1HR0Q

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hr0Q00
1IXRA 3F2DA 5M5WH 3B6YA 3KFUA 4IJLA 5M3FH 4GOPC 1HR0Q 1SN8A 5M5YH 3CCEA 5IP7G 4DR4Q 4L5QA 4JG2A 1PV4A 1PFSA 4YWLA 2R92G 3GD7A 1LTLA 5C44G 4LF5Q 5IP7H 3T1YQ 2PMZE 3PUZA 3CCSA 4GOPB 5GAHC 4KHPQ 3FKIH 1O7IA 3W1GA 1S40A 2WB1G 2ES2A 2WAQG 4JI6L 2R92H 5C44H 4MTNA 2UU9Q 1QVGA 2MO0A 1XNRQ 1B70B 3J7ZC 2CWPA 1NE3A 2ZM6Q 4DR6L 2UXDQ 2A19A 4IPHA 4JBKA 2HHHL 4DV4Q 3CAMA 1I94Q 3HOUH 4JI8L 1VQFA 2XTIA 4UP7A 4DAYB 4KLKA 1UE6A 4DKAC 4YY3L 4DR1Q 1PYBA 1D8LA 3CMEA 1E22A 4A3BG 5IY0A 1TWFH 1SE8A 4AIMA 1HJPA 2ZTCA 3UDFA 1HNZQ 2RHQB 4LFAQ 3SGIA 2ALYB 4LF7Q 1YHAA 4LNQA 3OTOL 1P8LA 4AQYL 1WOCA 1Q81C 3EIVA 3T1HQ 3KDFB 3W1BA 1XMOQ 2F4VL 3AFPA 2JA5G 1HH2P 4LF8L 5AJ3L 3AFQA 5GAGC 5IYDH 3BU2A 1VQKA 1K8GA 2E2HH 1FJGQ 4P72A 1EIFA 4YCUA 3RN5A 2JE6I 2OTLA 2VUMH 2D0PA 2HT1A 3I2ZA 1Z9FA 2HIVA 1M1KC 2KHIA 3TRZA 3S1QH 2VNUD 3M4OH 2N49A 1Q8KA 1K3RA 4JBJA 3CXCA 4IOCA 3PF5A 3KJPA 4X66Q 4JI3Q 1J6QA 4PZ7A 3CPWA 2C35B 3K7UC 4A3DG 4APVA 1B8AA 1IBML 1OXTA 3HOYG 4BY7G 3U50C 3IRBA 3G4SA 3JAMc 4IFDJ 4AYBG 3F1ZA 4HJ9A 3CCMA 1VQOA 3DLLA 1N8RC 3CCLA 4JV5Q 1TWCH 1HR0L 1J5EQ 3PF4A 4BY7H 3D31A 4DR4L 3PV0A 2YTXA 2HQLA 1SFOH 2LSSA 4LF6Q 5IT9c 4L5SA 4LF5L 1K83H 4Y52H 2ATWA 2UUAQ 4PG3A 1SLJA 3M85A 4B3SL 3PO3H 1XMQQ 2NVTH 4OWWB 2UU9L 1XNRL 2QEXA 1EFWA 3U4ZA 4UP9A 4JI4L 4DUZQ 4DUYQ 2ZJRA 4IPGA 2NVYH 2ZTDA 3PUVA 2KCTA 2MNAA 1FL0A 5JEAJ 1EQQA 3CCVA 1I94L 1A0IA 1I50H 1JJCB 1JJ2A 4NXNQ 3H15A 4A3EG 3CPFA 4A3JG 1YVCA 1VS0A 2YTVA 1EIYB 4DR1L 5C4XG 4OX9L 2UUBQ 4JOIC 1T9HA 1VCIA 1YITA 1GM5A 3AEVA 4A3EH 3PO2H 1KC8C 4A3JH 3S2HH 1YIJA 1EUJA 3PCOB 3E0EA 1K73C 1Z47A 4DNIA 1BKBA 5IP9G 4IPCA 4JOIA 2E8GA 1HNZL 4GKJQ 1S72A 4LFAL 4X62Q 2AKWB 1PA6A 3H3VI 1A62A 1UE1A 1SRUA 5IP9H 1XMOL 1HR0W 4XTCS 1XPOA 1QVFA 1VQHA 2VS1A 4POFA 4GLXA 4DV0L 1FJGL 2CCZA 4A3CG 2WB1E 1E7ZA 1YHQA 1VQIA 1X55A 2E2JH 2Y0SE 1PH8A 1C7YA 2I5MX 4K0KQ 4MNOA 4BBRG 3KF6A 5IYCG 1N32Q 1C9OA 1NTGA 1CSQA 4JI3L 4X66L 4GKKQ 2EIFA 1GVPA 4H02A 1VQ5A 4LF4Q 1HZBA 4LWCA 2VQEQ 1K8AC 4DR7Q 4YCWA 3JC66 4DV5L 4O2DA 1KAWA 3FHWA 2Z6KC 5M3FG 4R1JA 3WWVA 1J5EL 3KLWA 3M3YH 4GLAC 1MIUA 4LF6L 2Q2UA 3I4MG 2KHJA 2Z6KA 4JYAQ 1D7QA 2RF4A 5E7NA 1HNWQ 3I4MH 1QUQA 4A3GH 3BJUA 4BXXH 4LFCQ 4QQBX 3FKIG 3HOWH 2AMCB 3HOXG 1WJJA 1UE5A 3VDYA 2I0QA 4QGUA 1KQSA 1OXUA 2OCEA 3GTJH 1IBKQ 2YU9H 4DUZL 1L1OC 4NXMQ 1YNXA 4X64Q 3HOXH 4DUYL 4YCVA 5J3BA 1P16A 4DPGA 5FLXc 4NXNL 3K81C 3F2BA 3UDXA 4JI0Q 1L1OA 4DV3L 2Q2TA 3HOUG 1TXYA 4QY7A 4R4QA 1VQDA 1VQGA 3ER0A 4C3JH 2UXCQ 1LUZA 2JA9A 3HKZE 3G6EA 1IBLL 4DR2Q 2UUBL 3M4QA 4IOAA 2JA7H 1G6PA 1X65A 5C0XJ 1PH3A 4RMFA 5GAEC 3TEHB 3J80c 3D0FA 1GKHA 4R4OA 3CC2A 2NZOA 5M3MG 3TREA 4X62L 1Y1VG 3I7FA 1N9WA 2ZTEA 3A0JA 2BA1A 4BY1G 1XNQL 2IX0A 5FLMG 5M3MH 3RLOA 3GTOH 1Y1VH 2MFIA 4DK3C 3AYHB 4A3LG 2N78A 4BY1H 3J81i 5IYDG 5FLMH 2BH8A 4HJ7A 4IFDG 1VQEA 4DR3L 2ZJQA 4JI7Q 4A3LH 2KENA 2VUMG 1U0LA 2HIXA 3J81j 4LW1A 1VQ7A 3CC7A 5LMNQ 3CW2C 3GTPH 2RCNA 1N32L 1CKNA 4R4CA 3HOVG 4Y7NH 4GKKL 4YHHQ 2K5HA 1MKHA 4LF4L 2VQEL 1X3FA 1L0WA 4R4TA 3HOVH 1IZ6A 1E1OA 4X6AH 1OXXK 4GNXA 4IFDI 2GN5A 1YZ6A 3E9HA 4JC0A 2OTJA 2N8NA 3BZKA 1PVOA 2IT1A 5DLQE 2VQFQ 1N34Q 1N33Q 1AH9A 2PQAA 2JK8A 1N36Q 1A63A 3NENA 2WP8J 4OWTB 1K0RA 1SROA 4L5RC 3I4NH 3CP0A 3NELA 2CFMA 4LFCL 2F52A 4B3MQ 4LUZA 3PO3G 4HJ8A 3ULLA 3T1YL 1IL2A 1PH1A 2I5LX 4C3IH 5K36G 1S3OA 1AE2A 2RHSB 4QIWE 1QVCA 4NXML 2N3SA 5IWAQ 3ULPA 3RR5A 4KHPL 3RN2A 1PYSB 2Q2HA 3H0GH 4HIOA 1WCMH 2E2IH 4JI0L 3G48A 3UDGA 3L2PA 3DM3A 2ZM6L 2UXDL 3KOJA 2UXCL 2MO1A 4DV4L 3Q8DA 1EQRA 2K52A 3KJOA 1JMCA 4B3TQ 2PI2E 3PO2G 1NY4A 3E9IA 2B3GA 2K5NA 4P73A 4JCVE 5GADC 2IY5B 2VW9A 2VL6A 2A8VA 2D0OA 1VQCA 2R93H 1HNXQ 3S1MH 2R7ZH 5FJ8H 1X54A 3GO5A 3ZJYC 1YJNA 3NBHB 1K9MC 3CC4A 4LF7L 3GTKH 3K7AH 4A76A 3S16H 4A93H 4AH6A 3T1HL 4A3IH 1G291 4JI7L 1X3EA 2I5HA 3ERSX 3K80C 3BZCA 1VQ9A 4GN4B 4HJ5A 1Y1WG 2UUCQ 4LFBQ 1TWHH 1AE3A 2WAQE 3PUXA 4PMWA 3PIOA 2B29A 2NZHA 4XIGS 4DR6Q 4B3RQ 4OO1G 4YHHL 2OQ0A 1VQJA 4FDBA 2Q2IA 1HZ9A 1Y1WH 1H95A 3S17H 1X56A 4GS3A 2AHOB 4IPDA 1VQBA 1DGSA 1VQMA 1CKOA 4A3KG 4JI5Q 2YV5A 1PH9A 2IHEA 3CD6A 3PSIA 1VQ4A 1B7YB 4OWXB 4JBWA 4QL5A 3RLNA 1V43A 4YY3Q 4DV6Q 1SR3A 1MJEA 3J7A5 4A3KH 3KF6B 1KD1C 1FVIA 1TWGH 3M9BA 1PH5A 1X9NA 1Q1BA 2DGYA 1BVSA 4JV5L 3S1NH 5GROA 3OTOQ 4A3FG 2L15A 4OO1I 4JI2Q 1HZCA 4JBMA 2F4VQ 2LXKA 3HOZH 1EOVA 4A3GG 5C0XG 4BXXG 3KF8B 3HOWG 4LF9Q 1HZAA 4A3FH 1JJGA 1PH7A 2UUAL 1JB7A 4PZ8A 4P71A 4WJ3M 4NPSA 5JJKA 4L5TA 5IWAL 1PH4A 1VQ6A 1XJVA 1YI2A 3S1RH 4KI0A 2AWOA 2JEBI 2LXJA 3OYYA 1XMQL 2R7FA 2OQKA 3EN2A 3J81c 3CMAA 2VY3A 1EWIA 1QUQB 4A4IA 2D62A 4UP8A 2Z0SA 1U5KA 2K75A 3F2CA 4PZ6A 1XPUA 4JI1Q 4GLVB 2JA6G 4ME3A 2JA7G 3KYHC 5LMUQ 5C0XI 2H5XA 1E3PA 3RLFA 1IBMQ 4DR5Q 4EQ5A 1KRSA 1Q46A 5C3EH 1L1OB 2K4KA 3MEFA 4HIDA 1WFQA 1R9TH 2JA6H 3K0XA 1HNXL 4DK6C 2QA4A 4DV1Q 4AYBE 4GKJL 1XTDA 1YEZA 1FGUA 3UE0A 4GOPA 2AWNA 1E1TA 2A1AA 3I4OA 1Q82C 1E24A 3OW2A 3PGZA 4NB3A 4YWMA 1C0AA 3STBD 1GO3E 4J15A 1V9PA 4BBSG 3TS0A 3TS2A 2EXDA 3GTQH 4C3HH 4B3SQ 2IHFA 1OXVA 2NVQH 3S2DH 2UUCL 2Y0SG 4BBSH 4R4IA 1YBYA 1CSPA 4LFBL 1Q12A 2R7DA 4LUOA 3RZDH 4JI4Q 4B3RL 3EBEA 2CWAA 5HGQA 1VQPA 3TQYA 4K0KL 2JQOA 2E5LQ 4MZ9A 1NMGA 1X6OA 2CQOA 4JI5L 2K14A 4LUVA 2K50A 1W3SA 2GVAA 1RIPA 1W2BA 4DV6L 5ELOA 1M90C 3MXNB 4OX9Q 4DAMA 2OWOA 3CCRA 4GNXC 4GN5A 4DR7L 1CKNB 1TWAH 4O0AA 5IE8A 3RZOH 4UPAA 5IYBG 4DV7Q 3KDFA 4HIKA 1RL2A 3M7NA 1YHBA 3S14H 4A3BH 4IO9A 2KBNA 5IYBH 1X3GA 3A5UA 4JI2L 5JEAG 3I4NG 1LM0A 4GNXB 1WI5A 4HIMA 3RNUA 4JYAL 2FXQA 4LF9L 3NEMA 4P75A 1ASZA 1BBUA 4DV0Q 1HNWL 1PH2A 2JA5H 5JJLA 4QJFA 2IX1A 1YJ9A 2PQAB 1SMXA 2GVBA 4EX5A 4HJAA 1JT8A 1ASYA 2KCMA 3H0GG 4OXPA 2WFWA 1WCMG 3J80i 1Q7YC 1OXSC 1A8VA 2NN6G 1IBKL 2B63G 4X64L 1QZGA 4JI1L 3HFZB 2UXBQ 3A5ZB 2K5VA 3HKZG 3L7ZC 1KL9A 2PNHA 5ELNA 3M4PA 1Y14B 5EAYA 3I55A 1G51A 5LMUL 4DV2Q 2B63H 4WJ4A 1JE5A 4DV5Q 4DR5L 4DR2L 4A3DH 4X65Q 2V1CC 1WYDA 3HOYH 2R93G 4DV1L 2R7ZG 3PUYA 5HY6A 1I3QH 5BR8Q 5FJ8G 4UY8C 2MQHA 4IJHA 2NN6I 2ZJPA 4A93G 1Q1EA 1KRTA 4BA1I 3F8TA 1GD7A 4A3IG 4A75A 3PIPA 4YWKA 1XPRA 1PHJA 2CKZB 3ULJA 3GTLH 5M5XH 4GN3B 5H1SE 4TQUS 5C4JH 1I6HH 2F3IA 3STBC 2NVXH 2ID0A 1LYLA 4JI6Q 3GTMH 2YYZA 3W5OA 1UE7A 4P74A 5LMNL 1L2FA 1MJCA 4DV3Q 1KIXA 2E5LL 2JEAI 3H3VH 1KXLA 2EQSA 3I56A 3JAMi 1IBLQ 2HHHQ 1Q86C 1OTCA 1VQNA 4RG1A 1BBWA 4JI8Q 1PH6A 4DV7L 1VQAA 3AQQA 5C4XH 4C2MH 1VQLA 3UE1A 3FP9A 3S15H 2JA8G 1XNQQ 1QZHA 2VQFL 1NJIC 1N34L 1CUKA 1N33L 5JJIA 3G71A 1NMFA 3U58A 3HOZG 1UEBA 1N36L 2JA8H 1UWVA 2JJQA 3U4VA 2YTYA 1KHIA 4AQYQ 4DR3Q 3PUWA 5GQOA 4OONA 4B3ML 5AJ3Q 4LF8Q 1NBWA 4TVAB 3UDIA 3CF5A 4POGA 4A3CH 2QGQA 1EYGA 3L0OA 2BA0A 3ICEA 2VZAA 3CCJA 2PI2A 1VQ8A 3A74A 4A3MG 3CQZH 3GDEA 2DUDA 3LGJA 2UXBL 3S24A 1I5FA 3HKSA 4DV2L 4BBRH 4BA2I 5IYCH 5LMNW 1YJWA 4KHZA 1IYJB 3CCQA 3CCUA 2XGTA 4ALPA 3K8AA 4A3MH 1V1QA 4X65L 2BH2A 5C3EG 4B3TL 2R6GA 3GTGH 1CKMA 2ASBA 5BR8L
chains in the Genus database with same CATH superfamily
1IXRA 3B6YA 1VF5C 4GOPC 5EJWA 5J1ZA 2B2TA 5M5YH 5IP7G 1QCBD 2D9UA 4C3HG 4BY1B 4LF5Q 3T1YQ 3FKIH 1O7IA 4JI6L 2WAQG 3J7YW 1NNXA 2Y0SB 4FXKC 1QVGA 2PYKA 2ZM6Q 2UXDQ 4IPHA 3CAMA 4JI8L 1VQFA 3NTIA 3T13A 3HOVB 3S9WA 1UE6A 1LTTD 1D8LA 1W6KA 4A3BG 1TWFH 1GUGA 2RVLA 4AIMA 2ZTCA 3M7GA 4J1MA 3K57A 1HNZQ 4LFAQ 3SGIA 4LF7Q 1RJTA 2QW7A 3OTOL 4AQYL 1Q81C 3EIVA 1E0BA 3V05A 1HH2P 5IYDH 1CK1A 4P72A 4C3IB 3I90A 1JWUD 1KDBA 2XRQD 1Z9FA 2HIVA 3S1QH 4Z9CB 2HQEA 2IL8A 2N49A 4G7HC 2F0KA 1K3RA 3VR6A 3PF5A 4HSVA 2KEEA 4JI3Q 1CZGA 4A3DG 3EROA 2BCOA 3HOYG 4BY7G 3G4SA 3IRBA 2F0UA 3D8GA 2N55A 2SEBD 4HJ9A 3CCLA 3DLLA 3K5NA 2KECA 1XYIA 1HR0L 2R93B 2R7ZB 2CW0D 2L9HA 2HQLA 1SFOH 4LF6Q 5IT9c 1Y69U 1TQOA 2ATWA 4A3IB 2UUAQ 2SOBA 4PG3A 4JPBW 3M85A 1LTGD 1ML0D 4B3SL 4OWWB 5K36H 1XNRL 2QEXA 3MXGA 3U4ZA 4HAEA 3BVMA 4DUYQ 2NVYH 1G8ZD 1EQQA 2KCTA 1R4QB 1Y1WB 4NXNQ 5KNBA 3H15A 1SSOA 1EIYB 5C4XG 2RQXA 4JOIC 3NBHA 4RH6A 5CORA 3S2HH 1RKNA 5I4DA 3AEVA 1PTOD 4A3JH 4A3KB 1YIJA 3PO2H 1K73C 3E0EA 5IGEA 1BKBA 1PZKD 4GKJQ 4JOIA 1PRTF 2F0WA 1V1PB 5IGCA 1A62A 1UE1A 2O4XA 1HR0W 1VDZA 1QVFA 2VS1A 4POFA 4GLXA 1FJGL 3ERQA 1E7ZA 1YHQA 3DMUA 1X55A 4ZKCB 3CQZB 1PH8A 1HA5A 2JYOA 5KYIA 4H13C 4A3MB 1VQ5A 4KHVA 3SHLA 3VYRA 1LABA 1K8AC 4U68A 5IGDA 5C3EB 1UEAB 2B2YA 3MHBA 1J5EL 5C4HA 2RSOA 2MGSA 2N88A 3D6WA 3CRLC 5C0XH 3GTQB 4IURA 4LFCQ 1Z6HA 3HOWH 3HOXG 1UE5A 5C44B 3VDYA 4QGUA 3FDTA 1OXUA 2OCEA 5EPLA 1IBKQ 4NXMQ 4DUZL 1PZID 1EYAA 3LX0A 4DPGA 3I72A 1EU4A 4JI0Q 3X3NA 2L4NA 1TXYA 1VQDA 1S5FD 1VQGA 2UXCQ 1F77A 2NTTA 1G6PA 5E4XA 4IUPA 4DK1A 5C0XJ 3TEHB 1GKHA 3HG9A 3CC2A 4QUCA 3T16A 5M3MG 4X62L 3MXUA 3A0JA 2DNEA 1XNQL 2IX0A 5FLMG 1PTOC 4K8JA 2NBFA 1LT5D 1Y1VH 3KLSA 2WIIB 4DK3C 2N78A 4BY1H 3G6JB 2J4XA 4IFDG 3Q0AA 4JI7Q 2KENA 2VUMG 2HIXA 3MXNA 3CC7A 3TZUA 1B9MA 2PQEA 5DAUA 4GKKL 3T51B 2IX3A 3HOVH 1IZ6A 5KYLA 2PPBC 2F0LA 4X6AH 1OXXK 5J39A 4IFDI 2GN5A 2OTJA 2OEOA 4CKCA 5EKLA 3WOEA 5CV9A 3DHQA 3A8IE 2WP8J 4P2CB 3LWUA 4FO2A 3CP0A 3QG1A 3ULLA 1IL2A 3MA2B 5C4JB 4C3IH 1I6HB 2RHSB 2BE5C 3RR5A 1ENFA 5IIFA 3RN2A 2Q2HA 4HIOA 3G48A 3DM3A 2MO1A 1OO9B 1EQRA 3CKIB 2EYLA 1WD0A 5GADC 3OSOA 2VW9A 2VL6A 4C2MB 2A8VA 1VQCA 2R93H 2R7ZH 5IT9L 3ZJYC 3GTKH 3HS0C 4Q5VA 4A3IH 5LHY1 4ID6A 1I4PA 4XQQA 3K80C 1WTVA 5D14A 1A2UA 2QILA 4PMWA 3PUXA 2NTSA 4XIGS 