1C48A

Mutated shiga-like toxin b subunit (g62t)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGTFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Identification of the Primary Receptor Binding Site of Shiga-Like Toxin B Subunits: Structures of Mutated Shiga-Like Toxin I B-Pentamer with and without Bound Carbohydrate
rcsb
source organism Phage h30
molecule tags Toxin
molecule keywords PROTEIN (SHIGA-LIKE TOXIN I B SUBUNIT)
total genus 18
structure length 69
sequence length 69
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 1999-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1c48A00
1D1IA 2GA4B 2C5CA 1CZWA 1QNUA 1CZGA 1D1KA 4M1UB 1BOSA 1R4PB 1C48A 1CQFA 2XSCA 1DM0B 1R4QB 4P2CB 1QOHA 1C4QA 2BOSA 3MXGA 4ULLA
chains in the Genus database with same CATH superfamily
4P75A 3PUVA 5A2QE 1EWHA 1STHA 3S1MH 2HDMA 2UUBQ 1OXXK 3N6RA 4IUVA 2PZUA 4C1NI 3TQYA 1AZPA 2K5HA 5E3FA 3JAMi 3VYRA 3OOCA 3WWVA 3EJIA 1C7YA 3AFPA 1YEZA 2D62A 3GP7A 1LV9A 2CWAA 1EOTA 1UAPA 2H4OA 1SE4A 4FXKC 3W3AA 2Q8TA 5C5LA 1BXTA 3V05A 3DLLA 1BDOA 3CRKC 3K7AH 4OIJA 3K5NA 2NBFA 1O78A 1JOQA 2EJFC 2YU9H 1Z7TA 1WTVA 4BXXH 5T1IA 3HOWB 3R3OA 2K05A 1B9MA 4TQUS 2F0GA 1ML0D 1HHVA 1DZ1A 2K5DA 1HZCA 1PH9A 3GTGH 1JE5A 5FLXc 1C9OA 3K6OA 4V190 1HXYD 3JC66 1PH5A 3MEHA 1HNXQ 4DR4Q 3AFQA 3CQZB 5A35A 4YCWA 1MGSA 4A3KB 1B3QA 5IIFA 2OTLA 3B6YA 1TVXA 2QDBA 5KNCA 3C1EA 5ELEA 4A3BB 1GUGA 2F0HA 1B50A 5JPMC 4KMUC 4WORA 2HHHL 1SYFA 2K5NA 4ULLA 2XWJB 4CKEA 4IO9A 2LS01 2NVYH 1EOVA 1L0XB 3EVQA 2R6GA 1Q81C 3QJYA 3CCLA 5EKKA 3GTGB 4BA2I 1A0IA 4PZ7A 4CJ1B 5C0XJ 4UP7A 1SMYC 2I5MX 2UUBL 3M7NA 3CQZH 1PMRA 5FJ8H 4N9PA 1LO5D 1Y8OB 4BY1G 1SDFA 2JE6I 4Z9CB 5C4ZA 5JPNC 1I3QB 1NY4A 2KOLA 1TT2A 2R7ZB 4JW0A 1XTDA 1S40A 1A2UA 4X64L 2RSOA 5IT9L 5JVG3 4TKOB 1N8RC 4A3BH 4GN5A 2RF4A 4OL7A 1Q1BA 3KOJA 1LT4D 1QUQA 3BZKA 1C0AA 1RL2A 2NVYB 3Q24A 3PSIA 3KDFA 2HT1A 1TS5A 3EFXD 1B44D 1Z47A 4L5RC 1CI3M 3T1HQ 2AWNA 5CGKA 1IKMA 2XN9C 3M4OH 2EYHA 4K2LA 2PI2A 1QE6A 3H0GG 1EY8A 4RGMA 4DNIA 3QWNA 1KNEA 3J80c 3EQLC 3K5LA 4LAAA 1PFNA 4LW1A 2HHHQ 2KVMA 3U4VA 4ZAIA 2B2TC 2XNAC 2RDFA 4A3EH 3HOUG 2Q8IB 2ZM6Q 1I3QH 2R7ZH 4IPHA 4A3EG 2PCFB 1X3PA 2R7ZG 3GTOB 2N49A 4TRDA 2XWBB 4LFAL 1U0LA 1RHPA 1NJIC 2AMCB 3T1YQ 1TWFB 1EY4A 5EQ0A 2F0FA 3MXUA 1VDZA 1U4LA 1KABA 1RIPA 1SSOA 1STGA 4AIMA 4BY7H 2E2IB 1LTLA 1MD2D 4IFDJ 4IZ8A 4HMIA 4K8JA 1I4RA 1CHPD 3M4OB 5KYIA 2VNUD 3IKJA 1EU4A 3OW2A 5JEAJ 2JP1A 5JJZA 1BKBA 2L5TA 4JOIA 1JWMD 1QUQB 4IUPA 3TN2A 1N32L 2EJMA 2MFIA 3SK8A 4LF9Q 1Y8PB 2VL6A 3HOUB 1HCZA 3CP0A 3GTOH 1HNWQ 1JWSD 3FKIB 4HIKA 1HA5A 3BU2A 2NVXB 1L0YB 2Q2TA 4Y7NH 3FRPB 2RVLA 2JEAI 3FPPA 4U673 1A15A 4UP9A 4M8AA 5HY6A 5M3FG 4X62L 3VR2A 1XX8A 4QIWE 3GQBA 1IL2A 3E3XA 3J80E 4IALA 1V43A 1VQ9A 3AQQA 4ZRZA 1DXMA 4A3IH 1SJED 2IHFA 4A3IG 1VQGA 2AUJD 2KUMA 4QUFA 5J3BA 2EYJA 4JVZA 4P71A 3CD6A 3NUCA 2L15A 3FEWX 2IT1A 3FKIH 3CCEA 1PTOF 1WCMG 5IY0A 3A8KE 2NVXH 1PYBA 4Y7NB 1SNMA 2CVRA 2UU9Q 1A6XA 1HFNA 1I4PA 1PTOH 1ZEQX 4DPGA 3HKZB 4X3TA 3JAML 3MVVA 1OXSC 3S9WA 3DWQA 3P7JA 1JB7A 1XPOA 2VZAA 4TVAB 4FXGC 1TU2B 3S1RH 2QDLA 4ZK9B 4CBVA 5LL6S 2DY7A 3CXCA 1IW7D 1X3EA 4NKLA 1EIGA 2UXCL 4X66Q 2HIVA 3TDQA 1X3GA 1IXRA 4KHVA 3I7FA 2NVQH 4DV0L 2QEJC 4BBRB 3CMAA 1UNSA 4KHZA 2ASBA 4IOAA 3UDGA 4K8IA 1DD2A 4MHEA 1E2WA 2EYFA 2JA8B 1WCMB 4JI8L 5C0XG 2KHIA 4BA1I 4DR6Q 5M3MH 1PTOB 1CM9A 3SHLA 3HOYB 4QF4A 1PHJA 3CHBD 1ET9A 2CH4A 1QOHA 4JYAQ 4LF4L 1HQMC 4IN3A 5C44G 3S1RB 1KD1C 2B2YC 2KQ3A 2ZJQA 2QGQA 4LNQA 4K0KL 4HIDA 4WJ4A 2F0EA 3BDLA 3FPUB 2F0IA 3SDZA 1UEAB 1PH2A 4M1UB 2EZVA 1ICFB 2MP1A 1WFQA 1PXUA 1EFID 5AJ3Q 4A3DG 2NVQB 3VR4A 2BH2A 4N8X1 3ULJA 4A3DH 4U68A 2G5DA 4XDXA 4XQQA 3KK7A 4DR5Q 4BBRG 1J5EQ 1PDQA 1YHQA 1STAA 1SYCA 1W6KA 2TMPA 3FVQA 4YWLA 3PMFA 1NE3A 1H9JA 4JC0A 5CBEE 4B3SQ 1SFOH 1NMGA 5GAHC 3MXNB 3PO3B 4CJ0B 3KLSA 5IYDH 1B9NA 1B1ZA 1QZHA 4KKUA 2B63B 3GTKB 4FNFA 3D8GA 3TZUA 3OIPA 5I6WA 2NN6I 5FO9B 3KF8B 1AE3A 4KD3A 5KNBA 5CV4A 4UPAA 1U5KA 2B2TA 4EVOA 3CCQA 1MSHA 3CCMA 3N52A 2F1MA 1C8CA 1ILQA 1VQ5A 1F9QA 1N32Q 2HDLA 4MZ9A 4LF6L 1GM5A 1E1TA 3V2TA 3ITPA 3G7LA 2NZHA 4JV5L 1CQVA 5DAUA 2WKDA 4RGNA 4H13C 3HOZB 4N9TA 4A3GH 5JEAG 2K1BA 2L55A 4BS9A 4LUOA 4DV0Q 4HAEA 1LTTD 2HUGA 3I55A 1OXUA 3GTMB 5J1ZA 2B63H 3F2DA 1KDCA 3GTKH 2GA4B 1GUNA 1LACA 4UP8A 1PA6A 1CA5A 3X3MA 1D5ZC 1A3VA 3W5OA 2FHTA 4DR6L 1HJPA 2KCNA 2MO1A 2UXBQ 3MZ5A 1SJHD 3RLFA 5ELCA 3NELA 4DKAC 1E2VA 5A2QL 4A3BG 1JE4A 2RCFA 1X6OA 3A7AB 1PYWD 5ELOA 4DV2L 4ID6A 5CC4A 1LTRD 3H6MA 4LFCQ 1CUKA 2EXZA 2OEOA 5CV6A 1BVSA 3A74A 4IUNA 3BZCA 3BYTB 3VYSA 3DHQA 4K6DA 3HP3A 3KF8A 4IJLA 2QEXA 2PMZE 1UE6A 2OF1A 1J5EL 3H0GH 1CA6A 4RHSA 1S3OA 1LT3D 2SNMA 1VQJA 3SGIA 1B4OA 3CCVA 2F3IA 3SVMA 3I4NG 1G2TA 1KXLA 1GD7A 3MHBA 3D0FA 2JA8G 5CYUA 3J81j 3SK4A 3PUXA 2IX3A 1S4ZA 2JXMB 3CPFA 1IBML 3M4YA 3MTSA 2R3ZA 1XNRQ 1KAAA 4DAYB 5HGQA 2QF7A 3BVMA 5T1GA 1KRSA 3DM3A 1L0WA 4EGVA 3H0GB 4PG3A 2UUCQ 3V96A 2QILA 3OMGA 1A3TA 2NTSA 1J6QA 4LFBL 3M85A 4DV3L 4LF4Q 2MNAA 2AHOB 1YIJA 3J81i 2E76C 1WD0A 5C4XG 4P72A 4LF5L 2KENA 3KLRA 5CV9A 5C4JH 1Y1WB 4HIMA 3PO2B 3A54A 1EY7A 3KF6A 3P75A 3PCOB 3S14B 2Z8LA 5JEAH 5ELBA 4L8JA 2RQXA 3BDOA 4QB4A 1N9WA 4DAMA 3S17H 4G7OC 1V8QA 1HUNA 1WD1A 1JT8A 3HOXG 1HZBA 2KHJA 1TWGB 3S2DB 3E9HA 1FJGQ 4DV2Q 2YYZA 4LFCL 4O0AA 5JVH3 1CSQA 1IBKQ 2EYOA 4GLVB 2B2UC 1PRTD 1SYGA 3PIPA 2MJ8A 4JI3L 3MA2B 3Q8DA 3J81L 1MIUA 1Q46A 1NSNS 4HJ7A 5H1SE 4YHHQ 5IP9G 2LY7A 3PO2H 1QVCA 3U9OA 3NTHA 3UDXA 4C3IB 2ES2A 2L11A 3ND8A 3S15B 1HZAA 1S5DD 2D0PA 2IHEA 5FLMG 1UE7A 2JA7B 2E2DC 3KBGA 4HTHA 1X54A 2PQEA 1S5BD 3RLOA 1KQSA 1SR3A 4HEDA 3EBEA 4LF6Q 1GXDC 4DV3Q 3CC7A 1TWGH 3PIOA 4HJAA 1K8AC 3HOXB 4LF5Q 1Y1VH 1G2SA 3MC0B 3BG3A 1ZXTA 4C3HB 1QG7A 1EL0A 2NUCA 3Q6SA 2Z6KA 4A3JB 4HSPA 1A62A 3IFDA 1N33L 1VQBA 2F4IA 1WTHA 1LM0A 3DM1A 2EY5A 1TWHB 4B3MQ 4JI1L 2MGSA 3GTPB 4XT3B 4A4IA 1VQMA 4YIJA 2F0NA 3TBIB 5IOCA 2UUCL 1KHIA 4LF8L 1UEBA 1FJGL 3BYYB 2J4XA 4F88A 4IFDI 3S1NH 3R93A 4C3IG 2JA7H 4FXDA 1EWIA 3C3LA 3A8JE 4DUZQ 2GVBA 1QNUA 3D31A 5EGTA 3NHHA 4V0BA 5BN3A 4GZYC 2K75A 1Y1VB 1I50H 4DR3Q 3KF6B 4YHHL 1HA6A 5IGDA 4JK1C 2I5LX 3SK5A 3E5SA 1E2ZA 4J8QA 2IL8A 2R92H 4JPBW 1FNVA 1RJTA 2A6HD 2VUMB 3HKZE 1TWHH 4YWKA 1DYQA 1E3PA 1VMCA 3GTPH 4NB3A 2Z1CA 2Z6BA 4X66L 2ZTDA 4IPCA 1F2ZA 3AYHB 2NWGA 1I94Q 2YTVA 1XWEA 5DLQE 5M3FH 4KJNA 5KNDA 2M9VA 1CKNB 1YJWA 4BBSH 1SE2A 2WINB 2NVTB 1U4MA 3HOYG 4K5WA 1X32A 4MTNA 3X3NA 4X62Q 2Z9HA 2FMMA 3TZDA 5K5PA 2O5IC 1HNXL 4LF8Q 4DK1A 2PNRC 2OCEA 4CKCA 5IP9H 2F52A 2A73B 3Q23A 1K0RA 4JI2Q 1EIYB 2VUMH 2CW0D 5JJKA 3P20A 3E0EA 2N55A 4OWXB 3ULPA 4IUUA 1CQFA 5CR3A 4DUZL 3G71A 1P8LA 3I4MG 4Q5VA 3IRBA 1UUPA 4DK3C 4BY1B 2SDFA 4PZ8A 4XQJA 1SAPA 4PQXA 4DR5L 1YITA 4CGYB 2AQ2B 3E9IA 3EIVA 1P16A 4K6LA 3RR5A 4RH6A 1KNAA 5C5MA 2EDGA 1DONA 1F9SA 4KV6A 4LUVA 1B70B 1BOSA 2R7DA 3Q0AA 2BA0A 1O7IA 2UXCQ 1WTOA 5E7NA 1KTKA 1NCVA 3H91A 1RF2D 5M5XH 3C46A 1XMOL 3KLWA 1G8ZD 3Q22A 4LK1C 5LMNL 3AU7A 1I4QA 5M5YB 3ULLA 1R9TH 2AUKA 2B3GA 5ELNA 1EYDA 3ER0A 2A8VA 1K0SA 5C44H 4A3LG 4AH6A 1XMQL 3F2UA 3NWSA 1OO9B 1XXGA 1PTOD 1A8VA 1YNND 2I07B 3C1FA 5LL6X 4X65L 3GTJH 3KFUA 4JYAL 3NQTA 1M8AA 3BDCA 2EY1A 2CWPA 5M5WH 3CCRA 4K0KQ 1EUJA 1XYIA 3OWEB 1YNXA 4DV5L 5K36G 2LSSA 1D1KA 1EYCA 2N8NA 3NP8A 1IZ6A 5M5XB 4P74A 3I4NH 2BCOA 5FO8B 2F0WA 4BXXG 1PH1A 3TEHB 1R9TB 1NUCA 5IODA 1QVGA 1E24A 3JAME 3K81C 3HOVB 1PZID 1B53A 4JI2L 1YHAA 2DY8A 3KJOA 1AEXA 4B3RQ 5E4WC 4UY8C 1QWYA 1RKNA 4C3JB 4FO2A 4G7ZC 5NUCA 1PRTB 1EEID 1EQTA 1GHJA 2WAQB 3S1QB 4I7AA 1PFBA 2JA9A 1DGSA 5KIXA 1H9RA 5C4XH 2PNHA 1X65A 3NXWA 4J15A 3ZJYC 2CH4W 3I4NB 4IOCA 4HN7A 5FLXL 2ZTEA 2YTYA 4JI7Q 1JJCB 2KBNA 2PW5A 1VQLA 2JA6H 1VQHA 3A55A 1SRUA 1T9HA 2XTIA 1N36L 3E0JA 2JJQA 3I73A 2A6HC 2LMCB 3NTKA 4OELB 4C56C 1IW7C 2VW9A 5EBCA 4KY7A 2H1EA 1YJNA 2HD3A 4C3JH 5LMNQ 1IBMQ 1ONLA 4DR2Q 3G4SA 2WB1B 2F3VA 4GN3B 1HR0L 1GJXA 2DN8A 5IGEA 1AN8A 1M90C 3S1QH 1QJOA 2C5CA 1JOKA 4FF3A 3P1HA 2D5DA 3TS0A 3RZDB 1SE8A 1PH6A 2JN4A 2K14A 