A 3P20A 5EKLA 5FLXE 3GD7A 1KLGD 1NMGA 1DJRD 4U68A 1II3A 3SK6A 4GKKL 4JI8Q 4A3CG 3L3OC 1HJPA 3FHWA 1SSOA 2NVYH 1CZGA 1EY9A 4TRDA 2JA6G 1BBWA 4GOPC 4LF9Q 4X65L 4GKKQ 4P2CB 4RCOA 2VUMH 1J5EL 3GTQH 1PH4A 2WV6D 4JI3Q 1WTRA 1VQ8A 2F0TA 2UUCL 4OO1H 4HAEA 4PMBA 2E2IB 4GLVB 2R7ZG 1A3VA 4MHEA 4A3EG 4L5QA 1X3FA 3KFUA 4N9PA 5IP7G 2VB3X 5GROA 3MXUA 4BY1G 4POGA 3T1YQ 1I5FA 4ZQ3A 1B3QA 1AE2A 1GHKA 2K01A 4BY7H 3A5UA 1LTID 2UUCQ 2BH8A 5G3LF 5M5WH 3X3MA 1EWCA 4V0BA 3CF5A 3H3VH 1GJXA 4KKTA 2L15A 2NVYB 1PH1A 2J4XA 3ZYYX 2KJXA 2AUKA 2IX3A 3K5LA 1F9PA 3GP7A 4LF5L 1EIGA 2D0PA 4POFA 1MD2D 1MGSA 2F0IA 2VUMB 1SMYD 3GTQB 4LFBL 4DV6L 5K36G 1KL9A 3UE1A 3C2PA 1KDBA 1NTGA 1RCVD 4IFDG 4XDXA 2A68D 4Q5VA 2ZT9C 2CWPA 4IFDH 3DM1A 1L2FA 4LF5Q 3H91A 4HJ7A 5EPKA 1TWAB 2F0NA 1IW7C 2DJFC 4JI1Q 4EGVA 3ER0A 3HOXH 1H9SB 3VYSA 4EQ5A 3RZDH 1VQCA 1DGSA 4BY7B 1CQVA 1STBA 2KHJA 1XTCD 2A68C 1HNWQ 5M5WB 3PGZA 2XTIA 3FKIH 2NTTA 1CSQA 1H9JA 2NVXH 3M4OH 2OQKA 1BVSA 4OELB 3NEMA 3I2ZA 2QEXA 3Q22A 4QUCA 3FPUB 2YV5A 4DR4L 1TS3A 3RUZA 3SHLA 4B3SL 3K59A 3A8IE 2M00A 4K2KA 1FGBD 4DV0Q 3KBGA 5KYLA 3T1HL 1G291 4K8JA 3AEVA 1CT1D 2EJFC 3HOZG 2EYPA 5C3EH 4RHSA 1BCPD 1FNUA 4R4OA 3FRPB 2JXMB 2A5HA 4ZUJA 1V43A 2BOSA 1B2TA 2MNAA 1ENAA 2KENA 3T1HQ 3FDTA 1EQQA 3TS0A 4A3LG 3FKIB 3VYUA 4ID6A 1BCPC 4C1NK 2NVXB 4UP7A 3NBHB 3M4OB 4B9WA 4A3KH 4LF6L 5HGQA 1VQNA 1KTKA 4A3JH 4EQPA 4JCVE 5IP9H 1B3AA 1U4RA 2X6GA 1EQVA 5GAEC 1K0RA 4DK1A 1JOKA 2IL8A 4R8IA 1UEAB 1SJHD 5IYDH 1VS0A 1I4PA 1YNND 2RSOA 3E5SA 2SEBD 5CV8A 1B7YB 2ASBA 4ME5A 1KDCA 4NPSA 3LNNA 1JR0D 5I9PA 2PZTA 3K5NA 1L1OB 1STNA 4A4IA 4RCNA 1CQFA 5C3EB 4KN4C 4LF6Q 2L11A 3QG1A 3MWYW 4CHTB 4DR5L 5J39A 2PQAA 2RBMA 3LWEA 5GQOA 3LWUA 5DM73 1G2TA 1YNNC 2OEOA 4RGOS 5C5MA 4WJ4A 1V1OA 5COYA 2EJMA 1GM5A 1DCZA 4YY3L 4ILWA 4HN7A 3MAQA 2IHFA 1YBYA 1EFWA 2KBNA 5IYBG 3BVMA 1CKMA 1SYFA 2OCEA 4A3KB 1MJEA 2JE6I 2F0VA 4A3JB 4IUVA 1EYDA 3SVMA 2CKZB 4XT3B 5KYIA 1UE5A 2I46A 4QJFA 5T1IA 4DR1Q 3SK5A 3CCLA 1Q81C 2GA4B 2A1AA 4IPCA 1FL0A 3A8JE 3A7LA 2RDGA 2B2YC 3HKZE 5IYCH 1QNKA 2ATWA 1HA6A 2KCTA 1O7YA 2K7VA 3ULLA 2RF4A 4P75A 1QVFA 1HR0W 4KLKA 4RMFA 3K5OA 2HQEA 2QEJC 4QL5A 1BKBA 1MBYA 2XGTA 4FO2A 4DAPA 2IY5B 1HZ9A 2F3WA 1SYBA 4GNXA 3WOFA 2KHIA 1DONA 1D1KA 2O4XA 1WTHA 1SNDA 1PRTF 5ELFA 1MHWC 4IALA 2B39A 1JMCA 3A56A 1PH2A 1IZ6A 4GOPB 1WTPA 2F0OA 1XX8A 3KF8B 3GTJH 4OEMB 3W1BA 3H15A 2CH4A 3QB3A 2AWOA 1SJED 4DR7L 1YJ9A 2J0TD 3BVGA 3I8ZA 3J80L 1XXGA 4V190 4YWLA 4JI4Q 2CQOA 1N36L 1SE2A 3IL8A 1NE3A 1P8LA 4Z9CB 5LMNQ 5CGKA 4DV7Q 4GZYC 3LX0A 3PIO3 4DUYL 1X55A 2K1BA 2QKIC 2G5DA 4HSVA 3B6YA 4A3BH 3M7NA 3R2TA 3ITPA 3I73A 4TSSA 3MVVA 3U58A 4Y52H 2EY5A 4DUYQ 2I0QA 1X56A 3OPOA 4PV1C 4WJ3M 2BA0A 3SDZA 4XQJA 2N49A 3K58A 4JI6L 3JAMc 1TWHH 3GTJB 2UUBL 3BDCA 3C1EA 5EQ0A 1XMOL 1MSGA 1ASZA 4NXMQ 2CWAA 5JJLA 5LL6X 4LFAL 2MO0A 4IUPA 4DV3L 2GVBA 3F1ZA 1D2BA 3ERQA 4OO1I 1KAAA 1GUSA 4HEDA 1S5ED 3HOVB 2UUBQ 4OXPA 4RGNA 4APVA 1F9QA 1NSNS 1VQ4A 5ISRA 3F8TA 1Q86C 4A3BB 4JBKA 5AFWA 4DV3Q 1HR0L 1G91A 2UU9Q 5JJZA 2B8GA 4K5VA 1M90C 1STAA 1O7ZA 1X3PA 2F52A 1PA6A 1B1ZA 1JB3A 1K83H 3AQQA 2WB1E 5A2QE 1Q8KA 2K33A 1GUOA 1VQJA 5CBAE 1TWHB 2D2CC 5ELEA 2X6LA 2PMZE 1LYLA 1CUKA 1VDZA 1M4VA 1HQRD 3CRKC 2LKVA 2UXDL 1RODA 2Q2TA 5JEAJ 3J81i 2CW0D 2PW5A 2VNUD 5CYUA 4K5XA 3S1QH 2KQ3A 1QNUA 1SE4A 1I6VC 1X3EA 4F87A 5CR3A 1LTLA 1ENFA 3S1MH 1NMFA 5FOBB 1C0AA 4R8NA 5C4HA 5CV6A 2CW0C 3PF5A 4XYOA 2TMPA 5D14A 1Y8NB 2WFWA 1I50B 1K83B 3KBXA 3ULPA 2UUAL 3I7FA 2H4OA 1EY4A 1FR3A 4HSPA 1GHJA 2HIXA 4JI2L 4FP5D 3E3XA 4KTAA 2Z6BA 1N34Q 3HOYB 1EWIA 1HCZA 1YEZA 3ULJA 2CVRA 1EYAA 3GDEA 3KLSX 3S1QB 2UUAQ 2R7FA 1H9RA 1HTPA 1RIPA 2F0GA 2QW7A 3AFPA 5CV9A 3L9AX 1PZKD 4DA2A 1IYJB 2MQHA 2ZJPA 1U4MA 3K6OA 1ZKOA 3S1MB 2MO1A 1D5MC 2SNMA 1ICFB 1IBLQ 2Q2HA 2ZJRA 4DAYB 1GO3E 2PNHA 2R92G 4CDDC 4JC0A 4GLAC 4A93G 4A3IG 1W2BA 5I2XA 4HIKA 1PDQA 2JA5G 3P1HA 3TQYA 4J1MA 1E22A 2WKCA 2XVSA 1D7QA 5FJ8H 5F2DA 4ZLTF 1S5DD 2YYZA 1G51A 2BCOA 4LFCL 5J22A 4LW1A 1CZWA 1VQGA 3HKZB 5CV4A 1C7YA 3EQLC 5JJIA 2B8FA 4PZ8A 2Y0SG 4DR2L 5M3FH 2A8VA 1HXYD 1Y14B 4DV1L 3H0GH 1SYGA 2R93G 2B2WA 4PMWA 3S24A 4BBRG 5D3IB 3HOWG 1Q82C 1QVGA 4FF3A 4LFCQ 2ZM6L 2A73B 1I94L 2F03A 1TR5A 2HD3A 1Z47A 3PO2G 3AYHB 4FYDA 1WTXA 3G6JB 4JI7L 2DY8A 1AP0A 1JOOA 2Z4IA 2MUYA 3MHBA 2B2TC 3I4NG 1V8QA 3OIPA 4QUFA 1LABA 1Y1WH 1PRTD 4C2MH 4BA2I 5EKKA 1TWGH 4CKCA 2F0EA 1GKHA 5IWAL 4XT1B 3GTLH 1LO5D 2DY7A 4JOIC 3H3VC 1STGA 1RDPD 2VL6A 5M3FB 2XRQD 4R4QA 4XYQA 3BZDB 3Q8DA 1KLUD 1PRTC 3RN2A 1JJCB 2P5ZX 4KJNA 3H0GB 4DV4L 3RZOH 3J81E 4NKLA 2EYOA 4CDFC 3MEFA 3V05A 3NQIA 1JT8A 1WVLA 1IKMA 2JEAI 2MHVA 3E6ZX 2F4VL 3EFXD 1A62A 2HDMA 5FO7B 4B3ML 4C1NI 1GVPA 4ULLA 2JEBI 4YHHL 2WIIB 4DV4Q 5DAUA 2PQAB 3TP6A 4PNYA 3PO3H 5C44G 3QJYA 4ZK9B 4CKBA 1Y1WB 4A3GH 4C2MB 1J8IA 3AB9A 3O13A 1RKNA 3A8KE 1PFNA 3GTLB 4B3MQ 2DGYA 2YTXA 5JPMC 3D0FA 2UXCL 5C0XJ 3QWNA 1OO9B 3D31A 1LLRD 2NN6I 3K0YA 5I9OA 2QILA 4C3JG 3RZOB 4L63B 2E2HH 1A3TA 3RN5A 1EYCA 3VR4A 2VW9A 4QGUA 4LF8L 3U9OA 4PG3A 3QIAA 2UXCQ 1TWFB 3URYA 3NTHA 1QG7A 1YJWA 4M8AA 1L1OC 3WOEA 2K5NA 3NUCA 4P71A 2VS1A 3VR3A 3FVQA 1A2UA 4H44C 4K14A 1HZCA 4A3GB 1B8AA 4N8FA 2IPKD 1WCMH 2K5VA 4DAMA 3K7UC 2WB1B 4OWXB 1HFGA 2B2UA 3RLOA 1GOZA 3M4QA 3I3CA 2PMZB 4GNXB 1UUPA 4PMCA 3CC2A 2OTLA 1PH5A 4RAUC 3IAYA 1YITA 1EQRA 3KF6A 4HIOA 1HHVA 1LTGD 2EYLA 2K28A 5IOCA 5M3MH 2FJ2A 3E0JA 3G4SA 1UEBA 4JG2A 1LTTD 1SYEA 2B63H 3SE0A 1EUJA 5E4WC 2RDFA 5FLXL 1HNXQ 2G9HD 2N78A 1S72A 1RJTA 4QF4A 5H1SE 2VY3A 4DXGA 3CU7A 1EZ8A 1DOLA 5E7NA 2PCFB 1WCMB 4JBMA 1S40A 3MZ5A 1L0XB 4A3MG 1NAPA 4RGTA 4LF9L 3STBD 1WD0A 4JV5Q 1CHQD 3H6MA 4XTCS 4JI3L 2Z6KA 4A3CH 4A3FG 4KHZA 5M3MB 3GTGH 4FF1A 1MJCA 4IFDJ 4FXGC 2C35B 3STBC 1EY5A 2JA6H 2SDFA 2B63B 4CDCC 3T1YL 1F9RA 4OWTB 3QO2A 2KUMA 1YHBA 1UE6A 4QMGA 2EXDA 4OHJA 3W2DA 2XSCA 2SNSA 1BO0A 2EE1A 3LGJA 4RH6A 2Q8IB 3EIVA 2R7ZH 2ZTEA 2F1MA 4A3EH 1LV9A 3CMEA 3EROA 5IP7H 1K0SA 3I90A 5T1GA 3I4OA 1SNOA 3CC7A 4BY1H 1IKLA 2D0OA 1PHJA 2VXWA 2N8NA 4QB4A 3U4ZA 5E1FA 3H94A 1G8ZD 2F0LA 2MJ8A 4LWCA 1E0BA 2KEDA 4JPBW 5D3DA 1V1QA 2WACA 2EIFA 1UE1A 4KD3A 2JA6B 1A63A 2IJ0A 1IW7D 4JI1L 4DV5L 3J7AV 3CHBD 4CKEA 1KIXA 1K73C 2BA1A 3S14H 5K36H 1NUCA 1HNWL 4FNFA 1UNSA 3BJUA 4F7XA 3UDIA 1E2ZA 2LFNA 4IPHA 2R7ZB 4A3EB 4DV5Q 2HCIA 3BYTB 5CV5A 3D4WA 4BY1B 4IUQA 3PIPA 1QZGA 1ILPA 3TBIB 1BBUA 2QF7A 5BN5A 1A6XA 4N8X1 2JA7G 1AFPA 4HJ9A 3GV3A 4DV0L 1Y69U 2PNRC 2R61A 1C8CA 5LL6S 1E2WA 1J9OA 4KK7A 4DUZQ 1VCIA 1PRTB 1EFID 1VMPA 3MC0B 4LF4L 1Q12A 2EJGC 1EY7A 1NR4A 5C4XG 2A74C 5IT9E 1ET9A 2EDGA 2JA8G 5CV7A 2TSSA 3S14B 2F3VA 3E0EA 3C3LA 1TQOA 4LF4Q 2K4KA 4YIJA 5KNCA 3HOZH 1M1KC 1X32A 1JWMD 3QOJA 3EA6A 1GXDC 3HOXB 1WTVA 1SROA 4XIGS 3S1RH 3RZDB 1CK1A 1VQ7A 3G7LA 4X6AH 4WRDA 2ZTDA 4CJ2C 3L2PA 3PUZA 2XN9C 5LMNW 4A3LH 2QCPX 4QIWB 1B9MA 1Y1VG 1O80A 2JYOA 3CD6A 1Q1EA 3TP5A 1O7LA 4ME3A 1Y1VH 3CCUA 4A3DG 1FNWA 1WFQA 4YWMA 2NBFA 2BDOA 4GN5A 1L0WA 3UDXA 1K3BC 2F0FA 2PI2A 1D5XC 2D62A 1ESRA 3MFGA 5KNDA 2XWBB 3S2DH 2VB2X 3HOZB 4DR3Q 4CBVA 1Q90A 1CTMA 1EIHA 2ES2A 3S1RB 3PCOB 2B3GA 3MFYA 2QGQA 2L55A 4J15A 4FVMA 1HNZQ 4DR1L 1PTOF 2AKWB 4DU9A 5I6YA 3KOJA 1P16A 4ZKCB 3BU2A 2RVLA 3G6EA 3NWTA 1UAPA 3M4YA 3EBEA 4MNOA 4C3IG 1V1PB 5IYBH 1O7IA 1TS5A 1QWYA 2KHSA 1XNQQ 3T4AC 1B44D 4AYBG 1B50A 1SRUA 2FMCA 2FFKB 2K14A 1VMCA 4BBSG 2LY7A 3DHQA 2WINB 5LHY1 5HURA 3S2DB 4BBSH 2I07B 2NVTH 4UP8A 4A76A 2NWGA 4X3TA 5ELNA 1VQPA 1K8OA 1U9RA 3DWQA 3SR1A 4R4TA 4NW2A 2NZ1D 3D6CA 1HZBA 4I7AA 3K8AA 1SEBD 3T13A 1QB5D 1F2LA 3Q24A 4J6HA 3GTPH 4MTKA 4JI0L 4C3HG 1I6HH 4DAVA 5C3XA 5DNFA 1CKNA 2K04A 4U673 3TP8A 4JI4L 2OTJA 2E2JH 3DM3A 3UE0A 4KKSA 2CH4W 5LMNL 4DV7L 4RA8A 1HUMA 2AUJD 3K57A 2L9HA 2KCNA 4JI0Q 2Z1CA 5C0XI 3D3RA 3KDFB 3S16H 1PH6A 4BXXG 2K03A 4LF7Q 1IXRA 2EY6A 2NVTB 4MTNA 4DKAC 1D1IA 1Z6HA 2Y0SE 3N6RA 3CXCA 1AEXA 1BNZA 1YNJD 4B3RL 2A6ED 1IYVA 2SOBA 1S5CD 3CCJA 3C1FA 4ODGA 3PQIA 1AN8A 2IWHA 1BDOA 4BS9A 2A6HD 2NN6G 2AQ3B 2EY2A 4JW0A 1TY2A 3GTPB 2PI2E 3H09A 4NXML 1I6HB 1ZYRD 5M5YH 3M85A 3D4DA 4H13C 2FHTA 1IBKQ 2HQLA 5IIFA 1YNJC 3OW7A 5G3LD 4B3RQ 2A6EC 5KGUA 4FDBA 2E2JB 1PMRA 3VR2A 2A6HC 3BG3A 2L12A 4QY7A 3EJIA 1ZYRC 2M9VA 1EQTA 1BUVT 3CCMA 1WTOA 5AJ3Q 4X3UA 3K80C 2UU9L 3WWVA 3A0JA 4YCUA 1WD1A 2B2VA 2RHQB 1RTOA 4ALPA 3J7ZC
