1C48A

Mutated shiga-like toxin b subunit (g62t)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
69
structure length
69
Chain Sequence
b'TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGTFSEVIFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (SHIGA-LIKE TOXIN I B SUBUNIT)
publication title Identification of the Primary Receptor Binding Site of Shiga-Like Toxin B Subunits: Structures of Mutated Shiga-Like Toxin I B-Pentamer with and without Bound Carbohydrate
rcsb
source organism Phage h30
molecule tags Toxin
total genus 18
structure length 69
sequence length 69
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 1999-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1c48A00
1D1IA 1CQFA 4M1UB 1QOHA 4P2CB 2GA4B 1CZGA 4ULLA 1C4QA 1BOSA 1QNUA 3MXGA 1R4PB 2XSCA 1DM0B 1D1KA 1C48A 1R4QB 2BOSA 2C5CA 1CZWA
chains in the Genus database with same CATH superfamily
1CKOA 2PO4A 1LTBD 2LXJA 1I6HH 4DAYA 1PH7A 1E3PA 2K33A 1OXVA 3RN5A 3FKIH 4ILWA 3VR5A 1O7LA 5IT9c 1XPOA 3QJYA 2M00A 3J80i 5I6YA 3S14B 4C3JB 1LT4D 5FO9B 3S1NH 1XPRA 3M7NA 2H5XA 5C5LA 4JI5L 3FEWX 4X62Q 2O5IC 1PRTD 2HUGA 1DOKA 2E2HH 3HOXH 4GKJQ 4LK1C 5EGTA 4YWMA 1FYCA 1SMYD 5JJKA 1CKNB 4JYAQ 3JAMi 4DV4Q 2WAQB 1Z6HA 2IX1A 3OPOA 4QF4A 2O2LD 4A3IH 1STAA 3CCVA 2E2IH 3A55A 3N6RA 1SDFA 1Y1VH 1S72A 2Z6BA 1PFBA 1HA5A 1D6EC 4GNXC 3BG3A 3GTOB 5JOBA 4X3KA 4P2CB 5GQOA 1QUQB 3TP7A 1KLUD 5C3EB 1NY4A 1BOSA 3IKJA 4IUPA 2DY7A 4IJLA 2Y0SB 1DYQA 1D5XC 1NUCA 1BBWA 3P75A 5D65A 2WKDA 3MEHA 1Q3LA 2XGTA 2JA5B 2K5WA 4IPHA 5BN3A 3Q24A 1B9NA 1D5ZC 3VA5A 3ICEA 3KOJA 4RCNA 1IYVA 1RTNA 1R4QB 3NEMA 1LTSD 3VYSA 4A3FH 1IL2A 1IHZA 1NE3A 1YNJC 4B3MQ 1PXUA 2NN6I 3SK8A 3KF6B 1WCMG 3NQTA 2F0MA 2F0PA 1JE4A 2J4XA 1MJCA 3J80c 4DKAC 3O13A 2FMCA 3P1HA 3GO5A 5IYCG 2JA9A 4OIJA 3B6YA 1II3A 1KIXA 4U68A 2A74C 3NELA 1IW7C 4F8MA 4IFDI 3TMEA 1GUTA 1HNWL 1I94Q 4LF9L 1RD9D 4YCVA 4A3KH 2B3GA 4CKEA 1BBXC 1AE2A 1QVGA 1I4RA 4GNXA 1EFID 1H9SB 3JAMc 2E2JH 3STBC 4A4IA 1VQIA 4ABNA 4DK0A 3J7AV 3ULLA 2KENA 3CD6A 2WACA 2ZM6L 4JBMA 1GXDC 4G7ZC 3GTGB 2YTVA 2PYKA 4P74A 2JXMB 4BY1H 4C1NI 2KCNA 3CKIB 4LJZC 2OT2A 3NXWA 4HR7B 4BY7G 4LF6L 3E6ZX 4ULLA 1PA6A 5C5MA 1VQ7A 4K0KQ 5GROA 5LMNQ 1UEAB 3HG9A 4YHHL 4JI7Q 3MFYA 4HJ9A 3A74A 1TXYA 1VDZA 4OL7A 1SE8A 1M90C 4X65L 3CCQA 2NVYH 1WYDA 2F0DA 3QB3A 3QG1A 4IZ8A 3NBIA 4G57A 1PH1A 1T5XD 2D0PA 5KNBA 1YEZA 4QY7A 3K8AA 1X55A 1DGSA 4JOIC 1G6ZA 4PV1C 1KHIA 3S1MH 5M3FH 5FKAC 4XQNA 1X3GA 1QZGA 2VB3X 3T4AC 5BR8L 4OO1H 5EKIA 1XYIA 1VMCA 1JCKB 1EOTA 1L2FA 1K83H 1TR5A 2F0HA 1QNUA 1ESFA 3MEFA 4FYDA 1OXTA 3BZKA 2OEOA 2A6HD 2ZXOA 3T13A 3R2IA 1V1QA 2EY1A 1WCMB 3F2BA 3RR5A 4L5SA 3EFXD 1J5EQ 1SFOB 4DR7L 2YV5A 4R4TA 3H0GG 5J22A 1ASZA 4DV7Q 3OWEB 2JQOA 5ISRA 2UUAL 3DUZA 4DR3L 1XNRL 4NP5A 1E22A 3U4VA 4LFBL 4WJ4A 4X3SA 2ZTCA 1Q82C 4JI8L 4NXML 1N33L 4GOPA 3T56B 1N34L 1DZ1A 2V4DA 3L3OC 4GN3B 2R92H 3CRKC 1JB3A 2E75C 2K5VA 1PH9A 5ELEA 2K6AA 1T5EA 1LO5D 1STEA 5C4JB 1QWYA 1VQMA 3QO2A 4A3LH 3DEPA 1SYBA 1SSOA 1H9KA 1KRTA 2C5CA 4TRDA 3VDYA 2QKIC 2LFNA 1L1OB 5IYDH 2HT1A 1KNAA 2IY5B 1RF2D 1Q7YC 3HOVB 4DXGA 4JOIA 1BBUA 4BY7B 3BVMA 1HUNA 1LT5D 2F0TA 5LMUQ 3FPPA 3ZJYC 2A1AA 2CHBD 2DNCA 1VQFA 4CKBA 2KHIA 1BR9A 1HZ9A 2MNAA 2Z8LA 1VS0A 4J15A 5EPLA 1HZAA 1STGA 4ALPA 1JT8A 1HQMC 2R7ZG 2PW5A 3BYYB 1J8IA 1PRTC 2N55A 1STBA 4LW1A 4OXPA 5AJ3L 3J81E 5HY6A 1LACA 2L12A 4X3TA 3DXJC 4AYBE 3GTQB 5JEAG 4A3DH 1SJED 4X66Q 2IX3A 3OHXC 3DMUA 3VR4A 3OWFA 2F52A 1JE5A 2EY5A 1U4MA 5I2YA 1V1PA 1PH3A 4I65A 2M9VA 3C3LA 3TZUA 2L11A 4RHRA 2B8FA 3I55A 2QGQA 3KBXA 1DXMA 2WINB 3C1EA 5C4ZA 3U9OA 2EQSA 2K04A 2QF7A 5C6AA 3J81j 5IP7G 1K28A 4POGA 3E0JA 3H09A 1RDPD 4BXXG 3PO2G 2JSOA 1PVOA 3NHHA 3E0EA 2Q2UA 2KHJA 1MSHA 1KDCA 3CRLC 4P71A 2F0WA 1I4QA 2B8GA 3D4WA 3CPWA 1X9NA 4CGYB 5F2DA 1MI2A 2A19A 3PO3G 2KVMA 4C56C 1BO0A 4FF2A 2OQKA 1PH4A 4QJFA 2K32A 2JP1A 4A3MH 3I70A 2B39A 4DNIA 3R8BA 1F9RA 2UUBQ 4Y7NB 3GTPB 4ZUJA 1MD2D 5KNDA 4X62L 4P73A 1EIYB 1SE3A 3CP0A 2NVXB 2RCFA 2VUMG 1IZ6A 4GKJL 4RKLA 3SK5A 5EAYA 4JVZA 2G9DA 3L9AX 3C2PA 4DV0L 3SE0A 3M3YH 4JYAL 4K5VA 3J7AF 4DV4L 3HOZH 4AYBG 3FPUB 3E5SA 4TVAB 1D7QA 3RZDH 1SNOA 4S3SA 4A3EH 4JI3Q 1D2BA 1K0RA 3OIQA 1IBLQ 4IUVA 5DAUA 5M5WH 2CVRA 2JA8H 3S2DH 3HKSA 3RLOA 3K81C 3M4OH 2Q8IB 5EKLA 1PFMA 2PZTA 4KD4A 1GUSA 1UNSA 1C8CA 3AYHB 2RDGA 1FR3A 4H7BA 3HOUG 4JI4Q 3G48A 3I56A 1LTTD 2DGYA 3V96A 4DR2Q 3I4MB 1VQBA 2F3WA 1YJNA 2YYZA 1UAPA 1M8AA 1KRSA 2D9UA 3UDGA 1UE1A 1EZ8A 4NPSA 5G3LF 3PO2B 1VMPA 3NPPA 4IPGA 3GTJB 1PZID 2KCMA 1FJGQ 3I4LA 3RZOB 3NK9A 4Y52H 3D6WA 2DJGC 1RL2A 2HCCA 3HEJA 3PO3B 1LABA 2R93B 2NN6H 1H9RA 3BS1A 4IO9A 5ELNA 2E74C 2ZJPA 4OWWB 1YZ6A 5DLQE 4DK6C 5L37A 1U4RA 1Q1EA 1WTVA 1AZPA 1EQVA 4DNTB 3D8GA 1OTCA 1HJPA 1B3AA 1SYFA 1Q1BA 3F2UA 1WFQA 3CF5A 1IKMA 1PYSB 4DV6Q 1HPCA 3TP6A 4EVOA 2ZTEA 1Z9FA 5E3FA 1AZQA 2MQHA 4IFDH 2F0NA 3HOYH 4FF1A 3R3OA 3I4NH 2ID0A 1QCBD 1HHVA 3BYTB 3PMFA 5KYIA 1YVCA 5M3MH 3PF4A 1GO3E 3GTMB 2A6EC 3TREA 1PTOB 1CT1D 4A3GG 3X3MA 4EQOA 3MZ5A 1ICWA 4K0KL 5LMNL 4C3HG 2XSCA 4JI7L 1A62A 5CYUA 1XMOQ 4A75A 1RKNA 3D3RA 1ENAA 3Q8DA 3HOUB 3H15A 2R3ZA 4XIGS 3DM1A 4PMCA 3TS2A 1LM0A 4QGUA 1G291 1PH2A 1NMGA 1TWFB 5I4DA 4XQQA 2ATWA 1CQVA 3KDFA 2OCEA 3S14H 4C3JH 4N9TA 4H13C 3M9BA 1Y1WG 1I4PA 1ICFB 4HN7A 1ZXTA 2KOLA 3GV3A 1M4VA 3K58A 1C48A 1B9MA 1J5EL 2B63G 4DAYB 1YJ9A 2YU9B 2EYMA 2GN5A 2ASBA 3AMUA 2EJMA 3BDLA 2EYJA 4QCLA 5E7NA 4DV7L 2I07B 4RHSA 2QA4A 1O80A 3HOWG 2FMMA 1ONLA 3H3VI 4ZRZA 4EQNA 2B2UA 3UDXA 3TP8A 1TS5A 3I72A 3ZYYX 1PH8A 4OWTB 1HNXL 2LMCB 2OWOA 2C35B 4G7HC 4F7XA 4BBRB 2WIIB 3PV0A 3DEOA 3M85A 1SNCA 3GTOH 3UDIA 2CKZB 1A15A 4TQUS 5C0XJ 2PPBC 4HJ8A 4YY3Q 1I5FA 1QG7A 4GKKQ 4PMBA 3T1YQ 4R1JA 4EGVA 2RHQB 5C3EH 4MTNA 3BZDB 2EXDA 3OSOA 2F4VL 1TVXA 1VQPA 2HD3A 2Z0SA 4RH6A 4EQ5A 3S1RB 4RAUC 2C9OA 3MA2B 2PQAA 1R9TB 4UP7A 3NTIA 3V2TA 1SE2A 1VQKA 4R9WA 3TZDA 2JA5H 4A3GB 1VQGA 4YWKA 3L0OA 4R8IA 1ENFA 3NWTA 4H44C 1YITA 1UEBA 5LMUL 5ELCA 1STHA 2EY2A 1D1IA 4KKTA 1HZCA 1RODA 4CDFC 1XMQQ 3R2TA 4DR4Q 4WRDA 3G71A 2B2WC 4TKOB 1VQHA 1EYAA 2EYOA 4AH6A 3UE0A 1TQOA 1JR0D 2ZTDA 5FJ8H 5IT9L 1OXXK 1QILA 4A3JG 2EY6A 3SK4A 1JJ2A 4KKUA 3TEHB 3HRZC 3A7LA 4C3IG 2RQXA 4DK3C 4JI0Q 1Y1WB 4DR6Q 1G51A 5M5YB 1KDAA 1K3BC 2F0KA 4CBVA 2KEDA 4WORA 3S15B 3IRBA 2B63B 1PMRA 3QR8A 3RN2A 3D31A 3DWQA 3CCMA 4J1MA 1YBYA 1CHPD 3I90A 4B9XA 4WJWA 1G2SA 1VCIA 4JBKA 2CH4W 1CM9A 1F9QA 3GTGH 3FVQA 3HOWB 4O0AA 2AUJD 3FRPB 3CQZB 1O78A 2XWBB 4NKLA 4DV5Q 5IGBA 3PSIA 4RWSC 3S1QB 3MXUA 3Q22A 2WV6D 4JK1C 4JI2Q 1HR0W 2QCPX 4GNXB 3I73A 1H9MA 1L0YB 2PNHA 5ELOA 3I91A 4OX9L 2E2DC 4NW2A 1YHBA 1KTKA 4N8FA 2Z1CA 2B2WA 2ZXRA 3HKZB 1DCZA 1SLJA 3MXNA 1V1OA 4A3BG 1ZEQX 2CW0D 3R93A 4IFDJ 1LTLA 4MHEA 4DAVA 4C2MB 5FLMG 3VR2A 5GAEC 5IYBG 1EWHA 3VR3A 1Q46A 4BBSG 1WCMH 1ET6A 4DK1A 3UI2A 2FXQA 1GOZA 1L0WA 5FLXc 5JJLA 1EYGA 1SFOH 1N9WA 3VYTA 4IOAA 1VQCA 4A3JB 1GVPA 3C1FA 4JI3L 4X64Q 1GUGA 1IBLL 1XPUA 2NZOA 5JPNC 2LS01 1MBYA 2VB2X 3T1HQ 4OIKA 1KDBA 1B53A 4RGNA 2BH2A 3JAML 1NNXA 2KEEA 1MJEA 1Q8IA 2FHTA 5C4JH 3TN2A 2VQEL 2PZWA 4JI1Q 2UUCQ 3ND9A 4A93G 3K0YA 2ZJRA 1AE3A 4DR2L 3KJPA 4PZ8A 1XNQQ 2Q2HA 4K14A 1CA6A 1K3RA 4GOPB 1ILQA 4CDDC 1I3QB 3CCUA 3HOVH 2EYLA 3AFQA 4KI0A 1IBKL 4BY7H 2LXKA 1C0AA 2RSOA 1FJGL 1IL8A 2E76C 5I6WA 1QZHA 3KYHC 4A3FG 3ERSX 3K80C 3K7AB 3CC2A 4TSSA 3E3XA 4F88A 4LF8L 4QL5A 4HIOA 4UHVA 1M1KC 1B2TA 2NZHA 1A3VA 4GOPC 5CR3A 4M1UB 5LL6S 1A0IA 1A6XA 4DF7A 1J9OA 4E6IA 4A3BB 3GTQH 3K5NA 1CKNA 2KECA 2KA7A 4I7AA 5JJZA 3L2PA 4QQBX 1KABA 2K75A 4DV6L 2RVLA 3EJIA 1SJHD 4BBSB 3AB9A 2QEXA 1HXYD 1QOHA 4DAMA 1AEXA 1F77A 2HDMA 5LHY1 1VQJA 2BA0A 2SEBD 3M4QA 1F2ZA 1SEBD 2VL6A 2ZXPA 4MZ9A 1E2WA 4CJ0B 2RCNA 1F2YA 4WFN3 1G91A 4BY1G 4DUZQ 1DD2A 1JMCA 1V1PB 2NTTA 3OW7A 4LAAA 1KL9A 3UDFA 2P5ZX 1PRTF 4DR5Q 1ZKOA 4KY7A 3H94A 4ZQ3A 4A93B 1ET9A 2X69A 4AIMA 1HUMA 5EBCA 3SEBA 1AH9A 1JWSD 2K14A 3WOFA 4R4IA 1HFGA 1D1KA 1EQTA 1SYEA 4B3SQ 4OO1G 2O5JC 4Y7NH 2F0IA 1Q8KA 3GTPH 3KF8A 4XTCS 1JC7A 2A6ED 3QIAA 5EQ0A 1I4XA 