2VW9A

Single stranded dna binding protein complex from helicobacter pylori
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
108
structure length
108
Chain Sequence
MFNKVIMVGRLTRNVELKYLPSGSAAATIGLATSRRFKKQDGTLGEEVCFIDARLFGRTAEIANQYLSKGSSVLIEGRLTYESWMDQTGKKNSRHTITADSLQFMDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords SINGLE-STRANDED DNA BINDING PROTEIN
publication title Single-Stranded DNA-Binding Protein Complex from Helicobacter Pylori Suggests an Ssdna-Binding Surface.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 20
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vw9A00
3KFUA 1OXXK 2AWOA 3I7FA 1C0AA 3VDYA 2CWAA 1SFOH 4JCVE 4OXPA 4AH6A 3JAMi 4X65Q 2E2JH 1Q81C 3J7ZC 3TQYA 3M4OH 3EIVA 4R4OA 1KHIA 4DR3L 4JI4L 3PUXA 2JEAI 4A3BH 4A93G 3A5UA 2A8VA 3UDXA 4IFDJ 2E8GA 5GAHC 4NXNL 1YHBA 1PH6A 1U5KA 4DR2Q 1Q86C 2QA4A 1A62A 2JA8G 2KBNA 2Q2UA 4BY1H 3RLOA 1PH8A 2YV5A 4R1JA 2YYZA 1PHJA 4A3MG 1PH5A 4A3IG 1OTCA 4LF6Q 3TREA 4EQ5A 4IO9A 3M9BA 2MFIA 3ICEA 4GOPB 3PUWA 4A3FG 4JI5L 4JI1L 1OXVA 4YY3L 3T1HL 1YHQA 1P16A 2I5HA 4GN4B 3RN2A 1PYSB 4A3GH 4JYAL 2VNUD 2ZJQA 3ULJA 3ER0A 1YVCA 5M3MH 5GADC 3GTGH 4LF7L 3PO2G 5LMNQ 4GKKL 3CCRA 5IP9G 3CCQA 3MEFA 2K75A 4LFAQ 1HZAA 1UE5A 4DV0L 4R4CA 1TWHH 3L2PA 3CCSA 4DR5L 2HHHQ 1XNRQ 2R92G 2HIXA 1A8VA 1M90C 1HJPA 4ME3A 4DV5L 2PQAB 1VQEA 1LUZA 1TWCH 2ASBA 4GKJL 3I4OA 1QZHA 3H0GG 1BKBA 4BXXH 1PH1A 3CCMA 4B3MQ 3UE1A 1NTGA 4TQUS 5JJIA 5IYDH 4LFCQ 1IL2A 4JI2L 1NMFA 1XJVA 2ATWA 3F2DA 4OWTB 1LM0A 3J80c 2ZM6Q 4J15A 3A74A 4UPAA 1IBLL 2XGTA 5FJ8H 4YCWA 3BZKA 2R7ZH 2YTXA 2IY5B 5IYCG 1JT8A 3U4VA 1M1KC 3DLLA 2ZTEA 2Z0SA 4BY7H 3CD6A 4DR2L 4APVA 4JI7Q 1YI2A 3HOYG 5EAYA 3FHWA 4DV2Q 4GLAC 4LF8Q 4DUZQ 4JBKA 3M7NA 5K36G 5LMUQ 4A3DH 5JJLA 1NBWA 3RLNA 4LF6L 3ULPA 1QVCA 1VQIA 2GN5A 1VQAA 1VQDA 2JA5H 1K8AC 3LGJA 5ELNA 3AQQA 3PIPA 1VQOA 1VQ5A 1Q1BA 4RG1A 3UDFA 4IFDG 1Q8KA 1T9HA 1QVGA 3GDEA 4YHHQ 3F2BA 1K3RA 2KENA 3F1ZA 4B3RQ 1CKNA 2HQLA 1R9TH 3J7A5 4IOCA 2CWPA 2EIFA 4A3EG 1XNRL 1SR3A 4R4TA 3W5OA 2Q2TA 2ZTCA 3U4ZA 3HOZH 4BA1I 2VQEL 1W3SA 2I5MX 2WB1G 2E5LL 1Q12A 4WJ4A 1XPUA 1EWIA 4GN5A 4JV5Q 4OO1G 1IXRA 4B3ML 2WFWA 2UUCQ 3I4MG 1PYBA 3B6YA 3L0OA 4LFCL 1I94Q 1KXLA 1C9OA 4YCUA 4AYBE 1GKHA 3W1GA 2K52A 1Q7YC 2OCEA 4LW1A 2VS1A 2ZM6L 3CC7A 2IHFA 1VQNA 2YTYA 3GTQH 4A3JG 4P71A 3S1RH 1HR0W 3MXNB 4RMFA 4JI6L 3PF4A 2VUMH 1WJJA 4UP9A 4BBSH 1VQGA 1PFSA 4JI7L 1NE3A 4L5RC 3HFZB 3S16H 4DR7L 4A3CG 2VQFL 3IRBA 3T1HQ 4JI1Q 1PH9A 5GQOA 3K81C 3I56A 2ALYB 1OXSC 1HR0Q 5E7NA 4POFA 4BBRH 4LF7Q 3S2DH 1PH2A 4POGA 4GKKQ 3HOUG 4DR5Q 3U50C 3HKZG 3CXCA 2BH2A 4X6AH 2GVBA 5M3FG 1UWVA 2QGQA 2R6GA 4YHHL 1N36L 5IYBG 4B3RL 3M3YH 1VQHA 4JBJA 4O0AA 1KD1C 4EX5A 1HNXQ 1NY4A 1L1OA 5IP7H 1QZGA 1X65A 5C3EG 1TWGH 3TS0A 1SN8A 3JC66 4MTNA 1KRTA 3PF5A 1B8AA 5FLMH 2FXQA 1I3QH 1LTLA 5C0XI 1WOCA 4IPGA 1D8LA 3A5ZB 3CW2C 4DV3Q 3J81i 4GNXA 4JV5L 1IBLQ 1ASYA 3S2HH 1X9NA 1E1OA 4C2MH 2UUCL 1I94L 1CKMA 1L2FA 4P75A 2K50A 1JB7A 2E2IH 1QUQB 4KI0A 3JAMc 3PO3H 3J81c 4A3BG 1KQSA 2K5VA 2RCNA 3CCUA 4B3SQ 4C3JH 3I4NH 1WFQA 3M4QA 1VQFA 2K4KA 4BY1G 4IPDA 2K5HA 2NVXH 4A3CH 1O7IA 1SRUA 4LFBQ 4KHPQ 4A76A 3F8TA 1XMOQ 5IT9c 3AFQA 4DR6Q 1IBML 1N32Q 2MO0A 4JBWA 2RF4A 3HOXH 1HR0L 2NZHA 4A3GG 1X3FA 1Q46A 1YHAA 1GO3E 5M3MG 3E9IA 3T1YL 4A3KG 2R7DA 1SLJA 2YTVA 4JOIC 1YEZA 3AFPA 4YWKA 1I6HH 1FGUA 4IJHA 2VW9A 1XNQQ 4L5TA 1E1TA 3KF6A 4C3IH 3BZCA 2VQEQ 1VQMA 1EQQA 1VQKA 2Y0SG 3PUVA 1HNXL 1FJGL 2E5LQ 4P73A 3CCEA 3GTKH 1Z9FA 2AHOB 1U0LA 3HOVG 3KJPA 2D0PA 2UXDL 3M4PA 2JK8A 1YBYA 1MKHA 3GTPH 2BH8A 4LWCA 5IYDG 1TXYA 3K80C 2NN6G 2OTJA 3KLWA 4DV3L 4DPGA 3KF8B 3PUZA 3E0EA 4A75A 4DV1Q 4P74A 1N9WA 4JI6Q 4OONA 2JE6I 5FJ8G 5C44H 5ELOA 5GAGC 1K9MC 2PMZE 2VY3A 3D0FA 2AMCB 4DR7Q 1KL9A 4B3SL 4BY7G 1NMGA 3NEMA 3Q8DA 4DK3C 2VQFQ 3KJOA 2UXBQ 1V43A 2DGYA 1H95A 4HIDA 1J5EL 4DV7L 1VQLA 2I0QA 4PZ6A 2GVAA 3G48A 2F4VL 4HJ8A 4PG3A 3S1QH 3CAMA 3OTOQ 4A3DG 1XMOL 1E22A 3UDIA 4WJ3M 4DR6L 2JA5G 1N32L 1I5FA 4Y7NH 4X66Q 4HJ9A 1KC8C 1C7YA 1Y14B 1ASZA 3EN2A 4DV6Q 3GTMH 4GS3A 2B63H 2D0OA 1N36Q 5IYCH 1K73C 3PIOA 1OXTA 3CQZH 2JA7H 1CSQA 4PZ8A 4X64L 2UUAL 1L0WA 4HIKA 2JA6H 2CQOA 2MQHA 3FKIH 1VCIA 2R7FA 1X3EA 2R93H 4IOAA 1PA6A 1XNQL 3CF5A 2KHJA 4AQYQ 3HKZE 3HOZG 1EIYB 1JJGA 4R4QA 1DGSA 1HNWL 3AYHB 1K0RA 5M5XH 2UXCL 4X62Q 1K83H 4DK6C 5GROA 4L5SA 1YITA 4QJFA 1Y1WH 3D31A 2WP8J 4ALPA 4DNIA 3TEHB 1SE8A 2HIVA 4LFBL 1L1OC 1HNZQ 4UY8C 4A3LH 4DV1L 1YJ9A 1K8GA 4JI0Q 2B3GA 2KCMA 2NVYH 5M5YH 3CCLA 1VQ6A 4XTCS 3TS2A 1QVFA 4IPCA 3SGIA 3RNUA 3I55A 4HJAA 2VUMG 1CKOA 4OWWB 4BBSG 1UE7A 3CP0A 1IBMQ 2UU9L 2VL6A 4LNQA 1UE6A 2UXBL 4PZ7A 1WCMH 2RHQB 1EQRA 1XMQQ 1A0IA 1Y1VH 2BA0A 2OQ0A 4GOPA 4JBMA 3OTOL 1YIJA 5HGQA 2F3IA 3T1YQ 4A4IA 4BBRG 3HOWH 3PCOB 1BBWA 2PNHA 4X66L 5C0XJ 5AJ3Q 4DV6L 5C4XH 1VQ9A 2JQOA 1N8RC 1B70B 1FJGQ 4DAYB 2E2HH 3G71A 1Q1EA 3UDGA 2YU9H 2UXDQ 2JEBI 1PVOA 1X3GA 2PQAA 4UP7A 3FP9A 4JI3L 4LUOA 3A0JA 2UUBL 1X56A 4AQYL 4DR1Q 4JI8L 2IHEA 5FLMG 4YCVA 2JJQA 3BJUA 5JEAG 4GLXA 4X62L 1J6QA 2Z6KA 2EXDA 1CKNB 3GTLH 1X6OA 2DUDA 4LUZA 1LYLA 1G51A 2IX0A 1GVPA 1X55A 1JMCA 4LUVA 4LF4Q 3BU2A 4OX9Q 3AEVA 4QL5A 3PO3G 3KOJA 1HNZL 2MO1A 1EOVA 2N3SA 1VQ8A 4JI0L 3I4NG 5HY6A 1GM5A 3RR5A 4UP8A 2N49A 4K0KL 1J5EQ 1IBKQ 4DV7Q 3ZJYC 2F4VQ 2OTLA 1S3OA 2XTIA 2NZOA 1YZ6A 1FL0A 2ES2A 3WWVA 3K7AH 4QIWE 4A93H 1XMQL 3KDFA 2KHIA 2WAQG 3HOXG 3S1NH 1V1QA 2ID0A 2A19A 1E24A 4X64Q 4DV4L 4HIMA 2UUAQ 4YWLA 2JA8H 1PV4A 3H3VI 2AKWB 4LF9L 4DR4L 3OW2A 4Y52H 3S15H 2Q2HA 5AJ3L 3NELA 2Q2IA 3CPWA 1P8LA 2ZJRA 4A3MH 4IJLA 3U58A 4A3IH 4QQBX 2I5LX 3CMEA 1I50H 4QGUA 5LMNW 1HNWQ 3S1MH 4JG2A 2UXCQ 4IFDI 5IE8A 5BR8L 4A3FH 4BXXG 4KLKA 1N33Q 4KHPL 4L5QA 3CPFA 2C35B 4DR1L 2KCTA 3RZOH 3UE0A 1XPRA 3PO2H 4A3KH 2OQKA 5IP9H 5C4JH 3RN5A 5C0XG 2WB1E 3PUYA 2R92H 1FVIA 2LXKA 1RL2A 3S17H 1IYJB 4NB3A 1VQBA 1L1OB 3STBD 4OX9L 5C44G 4LF4L 2R7ZG 1N34L 4OO1I 1BVSA 3G4SA 2HT1A 1EUJA 1VQ7A 2V1CC 3H0GH 4AIMA 3S14H 3PSIA 3NBHB 3HOVH 3J81j 2UU9Q 4OWXB 5DLQE 2LSSA 5IWAL 2CKZB 3J80i 3GTJH 1IBKL 1S72A 4GNXB 1TWFH 1WI5A 5IY0A 3CCVA 4O2DA 5JEAJ 3DM3A 1X54A 3M85A 4QY7A 5JJKA 1HH2P 2K5NA 4X65L 3PV0A 1IZ6A 1S40A 1HZCA 2H5XA 1YJWA 2MNAA 1XPOA 1KAWA 4NXMQ 2B63G 2RHSB 4H02A 2AWNA 4HIOA 4C3HH 3HOYH 3H15A 2JA7G 1PH4A 4KHZA 1SMXA 4LF5Q 4JI3Q 3I2ZA 3H3VH 1Q82C 2JA6G 3FKIG 2IT1A 3STBC 1G291 2BA1A 4JOIA 5GAEC 3OYYA 4MNOA 4GOPC 2UUBQ 2R93G 4JI8Q 2PI2A 1TWAH 1G6PA 4TVAB 3KDFB 3K8AA 1JJ2A 2K14A 1RIPA 1E7ZA 2N8NA 2LXJA 1W2BA 1N33L 1B7YB 3CCJA 4PMWA 3K0XA 1Y1WG 4DAMA 1OXUA 3CMAA 3NENA 2CFMA 5M5WH 4B3TQ 1D7QA 1QUQA 1GD7A 5LMNL 4DUYQ 3K7UC 4A3EH 3KF6B 2OWOA 4A3LG 1VQ4A 4LFAL 2QEXA 3CC4A 1KIXA 2HHHL 4K0KQ 3GO5A 1VQPA 1E3PA 2PI2E 4GNXC 1EFWA 1VS0A 4GN3B 2Z6KC 1HZBA 1CUKA 2IX1A 3I4MH 4MZ9A 2A1AA 1AE3A 3ULLA 1WCMG 4DR3Q 4R4IA 1MJEA 2ZJPA 2CCZA 4JI4Q 1VQCA 3W1BA 1Y1VG 1WYDA 3ERSX 4NXNQ 2NVQH 4DV4Q 2NVTH 4DR4Q 1V9PA 3F2CA 1EIFA 4LF9Q 4A3JH 1PH7A 1EYGA 3HOWG 1UE1A 3TRZA 3L7ZC 3RLFA 4NXML 5C4XG 1CSPA 1MIUA 3E9HA 3GD7A 1MJCA 1PH3A 1YJNA 2N78A 2WAQE 3EBEA 4FDBA 5IP7G 3HKSA 4LF5L 5BR8Q 4DV2L 3GTOH 4JI5Q 4DUZL 4YY3Q 4LF8L 2L15A 2F52A 5LMUL 2ZTDA 3S24A 4JYAQ 2EQSA 1NJIC 4JC0A 4NPSA 3HOUH 1UEBA 4DKAC 2Y0SE 2D62A 2JA9A 1Z47A 4XIGS 2VZAA 4DV0Q 5M3FH 1HZ9A 1BBUA 1SROA 5IYBH 5FLXc 3PGZA 1KRSA 5J3BA 4DV5Q 1N34Q 5H1SE 3CC2A 1AE2A 4BA2I 4B3TL 4P72A 5C3EH 1XTDA 1VQJA 3G6EA 4DUYL 4HJ7A 4GKJQ 1A63A 2B29A 1JE5A 4IPHA 1AH9A 4GLVB 4AYBG 3KYHC 4YWMA 5IWAQ 3RZDH 2NN6I 4HJ5A 1JJCB 4JI2Q 1YNXA
chains in the Genus database with same CATH superfamily
2LS01 1OXXK 1K28A 3VDYA 5TSSA 4XQQA 2E2JH 1B3QA 3M4OH 1Q81C 2ZXPA 3TQYA 4R4OA 1KHIA 3PUXA 1X3PA 3A5UA 4IFDJ 4RGNA 1EL0A 2B2VC 1PH6A 4PMCA 3KLSX 4X3SA 4A3FB 2E74C 2Q2UA 1PH8A 4R1JA 2YYZA 4B9WA 4A3MG 3TDQA 1NCVA 4A3IG 3BVGA 3TREA 3M9BA 2MFIA 4GOPB 3GV3A 4JI1L 1PYSB 4JYAL 3ULJA 3ER0A 3DM1A 5GADC 5COYA 3GTGH 4LF7L 1WD0A 2DJGC 3S14B 4HEDA 4GKKL 1VMPA 3MEFA 1SSOA 1UE5A 4R4CA 1TWHH 4DV0L 2R92G 1LTID 2TMPA 1TWFB 4ME3A 1A3UA 3NUCA 4DXFA 4F88A 3CCMA 3UE1A 4TQUS 1JOKA 4K2KA 4CKEA 3J80L 1LLRD 4OWTB 4C3HB 3HOYB 1LM0A 3CU7A 5DM63 5C0XH 3SK8A 4YCWA 5JOBA 5IYCG 2NWGA 3DLLA 1JORA 3CD6A 2B2WA 4JI7Q 3A8JE 3FHWA 1EFID 4JBKA 3M7NA 2A5HA 1UNSA 2F0QA 3RLNA 1F2LA 5EPJA 1PYWD 1VQIA 1G2TA 4V190 5ELNA 2F0DA 1KDCA 1VQ5A 3UDFA 2IL8A 1T9HA 3GDEA 3F1ZA 1CKNA 2EYFA 2EIFA 3D8GA 5KEEA 3VA5A 3KLSA 2B2UA 5LL6S 2SNSA 2I5MX 2WB1G 4WJ4A 1XPUA 4ID6A 1EWIA 1IXRA 4B3ML 2WFWA 3H3VC 1I94Q 4LFCL 1F9PA 4IUNA 3VYUA 4AYBE 3ITPA 1TR5A 4HSVA 1Q7YC 1ESRA 4LW1A 1GHJA 2E75C 4KN4C 3S1RH 1HR0W 3MXNB 4N8FA 2D2CC 2VUMH 4M8AA 4PNYA 4C1NI 1I4XA 3GQBA 1PFSA 3HOUB 4DR7L 3HFZB 4QB4A 1LTGD 2VB3X 3H6MA 3TZDA 2VQFL 1C8CA 3IRBA 1RD9D 1QNKA 1IKMA 4QMGA 3I56A 3NXWA 5E7NA 3RD4A 1QG7A 3S2DH 4POGA 4XYOA 1DOMA 1EWCA 4DR5Q 3E0JA 3HKZG 3W3AA 3CXCA 2QDLA 1O78A 1UWVA 1SYCA 1J9OA 1QZGA 3X3MA 2E2JB 1X65A 5C3EG 3M4OB 1K8OA 1SN8A 4MTNA 4CKBA 5IGFA 4IURA 5C0XI 1WOCA 2BE5C 1HUNA 4IPGA 2K5WA 3J81i 1ASYA 2F0WA 1CKMA 4HTHA 1L2FA 4P75A 1S5CD 1KAAA 4KI0A 2BDOA 1KQSA 3CCUA 1EY6A 4B3SQ 1MGSA 4FXKC 4C3JH 3M4QA 3I4NH 2RBMA 2K01A 4BY1G 4IPDA 2K5HA 3QR8A 4CDCC 1O7IA 4A3CH 1SRUA 4KHPQ 3GTGB 1ONLA 1QNUA 5IT9c 5FO8B 3AFQA 4K5XA 2B39A 1TWHB 3BDOA 1FNVA 3SHLA 1HR0L 1ICWA 2RSNA 1X3FA 1STYA 5E4WC 1Q46A 5M3MG 2YTVA 3G6JB 4JOIC 1B53A 3KF6A 1AW7A 1MBYA 1EQQA 2Y0SG 1SJED 1HNXL 2E5LQ 4P73A 