3J7AV 1Y1WH 3P75A 5DEHA 3R3OA 4BBRB 4IPDA 2XNAC 2YV5A 1PH9A 2IHEA 5COYA 1B1ZA 1V43A 1SR3A 4J6HA 4A3KH 3KF6B 3GTGB 1FVIA 4ZRZA 4LJZC 4KMUC 3FMCA 4L63B 1M8AA 3OTOQ 1Z7TA 1HZCA 4BXXG 3VA7A 1F2MA 3KF8B 1HZAA 4A3FH 1PH7A 1JB7A 5JJKA 4P71A 3NTHA 2RSNA 4L5TA 1XJVA 2R92B 2JEBI 2LXJA 5JPNC 1XMQL 1D5ZC 2R7FA 1TIID 3EN2A 4CHTB 2VY3A 2D62A 3QJYA 4UP8A 2TMPA 4C3JB 3H94A 4EVOA 4JI1Q 3HOUB 1EIHA 3BZDB 4GLVB 2JA7G 3KYHC 5LMUQ 1J9OA 2B2VC 4DR5Q 4EQ5A 5C3EH 1DD2A 3I8ZA 2C9OA 3K0XA 1HNXL 3VA5A 4DV1Q 2B2UA 1LT6D 3I4OA 2E74C 1SE3A 1GO3E 1PLFA 3GTQH 1STAA 2HCIA 1WD1A 4B3SQ 2IHFA 2F0JA 2E2HB 3EA6A 3FPPA 2UUCL 4BBSH 4R4IA 1Q12A 5DM73 4B3RL 1XWEA 4B9XA 2OXPA 4MZ9A 4JI5L 2F0MA 4CDFC 1SYGA 4DV6L 1M90C 2OWOA 3D3RA 4GNXC 2EY6A 2KVMA 3M7NA 3NXWA 3S14H 4IO9A 2JSOA 2X69A 1AW7A 5IYBH 4JI2L 5C6AA 4FXDA 5JEAG 1LM0A 4HIMA 3RNUA 1LT3D 2FXQA 4LF9L 4P75A 4KKTA 2WV6D 1PH2A 1EQTA 2PQAB 2GVBA 3PO3B 2NVTB 2WFWA 2I07B 2FMCA 2NN6G 3C1FA 4X64L 1DYQA 1SDFA 4DAVA 1WTRA 2LY7A 1SYCA 2K5VA 2PNHA 4RGMA 2B63H 1Y14B 3I55A 5DNFA 2V1CC 5FO7B 3PUYA 3GP7A 4R8IA 3S16B 5IODA 2NN6I 2ZJPA 1Q1EA 2KOLA 1GD7A 1SNCA 4A75A 5BR8L 4YWKA 3TMEA 1PHJA 2CKZB 3A7AB 3D4RA 3NQIA 5C4JH 2RDFA 1I6HH 2EY5A 3MC0B 5D3IB 2SDFA 5T1IA 3GTMH 1UE7A 1LT4D 2HHHQ 2EDGA 1ESRA 1OTCA 2BOSA 1JWSD 2G5DA 1VQAA 3AQQA 4C2MH 1FNVA 3L9AX 2HCCA 2JA8G 1XNQQ 1QZHA 2VQFL 2LFNA 1N34L 1N33L 5JJIA 3G71A 4I7AA 3U58A 1KNAA 1N36L 3U4VA 4CJ1B 3I4MB 1PDQA 1ET6A 5AJ3Q 3UDIA 4FP5D 2K1BA 1JC7A 4A3CH 2QGQA 3GTJB 2BA0A 3ICEA 2VZAA 4ME5A 3CCJA 4BBRH 2P5ZX 5IYCH 1F2YA 4DK0A 4KHZA 1X3PA 3GTGH 3SK5A 2CCZA 1ESFA 3F2DA 2Q8RE 2F3WA 1SN8A 1ZYRD 3CCEA 1HTPA 4DR4Q 4L5QA 3GTOB 1PFSA 4YWLA 3V96A 3GD7A 3S2DB 2PMZE 4GOPB 3W1GA 2R92H 4MTNA 2UU9Q 3TDQA 5IT9E 2CWPA 2CH4W 4DR6L 2A19A 4ZCKA 2XVSA 3HOUH 3VR4A 4UP7A 1UAPA 2F0PA 2QEJC 2ZT9C 3O13A 3A8JE 3MEHA 2EYFA 5KNDA 1E22A 5IY0A 1SE8A 1HJPA 3OPOA 2ALYB 1WOCA 4IUUA 3KDFB 3I4NB 1I6VC 2B39A 4LMQD 2M9VA 1LV9A 2RKSA 2E2HH 5IOCA 3RN5A 1GUTA 2JE6I 4DA2A 2OTLA 2HT1A 4OHJA 3H0GB 5FKAC 3U9SA 1HFNA 1H9SB 1Q8KA 1KDAA 3RD4A 4IOCA 1TVXA 2HDMA 5IGFA 4KN7C 4QCLA 3HKZB 5CBAE 1D5XC 4NKLA 3VR3A 3SDZA 5ELDA 3U50C 3JAMc 1FR3A 4AYBG 1N8RC 2EYMA 4RKBA 1SJED 3UI2A 1JQYD 3GV6A 4CDDC 4G57A 1ZYRC 4X3TA 1SLJA 1EZ6A 4KK7A 3PO3H 1XMQQ 2NVTH 3MXPA 1TWHB 5AFWA 2XN9C 2ZJRA 3PUVA 2MNAA 1U4MA 5JEAJ 1I94L 1JJ2A 5C4ZA 3DWAA 4EQOA 4A3JG 1YVCA 3IFTA 1WTPA 1PRTD 4DR1L 3H91A 1VCIA 1YITA 1GUNA 4A3EH 1EUJA 1Y8PB 3H09A 2EYPA 2EYJA 1VMCA 1WTQA 2AKWB 1PA6A 1JWMD 1SRUA 4IALA 1HXYD 1XMOL 3T56B 1GHKA 1XPOA 2TSSA 3HOZB 1ZEQX 1VQHA 1V1OA 1TT2A 3ND8A 1A2TA 2VXWA 4QIWB 2Y0SE 1C7YA 4CJ0B 1N32Q 2FINB 2EPBA 4X66L 3Q22A 1ICWA 2EIFA 1GVPA 1HZBA 2VQEQ 2G9DA 2F0NA 2L5TA 4DV5L 1RDPD 3FHWA 1ZKOA 1EWHA 5M3FG 3K58A 4R1JA 3M3YH 1MIUA 4XT1B 1SJHD 2RF4A 3MFGA 3I4MH 1QUQA 2KQ3A 4C3HB 5DM63 2I0QA 3P7JA 3GTJH 2PZUA 2EYOA 4X64Q 1P16A 4RWSC 4NMZA 1JICA 4R4QA 3GQBA 1LUZA 2JA9A 1IBLL 2UUBL 1X65A 3V2TA 4FF4A 1TWAB 3D0FA 4R4OA 2K04A 2XWBB 3C1EA 1LTSD 1PRTC 1Y1VG 4FVMA 4A3BB 2ZTEA 2K05A 4BY1G 2Z8LA 1F9QA 3OWFA 3R2IA 3RLOA 4MIUA 3GTOH 3AYHB 1STYA 3ND9A 2HUGA 4K5WA 1VQEA 2ZJQA 2JP1A 5FLXL 5D65A 1PTOB 4S3SA 1U0LA 4LW1A 1VQ7A 1BCPC 4ZQ3A 1HRJA 3HZXA 3HOVG 1NCVA 3J80L 4LF4L 5F2DA 2WACA 3Q6SA 1X3FA 1L0WA 1EYCA 4BS9A 2NWGA 1E1OA 2ICIA 4A3DB 4MN3A 1PZJD 1SXTA 1G2TA 3HOYB 2VQFQ 1N34Q 1I3QB 1N33Q 1N36Q 2M00A 4K2KA 1SROA 4L5RC 3I4NH 3VR2A 4C3IG 4DN4M 1U4RA 4HJ8A 1B53A 2L0CA 2I5LX 1AE2A 2F0GA 4TKOB 2N3SA 5IWAQ 3ULPA 4L6TB 1C4QA 2K28A 1KLGD 2F0EA 3H0GH 2E2IH 5FO8B 1QJOA 3UDGA 3NQTA 1A3VA 3NPPA 3Q24A 3JAML 4FF2A 2K5NA 1RF2D 4JCVE 4P73A 1BDOA 5C4XB 2RBMA 1QG7A 4KY6A 1D2BA 1X54A 2AQ2B 1BF4A 5G3LF 3BYTB 3T1HL 5HURA 1BQQT 3BZCA 3FEWX 4HJ5A 1Y1WG 1TWHH 1AE3A 2F0TA 4DR6Q 4OO1G 1BCPF 4YHHL 1U9RA 1VQJA 4FDBA 1H95A 1X56A 4GS3A 2AHOB 1VQBA 1VQMA 4A3KG 3PSIA 4JBWA 3RLNA 3J7A5 1MJEA 1QWYA 3CU7A 2WKDA 1KD1C 2B2YC 4ABNA 1IKMA 2IWHA 1QILA 1FNUA 1X9NA 5M5WB 4C56C 2F0HA 4EGVA 2ICEC 4A3FG 2L15A 4OO1I 2LXKA 3HOZH 3OMCA 1GXDC 4A3GG 3NUCA 1JJGA 2BE5D 4WJ3M 4DNRB 1HUMA 5ELEA 1PH4A 3HOXB 3OYYA 1E2ZA 2OQKA 4GZYC 1I4HA 3DEPA 1LTRD 2A73B 3PIO3 1X32A 3DWQA 5CMDA 1E3PA 3KUPA 3QR8A 1L1OB 2K4KA 3MEFA 4DK6C 2EVBA 1XTDA 5M3MB 1RODA 2F03A 1II3A 4ULLA 4KKSA 3OW2A 4NB3A 3STBD 4J15A 1V9PA 2Z4IA 2EJMA 4X3KA 4BBSG 3P1HA 4C3HH 2R3ZA 2A5HA 2DJFC 5CBEE 4LFBL 1CSPA 1IW7D 2R7DA 5ISRA 2VUMB 4ZKBB 1QNKA 3IAYA 1HUNA 1X3QA 2PCFB 3TQYA 1VQPA 3OW7A 2MJ8A 1R4PB 3HEJA 1KAAA 1EOTA 1T5XD 1W2BA 4CGYB 4DR7L 4GN5A 1CKNB 1TWAH 5IE8A 4UPAA 5IYBG 4DV7Q 4HIKA 3A56A 4A3BH 1TWCB 1SAPA 5C3XA 4GNXB 3PQIA 4JYAL 4IZ8A 1HQRD 1BBUA 1K83B 2NB0A 4ZUJA 1HNWL 1YNNC 2RCFA 3C2PA 2KHSA 3DWPA 2EJGC 5I6YA 3EVQA 1PTOH 1H9KA 1WCMG 3J80i 1OXSC 1A8VA 2B63G 4K6LA 2PW5A 1DOLA 2AQ3B 4ZUIA 1K0SA 1I50B 2UXBQ 2LS01 1ASYA 3R8BA 1MI2A 5EAYA 4WJ4A 1G51A 4DV5Q 1TS2A 4DR2L 4A3DH 2J0TD 2A6ED 1JCKB 3HOYH 3S1MB 3D4WA 5HY6A 4N8X1 1I3QH 5BR8Q 5FJ8G 1S5CD 2AQ1B 4A93G 1KRTA 3L3OC 4H0LC 1HQMC 4PQXA 5H1SE 4G7ZC 3KK7A 3NP8A 3STBC 4RKLA 2E2JB 4JI6Q 5IGBA 2E5LL 4P74A 5LMNL 1IW7C 3I56A 3JAMi 2Z6BA 3MVVA 1IBLQ 1BBXC 2XWJB 1DXMA 1V1PA 1Q86C 1W6JA 4RG1A 4JI8Q 1PH6A 5FLXE 5C4XH 4RGNA 3UE1A 3FP9A 3DM1A 2JXMB 1EFID 3J80E 1CHPD 2JJQA 2EYHA 1KHIA 4AQYQ 3PUWA 2MUYA 4OONA 1NBWA 1B3AA 4DU9A 2CVRA 3L0OA 3PIP3 3GV3A 1VQ8A 3CQZH 2DUDA 1O80A 1DOMA 1I5FA 3DXJC 4LK1C 4DV2L 2ZXPA 5LMNW 4A3MH 1IYJB 3CCQA 3CCUA 2XGTA 3TP7A 1V1QA 4X65L 2BH2A 2JA7B 3C46A 4B3TL 4DGZA 2M2LA 2F0DA 2B2UC 5M5WH 4IJLA 3DEOA 2A6EC 3TZDA 1HR0Q 1CI3M 1AEXA 2R92G 1FNWA 3JAME 3PUZA 3CCSA 5GAHC 1HHVA 2ES2A 1S40A 2WB1G 4HCSA 5C44H 2XRSD 2MO0A 1XNRQ 5J22A 1B70B 1I4XA 2SNSA 3GTPB 1MD2D 3W3AA 4KTAA 4WORA 4Y7NB 2L55A 1NR2A 4O1NA 4DAYB 1VMPA 2O5JC 5FOBB 4DKAC 1PYBA 2CQAA 1JR0D 3UDFA 5K5PA 1FD7D 4G7OC 1TU2B 5I2XA 4FF1A 1ICFB 1ZXTA 3T1HQ 1U4LA 3W1BA 3AFPA 2JA5G 3I91A 4RFBA 4LF8L 3AFQA 5GAGC 3BU2A 1EY4A 3MTSA 2QF7A 1FJGQ 1QB5D 2MP1A 1TKWB 2VUMH 2D0PA 2PZTA 1SE4A 3IFDA 3I2ZA 5A2QL 1M1KC 2K6AA 1C48A 1JOKA 3CXCA 3FVQA 3KJPA 5ELCA 5EQ0A 3NWTA 3CPWA 1E2WA 1STBA 4EQNA 1B8AA 1IBML 4I65A 4IFDJ 1GUSA 3CCMA 3E5SA 1TWCH 1J5EQ 3PF4A 3D31A 1MBYA 1F9SA 4ILWA 2BDOA 2A69C 3K7AB 4LF5L 1K83H 1H9MA 1ONLA 1A6XA 3SXHA 2MHVA 2PW7A 1STEA 3A8KE 4JI4L 2WKCA 4DUZQ 2Q2UA 5EGTA 1FL0A 3CCVA 1I50H 3S17B 1EEID 4A3EG 3CPFA 1S5BD 1VS0A 2EE1A 2YTVA 3BDLA 1S4ZA 2NUCA 1EYDA 1KC8C 1BR9A 4DNIA 4IPCA 1HNZL 1S72A 4LFAL 4X62Q 4KJNA 3H3VI 3S1NB 1LO5D 5IP9H 4XTCS 3AU7A 1DCZA 3QOJA 2E2JH 4OGQC 4ZLTF 1F2LA 2C5CA 2SNMA 5CGKA 3KF6A 1C9OA 1NTGA 1CSQA 1UUPA 4JI3L 4GKKQ 4H02A 4RAUC 4LWCA 4DR7Q 4N9PA 1B2TA 4O2DA 1KAWA 2EXZA 2JA6B 2Z6KC 5T1GA 4RCOA 3KF8A 3AB9A 3WWVA 3KLWA 1D1KA 4LF6L 4XYOA 3I4MG 2KHJA 2Z6KA 4JYAQ 2L11A 4L8JA 1D7QA 4KN4C 4XDXA 1RTNA 1HNWQ 3BJUA 4BXXH 5CV7A 1KLUD 4QQBX 3FKIG 3C3LA 2AMCB 2ZXOA 1WJJA 1H9JA 1WTWA 2NVQB 1K3BC 1TR5A 3QWNA 4NW2A 5KNCA 4DUYL 3RZDB 4YCVA 5J3BA 2PNRC 5FLXc 4NXNL 3UDXA 2Q2TA 4DV3L 1EQVA 3W2DA 1MSHA 2X6LA 2F1MA 4C3JH 3HKZE 1STHA 4K8IA 4DR2Q 2JA7H 1MHWC 1TS5A 3J80c 4B9WA 4MHEA 3TREA 3I7FA 2BA1A 3G7LA 1PYWD 3A55A 1SBBB 2MFIA 3D4DA 4RGOS 3SE0A 3RMHA 1CFMA 5IYDG 2BH8A 4HJ7A 4G4KA 1PRTB 4DR3L 4A3LH 2KA7A 3J81j 2FJ2A 3SEBA 4JK1C 5LMNQ 3CW2C 1AP0A 3GTPH 2RCNA 3NBIA 4Y7NH 1TS4A 5EBDA 2VB2X 1MKHA 3TP5A 4XQJA 3BS1A 3URYA 4FF3A 5KIXA 3E9HA 1YZ6A 1PVOA 2N8NA 4TSSA 3CRKC 5DLQE 4AYBB 1AH9A 2PQAA 1A63A 3NENA 4OWTB 5JEAH 1J8IA 2CFMA 4LFCL 3H3VC 2F52A 5M5XB 4XYQA 1PH1A 5K36G 3P20A 3SR1A 1A3TA 4QIWE 1QVCA 4NXML 4KHPL 4JI0L 1BOSA 3KOJA 2ZXRA 2UXCL 4DV4L 3Q8DA 2K52A 4K2LA 1EY7A 1SMYD 4HEDA 1BUVT 4B3TQ 1DZ1A 2A68C 4A3JB 3PO2G 3E9IA 1DJRD 2IY5B 1TY2A 4CJ2C 5G3LD 2VB3X 1SYBA 1HNXQ 5EKIA 4XT3B 1G6ZA 4HTHA 1MGSA 3NBHB 1K9MC 3CC4A 3S16H 3K7AH 1SYEA 2IW3A 4AH6A 3BVGA 1O7LA 5E1FA 4JI7L 1GOZA 4NP5A 1V8QA 1X3EA 1XX8A 1BCPD 2F4IA 1B3QA 4GN4B 2UUCQ 4PNYA 2WAQE 2NZHA 4B3RQ 4KY5A 3S17H 3TP6A 5A35A 1DGSA 4IQZA 3K5OA 4JI5Q 3CD6A 2FMMA 2B2WA 2KEDA 1VQ4A 4B08A 4M8AA 4DV6Q 1AZPA 4K14A 5EBCA 5LL6S 2L12A 5JPMC 4JV5L 5M3FB 3S1NH 3E0JA 1HCZA 4DF7A 2E76C 5HGTA 4JI2Q 4C1NI 3R93A 2E75C 5C0XG 4RCNA 4LF9Q 3HOWG 5CV8A 1GUWA 4F87A 4PZ8A 4NPSA 3BVZA 3ZYYX 1VQ6A 1YI2A 4KI0A 3HP3A 2AWOA 3J81c 3LNNA 3BDCA 4A4IA 2ENBA 2WAQB 1U5KA 2K75A 3CHBD 2WINB 4IN3A 3F2CA 1NUCA 1XPUA 4EQPA 4ME3A 3NTKA 5C0XI 5D3DA 2H5XA 1IBMQ 3RLFA 4K6DA 1Q90A 2QDBA 1SNMA 1PFMA 1Q46A 2JA6H 1IKLA 1SMYC 1YEZA 1FGUA 4GOPA 1HA6A 1Y1VB 2A1AA 1Q82C 2AUKA 3N6RA 4UHVA 4YWMA 1KNEA 4PV1C 1B50A 1F2ZA 1IYUA 4DFAA 2EXDA 2KCCA 2F0VA 1H9RA 3S2DH 2NVQH 2K5DA 2Y0SG 4V190 3RZDH 4JI4Q 2K33A 3EBEA 3K59A 4K0KL 3M4OB 3QIAA 1NMGA 4PMBA 2K50A 2GVAA 5ELOA 1JB3A 3MXNB 4O0AA 3U9OA 1UNSA 3KDFA 1HFGA 1YHBA 3I3CA 2KBNA 4BY7B 4OIJA 1X3GA 2K7VA 4CKEA 1L0XB 3NHHA 1CT1D 2L1BA 5JJLA 1GUOA 1H9SA 1A3UA 2FFKB 5CR3A 3DUZA 4EX5A 4HR7B 4HJAA 3IKJA 1L0YB 1Q7YC 4V0BA 1ET9A 1QZGA 3MZ5A 4JI1L 4F88A 4KY7A 3L7ZC 4XXEA 1KL9A 5LMUL 1EY6A 5CYUA 1JORA 1JE5A 4DR5L 4OIKA 2V4DA 4RHRA 4CDEC 1WYDA 1S5ED 2R93G 2DNCA 1KABA 4DV1L 2R7ZG 3RUZA 1S5DD 1BNZA 3GTKB 2D5DA 3T53B 4IJHA 4BA1I 3F8TA 4A3IG 3VYSA 1ENAA 1XPRA 4I7ZC 5M5XH 5BN5A 4TQUS 2D2CC 2K01A 4R9WA 1EWCA 2ID0A 1EY5A 2QDLA 1LYLA 1FYCA 2YYZA 3W5OA 2JEAI 1MJCA 4DV3Q 1KIXA 1KXLA 4ZK9B 2Q8IB 3ONAB 1RCVD 3FRPB 5C5LA 1VQLA 1LACA 3E6ZX 3R2TA 1CUKA 1UWVA 