4CDEC 1TY2A 2NVXH 2R7DA 1JICA 1VQDA 3Q0AA 2X6GA 3BVZA 2MJ8A 3OYYA 1PRTB 5ELDA 4FF4A 3S2HB 5CV5A 3OMGA 2Q8TA 1HTLD 1T9HA 2G5DA 1HFNA 3FDTA 5JEAH 4O42A 4H0LC 1SYDA 1V9PA 1VQOA 2BCOA 2GVBA 4JC0A 4MIUA 1MIUA 3OMCA 4Z9CB 5FO7B 1RJTA 3H3VH 2RDHA 2R92G 4YY3L 1QB5D 4GKKL 4JG2A 1BDOA 3U4ZA 3T1YL 1W6KA 2K1BA 4JV5Q 4JBWA 4A3LG 3NWSA 1EY9A 2JA7G 2HIVA 5IP7H 3I4MH 1VQ4A 2ENBA 2K52A 1TWGB 4BXXH 1NR4A 1QNKA 4IJHA 4HIMA 3PO2H 5GAHC 4JI6Q 4GZYC 3GTJH 2MUYA 2DUDA 1XMQL 2VXWA 3H0GB 2CW0C 1B3QA 1CKMA 3RZOH 4LWCA 2K5DA 3BZCA 1D8LA 2XNAC 3RNUA 1C7YA 3J81i 2PW7A 3PO3H 2NB0A 4DV3Q 2R93H 4KY6A 4XDXA 3KK7A 2AQ3B 2EIFA 1G8ZD 4K6LA 5DNFA 1U4PA 4JI0L 3PIO3 2K5HA 4DR6L 2K5NA 4L5RC 4A3DG 2N88A 3FHWA 1B1ZA 3K57A 1QE6A 3A5UA 2IJ0A 1X65A 3J7A5 2N78A 2AWNA 2KQ3A 3RD4A 3DLLA 4IOCA 4LF5Q 1DM0B 1JWMD 1L0XB 4RGTA 1BCPD 1FL0A 1SXTA 4BS9A 2RHSB 2F0OA 2K05A 3TRZA 3PGZA 1WTRA 2EYFA 2JEAI 3T51B 1VQEA 3GTMH 3CMAA 3W3AA 1L1OA 2NVTB 4DV5L 1PTOH 1E1OA 1Q12A 5IP9G 1O7IA 4RKBA 4JI2L 4K8IA 1YHAA 5K36G 1EIFA 1TS3A 5CMDA 3NBHA 4IUTA 4ZLTF 2R7ZB 3TSSA 2RKSA 4IURA 1DOLA 2UXBQ 2RA4A 5C44G 2BE5C 4UP8A 3HOUH 2TSSA 2JA7B 1B8AA 5M5XB 1BUVT 1PFNA 5JPMC 1LT6D 1B70B 5C0XG 5BN4A 4Q0FA 4FO2A 2KHSA 1D5MC 1LTGD 1TWFH 4A3MG 4LNQA 1W6JA 1NAPA 2Q8RE 1PZKD 2B2VC 1WTOA 4KTAA 3M4YA 3K59A 1Y69U 3LX0A 3A5ZB 1DJRD 4POFA 3WOEA 3J81c 5KRUA 1RIPA 4FXDA 1F9PA 3K5MA 4KHPQ 2YU9H 1LTAD 1SNQA 5M9OA 1X3QA 2XRQD 3KJOA 4ZKBB 3LWEA 4KHVA 3KLSX 3F1ZA 3KDFB 4X64L 4DPGA 1EY7A 4XQJA 1K8AC 3HOZG 3TQYA 2CFMA 4B3ML 1CSQA 1N8RC 1DOMA 2KUMA 1Z7TA 4BBRH 5DEHA 1GKHA 1SR3A 2JA8G 1E2VA 4JCVE 1BNZA 2AWOA 1PTOF 1HNWQ 5D3IB 4JI1L 3CAMA 1X56A 2DJFC 2UUCL 1KQSA 1PYBA 1V8QA 3K5OA 3I7FA 3UE1A 2RF4A 4FDBA 5CC4A 3ITPA 4HCEA 2FINB 1XNQL 2ZT9C 3HGBA 2A73B 1XTDA 2NTSA 2HDLA 3S1RH 3FMCA 1EFWA 4FF3A 1I94L 2YTYA 4DR1Q 4KN7C 1R9TH 1S5DD 4HCSA 1N32Q 1SYCA 1TWAB 2L1BA 3H91A 3MWYW 5H1SE 1VQLA 4DV1Q 4A3GH 3DM3A 4GS3A 1Q81C 1A3TA 2CWPA 2VUMB 2B2VA 3ND8A 5FO8B 1EY0A 2WFWA 3KLWA 1SN8A 4CJ2C 5IGCA 2EVBA 1RHPA 4AYBB 2B2UC 4A76A 3HFZB 5C44B 2LKVA 4UPAA 4N8X1 1FGBD 3GV6A 4QUCA 4X65Q 5KYLA 4KK7A 1O7ZA 5CV7A 3GTKB 3CCSA 1BQQT 2F0EA 1Y1WH 1HR0Q 2EJGC 2OXPA 3RMHA 4PG3A 3BDCA 4DNRB 5M5YH 2AQ1B 2SNSA 3MC0B 1KD1C 2VZAA 1EY4A 1PH5A 2N8NA 4HJ7A 3S16B 1X3FA 4KD3A 5ELFA 3BJUA 3S15H 2B63H 2QDLA 5TSSA 3AFPA 2HHHQ 3K5LA 1QVCA 3HS0C 4IFDG 1FGUA 2A68C 4G4KA 2OQ0A 1TWHB 1GUOA 4B3TQ 3BU2A 2I5MX 3I4NG 4DR7Q 3D0FA 3HOWH 1E24A 1PV4A 4K2LA 2B2TC 1I4HA 2UUAQ 3G7LA 4CKCA 4NB3A 4DUZL 3CQZH 1U5KA 3S9WA 2OTLA 1S4ZA 2F0VA 3OTOQ 5IT9E 4IPCA 2OTJA 1N33Q 3S1QH 2WB1E 4A3CH 3CMEA 2H4OA 2KBNA 3RUZA 1SBBB 3CW2C 3Q23A 4DR5L 4GN5A 1KC8C 3LGJA 2IT1A 4XYOA 1NTGA 5IWAQ 5IIFA 5EKKA 2L0CA 4ZK9B 4ZUIA 3U50C 3ONAB 1MGSA 1KAAA 3SXHA 3VA7A 5KIXA 4B3SL 4DGZA 1JB7A 4OELB 5IODA 2A5HA 2VS1A 1CZGA 1XXGA 5I9OA 4UP9A 3I2ZA 4P72A 4C2MH 3LWUA 5IE8A 2ICIA 2NVQB 1LTID 4ID6A 2QEJC 4KV6A 2MPMA 1MSGA 1XWEA 4ZKCB 3MXNB 4KHZA 1PFSA 4PZ6A 3PIP3 3DWAA 4DFAA 2EE1A 4A3JH 1DONA 3DWPA 3Q6SA 2JA6G 2BOSA 1TIID 2F0QA 1BCPC 4C3HB 2WAQG 1NSNS 3KLSA 4KJOA 3A7AB 2B2TA 4RMFA 4FXGC 3IFDA 1Q86C 4PNYA 3C46A 2F0SA 5C4XG 3A8KE 5JAVA 1EOVA 4JV5L 1FVIA 1KXLA 2JN4A 1NBWA 4DAPA 1SE4A 3SK6A 3IL8A 3L7ZC 5D3DA 1CA5A 1WTHA 3EA6A 3NSWA 1P16A 4X66L 1GHJA 3PF5A 4ME3A 4DXFA 4H02A 2IW3A 2XTIA 4R4QA 4LFAQ 1Y8PB 1I3QH 1ASYA 5IGFA 2WB1G 5KNCA 2VQFQ 4K8JA 4JI6L 4CHTB 1K9MC 3A8JE 1EQRA 1EIHA 2BDOA 1K8GA 3S17B 5C0XI 3K7AH 1VF5C 4QUFA 2KCCA 1HTPA 4PMWA 3ULJA 4DUYQ 1CUKA 3PIPA 5A35A 2XVSA 3GD7A 3JAME 5FJ8G 1S40A 5IGDA 1KAWA 4A3BH 3PUWA 4ZCKA 1TU2B 5IY0A 3MTSA 1ENCA 2QILA 3G6JB 5EJWA 2F3IA 2K01A 1XX8A 5KEEA 2BDNA 5FOBB 3IFTA 2IL8A 5FLMH 1IBMQ 3TS0A 5IYBH 1EIGA 4LF4Q 2Z9HA 5FLXL 4LF5L 1G6PA 1EU4A 4BBSH 2QW7A 1BXTA 3EIVA 4LUVA 1YHQA 1NJIC 3FKIG 1NCVA 5A2QL 4DA2A 1EQQA 2UXDQ 1XJVA 2UUBL 1C9OA 3U58A 1K0SA 4DV0Q 4YCWA 2JA6B 1LYLA 2IHFA 4IN3A 4YIJA 2VNUD 3KFUA 3SHLA 1PHJA 3TBIB 2F4IA 5KGUA 4KMUC 1JJGA 3MHBA 1Y14B 2V1CC 1WJJA 1X6OA 2IHEA 1PLFA 1ZYRD 1AW7A 1XTCD 4YCUA 1RTOA 3J80L 5I9PA 3GTLB 5C4XB 2E8GA 1WD0A 3T16A 5HURA 3HOXG 2N49A 3HP3A 1ESRA 4L63B 3EQLC 4QIWE 2UXBL 1N36Q 1UUPA 5IYCH 2CCZA 4A93H 2PZUA 4HSVA 1FNWA 4C3IB 1OO9B 4A3IG 1STNA 3I3CA 1IKLA 2Z4IA 1I4GA 3E9IA 1Y1VG 1X3EA 4HJAA 3ULPA 1U9RA 3EN2A 2WB1B 3CXCA 5T1IA 2PQEA 4APVA 1SAPA 3QOJA 4JI4L 4K5XA 5EBDA 1TWCB 3GQBA 4FVMA 1WTXA 4KHPL 1MHWC 1SROA 2MFIA 4KKSA 4O1NA 3AQQA 1OXSC 3N52A 1WOCA 2UXCQ 2A69C 1I50B 2CWAA 3IAYA 3AEVA 3S2HH 1UE6A 1BVSA 2L55A 4LF7Q 2BE5D 2F0FA 5CBAE 5IGGA 3KF8B 3PCOB 5NUCA 3M4PA 1VF7A 3ER0A 4HMIA 1OXUA 4MTKA 5E4XA 5EPJA 1TS2A 4RFBA 2XWJB 1I6VC 1I6HB 1EEFD 4OWXB 3J7YW 1A2UA 3FKIB 4Q5VA 3FP9A 4C1NK 4L6TB 1EEID 4DR1L 2K5QA 2JE6I 3BDOA 1N32L 1SNPA 2DNEA 1YI2A 2UU9Q 1GUNA 3S1NB 5IOCA 1TWGH 4DV1L 3OW2A 2DY8A 1YNND 3HOVG 2PI2A 1LV9A 4A3KG 1GJXA 2K03A 1RCVD 2O4XA 2E2HB 2GA4B 2PNRC 3HOXB 1VQ6A 3T53B 2Z4HA 3H0GH 5CV6A 1AN8A 1QUQA 2L9HA 5AFWA 4KLKA 2GVAA 2L5TA 1VQNA 5K5PA 3EROA 1JWUD 2FJ2A 2E5LQ 3M7GA 2EYPA 5CBEE 4A3IB 5CV9A 3E9HA 3W5OA 2E2IB 1A2TA 2IPKD 2EPBA 1Y1VB 4HJ5A 1HR0L 4GN4B 1XMOL 3KLRA 4R4OA 3TDQA 3QOLA 1EUJA 4JBJA 1BF4A 2JK8A 2XRSD 1HCZA 1SNDA 1HH2P 5J3BA 3KF6A 3NP8A 2IWHA 2HHHL 2EDGA 2H1EA 1JQYD 2NUCA 5ELBA 5M3FG 1X54A 4B3TL 1EZ6A 1K73C 3D4RA 2F3VA 2MO1A 1CI3M 3PUYA 2NVTH 1E7ZA 3NE5B 1NMFA 4A3FB 4HIDA 3OTOL 1SNMA 1GM5A 3CC4A 1F9SA 1HNXQ 4AQYQ 2SNMA 2IX0A 4HEDA 4XT1B 2R7ZH 4K5WA 1WTPA 1Z47A 3CCRA 4B3RQ 1YNXA 1H9SA 5IWAL 1B50A 2PMZE 3PUVA 2Q2TA 4P75A 3W2DA 1SYGA 1LTRD 2JA7H 4NXNQ 3CCLA 5M5XH 3KUPA 4UDUC 2F4VQ 5G3LD 2K7VA 1TS4A 4B9WA 1X32A 2A68D 4V0BA 1CK1A 4A3KB 2QDBA 1HNZQ 3NBHB 4GLAC 1VQ8A 3HZXA 5CV8A 4BA2I 5E4WC 2EZVA 4QIWB 4DN4M 1EWIA 2E2JB 1JORA 3J7ZC 2FFKB 2I5LX 2LSSA 4DV2Q 1S5BD 2ICEC 5IYDG 1PTOD 1TY0A 1CTMA 1L1OC 4LFCQ 4NMZA 2AKWB 4G7OC 5E1FA 4BWGB 3W1GA 4BY1B 4FXKC 3SGIA 1VQAA 2F0UA 5FK9C 3VYRA 4CDCC 1IXRA 3RLFA 1HZBA 2A8VA 4DR4L 1SMYC 3I8ZA 1JOOA 5EPKA 2K4KA 2NVYB 1S5ED 1CHQD 5C3WA 4HTHA 1ZYRC 2AMCB 5HGQA 5I2XA 1FNUA 1SMXA 4KJNA 4OEMB 3S1MB 5M3FB 4EQPA 3MAQA 3PQIA 4ME5A 2MGSA 2MHVA 2M2LA 4LFAL 1K83B 1TT2A 3EBEA 3I4MG 5LL6X 5J39A 1UE5A 2F0LA 1TWAH 2VQFL 4L8JA 5IP9H 3F8TA 2YTXA 2VUMH 1EY8A 4JI5Q 5LMNW 5K36H 3A56A 5IGEA 2ZJQA 2R7FA 3PUXA 4MN3A 1CZWA 5J1ZA 1AP0A 5D14A 1U0LA 4DUYL 1LT3D 2R6GA 3U9SA 1PZJD 5DM63 4HIKA 5C44H 3KBGA 4OHJA 4OX9Q 1UE7A 1QJOA 5JVG3 1C4QA 2K50A 4J8QA 2R93G 1R4PB 1S3OA 5C0XH 4LUOA 1YIJA 1STYA 1GD7A 3SVMA 4ZAIA 3CPFA 4IQZA 4QMGA 2R92B 4RGOS 4HSPA 3GTKH 3MXPA 3GP7A 2R61A 1WVLA 1E2ZA 1H95A 3J81L 2SOBA 2HCIA 4ZYSA 2D62A 5JJIA 4FP5D 2BH8A 5GAGC 2SDFA 1S5CD 4MNOA 3X3NA 2HQLA 2OF1A 3WWVA 1IBML 4LF4L 1A8VA 3CC7A 3EVQA 3S16H 1FD7D 4OGQC 3D4DA 1H9JA 2EOTA 2UXDL 3PIOA 4K2KA 1VQ9A 1LLRD 2MP1A 1CFMA 1EY5A 4IUUA 3TP5A 1TWHH 3P7JA 4CJ1B 2K28A 5HGTA 2CH4A 4XXEA 1QVFA 2TMPA 1EL0A 1WI5A 1EU3A 4B08A 1HA6A 3S24A 1YNNC 3A54A 1N36L 3K0XA 2NWGA 1BKBA 3OIPA 3MVVA 1W2BA 2NYZD 1K8OA 4A3EG 4OONA 2VQEQ 3JC66 2WKCA 4IUNA 4FNFA 4K6DA 2JEBI 1JOQA 3GDEA 5CV4A 1JJCB 3T1HL 4A3DB 4R4CA 4X6AH 2Z6KC 4O2DA 4IALA 1KLGD 1EYDA 3H3VC 4LF9Q 3H6MA 2JJQA 1Y8OB 5C3XA 4XT3B 3SDZA 2XIWA 3CCEA 1PYWD 1PH6A 1IBKQ 2EYHA 4ODGA 4NDXA 3NTKA 1X3PA 4EX5A 2PMZB 2J7ZA 1JOKA 2NVQH 2UXCL 2ZM6Q 4IUQA 1HRJA 5T1GA 4LF8Q 2ALYB 2A6HC 5BN5A 5COYA 4LF7L 1UWVA 4PQXA 3VYUA 4GLXA 4C3HH 1FNVA 2XN9C 2DN8A 2KJXA 4LF6Q 2EJFC 2EXZA 1CSPA 1P8LA 4WJ3M 3QWNA 1J6QA 1WTWA 4YHHQ 4BBRG 2CQOA 1NR2A 3V05A 5JEAJ 1EY6A 2PQAB 4BA1I 4OO1I 4F87A 4LUZA 1SRUA 2NN6G 3W1BA 1S5FD 4R8NA 5CORA 2VY3A 4A3MB 3PUZA 1IYUA 4X3UA 3F2DA 3G6EA 1WD1A 1TKWB 1YNJD 1A3UA 1GHKA 2WAQE 1AFPA 2UU9L 5BR8Q 4PZ7A 2B2YC 2F0JA 2A69D 3HKZE 2Z6KA 2PI2E 2L15A 5C4HA 2D2CC 4QB4A 2RDFA 2LY7A 3VR6A 2HQEA 3CU7A 3SR1A 1B44D 3HOYG 2F1MA 4L5TA 4XYQA 3G4SA 3S17H 3M3YB 2X6LA 2NZ1D 3HOZB 1LUZA 1IW7D 2B29A 3RZDB 5M3MG 1BCPF 2E5LL 2Q2IA 4KN4C 4A3EB 4DR3Q 2Y0SE 4RGMA 1XNRQ 3F2CA 1EWCA 2BA1A 3NENA 4LFBQ 1PTOC 3NUCA 5M5WB 4JI8Q 3D6CA 4NXMQ 3LNNA 4U673 2JA8B 3S2DB 4UY8C 3P20A 4YWLA 1N34Q 5JVH3 1A63A 1GUWA 3ERQA 3STBD 3M4OB 3WDNA 4DU9A 5GADC 1U4LA 1B4OA 1K8MA 4RG1A 1KNEA 4RCOA 1G2TA 3A8IE 2AUKA 1MKHA 2I5HA 4I7ZC 2F0GA 1CQFA 3AU7A 3K7UC 2ES2A 2G9HD 4C3JG 2JA6H 1VQ5A 1BCPB 3K6OA 3MXGA 4IPDA 3NQIA 1F2LA 2JYOA 2B2YA 1EYCA 1WTQA 1B7YB 4AQYL 1PDQA 3URYA 2F03A 3DHQA 3GTLH 5C4XH 2RSNA 2I46A 4A3CG 4B3RL 4L5QA 4M8AA 2HIXA 3CCJA 2NBFA 3MFGA 5AJ3Q 1IYJB 4NXNL 4C3IH 2VW9A 2J0TD 5FLXE 2L4NA 3HKZG 4LMQD 1HNZL 5A2QE 4JW0A 1Q90A 1W3SA 4HAEA 3I4OA 3OOCA 5CGKA 1ILPA 3A0JA 2WP8J 2N3SA 4V190 3HOYB 4DV2L 1TWCH 5C3EG 1YJWA 4GLVB 4J6HA 2AQ2B 4LFCL 3RLNA 3I4NB 2Y0SG 5M3MB 2KCTA 3J80E 1HQRD 1E0BA 1I50H 2CQAA 2MO0A 3CHBD 2D5DA 2JA5G 4UAIA 3NTHA 1O7YA 2I0QA 1V43A 4JPBW 1Y8NB 4KY5A 2D0OA 3BVGA 1E1TA 1ML0D 4N9PA 4RA8A 1F2MA 5DM73 2AHOB 2RBMA 4HMJA 4DV3L 2PCFB
