1C48A

Mutated shiga-like toxin b subunit (g62t)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGTFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (SHIGA-LIKE TOXIN I B SUBUNIT)
publication title Identification of the Primary Receptor Binding Site of Shiga-Like Toxin B Subunits: Structures of Mutated Shiga-Like Toxin I B-Pentamer with and without Bound Carbohydrate
rcsb
source organism Phage h30
molecule tags Toxin
total genus 18
structure length 69
sequence length 69
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 1999-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1c48A00
1BOSA 1C4QA 1R4PB 3MXGA 1D1KA 1D1IA 4ULLA 1CZWA 1QOHA 1CQFA 2GA4B 1QNUA 2XSCA 1DM0B 2BOSA 4M1UB 2C5CA 1C48A 4P2CB 1CZGA 1R4QB
chains in the Genus database with same CATH superfamily
1BOSA 2F1MA 2HUGA 2Q2IA 3RZOB 4S3SA 3H3VH 3L9AX 3M4PA 3S24A 3MXGA 3NWTA 1GXDC 1TWAB 1RJTA 3J81L 1EU3A 5JJIA 3FKIH 3R2TA 1JB7A 3D3RA 2VB3X 5JEAG 4I65A 3JAME 5A2QE 1PA6A 4B3MQ 2WAQB 4FXDA 1O80A 1B9MA 5D3DA 4HSPA 1MKHA 3NUCA 4QL5A 1SFOH 4CDFC 4JI1Q 3SDZA 1EOVA 1YNNC 1V1PA 2R6GA 3GTQB 1IBLQ 2WB1G 4G57A 4IO9A 1I94Q 2QW7A 5IE8A 1HNWQ 2NVYB 5ELOA 1SYFA 3OWFA 1ONLA 4GNXC 1CHPD 3NELA 2HDLA 3H0GG 2NYZD 3FDTA 5HGQA 3OTOL 1SXTA 1LO5D 3PO2G 4M1UB 2CH4A 2F0VA 3R8BA 1E2ZA 3OPOA 2X6LA 2I07B 2RSOA 2HIXA 1XTDA 2ZTCA 1HXYD 2IL8A 1SFOB 4XQJA 2LFNA 3ICEA 2KENA 2EDGA 5IP9H 3PO3B 1TY0A 4R4QA 2M9VA 2LS01 4KTAA 4LF9L 1VQGA 2HHHL 5JOBA 2C5CA 3T1YL 1NJIC 4DV6Q 4GKKQ 5IGBA 2A1AA 3S16H 2EYMA 3U4VA 1E1TA 3E0EA 2KOLA 3AFPA 3BYTB 1UNSA 3H3VC 5C3XA 1K8MA 4GOPA 2RCNA 2UU9L 1FGBD 5FLXc 1H9JA 4HIKA 4PQXA 3S1RH 4DUZL 2N78A 3VDYA 1Q1BA 3MTSA 2NZHA 3BDOA 4PMBA 1YITA 1SNDA 4ODGA 3TMEA 4BY7G 5G3LD 2OQKA 4MN3A 1PFMA 2F52A 3BDCA 4C3JG 2K6AA 1DGSA 2Q8RE 4X3TA 2Z1CA 2MJ8A 2X6GA 2EYFA 2CH4W 2DY7A 3DMUA 4DR3L 3NEMA 3PV0A 4ALPA 1FVIA 4LWCA 4Q0FA 1TU2B 4DU9A 3OMGA 1VQLA 1S5BD 1NAPA 4X3SA 2D5DA 3TP6A 1EY9A 2L15A 4P71A 2E2JH 1S3OA 1EY8A 4PMWA 5CV6A 4XYQA 1B3QA 1Y8PB 4CGYB 4BY1H 1XYIA 1LV9A 2KCCA 4IN3A 2KCTA 5CGKA 3D4DA 1K28A 3OTOQ 1Y14B 3S1RB 2VUMH 3T13A 4ZLTF 2G9HD 1SRUA 1E3PA 3KLSA 4J1MA 2OEOA 1JOQA 1J9OA 4HIOA 5IGEA 1GKHA 1ENCA 3IKJA 1CA6A 3EFXD 4A3BH 1STAA 5CC4A 1HTLD 5E4XA 4DR4Q 5EPLA 3QOLA 5FLXE 1UAPA 4YWKA 1RKNA 4ZYSA 4LF9Q 4GZYC 1JT8A 2MP1A 2HHHQ 5C5MA 4DV4L 1FL0A 3T1YQ 1NR2A 2R7ZG 2E2JB 2B63B 1NE3A 1HFNA 1EIGA 1PH3A 4DN4M 1Q3LA 4RFBA 1S5ED 4OIJA 3FEWX 3TZUA 1SE4A 3V96A 1D6EC 4OONA 3CRLC 3TRZA 3I7FA 2UU9Q 4DAPA 2WFWA 1RF2D 2MGSA 2QDLA 3W2DA 2ZTDA 4A3LG 4DUZQ 1STNA 2JK8A 3I56A 1DOKA 4CKBA 3SXHA 4IJLA 4JBJA 5IYCG 4IPGA 2KUMA 1AW7A 5CORA 5L37A 3K59A 1RDPD 5C3EG 1OXSC 1STHA 2PNHA 3DLLA 1PTOF 1KD1C 4K6LA 1EFWA 3J7A5 4DR3Q 3I4MG 2XWJB 1BDOA 1V1QA 2PMZE 3BU2A 4KJNA 3K58A 2K5QA 3E3XA 3H0GH 2F0HA 2QCPX 5I6WA 2K1BA 1PV4A 1K3RA 1QZGA 1A15A 4HTHA 4LF8L 5C44H 3LWEA 4RCOA 4HIMA 3FPUB 2ES2A 4YIJA 1CKMA 5E1FA 1ESFA 2VS1A 4ILWA 3I4NH 2XN9C 4IUPA 5A2QL 4APVA 3G4SA 4OIKA 4RGTA 5ELDA 1BO0A 3F2BA 1VQEA 2B2VA 2EXZA 2IJ0A 2YV5A 1A3UA 2WINB 2NTTA 2JQOA 4G7ZC 4AQYL 3KBXA 2WB1B 2PZUA 4RHRA 5GAEC 1WTWA 3GDEA 4JYAQ 2VNUD 2UUAL 5EAYA 2JJQA 1KQSA 1TIID 3F2DA 1SYEA 2HDMA 4DV5L 1MBYA 3ULLA 1PRTC 5LL6X 2KEDA 2R92G 3H15A 1NSNS 2M00A 3PO2B 4YCWA 2QDBA 1PFBA 1SJHD 2E74C 4KKUA 1M1KC 1SR3A 4QGUA 1AE3A 2AKWB 3ERSX 1ASZA 1XNRL 4A3JG 1HZCA 1FNUA 2JYOA 1LYLA 1DOLA 1QUQA 2VZAA 3HKZG 4JI3L 3DEPA 1WTPA 2OF1A 1GO3E 1IW7D 1RD9D 1VQ7A 4Y7NH 1FR3A 5KNDA 3CC7A 1HA5A 2BDNA 1IKMA 2F0NA 1QZHA 3CD6A 3CMAA 3J81c 3STBD 3F8TA 2YTVA 2BE5D 3R93A 5C0XG 3U9SA 3M3YH 3CQZB 1LTSD 1LT3D 2F0QA 3DM1A 2Z6KC 1TWHH 3UDFA 4LF8Q 3OHXC 4GLAC 1G291 4BY7B 4C1NK 4J6HA 2JEAI 4A3GH 4A93G 3C1FA 1VQ5A 1CSPA 1QB5D 1AP0A 4C3JB 3ULPA 2AMCB 2F0FA 2L55A 1IYJB 1SYDA 2PNRC 4JW0A 3T4AC 4X3KA 1GOZA 1Q1EA 5E7NA 1QVGA 2V4DA 1ET6A 1PXUA 2I5LX 1YJNA 5C0XI 4AQYQ 3GTPH 3A56A 1J8IA 1LTAD 3HOUG 2PPBC 3ER0A 2UUAQ 1K3BC 2ZM6L 2R7ZH 1GUOA 3KOJA 4KY5A 2F0GA 1VQMA 4GLXA 4DV5Q 1QVFA 3M3YB 1PH5A 3TSSA 5KRUA 5FO9B 2B2TC 1UE1A 5KNCA 1A0IA 1CKNA 4R4OA 1K83B 4A3LH 2ENBA 1SE8A 3M85A 1AH9A 1AZQA 1VQNA 1F9PA 4IUQA 1EYDA 1I4QA 2F0DA 1VQOA 2LMCB 3J81E 4TQUS 5C4JB 4KHVA 5C3EH 1KLGD 5NUCA 3UDXA 4JG2A 2JE6I 1XNRQ 2K5WA 5E4WC 2WAQG 3HEJA 4RGNA 1E24A 4QUFA 4RMFA 2IX1A 1YHQA 2JP1A 4JI3Q 3I4MH 3BDLA 4LUZA 4BS9A 3GTMB 1I50H 1E0BA 4RKBA 4KD4A 5IGCA 2WKCA 1SJED 5J39A 4NXML 1EQTA 2EPBA 2CW0C 1STGA 2IHFA 3DWQA 2KBNA 2ATWA 3GTKH 3S2HB 3WOEA 1IL2A 2TMPA 3W1GA 4XT3B 1EOTA 2K03A 3H91A 1YI2A 3IFDA 3CCQA 2EY6A 4F8MA 1OXUA 1SNPA 3TEHB 2F03A 4OO1G 5KIXA 1TS4A 3NTHA 3KDFB 1JB3A 1EIFA 5ELNA 1AFPA 3P75A 4LUVA 5C3EB 4QUCA 1WVLA 1H9SB 3HS0C 5C3WA 1QOHA 4ZAIA 5I4DA 4A3IG 4FF1A 3GV6A 4KHZA 1HZBA 1JOKA 2R92H 4ME3A 2KJXA 3BG3A 3HRZC 3MEHA 1WYDA 1PH9A 2YTXA 5FOBB 2ZM6Q 4RKLA 1EY5A 1XMOL 3D0FA 2XVSA 2RF4A 2QEXA 5IYDG 1VQIA 4OO1I 4A3DB 1LTBD 3M9BA 3GTKB 2UUCL 4R8IA 3I72A 2ZXPA 1SROA 1SN8A 2HIVA 1BKBA 1Z6HA 2L4NA 4JBWA 4A3JH 1DCZA 1JE5A 4GNXA 3I70A 3VR5A 3GV3A 1BBXC 3VR2A 2N55A 4K5XA 4TSSA 2Z0SA 3CCMA 4PZ7A 2ZJRA 2L12A 3LGJA 1XTCD 2VB2X 4KI0A 5C0XH 3EJIA 2R92B 4X65L 1NBWA 1IYVA 2F3WA 1LABA 5FLMH 2AQ2B 2A68D 4NXMQ 3I73A 3M4QA 5F2DA 2CKZB 1E7ZA 2F0OA 1MD2D 2JEBI 4YWLA 4YCUA 3VR3A 3UDGA 5KEEA 2K50A 5J1ZA 1YVCA 4A93H 3HOYH 4JI0L 4AYBE 2AQ3B 3ITPA 4A3KB 3NTIA 3VYRA 2E2IB 4DV3L 2E76C 5ISRA 1HPCA 3HP3A 1TS5A 1L1OC 2EJGC 1BCPF 3HKZB 1UE5A 1EEFD 2A6ED 2XRQD 4QQBX 4K5VA 4LF7L 2MQHA 3HOUH 1BNZA 1SYBA 1RHPA 2JA7G 4NPSA 2GVBA 2Z4HA 1CZGA 4DNTB 1OXVA 1WTOA 1L2FA 1KABA 4C3IG 5EKKA 4A3EG 1HA6A 2AUKA 1KAWA 1CZWA 5GADC 1XMOQ 3HOXG 3RZOH 2B63G 3AB9A 3DHQA 3K6OA 3PMFA 4POFA 2X69A 4KY7A 1W3SA 1EZ8A 1TWAH 3ND8A 1VF7A 2B3GA 3CPFA 1G2SA 2UUCQ 1JWSD 5DLQE 4B9WA 3L0OA 3RLOA 5DEHA 3ZYYX 5EKIA 2WIIB 3HOUB 5C0XJ 3PUVA 3GTQH 1K9MC 5FK9C 1SAPA 3HOWG 1XNQL 2NVYH 3ERQA 4DV2L 3MXNA 4DXGA 4X65Q 4IOAA 1SYGA 3OOCA 1QWYA 5H1SE 2EZVA 1LLRD 4DR7L 3E6ZX 1UWVA 5IP7G 1EWHA 4OO1H 2LY7A 4FF2A 4JI0Q 1PZJD 4CHTB 2A69D 4DV3Q 4KLKA 2IWHA 1X56A 3AEVA 2H4OA 4A75A 1B50A 1VQJA 2D2CC 3KF8B 3RN2A 5M9OA 3K80C 1BVSA 3FRPB 2NBFA 4B08A 3S1MH 1FJGL 3PO3H 4LF7Q 1SNCA 3K81C 4QY7A 4LMQD 5COYA 3C3LA 1S5DD 1HUNA 1H9KA 1CA5A 1HCZA 2JA8G 1TWCH 2ZJPA 1VQFA 2F0JA 3EVQA 2IX0A 4ZK9B 5IYDH 3S14B 3TDQA 2PW5A 1VQ9A 4HEDA 3AFQA 1KLUD 2KA7A 5I9OA 3KJOA 3A55A 1VQBA 4P72A 1Q8KA 3BYYB 2ZTEA 4OX9L 1T5EA 1SNOA 1EYGA 4P2CB 4GLVB 1GUSA 1LTLA 3G6EA 5IT9L 3HG9A 4CDCC 2QKIC 4KHPL 2OTLA 2PYKA 4A3IB 1ASYA 3CCSA 2JA5G 1GHKA 3DEOA 1E22A 5JJZA 1V43A 3WDNA 3S1MB 3M4YA 3S17H 4NXNL 5FO8B 4FYDA 4DAVA 2N3SA 1PH4A 1FGUA 3GTLB 4UPAA 3CHBD 1PYBA 1TWCB 2Q8IB 1OXXK 3G71A 4RCNA 1Y1WG 4EQPA 4XXEA 1PZKD 1KXLA 1QE6A 3V2TA 1XNQQ 2O5JC 4DV2Q 2IW3A 4DFAA 1BBUA 4QMGA 1JJ2A 5M5XB 4N9PA 1VQHA 3PUYA 2I5MX 1A6XA 4DR7Q 2Y0SB 3I91A 1D5MC 2XTIA 5IODA 5KYIA 3QJYA 4LF6L 4XTCS 1EYCA 1YHAA 4DR6L 2VQEL 2OQ0A 1I4GA 2D9UA 3S2DB 3MFGA 2JA7H 2RKSA 3OIQA 3WWVA 2XIWA 3OIPA 2FHTA 1O7ZA 1HR0L 4R1JA 2ID0A 3TP7A 3X3NA 3S17B 1JWMD 4CJ1B 1B70B 1FJGQ 3MC0B 1JWUD 2MPMA 5M3MG 4A3EH 3T56B 1C7YA 2PZTA 5GAGC 5GQOA 3HFZB 1R9TB 2B63H 1T9HA 4PZ6A 1K0SA 3DM3A 4JCVE 2HCCA 2P5ZX 3HOZG 4C2MH 1PH2A 2F0EA 4HR7B 5JPNC 1MGSA 1HR0W 1K0RA 2UXDL 4OL7A 4J15A 4OX9Q 4CBVA 1FNVA 2L5TA 3KLRA 2Q8TA 4NW2A 5HY6A 1B8AA 3OSOA 4DK6C 2Z6KA 5T1IA 4KHPQ 1YJ9A 1ICFB 4LAAA 1Q8IA 2JA7B 3BVMA 1N32L 4V0BA 4IJHA 1TR5A 2O5IC 4C3IB 4NP5A 5M3FG 1PTOD 2XGTA 4BBSG 4NXNQ 1PYSB 2PO4A 4A3EB 2J4XA 2BDOA 1P8LA 2CVRA 1U4LA 1V1PB 2NWGA 2B39A 3NE5B 4KN4C 1KNEA 3HOXB 1HQRD 3BZKA 1A3VA 3TP5A 4OWXB 4JPBW 4C2MB 3T16A 3N52A 2KVMA 5CV7A 5JEAH 5LHY1 1VS0A 1YBYA 2ICIA 4DGZA 2N8NA 3X3MA 3E9HA 4IPDA 4DUYL 4P73A 1MHWC 1A2UA 4LF6Q 5GROA 1HZ9A 4LFAL 4DR6Q 2VQEQ 4RHSA 1O7IA 1X55A 1PTOB 2JA8H 3NBHB 3HOWB 2SOBA 4JC0A 1HR0Q 4YHHL 4PZ8A 1JE4A 4G7HC 3SGIA 1VQDA 2WV6D 2E2DC 4NMZA 4JI8L 4UAIA 5C5LA 1A62A 5K5PA 5BR8L 3L3OC 3PO2H 3E5SA 3NK9A 2TSSA 2B29A 2HD3A 2NVQB 4MZ9A 4A3DG 1IBKL 5BN3A 2NN6G 2UXDQ 1TWGB 4GOPB 2R93G 1PHJA 3RUZA 