3DEOA 2D0PA 3M4PA 3WDNA 1AP0A 2BH8A 3BS1A 1TXYA 1O7YA 4KKSA 5IT9E 2KECA 2SDFA 2A69D 3KLWA 3EA6A 5JAVA 2EYJA 1LTTD 5I9OA 4A75A 1HTPA 4DV1Q 5EQ0A 5DM73 4FF4A 4K6LA 4K8IA 4BY7G 1MHWC 4B9XA 4KY5A 2UXBQ 2ENBA 1V43A 4DV7L 1JR0D 2GVAA 5A2QL 3A54A 1MD2D 2JA5G 1N32L 1I5FA 4HJ9A 4X66Q 1KC8C 4LMQD 2K03A 3EN2A 3PIOA 1HTLD 2JA7H 2K04A 2L9HA 4Z9CB 2CQOA 1SAPA 3FKIH 1F9RA 1L0XB 3CRLC 1PA6A 1XNQL 1Y1WB 3NHHA 3CF5A 4AQYQ 1EIYB 5ELEA 1HNWL 2L11A 2K5QA 1K83H 5KNDA 4L5SA 5M5YB 2K5DA 4QJFA 2VUMB 2SNMA 2F0PA 4DNIA 3OMCA 4FVMA 1L1OC 4UAIA 2NTSA 3R93A 1ICFB 1R4PB 2K6AA 1U4RA 3CCLA 1WCMB 1VQ6A 3TS2A 1QVFA 5K5PA 4DU9A 3OPOA 3S2DB 4I7ZC 5LL6X 1NUCA 2RA4A 1EQRA 3NE5B 1FNWA 2OQ0A 5CYUA 4ODGA 4GOPA 3OTOL 4A4IA 3HOWH 1S5BD 4IUVA 5E4XA 1PRTB 2QEJC 5C4XH 1VQ9A 4KTAA 1N8RC 1FJGQ 2E2HH 4UHVA 1EZ8A 3DMUA 2UXDQ 4JI3L 1KABA 4IALA 2ZT9C 2DJFC 1X56A 1EOTA 1PRTD 3HGBA 2IHEA 3A56A 4GLXA 4C3JB 3I4NB 1D1IA 5EBCA 2Z6KA 3I91A 4K5WA 1UEAB 4LUZA 1SEBD 2KEDA 4DNTB 1EIHA 3R2TA 3PO3G 2AQ1B 1HNZL 3IL8A 5ELFA 1EOVA 1VQ8A 4JI0L 3WOEA 1J5EQ 1IBKQ 3ZJYC 1S3OA 5EPLA 1YZ6A 4EGVA 3NQIA 1XMQL 4K6DA 1IW7D 4FNFA 4DNRB 3HOXG 1V1QA 2ID0A 1RJTA 5IOCA 1AFPA 2UUAQ 4YWLA 1PV4A 3J81E 1K0SA 3CPWA 5EKIA 3MZ5A 2Q2IA 3NELA 3NTHA 1P8LA 5AJ3L 4A3MH 3U58A 4A3IH 3RZOB 4J1MA 1NR2A 1RTNA 3A7AB 2FJ2A 3MFGA 5IE8A 4BWGB 4KLKA 1N33Q 1B3AA 2C35B 4DR1L 4G7ZC 1I4RA 3R3OA 5I4DA 2CH4W 4HMIA 5A35A 5C4JH 2EVBA 5C0XG 2R92H 3S17H 1IYJB 4NB3A 1B9NA 1VQBA 2MGSA 2F0EA 3X3NA 5C44G 4Q5VA 1N34L 1BVSA 1HFNA 2HT1A 1Q3LA 3HOVH 1JWMD 4R9WA 3GTJH 2CKZB 1Y69U 3T56B 3OOCA 2JA7B 2ICIA 3DM3A 4DA2A 2CQAA 4QY7A 2F4IA 3FKIB 3D4WA 1IZ6A 1HZCA 1SYEA 4NXMQ 1XPOA 1KAWA 3H15A 3SEBA 2K7VA 1K83B 2VB2X 3I2ZA 3H3VH 3J7YW 2M00A 2R93G 1V1PB 1TIID 3V96A 1G6PA 1RDPD 5C5MA 5M5WB 4DAVA 2H4OA 1E7ZA 2N8NA 3E3XA 1Y1WG 4KJNA 1OXUA 5FO7B 3VYTA 3DWAA 1GD7A 1JOQA 4UDUC 3T53B 3CC4A 4OHJA 4QUFA 1VQPA 3NK9A 4WORA 5I9PA 2A68D 1DYQA 1XWEA 1HZBA 3NTIA 1CUKA 1XX8A 4MZ9A 3MXGA 1QB5D 3C46A 1AE3A 3ULLA 5C4XB 1WCMG 3DUZA 4JI4Q 1VQCA 1ZYRD 4M1UB 1Y1VG 1WYDA 2E2HB 3BYTB 2NVTH 4DR4Q 2Z4IA 1PH7A 4OIKA 1XXGA 5KNCA 4O42A 1EQTA 2N78A 2WAQE 4FDBA 2A6HC 1ET9A 3GTOH 4JI5Q 2ZXRA 2ZTDA 1NJIC 1LT6D 4NPSA 1UEBA 4K2LA 4RGMA 2WV6D 4XIGS 5JVH3 4EQOA 3URYA 2QILA 5FLXc 5JJKA 1AN8A 4BA2I 5C3EH 1VQJA 1B44D 1A63A 2K1BA 4IPHA 2ZXOA 4RGOS 4YWMA 4HSPA 1PTOH 4A3CG 1JJCB 1YNXA 3PQIA 3KFUA 2AWOA 3I7FA 1C0AA 2CWAA 3AB9A 4JCVE 1V8QA 4A3MB 1AZPA 4A3IB 3UDXA 2A8VA 2E8GA 2KHSA 4NXNL 1YHBA 4DR2Q 5FLXE 1CHQD 4BY1H 2YV5A 4XQNA 2O5JC 1PHJA 2RKSA 1PH5A 1OTCA 5C4JB 4ZKCB 4EQ5A 1CM9A 5IGCA 2R92B 1F2MA 1OXVA 1DD2A 4GN4B 1BR9A 4RGTA 5IGBA 2ZJQA 1YVCA 5M3MH 5LMNQ 3HOVB 3CCRA 4LFAQ 4DR5L 3GTJB 2J7ZA 2HHHQ 5BN5A 1M90C 5EKLA 3MC0B 2ASBA 1EY5A 4GKJL 2RDFA 3H0GG 1BF4A 1BKBA 2A6EC 3BZDB 1G2SA 1D5XC 1NMFA 5DEHA 4TSSA 4QIWB 2ZM6Q 4J15A 3MEHA 4ZAIA 1SMYC 2YTXA 3NWSA 3L9AX 2IY5B 1JCKB 2ZTEA 4BY7H 2QF7A 4K8JA 4E6IA 4APVA 4GLAC 5LMUQ 2SEBD 4LF6L 2Z4HA 3E5SA 2GN5A 2X6LA 1PRTF 2JA5H 1K8AC 3FVQA 4NKLA 1ENFA 4RG1A 1Q8KA 1QVGA 4YHHQ 2FINB 4B3RQ 2WB1B 1R9TH 4IOCA 2MUYA 3P75A 2KOLA 1XNRL 1O7ZA 1SR3A 2JP1A 1STAA 1I4QA 1EY0A 1W3SA 2E5LL 1Q12A 3SE0A 4CDFC 2NVTB 4JV5Q 1WVLA 4CGYB 2UUCQ 2B2TA 3B6YA 3L0OA 1C9OA 1X3QA 4RCNA 3W1GA 1RTOA 2IHFA 1VQNA 1DJRD 4A3JG 1A2UA 3GTOB 5KRUA 2PZTA 1GJXA 1HQMC 3MTSA 1LTAD 1B4OA 1Z7TA 1A2TA 4UP9A 2BE5D 3S16H 4RWSC 3U9OA 2PPBC 3T1HQ 1GUTA 2EE1A 3OWFA 4FF2A 3K81C 3CHBD 1PFMA 1OXSC 1JC7A 5KYIA 5C3EB 3SK4A 4L63B 4H44C 2BH2A 1EZ6A 1PTOB 3KF8A 2GVBA 5M3FG 2R6GA 3M3YH 1VQHA 4O0AA 1DONA 1KD1C 1D6EC 5IP7H 2OEOA 1EY8A 5EJWA 1SYDA 5ELBA 4ZKBB 1AZQA 2NTTA 1B8AA 1LTLA 1B50A 1PTOD 3A5ZB 1QE6A 1IBLQ 4BY1B 1E1OA 3JAML 4N8X1 1QWYA 1SYBA 3PO3H 4XT1B 1HHVA 2FFKB 1SXTA 1VQFA 5M3MB 3I8ZA 1V1PA 4DR6Q 3H09A 1QOHA 2RF4A 1SBBB 4RFBA 3HOXH 2Y0SB 2B2WC 3VYSA 5T1GA 4JPBW 3HG9A 1GUSA 1ML0D 3TBIB 1YEZA 1II3A 2QDBA 1I6HH 2VQEQ 1VQMA 1VQKA 1EU3A 1FJGL 2PO4A 1Z9FA 3HOVG 2UXDL 3QOLA 4B08A 2JK8A 1MKHA 5IYDG 1IYVA 3BVMA 4BY7B 4DV3L 3RMHA 4DPGA 2K32A 4R8NA 3E0EA 1TS4A 4XT3B 2C5CA 4P74A 1N9WA 4JI6Q 1UUPA 4OONA 5C44H 2XVSA 3TMEA 5ELOA 5GAGC 1A15A 3K59A 3D0FA 2AMCB 1KL9A 2JA5B 3NEMA 2B2VA 2C9OA 4DK3C 3KJOA 3O13A 2DGYA 2B63B 1H95A 1J5EL 4LFBL 1RF2D 5KIXA 4PV1C 1R9TB 4PG3A 3CAMA 1XMOL 1LACA 1Q8IA 3LX0A 4WJ3M 1C7YA 1ASZA 4DV6Q 4GS3A 2D0OA 1N36Q 2KQ3A 1K73C 3FDTA 4PZ8A 1SNQA 3KUPA 2UUAL 1L0WA 3OWEB 2R7FA 2R93H 4IOAA 2NBFA 2KHJA 1JJGA 2AUJD 1K0RA 5J22A 3WOFA 1JWUD 3V2TA 2A73B 1T5XD 1Y1WH 4ALPA 1LV9A 1SE8A 1UAPA 4WRDA 3S16B 3QOJA 1E2ZA 4UY8C 4ULLA 2JN4A 5I6YA 1K8GA 2MHVA 2B3GA 5ELDA 5M5YH 2FMCA 1TS2A 4LAAA 1CKOA 4H0LC 3IFDA 1UE7A 1NAPA 3HS0C 2VL6A 1WCMH 2RHQB 2LKVA 1A0IA 1Y1VH 3M3YB 1KLGD 1YIJA 2EY1A 2F3IA 5HGQA 3T1YQ 4BBRG 3PCOB 1BBWA 1S4ZA 5C0XJ 2JQOA 2RCFA 3TP5A 3P7JA 2LY7A 2YU9H 5CV7A 4UP7A 4LUOA 3TN2A 4DGZA 3NBHA 2CVRA 3PO3B 2KA7A 2JJQA 4TKOB 5JEAG 2KCCA 1SNCA 4X62L 3HP3A 3GTLH 2DUDA 1LYLA 3BDLA 1G51A 2IX0A 2IW3A 1X55A 4OX9Q 4LUVA 4QL5A 4KJOA 2NYZD 1CFMA 3HOXB 4UP8A 2N49A 3OMGA 1PFBA 2L1BA 2F4VQ 2OTLA 1BXTA 3C2PA 2NZOA 1FL0A 1MI2A 1HRJA 1I6HB 3KDFA 1H9RA 1LO5D 1NR4A 1EEFD 2R61A 4X64Q 4DR4L 2DNEA 2AKWB 4Y52H 1OO9B 2ZJRA 2E2DC 4QQBX 4C3IG 1I50H 5LMNW 1CA5A 2UXCQ 5EBDA 5C44B 1XTCD 1RHPA 2KCTA 3RZOH 3DWQA 3UE0A 5CORA 1CT1D 3EFXD 4A3KH 4FYDA 1YNJD 3RN5A 2QCPX 4LF4L 4OELB 1EUJA 2DY8A 3H0GH 1H9SB 4QCLA 3PSIA 1LTBD 3J81j 3KBGA 1SNMA 2LSSA 3J80i 4MIUA 5IGEA 1WI5A 2R3ZA 3HRZC 3ERQA 2XRSD 1QJOA 1J8IA 2R93B 3PV0A 2H5XA 2B63G 2RHSB 5KNBA 4H02A 2CW0C 1PH4A 1SMXA 2JA6G 2UUBQ 4JOIA 5GAEC 3OIPA 4GOPC 4N9TA 4JI8Q 3VR5A 1GXDC 1TWAH 1T5EA 1EQVA 2Q8RE 1PTOF 3K8AA 1H9MA 2K14A 1FD7D 2LXJA 5FOBB 1EY7A 1B7YB 3CCJA 4DAMA 5M5WH 1D7QA 5LMNL 4DUYQ 4LFAL 2QEXA 2A6HD 2HHHL 4K0KQ 1Y1VB 1E3PA 2F1MA 2PI2E 4GNXC 2JYOA 2Z6KC 1IYUA 5DNFA 4DXGA 1GUOA 4NP5A 2I46A 4DV4Q 3SK6A 2YU9B 4S3SA 4LF9Q 4A3JH 2IPKD 4RAUC 1MIUA 4PMBA 3K5NA 1MJCA 2F0SA 1EYAA 3EBEA 5IP7G 3HKSA 4LF5L 2EOTA 1LT4D 1IKLA 3GTLB 3Q24A 5LMUL 4JYAQ 4FXGC 4JC0A 3MFYA 2F0UA 2D62A 2JA9A 4DV0Q 5M3FH 1BBUA 1LT3D 4B3TL 4HJ7A 1CTMA 2PCFB 4GLVB 4AYBG 3RZDH 5CV5A 2NN6I 3DHQA 4HJ5A 4A3BB 2IWHA 1BCPC 2F0JA 2EY5A 2HD3A 3T16A 4OXPA 4NW2A 4X65Q 2WKDA 1MSHA 2WKCA 4DR3L 4A93G 2BDNA 5ISRA 1TKWB 4RKBA 4DK1A 1I50B 5M9OA 1Q86C 1TU2B 2A6ED 4G7OC 1S5ED 1QCBD 1DM0B 4A3KB 3MXPA 3ICEA 3GV6A 3CKIB 3K0YA 3I3CA 3PUWA 4ILWA 3VR6A 4YY3L 3K5MA 3T1HL 5CV4A 1P16A 3RN2A 1EY9A 1SMYD 1ZEQX 1D1KA 4Q0FA 3PO2G 3H0GB 2HDMA 4JK1C 4K14A 1F9QA 1VDZA 1TY2A 1A8VA 2HIXA 1HJPA 4DV5L 3MXNA 1VQEA 1LUZA 1EWHA 4IUQA 3I4OA 1QZHA 1WD1A 4C56C 4B3MQ 5JJIA 5IYDH 4LFCQ 1IL2A 4JI2L 2ATWA 3J80c 4ABNA 1NSNS 1IBLL 3DEPA 2EPBA 3BZKA 1TWAB 1M1KC 1YI2A 5EAYA 4ZUIA 4DV2Q 4LF8Q 4DUZQ 5K36G 3PIO3 5JJLA 5CV8A 1NBWA 1QVCA 1O80A 1VQAA 1SNPA 4ZRZA 2LFNA 2PQEA 3PIPA 1VQOA 1RKNA 2OF1A 3J80E 1FYCA 4WFN3 2KENA 2Z1CA 2HQLA 2A69C 1GUNA 2K28A 2CWPA 2PMZB 4A3EG 3K58A 3W5OA 4R4TA 2ZTCA 3U4ZA 1F2ZA 4BA1I 1HUMA 4F87A 2VQEL 2BOSA 4A3JB 1ILPA 1I4HA 1PYBA 3I4MG 2IX3A 4YCUA 1D5ZC 4HAEA 2CH4A 3FMCA 3C1FA 3CC7A 4O1NA 2WACA 2YTYA 2TSSA 4F8MA 4P71A 3GTQH 1CZGA 4JI6L 3PF4A 3OSOA 5KGUA 1WJJA 1B1ZA 3SK5A 4LK1C 4N9PA 1SJHD 4JI7L 1NE3A 3I70A 5M3FB 1PH9A 5GQOA 1HQRD 5JJZA 2ALYB 1HR0Q 4LJZC 4BBRH 3QG1A 3FEWX 3U50C 3RZDB 2EYOA 2I07B 1CK1A 5C3WA 1N36L 5IYBG 4ZLTF 4JBJA 4EX5A 1HNXQ 1NY4A 1TWGH 3JC66 4JVZA 5JPMC 3C1EA 2LMCB 1KRTA 2L12A 4X3TA 1H9SA 5C5LA 5JEAH 2B8GA 1D8LA 3CW2C 2EYHA 3S2HH 1X9NA 3VR2A 3C3LA 3QIAA 4C2MH 1HXYD 3U9SA 4XXEA 1I94L 1FNUA 2G5DA 2K50A 1JB7A 1QUQB 3ONAB 4A3BG 1BNZA 2K5VA 1MSGA 2RCNA 3FPPA 4IQZA 1WFQA 1DOKA 5D3DA 2NVXH 3BYYB 3ZYYX 5IT9L 4A76A 4RH6A 5EKKA 1I6VC 1N32Q 2MO0A 4XYQA 2NZHA 2VXWA 4A3GG 4F7XA 4CJ2C 1YHAA 3T1YL 4A3KG 3E9IA 2R7DA 4EQNA 3AFPA 1FGUA 4IJHA 1D2BA 1XNQQ 4C3IH 3BZCA 3CCEA 4DK0A 5NUCA 1TS3A 2AHOB 1U0LA 3KJPA 2V4DA 5D3IB 3K80C 2NN6G 2HCCA 2N88A 1VF5C 2OTJA 3ND9A 3I72A 4NDXA 3OIQA 2Z6BA 2MPMA 5FJ8G 2RSOA 2VY3A 3A55A 2F0VA 4B3SL 4FF3A 2B2TC 2PYKA 3VYRA 5CBEE 3SR1A 4HIDA 1VQLA 2EY2A 2F4VL 4ZYSA 1ZKOA 4A3DG 4KHPL 4HJ8A 3Q22A 3OTOQ 1E22A 2NZ1D 4WJWA 4Y7NH 2B63H 2Q8TA 1OXTA 1CSQA 3IFTA 4X64L 3BG3A 4HIKA 2JA6H 2MQHA 3HKZE 3HOZG 2DN8A 4KK7A 2FMMA 5CR3A 2UXCL 2RDGA 1SDFA 3GTQB 2WIIB 1YITA 4IFDH 3D31A 4I65A 4MN3A 2HIVA 5A2QE 1CA6A 1HNZQ 1PXUA 1KNEA 4BS9A 2AUKA 4DV1L 1YJ9A 4JI0Q 2KJXA 1DZ1A 4XTCS 5EPKA 1CZWA 4IPCA 4L6TB 1DOLA 3SGIA 3I55A 4HJAA 2HDLA 4BBRB 4BBSG 3H91A 2NB0A 3QWNA 4OO1H 4RA8A 1IBMQ 2UXBL 2KCNA 1UE6A 4PZ7A 2FHTA 2QKIC 1XMQQ 2HQEA 1WTWA 3IAYA 1TWGB 4X66L 2PNHA 3HEJA 1HA5A 3D4DA 5AJ3Q 1B70B 1DXMA 2XWJB 4DAYB 1S5FD 1Q1EA 2XNAC 3S2HB 2JEBI 4CHTB 1X3GA 4C2MB 1PVOA 3FP9A 2SOBA 2UUBL 4KV6A 2X6GA 4AQYL 4DR1Q 4JI8L 5FLMG 2EYMA 3BJUA 4YCVA 1J6QA 1W6KA 2EXDA 3J81L 3UI2A 2NVXB 2KVMA 1JMCA 4P2CB 5BN3A 2J4XA 3KOJA 5CV6A 3BDCA 1LT5D 5HY6A 1GM5A 5C3XA 1U4LA 4C1NK 4G57A 4K0KL 1F2YA 3TZUA 2WINB 2M2LA 2JA8B 3AMUA 4A93H 2BCOA 2KHIA 2WAQG 4C3IB 2B2YA 2Z8LA 3Q23A 2A19A 2Z9HA 4IUPA 4DV4L 3NPPA 4LF9L 1TT2A 3OW2A 3S15H 2Q2HA 5C4HA 1B9MA 4IJLA 1EYDA 1STGA 3CMEA 1W6JA 2XSCA 3S1MH 4JG2A 4IFDI 2JXMB 4CBVA 4L5QA 1O7LA 5C6AA 1XPRA 3PO2H 2CW0D 1ET6A 3PUYA 1FVIA 1K8MA 2B2UC 5EGTA 4CJ0B 1L1OB 2F3VA 2PZWA 3NTKA 4KKTA 4OO1I 3G4SA 2HCIA 2V1CC 2IJ0A 1QILA 4AIMA 2EDGA 2HUGA 3A7LA 1STEA 2UU9Q 4Y7NB 4MTKA 2PNRC 3KBXA 5DLQE 4IN3A 3T4AC 1IBKL 1S72A 4GNXB 5G3LD 5IY0A 3CCVA 