chains in the Genus database with same CATH topology
2PO4A 1LTBD 4DAYA 2K33A 1OXVA 4ILWA 3VR5A 1O7LA 3QJYA 2M00A 5I6YA 3S14B 4C3JB 1LT4D 5FO9B 3M7NA 5C5LA 3FEWX 2O5IC 1PRTD 2HUGA 1DOKA 4LK1C 5EGTA 1FYCA 1SMYD 2WAQB 1Z6HA 2IX1A 3OPOA 4QF4A 2O2LD 1STAA 3A55A 3N6RA 1SDFA 1PFBA 1HA5A 1D6EC 3GTOB 3BG3A 5JOBA 4X3KA 4P2CB 3TP7A 1KLUD 5C3EB 1BOSA 3IKJA 4IUPA 2DY7A 2Y0SB 1DYQA 1D5XC 1NUCA 3P75A 5D65A 2WKDA 3MEHA 1Q3LA 2JA5B 2K5WA 5BN3A 3Q24A 1B9NA 1D5ZC 3VA5A 1IYVA 4RCNA 1RTNA 1R4QB 1LTSD 3VYSA 1IHZA 1YNJC 1PXUA 2NN6I 3SK8A 2F0MA 3NQTA 2F0PA 1JE4A 2J4XA 3O13A 2FMCA 3P1HA 3GO5A 4OIJA 1II3A 4U68A 2A74C 4F8MA 1IW7C 4IFDI 3TMEA 1GUTA 1RD9D 4CKEA 1BBXC 1I4RA 1EFID 1H9SB 4ABNA 4DK0A 3J7AV 2WACA 1GXDC 4G7ZC 3GTGB 2PYKA 2JXMB 4C1NI 2KCNA 3CKIB 4LJZC 2OT2A 3NXWA 4HR7B 3E6ZX 4ULLA 5C5MA 1UEAB 3HG9A 3MFYA 1VDZA 4OL7A 2F0DA 3QB3A 3QG1A 4IZ8A 3NBIA 4G57A 1T5XD 5KNBA 1G6ZA 4PV1C 5FKAC 4XQNA 2VB3X 3T4AC 4OO1H 5EKIA 1XYIA 1VMCA 1JCKB 1EOTA 1TR5A 2F0HA 1QNUA 1ESFA 4FYDA 1OXTA 2OEOA 2A6HD 2ZXOA 3T13A 3R2IA 2EY1A 1WCMB 3EFXD 1SFOB 5J22A 3OWEB 5ISRA 3DUZA 4NP5A 4X3SA 3T56B 1DZ1A 2V4DA 3L3OC 3CRKC 1JB3A 2E75C 5ELEA 2K6AA 1T5EA 1LO5D 1STEA 5C4JB 1QWYA 3QO2A 3DEPA 1SYBA 1SSOA 1H9KA 2C5CA 4TRDA 2QKIC 2LFNA 1KNAA 1RF2D 3HOVB 4DXGA 4BY7B 3BVMA 1HUNA 1LT5D 2F0TA 3FPPA 2CHBD 2DNCA 4CKBA 1BR9A 2Z8LA 5EPLA 1STGA 1HQMC 2PW5A 3BYYB 1J8IA 1PRTC 2N55A 1STBA 3J81E 1LACA 2L12A 4X3TA 3DXJC 3GTQB 5JEAG 1SJED 2IX3A 3OHXC 3DMUA 3VR4A 3OWFA 2EY5A 1U4MA 5I2YA 1V1PA 4I65A 2M9VA 3C3LA 3TZUA 2L11A 4RHRA 2B8FA 3KBXA 1DXMA 2WINB 3C1EA 5C4ZA 3U9OA 2K04A 2QF7A 5C6AA 3E0JA 3H09A 1RDPD 2JSOA 3NHHA 1MSHA 1KDCA 3CRLC 2F0WA 1I4QA 2B8GA 3D4WA 4CGYB 5F2DA 1MI2A 2KVMA 4C56C 1BO0A 4FF2A 2K32A 2JP1A 3I70A 2B39A 3R8BA 1F9RA 4Y7NB 3GTPB 4ZUJA 1MD2D 5KNDA 1SE3A 2NVXB 4RKLA 3SK5A 2G9DA 3L9AX 3C2PA 3SE0A 4K5VA 3J7AF 3FPUB 3E5SA 1SNOA 4S3SA 1D2BA 3OIQA 4IUVA 5DAUA 2CVRA 2Q8IB 5EKLA 1PFMA 2PZTA 4KD4A 1GUSA 1UNSA 1C8CA 2RDGA 1FR3A 4H7BA 1LTTD 3V96A 3I4MB 2F3WA 2YYZA 1UAPA 1M8AA 2D9UA 1EZ8A 5G3LF 3PO2B 1VMPA 3NPPA 3GTJB 1PZID 3I4LA 3RZOB 3NK9A 3D6WA 2HCCA 3HEJA 3PO3B 1LABA 2R93B 2NN6H 1H9RA 3BS1A 2E74C 1U4RA 1Q1EA 1WTVA 1AZPA 1EQVA 4DNTB 3D8GA 1B3AA 1SYFA 1Q1BA 3F2UA 1IKMA 1HPCA 3TP6A 4EVOA 5E3FA 1AZQA 4IFDH 2F0NA 4FF1A 3R3OA 2ID0A 1QCBD 1HHVA 3BYTB 3PMFA 5KYIA 3GTMB 2A6EC 1PTOB 1CT1D 3X3MA 4EQOA 3MZ5A 1ICWA 4C3HG 2XSCA 5CYUA 1RKNA 3D3RA 1ENAA 3HOUB 2R3ZA 4XIGS 3DM1A 4PMCA 1G291 1TWFB 5I4DA 4XQQA 1CQVA 4N9TA 4H13C 1I4PA 4HN7A 1ZXTA 2KOLA 3GV3A 1M4VA 3K58A 1C48A 1B9MA 2YU9B 2EYMA 3AMUA 2EJMA 3BDLA 2EYJA 4QCLA 2I07B 4RHSA 1O80A 2FMMA 1ONLA 4ZRZA 4EQNA 2B2UA 3TP8A 1TS5A 3I72A 3ZYYX 2LMCB 4G7HC 4F7XA 4BBRB 2WIIB 3PV0A 3DEOA 3M85A 1SNCA 1A15A 4TQUS 5C0XJ 2PPBC 1QG7A 4PMBA 4EGVA 3BZDB 3OSOA 1TVXA 4RH6A 3S1RB 4RAUC 2C9OA 3MA2B 1R9TB 3NTIA 3V2TA 1SE2A 4R9WA 3TZDA 4A3GB 4R8IA 1ENFA 3NWTA 4H44C 5ELCA 1STHA 2EY2A 1D1IA 4KKTA 1RODA 3R2TA 4WRDA 2B2WC 4TKOB 1EYAA 2EYOA 1TQOA 1JR0D 5IT9L 1OXXK 1QILA 2EY6A 3SK4A 4KKUA 3HRZC 3A7LA 4C3IG 2RQXA 1Y1WB 5M5YB 1KDAA 2F0KA 4CBVA 2KEDA 4WORA 3S15B 2B63B 1PMRA 3D31A 3DWQA 4J1MA 1CHPD 3I90A 4B9XA 4WJWA 1G2SA 1VCIA 1CM9A 1F9QA 3HOWB 3FVQA 2AUJD 3FRPB 3CQZB 1O78A 2XWBB 4NKLA 5IGBA 4RWSC 3S1QB 3MXUA 3Q22A 2WV6D 4JK1C 2QCPX 3I73A 1H9MA 1L0YB 3I91A 2E2DC 4NW2A 1KTKA 2Z1CA 2B2WA 2ZXRA 3HKZB 1DCZA 3MXNA 1V1OA 1ZEQX 2CW0D 3R93A 4IFDJ 4MHEA 4DAVA 4C2MB 3VR2A 1EWHA 3VR3A 1ET6A 4DK1A 3UI2A 1GOZA 3VYTA 4A3JB 3C1FA 1GUGA 5JPNC 2LS01 1MBYA 2VB2X 4OIKA 1KDBA 1B53A 4RGNA 3JAML 2KEEA 1Q8IA 2FHTA 3TN2A 2PZWA 3ND9A 3K0YA 4K14A 1CA6A 1ILQA 1I3QB 2EYLA 4KI0A 2RSOA 1IL8A 2E76C 5I6WA 3K7AB 4TSSA 4F88A 1B2TA 1A3VA 5CR3A 4M1UB 5LL6S 1A6XA 4DF7A 1J9OA 4E6IA 4A3BB 3K5NA 2KECA 2KA7A 5JJZA 1KABA 2RVLA 3EJIA 1SJHD 4BBSB 3AB9A 1HXYD 1QOHA 1AEXA 1F77A 2HDMA 5LHY1 2SEBD 2BA0A 1F2ZA 1SEBD 2ZXPA 1E2WA 4CJ0B 1F2YA 4WFN3 1G91A 1DD2A 1V1PB 2NTTA 3OW7A 4LAAA 1PRTF 1ZKOA 4KY7A 3H94A 4ZQ3A 4A93B 1ET9A 2X69A 1HUMA 5EBCA 3SEBA 1JWSD 3WOFA 1HFGA 1D1KA 1EQTA 1SYEA 4OO1G 2O5JC 2F0IA 3KF8A 4XTCS 1JC7A 2A6ED 3QIAA 5EQ0A 1I4XA 1TY2A 1JICA 3Q0AA 2X6GA 3BVZA 2MJ8A 1PRTB 5ELDA 4FF4A 3S2HB 5CV5A 3OMGA 2Q8TA 1HTLD 1HFNA 3FDTA 5JEAH 4O42A 4H0LC 1SYDA 2BCOA 4MIUA 3OMCA 4Z9CB 5FO7B 1RJTA 2RDHA 1QB5D 1BDOA 1W6KA 2K1BA 4JBWA 3NWSA 1EY9A 2ENBA 1TWGB 1NR4A 1QNKA 4GZYC 2MUYA 2VXWA 3H0GB 2CW0C 2K5DA 2XNAC 2PW7A 2NB0A 4KY6A 4XDXA 3KK7A 2AQ3B 1G8ZD 4K6LA 5DNFA 1U4PA 3PIO3 2N88A 1B1ZA 3K57A 1QE6A 2IJ0A 2AWNA 2KQ3A 3RD4A 1DM0B 1JWMD 1L0XB 4RGTA 1BCPD 1SXTA 4BS9A 2F0OA 2K05A 1WTRA 2EYFA 2JEAI 3T51B 3W3AA 2NVTB 1PTOH 1Q12A 4RKBA 4K8IA 5K36G 1TS3A 5CMDA 3NBHA 4IUTA 4ZLTF 2R7ZB 3TSSA 2RKSA 4IURA 1DOLA 2RA4A 2BE5C 2TSSA 2JA7B 5M5XB 1BUVT 1PFNA 5JPMC 1LT6D 5C0XG 5BN4A 4Q0FA 4FO2A 2KHSA 1D5MC 1LTGD 1W6JA 1NAPA 2Q8RE 1PZKD 2B2VC 1WTOA 4KTAA 3M4YA 3K59A 1Y69U 3LX0A 1DJRD 3WOEA 5KRUA 4FXDA 1F9PA 3K5MA 1LTAD 1SNQA 5M9OA 1X3QA 2XRQD 4ZKBB 3LWEA 4KHVA 3KLSX 1EY7A 4XQJA 1DOMA 2KUMA 1Z7TA 5DEHA 1E2VA 1BNZA 2AWOA 1PTOF 5D3IB 1V8QA 3K5OA 5CC4A 3ITPA 4HCEA 2FINB 2ZT9C 3HGBA 2A73B 2NTSA 2HDLA 3FMCA 4FF3A 4KN7C 1S5DD 4HCSA 1SYCA 1TWAB 2L1BA 3H91A 3MWYW 1A3TA 2VUMB 2B2VA 3ND8A 5FO8B 1EY0A 4CJ2C 5IGCA 2EVBA 1RHPA 4AYBB 2B2UC 5C44B 2LKVA 1FGBD 3GV6A 4QUCA 5KYLA 4KK7A 1O7ZA 5CV7A 3GTKB 1BQQT 2F0EA 2EJGC 2OXPA 3RMHA 3BDCA 4DNRB 2AQ1B 2SNSA 3MC0B 1EY4A 3S16B 4KD3A 5ELFA 5TSSA 3K5LA 3HS0C 4IFDG 2A68C 4G4KA 1TWHB 1GUOA 4K2LA 2B2TC 1I4HA 3G7LA 4CKCA 3S9WA 1S4ZA 2F0VA 5IT9E 2H4OA 3RUZA 1SBBB 3Q23A 2IT1A 4XYOA 5IIFA 5EKKA 2L0CA 4ZK9B 4ZUIA 3ONAB 1MGSA 3SXHA 1KAAA 3VA7A 5KIXA 4DGZA 5IODA 2A5HA 1CZGA 1XXGA 5I9OA 3LWUA 2ICIA 2NVQB 1LTID 4ID6A 2QEJC 4KV6A 2MPMA 1MSGA 1XWEA 4ZKCB 4KHZA 3PIP3 3DWAA 4DFAA 2EE1A 1DONA 3DWPA 3Q6SA 2BOSA 1TIID 2F0QA 1BCPC 4C3HB 1NSNS 3KLSA 4KJOA 3A7AB 2B2TA 4FXGC 3IFDA 4PNYA 3C46A 2F0SA 3A8KE 5JAVA 4DAPA 1SE4A 3SK6A 3IL8A 3L7ZC 5D3DA 1CA5A 3EA6A 3NSWA 1GHJA 4DXFA 2IW3A 1Y8PB 5IGFA 5KNCA 4K8JA 4CHTB 3A8JE 1EIHA 2BDOA 3S17B 5C0XI 1VF5C 4QUFA 2KCCA 1HTPA 4PMWA 5A35A 2XVSA 3GD7A 3JAME 5IGDA 3PUWA 1TU2B 3MTSA 1ENCA 2QILA 3G6JB 5EJWA 2K01A 1XX8A 5KEEA 2BDNA 5FOBB 3IFTA 2IL8A 1EIGA 5FLXL 1EU4A 1BXTA 1NCVA 5A2QL 4DA2A 2JA6B 4YIJA 4IN3A 2VNUD 3SHLA 3TBIB 2F4IA 5KGUA 4KMUC 3MHBA 1PLFA 1ZYRD 1AW7A 1XTCD 1RTOA 3J80L 5I9PA 3GTLB 5C4XB 1WD0A 3T16A 5HURA 3HP3A 1ESRA 4L63B 3EQLC 1UUPA 2PZUA 4HSVA 1FNWA 4C3IB 1OO9B 1STNA 3I3CA 1IKLA 2Z4IA 1I4GA 1U9RA 2WB1B 5T1IA 2PQEA 1SAPA 3QOJA 4K5XA 5EBDA 1TWCB 3GQBA 4FVMA 1WTXA 4KKSA 4O1NA 1OXSC 3N52A 2A69C 1I50B 3IAYA 2L55A 2BE5D 2F0FA 5CBAE 5IGGA 5NUCA 1VF7A 4HMIA 1OXUA 5E4XA 5EPJA 1TS2A 4RFBA 2XWJB 1I6VC 1I6HB 1EEFD 3J7YW 1A2UA 3FKIB 4Q5VA 4C1NK 4L6TB 1EEID 2K5QA 2JE6I 3BDOA 1SNPA 2DNEA 1GUNA 3S1NB 5IOCA 2DY8A 1YNND 1LV9A 1GJXA 2K03A 1RCVD 2O4XA 2E2HB 2GA4B 2PNRC 3HOXB 3T53B 2Z4HA 5CV6A 1AN8A 5AFWA 2L9HA 2L5TA 5K5PA 3EROA 1JWUD 2FJ2A 3M7GA 2EYPA 5CBEE 4A3IB 5CV9A 2E2IB 1A2TA 2IPKD 2EPBA 1Y1VB 3KLRA 3TDQA 3QOLA 1BF4A 2XRSD 1HCZA 1SNDA 3NP8A 2IWHA 2EDGA 2H1EA 1JQYD 2NUCA 5ELBA 1EZ6A 3D4RA 2F3VA 1CI3M 3PUYA 3NE5B 4A3FB 1SNMA 1F9SA 2SNMA 2IX0A 4HEDA 4XT1B 4K5WA 1WTPA 1Z47A 1H9SA 1B50A 3PUVA 