1C48A

Mutated shiga-like toxin b subunit (g62t)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGTFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Toxin
molecule keywords PROTEIN (SHIGA-LIKE TOXIN I B SUBUNIT)
publication title Identification of the Primary Receptor Binding Site of Shiga-Like Toxin B Subunits: Structures of Mutated Shiga-Like Toxin I B-Pentamer with and without Bound Carbohydrate
rcsb
source organism Phage h30
total genus 18
structure length 69
sequence length 69
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 1999-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1c48A00
1R4PB 1R4QB 3MXGA 1CZWA 1QNUA 1D1KA 4P2CB 2BOSA 1BOSA 1D1IA 1CZGA 1QOHA 2GA4B 1C4QA 1DM0B 1CQFA 4ULLA 2XSCA 2C5CA 1C48A 4M1UB
chains in the Genus database with same CATH superfamily
2LY7A 5I9PA 1UEBA 1E3PA 3O13A 1N8RC 4IUTA 5EQ0A 3PUWA 4IUPA 2DN8A 1N32L 3PO2G 5LL6S 1WCMH 1JORA 5KIXA 2RSNA 1BCPD 4IUQA 2F0JA 2EXZA 5ELBA 3GTLH 2F0TA 4ME5A 3K0XA 3K5OA 3VR4A 3Q8DA 2CW0D 4K2KA 1XJVA 3RUZA 4KHPQ 4BBSB 4HIDA 5DAUA 2WAQB 2LFNA 4QCLA 4OXPA 4LF9L 1HRJA 2D9UA 4GKJQ 2G9HD 2RKSA 4DXFA 1UE7A 1W3SA 1Q90A 1A0IA 3KUPA 1Q1BA 1PH9A 3GTPB 4G57A 2QEXA 2R7ZB 1WOCA 3SK5A 4XDXA 2HT1A 3EIVA 1VQCA 2F0DA 3NWTA 2B39A 2KBNA 2MJ8A 1DJRD 5KNBA 1YZ6A 3T13A 1R9TH 3I4OA 2ZTEA 1VQ4A 4RCOA 1M1KC 4RCNA 5IGGA 3K80C 1SYFA 1XNRQ 4FF1A 2NB0A 3A8IE 4JI1Q 5G3LD 2PMZE 2UU9L 5LMUL 1PH8A 4DNRB 1L1OA 1L1OB 4XQQA 5KGUA 1FJGQ 1LT3D 4NP5A 4O1NA 5IT9L 3H3VI 4A3BB 1V9PA 3SK6A 3SDZA 2KVMA 5ELFA 2F0MA 2Z6KA 3CCQA 4I7AA 2E5LL 1CA5A 4DPGA 4DF7A 4Q5VA 2O5JC 3GTOH 2F0SA 4JYAL 4X3UA 4ZCKA 1RJTA 1STYA 2EY2A 3KK7A 4DR6L 1VMCA 4AYBG 1YJ9A 1S40A 5IGCA 5I6YA 2JA8B 3BG3A 1E0BA 1O7ZA 1TVXA 5EAYA 1TY2A 3IRBA 1N34Q 1GKHA 4A3KB 2I5HA 3AB9A 4B3SL 1ZKOA 5FO7B 2HDMA 2L12A 2JA6G 2NN6G 2RBMA 1KXLA 1LTID 3CCVA 5EPLA 3HOXG 4LJZC 3WDNA 3GD7A 3MTSA 1CUKA 1EWIA 4B3RQ 3DHQA 1LYLA 2Q2IA 3BS1A 1HPCA 1K3BC 4TVAB 5EBCA 3KF8A 3KF8B 1MSGA 4MHEA 4GKKL 3J7A5 4IN3A 2GVAA 4DK0A 3J81L 1SNQA 3RMHA 5ELOA 3EA6A 4Y7NB 5M5XH 3I8ZA 4GLXA 4P71A 5DEHA 1SNCA 3P7JA 1EEFD 4IFDI 1KL9A 4EQPA 3SR1A 1PTOC 4X66Q 4A76A 1VQBA 5NUCA 3QIAA 2JA7B 1RHPA 4K2LA 3J80E 2NVXB 1MIUA 4DV2L 4DV1Q 3L0OA 3S16H 2BCOA 2EY1A 1QWYA 3H6MA 2D2CC 4WORA 1EUJA 4KD4A 3MXNA 3PO3G 3MXNB 3BU2A 5M3FB 1NCVA 1BUVT 1HJPA 5IODA 5IGDA 4DV3L 5CV9A 2OEOA 3S2HH 4JI3Q 4J1MA 4JW0A 2VQFQ 3S24A 1JB7A 3CPFA 5IGFA 5C4XG 1KNEA 2F0NA 4LF7L 4C2MB 3IFDA 4HIOA 5I4DA 1CT1D 5EKKA 3X3MA 3I4NH 1I4PA 2E74C 3NXWA 1OXXK 4YCWA 4YCUA 3KLWA 3NTHA 5KRUA 2N55A 2E2JH 4MTKA 1XNQL 1EWHA 4DR3L 1N33L 3CC7A 1N32Q 1VQPA 1K0RA 1I6HH 1VF5C 4I65A 3A8KE 1AZPA 1I50H 3D6WA 1PLFA 4OELB 3SVMA 3KBXA 2VUMG 4EX5A 1T5EA 1HR0L 3NPPA 1HNZQ 5HGTA 5M5YH 3JAML 2PI2E 1HHVA 4G7HC 2M2LA 3VYRA 4LFCL 3RNUA 4GNXC 4CDDC 1VQMA 4LF9Q 1XXGA 1IXRA 4KHVA 4A75A 1G91A 2M00A 4TSSA 1K73C 5GROA 1Y8NB 2NVTH 3BZDB 4K0KL 1GUNA 3F2CA 4A3EB 2A73B 1X55A 2NVYB 1QZHA 3HOWG 3I91A 3SEBA 5FO9B 1QNKA 5ELDA 1TS5A 1Y8OB 1VDZA 1L0YB 1YNJD 4R4IA 3K0YA 2XSCA 1B9MA 4DNTB 4M8AA 3W1GA 2OT2A 5CBAE 3SHLA 4GLAC 2UU9Q 1A3UA 5LMUQ 1E2WA 3M3YH 3VA7A 2R92G 2NVQB 1QNUA 4KK7A 3HOUG 1AP0A 4IJLA 4C3HG 2IW3A 4R4CA 4N8FA 3NQTA 5GAHC 2A6ED 4UDUC 2E5LQ 5C0XG 3CF5A 1SFOB 1Q8IA 4A3DG 3GV6A 4DFAA 3MAQA 2ZJRA 3CAMA 3H3VC 4JYAQ 4DR6Q 2Q8RE 2WKCA 3FHWA 3I4MG 1HNWL 1YNND 2FXQA 4NB3A 5M9OA 2Y0SE 1EQRA 4RG1A 1C7YA 4F7XA 3HOZG 3NE5B 4DUZL 2QEJC 1K8GA 2K14A 3KBGA 1QVFA 2QA4A 3TP8A 1ILQA 1V43A 1ESFA 1HNXL 3S1QB 4DK6C 4B3MQ 5CV6A 3S2DB 4CJ2C 2JA6H 3DXJC 1KAWA 2C5CA 4AQYQ 4P72A 1U5KA 5LMNL 4KJOA 2KCMA 3HOXH 4B3TL 4S3SA 3K5MA 5A2QL 1EYDA 2MPMA 1YIJA 1S72A 4A93G 2B63G 1QE6A 1VQJA 2B2WA 3R3OA 5C6AA 4ZLTF 2Q8IB 1I94L 4QJFA 1ASYA 3D6CA 2KCCA 1MI2A 3BDOA 2EJFC 1F9RA 1PRTF 3J7AV 3I4LA 2B2TA 3AFQA 4DV2Q 4YWLA 1CKNA 1CKNB 5FJ8G 3I72A 2K04A 4JG2A 4JI8L 3OYYA 4CKBA 1BCPB 1SYEA 2RVLA 4N9TA 4L5QA 1E22A 1VCIA 2DY7A 1UE6A 3W5OA 2CCZA 1HZCA 1LTLA 2H1EA 4DV3Q 5LL6X 1PFMA 1SMXA 1ZEQX 4L6TB 4QUFA 4PQXA 3PO3H 3L7ZC 4J8QA 1Y69U 4BBRH 2IHEA 1STNA 3T1YL 2HD3A 1IBKL 3HS0C 1VF7A 3SK4A 2EY5A 3KF6A 4LF7Q 3KF6B 5M5WH 5AJ3L 3RZOH 5J39A 1PYSB 3M4OB 3CP0A 3D4DA 4LW1A 4GN5A 3BJUA 4BY7G 4IOCA 3K7AH 3S14H 4JBKA 1SXTA 1HCZA 1SMYC 1JT8A 2DJFC 4IALA 1JOQA 3TRZA 4A3IH 1HQRD 1OXSC 3B6YA 4HSPA 1S5DD 2TMPA 4KI0A 4B08A 2JA5B 3BDCA 4A3MG 1RDPD 2DJGC 1KD1C 3N52A 3H09A 5COYA 3ND9A 2L15A 3D4RA 5L37A 5M3MB 4JVZA 4NMZA 1DCZA 1HR0Q 3TS0A 2MO0A 3RLFA 3KLSA 1PMRA 1WI5A 1MKHA 2VUMH 1LT6D 4LFCQ 1O7YA 2WIIB 1NNXA 2I07B 3GV3A 4K8JA 3W1BA 4X62L 2VB3X 4NXML 5JEAG 3NENA 5KNCA 5DM63 3NEMA 2MHVA 3J80c 2PNRC 3W3AA 3W2DA 4QL5A 5C44G 1Q7YC 3OMCA 4FF3A 5IYCG 1A62A 3R2TA 2IWHA 4JI2L 4NW2A 1I4GA 1S4ZA 2RF4A 4A3JG 2WINB 4C1NI 3HOWH 4DV7L 2K32A 1D2BA 4K6DA 4YY3L 1SYBA 1XTCD 4DN4M 2ZJPA 4OX9L 1STAA 2JE6I 4RAUC 2AKWB 2VXWA 2FMCA 2CKZB 5CC4A 5IGEA 1ZYRD 5FOBB 3KJOA 2R92H 3G6EA 3HOUH 3U9SA 1EQVA 4C3HH 4DV0L 1K8MA 3F2UA 3CMAA 4I7ZC 5C0XH 1X3GA 2KEDA 4UP9A 4WJ4A 1P16A 4A3DH 4K8IA 3SGIA 1IYVA 3GQBA 4KLKA 1BBUA 1CI3M 1BR9A 3STBD 4X65L 4R4TA 4EQ5A 5JPNC 4FVMA 2LS01 1YHAA 5C5MA 3V05A 4C3JB 4FP5D 1WTXA 2PYKA 3I4MH 1B1ZA 1CSQA 4NDXA 1VQHA 1PTOH 4MIUA 4C3IH 2PZWA 1HNXQ 1K28A 1EZ8A 4IURA 1TIID 3CCRA 2EYJA 1SYGA 2N88A 3GTMH 1HH2P 1KDBA 1TWHH 3ITPA 3NTIA 5C4JB 4P73A 3FEWX 2L11A 4OWTB 5CV5A 1AE3A 3D0FA 2E2IH 1CKMA 4XYQA 4B3TQ 4ZUIA 2UXCL 4KHZA 1RODA 3MC0B 4RHSA 3S1MB 2EPBA 4KY6A 3TZDA 4CJ0B 1Q46A 2DUDA 2PI2A 2IT1A 1TR5A 4F88A 1PH3A 1PRTB 1I94Q 3H0GH 2JA9A 2AQ1B 5D3DA 2CFMA 3I70A 1BXTA 3H94A 2BE5D 4JI6Q 1O78A 3CQZB 3L3OC 3T51B 2JEBI 3GTQB 2RHSB 1L1OC 1KDCA 3ZYYX 1ET6A 3Q24A 5JJIA 4OEMB 2N8NA 2PZTA 2Z6KC 1WTRA 3OIPA 4JI8Q 1WD0A 4LFBQ 4LUZA 3KJPA 2A5HA 2N49A 1OXVA 2RDHA 1SYDA 1BQQT 2Q2TA 1OO9B 3AU7A 3TSSA 2HQLA 3CMEA 4PMWA 1J9OA 1G8ZD 2F1MA 2F0KA 1D1IA 4KV6A 3T1YQ 2EOTA 3S15B 1KQSA 3L2PA 4A3GG 4ILWA 4LNQA 1U4PA 5EGTA 1PTOD 1TWAB 2WB1E 1NSNS 4ZRZA 5K36H 2XWBB 1EQTA 4YCVA 4GN4B 1PVOA 2BH2A 2BDOA 3FPUB 2PO4A 3OIQA 3GTGH 4DAVA 1PFBA 4BY7H 1X56A 1BBWA 2Y0SB 1EYAA 3I4NG 1KTKA 1CK1A 1MSHA 4ZUJA 3HKZG 2H5XA 2EVBA 5C3XA 2E75C 2JYOA 2R93H 1RCVD 1LT4D 2L9HA 1NUCA 3TREA 1XPOA 4JOIC 1G2SA 1HFGA 1GUOA 4NKLA 3WWVA 4DR4L 3GO5A 4WJWA 2K33A 1F2ZA 1IW7D 1QUQA 1QUQB 3NHHA 4X62Q 3GTKH 4PG3A 4IQZA 5FLXE 1B50A 1HR0W 2F3VA 4APVA 3H3VH 1E24A 4TRDA 1Z47A 4DR5Q 3BDLA 1S5ED 2LKVA 1B2TA 5JEAH 4DR1Q 4JI2Q 2KQ3A 3PO2B 1KRSA 1LUZA 2K03A 3NBIA 3JAMi 3KFUA 2K7VA 1UWVA 4KJNA 5CMDA 5C44H 2R7DA 1HQMC 2KEEA 2RCNA 5IYCH 1MJEA 4YY3Q 2QW7A 1MJCA 3PMFA 1ZYRC 2JP1A 3TN2A 2WAQG 2Z4HA 4A3JH 4DNIA 3C2PA 1TS4A 3P20A 3CCLA 4ZK9B 4XT3B 1HZAA 1PV4A 2KUMA 1C9OA 1RTNA 2LMCB 5A35A 4UAIA 4EVOA 2Z6BA 1AH9A 2R7ZG 1TS3A 3UDFA 1EYCA 1AFPA 1H9KA 5E1FA 5IP7G 4U68A 3STBC 1NMGA 1UEAB 1M4VA 4BWGB 4JBJA 3OSOA 1S5FD 3OTOQ 1JB3A 3R2IA 3M4QA 5D3IB 1NTGA 3TEHB 3UDXA 2ICEC 4OIJA 1SYCA 1JWUD 4HSVA 4BY1B 1A2UA 4JV5L 2NTSA 3QG1A 4LUOA 4QGUA 4LF5Q 3SK8A 1QOHA 2V1CC 3FMCA 5JOBA 1JJ2A 2F0HA 2B2VA 4QMGA 1GD7A 3LGJA 2UXDL 4DV6Q 3U58A 3J7YW 1QZGA 1O7IA 3EFXD 1H9SA 1H9SB 1EFID 5EBDA 1WTQA 4IFDH 3E5SA 3HRZC 1RKNA 2BOSA 4UPAA 1Q3LA 1QG7A 1AN8A 1ILPA 1JC7A 4ZYSA 2UXCQ 1SDFA 3J80L 2JA8G 5FLMG 1FNUA 2KCNA 4C56C 1T5XD 1LLRD 3FVQA 4LF6L 5GAEC 4A3KG 2BE5C 1NAPA 3DM1A 1TQOA 5LMNW 1AW7A 2Z1CA 1CA6A 3CRLC 3A74A 2A69D 2FINB 3M9BA 2OQ0A 5T1GA 1D1KA 4KKSA 5CV8A 3KLRA 2HCIA 2E8GA 3U4ZA 1X3PA 4OGQC 1FNWA 1NR2A 4DUYQ 2F0UA 4R4OA 4QQBX 1G2TA 2A8VA 1B9NA 2B29A 3E3XA 4RGMA 1XTDA 2R6GA 2Z9HA 3MA2B 4RWSC 3BYYB 5EPJA 2TSSA 5EPKA 5D14A 2G9DA 2GVBA 4LFAL 1LACA 4YHHL 4LF4L 2JA7G 3H91A 3OW2A 4FNFA 3DEPA 3EBEA 4DV5Q 3P1HA 4ZKBB 4A3GH 1GHJA 4BBRG 2KA7A 1ENAA 1PXUA 2SEBD 3UI2A 5EKLA 1QVGA 3R8BA 4C1NK 3PIOA 3PQIA 2V4DA 1SNPA 1JICA 2VNUD 5M3FG 1YVCA 1J5EL 1YJWA 1BCPF 5I2XA 1ENFA 4LMQD 2H4OA 1XPRA 1F77A 4JI5L 1CFMA 3JC66 1L0XB 1TU2B 3A0JA 4A3IG 1PFNA 3RZOB 1GUWA 2YTYA 3MEFA 1K0SA 2K6AA 2AUKA 1IW7C 4HTHA 2HCCA 4HJ7A 5C4XB 5IGBA 2CVRA 3S14B 1VQAA 4IPGA 4WRDA 4YWMA 