1X3FA 4LFBL 5FJ8G 1U5KA 1PRTF 3MEFA 3QOJA 3EROA 4QIWE 5T1GA 1M90C 2N49A 2JA8B 1N32Q 1Y1WH 3S9WA 3NTKA 3CXCA 1KC8C 2RA4A 1K8GA 1X3EA 3U58A 2EYJA 2BA1A 4DXFA 3VA7A 4H7BA 1S5CD 3CCLA 3CQZH 4XQQA 2F0WA 2NN6I 1YJWA 4XDXA 4DV4Q 2PZWA 1Y1VG 5JEAJ 4IFDG 1STYA 3PIPA 1BXTA 3W1BA 3KF6A 2I0QA 4BY7H 3FMCA 3CC4A 4LUOA 1C9OA 5EJWA 2EYOA 2F0SA 1I6VC 5BN5A 4A3KG 1X3PA 4C3JH 2JA5B 2A6HD 1ILQA 2CQOA 5LMNL 1EWIA 4ULLA 4GS3A 5EBCA 4DUYQ 2QF7A 3K5MA 3ZJYC 1WD1A 5M3MH 2I46A 3PF4A 1IBML 2WAQE 2YYZA 4XIGS 4LFAQ 1GHJA 2KHSA 4DK1A 4K6DA 1Y1WB 3A74A 4O2DA 3SK4A 4DK3C 4IFDI 3MA2B 1W6JA 1HNZL 4YHHQ 2E2HB 3J81j 1AEXA 1DJRD 3A8IE 3J7AF 4H02A 1FNWA 2OXPA 4C3HG 2F0IA 4JI4L 5LMNW 4JI8Q 2CCZA 2XRSD 5BR8Q 3I8ZA 2IHEA 3VR6A 5BN4A 3D31A 4JOIC 1K83H 2B2WC 5JVG3 3EIVA 5KNBA 4ZQ3A 2SNMA 3PUZA 3CCVA 2SNSA 2G9DA 4K5WA 1DOMA 5C4JH 4HJAA 1CKOA 1JCKB 1EUJA 2VXWA 3SHLA 1KDCA 4Y52H 4LFBQ 2Z6BA 1VQ6A 4JBMA 2RBMA 1DZ1A 1U4PA 5M3MB 3S15B 2K14A 1L1OA 2F0MA 1RTOA 3GTMH 3TREA 4Q5VA 3KBGA 3J7AV 4OEMB 2A19A 2RDGA 4LF5L 1YZ6A 5IT9c 4ABNA 1ZYRD 4BBRG 3HOZB 1U0LA 4FDBA 3Q23A 3ULJA 1X9NA 5IWAL 4K0KL 4YY3L 1BR9A 1EWCA 3S2HH 2YU9B 3RZDB 2Z4IA 1N34L 4HCEA 1F9RA 1X3QA 3MHBA 4JK1C 5IYCH 2E75C 3NP8A 3MXPA 4H13C 4PNYA 2R7DA 2MUYA 2FFKB 2ZJQA 1EQVA 2CQAA 1YNJD 1IW7C 1RODA 5LMNQ 1M8AA 3IFTA 5M3FB 2YTYA 4BBSB 2FMCA 1YEZA 1A2TA 2F4IA 3STBC 1C4QA 1WCMB 1NMGA 2BE5C 1YNXA 1IZ6A 3SK6A 3GTJH 4IUNA 1IBMQ 5CBAE 3B6YA 1KHIA 3S1NB 3R3OA 4K2KA 4WORA 3KK7A 1V1OA 1HNZQ 3SEBA 2EY5A 1L0YB 1IL8A 1DM0B 1NR4A 4A3DH 4JI4Q 3MVVA 2NN6H 2VW9A 5HGTA 1D2BA 1SDFA 1PZID 1GUNA 5FJ8H 3K7UC 3C46A 4BXXG 2NVTB 2QGQA 5FO7B 2D62A 4X6AH 3K0XA 3MXUA 1K8OA 5IT9E 2O4XA 1X6OA 4KD3A 3MFYA 1S4ZA 2EY1A 3S1QH 3KUPA 1QUQB 2F0TA 2PCFB 3GTJB 2PQAA 1B44D 4IUVA 1XPUA 2PQEA 1LT5D 4IFDH 1ML0D 3FKIG 2PW7A 2IX3A 4LF5Q 1JR0D 3H09A 4U673 1WOCA 1V8QA 1STBA 1ZEQX 2QEJC 3TP8A 5IWAQ 4A3KH 4YY3Q 2E2IH 4K0KQ 1HQMC 1SNMA 3LWUA 2R93B 1YHBA 1TVXA 1N34Q 5IIFA 1M4VA 4UP9A 4RG1A 1BCPD 2Y0SG 3QO2A 4ID6A 1G8ZD 1CT1D 2AWOA 4K8IA 4HMJA 3DWPA 1VQAA 3S1QB 1PLFA 5EQ0A 1I6HB 1MSGA 5EGTA 4HN7A 2LKVA 2PI2E 4OHJA 2K5DA 4KKSA 3UE1A 3NWSA 3QG1A 4IUTA 3W3AA 3SE0A 1DONA 1Y1VB 2BOSA 2C35B 3IL8A 3P20A 2ICEC 1JMCA 4R4TA 1IYUA 1CUKA 1D7QA 3DXJC 4TKOB 2F0UA 2A8VA 2EJFC 4OELB 2I5HA 5D3IB 2D0OA 1QJOA 4DR5L 2E5LL 4UP8A 4F88A 2OCEA 3A5UA 2NB0A 1BCPB 5JVH3 3D4RA 1O7LA 1G2TA 2EYHA 1LT4D 1HZAA 1XJVA 5IOCA 2CFMA 5HURA 1CKNB 5LMUL 4GN3B 2LXJA 3PIOA 1I3QH 2DJGC 3HOVB 1EIYB 3Q6SA 4I7ZC 4WJ4A 3NHHA 5C4HA 3PQIA 2KECA 1VQCA 1XPOA 1SMYD 4IURA 3TN2A 4IFDJ 3I90A 4A3FB 4HMIA 1PH7A 4ZCKA 4C3HB 2WB1E 2F3VA 3G7LA 1X54A 2F0LA 4MTNA 1BUVT 3U50C 4L5QA 3GTOH 3SR1A 2EXDA 4DAYB 1DXMA 2PMZB 3RR5A 3AQQA 3FVQA 2XSCA 1JJCB 1CSQA 1EFID 1JQYD 3D8GA 2JA6B 2RDFA 5C4XB 1ZXTA 4LFCL 1PFNA 1YNND 4MHEA 1TS2A 1KDAA 5K36G 4UP7A 4ZUIA 4A4IA 1EY7A 1I3QB 3UI2A 3M4OB 2EE1A 4LNQA 4RWSC 4C1NI 1F9QA 4WFN3 4R4IA 5ELCA 3K7AB 1XPRA 4KMUC 5JAVA 5JJKA 3PUXA 1H9MA 4ZRZA 2A68C 3J80i 4BBRB 3K0YA 4A76A 2JXMB 4RGOS 1Q12A 3S14H 2VUMG 4KKTA 1LM0A 1A3TA 2KCMA 2B8FA 1LTID 4DV1L 1F2YA 3A7AB 2N88A 5I2YA 4JBKA 3GTOB 2VQFL 4QB4A 1B1ZA 3K5OA 4EGVA 4A3BG 3WOFA 4P74A 4BXXH 3C2PA 5ELBA 3H94A 4DR5Q 1LUZA 4CDEC 1X65A 2E5LQ 2UXCL 1VQPA 5CBEE 4DKAC 1Q81C 5IY0A 4A3IH 3CAMA 5EKLA 4GNXB 3T53B 5LMUQ 4GKJL 1C0AA 2K7VA 2B2YC 3QIAA 3OYYA 4MTKA 4X62L 3FP9A 3GTLH 1XMQL 3LNNA 1HFGA 1T5XD 4NB3A 2Z9HA 3HGBA 1SYCA 3HZXA 5DM73 5CR3A 1KDBA 3KYHC 5D65A 1QVCA 1G51A 1KAAA 1W2BA 1F2LA 3VYTA 2B2UC 3CRKC 5M5XH 1B2TA 2OTJA 4AIMA 1S5FD 1GUTA 3LX0A 1MI2A 4DPGA 2IY5B 5ELEA 4B3RL 1RL2A 4XYOA 3NSWA 4ZUJA 4DV0L 4LFCQ 2NVXB 3NXWA 3CCRA 4JI5L 3S2DH 5D14A 2FJ2A 2RCFA 4G4KA 1TY2A 2KHIA 1EY4A 5C44G 4DF7A 2NZOA 4TRDA 2PI2A 1SEBD 1WTXA 3VYUA 4B3TL 3FKIB 2Z8LA 3I4NG 1R9TH 3NBHA 4DR2L 3BZCA 4J8QA 3EBEA 1AE2A 4KJOA 4LK1C 4DV7L 4DV1Q 2Q2TA 3A5ZB 1DYQA 2A69C 1KIXA 3NBIA 4HAEA 1CI3M 2VQFQ 5E3FA 3GD7A 3A54A 1N8RC 1NNXA 1GUWA 4FF3A 1RTNA 2ZT9C 1Q46A 1VQ4A 3BS1A 3JAMi 4N9TA 4L8JA 1EZ6A 2KEEA 2AHOB 3TBIB 2F4VL 2UXCQ 1VQKA 4LW1A 2K01A 3RLFA 2A74C 4GKJQ 1VQ8A 4C3IH 1U4RA 4L63B 5CMDA 1ILPA 2VL6A 4X62Q 2H5XA 2MO0A 3EQLC 1OO9B 4L6TB 1PH6A 2RDHA 1CFMA 3OMCA 1XMQQ 3HOXH 3RNUA 3EA6A 3TS2A 1TWFH 5JJLA 4A3CG 1PVOA 2K32A 4FVMA 1HHVA 4YWMA 4DNIA 2K4KA 3EN2A 1X32A 3C1EA 3Q0AA 5ELFA 2IT1A 3J80L 3MXNB 3CKIB 3ND9A 5K36H 1I4PA 3A8KE 1QNKA 3RLNA 5A35A 2LSSA 1K8AC 2FINB 3RMHA 3CW2C 4O42A 4B3RQ 4JOIA 3UE0A 2B2WA 1LTTD 3S16B 3KJPA 2WACA 4DV0Q 2OWOA 1ZKOA 1PH1A 1PTOH 3QB3A 4JI5Q 3AYHB 5IGDA 5I9PA 3TS0A 3HOWH 2EY2A 4K14A 1Q90A 3PIO3 2RVLA 5G3LF 1WCMG 1X3GA 2K75A 4OGQC 3FHWA 4ZKBB 3M7GA 4A3GG 4B3TQ 1Z47A 1I4RA 1TWFB 3ONAB 5IP7H 4JYAL 1B3AA 4A3MG 4DR2Q 5EPJA 2KQ3A 2RHQB 4PV1C 2NVQH 2ZXOA 1U9RA 4DV7Q 1WD0A 3JC66 1NY4A 5CYUA 2BH2A 2WKDA 1EU4A 4PG3A 4WJ3M 3F2CA 1TWGH 2B2TA 1H95A 4F7XA 2BH8A 1J6QA 2FMMA 5M5YH 4IUUA 2VY3A 1KL9A 2GVAA 1PRTD 4PMCA 4BY1B 3HKZE 2F4VQ 3CC2A 2K28A 1PMRA 3M7NA 2VUMB 1AZPA 4IALA 2JA9A 3K57A 4IQZA 4JI6L 3F1ZA 1I4HA 3I4LA 2F3IA 4A3BB 1N9WA 1L0WA 1EEID 1P16A 1SNQA 4OXPA 2F0PA 4N8FA 4FO2A 3PGZA 1LT6D 5C6AA 1G91A 1EIHA 1NUCA 4HSVA 1CM9A 4H44C 2K5NA 2QA4A 2JA5H 3CMEA 1PRTB 4AYBB 5M5YB 1KNAA 1F9SA 1TKWB 3T1HL 4HJ9A 1KRTA 2XWBB 1HJPA 3BJUA 1PTOC 4FF4A 3CP0A 4O0AA 4CJ0B 1OTCA 2DNEA 1Y8NB 5J3BA 2EVBA 3Q22A 3JAML 1K73C 1EYAA 1PDQA 3PSIA 1O7YA 4G7OC 2E2HH 3MZ5A 3IRBA 3I2ZA 3L2PA 3SK8A 4FXGC 3L7ZC 1EY6A 2CHBD 2WP8J 4N8X1 4BA1I 2MFIA 4IPCA 4RH6A 4Z9CB 4OWTB 4X66L 1VCIA 4EQ5A 5IYBG 2SDFA 4WRDA 4V190 2EYPA 4JV5L 4GOPC 5GAHC 1STEA 1F77A 2L1BA 3URYA 2AQ1B 4EVOA 1XXGA 3H0GB 2E8GA 2FXQA 2DUDA 2ZXRA 4R9WA 4CKEA 5KYLA 5C44B 1GD7A 3S15H 3HOVG 1ENAA 4E6IA 4POGA 2R3ZA 2AWNA 3KDFA 1QCBD 4RAUC 5LL6S 3I4NB 4ME5A 1H9SA 1G6ZA 5CV9A 1TT2A 1H9RA 1PH8A 2UUBL 3CCUA 4A3CH 1O78A 5M5WH 4A3FG 1MSHA 1GM5A 3HOZH 4DK0A 1XWEA 3FPPA 4U68A 2KCNA 3QR8A 4JI6Q 1VMPA 4JVZA 3J7YW 1F2ZA 2KHJA 2YU9H 1EQRA 1S72A 3U4ZA 3RZDH 4NKLA 3PUWA 1VF5C 3BVGA 1WTQA 2JA6G 3SVMA 1IBKQ 5C4XG 1ESRA 3K5LA 1Z9FA 1CQVA 3D6CA 1SSOA 1QG7A 1N36L 5M3FH 5FKAC 4R8NA 2CW0D 4B9XA 3T1HQ 5FLMG 4BBSH 1D1IA 1WCMH 1LTRD 5IGGA 4BWGB 2ALYB 2RHSB 3BZDB 3S1NH 3HOYG 2IPKD 1IXRA 2K5HA 1HH2P 1ICWA 5AFWA 4LF4L 1JOOA 5M5WB 3OW2A 3G48A 4A3MH 3P1HA 1B4OA 5IGFA 2EIFA 1IHZA 1NCVA 1R4QB 5CV8A 1LACA 1D5XC 4JI2L 3PCOB 2GN5A 3E0JA 1GVPA 4DA2A 4Y7NB 2A6HC 1HUMA 4H0LC 4KV6A 2D0PA 1E1OA 4X66Q 2HQLA 4MIUA 2JN4A 2O2LD 2K52A 4DR1L 2NVTH 1UEAB 4JV5Q 2C9OA 1E2WA 4QCLA 2V1CC 4AH6A 4EX5A 2Y0SE 3R2IA 4I7AA 4FP5D 3CF5A 2EYLA 4B3SL 3AMUA 1I5FA 2JSOA 1TWHB 4LJZC 2DY8A 1SMXA 2J7ZA 3VR4A 2K5VA 1C8CA 4A3GB 4R4CA 5I6YA 1ENFA 3I55A 1RIPA 3F2UA 3RN5A 2L0CA 4P75A 4A3MB 1Q7YC 1PYWD 2UUBQ 1KRSA 4RGMA 1JORA 2EJMA 5EBDA 2DGYA 1YIJA 3RD4A 5FLXL 4JI7L 1HRJA 1MJCA 1CTMA 1C48A 2UXBL 3GTPB 1HTPA 2R93H 1V9PA 2CWAA 1N33L 1IKLA 1E2VA 3KLSX 3T51B 1PFSA 1WI5A 2HT1A 4DAYA 2R7ZB 2Q2UA 4UHVA 1I4XA 1D1KA 2L9HA 3KF6B 3DWAA 3SK5A 1BQQT 1CHQD 2NTSA 1HNXL 2SEBD 4EQOA 2B2VC 2NZ1D 4XQNA 1UUPA 3D6WA 1U4MA 2A5HA 4NDXA 3W5OA 4DAMA 4L5TA 1N36Q 1I6HH 1AN8A 3KLWA 3I3CA 3J80c 4HJ8A 1J5EL 1ZYRC 2K04A 3Q24A 3NENA 2OT2A 1F2MA 1SE2A 2MO1A 4C56C 1RCVD 3G6JB 3AU7A 1CK1A 2B2YA 2RQXA 1Y1VH 4K8JA 4LF4Q 1B53A 5IYBH 2XNAC 1MIUA 4HCSA 4O1NA 4UDUC 3OWEB 4TVAB 3I4MB 4JI2Q 4CKCA 1I50B 3GQBA 3PO3G 1W6KA 1LTGD 1YNJC 2CWPA 2Q2HA 3MWYW 4ZKCB 4FNFA 3MAQA 1TXYA 2B2UA 3J81i 3E9IA 3HOVH 3H3VI 2DNCA 4DR1Q 4IZ8A 2ASBA 4WJWA 5KGUA 3J7ZC 3CPWA 4B3SQ 3CCJA 1Y69U 3KF8A 1UE6A 4A3FH 5CV4A 4C3HH 2EQSA 1A63A 1L1OB 4RA8A 4CDDC 4IOCA 3IAYA 2BA0A 3DUZA 1Y8OB 3K5NA 3U9OA 3NQIA 3CU7A 2K33A 4K2LA 1KTKA 1L0XB 1UEBA 2JA6H 1R4PB 1XX8A 3UDIA 1FD7D 2LXKA 4GN4B 4JI7Q 3A7LA 1GJXA 1D5ZC 1II3A 1A8VA 5C4XH 1SLJA 2UXBQ 5IP9G 3OW7A 4HJ5A 3J80E 4M8AA 1N33Q 1TQOA 3P7JA 2EOTA 4KN7C 1NMFA 3TQYA 4L5RC 3GTGH 1TS3A 5TSSA 5AJ3L 4X64L 1NTGA 4IPHA 2GA4B 3PIP3 1GUGA 2H1EA 4DR4L 1B9NA 3M4OH 1Q82C 1EQQA 1JICA 4X3UA 2BCOA 2QILA 3NQTA 1HNXQ 1MJEA 1EY0A 1UE7A 4OWWB 3K7AH 4F87A 2M2LA 1BF4A 4A3JB 1B7YB 4BBRH 1SE3A 2HQEA 5I2XA 4B3ML 2NUCA 3I4OA 5C4ZA 1S40A 3QWNA 1SBBB 1J5EQ 3NPPA 3KFUA 4JI1L 1VDZA 2B8GA 4DNRB 5J22A 2DJFC 1IBLL 3CCEA 4UY8C 4GN5A 1I94L 1DD2A 2R61A 4HJ7A 1FYCA 1BCPC 1HNWL 5JPMC 4QF4A 4L5SA 5DM63 3GP7A 1JJGA 4KK7A 1Z7TA 1WTVA 1EL0A 3VYSA 3JAMc 3Q8DA 2AUJD 3GTGB 4BA2I 1G6PA 2L11A 3D4WA 2F0KA 1JC7A 3BVZA 1BBWA 4A93B 2MHVA 3HOYB 4EQNA 1WJJA 4FXKC 4BY1G 3K8AA 2A73B 4QIWB 5DAUA 3N6RA 3GO5A 1QILA 3A0JA 1WTRA 2HCIA 5DNFA 1ET9A 1Q86C 4KY6A 2PQAB 4QJFA 2DN8A 1WFQA 2G5DA 5EPKA 3VA5A 1OXTA 4XT1B 5CV5A 3PF5A 4DV6L 4CJ2C 2R7FA 2MNAA 1CQFA 4GKKL 2A6EC 1WTHA 3TZDA 2J0TD 1QNUA 1VMCA 2RSNA 3O13A 3A8JE 2K05A 4HIDA 4YCVA 2NVXH 3H6MA 4MNOA 1D8LA 1SMYC 3V05A 4AYBG 4X64Q 3HKSA 5AJ3Q
