1HR0Q

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hr0Q00
3HKSA 5IYBH 5JJLA 3G4SA 1A0IA 2BH8A 3KF8B 2YTVA 4JI3Q 1Q86C 4JV5Q 4JG2A 4A3DH 1Y1WH 3GTMH 4BA1I 3EBEA 2ZTEA 1Q1EA 4P72A 4POFA 1OXTA 1HNZL 4OWXB 1RL2A 3TQYA 4P73A 4A3JH 1XNRL 5BR8L 4AQYQ 1U5KA 4P75A 3G71A 4A3MG 4O0AA 3GTPH 2N49A 1K8GA 3CCRA 2VNUD 5IYCG 1KAWA 1D7QA 2IHFA 1JE5A 1E1OA 4IPDA 4JI0Q 4A93G 3HFZB 4LF5Q 1V9PA 3HOVG 2R7ZG 1Z9FA 3H0GG 5FLMG 2UXCQ 1X3EA 3S16H 1W3SA 1EIFA 1SMXA 5ELNA 1NBWA 4XIGS 5IWAL 4HJ5A 2MQHA 4IJLA 3CCVA 4GKJQ 5IP7H 2CWAA 1CKMA 4A3KH 1VQ4A 4PZ6A 1EFWA 1UE7A 1EOVA 1C0AA 1N36Q 5GQOA 2BH2A 3J7A5 4MZ9A 3CP0A 4QJFA 1SFOH 2ZM6L 2AMCB 2OTJA 1DGSA 4ALPA 1JJCB 5IT9c 1JB7A 2RF4A 1ASZA 4DR6L 4A76A 3PV0A 2LXKA 1PH8A 4JI2L 3HOZG 2Z6KA 3E9HA 2HIVA 3RN5A 3I4OA 3CCQA 1Q8KA 2I5MX 4X65L 2DUDA 4C3HH 2Q2IA 2R92H 1YEZA 1QUQB 3TREA 1HZ9A 3UDGA 2ZTDA 4MTNA 3F2BA 1V1QA 4R4IA 4B3SQ 2VUMH 3H3VI 4HJ8A 1WOCA 3HKZE 3BZKA 4DUYL 3U50C 4B3ML 2CKZB 4BA2I 4IPCA 1N34L 1MJEA 4A3JG 1G51A 3CMAA 4BY7H 3KDFB 4A3GH 1E24A 4GN5A 5IP9H 3D31A 4X6AH 4LF4L 4C2MH 5LMNQ 1CKNA 3OTOQ 1VQBA 2PQAB 1VQIA 1VQCA 1L1OA 3ULLA 3I55A 1YHQA 4GNXB 1NE3A 2UUCL 1OXSC 4DK3C 2JA6G 2WAQG 5IP7G 4PZ8A 1B8AA 1G291 4DV3Q 5IYDG 4A75A 3T1YL 4A3KG 1IBML 2KCTA 2OQ0A 1X54A 1FL0A 1Y1VG 3RZDH 1HZCA 2Y0SE 4NB3A 1G6PA 2L15A 3M4QA 4NXML 3DLLA 1JJGA 1C9OA 2AKWB 2PI2E 2WB1E 4QGUA 2PMZE 1PV4A 2UUAQ 4GLVB 4JI5Q 3UDIA 1Q12A 5ELOA 4AH6A 1N32Q 2JA7G 1L2FA 1J5EL 5LMUQ 5M5XH 4JYAL 1NMGA 3PF4A 4LF6Q 1X3FA 4DR3Q 4DV0L 1T9HA 4BBRH 2F4VQ 4KHPL 1KL9A 4BY1G 4MNOA 4DV2Q 2VUMG 3ULJA 2GVAA 4JBWA 3G6EA 4BBSH 3RLOA 1VQEA 1PYBA 4R4CA 1B70B 2YU9H 4B3TQ 3PSIA 3U58A 3ULPA 2QGQA 4UP9A 3TS2A 3CQZH 4A3GG 2UU9Q 3LGJA 5IP9G 5C3EG 4X64L 1Q1BA 2D0PA 4PG3A 2NN6I 4LUOA 2BA0A 1X3GA 2Q2TA 1X56A 1IBKL 4DV7Q 2JEBI 1NY4A 1TWGH 1N33L 3S2DH 1HJPA 4B3RQ 1E7ZA 2CQOA 2UUBL 4HIDA 2JA8H 3NELA 1PYSB 2GN5A 1VQDA 5LMNW 4LF7L 4A3EH 3PF5A 3CCLA 4LFCQ 4LWCA 2V1CC 2HIXA 3RN2A 2EQSA 1YBYA 2F3IA 5GROA 4Y7NH 1I94Q 4QIWE 4NPSA 4JI3L 3HOWH 4JV5L 4JOIC 1K73C 1KHIA 2K5HA 3HKZG 3JAMi 1KQSA 1S3OA 4LNQA 4LF9Q 1SRUA 1KXLA 2NN6G 1SN8A 2WFWA 3KJPA 3GTOH 4QL5A 1L0WA 4BBRG 4AQYL 2KBNA 1QVCA 4NXNQ 1JMCA 1X65A 1FGUA 3J7ZC 3PUVA 1IBLQ 4BBSG 1YVCA 2RCNA 3RR5A 1PH4A 4RMFA 1NMFA 2E2JH 3FKIG 4JI0L 1XNQQ 3K7UC 1YJ9A 1LM0A 5AJ3Q 4HJ7A 2UXCL 4LFAQ 1TXYA 4A3FH 1KD1C 2BA1A 2N8NA 1QZGA 1HNXQ 4GKJL 2UXDQ 3AQQA 2AWOA 3GTJH 4DV1L 1N36L 4P74A 2Y0SG 4DR2Q 4JI4L 4DR4Q 1CSPA 1WCMG 4HIOA 2WB1G 3K80C 1UE6A 3A5ZB 3PUWA 2K75A 3WWVA 3CF5A 4L5TA 1YHAA 3PO3H 3KF6B 2JA8G 4HIMA 3W5OA 4JBKA 4LF8L 2OTLA 4JI1Q 4YHHQ 5JEAG 2MFIA 3UDXA 1R9TH 2OWOA 3CPWA 3CCEA 3HOWG 4DR5Q 4IOAA 1GD7A 3AFPA 1BVSA 3NEMA 1XMQQ 3AFQA 3S1NH 2GVBA 1UE5A 4R1JA 1PH9A 1I3QH 5LMNL 4OX9Q 4HJ9A 4DR7Q 2K5NA 1LUZA 4X62Q 4GLXA 1VQHA 2AWNA 3CAMA 2Z6KC 1EWIA 5IYBG 3W1BA 3OTOL 3PUYA 2EIFA 2OCEA 2VQFQ 1S72A 3M7NA 1A63A 4JI8Q 5GAHC 4A3IH 1HR0Q 4TQUS 4OWTB 1A62A 3UDFA 2IHEA 3STBC 3GTKH 4A3FG 4A3DG 3ERSX 1Y1WG 1Y14B 2YTXA 3F8TA 2IT1A 3F2CA 1QUQA 2JJQA 5C44H 4DV3L 3J80i 3VDYA 5BR8Q 1C7YA 1TWFH 3SGIA 5C4JH 3BZCA 2E5LL 2ES2A 5C0XG 4DR1Q 1S40A 4LW1A 1O7IA 2NVQH 2UUAL 3CC4A 3D0FA 4A4IA 3KDFA 5IWAQ 1VQ8A 3PO3G 1N32L 2R93H 4WJ4A 1FVIA 1CKOA 3OYYA 5LMUL 2JE6I 1RIPA 1L1OC 1AE3A 1WJJA 2PQAA 4DR3L 4YY3L 3RNUA 2JA5H 1M1KC 4LF6L 2F4VL 3KLWA 4JI6Q 3I4NH 4L5RC 4DV2L 4GNXA 1VQGA 3PO2H 1BBWA 1N8RC 2IX1A 4LFBQ 4DR6Q 4B3TL 3PUZA 4R4QA 2HHHQ 4IPHA 1PH5A 3L7ZC 1L1OB 5HY6A 2ZJRA 1OXVA 3RLNA 3KJOA 3UE1A 1W2BA 1VQ9A 4OWWB 4UY8C 2UU9L 2VQEL 2R92G 4IOCA 1HZAA 1EYGA 2ID0A 4GOPA 3HOYH 1JJ2A 4YWLA 2NVTH 4X66Q 4JC0A 3TEHB 4GOPC 4DV7L 3J81i 2PNHA 4POGA 3CCUA 5FJ8H 1X6OA 5C44G 1K8AC 4EQ5A 2ZTCA 4IJHA 2K14A 4A3BH 1PVOA 4LFCL 2YTYA 1SLJA 3M4PA 1I5FA 1Z47A 3Q8DA 3CC7A 4BY7G 1LTLA 5E7NA 2EXDA 1HR0W 2ASBA 2ATWA 4OONA 4DV5Q 3KYHC 1I94L 4GKKL 4QY7A 3PGZA 1SE8A 4UPAA 3PIPA 1BBUA 5J3BA 4EX5A 3B6YA 4LF9L 4UP8A 5IE8A 4OO1I 2JK8A 1M90C 3S14H 1KIXA 1JT8A 1HH2P 4H02A 4LUZA 4APVA 1XMOQ 1N9WA 3I4NG 4NXNL 4DKAC 2Q2HA 4L5QA 1OTCA 4DK6C 3G48A 1IBLL 4DAMA 3F1ZA 4DV4Q 1XNQL 3L0OA 3S15H 5IY0A 4BXXH 5AJ3L 4IPGA 1J5EQ 1YI2A 4LFAL 1WFQA 3NENA 4KHZA 4DNIA 4A3CH 5M5WH 1QZHA 1HNXL 3J81c 2F52A 5GADC 3T1HQ 1VQKA 2UXDL 1UE1A 4YWMA 1XTDA 4KHPQ 3U4VA 4DUZQ 3E9IA 5M3FH 2NZOA 4YCUA 1K3RA 3HOXH 4OO1G 1IZ6A 1VQJA 1SR3A 3RZOH 3HOUH 3CCJA 4JI7Q 4K0KQ 2UXBQ 4DV6Q 5C4XH 1VQOA 5FJ8G 4LF5L 3S17H 3CCSA 4DPGA 4XTCS 2RHQB 2VL6A 4JI1L 2B3GA 5EAYA 3GTGH 1ASYA 1SROA 1VCIA 1IYJB 2B63H 2D62A 1V43A 4HJAA 2LXJA 3FP9A 4PZ7A 4DR5L 3TS0A 4ME3A 1XMQL 3I2ZA 1XPUA 2VZAA 3NBHB 1J6QA 2AHOB 2QEXA 3HOZH 3GO5A 1FJGQ 2E8GA 1KRTA 1CSQA 2NVYH 3CCMA 1MIUA 3CMEA 3JAMc 4OX9L 3PIOA 4DR7L 3KFUA 4X62L 3GD7A 4A3EG 3M4OH 1EIYB 1HNWQ 4AYBE 2VQFL 5K36G 3UE0A 1XPOA 1KC8C 1PHJA 3KF6A 1X55A 4JI8L 3AEVA 1HR0L 4BXXG 1VQ5A 1X9NA 4B3SL 3PCOB 3S1QH 1VQ7A 4IFDI 2LSSA 5H1SE 4A3CG 4AIMA 2MNAA 2IX0A 1VQFA 2D0OA 4C3IH 5C0XI 2R6GA 2I5HA 1PFSA 5M3FG 2VY3A 4PMWA 1VQNA 3HOXG 2NVXH 3I4MH 4DR1L 4R4TA 2CFMA 3CW2C 3JC66 3HOUG 1EUJA 4OXPA 2N3SA 1K9MC 3J81j 3CC2A 2K50A 4O2DA 1H95A 2MO1A 2JA6H 4A3LH 1B7YB 1MJCA 2Q2UA 1E1TA 3H3VH 4UP7A 5IYDH 2Z0SA 1HNZQ 1BKBA 4GN4B 3EIVA 5M5YH 1Y1VH 3ZJYC 4DV1Q 4JI4Q 1XNRQ 4JCVE 1QVFA 2B63G 4IFDG 3EN2A 4JI6L 1A8VA 3IRBA 4LFBL 5M3MH 4LUVA 3CXCA 4J15A 3OW2A 2K52A 2JA7H 5C4XG 2HHHL 2WP8J 4JI5L 4LF8Q 4L5SA 1YHBA 1TWAH 2H5XA 1Q82C 3AYHB 1Q81C 5JEAJ 3W1GA 1PH1A 1HZBA 1Q46A 4JBJA 1PA6A 1PH3A 1P8LA 1TWHH 4BY1H 2C35B 1VQAA 1YJNA 3MXNB 3TRZA 4X66L 2ZJPA 2QA4A 1CUKA 2ZM6Q 2DGYA 3A0JA 1VQPA 4IO9A 1CKNB 1IXRA 4GNXC 2MO0A 4JI2Q 2I0QA 1K83H 1XJVA 1PH7A 1UWVA 1E22A 1EQRA 5C3EH 4YWKA 4X65Q 2KENA 2N78A 3K7AH 2CCZA 3I4MG 4Y52H 3J80c 1NJIC 4RG1A 4DV5L 2OQKA 1GVPA 4FDBA 3DM3A 3A5UA 1D8LA 3BU2A 4A3IG 2NZHA 4DUYQ 3M3YH 4B3MQ 4A3LG 5DLQE 4GLAC 3CD6A 3RLFA 3FHWA 4B3RL 2A19A 4IFDJ 3K8AA 1N34Q 5GAGC 1XPRA 1VQMA 1GKHA 1XMOL 1GM5A 2E5LQ 2A1AA 4AYBG 3M85A 2E2IH 5C0XJ 4LF4Q 4YCVA 1PH6A 1LYLA 2VS1A 5M3MG 2KHIA 4DV4L 2PI2A 4GOPB 1I6HH 2K4KA 2UUCQ 1WYDA 2R7DA 3K0XA 2KCMA 2R93G 3A74A 3T1HL 2YV5A 1IL2A 4YY3Q 3T1YQ 1YJWA 4DAYB 1IBMQ 1VQLA 4DUZL 3CPFA 2YYZA 4YCWA 1QVGA 1U0LA 2JA5G 2KHJA 1UEBA 4NXMQ 3PO2G 3FKIH 4JI7L 2I5LX 1OXUA 4K0KL 2XGTA 5JJIA 4P71A 5GAEC 2UXBL 4DV6L 2IY5B 2JA9A 3S2HH 3I56A 4GS3A 2JQOA 2FXQA 3I7FA 1TWCH 4JYAQ 1E3PA 2VQEQ 1YNXA 2ZJQA 2HT1A 4R4OA 2HQLA 2JEAI 1YZ6A 4DV0Q 1VQ6A 4QQBX 4A3MH 2E2HH 2CWPA 2B29A 1P16A 1WCMH 4WJ3M 3HOYG 4KLKA 2VW9A 1K0RA 5IYCH 4DR2L 3S1RH 4DR4L 3MEFA 1VS0A 3STBD 4A93H 2R7FA 3HOVH 2R7ZH 1FJGL 4C3JH 3H0GH 5FLMH 1AE2A 2K5VA 3F2DA 4HIKA 1EQQA 4GN3B 3S1MH 1MKHA 4JOIA 1PH2A 2A8VA 1I50H 5FLXc 4YHHL 4A3BG 1HNWL 5HGQA 1NTGA 4X64Q 4GKKQ 1YITA 3KOJA 1GO3E 2RHSB 1KRSA 5JJKA 1WI5A 2XTIA 4TVAB 3PUXA 3H15A 3BJUA 3L2PA 1IBKQ 3K81C 1N33Q 1OXXK 1Q7YC 3GDEA 3ICEA 2WAQE 1YIJA 3U4ZA 1AH9A 3E0EA 2UUBQ 2ALYB 3GTQH 3ER0A 4LF7Q 4JBMA 3GTLH 3M9BA 4KI0A 3S24A
chains in the Genus database with same CATH superfamily
1H9MA 4A3JB 1A0IA 2BH8A 2PQEA 4JV5Q 1STNA 4BA1I 2PO4A 1SYCA 4HMJA 3CKIB 1OXTA 4OWXB 2R3ZA 4OELB 5BR8L 4A3MG 1T5EA 2N49A 4CDCC 2VNUD 2IHFA 1LT3D 1JE5A 1A3UA 5JAVA 2QKIC 1STGA 1SFOB 1CZWA 1KDAA 1X3EA 1B4OA 1W3SA 5C4XG 4GKJQ 1NBWA 2MQHA 1STEA 1JB3A 1UE7A 2F0OA 4V0BA 3AMUA 3CP0A 2B2YC 3KLSX 1CQVA 3PV0A 2LXKA 5FOBB 4A76A 1B50A 1EY6A 5C6AA 2HIVA 3FVQA 4N8FA 1SMYD 2DUDA 4C3HH 1MBYA 1PLFA 4G57A 1YEZA 4A3GB 3TREA 1HZ9A 2B2TC 3HKZE 3BZKA 4DUYL 3U50C 4B3ML 3MXPA 4BA2I 4A3JG 3VYRA 2PZTA 4C2MH 4XT1B 4ZQ3A 2PQAB 4HMIA 2OEOA 3JAME 2AQ1B 1VQCA 4H0LC 1O7ZA 2UUCL 1OXSC 3MTSA 5IP7G 3H94A 1G291 1CZGA 2A68D 1IBML 5COYA 2KCTA 3J7AV 1X54A 1FL0A 1Y1VG 3TP5A 2PZUA 3K0YA 1B53A 1MHWC 4NXML 3T4AC 2ZXOA 3OIQA 4QGUA 2A6EC 3QB3A 4GLVB 4JI5Q 4AH6A 1N32Q 1PYWD 3MXGA 1PMRA 4ZAIA 2G9DA 3NTKA 1HRJA 1SE2A 3PF4A 3CQZB 3NXWA 5DM73 4BBRH 3MEHA 4MNOA 1QCBD 4KKTA 4F7XA 4XQNA 3RLOA 4R4CA 1B70B 4UP9A 4A3GG 1K8OA 3BVGA 3J80L 3Q6SA 2KA7A 1KNAA 1Q1BA 2NN6I 1X3GA 4KKUA 3G6JB 2JEBI 1LT5D 4K2KA 1TWGH 3S2DH 1HJPA 1B1ZA 2JA8H 3NELA 3PF5A 3CCLA 3SE0A 2K5WA 2V1CC 2HIXA 4DXFA 2EQSA 1DOMA 2F3IA 5GROA 5C3XA 1A3TA 4J1MA 4Y7NH 4JI3L 1BCPF 1KHIA 2K5HA 2E2JB 5AFWA 2DJGC 1KQSA 1SRUA 3K57A 4DFAA 2EY5A 1BXTA 2K04A 4QL5A 1QVCA 4NXNQ 1XYIA 1IBLQ 4HEDA 1NMFA 2O2LD 3K7UC 2MUYA 4HJ7A 4QIWB 5CV7A 4RCNA 3SK4A 2AWOA 1C8CA 2EVBA 4NKLA 4DV1L 4DGZA 1EY5A 5JOBA 3J7AF 1D5ZC 3FPUB 4L5TA 1SNPA 3PO3H 1J9OA 4JBKA 3LX0A 5JEAG 2OWOA 1R9TH 2F0WA 1SYFA 4DR5Q 1SJED 3NTIA 1TT2A 1BVSA 5ELBA 1HA5A 1EWCA 2FINB 2PYKA 1UE5A 1T5XD 1I3QH 1LUZA 4G4KA 1QOHA 1TWFB 1EY8A 3EJIA 3OTOL 2EIFA 1JOQA 2KQ3A 3MFGA 1A62A 3GTKH 2IHEA 1ENFA 4MN3A 3ERSX 3F8TA 2IT1A 5C44H 3C2PA 4DV3L 5C3WA 1STBA 2TMPA 4U68A 2L4NA 3VR4A 2E5LL 2HDLA 1S40A 1STHA 3PO2B 4BWGB 2UUAL 3GQBA 3CC4A 2C9OA 1VDZA 3M4YA 1BCPD 1FVIA 3NPPA 5CV4A 3SK8A 3D6WA 1RIPA 3H09A 1D5XC 1SYGA 1L1OC 2PQAA 1EY7A 4LF6L 5FO9B 1M1KC 2F4VL 3I4NH 1K3BC 3DXJC 1A2TA 1RD9D 3PUZA 2NYZD 2HHHQ 4KHVA 3L7ZC 1L1OB 1EEFD 4Q0FA 4TKOB 5HY6A 3V96A 1KABA 5JVG3 3KJOA 3MXUA 1W2BA 1VQ9A 5CC4A 4C3HG 1HZAA 5J1ZA 2ID0A 4GOPA 1EQVA 4KV6A 5ELCA 2NVTH 4X66Q 4DV7L 3K5OA 2F0SA 2HDMA 5FJ8H 1X6OA 1K8AC 4EQ5A 1SNCA 4IJHA 4PMCA 4LFCL 3MAQA 2YTYA 1YNND 1Z47A 3CC7A 2ATWA 3I90A 1PTOH 3OMGA 2FMMA 3PGZA 2K5QA 4EX5A 4Y7NB 3KBXA 3T51B 5A35A 3HRZC 