3K5LA 1STHA 5JVG3 1X54A 2JA6B 1HH2P 2K5NA 4X65L 1S40A 1R4QB 1YJWA 1RCVD 1HPCA 2AWNA 4HIOA 2F0TA 1IL8A 1GOZA 1TS5A 4MHEA 1Q82C 5K36H 2IT1A 3STBC 1G291 2BA1A 3OYYA 4MNOA 4OIJA 3QB3A 4KY6A 2G9DA 1N33L 4J8QA 4ZCKA 3D6CA 1YNNC 4PMWA 3K0XA 4EVOA 1QUQA 4A3EH 4HR7B 2OWOA 4A3LG 1VQ4A 2RDHA 2MJ8A 1KIXA 3GO5A 4OEMB 4QF4A 1ENCA 5AFWA 1SE2A 1M8AA 2IX1A 3I4MH 2A1AA 4HCEA 4KN7C 4ZQ3A 1BCPB 1MJEA 4FO2A 3W1BA 3ERSX 4NXNQ 2NVQH 5IIFA 3EROA 1U4PA 3F2CA 1EYGA 3L7ZC 3RLFA 2JSOA 4DN4M 4NXML 1CSPA 3DWPA 3GD7A 1JWSD 1BCPD 1D5MC 5BR8Q 4DV2L 4LF8L 3EJIA 4DUZL 2L15A 4U673 2F52A 4V0BA 2EQSA 1AEXA 1JB3A 1E2WA 4DKAC 4AYBB 1Z47A 5FLXL 2VZAA 3VA7A 5IYBH 2DY7A 2EZVA 5J3BA 4EQPA 3TP6A 3A8KE 1XTDA 4GKJQ 4CDDC 2B29A 1AH9A 1WTPA 3KYHC 4A93B 5JPNC 5IWAQ 1KDBA 1H9KA 5L37A 4AH6A 3JAMi 1SFOH 3S15B 3J7ZC 3EIVA 4L8JA 2O5IC 2JEAI 4JI4L 4A3BH 1VMCA 5ELCA 5GAHC 1STNA 3S1MB 1IHZA 1U5KA 3L3OC 1CQFA 1A62A 2QA4A 2KBNA 2JA8G 1FR3A 3RLOA 3CRKC 3SXHA 1STBA 5FKAC 3PO2B 5I6WA 2OXPA 4LF6Q 2F3WA 3OHXC 4IO9A 4JW0A 4A3FG 4JI5L 1V1OA 1YHQA 2PW5A 2I5HA 4A3GH 1KDAA 2VNUD 1PTOC 5IP9G 3CCQA 2K75A 1HZAA 3W2DA 1XNRQ 3L2PA 3CCSA 1PLFA 3MHBA 3GP7A 2PQAB 1TWCH 4OGQC 4GZYC 2F0KA 4BXXH 3SVMA 1TQOA 1PH1A 2XRQD 1JQYD 3M7GA 1NTGA 3J7AV 2B8FA 5CBAE 2NN6H 1XJVA 3F2DA 5CMDA 3A74A 4UPAA 5HURA 4U68A 2J0TD 2XGTA 5FJ8H 2F0NA 2M9VA 5E1FA 2R7ZH 4ME5A 1JT8A 3U4VA 2Z0SA 4ZK9B 3T51B 3MVVA 4DR2L 1EY4A 3NBIA 4IZ8A 4C3HG 3HOYG 1F77A 4RHRA 4DAYA 4A3DH 5E3FA 3RUZA 3ULPA 2D5DA 1VQDA 4A3EB 1WTVA 3LGJA 3AQQA 1Q1BA 4IFDG 5IGGA 1K3RA 3F2BA 1PMRA 3J7A5 3I90A 1K3BC 1Z6HA 3I4MB 2CHBD 1SNOA 2Q2TA 2XIWA 3HOZH 4RKLA 1SNDA 2NVQB 2O4XA 3FPUB 2L0CA 2X69A 4GN5A 2EY6A 5F2DA 4OO1G 2L55A 3S1RB 1KXLA 1Q90A 1HCZA 4HN7A 1BQQT 3TP8A 2F0OA 1GKHA 2F0FA 2K52A 2OCEA 2VS1A 2ZM6L 2EYPA 1DCZA 4RMFA 1BOSA 1SE4A 4BBSH 1VQGA 3MXUA 4KD4A 3K57A 4H13C 4L5RC 3ND8A 3TSSA 4X3KA 4JI1Q 1EU4A 1GUGA 3K6OA 2Q8IB 4POFA 4LF7Q 1PH2A 4GKKQ 3KLRA 1PFNA 3HOUG 3OW7A 2K33A 4X6AH 3DXJC 1H9JA 2QGQA 1SYGA 5HGTA 4YHHL 4B3RL 1BUVT 1L1OA 1SFOB 5IODA 3TS0A 1WTXA 4FXDA 3PF5A 5FLMH 2FXQA 1I3QH 2O2LD 4JV5L 4DV3Q 4GNXA 5G3LF 2H1EA 2UUCL 2E2IH 3P1HA 3JAMc 3J81c 4XQJA 5D65A 1GUWA 2K4KA 1EYCA 1U4MA 1JE4A 2EJFC 4A3GB 3HZXA 3N6RA 1L0YB 3NP8A 4LFBQ 3F8TA 1XMOQ 4R8IA 2AQ2B 1VF7A 1IBML 4JBWA 1ILQA 4KD3A 2L4NA 1TWCB 4NMZA 1GO3E 5CV9A 1SLJA 3JAME 4YWKA 1SE3A 3EQLC 2VW9A 4L5TA 1E1TA 1PZJD 3PUVA 3GTKH 2QW7A 1PZKD 3SDZA 1XYIA 1EEID 3MA2B 1YBYA 5FK9C 5J39A 2MP1A 3LNNA 4RCOA 3GTPH 4LWCA 2R7ZB 3KF8B 1WTHA 3PUZA 5J1ZA 4RHSA 4I7AA 3M4YA 2JE6I 4A3DB 1K9MC 2PMZE 4DR7Q 5IGDA 4OL7A 1NMGA 3Q8DA 2VQFQ 1BCPF 1HFGA 2F0LA 2I0QA 4PZ6A 3G48A 4YIJA 3S1QH 2ICEC 3UDIA 4DR6L 2AQ3B 5I2XA 1ESFA 1Y14B 3GTMH 3HOZB 5IYCH 3CQZH 1WTOA 1YNJC 2G9HD 3FRPB 1WTQA 3V05A 3J7AF 1G6ZA 1BBXC 1VCIA 1TY0A 1X3EA 1KNAA 1PDQA 2EJMA 4CDEC 1S5DD 1BO0A 4R4QA 1DGSA 3MAQA 3AYHB 3BVZA 1G8ZD 5M5XH 4X62Q 4DK6C 5GROA 1A6XA 2WP8J 2XWBB 3LWEA 3KK7A 3TEHB 4BBSB 1M4VA 2K05A 3E6ZX 4A3LH 1E2VA 1SYFA 4H7BA 2KCMA 1KTKA 2NVYH 3LWUA 5D14A 3RNUA 2VUMG 4CKCA 4OWWB 3CP0A 3HOWB 5BN4A 1LABA 1LTSD 2UU9L 4LNQA 4KMUC 3K5OA 2BA0A 1X32A 4JBMA 3S9WA 2RVLA 2PZUA 3VR3A 4DV6L 1I3QB 1Y8NB 2RQXA 4XDXA 3G71A 1KLUD 3UDGA 1G91A 3R8BA 5LHY1 2PQAA 2EJGC 3A0JA 2E2IB 1U9RA 5DAUA 1CKNB 1CQVA 1X6OA 4G4KA 1GVPA 3D6WA 4LF4Q 3AEVA 3BU2A 1E0BA 1I4PA 2MO1A 2N3SA 4C3JG 3I4NG 1HA6A 3RR5A 2WAQB 3NQTA 4HMJA 3PMFA 4DV7Q 2XTIA 2ES2A 3WWVA 3K7AH 4QIWE 1A3TA 1PRTC 3S1NH 1C48A 2KEEA 3GTKB 1TVXA 4IUUA 1E24A 4HIMA 2JA8H 3H3VI 4KY7A 1Y8PB 3F2UA 3GTPB 2I5LX 4QGUA 1BDOA 3A8IE 1HNWQ 4TRDA 1JOOA 5BR8L 4A3FH 1WTRA 4BXXG 1FGBD 3S17B 5C4ZA 4FP5D 3CPFA 1ENAA 1CI3M 3AU7A 3P20A 3G7LA 2OQKA 5IP9H 3Q6SA 2P5ZX 2WB1E 4HCSA 2LXKA 1RL2A 3Q0AA 1IW7C 4J6HA 3STBD 4OX9L 2R7ZG 3MWYW 3S1QB 1VQ7A 1A3VA 4IUTA 3S14H 3NBHB 3IKJA 4OWXB 3R2IA 3GTMB 2KUMA 3EVQA 3I73A 3NSWA 5IWAL 4FF1A 1TWFH 1YNND 3CQZB 2F0MA 4O2DA 5JEAJ 4DFAA 3M85A 4X3UA 3NWTA 3D4RA 4KHVA 4K5VA 2MNAA 2DNCA 4C3HH 3HOYH 2JA7G 5KYLA 5M5XB 4KHZA 4LF5Q 5FO9B 3PIP3 4JI3Q 2L5TA 1GHKA 3FKIG 5CGKA 3N52A 4QUCA 2EXZA 1Y8OB 2PI2A 2D9UA 4DAPA 4TVAB 4ZUJA 3KDFB 3H94A 2E76C 2NVYB 1JJ2A 1W2BA 1RIPA 2OT2A 4CJ1B 1C4QA 4KKUA 3CMAA 3NENA 2CFMA 4B3TQ 3K7UC 3KF6B 5CC4A 4DF7A 3TP7A 2F0GA 1RODA 1EFWA 2F03A 4GN3B 1VS0A 3QJYA 3QO2A 1NNXA 1PZID 1B2TA 4DR3Q 2PW7A 4R4IA 2ZJPA 4PQXA 2CCZA 5T1IA 4G7HC 1V9PA 1EIFA 3HOWG 2N55A 1UE1A 3TRZA 5C4XG 3E9HA 2A74C 2NUCA 1PH3A 1YJNA 2F0IA 1ZXTA 3HKZB 1CHPD 1LTRD 4YY3Q 2B2YC 2A68C 1EIGA 3S24A 2EYLA 3HOUH 2GA4B 2Y0SE 1HZ9A 1SROA 2XN9C 1ZYRC 3PGZA 1KRSA 3VR4A 5I2YA 1I4GA 4DV5Q 1N34Q 5H1SE 3CC2A 1AE2A 4P72A 3G6EA 3T13A 4DUYL 1JE5A 3K7AB 3D3RA 2F0HA 3I4LA 1F9SA 3S1NB 1JICA 4JI2Q
chains in the Genus database with same CATH topology
3KFUA 1OXXK 2AWOA 3I7FA 1C0AA 3VDYA 2CWAA 1SFOH 4JCVE 4OXPA 4AH6A 3JAMi 4X65Q 2E2JH 1Q81C 3J7ZC 3TQYA 3M4OH 3EIVA 4R4OA 1KHIA 4DR3L 4JI4L 3PUXA 2JEAI 4A3BH 4A93G 3A5UA 2A8VA 3UDXA 4IFDJ 2E8GA 5GAHC 4NXNL 1YHBA 1PH6A 1U5KA 4DR2Q 1Q86C 2QA4A 1A62A 2JA8G 2KBNA 2Q2UA 4BY1H 3RLOA 1PH8A 2YV5A 4R1JA 2YYZA 1PHJA 4A3MG 1PH5A 4A3IG 1OTCA 4LF6Q 3TREA 4EQ5A 4IO9A 3M9BA 2MFIA 3ICEA 4GOPB 3PUWA 4A3FG 4JI5L 4JI1L 1OXVA 4YY3L 3T1HL 1YHQA 1P16A 2I5HA 4GN4B 3RN2A 1PYSB 4A3GH 4JYAL 2VNUD 2ZJQA 3ULJA 3ER0A 1YVCA 5M3MH 5GADC 3GTGH 4LF7L 3PO2G 5LMNQ 4GKKL 3CCRA 5IP9G 3CCQA 3MEFA 2K75A 4LFAQ 1HZAA 1UE5A 4DV0L 4R4CA 1TWHH 3L2PA 3CCSA 4DR5L 2HHHQ 1XNRQ 2R92G 2HIXA 1A8VA 1M90C 1HJPA 4ME3A 4DV5L 2PQAB 1VQEA 1LUZA 1TWCH 2ASBA 4GKJL 3I4OA 1QZHA 3H0GG 1BKBA 4BXXH 1PH1A 3CCMA 4B3MQ 3UE1A 1NTGA 4TQUS 5JJIA 5IYDH 4LFCQ 1IL2A 4JI2L 1NMFA 1XJVA 2ATWA 3F2DA 4OWTB 1LM0A 3J80c 2ZM6Q 4J15A 3A74A 4UPAA 1IBLL 2XGTA 5FJ8H 4YCWA 3BZKA 2R7ZH 2YTXA 2IY5B 5IYCG 1JT8A 3U4VA 1M1KC 3DLLA 2ZTEA 2Z0SA 4BY7H 3CD6A 4DR2L 4APVA 4JI7Q 1YI2A 3HOYG 5EAYA 3FHWA 4DV2Q 4GLAC 4LF8Q 4DUZQ 4JBKA 3M7NA 5K36G 5LMUQ 4A3DH 5JJLA 1NBWA 3RLNA 4LF6L 3ULPA 1QVCA 1VQIA 2GN5A 1VQAA 1VQDA 2JA5H 1K8AC 3LGJA 5ELNA 3AQQA 3PIPA 1VQOA 1VQ5A 1Q1BA 4RG1A 3UDFA 4IFDG 1Q8KA 1T9HA 1QVGA 3GDEA 4YHHQ 3F2BA 1K3RA 2KENA 3F1ZA 4B3RQ 1CKNA 2HQLA 1R9TH 3J7A5 4IOCA 2CWPA 2EIFA 4A3EG 1XNRL 1SR3A 4R4TA 3W5OA 2Q2TA 2ZTCA 3U4ZA 3HOZH 4BA1I 2VQEL 1W3SA 2I5MX 2WB1G 2E5LL 1Q12A 4WJ4A 1XPUA 1EWIA 4GN5A 4JV5Q 4OO1G 1IXRA 4B3ML 2WFWA 2UUCQ 3I4MG 1PYBA 3B6YA 3L0OA 4LFCL 1I94Q 1KXLA 1C9OA 4YCUA 4AYBE 1GKHA 3W1GA 2K52A 1Q7YC 2OCEA 4LW1A 2VS1A 2ZM6L 3CC7A 2IHFA 1VQNA 2YTYA 3GTQH 4A3JG 4P71A 3S1RH 1HR0W 3MXNB 4RMFA 4JI6L 3PF4A 2VUMH 1WJJA 4UP9A 4BBSH 1VQGA 1PFSA 4JI7L 1NE3A 4L5RC 3HFZB 3S16H 4DR7L 4A3CG 2VQFL 3IRBA 3T1HQ 4JI1Q 1PH9A 5GQOA 3K81C 3I56A 2ALYB 1OXSC 1HR0Q 5E7NA 4POFA 4BBRH 4LF7Q 3S2DH 1PH2A 4POGA 4GKKQ 3HOUG 4DR5Q 3U50C 3HKZG 3CXCA 2BH2A 4X6AH 2GVBA 5M3FG 1UWVA 2QGQA 2R6GA 4YHHL 1N36L 5IYBG 4B3RL 3M3YH 1VQHA 4JBJA 4O0AA 1KD1C 4EX5A 1HNXQ 1NY4A 1L1OA 5IP7H 1QZGA 1X65A 5C3EG 1TWGH 3TS0A 1SN8A 3JC66 4MTNA 1KRTA 3PF5A 1B8AA 5FLMH 2FXQA 1I3QH 1LTLA 5C0XI 1WOCA 4IPGA 1D8LA 3A5ZB 3CW2C 4DV3Q 3J81i 4GNXA 4JV5L 1IBLQ 1ASYA 3S2HH 1X9NA 1E1OA 4C2MH 2UUCL 1I94L 1CKMA 1L2FA 4P75A 2K50A 1JB7A 2E2IH 1QUQB 4KI0A 3JAMc 3PO3H 3J81c 4A3BG 1KQSA 2K5VA 2RCNA 3CCUA 4B3SQ 4C3JH 3I4NH 1WFQA 3M4QA 1VQFA 2K4KA 4BY1G 4IPDA 2K5HA 2NVXH 4A3CH 1O7IA 1SRUA 4LFBQ 4KHPQ 4A76A 3F8TA 1XMOQ 5IT9c 3AFQA 4DR6Q 1IBML 1N32Q 2MO0A 4JBWA 2RF4A 3HOXH 1HR0L 2NZHA 4A3GG 1X3FA 1Q46A 1YHAA 1GO3E 5M3MG 3E9IA 3T1YL 4A3KG 2R7DA 1SLJA 2YTVA 4JOIC 1YEZA 3AFPA 4YWKA 1I6HH 1FGUA 4IJHA 2VW9A 1XNQQ 4L5TA 1E1TA 3KF6A 4C3IH 3BZCA 2VQEQ 1VQMA 1EQQA 1VQKA 2Y0SG 3PUVA 1HNXL 1FJGL 2E5LQ 4P73A 3CCEA 3GTKH 1Z9FA 2AHOB 1U0LA 3HOVG 3KJPA 2D0PA 2UXDL 3M4PA 2JK8A 1YBYA 1MKHA 3GTPH 2BH8A 4LWCA 5IYDG 1TXYA 3K80C 2NN6G 2OTJA 3KLWA 4DV3L 4DPGA 3KF8B 3PUZA 3E0EA 4A75A 4DV1Q 4P74A 1N9WA 4JI6Q 4OONA 2JE6I 5FJ8G 5C44H 5ELOA 5GAGC 1K9MC 2PMZE 2VY3A 3D0FA 2AMCB 4DR7Q 1KL9A 4B3SL 4BY7G 1NMGA 3NEMA 3Q8DA 4DK3C 2VQFQ 3KJOA 2UXBQ 1V43A 2DGYA 1H95A 4HIDA 1J5EL 4DV7L 1VQLA 2I0QA 4PZ6A 2GVAA 3G48A 2F4VL 4HJ8A 4PG3A 3S1QH 3CAMA 3OTOQ 4A3DG 1XMOL 1E22A 3UDIA 4WJ3M 4DR6L 2JA5G 1N32L 1I5FA 4Y7NH 4X66Q 4HJ9A 1KC8C 1C7YA 1Y14B 1ASZA 3EN2A 4DV6Q 3GTMH 4GS3A 2B63H 2D0OA 1N36Q 5IYCH 1K73C 3PIOA 1OXTA 3CQZH 2JA7H 1CSQA 4PZ8A 4X64L 2UUAL 1L0WA 4HIKA 2JA6H 2CQOA 2MQHA 3FKIH 1VCIA 2R7FA 1X3EA 2R93H 4IOAA 1PA6A 1XNQL 3CF5A 2KHJA 4AQYQ 3HKZE 3HOZG 1EIYB 1JJGA 4R4QA 1DGSA 1HNWL 3AYHB 1K0RA 5M5XH 2UXCL 4X62Q 1K83H 4DK6C 5GROA 4L5SA 1YITA 4QJFA 1Y1WH 3D31A 2WP8J 4ALPA 4DNIA 3TEHB 1SE8A 2HIVA 4LFBL 1L1OC 1HNZQ 4UY8C 4A3LH 4DV1L 1YJ9A 1K8GA 4JI0Q 2B3GA 2KCMA 2NVYH 5M5YH 3CCLA 1VQ6A 4XTCS 3TS2A 1QVFA 4IPCA 3SGIA 3RNUA 3I55A 4HJAA 2VUMG 1CKOA 4OWWB 4BBSG 1UE7A 3CP0A 1IBMQ 2UU9L 2VL6A 4LNQA 1UE6A 2UXBL 4PZ7A 1WCMH 2RHQB 1EQRA 1XMQQ 1A0IA 1Y1VH 2BA0A 2OQ0A 4GOPA 4JBMA 3OTOL 1YIJA 5HGQA 2F3IA 3T1YQ 4A4IA 4BBRG 3HOWH 3PCOB 1BBWA 2PNHA 4X66L 5C0XJ 5AJ3Q 4DV6L 5C4XH 1VQ9A 2JQOA 1N8RC 1B70B 1FJGQ 4DAYB 2E2HH 3G71A 1Q1EA 3UDGA 2YU9H 2UXDQ 2JEBI 1PVOA 1X3GA 2PQAA 4UP7A 3FP9A 4JI3L 4LUOA 3A0JA 2UUBL 1X56A 4AQYL 4DR1Q 4JI8L 2IHEA 5FLMG 4YCVA 2JJQA 3BJUA 5JEAG 4GLXA 4X62L 1J6QA 2Z6KA 2EXDA 1CKNB 3GTLH 1X6OA 2DUDA 4LUZA 1LYLA 1G51A 2IX0A 1GVPA 1X55A 1JMCA 4LUVA 4LF4Q 3BU2A 4OX9Q 3AEVA 4QL5A 3PO3G 3KOJA 1HNZL 2MO1A 1EOVA 2N3SA 1VQ8A 4JI0L 3I4NG 5HY6A 1GM5A 3RR5A 4UP8A 2N49A 4K0KL 