chains in the Genus database with same CATH topology
1Z47A 3PO2G 1HNZL 3GD7A 4A3KG 1OXTA 3AYHB 1NMGA 3J81c 2V1CC 4A3JG 1VQKA 5IP9G 1CSPA 2ID0A 1VQMA 4JI7L 4PZ7A 4JBJA 1EIYB 5IYDG 4GKKL 4JI8Q 3I4NG 1E1OA 4O2DA 3FP9A 3CCEA 1YHQA 4A3CG 1Y1WH 4C2MH 1YJNA 4BA2I 1HJPA 1TWGH 3FHWA 3H3VI 1XNQL 1JJGA 4HIMA 1QUQB 1E3PA 1GKHA 2NVYH 5IWAL 1EOVA 2ZTCA 3GTLH 4P74A 4JOIC 4BA1I 1BBWA 2JA6G 4JYAQ 4GOPC 1PV4A 1SLJA 4LF9Q 4X65L 3K81C 3F2BA 4GKKQ 2VL6A 4R4QA 2VUMH 1U5KA 3Q8DA 1J5EL 1K8GA 4GNXC 3GTQH 3RN2A 1JJCB 3E9HA 4DV4L 2VQFL 1PH4A 3RZOH 1E24A 4JI3Q 2IT1A 4C3IH 1VQ8A 2UUCL 3MEFA 1YIJA 3S1NH 2A19A 4GLVB 4LUZA 1JT8A 2R7ZG 3M3YH 4JBWA 2JEAI 2UXBL 4IFDI 4A3EG 4L5QA 1X3FA 2WP8J 3CCSA 3KFUA 2LSSA 5IP7G 2RHSB 3CW2C 4OWWB 2F4VL 5GROA 3ICEA 1A62A 4DR5Q 4B3ML 4POGA 4BY1G 1GVPA 3T1YQ 2JEBI 4YHHL 1I5FA 1AE2A 3I56A 4DV4Q 3HOYG 2VQFQ 2PQAB 4BY7H 1S3OA 1OXSC 3A5UA 3PO3H 2UUCQ 5C44G 2BH8A 5M5WH 1N34L 2LXJA 5M5XH 2R6GA 3CF5A 3H3VH 4A3GH 4YY3Q 2UXBQ 3CQZH 2L15A 5EAYA 4NB3A 1PH1A 5IYCG 4B3MQ 2DGYA 2YTXA 4DK6C 3D0FA 2UXCL 1KHIA 5C0XJ 1Q46A 4IJLA 3CC4A 4LF5L 2D0PA 3D31A 4DPGA 4X66L 4POFA 2NN6I 3UDGA 4C3HH 4LF7L 4LFBL 4DV6L 5K36G 1KL9A 2E2HH 3UE1A 3AFQA 3RN5A 1XPRA 1NTGA 1XMQL 1IBLL 4IFDG 2VW9A 1PH3A 4QGUA 4LF8L 2CWPA 5J3BA 4PG3A 2UXCQ 1LUZA 1L2FA 4EX5A 4LF5Q 4HJ7A 4X66Q 4GS3A 5GAHC 1YJWA 1L1OC 1AH9A 4RG1A 2K5NA 4JI1Q 4Y7NH 1X6OA 3ER0A 4EQ5A 3HOXH 1PH8A 1RL2A 3RZDH 1VQCA 2FXQA 1DGSA 4P71A 2VS1A 4KI0A 3PF4A 4BXXH 2KHJA 2YTVA 1XMQQ 1KRTA 1IBKL 1HNWQ 3PGZA 2N3SA 4KHPQ 1HZCA 2XTIA 1B8AA 3FKIH 1WCMH 1CSQA 2K5VA 4UP9A 4DAMA 3K7UC 2NVXH 4OWXB 3RLOA 3M4OH 1WYDA 1ASYA 2OQKA 1BVSA 2R92H 3NEMA 3M4QA 2K75A 3I2ZA 2E8GA 4GNXB 2QEXA 1TWCH 4UPAA 1KRSA 4A93H 2YV5A 3CC2A 4A3IH 2OTLA 4DR4L 2ALYB 1PH5A 2JA5H 1YITA 2ZJQA 5FLXc 3NENA 5AJ3L 5JEAG 3W5OA 1EQRA 3TRZA 4YWKA 1CKOA 1PYSB 3KF6A 4HIOA 1QZHA 4B3SL 3CAMA 3HOVG 3TS2A 5M3MH 1YVCA 3T1HL 4DV0Q 3RNUA 1G291 3G48A 3AEVA 3G4SA 1UEBA 1VQ6A 3HOVH 3HOZG 4JG2A 4A3BG 5C3EH 3HOUG 1GD7A 4L5TA 1VQLA 4DR7Q 3ZJYC 2B63H 1EUJA 1W3SA 1XJVA 5C4JH 4R4OA 1K3RA 1NJIC 4DK3C 1HNXQ 1V43A 2N78A 1S72A 1N36Q 2MNAA 4JI5Q 2KENA 1OXVA 2WAQE 1JE5A 3KF6B 1B70B 5H1SE 3T1HQ 2R93H 2IHEA 1Q1BA 2VY3A 4BBRH 4AQYL 3HOWH 1EQQA 3TS0A 4A3LG 1N33Q 5E7NA 2HT1A 4JBMA 1S40A 4UP7A 4A3MG 1FGUA 3NBHB 4JYAL 3PO2H 4A3KH 4LF9L 4AH6A 4LF6L 5HGQA 3J7A5 1UE7A 3STBD 1VQNA 4A3JH 4P73A 4JCVE 5IP9H 5GAEC 1U0LA 1K0RA 4JV5Q 3CMAA 5IYDH 4AQYQ 2F3IA 4XTCS 1VS0A 2Z6KA 4JI3L 1XPUA 2JA9A 3I4NH 4A3FG 4A3CH 3UDFA 1VQAA 3TREA 1B7YB 4KHZA 2ASBA 3GTGH 4JI6Q 4NPSA 4PZ6A 1MJCA 1L1OB 4AIMA 4IFDJ 1KAWA 4A4IA 4HJ8A 1XMOQ 2C35B 4LF6Q 4DV2L 3STBC 2WAQG 4GN3B 4IOCA 4A75A 2JA6H 4DR5L 4LFAQ 2PQAA 4X64Q 1PVOA 5ELOA 3T1YL 1KXLA 4OWTB 5GQOA 1C9OA 2IX0A 2JK8A 3CPFA 2HHHL 3JAMi 1YHBA 3PV0A 4WJ4A 3CPWA 1UE6A 3IRBA 1EIFA 2AMCB 3PUVA 2EXDA 5IE8A 1I50H 1GM5A 4YY3L 1SE8A 1KC8C 5JJKA 4YCVA 4DV2Q 3LGJA 3L7ZC 1SFOH 2IHFA 3EIVA 2R7ZH 2ZTEA 2VQEQ 1YBYA 4B3TL 4A3EH 4DR6Q 1JJ2A 3CMEA 1OXXK 2KBNA 1EFWA 5IYBG 4LUOA 5IP7H 1CKMA 1SN8A 2OCEA 2RCNA 4OONA 3J81j 1MJEA 1HR0Q 4L5SA 2JE6I 3I4OA 3KYHC 3CC7A 1EYGA 4GN4B 1VQFA 2HHHQ 4BY1H 2D0OA 1PHJA 3HOYH 2CKZB 4HJAA 2N8NA 3U4ZA 1UE5A 5C44H 4QJFA 3KJOA 4DR1Q 3PUXA 3KLWA 5GAGC 3CCLA 4LWCA 1Q81C 1N32L 2A1AA 4IPCA 3I4MG 4B3TQ 1FL0A 5DLQE 2NVQH 1V1QA 3HKZE 4OX9Q 5IYCH 5LMUQ 1VQ5A 1VQOA 2EIFA 2ATWA 1UE1A 1A63A 1WJJA 2KCTA 4JI1L 3ULLA 2RF4A 4DV5L 3CCQA 2AWNA 1KIXA 3A5ZB 3CCVA 4P75A 2UXDQ 1K73C 1QVFA 1VQDA 4JOIA 1HR0W 2BA1A 1PFSA 4KLKA 4RMFA 4C3JH 3S14H 4GOPA 1N32Q 1HNWL 4KHPL 4H02A 2JJQA 4QL5A 3BJUA 1BKBA 2XGTA 2IY5B 3UDIA 1Q7YC 1HZ9A 2CFMA 3MXNB 4YCWA 3BZCA 3PUYA 5IT9c 4GNXA 4IPHA 1WI5A 2KHIA 4DV5Q 4HJ5A 2DUDA 2QA4A 2CCZA 1VQHA 4O0AA 5BR8Q 1QZGA 3PIPA 1KQSA 3HFZB 3J80c 1JMCA 1BBUA 2I5LX 3HKZG 1PH2A 1IZ6A 4GOPB 2JA7G 3F2DA 4HJ9A 3KF8B 4DV0L 3GTJH 1SR3A 3W1BA 3H15A 4UY8C 1X65A 4DUZQ 2AWOA 1VCIA 3TEHB 2NZHA 4DR7L 4JI2Q 1YJ9A 4LF4L 4IJHA 1Q12A 3GO5A 4IO9A 1IL2A 5C4XG 1I3QH 3OTOQ 4YWLA 4JI4Q 3U4VA 1HNXL 1HH2P 2CQOA 1N36L 3BZKA 4LUVA 4GKJL 1NE3A 1P8LA 4JI5L 2JA8G 5LMNQ 4DV7Q 1E7ZA 2YTYA 1X3GA 3E0EA 4DUYL 1X55A 3F2CA 1N33L 4HIDA 4K0KQ 3A74A 4LF4Q 1R9TH 2K4KA 1NY4A 3B6YA 3HOZH 1M1KC 3HOUH 3M7NA 4A3BH 2EQSA 1YZ6A 5FJ8G 2OQ0A 1SROA 4XIGS 3RLNA 3S1RH 4GKJQ 1X9NA 4JV5L 1VQ7A 3U58A 4Y52H 1JB7A 4X6AH 4DUYQ 2I0QA 1X56A 3K0XA 2ZTDA 4WJ3M 2BA0A 1L1OA 3L2PA 2N49A 3PUZA 5C0XG 4JI6L 5M3FG 4DNIA 3JAMc 1TXYA 4OX9L 5LMNW 1TWHH 4A3LH 2UUBL 3S15H 2HIVA 5HY6A 1XMOL 1Y1VG 3H0GG 1ASZA 3CD6A 1Q1EA 4NXMQ 2CWAA 1K8AC 2I5MX 4ME3A 4A3MH 5JJLA 4R1JA 4LFAL 3W1GA 4X64L 1Y1VH 1J6QA 2MO0A 3CCUA 4A3DG 1WFQA 4DV3L 2I5HA 4YWMA 3GTOH 1X54A 1WOCA 2GVBA 4GN5A 1L0WA 3F1ZA 3UDXA 1D8LA 2E2IH 1XNRQ 4OO1I 2Q2IA 1AE3A 4R4CA 1K9MC 4A3FH 2UUBQ 3S2HH 4OXPA 4APVA 1MKHA 2PI2A 4DR2Q 4LNQA 2D62A 1A8VA 2GVAA 3L0OA 3RR5A 1YNXA 3DLLA 1VQ4A 2VQEL 3F8TA 3PSIA 4AYBE 4DV1Q 1Q86C 3S2DH 4DR3Q 4JBKA 4DR6L 1Y1WG 5GADC 4DV3Q 1HR0L 2UU9Q 4TVAB 2ES2A 2Q2UA 2MFIA 3PCOB 2B3GA 4NXNQ 2ZM6Q 2QGQA 1M90C 1XPOA 1I94Q 2F52A 2GN5A 1PA6A 4J15A 4IPGA 1K83H 1HNZQ 4DR1L 3AQQA 2AKWB 2OWOA 3GTKH 3KOJA 1P16A 1V9PA 2VZAA 2WB1E 3BU2A 1Q8KA 1VQJA 4JI7Q 2KCMA 2VUMG 3G6EA 1PH7A 3EBEA 3M4PA 2PMZE 1LYLA 1VQIA 4MNOA 1SMXA 4P72A 3U50C 1CUKA 5LMUL 1QVCA 2R7DA 5IYBH 1O7IA 3OW2A 1FJGL 4OO1G 2Z0SA 2JQOA 3JC66 1XNQQ 2UXDL 1Z9FA 2Q2TA 5JEAJ 5IWAQ 3J81i 4AYBG 3EN2A 1FVIA 2VNUD 1SRUA 3ERSX 3S1QH 2K14A 4MZ9A 1A0IA 1TWFH 1XTDA 4X65Q 1X3EA 4BBSG 2E5LL 3I4MH 4BY7G 1TWAH 1J5EQ 1LTLA 1FJGQ 1N9WA 4BBSH 3PO3G 3S1MH 2NVTH 1NMFA 1C0AA 4A3GG 4UP8A 1OTCA 4A76A 1IBML 5BR8L 5ELNA 1KD1C 1VQPA 2WB1G 3PF5A 2K5HA 3G71A 4R4TA 3SGIA 3CP0A 2WFWA 2IX1A 1HZBA 3K7AH 3PUWA 3K8AA 2F4VQ 2E5LQ 1H95A 3ULPA 3KDFA 4YHHQ 2UUAL 3GTPH 3I7FA 4DUZL 4QQBX 4JI0L 1E1TA 1I6HH 4QIWE 4JI2L 2HIXA 1T9HA 1IBMQ 1CKNA 1N34Q 3OTOL 4JI4L 1OXUA 2E2JH 3DM3A 4IOAA 3UE0A 2OTJA 3RLFA 1EWIA 5LMNL 1VQBA 1YEZA 3ULJA 3CCRA 4DV7L 2YU9H 1G6PA 2H5XA 3GDEA 2UUAQ 2R7FA 2JA7H 4K0KL 4JI0Q 1RIPA 5C0XI 3KDFB 3AFPA 3S16H 3HOXG 3I55A 1PH6A 1IYJB 2K50A 2MQHA 2ZJPA 4IPDA 4BXXG 4LF7Q 4LFBQ 1IXRA 4MTNA 4DKAC 4DV6Q 2MO1A 2BH2A 1CKNB 2Y0SE 3FKIG 5C4XH 1WCMG 2Q2HA 3HKSA 4X62L 3CXCA 2ZJRA 1IBLQ 4DAYB 1GO3E 4LF8Q 4B3RL 3E9IA 2PNHA 4GLXA 2R92G 3CCJA 4JC0A 2JA8H 1N8RC 2Z6KC 1YHAA 1UWVA 1PH9A 3S17H 1VQEA 4GLAC 4A93G 5IY0A 4A3IG 2NN6G 1W2BA 4HIKA 3M9BA 2JA5G 1PYBA 2PI2E 3TQYA 4NXML 3M85A 5M5YH 1E22A 4TQUS 2K52A 1VQ9A 2B29A 5M3MG 4X62Q 1D7QA 2LXKA 2HQLA 2NZOA 5FJ8H 1IBKQ 4B3RQ 1HZAA 4FDBA 2YYZA 1G51A 2AHOB 3GTMH 5C3EG 4LFCL 1NBWA 1XNRL 3NELA 4LW1A 2B63G 1VQGA 1C7YA 4L5RC 3VDYA 4R4IA 1MIUA 5JJIA 4PZ8A 4QY7A 2Y0SG 3KJPA 5M3FH 4DR2L 2A8VA 3J80i 