1YNND 4A3FB 1XXGA 4DAPA 4A3GB 4DR3Q 2DN8A 5GQOA 1M4VA 1SNQA 4B3ML 4POGA 4TVAB 2PO4A 1U4PA 5JAVA 3EQLC 1EYGA 2YU9B 3A74A 4A3MG 3S24A 3HKSA 4BA2I 3VR5A 4K5VA 1YJWA 4ALPA 2K32A 5C3EG 2F0OA 2R6GA 1MSGA 2QCPX 1CKMA 3BYYB 1LTBD 1CM9A 4KV6A 3KFUA 5M3FH 1STNA 1SNOA 3BG3A 4JW0A 3HRZC 1B44D 3PMFA 4JG2A 1PV4A 2CW0C 4WFN3 3OHXC 1LTLA 2CHBD 5C44G 5IP7H 5JVH3 2I46A 4KJOA 4BBSB 3WDNA 4KHPQ 2K03A 3J81L 2F0QA 3J7ZC 1NE3A 4JBKA 2HHHL 4DV4Q 1CQVA 1I94Q 4DXGA 5EPJA 4HMJA 2XTIA 4KLKA 3EFXD 2KUMA 2GA4B 2MPMA 4YY3L 2X6GA 4DR1Q 3NSWA 3S14B 3CMEA 2OT2A 3FPUB 3Q23A 3OMGA 2RHQB 2HDLA 4PMCA 1RHPA 4HMIA 1YHAA 4LNQA 3KLRA 1P8LA 3LWEA 2F4VL 1XMOQ 1EZ8A 1IL8A 1AZQA 1CQFA 5AJ3L 2DJGC 1VQKA 1JE4A 1K8GA 1EIFA 3D6CA 4YCUA 5CC4A 2A6HD 4WJWA 3A54A 2VNUD 2KHIA 1WCMB 3TRZA 3M4OH 2B8GA 2B63B 4JBJA 3MAQA 4X66Q 1J6QA 4PZ7A 2C35B 3K7UC 4APVA 1CTMA 2EY1A 1OXTA 5FK9C 2Z4HA 3K5MA 1KDCA 1VQOA 3F1ZA 2H1EA 4JV5Q 1SNPA 4BY7H 4TRDA 4DR4L 3PV0A 2YTXA 5ELBA 1PXUA 2J7ZA 2LSSA 4A93B 3KBGA 4L5SA 2XIWA 5E4WC 4Y52H 1QOHA 3GTMB 2UU9L 1SYFA 3QB3A 1EFWA 4UP9A 2IJ0A 3I4LA 1CHQD 4IPGA 2ZTDA 3TBIB 4CKBA 5BN4A 1A0IA 1JJCB 2XSCA 2CH4A 1G91A 4RHSA 4J8QA 4OX9L 2UUBQ 2A74C 1T9HA 4QF4A 1K28A 1GM5A 1YNJD 3OWEB 3PCOB 1Z47A 1TWGB 4HN7A 5IP9G 4CBVA 1JOOA 2E8GA 4NDXA 3M4YA 1PTOF 1BXTA 2NZ1D 3NE5B 4DXFA 1VF7A 1CA5A 5FO9B 2BDNA 4DV0L 2O5IC 4A3CG 2WB1E 1VQIA 1EY8A 3S1RB 4O42A 3VYUA 4U673 2I5MX 4K0KQ 4MNOA 4BBRG 4F7XA 5IYCG 4M1UB 4OO1H 2A6HC 4KD3A 1QNUA 3N52A 1WVLA 4LF4Q 4HSPA 4YCWA 1RTOA 3JC66 4KKUA 1R9TB 5CV6A 1Y8OB 4GLAC 2OF1A 2A69D 1DM0B 4C1NK 5E7NA 4A3GH 1LTAD 1TY0A 5IGGA 1EL0A 4N8FA 1KQSA 3TSSA 1ENCA 2YU9H 1WTXA 1L1OC 1B4OA 1B9NA 1YNXA 2WB1B 5JOBA 3HOXH 4C3JG 3F2BA 3K81C 3HOUG 1L1OA 5ELFA 4QY7A 1JOQA 3ER0A 4ODGA 1JT8A 3G6EA 4IOAA 3M4QA 5KGUA 1DOKA 2B2VA 4RMFA 5GAEC 1PH3A 3RZOB 2F0FA 1O7YA 4HCEA 2NZOA 1K8OA 1N9WA 1YNJC 5M3MH 2O2LD 4UDUC 4N9TA 4A3LG 3J81i 5FLMH 4IUQA 4CDCC 2JA5B 4UAIA 1I4GA 5JVG3 4IFDH 5TSSA 3QO2A 1N32L 1CKNA 1FGBD 4R4CA 4YHHQ 2K5HA 4H44C 2VQEL 4R4TA 1GJXA 2E2DC 4GNXA 1I4RA 4JC0A 4ZYSA 3BZKA 2IT1A 2B8FA 2JK8A 2QKIC 1SEBD 4QB4A 3OOCA 1K0RA 3NELA 1F9RA 4B3MQ 3H6MA 3KLSX 3GTLB 4LUZA 3PO3G 3T1YL 2RDGA 1S3OA 3MWYW 2NVXB 1PYSB 5M9OA 1XTCD 1WCMH 1Q3LA 1D5MC 3L2PA 2ZM6L 2UXDL 1JMCA 3KJOA 4E6IA 4LAAA 4A3EB 3EJIA 2PI2E 1NY4A 2B3GA 1AFPA 3QOLA 3J81E 5LL6X 1EY0A 1KTKA 4FYDA 3S15B 2D0OA 3T4AC 3S1MH 5C3WA 3I70A 3GO5A 5FJ8H 1YJNA 3K5LA 4A93H 4LF7L 2JA8B 4A76A 5CV5A 3X3MA 5E3FA 4OEMB 4X3UA 1G291 1G2SA 1D6EC 2DY7A 4Q0FA 1EEFD 2I5HA 3ERSX 1WTHA 1LTID 1VQ9A 1AN8A 4RGTA 4LFBQ 3PIOA 1PMRA 2B29A 5I6WA 2OQ0A 2Q2IA 1HZ9A 5NUCA 1CZWA 1CKOA 1Y8NB 1B7YB 4OWXB 4QL5A 4YY3Q 2F0IA 2DY8A 2EOTA 3KBXA 1E2VA 1TWGH 3M3YB 3M9BA 1PH5A 1O78A 1PFNA 1Q1BA 2DGYA 1BVSA 2NYZD 2RA4A 5GROA 2EZVA 1NAPA 5M5YB 4IUVA 4JBMA 2F4VQ 4FXGC 1EOVA 4X3SA 3BDOA 2FHTA 2UUAL 5IWAL 3FKIB 4QMGA 3S1RH 4JVZA 3CMAA 1EWIA 1QUQB 1O7ZA 2Z0SA 4PZ6A 1SE2A 2A68D 1SNDA 2JA6G 3IL8A 1SYDA 2Q8TA 1F9PA 2R61A 5EKKA 1R9TH 1KRSA 4HIDA 1Q8IA 1WFQA 1TWFB 4R8NA 2QA4A 4AYBE 4GKJL 3E3XA 1BO0A 3UE0A 2AWNA 1E1TA 1E24A 2G9HD 3PGZA 1C0AA 3TS0A 3TS2A 1OXVA 2KCNA 1EU3A 3SK8A 1YBYA 2PZWA 2Z1CA 4LUOA 4DAYA 3J7AF 2CWAA 5HGQA 4KD4A 3S1QB 2JQOA 2E5LQ 1X6OA 2CQOA 2K14A 4LUVA 1W3SA 4XQNA 1NSNS 1RIPA 2JN4A 4MTKA 4OX9Q 4DAMA 3CCRA 2LKVA 5KRUA 1ILPA 3RZOH 5CV4A 1HTLD 1BCPB 4IUNA 1RL2A 4ZAIA 3A5UA 3I4NG 1SFOB 1WI5A 1D1IA 3NEMA 1ASZA 4DV0Q 5C5MA 2JA5H 4QJFA 3K6OA 2PMZB 1YJ9A 2IX1A 3HGBA 1SMXA 5EPKA 5KEEA 4YIJA 2K5WA 3H0GG 1PFBA 1TS3A 2KCMA 4OXPA 4QUFA 1IBKL 2E2IB 3SK4A 1C8CA 3NK9A 2NVYB 2K5QA 5I9PA 2EY2A 3HFZB 3A5ZB 3HKZG 2NN6H 5ELNA 4DV2Q 4H7BA 3M4PA 2AUJD 2F0SA 1EY9A 4X65Q 1GHJA 3S2HB 3PO2B 4K5XA 1T5EA 1A15A 4UY8C 2MQHA 3MFYA 5I9OA 1DONA 4DNTB 3AMUA 3SVMA 3PIPA 4FNFA 3ULJA 3GTLH 1ILQA 2LMCB 4GN3B 2F3IA 1EIGA 2NVXH 3F2UA 5L37A 3ITPA 3H3VH 1K8MA 3VYTA 1L2FA 2EQSA 4F8MA 3NWSA 3SK6A 2B2WC 1VQNA 1BBWA 5JJZA 4DV7L 1LLRD 3S15H 2H4OA 1CA6A 5I2YA 3TP8A 1I4QA 5BN3A 1NJIC 1NMFA 3HOZG 1UEBA 1IHZA 2Z9HA 4IUTA 5A2QE 2JA8H 2KJXA 3I73A 2YTYA 4WRDA 4BWGB 4RA8A 1HPCA 3OIPA 4LF8Q 3HOWB 3CF5A 1IYVA 2RDHA 1WTOA 3K0YA 1STGA 1NR4A 4OELB 3TN2A 2PI2A 4OL7A 3GDEA 3LGJA 3WOFA 2UXBL 2IPKD 3A7LA 3K8AA 2EJFC 2HD3A 1QE6A 2F3VA 2ASBA 3OIQA 2B2TC 1RD9D
chains in the Genus database with same CATH topology
1IXRA 3F2DA 5M5WH 3B6YA 3KFUA 4IJLA 5M3FH 4GOPC 1HR0Q 1SN8A 5M5YH 3CCEA 5IP7G 4DR4Q 4L5QA 4JG2A 1PV4A 1PFSA 4YWLA 2R92G 3GD7A 1LTLA 5C44G 4LF5Q 5IP7H 3T1YQ 2PMZE 3PUZA 3CCSA 4GOPB 5GAHC 4KHPQ 3FKIH 1O7IA 3W1GA 1S40A 2WB1G 2ES2A 2WAQG 4JI6L 2R92H 5C44H 4MTNA 2UU9Q 1QVGA 2MO0A 1XNRQ 1B70B 3J7ZC 2CWPA 1NE3A 2ZM6Q 4DR6L 2UXDQ 2A19A 4IPHA 4JBKA 2HHHL 4DV4Q 3CAMA 1I94Q 3HOUH 4JI8L 1VQFA 2XTIA 4UP7A 4DAYB 4KLKA 1UE6A 4DKAC 4YY3L 4DR1Q 1PYBA 1D8LA 3CMEA 1E22A 4A3BG 5IY0A 1TWFH 1SE8A 4AIMA 1HJPA 2ZTCA 3UDFA 1HNZQ 2RHQB 4LFAQ 3SGIA 2ALYB 4LF7Q 1YHAA 4LNQA 3OTOL 1P8LA 4AQYL 1WOCA 1Q81C 3EIVA 3T1HQ 3KDFB 3W1BA 1XMOQ 2F4VL 3AFPA 2JA5G 1HH2P 4LF8L 5AJ3L 3AFQA 5GAGC 5IYDH 3BU2A 1VQKA 1K8GA 2E2HH 1FJGQ 4P72A 1EIFA 4YCUA 3RN5A 2JE6I 2OTLA 2VUMH 2D0PA 2HT1A 3I2ZA 1Z9FA 2HIVA 1M1KC 2KHIA 3TRZA 3S1QH 2VNUD 3M4OH 2N49A 1Q8KA 1K3RA 4JBJA 3CXCA 4IOCA 3PF5A 3KJPA 4X66Q 4JI3Q 1J6QA 4PZ7A 3CPWA 2C35B 3K7UC 4A3DG 4APVA 1B8AA 1IBML 1OXTA 3HOYG 4BY7G 3U50C 3IRBA 3G4SA 3JAMc 4IFDJ 4AYBG 3F1ZA 4HJ9A 3CCMA 1VQOA 3DLLA 1N8RC 3CCLA 4JV5Q 1TWCH 1HR0L 1J5EQ 3PF4A 4BY7H 3D31A 4DR4L 3PV0A 2YTXA 2HQLA 1SFOH 2LSSA 4LF6Q 5IT9c 4L5SA 4LF5L 1K83H 4Y52H 2ATWA 2UUAQ 4PG3A 1SLJA 3M85A 4B3SL 3PO3H 1XMQQ 2NVTH 4OWWB 2UU9L 1XNRL 2QEXA 1EFWA 3U4ZA 4UP9A 4JI4L 4DUZQ 4DUYQ 2ZJRA 4IPGA 2NVYH 2ZTDA 3PUVA 2KCTA 2MNAA 1FL0A 5JEAJ 1EQQA 3CCVA 1I94L 1A0IA 1I50H 1JJCB 1JJ2A 4NXNQ 3H15A 4A3EG 3CPFA 4A3JG 1YVCA 1VS0A 2YTVA 1EIYB 4DR1L 5C4XG 4OX9L 2UUBQ 4JOIC 1T9HA 1VCIA 1YITA 1GM5A 3AEVA 4A3EH 3PO2H 1KC8C 4A3JH 3S2HH 1YIJA 1EUJA 3PCOB 3E0EA 1K73C 1Z47A 4DNIA 1BKBA 5IP9G 4IPCA 4JOIA 2E8GA 1HNZL 4GKJQ 1S72A 4LFAL 4X62Q 2AKWB 1PA6A 3H3VI 1A62A 1UE1A 1SRUA 5IP9H 1XMOL 1HR0W 4XTCS 1XPOA 1QVFA 1VQHA 2VS1A 4POFA 4GLXA 4DV0L 1FJGL 2CCZA 4A3CG 2WB1E 1E7ZA 1YHQA 1VQIA 1X55A 2E2JH 2Y0SE 1PH8A 1C7YA 2I5MX 4K0KQ 4MNOA 4BBRG 3KF6A 5IYCG 1N32Q 1C9OA 1NTGA 1CSQA 4JI3L 4X66L 4GKKQ 2EIFA 1GVPA 4H02A 1VQ5A 4LF4Q 1HZBA 4LWCA 2VQEQ 1K8AC 4DR7Q 4YCWA 3JC66 4DV5L 4O2DA 1KAWA 3FHWA 2Z6KC 5M3FG 4R1JA 3WWVA 1J5EL 3KLWA 3M3YH 4GLAC 1MIUA 4LF6L 2Q2UA 3I4MG 2KHJA 2Z6KA 4JYAQ 1D7QA 2RF4A 5E7NA 1HNWQ 3I4MH 1QUQA 4A3GH 3BJUA 4BXXH 4LFCQ 4QQBX 3FKIG 3HOWH 2AMCB 3HOXG 1WJJA 1UE5A 3VDYA 2I0QA 4QGUA 1KQSA 1OXUA 2OCEA 3GTJH 1IBKQ 2YU9H 4DUZL 1L1OC 4NXMQ 1YNXA 4X64Q 3HOXH 4DUYL 4YCVA 5J3BA 1P16A 4DPGA 5FLXc 4NXNL 3K81C 3F2BA 3UDXA 4JI0Q 1L1OA 4DV3L 2Q2TA 3HOUG 1TXYA 4QY7A 4R4QA 1VQDA 1VQGA 3ER0A 4C3JH 2UXCQ 1LUZA 2JA9A 3HKZE 3G6EA 1IBLL 4DR2Q 2UUBL 3M4QA 4IOAA 2JA7H 1G6PA 1X65A 5C0XJ 1PH3A 4RMFA 5GAEC 3TEHB 3J80c 3D0FA 1GKHA 4R4OA 3CC2A 2NZOA 5M3MG 3TREA 4X62L 1Y1VG 3I7FA 1N9WA 2ZTEA 3A0JA 2BA1A 4BY1G 1XNQL 2IX0A 5FLMG 5M3MH 3RLOA 3GTOH 1Y1VH 2MFIA 4DK3C 3AYHB 4A3LG 2N78A 4BY1H 3J81i 5IYDG 5FLMH 2BH8A 4HJ7A 4IFDG 1VQEA 4DR3L 2ZJQA 4JI7Q 4A3LH 2KENA 2VUMG 1U0LA 2HIXA 3J81j 4LW1A 1VQ7A 3CC7A 5LMNQ 3CW2C 3GTPH 2RCNA 1N32L 1CKNA 4R4CA 3HOVG 4Y7NH 4GKKL 4YHHQ 2K5HA 1MKHA 4LF4L 2VQEL 1X3FA 1L0WA 4R4TA 3HOVH 1IZ6A 1E1OA 4X6AH 1OXXK 4GNXA 4IFDI 2GN5A 1YZ6A 3E9HA 4JC0A 2OTJA 2N8NA 3BZKA 1PVOA 2IT1A 5DLQE 2VQFQ 1N34Q 1N33Q 1AH9A 2PQAA 2JK8A 1N36Q 1A63A 3NENA 2WP8J 4OWTB 1K0RA 1SROA 4L5RC 3I4NH 3CP0A 3NELA 2CFMA 4LFCL 2F52A 4B3MQ 4LUZA 3PO3G 4HJ8A 3ULLA 3T1YL 1IL2A 1PH1A 2I5LX 4C3IH 5K36G 1S3OA 1AE2A 2RHSB 4QIWE 1QVCA 4NXML 2N3SA 5IWAQ 3ULPA 3RR5A 4KHPL 3RN2A 1PYSB 2Q2HA 3H0GH 4HIOA 1WCMH 2E2IH 4JI0L 3G48A 3UDGA 3L2PA 3DM3A 2ZM6L 2UXDL 3KOJA 2UXCL 2MO1A 4DV4L 3Q8DA 1EQRA 2K52A 3KJOA 1JMCA 4B3TQ 2PI2E 3PO2G 1NY4A 3E9IA 2B3GA 2K5NA 4P73A 4JCVE 5GADC 2IY5B 2VW9A 2VL6A 2A8VA 2D0OA 1VQCA 2R93H 1HNXQ 3S1MH 2R7ZH 5FJ8H 1X54A 3GO5A 3ZJYC 1YJNA 3NBHB 1K9MC 3CC4A 4LF7L 3GTKH 3K7AH 4A76A 3S16H 4A93H 4AH6A 3T1HL 4A3IH 1G291 4JI7L 1X3EA 2I5HA 3ERSX 3K80C 3BZCA 1VQ9A 4GN4B 4HJ5A 1Y1WG 2UUCQ 4LFBQ 1TWHH 1AE3A 2WAQE 3PUXA 4PMWA 3PIOA 2B29A 2NZHA 4XIGS 4DR6Q 4B3RQ 4OO1G 4YHHL 2OQ0A 1VQJA 4FDBA 2Q2IA 1HZ9A 1Y1WH 1H95A 3S17H 1X56A 4GS3A 2AHOB 4IPDA 1VQBA 1DGSA 1VQMA 1CKOA 4A3KG 4JI5Q 2YV5A 1PH9A 2IHEA 3CD6A 3PSIA 1VQ4A 1B7YB 4OWXB 4JBWA 4QL5A 3RLNA 1V43A 4YY3Q 4DV6Q 1SR3A 1MJEA 3J7A5 4A3KH 3KF6B 1KD1C 1FVIA 1TWGH 3M9BA 1PH5A 1X9NA 1Q1BA 2DGYA 1BVSA 4JV5L 3S1NH 5GROA 3OTOQ 4A3FG 2L15A 4OO1I 4JI2Q 1HZCA 4JBMA 2F4VQ 2LXKA 3HOZH 1EOVA 4A3GG 5C0XG 4BXXG 3KF8B 3HOWG 4LF9Q 1HZAA 4A3FH 1JJGA 1PH7A 2UUAL 1JB7A 4PZ8A 4P71A 4WJ3M 4NPSA 5JJKA 4L5TA 5IWAL 1PH4A 1VQ6A 1XJVA 1YI2A 3S1RH 4KI0A 2AWOA 2JEBI 2LXJA 3OYYA 1XMQL 2R7FA 2OQKA 3EN2A 3J81c 3CMAA 2VY3A 1EWIA 1QUQB 4A4IA 2D62A 4UP8A 2Z0SA 1U5KA 2K75A 3F2CA 4PZ6A 1XPUA 4JI1Q 4GLVB 2JA6G 4ME3A 2JA7G 3KYHC 5LMUQ 5C0XI 2H5XA 1E3PA 3RLFA 1IBMQ 4DR5Q 4EQ5A 1KRSA 1Q46A 5C3EH 1L1OB 2K4KA 3MEFA 4HIDA 1WFQA 1R9TH 2JA6H 3K0XA 1HNXL 4DK6C 2QA4A 4DV1Q 4AYBE 4GKJL 1XTDA 1YEZA 1FGUA 3UE0A 4GOPA 2AWNA 1E1TA 2A1AA 3I4OA 1Q82C 1E24A 3OW2A 3PGZA 4NB3A 4YWMA 1C0AA 3STBD 1GO3E 4J15A 1V9PA 4BBSG 3TS0A 3TS2A 2EXDA 