3RLFA

Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
molecule keywords Maltose-binding periplasmic protein
total genus 106
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3rlfA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3rlfA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rlfA01
4MGIR 3FB4A 4I1OA 1EFRA 3KXLA 5DO9A 3CXCA 2QZ4A 2E75C 4BZPA 4R4QA 1DAKA 1XU4A 1V43A 1T5LA 4YMTA 1T5EA 2D7DA 4IFDH 3M4PA 5SZIA 4L16A 4FD2A 4RY2A 3WYFA 1JAHA 1GSIA 1QHHB 2VP2A 1Y3AA 1T4GA 3DL0A 4JVSB 4BFTA 1SVLA 4ZV4A 2EDGA 1UKZA 1D2NA 3RANA 5GADC 3EZFA 1Q81C 1HPCA 1G17A 1GITA 4PC1A 4CEHA 4YC7A 4DR2Q 4HAUA 2AFHE 1E2KA 2J46A 1HNZQ 4NL4H 3GJXC 4M0LA 1I6VC 3C16C 3S1AB 3PEWA 2W58A 1G64A 1NBMD 4MDFA 2WSSD 2FFBA 1IW7D 1PYBA 3E9HA 4R98A 2E2IH 3N70A 4GPTA 2UU9L 3UDGA 4BEBA 4OJQA 3PFIA 1S1CA 3NEYA 1DEKA 3JZAA 4GN5A 1FJGQ 1VG1A 2KBEA 4BXXG 3UDFA 1JBKA 1L8QA 1DXMA 3NBYC 4MH0R 3KZ1E 2O0HA 1U81A 1SZPA 3B1VA 1G51A 1SE8A 1TWCH 1A6XA 1VQAA 3H4MA 3P4YA 3BZCA 3SHFA 3B1XA 5EE9A 3UK6A 4CEHB 4KCGA 2REOA 1Z06A 1ZP6A 3GJ6A 4JL6A 5EUMA 2MFIA 3R9XA 4K0KL 1N5JA 2J0VA 5G40A 2ASBA 1W44A 1Z47A 1VQFA 1TF2A 2AKYA 1HR0W 2O5VA 4HZUA 5H70A 3PCRB 3QSYA 1IONA 1R7RA 2GJAA 2ZQ5A 3U3KA 4QC2A 2KHIA 2CLSA 2VH5R 1Q44A 1FTNA 3CX8A 1ANKA 2JATA 2A7QA 3WMFA 3BDOA 2PCJA 2MNAA 2QPAA 1MR3F 3TQYA 2BOVA 5HGQA 3NIBA 2F9LA 5IT5A 4LF4L 1W49A 2RH5A 4JYCA 2VW9A 1C7YA 1H8ED 2J9RA 2ALYB 4DT1A 2XTMA 3HOXG 3BH7A 2ZRPA 2I5HA 4RZ2A 5C2JB 1WBDA 1SLJA 1PVOA 1BS1A 1AKEA 4LF6Q 4H1UA 4X65L 1X8KA 1Z6TA 2WIBA 4KSCA 1KYIA 4B33A 4XVQA 2XB4A 4NKRA 2HT1A 1SFOH 5BYKA 4B34A 1E2ZA 5DIFA 4A2QA 3QXXA 1H95A 4UNPA 2WTUA 3MGCA 4LYHA 3OW2A 4Z51A 1OH8A 2AD1A 4TTPA 4JVMA 2DY1A 4V02A 421PA 4OWTB 5L8VA 4A3FH 4ESHA 1N0WA 4DK1A 3CPEA 3A8JE 1AK2A 1SXJD 4YHHQ 5L3QA 121PA 1QBKC 1S96A 1ZIOA 2J0UA 5J40A 2K4KA 2FE4A 1IXRA 4ASUD 1GKUB 1N36L 3RDPA 3K1JA 4YONB 3E1SA 3I5XA 4QIWE 4Z54A 2CXXA 3X1WA 5DH9A 1DG3A 2R6DA 2VEDA 2QT1A 4DNTB 1GO3E 3IHLA 4FWIB 4HB3A 4PTLA 4WXRA 5E95A 3SJBA 3OZXA 2E2HH 3DMNA 3T1HQ 3C5CA 4A15A 2ZRJA 5BN4A 2OXCA 5KSPA 3ONWA 3TUZC 2UZIR 4ALPA 3EASA 1OW3B 3M0EA 4PXAA 1ZNWA 4BRWA 3OESA 1QZGA 2ASEA 3E5HA 2YV5A 3DO6A 4DV0L 5F3WB 3U50C 1A2BA 2PLFA 4JLVA 2E1RA 1KI4A 4ME3A 1YVDA 2BDTA 1LVGA 2F3TA 4M1MA 2IL1A 4TQUS 4L8GA 3VR1A 4BFXA 3F2DA 5EE0A 4X64Q 1XXHA 2PMKA 3EZ2A 2IY5B 1IQPA 1ELOA 3IGFA 1I5FA 3WYGA 5EXXA 3KQNA 3PXGA 1VQ8A 4Q1CA 3Q9LA 4LF9L 3PEVA 3SZRA 5CB6A 4BGDA 5DISB 5L3SA 1U8AA 3FFBA 4C2UA 2BMJA 2IHEA 1NVXQ 4OQNA 1JR3E 3UANA 1IBKL 2ONKA 1D6JA 4DIEA 5K36H 6Q21A 4D82A 1K3RA 3MD0A 3G5UA 3RR5A 2FV8A 1V1QA 1JB7A 1G41A 3KKPA 2J45A 3T53B 3CNOA 1GKIA 4JIMA 2A5YB 5IRCD 4HB4A 1S72A 2QP3A 3TSWA 5JWHA 1Y14B 1GRNA 4KSBA 2QRZA 1AZSC 5F9HA 3DEFA 1VHTA 1MJEA 4A3CH 3BB1A 3I2ZA 1AKYA 3BK7A 4BLPA 4ZI2A 2WZQA 4EQ5A 5FPYA 2JLXA 2B63H 4D4KA 1EWQA 1C1YA 1ZJ6A 2WP8J 4KODA 3RRNA 2D0OA 4GOXA 4MKHA 3FMCA 3PSIA 3WNCA 4O3MA 4OI0A 3CW2C 2CBZA 2J0UB 1ZD1A 2B6HA 3BWDD 2J59A 3LX5A 3QE0A 3SBEA 4QY7A 4M9ZA 1HNWL 1X86B 4XSHA 4OBEA 4EPVA 1DBSA 1NN0A 1BKBA 5KDOA 4TL8A 2PL3A 1DAHA 2MSCB 4ZDJA 4BFZA 2JLRA 4ZKEA 3A8KE 1T9HA 2KCMA 4DLXA 1QJOA 2YWEA 2BDOA 3S17H 4JVNA 4V03A 3R8CA 3H3VI 3GJ4A 3MCAA 4L5BA 2AK3A 2GF9A 4V0OA 1M1KC 4X8LA 5AUPB 1GUAA 2Q9BA 5JI2E 4GN3B 2Q8IB 1IM2A 2AD5A 2WKQA 2G77B 1V9PA 2WJJA 5JEEA 2E2JH 5GJBA 2OV2A 2LSSA 1CKNA 2A5GA 3K0SA 2IYRA 1CTQA 2ZRCA 4JLKA 1NSTA 2JIZA 2FDCA 2P5SA 4JVLA 3EIVA 3GLGB 1NJIC 2R6FA 2QEXA 3NC1C 1IL2A 2H5EA 2R7ZH 4QJ3A 1WJJA 1TXYA 1QVRA 1J5EQ 4A3BH 2HXSA 1E3MA 5GVRA 4P4TA 4Z1MD 1E1QA 4B2LA 4IW3B 5EP4A 1Z5ZA 3IIMA 4NONA 1BKDR 3I4NH 2W6JD 2UXDQ 4POGA 4DWJA 1EESA 5BR8Q 5JBQA 4L5RC 2D4HA 2FEMA 3OEEA 3FPAA 5G53C 1CR2A 3K09C 1XP8A 4M1SA 2NPFA 3PO3G 4YMSA 5B30A 3PUZA 4GKKL 1LTLA 4NBSA 4Q9LA 4WZBE 2HF9A 5IP9G 4JL5A 1W0JD 4TMKA 1ZD9A 1R6BX 4LBWA 1CU1A 1E2PA 2DWPA 4A3MG 2J7KA 2QPTA 4MRRA 1E9RA 2I4IA 4WW0A 2BVNA 1GL6A 2F43B 2O8DA 3C8UA 1H8HD 4MUAA 1VQ7A 4ZDKA 2PNHA 3FKSD 3ZVRA 1DO0A 5FOWA 3W90A 4A3MH 3I4MG 4V0LA 2IXEA 1V5WA 4PX9A 2XSZA 4IOAA 2FZ4A 2P65A 4TYPA 5TVKA 4LHVA 4BFYA 1TF5A 4E22A 3MFYA 5EAYA 4Q1DA 1GOTA 1BH2A 3OPOA 1A0IA 1U8ZA 2MO0A 4KHPL 1PH2A 4X62L 5JRJA 3ZVNA 3RWMB 4A1FA 4KMUC 4PZLA 1S2MA 2QA4A 2A5JA 3BXZA 1KAWA 5IWAQ 4FMDF 2FJUA 5M3MH 4BBRG 5FL7D 2OBLA 2BKUA 1P72A 4QBIA 1EX7A 2E5LL 1OHHD 3EXAA 4DVGA 4DUGD 1AIPA 3HOXH 4TLBA 1JQLB 1ASZA 1NLFA 4EFNA 2AR7A 4BE7B 3CMAA 1I94L 2VF8A 1MO4A 4LJ8A 5JJIA 3HP1A 3L2PA 2JA7G 1Z0FA 4H9GA 4IDNA 5LD2B 1P9NA 2ZR7A 3M1IA 4GT1A 4P74A 3OEHD 3BFKA 4Q4HB 2CL7X 4WXPA 4HZUB 4G0NA 3KLWA 4U02A 2FPMA 5EXSA 5FBQB 1GG2A 2EQBA 2OUKA 5CM8B 3RN2A 3TR0A 3J81c 2IUSA 2F1RA 4LUVA 1BO6A 4IPGA 2VLIA 4PAQA 2ZRHA 3GLGA 4Q7KA 5C4GB 2ZPTX 2DNEA 5KPJA 1XEXA 1SMXA 1UBCA 2IYWA 4BZQA 1TMKA 1SVSA 2MSDB 1UDXA 1E9AA 1FW6A 1KXLA 1AJEA 1IBML 2BC9A 3AF4A 2A6HC 1QG4A 1JJ7A 1YZGA 5UKDA 3SQXA 1N0UA 1OYWA 5KSYA 2GRJA 3FPPA 4P71A 2J7PA 2V1UA 3PIRA 1VECA 2R2AA 3VQTA 1EIYB 1R0ZA 2CL0X 2PLRA 2VHCA 2VSXA 4MITA 4MQBA 3AVQA 4EKDA 1A1VA 1KAGA 1GNQA 2UUBL 4A3JH 1LS6A 1XJCA 2EJMA 