2VW9A

Single stranded dna binding protein complex from helicobacter pylori
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
108
structure length
108
Chain Sequence
MFNKVIMVGRLTRNVELKYLPSGSAAATIGLATSRRFKKQDGTLGEEVCFIDARLFGRTAEIANQYLSKGSSVLIEGRLTYESWMDQTGKKNSRHTITADSLQFMDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SINGLE-STRANDED DNA BINDING PROTEIN
publication title Single-Stranded DNA-Binding Protein Complex from Helicobacter Pylori Suggests an Ssdna-Binding Surface.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Dna binding protein
total genus 20
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vw9A00
5M3FH 2CCZA 3CPFA 1EWIA 2AWNA 4B3RL 2NZOA 3CQZH 3RN5A 2JA6H 3PO3H 3TEHB 1YHAA 3T1YQ 1V1QA 5C4JH 3CCEA 4HIKA 4QL5A 3NELA 3UE0A 4GNXC 1PH1A 4LF9L 2R7ZH 1A0IA 1SMXA 2GN5A 1X9NA 1I3QH 2NVYH 1OTCA 4A3CG 3KJOA 2JE6I 2HIVA 2YTYA 2UXDL 3T1HQ 1IBKQ 1SROA 4BA1I 1PYBA 5HGQA 4X64L 1TWHH 1V9PA 1CSPA 3W5OA 4DV4Q 1VQDA 1CKNB 4P71A 1RIPA 1HNXQ 1U0LA 4DV2Q 3S2HH 3TS0A 1XPOA 3EN2A 2IX0A 3RNUA 2ZTDA 3CMEA 3DLLA 4LFCL 4DV5Q 1K0RA 2JA7H 2LXJA 3RZOH 2AMCB 1I94Q 1B70B 1HZAA 3U50C 4A4IA 4HIOA 4ME3A 3KF6B 4AH6A 2HQLA 4HIDA 3UDGA 2VQFL 3PIOA 4JI6Q 4UP8A 4HJ8A 4GKJQ 2RF4A 3NENA 2UUAQ 1N9WA 1Q7YC 3TS2A 3TQYA 4LF4Q 3GTLH 4K0KL 2Z6KA 3CC2A 2JA9A 1L1OC 4P75A 1K9MC 2K5VA 1J5EQ 2K4KA 4B3SL 1FJGL 1E22A 4A3GG 4NPSA 4LF8Q 4LFBL 3GTQH 2N3SA 2IY5B 3K8AA 2ZJRA 3AFPA 1TWAH 1UE5A 4BXXG 4BY1H 4YCWA 4BBRH 3K81C 2ZM6L 4AYBG 5C3EH 1M90C 4JBMA 5IWAQ 2OQ0A 1OXXK 3FKIG 4DR2Q 4O2DA 4JI2Q 3RLNA 4DR5L 4LFAQ 1QVCA 5AJ3Q 4A3EH 4LW1A 2Y0SG 1X54A 4EX5A 3PO2G 1RL2A 2UUCQ 4GKKL 4JCVE 2JK8A 5IYCG 4HJAA 3J7A5 5M5WH 1ASZA 2ES2A 4BY7G 1K83H 2RHSB 4YCUA 5C44G 2QA4A 4GNXB 3HOYG 5C4XH 4OXPA 1NTGA 3OW2A 3CCQA 1BBWA 4DPGA 1IBLL 4DR6L 1VQIA 2GVBA 4B3RQ 3H3VI 3B6YA 3KOJA 5IP9H 3M85A 1XMQL 4JI5L 2H5XA 2K5NA 1KXLA 4LF6L 3PV0A 4QGUA 4IPDA 4POGA 2JA8G 4DUYL 2EQSA 4L5TA 3KDFB 1EQRA 1KQSA 2ZJPA 2AWOA 2F52A 1VQ7A 4PG3A 2VQEL 4IFDJ 1FGUA 1K8GA 1HNWL 4YWLA 4L5SA 2CQOA 3J80c 3F8TA 2BA1A 1KL9A 1VQ5A 4LF7Q 1TWFH 3PIPA 1XNQL 1E24A 2JQOA 3A5UA 1E7ZA 1QZHA 5IE8A 4A3MG 2N78A 3H0GG 2OTLA 3AFQA 1L1OB 2XGTA 3F2BA 1JJCB 2WB1E 1Q86C 5JEAG 1E3PA 3L7ZC 2KCMA 4OO1I 2CWPA 3E0EA 4JBWA 4XTCS 2K5HA 4ALPA 4AQYQ 1HZ9A 1EOVA 3I56A 4K0KQ 1PH3A 1X3GA 4HJ5A 3GTGH 4B3SQ 3S1RH 4DV6L 3HOXG 1R9TH 1NY4A 5M3MG 4L5QA 5FLMH 3UE1A 1Y1WH 2YYZA 1L0WA 3ICEA 3S15H 2UXBL 4A3IH 1GKHA 1PH8A 2A8VA 4PZ8A 1L2FA 3CPWA 3HFZB 4QJFA 3TRZA 3NBHB 3PUXA 2WAQE 5GROA 1PH4A 2E2IH 3HOWH 1UEBA 4YY3L 3OYYA 3M4PA 2UXCQ 5FJ8H 1UE7A 2VY3A 1XNRQ 2HHHQ 1AH9A 1HZBA 4DR5Q 4GN3B 1QZGA 2RHQB 3DM3A 2JA5G 1JE5A 3CD6A 2JJQA 4P72A 1JJGA 5GAEC 3J81c 5DLQE 4C2MH 4DNIA 4GOPC 1EUJA 2BH8A 4A93H 1P16A 1KRSA 3KF6A 4JG2A 2MQHA 4DV7L 1N36L 3PUZA 1YIJA 2PNHA 2BH2A 3S1QH 1YVCA 4IOAA 3S1MH 4IPCA 2CWAA 4DR4Q 4H02A 2OTJA 1IBLQ 4OONA 2JA6G 1QUQB 2HIXA 3AQQA 2NVQH 3S2DH 1K73C 2DGYA 4KHPL 1SLJA 3BU2A 5LMNL 1XMQQ 2E5LQ 4B3MQ 3HOUH 4HIMA 4DR7Q 4DR1L 2NZHA 4LF6Q 3F2CA 3FHWA 3I4MH 3S1NH 1PVOA 1G291 4MNOA 4NXNL 1OXSC 4HJ7A 5LMUL 4GLVB 2KCTA 2OCEA 3JAMi 2VQEQ 1Z9FA 2ZTCA 2LXKA 3GO5A 2IT1A 4DV0L 1XPRA 4JI7L 3H15A 2XTIA 1VQ6A 4X65L 1MIUA 1GD7A 1A63A 2VL6A 2UU9Q 1J6QA 1KC8C 3ULJA 4UP7A 5GADC 3I4NH 2LSSA 3I7FA 1PH6A 4DAMA 1I5FA 1LYLA 5C0XG 2KENA 1YJ9A 2K50A 5GQOA 1LM0A 2UUBQ 2L15A 2N49A 3CCUA 4DUZL 1K3RA 4A3CH 2Z6KC 1NMFA 1NJIC 3OTOL 3L2PA 4B3TQ 1VQ4A 2MFIA 1IXRA 1OXUA 4X66Q 2UXBQ 4R4CA 4BY1G 1X65A 3PGZA 3KDFA 4QIWE 4AIMA 5C0XI 4IFDI 4OWXB 2Q2IA 4JOIA 4OX9Q 5C3EG 4GOPB 3VDYA 3CCJA 4POFA 3STBD 2MNAA 3GTPH 1PA6A 3RLOA 2DUDA 1VQJA 3STBC 1Q12A 1Q46A 2Y0SE 2I5HA 4YHHL 2F4VL 4J15A 4A3LG 4NXML 1PH7A 2KHIA 2VZAA 3KYHC 4DV7Q 1S72A 1CUKA 3PSIA 4A3BG 3RN2A 5IT9c 2D62A 5C4XG 1IZ6A 3ULLA 4JI1Q 4Y52H 1VQAA 1VQGA 1S3OA 1XJVA 2VUMG 4LNQA 1HR0L 2JEBI 3HOVG 3PF5A 1N34L 5IP9G 1Z47A 3KLWA 4A3FH 3HOZG 4A3GH 2IHFA 1E1OA 3UDFA 4BBSG 4KHPQ 3BZCA 3G71A 4R4TA 4BXXH 4A75A 4UPAA 4R4QA 4DR1Q 1TXYA 2D0OA 4LF9Q 1SN8A 4LWCA 1JB7A 1C7YA 4WJ3M 1VQKA 4KHZA 4LUZA 1PYSB 2K14A 5BR8L 2UXDQ 4Y7NH 5LMUQ 3H3VH 4DV1L 1VQ8A 3FKIH 4X64Q 4DV0Q 1WFQA 1Q81C 4DR3L 4OO1G 2KHJA 3PO2H 1BVSA 4A3DG 4JI3L 4FDBA 4GN4B 4OWTB 3FP9A 2ALYB 1AE3A 3F1ZA 3MEFA 4JI0L 1YBYA 4LFCQ 2B63H 5C44H 4IO9A 1MKHA 3ERSX 3W1BA 2Q2HA 1N33L 2ATWA 3A0JA 4L5RC 3AYHB 4DAYB 2VQFQ 1WI5A 3IRBA 4YWMA 4TVAB 3A5ZB 4XIGS 1Y1VG 2PI2E 3S17H 5IP7H 2F3IA 3I55A 1Q1EA 4A3JH 1XPUA 3CW2C 1XNRL 4RMFA 2JA8H 1SE8A 2FXQA 4YCVA 3TREA 3T1HL 2ZJQA 1FJGQ 1O7IA 1YHQA 1HH2P 1NE3A 2Z0SA 1YZ6A 4DV4L 1WOCA 1QVFA 4LFBQ 2VNUD 5IYDG 1BBUA 1HNXL 4HJ9A 1KAWA 1YEZA 2NN6G 4DV2L 1K8AC 1EFWA 1CKMA 1PH9A 2JEAI 3HOWG 1N32L 3LGJA 3RR5A 3K7AH 4DV5L 2ZM6Q 1IBML 1X55A 3U4ZA 3UDIA 1I94L 1CKNA 3H0GH 5IYBH 4JI6L 3E9IA 3ER0A 1XMOL 3I4NG 4P74A 4GKJL 1PH5A 5E7NA 2R93G 4A3KG 2I0QA 5M5YH 2R6GA 4DV3L 1YITA 4GKKQ 2NVXH 4LF4L 2NN6I 1CSQA 1YNXA 2EIFA 3HKZE 2MO1A 5M3FG 4IJLA 3HOXH 5ELOA 1HR0Q 3HKSA 5M3MH 4LF8L 3KFUA 5JJKA 4DR6Q 2ZTEA 3PO3G 3JC66 3RZDH 3HOUG 2YTXA 5IY0A 3S24A 1EIYB 3CC4A 4BA2I 4GS3A 4DKAC 1MJCA 5JJIA 2IX1A 2R7ZG 1A62A 1B8AA 3G6EA 1KHIA 4JI5Q 2WAQG 2A1AA 3J7ZC 5IWAL 2CFMA 1GM5A 2R92H 1VQNA 4DUYQ 1D8LA 4P73A 1S40A 1C9OA 4DR2L 1FL0A 1X6OA 1VQLA 4GOPA 4JI2L 5GAHC 1Q82C 5AJ3L 4LFAL 3G48A 1YI2A 2JA5H 1G51A 1GVPA 1LTLA 1EQQA 4JI8L 3M4QA 1HNZL 3S14H 3AEVA 2E2JH 2OWOA 1X56A 1XNQQ 2JA7G 1WCMH 2ASBA 1VQPA 4C3JH 4JBJA 1N33Q 3GTMH 3CC7A 1GO3E 3ZJYC 3M4OH 3PUWA 4JV5L 3D31A 4JC0A 1Q8KA 2AHOB 1UWVA 4GNXA 4IFDG 2EXDA 3I2ZA 1WJJA 1VQFA 4JYAL 2PQAB 3J81i 1G6PA 5JJLA 1T9HA 4PMWA 1E1TA 5FLXc 4DV6Q 5LMNW 2A19A 3I4OA 2YTVA 4C3IH 3PF4A 5JEAJ 4A76A 1N32Q 3KJPA 1HZCA 4LF7L 1EIFA 4BBRG 3G4SA 4UY8C 2VS1A 1PV4A 1C0AA 4X6AH 3W1GA 4AYBE 3ULPA 5M5XH 1IBMQ 4R1JA 1UE6A 4JOIC 4QQBX 4YY3Q 3CCSA 4EQ5A 1VQCA 2PMZE 4X62L 2GVAA 3CAMA 4MTNA 3K0XA 1M1KC 2AKWB 1XMOQ 3D0FA 4R4IA 4A3EG 3M9BA 2CKZB 4DV3Q 1X3FA 2I5LX 3J81j 2QEXA 2D0PA 3K80C 2E8GA 2N8NA 1L1OA 1LUZA 4AQYL 3BJUA 1N36Q 4MZ9A 3A74A 3EBEA 2K52A 2IHEA 1QVGA 1JT8A 3GTJH 4NB3A 1VQBA 1X3EA 4LUOA 4A3FG 4WJ4A 1VS0A 3F2DA 1UE1A 1H95A 1SFOH 4GN5A 2OQKA 5LMNQ 4O0AA 5HY6A 1KRTA 1A8VA 1V43A 2V1CC 3CCMA 2UXCL 1PH2A 3NEMA 1YHBA 2B3GA 2B29A 2PI2A 3PUVA 4QY7A 1KD1C 1Y14B 3KF8B 2HHHL 4NXNQ 4GLXA 2NVTH 4C3HH 1YJNA 4JI7Q 4JI4L 4A3LH 1ASYA 4IOCA 2K75A 3E9HA 3L0OA 2I5MX 1OXTA 4JI8Q 4X65Q 1HNZQ 3UDXA 3WWVA 2B63G 4A3BH 3SGIA 1D7QA 4IPGA 5IYCH 1U5KA 3BZKA 3Q8DA 4BY7H 1I50H 2R7FA 2RCNA 3HOYH 4DR4L 1VCIA 1EYGA 3GTOH 4JV5Q 1VQOA 2VUMH 1IYJB 4KI0A 1W2BA 3HOVH 3HOZH 2BA0A 4PZ6A 3PCOB 4YWKA 4BBSH 1NBWA 2E5LL 3T1YL 4B3ML 5IP7G 4APVA 3GTKH 4DR7L 4KLKA 4A3JG 3EIVA 5K36G 4JYAQ 1HR0W 1P8LA 2KBNA 1QUQA 4IJHA 4IPHA 3MXNB 4DUZQ 3GDEA 5EAYA 1KIXA 2E2HH 1VQMA 1IBKL 2MO0A 5ELNA 5FLMG 5C0XJ 3OTOQ 1TWCH 1VQHA 1Y1WG 4LF5L 1IL2A 1AE2A 1CKOA 3PUYA 4A3IG 1PFSA 4LUVA 3CCRA 4R4OA 4A3DH 3CMAA 2UU9L 3K7UC 1I6HH 1N8RC 4DK6C 1MJEA 5IYBG 5FJ8G 4X62Q 3M3YH 1YJWA 4A3MH 1JJ2A 1JMCA 2YU9H 1OXVA 4JBKA 1FVIA 2F4VQ 4YHHQ 1SRUA 2WB1G 4NXMQ 4A93G 2UUAL 4DK3C 1Y1VH 4RG1A 3CCLA 4OWWB 2ID0A 3GD7A 2UUBL 1HJPA 2VW9A 3JAMc 3J80i 2R7DA 1J5EL 4B3TL 2YV5A 4X66L 3CXCA 3RLFA 2PQAA 1N34Q 2C35B 3CP0A 2WP8J 4GLAC 1PHJA 5IYDH 4PZ7A 4OX9L 1WYDA 3S16H 1Q1BA 3U58A 2WFWA 2R92G 1HNWQ 1DGSA 1NMGA 3I4MG 2Q2UA 4TQUS 5J3BA 2HT1A 5BR8Q 3CCVA 4DV1Q 1XTDA 1VQEA 5H1SE 1B7YB 5GAGC 1W3SA 4JI4Q 4UP9A 4LF5Q 4DR3Q 2Q2TA 4A3KH 2R93H 2UUCL 1TWGH 4JI3Q 3CF5A 1SR3A 1WCMG 2QGQA 4JI1L 3U4VA 1BKBA 1VQ9A 4JI0Q 3HKZG 3M7NA
chains in the Genus database with same CATH superfamily
5M3FH 2CCZA 4B9XA 2AWNA 1QG7A 4FXKC 3S2HB 1QNUA 5FLXE 3TEHB 5EPKA 1TVXA 3CCEA 2R7ZH 1SMXA 1G6ZA 1D5XC 4A3CG 3SDZA 1IBKQ 3FDTA 1QILA 3TZUA 3W5OA 4LAAA 4P71A 4XT3B 5I6WA 4DV2Q 3DXJC 2XWJB 2IX0A 3RNUA 3DLLA 4LFCL 1SMYC 4K2KA 3RZOH 2AMCB 2V4DA 1GOZA 2EY6A 2Z6BA 1HZAA 4A4IA 3EQLC 3QG1A 2VQFL 4HJ8A 4IUTA 2RF4A 3NENA 4ZKCB 3DMUA 1N9WA 1EY7A 3GTLH 4K6DA 4KMUC 3CC2A 1L1OC 4P75A 2NUCA 2K4KA 4B3SL 1HA5A 1ESFA 2ZJRA 3MXNA 1WD1A 3AFPA 2J7ZA 1FYCA 4DXFA 4BWGB 4BXXG 4BBRH 4WFN3 1F77A 4AYBG 5C3EH 5IWAQ 3FKIG 4DR2Q 4JI2Q 4QIWB 2RQXA 4LW1A 4EX5A 1E0BA 2SDFA 1RL2A 3MXPA 1KNEA 2JK8A 5IYCG 3J7A5 4BY7G 1K83H 2QA4A 3FKIB 5I9OA 4GNXB 1G91A 3KOJA 4KKSA 1EU3A 2EYPA 4JI5L 4POGA 4IPDA 1IL8A 3ND8A 4L5TA 1EQRA 1BCPF 2KEDA 4PG3A 1FGUA 1K8GA 2CQOA 3J80c 1KL9A 2A5HA 1O7YA 2AUKA 1TWFH 4XQQA 2JQOA 3BDOA 5IE8A 4A3MG 2CHBD 1H9JA 2F0QA 2XGTA 3F2BA 3P20A 3JAME 1Q86C 1KLGD 1E3PA 2KCMA 4JBWA 2K5HA 4ALPA 1PH3A 1FR3A 3GTGH 4B3SQ 2MPMA 1M8AA 5M3MG 4UDUC 4L5QA 1PRTB 3EJIA 3UI2A 3R8BA 5FLMH 1Y1WH 1L0WA 2L4NA 4A93B 4KY7A 4CJ0B 1GKHA 2Z4HA 3KLSA 1K0SA 2WIIB 1HA6A 3CPWA 3HFZB 4ZYSA 3D4WA 1PFBA 5GROA 5M3MB 1UEBA 3GV3A 2VB2X 3OYYA 3RZDB 1B1ZA 1ZKOA 1WVLA 2HHHQ 2AQ3B 1A3VA 1AH9A 3K5MA 2QW7A 1SSOA 5C4ZA 2JA5G 1JE5A 3CD6A 4RGMA 1PZID 5GAEC 3J81c 2C5CA 4H0LC 2RVLA 4DNIA 1EUJA 1KRSA 4JG2A 3S1QH 1W6KA 3PUZA 1N36L 1YVCA 1LTBD 4FYDA 1IYVA 2OF1A 2SEBD 2JA6G 3S2DH 3QOJA 3HOUH 4KD3A 4HIMA 3H3VC 4C3JB 4DR1L 4N9TA 1S5BD 2A73B 1GJXA 1DD2A 3J7AV 3FHWA 5KYIA 3I4MH 3BG3A 3S1NH 1PVOA 4CDDC 1FNUA 5EQ0A 2OCEA 2LXKA 3GO5A 2XTIA 4KN4C 4X65L 1SYDA 1GD7A 1KC8C 2EY1A 3ULJA 4UP7A 3I4NH 1HTPA 1TS2A 1BCPC 2IWHA 1RDPD 1PH6A 1LT6D 3FMCA 2K50A 2B2WC 1BUVT 4RH6A 2A6HC 3GTPB 2O4XA 3A8IE 3MEHA 3CCUA 4DUZL 4A3CH 1NJIC 1QB5D 2MFIA 1CFMA 2DJGC 1X65A 