4DR4Q 1Y14B 3OYYA 4DV1L 3CCMA 4DR3L 3H0GH 5FLMG 5AJ3Q 1YI2A 2R93G 4PMWA 3S24A 4B3SQ 4BBRG 3HOWG 1Q82C 1QVGA 3K80C 4JI8L 2UU9L 3WWVA 5FLMH 1LM0A 4LFCQ 3A0JA 4A3DH 4NXNL 1QUQA 2ZM6L 4YCUA 1I94L 2RHQB 3PIOA 4ALPA 3J7ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z47 A;  3PO2 G;  1HNZ L;  3GD7 A;  4A3K G;  1OXT A;  3AYH B;  1NMG A;  3J81 c;  2V1C C;  4A3J G;  1VQK A;  5IP9 G;  1CSP A;  2ID0 A;  1VQM A;  4JI7 L;  4PZ7 A;  4JBJ A;  1EIY B;  5IYD G;  4GKK L;  4JI8 Q;  3I4N G;  1E1O A;  4O2D A;  3FP9 A;  3CCE A;  1YHQ A;  4A3C G;  1Y1W H;  4C2M H;  1YJN A;  4BA2 I;  1HJP A;  1TWG H;  3FHW A;  3H3V I;  1XNQ L;  1JJG A;  4HIM A;  1QUQ B;  1E3P A;  1GKH A;  2NVY H;  5IWA L;  1EOV A;  2ZTC A;  3GTL H;  4P74 A;  4JOI C;  4BA1 I;  1BBW A;  2JA6 G;  4JYA Q;  4GOP C;  1PV4 A;  1SLJ A;  4LF9 Q;  4X65 L;  3K81 C;  3F2B A;  4GKK Q;  2VL6 A;  4R4Q A;  2VUM H;  1U5K A;  3Q8D A;  1J5E L;  1K8G A;  4GNX C;  3GTQ H;  3RN2 A;  1JJC B;  3E9H A;  4DV4 L;  2VQF L;  1PH4 A;  3RZO H;  1E24 A;  4JI3 Q;  2IT1 A;  4C3I H;  1VQ8 A;  2UUC L;  3MEF A;  1YIJ A;  3S1N H;  2A19 A;  4GLV B;  4LUZ A;  1JT8 A;  2R7Z G;  3M3Y H;  4JBW A;  2JEA I;  2UXB L;  4IFD I;  4A3E G;  4L5Q A;  1X3F A;  2WP8 J;  3CCS A;  3KFU A;  2LSS A;  5IP7 G;  2RHS B;  3CW2 C;  4OWW B;  2F4V L;  5GRO A;  3ICE A;  1A62 A;  4DR5 Q;  4B3M L;  4POG A;  4BY1 G;  1GVP A;  3T1Y Q;  2JEB I;  4YHH L;  1I5F A;  1AE2 A;  3I56 A;  4DV4 Q;  3HOY G;  2VQF Q;  2PQA B;  4BY7 H;  1S3O A;  1OXS C;  3A5U A;  3PO3 H;  2UUC Q;  5C44 G;  2BH8 A;  5M5W H;  1N34 L;  2LXJ A;  5M5X H;  2R6G A;  3CF5 A;  3H3V H;  4A3G H;  4YY3 Q;  2UXB Q;  3CQZ H;  2L15 A;  5EAY A;  4NB3 A;  1PH1 A;  5IYC G;  4B3M Q;  2DGY A;  2YTX A;  4DK6 C;  3D0F A;  2UXC L;  1KHI A;  5C0X J;  1Q46 A;  4IJL A;  3CC4 A;  4LF5 L;  2D0P A;  3D31 A;  4DPG A;  4X66 L;  4POF A;  2NN6 I;  3UDG A;  4C3H H;  4LF7 L;  4LFB L;  4DV6 L;  5K36 G;  1KL9 A;  2E2H H;  3UE1 A;  3AFQ A;  3RN5 A;  1XPR A;  1NTG A;  1XMQ L;  1IBL L;  4IFD G;  2VW9 A;  1PH3 A;  4QGU A;  4LF8 L;  2CWP A;  5J3B A;  4PG3 A;  2UXC Q;  1LUZ A;  1L2F A;  4EX5 A;  4LF5 Q;  4HJ7 A;  4X66 Q;  4GS3 A;  5GAH C;  1YJW A;  1L1O C;  1AH9 A;  4RG1 A;  2K5N A;  4JI1 Q;  4Y7N H;  1X6O A;  3ER0 A;  4EQ5 A;  3HOX H;  1PH8 A;  1RL2 A;  3RZD H;  1VQC A;  2FXQ A;  1DGS A;  4P71 A;  2VS1 A;  4KI0 A;  3PF4 A;  4BXX H;  2KHJ A;  2YTV A;  1XMQ Q;  1KRT A;  1IBK L;  1HNW Q;  3PGZ A;  2N3S A;  4KHP Q;  1HZC A;  2XTI A;  1B8A A;  3FKI H;  1WCM H;  1CSQ A;  2K5V A;  4UP9 A;  4DAM A;  3K7U C;  2NVX H;  4OWX B;  3RLO A;  3M4O H;  1WYD A;  1ASY A;  2OQK A;  1BVS A;  2R92 H;  3NEM A;  3M4Q A;  2K75 A;  3I2Z A;  2E8G A;  4GNX B;  2QEX A;  1TWC H;  4UPA A;  1KRS A;  4A93 H;  2YV5 A;  3CC2 A;  4A3I H;  2OTL A;  4DR4 L;  2ALY B;  1PH5 A;  2JA5 H;  1YIT A;  2ZJQ A;  5FLX c;  3NEN A;  5AJ3 L;  5JEA G;  3W5O A;  1EQR A;  3TRZ A;  4YWK A;  1CKO A;  1PYS B;  3KF6 A;  4HIO A;  1QZH A;  4B3S L;  3CAM A;  3HOV G;  3TS2 A;  5M3M H;  1YVC A;  3T1H L;  4DV0 Q;  3RNU A;  1G29 1;  3G48 A;  3AEV A;  3G4S A;  1UEB A;  1VQ6 A;  3HOV H;  3HOZ G;  4JG2 A;  4A3B G;  5C3E H;  3HOU G;  1GD7 A;  4L5T A;  1VQL A;  4DR7 Q;  3ZJY C;  2B63 H;  1EUJ A;  1W3S A;  1XJV A;  5C4J H;  4R4O A;  1K3R A;  1NJI C;  4DK3 C;  1HNX Q;  1V43 A;  2N78 A;  1S72 A;  1N36 Q;  2MNA A;  4JI5 Q;  2KEN A;  1OXV A;  2WAQ E;  1JE5 A;  3KF6 B;  1B70 B;  5H1S E;  3T1H Q;  2R93 H;  2IHE A;  1Q1B A;  2VY3 A;  4BBR H;  4AQY L;  3HOW H;  1EQQ A;  3TS0 A;  4A3L G;  1N33 Q;  5E7N A;  2HT1 A;  4JBM A;  1S40 A;  4UP7 A;  4A3M G;  1FGU A;  3NBH B;  4JYA L;  3PO2 H;  4A3K H;  4LF9 L;  4AH6 A;  4LF6 L;  5HGQ A;  3J7A 5;  1UE7 A;  3STB D;  1VQN A;  4A3J H;  4P73 A;  4JCV E;  5IP9 H;  5GAE C;  1U0L A;  1K0R A;  4JV5 Q;  3CMA A;  5IYD H;  4AQY Q;  2F3I A;  4XTC S;  1VS0 A;  2Z6K A;  4JI3 L;  1XPU A;  2JA9 A;  3I4N H;  4A3F G;  4A3C H;  3UDF A;  1VQA A;  3TRE A;  1B7Y B;  4KHZ A;  2ASB A;  3GTG H;  4JI6 Q;  4NPS A;  4PZ6 A;  1MJC A;  1L1O B;  4AIM A;  4IFD J;  1KAW A;  4A4I A;  4HJ8 A;  1XMO Q;  2C35 B;  4LF6 Q;  4DV2 L;  3STB C;  2WAQ G;  4GN3 B;  4IOC A;  4A75 A;  2JA6 H;  4DR5 L;  4LFA Q;  2PQA A;  4X64 Q;  1PVO A;  5ELO A;  3T1Y L;  1KXL A;  4OWT B;  5GQO A;  1C9O A;  2IX0 A;  2JK8 A;  3CPF A;  2HHH L;  3JAM i;  1YHB A;  3PV0 A;  4WJ4 A;  3CPW A;  1UE6 A;  3IRB A;  1EIF A;  2AMC B;  3PUV A;  2EXD A;  5IE8 A;  1I50 H;  1GM5 A;  4YY3 L;  1SE8 A;  1KC8 C;  5JJK A;  4YCV A;  4DV2 Q;  3LGJ A;  3L7Z C;  1SFO H;  2IHF A;  3EIV A;  2R7Z H;  2ZTE A;  2VQE Q;  1YBY A;  4B3T L;  4A3E H;  4DR6 Q;  1JJ2 A;  3CME A;  1OXX K;  2KBN A;  1EFW A;  5IYB G;  4LUO A;  5IP7 H;  1CKM A;  1SN8 A;  2OCE A;  2RCN A;  4OON A;  3J81 j;  1MJE A;  1HR0 Q;  4L5S A;  2JE6 I;  3I4O A;  3KYH C;  3CC7 A;  1EYG A;  4GN4 B;  1VQF A;  2HHH Q;  4BY1 H;  2D0O A;  1PHJ A;  3HOY H;  2CKZ B;  4HJA A;  2N8N A;  3U4Z A;  1UE5 A;  5C44 H;  4QJF A;  3KJO A;  4DR1 Q;  3PUX A;  3KLW A;  5GAG C;  3CCL A;  4LWC A;  1Q81 C;  1N32 L;  2A1A A;  4IPC A;  3I4M G;  4B3T Q;  1FL0 A;  5DLQ E;  2NVQ H;  1V1Q A;  3HKZ E;  4OX9 Q;  5IYC H;  5LMU Q;  1VQ5 A;  1VQO A;  2EIF A;  2ATW A;  1UE1 A;  1A63 A;  1WJJ A;  2KCT A;  4JI1 L;  3ULL A;  2RF4 A;  4DV5 L;  3CCQ A;  2AWN A;  1KIX A;  3A5Z B;  3CCV A;  4P75 A;  2UXD Q;  1K73 C;  1QVF A;  1VQD A;  4JOI A;  1HR0 W;  2BA1 A;  1PFS A;  4KLK A;  4RMF A;  4C3J H;  3S14 H;  4GOP A;  1N32 Q;  1HNW L;  4KHP L;  4H02 A;  2JJQ A;  4QL5 A;  3BJU A;  1BKB A;  2XGT A;  2IY5 B;  3UDI A;  1Q7Y C;  1HZ9 A;  2CFM A;  3MXN B;  4YCW A;  3BZC A;  3PUY A;  5IT9 c;  4GNX A;  4IPH A;  1WI5 A;  2KHI A;  4DV5 Q;  4HJ5 A;  2DUD A;  2QA4 A;  2CCZ A;  1VQH A;  4O0A A;  5BR8 Q;  1QZG A;  3PIP A;  1KQS A;  3HFZ B;  3J80 c;  1JMC A;  1BBU A;  2I5L X;  3HKZ G;  1PH2 A;  1IZ6 A;  4GOP B;  2JA7 G;  3F2D A;  4HJ9 A;  3KF8 B;  4DV0 L;  3GTJ H;  1SR3 A;  3W1B A;  3H15 A;  4UY8 C;  1X65 A;  4DUZ Q;  2AWO A;  1VCI A;  3TEH B;  2NZH A;  4DR7 L;  4JI2 Q;  1YJ9 A;  4LF4 L;  4IJH A;  1Q12 A;  3GO5 A;  4IO9 A;  1IL2 A;  5C4X G;  1I3Q H;  3OTO Q;  4YWL A;  4JI4 Q;  3U4V A;  1HNX L;  1HH2 P;  2CQO A;  1N36 L;  3BZK A;  4LUV A;  4GKJ L;  1NE3 A;  1P8L A;  4JI5 L;  2JA8 G;  5LMN Q;  4DV7 Q;  1E7Z A;  2YTY A;  1X3G A;  3E0E A;  4DUY L;  1X55 A;  3F2C A;  1N33 L;  4HID A;  4K0K Q;  3A74 A;  4LF4 Q;  1R9T H;  2K4K A;  1NY4 A;  3B6Y A;  3HOZ H;  1M1K C;  3HOU H;  3M7N A;  4A3B H;  2EQS A;  1YZ6 A;  5FJ8 G;  2OQ0 A;  1SRO A;  4XIG S;  3RLN A;  3S1R H;  4GKJ Q;  1X9N A;  4JV5 L;  1VQ7 A;  3U58 A;  4Y52 H;  1JB7 A;  4X6A H;  4DUY Q;  2I0Q A;  1X56 A;  3K0X A;  2ZTD A;  4WJ3 M;  2BA0 A;  1L1O A;  3L2P A;  2N49 A;  3PUZ A;  5C0X G;  4JI6 L;  5M3F G;  4DNI A;  3JAM c;  1TXY A;  4OX9 L;  5LMN W;  1TWH H;  4A3L H;  2UUB L;  3S15 H;  2HIV A;  5HY6 A;  1XMO L;  1Y1V G;  3H0G G;  1ASZ A;  3CD6 A;  1Q1E A;  4NXM Q;  2CWA A;  1K8A C;  2I5M X;  4ME3 A;  4A3M H;  5JJL A;  4R1J A;  4LFA L;  3W1G A;  4X64 L;  1Y1V H;  1J6Q A;  2MO0 A;  3CCU A;  4A3D G;  1WFQ A;  4DV3 L;  2I5H A;  4YWM A;  3GTO H;  1X54 A;  1WOC A;  2GVB A;  4GN5 A;  1L0W A;  3F1Z A;  3UDX A;  1D8L A;  2E2I H;  1XNR Q;  4OO1 I;  2Q2I A;  1AE3 A;  4R4C A;  1K9M C;  4A3F H;  2UUB Q;  3S2H H;  4OXP A;  4APV A;  1MKH A;  2PI2 A;  4DR2 Q;  4LNQ A;  2D62 A;  1A8V A;  2GVA A;  3L0O A;  3RR5 A;  1YNX