2K6AA 1Y1WG 4KI0A 1TY0A 1QILA 2MQHA 3M9BA 4NDXA 4KKTA 4L5SA 3RZOH 3T1HL 3I4LA 5HURA 2Z0SA 5ISRA 1TS3A 1F77A 2JA6B 2A68C 4POGA 1VS0A 4H0LC 1AP0A 5BR8Q 3DEOA 1PZJD 4GLAC 2UU9L 1LT5D 1VQFA 4OONA 4DA2A 4DAYA 1PH3A 2PW7A 5EAYA 4L5TA 1VQ6A 1S72A 2JYOA 1X55A 4LFAQ 1F2YA 1RDPD 4L5QA 4OHJA 4R8NA 2B2YA 1H9SB 1BNZA 1LUZA 1PFMA 1YI2A 5IGGA 2BE5D 3D4DA 2ZXOA 4PNYA 3UDIA 3JAMc 3MFGA 4YCVA 1F9RA 2AKWB 5JOBA 1OTCA 5CV8A 3HRZC 5D65A 3J80L 1SNOA 4EQNA 1U9RA 3NTIA 2E2HH 4G4KA 3ZYYX 2C35B 2DNCA 3H94A 4J6HA 1YNNC 1S5ED 4B9WA 1HZ9A 2L1BA 2K04A 4R1JA 5ELDA 1XMQQ 1SE3A 3FHWA 1CKOA 4DV7L 3BZDB 4JI7L 4LF9L 1N36Q 2KEDA 3HOWG 4LFBQ 3U9SA 3A56A 1L1OB 2ENBA 3CAMA 2FXQA 2YU9B 1GUWA 3NPPA 4KN4C 4R4QA 1HH2P 3HOWH 3FDTA 3LWUA 1EQVA 2DJFC 1AH9A 3GD7A 3H3VH 1G6PA 4A93H 5CMDA 2A74C 5J22A 3MWYW 3GV6A 1G51A 1O7YA 2F0SA 4AYBG 4S3SA 4JBJA 1Q8KA 3PQIA 2QW7A 1F9PA 3D3RA 4JG2A 4HCSA 4C3HG 4R4TA 1IBLL 4K14A 2KEEA 4IFDH 1FVIA 4GKJQ 3GV3A 3ERQA 2R93H 1HTPA 2O5JC 1H9MA 1CZGA 4X6AH 1IHZA 2F0UA 1PVOA 3DWAA 2FFKB 1YBYA 3DXJC 4NXNL 3NE5B 3QIAA 1MKHA 1TS4A 5IGBA 4DR3L 4GKKL 3CCUA 4KKSA 2EYPA 2VXWA 1F2MA 1EFWA 3H09A 4LJZC 3J7YW 4DV1L 2VUMG 2PO4A 1FNWA 4A93B 2KCTA 2K7VA 2JSOA 4ALPA 3CMEA 1FYCA 5JJLA 4JI4Q 4AYBB 2RA4A 4HR7B 1Y1VG 4DNRB 2JA5B 2ZXRA 3K0XA 5EPJA 3OIQA 1YNJC 3PUWA 4NPSA 4L6TB 1Q12A 1JQYD 4DV6L 5BN4A 1AW7A 3D4WA 5EPLA 3VYTA 1SNDA 1NAPA 2N3SA 2CFMA 1OXVA 3KBXA 4DR2L 3T51B 3DWPA 4UDUC 4ILWA 4R8IA 5HGTA 1N33Q 3ERSX 3K0YA 1PRTF 3HS0C 4OXPA 5IGCA 1SYBA 3TP8A 2CCZA 2B2WC 4IPGA 5IT9E 4B3ML 2LFNA 4UHVA 4XTCS 4POFA 2FINB 4R4OA 2K32A 4A3CH 2K33A 1VQNA 5C0XH 4DR4L 2MO0A 3J7ZC 4OO1G 2PPBC 4A3CG 1GHKA 5FOBB 4OO1H 1W3SA 2V1CC 2JA5H 2F0PA 1EY6A 3RMHA 3MXNA 2A5HA 2CQAA 3WDNA 1O7LA 3WOEA 4A3KH 4A3EB 1I6VC 4GKKQ 3QG1A 4P73A 1CHQD 4A3KG 2O4XA 2LXKA 4NXML 3J7AV 5DM63 3QO2A 5JJIA 5G3LF 2KJXA 3OTOL 4JI4L 1VQKA 1WVLA 4AQYQ 1BCPB 3T1YL 1K83H 2XGTA 3GDEA 2E2IH 3AEVA 4R4IA 1I5FA 3CPWA 3S24A 1GKHA 2BDNA 2EY6A 1TQOA 5G3LD 3CRLC 2Q2IA 5I2YA 4MIUA 1RTOA 1EZ6A 2LKVA 4YY3Q 2VQFL 1JR0D 4DXGA 1GUSA 2R93G 4HJ8A 2QCPX 1XNQQ 1TIID 3EN2A 3L2PA 3K8AA 2NTTA 2RBMA 3RN5A 1MHWC 1K8OA 1XNRL 1PFSA 3HFZB 2B8FA 2MHVA 4KY6A 1TS2A 3FKIG 1STBA 2PQAB 4KD4A 5GROA 3I91A 1KL9A 2HQLA 2IY5B 1WTQA 3LWEA 5FLMH 3TRZA 1E7ZA 1QCBD 4GOPA 1S5FD 1T5XD 3PIO3 1XPUA 3I72A 1K83B 1KLGD 3PGZA 1SYEA 4DV6Q 1WI5A 2F0LA 2L0CA 1FGUA 3L3OC 4B9XA 4QJFA 2ATWA 1YJ9A 1MSGA 4DV5Q 1AFPA 4DFAA 2O2LD 3K5MA 1J9OA 1O7ZA 3PF5A 4IJHA 2ID0A 4ME5A 1UWVA 1BCPC 3RLNA 4RG1A 5IP7G 2ZM6L 2B63G 4XT1B 1VQIA 1WTRA 1BBUA 4A3IB 1WTXA 1Q82C 4KTAA 3NENA 5F2DA 1VF5C 3PIP3 2IX0A 4A3JG 2A19A 1BR9A 4IQZA 2HIXA 4JOIC 1TWFH 4ME3A 2JA7G 1EZ8A 1XJVA 4O42A 5DEHA 4BY7B 4A3LH 3ICEA 1NMFA 1I6HH 5EKIA 5C3EG 1XMOQ 3OYYA 5C4HA 2KA7A 4PMWA 1GVPA 3SEBA 3NSWA 5KGUA 3H15A 1HFGA 2IX1A 1G6ZA 2ZXPA 4AQYL 2L4NA 4LMQD 3R8BA 4HJ5A 2WAQG 1HNZQ 2DJGC 2R92G 5CORA 5I6YA 1WTWA 1ZYRC 1K28A 3HOUH 4BBRH 1W6JA 1BUVT 1EY5A 4FYDA 1K9MC 1BBWA 2RHQB 3G6JB 1L1OC 2WKCA 3A7LA 1EIHA 2K01A 4A3FG 4EX5A 4JBWA 4A3MG 1KIXA 3NEMA 5C3WA 2JA8H 3U4ZA 1YNJD 4XIGS 1VQ8A 1CZWA 4DN4M 4H44C 2CKZB 1I6HB 4JI8Q 3HOYH 3IFTA 4BY7G 2EXDA 1BBXC 2EQSA 2ICEC 1CSPA 1B2TA 2K50A 1TXYA 1VQDA 5E4XA 4QIWB 4PMBA 1HUMA 1TY2A 1I4XA 5GQOA 4GLXA 3NQIA 4B3RL 2I0QA 3GTQH 3G48A 2F0OA 2C9OA 2UXDL 2K5VA 1HTLD 3FP9A 1DJRD 1JJGA 2N78A 4NP5A 4DAVA 2PYKA 3A5UA 1EY9A 1QNKA 2EVBA 4FVMA 1A3UA 1C48A 1Z9FA 4A3GG 4HIOA 2B2VC 3SE0A 2XRSD 1GUTA 3W1GA 4MTKA 4ZUJA 3KJPA 1PH4A 1JORA 1EYAA 1S5CD 2E8GA 4JBMA 1D1IA 1SNQA 1KDBA 4X3UA 4XQNA 1PH7A 3NBHA 1IBKL 4E6IA 2EOTA 4J1MA 4CDCC 4KHPQ 3VDYA 2EYMA 2Z4IA 1G291 1E22A 1BCPF 4YY3L 2VQFQ 1N34Q 2UUAQ 2F4VQ 3GTQB 5IYBH 1EEFD 4WRDA 3DUZA 3UDFA 3UI2A 1V1PA 1Q86C 2ZTCA 4AYBE 4QMGA 1PTOC 1SMXA 3QR8A 1D8LA 4DV4Q 3VR5A 1A2TA 3D4RA 5M9OA 5GAEC 4QY7A 1JCKB 4A76A 4QQBX 1ILPA 4DR1Q 1WCMH 3QB3A 4A3GB 1X9NA 2KCCA 5EKLA 5M3MB 4YCUA 1AE2A 4IPDA 3CCSA 3GTMH 2BA1A 3C2PA 3W2DA 4RHRA 5D3IB 2WFWA 1VQ7A 2L12A 4DR7L 4C1NK 3TP6A 1EIFA 1LT6D 4CDFC 3RD4A 4PZ6A 1D7QA 2WAQE 2H5XA 3K80C 2GVAA 3MXPA 4A3DB 5FO7B 3KDFB 1ENCA 3KLSX 3TMEA 4DK0A 5LMUL 5C3XA 1Y8NB 3NBHB 1EYGA 4FF1A 3I4OA 1RTNA 1H9KA 2Q8RE 2PZWA 4GOPC 4KHPL 2OQ0A 1LTAD 4GNXC 3HZXA 3AMUA 1SFOB 3I8ZA 1N34L 4ZLTF 2UUAL 2FJ2A 2R61A 4LWCA 4ZCKA 3PO3H 2PMZB 3HEJA 1JOOA 4DV1Q 2RDGA 3CCJA 3HOVG 3I2ZA 2WIIB 5FKAC 3BVGA 2RKSA 5AFWA 4DXFA 3S2HH 3J81c 3F1ZA 1PH8A 2EJGC 2A69D 1V1OA 2DGYA 2VB3X 1ENAA 4DUYQ 5KEEA 2NYZD 4UAIA 4WFN3 4ZQ3A 4JI5L 1YHBA 1FR3A 4Q0FA 4HCEA 5K36H 2BOSA 1CKNA 1EU3A 3QOLA 2EE1A 3HOZH 3I70A 5IGFA 1RCVD 2PQAA 4IFDG 1JB3A 4QL5A 1CTMA 1DCZA 3TS2A 3TP7A 4DV4L 4F87A 2WP8J 3M7GA 1JICA 2VY3A 4B3TL 4OEMB 1OXTA 3PUZA 1HQRD 2XSCA 1AZQA 2EY2A 3S2HB 2IWHA 1L2FA 3T56B 1I4HA 3D6CA 4XXEA 2F0JA 1Y1WH 4O1NA 5ELFA 3A0JA 2UXDQ 2KECA 2PZTA 2R7FA 3KYHC 4OIKA 3RUZA 1IYVA 4NXNQ 4MN3A 2YTXA 4IUTA 3L0OA 1GO3E 2AWOA 2Z4HA 3W1BA 4OWWB 3S17B 3AB9A 1T5EA 3TSSA 2K52A 1E1OA 1STEA 3S2DH 3J80i 1TR5A 1U4PA 2X6LA 2WB1G 3R2TA 4P2CB 5LMUQ 2JA6G 4CDEC 2K5QA 3OSOA 2NZ1D 1K8MA 3DMUA 5LHY1 1RODA 2F0TA 1X3QA 2JEBI 1PRTC 2MPMA 4JI5Q 5FJ8G 1WJJA 3M4QA 4QUCA 5I9PA 4HSVA 4GN4B 1Q1EA 1KRTA 1V1QA 3FMCA 1SMYD 4OO1I 1QVFA 4C3IH 1HR0Q 4DU9A 3S15H 2HCIA 3OHXC 2J7ZA 3R2IA 3PF4A 2J0TD 5D3DA 4RGOS 4FF2A 4G7HC 3TP5A 5J39A 2K28A 2A68D 2RSNA 4DGZA 3BJUA 4X65Q 3SR1A 2F03A 3CKIB 4ZYSA 1MI2A 4R4CA 1K3BC 4JI6L 3URYA 5FLXE 1SNPA 5IT9c 2RCNA 1SBBB 3L7ZC 1I4GA 4EQ5A 3VR3A 1SN8A 3EROA 1B3AA 2Y0SB 3A5ZB 3LX0A 5C4JB 2DUDA 5EJWA 1WOCA 4OGQC 1YZ6A 3S14H 3T13A 4RMFA 1HR0W 4RCNA 3HOZG 3S1NB 1K73C 2Q2UA 2SOBA 4A3MH 4TSSA 1H95A 2N88A 1D5XC 5KRUA 2Z6KC 3RN2A 4FP5D 1I50B 2TSSA 1PZKD 2E5LQ 2ZJRA 1FGBD 1GUOA 2IJ0A 3MFYA 4QCLA 2E75C 4NMZA 1BO0A 1XNQL 1LABA 3I3CA 4PV1C 2R92B 2A69C 3OMCA 2NN6H 5DM73 1DOLA 1ICWA 3MEFA 1CFMA 2RHSB 5I2XA 3I4MH 4IUQA 1QZGA 5CV7A 4GS3A 1TWCH 4JV5Q 1Q8IA 3HKSA 1NR2A 4ZUIA 4OX9L 5L37A 5M3FB 4A3MB 1LLRD 1VMPA 4A93G 1I94L 4O2DA 2X6GA 1SXTA 1PYSB 2NVTH 5IP7H 3HOXH 4GNXA 2ZT9C 1ASZA 4KK7A 4X64Q 4ODGA 3LNNA 5E1FA 4C3HH 1CK1A 1MJCA 5IWAL 4BWGB 4X3SA 1Q90A 4C3JG 4LUZA 4A3JH 2BDOA 1DM0B 1IBLQ 1ESFA 4JI1Q 4Y52H 1NR4A 4N8FA 5JAVA 4B3TQ 2BH8A 1MBYA 2OWOA 1C4QA 1SEBD 1HPCA 1NNXA 3PV0A 2M00A 2ICIA 3I4MB 4JI6Q 3OWFA 3HKZG 3VYUA 2CHBD 4EQOA 1TWCB 2D0OA 4QGUA 2ZJPA 3H3VI 1ZKOA 3S16B 1IKLA 1VF7A 4KN7C 3UE1A 2L9HA 1Q7YC 4A75A 4RFBA 2IPKD 1E0BA 1M1KC 1CT1D 2AQ3B 1NBWA 3CW2C 4CDDC 1Y14B 3WOFA 1KDAA 3SK6A 2MUYA 1D5MC 1IL8A 2B2WA 3K58A 3T4AC 3T53B 1B8AA 1R4PB 2JK8A 2F0KA 2LXJA 1EQQA 2M2LA 2XIWA 1XPRA 4OX9Q 4LF7Q 1FNUA 1U4RA 3J7AF 4K5XA 2VQEQ 2IW3A 3F8TA 1X56A 3O13A 3GO5A 3J81E 1R4QB 3KUPA 3A8IE 4CKBA 3S16H 4ABNA 5C44B 5IWAQ 3M4PA 1KAWA 1V1PB 2KCMA 4H7BA 3TREA 2I46A 3STBD 4BBSB 5M3MG 3GTJB 2WB1E 3PO3G 1GOZA 1VQ4A 3PUYA 4GOPB 4DR1L 3F2BA 1HNWL 3M3YH 2NN6G 4DK6C 5M5WB 4XYQA 3VA7A 5C0XI 1RD9D 4HJ9A 3MAQA 1LTBD 1BF4A 2CW0C 2FMCA 3OW7A 3VA5A 1QB5D 1LYLA 4B08A 3ND9A 4WJWA 1STNA 2E74C 5I4DA 1ASYA 2VS1A 1KC8C 2G9DA 2G9HD 1HRJA 2A6ED 4KLKA 3GTLB 1II3A 3K59A 4OWTB 1V9PA 5LMNW 3OTOQ 1JJ2A 2OXPA 3F2CA 4JI0L 1SROA 3OPOA 2Y0SE 4I7ZC 4BY1H 3HGBA 4R9WA 4YWMA 1K8GA 1LTGD 3K7UC 4RKLA 5IYBG 3UE0A 4BBSG 1W2BA 4CHTB 4F7XA 4DF7A 4K5VA 3M3YB 1CKMA 4RGTA 4KJOA 1IYUA 4X3KA 1A63A 4K2KA 2E5LL 1DOMA 2F4VL 1KLUD 4HMJA 5COYA 4FF4A 2NB0A 2OT2A 1FL0A 3ONAB 3I90A 1SLJA 5C3EH 1EY0A 5EPKA 2JQOA 4I65A 4RA8A 4ZKCB 4EQPA 1ZYRD 3BS1A 1JC7A 1SNCA 1SYDA 4ZKBB 5M5YH 3CC4A 4WJ3M 2F0VA 3GTLH 4FDBA 3H3VC 1Y69U 2E2JB 2EIFA 5EBDA 2F3WA 3CU7A 2HQEA 3NWTA 3IAYA 1VCIA 4KY5A 1JWUD 2F0QA 4MNOA 1G91A 1ET6A 1ESRA 4CJ2C 3U50C 1VQCA 2NZOA 4A3FH 2DNEA 4DR7Q 3NBIA 2OTJA 2YV5A 4JI0Q 1D6EC 1TWAB 1TKWB 2A1AA 3RZDH 2OQKA 2GN5A 4JBKA 4RKBA 5C3EB 1BCPD 1WTPA 1D2BA 4DAPA 2D9UA 1Z6HA 1H9SA 3J7A5 4L63B 1JMCA 2PI2E 1NTGA 1Q3LA 2CQOA 2D2CC 1ENFA 2E2JH 3HOVH 1L1OA 2XRQD 3DEPA 2JA5G 4XYOA 2A6EC 5C6AA 1LTID 1O80A 2SNSA 4GNXB 2F0MA 2XVSA 4NXMQ 1LTSD 3MXGA 5I9OA 2QKIC 5IE8A 4A3FB 4H02A 2HCCA 2P5ZX 1HNZL 4JCVE 5C4XB 5GADC 1TWAH 1EWCA 2AQ1B 4PMCA 2B39A 4B3SL 4DNTB 4DUYL 3SXHA 1BQQT 5D14A 4C2MH 2F0DA 3RNUA 2BE5C 4F8MA 4LF7L 1VQPA 2V4DA 3VR6A 2VQEL 4JI3Q 1MJEA 2B29A 2E2HB 2K03A 2RDHA 1STYA 3NK9A 1IYJB 3STBC 2WACA 5IYDG 1X3FA 5DNFA 1EQRA 1UE5A 3BVZA 4IURA 2B2VA 3K57A 3L9AX 3LGJA 4RWSC 5FK9C 3IL8A 4RAUC 1VQOA 5CV5A 3EA6A 4G57A 2KHSA 3HG9A 1K3RA 3PO2G 4DV7Q 5BN5A 3G6EA 1FD7D 1VQAA 3S1MB 1F2LA 1VQEA 1UE1A 3CC2A 2X69A 3CF5A 1B7YB 3T16A 3E6ZX 2Y0SG 2ALYB 2B2UA 2I5HA 2EPBA 1YVCA 2QA4A 4C2MB 5KYLA 2EYLA 2K5WA 3RZOB 2Q2HA 1J8IA 5BR8L 3D6WA 1WYDA 4NW2A 5AJ3L 5TSSA 2SEBD 3I56A 2UXBL 3K5OA 1PLFA 5GAGC 2K4KA 5IYCG 5CBAE 1XTCD 2R93B 2WV6D 5IYCH 4GKJL 3K7AB 2B8GA 2VB2X 3QOJA 1PV4A 1DOKA 4APVA 4RCOA 3U58A 1M4VA