4CKEA 1HFGA 2K5WA 4OWXB 4JOIA 1D1KA 5IGGA 3CCJA 3STBD 2MNAA 3DHQA 2G5DA 2XSCA 3AB9A 2Y0SE 2NYZD 3KYHC 1WTVA 1CUKA 2NVTB 1IZ6A 2F0KA 4C3HB 3I70A 1VQAA 1VQGA 1SXTA 5CBAE 3MFYA 1S3OA 2VUMG 2KECA 2PQEA 2QF7A 3HOZG 3S9WA 2IHFA 4PNYA 4BXXH 1I50B 4A75A 4DR1Q 1ML0D 2VUMB 4WJ3M 2EVBA 2B39A 2L12A 4WRDA 4LUZA 3HOZB 1PYSB 3VR4A 3FKIH 3GTKB 1EY0A 4ZQ3A 4GN4B 4KTAA 4OWTB 3F1ZA 1YBYA 5D14A 1MKHA 4OIJA 3W1BA 4L5RC 1STNA 1I6HB 3K7AB 3OWFA 1I4GA 3M3YB 3N6RA 4P2CB 1Q1EA 2YU9B 2JP1A 2FMMA 5M5YB 1WOCA 4LFBQ 1PTOD 2E2DC 2EE1A 1SYFA 1U4PA 4ULLA 1HUNA 1WTRA 1CKMA 4F7XA 1B50A 2F0FA 3LGJA 1X55A 3U4ZA 1I94L 2M9VA 1YNJC 3E9IA 5CV7A 1PH5A 3BYYB 4A3KG 1XYIA 2I0QA 2R93G 2R6GA 1WTWA 4LF4L 2KEEA 2H4OA 3MA2B 3DM1A 4IJLA 1PRTF 1HQRD 1PYWD 1Y8PB 3HKSA 3I4LA 4TKOB 5AFWA 5M3MH 4A3KB 4C1NI 3RZDH 1Y69U 2YTXA 1C8CA 5IY0A 4DKAC 1A62A 2FHTA 3G6JB 3GTMB 1EOTA 1TY2A 4IUUA 1S40A 1X6OA 3ZYYX 2EYHA 1V8QA 3T53B 3G48A 2JA5H 1G51A 1I3QB 5JVG3 3AEVA 2JA7G 1TWHB 4HCEA 2ASBA 4C3JH 2XN9C 1NAPA 2ZXRA 4ID6A 3D31A 1Q8KA 1UAPA 4ZKBB 2EXDA 1LTAD 5J1ZA 2IPKD 4QF4A 1CA6A 3I73A 5JEAJ 4A76A 2NB0A 3KJPA 1HZCA 4UAIA 3EA6A 4AYBE 4R9WA 2WINB 4JOIC 4RGNA 3CCSA 3G7LA 2PMZE 1PTOH 4BY1B 4A3EG 1PMRA 2HCCA 4J8QA 3QJYA 2L11A 3A54A 2I5LX 1H9SA 3J81j 2E8GA 1JCKB 4MZ9A 1JT8A 3SXHA 1K8OA 4A3EB 4NB3A 3R3OA 4WJ4A 1DYQA 4K5VA 4A3FG 3SHLA 1EWCA 1LT5D 1H95A 5M5WB 4GN5A 2OQKA 5C4XB 4O0AA 1V43A 3VYSA 3CCMA 4K8IA 2UXCL 1PH2A 3IFTA 2B3GA 2B29A 2NVTH 3HOVB 4NXNQ 3KF8B 2WV6D 4C3HH 1YJNA 3CRLC 5FO8B 1GUNA 2K75A 4IUVA 3UDXA 4EGVA 2B63G 1U5KA 3BZKA 3Q8DA 1B9NA 1G2SA 1I50H 3U9OA 2RCNA 5EGTA 1WTQA 1VCIA 4V190 2VUMH 3HOZH 4A3DB 4ZK9B 2E5LL 5A2QL 4DR7L 3GTKH 2B2TA 4ZUIA 5LL6S 4IPHA 2X69A 2MJ8A 2E2HH 3NP8A 3WDNA 5ELNA 1C4QA 4RA8A 3OTOQ 1TWCH 3OHXC 1CKOA 4A3IG 4LUVA 1PFMA 2XIWA 1MSGA 2KJXA 1EYAA 1I6HH 1IW7C 4DK6C 5IYBG 2LFNA 3S15B 3M3YH 4A3IB 3ONAB 1KABA 1JMCA 2YU9H 4JBKA 5ELBA 2QEJC 2XRQD 2UUAL 4OWWB 2ID0A 1U4MA 2VW9A 2R7DA 3ERQA 1J5EL 3CXCA 1N34Q 2X6LA 4I65A 1X32A 5IGDA 1PHJA 2NTSA 3S1MB 3S16H 4KN7C 3U58A 1DGSA 5M3FB 1NMGA 3K58A 5J3BA 2HT1A 4CKBA 4O1NA 1CHPD 5GAGC 4LJZC 2A69D 4A3KH 2R93H 1ET9A 2VB3X 3HKZG 3D4DA 5ELEA 3TDQA 1EWIA 1RD9D 2XWBB 1Y8OB 4HIKA 1SE2A 3NELA 3NPPA 4CJ1B 1PH1A 4LF9L 1A0IA 2GN5A 3CHBD 4HEDA 1I3QH 2PW5A 2K04A 5HGTA 3KJOA 2YTYA 3T1HQ 4C3IG 4X64L 1TWHH 1V9PA 1CSPA 5FLXL 4DV4Q 3FEWX 1HNXQ 3GTLB 1U0LA 1SMYD 3KF8A 3SK5A 3TS0A 3CMEA 2JA7H 1E2WA 1ZEQX 1LTID 1GHJA 2AQ1B 4JI6Q 3PIOA 4HMJA 1O80A 4BBRB 2UUAQ 1Q7YC 3TS2A 1RF2D 1AW7A 2EYJA 1J5EQ 4N8X1 2TMPA 4A3GG 1A2TA 2F3WA 2BE5D 4LF8Q 1ICFB 1TWAH 2F0WA 4BY1H 5J39A 4PV1C 4G4KA 2EXZA 3DWQA 4A3GB 2OQ0A 2RSOA 1GUSA 4O2DA 2O5IC 3RLNA 5EKLA 4A3EH 3PO2G 2Y0SG 4CDCC 4JCVE 1XXGA 5FO9B 5M5WH 5C4XH 4OXPA 3OW2A 2A68C 3CCQA 1UNSA 3PO2B 1BXTA 1J9OA 1IBLL 3H3VI 1S5ED 2Z4IA 1TWFB 5IP9H 1XMQL 1CTMA 2K5NA 1KXLA 1NNXA 1S5CD 1MGSA 1ET6A 2EQSA 1SJED 3PQIA 5J22A 1VQ7A 5A35A 2VQEL 1EYCA 3VA5A 2SNMA 4RHSA 4L5SA 2WKDA 4A3JB 2F0IA 4WORA 3GTGB 1VQ5A 2X6GA 1XNQL 1E24A 5DM73 5CV8A 1QZHA 2N78A 3H0GG 1Y1WB 3S17B 3AFQA 5EJWA 2K01A 4H13C 4ZAIA 2L9HA 5JEAG 1EY4A 3E0EA 2RDGA 3H0GB 3OPOA 4HJ5A 1RJTA 4DU9A 1R9TH 3H09A 3JAML 1X3QA 3UE1A 2WB1B 2YYZA 3KBXA 1LT4D 3ICEA 3S15H 4A3IH 2A8VA 1PH8A 4PZ8A 1L2FA 4MIUA 3TRZA 3PUXA 1PH4A 1GUWA 1LACA 2M00A 2VY3A 1XNRQ 1TIID 2CVRA 4GN3B 1B3AA 1JJGA 2DJFC 4DAVA 2R92B 2BH8A 1P16A 2J4XA 1SYGA 3I4MB 2MQHA 2BH2A 3S1MH 4DR4Q 1YNNC 3NQTA 2TSSA 1IBLQ 2OTJA 4OONA 2EDGA 4KKUA 1QUQB 2HIXA 4KHPL 5LMNL 1XMQQ 1AFPA 2XRSD 1MI2A 3I4NB 3ITPA 2HD3A 2EYMA 1G291 3MAQA 4L6TB 3LX0A 2KCTA 2VQEQ 3JAMi 1Z9FA 2P5ZX 3BDLA 4RFBA 2B2UA 4DN4M 1XPRA 4JI7L 5T1IA 5D3DA 1ENAA 2UU9Q 4ZCKA 1WTXA 2LS01 5GADC 4XDXA 1WTOA 1I5FA 2KENA 4DNRB 4MN3A 4RWSC 5C3WA 5BN4A 2OT2A 5E4XA 4FVMA 3L2PA 1OXUA 4X66Q 1SYBA 2A6EC 4R4CA 2BCOA 3EFXD 3PGZA 4IFDI 1SEBD 5JVH3 2Q2IA 4OX9Q 4GOPB 3DEOA 1PA6A 3RLOA 2DUDA 1VQJA 1WTPA 1Q46A 2F4VL 4YHHL 1ILPA 4J15A 3HRZC 4NXML 4AYBB 3RN2A 5IT9c 4Y52H 4JI1Q 2PMZB 2JYOA 2F0OA 1HR0L 4A3GH 1U4RA 3KLWA 4KHPQ 1CQVA 3TN2A 4BY7B 4R4QA 2D0OA 1SN8A 4KHZA 1F9RA 2K14A 5BR8L 3H3VH 4KHVA 4DV1L 4FXGC 3NUCA 4DR3L 2KHJA 3PO2H 1BVSA 1I6VC 2F0HA 5C6AA 4JI3L 1AE3A 2EYFA 4JI0L 4ME5A 4FF2A 4LFCQ 4IO9A 3HG9A 5KGUA 3IL8A 4N9PA 4IALA 3A0JA 1SNCA 4DAYB 2VQFQ 1I4QA 4XIGS 2PI2E 1G2TA 4A3MB 2F0EA 4A3JH 3IFDA 3CW2C 5K36H 3CKIB 1SE8A 2FXQA 3TREA 5IGCA 5KNDA 2ZJQA 3Q0AA 1YHQA 2Q8IB 2VNUD 1NCVA 1QVFA 3MVVA 3A8KE 3LWUA 5IYDG 3S17H 5C5LA 3WOEA 1N32L 1PH9A 2JEAI 1BNZA 3HOWG 3RD4A 1EYDA 2HCIA 4DV5L 3VYTA 3K5OA 3H0GH 1GUOA 3FRPB 3ER0A 4ZLTF 2EY5A 4P74A 4GKJL 4QB4A 5JEAH 4DV3L 4HAEA 4QCLA 3Q22A 1YNXA 3HKZE 2K32A 1II3A 3R2IA 4IUQA 5ELOA 1HR0Q 2JA5B 3KFUA 3TP7A 2KUMA 3Q24A 2ZTEA 4F87A 2EZVA 3S24A 3J7AF 3CC4A 2F0MA 4HSPA 2BOSA 4GS3A 4BA2I 5JJIA 5JAVA 3GQBA 4JI5Q 1KHIA 2E74C 2WAQG 1FNVA 4RAUC 3J7ZC 4G7HC 5CGKA 2R92H 2JA6B 1D8LA 4P73A 4IZ8A 4GOPA 1ZYRC 1Q82C 5AJ3L 4LFAL 1X3PA 4X3TA 2K05A 5NUCA 2QILA 4CBVA 1PXUA 3V05A 2B2UC 5DAUA 5EKIA 3KLRA 1B9MA 2EYOA 1BDOA 1GO3E 3NHHA 4JV5L 3NSWA 3PUWA 3VYRA 3A7AB 2L5TA 3BZDB 2AHOB 4GNXA 3FVQA 1WJJA 1VQFA 1PTOB 1PZKD 2I07B 4G7OC 1G6PA 4PMWA 2HDMA 1TKWB 2A19A 1EY8A 1F2MA 2R61A 1KNAA 1DOLA 1N32Q 3BVGA 4X3SA 5IIFA 4LF7L 1EIFA 2VS1A 1C0AA 3MTSA 4X6AH 5IODA 3ULPA 4R1JA 4M1UB 1B44D 2PNRC 3CAMA 4MTNA 3K0XA 2AKWB 4R4IA 1DOKA 3K5NA 5FO7B 3M9BA 2CKZB 4DV3Q 5LL6X 4AQYL 2D0PA 3BJUA 1N36Q 3A74A 3GTJH 2EJFC 1X3EA 3F2DA 1UE1A 4ODGA 3O13A 4OEMB 1GXDC 3T4AC 1EL0A 5HY6A 1KRTA 1STAA 4HCSA 1TR5A 1A3UA 4QY7A 1KD1C 1Y14B 3NTIA 3X3MA 4FNFA 4KY5A 3I8ZA 1EIHA 1F2ZA 2H1EA 3SE0A 4X65Q 4DXGA 5IYCH 3L3OC 2E2HB 3D6WA 4BY7H 1MHWC 1BQQT 1TWCB 4B9WA 2F0GA 5JPMC 4JV5Q 2EYLA 3I72A 1O78A 1W2BA 1FNWA 4B3ML 5IP7G 4APVA 4KLKA 2KBNA 5EPJA 4IJHA 4XYQA 4DUZQ 1KIXA 3GDEA 1SDFA 5EAYA 4EVOA 1IL2A 4LF5L 1VQHA 2KHSA 1AE2A 3PUYA 5ELCA 1IW7D 3QIAA 5CV9A 2RDFA 3MWYW 2IJ0A 1STHA 3NK9A 1HQMC 4DGZA 4A3MH 3NTKA 3E6ZX 1QE6A 1SRUA 3S16B 4DK3C 1ENFA 3GD7A 2UUBL 2NTTA 4CJ2C 4LK1C 3SK4A 3SEBA 4B3TL 2YV5A 2R93B 3OIQA 2J0TD 3MXUA 4GLAC 3NXWA 5IYDH 3R93A 1WYDA 3P1HA 1Q1BA 2Q2UA 4J6HA 2E76C 3CCVA 1JC7A 5M9OA 2B2YA 3QOLA 2EOTA 3CF5A 1WCMG 1VQ9A 3U4VA 3CPFA 2QKIC 1KDCA 3CQZH 3SK8A 2JA6H 1EFID 1ZXTA 1V1QA 2JA7B 1DCZA 3UE0A 4GNXC 5FOBB 3PIO3 1D5ZC 1OTCA 5CBEE 5DNFA 2MP1A 2JE6I 2UXDL 1SROA 1PYBA 2CW0D 4ZUJA 5HGQA 2XVSA 1VQDA 1CKNB 1XPOA 2ZTDA 1K0RA 2LXJA 3MZ5A 1I94Q 1B70B 1HXYD 3TZDA 4U673 4HIOA 1TWAB 2HQLA 4RKLA 3MXGA 2ENBA 4I7ZC 1LO5D 4KD4A 1PTOF 3TQYA 4LF4Q 1SE4A 2Z6KA 2QDBA 2JA9A 1K9MC 1FJGL 1F2YA 3R2TA 1E22A 1SE3A 2N3SA 4K8JA 1WTHA 3K8AA 5EBDA 1UE5A 4WJWA 1A3TA 3L9AX 2ZM6L 1KDBA 1M90C 4JBMA 4A3FB 1PRTC 4F88A 1F9SA 1JWSD 1OXXK 1RHPA 2M2LA 3ND9A 4CKCA 3SVMA 4YIJA 2ICIA 2WKCA 1QVCA 1GHKA 3U9SA 1X54A 2OEOA 4ABNA 4GKKL 4NDXA 3DWPA 2A68D 4Y7NB 1ASZA 1AZPA 2RHSB 4YCUA 5C44G 3HOYG 1U9RA 1EWHA 1NTGA 1BBWA 2AQ2B 4FF4A 3W2DA 4B08A 5BN5A 4DR6L 3P75A 2GVBA 1DM0B 2B63B 2JN4A 2F0SA 1D5MC 4LF6L 4QGUA 2JA8G 1H9RA 4DUYL 2ZJPA 2AWOA 1M4VA 1O7ZA 4IFDJ 1HNWL 3I90A 2BA1A 1A2UA 3PIPA 1K3BC 1R9TB 1B3QA 1E7ZA 4JW0A 3TP8A 2OTLA 4Q5VA 3PMFA 1L1OB 5ELDA 1EY9A 1JJCB 2VXWA 4XT1B 3T56B 4OO1I 3NE5B 5JJZA 1X3GA 4X3UA 1TS4A 4DV6L 3HOXG 1NY4A 4TSSA 2KOLA 2NVXB 1PFNA 3RUZA 1RTOA 3MFGA 3NBHB 2WAQE 3CU7A 5EPLA 1JB3A 4YY3L 2UXCQ 5BN3A 1UE7A 1VMPA 1QZGA 2RHQB 2JJQA 3AMUA 2SNSA 1YNND 3LWEA 1YIJA 1PZJD 4L63B 5G3LD 2FJ2A 3AQQA 3C1EA 1UEAB 1K8MA 3S14B 1MBYA 2E5LQ 5KYLA 1ENCA 4DR7Q 3HKZB 2NZHA 4FP5D 4LF6Q 2NWGA 2GA4B 1CQFA 1OXSC 4XQJA 1HNWQ 5LHY1 4DV0L 1EEFD 1VQ6A 4NKLA 1MIUA 1CHQD 1U4LA 2KA7A 2VL6A 2PPBC 1J6QA 5IGEA 2LSSA 4C3IB 2L0CA 1K28A 5CORA 1LYLA 5GQOA 1LM0A 4FF1A 2F0LA 2RA4A 2Q8TA 3A55A 4IN3A 1K3RA 4HMIA 2Z6KC 2LKVA 3K57A 1IXRA 1EZ6A 4U68A 4K5XA 5CYUA 4OL7A 4XQNA 4AIMA 1W6JA 5C3EG 4HR7B 3VDYA 1STEA 3IKJA 4DA2A 4POFA 4E6IA 4A3LG 5I9PA 1PH7A 2KHIA 2PYKA 4A3BG 3PSIA 1LLRD 3D8GA 1S4ZA 5KNBA 3ULLA 5DM63 3E0JA 1G8ZD 1LTGD 4LNQA 2Y0SB 1Z47A 4A3FH 4A3BB 3UDFA 3G71A 5CMDA 3GTOB 1TXYA 4LF9Q 4LWCA 1JWUD 3DEPA 2K6AA 2B2TC 4Y7NH 3NBHA 1BCPB 5I4DA 4X64Q 4DV0Q 1L0YB 2D9UA 1AP0A 1Q81C 3TP6A 5I2YA 2ALYB 2B2VA 2CH4A 3MEFA 1BO0A 2B63H 1S5DD 5C44H 1TT2A 2ATWA 3QR8A 1HHVA 1GUGA 3AYHB 4EQNA 1SYCA 3KBGA 3IRBA 4YWMA 1Y1VG 3Q6SA 3URYA 2KQ3A 2JA8H 1RODA 1O7IA 1NE3A 2Z0SA 1Y1VB 3K6OA 1KAWA 1YEZA 2NN6G 4DV2L 3Q23A 3IAYA 3C3LA 3TP5A 1IBML 4OGQC 3VA7A 5IYBH 2F0NA 4L8JA 2K5QA 1XMOL 3T16A 1YITA 2NVXH 2NN6I 1B4OA 1CSQA 1RCVD 2EIFA 1STBA 2MO1A 3HOXH 4IUNA 3C46A 4RCOA 5JJKA 3K5LA 3OOCA 5C5MA 3PO3G 3HOUG 3OMCA 1SNPA 2D2CC 5EBCA 1MJCA 1B8AA 3G6EA 2N88A 1GM5A 5IWAL 2CFMA 2D5DA 3D3RA 1ZYRD 4CGYB 1D6EC 2CQAA 1VQNA 3PO3B 4DR2L 5C4JB 2K5DA 1VQLA 1E2VA 4JI2L 5GAHC 1YI2A 1ONLA 4H44C 1GVPA 4QUFA 1EQQA 4JI8L 1KAAA 3M4QA 3K59A 3S14H 2OWOA 5E3FA 1XNQQ 1BCPD 2Z9HA 1VQPA 4JBJA 4G7ZC 3ZJYC 1WD0A 4KKTA 1LT3D 1UWVA 4IFDG 3P7JA 2A6HD 4H7BA 3I2ZA 1KTKA 2IW3A 2PQAB 3J81i 1T9HA 1E1TA 5FLXc 4JK1C 3NWSA 4C3IH 1CK1A 5FKAC 3W1GA 3GTJB 1IBMQ 5M5XH 1UE6A 3GTQB 5IOCA 1VQCA 4X62L 5IT9E 1M1KC 2F0TA 4NMZA 5D65A 3NTHA 3C2PA 1XMOQ 1Q90A 2B2WA 3VR5A 5E1FA 3TBIB 1R4QB 2QEXA 1QCBD 3K80C 4ZRZA 2B8GA 1LUZA 3EBEA 2RSNA 1QVGA 1CZWA 2MHVA 1AN8A 1VQBA 3DUZA 3QB3A 2Q8RE 2BE5C 1QNKA 3VYUA 5LMNQ 2RCFA 3BS1A 1A8VA 2V1CC 3J80E 4K2LA 1YHBA 3PUVA 2HHHL 5JPNC 1QWYA 5ELFA 4OHJA 4V0BA 5CV6A 4JI4L 2KVMA 4JI7Q 4A3LH 1ASYA 4Q0FA 1IKMA 