2VW9A

Single stranded dna binding protein complex from helicobacter pylori
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
108
structure length
108
Chain Sequence
b'MFNKVIMVGRLTRNVELKYLPSGSAAATIGLATSRRFKKQDGTLGEEVCFIDARLFGRTAEIANQYLSKGSSVLIEGRLTYESWMDQTGKKNSRHTITADSLQFMDKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SINGLE-STRANDED DNA BINDING PROTEIN
publication title Single-Stranded DNA-Binding Protein Complex from Helicobacter Pylori Suggests an Ssdna-Binding Surface.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Dna binding protein
total genus 20
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vw9A00
2OQ0A 1E1OA 4UP8A 1YITA 4R4OA 4DR4Q 1TWGH 2MQHA 1PFSA 3BZKA 4X65L 5IYBG 3F2DA 4JI0L 5IP7G 3PUVA 4A3JH 2QGQA 1VQPA 2ZJQA 3OTOQ 1QZGA 4B3TQ 3ER0A 3HOUH 2NVTH 4BBRG 1GKHA 3D31A 3HFZB 1K8AC 1J5EQ 4O0AA 4JYAL 3KJOA 4LWCA 2JA6G 4LW1A 1IBMQ 2JA8H 1E1TA 4P72A 1C0AA 4DV0Q 4JBKA 1Y1VH 4A4IA 3I56A 4QY7A 5C0XJ 3J80i 2F4VQ 4OO1G 1C9OA 2I5LX 3DM3A 3CPWA 1YHQA 1HNWL 1V1QA 4GKJL 3HOXH 2VUMG 2N3SA 4QQBX 1R9TH 5C0XI 2HHHQ 4JYAQ 4QIWE 4JI7L 4DR6L 1KHIA 1N33L 5JEAG 1X55A 1QVFA 4AYBE 5ELOA 2N78A 4DV2Q 1U0LA 2DUDA 2ZJPA 2Q2TA 4KLKA 5IE8A 3BZCA 4LF4Q 3UE1A 5JJLA 1JT8A 4GS3A 3HOZH 3PO2G 4YY3L 4GKJQ 2R92G 1EQQA 1N34Q 2D0OA 3GTKH 4L5RC 4A93H 1K73C 2Z6KA 1FL0A 2NZHA 4OX9L 2KHIA 4KHPL 1UEBA 1N33Q 2K75A 3AQQA 3CCLA 3KOJA 3CCMA 1WOCA 2E2JH 1HR0L 4EX5A 3CC7A 4UP7A 1K9MC 3ULJA 5IYBH 1EYGA 3F8TA 3BU2A 2LSSA 5FJ8G 1E24A 1V43A 2OCEA 1VS0A 4XTCS 4NXNL 1MKHA 5GROA 1A0IA 5FLXc 4BBRH 4A75A 1PH6A 1W3SA 1L0WA 4OX9Q 4KHPQ 4RG1A 4DV6L 2JA6H 1SE8A 4AQYQ 1VQ7A 5M3MG 4FDBA 5JJIA 1UE7A 3A5UA 3T1HL 3GTMH 3FKIH 1FVIA 4PG3A 1PH2A 3RN2A 1SROA 1HNZQ 2BH2A 5C44H 1HR0Q 4A3BG 2RHSB 4IPDA 2RF4A 3PIOA 3B6YA 4JI1L 3RLFA 2VUMH 4PZ7A 3CP0A 4AH6A 4A3DG 4DR2L 4NXNQ 1OXUA 3L7ZC 2UUCQ 1S3OA 3KF6A 3M4QA 2EIFA 1YHAA 4LUOA 3UDXA 3T1HQ 2GN5A 3E9HA 1I94Q 2E5LL 1NMFA 3CD6A 3KJPA 3ULLA 2JA9A 1TXYA 3OYYA 1JMCA 3CW2C 2R92H 3EBEA 4LFBL 4JCVE 4JI1Q 2N49A 2Z6KC 4DR2Q 1XNQQ 4JI5Q 4X64L 1YHBA 1YNXA 3I4OA 5JEAJ 3PUWA 3CXCA 1A62A 1L1OA 3PCOB 4DV7L 2CWAA 3EIVA 3S14H 4UPAA 3W1GA 1QZHA 1XNRQ 4POGA 3I4NH 1Y14B 1M1KC 4MTNA 3IRBA 1I3QH 3CC4A 1K0RA 2E2IH 4IJHA 1E7ZA 1VQLA 4GLAC 5FJ8H 2VNUD 2IT1A 4LF9L 1UE5A 3S1QH 4POFA 4Y52H 5C3EG 2PMZE 4DV1L 2IHEA 2WAQG 5GAHC 4OONA 5M3MH 5IWAL 5LMUL 4IOCA 3H0GH 4IPCA 4JOIA 2H5XA 4C3HH 1KD1C 2WB1G 4ALPA 3J7ZC 4A3BH 2OTJA 1Q12A 1VQJA 4X6AH 2UUAQ 2R93G 3TRZA 4A3DH 4HIMA 4LF9Q 3JC66 4QL5A 3UDFA 5BR8L 1ASZA 3CCEA 1GD7A 4MNOA 3M4PA 2K5HA 5GAGC 2B63H 3A0JA 4A3GG 4R1JA 1WCMG 3M9BA 3RZDH 2AHOB 4ME3A 4OWTB 1X3EA 1VQ8A 2JA7G 3HOZG 4DR4L 3RR5A 5E7NA 2B29A 1Q86C 4NXMQ 1P16A 4O2DA 2ZJRA 1X54A 4P75A 3JAMc 2ZM6L 3CCJA 4WJ4A 3OTOL 1DGSA 4DUYL 4B3TL 4A93G 3AFQA 5C4JH 1J5EL 5IYCG 3K0XA 1L1OC 5BR8Q 2VQEQ 3PUXA 3CF5A 4DV0L 3AFPA 1EFWA 2F4VL 1EOVA 4YCVA 4TVAB 3J81i 5M5YH 3I55A 3PV0A 1CSQA 4GN4B 4GLXA 3DLLA 3HKSA 2ZM6Q 1CKNA 3KF6B 3KFUA 1I6HH 4JI8Q 2ID0A 4DUYQ 2HHHL 3D0FA 4DV4Q 4JI4L 1YJ9A 3TREA 1B7YB 1I5FA 2BH8A 5EAYA 4IPHA 3CCVA 3UE0A 5M5XH 2NVXH 5C3EH 1NBWA 3LGJA 3FKIG 3CCRA 4DV2L 1JJ2A 4LF4L 1B70B 2R7DA 4JOIC 4YWMA 5C44G 1K83H 3RN5A 1CKMA 1WFQA 1TWHH 1VCIA 1RL2A 3UDIA 4DR5L 1A8VA 1N34L 1QVGA 1EIFA 2YV5A 4IFDG 5JJKA 1L1OB 1N32Q 1VQKA 1Y1WG 2RHQB 4DV5L 4RMFA 2Y0SE 2VL6A 2WP8J 3S1NH 4HIOA 2R93H 4JI4Q 1JB7A 1K3RA 2ASBA 3S2HH 5C4XG 2NN6G 3PUZA 2JEAI 4DR3Q 4JBWA 4A3GH 3JAMi 1WCMH 1JJCB 1YJNA 2UU9Q 4LF7L 2JA7H 3K7UC 4DNIA 1VQ5A 2IY5B 2YTXA 4DAMA 4DR5Q 1FJGQ 5IY0A 1QUQA 1HH2P 1OXSC 4DV5Q 4BBSH 2KCMA 2R7ZG 2N8NA 2F3IA 5IYCH 2ZTCA 4APVA 1VQMA 1IBLQ 4AQYL 3MEFA 3H15A 3K80C 1HJPA 1LTLA 3STBD 1HNZL 3GTLH 3I4NG 4LF7Q 1KAWA 1G6PA 1VQIA 3E9IA 3G48A 5LMNL 1E22A 1KL9A 4DUZQ 4DR1Q 2Q2UA 4A3LH 1VQEA 2NVQH 4LNQA 5H1SE 1LUZA 2VS1A 2GVBA 5AJ3Q 2JE6I 1GM5A 2UUCL 2JQOA 1KRSA 4PZ6A 4TQUS 4A76A 4LF5L 1VQFA 1X6OA 1HR0W 2UXBQ 2KENA 4GOPC 3H0GG 1SFOH 3U4ZA 1I94L 4JC0A 1V9PA 4P73A 2MO1A 4LF6L 1YZ6A 5LMNQ 3RNUA 2EQSA 4DV3L 2MNAA 4B3RQ 3L2PA 3RLOA 1XNQL 4JI5L 1Y1WH 1XPOA 4QJFA 3F2CA 3K81C 4GNXA 3VDYA 2B63G 3OW2A 1PH7A 4YHHQ 1B8AA 1Q7YC 2LXKA 5C4XH 1KQSA 4LF5Q 1CKNB 4KHZA 1XNRL 5GADC 2A1AA 1SLJA 4IPGA 1IBKQ 3Q8DA 4A3KG 4IFDJ 4A3MG 3ERSX 2NZOA 1Q81C 3PGZA 4LF6Q 1SN8A 1X56A 4DV3Q 1KIXA 4LUVA 4A3CH 1Q8KA 4L5SA 2MO0A 3U50C 2R7ZH 4IFDI 1HNXQ 4YWLA 3RLNA 2ZTEA 1X3FA 5M5WH 4B3MQ 3MXNB 4QGUA 2CKZB 1A63A 1JE5A 2VZAA 2NN6I 4XIGS 2ALYB 4A3FG 2HQLA 3TEHB 3S24A 2HIVA 2UUAL 2CQOA 3W5OA 4JI6L 4BY1G 3NEMA 2PI2E 4L5TA 4JBMA 1RIPA 2JA5G 3S15H 1PYBA 1UE1A 2B3GA 2WAQE 3AYHB 3HOVG 3S1MH 4GKKL 4R4IA 1QUQB 1Z9FA 5M3FG 2UUBL 4A3IH 1NY4A 2K5VA 4NXML 4DR7Q 2WB1E 2KBNA 2LXJA 2NVYH 1TWAH 1D7QA 2YU9H 1BVSA 3HKZG 4HIDA 4JI6Q 2VQEL 4GNXC 1S40A 1D8LA 3CQZH 1G51A 3I4MG 4IJLA 3TS0A 2WFWA 4GKKQ 1P8LA 1XTDA 1PH3A 2UUBQ 2DGYA 1NMGA 3KF8B 4A3KH 3E0EA 2YYZA 4JI2Q 4JI8L 4HIKA 4A3MH 4BBSG 4K0KQ 5IT9c 4DV4L 2AKWB 2IX0A 1J6QA 1MIUA 3CCSA 1N8RC 1OTCA 4UP9A 3J80c 3NELA 1WYDA 2RCNA 1BBWA 3WWVA 5J3BA 2YTVA 1Q82C 1PYSB 4P74A 4DPGA 1IZ6A 3K8AA 4NPSA 4JBJA 1EUJA 2Q2IA 1PH5A 3GDEA 3T1YQ 4A3LG 4GNXB 1N32L 5HGQA 1E3PA 4A3FH 1VQ9A 4LF8L 1XMOQ 4LFAQ 4X66Q 2K50A 4BY1H 2PQAA 1ASYA 4BXXG 2L15A 4DKAC 2CCZA 3S16H 2AWOA 3H3VH 4DR3L 2JA5H 3S17H 1M90C 1NE3A 3HOVH 1O7IA 4R4CA 4BY7G 4KI0A 2UU9L 4GOPA 2MFIA 3CCQA 5M3FH 4C3IH 1FJGL 3M3YH 1PH4A 1IYJB 2UXDL 1EWIA 1LYLA 2OQKA 4YCUA 1VQBA 3PF5A 4LF8Q 2K5NA 4BA2I 3HOWG 3HOYG 1IBLL 3FHWA 3ZJYC 2QEXA 4OWXB 1X9NA 3I4MH 1SMXA 3TS2A 1U5KA 3STBC 3GTPH 4R4QA 1Q1BA 2A8VA 4GN3B 4UY8C 3H3VI 2EXDA 4DR1L 4DUZL 2E2HH 2UXCL 4LFCQ 1HZCA 1YIJA 2IX1A 4A3CG 4X62Q 2KCTA 3J81j 1K8GA 2UXDQ 2A19A 2XTIA 4YCWA 5AJ3L 2YTYA 5ELNA 2D62A 3AEVA 4X65Q 2XGTA 3G6EA 1VQDA 1UWVA 1YJWA 2VQFL 4JI0Q 1MJCA 4LUZA 1HZBA 2UXBL 3CPFA 2Y0SG 4HJ5A 4P71A 4IO9A 3M7NA 5IP9G 1HZ9A 1VQAA 4AYBG 3GTGH 2JK8A 2UXCQ 1PH8A 1PA6A 4B3RL 3KDFA 2I5MX 3F2BA 5DLQE 5K36G 1I50H 4WJ3M 1HNWQ 3KLWA 2R7FA 3J7A5 1NJIC 4YHHL 2VQFQ 4BXXH 3I2ZA 4JG2A 5GAEC 3UDGA 4A3IG 1CKOA 2Q2HA 5LMNW 1MJEA 4BY7H 1IBKL 5FLMH 3PSIA 4JI7Q 4DR6Q 1AH9A 4PMWA 2OTLA 2JEBI 1KRTA 2JJQA 4A3EG 4H02A 4MZ9A 2FXQA 2PI2A 2VY3A 3CCUA 3PO3G 4DK6C 2R6GA 1HNXL 4YY3Q 3GTOH 3HOWH 3HOYH 1Z47A 5IP7H 4B3ML 5IYDG 1VQOA 3CC2A 3SGIA 3S1RH 2ATWA 1AE2A 2IHFA 4DK3C 2PQAB 4HJ7A 3GD7A 1LM0A 1TWCH 3ULPA 3GTQH 1VQHA 4OWWB 2K14A 3S2DH 3GO5A 3M85A 4GN5A 4GOPB 1VQ6A 4HJ9A 4AIMA 1XJVA 1YBYA 1BBUA 3FP9A 5GQOA 3A5ZB 1YEZA 4C3JH 1S72A 1KC8C 1X3GA 2ZTDA 4DR7L 5IP9H 4IOAA 2QA4A 1YI2A 1WI5A 3RZOH 1AE3A 4DV6Q 2F52A 2HIXA 3NBHB 2I0QA 1GO3E 4X62L 1Q1EA 4PZ8A 4C2MH 1EQRA 3L0OA 4GLVB 4NB3A 3PO2H 4B3SL 1G291 4OO1I 1OXXK 1T9HA 3M4OH 2E8GA 2KHJA 3BJUA 1PV4A 3A74A 1H95A 1YVCA 1NTGA 3U4VA 2CWPA 4HJAA 1JJGA 2D0PA 4JI2L 4K0KL 1C7YA 1N36Q 4A3EH 4R4TA 1QVCA 2E5LQ 1IXRA 1VQGA 5C0XG 2OWOA 2BA1A 3EN2A 3HKZE 4Y7NH 4A3JG 1EIYB 3K7AH 1PHJA 3J81c 3PO3H 3HOUG 5HY6A 1FGUA 1Q46A 1VQ4A 4B3SQ 4JI3L 4LFBQ 4YWKA 1OXTA 5IYDH 2GVAA 1CUKA 1L2FA 3KDFB 3PUYA 2AWNA 4X64Q 3T1YL 2CFMA 3KYHC 4EQ5A 2JA8G 1Y1VG 3TQYA 2C35B 2HT1A 4DV7Q 1CSPA 1N9WA 2AMCB 1XMOL 4X66L 4LFAL 3NENA 3HOXG 2VW9A 4HJ8A 2Z0SA 1BKBA 1GVPA 4J15A 1W2BA 1VQNA 3G71A 4BA1I 1PH1A 4JI3Q 3G4SA 4JV5L 2I5HA 3CMAA 1XMQL 1PH9A 4DV1Q 1UE6A 3CMEA 3PF4A 2K52A 3W1BA 1N36L 1IL2A 3ICEA 1SR3A 1XPUA 1VQCA 5IWAQ 2K4KA 1SRUA 5LMUQ 1KXLA 2PNHA 4DAYB 1WJJA 2ES2A 1XPRA 3U58A 2BA0A 4L5QA 4JV5Q 3CAMA 5FLMG 1HZAA 4OXPA 3PIPA 1PVOA 1IBML 1XMQQ 1TWFH 2V1CC 1OXVA 3F1ZA 4LFCL 3I7FA 3GTJH 1X65A
chains in the Genus database with same CATH superfamily
4UP8A 1YITA 3BZKA 5IYBG 5C0XH 4A3JH 1VQPA 3OTOQ 4JYAL 2KEEA 2K6AA 3KJOA 4K5VA 3A8JE 1E1TA 4P72A 1C0AA 1HFGA 4A4IA 1X32A 4ZKBB 3CKIB 3HEJA 1DZ1A 3DM3A 1YHQA 4C56C 4GKJL 3A55A 1AP0A 2NVQB 4QQBX 4F8MA 2HHHQ 5C0XI 2IWHA 1KHIA 4RGNA 4DK1A 4AYBE 1LTBD 2AQ1B 1JT8A 2VB3X 3NTKA 3W3AA 4GS3A 1LT4D 3UE1A 3K58A 1I4QA 2F0PA 1D5XC 2D0OA 4L5RC 4A93H 2IL8A 2MPMA 4OEMB 2K75A 3CCLA 4WFN3 3CCMA 1WOCA 3AMUA 2LS01 3H91A 3NWSA 4RHRA 4CHTB 1EEID 4EX5A 3MFGA 3BU2A 5FJ8G 2OCEA 1EYGA 3PIP3 1NAPA 1AZPA 1UUPA 3TZDA 1W3SA 4OX9Q 4KHPQ 2F0DA 4RG1A 1SE8A 5JJIA 1VQ7A 5M3MG 5M5WB 3T1HL 3GTMH 5CV6A 4C3HG 2L1BA 3RN2A 5KGUA 3VYSA 3K0YA 1HR0Q 3B6YA 4XT3B 4A3DG 5J1ZA 2B2YC 1TU2B 2QCPX 1S3OA 3KUPA 3M4QA 4XQJA 1CT1D 1STHA 1YHAA 2GN5A 3E9HA 2F3VA 4ZUJA 1I94Q 1GHKA 5I6WA 1JMCA 3CW2C 2NVYB 5CORA 4JCVE 4JI1Q 2Z6KC 4X64L 4RGMA 3I4OA 4V0BA 2A74C 2CWAA 1JOKA 1QE6A 5EJWA 3S14H 1Z6HA 4UPAA 1QZHA 3IAYA 1FYCA 3D3RA 4A3MB 1E7ZA 4RCOA 5C4JB 1VQLA 2IT1A 3S1QH 1E2ZA 2Q8RE 5C3EG 5GAHC 3T13A 4OONA 5DNFA 5LMUL 2H5XA 1HCZA 4F87A 3J7ZC 1WTWA 4A3BH 1PFNA 2OTJA 1O78A 4H44C 4LF9Q 3JC66 3SK6A 1ASZA 1GD7A 4MNOA 2EOTA 3M4PA 4B9XA 4A3GG 4R1JA 3RZDH 1X3EA 4IUTA 3HOZG 4G57A 1IW7C 4O2DA 3OTOL 1DGSA 3AFQA 1PTOH 4FO2A 3E5SA 3HKZB 1L1OC 4WRDA 3PUXA 1SDFA 3FRPB 2A6EC 3NP8A 5M5YH 4GLXA 3KFUA 2ZM6Q 3NTHA 2F0UA 3TSSA 4DUYQ 2HHHL 1KDBA 1BCPF 2KUMA 1YJ9A 3TREA 2BH8A 1PRTB 3CCVA 4IPHA 5KEEA 1NBWA 3FKIG 4DN4M 1DCZA 3A54A 1K83H 1CKMA 1TWHH 3QR8A 5C4HA 3KLSA 3UDIA 3GTGB 3TP7A 3MXNA 1KABA 1I50B 1MSHA 3MXUA 4HIOA 3RUZA 4JI4Q 5E1FA 3RMHA 3J81L 3NBHA 3S2HH 3PUZA 5T1IA 3JAMi 1WD0A 4BY7B 2UU9Q 5CV5A 4DAVA 4PV1C 5DAUA 1QUQA 1OXSC 1DM0B 1Z7TA 2KCMA 4WORA 1ONLA 3FDTA 1VQMA 3HOWB 1EU4A 3MC0B 3MEFA 3SXHA 2KEDA 1LTLA 4FVMA 4LF7Q 1KAWA 1VQIA 1E22A 4DUZQ 1LTRD 