5TSSA 4G7HC 1KIXA 3S14H 3A55A 1AFPA 1XMOQ 1SMYC 2A6HD 2EOTA 4IUTA 5LHY1 1XNQL 3FRPB 4CJ1B 2HD3A 1WVLA 4IPGA 1J5EQ 1YI2A 4LFAL 4DNIA 1QZHA 1QB5D 1I4HA 1XTDA 1FNVA 3U4VA 2I46A 3TZDA 5M3FH 1B44D 4LMQD 3CU7A 5IGCA 2QCPX 2B63B 3HOUH 1IKMA 1O80A 2BDOA 1EYDA 2RHQB 2VL6A 4JI1L 3KLRA 1VCIA 3P1HA 2LXJA 3FP9A 4PZ7A 3TP7A 1XMQL 2IPKD 2VZAA 1CA6A 1DZ1A 2QEXA 5M9OA 1SEBD 3HOZH 1X3QA 2SNMA 4OX9L 4DR7L 4UAIA 4X62L 5DEHA 3BYTB 3KBGA 3R3OA 2NVXB 3K5NA 3AEVA 3S1QH 4CDFC 1VQ7A 3GV3A 5KYIA 4FYDA 4A3CG 1S5CD 5C0XI 2NBFA 5CR3A 2Q8TA 5CYUA 4DAVA 4DR1L 2ENBA 2WIIB 5JJZA 5M3MB 1B7YB 1E1TA 4OHJA 1LTRD 2JA7B 1BUVT 4UHVA 5KNDA 2HCCA 4GN4B 5M5YH 3EIVA 1DCZA 2B63G 4H13C 2E2DC 3A8IE 2DNEA 4LFBL 1AEXA 4YIJA 2EYJA 4FF4A 2WP8J 4JI5L 4LF8Q 1SNQA 3AYHB 1I4XA 1PH1A 3W1GA 1HZBA 5IOCA 1TWHH 1WTRA 2C35B 1VQAA 3MXNB 1CUKA 4KKSA 2EPBA 4IO9A 1CKNB 3DWPA 1NCVA 1UWVA 1E22A 3NWTA 3NQIA 4F88A 1NJIC 5I2YA 2OQKA 3V2TA 4FDBA 1RDPD 3A5UA 2NZHA 4DUYQ 4B3MQ 1NR4A 1I6HB 4MIUA 1G8ZD 2HQEA 1GKHA 4RGNA 2A1AA 5IT9E 2VS1A 1EYAA 5M3MG 5DNFA 4XYQA 2K4KA 4ME5A 5FK9C 2RBMA 1M4VA 2UUCQ 1E0BA 4LK1C 2KCMA 5BN4A 2F0EA 1IBMQ 3C3LA 1SAPA 2Z9HA 1QVGA 3E3XA 1UEBA 4NXMQ 2E76C 3FKIH 2ZXPA 1OXUA 1VF5C 4K0KL 5IGFA 1GUSA 2JA9A 4C1NI 3HOVB 1I4GA 1ML0D 2EYHA 2VQEQ 1YNXA 1ICWA 1YZ6A 1VQ6A 2RA4A 4A3MH 2A74C 2B29A 5T1GA 1H9SB 1K0RA 1D1IA 4K8IA 1A6XA 1LLRD 3GV6A 1M8AA 1FJGL 4C3JH 1TS5A 3T56B 1BCPC 1EQQA 3HOZB 3OMCA 4JOIA 1K28A 1I50H 1TY2A 1NTGA 1YITA 3QOLA 1GO3E 3NWSA 2RHSB 1RF2D 4K5VA 4K5XA 3R8BA 1WTHA 3K81C 1BCPB 2BCOA 1Q7YC 1BR9A 3GDEA 3BVZA 1YIJA 4FF1A 3GTLH 3M9BA 4KI0A 2L11A 3HP3A 3S24A 5JJLA 3G4SA 3KF8B 4JI3Q 4JG2A 1Y1WH 5KGUA 1J8IA 2ZTEA 3QR8A 3W3AA 5I9OA 1HNZL 2WAQB 1FGBD 4P73A 4A3JH 1XNRL 3Q24A 1IHZA 4O0AA 4N9TA 5EPKA 5IYCG 3VR3A 1DOLA 3DHQA 5T1IA 1XXGA 1Y8NB 2K28A 3HFZB 3A56A 1V9PA 3HOVG 4HTHA 1SMXA 4XIGS 5IP7H 1IW7C 2O4XA 1HFNA 4XYOA 3RD4A 5GQOA 2J4XA 1ESFA 2JP1A 4QJFA 1NAPA 1SFOH 2ZM6L 2AMCB 1DGSA 4ALPA 2X69A 2VUMB 1JB7A 2RF4A 4JI2L 3HOZG 2A5HA 1Z7TA 3I4OA 3CCQA 3TDQA 3BVMA 2L1BA 2I5MX 2R92H 1AP0A 3ND9A 2ZTDA 4R4IA 1XX8A 2K32A 1TS3A 2SDFA 5EQ0A 1GJXA 4IPCA 1N34L 2EJFC 3MXNA 1G51A 3O13A 1CT1D 4A3GH 1E24A 2J7ZA 2NTTA 3P7JA 3D6CA 4LF4L 1CKNA 3OTOQ 3RZDB 4ZCKA 1VQIA 4FXGC 1YHQA 3ULLA 3FEWX 2WAQG 4PZ8A 4DV3Q 4QCLA 1RTOA 5M5XB 2OQ0A 2Y0SE 1G6PA 2P5ZX 3M4QA 3DLLA 1TIID 3EROA 5CV9A 2UUAQ 4BBSB 4IUQA 5ELOA 2YU9B 5C5LA 1J5EL 1NMGA 4LF6Q 1X3FA 1JCKB 2F4VQ 4OO1H 1B9MA 2VUMG 1S5BD 1PXUA 5KIXA 1WTQA 4KMUC 1RKNA 1VQEA 1HPCA 4WORA 1SXTA 4FXKC 2WB1B 2PMZB 3U58A 2QGQA 2B2UC 1KNEA 3CQZH 4CJ2C 1QG7A 2F0TA 2AUJD 4HCSA 2D0PA 4PG3A 5CBEE 2EJGC 2M00A 3D3RA 2EYPA 4QB4A 1IBKL 4DV7Q 3HOWB 4XXEA 4IUPA 3D4RA 4B3RQ 3P75A 2UUBL 4FVMA 1VQDA 1A15A 4F8MA 4LFCQ 3L3OC 4LWCA 3RN2A 4X3TA 5JEAH 1YBYA 4X3UA 2G5DA 1DONA 1HA6A 5EKIA 1GHJA 2EXZA 1K73C 1D6EC 1S3OA 4LNQA 3ONAB 2V4DA 3ERQA 4BBSG 2RCNA 2E2JH 4RMFA 1XNQQ 3FKIG 1LM0A 4LFAQ 1TXYA 3J81L 3KF8A 3AQQA 4RHRA 4IFDH 4L63B 1N36L 2K6AA 3A8KE 2WB1G 2KJXA 4HSVA 3A5ZB 1IL8A 2K75A 3WWVA 3SHLA 4C3JG 2L5TA 1F2ZA 2JXMB 2TSSA 4HIMA 4LF8L 2OTLA 4JI1Q 3H3VC 5JPMC 2QDBA 3CPWA 2A69D 3HOWG 1GD7A 2R92B 1XMQQ 1FD7D 5F2DA 3AFQA 3LWUA 5CMDA 1FYCA 2F0QA 1EZ6A 3K5LA 2CVRA 4R1JA 1PH9A 4OX9Q 4HJ9A 4DR7Q 4X62Q 5A2QE 2AWNA 3CAMA 2Z6KC 4I65A 1S72A 2Z6BA 3PUYA 5C4JB 3D4DA 3CRLC 4TQUS 3FMCA 4OWTB 1F77A 1Y1WG 2YTXA 4K5WA 3J80i 1C7YA 2H4OA 1TWFH 2B2VC 3BZCA 2ES2A 5C0XG 4DR1Q 2ICIA 5JPNC 5BN3A 5IWAQ 1VQ8A 1MI2A 5EBDA 5ISRA 1LTID 1AE3A 3BDCA 4RCOA 3KLWA 3E5SA 3PO2H 2RCFA 1VQGA 1PZID 2E75C 3VR6A 4DR6Q 4LFBQ 4B3TL 2LMCB 1XTCD 5HURA 3FDTA 4DNRB 4UY8C 2UU9L 1DD2A 2VQEL 1F2YA 1TS4A 2AQ2B 4IOCA 1EYGA 2R92G 3HOYH 4B08A 1JJ2A 1G91A 1EY0A 3PIO3 3KK7A 3NP8A 4UDUC 5K5PA 1LV9A 4GOPC 1D5MC 4DAYA 1O78A 1S5FD 1TQOA 2HUGA 3NBIA 2F0IA 2L55A 1I5FA 1LTLA 2PZWA 3KYHC 1WTOA 1I94L 4UPAA 5FKAC 1GOZA 4R8IA 2F0UA 1X3PA 4RGMA 5M5WB 2XVSA 5KRUA 1U4PA 1N9WA 3IKJA 4FXDA 2Q2HA 4QMGA 1OTCA 3R2IA 2EE1A 3IL8A 1CA5A 5AJ3L 2IL8A 1V1PA 1WFQA 2PW5A 2D5DA 4A3CH 1HNXL 3J81c 2F52A 3ITPA 3S17B 2UXDL 2C5CA 1O7YA 3E9IA 4YCUA 4RGTA 4OO1G 1PZJD 1U9RA 3CCJA 4IQZA 4K0KQ 5LL6X 2K1BA 2VB3X 1JOOA 2B3GA 1ASYA 3S9WA 3MC0B 2B63H 4HJAA 4RFBA 1TU2B 1FJGQ 2E8GA 2IJ0A 1CSQA 3CCMA 1JICA 5C4ZA 3PIOA 2K7VA 4FF2A 4C3IB 1R4PB 1EIYB 4AYBE 3L9AX 1PHJA 4JI8L 3I4MB 1F2LA 1X9NA 3PCOB 1JC7A 2EY1A 3BZDB 1R4QB 3NK9A 4AIMA 2MNAA 2DJFC 1CI3M 1HHVA 1FNUA 2VY3A 2B2WC 4K8JA 2NVXH 2LFNA 2CFMA 1K9MC 3J81j 3CC2A 1IYVA 2MO1A 2JA6H 2Q2UA 3LNNA 3A8JE 4JVZA 5IYDH 4R9WA 2Z0SA 1HNZQ 4JI4Q 3ZJYC 1XNRQ 2B2YA 4IFDG 4WJWA 3EN2A 4JI6L 2K05A 1HUMA 5M3MH 4LUVA 1QNUA 3OW2A 1CHPD 1SBBB 2JA7H 2RVLA 4RA8A 3HS0C 2B2TA 4HAEA 3DEPA 1K83B 1PH3A 2BOSA 4BY1H 2ZT9C 3F2UA 3HGBA 1YJNA 3TRZA 1WD0A 4ZYSA 2ZM6Q 3SK6A 3HOYB 4GNXC 1SDFA 2MO0A 4JI2Q 3M3YB 2I0QA 2D2CC 2WKDA 4KJNA 4HN7A 1EQRA 3WOEA 4YWKA 2KENA 3I4MG 3J80c 4RG1A 2E2IB 1EL0A 3DM3A 1D8LA 1JR0D 3BU2A 2F0NA 5E4XA 3RLFA 4B3RL 3K8AA 1BQQT 1N34Q 2PCFB 1XPRA 1HQMC 1GM5A 1STAA 4HSPA 1CFMA 4LF4Q 1CQFA 2A69C 2KHIA 4KTAA 4DV4L 1I6HH 2CW0C 3IFDA 2XRSD 1WYDA 3N6RA 3K0XA 4P2CB 2YV5A 2LS01 4DUZL 1IW7D 1XWEA 4K14A 2X6GA 2Y0SB 3PO2G 1Q8IA 1WCMB 4Z9CB 2XGTA 4P71A 2UXBL 4DV6L 3SVMA 1PFNA 3R2TA 3I56A 4GS3A 3ND8A 2QILA 1D1KA 2MGSA 1G2SA 2DNCA 2HQLA 4QQBX 1SNMA 3DEOA 3HOYG 2VW9A 1MD2D 5IYCH 3STBD 3HOVH 2B8FA 1AE2A 3F2DA 4HIKA 4LJZC 1OO9B 5I6WA 2K5DA 5EPLA 4GKKQ 1BOSA 4DF7A 1KRSA 1WI5A 2L12A 2XTIA 4TVAB 3H15A 1IBKQ 1OXXK 3MVVA 3MZ5A 1HTPA 3E0EA 2UUBQ 3GTMB 5DAUA 2F03A 2SNSA 3OPOA 1TS2A 2PNRC 4RHSA 3GTPB 5JVH3 1Q86C 4A3DH 4RAUC 1Q90A 3EBEA 4P72A 4POFA 2EY2A 3S16B 2JA6B 1RL2A 2EYMA 1B3QA 1U5KA 4P75A 4A3KB 3DWQA 1WD1A 1K8GA 3CCRA 1KAWA 1D7QA 1CHQD 2KOLA 4NMZA 1E1OA 4FF3A 1EU4A 2LKVA 5I9PA 4LF5Q 5FLMG 1EIFA 4HJ5A 1NR2A 5IWAL 4IJLA 3OWFA 1EFWA 1EOVA 1N36Q 4KD3A 2AQ3B 3Q23A 4BY1B 2OTJA 1GUNA 1JJCB 1DYQA 4DR6L 3JAML 3BG3A 3MFYA 1Q8KA 3D4WA 2M9VA 5IODA 4BY7B 1UEAB 4F87A 3AU7A 3C1FA 3F2BA 1E2ZA 1V1QA 2VUMH 1DXMA 3H3VI 3OWEB 1MSHA 4KJOA 3CMAA 3KDFB 4GN5A 2JYOA 3D31A 1VQBA 5L37A 1PZKD 3I55A 1L1OA 1NE3A 4DK3C 2JA6G 3HKZB 1JORA 5ELDA 3T1YL 4A3KG 5IYDG 3NTHA 2F0JA 4HR7B 3RZDH 1HZCA 1SYDA 4NB3A 2L15A 3QOJA 1II3A 2EJMA 3U9SA 1JJGA 3BYYB 2AKWB 1QJOA 3G7LA 1PTOC 3VR2A 1Q12A 4OIJA 1L2FA 3KLSA 2JA7G 1HTLD 3I70A 4ODGA 5M5XH 1LT4D 4JYAL 1T9HA 2QW7A 1KL9A 4BY1G 3I73A 3VYUA 3G6EA 4BBSH 2YU9H 4B3TQ 4KK7A 1NUCA 4QUFA 3PSIA 2XWBB 2ICEC 2UU9Q 1H9KA 3LGJA 1KLUD 5IP9G 4FP5D 4LUOA 5IGDA 1NY4A 3VA7A 4HIDA 1PYSB 3HZXA 5LMNW 1ICFB 4A3EH 3GTOB 3VA5A 4EGVA 3K58A 1I94Q 4QIWE 3HOWH 3HKZG 1KXLA 3J80E 3HG9A 2NN6G 1SN8A 2D9UA 2WFWA 4A3DB 3KJPA 4A3FB 1TKWB 1L0WA 4ULLA 4AQYL 2KBNA 3GTJB 1FGUA 3J7ZC 3PUVA 2BE5D 3NE5B 3RR5A 1PH4A 4JI0L 3QJYA 4G7ZC 3VYSA 5AJ3Q 2UXCL 5D14A 2N8NA 1QZGA 1HNXQ 2UXDQ 2IX3A 1HQRD 2MPMA 3DMUA 3TP6A 4JI4L 4P74A 4IUVA 5HGTA 5C0XH 1W6JA 1GXDC 1GUTA 4DK1A 1YHAA 3KF6B 3S1NB 3W5OA 4YHHQ 3V05A 4J6HA 4BS9A 4I7ZC 2RKSA 1S5ED 1SE3A 4A3IB 1LACA 1A3VA 2WV6D 1G2TA 2K5NA 4C1NK 3TBIB 5LMNL 1EWIA 2OCEA 1A63A 4JI8Q 5GAHC 4EQPA 4G7OC 3BDLA 5EKLA 3UDFA 3EFXD 3STBC 4A3FG 4A3DG 2NVQB 1Y14B 3F2CA 3H6MA 1U4RA 2JJQA 1A2UA 2R93B 1Y69U 5C4JH 1E2WA 2JA5B 1EU3A 4LW1A 4MHEA 2LY7A 3D0FA 2XNAC 3KDFA 4WJ4A 1CKOA 5LMUL 2JE6I 5KNCA 2F3VA 4DR3L 3BDOA 4OGQC 1BO0A 2CQAA 4CJ0B 4JI6Q 4DV2L 4L5RC 1DJRD 1BBWA 2IW3A 1Q3LA 3N52A 1W6KA 4IPHA 1PH5A 4N8X1 1EIGA 1OXVA 5KYLA 2H1EA 2B39A 2XN9C 1WTPA 4KN4C 2MHVA 3NQTA 2O5JC 2K33A 4YWLA 4V190 5IGGA 3J81i 3CCUA 4PNYA 4A3BH 1HUNA 3PQIA 2EDGA 1SLJA 5J22A 1HR0W 2ASBA 4OONA 4A3EB 2Z4IA 4GKKL 1H9JA 1SE8A 1F9RA 3S15B 1SJHD 4LF9L 4CBVA 1M90C 1MSGA 1EFID 1HH2P 4LUZA 4APVA 1H9SA 5LL6S 2X6LA 4I7AA 4DAMA 3RUZA 4ZKBB 3HOXB 3F1ZA 4DV4Q 3RZOB 4EQOA 3NENA 1MGSA 4GZYC 3EVQA 5M5WH 5GADC 1VQKA 1FR3A 3R93A 1JE4A 1UE1A 2I07B 4KHPQ 4DUZQ 3BS1A 3NHHA 1K3RA 1IZ6A 4DXGA 4NDXA 2UXBQ 4DV6Q 4LF5L 3S17H 3CCSA 4DPGA 1ZKOA 1AN8A 1HFGA 2NVYB 5EAYA 4KY7A 1IYJB 1U4LA 1V43A 4KY6A 4M1UB 1XPUA 1RHPA 1IKLA 2AHOB 4DA2A 1SNDA 2KEEA 3GO5A 5FO7B 1MIUA 3HEJA 3KFUA 4ID6A 5EKKA 5FLXL 4A3EG 1F9QA 5D3IB 2VQFL 2OF1A 3QWNA 3UE0A 1KC8C 5K36G 1YNJC 3KF6A 1X55A 2RQXA 1HR0L 4BXXG 2CW0D 2LSSA 2IX0A 5DM63 2D0OA 4C3IH 2R6GA 2I5HA 1PFSA 1X32A 3URYA 3HOXG 1Y1VB 3I4MH 4L8JA 3JC66 4B9XA 4DK0A 1KDCA 1JWMD 1H95A 2F0MA 2KHSA 3T53B 1BDOA 1BBXC 1ONLA 4ZKCB 1BKBA 1TWAB 1O7LA 2JN4A 4JCVE 1QVFA 1NSNS 2NZ1D 1A8VA 3IRBA 1HCZA 2PW7A 3CXCA 1LTAD 2KVMA 4J8QA 5IIFA 2B8GA 5G3LF 4NP5A 4L5SA 2H5XA 1Q82C 2Q8RE 4FNFA 5JEAJ 4C56C 1Q46A 1PA6A 1BF4A 4CGYB 3K7AB 2BE5C 3UI2A 5IT9L 4IUNA 1IXRA 1EY9A 2F0DA 4KN7C 4X3SA 1ENAA 1K83H 1XJVA 5CGKA 4XT3B 2FMCA 2WINB 5C3EH 2FHTA 4A3BB 2F0HA 1PTOF 4DV5L 1GVPA 2OXPA 3IAYA 3M3YH 1BNZA 5E3FA 4A3LG 2L0CA 1STYA 1K8MA 3CD6A 3FHWA 1CK1A 4IFDJ 1DOKA 1S4ZA 3CHBD 3VYTA 2E2IH 4YCVA 4X3KA 1PH6A 1LYLA 3T13A 5C4HA 2PI2A 4GOPB 1K0SA 1B2TA 1PRTF 2WKCA 3A74A 3T1HL 4YY3Q 3T1YQ 1L0XB 3EQLC 3CPFA 1TWCB 2KCNA 2YYZA 4YCWA 1U0LA 5E1FA 2PPBC 2HCIA 4RKLA 3AB9A 3CRKC 2E2HB 4JI7L 2I5LX 2B2UA 2EYFA 5KEEA 3S1RB 5GAEC 3Q0AA 2IY5B 4A93B 3S2HH 2R7ZB 2FXQA 2N88A 3H0GB 4RH6A 4JYAQ 1E3PA 4DN4M 1RODA 2HT1A 4R4OA 3S1MB 4WJ3M 2RSOA 1P16A 1WCMH 3DUZA 1VS0A 4QUCA 2FFKB 3U9OA 1D2BA 5D65A 5FLMH 3GP7A 4GN3B 4R8NA 4A3BG 2MJ8A 5G3LD 3W2DA 5FLXc 4YHHL 1PH2A 3GTQB 5HGQA 1HNWL 