1J5EQ 1IBKQ 4DV7Q 3ZJYC 2F4VQ 2OTLA 1S3OA 2XTIA 2NZOA 1YZ6A 1FL0A 2ES2A 3WWVA 3K7AH 4QIWE 4A93H 1XMQL 3KDFA 2KHIA 2WAQG 3HOXG 3S1NH 1V1QA 2ID0A 2A19A 1E24A 4X64Q 4DV4L 4HIMA 2UUAQ 4YWLA 2JA8H 1PV4A 3H3VI 2AKWB 4LF9L 4DR4L 3OW2A 4Y52H 3S15H 2Q2HA 5AJ3L 3NELA 2Q2IA 3CPWA 1P8LA 2ZJRA 4A3MH 4IJLA 3U58A 4A3IH 4QQBX 2I5LX 3CMEA 1I50H 4QGUA 5LMNW 1HNWQ 3S1MH 4JG2A 2UXCQ 4IFDI 5IE8A 5BR8L 4A3FH 4BXXG 4KLKA 1N33Q 4KHPL 4L5QA 3CPFA 2C35B 4DR1L 2KCTA 3RZOH 3UE0A 1XPRA 3PO2H 4A3KH 2OQKA 5IP9H 5C4JH 3RN5A 5C0XG 2WB1E 3PUYA 2R92H 1FVIA 2LXKA 1RL2A 3S17H 1IYJB 4NB3A 1VQBA 1L1OB 3STBD 4OX9L 5C44G 4LF4L 2R7ZG 1N34L 4OO1I 1BVSA 3G4SA 2HT1A 1EUJA 1VQ7A 2V1CC 3H0GH 4AIMA 3S14H 3PSIA 3NBHB 3HOVH 3J81j 2UU9Q 4OWXB 5DLQE 2LSSA 5IWAL 2CKZB 3J80i 3GTJH 1IBKL 1S72A 4GNXB 1TWFH 1WI5A 5IY0A 3CCVA 4O2DA 5JEAJ 3DM3A 1X54A 3M85A 4QY7A 5JJKA 1HH2P 2K5NA 4X65L 3PV0A 1IZ6A 1S40A 1HZCA 2H5XA 1YJWA 2MNAA 1XPOA 1KAWA 4NXMQ 2B63G 2RHSB 4H02A 2AWNA 4HIOA 4C3HH 3HOYH 3H15A 2JA7G 1PH4A 4KHZA 1SMXA 4LF5Q 4JI3Q 3I2ZA 3H3VH 1Q82C 2JA6G 3FKIG 2IT1A 3STBC 1G291 2BA1A 4JOIA 5GAEC 3OYYA 4MNOA 4GOPC 2UUBQ 2R93G 4JI8Q 2PI2A 1TWAH 1G6PA 4TVAB 3KDFB 3K8AA 1JJ2A 2K14A 1RIPA 1E7ZA 2N8NA 2LXJA 1W2BA 1N33L 1B7YB 3CCJA 4PMWA 3K0XA 1Y1WG 4DAMA 1OXUA 3CMAA 3NENA 2CFMA 5M5WH 4B3TQ 1D7QA 1QUQA 1GD7A 5LMNL 4DUYQ 3K7UC 4A3EH 3KF6B 2OWOA 4A3LG 1VQ4A 4LFAL 2QEXA 3CC4A 1KIXA 2HHHL 4K0KQ 3GO5A 1VQPA 1E3PA 2PI2E 4GNXC 1EFWA 1VS0A 4GN3B 2Z6KC 1HZBA 1CUKA 2IX1A 3I4MH 4MZ9A 2A1AA 1AE3A 3ULLA 1WCMG 4DR3Q 4R4IA 1MJEA 2ZJPA 2CCZA 4JI4Q 1VQCA 3W1BA 1Y1VG 1WYDA 3ERSX 4NXNQ 2NVQH 4DV4Q 2NVTH 4DR4Q 1V9PA 3F2CA 1EIFA 4LF9Q 4A3JH 1PH7A 1EYGA 3HOWG 1UE1A 3TRZA 3L7ZC 3RLFA 4NXML 5C4XG 1CSPA 1MIUA 3E9HA 3GD7A 1MJCA 1PH3A 1YJNA 2N78A 2WAQE 3EBEA 4FDBA 5IP7G 3HKSA 4LF5L 5BR8Q 4DV2L 3GTOH 4JI5Q 4DUZL 4YY3Q 4LF8L 2L15A 2F52A 5LMUL 2ZTDA 3S24A 4JYAQ 2EQSA 1NJIC 4JC0A 4NPSA 3HOUH 1UEBA 4DKAC 2Y0SE 2D62A 2JA9A 1Z47A 4XIGS 2VZAA 4DV0Q 5M3FH 1HZ9A 1BBUA 1SROA 5IYBH 5FLXc 3PGZA 1KRSA 5J3BA 4DV5Q 1N34Q 5H1SE 3CC2A 1AE2A 4BA2I 4B3TL 4P72A 5C3EH 1XTDA 1VQJA 3G6EA 4DUYL 4HJ7A 4GKJQ 1A63A 2B29A 1JE5A 4IPHA 1AH9A 4GLVB 4AYBG 3KYHC 4YWMA 5IWAQ 3RZDH 2NN6I 4HJ5A 1JJCB 4JI2Q 1YNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KFU A;  1OXX K;  2AWO A;  3I7F A;  1C0A A;  3VDY A;  2CWA A;  1SFO H;  4JCV E;  4OXP A;  4AH6 A;  3JAM i;  4X65 Q;  2E2J H;  1Q81 C;  3J7Z C;  3TQY A;  3M4O H;  3EIV A;  4R4O A;  1KHI A;  4DR3 L;  4JI4 L;  3PUX A;  2JEA I;  4A3B H;  4A93 G;  3A5U A;  2A8V A;  3UDX A;  4IFD J;  2E8G A;  5GAH C;  4NXN L;  1YHB A;  1PH6 A;  1U5K A;  4DR2 Q;  1Q86 C;  2QA4 A;  1A62 A;  2JA8 G;  2KBN A;  2Q2U A;  4BY1 H;  3RLO A;  1PH8 A;  2YV5 A;  4R1J A;  2YYZ A;  1PHJ A;  4A3M G;  1PH5 A;  4A3I G;  1OTC A;  4LF6 Q;  3TRE A;  4EQ5 A;  4IO9 A;  3M9B A;  2MFI A;  3ICE A;  4GOP B;  3PUW A;  4A3F G;  4JI5 L;  4JI1 L;  1OXV A;  4YY3 L;  3T1H L;  1YHQ A;  1P16 A;  2I5H A;  4GN4 B;  3RN2 A;  1PYS B;  4A3G H;  4JYA L;  2VNU D;  2ZJQ A;  3ULJ A;  3ER0 A;  1YVC A;  5M3M H;  5GAD C;  3GTG H;  4LF7 L;  3PO2 G;  5LMN Q;  4GKK L;  3CCR A;  5IP9 G;  3CCQ A;  3MEF A;  2K75 A;  4LFA Q;  1HZA A;  1UE5 A;  4DV0 L;  4R4C A;  1TWH H;  3L2P A;  3CCS A;  4DR5 L;  2HHH Q;  1XNR Q;  2R92 G;  2HIX A;  1A8V A;  1M90 C;  1HJP A;  4ME3 A;  4DV5 L;  2PQA B;  1VQE A;  1LUZ A;  1TWC H;  2ASB A;  4GKJ L;  3I4O A;  1QZH A;  3H0G G;  1BKB A;  4BXX H;  1PH1 A;  3CCM A;  4B3M Q;  3UE1 A;  1NTG A;  4TQU S;  5JJI A;  5IYD H;  4LFC Q;  1IL2 A;  4JI2 L;  1NMF A;  1XJV A;  2ATW A;  3F2D A;  4OWT B;  1LM0 A;  3J80 c;  2ZM6 Q;  4J15 A;  3A74 A;  4UPA A;  1IBL L;  2XGT A;  5FJ8 H;  4YCW A;  3BZK A;  2R7Z H;  2YTX A;  2IY5 B;  5IYC G;  1JT8 A;  3U4V A;  1M1K C;  3DLL A;  2ZTE A;  2Z0S A;  4BY7 H;  3CD6 A;  4DR2 L;  4APV A;  4JI7 Q;  1YI2 A;  3HOY G;  5EAY A;  3FHW A;  4DV2 Q;  4GLA C;  4LF8 Q;  4DUZ Q;  4JBK A;  3M7N A;  5K36 G;  5LMU Q;  4A3D H;  5JJL A;  1NBW A;  3RLN A;  4LF6 L;  3ULP A;  1QVC A;  1VQI A;  2GN5 A;  1VQA A;  1VQD A;  2JA5 H;  1K8A C;  3LGJ A;  5ELN A;  3AQQ A;  3PIP A;  1VQO A;  1VQ5 A;  1Q1B A;  4RG1 A;  3UDF A;  4IFD G;  1Q8K A;  1T9H A;  1QVG A;  3GDE A;  4YHH Q;  3F2B A;  1K3R A;  2KEN A;  3F1Z A;  4B3R Q;  1CKN A;  2HQL A;  1R9T H;  3J7A 5;  4IOC A;  2CWP A;  2EIF A;  4A3E G;  1XNR L;  1SR3 A;  4R4T A;  3W5O A;  2Q2T A;  2ZTC A;  3U4Z A;  3HOZ H;  4BA1 I;  2VQE L;  1W3S A;  2I5M X;  2WB1 G;  2E5L L;  1Q12 A;  4WJ4 A;  1XPU A;  1EWI A;  4GN5 A;  4JV5 Q;  4OO1 G;  1IXR A;  4B3M L;  2WFW A;  2UUC Q;  3I4M G;  1PYB A;  3B6Y A;  3L0O A;  4LFC L;  1I94 Q;  1KXL A;  1C9O A;  4YCU A;  4AYB E;  1GKH A;  3W1G A;  2K52 A;  1Q7Y C;  2OCE A;  4LW1 A;  2VS1 A;  2ZM6 L;  3CC7 A;  2IHF A;  1VQN A;  2YTY A;  3GTQ H;  4A3J G;  4P71 A;  3S1R H;  1HR0 W;  3MXN B;  4RMF A;  4JI6 L;  3PF4 A;  2VUM H;  1WJJ A;  4UP9 A;  4BBS H;  1VQG A;  1PFS A;  4JI7 L;  1NE3 A;  4L5R C;  3HFZ B;  3S16 H;  4DR7 L;  4A3C G;  2VQF L;  3IRB A;  3T1H Q;  4JI1 Q;  1PH9 A;  5GQO A;  3K81 C;  3I56 A;  2ALY B;  1OXS C;  1HR0 Q;  5E7N A;  4POF A;  4BBR H;  4LF7 Q;  3S2D H;  1PH2 A;  4POG A;  4GKK Q;  3HOU G;  4DR5 Q;  3U50 C;  3HKZ G;  3CXC A;  2BH2 A;  4X6A H;  2GVB A;  5M3F G;  1UWV A;  2QGQ A;  2R6G A;  4YHH L;  1N36 L;  5IYB G;  4B3R L;  3M3Y H;  1VQH A;  4JBJ A;  4O0A A;  1KD1 C;  4EX5 A;  1HNX Q;  1NY4 A;  1L1O A;  5IP7 H;  1QZG A;  1X65 A;  5C3E G;  1TWG H;  3TS0 A;  1SN8 A;  3JC6 6;  4MTN A;  1KRT A;  3PF5 A;  1B8A A;  5FLM H;  2FXQ A;  1I3Q H;  1LTL A;  5C0X I;  1WOC A;  4IPG A;  1D8L A;  3A5Z B;  3CW2 C;  4DV3 Q;  3J81 i;  4GNX A;  4JV5 L;  1IBL Q;  1ASY A;  3S2H H;  1X9N A;  1E1O A;  4C2M H;  2UUC L;  1I94 L;  1CKM A;  1L2F A;  4P75 A;  2K50 A;  1JB7 A;  2E2I H;  1QUQ B;  4KI0 A;  3JAM c;  3PO3 H;  3J81 c;  4A3B G;  1KQS A;  2K5V A;  2RCN A;  3CCU A;  4B3S Q;  4C3J H;  3I4N H;  1WFQ A;  3M4Q A;  1VQF A;  2K4K A;  4BY1 G;  4IPD A;  2K5H A;  2NVX H;  4A3C H;  1O7I A;  1SRU A;  4LFB Q;  4KHP Q;  4A76 A;  3F8T A;  1XMO Q;  5IT9 c;  3AFQ A;  4DR6 Q;  1IBM L;  1N32 Q;  2MO0 A;  4JBW A;  2RF4 A;  3HOX H;  1HR0 L;  2NZH A;  4A3G G;  1X3F A;  1Q46 A;  1YHA A;  1GO3 E;  5M3M G;  3E9I A;  3T1Y L;  4A3K G;  2R7D A;  1SLJ A;  2YTV A;  4JOI C;  1YEZ A;  3AFP A;  4YWK A;  1I6H H;  1FGU A;  4IJH A;  2VW9 A;  1XNQ Q;  4L5T A;  1E1T A;  3KF6 A;  4C3I H;  3BZC A;  2VQE Q;  1VQM A;  1EQQ A;  1VQK A;  2Y0S G;  3PUV A;  1HNX L;  1FJG L;  2E5L Q;  4P73 A;  3CCE A;  3GTK H;  1Z9F A;  2AHO B;  1U0L A;  3HOV G;  3KJP A;  2D0P A;  2UXD L;  3M4P A;  2JK8 A;  1YBY A;  1MKH A;  3GTP H;  2BH8 A;  4LWC A;  5IYD G;  1TXY A;  3K80 C;  2NN6 G;  2OTJ A;  3KLW A;  4DV3 L;  4DPG A;  3KF8 B;  3PUZ A;  3E0E A;  4A75 A;  4DV1 Q;  4P74 A;  1N9W A;  4JI6 Q;  4OON A;  2JE6 I;  5FJ8 G;  5C44 H;  5ELO A;  5GAG C;  1K9M C;  2PMZ E;  2VY3 A;  3D0F A;  2AMC B;  4DR7 Q;  1KL9 A;  4B3S L;  4BY7 G;  1NMG A;  3NEM A;  3Q8D A;  4DK3 C;  2VQF Q;  3KJO A;  2UXB Q;  1V43 A;  2DGY A;  1H95 A;  4HID A;  1J5E L;  4DV7 L;  1VQL A;  2I0Q A;  4PZ6 A;  2GVA A;  3G48 A;  2F4V L;  4HJ8 A;  4PG3 A;  3S1Q H;  3CAM A;  3OTO Q;  4A3D G;  1XMO L;  1E22 A;  3UDI A;  4WJ3 M;  4DR6 L;  2JA5 G;  1N32 L;  1I5F A;  4Y7N H;  4X66 Q;  4HJ9 A;  1KC8 C;  1C7Y A;  1Y14 B;  1ASZ A;  3EN2 A;  4DV6 Q;  3GTM H;  4GS3 A;  2B63 H;  2D0O A;  1N36 Q;  5IYC H;  1K73 C;  3PIO A;  1OXT A;  3CQZ H;  2JA7 H;  1CSQ A;  4PZ8 A;  4X64 L;  2UUA L;  1L0W A;  4HIK A;  2JA6 H;  2CQO A;  2MQH A;  3FKI H;  1VCI A;  2R7F A;  1X3E A;  2R93 H;  4IOA A;  1PA6 A;  1XNQ L;  3CF5 A;  2KHJ A;  4AQY Q;  3HKZ E;  3HOZ G;  1EIY B;  1JJG A;  4R4Q A;  1DGS A;  1HNW L;  3AYH B;  1K0R A;  5M5X H;  2UXC L;  4X62 Q;  1K83 H;  4DK6 C;  5GRO A;  4L5S A;  1YIT A;  4QJF A;  1Y1W H;  3D31 A;  2WP8 J;  4ALP A;  4DNI A;  3TEH B;  1SE8 A;  2HIV A;  4LFB L;  1L1O C;  1HNZ Q;  4UY8 C;  4A3L H;  4DV1 L;  1YJ9 A;  1K8G A;  4JI0 Q;  2B3G A;  2KCM A;  2NVY H;  5M5Y H;  3CCL A;  1VQ6 A;  4XTC S;  3TS2 A;  1QVF A;  4IPC A;  3SGI A;  3RNU A;  3I55 A;  4HJA A;  2VUM G;  1CKO A;  4OWW B;  4BBS G;  1UE7 A;  3CP0 A;  1IBM Q;  2UU9 L;  2VL6 A;  4LNQ A;  1UE6 A;  2UXB L;  4PZ7 A;  1WCM H;  2RHQ B;  1EQR A;  1XMQ Q;  1A0I A;  1Y1V H;  2BA0 A;  2OQ0 A;  4GOP A;  4JBM A;  3OTO L;  1YIJ A;  5HGQ A;  2F3I A;  3T1Y Q;  4A4I A;  4BBR G;  3HOW H;  3PCO B;  1BBW A;  2PNH A;  4X66 L;  5C0X J;  5AJ3 Q;  4DV6 L;  5C4X H;  1VQ9 A;  2JQO A;  1N8R C;  1B70 B;  1FJG Q;  4DAY B;  2E2H H;  3G71 A;  1Q1E A;  3UDG A;  2YU9 H;  2UXD Q;  2JEB I;  1PVO A;  1X3G A;  2PQA A;  4UP7 A;  3FP9 A;  4JI3 L;  4LUO A;  3A0J A;  2UUB L;  1X56 A;  4AQY L;  4DR1 Q;  4JI8 L;  2IHE A;  5FLM G;  4YCV A;  2JJQ A;  3BJU A;  5JEA G;  4GLX A;  4X62 L;  1J6Q A;  2Z6K A;  2EXD A;  1CKN B;  3GTL H;  1X6O A;  2DUD A;  4LUZ A;  1LYL A;  1G51 A;  2IX0 A;  1GVP A;  1X55 A;  1JMC A;  4LUV A;  4LF4 Q;  3BU2 A;  4OX9 Q;  3AEV A;  4QL5 A;  3PO3 G;  3KOJ A;  1HNZ L;  2MO1 A;  1EOV A;  2N3S A;  1VQ8 A;  4JI0 L;  3I4N G;  5HY6 A;  1GM5 A;  3RR5 A;  4UP8 A;  2N49 A;  4K0K L;  1J5E Q;  1IBK Q;  4DV7 Q;  3ZJY C;  2F4V Q;  2OTL A;  1S3O A;  2XTI A;  2NZO A;  1YZ6 A;  1FL0 A;  2ES2 A;  3WWV A;  3K7A H;  4QIW E;  4A93 H;  1XMQ L;  3KDF