chains in the Genus database with same CATH topology
1BOSA 2F1MA 2HUGA 3RZOB 4S3SA 3L9AX 3MXGA 3NWTA 1GXDC 1TWAB 1RJTA 3J81L 1EU3A 3R2TA 3D3RA 2VB3X 5JEAG 4I65A 3JAME 5A2QE 2WAQB 4FXDA 1O80A 1B9MA 5D3DA 4HSPA 3NUCA 3SDZA 1YNNC 1V1PA 2R6GA 3GTQB 4G57A 2NVYB 1SYFA 3OWFA 1ONLA 1CHPD 2HDLA 2NYZD 3FDTA 1SXTA 1LO5D 4M1UB 2F0VA 3R8BA 1E2ZA 3OPOA 2X6LA 2I07B 2RSOA 1HXYD 2IL8A 1SFOB 4XQJA 2LFNA 3PO3B 2EDGA 1TY0A 2M9VA 2LS01 4KTAA 5JOBA 2C5CA 5IGBA 2EYMA 2KOLA 3BYTB 1UNSA 3H3VC 5C3XA 1K8MA 1FGBD 1H9JA 4PQXA 1Q1BA 3MTSA 3BDOA 4PMBA 1SNDA 4ODGA 3TMEA 5G3LD 4MN3A 1PFMA 3BDCA 4C3JG 2K6AA 2Q8RE 4X3TA 2Z1CA 2MJ8A 2X6GA 2EYFA 2DY7A 3DMUA 3PV0A 4Q0FA 1TU2B 4DU9A 3OMGA 1S5BD 1NAPA 4X3SA 2D5DA 3TP6A 1EY9A 1EY8A 4PMWA 5CV6A 4XYQA 1Y8PB 4CGYB 1XYIA 1LV9A 2KCCA 4IN3A 5CGKA 3D4DA 3S1RB 3T13A 4ZLTF 2G9HD 3KLSA 4J1MA 2OEOA 1JOQA 1J9OA 5IGEA 1ENCA 3IKJA 1CA6A 3EFXD 1STAA 5CC4A 1HTLD 5E4XA 5EPLA 3QOLA 5FLXE 1UAPA 1RKNA 4ZYSA 4GZYC 2MP1A 5C5MA 1NR2A 2E2JB 2B63B 1HFNA 1EIGA 4DN4M 1Q3LA 4RFBA 1S5ED 4OIJA 3FEWX 3TZUA 1SE4A 3V96A 1D6EC 3CRLC 4DAPA 1RF2D 2MGSA 3W2DA 1STNA 1DOKA 4CKBA 3SXHA 2KUMA 1AW7A 5CORA 3K59A 1RDPD 1STHA 1OXSC 1PTOF 4K6LA 2XWJB 1BDOA 4KJNA 3K58A 2K5QA 2F0HA 2QCPX 5I6WA 2K1BA 1A15A 4HTHA 3LWEA 4RCOA 3FPUB 4YIJA 5E1FA 1ESFA 4ILWA 2XN9C 4IUPA 5A2QL 4OIKA 4RGTA 5ELDA 1BO0A 2B2VA 2EXZA 2IJ0A 1A3UA 2WINB 2NTTA 4G7ZC 3KBXA 2WB1B 2PZUA 4RHRA 1WTWA 2VNUD 1TIID 1SYEA 2HDMA 1MBYA 1PRTC 5LL6X 2KEDA 1NSNS 2M00A 3PO2B 2QDBA 1PFBA 1SJHD 2E74C 4KKUA 1FNUA 2JYOA 1DOLA 3DEPA 1WTPA 2OF1A 1IW7D 1RD9D 1FR3A 5KNDA 1HA5A 2BDNA 1IKMA 2F0NA 2BE5D 3R93A 5C0XG 3U9SA 3CQZB 1LTSD 1LT3D 2F0QA 3DM1A 3OHXC 1G291 4BY7B 4C1NK 4J6HA 2JEAI 3C1FA 1QB5D 1AP0A 4C3JB 2F0FA 2L55A 1SYDA 2PNRC 3T4AC 4X3KA 1GOZA 1Q1EA 2V4DA 1ET6A 1PXUA 5C0XI 3A56A 1J8IA 1LTAD 2PPBC 1GUOA 4KY5A 2F0GA 3M3YB 3TSSA 5KRUA 5FO9B 2B2TC 5KNCA 1K83B 2ENBA 3M85A 1AZQA 1F9PA 4IUQA 1EYDA 1I4QA 2F0DA 2LMCB 3J81E 4TQUS 5C4JB 4KHVA 1KLGD 5NUCA 2JE6I 2K5WA 5E4WC 3HEJA 4RGNA 4QUFA 2IX1A 2JP1A 3BDLA 4BS9A 3GTMB 1E0BA 4RKBA 4KD4A 5IGCA 2WKCA 1SJED 5J39A 1EQTA 2EPBA 2CW0C 1STGA 3DWQA 3S2HB 3WOEA 2TMPA 4XT3B 1EOTA 2K03A 3H91A 3IFDA 2EY6A 4F8MA 1OXUA 1SNPA 2F03A 4OO1G 5KIXA 1TS4A 3NTHA 1JB3A 1AFPA 3P75A 5C3EB 4QUCA 1WVLA 1H9SB 3HS0C 5C3WA 1QOHA 4ZAIA 5I4DA 4FF1A 3GV6A 4KHZA 1JOKA 2KJXA 3BG3A 3HRZC 3MEHA 5FOBB 4RKLA 1EY5A 2XVSA 4OO1I 4A3DB 1LTBD 3GTKB 4R8IA 3I72A 2ZXPA 4JBWA 1Z6HA 2L4NA 1DCZA 3I70A 3VR5A 3GV3A 1BBXC 3VR2A 2N55A 4K5XA 4TSSA 2L12A 1XTCD 2VB2X 4KI0A 5C0XH 3EJIA 2R92B 1IYVA 2F3WA 1LABA 2AQ2B 2A68D 3I73A 5F2DA 2F0OA 3VR3A 1MD2D 2JEBI 5KEEA 5J1ZA 2AQ3B 3ITPA 4A3KB 3NTIA 3VYRA 2E2IB 2E76C 5ISRA 1HPCA 3HP3A 1TS5A 2EJGC 1BCPF 3HKZB 1EEFD 2A6ED 2XRQD 4K5VA 1BNZA 1SYBA 1RHPA 2Z4HA 1CZGA 4DNTB 1OXVA 1WTOA 1KABA 4C3IG 5EKKA 1HA6A 2AUKA 1CZWA 3AB9A 3DHQA 3K6OA 3PMFA 2X69A 4KY7A 1EZ8A 1VF7A 3ND8A 1G2SA 1JWSD 4B9WA 5DEHA 3ZYYX 5EKIA 2WIIB 3HOUB 5C0XJ 3PUVA 5FK9C 1SAPA 3ERQA 3MXNA 4DXGA 1SYGA 3OOCA 1QWYA 2EZVA 1LLRD 3E6ZX 1EWHA 4OO1H 2LY7A 4FF2A 1PZJD 4CHTB 2A69D 2IWHA 2H4OA 1B50A 2D2CC 5M9OA 3FRPB 2NBFA 4B08A 1SNCA 4LMQD 5COYA 3C3LA 1S5DD 1HUNA 1H9KA 1CA5A 1HCZA 2F0JA 3EVQA 2IX0A 4ZK9B 3S14B 3TDQA 2PW5A 4HEDA 1KLUD 2KA7A 5I9OA 3A55A 3BYYB 1T5EA 1SNOA 4P2CB 1GUSA 5IT9L 3HG9A 2QKIC 2PYKA 4A3IB 1GHKA 3DEOA 5JJZA 1V43A 3WDNA 3S1MB 3M4YA 5FO8B 4FYDA 4DAVA 3GTLB 3CHBD 1TWCB 2Q8IB 1OXXK 4RCNA 4EQPA 4XXEA 1PZKD 1QE6A 3V2TA 2O5JC 2IW3A 4DFAA 4QMGA 5M5XB 4N9PA 3PUYA 1A6XA 2Y0SB 3I91A 1D5MC 5IODA 5KYIA 3QJYA 4XTCS 1EYCA 1I4GA 2D9UA 3S2DB 3MFGA 2RKSA 3OIQA 2XIWA 3OIPA 2FHTA 1O7ZA 3X3NA 2ID0A 3TP7A 3S17B 1JWMD 4CJ1B 3MC0B 1JWUD 2MPMA 3T56B 2PZTA 1R9TB 2HCCA 2F0EA 4HR7B 5JPNC 1MGSA 4OL7A 4CBVA 1FNVA 2L5TA 3KLRA 2Q8TA 4NW2A 3OSOA 5T1IA 4LAAA 1Q8IA 2JA7B 3BVMA 4V0BA 1TR5A 2O5IC 4C3IB 4NP5A 1PTOD 2PO4A 4A3EB 2J4XA 2BDOA 2CVRA 1U4LA 1V1PB 2NWGA 2B39A 3NE5B 4KN4C 1KNEA 3HOXB 1HQRD 1A3VA 3TP5A 4C2MB 3T16A 3N52A 2KVMA 5CV7A 5JEAH 5LHY1 2ICIA 4DGZA 3X3MA 1A2UA 4RHSA 1PTOB 3HOWB 2SOBA 1JE4A 4G7HC 2WV6D 2E2DC 4NMZA 4UAIA 5C5LA 5K5PA 3L3OC 3E5SA 3NK9A 2TSSA 2NVQB 5BN3A 2NN6G 1TWGB 3RUZA 1PRTF 3QOJA 3EROA 5T1GA 2JA8B 3S9WA 3NTKA 2RA4A 2EYJA 2BA1A 4DXFA 3VA7A 4H7BA 1S5CD 4XQQA 2F0WA 2NN6I 4XDXA 2PZWA 5JEAJ 4IFDG 1STYA 1BXTA 3FMCA 5EJWA 2EYOA 2F0SA 1I6VC 5BN5A 1X3PA 2JA5B 2A6HD 1ILQA 4ULLA 5EBCA 2QF7A 3K5MA 1WD1A 2I46A 2YYZA 4XIGS 1GHJA 2KHSA 4DK1A 4K6DA 1Y1WB 3SK4A 4IFDI 3MA2B 1W6JA 2E2HB 1AEXA 1DJRD 3A8IE 3J7AF 1FNWA 2OXPA 4C3HG 2F0IA 2XRSD 3I8ZA 3VR6A 5BN4A 3D31A 2B2WC 5JVG3 5KNBA 4ZQ3A 2SNMA 3PUZA 2SNSA 2G9DA 4K5WA 1DOMA 2VXWA 1JCKB 3SHLA 1KDCA 2RBMA 1DZ1A 1U4PA 5M3MB 3S15B 2F0MA 1RTOA 4Q5VA 3KBGA 3J7AV 2RDGA 4ABNA 1ZYRD 3HOZB 3Q23A 1BR9A 1EWCA 2YU9B 3RZDB 2Z4IA 4HCEA 1F9RA 1X3QA 3MHBA 4JK1C 2E75C 3NP8A 3MXPA 4H13C 4PNYA 2MUYA 2FFKB 1EQVA 2CQAA 1YNJD 1IW7C 1RODA 1M8AA 3IFTA 5M3FB 4BBSB 2FMCA 1A2TA 2F4IA 1C4QA 1WCMB 2BE5C 3SK6A 4IUNA 5CBAE 3S1NB 3R3OA 4K2KA 4WORA 3KK7A 1V1OA 3SEBA 2EY5A 1L0YB 1IL8A 1DM0B 1NR4A 3MVVA 2NN6H 5HGTA 1D2BA 1SDFA 1PZID 1GUNA 3C46A 2NVTB 5FO7B 2D62A 3MXUA 1K8OA 5IT9E 2O4XA 4KD3A 3MFYA 1S4ZA 2EY1A 3KUPA 2F0TA 2PCFB 3GTJB 1B44D 4IUVA 2PQEA 1LT5D 4IFDH 1ML0D 2PW7A 2IX3A 1JR0D 3H09A 4U673 1V8QA 1STBA 1ZEQX 2QEJC 3TP8A 1HQMC 1SNMA 3LWUA 2R93B 1TVXA 5IIFA 1M4VA 1BCPD 3QO2A 4ID6A 1G8ZD 1CT1D 2AWOA 4K8IA 4HMJA 3DWPA 3S1QB 1PLFA 5EQ0A 1I6HB 1MSGA 5EGTA 4HN7A 2LKVA 4OHJA 2K5DA 4KKSA 3NWSA 3QG1A 4IUTA 3W3AA 3SE0A 1DONA 1Y1VB 2BOSA 3P20A 3IL8A 2ICEC 1IYUA 3DXJC 4TKOB 2F0UA 2EJFC 5D3IB 1QJOA 4F88A 2NB0A 1BCPB 5JVH3 3D4RA 1O7LA 1G2TA 2EYHA 1LT4D 5IOCA 5HURA 3HOVB 3Q6SA 4I7ZC 3NHHA 5C4HA 2KECA 1SMYD 4IURA 3TN2A 4IFDJ 3I90A 4A3FB 4HMIA 4C3HB 2F3VA 3G7LA 2F0LA 1BUVT 3SR1A 1DXMA 2PMZB 3FVQA 2XSCA 1JQYD 3D8GA 1EFID 2JA6B 2RDFA 5C4XB 1ZXTA 1PFNA 1YNND 4MHEA 1TS2A 1KDAA 5K36G 4ZUIA 1EY7A 1I3QB 3UI2A 3M4OB 2EE1A 4RWSC 4C1NI 1F9QA 4WFN3 5ELCA 3K7AB 4KMUC 5JAVA 3PUXA 1H9MA 4ZRZA 2A68C 4BBRB 3K0YA 2JXMB 4RGOS 1Q12A 4KKTA 1A3TA 2B8FA 1LTID 1F2YA 3A7AB 2N88A 5I2YA 3GTOB 4QB4A 1B1ZA 3K5OA 4EGVA 3WOFA 3C2PA 5ELBA 3H94A 5CBEE 5EKLA 3T53B 2K7VA 2B2YC 3QIAA 3LNNA 1HFGA 1T5XD 3HGBA 1SYCA 3HZXA 5DM73 5CR3A 1KDBA 5D65A 1KAAA 1F2LA 3VYTA 2B2UC 3CRKC 1B2TA 1S5FD 1GUTA 3LX0A 1MI2A 5ELEA 4XYOA 3NSWA 4ZUJA 2NVXB 3NXWA 5D14A 2FJ2A 4G4KA 1TY2A 1EY4A 4DF7A 4TRDA 1SEBD 1WTXA 3VYUA 3FKIB 2Z8LA 3NBHA 4J8QA 4KJOA 4LK1C 1DYQA 2A69C 3NBIA 4HAEA 1CI3M 5E3FA 3GD7A 3A54A 1GUWA 4FF3A 1RTNA 2ZT9C 3BS1A 4N9TA 4L8JA 1EZ6A 2KEEA 3TBIB 2K01A 3RLFA 2A74C 1U4RA 4L63B 5CMDA 1ILPA 3EQLC 1OO9B 4L6TB 2RDHA 1CFMA 3OMCA 3EA6A 2K32A 4FVMA 1HHVA 1X32A 3C1EA 3Q0AA 5ELFA 2IT1A 3J80L 3CKIB 3ND9A 5K36H 1I4PA 3A8KE 1QNKA 5A35A 2FINB 3RMHA 4O42A 2B2WA 1LTTD 3S16B 2WACA 1ZKOA 1PTOH 3QB3A 5IGDA 5I9PA 4K14A 2EY2A 1Q90A 3PIO3 2RVLA 5G3LF 4OGQC 4ZKBB 3M7GA 1Z47A 1I4RA 1TWFB 3ONAB 1B3AA 5EPJA 2KQ3A 4PV1C 2ZXOA 1U9RA 1WD0A 5CYUA 2WKDA 1EU4A 2B2TA 4F7XA 2FMMA 4IUUA 1PRTD 4PMCA 4BY1B 2K28A 1PMRA 3M7NA 2VUMB 1AZPA 4IALA 3K57A 4IQZA 1I4HA 3I4LA 4A3BB 1EEID 1SNQA 2F0PA 4FO2A 1LT6D 5C6AA 1G91A 1EIHA 1NUCA 4HSVA 1CM9A 4H44C 1PRTB 4AYBB 5M5YB 1KNAA 1F9SA 1TKWB 2XWBB 1PTOC 4FF4A 4CJ0B 2DNEA 1Y8NB 2EVBA 3Q22A 3JAML 1EYAA 1PDQA 