4CDDC 2NB0A 3A7LA 1LTSD 1PFMA 3PUXA 1AH9A 3ICEA 2WAQE 3U4ZA 5I2XA 3ER0A 1LO5D 2EYOA 3QG1A 1HXYD 4JBMA 4UP8A 3HKSA 3OOCA 5IYBH 2YTVA 1PTOD 3GTMH 1Q1EA 5KNBA 3TQYA 4AQYQ 1V8QA 3G71A 3GTPH 1LTGD 3I3CA 3QIAA 4PMBA 4IPDA 4JI0Q 4A93G 3SDZA 4O42A 2KEDA 2R7ZG 3SK5A 1Z9FA 3H0GG 2NUCA 2UXCQ 3FPPA 3S16H 5ELNA 3CCVA 2CWAA 1CKMA 4A3KH 1VQ4A 4PZ6A 5ELFA 1C0AA 1PRTD 2BH2A 4C3HB 3A54A 2QDLA 2R61A 4MZ9A 3J7A5 1EEID 4EVOA 2Z4HA 1G6ZA 1QWYA 1B9NA 1ASZA 1LTTD 4K6DA 5IT9c 1EYCA 1ET6A 3TZUA 1PH8A 4IURA 4ZK9B 2Z6KA 3E9HA 3RN5A 4X65L 1S5DD 2Q2IA 4U673 2F1MA 1QUQB 3UDGA 4MTNA 5C3EB 4C2MB 4B3SQ 4HJ8A 1WOCA 2XRQD 2CKZB 2B2VA 3SXHA 3I4LA 1MJEA 4C3IG 4BY7H 2KCCA 5EPJA 1WTVA 1EZ8A 5IP9H 4X6AH 1EOTA 5LMNQ 2K03A 3J7YW 1JWUD 1VMCA 3A7AB 4ILWA 4GNXB 3OIPA 1WTWA 1B8AA 4A75A 1SSOA 2CHBD 2RSNA 4BBRB 3TN2A 2NWGA 1C9OA 2PI2E 2WB1E 1PV4A 1WTXA 2PMZE 1C4QA 4DNTB 1F9SA 3UDIA 2KECA 2NN6H 5LMUQ 4DR3Q 3S2HB 4DV0L 4KHPL 4DV2Q 1LTBD 1Y8PB 3ULJA 3M7GA 2GVAA 4JBWA 1AW7A 1PYBA 1LT6D 1RCVD 1TWGB 4ZUJA 3TS2A 3ULPA 3S2DB 5CV5A 2JA8B 1Y8OB 5C3EG 4X64L 1ZYRD 2ZXRA 4CKBA 4CKEA 5E4WC 2BA0A 1F2MA 4XQJA 2Q2TA 1X56A 1U4MA 3OHXC 1N33L 3Q22A 1EWHA 1E7ZA 2CQOA 2GN5A 4IUUA 4LF7L 2Q8IB 1CTMA 3ZYYX 4NPSA 4JV5L 4JOIC 3JAMi 2F0PA 4LF9Q 2CH4W 4PV1C 2RDHA 4KY5A 4ZRZA 1VF7A 1SNOA 2RDGA 3GTOH 4BBRG 1F9PA 2F4IA 1JMCA 1X65A 1SYEA 3E0JA 2E74C 2L9HA 1YVCA 1ESRA 3TMEA 2A73B 1YJ9A 1I4QA 4ZUIA 4RKBA 4A3FH 1KD1C 2BA1A 1JOKA 4GKJL 4RWSC 2A68C 3PO3B 3GTJH 2Y0SG 4DR2Q 3X3MA 4DR4Q 1CSPA 3K59A 1WCMG 2IWHA 1R9TB 4K2LA 5I4DA 5A2QL 4HIOA 3K80C 1EY4A 1UE6A 4B9WA 1H9RA 3PUWA 3CF5A 1PDQA 2K01A 2JA8G 1C48A 2DN8A 3I8ZA 1I3QB 1V1OA 2MFIA 3UDXA 3CCEA 1GHKA 4IOAA 1RJTA 3AFPA 5I6YA 3J81E 3NEMA 4L6TB 3S1NH 2GVBA 2B2WA 2OT2A 4ABNA 3SR1A 3GTKB 3NSWA 3DWAA 3PIP3 5C44B 3P20A 4GLXA 1VQHA 2VXWA 2NTSA 2VQFQ 4E6IA 5IYBG 3W1BA 3M7NA 1CM9A 5EBCA 4A3IH 2Z1CA 1HR0Q 5FLXE 1QUQA 2KUMA 3E6ZX 3VDYA 1ENCA 5BR8Q 3SGIA 3TP8A 1ZEQX 4JW0A 3I4NB 1I4PA 1O7IA 2NVQH 4OEMB 4A4IA 3PO3G 1N32L 2R93H 3PMFA 4S3SA 3OYYA 1WJJA 1UAPA 3RNUA 4YY3L 3RMHA 2JA5H 2F0KA 4NW2A 4GNXA 4CDEC 1N8RC 2IX1A 3T16A 1JWSD 4MTKA 2NVTB 4R4QA 1TR5A 2ZJRA 3RLNA 4OWWB 3UE1A 3MWYW 1ILPA 1TVXA 4DU9A 5IGEA 1YNJD 2EY6A 5BN5A 1PTOB 2Z8LA 4JC0A 3TEHB 4PQXA 2PNHA 1RTNA 4POGA 3TSSA 5C44G 2ZTCA 4ZLTF 2K14A 1PVOA 1Z6HA 3S14B 3M4PA 4BY7G 3Q8DA 5E7NA 1PRTC 2EXDA 1KLGD 4DV5Q 1I6VC 4QY7A 4DAPA 2J0TD 3PIPA 1BBUA 5J3BA 3B6YA 5IE8A 3X3NA 2JK8A 4OO1I 1JT8A 1PRTB 4H02A 5CORA 2F0LA 2EYLA 1ILQA 4NXNL 4DKAC 3I4NG 4L5QA 5K36H 4DK6C 3G48A 4H7BA 2VB2X 5ELEA 5M3FB 1IBLL 3L0OA 3S15H 3HOUB 5IY0A 3I91A 4BXXH 5D3DA 4KHZA 2WACA 3D8GA 3T1HQ 4YWMA 4IALA 2NZOA 2SEBD 3HOXH 1UUPA 4XDXA 1VQJA 1SR3A 3RZOH 2AUKA 2QEJC 3LWEA 4JI7Q 5C4XH 1VQOA 2GA4B 5FJ8G 2XIWA 4JPBW 4XTCS 3GTGH 1SROA 2D62A 4DR5L 3TS0A 4ME3A 3I2ZA 3NBHB 1J6QA 3SEBA 4M8AA 1QILA 5CBAE 1KRTA 3S1QB 2NVYH 1VMPA 3CMEA 3JAMc 3C1EA 3OW7A 3GD7A 3M4OH 1HNWQ 4N9PA 1GUGA 1XPOA 2A6ED 1IYUA 1VQ5A 2QF7A 4B3SL 4JK1C 4IFDI 5H1SE 1ZXTA 3H91A 1VQFA 1PFBA 2RDFA 4TRDA 1YNNC 5M3FG 1VQNA 3I72A 4PMWA 5M5YB 2MP1A 1NNXA 3CW2C 1ZYRC 3EA6A 4R4TA 4WRDA 3HOUG 1L0YB 5CV8A 4AYBB 1EUJA 5FO8B 4OXPA 2N3SA 2K50A 3MHBA 4O2DA 3NUCA 4WFN3 3WDNA 4A3LH 1MJCA 1TY0A 3H3VH 4UP7A 4IZ8A 1B3AA 3DM1A 4DV1Q 1Y1VH 2A6HC 5C5MA 1ET9A 1TWHB 4HCEA 1AZQA 4J15A 2K52A 2HHHL 1KTKA 1YHBA 1TWAH 1Q81C 1GUWA 3MA2B 4FO2A 2F0VA 4JBJA 3C46A 1P8LA 4X66L 2ZJPA 2QA4A 2DY8A 2DGYA 3A0JA 1VQPA 1E2VA 4XQQA 2O5IC 1PH7A 4CHTB 4X65Q 3IFTA 2CCZA 2N78A 3K7AH 4Y52H 5CV6A 4RGOS 5IGBA 4A3IG 4QF4A 5DLQE 4GLAC 2A19A 4CKCA 5GAGC 1VQMA 1XMOL 2E5LQ 3OSOA 2F3WA 4AYBG 3M85A 5C0XJ 4K6LA 3K6OA 5EGTA 4OIKA 3FKIB 2CH4A 5J39A 4OL7A 1FNWA 2R7DA 2F0FA 2R93G 1UNSA 1IL2A 2JSOA 1AZPA 1LABA 2DY7A 4O1NA 4DAYB 1YJWA 3QO2A 1JQYD 2XSCA 1VQLA 2JA5G 2N55A 2KHJA 4A3MB 5JJIA 2XWJB 1I4RA 4IN3A 2JQOA 3I7FA 5NUCA 4C3JB 1TWCH 2EZVA 5C4XB 2ZJQA 2JEAI 1GUOA 4DV0Q 2M2LA 2BDNA 2E2HH 2CWPA 1I50B 1QNKA 2SOBA 4KLKA 4EQNA 4DR2L 3S1RH 3GTGB 4DR4L 3MEFA 2F0GA 4A93H 2R7FA 4LAAA 2R7ZH 1SE4A 2FJ2A 2G9HD 3H0GH 2K5VA 4H44C 1V1PB 3S1MH 1MKHA 2A8VA 1EIHA 4KD4A 5EJWA 4TSSA 3GTLB 1DM0B 4X64Q 4Q5VA 3KOJA 1EQTA 1KDBA 3KUPA 3WOFA 5JJKA 3K5MA 3M4OB 1KAAA 1SYBA 3BJUA 3L2PA 3VR5A 1N33Q 1Y1WB 2ALYB 3GTQH 4LF7Q 1QE6A 3NBHA
chains in the Genus database with same CATH topology
3HKSA 5IYBH 5JJLA 3G4SA 1A0IA 2BH8A 3KF8B 2YTVA 4JI3Q 1Q86C 4JV5Q 4JG2A 4A3DH 1Y1WH 3GTMH 4BA1I 3EBEA 2ZTEA 1Q1EA 4P72A 4POFA 1OXTA 1HNZL 4OWXB 1RL2A 3TQYA 4P73A 4A3JH 1XNRL 5BR8L 4AQYQ 1U5KA 4P75A 3G71A 4A3MG 4O0AA 3GTPH 2N49A 1K8GA 3CCRA 2VNUD 5IYCG 1KAWA 1D7QA 2IHFA 1JE5A 1E1OA 4IPDA 4JI0Q 4A93G 3HFZB 4LF5Q 1V9PA 3HOVG 2R7ZG 1Z9FA 3H0GG 5FLMG 2UXCQ 1X3EA 3S16H 1W3SA 1EIFA 1SMXA 5ELNA 1NBWA 4XIGS 5IWAL 4HJ5A 2MQHA 4IJLA 3CCVA 4GKJQ 5IP7H 2CWAA 1CKMA 4A3KH 1VQ4A 4PZ6A 1EFWA 1UE7A 1EOVA 1C0AA 1N36Q 5GQOA 2BH2A 3J7A5 4MZ9A 3CP0A 4QJFA 1SFOH 2ZM6L 2AMCB 2OTJA 1DGSA 4ALPA 1JJCB 5IT9c 1JB7A 2RF4A 1ASZA 4DR6L 4A76A 3PV0A 2LXKA 1PH8A 4JI2L 3HOZG 2Z6KA 3E9HA 2HIVA 3RN5A 3I4OA 3CCQA 1Q8KA 2I5MX 4X65L 2DUDA 4C3HH 2Q2IA 2R92H 1YEZA 1QUQB 3TREA 1HZ9A 3UDGA 2ZTDA 4MTNA 3F2BA 1V1QA 4R4IA 4B3SQ 2VUMH 3H3VI 4HJ8A 1WOCA 3HKZE 3BZKA 4DUYL 3U50C 4B3ML 2CKZB 4BA2I 4IPCA 1N34L 1MJEA 4A3JG 1G51A 3CMAA 4BY7H 3KDFB 4A3GH 1E24A 4GN5A 5IP9H 3D31A 4X6AH 4LF4L 4C2MH 5LMNQ 1CKNA 3OTOQ 1VQBA 2PQAB 1VQIA 1VQCA 1L1OA 3ULLA 3I55A 1YHQA 4GNXB 1NE3A 2UUCL 1OXSC 4DK3C 2JA6G 2WAQG 5IP7G 4PZ8A 1B8AA 1G291 4DV3Q 5IYDG 4A75A 3T1YL 4A3KG 1IBML 2KCTA 2OQ0A 1X54A 1FL0A 1Y1VG 3RZDH 1HZCA 2Y0SE 4NB3A 1G6PA 2L15A 3M4QA 4NXML 3DLLA 1JJGA 1C9OA 2AKWB 2PI2E 2WB1E 4QGUA 2PMZE 1PV4A 2UUAQ 4GLVB 4JI5Q 3UDIA 1Q12A 5ELOA 4AH6A 1N32Q 2JA7G 1L2FA 1J5EL 5LMUQ 5M5XH 4JYAL 1NMGA 3PF4A 4LF6Q 1X3FA 4DR3Q 4DV0L 1T9HA 4BBRH 2F4VQ 4KHPL 1KL9A 4BY1G 4MNOA 4DV2Q 2VUMG 3ULJA 2GVAA 4JBWA 3G6EA 4BBSH 3RLOA 1VQEA 1PYBA 4R4CA 1B70B 2YU9H 4B3TQ 3PSIA 3U58A 3ULPA 2QGQA 4UP9A 3TS2A 3CQZH 4A3GG 2UU9Q 3LGJA 5IP9G 5C3EG 4X64L 1Q1BA 2D0PA 4PG3A 2NN6I 4LUOA 2BA0A 1X3GA 2Q2TA 1X56A 1IBKL 4DV7Q 2JEBI 1NY4A 1TWGH 1N33L 3S2DH 1HJPA 4B3RQ 1E7ZA 2CQOA 2UUBL 4HIDA 2JA8H 3NELA 1PYSB 2GN5A 1VQDA 5LMNW 4LF7L 4A3EH 3PF5A 3CCLA 4LFCQ 4LWCA 2V1CC 2HIXA 3RN2A 2EQSA 1YBYA 2F3IA 5GROA 4Y7NH 1I94Q 4QIWE 4NPSA 4JI3L 3HOWH 4JV5L 4JOIC 1K73C 1KHIA 2K5HA 3HKZG 3JAMi 1KQSA 1S3OA 4LNQA 4LF9Q 1SRUA 1KXLA 2NN6G 1SN8A 2WFWA 3KJPA 3GTOH 4QL5A 1L0WA 4BBRG 4AQYL 2KBNA 1QVCA 4NXNQ 1JMCA 1X65A 1FGUA 3J7ZC 3PUVA 1IBLQ 4BBSG 1YVCA 2RCNA 3RR5A 1PH4A 4RMFA 1NMFA 2E2JH 3FKIG 4JI0L 1XNQQ 3K7UC 1YJ9A 1LM0A 5AJ3Q 4HJ7A 2UXCL 4LFAQ 1TXYA 4A3FH 1KD1C 2BA1A 2N8NA 1QZGA 1HNXQ 4GKJL 2UXDQ 3AQQA 2AWOA 3GTJH 4DV1L 1N36L 4P74A 2Y0SG 4DR2Q 4JI4L 4DR4Q 1CSPA 1WCMG 4HIOA 2WB1G 3K80C 1UE6A 3A5ZB 3PUWA 2K75A 3WWVA 3CF5A 4L5TA 1YHAA 3PO3H 3KF6B 2JA8G 4HIMA 3W5OA 4JBKA 4LF8L 2OTLA 4JI1Q 4YHHQ 5JEAG 2MFIA 3UDXA 1R9TH 2OWOA 3CPWA 3CCEA 3HOWG 4DR5Q 4IOAA 1GD7A 3AFPA 1BVSA 3NEMA 1XMQQ 3AFQA 3S1NH 2GVBA 1UE5A 4R1JA 1PH9A 1I3QH 5LMNL 4OX9Q 4HJ9A 4DR7Q 2K5NA 1LUZA 4X62Q 4GLXA 1VQHA 2AWNA 3CAMA 2Z6KC 1EWIA 5IYBG 3W1BA 3OTOL 3PUYA 2EIFA 2OCEA 2VQFQ 1S72A 3M7NA 1A63A 4JI8Q 5GAHC 4A3IH 1HR0Q 4TQUS 4OWTB 1A62A 3UDFA 2IHEA 3STBC 3GTKH 4A3FG 4A3DG 3ERSX 1Y1WG 1Y14B 2YTXA 3F8TA 2IT1A 3F2CA 1QUQA 2JJQA 5C44H 4DV3L 3J80i 3VDYA 5BR8Q 1C7YA 1TWFH 3SGIA 5C4JH 3BZCA 2E5LL 2ES2A 5C0XG 4DR1Q 1S40A 4LW1A 1O7IA 2NVQH 2UUAL 3CC4A 3D0FA 4A4IA 3KDFA 5IWAQ 1VQ8A 3PO3G 1N32L 2R93H 4WJ4A 1FVIA 1CKOA 3OYYA 5LMUL 2JE6I 1RIPA 1L1OC 1AE3A 1WJJA 2PQAA 4DR3L 4YY3L 3RNUA 2JA5H 1M1KC 4LF6L 2F4VL 3KLWA 4JI6Q 3I4NH 4L5RC 4DV2L 4GNXA 1VQGA 3PO2H 1BBWA 1N8RC 2IX1A 4LFBQ 4DR6Q 4B3TL 3PUZA 4R4QA 2HHHQ 4IPHA 1PH5A 3L7ZC 1L1OB 5HY6A 2ZJRA 1OXVA 3RLNA 3KJOA 3UE1A 1W2BA 1VQ9A 4OWWB 4UY8C 2UU9L 2VQEL 2R92G 4IOCA 1HZAA 1EYGA 2ID0A 4GOPA 3HOYH 1JJ2A 4YWLA 2NVTH 4X66Q 4JC0A 3TEHB 4GOPC 4DV7L 3J81i 2PNHA 4POGA 3CCUA 5FJ8H 1X6OA 5C44G 1K8AC 4EQ5A 2ZTCA 4IJHA 2K14A 4A3BH 1PVOA 4LFCL 2YTYA 1SLJA 3M4PA 1I5FA 1Z47A 3Q8DA 3CC7A 4BY7G 1LTLA 5E7NA 2EXDA 1HR0W 2ASBA 2ATWA 4OONA 4DV5Q 3KYHC 1I94L 4GKKL 4QY7A 3PGZA 1SE8A 4UPAA 3PIPA 1BBUA 5J3BA 4EX5A 3B6YA 4LF9L 4UP8A 5IE8A 4OO1I 2JK8A 1M90C 3S14H 1KIXA 1JT8A 1HH2P 4H02A 4LUZA 4APVA 1XMOQ 1N9WA 3I4NG 4NXNL 4DKAC 2Q2HA 4L5QA 1OTCA 4DK6C 3G48A 1IBLL 4DAMA 3F1ZA 4DV4Q 1XNQL 3L0OA 3S15H 5IY0A 4BXXH 5AJ3L 4IPGA 1J5EQ 1YI2A 4LFAL 1WFQA 3NENA 4KHZA 4DNIA 4A3CH 5M5WH 1QZHA 1HNXL 3J81c 2F52A 5GADC 3T1HQ 1VQKA 2UXDL 1UE1A 4YWMA 1XTDA 4KHPQ 3U4VA 4DUZQ 3E9IA 5M3FH 2NZOA 4YCUA 1K3RA 3HOXH 4OO1G 1IZ6A 1VQJA 1SR3A 3RZOH 3HOUH 3CCJA 4JI7Q 4K0KQ 2UXBQ 4DV6Q 5C4XH 1VQOA 5FJ8G 4LF5L 3S17H 3CCSA 4DPGA 4XTCS 2RHQB 2VL6A 4JI1L 2B3GA 5EAYA 3GTGH 1ASYA 1SROA 1VCIA 1IYJB 2B63H 2D62A 1V43A 4HJAA 2LXJA 3FP9A 4PZ7A 4DR5L 3TS0A 4ME3A 1XMQL 3I2ZA 1XPUA 2VZAA 3NBHB 1J6QA 2AHOB 2QEXA 3HOZH 3GO5A 1FJGQ 2E8GA 1KRTA 1CSQA 2NVYH 3CCMA 1MIUA 3CMEA 3JAMc 4OX9L 3PIOA 4DR7L 3KFUA 4X62L 3GD7A 4A3EG 3M4OH 1EIYB 1HNWQ 4AYBE 2VQFL 5K36G 3UE0A 1XPOA 1KC8C 1PHJA 3KF6A 1X55A 4JI8L 3AEVA 1HR0L 4BXXG 1VQ5A 1X9NA 4B3SL 3PCOB 3S1QH 1VQ7A 4IFDI 2LSSA 5H1SE 4A3CG 4AIMA 2MNAA 2IX0A 1VQFA 2D0OA 4C3IH 5C0XI 2R6GA 2I5HA 1PFSA 5M3FG 2VY3A 4PMWA 1VQNA 3HOXG 2NVXH 3I4MH 4DR1L 4R4TA 2CFMA 3CW2C 3JC66 3HOUG 