2EQSA

Solution structure of the s1 rna binding domain of human atp-dependent rna helicase dhx8
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
103
structure length
103
Chain Sequence
GSSGSSGEEPTIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase DHX8
publication title Solution structure of the S1 RNA binding domain of human ATP-dependent RNA helicase DHX8
rcsb
source organism Homo sapiens
total genus 9
structure length 103
sequence length 103
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2eqsA01
4DV2L 2VY3A 3UDXA 1VQPA 2CCZA 2WP8J 1VQFA 4LF5L 1I50H 2VUMH 2YTVA 1VQHA 3HOUH 4APVA 1GO3E 2NVXH 2MFIA 1L1OB 2EXDA 4A3EG 1Q7YC 3I4MG 2BA1A 3HFZB 1PV4A 3I55A 3EIVA 2I5HA 1J6QA 1HH2P 3TS0A 1I94Q 3T1YQ 1VCIA 4HJ7A 3B6YA 1TXYA 4A3IH 3S1MH 1EOVA 2UU9Q 3HOXG 2LXJA 3M4PA 5BR8Q 3F2DA 4HIMA 2N3SA 4ALPA 1VQNA 2ZJPA 2JEBI 5DLQE 4DV3L 4IOAA 2VL6A 2LXKA 2N78A 1C7YA 2A1AA 3WWVA 4LFCL 2KENA 1J5EL 1HR0W 4JI2Q 4A3KG 2UUAL 2IX0A 4DPGA 3CCQA 3G71A 4DV4Q 2R92H 4KHPL 5M5YH 2AHOB 3T1HQ 4AQYQ 1K8AC 1O7IA 2WAQG 5IWAL 2L15A 1GD7A 4C3JH 3STBD 1UE1A 1VQ9A 4JI3L 1XNQQ 4DV2Q 2NVYH 2WFWA 4QY7A 1PH7A 2E2HH 2R7ZG 1YHAA 4LF5Q 1KXLA 3ZJYC 4PZ6A 1RL2A 3PGZA 3KF6A 1KHIA 1L0WA 5M3FH 1EUJA 5IP9G 5C4JH 2VNUD 1BVSA 4AIMA 2H5XA 4P73A 2IY5B 1SMXA 1VQIA 4GS3A 4DK6C 4GN5A 4LUVA 3KF6B 2JQOA 1XMOL 4YCVA 5LMUL 2PI2A 4DR5L 4A3BH 5C44G 3E9HA 2N8NA 1NMFA 4BY7G 5GAHC 3G4SA 3ER0A 1VQDA 5C0XI 1WCMH 4DV3Q 2ALYB 2CKZB 2K4KA 1LTLA 3EBEA 4KI0A 4OWWB 1N33L 3S24A 4DV6L 3W1BA 1WJJA 4HIDA 3PUVA 5M5XH 4DV5L 3KDFA 1YJWA 4LFCQ 2UXDQ 1G6PA 1J5EQ 1JE5A 2JK8A 2UUAQ 1VQGA 2Z6KC 3M4QA 4KHPQ 3W1GA 1CKMA 5IYCG 4OO1I 1E22A 4EQ5A 2AWNA 5IYDG 3CCLA 3GTGH 3S15H 2UXCL 3KLWA 4R4IA 4DV1L 1HZBA 1H95A 1OXXK 1FL0A 3UDGA 2HT1A 4A3GG 4JI3Q 5E7NA 5FLMG 5K36G 5C3EH 2WB1G 4A3JG 3KJPA 4A3FG 1YIJA 1JT8A 1EQRA 2KCMA 4LUZA 4JV5L 4JI4L 2CWAA 1SE8A 3PIPA 4JOIC 3SGIA 2HHHL 3J80c 3DLLA 3I2ZA 4HIKA 3H0GH 4JCVE 1JMCA 4A3CH 1KRTA 1NBWA 2YU9H 4IPHA 1YNXA 1EFWA 3S2DH 3CD6A 2EQSA 3RLOA 3VDYA 2JA5H 3STBC 3M4OH 3TQYA 1TWHH 3TRZA 5LMUQ 1KAWA 2R6GA 2RF4A 3LGJA 4DK3C 4OX9L 5FLXc 4IJLA 1OXVA 1VQMA 2ZJQA 1QUQA 1N32L 1N33Q 2Q2IA 4JBWA 3IRBA 1CSPA 4DV6Q 4TVAB 1KQSA 4QIWE 3J7ZC 3HOWG 4DV5Q 1YHBA 2PQAA 4X66L 2KHIA 5LMNQ 4DAYB 1QUQB 4DR4L 4GN3B 1A62A 2UUCL 1W3SA 2ZM6L 2E2IH 2OQKA 4HIOA 2LSSA 1IBKQ 4LF8L 1YZ6A 3PO2G 4DV1Q 1KRSA 1OXSC 3FKIG 2NN6I 4LWCA 4BY1H 4UP7A 1SROA 3TREA 4Y7NH 4BBSH 5C4XG 2Z6KA 2GVAA 1LUZA 3I4OA 4BBRG 5IYBH 2E5LL 3D0FA 1VQ4A 3GTKH 2QGQA 1GVPA 1P8LA 4JBJA 1AE3A 4JI4Q 3U50C 2BA0A 3NELA 1E24A 4AH6A 3J80i 4IPCA 4A3EH 2NVQH 1K8GA 3I4MH 2Q2HA 1Q8KA 4MTNA 2AKWB 2KHJA 4QJFA 2HIVA 4DR2L 4JOIA 4OX9Q 1K3RA 3CCSA 2D0PA 3HOXH 4GNXC 1N32Q 4WJ3M 1YI2A 1EYGA 4X6AH 4X66Q 4IFDG 1PH3A 4JI6L 2C35B 1LM0A 1S40A 3E0EA 4DR6Q 2DGYA 5FJ8G 4IO9A 4DR4Q 1Q81C 2UUCQ 1HZAA 4DKAC 2ZM6Q 4A3KH 5GROA 1VQAA 3F2CA 3RNUA 4B3SL 1WFQA 1HNXL 2Q2UA 1PHJA 4DAMA 1E3PA 2CWPA 2JEAI 3H15A 3GTMH 4AYBE 3G48A 1CKNA 4P74A 2FXQA 3BJUA 2B63G 4GKJL 2E5LQ 3RN2A 2EIFA 1VQEA 3H3VH 3CPWA 2PNHA 1CKNB 3ERSX 3K0XA 3KF8B 1QZGA 2ES2A 1VQKA 1T9HA 1HNZQ 3HKZE 5IE8A 5IP9H 1IBLL 3S17H 4GKKL 3PO3G 3M7NA 4C3HH 4DR2Q 5GAGC 4IJHA 1N8RC 2YV5A 4DUYL 2R7DA 1XPUA 1M1KC 3AYHB 5IP7G 5LMNW 1PH9A 1SFOH 4GOPC 1BBWA 3E9IA 2K5HA 5C44H 1NJIC 4BY7H 1YJNA 2UXBL 2R7ZH 1VQLA 3W5OA 1Y1VG 1CUKA 1NE3A 3PUZA 4JI6Q 3KOJA 3F2BA 4DNIA 2HQLA 2JE6I 4GNXA 4A3DG 2K5VA 3GTPH 2E8GA 4UY8C 5IYCH 3U58A 2OQ0A 3CMAA 1HNXQ 3KFUA 2GN5A 4LFBL 1B70B 5IYDH 1S3OA 4GNXB 2CQOA 3CF5A 2F4VL 2QA4A 4HJ5A 3DM3A 1E7ZA 1XMQL 4A3LG 4GKJQ 3CPFA 1Q82C 3HOYG 1FJGL 3ICEA 4A3GH 3CP0A 3J81c 5FLMH 1YHQA 2ATWA 3CQZH 4DR7L 4KLKA 4A3JH 4A3FH 1XNQL 2YYZA 3NENA 4PMWA 1QZHA 1PH1A 3I56A 4LF7L 2KCTA 4WJ4A 1IBLQ 2Y0SE 4GKKQ 1B7YB 4R4OA 1BBUA 1RIPA 3FP9A 3UDIA 3HOVH 4DUYQ 2D0OA 1VQ6A 2DUDA 2IX1A 3RR5A 4C2MH 3PSIA 4IPDA 5IWAQ 2UXBQ 1VQJA 3RZDH 4A75A 1Q1EA 4RMFA 1MJCA 2F3IA 4OWXB 5HGQA 3HOWH 4L5TA 4BXXG 1I3QH 2K5NA 3I7FA 3GTJH 4GOPA 1JB7A 4O2DA 1GM5A 1K73C 1MKHA 1TWFH 2A19A 1JJGA 4GN4B 1VQ8A 4LFBQ 2B3GA 3J81j 1YITA 4GOPB 3K80C 3PO2H 3FKIH 2NZOA 4FDBA 4NPSA 1NTGA 3GDEA 1FJGQ 5C4XH 3PF4A 2JA9A 1Q46A 2GVBA 4DR7Q 4R4TA 2RCNA 2ZTCA 4PZ7A 4BBRH 3PUWA 1UWVA 1HJPA 3J81i 1XMOQ 1PYBA 4DR5Q 1PH4A 4JI5L 4LF7Q 4P72A 2RHQB 3G6EA 1N34L 4A93G 2K75A 1DGSA 1X6OA 3K7AH 1D8LA 3TS2A 1K9MC 3BU2A 3K81C 1PH5A 4A4IA 2WAQE 1X65A 2YTXA 3CXCA 4H02A 3L0OA 3H3VI 3GTLH 3CMEA 4GLAC 2VQFL 1XNRL 2R93G 3CCUA 3A5ZB 2UXCQ 2ZJRA 4OONA 3FHWA 4K0KL 1A63A 1VQOA 1VQCA 1ASZA 2JA8G 3ULPA 2Q2TA 4O0AA 5FJ8H 1Y1WG 4JBKA 4B3TL 1D7QA 1UE6A 2VW9A 1L1OC 4JV5Q 2HHHQ 2MO1A 3PCOB 4NXML 2OTJA 2B63H 4R1JA 5J3BA 1Q1BA 4JI1L 3PUXA 4JC0A 4JI8L 1E1OA 4MNOA 1OTCA 3CC4A 4JYAL 1XPOA 1OXUA 4JI5Q 3JAMc 1S72A 3L2PA 2ID0A 1N34Q 4NXNL 3HOZG 1X54A 3AFPA 3U4ZA 3PO3H 5ELNA 1R9TH 1PH8A 1TWAH 4LW1A 3I4NG 1QVGA 1IL2A 4L5SA 5IP7H 4QGUA 4OWTB 2JJQA 5IY0A 2VQFQ 4LF8Q 1XNRQ 3S16H 2K14A 1NY4A 5JEAJ 1HZCA 4RG1A 3CC7A 4GLXA 4JBMA 4K0KQ 1TWGH 1Y1VH 3A74A 1VQBA 1XTDA 1Y14B 3OYYA 4P75A 5M3MG 4A3DH 2Y0SG 3UDFA 2PMZE 1WI5A 1G51A 3NBHB 1Z47A 3CCVA 5C0XJ 2QEXA 1JJ2A 4B3TQ 3RZOH 3MXNB 3T1HL 3OTOL 4AQYL 1X56A 3CW2C 4NXMQ 4OXPA 4BA1I 4A3LH 2I0QA 1P16A 4C3IH 3HOYH 4UP9A 4JI1Q 4X65L 4JI8Q 3RLNA 4OO1G 4JYAQ 1PVOA 1FGUA 4QQBX 1KL9A 4TQUS 4R4QA 3U4VA 2ZTEA 2KBNA 3F8TA 4DUZL 1PH2A 1MJEA 3JAMi 1IXRA 1KIXA 4L5RC 4POGA 1JJCB 1E1TA 3PUYA 3GD7A 2IHFA 2V1CC 2JA7G 4B3RL 2MNAA 1L2FA 1N36L 3A5UA 2YTYA 5JJIA 1G291 4A3MG 3MEFA 5GQOA 4B3SQ 3S2HH 5GAEC 4A76A 3GTOH 4LF9L 5ELOA 1FVIA 2K52A 2XTIA 3AFQA 4L5QA 4IOCA 3RN5A 2JA6G 2AMCB 4JI7L 1X3GA 5EAYA 4BXXH 2UXDL 3EN2A 5M5WH 4POFA 4Y52H 2VS1A 4DR1L 1IZ6A 3A0JA 4LF4L 2NVTH 4ME3A 2PI2E 4DV7L 4XIGS 1YEZA 3OTOQ 4NXNQ 2VUMG 1W2BA 3HOUG 3ULLA 4YWKA 1SLJA 3BZKA 2CFMA 2A8VA 3PIOA 4X65Q 1K0RA 1SN8A 1LYLA 4IFDI 2MO0A 3JC66 3PF5A 3AEVA 3KJOA 4YHHL 4A3IG 4LFAL 2I5MX 2BH8A 2OCEA 4DUZQ 1PFSA 2NN6G 3UE0A 1X9NA 4MZ9A 4PZ8A 4A93H 3HKSA 3NEMA 1SRUA 1IYJB 1QVCA 4B3RQ 2N49A 4JG2A 1NMGA 3D31A 1N36Q 2ZTDA 4LF6L 3Q8DA 1Q12A 1V1QA 1X3EA 1CSQA 2R92G 2E2JH 4DR3L 4LNQA 3F1ZA 1AH9A 4JI0L 2VQEL 4LF9Q 2R93H 3RLFA 3S1NH 2F4VQ 3GO5A 1XMQQ 1K83H 1VS0A 4JI7Q 1HR0L 5LMNL 1UE5A 2B29A 4DR1Q 1PA6A 1I5FA 3KYHC 4YY3L 2JA8H 1C0AA 4LF4Q 1TWCH 1Y1WH 1MIUA 4UP8A 4P71A 4DV7Q 4EX5A 5AJ3L 2RHSB 1VQ5A 3KDFB 5M3FG 1N9WA 4XTCS 3M3YH 4NB3A 3BZCA 2MQHA 4UPAA 1YVCA 3CCEA 1A0IA 4X64L 1UEBA 2R7FA 3M9BA 2K50A 3L7ZC 1M90C 1I6HH 2VZAA 4LFAQ 4YHHQ 4LUOA 4A3BG 4AYBG 3K7UC 1U5KA 4IPGA 5IT9c 4HJ8A 3HOVG 1WCMG 1SR3A 2UUBL 3HOZH 3GTQH 1XJVA 1HZ9A 4X62L 3CCJA 4DV0L 1WOCA 3OW2A 1WYDA 2NZHA 1IBML 1EIYB 4LF6Q 1YBYA 1KD1C 2XGTA 1U0LA 3HKZG 2AWOA 3ULJA 3M85A 3I4NH 4DR3Q 4JI0Q 2VQEQ 5JJLA 1YJ9A 2F52A 2OWOA 1PYSB 1HNWL 1HR0Q 3CCRA 3TEHB 1EIFA 4PG3A 2HIXA 5C3EG 4YY3Q 1C9OA 4B3ML 4DR6L 4HJAA 5M3MH 1IBKL 4YCWA 5AJ3Q 3PV0A 3AQQA 2OTLA 2PQAB 4HJ9A 3S1QH 1KC8C 3J7A5 3H0GG 4A3CG 5GADC 4YWLA 4X64Q 1QVFA 4QL5A 2JA5G 1Z9FA 2Z0SA 1EQQA 2ASBA 1I94L 3T1YL 5JJKA 3UE1A 1EWIA 2UU9L 5BR8L 1V9PA 2UUBQ 4J15A 2I5LX 1V43A 4X62Q 5H1SE 2WB1E 1HNZL 4DV0Q 1BKBA 5JEAG 1Q86C 1B8AA 3S14H 3K8AA 2JA7H 4GLVB 1IBMQ 1A8VA 4YWMA 5HY6A 4YCUA 3CCMA 1OXTA 1XPRA 1GKHA 2IT1A 1VQ7A 4JI2L 1UE7A 1X55A 1ASYA 5C0XG 4R4CA 1CKOA 4DV4L 4A3MH 4BA2I 3CC2A 3CAMA 2IHEA 1HNWQ 4BY1G 4IFDJ 1X3FA 1PH6A 2BH2A 4BBSG 2D62A 2JA6H 4B3MQ 4KHZA 5IYBG 1AE2A 3S1RH 1L1OA
chains in the Genus database with same CATH superfamily
2VY3A 1V8QA 3OWEB 5CV9A 3S2HB 1U4LA 3GTOB 2EXZA 2CW0C 2YTVA 3TDQA 4APVA 4JVZA 1L1OB 1I4XA 2CHBD 2EXDA 3I4MG 4CJ1B 2VB2X 1J6QA 1VCIA 4HJ7A 3M4PA 4HIMA 1VQNA 1ENFA 2EY1A 1O7LA 1HUMA 2LXKA 5T1IA 3R2TA 4KN4C 3R93A 1DONA 5TSSA 4EQOA 3V96A 4K5VA 4DV4Q 2R92H 4KHPL 2AHOB 2QKIC 4K5XA 2ZXRA 2KVMA 3H6MA 2F0OA 3OIPA 1I3QB 3GTJB 1XNQQ 2E2HH 1KXLA 4PZ6A 4IURA 1BXTA 3WOEA 1L0WA 5M3FH 4AIMA 1SMXA 3OMCA 4YCVA 5FOBB 5LMUL 5C44G 3E9HA 1AZQA 3E0JA 2CKZB 4OWWB 3EBEA 2O5JC 4DV6L 3W1BA 2UXDQ 4DV5L 3KUPA 1SYFA 1G6PA 1G2TA 2XVSA 2UUAQ 1CKMA 4EQ5A 3CCLA 3K6OA 1LTID 4DF7A 2UXCL 3KLWA 1Y69U 5ELFA 1R4PB 4H7BA 1EQRA 2EY6A 2KCMA 4LUZA 2HCIA 4JOIC 5A2QL 4RGTA 1A3VA 3H0GH 4JCVE 4A3CH 1B53A 4OL7A 1BCPD 3A7LA 3RLOA 3STBC 3M4OH 1Z6HA 1KAWA 2CW0D 2R6GA 4DK3C 5M9OA 2ZJQA 1QUQA 2KHSA 4JBWA 3IRBA 1SE4A 4TVAB 1SAPA 3PO3B 1R9TB 1C8CA 1SDFA 5C3XA 1AFPA 3C2PA 2ENBA 4GN3B 1A62A 3S9WA 1QOHA 4LF8L 3TP8A 1OXSC 4LWCA 5CMDA 3K59A 4FNFA 3T13A 2I07B 2HD3A 3A8JE 1LUZA 3C1FA 2E5LL 2RBMA 2NTTA 1GVPA 1WTRA 3Q0AA 1E24A 2FHTA 3J80i 4IPCA 1B3QA 2F0EA 1KLUD 2J7ZA 1RJTA 2HIVA 5C5LA 4JOIA 4GNXC 5JVG3 4WJ3M 5EBDA 1YI2A 2XRSD 1JQYD 3MXUA 1HTLD 1SSOA 1PH3A 4IFDG 1CA6A 1TS2A 3E0EA 4DR4Q 1HZAA 4A3KH 3IFTA 2WIIB 3F2CA 3RNUA 1WFQA 2KECA 1PRTF 3GTMH 3H15A 3G48A 4P74A 3BJUA 2A73B 5KEEA 1U4RA 3BVGA 1VQEA 1DYQA 3H3VH 1PTOD 3K0XA 4GKKL 4JW0A 3PO3G 3Q22A 3M7NA 1TVXA 4DR2Q 2WKCA 2XNAC 2YV5A 2B2WC 3AYHB 1PH9A 1NJIC 3E9IA 2R7ZH 2F1MA 2NTSA 3H91A 3KOJA 4DNIA 3R3OA 4GNXA 2E8GA 2E2JB 4CGYB 1FNUA 4LFBL 2F0PA 1JWMD 5IYDH 1EZ8A 3TZUA 2F4VL 4HJ5A 1HHVA 1Q82C 2PYKA 3VR4A 3J81c 2JA8B 1A3UA 4DR7L 2DY8A 4A3JH 1XWEA 4A3FH 5HGTA 2A6EC 4PMWA 1PH1A 1BCPB 1J8IA 5CV4A 1B7YB 4KKUA 1B1ZA 3UDIA 3OWFA 2EYPA 4DUYQ 2L12A 2D0OA 2Z1CA 3DUZA 2IX1A 3RR5A 4C2MH 1RTNA 5IWAQ 3HOZB 2EJGC 4L6TB 5HGQA 5ELBA 4BXXG 2F0UA 1JB7A 1GM5A 3UI2A 1MKHA 4WJWA 1K73C 4GN4B 1CQVA 5NUCA 