1HR0Q

Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Crystal structure of an initiation factor bound to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Escherichia coli
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hr0Q00
1P16A 4DV6L 2PQAA 4DUYQ 2R92H 1U5KA 4GNXC 4DNIA 3NENA 1NBWA 1N32L 4B3SL 2JJQA 3I4OA 3HKSA 4KLKA 5GAHC 4IFDJ 4EX5A 4A3EG 4DUYL 4LFCQ 1WCMG 2VQEL 4JOIA 2WAQE 4KI0A 4A76A 3MXNB 3EBEA 4L5RC 2LXJA 5IP7G 3HOXG 2A8VA 1N36Q 5ELOA 1SE8A 3J81j 2QEXA 1NY4A 2C35B 1IBMQ 1Q12A 3SGIA 1L1OC 4LFAQ 1EUJA 4LFCL 3GTJH 4AYBE 1XJVA 3CD6A 1SROA 5JJLA 2HHHQ 4A3BG 2N3SA 1PHJA 3HOVG 5M5XH 5EAYA 2PQAB 4Y52H 3CMAA 4GNXA 4A3MG 1IBML 5FJ8G 3GTQH 4LFAL 1RL2A 2R6GA 4KHZA 2R93G 2K5HA 2MFIA 1X3FA 4K0KQ 1PH8A 4R4CA 3KF8B 3M4QA 1VQOA 2HHHL 2WAQG 1NE3A 4C3IH 4JI7Q 1KXLA 3ZJYC 2UXBQ 2JA6G 5H1SE 2CWAA 4JI3Q 3CPWA 1Y1VH 2A1AA 2AHOB 4IFDI 1VQAA 3M9BA 3CQZH 1Q1BA 5LMNW 4K0KL 4IFDG 2DUDA 5ELNA 4AYBG 3EIVA 4JI7L 3HOYG 2Y0SG 1VQHA 1L2FA 5C44H 1UE5A 5IYCH 2RF4A 3ULPA 2UXBL 2KCTA 3KJPA 4JI3L 1WI5A 2E8GA 1HR0W 5K36G 1O7IA 4B3TQ 3OTOQ 2JA8H 4GNXB 2ASBA 2OCEA 4A3FG 4YWKA 2K5VA 2WB1E 4BBRG 1PH2A 4IJHA 1YIJA 3A74A 3UDGA 3KF6B 4B3TL 2NVXH 3F1ZA 3OTOL 3M4OH 5M5WH 4NB3A 1XNQQ 3JAMi 2BH2A 4OO1G 2PMZE 1X3GA 3PO3G 3B6YA 1FL0A 4R4TA 5JEAJ 3H0GG 1K73C 3RZOH 5JJKA 2LSSA 2NN6I 3CC4A 1QUQA 1KIXA 2YV5A 4J15A 2R7FA 1PA6A 1QVFA 1XNQL 3I4NH 1MJCA 2R7ZG 3ULJA 1I6HH 1VS0A 2WFWA 1KC8C 2WB1G 5C4XH 2AWOA 2UU9Q 2I0QA 3U58A 5IYDH 1K3RA 3PIPA 4HJ5A 2HIVA 4GKKQ 4QIWE 5HGQA 2YTVA 1IYJB 2RHQB 4P75A 1UE6A 2ALYB 4YCUA 5GAGC 2NZOA 2UU9L 1A0IA 2K14A 2VUMH 4GN5A 4GKKL 2NVYH 1W3SA 3K7AH 4A3GH 1WFQA 1QUQB 3D31A 4JC0A 4PZ8A 3UDXA 1Q46A 1VQIA 3PUYA 5JEAG 3S16H 1GO3E 2K50A 3UDIA 1TWFH 3KDFA 4BA1I 4A3KG 1C0AA 4XTCS 1H95A 1PV4A 3E9IA 3JC66 2V1CC 4P73A 1B7YB 4DV2Q 1K83H 2Q2TA 1VQLA 1V43A 1VQPA 3JAMc 3GTGH 3F2DA 4DR3Q 4UP9A 3M85A 2UUAQ 2E2IH 1EYGA 2JA5H 3HOWG 1HNWQ 4NXMQ 2N49A 2PI2E 1I3QH 1BVSA 5GADC 4DV2L 2D62A 4JI1Q 3WWVA 5LMUQ 4DR3L 2UUAL 1R9TH 3M4PA 1HNWL 2QGQA 4NXML 5C3EG 4JBMA 2CKZB 3KDFB 3FHWA 5GQOA 4A3EH 1Z47A 5GROA 4JI1L 4PZ6A 1WCMH 2VY3A 5LMUL 3HOUG 2HQLA 3RLNA 3CCVA 4LF5Q 1LM0A 4YHHQ 5IP7H 3HOXH 4JI4Q 1HNZQ 3RZDH 1CUKA 2KCMA 3W5OA 1ASZA 1XPUA 3NELA 3HOZG 2NZHA 2CWPA 4IOCA 1X55A 1K8AC 1VQMA 4GKJQ 4LF5L 4YHHL 3HOVH 4LUZA 4JI4L 4IOAA 2I5HA 4MNOA 4A3MH 5FJ8H 1VQJA 3VDYA 1CKOA 4JI0Q 1NMFA 2R93H 2VZAA 4EQ5A 4YCWA 4GKJL 4TQUS 2JA9A 1PVOA 2ES2A 1G51A 4GLAC 1FGUA 3RLOA 2B63G 2JA6H 2CCZA 3I56A 4JI0L 4DV7Q 3S1QH 1PH6A 3TQYA 2VW9A 2ZJRA 2I5LX 3HOYH 1KAWA 5C0XI 4JYAQ 2CQOA 2H5XA 2YTYA 3PIOA 3S1MH 3HFZB 1YEZA 4UPAA 3K0XA 1EOVA 4HIOA 4DV7L 1XNRQ 1D8LA 4LUOA 3OW2A 4R4QA 3RLFA 4A4IA 3CCUA 4BBSG 4JYAL 4HIDA 1ASYA 4DK3C 3KJOA 3LGJA 4A3FH 1VQ7A 1E7ZA 4BBRH 3PUVA 2MQHA 4JBJA 1XMQQ 1XNRL 1HZBA 1K8GA 1OXXK 1YITA 4RMFA 4H02A 2Y0SE 3U4ZA 3PO3H 2E2HH 4AIMA 1IXRA 4WJ4A 3H0GH 1N36L 1XMQL 2NVQH 3GDEA 4A3DG 4C3HH 4B3RL 4L5QA 1VQEA 4POFA 4DR2Q 1X9NA 2R7ZH 3J7A5 3NEMA 4YWMA 5DLQE 4A3LG 2EQSA 1SLJA 3K8AA 4X64Q 1JJCB 4GN4B 2VNUD 2IX1A 3I7FA 2IX0A 3D0FA 1L1OA 3UE0A 4YY3Q 3L2PA 4DR2L 2GVAA 5FLMG 4AQYQ 1NJIC 3CCLA 4A3CG 1NMGA 1OXUA 1X56A 2EIFA 4HJ9A 1E1TA 2RCNA 3FKIG 1XPRA 3EN2A 1VQ6A 4DV3Q 4X64L 3T1YQ 4OWXB 4LF4Q 4KHPQ 1MJEA 4P72A 1M90C 4YY3L 4LFBQ 3PCOB 4AQYL 1VQGA 1Z9FA 4B3ML 4RG1A 4LW1A 4DV3L 2VQFQ 1BBUA 3T1YL 4LF4L 3STBD 4KHPL 1WYDA 2ATWA 2IHFA 4LF6Q 1A62A 4LFBL 3T1HQ 4IO9A 3UDFA 1DGSA 3G48A 3I4MG 3W1GA 2KENA 1E3PA 1OXTA 1PH4A 1BKBA 2HT1A 1L1OB 4JBWA 2VQFL 3ICEA 4BY7G 1VQKA 1UWVA 4LF6L 3S15H 4L5SA 2NN6G 1YBYA 1YHBA 3T1HL 3HOWH 2AWNA 1XTDA 3PF5A 4BY1H 1CSPA 2LXKA 2VL6A 1AH9A 1X3EA 4LF7Q 4HJ8A 4GN3B 4DR1Q 3S2DH 4MZ9A 3L0OA 5M3FG 1CKNA 1SFOH 4NPSA 1LUZA 1I5FA 5C3EH 2JA7H 2OTJA 5IYBH 4LF7L 3U50C 1YHAA 2WP8J 3ER0A 3K80C 4R4IA 4DR1L 3HOUH 4YCVA 3H3VI 3CCSA 1C9OA 5JJIA 1EQQA 1CKMA 4ME3A 4A3IG 2VS1A 2OTLA 4DUZQ 1EIYB 5M3MH 4GLXA 3Q8DA 1RIPA 1AE3A 1V1QA 5IE8A 2UXCQ 1UEBA 1Q1EA 1GD7A 3J80i 4DR6Q 1G6PA 2AMCB 1CKNB 2KHJA 4LWCA 4HJ7A 1Y1WG 2BH8A 4DAMA 2BA0A 4P71A 5C44G 4DUZL 5IYCG 1EFWA 1Q81C 2CFMA 3KLWA 1S40A 2E5LQ 4DR6L 2GVBA 1GVPA 3S1RH 1M1KC 4ALPA 3CCQA 1E24A 1CSQA 1PYSB 3S24A 4FDBA 1KQSA 1N34Q 4JV5Q 1TXYA 2D0OA 1N8RC 2DGYA 1HH2P 1S3OA 1HZAA 1K0RA 4YWLA 2E5LL 4WJ3M 3CCMA 4HJAA 4DPGA 2JEAI 2ZM6Q 2UUBQ 4B3RQ 5C0XJ 1FJGQ 1N34L 3OYYA 3S17H 1N9WA 4JI2Q 4JV5L 2F3IA 3A0JA 1IZ6A 1J5EQ 3M3YH 3H15A 1E1OA 2PNHA 3A5ZB 3CW2C 2ZM6L 2E2JH 2UUBL 2JK8A 1X6OA 2OQ0A 2XGTA 1QZGA 1FJGL 4A3BH 1TWHH 4JI2L 1HNZL 3CCJA 1YHQA 1N33Q 4A3DH 1J5EL 5IYDG 2Q2UA 3GTKH 1X54A 3PUWA 2Q2HA 4B3MQ 3U4VA 1YJNA 1WJJA 4XIGS 3J80c 4DV0Q 1VQ4A 3CF5A 4PMWA 1N33L 1VQ9A 3AYHB 4A3LH 3K7UC 5GAEC 3K81C 3PGZA 4QGUA 4A3GG 3G6EA 2B3GA 2N78A 2Z6KC 4LUVA 4X65Q 4IPCA 3G4SA 4X62Q 3TS0A 5FLMH 1YNXA 4Y7NH 3F2BA 4DV0L 5C0XG 4A3CH 3PUXA 1VQNA 3BZKA 1J6QA 1EIFA 1KRSA 2ID0A 1BBWA 4DR5Q 1X65A 2YTXA 5HY6A 3MEFA 1OXSC 3CXCA 3AFQA 5IWAQ 4X65L 4QJFA 5M5YH 4IPHA 4X62L 4A75A 3IRBA 3GTOH 5LMNQ 1YVCA 4DR5L 4PZ7A 1L0WA 4DAYB 1U0LA 3GO5A 3RR5A 3RN5A 3TRZA 4OX9Q 5IWAL 5IY0A 1HR0Q 1VCIA 3I2ZA 4DR7Q 2F4VQ 5LMNL 1YZ6A 2Z6KA 3I4MH 3FP9A 2PI2A 2A19A 2HIXA 2I5MX 4AH6A 4OX9L 3PF4A 2VQEQ 1LTLA 4GOPC 4BY7H 3PO2G 4GLVB 2OQKA 1HR0L 1JMCA 4OWTB 4DR7L 2F4VL 3CCRA 2ZJQA 1TWAH 4B3SQ 1G291 4BA2I 2B29A 3ULLA 1OTCA 4LNQA 1KRTA 2IHEA 5IP9G 4DV4Q 1TWCH 4DKAC 4A3JG 5M3FH 4A93G 4OONA 1OXVA 4DV5Q 5C4JH 4JBKA 1Q8KA 1YJ9A 4DV4L 2YU9H 4X6AH 1Y14B 2RHSB 3AQQA 1E22A 1VQBA 4HIKA 4GOPA 3PSIA 2JE6I 4DV5L 3PV0A 1VQ5A 3S14H 1T9HA 2GN5A 1B70B 5BR8Q 3H3VH 1A8VA 3ERSX 3GTLH 3S2HH 4A3IH 4BXXG 2IT1A 1VQ8A 2L15A 3HKZE 1EWIA 3KF6A 4A3KH 2Q2IA 4JCVE 4DK6C 3F2CA 4QY7A 1QVGA 1IL2A 5BR8L 2BA1A 4JI8Q 3CMEA 1Y1WH 4JI5Q 5E7NA 2R92G 2MO0A 1JJGA 3GD7A 3KOJA 1S72A 1JE5A 2KBNA 1IBKQ 4JI8L 1HNXQ 4GOPB 4JI5L 4APVA 1SMXA 3J7ZC 3HKZG 2KHIA 4TVAB 3S1NH 1WOCA 1C7YA 3TS2A 1TWGH 3CP0A 1PFSA 1I50H 1NTGA 1IBKL 2XTIA 3CAMA 1HNXL 3J81i 3I55A 4OO1I 5J3BA 4IPDA 1PH9A 3BU2A 4O0AA 3RNUA 1MIUA 4X66Q 3PUZA 3RN2A 1EQRA 1VQCA 4JI6Q 4OXPA 4JG2A 3CC7A 2NVTH 2YYZA 1AE2A 1QZHA 3HOZH 3CPFA 1HZ9A 1V9PA 3L7ZC 4L5TA 3W1BA 2UUCQ 3NBHB 1PH5A 2Z0SA 4X66L 4LF8Q 3UE1A 1VQFA 4HIMA 1VQDA 1IBLQ 4JI6L 1Y1VG 4MTNA 1Q7YC 5AJ3Q 4POGA 3DLLA 2UUCL 3E0EA 4IJLA 1QVCA 2D0PA 3AFPA 4PG3A 2QA4A 2MO1A 2R7DA 4LF8L 2B63H 2UXCL 1IBLL 1W2BA 1K9MC 2ZTEA 4QL5A 1KL9A 5AJ3L 2N8NA 2JA8G 4R1JA 1HJPA 3TREA 1JB7A 3KYHC 3G71A 4OWWB 4BBSH 2EXDA 3GTPH 2UXDQ 3GTMH 3STBC 1PYBA 3J81c 1KHIA 2OWOA 3BJUA 1D7QA 1I94Q 4O2DA 4P74A 1P8LA 1KD1C 2ZTCA 4QQBX 4IPGA 3I4NG 3KFUA 3TEHB 1FVIA 1UE7A 4BY1G 2UXDL 1A63A 1B8AA 2AKWB 1MKHA 3E9HA 5C4XG 3A5UA 1I94L 3PO2H 3BZCA 3F8TA 2JEBI 1LYLA 4GS3A 2JA7G 1SN8A 2FXQA 1PH3A 5IYBG 5FLXc 1XMOQ 1Q82C 4NXNQ 2VUMG 5IP9H 1UE1A 1SR3A 4A3JH 4A93H 1JT8A 1YJWA 4DV1Q 3CCEA 1HZCA 2K5NA 1XPOA 4UP8A 1JJ2A 3FKIH 1XMOL 2F52A 4NXNL 1Q86C 4DR4Q 4LF9Q 1PH7A 5M3MG 1GM5A 2ZJPA 4DV1L 2ZTDA 4UY8C 4R4OA 2K52A 2K4KA 2JQOA 4C2MH 1GKHA 3CC2A 4JOIC 5IT9c 4DV6Q 4DR4L 2MNAA 4LF9L 4BXXH 2K75A 1SRUA 3DM3A 4UP7A 2IY5B 3M7NA 1PH1A 2JA5G 1N32Q 1YI2A 3AEVA 4C3JH
chains in the Genus database with same CATH superfamily
4YIJA 2EY2A 1QB5D 4B3SL 3I4OA 3HKSA 5GAHC 2QF7A 2BCOA 4EX5A 1F2ZA 2CW0D 4X3KA 1G6ZA 4L5RC 1W6KA 2LXJA 2FJ2A 5ELOA 1B44D 3SGIA 4LFAQ 2N3SA 2CHBD 2PQAB 4GNXA 3K5MA 5FJ8G 1O7LA 2QKIC 4KHZA 2MFIA 4BWGB 4R4CA 3KF8B 4JI7Q 5IT9E 1EYAA 1KXLA 3ZJYC 3TMEA 5F2DA 1SYCA 2A1AA 4IFDG 2EY5A 1L2FA 1BR9A 1UE5A 2CVRA 4H44C 2UXBL 1SE4A 1W6JA 4JI3L 3OTOQ 3M7GA 1LTRD 2K5VA 1PH2A 3UDGA 2JP1A 1DXMA 1XNQQ 3DWPA 4OO1G 3PO3G 5JJKA 4ZKCB 4JVZA 3SR1A 1QUQA 2B2WA 5FLXL 2YV5A 2EZVA 2R7FA 3E3XA 5EGTA 1QVFA 2EYJA 1MJCA 3PMFA 2EE1A 2Z1CA 1KC8C 2WB1G 4U673 2I0QA 4G7HC 3N6RA 5HGQA 3T51B 2CW0C 2RHQB 4P75A 2K14A 4CDDC 2IW3A 1X3PA 1K0SA 1LABA 4JC0A 3D31A 3NTHA 3S16H 2K50A 3UDIA 4ILWA 5J39A 3GTOB 4XDXA 2RSOA 4KKUA 1H95A 1HA6A 4P73A 1EYDA 4XYOA 4DR3Q 4UP9A 1NR4A 4C3JB 1LLRD 2JA5H 4OIKA 4NXMQ 2N49A 1I3QH 4DV2L 3ONAB 4JI1Q 4NDXA 5IGEA 2UUAL 4JBMA 1QILA 4QCLA 5LMUL 3ERQA 1BOSA 1D5XC 2LKVA 5M3FB 4QMGA 3IFDA 1LM0A 4YHHQ 2QW7A 3HOXH 3Q23A 1AW7A 1WTPA 1JE4A 1ASZA 2XWBB 1F2LA 1SYBA 5M5XB 1WD0A 3I8ZA 3TDQA 3MXUA 4JI4L 2I5HA 3KUPA 5DAUA 1NR2A 1CKOA 1TKWB 1B50A 3ND8A 2VZAA 4TQUS 2ES2A 1TS3A 2KEEA 4CJ0B 1HQMC 5ELCA 4JI0L 4XQJA 3HOYH 5EJWA 3PIOA 2JSOA 1YEZA 1EOVA 2B8GA 1S4ZA 2A6EC 3W3AA 4LUOA 4B08A 1XNRQ 2JA8B 4R4QA 4A4IA 3CCUA 5E4XA 1TWGB 4DK3C 2ZXPA 2MQHA 3M4OB 2NVXB 5M5WB 4RAUC 1TY0A 4RMFA 2F03A 3U4ZA 2E2HH 1IXRA 4WJ4A 5KYLA 2ZT9C 1N36L 2XIWA 5IGFA 3GDEA 1A6XA 1PFBA 4KN4C 4POFA 1I6HB 3J7A5 3LWEA 2XRSD 3D8GA 4X64Q 3QG1A 1OXUA 4OELB 1XPRA 1E1TA 2VUMB 1VQ6A 2JN4A 4A3GB 1XWEA 1M90C 5IOCA 4AQYL 3I3CA 5JEAH 4DV3L 4LF4L 4KHPL 4IZ8A 4LF6Q 4LFBL 2FMCA 5E3FA 4C3JG 5C5LA 3EFXD 1BKBA 2F0VA 2E2IB 1UWVA 4L5SA 1YBYA 4WFN3 3T1HL 1XTDA 1GUNA 1Z6HA 4OL7A 1LT4D 5I2XA 2F0GA 2PW7A 4DR1Q 3S2DH 2AQ1B 4MZ9A 5M3FG 1D5ZC 1MI2A 5KNBA 1WCMB 2OTJA 4MHEA 3ER0A 3I70A 1F2YA 3RZDB 1JOKA 1BUVT 2B2YA 2NYZD 1RDPD 1EQQA 1PTOB 4IUTA 4ZUJA 1GXDC 1EIYB 4GLXA 3Q8DA 1RIPA 1AE3A 1U9RA 1V1QA 2FHTA 2R93B 4KHVA 2O5IC 4E6IA 4RFBA 3J80i 1G6PA 2KHJA 2WAQB 4IQZA 4P71A 2DY8A 5IYCG 4DUZL 2F0IA 5CBAE 2CFMA 3EVQA 2JYOA 2SEBD 4AYBB 2GVBA 4CJ2C 3CCQA 4ALPA 1E24A 3OPOA 2L0CA 4JV5Q 2RVLA 1DD2A 4WJ3M 1HH2P 1S3OA 