1O7YA 4G7OC 3MZ5A 3SK8A 4FXGC 3L7ZC 1EY6A 2CHBD 2WP8J 4BA1I 4Z9CB 4RH6A 1VCIA 2SDFA 4WRDA 4V190 2EYPA 1STEA 1F77A 2L1BA 3URYA 2AQ1B 4EVOA 1XXGA 3H0GB 2ZXRA 4R9WA 4CKEA 5KYLA 5C44B 1ENAA 4E6IA 2R3ZA 2AWNA 1QCBD 4RAUC 5LL6S 3I4NB 4ME5A 1H9SA 1G6ZA 5CV9A 1TT2A 1H9RA 1O78A 1MSHA 4DK0A 1XWEA 3FPPA 4U68A 2KCNA 1VMPA 3J7YW 1F2ZA 4NKLA 3PUWA 1VF5C 3BVGA 1WTQA 3SVMA 1ESRA 3K5LA 1CQVA 3D6CA 1SSOA 1QG7A 5FKAC 4R8NA 2CW0D 4B9XA 1D1IA 1LTRD 5IGGA 4BWGB 3BZDB 2IPKD 1ICWA 5AFWA 1JOOA 5M5WB 3P1HA 1B4OA 5IGFA 1IHZA 1NCVA 1R4QB 5CV8A 1LACA 1D5XC 3E0JA 4DA2A 4Y7NB 2A6HC 1HUMA 4H0LC 4KV6A 4MIUA 2O2LD 1UEAB 2C9OA 1E2WA 4QCLA 3R2IA 4FP5D 2EYLA 3AMUA 2JSOA 1TWHB 4LJZC 2DY8A 2J7ZA 3VR4A 1C8CA 4A3GB 5I6YA 1ENFA 3F2UA 4A3MB 2L0CA 1JORA 1PYWD 4RGMA 2EJMA 5EBDA 1HRJA 3RD4A 5FLXL 1CTMA 1C48A 3GTPB 1HTPA 1IKLA 1E2VA 3KLSX 3T51B 4DAYA 2R7ZB 1I4XA 1D1KA 2L9HA 3DWAA 3SK5A 1BQQT 1CHQD 2NTSA 2SEBD 4EQOA 2B2VC 2NZ1D 4XQNA 1UUPA 3D6WA 1U4MA 2A5HA 4NDXA 1AN8A 3I3CA 1ZYRC 2K04A 3Q24A 2OT2A 1F2MA 1SE2A 4C56C 1RCVD 3G6JB 3AU7A 1CK1A 2B2YA 2RQXA 4K8JA 1B53A 2XNAC 4HCSA 4O1NA 4UDUC 3OWEB 3I4MB 4CKCA 1I50B 3GQBA 1W6KA 1LTGD 1YNJC 4ZKCB 3MWYW 4FNFA 3MAQA 2B2UA 2DNCA 4IZ8A 4WJWA 5KGUA 1Y69U 3KF8A 5CV4A 4RA8A 3IAYA 2BA0A 3DUZA 1Y8OB 3K5NA 3U9OA 3NQIA 3CU7A 2K33A 4K2LA 1KTKA 1L0XB 1R4PB 1XX8A 1FD7D 1GJXA 3A7LA 1D5ZC 1II3A 3OW7A 3J80E 4M8AA 1TQOA 3P7JA 2EOTA 4KN7C 1TS3A 5TSSA 2GA4B 3PIP3 1GUGA 2H1EA 1B9NA 1JICA 4X3UA 2BCOA 2QILA 3NQTA 1EY0A 4F87A 2M2LA 1BF4A 4A3JB 1SE3A 2HQEA 5I2XA 2NUCA 5C4ZA 3QWNA 1SBBB 3NPPA 1VDZA 2B8GA 4DNRB 5J22A 1DD2A 2R61A 1FYCA 1BCPC 5JPMC 4QF4A 5DM63 3GP7A 4KK7A 1Z7TA 1WTVA 1EL0A 3VYSA 2AUJD 3GTGB 4BA2I 2L11A 3D4WA 2F0KA 1JC7A 3BVZA 4A93B 2MHVA 3HOYB 4EQNA 4FXKC 2A73B 4QIWB 5DAUA 3N6RA 3GO5A 1QILA 1WTRA 2HCIA 5DNFA 1ET9A 4KY6A 2DN8A 5EPKA 3VA5A 1OXTA 4XT1B 5CV5A 4CJ2C 1CQFA 2A6EC 3TZDA 2J0TD 1QNUA 1VMCA 2RSNA 3O13A 3A8JE 2K05A 3H6MA 1SMYC 3V05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BOS A;  1C4Q A;  1R4P B;  3MXG A;  1D1K A;  1D1I A;  4ULL A;  1CZW A;  1QOH A;  1CQF A;  2GA4 B;  1QNU A;  2XSC A;  1DM0 B;  2BOS A;  4M1U B;  2C5C A;  1C48 A;  4P2C B;  1CZG A;  1R4Q B; 
#chains in the Genus database with same CATH topology
 1BOS A;  2F1M A;  2HUG A;  2Q2I A;  3RZO B;  4S3S A;  3H3V H;  3L9A X;  3M4P A;  3S24 A;  3MXG A;  3NWT A;  1GXD C;  1TWA B;  1RJT A;  3J81 L;  1EU3 A;  5JJI A;  3FKI H;  3R2T A;  1JB7 A;  3D3R A;  2VB3 X;  5JEA G;  4I65 A;  3JAM E;  5A2Q E;  1PA6 A;  4B3M Q;  2WAQ B;  4FXD A;  1O80 A;  1B9M A;  5D3D A;  4HSP A;  1MKH A;  3NUC A;  4QL5 A;  1SFO H;  4CDF C;  4JI1 Q;  3SDZ A;  1EOV A;  1YNN C;  1V1P A;  2R6G A;  3GTQ B;  1IBL Q;  2WB1 G;  4G57 A;  4IO9 A;  1I94 Q;  2QW7 A;  5IE8 A;  1HNW Q;  2NVY B;  5ELO A;  1SYF A;  3OWF A;  1ONL A;  4GNX C;  1CHP D;  3NEL A;  2HDL A;  3H0G G;  2NYZ D;  3FDT A;  5HGQ A;  3OTO L;  1SXT A;  1LO5 D;  3PO2 G;  4M1U B;  2CH4 A;  2F0V A;  3R8B A;  1E2Z A;  3OPO A;  2X6L A;  2I07 B;  2RSO A;  2HIX A;  1XTD A;  2ZTC A;  1HXY D;  2IL8 A;  1SFO B;  4XQJ A;  2LFN A;  3ICE A;  2KEN A;  2EDG A;  5IP9 H;  3PO3 B;  1TY0 A;  4R4Q A;  2M9V A;  2LS0 1;  4KTA A;  4LF9 L;  1VQG A;  2HHH L;  5JOB A;  2C5C A;  3T1Y L;  1NJI C;  4DV6 Q;  4GKK Q;  5IGB A;  2A1A A;  3S16 H;  2EYM A;  3U4V A;  1E1T A;  3E0E A;  2KOL A;  3AFP A;  3BYT B;  1UNS A;  3H3V C;  5C3X A;  1K8M A;  4GOP A;  2RCN A;  2UU9 L;  1FGB D;  5FLX c;  1H9J A;  4HIK A;  4PQX A;  3S1R H;  4DUZ L;  2N78 A;  3VDY A;  1Q1B A;  3MTS A;  2NZH A;  3BDO A;  4PMB A;  1YIT A;  1SND A;  4ODG A;  3TME A;  4BY7 G;  5G3L D;  2OQK A;  4MN3 A;  1PFM A;  2F52 A;  3BDC A;  4C3J G;  2K6A A;  1DGS A;  2Q8R E;  4X3T A;  2Z1C A;  2MJ8 A;  2X6G A;  2EYF A;  2CH4 W;  2DY7 A;  3DMU A;  4DR3 L;  3NEM A;  3PV0 A;  4ALP A;  1FVI A;  4LWC A;  4Q0F A;  1TU2 B;  4DU9 A;  3OMG A;  1VQL A;  1S5B D;  1NAP A;  4X3S A;  2D5D A;  3TP6 A;  1EY9 A;  2L15 A;  4P71 A;  2E2J H;  1S3O A;  1EY8 A;  4PMW A;  5CV6 A;  4XYQ A;  1B3Q A;  1Y8P B;  4CGY B;  4BY1 H;  1XYI A;  1LV9 A;  2KCC A;  4IN3 A;  2KCT A;  5CGK A;  3D4D A;  1K28 A;  3OTO Q;  1Y14 B;  3S1R B;  2VUM H;  3T13 A;  4ZLT F;  2G9H D;  1SRU A;  1E3P A;  3KLS A;  4J1M A;  2OEO A;  1JOQ A;  1J9O A;  4HIO A;  5IGE A;  1GKH A;  1ENC A;  3IKJ A;  1CA6 A;  3EFX D;  4A3B H;  1STA A;  5CC4 A;  1HTL D;  5E4X A;  4DR4 Q;  5EPL A;  3QOL A;  5FLX E;  1UAP A;  4YWK A;  1RKN A;  4ZYS A;  4LF9 Q;  4GZY C;  1JT8 A;  2MP1 A;  2HHH Q;  5C5M A;  4DV4 L;  1FL0 A;  3T1Y Q;  1NR2 A;  2R7Z G;  2E2J B;  2B63 B;  1NE3 A;  1HFN A;  1EIG A;  1PH3 A;  4DN4 M;  1Q3L A;  4RFB A;  1S5E D;  4OIJ A;  3FEW X;  3TZU A;  1SE4 A;  3V96 A;  1D6E C;  4OON A;  3CRL C;  3TRZ A;  3I7F A;  2UU9 Q;  4DAP A;  2WFW A;  1RF2 D;  2MGS A;  2QDL A;  3W2D A;  2ZTD A;  4A3L G;  4DUZ Q;  1STN A;  2JK8 A;  3I56 A;  1DOK A;  4CKB A;  3SXH A;  4IJL A;  4JBJ A;  5IYC G;  4IPG A;  2KUM A;  1AW7 A;  5COR A;  5L37 A;  3K59 A;  1RDP D;  5C3E G;  1OXS C;  1STH A;  2PNH A;  3DLL A;  1PTO F;  1KD1 C;  4K6L A;  1EFW A;  3J7A 5;  4DR3 Q;  3I4M G;  2XWJ B;  1BDO A;  1V1Q A;  2PMZ E;  3BU2 A;  4KJN A;  3K58 A;  2K5Q A;  3E3X A;  3H0G H;  2F0H A;  2QCP X;  5I6W A;  2K1B A;  1PV4 A;  1K3R A;  1QZG A;  1A15 A;  4HTH A;  4LF8 L;  5C44 H;  3LWE A;  4RCO A;  4HIM A;  3FPU B;  2ES2 A;  4YIJ A;  1CKM A;  5E1F A;  1ESF A;  2VS1 A;  4ILW A;  3I4N H;  2XN9 C;  4IUP A;  5A2Q L;  4APV A;  3G4S A;  4OIK A;  4RGT A;  5ELD A;  1BO0 A;  3F2B A;  1VQE A;  2B2V A;  2EXZ A;  2IJ0 A;  2YV5 A;  1A3U A;  2WIN B;  2NTT A;  2JQO A;  4G7Z C;  4AQY L;  3KBX A;  2WB1 B;  2PZU A;  4RHR A;  5GAE C;  1WTW A;  3GDE A;  4JYA Q;  2VNU D;  2UUA L;  5EAY A;  2JJQ A;  1KQS A;  1TII D;  3F2D A;  1SYE A;  2HDM A;  4DV5 L;  1MBY A;  3ULL A;  1PRT C;  5LL6 X;  2KED A;  2R92 G;  3H15 A;  1NSN S;  2M00 A;  3PO2 B;  4YCW A;  2QDB A;  1PFB A;  1SJH D;  2E74 C;  4KKU A;  1M1K C;  1SR3 A;  4QGU A;  1AE3 A;  2AKW B;  3ERS X;  1ASZ A;  1XNR L;  4A3J G;  1HZC A;  1FNU A;  2JYO A;  1LYL A;  1DOL A;  1QUQ A;  2VZA A;  3HKZ G;  4JI3 L;  3DEP A;  1WTP A;  2OF1 A;  1GO3 E;  1IW7 D;  1RD9 D;  1VQ7 A;  4Y7N H;  1FR3 A;  5KND A;  3CC7 A;  1HA5 A;  2BDN A;  1IKM A;  2F0N A;  1QZH A;  3CD6 A;  3CMA A;  3J81 c;  3STB D;  3F8T A;  2YTV A;  2BE5 D;  3R93 A;  5C0X G;  3U9S A;  3M3Y H;  3CQZ B;  1LTS D;  1LT3 D;  2F0Q A;  3DM1 A;  2Z6K C;  1TWH H;  3UDF A;  4LF8 Q;  3OHX C;  4GLA C;  1G29 1;  4BY7 B;  4C1N K;  4J6H A;  2JEA I;  4A3G H;  4A93 G;  3C1F A;  1VQ5 A;  1CSP A;  1QB5 D;  1AP0 A;  4C3J B;  3ULP A;  2AMC B;  2F0F A;  2L55 A;  1IYJ B;  1SYD A;  2PNR C;  4JW0 A;  3T4A C;  4X3K A;  1GOZ A;  1Q1E A;  5E7N A;  1QVG A;  2V4D A;  1ET6 A;  1PXU A;  2I5L X;  1YJN A;  5C0X I;  4AQY Q;  3GTP H;  3A56 A;  1J8I A;  1LTA D;  3HOU G;  2PPB C;  3ER0 A;  2UUA Q;  1K3B C;  2ZM6 L;  2R7Z H;  1GUO A;  3KOJ A;  4KY5 A;  2F0G A;  1VQM A;  4GLX A;  4DV5 Q;  1QVF A;  3M3Y B;  1PH5 A;  3TSS A;  5KRU A;  5FO9 B;  2B2T C;  1UE1 A;  5KNC A;  1A0I A;  1CKN A;  4R4O A;  1K83 B;  4A3L H;  2ENB A;  1SE8 A;  3M85 A;  1AH9 A;  1AZQ A;  1VQN A;  1F9P A;  4IUQ A;  1EYD A;  1I4Q A;  2F0D A;  1VQO A;  2LMC B;  3J81 E;  4TQU S;  5C4J B;  4KHV A;  5C3E H;  1KLG D;  5NUC A;  3UDX A;  4JG2 A;  2JE6 I;  1XNR Q;  2K5W A;  5E4W C;  2WAQ G;  3HEJ A;  4RGN A;  1E24 A;  4QUF A;  4RMF A;  2IX1 A;  1YHQ A;  2JP1 A;  4JI3 Q;  3I4M H;  3BDL A;  4LUZ A;  4BS9 A;  3GTM B;  1I50 H;  1E0B A;  4RKB A;  4KD4 A;  5IGC A;  2WKC A;  1SJE D;  5J39 A;  4NXM L;  1EQT A;  2EPB A;  2CW0 C;  1STG A;  2IHF A;  3DWQ A;  2KBN A;  2ATW A;  3GTK H;  3S2H B;  3WOE A;  1IL2 A;  2TMP A;  3W1G A;  4XT3 B;  1EOT A;  2K03 A;  3H91 A;  1YI2 A;  3IFD A;  3CCQ A;  2EY6 A;  4F8M A;  1OXU A;  1SNP A;  3TEH B;  2F03 A;  4OO1 G;  5KIX A;  1TS4 A;  3NTH A;  3KDF B;  1JB3 A;  1EIF A;  5ELN A;  1AFP A;  3P75 A;  4LUV A;  5C3E B;  