2KCCA 4JI8Q 4C56C 2I5MX 1OXTA 3OMGA 3WWVA 1LTTD 4A3BH 1EEID 2B2VC 1D2BA 2R7FA 3GTOH 1EYGA 1PLFA 1VQOA 2PZTA 1IYJB 2L55A 4KI0A 1C48A 2BA0A 4PZ6A 1NBWA 2RBMA 3T1YL 1Z6HA 3EIVA 4IUPA 1P8LA 4DNTB 1LTSD 1QUQA 2RKSA 3LNNA 4LMQD 2HDLA 1VQMA 4I7AA 5C0XJ 1RKNA 1PFSA 1CT1D 3CCRA 4R4OA 3S1RB 3CMAA 2MUYA 1JOKA 3K7UC 1BR9A 4KJOA 1MJEA 5FJ8G 3J81E 1YNJD 4X62Q 1YJWA 1JJ2A 2F4VQ 4YHHQ 3A8JE 3HOWB 2E2IB 1JR0D 1RTNA 4NXMQ 4A93G 3CCLA 1Y1VH 4RG1A 1HJPA 1JOOA 3JAMc 3SR1A 2EJMA 4FF3A 4C2MB 1CZGA 2PQAA 2C35B 3CP0A 3GP7A 4PZ7A 1I4HA 2NN6H 1SNMA 3HZXA 2NVQB 2KCNA 1F9QA 1CA5A 5BR8Q 3CQZB 4FXDA 4DV1Q 4PQXA 1VQEA 5H1SE 1IHZA 4JI4Q 4C1NK 4DR3Q 5HURA 4EQPA 2UUCL 2WAQB 4JI3Q 5CC4A 4JI0Q 1XWEA 4C3JG 4M8AA 2OXPA 1SAPA 3E5SA 3QWNA 2B8FA 1R4PB 4B3RL 2SOBA 4DF7A 2NZOA 3RN5A 3PO3H 1V1PB 3T1YQ 1YHAA 2DY7A 1QJOA 5C4JH 4QL5A 3OW7A 1X9NA 2NVYH 4RHRA 3A56A 2HIVA 1DJRD 4BA1I 2Z1CA 3T51B 1RIPA 3S2HH 1SNOA 1SYEA 5EKKA 3EN2A 4DK1A 1HUMA 1HPCA 2F4IA 4DV5Q 5TSSA 3U50C 1EQVA 2BDNA 4ME3A 3KF6B 4AH6A 4HIDA 2EY2A 3UDGA 4UP8A 4GKJQ 3N52A 4X3KA 4IFDH 1STYA 3V96A 4OELB 1JORA 4DAPA 4K0KL 4DAYA 4ILWA 1SNQA 3WOFA 2K5VA 4NPSA 3C1FA 4LFBL 3GTQH 2IY5B 2NBFA 3NBIA 2QCPX 2PZWA 4YCWA 1PRTD 3K81C 3MHBA 2K1BA 1JWMD 5C4HA 3VR2A 4C3HG 5KIXA 4KK7A 4DR5L 4LFAQ 5AJ3Q 1J8IA 1CM9A 2LMCB 2UUCQ 4HJAA 1EIGA 2ES2A 2NZ1D 2XNAC 4MTKA 5KEEA 4J1MA 3T13A 5KRUA 4DPGA 3PIP3 1VQIA 4B3RQ 1AEXA 3B6YA 4K5WA 4N8FA 3M85A 4IQZA 2H5XA 3KLSX 3PV0A 3SK6A 3KDFB 3I3CA 1KQSA 2F52A 2ICEC 4YWLA 3F8TA 4LF7Q 3A5UA 3QO2A 1DOMA 1H9SB 2G9DA 2WACA 5DEHA 2WB1E 2ZXPA 3L7ZC 2CWPA 4XTCS 4AQYQ 5FK9C 4K0KQ 1HZ9A 1EOVA 3I56A 3W3AA 1V1PA 3S1RH 5D3IB 2PCFB 3D6CA 2UXBL 3HS0C 4PMCA 4QJFA 1HTLD 2E2IH 3HOWH 1NSNS 1SJHD 3M4PA 3HGBA 1T5EA 3BVMA 5FJ8H 2MGSA 4K14A 5COYA 1HZBA 2RDHA 4DR5Q 2F0JA 1QOHA 3DM3A 4P72A 2EPBA 5DLQE 4C2MH 4GOPC 4A93H 4MHEA 3H91A 1EY5A 3KF6A 4DV7L 4XYOA 2PNHA 5I6YA 4IOAA 1CI3M 4IPCA 2CWAA 4H02A 1KDAA 4G57A 2F0DA 2NVQH 3KK7A 1K73C 1B53A 2E2JB 4JVZA 2DGYA 1SLJA 2IL8A 3BU2A 4B3MQ 1WCMB 3TSSA 5F2DA 3M4OB 5C3XA 3F2CA 4MNOA 4NXNL 1NR2A 1Z7TA 4CDFC 1A15A 2JXMB 4HJ7A 5LMUL 2LY7A 4GLVB 4DK0A 4LF5Q 1TU2B 2ZXOA 2ZTCA 3FPPA 4RGTA 2IT1A 2JSOA 1A6XA 3H15A 4CDEC 1NR4A 1A63A 1EY6A 3HEJA 3I7FA 1I4PA 4OIKA 5CR3A 4DAMA 5C0XG 4KV6A 4KY6A 4EQOA 2BDOA 1YJ9A 4QMGA 2DY8A 3M7GA 5IGBA 2UUBQ 2L15A 2N49A 5T1GA 1TS3A 1NMFA 1OO9B 3OTOL 4B3TQ 1VQ4A 2UXBQ 4BY1G 1EU4A 3KDFA 4QIWE 5C0XI 4XXEA 5L37A 5E4WC 3TMEA 1HCZA 3MC0B 3GTPH 1SFOB 3STBC 1B2TA 4F8MA 1LV9A 1Q12A 2I5HA 1BOSA 2K03A 2VZAA 4DV7Q 1S72A 2DNCA 2EJGC 1GUTA 2PO4A 2ZT9C 2D62A 5C4XG 1VMCA 1F2LA 1XJVA 2JEBI 3HOVG 3PF5A 1N34L 5IP9G 3GV6A 4BBSG 1E1OA 4R8NA 3BZCA 4R4TA 3H94A 1TY0A 4UPAA 5C44B 3HOYB 1JB7A 1C7YA 2QDLA 2K28A 1VQKA 2UXDQ 3VR6A 4BBSB 5LMUQ 1I4XA 1VQ8A 1JE4A 4FO2A 1WFQA 4OO1G 2N55A 4A3DG 4FDBA 3FP9A 2JA8B 2C9OA 5JOBA 3ERSX 2AUJD 2Q2HA 1N33L 1WI5A 4IURA 4TVAB 1SNDA 3A5ZB 5IP7H 2F3IA 3I55A 1HFNA 1MD2D 1XPUA 4RMFA 4Z9CB 4R8IA 4YCVA 3T1HL 1FJGQ 3HP3A 2FMCA 2HQEA 3EROA 1HH2P 1YZ6A 4DV4L 1ILQA 3V2TA 3DWAA 1BBUA 1HNXL 4HJ9A 4RKBA 1EFWA 1K8AC 1PTOC 3RR5A 3K7AH 2ZM6Q 3HOXB 3UDIA 2A74C 1CKNA 4K6LA 4O42A 4JI6L 1I4RA 2F03A 2I46A 1F9PA 5E7NA 2O2LD 1AZQA 5M5YH 2FFKB 4GKKQ 1FD7D 1VF7A 2B2YC 5M3FG 1S5FD 4LF8L 1TWGB 4DR6Q 1V1OA 3JC66 1JICA 1EIYB 2L1BA 2IX1A 2R7ZG 1LTRD 1T5XD 2A1AA 1KLUD 4KJNA 2F0VA 4DUYQ 1MSHA 1C9OA 3RMHA 1FL0A 4HSVA 2R7ZB 3AU7A 2PW7A 1LTLA 3K0YA 1HNZL 2E2JH 1X56A 2CH4W 1TQOA 1WCMH 1IYUA 1N33Q 3GTMH 3CC7A 3M4OH 1DZ1A 1HRJA 1STGA 4JC0A 3RZOB 5M5XB 1ESRA 4JYAL 5JJLA 4DFAA 4DV6Q 5LMNW 2A6ED 3I4OA 1H9MA 2YTVA 1H9KA 2CW0C 1O7LA 3PF4A 2O5JC 2IX3A 4RCNA 2DNEA 4BBRG 3G4SA 4UY8C 1PV4A 1XTCD 4QQBX 1UUPA 4YY3Q 4EQ5A 2E75C 2F1MA 1DXMA 4HTHA 2GVAA 5ISRA 3D0FA 3OSOA 5C0XH 3OIPA 2K33A 5C3EB 1X3FA 3A7LA 1FGBD 1D1IA 1L1OA 2N8NA 2K52A 2IHEA 5KNCA 5IT9L 3FPUB 1LABA 3KUPA 4LUOA 1VS0A 1SFOH 1SBBB 2K7VA 1XX8A 1K83B 2F0UA 4BS9A 3J7YW 2R3ZA 4NP5A 2PZUA 4HN7A 3NEMA 1XNRL 2PI2A 4GLXA 3CRKC 1Y8NB 4NW2A 4IOCA 5G3LF 2FINB 3E9HA 3L0OA 5A2QE 1HNZQ 3BYTB 1D7QA 3BVZA 3SGIA 4IPGA 5IGFA 1EQTA 3J80L 4PMBA 4DR4L 3HOYH 2F3VA 1BF4A 3NQIA 3HOVH 3PCOB 4RGOS 4YWKA 4BBSH 1VF5C 5I2XA 4A3JG 3D4RA 1TS5A 4JYAQ 1HR0W 5K36G 3MXNB 1PDQA 1EZ8A 4JPBW 5CV4A 1IBKL 2MO0A 5FLMG 1Y1WG 1BBXC 4TRDA 4OO1H 1JOQA 1DONA 4A3DH 3EVQA 1Q8IA 2UU9L 1N8RC 5K5PA 2Z8LA 3I91A 3X3NA 3E3XA 3BDCA 4CHTB 1E2ZA 1OXVA 1FVIA 3VR3A 2WB1G 3H6MA 1JQYD 1L0XB 3J81L 3J80i 1Q3LA 2DN8A 1VDZA 4X66L 3RLFA 3S1QB 2G9HD 2WP8J 4QUCA 4OX9L 4GZYC 2WFWA 2R92G 2HUGA 3I4MG 3S2DB 4S3SA 4TQUS 1NUCA 3HOUB 4UHVA 1XTDA 3OWEB 1IKLA 3M4YA 1B7YB 1ICWA 1W3SA 4UP9A 2Q2TA 2F0PA 3S1NB 1TWGH 3NWTA 2NVYB 3F2UA 1SR3A 2A69C 2QGQA 4JI1L 1BKBA 3I4NG 5CV5A 3M7NA
chains in the Genus database with same CATH topology
5M3FH 2CCZA 3CPFA 1EWIA 2AWNA 4B3RL 2NZOA 3CQZH 3RN5A 2JA6H 3PO3H 3TEHB 1YHAA 3T1YQ 1V1QA 5C4JH 3CCEA 4HIKA 4QL5A 3NELA 3UE0A 4GNXC 1PH1A 4LF9L 2R7ZH 1A0IA 1SMXA 2GN5A 1X9NA 1I3QH 2NVYH 1OTCA 4A3CG 3KJOA 2JE6I 2HIVA 2YTYA 2UXDL 3T1HQ 1IBKQ 1SROA 4BA1I 1PYBA 5HGQA 4X64L 1TWHH 1V9PA 1CSPA 3W5OA 4DV4Q 1VQDA 1CKNB 4P71A 1RIPA 1HNXQ 1U0LA 4DV2Q 3S2HH 3TS0A 1XPOA 3EN2A 2IX0A 3RNUA 2ZTDA 3CMEA 3DLLA 4LFCL 4DV5Q 1K0RA 2JA7H 2LXJA 3RZOH 2AMCB 1I94Q 1B70B 1HZAA 3U50C 4A4IA 4HIOA 4ME3A 3KF6B 4AH6A 2HQLA 4HIDA 3UDGA 2VQFL 3PIOA 4JI6Q 4UP8A 4HJ8A 4GKJQ 2RF4A 3NENA 2UUAQ 1N9WA 1Q7YC 3TS2A 3TQYA 4LF4Q 3GTLH 4K0KL 2Z6KA 3CC2A 2JA9A 1L1OC 4P75A 1K9MC 2K5VA 1J5EQ 2K4KA 4B3SL 1FJGL 1E22A 4A3GG 4NPSA 4LF8Q 4LFBL 3GTQH 2N3SA 2IY5B 3K8AA 2ZJRA 3AFPA 1TWAH 1UE5A 4BXXG 4BY1H 4YCWA 4BBRH 3K81C 2ZM6L 4AYBG 5C3EH 1M90C 4JBMA 5IWAQ 2OQ0A 1OXXK 3FKIG 4DR2Q 4O2DA 4JI2Q 3RLNA 4DR5L 4LFAQ 1QVCA 5AJ3Q 4A3EH 4LW1A 2Y0SG 1X54A 4EX5A 3PO2G 1RL2A 2UUCQ 4GKKL 4JCVE 2JK8A 5IYCG 4HJAA 3J7A5 5M5WH 1ASZA 2ES2A 4BY7G 1K83H 2RHSB 4YCUA 5C44G 2QA4A 4GNXB 3HOYG 5C4XH 4OXPA 1NTGA 3OW2A 3CCQA 1BBWA 4DPGA 1IBLL 4DR6L 1VQIA 2GVBA 4B3RQ 3H3VI 3B6YA 3KOJA 5IP9H 3M85A 1XMQL 4JI5L 2H5XA 2K5NA 1KXLA 4LF6L 3PV0A 4QGUA 4IPDA 4POGA 2JA8G 4DUYL 2EQSA 4L5TA 3KDFB 1EQRA 1KQSA 2ZJPA 2AWOA 2F52A 1VQ7A 4PG3A 2VQEL 4IFDJ 1FGUA 1K8GA 1HNWL 4YWLA 4L5SA 2CQOA 3J80c 3F8TA 2BA1A 1KL9A 1VQ5A 4LF7Q 1TWFH 3PIPA 1XNQL 1E24A 2JQOA 3A5UA 1E7ZA 1QZHA 5IE8A 4A3MG 2N78A 3H0GG 2OTLA 3AFQA 1L1OB 2XGTA 3F2BA 1JJCB 2WB1E 1Q86C 5JEAG 1E3PA 3L7ZC 2KCMA 4OO1I 2CWPA 3E0EA 4JBWA 4XTCS 2K5HA 4ALPA 4AQYQ 1HZ9A 1EOVA 3I56A 4K0KQ 1PH3A 1X3GA 4HJ5A 3GTGH 4B3SQ 3S1RH 4DV6L 3HOXG 1R9TH 1NY4A 5M3MG 4L5QA 5FLMH 3UE1A 1Y1WH 2YYZA 1L0WA 3ICEA 3S15H 2UXBL 4A3IH 1GKHA 1PH8A 2A8VA 4PZ8A 1L2FA 3CPWA 3HFZB 4QJFA 3TRZA 3NBHB 3PUXA 2WAQE 5GROA 1PH4A 2E2IH 3HOWH 1UEBA 4YY3L 3OYYA 3M4PA 2UXCQ 5FJ8H 1UE7A 2VY3A 1XNRQ 2HHHQ 1AH9A 1HZBA 4DR5Q 4GN3B 1QZGA 2RHQB 3DM3A 2JA5G 1JE5A 3CD6A 2JJQA 4P72A 1JJGA 5GAEC 3J81c 5DLQE 4C2MH 4DNIA 4GOPC 1EUJA 2BH8A 4A93H 1P16A 1KRSA 3KF6A 4JG2A 2MQHA 4DV7L 1N36L 3PUZA 1YIJA 2PNHA 2BH2A 3S1QH 1YVCA 4IOAA 3S1MH 4IPCA 2CWAA 4DR4Q 4H02A 2OTJA 1IBLQ 4OONA 2JA6G 1QUQB 2HIXA 3AQQA 2NVQH 3S2DH 1K73C 2DGYA 4KHPL 1SLJA 3BU2A 5LMNL 1XMQQ 2E5LQ 4B3MQ 3HOUH 4HIMA 4DR7Q 4DR1L 2NZHA 4LF6Q 3F2CA 3FHWA 3I4MH 3S1NH 1PVOA 1G291 4MNOA 4NXNL 1OXSC 4HJ7A 5LMUL 4GLVB 2KCTA 2OCEA 3JAMi 2VQEQ 1Z9FA 2ZTCA 2LXKA 3GO5A 2IT1A 4DV0L 1XPRA 4JI7L 3H15A 2XTIA 1VQ6A 4X65L 1MIUA 1GD7A 1A63A 2VL6A 2UU9Q 1J6QA 1KC8C 3ULJA 4UP7A 5GADC 3I4NH 2LSSA 3I7FA 1PH6A 4DAMA 1I5FA 1LYLA 5C0XG 2KENA 1YJ9A 2K50A 5GQOA 1LM0A 2UUBQ 2L15A 2N49A 3CCUA 4DUZL 1K3RA 4A3CH 2Z6KC 1NMFA 1NJIC 3OTOL 3L2PA 4B3TQ 1VQ4A 2MFIA 1IXRA 1OXUA 4X66Q 2UXBQ 4R4CA 4BY1G 1X65A 3PGZA 3KDFA 4QIWE 4AIMA 5C0XI 4IFDI 4OWXB 2Q2IA 4JOIA 4OX9Q 5C3EG 4GOPB 3VDYA 3CCJA 4POFA 3STBD 2MNAA 3GTPH 1PA6A 3RLOA 2DUDA 1VQJA 3STBC 1Q12A 1Q46A 2Y0SE 2I5HA 4YHHL 2F4VL 4J15A 4A3LG 4NXML 1PH7A 2KHIA 2VZAA 3KYHC 4DV7Q 1S72A 1CUKA 3PSIA 4A3BG 3RN2A 5IT9c 2D62A 5C4XG 1IZ6A 3ULLA 4JI1Q 4Y52H 1VQAA 1VQGA 1S3OA 1XJVA 2VUMG 4LNQA 1HR0L 2JEBI 3HOVG 3PF5A 1N34L 5IP9G 1Z47A 3KLWA 4A3FH 3HOZG 4A3GH 2IHFA 1E1OA 3UDFA 4BBSG 4KHPQ 3BZCA 3G71A 4R4TA 4BXXH 4A75A 4UPAA 4R4QA 4DR1Q 1TXYA 2D0OA 4LF9Q 1SN8A 4LWCA 1JB7A 1C7YA 4WJ3M 1VQKA 4KHZA 4LUZA 1PYSB 2K14A 5BR8L 2UXDQ 4Y7NH 5LMUQ 3H3VH 4DV1L 1VQ8A 3FKIH 4X64Q 4DV0Q 1WFQA 1Q81C 4DR3L 4OO1G 2KHJA 3PO2H 1BVSA 4A3DG 4JI3L 4FDBA 4GN4B 4OWTB 3FP9A 2ALYB 1AE3A 3F1ZA 3MEFA 4JI0L 1YBYA 4LFCQ 2B63H 5C44H 4IO9A 1MKHA 3ERSX 3W1BA 2Q2HA 1N33L 2ATWA 3A0JA 4L5RC 3AYHB 4DAYB 2VQFQ 1WI5A 3IRBA 4YWMA 4TVAB 3A5ZB 4XIGS 1Y1VG 2PI2E 3S17H 5IP7H 2F3IA 3I55A 1Q1EA 4A3JH 1XPUA 3CW2C 1XNRL 4RMFA 2JA8H 1SE8A 2FXQA 4YCVA 3TREA 3T1HL 2ZJQA 1FJGQ 1O7IA 1YHQA 1HH2P 1NE3A 2Z0SA 1YZ6A 4DV4L 1WOCA 1QVFA 4LFBQ 2VNUD 5IYDG 1BBUA 1HNXL 4HJ9A 1KAWA 1YEZA 2NN6G 4DV2L 1K8AC 1EFWA 1CKMA 1PH9A 2JEAI 3HOWG 1N32L 3LGJA 3RR5A 3K7AH 4DV5L 2ZM6Q 1IBML 1X55A 3U4ZA 3UDIA 1I94L 1CKNA 3H0GH 5IYBH 4JI6L 3E9IA 3ER0A 1XMOL 3I4NG 4P74A 4GKJL 1PH5A 5E7NA 2R93G 4A3KG 2I0QA 5M5YH 2R6GA 4DV3L 1YITA 4GKKQ 2NVXH 4LF4L 2NN6I 1CSQA 1YNXA 2EIFA 3HKZE 2MO1A 5M3FG 4IJLA 3HOXH 5ELOA 1HR0Q 3HKSA 5M3MH 4LF8L 3KFUA 5JJKA 4DR6Q 2ZTEA 3PO3G 3JC66 3RZDH 3HOUG 2YTXA 5IY0A 3S24A 1EIYB 3CC4A 4BA2I 4GS3A 4DKAC 1MJCA 5JJIA 2IX1A 2R7ZG 1A62A 1B8AA 3G6EA 1KHIA 4JI5Q 2WAQG 2A1AA 3J7ZC 5IWAL 2CFMA 1GM5A 2R92H 1VQNA 4DUYQ 1D8LA 4P73A 1S40A 1C9OA 4DR2L 1FL0A 1X6OA 1VQLA 4GOPA 