2VW9A

Single stranded dna binding protein complex from helicobacter pylori
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
108
structure length
108
Chain Sequence
MFNKVIMVGRLTRNVELKYLPSGSAAATIGLATSRRFKKQDGTLGEEVCFIDARLFGRTAEIANQYLSKGSSVLIEGRLTYESWMDQTGKKNSRHTITADSLQFMDKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Single-Stranded DNA-Binding Protein Complex from Helicobacter Pylori Suggests an Ssdna-Binding Surface.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Dna binding protein
molecule keywords SINGLE-STRANDED DNA BINDING PROTEIN
total genus 20
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vw9A00
1FJGL 1PH5A 1WJJA 2RF4A 1R9TH 3S2HH 4NB3A 4LFCQ 4YWLA 4O0AA 4QIWE 4DUZQ 4A3MG 2NVXH 1NTGA 4LFAL 5LMNW 3UDGA 2R93G 5GADC 1VQDA 3H3VH 2YV5A 3RLNA 3CQZH 4BBRH 4AQYQ 5C44H 2VL6A 4P71A 4A3KH 1A62A 1EOVA 1UE6A 2QEXA 2IHEA 4C3JH 1RIPA 3BU2A 5M3MH 2JJQA 2NVYH 4IJHA 1VQOA 4JI3L 3J81i 4OX9L 2B63H 4GKJL 1EYGA 1NJIC 4POGA 4DR4L 2Q2UA 4DUYL 4B3TQ 3J81c 2UUCQ 4JG2A 4JI2Q 2RCNA 2EXDA 2JK8A 3CP0A 3HKSA 3I56A 2K52A 4DK6C 3H15A 1Q7YC 4MTNA 2PQAB 1GVPA 4OX9Q 2NVQH 4DV6L 2VQFL 2R92H 2F3IA 2YTXA 2N49A 1N34L 4JBJA 2GVBA 4JOIC 1SFOH 2MNAA 3M9BA 3PUVA 1VQIA 2BA1A 1EQRA 3GDEA 3KF8B 5IP9G 1VQFA 5IE8A 1QUQB 2Q2IA 4DR5Q 5GAGC 1Y1WG 2NZHA 2VQFQ 1QZHA 1Q12A 1XJVA 1JJCB 2CKZB 3TS2A 4JV5L 2F4VL 4YWMA 1N32L 4LW1A 5LMNQ 3KDFA 3EBEA 4X64Q 3CCRA 2ID0A 2NZOA 3RNUA 2VZAA 4BXXG 3CMAA 1PA6A 5IP7H 3M3YH 2UXBQ 2JA5G 3AQQA 4YHHL 1HNXQ 1XMQL 1DGSA 2D62A 3JAMi 4JI5L 3CCJA 5K36G 1I5FA 2R93H 1VQMA 4BY1G 2Z0SA 4Y7NH 3W5OA 4ME3A 1U0LA 1G6PA 2WAQE 1XPRA 1X9NA 2F52A 2AKWB 4A3FH 1JMCA 5JJKA 3CMEA 1VQEA 2YYZA 3STBC 1Y14B 4GNXA 4JI7L 3L7ZC 1KRSA 4JBMA 5IT9c 4UP8A 2R7ZG 1S40A 2KHIA 1QVCA 1SRUA 2PQAA 5JJIA 2JA6H 4K0KL 5C4XH 1KXLA 3ULJA 2GVAA 4DV2Q 1Y1WH 2D0PA 1RL2A 5JEAG 4DR1Q 3HOWH 4OWTB 4A3GH 4LF5L 3F8TA 1LUZA 1EWIA 1P16A 3JC66 4LFBQ 2HIXA 4NXMQ 4DR7L 1E24A 2NN6G 1LM0A 2OCEA 1J5EQ 1IBLL 1TXYA 4DR4Q 3M4OH 1OXVA 4X66L 1PH3A 4JI4L 3UDXA 3S2DH 4BY7G 5FLMG 2UUCL 3Q8DA 3CCSA 1CKMA 1H95A 3PO3H 3WWVA 2QA4A 4IO9A 1YVCA 3KOJA 1E1OA 3BZCA 4UY8C 4DUYQ 3JAMc 4BY1H 3W1BA 1QVFA 2I5LX 3GTGH 4JYAQ 1I3QH 3U58A 1HJPA 4WJ3M 5H1SE 1X6OA 1TWCH 1OXSC 1UEBA 3IRBA 4LWCA 5AJ3L 1HR0W 4HJAA 4A3GG 5IP7G 2VS1A 3B6YA 4JI0Q 5M3FG 4YCWA 4YY3L 4DR5L 2Q2TA 4APVA 2CQOA 3F1ZA 4LUVA 4DAMA 1NMFA 4DV1Q 5JEAJ 4DV7Q 1YITA 2UUBQ 4DNIA 4LF6Q 4C3HH 4IOAA 4JV5Q 2BH8A 5GAHC 2F4VQ 3HOZG 3S1NH 2UXCQ 4A3IH 2K5NA 4DR2L 1OXXK 1B8AA 1HZCA 2Y0SE 4YY3Q 1HNZL 1IBKQ 1N32Q 5LMNL 2IX1A 2K5HA 2DUDA 3S1MH 3T1YQ 3D31A 3I4MG 1W2BA 1VQAA 1GM5A 1C7YA 1SMXA 2VQEQ 3I4NH 2UXDQ 3S1QH 2NVTH 3PUZA 3RLFA 3DM3A 2HT1A 1VQ6A 2JA7H 3A5UA 1AE3A 3CCLA 4GLXA 1A63A 1L1OC 2MO0A 3CXCA 1Y1VG 3F2BA 3KYHC 4GNXC 4BBSG 2I5MX 4OO1G 1JJ2A 3ERSX 1N36Q 3LGJA 1TWGH 1HZ9A 4AQYL 2B3GA 4K0KQ 1B7YB 3AYHB 1O7IA 2Z6KC 4L5SA 5FJ8G 1SLJA 1Q1EA 5IYBH 4LF7Q 3PF4A 1VQCA 4A3BG 4A76A 1PH8A 3I2ZA 4NXNL 1PH2A 1J5EL 4OXPA 2Q2HA 4GLAC 1IBLQ 4B3ML 3BZKA 1FJGQ 3CCEA 3AFPA 3NELA 1BKBA 4WJ4A 3EN2A 4AH6A 5BR8Q 2DGYA 4GS3A 2WB1E 1Z47A 3KFUA 4BBSH 4KI0A 5GAEC 4P75A 1TWAH 1V9PA 1KD1C 4BY7H 5FLMH 1AE2A 4QL5A 2R7FA 3U4ZA 4X62L 1N34Q 4IPDA 3PV0A 1VQGA 3PIOA 4DKAC 4BBRG 5LMUQ 5C44G 3RLOA 4A75A 1C9OA 3CCVA 1N9WA 1YHAA 3SGIA 4C2MH 4EX5A 4A3LH 3W1GA 4A93G 2ZTEA 2CFMA 4H02A 3F2DA 4IPHA 2JA6G 4LUOA 3U4VA 1ASZA 2IHFA 4X64L 3DLLA 3RN5A 1CKNA 2N78A 2JA8H 3RN2A 4LUZA 3M85A 4X66Q 2ZJRA 1Y1VH 5M5XH 2UXCL 4DV5Q 4R4OA 1A8VA 5J3BA 1IL2A 3KJOA 4A3JH 2GN5A 2WFWA 4R4IA 1UE7A 5M3MG 1I94L 4JYAL 1IBKL 2AHOB 3GTOH 1W3SA 1ASYA 1EFWA 4GKKL 2MO1A 2ZM6L 1IXRA 1IBML 4JI6Q 2KHJA 4A3EH 3K0XA 4GOPC 4DAYB 5AJ3Q 2R7DA 4TQUS 5C3EG 1BVSA 2VQEL 1QVGA 1JT8A 2R6GA 1K73C 1L1OA 2YU9H 4B3SL 4DV1L 3J80i 3NBHB 1NY4A 4R1JA 1KQSA 2PI2E 4HIKA 2B63G 3PO2G 2ZJQA 2MQHA 2D0OA 1X3GA 3KJPA 1X55A 1XNQQ 4AYBG 4L5QA 2VY3A 2ZTDA 4DPGA 1EQQA 4L5RC 3PCOB 5IP9H 2K14A 1KHIA 1N33Q 3PUYA 1A0IA 1Q86C 2I0QA 2AMCB 1PH9A 3L2PA 1K0RA 3T1YL 1MKHA 1TWHH 2ZTCA 3K80C 4IOCA 3H3VI 4LFCL 2HHHQ 3TRZA 1E7ZA 4MZ9A 5ELNA 1WI5A 3AFQA 1UE5A 1PH1A 2NN6I 3A5ZB 4GOPB 2E2IH 4A3DH 1G291 1KL9A 1PV4A 3ULLA 1XNRQ 3HOYG 1E1TA 2VW9A 2AWOA 4QQBX 1NMGA 3I55A 1JB7A 4JBKA 3S14H 1CUKA 4IFDG 3PGZA 4YCVA 1XTDA 3I4MH 4RG1A 1VCIA 3ER0A 4JI1Q 2OQKA 3RZOH 4GN3B 4DR6L 4DV4L 1IYJB 2K5VA 4PG3A 5IYCG 4LNQA 1D8LA 3S15H 4JBWA 1PYSB 5FLXc 1VQ4A 3UDIA 1WFQA 4GKJQ 4JI3Q 1K8GA 1E22A 4TVAB 1M90C 1XPUA 4JI1L 1X54A 2VUMG 5IYBG 3J7ZC 2ES2A 3M4PA 5C0XG 1WCMH 4DV2L 5HY6A 1YHQA 4B3TL 2UXDL 4O2DA 3CCMA 3I4OA 3HOXG 1EIYB 2E2HH 1D7QA 4GKKQ 1P8LA 1JJGA 4DR1L 4LF8Q 3A74A 1PH7A 3CF5A 3H0GG 3PUWA 3RZDH 1FVIA 1YBYA 4PZ7A 4HJ7A 3KF6A 3HOYH 5C4XG 1EUJA 2ZM6Q 1IBMQ 4B3RQ 2Y0SG 4DV3L 3T1HQ 1NBWA 1VS0A 3U50C 3HOVG 1PYBA 2KCTA 1V1QA 3GTKH 3I7FA 1CSQA 1XNQL 2A19A 1L0WA 3BJUA 4QJFA 4OO1I 3TEHB 3GTMH 1MJEA 2IX0A 3J7A5 1PH6A 2JEBI 1MIUA 1U5KA 4LF4Q 3CW2C 2XTIA 1HNWL 5IY0A 1GO3E 1QZGA 4JI0L 1UWVA 3HOUH 1C0AA 4A3IG 2JA9A 3E9HA 3EIVA 2HQLA 4GN4B 2K4KA 1GD7A 2R92G 1IZ6A 3NENA 4JI6L 5EAYA 3HKZE 1SE8A 4IFDJ 3PO3G 3AEVA 4POFA 4A3CH 4QY7A 4DR2Q 3J80c 4BA1I 4R4TA 1BBWA 2KCMA 4A3EG 3S24A 2UUAL 4LF5Q 4LFBL 3L0OA 5C3EH 4NXML 3G71A 4DV6Q 2ATWA 1MJCA 1SR3A 4NXNQ 4KHPL 3OTOQ 2Z6KA 4IJLA 2K50A 4L5TA 2PI2A 3VDYA 3F2CA 5FJ8H 2BA0A 2LXKA 4JCVE 4HJ5A 2KBNA 4DR3Q 3K7UC 4A3KG 3CAMA 1VQ7A 4A3JG 4OONA 3STBD 1N33L 5C0XJ 1L2FA 3PUXA 1NE3A 1VQJA 4DR6Q 4RMFA 4AYBE 1HR0L 1VQ8A 1VQKA 1KIXA 3GTLH 1UE1A 5IYCH 4MNOA 4HJ8A 4DR3L 3CC2A 1K3RA 4A4IA 1X3EA 1S3OA 4QGUA 2CCZA 4KHZA 1YJNA 3HOWG 2JE6I 1LYLA 1X65A 4JI4Q 2YTVA 3E9IA 4OWXB 4JI2L 1PFSA 2UUBL 4YHHQ 2I5HA 1HNXL 1XMQQ 3KLWA 3ZJYC 1PVOA 2EQSA 1L1OB 2V1CC 2XGTA 3FKIG 2PNHA 5ELOA 2E5LQ 2KENA 2MFIA 3GD7A 1J6QA 3UE0A 3CPWA 1HNZQ 1SROA 1KC8C 1OXTA 1X3FA 3K8AA 2RHQB 1QUQA 5HGQA 3CC4A 4BA2I 3FP9A 1HZAA 2IT1A 1Q82C 2BH2A 2JA8G 2JEAI 4X6AH 2PMZE 3M7NA 3CCQA 2OWOA 4DV7L 4LF6L 4JC0A 5JJLA 1M1KC 1EIFA 3FKIH 1N8RC 4EQ5A 3S17H 4JI8Q 5M3FH 1K8AC 3M4QA 3ULPA 3K7AH 1KRTA 3KF6B 4BXXH 1YIJA 3K81C 4HIOA 3UE1A 2HHHL 4NPSA 4P72A 1Z9FA 4GOPA 4B3SQ 2VUMH 2H5XA 4Y52H 1JE5A 5GQOA 4A3MH 1N36L 4IPCA 4LF8L 4UP7A 4HIDA 4R4QA 3E0EA 3HOZH 3UDFA 2R7ZH 1FL0A 2N8NA 2RHSB 3G48A 2UUAQ 4LF9Q 4A3CG 4A3FG 2LXJA 1B70B 1Q1BA 4A93H 1YI2A 3ICEA 4KHPQ 3OTOL 5M5WH 4JI7Q 1WOCA 1BBUA 2WP8J 3H0GH 4ALPA 1Q8KA 4PMWA 1E3PA 3J81j 4OWWB 4JOIA 1I94Q 1VQ9A 3I4NG 4AIMA 2IY5B 4KLKA 1KAWA 1YJ9A 2OTJA 1VQBA 4LF9L 1XMOL 1OTCA 2VNUD 4JI5Q 1YEZA 2WB1G 2ALYB 3HFZB 4LF4L 2UU9Q 4DV0L 3GTJH 4IFDI 2QGQA 1VQ5A 3HKZG 2E2JH 1CKOA 4A3DG 2YTYA 1HNWQ 2A1AA 2ZJPA 3A0JA 1FGUA 2WAQG 2ASBA 2LSSA 5IWAQ 4DUZL 1YZ6A 5LMUL 4B3MQ 2HIVA 5M5YH 1XMOQ 1HZBA 2E8GA 5C4JH 4GNXB 3OYYA 3MEFA 2JA7G 2OQ0A 5BR8L 1VQNA 1XPOA 4DV4Q 1AH9A 4FDBA 2K75A 5C0XI 5IYDH 5IWAL 3D0FA 1CSPA 2EIFA 3CPFA 2JA5H 3FHWA 1Q81C 4X62Q 4DV3Q 4B3RL 3PIPA 1PH4A 4DR7Q 3RR5A 3GTQH 4UPAA 4HIMA 3OW2A 2E5LL 3TREA 4J15A 4C3IH 3S1RH 1K9MC 2L15A 3TQYA 1YHBA 3HOUG 1T9HA 2C35B 5IYDG 3PF5A 1SN8A 3KDFB 1TWFH 1YNXA 3NEMA 4A3LG 3HOXH 1PHJA 4LF7L 1I50H 2CWPA 3G4SA 4DV5L 1K83H 3CC7A 1OXUA 1VQHA 3PSIA 2FXQA 4X65Q 4R4CA 4XIGS 2A8VA 5E7NA 3TS0A 1S72A 3CCUA 3S16H 3HOVH 4GLVB 5GROA 4PZ6A 4XTCS 1VQPA 4YWKA 1GKHA 1LTLA 4IPGA 1V43A 4P74A 1HH2P 1CKNB 1X56A 4X65L 4UP9A 4YCUA 1YJWA 1VQLA 3G6EA 2UXBL 3MXNB 4DK3C 2OTLA 1WYDA 4HJ9A 3GTPH 2N3SA 3CD6A 1G51A 4A3BH 4P73A 2AWNA 4JI8L 2UU9L 4GN5A 1WCMG 4LFAQ 1HR0Q 1XNRL 1I6HH 2CWAA 2JQOA 3GO5A 3T1HL 4DV0Q 3PO2H 5DLQE 2B29A 4PZ8A 1Q46A
chains in the Genus database with same CATH superfamily
1U4RA 1FJGL 2RF4A 4LFCQ 1MI2A 4XT1B 2B8FA 4YWLA 4A3MG 2E74C 5ELCA 1QILA 2R93G 3RLNA 3QG1A 1BCPD 1VQOA 4LF5Q 3S2DB 2NVYH 1SNDA 3MXNA 4IJHA 4OX9L 3FRPB 1EYGA 1NJIC 2Q2UA 1MSGA 4DUYL 2FMCA 2IW3A 2RCNA 1CFMA 3WDNA 3I56A 2K52A 3QOLA 1J8IA 2R92H 1EYCA 3L3OC 4JBJA 4ME5A 2EYOA 3HS0C 1SDFA 3PUVA 5ELDA 5KYIA 2SNSA 1VF7A 2Q2IA 4DR5Q 3A7AB 2VQFQ 3MXUA 1WCMB 1LTRD 2KEDA 5LMNQ 5DM63 3CCRA 3K7AB 4H13C 3CMAA 4E6IA 2CH4A 4OIJA 5IP7H 1TIID 1PA6A 2UXBQ 2LMCB 1FGBD 5M3FB 2JA5G 3AQQA 3VR3A 1E2ZA 2R93H 3SHLA 4IUPA 4Y7NH 3KBXA 3OOCA 4ME3A 1U0LA 1G6PA 2AKWB 1FR3A 5JJKA 3STBC 4JI7L 2R7ZG 3L7ZC 2K5WA 5JJIA 4DF7A 1WTQA 2JA6H 1HXYD 3ULJA 5JVH3 1Y1WH 2D0PA 1RL2A 1PFBA 4LFBQ 1Y1VB 1IBLL 2EJFC 5LL6X 3VYSA 1SYGA 3TSSA 4JI4L 3GV6A 3UDXA 2KECA 3Q8DA 1X3QA 3WWVA 1YVCA 3KOJA 1E1OA 1U9RA 4BY1H 1QVFA 2I5LX 4UAIA 2KJXA 1ICFB 2PMZB 4CJ1B 1X6OA 5CBEE 1UEBA 1LTBD 4TSSA 3C2PA 1SMYD 4HJAA 4A3GG 2VS1A 3VR2A 2DJGC 3HZXA 5EPLA 4LUVA 2UUBQ 4U673 1YITA 4DNIA 2BH8A 5GAHC 4HAEA 2PW7A 1ESFA 1I3QB 4HSPA 4CKBA 1OXXK 3MA2B 1B9NA 5LMNL 2L5TA 5G3LF 3T1YQ 3I4MG 1W2BA 1VQAA 4A93B 4G7OC 3QR8A 1BO0A 3E3XA 2UXDQ 3S1QH 4QCLA 3RLFA 1BDOA 3CCLA 2K33A 1A63A 3J7AF 1UEAB 3CXCA 3KYHC 4BBSG 1KNAA 1JJ2A 1N36Q 1TWGH 4RGNA 3K57A 2F0KA 2X69A 2B2UA 5ELEA 1EIGA 2B3GA 5HGTA 2F0MA 2KA7A 4L5SA 1DOMA 2Z6KC 1TR5A 4LF7Q 1CQFA 4A76A 4X3TA 1PH8A 3QIAA 1PH2A 2Q2HA 1TY0A 4GLAC 1FJGQ 3CCEA 3NELA 3EN2A 4AH6A 3PO2B 3EROA 1XXGA 4BY7H 4NDXA 1AE2A 4QL5A 5IGBA 1XX8A 3U4ZA 2K28A 3PV0A 1VQGA 1ICWA 4ZUIA 1C8CA 5C44G 1Y8OB 1C9OA 1YHAA 4LAAA 4H02A 2FHTA 1VMPA 2NBFA 4LUOA 3U4VA 2ZXRA 1YNND 2N78A 1GUGA 4IURA 4JK1C 1IW7D 5EJWA 4ZCKA 2ZJRA 5JPMC 4KKUA 5M5XH 5CORA 1A8VA 2D2CC 1EY5A 2V4DA 1UE7A 5M3MG 4TKOB 5NUCA 1ASYA 2ZM6L 1IBML 4N8X1 2H4OA 2R7DA 5C3EG 1GOZA 1LO5D 