3GTQH 4C3HH 4B3SQ 2IHFA 1OXVA 2NVQH 3S2DH 2UUCL 2Y0SG 4BBSH 4R4IA 1YBYA 1CSPA 4LFBL 1Q12A 2R7DA 4LUOA 3RZDH 4JI4Q 4B3RL 3EBEA 2CWAA 5HGQA 1VQPA 3TQYA 4K0KL 2JQOA 2E5LQ 4MZ9A 1NMGA 1X6OA 2CQOA 4JI5L 2K14A 4LUVA 2K50A 1W3SA 2GVAA 1RIPA 1W2BA 4DV6L 5ELOA 1M90C 3MXNB 4OX9Q 4DAMA 2OWOA 3CCRA 4GNXC 4GN5A 4DR7L 1CKNB 1TWAH 4O0AA 5IE8A 3RZOH 4UPAA 5IYBG 4DV7Q 3KDFA 4HIKA 1RL2A 3M7NA 1YHBA 3S14H 4A3BH 4IO9A 2KBNA 5IYBH 1X3GA 3A5UA 4JI2L 5JEAG 3I4NG 1LM0A 4GNXB 1WI5A 4HIMA 3RNUA 4JYAL 2FXQA 4LF9L 3NEMA 4P75A 1ASZA 1BBUA 4DV0Q 1HNWL 1PH2A 2JA5H 5JJLA 4QJFA 2IX1A 1YJ9A 2PQAB 1SMXA 2GVBA 4EX5A 4HJAA 1JT8A 1ASYA 2KCMA 3H0GG 4OXPA 2WFWA 1WCMG 3J80i 1Q7YC 1OXSC 1A8VA 2NN6G 1IBKL 2B63G 4X64L 1QZGA 4JI1L 3HFZB 2UXBQ 3A5ZB 2K5VA 3HKZG 3L7ZC 1KL9A 2PNHA 5ELNA 3M4PA 1Y14B 5EAYA 3I55A 1G51A 5LMUL 4DV2Q 2B63H 4WJ4A 1JE5A 4DV5Q 4DR5L 4DR2L 4A3DH 4X65Q 2V1CC 1WYDA 3HOYH 2R93G 4DV1L 2R7ZG 3PUYA 5HY6A 1I3QH 5BR8Q 5FJ8G 4UY8C 2MQHA 4IJHA 2NN6I 2ZJPA 4A93G 1Q1EA 1KRTA 4BA1I 3F8TA 1GD7A 4A3IG 4A75A 3PIPA 4YWKA 1XPRA 1PHJA 2CKZB 3ULJA 3GTLH 5M5XH 4GN3B 5H1SE 4TQUS 5C4JH 1I6HH 2F3IA 3STBC 2NVXH 2ID0A 1LYLA 4JI6Q 3GTMH 2YYZA 3W5OA 1UE7A 4P74A 5LMNL 1L2FA 1MJCA 4DV3Q 1KIXA 2E5LL 2JEAI 3H3VH 1KXLA 2EQSA 3I56A 3JAMi 1IBLQ 2HHHQ 1Q86C 1OTCA 1VQNA 4RG1A 1BBWA 4JI8Q 1PH6A 4DV7L 1VQAA 3AQQA 5C4XH 4C2MH 1VQLA 3UE1A 3FP9A 3S15H 2JA8G 1XNQQ 1QZHA 2VQFL 1NJIC 1N34L 1CUKA 1N33L 5JJIA 3G71A 1NMFA 3U58A 3HOZG 1UEBA 1N36L 2JA8H 1UWVA 2JJQA 3U4VA 2YTYA 1KHIA 4AQYQ 4DR3Q 3PUWA 5GQOA 4OONA 4B3ML 5AJ3Q 4LF8Q 1NBWA 4TVAB 3UDIA 3CF5A 4POGA 4A3CH 2QGQA 1EYGA 3L0OA 2BA0A 3ICEA 2VZAA 3CCJA 2PI2A 1VQ8A 3A74A 4A3MG 3CQZH 3GDEA 2DUDA 3LGJA 2UXBL 3S24A 1I5FA 3HKSA 4DV2L 4BBRH 4BA2I 5IYCH 5LMNW 1YJWA 4KHZA 1IYJB 3CCQA 3CCUA 2XGTA 4ALPA 3K8AA 4A3MH 1V1QA 4X65L 2BH2A 5C3EG 4B3TL 2R6GA 3GTGH 1CKMA 2ASBA 5BR8L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IXR A;  3F2D A;  5M5W H;  3B6Y A;  3KFU A;  4IJL A;  5M3F H;  4GOP C;  1HR0 Q;  1SN8 A;  5M5Y H;  3CCE A;  5IP7 G;  4DR4 Q;  4L5Q A;  4JG2 A;  1PV4 A;  1PFS A;  4YWL A;  2R92 G;  3GD7 A;  1LTL A;  5C44 G;  4LF5 Q;  5IP7 H;  3T1Y Q;  2PMZ E;  3PUZ A;  3CCS A;  4GOP B;  5GAH C;  4KHP Q;  3FKI H;  1O7I A;  3W1G A;  1S40 A;  2WB1 G;  2ES2 A;  2WAQ G;  4JI6 L;  2R92 H;  5C44 H;  4MTN A;  2UU9 Q;  1QVG A;  2MO0 A;  1XNR Q;  1B70 B;  3J7Z C;  2CWP A;  1NE3 A;  2ZM6 Q;  4DR6 L;  2UXD Q;  2A19 A;  4IPH A;  4JBK A;  2HHH L;  4DV4 Q;  3CAM A;  1I94 Q;  3HOU H;  4JI8 L;  1VQF A;  2XTI A;  4UP7 A;  4DAY B;  4KLK A;  1UE6 A;  4DKA C;  4YY3 L;  4DR1 Q;  1PYB A;  1D8L A;  3CME A;  1E22 A;  4A3B G;  5IY0 A;  1TWF H;  1SE8 A;  4AIM A;  1HJP A;  2ZTC A;  3UDF A;  1HNZ Q;  2RHQ B;  4LFA Q;  3SGI A;  2ALY B;  4LF7 Q;  1YHA A;  4LNQ A;  3OTO L;  1P8L A;  4AQY L;  1WOC A;  1Q81 C;  3EIV A;  3T1H Q;  3KDF B;  3W1B A;  1XMO Q;  2F4V L;  3AFP A;  2JA5 G;  1HH2 P;  4LF8 L;  5AJ3 L;  3AFQ A;  5GAG C;  5IYD H;  3BU2 A;  1VQK A;  1K8G A;  2E2H H;  1FJG Q;  4P72 A;  1EIF A;  4YCU A;  3RN5 A;  2JE6 I;  2OTL A;  2VUM H;  2D0P A;  2HT1 A;  3I2Z A;  1Z9F A;  2HIV A;  1M1K C;  2KHI A;  3TRZ A;  3S1Q H;  2VNU D;  3M4O H;  2N49 A;  1Q8K A;  1K3R A;  4JBJ A;  3CXC A;  4IOC A;  3PF5 A;  3KJP A;  4X66 Q;  4JI3 Q;  1J6Q A;  4PZ7 A;  3CPW A;  2C35 B;  3K7U C;  4A3D G;  4APV A;  1B8A A;  1IBM L;  1OXT A;  3HOY G;  4BY7 G;  3U50 C;  3IRB A;  3G4S A;  3JAM c;  4IFD J;  4AYB G;  3F1Z A;  4HJ9 A;  3CCM A;  1VQO A;  3DLL A;  1N8R C;  3CCL A;  4JV5 Q;  1TWC H;  1HR0 L;  1J5E Q;  3PF4 A;  4BY7 H;  3D31 A;  4DR4 L;  3PV0 A;  2YTX A;  2HQL A;  1SFO H;  2LSS A;  4LF6 Q;  5IT9 c;  4L5S A;  4LF5 L;  1K83 H;  4Y52 H;  2ATW A;  2UUA Q;  4PG3 A;  1SLJ A;  3M85 A;  4B3S L;  3PO3 H;  1XMQ Q;  2NVT H;  4OWW B;  2UU9 L;  1XNR L;  2QEX A;  1EFW A;  3U4Z A;  4UP9 A;  4JI4 L;  4DUZ Q;  4DUY Q;  2ZJR A;  4IPG A;  2NVY H;  2ZTD A;  3PUV A;  2KCT A;  2MNA A;  1FL0 A;  5JEA J;  1EQQ A;  3CCV A;  1I94 L;  1A0I A;  1I50 H;  1JJC B;  1JJ2 A;  4NXN Q;  3H15 A;  4A3E G;  3CPF A;  4A3J G;  1YVC A;  1VS0 A;  2YTV A;  1EIY B;  4DR1 L;  5C4X G;  4OX9 L;  2UUB Q;  4JOI C;  1T9H A;  1VCI A;  1YIT A;  1GM5 A;  3AEV A;  4A3E H;  3PO2 H;  1KC8 C;  4A3J H;  3S2H H;  1YIJ A;  1EUJ A;  3PCO B;  3E0E A;  1K73 C;  1Z47 A;  4DNI A;  1BKB A;  5IP9 G;  4IPC A;  4JOI A;  2E8G A;  1HNZ L;  4GKJ Q;  1S72 A;  4LFA L;  4X62 Q;  2AKW B;  1PA6 A;  3H3V I;  1A62 A;  1UE1 A;  1SRU A;  5IP9 H;  1XMO L;  1HR0 W;  4XTC S;  1XPO A;  1QVF A;  1VQH A;  2VS1 A;  4POF A;  4GLX A;  4DV0 L;  1FJG L;  2CCZ A;  4A3C G;  2WB1 E;  1E7Z A;  1YHQ A;  1VQI A;  1X55 A;  2E2J H;  2Y0S E;  1PH8 A;  1C7Y A;  2I5M X;  4K0K Q;  4MNO A;  4BBR G;  3KF6 A;  5IYC G;  1N32 Q;  1C9O A;  1NTG A;  1CSQ A;  4JI3 L;  4X66 L;  4GKK Q;  2EIF A;  1GVP A;  4H02 A;  1VQ5 A;  4LF4 Q;  1HZB A;  4LWC A;  2VQE Q;  1K8A C;  4DR7 Q;  4YCW A;  3JC6 6;  4DV5 L;  4O2D A;  1KAW A;  3FHW A;  2Z6K C;  5M3F G;  4R1J A;  3WWV A;  1J5E L;  3KLW A;  3M3Y H;  4GLA C;  1MIU A;  4LF6 L;  2Q2U A;  3I4M G;  2KHJ A;  2Z6K A;  4JYA Q;  1D7Q A;  2RF4 A;  5E7N A;  1HNW Q;  3I4M H;  1QUQ A;  4A3G H;  3BJU A;  4BXX H;  4LFC Q;  4QQB X;  3FKI G;  3HOW H;  2AMC B;  3HOX G;  1WJJ A;  1UE5 A;  3VDY A;  2I0Q A;  4QGU A;  1KQS A;  1OXU A;  2OCE A;  3GTJ H;  1IBK Q;  2YU9 H;  4DUZ L;  1L1O C;  4NXM Q;  1YNX A;  4X64 Q;  3HOX H;  4DUY L;  4YCV A;  5J3B A;  1P16 A;  4DPG A;  5FLX c;  4NXN L;  3K81 C;  3F2B A;  3UDX A;  4JI0 Q;  1L1O A;  4DV3 L;  2Q2T A;  3HOU G;  1TXY A;  4QY7 A;  4R4Q A;  1VQD A;  1VQG A;  3ER0 A;  4C3J H;  2UXC Q;  1LUZ A;  2JA9 A;  3HKZ E;  3G6E A;  1IBL L;  4DR2 Q;  2UUB L;  3M4Q A;  4IOA A;  2JA7 H;  1G6P A;  1X65 A;  5C0X J;  1PH3 A;  4RMF A;  5GAE C;  3TEH B;  3J80 c;  3D0F A;  1GKH A;  4R4O A;  3CC2 A;  2NZO A;  5M3M G;  3TRE A;  4X62 L;  1Y1V G;  3I7F A;  1N9W A;  2ZTE A;  3A0J A;  2BA1 A;  4BY1 G;  1XNQ L;  2IX0 A;  5FLM G;  5M3M H;  3RLO A;  3GTO H;  1Y1V H;  2MFI A;  4DK3 C;  3AYH B;  4A3L G;  2N78 A;  4BY1 H;  3J81 i;  5IYD G;  5FLM H;  2BH8 A;  4HJ7 A;  4IFD G;  1VQE A;  4DR3 L;  2ZJQ A;  4JI7 Q;  4A3L H;  2KEN A;  2VUM G;  1U0L A;  2HIX A;  3J81 j;  4LW1 A;  1VQ7 A;  3CC7 A;  5LMN Q;  3CW2 C;  3GTP H;  2RCN A;  1N32 L;  1CKN A;  4R4C A;  3HOV G;  4Y7N H;  4GKK L;  4YHH Q;  2K5H A;  1MKH A;  4LF4 L;  2VQE L;  1X3F A;  1L0W A;  4R4T A;  3HOV H;  1IZ6 A;  1E1O A;  4X6A H;  1OXX K;  4GNX A;  4IFD I;  2GN5 A;  1YZ6 A;  3E9H A;  4JC0 A;  2OTJ A;  2N8N A;  3BZK A;  1PVO A;  2IT1 A;  5DLQ E;  2VQF Q;  1N34 Q;  1N33 Q;  1AH9 A;  2PQA A;  2JK8 A;  1N36 Q;  1A63 A;  3NEN A;  2WP8 J;  4OWT B;  1K0R A;  1SRO A;  4L5R C;  3I4N H;  3CP0 A;  3NEL A;  2CFM A;  4LFC L;  2F52 A;  4B3M Q;  4LUZ A;  3PO3 G;  4HJ8 A;  3ULL A;  3T1Y L;  1IL2 A;  1PH1 A;  2I5L X;  4C3I H;  5K36 G;  1S3O A;  1AE2 A;  2RHS B;  4QIW E;  1QVC A;  4NXM L;  2N3S A;  5IWA Q;  3ULP A;  3RR5 A;  4KHP L;  3RN2 A;  1PYS B;  2Q2H A;  3H0G H;  4HIO A;  1WCM H;  2E2I H;  4JI0 L;  3G48 A;  3UDG A;  3L2P A;  3DM3 A;  2ZM6 L;  2UXD L;  3KOJ A;  2UXC L;  2MO1 A;  4DV4 L;  3Q8D A;  1EQR A;  2K52 A;  3KJO A;  1JMC A;  4B3T Q;  2PI2 E;  3PO2 G;  1NY4 A;  3E9I A;  2B3G A;  2K5N A;  4P73 A;  4JCV E;  5GAD C;  2IY5 B;  2VW9 A;  2VL6 A;  2A8V A;  2D0O A;  1VQC A;  2R93 H;  1HNX Q;  3S1M H;  2R7Z H;  5FJ8 H;  1X54 A;  3GO5 A;  3ZJY C;  1YJN A;  3NBH B;  1K9M C;  3CC4 A;  4LF7 L;  3GTK H;  3K7A H;  4A76 A;  3S16 H;  4A93 H;  4AH6 A;  3T1H L;  4A3I H;  1G29 1;  4JI7 L;  1X3E A;  2I5H A;  3ERS X;  3K80 C;  3BZC A;  1VQ9 A;  4GN4 B;  4HJ5 A;  1Y1W G;  2UUC Q;  4LFB Q;  1TWH H;  1AE3 A;  2WAQ E;  3PUX A;  4PMW A;  3PIO A;  2B29 A;  2NZH A;  4XIG S;  4DR6 Q;  4B3R Q;  4OO1 G;  4YHH L;  2OQ0 A;  1VQJ A;  4FDB A;  2Q2I A;  1HZ9 A;  1Y1W H;  1H95 A;  3S17 H;  1X56 A;  4GS3 A;  2AHO B;  4IPD A;  1VQB A;  1DGS A;  1VQM A;  1CKO A;  4A3K G;  4JI5 Q;  2YV5 A;  1PH9 A;  2IHE A;  3CD6 A;  3PSI A;  1VQ4 A;  1B7Y B;  4OWX B;  4JBW A;  4QL5 A;  3RLN A;  1V43 A;  4YY3 Q;  4DV6 Q;  1SR3 A;  1MJE A;  3J7A 5;  4A3K H;  3KF6 B;  1KD1 C;  1FVI A;  1TWG H;  3M9B A;  1PH5 A;  1X9N A;  1Q1B A;  2DGY A;  1BVS A;  4JV5 L;  3S1N H;  5GRO A;  3OTO Q;  4A3F G;  2L15 A;  4OO1 I;  4JI2 Q;  1HZC A;  4JBM A;  2F4V Q;  2LXK A;  3HOZ H;  1EOV A;  4A3G G;  5C0X G;  4BXX G;  3KF8 B;  3HOW G;  4LF9 Q;  1HZA A;  4A3F H;  1JJG A;  1PH7 A;  2UUA L;  1JB7 A;  4PZ8 A;  4P71 A;  4WJ3 M;  4NPS A;  5JJK A;  4L5T A;  5IWA L;  1PH4 A;  1VQ6 A;  1XJV A;  1YI2 A;  3S1R H;  4KI0 A;  2AWO A;  2JEB I;  2LXJ A;  3OYY A;  1XMQ L;  2R7F A;  2OQK A;  3EN2 A;  3J81 c;  3CMA A;  2VY3 A;  1EWI A;  1QUQ B;  4A4I A;  2D62 A;  4UP8 A;  2Z0S A;  1U5K A;  2K75 A;  3F2C A;  4PZ6 A;  1XPU A;  4JI1 Q;  4GLV B;  2JA6 G;  4ME3 A;  2JA7 G;  3KYH C;  5LMU Q;  5C0X I;  2H5X A;  1E3P A;  3RLF A;  1IBM Q;  4DR5 Q;  4EQ5 A;  1KRS A;  1Q46 A;  5C3E H;  1L1O B;  2K4K A;  3MEF A;  4HID A;  1WFQ A;  1R9T H;  2JA6 H;  3K0X A;  1HNX L;  4DK6 C;  2QA4 A;  4DV1 Q;  4AYB E;  4GKJ L;  1XTD A;  1YEZ A;  1FGU A;  3UE0 A;  4GOP A;  2AWN A;  1E1T A;  2A1A A;  3I4O A;  1Q82 C;  1E24 A;  3OW2 A;  3PGZ A;  4NB3 A;  4YWM