1K83B 2PW5A 3QOLA 2G5DA 1SMYD 2E2HB 3OHXC 1H9JA 1HXYD 3AFPA 3U9OA 4KN7C 2KENA 3TP6A 5BN5A 5K5PA 4A3FB 1D7QA 2CQOA 3K81C 3CD6A 2IY5B 1TWGB 1EYGA 1A6XA 2BA1A 3KLSX 2NYZD 3HG9A 4POGA 2C9OA 4OO1I 3CCEA 2KECA 5G3LF 3X3NA 2B2UA 1LTRD 2QDBA 4P2CB 3CHBD 3K8AA 4HMJA 4HCEA 1MBYA 4BBSH 1B7YB 2VZAA 4N9PA 3EJIA 3DEOA 1AZQA 4LK1C 2K52A 2UUAL 2YTXA 3MHBA 1I5FA 3C1EA 5TSSA 5BR8L 1PFSA 4A3EG 2ATWA 1AEXA 4FF4A 1LABA 4BA2I 1JE5A 3GTPH 2R7ZH 3HOVG 2R3ZA 3Q22A 5D65A 3D8GA 1GUSA 2N78A 1JR0D 3TP5A 2C35B 5IP7H 4JV5Q 1I4RA 1WTHA 5IYBG 2A6HD 2CH4A 1EEID 3BZCA 1VQLA 1CSPA 2I0QA 2WB1B 2F0FA 3GTJB 1X3EA 1JJGA 2VQEL 1LTAD 1IL2A 4AH6A 1M90C 1ICWA 4UP7A 1Y1WG 1U4LA 4K6LA 3Q0AA 2UXDQ 1E2VA 4CDCC 1X54A 4C3HB 4X64L 4K5XA 2ASBA 4XYOA 3AQQA 3BYTB 1FD7D 3UE1A 1L2FA 2J0TD 4C3IG 2NUCA 4JC0A 4NXNL 1PH6A 4B3SQ 1B8AA 5BN3A 1M8AA 1HUNA 5EJWA 1EY5A 5FLXc 1IL8A 2A69C 1N9WA 2F03A 3V96A 1DYQA 1JWSD 1KAAA 2AWNA 2JA8H 4LF8L 2OTJA 5FLMH 4H02A 3HOZB 2F4VL 4XIGS 1IYUA 1WYDA 4A3KH 4KTAA 2CH4W 4FXKC 2AHOB 3S1RB 4RFBA 3NWSA 1V1OA 1TWCB 2E2IB 2DNCA 4GKKQ 4KN4C 2F0PA 2K5HA 1J6QA 3H0GG 1MHWC 1WFQA 1Y1VB 3RN5A 5C0XJ 1EL0A 2Q2UA 1B4OA 4CGYB 4V190 3E9IA 2GA4B 2XTIA 2XRQD 4OWXB 1DXMA 4WJ3M 3LX0A 1DGSA 2K5VA 4XTCS 4A93B 3HOYB 2K50A 3FKIB 1BDOA 2B63B 2XNAC 1Y8PB 2KOLA 4YHHQ 4Y7NH 2PPBC 1VQIA 1RTOA 1I3QB 3AYHB 1EIYB 3VR3A 5DM73 3ONAB 2HHHL 1LTBD 2ZXRA 2R61A 2JA7H 2UXBL 1YBYA 2M9VA 2R7FA 5KYLA 3I55A 2K75A 2OQKA 5IIFA 2K5DA 1ZXTA 2FHTA 3FRPB 3TBIB 4HAEA 5K36G 4GS3A 5F2DA 2F0GA 4JI5Q 2J4XA 5M3FH 4QF4A 2B2YC 1Q81C 3I56A 3ULPA 4CDEC 3J7ZC 2UUBL 4FXDA 4Y52H 2NN6I 4GNXA 4GNXB 1VQGA 1XNQQ 4XQNA 4DR3Q 1PH1A 5IP9H 3QR8A 1VQEA 1N33Q 4PZ7A 2RQXA 2WFWA 3RZDB 4IUNA 1GM5A 4DR7L 2R93G 3M7GA 5AFWA 4BY7B 3CXCA 4C2MH 5H1SE 2QDLA 2IX0A 2CQAA 3BZKA 1JMCA 2JA5G 3T1HL 2F3WA 1EIGA 5HURA 3V2TA 4AYBE 3RR5A 1WTOA 4A3MB 2AQ2B 2L4NA 3S17B 1CHPD 4OIKA 5C3WA 4X6AH 4UP8A 2IHFA 4K5VA 1IBLL 4EQOA 1SE2A 1EQQA 1A3VA 1CHQD 3U4VA 2PZUA 1V1QA 2MQHA 3DWPA 1W6KA 3HZXA 1WCMB 3R93A 4K0KQ 2Z0SA 3TZUA 3GTKB 1D5ZC 3PIO3 3WOFA 2CWPA 3GTLB 4DAPA 4POFA 4OONA 1LTTD 4RHRA 3GP7A 5BR8Q 4DK3C 1F2LA 2YV5A 1U9RA 2A6HC 1ICFB 1UUPA 3VYUA 1WD1A 2JEAI 5C44B 3HFZB 3MXUA 4A3EH 2NVYH 1PZJD 3PUZA 5IYDG 2HDLA 2OCEA 3K5LA 4DR2L 4JCVE 3HOVH 2Z8LA 2JQOA 4HR7B 1EY7A 5KEEA 1OXUA 3E0JA 3K6OA 4DKAC 5IYBH 3MXPA 1XX8A 4DK1A 1R9TB 2F52A 3NP8A 2NVQH 3RN2A 1TS2A 5CYUA 5JJZA 4FO2A 1Y14B 2UUCL 1FYCA 2QCPX 1HNWQ 1Y1WH 4ZKCB 5C3EG 2IX3A 1K3RA 3G71A 3MWYW 1SFOH 4NXNQ 4O42A 2ZM6L 3C46A 4DAMA 4MN3A 3T16A 5JEAJ 1WJJA 3QB3A 1EY9A 4DUZQ 3J7AF 1K8AC 4Z9CB 4L5TA 1LV9A 4IFDG 3K5NA 4CDFC 1IHZA 4HMIA 4LF8Q 4C3JG 1XNRL 1BKBA 4IPHA 2F4VQ 2EJMA 4FXGC 2WV6D 3GTOB 4FYDA 5LMNQ 1Q1EA 2XIWA 4QIWE 2KHSA 2Q8TA 1FJGL 4ULLA 1K9MC 1PYBA 3EQLC 3F2DA 1WTWA 3S1QH 1SE8A 1UE1A 3S2DH 3T4AC 3G48A 4NPSA 1I4QA 4P75A 3K7UC 1S5CD 3VA5A 2D5DA 1FGBD 3U50C 1C0AA 3C1FA 2PQAA 2PQAB 5CORA 1BVSA 3F2BA 2E2DC 5DNFA 3VYSA 3IKJA 1TY0A 3RLOA 1I6VC 5GADC 3J81i 1DZ1A 4EQNA 1II3A 1A2TA 4QUCA 2BA0A 1QILA 1XWEA 2HHHQ 4IFDJ 5M5XB 2ENBA 2SOBA 4B3RL 2UXBQ 1DOLA 1S5BD 5I2YA 1B53A 3NBHA 3NBHB 1NY4A 2AMCB 1IBKQ 2DGYA 5FLXL 5AJ3Q 1PHJA 2K05A 4OO1G 2EZVA 3ER0A 1EY6A 3S16B 3JAMc 1UNSA 4R1JA 4LWCA 5ELNA 1TXYA 3CCUA 4RMFA 1SE4A 2IL8A 2NZOA 1B3AA 1P8LA 1EFWA 5FK9C 3S2HB 3Q6SA 2JSOA 5JVH3 4JI4L 2K5WA 4H0LC 3AMUA 1JQYD 3T1HQ 2PQEA 4F8MA 1EZ6A 1VQDA 4IUUA 1GUTA 2Y0SG 4HJAA 1F2YA 3GDEA 3NSWA 1ML0D 2JA5H 1KNAA 3QWNA 1H95A 3I4NB 2VQFL 1B70B 3HKZB 4HIMA 2E2JB 3VDYA 1W2BA 2XRSD 2YU9H 4NXMQ 1X65A 1PH4A 3TS2A 2WP8J 1I6HB 3KYHC 1JE4A 3NQIA 1I50B 3QJYA 3BVGA 4CBVA 4GLVB 1O7LA 3PF5A 3E0EA 2WKDA 1HFNA 5T1IA 2QKIC 5M5YB 3OMGA 1CKOA 4DV7Q 4BBSG 3FPPA 4OX9Q 1G51A 1N36L 1DONA 4HN7A 3OWEB 1MGSA 2EYFA 3F8TA 4DR2Q 1DOKA 1IKMA 4R8IA 4JI0L 2NVTB 4L63B 2AWOA 1HNZL 4A3LH 3KOJA 1IBML 5IYDH 3S1NH 1DOMA 4DV0Q 1CZWA 1I4HA 1E1TA 1QCBD 1STBA 1HA5A 2CHBD 1VQ5A 2UUCQ 1QB5D 5HY6A 1FGUA 4X65Q 1STEA 2IX1A 3MZ5A 3A8JE 2ZM6Q 3K57A 3M3YB 5CV7A 4RH6A 4BY1G 3T53B 2O5IC 1JJCB 5C3EH 3DWQA 2JXMB 4KKTA 5E4XA 2BH8A 4A3BG 3MVVA 3HGBA 1VQOA 2A1AA 5JJLA 2NWGA 1MD2D 2OXPA 1GJXA 1B44D 4J15A 4ODGA 4DAYA 4DAYB 1PA6A 1D8LA 1U4RA 4C3JH 2I46A 4JPBW 2B2UC 5CBEE 1J8IA 1KLGD 1TKWB 1CQFA 2RSOA 2WACA 1BNZA 4AYBB 4CHTB 2DNEA 5CV4A 3BVZA 4ME3A 2L5TA 5CGKA 5C4JH 2B8FA 3D3RA 3PUYA 3DUZA 2N3SA 4PMCA 1GHKA 3M4YA 1A8VA 1G6ZA 4MTNA 4ZQ3A 4XQJA 3S1MH 2JA6B 1JCKB 2IJ0A 4HCSA 1PTOF 2O4XA 5JAVA 3HOXB 2F0EA 2RCFA 2SNMA 4DXGA 2F0OA 3CRKC 1CQVA 1TWFH 1HUMA 5EKIA 2CWAA 2KJXA 3K59A 1G291 4B3ML 3A54A 1NBWA 3CCSA 1QVCA 1RF2D 4HJ8A 3CQZH 4AQYL 1VQ7A 2HQEA 1A15A 3PIP3 3GTQH 3G6JB 3DMUA 2RHQB 1HTLD 4H44C 4B9XA 5IT9E 4GOPA 1WTPA 4GOPB 1X3QA 1H9RA 3ND8A 2HIVA 3CKIB 4R9WA 1F2MA 1YI2A 1H9MA 1X9NA 4B9WA 4PMBA 4KD3A 1SEBD 1SLJA 4JOIA 3SXHA 2JN4A 1NJIC 3OW7A 2NZ1D 3UE0A 3I90A 4RGOS 2ICIA 4JI7L 3S15H 2A68C 3LWUA 1XPUA 3I73A 5FO8B 4OO1H 2F4IA 3DWAA 4YIJA 2LXKA 3D31A 1ET9A 1TWAH 3E9HA 4JI4Q 2F0IA 3PO3B 4BBRB 1GUGA 1CZGA 1KABA 5BN4A 2FFKB 4TKOB 5IP9G 3HEJA 5M5WB 2KHJA 4F87A 2VY3A 3CCJA 1NMFA 2B2WC 1YHQA 1E1OA 1IKLA 3K7AB 1PZKD 1U0LA 4DR4Q 1PDQA 4DV4L 3PUVA 1A63A 3FDTA 1VQ6A 4QIWB 4EGVA 1X6OA 1ESRA 3DM3A 3K58A 4A3IB 2F0WA 1Q82C 1XYIA 1NE3A 1Z7TA 4OHJA 2EYOA 2JJQA 1PRTD 1UE5A 4HIKA 3J81E 2XGTA 3PUXA 2B2TC 4G4KA 3SE0A 3NTKA 3EN2A 3IL8A 3S9WA 1PYWD 4A3FG 3J81j 1BCPC 4GZYC 2QILA 1ASZA 1LM0A 1XMQL 2VUMB 2CW0C 1N36Q 2O2LD 5GAGC 4LUVA 4JBWA 3NK9A 2YYZA 4JI0Q 3M85A 3PF4A 1UAPA 3PO2H 2NTTA 2EYLA 2EJGC 1IBMQ 2I5LX 2IPKD 4QY7A 1O80A 2RDFA 3FP9A 1IZ6A 1HTPA 1SE3A 4QB4A 1BF4A 4PZ6A 2K5NA 4IOAA 2OF1A 4BXXG 2X69A 3HOWB 3OOCA 3MFYA 2D0PA 2VW9A 3RLNA 1K8OA 1U4MA 2X6LA 3HOVB 1HZBA 1E2ZA 2F0LA 2WB1G 2F0QA 1NR4A 1WTVA 2R92B 4U673 3PCOB 3HOUB 4BY1H 1EIHA 4RGTA 3URYA 4CKEA 3P75A 4Q0FA 4A3BH 5IY0A 3T56B 1KHIA 4FF2A 4A3CG 4R8NA 4A3DB 2ALYB 2XN9C 3A55A 1Y1WB 5J1ZA 4ALPA 3D4WA 4L8JA 3DLLA 5KYIA 3PSIA 1EOTA 3JAME 4DU9A 4LF6Q 1ENCA 4L5SA 3I4MB 2K01A 5C4HA 4RKBA 1JWMD 1PTOB 1L0WA 4C3IB 3UDGA 1VS0A 4LAAA 1D6EC 1SAPA 5IWAL 3GTMB 3HKZE 1Z6HA 1TWHB 2AUJD 5GQOA 4OWWB 4PNYA 4XXEA 3A5UA 4DA2A 1LTGD 3VR5A 1SR3A 4R4QA 4BA1I 1BBXC 1VMPA 5CR3A 1A3TA 1LT5D 4IPDA 1RL2A 3QO2A 1FR3A 5E3FA 4RGNA 1SROA 1YHBA 2NN6H 2ES2A 3CC2A 3VYTA 1Y1VG 3H0GB 4KKUA 2GN5A 1EWCA 1YITA 1FVIA 5E4WC 4HJ5A 2F3IA 2YTVA 3MXGA 4LFAQ 4LF4Q 1BO0A 3HOYG 1PH5A 3FKIG 1KC8C 3KDFA 3KDFB 3WOEA 2ZXPA 4K14A 3EVQA 1GVPA 5JVG3 1G6PA 1I4XA 2WAQE 4JI7Q 4IUVA 4A4IA 3OPOA 2ID0A 2NVXH 1VQKA 4JI6L 1C48A 4M1UB 3CU7A 1J5EQ 2NBFA 4GN3B 3IFTA 2QF7A 4AIMA 3A7AB 2A74C 3BVMA 3N6RA 2ZT9C 2L0CA 1LTSD 1YEZA 2EYPA 1KRTA 4LFBL 5ELCA 1E7ZA 5J22A 2PNHA 2ZTDA 3LNNA 2K4KA 2XVSA 4MNOA 1PRTC 1Q86C 4DV4Q 2PMZB 4RKLA 1HA6A 2VS1A 1FNVA 3NELA 5HGQA 3GTGB 3C3LA 5A2QE 1GOZA 1LO5D 1XMOL 1OXTA 5C4XH 4OL7A 4JK1C 1K83H 1ONLA 3OWFA 2R93B 1BOSA 5M3MG 2EYHA 2E2HH 4X3TA 1C8CA 4DGZA 4A3FH 1XMQQ 1CM9A 2PW7A 3MFGA 3M4PA 4KY7A 1SN8A 1TWGH 1VQFA 2HIXA 2YU9B 3CPWA 2EQSA 2FJ2A 4H13C 1VQ8A 2LXJA 5IT9c 2EY6A 1F9PA 2EYMA 1QJOA 3TP7A 2UUAQ 2J7ZA 5C4ZA 5ISRA 1WCMG 2EIFA 5C5LA 2SNSA 1RD9D 1S3OA 1SNOA 4K5WA 4IJHA 1V8QA 3ULJA 3A5ZB 1PZID 1EIFA 4HEDA 1OTCA 2VB2X 3H15A 1W6JA 3G7LA 2F0VA 5I6WA 4KMUC 3VR6A 4ID6A 1X32A 4A3LG 5DLQE 3AEVA 1EU3A 2EE1A 5KNDA 1YNJC 4DR5L 4A3JB 1KIXA 1JOKA 4BXXH 2Q2HA 4DR1L 4IZ8A 2VQEQ 1B3QA 4KHPL 3EROA 2A19A 2L1BA 1VQ9A 1RIPA 2PCFB 2K1BA 4E6IA 5I9OA 3UDIA 1JOOA 2KCTA 3S1NB 1KLUD 4PV1C 4IO9A 4X64Q 1C4QA 2A6EC 4GKJL 3ULLA 4L5RC 3L9AX 1F9QA 4MZ9A 2VL6A 3GTJH 3CC4A 3HKSA 3ERQA 3ICEA 1HZ9A 4BS9A 3A56A 2ZJQA 3PIPA 3J81c 1X3FA 4A3CH 1EY0A 2BDNA 1YNNC 2L55A 4PZ8A 1SSOA 1FL0A 5C3EB 1YNXA 4G7ZC 3OTOL 2KHIA 1SJED 1STHA 4O0AA 3CCMA 2SDFA 4JI1L 2FMMA 2MO1A 5IWAQ 2P5ZX 1DM0B 4RA8A 1GO3E 4LF5L 2ZTCA 3J80i 4JBMA 3VR2A 4FDBA 4O2DA 4X3SA 2MNAA 3ZJYC 3PV0A 1R4QB 3HOZH 5JPMC 5IE8A 1V1PA 1Q12A 1V1PB 2MP1A 2XWJB 4DV6L 1WVLA 2OWOA 3S1RH 3I3CA 2D62A 2MUYA 4XT1B 2EDGA 3HP3A 1TWCH 5J3BA 2E76C 3I7FA 4UHVA 2K28A 1N34L 4CJ1B 4ABNA 2D0OA 2B2YA 1STGA 1Y1VH 3TDQA 4N8X1 4YWKA 4P74A 1KDAA 1CTMA 1R4PB 2X6GA 4G7OC 1TWFB 5C0XI 1EU4A 2JK8A 1SRUA 2OTLA 3TMEA 2B2VC 2MFIA 4A93H 3HOYH 2LSSA 3FKIH 2I5MX 2B63H 1SNMA 5FKAC 1Q8KA 3RD4A 3M7NA 3ERSX 5IOCA 3A7LA 4X3KA 1TT2A 1EOVA 3G4SA 1I3QH 3CW2C 5LHY1 1AE2A 1D5XC 4UY8C 4IPCA 1PH2A 4H7BA 3PGZA 4DUYL 2RDGA 4ZAIA 1Z9FA 4V0BA 2UUBQ 1F9SA 1SBBB 2B3GA 4KY5A 4TQUS 3MEHA 2QGQA 3TQYA 5FJ8H 1EY4A 1T9HA 4A3GB 5ELEA 4X66L 4HJ9A 4DR7Q 2K5QA 3M4OH 2AQ3B 3QOJA 4DV1L 2A68D 1XMOQ 1DD2A 4DV5L 3IAYA 1GXDC 3F1ZA 1VQNA 2B8GA 1PH7A 3RZDH 1YJNA 4CKCA 2Z4IA 3NUCA 4JI3L 2HUGA 5JJKA 3I2ZA 1IBLQ 4WFN3 1EY8A 1SNDA 1SJHD 3E6ZX 3LWEA 5E7NA 5M3MH 2ZXOA 4GOPC 2DY8A 2MGSA 1D5MC 2NZHA 3Q23A 4A3MH 1IYJB 2RA4A 3S17H 2EXDA 4J6HA