3DMUA 3Q22A 4B3SL 1H9KA 1KQSA 2PI2E 1X55A 4AYBG 3OIPA 1Q86C 2AMCB 1MKHA 3HOVB 4LFCL 2HHHQ 2R61A 3S1MB 1UE5A 3C1FA 1S5ED 2NN6I 4GOPB 4V190 5IGDA 4KN7C 2JA6B 1MGSA 3S15B 4OELB 1EQVA 2IWHA 1SE2A 2VW9A 1C4QA 3FPUB 2JN4A 3JAML 3S14H 5C0XH 3I4MH 4RG1A 1VCIA 4JI1Q 1TS2A 4GN3B 2RDHA 5T1IA 4XYQA 1SNCA 2B2TA 3Q6SA 2B2YA 1VQ4A 2M2LA 1WFQA 2JP1A 1K8GA 3I91A 2J4XA 3J7ZC 3L9AX 1YHQA 4A3JB 1JR0D 4O2DA 2K5QA 1EIYB 4GKKQ 2HDLA 4DR1L 4LF8Q 3PUWA 4TRDA 1I50B 5I6WA 2AQ2B 1PXUA 1OO9B 4DV3L 2MP1A 1JOKA 1PYBA 2A68C 1CSQA 1ZEQX 3BJUA 4QJFA 4OO1I 5I9OA 2IX0A 4EQNA 2M00A 1PH6A 3HOYB 2F0OA 4XYOA 4K5XA 3NWTA 5IY0A 1C0AA 4A3IG 3E9HA 1DZ1A 2K32A 1IZ6A 3C46A 3NHHA 1R4PB 1STGA 4M8AA 5CBAE 3SXHA 3PO3G 1NUCA 4DR2Q 2GA4B 5CV6A 3D6CA 4BA1I 2KCMA 5KNDA 3AB9A 2B2VA 3G71A 2NB0A 2HUGA 1SR3A 3OTOQ 3S2HB 3VDYA 5FJ8H 4DR3Q 4A3KG 3K7UC 4OONA 1N33L 4XDXA 2IPKD 1RTNA 1H9RA 4RMFA 4AYBE 2K6AA 2X6GA 3GTLH 1D6EC 1LTTD 5IYCH 1B3AA 4MNOA 1IKMA 5C4HA 2Y0SB 1K3RA 2CCZA 4KHZA 2JE6I 3E9IA 4JI2L 4MTKA 4ZLTF 4FF2A 3N52A 2BE5D 3ZJYC 3TP7A 3CKIB 1TS3A 2E5LQ 2WAQB 3CPWA 5IGFA 4RGOS 1KC8C 3K8AA 3FP9A 2IT1A 2JEAI 1G2SA 4DV7L 4LF6L 3E0JA 4JC0A 2O4XA 1SE4A 3FKIH 1N8RC 5C4ZA 2KQ3A 4EQ5A 4JI8Q 4IUVA 1CI3M 3K7AH 1NNXA 4H0LC 1HA6A 1MD2D 3UE1A 3VYRA 1JWSD 4NPSA 1Z9FA 5CV4A 2F0DA 4Y52H 4A3MH 5GQOA 3NUCA 5ELBA 4Y7NB 5KNBA 3UDFA 1SXTA 2R7ZH 3AU7A 3U9OA 1J9OA 4LF9Q 4A3CG 1Q1BA 2F0NA 1WTPA 4Q5VA 1W6JA 3ICEA 2SEBD 3NQTA 1WOCA 4PMWA 3J81j 4RHSA 4K5VA 1I94Q 2OTJA 3T13A 3GTKB 2F0LA 2K5DA 4JI5Q 2WB1G 1XYIA 1I6HB 1VQ5A 4A3DG 1F9RA 3J81E 2A1AA 3WOFA 1HHVA 2ICEC 5IWAQ 5M5YH 3RZDB 1XMOQ 1BNZA 2E8GA 1KDAA 4GNXB 2JA7G 2JA8B 4XT3B 5BR8L 4ULLA 1VQNA 2OEOA 4C1NK 2DY7A 1PTOD 2L0CA 3D0FA 4J1MA 3PIPA 1PH4A 1S5CD 4XQJA 3DWAA 3E5SA 3ND8A 2Z4HA 4C3IH 1K9MC 3TQYA 2R93B 4FNFA 3HOUG 1DCZA 4DK0A 5IYDG 3PF5A 2L1BA 3A8JE 4LF7L 3BYYB 3PMFA 5D65A 3HRZC 2CWPA 4FXKC 5EBDA 1VQHA 3PSIA 2C9OA 4X65Q 4XIGS 4HMIA 2RBMA 5E7NA 3TS0A 4I65A 1S72A 3S16H 1QG7A 5GROA 2I07B 3D6WA 4XTCS 1PRTC 4YWKA 1AW7A 4IPGA 1EFID 4UP9A 1K83B 1TU2B 3O13A 2UXBL 2OTLA 3M4YA 4P73A 2E2DC 4JI8L 4GN5A 1WCMG 3GTJB 2JQOA 4PNYA 3GO5A 1B2TA 1I4RA 2B29A 1Q46A 1GUOA 1HA5A 4Q0FA 1T5XD 3TP5A 4QIWE 2PO4A 3EQLC 1KNEA 4LFAL 5GADC 1VQDA 3IFTA 3H3VH 4AQYQ 4P71A 4A3KH 1EL0A 2MHVA 1II3A 2QEXA 4C3JH 2A8VA 2JJQA 2B63H 1HQMC 1JWMD 1LV9A 3J81c 4L8JA 2NVXB 3GTLB 2JK8A 5DAUA 3CP0A 4DK6C 3PIP3 1KLGD 2NVQH 4DV6L 5IGCA 1SFOH 5GAGC 1ILQA 5T1GA 1Q12A 1JJCB 3A8KE 1D5XC 2CKZB 3TS2A 2ICIA 3I8ZA 1TS4A 3M3YH 4FP5D 1EQTA 2RSNA 1HNXQ 3H3VC 1DGSA 2D62A 1RD9D 3JAMi 3CCJA 1Y8NB 4BY1G 2Z0SA 3W5OA 1Q3LA 3MVVA 1NR2A 2WAQE 1TVXA 1XPRA 1G91A 5E1FA 3CMEA 4UP8A 1S40A 1F2YA 4PQXA 3VR4A 1JCKB 5I2XA 4H44C 1G6ZA 5JEAG 4DR1Q 2HIXA 4DR7L 1E24A 1PTOF 3DXJC 2NN6G 4BBSB 4DR4Q 3RMHA 4X66L 4BY7G 3KLSA 5FLMG 1EY9A 1Y1WB 1RJTA 3URYA 3BZCA 4S3SA 4UY8C 3JAMc 3I73A 1I3QH 1F9QA 3V96A 1PRTF 4KY7A 4WJ3M 5FKAC 1TWCH 2HDMA 2XN9C 5AJ3L 1HR0W 1IYUA 4KN4C 3NTIA 5IP7G 1WTOA 5IIFA 1FNUA 3S17B 4FF3A 3D4DA 4YY3L 5C4XG 2CQOA 3F1ZA 4DV7Q 4LF6Q 5JEAJ 1H9SA 3GTQB 2F4VQ 1B4OA 2K5NA 2A69D 2PZWA 3TZDA 2Y0SE 1HNZL 1O7ZA 4IFDH 1U4PA 4DAPA 3S1MH 1CZWA 1C7YA 1HUNA 2KUMA 2NVTH 1QNUA 2RDGA 1AE3A 2XWJB 3MXGA 4GLXA 1V1OA 1L1OC 2EY1A 3DWPA 1EWCA 2I5MX 1GUTA 4BS9A 4QB4A 3ERSX 5M3MB 1NSNS 2LY7A 3GTPB 3K5LA 3EFXD 1B7YB 1X32A 5C3EB 4L6TB 1CQVA 1SLJA 4A3BG 2K04A 3SK8A 1SYEA 3BZKA 3AFPA 1B9MA 4G4KA 2DGYA 4PV1C 3BDOA 3SE0A 4P75A 4CDFC 1B44D 2OT2A 1W6KA 2PW5A 2R7FA 4O42A 1N34Q 1PTOB 3PIOA 2ENBA 3MTSA 2J0TD 3RLOA 1BUVT 3CCVA 3MFYA 4A3LH 1HFGA 4K14A 3F2DA 5K5PA 1ASZA 2JA6G 2IHFA 4X64L 1CZGA 3RN5A 2JA8H 3M85A 4X66Q 1LT5D 4R4OA 5J3BA 1LABA 1IL2A 3KJOA 3ONAB 2B2TC 1JWUD 2Q8TA 2Q8RE 2PPBC 1W3SA 4JW0A 4EQOA 1EFWA 1WTHA 2KHJA 3NTHA 3TBIB 4GOPC 5AJ3Q 3J7YW 1SBBB 4K2LA 5DM73 2KEEA 2RKSA 2VUMB 4FYDA 5D3IB 1C48A 3HOXB 5FOBB 4HIKA 1O78A 2B63G 4WRDA 3KJPA 4RGMA 3C1EA 3BZDB 4DPGA 1HFNA 2A73B 1UNSA 2Z1CA 1K0RA 4P2CB 3VR5A 3L2PA 3T1YL 3H3VI 3CQZB 3SK6A 4BBRB 4CKCA 3AMUA 1E7ZA 1WI5A 1PH1A 1A2UA 1AZPA 2E2IH 5EKLA 1V8QA 4A3DH 5KEEA 2TSSA 1PV4A 3T4AC 4DNRB 1JB3A 4QQBX 4A3IB 1TQOA 3PGZA 1DJRD 4YCVA 1AEXA 3ER0A 2OQKA 1PFMA 3PO3B 1IYJB 2K5VA 4PG3A 4NKLA 4OL7A 1CA5A 1PYSB 5FLXc 3T16A 3UDIA 5CV5A 4GKJQ 4JI3Q 1M90C 1XPUA 4CDEC 4ZRZA 2ES2A 5C0XG 2MPMA 4A3KB 4DV2L 4B3TL 1TKWB 2P5ZX 3I4OA 2F0TA 1D7QA 1PRTB 3H0GG 3RZDH 5M5YB 2JSOA 1LLRD 1E0BA 1FVIA 2Y0SG 3OWEB 1BOSA 1NBWA 1VS0A 3T1HQ 5A2QL 4KY6A 4C2MB 2F0FA 3GTKH 1I4QA 1XNQL 2A19A 1E2WA 2XWBB 1L0WA 4K2KA 1DOLA 3GTMH 1MJEA 1EIHA 2WV6D 1MIUA 1U5KA 1TWAB 2XTIA 5M9OA 4IN3A 4JI0L 1F2ZA 3EIVA 4GN4B 2R92G 4HCSA 3NENA 5EAYA 3HGBA 1O80A 3HKZE 4ZKBB 5EKKA 4A3CH 1XTCD 3MZ5A 4LFBL 2ATWA 1MJCA 3W3AA 1EU3A 3MXPA 1DYQA 3QB3A 2L4NA 2A68D 4HJ5A 2KBNA 3Q0AA 3QO2A 4LJZC 5C0XJ 1L2FA 3NWSA 1VQJA 1VQ8A 1VQKA 1KIXA 1LTSD 3J80E 5E3FA 1X3EA 1S3OA 4QGUA 5KYLA 3H6MA 2A69C 2G9DA 2XVSA 4OWXB 1PFSA 2UUBL 1HNXL 3S16B 3FKIG 4C56C 1R9TB 1LACA 1I6VC 2KENA 3DEPA 1HNZQ 1SROA 2Z9HA 1X3FA 1QUQA 5HGQA 4BA2I 1EZ8A 5D3DA 1Q82C 1EY0A 2PMZE 2RA4A 1SJHD 4C3IB 3M7NA 1ESRA 1TWCB 3I70A 2OWOA 1QB5D 4OEMB 1CT1D 2RCFA 1D1IA 3R2IA 5M3FH 4A3EB 3ULPA 2DJFC 3KF6B 1AFPA 1YIJA 3K81C 4HIOA 4B3SQ 1A6XA 1MBYA 1N36L 5C6AA 4LF8L 1PDQA 4HIDA 4KKTA 3E0EA 3HOZH 3HOUB 2AQ3B 1E2VA 1I4HA 3U9SA 2UUAQ 1D1KA 2X6LA 4A3FG 1B70B 3I3CA 3H94A 1MSHA 5M5WH 1BBUA 4ALPA 1E3PA 3MHBA 1HQRD 1GHJA 4AIMA 4KLKA 3T51B 1CHPD 4F87A 1XMOL 1OTCA 2ALYB 2F0WA 1VMCA 5CR3A 3GTJH 2UU9Q 2E2JH 2ZJPA 1U4MA 3A0JA 1FGUA 2ASBA 4ZYSA 4B3MQ 4H7BA 4EVOA 2C5CA 2HCIA 2R3ZA 4I7AA 4DAVA 1HZBA 4DN4M 3VA5A 2NTSA 2NVYB 4FDBA 5C0XI 2EIFA 3CPFA 4C3JB 4B3RL 1SYCA 1V1PB 2VB3X 2A6HD 1SNQA 4X62Q 1DONA 3RR5A 3NTKA 5E4WC 3TREA 4J15A 2DN8A 1Q90A 1YHBA 3NE5B 5ELFA 2NVQB 3SEBA 2WKDA 1B50A 1I50H 3G4SA 3S1QB 2EDGA 5EPKA 4DV5L 1K83H 3CC7A 1OXUA 3I4NB 4R4CA 1PYWD 5J22A 4NMZA 3NXWA 5TSSA 3HOVH 4GLVB 1G2TA 1STNA 3HEJA 1GKHA 3NP8A 4P74A 3FEWX 1CKNB 4C3HB 1SJED 4B9XA 4DK3C 3CD6A 1HTPA 1G51A 2B2WA 2AWNA 5BN3A 4LFAQ 3A55A 1I6HH 2RSOA 2NWGA 2F1MA 2CWAA 4ZAIA 2K01A 4IUTA 3RZOB 5DLQE 4IUUA 1PH5A 1WJJA 3S2HH 4NB3A 2CHBD 4O0AA 4LMQD 2NVXH 1NTGA 2A6ED 2WACA 5LMNW 2YV5A 2O2LD 3CQZH 4BBRH 3BDLA 1BCPF 1A62A 1EOVA 1UE6A 2EYJA 1RIPA 5M3MH 4GKJL 4JI3L 3J81i 1K0SA 2KVMA 5ISRA 1WVLA 4DGZA 3C3LA 4BWGB 5HURA 4JI2Q 3OSOA 2EXDA 3HKSA 2I46A 1Q7YC 3H15A 4U68A 1RHPA 5FLXL 2PQAB 1GVPA 4OX9Q 4HTHA 2VQFL 1WTXA 2FJ2A 2N49A 5EKIA 4G57A 2EYHA 3K0YA 2MNAA 3M9BA 3D8GA 1VQIA 2L11A 3GDEA 3KF8B 5IP9G 1SAPA 4CJ2C 1QUQB 4KJNA 2NZHA 1QZHA 1AZQA 5FLXE 4RCOA 4YWMA 2F4VL 3KDFA 3EBEA 3FPPA 3I4LA 4X64Q 2A5HA 4ZQ3A 4XQNA 3RNUA 2VZAA 2EYMA 2F0GA 4K8JA 1STBA 3BG3A 5C4XB 2PNRC 1XMQL 4A3MB 3NSWA 1S5BD 1VQMA 4XXEA 2F52A 4UDUC 1JMCA 2YYZA 2CQAA 5IT9c 2KHIA 1SRUA 3H09A 5I4DA 5JPNC 1KXLA 1CHQD 1JOQA 2GVAA 2E2IB 2JXMB 4DK1A 4OHJA 3MAQA 2QKIC 3KF8A 4OWTB 2H1EA 3F8TA 3JC66 5JVG3 5D14A 1F2MA 3OWFA 2Z4IA 2BOSA 2OCEA 1Q8IA 1TXYA 4F8MA 1OXVA 1PH3A 3S2DH 2IJ0A 4B9WA 3CCSA 2UUCL 1CKMA 3PO3H 2HD3A 4IO9A 4JYAQ 1R4QB 2A6HC 3U58A 1HTLD 1HJPA 5H1SE 1OXSC 1ZKOA 4LWCA 4N9PA 2F0JA 1EEFD 3B6YA 1GXDC 5M3FG 2JA5B 2Q2TA 4HMJA 4APVA 4DV1Q 4LF4Q 4DAMA 1PMRA 4JV5Q 3FMCA 3HOZG 4QMGA 2UXCQ 4OGQC 4R9WA 4A3IH 4M1UB 4DR2L 2K05A 1B8AA 3IAYA 4DXFA 2R7ZB 1ONLA 2PCFB 1IBKQ 2DUDA 4C1NI 1JORA 1H9SB 1SMXA 2VQEQ 3PUZA 3DM3A 3MC0B 3WOEA 1QCBD 3HG9A 1PZID 2MO0A 2NUCA 4O1NA 1Y1VG 3F2BA 1F9SA 1SFOB 1WTRA 3LGJA 3H91A 4IUNA 2PYKA 4FO2A 1JC7A 3AYHB 4HSVA 3T56B 5FJ8G 2SDFA 3DWQA 1Q1EA 5EQ0A 2F4IA 3I2ZA 4NXNL 3TN2A 4OXPA 1LTID 1J5EL 3ND9A 1BKBA 4WJ4A 5FO7B 5BR8Q 2K1BA 2WB1E 2E76C 5GAEC 1TWAH 1KD1C 1WTWA 1K8OA 2QCPX 1UUPA 4IPDA 1K3BC 4DKAC 4BBRG 5LMUQ 5BN5A 3KLSX 1YNNC 1N9WA 4C2MH 4EX5A 3W1GA 2F3WA 2K03A 4A93G 1L0YB 2ZTEA 1IW7C 2F0SA 2F0VA 5I9PA 3SK5A 2XRQD 1EYDA 3FDTA 3A8IE 2SNMA 1HPCA 3DLLA 4G7ZC 3RN2A 4LUZA 3NK9A 2UXCL 5FO9B 3K5MA 3LWUA 2WINB 2O5JC 1EY8A 2GN5A 1M8AA 1I94L 4JYAL 1IBKL 2AHOB 4J6HA 4GKKL 3BS1A 4JI6Q 1IXRA 4A3EH 3K0XA 1JT8A 3TP8A 2VQEL 1QVGA 1Z6HA 2R6GA 2EYFA 5EGTA 5IGGA 3ERQA 4HN7A 2YU9H 3K5NA 4DV1L 3J80i 4QIWB 1PZKD 3PO2G 2NN6H 2D0OA 1X3GA 2MQHA 3GTOB 1XNQQ 3VYUA 3H0GB 3CHBD 5IP9H 2K14A 1KHIA 1RCVD 3RUZA 3Q23A 1TS5A 5DNFA 5IGEA 1PH9A 2ZTCA 5C44B 1O7YA 3TRZA 5CV9A 5EPJA 1ZXTA 1S4ZA 3A5ZB 3NBIA 1KL9A 1XNRQ 3NPPA 3ULLA 3HOYG 1PTOH 1E1TA 1HUMA 3I55A 3IFDA 3K6OA 1DM0B 1BQQT 3RZOH 2JYOA 4DV4L 2RDFA 2XSCA 4XQQA 3IL8A 5IYCG 3PIO3 1RF2D 1D8LA 3K59A 4B08A 4JBWA 1QWYA 1KAAA 1RTOA 4I7ZC 1E22A 2XIWA 4TVAB 1LT4D 4RGTA 3JAME 3M4PA 5IOCA 2UXDL 1ENFA 1ML0D 2E2HH 3GP7A 1P8LA 2EY6A 2CH4W 4V0BA 1GUWA 1PH7A 5K36H 2B39A 4PZ7A 3P20A 4CDDC 4B3RQ 4CKEA 3HOVG 2L12A 2DNCA 2KCTA 4DFAA 2BDOA 4GZYC 1YNJC 3I7FA 1PFNA 5E4XA 2QILA 3J7A5 2JEBI 5J1ZA 1QE6A 1HNWL 1GO3E 1UWVA 5EBCA 3V05A 5G3LD 3NBHA 3P75A 1ET9A 1I4XA 1QJOA 3AEVA 3OIQA 3J80c 2LFNA 4R4TA 1BBWA 3S24A 4ZKCB 3L0OA 5C3EH 1ILPA 4DV6Q 5CMDA 3F2CA 1SYDA 2BA0A 2LXKA 3S1RB 5CYUA 4A3JG 4KD3A 5COYA 5IT9L 1IL8A 2E2JB 3E6ZX 1EU4A 3N6RA 2Q8IB 4FVMA 1L0XB 4HJ8A 4DR3L 3CC2A 2BE5C 2PZTA 1YJNA 4RKBA 4JI4Q 1EY6A 2EY5A 5A35A 1HRJA 1KDBA 2I5HA 1XMQQ 1DXMA 2V1CC 4A3DB 4FF4A 1SSOA 5ELOA 1IYVA 3BVMA 3G7LA 2N55A 3TDQA 1J6QA 1ENAA 3GV3A 3MFGA 2RHQB 4DA2A 1LT3D 3CC4A 1HZAA 2JA8G 2BH2A 2JA7B 1ZYRD 1CA6A 1BBXC 1GUNA 1TWFB 4EQPA 1UAPA 5JJLA 1T5EA 1M1KC 1A15A 4ILWA 1ENCA 1K8AC 3M4QA 1KRTA 4FF1A 4HEDA 