1KDAA 2E5LL 2P5ZX 2JEAI 3HKZB 3MC0B 2ZM6Q 4BBRB 1LV9A 5CV5A 3S17H 3AU7A 3BYTB 1J5EQ 1IZ6A 3FPPA 4B3RL 2E2JH 2XGTA 2OQ0A 1QZGA 1O78A 5EPJA 3H0GB 1JB3A 1FJGL 4JI2L 2RDHA 4C3HB 5IYDG 2R7ZB 4PQXA 1GUOA 3MXGA 1LTBD 3T13A 1Y1VB 4PMWA 3NK9A 4A3LH 4XQQA 1EQVA 3HEJA 3K81C 4QGUA 1HXYD 4A3GG 3G6EA 2Z6KC 2N78A 3I91A 3LX0A 3F2BA 4A3CH 4I65A 3PUXA 1VQNA 4DR5Q 1EIFA 5DM73 1BBWA 5K36H 1JWSD 1OXSC 1XTCD 1VMPA 4NMZA 5I6WA 3CXCA 4QJFA 2V4DA 5M5YH 2WINB 1YVCA 2FFKB 1STBA 1DJRD 4PZ7A 4L8JA 1RODA 3FRPB 2HUGA 5IY0A 1VCIA 3L3OC 4DR7Q 2F4VQ 5LMNL 2K1BA 4RWSC 2A19A 2PI2A 4AH6A 2C9OA 3S15B 3PO2G 4GLVB 1HR0L 1D6EC 2ZJQA 3KF8A 3D6WA 1G291 4ZQ3A 1OO9B 4DV4Q 2X69A 2RSNA 1BXTA 2CQAA 3WDNA 4OONA 1LTID 5C4JH 5BN3A 3QWNA 2YU9H 1Y14B 1E22A 1VQBA 3PSIA 5COYA 3S14H 1T9HA 1STEA 1A8VA 3S2HH 2L15A 2EYFA 2A69C 3A7AB 1ZKOA 4QY7A 1FNWA 2E2DC 3CMEA 5E7NA 1SNPA 3BDOA 3NBHA 3HGBA 1B53A 3S1RB 1HNXQ 3HRZC 4APVA 2B2VA 3HKZG 3S1NH 3OSOA 3TS2A 4FXKC 3CP0A 3C3LA 2A73B 2RA4A 1JWUD 4PNYA 3CAMA 1I4GA 1D1KA 4HSPA 3QR8A 1CHPD 3BU2A 3J7YW 1CT1D 3CC7A 4C3HG 2B8FA 1AE2A 1QZHA 5JOBA 3L7ZC 2UUCQ 3SDZA 3HOVB 1G8ZD 1PH5A 3I72A 3H94A 1EY5A 3OWEB 1IBLQ 1Y1VG 4G7ZC 4CBVA 2L12A 4MTKA 1T5XD 2D0PA 1JQYD 1GUTA 1PRTF 1W2BA 4ODGA 5AJ3L 3MA2B 2N8NA 4F87A 1CQVA 3VA5A 3CRLC 4DXFA 1H9KA 2F0FA 3K59A 3IL8A 4B9WA 2EXDA 1X3QA 3GTMH 1WTRA 1PYBA 3J81c 3HG9A 1D7QA 4FF1A 4O2DA 4KJOA 1JICA 3QJYA 3I4NG 3KFUA 3I4MB 2UXDL 1A63A 1B8AA 2QCPX 5C4XG 4BY7B 4O42A 5CR3A 2ENBA 5E1FA 3BZCA 1ENAA 2JEBI 1LYLA 1SN8A 2PZTA 4UDUC 1O80A 3SK6A 4NXNQ 3SK4A 1KDBA 3EA6A 4A3JH 3RUZA 4IALA 1K3BC 1A3VA 2K5NA 4K8JA 4IN3A 2J7ZA 5EPLA 2F52A 4JPBW 4DR4Q 1ESRA 1PH7A 1C48A 2ZJPA 1PYWD 2K4KA 2JQOA 3MXNA 3GTLB 1J8IA 4DV6Q 2MNAA 3J81E 4A3KB 2K75A 1SRUA 1VF7A 1LT3D 4K2KA 2XVSA 1PH1A 3AEVA 1Y1WB 2KVMA 1ILQA 4DUYQ 2R92H 2F0JA 4GNXC 4KD3A 4C1NI 1N32L 2K01A 1U4MA 1H9JA 3V2TA 4PMCA 1FNUA 2WAQE 1IW7C 2Q8TA 1BBXC 2K5WA 5C3EB 5IP7G 2A8VA 5CV7A 1SE8A 1HUNA 1L1OC 1EUJA 3GTJH 4AYBE 1ZYRD 3OMCA 2HHHQ 4RGMA 5G3LF 5JVG3 3HOVG 1U4LA 4A3MG 3GTQH 4LFAL 1RL2A 4K0KQ 1VQOA 4C3IH 4RHRA 2JA6G 5KEEA 2AHOB 3CQZH 3DM1A 4JI7L 1Q90A 1VQHA 4KJNA 5C44H 3ULPA 3ITPA 2KCTA 3X3NA 1HQRD 2B2WC 3T4AC 2IJ0A 3P75A 3CHBD 3E5SA 4B3TQ 4A3FG 2EY6A 4OHJA 4KN7C 1M8AA 1EIGA 1YIJA 4BBSB 1A2TA 3OTOL 1DM0B 1O7ZA 2Z4IA 3B6YA 1FL0A 1ICFB 5JEAJ 5KGUA 1WTXA 3RZOH 2LSSA 1AEXA 3CC4A 1MSHA 1XNQL 1YNJD 1VS0A 2WFWA 4A3DB 1QWYA 1K3RA 3PIPA 4GKKQ 3K5OA 1PZKD 2F1MA 1WTQA 2KCCA 2ZXOA 2NZOA 3KBGA 1TU2B 2X6GA 2NVYH 1B9NA 1ICWA 2KEDA 1ZYRC 3UDXA 3PUYA 2F0WA 1TWFH 3GP7A 4A3KG 4XTCS 2EPBA 1PV4A 2D2CC 2Q2TA 1VQPA 2LY7A 1E2VA 2A68D 4K6DA 3HOWG 1HNWQ 1M4VA 1BVSA 4CDEC 2FMMA 4DR3L 1R9TH 4R8IA 3I73A 3M4PA 5HURA 3PIP3 4NXML 1LTSD 5C3EG 2CKZB 3KDFB 2F0MA 5GQOA 1Z47A 3C1EA 4JI1L 2I46A 4PZ6A 2VY3A 3SK8A 3HOUG 3RLNA 4LF5Q 1HNZQ 2KCMA 1BCPD 5C3WA 1XPUA 2NZHA 2CWPA 4IOCA 1X55A 1K8AC 4GKJQ 4ID6A 2EJGC 5IODA 4YHHL 4IUQA 3NQIA 1SXTA 4EVOA 5FJ8H 5CYUA 1NMFA 4A3IB 3BYYB 1EY8A 1ZEQX 4GLAC 1FGUA 2ICIA 3RLOA 2BE5C 4QB4A 2XNAC 1SEBD 4DV7Q 1PH6A 2Z8LA 4K6LA 4JYAQ 4LMQD 3S1MH 4KY5A 4KY6A 2PZWA 3K0XA 4UPAA 4ZUIA 1C4QA 4BBSG 3D4DA 3LGJA 1E7ZA 1XMQQ 1XNRL 3GQBA 1K8GA 3A56A 2NBFA 3OW7A 2H1EA 4RCOA 3PO3H 4OO1H 4OEMB 1PMRA 4NKLA 5LL6S 2NVQH 4A3DG 3BDLA 1F9SA 2IX3A 4DR2Q 5FOBB 1QE6A 3P7JA 1SLJA 3K8AA 1RHPA 1JJCB 5C3XA 2IX1A 3I7FA 4YY3Q 1L1OA 1NJIC 3SHLA 2EIFA 3A7LA 2A6HD 4X64L 1BCPC 3JAML 4UHVA 1VQGA 1Z9FA 1D1IA 3A8IE 5EBDA 3S16B 4RG1A 4LW1A 5CV9A 1HFGA 2VQFQ 1BBUA 2ATWA 2IHFA 1A62A 3MWYW 4IO9A 1DGSA 3G48A 4IUNA 1E3PA 2KENA 1U4RA 4CKEA 4JBWA 1DZ1A 3ICEA 1VQKA 2IL8A 2JA5B 4LF6L 2NN6G 2B2YC 1I3QB 5KNDA 3QIAA 2AUJD 4Q5VA 4ULLA 2VL6A 3PF5A 1YNND 1ONLA 1HCZA 4LF7Q 1ESFA 1CTMA 4GN3B 5CORA 1K28A 1LUZA 2MUYA 3NUCA 3K5LA 4DNRB 5IYBH 1YHAA 2F0QA 4DR1L 3KBXA 1C9OA 5JJIA 4ZK9B 1V1PA 4A3IG 2VS1A 5M3MH 1LACA 1AN8A 5IE8A 2K5DA 2HCIA 1UEBA 1GD7A 1CKNB 4LWCA 2XN9C 5CV8A 5FK9C 3I90A 4DA2A 1A15A 3HOYB 2A6HC 3S24A 4FDBA 1HTLD 1PRTB 5FKAC 2D0OA 4JW0A 1N8RC 1HZAA 4HJAA 1GUSA 4JV5L 3A0JA 3H15A 1E1OA 2PNHA 3A5ZB 2ZM6L 2E2HB 5IGGA 1X6OA 3H6MA 4K2LA 4A3BH 4M1UB 4I7AA 1K8MA 1YI2A 3MTSA 1N33Q 2F0EA 1J5EL 1BF4A 3GV6A 3U4VA 4XIGS 3WOFA 3J80c 4DV0Q 3K57A 2EJMA 3TZUA 4LUVA 4IPCA 3G4SA 4X62Q 4HTHA 3TS0A 5C0XG 3BZKA 5EBCA 5LL6X 1KDCA 3AFQA 3GTOH 4FYDA 4DR5L 4DAYB 3TRZA 1B3QA 4OX9Q 2C5CA 2DJGC 3I2ZA 2PYKA 2G5DA 2I5MX 1CZWA 2HIXA 3HS0C 2DY7A 1LTLA 4XT3B 2OQKA 1ENFA 2F4VL 4DR7L 1TS2A 1PZID 1TWAH 3VA7A 2Q8IB 1FD7D 4LNQA 3J80E 4KMUC 3S2DB 2IHEA 2NB0A 2K28A 3H09A 1D2BA 2D5DA 5M3FH 4XYQA 4HSVA 4IURA 2HQEA 3G7LA 1MBYA 2Z9HA 3NTIA 3D6CA 4TSSA 3PIO3 1Q8KA 1TT2A 4DV4L 4X6AH 2RHSB 3AQQA 3E6ZX 4GOPA 2JE6I 1VQ5A 1B70B 3H3VH 2B2VC 4U68A 1DOMA 4CKBA 2Q2IA 4RH6A 2MHVA 1LTTD 1QNKA 2DN8A 2MPMA 2ZXRA 2MO0A 3KOJA 1S72A 3EROA 1JE5A 1J9OA 1IBKQ 1K8OA 3ZYYX 1EZ8A 4TVAB 4M8AA 1C7YA 2EDGA 1TWGH 1PFSA 4IUPA 5CV4A 1I50H 1NTGA 4A3EB 1HNXL 3DWAA 4OO1I 5C6AA 3U9SA 2RDGA 1BO0A 1PH9A 3VYUA 4X66Q 1JR0D 2QDLA 4NW2A 4JG2A 4JI6Q 2E2JB 1R4PB 3HOZH 4L5TA 1TIID 4ZRZA 2RBMA 5I6YA 4LF8Q 3UE1A 1VQFA 4POGA 2UUCL 2R61A 5D3DA 1II3A 2MO1A 1RKNA 2L55A 2B63H 2UXCL 5EPKA 1IBLL 2ZTEA 4QL5A 5I9PA 5KYIA 4RGTA 2JA8G 4WJWA 1JORA 3H3VC 4R9WA 1VMCA 2PCFB 5M5YB 4HCSA 3KYHC 1HUMA 2K7VA 4QUCA 3GTPH 3VR4A 5T1GA 1KHIA 3BVMA 3T53B 4H7BA 1QJOA 1I94Q 4P74A 4QQBX 4HAEA 2ZTCA 3NQTA 4IPGA 3BVZA 3NPPA 5EKKA 1UUPA 3PO2H 3FMCA 2G9DA 1EFID 2K32A 4IUVA 4GS3A 1BQQT 5FLXc 1XMOQ 2VUMG 1SJED 1UE1A 1STYA 4BS9A 1JT8A 4J8QA 5C4JB 1PTOD 1FNVA 1B9MA 1HZCA 3CCEA 1JJ2A 4UP8A 4V190 3FKIH 4NXNL 1PTOH 1WTWA 4HN7A 4FF4A 1STHA 1GM5A 1VDZA 3S14B 4R4OA 3S2HB 4C2MH 4KK7A 2Z4HA 4DR4L 3DM3A 4UP7A 2IY5B 1JOOA 1EEID 1PVOA 5EQ0A 1STGA 4DV6L 2PQAA 1U5KA 3NXWA 3NENA 5IGDA 4IFDJ 4A3EG 4DUYL 4LFCQ 1WCMG 1H9SB 3NSWA 2VQEL 3S1NB 5FLXE 1JWMD 4ZAIA 4A76A 3EBEA 2NZ1D 1RCVD 1N36Q 3J81j 1IBMQ 1NY4A 2C35B 1XJVA 1SROA 3NBIA 1PHJA 4EQNA 4CDFC 1EWCA 3HZXA 5CBEE 2R6GA 3V96A 2R93G 4WORA 3M4QA 2HHHL 2WAQG 1NE3A 3E0JA 4FXGC 2CWAA 2KUMA 3CPWA 1Y1VH 1Q1BA 4K0KL 3EJIA 5ELNA 4AYBG 3KJPA 1V1OA 3DEOA 4XT1B 5K36G 1PTOC 1O7IA 4GNXB 2ASBA 4YWKA 4BBRG 1SNDA 4IJHA 3A74A 4B3TL 2VB2X 3F1ZA 4ZKBB 3GTMB 3JAMi 2PMZE 1X3GA 4H0LC 4R4TA 3H0GG 4DAPA 5JPNC 4FF3A 2EYOA 1KIXA 1FR3A 1UAPA 3I4NH 3I4LA 5FO7B 2R7ZG 1SYDA 4XQNA 5C4XH 2AWOA 2UU9Q 2MGSA 2YTVA 3AB9A 5I9OA 4CGYB 2ALYB 1A0IA 2Q8RE 4X3SA 4A3JB 3QO2A 4GKKL 1DOKA 1W3SA 2EVBA 3K7AH 5IT9L 3SK5A 3VR2A 1QUQB 4PZ8A 1Q46A 1VQIA 2KOLA 4BA1I 1C0AA 2X6LA 2TMPA 3JC66 3W2DA 1IKLA 2F4IA 1K83H 3GTGH 1V43A 3M85A 1EYGA 2QDBA 4DF7A 4RA8A 2B2TA 1S5CD 2R92B 5ELBA 2D62A 3WWVA 2OXPA 1I4PA 1HNWL 2B2UA 1FYCA 1Y8NB 5GROA 1TVXA 2HD3A 5E4WC 4KD4A 5IP7H 1CUKA 1ENCA 2F3WA 3GTJB 1EY0A 2AQ3B 2XRQD 3R2IA 3NWSA 4LF5L 1TR5A 3HOVH 3GTQB 2IPKD 2WKDA 4KTAA 4MNOA 4A3MH 1HFNA 1VQJA 3VDYA 2RCFA 1EQTA 4EQ5A 4C3IB 1SYEA 4K8IA 4S3SA 4GKJL 2MJ8A 1G51A 1ILPA 2JA6H 1JCKB 2RDFA 5CC4A 2CCZA 4CKCA 3CQZB 3K6OA 3S1QH 5AFWA 1CK1A 2VW9A 2I5LX 5C44B 1KTKA 2CQOA 2H5XA 4C1NK 2YTYA 1XYIA 5DNFA 4DV7L 4HCEA 3OMGA 1ET6A 3DXJC 3OW2A 3RLFA 2KCNA 4JYAL 4HIDA 4P2CB 1ASYA 2L11A 1QG7A 4EQPA 4A3FH 4JBJA 4CJ1B 1SBBB 1HZBA 3H91A 4H02A 3RZOB 4DNTB 2NVTB 1XMQL 3QB3A 5C4HA 4L5QA 1VQEA 1X9NA 5DLQE 4FVMA 4TKOB 3DWQA 2VNUD 3BG3A 3D0FA 3UE0A 4DR2L 5FLMG 3CCLA 1NMGA 1I4XA 3T1YQ 4YY3L 1V8QA 3OIPA 2EYHA 3BDCA 4PMBA 1Y8PB 1TWFB 5I2YA 3STBD 4LAAA 1MSGA 1WYDA 3VYSA 3UDFA 3I4MG 3W1GA 2HCCA 1OXTA 5ELDA 2VQFL 1PDQA 2DNCA 4BY7G 2E75C 1YHBA 3HOWH 2AWNA 4BY1H 1BDOA 5IGBA 1CSPA 2LXKA 1AH9A 3K58A 1KABA 1JOQA 2NWGA 3TP7A 4HJ8A 1R9TB 2ICEC 3FPUB 1SFOH 3L0OA 1QOHA 4RKLA 5C3EH 3N52A 4FP5D 2O4XA 2JA7H 2HDLA 3F2UA 3DHQA 4LF7L 3U50C 4A93B 3FDTA 3K80C 4R4IA 3HOUH 2NTSA 3EQLC 4YCVA 5D14A 3D3RA 2F0NA 1MGSA 2J0TD 2L5TA 4ME3A 1S5DD 4KKTA 2OTLA 1DYQA 1RJTA 1TQOA 2OF1A 4N8X1 4DR6Q 2AMCB 1Y1WG 1QNUA 5C44G 1EFWA 1L0YB 2F0TA 1Q81C 3T56B 1S40A 1CHQD 1M1KC 3S1MB 3MFYA 1PYSB 4K5VA 1N34Q 1TXYA 1H9MA 1K0RA 5DEHA 1I6VC 3CCMA 3MZ5A 2UUBQ 3TBIB 3VYRA 3OYYA 1N9WA 2CH4W 1NSNS 3M3YH 1EYCA 1SMYD 3IFTA 3PO3B 2JK8A 5J22A 1TWHH 2N55A 2SNSA 3X3MA 1YNJC 3CCJA 4A3DH 1GUWA 5JAVA 1PFNA 3GTKH 1X54A 2Q2HA 4B3MQ 3GV3A 1YJNA 1WJJA 3K5NA 3BS1A 3CF5A 1N33L 2L1BA 3AYHB 1VQ9A 4B9XA 4IFDH 4X65Q 4Y7NH 1YNXA 2EYMA 3LWUA 2AQ2B 4DV0L 1EL0A 2SOBA 2VB3X 3SE0A 1J6QA 1KRSA 1X65A 5IWAQ 4X62L 3IRBA 1Q8IA 4I7ZC 1B3AA 1U0LA 3GO5A 4Q0FA 4QIWB 4RGOS 1CI3M 1YZ6A 2EJFC 3FP9A 1O7YA 3FVQA 4LK1C 5I4DA 2A68C 4OX9L 2RQXA 5CGKA 3Q0AA 4GOPC 2NN6H 1DCZA 4OIJA 5FO9B 1OTCA 5C5MA 3Q22A 4GZYC 1KRTA 5IP9G 1TWCH 4A93G 4DV5Q 2L9HA 3V05A 1YJ9A 2F0PA 4HIKA 1DONA 1SMYC 1CM9A 4R8NA 3PV0A 3MAQA 2GN5A 1RF2D 5BR8Q 2K04A 4G57A 2M00A 4A3IH 1CFMA 2KHSA 1VQ8A 5M3MB 4BXXG 1A3UA 3O13A 1EWIA 1EY9A 4JCVE 4DK6C 2EYPA 1I4HA 3F2CA 1UEAB 1RTOA 4JI8Q 3VR6A 4JI5Q 1JJGA 2SNMA 2KBNA 3J7AV 1Z7TA 3J7ZC 3NE5B 1SMXA 3PQIA 5KNCA 1WOCA 1AFPA 1IBKL 2XTIA 5TSSA 5T1IA 5J3BA 1Y69U 3HOXB 2EYLA 1MIUA 3A55A 3RN2A 1EQRA 4OXPA 1B4OA 2PO4A 2YYZA 1B1ZA 4N9TA 3CPFA 4A3BB 3W1BA 3NBHB 3KLSA 4X66L 1KLGD 4HIMA 1VQDA 4FNFA 4JI6L 4MTNA 1Q7YC 3DLLA 1QVCA 3AFPA 4PG3A 2R7DA 4HMIA 4LF8L 4V0BA 3MHBA 2LMCB 1EWHA 4ABNA 2Y0SB 2A6ED 1SJHD 5C0XH 3OIQA 4H13C 3C2PA 4OWWB 3G71A 4F88A 3OWFA 1STNA 2OWOA 4DN4M 4O1NA 3L9AX 1FVIA 1UE7A 3NWTA 4N8FA 4QUFA 3E9HA 3CRKC 3A5UA 1I94L 1TWAB 1YNNC 