chains in the Genus database with same CATH topology
5A2QE 3PUVA 1EWHA 1STHA 2HDMA 1OXXK 3N6RA 4IUVA 2PZUA 4C1NI 1AZPA 5E3FA 3VYRA 3OOCA 3EJIA 2D62A 3GP7A 1LV9A 1EOTA 1UAPA 2H4OA 1SE4A 4FXKC 3W3AA 2Q8TA 5C5LA 1BXTA 3V05A 1BDOA 3CRKC 4OIJA 3K5NA 2NBFA 1O78A 1JOQA 2EJFC 1Z7TA 1WTVA 5T1IA 3HOWB 3R3OA 2K05A 1B9MA 4TQUS 2F0GA 1ML0D 1HHVA 1DZ1A 2K5DA 3K6OA 4V190 1HXYD 3MEHA 3CQZB 5A35A 1MGSA 4A3KB 5IIFA 1TVXA 2QDBA 5KNCA 3C1EA 5ELEA 4A3BB 1GUGA 2F0HA 1B50A 5JPMC 4KMUC 4WORA 1SYFA 4ULLA 2XWJB 4CKEA 2LS01 1L0XB 3EVQA 2R6GA 3QJYA 5EKKA 3GTGB 4BA2I 4CJ1B 5C0XJ 1SMYC 3M7NA 1PMRA 4N9PA 1LO5D 1Y8OB 1SDFA 2JE6I 4Z9CB 5C4ZA 5JPNC 1I3QB 2KOLA 2R7ZB 1TT2A 1A2UA 2RSOA 5IT9L 5JVG3 4TKOB 4OL7A 1Q1BA 1LT4D 2NVYB 3Q24A 1TS5A 3EFXD 1B44D 1Z47A 1CI3M 2AWNA 5CGKA 1IKMA 2XN9C 2EYHA 4K2LA 1QE6A 1EY8A 4RGMA 3QWNA 1KNEA 3EQLC 3K5LA 4LAAA 1PFNA 2KVMA 4ZAIA 2B2TC 2XNAC 2RDFA 2Q8IB 2PCFB 1X3PA 3GTOB 4TRDA 2XWBB 1RHPA 1TWFB 1EY4A 5EQ0A 2F0FA 3MXUA 1VDZA 1U4LA 1KABA 1SSOA 1STGA 2E2IB 1MD2D 4IFDJ 4IZ8A 4HMIA 4K8JA 1I4RA 1CHPD 3M4OB 5KYIA 2VNUD 3IKJA 1EU4A 5JEAJ 2JP1A 5JJZA 2L5TA 1JWMD 4IUPA 3TN2A 2EJMA 3SK8A 1Y8PB 3HOUB 1HCZA 1JWSD 3FKIB 1HA5A 2NVXB 1L0YB 3FRPB 2RVLA 2JEAI 3FPPA 4U673 1A15A 4M8AA 3VR2A 1XX8A 3GQBA 3J80E 4IALA 1V43A 4ZRZA 1DXMA 1SJED 2AUJD 2KUMA 4QUFA 2EYJA 3NUCA 3FEWX 2IT1A 1PTOF 3A8KE 4Y7NB 1SNMA 2CVRA 1A6XA 1HFNA 1I4PA 1PTOH 1ZEQX 3HKZB 4X3TA 3JAML 3MVVA 1OXSC 3S9WA 3DWQA 3P7JA 4FXGC 1TU2B 4ZK9B 4CBVA 5LL6S 2DY7A 1IW7D 4NKLA 1EIGA 3TDQA 4KHVA 2QEJC 4BBRB 1UNSA 4KHZA 4K8IA 1DD2A 4MHEA 1E2WA 2EYFA 2JA8B 1WCMB 5C0XG 4BA1I 1PTOB 1CM9A 3SHLA 3HOYB 4QF4A 3CHBD 1ET9A 1QOHA 1HQMC 4IN3A 3S1RB 2B2YC 2KQ3A 2F0EA 3BDLA 3FPUB 2F0IA 3SDZA 1UEAB 4M1UB 2EZVA 2MP1A 1PXUA 1EFID 2NVQB 3VR4A 4U68A 4XQQA 4XDXA 3KK7A 1PDQA 1STAA 1SYCA 1W6KA 2TMPA 3FVQA 3PMFA 1H9JA 5CBEE 3PO3B 4CJ0B 3KLSA 1B9NA 1B1ZA 4KKUA 3GTKB 2B63B 4FNFA 3D8GA 3TZUA 3OIPA 5I6WA 2NN6I 5FO9B 4KD3A 5KNBA 5CV4A 2B2TA 4EVOA 1MSHA 3N52A 2F1MA 1C8CA 1ILQA 1F9QA 2HDLA 3V2TA 3ITPA 3G7LA 1CQVA 5DAUA 2WKDA 4RGNA 4H13C 3HOZB 4N9TA 5JEAG 2K1BA 2L55A 4BS9A 4HAEA 1LTTD 2HUGA 1OXUA 3GTMB 5J1ZA 1KDCA 2GA4B 1GUNA 1LACA 1CA5A 3X3MA 1D5ZC 1A3VA 2FHTA 2KCNA 3MZ5A 1SJHD 3RLFA 5ELCA 1E2VA 5A2QL 1JE4A 3A7AB 1PYWD 4ID6A 5CC4A 1LTRD 3H6MA 2EXZA 2OEOA 5CV6A 4IUNA 3BYTB 3VYSA 3DHQA 4K6DA 3HP3A 3KF8A 2OF1A 1CA6A 4RHSA 1LT3D 2SNMA 1B4OA 3SVMA 1G2TA 3MHBA 5CYUA 3SK4A 3PUXA 2IX3A 1S4ZA 2JXMB 3M4YA 3MTSA 2R3ZA 1KAAA 2QF7A 3BVMA 5T1GA 4EGVA 3H0GB 3V96A 2QILA 3OMGA 1A3TA 2NTSA 3M85A 2E76C 1WD0A 3KLRA 5CV9A 1Y1WB 3PO2B 3A54A 1EY7A 3P75A 3S14B 2Z8LA 5JEAH 5ELBA 4L8JA 2RQXA 3BDOA 4QB4A 4G7OC 1HUNA 1V8QA 1WD1A 1TWGB 3S2DB 2YYZA 5JVH3 2EYOA 2B2UC 1PRTD 1SYGA 2MJ8A 3MA2B 3J81L 1NSNS 2LY7A 3U9OA 3NTHA 4C3IB 2L11A 3ND8A 3S15B 1S5DD 2JA7B 2E2DC 3KBGA 4HTHA 2PQEA 1S5BD 4HEDA 1GXDC 3HOXB 1G2SA 3MC0B 3BG3A 1ZXTA 4C3HB 1QG7A 1EL0A 2NUCA 3Q6SA 4A3JB 4HSPA 3IFDA 2F4IA 3DM1A 2EY5A 1TWHB 2MGSA 3GTPB 4XT3B 4YIJA 2F0NA 3TBIB 5IOCA 3BYYB 2J4XA 4F88A 4IFDI 3R93A 4C3IG 4FXDA 3C3LA 3A8JE 1QNUA 3D31A 5EGTA 3NHHA 4V0BA 5BN3A 4GZYC 1Y1VB 1HA6A 5IGDA 4JK1C 3SK5A 3E5SA 1E2ZA 4J8QA 2IL8A 1FNVA 1RJTA 2A6HD 2VUMB 1DYQA 1VMCA 2Z1CA 1F2ZA 2NWGA 1XWEA 4KJNA 5KNDA 2M9VA 1SE2A 2WINB 2NVTB 1U4MA 4K5WA 1X32A 3X3NA 2FMMA 3TZDA 5K5PA 2O5IC 4DK1A 2PNRC 4CKCA 2A73B 3Q23A 2CW0D 3P20A 2N55A 4IUUA 1CQFA 5CR3A 4Q5VA 1UUPA 4BY1B 2SDFA 4XQJA 1SAPA 4PQXA 4CGYB 2AQ2B 4K6LA 4RH6A 1KNAA 5C5MA 2EDGA 1DONA 1F9SA 4KV6A 1BOSA 3Q0AA 2BA0A 1WTOA 1KTKA 1NCVA 3H91A 1RF2D 3C46A 1G8ZD 3Q22A 4LK1C 3AU7A 1I4QA 5M5YB 2AUKA 1EYDA 3F2UA 3NWSA 1OO9B 1XXGA 1PTOD 2I07B 1YNND 3C1FA 5LL6X 3NQTA 1M8AA 3BDCA 2EY1A 1XYIA 3OWEB 5K36G 1D1KA 1EYCA 3NP8A 5M5XB 2BCOA 5FO8B 2F0WA 1R9TB 1NUCA 5IODA 3JAME 3HOVB 1PZID 1B53A 2DY8A 1AEXA 5E4WC 1QWYA 1RKNA 4C3JB 4FO2A 4G7ZC 5NUCA 1PRTB 1EEID 1EQTA 1GHJA 2WAQB 3S1QB 1PFBA 5KIXA 1H9RA 3NXWA 3I4NB 4HN7A 5FLXL 2PW5A 3A55A 3E0JA 3I73A 2A6HC 2LMCB 3NTKA 4C56C 1IW7C 5EBCA 4KY7A 2H1EA 1ONLA 2WB1B 2F3VA 1GJXA 2DN8A 5IGEA 1AN8A 1QJOA 2C5CA 1JOKA 4FF3A 3P1HA 2D5DA 3RZDB 2K6AA 4KI0A 1TY0A 1QILA 4NDXA 4KKTA 3I4LA 5HURA 5ISRA 1TS3A 1F77A 2JA6B 2A68C 4H0LC 1AP0A 3DEOA 1PZJD 1LT5D 4DA2A 4DAYA 2PW7A 2JYOA 1F2YA 1RDPD 4OHJA 4R8NA 2B2YA 1H9SB 1BNZA 1PFMA 5IGGA 2BE5D 3D4DA 2ZXOA 4PNYA 3MFGA 1F9RA 5JOBA 5CV8A 3HRZC 5D65A 3J80L 1SNOA 4EQNA 1U9RA 3NTIA 4G4KA 3ZYYX 2DNCA 3H94A 4J6HA 1YNNC 1S5ED 4B9WA 2L1BA 2K04A 5ELDA 1SE3A 3BZDB 2KEDA 3U9SA 3A56A 2YU9B 2ENBA 1GUWA 3NPPA 4KN4C 3FDTA 3LWUA 1EQVA 3GD7A 5CMDA 2A74C 5J22A 3MWYW 3GV6A 2F0SA 1O7YA 4S3SA 1F9PA 3D3RA 4HCSA 4C3HG 4K14A 2KEEA 4IFDH 3GV3A 3ERQA 1HTPA 2O5JC 1H9MA 1CZGA 1IHZA 2F0UA 3DWAA 2FFKB 3DXJC 3NE5B 3QIAA 1TS4A 5IGBA 4KKSA 2EYPA 2VXWA 1F2MA 3H09A 4LJZC 3J7YW 2PO4A 1FNWA 4A93B 2K7VA 2JSOA 1FYCA 4AYBB 2RA4A 4HR7B 4DNRB 2JA5B 2ZXRA 5EPJA 3OIQA 1YNJC 3PUWA 4L6TB 1Q12A 1JQYD 5BN4A 1AW7A 3D4WA 5EPLA 3VYTA 1SNDA 1NAPA 1OXVA 3KBXA 3T51B 3DWPA 4UDUC 4ILWA 4R8IA 5HGTA 3K0YA 1PRTF 3HS0C 5IGCA 1SYBA 3TP8A 2B2WC 5IT9E 2LFNA 4XTCS 2FINB 2K32A 2K33A 5C0XH 4OO1G 2PPBC 1GHKA 5FOBB 4OO1H 2F0PA 1EY6A 3RMHA 3MXNA 2A5HA 2CQAA 3WDNA 1O7LA 3WOEA 4A3EB 1I6VC 3QG1A 1CHQD 2O4XA 3J7AV 5DM63 3QO2A 5G3LF 2KJXA 1WVLA 1BCPB 2BDNA 2EY6A 1TQOA 5G3LD 3CRLC 5I2YA 4MIUA 1RTOA 1EZ6A 2LKVA 1JR0D 4DXGA 1GUSA 2QCPX 1TIID 2NTTA 2RBMA 1K8OA 2B8FA 2MHVA 4KY6A 1TS2A 1STBA 4KD4A 3I91A 1WTQA 3LWEA 1QCBD 1S5FD 1T5XD 3PIO3 3I72A 1K83B 1KLGD 1SYEA 2F0LA 2L0CA 3L3OC 4B9XA 1MSGA 1AFPA 4DFAA 2O2LD 3K5MA 1J9OA 1O7ZA 2ID0A 4ME5A 1BCPC 4XT1B 1WTRA 1WTXA 4A3IB 4KTAA 5F2DA 1VF5C 3PIP3 2IX0A 1BR9A 4IQZA 1EZ8A 4O42A 5DEHA 4BY7B 5EKIA 5C4HA 2KA7A 4PMWA 3SEBA 3NSWA 5KGUA 1HFGA 2IX1A 1G6ZA 2ZXPA 2L4NA 4LMQD 3R8BA 5CORA 5I6YA 1WTWA 1ZYRC 1W6JA 1BUVT 1EY5A 4FYDA 3G6JB 2WKCA 3A7LA 1EIHA 2K01A 4JBWA 5C3WA 1YNJD 4XIGS 1CZWA 4DN4M 4H44C 1I6HB 3IFTA 1BBXC 2ICEC 1B2TA 5E4XA 4QIWB 4PMBA 1HUMA 1TY2A 1I4XA 3NQIA 2F0OA 2C9OA 1HTLD 1DJRD 4NP5A 4DAVA 2PYKA 1EY9A 1QNKA 2EVBA 4FVMA 1A3UA 1C48A 2B2VC 3SE0A 2XRSD 1GUTA 4ZUJA 1JORA 1EYAA 1S5CD 1D1IA 1SNQA 1KDBA 4XQNA 4X3UA 3NBHA 4E6IA 2EOTA 4J1MA 2EYMA 2Z4IA 1G291 1BCPF 3GTQB 1EEFD 4WRDA 3DUZA 3UI2A 1V1PA 4QMGA 1PTOC 3VR5A 1A2TA 3D4RA 5M9OA 1JCKB 1ILPA 3QB3A 4A3GB 2KCCA 5EKLA 5M3MB 2BA1A 3C2PA 3W2DA 4RHRA 5D3IB 2L12A 4C1NK 3TP6A 1LT6D 3RD4A 3MXPA 4A3DB 5FO7B 1ENCA 3KLSX 3TMEA 4DK0A 5C3XA 1Y8NB 4FF1A 1RTNA 1H9KA 2Q8RE 2PZWA 1LTAD 3AMUA 3HZXA 1SFOB 3I8ZA 4ZLTF 2FJ2A 2R61A 2PMZB 3HEJA 1JOOA 2RDGA 2WIIB 5FKAC 3BVGA 2RKSA 5AFWA 4DXFA 2EJGC 2A69D 1V1OA 2VB3X 1ENAA 5KEEA 2NYZD 4UAIA 4WFN3 4ZQ3A 1FR3A 4Q0FA 4HCEA 5K36H 2BOSA 1EU3A 3QOLA 2EE1A 3I70A 5IGFA 1RCVD 4IFDG 1JB3A 1CTMA 1DCZA 3TP7A 4F87A 2WP8J 3M7GA 1JICA 1OXTA 3PUZA 1HQRD 2XSCA 1AZQA 2EY2A 3S2HB 2IWHA 3T56B 1I4HA 3D6CA 4XXEA 2F0JA 4O1NA 5ELFA 2KECA 2PZTA 4OIKA 3RUZA 1IYVA 4MN3A 4IUTA 2Z4HA 2AWOA 3S17B 3AB9A 1T5EA 3TSSA 1STEA 1TR5A 1U4PA 2X6LA 3R2TA 4P2CB 2K5QA 3OSOA 2NZ1D 1K8MA 3DMUA 5LHY1 1RODA 2F0TA 1X3QA 2JEBI 1PRTC 2MPMA 4QUCA 5I9PA 4HSVA 1Q1EA 3FMCA 1SMYD 4OO1I 4DU9A 2HCIA 3OHXC 2J7ZA 3R2IA 2J0TD 5D3DA 4RGOS 4FF2A 4G7HC 3TP5A 5J39A 2K28A 2A68D 2RSNA 4DGZA 3SR1A 2F03A 3CKIB 4ZYSA 1MI2A 3URYA 5FLXE 1SNPA 1SBBB 3L7ZC 