3W2DA 1SYGA 1LTRD 3KUPA 4UDUC 5G3LD 2K7VA 1TS4A 4B9WA 1X32A 2A68D 4V0BA 1CK1A 4A3KB 2QDBA 3HZXA 5CV8A 4BA2I 5E4WC 2EZVA 4QIWB 4DN4M 2E2JB 1JORA 2FFKB 1S5BD 2ICEC 1PTOD 1TY0A 1CTMA 4NMZA 4G7OC 5E1FA 4BWGB 4BY1B 4FXKC 2F0UA 5FK9C 3VYRA 3RLFA 1SMYC 3I8ZA 1JOOA 5EPKA 2NVYB 1S5ED 1CHQD 5C3WA 4HTHA 1ZYRC 5I2XA 1FNUA 4KJNA 3S1MB 5M3FB 4EQPA 3MAQA 4ME5A 2MGSA 2MHVA 2M2LA 1K83B 1TT2A 5LL6X 5J39A 2F0LA 4L8JA 1EY8A 5K36H 3A56A 5IGEA 3PUXA 4MN3A 5J1ZA 1CZWA 1AP0A 5D14A 1LT3D 2R6GA 3U9SA 1PZJD 5DM63 3KBGA 4OHJA 1QJOA 5JVG3 1C4QA 4J8QA 1R4PB 5C0XH 1STYA 3SVMA 4ZAIA 4QMGA 4IQZA 2R92B 4RGOS 4HSPA 3MXPA 3GP7A 2R61A 1WVLA 1E2ZA 3J81L 2SOBA 2HCIA 4ZYSA 2D62A 4FP5D 2SDFA 1S5CD 3X3NA 2OF1A 3EVQA 1FD7D 4OGQC 3D4DA 1H9JA 2EOTA 4K2KA 1LLRD 2MP1A 1CFMA 1EY5A 4IUUA 3TP5A 3P7JA 4CJ1B 2K28A 5HGTA 4XXEA 2TMPA 1EL0A 1EU3A 4B08A 1HA6A 1YNNC 3A54A 2NWGA 3OIPA 3MVVA 2NYZD 1K8OA 2WKCA 4IUNA 4FNFA 4K6DA 2JEBI 1JOQA 4A3DB 5CV4A 4IALA 1KLGD 1EYDA 3H3VC 3H6MA 5C3XA 1Y8OB 4XT3B 3SDZA 2XIWA 1PYWD 2EYHA 4ODGA 4NDXA 3NTKA 1X3PA 2PMZB 2J7ZA 1JOKA 4IUQA 1HRJA 5T1GA 2A6HC 5BN5A 5COYA 4PQXA 3VYUA 1FNVA 2XN9C 2DN8A 2KJXA 2EJFC 2EXZA 3QWNA 1WTWA 1NR2A 3V05A 5JEAJ 1EY6A 4BA1I 4OO1I 4F87A 2NN6G 1S5FD 4R8NA 5CORA 4A3MB 3PUZA 1IYUA 4X3UA 1WD1A 1TKWB 1YNJD 1A3UA 1GHKA 1AFPA 2B2YC 2F0JA 2A69D 5C4HA 2D2CC 4QB4A 2RDFA 2LY7A 3VR6A 2HQEA 3CU7A 3SR1A 1B44D 2F1MA 4XYQA 3M3YB 2X6LA 2NZ1D 3HOZB 1IW7D 3RZDB 1BCPF 4KN4C 4A3EB 4RGMA 1EWCA 2BA1A 1PTOC 3NUCA 5M5WB 3D6CA 3LNNA 4U673 2JA8B 3S2DB 3P20A 5JVH3 1GUWA 3ERQA 3M4OB 3WDNA 4DU9A 1U4LA 1B4OA 1K8MA 1KNEA 4RCOA 1G2TA 3A8IE 2AUKA 4I7ZC 2F0GA 1CQFA 3AU7A 2G9HD 4C3JG 1BCPB 3K6OA 3MXGA 3NQIA 1F2LA 2JYOA 2B2YA 1EYCA 1WTQA 1PDQA 3URYA 2F03A 3DHQA 2RSNA 2I46A 4M8AA 2NBFA 3MFGA 2J0TD 5FLXE 2L4NA 4LMQD 5A2QE 1Q90A 4HAEA 3OOCA 5CGKA 1ILPA 2WP8J 4V190 3HOYB 4J6HA 2AQ2B 3I4NB 5M3MB 3J80E 1HQRD 1E0BA 2CQAA 3CHBD 2D5DA 4UAIA 3NTHA 1O7YA 1V43A 1Y8NB 4KY5A 3BVGA 1ML0D 4N9PA 4RA8A 1F2MA 5DM73 2RBMA 4HMJA 2PCFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D1I A;  1CQF A;  4M1U B;  1QOH A;  4P2C B;  2GA4 B;  1CZG A;  4ULL A;  1C4Q A;  1BOS A;  1QNU A;  3MXG A;  1R4P B;  2XSC A;  1DM0 B;  1D1K A;  1C48 A;  1R4Q B;  2BOS A;  2C5C A;  1CZW A; 
#chains in the Genus database with same CATH topology
 1CKO A;  2PO4 A;  1LTB D;  2LXJ A;  1I6H H;  4DAY A;  1PH7 A;  1E3P A;  2K33 A;  1OXV A;  3RN5 A;  3FKI H;  4ILW A;  3VR5 A;  1O7L A;  5IT9 c;  1XPO A;  3QJY A;  2M00 A;  3J80 i;  5I6Y A;  3S14 B;  4C3J B;  1LT4 D;  5FO9 B;  3S1N H;  1XPR A;  3M7N A;  2H5X A;  5C5L A;  4JI5 L;  3FEW X;  4X62 Q;  2O5I C;  1PRT D;  2HUG A;  1DOK A;  2E2H H;  3HOX H;  4GKJ Q;  4LK1 C;  5EGT A;  4YWM A;  1FYC A;  1SMY D;  5JJK A;  1CKN B;  4JYA Q;  3JAM i;  4DV4 Q;  2WAQ B;  1Z6H A;  2IX1 A;  3OPO A;  4QF4 A;  2O2L D;  4A3I H;  1STA A;  3CCV A;  2E2I H;  3A55 A;  3N6R A;  1SDF A;  1Y1V H;  1S72 A;  2Z6B A;  1PFB A;  1HA5 A;  1D6E C;  4GNX C;  3BG3 A;  3GTO B;  5JOB A;  4X3K A;  4P2C B;  5GQO A;  1QUQ B;  3TP7 A;  1KLU D;  5C3E B;  1NY4 A;  1BOS A;  3IKJ A;  4IUP A;  2DY7 A;  4IJL A;  2Y0S B;  1DYQ A;  1D5X C;  1NUC A;  1BBW A;  3P75 A;  5D65 A;  2WKD A;  3MEH A;  1Q3L A;  2XGT A;  2JA5 B;  2K5W A;  4IPH A;  5BN3 A;  3Q24 A;  1B9N A;  1D5Z C;  3VA5 A;  3ICE A;  3KOJ A;  4RCN A;  1IYV A;  1RTN A;  1R4Q B;  3NEM A;  1LTS D;  3VYS A;  4A3F H;  1IL2 A;  1IHZ A;  1NE3 A;  1YNJ C;  4B3M Q;  1PXU A;  2NN6 I;  3SK8 A;  3KF6 B;  1WCM G;  3NQT A;  2F0M A;  2F0P A;  1JE4 A;  2J4X A;  1MJC A;  3J80 c;  4DKA C;  3O13 A;  2FMC A;  3P1H A;  3GO5 A;  5IYC G;  2JA9 A;  4OIJ A;  3B6Y A;  1II3 A;  1KIX A;  4U68 A;  2A74 C;  3NEL A;  1IW7 C;  4F8M A;  4IFD I;  3TME A;  1GUT A;  1HNW L;  1I94 Q;  4LF9 L;  1RD9 D;  4YCV A;  4A3K H;  2B3G A;  4CKE A;  1BBX C;  1AE2 A;  1QVG A;  1I4R A;  4GNX A;  1EFI D;  1H9S B;  3JAM c;  2E2J H;  3STB C;  4A4I A;  1VQI A;  4ABN A;  4DK0 A;  3J7A V;  3ULL A;  2KEN A;  3CD6 A;  2WAC A;  2ZM6 L;  4JBM A;  1GXD C;  4G7Z C;  3GTG B;  2YTV A;  2PYK A;  4P74 A;  2JXM B;  4BY1 H;  4C1N I;  2KCN A;  3CKI B;  4LJZ C;  2OT2 A;  3NXW A;  4HR7 B;  4BY7 G;  4LF6 L;  3E6Z X;  4ULL A;  1PA6 A;  5C5M A;  1VQ7 A;  4K0K Q;  5GRO A;  5LMN Q;  1UEA B;  3HG9 A;  4YHH L;  4JI7 Q;  3MFY A;  4HJ9 A;  3A74 A;  1TXY A;  1VDZ A;  4OL7 A;  1SE8 A;  1M90 C;  4X65 L;  3CCQ A;  2NVY H;  1WYD A;  2F0D A;  3QB3 A;  3QG1 A;  4IZ8 A;  3NBI A;  4G57 A;  1PH1 A;  1T5X D;  2D0P A;  5KNB A;  1YEZ A;  4QY7 A;  3K8A A;  1X55 A;  1DGS A;  4JOI C;  1G6Z A;  4PV1 C;  1KHI A;  3S1M H;  5M3F H;  5FKA C;  4XQN A;  1X3G A;  1QZG A;  2VB3 X;  3T4A C;  5BR8 L;  4OO1 H;  5EKI A;  1XYI A;  1VMC A;  1JCK B;  1EOT A;  1L2F A;  1K83 H;  1TR5 A;  2F0H A;  1QNU A;  1ESF A;  3MEF A;  4FYD A;  1OXT A;  3BZK A;  2OEO A;  2A6H D;  2ZXO A;  3T13 A;  3R2I A;  1V1Q A;  2EY1 A;  1WCM B;  3F2B A;  3RR5 A;  4L5S A;  3EFX D;  1J5E Q;  1SFO B;  4DR7 L;  2YV5 A;  4R4T A;  3H0G G;  5J22 A;  1ASZ A;  4DV7 Q;  3OWE B;  2JQO A;  5ISR A;  2UUA L;  3DUZ A;  4DR3 L;  1XNR L;  4NP5 A;  1E22 A;  3U4V A;  4LFB L;  4WJ4 A;  4X3S A;  2ZTC A;  1Q82 C;  4JI8 L;  4NXM L;  1N33 L;  4GOP A;  3T56 B;  1N34 L;  1DZ1 A;  2V4D A;  3L3O C;  4GN3 B;  2R92 H;  3CRK C;  1JB3 A;  2E75 C;  2K5V A;  1PH9 A;  5ELE A;  2K6A A;  1T5E A;  1LO5 D;  1STE A;  5C4J B;  1QWY A;  1VQM A;  3QO2 A;  4A3L H;  3DEP A;  1SYB A;  1SSO A;  1H9K A;  1KRT A;  2C5C A;  4TRD A;  3VDY A;  2QKI C;  2LFN A;  1L1O B;  5IYD H;  2HT1 A;  1KNA A;  2IY5 B;  1RF2 D;  1Q7Y C;  3HOV B;  4DXG A;  4JOI A;  1BBU A;  4BY7 B;  3BVM A;  1HUN A;  1LT5 D;  2F0T A;  5LMU Q;  3FPP A;  3ZJY C;  2A1A A;  2CHB D;  2DNC A;  1VQF A;  4CKB A;  2KHI A;  1BR9 A;  1HZ9 A;  2MNA A;  2Z8L A;  1VS0 A;  4J15 A;  5EPL A;  1HZA A;  1STG A;  4ALP A;  1JT8 A;  1HQM C;  2R7Z G;  2PW5 A;  3BYY B;  1J8I A;  1PRT C;  2N55 A;  1STB A;  4LW1 A;  4OXP A;  5AJ3 L;  3J81 E;  5HY6 A;  1LAC A;  2L12 A;  4X3T A;  3DXJ C;  4AYB E;  3GTQ B;  5JEA G;  4A3D H;  1SJE D;  4X66 Q;  2IX3 A;  3OHX C;  3DMU A;  3VR4 A;  3OWF A;  2F52 A;  1JE5 A;  2EY5 A;  1U4M A;  5I2Y A;  1V1P A;  1PH3 A;  4I65 A;  2M9V A;  3C3L A;  3TZU A;  2L11 A;  4RHR A;  2B8F A;  3I55 A;  2QGQ A;  3KBX A;  1DXM A;  2WIN B;  3C1E A;  5C4Z A;  3U9O A;  2EQS A;  2K04 A;  2QF7 A;  5C6A A;  3J81 j;  5IP7 G;  1K28 A;  4POG A;  3E0J A;  3H09 A;  1RDP D;  4BXX G;  3PO2 G;  2JSO A;  1PVO A;  3NHH A;  3E0E A;  2Q2U A;  2KHJ A;  1MSH A;  1KDC A;  3CRL C;  4P71 A;  2F0W A;  1I4Q A;  2B8G A;  3D4W A;  3CPW A;  1X9N A;  4CGY B;  5F2D A;  1MI2 A;  2A19 A;  3PO3 G;  2KVM A;  4C56 C;  1BO0 A;  4FF2 A;  2OQK A;  1PH4 A;  4QJF A;  2K32 A;  2JP1 A;  4A3M H;  3I70 A;  2B39 A;  4DNI A;  3R8B A;  1F9R A;  2UUB Q;  4Y7N B;  3GTP B;  4ZUJ A;  1MD2 D;  5KND A;  4X62 L;  4P73 A;  1EIY B;  1SE3 A;  3CP0 A;  2NVX B;  2RCF A;  2VUM G;  1IZ6 A;  4GKJ L;  4RKL A;  3SK5 A;  5EAY A;  4JVZ A;  2G9D A;  3L9A X;  3C2P A;  4DV0 L;  3SE0 A;  3M3Y H;  4JYA L;  4K5V A;  3J7A F;  4DV4 L;  3HOZ H;  4AYB G;  3FPU B;  3E5S A;  4TVA B;  1D7Q A;  3RZD H;  1SNO A;  4S3S A;  4A3E H;  4JI3 Q;  1D2B A;  1K0R A;  3OIQ A;  1IBL Q;  4IUV A;  5DAU A;  5M5W H;  2CVR A;  2JA8 H;  3S2D H;  3HKS A;  3RLO A;  3K81 C;  3M4O H;  2Q8I B;  5EKL A;  1PFM A;  2PZT A;  4KD4 A;  1GUS A;  1UNS A;  1C8C A;  3AYH B;  2RDG A;  1FR3 A;  4H7B A;  3HOU G;  4JI4 Q;  3G48 A;  3I56 A;  1LTT D;  2DGY A;  3V96 A;  4DR2 Q;  3I4M B;  1VQB A;  2F3W A;  1YJN A;  2YYZ A;  1UAP A;  1M8A A;  1KRS A;  2D9U A;  3UDG A;  1UE1 A;  1EZ8 A;  4NPS A;  5G3L F;  3PO2 B;  1VMP A;  3NPP A;  4IPG A;  3GTJ B;  1PZI D;  2KCM A;  1FJG Q;  3I4L A;  3RZO B;  3NK9 A;  4Y52 H;  3D6W A;  2DJG C;  1RL2 A;  2HCC A;  3HEJ A;  3PO3 B;  1LAB A;  2R93 B;  2NN6 H;  1H9R A;  3BS1 A;  4IO9 A;  5ELN A;  2E74 C;  2ZJP A;  4OWW B;  1YZ6 A;  5DLQ E;  4DK6 C;  5L37 A;  1U4R A;  1Q1E A;  