5CBAE 2M2LA 3J81j 4GOPB 1YITA 3OHXC 1EY5A 3FKIH 3C3LA 4R9WA 2RVLA 3T53B 4R4TA 2RCNA 4RA8A 4BBRH 1EFID 2Y0SB 1MBYA 1L0YB 3VYSA 4DN4M 4LF7Q 1F9SA 4P72A 2RHQB 3G6EA 1I4QA 1LTRD 1DGSA 2E2DC 3EROA 3LWEA 1X6OA 4DXGA 1D8LA 4ZYSA 1K9MC 2EDGA 1X65A 3CXCA 3L0OA 3GTLH 2A74C 1XNRL 1S5CD 3VA5A 2ZJRA 4OONA 4KMUC 3DWPA 2JA7B 4IUTA 1VQCA 2JA8G 1HXYD 3EJIA 1CZGA 3NPPA 4A3MB 2VW9A 3LX0A 4JV5Q 1WTPA 3HP3A 4R1JA 1PTOB 1Q1BA 4WRDA 2RQXA 4JI1L 4JC0A 4DK0A 1E1OA 4MNOA 5IGCA 1XPOA 3Q6SA 2VUMB 3JAMc 1S72A 2WAQB 2XIWA 1N34Q 3HOZG 5EGTA 2TSSA 4Q0FA 5LL6S 1NR4A 5C5MA 4PQXA 5ELNA 1K3BC 1WD0A 1TWAH 1F2MA 4A3IB 5EQ0A 4OWTB 5IY0A 3S16H 1F77A 4K0KQ 1H9JA 1Y14B 4A3DH 2Y0SG 3NWTA 3NBHB 1WI5A 5C0XJ 2ICIA 3MXNB 5T1GA 4B08A 1SYDA 3CW2C 4NXMQ 4OXPA 4A3LH 1P16A 1D5XC 2NVYB 4KD3A 4JI8Q 4OO1G 2B2YC 4JYAQ 5KNCA 3SHLA 3G7LA 4R4QA 1IL8A 3D6CA 2WINB 2WKDA 4NXNQ 1F9QA 2KBNA 1JWSD 1PH2A 5C4JB 1H9SA 3PUYA 1FD7D 3CRKC 3FPUB 2JA7G 2MP1A 4K2KA 1U9RA 3OSOA 1MGSA 4IUVA 2C5CA 1GUWA 4XT1B 1QWYA 5GQOA 4A3MG 5M5XB 4JI7L 1LABA 1X3GA 3SEBA 3D4RA 2UXDL 4Y52H 1RKNA 4DR1L 1IZ6A 2PI2E 2VUMG 3OTOQ 2C9OA 1D1IA 3S15B 5EKLA 3VYRA 2CFMA 2A8VA 1QE6A 5E1FA 4ULLA 4IFDI 4LK1C 3IAYA 3NUCA 4A3IG 2KEEA 2BH8A 2PZWA 4MZ9A 4PZ8A 2YU9B 3HKSA 3S2DB 2BDNA 1IYJB 1ET9A 4B3RQ 2JA5B 2EVBA 1N36Q 3G6JB 4HEDA 4LF6L 3VA7A 1OO9B 2VQEL 1RHPA 3IFDA 1XMQQ 3DXJC 1TIID 1HR0L 1S5BD 2B29A 5IGGA 4LF4Q 1Y1WH 1MIUA 4IUPA 4UP8A 4WORA 4DV7Q 5AJ3L 2PCFB 5JVH3 3M3YH 1N9WA 3KBXA 4BY1B 4Y7NB 1I4RA 1YVCA 1SJHD 4X64L 3CCEA 1UEBA 5ELCA 3M9BA 2VZAA 3GTKB 4YHHQ 4QB4A 1DOKA 4LUOA 1EEFD 1RCVD 3URYA 2FMMA 2QCPX 3GTQH 4A3EB 1W6JA 2NVQB 4DV0L 2FINB 5C4ZA 1EIYB 3DM1A 5IODA 1YNND 4V190 3I4NH 1G8ZD 4DR3Q 3QOJA 5JJLA 1YJ9A 4CJ2C 2K32A 4EQPA 1KAAA 4CBVA 1LTGD 4PG3A 3J7AF 4QUCA 1SBBB 4YCWA 1FNWA 1IYVA 3S1QH 2X69A 4K8JA 3A7AB 1KC8C 3RMHA 2QF7A 2JA5G 4FO2A 5D3DA 2HDLA 2RSNA 2ASBA 3SVMA 2BCOA 2IX3A 3MHBA 1EIHA 1W6KA 3D8GA 5BR8L 2UUBQ 4J15A 2I5LX 1PLFA 3BG3A 4X62Q 3S17B 1BKBA 4DGZA 1VMPA 5JEAG 4N9PA 4XXEA 1A8VA 4RHRA 1SFOB 1HFNA 1ASYA 1CKOA 3CAMA 1WTVA 4BY1G 4IFDJ 1X3FA 2D62A 1L1OA 4DV2L 2WP8J 4LF5L 1I50H 1VQHA 1GO3E 2MHVA 4A3EG 1Q7YC 4A3GB 3I55A 2I5HA 3BDCA 1HH2P 3CQZB 2EZVA 1I94Q 3T1YQ 4G4KA 1TXYA 1U4PA 3S1MH 1ML0D 1YNJC 2AQ3B 2UU9Q 1CHPD 2O4XA 2N3SA 2NN6H 4Z9CB 1A15A 2VL6A 4KY5A 4NW2A 4KJNA 4X3UA 3Q23A 2A1AA 5CV5A 3WWVA 2B2VC 4LFCL 1J5EL 3CCQA 3G71A 5M5YH 5DM63 1K8AC 1MSHA 5IWAL 1NUCA 3RZDB 2L15A 1STEA 3HOWB 2O2LD 1UE1A 2H4OA 2ZT9C 4EVOA 4HMJA 1TWFB 2K03A 1PH7A 3ZJYC 2H5XA 3TMEA 1VQIA 4GS3A 3X3MA 1PFBA 4A3BH 3IL8A 4F88A 1WCMH 4DV3Q 1N33L 1LTLA 1TS4A 3K7AB 5I2XA 1WJJA 3PUVA 1YJWA 3KDFA 4OO1I 3M4QA 2KA7A 1E22A 2I46A 4R4IA 1H95A 4A3GG 1SJED 4JI3Q 2B2UA 1QB5D 4CKBA 4JV5L 4JI4L 5E3FA 1SE8A 3TP6A 1Y8OB 5A35A 2B63B 3CD6A 2L55A 4J1MA 1TWHH 3TRZA 3K5LA 2AQ1B 1Q8IA 1N32L 1Y8PB 4O42A 4L63B 1KQSA 4QIWE 3HOWG 3O13A 4CKEA 1YHBA 4X66L 2KHIA 4IZ8A 4F7XA 4DAYB 1C48A 2EY5A 3T16A 3VR6A 2UUCL 2ZM6L 2E2IH 2LSSA 3ZYYX 4DV1Q 3SK6A 3TREA 1SROA 2A68C 4BBSH 2XSCA 2GVAA 3K57A 5IGDA 2X6GA 1VQ4A 2QGQA 3X3NA 2JP1A 1P8LA 4JBJA 3TP7A 4ZKCB 4AH6A 4IUQA 1A6XA 4C3IB 1VMCA 1H9KA 3NHHA 2KHJA 3MA2B 4OX9Q 5KRUA 1WVLA 2D0PA 3HOXH 2ZXOA 1EYGA 1LV9A 3OW7A 4X6AH 4JI6L 1KDAA 2LFNA 1S40A 4DR6Q 1ZYRD 1O80A 2DGYA 5FJ8G 1BCPC 1LT6D 1HNXL 1A2UA 1PHJA 4DAMA 1E3PA 1LTTD 2CWPA 5JOBA 4AYBE 1X3QA 2FXQA 2B63G 4GKJL 3QIAA 3RN2A 2F0WA 4E6IA 3NBIA 4RCNA 3RD4A 3ERSX 1EY7A 1T9HA 5IE8A 1MSGA 5IP9H 4FXDA 5J22A 1T5XD 2F0NA 4C3HH 5GAGC 2EYJA 4IJHA 1N8RC 2R7DA 1M1KC 5IP7G 1DM0B 1BBWA 1UAPA 4GOPC 1X3PA 4BY7H 1YJNA 1NSNS 2UXBL 3BDLA 1NE3A 3A8KE 3F2BA 4IUUA 2HQLA 2JE6I 3PQIA 3GTPH 4HSPA 5IYCH 3CMAA 3U58A 2GN5A 1B70B 1S3OA 3CF5A 1ESRA 4CHTB 2QA4A 1XMQL 1E7ZA 2SOBA 4C3IG 1SXTA 3ICEA 3GP7A 5FLMH 2ATWA 1TR5A 1TWCB 3HKZB 1HQRD 1TQOA 5K36H 2B39A 4OEMB 5KIXA 3GV3A 1RF2D 3I56A 2OXPA 2A68D 3CKIB 4H0LC 1IBLQ 2RSOA 2Y0SE 3NTKA 3I91A 4K5WA 4R4OA 3EA6A 1I6HB 1R4QB 1ENAA 1AW7A 2X6LA 4A75A 1Q1EA 2PW5A 1PTOC 1AN8A 1TY2A 2K5NA 4GOPA 4O2DA 4CDCC 1JJGA 2A19A 3PO2H 4KTAA 4NPSA 1FJGQ 3EFXD 5C4XH 2SNSA 1Q46A 2GVBA 3PIO3 5I9OA 2L9HA 1PYBA 4UDUC 5JPMC 1F9RA 4JI5L 5E4WC 2K01A 4NKLA 1FNVA 3BU2A 3K81C 4G57A 2WAQE 2YTXA 4CKCA 4FF1A 3OPOA 1WTHA 4GLAC 2VQFL 3CCUA 3ND9A 4M8AA 3S14B 1JE4A 1CI3M 1ASZA 2Q2TA 4JBKA 1UE6A 3HS0C 2HHHQ 3GQBA 1ET6A 1PFMA 2JA6B 1HRJA 4PNYA 4TSSA 2EYHA 2K6AA 4QIWB 4NMZA 3AFPA 3U4ZA 4DNTB 3T56B 5KNBA 2DNCA 2AUJD 1QVGA 4QGUA 1NY4A 3NBHA 5JEAJ 1HZCA 4RG1A 3CC7A 4KN7C 1Y1VH 3ONAB 3MXNA 4N8FA 4P75A 2K5QA 2F0GA 3QO2A 2Q8IB 2PMZE 4B3TQ 3CCVA 2R92B 3RZOH 1QG7A 1H9MA 2K33A 2RKSA 3HOYH 4X65L 2E2HB 1PVOA 2IJ0A 4FXKC 2MUYA 3U4VA 5C3WA 2N88A 5G3LD 2IWHA 2ZTEA 3F8TA 5M3FB 1PZJD 2V1CC 4DXFA 2F0IA 2MNAA 1L2FA 1KDBA 1XX8A 3QJYA 4AYBB 1PYWD 3A5UA 4G7HC 1PMRA 4BS9A 1G291 4B3SQ 2F0HA 1BO0A 4RAUC 1FVIA 5ELOA 5J39A 2JA6G 4DAVA 2PZUA 2B8GA 5M5WH 4POFA 3MFYA 2VS1A 4C56C 3V2TA 2NVTH 3NTHA 2OEOA 1EL0A 1SNQA 1II3A 1SYEA 3K5MA 1K0RA 2MO0A 3JC66 3PF5A 5IIFA 4B9WA 3I73A 1WTXA 4LFAL 4DUZQ 2EYMA 1BBXC 1X9NA 3H0GB 4A93H 3NEMA 4ID6A 4C1NI 2B2WA 4KHVA 3M4OB 1NMGA 5EKIA 2ZTDA 2WV6D 4XQJA 1Q12A 1V1QA 1X3EA 2R92G 4X3SA 4C1NK 4UAIA 4JI0L 4LF9Q 2R93H 3S1NH 4S3SA 1BNZA 1K83H 4IN3A 1HCZA 1EWCA 1JC7A 3LWUA 4P71A 2RHSB 5M3FG 4XTCS 5COYA 2GA4B 3J81E 2MQHA 4RH6A 1B9NA 2F4IA 2R7FA 1UUPA 1SE3A 2K50A 1M90C 1CFMA 2ZXPA 1GUTA 4AYBG 4LAAA 1U5KA 2LY7A 5LHY1 2LS01 4F8MA 4HJ8A 1SR3A 2R61A 1XJVA 1WOCA 4JK1C 2NZHA 2AWOA 1UEAB 3ULJA 2IW3A 3M85A 2CQAA 1CA5A 4TRDA 3GV6A 1O78A 1PYSB 3SK4A 4YY3Q 1C9OA 4B3ML 4DR6L 5M3MH 1IBKL 4A3KB 3NE5B 4EQNA 2K05A 2SNMA 2OTLA 4HJ9A 5JPNC 1IW7D 3GTMB 3J7A5 3H0GG 4A3CG 3TBIB 1G91A 1VF5C 1O7YA 2RCFA 4J8QA 4OGQC 1CQFA 5FLXE 1AZPA 3UE1A 3QB3A 4FXGC 1V9PA 2RDGA 1V43A 1D2BA 2IL8A 4ZQ3A 3I4LA 3MTSA 1HUNA 1STHA 1IBMQ 5HY6A 2MJ8A 1EY9A 3OIQA 4DNRB 1A2TA 3F2UA 4DV4L 4FVMA 4BA2I 5FO9B 1K0SA 2R7ZB 2J4XA 1HNWQ 4ZCKA 5EPLA 1BCPF 3S1RH 1XNQL 2EE1A 3UDXA 1VQPA 2CCZA 1VQFA 1G2SA 2L0CA 1YNNC 4ZRZA 3HOUH 4XQNA 4ODGA 2MFIA 2NVXH 3IKJA 1WTOA 3HFZB 1PV4A 3EIVA 4XYOA 2Z8LA 3KK7A 3JAME 2WB1B 4A3JB 4A3FB 1B44D 1C4QA 1DXMA 2PQEA 4ALPA 2M9VA 2JEBI 5DLQE 2PMZB 4TKOB 3C46A 1QJOA 4IOAA 1RDPD 2KENA 4JI2Q 4A3KG 2UUAL 4DPGA 4C2MB 5ELEA 3TN2A 4QCLA 1LTAD 4RKBA 3T1HQ 1O7IA 2WAQG 1SEBD 1GD7A 4C3JH 3DMUA 2XRQD 5CV8A 1VQ9A 4OHJA 1YHAA 1GUOA 3NXWA 1K83B 1KHIA 1SNDA 3FKIB 1EUJA 1V1PB 1BVSA 1EIGA 2B2YA 4O1NA 3D4DA 1TU2B 4P73A 4BBRB 2IY5B 2A69D 1S5DD 4GN5A 4LUVA 1EY0A 3KF6B 5FO8B 2PI2A 3G4SA 3ER0A 1VQDA 3HOVH 2ALYB 2K4KA 2R7ZG 4KI0A 2JK8A 1HQMC 2Z6KC 1JICA 4KHPQ 3GTLB 3CU7A 1PTOF 5AFWA 5IYDG 2XWBB 1DZ1A 3GTGH 1F2LA 3C1EA 1EOTA 1HZBA 1FL0A 1CM9A 3J81L 5C3EH 2WB1G 4A3JG 3KJPA 4A3FG 1JT8A 5JJZA 1JOKA 1EQTA 1FR3A 2F0JA 2HHHL 3SGIA 3J80c 2DJGC 4HIKA 4CDFC 1NBWA 2PNRC 1EFWA 1VF7A 1GOZA 2EQSA 3P75A 3VDYA 4DAPA 5LMUQ 2RF4A 3LGJA 4IJLA 1OXVA 4DAYA 1FGBD 1CSPA 4DV6Q 4DV5Q 1GUGA 2PQAA 1TWAB 1SNCA 1AP0A 4DR4L 5K5PA 2O5IC 1W3SA 4M1UB 3S16B 2OQKA 5C0XH 1YZ6A 3FKIG 1T5EA 4UP7A 1KTKA 3NSWA 2Z6KA 3I4OA 4BBRG 1AEXA 5IYBH 4A3DB 3D0FA 1AE3A 5FLXL 1GJXA 2BA0A 3I4MH 4MTNA 1Q8KA 3V05A 2F0LA 4QJFA 4DR2L 1STBA 1K3RA 1GHJA 3J7YW 1PFNA 1TY0A 2BDOA 2L5TA 2C35B 4I7AA 1LM0A 1HPCA 4IO9A 2XN9C 1QCBD 1Q81C 1CZWA 5GROA 1VQAA 4B3SL 2Q2UA 3HGBA 4FF4A 4HAEA 2SEBD 1PRTC 2KCNA 1B4OA 2E5LQ 3AMUA 4FYDA 1DD2A 1WD1A 3P7JA 2EIFA 2PNHA 3JAML 1CKNB 1NCVA 4RWSC 3QR8A 3KF8B 1SMYC 3HKZE 1HNZQ 3NQTA 4ME5A 1EYAA 1EYDA 3M7GA 4DUYL 2F0SA 5C44H 2K5HA 3DEOA 1U4MA 2AQ2B 2QDBA 2FJ2A 1VQLA 1CUKA 3PUZA 1BOSA 4Q5VA 4A3DG 2K5VA 3A8IE 1H9SB 1D5ZC 1WTQA 4UY8C 1SYGA 1X32A 2OQ0A 5D65A 2Q8RE 4A3LG 3U9OA 1F2ZA 1O7ZA 3CP0A 4QUFA 1YHQA 3NWSA 1Y1WB 4KLKA 4KKTA 1ZYRC 2MGSA 1SNOA 3M3YB 2L4NA 4LF7L 4GKKQ 1BBUA 3FP9A 3FVQA 4QF4A 2EYOA 2KUMA 1IYUA 1KNAA 4IPDA 3GTQB 2B8FA 2B2VA 4OWXB 1EWHA 4L5TA 1I3QH 3GTJH 3I7FA 3MEHA 3I4NB 3L9AX 4H13C 1JORA 2KJXA 3HEJA 4LFBQ 4KV6A 4FDBA 1K28A 2JA9A 4DR7Q 1VDZA 1STNA 4HCSA 3DHQA 4PZ7A 3J81i 1HJPA 2XWJB 1XMOQ 4DR5Q 4J6HA 1PH4A 3S1QB 3H09A 3FRPB 1N34L 1PRTD 2DY7A 3A55A 2K75A 3QWNA 1EY4A 3TS2A 5FO7B 1F9PA 1LLRD 4A4IA 3MC0B 3W3AA 2HDMA 4H02A 3H3VI 1SMYD 1BUVT 3CMEA 2CVRA 3AU7A 1BR9A 1EQVA 4K0KL 4IFDH 4MIUA 3ULPA 1Y1WG 1IKLA 1LO5D 3J7AV 1STAA 3E6ZX 1RD9D 1TS3A 3PCOB 4NXML 2OTJA 1PZID 3I70A 4XT3B 5J3BA 3HZXA 5ISRA 5IT9E 3PUXA 4JI8L 2NZ1D 4JYAL 1I50B 1OXUA 1STYA 5KYIA 3L2PA 2JN4A 5DNFA 4NXNL 1X54A 2RDFA 3L3OC 1HFGA 3PO3H 2A5HA 1R9TH 1PH8A 4LW1A 3I4NG 3S1MB 3MFGA 2K5WA 5C6AA 4L5SA 2JJQA 3DEPA 1XNRQ 1K8MA 4JBMA 4GLXA 1HA5A 1LT3D 1TWGH 1JWUD 3OYYA 3D4WA 2KQ3A 3UDFA 1JJ2A 1Z47A 2QEXA 1KNEA 5M5YB 1BDOA 1DOMA 5I6WA 3T1HL 3OTOL 4L8JA 4N9TA 2I0QA 4UP9A 4JI1Q 3RLNA 4EGVA 3I8ZA 3I72A 4TQUS 3SK8A 2V4DA 4L5RC 1MJEA 2CH4A 1IXRA 3JAMi 5CV7A 5BN4A 1E1TA 4U673 2IHFA 2LKVA 4B3RL 5HURA 1N36L 4A3BB 3NP8A 2YTYA 4ZAIA 5JJIA 3P20A 3MEFA 1WCMB 2D5DA 4A76A 1LACA 2G9HD 4KD4A 2K52A 3AFQA 4L5QA 4IOCA 3RN5A 2AMCB 4BXXH 4ZUIA 1PZKD 3EVQA 3A0JA 4LF4L 2E75C 1QNKA 4DV7L 1YEZA 3BDOA 3ULLA 4YWKA 1SLJA 3BZKA 1SN8A 2F0QA 2NBFA 3K0YA 2DN8A 1PRTB 2Q8TA 4YHHL 3KJOA 3BYYB 2I5MX 3SE0A 2OCEA 2NN6G 3UE0A 4XYQA 1UNSA 1SRUA 1CK1A 1QVCA 1ZEQX 2N49A 1E2VA 4RGNA 5IGEA 4JG2A 3D31A 1TWHB 2WACA 3CRLC 3Q8DA 1PDQA 1E2WA 4KY6A 2E2JH 4DR3L 1AH9A 4K8IA 1EZ6A 1CT1D 1ILQA 4JI7Q 3H3VC 4DR1Q 1M8AA 1PA6A 1I5FA 2P5ZX 3KYHC 3LNNA 2JA8H 