1EUJA 4OXPA 2N3SA 1K9MC 3J81j 3CC2A 2K50A 4O2DA 1H95A 2MO1A 2JA6H 4A3LH 1B7YB 1MJCA 2Q2UA 1E1TA 3H3VH 4UP7A 5IYDH 2Z0SA 1HNZQ 1BKBA 4GN4B 3EIVA 5M5YH 1Y1VH 3ZJYC 4DV1Q 4JI4Q 1XNRQ 4JCVE 1QVFA 2B63G 4IFDG 3EN2A 4JI6L 1A8VA 3IRBA 4LFBL 5M3MH 4LUVA 3CXCA 4J15A 3OW2A 2K52A 2JA7H 5C4XG 2HHHL 2WP8J 4JI5L 4LF8Q 4L5SA 1YHBA 1TWAH 2H5XA 1Q82C 3AYHB 1Q81C 5JEAJ 3W1GA 1PH1A 1HZBA 1Q46A 4JBJA 1PA6A 1PH3A 1P8LA 1TWHH 4BY1H 2C35B 1VQAA 1YJNA 3MXNB 3TRZA 4X66L 2ZJPA 2QA4A 1CUKA 2ZM6Q 2DGYA 3A0JA 1VQPA 4IO9A 1CKNB 1IXRA 4GNXC 2MO0A 4JI2Q 2I0QA 1K83H 1XJVA 1PH7A 1UWVA 1E22A 1EQRA 5C3EH 4YWKA 4X65Q 2KENA 2N78A 3K7AH 2CCZA 3I4MG 4Y52H 3J80c 1NJIC 4RG1A 4DV5L 2OQKA 1GVPA 4FDBA 3DM3A 3A5UA 1D8LA 3BU2A 4A3IG 2NZHA 4DUYQ 3M3YH 4B3MQ 4A3LG 5DLQE 4GLAC 3CD6A 3RLFA 3FHWA 4B3RL 2A19A 4IFDJ 3K8AA 1N34Q 5GAGC 1XPRA 1VQMA 1GKHA 1XMOL 1GM5A 2E5LQ 2A1AA 4AYBG 3M85A 2E2IH 5C0XJ 4LF4Q 4YCVA 1PH6A 1LYLA 2VS1A 5M3MG 2KHIA 4DV4L 2PI2A 4GOPB 1I6HH 2K4KA 2UUCQ 1WYDA 2R7DA 3K0XA 2KCMA 2R93G 3A74A 3T1HL 2YV5A 1IL2A 4YY3Q 3T1YQ 1YJWA 4DAYB 1IBMQ 1VQLA 4DUZL 3CPFA 2YYZA 4YCWA 1QVGA 1U0LA 2JA5G 2KHJA 1UEBA 4NXMQ 3PO2G 3FKIH 4JI7L 2I5LX 1OXUA 4K0KL 2XGTA 5JJIA 4P71A 5GAEC 2UXBL 4DV6L 2IY5B 2JA9A 3S2HH 3I56A 4GS3A 2JQOA 2FXQA 3I7FA 1TWCH 4JYAQ 1E3PA 2VQEQ 1YNXA 2ZJQA 2HT1A 4R4OA 2HQLA 2JEAI 1YZ6A 4DV0Q 1VQ6A 4QQBX 4A3MH 2E2HH 2CWPA 2B29A 1P16A 1WCMH 4WJ3M 3HOYG 4KLKA 2VW9A 1K0RA 5IYCH 4DR2L 3S1RH 4DR4L 3MEFA 1VS0A 3STBD 4A93H 2R7FA 3HOVH 2R7ZH 1FJGL 4C3JH 3H0GH 5FLMH 1AE2A 2K5VA 3F2DA 4HIKA 1EQQA 4GN3B 3S1MH 1MKHA 4JOIA 1PH2A 2A8VA 1I50H 5FLXc 4YHHL 4A3BG 1HNWL 5HGQA 1NTGA 4X64Q 4GKKQ 1YITA 3KOJA 1GO3E 2RHSB 1KRSA 5JJKA 1WI5A 2XTIA 4TVAB 3PUXA 3H15A 3BJUA 3L2PA 1IBKQ 3K81C 1N33Q 1OXXK 1Q7YC 3GDEA 3ICEA 2WAQE 1YIJA 3U4ZA 1AH9A 3E0EA 2UUBQ 2ALYB 3GTQH 3ER0A 4LF7Q 4JBMA 3GTLH 3M9BA 4KI0A 3S24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKS A;  5IYB H;  5JJL A;  3G4S A;  1A0I A;  2BH8 A;  3KF8 B;  2YTV A;  4JI3 Q;  1Q86 C;  4JV5 Q;  4JG2 A;  4A3D H;  1Y1W H;  3GTM H;  4BA1 I;  3EBE A;  2ZTE A;  1Q1E A;  4P72 A;  4POF A;  1OXT A;  1HNZ L;  4OWX B;  1RL2 A;  3TQY A;  4P73 A;  4A3J H;  1XNR L;  5BR8 L;  4AQY Q;  1U5K A;  4P75 A;  3G71 A;  4A3M G;  4O0A A;  3GTP H;  2N49 A;  1K8G A;  3CCR A;  2VNU D;  5IYC G;  1KAW A;  1D7Q A;  2IHF A;  1JE5 A;  1E1O A;  4IPD A;  4JI0 Q;  4A93 G;  3HFZ B;  4LF5 Q;  1V9P A;  3HOV G;  2R7Z G;  1Z9F A;  3H0G G;  5FLM G;  2UXC Q;  1X3E A;  3S16 H;  1W3S A;  1EIF A;  1SMX A;  5ELN A;  1NBW A;  4XIG S;  5IWA L;  4HJ5 A;  2MQH A;  4IJL A;  3CCV A;  4GKJ Q;  5IP7 H;  2CWA A;  1CKM A;  4A3K H;  1VQ4 A;  4PZ6 A;  1EFW A;  1UE7 A;  1EOV A;  1C0A A;  1N36 Q;  5GQO A;  2BH2 A;  3J7A 5;  4MZ9 A;  3CP0 A;  4QJF A;  1SFO H;  2ZM6 L;  2AMC B;  2OTJ A;  1DGS A;  4ALP A;  1JJC B;  5IT9 c;  1JB7 A;  2RF4 A;  1ASZ A;  4DR6 L;  4A76 A;  3PV0 A;  2LXK A;  1PH8 A;  4JI2 L;  3HOZ G;  2Z6K A;  3E9H A;  2HIV A;  3RN5 A;  3I4O A;  3CCQ A;  1Q8K A;  2I5M X;  4X65 L;  2DUD A;  4C3H H;  2Q2I A;  2R92 H;  1YEZ A;  1QUQ B;  3TRE A;  1HZ9 A;  3UDG A;  2ZTD A;  4MTN A;  3F2B A;  1V1Q A;  4R4I A;  4B3S Q;  2VUM H;  3H3V I;  4HJ8 A;  1WOC A;  3HKZ E;  3BZK A;  4DUY L;  3U50 C;  4B3M L;  2CKZ B;  4BA2 I;  4IPC A;  1N34 L;  1MJE A;  4A3J G;  1G51 A;  3CMA A;  4BY7 H;  3KDF B;  4A3G H;  1E24 A;  4GN5 A;  5IP9 H;  3D31 A;  4X6A H;  4LF4 L;  4C2M H;  5LMN Q;  1CKN A;  3OTO Q;  1VQB A;  2PQA B;  1VQI A;  1VQC A;  1L1O A;  3ULL A;  3I55 A;  1YHQ A;  4GNX B;  1NE3 A;  2UUC L;  1OXS C;  4DK3 C;  2JA6 G;  2WAQ G;  5IP7 G;  4PZ8 A;  1B8A A;  1G29 1;  4DV3 Q;  5IYD G;  4A75 A;  3T1Y L;  4A3K G;  1IBM L;  2KCT A;  2OQ0 A;  1X54 A;  1FL0 A;  1Y1V G;  3RZD H;  1HZC A;  2Y0S E;  4NB3 A;  1G6P A;  2L15 A;  3M4Q A;  4NXM L;  3DLL A;  1JJG A;  1C9O A;  2AKW B;  2PI2 E;  2WB1 E;  4QGU A;  2PMZ E;  1PV4 A;  2UUA Q;  4GLV B;  4JI5 Q;  3UDI A;  1Q12 A;  5ELO A;  4AH6 A;  1N32 Q;  2JA7 G;  1L2F A;  1J5E L;  5LMU Q;  5M5X H;  4JYA L;  1NMG A;  3PF4 A;  4LF6 Q;  1X3F A;  4DR3 Q;  4DV0 L;  1T9H A;  4BBR H;  2F4V Q;  4KHP L;  1KL9 A;  4BY1 G;  4MNO A;  4DV2 Q;  2VUM G;  3ULJ A;  2GVA A;  4JBW A;  3G6E A;  4BBS H;  3RLO A;  1VQE A;  1PYB A;  4R4C A;  1B70 B;  2YU9 H;  4B3T Q;  3PSI A;  3U58 A;  3ULP A;  2QGQ A;  4UP9 A;  3TS2 A;  3CQZ H;  4A3G G;  2UU9 Q;  3LGJ A;  5IP9 G;  5C3E G;  4X64 L;  1Q1B A;  2D0P A;  4PG3 A;  2NN6 I;  4LUO A;  2BA0 A;  1X3G A;  2Q2T A;  1X56 A;  1IBK L;  4DV7 Q;  2JEB I;  1NY4 A;  1TWG H;  1N33 L;  3S2D H;  1HJP A;  4B3R Q;  1E7Z A;  2CQO A;  2UUB L;  4HID A;  2JA8 H;  3NEL A;  1PYS B;  2GN5 A;  1VQD A;  5LMN W;  4LF7 L;  4A3E H;  3PF5 A;  3CCL A;  4LFC Q;  4LWC A;  2V1C C;  2HIX A;  3RN2 A;  2EQS A;  1YBY A;  2F3I A;  5GRO A;  4Y7N H;  1I94 Q;  4QIW E;  4NPS A;  4JI3 L;  3HOW H;  4JV5 L;  4JOI C;  1K73 C;  1KHI A;  2K5H A;  3HKZ G;  3JAM i;  1KQS A;  1S3O A;  4LNQ A;  4LF9 Q;  1SRU A;  1KXL A;  2NN6 G;  1SN8 A;  2WFW A;  3KJP A;  3GTO H;  4QL5 A;  1L0W A;  4BBR G;  4AQY L;  2KBN A;  1QVC A;  4NXN Q;  1JMC A;  1X65 A;  1FGU A;  3J7Z C;  3PUV A;  1IBL Q;  4BBS G;  1YVC A;  2RCN A;  3RR5 A;  1PH4 A;  4RMF A;  1NMF A;  2E2J H;  3FKI G;  4JI0 L;  1XNQ Q;  3K7U C;  1YJ9 A;  1LM0 A;  5AJ3 Q;  4HJ7 A;  2UXC L;  4LFA Q;  1TXY A;  4A3F H;  1KD1 C;  2BA1 A;  2N8N A;  1QZG A;  1HNX Q;  4GKJ L;  2UXD Q;  3AQQ A;  2AWO A;  3GTJ H;  4DV1 L;  1N36 L;  4P74 A;  2Y0S G;  4DR2 Q;  4JI4 L;  4DR4 Q;  1CSP A;  1WCM G;  4HIO A;  2WB1 G;  3K80 C;  1UE6 A;  3A5Z B;  3PUW A;  2K75 A;  3WWV A;  3CF5 A;  4L5T A;  1YHA A;  3PO3 H;  3KF6 B;  2JA8 G;  4HIM A;  3W5O A;  4JBK A;  4LF8 L;  2OTL A;  4JI1 Q;  4YHH Q;  5JEA G;  2MFI A;  3UDX A;  1R9T H;  2OWO A;  3CPW A;  3CCE A;  3HOW G;  4DR5 Q;  4IOA A;  1GD7 A;  3AFP A;  1BVS A;  3NEM A;  1XMQ Q;  3AFQ A;  3S1N H;  2GVB A;  1UE5 A;  4R1J A;  1PH9 A;  1I3Q H;  5LMN L;  4OX9 Q;  4HJ9 A;  4DR7 Q;  2K5N A;  1LUZ A;  4X62 Q;  4GLX A;  1VQH A;  2AWN A;  3CAM A;  2Z6K C;  1EWI A;  5IYB G;  3W1B A;  3OTO L;  3PUY A;  2EIF A;  2OCE A;  2VQF Q;  1S72 A;  3M7N A;  1A63 A;  4JI8 Q;  5GAH C;  4A3I H;  1HR0 Q;  4TQU S;  4OWT B;  1A62 A;  3UDF A;  2IHE A;  3STB C;  3GTK H;  4A3F G;  4A3D G;  3ERS X;  1Y1W G;  1Y14 B;  2YTX A;  3F8T A;  2IT1 A;  3F2C A;  1QUQ A;  2JJQ A;  5C44 H;  4DV3 L;  3J80 i;  3VDY A;  5BR8 Q;  1C7Y A;  1TWF H;  3SGI A;  5C4J H;  3BZC A;  2E5L L;  2ES2 A;  5C0X G;  4DR1 Q;  1S40 A;  4LW1 A;  1O7I A;  2NVQ H;  2UUA L;  3CC4 A;  3D0F A;  4A4I A;  3KDF A;  5IWA Q;  1VQ8 A;  3PO3 G;  1N32 L;  2R93 H;  4WJ4 A;  1FVI A;  1CKO A;  3OYY A;  5LMU L;  2JE6 I;  1RIP A;  1L1O C;  1AE3 A;  1WJJ A;  2PQA A;  4DR3 L;  4YY3 L;  3RNU A;  2JA5 H;  1M1K C;  4LF6 L;  2F4V L;  3KLW A;  4JI6 Q;  3I4N H;  4L5R C;  4DV2 L;  4GNX A;  1VQG A;  3PO2 H;  1BBW A;  1N8R C;  2IX1 A;  4LFB Q;  4DR6 Q;  4B3T L;  3PUZ A;  4R4Q A;  2HHH Q;  4IPH A;  1PH5 A;  3L7Z C;  1L1O B;  5HY6 A;  2ZJR A;  1OXV A;  3RLN A;  3KJO A;  3UE1 A;  1W2B A;  1VQ9 A;  4OWW B;  4UY8 C;  2UU9 L;  2VQE L;  2R92 G;  4IOC A;  1HZA A;  1EYG A;  2ID0 A;  4GOP A;  3HOY H;  1JJ2 A;  4YWL A;  2NVT H;  4X66 Q;  4JC0 A;  3TEH B;  4GOP C;  4DV7 L;  3J81 i;  2PNH A;  4POG A;  3CCU A;  5FJ8 H;  1X6O A;  5C44 G;  1K8A C;  4EQ5 A;  2ZTC A;  4IJH A;  2K14 A;  4A3B H;  1PVO A;  4LFC L;  2YTY A;  1SLJ A;  3M4P A;  1I5F A;  1Z47 A;  3Q8D A;  3CC7 A;  4BY7 G;  1LTL A;  5E7N A;  2EXD A;  1HR0 W;  2ASB A;  2ATW A;  4OON A;  4DV5 Q;  3KYH C;  1I94 L;  4GKK L;  4QY7 A;  3PGZ A;  1SE8 A;  4UPA A;  3PIP A;  1BBU A;  5J3B A;  4EX5 A;  3B6Y A;  4LF9 L;  4UP8 A;  5IE8 A;  4OO1 I;  2JK8 A;  1M90 C;  3S14 H;  1KIX A;  1JT8 A;  1HH2 P;  4H02 A;  4LUZ A;  4APV A;  1XMO Q;  1N9W A;  3I4N G;  4NXN L;  4DKA C;  2Q2H A;  4L5Q A;  1OTC A;  4DK6 C;  3G48 A;  1IBL L;  4DAM A;  3F1Z A;  4DV4 Q;  1XNQ L;  3L0O A;  3S15 H;  5IY0 A;  4BXX H;  5AJ3 L;  4IPG A;  1J5E Q;  1YI2 A;  4LFA L;  1WFQ A;  3NEN A;  4KHZ A;  4DNI A;  4A3C H;  5M5W H;  1QZH A;  1HNX L;  3J81 c;  2F52 A;  5GAD C;  3T1H Q;  1VQK A;  2UXD L;  1UE1 A;  4YWM A;  1XTD A;  4KHP Q;  3U4V A;  4DUZ Q;  3E9I A;  5M3F H;  2NZO A;  4YCU A;  1K3R A;  3HOX H;  4OO1 G;  1IZ6 A;  1VQJ A;  1SR3 A;  3RZO H;  3HOU H;  3CCJ A;  4JI7 Q;  4K0K Q;  2UXB Q;  4DV6 Q;  5C4X H;  1VQO A;  5FJ8 G;  4LF5 L;  3S17 H;  3CCS A;  4DPG A;  4XTC S;  2RHQ B;  2VL6 A;  4JI1 L;  2B3G A;  5EAY A;  3GTG H;  1ASY A;  1SRO A;  1VCI A;  1IYJ B;  2B63 H;  2D62 A;  1V43 A;  4HJA A;  2LXJ A;  3FP9 A;  4PZ7 A;  4DR5 L;  3TS0 A;  4ME3 A;  1XMQ L;  3I2Z A;  1XPU A;  2VZA A;  3NBH B;  1J6Q A;  2AHO B;  2QEX A;  3HOZ H;  3GO5 A;  1FJG Q;  2E8G A;  1KRT A;  1CSQ A;  2NVY H;  3CCM A;  1MIU A;  3CME A;  3JAM c;  4OX9 L;  3PIO A;  4DR7 L;  3KFU A;  4X62 L;  3GD7 A;  4A3E G;  3M4O H;  1EIY B;  1HNW Q;  4AYB E;  2VQF L;  5K36 G;  3UE0 A;  1XPO A;  1KC8 C;  1PHJ A;  3KF6 A;  1X55 A;  4JI8 L;  3AEV A;  1HR0 L;  4BXX G;  1VQ5 A;  1X9N A;  4B3S L;  3PCO B;  3S1Q H;  1VQ7 A;  4IFD I;  2LSS A;  5H1S E;  4A3C G;  4AIM A;  2MNA A;  2IX0 A;  1VQF A;  2D0O A;  4C3I H;  5C0X I;  2R6G A;  2I5H A;  1PFS A;  5M3F G;  2VY3 A;  4PMW A;  1VQN