1GHKA 1ET6A 1RODA 2HHHL 1KDCA 2VUMH 1JE5A 3HP3A 4R4QA 1FL0A 2EPBA 2QW7A 2RHSB 3G48A 4KTAA 2KCCA 4A93H 1YI2A 4KHPQ 3OTOL 5C5LA 1EY4A 3H0GH 2F0QA 1VQ9A 3I4NG 3HOWB 1KAWA 1VQBA 2VNUD 4KD4A 1YEZA 2QGQA 1LTAD 2YTYA 1GUSA 4ODGA 4EGVA 5M5WB 4DUZL 1YZ6A 2B2VC 5LMUL 5JAVA 2O5IC 2EJGC 3SK4A 4X3SA 5C4JH 1BR9A 2QDLA 3LNNA 4DV4Q 1AH9A 2MUYA 1FNWA 1EOTA 2B2UC 1CSPA 2IX3A 5DEHA 4G7HC 1LTGD 1GJXA 1CK1A 3J81L 1Q81C 4DV3Q 4DR7Q 4N9TA 3GTQH 4UPAA 3OW2A 2F0IA 3KK7A 2DNEA 2L15A 2BDNA 1T9HA 1TWFH 1YNXA 3HOXH 1PHJA 1B1ZA 2NVTB 3OMCA 4FXDA 1A2TA 2QF7A 3CCUA 4MIUA 1TWHB 1DD2A 4MN3A 3F2UA 3D3RA 4PZ6A 1VQPA 3HKZB 4KV6A 1LTLA 5F2DA 3KBGA 1V43A 1X56A 1VQLA 2D5DA 1PRTD 1WYDA 4HJ9A 1HCZA 1HR0Q 1D2BA 4DV0Q 2M9VA 4DU9A 1STEA 1NCVA 2F0UA 1CKOA 2EYLA 1R9TH 2AUKA 1EZ6A 4DUZQ 1FNVA 2J7ZA 3UDGA 3SR1A 2CVRA 4RCNA 2WKCA 1SEBD 5C44H 2VL6A 2IHEA 3BU2A 5CC4A 5FO8B 3CU7A 1ZYRC 4POGA 4DR4L 1TY2A 3CRKC 4B3TQ 3MWYW 2UUCQ 4JG2A 1D5MC 4MHEA 5BN4A 4MTNA 2EYPA 1STYA 4KK7A 2F3IA 2YTXA 1AN8A 3A56A 1YNJD 1N34L 1EWHA 2GVBA 4IZ8A 3SVMA 4JOIC 4KKSA 5IODA 2F03A 4BY7B 2BA1A 1EQRA 1VQFA 2EE1A 5IE8A 1Y1WG 2B8GA 3BDCA 1XJVA 4CDCC 3R93A 4CHTB 5KRUA 1WD0A 4JV5L 5L37A 1I4GA 5IT9E 1N32L 4LW1A 1DOKA 2ID0A 2NZOA 4BXXG 3DHQA 4L63B 2K7VA 3R3OA 1JE4A 4YHHL 4JI5L 3UI2A 5K36G 4PMBA 1I5FA 2KOLA 3TZUA 3HOZB 1I4PA 2HQEA 2XNAC 1X9NA 2EJMA 1H9MA 4A3FH 4Z9CB 1VQEA 4GNXA 1Y14B 4X3KA 3VA7A 1KRSA 4JBMA 2ZXOA 1CM9A 1QVCA 2PQAA 2EZVA 4K0KL 5C4XH 4X3UA 5CGKA 4DV2Q 3VYTA 2RVLA 3KUPA 1FYCA 3HOWH 4A3GH 4LF5L 1LUZA 1EWIA 1P16A 1WTVA 4NXMQ 5M5XB 1LM0A 3QOJA 1J5EQ 1X3PA 3Q24A 3M4OH 4OO1H 2QEJC 1FD7D 2E75C 3R8BA 1H95A 2QA4A 2A74C 3X3MA 4DUYQ 3W1BA 3GTGH 3GQBA 2F0EA 3ITPA 1F9PA 3IRBA 3R2TA 1MHWC 4JI0Q 4UHVA 2G5DA 4YCWA 4DR5L 1NMFA 4K6LA 4C3HH 4QUFA 4IOAA 4BY1B 3S1NH 3S14B 4NP5A 1HZCA 4YY3Q 1N32Q 1SNOA 2IX1A 2K5HA 3D31A 3GTMB 1GM5A 1TWGB 3I4NH 2HT1A 1VQ6A 2JA7H 5J39A 5KNCA 3A5UA 1LT6D 1VF5C 4IALA 4GNXC 5CV8A 2OF1A 2CW0C 3J7AV 4OO1G 2L55A 4FXGC 1HZ9A 1KABA 4AQYL 1QOHA 4K0KQ 1O7IA 1V1PA 4ABNA 5IYBH 3PF4A 1VQCA 1IBLQ 4B3ML 1A3UA 3M7GA 4A3GB 1QNKA 4ZK9B 4GS3A 1Z47A 3KFUA 1EY7A 1IHZA 1KLUD 3D4WA 4KI0A 4BBSH 1H9JA 1V9PA 4HCEA 5FLMH 5LL6S 4IQZA 4NW2A 4X62L 4RFBA 1Z7TA 4J8QA 3GTGB 2OXPA 4A75A 3SGIA 3I4MB 2SOBA 3EJIA 2Z8LA 2CFMA 4IPHA 2LS01 3V2TA 4CJ0B 1CKNA 1O7LA 1Y1VH 3S1NB 1BCPC 4DV5Q 4R8NA 2FMMA 4A3JH 2WFWA 4R4IA 1B53A 1IKLA 4WORA 3GTOH 4RAUC 4KMUC 2MO1A 1A3VA 4DAYB 4TQUS 4ZUJA 1BVSA 4A3BB 3TP6A 1K73C 3NQIA 1L1OA 1VDZA 4QUCA 4OIKA 3NBHB 3IKJA 1NY4A 1BF4A 4K6DA 4R1JA 3SDZA 4PMCA 2ZJQA 1EYAA 1Y8PB 2VY3A 2ZTDA 4L5QA 1EQQA 4L5RC 3PCOB 3OPOA 1N33Q 4YIJA 1TT2A 1JOOA 3PUYA 3QWNA 1A0IA 2I0QA 1EEID 5CV7A 2IL8A 1TWHH 1F2LA 3K80C 4IOCA 4WJWA 2FINB 4KHVA 4MZ9A 3OHXC 5ELNA 5C3WA 5KGUA 3K5OA 3AFQA 3P7JA 4JVZA 3OMGA 1PZJD 4ID6A 3P1HA 1G291 2TMPA 2AWOA 3ZYYX 1NMGA 5LHY1 1JB7A 4JBKA 2FFKB 1CUKA 4IFDG 2R92B 1XTDA 4DR6L 2E2HB 2BCOA 1BCPB 3A54A 4LNQA 3S15H 5C5MA 2MJ8A 5A2QE 4JI1L 1X54A 2VUMG 5IYBG 1WCMH 5HY6A 2QDBA 1NAPA 3VR6A 3HOXG 3CCMA 2ZT9C 4WFN3 2D9UA 2B63B 1JJGA 2B2YC 3A74A 4AYBB 3CF5A 2EY2A 1STAA 1YBYA 1G8ZD 2Z6BA 4HJ7A 3KF6A 3HOYH 1EUJA 2KHSA 2ZM6Q 1IBMQ 3U50C 1K8MA 3K58A 4R8IA 1V1QA 1AP0A 4F88A 1SMYC 2DY8A 1D5ZC 3FKIB 4K8IA 1KTKA 3TEHB 4DAYA 1A3TA 1SYFA 3G6JB 5JEAH 3CW2C 3RD4A 1QZGA 3HOUH 2ZXPA 2JA9A 2HQLA 3D4RA 2K4KA 1GD7A 4C3IG 4F7XA 4JI6L 3QJYA 1SE8A 4IFDJ 4POFA 4QY7A 4RWSC 4A3EG 2UUAL 4NXML 3J80L 4NXNQ 4KHPL 4CBVA 2VB2X 2Z6KA 2PQEA 4IJLA 2K50A 2YU9B 4L5TA 2PI2A 4QF4A 1WD1A 4JCVE 4RA8A 3CAMA 1VQ7A 3STBD 1S5FD 4RHRA 4KJOA 1S5DD 2AQ1B 5C3XA 3PUXA 1NE3A 4HR7B 4DR6Q 1HR0L 3DM1A 1UE1A 1B3QA 1M4VA 4A4IA 2LKVA 1Y69U 3X3NA 3DUZA 3HOWG 1K28A 1LYLA 1X65A 2YTVA 4YHHQ 2G9HD 3KLWA 3BVZA 1PVOA 2EQSA 1L1OB 2XGTA 2AUJD 2PNHA 2MFIA 3GD7A 3MEHA 3UE0A 1OXTA 2WIIB 1F77A 4X6AH 2L9HA 3CCQA 4CGYB 3BVGA 1JICA 1EIFA 2CW0D 1BXTA 3EA6A 4C3JG 3S17H 5I2YA 2EXZA 2NYZD 4BXXH 3M3YB 4P72A 4GOPA 1STHA 1RKNA 2H5XA 4IPCA 4UP7A 1CTMA 4DNTB 1SYBA 2XRSD 2N8NA 2NZ1D 1PTOC 2F0PA 2EVBA 2LXJA 3KLRA 2F3VA 4RH6A 3W2DA 4JI7Q 4LK1C 2WP8J 1Q8KA 4OWWB 4JOIA 2IY5B 5C4JB 2KCNA 4K5WA 1YJ9A 4LF9L 3HFZB 4LF4L 4IUQA 3DEOA 4DV0L 4IFDI 5FK9C 3HKZG 1HNWQ 3I90A 2WAQG 3EVQA 2F0HA 2B2WC 2LSSA 4C3HG 2HIVA 2NTTA 3MEFA 3OW7A 3OYYA 2OQ0A 3PQIA 1XPOA 1XWEA 5KIXA 2K75A 5IYDH 5IWAL 3LWEA 3T53B 5JOBA 2N88A 2JA5H 3FHWA 3LX0A 4HIMA 2PZUA 2E5LL 4N8FA 3TMEA 3FVQA 3S1RH 2HCCA 5JJZA 2C35B 4RKLA 1SN8A 4A3FB 3KDFB 4A3LG 2MGSA 3NEMA 5I6YA 3I72A 1PLFA 2FXQA 3BYTB 2WB1B 1RDPD 2VXWA 3CRLC 3A7LA 4JPBW 1SNPA 1HH2P 3M4OB 1NR4A 4X65L 4YCUA 5AFWA 1YJWA 3G6EA 4KY5A 3MXNB 3GTPH 2N3SA 4A3BH 1SE3A 4DXGA 2UU9L 1SNMA 1XNRL 1JQYD 2RQXA 3T1HL 1U4LA 3PO2H 2A6EC 2EOTA 3S9WA 4PZ8A
chains in the Genus database with same CATH topology
1FJGL 1PH5A 1WJJA 2RF4A 1R9TH 3S2HH 4NB3A 4LFCQ 4YWLA 4O0AA 4QIWE 4DUZQ 4A3MG 2NVXH 1NTGA 4LFAL 5LMNW 3UDGA 2R93G 5GADC 1VQDA 3H3VH 2YV5A 3RLNA 3CQZH 4BBRH 4AQYQ 5C44H 2VL6A 4P71A 4A3KH 1A62A 1EOVA 1UE6A 2QEXA 2IHEA 4C3JH 1RIPA 3BU2A 5M3MH 2JJQA 2NVYH 4IJHA 1VQOA 4JI3L 3J81i 4OX9L 2B63H 4GKJL 1EYGA 1NJIC 4POGA 4DR4L 2Q2UA 4DUYL 4B3TQ 3J81c 2UUCQ 4JG2A 4JI2Q 2RCNA 2EXDA 2JK8A 3CP0A 3HKSA 3I56A 2K52A 4DK6C 3H15A 1Q7YC 4MTNA 2PQAB 1GVPA 4OX9Q 2NVQH 4DV6L 2VQFL 2R92H 2F3IA 2YTXA 2N49A 1N34L 4JBJA 2GVBA 4JOIC 1SFOH 2MNAA 3M9BA 3PUVA 1VQIA 2BA1A 1EQRA 3GDEA 3KF8B 5IP9G 1VQFA 5IE8A 1QUQB 2Q2IA 4DR5Q 5GAGC 1Y1WG 2NZHA 2VQFQ 1QZHA 1Q12A 1XJVA 1JJCB 2CKZB 3TS2A 4JV5L 2F4VL 4YWMA 1N32L 4LW1A 5LMNQ 3KDFA 3EBEA 4X64Q 3CCRA 2ID0A 2NZOA 3RNUA 2VZAA 4BXXG 3CMAA 1PA6A 5IP7H 3M3YH 2UXBQ 2JA5G 3AQQA 4YHHL 1HNXQ 1XMQL 1DGSA 2D62A 3JAMi 4JI5L 3CCJA 5K36G 1I5FA 2R93H 1VQMA 4BY1G 2Z0SA 4Y7NH 3W5OA 4ME3A 1U0LA 1G6PA 2WAQE 1XPRA 1X9NA 2F52A 2AKWB 4A3FH 1JMCA 5JJKA 3CMEA 1VQEA 2YYZA 3STBC 1Y14B 4GNXA 4JI7L 3L7ZC 1KRSA 4JBMA 5IT9c 4UP8A 2R7ZG 1S40A 2KHIA 1QVCA 1SRUA 2PQAA 5JJIA 2JA6H 4K0KL 5C4XH 1KXLA 3ULJA 2GVAA 4DV2Q 1Y1WH 2D0PA 1RL2A 5JEAG 4DR1Q 3HOWH 4OWTB 4A3GH 4LF5L 3F8TA 1LUZA 1EWIA 1P16A 3JC66 4LFBQ 2HIXA 4NXMQ 4DR7L 1E24A 2NN6G 1LM0A 2OCEA 1J5EQ 1IBLL 1TXYA 4DR4Q 3M4OH 1OXVA 4X66L 1PH3A 4JI4L 3UDXA 3S2DH 4BY7G 5FLMG 2UUCL 3Q8DA 3CCSA 1CKMA 1H95A 3PO3H 3WWVA 2QA4A 4IO9A 1YVCA 3KOJA 1E1OA 3BZCA 4UY8C 4DUYQ 3JAMc 4BY1H 3W1BA 1QVFA 2I5LX 3GTGH 4JYAQ 1I3QH 3U58A 1HJPA 4WJ3M 5H1SE 1X6OA 1TWCH 1OXSC 1UEBA 3IRBA 4LWCA 5AJ3L 1HR0W 4HJAA 4A3GG 5IP7G 2VS1A 3B6YA 4JI0Q 5M3FG 4YCWA 4YY3L 4DR5L 2Q2TA 4APVA 2CQOA 3F1ZA 4LUVA 4DAMA 1NMFA 4DV1Q 5JEAJ 4DV7Q 1YITA 2UUBQ 4DNIA 4LF6Q 4C3HH 4IOAA 4JV5Q 2BH8A 5GAHC 2F4VQ 3HOZG 3S1NH 2UXCQ 4A3IH 2K5NA 4DR2L 1OXXK 1B8AA 1HZCA 2Y0SE 4YY3Q 1HNZL 1IBKQ 1N32Q 5LMNL 2IX1A 2K5HA 2DUDA 3S1MH 3T1YQ 3D31A 3I4MG 1W2BA 1VQAA 1GM5A 1C7YA 1SMXA 2VQEQ 3I4NH 2UXDQ 3S1QH 2NVTH 3PUZA 3RLFA 3DM3A 2HT1A 1VQ6A 2JA7H 3A5UA 1AE3A 3CCLA 4GLXA 1A63A 1L1OC 2MO0A 3CXCA 1Y1VG 3F2BA 3KYHC 4GNXC 4BBSG 2I5MX 4OO1G 1JJ2A 3ERSX 1N36Q 3LGJA 1TWGH 1HZ9A 4AQYL 2B3GA 4K0KQ 1B7YB 3AYHB 1O7IA 2Z6KC 4L5SA 5FJ8G 1SLJA 1Q1EA 5IYBH 4LF7Q 3PF4A 1VQCA 4A3BG 4A76A 1PH8A 3I2ZA 4NXNL 1PH2A 1J5EL 4OXPA 2Q2HA 4GLAC 1IBLQ 4B3ML 3BZKA 1FJGQ 3CCEA 3AFPA 3NELA 1BKBA 4WJ4A 3EN2A 4AH6A 5BR8Q 2DGYA 4GS3A 2WB1E 1Z47A 3KFUA 4BBSH 4KI0A 5GAEC 4P75A 1TWAH 1V9PA 1KD1C 4BY7H 5FLMH 1AE2A 4QL5A 2R7FA 3U4ZA 4X62L 1N34Q 4IPDA 3PV0A 1VQGA 3PIOA 4DKAC 4BBRG 5LMUQ 5C44G 3RLOA 4A75A 1C9OA 3CCVA 1N9WA 1YHAA 3SGIA 4C2MH 4EX5A 4A3LH 3W1GA 4A93G 2ZTEA 2CFMA 4H02A 3F2DA 4IPHA 2JA6G 4LUOA 3U4VA 1ASZA 2IHFA 4X64L 3DLLA 3RN5A 1CKNA 2N78A 2JA8H 3RN2A 4LUZA 3M85A 4X66Q 2ZJRA 1Y1VH 5M5XH 2UXCL 4DV5Q 4R4OA 1A8VA 5J3BA 1IL2A 3KJOA 4A3JH 2GN5A 2WFWA 4R4IA 1UE7A 5M3MG 1I94L 4JYAL 1IBKL 2AHOB 3GTOH 1W3SA 1ASYA 1EFWA 4GKKL 2MO1A 2ZM6L 1IXRA 1IBML 4JI6Q 2KHJA 4A3EH 3K0XA 4GOPC 4DAYB 5AJ3Q 2R7DA 4TQUS 5C3EG 1BVSA 2VQEL 1QVGA 1JT8A 2R6GA 1K73C 1L1OA 2YU9H 4B3SL 4DV1L 3J80i 3NBHB 1NY4A 4R1JA 1KQSA 2PI2E 4HIKA 2B63G 3PO2G 2ZJQA 2MQHA 2D0OA 1X3GA 3KJPA 1X55A 1XNQQ 4AYBG 4L5QA 2VY3A 2ZTDA 4DPGA 1EQQA 4L5RC 3PCOB 5IP9H 2K14A 1KHIA 1N33Q 3PUYA 1A0IA 1Q86C 2I0QA 2AMCB 1PH9A 3L2PA 1K0RA 3T1YL 1MKHA 1TWHH 2ZTCA 3K80C 4IOCA 3H3VI 4LFCL 2HHHQ 3TRZA 1E7ZA 4MZ9A 5ELNA 1WI5A 3AFQA 1UE5A 1PH1A 2NN6I 3A5ZB 4GOPB 2E2IH 4A3DH 1G291 1KL9A 1PV4A 3ULLA 1XNRQ 3HOYG 1E1TA 2VW9A 2AWOA 4QQBX 1NMGA 3I55A 1JB7A 4JBKA 3S14H 1CUKA 4IFDG 3PGZA 4YCVA 1XTDA 3I4MH 4RG1A 1VCIA 3ER0A 4JI1Q 2OQKA 3RZOH 4GN3B 4DR6L 4DV4L 1IYJB 2K5VA 4PG3A 5IYCG 4LNQA 1D8LA 3S15H 4JBWA 1PYSB 5FLXc 1VQ4A 3UDIA 1WFQA 4GKJQ 4JI3Q 1K8GA 1E22A 4TVAB 1M90C 1XPUA 4JI1L 1X54A 2VUMG 5IYBG 3J7ZC 2ES2A 3M4PA 5C0XG 1WCMH 4DV2L 5HY6A 1YHQA 4B3TL 2UXDL 4O2DA 3CCMA 3I4OA 3HOXG 1EIYB 2E2HH 1D7QA 4GKKQ 1P8LA 1JJGA 4DR1L 4LF8Q 3A74A 1PH7A 3CF5A 3H0GG 3PUWA 3RZDH 1FVIA 1YBYA 4PZ7A 4HJ7A 3KF6A 3HOYH 5C4XG 1EUJA 2ZM6Q 1IBMQ 4B3RQ 2Y0SG 4DV3L 3T1HQ 1NBWA 1VS0A 3U50C 3HOVG 1PYBA 2KCTA 1V1QA 3GTKH 3I7FA 1CSQA 1XNQL 2A19A 1L0WA 3BJUA 4QJFA 4OO1I 3TEHB 3GTMH 1MJEA 2IX0A 3J7A5 1PH6A 2JEBI 1MIUA 1U5KA 4LF4Q 3CW2C 2XTIA 1HNWL 5IY0A 1GO3E 1QZGA 4JI0L 1UWVA 3HOUH 1C0AA 4A3IG 2JA9A 3E9HA 3EIVA 2HQLA 4GN4B 2K4KA 1GD7A 2R92G 1IZ6A 3NENA 4JI6L 5EAYA 3HKZE 1SE8A 4IFDJ 3PO3G 3AEVA 4POFA 4A3CH 4QY7A 4DR2Q 3J80c 4BA1I 4R4TA 1BBWA 2KCMA 4A3EG 3S24A 2UUAL 4LF5Q 4LFBL 3L0OA 5C3EH 4NXML 3G71A 4DV6Q 2ATWA 1MJCA 1SR3A 4NXNQ 4KHPL 3OTOQ 