1I4GA 3VR3A 3EROA 1B3AA 2Y0SB 3LX0A 5C4JB 5EJWA 4OGQC 3T13A 4RCNA 3S1NB 2SOBA 4TSSA 2N88A 1D5XC 5KRUA 4FP5D 1I50B 2TSSA 1PZKD 1FGBD 1GUOA 2IJ0A 3MFYA 4QCLA 2E75C 4NMZA 1BO0A 1LABA 3I3CA 4PV1C 2R92B 2A69C 3OMCA 2NN6H 5DM73 1DOLA 1ICWA 1CFMA 5I2XA 4IUQA 5CV7A 1Q8IA 4ZUIA 1NR2A 5M3FB 4A3MB 1LLRD 1VMPA 2X6GA 1SXTA 2ZT9C 4KK7A 4ODGA 3LNNA 5E1FA 1CK1A 4BWGB 4X3SA 1Q90A 4C3JG 2BDOA 1DM0B 1ESFA 1NR4A 5JAVA 1MBYA 1C4QA 1SEBD 1HPCA 3PV0A 2M00A 2ICIA 3I4MB 3OWFA 3VYUA 2CHBD 4EQOA 1TWCB 1ZKOA 3S16B 1IKLA 1VF7A 4KN7C 2L9HA 4RFBA 2IPKD 1E0BA 1CT1D 2AQ3B 3WOFA 1KDAA 3SK6A 2MUYA 1D5MC 1IL8A 2B2WA 3K58A 3T4AC 3T53B 1R4PB 2F0KA 2M2LA 2XIWA 1FNUA 1U4RA 3J7AF 4K5XA 2IW3A 3O13A 3GO5A 3J81E 1R4QB 3KUPA 3A8IE 4CKBA 4ABNA 5C44B 1V1PB 4H7BA 2I46A 4BBSB 3GTJB 1GOZA 3PUYA 2NN6G 5M5WB 4XYQA 3VA7A 5C0XI 1RD9D 3MAQA 1LTBD 1BF4A 2CW0C 2FMCA 3OW7A 3VA5A 1QB5D 4B08A 3ND9A 4WJWA 1STNA 2E74C 5I4DA 2G9DA 2G9HD 1HRJA 2A6ED 3GTLB 1II3A 3K59A 2OXPA 3OPOA 4I7ZC 3HGBA 4R9WA 1LTGD 4RKLA 4CHTB 4F7XA 4DF7A 4K5VA 3M3YB 4RGTA 4KJOA 1IYUA 4X3KA 4K2KA 1DOMA 1KLUD 4HMJA 5COYA 4FF4A 2NB0A 2OT2A 3ONAB 3I90A 1EY0A 5EPKA 4I65A 4RA8A 4ZKCB 4EQPA 3BS1A 1ZYRD 1JC7A 1SYDA 1SNCA 4ZKBB 2F0VA 3H3VC 1Y69U 2E2JB 5EBDA 2F3WA 3CU7A 2HQEA 3NWTA 3IAYA 1VCIA 4KY5A 1JWUD 2F0QA 1G91A 4CJ2C 1ET6A 1ESRA 2DNEA 3NBIA 1D6EC 1TWAB 1TKWB 4RKBA 5C3EB 1BCPD 1WTPA 1D2BA 4DAPA 2D9UA 1Z6HA 1H9SA 4L63B 1Q3LA 2D2CC 1ENFA 2XRQD 3DEPA 4XYOA 2A6EC 5C6AA 1LTID 1O80A 2SNSA 2F0MA 2XVSA 1LTSD 3MXGA 5I9OA 2QKIC 4A3FB 2HCCA 5C4XB 1EWCA 2AQ1B 4PMCA 2B39A 4DNTB 3SXHA 1BQQT 5D14A 2F0DA 2BE5C 4F8MA 2V4DA 3VR6A 2E2HB 2K03A 2RDHA 1STYA 3NK9A 2WACA 3K57A 5DNFA 3BVZA 4IURA 2B2VA 3L9AX 4RWSC 5FK9C 3IL8A 4RAUC 5CV5A 3EA6A 4G57A 2KHSA 3HG9A 5BN5A 1FD7D 3S1MB 1F2LA 2X69A 3T16A 3E6ZX 2B2UA 2EPBA 4C2MB 5KYLA 2EYLA 2K5WA 3RZOB 1J8IA 3D6WA 4NW2A 5TSSA 2SEBD 3K5OA 1PLFA 5CBAE 1XTCD 2R93B 2WV6D 3K7AB 2B8GA 2VB2X 3QOJA 1DOKA 4RCOA 1M4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D1I A;  2GA4 B;  2C5C A;  1CZW A;  1QNU A;  1CZG A;  1D1K A;  4M1U B;  1BOS A;  1R4P B;  1C48 A;  1CQF A;  2XSC A;  1DM0 B;  1R4Q B;  4P2C B;  1QOH A;  1C4Q A;  2BOS A;  3MXG A;  4ULL A; 
#chains in the Genus database with same CATH topology
 4P75 A;  3PUV A;  5A2Q E;  1EWH A;  1STH A;  3S1M H;  2HDM A;  2UUB Q;  1OXX K;  3N6R A;  4IUV A;  2PZU A;  4C1N I;  3TQY A;  1AZP A;  2K5H A;  5E3F A;  3JAM i;  3VYR A;  3OOC A;  3WWV A;  3EJI A;  1C7Y A;  3AFP A;  1YEZ A;  2D62 A;  3GP7 A;  1LV9 A;  2CWA A;  1EOT A;  1UAP A;  2H4O A;  1SE4 A;  4FXK C;  3W3A A;  2Q8T A;  5C5L A;  1BXT A;  3V05 A;  3DLL A;  1BDO A;  3CRK C;  3K7A H;  4OIJ A;  3K5N A;  2NBF A;  1O78 A;  1JOQ A;  2EJF C;  2YU9 H;  1Z7T A;  1WTV A;  4BXX H;  5T1I A;  3HOW B;  3R3O A;  2K05 A;  1B9M A;  4TQU S;  2F0G A;  1ML0 D;  1HHV A;  1DZ1 A;  2K5D A;  1HZC A;  1PH9 A;  3GTG H;  1JE5 A;  5FLX c;  1C9O A;  3K6O A;  4V19 0;  1HXY D;  3JC6 6;  1PH5 A;  3MEH A;  1HNX Q;  4DR4 Q;  3AFQ A;  3CQZ B;  5A35 A;  4YCW A;  1MGS A;  4A3K B;  1B3Q A;  5IIF A;  2OTL A;  3B6Y A;  1TVX A;  2QDB A;  5KNC A;  3C1E A;  5ELE A;  4A3B B;  1GUG A;  2F0H A;  1B50 A;  5JPM C;  4KMU C;  4WOR A;  2HHH L;  1SYF A;  2K5N A;  4ULL A;  2XWJ B;  4CKE A;  4IO9 A;  2LS0 1;  2NVY H;  1EOV A;  1L0X B;  3EVQ A;  2R6G A;  1Q81 C;  3QJY A;  3CCL A;  5EKK A;  3GTG B;  4BA2 I;  1A0I A;  4PZ7 A;  4CJ1 B;  5C0X J;  4UP7 A;  1SMY C;  2I5M X;  2UUB L;  3M7N A;  3CQZ H;  1PMR A;  5FJ8 H;  4N9P A;  1LO5 D;  1Y8O B;  4BY1 G;  1SDF A;  2JE6 I;  4Z9C B;  5C4Z A;  5JPN C;  1I3Q B;  1NY4 A;  2KOL A;  1TT2 A;  2R7Z B;  4JW0 A;  1XTD A;  1S40 A;  1A2U A;  4X64 L;  2RSO A;  5IT9 L;  5JVG 3;  4TKO B;  1N8R C;  4A3B H;  4GN5 A;  2RF4 A;  4OL7 A;  1Q1B A;  3KOJ A;  1LT4 D;  1QUQ A;  3BZK A;  1C0A A;  1RL2 A;  2NVY B;  3Q24 A;  3PSI A;  3KDF A;  2HT1 A;  1TS5 A;  3EFX D;  1B44 D;  1Z47 A;  4L5R C;  1CI3 M;  3T1H Q;  2AWN A;  5CGK A;  1IKM A;  2XN9 C;  3M4O H;  2EYH A;  4K2L A;  2PI2 A;  1QE6 A;  3H0G G;  1EY8 A;  4RGM A;  4DNI A;  3QWN A;  1KNE A;  3J80 c;  3EQL C;  3K5L A;  4LAA A;  1PFN A;  4LW1 A;  2HHH Q;  2KVM A;  3U4V A;  4ZAI A;  2B2T C;  2XNA C;  2RDF A;  4A3E H;  3HOU G;  2Q8I B;  2ZM6 Q;  1I3Q H;  2R7Z H;  4IPH A;  4A3E G;  2PCF B;  1X3P A;  2R7Z G;  3GTO B;  2N49 A;  4TRD A;  2XWB B;  4LFA L;  1U0L A;  1RHP A;  1NJI C;  2AMC B;  3T1Y Q;  1TWF B;  1EY4 A;  5EQ0 A;  2F0F A;  3MXU A;  1VDZ A;  1U4L A;  1KAB A;  1RIP A;  1SSO A;  1STG A;  4AIM A;  4BY7 H;  2E2I B;  1LTL A;  1MD2 D;  4IFD J;  4IZ8 A;  4HMI A;  4K8J A;  1I4R A;  1CHP D;  3M4O B;  5KYI A;  2VNU D;  3IKJ A;  1EU4 A;  3OW2 A;  5JEA J;  2JP1 A;  5JJZ A;  1BKB A;  2L5T A;  4JOI A;  1JWM D;  1QUQ B;  4IUP A;  3TN2 A;  1N32 L;  2EJM A;  2MFI A;  3SK8 A;  4LF9 Q;  1Y8P B;  2VL6 A;  3HOU B;  1HCZ A;  3CP0 A;  3GTO H;  1HNW Q;  1JWS D;  3FKI B;  4HIK A;  1HA5 A;  3BU2 A;  2NVX B;  1L0Y B;  2Q2T A;  4Y7N H;  3FRP B;  2RVL A;  2JEA I;  3FPP A;  4U67 3;  1A15 A;  4UP9 A;  4M8A A;  5HY6 A;  5M3F G;  4X62 L;  3VR2 A;  1XX8 A;  4QIW E;  3GQB A;  1IL2 A;  3E3X A;  3J80 E;  4IAL A;  1V43 A;  1VQ9 A;  3AQQ A;  4ZRZ A;  1DXM A;  4A3I H;  1SJE D;  2IHF A;  4A3I G;  1VQG A;  2AUJ D;  2KUM A;  4QUF A;  5J3B A;  2EYJ A;  4JVZ A;  4P71 A;  3CD6 A;  3NUC A;  2L15 A;  3FEW X;  2IT1 A;  3FKI H;  3CCE A;  1PTO F;  1WCM G;  5IY0 A;  3A8K E;  2NVX H;  1PYB A;  4Y7N B;  1SNM A;  2CVR A;  2UU9 Q;  1A6X A;  1HFN A;  1I4P A;  1PTO H;  1ZEQ X;  4DPG A;  3HKZ B;  4X3T A;  3JAM L;  3MVV A;  1OXS C;  3S9W A;  3DWQ A;  3P7J A;  1JB7 A;  1XPO A;  2VZA A;  4TVA B;  4FXG C;  1TU2 B;  3S1R H;  2QDL A;  4ZK9 B;  4CBV A;  5LL6 S;  2DY7 A;  3CXC A;  1IW7 D;  1X3E A;  4NKL A;  1EIG A;  2UXC L;  4X66 Q;  2HIV A;  3TDQ A;  1X3G A;  1IXR A;  4KHV A;  3I7F A;  2NVQ H;  4DV0 L;  2QEJ C;  4BBR B;  3CMA A;  1UNS A;  4KHZ A;  2ASB A;  4IOA A;  3UDG A;  4K8I A;  1DD2 A;  4MHE A;  1E2W A;  2EYF A;  2JA8 B;  1WCM B;  4JI8 L;  5C0X G;  2KHI A;  4BA1 I;  4DR6 Q;  5M3M H;  1PTO B;  1CM9 A;  3SHL A;  3HOY B;  4QF4 A;  1PHJ A;  3CHB D;  1ET9 A;  2CH4 A;  1QOH A;  4JYA Q;  4LF4 L;  1HQM C;  4IN3 A;  5C44 G;  3S1R B;  1KD1 C;  2B2Y C;  2KQ3 A;  2ZJQ A;  2QGQ A;  4LNQ A;  4K0K L;  4HID A;  4WJ4 A;  2F0E A;  3BDL A;  3FPU B;  2F0I A;  3SDZ A;  1UEA B;  1PH2 A;  4M1U B;  2EZV A;  1ICF B;  2MP1 A;  1WFQ A;  1PXU A;  1EFI D;  5AJ3 Q;  4A3D G;  2NVQ B;  3VR4 A;  2BH2 A;  4N8X 1;  3ULJ A;  4A3D H;  4U68 A;  2G5D A;  4XDX A;  4XQQ A;  3KK7 A;  4DR5 Q;  4BBR G;  1J5E Q;  1PDQ A;  1YHQ A;  1STA A;  1SYC A;  1W6K A;  2TMP A;  3FVQ A;  4YWL A;  3PMF A;  1NE3 A;  1H9J A;  4JC0 A;  5CBE E;  4B3S Q;  1SFO H;  1NMG A;  5GAH C;  3MXN B;  3PO3 B;  4CJ0 B;  3KLS A;  5IYD H;  1B9N A;  1B1Z A;  1QZH A;  4KKU A;  2B63 B;  3GTK B;  4FNF A;  3D8G A;  3TZU A;  3OIP A;  5I6W A;  2NN6 I;  5FO9 B;  3KF8 B;  1AE3 A;  4KD3 A;  5KNB A;  5CV4 A;  4UPA A;  1U5K A;  2B2T A;  4EVO A;  3CCQ A;  1MSH A;  3CCM A;  3N52 A;  2F1M A;  1C8C A;  1ILQ A;  1VQ5 A;  1F9Q A;  1N32 Q;  2HDL A;  4MZ9 A;  4LF6 L;  1GM5 A;  1E1T A;  3V2T A;  3ITP A;  3G7L A;  2NZH A;  4JV5 L;  1CQV A;  5DAU A;  2WKD A;  4RGN A;  4H13 C;  3HOZ B;  4N9T A;  4A3G H;  5JEA G;  2K1B A;  2L55 A;  4BS9 A;  4LUO A;  4DV0 Q;  4HAE A;  1LTT D;  2HUG A;  3I55 A;  1OXU A;  3GTM B;  5J1Z A;  2B63 H;  3F2D A;  1KDC A;  3GTK H;  2GA4 B;  1GUN A;  1LAC A;  4UP8 A;  1PA6 A;  1CA5 A;  3X3M A;  1D5Z C;  1A3V A;  3W5O A;  2FHT A;  4DR6 L;  1HJP A;  2KCN A;  2MO1 A;  2UXB Q;  3MZ5 A;  1SJH D;  3RLF A;  5ELC A;  3NEL A;  4DKA C;  1E2V A;  5A2Q L;  4A3B G;  1JE4 A;  2RCF A;  1X6O A;  3A7A B;  1PYW D;  5ELO A;  4DV2 L;  4ID6 A;  5CC4 A;  1LTR D;  3H6M A;  4LFC Q;  1CUK A;  2EXZ A;  2OEO A;  5CV6 A;  1BVS A;  3A74 A;  4IUN A;  3BZC A;  3BYT B;  3VYS A;  3DHQ A;  4K6D A;  3HP3 A;  3KF8 A;  4IJL A;  2QEX A;  2PMZ E;  1UE6 A;  2OF1 