4QUC A;  1WVL A;  1H9S B;  3HS0 C;  5C3W A;  1QOH A;  4ZAI A;  5I4D A;  4A3I G;  4FF1 A;  3GV6 A;  4KHZ A;  1HZB A;  1JOK A;  2R92 H;  4ME3 A;  2KJX A;  3BG3 A;  3HRZ C;  3MEH A;  1WYD A;  1PH9 A;  2YTX A;  5FOB B;  2ZM6 Q;  4RKL A;  1EY5 A;  1XMO L;  3D0F A;  2XVS A;  2RF4 A;  2QEX A;  5IYD G;  1VQI A;  4OO1 I;  4A3D B;  1LTB D;  3M9B A;  3GTK B;  2UUC L;  4R8I A;  3I72 A;  2ZXP A;  1SRO A;  1SN8 A;  2HIV A;  1BKB A;  1Z6H A;  2L4N A;  4JBW A;  4A3J H;  1DCZ A;  1JE5 A;  4GNX A;  3I70 A;  3VR5 A;  3GV3 A;  1BBX C;  3VR2 A;  2N55 A;  4K5X A;  4TSS A;  2Z0S A;  3CCM A;  4PZ7 A;  2ZJR A;  2L12 A;  3LGJ A;  1XTC D;  2VB2 X;  4KI0 A;  5C0X H;  3EJI A;  2R92 B;  4X65 L;  1NBW A;  1IYV A;  2F3W A;  1LAB A;  5FLM H;  2AQ2 B;  2A68 D;  4NXM Q;  3I73 A;  3M4Q A;  5F2D A;  2CKZ B;  1E7Z A;  2F0O A;  1MD2 D;  2JEB I;  4YWL A;  4YCU A;  3VR3 A;  3UDG A;  5KEE A;  2K50 A;  5J1Z A;  1YVC A;  4A93 H;  3HOY H;  4JI0 L;  4AYB E;  2AQ3 B;  3ITP A;  4A3K B;  3NTI A;  3VYR A;  2E2I B;  4DV3 L;  2E76 C;  5ISR A;  1HPC A;  3HP3 A;  1TS5 A;  1L1O C;  2EJG C;  1BCP F;  3HKZ B;  1UE5 A;  1EEF D;  2A6E D;  2XRQ D;  4QQB X;  4K5V A;  4LF7 L;  2MQH A;  3HOU H;  1BNZ A;  1SYB A;  1RHP A;  2JA7 G;  4NPS A;  2GVB A;  2Z4H A;  1CZG A;  4DNT B;  1OXV A;  1WTO A;  1L2F A;  1KAB A;  4C3I G;  5EKK A;  4A3E G;  1HA6 A;  2AUK A;  1KAW A;  1CZW A;  5GAD C;  1XMO Q;  3HOX G;  3RZO H;  2B63 G;  3AB9 A;  3DHQ A;  3K6O A;  3PMF A;  4POF A;  2X69 A;  4KY7 A;  1W3S A;  1EZ8 A;  1TWA H;  3ND8 A;  1VF7 A;  2B3G A;  3CPF A;  1G2S A;  2UUC Q;  1JWS D;  5DLQ E;  4B9W A;  3L0O A;  3RLO A;  5DEH A;  3ZYY X;  5EKI A;  2WII B;  3HOU B;  5C0X J;  3PUV A;  3GTQ H;  1K9M C;  5FK9 C;  1SAP A;  3HOW G;  1XNQ L;  2NVY H;  3ERQ A;  4DV2 L;  3MXN A;  4DXG A;  4X65 Q;  4IOA A;  1SYG A;  3OOC A;  1QWY A;  5H1S E;  2EZV A;  1LLR D;  4DR7 L;  3E6Z X;  1UWV A;  5IP7 G;  1EWH A;  4OO1 H;  2LY7 A;  4FF2 A;  4JI0 Q;  1PZJ D;  4CHT B;  2A69 D;  4DV3 Q;  4KLK A;  2IWH A;  1X56 A;  3AEV A;  2H4O A;  4A75 A;  1B50 A;  1VQJ A;  2D2C C;  3KF8 B;  3RN2 A;  5M9O A;  3K80 C;  1BVS A;  3FRP B;  2NBF A;  4B08 A;  3S1M H;  1FJG L;  3PO3 H;  4LF7 Q;  1SNC A;  3K81 C;  4QY7 A;  4LMQ D;  5COY A;  3C3L A;  1S5D D;  1HUN A;  1H9K A;  1CA5 A;  1HCZ A;  2JA8 G;  1TWC H;  2ZJP A;  1VQF A;  2F0J A;  3EVQ A;  2IX0 A;  4ZK9 B;  5IYD H;  3S14 B;  3TDQ A;  2PW5 A;  1VQ9 A;  4HED A;  3AFQ A;  1KLU D;  2KA7 A;  5I9O A;  3KJO A;  3A55 A;  1VQB A;  4P72 A;  1Q8K A;  3BYY B;  2ZTE A;  4OX9 L;  1T5E A;  1SNO A;  1EYG A;  4P2C B;  4GLV B;  1GUS A;  1LTL A;  3G6E A;  5IT9 L;  3HG9 A;  4CDC C;  2QKI C;  4KHP L;  2OTL A;  2PYK A;  4A3I B;  1ASY A;  3CCS A;  2JA5 G;  1GHK A;  3DEO A;  1E22 A;  5JJZ A;  1V43 A;  3WDN A;  3S1M B;  3M4Y A;  3S17 H;  4NXN L;  5FO8 B;  4FYD A;  4DAV A;  2N3S A;  1PH4 A;  1FGU A;  3GTL B;  4UPA A;  3CHB D;  1PYB A;  1TWC B;  2Q8I B;  1OXX K;  3G71 A;  4RCN A;  1Y1W G;  4EQP A;  4XXE A;  1PZK D;  1KXL A;  1QE6 A;  3V2T A;  1XNQ Q;  2O5J C;  4DV2 Q;  2IW3 A;  4DFA A;  1BBU A;  4QMG A;  1JJ2 A;  5M5X B;  4N9P A;  1VQH A;  3PUY A;  2I5M X;  1A6X A;  4DR7 Q;  2Y0S B;  3I91 A;  1D5M C;  2XTI A;  5IOD A;  5KYI A;  3QJY A;  4LF6 L;  4XTC S;  1EYC A;  1YHA A;  4DR6 L;  2VQE L;  2OQ0 A;  1I4G A;  2D9U A;  3S2D B;  3MFG A;  2JA7 H;  2RKS A;  3OIQ A;  3WWV A;  2XIW A;  3OIP A;  2FHT A;  1O7Z A;  1HR0 L;  4R1J A;  2ID0 A;  3TP7 A;  3X3N A;  3S17 B;  1JWM D;  4CJ1 B;  1B70 B;  1FJG Q;  3MC0 B;  1JWU D;  2MPM A;  5M3M G;  4A3E H;  3T56 B;  1C7Y A;  2PZT A;  5GAG C;  5GQO A;  3HFZ B;  1R9T B;  2B63 H;  1T9H A;  4PZ6 A;  1K0S A;  3DM3 A;  4JCV E;  2HCC A;  2P5Z X;  3HOZ G;  4C2M H;  1PH2 A;  2F0E A;  4HR7 B;  5JPN C;  1MGS A;  1HR0 W;  1K0R A;  2UXD L;  4OL7 A;  4J15 A;  4OX9 Q;  4CBV A;  1FNV A;  2L5T A;  3KLR A;  2Q8T A;  4NW2 A;  5HY6 A;  1B8A A;  3OSO A;  4DK6 C;  2Z6K A;  5T1I A;  4KHP Q;  1YJ9 A;  1ICF B;  4LAA A;  1Q8I A;  2JA7 B;  3BVM A;  1N32 L;  4V0B A;  4IJH A;  1TR5 A;  2O5I C;  4C3I B;  4NP5 A;  5M3F G;  1PTO D;  2XGT A;  4BBS G;  4NXN Q;  1PYS B;  2PO4 A;  4A3E B;  2J4X A;  2BDO A;  1P8L A;  2CVR A;  1U4L A;  1V1P B;  2NWG A;  2B39 A;  3NE5 B;  4KN4 C;  1KNE A;  3HOX B;  1HQR D;  3BZK A;  1A3V A;  3TP5 A;  4OWX B;  4JPB W;  4C2M B;  3T16 A;  3N52 A;  2KVM A;  5CV7 A;  5JEA H;  5LHY 1;  1VS0 A;  1YBY A;  2ICI A;  4DGZ A;  2N8N A;  3X3M A;  3E9H A;  4IPD A;  4DUY L;  4P73 A;  1MHW C;  1A2U A;  4LF6 Q;  5GRO A;  1HZ9 A;  4LFA L;  4DR6 Q;  2VQE Q;  4RHS A;  1O7I A;  1X55 A;  1PTO B;  2JA8 H;  3NBH B;  3HOW B;  2SOB A;  4JC0 A;  1HR0 Q;  4YHH L;  4PZ8 A;  1JE4 A;  4G7H C;  3SGI A;  1VQD A;  2WV6 D;  2E2D C;  4NMZ A;  4JI8 L;  4UAI A;  5C5L A;  1A62 A;  5K5P A;  5BR8 L;  3L3O C;  3PO2 H;  3E5S A;  3NK9 A;  2TSS A;  2B29 A;  2HD3 A;  2NVQ B;  4MZ9 A;  4A3D G;  1IBK L;  5BN3 A;  2NN6 G;  2UXD Q;  1TWG B;  4GOP B;  2R93 G;  1PHJ A;  3RUZ A;  1X3F A;  4LFB L;  5FJ8 G;  1U5K A;  1PRT F;  3MEF A;  3QOJ A;  3ERO A;  4QIW E;  5T1G A;  1M90 C;  2N49 A;  2JA8 B;  1N32 Q;  1Y1W H;  3S9W A;  3NTK A;  3CXC A;  1KC8 C;  2RA4 A;  1K8G A;  1X3E A;  3U58 A;  2EYJ A;  2BA1 A;  4DXF A;  3VA7 A;  4H7B A;  1S5C D;  3CCL A;  3CQZ H;  4XQQ A;  2F0W A;  2NN6 I;  1YJW A;  4XDX A;  4DV4 Q;  2PZW A;  1Y1V G;  5JEA J;  4IFD G;  1STY A;  3PIP A;  1BXT A;  3W1B A;  3KF6 A;  2I0Q A;  4BY7 H;  3FMC A;  3CC4 A;  4LUO A;  1C9O A;  5EJW A;  2EYO A;  2F0S A;  1I6V C;  5BN5 A;  4A3K G;  1X3P A;  4C3J H;  2JA5 B;  2A6H D;  1ILQ A;  2CQO A;  5LMN L;  1EWI A;  4ULL A;  4GS3 A;  5EBC A;  4DUY Q;  2QF7 A;  3K5M A;  3ZJY C;  1WD1 A;  5M3M H;  2I46 A;  3PF4 A;  1IBM L;  2WAQ E;  2YYZ A;  4XIG S;  4LFA Q;  1GHJ A;  2KHS A;  4DK1 A;  4K6D A;  1Y1W B;  3A74 A;  4O2D A;  3SK4 A;  4DK3 C;  4IFD I;  3MA2 B;  1W6J A;  1HNZ L;  4YHH Q;  2E2H B;  3J81 j;  1AEX A;  1DJR D;  3A8I E;  3J7A F;  4H02 A;  1FNW A;  2OXP A;  4C3H G;  2F0I A;  4JI4 L;  5LMN W;  4JI8 Q;  2CCZ A;  2XRS D;  5BR8 Q;  3I8Z A;  2IHE A;  3VR6 A;  5BN4 A;  3D31 A;  4JOI C;  1K83 H;  2B2W C;  5JVG 3;  3EIV A;  5KNB A;  4ZQ3 A;  2SNM A;  3PUZ A;  3CCV A;  2SNS A;  2G9D A;  4K5W A;  1DOM A;  5C4J H;  4HJA A;  1CKO A;  1JCK B;  1EUJ A;  2VXW A;  3SHL A;  1KDC A;  4Y52 H;  4LFB Q;  2Z6B A;  1VQ6 A;  4JBM A;  2RBM A;  1DZ1 A;  1U4P A;  5M3M B;  3S15 B;  2K14 A;  1L1O A;  2F0M A;  1RTO A;  3GTM H;  3TRE A;  4Q5V A;  3KBG A;  3J7A V;  4OEM B;  2A19 A;  2RDG A;  4LF5 L;  1YZ6 A;  5IT9 c;  4ABN A;  1ZYR D;  4BBR G;  3HOZ B;  1U0L A;  4FDB A;  3Q23 A;  3ULJ A;  1X9N A;  5IWA L;  4K0K L;  4YY3 L;  1BR9 A;  1EWC A;  3S2H H;  2YU9 B;  3RZD B;  2Z4I A;  1N34 L;  4HCE A;  1F9R A;  1X3Q A;  3MHB A;  4JK1 C;  5IYC H;  2E75 C;  3NP8 A;  3MXP A;  4H13 C;  4PNY A;  2R7D A;  2MUY A;  2FFK B;  2ZJQ A;  1EQV A;  2CQA A;  1YNJ D;  1IW7 C;  1ROD A;  5LMN Q;  1M8A A;  3IFT A;  5M3F B;  2YTY A;  4BBS B;  2FMC A;  1YEZ A;  1A2T A;  2F4I A;  3STB C;  1C4Q A;  1WCM B;  1NMG A;  2BE5 C;  1YNX A;  1IZ6 A;  3SK6 A;  3GTJ H;  4IUN A;  1IBM Q;  5CBA E;  3B6Y A;  1KHI A;  3S1N B;  3R3O A;  4K2K A;  4WOR A;  3KK7 A;  1V1O A;  1HNZ Q;  3SEB A;  2EY5 A;  1L0Y B;  1IL8 A;  1DM0 B;  1NR4 A;  4A3D H;  4JI4 Q;  3MVV A;  2NN6 H;  2VW9 A;  5HGT A;  1D2B A;  1SDF A;  1PZI D;  1GUN A;  5FJ8 H;  3K7U C;  3C46 A;  4BXX G;  2NVT B;  2QGQ A;  5FO7 B;  2D62 A;  4X6A H;  3K0X A;  3MXU A;  1K8O A;  5IT9 E;  2O4X A;  1X6O A;  4KD3 A;  3MFY A;  1S4Z A;  2EY1 A;  3S1Q H;  3KUP A;  1QUQ B;  2F0T A;  2PCF B;  3GTJ B;  2PQA A;  1B44 D;  4IUV A;  1XPU A;  2PQE A;  1LT5 D;  4IFD H;  1ML0 D;  3FKI G;  2PW7 A;  2IX3 A;  4LF5 Q;  1JR0 D;  3H09 A;  4U67 3;  1WOC A;  1V8Q A;  1STB A;  1ZEQ X;  2QEJ C;  3TP8 A;  5IWA Q;  4A3K H;  4YY3 Q;  2E2I H;  4K0K Q;  1HQM C;  1SNM A;  3LWU A;  2R93 B;  1YHB A;  1TVX A;  1N34 Q;  5IIF A;  1M4V A;  4UP9 A;  4RG1 