4KV6A 2A5HA 2VXWA 1UNSA 3J7AF 2LFNA 1SNOA 3ND9A 1GUGA 5IYBG 1LO5D 1WVLA 4C56C 1SR3A 1GHKA 2PMZB 4DV1Q 3MEHA 1XXGA 4KY7A 1PFMA 1XMOL 1Q86C 1X32A 4DFAA 4LF9Q 5JJZA 5M3MG 5ELEA 4UY8C 2K52A 1GKHA 3CC2A 1PLFA 3M7NA 2JA5G 4B3SQ 4K14A 4C3JH 3KLSX 1LT5D 1P16A 1MD2D 4EGVA 1PRTD 3WOEA 4DNIA 5IIFA 1NBWA 2JJQA 4KLKA 5JPMC 3KK7A 2PQEA 1GOZA 2K03A 4JOIA 4KI0A 3MXNB 2BOSA 1I50B 3HOXG 3D4WA 1T5EA 2QEXA 1Q12A 5J1ZA 4LFCL 3DMUA 3CD6A 5JJLA 1IYUA 1FGBD 5DM63 4A3BG 5M5XH 4ME5A 5EAYA 4Y52H 3CMAA 1IBML 4ZYSA 3HOZB 2K5HA 3SXHA 1X3FA 1PH8A 1WTOA 3R8BA 3M4YA 2UXBQ 5H1SE 1E2WA 4JI3Q 3A8JE 4IFDI 1VQAA 3M9BA 5LMNW 2PNRC 2DUDA 3HOYG 2F3VA 3EIVA 2Y0SG 1DOLA 2B63B 5IYCH 2RF4A 3Q24A 5K5PA 1G91A 1I4RA 1MHWC 1WI5A 2E8GA 1HR0W 3J81L 2LS01 1SNMA 2JA8H 3MFGA 2K5QA 2OCEA 2OT2A 3NP8A 3P20A 2WB1E 3NHHA 2E76C 3KF6B 4J1MA 2NVXH 3GTPB 3M4OH 5M5WH 1BCPF 4NB3A 2BH2A 3S17B 4TRDA 1K73C 2PZUA 2NN6I 1F2MA 4J15A 1PA6A 2M2LA 1PRTC 3ULJA 1I6HH 3VYTA 3U58A 3PO2B 5IYDH 4HJ5A 2HIVA 4QIWE 1SYFA 3Q6SA 4RGNA 1IYJB 1UE6A 4YCUA 5GAGC 1G2SA 3BVGA 2UU9L 2DJFC 2F0SA 2VUMH 5M9OA 4GN5A 2M9VA 4A3GH 1SNQA 2B2TC 2K6AA 1AP0A 1U4PA 1WFQA 3FKIB 3U9OA 1R4QB 1SYGA 5G3LD 5JEAG 1GO3E 1HRJA 3KDFA 5D3IB 3UI2A 2B2UC 2F0DA 1G2TA 4C2MB 3E9IA 2V1CC 4IUUA 2K05A 2EOTA 1B7YB 2RKSA 4DV2Q 1VQLA 3JAMc 3F2DA 3KLRA 2UUAQ 2E2IH 4HEDA 1EY7A 2F0HA 5CMDA 3AMUA 2PI2E 5GADC 1H9RA 4RCNA 5LMUQ 2QGQA 2EY1A 2PW5A 4DGZA 1Q3LA 1IYVA 3FHWA 4A3EH 1ML0D 4HR7B 1WCMH 3SEBA 4DU9A 5BN4A 1A3TA 2HQLA 2NTTA 3CCVA 4JI4Q 2GA4B 3RZDH 3W5OA 1E0BA 2HDMA 2YU9B 3NELA 3HOZG 3MXPA 5JVH3 1VQMA 3DEPA 4IOAA 4LUZA 4JI0Q 2R93H 2A69D 2AUKA 4YCWA 2JA9A 3JAME 4XXEA 2B63G 2IWHA 4FF2A 3I56A 1RD9D 5D65A 3C46A 1NCVA 3TQYA 2ZJRA 1KAWA 5C0XI 4UAIA 3IAYA 3HFZB 4Z9CB 2F0OA 4HIOA 1D8LA 4X3UA 1KLUD 3KJOA 2WKCA 1VQ7A 4BBRH 3PUVA 4ZLTF 1GJXA 1OXXK 1YITA 2F0UA 2Y0SE 4DAVA 4AIMA 3H0GH 1C8CA 1SE3A 4C3HH 1WD1A 2I07B 2A74C 3I4NB 5LHY1 2R7ZH 5C4XB 1TY2A 3NEMA 4YWMA 4A3LG 2EQSA 1ZXTA 4RHSA 4GN4B 2Z6BA 4EQOA 2IX0A 3L2PA 1WTVA 2GVAA 4AQYQ 4A3CG 3DUZA 1SDFA 1X56A 4F7XA 4HJ9A 2RCNA 2J4XA 3FKIG 3EN2A 4DV3Q 3K7AB 3VR3A 1LTAD 4OWXB 4LF4Q 1MJEA 4KHPQ 4P72A 3R93A 4LFBQ 1F9QA 1KAAA 3PCOB 5A2QL 3FEWX 1HHVA 3T1YL 4RKBA 3T1HQ 1EY4A 1SAPA 1K83B 3GTGB 3A54A 1CQFA 1PH4A 1PZJD 1L1OB 2HT1A 4OGQC 3T16A 3BZDB 3S15H 1TS5A 1X3EA 2QEJC 3P1HA 1CKNA 4NPSA 1I5FA 1QCBD 4F8MA 1S5FD 1JC7A 1EY6A 2KJXA 2WP8J 1AZPA 1A2UA 4K5WA 3H3VI 4HMJA 4JK1C 3CCSA 2MP1A 1Y8OB 1CKMA 5HGTA 4MIUA 2F0KA 4DUZQ 2XSCA 4A3MB 2CH4A 2UXCQ 1HTPA 1Q1EA 1RTNA 1HPCA 3D4RA 2WACA 4HJ7A 2BH8A 4DAMA 1F9PA 2BA0A 1BNZA 2JA6B 4MN3A 1CA5A 3S1QB 3KLWA 2E5LQ 4DR6L 1GVPA 3S1RH 4DK1A 1CSQA 1KQSA 5L37A 1IKMA 1V1PB 1KNAA 2DGYA 1IW7D 4YWLA 1EEFD 1S5BD 3OHXC 4ZCKA 4DPGA 5KIXA 4B3RQ 2SDFA 5C0XJ 1LT6D 4A3FB 1EZ6A 1FJGQ 1N34L 1SSOA 5IGCA 4JI2Q 2B39A 2F3IA 3CW2C 2UUBL 4WRDA 1HNZL 1YHQA 2DNEA 3NTKA 2Q2UA 2N88A 3PUWA 3QOLA 4DAYA 1S5ED 5ISRA 1IHZA 1VF5C 2WV6D 2XWJB 1VQ4A 5FO8B 3K7UC 5GAEC 3PGZA 2B3GA 3VR5A 4CDCC 4B3ML 5FLMH 2WIIB 1SNCA 2ID0A 2YTXA 5HY6A 3MEFA 4X65L 4A75A 3R2TA 4IPHA 2BDOA 2H4OA 2KQ3A 5LMNQ 3TN2A 4N9PA 3RN5A 1L0WA 3RR5A 3CKIB 5IWAL 1HR0Q 3RMHA 2Z6KA 5ELFA 3I4MH 5CV6A 3PF4A 2D9UA 2VQEQ 4BY7H 5BN5A 3HOWB 1EU4A 2QILA 4OWTB 3S9WA 3CCRA 1JMCA 4BY1B 4BA2I 3TZDA 2B29A 3ULLA 1D5MC 4LJZC 1SFOB 2KECA 4DKAC 4A3JG 1B2TA 4FO2A 1OXVA 2JA7B 3TP8A 4G7OC 3MVVA 3RD4A 1EOTA 4JBKA 3HOUB 3HP3A 5A35A 2NVYB 4L63B 2EXZA 4DV5L 2L4NA 3ERSX 3GTLH 4X3TA 3TP5A 2IT1A 2BDNA 3HKZE 4A3KH 3KF6A 2K33A 2F0LA 1QVGA 3G6JB 1IL2A 5BR8L 2BA1A 1TS4A 1Y1WH 2R92G 2JXMB 2O2LD 3GD7A 1F77A 2TSSA 1CA6A 4JI8L 3URYA 2E74C 4GOPB 4JI5L 2KHIA 1WTHA 4QF4A 1GHJA 1PXUA 1NNXA 4G4KA 1PTOF 3J81i 3I55A 1NAPA 1E2ZA 4IPDA 4KKSA 4O0AA 3RNUA 3PUZA 3M3YB 1NUCA 1VQCA 2G9HD 2NVTH 3J80L 3TSSA 1HZ9A 1V9PA 1BCPB 1TWHB 4C3IG 2Z0SA 3QOJA 3GTKB 2PPBC 2O5JC 4L6TB 3TP6A 4CHTB 5AJ3Q 2BE5D 3E0EA 4IJLA 4PV1C 2QA4A 3K0YA 1K9MC 1XX8A 1KL9A 4J6HA 4Y7NB 4R1JA 3C1FA 1STAA 3OOCA 1AZQA 3R3OA 3SVMA 4DXGA 1HJPA 3TREA 1JB7A 4BBSH 3A8KE 5C4ZA 2NUCA 5NUCA 2UXDQ 3STBC 3BJUA 3LNNA 1ET9A 1EU3A 1P8LA 1KD1C 1L0XB 5EKLA 3IKJA 1F9RA 3TEHB 4BY1G 2AKWB 1MKHA 2NVQB 1LTGD 3F8TA 5KRUA 1CZGA 1EIHA 2WB1B 2R3ZA 2JA7G 2FXQA 1PH3A 1KNEA 4K5XA 1TWCB 1Q82C 4FXDA 5IP9H 4NP5A 4A93H 1YJWA 2OEOA 2FINB 4DK0A 1XPOA 1IL8A 1H9SA 3CU7A 4DV1L 2KA7A 1I4QA 2ZTDA 4JOIC 5IT9c 5EKIA 4LF9L 4BXXH 1HA5A 5A2QE 1N32Q 1SE2A
chains in the Genus database with same CATH topology
1P16A 4DV6L 2PQAA 4DUYQ 2R92H 1U5KA 4GNXC 4DNIA 3NENA 1NBWA 1N32L 4B3SL 2JJQA 3I4OA 3HKSA 4KLKA 5GAHC 4IFDJ 4EX5A 4A3EG 4DUYL 4LFCQ 1WCMG 2VQEL 4JOIA 2WAQE 4KI0A 4A76A 3MXNB 3EBEA 4L5RC 2LXJA 5IP7G 3HOXG 2A8VA 1N36Q 5ELOA 1SE8A 3J81j 2QEXA 1NY4A 2C35B 1IBMQ 1Q12A 3SGIA 1L1OC 4LFAQ 1EUJA 4LFCL 3GTJH 4AYBE 1XJVA 3CD6A 1SROA 5JJLA 2HHHQ 4A3BG 2N3SA 1PHJA 3HOVG 5M5XH 5EAYA 2PQAB 4Y52H 3CMAA 4GNXA 4A3MG 1IBML 5FJ8G 3GTQH 4LFAL 1RL2A 2R6GA 4KHZA 2R93G 2K5HA 2MFIA 1X3FA 4K0KQ 1PH8A 4R4CA 3KF8B 3M4QA 1VQOA 2HHHL 2WAQG 1NE3A 4C3IH 4JI7Q 1KXLA 3ZJYC 2UXBQ 2JA6G 5H1SE 2CWAA 4JI3Q 3CPWA 1Y1VH 2A1AA 2AHOB 4IFDI 1VQAA 3M9BA 3CQZH 1Q1BA 5LMNW 4K0KL 4IFDG 2DUDA 5ELNA 4AYBG 3EIVA 4JI7L 3HOYG 2Y0SG 1VQHA 1L2FA 5C44H 1UE5A 5IYCH 2RF4A 3ULPA 2UXBL 2KCTA 3KJPA 4JI3L 1WI5A 2E8GA 1HR0W 5K36G 1O7IA 4B3TQ 3OTOQ 2JA8H 4GNXB 2ASBA 2OCEA 4A3FG 4YWKA 2K5VA 2WB1E 4BBRG 1PH2A 4IJHA 1YIJA 3A74A 3UDGA 3KF6B 4B3TL 2NVXH 3F1ZA 3OTOL 3M4OH 5M5WH 4NB3A 1XNQQ 3JAMi 2BH2A 4OO1G 2PMZE 1X3GA 3PO3G 3B6YA 1FL0A 4R4TA 5JEAJ 3H0GG 1K73C 3RZOH 5JJKA 2LSSA 2NN6I 3CC4A 1QUQA 1KIXA 2YV5A 4J15A 2R7FA 1PA6A 1QVFA 1XNQL 3I4NH 1MJCA 2R7ZG 3ULJA 1I6HH 1VS0A 2WFWA 1KC8C 2WB1G 5C4XH 2AWOA 2UU9Q 2I0QA 3U58A 5IYDH 1K3RA 3PIPA 4HJ5A 2HIVA 4GKKQ 4QIWE 5HGQA 2YTVA 1IYJB 2RHQB 4P75A 1UE6A 2ALYB 4YCUA 5GAGC 2NZOA 2UU9L 1A0IA 2K14A 2VUMH 4GN5A 4GKKL 2NVYH 1W3SA 3K7AH 4A3GH 1WFQA 1QUQB 3D31A 4JC0A 4PZ8A 3UDXA 1Q46A 1VQIA 3PUYA 5JEAG 3S16H 1GO3E 2K50A 3UDIA 1TWFH 3KDFA 4BA1I 4A3KG 1C0AA 4XTCS 1H95A 1PV4A 3E9IA 3JC66 2V1CC 4P73A 1B7YB 4DV2Q 1K83H 2Q2TA 1VQLA 1V43A 1VQPA 3JAMc 3GTGH 3F2DA 4DR3Q 4UP9A 3M85A 2UUAQ 2E2IH 1EYGA 2JA5H 3HOWG 1HNWQ 4NXMQ 2N49A 2PI2E 1I3QH 1BVSA 5GADC 4DV2L 2D62A 4JI1Q 3WWVA 5LMUQ 4DR3L 2UUAL 1R9TH 3M4PA 1HNWL 2QGQA 4NXML 5C3EG 4JBMA 2CKZB 3KDFB 3FHWA 5GQOA 4A3EH 1Z47A 5GROA 4JI1L 4PZ6A 1WCMH 2VY3A 5LMUL 3HOUG 2HQLA 3RLNA 3CCVA 4LF5Q 1LM0A 4YHHQ 5IP7H 3HOXH 4JI4Q 1HNZQ 3RZDH 1CUKA 2KCMA 3W5OA 1ASZA 1XPUA 3NELA 3HOZG 2NZHA 2CWPA 4IOCA 1X55A 1K8AC 1VQMA 4GKJQ 4LF5L 4YHHL 3HOVH 4LUZA 4JI4L 4IOAA 2I5HA 4MNOA 4A3MH 5FJ8H 1VQJA 3VDYA 1CKOA 4JI0Q 1NMFA 2R93H 2VZAA 4EQ5A 4YCWA 4GKJL 4TQUS 2JA9A 1PVOA 2ES2A 1G51A 4GLAC 1FGUA 3RLOA 2B63G 2JA6H 2CCZA 3I56A 4JI0L 4DV7Q 3S1QH 1PH6A 3TQYA 2VW9A 2ZJRA 2I5LX 3HOYH 1KAWA 5C0XI 4JYAQ 2CQOA 2H5XA 2YTYA 3PIOA 3S1MH 3HFZB 1YEZA 4UPAA 3K0XA 1EOVA 4HIOA 4DV7L 1XNRQ 1D8LA 4LUOA 3OW2A 4R4QA 3RLFA 4A4IA 3CCUA 4BBSG 4JYAL 4HIDA 1ASYA 4DK3C 3KJOA 3LGJA 4A3FH 1VQ7A 1E7ZA 4BBRH 3PUVA 2MQHA 4JBJA 1XMQQ 1XNRL 1HZBA 1K8GA 1OXXK 1YITA 4RMFA 4H02A 2Y0SE 3U4ZA 3PO3H 2E2HH 4AIMA 1IXRA 4WJ4A 3H0GH 1N36L 1XMQL 2NVQH 3GDEA 4A3DG 4C3HH 4B3RL 4L5QA 1VQEA 4POFA 4DR2Q 1X9NA 2R7ZH 3J7A5 3NEMA 4YWMA 5DLQE 4A3LG 2EQSA 1SLJA 3K8AA 4X64Q 1JJCB 4GN4B 2VNUD 2IX1A 3I7FA 2IX0A 3D0FA 1L1OA 3UE0A 4YY3Q 3L2PA 4DR2L 2GVAA 5FLMG 4AQYQ 1NJIC 3CCLA 4A3CG 1NMGA 1OXUA 1X56A 2EIFA 4HJ9A 1E1TA 2RCNA 3FKIG 1XPRA 3EN2A 1VQ6A 4DV3Q 4X64L 3T1YQ 4OWXB 4LF4Q 4KHPQ 1MJEA 4P72A 1M90C 4YY3L 4LFBQ 3PCOB 4AQYL 1VQGA 1Z9FA 4B3ML 4RG1A 4LW1A 4DV3L 2VQFQ 1BBUA 3T1YL 4LF4L 3STBD 4KHPL 1WYDA 2ATWA 2IHFA 4LF6Q 1A62A 4LFBL 3T1HQ 4IO9A 3UDFA 1DGSA 3G48A 3I4MG 3W1GA 2KENA 1E3PA 1OXTA 1PH4A 1BKBA 2HT1A 1L1OB 4JBWA 2VQFL 3ICEA 4BY7G 1VQKA 1UWVA 4LF6L 3S15H 4L5SA 2NN6G 1YBYA 1YHBA 3T1HL 3HOWH 2AWNA 1XTDA 3PF5A 4BY1H 1CSPA 2LXKA 2VL6A 1AH9A 1X3EA 4LF7Q 4HJ8A 4GN3B 4DR1Q 3S2DH 4MZ9A 3L0OA 5M3FG 1CKNA 1SFOH 4NPSA 1LUZA 1I5FA 5C3EH 2JA7H 2OTJA 5IYBH 4LF7L 3U50C 1YHAA 2WP8J 3ER0A 3K80C 4R4IA 4DR1L 3HOUH 4YCVA 3H3VI 3CCSA 1C9OA 5JJIA 1EQQA 1CKMA 4ME3A 4A3IG 2VS1A 2OTLA 4DUZQ 1EIYB 5M3MH 4GLXA 3Q8DA 1RIPA 1AE3A 1V1QA 5IE8A 2UXCQ 1UEBA 1Q1EA 1GD7A 3J80i 4DR6Q 1G6PA 2AMCB 1CKNB 2KHJA 4LWCA 4HJ7A 1Y1WG 2BH8A 4DAMA 2BA0A 4P71A 5C44G 4DUZL 5IYCG 1EFWA 1Q81C 2CFMA 3KLWA 1S40A 2E5LQ 4DR6L 2GVBA 1GVPA 3S1RH 1M1KC 4ALPA 3CCQA 1E24A 1CSQA 1PYSB 3S24A 4FDBA 1KQSA 1N34Q 4JV5Q 1TXYA 2D0OA 1N8RC 2DGYA 1HH2P 1S3OA 1HZAA 1K0RA 4YWLA 2E5LL 4WJ3M 3CCMA 4HJAA 4DPGA 2JEAI 2ZM6Q 2UUBQ 4B3RQ 5C0XJ 1FJGQ 1N34L 3OYYA 3S17H 1N9WA 4JI2Q 4JV5L 2F3IA 3A0JA 1IZ6A 1J5EQ 3M3YH 3H15A 1E1OA 2PNHA 3A5ZB 3CW2C 2ZM6L 2E2JH 2UUBL 2JK8A 1X6OA 2OQ0A 2XGTA 1QZGA 1FJGL 4A3BH 1TWHH 4JI2L 1HNZL 3CCJA 1YHQA 1N33Q 4A3DH 1J5EL 5IYDG 2Q2UA 3GTKH 1X54A 3PUWA 2Q2HA 4B3MQ 3U4VA 1YJNA 1WJJA 4XIGS 3J80c 4DV0Q 1VQ4A 3CF5A 4PMWA 1N33L 1VQ9A 3AYHB 4A3LH 3K7UC 5GAEC 3K81C 3PGZA 4QGUA 4A3GG 3G6EA 2B3GA 2N78A 2Z6KC 4LUVA 4X65Q 4IPCA 3G4SA 4X62Q 3TS0A 5FLMH 1YNXA 4Y7NH 3F2BA 4DV0L 5C0XG 4A3CH 3PUXA 1VQNA 3BZKA 1J6QA 1EIFA 1KRSA 2ID0A 1BBWA 4DR5Q 1X65A 2YTXA 5HY6A 3MEFA 1OXSC 3CXCA 3AFQA 5IWAQ 4X65L 4QJFA 5M5YH 4IPHA 4X62L 4A75A 3IRBA 3GTOH 5LMNQ 1YVCA 4DR5L 4PZ7A 1L0WA 4DAYB 1U0LA 3GO5A 3RR5A 3RN5A 3TRZA 4OX9Q 5IWAL 5IY0A 1HR0Q 1VCIA 3I2ZA 