1WTV A;  1AZP A;  1EQV A;  4DNT B;  3D8G A;  1OTC A;  1HJP A;  1B3A A;  1SYF A;  1Q1B A;  3F2U A;  1WFQ A;  3CF5 A;  1IKM A;  1PYS B;  4DV6 Q;  1HPC A;  3TP6 A;  4EVO A;  2ZTE A;  1Z9F A;  5E3F A;  1AZQ A;  2MQH A;  4IFD H;  2F0N A;  3HOY H;  4FF1 A;  3R3O A;  3I4N H;  2ID0 A;  1QCB D;  1HHV A;  3BYT B;  3PMF A;  5KYI A;  1YVC A;  5M3M H;  3PF4 A;  1GO3 E;  3GTM B;  2A6E C;  3TRE A;  1PTO B;  1CT1 D;  4A3G G;  3X3M A;  4EQO A;  3MZ5 A;  1ICW A;  4K0K L;  5LMN L;  4C3H G;  2XSC A;  4JI7 L;  1A62 A;  5CYU A;  1XMO Q;  4A75 A;  1RKN A;  3D3R A;  1ENA A;  3Q8D A;  3HOU B;  3H15 A;  2R3Z A;  4XIG S;  3DM1 A;  4PMC A;  3TS2 A;  1LM0 A;  4QGU A;  1G29 1;  1PH2 A;  1NMG A;  1TWF B;  5I4D A;  4XQQ A;  2ATW A;  1CQV A;  3KDF A;  2OCE A;  3S14 H;  4C3J H;  4N9T A;  4H13 C;  3M9B A;  1Y1W G;  1I4P A;  1ICF B;  4HN7 A;  1ZXT A;  2KOL A;  3GV3 A;  1M4V A;  3K58 A;  1C48 A;  1B9M A;  1J5E L;  2B63 G;  4DAY B;  1YJ9 A;  2YU9 B;  2EYM A;  2GN5 A;  2ASB A;  3AMU A;  2EJM A;  3BDL A;  2EYJ A;  4QCL A;  5E7N A;  4DV7 L;  2I07 B;  4RHS A;  2QA4 A;  1O80 A;  3HOW G;  2FMM A;  1ONL A;  3H3V I;  4ZRZ A;  4EQN A;  2B2U A;  3UDX A;  3TP8 A;  1TS5 A;  3I72 A;  3ZYY X;  1PH8 A;  4OWT B;  1HNX L;  2LMC B;  2OWO A;  2C35 B;  4G7H C;  4F7X A;  4BBR B;  2WII B;  3PV0 A;  3DEO A;  3M85 A;  1SNC A;  3GTO H;  3UDI A;  2CKZ B;  1A15 A;  4TQU S;  5C0X J;  2PPB C;  4HJ8 A;  4YY3 Q;  1I5F A;  1QG7 A;  4GKK Q;  4PMB A;  3T1Y Q;  4R1J A;  4EGV A;  2RHQ B;  5C3E H;  4MTN A;  3BZD B;  2EXD A;  3OSO A;  2F4V L;  1TVX A;  1VQP A;  2HD3 A;  2Z0S A;  4RH6 A;  4EQ5 A;  3S1R B;  4RAU C;  2C9O A;  3MA2 B;  2PQA A;  1R9T B;  4UP7 A;  3NTI A;  3V2T A;  1SE2 A;  1VQK A;  4R9W A;  3TZD A;  2JA5 H;  4A3G B;  1VQG A;  4YWK A;  3L0O A;  4R8I A;  1ENF A;  3NWT A;  4H44 C;  1YIT A;  1UEB A;  5LMU L;  5ELC A;  1STH A;  2EY2 A;  1D1I A;  4KKT A;  1HZC A;  1ROD A;  4CDF C;  1XMQ Q;  3R2T A;  4DR4 Q;  4WRD A;  3G71 A;  2B2W C;  4TKO B;  1VQH A;  1EYA A;  2EYO A;  4AH6 A;  3UE0 A;  1TQO A;  1JR0 D;  2ZTD A;  5FJ8 H;  5IT9 L;  1OXX K;  1QIL A;  4A3J G;  2EY6 A;  3SK4 A;  1JJ2 A;  4KKU A;  3TEH B;  3HRZ C;  3A7L A;  4C3I G;  2RQX A;  4DK3 C;  4JI0 Q;  1Y1W B;  4DR6 Q;  1G51 A;  5M5Y B;  1KDA A;  1K3B C;  2F0K A;  4CBV A;  2KED A;  4WOR A;  3S15 B;  3IRB A;  2B63 B;  1PMR A;  3QR8 A;  3RN2 A;  3D31 A;  3DWQ A;  3CCM A;  4J1M A;  1YBY A;  1CHP D;  3I90 A;  4B9X A;  4WJW A;  1G2S A;  1VCI A;  4JBK A;  2CH4 W;  1CM9 A;  1F9Q A;  3GTG H;  3FVQ A;  3HOW B;  4O0A A;  2AUJ D;  3FRP B;  3CQZ B;  1O78 A;  2XWB B;  4NKL A;  4DV5 Q;  5IGB A;  3PSI A;  4RWS C;  3S1Q B;  3MXU A;  3Q22 A;  2WV6 D;  4JK1 C;  4JI2 Q;  1HR0 W;  2QCP X;  4GNX B;  3I73 A;  1H9M A;  1L0Y B;  2PNH A;  5ELO A;  3I91 A;  4OX9 L;  2E2D C;  4NW2 A;  1YHB A;  1KTK A;  4N8F A;  2Z1C A;  2B2W A;  2ZXR A;  3HKZ B;  1DCZ A;  1SLJ A;  3MXN A;  1V1O A;  4A3B G;  1ZEQ X;  2CW0 D;  3R93 A;  4IFD J;  1LTL A;  4MHE A;  4DAV A;  4C2M B;  5FLM G;  3VR2 A;  5GAE C;  5IYB G;  1EWH A;  3VR3 A;  1Q46 A;  4BBS G;  1WCM H;  1ET6 A;  4DK1 A;  3UI2 A;  2FXQ A;  1GOZ A;  1L0W A;  5FLX c;  5JJL A;  1EYG A;  1SFO H;  1N9W A;  3VYT A;  4IOA A;  1VQC A;  4A3J B;  1GVP A;  3C1F A;  4JI3 L;  4X64 Q;  1GUG A;  1IBL L;  1XPU A;  2NZO A;  5JPN C;  2LS0 1;  1MBY A;  2VB2 X;  3T1H Q;  4OIK A;  1KDB A;  1B53 A;  4RGN A;  2BH2 A;  3JAM L;  1NNX A;  2KEE A;  1MJE A;  1Q8I A;  2FHT A;  5C4J H;  3TN2 A;  2VQE L;  2PZW A;  4JI1 Q;  2UUC Q;  3ND9 A;  4A93 G;  3K0Y A;  2ZJR A;  1AE3 A;  4DR2 L;  3KJP A;  4PZ8 A;  1XNQ Q;  2Q2H A;  4K14 A;  1CA6 A;  1K3R A;  4GOP B;  1ILQ A;  4CDD C;  1I3Q B;  3CCU A;  3HOV H;  2EYL A;  3AFQ A;  4KI0 A;  1IBK L;  4BY7 H;  2LXK A;  1C0A A;  2RSO A;  1FJG L;  1IL8 A;  2E76 C;  5I6W A;  1QZH A;  3KYH C;  4A3F G;  3ERS X;  3K80 C;  3K7A B;  3CC2 A;  4TSS A;  3E3X A;  4F88 A;  4LF8 L;  4QL5 A;  4HIO A;  4UHV A;  1M1K C;  1B2T A;  2NZH A;  1A3V A;  4GOP C;  5CR3 A;  4M1U B;  5LL6 S;  1A0I A;  1A6X A;  4DF7 A;  1J9O A;  4E6I A;  4A3B B;  3GTQ H;  3K5N A;  1CKN A;  2KEC A;  2KA7 A;  4I7A A;  5JJZ A;  3L2P A;  4QQB X;  1KAB A;  2K75 A;  4DV6 L;  2RVL A;  3EJI A;  1SJH D;  4BBS B;  3AB9 A;  2QEX A;  1HXY D;  1QOH A;  4DAM A;  1AEX A;  1F77 A;  2HDM A;  5LHY 1;  1VQJ A;  2BA0 A;  2SEB D;  3M4Q A;  1F2Z A;  1SEB D;  2VL6 A;  2ZXP A;  4MZ9 A;  1E2W A;  4CJ0 B;  2RCN A;  1F2Y A;  4WFN 3;  1G91 A;  4BY1 G;  4DUZ Q;  1DD2 A;  1JMC A;  1V1P B;  2NTT A;  3OW7 A;  4LAA A;  1KL9 A;  3UDF A;  2P5Z X;  1PRT F;  4DR5 Q;  1ZKO A;  4KY7 A;  3H94 A;  4ZQ3 A;  4A93 B;  1ET9 A;  2X69 A;  4AIM A;  1HUM A;  5EBC A;  3SEB A;  1AH9 A;  1JWS D;  2K14 A;  3WOF A;  4R4I A;  1HFG A;  1D1K A;  1EQT A;  1SYE A;  4B3S Q;  4OO1 G;  2O5J C;  4Y7N H;  2F0I A;  1Q8K A;  3GTP H;  3KF8 A;  4XTC S;  1JC7 A;  2A6E D;  3QIA A;  5EQ0 A;  1I4X A;  4CDE C;  1TY2 A;  2NVX H;  2R7D A;  1JIC A;  1VQD A;  3Q0A A;  2X6G A;  3BVZ A;  2MJ8 A;  3OYY A;  1PRT B;  5ELD A;  4FF4 A;  3S2H B;  5CV5 A;  3OMG A;  2Q8T A;  1HTL D;  1T9H A;  2G5D A;  1HFN A;  3FDT A;  5JEA H;  4O42 A;  4H0L C;  1SYD A;  1V9P A;  1VQO A;  2BCO A;  2GVB A;  4JC0 A;  4MIU A;  1MIU A;  3OMC A;  4Z9C B;  5FO7 B;  1RJT A;  3H3V H;  2RDH A;  2R92 G;  4YY3 L;  1QB5 D;  4GKK L;  4JG2 A;  1BDO A;  3U4Z A;  3T1Y L;  1W6K A;  2K1B A;  4JV5 Q;  4JBW A;  4A3L G;  3NWS A;  1EY9 A;  2JA7 G;  2HIV A;  5IP7 H;  3I4M H;  1VQ4 A;  2ENB A;  2K52 A;  1TWG B;  4BXX H;  1NR4 A;  1QNK A;  4IJH A;  4HIM A;  3PO2 H;  5GAH C;  4JI6 Q;  4GZY C;  3GTJ H;  2MUY A;  2DUD A;  1XMQ L;  2VXW A;  3H0G B;  2CW0 C;  1B3Q A;  1CKM A;  3RZO H;  4LWC A;  2K5D A;  3BZC A;  1D8L A;  2XNA C;  3RNU A;  1C7Y A;  3J81 i;  2PW7 A;  3PO3 H;  2NB0 A;  4DV3 Q;  2R93 H;  4KY6 A;  4XDX A;  3KK7 A;  2AQ3 B;  2EIF A;  1G8Z D;  4K6L A;  5DNF A;  1U4P A;  4JI0 L;  3PIO 3;  2K5H A;  4DR6 L;  2K5N A;  4L5R C;  4A3D G;  2N88 A;  3FHW A;  1B1Z A;  3K57 A;  1QE6 A;  3A5U A;  2IJ0 A;  1X65 A;  3J7A 5;  2N78 A;  2AWN A;  2KQ3 A;  3RD4 A;  3DLL A;  4IOC A;  4LF5 Q;  1DM0 B;  1JWM D;  1L0X B;  4RGT A;  1BCP D;  1FL0 A;  1SXT A;  4BS9 A;  2RHS B;  2F0O A;  2K05 A;  3TRZ A;  3PGZ A;  1WTR A;  2EYF A;  2JEA I;  3T51 B;  1VQE A;  3GTM H;  3CMA A;  3W3A A;  1L1O A;  2NVT B;  4DV5 L;  1PTO H;  1E1O A;  1Q12 A;  5IP9 G;  1O7I A;  4RKB A;  4JI2 L;  4K8I A;  1YHA A;  5K36 G;  1EIF A;  1TS3 A;  5CMD A;  3NBH A;  4IUT A;  4ZLT F;  2R7Z B;  3TSS A;  2RKS A;  4IUR A;  1DOL A;  2UXB Q;  2RA4 A;  5C44 G;  2BE5 C;  4UP8 A;  3HOU H;  2TSS A;  2JA7 B;  1B8A A;  5M5X B;  1BUV T;  1PFN A;  5JPM C;  1LT6 D;  1B70 B;  5C0X G;  5BN4 A;  4Q0F A;  4FO2 A;  2KHS A;  1D5M C;  1LTG D;  1TWF H;  4A3M G;  4LNQ A;  1W6J A;  1NAP A;  2Q8R E;  1PZK D;  2B2V C;  1WTO A;  4KTA A;  3M4Y A;  3K59 A;  1Y69 U;  3LX0 A;  3A5Z B;  1DJR D;  4POF A;  3WOE A;  3J81 c;  5KRU A;  1RIP A;  4FXD A;  1F9P A;  3K5M A;  4KHP Q;  2YU9 H;  1LTA D;  1SNQ A;  5M9O A;  1X3Q A;  2XRQ D;  3KJO A;  4ZKB B;  3LWE A;  4KHV A;  3KLS X;  3F1Z A;  3KDF B;  4X64 L;  4DPG A;  1EY7 A;  4XQJ A;  1K8A C;  3HOZ G;  3TQY A;  2CFM A;  4B3M L;  1CSQ A;  1N8R C;  1DOM A;  2KUM A;  1Z7T A;  4BBR H;  5DEH A;  1GKH A;  1SR3 A;  2JA8 G;  1E2V A;  4JCV E;  1BNZ A;  2AWO A;  1PTO F;  1HNW Q;  5D3I B;  4JI1 L;  3CAM A;  1X56 A;  2DJF C;  2UUC L;  1KQS A;  1PYB A;  1V8Q A;  3K5O A;  3I7F A;  3UE1 A;  2RF4 A;  4FDB A;  5CC4 A;  3ITP A;  4HCE A;  2FIN B;  1XNQ L;  2ZT9 C;  3HGB A;  2A73 B;  1XTD A;  2NTS A;  2HDL A;  3S1R H;  3FMC A;  1EFW A;  4FF3 A;  1I94 L;  2YTY A;  4DR1 Q;  4KN7 C;  1R9T H;  1S5D D;  4HCS A;  1N32 Q;  1SYC A;  1TWA B;  2L1B A;  3H91 A;  3MWY W;  5H1S E;  1VQL A;  4DV1 Q;  4A3G H;  3DM3 A;  4GS3 A;  1Q81 C;  1A3T A;  2CWP A;  2VUM B;  2B2V A;  3ND8 A;  5FO8 B;  1EY0 A;  2WFW A;  3KLW A;  1SN8 A;  4CJ2 C;  5IGC A;  2EVB A;  1RHP A;  4AYB B;  2B2U C;  