1C0AA 3R8BA 2E2IB 2FMCA 3ND8A 3KLSA 1XTCD 3KDFB 5FKAC 4NB3A 3BZCA 5LL6X 4BBSB 4RGMA 4YIJA 4CDDC 4HTHA 3L7ZC 3N6RA 4CDEC 4A3BG 2F0VA 5KGUA 4IPGA 2ICEC 1WCMG 2UUBL 3HOZH 1HZ9A 4X62L 1JCKB 3CCJA 3OW2A 2NB0A 4LF6Q 3TP5A 3HKZG 3OOCA 3HOXB 2VQEQ 1TKWB 2F52A 2OWOA 1JR0D 1NAPA 4CJ0B 1E0BA 2EOTA 1HR0Q 3TEHB 2KCCA 2QW7A 1ESFA 2TMPA 5AJ3Q 5IT9L 4IUNA 1TWGB 5GADC 5CORA 4YWLA 4X64Q 1KABA 4QL5A 1QVFA 2Z0SA 4K6DA 1EQQA 1I94L 3T1YL 4OO1H 5JJKA 4K14A 4PMBA 3TZDA 2UU9L 3SXHA 3D6WA 5CC4A 2PW7A 1DOLA 2WB1E 1HNZL 4DV0Q 2MPMA 1B8AA 2JYOA 4C3HB 2JA7H 4YWMA 3CCMA 1ONLA 2IT1A 2RA4A 1FYCA 5CV6A 4WFN3 1VQ7A 3I3CA 4IQZA 4R4CA 4BY7B 4A3MH 4ABNA 2FFKB 1ZXTA 5JAVA 1PH6A 2K1BA 4BBSG 1PTOH 3GTPB 5IGFA 2F0FA 3N52A 5EPKA 2VUMH 2EYFA 2BE5C 3SK5A 1I4PA 2BA1A 3TS0A 3B6YA 4A3IH 1EOVA 3HOXG 2LXJA 5BR8Q 3F2DA 1Q3LA 3OMGA 2ZJPA 2R3ZA 2G9DA 4DV3L 5E4XA 1IW7C 1DCZA 2N78A 1C7YA 2Z9HA 1WTWA 4H44C 1HR0W 2E74C 2IX0A 5I6YA 1SNPA 4AQYQ 3A54A 3STBD 1V1OA 1QILA 4JI3L 4DV2Q 1V1PA 2NVYH 2WFWA 4QY7A 3SDZA 4N8X1 5I9PA 4LF5Q 1EY8A 5L37A 1RL2A 3PGZA 3KF6A 3PO2B 2HUGA 4NDXA 5IP9G 1SYCA 5C4JH 2VNUD 5C4XB 3T4AC 4C3HG 4DK6C 2JQOA 1XMOL 4MN3A 4DR5L 1ICWA 1NMFA 2N8NA 4RCOA 4DA2A 5GAHC 4BY7G 4ZKBB 3QOLA 5C0XI 3FEWX 3S24A 4NP5A 1SYBA 4HIDA 5M5XH 4LFCQ 1H9RA 1J5EQ 1JE5A 3HG9A 1VQGA 3W1GA 1E2ZA 5IYCG 3BVMA 2AWNA 2PPBC 3S15H 4DV1L 1EU4A 2F3WA 1OXXK 3UDGA 2HT1A 5E7NA 5FLMG 5K36G 1GHKA 1XXGA 4ZK9B 1YIJA 4QMGA 3VR2A 2CWAA 3PIPA 3DLLA 1SNMA 4HSVA 3I2ZA 1JMCA 1S5FD 4OIJA 1D1KA 1KRTA 2YU9H 4IPHA 1YNXA 3S2DH 2JA5H 2K04A 3TQYA 5KNDA 2G5DA 5CGKA 4OX9L 5FLXc 1VQMA 2BE5D 1N33Q 2Q2IA 3J7ZC 1D6EC 5JEAH 5LMNQ 3D3RA 5EBCA 4DK1A 1QUQB 2A69C 4HIOA 3PO2G 2AUKA 4X3KA 1KRSA 2NN6I 1Y1VB 4BY1H 5C4XG 5EKKA 4Y7NH 3K58A 3WOFA 1I4HA 2NUCA 3GTKH 2OT2A 4JI4Q 3RZOB 3U50C 3MXGA 3NELA 4A3EH 2NVQH 1K8GA 3HOYB 2H1EA 2Q2HA 1LT5D 2AKWB 1GUNA 2PZTA 2VB3X 3CCSA 1N32Q 2DJFC 1KDCA 3TSSA 4X66Q 3VYTA 1IKMA 5I2YA 2A6ED 2UUCQ 2ZM6Q 4DKAC 1ILPA 2JEAI 1CKNA 5M5WB 3KF8A 5C4HA 4G7OC 3KLSX 1NNXA 2NVTB 3CPWA 4FF2A 1ENCA 1QZGA 2ES2A 1VQKA 1IBLL 3S17H 3HRZC 2M00A 2F0TA 4HMIA 1Y8NB 4FF3A 1XPUA 5LMNW 3QG1A 1SFOH 3U9SA 1B9MA 4A93B 1I6VC 3W5OA 1Y1VG 4KY7A 4JI6Q 1Z7TA 1HA6A 1HNXQ 3MXPA 3KFUA 2R93B 3S1NB 1ZKOA 3AB9A 3ITPA 2CQOA 4GNXB 3DM3A 4GKJQ 3CPFA 3HOYG 1FJGL 4A3GH 1I4GA 4V0BA 3CQZH 2F0KA 5IOCA 2YYZA 3NENA 1QZHA 4IALA 1A3TA 1BQQT 4MHEA 2KCTA 4WJ4A 1TS5A 3VYUA 1RIPA 3FMCA 3BYTB 4XQQA 2NYZD 1VQ6A 2DUDA 1G6ZA 3FPPA 1GUSA 2LMCB 3PSIA 4K2LA 4ZLTF 5CBEE 2UXBQ 2D9UA 1ICFB 1QNUA 1VQJA 3RZDH 4RMFA 1MJCA 2F3IA 2K5DA 3HOWH 3E5SA 4HR7B 5I4DA 3WDNA 1LTBD 1TWFH 3PMFA 1VQ8A 5G3LF 1CTMA 1SE2A 2B3GA 2JSOA 3K80C 2NZOA 1NTGA 3GDEA 3PF4A 3EQLC 3SR1A 3Q24A 5M3MB 2ZTCA 3PUWA 1UWVA 4RFBA 2A6HC 3A56A 2D2CC 5BN3A 2B2TC 4RGOS 4A93G 3W2DA 3K7AH 3MVVA 1PH5A 2HQEA 1MD2D 5KYLA 5ELDA 2PO4A 4ZUJA 2R93G 3A5ZB 3I90A 2UXCQ 3FHWA 2L1BA 1LT4D 1M4VA 1A63A 1VQOA 2KEDA 4O0AA 3DWAA 5FJ8H 1S5ED 4LJZC 4B3TL 1D7QA 1L1OC 3P1HA 1EY6A 2MO1A 3H94A 2EJMA 5BN5A 2QILA 4RHSA 2EYLA 2B63H 3RUZA 3S1RB 2JXMB 3J80E 1OTCA 3CC4A 4JI5Q 3HOUB 2ID0A 3PIP3 2NVXB 3DWQA 2B2TA 5DAUA 1IL2A 4ILWA 5IP7H 1B2TA 2BOSA 2SDFA 2VQFQ 4LF8Q 2K14A 1S4ZA 1MI2A 5EPJA 5FK9C 3A74A 1VQBA 1JOOA 3R2IA 1XTDA 1TT2A 5M3MG 3K5OA 1G51A 1PXUA 4AQYL 3M4YA 1X56A 2EY2A 4C3JB 3NQIA 4BA1I 4C3IH 1B3AA 3BS1A 2RDHA 1FGUA 4QQBX 1KL9A 3NTIA 2K28A 2QDLA 4RKLA 4DFAA 4GZYC 4X3TA 4DUZL 1KIXA 4POGA 4BWGB 1JJCB 3NK9A 2Z4HA 3GD7A 4KKSA 2A6HD 2HCCA 1F2YA 2E76C 1XYIA 3S2HH 1B50A 3HOVB 5GAEC 3GTOH 4LF9L 4OELB 3CHBD 2XTIA 2DNEA 1HTPA 3MWYW 5EAYA 3EN2A 2NWGA 1GXDC 1STGA 2B2UC 4ME3A 1MHWC 1LTSD 4XIGS 3GTGB 1W2BA 3HOUG 5DM73 3MZ5A 1RODA 3PIOA 1EEID 4X65Q 5C3EB 1LYLA 4R8IA 3AEVA 2F3VA 1DJRD 3VR5A 5DEHA 1PFSA 1Q90A 3E3XA 5CYUA 3BZDB 1RTOA 1CSQA 1IHZA 2OF1A 2J0TD 4PV1C 4LNQA 3F1ZA 1BF4A 4K6LA 3RLFA 4FP5D 4C3JG 3GO5A 2F4VQ 1VS0A 5D14A 2L11A 3T51B 1L0XB 5LMNL 2EJFC 1UE5A 4YY3L 3MAQA 1TWCH 2IPKD 4LMQD 4EX5A 5F2DA 1VQ5A 4MTKA 2F03A 4HN7A 4HCEA 1EYCA 2F0DA 4UPAA 1A0IA 4JPBW 1EU3A 3FDTA 3ERQA 1I6HH 4LFAQ 5A2QE 3K7UC 1JOQA 5IT9c 3HOVG 3KLRA 4I65A 3I4MB 1WYDA 1J9OA 1IBML 4U68A 1YBYA 1KD1C 2XGTA 1U0LA 2CH4W 3BVZA 2N55A 4JI0Q 4P2CB 5IGBA 1NR2A 4OIKA 3KBGA 1HNWL 3CCRA 2Z6BA 1EIFA 4F87A 2HIXA 5C3EG 4UHVA 1K8OA 1YNJD 4HJAA 4R8NA 2QEJC 5CR3A 3PV0A 3AQQA 2K7VA 2PQAB 3J80L 1CHQD 2KOLA 5D3IB 1Z9FA 4PMCA 3VR3A 1JB3A 4B9XA 1KLGD 2EPBA 1EWIA 4KK7A 5H1SE 1Q86C 3S14H 3K8AA 4GLVB 4KJOA 1D5MC 2VXWA 4YCUA 1OXTA 4XDXA 1XPRA 1GKHA 5J1ZA 4JI2L 4I7ZC 5C44B 1UE7A 1X55A 5C0XG 2F0MA 2Z4IA 3CC2A 3K5NA 2IHEA 2BH2A 5EJWA 2JA6H 4G7ZC 4B3MQ 4KHZA 4DU9A 5IYBG 1AE2A 1IBKQ
chains in the Genus database with same CATH topology
4DV2L 2VY3A 3UDXA 1VQPA 2CCZA 2WP8J 1VQFA 4LF5L 1I50H 2VUMH 2YTVA 1VQHA 3HOUH 4APVA 1GO3E 2NVXH 2MFIA 1L1OB 2EXDA 4A3EG 1Q7YC 3I4MG 2BA1A 3HFZB 1PV4A 3I55A 3EIVA 2I5HA 1J6QA 1HH2P 3TS0A 1I94Q 3T1YQ 1VCIA 4HJ7A 3B6YA 1TXYA 4A3IH 3S1MH 1EOVA 2UU9Q 3HOXG 2LXJA 3M4PA 5BR8Q 3F2DA 4HIMA 2N3SA 4ALPA 1VQNA 2ZJPA 2JEBI 5DLQE 4DV3L 4IOAA 2VL6A 2LXKA 2N78A 1C7YA 2A1AA 3WWVA 4LFCL 2KENA 1J5EL 1HR0W 4JI2Q 4A3KG 2UUAL 2IX0A 4DPGA 3CCQA 3G71A 4DV4Q 2R92H 4KHPL 5M5YH 2AHOB 3T1HQ 4AQYQ 1K8AC 1O7IA 2WAQG 5IWAL 2L15A 1GD7A 4C3JH 3STBD 1UE1A 1VQ9A 4JI3L 1XNQQ 4DV2Q 2NVYH 2WFWA 4QY7A 1PH7A 2E2HH 2R7ZG 1YHAA 4LF5Q 1KXLA 3ZJYC 4PZ6A 1RL2A 3PGZA 3KF6A 1KHIA 1L0WA 5M3FH 1EUJA 5IP9G 5C4JH 2VNUD 1BVSA 4AIMA 2H5XA 4P73A 2IY5B 1SMXA 1VQIA 4GS3A 4DK6C 4GN5A 4LUVA 3KF6B 2JQOA 1XMOL 4YCVA 5LMUL 2PI2A 4DR5L 4A3BH 5C44G 3E9HA 2N8NA 1NMFA 4BY7G 5GAHC 3G4SA 3ER0A 1VQDA 5C0XI 1WCMH 4DV3Q 2ALYB 2CKZB 2K4KA 1LTLA 3EBEA 4KI0A 4OWWB 1N33L 3S24A 4DV6L 3W1BA 1WJJA 4HIDA 3PUVA 5M5XH 4DV5L 3KDFA 1YJWA 4LFCQ 2UXDQ 1G6PA 1J5EQ 1JE5A 2JK8A 2UUAQ 1VQGA 2Z6KC 3M4QA 4KHPQ 3W1GA 1CKMA 5IYCG 4OO1I 1E22A 4EQ5A 2AWNA 5IYDG 3CCLA 3GTGH 3S15H 2UXCL 3KLWA 4R4IA 4DV1L 1HZBA 1H95A 1OXXK 1FL0A 3UDGA 2HT1A 4A3GG 4JI3Q 5E7NA 5FLMG 5K36G 5C3EH 2WB1G 4A3JG 3KJPA 4A3FG 1YIJA 1JT8A 1EQRA 2KCMA 4LUZA 4JV5L 4JI4L 2CWAA 1SE8A 3PIPA 4JOIC 3SGIA 2HHHL 3J80c 3DLLA 3I2ZA 4HIKA 3H0GH 4JCVE 1JMCA 4A3CH 1KRTA 1NBWA 2YU9H 4IPHA 1YNXA 1EFWA 3S2DH 3CD6A 2EQSA 3RLOA 3VDYA 2JA5H 3STBC 3M4OH 3TQYA 1TWHH 3TRZA 5LMUQ 1KAWA 2R6GA 2RF4A 3LGJA 4DK3C 4OX9L 5FLXc 4IJLA 1OXVA 1VQMA 2ZJQA 1QUQA 1N32L 1N33Q 2Q2IA 4JBWA 3IRBA 1CSPA 4DV6Q 4TVAB 1KQSA 4QIWE 3J7ZC 3HOWG 4DV5Q 1YHBA 2PQAA 4X66L 2KHIA 5LMNQ 4DAYB 1QUQB 4DR4L 4GN3B 1A62A 2UUCL 1W3SA 2ZM6L 2E2IH 2OQKA 4HIOA 2LSSA 1IBKQ 4LF8L 1YZ6A 3PO2G 4DV1Q 1KRSA 1OXSC 3FKIG 2NN6I 4LWCA 4BY1H 4UP7A 1SROA 3TREA 4Y7NH 4BBSH 5C4XG 2Z6KA 2GVAA 1LUZA 3I4OA 4BBRG 5IYBH 2E5LL 3D0FA 1VQ4A 3GTKH 2QGQA 1GVPA 1P8LA 4JBJA 1AE3A 4JI4Q 3U50C 2BA0A 3NELA 1E24A 4AH6A 3J80i 4IPCA 4A3EH 2NVQH 1K8GA 3I4MH 2Q2HA 1Q8KA 4MTNA 2AKWB 2KHJA 4QJFA 2HIVA 4DR2L 4JOIA 4OX9Q 1K3RA 3CCSA 2D0PA 3HOXH 4GNXC 1N32Q 4WJ3M 1YI2A 1EYGA 4X6AH 4X66Q 4IFDG 1PH3A 4JI6L 2C35B 1LM0A 1S40A 3E0EA 4DR6Q 2DGYA 5FJ8G 4IO9A 4DR4Q 1Q81C 2UUCQ 1HZAA 4DKAC 2ZM6Q 4A3KH 5GROA 1VQAA 3F2CA 3RNUA 4B3SL 1WFQA 1HNXL 2Q2UA 1PHJA 4DAMA 1E3PA 2CWPA 2JEAI 3H15A 3GTMH 4AYBE 3G48A 1CKNA 4P74A 2FXQA 3BJUA 2B63G 4GKJL 2E5LQ 3RN2A 2EIFA 1VQEA 3H3VH 3CPWA 2PNHA 1CKNB 3ERSX 3K0XA 3KF8B 1QZGA 2ES2A 1VQKA 1T9HA 1HNZQ 3HKZE 5IE8A 5IP9H 1IBLL 3S17H 4GKKL 3PO3G 3M7NA 4C3HH 4DR2Q 5GAGC 4IJHA 1N8RC 2YV5A 4DUYL 2R7DA 1XPUA 1M1KC 3AYHB 5IP7G 5LMNW 1PH9A 1SFOH 4GOPC 1BBWA 3E9IA 2K5HA 5C44H 1NJIC 4BY7H 1YJNA 2UXBL 2R7ZH 1VQLA 3W5OA 1Y1VG 1CUKA 1NE3A 3PUZA 4JI6Q 3KOJA 3F2BA 4DNIA 2HQLA 2JE6I 4GNXA 4A3DG 2K5VA 3GTPH 2E8GA 4UY8C 5IYCH 3U58A 2OQ0A 3CMAA 1HNXQ 3KFUA 2GN5A 4LFBL 1B70B 5IYDH 1S3OA 4GNXB 2CQOA 3CF5A 2F4VL 2QA4A 4HJ5A 3DM3A 1E7ZA 1XMQL 4A3LG 4GKJQ 3CPFA 1Q82C 3HOYG 1FJGL 3ICEA 4A3GH 3CP0A 3J81c 5FLMH 1YHQA 2ATWA 3CQZH 4DR7L 4KLKA 4A3JH 4A3FH 1XNQL 2YYZA 3NENA 4PMWA 1QZHA 1PH1A 3I56A 4LF7L 2KCTA 4WJ4A 1IBLQ 2Y0SE 4GKKQ 1B7YB 4R4OA 1BBUA 1RIPA 3FP9A 3UDIA 3HOVH 4DUYQ 2D0OA 1VQ6A 2DUDA 2IX1A 3RR5A 4C2MH 3PSIA 4IPDA 5IWAQ 2UXBQ 1VQJA 3RZDH 4A75A 1Q1EA 4RMFA 1MJCA 2F3IA 4OWXB 5HGQA 3HOWH 4L5TA 4BXXG 1I3QH 2K5NA 3I7FA 3GTJH 4GOPA 1JB7A 4O2DA 1GM5A 1K73C 1MKHA 1TWFH 2A19A 1JJGA 4GN4B 1VQ8A 4LFBQ 2B3GA 3J81j 1YITA 4GOPB 3K80C 3PO2H 3FKIH 2NZOA 4FDBA 4NPSA 1NTGA 3GDEA 1FJGQ 5C4XH 3PF4A 2JA9A 1Q46A 2GVBA 4DR7Q 4R4TA 2RCNA 2ZTCA 4PZ7A 4BBRH 3PUWA 1UWVA 1HJPA 3J81i 1XMOQ 1PYBA 4DR5Q 1PH4A 4JI5L 4LF7Q 4P72A 2RHQB 3G6EA 1N34L 4A93G 2K75A 1DGSA 1X6OA 3K7AH 1D8LA 3TS2A 1K9MC 3BU2A 3K81C 1PH5A 4A4IA 2WAQE 1X65A 2YTXA 3CXCA 4H02A 3L0OA 3H3VI 3GTLH 3CMEA 4GLAC 2VQFL 1XNRL 2R93G 3CCUA 3A5ZB 2UXCQ 2ZJRA 4OONA 3FHWA 4K0KL 1A63A 1VQOA 1VQCA 1ASZA 2JA8G 3ULPA 2Q2TA 4O0AA 5FJ8H 1Y1WG 4JBKA 4B3TL 1D7QA 1UE6A 2VW9A 1L1OC 4JV5Q 2HHHQ 2MO1A 3PCOB 4NXML 2OTJA 2B63H 4R1JA 5J3BA 1Q1BA 4JI1L 3PUXA 4JC0A 4JI8L 1E1OA 4MNOA 1OTCA 3CC4A 4JYAL 1XPOA 1OXUA 4JI5Q 3JAMc 1S72A 3L2PA 2ID0A 1N34Q 4NXNL 3HOZG 1X54A 3AFPA 3U4ZA 3PO3H 5ELNA 1R9TH 1PH8A 1TWAH 4LW1A 3I4NG 1QVGA 1IL2A 4L5SA 5IP7H 4QGUA 4OWTB 2JJQA 5IY0A 2VQFQ 4LF8Q 1XNRQ 3S16H 2K14A 1NY4A 5JEAJ 1HZCA 4RG1A 3CC7A 4GLXA 4JBMA 4K0KQ 1TWGH 1Y1VH 3A74A 1VQBA 1XTDA 1Y14B 3OYYA 4P75A 5M3MG 4A3DH 2Y0SG 3UDFA 2PMZE 1WI5A 1G51A 3NBHB 1Z47A 3CCVA 5C0XJ 2QEXA 1JJ2A 4B3TQ 3RZOH 3MXNB 3T1HL 3OTOL 4AQYL 1X56A 3CW2C 4NXMQ 4OXPA 4BA1I 4A3LH 