3S2DB 1LUZA 4KY6A 2M2LA 2JQOA 4RAUC 4ZQ3A 5C6AA 4WJWA 1HR0W 4GOPC 1I94L 1EY6A 3KLRA 2SEBD 3RZOB 1HPCA 2MO1A 4LF6L 2EE1A 1A3UA 4DV3L 4K14A 1EFID 4B3RQ 4C2MB 1CZWA 1Y1WH 3SK8A 3PQIA 3VDYA 4KKSA 1PXUA 4LF5Q 3I91A 3R93A 1CKNB 3VYTA 3DM1A 1SLJA 5G3LD 5FKAC 5C3XA 5FO7B 2XNAC 4A3MG 2NZOA 1SN8A 2RBMA 3FMCA 4A3CH 1HA6A 2B2UC 4ABNA 5A2QL 1HNXQ 1S5DD 3ITPA 3RLNA 1RCVD 3J81E 4QGUA 2CKZB 4DNRB 2FINB 3S24A 1SBBB 3H94A 4JI6L 1D1KA 1RF2D 5IT9E 5K36H 3NEMA 2A68D 1EZ6A 2PI2E 4L5TA 4JBMA 1PYBA 1JWSD 4R4IA 2UUBL 5CBEE 2K5VA 1C48A 2EYLA 3HKZG 4Q0FA 4QUCA 5ELCA 2CVRA 4GKKQ 1P8LA 4LAAA 5DM63 5IGCA 4X3TA 3SHLA 1STYA 4A3KH 1PZID 5COYA 2EYPA 4RGTA 2HD3A 4RKBA 3GP7A 3J80c 2WIIB 2TSSA 5J3BA 3K8AA 1HTPA 1PH5A 3GDEA 3T1YQ 5EKLA 1F9SA 1G2SA 4GNXB 1L0XB 5CMDA 2WKDA 1VQ9A 3RD4A 1S5BD 3MFYA 1M4VA 5JVG3 4LFAQ 1XMOQ 3HOXB 2K50A 2PQAA 1ASYA 1HXYD 5A2QE 3Q22A 4BY7G 5F2DA 2UU9L 2N55A 4C3IH 1DXMA 4ZYSA 1PRTD 2UXDL 3EROA 2OQKA 4K6LA 3PF5A 3O13A 4KTAA 3HOWG 2FMMA 2A8VA 4GN3B 1DYQA 2EXDA 4DUZL 1BOSA 1ENCA 2M9VA 2XTIA 2PPBC 2DNCA 2XGTA 1KNEA 3N52A 4LUZA 1BCPC 1HZBA 4FF4A 3E6ZX 4HSVA 4BBRB 5IP9G 3M7NA 5IGBA 4N9TA 1PA6A 4B3RL 3KDFA 3BS1A 3F2BA 1JC7A 1ZYRC 4UDUC 5IGEA 3FVQA 2FHTA 3HGBA 1LACA 1U4LA 5EPLA 3I2ZA 1TQOA 5GAEC 5KIXA 5FLMH 3PSIA 1VMCA 4DR6Q 2SNSA 4QB4A 2FXQA 2PI2A 2RCFA 1STAA 4DK6C 1HNXL 1CA5A 4UAIA 2R92B 1Z47A 4XQNA 1EIGA 1VQOA 3CC2A 3MZ5A 5FK9C 2BDNA 3ULPA 3GD7A 1TWCH 1VQHA 4DGZA 2X69A 4HJ9A 1D6EC 2F0TA 3MHBA 1WTRA 1S72A 1X3GA 2CQAA 2ZTDA 4R8NA 2Q8IB 1EU3A 1R4PB 4DV6Q 5EGTA 3H0GB 1PDQA 4E6IA 1GUGA 3BZDB 3K6OA 2CWPA 1JJGA 4X3KA 2B63B 4IN3A 3K5MA 1C7YA 4A3EH 2E5LQ 1QVCA 1VQGA 3OOCA 4ZKCB 3K7AH 1PHJA 3PO3H 4QUFA 2K03A 1FGUA 4JI3L 2EYMA 5BN5A 1L2FA 2PNRC 4XXEA 4L8JA 3T1YL 2BDOA 2CFMA 3KYHC 4EQ5A 2C35B 3GTJB 3M4YA 2EDGA 2XWJB 1SMYC 1XMOL 4LFAL 3NENA 3HOXG 2L9HA 1WTVA 3VR2A 1BKBA 4J15A 2PO4A 5D65A 1RHPA 1JOOA 2RSNA 2EY2A 3CMAA 1PH9A 2A73B 2NVXB 1UE6A 2J0TD 2WAQB 3CMEA 3PF4A 3W1BA 2P5ZX 2DY8A 1TS3A 2XSCA 2ZXPA 1J8IA 2EY1A 3PIO3 2WB1B 3A56A 3D4RA 3IL8A 3D6CA 4DAYB 3U58A 1AW7A 2R93B 1AN8A 4BWGB 3K5LA 1N36Q 1H9SA 1WCMB 2F0LA 4ODGA 1TWGH 5I2XA 5CV4A 2QGQA 4U673 1QZGA 2NVTH 4BBRG 1GKHA 1J5EQ 2I46A 3NUCA 1IBMQ 2JA8H 1I4RA 3I72A 4JBKA 1Y1VH 3I56A 4QY7A 3GTLB 1ESRA 2LKVA 1C9OA 2I5LX 4J1MA 4CDDC 4HEDA 5ISRA 1R9TH 4JYAQ 1H9KA 1HRJA 5FLXE 4DR6L 2B2YA 5JEAG 2CW0D 4KMUC 5E3FA 1U0LA 5JJLA 4L63B 3R8BA 3HOZH 4GKJQ 2R92G 3A8KE 4CJ0B 1N34Q 2Z6KA 2NZHA 3J80L 1X3QA 3DXJC 2KHIA 2QW7A 4C1NK 4M1UB 5C4XB 1F77A 4I7AA 4K6DA 2E2JH 2C5CA 4FF2A 2G5DA 3CC7A 1F2YA 4UP7A 1PMRA 2MJ8A 3OIPA 3ULJA 1STNA 1VF7A 2LSSA 1E24A 4NXNL 4XTCS 3HS0C 1MKHA 3T4AC 4IQZA 4KN7C 4DV6L 2JA6H 4AQYQ 4FDBA 3A5UA 3FKIH 1HNZQ 3I4NB 1V1OA 1O7YA 2BOSA 3PIOA 3MAQA 1B50A 3HP3A 3RLFA 2VUMH 1CK1A 4PZ7A 2F0GA 4DR2L 4H13C 3S15B 2F0KA 1T5XD 4IUUA 3S1MB 4LUOA 3T1HQ 2E5LL 1NMFA 3KJPA 2WKCA 3OYYA 1TWAB 5DEHA 5JEAJ 3PUWA 3CQZB 1L1OA 3PCOB 4LK1C 3EIVA 1NCVA 3KLSX 2EXZA 1GUTA 4POGA 2B39A 3H3VC 4CKEA 3CC4A 1K0RA 1CQFA 4TSSA 4GLAC 2K7VA 4OL7A 4POFA 1IYUA 2PMZE 3UI2A 1K8MA 2WAQG 1GJXA 2BE5C 2HDMA 2WB1G 4ALPA 1F9PA 4A3FB 2UUAQ 2R93G 2FFKB 1BF4A 4QF4A 5BR8L 2IPKD 2F0VA 3CCEA 1JQYD 3C46A 3S16B 1B3AA 3T56B 3S17B 2JA5B 1RKNA 3A0JA 1WCMG 3M9BA 1LTID 2NWGA 1SNDA 4OWTB 1BNZA 1Q86C 2B29A 1P16A 4WJ4A 2QDLA 1JB3A 5C4JH 1J5EL 3LWUA 5IYCG 3NK9A 3AFPA 3I4MB 1A2TA 1ENAA 2QDBA 1EOVA 2WINB 3GTPB 3DWPA 1C4QA 2ENBA 3PMFA 3I55A 2PMZB 3PV0A 2E2HB 3DLLA 1FR3A 4MTKA 4BBSB 1I5FA 4CDFC 3L3OC 3OIQA 1ET9A 3LGJA 2R7DA 3RN5A 4FXGC 4DR5L 1N34L 1QVGA 2YV5A 4IFDG 2WP8J 2K5QA 5K5PA 1JB7A 2PZTA 5C4XG 2A69C 2D5DA 2JEAI 4DR3Q 3K59A 1JJCB 1YJNA 2JA7H 4DF7A 1VQ5A 2IY5B 3FPPA 1CTMA 4MN3A 2B2UA 3GTOB 2F0MA 4KJNA 1IBLQ 4AQYL 4QMGA 3H15A 4DNTB 3I4NG 3STBD 1HNZL 4G4KA 3ERQA 3R2TA 1DD2A 3SE0A 3E9IA 1UNSA 2K1BA 5LMNL 1KL9A 1SSOA 2RA4A 5DM73 5H1SE 1HUNA 1GM5A 5LL6X 3DWAA 3Q23A 4A76A 1X6OA 2UXBQ 2KENA 5C5LA 1SFOH 4C3JB 4ILWA 4JC0A 3HZXA 2F1MA 4AYBB 1YZ6A 2MNAA 3RLOA 3F2CA 1QB5D 2LFNA 3OW2A 1B8AA 4RKLA 1KQSA 3M4OB 2NN6H 3VYRA 2JYOA 4JK1C 5GADC 3T51B 1RODA 4IPGA 4IFDJ 3CU7A 3DEOA 4LF6Q 1PFBA 4DV3Q 2YU9B 1QCBD 1Q8KA 3U50C 2R7ZH 5J39A 1O7LA 4YWLA 1LT6D 2ZTEA 3MXNB 4ZK9B 5CBAE 2K01A 4B9WA 3EFXD 1JE5A 4XIGS 2NN6I 5ELBA 5IIFA 4A3FG 2UUAL 1EYDA 3IKJA 1QNKA 1KDCA 3LNNA 1RIPA 2L11A 2JA5G 2B3GA 2TMPA 1QUQB 5D3IB 4EQNA 2ICEC 1NY4A 4PMBA 2LXJA 1FD7D 1BVSA 3VR3A 4HIDA 4JI6Q 3I4MG 4O1NA 1DONA 2CHBD 2UUBQ 1EWHA 1W6JA 1PYWD 1TWFB 2DGYA 1H9JA 1ET6A 1AZQA 3KF8B 2E76C 2J4XA 2YYZA 4KV6A 4HIKA 4BBSG 4K0KQ 4V190 3CCSA 3LWEA 1F2LA 4A3JB 1WYDA 3WWVA 1JORA 2KVMA 4N8FA 4P74A 4DPGA 2LMCB 4NPSA 3D6WA 4JBJA 1EUJA 2Q2IA 3I70A 2CH4A 2F0NA 4BY1H 2L15A 1GUNA 3H3VH 4DR3L 3HOVH 1H95A 2M00A 5M3FH 1FNUA 1BDOA 5TSSA 3M3YH 1PH4A 1LT5D 2C9OA 1M8AA 4XQQA 1VQBA 1A2UA 1S5ED 1IBLL 2NBFA 1X9NA 1JE4A 2F0SA 5G3LF 4A93B 3X3NA 3TS2A 3STBC 5CC4A 3H3VI 1CQVA 1HHVA 2Z8LA 1HQMC 4LFCQ 1HZCA 2IX1A 2UXDQ 1K8GA 2YTYA 4RHSA 2D62A 3AEVA 4X65Q 4JI0Q 2ZXOA 2UXBL 4JVZA 1CZGA 3G6JB 4P71A 2NZ1D 1HZ9A 1VQAA 4AYBG 4YIJA 3GTMB 1PH8A 2PCFB 2QKIC 5DLQE 4WJ3M 1QNUA 1HNWQ 3TP8A 4BXXH 3UDGA 2BCOA 5JOBA 4JI7Q 4PMWA 2JJQA 1V1PA 4MZ9A 2EYFA 1QWYA 4XT1B 2L0CA 4YY3Q 3HOYH 1IKMA 5IYDG 3SGIA 3S1RH 4K2KA 4DK3C 5IODA 2PQAB 3S14B 4HJ7A 5KRUA 3GTQH 1J9OA 3D4DA 3GO5A 1VQ6A 4ZUIA 1XJVA 2R61A 2EY5A 4U68A 5GQOA 3A5ZB 1YEZA 1KC8C 3S1QB 1PZKD 1YI2A 1AE3A 5FO8B 1K0SA 2AQ2B 2I0QA 1GO3E 4L6TB 2K32A 4A3BB 3L0OA 4GLVB 4NB3A 1QILA 1G291 1T9HA 2KHJA 1SNPA 1PV4A 4K0KL 3RZDB 1WD1A 3AU7A 5C0XG 2OWOA 4Y7NH 2B2TC 4A3JG 2XVSA 1EIYB 1ILPA 2AUKA 5HY6A 1Q46A 1TS2A 2ZXRA 1PTOB 4LFBQ 2KQ3A 3K57A 3KDFB 3PUYA 4K2LA 4ULLA 1U9RA 1SEBD 2HT1A 1STGA 5M5YB 2AMCB 4HJ8A 2Z0SA 1GVPA 1W2BA 1VQNA 1DOMA 3ZYYX 1PH1A 4JI3Q 3G4SA 3KK7A 2DY7A 1MI2A 3KBXA 5I4DA 5KNCA 2K52A 5D14A 1IL2A 1F9RA 1K83B 2K4KA 1TWHB 4DXFA 2N88A 1KXLA 2PNHA 3SK5A 1I4PA 1WJJA 1WVLA 3NXWA 1MBYA 1NR2A 2K33A 4L5QA 5C5MA 1PVOA 2PQEA 1BR9A 3S2HB 2Z1CA 3C1EA 4PMCA 4LFCL 5HURA 4KJOA 3GTJH 1X65A 3MA2B 2A6HD 2J7ZA 4R4OA 4DR4Q 2MQHA 4X65L 4JI0L 4XDXA 3PUVA 1SNOA 2KJXA 5A35A 3HOUH 3ER0A 3J7A5 4IUQA 3D31A 3HFZB 4O0AA 4LWCA 4HMJA 2MGSA 4LW1A 5JPNC 4QCLA 4DV0Q 2F4VQ 3L9AX 5C0XJ 5D3DA 4OO1G 1SYDA 1H9MA 1HNWL 1V1QA 1ZKOA 3BVGA 2N3SA 1TKWB 3WDNA 4QIWE 1GUOA 4JI7L 1N33L 1X55A 1XTCD 2E2DC 2N78A 4DV2Q 4KHVA 4LF4Q 5IE8A 1QG7A 3BZCA 4CKBA 5C44B 4YY3L 2KCCA 4KD4A 3GTKH 1X3PA 1Y1WB 1K73C 1S5CD 4FP5D 2DJGC 2L5TA 2F0WA 3NBIA 1YNND 5IYBH 3F8TA 2F0IA 1V43A 1VS0A 5GROA 1A0IA 1PH6A 5E4XA 1EZ8A 1I4HA 1LTGD 1FVIA 4PG3A 1PH2A 1SROA 4A3BG 2A68C 2RF4A 2JP1A 2HCCA 4NXNQ 1H9SB 2SNMA 3L7ZC 2UUCQ 3KF6A 1T5EA 3UDXA 3SEBA 2F0QA 3CD6A 3ULLA 1DOKA 1D2BA 3V96A 3EBEA 4LFBL 2N49A 4DR2Q 1XNQQ 4JI5Q 3CRKC 4S3SA 2B8GA 4KK7A 3R3OA 1EY9A 2A5HA 4I65A 3W1GA 2NTSA 3I4NH 1Y14B 1A15A 2XRSD 4MTNA 1D5MC 1I3QH 3IRBA 4A3KB 1M1KC 2E2IH 5I9OA 2OF1A 4CDCC 5KYIA 3QB3A 1EYAA 1IYVA 5FJ8H 1UE5A 1Y8NB 2D2CC 3U9SA 5M3MH 4JPBW 4IOCA 4IPCA 4C3HH 1KD1C 1PTOD 5IGFA 4MHEA 2G9HD 2HQEA 1Q12A 5HGTA 1ESFA 4A3DH 4HIMA 5EPKA 3D4WA 4UHVA 2EYHA 2EY6A 4X3SA 3TZUA 2Z6BA 1PRTC 4H7BA 4HN7A 1VQ8A 1SYBA 4DR4L 4C3IB 3RR5A 4NXMQ 1STBA 3J7YW 3QOLA 3VR4A 4P75A 3CCJA 3K0XA 3T53B 2LY7A 2VQEQ 5BR8Q 3CF5A 3VA7A 4DV0L 1EY8A 2QILA 2F4VL 3J81i 1CSQA 3HG9A 4GN4B 4NDXA 3HKSA 1I6HH 2HCIA 3H09A 3NPPA 3NWTA 4ZRZA 3W2DA 3DMUA 3UE0A 5M5XH 5C3EH 3CCRA 5CV9A 4DV2L 3OWEB 1JJ2A 4LF4L 4JOIC 4F88A 4F7XA 3BDLA 5C44G 4I7ZC 4DA2A 1S4ZA 3NSWA 1B9NA 4ZLTF 1EIFA 1CA6A 5JJKA 1L1OB 1VQKA 1Y1WG 2RHQB 1F9QA 2O2LD 4RMFA 2VL6A 4DV5L 1G6ZA 3S1NH 5IGGA 1WTXA 2VB2X 1K3RA 2GA4B 3S9WA 4JBWA 1D5ZC 2JSOA 4A3GH 3IFDA 2NTTA 3K7UC 2AUJD 4DNIA 2F0OA 3M7GA 4K5WA 4DR5Q 1FJGQ 5IOCA 1NNXA 1HH2P 1MD2D 4BBSH 2N8NA 5EQ0A 4APVA 2B8FA 4PQXA 3K80C 3D8GA 3E0JA 1A3TA 5AFWA 1G6PA 3G48A 1OO9B 1TIID 4DR1Q 2Q2UA 5JAVA 2NVQH 1TWCB 1E2VA 4LNQA 1B4OA 3I73A 2VS1A 4JW0A 1SE4A 2GVBA 5AJ3Q 1RJTA 2UUCL 1KRSA 1SNMA 2L4NA 2X6GA 4CBVA 3H0GG 2DN8A 3U4ZA 1V9PA 3MTSA 5CV8A 1QOHA 5LMNQ 3RNUA 3L2PA 1XNQL 4JI5L 4QJFA 2B63G 4YHHQ 5I6YA 4KHZA 4A3IB 2A1AA 4A3KG 3ERSX 4A3EB 1KIXA 2MO0A 1E0BA 3K7AB 3PO3B 2RKSA 1X3FA 3P20A 5M5WH 1W6KA 4B3MQ 2JN4A 4ID6A 1U4MA 2JXMB 1TVXA 1CI3M 1JCKB 2HQLA 3QJYA 1SE2A 2HIVA 3AB9A 3X3MA 1NR4A 4OIJA 1HFNA 1UE1A 2G9DA 3J80E 5BN4A 2EVBA 1Z9FA 4C3IG 4NXML 3EQLC 4G7ZC 4XYQA 3BDCA 1QJOA 2NVYH 1GOZA 3CHBD 2YU9H 1UEAB 2VQEL 4GNXC 1S40A 3Q0AA 1D8LA 1EY7A 3QIAA 4IJLA 3TS0A 2WFWA 2Z4HA 2CH4W 4P2CB 1PH3A 4RFBA 1KLUD 1HUMA 1Y8PB 3E0EA 4JI2Q 4A3MH 4CDEC 5IT9c 1TWGB 1WTHA 1OTCA 4FXDA 1GUSA 1BBWA 1EWCA 1EY5A 2NVTB 2JA8B 1LABA 2RVLA 4A3LG 1Y1VB 5ELDA 1CHQD 4LF8L 1ML0D 4X66Q 2CCZA 2CW0C 2AWOA 1JWUD 5EBDA 1NE3A 1O7IA 2OT2A 4R4CA 4X3UA 4GOPA 2MFIA 3CCQA 4DAPA 1FJGL 2RQXA 3HRZC 4EVOA 1HA5A 4Z9CB 1LYLA 2H4OA 1SYEA 4HTHA 2K5NA 4BA2I 3HOZB 1IW7D 2K5WA 2QEXA 2D9UA 4OWXB 1G2TA 1PZJD 4DR1L 5EBCA 2UXCL 1U4RA 2A6ED 3J81j 2E2JB 5AJ3L 1K28A 3G6EA 1VQDA 1YJWA 2VQFL 1MJCA 3CPFA 1LT3D 4HJ5A 4IO9A 1PLFA 2JA6B 3GTGH 4FF3A 3FKIB 2EYJA 2I5MX 1I50H 2RDGA 1IKLA 1NJIC 4YHHL 2VUMB 3LX0A 4JG2A 1ZXTA 1LTAD 4A3IG 1CKOA 2Q2HA 5LMNW 4BY7H 4OIKA 1AH9A 2JEBI 1KRTA 1RTOA 4A3EG 4H02A 2VY3A 1BCPB 2RSOA 4KN4C 3PO3G 2R6GA 3PO2B 3HOWH 2B2TA 4B3ML 3BYTB 4BS9A 2ATWA 1AE2A 2IHFA 1SYGA 1MSGA 1EY0A 1O7ZA 1LM0A 4OWWB 4NP5A 4OO1H 3S2DH 4GN5A 1K8OA 1YBYA 4LJZC 1Q90A 2EJGC 5IP9H 1KDAA 3I90A 2QA4A 