A;  2KHI A;  2WAQ G;  3HOX G;  3S1N H;  1V1Q A;  2ID0 A;  2A19 A;  1E24 A;  4X64 Q;  4DV4 L;  4HIM A;  2UUA Q;  4YWL A;  2JA8 H;  1PV4 A;  3H3V I;  2AKW B;  4LF9 L;  4DR4 L;  3OW2 A;  4Y52 H;  3S15 H;  2Q2H A;  5AJ3 L;  3NEL A;  2Q2I A;  3CPW A;  1P8L A;  2ZJR A;  4A3M H;  4IJL A;  3U58 A;  4A3I H;  4QQB X;  2I5L X;  3CME A;  1I50 H;  4QGU A;  5LMN W;  1HNW Q;  3S1M H;  4JG2 A;  2UXC Q;  4IFD I;  5IE8 A;  5BR8 L;  4A3F H;  4BXX G;  4KLK A;  1N33 Q;  4KHP L;  4L5Q A;  3CPF A;  2C35 B;  4DR1 L;  2KCT A;  3RZO H;  3UE0 A;  1XPR A;  3PO2 H;  4A3K H;  2OQK A;  5IP9 H;  5C4J H;  3RN5 A;  5C0X G;  2WB1 E;  3PUY A;  2R92 H;  1FVI A;  2LXK A;  1RL2 A;  3S17 H;  1IYJ B;  4NB3 A;  1VQB A;  1L1O B;  3STB D;  4OX9 L;  5C44 G;  4LF4 L;  2R7Z G;  1N34 L;  4OO1 I;  1BVS A;  3G4S A;  2HT1 A;  1EUJ A;  1VQ7 A;  2V1C C;  3H0G H;  4AIM A;  3S14 H;  3PSI A;  3NBH B;  3HOV H;  3J81 j;  2UU9 Q;  4OWX B;  5DLQ E;  2LSS A;  5IWA L;  2CKZ B;  3J80 i;  3GTJ H;  1IBK L;  1S72 A;  4GNX B;  1TWF H;  1WI5 A;  5IY0 A;  3CCV A;  4O2D A;  5JEA J;  3DM3 A;  1X54 A;  3M85 A;  4QY7 A;  5JJK A;  1HH2 P;  2K5N A;  4X65 L;  3PV0 A;  1IZ6 A;  1S40 A;  1HZC A;  2H5X A;  1YJW A;  2MNA A;  1XPO A;  1KAW A;  4NXM Q;  2B63 G;  2RHS B;  4H02 A;  2AWN A;  4HIO A;  4C3H H;  3HOY H;  3H15 A;  2JA7 G;  1PH4 A;  4KHZ A;  1SMX A;  4LF5 Q;  4JI3 Q;  3I2Z A;  3H3V H;  1Q82 C;  2JA6 G;  3FKI G;  2IT1 A;  3STB C;  1G29 1;  2BA1 A;  4JOI A;  5GAE C;  3OYY A;  4MNO A;  4GOP C;  2UUB Q;  2R93 G;  4JI8 Q;  2PI2 A;  1TWA H;  1G6P A;  4TVA B;  3KDF B;  3K8A A;  1JJ2 A;  2K14 A;  1RIP A;  1E7Z A;  2N8N A;  2LXJ A;  1W2B A;  1N33 L;  1B7Y B;  3CCJ A;  4PMW A;  3K0X A;  1Y1W G;  4DAM A;  1OXU A;  3CMA A;  3NEN A;  2CFM A;  5M5W H;  4B3T Q;  1D7Q A;  1QUQ A;  1GD7 A;  5LMN L;  4DUY Q;  3K7U C;  4A3E H;  3KF6 B;  2OWO A;  4A3L G;  1VQ4 A;  4LFA L;  2QEX A;  3CC4 A;  1KIX A;  2HHH L;  4K0K Q;  3GO5 A;  1VQP A;  1E3P A;  2PI2 E;  4GNX C;  1EFW A;  1VS0 A;  4GN3 B;  2Z6K C;  1HZB A;  1CUK A;  2IX1 A;  3I4M H;  4MZ9 A;  2A1A A;  1AE3 A;  3ULL A;  1WCM G;  4DR3 Q;  4R4I A;  1MJE A;  2ZJP A;  2CCZ A;  4JI4 Q;  1VQC A;  3W1B A;  1Y1V G;  1WYD A;  3ERS X;  4NXN Q;  2NVQ H;  4DV4 Q;  2NVT H;  4DR4 Q;  1V9P A;  3F2C A;  1EIF A;  4LF9 Q;  4A3J H;  1PH7 A;  1EYG A;  3HOW G;  1UE1 A;  3TRZ A;  3L7Z C;  3RLF A;  4NXM L;  5C4X G;  1CSP A;  1MIU A;  3E9H A;  3GD7 A;  1MJC A;  1PH3 A;  1YJN A;  2N78 A;  2WAQ E;  3EBE A;  4FDB A;  5IP7 G;  3HKS A;  4LF5 L;  5BR8 Q;  4DV2 L;  3GTO H;  4JI5 Q;  4DUZ L;  4YY3 Q;  4LF8 L;  2L15 A;  2F52 A;  5LMU L;  2ZTD A;  3S24 A;  4JYA Q;  2EQS A;  1NJI C;  4JC0 A;  4NPS A;  3HOU H;  1UEB A;  4DKA C;  2Y0S E;  2D62 A;  2JA9 A;  1Z47 A;  4XIG S;  2VZA A;  4DV0 Q;  5M3F H;  1HZ9 A;  1BBU A;  1SRO A;  5IYB H;  5FLX c;  3PGZ A;  1KRS A;  5J3B A;  4DV5 Q;  1N34 Q;  5H1S E;  3CC2 A;  1AE2 A;  4BA2 I;  4B3T L;  4P72 A;  5C3E H;  1XTD A;  1VQJ A;  3G6E A;  4DUY L;  4HJ7 A;  4GKJ Q;  1A63 A;  2B29 A;  1JE5 A;  4IPH A;  1AH9 A;  4GLV B;  4AYB G;  3KYH C;  4YWM A;  5IWA Q;  3RZD H;  2NN6 I;  4HJ5 A;  1JJC B;  4JI2 Q;  1YNX A; 
#chains in the Genus database with same CATH topology
 2LS0 1;  1OXX K;  1K28 A;  3VDY A;  5TSS A;  4XQQ A;  2E2J H;  1B3Q A;  3M4O H;  1Q81 C;  2ZXP A;  3TQY A;  4R4O A;  1KHI A;  3PUX A;  1X3P A;  3A5U A;  4IFD J;  4RGN A;  1EL0 A;  2B2V C;  1PH6 A;  4PMC A;  3KLS X;  4X3S A;  4A3F B;  2E74 C;  2Q2U A;  1PH8 A;  4R1J A;  2YYZ A;  4B9W A;  4A3M G;  3TDQ A;  1NCV A;  4A3I G;  3BVG A;  3TRE A;  3M9B A;  2MFI A;  4GOP B;  3GV3 A;  4JI1 L;  1PYS B;  4JYA L;  3ULJ A;  3ER0 A;  3DM1 A;  5GAD C;  5COY A;  3GTG H;  4LF7 L;  1WD0 A;  2DJG C;  3S14 B;  4HED A;  4GKK L;  1VMP A;  3MEF A;  1SSO A;  1UE5 A;  4R4C A;  1TWH H;  4DV0 L;  2R92 G;  1LTI D;  2TMP A;  1TWF B;  4ME3 A;  1A3U A;  3NUC A;  4DXF A;  4F88 A;  3CCM A;  3UE1 A;  4TQU S;  1JOK A;  4K2K A;  4CKE A;  3J80 L;  1LLR D;  4OWT B;  4C3H B;  3HOY B;  1LM0 A;  3CU7 A;  5DM6 3;  5C0X H;  3SK8 A;  4YCW A;  5JOB A;  5IYC G;  2NWG A;  3DLL A;  1JOR A;  3CD6 A;  2B2W A;  4JI7 Q;  3A8J E;  3FHW A;  1EFI D;  4JBK A;  3M7N A;  2A5H A;  1UNS A;  2F0Q A;  3RLN A;  1F2L A;  5EPJ A;  1PYW D;  1VQI A;  1G2T A;  4V19 0;  5ELN A;  2F0D A;  1KDC A;  1VQ5 A;  3UDF A;  2IL8 A;  1T9H A;  3GDE A;  3F1Z A;  1CKN A;  2EYF A;  2EIF A;  3D8G A;  5KEE A;  3VA5 A;  3KLS A;  2B2U A;  5LL6 S;  2SNS A;  2I5M X;  2WB1 G;  4WJ4 A;  1XPU A;  4ID6 A;  1EWI A;  1IXR A;  4B3M L;  2WFW A;  3H3V C;  1I94 Q;  4LFC L;  1F9P A;  4IUN A;  3VYU A;  4AYB E;  3ITP A;  1TR5 A;  4HSV A;  1Q7Y C;  1ESR A;  4LW1 A;  1GHJ A;  2E75 C;  4KN4 C;  3S1R H;  1HR0 W;  3MXN B;  4N8F A;  2D2C C;  2VUM H;  4M8A A;  4PNY A;  4C1N I;  1I4X A;  3GQB A;  1PFS A;  3HOU B;  4DR7 L;  3HFZ B;  4QB4 A;  1LTG D;  2VB3 X;  3H6M A;  3TZD A;  2VQF L;  1C8C A;  3IRB A;  1RD9 D;  1QNK A;  1IKM A;  4QMG A;  3I56 A;  3NXW A;  5E7N A;  3RD4 A;  1QG7 A;  3S2D H;  4POG A;  4XYO A;  1DOM A;  1EWC A;  4DR5 Q;  3E0J A;  3HKZ G;  3W3A A;  3CXC A;  2QDL A;  1O78 A;  1UWV A;  1SYC A;  1J9O A;  1QZG A;  3X3M A;  2E2J B;  1X65 A;  5C3E G;  3M4O B;  1K8O A;  1SN8 A;  4MTN A;  4CKB A;  5IGF A;  4IUR A;  5C0X I;  1WOC A;  2BE5 C;  1HUN A;  4IPG A;  2K5W A;  3J81 i;  1ASY A;  2F0W A;  1CKM A;  4HTH A;  1L2F A;  4P75 A;  1S5C D;  1KAA A;  4KI0 A;  2BDO A;  1KQS A;  3CCU A;  1EY6 A;  4B3S Q;  1MGS A;  4FXK C;  4C3J H;  3M4Q A;  3I4N H;  2RBM A;  2K01 A;  4BY1 G;  4IPD A;  2K5H A;  3QR8 A;  4CDC C;  1O7I A;  4A3C H;  1SRU A;  4KHP Q;  3GTG B;  1ONL A;  1QNU A;  5IT9 c;  5FO8 B;  3AFQ A;  4K5X A;  2B39 A;  1TWH B;  3BDO A;  1FNV A;  3SHL A;  1HR0 L;  1ICW A;  2RSN A;  1X3F A;  1STY A;  5E4W C;  1Q46 A;  5M3M G;  2YTV A;  3G6J B;  4JOI C;  1B53 A;  3KF6 A;  1AW7 A;  1MBY A;  1EQQ A;  2Y0S G;  1SJE D;  1HNX L;  2E5L Q;  4P73 A;  3DEO A;  2D0P A;  3M4P A;  3WDN A;  1AP0 A;  2BH8 A;  3BS1 A;  1TXY A;  1O7Y A;  4KKS A;  5IT9 E;  2KEC A;  2SDF A;  2A69 D;  3KLW A;  3EA6 A;  5JAV A;  2EYJ A;  1LTT D;  5I9O A;  4A75 A;  1HTP A;  4DV1 Q;  5EQ0 A;  5DM7 3;  4FF4 A;  4K6L A;  4K8I A;  4BY7 G;  1MHW C;  4B9X A;  4KY5 A;  2UXB Q;  2ENB A;  1V43 A;  4DV7 L;  1JR0 D;  2GVA A;  5A2Q L;  3A54 A;  1MD2 D;  2JA5 G;  1N32 L;  1I5F A;  4HJ9 A;  4X66 Q;  1KC8 C;  4LMQ D;  2K03 A;  3EN2 A;  3PIO A;  1HTL D;  2JA7 H;  2K04 A;  2L9H A;  4Z9C B;  2CQO A;  1SAP A;  3FKI H;  1F9R A;  1L0X B;  3CRL C;  1PA6 A;  1XNQ L;  1Y1W B;  3NHH A;  3CF5 A;  4AQY Q;  1EIY B;  5ELE A;  1HNW L;  2L11 A;  2K5Q A;  1K83 H;  5KND A;  4L5S A;  5M5Y B;  2K5D A;  4QJF A;  2VUM B;  2SNM A;  2F0P A;  4DNI A;  3OMC A;  4FVM A;  1L1O C;  4UAI A;  2NTS A;  3R93 A;  1ICF B;  1R4P B;  2K6A A;  1U4R A;  3CCL A;  1WCM B;  1VQ6 A;  3TS2 A;  1QVF A;  5K5P A;  4DU9 A;  3OPO A;  3S2D B;  4I7Z C;  5LL6 X;  1NUC A;  2RA4 A;  1EQR A;  3NE5 B;  1FNW A;  2OQ0 A;  5CYU A;  4ODG A;  4GOP A;  3OTO L;  4A4I A;  3HOW H;  1S5B D;  4IUV A;  5E4X A;  1PRT B;  2QEJ C;  5C4X H;  1VQ9 A;  4KTA A;  1N8R C;  1FJG Q;  2E2H H;  4UHV A;  1EZ8 A;  3DMU A;  2UXD Q;  4JI3 L;  1KAB A;  4IAL A;  2ZT9 C;  2DJF C;  1X56 A;  1EOT A;  1PRT D;  3HGB A;  2IHE A;  3A56 A;  4GLX A;  4C3J B;  3I4N B;  1D1I A;  5EBC A;  2Z6K A;  3I91 A;  4K5W A;  1UEA B;  4LUZ A;  1SEB D;  2KED A;  4DNT B;  1EIH A;  3R2T A;  3PO3 G;  2AQ1 B;  1HNZ L;  3IL8 A;  5ELF A;  1EOV A;  1VQ8 A;  4JI0 L;  3WOE A;  1J5E Q;  1IBK Q;  3ZJY C;  1S3O A;  5EPL A;  1YZ6 A;  4EGV A;  3NQI A;  1XMQ L;  4K6D A;  1IW7 D;  4FNF A;  4DNR B;  3HOX G;  1V1Q A;  2ID0 A;  1RJT A;  5IOC A;  1AFP A;  2UUA Q;  4YWL A;  1PV4 A;  3J81 E;  1K0S A;  3CPW A;  5EKI A;  3MZ5 A;  2Q2I A;  3NEL A;  3NTH A;  1P8L A;  5AJ3 L;  4A3M H;  3U58 A;  4A3I H;  3RZO B;  4J1M A;  1NR2 A;  1RTN A;  3A7A B;  2FJ2 A;  3MFG A;  5IE8 A;  4BWG B;  4KLK A;  1N33 Q;  1B3A A;  2C35 B;  4DR1 L;  4G7Z C;  1I4R A;  3R3O A;  5I4D A;  2CH4 W;  4HMI A;  5A35 A;  5C4J H;  2EVB A;  5C0X G;  2R92 H;  3S17 H;  1IYJ B;  4NB3 A;  1B9N A;  1VQB A;  2MGS A;  2F0E A;  3X3N A;  5C44 G;  4Q5V A;  1N34 L;  1BVS A;  1HFN A;  2HT1 A;  1Q3L A;  3HOV H;  1JWM D;  4R9W A;  3GTJ H;  2CKZ B;  1Y69 U;  3T56 B;  3OOC A;  2JA7 B;  2ICI A;  3DM3 A;  4DA2 A;  2CQA A;  4QY7 A;  2F4I A;  3FKI B;  3D4W A;  1IZ6 A;  1HZC A;  1SYE A;  4NXM Q;  1XPO A;  1KAW A;  3H15 A;  3SEB A;  2K7V A;  1K83 B;  2VB2 X;  3I2Z A;  3H3V H;  3J7Y W;  2M00 A;  2R93 G;  1V1P B;  1TII D;  3V96 A;  1G6P A;  1RDP D;  5C5M A;  5M5W B;  4DAV A;  2H4O A;  1E7Z A;  2N8N A;  3E3X A;  1Y1W G;  4KJN A;  1OXU A;  5FO7 B;  3VYT A;  3DWA A;  1GD7 A;  1JOQ A;  4UDU C;  3T53 B;  3CC4 A;  4OHJ A;  4QUF A;  1VQP A;  3NK9 A;  4WOR A;  5I9P A;  2A68 D;  1DYQ A;  1XWE A;  1HZB A;  3NTI A;  1CUK A;  1XX8 A;  4MZ9 A;  3MXG A;  1QB5 D;  3C46 A;  1AE3 A;  3ULL A;  5C4X B;  1WCM G;  3DUZ A;  4JI4 Q;  1VQC A;  1ZYR D;  4M1U B;  1Y1V G;  1WYD A;  2E2H B;  3BYT B;  2NVT H;  4DR4 Q;  2Z4I A;  1PH7 A;  4OIK A;  1XXG A;  5KNC A;  4O42 A;  1EQT A;  2N78 A;  2WAQ E;  4FDB A;  2A6H C;  1ET9 A;  3GTO H;  4JI5 Q;  2ZXR A;  2ZTD A;  1NJI C;  1LT6 D;  4NPS A;  1UEB A;  4K2L A;  4RGM A;  2WV6 D;  4XIG S;  5JVH 3;  4EQO A;  3URY