A;  1J5E L;  3H0G H;  1CA6 A;  4RHS A;  1S3O A;  1LT3 D;  2SNM A;  1VQJ A;  3SGI A;  1B4O A;  3CCV A;  2F3I A;  3SVM A;  3I4N G;  1G2T A;  1KXL A;  1GD7 A;  3MHB A;  3D0F A;  2JA8 G;  5CYU A;  3J81 j;  3SK4 A;  3PUX A;  2IX3 A;  1S4Z A;  2JXM B;  3CPF A;  1IBM L;  3M4Y A;  3MTS A;  2R3Z A;  1XNR Q;  1KAA A;  4DAY B;  5HGQ A;  2QF7 A;  3BVM A;  5T1G A;  1KRS A;  3DM3 A;  1L0W A;  4EGV A;  3H0G B;  4PG3 A;  2UUC Q;  3V96 A;  2QIL A;  3OMG A;  1A3T A;  2NTS A;  1J6Q A;  4LFB L;  3M85 A;  4DV3 L;  4LF4 Q;  2MNA A;  2AHO B;  1YIJ A;  3J81 i;  2E76 C;  1WD0 A;  5C4X G;  4P72 A;  4LF5 L;  2KEN A;  3KLR A;  5CV9 A;  5C4J H;  1Y1W B;  4HIM A;  3PO2 B;  3A54 A;  1EY7 A;  3KF6 A;  3P75 A;  3PCO B;  3S14 B;  2Z8L A;  5JEA H;  5ELB A;  4L8J A;  2RQX A;  3BDO A;  4QB4 A;  1N9W A;  4DAM A;  3S17 H;  4G7O C;  1V8Q A;  1HUN A;  1WD1 A;  1JT8 A;  3HOX G;  1HZB A;  2KHJ A;  1TWG B;  3S2D B;  3E9H A;  1FJG Q;  4DV2 Q;  2YYZ A;  4LFC L;  4O0A A;  5JVH 3;  1CSQ A;  1IBK Q;  2EYO A;  4GLV B;  2B2U C;  1PRT D;  1SYG A;  3PIP A;  2MJ8 A;  4JI3 L;  3MA2 B;  3Q8D A;  3J81 L;  1MIU A;  1Q46 A;  1NSN S;  4HJ7 A;  5H1S E;  4YHH Q;  5IP9 G;  2LY7 A;  3PO2 H;  1QVC A;  3U9O A;  3NTH A;  3UDX A;  4C3I B;  2ES2 A;  2L11 A;  3ND8 A;  3S15 B;  1HZA A;  1S5D D;  2D0P A;  2IHE A;  5FLM G;  1UE7 A;  2JA7 B;  2E2D C;  3KBG A;  4HTH A;  1X54 A;  2PQE A;  1S5B D;  3RLO A;  1KQS A;  1SR3 A;  4HED A;  3EBE A;  4LF6 Q;  1GXD C;  4DV3 Q;  3CC7 A;  1TWG H;  3PIO A;  4HJA A;  1K8A C;  3HOX B;  4LF5 Q;  1Y1V H;  1G2S A;  3MC0 B;  3BG3 A;  1ZXT A;  4C3H B;  1QG7 A;  1EL0 A;  2NUC A;  3Q6S A;  2Z6K A;  4A3J B;  4HSP A;  1A62 A;  3IFD A;  1N33 L;  1VQB A;  2F4I A;  1WTH A;  1LM0 A;  3DM1 A;  2EY5 A;  1TWH B;  4B3M Q;  4JI1 L;  2MGS A;  3GTP B;  4XT3 B;  4A4I A;  1VQM A;  4YIJ A;  2F0N A;  3TBI B;  5IOC A;  2UUC L;  1KHI A;  4LF8 L;  1UEB A;  1FJG L;  3BYY B;  2J4X A;  4F88 A;  4IFD I;  3S1N H;  3R93 A;  4C3I G;  2JA7 H;  4FXD A;  1EWI A;  3C3L A;  3A8J E;  4DUZ Q;  2GVB A;  1QNU A;  3D31 A;  5EGT A;  3NHH A;  4V0B A;  5BN3 A;  4GZY C;  2K75 A;  1Y1V B;  1I50 H;  4DR3 Q;  3KF6 B;  4YHH L;  1HA6 A;  5IGD A;  4JK1 C;  2I5L X;  3SK5 A;  3E5S A;  1E2Z A;  4J8Q A;  2IL8 A;  2R92 H;  4JPB W;  1FNV A;  1RJT A;  2A6H D;  2VUM B;  3HKZ E;  1TWH H;  4YWK A;  1DYQ A;  1E3P A;  1VMC A;  3GTP H;  4NB3 A;  2Z1C A;  2Z6B A;  4X66 L;  2ZTD A;  4IPC A;  1F2Z A;  3AYH B;  2NWG A;  1I94 Q;  2YTV A;  1XWE A;  5DLQ E;  5M3F H;  4KJN A;  5KND A;  2M9V A;  1CKN B;  1YJW A;  4BBS H;  1SE2 A;  2WIN B;  2NVT B;  1U4M A;  3HOY G;  4K5W A;  1X32 A;  4MTN A;  3X3N A;  4X62 Q;  2Z9H A;  2FMM A;  3TZD A;  5K5P A;  2O5I C;  1HNX L;  4LF8 Q;  4DK1 A;  2PNR C;  2OCE A;  4CKC A;  5IP9 H;  2F52 A;  2A73 B;  3Q23 A;  1K0R A;  4JI2 Q;  1EIY B;  2VUM H;  2CW0 D;  5JJK A;  3P20 A;  3E0E A;  2N55 A;  4OWX B;  3ULP A;  4IUU A;  1CQF A;  5CR3 A;  4DUZ L;  3G71 A;  1P8L A;  3I4M G;  4Q5V A;  3IRB A;  1UUP A;  4DK3 C;  4BY1 B;  2SDF A;  4PZ8 A;  4XQJ A;  1SAP A;  4PQX A;  4DR5 L;  1YIT A;  4CGY B;  2AQ2 B;  3E9I A;  3EIV A;  1P16 A;  4K6L A;  3RR5 A;  4RH6 A;  1KNA A;  5C5M A;  2EDG A;  1DON A;  1F9S A;  4KV6 A;  4LUV A;  1B70 B;  1BOS A;  2R7D A;  3Q0A A;  2BA0 A;  1O7I A;  2UXC Q;  1WTO A;  5E7N A;  1KTK A;  1NCV A;  3H91 A;  1RF2 D;  5M5X H;  3C46 A;  1XMO L;  3KLW A;  1G8Z D;  3Q22 A;  4LK1 C;  5LMN L;  3AU7 A;  1I4Q A;  5M5Y B;  3ULL A;  1R9T H;  2AUK A;  2B3G A;  5ELN A;  1EYD A;  3ER0 A;  2A8V A;  1K0S A;  5C44 H;  4A3L G;  4AH6 A;  1XMQ L;  3F2U A;  3NWS A;  1OO9 B;  1XXG A;  1PTO D;  1A8V A;  1YNN D;  2I07 B;  3C1F A;  5LL6 X;  4X65 L;  3GTJ H;  3KFU A;  4JYA L;  3NQT A;  1M8A A;  3BDC A;  2EY1 A;  2CWP A;  5M5W H;  3CCR A;  4K0K Q;  1EUJ A;  1XYI A;  3OWE B;  1YNX A;  4DV5 L;  5K36 G;  2LSS A;  1D1K A;  1EYC A;  2N8N A;  3NP8 A;  1IZ6 A;  5M5X B;  4P74 A;  3I4N H;  2BCO A;  5FO8 B;  2F0W A;  4BXX G;  1PH1 A;  3TEH B;  1R9T B;  1NUC A;  5IOD A;  1QVG A;  1E24 A;  3JAM E;  3K81 C;  3HOV B;  1PZI D;  1B53 A;  4JI2 L;  1YHA A;  2DY8 A;  3KJO A;  1AEX A;  4B3R Q;  5E4W C;  4UY8 C;  1QWY A;  1RKN A;  4C3J B;  4FO2 A;  4G7Z C;  5NUC A;  1PRT B;  1EEI D;  1EQT A;  1GHJ A;  2WAQ B;  3S1Q B;  4I7A A;  1PFB A;  2JA9 A;  1DGS A;  5KIX A;  1H9R A;  5C4X H;  2PNH A;  1X65 A;  3NXW A;  4J15 A;  3ZJY C;  2CH4 W;  3I4N B;  4IOC A;  4HN7 A;  5FLX L;  2ZTE A;  2YTY A;  4JI7 Q;  1JJC B;  2KBN A;  2PW5 A;  1VQL A;  2JA6 H;  1VQH A;  3A55 A;  1SRU A;  1T9H A;  2XTI A;  1N36 L;  3E0J A;  2JJQ A;  3I73 A;  2A6H C;  2LMC B;  3NTK A;  4OEL B;  4C56 C;  1IW7 C;  2VW9 A;  5EBC A;  4KY7 A;  2H1E A;  1YJN A;  2HD3 A;  4C3J H;  5LMN Q;  1IBM Q;  1ONL A;  4DR2 Q;  3G4S A;  2WB1 B;  2F3V A;  4GN3 B;  1HR0 L;  1GJX A;  2DN8 A;  5IGE A;  1AN8 A;  1M90 C;  3S1Q H;  1QJO A;  2C5C A;  1JOK A;  4FF3 A;  3P1H A;  2D5D A;  3TS0 A;  3RZD B;  1SE8 A;  1PH6 A;  2JN4 A;  2K14 A;  2K6A A;  1Y1W G;  4KI0 A;  1TY0 A;  1QIL A;  2MQH A;  3M9B A;  4NDX A;  4KKT A;  4L5S A;  3RZO H;  3T1H L;  3I4L A;  5HUR A;  2Z0S A;  5ISR A;  1TS3 A;  1F77 A;  2JA6 B;  2A68 C;  4POG A;  1VS0 A;  4H0L C;  1AP0 A;  5BR8 Q;  3DEO A;  1PZJ D;  4GLA C;  2UU9 L;  1LT5 D;  1VQF A;  4OON A;  4DA2 A;  4DAY A;  1PH3 A;  2PW7 A;  5EAY A;  4L5T A;  1VQ6 A;  1S72 A;  2JYO A;  1X55 A;  4LFA Q;  1F2Y A;  1RDP D;  4L5Q A;  4OHJ A;  4R8N A;  2B2Y A;  1H9S B;  1BNZ A;  1LUZ A;  1PFM A;  1YI2 A;  5IGG A;  2BE5 D;  3D4D A;  2ZXO A;  4PNY A;  3UDI A;  3JAM c;  3MFG A;  4YCV A;  1F9R A;  2AKW B;  5JOB A;  1OTC A;  5CV8 A;  3HRZ C;  5D65 A;  3J80 L;  1SNO A;  4EQN A;  1U9R A;  3NTI A;  2E2H H;  4G4K A;  3ZYY X;  2C35 B;  2DNC A;  3H94 A;  4J6H A;  1YNN C;  1S5E D;  4B9W A;  1HZ9 A;  2L1B A;  2K04 A;  4R1J A;  5ELD A;  1XMQ Q;  1SE3 A;  3FHW A;  1CKO A;  4DV7 L;  3BZD B;  4JI7 L;  4LF9 L;  1N36 Q;  2KED A;  3HOW G;  4LFB Q;  3U9S A;  3A56 A;  1L1O B;  2ENB A;  3CAM A;  2FXQ A;  2YU9 B;  1GUW A;  3NPP A;  4KN4 C;  4R4Q A;  1HH2 P;  3HOW H;  3FDT A;  3LWU A;  1EQV A;  2DJF C;  1AH9 A;  3GD7 A;  3H3V H;  1G6P A;  4A93 H;  5CMD A;  2A74 C;  5J22 A;  3MWY W;  3GV6 A;  1G51 A;  1O7Y A;  2F0S A;  4AYB G;  4S3S A;  4JBJ A;  1Q8K A;  3PQI A;  2QW7 A;  1F9P A;  3D3R A;  4JG2 A;  4HCS A;  4C3H G;  4R4T A;  1IBL L;  4K14 A;  2KEE A;  4IFD H;  1FVI A;  4GKJ Q;  3GV3 A;  3ERQ A;  2R93 H;  1HTP A;  2O5J C;  1H9M A;  1CZG A;  4X6A H;  1IHZ A;  2F0U A;  1PVO A;  3DWA A;  2FFK B;  1YBY A;  3DXJ C;  4NXN L;  3NE5 B;  3QIA A;  1MKH A;  1TS4 A;  5IGB A;  4DR3 L;  4GKK L;  3CCU A;  4KKS A;  2EYP A;  2VXW A;  1F2M A;  1EFW A;  3H09 A;  4LJZ C;  3J7Y W;  4DV1 L;  2VUM G;  2PO4 A;  1FNW A;  4A93 B;  2KCT A;  2K7V A;  2JSO A;  4ALP A;  3CME A;  1FYC A;  5JJL A;  4JI4 Q;  4AYB B;  2RA4 A;  4HR7 B;  1Y1V G;  4DNR B;  2JA5 B;  2ZXR A;  3K0X A;  5EPJ A;  3OIQ A;  1YNJ C;  3PUW A;  4NPS A;  4L6T B;  1Q12 A;  1JQY D;  4DV6 L;  5BN4 A;  1AW7 A;  3D4W A;  5EPL A;  3VYT A;  1SND A;  1NAP A;  2N3S A;  2CFM A;  1OXV A;  3KBX A;  4DR2 L;  3T51 B;  3DWP A;  4UDU C;  4ILW A;  4R8I A;  5HGT A;  1N33 Q;  3ERS X;  3K0Y A;  1PRT F;  3HS0 C;  4OXP A;  5IGC A;  1SYB A;  3TP8 A;  2CCZ A;  2B2W C;  4IPG A;  5IT9 E;  4B3M L;  2LFN A;  4UHV A;  4XTC S;  4POF A;  2FIN B;  4R4O A;  2K32 A;  4A3C H;  2K33 A;  1VQN A;  5C0X H;  4DR4 L;  2MO0 A;  3J7Z C;  4OO1 G;  2PPB C;  4A3C G;  1GHK A;  5FOB B;  4OO1 H;  1W3S A;  2V1C C;  2JA5 H;  2F0P A;  1EY6 A;  3RMH A;  3MXN A;  2A5H A;  2CQA A;  3WDN A;  1O7L A;  3WOE A;  4A3K H;  4A3E B;  1I6V C;  4GKK Q;  3QG1 A;  4P73 A;  1CHQ D;  4A3K G;  2O4X A;  2LXK A;  4NXM L;  3J7A V;  5DM6 3;  3QO2 A;  5JJI A;  5G3L F;  2KJX A;  3OTO L;  4JI4 L;  1VQK A;  1WVL A;  4AQY Q;  1BCP B;  3T1Y L;  1K83 H;  2XGT A;  3GDE A;  2E2I H;  3AEV A;  4R4I A;  1I5F A;  3CPW A;  3S24 A;  1GKH A;  2BDN A;  2EY6 A;  1TQO A;  