3RZOH 3DEPA 1CFMA 2F52A 3NBHB 4X62L 1LLRD 4PZ8A 4C2MH 2KOLA 3P7JA 4B3SL 5IGDA 3R2IA 4OO1I 3SK4A 3Q6SA 1XXGA 2E8GA 3BJUA 1UAPA 3A74A 3U4VA 2D0PA 4JI2L 1C8CA 1E2WA 4KKTA 4HMIA 4R4TA 5LL6S 1IXRA 2BA1A 3EN2A 3HKZE 2B2WC 1STEA 3TBIB 4YWKA 4CKCA 1OXTA 1CUKA 2AWNA 2JA8G 3I4LA 3Q24A 1Y1VG 4DV7Q 3MVVA 2OEOA 5JJZA 4RCNA 1CSPA 1BO0A 3WOEA 4X66L 1LO5D 1I6VC 2ZT9C 3V2TA 1A6XA 4JV5L 1V1PB 1XMQL 4DV1Q 5FOBB 1SR3A 1VQCA 5IWAQ 3GV6A 1B2TA 1AEXA 1I4GA 2DJFC 1XPRA 3DWQA 1MGSA 2O4XA 2PW5A 4EQOA 4IZ8A 4OXPA 3PIPA 1H9RA 1OXVA 2V1CC 3I7FA 1BQQT 4J8QA 2OQ0A 1E1OA 5EKIA 1SJED 2JA7B 2MUYA 2K5DA 1PFSA 1KTKA 3F2DA 5IP7G 3OW7A 2ZJQA 1KAAA 4B3TQ 4NKLA 1K8AC 2DNEA 2JA6G 3QOJA 1MHWC 3J80i 4KY5A 3CPWA 3HOXH 2VUMG 1KNAA 3U9OA 4C3JG 4OGQC 4DXGA 1QVFA 5ELOA 2B2VC 3MWYW 2DUDA 1SFOB 2ZJPA 2Q2TA 4KLKA 4NMZA 4HCEA 2VXWA 3PO2G 1EQQA 5IT9L 4TKOB 1YNJD 1FL0A 1II3A 3K5NA 4OX9L 4KHPL 1UEBA 1N33Q 3AQQA 3KOJA 4HAEA 2V4DA 1JICA 1HR0L 1DJRD 5C3WA 5KNBA 1K9MC 5EKKA 4GZYC 5FLXc 4BBRH 3NTIA 4A75A 2R7ZB 3KF8A 1L0WA 1BCPD 1CHPD 1UE7A 2KECA 5KNDA 2BH2A 5C44H 1JOQA 5JVH3 2RHSB 4IPDA 1VMPA 4JI1L 2Z4IA 3CP0A 1HTLD 4AH6A 3VYUA 1ZYRD 1OXUA 3NQTA 4TRDA 1SAPA 1EOTA 4FNFA 2EIFA 5JEAH 4B08A 4ZAIA 1WTOA 2JA9A 1TXYA 2H1EA 3P75A 2R92H 4HCSA 3CRLC 2WV6D 4KD3A 1YHBA 1PRTF 1YNXA 3SDZA 3CXCA 1NUCA 1A62A 1R4QB 1RD9D 4DV7L 2QF7A 4FF1A 3T16A 3TN2A 1XNRQ 1TR5A 4IJHA 3SVMA 1EQTA 1Y69U 4LF9L 4N9PA 2VNUD 4Y52H 4DV1L 2IHEA 2AQ3B 1LTTD 4J6HA 5IWAL 4KY7A 1EL0A 3H0GH 4JOIA 4RGOS 1K3BC 1VQJA 4X6AH 1ICFB 2L12A 3TRZA 4HR7B 3OMCA 4QL5A 3UDFA 4BY1B 2K5HA 5GAGC 2B63H 1EYCA 4CJ2C 3HOVB 5J22A 2AHOB 4ME3A 2JA7G 3H6MA 3BYYB 5M3FB 3TMEA 5E7NA 3M3YB 2ZJRA 1X54A 3JAMc 2ZM6L 3WOFA 4B3TL 4DUYL 3VR6A 4A93G 2IJ0A 2FMCA 5E4WC 1EFWA 4YCVA 4TVAB 4XYOA 2F0EA 3ND8A 4NW2A 2F0FA 1GHJA 1CKNA 1SE3A 3KF6B 4JI8Q 2ID0A 1RTNA 3D0FA 1SMYD 4DV4Q 4JI4L 1B7YB 5EAYA 2NVXH 2HDLA 1B70B 4YWMA 2X6LA 2F0JA 1WFQA 1S5FD 1VCIA 1RL2A 1A8VA 5JPMC 3SR1A 3J7AF 1N32Q 1B9MA 3DHQA 2Y0SE 1YNJC 2R93H 1B1ZA 1PFMA 1TS5A 1V8QA 3QG1A 4OELB 2ASBA 2NN6G 1HQRD 5CR3A 1AFPA 4IALA 1WCMH 2IX3A 4LF7L 3OPOA 2YTXA 1Q8IA 4DAMA 5IY0A 4K8JA 4DV5Q 1XX8A 3DUZA 4DFAA 2F3IA 2R7ZG 1RDPD 5IYCH 2ZTCA 3HOYB 4G7OC 3MXGA 1O80A 3QO2A 3GTLH 1HJPA 2QEJC 3S1RB 1XYIA 4A3LH 1VQEA 3GTQB 2WACA 2JE6I 3I3CA 4PZ6A 4TQUS 4LF5L 1G91A 1VQFA 1PTOF 1Y8OB 3OSOA 2Y0SB 4EGVA 1A3VA 1SNQA 4QIWB 4P73A 2PYKA 1TT2A 3EA6A 3A8IE 3C2PA 1FNVA 5KYLA 3OWFA 2EQSA 3OMGA 4IFDH 1GUWA 1XPOA 3K81C 4GNXA 5LHY1 1PH7A 2SOBA 1Q7YC 2LXKA 5C4XH 5BN3A 1XNRL 3GQBA 2PZUA 1IBKQ 1D1IA 3Q8DA 3K5OA 1Q81C 1VF5C 3PGZA 2E74C 1X56A 1BXTA 4LUVA 4N8X1 1XWEA 4L5SA 4DU9A 4Y7NB 4O42A 4IFDI 3BVMA 5I9PA 2XWBB 4EQPA 3V05A 4G7HC 1A63A 2VZAA 2ALYB 3OHXC 5CGKA 3TEHB 1SXTA 2CQOA 1LV9A 4IUPA 3MEHA 3W5OA 4BY1G 2K04A 3TP6A 3S15H 3AYHB 5L37A 1EY4A 2WAQE 3HOVG 3S1MH 4GKKL 2IW3A 5M3FG 1JR0D 4A3IH 4DR7Q 1TS4A 3NQIA 2ICIA 2WB1E 2KBNA 5NUCA 2EJFC 3EVQA 1TWAH 1D7QA 3A7AB 4OHJA 3FPUB 1GXDC 3CQZH 1G51A 1SNCA 5FLXL 1XTDA 2A6HC 1FGBD 1I4XA 4KKUA 1NMGA 4ZCKA 4JI8L 1WTPA 5CV7A 1ILQA 4DV4L 5FO9B 2AKWB 2IX0A 4CGYB 1J6QA 1MIUA 1N8RC 2I07B 4UP9A 3NELA 2RCNA 1Q82C 3HOUB 2YTVA 1PYSB 1BUVT 3QWNA 4RA8A 1IZ6A 2EYOA 1N32L 2BE5D 3GV3A 2RDHA 5HGQA 1E3PA 5EPJA 4A3FH 1BBXC 4FYDA 4ME5A 1F2MA 2F3WA 2MP1A 4LMQD 4BXXG 3URYA 2XRQD 4DKAC 3S16H 3C3LA 3S17H 2JA5H 1M90C 3BG3A 1ICWA 4KI0A 1B44D 3VR5A 1IYJB 1EWIA 4YCUA 4LF8Q 3HOYG 3FHWA 3ZJYC 3I4MH 1IHZA 3GTKB 1TY2A 3MXPA 1SMXA 1U5KA 3GTPH 4R4QA 1Q1BA 4UY8C 1YNNC 2E2HH 2O5JC 1YIJA 4A3CG 2XIWA 2KCTA 4X62Q 1B3QA 2A19A 1DOLA 4YCWA 2XN9C 5ELNA 3A7LA 1UWVA 1ENFA 2Y0SG 1ZEQX 2F4IA 1JWMD 2F03A 2JK8A 2UXCQ 5C4ZA 1KLGD 5CYUA 3TDQA 1B53A 4M8AA 4Q5VA 5K36G 4R8IA 3JAML 3E3XA 2R7FA 3KLWA 2R3ZA 5T1GA 1CM9A 4CJ1B 2VQFQ 1SYCA 1EIHA 1MJEA 1LTSD 1IBKL 1WTQA 3I8ZA 5I2YA 2A69D 2OTLA 1EEFD 3ONAB 2L55A 2EJMA 3CCUA 3KBGA 3GTOH 2B2WA 5IP7H 3ND9A 4RH6A 2O5IC 2E75C 3VA5A 4DAYA 4K8IA 3F2UA 3EJIA 1TY0A 2K14A 3M85A 2PZWA 4GOPB 1I3QB 2E2IB 4AIMA 1BBUA 3NE5B 4HSPA 3FP9A 2Z9HA 4C3JH 3NHHA 2KCNA 1SYFA 4DR7L 4IOAA 1PTOC 3FEWX 1WI5A 1IL8A 3IFTA 2HIXA 2SDFA 4K5XA 5M3MB 3BVZA 1Q1EA 4C3HB 5ELEA 1FNWA 1EQRA 2NUCA 2F0HA 3PO2H 1U4PA 1OXXK 3J7AV 3M4OH 4A3DB 4IUNA 2EZVA 2HUGA 1YVCA 1NTGA 3N6RA 4HJAA 2KA7A 2NYZD 4H0LC 4C1NI 3J81c 3HOUG 3TP5A 3JAME 1VQ4A 4B3SQ 3C1FA 5IYDH 2GVAA 5M9OA 4X64Q 4IUVA 3TQYA 1Q3LA 4DK0A 2OXPA 2RDFA 1EQVA 1NSNS 3G7LA 1N9WA 4R9WA 2VW9A 2FJ2A 1G8ZD 2K28A 1I6HB 2KHSA 3G71A 4BA1I 1L0YB 1F2ZA 2K05A 2I5HA 2EPBA 5M5XB 5C3EB 1N36L 3ICEA 2Q8TA 1XPUA 3P1HA 2B2VA 1SRUA 2PW7A 2NB0A 5LMUQ 4MIUA 2MHVA 4RWSC 2ES2A 1SJHD 2BA0A 1R9TB 3S1NB 4JV5Q 3CAMA 4PNYA 5FLMG 1HZAA 4IURA 3BDOA 1IBML 1XMQQ 1TWFH 1VDZA 3F1ZA 4FXKC 5ELFA 4A3GB
chains in the Genus database with same CATH topology
2OQ0A 1E1OA 4UP8A 1YITA 4R4OA 4DR4Q 1TWGH 2MQHA 1PFSA 3BZKA 4X65L 5IYBG 3F2DA 4JI0L 5IP7G 3PUVA 4A3JH 2QGQA 1VQPA 2ZJQA 3OTOQ 1QZGA 4B3TQ 3ER0A 3HOUH 2NVTH 4BBRG 1GKHA 3D31A 3HFZB 1K8AC 1J5EQ 4O0AA 4JYAL 3KJOA 4LWCA 2JA6G 4LW1A 1IBMQ 2JA8H 1E1TA 4P72A 1C0AA 4DV0Q 4JBKA 1Y1VH 4A4IA 3I56A 4QY7A 5C0XJ 3J80i 2F4VQ 4OO1G 1C9OA 2I5LX 3DM3A 3CPWA 1YHQA 1HNWL 1V1QA 4GKJL 3HOXH 2VUMG 2N3SA 4QQBX 1R9TH 5C0XI 2HHHQ 4JYAQ 4QIWE 4JI7L 4DR6L 1KHIA 1N33L 5JEAG 1X55A 1QVFA 4AYBE 5ELOA 2N78A 4DV2Q 1U0LA 2DUDA 2ZJPA 2Q2TA 4KLKA 5IE8A 3BZCA 4LF4Q 3UE1A 5JJLA 1JT8A 4GS3A 3HOZH 3PO2G 4YY3L 4GKJQ 2R92G 1EQQA 1N34Q 2D0OA 3GTKH 4L5RC 4A93H 1K73C 2Z6KA 1FL0A 2NZHA 4OX9L 2KHIA 4KHPL 1UEBA 1N33Q 2K75A 3AQQA 3CCLA 3KOJA 3CCMA 1WOCA 2E2JH 1HR0L 4EX5A 3CC7A 4UP7A 1K9MC 3ULJA 5IYBH 1EYGA 3F8TA 3BU2A 2LSSA 5FJ8G 1E24A 1V43A 2OCEA 1VS0A 4XTCS 4NXNL 1MKHA 5GROA 1A0IA 5FLXc 4BBRH 4A75A 1PH6A 1W3SA 1L0WA 4OX9Q 4KHPQ 4RG1A 4DV6L 2JA6H 1SE8A 4AQYQ 1VQ7A 5M3MG 4FDBA 5JJIA 1UE7A 3A5UA 3T1HL 3GTMH 3FKIH 1FVIA 4PG3A 1PH2A 3RN2A 1SROA 1HNZQ 2BH2A 5C44H 1HR0Q 4A3BG 2RHSB 4IPDA 2RF4A 3PIOA 3B6YA 4JI1L 3RLFA 2VUMH 4PZ7A 3CP0A 4AH6A 4A3DG 4DR2L 4NXNQ 1OXUA 3L7ZC 2UUCQ 1S3OA 3KF6A 3M4QA 2EIFA 1YHAA 4LUOA 3UDXA 3T1HQ 2GN5A 3E9HA 1I94Q 2E5LL 1NMFA 3CD6A 3KJPA 3ULLA 2JA9A 1TXYA 3OYYA 1JMCA 3CW2C 2R92H 3EBEA 4LFBL 4JCVE 4JI1Q 2N49A 2Z6KC 4DR2Q 1XNQQ 4JI5Q 4X64L 1YHBA 1YNXA 3I4OA 5JEAJ 3PUWA 3CXCA 1A62A 1L1OA 3PCOB 4DV7L 2CWAA 3EIVA 3S14H 4UPAA 3W1GA 1QZHA 1XNRQ 4POGA 3I4NH 1Y14B 1M1KC 4MTNA 3IRBA 1I3QH 3CC4A 1K0RA 2E2IH 4IJHA 1E7ZA 1VQLA 4GLAC 5FJ8H 2VNUD 2IT1A 4LF9L 1UE5A 3S1QH 4POFA 4Y52H 5C3EG 2PMZE 4DV1L 2IHEA 2WAQG 5GAHC 4OONA 5M3MH 5IWAL 5LMUL 4IOCA 3H0GH 4IPCA 4JOIA 2H5XA 4C3HH 1KD1C 2WB1G 4ALPA 3J7ZC 4A3BH 2OTJA 1Q12A 1VQJA 4X6AH 2UUAQ 2R93G 3TRZA 4A3DH 4HIMA 4LF9Q 3JC66 4QL5A 3UDFA 5BR8L 1ASZA 3CCEA 1GD7A 4MNOA 3M4PA 2K5HA 5GAGC 2B63H 3A0JA 4A3GG 4R1JA 1WCMG 3M9BA 3RZDH 2AHOB 4ME3A 4OWTB 1X3EA 1VQ8A 2JA7G 3HOZG 4DR4L 3RR5A 5E7NA 2B29A 1Q86C 4NXMQ 1P16A 4O2DA 2ZJRA 1X54A 4P75A 3JAMc 2ZM6L 3CCJA 4WJ4A 3OTOL 1DGSA 4DUYL 4B3TL 4A93G 3AFQA 5C4JH 1J5EL 5IYCG 3K0XA 1L1OC 5BR8Q 2VQEQ 3PUXA 3CF5A 4DV0L 3AFPA 1EFWA 2F4VL 1EOVA 4YCVA 4TVAB 3J81i 5M5YH 3I55A 3PV0A 1CSQA 4GN4B 4GLXA 3DLLA 3HKSA 2ZM6Q 1CKNA 3KF6B 3KFUA 1I6HH 4JI8Q 2ID0A 4DUYQ 2HHHL 3D0FA 4DV4Q 4JI4L 1YJ9A 3TREA 1B7YB 1I5FA 2BH8A 5EAYA 4IPHA 3CCVA 3UE0A 5M5XH 2NVXH 5C3EH 1NBWA 3LGJA 3FKIG 3CCRA 4DV2L 1JJ2A 4LF4L 1B70B 2R7DA 4JOIC 4YWMA 5C44G 1K83H 3RN5A 1CKMA 1WFQA 1TWHH 1VCIA 1RL2A 3UDIA 4DR5L 1A8VA 1N34L 1QVGA 1EIFA 2YV5A 4IFDG 5JJKA 1L1OB 1N32Q 1VQKA 1Y1WG 2RHQB 4DV5L 4RMFA 2Y0SE 2VL6A 2WP8J 3S1NH 4HIOA 2R93H 4JI4Q 1JB7A 1K3RA 2ASBA 3S2HH 5C4XG 2NN6G 3PUZA 2JEAI 4DR3Q 4JBWA 4A3GH 3JAMi 1WCMH 1JJCB 1YJNA 2UU9Q 4LF7L 2JA7H 3K7UC 4DNIA 1VQ5A 2IY5B 2YTXA 4DAMA 4DR5Q 1FJGQ 5IY0A 1QUQA 1HH2P 1OXSC 4DV5Q 4BBSH 2KCMA 2R7ZG 2N8NA 2F3IA 5IYCH 2ZTCA 4APVA 1VQMA 1IBLQ 4AQYL 3MEFA 3H15A 3K80C 1HJPA 1LTLA 3STBD 1HNZL 3GTLH 3I4NG 4LF7Q 1KAWA 1G6PA 1VQIA 3E9IA 3G48A 5LMNL 1E22A 1KL9A 4DUZQ 4DR1Q 2Q2UA 4A3LH 1VQEA 2NVQH 4LNQA 5H1SE 1LUZA 2VS1A 2GVBA 5AJ3Q 2JE6I 1GM5A 2UUCL 2JQOA 1KRSA 4PZ6A 4TQUS 4A76A 4LF5L 1VQFA 1X6OA 1HR0W 2UXBQ 2KENA 4GOPC 3H0GG 1SFOH 3U4ZA 1I94L 4JC0A 1V9PA 4P73A 2MO1A 4LF6L 1YZ6A 5LMNQ 3RNUA 2EQSA 4DV3L 2MNAA 4B3RQ 3L2PA 3RLOA 1XNQL 4JI5L 1Y1WH 1XPOA 4QJFA 3F2CA 3K81C 4GNXA 3VDYA 2B63G 3OW2A 1PH7A 4YHHQ 1B8AA 1Q7YC 2LXKA 5C4XH 1KQSA 4LF5Q 1CKNB 4KHZA 1XNRL 5GADC 2A1AA 1SLJA 4IPGA 1IBKQ 3Q8DA 4A3KG 4IFDJ 4A3MG 3ERSX 2NZOA 1Q81C 3PGZA 4LF6Q 1SN8A 1X56A 4DV3Q 1KIXA 4LUVA 4A3CH 1Q8KA 4L5SA 2MO0A 3U50C 2R7ZH 4IFDI 1HNXQ 4YWLA 3RLNA 2ZTEA 1X3FA 5M5WH 4B3MQ 3MXNB 4QGUA 2CKZB 1A63A 1JE5A 2VZAA 2NN6I 4XIGS 2ALYB 4A3FG 2HQLA 3TEHB 3S24A 2HIVA 2UUAL 2CQOA 3W5OA 4JI6L 4BY1G 3NEMA 2PI2E 4L5TA 4JBMA 1RIPA 2JA5G 3S15H 1PYBA 1UE1A 2B3GA 2WAQE 3AYHB 3HOVG 3S1MH 4GKKL 4R4IA 1QUQB 1Z9FA 5M3FG 2UUBL 4A3IH 1NY4A 2K5VA 4NXML 4DR7Q 2WB1E 2KBNA 2LXJA 2NVYH 1TWAH 1D7QA 2YU9H 1BVSA 3HKZG 4HIDA 4JI6Q 2VQEL 4GNXC 1S40A 1D8LA 3CQZH 1G51A 3I4MG 4IJLA 3TS0A 2WFWA 4GKKQ 1P8LA 1XTDA 1PH3A 2UUBQ 2DGYA 1NMGA 3KF8B 4A3KH 3E0EA 2YYZA 4JI2Q 4JI8L 4HIKA 4A3MH 4BBSG 4K0KQ 5IT9c 4DV4L 2AKWB 2IX0A 1J6QA 1MIUA 3CCSA 1N8RC 1OTCA 4UP9A 3J80c 3NELA 1WYDA 2RCNA 1BBWA 3WWVA 5J3BA 2YTVA 1Q82C 1PYSB 4P74A 4DPGA 1IZ6A 3K8AA 4NPSA 4JBJA 1EUJA 2Q2IA 1PH5A 3GDEA 3T1YQ 4A3LG 4GNXB 1N32L 5HGQA 1E3PA 4A3FH 1VQ9A 4LF8L 1XMOQ 4LFAQ 4X66Q 2K50A 4BY1H 2PQAA 1ASYA 4BXXG 2L15A 4DKAC 2CCZA 3S16H 