2Z6KA 4IJLA 2K50A 4L5TA 2PI2A 3VDYA 3F2CA 5FJ8H 2BA0A 2LXKA 4JCVE 4HJ5A 2KBNA 4DR3Q 3K7UC 4A3KG 3CAMA 1VQ7A 4A3JG 4OONA 3STBD 1N33L 5C0XJ 1L2FA 3PUXA 1NE3A 1VQJA 4DR6Q 4RMFA 4AYBE 1HR0L 1VQ8A 1VQKA 1KIXA 3GTLH 1UE1A 5IYCH 4MNOA 4HJ8A 4DR3L 3CC2A 1K3RA 4A4IA 1X3EA 1S3OA 4QGUA 2CCZA 4KHZA 1YJNA 3HOWG 2JE6I 1LYLA 1X65A 4JI4Q 2YTVA 3E9IA 4OWXB 4JI2L 1PFSA 2UUBL 4YHHQ 2I5HA 1HNXL 1XMQQ 3KLWA 3ZJYC 1PVOA 2EQSA 1L1OB 2V1CC 2XGTA 3FKIG 2PNHA 5ELOA 2E5LQ 2KENA 2MFIA 3GD7A 1J6QA 3UE0A 3CPWA 1HNZQ 1SROA 1KC8C 1OXTA 1X3FA 3K8AA 2RHQB 1QUQA 5HGQA 3CC4A 4BA2I 3FP9A 1HZAA 2IT1A 1Q82C 2BH2A 2JA8G 2JEAI 4X6AH 2PMZE 3M7NA 3CCQA 2OWOA 4DV7L 4LF6L 4JC0A 5JJLA 1M1KC 1EIFA 3FKIH 1N8RC 4EQ5A 3S17H 4JI8Q 5M3FH 1K8AC 3M4QA 3ULPA 3K7AH 1KRTA 3KF6B 4BXXH 1YIJA 3K81C 4HIOA 3UE1A 2HHHL 4NPSA 4P72A 1Z9FA 4GOPA 4B3SQ 2VUMH 2H5XA 4Y52H 1JE5A 5GQOA 4A3MH 1N36L 4IPCA 4LF8L 4UP7A 4HIDA 4R4QA 3E0EA 3HOZH 3UDFA 2R7ZH 1FL0A 2N8NA 2RHSB 3G48A 2UUAQ 4LF9Q 4A3CG 4A3FG 2LXJA 1B70B 1Q1BA 4A93H 1YI2A 3ICEA 4KHPQ 3OTOL 5M5WH 4JI7Q 1WOCA 1BBUA 2WP8J 3H0GH 4ALPA 1Q8KA 4PMWA 1E3PA 3J81j 4OWWB 4JOIA 1I94Q 1VQ9A 3I4NG 4AIMA 2IY5B 4KLKA 1KAWA 1YJ9A 2OTJA 1VQBA 4LF9L 1XMOL 1OTCA 2VNUD 4JI5Q 1YEZA 2WB1G 2ALYB 3HFZB 4LF4L 2UU9Q 4DV0L 3GTJH 4IFDI 2QGQA 1VQ5A 3HKZG 2E2JH 1CKOA 4A3DG 2YTYA 1HNWQ 2A1AA 2ZJPA 3A0JA 1FGUA 2WAQG 2ASBA 2LSSA 5IWAQ 4DUZL 1YZ6A 5LMUL 4B3MQ 2HIVA 5M5YH 1XMOQ 1HZBA 2E8GA 5C4JH 4GNXB 3OYYA 3MEFA 2JA7G 2OQ0A 5BR8L 1VQNA 1XPOA 4DV4Q 1AH9A 4FDBA 2K75A 5C0XI 5IYDH 5IWAL 3D0FA 1CSPA 2EIFA 3CPFA 2JA5H 3FHWA 1Q81C 4X62Q 4DV3Q 4B3RL 3PIPA 1PH4A 4DR7Q 3RR5A 3GTQH 4UPAA 4HIMA 3OW2A 2E5LL 3TREA 4J15A 4C3IH 3S1RH 1K9MC 2L15A 3TQYA 1YHBA 3HOUG 1T9HA 2C35B 5IYDG 3PF5A 1SN8A 3KDFB 1TWFH 1YNXA 3NEMA 4A3LG 3HOXH 1PHJA 4LF7L 1I50H 2CWPA 3G4SA 4DV5L 1K83H 3CC7A 1OXUA 1VQHA 3PSIA 2FXQA 4X65Q 4R4CA 4XIGS 2A8VA 5E7NA 3TS0A 1S72A 3CCUA 3S16H 3HOVH 4GLVB 5GROA 4PZ6A 4XTCS 1VQPA 4YWKA 1GKHA 1LTLA 4IPGA 1V43A 4P74A 1HH2P 1CKNB 1X56A 4X65L 4UP9A 4YCUA 1YJWA 1VQLA 3G6EA 2UXBL 3MXNB 4DK3C 2OTLA 1WYDA 4HJ9A 3GTPH 2N3SA 3CD6A 1G51A 4A3BH 4P73A 2AWNA 4JI8L 2UU9L 4GN5A 1WCMG 4LFAQ 1HR0Q 1XNRL 1I6HH 2CWAA 2JQOA 3GO5A 3T1HL 4DV0Q 3PO2H 5DLQE 2B29A 4PZ8A 1Q46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJG L;  1PH5 A;  1WJJ A;  2RF4 A;  1R9T H;  3S2H H;  4NB3 A;  4LFC Q;  4YWL A;  4O0A A;  4QIW E;  4DUZ Q;  4A3M G;  2NVX H;  1NTG A;  4LFA L;  5LMN W;  3UDG A;  2R93 G;  5GAD C;  1VQD A;  3H3V H;  2YV5 A;  3RLN A;  3CQZ H;  4BBR H;  4AQY Q;  5C44 H;  2VL6 A;  4P71 A;  4A3K H;  1A62 A;  1EOV A;  1UE6 A;  2QEX A;  2IHE A;  4C3J H;  1RIP A;  3BU2 A;  5M3M H;  2JJQ A;  2NVY H;  4IJH A;  1VQO A;  4JI3 L;  3J81 i;  4OX9 L;  2B63 H;  4GKJ L;  1EYG A;  1NJI C;  4POG A;  4DR4 L;  2Q2U A;  4DUY L;  4B3T Q;  3J81 c;  2UUC Q;  4JG2 A;  4JI2 Q;  2RCN A;  2EXD A;  2JK8 A;  3CP0 A;  3HKS A;  3I56 A;  2K52 A;  4DK6 C;  3H15 A;  1Q7Y C;  4MTN A;  2PQA B;  1GVP A;  4OX9 Q;  2NVQ H;  4DV6 L;  2VQF L;  2R92 H;  2F3I A;  2YTX A;  2N49 A;  1N34 L;  4JBJ A;  2GVB A;  4JOI C;  1SFO H;  2MNA A;  3M9B A;  3PUV A;  1VQI A;  2BA1 A;  1EQR A;  3GDE A;  3KF8 B;  5IP9 G;  1VQF A;  5IE8 A;  1QUQ B;  2Q2I A;  4DR5 Q;  5GAG C;  1Y1W G;  2NZH A;  2VQF Q;  1QZH A;  1Q12 A;  1XJV A;  1JJC B;  2CKZ B;  3TS2 A;  4JV5 L;  2F4V L;  4YWM A;  1N32 L;  4LW1 A;  5LMN Q;  3KDF A;  3EBE A;  4X64 Q;  3CCR A;  2ID0 A;  2NZO A;  3RNU A;  2VZA A;  4BXX G;  3CMA A;  1PA6 A;  5IP7 H;  3M3Y H;  2UXB Q;  2JA5 G;  3AQQ A;  4YHH L;  1HNX Q;  1XMQ L;  1DGS A;  2D62 A;  3JAM i;  4JI5 L;  3CCJ A;  5K36 G;  1I5F A;  2R93 H;  1VQM A;  4BY1 G;  2Z0S A;  4Y7N H;  3W5O A;  4ME3 A;  1U0L A;  1G6P A;  2WAQ E;  1XPR A;  1X9N A;  2F52 A;  2AKW B;  4A3F H;  1JMC A;  5JJK A;  3CME A;  1VQE A;  2YYZ A;  3STB C;  1Y14 B;  4GNX A;  4JI7 L;  3L7Z C;  1KRS A;  4JBM A;  5IT9 c;  4UP8 A;  2R7Z G;  1S40 A;  2KHI A;  1QVC A;  1SRU A;  2PQA A;  5JJI A;  2JA6 H;  4K0K L;  5C4X H;  1KXL A;  3ULJ A;  2GVA A;  4DV2 Q;  1Y1W H;  2D0P A;  1RL2 A;  5JEA G;  4DR1 Q;  3HOW H;  4OWT B;  4A3G H;  4LF5 L;  3F8T A;  1LUZ A;  1EWI A;  1P16 A;  3JC6 6;  4LFB Q;  2HIX A;  4NXM Q;  4DR7 L;  1E24 A;  2NN6 G;  1LM0 A;  2OCE A;  1J5E Q;  1IBL L;  1TXY A;  4DR4 Q;  3M4O H;  1OXV A;  4X66 L;  1PH3 A;  4JI4 L;  3UDX A;  3S2D H;  4BY7 G;  5FLM G;  2UUC L;  3Q8D A;  3CCS A;  1CKM A;  1H95 A;  3PO3 H;  3WWV A;  2QA4 A;  4IO9 A;  1YVC A;  3KOJ A;  1E1O A;  3BZC A;  4UY8 C;  4DUY Q;  3JAM c;  4BY1 H;  3W1B A;  1QVF A;  2I5L X;  3GTG H;  4JYA Q;  1I3Q H;  3U58 A;  1HJP A;  4WJ3 M;  5H1S E;  1X6O A;  1TWC H;  1OXS C;  1UEB A;  3IRB A;  4LWC A;  5AJ3 L;  1HR0 W;  4HJA A;  4A3G G;  5IP7 G;  2VS1 A;  3B6Y A;  4JI0 Q;  5M3F G;  4YCW A;  4YY3 L;  4DR5 L;  2Q2T A;  4APV A;  2CQO A;  3F1Z A;  4LUV A;  4DAM A;  1NMF A;  4DV1 Q;  5JEA J;  4DV7 Q;  1YIT A;  2UUB Q;  4DNI A;  4LF6 Q;  4C3H H;  4IOA A;  4JV5 Q;  2BH8 A;  5GAH C;  2F4V Q;  3HOZ G;  3S1N H;  2UXC Q;  4A3I H;  2K5N A;  4DR2 L;  1OXX K;  1B8A A;  1HZC A;  2Y0S E;  4YY3 Q;  1HNZ L;  1IBK Q;  1N32 Q;  5LMN L;  2IX1 A;  2K5H A;  2DUD A;  3S1M H;  3T1Y Q;  3D31 A;  3I4M G;  1W2B A;  1VQA A;  1GM5 A;  1C7Y A;  1SMX A;  2VQE Q;  3I4N H;  2UXD Q;  3S1Q H;  2NVT H;  3PUZ A;  3RLF A;  3DM3 A;  2HT1 A;  1VQ6 A;  2JA7 H;  3A5U A;  1AE3 A;  3CCL A;  4GLX A;  1A63 A;  1L1O C;  2MO0 A;  3CXC A;  1Y1V G;  3F2B A;  3KYH C;  4GNX C;  4BBS G;  2I5M X;  4OO1 G;  1JJ2 A;  3ERS X;  1N36 Q;  3LGJ A;  1TWG H;  1HZ9 A;  4AQY L;  2B3G A;  4K0K Q;  1B7Y B;  3AYH B;  1O7I A;  2Z6K C;  4L5S A;  5FJ8 G;  1SLJ A;  1Q1E A;  5IYB H;  4LF7 Q;  3PF4 A;  1VQC A;  4A3B G;  4A76 A;  1PH8 A;  3I2Z A;  4NXN L;  1PH2 A;  1J5E L;  4OXP A;  2Q2H A;  4GLA C;  1IBL Q;  4B3M L;  3BZK A;  1FJG Q;  3CCE A;  3AFP A;  3NEL A;  1BKB A;  4WJ4 A;  3EN2 A;  4AH6 A;  5BR8 Q;  2DGY A;  4GS3 A;  2WB1 E;  1Z47 A;  3KFU A;  4BBS H;  4KI0 A;  5GAE C;  4P75 A;  1TWA H;  1V9P A;  1KD1 C;  4BY7 H;  5FLM H;  1AE2 A;  4QL5 A;  2R7F A;  3U4Z A;  4X62 L;  1N34 Q;  4IPD A;  3PV0 A;  1VQG A;  3PIO A;  4DKA C;  4BBR G;  5LMU Q;  5C44 G;  3RLO A;  4A75 A;  1C9O A;  3CCV A;  1N9W A;  1YHA A;  3SGI A;  4C2M H;  4EX5 A;  4A3L H;  3W1G A;  4A93 G;  2ZTE A;  2CFM A;  4H02 A;  3F2D A;  4IPH A;  2JA6 G;  4LUO A;  3U4V A;  1ASZ A;  2IHF A;  4X64 L;  3DLL A;  3RN5 A;  1CKN A;  2N78 A;  2JA8 H;  3RN2 A;  4LUZ A;  3M85 A;  4X66 Q;  2ZJR A;  1Y1V H;  5M5X H;  2UXC L;  4DV5 Q;  4R4O A;  1A8V A;  5J3B A;  1IL2 A;  3KJO A;  4A3J H;  2GN5 A;  2WFW A;  4R4I A;  1UE7 A;  5M3M G;  1I94 L;  4JYA L;  1IBK L;  2AHO B;  3GTO H;  1W3S A;  1ASY A;  1EFW A;  4GKK L;  2MO1 A;  2ZM6 L;  1IXR A;  1IBM L;  4JI6 Q;  2KHJ A;  4A3E H;  3K0X A;  4GOP C;  4DAY B;  5AJ3 Q;  2R7D A;  4TQU S;  5C3E G;  1BVS A;  2VQE L;  1QVG A;  1JT8 A;  2R6G A;  1K73 C;  1L1O A;  2YU9 H;  4B3S L;  4DV1 L;  3J80 i;  3NBH B;  1NY4 A;  4R1J A;  1KQS A;  2PI2 E;  4HIK A;  2B63 G;  3PO2 G;  2ZJQ A;  2MQH A;  2D0O A;  1X3G A;  3KJP A;  1X55 A;  1XNQ Q;  4AYB G;  4L5Q A;  2VY3 A;  2ZTD A;  4DPG A;  1EQQ A;  4L5R C;  3PCO B;  5IP9 H;  2K14 A;  1KHI A;  1N33 Q;  3PUY A;  1A0I A;  1Q86 C;  2I0Q A;  2AMC B;  1PH9 A;  3L2P A;  1K0R A;  3T1Y L;  1MKH A;  1TWH H;  2ZTC A;  3K80 C;  4IOC A;  3H3V I;  4LFC L;  2HHH Q;  3TRZ A;  1E7Z A;  4MZ9 A;  5ELN A;  1WI5 A;  3AFQ A;  1UE5 A;  1PH1 A;  2NN6 I;  3A5Z B;  4GOP B;  2E2I H;  4A3D H;  1G29 1;  1KL9 A;  1PV4 A;  3ULL A;  1XNR Q;  3HOY G;  1E1T A;  2VW9 A;  2AWO A;  4QQB X;  1NMG A;  3I55 A;  1JB7 A;  4JBK A;  3S14 H;  1CUK A;  4IFD G;  3PGZ A;  4YCV A;  1XTD A;  3I4M H;  4RG1 A;  1VCI A;  3ER0 A;  4JI1 Q;  2OQK A;  3RZO H;  4GN3 B;  4DR6 L;  4DV4 L;  1IYJ B;  2K5V A;  4PG3 A;  5IYC G;  4LNQ A;  1D8L A;  3S15 H;  4JBW A;  1PYS B;  5FLX c;  1VQ4 A;  3UDI A;  1WFQ A;  4GKJ Q;  4JI3 Q;  1K8G A;  1E22 A;  4TVA B;  1M90 C;  1XPU A;  4JI1 L;  1X54 A;  2VUM G;  5IYB G;  3J7Z C;  2ES2 A;  3M4P A;  5C0X G;  1WCM H;  4DV2 L;  5HY6 A;  1YHQ A;  4B3T L;  2UXD L;  4O2D A;  3CCM A;  3I4O A;  3HOX G;  1EIY B;  2E2H H;  1D7Q A;  4GKK Q;  1P8L A;  1JJG A;  4DR1 L;  4LF8 Q;  3A74 A;  1PH7 A;  3CF5 A;  3H0G G;  3PUW A;  3RZD H;  1FVI A;  1YBY A;  4PZ7 A;  4HJ7 A;  3KF6 A;  3HOY H;  5C4X G;  1EUJ A;  2ZM6 Q;  1IBM Q;  4B3R Q;  2Y0S G;  4DV3 L;  3T1H Q;  1NBW A;  1VS0 A;  3U50 C;  3HOV G;  1PYB A;  2KCT A;  1V1Q A;  3GTK H;  3I7F A;  1CSQ A;  1XNQ L;  2A19 A;  1L0W A;  3BJU A;  4QJF A;  4OO1 I;  3TEH B;  3GTM H;  1MJE A;  2IX0 A;  3J7A 5;  1PH6 A;  2JEB I;  1MIU A;  1U5K A;  4LF4 Q;  3CW2 C;  2XTI A;  1HNW L;  5IY0 A;  1GO3 E;  1QZG A;  4JI0 L;  1UWV A;  3HOU H;  1C0A A;  4A3I G;  2JA9 A;  3E9H A;  3EIV A;  2HQL A;  4GN4 B;  2K4K A;  1GD7 A;  2R92 G;  1IZ6 A;  3NEN A;  4JI6 L;  5EAY A;  3HKZ E;  1SE8 A;  4IFD J;  3PO3 G;  3AEV A;  4POF A;  4A3C H;  4QY7 A;  4DR2 Q;  3J80 c;  4BA1 I;  4R4T A;  1BBW A;  2KCM A;  4A3E G;  3S24 A;  2UUA L;  4LF5 Q;  4LFB L;  3L0O A;  5C3E H;  4NXM L;  3G71 A;  4DV6 Q;  2ATW A;  1MJC A;  1SR3 A;  4NXN Q;  4KHP L;  3OTO Q;  2Z6K A;  4IJL A;  2K50 A;  4L5T A;  2PI2 A;  3VDY A;  3F2C A;  5FJ8 H;  2BA0 A;  2LXK A;  4JCV E;  4HJ5 A;  2KBN A;  4DR3 Q;  3K7U C;  4A3K G;  3CAM A;  1VQ7 A;  