4JI2L 5GAHC 1Q82C 5AJ3L 4LFAL 3G48A 1YI2A 2JA5H 1G51A 1GVPA 1LTLA 1EQQA 4JI8L 3M4QA 1HNZL 3S14H 3AEVA 2E2JH 2OWOA 1X56A 1XNQQ 2JA7G 1WCMH 2ASBA 1VQPA 4C3JH 4JBJA 1N33Q 3GTMH 3CC7A 1GO3E 3ZJYC 3M4OH 3PUWA 4JV5L 3D31A 4JC0A 1Q8KA 2AHOB 1UWVA 4GNXA 4IFDG 2EXDA 3I2ZA 1WJJA 1VQFA 4JYAL 2PQAB 3J81i 1G6PA 5JJLA 1T9HA 4PMWA 1E1TA 5FLXc 4DV6Q 5LMNW 2A19A 3I4OA 2YTVA 4C3IH 3PF4A 5JEAJ 4A76A 1N32Q 3KJPA 1HZCA 4LF7L 1EIFA 4BBRG 3G4SA 4UY8C 2VS1A 1PV4A 1C0AA 4X6AH 3W1GA 4AYBE 3ULPA 5M5XH 1IBMQ 4R1JA 1UE6A 4JOIC 4QQBX 4YY3Q 3CCSA 4EQ5A 1VQCA 2PMZE 4X62L 2GVAA 3CAMA 4MTNA 3K0XA 1M1KC 2AKWB 1XMOQ 3D0FA 4R4IA 4A3EG 3M9BA 2CKZB 4DV3Q 1X3FA 2I5LX 3J81j 2QEXA 2D0PA 3K80C 2E8GA 2N8NA 1L1OA 1LUZA 4AQYL 3BJUA 1N36Q 4MZ9A 3A74A 3EBEA 2K52A 2IHEA 1QVGA 1JT8A 3GTJH 4NB3A 1VQBA 1X3EA 4LUOA 4A3FG 4WJ4A 1VS0A 3F2DA 1UE1A 1H95A 1SFOH 4GN5A 2OQKA 5LMNQ 4O0AA 5HY6A 1KRTA 1A8VA 1V43A 2V1CC 3CCMA 2UXCL 1PH2A 3NEMA 1YHBA 2B3GA 2B29A 2PI2A 3PUVA 4QY7A 1KD1C 1Y14B 3KF8B 2HHHL 4NXNQ 4GLXA 2NVTH 4C3HH 1YJNA 4JI7Q 4JI4L 4A3LH 1ASYA 4IOCA 2K75A 3E9HA 3L0OA 2I5MX 1OXTA 4JI8Q 4X65Q 1HNZQ 3UDXA 3WWVA 2B63G 4A3BH 3SGIA 1D7QA 4IPGA 5IYCH 1U5KA 3BZKA 3Q8DA 4BY7H 1I50H 2R7FA 2RCNA 3HOYH 4DR4L 1VCIA 1EYGA 3GTOH 4JV5Q 1VQOA 2VUMH 1IYJB 4KI0A 1W2BA 3HOVH 3HOZH 2BA0A 4PZ6A 3PCOB 4YWKA 4BBSH 1NBWA 2E5LL 3T1YL 4B3ML 5IP7G 4APVA 3GTKH 4DR7L 4KLKA 4A3JG 3EIVA 5K36G 4JYAQ 1HR0W 1P8LA 2KBNA 1QUQA 4IJHA 4IPHA 3MXNB 4DUZQ 3GDEA 5EAYA 1KIXA 2E2HH 1VQMA 1IBKL 2MO0A 5ELNA 5FLMG 5C0XJ 3OTOQ 1TWCH 1VQHA 1Y1WG 4LF5L 1IL2A 1AE2A 1CKOA 3PUYA 4A3IG 1PFSA 4LUVA 3CCRA 4R4OA 4A3DH 3CMAA 2UU9L 3K7UC 1I6HH 1N8RC 4DK6C 1MJEA 5IYBG 5FJ8G 4X62Q 3M3YH 1YJWA 4A3MH 1JJ2A 1JMCA 2YU9H 1OXVA 4JBKA 1FVIA 2F4VQ 4YHHQ 1SRUA 2WB1G 4NXMQ 4A93G 2UUAL 4DK3C 1Y1VH 4RG1A 3CCLA 4OWWB 2ID0A 3GD7A 2UUBL 1HJPA 2VW9A 3JAMc 3J80i 2R7DA 1J5EL 4B3TL 2YV5A 4X66L 3CXCA 3RLFA 2PQAA 1N34Q 2C35B 3CP0A 2WP8J 4GLAC 1PHJA 5IYDH 4PZ7A 4OX9L 1WYDA 3S16H 1Q1BA 3U58A 2WFWA 2R92G 1HNWQ 1DGSA 1NMGA 3I4MG 2Q2UA 4TQUS 5J3BA 2HT1A 5BR8Q 3CCVA 4DV1Q 1XTDA 1VQEA 5H1SE 1B7YB 5GAGC 1W3SA 4JI4Q 4UP9A 4LF5Q 4DR3Q 2Q2TA 4A3KH 2R93H 2UUCL 1TWGH 4JI3Q 3CF5A 1SR3A 1WCMG 2QGQA 4JI1L 3U4VA 1BKBA 1VQ9A 4JI0Q 3HKZG 3M7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M3F H;  2CCZ A;  3CPF A;  1EWI A;  2AWN A;  4B3R L;  2NZO A;  3CQZ H;  3RN5 A;  2JA6 H;  3PO3 H;  3TEH B;  1YHA A;  3T1Y Q;  1V1Q A;  5C4J H;  3CCE A;  4HIK A;  4QL5 A;  3NEL A;  3UE0 A;  4GNX C;  1PH1 A;  4LF9 L;  2R7Z H;  1A0I A;  1SMX A;  2GN5 A;  1X9N A;  1I3Q H;  2NVY H;  1OTC A;  4A3C G;  3KJO A;  2JE6 I;  2HIV A;  2YTY A;  2UXD L;  3T1H Q;  1IBK Q;  1SRO A;  4BA1 I;  1PYB A;  5HGQ A;  4X64 L;  1TWH H;  1V9P A;  1CSP A;  3W5O A;  4DV4 Q;  1VQD A;  1CKN B;  4P71 A;  1RIP A;  1HNX Q;  1U0L A;  4DV2 Q;  3S2H H;  3TS0 A;  1XPO A;  3EN2 A;  2IX0 A;  3RNU A;  2ZTD A;  3CME A;  3DLL A;  4LFC L;  4DV5 Q;  1K0R A;  2JA7 H;  2LXJ A;  3RZO H;  2AMC B;  1I94 Q;  1B70 B;  1HZA A;  3U50 C;  4A4I A;  4HIO A;  4ME3 A;  3KF6 B;  4AH6 A;  2HQL A;  4HID A;  3UDG A;  2VQF L;  3PIO A;  4JI6 Q;  4UP8 A;  4HJ8 A;  4GKJ Q;  2RF4 A;  3NEN A;  2UUA Q;  1N9W A;  1Q7Y C;  3TS2 A;  3TQY A;  4LF4 Q;  3GTL H;  4K0K L;  2Z6K A;  3CC2 A;  2JA9 A;  1L1O C;  4P75 A;  1K9M C;  2K5V A;  1J5E Q;  2K4K A;  4B3S L;  1FJG L;  1E22 A;  4A3G G;  4NPS A;  4LF8 Q;  4LFB L;  3GTQ H;  2N3S A;  2IY5 B;  3K8A A;  2ZJR A;  3AFP A;  1TWA H;  1UE5 A;  4BXX G;  4BY1 H;  4YCW A;  4BBR H;  3K81 C;  2ZM6 L;  4AYB G;  5C3E H;  1M90 C;  4JBM A;  5IWA Q;  2OQ0 A;  1OXX K;  3FKI G;  4DR2 Q;  4O2D A;  4JI2 Q;  3RLN A;  4DR5 L;  4LFA Q;  1QVC A;  5AJ3 Q;  4A3E H;  4LW1 A;  2Y0S G;  1X54 A;  4EX5 A;  3PO2 G;  1RL2 A;  2UUC Q;  4GKK L;  4JCV E;  2JK8 A;  5IYC G;  4HJA A;  3J7A 5;  5M5W H;  1ASZ A;  2ES2 A;  4BY7 G;  1K83 H;  2RHS B;  4YCU A;  5C44 G;  2QA4 A;  4GNX B;  3HOY G;  5C4X H;  4OXP A;  1NTG A;  3OW2 A;  3CCQ A;  1BBW A;  4DPG A;  1IBL L;  4DR6 L;  1VQI A;  2GVB A;  4B3R Q;  3H3V I;  3B6Y A;  3KOJ A;  5IP9 H;  3M85 A;  1XMQ L;  4JI5 L;  2H5X A;  2K5N A;  1KXL A;  4LF6 L;  3PV0 A;  4QGU A;  4IPD A;  4POG A;  2JA8 G;  4DUY L;  2EQS A;  4L5T A;  3KDF B;  1EQR A;  1KQS A;  2ZJP A;  2AWO A;  2F52 A;  1VQ7 A;  4PG3 A;  2VQE L;  4IFD J;  1FGU A;  1K8G A;  1HNW L;  4YWL A;  4L5S A;  2CQO A;  3J80 c;  3F8T A;  2BA1 A;  1KL9 A;  1VQ5 A;  4LF7 Q;  1TWF H;  3PIP A;  1XNQ L;  1E24 A;  2JQO A;  3A5U A;  1E7Z A;  1QZH A;  5IE8 A;  4A3M G;  2N78 A;  3H0G G;  2OTL A;  3AFQ A;  1L1O B;  2XGT A;  3F2B A;  1JJC B;  2WB1 E;  1Q86 C;  5JEA G;  1E3P A;  3L7Z C;  2KCM A;  4OO1 I;  2CWP A;  3E0E A;  4JBW A;  4XTC S;  2K5H A;  4ALP A;  4AQY Q;  1HZ9 A;  1EOV A;  3I56 A;  4K0K Q;  1PH3 A;  1X3G A;  4HJ5 A;  3GTG H;  4B3S Q;  3S1R H;  4DV6 L;  3HOX G;  1R9T H;  1NY4 A;  5M3M G;  4L5Q A;  5FLM H;  3UE1 A;  1Y1W H;  2YYZ A;  1L0W A;  3ICE A;  3S15 H;  2UXB L;  4A3I H;  1GKH A;  1PH8 A;  2A8V A;  4PZ8 A;  1L2F A;  3CPW A;  3HFZ B;  4QJF A;  3TRZ A;  3NBH B;  3PUX A;  2WAQ E;  5GRO A;  1PH4 A;  2E2I H;  3HOW H;  1UEB A;  4YY3 L;  3OYY A;  3M4P A;  2UXC Q;  5FJ8 H;  1UE7 A;  2VY3 A;  1XNR Q;  2HHH Q;  1AH9 A;  1HZB A;  4DR5 Q;  4GN3 B;  1QZG A;  2RHQ B;  3DM3 A;  2JA5 G;  1JE5 A;  3CD6 A;  2JJQ A;  4P72 A;  1JJG A;  5GAE C;  3J81 c;  5DLQ E;  4C2M H;  4DNI A;  4GOP C;  1EUJ A;  2BH8 A;  4A93 H;  1P16 A;  1KRS A;  3KF6 A;  4JG2 A;  2MQH A;  4DV7 L;  1N36 L;  3PUZ A;  1YIJ A;  2PNH A;  2BH2 A;  3S1Q H;  1YVC A;  4IOA A;  3S1M H;  4IPC A;  2CWA A;  4DR4 Q;  4H02 A;  2OTJ A;  1IBL Q;  4OON A;  2JA6 G;  1QUQ B;  2HIX A;  3AQQ A;  2NVQ H;  3S2D H;  1K73 C;  2DGY A;  4KHP L;  1SLJ A;  3BU2 A;  5LMN L;  1XMQ Q;  2E5L Q;  4B3M Q;  3HOU H;  4HIM A;  4DR7 Q;  4DR1 L;  2NZH A;  4LF6 Q;  3F2C A;  3FHW A;  3I4M H;  3S1N H;  1PVO A;  1G29 1;  4MNO A;  4NXN L;  1OXS C;  4HJ7 A;  5LMU L;  4GLV B;  2KCT A;  2OCE A;  3JAM i;  2VQE Q;  1Z9F A;  2ZTC A;  2LXK A;  3GO5 A;  2IT1 A;  4DV0 L;  1XPR A;  4JI7 L;  3H15 A;  2XTI A;  1VQ6 A;  4X65 L;  1MIU A;  1GD7 A;  1A63 A;  2VL6 A;  2UU9 Q;  1J6Q A;  1KC8 C;  3ULJ A;  4UP7 A;  5GAD C;  3I4N H;  2LSS A;  3I7F A;  1PH6 A;  4DAM A;  1I5F A;  1LYL A;  5C0X G;  2KEN A;  1YJ9 A;  2K50 A;  5GQO A;  1LM0 A;  2UUB Q;  2L15 A;  2N49 A;  3CCU A;  4DUZ L;  1K3R A;  4A3C H;  2Z6K C;  1NMF A;  1NJI C;  3OTO L;  3L2P A;  4B3T Q;  1VQ4 A;  2MFI A;  1IXR A;  1OXU A;  4X66 Q;  2UXB Q;  4R4C A;  4BY1 G;  1X65 A;  3PGZ A;  3KDF A;  4QIW E;  4AIM A;  5C0X I;  4IFD I;  4OWX B;  2Q2I A;  4JOI A;  4OX9 Q;  5C3E G;  4GOP B;  3VDY A;  3CCJ A;  4POF A;  3STB D;  2MNA A;  3GTP H;  1PA6 A;  3RLO A;  2DUD A;  1VQJ A;  3STB C;  1Q12 A;  1Q46 A;  2Y0S E;  2I5H A;  4YHH L;  2F4V L;  4J15 A;  4A3L G;  4NXM L;  1PH7 A;  2KHI A;  2VZA A;  3KYH C;  4DV7 Q;  1S72 A;  1CUK A;  3PSI A;  4A3B G;  3RN2 A;  5IT9 c;  2D62 A;  5C4X G;  1IZ6 A;  3ULL A;  4JI1 Q;  4Y52 H;  1VQA A;  1VQG A;  1S3O A;  1XJV A;  2VUM G;  4LNQ A;  1HR0 L;  2JEB I;  3HOV G;  3PF5 A;  1N34 L;  5IP9 G;  1Z47 A;  3KLW A;  4A3F H;  3HOZ G;  4A3G H;  2IHF A;  1E1O A;  3UDF A;  4BBS G;  4KHP Q;  3BZC A;  3G71 A;  4R4T A;  4BXX H;  4A75 A;  4UPA A;  4R4Q A;  4DR1 Q;  1TXY A;  2D0O A;  4LF9 Q;  1SN8 A;  4LWC A;  1JB7 A;  1C7Y A;  4WJ3 M;  1VQK A;  4KHZ A;  4LUZ A;  1PYS B;  2K14 A;  5BR8 L;  2UXD Q;  4Y7N H;  5LMU Q;  3H3V H;  4DV1 L;  1VQ8 A;  3FKI H;  4X64 Q;  4DV0 Q;  1WFQ A;  1Q81 C;  4DR3 L;  4OO1 G;  2KHJ A;  3PO2 H;  1BVS A;  4A3D G;  4JI3 L;  4FDB A;  4GN4 B;  4OWT B;  3FP9 A;  2ALY B;  1AE3 A;  3F1Z A;  3MEF A;  4JI0 L;  1YBY A;  4LFC Q;  2B63 H;  5C44 H;  4IO9 A;  1MKH A;  3ERS X;  3W1B A;  2Q2H A;  1N33 L;  2ATW A;  3A0J A;  4L5R C;  3AYH B;  4DAY B;  2VQF Q;  1WI5 A;  3IRB A;  4YWM A;  4TVA B;  3A5Z B;  4XIG S;  1Y1V G;  2PI2 E;  3S17 H;  5IP7 H;  2F3I A;  3I55 A;  1Q1E A;  4A3J H;  1XPU A;  3CW2 C;  1XNR L;  4RMF A;  2JA8 H;  1SE8 A;  2FXQ A;  4YCV A;  3TRE A;  3T1H L;  2ZJQ A;  1FJG Q;  1O7I A;  1YHQ A;  1HH2 P;  1NE3 A;  2Z0S A;  1YZ6 A;  4DV4 L;  1WOC A;  1QVF A;  4LFB Q;  2VNU D;  5IYD G;  1BBU A;  1HNX L;  4HJ9 A;  1KAW A;  1YEZ A;  2NN6 G;  4DV2 L;  1K8A C;  1EFW A;  1CKM A;  1PH9 A;  2JEA I;  3HOW G;  1N32 L;  3LGJ A;  3RR5 A;  3K7A H;  4DV5 L;  2ZM6 Q;  1IBM L;  1X55 A;  3U4Z A;  3UDI A;  1I94 L;  1CKN A;  3H0G H;  5IYB H;  4JI6 L;  3E9I A;  3ER0 A;  1XMO L;  3I4N G;  4P74 A;  4GKJ L;  1PH5 A;  5E7N A;  2R93 G;  4A3K G;  2I0Q A;  5M5Y H;  2R6G A;  4DV3 L;  1YIT A;  4GKK Q;  2NVX H;  4LF4 L;  2NN6 I;  1CSQ A;  1YNX A;  2EIF A;  3HKZ E;  2MO1 A;  5M3F G;  4IJL A;  3HOX H;  5ELO A;  1HR0 Q;  3HKS A;  5M3M H;  4LF8 L;  3KFU A;  5JJK A;  4DR6 Q;  2ZTE A;  3PO3 G;  3JC6 6;  3RZD H;  3HOU G;  2YTX A;  5IY0 A;  3S24 A;  1EIY B;  3CC4 A;  4BA2 I;  4GS3 A;  4DKA C;  1MJC A;  5JJI A;  2IX1 A;  2R7Z G;  1A62 A;  1B8A A;  3G6E A;  1KHI A;  4JI5 Q;  2WAQ G;  2A1A A;  3J7Z C;  5IWA L;  2CFM A;  1GM5 A;  2R92 H;  1VQN A;  4DUY Q;  1D8L A;  4P73 A;  1S40 A;  1C9O A;  4DR2 L;  1FL0 A;  1X6O A;  1VQL A;  4GOP A;  4JI2 L;  5GAH C;  1Q82 C;  5AJ3 L;  4LFA L;  3G48 A;  1YI2 A;  2JA5 H;  1G51 A;  1GVP A;  1LTL A;  1EQQ A;  4JI8 L;  3M4Q A;  1HNZ L;  3S14 H;  3AEV A;  2E2J H;  