5HKKA 2B29A 3WNDA 4LY6A 4LUCA 4AG6A 1ZCAA 1CLUA 4QHSA 4TL7A 4P0TA 3RABA 2Y8EA 5IT9c 3AVTA 1WXQA 2IHFA 4PZYA 3LY5A 3KXKA 1U0LA 3PEUA 1CTMA 2KCCA 1KSHA 4URZR 3U7FB 4A3IG 2IS4A 1VQMA 4M1KA 2OCYC 2ODBA 3I3SR 1TWHH 4LF5L 4KI0A 3LH5A 4KVGA 3VHXA 2NG1A 2GJ8A 5C4MA 3M4OH 3U3OA 2EWWA 4B3SQ 1TWAH 3MMPA 4DR4L 4JI4Q 4UJ5A 1CJUC 4FIDA 1HNXL 1E2LA 2BBWA 3AFPA 4KLNA 5CB8A 4LWZA 4RD4A 4OQXA 3X2SA 2ZT9C 2ZTDA 3KJGA 3QXHA 1N25A 3EA0A 3FKQA 1UJ2A 3CRRA 2QM7A 1DS6A 2BEKA 2EYQA 4RVCA 4IDPA 4A4DA 1SRUA 5D3MB 5JLJA 1E9BA 4JI2L 1P8LA 2BJVA 1WBBA 2H5XA 1YQTA 3EC2A 3LAWA 1E98A 2ZUCA 1VG0B 3CRKC 4HIDA 4HJ8A 4JYAQ 4X6AH 1HH4A 1P62B 1WE2A 2X8AA 4RJLA 4D4JA 1J8YF 2P6UA 4FXPA 3U4ZA 2DR3A 1FX0B 1R0YA 3J80i 4M8NE 3GQBA 3S24A 1HURA 4PC6A 3GLHB 3W9YA 4A3LG 3KYHC 5C3EH 1X6VA 1XMVA 1N6LA 2B21A 2GVZC 2Q2TA 1G5RA 4UXHA 2GILA 4LZZA 2F6RA 3C41J 4A82A 1E24A 1R0WA 1EWHA 3W3AA 1KRTA 3L0PA 4YMUA 1DVRA 3QOFA 3OW7A 1CF4A 5HY6A 1KDOA 4LV5B 4UNSA 4W5HA 1N6RA 4RZUA 3U44B 4YMVA 1IYVA 1KY2A 4CT5A 3PVSA 4Q7JB 1A5TA 2J0SA 1VQ5A 4NB3A 2VQEQ 3LDAA 1Z2CA 1TWFH 1FTSA 2DUDA 2G1KA 3T34A 3SYKA 3R9IA 3KFUA 5JCPA 4A3IH 3IO3A 4RMFA 3O8BA 4XJXA 5C0XH 1IXZA 4NPSA 4ZDWA 4A2WA 2AUJD 3AKDA 2PI2A 1E1TA 1KJWA 2GJSA 3DZ8A 3MLEA 4ZPXA 2IWHA 1F2UB 5LPNA 4X8OA 5F9FA 2QN6A 3OIYA 4B3GA 3HOWH 1Y8OB 1ZUNB 4H1VA 5IHPA 2QSYA 3C7KA 1M8PA 1LV7A 2E9SA 3RS3A 2XXAB 3GFOA 3NWJA 4B3BA 4XOIA 3SOPA 1YZUA 1I4LD 4B71A 2GJ9A 4TMWA 2CCKA 3K70D 2OO7A 2I3BA 1HNXQ 1G7SA 1E9CA 3U7HB 1HTPA 4GNKA 1Q7YC 4P3YA 4ARZA 4DV2Q 1X3SA 4AYTA 4D0LB 2VO1A 1XCMA 2MMGA 4G5QA 4P32A 3T61A 4HLCA 1NMZA 2OESA 3E70C 2FX3A 3DOFA 1WRBA 3U2QA 5M3MG 4W7SA 4DK6C 4A6PA 3I7FA 2ERXA 1GIAA 1D5CA 3FKIG 3FMOB 1D2EA 1N2CE 2OCPA 2K75A 4A0RA 1Q1ZA 4OJKA 4R71A 2NPIA 4UNRA 2GXUA 1WA5A 4TMZA 5FOUA 2R6GA 3I73A 3M4YA 1OTCA 2VQSA 2QBYA 1FMLA 3TVTA 2JCSA 4QGUA 5HTKA 3EZ9A 2ZJRA 5KNCA 3SC3A 4IVQA 2AN9A 2B8GA 1KHIA 1N0VC 2FGKA 1M2OB 4AC9A 3THYB 5CJ2A 3RYTC 1X65A 3C5HA 2H17A 3PJRA 3ICEA 4YWMA 1GDDA 3OAAD 3NBXX 5EP1A 4GDFA 1N33Q 2QPOA 4ON9A 2FH5B 3I92A 3KQLA 5LMNL 1Q22A 5ELOA 4LGMA 4PO1A 2GDJA 4PZ7A 3DKVA 1E4YA 2HUPA 2ZIAA 1VCIA 1C9OA 3MRSA 4JK1C 4IKEA 4R9UC 1II9A 4URWR 3OIUA 4A3FG 1CS4C 2HQLA 3RC3A 1NY5A 3BD9A 3UIEA 3GLGE 4A36A 4XTRA 2PMDA 5DN6D 3TK1A 3KUDA 4D0GA 4GSYA 2O8FB 1FYCA 2PT5A 2NVYH 5L3VA 4FWTA 5EXTA 5B64A 1Z3IX 1HZAA 3SGIA 3O8CA 3VFDA 2UUCQ 3PENA 4XH9B 1YU9A 4F38A 3F8TA 3RS0A 5FBVB 2WPDA 2JJ2A 3U5ZB 3VR6A 3TREA 1R0XA 4NCHA 3AUYA 5DN6A 2UZ3A 2EW1A 2I0QA 2PI2E 1PA6A 4D2IA 4HYYA 1LM0A 1WFQA 4UNQA 1XD9A 5GJWC 3K80C 3IKJA 5FOVA 4B75A 3BERA 3PUWA 1B7YB 3GLIA 3FOZA 2GA8A 2V9PA 2RGNA 1LS1A 1Q21A 4J15A 4HAWA 1RIFA 3QUSA 1ZINA 1OXSC 2OFWA 4IXNA 4Z8XA 4B3RL 1FR3A 5BWMA 2H7VA 4LJ5A 1XTDA 2CLCX 3FKIH 3S16H 1NTGA 1J8MF 1KZ7B 2H1LA 2V7QA 1T5IA 2ORIA 3T12A 1D2MA 4DLVA 4LJAA 2F3IA 3GJ0A 1YHBA 3HOZG 5KTYA 1OSNA 3BBPA 1TU3A 4QRHA 4PHFA 4HUQB 1X55A 1GWNA 1TQ6A 4A8JA 3AVWA 4DV2L 3TLXA 4AK9A 1OV4A 3VR2A 4NDZA 2I1VB 4OHYA 3NXSA 2GF0A 1IW7C 4GMXA 2GHIA 2R6CA 1SVIA 3TQFA 3AVXA 2ZR0A 3KF8B 5CYOA 1M34E 1VQHA 1E79D 5JEAH 1YNXA 1XD8A 1S1MA 1N8RC 4B3TL 2F1IA 4LFAQ 1QVAA 4OX9L 1XNJA 1DAMA 2R65A 3MAAC 3QF4A 4BLOA 3AVYA 2IHYA 3RZOH 1KO4A 4Q47A 1JEDA 5FOXA 3Q7QA 4GKJQ 3NHBA 4IDOA 1H9MA 2A1AA 4BZXA 2Q3FA 2OG2A 3GEHA 4WZ6A 3TMKA 1P2TA 3U44A 2OQ0A 1YNJC 1KI6A 1U9IC 4POAA 3RAPR 1KO5A 1KNQA 1M1YE 1XTJA 2ZM6Q 1KO7A 2OEPA 3HDTA 3HFZB 4PZ6A 2Z0SA 4MKIA 4PAOA 3RWOA 1HR0Q 5JJLA 5G41A 3A6PC 3UMSA 4OYHA 2WKRA 3IHWA 2GCPA 3QNUA 1H65A 4DNIA 2C35B 4WJ3M 2FWRA 2FSGA 2QU8A 4KXFB 3T06B 3GJ7A 5AUNB 5AUOB 2WHXA 1OYYA 3ZJYC 4R4TA 4I99A 8OHMA 5C3EG 3UG7A 1TL7C 4A3JG 1NI3A 4AYBG 4YWLA 2BBSA 1ZIPA 3DHWC 3LD9A 4JBXA 3DXJC 4Q4HA 5B2ZA 4AKEA 4D80A 2ZM5A 1B23P 4GNXB 4MNOA 2ZJQA 1IN4A 2V6IA 1IY0A 3SHWA 1W46A 4BASA 1PUJA 1G7CA 4I4LA 3RNLA 1E6CA 3IRBA 4EJSC 2CEAA 1NKSA 4A93G 1E99A 3W3ZB 4G1UC 1D8TA 1Z28A 1XEXB 3H1TA 4NXMQ 3EG5A 5GJVC 4TYWA 2ZJOA 3H2YA 1P2VA 2BKEA 4PC3A 4BLSA 2GCOA 3VHLB 1NN1A 1HNWQ 1NMYA 3SE0A 1A8VA 1CFMA 3CPFA 1E96A 1XTRA 2ORVA 2VSFA 4QGHA 3THWA 1ZUHA 2VF7A 3SJAA 4X66L 3AUXA 5B58C 1U8YA 1BVSA 5AJ3Q 2BMEA 4NU0A 1W36C 3CRQA 4I7ZC 1C9KA 1YNNC 1ZRHA 4LYFA 1ZM9A 1Q82C 1L4UA 3GLIB 4C30A 1GRRA 3TUJC 5LMNQ 3VA7A 2RGDA 4V0KA 5KNBA 3W34A 1XCGB 4DDWA 2PZEA 1II0A 521PA 1W47A 1T0JB 3HOUH 1KAOA 1EOVA 1UPTA 2ONJA 3CWQA 3OE7A 4AYWA 4A3CG 1V8QA 1K8AC 3U3JA 4I1SA 3SYLA 1E79A 2K7VA 4ACAA 4FI3C 3DKPA 1RRGA 1OIWA 2HV8A 3L82B 3GTKH 2XXAA 1YI2A 2EFCB 2QUZA 5AJWA 2O8BB 1D7QA 1P2UA 2VHQA 4PSVA 3TW4A 1EGAA 4TQAA 5FTLA 3J7ZC 1CXZA 4ZDIA 2FSHA 2XSZD 2GAOA 3LO5A 2PPBC 4C0QC 3TS2A 3N5CA 4JSTA 5JRZA 1K6MA 2L0XA 5D3MA 3THOA 4GMDA 1E2HA 5IK2A 1ZM4A 2JA8H 4DSNA 1FVIA 2F55A 2O0JA 4HDCA 2EWVA 1M7BA 2DFTA 1G3IA 2HIVA 1XBTA 2NO0A 2ZRAA 3WRXC 2N42A 4MRNA 5FUWA 1XDBA 3BAFA 4GKJL 2ZTEA 4LYJA 2IEYA 4NCJA 4C4PA 1DTSA 4M21A 1HQCA 4PO8A 2O8BA 1KDTA 4LJ7A 3DVLA 3W5JA 3K0XA 5IY0A 3EC1A 3Q85A 5KOYA 3LGJA 4NXNL 1Z2AA 2YZ2A 3MXUA 2CE2X 3EQLC 1ZU5A 4PPFA 1FFHA 2OBMA 5AJ3L 2EJFC 4KU4A 4H02A 4W5JA 3UMFA 1ZYUA 2E8GA 3GO5A 