2I0QA 1P16A 4C3IH 3HOYH 4UP9A 4JI1Q 4X65L 4JI8Q 3RLNA 4OO1G 4JYAQ 1PVOA 1FGUA 4QQBX 1KL9A 4TQUS 4R4QA 3U4VA 2ZTEA 2KBNA 3F8TA 4DUZL 1PH2A 1MJEA 3JAMi 1IXRA 1KIXA 4L5RC 4POGA 1JJCB 1E1TA 3PUYA 3GD7A 2IHFA 2V1CC 2JA7G 4B3RL 2MNAA 1L2FA 1N36L 3A5UA 2YTYA 5JJIA 1G291 4A3MG 3MEFA 5GQOA 4B3SQ 3S2HH 5GAEC 4A76A 3GTOH 4LF9L 5ELOA 1FVIA 2K52A 2XTIA 3AFQA 4L5QA 4IOCA 3RN5A 2JA6G 2AMCB 4JI7L 1X3GA 5EAYA 4BXXH 2UXDL 3EN2A 5M5WH 4POFA 4Y52H 2VS1A 4DR1L 1IZ6A 3A0JA 4LF4L 2NVTH 4ME3A 2PI2E 4DV7L 4XIGS 1YEZA 3OTOQ 4NXNQ 2VUMG 1W2BA 3HOUG 3ULLA 4YWKA 1SLJA 3BZKA 2CFMA 2A8VA 3PIOA 4X65Q 1K0RA 1SN8A 1LYLA 4IFDI 2MO0A 3JC66 3PF5A 3AEVA 3KJOA 4YHHL 4A3IG 4LFAL 2I5MX 2BH8A 2OCEA 4DUZQ 1PFSA 2NN6G 3UE0A 1X9NA 4MZ9A 4PZ8A 4A93H 3HKSA 3NEMA 1SRUA 1IYJB 1QVCA 4B3RQ 2N49A 4JG2A 1NMGA 3D31A 1N36Q 2ZTDA 4LF6L 3Q8DA 1Q12A 1V1QA 1X3EA 1CSQA 2R92G 2E2JH 4DR3L 4LNQA 3F1ZA 1AH9A 4JI0L 2VQEL 4LF9Q 2R93H 3RLFA 3S1NH 2F4VQ 3GO5A 1XMQQ 1K83H 1VS0A 4JI7Q 1HR0L 5LMNL 1UE5A 2B29A 4DR1Q 1PA6A 1I5FA 3KYHC 4YY3L 2JA8H 1C0AA 4LF4Q 1TWCH 1Y1WH 1MIUA 4UP8A 4P71A 4DV7Q 4EX5A 5AJ3L 2RHSB 1VQ5A 3KDFB 5M3FG 1N9WA 4XTCS 3M3YH 4NB3A 3BZCA 2MQHA 4UPAA 1YVCA 3CCEA 1A0IA 4X64L 1UEBA 2R7FA 3M9BA 2K50A 3L7ZC 1M90C 1I6HH 2VZAA 4LFAQ 4YHHQ 4LUOA 4A3BG 4AYBG 3K7UC 1U5KA 4IPGA 5IT9c 4HJ8A 3HOVG 1WCMG 1SR3A 2UUBL 3HOZH 3GTQH 1XJVA 1HZ9A 4X62L 3CCJA 4DV0L 1WOCA 3OW2A 1WYDA 2NZHA 1IBML 1EIYB 4LF6Q 1YBYA 1KD1C 2XGTA 1U0LA 3HKZG 2AWOA 3ULJA 3M85A 3I4NH 4DR3Q 4JI0Q 2VQEQ 5JJLA 1YJ9A 2F52A 2OWOA 1PYSB 1HNWL 1HR0Q 3CCRA 3TEHB 1EIFA 4PG3A 2HIXA 5C3EG 4YY3Q 1C9OA 4B3ML 4DR6L 4HJAA 5M3MH 1IBKL 4YCWA 5AJ3Q 3PV0A 3AQQA 2OTLA 2PQAB 4HJ9A 3S1QH 1KC8C 3J7A5 3H0GG 4A3CG 5GADC 4YWLA 4X64Q 1QVFA 4QL5A 2JA5G 1Z9FA 2Z0SA 1EQQA 2ASBA 1I94L 3T1YL 5JJKA 3UE1A 1EWIA 2UU9L 5BR8L 1V9PA 2UUBQ 4J15A 2I5LX 1V43A 4X62Q 5H1SE 2WB1E 1HNZL 4DV0Q 1BKBA 5JEAG 1Q86C 1B8AA 3S14H 3K8AA 2JA7H 4GLVB 1IBMQ 1A8VA 4YWMA 5HY6A 4YCUA 3CCMA 1OXTA 1XPRA 1GKHA 2IT1A 1VQ7A 4JI2L 1UE7A 1X55A 1ASYA 5C0XG 4R4CA 1CKOA 4DV4L 4A3MH 4BA2I 3CC2A 3CAMA 2IHEA 1HNWQ 4BY1G 4IFDJ 1X3FA 1PH6A 2BH2A 4BBSG 2D62A 2JA6H 4B3MQ 4KHZA 5IYBG 1AE2A 3S1RH 1L1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV2 L;  2VY3 A;  3UDX A;  1VQP A;  2CCZ A;  2WP8 J;  1VQF A;  4LF5 L;  1I50 H;  2VUM H;  2YTV A;  1VQH A;  3HOU H;  4APV A;  1GO3 E;  2NVX H;  2MFI A;  1L1O B;  2EXD A;  4A3E G;  1Q7Y C;  3I4M G;  2BA1 A;  3HFZ B;  1PV4 A;  3I55 A;  3EIV A;  2I5H A;  1J6Q A;  1HH2 P;  3TS0 A;  1I94 Q;  3T1Y Q;  1VCI A;  4HJ7 A;  3B6Y A;  1TXY A;  4A3I H;  3S1M H;  1EOV A;  2UU9 Q;  3HOX G;  2LXJ A;  3M4P A;  5BR8 Q;  3F2D A;  4HIM A;  2N3S A;  4ALP A;  1VQN A;  2ZJP A;  2JEB I;  5DLQ E;  4DV3 L;  4IOA A;  2VL6 A;  2LXK A;  2N78 A;  1C7Y A;  2A1A A;  3WWV A;  4LFC L;  2KEN A;  1J5E L;  1HR0 W;  4JI2 Q;  4A3K G;  2UUA L;  2IX0 A;  4DPG A;  3CCQ A;  3G71 A;  4DV4 Q;  2R92 H;  4KHP L;  5M5Y H;  2AHO B;  3T1H Q;  4AQY Q;  1K8A C;  1O7I A;  2WAQ G;  5IWA L;  2L15 A;  1GD7 A;  4C3J H;  3STB D;  1UE1 A;  1VQ9 A;  4JI3 L;  1XNQ Q;  4DV2 Q;  2NVY H;  2WFW A;  4QY7 A;  1PH7 A;  2E2H H;  2R7Z G;  1YHA A;  4LF5 Q;  1KXL A;  3ZJY C;  4PZ6 A;  1RL2 A;  3PGZ A;  3KF6 A;  1KHI A;  1L0W A;  5M3F H;  1EUJ A;  5IP9 G;  5C4J H;  2VNU D;  1BVS A;  4AIM A;  2H5X A;  4P73 A;  2IY5 B;  1SMX A;  1VQI A;  4GS3 A;  4DK6 C;  4GN5 A;  4LUV A;  3KF6 B;  2JQO A;  1XMO L;  4YCV A;  5LMU L;  2PI2 A;  4DR5 L;  4A3B H;  5C44 G;  3E9H A;  2N8N A;  1NMF A;  4BY7 G;  5GAH C;  3G4S A;  3ER0 A;  1VQD A;  5C0X I;  1WCM H;  4DV3 Q;  2ALY B;  2CKZ B;  2K4K A;  1LTL A;  3EBE A;  4KI0 A;  4OWW B;  1N33 L;  3S24 A;  4DV6 L;  3W1B A;  1WJJ A;  4HID A;  3PUV A;  5M5X H;  4DV5 L;  3KDF A;  1YJW A;  4LFC Q;  2UXD Q;  1G6P A;  1J5E Q;  1JE5 A;  2JK8 A;  2UUA Q;  1VQG A;  2Z6K C;  3M4Q A;  4KHP Q;  3W1G A;  1CKM A;  5IYC G;  4OO1 I;  1E22 A;  4EQ5 A;  2AWN A;  5IYD G;  3CCL A;  3GTG H;  3S15 H;  2UXC L;  3KLW A;  4R4I A;  4DV1 L;  1HZB A;  1H95 A;  1OXX K;  1FL0 A;  3UDG A;  2HT1 A;  4A3G G;  4JI3 Q;  5E7N A;  5FLM G;  5K36 G;  5C3E H;  2WB1 G;  4A3J G;  3KJP A;  4A3F G;  1YIJ A;  1JT8 A;  1EQR A;  2KCM A;  4LUZ A;  4JV5 L;  4JI4 L;  2CWA A;  1SE8 A;  3PIP A;  4JOI C;  3SGI A;  2HHH L;  3J80 c;  3DLL A;  3I2Z A;  4HIK A;  3H0G H;  4JCV E;  1JMC A;  4A3C H;  1KRT A;  1NBW A;  2YU9 H;  4IPH A;  1YNX A;  1EFW A;  3S2D H;  3CD6 A;  2EQS A;  3RLO A;  3VDY A;  2JA5 H;  3STB C;  3M4O H;  3TQY A;  1TWH H;  3TRZ A;  5LMU Q;  1KAW A;  2R6G A;  2RF4 A;  3LGJ A;  4DK3 C;  4OX9 L;  5FLX c;  4IJL A;  1OXV A;  1VQM A;  2ZJQ A;  1QUQ A;  1N32 L;  1N33 Q;  2Q2I A;  4JBW A;  3IRB A;  1CSP A;  4DV6 Q;  4TVA B;  1KQS A;  4QIW E;  3J7Z C;  3HOW G;  4DV5 Q;  1YHB A;  2PQA A;  4X66 L;  2KHI A;  5LMN Q;  4DAY B;  1QUQ B;  4DR4 L;  4GN3 B;  1A62 A;  2UUC L;  1W3S A;  2ZM6 L;  2E2I H;  2OQK A;  4HIO A;  2LSS A;  1IBK Q;  4LF8 L;  1YZ6 A;  3PO2 G;  4DV1 Q;  1KRS A;  1OXS C;  3FKI G;  2NN6 I;  4LWC A;  4BY1 H;  4UP7 A;  1SRO A;  3TRE A;  4Y7N H;  4BBS H;  5C4X G;  2Z6K A;  2GVA A;  1LUZ A;  3I4O A;  4BBR G;  5IYB H;  2E5L L;  3D0F A;  1VQ4 A;  3GTK H;  2QGQ A;  1GVP A;  1P8L A;  4JBJ A;  1AE3 A;  4JI4 Q;  3U50 C;  2BA0 A;  3NEL A;  1E24 A;  4AH6 A;  3J80 i;  4IPC A;  4A3E H;  2NVQ H;  1K8G A;  3I4M H;  2Q2H A;  1Q8K A;  4MTN A;  2AKW B;  2KHJ A;  4QJF A;  2HIV A;  4DR2 L;  4JOI A;  4OX9 Q;  1K3R A;  3CCS A;  2D0P A;  3HOX H;  4GNX C;  1N32 Q;  4WJ3 M;  1YI2 A;  1EYG A;  4X6A H;  4X66 Q;  4IFD G;  1PH3 A;  4JI6 L;  2C35 B;  1LM0 A;  1S40 A;  3E0E A;  4DR6 Q;  2DGY A;  5FJ8 G;  4IO9 A;  4DR4 Q;  1Q81 C;  2UUC Q;  1HZA A;  4DKA C;  2ZM6 Q;  4A3K H;  5GRO A;  1VQA A;  3F2C A;  3RNU A;  4B3S L;  1WFQ A;  1HNX L;  2Q2U A;  1PHJ A;  4DAM A;  1E3P A;  2CWP A;  2JEA I;  3H15 A;  3GTM H;  4AYB E;  3G48 A;  1CKN A;  4P74 A;  2FXQ A;  3BJU A;  2B63 G;  4GKJ L;  2E5L Q;  3RN2 A;  2EIF A;  1VQE A;  3H3V H;  3CPW A;  2PNH A;  1CKN B;  3ERS X;  3K0X A;  3KF8 B;  1QZG A;  2ES2 A;  1VQK A;  1T9H A;  1HNZ Q;  3HKZ E;  5IE8 A;  5IP9 H;  1IBL L;  3S17 H;  4GKK L;  3PO3 G;  3M7N A;  4C3H H;  4DR2 Q;  5GAG C;  4IJH A;  1N8R C;  2YV5 A;  4DUY L;  2R7D A;  1XPU A;  1M1K C;  3AYH B;  5IP7 G;  5LMN W;  1PH9 A;  1SFO H;  4GOP C;  1BBW A;  3E9I A;  2K5H A;  5C44 H;  1NJI C;  4BY7 H;  1YJN A;  2UXB L;  2R7Z H;  1VQL A;  3W5O A;  1Y1V G;  1CUK A;  1NE3 A;  3PUZ A;  4JI6 Q;  3KOJ A;  3F2B A;  4DNI A;  2HQL A;  2JE6 I;  4GNX A;  4A3D G;  2K5V A;  3GTP H;  2E8G A;  4UY8 C;  5IYC H;  3U58 A;  2OQ0 A;  3CMA A;  1HNX Q;  3KFU A;  2GN5 A;  4LFB L;  1B70 B;  5IYD H;  1S3O A;  4GNX B;  2CQO A;  3CF5 A;  2F4V L;  2QA4 A;  4HJ5 A;  3DM3 A;  1E7Z A;  1XMQ L;  4A3L G;  4GKJ Q;  3CPF A;  1Q82 C;  3HOY G;  1FJG L;  3ICE A;  4A3G H;  3CP0 A;  3J81 c;  5FLM H;  1YHQ A;  2ATW A;  3CQZ H;  4DR7 L;  4KLK A;  4A3J H;  4A3F H;  1XNQ L;  2YYZ A;  3NEN A;  4PMW A;  1QZH A;  1PH1 A;  3I56 A;  4LF7 L;  2KCT A;  4WJ4 A;  1IBL Q;  2Y0S E;  4GKK Q;  1B7Y B;  4R4O A;  1BBU A;  1RIP A;  3FP9 A;  3UDI A;  3HOV H;  4DUY Q;  2D0O A;  1VQ6 A;  2DUD A;  2IX1 A;  3RR5 A;  4C2M H;  3PSI A;  4IPD A;  5IWA Q;  2UXB Q;  1VQJ A;  3RZD H;  4A75 A;  1Q1E A;  4RMF A;  1MJC A;  2F3I A;  4OWX B;  5HGQ A;  3HOW H;  4L5T A;  4BXX G;  1I3Q H;  2K5N A;  3I7F A;  3GTJ H;  4GOP A;  1JB7 A;  4O2D A;  1GM5 A;  1K73 C;  1MKH A;  1TWF H;  2A19 A;  1JJG A;  4GN4 B;  1VQ8 A;  4LFB Q;  2B3G A;  3J81 j;  1YIT A;  4GOP B;  3K80 C;  3PO2 H;  3FKI H;  2NZO A;  4FDB A;  4NPS A;  1NTG A;  3GDE A;  1FJG Q;  5C4X H;  3PF4 A;  2JA9 A;  1Q46 A;  2GVB A;  4DR7 Q;  4R4T A;  2RCN A;  2ZTC A;  4PZ7 A;  4BBR H;  3PUW A;  1UWV A;  1HJP A;  3J81 i;  1XMO Q;  1PYB A;  4DR5 Q;  1PH4 A;  4JI5 L;  4LF7 Q;  4P72 A;  2RHQ B;  3G6E A;  1N34 L;  4A93 G;  2K75 A;  1DGS A;  1X6O A;  3K7A H;  1D8L A;  3TS2 A;  1K9M C;  3BU2 A;  3K81 C;  1PH5 A;  4A4I A;  2WAQ E;  1X65 A;  2YTX A;  3CXC A;  4H02 A;  3L0O A;  3H3V I;  3GTL H;  3CME A;  4GLA C;  2VQF L;  1XNR L;  2R93 G;  3CCU A;  3A5Z B;  2UXC Q;  2ZJR A;  4OON A;  3FHW A;  4K0K L;  1A63 A;  1VQO A;  1VQC A;  1ASZ A;  2JA8 G;  3ULP A;  2Q2T A;  4O0A A;  5FJ8 H;  1Y1W G;  4JBK A;  4B3T L;  1D7Q A;  1UE6 A;  2VW9 A;  1L1O C;  4JV5 Q;  2HHH Q;  2MO1 A;  3PCO B;  4NXM L;  2OTJ A;  2B63 H;  4R1J A;  5J3B A;  1Q1B A;  4JI1 L;  3PUX A;  4JC0 A;  4JI8 L;  1E1O A;  4MNO A;  1OTC A;  3CC4 A;  4JYA L;  1XPO A;  1OXU A;  4JI5 Q;  3JAM c;  1S72 A;  3L2P A;  2ID0 A;  1N34 Q;  4NXN L;  3HOZ G;  1X54 A;  3AFP A;  3U4Z A;  3PO3 H;  5ELN A;  1R9T H;  1PH8 A;  1TWA H;  4LW1 A;  3I4N G;  1QVG A;  1IL2 A;  4L5S A;  5IP7 H;  4QGU A;  4OWT B;  2JJQ A;  5IY0 A;  2VQF Q;  4LF8 Q;  1XNR Q;  3S16 H;  2K14 A;  1NY4 A;  5JEA J;  1HZC A;  4RG1 A;  3CC7 A;  4GLX A;  4JBM A;  4K0K Q;  1TWG H;  1Y1V H;  3A74 A;  1VQB A;  1XTD A;  1Y14 B;  3OYY A;  4P75 A;  5M3M G;  4A3D H;  2Y0S G;  3UDF A;  2PMZ E;  1WI5 A;  1G51 A;  3NBH B;  1Z47 A;  3CCV A;  5C0X J;  2QEX A;  1JJ2 A;  4B3T Q;  3RZO H;  3MXN B;  3T1H L;  3OTO L;  4AQY L;  1X56 A;  3CW2 C;  4NXM Q;  4OXP A;  4BA1 I;  4A3L H;  2I0Q A;  1P16 A;  4C3I H;  3HOY H;  4UP9 A;  4JI1 Q;  4X65 L;  4JI8 Q;  3RLN A;  4OO1 G;  4JYA Q;  1PVO A;  1FGU A;  4QQB