A;  1BCP D;  2Y0S G;  3QO2 A;  4ID6 A;  1G8Z D;  1CT1 D;  2AWO A;  4K8I A;  4HMJ A;  3DWP A;  1VQA A;  3S1Q B;  1PLF A;  5EQ0 A;  1I6H B;  1MSG A;  5EGT A;  4HN7 A;  2LKV A;  2PI2 E;  4OHJ A;  2K5D A;  4KKS A;  3UE1 A;  3NWS A;  3QG1 A;  4IUT A;  3W3A A;  3SE0 A;  1DON A;  1Y1V B;  2BOS A;  2C35 B;  3IL8 A;  3P20 A;  2ICE C;  1JMC A;  4R4T A;  1IYU A;  1CUK A;  1D7Q A;  3DXJ C;  4TKO B;  2F0U A;  2A8V A;  2EJF C;  4OEL B;  2I5H A;  5D3I B;  2D0O A;  1QJO A;  4DR5 L;  2E5L L;  4UP8 A;  4F88 A;  2OCE A;  3A5U A;  2NB0 A;  1BCP B;  5JVH 3;  3D4R A;  1O7L A;  1G2T A;  2EYH A;  1LT4 D;  1HZA A;  1XJV A;  5IOC A;  2CFM A;  5HUR A;  1CKN B;  5LMU L;  4GN3 B;  2LXJ A;  3PIO A;  1I3Q H;  2DJG C;  3HOV B;  1EIY B;  3Q6S A;  4I7Z C;  4WJ4 A;  3NHH A;  5C4H A;  3PQI A;  2KEC A;  1VQC A;  1XPO A;  1SMY D;  4IUR A;  3TN2 A;  4IFD J;  3I90 A;  4A3F B;  4HMI A;  1PH7 A;  4ZCK A;  4C3H B;  2WB1 E;  2F3V A;  3G7L A;  1X54 A;  2F0L A;  4MTN A;  1BUV T;  3U50 C;  4L5Q A;  3GTO H;  3SR1 A;  2EXD A;  4DAY B;  1DXM A;  2PMZ B;  3RR5 A;  3AQQ A;  3FVQ A;  2XSC A;  1JJC B;  1CSQ A;  1EFI D;  1JQY D;  3D8G A;  2JA6 B;  2RDF A;  5C4X B;  1ZXT A;  4LFC L;  1PFN A;  1YNN D;  4MHE A;  1TS2 A;  1KDA A;  5K36 G;  4UP7 A;  4ZUI A;  4A4I A;  1EY7 A;  1I3Q B;  3UI2 A;  3M4O B;  2EE1 A;  4LNQ A;  4RWS C;  4C1N I;  1F9Q A;  4WFN 3;  4R4I A;  5ELC A;  3K7A B;  1XPR A;  4KMU C;  5JAV A;  5JJK A;  3PUX A;  1H9M A;  4ZRZ A;  2A68 C;  3J80 i;  4BBR B;  3K0Y A;  4A76 A;  2JXM B;  4RGO S;  1Q12 A;  3S14 H;  2VUM G;  4KKT A;  1LM0 A;  1A3T A;  2KCM A;  2B8F A;  1LTI D;  4DV1 L;  1F2Y A;  3A7A B;  2N88 A;  5I2Y A;  4JBK A;  3GTO B;  2VQF L;  4QB4 A;  1B1Z A;  3K5O A;  4EGV A;  4A3B G;  3WOF A;  4P74 A;  4BXX H;  3C2P A;  5ELB A;  3H94 A;  4DR5 Q;  1LUZ A;  4CDE C;  1X65 A;  2E5L Q;  2UXC L;  1VQP A;  5CBE E;  4DKA C;  1Q81 C;  5IY0 A;  4A3I H;  3CAM A;  5EKL A;  4GNX B;  3T53 B;  5LMU Q;  4GKJ L;  1C0A A;  2K7V A;  2B2Y C;  3QIA A;  3OYY A;  4MTK A;  4X62 L;  3FP9 A;  3GTL H;  1XMQ L;  3LNN A;  1HFG A;  1T5X D;  4NB3 A;  2Z9H A;  3HGB A;  1SYC A;  3HZX A;  5DM7 3;  5CR3 A;  1KDB A;  3KYH C;  5D65 A;  1QVC A;  1G51 A;  1KAA A;  1W2B A;  1F2L A;  3VYT A;  2B2U C;  3CRK C;  5M5X H;  1B2T A;  2OTJ A;  4AIM A;  1S5F D;  1GUT A;  3LX0 A;  1MI2 A;  4DPG A;  2IY5 B;  5ELE A;  4B3R L;  1RL2 A;  4XYO A;  3NSW A;  4ZUJ A;  4DV0 L;  4LFC Q;  2NVX B;  3NXW A;  3CCR A;  4JI5 L;  3S2D H;  5D14 A;  2FJ2 A;  2RCF A;  4G4K A;  1TY2 A;  2KHI A;  1EY4 A;  5C44 G;  4DF7 A;  2NZO A;  4TRD A;  2PI2 A;  1SEB D;  1WTX A;  3VYU A;  4B3T L;  3FKI B;  2Z8L A;  3I4N G;  1R9T H;  3NBH A;  4DR2 L;  3BZC A;  4J8Q A;  3EBE A;  1AE2 A;  4KJO A;  4LK1 C;  4DV7 L;  4DV1 Q;  2Q2T A;  3A5Z B;  1DYQ A;  2A69 C;  1KIX A;  3NBI A;  4HAE A;  1CI3 M;  2VQF Q;  5E3F A;  3GD7 A;  3A54 A;  1N8R C;  1NNX A;  1GUW A;  4FF3 A;  1RTN A;  2ZT9 C;  1Q46 A;  1VQ4 A;  3BS1 A;  3JAM i;  4N9T A;  4L8J A;  1EZ6 A;  2KEE A;  2AHO B;  3TBI B;  2F4V L;  2UXC Q;  1VQK A;  4LW1 A;  2K01 A;  3RLF A;  2A74 C;  4GKJ Q;  1VQ8 A;  4C3I H;  1U4R A;  4L63 B;  5CMD A;  1ILP A;  2VL6 A;  4X62 Q;  2H5X A;  2MO0 A;  3EQL C;  1OO9 B;  4L6T B;  1PH6 A;  2RDH A;  1CFM A;  3OMC A;  1XMQ Q;  3HOX H;  3RNU A;  3EA6 A;  3TS2 A;  1TWF H;  5JJL A;  4A3C G;  1PVO A;  2K32 A;  4FVM A;  1HHV A;  4YWM A;  4DNI A;  2K4K A;  3EN2 A;  1X32 A;  3C1E A;  3Q0A A;  5ELF A;  2IT1 A;  3J80 L;  3MXN B;  3CKI B;  3ND9 A;  5K36 H;  1I4P A;  3A8K E;  1QNK A;  3RLN A;  5A35 A;  2LSS A;  1K8A C;  2FIN B;  3RMH A;  3CW2 C;  4O42 A;  4B3R Q;  4JOI A;  3UE0 A;  2B2W A;  1LTT D;  3S16 B;  3KJP A;  2WAC A;  4DV0 Q;  2OWO A;  1ZKO A;  1PH1 A;  1PTO H;  3QB3 A;  4JI5 Q;  3AYH B;  5IGD A;  5I9P A;  3TS0 A;  3HOW H;  2EY2 A;  4K14 A;  1Q90 A;  3PIO 3;  2RVL A;  5G3L F;  1WCM G;  1X3G A;  2K75 A;  4OGQ C;  3FHW A;  4ZKB B;  3M7G A;  4A3G G;  4B3T Q;  1Z47 A;  1I4R A;  1TWF B;  3ONA B;  5IP7 H;  4JYA L;  1B3A A;  4A3M G;  4DR2 Q;  5EPJ A;  2KQ3 A;  2RHQ B;  4PV1 C;  2NVQ H;  2ZXO A;  1U9R A;  4DV7 Q;  1WD0 A;  3JC6 6;  1NY4 A;  5CYU A;  2BH2 A;  2WKD A;  1EU4 A;  4PG3 A;  4WJ3 M;  3F2C A;  1TWG H;  2B2T A;  1H95 A;  4F7X A;  2BH8 A;  1J6Q A;  2FMM A;  5M5Y H;  4IUU A;  2VY3 A;  1KL9 A;  2GVA A;  1PRT D;  4PMC A;  4BY1 B;  3HKZ E;  2F4V Q;  3CC2 A;  2K28 A;  1PMR A;  3M7N A;  2VUM B;  1AZP A;  4IAL A;  2JA9 A;  3K57 A;  4IQZ A;  4JI6 L;  3F1Z A;  1I4H A;  3I4L A;  2F3I A;  4A3B B;  1N9W A;  1L0W A;  1EEI D;  1P16 A;  1SNQ A;  4OXP A;  2F0P A;  4N8F A;  4FO2 A;  3PGZ A;  1LT6 D;  5C6A A;  1G91 A;  1EIH A;  1NUC A;  4HSV A;  1CM9 A;  4H44 C;  2K5N A;  2QA4 A;  2JA5 H;  3CME A;  1PRT B;  4AYB B;  5M5Y B;  1KNA A;  1F9S A;  1TKW B;  3T1H L;  4HJ9 A;  1KRT A;  2XWB B;  1HJP A;  3BJU A;  1PTO C;  4FF4 A;  3CP0 A;  4O0A A;  4CJ0 B;  1OTC A;  2DNE A;  1Y8N B;  5J3B A;  2EVB A;  3Q22 A;  3JAM L;  1K73 C;  1EYA A;  1PDQ A;  3PSI A;  1O7Y A;  4G7O C;  2E2H H;  3MZ5 A;  3IRB A;  3I2Z A;  3L2P A;  3SK8 A;  4FXG C;  3L7Z C;  1EY6 A;  2CHB D;  2WP8 J;  4N8X 1;  4BA1 I;  2MFI A;  4IPC A;  4RH6 A;  4Z9C B;  4OWT B;  4X66 L;  1VCI A;  4EQ5 A;  5IYB G;  2SDF A;  4WRD A;  4V19 0;  2EYP A;  4JV5 L;  4GOP C;  5GAH C;  1STE A;  1F77 A;  2L1B A;  3URY A;  2AQ1 B;  4EVO A;  1XXG A;  3H0G B;  2E8G A;  2FXQ A;  2DUD A;  2ZXR A;  4R9W A;  4CKE A;  5KYL A;  5C44 B;  1GD7 A;  3S15 H;  3HOV G;  1ENA A;  4E6I A;  4POG A;  2R3Z A;  2AWN A;  3KDF A;  1QCB D;  4RAU C;  5LL6 S;  3I4N B;  4ME5 A;  1H9S A;  1G6Z A;  5CV9 A;  1TT2 A;  1H9R A;  1PH8 A;  2UUB L;  3CCU A;  4A3C H;  1O78 A;  5M5W H;  4A3F G;  1MSH A;  1GM5 A;  3HOZ H;  4DK0 A;  1XWE A;  3FPP A;  4U68 A;  2KCN A;  3QR8 A;  4JI6 Q;  1VMP A;  4JVZ A;  3J7Y W;  1F2Z A;  2KHJ A;  2YU9 H;  1EQR A;  1S72 A;  3U4Z A;  3RZD H;  4NKL A;  3PUW A;  1VF5 C;  3BVG A;  1WTQ A;  2JA6 G;  3SVM A;  1IBK Q;  5C4X G;  1ESR A;  3K5L A;  1Z9F A;  1CQV A;  3D6C A;  1SSO A;  1QG7 A;  1N36 L;  5M3F H;  5FKA C;  4R8N A;  2CW0 D;  4B9X A;  3T1H Q;  5FLM G;  4BBS H;  1D1I A;  1WCM H;  1LTR D;  5IGG A;  4BWG B;  2ALY B;  2RHS B;  3BZD B;  3S1N H;  3HOY G;  2IPK D;  1IXR A;  2K5H A;  1HH2 P;  1ICW A;  5AFW A;  4LF4 L;  1JOO A;  5M5W B;  3OW2 A;  3G48 A;  4A3M H;  3P1H A;  1B4O A;  5IGF A;  2EIF A;  1IHZ A;  1NCV A;  1R4Q B;  5CV8 A;  1LAC A;  1D5X C;  4JI2 L;  3PCO B;  2GN5 A;  3E0J A;  1GVP A;  4DA2 A;  4Y7N B;  2A6H C;  1HUM A;  4H0L C;  4KV6 A;  2D0P A;  1E1O A;  4X66 Q;  2HQL A;  4MIU A;  2JN4 A;  2O2L D;  2K52 A;  4DR1 L;  2NVT H;  1UEA B;  4JV5 Q;  2C9O A;  1E2W A;  4QCL A;  2V1C C;  4AH6 A;  4EX5 A;  2Y0S E;  3R2I A;  4I7A A;  4FP5 D;  3CF5 A;  2EYL A;  4B3S L;  3AMU A;  1I5F A;  2JSO A;  1TWH B;  4LJZ C;  2DY8 A;  1SMX A;  2J7Z A;  3VR4 A;  2K5V A;  1C8C A;  4A3G B;  4R4C A;  5I6Y A;  1ENF A;  3I55 A;  1RIP A;  3F2U A;  3RN5 A;  2L0C A;  4P75 A;  4A3M B;  1Q7Y C;  1PYW D;  2UUB Q;  1KRS A;  4RGM A;  1JOR A;  2EJM A;  5EBD A;  2DGY A;  1YIJ A;  3RD4 A;  5FLX L;  4JI7 L;  1HRJ A;  1MJC A;  1CTM A;  1C48 A;  2UXB L;  3GTP B;  1HTP A;  2R93 H;  1V9P A;  2CWA A;  1N33 L;  1IKL A;  1E2V A;  3KLS X;  3T51 B;  1PFS A;  1WI5 A;  2HT1 A;  4DAY A;  2R7Z B;  2Q2U A;  4UHV A;  1I4X A;  1D1K A;  2L9H A;  3KF6 B;  3DWA A;  3SK5 A;  1BQQ T;  1CHQ D;  2NTS A;  1HNX L;  2SEB D;  4EQO A;  2B2V C;  2NZ1 D;  4XQN A;  1UUP A;  3D6W A;  1U4M A;  2A5H A;  4NDX A;  3W5O A;  4DAM A;  4L5T A;  1N36 Q;  1I6H H;  1AN8 A;  3KLW A;  3I3C A;  3J80 c;  4HJ8 A;  1J5E L;  1ZYR C;  2K04 A;  3Q24 A;  3NEN A;  2OT2 A;  1F2M A;  1SE2 A;  2MO1 A;  4C56 C;  1RCV D;  3G6J B;  3AU7 A;  1CK1 A;  2B2Y A;  2RQX A;  1Y1V H;  4K8J A;  4LF4 Q;  1B53 A;  5IYB H;  2XNA C;  1MIU A;  4HCS A;  4O1N A;  4UDU C;  3OWE B;  4TVA B;  3I4M B;  4JI2 Q;  4CKC A;  1I50 B;  3GQB A;  3PO3 G;  1W6K A;  1LTG D;  1YNJ C;  2CWP A;  