4A76 A;  3HFZ B;  5C44 B;  2LKV A;  4UPA A;  4N8X 1;  1FGB D;  3GV6 A;  4QUC A;  4X65 Q;  5KYL A;  4KK7 A;  1O7Z A;  5CV7 A;  3GTK B;  3CCS A;  1BQQ T;  2F0E A;  1Y1W H;  1HR0 Q;  2EJG C;  2OXP A;  3RMH A;  4PG3 A;  3BDC A;  4DNR B;  5M5Y H;  2AQ1 B;  2SNS A;  3MC0 B;  1KD1 C;  2VZA A;  1EY4 A;  1PH5 A;  2N8N A;  4HJ7 A;  3S16 B;  1X3F A;  4KD3 A;  5ELF A;  3BJU A;  3S15 H;  2B63 H;  2QDL A;  5TSS A;  3AFP A;  2HHH Q;  3K5L A;  1QVC A;  3HS0 C;  4IFD G;  1FGU A;  2A68 C;  4G4K A;  2OQ0 A;  1TWH B;  1GUO A;  4B3T Q;  3BU2 A;  2I5M X;  3I4N G;  4DR7 Q;  3D0F A;  3HOW H;  1E24 A;  1PV4 A;  4K2L A;  2B2T C;  1I4H A;  2UUA Q;  3G7L A;  4CKC A;  4NB3 A;  4DUZ L;  3CQZ H;  1U5K A;  3S9W A;  2OTL A;  1S4Z A;  2F0V A;  3OTO Q;  5IT9 E;  4IPC A;  2OTJ A;  1N33 Q;  3S1Q H;  2WB1 E;  4A3C H;  3CME A;  2H4O A;  2KBN A;  3RUZ A;  1SBB B;  3CW2 C;  3Q23 A;  4DR5 L;  4GN5 A;  1KC8 C;  3LGJ A;  2IT1 A;  4XYO A;  1NTG A;  5IWA Q;  5IIF A;  5EKK A;  2L0C A;  4ZK9 B;  4ZUI A;  3U50 C;  3ONA B;  1MGS A;  1KAA A;  3SXH A;  3VA7 A;  5KIX A;  4B3S L;  4DGZ A;  1JB7 A;  4OEL B;  5IOD A;  2A5H A;  2VS1 A;  1CZG A;  1XXG A;  5I9O A;  4UP9 A;  3I2Z A;  4P72 A;  4C2M H;  3LWU A;  5IE8 A;  2ICI A;  2NVQ B;  1LTI D;  4ID6 A;  2QEJ C;  4KV6 A;  2MPM A;  1MSG A;  1XWE A;  4ZKC B;  3MXN B;  4KHZ A;  1PFS A;  4PZ6 A;  3PIP 3;  3DWA A;  4DFA A;  2EE1 A;  4A3J H;  1DON A;  3DWP A;  3Q6S A;  2JA6 G;  2BOS A;  1TII D;  2F0Q A;  1BCP C;  4C3H B;  2WAQ G;  1NSN S;  3KLS A;  4KJO A;  3A7A B;  2B2T A;  4RMF A;  4FXG C;  3IFD A;  1Q86 C;  4PNY A;  3C46 A;  2F0S A;  5C4X G;  3A8K E;  5JAV A;  1EOV A;  4JV5 L;  1FVI A;  1KXL A;  2JN4 A;  1NBW A;  4DAP A;  1SE4 A;  3SK6 A;  3IL8 A;  3L7Z C;  5D3D A;  1CA5 A;  1WTH A;  3EA6 A;  3NSW A;  1P16 A;  4X66 L;  1GHJ A;  3PF5 A;  4ME3 A;  4DXF A;  4H02 A;  2IW3 A;  2XTI A;  4R4Q A;  4LFA Q;  1Y8P B;  1I3Q H;  1ASY A;  5IGF A;  2WB1 G;  5KNC A;  2VQF Q;  4K8J A;  4JI6 L;  4CHT B;  1K9M C;  3A8J E;  1EQR A;  1EIH A;  2BDO A;  1K8G A;  3S17 B;  5C0X I;  3K7A H;  1VF5 C;  4QUF A;  2KCC A;  1HTP A;  4PMW A;  3ULJ A;  4DUY Q;  1CUK A;  3PIP A;  5A35 A;  2XVS A;  3GD7 A;  3JAM E;  5FJ8 G;  1S40 A;  5IGD A;  1KAW A;  4A3B H;  3PUW A;  4ZCK A;  1TU2 B;  5IY0 A;  3MTS A;  1ENC A;  2QIL A;  3G6J B;  5EJW A;  2F3I A;  2K01 A;  1XX8 A;  5KEE A;  2BDN A;  5FOB B;  3IFT A;  2IL8 A;  5FLM H;  1IBM Q;  3TS0 A;  5IYB H;  1EIG A;  4LF4 Q;  2Z9H A;  5FLX L;  4LF5 L;  1G6P A;  1EU4 A;  4BBS H;  2QW7 A;  1BXT A;  3EIV A;  4LUV A;  1YHQ A;  1NJI C;  3FKI G;  1NCV A;  5A2Q L;  4DA2 A;  1EQQ A;  2UXD Q;  1XJV A;  2UUB L;  1C9O A;  3U58 A;  1K0S A;  4DV0 Q;  4YCW A;  2JA6 B;  1LYL A;  2IHF A;  4IN3 A;  4YIJ A;  2VNU D;  3KFU A;  3SHL A;  1PHJ A;  3TBI B;  2F4I A;  5KGU A;  4KMU C;  1JJG A;  3MHB A;  1Y14 B;  2V1C C;  1WJJ A;  1X6O A;  2IHE A;  1PLF A;  1ZYR D;  1AW7 A;  1XTC D;  4YCU A;  1RTO A;  3J80 L;  5I9P A;  3GTL B;  5C4X B;  2E8G A;  1WD0 A;  3T16 A;  5HUR A;  3HOX G;  2N49 A;  3HP3 A;  1ESR A;  4L63 B;  3EQL C;  4QIW E;  2UXB L;  1N36 Q;  1UUP A;  5IYC H;  2CCZ A;  4A93 H;  2PZU A;  4HSV A;  1FNW A;  4C3I B;  1OO9 B;  4A3I G;  1STN A;  3I3C A;  1IKL A;  2Z4I A;  1I4G A;  3E9I A;  1Y1V G;  1X3E A;  4HJA A;  3ULP A;  1U9R A;  3EN2 A;  2WB1 B;  3CXC A;  5T1I A;  2PQE A;  4APV A;  1SAP A;  3QOJ A;  4JI4 L;  4K5X A;  5EBD A;  1TWC B;  3GQB A;  4FVM A;  1WTX A;  4KHP L;  1MHW C;  1SRO A;  2MFI A;  4KKS A;  4O1N A;  3AQQ A;  1OXS C;  3N52 A;  1WOC A;  2UXC Q;  2A69 C;  1I50 B;  2CWA A;  3IAY A;  3AEV A;  3S2H H;  1UE6 A;  1BVS A;  2L55 A;  4LF7 Q;  2BE5 D;  2F0F A;  5CBA E;  5IGG A;  3KF8 B;  3PCO B;  5NUC A;  3M4P A;  1VF7 A;  3ER0 A;  4HMI A;  1OXU A;  4MTK A;  5E4X A;  5EPJ A;  1TS2 A;  4RFB A;  2XWJ B;  1I6V C;  1I6H B;  1EEF D;  4OWX B;  3J7Y W;  1A2U A;  3FKI B;  4Q5V A;  3FP9 A;  4C1N K;  4L6T B;  1EEI D;  4DR1 L;  2K5Q A;  2JE6 I;  3BDO A;  1N32 L;  1SNP A;  2DNE A;  1YI2 A;  2UU9 Q;  1GUN A;  3S1N B;  5IOC A;  1TWG H;  4DV1 L;  3OW2 A;  2DY8 A;  1YNN D;  3HOV G;  2PI2 A;  1LV9 A;  4A3K G;  1GJX A;  2K03 A;  1RCV D;  2O4X A;  2E2H B;  2GA4 B;  2PNR C;  3HOX B;  1VQ6 A;  3T53 B;  2Z4H A;  3H0G H;  5CV6 A;  1AN8 A;  1QUQ A;  2L9H A;  5AFW A;  4KLK A;  2GVA A;  2L5T A;  1VQN A;  5K5P A;  3ERO A;  1JWU D;  2FJ2 A;  2E5L Q;  3M7G A;  2EYP A;  5CBE E;  4A3I B;  5CV9 A;  3E9H A;  3W5O A;  2E2I B;  1A2T A;  2IPK D;  2EPB A;  1Y1V B;  4HJ5 A;  1HR0 L;  4GN4 B;  1XMO L;  3KLR A;  4R4O A;  3TDQ A;  3QOL A;  1EUJ A;  4JBJ A;  1BF4 A;  2JK8 A;  2XRS D;  1HCZ A;  1SND A;  1HH2 P;  5J3B A;  3KF6 A;  3NP8 A;  2IWH A;  2HHH L;  2EDG A;  2H1E A;  1JQY D;  2NUC A;  5ELB A;  5M3F G;  1X54 A;  4B3T L;  1EZ6 A;  1K73 C;  3D4R A;  2F3V A;  2MO1 A;  1CI3 M;  3PUY A;  2NVT H;  1E7Z A;  3NE5 B;  1NMF A;  4A3F B;  4HID A;  3OTO L;  1SNM A;  1GM5 A;  3CC4 A;  1F9S A;  1HNX Q;  4AQY Q;  2SNM A;  2IX0 A;  4HED A;  4XT1 B;  2R7Z H;  4K5W A;  1WTP A;  1Z47 A;  3CCR A;  4B3R Q;  1YNX A;  1H9S A;  5IWA L;  1B50 A;  2PMZ E;  3PUV A;  2Q2T A;  4P75 A;  3W2D A;  1SYG A;  1LTR D;  2JA7 H;  4NXN Q;  3CCL A;  5M5X H;  3KUP A;  4UDU C;  2F4V Q;  5G3L D;  2K7V A;  1TS4 A;  4B9W A;  1X32 A;  2A68 D;  4V0B A;  1CK1 A;  4A3K B;  2QDB A;  1HNZ Q;  3NBH B;  4GLA C;  1VQ8 A;  3HZX A;  5CV8 A;  4BA2 I;  5E4W C;  2EZV A;  4QIW B;  4DN4 M;  1EWI A;  2E2J B;  1JOR A;  3J7Z C;  2FFK B;  2I5L X;  2LSS A;  4DV2 Q;  1S5B D;  2ICE C;  5IYD G;  1PTO D;  1TY0 A;  1CTM A;  1L1O C;  4LFC Q;  4NMZ A;  2AKW B;  4G7O C;  5E1F A;  4BWG B;  3W1G A;  4BY1 B;  4FXK C;  3SGI A;  1VQA A;  2F0U A;  5FK9 C;  3VYR A;  4CDC C;  1IXR A;  3RLF A;  1HZB A;  2A8V A;  4DR4 L;  1SMY C;  3I8Z A;  1JOO A;  5EPK A;  2K4K A;  2NVY B;  1S5E D;  1CHQ D;  5C3W A;  4HTH A;  1ZYR C;  2AMC B;  5HGQ A;  5I2X A;  1FNU A;  1SMX A;  4KJN A;  4OEM B;  3S1M B;  5M3F B;  4EQP A;  3MAQ A;  3PQI A;  4ME5 A;  2MGS A;  2MHV A;  2M2L A;  4LFA L;  1K83 B;  1TT2 A;  3EBE A;  3I4M G;  5LL6 X;  5J39 A;  1UE5 A;  2F0L A;  1TWA H;  2VQF L;  4L8J A;  5IP9 H;  3F8T A;  2YTX A;  2VUM H;  1EY8 A;  4JI5 Q;  5LMN W;  5K36 H;  3A56 A;  5IGE A;  2ZJQ A;  2R7F A;  3PUX A;  4MN3 A;  1CZW A;  5J1Z A;  1AP0 A;  5D14 A;  1U0L A;  4DUY L;  1LT3 D;  2R6G A;  3U9S A;  1PZJ D;  5DM6 3;  4HIK A;  5C44 H;  3KBG A;  4OHJ A;  4OX9 Q;  1UE7 A;  1QJO A;  5JVG 3;  1C4Q A;  2K50 A;  4J8Q A;  2R93 G;  1R4P B;  1S3O A;  5C0X H;  4LUO A;  1YIJ A;  1STY A;  1GD7 A;  3SVM A;  4ZAI A;  3CPF A;  4IQZ A;  4QMG A;  2R92 B;  4RGO S;  4HSP A;  3GTK H;  3MXP A;  3GP7 A;  2R61 A;  1WVL A;  1E2Z A;  1H95 A;  3J81 L;  2SOB A;  2HCI A;  4ZYS A;  2D62 A;  5JJI A;  4FP5 D;  2BH8 A;  5GAG C;  2SDF A;  1S5C D;  4MNO A;  3X3N A;  2HQL A;  2OF1 A;  3WWV A;  1IBM L;  4LF4 L;  1A8V A;  3CC7 A;  3EVQ A;  3S16 H;  1FD7 D;  4OGQ C;  3D4D A;  1H9J A;  2EOT A;  2UXD L;  3PIO A;  4K2K A;  1VQ9 A;  1LLR D;  2MP1 A;  1CFM A;  1EY5 A;  4IUU A;  3TP5 A;  1TWH H;  3P7J A;  4CJ1 B;  2K28 A;  5HGT A;  2CH4 A;  4XXE A;  1QVF A;  2TMP A;  1EL0 A;  1WI5 A;  1EU3 A;  4B08 A;  1HA6 A;  3S24 A;  1YNN C;  3A54 A;  1N36 L;  3K0X A;  2NWG A;  1BKB A;  3OIP A;  3MVV A;  1W2B A;  2NYZ D;  1K8O A;  4A3E G;  4OON A;  2VQE Q;  3JC6 6;  2WKC A;  4IUN A;  4FNF A;  4K6D A;  2JEB I;  1JOQ A;  3GDE A;  5CV4 A;  1JJC B;  3T1H L;  4A3D B;  4R4C A;  4X6A H;  2Z6K C;  4O2D A;  4IAL A;  1KLG D;  1EYD A;  3H3V C;  4LF9 Q;  3H6M A;  2JJQ A;  1Y8O B;  5C3X A;  4XT3 B;  3SDZ A;  2XIW A;  3CCE A;  1PYW D;  1PH6 A;  1IBK Q;  2EYH A;  4ODG A;  4NDX A;  3NTK A;  1X3P A;  4EX5 A;  2PMZ B;  2J7Z A;  1JOK A;  2NVQ H;  2UXC L;  2ZM6 Q;  4IUQ A;  1HRJ A;  5T1G A;  4LF8 Q;  2ALY B;  2A6H C;  5BN5 A;  5COY A;  4LF7 L;  1UWV A;  4PQX A;  3VYU A;  4GLX A;  4C3H H;  1FNV A;  2XN9 C;  2DN8 A;  2KJX A;  4LF6 Q;  2EJF C;  2EXZ A;  1CSP A;  1P8L A;  4WJ3 M;  