X;  1KL9 A;  4TQU S;  4R4Q A;  3U4V A;  2ZTE A;  2KBN A;  3F8T A;  4DUZ L;  1PH2 A;  1MJE A;  3JAM i;  1IXR A;  1KIX A;  4L5R C;  4POG A;  1JJC B;  1E1T A;  3PUY A;  3GD7 A;  2IHF A;  2V1C C;  2JA7 G;  4B3R L;  2MNA A;  1L2F A;  1N36 L;  3A5U A;  2YTY A;  5JJI A;  1G29 1;  4A3M G;  3MEF A;  5GQO A;  4B3S Q;  3S2H H;  5GAE C;  4A76 A;  3GTO H;  4LF9 L;  5ELO A;  1FVI A;  2K52 A;  2XTI A;  3AFQ A;  4L5Q A;  4IOC A;  3RN5 A;  2JA6 G;  2AMC B;  4JI7 L;  1X3G A;  5EAY A;  4BXX H;  2UXD L;  3EN2 A;  5M5W H;  4POF A;  4Y52 H;  2VS1 A;  4DR1 L;  1IZ6 A;  3A0J A;  4LF4 L;  2NVT H;  4ME3 A;  2PI2 E;  4DV7 L;  4XIG S;  1YEZ A;  3OTO Q;  4NXN Q;  2VUM G;  1W2B A;  3HOU G;  3ULL A;  4YWK A;  1SLJ A;  3BZK A;  2CFM A;  2A8V A;  3PIO A;  4X65 Q;  1K0R A;  1SN8 A;  1LYL A;  4IFD I;  2MO0 A;  3JC6 6;  3PF5 A;  3AEV A;  3KJO A;  4YHH L;  4A3I G;  4LFA L;  2I5M X;  2BH8 A;  2OCE A;  4DUZ Q;  1PFS A;  2NN6 G;  3UE0 A;  1X9N A;  4MZ9 A;  4PZ8 A;  4A93 H;  3HKS A;  3NEM A;  1SRU A;  1IYJ B;  1QVC A;  4B3R Q;  2N49 A;  4JG2 A;  1NMG A;  3D31 A;  1N36 Q;  2ZTD A;  4LF6 L;  3Q8D A;  1Q12 A;  1V1Q A;  1X3E A;  1CSQ A;  2R92 G;  2E2J H;  4DR3 L;  4LNQ A;  3F1Z A;  1AH9 A;  4JI0 L;  2VQE L;  4LF9 Q;  2R93 H;  3RLF A;  3S1N H;  2F4V Q;  3GO5 A;  1XMQ Q;  1K83 H;  1VS0 A;  4JI7 Q;  1HR0 L;  5LMN L;  1UE5 A;  2B29 A;  4DR1 Q;  1PA6 A;  1I5F A;  3KYH C;  4YY3 L;  2JA8 H;  1C0A A;  4LF4 Q;  1TWC H;  1Y1W H;  1MIU A;  4UP8 A;  4P71 A;  4DV7 Q;  4EX5 A;  5AJ3 L;  2RHS B;  1VQ5 A;  3KDF B;  5M3F G;  1N9W A;  4XTC S;  3M3Y H;  4NB3 A;  3BZC A;  2MQH A;  4UPA A;  1YVC A;  3CCE A;  1A0I A;  4X64 L;  1UEB A;  2R7F A;  3M9B A;  2K50 A;  3L7Z C;  1M90 C;  1I6H H;  2VZA A;  4LFA Q;  4YHH Q;  4LUO A;  4A3B G;  4AYB G;  3K7U C;  1U5K A;  4IPG A;  5IT9 c;  4HJ8 A;  3HOV G;  1WCM G;  1SR3 A;  2UUB L;  3HOZ H;  3GTQ H;  1XJV A;  1HZ9 A;  4X62 L;  3CCJ A;  4DV0 L;  1WOC A;  3OW2 A;  1WYD A;  2NZH A;  1IBM L;  1EIY B;  4LF6 Q;  1YBY A;  1KD1 C;  2XGT A;  1U0L A;  3HKZ G;  2AWO A;  3ULJ A;  3M85 A;  3I4N H;  4DR3 Q;  4JI0 Q;  2VQE Q;  5JJL A;  1YJ9 A;  2F52 A;  2OWO A;  1PYS B;  1HNW L;  1HR0 Q;  3CCR A;  3TEH B;  1EIF A;  4PG3 A;  2HIX A;  5C3E G;  4YY3 Q;  1C9O A;  4B3M L;  4DR6 L;  4HJA A;  5M3M H;  1IBK L;  4YCW A;  5AJ3 Q;  3PV0 A;  3AQQ A;  2OTL A;  2PQA B;  4HJ9 A;  3S1Q H;  1KC8 C;  3J7A 5;  3H0G G;  4A3C G;  5GAD C;  4YWL A;  4X64 Q;  1QVF A;  4QL5 A;  2JA5 G;  1Z9F A;  2Z0S A;  1EQQ A;  2ASB A;  1I94 L;  3T1Y L;  5JJK A;  3UE1 A;  1EWI A;  2UU9 L;  5BR8 L;  1V9P A;  2UUB Q;  4J15 A;  2I5L X;  1V43 A;  4X62 Q;  5H1S E;  2WB1 E;  1HNZ L;  4DV0 Q;  1BKB A;  5JEA G;  1Q86 C;  1B8A A;  3S14 H;  3K8A A;  2JA7 H;  4GLV B;  1IBM Q;  1A8V A;  4YWM A;  5HY6 A;  4YCU A;  3CCM A;  1OXT A;  1XPR A;  1GKH A;  2IT1 A;  1VQ7 A;  4JI2 L;  1UE7 A;  1X55 A;  1ASY A;  5C0X G;  4R4C A;  1CKO A;  4DV4 L;  4A3M H;  4BA2 I;  3CC2 A;  3CAM A;  2IHE A;  1HNW Q;  4BY1 G;  4IFD J;  1X3F A;  1PH6 A;  2BH2 A;  4BBS G;  2D62 A;  2JA6 H;  4B3M Q;  4KHZ A;  5IYB G;  1AE2 A;  3S1R H;  1L1O A; 
#chains in the Genus database with same CATH topology
 2VY3 A;  1V8Q A;  3OWE B;  5CV9 A;  3S2H B;  1U4L A;  3GTO B;  2EXZ A;  2CW0 C;  2YTV A;  3TDQ A;  4APV A;  4JVZ A;  1L1O B;  1I4X A;  2CHB D;  2EXD A;  3I4M G;  4CJ1 B;  2VB2 X;  1J6Q A;  1VCI A;  4HJ7 A;  3M4P A;  4HIM A;  1VQN A;  1ENF A;  2EY1 A;  1O7L A;  1HUM A;  2LXK A;  5T1I A;  3R2T A;  4KN4 C;  3R93 A;  1DON A;  5TSS A;  4EQO A;  3V96 A;  4K5V A;  4DV4 Q;  2R92 H;  4KHP L;  2AHO B;  2QKI C;  4K5X A;  2ZXR A;  2KVM A;  3H6M A;  2F0O A;  3OIP A;  1I3Q B;  3GTJ B;  1XNQ Q;  2E2H H;  1KXL A;  4PZ6 A;  4IUR A;  1BXT A;  3WOE A;  1L0W A;  5M3F H;  4AIM A;  1SMX A;  3OMC A;  4YCV A;  5FOB B;  5LMU L;  5C44 G;  3E9H A;  1AZQ A;  3E0J A;  2CKZ B;  4OWW B;  3EBE A;  2O5J C;  4DV6 L;  3W1B A;  2UXD Q;  4DV5 L;  3KUP A;  1SYF A;  1G6P A;  1G2T A;  2XVS A;  2UUA Q;  1CKM A;  4EQ5 A;  3CCL A;  3K6O A;  1LTI D;  4DF7 A;  2UXC L;  3KLW A;  1Y69 U;  5ELF A;  1R4P B;  4H7B A;  1EQR A;  2EY6 A;  2KCM A;  4LUZ A;  2HCI A;  4JOI C;  5A2Q L;  4RGT A;  1A3V A;  3H0G H;  4JCV E;  4A3C H;  1B53 A;  4OL7 A;  1BCP D;  3A7L A;  3RLO A;  3STB C;  3M4O H;  1Z6H A;  1KAW A;  2CW0 D;  2R6G A;  4DK3 C;  5M9O A;  2ZJQ A;  1QUQ A;  2KHS A;  4JBW A;  3IRB A;  1SE4 A;  4TVA B;  1SAP A;  3PO3 B;  1R9T B;  1C8C A;  1SDF A;  5C3X A;  1AFP A;  3C2P A;  2ENB A;  4GN3 B;  1A62 A;  3S9W A;  1QOH A;  4LF8 L;  3TP8 A;  1OXS C;  4LWC A;  5CMD A;  3K59 A;  4FNF A;  3T13 A;  2I07 B;  2HD3 A;  3A8J E;  1LUZ A;  3C1F A;  2E5L L;  2RBM A;  2NTT A;  1GVP A;  1WTR A;  3Q0A A;  1E24 A;  2FHT A;  3J80 i;  4IPC A;  1B3Q A;  2F0E A;  1KLU D;  2J7Z A;  1RJT A;  2HIV A;  5C5L A;  4JOI A;  4GNX C;  5JVG 3;  4WJ3 M;  5EBD A;  1YI2 A;  2XRS D;  1JQY D;  3MXU A;  1HTL D;  1SSO A;  1PH3 A;  4IFD G;  1CA6 A;  1TS2 A;  3E0E A;  4DR4 Q;  1HZA A;  4A3K H;  3IFT A;  2WII B;  3F2C A;  3RNU A;  1WFQ A;  2KEC A;  1PRT F;  3GTM H;  3H15 A;  3G48 A;  4P74 A;  3BJU A;  2A73 B;  5KEE A;  1U4R A;  3BVG A;  1VQE A;  1DYQ A;  3H3V H;  1PTO D;  3K0X A;  4GKK L;  4JW0 A;  3PO3 G;  3Q22 A;  3M7N A;  1TVX A;  4DR2 Q;  2WKC A;  2XNA C;  2YV5 A;  2B2W C;  3AYH B;  1PH9 A;  1NJI C;  3E9I A;  2R7Z H;  2F1M A;  2NTS A;  3H91 A;  3KOJ A;  4DNI A;  3R3O A;  4GNX A;  2E8G A;  2E2J B;  4CGY B;  1FNU A;  4LFB L;  2F0P A;  1JWM D;  5IYD H;  1EZ8 A;  3TZU A;  2F4V L;  4HJ5 A;  1HHV A;  1Q82 C;  2PYK A;  3VR4 A;  3J81 c;  2JA8 B;  1A3U A;  4DR7 L;  2DY8 A;  4A3J H;  1XWE A;  4A3F H;  5HGT A;  2A6E C;  4PMW A;  1PH1 A;  1BCP B;  1J8I A;  5CV4 A;  1B7Y B;  4KKU A;  1B1Z A;  3UDI A;  3OWF A;  2EYP A;  4DUY Q;  2L12 A;  2D0O A;  2Z1C A;  3DUZ A;  2IX1 A;  3RR5 A;  4C2M H;  1RTN A;  5IWA Q;  3HOZ B;  2EJG C;  4L6T B;  5HGQ A;  5ELB A;  4BXX G;  2F0U A;  1JB7 A;  1GM5 A;  3UI2 A;  1MKH A;  4WJW A;  1K73 C;  4GN4 B;  1CQV A;  5NUC A;  5CBA E;  2M2L A;  3J81 j;  4GOP B;  1YIT A;  3OHX C;  1EY5 A;  3FKI H;  3C3L A;  4R9W A;  2RVL A;  3T53 B;  4R4T A;  2RCN A;  4RA8 A;  4BBR H;  1EFI D;  2Y0S B;  1MBY A;  1L0Y B;  3VYS A;  4DN4 M;  4LF7 Q;  1F9S A;  4P72 A;  2RHQ B;  3G6E A;  1I4Q A;  1LTR D;  1DGS A;  2E2D C;  3ERO A;  3LWE A;  1X6O A;  4DXG A;  1D8L A;  4ZYS A;  1K9M C;  2EDG A;  1X65 A;  3CXC A;  3L0O A;  3GTL H;  2A74 C;  1XNR L;  1S5C D;  3VA5 A;  2ZJR A;  4OON A;  4KMU C;  3DWP A;  2JA7 B;  4IUT A;  1VQC A;  2JA8 G;  1HXY D;  3EJI A;  1CZG A;  3NPP A;  4A3M B;  2VW9 A;  3LX0 A;  4JV5 Q;  1WTP A;  3HP3 A;  4R1J A;  1PTO B;  1Q1B A;  4WRD A;  2RQX A;  4JI1 L;  4JC0 A;  4DK0 A;  1E1O A;  4MNO A;  5IGC A;  1XPO A;  3Q6S A;  2VUM B;  3JAM c;  1S72 A;  2WAQ B;  2XIW A;  1N34 Q;  3HOZ G;  5EGT A;  2TSS A;  4Q0F A;  5LL6 S;  1NR4 A;  5C5M A;  4PQX A;  5ELN A;  1K3B C;  1WD0 A;  1TWA H;  1F2M A;  4A3I B;  5EQ0 A;  4OWT B;  5IY0 A;  3S16 H;  1F77 A;  4K0K Q;  1H9J A;  1Y14 B;  4A3D H;  2Y0S G;  3NWT A;  3NBH B;  1WI5 A;  5C0X J;  2ICI A;  3MXN B;  5T1G A;  4B08 A;  1SYD A;  3CW2 C;  4NXM Q;  4OXP A;  4A3L H;  1P16 A;  1D5X C;  2NVY B;  4KD3 A;  4JI8 Q;  4OO1 G;  2B2Y C;  4JYA Q;  5KNC A;  3SHL A;  3G7L A;  4R4Q A;  1IL8 A;  3D6C A;  2WIN B;  2WKD A;  4NXN Q;  1F9Q A;  2KBN A;  1JWS D;  1PH2 A;  5C4J B;  1H9S A;  3PUY A;  1FD7 D;  3CRK C;  3FPU B;  2JA7 G;  2MP1 A;  4K2K A;  1U9R A;  3OSO A;  1MGS A;  4IUV A;  2C5C A;  1GUW A;  4XT1 B;  1QWY A;  5GQO A;  4A3M G;  5M5X B;  4JI7 L;  1LAB A;  1X3G A;  3SEB A;  3D4R A;  2UXD L;  4Y52 H;  1RKN A;  4DR1 L;  1IZ6 A;  2PI2 E;  2VUM G;  3OTO Q;  2C9O A;  1D1I A;  3S15 B;  5EKL A;  3VYR A;  2CFM A;  2A8V A;  1QE6 A;  5E1F A;  4ULL A;  4IFD I;  4LK1 C;  3IAY A;  3NUC A;  4A3I G;  2KEE A;  2BH8 A;  2PZW A;  4MZ9 A;  4PZ8 A;  2YU9 B;  3HKS A;  3S2D B;  2BDN A;  1IYJ B;  1ET9 A;  4B3R Q;  2JA5 B;  2EVB A;  1N36 Q;  3G6J B;  4HED A;  4LF6 L;  3VA7 A;  1OO9 B;  2VQE L;  1RHP A;  3IFD A;  1XMQ Q;  3DXJ C;  1TII D;  1HR0 L;  1S5B D;  2B29 A;  5IGG A;  4LF4 Q;  1Y1W H;  1MIU A;  4IUP A;  4UP8 A;  4WOR A;  4DV7 Q;  5AJ3 L;  2PCF B;  5JVH 3;  3M3Y H;  1N9W A;  3KBX A;  4BY1 B;  4Y7N B;  1I4R A;  1YVC A;  1SJH D;  4X64 L;  3CCE A;  1UEB A;  5ELC A;  3M9B A;  2VZA A;  3GTK B;  4YHH Q;  4QB4 A;  1DOK A;  4LUO A;  1EEF D;  1RCV D;  3URY A;  2FMM A;  2QCP X;  3GTQ H;  4A3E B;  1W6J A;  2NVQ B;  4DV0 L;  2FIN B;  5C4Z A;  1EIY B;  3DM1 A;  5IOD A;  1YNN D;  4V19 0;  3I4N H;  1G8Z D;  4DR3 Q;  3QOJ A;  5JJL A;  1YJ9 A;  4CJ2 C;  2K32 A;  4EQP A;  1KAA A;  4CBV A;  1LTG D;  4PG3 A;  3J7A F;  4QUC A;  1SBB B;  4YCW A;  1FNW A;  1IYV A;  3S1Q H;  2X69 A;  4K8J A;  3A7A B;  1KC8 C;  3RMH A;  2QF7 A;  2JA5 G;  4FO2 A;  5D3D A;  2HDL A;  2RSN A;  2ASB A;  3SVM A;  2BCO A;  2IX3 A;  3MHB A;  1EIH A;  1W6K A;  3D8G A;  5BR8 L;  2UUB Q;  4J15 A;  2I5L X;  1PLF A;  3BG3 A;  4X62 Q;  3S17 B;  1BKB A;  4DGZ A;  1VMP A;  5JEA G;  4N9P A;  4XXE A;  1A8V A;  4RHR A;  1SFO B;  1HFN A;  1ASY A;  1CKO A;  3CAM A;  1WTV A;  4BY1 G;  4IFD J;  1X3F A;  2D62 A;  1L1O A;  4DV2 L;  2WP8 J;  4LF5 L;  1I50 H;  1VQH A;  1GO3 E;  2MHV A;  4A3E G;  1Q7Y C;  4A3G B;  3I55 A;  2I5H A;  3BDC A;  1HH2 P;  