chains in the Genus database with same CATH topology
2LY7A 5I9PA 3O13A 4IUTA 5EQ0A 3PUWA 4IUPA 2DN8A 5LL6S 1JORA 5KIXA 2RSNA 1BCPD 4IUQA 2F0JA 2EXZA 5ELBA 2F0TA 4ME5A 3K5OA 3VR4A 2CW0D 4K2KA 3RUZA 4BBSB 5DAUA 2WAQB 2LFNA 4QCLA 1HRJA 2D9UA 2G9HD 2RKSA 4DXFA 1Q90A 3KUPA 1Q1BA 3GTPB 4G57A 2R7ZB 3SK5A 4XDXA 2F0DA 3NWTA 2B39A 2MJ8A 1DJRD 5KNBA 3T13A 4RCOA 4RCNA 5IGGA 1SYFA 4FF1A 2NB0A 3A8IE 5G3LD 4DNRB 4XQQA 5KGUA 1LT3D 4NP5A 4O1NA 5IT9L 4A3BB 3SK6A 3SDZA 2KVMA 5ELFA 2F0MA 1CA5A 4DF7A 4Q5VA 2O5JC 2F0SA 4X3UA 1RJTA 1STYA 2EY2A 3KK7A 1VMCA 5IGCA 5I6YA 2JA8B 3BG3A 1E0BA 1O7ZA 1TVXA 1TY2A 4A3KB 3AB9A 1ZKOA 5FO7B 2HDMA 2L12A 2NN6G 2RBMA 1LTID 5EPLA 4LJZC 3WDNA 3GD7A 3MTSA 3DHQA 3BS1A 1HPCA 5EBCA 3KF8A 1MSGA 4MHEA 4IN3A 4DK0A 3J81L 1SNQA 3RMHA 3EA6A 4Y7NB 3I8ZA 5DEHA 1SNCA 3P7JA 1EEFD 4IFDI 4EQPA 3SR1A 1PTOC 5NUCA 3QIAA 2JA7B 1RHPA 4K2LA 3J80E 2NVXB 2BCOA 2EY1A 1QWYA 3H6MA 2D2CC 4WORA 4KD4A 3MXNA 5M3FB 1NCVA 1BUVT 5IODA 5IGDA 5CV9A 2OEOA 4J1MA 5IGFA 1KNEA 2F0NA 4C2MB 3IFDA 5I4DA 1CT1D 5EKKA 3X3MA 1I4PA 2E74C 3NXWA 1OXXK 3NTHA 5KRUA 2N55A 1EWHA 1VF5C 4I65A 3A8KE 1AZPA 3D6WA 1PLFA 3SVMA 3KBXA 1T5EA 3NPPA 5HGTA 3JAML 1HHVA 4G7HC 2M2LA 3VYRA 1XXGA 4KHVA 1G91A 2M00A 4TSSA 1Y8NB 3BZDB 1GUNA 4A3EB 2A73B 2NVYB 3I91A 3SEBA 5FO9B 1QNKA 5ELDA 1TS5A 1Y8OB 1VDZA 1L0YB 1YNJD 3K0YA 2XSCA 1B9MA 4DNTB 4M8AA 2OT2A 5CBAE 3SHLA 1A3UA 1E2WA 3VA7A 2NVQB 1QNUA 4KK7A 1AP0A 4C3HG 2IW3A 3NQTA 2A6ED 4UDUC 5C0XG 1SFOB 1Q8IA 3GV6A 4DFAA 3MAQA 3H3VC 2Q8RE 2WKCA 1YNND 5M9OA 4F7XA 3NE5B 2QEJC 3KBGA 3TP8A 1ILQA 1V43A 1ESFA 3S1QB 5CV6A 3S2DB 4CJ2C 3DXJC 2C5CA 4KJOA 4S3SA 3K5MA 5A2QL 1EYDA 2MPMA 1QE6A 2B2WA 3R3OA 5C6AA 4ZLTF 2Q8IB 3D6CA 2KCCA 1MI2A 3BDOA 2EJFC 1F9RA 1PRTF 3J7AV 3I4LA 2B2TA 3I72A 2K04A 4CKBA 1BCPB 1SYEA 2RVLA 4N9TA 1VCIA 2DY7A 2H1EA 5LL6X 1PFMA 1ZEQX 4L6TB 4QUFA 4PQXA 3L7ZC 4J8QA 1Y69U 1STNA 3HS0C 1VF7A 3SK4A 2EY5A 5J39A 3M4OB 3D4DA 1SXTA 1HCZA 1SMYC 4IALA 1JOQA 1HQRD 1OXSC 4HSPA 1S5DD 2TMPA 4KI0A 4B08A 2JA5B 3BDCA 1RDPD 3N52A 3H09A 5COYA 3ND9A 3D4RA 5M3MB 4NMZA 1DCZA 3RLFA 3KLSA 1PMRA 1LT6D 1O7YA 2WIIB 2I07B 3GV3A 4K8JA 2VB3X 5JEAG 5KNCA 5DM63 2MHVA 2PNRC 3W3AA 3W2DA 4FF3A 3OMCA 3R2TA 2IWHA 4NW2A 1I4GA 1S4ZA 2WINB 4C1NI 2K32A 1D2BA 4K6DA 1SYBA 1XTCD 4DN4M 1STAA 2JE6I 4RAUC 2VXWA 2FMCA 5CC4A 5IGEA 1ZYRD 5FOBB 3U9SA 1EQVA 1K8MA 3F2UA 4I7ZC 5C0XH 2KEDA 4K8IA 1IYVA 3GQBA 1CI3M 1BR9A 5JPNC 4FVMA 2LS01 5C5MA 3V05A 4C3JB 4FP5D 1WTXA 2PYKA 1B1ZA 4NDXA 1PTOH 4MIUA 2PZWA 1EZ8A 4IURA 1TIID 2EYJA 1SYGA 2N88A 1KDBA 3NTIA 3ITPA 5C4JB 3FEWX 2L11A 5CV5A 4XYQA 4ZUIA 4KHZA 1RODA 3MC0B 4RHSA 3S1MB 2EPBA 4KY6A 3TZDA 4CJ0B 2IT1A 1TR5A 4F88A 1PRTB 2AQ1B 5D3DA 3I70A 1BXTA 3H94A 2BE5D 1O78A 3CQZB 3L3OC 3T51B 2JEBI 3GTQB 1KDCA 3ZYYX 1ET6A 3Q24A 2PZTA 1WTRA 3OIPA 1WD0A 2A5HA 1OXVA 2RDHA 1SYDA 1BQQT 1OO9B 3AU7A 3TSSA 4PMWA 1J9OA 1G8ZD 2F1MA 2F0KA 1D1IA 4KV6A 3S15B 2EOTA 4ILWA 1U4PA 5EGTA 1PTOD 1TWAB 1NSNS 4ZRZA 5K36H 2XWBB 1EQTA 2BDOA 3FPUB 2PO4A 3OIQA 4DAVA 1PFBA 2Y0SB 1EYAA 1KTKA 1CK1A 1MSHA 4ZUJA 2EVBA 5C3XA 2E75C 2JYOA 1RCVD 1LT4D 2L9HA 1NUCA 1G2SA 1HFGA 1GUOA 4NKLA 3GO5A 4WJWA 2K33A 1F2ZA 1IW7D 3NHHA 4IQZA 5FLXE 1B50A 2F3VA 4TRDA 1Z47A 3BDLA 1S5ED 2LKVA 1B2TA 5JEAH 2KQ3A 3PO2B 2K03A 3NBIA 2K7VA 4KJNA 5CMDA 1HQMC 2KEEA 3PMFA 1ZYRC 2JP1A 3TN2A 2Z4HA 3C2PA 1TS4A 3P20A 4ZK9B 4XT3B 2KUMA 1RTNA 2LMCB 5A35A 4UAIA 4EVOA 1TS3A 1EYCA 1AFPA 1H9KA 5E1FA 4U68A 1UEAB 1M4VA 4BWGB 3OSOA 1S5FD 1JB3A 3R2IA 5D3IB 2ICEC 4OIJA 1SYCA 1JWUD 4HSVA 4BY1B 1A2UA 2NTSA 3QG1A 3SK8A 1QOHA 3FMCA 5JOBA 2F0HA 2B2VA 4QMGA 3J7YW 3EFXD 1H9SA 1H9SB 1EFID 5EBDA 1WTQA 4IFDH 3E5SA 3HRZC 1RKNA 2BOSA 1Q3LA 1QG7A 1AN8A 1ILPA 1JC7A 4ZYSA 1SDFA 3J80L 1FNUA 2KCNA 4C56C 1T5XD 1LLRD 3FVQA 2BE5C 1NAPA 3DM1A 1TQOA 1AW7A 2Z1CA 1CA6A 3CRLC 2A69D 2FINB 5T1GA 1D1KA 4KKSA 5CV8A 3KLRA 2HCIA 1X3PA 4OGQC 1FNWA 1NR2A 2F0UA 1G2TA 1B9NA 4RGMA 2R6GA 3MA2B 4RWSC 3BYYB 5EPJA 2TSSA 5EPKA 5D14A 2G9DA 1LACA 3H91A 4FNFA 3DEPA 3P1HA 4ZKBB 1GHJA 2KA7A 1ENAA 1PXUA 2SEBD 3UI2A 5EKLA 3R8BA 4C1NK 2V4DA 1SNPA 1JICA 2VNUD 1BCPF 5I2XA 1ENFA 4LMQD 2H4OA 1F77A 1CFMA 1L0XB 1TU2B 1PFNA 3RZOB 1GUWA 2K6AA 2AUKA 1IW7C 4HTHA 2HCCA 5C4XB 5IGBA 2CVRA 3S14B 4WRDA 1K83B 2PW5A 3QOLA 1SMYD 2E2HB 3OHXC 1H9JA 1HXYD 3U9OA 4KN7C 3TP6A 5K5PA 5BN5A 4A3FB 1TWGB 1A6XA 2BA1A 3KLSX 2NYZD 3HG9A 2C9OA 4OO1I 2KECA 5G3LF 3X3NA 2B2UA 1LTRD 2QDBA 4P2CB 3CHBD 4HMJA 4HCEA 1MBYA 4N9PA 3EJIA 3DEOA 1AZQA 4LK1C 3MHBA 3C1EA 5TSSA 1AEXA 4FF4A 1LABA 4BA2I 2R3ZA 3Q22A 5D65A 3D8GA 1GUSA 1JR0D 3TP5A 1I4RA 2A6HD 1EEID 2WB1B 2F0FA 3GTJB 1LTAD 1ICWA 1U4LA 4K6LA 3Q0AA 1E2VA 4C3HB 4K5XA 4XYOA 3BYTB 1FD7D 2J0TD 4C3IG 2NUCA 5BN3A 1HUNA 1M8AA 5EJWA 1EY5A 1IL8A 2A69C 2F03A 3V96A 1DYQA 1JWSD 1KAAA 2AWNA 3HOZB 4XIGS 1IYUA 4KTAA 4FXKC 3S1RB 4RFBA 3NWSA 1V1OA 1TWCB 2E2IB 2DNCA 4KN4C 2F0PA 1Y1VB 5C0XJ 1EL0A 1B4OA 4CGYB 4V190 2GA4B 2XRQD 1DXMA 3LX0A 4XTCS 4A93B 3HOYB 3FKIB 1BDOA 2B63B 2XNAC 1Y8PB 2KOLA 2PPBC 1RTOA 1I3QB 3VR3A 5DM73 3ONAB 1LTBD 2ZXRA 2R61A 2M9VA 5KYLA 5IIFA 2K5DA 1ZXTA 2FHTA 3FRPB 3TBIB 4HAEA 5K36G 5F2DA 2F0GA 2J4XA 4QF4A 2B2YC 4FXDA 2NN6I 4XQNA 2RQXA 3RZDB 4IUNA 3M7GA 5AFWA 4BY7B 2IX0A 2CQAA 2F3WA 1EIGA 5HURA 3V2TA 1WTOA 4A3MB 2AQ2B 2L4NA 3S17B 1CHPD 4OIKA 5C3WA 4K5VA 4EQOA 1SE2A 1A3VA 1CHQD 2PZUA 3DWPA 1W6KA 3HZXA 1WCMB 3R93A 3TZUA 3GTKB 1D5ZC 3PIO3 3WOFA 3GTLB 4DAPA 4RHRA 1LTTD 3GP7A 1F2LA 1U9RA 2A6HC 1UUPA 3VYUA 1WD1A 2JEAI 5C44B 3MXUA 3PUZA 1PZJD 2HDLA 3K5LA 2Z8LA 4HR7B 1EY7A 5KEEA 1OXUA 3E0JA 3K6OA 3MXPA 1XX8A 4DK1A 1R9TB 3NP8A 1TS2A 5CYUA 5JJZA 4FO2A 1FYCA 2QCPX 4ZKCB 2IX3A 3MWYW 4O42A 3C46A 4MN3A 3T16A 5JEAJ 3QB3A 1EY9A 3J7AF 4Z9CB 1LV9A 4IFDG 3K5NA 1IHZA 4HMIA 4C3JG 2EJMA 4FXGC 2WV6D 3GTOB 4FYDA 1Q1EA 2XIWA 2KHSA 2Q8TA 4ULLA 3EQLC 1WTWA 3T4AC 1I4QA 1S5CD 3VA5A 2D5DA 1FGBD 3C1FA 5CORA 2E2DC 5DNFA 3VYSA 3IKJA 1TY0A 1I6VC 1DZ1A 4EQNA 1II3A 1A2TA 4QUCA 2BA0A 1QILA 1XWEA 4IFDJ 5M5XB 2ENBA 2SOBA 1DOLA 1S5BD 5I2YA 1B53A 3NBHA 5FLXL 2K05A 4OO1G 2EZVA 1EY6A 3S16B 1UNSA 1SE4A 2IL8A 1B3AA 5FK9C 3S2HB 3Q6SA 2JSOA 5JVH3 2K5WA 4H0LC 3AMUA 1JQYD 2PQEA 4F8MA 1EZ6A 4IUUA 1GUTA 1F2YA 3NSWA 1ML0D 1KNAA 3QWNA 3I4NB 3HKZB 2E2JB 2XRSD 2WP8J 1I6HB 1JE4A 3NQIA 1I50B 3QJYA 3BVGA 4CBVA 1O7LA 2WKDA 1HFNA 5T1IA 2QKIC 5M5YB 3OMGA 3FPPA 1DONA 4HN7A 3OWEB 1MGSA 2EYFA 1DOKA 1IKMA 4R8IA 2NVTB 4L63B 2AWOA 1DOMA 1CZWA 1I4HA 1QCBD 1STBA 1HA5A 2CHBD 1QB5D 1STEA 2IX1A 3MZ5A 3A8JE 3K57A 3M3YB 5CV7A 4RH6A 3T53B 2O5IC 3DWQA 2JXMB 4KKTA 5E4XA 3MVVA 3HGBA 2NWGA 1MD2D 2OXPA 1GJXA 1B44D 4ODGA 4DAYA 1U4RA 2I46A 2B2UC 5CBEE 1J8IA 1KLGD 1TKWB 1CQFA 2RSOA 2WACA 1BNZA 4AYBB 4CHTB 2DNEA 5CV4A 3BVZA 2L5TA 5CGKA 2B8FA 3D3RA 3PUYA 3DUZA 4PMCA 1GHKA 3M4YA 1G6ZA 4ZQ3A 4XQJA 2JA6B 1JCKB 2IJ0A 4HCSA 1PTOF 2O4XA 5JAVA 3HOXB 2F0EA 2SNMA 4DXGA 2F0OA 3CRKC 1CQVA 1HUMA 5EKIA 2KJXA 3K59A 1G291 3A54A 1RF2D 2HQEA 1A15A 3PIP3 3G6JB 3DMUA 1HTLD 4H44C 4B9XA 5IT9E 1WTPA 1X3QA 1H9RA 3ND8A 3CKIB 4R9WA 1F2MA 1H9MA 4B9WA 4PMBA 4KD3A 1SEBD 3SXHA 3OW7A 2NZ1D 3I90A 4RGOS 2ICIA 2A68C 3LWUA 3I73A 5FO8B 4OO1H 2F4IA 3DWAA 4YIJA 3D31A 1ET9A 2F0IA 3PO3B 4BBRB 1GUGA 1CZGA 1KABA 5BN4A 2FFKB 4TKOB 3HEJA 5M5WB 4F87A 2B2WC 1IKLA 3K7AB 1PZKD 1PDQA 3PUVA 3FDTA 4QIWB 4EGVA 4A3IB 1ESRA 