3AP2A 4AIIA 2PJZA 3AF1A 1ZC4A 4JLNA 3GTQH 3B2EA 4DV3Q 1TQDA 2N8NA 2R7ZG 2CVFA 3TZUA 2NVQH 1FX0A 2QT0A 4KV9A 3IPXA 1GL9B 5AJYA 2N1BA 1CKMA 2ZRIA 2HEIA 3KJIA 4CVNA 4JLOA 4KAXA 4AKGA 1P9WA 2EVBA 1NBWA 1Z6AA 1CR4A 4LBVA 2BV3A 1VS0A 2CWAA 2X77A 3OYYA 1G9XA 3QVUA 1S3GA 1OIVA 2QQEA 3H15A 3A7LA 5CK5A 2UXBQ 1FPMA 2V3CC 3W8RA 4TMVA 5JS8A 1GAJA 2RGEA 1OXVA 3CC7A 4LF8L 4TKOB 2XOKA 2VY3A 1WMSA 2ZJBA 3A1WA 3AVPA 1HA3A 5SZKB 4B2IA 5IP9H 4BFUA 3LQRA 3OEHA 2WPDD 2R9VA 3KF6A 3IBGA 5FLXc 2ES2A 3IIKA 1G5PA 2IEZA 4FW9A 1EFUA 2ANBA 1NP6A 3PUVA 3W5OA 4LHXA 1PH7A 2ATXA 4OHWA 1ZNYA 2W6IA 5FH9A 1I6HH 4OQFA 3CQZH 1PH4A 4LFCQ 4A76A 1KD1C 4DLRA 1QHYA 3T5DA 3JVUA 3WNBA 2UXBL 3QI2A 3W8NA 4PPGA 3QPWA 1Q46A 2DPXA 1BBUA 2FFHA 2NMVA 1N34Q 5EP2A 1CSPA 3AM1A 3RC8A 2IYYA 1DAIA 2D7CA 4LI0A 3OOCA 1F6BA 4D4MA 2QA5A 3A37A 4AQYL 2XGJA 5TY0A 1QZHA 1WF3A 2JA9A 2V55B 3OIVA 1ZU4A 2W0SA 2IBMA 4AY2A 4FMCB 3CZQA 3AKYA 4TL9A 4IPDA 4OX9Q 1OHHA 2IYVA 3LQQA 4TTQA 2NTYC 1M7GA 1G8HA 1GUGA 3U3RA 4ARZB 3CCQA 3CCMA 4HAVA 5FOSA 4YDHB 3H0GG 1L2TA 2EU8A 4LJ9A 3VKWA 3QPUA 1GJXA 4DIDA 5KSZA 2O8EB 1N33L 2CVHA 1FL9A 1G3MA 2EFDB 2H92A 1OFTA 1VHLA 2GKSA 1UE1A 1I2DA 2CJWA 2ZRFA 3OIWA 3ZYCA 4IDQA 1HYQA 1TF7A 1RRPA 2C99A 4GZLA 4NE2A 1Z7TA 4X8MA 1NL3A 4C0SA 2BHRA 3ZIAA 4CYMA 3BB4A 4A0HA 1A63A 4PQFA 4J0QA 4YXWA 3VMFA 4BWYA 4CIDA 1BMFA 1Q12A 2QL6A 4DR2L 1CKEA 4PG3A 1P7CA 1XWIA 3NBHB 1DD2A 2ZSDA 3B85A 5BYJA 3STBD 3JAMc 2W2XA 1PLLA 4IPCA 2VTKA 5KO2A 1RC8A 1TU2B 2E76C 4LF9Q 5FR2A 4ACBA 1OH7A 4DUYL 5JJKA 2EVWX 1AS2A 3THWB 1DPFA 4EUNA 2UUBQ 5TV2A 1SHZA 5EP3A 4Y52H 2ZUBA 4PMWA 1U5KA 2QI9C 1B70B 1WOCA 1KOFA 3B1YA 3NEJA 3K70B 2JJQA 4KVAA 5AJVB 1ZUIA 2YHSA 1HCZA 1XPRA 2HLDA 1HJPA 4DV0Q 4GNXC 3F3YA 3JZMA 3MJRA 3LBHA 4A0GA 1IN8A 4WAUA 3TUIC 3GP8A 3DLLA 2VUMG 4CRWB 3U6KA 2NQ2C 2ZUDA 4G5OA 2WJHA 4JI6L 1US8A 4KHZA 2JLSA 2FA9A 3J80c 4OI1A 1UKYA 1G8GA 4PC2A 1EK0A 4C9BA 3FMFA 3Q8DA 2VUMH 5EJEA 1JI0A 2KA7A 4DV3L 1JQJC 1NMXA 5JEDA 1HY3A 1O7LA 3QKSB 4BY7H 4F4IA 2XGTA 1N36Q 2OTJA 5JHHB 4ESVA 1E32A 5IDVA 2DFNA 3D7MA 1BYIA 4QGAA 2IYTA 1WYDA 3HOUG 1Z29A 1XTIA 3UDIA 3BORA 3RHFA 5J5CA 1R9TH 1KI8A 2VHTA 4GOKA 1UF9A 1COWA 3T56B 1YZQA 5JZVA 1A82A 5KNDA 2LXJA 1W4AA 4IHQA 2A5DA 5CDFA 3CUEF 3THXB 3VKHA 1VIAA 3P32A 4OKSA 2AK2A 4KO8A 4FCVA 1TTTA 5FTNA 4DUYQ 3QG1A 4JLPA 4MA4A 1AE2A 2FEOA 4A3GG 4GP6A 1BIFA 1DO2A 1EFTA 2PJRA 1IBKQ 1BMFD 1KK0A 1AH9A 3KOJA 4B3MQ 4TMTA 2ZI5A 2GBLA 3DM9B 4O2DA 4FCTA 2K14A 2DYKA 1VQPA 2XNSA 1WI5A 2A69D 2D74A 4HLUC 4JBYA 3RLFA 4A3GH 4HJAA 4MZ9A 2R7FA 1W2HA 2EFGA 2GJKA 2ZM6L 2WAYA 3V4RA 3FKSA 4LBZA 1PFSA 1P2SA 1XPUA 3LVRE 1HTWA 4N1AA 3UWOA 5J4VA 3I61A 2O8DB 3KXIA 4X64L 1XTKA 2FMXA 1XZPA 2ZITA 2YKGA 5JMTA 4IJLA 4I1VA 4LK2A 1GHKA 2WOJA 4RD6A 1JAIA 3G0HA 1Q3TA 2ZU6A 2JLZA 4KBFA 2I5LX 1O3YA 1A2KC 1GUTA 3RS4A 2FNAA 4P73A 2ZSEA 3U4QA 4TLDA 1S3OA 2D2CC 3EIEA 3I4NG 4LRWA 4B47A 4XSGA 1P9RA 3QPVA 4PAMA 4Q7LA 2OSBA 1QHHA 3HU2A 5JEAJ 3A4LA 2JDID 1R8SA 2A30A 4KKTA 1A4RA 1ONBA 2NGRA 4FINA 2C9OA 3CF5A 4HATA 1EWRA 2ECKA 3TSOA 4DCNA 2H18A 2JGNA 2QTFA 1B8AA 3E0EA 2F1HA 4S2EA 3AVVA 1RRFA 1PLJA 3W1GA 1Z0DA 4DT1B 3M9BA 3NKVA 3IUYA 3P4XA 2W83A 2JA6G 1XRJA 4GRAA 1H9RA 2Z6KC 3I55A 4BLQA 3QKSA 4A6XA 1P3JA 1E1QD 1FP6A 4LV6A 4IFDI 3AH8A 1KHTA 1I94Q 3DPUA 4G7OC 3QKUA 1SXJA 3S15H 4BXXH 4CEJA 3TE6A 3N6RA 4MUBA 1L1OA 3I8SA 1MRSA 4IXMA 1G4AE 1G291 4AH6A 1II8A 2OXRA 3K9GA 1CEEA 1K8MA 4LNQA 2XOKD 5DE3A 4QNMA 2AKWB 1QHXA 3HR8A 4B3DA 4C0BA 3CR7A 1NY4A 4GOPC 4LF8Q 5FUYA 3ECCA 1S4QA 4DCTA 3I1FA 2WWYA 1VMAA 2AL7A 4Q21A 2NO6A 1DCZA 1Z0AA 5DYGA 3TH5A 5TDHA 4ASUA 4BPBA 4LF4Q 2WM9B 1FZQA 2FSIA 1KSGA 2IYXA 2JEBI 2V4DA 2DBYA 2WAXA 2ZI9A 1ZC3A 1MV5A 4PANA 3L8YA 4TT3D 2EYUA 4XVRA 3ADBA 2W2VA 2XZLA 1YZTA 4KKUA 1UBGA 5FUVA 1TUEA 4UQOA 4E5UA 5A4JA 4AI6A 2LXKA 3NELA 3B60A 1QHNA 4YWKA 3PF4A 2OLKA 3TW8B 1QVFA 1HE8B 5FI1B 1SGWA 2QTVB 5JWRA 2GXQA 1TUIA 4BFWA 3ASYA 4JJZA 4LSGA 4G7ZC 1SVMA 1K5GA 4HB2A 4NCKA 4DUZL 5DHFA 3GLIE 2D3WA 3KJEA 3T1OA 1X1SA 4RZ3A 2YTVA 5E7IA 4G5SA 3A8IE 5FTKA 5E3HA 1SKYE 4RD1A 3CF0A 3K9HA 5FL7A 3U4QB 4GKKQ 1IN7A 1E0KA 4B3CA 3K0FB 1LF5A 1N9WA 5FPHA 2ZS9A 2IX3A 1W4CA 1AGRA 1WP9A 2ZJZA 3TAUA 2AFIE 4ZIRB 1NVUQ 3UE0A 3M6AA 1BBWA 3K70C 4R2IA 2QMHA 2R7DA 2ZRMA 4Q66C 1IN5A 3LBNA 2D0PA 3G6EA 3D0FA 4XD7D 5CLLA 2ZEJA 1UE7A 1AE3A 4XD7A 4DKAC 4F4CA 1LW7A 4R2HA 5SZHB 3KUCA 4G3XA 2WV9A 5IK2D 5FJ8G 3PO2G 1Q8KA 1RZ3A 2Q21A 2CCJA 3EZ7A 4K81B 4DLZA 1HH2P 2I5MX 3TRZA 4IDHA 1E7ZA 2ATVA 5J4YA 4PHHA 1XMSA 2NVTH 4NHOA 1M90C 1ZM2A 1AS0A 3RNUA 4DXAA 5IYCH 2V7QD 4R4IA 5FLMH 4KLKA 4DAYB 2R92H 1AN0A 3K9LA 3QKTA 1HZBA 4M4SA 3PQCA 4Q00A 3QY0A 1FGUA 1MABA 3KKMA 1IYJB 4JBKA 3ZZUA 2JASA 1HV8A 1MO5A 4BBSG 2BCJQ 1O87A 2QE7D 2O8FA 5H68A 4WJ4A 3OTOL 2GK7A 4LC0A 1T0HB 4LJ4A 1H9JA 3QENA 5AWFC 2PH1A 1CJMA 1VQBA 3GEEA 4Z1MA 4WVFA 5JWOA 3WHKA 2KENA 1VQKA 4PQYA 3KDSE 1Y1VG 1Q57A 1YR8A 3A74A 3CZPA 4RKEA 1P16A 1KSJA 3NH6A 4AG5A 1RE0A 1A7JA 2BMFA 2DFKB 2WWXA 3HOZH 2JA7H 2BM0A 2P2LA 2VP6A 1KRSA 2HCBA 3B13B 4Q9JA 2LWIA 2FG5A 2YOFA 4PPQA 4ZI3A 4BY7G 