5G3L D;  3CRL C;  2Q2I A;  5I2Y A;  4MIU A;  1RTO A;  1EZ6 A;  2LKV A;  4YY3 Q;  2VQF L;  1JR0 D;  4DXG A;  1GUS A;  2R93 G;  4HJ8 A;  2QCP X;  1XNQ Q;  1TII D;  3EN2 A;  3L2P A;  3K8A A;  2NTT A;  2RBM A;  3RN5 A;  1MHW C;  1K8O A;  1XNR L;  1PFS A;  3HFZ B;  2B8F A;  2MHV A;  4KY6 A;  1TS2 A;  3FKI G;  1STB A;  2PQA B;  4KD4 A;  5GRO A;  3I91 A;  1KL9 A;  2HQL A;  2IY5 B;  1WTQ A;  3LWE A;  5FLM H;  3TRZ A;  1E7Z A;  1QCB D;  4GOP A;  1S5F D;  1T5X D;  3PIO 3;  1XPU A;  3I72 A;  1K83 B;  1KLG D;  3PGZ A;  1SYE A;  4DV6 Q;  1WI5 A;  2F0L A;  2L0C A;  1FGU A;  3L3O C;  4B9X A;  4QJF A;  2ATW A;  1YJ9 A;  1MSG A;  4DV5 Q;  1AFP A;  4DFA A;  2O2L D;  3K5M A;  1J9O A;  1O7Z A;  3PF5 A;  4IJH A;  2ID0 A;  4ME5 A;  1UWV A;  1BCP C;  3RLN A;  4RG1 A;  5IP7 G;  2ZM6 L;  2B63 G;  4XT1 B;  1VQI A;  1WTR A;  1BBU A;  4A3I B;  1WTX A;  1Q82 C;  4KTA A;  3NEN A;  5F2D A;  1VF5 C;  3PIP 3;  2IX0 A;  4A3J G;  2A19 A;  1BR9 A;  4IQZ A;  2HIX A;  4JOI C;  1TWF H;  4ME3 A;  2JA7 G;  1EZ8 A;  1XJV A;  4O42 A;  5DEH A;  4BY7 B;  4A3L H;  3ICE A;  1NMF A;  1I6H H;  5EKI A;  5C3E G;  1XMO Q;  3OYY A;  5C4H A;  2KA7 A;  4PMW A;  1GVP A;  3SEB A;  3NSW A;  5KGU A;  3H15 A;  1HFG A;  2IX1 A;  1G6Z A;  2ZXP A;  4AQY L;  2L4N A;  4LMQ D;  3R8B A;  4HJ5 A;  2WAQ G;  1HNZ Q;  2DJG C;  2R92 G;  5COR A;  5I6Y A;  1WTW A;  1ZYR C;  1K28 A;  3HOU H;  4BBR H;  1W6J A;  1BUV T;  1EY5 A;  4FYD A;  1K9M C;  1BBW A;  2RHQ B;  3G6J B;  1L1O C;  2WKC A;  3A7L A;  1EIH A;  2K01 A;  4A3F G;  4EX5 A;  4JBW A;  4A3M G;  1KIX A;  3NEM A;  5C3W A;  2JA8 H;  3U4Z A;  1YNJ D;  4XIG S;  1VQ8 A;  1CZW A;  4DN4 M;  4H44 C;  2CKZ B;  1I6H B;  4JI8 Q;  3HOY H;  3IFT A;  4BY7 G;  2EXD A;  1BBX C;  2EQS A;  2ICE C;  1CSP A;  1B2T A;  2K50 A;  1TXY A;  1VQD A;  5E4X A;  4QIW B;  4PMB A;  1HUM A;  1TY2 A;  1I4X A;  5GQO A;  4GLX A;  3NQI A;  4B3R L;  2I0Q A;  3GTQ H;  3G48 A;  2F0O A;  2C9O A;  2UXD L;  2K5V A;  1HTL D;  3FP9 A;  1DJR D;  1JJG A;  2N78 A;  4NP5 A;  4DAV A;  2PYK A;  3A5U A;  1EY9 A;  1QNK A;  2EVB A;  4FVM A;  1A3U A;  1C48 A;  1Z9F A;  4A3G G;  4HIO A;  2B2V C;  3SE0 A;  2XRS D;  1GUT A;  3W1G A;  4MTK A;  4ZUJ A;  3KJP A;  1PH4 A;  1JOR A;  1EYA A;  1S5C D;  2E8G A;  4JBM A;  1D1I A;  1SNQ A;  1KDB A;  4X3U A;  4XQN A;  1PH7 A;  3NBH A;  1IBK L;  4E6I A;  2EOT A;  4J1M A;  4CDC C;  4KHP Q;  3VDY A;  2EYM A;  2Z4I A;  1G29 1;  1E22 A;  1BCP F;  4YY3 L;  2VQF Q;  1N34 Q;  2UUA Q;  2F4V Q;  3GTQ B;  5IYB H;  1EEF D;  4WRD A;  3DUZ A;  3UDF A;  3UI2 A;  1V1P A;  1Q86 C;  2ZTC A;  4AYB E;  4QMG A;  1PTO C;  1SMX A;  3QR8 A;  1D8L A;  4DV4 Q;  3VR5 A;  1A2T A;  3D4R A;  5M9O A;  5GAE C;  4QY7 A;  1JCK B;  4A76 A;  4QQB X;  1ILP A;  4DR1 Q;  1WCM H;  3QB3 A;  4A3G B;  1X9N A;  2KCC A;  5EKL A;  5M3M B;  4YCU A;  1AE2 A;  4IPD A;  3CCS A;  3GTM H;  2BA1 A;  3C2P A;  3W2D A;  4RHR A;  5D3I B;  2WFW A;  1VQ7 A;  2L12 A;  4DR7 L;  4C1N K;  3TP6 A;  1EIF A;  1LT6 D;  4CDF C;  3RD4 A;  4PZ6 A;  1D7Q A;  2WAQ E;  2H5X A;  3K80 C;  2GVA A;  3MXP A;  4A3D B;  5FO7 B;  3KDF B;  1ENC A;  3KLS X;  3TME A;  4DK0 A;  5LMU L;  5C3X A;  1Y8N B;  3NBH B;  1EYG A;  4FF1 A;  3I4O A;  1RTN A;  1H9K A;  2Q8R E;  2PZW A;  4GOP C;  4KHP L;  2OQ0 A;  1LTA D;  4GNX C;  3HZX A;  3AMU A;  1SFO B;  3I8Z A;  1N34 L;  4ZLT F;  2UUA L;  2FJ2 A;  2R61 A;  4LWC A;  4ZCK A;  3PO3 H;  2PMZ B;  3HEJ A;  1JOO A;  4DV1 Q;  2RDG A;  3CCJ A;  3HOV G;  3I2Z A;  2WII B;  5FKA C;  3BVG A;  2RKS A;  5AFW A;  4DXF A;  3S2H H;  3J81 c;  3F1Z A;  1PH8 A;  2EJG C;  2A69 D;  1V1O A;  2DGY A;  2VB3 X;  1ENA A;  4DUY Q;  5KEE A;  2NYZ D;  4UAI A;  4WFN 3;  4ZQ3 A;  4JI5 L;  1YHB A;  1FR3 A;  4Q0F A;  4HCE A;  5K36 H;  2BOS A;  1CKN A;  1EU3 A;  3QOL A;  2EE1 A;  3HOZ H;  3I70 A;  5IGF A;  1RCV D;  2PQA A;  4IFD G;  1JB3 A;  4QL5 A;  1CTM A;  1DCZ A;  3TS2 A;  3TP7 A;  4DV4 L;  4F87 A;  2WP8 J;  3M7G A;  1JIC A;  2VY3 A;  4B3T L;  4OEM B;  1OXT A;  3PUZ A;  1HQR D;  2XSC A;  1AZQ A;  2EY2 A;  3S2H B;  2IWH A;  1L2F A;  3T56 B;  1I4H A;  3D6C A;  4XXE A;  2F0J A;  1Y1W H;  4O1N A;  5ELF A;  3A0J A;  2UXD Q;  2KEC A;  2PZT A;  2R7F A;  3KYH C;  4OIK A;  3RUZ A;  1IYV A;  4NXN Q;  4MN3 A;  2YTX A;  4IUT A;  3L0O A;  1GO3 E;  2AWO A;  2Z4H A;  3W1B A;  4OWW B;  3S17 B;  3AB9 A;  1T5E A;  3TSS A;  2K52 A;  1E1O A;  1STE A;  3S2D H;  3J80 i;  1TR5 A;  1U4P A;  2X6L A;  2WB1 G;  3R2T A;  4P2C B;  5LMU Q;  2JA6 G;  4CDE C;  2K5Q A;  3OSO A;  2NZ1 D;  1K8M A;  3DMU A;  5LHY 1;  1ROD A;  2F0T A;  1X3Q A;  2JEB I;  1PRT C;  2MPM A;  4JI5 Q;  5FJ8 G;  1WJJ A;  3M4Q A;  4QUC A;  5I9P A;  4HSV A;  4GN4 B;  1Q1E A;  1KRT A;  1V1Q A;  3FMC A;  1SMY D;  4OO1 I;  1QVF A;  4C3I H;  1HR0 Q;  4DU9 A;  3S15 H;  2HCI A;  3OHX C;  2J7Z A;  3R2I A;  3PF4 A;  2J0T D;  5D3D A;  4RGO S;  4FF2 A;  4G7H C;  3TP5 A;  5J39 A;  2K28 A;  2A68 D;  2RSN A;  4DGZ A;  3BJU A;  4X65 Q;  3SR1 A;  2F03 A;  3CKI B;  4ZYS A;  1MI2 A;  4R4C A;  1K3B C;  4JI6 L;  3URY A;  5FLX E;  1SNP A;  5IT9 c;  2RCN A;  1SBB B;  3L7Z C;  1I4G A;  4EQ5 A;  3VR3 A;  1SN8 A;  3ERO A;  1B3A A;  2Y0S B;  3A5Z B;  3LX0 A;  5C4J B;  2DUD A;  5EJW A;  1WOC A;  4OGQ C;  1YZ6 A;  3S14 H;  3T13 A;  4RMF A;  1HR0 W;  4RCN A;  3HOZ G;  3S1N B;  1K73 C;  2Q2U A;  2SOB A;  4A3M H;  4TSS A;  1H95 A;  2N88 A;  1D5X C;  5KRU A;  2Z6K C;  3RN2 A;  4FP5 D;  1I50 B;  2TSS A;  1PZK D;  2E5L Q;  2ZJR A;  1FGB D;  1GUO A;  2IJ0 A;  3MFY A;  4QCL A;  2E75 C;  4NMZ A;  1BO0 A;  1XNQ L;  1LAB A;  3I3C A;  4PV1 C;  2R92 B;  2A69 C;  3OMC A;  2NN6 H;  5DM7 3;  1DOL A;  1ICW A;  3MEF A;  1CFM A;  2RHS B;  5I2X A;  3I4M H;  4IUQ A;  1QZG A;  5CV7 A;  4GS3 A;  1TWC H;  4JV5 Q;  1Q8I A;  3HKS A;  1NR2 A;  4ZUI A;  4OX9 L;  5L37 A;  5M3F B;  4A3M B;  1LLR D;  1VMP A;  4A93 G;  1I94 L;  4O2D A;  2X6G A;  1SXT A;  1PYS B;  2NVT H;  5IP7 H;  3HOX H;  4GNX A;  2ZT9 C;  1ASZ A;  4KK7 A;  4X64 Q;  4ODG A;  3LNN A;  5E1F A;  4C3H H;  1CK1 A;  1MJC A;  5IWA L;  4BWG B;  4X3S A;  1Q90 A;  4C3J G;  4LUZ A;  4A3J H;  2BDO A;  1DM0 B;  1IBL Q;  1ESF A;  4JI1 Q;  4Y52 H;  1NR4 A;  4N8F A;  5JAV A;  4B3T Q;  2BH8 A;  1MBY A;  2OWO A;  1C4Q A;  1SEB D;  1HPC A;  1NNX A;  3PV0 A;  2M00 A;  2ICI A;  3I4M B;  4JI6 Q;  3OWF A;  3HKZ G;  3VYU A;  2CHB D;  4EQO A;  1TWC B;  2D0O A;  4QGU A;  2ZJP A;  3H3V I;  1ZKO A;  3S16 B;  1IKL A;  1VF7 A;  4KN7 C;  3UE1 A;  2L9H A;  1Q7Y C;  4A75 A;  4RFB A;  2IPK D;  1E0B A;  1M1K C;  1CT1 D;  2AQ3 B;  1NBW A;  3CW2 C;  4CDD C;  1Y14 B;  3WOF A;  1KDA A;  3SK6 A;  2MUY A;  1D5M C;  1IL8 A;  2B2W A;  3K58 A;  3T4A C;  3T53 B;  1B8A A;  1R4P B;  2JK8 A;  2F0K A;  2LXJ A;  1EQQ A;  2M2L A;  2XIW A;  1XPR A;  4OX9 Q;  4LF7 Q;  1FNU A;  1U4R A;  3J7A F;  4K5X A;  2VQE Q;  2IW3 A;  3F8T A;  1X56 A;  3O13 A;  3GO5 A;  3J81 E;  1R4Q B;  3KUP A;  3A8I E;  4CKB A;  3S16 H;  4ABN A;  5C44 B;  5IWA Q;  3M4P A;  1KAW A;  1V1P B;  2KCM A;  4H7B A;  3TRE A;  2I46 A;  3STB D;  4BBS B;  5M3M G;  3GTJ B;  2WB1 E;  3PO3 G;  1GOZ A;  1VQ4 A;  3PUY A;  4GOP B;  4DR1 L;  3F2B A;  1HNW L;  3M3Y H;  2NN6 G;  4DK6 C;  5M5W B;  4XYQ A;  3VA7 A;  5C0X I;  1RD9 D;  4HJ9 A;  3MAQ A;  1LTB D;  1BF4 A;  2CW0 C;  2FMC A;  3OW7 A;  3VA5 A;  1QB5 D;  1LYL A;  4B08 A;  3ND9 A;  4WJW A;  1STN A;  2E74 C;  5I4D A;  1ASY A;  2VS1 A;  1KC8 C;  2G9D A;  2G9H D;  1HRJ A;  2A6E D;  4KLK A;  3GTL B;  1II3 A;  3K59 A;  4OWT B;  1V9P A;  5LMN W;  3OTO Q;  1JJ2 A;  2OXP A;  3F2C A;  4JI0 L;  1SRO A;  3OPO A;  2Y0S E;  4I7Z C;  4BY1 H;  3HGB A;  4R9W A;  4YWM A;  1K8G A;  1LTG D;  3K7U C;  4RKL A;  5IYB G;  3UE0 A;  4BBS G;  1W2B A;  4CHT B;  4F7X A;  4DF7 A;  4K5V A;  3M3Y B;  1CKM A;  4RGT A;  4KJO A;  1IYU A;  4X3K A;  1A63 A;  4K2K A;  2E5L L;  1DOM A;  2F4V L;  1KLU D;  4HMJ A;  5COY A;  4FF4 A;  2NB0 A;  2OT2 A;  1FL0 