2AWOA 3H3VH 4DR3L 2JA5H 3S17H 1M90C 1NE3A 3HOVH 1O7IA 4R4CA 4BY7G 4KI0A 2UU9L 4GOPA 2MFIA 3CCQA 5M3FH 4C3IH 1FJGL 3M3YH 1PH4A 1IYJB 2UXDL 1EWIA 1LYLA 2OQKA 4YCUA 1VQBA 3PF5A 4LF8Q 2K5NA 4BA2I 3HOWG 3HOYG 1IBLL 3FHWA 3ZJYC 2QEXA 4OWXB 1X9NA 3I4MH 1SMXA 3TS2A 1U5KA 3STBC 3GTPH 4R4QA 1Q1BA 2A8VA 4GN3B 4UY8C 3H3VI 2EXDA 4DR1L 4DUZL 2E2HH 2UXCL 4LFCQ 1HZCA 1YIJA 2IX1A 4A3CG 4X62Q 2KCTA 3J81j 1K8GA 2UXDQ 2A19A 2XTIA 4YCWA 5AJ3L 2YTYA 5ELNA 2D62A 3AEVA 4X65Q 2XGTA 3G6EA 1VQDA 1UWVA 1YJWA 2VQFL 4JI0Q 1MJCA 4LUZA 1HZBA 2UXBL 3CPFA 2Y0SG 4HJ5A 4P71A 4IO9A 3M7NA 5IP9G 1HZ9A 1VQAA 4AYBG 3GTGH 2JK8A 2UXCQ 1PH8A 1PA6A 4B3RL 3KDFA 2I5MX 3F2BA 5DLQE 5K36G 1I50H 4WJ3M 1HNWQ 3KLWA 2R7FA 3J7A5 1NJIC 4YHHL 2VQFQ 4BXXH 3I2ZA 4JG2A 5GAEC 3UDGA 4A3IG 1CKOA 2Q2HA 5LMNW 1MJEA 4BY7H 1IBKL 5FLMH 3PSIA 4JI7Q 4DR6Q 1AH9A 4PMWA 2OTLA 2JEBI 1KRTA 2JJQA 4A3EG 4H02A 4MZ9A 2FXQA 2PI2A 2VY3A 3CCUA 3PO3G 4DK6C 2R6GA 1HNXL 4YY3Q 3GTOH 3HOWH 3HOYH 1Z47A 5IP7H 4B3ML 5IYDG 1VQOA 3CC2A 3SGIA 3S1RH 2ATWA 1AE2A 2IHFA 4DK3C 2PQAB 4HJ7A 3GD7A 1LM0A 1TWCH 3ULPA 3GTQH 1VQHA 4OWWB 2K14A 3S2DH 3GO5A 3M85A 4GN5A 4GOPB 1VQ6A 4HJ9A 4AIMA 1XJVA 1YBYA 1BBUA 3FP9A 5GQOA 3A5ZB 1YEZA 4C3JH 1S72A 1KC8C 1X3GA 2ZTDA 4DR7L 5IP9H 4IOAA 2QA4A 1YI2A 1WI5A 3RZOH 1AE3A 4DV6Q 2F52A 2HIXA 3NBHB 2I0QA 1GO3E 4X62L 1Q1EA 4PZ8A 4C2MH 1EQRA 3L0OA 4GLVB 4NB3A 3PO2H 4B3SL 1G291 4OO1I 1OXXK 1T9HA 3M4OH 2E8GA 2KHJA 3BJUA 1PV4A 3A74A 1H95A 1YVCA 1NTGA 3U4VA 2CWPA 4HJAA 1JJGA 2D0PA 4JI2L 4K0KL 1C7YA 1N36Q 4A3EH 4R4TA 1QVCA 2E5LQ 1IXRA 1VQGA 5C0XG 2OWOA 2BA1A 3EN2A 3HKZE 4Y7NH 4A3JG 1EIYB 3K7AH 1PHJA 3J81c 3PO3H 3HOUG 5HY6A 1FGUA 1Q46A 1VQ4A 4B3SQ 4JI3L 4LFBQ 4YWKA 1OXTA 5IYDH 2GVAA 1CUKA 1L2FA 3KDFB 3PUYA 2AWNA 4X64Q 3T1YL 2CFMA 3KYHC 4EQ5A 2JA8G 1Y1VG 3TQYA 2C35B 2HT1A 4DV7Q 1CSPA 1N9WA 2AMCB 1XMOL 4X66L 4LFAL 3NENA 3HOXG 2VW9A 4HJ8A 2Z0SA 1BKBA 1GVPA 4J15A 1W2BA 1VQNA 3G71A 4BA1I 1PH1A 4JI3Q 3G4SA 4JV5L 2I5HA 3CMAA 1XMQL 1PH9A 4DV1Q 1UE6A 3CMEA 3PF4A 2K52A 3W1BA 1N36L 1IL2A 3ICEA 1SR3A 1XPUA 1VQCA 5IWAQ 2K4KA 1SRUA 5LMUQ 1KXLA 2PNHA 4DAYB 1WJJA 2ES2A 1XPRA 3U58A 2BA0A 4L5QA 4JV5Q 3CAMA 5FLMG 1HZAA 4OXPA 3PIPA 1PVOA 1IBML 1XMQQ 1TWFH 2V1CC 1OXVA 3F1ZA 4LFCL 3I7FA 3GTJH 1X65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OQ0 A;  1E1O A;  4UP8 A;  1YIT A;  4R4O A;  4DR4 Q;  1TWG H;  2MQH A;  1PFS A;  3BZK A;  4X65 L;  5IYB G;  3F2D A;  4JI0 L;  5IP7 G;  3PUV A;  4A3J H;  2QGQ A;  1VQP A;  2ZJQ A;  3OTO Q;  1QZG A;  4B3T Q;  3ER0 A;  3HOU H;  2NVT H;  4BBR G;  1GKH A;  3D31 A;  3HFZ B;  1K8A C;  1J5E Q;  4O0A A;  4JYA L;  3KJO A;  4LWC A;  2JA6 G;  4LW1 A;  1IBM Q;  2JA8 H;  1E1T A;  4P72 A;  1C0A A;  4DV0 Q;  4JBK A;  1Y1V H;  4A4I A;  3I56 A;  4QY7 A;  5C0X J;  3J80 i;  2F4V Q;  4OO1 G;  1C9O A;  2I5L X;  3DM3 A;  3CPW A;  1YHQ A;  1HNW L;  1V1Q A;  4GKJ L;  3HOX H;  2VUM G;  2N3S A;  4QQB X;  1R9T H;  5C0X I;  2HHH Q;  4JYA Q;  4QIW E;  4JI7 L;  4DR6 L;  1KHI A;  1N33 L;  5JEA G;  1X55 A;  1QVF A;  4AYB E;  5ELO A;  2N78 A;  4DV2 Q;  1U0L A;  2DUD A;  2ZJP A;  2Q2T A;  4KLK A;  5IE8 A;  3BZC A;  4LF4 Q;  3UE1 A;  5JJL A;  1JT8 A;  4GS3 A;  3HOZ H;  3PO2 G;  4YY3 L;  4GKJ Q;  2R92 G;  1EQQ A;  1N34 Q;  2D0O A;  3GTK H;  4L5R C;  4A93 H;  1K73 C;  2Z6K A;  1FL0 A;  2NZH A;  4OX9 L;  2KHI A;  4KHP L;  1UEB A;  1N33 Q;  2K75 A;  3AQQ A;  3CCL A;  3KOJ A;  3CCM A;  1WOC A;  2E2J H;  1HR0 L;  4EX5 A;  3CC7 A;  4UP7 A;  1K9M C;  3ULJ A;  5IYB H;  1EYG A;  3F8T A;  3BU2 A;  2LSS A;  5FJ8 G;  1E24 A;  1V43 A;  2OCE A;  1VS0 A;  4XTC S;  4NXN L;  1MKH A;  5GRO A;  1A0I A;  5FLX c;  4BBR H;  4A75 A;  1PH6 A;  1W3S A;  1L0W A;  4OX9 Q;  4KHP Q;  4RG1 A;  4DV6 L;  2JA6 H;  1SE8 A;  4AQY Q;  1VQ7 A;  5M3M G;  4FDB A;  5JJI A;  1UE7 A;  3A5U A;  3T1H L;  3GTM H;  3FKI H;  1FVI A;  4PG3 A;  1PH2 A;  3RN2 A;  1SRO A;  1HNZ Q;  2BH2 A;  5C44 H;  1HR0 Q;  4A3B G;  2RHS B;  4IPD A;  2RF4 A;  3PIO A;  3B6Y A;  4JI1 L;  3RLF A;  2VUM H;  4PZ7 A;  3CP0 A;  4AH6 A;  4A3D G;  4DR2 L;  4NXN Q;  1OXU A;  3L7Z C;  2UUC Q;  1S3O A;  3KF6 A;  3M4Q A;  2EIF A;  1YHA A;  4LUO A;  3UDX A;  3T1H Q;  2GN5 A;  3E9H A;  1I94 Q;  2E5L L;  1NMF A;  3CD6 A;  3KJP A;  3ULL A;  2JA9 A;  1TXY A;  3OYY A;  1JMC A;  3CW2 C;  2R92 H;  3EBE A;  4LFB L;  4JCV E;  4JI1 Q;  2N49 A;  2Z6K C;  4DR2 Q;  1XNQ Q;  4JI5 Q;  4X64 L;  1YHB A;  1YNX A;  3I4O A;  5JEA J;  3PUW A;  3CXC A;  1A62 A;  1L1O A;  3PCO B;  4DV7 L;  2CWA A;  3EIV A;  3S14 H;  4UPA A;  3W1G A;  1QZH A;  1XNR Q;  4POG A;  3I4N H;  1Y14 B;  1M1K C;  4MTN A;  3IRB A;  1I3Q H;  3CC4 A;  1K0R A;  2E2I H;  4IJH A;  1E7Z A;  1VQL A;  4GLA C;  5FJ8 H;  2VNU D;  2IT1 A;  4LF9 L;  1UE5 A;  3S1Q H;  4POF A;  4Y52 H;  5C3E G;  2PMZ E;  4DV1 L;  2IHE A;  2WAQ G;  5GAH C;  4OON A;  5M3M H;  5IWA L;  5LMU L;  4IOC A;  3H0G H;  4IPC A;  4JOI A;  2H5X A;  4C3H H;  1KD1 C;  2WB1 G;  4ALP A;  3J7Z C;  4A3B H;  2OTJ A;  1Q12 A;  1VQJ A;  4X6A H;  2UUA Q;  2R93 G;  3TRZ A;  4A3D H;  4HIM A;  4LF9 Q;  3JC6 6;  4QL5 A;  3UDF A;  5BR8 L;  1ASZ A;  3CCE A;  1GD7 A;  4MNO A;  3M4P A;  2K5H A;  5GAG C;  2B63 H;  3A0J A;  4A3G G;  4R1J A;  1WCM G;  3M9B A;  3RZD H;  2AHO B;  4ME3 A;  4OWT B;  1X3E A;  1VQ8 A;  2JA7 G;  3HOZ G;  4DR4 L;  3RR5 A;  5E7N A;  2B29 A;  1Q86 C;  4NXM Q;  1P16 A;  4O2D A;  2ZJR A;  1X54 A;  4P75 A;  3JAM c;  2ZM6 L;  3CCJ A;  4WJ4 A;  3OTO L;  1DGS A;  4DUY L;  4B3T L;  4A93 G;  3AFQ A;  5C4J H;  1J5E L;  5IYC G;  3K0X A;  1L1O C;  5BR8 Q;  2VQE Q;  3PUX A;  3CF5 A;  4DV0 L;  3AFP A;  1EFW A;  2F4V L;  1EOV A;  4YCV A;  4TVA B;  3J81 i;  5M5Y H;  3I55 A;  3PV0 A;  1CSQ A;  4GN4 B;  4GLX A;  3DLL A;  3HKS A;  2ZM6 Q;  1CKN A;  3KF6 B;  3KFU A;  1I6H H;  4JI8 Q;  2ID0 A;  4DUY Q;  2HHH L;  3D0F A;  4DV4 Q;  4JI4 L;  1YJ9 A;  3TRE A;  1B7Y B;  1I5F A;  2BH8 A;  5EAY A;  4IPH A;  3CCV A;  3UE0 A;  5M5X H;  2NVX H;  5C3E H;  1NBW A;  3LGJ A;  3FKI G;  3CCR A;  4DV2 L;  1JJ2 A;  4LF4 L;  1B70 B;  2R7D A;  4JOI C;  4YWM A;  5C44 G;  1K83 H;  3RN5 A;  1CKM A;  1WFQ A;  1TWH H;  1VCI A;  1RL2 A;  3UDI A;  4DR5 L;  1A8V A;  1N34 L;  1QVG A;  1EIF A;  2YV5 A;  4IFD G;  5JJK A;  1L1O B;  1N32 Q;  1VQK A;  1Y1W G;  2RHQ B;  4DV5 L;  4RMF A;  2Y0S E;  2VL6 A;  2WP8 J;  3S1N H;  4HIO A;  2R93 H;  4JI4 Q;  1JB7 A;  1K3R A;  2ASB A;  3S2H H;  5C4X G;  2NN6 G;  3PUZ A;  2JEA I;  4DR3 Q;  4JBW A;  4A3G H;  3JAM i;  1WCM H;  1JJC B;  1YJN A;  2UU9 Q;  4LF7 L;  2JA7 H;  3K7U C;  4DNI A;  1VQ5 A;  2IY5 B;  2YTX A;  4DAM A;  4DR5 Q;  1FJG Q;  5IY0 A;  1QUQ A;  1HH2 P;  1OXS C;  4DV5 Q;  4BBS H;  2KCM A;  2R7Z G;  2N8N A;  2F3I A;  5IYC H;  2ZTC A;  4APV A;  1VQM A;  1IBL Q;  4AQY L;  3MEF A;  3H15 A;  3K80 C;  1HJP A;  1LTL A;  3STB D;  1HNZ L;  3GTL H;  3I4N G;  4LF7 Q;  1KAW A;  1G6P A;  1VQI A;  3E9I A;  3G48 A;  5LMN L;  1E22 A;  1KL9 A;  4DUZ Q;  4DR1 Q;  2Q2U A;  4A3L H;  1VQE A;  2NVQ H;  4LNQ A;  5H1S E;  1LUZ A;  2VS1 A;  2GVB A;  5AJ3 Q;  2JE6 I;  1GM5 A;  2UUC L;  2JQO A;  1KRS A;  4PZ6 A;  4TQU S;  4A76 A;  4LF5 L;  1VQF A;  1X6O A;  1HR0 W;  2UXB Q;  2KEN A;  4GOP C;  3H0G G;  1SFO H;  3U4Z A;  1I94 L;  4JC0 A;  1V9P A;  4P73 A;  2MO1 A;  4LF6 L;  1YZ6 A;  5LMN Q;  3RNU A;  2EQS A;  4DV3 L;  2MNA A;  4B3R Q;  3L2P A;  3RLO A;  1XNQ L;  4JI5 L;  1Y1W H;  1XPO A;  4QJF A;  3F2C A;  3K81 C;  4GNX A;  3VDY A;  2B63 G;  3OW2 A;  1PH7 A;  4YHH Q;  1B8A A;  1Q7Y C;  2LXK A;  5C4X H;  1KQS A;  4LF5 Q;  1CKN B;  4KHZ A;  1XNR L;  5GAD C;  2A1A A;  1SLJ A;  4IPG A;  1IBK Q;  3Q8D A;  4A3K G;  4IFD J;  4A3M G;  3ERS X;  2NZO A;  1Q81 C;  3PGZ A;  4LF6 Q;  1SN8 A;  1X56 A;  4DV3 Q;  1KIX A;  4LUV A;  4A3C H;  1Q8K A;  4L5S A;  2MO0 A;  3U50 C;  2R7Z H;  4IFD I;  1HNX Q;  4YWL A;  3RLN A;  2ZTE A;  1X3F A;  5M5W H;  4B3M Q;  3MXN B;  4QGU A;  2CKZ B;  1A63 A;  1JE5 A;  2VZA A;  2NN6 I;  4XIG S;  2ALY B;  4A3F G;  2HQL A;  3TEH B;  3S24 A;  2HIV A;  2UUA L;  2CQO A;  3W5O A;  4JI6 L;  4BY1 G;  3NEM A;  2PI2 E;  4L5T A;  4JBM A;  1RIP A;  2JA5 G;  3S15 H;  1PYB A;  1UE1 A;  2B3G A;  2WAQ E;  3AYH B;  3HOV G;  3S1M H;  4GKK L;  4R4I A;  1QUQ B;  1Z9F A;  5M3F G;  2UUB L;  4A3I H;  1NY4 A;  2K5V A;  4NXM L;  4DR7 Q;  2WB1 E;  2KBN A;  2LXJ A;  2NVY H;  1TWA H;  1D7Q A;  2YU9 H;  1BVS A;  3HKZ G;  4HID A;  4JI6 Q;  2VQE L;  4GNX C;  1S40 A;  1D8L A;  3CQZ H;  1G51 A;  3I4M G;  4IJL A;  3TS0 A;  2WFW A;  4GKK Q;  1P8L A;  1XTD A;  1PH3 A;  2UUB Q;  2DGY A;  1NMG A;  3KF8 B;  4A3K H;  3E0E A;  2YYZ A;  4JI2 Q;  4JI8 L;  4HIK A;  4A3M H;  4BBS G;  4K0K Q;  5IT9 c;  4DV4 L;  2AKW B;  2IX0 A;  1J6Q A;  1MIU A;  3CCS A;  1N8R C;  1OTC A;  4UP9 A;  3J80 c;  3NEL A;  1WYD A;  2RCN A;  1BBW A;  3WWV A;  5J3B A;  2YTV A;  1Q82 C;  1PYS B;  4P74 A;  4DPG A;  1IZ6 A;  3K8A A;  4NPS A;  4JBJ A;  1EUJ A;  2Q2I A;  1PH5 A;  3GDE A;  3T1Y Q;  4A3L G;  4GNX B;  1N32 L;  5HGQ A;  1E3P A;  4A3F H;  1VQ9 A;  4LF8 L;  1XMO Q;  4LFA Q;  4X66 Q;  2K50 A;  4BY1 H;  2PQA A;  1ASY A;  4BXX G;  2L15 A;  4DKA C;  2CCZ A;  3S16 H;  2AWO A;  3H3V H;  4DR3 L;  2JA5 H;  3S17 H;  1M90 C;  1NE3 A;  3HOV H;  1O7I A;  4R4C A;  4BY7 G;  4KI0 A;  2UU9 L;  4GOP A;  2MFI A;  3CCQ A;  5M3F H;  4C3I H;  1FJG L;  