3A1UA 4M1TA 3VAAA 1K0RA 4TLEA 1J5EL 5HZKA 2GVAA 3VNUA 1VQIA 1P6XA 2ZREA 4NYIR 2LMCB 1G8YA 3LBIA 5L3QB 5E4FA 1PH3A 4NH0A 1CBUA 5K8IA 3IO5A 4E09A 3VNVA 4Q9HA 4P75A 2CWPA 1OF1A 2RHMA 4KKSA 1IHUA 1SULA 3CMEA 2DNCA 4GOPA 4L5SA 3M3YH 3B1WA 5BQ5A 5M3FG 3CPJB 3V9PA 4QM7A 3R8FA 2JEOA 1O7IA 4PZZA 1NNEA 3EPLA 1UFQA 4TL6A 3SN6A 2VA8A 2V8OA 2ZROA 4HAXA 5CK4A 4JI3L 5EQTA 4UXJA 3X1YA 3ZD7A 5LMNW 1N5KA 3U60B 4BUJA 4MKGA 2JQOA 4JI7Q 1VQEA 1U0JA 1H9SB 3V4FA 4ZIRA 2IF0A 2BCGY 1E2JA 4O2RA 2J3EA 4QG7A 3D8BA 1IBLQ 2PEZA 2PZFA 1JEEA 1L7VC 4URXR 1RPZA 3KF6B 1G7RA 1SHKA 4WIAA 1GD7A 2JE6I 1F3OA 2DHRA 2JJ8A 3AP3A 4P31A 5L3RA 3ULLA 1GL7A 1KIMA 4IFEA 1XJQA 1PJRA 1SVKA 3EZ6A 4QHYA 4TLCA 5TARA 2OLJA 4LPKA 5FFMA 3CCLA 3CH5A 1Z6GA 1NG9A 2P3SA 2YWHA 3RS5A 1N3BA 5FBWB 3EPHA 3S1MH 5FPTA 3HOWG 4DV7L 2H8KA 1KK1A 2QG6A 3LNCA 3CCVA 4R1JA 3FHCB 4AIMA 3GTJH 3U7GA 1E3PA 1NKTA 1U9IA 5BR8L 3TBKA 4AYBE 1E2IA 2PQAB 2B8FA 3HOVG 1JR3A 2IUUA 3K7UC 1ZAKA 2WWIA 2GEUA 1IJEA 2ERYA 1T3SA 1SKQA 2GXSA 2XEXA 5HR5A 4TZ6A 3CB4A 3OEED 1KSFX 5CITA 4B74A 1DELA 3QEOA 1OB2A 1IZ6A 3LNNA 4L5QA 1VQ4A 3VTKA 4OI2A 4GLAC 2HCJB 3HKSA 1NIJA 2ZU0C 3IQXA 1G7TA 1F2TA 4OHVA 3SQWA 4YMWA 4DDTA 3ZS9A 4DR5Q 4B3RQ 2J7PD 3AKCA 721PA 1T8UA 3WYAA 4RZXA 1K8RA 1S9HA 5IYBH 1E2DA 3K0FA 4NCIA 4P72A 2V1XA 3CX6A 4LJZC 3VR4A 3SEAA 3F0TA 5JHGB 1X6OA 4JBJA 3SU8A 4C7OA 2F43A 1JJCB 1Z6YA 1DG1G 3PIOA 3PITA 3P27A 2VPPA 3MEFA 4MRPA 1LACA 1NVVQ 2JAQA 2MSEB 4HLUA 4JT2A 4P4SA 4C3HH 3S1NH 2UUCL 1IBRA 1DGSA 1OKKD 5IYDG 2DFLA 4IPHA 3HPQA 3OHMA 3VX3A 3M4QA 2XZOA 4RG1A 4OK6A 2O8CB 4XIGS 3UDXA 1XFAA 2A5FA 3AGQA 5FTMA 1OIXA 1X1RA 2VHUA 4DR3Q 4Q4AB 1IN6A 2BBTA 4JLMA 4L4UA 4B73A 5C46F 3KKNA 4F92B 5KU1A 1CRPA 4K0KQ 1U0HC 3HKZG 3ND8A 1CKNB 1MKHA 4LUZA 2NO7A 2PX0A 4N0DA 2A68C 2IHBA 3FHTA 4AKHA 1W2GA 3L2OB 3A0JA 3ER0A 4TSFD 1X3GA 1CJKC 621PA 3DM3A 3FP9A 4A3BG 1KDPA 4PSAA 1JMCA 4Q5IA 1UAAA 3BG3A 1EFWA 3AF0A 4M1YA 3QKRB 2SHKA 4DUGA 4B76A 4ZKDA 3A7AB 2WFWA 1LNZA 4DR4Q 3RVBA 3BH6A 4NPHA 4OK5A 2UU9Q 1J99A 4PFSA 4UP7A 3MWYW 3QBTA 5LBIA 3ZDQA 5JCZA 2ZVQX 3S1QH 3HOVH 4LF5Q 1FL0A 2V54A 2QMUA 1U99A 4TN1A 1HE1C 1ZBDA 1K8GA 1EFCA 3BFVA 4LHZA 3A1SA 4C0JA 3UG6A 3EWSA 3WWVA 2Z6KA 3C4JA 1KKLA 3FWYA 1ODFA 2CCZA 1ZM7A 3J81i 4FDBA 2Z43A 4Q03A 1WCMH 2JLYA 2AUKA 1KY3A 3FGNA 2O8CA 4DB4A 4L15A 1TAGA 1E2NA 2WVJA 4QFMA 4ZO4A 5LB2A 1SN8A 5A0FA 2QGZA 2QGQA 4XVUA 5J4LA 1M7HA 2RGXA 1HZCA 4MDEA 4JV5Q 3KB1A 1W1WA 2VP5A 4A3EH 5C1BA 4TLAA 2ZJ8A 3GLFB 3CIOA 2NZHA 5GJCA 4KITB 4DLWA 3CPWA 1E9SA 4FMBB 3UKDA 1EIFA 4QGFA 4OO1H 2HIXA 1ZCBA 221PA 2AKAB 4QGGA 4TWZA 1W4BA 1LYLA 4JYBA 4LFAL 1ZW6A 4GZYC 4QJFA 1MH1A 3NVAA 3ZGXA 4DLYA 3T5GA 3G48A 3UMRA 1QUQB 2ZS8A 4LW1A 4Q18A 1KIXA 1OPXA 1R5NA 1Z07A 2F3RA 3LXXA 5TXGA 1R5BA 5C0XI 2XX3A 1VQ9A 1NLZA 2IYSA 2X2EA 3KQKA 4HAYA 3ADCA 5C4XG 4B3SL 3SBDA 4AQYQ 4RD0A 1KKMA 5GAHC 2GN5A 2CE7A 3A1VA 4V0MA 3ULPA 5K36G 2ZRGA 3L7ZC 3L43A 4APVA 4DLSA 5DGXA 1Y8NB 2VQFL 1S9DA 5C4XH 2JJ2D 2ZRLA 3AYHB 1CJTC 2GEDA 2KB0A 1RYFA 2G3YA 4BY1G 4MGKR 3CCUA 4LUOA 4GFDA 4LFCL 2A68D 3A58B 1PH9A 4HUQA 4A8JB 4DBLC 3B9PA 3WP1B 3GPLA 2ZYUX 4QXAA 3U6BA 4GNXA 4B32A 2CHGA 4ERNA 1N6IA 3W1BA 1NG1A 3O8DA 2C03A 4A3KG 2KBFA 1E9EA 4PO9A 4HIMA 3QXCA 3Q5DA 3KFVA 1QZXA 2G0TA 1Q20A 2VP4A 4QBFA 1HUQA 2Q2IA 3DMDA 3MSXA 2WOOA 2L5TA 1AQYA 2JLWA 2O8EA 2B8TA 1IBMQ 5FJ8H 3PF5A 3PO2H 4QM6A 2FPKA 2N3SA 4Z8YA 4CW7A 2LKCA 4Q1EA 4YDSA 1ESMA 3TGPA 1D9ZA 2CCGA 3EAQA 4GLVB 2REXB 3MWLA 4IOJA 4OI4A 1SXJB 3O8RA 4HI0E 3H0KA 3PUYA 4URYR 2K5HA 2D2FA 2XB2A 1QVGA 1AGPA 2JA5G 1F60A 1KDRA 1N6OA 4EPRA 4ZCMA 1KL9A 1E0JA 1XXHE 1XNRQ 4KFRA 5FTJA 4D25A 3EPKA 1YZ6A 4O25A 3IILA 3HOYH 2KWIA 1CP2A 4JI0L 3I56A 1J70A 2GVDC 1KMQA 1T91A 2N78A 3ADKA 3HPRA 3IDQA 3IIJA 1MOZA 3DM5A 5AK0A 3NG1A 4EFMA 2G9NA 2AWOA 4DAMA 1FOEB 4P4SB 2WMNB 1F5NA 4YCWA 1E1RD 3J7A5 2IW3A 2AX4A 1Y63A 4B3XA 1GHJA 3RLNA 4C3IH 1YR7A 2R44A 2ZYTX 4JKIA 3L0IB 4LCBA 4YQFA 3U3MA 3ZS8A 4JOIA 5G3ZA 3F1ZA 4AKIA 2IYLD 3JC66 3P26A 2GZHA 2JA1A 2NIPA 3H3VH 2CW0C 2EJGC 4LWCA 3FVQA 4QL3A 1E2WA 4B3ML 1G8FA 1H9SA 5J4KA 2CDNA 2C8VA 1Q86C 5GAEC 2JLQA 1G16A 1Z8FA 3CF2A 5TB5A 1OXUA 1VQLA 4S35A 2CFMA 4A0FA 1SVOA 2Z5FA 3HWSA 3MWJA 5ELNA 1VQOA 3X1XA 3G71A 3TS0A 4DV4Q 5M04A 4KBGA 2QROA 4JLJA 1YEZA 3CCEA 1G6OA 2A19A 1G18A 3M85A 1BYUA 1OJLA 2Q9CA 4JG2A 1EWIA 1XF9A 3AF3A 3CF6R 3QF4B 5K8UA 2OFOA 4LPSA 1UKEA 4MGYR 5CIQA 5CJPA 5FL3A 3WMGA 4B35A 2FGJA 1CULC 3GJ5A 2Q6TA 3CPHA 1U2RA 2W0MA 5AR1A 5GADl 1E2VA 2ODNA 2CLDX 3REFA 1BOFA 4POFA 2WWWA 5KDDA 2DN8A 2IWRA 1SROA 2F52A 2EFEB 2CNWA 3CLVA 5K8LA 5IP7H 3PUXA 4HIOA 3BGWA 3GLHA 2ODEA 2YWFA 1GUNA 1NVVR 1P61B 4A4IA 4NXML 2C95A 4Y7NH 1YVCA 3I32A 3OFNA 2JA8G 3B6YA 1W7AA 3HYRA 4KFSA 4LF7L 1OKKA 4KFTA 3JAMi 1E2FA 4NYMR 3VR3A 4HSEA 2YYZA 4LF7Q 2NO9A 4DV5Q 2RB4A 1JJGA 1ZVQA 3OFND 3AVUA 1RJ9A 1RW4A 4LYAA 1YKSA 2IYQA 5TMPA 1K9MC 1VQDA 3A1TA 1OXXK 5E7JA 3FMIA 4ZCLA 1ZYRC 1Q1BA 2WKPA 2QGNA 1ZM3A 3AEZA 5A5GA 3P20A 1ESNA 1GZSA 1NSFA 2JK8A 4HDQB 3WHLA 4JCVE 1KK3A 2D5DA 1PH1A 4Q9KA 1UEJA 3MUFA 4DHEA 3UATA 1NF3A 2VHJA 