4A3J G;  4OON A;  3STB D;  1N33 L;  5C0X J;  1L2F A;  3PUX A;  1NE3 A;  1VQJ A;  4DR6 Q;  4RMF A;  4AYB E;  1HR0 L;  1VQ8 A;  1VQK A;  1KIX A;  3GTL H;  1UE1 A;  5IYC H;  4MNO A;  4HJ8 A;  4DR3 L;  3CC2 A;  1K3R A;  4A4I A;  1X3E A;  1S3O A;  4QGU A;  2CCZ A;  4KHZ A;  1YJN A;  3HOW G;  2JE6 I;  1LYL A;  1X65 A;  4JI4 Q;  2YTV A;  3E9I A;  4OWX B;  4JI2 L;  1PFS A;  2UUB L;  4YHH Q;  2I5H A;  1HNX L;  1XMQ Q;  3KLW A;  3ZJY C;  1PVO A;  2EQS A;  1L1O B;  2V1C C;  2XGT A;  3FKI G;  2PNH A;  5ELO A;  2E5L Q;  2KEN A;  2MFI A;  3GD7 A;  1J6Q A;  3UE0 A;  3CPW A;  1HNZ Q;  1SRO A;  1KC8 C;  1OXT A;  1X3F A;  3K8A A;  2RHQ B;  1QUQ A;  5HGQ A;  3CC4 A;  4BA2 I;  3FP9 A;  1HZA A;  2IT1 A;  1Q82 C;  2BH2 A;  2JA8 G;  2JEA I;  4X6A H;  2PMZ E;  3M7N A;  3CCQ A;  2OWO A;  4DV7 L;  4LF6 L;  4JC0 A;  5JJL A;  1M1K C;  1EIF A;  3FKI H;  1N8R C;  4EQ5 A;  3S17 H;  4JI8 Q;  5M3F H;  1K8A C;  3M4Q A;  3ULP A;  3K7A H;  1KRT A;  3KF6 B;  4BXX H;  1YIJ A;  3K81 C;  4HIO A;  3UE1 A;  2HHH L;  4NPS A;  4P72 A;  1Z9F A;  4GOP A;  4B3S Q;  2VUM H;  2H5X A;  4Y52 H;  1JE5 A;  5GQO A;  4A3M H;  1N36 L;  4IPC A;  4LF8 L;  4UP7 A;  4HID A;  4R4Q A;  3E0E A;  3HOZ H;  3UDF A;  2R7Z H;  1FL0 A;  2N8N A;  2RHS B;  3G48 A;  2UUA Q;  4LF9 Q;  4A3C G;  4A3F G;  2LXJ A;  1B70 B;  1Q1B A;  4A93 H;  1YI2 A;  3ICE A;  4KHP Q;  3OTO L;  5M5W H;  4JI7 Q;  1WOC A;  1BBU A;  2WP8 J;  3H0G H;  4ALP A;  1Q8K A;  4PMW A;  1E3P A;  3J81 j;  4OWW B;  4JOI A;  1I94 Q;  1VQ9 A;  3I4N G;  4AIM A;  2IY5 B;  4KLK A;  1KAW A;  1YJ9 A;  2OTJ A;  1VQB A;  4LF9 L;  1XMO L;  1OTC A;  2VNU D;  4JI5 Q;  1YEZ A;  2WB1 G;  2ALY B;  3HFZ B;  4LF4 L;  2UU9 Q;  4DV0 L;  3GTJ H;  4IFD I;  2QGQ A;  1VQ5 A;  3HKZ G;  2E2J H;  1CKO A;  4A3D G;  2YTY A;  1HNW Q;  2A1A A;  2ZJP A;  3A0J A;  1FGU A;  2WAQ G;  2ASB A;  2LSS A;  5IWA Q;  4DUZ L;  1YZ6 A;  5LMU L;  4B3M Q;  2HIV A;  5M5Y H;  1XMO Q;  1HZB A;  2E8G A;  5C4J H;  4GNX B;  3OYY A;  3MEF A;  2JA7 G;  2OQ0 A;  5BR8 L;  1VQN A;  1XPO A;  4DV4 Q;  1AH9 A;  4FDB A;  2K75 A;  5C0X I;  5IYD H;  5IWA L;  3D0F A;  1CSP A;  2EIF A;  3CPF A;  2JA5 H;  3FHW A;  1Q81 C;  4X62 Q;  4DV3 Q;  4B3R L;  3PIP A;  1PH4 A;  4DR7 Q;  3RR5 A;  3GTQ H;  4UPA A;  4HIM A;  3OW2 A;  2E5L L;  3TRE A;  4J15 A;  4C3I H;  3S1R H;  1K9M C;  2L15 A;  3TQY A;  1YHB A;  3HOU G;  1T9H A;  2C35 B;  5IYD G;  3PF5 A;  1SN8 A;  3KDF B;  1TWF H;  1YNX A;  3NEM A;  4A3L G;  3HOX H;  1PHJ A;  4LF7 L;  1I50 H;  2CWP A;  3G4S A;  4DV5 L;  1K83 H;  3CC7 A;  1OXU A;  1VQH A;  3PSI A;  2FXQ A;  4X65 Q;  4R4C A;  4XIG S;  2A8V A;  5E7N A;  3TS0 A;  1S72 A;  3CCU A;  3S16 H;  3HOV H;  4GLV B;  5GRO A;  4PZ6 A;  4XTC S;  1VQP A;  4YWK A;  1GKH A;  1LTL A;  4IPG A;  1V43 A;  4P74 A;  1HH2 P;  1CKN B;  1X56 A;  4X65 L;  4UP9 A;  4YCU A;  1YJW A;  1VQL A;  3G6E A;  2UXB L;  3MXN B;  4DK3 C;  2OTL A;  1WYD A;  4HJ9 A;  3GTP H;  2N3S A;  3CD6 A;  1G51 A;  4A3B H;  4P73 A;  2AWN A;  4JI8 L;  2UU9 L;  4GN5 A;  1WCM G;  4LFA Q;  1HR0 Q;  1XNR L;  1I6H H;  2CWA A;  2JQO A;  3GO5 A;  3T1H L;  4DV0 Q;  3PO2 H;  5DLQ E;  2B29 A;  4PZ8 A;  1Q46 A; 
#chains in the Genus database with same CATH topology
 1U4R A;  1FJG L;  2RF4 A;  4LFC Q;  1MI2 A;  4XT1 B;  2B8F A;  4YWL A;  4A3M G;  2E74 C;  5ELC A;  1QIL A;  2R93 G;  3RLN A;  3QG1 A;  1BCP D;  1VQO A;  4LF5 Q;  3S2D B;  2NVY H;  1SND A;  3MXN A;  4IJH A;  4OX9 L;  3FRP B;  1EYG A;  1NJI C;  2Q2U A;  1MSG A;  4DUY L;  2FMC A;  2IW3 A;  2RCN A;  1CFM A;  3WDN A;  3I56 A;  2K52 A;  3QOL A;  1J8I A;  2R92 H;  1EYC A;  3L3O C;  4JBJ A;  4ME5 A;  2EYO A;  3HS0 C;  1SDF A;  3PUV A;  5ELD A;  5KYI A;  2SNS A;  1VF7 A;  2Q2I A;  4DR5 Q;  3A7A B;  2VQF Q;  3MXU A;  1WCM B;  1LTR D;  2KED A;  5LMN Q;  5DM6 3;  3CCR A;  3K7A B;  4H13 C;  3CMA A;  4E6I A;  2CH4 A;  4OIJ A;  5IP7 H;  1TII D;  1PA6 A;  2UXB Q;  2LMC B;  1FGB D;  5M3F B;  2JA5 G;  3AQQ A;  3VR3 A;  1E2Z A;  2R93 H;  3SHL A;  4IUP A;  4Y7N H;  3KBX A;  3OOC A;  4ME3 A;  1U0L A;  1G6P A;  2AKW B;  1FR3 A;  5JJK A;  3STB C;  4JI7 L;  2R7Z G;  3L7Z C;  2K5W A;  5JJI A;  4DF7 A;  1WTQ A;  2JA6 H;  1HXY D;  3ULJ A;  5JVH 3;  1Y1W H;  2D0P A;  1RL2 A;  1PFB A;  4LFB Q;  1Y1V B;  1IBL L;  2EJF C;  5LL6 X;  3VYS A;  1SYG A;  3TSS A;  4JI4 L;  3GV6 A;  3UDX A;  2KEC A;  3Q8D A;  1X3Q A;  3WWV A;  1YVC A;  3KOJ A;  1E1O A;  1U9R A;  4BY1 H;  1QVF A;  2I5L X;  4UAI A;  2KJX A;  1ICF B;  2PMZ B;  4CJ1 B;  1X6O A;  5CBE E;  1UEB A;  1LTB D;  4TSS A;  3C2P A;  1SMY D;  4HJA A;  4A3G G;  2VS1 A;  3VR2 A;  2DJG C;  3HZX A;  5EPL A;  4LUV A;  2UUB Q;  4U67 3;  1YIT A;  4DNI A;  2BH8 A;  5GAH C;  4HAE A;  2PW7 A;  1ESF A;  1I3Q B;  4HSP A;  4CKB A;  1OXX K;  3MA2 B;  1B9N A;  5LMN L;  2L5T A;  5G3L F;  3T1Y Q;  3I4M G;  1W2B A;  1VQA A;  4A93 B;  4G7O C;  3QR8 A;  1BO0 A;  3E3X A;  2UXD Q;  3S1Q H;  4QCL A;  3RLF A;  1BDO A;  3CCL A;  2K33 A;  1A63 A;  3J7A F;  1UEA B;  3CXC A;  3KYH C;  4BBS G;  1KNA A;  1JJ2 A;  1N36 Q;  1TWG H;  4RGN A;  3K57 A;  2F0K A;  2X69 A;  2B2U A;  5ELE A;  1EIG A;  2B3G A;  5HGT A;  2F0M A;  2KA7 A;  4L5S A;  1DOM A;  2Z6K C;  1TR5 A;  4LF7 Q;  1CQF A;  4A76 A;  4X3T A;  1PH8 A;  3QIA A;  1PH2 A;  2Q2H A;  1TY0 A;  4GLA C;  1FJG Q;  3CCE A;  3NEL A;  3EN2 A;  4AH6 A;  3PO2 B;  3ERO A;  1XXG A;  4BY7 H;  4NDX A;  1AE2 A;  4QL5 A;  5IGB A;  1XX8 A;  3U4Z A;  2K28 A;  3PV0 A;  1VQG A;  1ICW A;  4ZUI A;  1C8C A;  5C44 G;  1Y8O B;  1C9O A;  1YHA A;  4LAA A;  4H02 A;  2FHT A;  1VMP A;  2NBF A;  4LUO A;  3U4V A;  2ZXR A;  1YNN D;  2N78 A;  1GUG A;  4IUR A;  4JK1 C;  1IW7 D;  5EJW A;  4ZCK A;  2ZJR A;  5JPM C;  4KKU A;  5M5X H;  5COR A;  1A8V A;  2D2C C;  1EY5 A;  2V4D A;  1UE7 A;  5M3M G;  4TKO B;  5NUC A;  1ASY A;  2ZM6 L;  1IBM L;  4N8X 1;  2H4O A;  2R7D A;  5C3E G;  1GOZ A;  1LO5 D;  3DMU A;  3Q22 A;  4B3S L;  1H9K A;  1KQS A;  2PI2 E;  1X55 A;  4AYB G;  3OIP A;  1Q86 C;  2AMC B;  1MKH A;  3HOV B;  4LFC L;  2HHH Q;  2R61 A;  3S1M B;  1UE5 A;  3C1F A;  1S5E D;  2NN6 I;  4GOP B;  4V19 0;  5IGD A;  4KN7 C;  2JA6 B;  1MGS A;  3S15 B;  4OEL B;  1EQV A;  2IWH A;  1SE2 A;  2VW9 A;  1C4Q A;  3FPU B;  2JN4 A;  3JAM L;  3S14 H;  5C0X H;  3I4M H;  4RG1 A;  1VCI A;  4JI1 Q;  1TS2 A;  4GN3 B;  2RDH A;  5T1I A;  4XYQ A;  1SNC A;  2B2T A;  3Q6S A;  2B2Y A;  1VQ4 A;  2M2L A;  1WFQ A;  2JP1 A;  1K8G A;  3I91 A;  2J4X A;  3J7Z C;  3L9A X;  1YHQ A;  4A3J B;  1JR0 D;  4O2D A;  2K5Q A;  1EIY B;  4GKK Q;  2HDL A;  4DR1 L;  4LF8 Q;  3PUW A;  4TRD A;  1I50 B;  5I6W A;  2AQ2 B;  1PXU A;  1OO9 B;  4DV3 L;  2MP1 A;  1JOK A;  1PYB A;  2A68 C;  1CSQ A;  1ZEQ X;  3BJU A;  4QJF A;  4OO1 I;  5I9O A;  2IX0 A;  4EQN A;  2M00 A;  1PH6 A;  3HOY B;  2F0O A;  4XYO A;  4K5X A;  3NWT A;  5IY0 A;  1C0A A;  4A3I G;  3E9H A;  1DZ1 A;  2K32 A;  1IZ6 A;  3C46 A;  3NHH A;  1R4P B;  1STG A;  4M8A A;  5CBA E;  3SXH A;  3PO3 G;  1NUC A;  4DR2 Q;  2GA4 B;  5CV6 A;  3D6C A;  4BA1 I;  2KCM A;  5KND A;  3AB9 A;  2B2V A;  3G71 A;  2NB0 A;  2HUG A;  1SR3 A;  3OTO Q;  3S2H B;  3VDY A;  5FJ8 H;  4DR3 Q;  4A3K G;  3K7U C;  4OON A;  1N33 L;  4XDX A;  2IPK D;  1RTN A;  1H9R A;  4RMF A;  4AYB E;  2K6A A;  2X6G A;  3GTL H;  1D6E C;  1LTT D;  5IYC H;  1B3A A;  4MNO A;  1IKM A;  5C4H A;  2Y0S B;  1K3R A;  2CCZ A;  4KHZ A;  2JE6 I;  3E9I A;  4JI2 L;  4MTK A;  4ZLT F;  4FF2 A;  3N52 A;  2BE5 D;  3ZJY C;  3TP7 A;  3CKI B;  1TS3 A;  2E5L Q;  2WAQ B;  3CPW A;  5IGF A;  4RGO S;  1KC8 C;  3K8A A;  3FP9 A;  2IT1 A;  2JEA I;  1G2S A;  4DV7 L;  4LF6 L;  3E0J A;  4JC0 A;  2O4X A;  1SE4 A;  3FKI H;  1N8R C;  5C4Z A;  2KQ3 A;  4EQ5 A;  4JI8 Q;  4IUV A;  1CI3 M;  3K7A H;  1NNX A;  4H0L C;  1HA6 A;  1MD2 D;  3UE1 A;  3VYR A;  1JWS D;  4NPS A;  1Z9F A;  5CV4 A;  2F0D A;  4Y52 H;  4A3M H;  5GQO A;  3NUC A;  5ELB A;  4Y7N B;  5KNB A;  3UDF A;  1SXT A;  2R7Z H;  3AU7 A;  3U9O A;  1J9O A;  4LF9 Q;  4A3C G;  1Q1B A;  2F0N A;  1WTP A;  4Q5V A;  1W6J A;  3ICE A;  2SEB D;  3NQT A;  1WOC A;  4PMW A;  3J81 j;  4RHS A;  4K5V A;  1I94 Q;  2OTJ A;  3T13 A;  3GTK B;  2F0L A;  2K5D A;  4JI5 Q;  2WB1 G;  1XYI A;  1I6H B;  1VQ5 A;  4A3D G;  1F9R A;  3J81 E;  2A1A A;  3WOF A;  1HHV A;  2ICE C;  5IWA Q;  5M5Y H;  3RZD B;  1XMO Q;  1BNZ A;  2E8G A;  1KDA A;  4GNX B;  2JA7 G;  2JA8 B;  4XT3 B;  5BR8 L;  4ULL A;  1VQN A;  2OEO A;  4C1N K;  2DY7 A;  1PTO D;  2L0C A;  3D0F A;  4J1M A;  3PIP A;  1PH4 A;  1S5C D;  4XQJ A;  3DWA A;  3E5S A;  3ND8 A;  2Z4H A;  4C3I H;  1K9M C;  3TQY A;  2R93 B;  4FNF A;  3HOU G;  1DCZ A;  4DK0 A;  5IYD G;  3PF5 A;  2L1B A;  3A8J E;  4LF7 L;  3BYY B;  3PMF A;  5D65 A;  3HRZ C;  2CWP A;  4FXK C;  5EBD A;  1VQH A;  3PSI A;  2C9O A;  4X65 Q;  4XIG S;  4HMI A;  2RBM A;  5E7N A;  3TS0 A;  4I65 A;  1S72 A;  3S16 H;  1QG7 A;  5GRO A;  2I07 B;  3D6W A;  4XTC S;  1PRT C;  4YWK A;  1AW7 A;  4IPG A;  1EFI D;  4UP9 A;  1K83 B;  1TU2 B;  3O13 A;  2UXB L;  2OTL A;  3M4Y A;  4P73 A;  2E2D C;  4JI8 L;  4GN5 A;  1WCM G;  3GTJ B;  2JQO A;  4PNY A;  3GO5 A;  1B2T A;  1I4R A;  2B29 A;  1Q46 A;  1GUO A;  1HA5 A;  4Q0F A;  1T5X D;  3TP5 A;  4QIW E;  2PO4 A;  3EQL C;  1KNE A;  4LFA L;  5GAD C;  1VQD A;  3IFT A;  3H3V H;  4AQY Q;  4P71 A;  4A3K