A;  3ONA B;  3I90 A;  1SLJ A;  5C3E H;  1EY0 A;  5EPK A;  2JQO A;  4I65 A;  4RA8 A;  4ZKC B;  4EQP A;  1ZYR D;  3BS1 A;  1JC7 A;  1SNC A;  1SYD A;  4ZKB B;  5M5Y H;  3CC4 A;  4WJ3 M;  2F0V A;  3GTL H;  4FDB A;  3H3V C;  1Y69 U;  2E2J B;  2EIF A;  5EBD A;  2F3W A;  3CU7 A;  2HQE A;  3NWT A;  3IAY A;  1VCI A;  4KY5 A;  1JWU D;  2F0Q A;  4MNO A;  1G91 A;  1ET6 A;  1ESR A;  4CJ2 C;  3U50 C;  1VQC A;  2NZO A;  4A3F H;  2DNE A;  4DR7 Q;  3NBI A;  2OTJ A;  2YV5 A;  4JI0 Q;  1D6E C;  1TWA B;  1TKW B;  2A1A A;  3RZD H;  2OQK A;  2GN5 A;  4JBK A;  4RKB A;  5C3E B;  1BCP D;  1WTP A;  1D2B A;  4DAP A;  2D9U A;  1Z6H A;  1H9S A;  3J7A 5;  4L63 B;  1JMC A;  2PI2 E;  1NTG A;  1Q3L A;  2CQO A;  2D2C C;  1ENF A;  2E2J H;  3HOV H;  1L1O A;  2XRQ D;  3DEP A;  2JA5 G;  4XYO A;  2A6E C;  5C6A A;  1LTI D;  1O80 A;  2SNS A;  4GNX B;  2F0M A;  2XVS A;  4NXM Q;  1LTS D;  3MXG A;  5I9O A;  2QKI C;  5IE8 A;  4A3F B;  4H02 A;  2HCC A;  2P5Z X;  1HNZ L;  4JCV E;  5C4X B;  5GAD C;  1TWA H;  1EWC A;  2AQ1 B;  4PMC A;  2B39 A;  4B3S L;  4DNT B;  4DUY L;  3SXH A;  1BQQ T;  5D14 A;  4C2M H;  2F0D A;  3RNU A;  2BE5 C;  4F8M A;  4LF7 L;  1VQP A;  2V4D A;  3VR6 A;  2VQE L;  4JI3 Q;  1MJE A;  2B29 A;  2E2H B;  2K03 A;  2RDH A;  1STY A;  3NK9 A;  1IYJ B;  3STB C;  2WAC A;  5IYD G;  1X3F A;  5DNF A;  1EQR A;  1UE5 A;  3BVZ A;  4IUR A;  2B2V A;  3K57 A;  3L9A X;  3LGJ A;  4RWS C;  5FK9 C;  3IL8 A;  4RAU C;  1VQO A;  5CV5 A;  3EA6 A;  4G57 A;  2KHS A;  3HG9 A;  1K3R A;  3PO2 G;  4DV7 Q;  5BN5 A;  3G6E A;  1FD7 D;  1VQA A;  3S1M B;  1F2L A;  1VQE A;  1UE1 A;  3CC2 A;  2X69 A;  3CF5 A;  1B7Y B;  3T16 A;  3E6Z X;  2Y0S G;  2ALY B;  2B2U A;  2I5H A;  2EPB A;  1YVC A;  2QA4 A;  4C2M B;  5KYL A;  2EYL A;  2K5W A;  3RZO B;  2Q2H A;  1J8I A;  5BR8 L;  3D6W A;  1WYD A;  4NW2 A;  5AJ3 L;  5TSS A;  2SEB D;  3I56 A;  2UXB L;  3K5O A;  1PLF A;  5GAG C;  2K4K A;  5IYC G;  5CBA E;  1XTC D;  2R93 B;  2WV6 D;  5IYC H;  4GKJ L;  3K7A B;  2B8G A;  2VB2 X;  3QOJ A;  1PV4 A;  1DOK A;  4APV A;  4RCO A;  3U58 A;  1M4V A; 
#chains in the Genus database with same CATH homology
 5A2Q E;  3PUV A;  1EWH A;  1STH A;  2HDM A;  1OXX K;  3N6R A;  4IUV A;  2PZU A;  4C1N I;  1AZP A;  5E3F A;  3VYR A;  3OOC A;  3EJI A;  2D62 A;  3GP7 A;  1LV9 A;  1EOT A;  1UAP A;  2H4O A;  1SE4 A;  4FXK C;  3W3A A;  2Q8T A;  5C5L A;  1BXT A;  3V05 A;  1BDO A;  3CRK C;  4OIJ A;  3K5N A;  2NBF A;  1O78 A;  1JOQ A;  2EJF C;  1Z7T A;  1WTV A;  5T1I A;  3HOW B;  3R3O A;  2K05 A;  1B9M A;  4TQU S;  2F0G A;  1ML0 D;  1HHV A;  1DZ1 A;  2K5D A;  3K6O A;  4V19 0;  1HXY D;  3MEH A;  3CQZ B;  5A35 A;  1MGS A;  4A3K B;  5IIF A;  1TVX A;  2QDB A;  5KNC A;  3C1E A;  5ELE A;  4A3B B;  1GUG A;  2F0H A;  1B50 A;  5JPM C;  4KMU C;  4WOR A;  1SYF A;  4ULL A;  2XWJ B;  4CKE A;  2LS0 1;  1L0X B;  3EVQ A;  2R6G A;  3QJY A;  5EKK A;  3GTG B;  4BA2 I;  4CJ1 B;  5C0X J;  1SMY C;  3M7N A;  1PMR A;  4N9P A;  1LO5 D;  1Y8O B;  1SDF A;  2JE6 I;  4Z9C B;  5C4Z A;  5JPN C;  1I3Q B;  2KOL A;  2R7Z B;  1TT2 A;  1A2U A;  2RSO A;  5IT9 L;  5JVG 3;  4TKO B;  4OL7 A;  1Q1B A;  1LT4 D;  2NVY B;  3Q24 A;  1TS5 A;  3EFX D;  1B44 D;  1Z47 A;  1CI3 M;  2AWN A;  5CGK A;  1IKM A;  2XN9 C;  2EYH A;  4K2L A;  1QE6 A;  1EY8 A;  4RGM A;  3QWN A;  1KNE A;  3EQL C;  3K5L A;  4LAA A;  1PFN A;  2KVM A;  4ZAI A;  2B2T C;  2XNA C;  2RDF A;  2Q8I B;  2PCF B;  1X3P A;  3GTO B;  4TRD A;  2XWB B;  1RHP A;  1TWF B;  1EY4 A;  5EQ0 A;  2F0F A;  3MXU A;  1VDZ A;  1U4L A;  1KAB A;  1SSO A;  1STG A;  2E2I B;  1MD2 D;  4IFD J;  4IZ8 A;  4HMI A;  4K8J A;  1I4R A;  1CHP D;  3M4O B;  5KYI A;  2VNU D;  3IKJ A;  1EU4 A;  5JEA J;  2JP1 A;  5JJZ A;  2L5T A;  1JWM D;  4IUP A;  3TN2 A;  2EJM A;  3SK8 A;  1Y8P B;  3HOU B;  1HCZ A;  1JWS D;  3FKI B;  1HA5 A;  2NVX B;  1L0Y B;  3FRP B;  2RVL A;  2JEA I;  3FPP A;  4U67 3;  1A15 A;  4M8A A;  3VR2 A;  1XX8 A;  3GQB A;  3J80 E;  4IAL A;  1V43 A;  4ZRZ A;  1DXM A;  1SJE D;  2AUJ D;  2KUM A;  4QUF A;  2EYJ A;  3NUC A;  3FEW X;  2IT1 A;  1PTO F;  3A8K E;  4Y7N B;  1SNM A;  2CVR A;  1A6X A;  1HFN A;  1I4P A;  1PTO H;  1ZEQ X;  3HKZ B;  4X3T A;  3JAM L;  3MVV A;  1OXS C;  3S9W A;  3DWQ A;  3P7J A;  4FXG C;  1TU2 B;  4ZK9 B;  4CBV A;  5LL6 S;  2DY7 A;  1IW7 D;  4NKL A;  1EIG A;  3TDQ A;  4KHV A;  2QEJ C;  4BBR B;  1UNS A;  4KHZ A;  4K8I A;  1DD2 A;  4MHE A;  1E2W A;  2EYF A;  2JA8 B;  1WCM B;  5C0X G;  4BA1 I;  1PTO B;  1CM9 A;  3SHL A;  3HOY B;  4QF4 A;  3CHB D;  1ET9 A;  1QOH A;  1HQM C;  4IN3 A;  3S1R B;  2B2Y C;  2KQ3 A;  2F0E A;  3BDL A;  3FPU B;  2F0I A;  3SDZ A;  1UEA B;  4M1U B;  2EZV A;  2MP1 A;  1PXU A;  1EFI D;  2NVQ B;  3VR4 A;  4U68 A;  4XQQ A;  4XDX A;  3KK7 A;  1PDQ A;  1STA A;  1SYC A;  1W6K A;  2TMP A;  3FVQ A;  3PMF A;  1H9J A;  5CBE E;  3PO3 B;  4CJ0 B;  3KLS A;  1B9N A;  1B1Z A;  4KKU A;  3GTK B;  2B63 B;  4FNF A;  3D8G A;  3TZU A;  3OIP A;  5I6W A;  2NN6 I;  5FO9 B;  4KD3 A;  5KNB A;  5CV4 A;  2B2T A;  4EVO A;  1MSH A;  3N52 A;  2F1M A;  1C8C A;  1ILQ A;  1F9Q A;  2HDL A;  3V2T A;  3ITP A;  3G7L A;  1CQV A;  5DAU A;  2WKD A;  4RGN A;  4H13 C;  3HOZ B;  4N9T A;  5JEA G;  2K1B A;  2L55 A;  4BS9 A;  4HAE A;  1LTT D;  2HUG A;  1OXU A;  3GTM B;  5J1Z A;  1KDC A;  2GA4 B;  1GUN A;  1LAC A;  1CA5 A;  3X3M A;  1D5Z C;  1A3V A;  2FHT A;  2KCN A;  3MZ5 A;  1SJH D;  3RLF A;  5ELC A;  1E2V A;  5A2Q L;  1JE4 A;  3A7A B;  1PYW D;  4ID6 A;  5CC4 A;  1LTR D;  3H6M A;  2EXZ A;  2OEO A;  5CV6 A;  4IUN A;  3BYT B;  3VYS A;  3DHQ A;  4K6D A;  3HP3 A;  3KF8 A;  2OF1 A;  1CA6 A;  4RHS A;  1LT3 D;  2SNM A;  1B4O A;  3SVM A;  1G2T A;  3MHB A;  5CYU A;  3SK4 A;  3PUX A;  2IX3 A;  1S4Z A;  2JXM B;  3M4Y A;  3MTS A;  2R3Z A;  1KAA A;  2QF7 A;  3BVM A;  5T1G A;  4EGV A;  3H0G B;  3V96 A;  2QIL A;  3OMG A;  1A3T A;  2NTS A;  3M85 A;  2E76 C;  1WD0 A;  3KLR A;  5CV9 A;  1Y1W B;  3PO2 B;  3A54 A;  1EY7 A;  3P75 A;  3S14 B;  2Z8L A;  5JEA H;  5ELB A;  4L8J A;  2RQX A;  3BDO A;  4QB4 A;  4G7O C;  1HUN A;  1V8Q A;  1WD1 A;  1TWG B;  3S2D B;  2YYZ A;  5JVH 3;  2EYO A;  2B2U C;  1PRT D;  1SYG A;  2MJ8 A;  3MA2 B;  3J81 L;  1NSN S;  2LY7 A;  3U9O A;  3NTH A;  4C3I B;  2L11 A;  3ND8 A;  3S15 B;  1S5D D;  2JA7 B;  2E2D C;  3KBG A;  4HTH A;  2PQE A;  1S5B D;  4HED A;  1GXD C;  3HOX B;  1G2S A;  3MC0 B;  3BG3 A;  1ZXT A;  4C3H B;  1QG7 A;  1EL0 A;  2NUC A;  3Q6S A;  4A3J B;  4HSP A;  3IFD A;  2F4I A;  3DM1 A;  2EY5 A;  1TWH B;  2MGS A;  3GTP B;  4XT3 B;  4YIJ A;  2F0N A;  3TBI B;  5IOC A;  3BYY B;  2J4X A;  4F88 A;  4IFD I;  3R93 A;  4C3I G;  4FXD A;  3C3L A;  3A8J E;  1QNU A;  3D31 A;  5EGT A;  3NHH A;  4V0B A;  5BN3 A;  4GZY C;  1Y1V B;  1HA6 A;  5IGD A;  4JK1 C;  3SK5 A;  3E5S A;  1E2Z A;  4J8Q A;  2IL8 A;  1FNV A;  1RJT A;  2A6H D;  2VUM B;  1DYQ A;  1VMC A;  2Z1C A;  1F2Z A;  2NWG A;  1XWE A;  4KJN A;  5KND A;  2M9V A;  1SE2 A;  2WIN B;  2NVT B;  1U4M A;  4K5W A;  1X32 A;  3X3N A;  2FMM A;  3TZD A;  5K5P A;  2O5I C;  4DK1 A;  2PNR C;  4CKC A;  2A73 B;  3Q23 A;  2CW0 D;  3P20 A;  2N55 A;  4IUU A;  1CQF A;  5CR3 A;  4Q5V A;  1UUP A;  4BY1 B;  2SDF A;  4XQJ A;  1SAP A;  4PQX A;  4CGY B;  2AQ2 B;  4K6L A;  4RH6 A;  1KNA A;  5C5M A;  2EDG A;  1DON A;  1F9S A;  4KV6 A;  1BOS A;  3Q0A A;  2BA0 A;  1WTO A;  1KTK A;  1NCV A;  3H91 A;  1RF2 D;  3C46 A;  1G8Z D;  3Q22 A;  4LK1 C;  3AU7 A;  1I4Q A;  5M5Y B;  2AUK A;  1EYD A;  3F2U A;  3NWS A;  1OO9 B;  1XXG A;  1PTO D;  2I07 B;  1YNN D;  3C1F A;  5LL6 X;  3NQT A;  1M8A A;  3BDC A;  2EY1 A;  1XYI A;  3OWE B;  5K36 G;  1D1K A;  1EYC A;  3NP8 A;  5M5X B;  2BCO A;  5FO8 B;  2F0W A;  1R9T B;  1NUC A;  5IOD A;  3JAM E;  3HOV B;  1PZI D;  1B53 A;  2DY8 A;  1AEX A;  5E4W C;  1QWY A;  1RKN A;  4C3J B;  4FO2 A;  4G7Z C;  5NUC A;  1PRT B;  1EEI D;  1EQT A;  1GHJ A;  2WAQ B;  3S1Q B;  1PFB A;  5KIX A;  1H9R A;  3NXW A;  3I4N B;  