3K58A 2F0WA 1XYIA 1Z7TA 4OHJA 2EYOA 1PRTD 3J81E 3PUXA 2B2TC 4G4KA 3SE0A 3NTKA 3S9WA 3IL8A 1PYWD 1BCPC 4GZYC 2QILA 2VUMB 2CW0C 2O2LD 4JBWA 3NK9A 2YYZA 3M85A 1UAPA 2NTTA 2EYLA 2EJGC 2IPKD 1O80A 2RDFA 1BF4A 1HTPA 1SE3A 4QB4A 2OF1A 2X69A 3HOWB 3OOCA 3MFYA 1K8OA 1U4MA 2X6LA 3HOVB 1E2ZA 2F0LA 2F0QA 1NR4A 1WTVA 2R92B 4U673 1EIHA 3HOUB 4RGTA 3URYA 4CKEA 3P75A 4Q0FA 3T56B 4FF2A 4R8NA 4A3DB 2XN9C 3A55A 1Y1WB 5J1ZA 3D4WA 4L8JA 5KYIA 1EOTA 3JAME 4DU9A 1ENCA 3I4MB 2K01A 5C4HA 4RKBA 1JWMD 1PTOB 4C3IB 4LAAA 1D6EC 1SAPA 3GTMB 1Z6HA 1TWHB 2AUJD 4PNYA 4XXEA 4DA2A 1LTGD 3VR5A 4BA1I 1BBXC 1VMPA 5CR3A 1A3TA 1LT5D 3QO2A 1FR3A 5E3FA 4RGNA 2NN6H 3VYTA 3H0GB 4KKUA 1EWCA 5E4WC 3MXGA 1BO0A 3WOEA 2ZXPA 4K14A 3EVQA 5JVG3 1I4XA 4IUVA 3OPOA 2ID0A 1C48A 4M1UB 3CU7A 2NBFA 3IFTA 2QF7A 3A7AB 2A74C 3BVMA 3N6RA 2ZT9C 2L0CA 1LTSD 2EYPA 5ELCA 5J22A 3LNNA 2XVSA 1PRTC 2PMZB 4RKLA 1HA6A 1FNVA 3GTGB 3C3LA 5A2QE 1GOZA 1LO5D 1OXTA 4OL7A 4JK1C 1ONLA 3OWFA 2R93B 1BOSA 2EYHA 4X3TA 1C8CA 4DGZA 1CM9A 2PW7A 3MFGA 4KY7A 2YU9B 2FJ2A 4H13C 2EY6A 1F9PA 2EYMA 1QJOA 3TP7A 2J7ZA 5C4ZA 5ISRA 5C5LA 2SNSA 1RD9D 1SNOA 4K5WA 1V8QA 1PZID 4HEDA 2VB2X 1W6JA 3G7LA 2F0VA 5I6WA 4KMUC 3VR6A 4ID6A 1X32A 1EU3A 2EE1A 5KNDA 1YNJC 4A3JB 1JOKA 4IZ8A 3EROA 2L1BA 2PCFB 2K1BA 4E6IA 5I9OA 1JOOA 3S1NB 1KLUD 4PV1C 1C4QA 2A6EC 3L9AX 1F9QA 3ERQA 4BS9A 3A56A 1EY0A 2BDNA 1YNNC 2L55A 1SSOA 5C3EB 4G7ZC 1SJED 1STHA 2SDFA 2FMMA 1DM0B 4RA8A 3VR2A 4X3SA 3PV0A 1R4QB 5JPMC 1V1PA 1Q12A 1V1PB 2MP1A 2XWJB 1WVLA 3I3CA 2D62A 2MUYA 4XT1B 2EDGA 3HP3A 2E76C 2K28A 4CJ1B 4ABNA 2B2YA 1STGA 3TDQA 1KDAA 1CTMA 1R4PB 2X6GA 4G7OC 1TWFB 5C0XI 1EU4A 3TMEA 2B2VC 1SNMA 5FKAC 3RD4A 3M7NA 5IOCA 3A7LA 4X3KA 1TT2A 5LHY1 1D5XC 4H7BA 2RDGA 4ZAIA 4V0BA 1F9SA 1SBBB 4KY5A 4TQUS 3MEHA 1EY4A 4A3GB 5ELEA 2K5QA 2AQ3B 3QOJA 2A68D 1DD2A 3IAYA 1GXDC 2B8GA 4CKCA 2Z4IA 3NUCA 2HUGA 4WFN3 1EY8A 1SNDA 1SJHD 3E6ZX 3LWEA 2ZXOA 2DY8A 2MGSA 1D5MC 3Q23A 2RA4A 4J6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R4P B;  1R4Q B;  3MXG A;  1CZW A;  1QNU A;  1D1K A;  4P2C B;  2BOS A;  1BOS A;  1D1I A;  1CZG A;  1QOH A;  2GA4 B;  1C4Q A;  1DM0 B;  1CQF A;  4ULL A;  2XSC A;  2C5C A;  1C48 A;  4M1U B; 
#chains in the Genus database with same CATH topology
 2LY7 A;  5I9P A;  1UEB A;  1E3P A;  3O13 A;  1N8R C;  4IUT A;  5EQ0 A;  3PUW A;  4IUP A;  2DN8 A;  1N32 L;  3PO2 G;  5LL6 S;  1WCM H;  1JOR A;  5KIX A;  2RSN A;  1BCP D;  4IUQ A;  2F0J A;  2EXZ A;  5ELB A;  3GTL H;  2F0T A;  4ME5 A;  3K0X A;  3K5O A;  3VR4 A;  3Q8D A;  2CW0 D;  4K2K A;  1XJV A;  3RUZ A;  4KHP Q;  4BBS B;  4HID A;  5DAU A;  2WAQ B;  2LFN A;  4QCL A;  4OXP A;  4LF9 L;  1HRJ A;  2D9U A;  4GKJ Q;  2G9H D;  2RKS A;  4DXF A;  1UE7 A;  1W3S A;  1Q90 A;  1A0I A;  3KUP A;  1Q1B A;  1PH9 A;  3GTP B;  4G57 A;  2QEX A;  2R7Z B;  1WOC A;  3SK5 A;  4XDX A;  2HT1 A;  3EIV A;  1VQC A;  2F0D A;  3NWT A;  2B39 A;  2KBN A;  2MJ8 A;  1DJR D;  5KNB A;  1YZ6 A;  3T13 A;  1R9T H;  3I4O A;  2ZTE A;  1VQ4 A;  4RCO A;  1M1K C;  4RCN A;  5IGG A;  3K80 C;  1SYF A;  1XNR Q;  4FF1 A;  2NB0 A;  3A8I E;  4JI1 Q;  5G3L D;  2PMZ E;  2UU9 L;  5LMU L;  1PH8 A;  4DNR B;  1L1O A;  1L1O B;  4XQQ A;  5KGU A;  1FJG Q;  1LT3 D;  4NP5 A;  4O1N A;  5IT9 L;  3H3V I;  4A3B B;  1V9P A;  3SK6 A;  3SDZ A;  2KVM A;  5ELF A;  2F0M A;  2Z6K A;  3CCQ A;  4I7A A;  2E5L L;  1CA5 A;  4DPG A;  4DF7 A;  4Q5V A;  2O5J C;  3GTO H;  2F0S A;  4JYA L;  4X3U A;  4ZCK A;  1RJT A;  1STY A;  2EY2 A;  3KK7 A;  4DR6 L;  1VMC A;  4AYB G;  1YJ9 A;  1S40 A;  5IGC A;  5I6Y A;  2JA8 B;  3BG3 A;  1E0B A;  1O7Z A;  1TVX A;  5EAY A;  1TY2 A;  3IRB A;  1N34 Q;  1GKH A;  4A3K B;  2I5H A;  3AB9 A;  4B3S L;  1ZKO A;  5FO7 B;  2HDM A;  2L12 A;  2JA6 G;  2NN6 G;  2RBM A;  1KXL A;  1LTI D;  3CCV A;  5EPL A;  3HOX G;  4LJZ C;  3WDN A;  3GD7 A;  3MTS A;  1CUK A;  1EWI A;  4B3R Q;  3DHQ A;  1LYL A;  2Q2I A;  3BS1 A;  1HPC A;  1K3B C;  4TVA B;  5EBC A;  3KF8 A;  3KF8 B;  1MSG A;  4MHE A;  4GKK L;  3J7A 5;  4IN3 A;  2GVA A;  4DK0 A;  3J81 L;  1SNQ A;  3RMH A;  5ELO A;  3EA6 A;  4Y7N B;  5M5X H;  3I8Z A;  4GLX A;  4P71 A;  5DEH A;  1SNC A;  3P7J A;  1EEF D;  4IFD I;  1KL9 A;  4EQP A;  3SR1 A;  1PTO C;  4X66 Q;  4A76 A;  1VQB A;  5NUC A;  3QIA A;  2JA7 B;  1RHP A;  4K2L A;  3J80 E;  2NVX B;  1MIU A;  4DV2 L;  4DV1 Q;  3L0O A;  3S16 H;  2BCO A;  2EY1 A;  1QWY A;  3H6M A;  2D2C C;  4WOR A;  1EUJ A;  4KD4 A;  3MXN A;  3PO3 G;  3MXN B;  3BU2 A;  5M3F B;  1NCV A;  1BUV T;  1HJP A;  5IOD A;  5IGD A;  4DV3 L;  5CV9 A;  2OEO A;  3S2H H;  4JI3 Q;  4J1M A;  4JW0 A;  2VQF Q;  3S24 A;  1JB7 A;  3CPF A;  5IGF A;  5C4X G;  1KNE A;  2F0N A;  4LF7 L;  4C2M B;  3IFD A;  4HIO A;  5I4D A;  1CT1 D;  5EKK A;  3X3M A;  3I4N H;  1I4P A;  2E74 C;  3NXW A;  1OXX K;  4YCW A;  4YCU A;  3KLW A;  3NTH A;  5KRU A;  2N55 A;  2E2J H;  4MTK A;  1XNQ L;  1EWH A;  4DR3 L;  1N33 L;  3CC7 A;  1N32 Q;  1VQP A;  1K0R A;  1I6H H;  1VF5 C;  4I65 A;  3A8K E;  1AZP A;  1I50 H;  3D6W A;  1PLF A;  4OEL B;  3SVM A;  3KBX A;  2VUM G;  4EX5 A;  1T5E A;  1HR0 L;  3NPP A;  1HNZ Q;  5HGT A;  5M5Y H;  3JAM L;  2PI2 E;  1HHV A;  4G7H C;  2M2L A;  3VYR A;  4LFC L;  3RNU A;  4GNX C;  4CDD C;  1VQM A;  4LF9 Q;  1XXG A;  1IXR A;  4KHV A;  4A75 A;  1G91 A;  2M00 A;  4TSS A;  1K73 C;  5GRO A;  1Y8N B;  2NVT H;  3BZD B;  4K0K L;  1GUN A;  3F2C A;  4A3E B;  2A73 B;  1X55 A;  2NVY B;  1QZH A;  3HOW G;  3I91 A;  3SEB A;  5FO9 B;  1QNK A;  5ELD A;  1TS5 A;  1Y8O B;  1VDZ A;  1L0Y B;  1YNJ D;  4R4I A;  3K0Y A;  2XSC A;  1B9M A;  4DNT B;  4M8A A;  3W1G A;  2OT2 A;  5CBA E;  3SHL A;  4GLA C;  2UU9 Q;  1A3U A;  5LMU Q;  1E2W A;  3M3Y H;  3VA7 A;  2R92 G;  2NVQ B;  1QNU A;  4KK7 A;  3HOU G;  1AP0 A;  4IJL A;  4C3H G;  2IW3 A;  4R4C A;  4N8F A;  3NQT A;  5GAH C;  2A6E D;  4UDU C;  2E5L Q;  5C0X G;  3CF5 A;  1SFO B;  1Q8I A;  4A3D G;  3GV6 A;  4DFA A;  3MAQ A;  2ZJR A;  3CAM A;  3H3V C;  4JYA Q;  4DR6 Q;  2Q8R E;  2WKC A;  3FHW A;  3I4M G;  1HNW L;  1YNN D;  2FXQ A;  4NB3 A;  5M9O A;  2Y0S E;  1EQR A;  4RG1 A;  1C7Y A;  4F7X A;  3HOZ G;  3NE5 B;  4DUZ L;  2QEJ C;  1K8G A;  2K14 A;  3KBG A;  1QVF A;  2QA4 A;  3TP8 A;  1ILQ A;  1V43 A;  1ESF A;  1HNX L;  3S1Q B;  4DK6 C;  4B3M Q;  5CV6 A;  3S2D B;  4CJ2 C;  2JA6 H;  3DXJ C;  1KAW A;  2C5C A;  4AQY Q;  4P72 A;  1U5K A;  5LMN L;  4KJO A;  2KCM A;  3HOX H;  4B3T L;  4S3S A;  3K5M A;  5A2Q L;  1EYD A;  2MPM A;  1YIJ A;  1S72 A;  4A93 G;  2B63 G;  1QE6 A;  1VQJ A;  2B2W A;  3R3O A;  5C6A A;  4ZLT F;  2Q8I B;  1I94 L;  4QJF A;  1ASY A;  3D6C A;  2KCC A;  1MI2 A;  3BDO A;  2EJF C;  1F9R A;  1PRT F;  3J7A V;  3I4L A;  2B2T A;  3AFQ A;  4DV2 Q;  4YWL A;  1CKN A;  1CKN B;  5FJ8 G;  3I72 A;  2K04 A;  4JG2 A;  4JI8 L;  3OYY A;  4CKB A;  1BCP B;  1SYE A;  2RVL A;  4N9T A;  4L5Q A;  1E22 A;  1VCI A;  2DY7 A;  1UE6 A;  3W5O A;  2CCZ A;  1HZC A;  1LTL A;  2H1E A;  4DV3 Q;  5LL6 X;  1PFM A;  1SMX A;  1ZEQ X;  4L6T B;  4QUF A;  4PQX A;  3PO3 H;  3L7Z C;  4J8Q A;  1Y69 U;  4BBR H;  2IHE A;  1STN A;  3T1Y L;  2HD3 A;  1IBK L;  3HS0 C;  1VF7 A;  3SK4 A;  2EY5 A;  3KF6 A;  4LF7 Q;  3KF6 B;  5M5W H;  5AJ3 L;  3RZO H;  5J39 A;  1PYS B;  3M4O B;  3CP0 A;  3D4D A;  4LW1 A;  4GN5 A;  3BJU A;  4BY7 G;  4IOC A;  3K7A H;  3S14 H;  4JBK A;  1SXT A;  1HCZ A;  1SMY C;  1JT8 A;  2DJF C;  4IAL A;  1JOQ A;  3TRZ A;  4A3I H;  1HQR D;  1OXS C;  3B6Y A;  4HSP A;  1S5D D;  2TMP A;  4KI0 A;  4B08 A;  2JA5 B;  3BDC A;  4A3M G;  1RDP D;  2DJG C;  1KD1 C;  3N52 A;  3H09 A;  5COY A;  3ND9 A;  2L15 A;  3D4R A;  5L37 A;  5M3M B;  4JVZ A;  4NMZ A;  1DCZ A;  1HR0 Q;  3TS0 A;  2MO0 A;  3RLF A;  3KLS A;  1PMR A;  1WI5 A;  1MKH A;  2VUM H;  1LT6 D;  4LFC Q;  1O7Y A;  2WII B;  1NNX A;  2I07 B;  3GV3 A;  4K8J A;  3W1B A;  4X62 L;  2VB3 X;  4NXM L;  5JEA G;  3NEN A;  5KNC A;  5DM6 3;  3NEM A;  2MHV A;  3J80 c;  2PNR C;  3W3A A;  3W2D A;  4QL5 A;  