A;  3DLL A;  1VQ4 A;  2VQE L;  3F8T A;  3PSI A;  4AYB E;  4DV1 Q;  1Q86 C;  3S2D H;  4DR3 Q;  4JBK A;  4DR6 L;  1Y1W G;  5GAD C;  4DV3 Q;  1HR0 L;  2UU9 Q;  4TVA B;  2ES2 A;  2Q2U A;  2MFI A;  3PCO B;  2B3G A;  4NXN Q;  2ZM6 Q;  2QGQ A;  1M90 C;  1XPO A;  1I94 Q;  2F52 A;  2GN5 A;  1PA6 A;  4J15 A;  4IPG A;  1K83 H;  1HNZ Q;  4DR1 L;  3AQQ A;  2AKW B;  2OWO A;  3GTK H;  3KOJ A;  1P16 A;  1V9P A;  2VZA A;  2WB1 E;  3BU2 A;  1Q8K A;  1VQJ A;  4JI7 Q;  2KCM A;  2VUM G;  3G6E A;  1PH7 A;  3EBE A;  3M4P A;  2PMZ E;  1LYL A;  1VQI A;  4MNO A;  1SMX A;  4P72 A;  3U50 C;  1CUK A;  5LMU L;  1QVC A;  2R7D A;  5IYB H;  1O7I A;  3OW2 A;  1FJG L;  4OO1 G;  2Z0S A;  2JQO A;  3JC6 6;  1XNQ Q;  2UXD L;  1Z9F A;  2Q2T A;  5JEA J;  5IWA Q;  3J81 i;  4AYB G;  3EN2 A;  1FVI A;  2VNU D;  1SRU A;  3ERS X;  3S1Q H;  2K14 A;  4MZ9 A;  1A0I A;  1TWF H;  1XTD A;  4X65 Q;  1X3E A;  4BBS G;  2E5L L;  3I4M H;  4BY7 G;  1TWA H;  1J5E Q;  1LTL A;  1FJG Q;  1N9W A;  4BBS H;  3PO3 G;  3S1M H;  2NVT H;  1NMF A;  1C0A A;  4A3G G;  4UP8 A;  1OTC A;  4A76 A;  1IBM L;  5BR8 L;  5ELN A;  1KD1 C;  1VQP A;  2WB1 G;  3PF5 A;  2K5H A;  3G71 A;  4R4T A;  3SGI A;  3CP0 A;  2WFW A;  2IX1 A;  1HZB A;  3K7A H;  3PUW A;  3K8A A;  2F4V Q;  2E5L Q;  1H95 A;  3ULP A;  3KDF A;  4YHH Q;  2UUA L;  3GTP H;  3I7F A;  4DUZ L;  4QQB X;  4JI0 L;  1E1T A;  1I6H H;  4QIW E;  4JI2 L;  2HIX A;  1T9H A;  1IBM Q;  1CKN A;  1N34 Q;  3OTO L;  4JI4 L;  1OXU A;  2E2J H;  3DM3 A;  4IOA A;  3UE0 A;  2OTJ A;  3RLF A;  1EWI A;  5LMN L;  1VQB A;  1YEZ A;  3ULJ A;  3CCR A;  4DV7 L;  2YU9 H;  1G6P A;  2H5X A;  3GDE A;  2UUA Q;  2R7F A;  2JA7 H;  4K0K L;  4JI0 Q;  1RIP A;  5C0X I;  3KDF B;  3AFP A;  3S16 H;  3HOX G;  3I55 A;  1PH6 A;  1IYJ B;  2K50 A;  2MQH A;  2ZJP A;  4IPD A;  4BXX G;  4LF7 Q;  4LFB Q;  1IXR A;  4MTN A;  4DKA C;  4DV6 Q;  2MO1 A;  2BH2 A;  1CKN B;  2Y0S E;  3FKI G;  5C4X H;  1WCM G;  2Q2H A;  3HKS A;  4X62 L;  3CXC A;  2ZJR A;  1IBL Q;  4DAY B;  1GO3 E;  4LF8 Q;  4B3R L;  3E9I A;  2PNH A;  4GLX A;  2R92 G;  3CCJ A;  4JC0 A;  2JA8 H;  1N8R C;  2Z6K C;  1YHA A;  1UWV A;  1PH9 A;  3S17 H;  1VQE A;  4GLA C;  4A93 G;  5IY0 A;  4A3I G;  2NN6 G;  1W2B A;  4HIK A;  3M9B A;  2JA5 G;  1PYB A;  2PI2 E;  3TQY A;  4NXM L;  3M85 A;  5M5Y H;  1E22 A;  4TQU S;  2K52 A;  1VQ9 A;  2B29 A;  5M3M G;  4X62 Q;  1D7Q A;  2LXK A;  2HQL A;  2NZO A;  5FJ8 H;  1IBK Q;  4B3R Q;  1HZA A;  4FDB A;  2YYZ A;  1G51 A;  2AHO B;  3GTM H;  5C3E G;  4LFC L;  1NBW A;  1XNR L;  3NEL A;  4LW1 A;  2B63 G;  1VQG A;  1C7Y A;  4L5R C;  3VDY A;  4R4I A;  1MIU A;  5JJI A;  4PZ8 A;  4QY7 A;  2Y0S G;  3KJP A;  5M3F H;  4DR2 L;  2A8V A;  3J80 i;  4DR4 Q;  1Y14 B;  3OYY A;  4DV1 L;  3CCM A;  4DR3 L;  3H0G H;  5FLM G;  5AJ3 Q;  1YI2 A;  2R93 G;  4PMW A;  3S24 A;  4B3S Q;  4BBR G;  3HOW G;  1Q82 C;  1QVG A;  3K80 C;  4JI8 L;  2UU9 L;  3WWV A;  5FLM H;  1LM0 A;  4LFC Q;  3A0J A;  4A3D H;  4NXN L;  1QUQ A;  2ZM6 L;  4YCU A;  1I94 L;  2RHQ B;  3PIO A;  4ALP A;  3J7Z C; 
#chains in the Genus database with same CATH topology
 1PFB A;  5KEE A;  1OXT A;  1HTL D;  2LMC B;  2C5C A;  1JE4 A;  2V1C C;  1VQK A;  4KJO A;  1VQM A;  1CHP D;  2EYJ A;  4JBJ A;  4PZ7 A;  1EIY B;  1DM0 B;  1DXM A;  1E1O A;  1PZI D;  1SNQ A;  3FP9 A;  4O2D A;  5NUC A;  2Q8T A;  3CCE A;  1YHQ A;  3FMC A;  2K5W A;  3H3V I;  1JJG A;  5JVG 3;  4HIM A;  1QUQ B;  3WDN A;  2EZV A;  1ENC A;  4JYA Q;  1SLJ A;  4HTH A;  3F2B A;  1TS2 A;  1K8G A;  4GNX C;  4H7B A;  1EY0 A;  2VQF L;  5IGF A;  2IT1 A;  2LS0 1;  2EXZ A;  1H9K A;  1QCB D;  1YIJ A;  3S1N H;  4DNT B;  3M3Y H;  2UXB L;  4IFD I;  2WP8 J;  1VF7 A;  3CCS A;  2LSS A;  2RHS B;  3CW2 C;  3ICE A;  3F2U A;  3M7G A;  1NR2 A;  3HOY G;  2VQF Q;  5KIX A;  1S3O A;  2PYK A;  3C46 A;  1N34 L;  5M5X H;  4DK0 A;  1QE6 A;  2UXB Q;  1KAB A;  5EAY A;  4DK6 C;  2O2L D;  4NDX A;  1Q46 A;  4HR7 B;  3AMU A;  1TVX A;  3UDG A;  1TY0 A;  3AFQ A;  1IBL L;  1PH3 A;  5J3B A;  3M3Y B;  1LUZ A;  4XXE A;  5JVH 3;  1M8A A;  1TS4 A;  1FYC A;  1AH9 A;  3BVZ A;  2K5D A;  4RG1 A;  4Y7N H;  1PH8 A;  5E3F A;  2FXQ A;  5COR A;  4KI0 A;  3PF4 A;  1KRT A;  2N3S A;  4KHP Q;  5M5X B;  5D65 A;  4NP5 A;  5JOB A;  1WYD A;  2R92 H;  3SK4 A;  2E8G A;  1TWC H;  4UPA A;  1KRS A;  4A93 H;  4A3I H;  1A3U A;  2JA5 H;  2ZJQ A;  1D5Z C;  2MP1 A;  3NEN A;  5JEA G;  1PYS B;  3I72 A;  4BWG B;  1QZH A;  3TS2 A;  2JSO A;  3K5M A;  1PTO C;  4S3S A;  1VQ6 A;  3HOU G;  2XWJ B;  4L5T A;  1VQL A;  3ZJY C;  1W3S A;  4DFA A;  5C4J H;  2NYZ D;  5EGT A;  1NJI C;  2WKD A;  4Y7N B;  4JI5 Q;  1OXV A;  1JE5 A;  3NK9 A;  1B70 B;  2R93 H;  2IHE A;  1Q1B A;  4BBR H;  3HOW H;  1C4Q A;  1N33 Q;  2HT1 A;  4HMI A;  2DNC A;  2F0P A;  4ABN A;  4RKL A;  1KDA A;  5EKI A;  3PO2 H;  2R92 B;  3DXJ C;  3NTI A;  4AH6 A;  2PZW A;  3J7A 5;  4K6L A;  4P73 A;  1DZ1 A;  4A93 B;  3BS1 A;  4A3I B;  2F3I A;  1XPU A;  3I4N H;  2EOT A;  2JA9 A;  2F0K A;  1VQA A;  1HUN A;  5J1Z A;  3J81 L;  1Q8I A;  4K5W A;  1KAW A;  4IUN A;  4RWS C;  2WAQ G;  4IOC A;  4X64 Q;  3T56 B;  5ELO A;  5C4J B;  1C9O A;  3CPF A;  3BYY B;  2HHH L;  5M9O A;  3JAM i;  3TSS A;  2R93 B;  3IRB A;  2AMC B;  1Y8P B;  4OL7 A;  4BBR B;  3Q0A A;  3HOW B;  4EQN A;  5K5P A;  1DOK A;  1SE8 A;  1JOR A;  1JC7 A;  2VQE Q;  2HUG A;  4B3T L;  4DR6 Q;  1OXX K;  1SYD A;  4LUO A;  3PO2 B;  1LTS D;  4OX9 L;  2RCN A;  4L5S A;  3KYH C;  1EZ6 A;  2F0D A;  2HHH Q;  1VQF A;  1U4P A;  4HJA A;  4B08 A;  1TWG B;  1XWE A;  3I4N B;  5C44 H;  2Z9H A;  3KLW A;  1N32 L;  1B4O A;  3I4M G;  4B3T Q;  5DLQ E;  4LAA A;  3HZX A;  1I4X A;  4XQQ A;  2NVQ H;  4OX9 Q;  3KUP A;  5LMU Q;  1VQO A;  2DN8 A;  1ZEQ X;  1HA5 A;  3CCQ A;  2R3Z A;  1VQD A;  2KEC A;  4C3J H;  1PFS A;  3T53 B;  2BE5 D;  1RF2 D;  3ONA B;  4GOP A;  1N32 Q;  2Z4H A;  3KF8 A;  4H02 A;  2E2D C;  1I4R A;  1WTW A;  1FD7 D;  1WI5 A;  2KOL A;  1VQH A;  4O0A A;  5BR8 Q;  3R3O A;  1KQS A;  4ZUI A;  3PO3 B;  2BE5 C;  3HFZ B;  4MN3 A;  3J80 c;  1AZQ A;  2B2W C;  5C44 B;  3VA7 A;  3F2D A;  5IGB A;  1PLF A;  5IOD A;  1SR3 A;  4UY8 C;  4IUT A;  3TEH B;  1EY8 A;  2NZH A;  2NVQ B;  2CHB D;  2RKS A;  1B9N A;  4KHV A;  1S4Z A;  3GO5 A;  2OXP A;  3OTO Q;  1HNX L;  3BZK A;  4LUV A;  3T51 B;  2E2H B;  1AW7 A;  1R4Q B;  1E7Z A;  4KN7 C;  1F9S A;  3DWA A;  4FXD A;  3F2C A;  1IL8 A;  4HID A;  4K0K Q;  2J7Z A;  3A74 A;  1NY4 A;  1U4L A;  3J7A F;  2OQ0 A;  1EU4 A;  4JV5 L;  1K8M A;  2EY1 A;  5C4Z A;  5IGE A;  2IW3 A;  1STE A;  5C0X G;  5JAV A;  1TXY A;  4IZ8 A;  3S15 H;  2HIV A;  4WOR A;  3DMU A;  2KA7 A;  1K8A C;  4A3M H;  2G9D A;  4R1J A;  3SK8 A;  3TZD A;  1J6Q A;  1PTO H;  2PW7 A;  2I5H A;  4HCE A;  1CA6 A;  3GTO H;  1WOC A;  3TN2 A;  2E2I H;  1XNR Q;  4JK1 C;  4OIJ A;  3NWS A;  4R4C A;  1AE3 A;  4A3F H;  5EBC A;  2AQ2 B;  1MKH A;  3KLS A;  3FPP A;  3OHX C;  4LNQ A;  1A8V A;  3L0O A;  3RR5 A;  3DLL A;  4ZAI A;  4AYB E;  3PSI A;  1O78 A;  4Q0F A;  5GAD C;  3JAM E;  2XIW A;  3MA2 B;  3NBI A;  4RHR A;  1HPC A;  4NXN Q;  3I4L A;  1XPO A;  4HMJ A;  2GN5 A;  4PQX A;  3V96 A;  4N9T A;  3X3N A;  2OWO A;  2VZA A;  3R2I A;  2VUM G;  1PH7 A;  3V2T A;  3S15 B;  1SMX A;  3U50 C;  1QVC A;  4A3M B;  2R7D A;  3OW2 A;  4OO1 G;  1PTO B;  1SXT A;  1I4H A;  4UDU C;  5I4D A;  1Z9F A;  3GTO B;  3EN2 A;  3GTG B;  3ERS X;  4MZ9 A;  1A0I A;  3MXN A;  4A3F B;  4X65 