4HN7 A;  5FLX L;  2PW5 A;  3A55 A;  3E0J A;  3I73 A;  2A6H C;  2LMC B;  3NTK A;  4C56 C;  1IW7 C;  5EBC A;  4KY7 A;  2H1E A;  1ONL A;  2WB1 B;  2F3V A;  1GJX A;  2DN8 A;  5IGE A;  1AN8 A;  1QJO A;  2C5C A;  1JOK A;  4FF3 A;  3P1H A;  2D5D A;  3RZD B;  2K6A A;  4KI0 A;  1TY0 A;  1QIL A;  4NDX A;  4KKT A;  3I4L A;  5HUR A;  5ISR A;  1TS3 A;  1F77 A;  2JA6 B;  2A68 C;  4H0L C;  1AP0 A;  3DEO A;  1PZJ D;  1LT5 D;  4DA2 A;  4DAY A;  2PW7 A;  2JYO A;  1F2Y A;  1RDP D;  4OHJ A;  4R8N A;  2B2Y A;  1H9S B;  1BNZ A;  1PFM A;  5IGG A;  2BE5 D;  3D4D A;  2ZXO A;  4PNY A;  3MFG A;  1F9R A;  5JOB A;  5CV8 A;  3HRZ C;  5D65 A;  3J80 L;  1SNO A;  4EQN A;  1U9R A;  3NTI A;  4G4K A;  3ZYY X;  2DNC A;  3H94 A;  4J6H A;  1YNN C;  1S5E D;  4B9W A;  2L1B A;  2K04 A;  5ELD A;  1SE3 A;  3BZD B;  2KED A;  3U9S A;  3A56 A;  2YU9 B;  2ENB A;  1GUW A;  3NPP A;  4KN4 C;  3FDT A;  3LWU A;  1EQV A;  3GD7 A;  5CMD A;  2A74 C;  5J22 A;  3MWY W;  3GV6 A;  2F0S A;  1O7Y A;  4S3S A;  1F9P A;  3D3R A;  4HCS A;  4C3H G;  4K14 A;  2KEE A;  4IFD H;  3GV3 A;  3ERQ A;  1HTP A;  2O5J C;  1H9M A;  1CZG A;  1IHZ A;  2F0U A;  3DWA A;  2FFK B;  3DXJ C;  3NE5 B;  3QIA A;  1TS4 A;  5IGB A;  4KKS A;  2EYP A;  2VXW A;  1F2M A;  3H09 A;  4LJZ C;  3J7Y W;  2PO4 A;  1FNW A;  4A93 B;  2K7V A;  2JSO A;  1FYC A;  4AYB B;  2RA4 A;  4HR7 B;  4DNR B;  2JA5 B;  2ZXR A;  5EPJ A;  3OIQ A;  1YNJ C;  3PUW A;  4L6T B;  1Q12 A;  1JQY D;  5BN4 A;  1AW7 A;  3D4W A;  5EPL A;  3VYT A;  1SND A;  1NAP A;  1OXV A;  3KBX A;  3T51 B;  3DWP A;  4UDU C;  4ILW A;  4R8I A;  5HGT A;  3K0Y A;  1PRT F;  3HS0 C;  5IGC A;  1SYB A;  3TP8 A;  2B2W C;  5IT9 E;  2LFN A;  4XTC S;  2FIN B;  2K32 A;  2K33 A;  5C0X H;  4OO1 G;  2PPB C;  1GHK A;  5FOB B;  4OO1 H;  2F0P A;  1EY6 A;  3RMH A;  3MXN A;  2A5H A;  2CQA A;  3WDN A;  1O7L A;  3WOE A;  4A3E B;  1I6V C;  3QG1 A;  1CHQ D;  2O4X A;  3J7A V;  5DM6 3;  3QO2 A;  5G3L F;  2KJX A;  1WVL A;  1BCP B;  2BDN A;  2EY6 A;  1TQO A;  5G3L D;  3CRL C;  5I2Y A;  4MIU A;  1RTO A;  1EZ6 A;  2LKV A;  1JR0 D;  4DXG A;  1GUS A;  2QCP X;  1TII D;  2NTT A;  2RBM A;  1K8O A;  2B8F A;  2MHV A;  4KY6 A;  1TS2 A;  1STB A;  4KD4 A;  3I91 A;  1WTQ A;  3LWE A;  1QCB D;  1S5F D;  1T5X D;  3PIO 3;  3I72 A;  1K83 B;  1KLG D;  1SYE A;  2F0L A;  2L0C A;  3L3O C;  4B9X A;  1MSG A;  1AFP A;  4DFA A;  2O2L D;  3K5M A;  1J9O A;  1O7Z A;  2ID0 A;  4ME5 A;  1BCP C;  4XT1 B;  1WTR A;  1WTX A;  4A3I B;  4KTA A;  5F2D A;  1VF5 C;  3PIP 3;  2IX0 A;  1BR9 A;  4IQZ A;  1EZ8 A;  4O42 A;  5DEH A;  4BY7 B;  5EKI A;  5C4H A;  2KA7 A;  4PMW A;  3SEB A;  3NSW A;  5KGU A;  1HFG A;  2IX1 A;  1G6Z A;  2ZXP A;  2L4N A;  4LMQ D;  3R8B A;  5COR A;  5I6Y A;  1WTW A;  1ZYR C;  1W6J A;  1BUV T;  1EY5 A;  4FYD A;  3G6J B;  2WKC A;  3A7L A;  1EIH A;  2K01 A;  4JBW A;  5C3W A;  1YNJ D;  4XIG S;  1CZW A;  4DN4 M;  4H44 C;  1I6H B;  3IFT A;  1BBX C;  2ICE C;  1B2T A;  5E4X A;  4QIW B;  4PMB A;  1HUM A;  1TY2 A;  1I4X A;  3NQI A;  2F0O A;  2C9O A;  1HTL D;  1DJR D;  4NP5 A;  4DAV A;  2PYK A;  1EY9 A;  1QNK A;  2EVB A;  4FVM A;  1A3U A;  1C48 A;  2B2V C;  3SE0 A;  2XRS D;  1GUT A;  4ZUJ A;  1JOR A;  1EYA A;  1S5C D;  1D1I A;  1SNQ A;  1KDB A;  4XQN A;  4X3U A;  3NBH A;  4E6I A;  2EOT A;  4J1M A;  2EYM A;  2Z4I A;  1G29 1;  1BCP F;  3GTQ B;  1EEF D;  4WRD A;  3DUZ A;  3UI2 A;  1V1P A;  4QMG A;  1PTO C;  3VR5 A;  1A2T A;  3D4R A;  5M9O A;  1JCK B;  1ILP A;  3QB3 A;  4A3G B;  2KCC A;  5EKL A;  5M3M B;  2BA1 A;  3C2P A;  3W2D A;  4RHR A;  5D3I B;  2L12 A;  4C1N K;  3TP6 A;  1LT6 D;  3RD4 A;  3MXP A;  4A3D B;  5FO7 B;  1ENC A;  3KLS X;  3TME A;  4DK0 A;  5C3X A;  1Y8N B;  4FF1 A;  1RTN A;  1H9K A;  2Q8R E;  2PZW A;  1LTA D;  3AMU A;  3HZX A;  1SFO B;  3I8Z A;  4ZLT F;  2FJ2 A;  2R61 A;  2PMZ B;  3HEJ A;  1JOO A;  2RDG A;  2WII B;  5FKA C;  3BVG A;  2RKS A;  5AFW A;  4DXF A;  2EJG C;  2A69 D;  1V1O A;  2VB3 X;  1ENA A;  5KEE A;  2NYZ D;  4UAI A;  4WFN 3;  4ZQ3 A;  1FR3 A;  4Q0F A;  4HCE A;  5K36 H;  2BOS A;  1EU3 A;  3QOL A;  2EE1 A;  3I70 A;  5IGF A;  1RCV D;  4IFD G;  1JB3 A;  1CTM A;  1DCZ A;  3TP7 A;  4F87 A;  2WP8 J;  3M7G A;  1JIC A;  1OXT A;  3PUZ A;  1HQR D;  2XSC A;  1AZQ A;  2EY2 A;  3S2H B;  2IWH A;  3T56 B;  1I4H A;  3D6C A;  4XXE A;  2F0J A;  4O1N A;  5ELF A;  2KEC A;  2PZT A;  4OIK A;  3RUZ A;  1IYV A;  4MN3 A;  4IUT A;  2Z4H A;  2AWO A;  3S17 B;  3AB9 A;  1T5E A;  3TSS A;  1STE A;  1TR5 A;  1U4P A;  2X6L A;  3R2T A;  4P2C B;  2K5Q A;  3OSO A;  2NZ1 D;  1K8M A;  3DMU A;  5LHY 1;  1ROD A;  2F0T A;  1X3Q A;  2JEB I;  1PRT C;  2MPM A;  4QUC A;  5I9P A;  4HSV A;  1Q1E A;  3FMC A;  1SMY D;  4OO1 I;  4DU9 A;  2HCI A;  3OHX C;  2J7Z A;  3R2I A;  2J0T D;  5D3D A;  4RGO S;  4FF2 A;  4G7H C;  3TP5 A;  5J39 A;  2K28 A;  2A68 D;  2RSN A;  4DGZ A;  3SR1 A;  2F03 A;  3CKI B;  4ZYS A;  1MI2 A;  3URY A;  5FLX E;  1SNP A;  1SBB B;  3L7Z C;  1I4G A;  3VR3 A;  3ERO A;  1B3A A;  2Y0S B;  3LX0 A;  5C4J B;  5EJW A;  4OGQ C;  3T13 A;  4RCN A;  3S1N B;  2SOB A;  4TSS A;  2N88 A;  1D5X C;  5KRU A;  4FP5 D;  1I50 B;  2TSS A;  1PZK D;  1FGB D;  1GUO A;  2IJ0 A;  3MFY A;  4QCL A;  2E75 C;  4NMZ A;  1BO0 A;  1LAB A;  3I3C A;  4PV1 C;  2R92 B;  2A69 C;  3OMC A;  2NN6 H;  5DM7 3;  1DOL A;  1ICW A;  1CFM A;  5I2X A;  4IUQ A;  5CV7 A;  1Q8I A;  4ZUI A;  1NR2 A;  5M3F B;  4A3M B;  1LLR D;  1VMP A;  2X6G A;  1SXT A;  2ZT9 C;  4KK7 A;  4ODG A;  3LNN A;  5E1F A;  1CK1 A;  4BWG B;  4X3S A;  1Q90 A;  4C3J G;  2BDO A;  1DM0 B;  1ESF A;  1NR4 A;  5JAV A;  1MBY A;  1C4Q A;  1SEB D;  1HPC A;  3PV0 A;  2M00 A;  2ICI A;  3I4M B;  3OWF A;  3VYU A;  2CHB D;  4EQO A;  1TWC B;  1ZKO A;  3S16 B;  1IKL A;  1VF7 A;  4KN7 C;  2L9H A;  4RFB A;  2IPK D;  1E0B A;  1CT1 D;  2AQ3 B;  3WOF A;  1KDA A;  3SK6 A;  2MUY A;  1D5M C;  1IL8 A;  2B2W A;  3K58 A;  3T4A C;  3T53 B;  1R4P B;  2F0K A;  2M2L A;  2XIW A;  1FNU A;  1U4R A;  3J7A F;  4K5X A;  2IW3 A;  3O13 A;  3GO5 A;  3J81 E;  1R4Q B;  3KUP A;  3A8I E;  4CKB A;  4ABN A;  5C44 B;  1V1P B;  4H7B A;  2I46 A;  4BBS B;  3GTJ B;  1GOZ A;  3PUY A;  2NN6 G;  5M5W B;  4XYQ A;  3VA7 A;  5C0X I;  1RD9 D;  3MAQ A;  1LTB D;  1BF4 A;  2CW0 C;  2FMC A;  3OW7 A;  3VA5 A;  1QB5 D;  4B08 A;  3ND9 A;  4WJW A;  1STN A;  2E74 C;  5I4D A;  2G9D A;  2G9H D;  1HRJ A;  2A6E D;  3GTL B;  1II3 A;  3K59 A;  2OXP A;  3OPO A;  4I7Z C;  3HGB A;  4R9W A;  1LTG D;  4RKL A;  4CHT B;  4F7X A;  4DF7 A;  4K5V A;  3M3Y B;  4RGT A;  4KJO A;  1IYU A;  4X3K A;  4K2K A;  1DOM A;  1KLU D;  4HMJ A;  5COY A;  4FF4 A;  2NB0 A;  2OT2 A;  3ONA B;  3I90 A;  1EY0 A;  5EPK A;  4I65 A;  4RA8 A;  4ZKC B;  4EQP A;  3BS1 A;  1ZYR D;  1JC7 A;  1SYD A;  1SNC A;  4ZKB B;  2F0V A;  3H3V C;  1Y69 U;  2E2J B;  5EBD A;  2F3W A;  3CU7 A;  2HQE A;  3NWT A;  3IAY A;  1VCI A;  4KY5 A;  1JWU D;  2F0Q A;  1G91 A;  4CJ2 C;  1ET6 A;  1ESR A;  2DNE A;  3NBI A;  1D6E C;  1TWA B;  1TKW B;  4RKB A;  5C3E B;  1BCP D;  1WTP A;  1D2B A;  4DAP A;  2D9U A;  1Z6H A;  1H9S A;  4L63 B;  1Q3L A;  2D2C C;  1ENF A;  2XRQ D;  3DEP A;  4XYO A;  2A6E C;  5C6A A;  1LTI D;  1O80 A;  2SNS A;  2F0M A;  2XVS A;  1LTS D;  3MXG A;  5I9O A;  2QKI C;  4A3F B;  2HCC A;  5C4X B;  1EWC A;  2AQ1 B;  4PMC A;  2B39 A;  4DNT B;  3SXH A;  1BQQ T;  5D14 A;  2F0D A;  2BE5 C;  4F8M A;  2V4D A;  3VR6 A;  2E2H B;  2K03 A;  2RDH A;  1STY A;  3NK9 A;  2WAC A;  3K57 A;  5DNF A;  3BVZ A;  4IUR A;  2B2V A;  3L9A X;  4RWS C;  5FK9 C;  3IL8 A;  4RAU C;  5CV5 A;  3EA6 A;  4G57 A;  2KHS A;  3HG9 A;  5BN5 A;  1FD7 D;  3S1M B;  1F2L A;  2X69 A;  3T16 A;  3E6Z X;  2B2U A;  2EPB A;  4C2M B;  5KYL A;  2EYL A;  2K5W A;  3RZO B;  1J8I A;  3D6W A;  4NW2 A;  5TSS A;  2SEB D;  3K5O A;  1PLF A;  5CBA E;  1XTC D;  2R93 B;  2WV6 D;  3K7A B;  2B8G A;  2VB2 X;  3QOJ A;  1DOK A;  4RCO A;  1M4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...