5C44 G;  1Q7Y C;  3OMC A;  4FF3 A;  5IYC G;  1A62 A;  3R2T A;  2IWH A;  4JI2 L;  4NW2 A;  1I4G A;  1S4Z A;  2RF4 A;  4A3J G;  2WIN B;  4C1N I;  3HOW H;  4DV7 L;  2K32 A;  1D2B A;  4K6D A;  4YY3 L;  1SYB A;  1XTC D;  4DN4 M;  2ZJP A;  4OX9 L;  1STA A;  2JE6 I;  4RAU C;  2AKW B;  2VXW A;  2FMC A;  2CKZ B;  5CC4 A;  5IGE A;  1ZYR D;  5FOB B;  3KJO A;  2R92 H;  3G6E A;  3HOU H;  3U9S A;  1EQV A;  4C3H H;  4DV0 L;  1K8M A;  3F2U A;  3CMA A;  4I7Z C;  5C0X H;  1X3G A;  2KED A;  4UP9 A;  4WJ4 A;  1P16 A;  4A3D H;  4K8I A;  3SGI A;  1IYV A;  3GQB A;  4KLK A;  1BBU A;  1CI3 M;  1BR9 A;  3STB D;  4X65 L;  4R4T A;  4EQ5 A;  5JPN C;  4FVM A;  2LS0 1;  1YHA A;  5C5M A;  3V05 A;  4C3J B;  4FP5 D;  1WTX A;  2PYK A;  3I4M H;  1B1Z A;  1CSQ A;  4NDX A;  1VQH A;  1PTO H;  4MIU A;  4C3I H;  2PZW A;  1HNX Q;  1K28 A;  1EZ8 A;  4IUR A;  1TII D;  3CCR A;  2EYJ A;  1SYG A;  2N88 A;  3GTM H;  1HH2 P;  1KDB A;  1TWH H;  3ITP A;  3NTI A;  5C4J B;  4P73 A;  3FEW X;  2L11 A;  4OWT B;  5CV5 A;  1AE3 A;  3D0F A;  2E2I H;  1CKM A;  4XYQ A;  4B3T Q;  4ZUI A;  2UXC L;  4KHZ A;  1ROD A;  3MC0 B;  4RHS A;  3S1M B;  2EPB A;  4KY6 A;  3TZD A;  4CJ0 B;  1Q46 A;  2DUD A;  2PI2 A;  2IT1 A;  1TR5 A;  4F88 A;  1PH3 A;  1PRT B;  1I94 Q;  3H0G H;  2JA9 A;  2AQ1 B;  5D3D A;  2CFM A;  3I70 A;  1BXT A;  3H94 A;  2BE5 D;  4JI6 Q;  1O78 A;  3CQZ B;  3L3O C;  3T51 B;  2JEB I;  3GTQ B;  2RHS B;  1L1O C;  1KDC A;  3ZYY X;  1ET6 A;  3Q24 A;  5JJI A;  4OEM B;  2N8N A;  2PZT A;  2Z6K C;  1WTR A;  3OIP A;  4JI8 Q;  1WD0 A;  4LFB Q;  4LUZ A;  3KJP A;  2A5H A;  2N49 A;  1OXV A;  2RDH A;  1SYD A;  1BQQ T;  2Q2T A;  1OO9 B;  3AU7 A;  3TSS A;  2HQL A;  3CME A;  4PMW A;  1J9O A;  1G8Z D;  2F1M A;  2F0K A;  1D1I A;  4KV6 A;  3T1Y Q;  2EOT A;  3S15 B;  1KQS A;  3L2P A;  4A3G G;  4ILW A;  4LNQ A;  1U4P A;  5EGT A;  1PTO D;  1TWA B;  2WB1 E;  1NSN S;  4ZRZ A;  5K36 H;  2XWB B;  1EQT A;  4YCV A;  4GN4 B;  1PVO A;  2BH2 A;  2BDO A;  3FPU B;  2PO4 A;  3OIQ A;  3GTG H;  4DAV A;  1PFB A;  4BY7 H;  1X56 A;  1BBW A;  2Y0S B;  1EYA A;  3I4N G;  1KTK A;  1CK1 A;  1MSH A;  4ZUJ A;  3HKZ G;  2H5X A;  2EVB A;  5C3X A;  2E75 C;  2JYO A;  2R93 H;  1RCV D;  1LT4 D;  2L9H A;  1NUC A;  3TRE A;  1XPO A;  4JOI C;  1G2S A;  1HFG A;  1GUO A;  4NKL A;  3WWV A;  4DR4 L;  3GO5 A;  4WJW A;  2K33 A;  1F2Z A;  1IW7 D;  1QUQ A;  1QUQ B;  3NHH A;  4X62 Q;  3GTK H;  4PG3 A;  4IQZ A;  5FLX E;  1B50 A;  1HR0 W;  2F3V A;  4APV A;  3H3V H;  1E24 A;  4TRD A;  1Z47 A;  4DR5 Q;  3BDL A;  1S5E D;  2LKV A;  1B2T A;  5JEA H;  4DR1 Q;  4JI2 Q;  2KQ3 A;  3PO2 B;  1KRS A;  1LUZ A;  2K03 A;  3NBI A;  3JAM i;  3KFU A;  2K7V A;  1UWV A;  4KJN A;  5CMD A;  5C44 H;  2R7D A;  1HQM C;  2KEE A;  2RCN A;  5IYC H;  1MJE A;  4YY3 Q;  2QW7 A;  1MJC A;  3PMF A;  1ZYR C;  2JP1 A;  3TN2 A;  2WAQ G;  2Z4H A;  4A3J H;  4DNI A;  3C2P A;  1TS4 A;  3P20 A;  3CCL A;  4ZK9 B;  4XT3 B;  1HZA A;  1PV4 A;  2KUM A;  1C9O A;  1RTN A;  2LMC B;  5A35 A;  4UAI A;  4EVO A;  2Z6B A;  1AH9 A;  2R7Z G;  1TS3 A;  3UDF A;  1EYC A;  1AFP A;  1H9K A;  5E1F A;  5IP7 G;  4U68 A;  3STB C;  1NMG A;  1UEA B;  1M4V A;  4BWG B;  4JBJ A;  3OSO A;  1S5F D;  3OTO Q;  1JB3 A;  3R2I A;  3M4Q A;  5D3I B;  1NTG A;  3TEH B;  3UDX A;  2ICE C;  4OIJ A;  1SYC A;  1JWU D;  4HSV A;  4BY1 B;  1A2U A;  4JV5 L;  2NTS A;  3QG1 A;  4LUO A;  4QGU A;  4LF5 Q;  3SK8 A;  1QOH A;  2V1C C;  3FMC A;  5JOB A;  1JJ2 A;  2F0H A;  2B2V A;  4QMG A;  1GD7 A;  3LGJ A;  2UXD L;  4DV6 Q;  3U58 A;  3J7Y W;  1QZG A;  1O7I A;  3EFX D;  1H9S A;  1H9S B;  1EFI D;  5EBD A;  1WTQ A;  4IFD H;  3E5S A;  3HRZ C;  1RKN A;  2BOS A;  4UPA A;  1Q3L A;  1QG7 A;  1AN8 A;  1ILP A;  1JC7 A;  4ZYS A;  2UXC Q;  1SDF A;  3J80 L;  2JA8 G;  5FLM G;  1FNU A;  2KCN A;  4C56 C;  1T5X D;  1LLR D;  3FVQ A;  4LF6 L;  5GAE C;  4A3K G;  2BE5 C;  1NAP A;  3DM1 A;  1TQO A;  5LMN W;  1AW7 A;  2Z1C A;  1CA6 A;  3CRL C;  3A74 A;  2A69 D;  2FIN B;  3M9B A;  2OQ0 A;  5T1G A;  1D1K A;  4KKS A;  5CV8 A;  3KLR A;  2HCI A;  2E8G A;  3U4Z A;  1X3P A;  4OGQ C;  1FNW A;  1NR2 A;  4DUY Q;  2F0U A;  4R4O A;  4QQB X;  1G2T A;  2A8V A;  1B9N A;  2B29 A;  3E3X A;  4RGM A;  1XTD A;  2R6G A;  2Z9H A;  3MA2 B;  4RWS C;  3BYY B;  5EPJ A;  2TSS A;  5EPK A;  5D14 A;  2G9D A;  2GVB A;  4LFA L;  1LAC A;  4YHH L;  4LF4 L;  2JA7 G;  3H91 A;  3OW2 A;  4FNF A;  3DEP A;  3EBE A;  4DV5 Q;  3P1H A;  4ZKB B;  4A3G H;  1GHJ A;  4BBR G;  2KA7 A;  1ENA A;  1PXU A;  2SEB D;  3UI2 A;  5EKL A;  1QVG A;  3R8B A;  4C1N K;  3PIO A;  3PQI A;  2V4D A;  1SNP A;  1JIC A;  2VNU D;  5M3F G;  1YVC A;  1J5E L;  1YJW A;  1BCP F;  5I2X A;  1ENF A;  4LMQ D;  2H4O A;  1XPR A;  1F77 A;  4JI5 L;  1CFM A;  3JC6 6;  1L0X B;  1TU2 B;  3A0J A;  4A3I G;  1PFN A;  3RZO B;  1GUW A;  2YTY A;  3MEF A;  1K0S A;  2K6A A;  2AUK A;  1IW7 C;  4HTH A;  2HCC A;  4HJ7 A;  5C4X B;  5IGB A;  2CVR A;  3S14 B;  1VQA A;  4IPG A;  4WRD A;  4YWM A;  1K83 B;  2PW5 A;  3QOL A;  2G5D A;  1SMY D;  2E2H B;  3OHX C;  1H9J A;  1HXY D;  3AFP A;  3U9O A;  4KN7 C;  2KEN A;  3TP6 A;  5BN5 A;  5K5P A;  4A3F B;  1D7Q A;  2CQO A;  3K81 C;  3CD6 A;  2IY5 B;  1TWG B;  1EYG A;  1A6X A;  2BA1 A;  3KLS X;  2NYZ D;  3HG9 A;  4POG A;  2C9O A;  4OO1 I;  3CCE A;  2KEC A;  5G3L F;  3X3N A;  2B2U A;  1LTR D;  2QDB A;  4P2C B;  3CHB D;  3K8A A;  4HMJ A;  4HCE A;  1MBY A;  4BBS H;  1B7Y B;  2VZA A;  4N9P A;  3EJI A;  3DEO A;  1AZQ A;  4LK1 C;  2K52 A;  2UUA L;  2YTX A;  3MHB A;  1I5F A;  3C1E A;  5TSS A;  5BR8 L;  1PFS A;  4A3E G;  2ATW A;  1AEX A;  4FF4 A;  1LAB A;  4BA2 I;  1JE5 A;  3GTP H;  2R7Z H;  3HOV G;  2R3Z A;  3Q22 A;  5D65 A;  3D8G A;  1GUS A;  2N78 A;  1JR0 D;  3TP5 A;  2C35 B;  5IP7 H;  4JV5 Q;  1I4R A;  1WTH A;  5IYB G;  2A6H D;  2CH4 A;  1EEI D;  3BZC A;  1VQL A;  1CSP A;  2I0Q A;  2WB1 B;  2F0F A;  3GTJ B;  1X3E A;  1JJG A;  2VQE L;  1LTA D;  1IL2 A;  4AH6 A;  1M90 C;  1ICW A;  4UP7 A;  1Y1W G;  1U4L A;  4K6L A;  3Q0A A;  2UXD Q;  1E2V A;  4CDC C;  1X54 A;  4C3H B;  4X64 L;  4K5X A;  2ASB A;  4XYO A;  3AQQ A;  3BYT B;  1FD7 D;  3UE1 A;  1L2F A;  2J0T D;  4C3I G;  2NUC A;  4JC0 A;  4NXN L;  1PH6 A;  4B3S Q;  1B8A A;  5BN3 A;  1M8A A;  1HUN A;  5EJW A;  1EY5 A;  5FLX c;  1IL8 A;  2A69 C;  1N9W A;  2F03 A;  3V96 A;  1DYQ A;  1JWS D;  1KAA A;  2AWN A;  2JA8 H;  4LF8 L;  2OTJ A;  5FLM H;  4H02 A;  3HOZ B;  2F4V L;  4XIG S;  1IYU A;  1WYD A;  4A3K H;  4KTA A;  2CH4 W;  4FXK C;  2AHO B;  3S1R B;  4RFB A;  3NWS A;  1V1O A;  1TWC B;  2E2I B;  2DNC A;  4GKK Q;  4KN4 C;  2F0P A;  2K5H A;  1J6Q A;  3H0G G;  1MHW C;  1WFQ A;  1Y1V B;  3RN5 A;  5C0X J;  1EL0 A;  2Q2U A;  1B4O A;  4CGY B;  4V19 0;  3E9I A;  2GA4 B;  2XTI A;  2XRQ D;  4OWX B;  1DXM A;  4WJ3 M;  3LX0 A;  1DGS A;  2K5V A;  4XTC S;  4A93 B;  3HOY B;  2K50 A;  3FKI B;  1BDO A;  2B63 B;  2XNA C;  1Y8P B;  2KOL A;  4YHH Q;  4Y7N H;  2PPB C;  1VQI A;  1RTO A;  1I3Q B;  3AYH B;  1EIY B;  3VR3 A;  5DM7 3;  3ONA B;  2HHH L;  1LTB D;  2ZXR A;  2R61 A;  2JA7 H;  2UXB L;  1YBY A;  2M9V A;  2R7F A;  5KYL A;  3I55 A;  2K75 A;  2OQK A;  5IIF A;  2K5D A;  1ZXT A;  2FHT A;  3FRP B;  3TBI B;  4HAE A;  5K36 G;  4GS3 A;  5F2D A;  2F0G A;  4JI5 Q;  2J4X A;  5M3F H;  4QF4 A;  2B2Y C;  1Q81 C;  3I56 A;  3ULP A;  4CDE C;  3J7Z C;  2UUB L;  4FXD A;  4Y52 H;  2NN6 I;  4GNX A;  4GNX B;  1VQG A;  1XNQ Q;  4XQN A;  4DR3 Q;  1PH1 A;  5IP9 H;  3QR8 A;  1VQE A;  1N33 Q;  4PZ7 A;  2RQX A;  2WFW A;  3RZD B;  4IUN A;  1GM5 A;  4DR7 L;  2R93 G;  3M7G A;  5AFW A;  4BY7 B;  3CXC A;  4C2M H;  5H1S E;  2QDL A;  2IX0 A;  2CQA A;  3BZK A;  1JMC A;  2JA5 G;  3T1H L;  2F3W A;  1EIG A;  5HUR A;  3V2T A;  4AYB E;  3RR5 A;  1WTO A;  4A3M B;  2AQ2 B;  2L4N A;  3S17 B;  1CHP D;  4OIK A;  5C3W A;  4X6A H;  4UP8 A;  2IHF A;  4K5V A;  1IBL L;  4EQO A;  1SE2 A;  1EQQ A;  1A3V A;  1CHQ D;  3U4V A;  2PZU A;  1V1Q A;  2MQH A;  