H;  1EL0 A;  2MHV A;  1II3 A;  2QEX A;  4C3J H;  2A8V A;  2JJQ A;  2B63 H;  1HQM C;  1JWM D;  1LV9 A;  3J81 c;  4L8J A;  2NVX B;  3GTL B;  2JK8 A;  5DAU A;  3CP0 A;  4DK6 C;  3PIP 3;  1KLG D;  2NVQ H;  4DV6 L;  5IGC A;  1SFO H;  5GAG C;  1ILQ A;  5T1G A;  1Q12 A;  1JJC B;  3A8K E;  1D5X C;  2CKZ B;  3TS2 A;  2ICI A;  3I8Z A;  1TS4 A;  3M3Y H;  4FP5 D;  1EQT A;  2RSN A;  1HNX Q;  3H3V C;  1DGS A;  2D62 A;  1RD9 D;  3JAM i;  3CCJ A;  1Y8N B;  4BY1 G;  2Z0S A;  3W5O A;  1Q3L A;  3MVV A;  1NR2 A;  2WAQ E;  1TVX A;  1XPR A;  1G91 A;  5E1F A;  3CME A;  4UP8 A;  1S40 A;  1F2Y A;  4PQX A;  3VR4 A;  1JCK B;  5I2X A;  4H44 C;  1G6Z A;  5JEA G;  4DR1 Q;  2HIX A;  4DR7 L;  1E24 A;  1PTO F;  3DXJ C;  2NN6 G;  4BBS B;  4DR4 Q;  3RMH A;  4X66 L;  4BY7 G;  3KLS A;  5FLM G;  1EY9 A;  1Y1W B;  1RJT A;  3URY A;  3BZC A;  4S3S A;  4UY8 C;  3JAM c;  3I73 A;  1I3Q H;  1F9Q A;  3V96 A;  1PRT F;  4KY7 A;  4WJ3 M;  5FKA C;  1TWC H;  2HDM A;  2XN9 C;  5AJ3 L;  1HR0 W;  1IYU A;  4KN4 C;  3NTI A;  5IP7 G;  1WTO A;  5IIF A;  1FNU A;  3S17 B;  4FF3 A;  3D4D A;  4YY3 L;  5C4X G;  2CQO A;  3F1Z A;  4DV7 Q;  4LF6 Q;  5JEA J;  1H9S A;  3GTQ B;  2F4V Q;  1B4O A;  2K5N A;  2A69 D;  2PZW A;  3TZD A;  2Y0S E;  1HNZ L;  1O7Z A;  4IFD H;  1U4P A;  4DAP A;  3S1M H;  1CZW A;  1C7Y A;  1HUN A;  2KUM A;  2NVT H;  1QNU A;  2RDG A;  1AE3 A;  2XWJ B;  3MXG A;  4GLX A;  1V1O A;  1L1O C;  2EY1 A;  3DWP A;  1EWC A;  2I5M X;  1GUT A;  4BS9 A;  4QB4 A;  3ERS X;  5M3M B;  1NSN S;  2LY7 A;  3GTP B;  3K5L A;  3EFX D;  1B7Y B;  1X32 A;  5C3E B;  4L6T B;  1CQV A;  1SLJ A;  4A3B G;  2K04 A;  3SK8 A;  1SYE A;  3BZK A;  3AFP A;  1B9M A;  4G4K A;  2DGY A;  4PV1 C;  3BDO A;  3SE0 A;  4P75 A;  4CDF C;  1B44 D;  2OT2 A;  1W6K A;  2PW5 A;  2R7F A;  4O42 A;  1N34 Q;  1PTO B;  3PIO A;  2ENB A;  3MTS A;  2J0T D;  3RLO A;  1BUV T;  3CCV A;  3MFY A;  4A3L H;  1HFG A;  4K14 A;  3F2D A;  5K5P A;  1ASZ A;  2JA6 G;  2IHF A;  4X64 L;  1CZG A;  3RN5 A;  2JA8 H;  3M85 A;  4X66 Q;  1LT5 D;  4R4O A;  5J3B A;  1LAB A;  1IL2 A;  3KJO A;  3ONA B;  2B2T C;  1JWU D;  2Q8T A;  2Q8R E;  2PPB C;  1W3S A;  4JW0 A;  4EQO A;  1EFW A;  1WTH A;  2KHJ A;  3NTH A;  3TBI B;  4GOP C;  5AJ3 Q;  3J7Y W;  1SBB B;  4K2L A;  5DM7 3;  2KEE A;  2RKS A;  2VUM B;  4FYD A;  5D3I B;  1C48 A;  3HOX B;  5FOB B;  4HIK A;  1O78 A;  2B63 G;  4WRD A;  3KJP A;  4RGM A;  3C1E A;  3BZD B;  4DPG A;  1HFN A;  2A73 B;  1UNS A;  2Z1C A;  1K0R A;  4P2C B;  3VR5 A;  3L2P A;  3T1Y L;  3H3V I;  3CQZ B;  3SK6 A;  4BBR B;  4CKC A;  3AMU A;  1E7Z A;  1WI5 A;  1PH1 A;  1A2U A;  1AZP A;  2E2I H;  5EKL A;  1V8Q A;  4A3D H;  5KEE A;  2TSS A;  1PV4 A;  3T4A C;  4DNR B;  1JB3 A;  4QQB X;  4A3I B;  1TQO A;  3PGZ A;  1DJR D;  4YCV A;  1AEX A;  3ER0 A;  2OQK A;  1PFM A;  3PO3 B;  1IYJ B;  2K5V A;  4PG3 A;  4NKL A;  4OL7 A;  1CA5 A;  1PYS B;  5FLX c;  3T16 A;  3UDI A;  5CV5 A;  4GKJ Q;  4JI3 Q;  1M90 C;  1XPU A;  4CDE C;  4ZRZ A;  2ES2 A;  5C0X G;  2MPM A;  4A3K B;  4DV2 L;  4B3T L;  1TKW B;  2P5Z X;  3I4O A;  2F0T A;  1D7Q A;  1PRT B;  3H0G G;  3RZD H;  5M5Y B;  2JSO A;  1LLR D;  1E0B A;  1FVI A;  2Y0S G;  3OWE B;  1BOS A;  1NBW A;  1VS0 A;  3T1H Q;  5A2Q L;  4KY6 A;  4C2M B;  2F0F A;  3GTK H;  1I4Q A;  1XNQ L;  2A19 A;  1E2W A;  2XWB B;  1L0W A;  4K2K A;  1DOL A;  3GTM H;  1MJE A;  1EIH A;  2WV6 D;  1MIU A;  1U5K A;  1TWA B;  2XTI A;  5M9O A;  4IN3 A;  4JI0 L;  1F2Z A;  3EIV A;  4GN4 B;  2R92 G;  4HCS A;  3NEN A;  5EAY A;  3HGB A;  1O80 A;  3HKZ E;  4ZKB B;  5EKK A;  4A3C H;  1XTC D;  3MZ5 A;  4LFB L;  2ATW A;  1MJC A;  3W3A A;  1EU3 A;  3MXP A;  1DYQ A;  3QB3 A;  2L4N A;  2A68 D;  4HJ5 A;  2KBN A;  3Q0A A;  3QO2 A;  4LJZ C;  5C0X J;  1L2F A;  3NWS A;  1VQJ A;  1VQ8 A;  1VQK A;  1KIX A;  1LTS D;  3J80 E;  5E3F A;  1X3E A;  1S3O A;  4QGU A;  5KYL A;  3H6M A;  2A69 C;  2G9D A;  2XVS A;  4OWX B;  1PFS A;  2UUB L;  1HNX L;  3S16 B;  3FKI G;  4C56 C;  1R9T B;  1LAC A;  1I6V C;  2KEN A;  3DEP A;  1HNZ Q;  1SRO A;  2Z9H A;  1X3F A;  1QUQ A;  5HGQ A;  4BA2 I;  1EZ8 A;  5D3D A;  1Q82 C;  1EY0 A;  2PMZ E;  2RA4 A;  1SJH D;  4C3I B;  3M7N A;  1ESR A;  1TWC B;  3I70 A;  2OWO A;  1QB5 D;  4OEM B;  1CT1 D;  2RCF A;  1D1I A;  3R2I A;  5M3F H;  4A3E B;  3ULP A;  2DJF C;  3KF6 B;  1AFP A;  1YIJ A;  3K81 C;  4HIO A;  4B3S Q;  1A6X A;  1MBY A;  1N36 L;  5C6A A;  4LF8 L;  1PDQ A;  4HID A;  4KKT A;  3E0E A;  3HOZ H;  3HOU B;  2AQ3 B;  1E2V A;  1I4H A;  3U9S A;  2UUA Q;  1D1K A;  2X6L A;  4A3F G;  1B70 B;  3I3C A;  3H94 A;  1MSH A;  5M5W H;  1BBU A;  4ALP A;  1E3P A;  3MHB A;  1HQR D;  1GHJ A;  4AIM A;  4KLK A;  3T51 B;  1CHP D;  4F87 A;  1XMO L;  1OTC A;  2ALY B;  2F0W A;  1VMC A;  5CR3 A;  3GTJ H;  2UU9 Q;  2E2J H;  2ZJP A;  1U4M A;  3A0J A;  1FGU A;  2ASB A;  4ZYS A;  4B3M Q;  4H7B A;  4EVO A;  2C5C A;  2HCI A;  2R3Z A;  4I7A A;  4DAV A;  1HZB A;  4DN4 M;  3VA5 A;  2NTS A;  2NVY B;  4FDB A;  5C0X I;  2EIF A;  3CPF A;  4C3J B;  4B3R L;  1SYC A;  1V1P B;  2VB3 X;  2A6H D;  1SNQ A;  4X62 Q;  1DON A;  3RR5 A;  3NTK A;  5E4W C;  3TRE A;  4J15 A;  2DN8 A;  1Q90 A;  1YHB A;  3NE5 B;  5ELF A;  2NVQ B;  3SEB A;  2WKD A;  1B50 A;  1I50 H;  3G4S A;  3S1Q B;  2EDG A;  5EPK A;  4DV5 L;  1K83 H;  3CC7 A;  1OXU A;  3I4N B;  4R4C A;  1PYW D;  5J22 A;  4NMZ A;  3NXW A;  5TSS A;  3HOV H;  4GLV B;  1G2T A;  1STN A;  3HEJ A;  1GKH A;  3NP8 A;  4P74 A;  3FEW X;  1CKN B;  4C3H B;  1SJE D;  4B9X A;  4DK3 C;  3CD6 A;  1HTP A;  1G51 A;  2B2W A;  2AWN A;  5BN3 A;  4LFA Q;  3A55 A;  1I6H H;  2RSO A;  2NWG A;  2F1M A;  2CWA A;  4ZAI A;  2K01 A;  4IUT A;  3RZO B;  5DLQ E;  4IUU A;  1PH5 A;  1WJJ A;  3S2H H;  4NB3 A;  2CHB D;  4O0A A;  4LMQ D;  2NVX H;  1NTG A;  2A6E D;  2WAC A;  5LMN W;  2YV5 A;  2O2L D;  3CQZ H;  4BBR H;  3BDL A;  1BCP F;  1A62 A;  1EOV A;  1UE6 A;  2EYJ A;  1RIP A;  5M3M H;  4GKJ L;  4JI3 L;  3J81 i;  1K0S A;  2KVM A;  5ISR A;  1WVL A;  4DGZ A;  3C3L A;  4BWG B;  5HUR A;  4JI2 Q;  3OSO A;  2EXD A;  3HKS A;  2I46 A;  1Q7Y C;  3H15 A;  4U68 A;  1RHP A;  5FLX L;  2PQA B;  1GVP A;  4OX9 Q;  4HTH A;  2VQF L;  1WTX A;  2FJ2 A;  2N49 A;  5EKI A;  4G57 A;  2EYH A;  3K0Y A;  2MNA A;  3M9B A;  3D8G A;  1VQI A;  2L11 A;  3GDE A;  3KF8 B;  5IP9 G;  1SAP A;  4CJ2 C;  1QUQ B;  4KJN A;  2NZH A;  1QZH A;  1AZQ A;  5FLX E;  4RCO A;  4YWM A;  2F4V L;  3KDF A;  3EBE A;  3FPP A;  3I4L A;  4X64 Q;  2A5H A;  4ZQ3 A;  4XQN A;  3RNU A;  2VZA A;  2EYM A;  2F0G A;  4K8J A;  1STB A;  3BG3 A;  5C4X B;  2PNR C;  1XMQ L;  4A3M B;  3NSW A;  1S5B D;  1VQM A;  4XXE A;  2F52 A;  4UDU C;  1JMC A;  2YYZ A;  2CQA A;  5IT9 c;  2KHI A;  1SRU A;  3H09 A;  5I4D A;  5JPN C;  1KXL A;  1CHQ D;  1JOQ A;  2GVA A;  2E2I B;  2JXM B;  4DK1 A;  4OHJ A;  3MAQ A;  2QKI C;  3KF8 A;  4OWT B;  2H1E A;  3F8T A;  3JC6 6;  5JVG 3;  5D14 A;  1F2M A;  3OWF A;  2Z4I A;  2BOS A;  2OCE A;  1Q8I A;  1TXY A;  4F8M A;  1OXV A;  1PH3 A;  3S2D H;  2IJ0 A;  4B9W A;  3CCS A;  2UUC L;  1CKM A;  3PO3 H;  2HD3 A;  4IO9 A;  4JYA Q;  1R4Q B;  2A6H C;  3U58 A;  1HTL D;  1HJP A;  5H1S E;  1OXS C;  1ZKO A;  4LWC A;  4N9P A;  2F0J A;  1EEF D;  3B6Y A;  1GXD C;  5M3F G;  2JA5 B;  2Q2T A;  4HMJ A;  4APV A;  4DV1 Q;  4LF4 Q;  4DAM A;  1PMR A;  4JV5 Q;  3FMC A;  3HOZ G;  4QMG A;  2UXC Q;  4OGQ C;  4R9W A;  4A3I H;  4M1U B;  4DR2 L;  2K05 A;  1B8A A;  3IAY A;  4DXF A;  2R7Z B;  1ONL A;  2PCF B;  1IBK Q;  2DUD A;  4C1N I;  1JOR A;  1H9S B;  1SMX A;  2VQE Q;  3PUZ A;  3DM3 A;  3MC0 B;  3WOE A;  1QCB D;  3HG9 A;  1PZI D;  2MO0 A;  2NUC A;  4O1N A;  1Y1V G;  3F2B A;  1F9S A;  1SFO B;  1WTR A;  3LGJ A;  3H91 A;  4IUN A;  2PYK A;  4FO2 A;  1JC7 A;  3AYH B;  4HSV A;  3T56 B;  5FJ8 G;  2SDF A;  3DWQ A;  1Q1E A;  5EQ0 A;  2F4I A;  3I2Z A;  4NXN L;  3TN2 A;  4OXP A;  1LTI D;  1J5E L;  3ND9 A;  1BKB A;  4WJ4 A;  5FO7 B;  5BR8 Q;  2K1B A;  2WB1 E;  2E76 C;  5GAE C;  1TWA H;  1KD1 C;  1WTW A;  1K8O A;  2QCP X;  1UUP A;  4IPD A;  1K3B C;  4DKA C;  4BBR G;  5LMU Q;  5BN5 A;  3KLS X;  1YNN C;  1N9W A;  4C2M H;  4EX5 A;  3W1G A;  2F3W A;  2K03 A;  4A93 G;  1L0Y B;  2ZTE A;  1IW7 C;  2F0S A;  2F0V A;  5I9P A;  3SK5 A;  2XRQ D;  1EYD A;  3FDT A;  3A8I E;  2SNM A;  1HPC A;  3DLL A;  4G7Z C;  3RN2 A;  4LUZ A;  3NK9 A;  2UXC L;  5FO9 B;  3K5M A;  3LWU A;  2WIN B;  2O5J C;  1EY8 A;  2GN5 A;  1M8A A;  1I94 L;  4JYA L;  1IBK L;  2AHO B;  4J6H A;  4GKK L;  3BS1 A;  4JI6 Q;  1IXR A;  4A3E H;  3K0X A;  1JT8 A;  3TP8 A;  2VQE L;  1QVG A;  1Z6H A;  2R6G A;  2EYF A;  5EGT A;  5IGG A;  3ERQ A;  4HN7 A;  2YU9 H;  3K5N A;  4DV1 L;  3J80 i;  4QIW B;  1PZK D;  3PO2 G;  2NN6 H;  2D0O A;  1X3G A;  2MQH A;  3GTO B;  1XNQ Q;  3VYU A;  3H0G B;  3CHB D;  5IP9 H;  2K14 A;  1KHI A;  1RCV D;  3RUZ A;  3Q23 A;  1TS5 A;  5DNF A;  5IGE A;  1PH9 A;  2ZTC A;  5C44 B;  1O7Y A;  3TRZ A;  5CV9 A;  5EPJ A;  1ZXT A;  1S4Z A;  3A5Z B;  3NBI A;  1KL9 A;  1XNR Q;  3NPP A;  3ULL A;  3HOY G;  1PTO H;  1E1T A;  1HUM A;  3I55 A;  3IFD A;  3K6O A;  1DM0 B;  1BQQ T;  3RZO H;  2JYO A;  4DV4 L;  2RDF A;  2XSC A;  4XQQ A;  3IL8 A;  5IYC G;  3PIO 3;  1RF2 D;  1D8L A;  3K59 A;  4B08 A;  4JBW A;  1QWY A;  1KAA A;  1RTO A;  4I7Z C;  1E22 A;  2XIW A;  4TVA B;  1LT4 D;  4RGT A;  3JAM E;  3M4P A;  