A;  2QIL A;  5FLX c;  5JJK A;  1AN8 A;  4BA2 I;  5C3E H;  1VQJ A;  1B44 D;  1A63 A;  2K1B A;  4IPH A;  2ZXO A;  4RGO S;  4YWM A;  4HSP A;  1PTO H;  4A3C G;  1JJC B;  1YNX A;  3PQI A;  3KFU A;  2AWO A;  3I7F A;  1C0A A;  2CWA A;  3AB9 A;  4JCV E;  1V8Q A;  4A3M B;  1AZP A;  4A3I B;  3UDX A;  2A8V A;  2E8G A;  2KHS A;  4NXN L;  1YHB A;  4DR2 Q;  5FLX E;  1CHQ D;  4BY1 H;  2YV5 A;  4XQN A;  2O5J C;  1PHJ A;  2RKS A;  1PH5 A;  1OTC A;  5C4J B;  4ZKC B;  4EQ5 A;  1CM9 A;  5IGC A;  2R92 B;  1F2M A;  1OXV A;  1DD2 A;  4GN4 B;  1BR9 A;  4RGT A;  5IGB A;  2ZJQ A;  1YVC A;  5M3M H;  5LMN Q;  3HOV B;  3CCR A;  4LFA Q;  4DR5 L;  3GTJ B;  2J7Z A;  2HHH Q;  5BN5 A;  1M90 C;  5EKL A;  3MC0 B;  2ASB A;  1EY5 A;  4GKJ L;  2RDF A;  3H0G G;  1BF4 A;  1BKB A;  2A6E C;  3BZD B;  1G2S A;  1D5X C;  1NMF A;  5DEH A;  4TSS A;  4QIW B;  2ZM6 Q;  4J15 A;  3MEH A;  4ZAI A;  1SMY C;  2YTX A;  3NWS A;  3L9A X;  2IY5 B;  1JCK B;  2ZTE A;  4BY7 H;  2QF7 A;  4K8J A;  4E6I A;  4APV A;  4GLA C;  5LMU Q;  2SEB D;  4LF6 L;  2Z4H A;  3E5S A;  2GN5 A;  2X6L A;  1PRT F;  2JA5 H;  1K8A C;  3FVQ A;  4NKL A;  1ENF A;  4RG1 A;  1Q8K A;  1QVG A;  4YHH Q;  2FIN B;  4B3R Q;  2WB1 B;  1R9T H;  4IOC A;  2MUY A;  3P75 A;  2KOL A;  1XNR L;  1O7Z A;  1SR3 A;  2JP1 A;  1STA A;  1I4Q A;  1EY0 A;  1W3S A;  2E5L L;  1Q12 A;  3SE0 A;  4CDF C;  2NVT B;  4JV5 Q;  1WVL A;  4CGY B;  2UUC Q;  2B2T A;  3B6Y A;  3L0O A;  1C9O A;  1X3Q A;  4RCN A;  3W1G A;  1RTO A;  2IHF A;  1VQN A;  1DJR D;  4A3J G;  1A2U A;  3GTO B;  5KRU A;  2PZT A;  1GJX A;  1HQM C;  3MTS A;  1LTA D;  1B4O A;  1Z7T A;  1A2T A;  4UP9 A;  2BE5 D;  3S16 H;  4RWS C;  3U9O A;  2PPB C;  3T1H Q;  1GUT A;  2EE1 A;  3OWF A;  4FF2 A;  3K81 C;  3CHB D;  1PFM A;  1OXS C;  1JC7 A;  5KYI A;  5C3E B;  3SK4 A;  4L63 B;  4H44 C;  2BH2 A;  1EZ6 A;  1PTO B;  3KF8 A;  2GVB A;  5M3F G;  2R6G A;  3M3Y H;  1VQH A;  4O0A A;  1DON A;  1KD1 C;  1D6E C;  5IP7 H;  2OEO A;  1EY8 A;  5EJW A;  1SYD A;  5ELB A;  4ZKB B;  1AZQ A;  2NTT A;  1B8A A;  1LTL A;  1B50 A;  1PTO D;  3A5Z B;  1QE6 A;  1IBL Q;  4BY1 B;  1E1O A;  3JAM L;  4N8X 1;  1QWY A;  1SYB A;  3PO3 H;  4XT1 B;  1HHV A;  2FFK B;  1SXT A;  1VQF A;  5M3M B;  3I8Z A;  1V1P A;  4DR6 Q;  3H09 A;  1QOH A;  2RF4 A;  1SBB B;  4RFB A;  3HOX H;  2Y0S B;  2B2W C;  3VYS A;  5T1G A;  4JPB W;  3HG9 A;  1GUS A;  1ML0 D;  3TBI B;  1YEZ A;  1II3 A;  2QDB A;  1I6H H;  2VQE Q;  1VQM A;  1VQK A;  1EU3 A;  1FJG L;  2PO4 A;  1Z9F A;  3HOV G;  2UXD L;  3QOL A;  4B08 A;  2JK8 A;  1MKH A;  5IYD G;  1IYV A;  3BVM A;  4BY7 B;  4DV3 L;  3RMH A;  4DPG A;  2K32 A;  4R8N A;  3E0E A;  1TS4 A;  4XT3 B;  2C5C A;  4P74 A;  1N9W A;  4JI6 Q;  1UUP A;  4OON A;  5C44 H;  2XVS A;  3TME A;  5ELO A;  5GAG C;  1A15 A;  3K59 A;  3D0F A;  2AMC B;  1KL9 A;  2JA5 B;  3NEM A;  2B2V A;  2C9O A;  4DK3 C;  3KJO A;  3O13 A;  2DGY A;  2B63 B;  1H95 A;  1J5E L;  4LFB L;  1RF2 D;  5KIX A;  4PV1 C;  1R9T B;  4PG3 A;  3CAM A;  1XMO L;  1LAC A;  1Q8I A;  3LX0 A;  4WJ3 M;  1C7Y A;  1ASZ A;  4DV6 Q;  4GS3 A;  2D0O A;  1N36 Q;  2KQ3 A;  1K73 C;  3FDT A;  4PZ8 A;  1SNQ A;  3KUP A;  2UUA L;  1L0W A;  3OWE B;  2R7F A;  2R93 H;  4IOA A;  2NBF A;  2KHJ A;  1JJG A;  2AUJ D;  1K0R A;  5J22 A;  3WOF A;  1JWU D;  3V2T A;  2A73 B;  1T5X D;  1Y1W H;  4ALP A;  1LV9 A;  1SE8 A;  1UAP A;  4WRD A;  3S16 B;  3QOJ A;  1E2Z A;  4UY8 C;  4ULL A;  2JN4 A;  5I6Y A;  1K8G A;  2MHV A;  2B3G A;  5ELD A;  5M5Y H;  2FMC A;  1TS2 A;  4LAA A;  1CKO A;  4H0L C;  3IFD A;  1UE7 A;  1NAP A;  3HS0 C;  2VL6 A;  1WCM H;  2RHQ B;  2LKV A;  1A0I A;  1Y1V H;  3M3Y B;  1KLG D;  1YIJ A;  2EY1 A;  2F3I A;  5HGQ A;  3T1Y Q;  4BBR G;  3PCO B;  1BBW A;  1S4Z A;  5C0X J;  2JQO A;  2RCF A;  3TP5 A;  3P7J A;  2LY7 A;  2YU9 H;  5CV7 A;  4UP7 A;  4LUO A;  3TN2 A;  4DGZ A;  3NBH A;  2CVR A;  3PO3 B;  2KA7 A;  2JJQ A;  4TKO B;  5JEA G;  2KCC A;  1SNC A;  4X62 L;  3HP3 A;  3GTL H;  2DUD A;  1LYL A;  3BDL A;  1G51 A;  2IX0 A;  2IW3 A;  1X55 A;  4OX9 Q;  4LUV A;  4QL5 A;  4KJO A;  2NYZ D;  1CFM A;  3HOX B;  4UP8 A;  2N49 A;  3OMG A;  1PFB A;  2L1B A;  2F4V Q;  2OTL A;  1BXT A;  3C2P A;  2NZO A;  1FL0 A;  1MI2 A;  1HRJ A;  1I6H B;  3KDF A;  1H9R A;  1LO5 D;  1NR4 A;  1EEF D;  2R61 A;  4X64 Q;  4DR4 L;  2DNE A;  2AKW B;  4Y52 H;  1OO9 B;  2ZJR A;  2E2D C;  4QQB X;  4C3I G;  1I50 H;  5LMN W;  1CA5 A;  2UXC Q;  5EBD A;  5C44 B;  1XTC D;  1RHP A;  2KCT A;  3RZO H;  3DWQ A;  3UE0 A;  5COR A;  1CT1 D;  3EFX D;  4A3K H;  4FYD A;  1YNJ D;  3RN5 A;  2QCP X;  4LF4 L;  4OEL B;  1EUJ A;  2DY8 A;  3H0G H;  1H9S B;  4QCL A;  3PSI A;  1LTB D;  3J81 j;  3KBG A;  1SNM A;  2LSS A;  3J80 i;  4MIU A;  5IGE A;  1WI5 A;  2R3Z A;  3HRZ C;  3ERQ A;  2XRS D;  1QJO A;  1J8I A;  2R93 B;  3PV0 A;  2H5X A;  2B63 G;  2RHS B;  5KNB A;  4H02 A;  2CW0 C;  1PH4 A;  1SMX A;  2JA6 G;  2UUB Q;  4JOI A;  5GAE C;  3OIP A;  4GOP C;  4N9T A;  4JI8 Q;  3VR5 A;  1GXD C;  1TWA H;  1T5E A;  1EQV A;  2Q8R E;  1PTO F;  3K8A A;  1H9M A;  2K14 A;  1FD7 D;  2LXJ A;  5FOB B;  1EY7 A;  1B7Y B;  3CCJ A;  4DAM A;  5M5W H;  1D7Q A;  5LMN L;  4DUY Q;  4LFA L;  2QEX A;  2A6H D;  2HHH L;  4K0K Q;  1Y1V B;  1E3P A;  2F1M A;  2PI2 E;  4GNX C;  2JYO A;  2Z6K C;  1IYU A;  5DNF A;  4DXG A;  1GUO A;  4NP5 A;  2I46 A;  4DV4 Q;  3SK6 A;  2YU9 B;  4S3S A;  4LF9 Q;  4A3J H;  2IPK D;  4RAU C;  1MIU A;  4PMB A;  3K5N A;  1MJC A;  2F0S A;  1EYA A;  3EBE A;  5IP7 G;  3HKS A;  4LF5 L;  2EOT A;  1LT4 D;  1IKL A;  3GTL B;  3Q24 A;  5LMU L;  4JYA Q;  4FXG C;  4JC0 A;  3MFY A;  2F0U A;  2D62 A;  2JA9 A;  4DV0 Q;  5M3F H;  1BBU A;  1LT3 D;  4B3T L;  4HJ7 A;  1CTM A;  2PCF B;  4GLV B;  4AYB G;  3RZD H;  5CV5 A;  2NN6 I;  3DHQ A;  4HJ5 A;  4A3B B;  2IWH A;  1BCP C;  2F0J A;  2EY5 A;  2HD3 A;  3T16 A;  4OXP A;  4NW2 A;  4X65 Q;  2WKD A;  1MSH A;  2WKC A;  4DR3 L;  4A93 G;  2BDN A;  5ISR A;  1TKW B;  4RKB A;  4DK1 A;  1I50 B;  5M9O A;  1Q86 C;  1TU2 B;  2A6E D;  4G7O C;  1S5E D;  1QCB D;  1DM0 B;  4A3K B;  3MXP A;  3ICE A;  3GV6 A;  3CKI B;  3K0Y A;  3I3C A;  3PUW A;  4ILW A;  3VR6 A;  4YY3 L;  3K5M A;  3T1H L;  5CV4 A;  1P16 A;  3RN2 A;  1EY9 A;  1SMY D;  1ZEQ X;  1D1K A;  4Q0F A;  3PO2 G;  3H0G B;  2HDM A;  4JK1 C;  4K14 A;  1F9Q A;  1VDZ A;  1TY2 A;  1A8V A;  2HIX A;  1HJP A;  4DV5 L;  3MXN A;  1VQE A;  1LUZ A;  1EWH A;  4IUQ A;  3I4O A;  1QZH A;  1WD1 A;  4C56 C;  4B3M Q;  5JJI A;  5IYD H;  4LFC Q;  1IL2 A;  4JI2 L;  2ATW A;  3J80 c;  4ABN A;  1NSN S;  1IBL L;  3DEP A;  2EPB A;  3BZK A;  1TWA B;  1M1K C;  1YI2 A;  5EAY A;  4ZUI A;  4DV2 Q;  4LF8 Q;  4DUZ Q;  5K36 G;  3PIO 3;  5JJL A;  5CV8 A;  1NBW A;  1QVC A;  1O80 A;  1VQA A;  1SNP A;  4ZRZ A;  2LFN A;  2PQE A;  3PIP A;  1VQO A;  1RKN A;  2OF1 A;  3J80 E;  1FYC A;  4WFN 3;  2KEN A;  2Z1C A;  2HQL A;  2A69 C;  1GUN A;  2K28 A;  2CWP A;  2PMZ B;  4A3E G;  3K58 A;  3W5O A;  4R4T A;  2ZTC A;  3U4Z A;  1F2Z A;  4BA1 I;  1HUM A;  4F87 A;  2VQE L;  2BOS A;  4A3J B;  1ILP A;  1I4H A;  1PYB A;  3I4M G;  2IX3 A;  4YCU A;  1D5Z C;  4HAE A;  2CH4 A;  3FMC A;  3C1F A;  3CC7 A;  4O1N A;  2WAC A;  2YTY A;  2TSS A;  4F8M A;  4P71 A;  3GTQ H;  1CZG A;  4JI6 L;  3PF4 A;  3OSO A;  5KGU A;  1WJJ A;  1B1Z A;  3SK5 A;  4LK1 C;  4N9P A;  1SJH D;  4JI7 L;  1NE3 A;  3I70 A;  5M3F B;  1PH9 A;  5GQO A;  1HQR D;  5JJZ A;  2ALY B;  1HR0 Q;  4LJZ C;  4BBR H;  3QG1 A;  3FEW X;  3U50 C;  3RZD B;  2EYO A;  2I07 B;  1CK1 A;  5C3W A;  1N36 L;  5IYB G;  4ZLT F;  4JBJ A;  4EX5 A;  1HNX Q;  1NY4 A;  1TWG H;  3JC6 6;  4JVZ A;  5JPM C;  3C1E A;  2LMC B;  1KRT A;  2L12 A;  4X3T A;  1H9S A;  5C5L A;  5JEA H;  2B8G A;  1D8L A;  3CW2 C;  2EYH A;  3S2H H;  1X9N A;  3VR2 A;  3C3L A;  3QIA A;  4C2M H;  1HXY D;  3U9S A;  4XXE A;  1I94 L;  1FNU A;  2G5D A;  2K50 A;  1JB7 A;  1QUQ B;  3ONA B;  4A3B G;  1BNZ A;  2K5V A;  1MSG A;  2RCN A;  3FPP A;  4IQZ A;  1WFQ A;  1DOK A;  5D3D A;  2NVX H;  3BYY B;  3ZYY X;  5IT9 L;  4A76 A;  4RH6 A;  5EKK A;  1I6V C;  1N32 Q;  2MO0 A;  4XYQ A;  2NZH A;  2VXW A;  4A3G G;  4F7X A;  4CJ2 C;  1YHA A;  3T1Y L;  4A3K G;  3E9I A;  2R7D A;  4EQN A;  3AFP A;  1FGU A;  4IJH A;  1D2B A;  1XNQ Q;  4C3I H;  3BZC A;  3CCE A;  4DK0 A;  5NUC A;  1TS3 A;  2AHO B;  1U0L A;  3KJP A;  2V4D A;  5D3I B;  3K80 C;  2NN6 G;  2HCC A;  2N88 A;  1VF5 C;  2OTJ A;  3ND9 A;  3I72 A;  4NDX A;  3OIQ A;  2Z6B A;  2MPM A;  5FJ8 G;  2RSO A;  2VY3 A;  3A55 A;  2F0V A;  4B3S L;  4FF3 A;  2B2T C;  2PYK A;  3VYR A;  5CBE E;  3SR1 A;  4HID A;  1VQL A;  2EY2 A;  2F4V L;  4ZYS A;  1ZKO A;  4A3D G;  4KHP L;  4HJ8 A;  3Q22 A;  3OTO Q;  1E22 A;  2NZ1 D;  4WJW A;  4Y7N H;  2B63 H;  2Q8T A;  1OXT A;  1CSQ A;  3IFT A;  4X64 L;  3BG3 A;  4HIK A;  2JA6 H;  2MQH A;  3HKZ E;  3HOZ G;  2DN8 A;  4KK7 A;  2FMM A;  5CR3 A;  2UXC L;  2RDG A;  1SDF A;  3GTQ B;  2WII B;  1YIT A;  4IFD H;  3D31 A;  4I65 A;  4MN3 A;  2HIV A;  5A2Q E;  1CA6 A;  1HNZ Q;  1PXU A;  1KNE A;  4BS9 A;  2AUK A;  4DV1 L;  1YJ9 A;  4JI0 Q;  2KJX A;  1DZ1 A;  4XTC S;  5EPK A;  1CZW A;  4IPC A;  4L6T B;  1DOL A;  3SGI A;  3I55 A;  4HJA A;  2HDL A;  4BBR B;  4BBS G;  3H91 A;  2NB0 A;  3QWN A;  4OO1 H;  4RA8 A;  1IBM Q;  2UXB L;  2KCN A;  1UE6 A;  4PZ7 A;  2FHT A;  2QKI C;  1XMQ Q;  2HQE