3DWP A;  1W6K A;  3HZX A;  1WCM B;  3R93 A;  4K0K Q;  2Z0S A;  3TZU A;  3GTK B;  1D5Z C;  3PIO 3;  3WOF A;  2CWP A;  3GTL B;  4DAP A;  4POF A;  4OON A;  1LTT D;  4RHR A;  3GP7 A;  5BR8 Q;  4DK3 C;  1F2L A;  2YV5 A;  1U9R A;  2A6H C;  1ICF B;  1UUP A;  3VYU A;  1WD1 A;  2JEA I;  5C44 B;  3HFZ B;  3MXU A;  4A3E H;  2NVY H;  1PZJ D;  3PUZ A;  5IYD G;  2HDL A;  2OCE A;  3K5L A;  4DR2 L;  4JCV E;  3HOV H;  2Z8L A;  2JQO A;  4HR7 B;  1EY7 A;  5KEE A;  1OXU A;  3E0J A;  3K6O A;  4DKA C;  5IYB H;  3MXP A;  1XX8 A;  4DK1 A;  1R9T B;  2F52 A;  3NP8 A;  2NVQ H;  3RN2 A;  1TS2 A;  5CYU A;  5JJZ A;  4FO2 A;  1Y14 B;  2UUC L;  1FYC A;  2QCP X;  1HNW Q;  1Y1W H;  4ZKC B;  5C3E G;  2IX3 A;  1K3R A;  3G71 A;  3MWY W;  1SFO H;  4NXN Q;  4O42 A;  2ZM6 L;  3C46 A;  4DAM A;  4MN3 A;  3T16 A;  5JEA J;  1WJJ A;  3QB3 A;  1EY9 A;  4DUZ Q;  3J7A F;  1K8A C;  4Z9C B;  4L5T A;  1LV9 A;  4IFD G;  3K5N A;  4CDF C;  1IHZ A;  4HMI A;  4LF8 Q;  4C3J G;  1XNR L;  1BKB A;  4IPH A;  2F4V Q;  2EJM A;  4FXG C;  2WV6 D;  3GTO B;  4FYD A;  5LMN Q;  1Q1E A;  2XIW A;  4QIW E;  2KHS A;  2Q8T A;  1FJG L;  4ULL A;  1K9M C;  1PYB A;  3EQL C;  3F2D A;  1WTW A;  3S1Q H;  1SE8 A;  1UE1 A;  3S2D H;  3T4A C;  3G48 A;  4NPS A;  1I4Q A;  4P75 A;  3K7U C;  1S5C D;  3VA5 A;  2D5D A;  1FGB D;  3U50 C;  1C0A A;  3C1F A;  2PQA A;  2PQA B;  5COR A;  1BVS A;  3F2B A;  2E2D C;  5DNF A;  3VYS A;  3IKJ A;  1TY0 A;  3RLO A;  1I6V C;  5GAD C;  3J81 i;  1DZ1 A;  4EQN A;  1II3 A;  1A2T A;  4QUC A;  2BA0 A;  1QIL A;  1XWE A;  2HHH Q;  4IFD J;  5M5X B;  2ENB A;  2SOB A;  4B3R L;  2UXB Q;  1DOL A;  1S5B D;  5I2Y A;  1B53 A;  3NBH A;  3NBH B;  1NY4 A;  2AMC B;  1IBK Q;  2DGY A;  5FLX L;  5AJ3 Q;  1PHJ A;  2K05 A;  4OO1 G;  2EZV A;  3ER0 A;  1EY6 A;  3S16 B;  3JAM c;  1UNS A;  4R1J A;  4LWC A;  5ELN A;  1TXY A;  3CCU A;  4RMF A;  1SE4 A;  2IL8 A;  2NZO A;  1B3A A;  1P8L A;  1EFW A;  5FK9 C;  3S2H B;  3Q6S A;  2JSO A;  5JVH 3;  4JI4 L;  2K5W A;  4H0L C;  3AMU A;  1JQY D;  3T1H Q;  2PQE A;  4F8M A;  1EZ6 A;  1VQD A;  4IUU A;  1GUT A;  2Y0S G;  4HJA A;  1F2Y A;  3GDE A;  3NSW A;  1ML0 D;  2JA5 H;  1KNA A;  3QWN A;  1H95 A;  3I4N B;  2VQF L;  1B70 B;  3HKZ B;  4HIM A;  2E2J B;  3VDY A;  1W2B A;  2XRS D;  2YU9 H;  4NXM Q;  1X65 A;  1PH4 A;  3TS2 A;  2WP8 J;  1I6H B;  3KYH C;  1JE4 A;  3NQI A;  1I50 B;  3QJY A;  3BVG A;  4CBV A;  4GLV B;  1O7L A;  3PF5 A;  3E0E A;  2WKD A;  1HFN A;  5T1I A;  2QKI C;  5M5Y B;  3OMG A;  1CKO A;  4DV7 Q;  4BBS G;  3FPP A;  4OX9 Q;  1G51 A;  1N36 L;  1DON A;  4HN7 A;  3OWE B;  1MGS A;  2EYF A;  3F8T A;  4DR2 Q;  1DOK A;  1IKM A;  4R8I A;  4JI0 L;  2NVT B;  4L63 B;  2AWO A;  1HNZ L;  4A3L H;  3KOJ A;  1IBM L;  5IYD H;  3S1N H;  1DOM A;  4DV0 Q;  1CZW A;  1I4H A;  1E1T A;  1QCB D;  1STB A;  1HA5 A;  2CHB D;  1VQ5 A;  2UUC Q;  1QB5 D;  5HY6 A;  1FGU A;  4X65 Q;  1STE A;  2IX1 A;  3MZ5 A;  3A8J E;  2ZM6 Q;  3K57 A;  3M3Y B;  5CV7 A;  4RH6 A;  4BY1 G;  3T53 B;  2O5I C;  1JJC B;  5C3E H;  3DWQ A;  2JXM B;  4KKT A;  5E4X A;  2BH8 A;  4A3B G;  3MVV A;  3HGB A;  1VQO A;  2A1A A;  5JJL A;  2NWG A;  1MD2 D;  2OXP A;  1GJX A;  1B44 D;  4J15 A;  4ODG A;  4DAY A;  4DAY B;  1PA6 A;  1D8L A;  1U4R A;  4C3J H;  2I46 A;  4JPB W;  2B2U C;  5CBE E;  1J8I A;  1KLG D;  1TKW B;  1CQF A;  2RSO A;  2WAC A;  1BNZ A;  4AYB B;  4CHT B;  2DNE A;  5CV4 A;  3BVZ A;  4ME3 A;  2L5T A;  5CGK A;  5C4J H;  2B8F A;  3D3R A;  3PUY A;  3DUZ A;  2N3S A;  4PMC A;  1GHK A;  3M4Y A;  1A8V A;  1G6Z A;  4MTN A;  4ZQ3 A;  4XQJ A;  3S1M H;  2JA6 B;  1JCK B;  2IJ0 A;  4HCS A;  1PTO F;  2O4X A;  5JAV A;  3HOX B;  2F0E A;  2RCF A;  2SNM A;  4DXG A;  2F0O A;  3CRK C;  1CQV A;  1TWF H;  1HUM A;  5EKI A;  2CWA A;  2KJX A;  3K59 A;  1G29 1;  4B3M L;  3A54 A;  1NBW A;  3CCS A;  1QVC A;  1RF2 D;  4HJ8 A;  3CQZ H;  4AQY L;  1VQ7 A;  2HQE A;  1A15 A;  3PIP 3;  3GTQ H;  3G6J B;  3DMU A;  2RHQ B;  1HTL D;  4H44 C;  4B9X A;  5IT9 E;  4GOP A;  1WTP A;  4GOP B;  1X3Q A;  1H9R A;  3ND8 A;  2HIV A;  3CKI B;  4R9W A;  1F2M A;  1YI2 A;  1H9M A;  1X9N A;  4B9W A;  4PMB A;  4KD3 A;  1SEB D;  1SLJ A;  4JOI A;  3SXH A;  2JN4 A;  1NJI C;  3OW7 A;  2NZ1 D;  3UE0 A;  3I90 A;  4RGO S;  2ICI A;  4JI7 L;  3S15 H;  2A68 C;  3LWU A;  1XPU A;  3I73 A;  5FO8 B;  4OO1 H;  2F4I A;  3DWA A;  4YIJ A;  2LXK A;  3D31 A;  1ET9 A;  1TWA H;  3E9H A;  4JI4 Q;  2F0I A;  3PO3 B;  4BBR B;  1GUG A;  1CZG A;  1KAB A;  5BN4 A;  2FFK B;  4TKO B;  5IP9 G;  3HEJ A;  5M5W B;  2KHJ A;  4F87 A;  2VY3 A;  3CCJ A;  1NMF A;  2B2W C;  1YHQ A;  1E1O A;  1IKL A;  3K7A B;  1PZK D;  1U0L A;  4DR4 Q;  1PDQ A;  4DV4 L;  3PUV A;  1A63 A;  3FDT A;  1VQ6 A;  4QIW B;  4EGV A;  1X6O A;  1ESR A;  3DM3 A;  3K58 A;  4A3I B;  2F0W A;  1Q82 C;  1XYI A;  1NE3 A;  1Z7T A;  4OHJ A;  2EYO A;  2JJQ A;  1PRT D;  1UE5 A;  4HIK A;  3J81 E;  2XGT A;  3PUX A;  2B2T C;  4G4K A;  3SE0 A;  3NTK A;  3EN2 A;  3IL8 A;  3S9W A;  1PYW D;  4A3F G;  3J81 j;  1BCP C;  4GZY C;  2QIL A;  1ASZ A;  1LM0 A;  1XMQ L;  2VUM B;  2CW0 C;  1N36 Q;  2O2L D;  5GAG C;  4LUV A;  4JBW A;  3NK9 A;  2YYZ A;  4JI0 Q;  3M85 A;  3PF4 A;  1UAP A;  3PO2 H;  2NTT A;  2EYL A;  2EJG C;  1IBM Q;  2I5L X;  2IPK D;  4QY7 A;  1O80 A;  2RDF A;  3FP9 A;  1IZ6 A;  1HTP A;  1SE3 A;  4QB4 A;  1BF4 A;  4PZ6 A;  2K5N A;  4IOA A;  2OF1 A;  4BXX G;  2X69 A;  3HOW B;  3OOC A;  3MFY A;  2D0P A;  2VW9 A;  3RLN A;  1K8O A;  1U4M A;  2X6L A;  3HOV B;  1HZB A;  1E2Z A;  2F0L A;  2WB1 G;  2F0Q A;  1NR4 A;  1WTV A;  2R92 B;  4U67 3;  3PCO B;  3HOU B;  4BY1 H;  1EIH A;  4RGT A;  3URY A;  4CKE A;  3P75 A;  4Q0F A;  4A3B H;  5IY0 A;  3T56 B;  1KHI A;  4FF2 A;  4A3C G;  4R8N A;  4A3D B;  2ALY B;  2XN9 C;  3A55 A;  1Y1W B;  5J1Z A;  4ALP A;  3D4W A;  4L8J A;  3DLL A;  5KYI A;  3PSI A;  1EOT A;  3JAM E;  4DU9 A;  4LF6 Q;  1ENC A;  4L5S A;  3I4M B;  2K01 A;  5C4H A;  4RKB A;  1JWM D;  1PTO B;  1L0W A;  4C3I B;  3UDG A;  1VS0 A;  4LAA A;  1D6E C;  1SAP A;  5IWA L;  3GTM B;  3HKZ E;  1Z6H A;  1TWH B;  2AUJ D;  5GQO A;  4OWW B;  4PNY A;  4XXE A;  3A5U A;  4DA2 A;  1LTG D;  3VR5 A;  1SR3 A;  4R4Q A;  4BA1 I;  1BBX C;  1VMP A;  5CR3 A;  1A3T A;  1LT5 D;  4IPD A;  1RL2 A;  3QO2 A;  1FR3 A;  5E3F A;  4RGN A;  1SRO A;  1YHB A;  2NN6 H;  2ES2 A;  3CC2 A;  3VYT A;  1Y1V G;  3H0G B;  4KKU A;  2GN5 A;  1EWC A;  1YIT A;  1FVI A;  5E4W C;  4HJ5 A;  2F3I A;  2YTV A;  3MXG A;  4LFA Q;  4LF4 Q;  1BO0 A;  3HOY G;  1PH5 A;  3FKI G;  1KC8 C;  3KDF A;  3KDF B;  3WOE A;  2ZXP A;  4K14 A;  3EVQ A;  1GVP A;  5JVG 3;  1G6P A;  1I4X A;  2WAQ E;  4JI7 Q;  4IUV A;  4A4I A;  3OPO A;  2ID0 A;  2NVX H;  1VQK A;  4JI6 L;  1C48 A;  4M1U B;  3CU7 A;  1J5E Q;  2NBF A;  4GN3 B;  3IFT A;  2QF7 A;  4AIM A;  3A7A B;  2A74 C;  3BVM A;  3N6R A;  2ZT9 C;  2L0C A;  1LTS D;  1YEZ A;  2EYP A;  1KRT A;  4LFB L;  5ELC A;  1E7Z A;  5J22 A;  2PNH A;  2ZTD A;  3LNN A;  2K4K A;  2XVS A;  4MNO A;  1PRT C;  1Q86 C;  4DV4 Q;  2PMZ B;  4RKL A;  1HA6 A;  2VS1 A;  1FNV A;  3NEL A;  5HGQ A;  3GTG B;  3C3L A;  5A2Q E;  1GOZ A;  1LO5 D;  1XMO L;  1OXT A;  5C4X H;  4OL7 A;  4JK1 C;  1K83 H;  1ONL A;  3OWF A;  2R93 B;  1BOS A;  5M3M G;  2EYH A;  2E2H H;  4X3T A;  1C8C A;  4DGZ A;  4A3F H;  1XMQ Q;  1CM9 A;  2PW7 A;  3MFG A;  3M4P A;  4KY7 A;  1SN8 A;  1TWG H;  1VQF A;  2HIX A;  2YU9 B;  3CPW A;  2EQS A;  2FJ2 A;  4H13 C;  1VQ8 A;  2LXJ A;  5IT9 c;  2EY6 A;  1F9P A;  2EYM A;  1QJO A;  3TP7 A;  2UUA Q;  2J7Z A;  5C4Z A;  5ISR A;  1WCM G;  2EIF A;  5C5L A;  2SNS A;  1RD9 D;  1S3O A;  1SNO A;  4K5W A;  4IJH A;  1V8Q A;  3ULJ A;  3A5Z B;  1PZI D;  1EIF A;  4HED A;  1OTC A;  2VB2 X;  3H15 A;  1W6J A;  3G7L A;  2F0V A;  5I6W A;  4KMU C;  3VR6 A;  4ID6 A;  1X32 A;  4A3L G;  5DLQ E;  3AEV A;  1EU3 A;  2EE1 A;  5KND A;  1YNJ C;  4DR5 L;  4A3J B;  1KIX A;  1JOK A;  4BXX H;  2Q2H A;  4DR1 L;  4IZ8 A;  2VQE Q;  1B3Q A;  4KHP