3QWN A;  1J6Q A;  1WTW A;  4YHH Q;  4BBR G;  2CQO A;  1NR2 A;  3V05 A;  5JEA J;  1EY6 A;  2PQA B;  4BA1 I;  4OO1 I;  4F87 A;  4LUZ A;  1SRU A;  2NN6 G;  3W1B A;  1S5F D;  4R8N A;  5COR A;  2VY3 A;  4A3M B;  3PUZ A;  1IYU A;  4X3U A;  3F2D A;  3G6E A;  1WD1 A;  1TKW B;  1YNJ D;  1A3U A;  1GHK A;  2WAQ E;  1AFP A;  2UU9 L;  5BR8 Q;  4PZ7 A;  2B2Y C;  2F0J A;  2A69 D;  3HKZ E;  2Z6K A;  2PI2 E;  2L15 A;  5C4H A;  2D2C C;  4QB4 A;  2RDF A;  2LY7 A;  3VR6 A;  2HQE A;  3CU7 A;  3SR1 A;  1B44 D;  3HOY G;  2F1M A;  4L5T A;  4XYQ A;  3G4S A;  3S17 H;  3M3Y B;  2X6L A;  2NZ1 D;  3HOZ B;  1LUZ A;  1IW7 D;  2B29 A;  3RZD B;  5M3M G;  1BCP F;  2E5L L;  2Q2I A;  4KN4 C;  4A3E B;  4DR3 Q;  2Y0S E;  4RGM A;  1XNR Q;  3F2C A;  1EWC A;  2BA1 A;  3NEN A;  4LFB Q;  1PTO C;  3NUC A;  5M5W B;  4JI8 Q;  3D6C A;  4NXM Q;  3LNN A;  4U67 3;  2JA8 B;  3S2D B;  4UY8 C;  3P20 A;  4YWL A;  1N34 Q;  5JVH 3;  1A63 A;  1GUW A;  3ERQ A;  3STB D;  3M4O B;  3WDN A;  4DU9 A;  5GAD C;  1U4L A;  1B4O A;  1K8M A;  4RG1 A;  1KNE A;  4RCO A;  1G2T A;  3A8I E;  2AUK A;  1MKH A;  2I5H A;  4I7Z C;  2F0G A;  1CQF A;  3AU7 A;  3K7U C;  2ES2 A;  2G9H D;  4C3J G;  2JA6 H;  1VQ5 A;  1BCP B;  3K6O A;  3MXG A;  4IPD A;  3NQI A;  1F2L A;  2JYO A;  2B2Y A;  1EYC A;  1WTQ A;  1B7Y B;  4AQY L;  1PDQ A;  3URY A;  2F03 A;  3DHQ A;  3GTL H;  5C4X H;  2RSN A;  2I46 A;  4A3C G;  4B3R L;  4L5Q A;  4M8A A;  2HIX A;  3CCJ A;  2NBF A;  3MFG A;  5AJ3 Q;  1IYJ B;  4NXN L;  4C3I H;  2VW9 A;  2J0T D;  5FLX E;  2L4N A;  3HKZ G;  4LMQ D;  1HNZ L;  5A2Q E;  4JW0 A;  1Q90 A;  1W3S A;  4HAE A;  3I4O A;  3OOC A;  5CGK A;  1ILP A;  3A0J A;  2WP8 J;  2N3S A;  4V19 0;  3HOY B;  4DV2 L;  1TWC H;  5C3E G;  1YJW A;  4GLV B;  4J6H A;  2AQ2 B;  4LFC L;  3RLN A;  3I4N B;  2Y0S G;  5M3M B;  2KCT A;  3J80 E;  1HQR D;  1E0B A;  1I50 H;  2CQA A;  2MO0 A;  3CHB D;  2D5D A;  2JA5 G;  4UAI A;  3NTH A;  1O7Y A;  2I0Q A;  1V43 A;  4JPB W;  1Y8N B;  4KY5 A;  2D0O A;  3BVG A;  1E1T A;  1ML0 D;  4N9P A;  4RA8 A;  1F2M A;  5DM7 3;  2AHO B;  2RBM A;  4HMJ A;  4DV3 L;  2PCF B; 
#chains in the Genus database with same CATH homology
 2PO4 A;  1LTB D;  4DAY A;  2K33 A;  1OXV A;  4ILW A;  3VR5 A;  1O7L A;  3QJY A;  2M00 A;  5I6Y A;  3S14 B;  4C3J B;  1LT4 D;  5FO9 B;  3M7N A;  5C5L A;  3FEW X;  2O5I C;  1PRT D;  2HUG A;  1DOK A;  4LK1 C;  5EGT A;  1FYC A;  1SMY D;  2WAQ B;  1Z6H A;  2IX1 A;  3OPO A;  4QF4 A;  2O2L D;  1STA A;  3A55 A;  3N6R A;  1SDF A;  1PFB A;  1HA5 A;  1D6E C;  3GTO B;  3BG3 A;  5JOB A;  4X3K A;  4P2C B;  3TP7 A;  1KLU D;  5C3E B;  1BOS A;  3IKJ A;  4IUP A;  2DY7 A;  2Y0S B;  1DYQ A;  1D5X C;  1NUC A;  3P75 A;  5D65 A;  2WKD A;  3MEH A;  1Q3L A;  2JA5 B;  2K5W A;  5BN3 A;  3Q24 A;  1B9N A;  1D5Z C;  3VA5 A;  1IYV A;  4RCN A;  1RTN A;  1R4Q B;  1LTS D;  3VYS A;  1IHZ A;  1YNJ C;  1PXU A;  2NN6 I;  3SK8 A;  2F0M A;  3NQT A;  2F0P A;  1JE4 A;  2J4X A;  3O13 A;  2FMC A;  3P1H A;  3GO5 A;  4OIJ A;  1II3 A;  4U68 A;  2A74 C;  4F8M A;  1IW7 C;  4IFD I;  3TME A;  1GUT A;  1RD9 D;  4CKE A;  1BBX C;  1I4R A;  1EFI D;  1H9S B;  4ABN A;  4DK0 A;  3J7A V;  2WAC A;  1GXD C;  4G7Z C;  3GTG B;  2PYK A;  2JXM B;  4C1N I;  2KCN A;  3CKI B;  4LJZ C;  2OT2 A;  3NXW A;  4HR7 B;  3E6Z X;  4ULL A;  5C5M A;  1UEA B;  3HG9 A;  3MFY A;  1VDZ A;  4OL7 A;  2F0D A;  3QB3 A;  3QG1 A;  4IZ8 A;  3NBI A;  4G57 A;  1T5X D;  5KNB A;  1G6Z A;  4PV1 C;  5FKA C;  4XQN A;  2VB3 X;  3T4A C;  4OO1 H;  5EKI A;  1XYI A;  1VMC A;  1JCK B;  1EOT A;  1TR5 A;  2F0H A;  1QNU A;  1ESF A;  4FYD A;  1OXT A;  2OEO A;  2A6H D;  2ZXO A;  3T13 A;  3R2I A;  2EY1 A;  1WCM B;  3EFX D;  1SFO B;  5J22 A;  3OWE B;  5ISR A;  3DUZ A;  4NP5 A;  4X3S A;  3T56 B;  1DZ1 A;  2V4D A;  3L3O C;  3CRK C;  1JB3 A;  2E75 C;  5ELE A;  2K6A A;  1T5E A;  1LO5 D;  1STE A;  5C4J B;  1QWY A;  3QO2 A;  3DEP A;  1SYB A;  1SSO A;  1H9K A;  2C5C A;  4TRD A;  2QKI C;  2LFN A;  1KNA A;  1RF2 D;  3HOV B;  4DXG A;  4BY7 B;  3BVM A;  1HUN A;  1LT5 D;  2F0T A;  3FPP A;  2CHB D;  2DNC A;  4CKB A;  1BR9 A;  2Z8L A;  5EPL A;  1STG A;  1HQM C;  2PW5 A;  3BYY B;  1J8I A;  1PRT C;  2N55 A;  1STB A;  3J81 E;  1LAC A;  2L12 A;  4X3T A;  3DXJ C;  3GTQ B;  5JEA G;  1SJE D;  2IX3 A;  3OHX C;  3DMU A;  3VR4 A;  3OWF A;  2EY5 A;  1U4M A;  5I2Y A;  1V1P A;  4I65 A;  2M9V A;  3C3L A;  3TZU A;  2L11 A;  4RHR A;  2B8F A;  3KBX A;  1DXM A;  2WIN B;  3C1E A;  5C4Z A;  3U9O A;  2K04 A;  2QF7 A;  5C6A A;  3E0J A;  3H09 A;  1RDP D;  2JSO A;  3NHH A;  1MSH A;  1KDC A;  3CRL C;  2F0W A;  1I4Q A;  2B8G A;  3D4W A;  4CGY B;  5F2D A;  1MI2 A;  2KVM A;  4C56 C;  1BO0 A;  4FF2 A;  2K32 A;  2JP1 A;  3I70 A;  2B39 A;  3R8B A;  1F9R A;  4Y7N B;  3GTP B;  4ZUJ A;  1MD2 D;  5KND A;  1SE3 A;  2NVX B;  4RKL A;  3SK5 A;  2G9D A;  3L9A X;  3C2P A;  3SE0 A;  4K5V A;  3J7A F;  3FPU B;  3E5S A;  1SNO A;  4S3S A;  1D2B A;  3OIQ A;  4IUV A;  5DAU A;  2CVR A;  2Q8I B;  5EKL A;  1PFM A;  2PZT A;  4KD4 A;  1GUS A;  1UNS A;  1C8C A;  2RDG A;  1FR3 A;  4H7B A;  1LTT D;  3V96 A;  3I4M B;  2F3W A;  2YYZ A;  1UAP A;  1M8A A;  2D9U A;  1EZ8 A;  5G3L F;  3PO2 B;  1VMP A;  3NPP A;  3GTJ B;  1PZI D;  3I4L A;  3RZO B;  3NK9 A;  3D6W A;  2HCC A;  3HEJ A;  3PO3 B;  1LAB A;  2R93 B;  2NN6 H;  1H9R A;  3BS1 A;  2E74 C;  1U4R A;  1Q1E A;  1WTV A;  1AZP A;  1EQV A;  4DNT B;  3D8G A;  1B3A A;  1SYF A;  1Q1B A;  3F2U A;  1IKM A;  1HPC A;  3TP6 A;  4EVO A;  5E3F A;  1AZQ A;  4IFD H;  2F0N A;  4FF1 A;  3R3O A;  2ID0 A;  1QCB D;  1HHV A;  3BYT B;  3PMF A;  5KYI A;  3GTM B;  2A6E C;  1PTO B;  1CT1 D;  3X3M A;  4EQO A;  3MZ5 A;  1ICW A;  4C3H G;  2XSC A;  5CYU A;  1RKN A;  3D3R A;  1ENA A;  3HOU B;  2R3Z A;  4XIG S;  3DM1 A;  4PMC A;  1G29 1;  1TWF B;  5I4D A;  4XQQ A;  1CQV A;  4N9T A;  4H13 C;  1I4P A;  4HN7 A;  1ZXT A;  2KOL A;  3GV3 A;  1M4V A;  3K58 A;  1C48 A;  1B9M A;  2YU9 B;  2EYM A;  3AMU A;  2EJM A;  3BDL A;  2EYJ A;  4QCL A;  2I07 B;  4RHS A;  1O80 A;  2FMM A;  1ONL A;  4ZRZ A;  4EQN A;  2B2U A;  3TP8 A;  1TS5 A;  3I72 A;  3ZYY X;  2LMC B;  4G7H C;  4F7X A;  4BBR B;  2WII B;  3PV0 A;  3DEO A;  3M85 A;  1SNC A;  1A15 A;  4TQU S;  5C0X J;  2PPB C;  1QG7 A;  4PMB A;  4EGV A;  3BZD B;  3OSO A;  1TVX A;  4RH6 A;  3S1R B;  4RAU C;  2C9O A;  3MA2 B;  1R9T B;  3NTI A;  3V2T A;  1SE2 A;  4R9W A;  3TZD A;  4A3G B;  4R8I A;  1ENF A;  3NWT A;  4H44 C;  5ELC A;  1STH A;  2EY2 A;  1D1I A;  4KKT A;  1ROD A;  3R2T A;  4WRD A;  2B2W C;  4TKO B;  1EYA A;  2EYO A;  1TQO A;  1JR0 D;  5IT9 L;  1OXX K;  1QIL A;  2EY6 A;  3SK4 A;  4KKU A;  3HRZ C;  3A7L A;  4C3I G;  2RQX A;  1Y1W B;  5M5Y B;  1KDA A;  2F0K A;  4CBV A;  2KED A;  4WOR A;  3S15 B;  2B63 B;  1PMR A;  3D31 A;  3DWQ A;  4J1M A;  1CHP D;  3I90 A;  4B9X A;  4WJW A;  1G2S A;  1VCI A;  1CM9 A;  1F9Q A;  3HOW B;  3FVQ A;  2AUJ D;  3FRP B;  3CQZ B;  1O78 A;  2XWB B;  4NKL A;  5IGB A;  4RWS C;  3S1Q B;  3MXU A;  3Q22 A;  2WV6 D;  4JK1 C;  2QCP X;  3I73 A;  1H9M A;  1L0Y B;  3I91 A;  2E2D C;  4NW2 A;  1KTK A;  2Z1C A;  2B2W A;  2ZXR A;  3HKZ B;  1DCZ A;  3MXN A;  1V1O A;  1ZEQ X;  2CW0 D;  3R93 A;  4IFD J;  4MHE A;  4DAV A;  4C2M B;  3VR2 A;  1EWH A;  3VR3 A;  1ET6 A;  4DK1 A;  3UI2 A;  1GOZ A;  3VYT A;  4A3J B;  3C1F A;  1GUG A;  5JPN C;  2LS0 1;  1MBY A;  2VB2 X;  4OIK A;  1KDB A;  1B53 A;  4RGN A;  3JAM L;  2KEE A;  1Q8I A;  2FHT A;  3TN2 A;  2PZW A;  3ND9 A;  3K0Y A;  4K14 A;  1CA6 A;  1ILQ A;  1I3Q B;  2EYL A;  4KI0 A;  2RSO A;  1IL8 A;  2E76 C;  5I6W A;  3K7A B;  4TSS A;  4F88 A;  1B2T A;  1A3V A;  5CR3 A;  4M1U B;  5LL6 S;  1A6X A;  4DF7 A;  1J9O A;  4E6I A;  4A3B B;  3K5N A;  2KEC A;  2KA7 A;  5JJZ A;  1KAB A;  2RVL A;  3EJI A;  1SJH D;  4BBS B;  3AB9 A;  1HXY D;  1QOH A;  1AEX A;  1F77 A;  2HDM A;  5LHY 1;  2SEB D;  2BA0 A;  1F2Z A;  1SEB D;  2ZXP A;  1E2W A;  4CJ0 B;  1F2Y A;  4WFN 3;  1G91 A;  1DD2 A;  1V1P B;  