3CQZ B;  2EZV A;  1I94 Q;  3T1Y Q;  4G4K A;  1TXY A;  1U4P A;  3S1M H;  1ML0 D;  1YNJ C;  2AQ3 B;  2UU9 Q;  1CHP D;  2O4X A;  2N3S A;  2NN6 H;  4Z9C B;  1A15 A;  2VL6 A;  4KY5 A;  4NW2 A;  4KJN A;  4X3U A;  3Q23 A;  2A1A A;  5CV5 A;  3WWV A;  2B2V C;  4LFC L;  1J5E L;  3CCQ A;  3G71 A;  5M5Y H;  5DM6 3;  1K8A C;  1MSH A;  5IWA L;  1NUC A;  3RZD B;  2L15 A;  1STE A;  3HOW B;  2O2L D;  1UE1 A;  2H4O A;  2ZT9 C;  4EVO A;  4HMJ A;  1TWF B;  2K03 A;  1PH7 A;  3ZJY C;  2H5X A;  3TME A;  1VQI A;  4GS3 A;  3X3M A;  1PFB A;  4A3B H;  3IL8 A;  4F88 A;  1WCM H;  4DV3 Q;  1N33 L;  1LTL A;  1TS4 A;  3K7A B;  5I2X A;  1WJJ A;  3PUV A;  1YJW A;  3KDF A;  4OO1 I;  3M4Q A;  2KA7 A;  1E22 A;  2I46 A;  4R4I A;  1H95 A;  4A3G G;  1SJE D;  4JI3 Q;  2B2U A;  1QB5 D;  4CKB A;  4JV5 L;  4JI4 L;  5E3F A;  1SE8 A;  3TP6 A;  1Y8O B;  5A35 A;  2B63 B;  3CD6 A;  2L55 A;  4J1M A;  1TWH H;  3TRZ A;  3K5L A;  2AQ1 B;  1Q8I A;  1N32 L;  1Y8P B;  4O42 A;  4L63 B;  1KQS A;  4QIW E;  3HOW G;  3O13 A;  4CKE A;  1YHB A;  4X66 L;  2KHI A;  4IZ8 A;  4F7X A;  4DAY B;  1C48 A;  2EY5 A;  3T16 A;  3VR6 A;  2UUC L;  2ZM6 L;  2E2I H;  2LSS A;  3ZYY X;  4DV1 Q;  3SK6 A;  3TRE A;  1SRO A;  2A68 C;  4BBS H;  2XSC A;  2GVA A;  3K57 A;  5IGD A;  2X6G A;  1VQ4 A;  2QGQ A;  3X3N A;  2JP1 A;  1P8L A;  4JBJ A;  3TP7 A;  4ZKC B;  4AH6 A;  4IUQ A;  1A6X A;  4C3I B;  1VMC A;  1H9K A;  3NHH A;  2KHJ A;  3MA2 B;  4OX9 Q;  5KRU A;  1WVL A;  2D0P A;  3HOX H;  2ZXO A;  1EYG A;  1LV9 A;  3OW7 A;  4X6A H;  4JI6 L;  1KDA A;  2LFN A;  1S40 A;  4DR6 Q;  1ZYR D;  1O80 A;  2DGY A;  5FJ8 G;  1BCP C;  1LT6 D;  1HNX L;  1A2U A;  1PHJ A;  4DAM A;  1E3P A;  1LTT D;  2CWP A;  5JOB A;  4AYB E;  1X3Q A;  2FXQ A;  2B63 G;  4GKJ L;  3QIA A;  3RN2 A;  2F0W A;  4E6I A;  3NBI A;  4RCN A;  3RD4 A;  3ERS X;  1EY7 A;  1T9H A;  5IE8 A;  1MSG A;  5IP9 H;  4FXD A;  5J22 A;  1T5X D;  2F0N A;  4C3H H;  5GAG C;  2EYJ A;  4IJH A;  1N8R C;  2R7D A;  1M1K C;  5IP7 G;  1DM0 B;  1BBW A;  1UAP A;  4GOP C;  1X3P A;  4BY7 H;  1YJN A;  1NSN S;  2UXB L;  3BDL A;  1NE3 A;  3A8K E;  3F2B A;  4IUU A;  2HQL A;  2JE6 I;  3PQI A;  3GTP H;  4HSP A;  5IYC H;  3CMA A;  3U58 A;  2GN5 A;  1B70 B;  1S3O A;  3CF5 A;  1ESR A;  4CHT B;  2QA4 A;  1XMQ L;  1E7Z A;  2SOB A;  4C3I G;  1SXT A;  3ICE A;  3GP7 A;  5FLM H;  2ATW A;  1TR5 A;  1TWC B;  3HKZ B;  1HQR D;  1TQO A;  5K36 H;  2B39 A;  4OEM B;  5KIX A;  3GV3 A;  1RF2 D;  3I56 A;  2OXP A;  2A68 D;  3CKI B;  4H0L C;  1IBL Q;  2RSO A;  2Y0S E;  3NTK A;  3I91 A;  4K5W A;  4R4O A;  3EA6 A;  1I6H B;  1R4Q B;  1ENA A;  1AW7 A;  2X6L A;  4A75 A;  1Q1E A;  2PW5 A;  1PTO C;  1AN8 A;  1TY2 A;  2K5N A;  4GOP A;  4O2D A;  4CDC C;  1JJG A;  2A19 A;  3PO2 H;  4KTA A;  4NPS A;  1FJG Q;  3EFX D;  5C4X H;  2SNS A;  1Q46 A;  2GVB A;  3PIO 3;  5I9O A;  2L9H A;  1PYB A;  4UDU C;  5JPM C;  1F9R A;  4JI5 L;  5E4W C;  2K01 A;  4NKL A;  1FNV A;  3BU2 A;  3K81 C;  4G57 A;  2WAQ E;  2YTX A;  4CKC A;  4FF1 A;  3OPO A;  1WTH A;  4GLA C;  2VQF L;  3CCU A;  3ND9 A;  4M8A A;  3S14 B;  1JE4 A;  1CI3 M;  1ASZ A;  2Q2T A;  4JBK A;  1UE6 A;  3HS0 C;  2HHH Q;  3GQB A;  1ET6 A;  1PFM A;  2JA6 B;  1HRJ A;  4PNY A;  4TSS A;  2EYH A;  2K6A A;  4QIW B;  4NMZ A;  3AFP A;  3U4Z A;  4DNT B;  3T56 B;  5KNB A;  2DNC A;  2AUJ D;  1QVG A;  4QGU A;  1NY4 A;  3NBH A;  5JEA J;  1HZC A;  4RG1 A;  3CC7 A;  4KN7 C;  1Y1V H;  3ONA B;  3MXN A;  4N8F A;  4P75 A;  2K5Q A;  2F0G A;  3QO2 A;  2Q8I B;  2PMZ E;  4B3T Q;  3CCV A;  2R92 B;  3RZO H;  1QG7 A;  1H9M A;  2K33 A;  2RKS A;  3HOY H;  4X65 L;  2E2H B;  1PVO A;  2IJ0 A;  4FXK C;  2MUY A;  3U4V A;  5C3W A;  2N88 A;  5G3L D;  2IWH A;  2ZTE A;  3F8T A;  5M3F B;  1PZJ D;  2V1C C;  4DXF A;  2F0I A;  2MNA A;  1L2F A;  1KDB A;  1XX8 A;  3QJY A;  4AYB B;  1PYW D;  3A5U A;  4G7H C;  1PMR A;  4BS9 A;  1G29 1;  4B3S Q;  2F0H A;  1BO0 A;  4RAU C;  1FVI A;  5ELO A;  5J39 A;  2JA6 G;  4DAV A;  2PZU A;  2B8G A;  5M5W H;  4POF A;  3MFY A;  2VS1 A;  4C56 C;  3V2T A;  2NVT H;  3NTH A;  2OEO A;  1EL0 A;  1SNQ A;  1II3 A;  1SYE A;  3K5M A;  1K0R A;  2MO0 A;  3JC6 6;  3PF5 A;  5IIF A;  4B9W A;  3I73 A;  1WTX A;  4LFA L;  4DUZ Q;  2EYM A;  1BBX C;  1X9N A;  3H0G B;  4A93 H;  3NEM A;  4ID6 A;  4C1N I;  2B2W A;  4KHV A;  3M4O B;  1NMG A;  5EKI A;  2ZTD A;  2WV6 D;  4XQJ A;  1Q12 A;  1V1Q A;  1X3E A;  2R92 G;  4X3S A;  4C1N K;  4UAI A;  4JI0 L;  4LF9 Q;  2R93 H;  3S1N H;  4S3S A;  1BNZ A;  1K83 H;  4IN3 A;  1HCZ A;  1EWC A;  1JC7 A;  3LWU A;  4P71 A;  2RHS B;  5M3F G;  4XTC S;  5COY A;  2GA4 B;  3J81 E;  2MQH A;  4RH6 A;  1B9N A;  2F4I A;  2R7F A;  1UUP A;  1SE3 A;  2K50 A;  1M90 C;  1CFM A;  2ZXP A;  1GUT A;  4AYB G;  4LAA A;  1U5K A;  2LY7 A;  5LHY 1;  2LS0 1;  4F8M A;  4HJ8 A;  1SR3 A;  2R61 A;  1XJV A;  1WOC A;  4JK1 C;  2NZH A;  2AWO A;  1UEA B;  3ULJ A;  2IW3 A;  3M85 A;  2CQA A;  1CA5 A;  4TRD A;  3GV6 A;  1O78 A;  1PYS B;  3SK4 A;  4YY3 Q;  1C9O A;  4B3M L;  4DR6 L;  5M3M H;  1IBK L;  4A3K B;  3NE5 B;  4EQN A;  2K05 A;  2SNM A;  2OTL A;  4HJ9 A;  5JPN C;  1IW7 D;  3GTM B;  3J7A 5;  3H0G G;  4A3C G;  3TBI B;  1G91 A;  1VF5 C;  1O7Y A;  2RCF A;  4J8Q A;  4OGQ C;  1CQF A;  5FLX E;  1AZP A;  3UE1 A;  3QB3 A;  4FXG C;  1V9P A;  2RDG A;  1V43 A;  1D2B A;  2IL8 A;  4ZQ3 A;  3I4L A;  3MTS A;  1HUN A;  1STH A;  1IBM Q;  5HY6 A;  2MJ8 A;  1EY9 A;  3OIQ A;  4DNR B;  1A2T A;  3F2U A;  4DV4 L;  4FVM A;  4BA2 I;  5FO9 B;  1K0S A;  2R7Z B;  2J4X A;  1HNW Q;  4ZCK A;  5EPL A;  1BCP F;  3S1R H;  1XNQ L;  2EE1 A;  3UDX A;  1VQP A;  2CCZ A;  1VQF A;  1G2S A;  2L0C A;  1YNN C;  4ZRZ A;  3HOU H;  4XQN A;  4ODG A;  2MFI A;  2NVX H;  3IKJ A;  1WTO A;  3HFZ B;  1PV4 A;  3EIV A;  4XYO A;  2Z8L A;  3KK7 A;  3JAM E;  2WB1 B;  4A3J B;  4A3F B;  1B44 D;  1C4Q A;  1DXM A;  2PQE A;  4ALP A;  2M9V A;  2JEB I;  5DLQ E;  2PMZ B;  4TKO B;  3C46 A;  1QJO A;  4IOA A;  1RDP D;  2KEN A;  4JI2 Q;  4A3K G;  2UUA L;  4DPG A;  4C2M B;  5ELE A;  3TN2 A;  4QCL A;  1LTA D;  4RKB A;  3T1H Q;  1O7I A;  2WAQ G;  1SEB D;  1GD7 A;  4C3J H;  3DMU A;  2XRQ D;  5CV8 A;  1VQ9 A;  4OHJ A;  1YHA A;  1GUO A;  3NXW A;  1K83 B;  1KHI A;  1SND A;  3FKI B;  1EUJ A;  1V1P B;  1BVS A;  1EIG A;  2B2Y A;  4O1N A;  3D4D A;  1TU2 B;  4P73 A;  4BBR B;  2IY5 B;  2A69 D;  1S5D D;  4GN5 A;  4LUV A;  1EY0 A;  3KF6 B;  5FO8 B;  2PI2 A;  3G4S A;  3ER0 A;  1VQD A;  3HOV H;  2ALY B;  2K4K A;  2R7Z G;  4KI0 A;  2JK8 A;  1HQM C;  2Z6K C;  1JIC A;  4KHP Q;  3GTL B;  3CU7 A;  1PTO F;  5AFW A;  5IYD G;  2XWB B;  1DZ1 A;  3GTG H;  1F2L A;  3C1E A;  1EOT A;  1HZB A;  1FL0 A;  1CM9 A;  3J81 L;  5C3E H;  2WB1 G;  4A3J G;  3KJP A;  4A3F G;  1JT8 A;  5JJZ A;  1JOK A;  1EQT A;  1FR3 A;  2F0J A;  2HHH L;  3SGI A;  3J80 c;  2DJG C;  4HIK A;  4CDF C;  1NBW A;  2PNR C;  1EFW A;  1VF7 A;  1GOZ A;  2EQS A;  3P75 A;  3VDY A;  4DAP A;  5LMU Q;  2RF4 A;  3LGJ A;  4IJL A;  1OXV A;  4DAY A;  1FGB D;  1CSP A;  4DV6 Q;  4DV5 Q;  1GUG A;  2PQA A;  1TWA B;  1SNC A;  1AP0 A;  4DR4 L;  5K5P A;  2O5I C;  1W3S A;  4M1U B;  3S16 B;  2OQK A;  5C0X H;  1YZ6 A;  3FKI G;  1T5E A;  4UP7 A;  1KTK A;  3NSW A;  2Z6K A;  3I4O A;  4BBR G;  1AEX A;  5IYB H;  4A3D B;  3D0F A;  1AE3 A;  5FLX L;  1GJX A;  2BA0 A;  3I4M H;  4MTN A;  1Q8K A;  3V05 A;  2F0L A;  4QJF A;  4DR2 L;  1STB A;  1K3R A;  1GHJ A;  3J7Y W;  1PFN A;  1TY0 A;  2BDO A;  2L5T A;  2C35 B;  4I7A A;  1LM0 A;  1HPC A;  4IO9 A;  2XN9 C;  1QCB D;  1Q81 C;  1CZW A;  5GRO A;  1VQA A;  4B3S L;  2Q2U A;  3HGB A;  4FF4 A;  4HAE A;  2SEB D;  1PRT C;  2KCN A;  1B4O A;  2E5L Q;  3AMU A;  4FYD A;  1DD2 A;  1WD1 A;  3P7J A;  2EIF A;  2PNH A;  3JAM L;  1CKN B;  1NCV A;  4RWS C;  3QR8 A;  3KF8 B;  1SMY C;  3HKZ E;  1HNZ Q;  3NQT A;  4ME5 A;  1EYA A;  1EYD A;  3M7G A;  4DUY L;  2F0S A;  5C44 H;  2K5H A;  3DEO A;  1U4M A;  2AQ2 B;  2QDB A;  2FJ2 A;  1VQL A;  1CUK A;  3PUZ A;  1BOS A;  4Q5V A;  4A3D G;  2K5V A;  3A8I E;  1H9S B;  1D5Z C;  1WTQ A;  4UY8 C;  1SYG A;  1X32 A;  2OQ0 A;  5D65 A;  2Q8R E;  4A3L G;  3U9O A;  1F2Z A;  1O7Z A;  3CP0 A;  4QUF A;  1YHQ A;  3NWS A;  1Y1W B;  4KLK A;  4KKT A;  1ZYR C;  2MGS A;  1SNO A;  3M3Y B;  2L4N A;  4LF7 L;  4GKK Q;  1BBU A;  3FP9 A;  3FVQ A;  4QF4 A;  2EYO A;  2KUM A;  1IYU A;  1KNA A;  4IPD A;  3GTQ B;  2B8F A;  2B2V A;  4OWX B;  1EWH A;  4L5T A;  1I3Q H;  3GTJ H;  3I7F A;  3MEH A;  3I4N B;  3L9A X;  4H13 C;  1JOR A;  2KJX A;  3HEJ A;  4LFB Q;  4KV6 A;  4FDB A;  1K28 A;  2JA9 A;  4DR7 Q;  1VDZ A;  1STN A;  4HCS A;  3DHQ A;  4PZ7 A;  3J81 i;  1HJP A;  2XWJ B;  1XMO Q;  4DR5 Q;  4J6H A;  1PH4 A;  3S1Q B;  3H09 A;  3FRP B;  1N34 L;  1PRT D;  2DY7 A;  3A55 A;  2K75 A;  3QWN A;  1EY4 A;  3TS2 A;  5FO7 B;  1F9P A;  1LLR D;  4A4I A;  3MC0 B;  3W3A A;  2HDM A;  4H02 A;  3H3V I;  1SMY D;  1BUV T;  3CME A;  2CVR A;  3AU7 A;  1BR9 A;  1EQV A;  4K0K L;  4IFD H;  4MIU A;  3ULP A;  1Y1W G;  1IKL A;  1LO5 D;  3J7A V;  1STA A;  3E6Z X;  1RD9 D;  1TS3 A;  3PCO B;  4NXM L;  2OTJ A;  1PZI D;  3I70 A;  4XT3 B;  5J3B A;  3HZX A;  5ISR A;  5IT9 E;  3PUX A;  4JI8 L;  2NZ1 D;  4JYA L;  1I50 B;  1OXU A;  1STY A;  5KYI A;  3L2P A;  2JN4 A;  5DNF A;  4NXN L;  1X54 A;  2RDF A;  3L3O C;  1HFG A;  3PO3 H;  2A5H A;  