Q;  4BY7 G;  1TWA H;  1QOH A;  1J5E Q;  3HRZ C;  1N9W A;  4DXF A;  2B2U C;  3TDQ A;  1CI3 M;  1IBM L;  3OSO A;  3OOC A;  3IFT A;  4UAI A;  1BR9 A;  1EOT A;  2IX1 A;  3DEO A;  1MSH A;  1WTQ A;  3K7A H;  3PUW A;  2M2L A;  5C6A A;  1NCV A;  1Z7T A;  5KRU A;  4DUZ L;  4QQB X;  1E1T A;  1JWU D;  1T9H A;  2L1B A;  1IBM Q;  1MI2 A;  2O5J C;  4O42 A;  4O1N A;  4IOA A;  1OXU A;  4DAY A;  3RLF A;  3A55 A;  1ML0 D;  1I4Q A;  5IT9 L;  3CCR A;  1G6P A;  2JA7 H;  1SNC A;  2ZXR A;  4EVO A;  4XQN A;  2MGS A;  3HOX G;  3I55 A;  4IPD A;  2L4N A;  4LFB Q;  1SMY C;  3HS0 C;  4DV6 Q;  2BH2 A;  1SNP A;  3FKI G;  5C4X H;  3HKS A;  2PO4 A;  1SBB B;  3RD4 A;  2B2Y A;  2JP1 A;  2JA8 H;  2Z6K C;  1YHA A;  1UWV A;  4TKO B;  3K7A B;  3S17 H;  1VQE A;  5IY0 A;  1JWS D;  3OIQ A;  1ZXT A;  3M9B A;  1HFN A;  2ZXO A;  2K52 A;  4KD4 A;  2NZO A;  2QDB A;  2DJG C;  3GTM H;  2AHO B;  3MTS A;  5C3E G;  3SEB A;  1XYI A;  3BDO A;  4L5R C;  2JA7 B;  3J80 i;  4DR4 Q;  3TP7 A;  2L5T A;  3OYY A;  3VR5 A;  4DR3 L;  4QCL A;  5FLM G;  1YI2 A;  1X3Q A;  4B3S Q;  3HP3 A;  5FK9 C;  5FLM H;  3NXW A;  4A3D H;  5JPN C;  5C4X B;  4X3K A;  3T16 A;  4R9W A;  2NB0 A;  3IKJ A;  3PIO A;  2PPB C;  4G7O C;  1JCK B;  1PFM A;  5BN4 A;  1HNZ L;  2JA8 B;  4A3K G;  5KNB A;  2RQX A;  3J81 c;  3HGB A;  3NE5 B;  4A3J G;  1AZP A;  5IP9 G;  1CSP A;  2ID0 A;  3S17 B;  4LJZ C;  5IYD G;  2JN4 A;  1RHP A;  4CGY B;  4EQO A;  1YJN A;  3D6W A;  3N52 A;  1XNQ L;  1E3P A;  2EVB A;  3GTM B;  1EOV A;  3ND8 A;  1BOS A;  2ZTC A;  4P74 A;  5A35 A;  1IHZ A;  1BF4 A;  4BA1 I;  1PV4 A;  3K81 C;  4KY7 A;  2N55 A;  3U9S A;  1GUG A;  1U5K A;  3NSW A;  1QIL A;  1Y1V B;  3E9H A;  4NMZ A;  2ENB A;  1E24 A;  4C3I H;  1STY A;  4IUR A;  5EBD A;  2FIN B;  4IUU A;  4A3D B;  2A19 A;  3BDL A;  3D8G A;  4LUZ A;  1TII D;  4JBW A;  3HG9 A;  4IQZ A;  4OWW B;  4K2L A;  4DR5 Q;  3I56 A;  1OXS C;  3PIP 3;  2RCF A;  5FO8 B;  2LXJ A;  1EEF D;  2R6G A;  2V4D A;  4YY3 Q;  2NTS A;  3CQZ H;  5HGT A;  1L0Y B;  2E75 C;  4NB3 A;  2F0Q A;  5IYC G;  1ILQ A;  1CM9 A;  3IFD A;  1LTB D;  1KHI A;  3CC4 A;  4IJL A;  4DPG A;  4X66 L;  5EPJ A;  1F2Y A;  4C3H H;  4LF7 L;  3SXH A;  1RTN A;  1DOM A;  4ZKB B;  3NQT A;  2QDL A;  3TZU A;  4C3I B;  3Q23 A;  4FF2 A;  4UHV A;  1XMQ L;  1XPR A;  3W3A A;  2KVM A;  5CC4 A;  2EYM A;  3TME A;  3PMF A;  4C56 C;  3CKI B;  4WFN 3;  4G57 A;  4AYB B;  4EX5 A;  4X66 Q;  4GS3 A;  5GAH C;  2D5D A;  5ELB A;  4KMU C;  4BBS B;  1X6O A;  1RL2 A;  4BXX H;  2YTV A;  1XMQ Q;  4K6D A;  1IBK L;  2RA4 A;  3MXG A;  2K32 A;  4ZCK A;  4DGZ A;  4ZRZ A;  1SAP A;  4UP9 A;  4J8Q A;  3CQZ B;  4CJ0 B;  1TT2 A;  2K5Q A;  1ASY A;  3OMC A;  1B53 A;  4DF7 A;  2K75 A;  4CDE C;  3AU7 A;  4LMQ D;  2NN6 H;  2ALY B;  1KNA A;  5FLX c;  5AJ3 L;  3TRZ A;  3W5O A;  5ELD A;  4C3H B;  4YWK A;  1CKO A;  3HOV G;  3CAM A;  1YVC A;  1KNE A;  1LT6 D;  3RNU A;  3G48 A;  3HOV H;  4A3B G;  1GD7 A;  2ICI A;  3S9W A;  3J80 E;  4DR7 Q;  5C3W A;  3S16 B;  1GUW A;  1XJV A;  4KY5 A;  1K3R A;  4DK3 C;  1N36 Q;  1BXT A;  2WAQ E;  3KF6 B;  4AQY L;  3KK7 A;  1TKW B;  1ET6 A;  2AQ1 B;  3FEW X;  1TU2 B;  4RGM A;  1A2T A;  1FGU A;  4JYA L;  4E6I A;  3RMH A;  1UE7 A;  1GUN A;  5A2Q L;  1LT3 D;  5M5Y B;  1U0L A;  4F88 A;  3DUZ A;  3CMA A;  3NTK A;  3P75 A;  4AQY Q;  3UDF A;  3TRE A;  3UI2 A;  2F0J A;  4JI6 Q;  4PZ6 A;  4K8I A;  3R8B A;  4AIM A;  1F2M A;  4HJ8 A;  1XMO Q;  5I2Y A;  4DV2 L;  4GN3 B;  4A75 A;  2RDH A;  4LFA Q;  1PVO A;  1KXL A;  2IX0 A;  2JK8 A;  3GV6 A;  4IN3 A;  3PV0 A;  3CPW A;  1EIF A;  3PUV A;  5IGD A;  1QJO A;  5IE8 A;  1I50 H;  1KC8 C;  4WJW A;  5JJK A;  3D4R A;  5C5L A;  1BQQ T;  4YCV A;  4DV2 Q;  3L7Z C;  1SFO H;  5CMD A;  3MXP A;  3VYT A;  2Q8R E;  3ND9 A;  5E4X A;  1LTA D;  5CBE E;  1JJ2 A;  1G2S A;  1SN8 A;  4OON A;  3J81 j;  1HR0 Q;  3EVQ A;  1EYG A;  4GN4 B;  1DYQ A;  3HOY H;  1BBX C;  4B9X A;  3KJO A;  3PUX A;  5GAG C;  3QOL A;  1T5X D;  1LT4 D;  4X3S A;  2B2T A;  1F77 A;  3DEP A;  1VQ5 A;  1CFM A;  1S5F D;  1H9S A;  4OGQ C;  1WJJ A;  4RFB A;  2AWN A;  1JQY D;  3A5Z B;  3I91 A;  3CCV A;  2UXD Q;  1LAC A;  4JOI A;  5FO9 B;  4KKU A;  4DNR B;  1BCP B;  3S1N B;  4KHP L;  2JJQ A;  1Q7Y C;  1IYU A;  2CFM A;  3MXN B;  2D9U A;  3BZC A;  4YCW A;  2E74 C;  3PUY A;  5IT9 c;  1SFO B;  2PZU A;  2MPM A;  4HJ5 A;  4OIK A;  2DUD A;  2QA4 A;  5EJW A;  2CCZ A;  2E76 C;  1CA5 A;  2NUC A;  3OWE B;  1EY6 A;  2F0H A;  4FF4 A;  2N88 A;  1Q3L A;  2I5L X;  3HKZ G;  3CRL C;  2C9O A;  1PTO D;  5TSS A;  1ICW A;  1X65 A;  2B2V C;  4JI2 Q;  4IJH A;  4LK1 C;  4IO9 A;  2BDN A;  1IL2 A;  1I3Q H;  2XNA C;  3U4V A;  3I70 A;  1HH2 P;  2ICE C;  4GKJ L;  4JI5 L;  3OMG A;  5JEA H;  4JVZ A;  1DD2 A;  1VF5 C;  2DNE A;  4MIU A;  2YTY A;  1X3G A;  1N33 L;  5ELC A;  3NBH A;  1RD9 D;  1G6Z A;  3VA5 A;  2F4I A;  1R9T H;  3QR8 A;  3HOU H;  2EQS A;  2EPB A;  1YZ6 A;  5FJ8 G;  3RLN A;  4GKJ Q;  3MEH A;  1X9N A;  1SNM A;  1PYW D;  5EPL A;  3GQB A;  1JB7 A;  1ESF A;  3K0X A;  1JIC A;  1L1O A;  3NPP A;  5M3F G;  4DNI A;  2Z8L A;  5HY6 A;  3OWF A;  3H0G G;  1E2V A;  2I5M X;  1TWC B;  4L8J A;  4M1U B;  3W1G A;  4X64 L;  2JA5 B;  1I3Q B;  3J7Y W;  4HCS A;  2XRS D;  1X54 A;  4ZYS A;  4G4K A;  1D8L A;  4DN4 M;  4KV6 A;  1ONL A;  2Q2I A;  1K9M C;  5I6W A;  1EWH A;  3S2H H;  1EEI D;  4DR2 Q;  2GVA A;  1PXU A;  1PZJ D;  1YNX A;  2VQE L;  1R9T B;  4DV1 Q;  4DR6 L;  4I7Z C;  1S5B D;  3HOU B;  1Y1W G;  1V1P A;  2Y0S B;  1EL0 A;  3R93 A;  4TVA B;  2Q2U A;  4FXK C;  1A15 A;  1LTR D;  2MFI A;  2ZM6 Q;  1I94 Q;  2CQA A;  4IPG A;  3GTK H;  1V9P A;  4JI7 Q;  2KCM A;  1EU3 A;  1STH A;  3M4P A;  1JOQ A;  4P72 A;  1VQI A;  5LMU L;  2HCC A;  1FJG L;  2Z0S A;  2JQO A;  3JC6 6;  3VYR A;  1GUT A;  5IWA Q;  1FVI A;  2ZXP A;  5L37 A;  1TWF H;  1XTD A;  1BCP F;  4RKB A;  3S2H B;  2E5L L;  3I4M H;  1FJG Q;  5IGC A;  3PO3 G;  1D6E C;  3A7A B;  2WAQ B;  4A3G G;  3NP8 A;  1OTC A;  1F2Z A;  3HEJ A;  4I65 A;  5BR8 L;  1KD1 C;  1HRJ A;  2WB1 G;  2K5H A;  3G71 A;  1FNV A;  2FMM A;  3CP0 A;  3SGI A;  2RSN A;  1T5E A;  2F4V Q;  2E5L Q;  1H95 A;  2EYF A;  3GTK B;  3KDF A;  4YHH Q;  1W6K A;  4QIW E;  5IGG A;  1I4G A;  2X69 A;  1SYC A;  3KLR A;  3OTO L;  2OT2 A;  1Y8O B;  2HDL A;  1VQB A;  2YU9 H;  2H5X A;  4K0K L;  4L6T B;  3Q6S A;  1R4P B;  3DWP A;  3I4M B;  2K50 A;  1CKN B;  1K28 A;  1H9M A;  1NNX A;  1WCM G;  4X62 L;  2KEE A;  4C3J B;  4LF8 Q;  3E9I A;  2EYH A;  3NHH A;  4GLX A;  4H0L C;  1N8R C;  1HQM C;  2F0W A;  3A54 A;  1PH9 A;  2A69 D;  5FKA C;  1PYB A;  5DM6 3;  1C48 A;  4TQU S;  1SDF A;  2F0S A;  1VQ9 A;  2B29 A;  5M3M G;  4X62 Q;  2LXK A;  1HZA A;  2K05 A;  4G7H C;  5BN3 A;  1NBW A;  1XNR L;  3NEL A;  2H1E A;  2A69 C;  2B63 G;  2YU9 B;  2O5I C;  5DEH A;  4G7Z C;  3VDY A;  4R4I A;  1MIU A;  2OF1 A;  2F0U A;  5C0X H;  3KJP A;  2L0C A;  3VR6 A;  1LT5 D;  4F8M A;  1W6J A;  2F0M A;  2KCC A;  3P7J A;  4JI8 L;  2PQE A;  1LM0 A;  4NXN L;  1QUQ A;  4CJ1 B;  3JAM L;  2K6A A;  1SE3 A;  4KY6 A;  3P20 A;  5EKL A;  5FLX E;  3GD7 A;  1KLG D;  1NMG A;  1DJR D;  4U68 A;  1II3 A;  3SK6 A;  4GKK L;  4JI8 Q;  4A3C G;  3L3O C;  1HJP A;  3FHW A;  1SSO A;  2NVY H;  1CZG A;  1EY9 A;  4TRD A;  2JA6 G;  1BBW A;  4GOP C;  4LF9 Q;  4X65 L;  4GKK Q;  4P2C B;  4RCO A;  2VUM H;  1J5E L;  3GTQ H;  1PH4 A;  2WV6 D;  4JI3 Q;  1WTR A;  1VQ8 A;  2F0T A;  2UUC