4DR7Q 2F4VQ 5LMNL 1YZ6A 2Z6KA 3I4MH 3FP9A 2PI2A 2A19A 2HIXA 2I5MX 4AH6A 4OX9L 3PF4A 2VQEQ 1LTLA 4GOPC 4BY7H 3PO2G 4GLVB 2OQKA 1HR0L 1JMCA 4OWTB 4DR7L 2F4VL 3CCRA 2ZJQA 1TWAH 4B3SQ 1G291 4BA2I 2B29A 3ULLA 1OTCA 4LNQA 1KRTA 2IHEA 5IP9G 4DV4Q 1TWCH 4DKAC 4A3JG 5M3FH 4A93G 4OONA 1OXVA 4DV5Q 5C4JH 4JBKA 1Q8KA 1YJ9A 4DV4L 2YU9H 4X6AH 1Y14B 2RHSB 3AQQA 1E22A 1VQBA 4HIKA 4GOPA 3PSIA 2JE6I 4DV5L 3PV0A 1VQ5A 3S14H 1T9HA 2GN5A 1B70B 5BR8Q 3H3VH 1A8VA 3ERSX 3GTLH 3S2HH 4A3IH 4BXXG 2IT1A 1VQ8A 2L15A 3HKZE 1EWIA 3KF6A 4A3KH 2Q2IA 4JCVE 4DK6C 3F2CA 4QY7A 1QVGA 1IL2A 5BR8L 2BA1A 4JI8Q 3CMEA 1Y1WH 4JI5Q 5E7NA 2R92G 2MO0A 1JJGA 3GD7A 3KOJA 1S72A 1JE5A 2KBNA 1IBKQ 4JI8L 1HNXQ 4GOPB 4JI5L 4APVA 1SMXA 3J7ZC 3HKZG 2KHIA 4TVAB 3S1NH 1WOCA 1C7YA 3TS2A 1TWGH 3CP0A 1PFSA 1I50H 1NTGA 1IBKL 2XTIA 3CAMA 1HNXL 3J81i 3I55A 4OO1I 5J3BA 4IPDA 1PH9A 3BU2A 4O0AA 3RNUA 1MIUA 4X66Q 3PUZA 3RN2A 1EQRA 1VQCA 4JI6Q 4OXPA 4JG2A 3CC7A 2NVTH 2YYZA 1AE2A 1QZHA 3HOZH 3CPFA 1HZ9A 1V9PA 3L7ZC 4L5TA 3W1BA 2UUCQ 3NBHB 1PH5A 2Z0SA 4X66L 4LF8Q 3UE1A 1VQFA 4HIMA 1VQDA 1IBLQ 4JI6L 1Y1VG 4MTNA 1Q7YC 5AJ3Q 4POGA 3DLLA 2UUCL 3E0EA 4IJLA 1QVCA 2D0PA 3AFPA 4PG3A 2QA4A 2MO1A 2R7DA 4LF8L 2B63H 2UXCL 1IBLL 1W2BA 1K9MC 2ZTEA 4QL5A 1KL9A 5AJ3L 2N8NA 2JA8G 4R1JA 1HJPA 3TREA 1JB7A 3KYHC 3G71A 4OWWB 4BBSH 2EXDA 3GTPH 2UXDQ 3GTMH 3STBC 1PYBA 3J81c 1KHIA 2OWOA 3BJUA 1D7QA 1I94Q 4O2DA 4P74A 1P8LA 1KD1C 2ZTCA 4QQBX 4IPGA 3I4NG 3KFUA 3TEHB 1FVIA 1UE7A 4BY1G 2UXDL 1A63A 1B8AA 2AKWB 1MKHA 3E9HA 5C4XG 3A5UA 1I94L 3PO2H 3BZCA 3F8TA 2JEBI 1LYLA 4GS3A 2JA7G 1SN8A 2FXQA 1PH3A 5IYBG 5FLXc 1XMOQ 1Q82C 4NXNQ 2VUMG 5IP9H 1UE1A 1SR3A 4A3JH 4A93H 1JT8A 1YJWA 4DV1Q 3CCEA 1HZCA 2K5NA 1XPOA 4UP8A 1JJ2A 3FKIH 1XMOL 2F52A 4NXNL 1Q86C 4DR4Q 4LF9Q 1PH7A 5M3MG 1GM5A 2ZJPA 4DV1L 2ZTDA 4UY8C 4R4OA 2K52A 2K4KA 2JQOA 4C2MH 1GKHA 3CC2A 4JOIC 5IT9c 4DV6Q 4DR4L 2MNAA 4LF9L 4BXXH 2K75A 1SRUA 3DM3A 4UP7A 2IY5B 3M7NA 1PH1A 2JA5G 1N32Q 1YI2A 3AEVA 4C3JH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P16 A;  4DV6 L;  2PQA A;  4DUY Q;  2R92 H;  1U5K A;  4GNX C;  4DNI A;  3NEN A;  1NBW A;  1N32 L;  4B3S L;  2JJQ A;  3I4O A;  3HKS A;  4KLK A;  5GAH C;  4IFD J;  4EX5 A;  4A3E G;  4DUY L;  4LFC Q;  1WCM G;  2VQE L;  4JOI A;  2WAQ E;  4KI0 A;  4A76 A;  3MXN B;  3EBE A;  4L5R C;  2LXJ A;  5IP7 G;  3HOX G;  2A8V A;  1N36 Q;  5ELO A;  1SE8 A;  3J81 j;  2QEX A;  1NY4 A;  2C35 B;  1IBM Q;  1Q12 A;  3SGI A;  1L1O C;  4LFA Q;  1EUJ A;  4LFC L;  3GTJ H;  4AYB E;  1XJV A;  3CD6 A;  1SRO A;  5JJL A;  2HHH Q;  4A3B G;  2N3S A;  1PHJ A;  3HOV G;  5M5X H;  5EAY A;  2PQA B;  4Y52 H;  3CMA A;  4GNX A;  4A3M G;  1IBM L;  5FJ8 G;  3GTQ H;  4LFA L;  1RL2 A;  2R6G A;  4KHZ A;  2R93 G;  2K5H A;  2MFI A;  1X3F A;  4K0K Q;  1PH8 A;  4R4C A;  3KF8 B;  3M4Q A;  1VQO A;  2HHH L;  2WAQ G;  1NE3 A;  4C3I H;  4JI7 Q;  1KXL A;  3ZJY C;  2UXB Q;  2JA6 G;  5H1S E;  2CWA A;  4JI3 Q;  3CPW A;  1Y1V H;  2A1A A;  2AHO B;  4IFD I;  1VQA A;  3M9B A;  3CQZ H;  1Q1B A;  5LMN W;  4K0K L;  4IFD G;  2DUD A;  5ELN A;  4AYB G;  3EIV A;  4JI7 L;  3HOY G;  2Y0S G;  1VQH A;  1L2F A;  5C44 H;  1UE5 A;  5IYC H;  2RF4 A;  3ULP A;  2UXB L;  2KCT A;  3KJP A;  4JI3 L;  1WI5 A;  2E8G A;  1HR0 W;  5K36 G;  1O7I A;  4B3T Q;  3OTO Q;  2JA8 H;  4GNX B;  2ASB A;  2OCE A;  4A3F G;  4YWK A;  2K5V A;  2WB1 E;  4BBR G;  1PH2 A;  4IJH A;  1YIJ A;  3A74 A;  3UDG A;  3KF6 B;  4B3T L;  2NVX H;  3F1Z A;  3OTO L;  3M4O H;  5M5W H;  4NB3 A;  1XNQ Q;  3JAM i;  2BH2 A;  4OO1 G;  2PMZ E;  1X3G A;  3PO3 G;  3B6Y A;  1FL0 A;  4R4T A;  5JEA J;  3H0G G;  1K73 C;  3RZO H;  5JJK A;  2LSS A;  2NN6 I;  3CC4 A;  1QUQ A;  1KIX A;  2YV5 A;  4J15 A;  2R7F A;  1PA6 A;  1QVF A;  1XNQ L;  3I4N H;  1MJC A;  2R7Z G;  3ULJ A;  1I6H H;  1VS0 A;  2WFW A;  1KC8 C;  2WB1 G;  5C4X H;  2AWO A;  2UU9 Q;  2I0Q A;  3U58 A;  5IYD H;  1K3R A;  3PIP A;  4HJ5 A;  2HIV A;  4GKK Q;  4QIW E;  5HGQ A;  2YTV A;  1IYJ B;  2RHQ B;  4P75 A;  1UE6 A;  2ALY B;  4YCU A;  5GAG C;  2NZO A;  2UU9 L;  1A0I A;  2K14 A;  2VUM H;  4GN5 A;  4GKK L;  2NVY H;  1W3S A;  3K7A H;  4A3G H;  1WFQ A;  1QUQ B;  3D31 A;  4JC0 A;  4PZ8 A;  3UDX A;  1Q46 A;  1VQI A;  3PUY A;  5JEA G;  3S16 H;  1GO3 E;  2K50 A;  3UDI A;  1TWF H;  3KDF A;  4BA1 I;  4A3K G;  1C0A A;  4XTC S;  1H95 A;  1PV4 A;  3E9I A;  3JC6 6;  2V1C C;  4P73 A;  1B7Y B;  4DV2 Q;  1K83 H;  2Q2T A;  1VQL A;  1V43 A;  1VQP A;  3JAM c;  3GTG H;  3F2D A;  4DR3 Q;  4UP9 A;  3M85 A;  2UUA Q;  2E2I H;  1EYG A;  2JA5 H;  3HOW G;  1HNW Q;  4NXM Q;  2N49 A;  2PI2 E;  1I3Q H;  1BVS A;  5GAD C;  4DV2 L;  2D62 A;  4JI1 Q;  3WWV A;  5LMU Q;  4DR3 L;  2UUA L;  1R9T H;  3M4P A;  1HNW L;  2QGQ A;  4NXM L;  5C3E G;  4JBM A;  2CKZ B;  3KDF B;  3FHW A;  5GQO A;  4A3E H;  1Z47 A;  5GRO A;  4JI1 L;  4PZ6 A;  1WCM H;  2VY3 A;  5LMU L;  3HOU G;  2HQL A;  3RLN A;  3CCV A;  4LF5 Q;  1LM0 A;  4YHH Q;  5IP7 H;  3HOX H;  4JI4 Q;  1HNZ Q;  3RZD H;  1CUK A;  2KCM A;  3W5O A;  1ASZ A;  1XPU A;  3NEL A;  3HOZ G;  2NZH A;  2CWP A;  4IOC A;  1X55 A;  1K8A C;  1VQM A;  4GKJ Q;  4LF5 L;  4YHH L;  3HOV H;  4LUZ A;  4JI4 L;  4IOA A;  2I5H A;  4MNO A;  4A3M H;  5FJ8 H;  1VQJ A;  3VDY A;  1CKO A;  4JI0 Q;  1NMF A;  2R93 H;  2VZA A;  4EQ5 A;  4YCW A;  4GKJ L;  4TQU S;  2JA9 A;  1PVO A;  2ES2 A;  1G51 A;  4GLA C;  1FGU A;  3RLO A;  2B63 G;  2JA6 H;  2CCZ A;  3I56 A;  4JI0 L;  4DV7 Q;  3S1Q H;  1PH6 A;  3TQY A;  2VW9 A;  2ZJR A;  2I5L X;  3HOY H;  1KAW A;  5C0X I;  4JYA Q;  2CQO A;  2H5X A;  2YTY A;  3PIO A;  3S1M H;  3HFZ B;  1YEZ A;  4UPA A;  3K0X A;  1EOV A;  4HIO A;  4DV7 L;  1XNR Q;  1D8L A;  4LUO A;  3OW2 A;  4R4Q A;  3RLF A;  4A4I A;  3CCU A;  4BBS G;  4JYA L;  4HID A;  1ASY A;  4DK3 C;  3KJO A;  3LGJ A;  4A3F H;  1VQ7 A;  1E7Z A;  4BBR H;  3PUV A;  2MQH A;  4JBJ A;  1XMQ Q;  1XNR L;  1HZB A;  1K8G A;  1OXX K;  1YIT A;  4RMF A;  4H02 A;  2Y0S E;  3U4Z A;  3PO3 H;  2E2H H;  4AIM A;  1IXR A;  4WJ4 A;  3H0G H;  1N36 L;  1XMQ L;  2NVQ H;  3GDE A;  4A3D G;  4C3H H;  4B3R L;  4L5Q A;  1VQE A;  4POF A;  4DR2 Q;  1X9N A;  2R7Z H;  3J7A 5;  3NEM A;  4YWM A;  5DLQ E;  4A3L G;  2EQS A;  1SLJ A;  3K8A A;  4X64 Q;  1JJC B;  4GN4 B;  2VNU D;  2IX1 A;  3I7F A;  2IX0 A;  3D0F A;  1L1O A;  3UE0 A;  4YY3 Q;  3L2P A;  4DR2 L;  2GVA A;  5FLM G;  4AQY Q;  1NJI C;  3CCL A;  4A3C G;  1NMG A;  1OXU A;  1X56 A;  2EIF A;  4HJ9 A;  1E1T A;  2RCN A;  3FKI G;  1XPR A;  3EN2 A;  1VQ6 A;  4DV3 Q;  4X64 L;  3T1Y Q;  4OWX B;  4LF4 Q;  4KHP Q;  1MJE A;  4P72 A;  1M90 C;  4YY3 L;  4LFB Q;  3PCO B;  4AQY L;  1VQG A;  1Z9F A;  4B3M L;  4RG1 A;  4LW1 A;  4DV3 L;  2VQF Q;  1BBU A;  3T1Y L;  4LF4 L;  3STB D;  4KHP L;  1WYD A;  2ATW A;  2IHF A;  4LF6 Q;  1A62 A;  4LFB L;  3T1H Q;  4IO9 A;  3UDF A;  1DGS A;  3G48 A;  3I4M G;  3W1G A;  2KEN A;  1E3P A;  1OXT A;  1PH4 A;  1BKB A;  2HT1 A;  1L1O B;  4JBW A;  2VQF L;  3ICE A;  4BY7 G;  1VQK A;  1UWV A;  4LF6 L;  3S15 H;  4L5S A;  2NN6 G;  1YBY A;  1YHB A;  3T1H L;  3HOW H;  2AWN A;  1XTD A;  3PF5 A;  4BY1 H;  1CSP A;  2LXK A;  2VL6 A;  1AH9 A;  1X3E A;  4LF7 Q;  4HJ8 A;  4GN3 B;  4DR1 Q;  3S2D H;  4MZ9 A;  3L0O A;  5M3F G;  1CKN A;  1SFO H;  4NPS A;  1LUZ A;  1I5F A;  5C3E H;  2JA7 H;  2OTJ A;  5IYB H;  4LF7 L;  3U50 C;  1YHA A;  2WP8 J;  3ER0 A;  3K80 C;  4R4I A;  4DR1 L;  3HOU H;  4YCV A;  3H3V I;  3CCS A;  1C9O A;  5JJI A;  1EQQ A;  1CKM A;  4ME3 A;  4A3I G;  2VS1 A;  2OTL A;  4DUZ Q;  1EIY B;  5M3M H;  4GLX A;  3Q8D A;  1RIP A;  1AE3 A;  1V1Q A;  5IE8 A;  2UXC Q;  1UEB A;  1Q1E A;  1GD7 A;  3J80 i;  4DR6 Q;  1G6P A;  2AMC B;  1CKN B;  2KHJ A;  4LWC A;  4HJ7 A;  1Y1W G;  2BH8 A;  4DAM A;  2BA0 A;  4P71 A;  5C44 G;  4DUZ L;  5IYC G;  1EFW A;  1Q81 C;  2CFM A;  3KLW A;  1S40 A;  2E5L Q;  4DR6 L;  2GVB A;  1GVP A;  3S1R H;  1M1K C;  4ALP A;  3CCQ A;  1E24 A;  1CSQ A;  1PYS B;  3S24 A;  4FDB A;  1KQS A;  1N34 Q;  4JV5 Q;  1TXY A;  2D0O A;  1N8R C;  2DGY A;  1HH2 P;  1S3O A;  1HZA A;  1K0R A;  4YWL A;  2E5L L;  4WJ3 M;  3CCM A;  4HJA A;  4DPG A;  2JEA I;  2ZM6 Q;  2UUB Q;  4B3R Q;  5C0X J;  1FJG Q;  1N34 L;  3OYY A;  3S17 H;  1N9W A;  4JI2 Q;  4JV5 L;  2F3I A;  3A0J A;  1IZ6 A;  1J5E Q;  3M3Y H;  3H15 A;  1E1O A;  2PNH A;  3A5Z B;  3CW2 C;  2ZM6 L;  2E2J H;  2UUB L;  2JK8 A;  1X6O A;  2OQ0 A;  2XGT A;  1QZG A;  1FJG L;  4A3B H;  1TWH H;  4JI2 L;  1HNZ L;  3CCJ A;  1YHQ A;  1N33 Q;  4A3D H;  1J5E L;  5IYD G;  2Q2U A;  3GTK H;  1X54 A;  3PUW A;  2Q2H A;  4B3M Q;  3U4V A;  1YJN A;  1WJJ A;  4XIG S;  3J80 c;  4DV0 Q;  1VQ4 A;  3CF5 A;  4PMW A;  1N33 L;  1VQ9 A;  3AYH B;  4A3L H;  3K7U C;  5GAE C;  3K81 C;  3PGZ A;  4QGU A;  4A3G G;  3G6E A;  2B3G A;  2N78 A;  2Z6K C;  4LUV A;  4X65 Q;  4IPC A;  3G4S A;  4X62 Q;  3TS0 A;  5FLM H;  1YNX A;  4Y7N H;  3F2B A;  4DV0 L;  5C0X G;  4A3C H;  3PUX A;  1VQN A;  3BZK A;  1J6Q A;  1EIF A;  1KRS A;  2ID0 A;  1BBW A;  4DR5 Q;  1X65 A;  2YTX A;  5HY6 A;  3MEF A;  1OXS C;  3CXC A;  3AFQ A;  5IWA Q;  4X65 L;  4QJF A;  5M5Y H;  4IPH A;  4X62 L;  4A75 A;  3IRB A;  3GTO H;  5LMN Q;  1YVC A;  4DR5 L;  4PZ7 A;  1L0W A;  4DAY B;  1U0L A;  3GO5 A;  3RR5 A;  3RN5 A;  3TRZ A;  4OX9 Q;  5IWA L;  5IY0 A;  1HR0 Q;  1VCI A;  