A;  1C0A A;  3STB D;  1GO3 E;  4J15 A;  1V9P A;  4BBS G;  3TS0 A;  3TS2 A;  2EXD A;  3GTQ H;  4C3H H;  4B3S Q;  2IHF A;  1OXV A;  2NVQ H;  3S2D H;  2UUC L;  2Y0S G;  4BBS H;  4R4I A;  1YBY A;  1CSP A;  4LFB L;  1Q12 A;  2R7D A;  4LUO A;  3RZD H;  4JI4 Q;  4B3R L;  3EBE A;  2CWA A;  5HGQ A;  1VQP A;  3TQY A;  4K0K L;  2JQO A;  2E5L Q;  4MZ9 A;  1NMG A;  1X6O A;  2CQO A;  4JI5 L;  2K14 A;  4LUV A;  2K50 A;  1W3S A;  2GVA A;  1RIP A;  1W2B A;  4DV6 L;  5ELO A;  1M90 C;  3MXN B;  4OX9 Q;  4DAM A;  2OWO A;  3CCR A;  4GNX C;  4GN5 A;  4DR7 L;  1CKN B;  1TWA H;  4O0A A;  5IE8 A;  3RZO H;  4UPA A;  5IYB G;  4DV7 Q;  3KDF A;  4HIK A;  1RL2 A;  3M7N A;  1YHB A;  3S14 H;  4A3B H;  4IO9 A;  2KBN A;  5IYB H;  1X3G A;  3A5U A;  4JI2 L;  5JEA G;  3I4N G;  1LM0 A;  4GNX B;  1WI5 A;  4HIM A;  3RNU A;  4JYA L;  2FXQ A;  4LF9 L;  3NEM A;  4P75 A;  1ASZ A;  1BBU A;  4DV0 Q;  1HNW L;  1PH2 A;  2JA5 H;  5JJL A;  4QJF A;  2IX1 A;  1YJ9 A;  2PQA B;  1SMX A;  2GVB A;  4EX5 A;  4HJA A;  1JT8 A;  1ASY A;  2KCM A;  3H0G G;  4OXP A;  2WFW A;  1WCM G;  3J80 i;  1Q7Y C;  1OXS C;  1A8V A;  2NN6 G;  1IBK L;  2B63 G;  4X64 L;  1QZG A;  4JI1 L;  3HFZ B;  2UXB Q;  3A5Z B;  2K5V A;  3HKZ G;  3L7Z C;  1KL9 A;  2PNH A;  5ELN A;  3M4P A;  1Y14 B;  5EAY A;  3I55 A;  1G51 A;  5LMU L;  4DV2 Q;  2B63 H;  4WJ4 A;  1JE5 A;  4DV5 Q;  4DR5 L;  4DR2 L;  4A3D H;  4X65 Q;  2V1C C;  1WYD A;  3HOY H;  2R93 G;  4DV1 L;  2R7Z G;  3PUY A;  5HY6 A;  1I3Q H;  5BR8 Q;  5FJ8 G;  4UY8 C;  2MQH A;  4IJH A;  2NN6 I;  2ZJP A;  4A93 G;  1Q1E A;  1KRT A;  4BA1 I;  3F8T A;  1GD7 A;  4A3I G;  4A75 A;  3PIP A;  4YWK A;  1XPR A;  1PHJ A;  2CKZ B;  3ULJ A;  3GTL H;  5M5X H;  4GN3 B;  5H1S E;  4TQU S;  5C4J H;  1I6H H;  2F3I A;  3STB C;  2NVX H;  2ID0 A;  1LYL A;  4JI6 Q;  3GTM H;  2YYZ A;  3W5O A;  1UE7 A;  4P74 A;  5LMN L;  1L2F A;  1MJC A;  4DV3 Q;  1KIX A;  2E5L L;  2JEA I;  3H3V H;  1KXL A;  2EQS A;  3I56 A;  3JAM i;  1IBL Q;  2HHH Q;  1Q86 C;  1OTC A;  1VQN A;  4RG1 A;  1BBW A;  4JI8 Q;  1PH6 A;  4DV7 L;  1VQA A;  3AQQ A;  5C4X H;  4C2M H;  1VQL A;  3UE1 A;  3FP9 A;  3S15 H;  2JA8 G;  1XNQ Q;  1QZH A;  2VQF L;  1NJI C;  1N34 L;  1CUK A;  1N33 L;  5JJI A;  3G71 A;  1NMF A;  3U58 A;  3HOZ G;  1UEB A;  1N36 L;  2JA8 H;  1UWV A;  2JJQ A;  3U4V A;  2YTY A;  1KHI A;  4AQY Q;  4DR3 Q;  3PUW A;  5GQO A;  4OON A;  4B3M L;  5AJ3 Q;  4LF8 Q;  1NBW A;  4TVA B;  3UDI A;  3CF5 A;  4POG A;  4A3C H;  2QGQ A;  1EYG A;  3L0O A;  2BA0 A;  3ICE A;  2VZA A;  3CCJ A;  2PI2 A;  1VQ8 A;  3A74 A;  4A3M G;  3CQZ H;  3GDE A;  2DUD A;  3LGJ A;  2UXB L;  3S24 A;  1I5F A;  3HKS A;  4DV2 L;  4BBR H;  4BA2 I;  5IYC H;  5LMN W;  1YJW A;  4KHZ A;  1IYJ B;  3CCQ A;  3CCU A;  2XGT A;  4ALP A;  3K8A A;  4A3M H;  1V1Q A;  4X65 L;  2BH2 A;  5C3E G;  4B3T L;  2R6G A;  3GTG H;  1CKM A;  2ASB A;  5BR8 L; 
#chains in the Genus database with same CATH topology
 1IXR A;  3B6Y A;  1VF5 C;  4GOP C;  5EJW A;  5J1Z A;  2B2T A;  5M5Y H;  5IP7 G;  1QCB D;  2D9U A;  4C3H G;  4BY1 B;  4LF5 Q;  3T1Y Q;  3FKI H;  1O7I A;  4JI6 L;  2WAQ G;  3J7Y W;  1NNX A;  2Y0S B;  4FXK C;  1QVG A;  2PYK A;  2ZM6 Q;  2UXD Q;  4IPH A;  3CAM A;  4JI8 L;  1VQF A;  3NTI A;  3T13 A;  3HOV B;  3S9W A;  1UE6 A;  1LTT D;  1D8L A;  1W6K A;  4A3B G;  1TWF H;  1GUG A;  2RVL A;  4AIM A;  2ZTC A;  3M7G A;  4J1M A;  3K57 A;  1HNZ Q;  4LFA Q;  3SGI A;  4LF7 Q;  1RJT A;  2QW7 A;  3OTO L;  4AQY L;  1Q81 C;  3EIV A;  1E0B A;  3V05 A;  1HH2 P;  5IYD H;  1CK1 A;  4P72 A;  4C3I B;  3I90 A;  1JWU D;  1KDB A;  2XRQ D;  1Z9F A;  2HIV A;  3S1Q H;  4Z9C B;  2HQE A;  2IL8 A;  2N49 A;  4G7H C;  2F0K A;  1K3R A;  3VR6 A;  3PF5 A;  4HSV A;  2KEE A;  4JI3 Q;  1CZG A;  4A3D G;  3ERO A;  2BCO A;  3HOY G;  4BY7 G;  3G4S A;  3IRB A;  2F0U A;  3D8G A;  2N55 A;  2SEB D;  4HJ9 A;  3CCL A;  3DLL A;  3K5N A;  2KEC A;  1XYI A;  1HR0 L;  2R93 B;  2R7Z B;  2CW0 D;  2L9H A;  2HQL A;  1SFO H;  4LF6 Q;  5IT9 c;  1Y69 U;  1TQO A;  2ATW A;  4A3I B;  2UUA Q;  2SOB A;  4PG3 A;  4JPB W;  3M85 A;  1LTG D;  1ML0 D;  4B3S L;  4OWW B;  5K36 H;  1XNR L;  2QEX A;  3MXG A;  3U4Z A;  4HAE A;  3BVM A;  4DUY Q;  2NVY H;  1G8Z D;  1EQQ A;  2KCT A;  1R4Q B;  1Y1W B;  4NXN Q;  5KNB A;  3H15 A;  1SSO A;  1EIY B;  5C4X G;  2RQX A;  4JOI C;  3NBH A;  4RH6 A;  5COR A;  3S2H H;  1RKN A;  5I4D A;  3AEV A;  1PTO D;  4A3J H;  4A3K B;  1YIJ A;  3PO2 H;  1K73 C;  3E0E A;  5IGE A;  1BKB A;  1PZK D;  4GKJ Q;  4JOI A;  1PRT F;  2F0W A;  1V1P B;  5IGC A;  1A62 A;  1UE1 A;  2O4X A;  1HR0 W;  1VDZ A;  1QVF A;  2VS1 A;  4POF A;  4GLX A;  1FJG L;  3ERQ A;  1E7Z A;  1YHQ A;  3DMU A;  1X55 A;  4ZKC B;  3CQZ B;  1PH8 A;  1HA5 A;  2JYO A;  5KYI A;  4H13 C;  4A3M B;  1VQ5 A;  4KHV A;  3SHL A;  3VYR A;  1LAB A;  1K8A C;  4U68 A;  5IGD A;  5C3E B;  1UEA B;  2B2Y A;  3MHB A;  1J5E L;  5C4H A;  2RSO A;  2MGS A;  2N88 A;  3D6W A;  3CRL C;  5C0X H;  3GTQ B;  4IUR A;  4LFC Q;  1Z6H A;  3HOW H;  3HOX G;  1UE5 A;  5C44 B;  3VDY A;  4QGU A;  3FDT A;  1OXU A;  2OCE A;  5EPL A;  1IBK Q;  4NXM Q;  4DUZ L;  1PZI D;  1EYA A;  3LX0 A;  4DPG A;  3I72 A;  1EU4 A;  4JI0 Q;  3X3N A;  2L4N A;  1TXY A;  1VQD A;  1S5F D;  1VQG A;  2UXC Q;  1F77 A;  2NTT A;  1G6P A;  5E4X A;  4IUP A;  4DK1 A;  5C0X J;  3TEH B;  1GKH A;  3HG9 A;  3CC2 A;  4QUC A;  3T16 A;  5M3M G;  4X62 L;  3MXU A;  3A0J A;  2DNE A;  1XNQ L;  2IX0 A;  5FLM G;  1PTO C;  4K8J A;  2NBF A;  1LT5 D;  1Y1V H;  3KLS A;  2WII B;  4DK3 C;  2N78 A;  4BY1 H;  3G6J B;  2J4X A;  4IFD G;  3Q0A A;  4JI7 Q;  2KEN A;  2VUM G;  2HIX A;  3MXN A;  3CC7 A;  3TZU A;  1B9M A;  2PQE A;  5DAU A;  4GKK L;  3T51 B;  2IX3 A;  3HOV H;  1IZ6 A;  5KYL A;  2PPB C;  2F0L A;  4X6A H;  1OXX K;  5J39 A;  4IFD I;  2GN5 A;  2OTJ A;  2OEO A;  4CKC A;  5EKL A;  3WOE A;  5CV9 A;  3DHQ A;  3A8I E;  2WP8 J;  4P2C B;  3LWU A;  4FO2 A;  3CP0 A;  3QG1 A;  3ULL A;  1IL2 A;  3MA2 B;  5C4J B;  4C3I H;  1I6H B;  2RHS B;  2BE5 C;  3RR5 A;  1ENF A;  5IIF A;  3RN2 A;  2Q2H A;  4HIO A;  3G48 A;  3DM3 A;  2MO1 A;  1OO9 B;  1EQR A;  3CKI B;  2EYL A;  1WD0 A;  5GAD C;  3OSO A;  2VW9 A;  2VL6 A;  4C2M B;  2A8V A;  1VQC A;  2R93 H;  2R7Z H;  5IT9 L;  3ZJY C;  3GTK H;  3HS0 C;  4Q5V A;  4A3I H;  5LHY 1;  4ID6 A;  1I4P A;  4XQQ A;  3K80 C;  1WTV A;  5D14 A;  1A2U A;  2QIL A;  4PMW A;  3PUX A;  2NTS A;  4XIG S;  3J7A V;  1Y1W H;  3P75 A;  5DEH A;  3R3O A;  4BBR B;  4IPD A;  2XNA C;  2YV5 A;  1PH9 A;  2IHE A;  5COY A;  1B1Z A;  1V43 A;  1SR3 A;  4J6H A;  4A3K H;  3KF6 B;  3GTG B;  1FVI A;  4ZRZ A;  4LJZ C;  4KMU C;  3FMC A;  4L63 B;  1M8A A;  3OTO Q;  1Z7T A;  1HZC A;  4BXX G;  3VA7 A;  1F2M A;  3KF8 B;  1HZA A;  4A3F H;  1PH7 A;  1JB7 A;  5JJK A;  4P71 A;  3NTH A;  2RSN A;  4L5T A;  1XJV A;  2R92 B;  2JEB I;  2LXJ A;  5JPN C;  1XMQ L;  1D5Z C;  2R7F A;  1TII D;  3EN2 A;  4CHT B;  2VY3 A;  2D62 A;  3QJY A;  4UP8 A;  2TMP A;  4C3J B;  3H94 A;  4EVO A;  4JI1 Q;  3HOU B;  1EIH A;  3BZD B;  4GLV B;  2JA7 G;  3KYH C;  5LMU Q;  1J9O A;  2B2V C;  4DR5 Q;  4EQ5 A;  5C3E H;  1DD2 A;  3I8Z A;  2C9O A;  3K0X A;  1HNX L;  3VA5 A;  4DV1 Q;  2B2U A;  1LT6 D;  3I4O A;  2E74 C;  1SE3 A;  1GO3 E;  1PLF A;  3GTQ H;  1STA A;  2HCI A;  1WD1 A;  4B3S Q;  2IHF A;  2F0J A;  2E2H B;  3EA6 A;  3FPP A;  2UUC L;  4BBS H;  4R4I A;  1Q12 A;  5DM7 3;  4B3R L;  1XWE A;  4B9X A;  2OXP A;  4MZ9 A;  4JI5 L;  2F0M A;  4CDF C;  1SYG A;  4DV6 L;  1M90 C;  2OWO A;  3D3R A;  4GNX C;  2EY6 A;  2KVM A;  3M7N A;  3NXW A;  3S14 H;  4IO9 A;  2JSO A;  2X69 A;  1AW7 A;  5IYB H;  4JI2 L;  5C6A A;  4FXD A;  5JEA G;  1LM0 A;  4HIM A;  3RNU A;  1LT3 D;  2FXQ A;  4LF9 L;  4P75 A;  4KKT A;  2WV6 D;  1PH2 A;  1EQT A;  2PQA B;  2GVB A;  3PO3 B;  2NVT B;  2WFW A;  2I07 B;  2FMC A;  2NN6 G;  3C1F A;  4X64 L;  1DYQ A;  1SDF A;  4DAV A;  1WTR A;  2LY7 A;  1SYC A;  2K5V A;  2PNH A;  4RGM A;  2B63 H;  1Y14 B;  3I55 A;  5DNF A;  2V1C C;  5FO7 B;  3PUY A;  3GP7 A;  4R8I A;  3S16 B;  5IOD A;  2NN6 I;  2ZJP A;  1Q1E A;  2KOL A;  1GD7 A;  1SNC A;  4A75 A;  5BR8 L;  4YWK A;  3TME A;  1PHJ A;  2CKZ B;  3A7A B;  3D4R A;  3NQI A;  5C4J H;  2RDF A;  1I6H H;  2EY5 A;  3MC0 B;  5D3I B;  2SDF A;  5T1I A;  3GTM H;  1UE7 A;  1LT4 D;  2HHH Q;  2EDG A;  1ESR A;  1OTC A;  2BOS A;  1JWS D;  2G5D A;  1VQA A;  3AQQ A;  4C2M H;  1FNV A;  3L9A X;  2HCC A;  2JA8 G;  1XNQ Q;  1QZH A;  2VQF L;  2LFN A;  1N34 L;  1N33 L;  5JJI A;  3G71 A;  4I7A A;  3U58 A;  1KNA A;  1N36 L;  3U4V A;  4CJ1 B;  3I4M B;  1PDQ A;  1ET6 A;  5AJ3 Q;  3UDI A;  4FP5 D;  2K1B A;  1JC7 A;  4A3C H;  2QGQ A;  3GTJ B;  2BA0 A;  3ICE A;  2VZA A;  4ME5 A;  3CCJ A;  4BBR H;  2P5Z X;  5IYC H;  1F2Y A;  4DK0 A;  4KHZ A;  1X3P A;  3GTG H;  3SK5 A;  2CCZ A;  1ESF A;  3F2D A;  2Q8R E;  2F3W A;  1SN8 A;  1ZYR D;  3CCE A;  1HTP A;  4DR4 Q;  4L5Q A;  3GTO B;  1PFS A;  4YWL A;  3V96 A;  3GD7 A;  3S2D B;  2PMZ E;  4GOP B;  3W1G A;  2R92 H;  4MTN A;  2UU9 Q;  3TDQ A;  5IT9 E;  2CWP A;  2CH4 W;  4DR6 L;  2A19 A;  4ZCK A;  2XVS A;  3HOU H;  3VR4 A;  4UP7 A;  1UAP A;  2F0P A;  2QEJ C;  2ZT9 C;  3O13 A;  3A8J E;  3MEH A;  2EYF A;  5KND A;  1E22 A;  5IY0 A;  1SE8 A;  1HJP A;  3OPO A;  