A;  1WTW A;  3IAY A;  1TWG B;  4X66 L;  2PNH A;  3HEJ A;  1HA5 A;  3D4D A;  5AJ3 Q;  1B70 B;  1DXM A;  2XWJ B;  4DAY B;  1S5F D;  1Q1E A;  2XNA C;  3S2H B;  2JEB I;  4CHT B;  1X3G A;  4C2M B;  1PVO A;  3FP9 A;  2SOB A;  2UUB L;  4KV6 A;  2X6G A;  4AQY L;  4DR1 Q;  4JI8 L;  5FLM G;  2EYM A;  3BJU A;  4YCV A;  1J6Q A;  1W6K A;  2EXD A;  3J81 L;  3UI2 A;  2NVX B;  2KVM A;  1JMC A;  4P2C B;  5BN3 A;  2J4X A;  3KOJ A;  5CV6 A;  3BDC A;  1LT5 D;  5HY6 A;  1GM5 A;  5C3X A;  1U4L A;  4C1N K;  4G57 A;  4K0K L;  1F2Y A;  3TZU A;  2WIN B;  2M2L A;  2JA8 B;  3AMU A;  4A93 H;  2BCO A;  2KHI A;  2WAQ G;  4C3I B;  2B2Y A;  2Z8L A;  3Q23 A;  2A19 A;  2Z9H A;  4IUP A;  4DV4 L;  3NPP A;  4LF9 L;  1TT2 A;  3OW2 A;  3S15 H;  2Q2H A;  5C4H A;  1B9M A;  4IJL A;  1EYD A;  1STG A;  3CME A;  1W6J A;  2XSC A;  3S1M H;  4JG2 A;  4IFD I;  2JXM B;  4CBV A;  4L5Q A;  1O7L A;  5C6A A;  1XPR A;  3PO2 H;  2CW0 D;  1ET6 A;  3PUY A;  1FVI A;  1K8M A;  2B2U C;  5EGT A;  4CJ0 B;  1L1O B;  2F3V A;  2PZW A;  3NTK A;  4KKT A;  4OO1 I;  3G4S A;  2HCI A;  2V1C C;  2IJ0 A;  1QIL A;  4AIM A;  2EDG A;  2HUG A;  3A7L A;  1STE A;  2UU9 Q;  4Y7N B;  4MTK A;  2PNR C;  3KBX A;  5DLQ E;  4IN3 A;  3T4A C;  1IBK L;  1S72 A;  4GNX B;  5G3L D;  5IY0 A;  3CCV A;  3K5L A;  1STH A;  5JVG 3;  1X54 A;  2JA6 B;  1HH2 P;  2K5N A;  4X65 L;  1S40 A;  1R4Q B;  1YJW A;  1RCV D;  1HPC A;  2AWN A;  4HIO A;  2F0T A;  1IL8 A;  1GOZ A;  1TS5 A;  4MHE A;  1Q82 C;  5K36 H;  2IT1 A;  3STB C;  1G29 1;  2BA1 A;  3OYY A;  4MNO A;  4OIJ A;  3QB3 A;  4KY6 A;  2G9D A;  1N33 L;  4J8Q A;  4ZCK A;  3D6C A;  1YNN C;  4PMW A;  3K0X A;  4EVO A;  1QUQ A;  4A3E H;  4HR7 B;  2OWO A;  4A3L G;  1VQ4 A;  2RDH A;  2MJ8 A;  1KIX A;  3GO5 A;  4OEM B;  4QF4 A;  1ENC A;  5AFW A;  1SE2 A;  1M8A A;  2IX1 A;  3I4M H;  2A1A A;  4HCE A;  4KN7 C;  4ZQ3 A;  1BCP B;  1MJE A;  4FO2 A;  3W1B A;  3ERS X;  4NXN Q;  2NVQ H;  5IIF A;  3ERO A;  1U4P A;  3F2C A;  1EYG A;  3L7Z C;  3RLF A;  2JSO A;  4DN4 M;  4NXM L;  1CSP A;  3DWP A;  3GD7 A;  1JWS D;  1BCP D;  1D5M C;  5BR8 Q;  4DV2 L;  4LF8 L;  3EJI A;  4DUZ L;  2L15 A;  4U67 3;  2F52 A;  4V0B A;  2EQS A;  1AEX A;  1JB3 A;  1E2W A;  4DKA C;  4AYB B;  1Z47 A;  5FLX L;  2VZA A;  3VA7 A;  5IYB H;  2DY7 A;  2EZV A;  5J3B A;  4EQP A;  3TP6 A;  3A8K E;  1XTD A;  4GKJ Q;  4CDD C;  2B29 A;  1AH9 A;  1WTP A;  3KYH C;  4A93 B;  5JPN C;  5IWA Q;  1KDB A;  1H9K A;  5L37 A;  4AH6 A;  3JAM i;  1SFO H;  3S15 B;  3J7Z C;  3EIV A;  4L8J A;  2O5I C;  2JEA I;  4JI4 L;  4A3B H;  1VMC A;  5ELC A;  5GAH C;  1STN A;  3S1M B;  1IHZ A;  1U5K A;  3L3O C;  1CQF A;  1A62 A;  2QA4 A;  2KBN A;  2JA8 G;  1FR3 A;  3RLO A;  3CRK C;  3SXH A;  1STB A;  5FKA C;  3PO2 B;  5I6W A;  2OXP A;  4LF6 Q;  2F3W A;  3OHX C;  4IO9 A;  4JW0 A;  4A3F G;  4JI5 L;  1V1O A;  1YHQ A;  2PW5 A;  2I5H A;  4A3G H;  1KDA A;  2VNU D;  1PTO C;  5IP9 G;  3CCQ A;  2K75 A;  1HZA A;  3W2D A;  1XNR Q;  3L2P A;  3CCS A;  1PLF A;  3MHB A;  3GP7 A;  2PQA B;  1TWC H;  4OGQ C;  4GZY C;  2F0K A;  4BXX H;  3SVM A;  1TQO A;  1PH1 A;  2XRQ D;  1JQY D;  3M7G A;  1NTG A;  3J7A V;  2B8F A;  5CBA E;  2NN6 H;  1XJV A;  3F2D A;  5CMD A;  3A74 A;  4UPA A;  5HUR A;  4U68 A;  2J0T D;  2XGT A;  5FJ8 H;  2F0N A;  2M9V A;  5E1F A;  2R7Z H;  4ME5 A;  1JT8 A;  3U4V A;  2Z0S A;  4ZK9 B;  3T51 B;  3MVV A;  4DR2 L;  1EY4 A;  3NBI A;  4IZ8 A;  4C3H G;  3HOY G;  1F77 A;  4RHR A;  4DAY A;  4A3D H;  5E3F A;  3RUZ A;  3ULP A;  2D5D A;  1VQD A;  4A3E B;  1WTV A;  3LGJ A;  3AQQ A;  1Q1B A;  4IFD G;  5IGG A;  1K3R A;  3F2B A;  1PMR A;  3J7A 5;  3I90 A;  1K3B C;  1Z6H A;  3I4M B;  2CHB D;  1SNO A;  2Q2T A;  2XIW A;  3HOZ H;  4RKL A;  1SND A;  2NVQ B;  2O4X A;  3FPU B;  2L0C A;  2X69 A;  4GN5 A;  2EY6 A;  5F2D A;  4OO1 G;  2L55 A;  3S1R B;  1KXL A;  1Q90 A;  1HCZ A;  4HN7 A;  1BQQ T;  3TP8 A;  2F0O A;  1GKH A;  2F0F A;  2K52 A;  2OCE A;  2VS1 A;  2ZM6 L;  2EYP A;  1DCZ A;  4RMF A;  1BOS A;  1SE4 A;  4BBS H;  1VQG A;  3MXU A;  4KD4 A;  3K57 A;  4H13 C;  4L5R C;  3ND8 A;  3TSS A;  4X3K A;  4JI1 Q;  1EU4 A;  1GUG A;  3K6O A;  2Q8I B;  4POF A;  4LF7 Q;  1PH2 A;  4GKK Q;  3KLR A;  1PFN A;  3HOU G;  3OW7 A;  2K33 A;  4X6A H;  3DXJ C;  1H9J A;  2QGQ A;  1SYG A;  5HGT A;  4YHH L;  4B3R L;  1BUV T;  1L1O A;  1SFO B;  5IOD A;  3TS0 A;  1WTX A;  4FXD A;  3PF5 A;  5FLM H;  2FXQ A;  1I3Q H;  2O2L D;  4JV5 L;  4DV3 Q;  4GNX A;  5G3L F;  2H1E A;  2UUC L;  2E2I H;  3P1H A;  3JAM c;  3J81 c;  4XQJ A;  5D65 A;  1GUW A;  2K4K A;  1EYC A;  1U4M A;  1JE4 A;  2EJF C;  4A3G B;  3HZX A;  3N6R A;  1L0Y B;  3NP8 A;  4LFB Q;  3F8T A;  1XMO Q;  4R8I A;  2AQ2 B;  1VF7 A;  1IBM L;  4JBW A;  1ILQ A;  4KD3 A;  2L4N A;  1TWC B;  4NMZ A;  1GO3 E;  5CV9 A;  1SLJ A;  3JAM E;  4YWK A;  1SE3 A;  3EQL C;  2VW9 A;  4L5T A;  1E1T A;  1PZJ D;  3PUV A;  3GTK H;  2QW7 A;  1PZK D;  3SDZ A;  1XYI A;  1EEI D;  3MA2 B;  1YBY A;  5FK9 C;  5J39 A;  2MP1 A;  3LNN A;  4RCO A;  3GTP H;  4LWC A;  2R7Z B;  3KF8 B;  1WTH A;  3PUZ A;  5J1Z A;  4RHS A;  4I7A A;  3M4Y A;  2JE6 I;  4A3D B;  1K9M C;  2PMZ E;  4DR7 Q;  5IGD A;  4OL7 A;  1NMG A;  3Q8D A;  2VQF Q;  1BCP F;  1HFG A;  2F0L A;  2I0Q A;  4PZ6 A;  3G48 A;  4YIJ A;  3S1Q H;  2ICE C;  3UDI A;  4DR6 L;  2AQ3 B;  5I2X A;  1ESF A;  1Y14 B;  3GTM H;  3HOZ B;  5IYC H;  3CQZ H;  1WTO A;  1YNJ C;  2G9H D;  3FRP B;  1WTQ A;  3V05 A;  3J7A F;  1G6Z A;  1BBX C;  1VCI A;  1TY0 A;  1X3E A;  1KNA A;  1PDQ A;  2EJM A;  4CDE C;  1S5D D;  1BO0 A;  4R4Q A;  1DGS A;  3MAQ A;  3AYH B;  3BVZ A;  1G8Z D;  5M5X H;  4X62 Q;  4DK6 C;  5GRO A;  1A6X A;  2WP8 J;  2XWB B;  3LWE A;  3KK7 A;  3TEH B;  4BBS B;  1M4V A;  2K05 A;  3E6Z X;  4A3L H;  1E2V A;  1SYF A;  4H7B A;  2KCM A;  1KTK A;  2NVY H;  3LWU A;  5D14 A;  3RNU A;  2VUM G;  4CKC A;  4OWW B;  3CP0 A;  3HOW B;  5BN4 A;  1LAB A;  1LTS D;  2UU9 L;  4LNQ A;  4KMU C;  3K5O A;  2BA0 A;  1X32 A;  4JBM A;  3S9W A;  2RVL A;  2PZU A;  3VR3 A;  4DV6 L;  1I3Q B;  1Y8N B;  2RQX A;  4XDX A;  3G71 A;  1KLU D;  3UDG A;  1G91 A;  3R8B A;  5LHY 1;  2PQA A;  2EJG C;  3A0J A;  2E2I B;  1U9R A;  5DAU A;  1CKN B;  1CQV A;  1X6O A;  4G4K A;  1GVP A;  3D6W A;  4LF4 Q;  3AEV A;  3BU2 A;  1E0B A;  1I4P A;  2MO1 A;  2N3S A;  4C3J G;  3I4N G;  1HA6 A;  3RR5 A;  2WAQ B;  3NQT A;  4HMJ A;  3PMF A;  4DV7 Q;  2XTI A;  2ES2 A;  3WWV A;  3K7A H;  4QIW E;  1A3T A;  1PRT C;  3S1N H;  1C48 A;  2KEE A;  3GTK B;  1TVX A;  4IUU A;  1E24 A;  4HIM A;  2JA8 H;  3H3V I;  4KY7 A;  1Y8P B;  3F2U A;  3GTP B;  2I5L X;  4QGU A;  1BDO A;  3A8I E;  1HNW Q;  4TRD A;  1JOO A;  5BR8 L;  4A3F H;  1WTR A;  4BXX G;  1FGB D;  3S17 B;  5C4Z A;  4FP5 D;  3CPF A;  1ENA A;  1CI3 M;  3AU7 A;  3P20 A;  3G7L A;  2OQK A;  5IP9 H;  3Q6S A;  2P5Z X;  2WB1 E;  4HCS A;  2LXK A;  1RL2 A;  3Q0A A;  1IW7 C;  4J6H A;  3STB D;  4OX9 L;  2R7Z G;  3MWY W;  3S1Q B;  1VQ7 A;  1A3V A;  4IUT A;  3S14 H;  3NBH B;  3IKJ A;  4OWX B;  3R2I A;  3GTM B;  2KUM A;  3EVQ A;  3I73 A;  3NSW A;  5IWA L;  4FF1 A;  1TWF H;  1YNN D;  3CQZ B;  2F0M A;  4O2D A;  5JEA J;  4DFA A;  3M85 A;  4X3U A;  3NWT A;  3D4R A;  4KHV A;  4K5V A;  2MNA A;  2DNC A;  4C3H H;  3HOY H;  2JA7 G;  5KYL A;  5M5X B;  4KHZ A;  4LF5 Q;  5FO9 B;  3PIP 3;  4JI3 Q;  2L5T A;  1GHK A;  3FKI G;  5CGK A;  3N52 A;  4QUC A;  2EXZ A;  1Y8O B;  2PI2 A;  2D9U A;  4DAP A;  4TVA B;  4ZUJ A;  3KDF B;  3H94 A;  2E76 C;  2NVY B;  1JJ2 A;  1W2B A;  1RIP A;  2OT2 A;  4CJ1 B;  1C4Q A;  4KKU A;  3CMA A;  3NEN A;  2CFM A;  4B3T Q;  3K7U C;  3KF6 B;  5CC4 A;  4DF7 A;  3TP7 A;  2F0G A;  1ROD A;  1EFW A;  2F03 A;  4GN3 B;  1VS0 A;  3QJY A;  3QO2 A;  1NNX A;  1PZI D;  1B2T A;  4DR3 Q;  2PW7 A;  4R4I A;  2ZJP A;  4PQX A;  2CCZ A;  5T1I A;  4G7H C;  1V9P A;  1EIF A;  3HOW G;  2N55 A;  1UE1 A;  3TRZ A;  5C4X G;  3E9H A;  2A74 C;  2NUC A;  1PH3 A;  1YJN A;  2F0I A;  1ZXT A;  3HKZ B;  1CHP D;  1LTR D;  4YY3 Q;  2B2Y C;  2A68 C;  1EIG A;  3S24 A;  2EYL A;  3HOU H;  2GA4 B;  2Y0S E;  1HZ9 A;  1SRO A;  2XN9 C;  1ZYR C;  3PGZ A;  1KRS A;  3VR4 A;  5I2Y A;  1I4G A;  4DV5 Q;  1N34 Q;  5H1S E;  3CC2 A;  1AE2 A;  4P72 A;  3G6E A;  3T13 A;  4DUY L;  1JE5 A;  3K7A B;  3D3R A;  2F0H A;  3I4L A;  1F9S A;  3S1N B;  1JIC A;  4JI2 Q; 
#chains in the Genus database with same CATH homology