L;  3ERO A;  2A19 A;  2L1B A;  1VQ9 A;  1RIP A;  2PCF B;  2K1B A;  4E6I A;  5I9O A;  3UDI A;  1JOO A;  2KCT A;  3S1N B;  1KLU D;  4PV1 C;  4IO9 A;  4X64 Q;  1C4Q A;  2A6E C;  4GKJ L;  3ULL A;  4L5R C;  3L9A X;  1F9Q A;  4MZ9 A;  2VL6 A;  3GTJ H;  3CC4 A;  3HKS A;  3ERQ A;  3ICE A;  1HZ9 A;  4BS9 A;  3A56 A;  2ZJQ A;  3PIP A;  3J81 c;  1X3F A;  4A3C H;  1EY0 A;  2BDN A;  1YNN C;  2L55 A;  4PZ8 A;  1SSO A;  1FL0 A;  5C3E B;  1YNX A;  4G7Z C;  3OTO L;  2KHI A;  1SJE D;  1STH A;  4O0A A;  3CCM A;  2SDF A;  4JI1 L;  2FMM A;  2MO1 A;  5IWA Q;  2P5Z X;  1DM0 B;  4RA8 A;  1GO3 E;  4LF5 L;  2ZTC A;  3J80 i;  4JBM A;  3VR2 A;  4FDB A;  4O2D A;  4X3S A;  2MNA A;  3ZJY C;  3PV0 A;  1R4Q B;  3HOZ H;  5JPM C;  5IE8 A;  1V1P A;  1Q12 A;  1V1P B;  2MP1 A;  2XWJ B;  4DV6 L;  1WVL A;  2OWO A;  3S1R H;  3I3C A;  2D62 A;  2MUY A;  4XT1 B;  2EDG A;  3HP3 A;  1TWC H;  5J3B A;  2E76 C;  3I7F A;  4UHV A;  2K28 A;  1N34 L;  4CJ1 B;  4ABN A;  2D0O A;  2B2Y A;  1STG A;  1Y1V H;  3TDQ A;  4N8X 1;  4YWK A;  4P74 A;  1KDA A;  1CTM A;  1R4P B;  2X6G A;  4G7O C;  1TWF B;  5C0X I;  1EU4 A;  2JK8 A;  1SRU A;  2OTL A;  3TME A;  2B2V C;  2MFI A;  4A93 H;  3HOY H;  2LSS A;  3FKI H;  2I5M X;  2B63 H;  1SNM A;  5FKA C;  1Q8K A;  3RD4 A;  3M7N A;  3ERS X;  5IOC A;  3A7L A;  4X3K A;  1TT2 A;  1EOV A;  3G4S A;  1I3Q H;  3CW2 C;  5LHY 1;  1AE2 A;  1D5X C;  4UY8 C;  4IPC A;  1PH2 A;  4H7B A;  3PGZ A;  4DUY L;  2RDG A;  4ZAI A;  1Z9F A;  4V0B A;  2UUB Q;  1F9S A;  1SBB B;  2B3G A;  4KY5 A;  4TQU S;  3MEH A;  2QGQ A;  3TQY A;  5FJ8 H;  1EY4 A;  1T9H A;  4A3G B;  5ELE A;  4X66 L;  4HJ9 A;  4DR7 Q;  2K5Q A;  3M4O H;  2AQ3 B;  3QOJ A;  4DV1 L;  2A68 D;  1XMO Q;  1DD2 A;  4DV5 L;  3IAY A;  1GXD C;  3F1Z A;  1VQN A;  2B8G A;  1PH7 A;  3RZD H;  1YJN A;  4CKC A;  2Z4I A;  3NUC A;  4JI3 L;  2HUG A;  5JJK A;  3I2Z A;  1IBL Q;  4WFN 3;  1EY8 A;  1SND A;  1SJH D;  3E6Z X;  3LWE A;  5E7N A;  5M3M H;  2ZXO A;  4GOP C;  2DY8 A;  2MGS A;  1D5M C;  2NZH A;  3Q23 A;  4A3M H;  1IYJ B;  2RA4 A;  3S17 H;  2EXD A;  4J6H A; 
#chains in the Genus database with same CATH homology
 2LY7 A;  5I9P A;  3O13 A;  4IUT A;  5EQ0 A;  3PUW A;  4IUP A;  2DN8 A;  5LL6 S;  1JOR A;  5KIX A;  2RSN A;  1BCP D;  4IUQ A;  2F0J A;  2EXZ A;  5ELB A;  2F0T A;  4ME5 A;  3K5O A;  3VR4 A;  2CW0 D;  4K2K A;  3RUZ A;  4BBS B;  5DAU A;  2WAQ B;  2LFN A;  4QCL A;  1HRJ A;  2D9U A;  2G9H D;  2RKS A;  4DXF A;  1Q90 A;  3KUP A;  1Q1B A;  3GTP B;  4G57 A;  2R7Z B;  3SK5 A;  4XDX A;  2F0D A;  3NWT A;  2B39 A;  2MJ8 A;  1DJR D;  5KNB A;  3T13 A;  4RCO A;  4RCN A;  5IGG A;  1SYF A;  4FF1 A;  2NB0 A;  3A8I E;  5G3L D;  4DNR B;  4XQQ A;  5KGU A;  1LT3 D;  4NP5 A;  4O1N A;  5IT9 L;  4A3B B;  3SK6 A;  3SDZ A;  2KVM A;  5ELF A;  2F0M A;  1CA5 A;  4DF7 A;  4Q5V A;  2O5J C;  2F0S A;  4X3U A;  1RJT A;  1STY A;  2EY2 A;  3KK7 A;  1VMC A;  5IGC A;  5I6Y A;  2JA8 B;  3BG3 A;  1E0B A;  1O7Z A;  1TVX A;  1TY2 A;  4A3K B;  3AB9 A;  1ZKO A;  5FO7 B;  2HDM A;  2L12 A;  2NN6 G;  2RBM A;  1LTI D;  5EPL A;  4LJZ C;  3WDN A;  3GD7 A;  3MTS A;  3DHQ A;  3BS1 A;  1HPC A;  5EBC A;  3KF8 A;  1MSG A;  4MHE A;  4IN3 A;  4DK0 A;  3J81 L;  1SNQ A;  3RMH A;  3EA6 A;  4Y7N B;  3I8Z A;  5DEH A;  1SNC A;  3P7J A;  1EEF D;  4IFD I;  4EQP A;  3SR1 A;  1PTO C;  5NUC A;  3QIA A;  2JA7 B;  1RHP A;  4K2L A;  3J80 E;  2NVX B;  2BCO A;  2EY1 A;  1QWY A;  3H6M A;  2D2C C;  4WOR A;  4KD4 A;  3MXN A;  5M3F B;  1NCV A;  1BUV T;  5IOD A;  5IGD A;  5CV9 A;  2OEO A;  4J1M A;  5IGF A;  1KNE A;  2F0N A;  4C2M B;  3IFD A;  5I4D A;  1CT1 D;  5EKK A;  3X3M A;  1I4P A;  2E74 C;  3NXW A;  1OXX K;  3NTH A;  5KRU A;  2N55 A;  1EWH A;  1VF5 C;  4I65 A;  3A8K E;  1AZP A;  3D6W A;  1PLF A;  3SVM A;  3KBX A;  1T5E A;  3NPP A;  5HGT A;  3JAM L;  1HHV A;  4G7H C;  2M2L A;  3VYR A;  1XXG A;  4KHV A;  1G91 A;  2M00 A;  4TSS A;  1Y8N B;  3BZD B;  1GUN A;  4A3E B;  2A73 B;  2NVY B;  3I91 A;  3SEB A;  5FO9 B;  1QNK A;  5ELD A;  1TS5 A;  1Y8O B;  1VDZ A;  1L0Y B;  1YNJ D;  3K0Y A;  2XSC A;  1B9M A;  4DNT B;  4M8A A;  2OT2 A;  5CBA E;  3SHL A;  1A3U A;  1E2W A;  3VA7 A;  2NVQ B;  1QNU A;  4KK7 A;  1AP0 A;  4C3H G;  2IW3 A;  3NQT A;  2A6E D;  4UDU C;  5C0X G;  1SFO B;  1Q8I A;  3GV6 A;  4DFA A;  3MAQ A;  3H3V C;  2Q8R E;  2WKC A;  1YNN D;  5M9O A;  4F7X A;  3NE5 B;  2QEJ C;  3KBG A;  3TP8 A;  1ILQ A;  1V43 A;  1ESF A;  3S1Q B;  5CV6 A;  3S2D B;  4CJ2 C;  3DXJ C;  2C5C A;  4KJO A;  4S3S A;  3K5M A;  5A2Q L;  1EYD A;  2MPM A;  1QE6 A;  2B2W A;  3R3O A;  5C6A A;  4ZLT F;  2Q8I B;  3D6C A;  2KCC A;  1MI2 A;  3BDO A;  2EJF C;  1F9R A;  1PRT F;  3J7A V;  3I4L A;  2B2T A;  3I72 A;  2K04 A;  4CKB A;  1BCP B;  1SYE A;  2RVL A;  4N9T A;  1VCI A;  2DY7 A;  2H1E A;  5LL6 X;  1PFM A;  1ZEQ X;  4L6T B;  4QUF A;  4PQX A;  3L7Z C;  4J8Q A;  1Y69 U;  1STN A;  3HS0 C;  1VF7 A;  3SK4 A;  2EY5 A;  5J39 A;  3M4O B;  3D4D A;  1SXT A;  1HCZ A;  1SMY C;  4IAL A;  1JOQ A;  1HQR D;  1OXS C;  4HSP A;  1S5D D;  2TMP A;  4KI0 A;  4B08 A;  2JA5 B;  3BDC A;  1RDP D;  3N52 A;  3H09 A;  5COY A;  3ND9 A;  3D4R A;  5M3M B;  4NMZ A;  1DCZ A;  3RLF A;  3KLS A;  1PMR A;  1LT6 D;  1O7Y A;  2WII B;  2I07 B;  3GV3 A;  4K8J A;  2VB3 X;  5JEA G;  5KNC A;  5DM6 3;  2MHV A;  2PNR C;  3W3A A;  3W2D A;  4FF3 A;  3OMC A;  3R2T A;  2IWH A;  4NW2 A;  1I4G A;  1S4Z A;  2WIN B;  4C1N I;  2K32 A;  1D2B A;  4K6D A;  1SYB A;  1XTC D;  4DN4 M;  1STA A;  2JE6 I;  4RAU C;  2VXW A;  2FMC A;  5CC4 A;  5IGE A;  1ZYR D;  5FOB B;  3U9S A;  1EQV A;  1K8M A;  3F2U A;  4I7Z C;  5C0X H;  2KED A;  4K8I A;  1IYV A;  3GQB A;  1CI3 M;  1BR9 A;  5JPN C;  4FVM A;  2LS0 1;  5C5M A;  3V05 A;  4C3J B;  4FP5 D;  1WTX A;  2PYK A;  1B1Z A;  4NDX A;  1PTO H;  4MIU A;  2PZW A;  1EZ8 A;  4IUR A;  1TII D;  2EYJ A;  1SYG A;  2N88 A;  1KDB A;  3NTI A;  3ITP A;  5C4J B;  3FEW X;  2L11 A;  5CV5 A;  4XYQ A;  4ZUI A;  4KHZ A;  1ROD A;  3MC0 B;  4RHS A;  3S1M B;  2EPB A;  4KY6 A;  3TZD A;  4CJ0 B;  2IT1 A;  1TR5 A;  4F88 A;  1PRT B;  2AQ1 B;  5D3D A;  3I70 A;  1BXT A;  3H94 A;  2BE5 D;  1O78 A;  3CQZ B;  3L3O C;  3T51 B;  2JEB I;  3GTQ B;  1KDC A;  3ZYY X;  1ET6 A;  3Q24 A;  2PZT A;  1WTR A;  3OIP A;  1WD0 A;  2A5H A;  1OXV A;  2RDH A;  1SYD A;  1BQQ T;  1OO9 B;  3AU7 A;  3TSS A;  4PMW A;  1J9O A;  1G8Z D;  2F1M A;  2F0K A;  1D1I A;  4KV6 A;  3S15 B;  2EOT A;  4ILW A;  1U4P A;  5EGT A;  1PTO D;  1TWA B;  1NSN S;  4ZRZ A;  5K36 H;  2XWB B;  1EQT A;  2BDO A;  3FPU B;  2PO4 A;  3OIQ A;  4DAV A;  1PFB A;  2Y0S B;  1EYA A;  1KTK A;  1CK1 A;  1MSH A;  4ZUJ A;  2EVB A;  5C3X A;  2E75 C;  2JYO A;  1RCV D;  1LT4 D;  2L9H A;  1NUC A;  1G2S A;  1HFG A;  1GUO A;  4NKL A;  3GO5 A;  4WJW A;  2K33 A;  1F2Z A;  1IW7 D;  3NHH A;  4IQZ A;  5FLX E;  1B50 A;  2F3V A;  4TRD A;  1Z47 A;  3BDL A;  1S5E D;  2LKV A;  1B2T A;  5JEA H;  2KQ3 A;  3PO2 B;  2K03 A;  3NBI A;  2K7V A;  4KJN A;  5CMD A;  1HQM C;  2KEE A;  3PMF A;  1ZYR C;  2JP1 A;  3TN2 A;  2Z4H A;  3C2P A;  1TS4 A;  3P20 A;  4ZK9 B;  4XT3 B;  2KUM A;  1RTN A;  2LMC B;  5A35 A;  4UAI A;  4EVO A;  1TS3 A;  1EYC A;  1AFP A;  1H9K A;  5E1F A;  4U68 A;  1UEA B;  1M4V A;  4BWG B;  3OSO A;  1S5F D;  1JB3 A;  3R2I A;  5D3I B;  2ICE C;  4OIJ A;  1SYC A;  1JWU D;  4HSV A;  4BY1 B;  1A2U A;  2NTS A;  3QG1 A;  3SK8 A;  1QOH A;  3FMC A;  5JOB A;  2F0H A;  2B2V A;  4QMG A;  3J7Y W;  3EFX D;  1H9S A;  1H9S B;  1EFI D;  5EBD A;  1WTQ A;  4IFD H;  3E5S A;  3HRZ C;  1RKN A;  2BOS A;  1Q3L A;  1QG7 A;  1AN8 A;  1ILP A;  1JC7 A;  4ZYS A;  1SDF A;  3J80 L;  1FNU A;  2KCN A;  4C56 C;  1T5X D;  1LLR D;  3FVQ A;  2BE5 C;  1NAP A;  3DM1 A;  1TQO A;  1AW7 A;  2Z1C A;  1CA6 A;  3CRL C;  2A69 D;  2FIN B;  5T1G A;  1D1K A;  4KKS A;  5CV8 A;  3KLR A;  2HCI A;  1X3P A;  4OGQ C;  1FNW A;  1NR2 A;  2F0U A;  1G2T A;  1B9N A;  4RGM A;  2R6G A;  3MA2 B;  4RWS C;  3BYY B;  