2OWO A;  1X56 A;  1XNQ Q;  2JA7 G;  1WCM H;  2ASB A;  1VQP A;  4C3J H;  4JBJ A;  1N33 Q;  3GTM H;  3CC7 A;  1GO3 E;  3ZJY C;  3M4O H;  3PUW A;  4JV5 L;  3D31 A;  4JC0 A;  1Q8K A;  2AHO B;  1UWV A;  4GNX A;  4IFD G;  2EXD A;  3I2Z A;  1WJJ A;  1VQF A;  4JYA L;  2PQA B;  3J81 i;  1G6P A;  5JJL A;  1T9H A;  4PMW A;  1E1T A;  5FLX c;  4DV6 Q;  5LMN W;  2A19 A;  3I4O A;  2YTV A;  4C3I H;  3PF4 A;  5JEA J;  4A76 A;  1N32 Q;  3KJP A;  1HZC A;  4LF7 L;  1EIF A;  4BBR G;  3G4S A;  4UY8 C;  2VS1 A;  1PV4 A;  1C0A A;  4X6A H;  3W1G A;  4AYB E;  3ULP A;  5M5X H;  1IBM Q;  4R1J A;  1UE6 A;  4JOI C;  4QQB X;  4YY3 Q;  3CCS A;  4EQ5 A;  1VQC A;  2PMZ E;  4X62 L;  2GVA A;  3CAM A;  4MTN A;  3K0X A;  1M1K C;  2AKW B;  1XMO Q;  3D0F A;  4R4I A;  4A3E G;  3M9B A;  2CKZ B;  4DV3 Q;  1X3F A;  2I5L X;  3J81 j;  2QEX A;  2D0P A;  3K80 C;  2E8G A;  2N8N A;  1L1O A;  1LUZ A;  4AQY L;  3BJU A;  1N36 Q;  4MZ9 A;  3A74 A;  3EBE A;  2K52 A;  2IHE A;  1QVG A;  1JT8 A;  3GTJ H;  4NB3 A;  1VQB A;  1X3E A;  4LUO A;  4A3F G;  4WJ4 A;  1VS0 A;  3F2D A;  1UE1 A;  1H95 A;  1SFO H;  4GN5 A;  2OQK A;  5LMN Q;  4O0A A;  5HY6 A;  1KRT A;  1A8V A;  1V43 A;  2V1C C;  3CCM A;  2UXC L;  1PH2 A;  3NEM A;  1YHB A;  2B3G A;  2B29 A;  2PI2 A;  3PUV A;  4QY7 A;  1KD1 C;  1Y14 B;  3KF8 B;  2HHH L;  4NXN Q;  4GLX A;  2NVT H;  4C3H H;  1YJN A;  4JI7 Q;  4JI4 L;  4A3L H;  1ASY A;  4IOC A;  2K75 A;  3E9H A;  3L0O A;  2I5M X;  1OXT A;  4JI8 Q;  4X65 Q;  1HNZ Q;  3UDX A;  3WWV A;  2B63 G;  4A3B H;  3SGI A;  1D7Q A;  4IPG A;  5IYC H;  1U5K A;  3BZK A;  3Q8D A;  4BY7 H;  1I50 H;  2R7F A;  2RCN A;  3HOY H;  4DR4 L;  1VCI A;  1EYG A;  3GTO H;  4JV5 Q;  1VQO A;  2VUM H;  1IYJ B;  4KI0 A;  1W2B A;  3HOV H;  3HOZ H;  2BA0 A;  4PZ6 A;  3PCO B;  4YWK A;  4BBS H;  1NBW A;  2E5L L;  3T1Y L;  4B3M L;  5IP7 G;  4APV A;  3GTK H;  4DR7 L;  4KLK A;  4A3J G;  3EIV A;  5K36 G;  4JYA Q;  1HR0 W;  1P8L A;  2KBN A;  1QUQ A;  4IJH A;  4IPH A;  3MXN B;  4DUZ Q;  3GDE A;  5EAY A;  1KIX A;  2E2H H;  1VQM A;  1IBK L;  2MO0 A;  5ELN A;  5FLM G;  5C0X J;  3OTO Q;  1TWC H;  1VQH A;  1Y1W G;  4LF5 L;  1IL2 A;  1AE2 A;  1CKO A;  3PUY A;  4A3I G;  1PFS A;  4LUV A;  3CCR A;  4R4O A;  4A3D H;  3CMA A;  2UU9 L;  3K7U C;  1I6H H;  1N8R C;  4DK6 C;  1MJE A;  5IYB G;  5FJ8 G;  4X62 Q;  3M3Y H;  1YJW A;  4A3M H;  1JJ2 A;  1JMC A;  2YU9 H;  1OXV A;  4JBK A;  1FVI A;  2F4V Q;  4YHH Q;  1SRU A;  2WB1 G;  4NXM Q;  4A93 G;  2UUA L;  4DK3 C;  1Y1V H;  4RG1 A;  3CCL A;  4OWW B;  2ID0 A;  3GD7 A;  2UUB L;  1HJP A;  2VW9 A;  3JAM c;  3J80 i;  2R7D A;  1J5E L;  4B3T L;  2YV5 A;  4X66 L;  3CXC A;  3RLF A;  2PQA A;  1N34 Q;  2C35 B;  3CP0 A;  2WP8 J;  4GLA C;  1PHJ A;  5IYD H;  4PZ7 A;  4OX9 L;  1WYD A;  3S16 H;  1Q1B A;  3U58 A;  2WFW A;  2R92 G;  1HNW Q;  1DGS A;  1NMG A;  3I4M G;  2Q2U A;  4TQU S;  5J3B A;  2HT1 A;  5BR8 Q;  3CCV A;  4DV1 Q;  1XTD A;  1VQE A;  5H1S E;  1B7Y B;  5GAG C;  1W3S A;  4JI4 Q;  4UP9 A;  4LF5 Q;  4DR3 Q;  2Q2T A;  4A3K H;  2R93 H;  2UUC L;  1TWG H;  4JI3 Q;  3CF5 A;  1SR3 A;  1WCM G;  2QGQ A;  4JI1 L;  3U4V A;  1BKB A;  1VQ9 A;  4JI0 Q;  3HKZ G;  3M7N A; 
#chains in the Genus database with same CATH topology
 5M3F H;  2CCZ A;  4B9X A;  2AWN A;  1QG7 A;  4FXK C;  3S2H B;  1QNU A;  5FLX E;  3TEH B;  5EPK A;  1TVX A;  3CCE A;  2R7Z H;  1SMX A;  1G6Z A;  1D5X C;  4A3C G;  3SDZ A;  1IBK Q;  3FDT A;  1QIL A;  3TZU A;  3W5O A;  4LAA A;  4P71 A;  4XT3 B;  5I6W A;  4DV2 Q;  3DXJ C;  2XWJ B;  2IX0 A;  3RNU A;  3DLL A;  4LFC L;  1SMY C;  4K2K A;  3RZO H;  2AMC B;  2V4D A;  1GOZ A;  2EY6 A;  2Z6B A;  1HZA A;  4A4I A;  3EQL C;  3QG1 A;  2VQF L;  4HJ8 A;  4IUT A;  2RF4 A;  3NEN A;  4ZKC B;  3DMU A;  1N9W A;  1EY7 A;  3GTL H;  4K6D A;  4KMU C;  3CC2 A;  1L1O C;  4P75 A;  2NUC A;  2K4K A;  4B3S L;  1HA5 A;  1ESF A;  2ZJR A;  3MXN A;  1WD1 A;  3AFP A;  2J7Z A;  1FYC A;  4DXF A;  4BWG B;  4BXX G;  4BBR H;  4WFN 3;  1F77 A;  4AYB G;  5C3E H;  5IWA Q;  3FKI G;  4DR2 Q;  4JI2 Q;  4QIW B;  2RQX A;  4LW1 A;  4EX5 A;  1E0B A;  2SDF A;  1RL2 A;  3MXP A;  1KNE A;  2JK8 A;  5IYC G;  3J7A 5;  4BY7 G;  1K83 H;  2QA4 A;  3FKI B;  5I9O A;  4GNX B;  1G91 A;  3KOJ A;  4KKS A;  1EU3 A;  2EYP A;  4JI5 L;  4POG A;  4IPD A;  1IL8 A;  3ND8 A;  4L5T A;  1EQR A;  1BCP F;  2KED A;  4PG3 A;  1FGU A;  1K8G A;  2CQO A;  3J80 c;  1KL9 A;  2A5H A;  1O7Y A;  2AUK A;  1TWF H;  4XQQ A;  2JQO A;  3BDO A;  5IE8 A;  4A3M G;  2CHB D;  1H9J A;  2F0Q A;  2XGT A;  3F2B A;  3P20 A;  3JAM E;  1Q86 C;  1KLG D;  1E3P A;  2KCM A;  4JBW A;  2K5H A;  4ALP A;  1PH3 A;  1FR3 A;  3GTG H;  4B3S Q;  2MPM A;  1M8A A;  5M3M G;  4UDU C;  4L5Q A;  1PRT B;  3EJI A;  3UI2 A;  3R8B A;  5FLM H;  1Y1W H;  1L0W A;  2L4N A;  4A93 B;  4KY7 A;  4CJ0 B;  1GKH A;  2Z4H A;  3KLS A;  1K0S A;  2WII B;  1HA6 A;  3CPW A;  3HFZ B;  4ZYS A;  3D4W A;  1PFB A;  5GRO A;  5M3M B;  1UEB A;  3GV3 A;  2VB2 X;  3OYY A;  3RZD B;  1B1Z A;  1ZKO A;  1WVL A;  2HHH Q;  2AQ3 B;  1A3V A;  1AH9 A;  3K5M A;  2QW7 A;  1SSO A;  5C4Z A;  2JA5 G;  1JE5 A;  3CD6 A;  4RGM A;  1PZI D;  5GAE C;  3J81 c;  2C5C A;  4H0L C;  2RVL A;  4DNI A;  1EUJ A;  1KRS A;  4JG2 A;  3S1Q H;  1W6K A;  3PUZ A;  1N36 L;  1YVC A;  1LTB D;  4FYD A;  1IYV A;  2OF1 A;  2SEB D;  2JA6 G;  3S2D H;  3QOJ A;  3HOU H;  4KD3 A;  4HIM A;  3H3V C;  4C3J B;  4DR1 L;  4N9T A;  1S5B D;  2A73 B;  1GJX A;  1DD2 A;  3J7A V;  3FHW A;  5KYI A;  3I4M H;  3BG3 A;  3S1N H;  1PVO A;  4CDD C;  1FNU A;  5EQ0 A;  2OCE A;  2LXK A;  3GO5 A;  2XTI A;  4KN4 C;  4X65 L;  1SYD A;  1GD7 A;  1KC8 C;  2EY1 A;  3ULJ A;  4UP7 A;  3I4N H;  1HTP A;  1TS2 A;  1BCP C;  2IWH A;  1RDP D;  1PH6 A;  1LT6 D;  3FMC A;  2K50 A;  2B2W C;  1BUV T;  4RH6 A;  2A6H C;  3GTP B;  2O4X A;  3A8I E;  3MEH A;  3CCU A;  4DUZ L;  4A3C H;  1NJI C;  1QB5 D;  2MFI A;  1CFM A;  2DJG C;  1X65 A;  4CKE A;  1HFG A;  2K5W A;  4OWX B;  4JOI A;  1D1K A;  5IGG A;  3CCJ A;  3STB D;  2MNA A;  3DHQ A;  2G5D A;  2XSC A;  3AB9 A;  2Y0S E;  2NYZ D;  3KYH C;  1WTV A;  1CUK A;  2NVT B;  1IZ6 A;  2F0K A;  4C3H B;  3I70 A;  1VQA A;  1VQG A;  1SXT A;  5CBA E;  3MFY A;  1S3O A;  2VUM G;  2KEC A;  2PQE A;  2QF7 A;  3HOZ G;  3S9W A;  2IHF A;  4PNY A;  4BXX H;  1I50 B;  4A75 A;  4DR1 Q;  1ML0 D;  2VUM B;  4WJ3 M;  2EVB A;  2B39 A;  2L12 A;  4WRD A;  4LUZ A;  3HOZ B;  1PYS B;  3VR4 A;  3FKI H;  3GTK B;  1EY0 A;  4ZQ3 A;  4GN4 B;  4KTA A;  4OWT B;  3F1Z A;  1YBY A;  5D14 A;  1MKH A;  4OIJ A;  3W1B A;  4L5R C;  1STN A;  1I6H B;  3K7A B;  3OWF A;  1I4G A;  3M3Y B;  3N6R A;  4P2C B;  1Q1E A;  2YU9 B;  2JP1 A;  2FMM A;  5M5Y B;  1WOC A;  4LFB Q;  1PTO D;  2E2D C;  2EE1 A;  1SYF A;  1U4P A;  4ULL A;  1HUN A;  1WTR A;  1CKM A;  4F7X A;  1B50 A;  2F0F A;  3LGJ A;  1X55 A;  3U4Z A;  1I94 L;  2M9V A;  1YNJ C;  3E9I A;  5CV7 A;  1PH5 A;  3BYY B;  4A3K G;  1XYI A;  2I0Q A;  2R93 G;  2R6G A;  1WTW A;  4LF4 L;  2KEE A;  2H4O A;  3MA2 B;  3DM1 A;  4IJL A;  1PRT F;  1HQR D;  1PYW D;  1Y8P B;  3HKS A;  3I4L A;  4TKO B;  5AFW A;  5M3M H;  4A3K B;  4C1N I;  3RZD H;  1Y69 U;  2YTX A;  1C8C A;  5IY0 A;  4DKA C;  1A62 A;  2FHT A;  3G6J B;  3GTM B;  1EOT A;  1TY2 A;  4IUU A;  1S40 A;  1X6O A;  3ZYY X;  2EYH A;  1V8Q A;  3T53 B;  3G48 A;  2JA5 H;  1G51 A;  1I3Q B;  5JVG 3;  3AEV A;  2JA7 G;  1TWH B;  4HCE A;  2ASB A;  4C3J H;  2XN9 C;  1NAP A;  2ZXR A;  4ID6 A;  3D31 A;  1Q8K A;  1UAP A;  4ZKB B;  2EXD A;  1LTA D;  5J1Z A;  2IPK D;  4QF4 A;  1CA6 A;  3I73 A;  5JEA J;  4A76 A;  2NB0 A;  3KJP A;  1HZC A;  4UAI A;  3EA6 A;  4AYB E;  4R9W A;  2WIN B;  4JOI C;  4RGN A;  3CCS A;  3G7L A;  2PMZ E;  1PTO H;  4BY1 B;  4A3E G;  1PMR A;  2HCC A;  4J8Q A;  3QJY A;  2L11 A;  3A54 A;  2I5L X;  1H9S A;  3J81 j;  2E8G A;  1JCK B;  4MZ9 A;  1JT8 A;  3SXH A;  1K8O A;  4A3E B;  4NB3 A;  3R3O A;  4WJ4 A;  1DYQ A;  4K5V A;  4A3F G;  3SHL A;  1EWC A;  1LT5 D;  1H95 A;  5M5W B;  4GN5 A;  2OQK A;  5C4X B;  4O0A A;  1V43 A;  3VYS A;  3CCM A;  4K8I A;  2UXC L;  1PH2 A;  3IFT A;  2B3G A;  2B29 A;  2NVT H;  3HOV B;  4NXN Q;  3KF8 B;  2WV6 D;  4C3H H;  1YJN A;  3CRL C;  5FO8 B;  1GUN A;  2K75 A;  4IUV A;  3UDX A;  4EGV A;  2B63 G;  1U5K A;  3BZK A;  3Q8D A;  1B9N A;  1G2S A;  1I50 H;  3U9O A;  2RCN A;  5EGT A;  1WTQ A;  1VCI A;  4V19 0;  2VUM H;  3HOZ H;  4A3D B;  4ZK9 B;  2E5L L;  5A2Q L;  4DR7 L;  3GTK H;  2B2T A;  4ZUI A;  5LL6 S;  4IPH A;  2X69 A;  2MJ8 A;  2E2H H;  3NP8 A;  3WDN A;  5ELN A;  1C4Q A;  4RA8 A;  3OTO Q;  1TWC H;  3OHX C;  1CKO A;  4A3I G;  4LUV A;  1PFM A;  2XIW A;  1MSG A;  2KJX A;  1EYA A;  1I6H H;  1IW7 C;  4DK6 C;  5IYB G;  2LFN A;  3S15 B;  3M3Y H;  4A3I B;  3ONA B;  1KAB A;  1JMC A;  2YU9 H;  4JBK A;  5ELB A;  2QEJ C;  2XRQ D;  2UUA L;  4OWW B;  2ID0 A;  1U4M A;  2VW9 A;  2R7D A;  3ERQ A;  1J5E L;  3CXC A;  1N34 Q;  2X6L A;  4I65 A;  1X32 A;  5IGD A;  1PHJ A;  2NTS A;  3S1M B;  3S16 H;  4KN7 C;  3U58 A;  1DGS A;  5M3F B;  1NMG A;  3K58 A;  5J3B A;  2HT1 A;  4CKB A;  4O1N A;  1CHP D;  5GAG C;  4LJZ C;  2A69 D;  4A3K H;  2R93 H;  1ET9 A;  2VB3 X;  3HKZ G;  3D4D A;  5ELE A;  3TDQ A;  1EWI A;  1RD9 D;  2XWB B;  1Y8O B;  4HIK A;  1SE2 A;  3NEL A;  3NPP A;  4CJ1 B;  1PH1 A;  4LF9 L;  1A0I A;  2GN5 A;  3CHB D;  4HED