3I2Z A;  4DR7 Q;  2F4V Q;  5LMN L;  1YZ6 A;  2Z6K A;  3I4M H;  3FP9 A;  2PI2 A;  2A19 A;  2HIX A;  2I5M X;  4AH6 A;  4OX9 L;  3PF4 A;  2VQE Q;  1LTL A;  4GOP C;  4BY7 H;  3PO2 G;  4GLV B;  2OQK A;  1HR0 L;  1JMC A;  4OWT B;  4DR7 L;  2F4V L;  3CCR A;  2ZJQ A;  1TWA H;  4B3S Q;  1G29 1;  4BA2 I;  2B29 A;  3ULL A;  1OTC A;  4LNQ A;  1KRT A;  2IHE A;  5IP9 G;  4DV4 Q;  1TWC H;  4DKA C;  4A3J G;  5M3F H;  4A93 G;  4OON A;  1OXV A;  4DV5 Q;  5C4J H;  4JBK A;  1Q8K A;  1YJ9 A;  4DV4 L;  2YU9 H;  4X6A H;  1Y14 B;  2RHS B;  3AQQ A;  1E22 A;  1VQB A;  4HIK A;  4GOP A;  3PSI A;  2JE6 I;  4DV5 L;  3PV0 A;  1VQ5 A;  3S14 H;  1T9H A;  2GN5 A;  1B70 B;  5BR8 Q;  3H3V H;  1A8V A;  3ERS X;  3GTL H;  3S2H H;  4A3I H;  4BXX G;  2IT1 A;  1VQ8 A;  2L15 A;  3HKZ E;  1EWI A;  3KF6 A;  4A3K H;  2Q2I A;  4JCV E;  4DK6 C;  3F2C A;  4QY7 A;  1QVG A;  1IL2 A;  5BR8 L;  2BA1 A;  4JI8 Q;  3CME A;  1Y1W H;  4JI5 Q;  5E7N A;  2R92 G;  2MO0 A;  1JJG A;  3GD7 A;  3KOJ A;  1S72 A;  1JE5 A;  2KBN A;  1IBK Q;  4JI8 L;  1HNX Q;  4GOP B;  4JI5 L;  4APV A;  1SMX A;  3J7Z C;  3HKZ G;  2KHI A;  4TVA B;  3S1N H;  1WOC A;  1C7Y A;  3TS2 A;  1TWG H;  3CP0 A;  1PFS A;  1I50 H;  1NTG A;  1IBK L;  2XTI A;  3CAM A;  1HNX L;  3J81 i;  3I55 A;  4OO1 I;  5J3B A;  4IPD A;  1PH9 A;  3BU2 A;  4O0A A;  3RNU A;  1MIU A;  4X66 Q;  3PUZ A;  3RN2 A;  1EQR A;  1VQC A;  4JI6 Q;  4OXP A;  4JG2 A;  3CC7 A;  2NVT H;  2YYZ A;  1AE2 A;  1QZH A;  3HOZ H;  3CPF A;  1HZ9 A;  1V9P A;  3L7Z C;  4L5T A;  3W1B A;  2UUC Q;  3NBH B;  1PH5 A;  2Z0S A;  4X66 L;  4LF8 Q;  3UE1 A;  1VQF A;  4HIM A;  1VQD A;  1IBL Q;  4JI6 L;  1Y1V G;  4MTN A;  1Q7Y C;  5AJ3 Q;  4POG A;  3DLL A;  2UUC L;  3E0E A;  4IJL A;  1QVC A;  2D0P A;  3AFP A;  4PG3 A;  2QA4 A;  2MO1 A;  2R7D A;  4LF8 L;  2B63 H;  2UXC L;  1IBL L;  1W2B A;  1K9M C;  2ZTE A;  4QL5 A;  1KL9 A;  5AJ3 L;  2N8N A;  2JA8 G;  4R1J A;  1HJP A;  3TRE A;  1JB7 A;  3KYH C;  3G71 A;  4OWW B;  4BBS H;  2EXD A;  3GTP H;  2UXD Q;  3GTM H;  3STB C;  1PYB A;  3J81 c;  1KHI A;  2OWO A;  3BJU A;  1D7Q A;  1I94 Q;  4O2D A;  4P74 A;  1P8L A;  1KD1 C;  2ZTC A;  4QQB X;  4IPG A;  3I4N G;  3KFU A;  3TEH B;  1FVI A;  1UE7 A;  4BY1 G;  2UXD L;  1A63 A;  1B8A A;  2AKW B;  1MKH A;  3E9H A;  5C4X G;  3A5U A;  1I94 L;  3PO2 H;  3BZC A;  3F8T A;  2JEB I;  1LYL A;  4GS3 A;  2JA7 G;  1SN8 A;  2FXQ A;  1PH3 A;  5IYB G;  5FLX c;  1XMO Q;  1Q82 C;  4NXN Q;  2VUM G;  5IP9 H;  1UE1 A;  1SR3 A;  4A3J H;  4A93 H;  1JT8 A;  1YJW A;  4DV1 Q;  3CCE A;  1HZC A;  2K5N A;  1XPO A;  4UP8 A;  1JJ2 A;  3FKI H;  1XMO L;  2F52 A;  4NXN L;  1Q86 C;  4DR4 Q;  4LF9 Q;  1PH7 A;  5M3M G;  1GM5 A;  2ZJP A;  4DV1 L;  2ZTD A;  4UY8 C;  4R4O A;  2K52 A;  2K4K A;  2JQO A;  4C2M H;  1GKH A;  3CC2 A;  4JOI C;  5IT9 c;  4DV6 Q;  4DR4 L;  2MNA A;  4LF9 L;  4BXX H;  2K75 A;  1SRU A;  3DM3 A;  4UP7 A;  2IY5 B;  3M7N A;  1PH1 A;  2JA5 G;  1N32 Q;  1YI2 A;  3AEV A;  4C3J H; 
#chains in the Genus database with same CATH topology
 4YIJ A;  2EY2 A;  1QB5 D;  4B3S L;  3I4O A;  3HKS A;  5GAH C;  2QF7 A;  2BCO A;  4EX5 A;  1F2Z A;  2CW0 D;  4X3K A;  1G6Z A;  4L5R C;  1W6K A;  2LXJ A;  2FJ2 A;  5ELO A;  1B44 D;  3SGI A;  4LFA Q;  2N3S A;  2CHB D;  2PQA B;  4GNX A;  3K5M A;  5FJ8 G;  1O7L A;  2QKI C;  4KHZ A;  2MFI A;  4BWG B;  4R4C A;  3KF8 B;  4JI7 Q;  5IT9 E;  1EYA A;  1KXL A;  3ZJY C;  3TME A;  5F2D A;  1SYC A;  2A1A A;  4IFD G;  2EY5 A;  1L2F A;  1BR9 A;  1UE5 A;  2CVR A;  4H44 C;  2UXB L;  1SE4 A;  1W6J A;  4JI3 L;  3OTO Q;  3M7G A;  1LTR D;  2K5V A;  1PH2 A;  3UDG A;  2JP1 A;  1DXM A;  1XNQ Q;  3DWP A;  4OO1 G;  3PO3 G;  5JJK A;  4ZKC B;  4JVZ A;  3SR1 A;  1QUQ A;  2B2W A;  5FLX L;  2YV5 A;  2EZV A;  2R7F A;  3E3X A;  5EGT A;  1QVF A;  2EYJ A;  1MJC A;  3PMF A;  2EE1 A;  2Z1C A;  1KC8 C;  2WB1 G;  4U67 3;  2I0Q A;  4G7H C;  3N6R A;  5HGQ A;  3T51 B;  2CW0 C;  2RHQ B;  4P75 A;  2K14 A;  4CDD C;  2IW3 A;  1X3P A;  1K0S A;  1LAB A;  4JC0 A;  3D31 A;  3NTH A;  3S16 H;  2K50 A;  3UDI A;  4ILW A;  5J39 A;  3GTO B;  4XDX A;  2RSO A;  4KKU A;  1H95 A;  1HA6 A;  4P73 A;  1EYD A;  4XYO A;  4DR3 Q;  4UP9 A;  1NR4 A;  4C3J B;  1LLR D;  2JA5 H;  4OIK A;  4NXM Q;  2N49 A;  1I3Q H;  4DV2 L;  3ONA B;  4JI1 Q;  4NDX A;  5IGE A;  2UUA L;  4JBM A;  1QIL A;  4QCL A;  5LMU L;  3ERQ A;  1BOS A;  1D5X C;  2LKV A;  5M3F B;  4QMG A;  3IFD A;  1LM0 A;  4YHH Q;  2QW7 A;  3HOX H;  3Q23 A;  1AW7 A;  1WTP A;  1JE4 A;  1ASZ A;  2XWB B;  1F2L A;  1SYB A;  5M5X B;  1WD0 A;  3I8Z A;  3TDQ A;  3MXU A;  4JI4 L;  2I5H A;  3KUP A;  5DAU A;  1NR2 A;  1CKO A;  1TKW B;  1B50 A;  3ND8 A;  2VZA A;  4TQU S;  2ES2 A;  1TS3 A;  2KEE A;  4CJ0 B;  1HQM C;  5ELC A;  4JI0 L;  4XQJ A;  3HOY H;  5EJW A;  3PIO A;  2JSO A;  1YEZ A;  1EOV A;  2B8G A;  1S4Z A;  2A6E C;  3W3A A;  4LUO A;  4B08 A;  1XNR Q;  2JA8 B;  4R4Q A;  4A4I A;  3CCU A;  5E4X A;  1TWG B;  4DK3 C;  2ZXP A;  2MQH A;  3M4O B;  2NVX B;  5M5W B;  4RAU C;  1TY0 A;  4RMF A;  2F03 A;  3U4Z A;  2E2H H;  1IXR A;  4WJ4 A;  5KYL A;  2ZT9 C;  1N36 L;  2XIW A;  5IGF A;  3GDE A;  1A6X A;  1PFB A;  4KN4 C;  4POF A;  1I6H B;  3J7A 5;  3LWE A;  2XRS D;  3D8G A;  4X64 Q;  3QG1 A;  1OXU A;  4OEL B;  1XPR A;  1E1T A;  2VUM B;  1VQ6 A;  2JN4 A;  4A3G B;  1XWE A;  1M90 C;  5IOC A;  4AQY L;  3I3C A;  5JEA H;  4DV3 L;  4LF4 L;  4KHP L;  4IZ8 A;  4LF6 Q;  4LFB L;  2FMC A;  5E3F A;  4C3J G;  5C5L A;  3EFX D;  1BKB A;  2F0V A;  2E2I B;  1UWV A;  4L5S A;  1YBY A;  4WFN 3;  3T1H L;  1XTD A;  1GUN A;  1Z6H A;  4OL7 A;  1LT4 D;  5I2X A;  2F0G A;  2PW7 A;  4DR1 Q;  3S2D H;  2AQ1 B;  4MZ9 A;  5M3F G;  1D5Z C;  1MI2 A;  5KNB A;  1WCM B;  2OTJ A;  4MHE A;  3ER0 A;  3I70 A;  1F2Y A;  3RZD B;  1JOK A;  1BUV T;  2B2Y A;  2NYZ D;  1RDP D;  1EQQ A;  1PTO B;  4IUT A;  4ZUJ A;  1GXD C;  1EIY B;  4GLX A;  3Q8D A;  1RIP A;  1AE3 A;  1U9R A;  1V1Q A;  2FHT A;  2R93 B;  4KHV A;  2O5I C;  4E6I A;  4RFB A;  3J80 i;  1G6P A;  2KHJ A;  2WAQ B;  4IQZ A;  4P71 A;  2DY8 A;  5IYC G;  4DUZ L;  2F0I A;  5CBA E;  2CFM A;  3EVQ A;  2JYO A;  2SEB D;  4AYB B;  2GVB A;  4CJ2 C;  3CCQ A;  4ALP A;  1E24 A;  3OPO A;  2L0C A;  4JV5 Q;  2RVL A;  1DD2 A;  4WJ3 M;  1HH2 P;  1S3O A;  1KDA A;  2E5L L;  2P5Z X;  2JEA I;  3HKZ B;  3MC0 B;  2ZM6 Q;  4BBR B;  1LV9 A;  5CV5 A;  3S17 H;  3AU7 A;  3BYT B;  1J5E Q;  1IZ6 A;  3FPP A;  4B3R L;  2E2J H;  2XGT A;  2OQ0 A;  1QZG A;  1O78 A;  5EPJ A;  3H0G B;  1JB3 A;  1FJG L;  4JI2 L;  2RDH A;  4C3H B;  5IYD G;  2R7Z B;  4PQX A;  1GUO A;  3MXG A;  1LTB D;  3T13 A;  1Y1V B;  4PMW A;  3NK9 A;  4A3L H;  4XQQ A;  1EQV A;  3HEJ A;  3K81 C;  4QGU A;  1HXY D;  4A3G G;  3G6E A;  2Z6K C;  2N78 A;  3I91 A;  3LX0 A;  3F2B A;  4A3C H;  4I65 A;  3PUX A;  1VQN A;  4DR5 Q;  1EIF A;  5DM7 3;  1BBW A;  5K36 H;  1JWS D;  1OXS C;  1XTC D;  1VMP A;  4NMZ A;  5I6W A;  3CXC A;  4QJF A;  2V4D A;  5M5Y H;  2WIN B;  1YVC A;  2FFK B;  1STB A;  1DJR D;  4PZ7 A;  4L8J A;  1ROD A;  3FRP B;  2HUG A;  5IY0 A;  1VCI A;  3L3O C;  4DR7 Q;  2F4V Q;  5LMN L;  2K1B A;  4RWS C;  2A19 A;  2PI2 A;  4AH6 A;  2C9O A;  3S15 B;  3PO2 G;  4GLV B;  1HR0 L;  1D6E C;  2ZJQ A;  3KF8 A;  3D6W A;  1G29 1;  4ZQ3 A;  1OO9 B;  4DV4 Q;  2X69 A;  2RSN A;  1BXT A;  2CQA A;  3WDN A;  4OON A;  1LTI D;  5C4J H;  5BN3 A;  3QWN A;  2YU9 H;  1Y14 B;  1E22 A;  1VQB A;  3PSI A;  5COY A;  3S14 H;  1T9H A;  1STE A;  1A8V A;  3S2H H;  2L15 A;  2EYF A;  2A69 C;  3A7A B;  1ZKO A;  4QY7 A;  1FNW A;  2E2D C;  3CME A;  5E7N A;  1SNP A;  3BDO A;  3NBH A;  3HGB A;  1B53 A;  3S1R B;  1HNX Q;  3HRZ C;  4APV A;  2B2V A;  3HKZ G;  3S1N H;  3OSO A;  3TS2 A;  4FXK C;  3CP0 A;  3C3L A;  2A73 B;  2RA4 A;  1JWU D;  4PNY A;  3CAM A;  1I4G A;  1D1K A;  4HSP A;  3QR8 A;  1CHP D;  3BU2 A;  3J7Y W;  1CT1 D;  3CC7 A;  4C3H G;  2B8F A;  1AE2 A;  1QZH A;  5JOB A;  3L7Z C;  2UUC Q;  3SDZ A;  3HOV B;  1G8Z D;  1PH5 A;  3I72 A;  3H94 A;  1EY5 A;  3OWE B;  1IBL Q;  1Y1V G;  4G7Z C;  4CBV A;  2L12 A;  4MTK A;  1T5X D;  2D0P A;  1JQY D;  1GUT A;  1PRT F;  1W2B A;  4ODG A;  5AJ3 L;  3MA2 B;  2N8N A;  4F87 A;  1CQV A;  3VA5 A;  3CRL C;  4DXF A;  1H9K A;  2F0F A;  3K59 A;  3IL8 A;  4B9W A;  2EXD A;  1X3Q A;  3GTM H;  1WTR A;  1PYB A;  3J81 c;  3HG9 A;  1D7Q A;  4FF1 A;  4O2D A;  4KJO A;  1JIC A;  3QJY A;  3I4N G;  3KFU A;  3I4M B;  2UXD L;  1A63 A;  1B8A A;  2QCP X;  5C4X G;  4BY7 B;  4O42 A;  5CR3 A;  2ENB A;  5E1F A;  3BZC A;  1ENA A;  2JEB I;  1LYL A;  1SN8 A;  2PZT A;  4UDU C;  1O80 A;  3SK6 A;  4NXN Q;  3SK4 A;  1KDB A;  3EA6 A;  4A3J H;  3RUZ A;  4IAL A;  1K3B C;  1A3V A;  2K5N A;  4K8J A;  4IN3 A;  2J7Z A;  5EPL A;  2F52 A;  4JPB W;  4DR4 Q;  1ESR A;  1PH7 A;  1C48 A;  2ZJP A;  1PYW D;  2K4K A;  2JQO A;  3MXN A;  3GTL B;  1J8I A;  4DV6 Q;  2MNA A;  3J81 E;  4A3K B;  2K75 A;  1SRU A;  1VF7 A;  1LT3 D;  4K2K A;  2XVS A;  1PH1 A;  3AEV A;  1Y1W B;  2KVM A;  1ILQ A;  4DUY Q;  2R92 H;  2F0J A;  4GNX C;  4KD3 A;  4C1N I;  1N32 L;  2K01 A;  1U4M A;  1H9J A;  3V2T A;  4PMC A;  1FNU A;  2WAQ E;  1IW7 C;  2Q8T A;  1BBX C;  2K5W A;  5C3E B;  5IP7 G;  2A8V A;  5CV7 A;  1SE8 A;  1HUN A;  1L1O C;  1EUJ A;  3GTJ H;  4AYB E;  1ZYR D;  3OMC A;  2HHH Q;  