3M3Y H;  1PH4 A;  1IYJ B;  2UXD L;  1EWI A;  1LYL A;  2OQK A;  4YCU A;  1VQB A;  3PF5 A;  4LF8 Q;  2K5N A;  4BA2 I;  3HOW G;  3HOY G;  1IBL L;  3FHW A;  3ZJY C;  2QEX A;  4OWX B;  1X9N A;  3I4M H;  1SMX A;  3TS2 A;  1U5K A;  3STB C;  3GTP H;  4R4Q A;  1Q1B A;  2A8V A;  4GN3 B;  4UY8 C;  3H3V I;  2EXD A;  4DR1 L;  4DUZ L;  2E2H H;  2UXC L;  4LFC Q;  1HZC A;  1YIJ A;  2IX1 A;  4A3C G;  4X62 Q;  2KCT A;  3J81 j;  1K8G A;  2UXD Q;  2A19 A;  2XTI A;  4YCW A;  5AJ3 L;  2YTY A;  5ELN A;  2D62 A;  3AEV A;  4X65 Q;  2XGT A;  3G6E A;  1VQD A;  1UWV A;  1YJW A;  2VQF L;  4JI0 Q;  1MJC A;  4LUZ A;  1HZB A;  2UXB L;  3CPF A;  2Y0S G;  4HJ5 A;  4P71 A;  4IO9 A;  3M7N A;  5IP9 G;  1HZ9 A;  1VQA A;  4AYB G;  3GTG H;  2JK8 A;  2UXC Q;  1PH8 A;  1PA6 A;  4B3R L;  3KDF A;  2I5M X;  3F2B A;  5DLQ E;  5K36 G;  1I50 H;  4WJ3 M;  1HNW Q;  3KLW A;  2R7F A;  3J7A 5;  1NJI C;  4YHH L;  2VQF Q;  4BXX H;  3I2Z A;  4JG2 A;  5GAE C;  3UDG A;  4A3I G;  1CKO A;  2Q2H A;  5LMN W;  1MJE A;  4BY7 H;  1IBK L;  5FLM H;  3PSI A;  4JI7 Q;  4DR6 Q;  1AH9 A;  4PMW A;  2OTL A;  2JEB I;  1KRT A;  2JJQ A;  4A3E G;  4H02 A;  4MZ9 A;  2FXQ A;  2PI2 A;  2VY3 A;  3CCU A;  3PO3 G;  4DK6 C;  2R6G A;  1HNX L;  4YY3 Q;  3GTO H;  3HOW H;  3HOY H;  1Z47 A;  5IP7 H;  4B3M L;  5IYD G;  1VQO A;  3CC2 A;  3SGI A;  3S1R H;  2ATW A;  1AE2 A;  2IHF A;  4DK3 C;  2PQA B;  4HJ7 A;  3GD7 A;  1LM0 A;  1TWC H;  3ULP A;  3GTQ H;  1VQH A;  4OWW B;  2K14 A;  3S2D H;  3GO5 A;  3M85 A;  4GN5 A;  4GOP B;  1VQ6 A;  4HJ9 A;  4AIM A;  1XJV A;  1YBY A;  1BBU A;  3FP9 A;  5GQO A;  3A5Z B;  1YEZ A;  4C3J H;  1S72 A;  1KC8 C;  1X3G A;  2ZTD A;  4DR7 L;  5IP9 H;  4IOA A;  2QA4 A;  1YI2 A;  1WI5 A;  3RZO H;  1AE3 A;  4DV6 Q;  2F52 A;  2HIX A;  3NBH B;  2I0Q A;  1GO3 E;  4X62 L;  1Q1E A;  4PZ8 A;  4C2M H;  1EQR A;  3L0O A;  4GLV B;  4NB3 A;  3PO2 H;  4B3S L;  1G29 1;  4OO1 I;  1OXX K;  1T9H A;  3M4O H;  2E8G A;  2KHJ A;  3BJU A;  1PV4 A;  3A74 A;  1H95 A;  1YVC A;  1NTG A;  3U4V A;  2CWP A;  4HJA A;  1JJG A;  2D0P A;  4JI2 L;  4K0K L;  1C7Y A;  1N36 Q;  4A3E H;  4R4T A;  1QVC A;  2E5L Q;  1IXR A;  1VQG A;  5C0X G;  2OWO A;  2BA1 A;  3EN2 A;  3HKZ E;  4Y7N H;  4A3J G;  1EIY B;  3K7A H;  1PHJ A;  3J81 c;  3PO3 H;  3HOU G;  5HY6 A;  1FGU A;  1Q46 A;  1VQ4 A;  4B3S Q;  4JI3 L;  4LFB Q;  4YWK A;  1OXT A;  5IYD H;  2GVA A;  1CUK A;  1L2F A;  3KDF B;  3PUY A;  2AWN A;  4X64 Q;  3T1Y L;  2CFM A;  3KYH C;  4EQ5 A;  2JA8 G;  1Y1V G;  3TQY A;  2C35 B;  2HT1 A;  4DV7 Q;  1CSP A;  1N9W A;  2AMC B;  1XMO L;  4X66 L;  4LFA L;  3NEN A;  3HOX G;  2VW9 A;  4HJ8 A;  2Z0S A;  1BKB A;  1GVP A;  4J15 A;  1W2B A;  1VQN A;  3G71 A;  4BA1 I;  1PH1 A;  4JI3 Q;  3G4S A;  4JV5 L;  2I5H A;  3CMA A;  1XMQ L;  1PH9 A;  4DV1 Q;  1UE6 A;  3CME A;  3PF4 A;  2K52 A;  3W1B A;  1N36 L;  1IL2 A;  3ICE A;  1SR3 A;  1XPU A;  1VQC A;  5IWA Q;  2K4K A;  1SRU A;  5LMU Q;  1KXL A;  2PNH A;  4DAY B;  1WJJ A;  2ES2 A;  1XPR A;  3U58 A;  2BA0 A;  4L5Q A;  4JV5 Q;  3CAM A;  5FLM G;  1HZA A;  4OXP A;  3PIP A;  1PVO A;  1IBM L;  1XMQ Q;  1TWF H;  2V1C C;  1OXV A;  3F1Z A;  4LFC L;  3I7F A;  3GTJ H;  1X65 A; 
#chains in the Genus database with same CATH topology
 4UP8 A;  1YIT A;  3BZK A;  5IYB G;  5C0X H;  4A3J H;  1VQP A;  3OTO Q;  4JYA L;  2KEE A;  2K6A A;  3KJO A;  4K5V A;  3A8J E;  1E1T A;  4P72 A;  1C0A A;  1HFG A;  4A4I A;  1X32 A;  4ZKB B;  3CKI B;  3HEJ A;  1DZ1 A;  3DM3 A;  1YHQ A;  4C56 C;  4GKJ L;  3A55 A;  1AP0 A;  2NVQ B;  4QQB X;  4F8M A;  2HHH Q;  5C0X I;  2IWH A;  1KHI A;  4RGN A;  4DK1 A;  4AYB E;  1LTB D;  2AQ1 B;  1JT8 A;  2VB3 X;  3NTK A;  3W3A A;  4GS3 A;  1LT4 D;  3UE1 A;  3K58 A;  1I4Q A;  2F0P A;  1D5X C;  2D0O A;  4L5R C;  4A93 H;  2IL8 A;  2MPM A;  4OEM B;  2K75 A;  3CCL A;  4WFN 3;  3CCM A;  1WOC A;  3AMU A;  2LS0 1;  3H91 A;  3NWS A;  4RHR A;  4CHT B;  1EEI D;  4EX5 A;  3MFG A;  3BU2 A;  5FJ8 G;  2OCE A;  1EYG A;  3PIP 3;  1NAP A;  1AZP A;  1UUP A;  3TZD A;  1W3S A;  4OX9 Q;  4KHP Q;  2F0D A;  4RG1 A;  1SE8 A;  5JJI A;  1VQ7 A;  5M3M G;  5M5W B;  3T1H L;  3GTM H;  5CV6 A;  4C3H G;  2L1B A;  3RN2 A;  5KGU A;  3VYS A;  3K0Y A;  1HR0 Q;  3B6Y A;  4XT3 B;  4A3D G;  5J1Z A;  2B2Y C;  1TU2 B;  2QCP X;  1S3O A;  3KUP A;  3M4Q A;  4XQJ A;  1CT1 D;  1STH A;  1YHA A;  2GN5 A;  3E9H A;  2F3V A;  4ZUJ A;  1I94 Q;  1GHK A;  5I6W A;  1JMC A;  3CW2 C;  2NVY B;  5COR A;  4JCV E;  4JI1 Q;  2Z6K C;  4X64 L;  4RGM A;  3I4O A;  4V0B A;  2A74 C;  2CWA A;  1JOK A;  1QE6 A;  5EJW A;  3S14 H;  1Z6H A;  4UPA A;  1QZH A;  3IAY A;  1FYC A;  3D3R A;  4A3M B;  1E7Z A;  4RCO A;  5C4J B;  1VQL A;  2IT1 A;  3S1Q H;  1E2Z A;  2Q8R E;  5C3E G;  5GAH C;  3T13 A;  4OON A;  5DNF A;  5LMU L;  2H5X A;  1HCZ A;  4F87 A;  3J7Z C;  1WTW A;  4A3B H;  1PFN A;  2OTJ A;  1O78 A;  4H44 C;  4LF9 Q;  3JC6 6;  3SK6 A;  1ASZ A;  1GD7 A;  4MNO A;  2EOT A;  3M4P A;  4B9X A;  4A3G G;  4R1J A;  3RZD H;  1X3E A;  4IUT A;  3HOZ G;  4G57 A;  1IW7 C;  4O2D A;  3OTO L;  1DGS A;  3AFQ A;  1PTO H;  4FO2 A;  3E5S A;  3HKZ B;  1L1O C;  4WRD A;  3PUX A;  1SDF A;  3FRP B;  2A6E C;  3NP8 A;  5M5Y H;  4GLX A;  3KFU A;  2ZM6 Q;  3NTH A;  2F0U A;  3TSS A;  4DUY Q;  2HHH L;  1KDB A;  1BCP F;  2KUM A;  1YJ9 A;  3TRE A;  2BH8 A;  1PRT B;  3CCV A;  4IPH A;  5KEE A;  1NBW A;  3FKI G;  4DN4 M;  1DCZ A;  3A54 A;  1K83 H;  1CKM A;  1TWH H;  3QR8 A;  5C4H A;  3KLS A;  3UDI A;  3GTG B;  3TP7 A;  3MXN A;  1KAB A;  1I50 B;  1MSH A;  3MXU A;  4HIO A;  3RUZ A;  4JI4 Q;  5E1F A;  3RMH A;  3J81 L;  3NBH A;  3S2H H;  3PUZ A;  5T1I A;  3JAM i;  1WD0 A;  4BY7 B;  2UU9 Q;  5CV5 A;  4DAV A;  4PV1 C;  5DAU A;  1QUQ A;  1OXS C;  1DM0 B;  1Z7T A;  2KCM A;  4WOR A;  1ONL A;  3FDT A;  1VQM A;  3HOW B;  1EU4 A;  3MC0 B;  3MEF A;  3SXH A;  2KED A;  1LTL A;  4FVM A;  4LF7 Q;  1KAW A;  1VQI A;  1E22 A;  4DUZ Q;  1LTR D;  3S2D B;  1LUZ A;  4KY6 A;  2M2L A;  2JQO A;  4RAU C;  4ZQ3 A;  5C6A A;  4WJW A;  1HR0 W;  4GOP C;  1I94 L;  1EY6 A;  3KLR A;  2SEB D;  3RZO B;  1HPC A;  2MO1 A;  4LF6 L;  2EE1 A;  1A3U A;  4DV3 L;  4K14 A;  1EFI D;  4B3R Q;  4C2M B;  1CZW A;  1Y1W H;  3SK8 A;  3PQI A;  3VDY A;  4KKS A;  1PXU A;  4LF5 Q;  3I91 A;  3R93 A;  1CKN B;  3VYT A;  3DM1 A;  1SLJ A;  5G3L D;  5FKA C;  5C3X A;  5FO7 B;  2XNA C;  4A3M G;  2NZO A;  1SN8 A;  2RBM A;  3FMC A;  4A3C H;  1HA6 A;  2B2U C;  4ABN A;  5A2Q L;  1HNX Q;  1S5D D;  3ITP A;  3RLN A;  1RCV D;  3J81 E;  4QGU A;  2CKZ B;  4DNR B;  2FIN B;  3S24 A;  1SBB B;  3H94 A;  4JI6 L;  1D1K A;  1RF2 D;  5IT9 E;  5K36 H;  3NEM A;  2A68 D;  1EZ6 A;  2PI2 E;  4L5T A;  4JBM A;  1PYB A;  1JWS D;  4R4I A;  2UUB L;  5CBE E;  2K5V A;  1C48 A;  2EYL A;  3HKZ G;  4Q0F A;  4QUC A;  5ELC A;  2CVR A;  4GKK Q;  1P8L A;  4LAA A;  5DM6 3;  5IGC A;  4X3T A;  3SHL A;  1STY A;  4A3K H;  1PZI D;  5COY A;  2EYP A;  4RGT A;  2HD3 A;  4RKB A;  3GP7 A;  3J80 c;  2WII B;  2TSS A;  5J3B A;  3K8A A;  1HTP A;  1PH5 A;  3GDE A;  3T1Y Q;  5EKL A;  1F9S A;  1G2S A;  4GNX B;  1L0X B;  5CMD A;  2WKD A;  1VQ9 A;  3RD4 A;  1S5B D;  3MFY A;  1M4V A;  5JVG 3;  4LFA Q;  1XMO Q;  3HOX B;  2K50 A;  2PQA A;  1ASY A;  1HXY D;  5A2Q E;  3Q22 A;  4BY7 G;  5F2D A;  2UU9 L;  2N55 A;  4C3I H;  1DXM A;  4ZYS A;  1PRT D;  2UXD L;  3ERO A;  2OQK A;  4K6L A;  3PF5 A;  3O13 A;  4KTA A;  3HOW G;  2FMM A;  2A8V A;  4GN3 B;  1DYQ A;  2EXD A;  4DUZ L;  1BOS A;  1ENC A;  2M9V A;  2XTI A;  2PPB C;  2DNC A;  2XGT A;  1KNE A;  3N52 A;  4LUZ A;  1BCP C;  1HZB A;  4FF4 A;  3E6Z X;  4HSV A;  4BBR B;  5IP9 G;  3M7N A;  5IGB A;  4N9T A;  1PA6 A;  4B3R L;  3KDF A;  3BS1 A;  3F2B A;  1JC7 A;  1ZYR C;  4UDU C;  5IGE A;  3FVQ A;  2FHT A;  3HGB A;  1LAC A;  1U4L A;  5EPL A;  3I2Z A;  1TQO A;  5GAE C;  5KIX A;  5FLM H;  3PSI A;  1VMC A;  4DR6 Q;  2SNS A;  4QB4 A;  2FXQ A;  2PI2 A;  2RCF A;  1STA A;  4DK6 C;  1HNX L;  1CA5 A;  4UAI A;  2R92 B;  1Z47 A;  4XQN A;  1EIG A;  1VQO A;  3CC2 A;  3MZ5 A;  5FK9 C;  2BDN A;  3ULP A;  3GD7 A;  1TWC H;  1VQH A;  4DGZ A;  2X69 A;  4HJ9 A;  1D6E C;  2F0T A;  3MHB A;  1WTR A;  1S72 A;  1X3G A;  2CQA A;  2ZTD A;  4R8N A;  2Q8I B;  1EU3 A;  1R4P B;  4DV6 Q;  5EGT A;  3H0G B;  1PDQ A;  4E6I A;  1GUG A;  3BZD B;  3K6O A;  2CWP A;  1JJG A;  4X3K A;  2B63 B;  4IN3 A;  3K5M A;  1C7Y A;  4A3E H;  2E5L Q;  1QVC A;  1VQG A;  3OOC A;  4ZKC B;  3K7A H;  1PHJ A;  3PO3 H;  4QUF A;  2K03 A;  1FGU A;  4JI3 L;  2EYM A;  5BN5 A;  1L2F A;  2PNR C;  4XXE A;  4L8J A;  3T1Y L;  2BDO A;  2CFM A;  3KYH C;  4EQ5 A;  2C35 B;  3GTJ B;  3M4Y A;  2EDG A;  2XWJ B;  1SMY C;  1XMO L;  4LFA L;  3NEN A;  3HOX G;  2L9H A;  1WTV A;  3VR2 A;  1BKB A;  4J15 A;  2PO4 A;  5D65 A;  1RHP A;  1JOO A;  2RSN A;  2EY2 A;  3CMA A;  1PH9 A;  2A73 B;  2NVX B;  1UE6 A;  2J0T D;  2WAQ B;  3CME A;  3PF4 A;  3W1B A;  2P5Z X;  2DY8 A;  1TS3 A;  2XSC A;  2ZXP A;  1J8I A;  2EY1 A;  3PIO 3;  2WB1 B;  3A56 A;  3D4R A;  3IL8 A;  3D6C A;  4DAY B;  3U58 A;  1AW7 A;  2R93 B;  1AN8 A;  4BWG B;  3K5L A;  1N36 Q;  1H9S A;  1WCM B;  2F0L A;  4ODG A;  1TWG H;  5I2X A;  5CV4 A;  2QGQ A;  4U67 3;  1QZG A;  2NVT H;  4BBR G;  1GKH A;  1J5E Q;  2I46 A;  3NUC A;  1IBM Q;  2JA8 H;  1I4R A;  3I72 A;  4JBK A;  1Y1V H;  3I56 A;  4QY7 A;  3GTL B;  