L;  4OO1 H;  4HAE A;  4PMB A;  2E2I B;  4GLV B;  2R7Z G;  1A3V A;  4MHE A;  4A3E G;  4L5Q A;  1X3F A;  3KFU A;  4N9P A;  5IP7 G;  2VB3 X;  5GRO A;  3MXU A;  4BY1 G;  4POG A;  3T1Y Q;  1I5F A;  4ZQ3 A;  1B3Q A;  1AE2 A;  1GHK A;  2K01 A;  4BY7 H;  3A5U A;  1LTI D;  2UUC Q;  2BH8 A;  5G3L F;  5M5W H;  3X3M A;  1EWC A;  4V0B A;  3CF5 A;  3H3V H;  1GJX A;  4KKT A;  2L15 A;  2NVY B;  1PH1 A;  2J4X A;  3ZYY X;  2KJX A;  2AUK A;  2IX3 A;  3K5L A;  1F9P A;  3GP7 A;  4LF5 L;  1EIG A;  2D0P A;  4POF A;  1MD2 D;  1MGS A;  2F0I A;  2VUM B;  1SMY D;  3GTQ B;  4LFB L;  4DV6 L;  5K36 G;  1KL9 A;  3UE1 A;  3C2P A;  1KDB A;  1NTG A;  1RCV D;  4IFD G;  4XDX A;  2A68 D;  4Q5V A;  2ZT9 C;  2CWP A;  4IFD H;  3DM1 A;  1L2F A;  4LF5 Q;  3H91 A;  4HJ7 A;  5EPK A;  1TWA B;  2F0N A;  1IW7 C;  2DJF C;  4JI1 Q;  4EGV A;  3ER0 A;  3HOX H;  1H9S B;  3VYS A;  4EQ5 A;  3RZD H;  1VQC A;  1DGS A;  4BY7 B;  1CQV A;  1STB A;  2KHJ A;  1XTC D;  2A68 C;  1HNW Q;  5M5W B;  3PGZ A;  2XTI A;  3FKI H;  2NTT A;  1CSQ A;  1H9J A;  2NVX H;  3M4O H;  2OQK A;  1BVS A;  4OEL B;  3NEM A;  3I2Z A;  2QEX A;  3Q22 A;  4QUC A;  3FPU B;  2YV5 A;  4DR4 L;  1TS3 A;  3RUZ A;  3SHL A;  4B3S L;  3K59 A;  3A8I E;  2M00 A;  4K2K A;  1FGB D;  4DV0 Q;  3KBG A;  5KYL A;  3T1H L;  1G29 1;  4K8J A;  3AEV A;  1CT1 D;  2EJF C;  3HOZ G;  2EYP A;  5C3E H;  4RHS A;  1BCP D;  1FNU A;  4R4O A;  3FRP B;  2JXM B;  2A5H A;  4ZUJ A;  1V43 A;  2BOS A;  1B2T A;  2MNA A;  1ENA A;  2KEN A;  3T1H Q;  3FDT A;  1EQQ A;  3TS0 A;  4A3L G;  3FKI B;  3VYU A;  4ID6 A;  1BCP C;  4C1N K;  2NVX B;  4UP7 A;  3NBH B;  3M4O B;  4B9W A;  4A3K H;  4LF6 L;  5HGQ A;  1VQN A;  1KTK A;  4A3J H;  4EQP A;  4JCV E;  5IP9 H;  1B3A A;  1U4R A;  2X6G A;  1EQV A;  5GAE C;  1K0R A;  4DK1 A;  1JOK A;  2IL8 A;  4R8I A;  1UEA B;  1SJH D;  5IYD H;  1VS0 A;  1I4P A;  1YNN D;  2RSO A;  3E5S A;  2SEB D;  5CV8 A;  1B7Y B;  2ASB A;  4ME5 A;  1KDC A;  4NPS A;  3LNN A;  1JR0 D;  5I9P A;  2PZT A;  3K5N A;  1L1O B;  1STN A;  4A4I A;  4RCN A;  1CQF A;  5C3E B;  4KN4 C;  4LF6 Q;  2L11 A;  3QG1 A;  3MWY W;  4CHT B;  4DR5 L;  5J39 A;  2PQA A;  2RBM A;  3LWE A;  5GQO A;  3LWU A;  5DM7 3;  1G2T A;  1YNN C;  2OEO A;  4RGO S;  5C5M A;  4WJ4 A;  1V1O A;  5COY A;  2EJM A;  1GM5 A;  1DCZ A;  4YY3 L;  4ILW A;  4HN7 A;  3MAQ A;  2IHF A;  1YBY A;  1EFW A;  2KBN A;  5IYB G;  3BVM A;  1CKM A;  1SYF A;  2OCE A;  4A3K B;  1MJE A;  2JE6 I;  2F0V A;  4A3J B;  4IUV A;  1EYD A;  3SVM A;  2CKZ B;  4XT3 B;  5KYI A;  1UE5 A;  2I46 A;  4QJF A;  5T1I A;  4DR1 Q;  3SK5 A;  3CCL A;  1Q81 C;  2GA4 B;  2A1A A;  4IPC A;  1FL0 A;  3A8J E;  3A7L A;  2RDG A;  2B2Y C;  3HKZ E;  5IYC H;  1QNK A;  2ATW A;  1HA6 A;  2KCT A;  1O7Y A;  2K7V A;  3ULL A;  2RF4 A;  4P75 A;  1QVF A;  1HR0 W;  4KLK A;  4RMF A;  3K5O A;  2HQE A;  2QEJ C;  4QL5 A;  1BKB A;  1MBY A;  2XGT A;  4FO2 A;  4DAP A;  2IY5 B;  1HZ9 A;  2F3W A;  1SYB A;  4GNX A;  3WOF A;  2KHI A;  1DON A;  1D1K A;  2O4X A;  1WTH A;  1SND A;  1PRT F;  5ELF A;  1MHW C;  4IAL A;  2B39 A;  1JMC A;  3A56 A;  1PH2 A;  1IZ6 A;  4GOP B;  1WTP A;  2F0O A;  1XX8 A;  3KF8 B;  3GTJ H;  4OEM B;  3W1B A;  3H15 A;  2CH4 A;  3QB3 A;  2AWO A;  1SJE D;  4DR7 L;  1YJ9 A;  2J0T D;  3BVG A;  3I8Z A;  3J80 L;  1XXG A;  4V19 0;  4YWL A;  4JI4 Q;  2CQO A;  1N36 L;  1SE2 A;  3IL8 A;  1NE3 A;  1P8L A;  4Z9C B;  5LMN Q;  5CGK A;  4DV7 Q;  4GZY C;  3LX0 A;  3PIO 3;  4DUY L;  1X55 A;  2K1B A;  2QKI C;  2G5D A;  4HSV A;  3B6Y A;  4A3B H;  3M7N A;  3R2T A;  3ITP A;  3I73 A;  4TSS A;  3MVV A;  3U58 A;  4Y52 H;  2EY5 A;  4DUY Q;  2I0Q A;  1X56 A;  3OPO A;  4PV1 C;  4WJ3 M;  2BA0 A;  3SDZ A;  4XQJ A;  2N49 A;  3K58 A;  4JI6 L;  3JAM c;  1TWH H;  3GTJ B;  2UUB L;  3BDC A;  3C1E A;  5EQ0 A;  1XMO L;  1MSG A;  1ASZ A;  4NXM Q;  2CWA A;  5JJL A;  5LL6 X;  4LFA L;  2MO0 A;  4IUP A;  4DV3 L;  2GVB A;  3F1Z A;  1D2B A;  3ERQ A;  4OO1 I;  1KAA A;  1GUS A;  4HED A;  1S5E D;  3HOV B;  2UUB Q;  4OXP A;  4RGN A;  4APV A;  1F9Q A;  1NSN S;  1VQ4 A;  5ISR A;  3F8T A;  1Q86 C;  4A3B B;  4JBK A;  5AFW A;  4DV3 Q;  1HR0 L;  1G91 A;  2UU9 Q;  5JJZ A;  2B8G A;  4K5V A;  1M90 C;  1STA A;  1O7Z A;  1X3P A;  2F52 A;  1PA6 A;  1B1Z A;  1JB3 A;  1K83 H;  3AQQ A;  2WB1 E;  5A2Q E;  1Q8K A;  2K33 A;  1GUO A;  1VQJ A;  5CBA E;  1TWH B;  2D2C C;  5ELE A;  2X6L A;  2PMZ E;  1LYL A;  1CUK A;  1VDZ A;  1M4V A;  1HQR D;  3CRK C;  2LKV A;  2UXD L;  1ROD A;  2Q2T A;  5JEA J;  3J81 i;  2CW0 D;  2PW5 A;  2VNU D;  5CYU A;  4K5X A;  3S1Q H;  2KQ3 A;  1QNU A;  1SE4 A;  1I6V C;  1X3E A;  4F87 A;  5CR3 A;  1LTL A;  1ENF A;  3S1M H;  1NMF A;  5FOB B;  1C0A A;  4R8N A;  5C4H A;  5CV6 A;  2CW0 C;  3PF5 A;  4XYO A;  2TMP A;  5D14 A;  1Y8N B;  2WFW A;  1I50 B;  1K83 B;  3KBX A;  3ULP A;  2UUA L;  3I7F A;  2H4O A;  1EY4 A;  1FR3 A;  4HSP A;  1GHJ A;  2HIX A;  4JI2 L;  4FP5 D;  3E3X A;  4KTA A;  2Z6B A;  1N34 Q;  3HOY B;  1EWI A;  1HCZ A;  1YEZ A;  3ULJ A;  2CVR A;  1EYA A;  3GDE A;  3KLS X;  3S1Q B;  2UUA Q;  2R7F A;  1H9R A;  1HTP A;  1RIP A;  2F0G A;  2QW7 A;  3AFP A;  5CV9 A;  3L9A X;  1PZK D;  4DA2 A;  1IYJ B;  2MQH A;  2ZJP A;  1U4M A;  3K6O A;  1ZKO A;  3S1M B;  2MO1 A;  1D5M C;  2SNM A;  1ICF B;  1IBL Q;  2Q2H A;  2ZJR A;  4DAY B;  1GO3 E;  2PNH A;  2R92 G;  4CDD C;  4JC0 A;  4GLA C;  4A93 G;  4A3I G;  1W2B A;  5I2X A;  4HIK A;  1PDQ A;  2JA5 G;  3P1H A;  3TQY A;  4J1M A;  1E22 A;  2WKC A;  2XVS A;  1D7Q A;  5FJ8 H;  5F2D A;  4ZLT F;  1S5D D;  2YYZ A;  1G51 A;  2BCO A;  4LFC L;  5J22 A;  4LW1 A;  1CZW A;  1VQG A;  3HKZ B;  5CV4 A;  1C7Y A;  3EQL C;  5JJI A;  2B8F A;  4PZ8 A;  2Y0S G;  4DR2 L;  5M3F H;  2A8V A;  1HXY D;  1Y14 B;  4DV1 L;  3H0G H;  1SYG A;  2R93 G;  2B2W A;  4PMW A;  3S24 A;  4BBR G;  5D3I B;  3HOW G;  1Q82 C;  1QVG A;  4FF3 A;  4LFC Q;  2ZM6 L;  2A73 B;  1I94 L;  2F03 A;  1TR5 A;  2HD3 A;  1Z47 A;  3PO2 G;  3AYH B;  4FYD A;  1WTX A;  3G6J B;  4JI7 L;  2DY8 A;  1AP0 A;  1JOO A;  2Z4I A;  2MUY A;  3MHB A;  2B2T C;  3I4N G;  1V8Q A;  3OIP A;  4QUF A;  1LAB A;  1Y1W H;  1PRT D;  4C2M H;  4BA2 I;  5EKK A;  1TWG H;  4CKC A;  2F0E A;  1GKH A;  5IWA L;  4XT1 B;  3GTL H;  1LO5 D;  2DY7 A;  4JOI C;  3H3V C;  1STG A;  1RDP D;  2VL6 A;  5M3F B;  2XRQ D;  4R4Q A;  4XYQ A;  3BZD B;  3Q8D A;  1KLU D;  1PRT C;  3RN2 A;  1JJC B;  2P5Z X;  4KJN A;  3H0G B;  4DV4 L;  3RZO H;  3J81 E;  4NKL A;  2EYO A;  4CDF C;  3MEF A;  3V05 A;  3NQI A;  1JT8 A;  1WVL A;  1IKM A;  2JEA I;  2MHV A;  3E6Z X;  2F4V L;  3EFX D;  1A62 A;  2HDM A;  5FO7 B;  4B3M L;  4C1N I;  1GVP A;  4ULL A;  2JEB I;  4YHH L;  2WII B;  4DV4 Q;  5DAU A;  2PQA B;  3TP6 A;  4PNY A;  3PO3 H;  5C44 G;  3QJY A;  4ZK9 B;  4CKB A;  1Y1W B;  4A3G H;  4C2M B;  1J8I A;  3AB9 A;  3O13 A;  1RKN A;  3A8K E;  1PFN A;  3GTL B;  4B3M Q;  2DGY A;  2YTX A;  5JPM C;  3D0F A;  2UXC L;  5C0X J;  3QWN A;  1OO9 B;  3D31 A;  1LLR D;  2NN6 I;  3K0Y A;  5I9O A;  2QIL A;  4C3J G;  3RZO B;  4L63 B;  2E2H H;  1A3T A;  3RN5 A;  1EYC A;  3VR4 A;  2VW9 A;  4QGU A;  4LF8 L;  3U9O A;  4PG3 A;  3QIA A;  2UXC Q;  1TWF B;  3URY A;  3NTH A;  1QG7 A;  1YJW A;  4M8A A;  1L1O C;  3WOE A;  2K5N A;  3NUC A;  4P71 A;  2VS1 A;  3VR3 A;  3FVQ A;  1A2U A;  4H44 C;  4K14 A;  1HZC A;  4A3G B;  1B8A A;  4N8F A;  2IPK D;  1WCM H;  2K5V A;  4DAM A;  3K7U C;  2WB1 B;  4OWX B;  1HFG A;  2B2U A;  3RLO