 3KFU A;  1OXX K;  2AWO A;  3I7F A;  1C0A A;  3VDY A;  2CWA A;  1SFO H;  4JCV E;  4OXP A;  4AH6 A;  3JAM i;  4X65 Q;  2E2J H;  1Q81 C;  3J7Z C;  3TQY A;  3M4O H;  3EIV A;  4R4O A;  1KHI A;  4DR3 L;  4JI4 L;  3PUX A;  2JEA I;  4A3B H;  4A93 G;  3A5U A;  2A8V A;  3UDX A;  4IFD J;  2E8G A;  5GAH C;  4NXN L;  1YHB A;  1PH6 A;  1U5K A;  4DR2 Q;  1Q86 C;  2QA4 A;  1A62 A;  2JA8 G;  2KBN A;  2Q2U A;  4BY1 H;  3RLO A;  1PH8 A;  2YV5 A;  4R1J A;  2YYZ A;  1PHJ A;  4A3M G;  1PH5 A;  4A3I G;  1OTC A;  4LF6 Q;  3TRE A;  4EQ5 A;  4IO9 A;  3M9B A;  2MFI A;  3ICE A;  4GOP B;  3PUW A;  4A3F G;  4JI5 L;  4JI1 L;  1OXV A;  4YY3 L;  3T1H L;  1YHQ A;  1P16 A;  2I5H A;  4GN4 B;  3RN2 A;  1PYS B;  4A3G H;  4JYA L;  2VNU D;  2ZJQ A;  3ULJ A;  3ER0 A;  1YVC A;  5M3M H;  5GAD C;  3GTG H;  4LF7 L;  3PO2 G;  5LMN Q;  4GKK L;  3CCR A;  5IP9 G;  3CCQ A;  3MEF A;  2K75 A;  4LFA Q;  1HZA A;  1UE5 A;  4DV0 L;  4R4C A;  1TWH H;  3L2P A;  3CCS A;  4DR5 L;  2HHH Q;  1XNR Q;  2R92 G;  2HIX A;  1A8V A;  1M90 C;  1HJP A;  4ME3 A;  4DV5 L;  2PQA B;  1VQE A;  1LUZ A;  1TWC H;  2ASB A;  4GKJ L;  3I4O A;  1QZH A;  3H0G G;  1BKB A;  4BXX H;  1PH1 A;  3CCM A;  4B3M Q;  3UE1 A;  1NTG A;  4TQU S;  5JJI A;  5IYD H;  4LFC Q;  1IL2 A;  4JI2 L;  1NMF A;  1XJV A;  2ATW A;  3F2D A;  4OWT B;  1LM0 A;  3J80 c;  2ZM6 Q;  4J15 A;  3A74 A;  4UPA A;  1IBL L;  2XGT A;  5FJ8 H;  4YCW A;  3BZK A;  2R7Z H;  2YTX A;  2IY5 B;  5IYC G;  1JT8 A;  3U4V A;  1M1K C;  3DLL A;  2ZTE A;  2Z0S A;  4BY7 H;  3CD6 A;  4DR2 L;  4APV A;  4JI7 Q;  1YI2 A;  3HOY G;  5EAY A;  3FHW A;  4DV2 Q;  4GLA C;  4LF8 Q;  4DUZ Q;  4JBK A;  3M7N A;  5K36 G;  5LMU Q;  4A3D H;  5JJL A;  1NBW A;  3RLN A;  4LF6 L;  3ULP A;  1QVC A;  1VQI A;  2GN5 A;  1VQA A;  1VQD A;  2JA5 H;  1K8A C;  3LGJ A;  5ELN A;  3AQQ A;  3PIP A;  1VQO A;  1VQ5 A;  1Q1B A;  4RG1 A;  3UDF A;  4IFD G;  1Q8K A;  1T9H A;  1QVG A;  3GDE A;  4YHH Q;  3F2B A;  1K3R A;  2KEN A;  3F1Z A;  4B3R Q;  1CKN A;  2HQL A;  1R9T H;  3J7A 5;  4IOC A;  2CWP A;  2EIF A;  4A3E G;  1XNR L;  1SR3 A;  4R4T A;  3W5O A;  2Q2T A;  2ZTC A;  3U4Z A;  3HOZ H;  4BA1 I;  2VQE L;  1W3S A;  2I5M X;  2WB1 G;  2E5L L;  1Q12 A;  4WJ4 A;  1XPU A;  1EWI A;  4GN5 A;  4JV5 Q;  4OO1 G;  1IXR A;  4B3M L;  2WFW A;  2UUC Q;  3I4M G;  1PYB A;  3B6Y A;  3L0O A;  4LFC L;  1I94 Q;  1KXL A;  1C9O A;  4YCU A;  4AYB E;  1GKH A;  3W1G A;  2K52 A;  1Q7Y C;  2OCE A;  4LW1 A;  2VS1 A;  2ZM6 L;  3CC7 A;  2IHF A;  1VQN A;  2YTY A;  3GTQ H;  4A3J G;  4P71 A;  3S1R H;  1HR0 W;  3MXN B;  4RMF A;  4JI6 L;  3PF4 A;  2VUM H;  1WJJ A;  4UP9 A;  4BBS H;  1VQG A;  1PFS A;  4JI7 L;  1NE3 A;  4L5R C;  3HFZ B;  3S16 H;  4DR7 L;  4A3C G;  2VQF L;  3IRB A;  3T1H Q;  4JI1 Q;  1PH9 A;  5GQO A;  3K81 C;  3I56 A;  2ALY B;  1OXS C;  1HR0 Q;  5E7N A;  4POF A;  4BBR H;  4LF7 Q;  3S2D H;  1PH2 A;  4POG A;  4GKK Q;  3HOU G;  4DR5 Q;  3U50 C;  3HKZ G;  3CXC A;  2BH2 A;  4X6A H;  2GVB A;  5M3F G;  1UWV A;  2QGQ A;  2R6G A;  4YHH L;  1N36 L;  5IYB G;  4B3R L;  3M3Y H;  1VQH A;  4JBJ A;  4O0A A;  1KD1 C;  4EX5 A;  1HNX Q;  1NY4 A;  1L1O A;  5IP7 H;  1QZG A;  1X65 A;  5C3E G;  1TWG H;  3TS0 A;  1SN8 A;  3JC6 6;  4MTN A;  1KRT A;  3PF5 A;  1B8A A;  5FLM H;  2FXQ A;  1I3Q H;  1LTL A;  5C0X I;  1WOC A;  4IPG A;  1D8L A;  3A5Z B;  3CW2 C;  4DV3 Q;  3J81 i;  4GNX A;  4JV5 L;  1IBL Q;  1ASY A;  3S2H H;  1X9N A;  1E1O A;  4C2M H;  2UUC L;  1I94 L;  1CKM A;  1L2F A;  4P75 A;  2K50 A;  1JB7 A;  2E2I H;  1QUQ B;  4KI0 A;  3JAM c;  3PO3 H;  3J81 c;  4A3B G;  1KQS A;  2K5V A;  2RCN A;  3CCU A;  4B3S Q;  4C3J H;  3I4N H;  1WFQ A;  3M4Q A;  1VQF A;  2K4K A;  4BY1 G;  4IPD A;  2K5H A;  2NVX H;  4A3C H;  1O7I A;  1SRU A;  4LFB Q;  4KHP Q;  4A76 A;  3F8T A;  1XMO Q;  5IT9 c;  3AFQ A;  4DR6 Q;  1IBM L;  1N32 Q;  2MO0 A;  4JBW A;  2RF4 A;  3HOX H;  1HR0 L;  2NZH A;  4A3G G;  1X3F A;  1Q46 A;  1YHA A;  1GO3 E;  5M3M G;  3E9I A;  3T1Y L;  4A3K G;  2R7D A;  1SLJ A;  2YTV A;  4JOI C;  1YEZ A;  3AFP A;  4YWK A;  1I6H H;  1FGU A;  4IJH A;  2VW9 A;  1XNQ Q;  4L5T A;  1E1T A;  3KF6 A;  4C3I H;  3BZC A;  2VQE Q;  1VQM A;  1EQQ A;  1VQK A;  2Y0S G;  3PUV A;  1HNX L;  1FJG L;  2E5L Q;  4P73 A;  3CCE A;  3GTK H;  1Z9F A;  2AHO B;  1U0L A;  3HOV G;  3KJP A;  2D0P A;  2UXD L;  3M4P A;  2JK8 A;  1YBY A;  1MKH A;  3GTP H;  2BH8 A;  4LWC A;  5IYD G;  1TXY A;  3K80 C;  2NN6 G;  2OTJ A;  3KLW A;  4DV3 L;  4DPG A;  3KF8 B;  3PUZ A;  3E0E A;  4A75 A;  4DV1 Q;  4P74 A;  1N9W A;  4JI6 Q;  4OON A;  2JE6 I;  5FJ8 G;  5C44 H;  5ELO A;  5GAG C;  1K9M C;  2PMZ E;  2VY3 A;  3D0F A;  2AMC B;  4DR7 Q;  1KL9 A;  4B3S L;  4BY7 G;  1NMG A;  3NEM A;  3Q8D A;  4DK3 C;  2VQF Q;  3KJO A;  2UXB Q;  1V43 A;  2DGY A;  1H95 A;  4HID A;  1J5E L;  4DV7 L;  1VQL A;  2I0Q A;  4PZ6 A;  2GVA A;  3G48 A;  2F4V L;  4HJ8 A;  4PG3 A;  3S1Q H;  3CAM A;  3OTO Q;  4A3D G;  1XMO L;  1E22 A;  3UDI A;  4WJ3 M;  4DR6 L;  2JA5 G;  1N32 L;  1I5F A;  4Y7N H;  4X66 Q;  4HJ9 A;  1KC8 C;  1C7Y A;  1Y14 B;  1ASZ A;  3EN2 A;  4DV6 Q;  3GTM H;  4GS3 A;  2B63 H;  2D0O A;  1N36 Q;  5IYC H;  1K73 C;  3PIO A;  1OXT A;  3CQZ H;  2JA7 H;  1CSQ A;  4PZ8 A;  4X64 L;  2UUA L;  1L0W A;  4HIK A;  2JA6 H;  2CQO A;  2MQH A;  3FKI H;  1VCI A;  2R7F A;  1X3E A;  2R93 H;  4IOA A;  1PA6 A;  1XNQ L;  3CF5 A;  2KHJ A;  4AQY Q;  3HKZ E;  3HOZ G;  1EIY B;  1JJG A;  4R4Q A;  1DGS A;  1HNW L;  3AYH B;  1K0R A;  5M5X H;  2UXC L;  4X62 Q;  1K83 H;  4DK6 C;  5GRO A;  4L5S A;  1YIT A;  4QJF A;  1Y1W H;  3D31 A;  2WP8 J;  4ALP A;  4DNI A;  3TEH B;  1SE8 A;  2HIV A;  4LFB L;  1L1O C;  1HNZ Q;  4UY8 C;  4A3L H;  4DV1 L;  1YJ9 A;  1K8G A;  4JI0 Q;  2B3G A;  2KCM A;  2NVY H;  5M5Y H;  3CCL A;  1VQ6 A;  4XTC S;  3TS2 A;  1QVF A;  4IPC A;  3SGI A;  3RNU A;  3I55 A;  4HJA A;  2VUM G;  1CKO A;  4OWW B;  4BBS G;  1UE7 A;  3CP0 A;  1IBM Q;  2UU9 L;  2VL6 A;  4LNQ A;  1UE6 A;  2UXB L;  4PZ7 A;  1WCM H;  2RHQ B;  1EQR A;  1XMQ Q;  1A0I A;  1Y1V H;  2BA0 A;  2OQ0 A;  4GOP A;  4JBM A;  3OTO L;  1YIJ A;  5HGQ A;  2F3I A;  3T1Y Q;  4A4I A;  4BBR G;  3HOW H;  3PCO B;  1BBW A;  2PNH A;  4X66 L;  5C0X J;  5AJ3 Q;  4DV6 L;  5C4X H;  1VQ9 A;  2JQO A;  1N8R C;  1B70 B;  1FJG Q;  4DAY B;  2E2H H;  3G71 A;  1Q1E A;  3UDG A;  2YU9 H;  2UXD Q;  2JEB I;  1PVO A;  1X3G A;  2PQA A;  4UP7 A;  3FP9 A;  4JI3 L;  4LUO A;  3A0J A;  2UUB L;  1X56 A;  4AQY L;  4DR1 Q;  4JI8 L;  2IHE A;  5FLM G;  4YCV A;  2JJQ A;  3BJU A;  5JEA G;  4GLX A;  4X62 L;  1J6Q A;  2Z6K A;  2EXD A;  1CKN B;  3GTL H;  1X6O A;  2DUD A;  4LUZ A;  1LYL A;  1G51 A;  2IX0 A;  1GVP A;  1X55 A;  1JMC A;  4LUV A;  4LF4 Q;  3BU2 A;  4OX9 Q;  3AEV A;  4QL5 A;  3PO3 G;  3KOJ A;  1HNZ L;  2MO1 A;  1EOV A;  2N3S A;  1VQ8 A;  4JI0 L;  3I4N G;  5HY6 A;  1GM5 A;  3RR5 A;  4UP8 A;  2N49 A;  4K0K L;  1J5E Q;  1IBK Q;  4DV7 Q;  3ZJY C;  2F4V Q;  2OTL A;  1S3O A;  2XTI A;  2NZO A;  1YZ6 A;  1FL0 A;  2ES2 A;  3WWV A;  3K7A H;  4QIW E;  4A93 H;  1XMQ L;  3KDF A;  2KHI A;  2WAQ G;  3HOX G;  3S1N H;  1V1Q A;  2ID0 A;  2A19 A;  1E24 A;  4X64 Q;  4DV4 L;  4HIM A;  2UUA Q;  4YWL A;  2JA8 H;  1PV4 A;  3H3V I;  2AKW B;  4LF9 L;  4DR4 L;  3OW2 A;  4Y52 H;  3S15 H;  2Q2H A;  5AJ3 L;  3NEL A;  2Q2I A;  3CPW A;  1P8L A;  2ZJR A;  4A3M H;  4IJL A;  3U58 A;  4A3I H;  4QQB X;  2I5L X;  3CME A;  1I50 H;  4QGU A;  5LMN W;  1HNW Q;  3S1M H;  4JG2 A;  2UXC Q;  4IFD I;  5IE8 A;  5BR8 L;  4A3F H;  4BXX G;  4KLK A;  1N33 Q;  4KHP L;  4L5Q A;  3CPF A;  2C35 B;  4DR1 L;  2KCT A;  3RZO H;  3UE0 A;  1XPR A;  3PO2 H;  4A3K H;  2OQK A;  5IP9 H;  5C4J H;  3RN5 A;  5C0X G;  2WB1 E;  3PUY A;  2R92 H;  1FVI A;  2LXK A;  1RL2 A;  3S17 H;  1IYJ B;  4NB3 A;  1VQB A;  1L1O B;  3STB D;  4OX9 L;  5C44 G;  4LF4 L;  2R7Z G;  1N34 L;  4OO1 I;  1BVS A;  3G4S A;  2HT1 A;  1EUJ A;  1VQ7 A;  2V1C C;  3H0G H;  4AIM A;  3S14 H;  3PSI A;  3NBH B;  3HOV H;  3J81 j;  2UU9 Q;  4OWX B;  5DLQ E;  2LSS A;  5IWA L;  2CKZ B;  3J80 i;  3GTJ H;  1IBK L;  1S72 A;  4GNX B;  1TWF H;  1WI5 A;  5IY0 A;  3CCV A;  4O2D A;  5JEA J;  3DM3 A;  1X54 A;  3M85 A;  4QY7 A;  5JJK A;  1HH2 P;  2K5N A;  4X65 L;  3PV0 A;  1IZ6 A;  1S40 A;  1HZC A;  2H5X A;  1YJW A;  2MNA A;  1XPO A;  1KAW A;  4NXM Q;  2B63 G;  2RHS B;  4H02 A;  2AWN A;  4HIO A;  4C3H H;  3HOY H;  3H15 A;  2JA7 G;  1PH4 A;  4KHZ A;  1SMX A;  4LF5 Q;  4JI3 Q;  3I2Z A;  3H3V H;  1Q82 C;  2JA6 G;  3FKI G;  2IT1 A;  3STB C;  1G29 1;  2BA1 A;  4JOI A;  5GAE C;  3OYY A;  4MNO A;  4GOP C;  2UUB Q;  2R93 G;  4JI8 Q;  2PI2 A;  1TWA H;  1G6P A;  4TVA B;  3KDF B;  3K8A A;  1JJ2 A;  2K14 A;  1RIP A;  1E7Z A;  2N8N A;  2LXJ A;  1W2B A;  1N33 L;  1B7Y B;  3CCJ A;  4PMW A;  3K0X A;  1Y1W G;  4DAM A;  1OXU A;  3CMA A;  3NEN A;  2CFM A;  5M5W H;  4B3T Q;  1D7Q A;  1QUQ A;  1GD7 A;  5LMN L;  4DUY Q;  3K7U C;  4A3E H;  3KF6 B;  2OWO A;  4A3L G;  1VQ4 A;  4LFA L;  2QEX A;  3CC4 A;  1KIX A;  2HHH L;  4K0K Q;  3GO5 A;  1VQP A;  1E3P A;  2PI2 E;  4GNX C;  1EFW A;  1VS0 A;  4GN3 B;  2Z6K C;  1HZB A;  1CUK A;  2IX1 A;  3I4M H;  4MZ9 A;  2A1A A;  1AE3 A;  3ULL A;  1WCM G;  4DR3 Q;  4R4I A;  1MJE A;  2ZJP A;  2CCZ A;  4JI4 Q;  1VQC A;  3W1B A;  1Y1V G;  1WYD A;  3ERS X;  4NXN Q;  2NVQ H;  4DV4 Q;  2NVT H;  4DR4 Q;  1V9P A;  3F2C A;  1EIF A;  4LF9 Q;  4A3J H;  1PH7 A;  1EYG A;  3HOW G;  1UE1 A;  3TRZ A;  3L7Z C;  3RLF A;  4NXM L;  5C4X G;  1CSP A;  1MIU A;  3E9H A;  3GD7 A;  1MJC A;  1PH3 A;  1YJN A;  2N78 A;  2WAQ E;  3EBE A;  4FDB A;  5IP7 G;  3HKS A;  4LF5 L;  5BR8 Q;  4DV2 L;  3GTO H;  4JI5 Q;  4DUZ L;  4YY3 Q;  4LF8 L;  2L15 A;  2F52 A;  5LMU L;  2ZTD A;  3S24 A;  4JYA Q;  2EQS A;  1NJI C;  4JC0 A;  4NPS A;  3HOU H;  1UEB A;  4DKA C;  2Y0S E;  2D62 A;  2JA9 A;  1Z47 A;  4XIG S;  2VZA A;  4DV0 Q;  5M3F H;  1HZ9 A;  1BBU A;  1SRO A;  5IYB H;  5FLX c;  3PGZ A;  1KRS A;  5J3B A;  4DV5 Q;  1N34 Q;  5H1S E;  3CC2 A;  1AE2 A;  4BA2 I;  4B3T L;  4P72 A;  5C3E H;  1XTD A;  1VQJ A;  3G6E A;  4DUY L;  4HJ7 A;  4GKJ Q;  1A63 A;  2B29 A;  1JE5 A;  4IPH A;  1AH9 A;  4GLV B;  4AYB G;  3KYH C;  4YWM A;  5IWA Q;  3RZD H;  2NN6 I;  4HJ5 A;  1JJC B;  4JI2 Q;  1YNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...