1ESR A;  2LKV A;  1C9O A;  2I5L X;  4J1M A;  4CDD C;  4HED A;  5ISR A;  1R9T H;  4JYA Q;  1H9K A;  1HRJ A;  5FLX E;  4DR6 L;  2B2Y A;  5JEA G;  2CW0 D;  4KMU C;  5E3F A;  1U0L A;  5JJL A;  4L63 B;  3R8B A;  3HOZ H;  4GKJ Q;  2R92 G;  3A8K E;  4CJ0 B;  1N34 Q;  2Z6K A;  2NZH A;  3J80 L;  1X3Q A;  3DXJ C;  2KHI A;  2QW7 A;  4C1N K;  4M1U B;  5C4X B;  1F77 A;  4I7A A;  4K6D A;  2E2J H;  2C5C A;  4FF2 A;  2G5D A;  3CC7 A;  1F2Y A;  4UP7 A;  1PMR A;  2MJ8 A;  3OIP A;  3ULJ A;  1STN A;  1VF7 A;  2LSS A;  1E24 A;  4NXN L;  4XTC S;  3HS0 C;  1MKH A;  3T4A C;  4IQZ A;  4KN7 C;  4DV6 L;  2JA6 H;  4AQY Q;  4FDB A;  3A5U A;  3FKI H;  1HNZ Q;  3I4N B;  1V1O A;  1O7Y A;  2BOS A;  3PIO A;  3MAQ A;  1B50 A;  3HP3 A;  3RLF A;  2VUM H;  1CK1 A;  4PZ7 A;  2F0G A;  4DR2 L;  4H13 C;  3S15 B;  2F0K A;  1T5X D;  4IUU A;  3S1M B;  4LUO A;  3T1H Q;  2E5L L;  1NMF A;  3KJP A;  2WKC A;  3OYY A;  1TWA B;  5DEH A;  5JEA J;  3PUW A;  3CQZ B;  1L1O A;  3PCO B;  4LK1 C;  3EIV A;  1NCV A;  3KLS X;  2EXZ A;  1GUT A;  4POG A;  2B39 A;  3H3V C;  4CKE A;  3CC4 A;  1K0R A;  1CQF A;  4TSS A;  4GLA C;  2K7V A;  4OL7 A;  4POF A;  1IYU A;  2PMZ E;  3UI2 A;  1K8M A;  2WAQ G;  1GJX A;  2BE5 C;  2HDM A;  2WB1 G;  4ALP A;  1F9P A;  4A3F B;  2UUA Q;  2R93 G;  2FFK B;  1BF4 A;  4QF4 A;  5BR8 L;  2IPK D;  2F0V A;  3CCE A;  1JQY D;  3C46 A;  3S16 B;  1B3A A;  3T56 B;  3S17 B;  2JA5 B;  1RKN A;  3A0J A;  1WCM G;  3M9B A;  1LTI D;  2NWG A;  1SND A;  4OWT B;  1BNZ A;  1Q86 C;  2B29 A;  1P16 A;  4WJ4 A;  2QDL A;  1JB3 A;  5C4J H;  1J5E L;  3LWU A;  5IYC G;  3NK9 A;  3AFP A;  3I4M B;  1A2T A;  1ENA A;  2QDB A;  1EOV A;  2WIN B;  3GTP B;  3DWP A;  1C4Q A;  2ENB A;  3PMF A;  3I55 A;  2PMZ B;  3PV0 A;  2E2H B;  3DLL A;  1FR3 A;  4MTK A;  4BBS B;  1I5F A;  4CDF C;  3L3O C;  3OIQ A;  1ET9 A;  3LGJ A;  2R7D A;  3RN5 A;  4FXG C;  4DR5 L;  1N34 L;  1QVG A;  2YV5 A;  4IFD G;  2WP8 J;  2K5Q A;  5K5P A;  1JB7 A;  2PZT A;  5C4X G;  2A69 C;  2D5D A;  2JEA I;  4DR3 Q;  3K59 A;  1JJC B;  1YJN A;  2JA7 H;  4DF7 A;  1VQ5 A;  2IY5 B;  3FPP A;  1CTM A;  4MN3 A;  2B2U A;  3GTO B;  2F0M A;  4KJN A;  1IBL Q;  4AQY L;  4QMG A;  3H15 A;  4DNT B;  3I4N G;  3STB D;  1HNZ L;  4G4K A;  3ERQ A;  3R2T A;  1DD2 A;  3SE0 A;  3E9I A;  1UNS A;  2K1B A;  5LMN L;  1KL9 A;  1SSO A;  2RA4 A;  5DM7 3;  5H1S E;  1HUN A;  1GM5 A;  5LL6 X;  3DWA A;  3Q23 A;  4A76 A;  1X6O A;  2UXB Q;  2KEN A;  5C5L A;  1SFO H;  4C3J B;  4ILW A;  4JC0 A;  3HZX A;  2F1M A;  4AYB B;  1YZ6 A;  2MNA A;  3RLO A;  3F2C A;  1QB5 D;  2LFN A;  3OW2 A;  1B8A A;  4RKL A;  1KQS A;  3M4O B;  2NN6 H;  3VYR A;  2JYO A;  4JK1 C;  5GAD C;  3T51 B;  1ROD A;  4IPG A;  4IFD J;  3CU7 A;  3DEO A;  4LF6 Q;  1PFB A;  4DV3 Q;  2YU9 B;  1QCB D;  1Q8K A;  3U50 C;  2R7Z H;  5J39 A;  1O7L A;  4YWL A;  1LT6 D;  2ZTE A;  3MXN B;  4ZK9 B;  5CBA E;  2K01 A;  4B9W A;  3EFX D;  1JE5 A;  4XIG S;  2NN6 I;  5ELB A;  5IIF A;  4A3F G;  2UUA L;  1EYD A;  3IKJ A;  1QNK A;  1KDC A;  3LNN A;  1RIP A;  2L11 A;  2JA5 G;  2B3G A;  2TMP A;  1QUQ B;  5D3I B;  4EQN A;  2ICE C;  1NY4 A;  4PMB A;  2LXJ A;  1FD7 D;  1BVS A;  3VR3 A;  4HID A;  4JI6 Q;  3I4M G;  4O1N A;  1DON A;  2CHB D;  2UUB Q;  1EWH A;  1W6J A;  1PYW D;  1TWF B;  2DGY A;  1H9J A;  1ET6 A;  1AZQ A;  3KF8 B;  2E76 C;  2J4X A;  2YYZ A;  4KV6 A;  4HIK A;  4BBS G;  4K0K Q;  4V19 0;  3CCS A;  3LWE A;  1F2L A;  4A3J B;  1WYD A;  3WWV A;  1JOR A;  2KVM A;  4N8F A;  4P74 A;  4DPG A;  2LMC B;  4NPS A;  3D6W A;  4JBJ A;  1EUJ A;  2Q2I A;  3I70 A;  2CH4 A;  2F0N A;  4BY1 H;  2L15 A;  1GUN A;  3H3V H;  4DR3 L;  3HOV H;  1H95 A;  2M00 A;  5M3F H;  1FNU A;  1BDO A;  5TSS A;  3M3Y H;  1PH4 A;  1LT5 D;  2C9O A;  1M8A A;  4XQQ A;  1VQB A;  1A2U A;  1S5E D;  1IBL L;  2NBF A;  1X9N A;  1JE4 A;  2F0S A;  5G3L F;  4A93 B;  3X3N A;  3TS2 A;  3STB C;  5CC4 A;  3H3V I;  1CQV A;  1HHV A;  2Z8L A;  1HQM C;  4LFC Q;  1HZC A;  2IX1 A;  2UXD Q;  1K8G A;  2YTY A;  4RHS A;  2D62 A;  3AEV A;  4X65 Q;  4JI0 Q;  2ZXO A;  2UXB L;  4JVZ A;  1CZG A;  3G6J B;  4P71 A;  2NZ1 D;  1HZ9 A;  1VQA A;  4AYB G;  4YIJ A;  3GTM B;  1PH8 A;  2PCF B;  2QKI C;  5DLQ E;  4WJ3 M;  1QNU A;  1HNW Q;  3TP8 A;  4BXX H;  3UDG A;  2BCO A;  5JOB A;  4JI7 Q;  4PMW A;  2JJQ A;  1V1P A;  4MZ9 A;  2EYF A;  1QWY A;  4XT1 B;  2L0C A;  4YY3 Q;  3HOY H;  1IKM A;  5IYD G;  3SGI A;  3S1R H;  4K2K A;  4DK3 C;  5IOD A;  2PQA B;  3S14 B;  4HJ7 A;  5KRU A;  3GTQ H;  1J9O A;  3D4D A;  3GO5 A;  1VQ6 A;  4ZUI A;  1XJV A;  2R61 A;  2EY5 A;  4U68 A;  5GQO A;  3A5Z B;  1YEZ A;  1KC8 C;  3S1Q B;  1PZK D;  1YI2 A;  1AE3 A;  5FO8 B;  1K0S A;  2AQ2 B;  2I0Q A;  1GO3 E;  4L6T B;  2K32 A;  4A3B B;  3L0O A;  4GLV B;  4NB3 A;  1QIL A;  1G29 1;  1T9H A;  2KHJ A;  1SNP A;  1PV4 A;  4K0K L;  3RZD B;  1WD1 A;  3AU7 A;  5C0X G;  2OWO A;  4Y7N H;  2B2T C;  4A3J G;  2XVS A;  1EIY B;  1ILP A;  2AUK A;  5HY6 A;  1Q46 A;  1TS2 A;  2ZXR A;  1PTO B;  4LFB Q;  2KQ3 A;  3K57 A;  3KDF B;  3PUY A;  4K2L A;  4ULL A;  1U9R A;  1SEB D;  2HT1 A;  1STG A;  5M5Y B;  2AMC B;  4HJ8 A;  2Z0S A;  1GVP A;  1W2B A;  1VQN A;  1DOM A;  3ZYY X;  1PH1 A;  4JI3 Q;  3G4S A;  3KK7 A;  2DY7 A;  1MI2 A;  3KBX A;  5I4D A;  5KNC A;  2K52 A;  5D14 A;  1IL2 A;  1F9R A;  1K83 B;  2K4K A;  1TWH B;  4DXF A;  2N88 A;  1KXL A;  2PNH A;  3SK5 A;  1I4P A;  1WJJ A;  1WVL A;  3NXW A;  1MBY A;  1NR2 A;  2K33 A;  4L5Q A;  5C5M A;  1PVO A;  2PQE A;  1BR9 A;  3S2H B;  2Z1C A;  3C1E A;  4PMC A;  4LFC L;  5HUR A;  4KJO A;  3GTJ H;  1X65 A;  3MA2 B;  2A6H D;  2J7Z A;  4R4O A;  4DR4 Q;  2MQH A;  4X65 L;  4JI0 L;  4XDX A;  3PUV A;  1SNO A;  2KJX A;  5A35 A;  3HOU H;  3ER0 A;  3J7A 5;  4IUQ A;  3D31 A;  3HFZ B;  4O0A A;  4LWC A;  4HMJ A;  2MGS A;  4LW1 A;  5JPN C;  4QCL A;  4DV0 Q;  2F4V Q;  3L9A X;  5C0X J;  5D3D A;  4OO1 G;  1SYD A;  1H9M A;  1HNW L;  1V1Q A;  1ZKO A;  3BVG A;  2N3S A;  1TKW B;  3WDN A;  4QIW E;  1GUO A;  4JI7 L;  1N33 L;  1X55 A;  1XTC D;  2E2D C;  2N78 A;  4DV2 Q;  4KHV A;  4LF4 Q;  5IE8 A;  1QG7 A;  3BZC A;  4CKB A;  5C44 B;  4YY3 L;  2KCC A;  4KD4 A;  3GTK H;  1X3P A;  1Y1W B;  1K73 C;  1S5C D;  4FP5 D;  2DJG C;  2L5T A;  2F0W A;  3NBI A;  1YNN D;  5IYB H;  3F8T A;  2F0I A;  1V43 A;  1VS0 A;  5GRO A;  1A0I A;  1PH6 A;  5E4X A;  1EZ8 A;  1I4H A;  1LTG D;  1FVI A;  4PG3 A;  1PH2 A;  1SRO A;  4A3B G;  2A68 C;  2RF4 A;  2JP1 A;  2HCC A;  4NXN Q;  1H9S B;  2SNM A;  3L7Z C;  2UUC Q;  3KF6 A;  1T5E A;  3UDX A;  3SEB A;  2F0Q A;  3CD6 A;  3ULL A;  1DOK A;  1D2B A;  3V96 A;  3EBE A;  4LFB L;  2N49 A;  4DR2 Q;  1XNQ Q;  4JI5 Q;  3CRK C;  4S3S A;  2B8G A;  4KK7 A;  3R3O A;  1EY9 A;  2A5H A;  4I65 A;  3W1G A;  2NTS A;  3I4N H;  1Y14 B;  1A15 A;  2XRS D;  4MTN A;  1D5M C;  1I3Q H;  3IRB A;  4A3K B;  1M1K C;  2E2I H;  5I9O A;  2OF1 A;  4CDC C;  5KYI A;  3QB3 A;  1EYA A;  1IYV A;  5FJ8 H;  1UE5 A;  1Y8N B;  2D2C C;  3U9S A;  5M3M H;  4JPB W;  4IOC A;  4IPC A;  4C3H H;  1KD1 C;  1PTO D;  5IGF A;  4MHE A;  2G9H D;  2HQE A;  1Q12 A;  5HGT A;  1ESF A;  4A3D H;  4HIM A;  5EPK A;  3D4W A;  4UHV A;  2EYH A;  2EY6 A;  4X3S A;  3TZU A;  2Z6B A;  1PRT C;  4H7B A;  4HN7 A;  1VQ8 A;  1SYB A;  4DR4 L;  4C3I B;  3RR5 A;  4NXM Q;  1STB A;  3J7Y W;  3QOL A;  3VR4 A;  4P75 A;  3CCJ A;  3K0X A;  3T53 B;  2LY7 A;  2VQE Q;  5BR8 Q;  3CF5 A;  3VA7 A;  4DV0 L;  1EY8 A;  2QIL A;  2F4V L;  3J81 i;  1CSQ A;  3HG9 A;  4GN4 B;  4NDX A;  3HKS A;  1I6H H;  2HCI A;  3H09 A;  3NPP A;  3NWT A;  4ZRZ A;  3W2D A;  3DMU A;  3UE0 A;  5M5X H;  5C3E H;  3CCR A;  5CV9 A;  4DV2 L;  3OWE B;  1JJ2 A;  4LF4 L;  4JOI C;  4F88 A;  4F7X A;  3BDL A;  5C44 G;  4I7Z C;  4DA2 A;  1S4Z A;  3NSW A;  1B9N A;  4ZLT F;  1EIF A;  1CA6 A;  5JJK A;  1L1O B;  1VQK A;  1Y1W G;  2RHQ B;  1F9Q A;  2O2L D;  4RMF A;  2VL6 A;  4DV5 L;  1G6Z A;  3S1N H;  5IGG A;  1WTX A;  2VB2 X;  1K3R A;  2GA4 B;  3S9W A;  4JBW A;  1D5Z C;  2JSO A;  4A3G H;  3IFD A;  2NTT A;  3K7U C;  2AUJ D;  4DNI A;  2F0O A;  3M7G A;  4K5W A;  4DR5 Q;  1FJG Q;  5IOC A;  1NNX A;  1HH2 P;  1MD2 D;  4BBS H;  2N8N A;  5EQ0 A;  4APV A;  2B8F A;  4PQX A;  3K80 C;  3D8G A;  3E0J A;  1A3T A;  5AFW A;  1G6P A;  3G48 A;  1OO9 B;  1TII D;  4DR1 Q;  2Q2U A;  5JAV A;  2NVQ H;  1TWC B;  1E2V A;  4LNQ A;  1B4O A;  3I73 A;  2VS1 A;  4JW0 A;  1SE4 A;  2GVB A;  5AJ3 Q;  1RJT A;  2UUC L;  1KRS A;  1SNM A;  2L4N A;  2X6G A;  4CBV A;  3H0G G;  2DN8 A;  3U4Z A;  1V9P A;  3MTS A;  5CV8 A;  1QOH A;  5LMN Q;  3RNU A;  3L2P A;  1XNQ L;  4JI5 L;  4QJF A;  2B63 G;  4YHH Q;  5I6Y A;  4KHZ A;  4A3I B;  2A1A A;  4A3K G;  3ERS X;  4A3E B;  1KIX A;  2MO0 A;  1E0B A;  3K7A B;  3PO3 B;  2RKS A;  1X3F A;  3P20 A;  5M5W H;  1W6K A;  4B3M Q;  2JN4 A;  4ID6 A;  1U4M A;  2JXM B;  1TVX A;  1CI3 M;  1JCK B;  2HQL A;  3QJY A;  1SE2 A;  2HIV A;  3AB9 A;  3X3M A;  1NR4 A;  4OIJ A;  1HFN A;  1UE1 A;  2G9D A;  3J80 E;  5BN4 A;  2EVB A;  1Z9F A;  4C3I G;  4NXM L;  3EQL C;  4G7Z C;  4XYQ A;  3BDC A;  1QJO A;  2NVY H;  1GOZ A;  3CHB D;  2YU9 H;  1UEA B;  2VQE L;  4GNX C;  1S40 A;  3Q0A A;  1D8L A;  1EY7 A;  3QIA A;  4IJL A;  3TS0 A;  2WFW A;  2Z4H A;  2CH4 W;  4P2C B;  1PH3 A;  4RFB A;  1KLU D;  1HUM A;  1Y8P B;  3E0E A;  4JI2 Q;  4A3M H;  4CDE C;  5IT9 c;  1TWG