A;  3HOX G;  2NVX H;  3I4M H;  4DR1 L;  4R4T A;  2CFM A;  3CW2 C;  3JC6 6;  3HOU G;  1EUJ A;  4OXP A;  2N3S A;  1K9M C;  3J81 j;  3CC2 A;  2K50 A;  4O2D A;  1H95 A;  2MO1 A;  2JA6 H;  4A3L H;  1B7Y B;  1MJC A;  2Q2U A;  1E1T A;  3H3V H;  4UP7 A;  5IYD H;  2Z0S A;  1HNZ Q;  1BKB A;  4GN4 B;  3EIV A;  5M5Y H;  1Y1V H;  3ZJY C;  4DV1 Q;  4JI4 Q;  1XNR Q;  4JCV E;  1QVF A;  2B63 G;  4IFD G;  3EN2 A;  4JI6 L;  1A8V A;  3IRB A;  4LFB L;  5M3M H;  4LUV A;  3CXC A;  4J15 A;  3OW2 A;  2K52 A;  2JA7 H;  5C4X G;  2HHH L;  2WP8 J;  4JI5 L;  4LF8 Q;  4L5S A;  1YHB A;  1TWA H;  2H5X A;  1Q82 C;  3AYH B;  1Q81 C;  5JEA J;  3W1G A;  1PH1 A;  1HZB A;  1Q46 A;  4JBJ A;  1PA6 A;  1PH3 A;  1P8L A;  1TWH H;  4BY1 H;  2C35 B;  1VQA A;  1YJN A;  3MXN B;  3TRZ A;  4X66 L;  2ZJP A;  2QA4 A;  1CUK A;  2ZM6 Q;  2DGY A;  3A0J A;  1VQP A;  4IO9 A;  1CKN B;  1IXR A;  4GNX C;  2MO0 A;  4JI2 Q;  2I0Q A;  1K83 H;  1XJV A;  1PH7 A;  1UWV A;  1E22 A;  1EQR A;  5C3E H;  4YWK A;  4X65 Q;  2KEN A;  2N78 A;  3K7A H;  2CCZ A;  3I4M G;  4Y52 H;  3J80 c;  1NJI C;  4RG1 A;  4DV5 L;  2OQK A;  1GVP A;  4FDB A;  3DM3 A;  3A5U A;  1D8L A;  3BU2 A;  4A3I G;  2NZH A;  4DUY Q;  3M3Y H;  4B3M Q;  4A3L G;  5DLQ E;  4GLA C;  3CD6 A;  3RLF A;  3FHW A;  4B3R L;  2A19 A;  4IFD J;  3K8A A;  1N34 Q;  5GAG C;  1XPR A;  1VQM A;  1GKH A;  1XMO L;  1GM5 A;  2E5L Q;  2A1A A;  4AYB G;  3M85 A;  2E2I H;  5C0X J;  4LF4 Q;  4YCV A;  1PH6 A;  1LYL A;  2VS1 A;  5M3M G;  2KHI A;  4DV4 L;  2PI2 A;  4GOP B;  1I6H H;  2K4K A;  2UUC Q;  1WYD A;  2R7D A;  3K0X A;  2KCM A;  2R93 G;  3A74 A;  3T1H L;  2YV5 A;  1IL2 A;  4YY3 Q;  3T1Y Q;  1YJW A;  4DAY B;  1IBM Q;  1VQL A;  4DUZ L;  3CPF A;  2YYZ A;  4YCW A;  1QVG A;  1U0L A;  2JA5 G;  2KHJ A;  1UEB A;  4NXM Q;  3PO2 G;  3FKI H;  4JI7 L;  2I5L X;  1OXU A;  4K0K L;  2XGT A;  5JJI A;  4P71 A;  5GAE C;  2UXB L;  4DV6 L;  2IY5 B;  2JA9 A;  3S2H H;  3I56 A;  4GS3 A;  2JQO A;  2FXQ A;  3I7F A;  1TWC H;  4JYA Q;  1E3P A;  2VQE Q;  1YNX A;  2ZJQ A;  2HT1 A;  4R4O A;  2HQL A;  2JEA I;  1YZ6 A;  4DV0 Q;  1VQ6 A;  4QQB X;  4A3M H;  2E2H H;  2CWP A;  2B29 A;  1P16 A;  1WCM H;  4WJ3 M;  3HOY G;  4KLK A;  2VW9 A;  1K0R A;  5IYC H;  4DR2 L;  3S1R H;  4DR4 L;  3MEF A;  1VS0 A;  3STB D;  4A93 H;  2R7F A;  3HOV H;  2R7Z H;  1FJG L;  4C3J H;  3H0G H;  5FLM H;  1AE2 A;  2K5V A;  3F2D A;  4HIK A;  1EQQ A;  4GN3 B;  3S1M H;  1MKH A;  4JOI A;  1PH2 A;  2A8V A;  1I50 H;  5FLX c;  4YHH L;  4A3B G;  1HNW L;  5HGQ A;  1NTG A;  4X64 Q;  4GKK Q;  1YIT A;  3KOJ A;  1GO3 E;  2RHS B;  1KRS A;  5JJK A;  1WI5 A;  2XTI A;  4TVA B;  3PUX A;  3H15 A;  3BJU A;  3L2P A;  1IBK Q;  3K81 C;  1N33 Q;  1OXX K;  1Q7Y C;  3GDE A;  3ICE A;  2WAQ E;  1YIJ A;  3U4Z A;  1AH9 A;  3E0E A;  2UUB Q;  2ALY B;  3GTQ H;  3ER0 A;  4LF7 Q;  4JBM A;  3GTL H;  3M9B A;  4KI0 A;  3S24 A; 
#chains in the Genus database with same CATH topology
 1H9M A;  4A3J B;  1A0I A;  2BH8 A;  2PQE A;  4JV5 Q;  1STN A;  4BA1 I;  2PO4 A;  1SYC A;  4HMJ A;  3CKI B;  1OXT A;  4OWX B;  2R3Z A;  4OEL B;  5BR8 L;  4A3M G;  1T5E A;  2N49 A;  4CDC C;  2VNU D;  2IHF A;  1LT3 D;  1JE5 A;  1A3U A;  5JAV A;  2QKI C;  1STG A;  1SFO B;  1CZW A;  1KDA A;  1X3E A;  1B4O A;  1W3S A;  5C4X G;  4GKJ Q;  1NBW A;  2MQH A;  1STE A;  1JB3 A;  1UE7 A;  2F0O A;  4V0B A;  3AMU A;  3CP0 A;  2B2Y C;  3KLS X;  1CQV A;  3PV0 A;  2LXK A;  5FOB B;  4A76 A;  1B50 A;  1EY6 A;  5C6A A;  2HIV A;  3FVQ A;  4N8F A;  1SMY D;  2DUD A;  4C3H H;  1MBY A;  1PLF A;  4G57 A;  1YEZ A;  4A3G B;  3TRE A;  1HZ9 A;  2B2T C;  3HKZ E;  3BZK A;  4DUY L;  3U50 C;  4B3M L;  3MXP A;  4BA2 I;  4A3J G;  3VYR A;  2PZT A;  4C2M H;  4XT1 B;  4ZQ3 A;  2PQA B;  4HMI A;  2OEO A;  3JAM E;  2AQ1 B;  1VQC A;  4H0L C;  1O7Z A;  2UUC L;  1OXS C;  3MTS A;  5IP7 G;  3H94 A;  1G29 1;  1CZG A;  2A68 D;  1IBM L;  5COY A;  2KCT A;  3J7A V;  1X54 A;  1FL0 A;  1Y1V G;  3TP5 A;  2PZU A;  3K0Y A;  1B53 A;  1MHW C;  4NXM L;  3T4A C;  2ZXO A;  3OIQ A;  4QGU A;  2A6E C;  3QB3 A;  4GLV B;  4JI5 Q;  4AH6 A;  1N32 Q;  1PYW D;  3MXG A;  1PMR A;  4ZAI A;  2G9D A;  3NTK A;  1HRJ A;  1SE2 A;  3PF4 A;  3CQZ B;  3NXW A;  5DM7 3;  4BBR H;  3MEH A;  4MNO A;  1QCB D;  4KKT A;  4F7X A;  4XQN A;  3RLO A;  4R4C A;  1B70 B;  4UP9 A;  4A3G G;  1K8O A;  3BVG A;  3J80 L;  3Q6S A;  2KA7 A;  1KNA A;  1Q1B A;  2NN6 I;  1X3G A;  4KKU A;  3G6J B;  2JEB I;  1LT5 D;  4K2K A;  1TWG H;  3S2D H;  1HJP A;  1B1Z A;  2JA8 H;  3NEL A;  3PF5 A;  3CCL A;  3SE0 A;  2K5W A;  2V1C C;  2HIX A;  4DXF A;  2EQS A;  1DOM A;  2F3I A;  5GRO A;  5C3X A;  1A3T A;  4J1M A;  4Y7N H;  4JI3 L;  1BCP F;  1KHI A;  2K5H A;  2E2J B;  5AFW A;  2DJG C;  1KQS A;  1SRU A;  3K57 A;  4DFA A;  2EY5 A;  1BXT A;  2K04 A;  4QL5 A;  1QVC A;  4NXN Q;  1XYI A;  1IBL Q;  4HED A;  1NMF A;  2O2L D;  3K7U C;  2MUY A;  4HJ7 A;  4QIW B;  5CV7 A;  4RCN A;  3SK4 A;  2AWO A;  1C8C A;  2EVB A;  4NKL A;  4DV1 L;  4DGZ A;  1EY5 A;  5JOB A;  3J7A F;  1D5Z C;  3FPU B;  4L5T A;  1SNP A;  3PO3 H;  1J9O A;  4JBK A;  3LX0 A;  5JEA G;  2OWO A;  1R9T H;  2F0W A;  1SYF A;  4DR5 Q;  1SJE D;  3NTI A;  1TT2 A;  1BVS A;  5ELB A;  1HA5 A;  1EWC A;  2FIN B;  2PYK A;  1UE5 A;  1T5X D;  1I3Q H;  1LUZ A;  4G4K A;  1QOH A;  1TWF B;  1EY8 A;  3EJI A;  3OTO L;  2EIF A;  1JOQ A;  2KQ3 A;  3MFG A;  1A62 A;  3GTK H;  2IHE A;  1ENF A;  4MN3 A;  3ERS X;  3F8T A;  2IT1 A;  5C44 H;  3C2P A;  4DV3 L;  5C3W A;  1STB A;  2TMP A;  4U68 A;  2L4N A;  3VR4 A;  2E5L L;  2HDL A;  1S40 A;  1STH A;  3PO2 B;  4BWG B;  2UUA L;  3GQB A;  3CC4 A;  2C9O A;  1VDZ A;  3M4Y A;  1BCP D;  1FVI A;  3NPP A;  5CV4 A;  3SK8 A;  3D6W A;  1RIP A;  3H09 A;  1D5X C;  1SYG A;  1L1O C;  2PQA A;  1EY7 A;  4LF6 L;  5FO9 B;  1M1K C;  2F4V L;  3I4N H;  1K3B C;  3DXJ C;  1A2T A;  1RD9 D;  3PUZ A;  2NYZ D;  2HHH Q;  4KHV A;  3L7Z C;  1L1O B;  1EEF D;  4Q0F A;  4TKO B;  5HY6 A;  3V96 A;  1KAB A;  5JVG 3;  3KJO A;  3MXU A;  1W2B A;  1VQ9 A;  5CC4 A;  4C3H G;  1HZA A;  5J1Z A;  2ID0 A;  4GOP A;  1EQV A;  4KV6 A;  5ELC A;  2NVT H;  4X66 Q;  4DV7 L;  3K5O A;  2F0S A;  2HDM A;  5FJ8 H;  1X6O A;  1K8A C;  4EQ5 A;  1SNC A;  4IJH A;  4PMC A;  4LFC L;  3MAQ A;  2YTY A;  1YNN D;  1Z47 A;  3CC7 A;  2ATW A;  3I90 A;  1PTO H;  3OMG A;  2FMM A;  3PGZ A;  2K5Q A;  4EX5 A;  4Y7N B;  3KBX A;  3T51 B;  5A35 A;  3HRZ C;  5TSS A;  4G7H C;  1KIX A;  3S14 H;  3A55 A;  1AFP A;  1XMO Q;  1SMY C;  2A6H D;  2EOT A;  4IUT A;  5LHY 1;  1XNQ L;  3FRP B;  4CJ1 B;  2HD3 A;  1WVL A;  4IPG A;  1J5E Q;  1YI2 A;  4LFA L;  4DNI A;  1QZH A;  1QB5 D;  1I4H A;  1XTD A;  1FNV A;  3U4V A;  2I46 A;  3TZD A;  5M3F H;  1B44 D;  4LMQ D;  3CU7 A;  5IGC A;  2QCP X;  2B63 B;  3HOU H;  1IKM A;  1O80 A;  2BDO A;  1EYD A;  2RHQ B;  2VL6 A;  4JI1 L;  3KLR A;  1VCI A;  3P1H A;  2LXJ A;  3FP9 A;  4PZ7 A;  3TP7 A;  1XMQ L;  2IPK D;  2VZA A;  1CA6 A;  1DZ1 A;  2QEX A;  5M9O A;  1SEB D;  3HOZ H;  1X3Q A;  2SNM A;  4OX9 L;  4DR7 L;  4UAI A;  4X62 L;  5DEH A;  3BYT B;  3KBG A;  3R3O A;  2NVX B;  3K5N A;  3AEV A;  3S1Q H;  4CDF C;  1VQ7 A;  3GV3 A;  5KYI A;  4FYD A;  4A3C G;  1S5C D;  5C0X I;  2NBF A;  5CR3 A;  2Q8T A;  5CYU A;  4DAV A;  4DR1 L;  2ENB A;  2WII B;  5JJZ A;  5M3M B;  1B7Y B;  1E1T A;  4OHJ A;  1LTR D;  2JA7 B;  1BUV T;  4UHV A;  5KND A;  2HCC A;  4GN4 B;  5M5Y H;  3EIV A;  1DCZ A;  2B63 G;  4H13 C;  2E2D C;  3A8I E;  2DNE A;  4LFB L;  1AEX A;  4YIJ A;  2EYJ A;  4FF4 A;  2WP8 J;  4JI5 L;  4LF8 Q;  1SNQ A;  3AYH B;  1I4X A;  1PH1 A;  3W1G A;  1HZB A;  5IOC A;  1TWH H;  1WTR A;  2C35 B;  1VQA A;  3MXN B;  1CUK A;  4KKS A;  2EPB A;  4IO9 A;  1CKN B;  3DWP A;  1NCV A;  1UWV A;  1E22 A;  3NWT A;  3NQI A;  4F88 A;  1NJI C;  5I2Y A;  2OQK A;  3V2T A;  4FDB A;  1RDP D;  3A5U A;  2NZH A;  4DUY Q;  4B3M Q;  1NR4 A;  1I6H B;  4MIU A;  1G8Z D;  2HQE A;  1GKH A;  4RGN A;  2A1A A;  5IT9 E;  2VS1 A;  1EYA A;  5M3M G;  5DNF A;  4XYQ A;  2K4K A;  4ME5 A;  5FK9 C;  2RBM A;  1M4V A;  2UUC Q;  1E0B A;  4LK1 C;  2KCM A;  5BN4 A;  2F0E A;  1IBM Q;  3C3L A;  1SAP A;  2Z9H A;  1QVG A;  3E3X A;  1UEB A;  4NXM Q;  2E76 C;  3FKI H;  2ZXP A;  1OXU A;  1VF5 C;  4K0K L;  5IGF A;  1GUS A;  2JA9 A;  4C1N I;  3HOV B;  1I4G A;  1ML0 D;  2EYH A;  2VQE Q;  1YNX A;  1ICW A;  1YZ6 A;  1VQ6 A;  2RA4 A;  4A3M H;  2A74 C;  2B29 A;  5T1G A;  1H9S B;  1K0R A;  1D1I A;  4K8I A;  1A6X A;  1LLR D;  3GV6 A;  1M8A A;  1FJG L;  4C3J H;  1TS5 A;  3T56 B;  1BCP C;  1EQQ A;  3HOZ B;  3OMC A;  4JOI A;  1K28 A;  1I50 H;  1TY2 A;  1NTG A;  1YIT A;  3QOL A;  1GO3 E;  3NWS A;  2RHS B;  1RF2 D;  4K5V A;  4K5X A;  3R8B A;  1WTH A;  3K81 C;  1BCP B;  2BCO A;  1Q7Y C;  1BR9 A;  3GDE A;  3BVZ A;  1YIJ A;  4FF1 A;  3GTL H;  3M9B A;  4KI0 A;  2L11 A;  3HP3 A;  3S24 A;  5JJL A;  3G4S A;  3KF8 B;  4JI3 Q;  4JG2 A;  1Y1W H;  5KGU A;  1J8I A;  2ZTE A;  3QR8 A;  3W3A A;  5I9O A;  1HNZ L;  2WAQ B;  1FGB D;  4P73 A;  4A3J H;  1XNR L;  3Q24 A;  1IHZ A;  4O0A A;  4N9T A;  5EPK A;  5IYC G;  3VR3 A;  1DOL A;  3DHQ A;  5T1I A;  1XXG A;  1Y8N B;  2K28 A;  3HFZ B;  3A56 A;  1V9P A;  3HOV G;  4HTH A;  1SMX A;  4XIG S;  5IP7 H;  1IW7 C;  2O4X A;  1HFN A;  4XYO A;  