4RGM A;  5G3L F;  5JVG 3;  3HOV G;  1U4L A;  4A3M G;  3GTQ H;  4LFA L;  1RL2 A;  4K0K Q;  1VQO A;  4C3I H;  4RHR A;  2JA6 G;  5KEE A;  2AHO B;  3CQZ H;  3DM1 A;  4JI7 L;  1Q90 A;  1VQH A;  4KJN A;  5C44 H;  3ULP A;  3ITP A;  2KCT A;  3X3N A;  1HQR D;  2B2W C;  3T4A C;  2IJ0 A;  3P75 A;  3CHB D;  3E5S A;  4B3T Q;  4A3F G;  2EY6 A;  4OHJ A;  4KN7 C;  1M8A A;  1EIG A;  1YIJ A;  4BBS B;  1A2T A;  3OTO L;  1DM0 B;  1O7Z A;  2Z4I A;  3B6Y A;  1FL0 A;  1ICF B;  5JEA J;  5KGU A;  1WTX A;  3RZO H;  2LSS A;  1AEX A;  3CC4 A;  1MSH A;  1XNQ L;  1YNJ D;  1VS0 A;  2WFW A;  4A3D B;  1QWY A;  1K3R A;  3PIP A;  4GKK Q;  3K5O A;  1PZK D;  2F1M A;  1WTQ A;  2KCC A;  2ZXO A;  2NZO A;  3KBG A;  1TU2 B;  2X6G A;  2NVY H;  1B9N A;  1ICW A;  2KED A;  1ZYR C;  3UDX A;  3PUY A;  2F0W A;  1TWF H;  3GP7 A;  4A3K G;  4XTC S;  2EPB A;  1PV4 A;  2D2C C;  2Q2T A;  1VQP A;  2LY7 A;  1E2V A;  2A68 D;  4K6D A;  3HOW G;  1HNW Q;  1M4V A;  1BVS A;  4CDE C;  2FMM A;  4DR3 L;  1R9T H;  4R8I A;  3I73 A;  3M4P A;  5HUR A;  3PIP 3;  4NXM L;  1LTS D;  5C3E G;  2CKZ B;  3KDF B;  2F0M A;  5GQO A;  1Z47 A;  3C1E A;  4JI1 L;  2I46 A;  4PZ6 A;  2VY3 A;  3SK8 A;  3HOU G;  3RLN A;  4LF5 Q;  1HNZ Q;  2KCM A;  1BCP D;  5C3W A;  1XPU A;  2NZH A;  2CWP A;  4IOC A;  1X55 A;  1K8A C;  4GKJ Q;  4ID6 A;  2EJG C;  5IOD A;  4YHH L;  4IUQ A;  3NQI A;  1SXT A;  4EVO A;  5FJ8 H;  5CYU A;  1NMF A;  4A3I B;  3BYY B;  1EY8 A;  1ZEQ X;  4GLA C;  1FGU A;  2ICI A;  3RLO A;  2BE5 C;  4QB4 A;  2XNA C;  1SEB D;  4DV7 Q;  1PH6 A;  2Z8L A;  4K6L A;  4JYA Q;  4LMQ D;  3S1M H;  4KY5 A;  4KY6 A;  2PZW A;  3K0X A;  4UPA A;  4ZUI A;  1C4Q A;  4BBS G;  3D4D A;  3LGJ A;  1E7Z A;  1XMQ Q;  1XNR L;  3GQB A;  1K8G A;  3A56 A;  2NBF A;  3OW7 A;  2H1E A;  4RCO A;  3PO3 H;  4OO1 H;  4OEM B;  1PMR A;  4NKL A;  5LL6 S;  2NVQ H;  4A3D G;  3BDL A;  1F9S A;  2IX3 A;  4DR2 Q;  5FOB B;  1QE6 A;  3P7J A;  1SLJ A;  3K8A A;  1RHP A;  1JJC B;  5C3X A;  2IX1 A;  3I7F A;  4YY3 Q;  1L1O A;  1NJI C;  3SHL A;  2EIF A;  3A7L A;  2A6H D;  4X64 L;  1BCP C;  3JAM L;  4UHV A;  1VQG A;  1Z9F A;  1D1I A;  3A8I E;  5EBD A;  3S16 B;  4RG1 A;  4LW1 A;  5CV9 A;  1HFG A;  2VQF Q;  1BBU A;  2ATW A;  2IHF A;  1A62 A;  3MWY W;  4IO9 A;  1DGS A;  3G48 A;  4IUN A;  1E3P A;  2KEN A;  1U4R A;  4CKE A;  4JBW A;  1DZ1 A;  3ICE A;  1VQK A;  2IL8 A;  2JA5 B;  4LF6 L;  2NN6 G;  2B2Y C;  1I3Q B;  5KND A;  3QIA A;  2AUJ D;  4Q5V A;  4ULL A;  2VL6 A;  3PF5 A;  1YNN D;  1ONL A;  1HCZ A;  4LF7 Q;  1ESF A;  1CTM A;  4GN3 B;  5COR A;  1K28 A;  1LUZ A;  2MUY A;  3NUC A;  3K5L A;  4DNR B;  5IYB H;  1YHA A;  2F0Q A;  4DR1 L;  3KBX A;  1C9O A;  5JJI A;  4ZK9 B;  1V1P A;  4A3I G;  2VS1 A;  5M3M H;  1LAC A;  1AN8 A;  5IE8 A;  2K5D A;  2HCI A;  1UEB A;  1GD7 A;  1CKN B;  4LWC A;  2XN9 C;  5CV8 A;  5FK9 C;  3I90 A;  4DA2 A;  1A15 A;  3HOY B;  2A6H C;  3S24 A;  4FDB A;  1HTL D;  1PRT B;  5FKA C;  2D0O A;  4JW0 A;  1N8R C;  1HZA A;  4HJA A;  1GUS A;  4JV5 L;  3A0J A;  3H15 A;  1E1O A;  2PNH A;  3A5Z B;  2ZM6 L;  2E2H B;  5IGG A;  1X6O A;  3H6M A;  4K2L A;  4A3B H;  4M1U B;  4I7A A;  1K8M A;  1YI2 A;  3MTS A;  1N33 Q;  2F0E A;  1J5E L;  1BF4 A;  3GV6 A;  3U4V A;  4XIG S;  3WOF A;  3J80 c;  4DV0 Q;  3K57 A;  2EJM A;  3TZU A;  4LUV A;  4IPC A;  3G4S A;  4X62 Q;  4HTH A;  3TS0 A;  5C0X G;  3BZK A;  5EBC A;  5LL6 X;  1KDC A;  3AFQ A;  3GTO H;  4FYD A;  4DR5 L;  4DAY B;  3TRZ A;  1B3Q A;  4OX9 Q;  2C5C A;  2DJG C;  3I2Z A;  2PYK A;  2G5D A;  2I5M X;  1CZW A;  2HIX A;  3HS0 C;  2DY7 A;  1LTL A;  4XT3 B;  2OQK A;  1ENF A;  2F4V L;  4DR7 L;  1TS2 A;  1PZI D;  1TWA H;  3VA7 A;  2Q8I B;  1FD7 D;  4LNQ A;  3J80 E;  4KMU C;  3S2D B;  2IHE A;  2NB0 A;  2K28 A;  3H09 A;  1D2B A;  2D5D A;  5M3F H;  4XYQ A;  4HSV A;  4IUR A;  2HQE A;  3G7L A;  1MBY A;  2Z9H A;  3NTI A;  3D6C A;  4TSS A;  3PIO 3;  1Q8K A;  1TT2 A;  4DV4 L;  4X6A H;  2RHS B;  3AQQ A;  3E6Z X;  4GOP A;  2JE6 I;  1VQ5 A;  1B70 B;  3H3V H;  2B2V C;  4U68 A;  1DOM A;  4CKB A;  2Q2I A;  4RH6 A;  2MHV A;  1LTT D;  1QNK A;  2DN8 A;  2MPM A;  2ZXR A;  2MO0 A;  3KOJ A;  1S72 A;  3ERO A;  1JE5 A;  1J9O A;  1IBK Q;  1K8O A;  3ZYY X;  1EZ8 A;  4TVA B;  4M8A A;  1C7Y A;  2EDG A;  1TWG H;  1PFS A;  4IUP A;  5CV4 A;  1I50 H;  1NTG A;  4A3E B;  1HNX L;  3DWA A;  4OO1 I;  5C6A A;  3U9S A;  2RDG A;  1BO0 A;  1PH9 A;  3VYU A;  4X66 Q;  1JR0 D;  2QDL A;  4NW2 A;  4JG2 A;  4JI6 Q;  2E2J B;  1R4P B;  3HOZ H;  4L5T A;  1TII D;  4ZRZ A;  2RBM A;  5I6Y A;  4LF8 Q;  3UE1 A;  1VQF A;  4POG A;  2UUC L;  2R61 A;  5D3D A;  1II3 A;  2MO1 A;  1RKN A;  2L55 A;  2B63 H;  2UXC L;  5EPK A;  1IBL L;  2ZTE A;  4QL5 A;  5I9P A;  5KYI A;  4RGT A;  2JA8 G;  4WJW A;  1JOR A;  3H3V C;  4R9W A;  1VMC A;  2PCF B;  5M5Y B;  4HCS A;  3KYH C;  1HUM A;  2K7V A;  4QUC A;  3GTP H;  3VR4 A;  5T1G A;  1KHI A;  3BVM A;  3T53 B;  4H7B A;  1QJO A;  1I94 Q;  4P74 A;  4QQB X;  4HAE A;  2ZTC A;  3NQT A;  4IPG A;  3BVZ A;  3NPP A;  5EKK A;  1UUP A;  3PO2 H;  3FMC A;  2G9D A;  1EFI D;  2K32 A;  4IUV A;  4GS3 A;  1BQQ T;  5FLX c;  1XMO Q;  2VUM G;  1SJE D;  1UE1 A;  1STY A;  4BS9 A;  1JT8 A;  4J8Q A;  5C4J B;  1PTO D;  1FNV A;  1B9M A;  1HZC A;  3CCE A;  1JJ2 A;  4UP8 A;  4V19 0;  3FKI H;  4NXN L;  1PTO H;  1WTW A;  4HN7 A;  4FF4 A;  1STH A;  1GM5 A;  1VDZ A;  3S14 B;  4R4O A;  3S2H B;  4C2M H;  4KK7 A;  2Z4H A;  4DR4 L;  3DM3 A;  4UP7 A;  2IY5 B;  1JOO A;  1EEI D;  1PVO A;  5EQ0 A;  1STG A;  4DV6 L;  2PQA A;  1U5K A;  3NXW A;  3NEN A;  5IGD A;  4IFD J;  4A3E G;  4DUY L;  4LFC Q;  1WCM G;  1H9S B;  3NSW A;  2VQE L;  3S1N B;  5FLX E;  1JWM D;  4ZAI A;  4A76 A;  3EBE A;  2NZ1 D;  1RCV D;  1N36 Q;  3J81 j;  1IBM Q;  1NY4 A;  2C35 B;  1XJV A;  1SRO A;  3NBI A;  1PHJ A;  4EQN A;  4CDF C;  1EWC A;  3HZX A;  5CBE E;  2R6G A;  3V96 A;  2R93 G;  4WOR A;  3M4Q A;  2HHH L;  2WAQ G;  1NE3 A;  3E0J A;  4FXG C;  2CWA A;  2KUM A;  3CPW A;  1Y1V H;  1Q1B A;  4K0K L;  3EJI A;  5ELN A;  4AYB G;  3KJP A;  1V1O A;  3DEO A;  4XT1 B;  5K36 G;  1PTO C;  1O7I A;  4GNX B;  2ASB A;  4YWK A;  4BBR G;  1SND A;  4IJH A;  3A74 A;  4B3T L;  2VB2 X;  3F1Z A;  4ZKB B;  3GTM B;  3JAM i;  2PMZ E;  1X3G A;  4H0L C;  4R4T A;  3H0G G;  4DAP A;  5JPN C;  4FF3 A;  2EYO A;  1KIX A;  1FR3 A;  1UAP A;  3I4N H;  3I4L A;  5FO7 B;  2R7Z G;  1SYD A;  4XQN A;  5C4X H;  2AWO A;  2UU9 Q;  2MGS A;  2YTV A;  3AB9 A;  5I9O A;  4CGY B;  2ALY B;  1A0I A;  2Q8R E;  4X3S A;  4A3J B;  3QO2 A;  4GKK L;  1DOK A;  1W3S A;  2EVB A;  3K7A H;  5IT9 L;  3SK5 A;  3VR2 A;  1QUQ B;  4PZ8 A;  1Q46 A;  1VQI A;  2KOL A;  4BA1 I;  1C0A A;  2X6L A;  2TMP A;  3JC6 6;  3W2D A;  1IKL A;  2F4I A;  1K83 H;  3GTG H;  1V43 A;  3M85 A;  1EYG A;  2QDB A;  4DF7 A;  4RA8 A;  2B2T A;  1S5C D;  2R92 B;  5ELB A;  2D62 A;  3WWV A;  2OXP A;  1I4P A;  1HNW L;  2B2U A;  1FYC A;  1Y8N B;  5GRO A;  1TVX A;  2HD3 A;  5E4W C;  4KD4 A;  5IP7 H;  1CUK A;  1ENC A;  2F3W A;  3GTJ B;  1EY0 A;  2AQ3 B;  2XRQ D;  3R2I A;  3NWS A;  4LF5 L;  1TR5 A;  3HOV H;  3GTQ B;  2IPK D;  2WKD A;  4KTA A;  4MNO A;  4A3M H;  1HFN A;  1VQJ A;  3VDY A;  2RCF A;  1EQT A;  4EQ5 A;  4C3I B;  1SYE A;  4K8I A;  4S3S A;  4GKJ L;  2MJ8 A;  1G51 A;  1ILP A;  2JA6 H;  1JCK B;  2RDF A;  5CC4 A;  2CCZ A;  4CKC A;  3CQZ B;  3K6O A;  3S1Q H;  5AFW A;  1CK1 A;  2VW9 A;  2I5L X;  5C44 B;  1KTK A;  2CQO A;  2H5X A;  4C1N K;  2YTY A;  1XYI A;  5DNF A;  4DV7 L;  4HCE A;  3OMG A;  1ET6 A;  3DXJ C;  3OW2 A;  3RLF A;  2KCN A;  4JYA L;  4HID A;  4P2C B;  1ASY A;  2L11 A;  1QG7 A;  4EQP A;  4A3F H;  4JBJ A;  4CJ1 B;  1SBB B;  1HZB A;  3H91 A;  4H02 A;  3RZO B;  4DNT B;  2NVT B;  1XMQ L;  3QB3 A;  5C4H A;  4L5Q A;  1VQE A;  1X9N A;  5DLQ E;  4FVM A;  4TKO B;  3DWQ A;  2VNU D;  3BG3 A;  3D0F A;  3UE0 A;  4DR2 L;  5FLM G;  3CCL A;  1NMG A;  1I4X A;  3T1Y Q;  4YY3 L;  1V8Q A;  3OIP A;  2EYH A;  3BDC A;  4PMB A;  1Y8P B;  1TWF B;  5I2Y A;  3STB D;  4LAA A;  1MSG A;  1WYD A;  3VYS A;  3UDF A;  3I4M G;  3W1G A;  2HCC A;  1OXT A;  5ELD A;  2VQF L;  1PDQ A;  2DNC A;  4BY7 G;  2E75 C;  1YHB A;  3HOW H;  2AWN A;  4BY1 H;  1BDO A;  5IGB A;  1CSP A;  2LXK A;  1AH9 A;  3K58 A;  1KAB A;  1JOQ A;  2NWG A;  3TP7 A;  4HJ8 A;  1R9T B;  2ICE C;  3FPU B;  1SFO H;  3L0O A;  1QOH A;  4RKL A;  5C3E H;  3N52 A;  4FP5 D;  2O4X A;  2JA7 H;  2HDL A;  3F2U A;  3DHQ A;  4LF7 L;  3U50 C;  4A93 B;  3FDT A;  3K80 C;  4R4I A;  3HOU H;  2NTS A;  3EQL C;  4YCV A;  5D14 A;  3D3R A;  2F0N A;  1MGS A;  2J0T D;  2L5T A;  4ME3 A;  1S5D D;  4KKT A;  2OTL A;  1DYQ A;  1RJT A;  1TQO A;  2OF1 A;  4N8X 1;  4DR6 Q;  2AMC B;  1Y1W G;  1QNU A;  5C44 G;  1EFW A;  1L0Y B;  2F0T A;  1Q81 C;  3T56 B;  1S40 A;  1CHQ D;  1M1K C;  3S1M B;  3MFY A;  1PYS B;  4K5V A;  1N34 Q;  1TXY A;  1H9M A;  1K0R A;  5DEH A;  1I6V C;  3CCM A;  3MZ5 A;  2UUB Q;  3TBI B;  3VYR A;  3OYY A;  1N9W A;  2CH4 W;  1NSN S;  3M3Y H;  1EYC A;  1SMY D;  3IFT A;  3PO3 B;  2JK8 A;  5J22 A;  1TWH H;  2N55 A;  2SNS A;  3X3M A;  1YNJ C;  3CCJ A;  4A3D H;  1GUW A;  5JAV A;  1PFN A;  3GTK H;  1X54 A;  2Q2H A;  4B3M Q;  3GV3 A;  1YJN A;  1WJJ A;  3K5N A;  3BS1 A;  3CF5 A;  1N33 L;  2L1B A;  3AYH B;  1VQ9 A;  4B9X A;  