2Q2H A;  3MWY W;  4ZKC B;  4FNF A;  3MAQ A;  1TXY A;  2B2U A;  3J81 i;  3E9I A;  3HOV H;  3H3V I;  2DNC A;  4DR1 Q;  4IZ8 A;  2ASB A;  4WJW A;  5KGU A;  3J7Z C;  3CPW A;  4B3S Q;  3CCJ A;  1Y69 U;  3KF8 A;  1UE6 A;  4A3F H;  5CV4 A;  4C3H H;  2EQS A;  1A63 A;  1L1O B;  4RA8 A;  4CDD C;  4IOC A;  3IAY A;  2BA0 A;  3DUZ A;  1Y8O B;  3K5N A;  3U9O A;  3NQI A;  3CU7 A;  2K33 A;  4K2L A;  1KTK A;  1L0X B;  1UEB A;  2JA6 H;  1R4P B;  1XX8 A;  3UDI A;  1FD7 D;  2LXK A;  4GN4 B;  4JI7 Q;  3A7L A;  1GJX A;  1D5Z C;  1II3 A;  1A8V A;  5C4X H;  1SLJ A;  2UXB Q;  5IP9 G;  3OW7 A;  4HJ5 A;  3J80 E;  4M8A A;  1N33 Q;  1TQO A;  3P7J A;  2EOT A;  4KN7 C;  1NMF A;  3TQY A;  4L5R C;  3GTG H;  1TS3 A;  5TSS A;  5AJ3 L;  4X64 L;  1NTG A;  4IPH A;  2GA4 B;  3PIP 3;  1GUG A;  2H1E A;  4DR4 L;  1B9N A;  3M4O H;  1Q82 C;  1EQQ A;  1JIC A;  4X3U A;  2BCO A;  2QIL A;  3NQT A;  1HNX Q;  1MJE A;  1EY0 A;  1UE7 A;  4OWW B;  3K7A H;  4F87 A;  2M2L A;  1BF4 A;  4A3J B;  1B7Y B;  4BBR H;  1SE3 A;  2HQE A;  5I2X A;  4B3M L;  2NUC A;  3I4O A;  5C4Z A;  1S40 A;  3QWN A;  1SBB B;  1J5E Q;  3NPP A;  3KFU A;  4JI1 L;  1VDZ A;  2B8G A;  4DNR B;  5J22 A;  2DJF C;  1IBL L;  3CCE A;  4UY8 C;  4GN5 A;  1I94 L;  1DD2 A;  2R61 A;  4HJ7 A;  1FYC A;  1BCP C;  1HNW L;  5JPM C;  4QF4 A;  4L5S A;  5DM6 3;  3GP7 A;  1JJG A;  4KK7 A;  1Z7T A;  1WTV A;  1EL0 A;  3VYS A;  3JAM c;  3Q8D A;  2AUJ D;  3GTG B;  4BA2 I;  1G6P A;  2L11 A;  3D4W A;  2F0K A;  1JC7 A;  3BVZ A;  1BBW A;  4A93 B;  2MHV A;  3HOY B;  4EQN A;  1WJJ A;  4FXK C;  4BY1 G;  3K8A A;  2A73 B;  4QIW B;  5DAU A;  3N6R A;  3GO5 A;  1QIL A;  3A0J A;  1WTR A;  2HCI A;  5DNF A;  1ET9 A;  1Q86 C;  4KY6 A;  2PQA B;  4QJF A;  2DN8 A;  1WFQ A;  2G5D A;  5EPK A;  3VA5 A;  1OXT A;  4XT1 B;  5CV5 A;  3PF5 A;  4DV6 L;  4CJ2 C;  2R7F A;  2MNA A;  1CQF A;  4GKK L;  2A6E C;  1WTH A;  3TZD A;  2J0T D;  1QNU A;  1VMC A;  2RSN A;  3O13 A;  3A8J E;  2K05 A;  4HID A;  4YCV A;  2NVX H;  3H6M A;  4MNO A;  1D8L A;  1SMY C;  3V05 A;  4AYB G;  4X64 Q;  3HKS A;  5AJ3 Q; 
#chains in the Genus database with same CATH homology
 1BOS A;  2F1M A;  2HUG A;  3RZO B;  4S3S A;  3L9A X;  3MXG A;  3NWT A;  1GXD C;  1TWA B;  1RJT A;  3J81 L;  1EU3 A;  3R2T A;  3D3R A;  2VB3 X;  5JEA G;  4I65 A;  3JAM E;  5A2Q E;  2WAQ B;  4FXD A;  1O80 A;  1B9M A;  5D3D A;  4HSP A;  3NUC A;  3SDZ A;  1YNN C;  1V1P A;  2R6G A;  3GTQ B;  4G57 A;  2NVY B;  1SYF A;  3OWF A;  1ONL A;  1CHP D;  2HDL A;  2NYZ D;  3FDT A;  1SXT A;  1LO5 D;  4M1U B;  2F0V A;  3R8B A;  1E2Z A;  3OPO A;  2X6L A;  2I07 B;  2RSO A;  1HXY D;  2IL8 A;  1SFO B;  4XQJ A;  2LFN A;  3PO3 B;  2EDG A;  1TY0 A;  2M9V A;  2LS0 1;  4KTA A;  5JOB A;  2C5C A;  5IGB A;  2EYM A;  2KOL A;  3BYT B;  1UNS A;  3H3V C;  5C3X A;  1K8M A;  1FGB D;  1H9J A;  4PQX A;  1Q1B A;  3MTS A;  3BDO A;  4PMB A;  1SND A;  4ODG A;  3TME A;  5G3L D;  4MN3 A;  1PFM A;  3BDC A;  4C3J G;  2K6A A;  2Q8R E;  4X3T A;  2Z1C A;  2MJ8 A;  2X6G A;  2EYF A;  2DY7 A;  3DMU A;  3PV0 A;  4Q0F A;  1TU2 B;  4DU9 A;  3OMG A;  1S5B D;  1NAP A;  4X3S A;  2D5D A;  3TP6 A;  1EY9 A;  1EY8 A;  4PMW A;  5CV6 A;  4XYQ A;  1Y8P B;  4CGY B;  1XYI A;  1LV9 A;  2KCC A;  4IN3 A;  5CGK A;  3D4D A;  3S1R B;  3T13 A;  4ZLT F;  2G9H D;  3KLS A;  4J1M A;  2OEO A;  1JOQ A;  1J9O A;  5IGE A;  1ENC A;  3IKJ A;  1CA6 A;  3EFX D;  1STA A;  5CC4 A;  1HTL D;  5E4X A;  5EPL A;  3QOL A;  5FLX E;  1UAP A;  1RKN A;  4ZYS A;  4GZY C;  2MP1 A;  5C5M A;  1NR2 A;  2E2J B;  2B63 B;  1HFN A;  1EIG A;  4DN4 M;  1Q3L A;  4RFB A;  1S5E D;  4OIJ A;  3FEW X;  3TZU A;  1SE4 A;  3V96 A;  1D6E C;  3CRL C;  4DAP A;  1RF2 D;  2MGS A;  3W2D A;  1STN A;  1DOK A;  4CKB A;  3SXH A;  2KUM A;  1AW7 A;  5COR A;  3K59 A;  1RDP D;  1STH A;  1OXS C;  1PTO F;  4K6L A;  2XWJ B;  1BDO A;  4KJN A;  3K58 A;  2K5Q A;  2F0H A;  2QCP X;  5I6W A;  2K1B A;  1A15 A;  4HTH A;  3LWE A;  4RCO A;  3FPU B;  4YIJ A;  5E1F A;  1ESF A;  4ILW A;  2XN9 C;  4IUP A;  5A2Q L;  4OIK A;  4RGT A;  5ELD A;  1BO0 A;  2B2V A;  2EXZ A;  2IJ0 A;  1A3U A;  2WIN B;  2NTT A;  4G7Z C;  3KBX A;  2WB1 B;  2PZU A;  4RHR A;  1WTW A;  2VNU D;  1TII D;  1SYE A;  2HDM A;  1MBY A;  1PRT C;  5LL6 X;  2KED A;  1NSN S;  2M00 A;  3PO2 B;  2QDB A;  1PFB A;  1SJH D;  2E74 C;  4KKU A;  1FNU A;  2JYO A;  1DOL A;  3DEP A;  1WTP A;  2OF1 A;  1IW7 D;  1RD9 D;  1FR3 A;  5KND A;  1HA5 A;  2BDN A;  1IKM A;  2F0N A;  2BE5 D;  3R93 A;  5C0X G;  3U9S A;  3CQZ B;  1LTS D;  1LT3 D;  2F0Q A;  3DM1 A;  3OHX C;  1G29 1;  4BY7 B;  4C1N K;  4J6H A;  2JEA I;  3C1F A;  1QB5 D;  1AP0 A;  4C3J B;  2F0F A;  2L55 A;  1SYD A;  2PNR C;  3T4A C;  4X3K A;  1GOZ A;  1Q1E A;  2V4D A;  1ET6 A;  1PXU A;  5C0X I;  3A56 A;  1J8I A;  1LTA D;  2PPB C;  1GUO A;  4KY5 A;  2F0G A;  3M3Y B;  3TSS A;  5KRU A;  5FO9 B;  2B2T C;  5KNC A;  1K83 B;  2ENB A;  3M85 A;  1AZQ A;  1F9P A;  4IUQ A;  1EYD A;  1I4Q A;  2F0D A;  2LMC B;  3J81 E;  4TQU S;  5C4J B;  4KHV A;  1KLG D;  5NUC A;  2JE6 I;  2K5W A;  5E4W C;  3HEJ A;  4RGN A;  4QUF A;  2IX1 A;  2JP1 A;  3BDL A;  4BS9 A;  3GTM B;  1E0B A;  4RKB A;  4KD4 A;  5IGC A;  2WKC A;  1SJE D;  5J39 A;  1EQT A;  2EPB A;  2CW0 C;  1STG A;  3DWQ A;  3S2H B;  3WOE A;  2TMP A;  4XT3 B;  1EOT A;  2K03 A;  3H91 A;  3IFD A;  2EY6 A;  4F8M A;  1OXU A;  1SNP A;  2F03 A;  4OO1 G;  5KIX A;  1TS4 A;  3NTH A;  1JB3 A;  1AFP A;  3P75 A;  5C3E B;  4QUC A;  1WVL A;  1H9S B;  3HS0 C;  5C3W A;  1QOH A;  4ZAI A;  5I4D A;  4FF1 A;  3GV6 A;  4KHZ A;  1JOK A;  2KJX A;  3BG3 A;  3HRZ C;  3MEH A;  5FOB B;  4RKL A;  1EY5 A;  2XVS A;  4OO1 I;  4A3D B;  1LTB D;  3GTK B;  4R8I A;  3I72 A;  2ZXP A;  4JBW A;  1Z6H A;  2L4N A;  1DCZ A;  3I70 A;  3VR5 A;  3GV3 A;  1BBX C;  3VR2 A;  2N55 A;  4K5X A;  4TSS A;  2L12 A;  1XTC D;  2VB2 X;  4KI0 A;  5C0X H;  3EJI A;  2R92 B;  1IYV A;  2F3W A;  1LAB A;  2AQ2 B;  2A68 D;  3I73 A;  5F2D A;  2F0O A;  3VR3 A;  1MD2 D;  2JEB I;  5KEE A;  5J1Z A;  2AQ3 B;  3ITP A;  4A3K B;  3NTI A;  3VYR A;  2E2I B;  2E76 C;  5ISR A;  1HPC A;  3HP3 A;  1TS5 A;  2EJG C;  1BCP F;  3HKZ B;  1EEF D;  2A6E D;  2XRQ D;  4K5V A;  1BNZ A;  1SYB A;  1RHP A;  2Z4H A;  1CZG A;  4DNT B;  1OXV A;  1WTO A;  1KAB A;  4C3I G;  5EKK A;  1HA6 A;  2AUK A;  1CZW A;  3AB9 A;  3DHQ A;  3K6O A;  3PMF A;  2X69 A;  4KY7 A;  1EZ8 A;  1VF7 A;  3ND8 A;  1G2S A;  1JWS D;  4B9W A;  5DEH A;  3ZYY X;  5EKI A;  2WII B;  3HOU B;  5C0X J;  3PUV A;  5FK9 C;  1SAP A;  3ERQ A;  3MXN A;  4DXG A;  1SYG A;  3OOC A;  1QWY A;  2EZV A;  1LLR D;  3E6Z X;  1EWH A;  4OO1 H;  2LY7 A;  4FF2 A;  1PZJ D;  4CHT B;  2A69 D;  2IWH A;  2H4O A;  1B50 A;  2D2C C;  5M9O A;  3FRP B;  2NBF A;  4B08 A;  1SNC A;  4LMQ D;  5COY A;  3C3L A;  1S5D D;  1HUN A;  1H9K A;  1CA5 A;  1HCZ A;  2F0J A;  3EVQ A;  2IX0 A;  4ZK9 B;  3S14 B;  3TDQ A;  2PW5 A;  4HED A;  1KLU D;  2KA7 A;  5I9O A;  3A55 A;  3BYY B;  1T5E A;  1SNO A;  4P2C B;  1GUS A;  5IT9 L;  3HG9 A;  2QKI C;  2PYK A;  4A3I B;  1GHK A;  3DEO A;  5JJZ A;  1V43 A;  3WDN A;  3S1M B;  3M4Y A;  5FO8 B;  4FYD A;  4DAV A;  3GTL B;  3CHB D;  1TWC B;  2Q8I B;  1OXX K;  4RCN A;  4EQP A;  4XXE A;  1PZK D;  1QE6 A;  3V2T A;  2O5J C;  2IW3 A;  4DFA A;  4QMG A;  5M5X B;  4N9P A;  3PUY A;  1A6X A;  2Y0S B;  3I91 A;  1D5M C;  5IOD A;  5KYI A;  3QJY A;  4XTC S;  1EYC A;  1I4G A;  2D9U A;  3S2D B;  3MFG A;  2RKS A;  3OIQ A;  2XIW A;  3OIP A;  2FHT A;  1O7Z A;  3X3N A;  2ID0 A;  3TP7 A;  3S17 B;  1JWM D;  4CJ1 B;  3MC0 B;  1JWU D;  2MPM A;  3T56 B;  2PZT A;  1R9T B;  2HCC A;  2F0E A;  4HR7 B;  5JPN C;  1MGS A;  4OL7 A;  4CBV A;  1FNV A;  2L5T A;  3KLR A;  2Q8T A;  4NW2 A;  3OSO A;  5T1I A;  4LAA A;  1Q8I A;  2JA7 B;  3BVM A;  4V0B A;  1TR5 A;  2O5I C;  4C3I B;  4NP5 A;  1PTO D;  2PO4 A;  4A3E B;  2J4X A;  2BDO A;  2CVR A;  1U4L A;  1V1P B;  2NWG A;  2B39 A;  3NE5 B;  4KN4 C;  1KNE A;  