A;  1I3Q H;  2PW5 A;  2K04 A;  5HGT A;  3KJO A;  2YTY A;  3T1H Q;  4C3I G;  4X64 L;  1TWH H;  1V9P A;  1CSP A;  5FLX L;  4DV4 Q;  3FEW X;  1HNX Q;  3GTL B;  1U0L A;  1SMY D;  3KF8 A;  3SK5 A;  3TS0 A;  3CME A;  2JA7 H;  1E2W A;  1ZEQ X;  1LTI D;  1GHJ A;  2AQ1 B;  4JI6 Q;  3PIO A;  4HMJ A;  1O80 A;  4BBR B;  2UUA Q;  1Q7Y C;  3TS2 A;  1RF2 D;  1AW7 A;  2EYJ A;  1J5E Q;  4N8X 1;  2TMP A;  4A3G G;  1A2T A;  2F3W A;  2BE5 D;  4LF8 Q;  1ICF B;  1TWA H;  2F0W A;  4BY1 H;  5J39 A;  4PV1 C;  4G4K A;  2EXZ A;  3DWQ A;  4A3G B;  2OQ0 A;  2RSO A;  1GUS A;  4O2D A;  2O5I C;  3RLN A;  5EKL A;  4A3E H;  3PO2 G;  2Y0S G;  4CDC C;  4JCV E;  1XXG A;  5FO9 B;  5M5W H;  5C4X H;  4OXP A;  3OW2 A;  2A68 C;  3CCQ A;  1UNS A;  3PO2 B;  1BXT A;  1J9O A;  1IBL L;  3H3V I;  1S5E D;  2Z4I A;  1TWF B;  5IP9 H;  1XMQ L;  1CTM A;  2K5N A;  1KXL A;  1NNX A;  1S5C D;  1MGS A;  1ET6 A;  2EQS A;  1SJE D;  3PQI A;  5J22 A;  1VQ7 A;  5A35 A;  2VQE L;  1EYC A;  3VA5 A;  2SNM A;  4RHS A;  4L5S A;  2WKD A;  4A3J B;  2F0I A;  4WOR A;  3GTG B;  1VQ5 A;  2X6G A;  1XNQ L;  1E24 A;  5DM7 3;  5CV8 A;  1QZH A;  2N78 A;  3H0G G;  1Y1W B;  3S17 B;  3AFQ A;  5EJW A;  2K01 A;  4H13 C;  4ZAI A;  2L9H A;  5JEA G;  1EY4 A;  3E0E A;  2RDG A;  3H0G B;  3OPO A;  4HJ5 A;  1RJT A;  4DU9 A;  1R9T H;  3H09 A;  3JAM L;  1X3Q A;  3UE1 A;  2WB1 B;  2YYZ A;  3KBX A;  1LT4 D;  3ICE A;  3S15 H;  4A3I H;  2A8V A;  1PH8 A;  4PZ8 A;  1L2F A;  4MIU A;  3TRZ A;  3PUX A;  1PH4 A;  1GUW A;  1LAC A;  2M00 A;  2VY3 A;  1XNR Q;  1TII D;  2CVR A;  4GN3 B;  1B3A A;  1JJG A;  2DJF C;  4DAV A;  2R92 B;  2BH8 A;  1P16 A;  2J4X A;  1SYG A;  3I4M B;  2MQH A;  2BH2 A;  3S1M H;  4DR4 Q;  1YNN C;  3NQT A;  2TSS A;  1IBL Q;  2OTJ A;  4OON A;  2EDG A;  4KKU A;  1QUQ B;  2HIX A;  4KHP L;  5LMN L;  1XMQ Q;  1AFP A;  2XRS D;  1MI2 A;  3I4N B;  3ITP A;  2HD3 A;  2EYM A;  1G29 1;  3MAQ A;  4L6T B;  3LX0 A;  2KCT A;  2VQE Q;  3JAM i;  1Z9F A;  2P5Z X;  3BDL A;  4RFB A;  2B2U A;  4DN4 M;  1XPR A;  4JI7 L;  5T1I A;  5D3D A;  1ENA A;  2UU9 Q;  4ZCK A;  1WTX A;  2LS0 1;  5GAD C;  4XDX A;  1WTO A;  1I5F A;  2KEN A;  4DNR B;  4MN3 A;  4RWS C;  5C3W A;  5BN4 A;  2OT2 A;  5E4X A;  4FVM A;  3L2P A;  1OXU A;  4X66 Q;  1SYB A;  2A6E C;  4R4C A;  2BCO A;  3EFX D;  3PGZ A;  4IFD I;  1SEB D;  5JVH 3;  2Q2I A;  4OX9 Q;  4GOP B;  3DEO A;  1PA6 A;  3RLO A;  2DUD A;  1VQJ A;  1WTP A;  1Q46 A;  2F4V L;  4YHH L;  1ILP A;  4J15 A;  3HRZ C;  4NXM L;  4AYB B;  3RN2 A;  5IT9 c;  4Y52 H;  4JI1 Q;  2PMZ B;  2JYO A;  2F0O A;  1HR0 L;  4A3G H;  1U4R A;  3KLW A;  4KHP Q;  1CQV A;  3TN2 A;  4BY7 B;  4R4Q A;  2D0O A;  1SN8 A;  4KHZ A;  1F9R A;  2K14 A;  5BR8 L;  3H3V H;  4KHV A;  4DV1 L;  4FXG C;  3NUC A;  4DR3 L;  2KHJ A;  3PO2 H;  1BVS A;  1I6V C;  2F0H A;  5C6A A;  4JI3 L;  1AE3 A;  2EYF A;  4JI0 L;  4ME5 A;  4FF2 A;  4LFC Q;  4IO9 A;  3HG9 A;  5KGU A;  3IL8 A;  4N9P A;  4IAL A;  3A0J A;  1SNC A;  4DAY B;  2VQF Q;  1I4Q A;  4XIG S;  2PI2 E;  1G2T A;  4A3M B;  2F0E A;  4A3J H;  3IFD A;  3CW2 C;  5K36 H;  3CKI B;  1SE8 A;  2FXQ A;  3TRE A;  5IGC A;  5KND A;  2ZJQ A;  3Q0A A;  1YHQ A;  2Q8I B;  2VNU D;  1NCV A;  1QVF A;  3MVV A;  3A8K E;  3LWU A;  5IYD G;  3S17 H;  5C5L A;  3WOE A;  1N32 L;  1PH9 A;  2JEA I;  1BNZ A;  3HOW G;  3RD4 A;  1EYD A;  2HCI A;  4DV5 L;  3VYT A;  3K5O A;  3H0G H;  1GUO A;  3FRP B;  3ER0 A;  4ZLT F;  2EY5 A;  4P74 A;  4GKJ L;  4QB4 A;  5JEA H;  4DV3 L;  4HAE A;  4QCL A;  3Q22 A;  1YNX A;  3HKZ E;  2K32 A;  1II3 A;  3R2I A;  4IUQ A;  5ELO A;  1HR0 Q;  2JA5 B;  3KFU A;  3TP7 A;  2KUM A;  3Q24 A;  2ZTE A;  4F87 A;  2EZV A;  3S24 A;  3J7A F;  3CC4 A;  2F0M A;  4HSP A;  2BOS A;  4GS3 A;  4BA2 I;  5JJI A;  5JAV A;  3GQB A;  4JI5 Q;  1KHI A;  2E74 C;  2WAQ G;  1FNV A;  4RAU C;  3J7Z C;  4G7H C;  5CGK A;  2R92 H;  2JA6 B;  1D8L A;  4P73 A;  4IZ8 A;  4GOP A;  1ZYR C;  1Q82 C;  5AJ3 L;  4LFA L;  1X3P A;  4X3T A;  2K05 A;  5NUC A;  2QIL A;  4CBV A;  1PXU A;  3V05 A;  2B2U C;  5DAU A;  5EKI A;  3KLR A;  1B9M A;  2EYO A;  1BDO A;  1GO3 E;  3NHH A;  4JV5 L;  3NSW A;  3PUW A;  3VYR A;  3A7A B;  2L5T A;  3BZD B;  2AHO B;  4GNX A;  3FVQ A;  1WJJ A;  1VQF A;  1PTO B;  1PZK D;  2I07 B;  4G7O C;  1G6P A;  4PMW A;  2HDM A;  1TKW B;  2A19 A;  1EY8 A;  1F2M A;  2R61 A;  1KNA A;  1DOL A;  1N32 Q;  3BVG A;  4X3S A;  5IIF A;  4LF7 L;  1EIF A;  2VS1 A;  1C0A A;  3MTS A;  4X6A H;  5IOD A;  3ULP A;  4R1J A;  4M1U B;  1B44 D;  2PNR C;  3CAM A;  4MTN A;  3K0X A;  2AKW B;  4R4I A;  1DOK A;  3K5N A;  5FO7 B;  3M9B A;  2CKZ B;  4DV3 Q;  5LL6 X;  4AQY L;  2D0P A;  3BJU A;  1N36 Q;  3A74 A;  3GTJ H;  2EJF C;  1X3E A;  3F2D A;  1UE1 A;  4ODG A;  3O13 A;  4OEM B;  1GXD C;  3T4A C;  1EL0 A;  5HY6 A;  1KRT A;  1STA A;  4HCS A;  1TR5 A;  1A3U A;  4QY7 A;  1KD1 C;  1Y14 B;  3NTI A;  3X3M A;  4FNF A;  4KY5 A;  3I8Z A;  1EIH A;  1F2Z A;  2H1E A;  3SE0 A;  4X65 Q;  4DXG A;  5IYC H;  3L3O C;  2E2H B;  3D6W A;  4BY7 H;  1MHW C;  1BQQ T;  1TWC B;  4B9W A;  2F0G A;  5JPM C;  4JV5 Q;  2EYL A;  3I72 A;  1O78 A;  1W2B A;  1FNW A;  4B3M L;  5IP7 G;  4APV A;  4KLK A;  2KBN A;  5EPJ A;  4IJH A;  4XYQ A;  4DUZ Q;  1KIX A;  3GDE A;  1SDF A;  5EAY A;  4EVO A;  1IL2 A;  4LF5 L;  1VQH A;  2KHS A;  1AE2 A;  3PUY A;  5ELC A;  1IW7 D;  3QIA A;  5CV9 A;  2RDF A;  3MWY W;  2IJ0 A;  1STH A;  3NK9 A;  1HQM C;  4DGZ A;  4A3M H;  3NTK A;  3E6Z X;  1QE6 A;  1SRU A;  3S16 B;  4DK3 C;  1ENF A;  3GD7 A;  2UUB L;  2NTT A;  4CJ2 C;  4LK1 C;  3SK4 A;  3SEB A;  4B3T L;  2YV5 A;  2R93 B;  3OIQ A;  2J0T D;  3MXU A;  4GLA C;  3NXW A;  5IYD H;  3R93 A;  1WYD A;  3P1H A;  1Q1B A;  2Q2U A;  4J6H A;  2E76 C;  3CCV A;  1JC7 A;  5M9O A;  2B2Y A;  3QOL A;  2EOT A;  3CF5 A;  1WCM G;  1VQ9 A;  3U4V A;  3CPF A;  2QKI C;  1KDC A;  3CQZ H;  3SK8 A;  2JA6 H;  1EFI D;  1ZXT A;  1V1Q A;  2JA7 B;  1DCZ A;  3UE0 A;  4GNX C;  5FOB B;  3PIO 3;  1D5Z C;  1OTC A;  5CBE E;  5DNF A;  2MP1 A;  2JE6 I;  2UXD L;  1SRO A;  1PYB A;  2CW0 D;  4ZUJ A;  5HGQ A;  2XVS A;  1VQD A;  1CKN B;  1XPO A;  2ZTD A;  1K0R A;  2LXJ A;  3MZ5 A;  1I94 Q;  1B70 B;  1HXY D;  3TZD A;  4U67 3;  4HIO A;  1TWA B;  2HQL A;  4RKL A;  3MXG A;  2ENB A;  4I7Z C;  1LO5 D;  4KD4 A;  1PTO F;  3TQY A;  4LF4 Q;  1SE4 A;  2Z6K A;  2QDB A;  2JA9 A;  1K9M C;  1FJG L;  1F2Y A;  3R2T A;  1E22 A;  1SE3 A;  2N3S A;  4K8J A;  1WTH A;  3K8A A;  5EBD A;  1UE5 A;  4WJW A;  1A3T A;  3L9A X;  2ZM6 L;  1KDB A;  1M90 C;  4JBM A;  4A3F B;  1PRT C;  4F88 A;  1F9S A;  1JWS D;  1OXX K;  1RHP A;  2M2L A;  3ND9 A;  4CKC A;  3SVM A;  4YIJ A;  2ICI A;  2WKC A;  1QVC A;  1GHK A;  3U9S A;  1X54 A;  2OEO A;  4ABN A;  4GKK L;  4NDX A;  3DWP A;  2A68 D;  4Y7N B;  1ASZ A;  1AZP A;  2RHS B;  4YCU A;  5C44 G;  3HOY G;  1U9R A;  1EWH A;  1NTG A;  1BBW A;  2AQ2 B;  4FF4 A;  3W2D A;  4B08 A;  5BN5 A;  4DR6 L;  3P75 A;  2GVB A;  1DM0 B;  2B63 B;  2JN4 A;  2F0S A;  1D5M C;  4LF6 L;  4QGU A;  2JA8 G;  1H9R A;  4DUY L;  2ZJP A;  2AWO A;  1M4V A;  1O7Z A;  4IFD J;  1HNW L;  3I90 A;  2BA1 A;  1A2U A;  3PIP A;  1K3B C;  1R9T B;  1B3Q A;  1E7Z A;  4JW0 A;  3TP8 A;  2OTL A;  4Q5V A;  3PMF A;  1L1O B;  5ELD A;  1EY9 A;  1JJC B;  2VXW A;  4XT1 B;  3T56 B;  4OO1 I;  3NE5 B;  5JJZ A;  1X3G A;  4X3U A;  1TS4 A;  4DV6 L;  3HOX G;  1NY4 A;  4TSS A;  2KOL A;  2NVX B;  1PFN A;  3RUZ A;  1RTO A;  3MFG A;  3NBH B;  2WAQ E;  3CU7 A;  5EPL A;  1JB3 A;  4YY3 L;  2UXC Q;  5BN3 A;  1UE7 A;  1VMP A;  1QZG A;  2RHQ B;  2JJQ A;  3AMU A;  2SNS A;  1YNN D;  3LWE A;  1YIJ A;  1PZJ D;  4L63 B;  5G3L D;  2FJ2 A;  3AQQ A;  3C1E A;  1UEA B;  1K8M A;  3S14 B;  1MBY A;  2E5L Q;  5KYL A;  1ENC A;  4DR7 Q;  3HKZ B;  2NZH A;  4FP5 D;  4LF6 Q;  2NWG A;  2GA4 B;  1CQF A;  1OXS C;  4XQJ A;  1HNW Q;  5LHY 1;  4DV0 L;  1EEF D;  1VQ6 A;  4NKL A;  1MIU A;  1CHQ D;  1U4L A;  2KA7 A;  2VL6 A;  2PPB C;  1J6Q A;  5IGE A;  2LSS A;  4C3I B;  2L0C A;  1K28 A;  5COR A;  1LYL A;  5GQO A;  1LM0 A;  4FF1 A;  2F0L A;  2RA4 A;  2Q8T A;  3A55 A;  4IN3 A;  1K3R A;  4HMI A;  2Z6K C;  2LKV A;  3K57 A;  1IXR A;  1EZ6 A;  4U68 A;  4K5X A;  5CYU A;  4OL7 A;  4XQN A;  4AIM A;  1W6J A;  5C3E G;  4HR7 B;  3VDY A;  1STE A;  3IKJ A;  4DA2 A;  4POF A;  4E6I A;  4A3L G;  5I9P A;  1PH7 A;  2KHI A;  2PYK A;  4A3B G;  3PSI A;  1LLR D;  3D8G A;  1S4Z A;  5KNB A;  3ULL A;  5DM6 3;  3E0J A;  1G8Z D;  1LTG D;  4LNQ A;  2Y0S B;  1Z47 A;  4A3F H;  4A3B B;  3UDF A;  3G71 A;  5CMD A;  3GTO B;  1TXY A;  4LF9 Q;  4LWC A;  1JWU D;  3DEP A;  2K6A A;  2B2T C;  4Y7N H;  3NBH A;  1BCP B;  5I4D A;  4X64 Q;  4DV0 Q;  1L0Y B;  2D9U A;  1AP0 A;  1Q81 C;  3TP6 A;  5I2Y A;  2ALY B;  2B2V A;  2CH4 A;  3MEF A;  1BO0 A;  2B63 H;  1S5D D;  5C44 H;  1TT2 A;  2ATW A;  3QR8 A;  1HHV A;  1GUG A;  3AYH B;  4EQN A;  1SYC A;  3KBG A;  3IRB A;  4YWM A;  1Y1V G;  3Q6S A;  3URY A;  2KQ3 A;  2JA8 H;  1ROD A;  1O7I A;  1NE3 A;  2Z0S A;  1Y1V B;  3K6O A;  1KAW A;  1YEZ A;  2NN6 G;  4DV2 L;  3Q23 A;  3IAY A;  3C3L A;  3TP5 A;  1IBM L;  4OGQ C;  3VA7 A;  5IYB H;  2F0N A;  4L8J A;  2K5Q A;  1XMO L;  3T16 A;  1YIT A;  2NVX H;  2NN6 I;  1B4O A;  1CSQ A;  1RCV D;  2EIF A;  1STB A;  2MO1 A;  3HOX H;  4IUN A;  3C46 A;  4RCO A;  5JJK A;  3K5L A;  3OOC A;  5C5M A;  3PO3 G;  