2ALY B;  1WOC A;  4IUU A;  3KDF B;  3I4N B;  1I6V C;  2B39 A;  4LMQ D;  2M9V A;  1LV9 A;  2RKS A;  2E2H H;  5IOC A;  3RN5 A;  1GUT A;  2JE6 I;  4DA2 A;  2OTL A;  2HT1 A;  4OHJ A;  3H0G B;  5FKA C;  3U9S A;  1HFN A;  1H9S B;  1Q8K A;  1KDA A;  3RD4 A;  4IOC A;  1TVX A;  2HDM A;  5IGF A;  4KN7 C;  4QCL A;  3HKZ B;  5CBA E;  1D5X C;  4NKL A;  3VR3 A;  3SDZ A;  5ELD A;  3U50 C;  3JAM c;  1FR3 A;  4AYB G;  1N8R C;  2EYM A;  4RKB A;  1SJE D;  3UI2 A;  1JQY D;  3GV6 A;  4CDD C;  4G57 A;  1ZYR C;  4X3T A;  1SLJ A;  1EZ6 A;  4KK7 A;  3PO3 H;  1XMQ Q;  2NVT H;  3MXP A;  1TWH B;  5AFW A;  2XN9 C;  2ZJR A;  3PUV A;  2MNA A;  1U4M A;  5JEA J;  1I94 L;  1JJ2 A;  5C4Z A;  3DWA A;  4EQO A;  4A3J G;  1YVC A;  3IFT A;  1WTP A;  1PRT D;  4DR1 L;  3H91 A;  1VCI A;  1YIT A;  1GUN A;  4A3E H;  1EUJ A;  1Y8P B;  3H09 A;  2EYP A;  2EYJ A;  1VMC A;  1WTQ A;  2AKW B;  1PA6 A;  1JWM D;  1SRU A;  4IAL A;  1HXY D;  1XMO L;  3T56 B;  1GHK A;  1XPO A;  2TSS A;  3HOZ B;  1ZEQ X;  1VQH A;  1V1O A;  1TT2 A;  3ND8 A;  1A2T A;  2VXW A;  4QIW B;  2Y0S E;  1C7Y A;  4CJ0 B;  1N32 Q;  2FIN B;  2EPB A;  4X66 L;  3Q22 A;  1ICW A;  2EIF A;  1GVP A;  1HZB A;  2VQE Q;  2G9D A;  2F0N A;  2L5T A;  4DV5 L;  1RDP D;  3FHW A;  1ZKO A;  1EWH A;  5M3F G;  3K58 A;  4R1J A;  3M3Y H;  1MIU A;  4XT1 B;  1SJH D;  2RF4 A;  3MFG A;  3I4M H;  1QUQ A;  2KQ3 A;  4C3H B;  5DM6 3;  2I0Q A;  3P7J A;  3GTJ H;  2PZU A;  2EYO A;  4X64 Q;  1P16 A;  4RWS C;  4NMZ A;  1JIC A;  4R4Q A;  3GQB A;  1LUZ A;  2JA9 A;  1IBL L;  2UUB L;  1X65 A;  3V2T A;  4FF4 A;  1TWA B;  3D0F A;  4R4O A;  2K04 A;  2XWB B;  3C1E A;  1LTS D;  1PRT C;  1Y1V G;  4FVM A;  4A3B B;  2ZTE A;  2K05 A;  4BY1 G;  2Z8L A;  1F9Q A;  3OWF A;  3R2I A;  3RLO A;  4MIU A;  3GTO H;  3AYH B;  1STY A;  3ND9 A;  2HUG A;  4K5W A;  1VQE A;  2ZJQ A;  2JP1 A;  5FLX L;  5D65 A;  1PTO B;  4S3S A;  1U0L A;  4LW1 A;  1VQ7 A;  1BCP C;  4ZQ3 A;  1HRJ A;  3HZX A;  3HOV G;  1NCV A;  3J80 L;  4LF4 L;  5F2D A;  2WAC A;  3Q6S A;  1X3F A;  1L0W A;  1EYC A;  4BS9 A;  2NWG A;  1E1O A;  2ICI A;  4A3D B;  4MN3 A;  1PZJ D;  1SXT A;  1G2T A;  3HOY B;  2VQF Q;  1N34 Q;  1I3Q B;  1N33 Q;  1N36 Q;  2M00 A;  4K2K A;  1SRO A;  4L5R C;  3I4N H;  3VR2 A;  4C3I G;  4DN4 M;  1U4R A;  4HJ8 A;  1B53 A;  2L0C A;  2I5L X;  1AE2 A;  2F0G A;  4TKO B;  2N3S A;  5IWA Q;  3ULP A;  4L6T B;  1C4Q A;  2K28 A;  1KLG D;  2F0E A;  3H0G H;  2E2I H;  5FO8 B;  1QJO A;  3UDG A;  3NQT A;  1A3V A;  3NPP A;  3Q24 A;  3JAM L;  4FF2 A;  2K5N A;  1RF2 D;  4JCV E;  4P73 A;  1BDO A;  5C4X B;  2RBM A;  1QG7 A;  4KY6 A;  1D2B A;  1X54 A;  2AQ2 B;  1BF4 A;  5G3L F;  3BYT B;  3T1H L;  5HUR A;  1BQQ T;  3BZC A;  3FEW X;  4HJ5 A;  1Y1W G;  1TWH H;  1AE3 A;  2F0T A;  4DR6 Q;  4OO1 G;  1BCP F;  4YHH L;  1U9R A;  1VQJ A;  4FDB A;  1H95 A;  1X56 A;  4GS3 A;  2AHO B;  1VQB A;  1VQM A;  4A3K G;  3PSI A;  4JBW A;  3RLN A;  3J7A 5;  1MJE A;  1QWY A;  3CU7 A;  2WKD A;  1KD1 C;  2B2Y C;  4ABN A;  1IKM A;  2IWH A;  1QIL A;  1FNU A;  1X9N A;  5M5W B;  4C56 C;  2F0H A;  4EGV A;  2ICE C;  4A3F G;  2L15 A;  4OO1 I;  2LXK A;  3HOZ H;  3OMC A;  1GXD C;  4A3G G;  3NUC A;  1JJG A;  2BE5 D;  4WJ3 M;  4DNR B;  1HUM A;  5ELE A;  1PH4 A;  3HOX B;  3OYY A;  1E2Z A;  2OQK A;  4GZY C;  1I4H A;  3DEP A;  1LTR D;  2A73 B;  3PIO 3;  1X32 A;  3DWQ A;  5CMD A;  1E3P A;  3KUP A;  3QR8 A;  1L1O B;  2K4K A;  3MEF A;  4DK6 C;  2EVB A;  1XTD A;  5M3M B;  1ROD A;  2F03 A;  1II3 A;  4ULL A;  4KKS A;  3OW2 A;  4NB3 A;  3STB D;  4J15 A;  1V9P A;  2Z4I A;  2EJM A;  4X3K A;  4BBS G;  3P1H A;  4C3H H;  2R3Z A;  2A5H A;  2DJF C;  5CBE E;  4LFB L;  1CSP A;  1IW7 D;  2R7D A;  5ISR A;  2VUM B;  4ZKB B;  1QNK A;  3IAY A;  1HUN A;  1X3Q A;  2PCF B;  3TQY A;  1VQP A;  3OW7 A;  2MJ8 A;  1R4P B;  3HEJ A;  1KAA A;  1EOT A;  1T5X D;  1W2B A;  4CGY B;  4DR7 L;  4GN5 A;  1CKN B;  1TWA H;  5IE8 A;  4UPA A;  5IYB G;  4DV7 Q;  4HIK A;  3A56 A;  4A3B H;  1TWC B;  1SAP A;  5C3X A;  4GNX B;  3PQI A;  4JYA L;  4IZ8 A;  1HQR D;  1BBU A;  1K83 B;  2NB0 A;  4ZUJ A;  1HNW L;  1YNN C;  2RCF A;  3C2P A;  2KHS A;  3DWP A;  2EJG C;  5I6Y A;  3EVQ A;  1PTO H;  1H9K A;  1WCM G;  3J80 i;  1OXS C;  1A8V A;  2B63 G;  4K6L A;  2PW5 A;  1DOL A;  2AQ3 B;  4ZUI A;  1K0S A;  1I50 B;  2UXB Q;  2LS0 1;  1ASY A;  3R8B A;  1MI2 A;  5EAY A;  4WJ4 A;  1G51 A;  4DV5 Q;  1TS2 A;  4DR2 L;  4A3D H;  2J0T D;  2A6E D;  1JCK B;  3HOY H;  3S1M B;  3D4W A;  5HY6 A;  4N8X 1;  1I3Q H;  5BR8 Q;  5FJ8 G;  1S5C D;  2AQ1 B;  4A93 G;  1KRT A;  3L3O C;  4H0L C;  1HQM C;  4PQX A;  5H1S E;  4G7Z C;  3KK7 A;  3NP8 A;  3STB C;  4RKL A;  2E2J B;  4JI6 Q;  5IGB A;  2E5L L;  4P74 A;  5LMN L;  1IW7 C;  3I56 A;  3JAM i;  2Z6B A;  3MVV A;  1IBL Q;  1BBX C;  2XWJ B;  1DXM A;  1V1P A;  1Q86 C;  1W6J A;  4RG1 A;  4JI8 Q;  1PH6 A;  5FLX E;  5C4X H;  4RGN A;  3UE1 A;  3FP9 A;  3DM1 A;  2JXM B;  1EFI D;  3J80 E;  1CHP D;  2JJQ A;  2EYH A;  1KHI A;  4AQY Q;  3PUW A;  2MUY A;  4OON A;  1NBW A;  1B3A A;  4DU9 A;  2CVR A;  3L0O A;  3PIP 3;  3GV3 A;  1VQ8 A;  3CQZ H;  2DUD A;  1O80 A;  1DOM A;  1I5F A;  3DXJ C;  4LK1 C;  4DV2 L;  2ZXP A;  5LMN W;  4A3M H;  1IYJ B;  3CCQ A;  3CCU A;  2XGT A;  3TP7 A;  1V1Q A;  4X65 L;  2BH2 A;  2JA7 B;  3C46 A;  4B3T L;  4DGZ A;  2M2L A;  2F0D A;  2B2U C;  5M5W H;  4IJL A;  3DEO A;  2A6E C;  3TZD A;  1HR0 Q;  1CI3 M;  1AEX A;  2R92 G;  1FNW A;  3JAM E;  3PUZ A;  3CCS A;  5GAH C;  1HHV A;  2ES2 A;  1S40 A;  2WB1 G;  4HCS A;  5C44 H;  2XRS D;  2MO0 A;  1XNR Q;  5J22 A;  1B70 B;  1I4X A;  2SNS A;  3GTP B;  1MD2 D;  3W3A A;  4KTA A;  4WOR A;  4Y7N B;  2L55 A;  1NR2 A;  4O1N A;  4DAY B;  1VMP A;  2O5J C;  5FOB B;  4DKA C;  1PYB A;  2CQA A;  1JR0 D;  3UDF A;  5K5P A;  1FD7 D;  4G7O C;  1TU2 B;  5I2X A;  4FF1 A;  1ICF B;  1ZXT A;  3T1H Q;  1U4L A;  3W1B A;  3AFP A;  2JA5 G;  3I91 A;  4RFB A;  4LF8 L;  3AFQ A;  5GAG C;  3BU2 A;  1EY4 A;  3MTS A;  2QF7 A;  1FJG Q;  1QB5 D;  2MP1 A;  1TKW B;  2VUM H;  2D0P A;  2PZT A;  1SE4 A;  3IFD A;  3I2Z A;  5A2Q L;  1M1K C;  2K6A A;  1C48 A;  1JOK A;  3CXC A;  3FVQ A;  3KJP A;  5ELC A;  5EQ0 A;  3NWT A;  3CPW A;  1E2W A;  1STB A;  4EQN A;  1B8A A;  1IBM L;  4I65 A;  4IFD J;  1GUS A;  3CCM A;  3E5S A;  1TWC H;  1J5E Q;  3PF4 A;  3D31 A;  1MBY A;  1F9S A;  4ILW A;  2BDO A;  2A69 C;  3K7A B;  4LF5 L;  1K83 H;  1H9M A;  1ONL A;  1A6X A;  3SXH A;  2MHV A;  2PW7 A;  1STE A;  3A8K E;  4JI4 L;  2WKC A;  4DUZ Q;  2Q2U A;  5EGT A;  1FL0 A;  3CCV A;  1I50 H;  3S17 B;  1EEI D;  4A3E G;  3CPF A;  1S5B D;  1VS0 A;  2EE1 A;  2YTV A;  3BDL A;  1S4Z A;  2NUC A;  1EYD A;  1KC8 C;  1BR9 A;  4DNI A;  4IPC A;  1HNZ L;  1S72 A;  4LFA L;  4X62 Q;  4KJN A;  3H3V I;  3S1N B;  1LO5 D;  5IP9 H;  4XTC S;  3AU7 A;  1DCZ A;  3QOJ A;  2E2J H;  4OGQ C;  4ZLT F;  1F2L A;  2C5C A;  2SNM A;  5CGK A;  3KF6 A;  1C9O A;  1NTG A;  1CSQ A;  1UUP A;  4JI3 L;  4GKK Q;  4H02 A;  4RAU C;  4LWC A;  4DR7 Q;  4N9P A;  1B2T A;  4O2D A;  1KAW A;  2EXZ A;  2JA6 B;  2Z6K C;  5T1G A;  4RCO A;  3KF8 A;  3AB9 A;  3WWV A;  3KLW A;  1D1K A;  4LF6 L;  4XYO A;  3I4M G;  2KHJ A;  2Z6K A;  4JYA Q;  2L11 A;  4L8J A;  1D7Q A;  4KN4 C;  4XDX A;  1RTN A;  1HNW Q;  3BJU A;  4BXX H;  5CV7 A;  1KLU D;  4QQB X;  3FKI G;  3C3L A;  2AMC B;  2ZXO A;  1WJJ A;  1H9J A;  1WTW A;  2NVQ B;  1K3B C;  1TR5 A;  3QWN A;  4NW2 A;  5KNC A;  4DUY L;  3RZD B;  4YCV A;  5J3B A;  2PNR C;  5FLX c;  4NXN L;  3UDX A;  2Q2T A;  4DV3 L;  1EQV A;  3W2D A;  1MSH A;  2X6L A;  2F1M A;  4C3J H;  3HKZ E;  1STH A;  4K8I A;  4DR2 Q;  2JA7 H;  1MHW C;  1TS5 A;  3J80 c;  4B9W A;  4MHE A;  3TRE A;  3I7F A;  2BA1 A;  3G7L A;  1PYW D;  3A55 A;  1SBB B;  2MFI A;  3D4D A;  4RGO S;  3SE0 A;  3RMH A;  1CFM A;  5IYD G;  2BH8 A;  4HJ7 A;  4G4K A;  1PRT B;  4DR3 L;  4A3L H;  2KA7 A;  3J81 j;  2FJ2 A;  3SEB A;  4JK1 C;  5LMN Q;  3CW2 C;  1AP0 A;  3GTP H;  2RCN A;  3NBI A;  4Y7N H;  1TS4 A;  5EBD A;  2VB2 X;  1MKH A;  3TP5 A;  4XQJ A;  3BS1 A;  3URY A;  4FF3 A;  5KIX A;  3E9H A;  1YZ6 A;  1PVO A;  2N8N A;  4TSS A;  3CRK C;  5DLQ E;  4AYB B;  1AH9 A;  2PQA A;  1A63 A;  3NEN A;  4OWT B;  5JEA H;  1J8I A;  2CFM A;  4LFC L;  3H3V C;  2F52 A;  5M5X B;  4XYQ A;  1PH1 A;  5K36 G;  3P20 A;  3SR1 A;  1A3T A;  4QIW E;  1QVC A;  4NXM L;  4KHP L;  4JI0 L;  1BOS A;  3KOJ A;  2ZXR A;  2UXC L;  4DV4 L;  3Q8D A;  2K52 A;  4K2L A;  1EY7 A;  1SMY D;  4HED A;  1BUV T;  4B3T Q;  1DZ1 A;  2A68 C;  4A3J B;  3PO2 G;  3E9I A;  1DJR D;  2IY5 B;  1TY2 A;  4CJ2 C;  5G3L D;  2VB3 X;  1SYB A;  1HNX Q;  5EKI A;  4XT3 B;  1G6Z A;  4HTH A;  1MGS A;  3NBH B;  1K9M C;  3CC4 A;  3S16 H;  3K7A H;  1SYE A;  2IW3 A;  4AH6 A;  3BVG A;  1O7L A;  5E1F A;  4JI7 L;  1GOZ A;  4NP5 A;  1V8Q A;  1X3E A;  1XX8 A;  1BCP D;  2F4I A;  1B3Q A;  4GN4 B;  2UUC Q;  4PNY A;  2WAQ E;  2NZH A;  4B3R Q;  4KY5 A;  3S17 H;  3TP6 A;  5A35 A;  1DGS A;  4IQZ A;  3K5O A;  4JI5 Q;  3CD6 A;  2FMM A;  2B2W A;  2KED A;  1VQ4 A;  4B08 A;  4M8A A;  4DV6 Q;  1AZP A;  4K14 A;  5EBC A;  5LL6 S;  2L12 A;  5JPM C;  4JV5 L;  5M3F B;  3S1N H;  3E0J A;  1HCZ A;  4DF7 A;  2E76 C;  5HGT A;  4JI2 Q;  4C1N I;  3R93 A;  2E75 C;  5C0X G;  4RCN