1R9T H;  1PH8 A;  4LW1 A;  3I4N G;  3S1M B;  3MFG A;  2K5W A;  5C6A A;  4L5S A;  2JJQ A;  3DEP A;  1XNR Q;  1K8M A;  4JBM A;  4GLX A;  1HA5 A;  1LT3 D;  1TWG H;  1JWU D;  3OYY A;  3D4W A;  2KQ3 A;  3UDF A;  1JJ2 A;  1Z47 A;  2QEX A;  1KNE A;  5M5Y B;  1BDO A;  1DOM A;  5I6W A;  3T1H L;  3OTO L;  4L8J A;  4N9T A;  2I0Q A;  4UP9 A;  4JI1 Q;  3RLN A;  4EGV A;  3I8Z A;  3I72 A;  4TQU S;  3SK8 A;  2V4D A;  4L5R C;  1MJE A;  2CH4 A;  1IXR A;  3JAM i;  5CV7 A;  5BN4 A;  1E1T A;  4U67 3;  2IHF A;  2LKV A;  4B3R L;  5HUR A;  1N36 L;  4A3B B;  3NP8 A;  2YTY A;  4ZAI A;  5JJI A;  3P20 A;  3MEF A;  1WCM B;  2D5D A;  4A76 A;  1LAC A;  2G9H D;  4KD4 A;  2K52 A;  3AFQ A;  4L5Q A;  4IOC A;  3RN5 A;  2AMC B;  4BXX H;  4ZUI A;  1PZK D;  3EVQ A;  3A0J A;  4LF4 L;  2E75 C;  1QNK A;  4DV7 L;  1YEZ A;  3BDO A;  3ULL A;  4YWK A;  1SLJ A;  3BZK A;  1SN8 A;  2F0Q A;  2NBF A;  3K0Y A;  2DN8 A;  1PRT B;  2Q8T A;  4YHH L;  3KJO A;  3BYY B;  2I5M X;  3SE0 A;  2OCE A;  2NN6 G;  3UE0 A;  4XYQ A;  1UNS A;  1SRU A;  1CK1 A;  1QVC A;  1ZEQ X;  2N49 A;  1E2V A;  4RGN A;  5IGE A;  4JG2 A;  3D31 A;  1TWH B;  2WAC A;  3CRL C;  3Q8D A;  1PDQ A;  1E2W A;  4KY6 A;  2E2J H;  4DR3 L;  1AH9 A;  4K8I A;  1EZ6 A;  1CT1 D;  1ILQ A;  4JI7 Q;  3H3V C;  4DR1 Q;  1M8A A;  1PA6 A;  1I5F A;  2P5Z X;  3KYH C;  3LNN A;  2JA8 H;  1C0A A;  3R8B A;  2E2I B;  2FMC A;  3ND8 A;  3KLS A;  1XTC D;  3KDF B;  5FKA C;  4NB3 A;  3BZC A;  5LL6 X;  4BBS B;  4RGM A;  4YIJ A;  4CDD C;  4HTH A;  3L7Z C;  3N6R A;  4CDE C;  4A3B G;  2F0V A;  5KGU A;  4IPG A;  2ICE C;  1WCM G;  2UUB L;  3HOZ H;  1HZ9 A;  4X62 L;  1JCK B;  3CCJ A;  3OW2 A;  2NB0 A;  4LF6 Q;  3TP5 A;  3HKZ G;  3OOC A;  3HOX B;  2VQE Q;  1TKW B;  2F52 A;  2OWO A;  1JR0 D;  1NAP A;  4CJ0 B;  1E0B A;  2EOT A;  1HR0 Q;  3TEH B;  2KCC A;  2QW7 A;  1ESF A;  2TMP A;  5AJ3 Q;  5IT9 L;  4IUN A;  1TWG B;  5GAD C;  5COR A;  4YWL A;  4X64 Q;  1KAB A;  4QL5 A;  1QVF A;  2Z0S A;  4K6D A;  1EQQ A;  1I94 L;  3T1Y L;  4OO1 H;  5JJK A;  4K14 A;  4PMB A;  3TZD A;  2UU9 L;  3SXH A;  3D6W A;  5CC4 A;  2PW7 A;  1DOL A;  2WB1 E;  1HNZ L;  4DV0 Q;  2MPM A;  1B8A A;  2JYO A;  4C3H B;  2JA7 H;  4YWM A;  3CCM A;  1ONL A;  2IT1 A;  2RA4 A;  1FYC A;  5CV6 A;  4WFN 3;  1VQ7 A;  3I3C A;  4IQZ A;  4R4C A;  4BY7 B;  4A3M H;  4ABN A;  2FFK B;  1ZXT A;  5JAV A;  1PH6 A;  2K1B A;  4BBS G;  1PTO H;  3GTP B;  5IGF A;  2F0F A;  3N52 A;  5EPK A;  2VUM H;  2EYF A;  2BE5 C;  3SK5 A;  1I4P A;  2BA1 A;  3TS0 A;  3B6Y A;  4A3I H;  1EOV A;  3HOX G;  2LXJ A;  5BR8 Q;  3F2D A;  1Q3L A;  3OMG A;  2ZJP A;  2R3Z A;  2G9D A;  4DV3 L;  5E4X A;  1IW7 C;  1DCZ A;  2N78 A;  1C7Y A;  2Z9H A;  1WTW A;  4H44 C;  1HR0 W;  2E74 C;  2IX0 A;  5I6Y A;  1SNP A;  4AQY Q;  3A54 A;  3STB D;  1V1O A;  1QIL A;  4JI3 L;  4DV2 Q;  1V1P A;  2NVY H;  2WFW A;  4QY7 A;  3SDZ A;  4N8X 1;  5I9P A;  4LF5 Q;  1EY8 A;  5L37 A;  1RL2 A;  3PGZ A;  3KF6 A;  3PO2 B;  2HUG A;  4NDX A;  5IP9 G;  1SYC A;  5C4J H;  2VNU D;  5C4X B;  3T4A C;  4C3H G;  4DK6 C;  2JQO A;  1XMO L;  4MN3 A;  4DR5 L;  1ICW A;  1NMF A;  2N8N A;  4RCO A;  4DA2 A;  5GAH C;  4BY7 G;  4ZKB B;  3QOL A;  5C0X I;  3FEW X;  3S24 A;  4NP5 A;  1SYB A;  4HID A;  5M5X H;  4LFC Q;  1H9R A;  1J5E Q;  1JE5 A;  3HG9 A;  1VQG A;  3W1G A;  1E2Z A;  5IYC G;  3BVM A;  2AWN A;  2PPB C;  3S15 H;  4DV1 L;  1EU4 A;  2F3W A;  1OXX K;  3UDG A;  2HT1 A;  5E7N A;  5FLM G;  5K36 G;  1GHK A;  1XXG A;  4ZK9 B;  1YIJ A;  4QMG A;  3VR2 A;  2CWA A;  3PIP A;  3DLL A;  1SNM A;  4HSV A;  3I2Z A;  1JMC A;  1S5F D;  4OIJ A;  1D1K A;  1KRT A;  2YU9 H;  4IPH A;  1YNX A;  3S2D H;  2JA5 H;  2K04 A;  3TQY A;  5KND A;  2G5D A;  5CGK A;  4OX9 L;  5FLX c;  1VQM A;  2BE5 D;  1N33 Q;  2Q2I A;  3J7Z C;  1D6E C;  5JEA H;  5LMN Q;  3D3R A;  5EBC A;  4DK1 A;  1QUQ B;  2A69 C;  4HIO A;  3PO2 G;  2AUK A;  4X3K A;  1KRS A;  2NN6 I;  1Y1V B;  4BY1 H;  5C4X G;  5EKK A;  4Y7N H;  3K58 A;  3WOF A;  1I4H A;  2NUC A;  3GTK H;  2OT2 A;  4JI4 Q;  3RZO B;  3U50 C;  3MXG A;  3NEL A;  4A3E H;  2NVQ H;  1K8G A;  3HOY B;  2H1E A;  2Q2H A;  1LT5 D;  2AKW B;  1GUN A;  2PZT A;  2VB3 X;  3CCS A;  1N32 Q;  2DJF C;  1KDC A;  3TSS A;  4X66 Q;  3VYT A;  1IKM A;  5I2Y A;  2A6E D;  2UUC Q;  2ZM6 Q;  4DKA C;  1ILP A;  2JEA I;  1CKN A;  5M5W B;  3KF8 A;  5C4H A;  4G7O C;  3KLS X;  1NNX A;  2NVT B;  3CPW A;  4FF2 A;  1ENC A;  1QZG A;  2ES2 A;  1VQK A;  1IBL L;  3S17 H;  3HRZ C;  2M00 A;  2F0T A;  4HMI A;  1Y8N B;  4FF3 A;  1XPU A;  5LMN W;  3QG1 A;  1SFO H;  3U9S A;  1B9M A;  4A93 B;  1I6V C;  3W5O A;  1Y1V G;  4KY7 A;  4JI6 Q;  1Z7T A;  1HA6 A;  1HNX Q;  3MXP A;  3KFU A;  2R93 B;  3S1N B;  1ZKO A;  3AB9 A;  3ITP A;  2CQO A;  4GNX B;  3DM3 A;  4GKJ Q;  3CPF A;  3HOY G;  1FJG L;  4A3G H;  1I4G A;  4V0B A;  3CQZ H;  2F0K A;  5IOC A;  2YYZ A;  3NEN A;  1QZH A;  4IAL A;  1A3T A;  1BQQ T;  4MHE A;  2KCT A;  4WJ4 A;  1TS5 A;  3VYU A;  1RIP A;  3FMC A;  3BYT B;  4XQQ A;  2NYZ D;  1VQ6 A;  2DUD A;  1G6Z A;  3FPP A;  1GUS A;  2LMC B;  3PSI A;  4K2L A;  4ZLT F;  5CBE E;  2UXB Q;  2D9U A;  1ICF B;  1QNU A;  1VQJ A;  3RZD H;  4RMF A;  1MJC A;  2F3I A;  2K5D A;  3HOW H;  3E5S A;  4HR7 B;  5I4D A;  3WDN A;  1LTB D;  1TWF H;  3PMF A;  1VQ8 A;  5G3L F;  1CTM A;  1SE2 A;  2B3G A;  2JSO A;  3K80 C;  2NZO A;  1NTG A;  3GDE A;  3PF4 A;  3EQL C;  3SR1 A;  3Q24 A;  5M3M B;  2ZTC A;  3PUW A;  1UWV A;  4RFB A;  2A6H C;  3A56 A;  2D2C C;  5BN3 A;  2B2T C;  4RGO S;  4A93 G;  3W2D A;  3K7A H;  3MVV A;  1PH5 A;  2HQE A;  1MD2 D;  5KYL A;  5ELD A;  2PO4 A;  4ZUJ A;  2R93 G;  3A5Z B;  3I90 A;  2UXC Q;  3FHW A;  2L1B A;  1LT4 D;  1M4V A;  1A63 A;  1VQO A;  2KED A;  4O0A A;  3DWA A;  5FJ8 H;  1S5E D;  4LJZ C;  4B3T L;  1D7Q A;  1L1O C;  3P1H A;  1EY6 A;  2MO1 A;  3H94 A;  2EJM A;  5BN5 A;  2QIL A;  4RHS A;  2EYL A;  2B63 H;  3RUZ A;  3S1R B;  2JXM B;  3J80 E;  1OTC A;  3CC4 A;  4JI5 Q;  3HOU B;  2ID0 A;  3PIP 3;  2NVX B;  3DWQ A;  2B2T A;  5DAU A;  1IL2 A;  4ILW A;  5IP7 H;  1B2T A;  2BOS A;  2SDF A;  2VQF Q;  4LF8 Q;  2K14 A;  1S4Z A;  1MI2 A;  5EPJ A;  5FK9 C;  3A74 A;  1VQB A;  1JOO A;  3R2I A;  1XTD A;  1TT2 A;  5M3M G;  3K5O A;  1G51 A;  1PXU A;  4AQY L;  3M4Y A;  1X56 A;  2EY2 A;  4C3J B;  3NQI A;  4BA1 I;  4C3I H;  1B3A A;  3BS1 A;  2RDH A;  1FGU A;  4QQB X;  1KL9 A;  3NTI A;  2K28 A;  2QDL A;  4RKL A;  4DFA A;  4GZY C;  4X3T A;  4DUZ L;  1KIX A;  4POG A;  4BWG B;  1JJC B;  3NK9 A;  2Z4H A;  3GD7 A;  4KKS A;  2A6H D;  2HCC A;  1F2Y A;  2E76 C;  1XYI A;  3S2H H;  1B50 A;  3HOV B;  5GAE C;  3GTO H;  4LF9 L;  4OEL B;  3CHB D;  2XTI A;  2DNE A;  1HTP A;  3MWY W;  5EAY A;  3EN2 A;  2NWG A;  1GXD C;  1STG A;  2B2U C;  4ME3 A;  1MHW C;  1LTS D;  4XIG S;  3GTG B;  1W2B A;  3HOU G;  5DM7 3;  3MZ5 A;  1ROD A;  3PIO A;  1EEI D;  4X65 Q;  5C3E B;  1LYL A;  4R8I A;  3AEV A;  2F3V A;  1DJR D;  3VR5 A;  5DEH A;  1PFS A;  1Q90 A;  3E3X A;  5CYU A;  3BZD B;  1RTO A;  1CSQ A;  1IHZ A;  2OF1 A;  2J0T D;  4PV1 C;  4LNQ A;  3F1Z A;  1BF4 A;  4K6L A;  3RLF A;  4FP5 D;  4C3J G;  3GO5 A;  2F4V Q;  1VS0 A;  5D14 A;  2L11 A;  3T51 B;  1L0X B;  5LMN L;  2EJF C;  1UE5 A;  4YY3 L;  3MAQ A;  1TWC H;  2IPK D;  4LMQ D;  4EX5 A;  5F2D A;  1VQ5 A;  4MTK A;  2F03 A;  4HN7 A;  4HCE A;  1EYC A;  2F0D A;  4UPA A;  1A0I A;  4JPB W;  1EU3 A;  3FDT A;  3ERQ A;  1I6H H;  4LFA Q;  5A2Q E;  3K7U C;  1JOQ A;  5IT9 c;  3HOV G;  3KLR A;  4I65 A;  3I4M B;  1WYD A;  1J9O A;  1IBM L;  4U68 A;  1YBY A;  1KD1 C;  2XGT A;  1U0L A;  2CH4 W;  3BVZ A;  2N55 A;  4JI0 Q;  4P2C B;  5IGB A;  1NR2 A;  4OIK A;  3KBG A;  1HNW L;  3CCR A;  2Z6B A;  1EIF A;  4F87 A;  2HIX A;  5C3E G;  4UHV A;  1K8O A;  1YNJ D;  4HJA A;  4R8N A;  2QEJ C;  5CR3 A;  3PV0 A;  3AQQ A;  2K7V A;  2PQA B;  3J80 L;  1CHQ D;  2KOL A;  5D3I B;  1Z9F A;  4PMC A;  3VR3 A;  1JB3 A;  4B9X A;  1KLG D;  2EPB A;  1EWI A;  4KK7 A;  5H1S E;  1Q86 C;  3S14 H;  3K8A A;  4GLV B;  4KJO A;  1D5M C;  2VXW A;  4YCU A;  1OXT A;  4XDX A;  1XPR A;  1GKH A;  5J1Z A;  4JI2 L;  4I7Z C;  5C44 B;  1UE7 A;  1X55 A;  5C0X G;  2F0M A;  2Z4I A;  3CC2 A;  3K5N A;  2IHE A;  2BH2 A;  5EJW A;  2JA6 H;  4G7Z C;  4B3M Q;  4KHZ A;  4DU9 A;  5IYB G;  1AE2 A;  1IBK Q; 
#chains in the Genus database with same CATH homology