3HOU G;  3OMC A;  1SNP A;  2D2C C;  5EBC A;  1MJC A;  1B8A A;  3G6E A;  2N88 A;  1GM5 A;  5IWA L;  2CFM A;  2D5D A;  3D3R A;  1ZYR D;  4CGY B;  1D6E C;  2CQA A;  1VQN A;  3PO3 B;  4DR2 L;  5C4J B;  2K5D A;  1VQL A;  1E2V A;  4JI2 L;  5GAH C;  1YI2 A;  1ONL A;  4H44 C;  1GVP A;  4QUF A;  1EQQ A;  4JI8 L;  1KAA A;  3M4Q A;  3K59 A;  3S14 H;  2OWO A;  5E3F A;  1XNQ Q;  1BCP D;  2Z9H A;  1VQP A;  4JBJ A;  4G7Z C;  3ZJY C;  1WD0 A;  4KKT A;  1LT3 D;  1UWV A;  4IFD G;  3P7J A;  2A6H D;  4H7B A;  3I2Z A;  1KTK A;  2IW3 A;  2PQA B;  3J81 i;  1T9H A;  1E1T A;  5FLX c;  4JK1 C;  3NWS A;  4C3I H;  1CK1 A;  5FKA C;  3W1G A;  3GTJ B;  1IBM Q;  5M5X H;  1UE6 A;  3GTQ B;  5IOC A;  1VQC A;  4X62 L;  5IT9 E;  1M1K C;  2F0T A;  4NMZ A;  5D65 A;  3NTH A;  3C2P A;  1XMO Q;  1Q90 A;  2B2W A;  3VR5 A;  5E1F A;  3TBI B;  1R4Q B;  2QEX A;  1QCB D;  3K80 C;  4ZRZ A;  2B8G A;  1LUZ A;  3EBE A;  2RSN A;  1QVG A;  1CZW A;  2MHV A;  1AN8 A;  1VQB A;  3DUZ A;  3QB3 A;  2Q8R E;  2BE5 C;  1QNK A;  3VYU A;  5LMN Q;  2RCF A;  3BS1 A;  1A8V A;  2V1C C;  3J80 E;  4K2L A;  1YHB A;  3PUV A;  2HHH L;  5JPN C;  1QWY A;  5ELF A;  4OHJ A;  4V0B A;  5CV6 A;  4JI4 L;  2KVM A;  4JI7 Q;  4A3L H;  1ASY A;  4Q0F A;  1IKM A;  2KCC A;  4JI8 Q;  4C56 C;  2I5M X;  1OXT A;  3OMG A;  3WWV A;  1LTT D;  4A3B H;  1EEI D;  2B2V C;  1D2B A;  2R7F A;  3GTO H;  1EYG A;  1PLF A;  1VQO A;  2PZT A;  1IYJ B;  2L55 A;  4KI0 A;  1C48 A;  2BA0 A;  4PZ6 A;  1NBW A;  2RBM A;  3T1Y L;  1Z6H A;  3EIV A;  4IUP A;  1P8L A;  4DNT B;  1LTS D;  1QUQ A;  2RKS A;  3LNN A;  4LMQ D;  2HDL A;  1VQM A;  4I7A A;  5C0X J;  1RKN A;  1PFS A;  1CT1 D;  3CCR A;  4R4O A;  3S1R B;  3CMA A;  2MUY A;  1JOK A;  3K7U C;  1BR9 A;  4KJO A;  1MJE A;  5FJ8 G;  3J81 E;  1YNJ D;  4X62 Q;  1YJW A;  1JJ2 A;  2F4V Q;  4YHH Q;  3A8J E;  3HOW B;  2E2I B;  1JR0 D;  1RTN A;  4NXM Q;  4A93 G;  3CCL A;  1Y1V H;  4RG1 A;  1HJP A;  1JOO A;  3JAM c;  3SR1 A;  2EJM A;  4FF3 A;  4C2M B;  1CZG A;  2PQA A;  2C35 B;  3CP0 A;  3GP7 A;  4PZ7 A;  1I4H A;  2NN6 H;  1SNM A;  3HZX A;  2NVQ B;  2KCN A;  1F9Q A;  1CA5 A;  5BR8 Q;  3CQZ B;  4FXD A;  4DV1 Q;  4PQX A;  1VQE A;  5H1S E;  1IHZ A;  4JI4 Q;  4C1N K;  4DR3 Q;  5HUR A;  4EQP A;  2UUC L;  2WAQ B;  4JI3 Q;  5CC4 A;  4JI0 Q;  1XWE A;  4C3J G;  4M8A A;  2OXP A;  1SAP A;  3E5S A;  3QWN A;  2B8F A;  1R4P B;  4B3R L;  2SOB A;  4DF7 A;  2NZO A;  3RN5 A;  3PO3 H;  1V1P B;  3T1Y Q;  1YHA A;  2DY7 A;  1QJO A;  5C4J H;  4QL5 A;  3OW7 A;  1X9N A;  2NVY H;  4RHR A;  3A56 A;  2HIV A;  1DJR D;  4BA1 I;  2Z1C A;  3T51 B;  1RIP A;  3S2H H;  1SNO A;  1SYE A;  5EKK A;  3EN2 A;  4DK1 A;  1HUM A;  1HPC A;  2F4I A;  4DV5 Q;  5TSS A;  3U50 C;  1EQV A;  2BDN A;  4ME3 A;  3KF6 B;  4AH6 A;  4HID A;  2EY2 A;  3UDG A;  4UP8 A;  4GKJ Q;  3N52 A;  4X3K A;  4IFD H;  1STY A;  3V96 A;  4OEL B;  1JOR A;  4DAP A;  4K0K L;  4DAY A;  4ILW A;  1SNQ A;  3WOF A;  2K5V A;  4NPS A;  3C1F A;  4LFB L;  3GTQ H;  2IY5 B;  2NBF A;  3NBI A;  2QCP X;  2PZW A;  4YCW A;  1PRT D;  3K81 C;  3MHB A;  2K1B A;  1JWM D;  5C4H A;  3VR2 A;  4C3H G;  5KIX A;  4KK7 A;  4DR5 L;  4LFA Q;  5AJ3 Q;  1J8I A;  1CM9 A;  2LMC B;  2UUC Q;  4HJA A;  1EIG A;  2ES2 A;  2NZ1 D;  2XNA C;  4MTK A;  5KEE A;  4J1M A;  3T13 A;  5KRU A;  4DPG A;  3PIP 3;  1VQI A;  4B3R Q;  1AEX A;  3B6Y A;  4K5W A;  4N8F A;  3M85 A;  4IQZ A;  2H5X A;  3KLS X;  3PV0 A;  3SK6 A;  3KDF B;  3I3C A;  1KQS A;  2F52 A;  2ICE C;  4YWL A;  3F8T A;  4LF7 Q;  3A5U A;  3QO2 A;  1DOM A;  1H9S B;  2G9D A;  2WAC A;  5DEH A;  2WB1 E;  2ZXP A;  3L7Z C;  2CWP A;  4XTC S;  4AQY Q;  5FK9 C;  4K0K Q;  1HZ9 A;  1EOV A;  3I56 A;  3W3A A;  1V1P A;  3S1R H;  5D3I B;  2PCF B;  3D6C A;  2UXB L;  3HS0 C;  4PMC A;  4QJF A;  1HTL D;  2E2I H;  3HOW H;  1NSN S;  1SJH D;  3M4P A;  3HGB A;  1T5E A;  3BVM A;  5FJ8 H;  2MGS A;  4K14 A;  5COY A;  1HZB A;  2RDH A;  4DR5 Q;  2F0J A;  1QOH A;  3DM3 A;  4P72 A;  2EPB A;  5DLQ E;  4C2M H;  4GOP C;  4A93 H;  4MHE A;  3H91 A;  1EY5 A;  3KF6 A;  4DV7 L;  4XYO A;  2PNH A;  5I6Y A;  4IOA A;  1CI3 M;  4IPC A;  2CWA A;  4H02 A;  1KDA A;  4G57 A;  2F0D A;  2NVQ H;  3KK7 A;  1K73 C;  1B53 A;  2E2J B;  4JVZ A;  2DGY A;  1SLJ A;  2IL8 A;  3BU2 A;  4B3M Q;  1WCM B;  3TSS A;  5F2D A;  3M4O B;  5C3X A;  3F2C A;  4MNO A;  4NXN L;  1NR2 A;  1Z7T A;  4CDF C;  1A15 A;  2JXM B;  4HJ7 A;  5LMU L;  2LY7 A;  4GLV B;  4DK0 A;  4LF5 Q;  1TU2 B;  2ZXO A;  2ZTC A;  3FPP A;  4RGT A;  2IT1 A;  2JSO A;  1A6X A;  3H15 A;  4CDE C;  1NR4 A;  1A63 A;  1EY6 A;  3HEJ A;  3I7F A;  1I4P A;  4OIK A;  5CR3 A;  4DAM A;  5C0X G;  4KV6 A;  4KY6 A;  4EQO A;  2BDO A;  1YJ9 A;  4QMG A;  2DY8 A;  3M7G A;  5IGB A;  2UUB Q;  2L15 A;  2N49 A;  5T1G A;  1TS3 A;  1NMF A;  1OO9 B;  3OTO L;  4B3T Q;  1VQ4 A;  2UXB Q;  4BY1 G;  1EU4 A;  3KDF A;  4QIW E;  5C0X I;  4XXE A;  5L37 A;  5E4W C;  3TME A;  1HCZ A;  3MC0 B;  3GTP H;  1SFO B;  3STB C;  1B2T A;  4F8M A;  1LV9 A;  1Q12 A;  2I5H A;  1BOS A;  2K03 A;  2VZA A;  4DV7 Q;  1S72 A;  2DNC A;  2EJG C;  1GUT A;  2PO4 A;  2ZT9 C;  2D62 A;  5C4X G;  1VMC A;  1F2L A;  1XJV A;  2JEB I;  3HOV G;  3PF5 A;  1N34 L;  5IP9 G;  3GV6 A;  4BBS G;  1E1O A;  4R8N A;  3BZC A;  4R4T A;  3H94 A;  1TY0 A;  4UPA A;  5C44 B;  3HOY B;  1JB7 A;  1C7Y A;  2QDL A;  2K28 A;  1VQK A;  2UXD Q;  3VR6 A;  4BBS B;  5LMU Q;  1I4X A;  1VQ8 A;  1JE4 A;  4FO2 A;  1WFQ A;  4OO1 G;  2N55 A;  4A3D G;  4FDB A;  3FP9 A;  2JA8 B;  2C9O A;  5JOB A;  3ERS X;  2AUJ D;  2Q2H A;  1N33 L;  1WI5 A;  4IUR A;  4TVA B;  1SND A;  3A5Z B;  5IP7 H;  2F3I A;  3I55 A;  1HFN A;  1MD2 D;  1XPU A;  4RMF A;  4Z9C B;  4R8I A;  4YCV A;  3T1H L;  1FJG Q;  3HP3 A;  2FMC A;  2HQE A;  3ERO A;  1HH2 P;  1YZ6 A;  4DV4 L;  1ILQ A;  3V2T A;  3DWA A;  1BBU A;  1HNX L;  4HJ9 A;  4RKB A;  1EFW A;  1K8A C;  1PTO C;  3RR5 A;  3K7A H;  2ZM6 Q;  3HOX B;  3UDI A;  2A74 C;  1CKN A;  4K6L A;  4O42 A;  4JI6 L;  1I4R A;  2F03 A;  2I46 A;  1F9P A;  5E7N A;  2O2L D;  1AZQ A;  5M5Y H;  2FFK B;  4GKK Q;  1FD7 D;  1VF7 A;  2B2Y C;  5M3F G;  1S5F D;  4LF8 L;  1TWG B;  4DR6 Q;  1V1O A;  3JC6 6;  1JIC A;  1EIY B;  2L1B A;  2IX1 A;  2R7Z G;  1LTR D;  1T5X D;  2A1A A;  1KLU D;  4KJN A;  2F0V A;  4DUY Q;  1MSH A;  1C9O A;  3RMH A;  1FL0 A;  4HSV A;  2R7Z B;  3AU7 A;  2PW7 A;  1LTL A;  3K0Y A;  1HNZ L;  2E2J H;  1X56 A;  2CH4 W;  1TQO A;  1WCM H;  1IYU A;  1N33 Q;  3GTM H;  3CC7 A;  3M4O H;  1DZ1 A;  1HRJ A;  1STG A;  4JC0 A;  3RZO B;  5M5X B;  1ESR A;  4JYA L;  5JJL A;  4DFA A;  4DV6 Q;  5LMN W;  2A6E D;  3I4O A;  1H9M A;  2YTV A;  1H9K A;  2CW0 C;  1O7L A;  3PF4 A;  2O5J C;  2IX3 A;  4RCN A;  2DNE A;  4BBR G;  3G4S A;  4UY8 C;  1PV4 A;  1XTC D;  4QQB X;  1UUP A;  4YY3 Q;  4EQ5 A;  2E75 C;  2F1M A;  1DXM A;  4HTH A;  2GVA A;  5ISR A;  3D0F A;  3OSO A;  5C0X H;  3OIP A;  2K33 A;  5C3E B;  1X3F A;  3A7L A;  1FGB D;  1D1I A;  1L1O A;  2N8N A;  2K52 A;  2IHE A;  5KNC A;  5IT9 L;  3FPU B;  1LAB A;  3KUP A;  4LUO A;  1VS0 A;  1SFO H;  1SBB B;  2K7V A;  1XX8 A;  1K83 B;  2F0U A;  4BS9 A;  3J7Y W;  2R3Z A;  4NP5 A;  2PZU A;  4HN7 A;  3NEM A;  1XNR L;  2PI2 A;  4GLX A;  3CRK C;  1Y8N B;  4NW2 A;  4IOC A;  5G3L F;  2FIN B;  3E9H A;  3L0O A;  5A2Q E;  1HNZ Q;  3BYT B;  1D7Q A;  3BVZ A;  3SGI A;  4IPG A;  5IGF A;  1EQT A;  3J80 L;  4PMB A;  4DR4 L;  3HOY H;  2F3V A;  1BF4 A;  3NQI A;  3HOV H;  3PCO B;  4RGO S;  4YWK A;  4BBS H;  1VF5 C;  5I2X A;  4A3J G;  3D4R A;  1TS5 A;  4JYA Q;  1HR0 W;  5K36 G;  3MXN B;  1PDQ A;  1EZ8 A;  4JPB W;  5CV4 A;  1IBK L;  2MO0 A;  5FLM G;  1Y1W G;  1BBX C;  4TRD A;  4OO1 H;  1JOQ A;  1DON A;  4A3D H;  3EVQ A;  1Q8I A;  2UU9 L;  1N8R C;  5K5P A;  2Z8L A;  3I91 A;  3X3N A;  3E3X A;  3BDC A;  4CHT B;  1E2Z A;  1OXV A;  1FVI A;  3VR3 A;  2WB1 G;  3H6M A;  1JQY D;  1L0X B;  3J81 L;  3J80 i;  1Q3L A;  2DN8 A;  1VDZ A;  4X66 L;  3RLF A;  3S1Q B;  2G9H D;  2WP8 J;  4QUC A;  4OX9 L;  4GZY C;  2WFW A;  2R92 G;  2HUG A;  3I4M G;  3S2D B;  4S3S A;  4TQU S;  1NUC A;  3HOU B;  4UHV A;  1XTD A;  3OWE B;  1IKL A;  3M4Y A;  1B7Y B;  1ICW A;  1W3S A;  4UP9 A;  2Q2T A;  2F0P A;  3S1N B;  1TWG H;  3NWT A;  2NVY B;  3F2U A;  1SR3 A;  2A69 C;  2QGQ A;  4JI1 L;  1BKB A;  3I4N G;  5CV5 A;  3M7N A; 
#chains in the Genus database with same CATH homology