5IOC A;  2UXD L;  1ENF A;  1ML0 D;  2E2H H;  3GP7 A;  1P8L A;  2EY6 A;  2CH4 W;  4V0B A;  1GUW A;  1PH7 A;  5K36 H;  2B39 A;  4PZ7 A;  3P20 A;  4CDD C;  4B3R Q;  4CKE A;  3HOV G;  2L12 A;  2DNC A;  2KCT A;  4DFA A;  2BDO A;  4GZY C;  1YNJ C;  3I7F A;  1PFN A;  5E4X A;  2QIL A;  3J7A 5;  2JEB I;  5J1Z A;  1QE6 A;  1HNW L;  1GO3 E;  1UWV A;  5EBC A;  3V05 A;  5G3L D;  3NBH A;  3P75 A;  1ET9 A;  1I4X A;  1QJO A;  3AEV A;  3OIQ A;  3J80 c;  2LFN A;  4R4T A;  1BBW A;  3S24 A;  4ZKC B;  3L0O A;  5C3E H;  1ILP A;  4DV6 Q;  5CMD A;  3F2C A;  1SYD A;  2BA0 A;  2LXK A;  3S1R B;  5CYU A;  4A3J G;  4KD3 A;  5COY A;  5IT9 L;  1IL8 A;  2E2J B;  3E6Z X;  1EU4 A;  3N6R A;  2Q8I B;  4FVM A;  1L0X B;  4HJ8 A;  4DR3 L;  3CC2 A;  2BE5 C;  2PZT A;  1YJN A;  4RKB A;  4JI4 Q;  1EY6 A;  2EY5 A;  5A35 A;  1HRJ A;  1KDB A;  2I5H A;  1XMQ Q;  1DXM A;  2V1C C;  4A3D B;  4FF4 A;  1SSO A;  5ELO A;  1IYV A;  3BVM A;  3G7L A;  2N55 A;  3TDQ A;  1J6Q A;  1ENA A;  3GV3 A;  3MFG A;  2RHQ B;  4DA2 A;  1LT3 D;  3CC4 A;  1HZA A;  2JA8 G;  2BH2 A;  2JA7 B;  1ZYR D;  1CA6 A;  1BBX C;  1GUN A;  1TWF B;  4EQP A;  1UAP A;  5JJL A;  1T5E A;  1M1K C;  1A15 A;  4ILW A;  1ENC A;  1K8A C;  3M4Q A;  1KRT A;  4FF1 A;  4HED A;  1GHK A;  1ET6 A;  1ROD A;  2HHH L;  1KDC A;  2VUM H;  1JE5 A;  3HP3 A;  4R4Q A;  1FL0 A;  2EPB A;  2QW7 A;  2RHS B;  3G48 A;  4KTA A;  2KCC A;  4A93 H;  1YI2 A;  4KHP Q;  3OTO L;  5C5L A;  1EY4 A;  3H0G H;  2F0Q A;  1VQ9 A;  3I4N G;  3HOW B;  1KAW A;  1VQB A;  2VNU D;  4KD4 A;  1YEZ A;  2QGQ A;  1LTA D;  2YTY A;  1GUS A;  4ODG A;  4EGV A;  5M5W B;  4DUZ L;  1YZ6 A;  2B2V C;  5LMU L;  5JAV A;  2O5I C;  2EJG C;  3SK4 A;  4X3S A;  5C4J H;  1BR9 A;  2QDL A;  3LNN A;  4DV4 Q;  1AH9 A;  2MUY A;  1FNW A;  1EOT A;  2B2U C;  1CSP A;  2IX3 A;  5DEH A;  4G7H C;  1LTG D;  1GJX A;  1CK1 A;  3J81 L;  1Q81 C;  4DV3 Q;  4DR7 Q;  4N9T A;  3GTQ H;  4UPA A;  3OW2 A;  2F0I A;  3KK7 A;  2DNE A;  2L15 A;  2BDN A;  1T9H A;  1TWF H;  1YNX A;  3HOX H;  1PHJ A;  1B1Z A;  2NVT B;  3OMC A;  4FXD A;  1A2T A;  2QF7 A;  3CCU A;  4MIU A;  1TWH B;  1DD2 A;  4MN3 A;  3F2U A;  3D3R A;  4PZ6 A;  1VQP A;  3HKZ B;  4KV6 A;  1LTL A;  5F2D A;  3KBG A;  1V43 A;  1X56 A;  1VQL A;  2D5D A;  1PRT D;  1WYD A;  4HJ9 A;  1HCZ A;  1HR0 Q;  1D2B A;  4DV0 Q;  2M9V A;  4DU9 A;  1STE A;  1NCV A;  2F0U A;  1CKO A;  2EYL A;  1R9T H;  2AUK A;  1EZ6 A;  4DUZ Q;  1FNV A;  2J7Z A;  3UDG A;  3SR1 A;  2CVR A;  4RCN A;  2WKC A;  1SEB D;  5C44 H;  2VL6 A;  2IHE A;  3BU2 A;  5CC4 A;  5FO8 B;  3CU7 A;  1ZYR C;  4POG A;  4DR4 L;  1TY2 A;  3CRK C;  4B3T Q;  3MWY W;  2UUC Q;  4JG2 A;  1D5M C;  4MHE A;  5BN4 A;  4MTN A;  2EYP A;  1STY A;  4KK7 A;  2F3I A;  2YTX A;  1AN8 A;  3A56 A;  1YNJ D;  1N34 L;  1EWH A;  2GVB A;  4IZ8 A;  3SVM A;  4JOI C;  4KKS A;  5IOD A;  2F03 A;  4BY7 B;  2BA1 A;  1EQR A;  1VQF A;  2EE1 A;  5IE8 A;  1Y1W G;  2B8G A;  3BDC A;  1XJV A;  4CDC C;  3R93 A;  4CHT B;  5KRU A;  1WD0 A;  4JV5 L;  5L37 A;  1I4G A;  5IT9 E;  1N32 L;  4LW1 A;  1DOK A;  2ID0 A;  2NZO A;  4BXX G;  3DHQ A;  4L63 B;  2K7V A;  3R3O A;  1JE4 A;  4YHH L;  4JI5 L;  3UI2 A;  5K36 G;  4PMB A;  1I5F A;  2KOL A;  3TZU A;  3HOZ B;  1I4P A;  2HQE A;  2XNA C;  1X9N A;  2EJM A;  1H9M A;  4A3F H;  4Z9C B;  1VQE A;  4GNX A;  1Y14 B;  4X3K A;  3VA7 A;  1KRS A;  4JBM A;  2ZXO A;  1CM9 A;  1QVC A;  2PQA A;  2EZV A;  4K0K L;  5C4X H;  4X3U A;  5CGK A;  4DV2 Q;  3VYT A;  2RVL A;  3KUP A;  1FYC A;  3HOW H;  4A3G H;  4LF5 L;  1LUZ A;  1EWI A;  1P16 A;  1WTV A;  4NXM Q;  5M5X B;  1LM0 A;  3QOJ A;  1J5E Q;  1X3P A;  3Q24 A;  3M4O H;  4OO1 H;  2QEJ C;  1FD7 D;  2E75 C;  3R8B A;  1H95 A;  2QA4 A;  2A74 C;  3X3M A;  4DUY Q;  3W1B A;  3GTG H;  3GQB A;  2F0E A;  3ITP A;  1F9P A;  3IRB A;  3R2T A;  1MHW C;  4JI0 Q;  4UHV A;  2G5D A;  4YCW A;  4DR5 L;  1NMF A;  4K6L A;  4C3H H;  4QUF A;  4IOA A;  4BY1 B;  3S1N H;  3S14 B;  4NP5 A;  1HZC A;  4YY3 Q;  1N32 Q;  1SNO A;  2IX1 A;  2K5H A;  3D31 A;  3GTM B;  1GM5 A;  1TWG B;  3I4N H;  2HT1 A;  1VQ6 A;  2JA7 H;  5J39 A;  5KNC A;  3A5U A;  1LT6 D;  1VF5 C;  4IAL A;  4GNX C;  5CV8 A;  2OF1 A;  2CW0 C;  3J7A V;  4OO1 G;  2L55 A;  4FXG C;  1HZ9 A;  1KAB A;  4AQY L;  1QOH A;  4K0K Q;  1O7I A;  1V1P A;  4ABN A;  5IYB H;  3PF4 A;  1VQC A;  1IBL Q;  4B3M L;  1A3U A;  3M7G A;  4A3G B;  1QNK A;  4ZK9 B;  4GS3 A;  1Z47 A;  3KFU A;  1EY7 A;  1IHZ A;  1KLU D;  3D4W A;  4KI0 A;  4BBS H;  1H9J A;  1V9P A;  4HCE A;  5FLM H;  5LL6 S;  4IQZ A;  4NW2 A;  4X62 L;  4RFB A;  1Z7T A;  4J8Q A;  3GTG B;  2OXP A;  4A75 A;  3SGI A;  3I4M B;  2SOB A;  3EJI A;  2Z8L A;  2CFM A;  4IPH A;  2LS0 1;  3V2T A;  4CJ0 B;  1CKN A;  1O7L A;  1Y1V H;  3S1N B;  1BCP C;  4DV5 Q;  4R8N A;  2FMM A;  4A3J H;  2WFW A;  4R4I A;  1B53 A;  1IKL A;  4WOR A;  3GTO H;  4RAU C;  4KMU C;  2MO1 A;  1A3V A;  4DAY B;  4TQU S;  4ZUJ A;  1BVS A;  4A3B B;  3TP6 A;  1K73 C;  3NQI A;  1L1O A;  1VDZ A;  4QUC A;  4OIK A;  3NBH B;  3IKJ A;  1NY4 A;  1BF4 A;  4K6D A;  4R1J A;  3SDZ A;  4PMC A;  2ZJQ A;  1EYA A;  1Y8P B;  2VY3 A;  2ZTD A;  4L5Q A;  1EQQ A;  4L5R C;  3PCO B;  3OPO A;  1N33 Q;  4YIJ A;  1TT2 A;  1JOO A;  3PUY A;  3QWN A;  1A0I A;  2I0Q A;  1EEI D;  5CV7 A;  2IL8 A;  1TWH H;  1F2L A;  3K80 C;  4IOC A;  4WJW A;  2FIN B;  4KHV A;  4MZ9 A;  3OHX C;  5ELN A;  5C3W A;  5KGU A;  3K5O A;  3AFQ A;  3P7J A;  4JVZ A;  3OMG A;  1PZJ D;  4ID6 A;  3P1H A;  1G29 1;  2TMP A;  2AWO A;  3ZYY X;  1NMG A;  5LHY 1;  1JB7 A;  4JBK A;  2FFK B;  1CUK A;  4IFD G;  2R92 B;  1XTD A;  4DR6 L;  2E2H B;  2BCO A;  1BCP B;  3A54 A;  4LNQ A;  3S15 H;  5C5M A;  2MJ8 A;  5A2Q E;  4JI1 L;  1X54 A;  2VUM G;  5IYB G;  1WCM H;  5HY6 A;  2QDB A;  1NAP A;  3VR6 A;  3HOX G;  3CCM A;  2ZT9 C;  4WFN 3;  2D9U A;  2B63 B;  1JJG A;  2B2Y C;  3A74 A;  4AYB B;  3CF5 A;  2EY2 A;  1STA A;  1YBY A;  1G8Z D;  2Z6B A;  4HJ7 A;  3KF6 A;  3HOY H;  1EUJ A;  2KHS A;  2ZM6 Q;  1IBM Q;  3U50 C;  1K8M A;  3K58 A;  4R8I A;  1V1Q A;  1AP0 A;  4F88 A;  1SMY C;  2DY8 A;  1D5Z C;  3FKI B;  4K8I A;  1KTK A;  3TEH B;  4DAY A;  1A3T A;  1SYF A;  3G6J B;  5JEA H;  3CW2 C;  3RD4 A;  1QZG A;  3HOU H;  2ZXP A;  2JA9 A;  2HQL A;  3D4R A;  2K4K A;  1GD7 A;  4C3I G;  4F7X A;  4JI6 L;  3QJY A;  1SE8 A;  4IFD J;  4POF A;  4QY7 A;  4RWS C;  4A3E G;  2UUA L;  4NXM L;  3J80 L;  4NXN Q;  4KHP L;  4CBV A;  2VB2 X;  2Z6K A;  2PQE A;  4IJL A;  2K50 A;  2YU9 B;  4L5T A;  2PI2 A;  4QF4 A;  1WD1 A;  4JCV E;  4RA8 A;  3CAM A;  1VQ7 A;  3STB D;  1S5F D;  4RHR A;  4KJO A;  1S5D D;  2AQ1 B;  5C3X A;  3PUX A;  1NE3 A;  4HR7 B;  4DR6 Q;  1HR0 L;  3DM1 A;  1UE1 A;  1B3Q A;  1M4V A;  4A4I A;  2LKV A;  1Y69 U;  3X3N A;  3DUZ A;  3HOW G;  1K28 A;  1LYL A;  1X65 A;  2YTV A;  4YHH Q;  2G9H D;  3KLW A;  3BVZ A;  1PVO A;  2EQS A;  1L1O B;  2XGT A;  2AUJ D;  2PNH A;  2MFI A;  3GD7 A;  3MEH A;  3UE0 A;  1OXT A;  2WII B;  1F77 A;  4X6A H;  2L9H A;  3CCQ A;  4CGY B;  3BVG A;  1JIC A;  1EIF A;  2CW0 D;  1BXT A;  3EA6 A;  4C3J G;  3S17 H;  5I2Y A;  2EXZ A;  2NYZ D;  4BXX H;  3M3Y B;  4P72 A;  4GOP A;  1STH A;  1RKN A;  2H5X A;  4IPC A;  4UP7 A;  1CTM A;  4DNT B;  1SYB A;  2XRS D;  2N8N A;  2NZ1 D;  1PTO C;  2F0P A;  2EVB A;  2LXJ A;  3KLR A;  2F3V A;  4RH6 A;  3W2D A;  4JI7 Q;  4LK1 C;  2WP8 J;  1Q8K A;  4OWW B;  4JOI A;  2IY5 B;  5C4J B;  2KCN A;  4K5W A;  1YJ9 A;  4LF9 L;  3HFZ B;  4LF4 L;  4IUQ A;  3DEO A;  4DV0 L;  4IFD I;  5FK9 C;  3HKZ G;  1HNW Q;  3I90 A;  2WAQ G;  3EVQ A;  2F0H A;  2B2W C;  2LSS A;  4C3H G;  2HIV A;  2NTT A;  3MEF A;  3OW7 A;  3OYY A;  2OQ0 A;  3PQI A;  1XPO A;  1XWE A;  5KIX A;  2K75 A;  5IYD H;  5IWA L;  3LWE A;  3T53 B;  5JOB A;  2N88 A;  2JA5 H;  3FHW A;  3LX0 A;  4HIM A;  2PZU A;  2E5L L;  4N8F A;  3TME A;  3FVQ A;  3S1R H;  2HCC A;  5JJZ A;  2C35 B;  4RKL A;  1SN8 A;  4A3F B;  3KDF B;  4A3L G;  2MGS A;  3NEM A;  5I6Y A;  3I72 A;  1PLF A;  2FXQ A;  3BYT B;  2WB1 B;  1RDP D;  2VXW A;  3CRL C;  3A7L A;  4JPB W;  1SNP A;  1HH2 P;  3M4O B;  1NR4 A;  4X65 L;  4YCU A;  5AFW A;  1YJW A;  3G6E A;  4KY5 A;  3MXN B;  3GTP H;  2N3S A;  4A3B H;  1SE3 A;  4DXG A;  2UU9 L;  1SNM A;  1XNR L;  1JQY D;  2RQX A;  3T1H L;  1U4L A;  3PO2 H;  2A6E C;  2EOT A;  3S9W A;  4PZ8 A; 
#chains in the Genus database with same CATH homology