4US2R 4IJHA 1JPJA 3ZD6A 1U94A 2O5IC 1J6QA 2CHVA 5C0XG 1PH5A 3QQ5A 2Q0HA 1OFUX 3AB3A 4DSTA 1OB5A 4Y0VA 1JJ2A 1UM8A 1TQ2A 2J87A 4KHPQ 2CQOA 1I2MA 2ZS7A 5FBRB 5IYBG 3SS8A 5HE8A 3ASZA 1E0AA 2D62A 1R5OA 3NE5B 3RZDH 4JKYA 3PIPA 3LV8A 2NN6G 1OXTA 1O78A 4CEJB 1QDEA 3RLOA 3S14H 1QG2A 3GTOH 3HR7A 4Q1FA 5GVSA 2ZTSA 2QAGB 3GTMH 1CUKA 3AP1A 4QBGB 5EE5B 4Y0AA 3QKRA 3T15A 2NN6H 3ZIAD 3D31A 2P6NA 1AQUA 1NRJB 1PHJA 2AWNA 1XPOA 1KGDA 2VL7A 3VKGA 1VF7A 4DLTA 4BRUA 5BN5A 3I4MH 4M9QA 5CYPA 2JJ1A 4HIKA 3QJYA 2XTIA 2N49A 3G82C 3KDFB 2RKOA 4R4OA 1ASYA 2BA1A 2UUAQ 1FUKA 2HF8A 4C7OB 3TKLA 2YOHA 2K5VA 3KJPA 1N34L 2ZJAA 3LWNA 3RS7A 2ZAMA 2NZOA 3H86A 3N2IA 3QG5A 4UKDA 4PZ8A 3NBFA 2WB1G 4RFSB 2VQEL 4EQ6A 5KDLA 3MG9A 1KI3A 4GI7A 4G7HC 3ZVLA 4MRVA 3EPJA 3NHAA 5H1SE 1W2BA 1XNRL 3KKQA 1X3FA 2ZTCA 1YHQA 1Z9FA 1G8PA 1YZLA 2IYZA 4DCUA 1YHNA 1NBME 2REBA 1Z0IA 5CM9C 3CD6A 1XNQQ 2F1MA 3AQQA 1LF0A 1MABB 4DEXA 2FXQA 4JZKA 3MXNB 4A3DG 3TSZA 3CCRA 2TMKA 4KLZA 4D0NA 4RKFA 4HUTA 2HJVA 2ZSBA 1VDZA 4OQMA 3BZKA 2FF7A 2XNDD 1JXMA 2ZYWX 2RGCA 3FYHA 2ZJPA 1IYUA 2FFAA 4IFDJ 1W4RA 3K0AB 4OK3A 3EWAA 3RSOA 1VQCA 3GD7A 1A62A 4L8JA 1E9DA 1XEFA 3NDBB 2GZDA 2O52A 3TNFA 3PEYA 1KO1A 3PG5A 4JYAL 2YJTD 3W6OA 2BMDA 3KFXA 4WBSA 5FPKA 3W6NA 4CGZA 4II7A 4DPGA 1S3SA 4JI2Q 1EQRA 2ID0A 1HEIA 1HZ9A 4I81A 3T1TA 1K73C 3TEHB 3NBZC 4BLRA 5KYKA 3RS2A 3SJCA 1EUJA 1GILA 1RJ9B 2WMOB 1ETUA 1P73A 3A36A 3VX4A 3R9WA 4NXNQ 1JALA 1Z22A 2YVUA 4Q01A 4BECA 1G6PA 4Q9IA 1L1OB 2ZXUA 5G3YA 3QF7A 5DLQC 2OCEA 1HT1E 3IQWA 1N6KA 2O5JC 1HT2E 2PMZE 4IVPA 4LDJA 3CRMA 4B44A 4JI4L 2HJGA 2HHHQ 3IFTA 1JR3D 3BJUA 1FUUA 2HXYA 4IRUB 3KJHA 3CCSA 1E2GA 1R10A 2VP0A 3KTAB 3QBVA 2K5NA 1KK2A 3UWKA 3WXMA 4ZCIA 4O0AA 4JI8L 3S2HH 1KI9A 5DI3B 2ZI6A 3T1QA 5FUXA 4JC0A 1HNZL 4X65Q 4OL0A 1E1RA 4IOKA 2MQHA 2VRWA 2ATWA 1QUQA 1OE0A 2H57A 3AV0B 1W0JA 2Q2UA 1JB1A 1Z63A 1NMGA 3ZLJA 2G6BA 2AXPA 2ZE8A 4F93B 3HU3A 4Q4JA 3RRYA 4D81A 1Y8PB 2QP4A 4Q7MB 2IUTA 1W36B 1H8HA 4EPYA 1D9XA 3STBC 2YU9H 3GFTA 2W6JA 5GROA 4URVR 1G3RA 4DCVA 1CKOA 2ZI7A 4CZ2A 1RRCA 2AXNA 1G6HA 5DNYB 1OT3A 1XJVA 2RF4A 3F2CA 5CIWA 1YHAA 4LHWA 2QF7A 2C9YA 2DGYA 4F4JA 3D6TB 4AURA 5BXQC 2XAUA 1TKWB 4A3LH 2YTYA 1ZMXA 1NBMA 3KDFA 2WSMA 5AJZA 2IS2A 3CKLA 3BOSA 3OE7D 4C3ZA 4XWOA 4JI1Q 1RVDA 4M9XA 4LFBQ 3MWKA 2W6ID 1SXJE 5HZHA 2RGNC 1HQYE 3LLUA 4M1OA 3N2EA 3TAHA 2MMCA 4NYJQ 1UE5A 1VG8A 4YLGA 3I4LA 1P75A 2YINC 1FP7A 2B3GA 1Q1QA 3K7AH 1F2TB 4HLQB 3HOYG 1PYSB 4DCSA 4JL8A 1KC8C 5M5YH 3GDEA 4QNRA 2QBYB 5EZ6B 2IC5A 4A9AA 3LFUA 1I3QH 4G01B 4TZ0A 4DRZA 3PV0A 4QQBX 4BBSH 2J5XA 3EIHA 4OWWB 1E2EA 2BE5D 2OE2A 5DLQE 2Y0SG 4ITRC 4TMXA 1KMHA 1DAEA 3BIFA 4DV1L 1E4VA 2VL6A 1KJYA 1WDTA 4QHTA 3B1ZA 3BH0A 2RMKA 3QXSA 1UDWA 2GK6A 2E5LQ 2D2EA 4Q1BA 4GBMA 1EQQA 1VCOA 1E2MA 4LHYA 2ZVPX 1Q0UA 2DWOA 4YCUA 4HJ5A 3H84A 3K0AA 4RD3A 2C98A 4BFVA 3B82A 3FFAA 3OF5A 4GL2A 2QTHA 2OAP1 4DV6L 1GNRA 1PH8A 4EIWA 2ORWA 2R62A 2IF2A 2W2TA 3V00A 5F98A 1VG9B 5DI3A 4N0EA 1HR0L 1WB9A 1T8TA 1I4DD 2OFXA 3GMTA 1SQ5A 1U98A 2X1VA 1FQKA 2ANCA 1UEBA 2R93G 5EZ5A 3A8TA 3NEMA 1X3EA 3PCOB 2JLUA 1NIPA 3B5JA 4D26A 2A69C 1RKBA 4HDOB 3SNHA 1UBEA 4P33A 4C3JH 3A4NA 3PR1A 1JPNA 3LX8A 4XWAA 2E87A 3L0OA 4DR5L 2QORA 2PCFB 2Y0SE 2OCAA 4L9SA 4URUR 4B2PA 4B3TQ 1RIPA 3KX2A 4D4LA 5M3FH 2WJYA 2KHJA 1EYGA 1N6HA 3CO5A 2RAPA 1X56A 2A6ED 1B0UA 2V1CC 4DR6Q 4BEJA 5IE8A 4EX5A 1SMYC 1G4UR 2GAAA 1SR3A 3HU1A 2A3RA 3GLFE 1LY1A 1QHSA 4GOPB 3EW9A 3FHWA 4IEIA 1Z08A 1MJCA 1SVWA 1W0KD 1NJGA 4YCVA 5C44H 2HHHL 1GNPA 3J81j 1W5SA 2BWJA 4WOPA 3R7WA 3LW7A 3WBKA 1VCNA 4BFSA 4D6PA 1W0KA 4DV7Q 4OONA 4HR7B 1XCPA 2CHQA 1G19A 1JNYA 1QF9A 2KBNA 3IEUA 4PR0A 3LWUA 3GEIA 1AS3A 4JI0Q 4DR7L 5C44G 3GFPA 4PHTA 3NENA 1C0AA 1B9MA 4HEJA 2RGBA 3FMPB 4WZAE 4EPTA 3IPYA 2HYIC 5K8TA 5DHAA 2A78A 2CK3D 3ZZTA 5LMUL 2WB1E 1TX4B 4LK1C 2HYDA 4TYNA 1HQMC 3CX7A 4KFUA 1WQ1R 1E94E 1UKVY 1VQNA 5FPSA 5LDDC 2B7CA 1R4AA 1DARA 1TEXA 4JI7L 2BE5C 4EFLA 2P0EA 1TADA 3ERSX 4L5TA 3TIFA 2K52A 2BIFA 2V6JA 5EE1A 2XJ9A 4QKQA 3CNLA 3PGZA 4JOIC 2F4VQ 4M1WA 1LABA 3CH4B 3K9NA 2WJVA 4DC9A 2ZETA 1XB2A 4QBHA 2ZI4A 3U7EB 4AYXA 3I4OA 4PV1C 2HT6A 2XNDA 1YITA 2A8VA 2CMKA 1SXJC 5JSZB 4B6FA 3EA5A 5A35A 1TNDA 4O2LA 1GP2A 2UXCL 2GESA 4E07A 1OLOA 5J4HA 1XTSA 2MO1A 2WICA 2ZYVX 2RHSB 2VNUD 3E2IA 4DR7Q 5M5WH 1AM4D 1IOZA 1TQ4A 2C5LA 2YC4C 3K8YA 3P1JA 4IEEA 4ILEA 2BM1A 3GLHE 3GTGH 3QEJA 3VR5A 2AMCB 3WBJA 3T1YQ 3JVVA 5FOTA 2HLDD 1C4OA 5B57C 2ZE7A 1PLKA 4CEIB 1US8B 3NDPA 3TJZA 5FLMG 3U58A 3ZJYA 3CONA 1Y1VH 1RYHA 4BBRH 3RSLA 1XX6A 1G20E 1H8EA 2WWFA 4AD8A 4A93H 4JI5L 4JJKA 2RCNA 3S1RH 5J47A 2NZJA 1AZTA 1K83H 2BA0A 1UWVA 4MRSA 1Q3HA 2OILA 1G3UA 4Q02A 4PHGA 3HKZE 1DADA 3GTLH 3CC4A 2NN6I 3GJ3A 3L0SA 3OAAA 3B8HA 4KYIB 1NLYA 2WJIA 4KN4C 4C0HA 3X1DA 3GLFA 2LKDA 2PT7A 1S8FA 4KYUA 4N3NA 3WMEA 1WCV1 4RFSA 4EQ6B 4X62Q 4LBYA 1BDOA 1P4SA 4MYTA 3KJOA 4RFVA 1PUIA 4GOJA 4UJ3A 3Q5EA 1IAQA 3BJIC 5SZJA 4E03A 4JV5L 1X8JA 1MRNA 1PV4A 1VF5C 1NN5A 1VQ6A 3K0CC 1MIUA 4BY1H 4KN7C 3TR5A 2YWGA 4A8JC 2W00A 4LV8B 3K53A 4DLUA 3KQHA 2QAGC 2WIAA 3KQUA 2VYFA 