 4DV2 L;  2VY3 A;  3UDX A;  1VQP A;  2CCZ A;  2WP8 J;  1VQF A;  4LF5 L;  1I50 H;  2VUM H;  2YTV A;  1VQH A;  3HOU H;  4APV A;  1GO3 E;  2NVX H;  2MFI A;  1L1O B;  2EXD A;  4A3E G;  1Q7Y C;  3I4M G;  2BA1 A;  3HFZ B;  1PV4 A;  3I55 A;  3EIV A;  2I5H A;  1J6Q A;  1HH2 P;  3TS0 A;  1I94 Q;  3T1Y Q;  1VCI A;  4HJ7 A;  3B6Y A;  1TXY A;  4A3I H;  3S1M H;  1EOV A;  2UU9 Q;  3HOX G;  2LXJ A;  3M4P A;  5BR8 Q;  3F2D A;  4HIM A;  2N3S A;  4ALP A;  1VQN A;  2ZJP A;  2JEB I;  5DLQ E;  4DV3 L;  4IOA A;  2VL6 A;  2LXK A;  2N78 A;  1C7Y A;  2A1A A;  3WWV A;  4LFC L;  2KEN A;  1J5E L;  1HR0 W;  4JI2 Q;  4A3K G;  2UUA L;  2IX0 A;  4DPG A;  3CCQ A;  3G71 A;  4DV4 Q;  2R92 H;  4KHP L;  5M5Y H;  2AHO B;  3T1H Q;  4AQY Q;  1K8A C;  1O7I A;  2WAQ G;  5IWA L;  2L15 A;  1GD7 A;  4C3J H;  3STB D;  1UE1 A;  1VQ9 A;  4JI3 L;  1XNQ Q;  4DV2 Q;  2NVY H;  2WFW A;  4QY7 A;  1PH7 A;  2E2H H;  2R7Z G;  1YHA A;  4LF5 Q;  1KXL A;  3ZJY C;  4PZ6 A;  1RL2 A;  3PGZ A;  3KF6 A;  1KHI A;  1L0W A;  5M3F H;  1EUJ A;  5IP9 G;  5C4J H;  2VNU D;  1BVS A;  4AIM A;  2H5X A;  4P73 A;  2IY5 B;  1SMX A;  1VQI A;  4GS3 A;  4DK6 C;  4GN5 A;  4LUV A;  3KF6 B;  2JQO A;  1XMO L;  4YCV A;  5LMU L;  2PI2 A;  4DR5 L;  4A3B H;  5C44 G;  3E9H A;  2N8N A;  1NMF A;  4BY7 G;  5GAH C;  3G4S A;  3ER0 A;  1VQD A;  5C0X I;  1WCM H;  4DV3 Q;  2ALY B;  2CKZ B;  2K4K A;  1LTL A;  3EBE A;  4KI0 A;  4OWW B;  1N33 L;  3S24 A;  4DV6 L;  3W1B A;  1WJJ A;  4HID A;  3PUV A;  5M5X H;  4DV5 L;  3KDF A;  1YJW A;  4LFC Q;  2UXD Q;  1G6P A;  1J5E Q;  1JE5 A;  2JK8 A;  2UUA Q;  1VQG A;  2Z6K C;  3M4Q A;  4KHP Q;  3W1G A;  1CKM A;  5IYC G;  4OO1 I;  1E22 A;  4EQ5 A;  2AWN A;  5IYD G;  3CCL A;  3GTG H;  3S15 H;  2UXC L;  3KLW A;  4R4I A;  4DV1 L;  1HZB A;  1H95 A;  1OXX K;  1FL0 A;  3UDG A;  2HT1 A;  4A3G G;  4JI3 Q;  5E7N A;  5FLM G;  5K36 G;  5C3E H;  2WB1 G;  4A3J G;  3KJP A;  4A3F G;  1YIJ A;  1JT8 A;  1EQR A;  2KCM A;  4LUZ A;  4JV5 L;  4JI4 L;  2CWA A;  1SE8 A;  3PIP A;  4JOI C;  3SGI A;  2HHH L;  3J80 c;  3DLL A;  3I2Z A;  4HIK A;  3H0G H;  4JCV E;  1JMC A;  4A3C H;  1KRT A;  1NBW A;  2YU9 H;  4IPH A;  1YNX A;  1EFW A;  3S2D H;  3CD6 A;  2EQS A;  3RLO A;  3VDY A;  2JA5 H;  3STB C;  3M4O H;  3TQY A;  1TWH H;  3TRZ A;  5LMU Q;  1KAW A;  2R6G A;  2RF4 A;  3LGJ A;  4DK3 C;  4OX9 L;  5FLX c;  4IJL A;  1OXV A;  1VQM A;  2ZJQ A;  1QUQ A;  1N32 L;  1N33 Q;  2Q2I A;  4JBW A;  3IRB A;  1CSP A;  4DV6 Q;  4TVA B;  1KQS A;  4QIW E;  3J7Z C;  3HOW G;  4DV5 Q;  1YHB A;  2PQA A;  4X66 L;  2KHI A;  5LMN Q;  4DAY B;  1QUQ B;  4DR4 L;  4GN3 B;  1A62 A;  2UUC L;  1W3S A;  2ZM6 L;  2E2I H;  2OQK A;  4HIO A;  2LSS A;  1IBK Q;  4LF8 L;  1YZ6 A;  3PO2 G;  4DV1 Q;  1KRS A;  1OXS C;  3FKI G;  2NN6 I;  4LWC A;  4BY1 H;  4UP7 A;  1SRO A;  3TRE A;  4Y7N H;  4BBS H;  5C4X G;  2Z6K A;  2GVA A;  1LUZ A;  3I4O A;  4BBR G;  5IYB H;  2E5L L;  3D0F A;  1VQ4 A;  3GTK H;  2QGQ A;  1GVP A;  1P8L A;  4JBJ A;  1AE3 A;  4JI4 Q;  3U50 C;  2BA0 A;  3NEL A;  1E24 A;  4AH6 A;  3J80 i;  4IPC A;  4A3E H;  2NVQ H;  1K8G A;  3I4M H;  2Q2H A;  1Q8K A;  4MTN A;  2AKW B;  2KHJ A;  4QJF A;  2HIV A;  4DR2 L;  4JOI A;  4OX9 Q;  1K3R A;  3CCS A;  2D0P A;  3HOX H;  4GNX C;  1N32 Q;  4WJ3 M;  1YI2 A;  1EYG A;  4X6A H;  4X66 Q;  4IFD G;  1PH3 A;  4JI6 L;  2C35 B;  1LM0 A;  1S40 A;  3E0E A;  4DR6 Q;  2DGY A;  5FJ8 G;  4IO9 A;  4DR4 Q;  1Q81 C;  2UUC Q;  1HZA A;  4DKA C;  2ZM6 Q;  4A3K H;  5GRO A;  1VQA A;  3F2C A;  3RNU A;  4B3S L;  1WFQ A;  1HNX L;  2Q2U A;  1PHJ A;  4DAM A;  1E3P A;  2CWP A;  2JEA I;  3H15 A;  3GTM H;  4AYB E;  3G48 A;  1CKN A;  4P74 A;  2FXQ A;  3BJU A;  2B63 G;  4GKJ L;  2E5L Q;  3RN2 A;  2EIF A;  1VQE A;  3H3V H;  3CPW A;  2PNH A;  1CKN B;  3ERS X;  3K0X A;  3KF8 B;  1QZG A;  2ES2 A;  1VQK A;  1T9H A;  1HNZ Q;  3HKZ E;  5IE8 A;  5IP9 H;  1IBL L;  3S17 H;  4GKK L;  3PO3 G;  3M7N A;  4C3H H;  4DR2 Q;  5GAG C;  4IJH A;  1N8R C;  2YV5 A;  4DUY L;  2R7D A;  1XPU A;  1M1K C;  3AYH B;  5IP7 G;  5LMN W;  1PH9 A;  1SFO H;  4GOP C;  1BBW A;  3E9I A;  2K5H A;  5C44 H;  1NJI C;  4BY7 H;  1YJN A;  2UXB L;  2R7Z H;  1VQL A;  3W5O A;  1Y1V G;  1CUK A;  1NE3 A;  3PUZ A;  4JI6 Q;  3KOJ A;  3F2B A;  4DNI A;  2HQL A;  2JE6 I;  4GNX A;  4A3D G;  2K5V A;  3GTP H;  2E8G A;  4UY8 C;  5IYC H;  3U58 A;  2OQ0 A;  3CMA A;  1HNX Q;  3KFU A;  2GN5 A;  4LFB L;  1B70 B;  5IYD H;  1S3O A;  4GNX B;  2CQO A;  3CF5 A;  2F4V L;  2QA4 A;  4HJ5 A;  3DM3 A;  1E7Z A;  1XMQ L;  4A3L G;  4GKJ Q;  3CPF A;  1Q82 C;  3HOY G;  1FJG L;  3ICE A;  4A3G H;  3CP0 A;  3J81 c;  5FLM H;  1YHQ A;  2ATW A;  3CQZ H;  4DR7 L;  4KLK A;  4A3J H;  4A3F H;  1XNQ L;  2YYZ A;  3NEN A;  4PMW A;  1QZH A;  1PH1 A;  3I56 A;  4LF7 L;  2KCT A;  4WJ4 A;  1IBL Q;  2Y0S E;  4GKK Q;  1B7Y B;  4R4O A;  1BBU A;  1RIP A;  3FP9 A;  3UDI A;  3HOV H;  4DUY Q;  2D0O A;  1VQ6 A;  2DUD A;  2IX1 A;  3RR5 A;  4C2M H;  3PSI A;  4IPD A;  5IWA Q;  2UXB Q;  1VQJ A;  3RZD H;  4A75 A;  1Q1E A;  4RMF A;  1MJC A;  2F3I A;  4OWX B;  5HGQ A;  3HOW H;  4L5T A;  4BXX G;  1I3Q H;  2K5N A;  3I7F A;  3GTJ H;  4GOP A;  1JB7 A;  4O2D A;  1GM5 A;  1K73 C;  1MKH A;  1TWF H;  2A19 A;  1JJG A;  4GN4 B;  1VQ8 A;  4LFB Q;  2B3G A;  3J81 j;  1YIT A;  4GOP B;  3K80 C;  3PO2 H;  3FKI H;  2NZO A;  4FDB A;  4NPS A;  1NTG A;  3GDE A;  1FJG Q;  5C4X H;  3PF4 A;  2JA9 A;  1Q46 A;  2GVB A;  4DR7 Q;  4R4T A;  2RCN A;  2ZTC A;  4PZ7 A;  4BBR H;  3PUW A;  1UWV A;  1HJP A;  3J81 i;  1XMO Q;  1PYB A;  4DR5 Q;  1PH4 A;  4JI5 L;  4LF7 Q;  4P72 A;  2RHQ B;  3G6E A;  1N34 L;  4A93 G;  2K75 A;  1DGS A;  1X6O A;  3K7A H;  1D8L A;  3TS2 A;  1K9M C;  3BU2 A;  3K81 C;  1PH5 A;  4A4I A;  2WAQ E;  1X65 A;  2YTX A;  3CXC A;  4H02 A;  3L0O A;  3H3V I;  3GTL H;  3CME A;  4GLA C;  2VQF L;  1XNR L;  2R93 G;  3CCU A;  3A5Z B;  2UXC Q;  2ZJR A;  4OON A;  3FHW A;  4K0K L;  1A63 A;  1VQO A;  1VQC A;  1ASZ A;  2JA8 G;  3ULP A;  2Q2T A;  4O0A A;  5FJ8 H;  1Y1W G;  4JBK A;  4B3T L;  1D7Q A;  1UE6 A;  2VW9 A;  1L1O C;  4JV5 Q;  2HHH Q;  2MO1 A;  3PCO B;  4NXM L;  2OTJ A;  2B63 H;  4R1J A;  5J3B A;  1Q1B A;  4JI1 L;  3PUX A;  4JC0 A;  4JI8 L;  1E1O A;  4MNO A;  1OTC A;  3CC4 A;  4JYA L;  1XPO A;  1OXU A;  4JI5 Q;  3JAM c;  1S72 A;  3L2P A;  2ID0 A;  1N34 Q;  4NXN L;  3HOZ G;  1X54 A;  3AFP A;  3U4Z A;  3PO3 H;  5ELN A;  1R9T H;  1PH8 A;  1TWA H;  4LW1 A;  3I4N G;  1QVG A;  1IL2 A;  4L5S A;  5IP7 H;  4QGU A;  4OWT B;  2JJQ A;  5IY0 A;  2VQF Q;  4LF8 Q;  1XNR Q;  3S16 H;  2K14 A;  1NY4 A;  5JEA J;  1HZC A;  4RG1 A;  3CC7 A;  4GLX A;  4JBM A;  4K0K Q;  1TWG H;  1Y1V H;  3A74 A;  1VQB A;  1XTD A;  1Y14 B;  3OYY A;  4P75 A;  5M3M G;  4A3D H;  2Y0S G;  3UDF A;  2PMZ E;  1WI5 A;  1G51 A;  3NBH B;  1Z47 A;  3CCV A;  5C0X J;  2QEX A;  1JJ2 A;  4B3T Q;  3RZO H;  3MXN B;  3T1H L;  3OTO L;  4AQY L;  1X56 A;  3CW2 C;  4NXM Q;  4OXP A;  4BA1 I;  4A3L H;  2I0Q A;  1P16 A;  4C3I H;  3HOY H;  4UP9 A;  4JI1 Q;  4X65 L;  4JI8 Q;  3RLN A;  4OO1 G;  4JYA Q;  1PVO A;  1FGU A;  4QQB X;  1KL9 A;  4TQU S;  4R4Q A;  3U4V A;  2ZTE A;  2KBN A;  3F8T A;  4DUZ L;  1PH2 A;  1MJE A;  3JAM i;  1IXR A;  1KIX A;  4L5R C;  4POG A;  1JJC B;  1E1T A;  3PUY A;  3GD7 A;  2IHF A;  2V1C C;  2JA7 G;  4B3R L;  2MNA A;  1L2F A;  1N36 L;  3A5U A;  2YTY A;  5JJI A;  1G29 1;  4A3M G;  3MEF A;  5GQO A;  4B3S Q;  3S2H H;  5GAE C;  4A76 A;  3GTO H;  4LF9 L;  5ELO A;  1FVI A;  2K52 A;  2XTI A;  3AFQ A;  4L5Q A;  4IOC A;  3RN5 A;  2JA6 G;  2AMC B;  4JI7 L;  1X3G A;  5EAY A;  4BXX H;  2UXD L;  3EN2 A;  5M5W H;  4POF A;  4Y52 H;  2VS1 A;  4DR1 L;  1IZ6 A;  3A0J A;  4LF4 L;  2NVT H;  4ME3 A;  2PI2 E;  4DV7 L;  4XIG S;  1YEZ A;  3OTO Q;  4NXN Q;  2VUM G;  1W2B A;  3HOU G;  3ULL A;  4YWK A;  1SLJ A;  3BZK A;  2CFM A;  2A8V A;  3PIO A;  4X65 Q;  1K0R A;  1SN8 A;  1LYL A;  4IFD I;  2MO0 A;  3JC6 6;  3PF5 A;  3AEV A;  3KJO A;  4YHH L;  4A3I G;  4LFA L;  2I5M X;  2BH8 A;  2OCE A;  4DUZ Q;  1PFS A;  2NN6 G;  3UE0 A;  1X9N A;  4MZ9 A;  4PZ8 A;  4A93 H;  3HKS A;  3NEM A;  1SRU A;  1IYJ B;  1QVC A;  4B3R Q;  2N49 A;  4JG2 A;  1NMG A;  3D31 A;  1N36 Q;  2ZTD A;  4LF6 L;  3Q8D A;  1Q12 A;  1V1Q A;  1X3E A;  1CSQ A;  2R92 G;  2E2J H;  4DR3 L;  4LNQ A;  3F1Z A;  1AH9 A;  4JI0 L;  2VQE L;  4LF9 Q;  2R93 H;  3RLF A;  3S1N H;  2F4V Q;  3GO5 A;  1XMQ Q;  1K83 H;  1VS0 A;  4JI7 Q;  1HR0 L;  5LMN L;  1UE5 A;  2B29 A;  4DR1 Q;  1PA6 A;  1I5F A;  3KYH C;  4YY3 L;  2JA8 H;  1C0A A;  4LF4 Q;  1TWC H;  1Y1W H;  1MIU A;  4UP8 A;  4P71 A;  4DV7 Q;  4EX5 A;  5AJ3 L;  2RHS B;  1VQ5 A;  3KDF B;  5M3F G;  1N9W A;  4XTC S;  3M3Y H;  4NB3 A;  3BZC A;  2MQH A;  4UPA A;  1YVC A;  3CCE A;  1A0I A;  4X64 L;  1UEB A;  2R7F A;  3M9B A;  2K50 A;  3L7Z C;  1M90 C;  1I6H H;  2VZA A;  4LFA Q;  4YHH Q;  4LUO A;  4A3B G;  4AYB G;  3K7U C;  1U5K A;  4IPG A;  5IT9 c;  4HJ8 A;  3HOV G;  1WCM G;  1SR3 A;  2UUB L;  3HOZ H;  3GTQ H;  1XJV A;  1HZ9 A;  4X62 L;  3CCJ A;  4DV0 L;  1WOC A;  3OW2 A;  1WYD A;  2NZH A;  1IBM L;  1EIY B;  4LF6 Q;  1YBY A;  1KD1 C;  2XGT A;  1U0L A;  3HKZ G;  2AWO A;  3ULJ A;  3M85 A;  3I4N H;  4DR3 Q;  4JI0 Q;  2VQE Q;  5JJL A;  1YJ9 A;  2F52 A;  2OWO A;  1PYS B;  1HNW L;  1HR0 Q;  3CCR A;  3TEH B;  1EIF A;  4PG3 A;  2HIX A;  5C3E G;  4YY3 Q;  1C9O A;  4B3M L;  4DR6 L;  4HJA A;  5M3M H;  1IBK L;  4YCW A;  5AJ3 Q;  3PV0 A;  3AQQ A;  2OTL A;  2PQA B;  4HJ9 A;  3S1Q H;  1KC8 C;  3J7A 5;  3H0G G;  4A3C G;  5GAD C;  4YWL A;  4X64 Q;  1QVF A;  4QL5 A;  2JA5 G;  1Z9F A;  2Z0S A;  1EQQ A;  2ASB A;  1I94 L;  3T1Y L;  5JJK A;  3UE1 A;  1EWI A;  2UU9 L;  5BR8 L;  1V9P A;  2UUB Q;  4J15 A;  2I5L X;  1V43 A;  4X62 Q;  5H1S E;  2WB1 E;  1HNZ L;  4DV0 Q;  1BKB A;  5JEA G;  1Q86 C;  1B8A A;  3S14 H;  3K8A A;  2JA7 H;  4GLV B;  1IBM Q;  1A8V A;  4YWM A;  5HY6 A;  4YCU A;  3CCM A;  1OXT A;  1XPR A;  1GKH A;  2IT1 A;  1VQ7 A;  4JI2 L;  1UE7 A;  1X55 A;  1ASY A;  5C0X G;  4R4C A;  1CKO A;  4DV4 L;  4A3M H;  4BA2 I;  3CC2 A;  3CAM A;  2IHE A;  1HNW Q;  4BY1 G;  4IFD J;  1X3F A;  1PH6 A;  2BH2 A;  4BBS G;  2D62 A;  2JA6 H;  4B3M Q;  4KHZ A;  5IYB G;  1AE2 A;  3S1R H;  1L1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...