A;  1GOZ A;  3M4Q A;  3I3C A;  2PMZ B;  4GNX B;  1UUP A;  4PMC A;  3CC2 A;  2OTL A;  1PH5 A;  4RAU C;  3IAY A;  1YIT A;  1EQR A;  3KF6 A;  4HIO A;  1HHV A;  1LTG D;  2EYL A;  2K28 A;  5IOC A;  5M3M H;  2FJ2 A;  3E0J A;  3G4S A;  1UEB A;  4JG2 A;  1LTT D;  1SYE A;  2B63 H;  3SE0 A;  1EUJ A;  5E4W C;  2RDF A;  5FLX L;  1HNX Q;  2G9H D;  2N78 A;  1S72 A;  1RJT A;  4QF4 A;  5H1S E;  2VY3 A;  4DXG A;  3CU7 A;  1EZ8 A;  1DOL A;  5E7N A;  2PCF B;  1WCM B;  4JBM A;  1S40 A;  3MZ5 A;  1L0X B;  4A3M G;  1NAP A;  4RGT A;  4LF9 L;  3STB D;  1WD0 A;  4JV5 Q;  1CHQ D;  3H6M A;  4XTC S;  4JI3 L;  2Z6K A;  4A3C H;  4A3F G;  4KHZ A;  5M3M B;  3GTG H;  4FF1 A;  1MJC A;  4IFD J;  4FXG C;  2C35 B;  3STB C;  1EY5 A;  2JA6 H;  2SDF A;  2B63 B;  4CDC C;  3T1Y L;  1F9R A;  4OWT B;  3QO2 A;  2KUM A;  1YHB A;  1UE6 A;  4QMG A;  2EXD A;  4OHJ A;  3W2D A;  2XSC A;  2SNS A;  1BO0 A;  2EE1 A;  3LGJ A;  4RH6 A;  2Q8I B;  3EIV A;  2R7Z H;  2ZTE A;  2F1M A;  4A3E H;  1LV9 A;  3CME A;  3ERO A;  5IP7 H;  1K0S A;  3I90 A;  5T1G A;  3I4O A;  1SNO A;  3CC7 A;  4BY1 H;  1IKL A;  2D0O A;  1PHJ A;  2VXW A;  2N8N A;  4QB4 A;  3U4Z A;  5E1F A;  3H94 A;  1G8Z D;  2F0L A;  2MJ8 A;  4LWC A;  1E0B A;  2KED A;  4JPB W;  5D3D A;  1V1Q A;  2WAC A;  2EIF A;  1UE1 A;  4KD3 A;  2JA6 B;  1A63 A;  2IJ0 A;  1IW7 D;  4JI1 L;  4DV5 L;  3J7A V;  3CHB D;  4CKE A;  1KIX A;  1K73 C;  2BA1 A;  3S14 H;  5K36 H;  1NUC A;  1HNW L;  4FNF A;  1UNS A;  3BJU A;  4F7X A;  3UDI A;  1E2Z A;  2LFN A;  4IPH A;  2R7Z B;  4A3E B;  4DV5 Q;  2HCI A;  3BYT B;  5CV5 A;  3D4W A;  4BY1 B;  4IUQ A;  3PIP A;  1QZG A;  1ILP A;  3TBI B;  1BBU A;  2QF7 A;  5BN5 A;  1A6X A;  4N8X 1;  2JA7 G;  1AFP A;  4HJ9 A;  3GV3 A;  4DV0 L;  1Y69 U;  2PNR C;  2R61 A;  1C8C A;  5LL6 S;  1E2W A;  1J9O A;  4KK7 A;  4DUZ Q;  1VCI A;  1PRT B;  1EFI D;  1VMP A;  3MC0 B;  4LF4 L;  1Q12 A;  2EJG C;  1EY7 A;  1NR4 A;  5C4X G;  2A74 C;  5IT9 E;  1ET9 A;  2EDG A;  2JA8 G;  5CV7 A;  2TSS A;  3S14 B;  2F3V A;  3E0E A;  3C3L A;  1TQO A;  4LF4 Q;  2K4K A;  4YIJ A;  5KNC A;  3HOZ H;  1M1K C;  1X32 A;  1JWM D;  3QOJ A;  3EA6 A;  1GXD C;  3HOX B;  1WTV A;  1SRO A;  4XIG S;  3S1R H;  3RZD B;  1CK1 A;  1VQ7 A;  3G7L A;  4X6A H;  4WRD A;  2ZTD A;  4CJ2 C;  3L2P A;  3PUZ A;  2XN9 C;  5LMN W;  4A3L H;  2QCP X;  4QIW B;  1B9M A;  1Y1V G;  1O80 A;  2JYO A;  3CD6 A;  1Q1E A;  3TP5 A;  1O7L A;  4ME3 A;  1Y1V H;  3CCU A;  4A3D G;  1FNW A;  1WFQ A;  4YWM A;  2NBF A;  2BDO A;  4GN5 A;  1L0W A;  3UDX A;  1K3B C;  2F0F A;  2PI2 A;  1D5X C;  2D62 A;  1ESR A;  3MFG A;  5KND A;  2XWB B;  3S2D H;  2VB2 X;  3HOZ B;  4DR3 Q;  4CBV A;  1Q90 A;  1CTM A;  1EIH A;  2ES2 A;  3S1R B;  3PCO B;  2B3G A;  3MFY A;  2QGQ A;  2L55 A;  4J15 A;  4FVM A;  1HNZ Q;  4DR1 L;  1PTO F;  2AKW B;  4DU9 A;  5I6Y A;  3KOJ A;  1P16 A;  4ZKC B;  3BU2 A;  2RVL A;  3G6E A;  3NWT A;  1UAP A;  3M4Y A;  3EBE A;  4MNO A;  4C3I G;  1V1P B;  5IYB H;  1O7I A;  1TS5 A;  1QWY A;  2KHS A;  1XNQ Q;  3T4A C;  1B44 D;  4AYB G;  1B50 A;  1SRU A;  2FMC A;  2FFK B;  2K14 A;  1VMC A;  4BBS G;  2LY7 A;  3DHQ A;  2WIN B;  5LHY 1;  5HUR A;  3S2D B;  4BBS H;  2I07 B;  2NVT H;  4UP8 A;  4A76 A;  2NWG A;  4X3T A;  5ELN A;  1VQP A;  1K8O A;  1U9R A;  3DWQ A;  3SR1 A;  4R4T A;  4NW2 A;  2NZ1 D;  3D6C A;  1HZB A;  4I7A A;  3K8A A;  1SEB D;  3T13 A;  1QB5 D;  1F2L A;  3Q24 A;  4J6H A;  3GTP H;  4MTK A;  4JI0 L;  4C3H G;  1I6H H;  4DAV A;  5C3X A;  5DNF A;  1CKN A;  2K04 A;  4U67 3;  3TP8 A;  4JI4 L;  2OTJ A;  2E2J H;  3DM3 A;  3UE0 A;  4KKS A;  2CH4 W;  5LMN L;  4DV7 L;  4RA8 A;  1HUM A;  2AUJ D;  3K57 A;  2L9H A;  2KCN A;  4JI0 Q;  2Z1C A;  5C0X I;  3D3R A;  3KDF B;  3S16 H;  1PH6 A;  4BXX G;  2K03 A;  4LF7 Q;  1IXR A;  2EY6 A;  2NVT B;  4MTN A;  4DKA C;  1D1I A;  1Z6H A;  2Y0S E;  3N6R A;  3CXC A;  1AEX A;  1BNZ A;  1YNJ D;  4B3R L;  2A6E D;  1IYV A;  2SOB A;  1S5C D;  3CCJ A;  3C1F A;  4ODG A;  3PQI A;  1AN8 A;  2IWH A;  1BDO A;  4BS9 A;  2A6H D;  2NN6 G;  2AQ3 B;  2EY2 A;  4JW0 A;  1TY2 A;  3GTP B;  2PI2 E;  3H09 A;  4NXM L;  1I6H B;  1ZYR D;  5M5Y H;  3M85 A;  3D4D A;  4H13 C;  2FHT A;  1IBK Q;  2HQL A;  5IIF A;  1YNJ C;  3OW7 A;  5G3L D;  4B3R Q;  2A6E C;  5KGU A;  4FDB A;  2E2J B;  1PMR A;  3VR2 A;  2A6H C;  3BG3 A;  2L12 A;  4QY7 A;  3EJI A;  1ZYR C;  2M9V A;  1EQT A;  1BUV T;  3CCM A;  1WTO A;  5AJ3 Q;  4X3U A;  3K80 C;  2UU9 L;  3WWV A;  3A0J A;  4YCU A;  1WD1 A;  2B2V A;  2RHQ B;  1RTO A;  4ALP A;  3J7Z C; 
#chains in the Genus database with same CATH homology
 1Z47 A;  3PO2 G;  1HNZ L;  3GD7 A;  4A3K G;  1OXT A;  3AYH B;  1NMG A;  3J81 c;  2V1C C;  4A3J G;  1VQK A;  5IP9 G;  1CSP A;  2ID0 A;  1VQM A;  4JI7 L;  4PZ7 A;  4JBJ A;  1EIY B;  5IYD G;  4GKK L;  4JI8 Q;  3I4N G;  1E1O A;  4O2D A;  3FP9 A;  3CCE A;  1YHQ A;  4A3C G;  1Y1W H;  4C2M H;  1YJN A;  4BA2 I;  1HJP A;  1TWG H;  3FHW A;  3H3V I;  1XNQ L;  1JJG A;  4HIM A;  1QUQ B;  1E3P A;  1GKH A;  2NVY H;  5IWA L;  1EOV A;  2ZTC A;  3GTL H;  4P74 A;  4JOI C;  4BA1 I;  1BBW A;  2JA6 G;  4JYA Q;  4GOP C;  1PV4 A;  1SLJ A;  4LF9 Q;  4X65 L;  3K81 C;  3F2B A;  4GKK Q;  2VL6 A;  4R4Q A;  2VUM H;  1U5K A;  3Q8D A;  1J5E L;  1K8G A;  4GNX C;  3GTQ H;  3RN2 A;  1JJC B;  3E9H A;  4DV4 L;  2VQF L;  1PH4 A;  3RZO H;  1E24 A;  4JI3 Q;  2IT1 A;  4C3I H;  1VQ8 A;  2UUC L;  3MEF A;  1YIJ A;  3S1N H;  2A19 A;  4GLV B;  4LUZ A;  1JT8 A;  2R7Z G;  3M3Y H;  4JBW A;  2JEA I;  2UXB L;  4IFD I;  4A3E G;  4L5Q A;  1X3F A;  2WP8 J;  3CCS A;  3KFU A;  2LSS A;  5IP7 G;  2RHS B;  3CW2 C;  4OWW B;  2F4V L;  5GRO A;  3ICE A;  1A62 A;  4DR5 Q;  4B3M L;  4POG A;  4BY1 G;  1GVP A;  3T1Y Q;  2JEB I;  4YHH L;  1I5F A;  1AE2 A;  3I56 A;  4DV4 Q;  3HOY G;  2VQF Q;  2PQA B;  4BY7 H;  1S3O A;  1OXS C;  3A5U A;  3PO3 H;  2UUC Q;  5C44 G;  2BH8 A;  5M5W H;  1N34 L;  2LXJ A;  5M5X H;  2R6G A;  3CF5 A;  3H3V H;  4A3G H;  4YY3 Q;  2UXB Q;  3CQZ H;  2L15 A;  5EAY A;  4NB3 A;  1PH1 A;  5IYC G;  4B3M Q;  2DGY A;  2YTX A;  4DK6 C;  3D0F A;  2UXC L;  1KHI A;  5C0X J;  1Q46 A;  4IJL A;  3CC4 A;  4LF5 L;  2D0P A;  3D31 A;  4DPG A;  4X66 L;  4POF A;  2NN6 I;  3UDG A;  4C3H H;  4LF7 L;  4LFB L;  4DV6 L;  5K36 G;  1KL9 A;  2E2H H;  3UE1 A;  3AFQ A;  3RN5 A;  1XPR A;  1NTG A;  1XMQ L;  1IBL L;  4IFD G;  2VW9 A;  1PH3 A;  4QGU A;  4LF8 L;  2CWP A;  5J3B A;  4PG3 A;  2UXC Q;  1LUZ A;  1L2F A;  4EX5 A;  4LF5 Q;  4HJ7 A;  4X66 Q;  4GS3 A;  5GAH C;  1YJW A;  1L1O C;  1AH9 A;  4RG1 A;  2K5N A;  4JI1 Q;  4Y7N H;  1X6O A;  3ER0 A;  4EQ5 A;  3HOX H;  1PH8 A;  1RL2 A;  3RZD H;  1VQC A;  2FXQ A;  1DGS A;  4P71 A;  2VS1 A;  4KI0 A;  3PF4 A;  4BXX H;  2KHJ A;  2YTV A;  1XMQ Q;  1KRT A;  1IBK L;  1HNW Q;  3PGZ A;  2N3S A;  4KHP Q;  1HZC A;  2XTI A;  1B8A A;  3FKI H;  1WCM H;  1CSQ A;  2K5V A;  4UP9 A;  4DAM A;  3K7U C;  2NVX H;  4OWX B;  3RLO A;  3M4O H;  1WYD A;  1ASY A;  2OQK A;  1BVS A;  2R92 H;  3NEM A;  3M4Q A;  2K75 A;  3I2Z A;  2E8G A;  4GNX B;  2QEX A;  1TWC H;  4UPA A;  1KRS A;  4A93 H;  2YV5 A;  3CC2 A;  4A3I H;  2OTL A;  4DR4 L;  2ALY B;  1PH5 A;  2JA5 H;  1YIT A;  2ZJQ A;  5FLX c;  3NEN A;  5AJ3 L;  5JEA G;  3W5O A;  1EQR A;  3TRZ A;  4YWK A;  1CKO A;  1PYS B;  3KF6 A;  4HIO A;  1QZH A;  4B3S L;  3CAM A;  3HOV G;  3TS2 A;  5M3M H;  1YVC A;  3T1H L;  4DV0 Q;  3RNU A;  1G29 1;  3G48 A;  3AEV A;  3G4S A;  1UEB