A;  4LF9 Q;  3HOW G;  5CV8 A;  1GUW A;  4F87 A;  4PZ8 A;  4NPS A;  3BVZ A;  3ZYY X;  1VQ6 A;  1YI2 A;  4KI0 A;  3HP3 A;  2AWO A;  3J81 c;  3LNN A;  3BDC A;  4A4I A;  2ENB A;  2WAQ B;  1U5K A;  2K75 A;  3CHB D;  2WIN B;  4IN3 A;  3F2C A;  1NUC A;  1XPU A;  4EQP A;  4ME3 A;  3NTK A;  5C0X I;  5D3D A;  2H5X A;  1IBM Q;  3RLF A;  4K6D A;  1Q90 A;  2QDB A;  1SNM A;  1PFM A;  1Q46 A;  2JA6 H;  1IKL A;  1SMY C;  1YEZ A;  1FGU A;  4GOP A;  1HA6 A;  1Y1V B;  2A1A A;  1Q82 C;  2AUK A;  3N6R A;  4UHV A;  4YWM A;  1KNE A;  4PV1 C;  1B50 A;  1F2Z A;  1IYU A;  4DFA A;  2EXD A;  2KCC A;  2F0V A;  1H9R A;  3S2D H;  2NVQ H;  2K5D A;  2Y0S G;  4V19 0;  3RZD H;  4JI4 Q;  2K33 A;  3EBE A;  3K59 A;  4K0K L;  3M4O B;  3QIA A;  1NMG A;  4PMB A;  2K50 A;  2GVA A;  5ELO A;  1JB3 A;  3MXN B;  4O0A A;  3U9O A;  1UNS A;  3KDF A;  1HFG A;  1YHB A;  3I3C A;  2KBN A;  4BY7 B;  4OIJ A;  1X3G A;  2K7V A;  4CKE A;  1L0X B;  3NHH A;  1CT1 D;  2L1B A;  5JJL A;  1GUO A;  1H9S A;  1A3U A;  2FFK B;  5CR3 A;  3DUZ A;  4EX5 A;  4HR7 B;  4HJA A;  3IKJ A;  1L0Y B;  1Q7Y C;  4V0B A;  1ET9 A;  1QZG A;  3MZ5 A;  4JI1 L;  4F88 A;  4KY7 A;  3L7Z C;  4XXE A;  1KL9 A;  5LMU L;  1EY6 A;  5CYU A;  1JOR A;  1JE5 A;  4DR5 L;  4OIK A;  2V4D A;  4RHR A;  4CDE C;  1WYD A;  1S5E D;  2R93 G;  2DNC A;  1KAB A;  4DV1 L;  2R7Z G;  3RUZ A;  1S5D D;  1BNZ A;  3GTK B;  2D5D A;  3T53 B;  4IJH A;  4BA1 I;  3F8T A;  4A3I G;  3VYS A;  1ENA A;  1XPR A;  4I7Z C;  5M5X H;  5BN5 A;  4TQU S;  2D2C C;  2K01 A;  4R9W A;  1EWC A;  2ID0 A;  1EY5 A;  2QDL A;  1LYL A;  1FYC A;  2YYZ A;  3W5O A;  2JEA I;  1MJC A;  4DV3 Q;  1KIX A;  1KXL A;  4ZK9 B;  2Q8I B;  3ONA B;  1RCV D;  3FRP B;  5C5L A;  1VQL A;  1LAC A;  3E6Z X;  3R2T A;  1CUK A;  1UWV A;  1YNN D;  4A3F B;  1XXG A;  4DAP A;  4A3G B;  4DR3 Q;  2DN8 A;  5GQO A;  1M4V A;  1SNQ A;  4B3M L;  4POG A;  4TVA B;  2PO4 A;  1U4P A;  5JAV A;  3EQL C;  1EYG A;  2YU9 B;  3A74 A;  4A3M G;  3S24 A;  3HKS A;  4BA2 I;  3VR5 A;  4K5V A;  1YJW A;  4ALP A;  2K32 A;  5C3E G;  2F0O A;  2R6G A;  1MSG A;  2QCP X;  1CKM A;  3BYY B;  1LTB D;  1CM9 A;  4KV6 A;  3KFU A;  5M3F H;  1STN A;  1SNO A;  3BG3 A;  4JW0 A;  3HRZ C;  1B44 D;  3PMF A;  4JG2 A;  1PV4 A;  2CW0 C;  4WFN 3;  3OHX C;  1LTL A;  2CHB D;  5C44 G;  5IP7 H;  5JVH 3;  2I46 A;  4KJO A;  4BBS B;  3WDN A;  4KHP Q;  2K03 A;  3J81 L;  2F0Q A;  3J7Z C;  1NE3 A;  4JBK A;  2HHH L;  4DV4 Q;  1CQV A;  1I94 Q;  4DXG A;  5EPJ A;  4HMJ A;  2XTI A;  4KLK A;  3EFX D;  2KUM A;  2GA4 B;  2MPM A;  4YY3 L;  2X6G A;  4DR1 Q;  3NSW A;  3S14 B;  3CME A;  2OT2 A;  3FPU B;  3Q23 A;  3OMG A;  2RHQ B;  2HDL A;  4PMC A;  1RHP A;  4HMI A;  1YHA A;  4LNQ A;  3KLR A;  1P8L A;  3LWE A;  2F4V L;  1XMO Q;  1EZ8 A;  1IL8 A;  1AZQ A;  1CQF A;  5AJ3 L;  2DJG C;  1VQK A;  1JE4 A;  1K8G A;  1EIF A;  3D6C A;  4YCU A;  5CC4 A;  2A6H D;  4WJW A;  3A54 A;  2VNU D;  2KHI A;  1WCM B;  3TRZ A;  3M4O H;  2B8G A;  2B63 B;  4JBJ A;  3MAQ A;  4X66 Q;  1J6Q A;  4PZ7 A;  2C35 B;  3K7U C;  4APV A;  1CTM A;  2EY1 A;  1OXT A;  5FK9 C;  2Z4H A;  3K5M A;  1KDC A;  1VQO A;  3F1Z A;  2H1E A;  4JV5 Q;  1SNP A;  4BY7 H;  4TRD A;  4DR4 L;  3PV0 A;  2YTX A;  5ELB A;  1PXU A;  2J7Z A;  2LSS A;  4A93 B;  3KBG A;  4L5S A;  2XIW A;  5E4W C;  4Y52 H;  1QOH A;  3GTM B;  2UU9 L;  1SYF A;  3QB3 A;  1EFW A;  4UP9 A;  2IJ0 A;  3I4L A;  1CHQ D;  4IPG A;  2ZTD A;  3TBI B;  4CKB A;  5BN4 A;  1A0I A;  1JJC B;  2XSC A;  2CH4 A;  1G91 A;  4RHS A;  4J8Q A;  4OX9 L;  2UUB Q;  2A74 C;  1T9H A;  4QF4 A;  1K28 A;  1GM5 A;  1YNJ D;  3OWE B;  3PCO B;  1Z47 A;  1TWG B;  4HN7 A;  5IP9 G;  4CBV A;  1JOO A;  2E8G A;  4NDX A;  3M4Y A;  1PTO F;  1BXT A;  2NZ1 D;  3NE5 B;  4DXF A;  1VF7 A;  1CA5 A;  5FO9 B;  2BDN A;  4DV0 L;  2O5I C;  4A3C G;  2WB1 E;  1VQI A;  1EY8 A;  3S1R B;  4O42 A;  3VYU A;  4U67 3;  2I5M X;  4K0K Q;  4MNO A;  4BBR G;  4F7X A;  5IYC G;  4M1U B;  4OO1 H;  2A6H C;  4KD3 A;  1QNU A;  3N52 A;  1WVL A;  4LF4 Q;  4HSP A;  4YCW A;  1RTO A;  3JC6 6;  4KKU A;  1R9T B;  5CV6 A;  1Y8O B;  4GLA C;  2OF1 A;  2A69 D;  1DM0 B;  4C1N K;  5E7N A;  4A3G H;  1LTA D;  1TY0 A;  5IGG A;  1EL0 A;  4N8F A;  1KQS A;  3TSS A;  1ENC A;  2YU9 H;  1WTX A;  1L1O C;  1B4O A;  1B9N A;  1YNX A;  2WB1 B;  5JOB A;  3HOX H;  4C3J G;  3F2B A;  3K81 C;  3HOU G;  1L1O A;  5ELF A;  4QY7 A;  1JOQ A;  3ER0 A;  4ODG A;  1JT8 A;  3G6E A;  4IOA A;  3M4Q A;  5KGU A;  1DOK A;  2B2V A;  4RMF A;  5GAE C;  1PH3 A;  3RZO B;  2F0F A;  1O7Y A;  4HCE A;  2NZO A;  1K8O A;  1N9W A;  1YNJ C;  5M3M H;  2O2L D;  4UDU C;  4N9T A;  4A3L G;  3J81 i;  5FLM H;  4IUQ A;  4CDC C;  2JA5 B;  4UAI A;  1I4G A;  5JVG 3;  4IFD H;  5TSS A;  3QO2 A;  1N32 L;  1CKN A;  1FGB D;  4R4C A;  4YHH Q;  2K5H A;  4H44 C;  2VQE L;  4R4T A;  1GJX A;  2E2D C;  4GNX A;  1I4R A;  4JC0 A;  4ZYS A;  3BZK A;  2IT1 A;  2B8F A;  2JK8 A;  2QKI C;  1SEB D;  4QB4 A;  3OOC A;  1K0R A;  3NEL A;  1F9R A;  4B3M Q;  3H6M A;  3KLS X;  3GTL B;  4LUZ A;  3PO3 G;  3T1Y L;  2RDG A;  1S3O A;  3MWY W;  2NVX B;  1PYS B;  5M9O A;  1XTC D;  1WCM H;  1Q3L A;  1D5M C;  3L2P A;  2ZM6 L;  2UXD L;  1JMC A;  3KJO A;  4E6I A;  4LAA A;  4A3E B;  3EJI A;  2PI2 E;  1NY4 A;  2B3G A;  1AFP A;  3QOL A;  3J81 E;  5LL6 X;  1EY0 A;  1KTK A;  4FYD A;  3S15 B;  2D0O A;  3T4A C;  3S1M H;  5C3W A;  3I70 A;  3GO5 A;  5FJ8 H;  1YJN A;  3K5L A;  4A93 H;  4LF7 L;  2JA8 B;  4A76 A;  5CV5 A;  3X3M A;  5E3F A;  4OEM B;  4X3U A;  1G29 1;  1G2S A;  1D6E C;  2DY7 A;  4Q0F A;  1EEF D;  2I5H A;  3ERS X;  1WTH A;  1LTI D;  1VQ9 A;  1AN8 A;  4RGT A;  4LFB Q;  3PIO A;  1PMR A;  2B29 A;  5I6W A;  2OQ0 A;  2Q2I A;  1HZ9 A;  5NUC A;  1CZW A;  1CKO A;  1Y8N B;  1B7Y B;  4OWX B;  4QL5 A;  4YY3 Q;  2F0I A;  2DY8 A;  2EOT A;  3KBX A;  1E2V A;  1TWG H;  3M3Y B;  3M9B A;  1PH5 A;  1O78 A;  1PFN A;  1Q1B A;  2DGY A;  1BVS A;  2NYZ D;  2RA4 A;  5GRO A;  2EZV A;  1NAP A;  5M5Y B;  4IUV A;  4JBM A;  2F4V Q;  4FXG C;  1EOV A;  4X3S A;  3BDO A;  2FHT A;  2UUA L;  5IWA L;  3FKI B;  4QMG A;  3S1R H;  4JVZ A;  3CMA A;  1EWI A;  1QUQ B;  1O7Z A;  2Z0S A;  4PZ6 A;  1SE2 A;  2A68 D;  1SND A;  2JA6 G;  3IL8 A;  1SYD A;  2Q8T A;  1F9P A;  2R61 A;  5EKK A;  1R9T H;  1KRS A;  4HID A;  1Q8I A;  1WFQ A;  1TWF B;  4R8N A;  2QA4 A;  4AYB E;  4GKJ L;  3E3X A;  1BO0 A;  3UE0 A;  2AWN A;  1E1T A;  1E24 A;  2G9H D;  3PGZ A;  1C0A A;  3TS0 A;  3TS2 A;  1OXV A;  2KCN A;  1EU3 A;  3SK8 A;  1YBY A;  2PZW A;  2Z1C A;  4LUO A;  4DAY A;  3J7A F;  2CWA A;  5HGQ A;  4KD4 A;  3S1Q B;  2JQO A;  2E5L Q;  1X6O A;  2CQO A;  2K14 A;  4LUV A;  1W3S A;  4XQN A;  1NSN S;  1RIP A;  2JN4 A;  4MTK A;  4OX9 Q;  4DAM A;  3CCR A;  2LKV A;  5KRU A;  1ILP A;  3RZO H;  5CV4 A;  1HTL D;  1BCP B;  4IUN A;  1RL2 A;  4ZAI A;  3A5U A;  3I4N G;  1SFO B;  1WI5 A;  1D1I A;  3NEM A;  1ASZ A;  4DV0 Q;  5C5M A;  2JA5 H;  4QJF A;  3K6O A;  2PMZ B;  1YJ9 A;  2IX1 A;  3HGB A;  1SMX A;  5EPK A;  5KEE A;  4YIJ A;  2K5W A;  3H0G G;  1PFB A;  1TS3 A;  2KCM A;  4OXP A;  4QUF A;  1IBK L;  2E2I B;  3SK4 A;  1C8C A;  3NK9 A;  2NVY B;  2K5Q A;  5I9P A;  2EY2 A;  3HFZ B;  3A5Z B;  3HKZ G;  2NN6 H;  5ELN A;  4DV2 Q;  4H7B A;  3M4P A;  2AUJ D;  2F0S A;  1EY9 A;  4X65 Q;  1GHJ A;  3S2H B;  3PO2 B;  4K5X A;  1T5E A;  1A15 A;  4UY8 C;  2MQH A;  3MFY A;  5I9O A;  1DON A;  4DNT B;  3AMU A;  3SVM A;  3PIP A;  4FNF A;  3ULJ A;  3GTL H;  1ILQ A;  2LMC B;  4GN3 B;  2F3I A;  1EIG A;  2NVX H;  3F2U A;  5L37 A;  3ITP A;  3H3V H;  1K8M A;  3VYT A;  1L2F A;  2EQS A;  4F8M A;  3NWS A;  3SK6 A;  2B2W C;  1VQN A;  1BBW A;  5JJZ A;  4DV7 L;  1LLR D;  3S15 H;  2H4O A;  1CA6 A;  5I2Y A;  3TP8 A;  1I4Q A;  5BN3 A;  1NJI C;  1NMF A;  3HOZ G;  1UEB A;  1IHZ A;  2Z9H A;  4IUT A;  5A2Q E;  2JA8 H;  2KJX A;  3I73 A;  2YTY A;  4WRD A;  4BWG B;  4RA8 A;  1HPC A;  3OIP A;  4LF8 Q;  3HOW B;  3CF5 A;  1IYV A;  2RDH A;  1WTO A;  3K0Y A;  1STG A;  1NR4 A;  4OEL B;  3TN2 A;  2PI2 A;  4OL7 A;  3GDE A;  3LGJ A;  3WOF A;  2UXB L;  2IPK D;  3A7L A;  3K8A A;  2EJF C;  2HD3 A;  1QE6 A;  2F3V A;  2ASB A;  3OIQ A;  2B2T C;  1RD9 D; 
#chains in the Genus database with same CATH homology