4IFD H;  4X65 Q;  4Y7N H;  1YNX A;  2EYM A;  3LWU A;  2AQ2 B;  4DV0 L;  1EL0 A;  2SOB A;  2VB3 X;  3SE0 A;  1J6Q A;  1KRS A;  1X65 A;  5IWA Q;  4X62 L;  3IRB A;  1Q8I A;  4I7Z C;  1B3A A;  1U0L A;  3GO5 A;  4Q0F A;  4QIW B;  4RGO S;  1CI3 M;  1YZ6 A;  2EJF C;  3FP9 A;  1O7Y A;  3FVQ A;  4LK1 C;  5I4D A;  2A68 C;  4OX9 L;  2RQX A;  5CGK A;  3Q0A A;  4GOP C;  2NN6 H;  1DCZ A;  4OIJ A;  5FO9 B;  1OTC A;  5C5M A;  3Q22 A;  4GZY C;  1KRT A;  5IP9 G;  1TWC H;  4A93 G;  4DV5 Q;  2L9H A;  3V05 A;  1YJ9 A;  2F0P A;  4HIK A;  1DON A;  1SMY C;  1CM9 A;  4R8N A;  3PV0 A;  3MAQ A;  2GN5 A;  1RF2 D;  5BR8 Q;  2K04 A;  4G57 A;  2M00 A;  4A3I H;  1CFM A;  2KHS A;  1VQ8 A;  5M3M B;  4BXX G;  1A3U A;  3O13 A;  1EWI A;  1EY9 A;  4JCV E;  4DK6 C;  2EYP A;  1I4H A;  3F2C A;  1UEA B;  1RTO A;  4JI8 Q;  3VR6 A;  4JI5 Q;  1JJG A;  2SNM A;  2KBN A;  3J7A V;  1Z7T A;  3J7Z C;  3NE5 B;  1SMX A;  3PQI A;  5KNC A;  1WOC A;  1AFP A;  1IBK L;  2XTI A;  5TSS A;  5T1I A;  5J3B A;  1Y69 U;  3HOX B;  2EYL A;  1MIU A;  3A55 A;  3RN2 A;  1EQR A;  4OXP A;  1B4O A;  2PO4 A;  2YYZ A;  1B1Z A;  4N9T A;  3CPF A;  4A3B B;  3W1B A;  3NBH B;  3KLS A;  4X66 L;  1KLG D;  4HIM A;  1VQD A;  4FNF A;  4JI6 L;  4MTN A;  1Q7Y C;  3DLL A;  1QVC A;  3AFP A;  4PG3 A;  2R7D A;  4HMI A;  4LF8 L;  4V0B A;  3MHB A;  2LMC B;  1EWH A;  4ABN A;  2Y0S B;  2A6E D;  1SJH D;  5C0X H;  3OIQ A;  4H13 C;  3C2P A;  4OWW B;  3G71 A;  4F88 A;  3OWF A;  1STN A;  2OWO A;  4DN4 M;  4O1N A;  3L9A X;  1FVI A;  1UE7 A;  3NWT A;  4N8F A;  4QUF A;  3E9H A;  3CRK C;  3A5U A;  1I94 L;  1TWA B;  1YNN C;  4KV6 A;  2A5H A;  2VXW A;  1UNS A;  3J7A F;  2LFN A;  1SNO A;  3ND9 A;  1GUG A;  5IYB G;  1LO5 D;  1WVL A;  4C56 C;  1SR3 A;  1GHK A;  2PMZ B;  4DV1 Q;  3MEH A;  1XXG A;  4KY7 A;  1PFM A;  1XMO L;  1Q86 C;  1X32 A;  4DFA A;  4LF9 Q;  5JJZ A;  5M3M G;  5ELE A;  4UY8 C;  2K52 A;  1GKH A;  3CC2 A;  1PLF A;  3M7N A;  2JA5 G;  4B3S Q;  4K14 A;  4C3J H;  3KLS X;  1LT5 D;  1P16 A;  1MD2 D;  4EGV A;  1PRT D;  3WOE A;  4DNI A;  5IIF A;  1NBW A;  2JJQ A;  4KLK A;  5JPM C;  3KK7 A;  2PQE A;  1GOZ A;  2K03 A;  4JOI A;  4KI0 A;  3MXN B;  2BOS A;  1I50 B;  3HOX G;  3D4W A;  1T5E A;  2QEX A;  1Q12 A;  5J1Z A;  4LFC L;  3DMU A;  3CD6 A;  5JJL A;  1IYU A;  1FGB D;  5DM6 3;  4A3B G;  5M5X H;  4ME5 A;  5EAY A;  4Y52 H;  3CMA A;  1IBM L;  4ZYS A;  3HOZ B;  2K5H A;  3SXH A;  1X3F A;  1PH8 A;  1WTO A;  3R8B A;  3M4Y A;  2UXB Q;  5H1S E;  1E2W A;  4JI3 Q;  3A8J E;  4IFD I;  1VQA A;  3M9B A;  5LMN W;  2PNR C;  2DUD A;  3HOY G;  2F3V A;  3EIV A;  2Y0S G;  1DOL A;  2B63 B;  5IYC H;  2RF4 A;  3Q24 A;  5K5P A;  1G91 A;  1I4R A;  1MHW C;  1WI5 A;  2E8G A;  1HR0 W;  3J81 L;  2LS0 1;  1SNM A;  2JA8 H;  3MFG A;  2K5Q A;  2OCE A;  2OT2 A;  3NP8 A;  3P20 A;  2WB1 E;  3NHH A;  2E76 C;  3KF6 B;  4J1M A;  2NVX H;  3GTP B;  3M4O H;  5M5W H;  1BCP F;  4NB3 A;  2BH2 A;  3S17 B;  4TRD A;  1K73 C;  2PZU A;  2NN6 I;  1F2M A;  4J15 A;  1PA6 A;  2M2L A;  1PRT C;  3ULJ A;  1I6H H;  3VYT A;  3U58 A;  3PO2 B;  5IYD H;  4HJ5 A;  2HIV A;  4QIW E;  1SYF A;  3Q6S A;  4RGN A;  1IYJ B;  1UE6 A;  4YCU A;  5GAG C;  1G2S A;  3BVG A;  2UU9 L;  2DJF C;  2F0S A;  2VUM H;  5M9O A;  4GN5 A;  2M9V A;  4A3G H;  1SNQ A;  2B2T C;  2K6A A;  1AP0 A;  1U4P A;  1WFQ A;  3FKI B;  3U9O A;  1R4Q B;  1SYG A;  5G3L D;  5JEA G;  1GO3 E;  1HRJ A;  3KDF A;  5D3I B;  3UI2 A;  2B2U C;  2F0D A;  1G2T A;  4C2M B;  3E9I A;  2V1C C;  4IUU A;  2K05 A;  2EOT A;  1B7Y B;  2RKS A;  4DV2 Q;  1VQL A;  3JAM c;  3F2D A;  3KLR A;  2UUA Q;  2E2I H;  4HED A;  1EY7 A;  2F0H A;  5CMD A;  3AMU A;  2PI2 E;  5GAD C;  1H9R A;  4RCN A;  5LMU Q;  2QGQ A;  2EY1 A;  2PW5 A;  4DGZ A;  1Q3L A;  1IYV A;  3FHW A;  4A3E H;  1ML0 D;  4HR7 B;  1WCM H;  3SEB A;  4DU9 A;  5BN4 A;  1A3T A;  2HQL A;  2NTT A;  3CCV A;  4JI4 Q;  2GA4 B;  3RZD H;  3W5O A;  1E0B A;  2HDM A;  2YU9 B;  3NEL A;  3HOZ G;  3MXP A;  5JVH 3;  1VQM A;  3DEP A;  4IOA A;  4LUZ A;  4JI0 Q;  2R93 H;  2A69 D;  2AUK A;  4YCW A;  2JA9 A;  3JAM E;  4XXE A;  2B63 G;  2IWH A;  4FF2 A;  3I56 A;  1RD9 D;  5D65 A;  3C46 A;  1NCV A;  3TQY A;  2ZJR A;  1KAW A;  5C0X I;  4UAI A;  3IAY A;  3HFZ B;  4Z9C B;  2F0O A;  4HIO A;  1D8L A;  4X3U A;  1KLU D;  3KJO A;  2WKC A;  1VQ7 A;  4BBR H;  3PUV A;  4ZLT F;  1GJX A;  1OXX K;  1YIT A;  2F0U A;  2Y0S E;  4DAV A;  4AIM A;  3H0G H;  1C8C A;  1SE3 A;  4C3H H;  1WD1 A;  2I07 B;  2A74 C;  3I4N B;  5LHY 1;  2R7Z H;  5C4X B;  1TY2 A;  3NEM A;  4YWM A;  4A3L G;  2EQS A;  1ZXT A;  4RHS A;  4GN4 B;  2Z6B A;  4EQO A;  2IX0 A;  3L2P A;  1WTV A;  2GVA A;  4AQY Q;  4A3C G;  3DUZ A;  1SDF A;  1X56 A;  4F7X A;  4HJ9 A;  2RCN A;  2J4X A;  3FKI G;  3EN2 A;  4DV3 Q;  3K7A B;  3VR3 A;  1LTA D;  4OWX B;  4LF4 Q;  1MJE A;  4KHP Q;  4P72 A;  3R93 A;  4LFB Q;  1F9Q A;  1KAA A;  3PCO B;  5A2Q L;  3FEW X;  1HHV A;  3T1Y L;  4RKB A;  3T1H Q;  1EY4 A;  1SAP A;  1K83 B;  3GTG B;  3A54 A;  1CQF A;  1PH4 A;  1PZJ D;  1L1O B;  2HT1 A;  4OGQ C;  3T16 A;  3BZD B;  3S15 H;  1TS5 A;  1X3E A;  2QEJ C;  3P1H A;  1CKN A;  4NPS A;  1I5F A;  1QCB D;  4F8M A;  1S5F D;  1JC7 A;  1EY6 A;  2KJX A;  2WP8 J;  1AZP A;  1A2U A;  4K5W A;  3H3V I;  4HMJ A;  4JK1 C;  3CCS A;  2MP1 A;  1Y8O B;  1CKM A;  5HGT A;  4MIU A;  2F0K A;  4DUZ Q;  2XSC A;  4A3M B;  2CH4 A;  2UXC Q;  1HTP A;  1Q1E A;  1RTN A;  1HPC A;  3D4R A;  2WAC A;  4HJ7 A;  2BH8 A;  4DAM A;  1F9P A;  2BA0 A;  1BNZ A;  2JA6 B;  4MN3 A;  1CA5 A;  3S1Q B;  3KLW A;  2E5L Q;  4DR6 L;  1GVP A;  3S1R H;  4DK1 A;  1CSQ A;  1KQS A;  5L37 A;  1IKM A;  1V1P B;  1KNA A;  2DGY A;  1IW7 D;  4YWL A;  1EEF D;  1S5B D;  3OHX C;  4ZCK A;  4DPG A;  5KIX A;  4B3R Q;  2SDF A;  5C0X J;  1LT6 D;  4A3F B;  1EZ6 A;  1FJG Q;  1N34 L;  1SSO A;  5IGC A;  4JI2 Q;  2B39 A;  2F3I A;  3CW2 C;  2UUB L;  4WRD A;  1HNZ L;  1YHQ A;  2DNE A;  3NTK A;  2Q2U A;  2N88 A;  3PUW A;  3QOL A;  4DAY A;  1S5E D;  5ISR A;  1IHZ A;  1VF5 C;  2WV6 D;  2XWJ B;  1VQ4 A;  5FO8 B;  3K7U C;  5GAE C;  3PGZ A;  2B3G A;  3VR5 A;  4CDC C;  4B3M L;  5FLM H;  2WII B;  1SNC A;  2ID0 A;  2YTX A;  5HY6 A;  3MEF A;  4X65 L;  4A75 A;  3R2T A;  4IPH A;  2BDO A;  2H4O A;  2KQ3 A;  5LMN Q;  3TN2 A;  4N9P A;  3RN5 A;  1L0W A;  3RR5 A;  3CKI B;  5IWA L;  1HR0 Q;  3RMH A;  2Z6K A;  5ELF A;  3I4M H;  5CV6 A;  3PF4 A;  2D9U A;  2VQE Q;  4BY7 H;  5BN5 A;  3HOW B;  1EU4 A;  2QIL A;  4OWT B;  3S9W A;  3CCR A;  1JMC A;  4BY1 B;  4BA2 I;  3TZD A;  2B29 A;  3ULL A;  1D5M C;  4LJZ C;  1SFO B;  2KEC A;  4DKA C;  4A3J G;  1B2T A;  4FO2 A;  1OXV A;  2JA7 B;  3TP8 A;  4G7O C;  3MVV A;  3RD4 A;  1EOT A;  4JBK A;  3HOU B;  3HP3 A;  5A35 A;  2NVY B;  4L63 B;  2EXZ A;  4DV5 L;  2L4N A;  3ERS X;  3GTL H;  4X3T A;  3TP5 A;  2IT1 A;  2BDN A;  3HKZ E;  4A3K H;  3KF6 A;  2K33 A;  2F0L A;  1QVG A;  3G6J B;  1IL2 A;  5BR8 L;  2BA1 A;  1TS4 A;  1Y1W H;  2R92 G;  2JXM B;  2O2L D;  3GD7 A;  1F77 A;  2TSS A;  1CA6 A;  4JI8 L;  3URY A;  2E74 C;  4GOP B;  4JI5 L;  2KHI A;  1WTH A;  4QF4 A;  1GHJ A;  1PXU A;  1NNX A;  4G4K A;  1PTO F;  3J81 i;  3I55 A;  1NAP A;  1E2Z A;  4IPD A;  4KKS A;  4O0A A;  3RNU A;  3PUZ A;  3M3Y B;  1NUC A;  1VQC A;  2G9H D;  2NVT H;  3J80 L;  3TSS A;  1HZ9 A;  1V9P A;  1BCP B;  1TWH B;  4C3I G;  2Z0S A;  3QOJ A;  3GTK B;  2PPB C;  2O5J C;  4L6T B;  3TP6 A;  4CHT B;  5AJ3 Q;  2BE5 D;  3E0E A;  4IJL A;  4PV1 C;  2QA4 A;  3K0Y A;  1K9M C;  1XX8 A;  1KL9 A;  4J6H A;  4Y7N B;  4R1J A;  3C1F A;  1STA A;  3OOC A;  1AZQ A;  3R3O A;  3SVM A;  4DXG A;  1HJP A;  3TRE A;  1JB7 A;  4BBS H;  3A8K E;  5C4Z A;  2NUC A;  5NUC A;  2UXD Q;  3STB C;  3BJU A;  3LNN A;  1ET9 A;  1EU3 A;  1P8L A;  1KD1 C;  1L0X B;  5EKL A;  3IKJ A;  1F9R A;  3TEH B;  4BY1 G;  2AKW B;  1MKH A;  2NVQ B;  1LTG D;  3F8T A;  5KRU A;  1CZG A;  1EIH A;  2WB1 B;  2R3Z A;  2JA7 G;  2FXQ A;  1PH3 A;  1KNE A;  4K5X A;  1TWC B;  1Q82 C;  4FXD A;  5IP9 H;  4NP5 A;  4A93 H;  1YJW A;  2OEO A;  2FIN B;  4DK0 A;  1XPO A;  1IL8 A;  1H9S A;  3CU7 A;  4DV1 L;  2KA7 A;  1I4Q A;  2ZTD A;  4JOI C;  5IT9 c;  5EKI A;  4LF9 L;  4BXX H;  1HA5 A;  5A2Q E;  1N32 Q;  1SE2 A; 
#chains in the Genus database with same CATH homology