A;  1VQ6 A;  3HOV H;  3HOZ G;  4JG2 A;  4A3B G;  5C3E H;  3HOU G;  1GD7 A;  4L5T A;  1VQL A;  4DR7 Q;  3ZJY C;  2B63 H;  1EUJ A;  1W3S A;  1XJV A;  5C4J H;  4R4O A;  1K3R A;  1NJI C;  4DK3 C;  1HNX Q;  1V43 A;  2N78 A;  1S72 A;  1N36 Q;  2MNA A;  4JI5 Q;  2KEN A;  1OXV A;  2WAQ E;  1JE5 A;  3KF6 B;  1B70 B;  5H1S E;  3T1H Q;  2R93 H;  2IHE A;  1Q1B A;  2VY3 A;  4BBR H;  4AQY L;  3HOW H;  1EQQ A;  3TS0 A;  4A3L G;  1N33 Q;  5E7N A;  2HT1 A;  4JBM A;  1S40 A;  4UP7 A;  4A3M G;  1FGU A;  3NBH B;  4JYA L;  3PO2 H;  4A3K H;  4LF9 L;  4AH6 A;  4LF6 L;  5HGQ A;  3J7A 5;  1UE7 A;  3STB D;  1VQN A;  4A3J H;  4P73 A;  4JCV E;  5IP9 H;  5GAE C;  1U0L A;  1K0R A;  4JV5 Q;  3CMA A;  5IYD H;  4AQY Q;  2F3I A;  4XTC S;  1VS0 A;  2Z6K A;  4JI3 L;  1XPU A;  2JA9 A;  3I4N H;  4A3F G;  4A3C H;  3UDF A;  1VQA A;  3TRE A;  1B7Y B;  4KHZ A;  2ASB A;  3GTG H;  4JI6 Q;  4NPS A;  4PZ6 A;  1MJC A;  1L1O B;  4AIM A;  4IFD J;  1KAW A;  4A4I A;  4HJ8 A;  1XMO Q;  2C35 B;  4LF6 Q;  4DV2 L;  3STB C;  2WAQ G;  4GN3 B;  4IOC A;  4A75 A;  2JA6 H;  4DR5 L;  4LFA Q;  2PQA A;  4X64 Q;  1PVO A;  5ELO A;  3T1Y L;  1KXL A;  4OWT B;  5GQO A;  1C9O A;  2IX0 A;  2JK8 A;  3CPF A;  2HHH L;  3JAM i;  1YHB A;  3PV0 A;  4WJ4 A;  3CPW A;  1UE6 A;  3IRB A;  1EIF A;  2AMC B;  3PUV A;  2EXD A;  5IE8 A;  1I50 H;  1GM5 A;  4YY3 L;  1SE8 A;  1KC8 C;  5JJK A;  4YCV A;  4DV2 Q;  3LGJ A;  3L7Z C;  1SFO H;  2IHF A;  3EIV A;  2R7Z H;  2ZTE A;  2VQE Q;  1YBY A;  4B3T L;  4A3E H;  4DR6 Q;  1JJ2 A;  3CME A;  1OXX K;  2KBN A;  1EFW A;  5IYB G;  4LUO A;  5IP7 H;  1CKM A;  1SN8 A;  2OCE A;  2RCN A;  4OON A;  3J81 j;  1MJE A;  1HR0 Q;  4L5S A;  2JE6 I;  3I4O A;  3KYH C;  3CC7 A;  1EYG A;  4GN4 B;  1VQF A;  2HHH Q;  4BY1 H;  2D0O A;  1PHJ A;  3HOY H;  2CKZ B;  4HJA A;  2N8N A;  3U4Z A;  1UE5 A;  5C44 H;  4QJF A;  3KJO A;  4DR1 Q;  3PUX A;  3KLW A;  5GAG C;  3CCL A;  4LWC A;  1Q81 C;  1N32 L;  2A1A A;  4IPC A;  3I4M G;  4B3T Q;  1FL0 A;  5DLQ E;  2NVQ H;  1V1Q A;  3HKZ E;  4OX9 Q;  5IYC H;  5LMU Q;  1VQ5 A;  1VQO A;  2EIF A;  2ATW A;  1UE1 A;  1A63 A;  1WJJ A;  2KCT A;  4JI1 L;  3ULL A;  2RF4 A;  4DV5 L;  3CCQ A;  2AWN A;  1KIX A;  3A5Z B;  3CCV A;  4P75 A;  2UXD Q;  1K73 C;  1QVF A;  1VQD A;  4JOI A;  1HR0 W;  2BA1 A;  1PFS A;  4KLK A;  4RMF A;  4C3J H;  3S14 H;  4GOP A;  1N32 Q;  1HNW L;  4KHP L;  4H02 A;  2JJQ A;  4QL5 A;  3BJU A;  1BKB A;  2XGT A;  2IY5 B;  3UDI A;  1Q7Y C;  1HZ9 A;  2CFM A;  3MXN B;  4YCW A;  3BZC A;  3PUY A;  5IT9 c;  4GNX A;  4IPH A;  1WI5 A;  2KHI A;  4DV5 Q;  4HJ5 A;  2DUD A;  2QA4 A;  2CCZ A;  1VQH A;  4O0A A;  5BR8 Q;  1QZG A;  3PIP A;  1KQS A;  3HFZ B;  3J80 c;  1JMC A;  1BBU A;  2I5L X;  3HKZ G;  1PH2 A;  1IZ6 A;  4GOP B;  2JA7 G;  3F2D A;  4HJ9 A;  3KF8 B;  4DV0 L;  3GTJ H;  1SR3 A;  3W1B A;  3H15 A;  4UY8 C;  1X65 A;  4DUZ Q;  2AWO A;  1VCI A;  3TEH B;  2NZH A;  4DR7 L;  4JI2 Q;  1YJ9 A;  4LF4 L;  4IJH A;  1Q12 A;  3GO5 A;  4IO9 A;  1IL2 A;  5C4X G;  1I3Q H;  3OTO Q;  4YWL A;  4JI4 Q;  3U4V A;  1HNX L;  1HH2 P;  2CQO A;  1N36 L;  3BZK A;  4LUV A;  4GKJ L;  1NE3 A;  1P8L A;  4JI5 L;  2JA8 G;  5LMN Q;  4DV7 Q;  1E7Z A;  2YTY A;  1X3G A;  3E0E A;  4DUY L;  1X55 A;  3F2C A;  1N33 L;  4HID A;  4K0K Q;  3A74 A;  4LF4 Q;  1R9T H;  2K4K A;  1NY4 A;  3B6Y A;  3HOZ H;  1M1K C;  3HOU H;  3M7N A;  4A3B H;  2EQS A;  1YZ6 A;  5FJ8 G;  2OQ0 A;  1SRO A;  4XIG S;  3RLN A;  3S1R H;  4GKJ Q;  1X9N A;  4JV5 L;  1VQ7 A;  3U58 A;  4Y52 H;  1JB7 A;  4X6A H;  4DUY Q;  2I0Q A;  1X56 A;  3K0X A;  2ZTD A;  4WJ3 M;  2BA0 A;  1L1O A;  3L2P A;  2N49 A;  3PUZ A;  5C0X G;  4JI6 L;  5M3F G;  4DNI A;  3JAM c;  1TXY A;  4OX9 L;  5LMN W;  1TWH H;  4A3L H;  2UUB L;  3S15 H;  2HIV A;  5HY6 A;  1XMO L;  1Y1V G;  3H0G G;  1ASZ A;  3CD6 A;  1Q1E A;  4NXM Q;  2CWA A;  1K8A C;  2I5M X;  4ME3 A;  4A3M H;  5JJL A;  4R1J A;  4LFA L;  3W1G A;  4X64 L;  1Y1V H;  1J6Q A;  2MO0 A;  3CCU A;  4A3D G;  1WFQ A;  4DV3 L;  2I5H A;  4YWM A;  3GTO H;  1X54 A;  1WOC A;  2GVB A;  4GN5 A;  1L0W A;  3F1Z A;  3UDX A;  1D8L A;  2E2I H;  1XNR Q;  4OO1 I;  2Q2I A;  1AE3 A;  4R4C A;  1K9M C;  4A3F H;  2UUB Q;  3S2H H;  4OXP A;  4APV A;  1MKH A;  2PI2 A;  4DR2 Q;  4LNQ A;  2D62 A;  1A8V A;  2GVA A;  3L0O A;  3RR5 A;  1YNX A;  3DLL A;  1VQ4 A;  2VQE L;  3F8T A;  3PSI A;  4AYB E;  4DV1 Q;  1Q86 C;  3S2D H;  4DR3 Q;  4JBK A;  4DR6 L;  1Y1W G;  5GAD C;  4DV3 Q;  1HR0 L;  2UU9 Q;  4TVA B;  2ES2 A;  2Q2U A;  2MFI A;  3PCO B;  2B3G A;  4NXN Q;  2ZM6 Q;  2QGQ A;  1M90 C;  1XPO A;  1I94 Q;  2F52 A;  2GN5 A;  1PA6 A;  4J15 A;  4IPG A;  1K83 H;  1HNZ Q;  4DR1 L;  3AQQ A;  2AKW B;  2OWO A;  3GTK H;  3KOJ A;  1P16 A;  1V9P A;  2VZA A;  2WB1 E;  3BU2 A;  1Q8K A;  1VQJ A;  4JI7 Q;  2KCM A;  2VUM G;  3G6E A;  1PH7 A;  3EBE A;  3M4P A;  2PMZ E;  1LYL A;  1VQI A;  4MNO A;  1SMX A;  4P72 A;  3U50 C;  1CUK A;  5LMU L;  1QVC A;  2R7D A;  5IYB H;  1O7I A;  3OW2 A;  1FJG L;  4OO1 G;  2Z0S A;  2JQO A;  3JC6 6;  1XNQ Q;  2UXD L;  1Z9F A;  2Q2T A;  5JEA J;  5IWA Q;  3J81 i;  4AYB G;  3EN2 A;  1FVI A;  2VNU D;  1SRU A;  3ERS X;  3S1Q H;  2K14 A;  4MZ9 A;  1A0I A;  1TWF H;  1XTD A;  4X65 Q;  1X3E A;  4BBS G;  2E5L L;  3I4M H;  4BY7 G;  1TWA H;  1J5E Q;  1LTL A;  1FJG Q;  1N9W A;  4BBS H;  3PO3 G;  3S1M H;  2NVT H;  1NMF A;  1C0A A;  4A3G G;  4UP8 A;  1OTC A;  4A76 A;  1IBM L;  5BR8 L;  5ELN A;  1KD1 C;  1VQP A;  2WB1 G;  3PF5 A;  2K5H A;  3G71 A;  4R4T A;  3SGI A;  3CP0 A;  2WFW A;  2IX1 A;  1HZB A;  3K7A H;  3PUW A;  3K8A A;  2F4V Q;  2E5L Q;  1H95 A;  3ULP A;  3KDF A;  4YHH Q;  2UUA L;  3GTP H;  3I7F A;  4DUZ L;  4QQB X;  4JI0 L;  1E1T A;  1I6H H;  4QIW E;  4JI2 L;  2HIX A;  1T9H A;  1IBM Q;  1CKN A;  1N34 Q;  3OTO L;  4JI4 L;  1OXU A;  2E2J H;  3DM3 A;  4IOA A;  3UE0 A;  2OTJ A;  3RLF A;  1EWI A;  5LMN L;  1VQB A;  1YEZ A;  3ULJ A;  3CCR A;  4DV7 L;  2YU9 H;  1G6P A;  2H5X A;  3GDE A;  2UUA Q;  2R7F A;  2JA7 H;  4K0K L;  4JI0 Q;  1RIP A;  5C0X I;  3KDF B;  3AFP A;  3S16 H;  3HOX G;  3I55 A;  1PH6 A;  1IYJ B;  2K50 A;  2MQH A;  2ZJP A;  4IPD A;  4BXX G;  4LF7 Q;  4LFB Q;  1IXR A;  4MTN A;  4DKA C;  4DV6 Q;  2MO1 A;  2BH2 A;  1CKN B;  2Y0S E;  3FKI G;  5C4X H;  1WCM G;  2Q2H A;  3HKS A;  4X62 L;  3CXC A;  2ZJR A;  1IBL Q;  4DAY B;  1GO3 E;  4LF8 Q;  4B3R L;  3E9I A;  2PNH A;  4GLX A;  2R92 G;  3CCJ A;  4JC0 A;  2JA8 H;  1N8R C;  2Z6K C;  1YHA A;  1UWV A;  1PH9 A;  3S17 H;  1VQE A;  4GLA C;  4A93 G;  5IY0 A;  4A3I G;  2NN6 G;  1W2B A;  4HIK A;  3M9B A;  2JA5 G;  1PYB A;  2PI2 E;  3TQY A;  4NXM L;  3M85 A;  5M5Y H;  1E22 A;  4TQU S;  2K52 A;  1VQ9 A;  2B29 A;  5M3M G;  4X62 Q;  1D7Q A;  2LXK A;  2HQL A;  2NZO A;  5FJ8 H;  1IBK Q;  4B3R Q;  1HZA A;  4FDB A;  2YYZ A;  1G51 A;  2AHO B;  3GTM H;  5C3E G;  4LFC L;  1NBW A;  1XNR L;  3NEL A;  4LW1 A;  2B63 G;  1VQG A;  1C7Y A;  4L5R C;  3VDY A;  4R4I A;  1MIU A;  5JJI A;  4PZ8 A;  4QY7 A;  2Y0S G;  3KJP A;  5M3F H;  4DR2 L;  2A8V A;  3J80 i;  4DR4 Q;  1Y14 B;  3OYY A;  4DV1 L;  3CCM A;  4DR3 L;  3H0G H;  5FLM G;  5AJ3 Q;  1YI2 A;  2R93 G;  4PMW A;  3S24 A;  4B3S Q;  4BBR G;  3HOW G;  1Q82 C;  1QVG A;  3K80 C;  4JI8 L;  2UU9 L;  3WWV A;  5FLM H;  1LM0 A;  4LFC Q;  3A0J A;  4A3D H;  4NXN L;  1QUQ A;  2ZM6 L;  4YCU A;  1I94 L;  2RHQ B;  3PIO A;  4ALP A;  3J7Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...