B;  1WTH A;  1OTC A;  4FXD A;  1GUS A;  1BBW A;  1EWC A;  1EY5 A;  2NVT B;  2JA8 B;  1LAB A;  2RVL A;  4A3L G;  1Y1V B;  5ELD A;  1CHQ D;  4LF8 L;  1ML0 D;  4X66 Q;  2CCZ A;  2CW0 C;  2AWO A;  1JWU D;  5EBD A;  1NE3 A;  1O7I A;  2OT2 A;  4R4C A;  4X3U A;  4GOP A;  2MFI A;  3CCQ A;  4DAP A;  1FJG L;  2RQX A;  3HRZ C;  4EVO A;  1HA5 A;  4Z9C B;  1LYL A;  2H4O A;  1SYE A;  4HTH A;  2K5N A;  4BA2 I;  3HOZ B;  1IW7 D;  2K5W A;  2QEX A;  2D9U A;  4OWX B;  1G2T A;  1PZJ D;  4DR1 L;  5EBC A;  2UXC L;  1U4R A;  2A6E D;  3J81 j;  2E2J B;  5AJ3 L;  1K28 A;  3G6E A;  1VQD A;  1YJW A;  2VQF L;  1MJC A;  3CPF A;  1LT3 D;  4HJ5 A;  4IO9 A;  1PLF A;  2JA6 B;  3GTG H;  4FF3 A;  3FKI B;  2EYJ A;  2I5M X;  1I50 H;  2RDG A;  1IKL A;  1NJI C;  4YHH L;  2VUM B;  3LX0 A;  4JG2 A;  1ZXT A;  1LTA D;  4A3I G;  1CKO A;  2Q2H A;  5LMN W;  4BY7 H;  4OIK A;  1AH9 A;  2JEB I;  1KRT A;  1RTO A;  4A3E G;  4H02 A;  2VY3 A;  1BCP B;  2RSO A;  4KN4 C;  3PO3 G;  2R6G A;  3PO2 B;  3HOW H;  2B2T A;  4B3M L;  3BYT B;  4BS9 A;  2ATW A;  1AE2 A;  2IHF A;  1SYG A;  1MSG A;  1EY0 A;  1O7Z A;  1LM0 A;  4OWW B;  4NP5 A;  4OO1 H;  3S2D H;  4GN5 A;  1K8O A;  1YBY A;  4LJZ C;  1Q90 A;  2EJG C;  5IP9 H;  1KDA A;  3I90 A;  2QA4 A;  3RZO H;  3DEP A;  1CFM A;  2F52 A;  3NBH B;  4X62 L;  1LLR D;  4PZ8 A;  4C2M H;  2KOL A;  3P7J A;  4B3S L;  5IGD A;  3R2I A;  4OO1 I;  3SK4 A;  3Q6S A;  1XXG A;  2E8G A;  3BJU A;  1UAP A;  3A74 A;  3U4V A;  2D0P A;  4JI2 L;  1C8C A;  1E2W A;  4KKT A;  4HMI A;  4R4T A;  5LL6 S;  1IXR A;  2BA1 A;  3EN2 A;  3HKZ E;  2B2W C;  1STE A;  3TBI B;  4YWK A;  4CKC A;  1OXT A;  1CUK A;  2AWN A;  2JA8 G;  3I4L A;  3Q24 A;  1Y1V G;  4DV7 Q;  3MVV A;  2OEO A;  5JJZ A;  4RCN A;  1CSP A;  1BO0 A;  3WOE A;  4X66 L;  1LO5 D;  1I6V C;  2ZT9 C;  3V2T A;  1A6X A;  4JV5 L;  1V1P B;  1XMQ L;  4DV1 Q;  5FOB B;  1SR3 A;  1VQC A;  5IWA Q;  3GV6 A;  1B2T A;  1AEX A;  1I4G A;  2DJF C;  1XPR A;  3DWQ A;  1MGS A;  2O4X A;  2PW5 A;  4EQO A;  4IZ8 A;  4OXP A;  3PIP A;  1H9R A;  1OXV A;  2V1C C;  3I7F A;  1BQQ T;  4J8Q A;  2OQ0 A;  1E1O A;  5EKI A;  1SJE D;  2JA7 B;  2MUY A;  2K5D A;  1PFS A;  1KTK A;  3F2D A;  5IP7 G;  3OW7 A;  2ZJQ A;  1KAA A;  4B3T Q;  4NKL A;  1K8A C;  2DNE A;  2JA6 G;  3QOJ A;  1MHW C;  3J80 i;  4KY5 A;  3CPW A;  3HOX H;  2VUM G;  1KNA A;  3U9O A;  4C3J G;  4OGQ C;  4DXG A;  1QVF A;  5ELO A;  2B2V C;  3MWY W;  2DUD A;  1SFO B;  2ZJP A;  2Q2T A;  4KLK A;  4NMZ A;  4HCE A;  2VXW A;  3PO2 G;  1EQQ A;  5IT9 L;  4TKO B;  1YNJ D;  1FL0 A;  1II3 A;  3K5N A;  4OX9 L;  4KHP L;  1UEB A;  1N33 Q;  3AQQ A;  3KOJ A;  4HAE A;  2V4D A;  1JIC A;  1HR0 L;  1DJR D;  5C3W A;  5KNB A;  1K9M C;  5EKK A;  4GZY C;  5FLX c;  4BBR H;  3NTI A;  4A75 A;  2R7Z B;  3KF8 A;  1L0W A;  1BCP D;  1CHP D;  1UE7 A;  2KEC A;  5KND A;  2BH2 A;  5C44 H;  1JOQ A;  5JVH 3;  2RHS B;  4IPD A;  1VMP A;  4JI1 L;  2Z4I A;  3CP0 A;  1HTL D;  4AH6 A;  3VYU A;  1ZYR D;  1OXU A;  3NQT A;  4TRD A;  1SAP A;  1EOT A;  4FNF A;  2EIF A;  5JEA H;  4B08 A;  4ZAI A;  1WTO A;  2JA9 A;  1TXY A;  2H1E A;  3P75 A;  2R92 H;  4HCS A;  3CRL C;  2WV6 D;  4KD3 A;  1YHB A;  1PRT F;  1YNX A;  3SDZ A;  3CXC A;  1NUC A;  1A62 A;  1R4Q B;  1RD9 D;  4DV7 L;  2QF7 A;  4FF1 A;  3T16 A;  3TN2 A;  1XNR Q;  1TR5 A;  4IJH A;  3SVM A;  1EQT A;  1Y69 U;  4LF9 L;  4N9P A;  2VNU D;  4Y52 H;  4DV1 L;  2IHE A;  2AQ3 B;  1LTT D;  4J6H A;  5IWA L;  4KY7 A;  1EL0 A;  3H0G H;  4JOI A;  4RGO S;  1K3B C;  1VQJ A;  4X6A H;  1ICF B;  2L12 A;  3TRZ A;  4HR7 B;  3OMC A;  4QL5 A;  3UDF A;  4BY1 B;  2K5H A;  5GAG C;  2B63 H;  1EYC A;  4CJ2 C;  3HOV B;  5J22 A;  2AHO B;  4ME3 A;  2JA7 G;  3H6M A;  3BYY B;  5M3F B;  3TME A;  5E7N A;  3M3Y B;  2ZJR A;  1X54 A;  3JAM c;  2ZM6 L;  3WOF A;  4B3T L;  4DUY L;  3VR6 A;  4A93 G;  2IJ0 A;  2FMC A;  5E4W C;  1EFW A;  4YCV A;  4TVA B;  4XYO A;  2F0E A;  3ND8 A;  4NW2 A;  2F0F A;  1GHJ A;  1CKN A;  1SE3 A;  3KF6 B;  4JI8 Q;  2ID0 A;  1RTN A;  3D0F A;  1SMY D;  4DV4 Q;  4JI4 L;  1B7Y B;  5EAY A;  2NVX H;  2HDL A;  1B70 B;  4YWM A;  2X6L A;  2F0J A;  1WFQ A;  1S5F D;  1VCI A;  1RL2 A;  1A8V A;  5JPM C;  3SR1 A;  3J7A F;  1N32 Q;  1B9M A;  3DHQ A;  2Y0S E;  1YNJ C;  2R93 H;  1B1Z A;  1PFM A;  1TS5 A;  1V8Q A;  3QG1 A;  4OEL B;  2ASB A;  2NN6 G;  1HQR D;  5CR3 A;  1AFP A;  4IAL A;  1WCM H;  2IX3 A;  4LF7 L;  3OPO A;  2YTX A;  1Q8I A;  4DAM A;  5IY0 A;  4K8J A;  4DV5 Q;  1XX8 A;  3DUZ A;  4DFA A;  2F3I A;  2R7Z G;  1RDP D;  5IYC H;  2ZTC A;  3HOY B;  4G7O C;  3MXG A;  1O80 A;  3QO2 A;  3GTL H;  1HJP A;  2QEJ C;  3S1R B;  1XYI A;  4A3L H;  1VQE A;  3GTQ B;  2WAC A;  2JE6 I;  3I3C A;  4PZ6 A;  4TQU S;  4LF5 L;  1G91 A;  1VQF A;  1PTO F;  1Y8O B;  3OSO A;  2Y0S B;  4EGV A;  1A3V A;  1SNQ A;  4QIW B;  4P73 A;  2PYK A;  1TT2 A;  3EA6 A;  3A8I E;  3C2P A;  1FNV A;  5KYL A;  3OWF A;  2EQS A;  3OMG A;  4IFD H;  1GUW A;  1XPO A;  3K81 C;  4GNX A;  5LHY 1;  1PH7 A;  2SOB A;  1Q7Y C;  2LXK A;  5C4X H;  5BN3 A;  1XNR L;  3GQB A;  2PZU A;  1IBK Q;  1D1I A;  3Q8D A;  3K5O A;  1Q81 C;  1VF5 C;  3PGZ A;  2E74 C;  1X56 A;  1BXT A;  4LUV A;  4N8X 1;  1XWE A;  4L5S A;  4DU9 A;  4Y7N B;  4O42 A;  4IFD I;  3BVM A;  5I9P A;  2XWB B;  4EQP A;  3V05 A;  4G7H C;  1A63 A;  2VZA A;  2ALY B;  3OHX C;  5CGK A;  3TEH B;  1SXT A;  2CQO A;  1LV9 A;  4IUP A;  3MEH A;  3W5O A;  4BY1 G;  2K04 A;  3TP6 A;  3S15 H;  3AYH B;  5L37 A;  1EY4 A;  2WAQ E;  3HOV G;  3S1M H;  4GKK L;  2IW3 A;  5M3F G;  1JR0 D;  4A3I H;  4DR7 Q;  1TS4 A;  3NQI A;  2ICI A;  2WB1 E;  2KBN A;  5NUC A;  2EJF C;  3EVQ A;  1TWA H;  1D7Q A;  3A7A B;  4OHJ A;  3FPU B;  1GXD C;  3CQZ H;  1G51 A;  1SNC A;  5FLX L;  1XTD A;  2A6H C;  1FGB D;  1I4X A;  4KKU A;  1NMG A;  4ZCK A;  4JI8 L;  1WTP A;  5CV7 A;  1ILQ A;  4DV4 L;  5FO9 B;  2AKW B;  2IX0 A;  4CGY B;  1J6Q A;  1MIU A;  1N8R C;  2I07 B;  4UP9 A;  3NEL A;  2RCN A;  1Q82 C;  3HOU B;  2YTV A;  1PYS B;  1BUV T;  3QWN A;  4RA8 A;  1IZ6 A;  2EYO A;  1N32 L;  2BE5 D;  3GV3 A;  2RDH A;  5HGQ A;  1E3P A;  5EPJ A;  4A3F H;  1BBX C;  4FYD A;  4ME5 A;  1F2M A;  2F3W A;  2MP1 A;  4LMQ D;  4BXX G;  3URY A;  2XRQ D;  4DKA C;  3S16 H;  3C3L A;  3S17 H;  2JA5 H;  1M90 C;  3BG3 A;  1ICW A;  4KI0 A;  1B44 D;  3VR5 A;  1IYJ B;  1EWI A;  4YCU A;  4LF8 Q;  3HOY G;  3FHW A;  3ZJY C;  3I4M H;  1IHZ A;  3GTK B;  1TY2 A;  3MXP A;  1SMX A;  1U5K A;  3GTP H;  4R4Q A;  1Q1B A;  4UY8 C;  1YNN C;  2E2H H;  2O5J C;  1YIJ A;  4A3C G;  2XIW A;  2KCT A;  4X62 Q;  1B3Q A;  2A19 A;  1DOL A;  4YCW A;  2XN9 C;  5ELN A;  3A7L A;  1UWV A;  1ENF A;  2Y0S G;  1ZEQ X;  2F4I A;  1JWM D;  2F03 A;  2JK8 A;  2UXC Q;  5C4Z A;  1KLG D;  5CYU A;  3TDQ A;  1B53 A;  4M8A A;  4Q5V A;  5K36 G;  4R8I A;  3JAM L;  3E3X A;  2R7F A;  3KLW A;  2R3Z A;  5T1G A;  1CM9 A;  4CJ1 B;  2VQF Q;  1SYC A;  1EIH A;  1MJE A;  1LTS D;  1IBK L;  1WTQ A;  3I8Z A;  5I2Y A;  2A69 D;  2OTL A;  1EEF D;  3ONA B;  2L55 A;  2EJM A;  3CCU A;  3KBG A;  3GTO H;  2B2W A;  5IP7 H;  3ND9 A;  4RH6 A;  2O5I C;  2E75 C;  3VA5 A;  4DAY A;  4K8I A;  3F2U A;  3EJI A;  1TY0 A;  2K14 A;  3M85 A;  2PZW A;  4GOP B;  1I3Q B;  2E2I B;  4AIM A;  1BBU A;  3NE5 B;  4HSP A;  3FP9 A;  2Z9H A;  4C3J H;  3NHH A;  2KCN A;  1SYF A;  4DR7 L;  4IOA A;  1PTO C;  3FEW X;  1WI5 A;  1IL8 A;  3IFT A;  2HIX A;  2SDF A;  4K5X A;  5M3M B;  3BVZ A;  1Q1E A;  4C3H B;  5ELE A;  1FNW A;  1EQR A;  2NUC A;  2F0H A;  3PO2 H;  1U4P A;  1OXX K;  3J7A V;  3M4O H;  4A3D B;  4IUN A;  2EZV A;  2HUG A;  1YVC A;  1NTG A;  3N6R A;  4HJA A;  2KA7 A;  2NYZ D;  4H0L C;  4C1N I;  3J81 c;  3HOU G;  3TP5 A;  3JAM E;  1VQ4 A;  4B3S Q;  3C1F A;  5IYD H;  2GVA A;  5M9O A;  4X64 Q;  4IUV A;  3TQY A;  1Q3L A;  4DK0 A;  2OXP A;  2RDF A;  1EQV A;  1NSN S;  3G7L A;  1N9W A;  4R9W A;  2VW9 A;  2FJ2 A;  1G8Z D;  2K28 A;  1I6H B;  2KHS A;  3G71 A;  4BA1 I;  1L0Y B;  1F2Z A;  2K05 A;  2I5H A;  2EPB A;  5M5X B;  5C3E B;  1N36 L;  3ICE A;  2Q8T A;  1XPU A;  3P1H A;  2B2V A;  1SRU A;  2PW7 A;  2NB0 A;  5LMU Q;  4MIU A;  2MHV A;  4RWS C;  2ES2 A;  1SJH D;  2BA0 A;  1R9T B;  3S1N B;  4JV5 Q;  3CAM A;  4PNY A;  5FLM G;  1HZA A;  4IUR A;  3BDO A;  1IBM L;  1XMQ Q;  1TWF H;  1VDZ A;  3F1Z A;  4FXK C;  5ELF A;  4A3G B; 
#chains in the Genus database with same CATH homology