3HOX B;  1HQR D;  1A3V A;  3TP5 A;  4C2M B;  3T16 A;  3N52 A;  2KVM A;  5CV7 A;  5JEA H;  5LHY 1;  2ICI A;  4DGZ A;  3X3M A;  1A2U A;  4RHS A;  1PTO B;  3HOW B;  2SOB A;  1JE4 A;  4G7H C;  2WV6 D;  2E2D C;  4NMZ A;  4UAI A;  5C5L A;  5K5P A;  3L3O C;  3E5S A;  3NK9 A;  2TSS A;  2NVQ B;  5BN3 A;  2NN6 G;  1TWG B;  3RUZ A;  1PRT F;  3QOJ A;  3ERO A;  5T1G A;  2JA8 B;  3S9W A;  3NTK A;  2RA4 A;  2EYJ A;  2BA1 A;  4DXF A;  3VA7 A;  4H7B A;  1S5C D;  4XQQ A;  2F0W A;  2NN6 I;  4XDX A;  2PZW A;  5JEA J;  4IFD G;  1STY A;  1BXT A;  3FMC A;  5EJW A;  2EYO A;  2F0S A;  1I6V C;  5BN5 A;  1X3P A;  2JA5 B;  2A6H D;  1ILQ A;  4ULL A;  5EBC A;  2QF7 A;  3K5M A;  1WD1 A;  2I46 A;  2YYZ A;  4XIG S;  1GHJ A;  2KHS A;  4DK1 A;  4K6D A;  1Y1W B;  3SK4 A;  4IFD I;  3MA2 B;  1W6J A;  2E2H B;  1AEX A;  1DJR D;  3A8I E;  3J7A F;  1FNW A;  2OXP A;  4C3H G;  2F0I A;  2XRS D;  3I8Z A;  3VR6 A;  5BN4 A;  3D31 A;  2B2W C;  5JVG 3;  5KNB A;  4ZQ3 A;  2SNM A;  3PUZ A;  2SNS A;  2G9D A;  4K5W A;  1DOM A;  2VXW A;  1JCK B;  3SHL A;  1KDC A;  2RBM A;  1DZ1 A;  1U4P A;  5M3M B;  3S15 B;  2F0M A;  1RTO A;  4Q5V A;  3KBG A;  3J7A V;  2RDG A;  4ABN A;  1ZYR D;  3HOZ B;  3Q23 A;  1BR9 A;  1EWC A;  2YU9 B;  3RZD B;  2Z4I A;  4HCE A;  1F9R A;  1X3Q A;  3MHB A;  4JK1 C;  2E75 C;  3NP8 A;  3MXP A;  4H13 C;  4PNY A;  2MUY A;  2FFK B;  1EQV A;  2CQA A;  1YNJ D;  1IW7 C;  1ROD A;  1M8A A;  3IFT A;  5M3F B;  4BBS B;  2FMC A;  1A2T A;  2F4I A;  1C4Q A;  1WCM B;  2BE5 C;  3SK6 A;  4IUN A;  5CBA E;  3S1N B;  3R3O A;  4K2K A;  4WOR A;  3KK7 A;  1V1O A;  3SEB A;  2EY5 A;  1L0Y B;  1IL8 A;  1DM0 B;  1NR4 A;  3MVV A;  2NN6 H;  5HGT A;  1D2B A;  1SDF A;  1PZI D;  1GUN A;  3C46 A;  2NVT B;  5FO7 B;  2D62 A;  3MXU A;  1K8O A;  5IT9 E;  2O4X A;  4KD3 A;  3MFY A;  1S4Z A;  2EY1 A;  3KUP A;  2F0T A;  2PCF B;  3GTJ B;  1B44 D;  4IUV A;  2PQE A;  1LT5 D;  4IFD H;  1ML0 D;  2PW7 A;  2IX3 A;  1JR0 D;  3H09 A;  4U67 3;  1V8Q A;  1STB A;  1ZEQ X;  2QEJ C;  3TP8 A;  1HQM C;  1SNM A;  3LWU A;  2R93 B;  1TVX A;  5IIF A;  1M4V A;  1BCP D;  3QO2 A;  4ID6 A;  1G8Z D;  1CT1 D;  2AWO A;  4K8I A;  4HMJ A;  3DWP A;  3S1Q B;  1PLF A;  5EQ0 A;  1I6H B;  1MSG A;  5EGT A;  4HN7 A;  2LKV A;  4OHJ A;  2K5D A;  4KKS A;  3NWS A;  3QG1 A;  4IUT A;  3W3A A;  3SE0 A;  1DON A;  1Y1V B;  2BOS A;  3P20 A;  3IL8 A;  2ICE C;  1IYU A;  3DXJ C;  4TKO B;  2F0U A;  2EJF C;  5D3I B;  1QJO A;  4F88 A;  2NB0 A;  1BCP B;  5JVH 3;  3D4R A;  1O7L A;  1G2T A;  2EYH A;  1LT4 D;  5IOC A;  5HUR A;  3HOV B;  3Q6S A;  4I7Z C;  3NHH A;  5C4H A;  2KEC A;  1SMY D;  4IUR A;  3TN2 A;  4IFD J;  3I90 A;  4A3F B;  4HMI A;  4C3H B;  2F3V A;  3G7L A;  2F0L A;  1BUV T;  3SR1 A;  1DXM A;  2PMZ B;  3FVQ A;  2XSC A;  1JQY D;  3D8G A;  1EFI D;  2JA6 B;  2RDF A;  5C4X B;  1ZXT A;  1PFN A;  1YNN D;  4MHE A;  1TS2 A;  1KDA A;  5K36 G;  4ZUI A;  1EY7 A;  1I3Q B;  3UI2 A;  3M4O B;  2EE1 A;  4RWS C;  4C1N I;  1F9Q A;  4WFN 3;  5ELC A;  3K7A B;  4KMU C;  5JAV A;  3PUX A;  1H9M A;  4ZRZ A;  2A68 C;  4BBR B;  3K0Y A;  2JXM B;  4RGO S;  1Q12 A;  4KKT A;  1A3T A;  2B8F A;  1LTI D;  1F2Y A;  3A7A B;  2N88 A;  5I2Y A;  3GTO B;  4QB4 A;  1B1Z A;  3K5O A;  4EGV A;  3WOF A;  3C2P A;  5ELB A;  3H94 A;  5CBE E;  5EKL A;  3T53 B;  2K7V A;  2B2Y C;  3QIA A;  3LNN A;  1HFG A;  1T5X D;  3HGB A;  1SYC A;  3HZX A;  5DM7 3;  5CR3 A;  1KDB A;  5D65 A;  1KAA A;  1F2L A;  3VYT A;  2B2U C;  3CRK C;  1B2T A;  1S5F D;  1GUT A;  3LX0 A;  1MI2 A;  5ELE A;  4XYO A;  3NSW A;  4ZUJ A;  2NVX B;  3NXW A;  5D14 A;  2FJ2 A;  4G4K A;  1TY2 A;  1EY4 A;  4DF7 A;  4TRD A;  1SEB D;  1WTX A;  3VYU A;  3FKI B;  2Z8L A;  3NBH A;  4J8Q A;  4KJO A;  4LK1 C;  1DYQ A;  2A69 C;  3NBI A;  4HAE A;  1CI3 M;  5E3F A;  3GD7 A;  3A54 A;  1GUW A;  4FF3 A;  1RTN A;  2ZT9 C;  3BS1 A;  4N9T A;  4L8J A;  1EZ6 A;  2KEE A;  3TBI B;  2K01 A;  3RLF A;  2A74 C;  1U4R A;  4L63 B;  5CMD A;  1ILP A;  3EQL C;  1OO9 B;  4L6T B;  2RDH A;  1CFM A;  3OMC A;  3EA6 A;  2K32 A;  4FVM A;  1HHV A;  1X32 A;  3C1E A;  3Q0A A;  5ELF A;  2IT1 A;  3J80 L;  3CKI B;  3ND9 A;  5K36 H;  1I4P A;  3A8K E;  1QNK A;  5A35 A;  2FIN B;  3RMH A;  4O42 A;  2B2W A;  1LTT D;  3S16 B;  2WAC A;  1ZKO A;  1PTO H;  3QB3 A;  5IGD A;  5I9P A;  4K14 A;  2EY2 A;  1Q90 A;  3PIO 3;  2RVL A;  5G3L F;  4OGQ C;  4ZKB B;  3M7G A;  1Z47 A;  1I4R A;  1TWF B;  3ONA B;  1B3A A;  5EPJ A;  2KQ3 A;  4PV1 C;  2ZXO A;  1U9R A;  1WD0 A;  5CYU A;  2WKD A;  1EU4 A;  2B2T A;  4F7X A;  2FMM A;  4IUU A;  1PRT D;  4PMC A;  4BY1 B;  2K28 A;  1PMR A;  3M7N A;  2VUM B;  1AZP A;  4IAL A;  3K57 A;  4IQZ A;  1I4H A;  3I4L A;  4A3B B;  1EEI D;  1SNQ A;  2F0P A;  4FO2 A;  1LT6 D;  5C6A A;  1G91 A;  1EIH A;  1NUC A;  4HSV A;  1CM9 A;  4H44 C;  1PRT B;  4AYB B;  5M5Y B;  1KNA A;  1F9S A;  1TKW B;  2XWB B;  1PTO C;  4FF4 A;  4CJ0 B;  2DNE A;  1Y8N B;  2EVB A;  3Q22 A;  3JAM L;  1EYA A;  1PDQ A;  1O7Y A;  4G7O C;  3MZ5 A;  3SK8 A;  4FXG C;  3L7Z C;  1EY6 A;  2CHB D;  2WP8 J;  4BA1 I;  4Z9C B;  4RH6 A;  1VCI A;  2SDF A;  4WRD A;  4V19 0;  2EYP A;  1STE A;  1F77 A;  2L1B A;  3URY A;  2AQ1 B;  4EVO A;  1XXG A;  3H0G B;  2ZXR A;  4R9W A;  4CKE A;  5KYL A;  5C44 B;  1ENA A;  4E6I A;  2R3Z A;  2AWN A;  1QCB D;  4RAU C;  5LL6 S;  3I4N B;  4ME5 A;  1H9S A;  1G6Z A;  5CV9 A;  1TT2 A;  1H9R A;  1O78 A;  1MSH A;  4DK0 A;  1XWE A;  3FPP A;  4U68 A;  2KCN A;  1VMP A;  3J7Y W;  1F2Z A;  4NKL A;  3PUW A;  1VF5 C;  3BVG A;  1WTQ A;  3SVM A;  1ESR A;  3K5L A;  1CQV A;  3D6C A;  1SSO A;  1QG7 A;  5FKA C;  4R8N A;  2CW0 D;  4B9X A;  1D1I A;  1LTR D;  5IGG A;  4BWG B;  3BZD B;  2IPK D;  1ICW A;  5AFW A;  1JOO A;  5M5W B;  3P1H A;  1B4O A;  5IGF A;  1IHZ A;  1NCV A;  1R4Q B;  5CV8 A;  1LAC A;  1D5X C;  3E0J A;  4DA2 A;  4Y7N B;  2A6H C;  1HUM A;  4H0L C;  4KV6 A;  4MIU A;  2O2L D;  1UEA B;  2C9O A;  1E2W A;  4QCL A;  3R2I A;  4FP5 D;  2EYL A;  3AMU A;  2JSO A;  1TWH B;  4LJZ C;  2DY8 A;  2J7Z A;  3VR4 A;  1C8C A;  4A3G B;  5I6Y A;  1ENF A;  3F2U A;  4A3M B;  2L0C A;  1JOR A;  1PYW D;  4RGM A;  2EJM A;  5EBD A;  1HRJ A;  3RD4 A;  5FLX L;  1CTM A;  1C48 A;  3GTP B;  1HTP A;  1IKL A;  1E2V A;  3KLS X;  3T51 B;  4DAY A;  2R7Z B;  1I4X A;  1D1K A;  2L9H A;  3DWA A;  3SK5 A;  1BQQ T;  1CHQ D;  2NTS A;  2SEB D;  4EQO A;  2B2V C;  2NZ1 D;  4XQN A;  1UUP A;  3D6W A;  1U4M A;  2A5H A;  4NDX A;  1AN8 A;  3I3C A;  1ZYR C;  2K04 A;  3Q24 A;  2OT2 A;  1F2M A;  1SE2 A;  4C56 C;  1RCV D;  3G6J B;  3AU7 A;  1CK1 A;  2B2Y A;  2RQX A;  4K8J A;  1B53 A;  2XNA C;  4HCS A;  4O1N A;  4UDU C;  3OWE B;  3I4M B;  4CKC A;  1I50 B;  3GQB A;  1W6K A;  1LTG D;  1YNJ C;  4ZKC B;  3MWY W;  4FNF A;  3MAQ A;  2B2U A;  2DNC A;  4IZ8 A;  4WJW A;  5KGU A;  1Y69 U;  3KF8 A;  5CV4 A;  4RA8 A;  3IAY A;  2BA0 A;  3DUZ A;  1Y8O B;  3K5N A;  3U9O A;  3NQI A;  3CU7 A;  2K33 A;  4K2L A;  1KTK A;  1L0X B;  1R4P B;  1XX8 A;  1FD7 D;  1GJX A;  3A7L A;  1D5Z C;  1II3 A;  3OW7 A;  3J80 E;  4M8A A;  1TQO A;  3P7J A;  2EOT A;  4KN7 C;  1TS3 A;  5TSS A;  2GA4 B;  3PIP 3;  1GUG A;  2H1E A;  1B9N A;  1JIC A;  4X3U A;  2BCO A;  2QIL A;  3NQT A;  1EY0 A;  4F87 A;  2M2L A;  1BF4 A;  4A3J B;  1SE3 A;  2HQE A;  5I2X A;  2NUC A;  5C4Z A;  3QWN A;  1SBB B;  3NPP A;  1VDZ A;  2B8G A;  4DNR B;  5J22 A;  1DD2 A;  2R61 A;  1FYC A;  1BCP C;  5JPM C;  4QF4 A;  5DM6 3;  3GP7 A;  4KK7 A;  1Z7T A;  1WTV A;  1EL0 A;  3VYS A;  2AUJ D;  3GTG B;  4BA2 I;  2L11 A;  3D4W A;  2F0K A;  1JC7 A;  3BVZ A;  4A93 B;  2MHV A;  3HOY B;  4EQN A;  4FXK C;  2A73 B;  4QIW B;  5DAU A;  3N6R A;  3GO5 A;  1QIL A;  1WTR A;  2HCI A;  5DNF A;  1ET9 A;  4KY6 A;  2DN8 A;  5EPK A;  3VA5 A;  1OXT A;  4XT1 B;  5CV5 A;  4CJ2 C;  1CQF A;  2A6E C;  3TZD A;  2J0T D;  1QNU A;  1VMC A;  2RSN A;  3O13 A;  3A8J E;  2K05 A;  3H6M A;  1SMY C;  3V05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...