 5M3F H;  2CCZ A;  3CPF A;  1EWI A;  2AWN A;  4B3R L;  2NZO A;  3CQZ H;  3RN5 A;  2JA6 H;  3PO3 H;  3TEH B;  1YHA A;  3T1Y Q;  1V1Q A;  5C4J H;  3CCE A;  4HIK A;  4QL5 A;  3NEL A;  3UE0 A;  4GNX C;  1PH1 A;  4LF9 L;  2R7Z H;  1A0I A;  1SMX A;  2GN5 A;  1X9N A;  1I3Q H;  2NVY H;  1OTC A;  4A3C G;  3KJO A;  2JE6 I;  2HIV A;  2YTY A;  2UXD L;  3T1H Q;  1IBK Q;  1SRO A;  4BA1 I;  1PYB A;  5HGQ A;  4X64 L;  1TWH H;  1V9P A;  1CSP A;  3W5O A;  4DV4 Q;  1VQD A;  1CKN B;  4P71 A;  1RIP A;  1HNX Q;  1U0L A;  4DV2 Q;  3S2H H;  3TS0 A;  1XPO A;  3EN2 A;  2IX0 A;  3RNU A;  2ZTD A;  3CME A;  3DLL A;  4LFC L;  4DV5 Q;  1K0R A;  2JA7 H;  2LXJ A;  3RZO H;  2AMC B;  1I94 Q;  1B70 B;  1HZA A;  3U50 C;  4A4I A;  4HIO A;  4ME3 A;  3KF6 B;  4AH6 A;  2HQL A;  4HID A;  3UDG A;  2VQF L;  3PIO A;  4JI6 Q;  4UP8 A;  4HJ8 A;  4GKJ Q;  2RF4 A;  3NEN A;  2UUA Q;  1N9W A;  1Q7Y C;  3TS2 A;  3TQY A;  4LF4 Q;  3GTL H;  4K0K L;  2Z6K A;  3CC2 A;  2JA9 A;  1L1O C;  4P75 A;  1K9M C;  2K5V A;  1J5E Q;  2K4K A;  4B3S L;  1FJG L;  1E22 A;  4A3G G;  4NPS A;  4LF8 Q;  4LFB L;  3GTQ H;  2N3S A;  2IY5 B;  3K8A A;  2ZJR A;  3AFP A;  1TWA H;  1UE5 A;  4BXX G;  4BY1 H;  4YCW A;  4BBR H;  3K81 C;  2ZM6 L;  4AYB G;  5C3E H;  1M90 C;  4JBM A;  5IWA Q;  2OQ0 A;  1OXX K;  3FKI G;  4DR2 Q;  4O2D A;  4JI2 Q;  3RLN A;  4DR5 L;  4LFA Q;  1QVC A;  5AJ3 Q;  4A3E H;  4LW1 A;  2Y0S G;  1X54 A;  4EX5 A;  3PO2 G;  1RL2 A;  2UUC Q;  4GKK L;  4JCV E;  2JK8 A;  5IYC G;  4HJA A;  3J7A 5;  5M5W H;  1ASZ A;  2ES2 A;  4BY7 G;  1K83 H;  2RHS B;  4YCU A;  5C44 G;  2QA4 A;  4GNX B;  3HOY G;  5C4X H;  4OXP A;  1NTG A;  3OW2 A;  3CCQ A;  1BBW A;  4DPG A;  1IBL L;  4DR6 L;  1VQI A;  2GVB A;  4B3R Q;  3H3V I;  3B6Y A;  3KOJ A;  5IP9 H;  3M85 A;  1XMQ L;  4JI5 L;  2H5X A;  2K5N A;  1KXL A;  4LF6 L;  3PV0 A;  4QGU A;  4IPD A;  4POG A;  2JA8 G;  4DUY L;  2EQS A;  4L5T A;  3KDF B;  1EQR A;  1KQS A;  2ZJP A;  2AWO A;  2F52 A;  1VQ7 A;  4PG3 A;  2VQE L;  4IFD J;  1FGU A;  1K8G A;  1HNW L;  4YWL A;  4L5S A;  2CQO A;  3J80 c;  3F8T A;  2BA1 A;  1KL9 A;  1VQ5 A;  4LF7 Q;  1TWF H;  3PIP A;  1XNQ L;  1E24 A;  2JQO A;  3A5U A;  1E7Z A;  1QZH A;  5IE8 A;  4A3M G;  2N78 A;  3H0G G;  2OTL A;  3AFQ A;  1L1O B;  2XGT A;  3F2B A;  1JJC B;  2WB1 E;  1Q86 C;  5JEA G;  1E3P A;  3L7Z C;  2KCM A;  4OO1 I;  2CWP A;  3E0E A;  4JBW A;  4XTC S;  2K5H A;  4ALP A;  4AQY Q;  1HZ9 A;  1EOV A;  3I56 A;  4K0K Q;  1PH3 A;  1X3G A;  4HJ5 A;  3GTG H;  4B3S Q;  3S1R H;  4DV6 L;  3HOX G;  1R9T H;  1NY4 A;  5M3M G;  4L5Q A;  5FLM H;  3UE1 A;  1Y1W H;  2YYZ A;  1L0W A;  3ICE A;  3S15 H;  2UXB L;  4A3I H;  1GKH A;  1PH8 A;  2A8V A;  4PZ8 A;  1L2F A;  3CPW A;  3HFZ B;  4QJF A;  3TRZ A;  3NBH B;  3PUX A;  2WAQ E;  5GRO A;  1PH4 A;  2E2I H;  3HOW H;  1UEB A;  4YY3 L;  3OYY A;  3M4P A;  2UXC Q;  5FJ8 H;  1UE7 A;  2VY3 A;  1XNR Q;  2HHH Q;  1AH9 A;  1HZB A;  4DR5 Q;  4GN3 B;  1QZG A;  2RHQ B;  3DM3 A;  2JA5 G;  1JE5 A;  3CD6 A;  2JJQ A;  4P72 A;  1JJG A;  5GAE C;  3J81 c;  5DLQ E;  4C2M H;  4DNI A;  4GOP C;  1EUJ A;  2BH8 A;  4A93 H;  1P16 A;  1KRS A;  3KF6 A;  4JG2 A;  2MQH A;  4DV7 L;  1N36 L;  3PUZ A;  1YIJ A;  2PNH A;  2BH2 A;  3S1Q H;  1YVC A;  4IOA A;  3S1M H;  4IPC A;  2CWA A;  4DR4 Q;  4H02 A;  2OTJ A;  1IBL Q;  4OON A;  2JA6 G;  1QUQ B;  2HIX A;  3AQQ A;  2NVQ H;  3S2D H;  1K73 C;  2DGY A;  4KHP L;  1SLJ A;  3BU2 A;  5LMN L;  1XMQ Q;  2E5L Q;  4B3M Q;  3HOU H;  4HIM A;  4DR7 Q;  4DR1 L;  2NZH A;  4LF6 Q;  3F2C A;  3FHW A;  3I4M H;  3S1N H;  1PVO A;  1G29 1;  4MNO A;  4NXN L;  1OXS C;  4HJ7 A;  5LMU L;  4GLV B;  2KCT A;  2OCE A;  3JAM i;  2VQE Q;  1Z9F A;  2ZTC A;  2LXK A;  3GO5 A;  2IT1 A;  4DV0 L;  1XPR A;  4JI7 L;  3H15 A;  2XTI A;  1VQ6 A;  4X65 L;  1MIU A;  1GD7 A;  1A63 A;  2VL6 A;  2UU9 Q;  1J6Q A;  1KC8 C;  3ULJ A;  4UP7 A;  5GAD C;  3I4N H;  2LSS A;  3I7F A;  1PH6 A;  4DAM A;  1I5F A;  1LYL A;  5C0X G;  2KEN A;  1YJ9 A;  2K50 A;  5GQO A;  1LM0 A;  2UUB Q;  2L15 A;  2N49 A;  3CCU A;  4DUZ L;  1K3R A;  4A3C H;  2Z6K C;  1NMF A;  1NJI C;  3OTO L;  3L2P A;  4B3T Q;  1VQ4 A;  2MFI A;  1IXR A;  1OXU A;  4X66 Q;  2UXB Q;  4R4C A;  4BY1 G;  1X65 A;  3PGZ A;  3KDF A;  4QIW E;  4AIM A;  5C0X I;  4IFD I;  4OWX B;  2Q2I A;  4JOI A;  4OX9 Q;  5C3E G;  4GOP B;  3VDY A;  3CCJ A;  4POF A;  3STB D;  2MNA A;  3GTP H;  1PA6 A;  3RLO A;  2DUD A;  1VQJ A;  3STB C;  1Q12 A;  1Q46 A;  2Y0S E;  2I5H A;  4YHH L;  2F4V L;  4J15 A;  4A3L G;  4NXM L;  1PH7 A;  2KHI A;  2VZA A;  3KYH C;  4DV7 Q;  1S72 A;  1CUK A;  3PSI A;  4A3B G;  3RN2 A;  5IT9 c;  2D62 A;  5C4X G;  1IZ6 A;  3ULL A;  4JI1 Q;  4Y52 H;  1VQA A;  1VQG A;  1S3O A;  1XJV A;  2VUM G;  4LNQ A;  1HR0 L;  2JEB I;  3HOV G;  3PF5 A;  1N34 L;  5IP9 G;  1Z47 A;  3KLW A;  4A3F H;  3HOZ G;  4A3G H;  2IHF A;  1E1O A;  3UDF A;  4BBS G;  4KHP Q;  3BZC A;  3G71 A;  4R4T A;  4BXX H;  4A75 A;  4UPA A;  4R4Q A;  4DR1 Q;  1TXY A;  2D0O A;  4LF9 Q;  1SN8 A;  4LWC A;  1JB7 A;  1C7Y A;  4WJ3 M;  1VQK A;  4KHZ A;  4LUZ A;  1PYS B;  2K14 A;  5BR8 L;  2UXD Q;  4Y7N H;  5LMU Q;  3H3V H;  4DV1 L;  1VQ8 A;  3FKI H;  4X64 Q;  4DV0 Q;  1WFQ A;  1Q81 C;  4DR3 L;  4OO1 G;  2KHJ A;  3PO2 H;  1BVS A;  4A3D G;  4JI3 L;  4FDB A;  4GN4 B;  4OWT B;  3FP9 A;  2ALY B;  1AE3 A;  3F1Z A;  3MEF A;  4JI0 L;  1YBY A;  4LFC Q;  2B63 H;  5C44 H;  4IO9 A;  1MKH A;  3ERS X;  3W1B A;  2Q2H A;  1N33 L;  2ATW A;  3A0J A;  4L5R C;  3AYH B;  4DAY B;  2VQF Q;  1WI5 A;  3IRB A;  4YWM A;  4TVA B;  3A5Z B;  4XIG S;  1Y1V G;  2PI2 E;  3S17 H;  5IP7 H;  2F3I A;  3I55 A;  1Q1E A;  4A3J H;  1XPU A;  3CW2 C;  1XNR L;  4RMF A;  2JA8 H;  1SE8 A;  2FXQ A;  4YCV A;  3TRE A;  3T1H L;  2ZJQ A;  1FJG Q;  1O7I A;  1YHQ A;  1HH2 P;  1NE3 A;  2Z0S A;  1YZ6 A;  4DV4 L;  1WOC A;  1QVF A;  4LFB Q;  2VNU D;  5IYD G;  1BBU A;  1HNX L;  4HJ9 A;  1KAW A;  1YEZ A;  2NN6 G;  4DV2 L;  1K8A C;  1EFW A;  1CKM A;  1PH9 A;  2JEA I;  3HOW G;  1N32 L;  3LGJ A;  3RR5 A;  3K7A H;  4DV5 L;  2ZM6 Q;  1IBM L;  1X55 A;  3U4Z A;  3UDI A;  1I94 L;  1CKN A;  3H0G H;  5IYB H;  4JI6 L;  3E9I A;  3ER0 A;  1XMO L;  3I4N G;  4P74 A;  4GKJ L;  1PH5 A;  5E7N A;  2R93 G;  4A3K G;  2I0Q A;  5M5Y H;  2R6G A;  4DV3 L;  1YIT A;  4GKK Q;  2NVX H;  4LF4 L;  2NN6 I;  1CSQ A;  1YNX A;  2EIF A;  3HKZ E;  2MO1 A;  5M3F G;  4IJL A;  3HOX H;  5ELO A;  1HR0 Q;  3HKS A;  5M3M H;  4LF8 L;  3KFU A;  5JJK A;  4DR6 Q;  2ZTE A;  3PO3 G;  3JC6 6;  3RZD H;  3HOU G;  2YTX A;  5IY0 A;  3S24 A;  1EIY B;  3CC4 A;  4BA2 I;  4GS3 A;  4DKA C;  1MJC A;  5JJI A;  2IX1 A;  2R7Z G;  1A62 A;  1B8A A;  3G6E A;  1KHI A;  4JI5 Q;  2WAQ G;  2A1A A;  3J7Z C;  5IWA L;  2CFM A;  1GM5 A;  2R92 H;  1VQN A;  4DUY Q;  1D8L A;  4P73 A;  1S40 A;  1C9O A;  4DR2 L;  1FL0 A;  1X6O A;  1VQL A;  4GOP A;  4JI2 L;  5GAH C;  1Q82 C;  5AJ3 L;  4LFA L;  3G48 A;  1YI2 A;  2JA5 H;  1G51 A;  1GVP A;  1LTL A;  1EQQ A;  4JI8 L;  3M4Q A;  1HNZ L;  3S14 H;  3AEV A;  2E2J H;  2OWO A;  1X56 A;  1XNQ Q;  2JA7 G;  1WCM H;  2ASB A;  1VQP A;  4C3J H;  4JBJ A;  1N33 Q;  3GTM H;  3CC7 A;  1GO3 E;  3ZJY C;  3M4O H;  3PUW A;  4JV5 L;  3D31 A;  4JC0 A;  1Q8K A;  2AHO B;  1UWV A;  4GNX A;  4IFD G;  2EXD A;  3I2Z A;  1WJJ A;  1VQF A;  4JYA L;  2PQA B;  3J81 i;  1G6P A;  5JJL A;  1T9H A;  4PMW A;  1E1T A;  5FLX c;  4DV6 Q;  5LMN W;  2A19 A;  3I4O A;  2YTV A;  4C3I H;  3PF4 A;  5JEA J;  4A76 A;  1N32 Q;  3KJP A;  1HZC A;  4LF7 L;  1EIF A;  4BBR G;  3G4S A;  4UY8 C;  2VS1 A;  1PV4 A;  1C0A A;  4X6A H;  3W1G A;  4AYB E;  3ULP A;  5M5X H;  1IBM Q;  4R1J A;  1UE6 A;  4JOI C;  4QQB X;  4YY3 Q;  3CCS A;  4EQ5 A;  1VQC A;  2PMZ E;  4X62 L;  2GVA A;  3CAM A;  4MTN A;  3K0X A;  1M1K C;  2AKW B;  1XMO Q;  3D0F A;  4R4I A;  4A3E G;  3M9B A;  2CKZ B;  4DV3 Q;  1X3F A;  2I5L X;  3J81 j;  2QEX A;  2D0P A;  3K80 C;  2E8G A;  2N8N A;  1L1O A;  1LUZ A;  4AQY L;  3BJU A;  1N36 Q;  4MZ9 A;  3A74 A;  3EBE A;  2K52 A;  2IHE A;  1QVG A;  1JT8 A;  3GTJ H;  4NB3 A;  1VQB A;  1X3E A;  4LUO A;  4A3F G;  4WJ4 A;  1VS0 A;  3F2D A;  1UE1 A;  1H95 A;  1SFO H;  4GN5 A;  2OQK A;  5LMN Q;  4O0A A;  5HY6 A;  1KRT A;  1A8V A;  1V43 A;  2V1C C;  3CCM A;  2UXC L;  1PH2 A;  3NEM A;  1YHB A;  2B3G A;  2B29 A;  2PI2 A;  3PUV A;  4QY7 A;  1KD1 C;  1Y14 B;  3KF8 B;  2HHH L;  4NXN Q;  4GLX A;  2NVT H;  4C3H H;  1YJN A;  4JI7 Q;  4JI4 L;  4A3L H;  1ASY A;  4IOC A;  2K75 A;  3E9H A;  3L0O A;  2I5M X;  1OXT A;  4JI8 Q;  4X65 Q;  1HNZ Q;  3UDX A;  3WWV A;  2B63 G;  4A3B H;  3SGI A;  1D7Q A;  4IPG A;  5IYC H;  1U5K A;  3BZK A;  3Q8D A;  4BY7 H;  1I50 H;  2R7F A;  2RCN A;  3HOY H;  4DR4 L;  1VCI A;  1EYG A;  3GTO H;  4JV5 Q;  1VQO A;  2VUM H;  1IYJ B;  4KI0 A;  1W2B A;  3HOV H;  3HOZ H;  2BA0 A;  4PZ6 A;  3PCO B;  4YWK A;  4BBS H;  1NBW A;  2E5L L;  3T1Y L;  4B3M L;  5IP7 G;  4APV A;  3GTK H;  4DR7 L;  4KLK A;  4A3J G;  3EIV A;  5K36 G;  4JYA Q;  1HR0 W;  1P8L A;  2KBN A;  1QUQ A;  4IJH A;  4IPH A;  3MXN B;  4DUZ Q;  3GDE A;  5EAY A;  1KIX A;  2E2H H;  1VQM A;  1IBK L;  2MO0 A;  5ELN A;  5FLM G;  5C0X J;  3OTO Q;  1TWC H;  1VQH A;  1Y1W G;  4LF5 L;  1IL2 A;  1AE2 A;  1CKO A;  3PUY A;  4A3I G;  1PFS A;  4LUV A;  3CCR A;  4R4O A;  4A3D H;  3CMA A;  2UU9 L;  3K7U C;  1I6H H;  1N8R C;  4DK6 C;  1MJE A;  5IYB G;  5FJ8 G;  4X62 Q;  3M3Y H;  1YJW A;  4A3M H;  1JJ2 A;  1JMC A;  2YU9 H;  1OXV A;  4JBK A;  1FVI A;  2F4V Q;  4YHH Q;  1SRU A;  2WB1 G;  4NXM Q;  4A93 G;  2UUA L;  4DK3 C;  1Y1V H;  4RG1 A;  3CCL A;  4OWW B;  2ID0 A;  3GD7 A;  2UUB L;  1HJP A;  2VW9 A;  3JAM c;  3J80 i;  2R7D A;  1J5E L;  4B3T L;  2YV5 A;  4X66 L;  3CXC A;  3RLF A;  2PQA A;  1N34 Q;  2C35 B;  3CP0 A;  2WP8 J;  4GLA C;  1PHJ A;  5IYD H;  4PZ7 A;  4OX9 L;  1WYD A;  3S16 H;  1Q1B A;  3U58 A;  2WFW A;  2R92 G;  1HNW Q;  1DGS A;  1NMG A;  3I4M G;  2Q2U A;  4TQU S;  5J3B A;  2HT1 A;  5BR8 Q;  3CCV A;  4DV1 Q;  1XTD A;  1VQE A;  5H1S E;  1B7Y B;  5GAG C;  1W3S A;  4JI4 Q;  4UP9 A;  4LF5 Q;  4DR3 Q;  2Q2T A;  4A3K H;  2R93 H;  2UUC L;  1TWG H;  4JI3 Q;  3CF5 A;  1SR3 A;  1WCM G;  2QGQ A;  4JI1 L;  3U4V A;  1BKB A;  1VQ9 A;  4JI0 Q;  3HKZ G;  3M7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...