5EPJ A;  2TSS A;  5EPK A;  5D14 A;  2G9D A;  1LAC A;  3H91 A;  4FNF A;  3DEP A;  3P1H A;  4ZKB B;  1GHJ A;  2KA7 A;  1ENA A;  1PXU A;  2SEB D;  3UI2 A;  5EKL A;  3R8B A;  4C1N K;  2V4D A;  1SNP A;  1JIC A;  2VNU D;  1BCP F;  5I2X A;  1ENF A;  4LMQ D;  2H4O A;  1F77 A;  1CFM A;  1L0X B;  1TU2 B;  1PFN A;  3RZO B;  1GUW A;  2K6A A;  2AUK A;  1IW7 C;  4HTH A;  2HCC A;  5C4X B;  5IGB A;  2CVR A;  3S14 B;  4WRD A;  1K83 B;  2PW5 A;  3QOL A;  1SMY D;  2E2H B;  3OHX C;  1H9J A;  1HXY D;  3U9O A;  4KN7 C;  3TP6 A;  5K5P A;  5BN5 A;  4A3F B;  1TWG B;  1A6X A;  2BA1 A;  3KLS X;  2NYZ D;  3HG9 A;  2C9O A;  4OO1 I;  2KEC A;  5G3L F;  3X3N A;  2B2U A;  1LTR D;  2QDB A;  4P2C B;  3CHB D;  4HMJ A;  4HCE A;  1MBY A;  4N9P A;  3EJI A;  3DEO A;  1AZQ A;  4LK1 C;  3MHB A;  3C1E A;  5TSS A;  1AEX A;  4FF4 A;  1LAB A;  4BA2 I;  2R3Z A;  3Q22 A;  5D65 A;  3D8G A;  1GUS A;  1JR0 D;  3TP5 A;  1I4R A;  2A6H D;  1EEI D;  2WB1 B;  2F0F A;  3GTJ B;  1LTA D;  1ICW A;  1U4L A;  4K6L A;  3Q0A A;  1E2V A;  4C3H B;  4K5X A;  4XYO A;  3BYT B;  1FD7 D;  2J0T D;  4C3I G;  2NUC A;  5BN3 A;  1HUN A;  1M8A A;  5EJW A;  1EY5 A;  1IL8 A;  2A69 C;  2F03 A;  3V96 A;  1DYQ A;  1JWS D;  1KAA A;  2AWN A;  3HOZ B;  4XIG S;  1IYU A;  4KTA A;  4FXK C;  3S1R B;  4RFB A;  3NWS A;  1V1O A;  1TWC B;  2E2I B;  2DNC A;  4KN4 C;  2F0P A;  1Y1V B;  5C0X J;  1EL0 A;  1B4O A;  4CGY B;  4V19 0;  2GA4 B;  2XRQ D;  1DXM A;  3LX0 A;  4XTC S;  4A93 B;  3HOY B;  3FKI B;  1BDO A;  2B63 B;  2XNA C;  1Y8P B;  2KOL A;  2PPB C;  1RTO A;  1I3Q B;  3VR3 A;  5DM7 3;  3ONA B;  1LTB D;  2ZXR A;  2R61 A;  2M9V A;  5KYL A;  5IIF A;  2K5D A;  1ZXT A;  2FHT A;  3FRP B;  3TBI B;  4HAE A;  5K36 G;  5F2D A;  2F0G A;  2J4X A;  4QF4 A;  2B2Y C;  4FXD A;  2NN6 I;  4XQN A;  2RQX A;  3RZD B;  4IUN A;  3M7G A;  5AFW A;  4BY7 B;  2IX0 A;  2CQA A;  2F3W A;  1EIG A;  5HUR A;  3V2T A;  1WTO A;  4A3M B;  2AQ2 B;  2L4N A;  3S17 B;  1CHP D;  4OIK A;  5C3W A;  4K5V A;  4EQO A;  1SE2 A;  1A3V A;  1CHQ D;  2PZU A;  3DWP A;  1W6K A;  3HZX A;  1WCM B;  3R93 A;  3TZU A;  3GTK B;  1D5Z C;  3PIO 3;  3WOF A;  3GTL B;  4DAP A;  4RHR A;  1LTT D;  3GP7 A;  1F2L A;  1U9R A;  2A6H C;  1UUP A;  3VYU A;  1WD1 A;  2JEA I;  5C44 B;  3MXU A;  3PUZ A;  1PZJ D;  2HDL A;  3K5L A;  2Z8L A;  4HR7 B;  1EY7 A;  5KEE A;  1OXU A;  3E0J A;  3K6O A;  3MXP A;  1XX8 A;  4DK1 A;  1R9T B;  3NP8 A;  1TS2 A;  5CYU A;  5JJZ A;  4FO2 A;  1FYC A;  2QCP X;  4ZKC B;  2IX3 A;  3MWY W;  4O42 A;  3C46 A;  4MN3 A;  3T16 A;  5JEA J;  3QB3 A;  1EY9 A;  3J7A F;  4Z9C B;  1LV9 A;  4IFD G;  3K5N A;  1IHZ A;  4HMI A;  4C3J G;  2EJM A;  4FXG C;  2WV6 D;  3GTO B;  4FYD A;  1Q1E A;  2XIW A;  2KHS A;  2Q8T A;  4ULL A;  3EQL C;  1WTW A;  3T4A C;  1I4Q A;  1S5C D;  3VA5 A;  2D5D A;  1FGB D;  3C1F A;  5COR A;  2E2D C;  5DNF A;  3VYS A;  3IKJ A;  1TY0 A;  1I6V C;  1DZ1 A;  4EQN A;  1II3 A;  1A2T A;  4QUC A;  2BA0 A;  1QIL A;  1XWE A;  4IFD J;  5M5X B;  2ENB A;  2SOB A;  1DOL A;  1S5B D;  5I2Y A;  1B53 A;  3NBH A;  5FLX L;  2K05 A;  4OO1 G;  2EZV A;  1EY6 A;  3S16 B;  1UNS A;  1SE4 A;  2IL8 A;  1B3A A;  5FK9 C;  3S2H B;  3Q6S A;  2JSO A;  5JVH 3;  2K5W A;  4H0L C;  3AMU A;  1JQY D;  2PQE A;  4F8M A;  1EZ6 A;  4IUU A;  1GUT A;  1F2Y A;  3NSW A;  1ML0 D;  1KNA A;  3QWN A;  3I4N B;  3HKZ B;  2E2J B;  2XRS D;  2WP8 J;  1I6H B;  1JE4 A;  3NQI A;  1I50 B;  3QJY A;  3BVG A;  4CBV A;  1O7L A;  2WKD A;  1HFN A;  5T1I A;  2QKI C;  5M5Y B;  3OMG A;  3FPP A;  1DON A;  4HN7 A;  3OWE B;  1MGS A;  2EYF A;  1DOK A;  1IKM A;  4R8I A;  2NVT B;  4L63 B;  2AWO A;  1DOM A;  1CZW A;  1I4H A;  1QCB D;  1STB A;  1HA5 A;  2CHB D;  1QB5 D;  1STE A;  2IX1 A;  3MZ5 A;  3A8J E;  3K57 A;  3M3Y B;  5CV7 A;  4RH6 A;  3T53 B;  2O5I C;  3DWQ A;  2JXM B;  4KKT A;  5E4X A;  3MVV A;  3HGB A;  2NWG A;  1MD2 D;  2OXP A;  1GJX A;  1B44 D;  4ODG A;  4DAY A;  1U4R A;  2I46 A;  2B2U C;  5CBE E;  1J8I A;  1KLG D;  1TKW B;  1CQF A;  2RSO A;  2WAC A;  1BNZ A;  4AYB B;  4CHT B;  2DNE A;  5CV4 A;  3BVZ A;  2L5T A;  5CGK A;  2B8F A;  3D3R A;  3PUY A;  3DUZ A;  4PMC A;  1GHK A;  3M4Y A;  1G6Z A;  4ZQ3 A;  4XQJ A;  2JA6 B;  1JCK B;  2IJ0 A;  4HCS A;  1PTO F;  2O4X A;  5JAV A;  3HOX B;  2F0E A;  2SNM A;  4DXG A;  2F0O A;  3CRK C;  1CQV A;  1HUM A;  5EKI A;  2KJX A;  3K59 A;  1G29 1;  3A54 A;  1RF2 D;  2HQE A;  1A15 A;  3PIP 3;  3G6J B;  3DMU A;  1HTL D;  4H44 C;  4B9X A;  5IT9 E;  1WTP A;  1X3Q A;  1H9R A;  3ND8 A;  3CKI B;  4R9W A;  1F2M A;  1H9M A;  4B9W A;  4PMB A;  4KD3 A;  1SEB D;  3SXH A;  3OW7 A;  2NZ1 D;  3I90 A;  4RGO S;  2ICI A;  2A68 C;  3LWU A;  3I73 A;  5FO8 B;  4OO1 H;  2F4I A;  3DWA A;  4YIJ A;  3D31 A;  1ET9 A;  2F0I A;  3PO3 B;  4BBR B;  1GUG A;  1CZG A;  1KAB A;  5BN4 A;  2FFK B;  4TKO B;  3HEJ A;  5M5W B;  4F87 A;  2B2W C;  1IKL A;  3K7A B;  1PZK D;  1PDQ A;  3PUV A;  3FDT A;  4QIW B;  4EGV A;  4A3I B;  1ESR A;  3K58 A;  2F0W A;  1XYI A;  1Z7T A;  4OHJ A;  2EYO A;  1PRT D;  3J81 E;  3PUX A;  2B2T C;  4G4K A;  3SE0 A;  3NTK A;  3S9W A;  3IL8 A;  1PYW D;  1BCP C;  4GZY C;  2QIL A;  2VUM B;  2CW0 C;  2O2L D;  4JBW A;  3NK9 A;  2YYZ A;  3M85 A;  1UAP A;  2NTT A;  2EYL A;  2EJG C;  2IPK D;  1O80 A;  2RDF A;  1BF4 A;  1HTP A;  1SE3 A;  4QB4 A;  2OF1 A;  2X69 A;  3HOW B;  3OOC A;  3MFY A;  1K8O A;  1U4M A;  2X6L A;  3HOV B;  1E2Z A;  2F0L A;  2F0Q A;  1NR4 A;  1WTV A;  2R92 B;  4U67 3;  1EIH A;  3HOU B;  4RGT A;  3URY A;  4CKE A;  3P75 A;  4Q0F A;  3T56 B;  4FF2 A;  4R8N A;  4A3D B;  2XN9 C;  3A55 A;  1Y1W B;  5J1Z A;  3D4W A;  4L8J A;  5KYI A;  1EOT A;  3JAM E;  4DU9 A;  1ENC A;  3I4M B;  2K01 A;  5C4H A;  4RKB A;  1JWM D;  1PTO B;  4C3I B;  4LAA A;  1D6E C;  1SAP A;  3GTM B;  1Z6H A;  1TWH B;  2AUJ D;  4PNY A;  4XXE A;  4DA2 A;  1LTG D;  3VR5 A;  4BA1 I;  1BBX C;  1VMP A;  5CR3 A;  1A3T A;  1LT5 D;  3QO2 A;  1FR3 A;  5E3F A;  4RGN A;  2NN6 H;  3VYT A;  3H0G B;  4KKU A;  1EWC A;  5E4W C;  3MXG A;  1BO0 A;  3WOE A;  2ZXP A;  4K14 A;  3EVQ A;  5JVG 3;  1I4X A;  4IUV A;  3OPO A;  2ID0 A;  1C48 A;  4M1U B;  3CU7 A;  2NBF A;  3IFT A;  2QF7 A;  3A7A B;  2A74 C;  3BVM A;  3N6R A;  2ZT9 C;  2L0C A;  1LTS D;  2EYP A;  5ELC A;  5J22 A;  3LNN A;  2XVS A;  1PRT C;  2PMZ B;  4RKL A;  1HA6 A;  1FNV A;  3GTG B;  3C3L A;  5A2Q E;  1GOZ A;  1LO5 D;  1OXT A;  4OL7 A;  4JK1 C;  1ONL A;  3OWF A;  2R93 B;  1BOS A;  2EYH A;  4X3T A;  1C8C A;  4DGZ A;  1CM9 A;  2PW7 A;  3MFG A;  4KY7 A;  2YU9 B;  2FJ2 A;  4H13 C;  2EY6 A;  1F9P A;  2EYM A;  1QJO A;  3TP7 A;  2J7Z A;  5C4Z A;  5ISR A;  5C5L A;  2SNS A;  1RD9 D;  1SNO A;  4K5W A;  1V8Q A;  1PZI D;  4HED A;  2VB2 X;  1W6J A;  3G7L A;  2F0V A;  5I6W A;  4KMU C;  3VR6 A;  4ID6 A;  1X32 A;  1EU3 A;  2EE1 A;  5KND A;  1YNJ C;  4A3J B;  1JOK A;  4IZ8 A;  3ERO A;  2L1B A;  2PCF B;  2K1B A;  4E6I A;  5I9O A;  1JOO A;  3S1N B;  1KLU D;  4PV1 C;  1C4Q A;  2A6E C;  3L9A X;  1F9Q A;  3ERQ A;  4BS9 A;  3A56 A;  1EY0 A;  2BDN A;  1YNN C;  2L55 A;  1SSO A;  5C3E B;  4G7Z C;  1SJE D;  1STH A;  2SDF A;  2FMM A;  1DM0 B;  4RA8 A;  3VR2 A;  4X3S A;  3PV0 A;  1R4Q B;  5JPM C;  1V1P A;  1Q12 A;  1V1P B;  2MP1 A;  2XWJ B;  1WVL A;  3I3C A;  2D62 A;  2MUY A;  4XT1 B;  2EDG A;  3HP3 A;  2E76 C;  2K28 A;  4CJ1 B;  4ABN A;  2B2Y A;  1STG A;  3TDQ A;  1KDA A;  1CTM A;  1R4P B;  2X6G A;  4G7O C;  1TWF B;  5C0X I;  1EU4 A;  3TME A;  2B2V C;  1SNM A;  5FKA C;  3RD4 A;  3M7N A;  5IOC A;  3A7L A;  4X3K A;  1TT2 A;  5LHY 1;  1D5X C;  4H7B A;  2RDG A;  4ZAI A;  4V0B A;  1F9S A;  1SBB B;  4KY5 A;  4TQU S;  3MEH A;  1EY4 A;  4A3G B;  5ELE A;  2K5Q A;  2AQ3 B;  3QOJ A;  2A68 D;  1DD2 A;  3IAY A;  1GXD C;  2B8G A;  4CKC A;  2Z4I A;  3NUC A;  2HUG A;  4WFN 3;  1EY8 A;  1SND A;  1SJH D;  3E6Z X;  3LWE A;  2ZXO A;  2DY8 A;  2MGS A;  1D5M C;  3Q23 A;  2RA4 A;  4J6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...