 2OQ0 A;  1E1O A;  4UP8 A;  1YIT A;  4R4O A;  4DR4 Q;  1TWG H;  2MQH A;  1PFS A;  3BZK A;  4X65 L;  5IYB G;  3F2D A;  4JI0 L;  5IP7 G;  3PUV A;  4A3J H;  2QGQ A;  1VQP A;  2ZJQ A;  3OTO Q;  1QZG A;  4B3T Q;  3ER0 A;  3HOU H;  2NVT H;  4BBR G;  1GKH A;  3D31 A;  3HFZ B;  1K8A C;  1J5E Q;  4O0A A;  4JYA L;  3KJO A;  4LWC A;  2JA6 G;  4LW1 A;  1IBM Q;  2JA8 H;  1E1T A;  4P72 A;  1C0A A;  4DV0 Q;  4JBK A;  1Y1V H;  4A4I A;  3I56 A;  4QY7 A;  5C0X J;  3J80 i;  2F4V Q;  4OO1 G;  1C9O A;  2I5L X;  3DM3 A;  3CPW A;  1YHQ A;  1HNW L;  1V1Q A;  4GKJ L;  3HOX H;  2VUM G;  2N3S A;  4QQB X;  1R9T H;  5C0X I;  2HHH Q;  4JYA Q;  4QIW E;  4JI7 L;  4DR6 L;  1KHI A;  1N33 L;  5JEA G;  1X55 A;  1QVF A;  4AYB E;  5ELO A;  2N78 A;  4DV2 Q;  1U0L A;  2DUD A;  2ZJP A;  2Q2T A;  4KLK A;  5IE8 A;  3BZC A;  4LF4 Q;  3UE1 A;  5JJL A;  1JT8 A;  4GS3 A;  3HOZ H;  3PO2 G;  4YY3 L;  4GKJ Q;  2R92 G;  1EQQ A;  1N34 Q;  2D0O A;  3GTK H;  4L5R C;  4A93 H;  1K73 C;  2Z6K A;  1FL0 A;  2NZH A;  4OX9 L;  2KHI A;  4KHP L;  1UEB A;  1N33 Q;  2K75 A;  3AQQ A;  3CCL A;  3KOJ A;  3CCM A;  1WOC A;  2E2J H;  1HR0 L;  4EX5 A;  3CC7 A;  4UP7 A;  1K9M C;  3ULJ A;  5IYB H;  1EYG A;  3F8T A;  3BU2 A;  2LSS A;  5FJ8 G;  1E24 A;  1V43 A;  2OCE A;  1VS0 A;  4XTC S;  4NXN L;  1MKH A;  5GRO A;  1A0I A;  5FLX c;  4BBR H;  4A75 A;  1PH6 A;  1W3S A;  1L0W A;  4OX9 Q;  4KHP Q;  4RG1 A;  4DV6 L;  2JA6 H;  1SE8 A;  4AQY Q;  1VQ7 A;  5M3M G;  4FDB A;  5JJI A;  1UE7 A;  3A5U A;  3T1H L;  3GTM H;  3FKI H;  1FVI A;  4PG3 A;  1PH2 A;  3RN2 A;  1SRO A;  1HNZ Q;  2BH2 A;  5C44 H;  1HR0 Q;  4A3B G;  2RHS B;  4IPD A;  2RF4 A;  3PIO A;  3B6Y A;  4JI1 L;  3RLF A;  2VUM H;  4PZ7 A;  3CP0 A;  4AH6 A;  4A3D G;  4DR2 L;  4NXN Q;  1OXU A;  3L7Z C;  2UUC Q;  1S3O A;  3KF6 A;  3M4Q A;  2EIF A;  1YHA A;  4LUO A;  3UDX A;  3T1H Q;  2GN5 A;  3E9H A;  1I94 Q;  2E5L L;  1NMF A;  3CD6 A;  3KJP A;  3ULL A;  2JA9 A;  1TXY A;  3OYY A;  1JMC A;  3CW2 C;  2R92 H;  3EBE A;  4LFB L;  4JCV E;  4JI1 Q;  2N49 A;  2Z6K C;  4DR2 Q;  1XNQ Q;  4JI5 Q;  4X64 L;  1YHB A;  1YNX A;  3I4O A;  5JEA J;  3PUW A;  3CXC A;  1A62 A;  1L1O A;  3PCO B;  4DV7 L;  2CWA A;  3EIV A;  3S14 H;  4UPA A;  3W1G A;  1QZH A;  1XNR Q;  4POG A;  3I4N H;  1Y14 B;  1M1K C;  4MTN A;  3IRB A;  1I3Q H;  3CC4 A;  1K0R A;  2E2I H;  4IJH A;  1E7Z A;  1VQL A;  4GLA C;  5FJ8 H;  2VNU D;  2IT1 A;  4LF9 L;  1UE5 A;  3S1Q H;  4POF A;  4Y52 H;  5C3E G;  2PMZ E;  4DV1 L;  2IHE A;  2WAQ G;  5GAH C;  4OON A;  5M3M H;  5IWA L;  5LMU L;  4IOC A;  3H0G H;  4IPC A;  4JOI A;  2H5X A;  4C3H H;  1KD1 C;  2WB1 G;  4ALP A;  3J7Z C;  4A3B H;  2OTJ A;  1Q12 A;  1VQJ A;  4X6A H;  2UUA Q;  2R93 G;  3TRZ A;  4A3D H;  4HIM A;  4LF9 Q;  3JC6 6;  4QL5 A;  3UDF A;  5BR8 L;  1ASZ A;  3CCE A;  1GD7 A;  4MNO A;  3M4P A;  2K5H A;  5GAG C;  2B63 H;  3A0J A;  4A3G G;  4R1J A;  1WCM G;  3M9B A;  3RZD H;  2AHO B;  4ME3 A;  4OWT B;  1X3E A;  1VQ8 A;  2JA7 G;  3HOZ G;  4DR4 L;  3RR5 A;  5E7N A;  2B29 A;  1Q86 C;  4NXM Q;  1P16 A;  4O2D A;  2ZJR A;  1X54 A;  4P75 A;  3JAM c;  2ZM6 L;  3CCJ A;  4WJ4 A;  3OTO L;  1DGS A;  4DUY L;  4B3T L;  4A93 G;  3AFQ A;  5C4J H;  1J5E L;  5IYC G;  3K0X A;  1L1O C;  5BR8 Q;  2VQE Q;  3PUX A;  3CF5 A;  4DV0 L;  3AFP A;  1EFW A;  2F4V L;  1EOV A;  4YCV A;  4TVA B;  3J81 i;  5M5Y H;  3I55 A;  3PV0 A;  1CSQ A;  4GN4 B;  4GLX A;  3DLL A;  3HKS A;  2ZM6 Q;  1CKN A;  3KF6 B;  3KFU A;  1I6H H;  4JI8 Q;  2ID0 A;  4DUY Q;  2HHH L;  3D0F A;  4DV4 Q;  4JI4 L;  1YJ9 A;  3TRE A;  1B7Y B;  1I5F A;  2BH8 A;  5EAY A;  4IPH A;  3CCV A;  3UE0 A;  5M5X H;  2NVX H;  5C3E H;  1NBW A;  3LGJ A;  3FKI G;  3CCR A;  4DV2 L;  1JJ2 A;  4LF4 L;  1B70 B;  2R7D A;  4JOI C;  4YWM A;  5C44 G;  1K83 H;  3RN5 A;  1CKM A;  1WFQ A;  1TWH H;  1VCI A;  1RL2 A;  3UDI A;  4DR5 L;  1A8V A;  1N34 L;  1QVG A;  1EIF A;  2YV5 A;  4IFD G;  5JJK A;  1L1O B;  1N32 Q;  1VQK A;  1Y1W G;  2RHQ B;  4DV5 L;  4RMF A;  2Y0S E;  2VL6 A;  2WP8 J;  3S1N H;  4HIO A;  2R93 H;  4JI4 Q;  1JB7 A;  1K3R A;  2ASB A;  3S2H H;  5C4X G;  2NN6 G;  3PUZ A;  2JEA I;  4DR3 Q;  4JBW A;  4A3G H;  3JAM i;  1WCM H;  1JJC B;  1YJN A;  2UU9 Q;  4LF7 L;  2JA7 H;  3K7U C;  4DNI A;  1VQ5 A;  2IY5 B;  2YTX A;  4DAM A;  4DR5 Q;  1FJG Q;  5IY0 A;  1QUQ A;  1HH2 P;  1OXS C;  4DV5 Q;  4BBS H;  2KCM A;  2R7Z G;  2N8N A;  2F3I A;  5IYC H;  2ZTC A;  4APV A;  1VQM A;  1IBL Q;  4AQY L;  3MEF A;  3H15 A;  3K80 C;  1HJP A;  1LTL A;  3STB D;  1HNZ L;  3GTL H;  3I4N G;  4LF7 Q;  1KAW A;  1G6P A;  1VQI A;  3E9I A;  3G48 A;  5LMN L;  1E22 A;  1KL9 A;  4DUZ Q;  4DR1 Q;  2Q2U A;  4A3L H;  1VQE A;  2NVQ H;  4LNQ A;  5H1S E;  1LUZ A;  2VS1 A;  2GVB A;  5AJ3 Q;  2JE6 I;  1GM5 A;  2UUC L;  2JQO A;  1KRS A;  4PZ6 A;  4TQU S;  4A76 A;  4LF5 L;  1VQF A;  1X6O A;  1HR0 W;  2UXB Q;  2KEN A;  4GOP C;  3H0G G;  1SFO H;  3U4Z A;  1I94 L;  4JC0 A;  1V9P A;  4P73 A;  2MO1 A;  4LF6 L;  1YZ6 A;  5LMN Q;  3RNU A;  2EQS A;  4DV3 L;  2MNA A;  4B3R Q;  3L2P A;  3RLO A;  1XNQ L;  4JI5 L;  1Y1W H;  1XPO A;  4QJF A;  3F2C A;  3K81 C;  4GNX A;  3VDY A;  2B63 G;  3OW2 A;  1PH7 A;  4YHH Q;  1B8A A;  1Q7Y C;  2LXK A;  5C4X H;  1KQS A;  4LF5 Q;  1CKN B;  4KHZ A;  1XNR L;  5GAD C;  2A1A A;  1SLJ A;  4IPG A;  1IBK Q;  3Q8D A;  4A3K G;  4IFD J;  4A3M G;  3ERS X;  2NZO A;  1Q81 C;  3PGZ A;  4LF6 Q;  1SN8 A;  1X56 A;  4DV3 Q;  1KIX A;  4LUV A;  4A3C H;  1Q8K A;  4L5S A;  2MO0 A;  3U50 C;  2R7Z H;  4IFD I;  1HNX Q;  4YWL A;  3RLN A;  2ZTE A;  1X3F A;  5M5W H;  4B3M Q;  3MXN B;  4QGU A;  2CKZ B;  1A63 A;  1JE5 A;  2VZA A;  2NN6 I;  4XIG S;  2ALY B;  4A3F G;  2HQL A;  3TEH B;  3S24 A;  2HIV A;  2UUA L;  2CQO A;  3W5O A;  4JI6 L;  4BY1 G;  3NEM A;  2PI2 E;  4L5T A;  4JBM A;  1RIP A;  2JA5 G;  3S15 H;  1PYB A;  1UE1 A;  2B3G A;  2WAQ E;  3AYH B;  3HOV G;  3S1M H;  4GKK L;  4R4I A;  1QUQ B;  1Z9F A;  5M3F G;  2UUB L;  4A3I H;  1NY4 A;  2K5V A;  4NXM L;  4DR7 Q;  2WB1 E;  2KBN A;  2LXJ A;  2NVY H;  1TWA H;  1D7Q A;  2YU9 H;  1BVS A;  3HKZ G;  4HID A;  4JI6 Q;  2VQE L;  4GNX C;  1S40 A;  1D8L A;  3CQZ H;  1G51 A;  3I4M G;  4IJL A;  3TS0 A;  2WFW A;  4GKK Q;  1P8L A;  1XTD A;  1PH3 A;  2UUB Q;  2DGY A;  1NMG A;  3KF8 B;  4A3K H;  3E0E A;  2YYZ A;  4JI2 Q;  4JI8 L;  4HIK A;  4A3M H;  4BBS G;  4K0K Q;  5IT9 c;  4DV4 L;  2AKW B;  2IX0 A;  1J6Q A;  1MIU A;  3CCS A;  1N8R C;  1OTC A;  4UP9 A;  3J80 c;  3NEL A;  1WYD A;  2RCN A;  1BBW A;  3WWV A;  5J3B A;  2YTV A;  1Q82 C;  1PYS B;  4P74 A;  4DPG A;  1IZ6 A;  3K8A A;  4NPS A;  4JBJ A;  1EUJ A;  2Q2I A;  1PH5 A;  3GDE A;  3T1Y Q;  4A3L G;  4GNX B;  1N32 L;  5HGQ A;  1E3P A;  4A3F H;  1VQ9 A;  4LF8 L;  1XMO Q;  4LFA Q;  4X66 Q;  2K50 A;  4BY1 H;  2PQA A;  1ASY A;  4BXX G;  2L15 A;  4DKA C;  2CCZ A;  3S16 H;  2AWO A;  3H3V H;  4DR3 L;  2JA5 H;  3S17 H;  1M90 C;  1NE3 A;  3HOV H;  1O7I A;  4R4C A;  4BY7 G;  4KI0 A;  2UU9 L;  4GOP A;  2MFI A;  3CCQ A;  5M3F H;  4C3I H;  1FJG L;  3M3Y H;  1PH4 A;  1IYJ B;  2UXD L;  1EWI A;  1LYL A;  2OQK A;  4YCU A;  1VQB A;  3PF5 A;  4LF8 Q;  2K5N A;  4BA2 I;  3HOW G;  3HOY G;  1IBL L;  3FHW A;  3ZJY C;  2QEX A;  4OWX B;  1X9N A;  3I4M H;  1SMX A;  3TS2 A;  1U5K A;  3STB C;  3GTP H;  4R4Q A;  1Q1B A;  2A8V A;  4GN3 B;  4UY8 C;  3H3V I;  2EXD A;  4DR1 L;  4DUZ L;  2E2H H;  2UXC L;  4LFC Q;  1HZC A;  1YIJ A;  2IX1 A;  4A3C G;  4X62 Q;  2KCT A;  3J81 j;  1K8G A;  2UXD Q;  2A19 A;  2XTI A;  4YCW A;  5AJ3 L;  2YTY A;  5ELN A;  2D62 A;  3AEV A;  4X65 Q;  2XGT A;  3G6E A;  1VQD A;  1UWV A;  1YJW A;  2VQF L;  4JI0 Q;  1MJC A;  4LUZ A;  1HZB A;  2UXB L;  3CPF A;  2Y0S G;  4HJ5 A;  4P71 A;  4IO9 A;  3M7N A;  5IP9 G;  1HZ9 A;  1VQA A;  4AYB G;  3GTG H;  2JK8 A;  2UXC Q;  1PH8 A;  1PA6 A;  4B3R L;  3KDF A;  2I5M X;  3F2B A;  5DLQ E;  5K36 G;  1I50 H;  4WJ3 M;  1HNW Q;  3KLW A;  2R7F A;  3J7A 5;  1NJI C;  4YHH L;  2VQF Q;  4BXX H;  3I2Z A;  4JG2 A;  5GAE C;  3UDG A;  4A3I G;  1CKO A;  2Q2H A;  5LMN W;  1MJE A;  4BY7 H;  1IBK L;  5FLM H;  3PSI A;  4JI7 Q;  4DR6 Q;  1AH9 A;  4PMW A;  2OTL A;  2JEB I;  1KRT A;  2JJQ A;  4A3E G;  4H02 A;  4MZ9 A;  2FXQ A;  2PI2 A;  2VY3 A;  3CCU A;  3PO3 G;  4DK6 C;  2R6G A;  1HNX L;  4YY3 Q;  3GTO H;  3HOW H;  3HOY H;  1Z47 A;  5IP7 H;  4B3M L;  5IYD G;  1VQO A;  3CC2 A;  3SGI A;  3S1R H;  2ATW A;  1AE2 A;  2IHF A;  4DK3 C;  2PQA B;  4HJ7 A;  3GD7 A;  1LM0 A;  1TWC H;  3ULP A;  3GTQ H;  1VQH A;  4OWW B;  2K14 A;  3S2D H;  3GO5 A;  3M85 A;  4GN5 A;  4GOP B;  1VQ6 A;  4HJ9 A;  4AIM A;  1XJV A;  1YBY A;  1BBU A;  3FP9 A;  5GQO A;  3A5Z B;  1YEZ A;  4C3J H;  1S72 A;  1KC8 C;  1X3G A;  2ZTD A;  4DR7 L;  5IP9 H;  4IOA A;  2QA4 A;  1YI2 A;  1WI5 A;  3RZO H;  1AE3 A;  4DV6 Q;  2F52 A;  2HIX A;  3NBH B;  2I0Q A;  1GO3 E;  4X62 L;  1Q1E A;  4PZ8 A;  4C2M H;  1EQR A;  3L0O A;  4GLV B;  4NB3 A;  3PO2 H;  4B3S L;  1G29 1;  4OO1 I;  1OXX K;  1T9H A;  3M4O H;  2E8G A;  2KHJ A;  3BJU A;  1PV4 A;  3A74 A;  1H95 A;  1YVC A;  1NTG A;  3U4V A;  2CWP A;  4HJA A;  1JJG A;  2D0P A;  4JI2 L;  4K0K L;  1C7Y A;  1N36 Q;  4A3E H;  4R4T A;  1QVC A;  2E5L Q;  1IXR A;  1VQG A;  5C0X G;  2OWO A;  2BA1 A;  3EN2 A;  3HKZ E;  4Y7N H;  4A3J G;  1EIY B;  3K7A H;  1PHJ A;  3J81 c;  3PO3 H;  3HOU G;  5HY6 A;  1FGU A;  1Q46 A;  1VQ4 A;  4B3S Q;  4JI3 L;  4LFB Q;  4YWK A;  1OXT A;  5IYD H;  2GVA A;  1CUK A;  1L2F A;  3KDF B;  3PUY A;  2AWN A;  4X64 Q;  3T1Y L;  2CFM A;  3KYH C;  4EQ5 A;  2JA8 G;  1Y1V G;  3TQY A;  2C35 B;  2HT1 A;  4DV7 Q;  1CSP A;  1N9W A;  2AMC B;  1XMO L;  4X66 L;  4LFA L;  3NEN A;  3HOX G;  2VW9 A;  4HJ8 A;  2Z0S A;  1BKB A;  1GVP A;  4J15 A;  1W2B A;  1VQN A;  3G71 A;  4BA1 I;  1PH1 A;  4JI3 Q;  3G4S A;  4JV5 L;  2I5H A;  3CMA A;  1XMQ L;  1PH9 A;  4DV1 Q;  1UE6 A;  3CME A;  3PF4 A;  2K52 A;  3W1B A;  1N36 L;  1IL2 A;  3ICE A;  1SR3 A;  1XPU A;  1VQC A;  5IWA Q;  2K4K A;  1SRU A;  5LMU Q;  1KXL A;  2PNH A;  4DAY B;  1WJJ A;  2ES2 A;  1XPR A;  3U58 A;  2BA0 A;  4L5Q A;  4JV5 Q;  3CAM A;  5FLM G;  1HZA A;  4OXP A;  3PIP A;  1PVO A;  1IBM L;  1XMQ Q;  1TWF H;  2V1C C;  1OXV A;  3F1Z A;  4LFC L;  3I7F A;  3GTJ H;  1X65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...