 1P16 A;  4DV6 L;  2PQA A;  4DUY Q;  2R92 H;  1U5K A;  4GNX C;  4DNI A;  3NEN A;  1NBW A;  1N32 L;  4B3S L;  2JJQ A;  3I4O A;  3HKS A;  4KLK A;  5GAH C;  4IFD J;  4EX5 A;  4A3E G;  4DUY L;  4LFC Q;  1WCM G;  2VQE L;  4JOI A;  2WAQ E;  4KI0 A;  4A76 A;  3MXN B;  3EBE A;  4L5R C;  2LXJ A;  5IP7 G;  3HOX G;  2A8V A;  1N36 Q;  5ELO A;  1SE8 A;  3J81 j;  2QEX A;  1NY4 A;  2C35 B;  1IBM Q;  1Q12 A;  3SGI A;  1L1O C;  4LFA Q;  1EUJ A;  4LFC L;  3GTJ H;  4AYB E;  1XJV A;  3CD6 A;  1SRO A;  5JJL A;  2HHH Q;  4A3B G;  2N3S A;  1PHJ A;  3HOV G;  5M5X H;  5EAY A;  2PQA B;  4Y52 H;  3CMA A;  4GNX A;  4A3M G;  1IBM L;  5FJ8 G;  3GTQ H;  4LFA L;  1RL2 A;  2R6G A;  4KHZ A;  2R93 G;  2K5H A;  2MFI A;  1X3F A;  4K0K Q;  1PH8 A;  4R4C A;  3KF8 B;  3M4Q A;  1VQO A;  2HHH L;  2WAQ G;  1NE3 A;  4C3I H;  4JI7 Q;  1KXL A;  3ZJY C;  2UXB Q;  2JA6 G;  5H1S E;  2CWA A;  4JI3 Q;  3CPW A;  1Y1V H;  2A1A A;  2AHO B;  4IFD I;  1VQA A;  3M9B A;  3CQZ H;  1Q1B A;  5LMN W;  4K0K L;  4IFD G;  2DUD A;  5ELN A;  4AYB G;  3EIV A;  4JI7 L;  3HOY G;  2Y0S G;  1VQH A;  1L2F A;  5C44 H;  1UE5 A;  5IYC H;  2RF4 A;  3ULP A;  2UXB L;  2KCT A;  3KJP A;  4JI3 L;  1WI5 A;  2E8G A;  1HR0 W;  5K36 G;  1O7I A;  4B3T Q;  3OTO Q;  2JA8 H;  4GNX B;  2ASB A;  2OCE A;  4A3F G;  4YWK A;  2K5V A;  2WB1 E;  4BBR G;  1PH2 A;  4IJH A;  1YIJ A;  3A74 A;  3UDG A;  3KF6 B;  4B3T L;  2NVX H;  3F1Z A;  3OTO L;  3M4O H;  5M5W H;  4NB3 A;  1XNQ Q;  3JAM i;  2BH2 A;  4OO1 G;  2PMZ E;  1X3G A;  3PO3 G;  3B6Y A;  1FL0 A;  4R4T A;  5JEA J;  3H0G G;  1K73 C;  3RZO H;  5JJK A;  2LSS A;  2NN6 I;  3CC4 A;  1QUQ A;  1KIX A;  2YV5 A;  4J15 A;  2R7F A;  1PA6 A;  1QVF A;  1XNQ L;  3I4N H;  1MJC A;  2R7Z G;  3ULJ A;  1I6H H;  1VS0 A;  2WFW A;  1KC8 C;  2WB1 G;  5C4X H;  2AWO A;  2UU9 Q;  2I0Q A;  3U58 A;  5IYD H;  1K3R A;  3PIP A;  4HJ5 A;  2HIV A;  4GKK Q;  4QIW E;  5HGQ A;  2YTV A;  1IYJ B;  2RHQ B;  4P75 A;  1UE6 A;  2ALY B;  4YCU A;  5GAG C;  2NZO A;  2UU9 L;  1A0I A;  2K14 A;  2VUM H;  4GN5 A;  4GKK L;  2NVY H;  1W3S A;  3K7A H;  4A3G H;  1WFQ A;  1QUQ B;  3D31 A;  4JC0 A;  4PZ8 A;  3UDX A;  1Q46 A;  1VQI A;  3PUY A;  5JEA G;  3S16 H;  1GO3 E;  2K50 A;  3UDI A;  1TWF H;  3KDF A;  4BA1 I;  4A3K G;  1C0A A;  4XTC S;  1H95 A;  1PV4 A;  3E9I A;  3JC6 6;  2V1C C;  4P73 A;  1B7Y B;  4DV2 Q;  1K83 H;  2Q2T A;  1VQL A;  1V43 A;  1VQP A;  3JAM c;  3GTG H;  3F2D A;  4DR3 Q;  4UP9 A;  3M85 A;  2UUA Q;  2E2I H;  1EYG A;  2JA5 H;  3HOW G;  1HNW Q;  4NXM Q;  2N49 A;  2PI2 E;  1I3Q H;  1BVS A;  5GAD C;  4DV2 L;  2D62 A;  4JI1 Q;  3WWV A;  5LMU Q;  4DR3 L;  2UUA L;  1R9T H;  3M4P A;  1HNW L;  2QGQ A;  4NXM L;  5C3E G;  4JBM A;  2CKZ B;  3KDF B;  3FHW A;  5GQO A;  4A3E H;  1Z47 A;  5GRO A;  4JI1 L;  4PZ6 A;  1WCM H;  2VY3 A;  5LMU L;  3HOU G;  2HQL A;  3RLN A;  3CCV A;  4LF5 Q;  1LM0 A;  4YHH Q;  5IP7 H;  3HOX H;  4JI4 Q;  1HNZ Q;  3RZD H;  1CUK A;  2KCM A;  3W5O A;  1ASZ A;  1XPU A;  3NEL A;  3HOZ G;  2NZH A;  2CWP A;  4IOC A;  1X55 A;  1K8A C;  1VQM A;  4GKJ Q;  4LF5 L;  4YHH L;  3HOV H;  4LUZ A;  4JI4 L;  4IOA A;  2I5H A;  4MNO A;  4A3M H;  5FJ8 H;  1VQJ A;  3VDY A;  1CKO A;  4JI0 Q;  1NMF A;  2R93 H;  2VZA A;  4EQ5 A;  4YCW A;  4GKJ L;  4TQU S;  2JA9 A;  1PVO A;  2ES2 A;  1G51 A;  4GLA C;  1FGU A;  3RLO A;  2B63 G;  2JA6 H;  2CCZ A;  3I56 A;  4JI0 L;  4DV7 Q;  3S1Q H;  1PH6 A;  3TQY A;  2VW9 A;  2ZJR A;  2I5L X;  3HOY H;  1KAW A;  5C0X I;  4JYA Q;  2CQO A;  2H5X A;  2YTY A;  3PIO A;  3S1M H;  3HFZ B;  1YEZ A;  4UPA A;  3K0X A;  1EOV A;  4HIO A;  4DV7 L;  1XNR Q;  1D8L A;  4LUO A;  3OW2 A;  4R4Q A;  3RLF A;  4A4I A;  3CCU A;  4BBS G;  4JYA L;  4HID A;  1ASY A;  4DK3 C;  3KJO A;  3LGJ A;  4A3F H;  1VQ7 A;  1E7Z A;  4BBR H;  3PUV A;  2MQH A;  4JBJ A;  1XMQ Q;  1XNR L;  1HZB A;  1K8G A;  1OXX K;  1YIT A;  4RMF A;  4H02 A;  2Y0S E;  3U4Z A;  3PO3 H;  2E2H H;  4AIM A;  1IXR A;  4WJ4 A;  3H0G H;  1N36 L;  1XMQ L;  2NVQ H;  3GDE A;  4A3D G;  4C3H H;  4B3R L;  4L5Q A;  1VQE A;  4POF A;  4DR2 Q;  1X9N A;  2R7Z H;  3J7A 5;  3NEM A;  4YWM A;  5DLQ E;  4A3L G;  2EQS A;  1SLJ A;  3K8A A;  4X64 Q;  1JJC B;  4GN4 B;  2VNU D;  2IX1 A;  3I7F A;  2IX0 A;  3D0F A;  1L1O A;  3UE0 A;  4YY3 Q;  3L2P A;  4DR2 L;  2GVA A;  5FLM G;  4AQY Q;  1NJI C;  3CCL A;  4A3C G;  1NMG A;  1OXU A;  1X56 A;  2EIF A;  4HJ9 A;  1E1T A;  2RCN A;  3FKI G;  1XPR A;  3EN2 A;  1VQ6 A;  4DV3 Q;  4X64 L;  3T1Y Q;  4OWX B;  4LF4 Q;  4KHP Q;  1MJE A;  4P72 A;  1M90 C;  4YY3 L;  4LFB Q;  3PCO B;  4AQY L;  1VQG A;  1Z9F A;  4B3M L;  4RG1 A;  4LW1 A;  4DV3 L;  2VQF Q;  1BBU A;  3T1Y L;  4LF4 L;  3STB D;  4KHP L;  1WYD A;  2ATW A;  2IHF A;  4LF6 Q;  1A62 A;  4LFB L;  3T1H Q;  4IO9 A;  3UDF A;  1DGS A;  3G48 A;  3I4M G;  3W1G A;  2KEN A;  1E3P A;  1OXT A;  1PH4 A;  1BKB A;  2HT1 A;  1L1O B;  4JBW A;  2VQF L;  3ICE A;  4BY7 G;  1VQK A;  1UWV A;  4LF6 L;  3S15 H;  4L5S A;  2NN6 G;  1YBY A;  1YHB A;  3T1H L;  3HOW H;  2AWN A;  1XTD A;  3PF5 A;  4BY1 H;  1CSP A;  2LXK A;  2VL6 A;  1AH9 A;  1X3E A;  4LF7 Q;  4HJ8 A;  4GN3 B;  4DR1 Q;  3S2D H;  4MZ9 A;  3L0O A;  5M3F G;  1CKN A;  1SFO H;  4NPS A;  1LUZ A;  1I5F A;  5C3E H;  2JA7 H;  2OTJ A;  5IYB H;  4LF7 L;  3U50 C;  1YHA A;  2WP8 J;  3ER0 A;  3K80 C;  4R4I A;  4DR1 L;  3HOU H;  4YCV A;  3H3V I;  3CCS A;  1C9O A;  5JJI A;  1EQQ A;  1CKM A;  4ME3 A;  4A3I G;  2VS1 A;  2OTL A;  4DUZ Q;  1EIY B;  5M3M H;  4GLX A;  3Q8D A;  1RIP A;  1AE3 A;  1V1Q A;  5IE8 A;  2UXC Q;  1UEB A;  1Q1E A;  1GD7 A;  3J80 i;  4DR6 Q;  1G6P A;  2AMC B;  1CKN B;  2KHJ A;  4LWC A;  4HJ7 A;  1Y1W G;  2BH8 A;  4DAM A;  2BA0 A;  4P71 A;  5C44 G;  4DUZ L;  5IYC G;  1EFW A;  1Q81 C;  2CFM A;  3KLW A;  1S40 A;  2E5L Q;  4DR6 L;  2GVB A;  1GVP A;  3S1R H;  1M1K C;  4ALP A;  3CCQ A;  1E24 A;  1CSQ A;  1PYS B;  3S24 A;  4FDB A;  1KQS A;  1N34 Q;  4JV5 Q;  1TXY A;  2D0O A;  1N8R C;  2DGY A;  1HH2 P;  1S3O A;  1HZA A;  1K0R A;  4YWL A;  2E5L L;  4WJ3 M;  3CCM A;  4HJA A;  4DPG A;  2JEA I;  2ZM6 Q;  2UUB Q;  4B3R Q;  5C0X J;  1FJG Q;  1N34 L;  3OYY A;  3S17 H;  1N9W A;  4JI2 Q;  4JV5 L;  2F3I A;  3A0J A;  1IZ6 A;  1J5E Q;  3M3Y H;  3H15 A;  1E1O A;  2PNH A;  3A5Z B;  3CW2 C;  2ZM6 L;  2E2J H;  2UUB L;  2JK8 A;  1X6O A;  2OQ0 A;  2XGT A;  1QZG A;  1FJG L;  4A3B H;  1TWH H;  4JI2 L;  1HNZ L;  3CCJ A;  1YHQ A;  1N33 Q;  4A3D H;  1J5E L;  5IYD G;  2Q2U A;  3GTK H;  1X54 A;  3PUW A;  2Q2H A;  4B3M Q;  3U4V A;  1YJN A;  1WJJ A;  4XIG S;  3J80 c;  4DV0 Q;  1VQ4 A;  3CF5 A;  4PMW A;  1N33 L;  1VQ9 A;  3AYH B;  4A3L H;  3K7U C;  5GAE C;  3K81 C;  3PGZ A;  4QGU A;  4A3G G;  3G6E A;  2B3G A;  2N78 A;  2Z6K C;  4LUV A;  4X65 Q;  4IPC A;  3G4S A;  4X62 Q;  3TS0 A;  5FLM H;  1YNX A;  4Y7N H;  3F2B A;  4DV0 L;  5C0X G;  4A3C H;  3PUX A;  1VQN A;  3BZK A;  1J6Q A;  1EIF A;  1KRS A;  2ID0 A;  1BBW A;  4DR5 Q;  1X65 A;  2YTX A;  5HY6 A;  3MEF A;  1OXS C;  3CXC A;  3AFQ A;  5IWA Q;  4X65 L;  4QJF A;  5M5Y H;  4IPH A;  4X62 L;  4A75 A;  3IRB A;  3GTO H;  5LMN Q;  1YVC A;  4DR5 L;  4PZ7 A;  1L0W A;  4DAY B;  1U0L A;  3GO5 A;  3RR5 A;  3RN5 A;  3TRZ A;  4OX9 Q;  5IWA L;  5IY0 A;  1HR0 Q;  1VCI A;  3I2Z A;  4DR7 Q;  2F4V Q;  5LMN L;  1YZ6 A;  2Z6K A;  3I4M H;  3FP9 A;  2PI2 A;  2A19 A;  2HIX A;  2I5M X;  4AH6 A;  4OX9 L;  3PF4 A;  2VQE Q;  1LTL A;  4GOP C;  4BY7 H;  3PO2 G;  4GLV B;  2OQK A;  1HR0 L;  1JMC A;  4OWT B;  4DR7 L;  2F4V L;  3CCR A;  2ZJQ A;  1TWA H;  4B3S Q;  1G29 1;  4BA2 I;  2B29 A;  3ULL A;  1OTC A;  4LNQ A;  1KRT A;  2IHE A;  5IP9 G;  4DV4 Q;  1TWC H;  4DKA C;  4A3J G;  5M3F H;  4A93 G;  4OON A;  1OXV A;  4DV5 Q;  5C4J H;  4JBK A;  1Q8K A;  1YJ9 A;  4DV4 L;  2YU9 H;  4X6A H;  1Y14 B;  2RHS B;  3AQQ A;  1E22 A;  1VQB A;  4HIK A;  4GOP A;  3PSI A;  2JE6 I;  4DV5 L;  3PV0 A;  1VQ5 A;  3S14 H;  1T9H A;  2GN5 A;  1B70 B;  5BR8 Q;  3H3V H;  1A8V A;  3ERS X;  3GTL H;  3S2H H;  4A3I H;  4BXX G;  2IT1 A;  1VQ8 A;  2L15 A;  3HKZ E;  1EWI A;  3KF6 A;  4A3K H;  2Q2I A;  4JCV E;  4DK6 C;  3F2C A;  4QY7 A;  1QVG A;  1IL2 A;  5BR8 L;  2BA1 A;  4JI8 Q;  3CME A;  1Y1W H;  4JI5 Q;  5E7N A;  2R92 G;  2MO0 A;  1JJG A;  3GD7 A;  3KOJ A;  1S72 A;  1JE5 A;  2KBN A;  1IBK Q;  4JI8 L;  1HNX Q;  4GOP B;  4JI5 L;  4APV A;  1SMX A;  3J7Z C;  3HKZ G;  2KHI A;  4TVA B;  3S1N H;  1WOC A;  1C7Y A;  3TS2 A;  1TWG H;  3CP0 A;  1PFS A;  1I50 H;  1NTG A;  1IBK L;  2XTI A;  3CAM A;  1HNX L;  3J81 i;  3I55 A;  4OO1 I;  5J3B A;  4IPD A;  1PH9 A;  3BU2 A;  4O0A A;  3RNU A;  1MIU A;  4X66 Q;  3PUZ A;  3RN2 A;  1EQR A;  1VQC A;  4JI6 Q;  4OXP A;  4JG2 A;  3CC7 A;  2NVT H;  2YYZ A;  1AE2 A;  1QZH A;  3HOZ H;  3CPF A;  1HZ9 A;  1V9P A;  3L7Z C;  4L5T A;  3W1B A;  2UUC Q;  3NBH B;  1PH5 A;  2Z0S A;  4X66 L;  4LF8 Q;  3UE1 A;  1VQF A;  4HIM A;  1VQD A;  1IBL Q;  4JI6 L;  1Y1V G;  4MTN A;  1Q7Y C;  5AJ3 Q;  4POG A;  3DLL A;  2UUC L;  3E0E A;  4IJL A;  1QVC A;  2D0P A;  3AFP A;  4PG3 A;  2QA4 A;  2MO1 A;  2R7D A;  4LF8 L;  2B63 H;  2UXC L;  1IBL L;  1W2B A;  1K9M C;  2ZTE A;  4QL5 A;  1KL9 A;  5AJ3 L;  2N8N A;  2JA8 G;  4R1J A;  1HJP A;  3TRE A;  1JB7 A;  3KYH C;  3G71 A;  4OWW B;  4BBS H;  2EXD A;  3GTP H;  2UXD Q;  3GTM H;  3STB C;  1PYB A;  3J81 c;  1KHI A;  2OWO A;  3BJU A;  1D7Q A;  1I94 Q;  4O2D A;  4P74 A;  1P8L A;  1KD1 C;  2ZTC A;  4QQB X;  4IPG A;  3I4N G;  3KFU A;  3TEH B;  1FVI A;  1UE7 A;  4BY1 G;  2UXD L;  1A63 A;  1B8A A;  2AKW B;  1MKH A;  3E9H A;  5C4X G;  3A5U A;  1I94 L;  3PO2 H;  3BZC A;  3F8T A;  2JEB I;  1LYL A;  4GS3 A;  2JA7 G;  1SN8 A;  2FXQ A;  1PH3 A;  5IYB G;  5FLX c;  1XMO Q;  1Q82 C;  4NXN Q;  2VUM G;  5IP9 H;  1UE1 A;  1SR3 A;  4A3J H;  4A93 H;  1JT8 A;  1YJW A;  4DV1 Q;  3CCE A;  1HZC A;  2K5N A;  1XPO A;  4UP8 A;  1JJ2 A;  3FKI H;  1XMO L;  2F52 A;  4NXN L;  1Q86 C;  4DR4 Q;  4LF9 Q;  1PH7 A;  5M3M G;  1GM5 A;  2ZJP A;  4DV1 L;  2ZTD A;  4UY8 C;  4R4O A;  2K52 A;  2K4K A;  2JQO A;  4C2M H;  1GKH A;  3CC2 A;  4JOI C;  5IT9 c;  4DV6 Q;  4DR4 L;  2MNA A;  4LF9 L;  4BXX H;  2K75 A;  1SRU A;  3DM3 A;  4UP7 A;  2IY5 B;  3M7N A;  1PH1 A;  2JA5 G;  1N32 Q;  1YI2 A;  3AEV A;  4C3J H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...