 1FJG L;  1PH5 A;  1WJJ A;  2RF4 A;  1R9T H;  3S2H H;  4NB3 A;  4LFC Q;  4YWL A;  4O0A A;  4QIW E;  4DUZ Q;  4A3M G;  2NVX H;  1NTG A;  4LFA L;  5LMN W;  3UDG A;  2R93 G;  5GAD C;  1VQD A;  3H3V H;  2YV5 A;  3RLN A;  3CQZ H;  4BBR H;  4AQY Q;  5C44 H;  2VL6 A;  4P71 A;  4A3K H;  1A62 A;  1EOV A;  1UE6 A;  2QEX A;  2IHE A;  4C3J H;  1RIP A;  3BU2 A;  5M3M H;  2JJQ A;  2NVY H;  4IJH A;  1VQO A;  4JI3 L;  3J81 i;  4OX9 L;  2B63 H;  4GKJ L;  1EYG A;  1NJI C;  4POG A;  4DR4 L;  2Q2U A;  4DUY L;  4B3T Q;  3J81 c;  2UUC Q;  4JG2 A;  4JI2 Q;  2RCN A;  2EXD A;  2JK8 A;  3CP0 A;  3HKS A;  3I56 A;  2K52 A;  4DK6 C;  3H15 A;  1Q7Y C;  4MTN A;  2PQA B;  1GVP A;  4OX9 Q;  2NVQ H;  4DV6 L;  2VQF L;  2R92 H;  2F3I A;  2YTX A;  2N49 A;  1N34 L;  4JBJ A;  2GVB A;  4JOI C;  1SFO H;  2MNA A;  3M9B A;  3PUV A;  1VQI A;  2BA1 A;  1EQR A;  3GDE A;  3KF8 B;  5IP9 G;  1VQF A;  5IE8 A;  1QUQ B;  2Q2I A;  4DR5 Q;  5GAG C;  1Y1W G;  2NZH A;  2VQF Q;  1QZH A;  1Q12 A;  1XJV A;  1JJC B;  2CKZ B;  3TS2 A;  4JV5 L;  2F4V L;  4YWM A;  1N32 L;  4LW1 A;  5LMN Q;  3KDF A;  3EBE A;  4X64 Q;  3CCR A;  2ID0 A;  2NZO A;  3RNU A;  2VZA A;  4BXX G;  3CMA A;  1PA6 A;  5IP7 H;  3M3Y H;  2UXB Q;  2JA5 G;  3AQQ A;  4YHH L;  1HNX Q;  1XMQ L;  1DGS A;  2D62 A;  3JAM i;  4JI5 L;  3CCJ A;  5K36 G;  1I5F A;  2R93 H;  1VQM A;  4BY1 G;  2Z0S A;  4Y7N H;  3W5O A;  4ME3 A;  1U0L A;  1G6P A;  2WAQ E;  1XPR A;  1X9N A;  2F52 A;  2AKW B;  4A3F H;  1JMC A;  5JJK A;  3CME A;  1VQE A;  2YYZ A;  3STB C;  1Y14 B;  4GNX A;  4JI7 L;  3L7Z C;  1KRS A;  4JBM A;  5IT9 c;  4UP8 A;  2R7Z G;  1S40 A;  2KHI A;  1QVC A;  1SRU A;  2PQA A;  5JJI A;  2JA6 H;  4K0K L;  5C4X H;  1KXL A;  3ULJ A;  2GVA A;  4DV2 Q;  1Y1W H;  2D0P A;  1RL2 A;  5JEA G;  4DR1 Q;  3HOW H;  4OWT B;  4A3G H;  4LF5 L;  3F8T A;  1LUZ A;  1EWI A;  1P16 A;  3JC6 6;  4LFB Q;  2HIX A;  4NXM Q;  4DR7 L;  1E24 A;  2NN6 G;  1LM0 A;  2OCE A;  1J5E Q;  1IBL L;  1TXY A;  4DR4 Q;  3M4O H;  1OXV A;  4X66 L;  1PH3 A;  4JI4 L;  3UDX A;  3S2D H;  4BY7 G;  5FLM G;  2UUC L;  3Q8D A;  3CCS A;  1CKM A;  1H95 A;  3PO3 H;  3WWV A;  2QA4 A;  4IO9 A;  1YVC A;  3KOJ A;  1E1O A;  3BZC A;  4UY8 C;  4DUY Q;  3JAM c;  4BY1 H;  3W1B A;  1QVF A;  2I5L X;  3GTG H;  4JYA Q;  1I3Q H;  3U58 A;  1HJP A;  4WJ3 M;  5H1S E;  1X6O A;  1TWC H;  1OXS C;  1UEB A;  3IRB A;  4LWC A;  5AJ3 L;  1HR0 W;  4HJA A;  4A3G G;  5IP7 G;  2VS1 A;  3B6Y A;  4JI0 Q;  5M3F G;  4YCW A;  4YY3 L;  4DR5 L;  2Q2T A;  4APV A;  2CQO A;  3F1Z A;  4LUV A;  4DAM A;  1NMF A;  4DV1 Q;  5JEA J;  4DV7 Q;  1YIT A;  2UUB Q;  4DNI A;  4LF6 Q;  4C3H H;  4IOA A;  4JV5 Q;  2BH8 A;  5GAH C;  2F4V Q;  3HOZ G;  3S1N H;  2UXC Q;  4A3I H;  2K5N A;  4DR2 L;  1OXX K;  1B8A A;  1HZC A;  2Y0S E;  4YY3 Q;  1HNZ L;  1IBK Q;  1N32 Q;  5LMN L;  2IX1 A;  2K5H A;  2DUD A;  3S1M H;  3T1Y Q;  3D31 A;  3I4M G;  1W2B A;  1VQA A;  1GM5 A;  1C7Y A;  1SMX A;  2VQE Q;  3I4N H;  2UXD Q;  3S1Q H;  2NVT H;  3PUZ A;  3RLF A;  3DM3 A;  2HT1 A;  1VQ6 A;  2JA7 H;  3A5U A;  1AE3 A;  3CCL A;  4GLX A;  1A63 A;  1L1O C;  2MO0 A;  3CXC A;  1Y1V G;  3F2B A;  3KYH C;  4GNX C;  4BBS G;  2I5M X;  4OO1 G;  1JJ2 A;  3ERS X;  1N36 Q;  3LGJ A;  1TWG H;  1HZ9 A;  4AQY L;  2B3G A;  4K0K Q;  1B7Y B;  3AYH B;  1O7I A;  2Z6K C;  4L5S A;  5FJ8 G;  1SLJ A;  1Q1E A;  5IYB H;  4LF7 Q;  3PF4 A;  1VQC A;  4A3B G;  4A76 A;  1PH8 A;  3I2Z A;  4NXN L;  1PH2 A;  1J5E L;  4OXP A;  2Q2H A;  4GLA C;  1IBL Q;  4B3M L;  3BZK A;  1FJG Q;  3CCE A;  3AFP A;  3NEL A;  1BKB A;  4WJ4 A;  3EN2 A;  4AH6 A;  5BR8 Q;  2DGY A;  4GS3 A;  2WB1 E;  1Z47 A;  3KFU A;  4BBS H;  4KI0 A;  5GAE C;  4P75 A;  1TWA H;  1V9P A;  1KD1 C;  4BY7 H;  5FLM H;  1AE2 A;  4QL5 A;  2R7F A;  3U4Z A;  4X62 L;  1N34 Q;  4IPD A;  3PV0 A;  1VQG A;  3PIO A;  4DKA C;  4BBR G;  5LMU Q;  5C44 G;  3RLO A;  4A75 A;  1C9O A;  3CCV A;  1N9W A;  1YHA A;  3SGI A;  4C2M H;  4EX5 A;  4A3L H;  3W1G A;  4A93 G;  2ZTE A;  2CFM A;  4H02 A;  3F2D A;  4IPH A;  2JA6 G;  4LUO A;  3U4V A;  1ASZ A;  2IHF A;  4X64 L;  3DLL A;  3RN5 A;  1CKN A;  2N78 A;  2JA8 H;  3RN2 A;  4LUZ A;  3M85 A;  4X66 Q;  2ZJR A;  1Y1V H;  5M5X H;  2UXC L;  4DV5 Q;  4R4O A;  1A8V A;  5J3B A;  1IL2 A;  3KJO A;  4A3J H;  2GN5 A;  2WFW A;  4R4I A;  1UE7 A;  5M3M G;  1I94 L;  4JYA L;  1IBK L;  2AHO B;  3GTO H;  1W3S A;  1ASY A;  1EFW A;  4GKK L;  2MO1 A;  2ZM6 L;  1IXR A;  1IBM L;  4JI6 Q;  2KHJ A;  4A3E H;  3K0X A;  4GOP C;  4DAY B;  5AJ3 Q;  2R7D A;  4TQU S;  5C3E G;  1BVS A;  2VQE L;  1QVG A;  1JT8 A;  2R6G A;  1K73 C;  1L1O A;  2YU9 H;  4B3S L;  4DV1 L;  3J80 i;  3NBH B;  1NY4 A;  4R1J A;  1KQS A;  2PI2 E;  4HIK A;  2B63 G;  3PO2 G;  2ZJQ A;  2MQH A;  2D0O A;  1X3G A;  3KJP A;  1X55 A;  1XNQ Q;  4AYB G;  4L5Q A;  2VY3 A;  2ZTD A;  4DPG A;  1EQQ A;  4L5R C;  3PCO B;  5IP9 H;  2K14 A;  1KHI A;  1N33 Q;  3PUY A;  1A0I A;  1Q86 C;  2I0Q A;  2AMC B;  1PH9 A;  3L2P A;  1K0R A;  3T1Y L;  1MKH A;  1TWH H;  2ZTC A;  3K80 C;  4IOC A;  3H3V I;  4LFC L;  2HHH Q;  3TRZ A;  1E7Z A;  4MZ9 A;  5ELN A;  1WI5 A;  3AFQ A;  1UE5 A;  1PH1 A;  2NN6 I;  3A5Z B;  4GOP B;  2E2I H;  4A3D H;  1G29 1;  1KL9 A;  1PV4 A;  3ULL A;  1XNR Q;  3HOY G;  1E1T A;  2VW9 A;  2AWO A;  4QQB X;  1NMG A;  3I55 A;  1JB7 A;  4JBK A;  3S14 H;  1CUK A;  4IFD G;  3PGZ A;  4YCV A;  1XTD A;  3I4M H;  4RG1 A;  1VCI A;  3ER0 A;  4JI1 Q;  2OQK A;  3RZO H;  4GN3 B;  4DR6 L;  4DV4 L;  1IYJ B;  2K5V A;  4PG3 A;  5IYC G;  4LNQ A;  1D8L A;  3S15 H;  4JBW A;  1PYS B;  5FLX c;  1VQ4 A;  3UDI A;  1WFQ A;  4GKJ Q;  4JI3 Q;  1K8G A;  1E22 A;  4TVA B;  1M90 C;  1XPU A;  4JI1 L;  1X54 A;  2VUM G;  5IYB G;  3J7Z C;  2ES2 A;  3M4P A;  5C0X G;  1WCM H;  4DV2 L;  5HY6 A;  1YHQ A;  4B3T L;  2UXD L;  4O2D A;  3CCM A;  3I4O A;  3HOX G;  1EIY B;  2E2H H;  1D7Q A;  4GKK Q;  1P8L A;  1JJG A;  4DR1 L;  4LF8 Q;  3A74 A;  1PH7 A;  3CF5 A;  3H0G G;  3PUW A;  3RZD H;  1FVI A;  1YBY A;  4PZ7 A;  4HJ7 A;  3KF6 A;  3HOY H;  5C4X G;  1EUJ A;  2ZM6 Q;  1IBM Q;  4B3R Q;  2Y0S G;  4DV3 L;  3T1H Q;  1NBW A;  1VS0 A;  3U50 C;  3HOV G;  1PYB A;  2KCT A;  1V1Q A;  3GTK H;  3I7F A;  1CSQ A;  1XNQ L;  2A19 A;  1L0W A;  3BJU A;  4QJF A;  4OO1 I;  3TEH B;  3GTM H;  1MJE A;  2IX0 A;  3J7A 5;  1PH6 A;  2JEB I;  1MIU A;  1U5K A;  4LF4 Q;  3CW2 C;  2XTI A;  1HNW L;  5IY0 A;  1GO3 E;  1QZG A;  4JI0 L;  1UWV A;  3HOU H;  1C0A A;  4A3I G;  2JA9 A;  3E9H A;  3EIV A;  2HQL A;  4GN4 B;  2K4K A;  1GD7 A;  2R92 G;  1IZ6 A;  3NEN A;  4JI6 L;  5EAY A;  3HKZ E;  1SE8 A;  4IFD J;  3PO3 G;  3AEV A;  4POF A;  4A3C H;  4QY7 A;  4DR2 Q;  3J80 c;  4BA1 I;  4R4T A;  1BBW A;  2KCM A;  4A3E G;  3S24 A;  2UUA L;  4LF5 Q;  4LFB L;  3L0O A;  5C3E H;  4NXM L;  3G71 A;  4DV6 Q;  2ATW A;  1MJC A;  1SR3 A;  4NXN Q;  4KHP L;  3OTO Q;  2Z6K A;  4IJL A;  2K50 A;  4L5T A;  2PI2 A;  3VDY A;  3F2C A;  5FJ8 H;  2BA0 A;  2LXK A;  4JCV E;  4HJ5 A;  2KBN A;  4DR3 Q;  3K7U C;  4A3K G;  3CAM A;  1VQ7 A;  4A3J G;  4OON A;  3STB D;  1N33 L;  5C0X J;  1L2F A;  3PUX A;  1NE3 A;  1VQJ A;  4DR6 Q;  4RMF A;  4AYB E;  1HR0 L;  1VQ8 A;  1VQK A;  1KIX A;  3GTL H;  1UE1 A;  5IYC H;  4MNO A;  4HJ8 A;  4DR3 L;  3CC2 A;  1K3R A;  4A4I A;  1X3E A;  1S3O A;  4QGU A;  2CCZ A;  4KHZ A;  1YJN A;  3HOW G;  2JE6 I;  1LYL A;  1X65 A;  4JI4 Q;  2YTV A;  3E9I A;  4OWX B;  4JI2 L;  1PFS A;  2UUB L;  4YHH Q;  2I5H A;  1HNX L;  1XMQ Q;  3KLW A;  3ZJY C;  1PVO A;  2EQS A;  1L1O B;  2V1C C;  2XGT A;  3FKI G;  2PNH A;  5ELO A;  2E5L Q;  2KEN A;  2MFI A;  3GD7 A;  1J6Q A;  3UE0 A;  3CPW A;  1HNZ Q;  1SRO A;  1KC8 C;  1OXT A;  1X3F A;  3K8A A;  2RHQ B;  1QUQ A;  5HGQ A;  3CC4 A;  4BA2 I;  3FP9 A;  1HZA A;  2IT1 A;  1Q82 C;  2BH2 A;  2JA8 G;  2JEA I;  4X6A H;  2PMZ E;  3M7N A;  3CCQ A;  2OWO A;  4DV7 L;  4LF6 L;  4JC0 A;  5JJL A;  1M1K C;  1EIF A;  3FKI H;  1N8R C;  4EQ5 A;  3S17 H;  4JI8 Q;  5M3F H;  1K8A C;  3M4Q A;  3ULP A;  3K7A H;  1KRT A;  3KF6 B;  4BXX H;  1YIJ A;  3K81 C;  4HIO A;  3UE1 A;  2HHH L;  4NPS A;  4P72 A;  1Z9F A;  4GOP A;  4B3S Q;  2VUM H;  2H5X A;  4Y52 H;  1JE5 A;  5GQO A;  4A3M H;  1N36 L;  4IPC A;  4LF8 L;  4UP7 A;  4HID A;  4R4Q A;  3E0E A;  3HOZ H;  3UDF A;  2R7Z H;  1FL0 A;  2N8N A;  2RHS B;  3G48 A;  2UUA Q;  4LF9 Q;  4A3C G;  4A3F G;  2LXJ A;  1B70 B;  1Q1B A;  4A93 H;  1YI2 A;  3ICE A;  4KHP Q;  3OTO L;  5M5W H;  4JI7 Q;  1WOC A;  1BBU A;  2WP8 J;  3H0G H;  4ALP A;  1Q8K A;  4PMW A;  1E3P A;  3J81 j;  4OWW B;  4JOI A;  1I94 Q;  1VQ9 A;  3I4N G;  4AIM A;  2IY5 B;  4KLK A;  1KAW A;  1YJ9 A;  2OTJ A;  1VQB A;  4LF9 L;  1XMO L;  1OTC A;  2VNU D;  4JI5 Q;  1YEZ A;  2WB1 G;  2ALY B;  3HFZ B;  4LF4 L;  2UU9 Q;  4DV0 L;  3GTJ H;  4IFD I;  2QGQ A;  1VQ5 A;  3HKZ G;  2E2J H;  1CKO A;  4A3D G;  2YTY A;  1HNW Q;  2A1A A;  2ZJP A;  3A0J A;  1FGU A;  2WAQ G;  2ASB A;  2LSS A;  5IWA Q;  4DUZ L;  1YZ6 A;  5LMU L;  4B3M Q;  2HIV A;  5M5Y H;  1XMO Q;  1HZB A;  2E8G A;  5C4J H;  4GNX B;  3OYY A;  3MEF A;  2JA7 G;  2OQ0 A;  5BR8 L;  1VQN A;  1XPO A;  4DV4 Q;  1AH9 A;  4FDB A;  2K75 A;  5C0X I;  5IYD H;  5IWA L;  3D0F A;  1CSP A;  2EIF A;  3CPF A;  2JA5 H;  3FHW A;  1Q81 C;  4X62 Q;  4DV3 Q;  4B3R L;  3PIP A;  1PH4 A;  4DR7 Q;  3RR5 A;  3GTQ H;  4UPA A;  4HIM A;  3OW2 A;  2E5L L;  3TRE A;  4J15 A;  4C3I H;  3S1R H;  1K9M C;  2L15 A;  3TQY A;  1YHB A;  3HOU G;  1T9H A;  2C35 B;  5IYD G;  3PF5 A;  1SN8 A;  3KDF B;  1TWF H;  1YNX A;  3NEM A;  4A3L G;  3HOX H;  1PHJ A;  4LF7 L;  1I50 H;  2CWP A;  3G4S A;  4DV5 L;  1K83 H;  3CC7 A;  1OXU A;  1VQH A;  3PSI A;  2FXQ A;  4X65 Q;  4R4C A;  4XIG S;  2A8V A;  5E7N A;  3TS0 A;  1S72 A;  3CCU A;  3S16 H;  3HOV H;  4GLV B;  5GRO A;  4PZ6 A;  4XTC S;  1VQP A;  4YWK A;  1GKH A;  1LTL A;  4IPG A;  1V43 A;  4P74 A;  1HH2 P;  1CKN B;  1X56 A;  4X65 L;  4UP9 A;  4YCU A;  1YJW A;  1VQL A;  3G6E A;  2UXB L;  3MXN B;  4DK3 C;  2OTL A;  1WYD A;  4HJ9 A;  3GTP H;  2N3S A;  3CD6 A;  1G51 A;  4A3B H;  4P73 A;  2AWN A;  4JI8 L;  2UU9 L;  4GN5 A;  1WCM G;  4LFA Q;  1HR0 Q;  1XNR L;  1I6H H;  2CWA A;  2JQO A;  3GO5 A;  3T1H L;  4DV0 Q;  3PO2 H;  5DLQ E;  2B29 A;  4PZ8 A;  1Q46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...