3RD4 A;  5GQO A;  2J4X A;  1ESF A;  2JP1 A;  4QJF A;  1NAP A;  1SFO H;  2ZM6 L;  2AMC B;  1DGS A;  4ALP A;  2X69 A;  2VUM B;  1JB7 A;  2RF4 A;  4JI2 L;  3HOZ G;  2A5H A;  1Z7T A;  3I4O A;  3CCQ A;  3TDQ A;  3BVM A;  2L1B A;  2I5M X;  2R92 H;  1AP0 A;  3ND9 A;  2ZTD A;  4R4I A;  1XX8 A;  2K32 A;  1TS3 A;  2SDF A;  5EQ0 A;  1GJX A;  4IPC A;  1N34 L;  2EJF C;  3MXN A;  1G51 A;  3O13 A;  1CT1 D;  4A3G H;  1E24 A;  2J7Z A;  2NTT A;  3P7J A;  3D6C A;  4LF4 L;  1CKN A;  3OTO Q;  3RZD B;  4ZCK A;  1VQI A;  4FXG C;  1YHQ A;  3ULL A;  3FEW X;  2WAQ G;  4PZ8 A;  4DV3 Q;  4QCL A;  1RTO A;  5M5X B;  2OQ0 A;  2Y0S E;  1G6P A;  2P5Z X;  3M4Q A;  3DLL A;  1TII D;  3ERO A;  5CV9 A;  2UUA Q;  4BBS B;  4IUQ A;  5ELO A;  2YU9 B;  5C5L A;  1J5E L;  1NMG A;  4LF6 Q;  1X3F A;  1JCK B;  2F4V Q;  4OO1 H;  1B9M A;  2VUM G;  1S5B D;  1PXU A;  5KIX A;  1WTQ A;  4KMU C;  1RKN A;  1VQE A;  1HPC A;  4WOR A;  1SXT A;  4FXK C;  2WB1 B;  2PMZ B;  3U58 A;  2QGQ A;  2B2U C;  1KNE A;  3CQZ H;  4CJ2 C;  1QG7 A;  2F0T A;  2AUJ D;  4HCS A;  2D0P A;  4PG3 A;  5CBE E;  2EJG C;  2M00 A;  3D3R A;  2EYP A;  4QB4 A;  1IBK L;  4DV7 Q;  3HOW B;  4XXE A;  4IUP A;  3D4R A;  4B3R Q;  3P75 A;  2UUB L;  4FVM A;  1VQD A;  1A15 A;  4F8M A;  4LFC Q;  3L3O C;  4LWC A;  3RN2 A;  4X3T A;  5JEA H;  1YBY A;  4X3U A;  2G5D A;  1DON A;  1HA6 A;  5EKI A;  1GHJ A;  2EXZ A;  1K73 C;  1D6E C;  1S3O A;  4LNQ A;  3ONA B;  2V4D A;  3ERQ A;  4BBS G;  2RCN A;  2E2J H;  4RMF A;  1XNQ Q;  3FKI G;  1LM0 A;  4LFA Q;  1TXY A;  3J81 L;  3KF8 A;  3AQQ A;  4RHR A;  4IFD H;  4L63 B;  1N36 L;  2K6A A;  3A8K E;  2WB1 G;  2KJX A;  4HSV A;  3A5Z B;  1IL8 A;  2K75 A;  3WWV A;  3SHL A;  4C3J G;  2L5T A;  1F2Z A;  2JXM B;  2TSS A;  4HIM A;  4LF8 L;  2OTL A;  4JI1 Q;  3H3V C;  5JPM C;  2QDB A;  3CPW A;  2A69 D;  3HOW G;  1GD7 A;  2R92 B;  1XMQ Q;  1FD7 D;  5F2D A;  3AFQ A;  3LWU A;  5CMD A;  1FYC A;  2F0Q A;  1EZ6 A;  3K5L A;  2CVR A;  4R1J A;  1PH9 A;  4OX9 Q;  4HJ9 A;  4DR7 Q;  4X62 Q;  5A2Q E;  2AWN A;  3CAM A;  2Z6K C;  4I65 A;  1S72 A;  2Z6B A;  3PUY A;  5C4J B;  3D4D A;  3CRL C;  4TQU S;  3FMC A;  4OWT B;  1F77 A;  1Y1W G;  2YTX A;  4K5W A;  3J80 i;  1C7Y A;  2H4O A;  1TWF H;  2B2V C;  3BZC A;  2ES2 A;  5C0X G;  4DR1 Q;  2ICI A;  5JPN C;  5BN3 A;  5IWA Q;  1VQ8 A;  1MI2 A;  5EBD A;  5ISR A;  1LTI D;  1AE3 A;  3BDC A;  4RCO A;  3KLW A;  3E5S A;  3PO2 H;  2RCF A;  1VQG A;  1PZI D;  2E75 C;  3VR6 A;  4DR6 Q;  4LFB Q;  4B3T L;  2LMC B;  1XTC D;  5HUR A;  3FDT A;  4DNR B;  4UY8 C;  2UU9 L;  1DD2 A;  2VQE L;  1F2Y A;  1TS4 A;  2AQ2 B;  4IOC A;  1EYG A;  2R92 G;  3HOY H;  4B08 A;  1JJ2 A;  1G91 A;  1EY0 A;  3PIO 3;  3KK7 A;  3NP8 A;  4UDU C;  5K5P A;  1LV9 A;  4GOP C;  1D5M C;  4DAY A;  1O78 A;  1S5F D;  1TQO A;  2HUG A;  3NBI A;  2F0I A;  2L55 A;  1I5F A;  1LTL A;  2PZW A;  3KYH C;  1WTO A;  1I94 L;  4UPA A;  5FKA C;  1GOZ A;  4R8I A;  2F0U A;  1X3P A;  4RGM A;  5M5W B;  2XVS A;  5KRU A;  1U4P A;  1N9W A;  3IKJ A;  4FXD A;  2Q2H A;  4QMG A;  1OTC A;  3R2I A;  2EE1 A;  3IL8 A;  1CA5 A;  5AJ3 L;  2IL8 A;  1V1P A;  1WFQ A;  2PW5 A;  2D5D A;  4A3C H;  1HNX L;  3J81 c;  2F52 A;  3ITP A;  3S17 B;  2UXD L;  2C5C A;  1O7Y A;  3E9I A;  4YCU A;  4RGT A;  4OO1 G;  1PZJ D;  1U9R A;  3CCJ A;  4IQZ A;  4K0K Q;  5LL6 X;  2K1B A;  2VB3 X;  1JOO A;  2B3G A;  1ASY A;  3S9W A;  3MC0 B;  2B63 H;  4HJA A;  4RFB A;  1TU2 B;  1FJG Q;  2E8G A;  2IJ0 A;  1CSQ A;  3CCM A;  1JIC A;  5C4Z A;  3PIO A;  2K7V A;  4FF2 A;  4C3I B;  1R4P B;  1EIY B;  4AYB E;  3L9A X;  1PHJ A;  4JI8 L;  3I4M B;  1F2L A;  1X9N A;  3PCO B;  1JC7 A;  2EY1 A;  3BZD B;  1R4Q B;  3NK9 A;  4AIM A;  2MNA A;  2DJF C;  1CI3 M;  1HHV A;  1FNU A;  2VY3 A;  2B2W C;  4K8J A;  2NVX H;  2LFN A;  2CFM A;  1K9M C;  3J81 j;  3CC2 A;  1IYV A;  2MO1 A;  2JA6 H;  2Q2U A;  3LNN A;  3A8J E;  4JVZ A;  5IYD H;  4R9W A;  2Z0S A;  1HNZ Q;  4JI4 Q;  3ZJY C;  1XNR Q;  2B2Y A;  4IFD G;  4WJW A;  3EN2 A;  4JI6 L;  2K05 A;  1HUM A;  5M3M H;  4LUV A;  1QNU A;  3OW2 A;  1CHP D;  1SBB B;  2JA7 H;  2RVL A;  4RA8 A;  3HS0 C;  2B2T A;  4HAE A;  3DEP A;  1K83 B;  1PH3 A;  2BOS A;  4BY1 H;  2ZT9 C;  3F2U A;  3HGB A;  1YJN A;  3TRZ A;  1WD0 A;  4ZYS A;  2ZM6 Q;  3SK6 A;  3HOY B;  4GNX C;  1SDF A;  2MO0 A;  4JI2 Q;  3M3Y B;  2I0Q A;  2D2C C;  2WKD A;  4KJN A;  4HN7 A;  1EQR A;  3WOE A;  4YWK A;  2KEN A;  3I4M G;  3J80 c;  4RG1 A;  2E2I B;  1EL0 A;  3DM3 A;  1D8L A;  1JR0 D;  3BU2 A;  2F0N A;  5E4X A;  3RLF A;  4B3R L;  3K8A A;  1BQQ T;  1N34 Q;  2PCF B;  1XPR A;  1HQM C;  1GM5 A;  1STA A;  4HSP A;  1CFM A;  4LF4 Q;  1CQF A;  2A69 C;  2KHI A;  4KTA A;  4DV4 L;  1I6H H;  2CW0 C;  3IFD A;  2XRS D;  1WYD A;  3N6R A;  3K0X A;  4P2C B;  2YV5 A;  2LS0 1;  4DUZ L;  1IW7 D;  1XWE A;  4K14 A;  2X6G A;  2Y0S B;  3PO2 G;  1Q8I A;  1WCM B;  4Z9C B;  2XGT A;  4P71 A;  2UXB L;  4DV6 L;  3SVM A;  1PFN A;  3R2T A;  3I56 A;  4GS3 A;  3ND8 A;  2QIL A;  1D1K A;  2MGS A;  1G2S A;  2DNC A;  2HQL A;  4QQB X;  1SNM A;  3DEO A;  3HOY G;  2VW9 A;  1MD2 D;  5IYC H;  3STB D;  3HOV H;  2B8F A;  1AE2 A;  3F2D A;  4HIK A;  4LJZ C;  1OO9 B;  5I6W A;  2K5D A;  5EPL A;  4GKK Q;  1BOS A;  4DF7 A;  1KRS A;  1WI5 A;  2L12 A;  2XTI A;  4TVA B;  3H15 A;  1IBK Q;  1OXX K;  3MVV A;  3MZ5 A;  1HTP A;  3E0E A;  2UUB Q;  3GTM B;  5DAU A;  2F03 A;  2SNS A;  3OPO A;  1TS2 A;  2PNR C;  4RHS A;  3GTP B;  5JVH 3;  1Q86 C;  4A3D H;  4RAU C;  1Q90 A;  3EBE A;  4P72 A;  4POF A;  2EY2 A;  3S16 B;  2JA6 B;  1RL2 A;  2EYM A;  1B3Q A;  1U5K A;  4P75 A;  4A3K B;  3DWQ A;  1WD1 A;  1K8G A;  3CCR A;  1KAW A;  1D7Q A;  1CHQ D;  2KOL A;  4NMZ A;  1E1O A;  4FF3 A;  1EU4 A;  2LKV A;  5I9P A;  4LF5 Q;  5FLM G;  1EIF A;  4HJ5 A;  1NR2 A;  5IWA L;  4IJL A;  3OWF A;  1EFW A;  1EOV A;  1N36 Q;  4KD3 A;  2AQ3 B;  3Q23 A;  4BY1 B;  2OTJ A;  1GUN A;  1JJC B;  1DYQ A;  4DR6 L;  3JAM L;  3BG3 A;  3MFY A;  1Q8K A;  3D4W A;  2M9V A;  5IOD A;  4BY7 B;  1UEA B;  4F87 A;  3AU7 A;  3C1F A;  3F2B A;  1E2Z A;  1V1Q A;  2VUM H;  1DXM A;  3H3V I;  3OWE B;  1MSH A;  4KJO A;  3CMA A;  3KDF B;  4GN5 A;  2JYO A;  3D31 A;  1VQB A;  5L37 A;  1PZK D;  3I55 A;  1L1O A;  1NE3 A;  4DK3 C;  2JA6 G;  3HKZ B;  1JOR A;  5ELD A;  3T1Y L;  4A3K G;  5IYD G;  3NTH A;  2F0J A;  4HR7 B;  3RZD H;  1HZC A;  1SYD A;  4NB3 A;  2L15 A;  3QOJ A;  1II3 A;  2EJM A;  3U9S A;  1JJG A;  3BYY B;  2AKW B;  1QJO A;  3G7L A;  1PTO C;  3VR2 A;  1Q12 A;  4OIJ A;  1L2F A;  3KLS A;  2JA7 G;  1HTL D;  3I70 A;  4ODG A;  5M5X H;  1LT4 D;  4JYA L;  1T9H A;  2QW7 A;  1KL9 A;  4BY1 G;  3I73 A;  3VYU A;  3G6E A;  4BBS H;  2YU9 H;  4B3T Q;  4KK7 A;  1NUC A;  4QUF A;  3PSI A;  2XWB B;  2ICE C;  2UU9 Q;  1H9K A;  3LGJ A;  1KLU D;  5IP9 G;  4FP5 D;  4LUO A;  5IGD A;  1NY4 A;  3VA7 A;  4HID A;  1PYS B;  3HZX A;  5LMN W;  1ICF B;  4A3E H;  3GTO B;  3VA5 A;  4EGV A;  3K58 A;  1I94 Q;  4QIW E;  3HOW H;  3HKZ G;  1KXL A;  3J80 E;  3HG9 A;  2NN6 G;  1SN8 A;  2D9U A;  2WFW A;  4A3D B;  3KJP A;  4A3F B;  1TKW B;  1L0W A;  4ULL A;  4AQY L;  2KBN A;  3GTJ B;  1FGU A;  3J7Z C;  3PUV A;  2BE5 D;  3NE5 B;  3RR5 A;  1PH4 A;  4JI0 L;  3QJY A;  4G7Z C;  3VYS A;  5AJ3 Q;  2UXC L;  5D14 A;  2N8N A;  1QZG A;  1HNX Q;  2UXD Q;  2IX3 A;  1HQR D;  2MPM A;  3DMU A;  3TP6 A;  4JI4 L;  4P74 A;  4IUV A;  5HGT A;  5C0X H;  1W6J A;  1GXD C;  1GUT A;  4DK1 A;  1YHA A;  3KF6 B;  3S1N B;  3W5O A;  4YHH Q;  3V05 A;  4J6H A;  4BS9 A;  4I7Z C;  2RKS A;  1S5E D;  1SE3 A;  4A3I B;  1LAC A;  1A3V A;  2WV6 D;  1G2T A;  2K5N A;  4C1N K;  3TBI B;  5LMN L;  1EWI A;  2OCE A;  1A63 A;  4JI8 Q;  5GAH C;  4EQP A;  4G7O C;  3BDL A;  5EKL A;  3UDF A;  3EFX D;  3STB C;  4A3F G;  4A3D G;  2NVQ B;  1Y14 B;  3F2C A;  3H6M A;  1U4R A;  2JJQ A;  1A2U A;  2R93 B;  1Y69 U;  5C4J H;  1E2W A;  2JA5 B;  1EU3 A;  4LW1 A;  4MHE A;  2LY7 A;  3D0F A;  2XNA C;  3KDF A;  4WJ4 A;  1CKO A;  5LMU L;  2JE6 I;  5KNC A;  2F3V A;  4DR3 L;  3BDO A;  4OGQ C;  1BO0 A;  2CQA A;  4CJ0 B;  4JI6 Q;  4DV2 L;  4L5R C;  1DJR D;  1BBW A;  2IW3 A;  1Q3L A;  3N52 A;  1W6K A;  4IPH A;  1PH5 A;  4N8X 1;  1EIG A;  1OXV A;  5KYL A;  2H1E A;  2B39 A;  2XN9 C;  1WTP A;  4KN4 C;  2MHV A;  3NQT A;  2O5J C;  2K33 A;  4YWL A;  4V19 0;  5IGG A;  3J81 i;  3CCU A;  4PNY A;  4A3B H;  1HUN A;  3PQI A;  2EDG A;  1SLJ A;  5J22 A;  1HR0 W;  2ASB A;  4OON A;  4A3E B;  2Z4I A;  4GKK L;  1H9J A;  1SE8 A;  1F9R A;  3S15 B;  1SJH D;  4LF9 L;  4CBV A;  1M90 C;  1MSG A;  1EFI D;  1HH2 P;  4LUZ A;  4APV A;  1H9S A;  5LL6 S;  2X6L A;  4I7A A;  4DAM A;  3RUZ A;  4ZKB B;  3HOX B;  3F1Z A;  4DV4 Q;  3RZO B;  4EQO A;  3NEN A;  1MGS A;  4GZY C;  3EVQ A;  5M5W H;  5GAD C;  1VQK A;  1FR3 A;  3R93 A;  1JE4 A;  1UE1 A;  2I07 B;  4KHP Q;  4DUZ Q;  3BS1 A;  3NHH A;  1K3R A;  1IZ6 A;  4DXG A;  4NDX A;  2UXB Q;  4DV6 Q;  4LF5 L;  3S17 H;  3CCS A;  4DPG A;  1ZKO A;  1AN8 A;  1HFG A;  2NVY B;  5EAY A;  4KY7 A;  1IYJ B;  1U4L A;  1V43 A;  4KY6 A;  4M1U B;  1XPU A;  1RHP A;  1IKL A;  2AHO B;  4DA2 A;  1SND A;  2KEE A;  3GO5 A;  5FO7 B;  1MIU A;  3HEJ A;  3KFU A;  4ID6 A;  5EKK A;  5FLX L;  4A3E G;  1F9Q A;  5D3I B;  2VQF L;  2OF1 A;  3QWN A;  3UE0 