 1IXR A;  3F2D A;  5M5W H;  3B6Y A;  3KFU A;  4IJL A;  5M3F H;  4GOP C;  1HR0 Q;  1SN8 A;  5M5Y H;  3CCE A;  5IP7 G;  4DR4 Q;  4L5Q A;  4JG2 A;  1PV4 A;  1PFS A;  4YWL A;  2R92 G;  3GD7 A;  1LTL A;  5C44 G;  4LF5 Q;  5IP7 H;  3T1Y Q;  2PMZ E;  3PUZ A;  3CCS A;  4GOP B;  5GAH C;  4KHP Q;  3FKI H;  1O7I A;  3W1G A;  1S40 A;  2WB1 G;  2ES2 A;  2WAQ G;  4JI6 L;  2R92 H;  5C44 H;  4MTN A;  2UU9 Q;  1QVG A;  2MO0 A;  1XNR Q;  1B70 B;  3J7Z C;  2CWP A;  1NE3 A;  2ZM6 Q;  4DR6 L;  2UXD Q;  2A19 A;  4IPH A;  4JBK A;  2HHH L;  4DV4 Q;  3CAM A;  1I94 Q;  3HOU H;  4JI8 L;  1VQF A;  2XTI A;  4UP7 A;  4DAY B;  4KLK A;  1UE6 A;  4DKA C;  4YY3 L;  4DR1 Q;  1PYB A;  1D8L A;  3CME A;  1E22 A;  4A3B G;  5IY0 A;  1TWF H;  1SE8 A;  4AIM A;  1HJP A;  2ZTC A;  3UDF A;  1HNZ Q;  2RHQ B;  4LFA Q;  3SGI A;  2ALY B;  4LF7 Q;  1YHA A;  4LNQ A;  3OTO L;  1P8L A;  4AQY L;  1WOC A;  1Q81 C;  3EIV A;  3T1H Q;  3KDF B;  3W1B A;  1XMO Q;  2F4V L;  3AFP A;  2JA5 G;  1HH2 P;  4LF8 L;  5AJ3 L;  3AFQ A;  5GAG C;  5IYD H;  3BU2 A;  1VQK A;  1K8G A;  2E2H H;  1FJG Q;  4P72 A;  1EIF A;  4YCU A;  3RN5 A;  2JE6 I;  2OTL A;  2VUM H;  2D0P A;  2HT1 A;  3I2Z A;  1Z9F A;  2HIV A;  1M1K C;  2KHI A;  3TRZ A;  3S1Q H;  2VNU D;  3M4O H;  2N49 A;  1Q8K A;  1K3R A;  4JBJ A;  3CXC A;  4IOC A;  3PF5 A;  3KJP A;  4X66 Q;  4JI3 Q;  1J6Q A;  4PZ7 A;  3CPW A;  2C35 B;  3K7U C;  4A3D G;  4APV A;  1B8A A;  1IBM L;  1OXT A;  3HOY G;  4BY7 G;  3U50 C;  3IRB A;  3G4S A;  3JAM c;  4IFD J;  4AYB G;  3F1Z A;  4HJ9 A;  3CCM A;  1VQO A;  3DLL A;  1N8R C;  3CCL A;  4JV5 Q;  1TWC H;  1HR0 L;  1J5E Q;  3PF4 A;  4BY7 H;  3D31 A;  4DR4 L;  3PV0 A;  2YTX A;  2HQL A;  1SFO H;  2LSS A;  4LF6 Q;  5IT9 c;  4L5S A;  4LF5 L;  1K83 H;  4Y52 H;  2ATW A;  2UUA Q;  4PG3 A;  1SLJ A;  3M85 A;  4B3S L;  3PO3 H;  1XMQ Q;  2NVT H;  4OWW B;  2UU9 L;  1XNR L;  2QEX A;  1EFW A;  3U4Z A;  4UP9 A;  4JI4 L;  4DUZ Q;  4DUY Q;  2ZJR A;  4IPG A;  2NVY H;  2ZTD A;  3PUV A;  2KCT A;  2MNA A;  1FL0 A;  5JEA J;  1EQQ A;  3CCV A;  1I94 L;  1A0I A;  1I50 H;  1JJC B;  1JJ2 A;  4NXN Q;  3H15 A;  4A3E G;  3CPF A;  4A3J G;  1YVC A;  1VS0 A;  2YTV A;  1EIY B;  4DR1 L;  5C4X G;  4OX9 L;  2UUB Q;  4JOI C;  1T9H A;  1VCI A;  1YIT A;  1GM5 A;  3AEV A;  4A3E H;  3PO2 H;  1KC8 C;  4A3J H;  3S2H H;  1YIJ A;  1EUJ A;  3PCO B;  3E0E A;  1K73 C;  1Z47 A;  4DNI A;  1BKB A;  5IP9 G;  4IPC A;  4JOI A;  2E8G A;  1HNZ L;  4GKJ Q;  1S72 A;  4LFA L;  4X62 Q;  2AKW B;  1PA6 A;  3H3V I;  1A62 A;  1UE1 A;  1SRU A;  5IP9 H;  1XMO L;  1HR0 W;  4XTC S;  1XPO A;  1QVF A;  1VQH A;  2VS1 A;  4POF A;  4GLX A;  4DV0 L;  1FJG L;  2CCZ A;  4A3C G;  2WB1 E;  1E7Z A;  1YHQ A;  1VQI A;  1X55 A;  2E2J H;  2Y0S E;  1PH8 A;  1C7Y A;  2I5M X;  4K0K Q;  4MNO A;  4BBR G;  3KF6 A;  5IYC G;  1N32 Q;  1C9O A;  1NTG A;  1CSQ A;  4JI3 L;  4X66 L;  4GKK Q;  2EIF A;  1GVP A;  4H02 A;  1VQ5 A;  4LF4 Q;  1HZB A;  4LWC A;  2VQE Q;  1K8A C;  4DR7 Q;  4YCW A;  3JC6 6;  4DV5 L;  4O2D A;  1KAW A;  3FHW A;  2Z6K C;  5M3F G;  4R1J A;  3WWV A;  1J5E L;  3KLW A;  3M3Y H;  4GLA C;  1MIU A;  4LF6 L;  2Q2U A;  3I4M G;  2KHJ A;  2Z6K A;  4JYA Q;  1D7Q A;  2RF4 A;  5E7N A;  1HNW Q;  3I4M H;  1QUQ A;  4A3G H;  3BJU A;  4BXX H;  4LFC Q;  4QQB X;  3FKI G;  3HOW H;  2AMC B;  3HOX G;  1WJJ A;  1UE5 A;  3VDY A;  2I0Q A;  4QGU A;  1KQS A;  1OXU A;  2OCE A;  3GTJ H;  1IBK Q;  2YU9 H;  4DUZ L;  1L1O C;  4NXM Q;  1YNX A;  4X64 Q;  3HOX H;  4DUY L;  4YCV A;  5J3B A;  1P16 A;  4DPG A;  5FLX c;  4NXN L;  3K81 C;  3F2B A;  3UDX A;  4JI0 Q;  1L1O A;  4DV3 L;  2Q2T A;  3HOU G;  1TXY A;  4QY7 A;  4R4Q A;  1VQD A;  1VQG A;  3ER0 A;  4C3J H;  2UXC Q;  1LUZ A;  2JA9 A;  3HKZ E;  3G6E A;  1IBL L;  4DR2 Q;  2UUB L;  3M4Q A;  4IOA A;  2JA7 H;  1G6P A;  1X65 A;  5C0X J;  1PH3 A;  4RMF A;  5GAE C;  3TEH B;  3J80 c;  3D0F A;  1GKH A;  4R4O A;  3CC2 A;  2NZO A;  5M3M G;  3TRE A;  4X62 L;  1Y1V G;  3I7F A;  1N9W A;  2ZTE A;  3A0J A;  2BA1 A;  4BY1 G;  1XNQ L;  2IX0 A;  5FLM G;  5M3M H;  3RLO A;  3GTO H;  1Y1V H;  2MFI A;  4DK3 C;  3AYH B;  4A3L G;  2N78 A;  4BY1 H;  3J81 i;  5IYD G;  5FLM H;  2BH8 A;  4HJ7 A;  4IFD G;  1VQE A;  4DR3 L;  2ZJQ A;  4JI7 Q;  4A3L H;  2KEN A;  2VUM G;  1U0L A;  2HIX A;  3J81 j;  4LW1 A;  1VQ7 A;  3CC7 A;  5LMN Q;  3CW2 C;  3GTP H;  2RCN A;  1N32 L;  1CKN A;  4R4C A;  3HOV G;  4Y7N H;  4GKK L;  4YHH Q;  2K5H A;  1MKH A;  4LF4 L;  2VQE L;  1X3F A;  1L0W A;  4R4T A;  3HOV H;  1IZ6 A;  1E1O A;  4X6A H;  1OXX K;  4GNX A;  4IFD I;  2GN5 A;  1YZ6 A;  3E9H A;  4JC0 A;  2OTJ A;  2N8N A;  3BZK A;  1PVO A;  2IT1 A;  5DLQ E;  2VQF Q;  1N34 Q;  1N33 Q;  1AH9 A;  2PQA A;  2JK8 A;  1N36 Q;  1A63 A;  3NEN A;  2WP8 J;  4OWT B;  1K0R A;  1SRO A;  4L5R C;  3I4N H;  3CP0 A;  3NEL A;  2CFM A;  4LFC L;  2F52 A;  4B3M Q;  4LUZ A;  3PO3 G;  4HJ8 A;  3ULL A;  3T1Y L;  1IL2 A;  1PH1 A;  2I5L X;  4C3I H;  5K36 G;  1S3O A;  1AE2 A;  2RHS B;  4QIW E;  1QVC A;  4NXM L;  2N3S A;  5IWA Q;  3ULP A;  3RR5 A;  4KHP L;  3RN2 A;  1PYS B;  2Q2H A;  3H0G H;  4HIO A;  1WCM H;  2E2I H;  4JI0 L;  3G48 A;  3UDG A;  3L2P A;  3DM3 A;  2ZM6 L;  2UXD L;  3KOJ A;  2UXC L;  2MO1 A;  4DV4 L;  3Q8D A;  1EQR A;  2K52 A;  3KJO A;  1JMC A;  4B3T Q;  2PI2 E;  3PO2 G;  1NY4 A;  3E9I A;  2B3G A;  2K5N A;  4P73 A;  4JCV E;  5GAD C;  2IY5 B;  2VW9 A;  2VL6 A;  2A8V A;  2D0O A;  1VQC A;  2R93 H;  1HNX Q;  3S1M H;  2R7Z H;  5FJ8 H;  1X54 A;  3GO5 A;  3ZJY C;  1YJN A;  3NBH B;  1K9M C;  3CC4 A;  4LF7 L;  3GTK H;  3K7A H;  4A76 A;  3S16 H;  4A93 H;  4AH6 A;  3T1H L;  4A3I H;  1G29 1;  4JI7 L;  1X3E A;  2I5H A;  3ERS X;  3K80 C;  3BZC A;  1VQ9 A;  4GN4 B;  4HJ5 A;  1Y1W G;  2UUC Q;  4LFB Q;  1TWH H;  1AE3 A;  2WAQ E;  3PUX A;  4PMW A;  3PIO A;  2B29 A;  2NZH A;  4XIG S;  4DR6 Q;  4B3R Q;  4OO1 G;  4YHH L;  2OQ0 A;  1VQJ A;  4FDB A;  2Q2I A;  1HZ9 A;  1Y1W H;  1H95 A;  3S17 H;  1X56 A;  4GS3 A;  2AHO B;  4IPD A;  1VQB A;  1DGS A;  1VQM A;  1CKO A;  4A3K G;  4JI5 Q;  2YV5 A;  1PH9 A;  2IHE A;  3CD6 A;  3PSI A;  1VQ4 A;  1B7Y B;  4OWX B;  4JBW A;  4QL5 A;  3RLN A;  1V43 A;  4YY3 Q;  4DV6 Q;  1SR3 A;  1MJE A;  3J7A 5;  4A3K H;  3KF6 B;  1KD1 C;  1FVI A;  1TWG H;  3M9B A;  1PH5 A;  1X9N A;  1Q1B A;  2DGY A;  1BVS A;  4JV5 L;  3S1N H;  5GRO A;  3OTO Q;  4A3F G;  2L15 A;  4OO1 I;  4JI2 Q;  1HZC A;  4JBM A;  2F4V Q;  2LXK A;  3HOZ H;  1EOV A;  4A3G G;  5C0X G;  4BXX G;  3KF8 B;  3HOW G;  4LF9 Q;  1HZA A;  4A3F H;  1JJG A;  1PH7 A;  2UUA L;  1JB7 A;  4PZ8 A;  4P71 A;  4WJ3 M;  4NPS A;  5JJK A;  4L5T A;  5IWA L;  1PH4 A;  1VQ6 A;  1XJV A;  1YI2 A;  3S1R H;  4KI0 A;  2AWO A;  2JEB I;  2LXJ A;  3OYY A;  1XMQ L;  2R7F A;  2OQK A;  3EN2 A;  3J81 c;  3CMA A;  2VY3 A;  1EWI A;  1QUQ B;  4A4I A;  2D62 A;  4UP8 A;  2Z0S A;  1U5K A;  2K75 A;  3F2C A;  4PZ6 A;  1XPU A;  4JI1 Q;  4GLV B;  2JA6 G;  4ME3 A;  2JA7 G;  3KYH C;  5LMU Q;  5C0X I;  2H5X A;  1E3P A;  3RLF A;  1IBM Q;  4DR5 Q;  4EQ5 A;  1KRS A;  1Q46 A;  5C3E H;  1L1O B;  2K4K A;  3MEF A;  4HID A;  1WFQ A;  1R9T H;  2JA6 H;  3K0X A;  1HNX L;  4DK6 C;  2QA4 A;  4DV1 Q;  4AYB E;  4GKJ L;  1XTD A;  1YEZ A;  1FGU A;  3UE0 A;  4GOP A;  2AWN A;  1E1T A;  2A1A A;  3I4O A;  1Q82 C;  1E24 A;  3OW2 A;  3PGZ A;  4NB3 A;  4YWM A;  1C0A A;  3STB D;  1GO3 E;  4J15 A;  1V9P A;  4BBS G;  3TS0 A;  3TS2 A;  2EXD A;  3GTQ H;  4C3H H;  4B3S Q;  2IHF A;  1OXV A;  2NVQ H;  3S2D H;  2UUC L;  2Y0S G;  4BBS H;  4R4I A;  1YBY A;  1CSP A;  4LFB L;  1Q12 A;  2R7D A;  4LUO A;  3RZD H;  4JI4 Q;  4B3R L;  3EBE A;  2CWA A;  5HGQ A;  1VQP A;  3TQY A;  4K0K L;  2JQO A;  2E5L Q;  4MZ9 A;  1NMG A;  1X6O A;  2CQO A;  4JI5 L;  2K14 A;  4LUV A;  2K50 A;  1W3S A;  2GVA A;  1RIP A;  1W2B A;  4DV6 L;  5ELO A;  1M90 C;  3MXN B;  4OX9 Q;  4DAM A;  2OWO A;  3CCR A;  4GNX C;  4GN5 A;  4DR7 L;  1CKN B;  1TWA H;  4O0A A;  5IE8 A;  3RZO H;  4UPA A;  5IYB G;  4DV7 Q;  3KDF A;  4HIK A;  1RL2 A;  3M7N A;  1YHB A;  3S14 H;  4A3B H;  4IO9 A;  2KBN A;  5IYB H;  1X3G A;  3A5U A;  4JI2 L;  5JEA G;  3I4N G;  1LM0 A;  4GNX B;  1WI5 A;  4HIM A;  3RNU A;  4JYA L;  2FXQ A;  4LF9 L;  3NEM A;  4P75 A;  1ASZ A;  1BBU A;  4DV0 Q;  1HNW L;  1PH2 A;  2JA5 H;  5JJL A;  4QJF A;  2IX1 A;  1YJ9 A;  2PQA B;  1SMX A;  2GVB A;  4EX5 A;  4HJA A;  1JT8 A;  1ASY A;  2KCM A;  3H0G G;  4OXP A;  2WFW A;  1WCM G;  3J80 i;  1Q7Y C;  1OXS C;  1A8V A;  2NN6 G;  1IBK L;  2B63 G;  4X64 L;  1QZG A;  4JI1 L;  3HFZ B;  2UXB Q;  3A5Z B;  2K5V A;  3HKZ G;  3L7Z C;  1KL9 A;  2PNH A;  5ELN A;  3M4P A;  1Y14 B;  5EAY A;  3I55 A;  1G51 A;  5LMU L;  4DV2 Q;  2B63 H;  4WJ4 A;  1JE5 A;  4DV5 Q;  4DR5 L;  4DR2 L;  4A3D H;  4X65 Q;  2V1C C;  1WYD A;  3HOY H;  2R93 G;  4DV1 L;  2R7Z G;  3PUY A;  5HY6 A;  1I3Q H;  5BR8 Q;  5FJ8 G;  4UY8 C;  2MQH A;  4IJH A;  2NN6 I;  2ZJP A;  4A93 G;  1Q1E A;  1KRT A;  4BA1 I;  3F8T A;  1GD7 A;  4A3I G;  4A75 A;  3PIP A;  4YWK A;  1XPR A;  1PHJ A;  2CKZ B;  3ULJ A;  3GTL H;  5M5X H;  4GN3 B;  5H1S E;  4TQU S;  5C4J H;  1I6H H;  2F3I A;  3STB C;  2NVX H;  2ID0 A;  1LYL A;  4JI6 Q;  3GTM H;  2YYZ A;  3W5O A;  1UE7 A;  4P74 A;  5LMN L;  1L2F A;  1MJC A;  4DV3 Q;  1KIX A;  2E5L L;  2JEA I;  3H3V H;  1KXL A;  2EQS A;  3I56 A;  3JAM i;  1IBL Q;  2HHH Q;  1Q86 C;  1OTC A;  1VQN A;  4RG1 A;  1BBW A;  4JI8 Q;  1PH6 A;  4DV7 L;  1VQA A;  3AQQ A;  5C4X H;  4C2M H;  1VQL A;  3UE1 A;  3FP9 A;  3S15 H;  2JA8 G;  1XNQ Q;  1QZH A;  2VQF L;  1NJI C;  1N34 L;  1CUK A;  1N33 L;  5JJI A;  3G71 A;  1NMF A;  3U58 A;  3HOZ G;  1UEB A;  1N36 L;  2JA8 H;  1UWV A;  2JJQ A;  3U4V A;  2YTY A;  1KHI A;  4AQY Q;  4DR3 Q;  3PUW A;  5GQO A;  4OON A;  4B3M L;  5AJ3 Q;  4LF8 Q;  1NBW A;  4TVA B;  3UDI A;  3CF5 A;  4POG A;  4A3C H;  2QGQ A;  1EYG A;  3L0O A;  2BA0 A;  3ICE A;  2VZA A;  3CCJ A;  2PI2 A;  1VQ8 A;  3A74 A;  4A3M G;  3CQZ H;  3GDE A;  2DUD A;  3LGJ A;  2UXB L;  3S24 A;  1I5F A;  3HKS A;  4DV2 L;  4BBR H;  4BA2 I;  5IYC H;  5LMN W;  1YJW A;  4KHZ A;  1IYJ B;  3CCQ A;  3CCU A;  2XGT A;  4ALP A;  3K8A A;  4A3M H;  1V1Q A;  4X65 L;  2BH2 A;  5C3E G;  4B3T L;  2R6G A;  3GTG H;  1CKM A;  2ASB A;  5BR8 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...