2NTT A;  3OW7 A;  4LAA A;  1PRT F;  1ZKO A;  4KY7 A;  3H94 A;  4ZQ3 A;  4A93 B;  1ET9 A;  2X69 A;  1HUM A;  5EBC A;  3SEB A;  1JWS D;  3WOF A;  1HFG A;  1D1K A;  1EQT A;  1SYE A;  4OO1 G;  2O5J C;  2F0I A;  3KF8 A;  4XTC S;  1JC7 A;  2A6E D;  3QIA A;  5EQ0 A;  1I4X A;  1TY2 A;  1JIC A;  3Q0A A;  2X6G A;  3BVZ A;  2MJ8 A;  1PRT B;  5ELD A;  4FF4 A;  3S2H B;  5CV5 A;  3OMG A;  2Q8T A;  1HTL D;  1HFN A;  3FDT A;  5JEA H;  4O42 A;  4H0L C;  1SYD A;  2BCO A;  4MIU A;  3OMC A;  4Z9C B;  5FO7 B;  1RJT A;  2RDH A;  1QB5 D;  1BDO A;  1W6K A;  2K1B A;  4JBW A;  3NWS A;  1EY9 A;  2ENB A;  1TWG B;  1NR4 A;  1QNK A;  4GZY C;  2MUY A;  2VXW A;  3H0G B;  2CW0 C;  2K5D A;  2XNA C;  2PW7 A;  2NB0 A;  4KY6 A;  4XDX A;  3KK7 A;  2AQ3 B;  1G8Z D;  4K6L A;  5DNF A;  1U4P A;  3PIO 3;  2N88 A;  1B1Z A;  3K57 A;  1QE6 A;  2IJ0 A;  2AWN A;  2KQ3 A;  3RD4 A;  1DM0 B;  1JWM D;  1L0X B;  4RGT A;  1BCP D;  1SXT A;  4BS9 A;  2F0O A;  2K05 A;  1WTR A;  2EYF A;  2JEA I;  3T51 B;  3W3A A;  2NVT B;  1PTO H;  1Q12 A;  4RKB A;  4K8I A;  5K36 G;  1TS3 A;  5CMD A;  3NBH A;  4IUT A;  4ZLT F;  2R7Z B;  3TSS A;  2RKS A;  4IUR A;  1DOL A;  2RA4 A;  2BE5 C;  2TSS A;  2JA7 B;  5M5X B;  1BUV T;  1PFN A;  5JPM C;  1LT6 D;  5C0X G;  5BN4 A;  4Q0F A;  4FO2 A;  2KHS A;  1D5M C;  1LTG D;  1W6J A;  1NAP A;  2Q8R E;  1PZK D;  2B2V C;  1WTO A;  4KTA A;  3M4Y A;  3K59 A;  1Y69 U;  3LX0 A;  1DJR D;  3WOE A;  5KRU A;  4FXD A;  1F9P A;  3K5M A;  1LTA D;  1SNQ A;  5M9O A;  1X3Q A;  2XRQ D;  4ZKB B;  3LWE A;  4KHV A;  3KLS X;  1EY7 A;  4XQJ A;  1DOM A;  2KUM A;  1Z7T A;  5DEH A;  1E2V A;  1BNZ A;  2AWO A;  1PTO F;  5D3I B;  1V8Q A;  3K5O A;  5CC4 A;  3ITP A;  4HCE A;  2FIN B;  2ZT9 C;  3HGB A;  2A73 B;  2NTS A;  2HDL A;  3FMC A;  4FF3 A;  4KN7 C;  1S5D D;  4HCS A;  1SYC A;  1TWA B;  2L1B A;  3H91 A;  3MWY W;  1A3T A;  2VUM B;  2B2V A;  3ND8 A;  5FO8 B;  1EY0 A;  4CJ2 C;  5IGC A;  2EVB A;  1RHP A;  4AYB B;  2B2U C;  5C44 B;  2LKV A;  1FGB D;  3GV6 A;  4QUC A;  5KYL A;  4KK7 A;  1O7Z A;  5CV7 A;  3GTK B;  1BQQ T;  2F0E A;  2EJG C;  2OXP A;  3RMH A;  3BDC A;  4DNR B;  2AQ1 B;  2SNS A;  3MC0 B;  1EY4 A;  3S16 B;  4KD3 A;  5ELF A;  5TSS A;  3K5L A;  3HS0 C;  4IFD G;  2A68 C;  4G4K A;  1TWH B;  1GUO A;  4K2L A;  2B2T C;  1I4H A;  3G7L A;  4CKC A;  3S9W A;  1S4Z A;  2F0V A;  5IT9 E;  2H4O A;  3RUZ A;  1SBB B;  3Q23 A;  2IT1 A;  4XYO A;  5IIF A;  5EKK A;  2L0C A;  4ZK9 B;  4ZUI A;  3ONA B;  1MGS A;  3SXH A;  1KAA A;  3VA7 A;  5KIX A;  4DGZ A;  5IOD A;  2A5H A;  1CZG A;  1XXG A;  5I9O A;  3LWU A;  2ICI A;  2NVQ B;  1LTI D;  4ID6 A;  2QEJ C;  4KV6 A;  2MPM A;  1MSG A;  1XWE A;  4ZKC B;  4KHZ A;  3PIP 3;  3DWA A;  4DFA A;  2EE1 A;  1DON A;  3DWP A;  3Q6S A;  2BOS A;  1TII D;  2F0Q A;  1BCP C;  4C3H B;  1NSN S;  3KLS A;  4KJO A;  3A7A B;  2B2T A;  4FXG C;  3IFD A;  4PNY A;  3C46 A;  2F0S A;  3A8K E;  5JAV A;  4DAP A;  1SE4 A;  3SK6 A;  3IL8 A;  3L7Z C;  5D3D A;  1CA5 A;  3EA6 A;  3NSW A;  1GHJ A;  4DXF A;  2IW3 A;  1Y8P B;  5IGF A;  5KNC A;  4K8J A;  4CHT B;  3A8J E;  1EIH A;  2BDO A;  3S17 B;  5C0X I;  1VF5 C;  4QUF A;  2KCC A;  1HTP A;  4PMW A;  5A35 A;  2XVS A;  3GD7 A;  3JAM E;  5IGD A;  3PUW A;  1TU2 B;  3MTS A;  1ENC A;  2QIL A;  3G6J B;  5EJW A;  2K01 A;  1XX8 A;  5KEE A;  2BDN A;  5FOB B;  3IFT A;  2IL8 A;  1EIG A;  5FLX L;  1EU4 A;  1BXT A;  1NCV A;  5A2Q L;  4DA2 A;  2JA6 B;  4YIJ A;  4IN3 A;  2VNU D;  3SHL A;  3TBI B;  2F4I A;  5KGU A;  4KMU C;  3MHB A;  1PLF A;  1ZYR D;  1AW7 A;  1XTC D;  1RTO A;  3J80 L;  5I9P A;  3GTL B;  5C4X B;  1WD0 A;  3T16 A;  5HUR A;  3HP3 A;  1ESR A;  4L63 B;  3EQL C;  1UUP A;  2PZU A;  4HSV A;  1FNW A;  4C3I B;  1OO9 B;  1STN A;  3I3C A;  1IKL A;  2Z4I A;  1I4G A;  1U9R A;  2WB1 B;  5T1I A;  2PQE A;  1SAP A;  3QOJ A;  4K5X A;  5EBD A;  1TWC B;  3GQB A;  4FVM A;  1WTX A;  4KKS A;  4O1N A;  1OXS C;  3N52 A;  2A69 C;  1I50 B;  3IAY A;  2L55 A;  2BE5 D;  2F0F A;  5CBA E;  5IGG A;  5NUC A;  1VF7 A;  4HMI A;  1OXU A;  5E4X A;  5EPJ A;  1TS2 A;  4RFB A;  2XWJ B;  1I6V C;  1I6H B;  1EEF D;  3J7Y W;  1A2U A;  3FKI B;  4Q5V A;  4C1N K;  4L6T B;  1EEI D;  2K5Q A;  2JE6 I;  3BDO A;  1SNP A;  2DNE A;  1GUN A;  3S1N B;  5IOC A;  2DY8 A;  1YNN D;  1LV9 A;  1GJX A;  2K03 A;  1RCV D;  2O4X A;  2E2H B;  2GA4 B;  2PNR C;  3HOX B;  3T53 B;  2Z4H A;  5CV6 A;  1AN8 A;  5AFW A;  2L9H A;  2L5T A;  5K5P A;  3ERO A;  1JWU D;  2FJ2 A;  3M7G A;  2EYP A;  5CBE E;  4A3I B;  5CV9 A;  2E2I B;  1A2T A;  2IPK D;  2EPB A;  1Y1V B;  3KLR A;  3TDQ A;  3QOL A;  1BF4 A;  2XRS D;  1HCZ A;  1SND A;  3NP8 A;  2IWH A;  2EDG A;  2H1E A;  1JQY D;  2NUC A;  5ELB A;  1EZ6 A;  3D4R A;  2F3V A;  1CI3 M;  3PUY A;  3NE5 B;  4A3F B;  1SNM A;  1F9S A;  2SNM A;  2IX0 A;  4HED A;  4XT1 B;  4K5W A;  1WTP A;  1Z47 A;  1H9S A;  1B50 A;  3PUV A;  3W2D A;  1SYG A;  1LTR D;  3KUP A;  4UDU C;  5G3L D;  2K7V A;  1TS4 A;  4B9W A;  1X32 A;  2A68 D;  4V0B A;  1CK1 A;  4A3K B;  2QDB A;  3HZX A;  5CV8 A;  4BA2 I;  5E4W C;  2EZV A;  4QIW B;  4DN4 M;  2E2J B;  1JOR A;  2FFK B;  1S5B D;  2ICE C;  1PTO D;  1TY0 A;  1CTM A;  4NMZ A;  4G7O C;  5E1F A;  4BWG B;  4BY1 B;  4FXK C;  2F0U A;  5FK9 C;  3VYR A;  3RLF A;  1SMY C;  3I8Z A;  1JOO A;  5EPK A;  2NVY B;  1S5E D;  1CHQ D;  5C3W A;  4HTH A;  1ZYR C;  5I2X A;  1FNU A;  4KJN A;  3S1M B;  5M3F B;  4EQP A;  3MAQ A;  4ME5 A;  2MGS A;  2MHV A;  2M2L A;  1K83 B;  1TT2 A;  5LL6 X;  5J39 A;  2F0L A;  4L8J A;  1EY8 A;  5K36 H;  3A56 A;  5IGE A;  3PUX A;  4MN3 A;  5J1Z A;  1CZW A;  1AP0 A;  5D14 A;  1LT3 D;  2R6G A;  3U9S A;  1PZJ D;  5DM6 3;  3KBG A;  4OHJ A;  1QJO A;  5JVG 3;  1C4Q A;  4J8Q A;  1R4P B;  5C0X H;  1STY A;  3SVM A;  4ZAI A;  4QMG A;  4IQZ A;  2R92 B;  4RGO S;  4HSP A;  3MXP A;  3GP7 A;  2R61 A;  1WVL A;  1E2Z A;  3J81 L;  2SOB A;  2HCI A;  4ZYS A;  2D62 A;  4FP5 D;  2SDF A;  1S5C D;  3X3N A;  2OF1 A;  3EVQ A;  1FD7 D;  4OGQ C;  3D4D A;  1H9J A;  2EOT A;  4K2K A;  1LLR D;  2MP1 A;  1CFM A;  1EY5 A;  4IUU A;  3TP5 A;  3P7J A;  4CJ1 B;  2K28 A;  5HGT A;  4XXE A;  2TMP A;  1EL0 A;  1EU3 A;  4B08 A;  1HA6 A;  1YNN C;  3A54 A;  2NWG A;  3OIP A;  3MVV A;  2NYZ D;  1K8O A;  2WKC A;  4IUN A;  4FNF A;  4K6D A;  2JEB I;  1JOQ A;  4A3D B;  5CV4 A;  4IAL A;  1KLG D;  1EYD A;  3H3V C;  3H6M A;  5C3X A;  1Y8O B;  4XT3 B;  3SDZ A;  2XIW A;  1PYW D;  2EYH A;  4ODG A;  4NDX A;  3NTK A;  1X3P A;  2PMZ B;  2J7Z A;  1JOK A;  4IUQ A;  1HRJ A;  5T1G A;  2A6H C;  5BN5 A;  5COY A;  4PQX A;  3VYU A;  1FNV A;  2XN9 C;  2DN8 A;  2KJX A;  2EJF C;  2EXZ A;  3QWN A;  1WTW A;  1NR2 A;  3V05 A;  5JEA J;  1EY6 A;  4BA1 I;  4OO1 I;  4F87 A;  2NN6 G;  1S5F D;  4R8N A;  5COR A;  4A3M B;  3PUZ A;  1IYU A;  4X3U A;  1WD1 A;  1TKW B;  1YNJ D;  1A3U A;  1GHK A;  1AFP A;  2B2Y C;  2F0J A;  2A69 D;  5C4H A;  2D2C C;  4QB4 A;  2RDF A;  2LY7 A;  3VR6 A;  2HQE A;  3CU7 A;  3SR1 A;  1B44 D;  2F1M A;  4XYQ A;  3M3Y B;  2X6L A;  2NZ1 D;  3HOZ B;  1IW7 D;  3RZD B;  1BCP F;  4KN4 C;  4A3E B;  4RGM A;  1EWC A;  2BA1 A;  1PTO C;  3NUC A;  5M5W B;  3D6C A;  3LNN A;  4U67 3;  2JA8 B;  3S2D B;  3P20 A;  5JVH 3;  1GUW A;  3ERQ A;  3M4O B;  3WDN A;  4DU9 A;  1U4L A;  1B4O A;  1K8M A;  1KNE A;  4RCO A;  1G2T A;  3A8I E;  2AUK A;  4I7Z C;  2F0G A;  1CQF A;  3AU7 A;  2G9H D;  4C3J G;  1BCP B;  3K6O A;  3MXG A;  3NQI A;  1F2L A;  2JYO A;  2B2Y A;  1EYC A;  1WTQ A;  1PDQ A;  3URY A;  2F03 A;  3DHQ A;  2RSN A;  2I46 A;  4M8A A;  2NBF A;  3MFG A;  2J0T D;  5FLX E;  2L4N A;  4LMQ D;  5A2Q E;  1Q90 A;  4HAE A;  3OOC A;  5CGK A;  1ILP A;  2WP8 J;  4V19 0;  3HOY B;  4J6H A;  2AQ2 B;  3I4N B;  5M3M B;  3J80 E;  1HQR D;  1E0B A;  2CQA A;  3CHB D;  2D5D A;  4UAI A;  3NTH A;  1O7Y A;  1V43 A;  1Y8N B;  4KY5 A;  3BVG A;  1ML0 D;  4N9P A;  4RA8 A;  1F2M A;  5DM7 3;  2RBM A;  4HMJ A;  2PCF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...