A;  1KC8 C;  5K36 G;  1YNJ C;  3KF6 A;  1X55 A;  2RQX A;  1HR0 L;  4BXX G;  2CW0 D;  2LSS A;  2IX0 A;  5DM6 3;  2D0O A;  4C3I H;  2R6G A;  2I5H A;  1PFS A;  1X32 A;  3URY A;  3HOX G;  1Y1V B;  3I4M H;  4L8J A;  3JC6 6;  4B9X A;  4DK0 A;  1KDC A;  1JWM D;  1H95 A;  2F0M A;  2KHS A;  3T53 B;  1BDO A;  1BBX C;  1ONL A;  4ZKC B;  1BKB A;  1TWA B;  1O7L A;  2JN4 A;  4JCV E;  1QVF A;  1NSN S;  2NZ1 D;  1A8V A;  3IRB A;  1HCZ A;  2PW7 A;  3CXC A;  1LTA D;  2KVM A;  4J8Q A;  5IIF A;  2B8G A;  5G3L F;  4NP5 A;  4L5S A;  2H5X A;  1Q82 C;  2Q8R E;  4FNF A;  5JEA J;  4C56 C;  1Q46 A;  1PA6 A;  1BF4 A;  4CGY B;  3K7A B;  2BE5 C;  3UI2 A;  5IT9 L;  4IUN A;  1IXR A;  1EY9 A;  2F0D A;  4KN7 C;  4X3S A;  1ENA A;  1K83 H;  1XJV A;  5CGK A;  4XT3 B;  2FMC A;  2WIN B;  5C3E H;  2FHT A;  4A3B B;  2F0H A;  1PTO F;  4DV5 L;  1GVP A;  2OXP A;  3IAY A;  3M3Y H;  1BNZ A;  5E3F A;  4A3L G;  2L0C A;  1STY A;  1K8M A;  3CD6 A;  3FHW A;  1CK1 A;  4IFD J;  1DOK A;  1S4Z A;  3CHB D;  3VYT A;  2E2I H;  4YCV A;  4X3K A;  1PH6 A;  1LYL A;  3T13 A;  5C4H A;  2PI2 A;  4GOP B;  1K0S A;  1B2T A;  1PRT F;  2WKC A;  3A74 A;  3T1H L;  4YY3 Q;  3T1Y Q;  1L0X B;  3EQL C;  3CPF A;  1TWC B;  2KCN A;  2YYZ A;  4YCW A;  1U0L A;  5E1F A;  2PPB C;  2HCI A;  4RKL A;  3AB9 A;  3CRK C;  2E2H B;  4JI7 L;  2I5L X;  2B2U A;  2EYF A;  5KEE A;  3S1R B;  5GAE C;  3Q0A A;  2IY5 B;  4A93 B;  3S2H H;  2R7Z B;  2FXQ A;  2N88 A;  3H0G B;  4RH6 A;  4JYA Q;  1E3P A;  4DN4 M;  1ROD A;  2HT1 A;  4R4O A;  3S1M B;  4WJ3 M;  2RSO A;  1P16 A;  1WCM H;  3DUZ A;  1VS0 A;  4QUC A;  2FFK B;  3U9O A;  1D2B A;  5D65 A;  5FLM H;  3GP7 A;  4GN3 B;  4R8N A;  4A3B G;  2MJ8 A;  5G3L D;  3W2D A;  5FLX c;  4YHH L;  1PH2 A;  3GTQ B;  5HGQ A;  1HNW L;  4CDD C;  2NB0 A;  3A7L A;  1LTS D;  1PFM A;  3PUX A;  1AH9 A;  3ICE A;  2WAQ E;  3U4Z A;  5I2X A;  3ER0 A;  1LO5 D;  2EYO A;  3QG1 A;  1HXY D;  4JBM A;  4UP8 A;  3HKS A;  3OOC A;  5IYB H;  2YTV A;  1PTO D;  3GTM H;  1Q1E A;  5KNB A;  3TQY A;  4AQY Q;  1V8Q A;  3G71 A;  3GTP H;  1LTG D;  3I3C A;  3QIA A;  4PMB A;  4IPD A;  4JI0 Q;  4A93 G;  3SDZ A;  4O42 A;  2KED A;  2R7Z G;  3SK5 A;  1Z9F A;  3H0G G;  2NUC A;  2UXC Q;  3FPP A;  3S16 H;  5ELN A;  3CCV A;  2CWA A;  1CKM A;  4A3K H;  1VQ4 A;  4PZ6 A;  5ELF A;  1C0A A;  1PRT D;  2BH2 A;  4C3H B;  3A54 A;  2QDL A;  2R61 A;  4MZ9 A;  3J7A 5;  1EEI D;  4EVO A;  2Z4H A;  1G6Z A;  1QWY A;  1B9N A;  1ASZ A;  1LTT D;  4K6D A;  5IT9 c;  1EYC A;  1ET6 A;  3TZU A;  1PH8 A;  4IUR A;  4ZK9 B;  2Z6K A;  3E9H A;  3RN5 A;  4X65 L;  1S5D D;  2Q2I A;  4U67 3;  2F1M A;  1QUQ B;  3UDG A;  4MTN A;  5C3E B;  4C2M B;  4B3S Q;  4HJ8 A;  1WOC A;  2XRQ D;  2CKZ B;  2B2V A;  3SXH A;  3I4L A;  1MJE A;  4C3I G;  4BY7 H;  2KCC A;  5EPJ A;  1WTV A;  1EZ8 A;  5IP9 H;  4X6A H;  1EOT A;  5LMN Q;  2K03 A;  3J7Y W;  1JWU D;  1VMC A;  3A7A B;  4ILW A;  4GNX B;  3OIP A;  1WTW A;  1B8A A;  4A75 A;  1SSO A;  2CHB D;  2RSN A;  4BBR B;  3TN2 A;  2NWG A;  1C9O A;  2PI2 E;  2WB1 E;  1PV4 A;  1WTX A;  2PMZ E;  1C4Q A;  4DNT B;  1F9S A;  3UDI A;  2KEC A;  2NN6 H;  5LMU Q;  4DR3 Q;  3S2H B;  4DV0 L;  4KHP L;  4DV2 Q;  1LTB D;  1Y8P B;  3ULJ A;  3M7G A;  2GVA A;  4JBW A;  1AW7 A;  1PYB A;  1LT6 D;  1RCV D;  1TWG B;  4ZUJ A;  3TS2 A;  3ULP A;  3S2D B;  5CV5 A;  2JA8 B;  1Y8O B;  5C3E G;  4X64 L;  1ZYR D;  2ZXR A;  4CKB A;  4CKE A;  5E4W C;  2BA0 A;  1F2M A;  4XQJ A;  2Q2T A;  1X56 A;  1U4M A;  3OHX C;  1N33 L;  3Q22 A;  1EWH A;  1E7Z A;  2CQO A;  2GN5 A;  4IUU A;  4LF7 L;  2Q8I B;  1CTM A;  3ZYY X;  4NPS A;  4JV5 L;  4JOI C;  3JAM i;  2F0P A;  4LF9 Q;  2CH4 W;  4PV1 C;  2RDH A;  4KY5 A;  4ZRZ A;  1VF7 A;  1SNO A;  2RDG A;  3GTO H;  4BBR G;  1F9P A;  2F4I A;  1JMC A;  1X65 A;  1SYE A;  3E0J A;  2E74 C;  2L9H A;  1YVC A;  1ESR A;  3TME A;  2A73 B;  1YJ9 A;  1I4Q A;  4ZUI A;  4RKB A;  4A3F H;  1KD1 C;  2BA1 A;  1JOK A;  4GKJ L;  4RWS C;  2A68 C;  3PO3 B;  3GTJ H;  2Y0S G;  4DR2 Q;  3X3M A;  4DR4 Q;  1CSP A;  3K59 A;  1WCM G;  2IWH A;  1R9T B;  4K2L A;  5I4D A;  5A2Q L;  4HIO A;  3K80 C;  1EY4 A;  1UE6 A;  4B9W A;  1H9R A;  3PUW A;  3CF5 A;  1PDQ A;  2K01 A;  2JA8 G;  1C48 A;  2DN8 A;  3I8Z A;  1I3Q B;  1V1O A;  2MFI A;  3UDX A;  3CCE A;  1GHK A;  4IOA A;  1RJT A;  3AFP A;  5I6Y A;  3J81 E;  3NEM A;  4L6T B;  3S1N H;  2GVB A;  2B2W A;  2OT2 A;  4ABN A;  3SR1 A;  3GTK B;  3NSW A;  3DWA A;  3PIP 3;  5C44 B;  3P20 A;  4GLX A;  1VQH A;  2VXW A;  2NTS A;  2VQF Q;  4E6I A;  5IYB G;  3W1B A;  3M7N A;  1CM9 A;  5EBC A;  4A3I H;  2Z1C A;  1HR0 Q;  5FLX E;  1QUQ A;  2KUM A;  3E6Z X;  3VDY A;  1ENC A;  5BR8 Q;  3SGI A;  3TP8 A;  1ZEQ X;  4JW0 A;  3I4N B;  1I4P A;  1O7I A;  2NVQ H;  4OEM B;  4A4I A;  3PO3 G;  1N32 L;  2R93 H;  3PMF A;  4S3S A;  3OYY A;  1WJJ A;  1UAP A;  3RNU A;  4YY3 L;  3RMH A;  2JA5 H;  2F0K A;  4NW2 A;  4GNX A;  4CDE C;  1N8R C;  2IX1 A;  3T16 A;  1JWS D;  4MTK A;  2NVT B;  4R4Q A;  1TR5 A;  2ZJR A;  3RLN A;  4OWW B;  3UE1 A;  3MWY W;  1ILP A;  1TVX A;  4DU9 A;  5IGE A;  1YNJ D;  2EY6 A;  5BN5 A;  1PTO B;  2Z8L A;  4JC0 A;  3TEH B;  4PQX A;  2PNH A;  1RTN A;  4POG A;  3TSS A;  5C44 G;  2ZTC A;  4ZLT F;  2K14 A;  1PVO A;  1Z6H A;  3S14 B;  3M4P A;  4BY7 G;  3Q8D A;  5E7N A;  1PRT C;  2EXD A;  1KLG D;  4DV5 Q;  1I6V C;  4QY7 A;  4DAP A;  2J0T D;  3PIP A;  1BBU A;  5J3B A;  3B6Y A;  5IE8 A;  3X3N A;  2JK8 A;  4OO1 I;  1JT8 A;  1PRT B;  4H02 A;  5COR A;  2F0L A;  2EYL A;  1ILQ A;  4NXN L;  4DKA C;  3I4N G;  4L5Q A;  5K36 H;  4DK6 C;  3G48 A;  4H7B A;  2VB2 X;  5ELE A;  5M3F B;  1IBL L;  3L0O A;  3S15 H;  3HOU B;  5IY0 A;  3I91 A;  4BXX H;  5D3D A;  4KHZ A;  2WAC A;  3D8G A;  3T1H Q;  4YWM A;  4IAL A;  2NZO A;  2SEB D;  3HOX H;  1UUP A;  4XDX A;  1VQJ A;  1SR3 A;  3RZO H;  2AUK A;  2QEJ C;  3LWE A;  4JI7 Q;  5C4X H;  1VQO A;  2GA4 B;  5FJ8 G;  2XIW A;  4JPB W;  4XTC S;  3GTG H;  1SRO A;  2D62 A;  4DR5 L;  3TS0 A;  4ME3 A;  3I2Z A;  3NBH B;  1J6Q A;  3SEB A;  4M8A A;  1QIL A;  5CBA E;  1KRT A;  3S1Q B;  2NVY H;  1VMP A;  3CME A;  3JAM c;  3C1E A;  3OW7 A;  3GD7 A;  3M4O H;  1HNW Q;  4N9P A;  1GUG A;  1XPO A;  2A6E D;  1IYU A;  1VQ5 A;  2QF7 A;  4B3S L;  4JK1 C;  4IFD I;  5H1S E;  1ZXT A;  3H91 A;  1VQF A;  1PFB A;  2RDF A;  4TRD A;  1YNN C;  5M3F G;  1VQN A;  3I72 A;  4PMW A;  5M5Y B;  2MP1 A;  1NNX A;  3CW2 C;  1ZYR C;  3EA6 A;  4R4T A;  4WRD A;  3HOU G;  1L0Y B;  5CV8 A;  4AYB B;  1EUJ A;  5FO8 B;  4OXP A;  2N3S A;  2K50 A;  3MHB A;  4O2D A;  3NUC A;  4WFN 3;  3WDN A;  4A3L H;  1MJC A;  1TY0 A;  3H3V H;  4UP7 A;  4IZ8 A;  1B3A A;  3DM1 A;  4DV1 Q;  1Y1V H;  2A6H C;  5C5M A;  1ET9 A;  1TWH B;  4HCE A;  1AZQ A;  4J15 A;  2K52 A;  2HHH L;  1KTK A;  1YHB A;  1TWA H;  1Q81 C;  1GUW A;  3MA2 B;  4FO2 A;  2F0V A;  4JBJ A;  3C46 A;  1P8L A;  4X66 L;  2ZJP A;  2QA4 A;  2DY8 A;  2DGY A;  3A0J A;  1VQP A;  1E2V A;  4XQQ A;  2O5I C;  1PH7 A;  4CHT B;  4X65 Q;  3IFT A;  2CCZ A;  2N78 A;  3K7A H;  4Y52 H;  5CV6 A;  4RGO S;  5IGB A;  4A3I G;  4QF4 A;  5DLQ E;  4GLA C;  2A19 A;  4CKC A;  5GAG C;  1VQM A;  1XMO L;  2E5L Q;  3OSO A;  2F3W A;  4AYB G;  3M85 A;  5C0X J;  4K6L A;  3K6O A;  5EGT A;  4OIK A;  3FKI B;  2CH4 A;  5J39 A;  4OL7 A;  1FNW A;  2R7D A;  2F0F A;  2R93 G;  1UNS A;  1IL2 A;  2JSO A;  1AZP A;  1LAB A;  2DY7 A;  4O1N A;  4DAY B;  1YJW A;  3QO2 A;  1JQY D;  2XSC A;  1VQL A;  2JA5 G;  2N55 A;  2KHJ A;  4A3M B;  5JJI A;  2XWJ B;  1I4R A;  4IN3 A;  2JQO A;  3I7F A;  5NUC A;  4C3J B;  1TWC H;  2EZV A;  5C4X B;  2ZJQ A;  2JEA I;  1GUO A;  4DV0 Q;  2M2L A;  2BDN A;  2E2H H;  2CWP A;  1I50 B;  1QNK A;  2SOB A;  4KLK A;  4EQN A;  4DR2 L;  3S1R H;  3GTG B;  4DR4 L;  3MEF A;  2F0G A;  4A93 H;  2R7F A;  4LAA A;  2R7Z H;  1SE4 A;  2FJ2 A;  2G9H D;  3H0G H;  2K5V A;  4H44 C;  1V1P B;  3S1M H;  1MKH A;  2A8V A;  1EIH A;  4KD4 A;  5EJW A;  4TSS A;  3GTL B;  1DM0 B;  4X64 Q;  4Q5V A;  3KOJ A;  1EQT A;  1KDB A;  3KUP A;  3WOF A;  5JJK A;  3K5M A;  3M4O B;  1KAA A;  1SYB A;  3BJU A;  3L2P A;  3VR5 A;  1N33 Q;  1Y1W B;  2ALY B;  3GTQ H;  4LF7 Q;  1QE6 A;  3NBH A; 
#chains in the Genus database with same CATH homology