5JECA 2UKDA 2QENA 2WWGA 3A4MA 4AWXA 2K50A 2E74C 4PSKA 4DKXA 5J3BA 3GJ8A 1FMJA 2FN4A 5KUTA 2QEQA 2J1LA 4US1R 4A3KH 2GWHA 2KSQA 4B48A 4K8OA 3BU2A 3S2DH 2V4ZA 2P6RA 2DCUA 4LC1A 2QNRA 2ZI3A 3RRMA 1IJFA 3RN5A 1CJVC 5HPYB 1DE0A 2KJQA 5EE3A 4HZIA 4OGQC 4YY3L 2UXDL 1AA9A 1YE8A 1PZNA 3CRVA 3FDIA 2VS1A 3KL4A 4QJ5A 4CDGA 5IYCG 3WY9A 2L15A 4US0R 4YHHL 4OO1G 4WA7A 4XWKA 1VYVA 1DAGA 2KCTA 4M53A 1J7KA 1G1MA 3B78A 4NYJR 4BA2I 2IX0A 1VYUA 1N5IA 4MTNA 2PZGA 4TSFA 1XMOQ 1ZD8A 2ZJ2A 2ZE6A 3SJZA 1E1OA 2JA5H 2Z83A 2WJGA 3F2BA 4FMDB 1GM5A 3CW2A 3FTQA 1D8LA 3WDNA 1MKYA 5LB4A 4H0LC 4GP7A 1VQJA 2CNWD 2PBRA 2ZRDA 1CSQA 4MYUA 4TT3A 1OH5A 3KTAA 3J81k 4UP9A 2C9CA 2LCFA 3O47A 4M2LA 2GEVA 2QY9A 2G88A 2OTLA 2G83A 4IOLA 3S1AA 4TYYA 1YJWA 1TWGH 2GCOB 4DV6Q 2FSFA 1NJFA 1KQSA 1YIJA 1T3HA 2B92A 2F7SA 1NN3A 2C96A 3LXRA 4EAQA 1EG7A 1KI7A 1GFIA 3AB9A 2Z4RA 4HJ9A 1XNQL 3LA6A 3QVVA 4GZMA 2Z6VA 2VZAA 1M74A 2QSZA 3LRPA 1X54A 3A5UA 4DSOA 1ZKOA 5LMUQ 1Y69U 4DV1Q 3LW8A 2CJWB 4A2PA 1XZQA 2ZSAA 2WAQG 4BLTA 1GRQA 4HJ7A 4JLDA 1TPZA 2Q9AA 2FFQA 3WP0A 3LVQE 4EDHA 1GTVA 3Q8XB 3GCGA 2JDIA 4NYMQ 3D3QA 4OHZA 2H16A 5JS7A 3Q72A 4UPAA 2FOLA 2VSOA 1QRAA 2UUAL 3AEVA 4MGZR 4TTRA 2IS6A 1VYTA 1YJNA 3AVOA 4RSGA 2IT1A 2F1JA 2NZ8A 1YJ9A 3CWZA 4PC7A 1I50H 4Q1AA 4RCYA 5KPDA 3ZQ6A 3K0EA 4ABYA 5H8WA 1CIPA 4JI1L 1YRBA 4DDVA 2JEAI 4DR1L 3T51B 5GQOA 4A75A 4DR6L 1KNXA 1QHGA 2B8WA 4K46A 4OQLA 4JLBA 3KKOA 4FCWA 1W48A 2ZJ5A 5D3QA 3SFZA 4XTCS 1IY1A 4QJ4A 2O0KA 3K8AA 1VPLA 1N6NA 4GN4B 4U7DA 1IBLL 2K5UA 4RCNA 3TVDA 1ZNZA 3D4RA 5C4JH 1Y1WG 3QXJA 5M5XH 5HKKD 4O0MA 4JSYA 1L4YA 1KTVA 4FMCF 4IVRA 3SDZA 3BE4A 3NH9A 2GVBA 4G5GA 1SKYB 5DI9A 1XMIA 5F2EA 1Y1WH 4JI3Q 3GTPH 1YRAA 4M22A 3PO3H 1WCMG 5C0XJ 2AHOA 4OXPA 4A3DH 1P60A 2A2ZA 3U61B 4LX0A 3I8XA 3BS4A 2XITA 4IO9A 5E7MA 4PPNA 1VKJA 2Z0MA 3TQCA 4HB0A 3R7WB 2IYUA 4DJTA 2ZSFA 3VDYA 1RL2A 5H1YA 1MO6A 5HE9A 1QHIA 2XJ4A 4NTZA 5ANRB 4Q4JB 1E0SA 4BA1I 1OFIA 4GS3A 4U5XA 4FN5A 1VTKA 3VU9A 3ETLA 2C78A 1JXOA 1COWD 3AKEA 4UXIA 3UPUA 2FZLA 1KZGB 1YR9A 2GETA 3B6EA 4H44C 1XMJA 3HYTA 4CT4B 4EPXA 5BW8A 4MKFA 4V0NA 2R8RA 2RHDA 1Z0JA 2B7BA 4A3EG 3B9QA 4DK3C 1JT8A 1XEWY 4IJMA 2UXCQ 4B6EA 1ONLA 4DEYA 3KLRA 2ZRNA 1XMQQ 1S0UA 1UBFA 2QMEA 4HAZA 1MO3A 3SR0A 2A6EC 3EN2A 3AGPA 2GXAA 4DR3L 5JSZA 2A6HD 2C04A 1X8LA 3ZQJA 4NMMA 5C18A 2AHOB 3B7GA 4LF6L 1NVWQ 4JI6Q 4UNNA 1NMFA 4IFDG 5IWAL 2PX3A 3A5ZB 3HGBA 1K8OA 1JJVA 1IXRC 2OAQ1 2WWHA 4R4CA 1T6NA 3Q3JB 2D06A 3CC2A 4DNRB 1F2UA 1NY6A 2QE7A 1GUSA 4JLAA 3ULJA 2OCBA 3U4VA 2JJ1D 2PCLA 2VIIA 2GCNA 2A9KA 2NOAA 4LJYA 2PEYA 2QRNA 1XJ0A 2UVQA 4W5WA 3I5YA 2J0QA 1E9FA 4C2TA 3IEVA 1G5TA 2Q3HA 3BC1A 1K5DA 4OWXB 1F48A 2P67A 3WRYC 1N5LA 1T3LA 2I1QA 3REGA 4OO1I 4QOSA 2YNMA 4C0LA 4NP6A 1PH6A 4JS0A 2VBCA 5JEAG 1KI6B 5JFGA 2HDNB 1FQJA 4UP8A 1CR0A 4UY8C 2EQSA 2IK8A 1R2QA 3ZZ0A 4C0KA 2CKZB 1XD2B 3W5IA 3X1ZA 4DR1Q 2PQAA 4TVAB 4DZZA 3R20A 2EFHB 1FJGL 1CR1A 2BJWA 1EX6A 3CM0A 3T1VA 4DSUA 2KE5A 2QMOA 3CR8A 2XZPA 2X19A 4TYQA 4BQSA 1Z6XA 4DDUA 2EIFA 4RCZA 1H9KA 2RGAA 1FNMA 2NO1A 5HCIA 4U00A 3T1YL 2EXDA 2OWOA 1KI2A 4DB2A 2XTZA 4V0ME 2ODWA 2VP9A 2ZE5A 3AFQA 3THYA 2FPLA 1L0WA 2ZR9A 1YBYA 5L3SB 4C2MH 3KB2A 4MYCA 1LTQA 1VIYA 2GBLC 4DUZQ 2ZRBA 3I72A 1P5ZB 1TU4A 2QQ0A 5FBLB 1YJ5A 1MT0A 1E69A 1S40A 1VCMA 2OM2A 1W5TA 1J2JA 2PNRC 3U9SA 2K33A 2BH8A 1R8QA 3T35A 2OHFA 1RFLA 3QIAA 2YOGA 2K32A 1W36D 4NYIQ 4YXWD 1I4TD 2P5TB 1KJZA 2ZRKA 1GKHA 1GVPA 3C14C 1NE3A 2F4VL 1EFRD 1UADA 2QM8A 4IFBA 5P21A 3C15C 1LFDB 3HJNA 3SI7A 3E9IA 3SYNA 3CP0A 1YZKA 1EFHA 2YC2C 4CEIA 2QP9X 2RHQB 2X2FA 3NTUA 1YR6A 5CLQA 3DOEA 1G21E 3FE2A 2KI5A 2JA6H 4JI5Q 2IXGA 2OT3B 3H0GH 3CBQA 4F7WA 3AF2A 5BN3A 4P4UA 4PQRA 5EUQB 5CDFE 3THXA 1XMOL 1XTQA 4OHXA 3RRZA 3NC0C 3EIQA 3Q7PA 2BEJA 2FU5C 4JT4A 2Q3MA 821PA 2YTXA 5GAGC 1EXMA 2OBNA 2IS1A 4TQ9A 4Q19A 1QVCA 4JBMA 2DWQA 4B3FX 2GNOA 4YY3Q 1E2QA 2J41A 3K81C 1II8B 1LB1B 5FI0B 2N46A 3TRFA 5JI3E 1XXHB 1JR6A 1Q1EA 4I1UA 1ZNXA 4H13C 1N32L 2G1JA 1B9NA 5IP7G 1OH6A 1L1OC 5HCNA 1UE6A 1CI3M 4JBWA 4G5RA 4LFBL 3LLMA 1VQGA 4IOMA 4EJSA 3BB3A 1Z6HA 5IYDH 3OTOQ 3F5FA 2F9MA 1JE5A 2BH2A 3EX7C 4Q48A 2ZJYA 3K0CA 1U90A 4RD2A 3VU9B 1KO8A 3UXMA 1KI1A 5LD2C 1XD2A 2Z4SA 3BRWD 2CK3A 2C2HA 1JECA 4MYHA 2QAGA 3CCJA 1L2FA 1X9NA 1GKYA 1PMRA 2OZEA 3EARA 3MJHA 2JXMB 5E7NA 4GLXA 2R92G 1DAFA 1DOAA 2WBLC 3DDCA 4DV4L 4L9WA 4IOCA 4IQZA 4JMPA 1OFHA 4X8HA 3ZH9B 4CF7A 3CRLC 5EXPA 3EBEA 3BFXA 4M9SA 2XTNA 1CRQA 2JLVA 1Z0KA 2IA5A 5KHOC 3W6PA 4Q4LA 1YZNA 5DSZA 5IF9A 1KMHB 2G0NA 5AJXA 3I62A 3L8ZA 2C77A 3T1HL 2CL6X 2RGGA 4JI8Q 4LJ6A 2ZAOA 3SFVA 2IX1A 2WSSA 3IBYA 4C0AC 3M7NA 1G3QA 4HLDA 4EJSB 3K09A 2IXFA 3ICQB 1N32Q 5DYIA 1XMQL 1GVNB 4NCNA 3ND9A 1Z83A 2ZANA 3DZDA 1N6PA 2GZAA 1GUOA 3G4SA 1Q90A 4DV5L 2DB3A 4F91B 3UE1A 2R93H 4DK0A 2VQFQ 1IY2A 4KJZA 2GTPA 2Q2HA 3CNNA 2BBOA 5AUQA 3CAMA 4B43A 5ELXA 1M6NA 4W9MC 1LUZA 1UEIA 4X66Q 3FHOA 1W3SA 1J90A 2NVXH 2B63G 2JIZD 2R6AA 4QL5A 5FR1A 4R7ZA 2OQKA 3AQ4A 3CRW1 4EPWA 3ADDA 1TEVA 4LOAA 3H94A 1XEWX 2QAJA 2WAQE 3ZVMA 4A92A 1IXSB 4NZYA 4Q4AA 1FNNA 5KSOA 1E22A
chains in the Genus database with same CATH superfamily
2HWKA 1E7RA 6CHYA 4I1OA 3KXLA 2H54A 2J9GA 3RC9A 1T5LA 1UQRA 1T2FA 4WL0A 3W5CA 1N0IA 4IFDH 3VKFA 5EKIA 1Y8CA 1QHHB 3QY9A 4HBGA 5HFNA 3RYFA 3WYFA 1F8UA 1EFAA 4JVSB 1HPLA 1M6HA 3DZHA 3PLRA 4BFTA 4ZV4A 2BSQA 4ATNA 1UKZA 2QTRA 2OMKA 5GADC 2MPMA 1AOXA 3G6JB 1ECFA 1MVOA 1SKBA 3DFMA 3F3SA 1JIJA 2FPRA 2VZEA 2ZSIA 3NBUA 4IKPA 4W1QA 1Q81C 1G17A 1L9XA 5KQRA 2NX2A 3V6LA 1RQGA 1ZJ5A 5CC4A 2YWXA 4HAUA 4ITVA 4U2GA 2XECA 2J46A 3LHIA 3PJFA 4DIOA 4AQYB 2O19A 2HTFA 1LI4A 1N5OX 3PEWA 2W58A 1A9YA 2LIVA 3OJWA 2WSSD 5FO1A 3P97A 1IW7D 2PWAA 3R6LA 4N7JA 5L9AA 1O95A 2VPQA 2GGSA 3LYUA 5HQJA 3WHPA 2X7XA 2FMMA 4YAEA 1R0BA 1U8FO 1WVGA 3PFIA 5BNWA 1S1CA 1DEKA 2Z6AA 1V1RB 1X14A 2EY2A 3HQ4O 2W6QA 2VHEA 4BY7B 1WXFA 3SC2B 1QIGA 1U81A 3B1VA 3B1JA 3BSYA 2PX5A 1VQAA 3HA2A 1BE0A 5EE9A 5JY1A 2QM0A 3UK6A 4CEHB 3S17B 5JXIA 1GPWB 3O4GA 3QEBZ 3V05A 3Q7TA 2H2WA 3FUXA 3PGMA 4D9HA 4U2KA 4Z7QB 2J8ZA 1OI4A 2B4YA 2AKYA 2VATA 1HR0W 1CB7A 4HZUA 4PBRA 2ZZKA 1OZFA 2GJAA 2XLCA 4IX9A 3TEJA 5BVGA 1OWOA 2GS9A 4L27A 2CLSA 4B83A 3F6BX 1EVZA 3ZKWB 2QUBA 5KOIA 1EUDB 1Z4NA 2EWMA 1HK7A 3CX8A 3E84A 1ANKA 1QM5A 4EB3A 4OKIA 3BDOA 1RZVA 2PLNA 3L77A 3MZ0A 3MT9A 4FYHA 4LXTA 4FE3A 4Y2GA 4QSHA 4G0VA 5JNRA 2WC1A 3WNQA 2DUJA 2J9RA 3FZGA 3DQZA 4DT1A 3TFWA 2C61A 5C2JB 3VTZA 5JZ9A 1BS1A 1AKEA 3TW6A 2JI7A 1Q0ZA 3C45A 4X65L 4HOYA 1Z6TA 5DRYA 4W1SA 1KYIA 2AJCA 5SV2A 5TSDA 3S28A 4B33A 1UFVA 1SFOH 2I6QA 3NCTA 1ZBQA 2A14A 1ZOSA 3QXXA 1QIIA 3ED1A 4MR9B 2OMEA 4NH4A 4L95C 1PNRA 4OHJA 1P9OA 4LYHA 3OW2A 1PFYA 2EATA 4LZLA 1SAPA 4XM1A 1BCPF 1G21B 4XB6B 4Z51A 4H0FA 3HCFA 2DY1A 2VUHB 3MFGA 421PA 3K6SA 4I46A 4DK1A 4KH1A 1M83A 3A1FA 1SXJD 4F7DA 4W9MC 3LKZA 4YO7A 1LPAB 3KAJA 2K4KA 4I4CA 3DUFA 4LNUA 4K5QA 1F9PA 1T13A 3W2IA 3TIGA 1FLVA 3J7AV 4DA7A 1GAQA 1IWBB 1GUZA 3HMQA 4JC4A 2NB0A 3PWZA 4GYWA 4H4CA 4J8PA 2JFXA 4BJ5A 2JFGA 2XRSD 1MC8A 2N75A 4JUAA 3A10A 4PTLA 1KMIY 2A94A 3D6HA 3GNTA 5E95A 3G9TA 2E2HH 4DW8A 3DMNA 2PJUA 3FDXA 3CQZB 1D2AA 2YXBA 4IQFA 2F67A 4YRDA 3HXLA 4CF4A 4O33A 3TUZC 3A4TA 3WWCA 2Y77A 2ZAIA 3EASA 3IHKA 4Y2VA 4DRYA 5LNK6 1TAUA 1C9EA 1FDOA 4DFAA 1U0RA 2BMVA 3LPMA 1QZGA 5A9TA 1JAXA 3E5HA 4MTLA 4N5NA 5DAUA 3DO6A 3PKIA 1PJSA 1Z39A 4JLVA 5BRJA 1R74A 4ME3A 1SBCA 1YVDA 1LVGA 3IP3A 4XYGA 3TW4A 4YCMA 1J2UA 4JODA 4L8GA 1CJCA 3VC7A 1EH5A 2IDJA 2EPBA 1GY8A 4LOKA 4LWOA 3MWEA 5EE0A 4FX5A 1UUFA 3ESRA 4IZIA 5HQ3A 3COJA 1ELOA 3VNRA 3DONA 5LOVF 3WSTA 1H2XA 4GKVA 4BAUA 1V0JA 3PXGA 1VQ8A 3H9CA 4FONA 3JWHA 5CB6A 3ZK7A 3ZCUA 1E4OA 4YR9A 4N8EA 2W6PA 1VCHA 1SPBS 1NVXQ 2BMJA 1RYBA 2Q3EA 1YTUA 2HD3A 4R84A 4A3FB 2ONKA 2GNAA 4DIEA 1L8LA 2YMLA 6Q21A 2AOWA 4N7BA 5T8KC 4XW2A 4E5YA 2D1SA 3G0GA 1K3RA 1EOTA 4W8GA 4JI8B 1H0HA 5HIIA 4MQMA 4NBKA 4WEOA 3QUAA 4CMIA 5CB4A 3CEAA 3NUGA 4F5WA 4M7OA 3KK0A 3CYFA 3PNBA 4L73A 3L7NA 4NZPA 5ALDA 5JVG3 4A3BB 1Q16A 4C6SA 3LNTA 1Q3KA 1JG6A 1WKBA 2WF6A 5I4DA 4UUOA 4BLPA 4EQ5A 1KJ9A 3HDQA 5FPYA 2H65A 4BQNA 4ZI2A 2JLXA 1YASA 3C2QA 4LWQA 3VSBA 1LI5A 2O2JA 4GBED 4D4KA 4CTNA 1EWQA 3OQ1A 1C8CA 3QE3A 5KZMB 2D0OA 1H05A 3MB5A 4GOXA 3UPTA 3AI3A 4GGOA 1RZRA 2MYPA 4BB0A 2CBZA 2CFRA 1ZD1A 2J0UB 3BWDD 3IMFA 3O8QB 3OTGA 1M6EX 4OU4A 4XSHA 4OBEA 4EPVA 1DBSA 5KDOA 4ZOCA 2C3OA 1H2FA 2PL3A 2ZK7A 3OZIA 4MVJG 3WGLA 1SCUA 1O4VA 3MA0A 3A8KE 2ONYA 5CNJA 1T9HA 1X7ZA 1M1ZA 5AYVA 1RNLA 5I9LA 1Q50A 3R8CA 4E6EA 2AKEA 1MF7A 3KR1A 4A1OA 4ZCTA 2UUAB 2GPJA 2YYAA 1GUAA 1RR6A 2Q9BA 2ZIXB 4GN3B 3ER6A 3FDZA 5JI2E 1IM2A 1M2EA 3BZDB 1GOZA 4LGVA 3R75A 2MIIA 3BJZA 2G77B 2R5FA 1ENCA 2G36A 2PMEA 5JEEA 4QT4A 3MXOA 2A5GA 3KVNA 1QH1B 2ZRCA 3HNOA 1RWWA 3UWDA 1NSTA 5CYFA 1F2VA 3H9BA 3UT0A 4JVLA 3EIVA 1AN9A 1Q77A 3TFOA 1NJIC 1O9HA 3VTAA 4B4WA 1B2TA 2XT0A 2R7ZH 4JH0A 5D1HA 1YE5A 4ENUA 2I6UA 1QVRA 3LM8A 1J5EQ 2HXSA 4Z9AA 5DWVA 4RMJA 1E3MA 4FJ1A 4KY6A 3B1KA 4B2LA 3B3GA 4IW3B 1WHSB 1FK8A 3NIWA 5LSAA 2ZOSA 2FPPA 4UEJA 2YMPA 3I4NH 3NRBA 5B7QA 2UXDQ 1HYBA 2OZKA 3OMXA 1EESA 5BR8Q 1GPBA 4G41A 3WSWA 4UAVA 2PZUA 4L5RC 2D4HA 2J3HA 4I1IA 4MJ3A 1CR2A 2EXZA 2NPFA 1XP8A 1L4FA 1UPCA 1LCIA 3MJFA 4WZBE 1T2EA 3KWMA 2JZCA 2FXVA 1YFZA 1ZD9A 4Z49A 2WU0A 3F9CA 1R6BX 2X9GA 1XZKA 4Y98A 2I4RA 1GN8A 4LCJA 2QPTA 4MRRA 2I4IA 2XUGA 4WW0A 1GL6A 3CT6A 2AYYA 1TQHA 3OQBA 4MGEA 2O8DA 3C8UA 4C03A 4FDAA 2OGWA 4ZDKA 4D0SA 3FKSD 2C83A 1ZQ1A 2GHQA 4OIMA 3ZUGA 4QUKA 4N6GA 1IEXA 2IXEA 4I8DA 4PX9A 3NVDA 3MTQA 2FZ4A 3MLAA 3GFQA 3RFXA 2Z2IA 4LHVA 3MFYA 3ICCA 3R2TA 3OPOA 1A0IA 1U8ZA 1PH2A 4LKOA 1E1LA 2FWNA 4TT8A 3L84A 3VR0A 2FWAA 3CH6A 1F8FA 2C29D 1M3SA 2FHTA 2XVXA 3K6JA 1XVLA 3NXKA 4PSUA 2OQRA 1K6IA 4IXWA 5L7YA 4YQZA 3UV7A 2POQX 4CLOA 4FMDF 2FJUA 3ICWA 3QB3A 5I6DA 1Y6JA 3DJFA 4YQYA 5KTMA 4FCCA 4JC5A 1AIPA 3HOXH 2G5TA 4HYEA 4TLBA 1WAMA 4LA4A 1E1MA 4J3FA 4Y7NB 3CMAA 4YN3A 4YCNA 1UZAA 1T43A 2DBZA 1ZXLA 2VJOA 2VF8A 2WJ4A 1SNMA 1YTLA 3DMGA 3HP1A 4BNUA 1CEYA 2QG4A 1DUSA 1ULUA 2OV3A 4GT1A 5BRAA 1SXIA 1X3LA 3QH4A 1BCPC 2QD3A 1OZAA 5CYUA 3OOYA 4KXNA 4TS1A 2CMFA 2W4QA 1C0EA 4GZ3A 3E53A 4MJ7A 4HTHA 2CL7X 2EG5A 3HU5A 3KWJA 