 3HKS A;  5IYB H;  5JJL A;  3G4S A;  1A0I A;  2BH8 A;  3KF8 B;  2YTV A;  4JI3 Q;  1Q86 C;  4JV5 Q;  4JG2 A;  4A3D H;  1Y1W H;  3GTM H;  4BA1 I;  3EBE A;  2ZTE A;  1Q1E A;  4P72 A;  4POF A;  1OXT A;  1HNZ L;  4OWX B;  1RL2 A;  3TQY A;  4P73 A;  4A3J H;  1XNR L;  5BR8 L;  4AQY Q;  1U5K A;  4P75 A;  3G71 A;  4A3M G;  4O0A A;  3GTP H;  2N49 A;  1K8G A;  3CCR A;  2VNU D;  5IYC G;  1KAW A;  1D7Q A;  2IHF A;  1JE5 A;  1E1O A;  4IPD A;  4JI0 Q;  4A93 G;  3HFZ B;  4LF5 Q;  1V9P A;  3HOV G;  2R7Z G;  1Z9F A;  3H0G G;  5FLM G;  2UXC Q;  1X3E A;  3S16 H;  1W3S A;  1EIF A;  1SMX A;  5ELN A;  1NBW A;  4XIG S;  5IWA L;  4HJ5 A;  2MQH A;  4IJL A;  3CCV A;  4GKJ Q;  5IP7 H;  2CWA A;  1CKM A;  4A3K H;  1VQ4 A;  4PZ6 A;  1EFW A;  1UE7 A;  1EOV A;  1C0A A;  1N36 Q;  5GQO A;  2BH2 A;  3J7A 5;  4MZ9 A;  3CP0 A;  4QJF A;  1SFO H;  2ZM6 L;  2AMC B;  2OTJ A;  1DGS A;  4ALP A;  1JJC B;  5IT9 c;  1JB7 A;  2RF4 A;  1ASZ A;  4DR6 L;  4A76 A;  3PV0 A;  2LXK A;  1PH8 A;  4JI2 L;  3HOZ G;  2Z6K A;  3E9H A;  2HIV A;  3RN5 A;  3I4O A;  3CCQ A;  1Q8K A;  2I5M X;  4X65 L;  2DUD A;  4C3H H;  2Q2I A;  2R92 H;  1YEZ A;  1QUQ B;  3TRE A;  1HZ9 A;  3UDG A;  2ZTD A;  4MTN A;  3F2B A;  1V1Q A;  4R4I A;  4B3S Q;  2VUM H;  3H3V I;  4HJ8 A;  1WOC A;  3HKZ E;  3BZK A;  4DUY L;  3U50 C;  4B3M L;  2CKZ B;  4BA2 I;  4IPC A;  1N34 L;  1MJE A;  4A3J G;  1G51 A;  3CMA A;  4BY7 H;  3KDF B;  4A3G H;  1E24 A;  4GN5 A;  5IP9 H;  3D31 A;  4X6A H;  4LF4 L;  4C2M H;  5LMN Q;  1CKN A;  3OTO Q;  1VQB A;  2PQA B;  1VQI A;  1VQC A;  1L1O A;  3ULL A;  3I55 A;  1YHQ A;  4GNX B;  1NE3 A;  2UUC L;  1OXS C;  4DK3 C;  2JA6 G;  2WAQ G;  5IP7 G;  4PZ8 A;  1B8A A;  1G29 1;  4DV3 Q;  5IYD G;  4A75 A;  3T1Y L;  4A3K G;  1IBM L;  2KCT A;  2OQ0 A;  1X54 A;  1FL0 A;  1Y1V G;  3RZD H;  1HZC A;  2Y0S E;  4NB3 A;  1G6P A;  2L15 A;  3M4Q A;  4NXM L;  3DLL A;  1JJG A;  1C9O A;  2AKW B;  2PI2 E;  2WB1 E;  4QGU A;  2PMZ E;  1PV4 A;  2UUA Q;  4GLV B;  4JI5 Q;  3UDI A;  1Q12 A;  5ELO A;  4AH6 A;  1N32 Q;  2JA7 G;  1L2F A;  1J5E L;  5LMU Q;  5M5X H;  4JYA L;  1NMG A;  3PF4 A;  4LF6 Q;  1X3F A;  4DR3 Q;  4DV0 L;  1T9H A;  4BBR H;  2F4V Q;  4KHP L;  1KL9 A;  4BY1 G;  4MNO A;  4DV2 Q;  2VUM G;  3ULJ A;  2GVA A;  4JBW A;  3G6E A;  4BBS H;  3RLO A;  1VQE A;  1PYB A;  4R4C A;  1B70 B;  2YU9 H;  4B3T Q;  3PSI A;  3U58 A;  3ULP A;  2QGQ A;  4UP9 A;  3TS2 A;  3CQZ H;  4A3G G;  2UU9 Q;  3LGJ A;  5IP9 G;  5C3E G;  4X64 L;  1Q1B A;  2D0P A;  4PG3 A;  2NN6 I;  4LUO A;  2BA0 A;  1X3G A;  2Q2T A;  1X56 A;  1IBK L;  4DV7 Q;  2JEB I;  1NY4 A;  1TWG H;  1N33 L;  3S2D H;  1HJP A;  4B3R Q;  1E7Z A;  2CQO A;  2UUB L;  4HID A;  2JA8 H;  3NEL A;  1PYS B;  2GN5 A;  1VQD A;  5LMN W;  4LF7 L;  4A3E H;  3PF5 A;  3CCL A;  4LFC Q;  4LWC A;  2V1C C;  2HIX A;  3RN2 A;  2EQS A;  1YBY A;  2F3I A;  5GRO A;  4Y7N H;  1I94 Q;  4QIW E;  4NPS A;  4JI3 L;  3HOW H;  4JV5 L;  4JOI C;  1K73 C;  1KHI A;  2K5H A;  3HKZ G;  3JAM i;  1KQS A;  1S3O A;  4LNQ A;  4LF9 Q;  1SRU A;  1KXL A;  2NN6 G;  1SN8 A;  2WFW A;  3KJP A;  3GTO H;  4QL5 A;  1L0W A;  4BBR G;  4AQY L;  2KBN A;  1QVC A;  4NXN Q;  1JMC A;  1X65 A;  1FGU A;  3J7Z C;  3PUV A;  1IBL Q;  4BBS G;  1YVC A;  2RCN A;  3RR5 A;  1PH4 A;  4RMF A;  1NMF A;  2E2J H;  3FKI G;  4JI0 L;  1XNQ Q;  3K7U C;  1YJ9 A;  1LM0 A;  5AJ3 Q;  4HJ7 A;  2UXC L;  4LFA Q;  1TXY A;  4A3F H;  1KD1 C;  2BA1 A;  2N8N A;  1QZG A;  1HNX Q;  4GKJ L;  2UXD Q;  3AQQ A;  2AWO A;  3GTJ H;  4DV1 L;  1N36 L;  4P74 A;  2Y0S G;  4DR2 Q;  4JI4 L;  4DR4 Q;  1CSP A;  1WCM G;  4HIO A;  2WB1 G;  3K80 C;  1UE6 A;  3A5Z B;  3PUW A;  2K75 A;  3WWV A;  3CF5 A;  4L5T A;  1YHA A;  3PO3 H;  3KF6 B;  2JA8 G;  4HIM A;  3W5O A;  4JBK A;  4LF8 L;  2OTL A;  4JI1 Q;  4YHH Q;  5JEA G;  2MFI A;  3UDX A;  1R9T H;  2OWO A;  3CPW A;  3CCE A;  3HOW G;  4DR5 Q;  4IOA A;  1GD7 A;  3AFP A;  1BVS A;  3NEM A;  1XMQ Q;  3AFQ A;  3S1N H;  2GVB A;  1UE5 A;  4R1J A;  1PH9 A;  1I3Q H;  5LMN L;  4OX9 Q;  4HJ9 A;  4DR7 Q;  2K5N A;  1LUZ A;  4X62 Q;  4GLX A;  1VQH A;  2AWN A;  3CAM A;  2Z6K C;  1EWI A;  5IYB G;  3W1B A;  3OTO L;  3PUY A;  2EIF A;  2OCE A;  2VQF Q;  1S72 A;  3M7N A;  1A63 A;  4JI8 Q;  5GAH C;  4A3I H;  1HR0 Q;  4TQU S;  4OWT B;  1A62 A;  3UDF A;  2IHE A;  3STB C;  3GTK H;  4A3F G;  4A3D G;  3ERS X;  1Y1W G;  1Y14 B;  2YTX A;  3F8T A;  2IT1 A;  3F2C A;  1QUQ A;  2JJQ A;  5C44 H;  4DV3 L;  3J80 i;  3VDY A;  5BR8 Q;  1C7Y A;  1TWF H;  3SGI A;  5C4J H;  3BZC A;  2E5L L;  2ES2 A;  5C0X G;  4DR1 Q;  1S40 A;  4LW1 A;  1O7I A;  2NVQ H;  2UUA L;  3CC4 A;  3D0F A;  4A4I A;  3KDF A;  5IWA Q;  1VQ8 A;  3PO3 G;  1N32 L;  2R93 H;  4WJ4 A;  1FVI A;  1CKO A;  3OYY A;  5LMU L;  2JE6 I;  1RIP A;  1L1O C;  1AE3 A;  1WJJ A;  2PQA A;  4DR3 L;  4YY3 L;  3RNU A;  2JA5 H;  1M1K C;  4LF6 L;  2F4V L;  3KLW A;  4JI6 Q;  3I4N H;  4L5R C;  4DV2 L;  4GNX A;  1VQG A;  3PO2 H;  1BBW A;  1N8R C;  2IX1 A;  4LFB Q;  4DR6 Q;  4B3T L;  3PUZ A;  4R4Q A;  2HHH Q;  4IPH A;  1PH5 A;  3L7Z C;  1L1O B;  5HY6 A;  2ZJR A;  1OXV A;  3RLN A;  3KJO A;  3UE1 A;  1W2B A;  1VQ9 A;  4OWW B;  4UY8 C;  2UU9 L;  2VQE L;  2R92 G;  4IOC A;  1HZA A;  1EYG A;  2ID0 A;  4GOP A;  3HOY H;  1JJ2 A;  4YWL A;  2NVT H;  4X66 Q;  4JC0 A;  3TEH B;  4GOP C;  4DV7 L;  3J81 i;  2PNH A;  4POG A;  3CCU A;  5FJ8 H;  1X6O A;  5C44 G;  1K8A C;  4EQ5 A;  2ZTC A;  4IJH A;  2K14 A;  4A3B H;  1PVO A;  4LFC L;  2YTY A;  1SLJ A;  3M4P A;  1I5F A;  1Z47 A;  3Q8D A;  3CC7 A;  4BY7 G;  1LTL A;  5E7N A;  2EXD A;  1HR0 W;  2ASB A;  2ATW A;  4OON A;  4DV5 Q;  3KYH C;  1I94 L;  4GKK L;  4QY7 A;  3PGZ A;  1SE8 A;  4UPA A;  3PIP A;  1BBU A;  5J3B A;  4EX5 A;  3B6Y A;  4LF9 L;  4UP8 A;  5IE8 A;  4OO1 I;  2JK8 A;  1M90 C;  3S14 H;  1KIX A;  1JT8 A;  1HH2 P;  4H02 A;  4LUZ A;  4APV A;  1XMO Q;  1N9W A;  3I4N G;  4NXN L;  4DKA C;  2Q2H A;  4L5Q A;  1OTC A;  4DK6 C;  3G48 A;  1IBL L;  4DAM A;  3F1Z A;  4DV4 Q;  1XNQ L;  3L0O A;  3S15 H;  5IY0 A;  4BXX H;  5AJ3 L;  4IPG A;  1J5E Q;  1YI2 A;  4LFA L;  1WFQ A;  3NEN A;  4KHZ A;  4DNI A;  4A3C H;  5M5W H;  1QZH A;  1HNX L;  3J81 c;  2F52 A;  5GAD C;  3T1H Q;  1VQK A;  2UXD L;  1UE1 A;  4YWM A;  1XTD A;  4KHP Q;  3U4V A;  4DUZ Q;  3E9I A;  5M3F H;  2NZO A;  4YCU A;  1K3R A;  3HOX H;  4OO1 G;  1IZ6 A;  1VQJ A;  1SR3 A;  3RZO H;  3HOU H;  3CCJ A;  4JI7 Q;  4K0K Q;  2UXB Q;  4DV6 Q;  5C4X H;  1VQO A;  5FJ8 G;  4LF5 L;  3S17 H;  3CCS A;  4DPG A;  4XTC S;  2RHQ B;  2VL6 A;  4JI1 L;  2B3G A;  5EAY A;  3GTG H;  1ASY A;  1SRO A;  1VCI A;  1IYJ B;  2B63 H;  2D62 A;  1V43 A;  4HJA A;  2LXJ A;  3FP9 A;  4PZ7 A;  4DR5 L;  3TS0 A;  4ME3 A;  1XMQ L;  3I2Z A;  1XPU A;  2VZA A;  3NBH B;  1J6Q A;  2AHO B;  2QEX A;  3HOZ H;  3GO5 A;  1FJG Q;  2E8G A;  1KRT A;  1CSQ A;  2NVY H;  3CCM A;  1MIU A;  3CME A;  3JAM c;  4OX9 L;  3PIO A;  4DR7 L;  3KFU A;  4X62 L;  3GD7 A;  4A3E G;  3M4O H;  1EIY B;  1HNW Q;  4AYB E;  2VQF L;  5K36 G;  3UE0 A;  1XPO A;  1KC8 C;  1PHJ A;  3KF6 A;  1X55 A;  4JI8 L;  3AEV A;  1HR0 L;  4BXX G;  1VQ5 A;  1X9N A;  4B3S L;  3PCO B;  3S1Q H;  1VQ7 A;  4IFD I;  2LSS A;  5H1S E;  4A3C G;  4AIM A;  2MNA A;  2IX0 A;  1VQF A;  2D0O A;  4C3I H;  5C0X I;  2R6G A;  2I5H A;  1PFS A;  5M3F G;  2VY3 A;  4PMW A;  1VQN A;  3HOX G;  2NVX H;  3I4M H;  4DR1 L;  4R4T A;  2CFM A;  3CW2 C;  3JC6 6;  3HOU G;  1EUJ A;  4OXP A;  2N3S A;  1K9M C;  3J81 j;  3CC2 A;  2K50 A;  4O2D A;  1H95 A;  2MO1 A;  2JA6 H;  4A3L H;  1B7Y B;  1MJC A;  2Q2U A;  1E1T A;  3H3V H;  4UP7 A;  5IYD H;  2Z0S A;  1HNZ Q;  1BKB A;  4GN4 B;  3EIV A;  5M5Y H;  1Y1V H;  3ZJY C;  4DV1 Q;  4JI4 Q;  1XNR Q;  4JCV E;  1QVF A;  2B63 G;  4IFD G;  3EN2 A;  4JI6 L;  1A8V A;  3IRB A;  4LFB L;  5M3M H;  4LUV A;  3CXC A;  4J15 A;  3OW2 A;  2K52 A;  2JA7 H;  5C4X G;  2HHH L;  2WP8 J;  4JI5 L;  4LF8 Q;  4L5S A;  1YHB A;  1TWA H;  2H5X A;  1Q82 C;  3AYH B;  1Q81 C;  5JEA J;  3W1G A;  1PH1 A;  1HZB A;  1Q46 A;  4JBJ A;  1PA6 A;  1PH3 A;  1P8L A;  1TWH H;  4BY1 H;  2C35 B;  1VQA A;  1YJN A;  3MXN B;  3TRZ A;  4X66 L;  2ZJP A;  2QA4 A;  1CUK A;  2ZM6 Q;  2DGY A;  3A0J A;  1VQP A;  4IO9 A;  1CKN B;  1IXR A;  4GNX C;  2MO0 A;  4JI2 Q;  2I0Q A;  1K83 H;  1XJV A;  1PH7 A;  1UWV A;  1E22 A;  1EQR A;  5C3E H;  4YWK A;  4X65 Q;  2KEN A;  2N78 A;  3K7A H;  2CCZ A;  3I4M G;  4Y52 H;  3J80 c;  1NJI C;  4RG1 A;  4DV5 L;  2OQK A;  1GVP A;  4FDB A;  3DM3 A;  3A5U A;  1D8L A;  3BU2 A;  4A3I G;  2NZH A;  4DUY Q;  3M3Y H;  4B3M Q;  4A3L G;  5DLQ E;  4GLA C;  3CD6 A;  3RLF A;  3FHW A;  4B3R L;  2A19 A;  4IFD J;  3K8A A;  1N34 Q;  5GAG C;  1XPR A;  1VQM A;  1GKH A;  1XMO L;  1GM5 A;  2E5L Q;  2A1A A;  4AYB G;  3M85 A;  2E2I H;  5C0X J;  4LF4 Q;  4YCV A;  1PH6 A;  1LYL A;  2VS1 A;  5M3M G;  2KHI A;  4DV4 L;  2PI2 A;  4GOP B;  1I6H H;  2K4K A;  2UUC Q;  1WYD A;  2R7D A;  3K0X A;  2KCM A;  2R93 G;  3A74 A;  3T1H L;  2YV5 A;  1IL2 A;  4YY3 Q;  3T1Y Q;  1YJW A;  4DAY B;  1IBM Q;  1VQL A;  4DUZ L;  3CPF A;  2YYZ A;  4YCW A;  1QVG A;  1U0L A;  2JA5 G;  2KHJ A;  1UEB A;  4NXM Q;  3PO2 G;  3FKI H;  4JI7 L;  2I5L X;  1OXU A;  4K0K L;  2XGT A;  5JJI A;  4P71 A;  5GAE C;  2UXB L;  4DV6 L;  2IY5 B;  2JA9 A;  3S2H H;  3I56 A;  4GS3 A;  2JQO A;  2FXQ A;  3I7F A;  1TWC H;  4JYA Q;  1E3P A;  2VQE Q;  1YNX A;  2ZJQ A;  2HT1 A;  4R4O A;  2HQL A;  2JEA I;  1YZ6 A;  4DV0 Q;  1VQ6 A;  4QQB X;  4A3M H;  2E2H H;  2CWP A;  2B29 A;  1P16 A;  1WCM H;  4WJ3 M;  3HOY G;  4KLK A;  2VW9 A;  1K0R A;  5IYC H;  4DR2 L;  3S1R H;  4DR4 L;  3MEF A;  1VS0 A;  3STB D;  4A93 H;  2R7F A;  3HOV H;  2R7Z H;  1FJG L;  4C3J H;  3H0G H;  5FLM H;  1AE2 A;  2K5V A;  3F2D A;  4HIK A;  1EQQ A;  4GN3 B;  3S1M H;  1MKH A;  4JOI A;  1PH2 A;  2A8V A;  1I50 H;  5FLX c;  4YHH L;  4A3B G;  1HNW L;  5HGQ A;  1NTG A;  4X64 Q;  4GKK Q;  1YIT A;  3KOJ A;  1GO3 E;  2RHS B;  1KRS A;  5JJK A;  1WI5 A;  2XTI A;  4TVA B;  3PUX A;  3H15 A;  3BJU A;  3L2P A;  1IBK Q;  3K81 C;  1N33 Q;  1OXX K;  1Q7Y C;  3GDE A;  3ICE A;  2WAQ E;  1YIJ A;  3U4Z A;  1AH9 A;  3E0E A;  2UUB Q;  2ALY B;  3GTQ H;  3ER0 A;  4LF7 Q;  4JBM A;  3GTL H;  3M9B A;  4KI0 A;  3S24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...