3EE6A 4WXPA 4U0JA 2WF9A 5D84A 2LKVA 2BGNA 2EQBA 4ML3A 3OFSA 2OUKA 5CM8B 1SMKA 5F4BA 3TR0A 2IUSA 3HBFA 5ELMA 4ZAWA 3E9DA 8ADHA 4X65B 4HS4A 2VLIA 5IT9A 3WJ7A 2ZRHA 3GLGA 3MYRA 3ML1A 3QK7A 5LMZA 5KPJA 1XEXA 4NE9A 5IGFA 5DZSA 5JCOA 1SMXA 4PZ0A 5LWQA 4KQ9A 4WT7A 1UBCA 1B76A 1Q0PA 2I67A 4P3XA 1CUCA 4QYIB 5GZ1A 5LKRA 1FW6A 2L11A 2N1MA 2BC9A 1KEZA 1QG4A 1JJ7A 1G8ZD 2OO3A 3SQXA 5A4AA 2CLFB 2WFLA 2APJA 3ITNA 4FGLA 5D5HA 1HMPA 4GLLA 3AL3A 3OO0A 1IKMA 1VECA 1WMDA 1PX2A 1KIFA 1U9JA 1CT1D 2FRDC 3AVQA 5BN5B 2OXTA 4EKDA 5DM70 1KAGA 1VJ5A 2C58A 3QYFA 1AUXA 1JQYD 3UCFA 5DKFA 4AG6A 4PGGA 4R8NA 1ZCAA 1WEHA 3RNOA 1ISHA 3HNRA 4J8QA 4QHSA 2ORED 1BCPB 3ROMA 4CLRB 3RABA 4QUFA 4OSPA 2G9HD 2G9ZA 3ZKWA 3ODPA 1WXQA 2AMFA 5BRNA 3T1HB 4PZYA 2ZDHA 3PEUA 4FZ5A 3LKVA 5B3AA 2IS4A 2ADMA 1WCMB 4GF5A 3I3SR 1TWHH 3UFBA 2XKKA 5EJ4A 2WLTA 2GJ8A 1Z88A 2L69A 3WIVA 3ZGYA 3QX9A 2EZ9A 4S1OA 1RAGA 1TWAH 2P69A 3AR2A 2CNOA 1N4DA 1FU7A 3E8MA 1SDFA 2JNWA 3N2GB 2OCGA 1CFJA 3S8EA 3OC0A 3V32A 7ABPA 2QYHA 4YI5A 4IYJA 2C59A 2PGJA 1DIAA 3EA0A 5A0VA 4H7FA 1DS6A 2GX6A 4A4DA 2UYHA 2V58A 3M6WA 3MTEA 1PO7A 1Z5NA 3JY6A 1WUHS 3G2HA 3STWA 4TVSA 2F0VA 2H5XA 1MVNA 5C8YB 1Q0TA 3DMPA 4PWZA 2ISQA 4JLMA 3CRKC 4HJ8A 1HH4A 1QV9A 3L93A 3F73A 2X8AA 4EJ2A 1I9GA 5ICCA 2Q6KA 1J8YF 2OXIA 2P6UA 1EM8A 3PXUA 4PU0A 3VYWA 4EB0A 3P9XA 3RROA 3V2IA 2ZJ6A 3TRDA 4EG8A 2IE8A 4M8NE 5CA0A 1JH9A 2JAHA 1DQSA 3MM4A 1HURA 3S24A 2I4OA 2AFVA 3GLHB 3MMNA 4PC6A 1KE1A 1V8PA 2WIKA 3H1GA 1Z7EA 4E46A 1VRWA 4D3ZA 2GF2A 5DLEA 3VAZA 4AECA 5H0IA 4AJNA 3KBXA 4JI2B 2DJIA 4EGVA 1R0WA 2NVBA 4JNCA 4LXHA 1LK5A 4B4DA 2JLCA 2VJPA 4HFMA 4F5DA 4B80A 2V0GA 2Y1DA 2P4UA 3MSCA 4IIHA 3DO8A 4JXXA 3PGJA 1TS2A 5CV5A 4FGKA 3LWEA 1AQLA 1N6RA 2I1LA 2CNBA 2YUTA 4RZUA 4AY4A 1H9BA 2Z6BA 1Z15A 4H3KB 1R6UA 5FWYA 3GVIA 5LQUA 1A5TA 1VQ5A 3NTQA 4M76B 3X2FA 2Z8ZA 1OWNA 2Z09A 3LDAA 1SG0A 1CY6A 2O1EA 4DLKA 1U1DA 5CFRA 1ARZA 3IQDB 1HRDA 2HN9A 3CC8A 3W4KA 5JCPA 1P18A 4C5CA 4NPSA 2YWJA 2AUJD 3AKDA 2PI2A 2IWHA 3VO9A 5LPNA 1U4PA 3SXUA 3QLTA 3SC4A 5LZ9A 1P3DA 5IHPA 3R6WA 1X19A 1XZGA 4I50F 5J5AA 3U4CA 3NWJA 2R8PA 3FA2A 4JI3B 4XOIA 4H77A 1TT5A 2PBLA 5GOTA 3FH0A 1KDVA 3KOOA 3IHTA 1Z38A 3EDRA 3SOPA 5FWYB 1V9CA 1AKUA 1FU4A 2W6OA 1EEHA 1I4LD 4B71A 2B2UC 3HO6A 3TZDA 2WHRA 4TMWA 2CCKA 2M6SA 4GZ5A 3QYPA 3ENKA 5FIUA 4MUEA 4JY7A 3GGSA 3VDMA 4EWLA 1VIDA 1Q7YC 2J9ZB 2WYVA 4HRXA 1YIDA 3Q2IA 1NUPA 1X3SA 1F2LA 4D0LB 2HDOA 4G5QA 4P32A 4QREA 4ZEOA 3HLTA 2NZ2A 4FOLA 4HLCA 4BMNA 3N9IA 4ZTBA 1V35A 1AKWA 2OK8A 5J2UF 1WRBA 1NU6A 4A6PA 3I7FA 1YVEI 1KH3A 2J4CA 3EF1A 3T9CA 3U3XA 2VCYA 1N2CE 4AZSA 3S3TA 3ZGVA 4R71A 3HJFA 1LQ2A 2NPIA 3KT3A 4B84A 4GMHA 2GXUA 2YASA 4BVAA 2Y2UA 3ANSA 3FVRA 3NOVA 1T0PA 4LRSB 2QBYA 1MT3A 1FMLA 4WK0B 2HA7A 4WLEA 2CXSA 5FWXB 3UAVA 2AN9A 4TKVA 3KBBA 2B8GA 1T6ZA 1FRNA 1ZVVA 1BKSB 4JOBA 1DT3A 3G68A 4J3JA 2FLVA 3S2IA 3U7RA 5FOQA 3C5HA 4YRRA 3PJRA 1GDDA 1SUWA 4K9KA 4QQ8A 5B3JA 4DWOA 5G02A 3KQLA 3FPEA 3GQBB 5LMNL 2Q62A 5ELOA 1GV1A 1DBIA 3P2YA 4GMFA 4X6LA 4LGMA 1S5ED 4PYNA 1DRWA 2SCUB 5JNVA 2GDJA 4Q9NA 1UCFA 1E4YA 2HUPA 4KJXA 1C9OA 4R9UC 3WWEA 4PG8A 2EYJA 1II9A 3DEZA 4A3FG 1CS4C 3OIUA 4PICA 2ZB4A 3BD9A 4URWR 1ZWKA 3OP1A 1OLUB 3FOAA 3UIEA 3O13A 4GSYA 2PT5A 4W9NA 1B26A 3RUZA 5L3VA 1QWYA 3G5TA 1DP4A 5HCUA 3SGIA 4XJSA 1OR8A 1XZEA 2LDXA 2C20A 2XGMA 4D9GA 3NGMA 4Q3OA 3LWDA 2FDRA 3PENA 4F38A 4NOKA 1BXTA 2QN9A 5KTOA 2JJ2A 3BGIA 4X1OA 3LQ4A 4NCHA 3AUYA 3EROA 2GM5A 1WSWA 3HFJA 4K86A 2EW1A 1XN4A 1RT9A 2DSNA 1QFSA 2PI2E 1PA6A 2W37A 3UV6A 3B2NA 3LFTA 4PZ9A 1MVLA 1WUKS 4ECAA 9ATCA 1G98A 1FB5A 1K4MA 4B75A 2JA2A 3GLIA 3OMLA 2V9PA 2I65A 3RRBA 1LS1A 1Y3CE 1Q21A 4M9UA 5DX8A 1KP2A 4KK3A 1RIFA 7REQA 1LWOA 4Z8XA 1UBMS 4UVGA 5BWMA 4B3RL 5GAJA 3CH7A 4OL7A 1ZI8A 3TLEA 3NYWA 4YRGA 3QOWA 2ZAYA 2V7QA 1T5IA 3DQQA 5EFOA 4ZCKA 2VDJA 3HWWA 4W6QA 3VM6A 1OCEA 3MTAA 1U4NA 2PGXA 2BGIA 2V6BA 2ATIA 2F3IA 4TLMB 3OY7A 1T15A 3FSEA 1T35A 4HBZA 1EB8A 3HOZG 4PSCA 1DBQA 2A0UA 1Y0BA 5KC8A 3H8WA 3A6LA 2ZBVA 1W19A 1W4LA 1FDVA 3NYQA 4HUQB 4A8JA 1XZ8A 4CT0A 5CFMA 1LT6D 4LDPA 1GPKA 1EU4A 1OV4A 1ZK3A 3HJAA 4RLSA 3PIO3 1JE0A 4OHYA 4EGQA 3G1UA 2CXOA 1SVIA 3UJ8A 4MKRA 3LJKA 1IZZA 2F3SA 5CYOA 3D0KA 3SHOA 1VQHA 4I55A 1S1MA 3HRIA 3PQ2A 4KWEA 2F1IA 1QVAA 1Y6RA 2VRBA 2R65A 1Z36A 4GUAA 4I4TF 1JWSD 3RZOH 3O1JC 2NTSA 3TN7A 1IRXA 1S5PA 3Q7QA 3NHBA 4G84A 2EP5A 2FK7A 4OHBA 1H9MA 3GZ4A 3IVAA 2A1AA 1O03A 3H11A 2C5AA 3OETA 3D7KA 4AUKA 4G1FA 4LHEA 1LVUA 4O4LB 1E3DA 2ZXPA 2QIPA 3R0IA 4U7FA 4PZ6A 1O9GA 3A6PC 2QG9A 3RWOA 1HR0Q 5JJLA 2VHWA 3EFXD 2N0SA 2WABA 4TRMA 5DCWA 4MB2A 1DZ1A 3MWDB 2WKRA 4MUGA 2ET6A 2GCPA 3DXZA 4DNIA 4WJ3M 4EQNA 1A69A 2FSGA 3EGEA 3FGPA 3M7IA 3Q7IA 3T06B 3GEGA 3UJCA 2J9YB 3I9KA 1G21A 2EL9A 1MZPA 4W5NA 1NXQA 1EG2A 1HUMA 2GAFA 3UG7A 2QD1A 2B3TA 1IRIA 1X39A 3ET5A 2RDHA 5E8RA 4AYBG 1BX1A 3DHWC 1B23P 5ISRA 4JBXA 3PWTA 4Q4HA 3FYSA 1GTJ1 3IMKA 4R8IA 3K32A 5SYMA 2ZJQA 3OCCA 4AO8A 3S8MA 5B2FA 1QP7A 1JB3A 1ADFA 2E4VA 1W46A 4IV0A 1GZ4A 4DQUA 1WB6A 3LQKA 1XOIA 1E6CA 1A4XA 1TK3A 3QVJA 1J0CA 3KZXA 1NKSA 4G9GA