3RLFA

Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
total genus 106
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3rlfA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3rlfA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rlfA01
5M3MG 1OKKA 1OXUA 1M7GA 1R0XA 2EJGC 5E3HA 2QRNA 3HOYH 4OO1H 1BOFA 1ZM4A 3QKRA 1GWNA 2C03A 3PF4A 2F7SA 4DV2Q 3KKPA 2VF7A 1EX7A 3SU8A 4DR5Q 2ZI6A 2I5MX 2CBZA 3AEZA 1JB1A 1QUQA 2PI2E 3R9IA 5L3QA 1QJOA 3EZ6A 2G1KA 1A8VA 1P4SA 2CLSA 3BB3A 1WCV1 2V6IA 2XZPA 2ASBA 1GIAA 3CCLA 1ASYA 4BA1I 2FNAA 2FU5C 3BFKA 1W36C 5C4MA 3W6PA 3DZ8A 4PX9A 3ZH9B 5HKKD 1E2KA 3EBEA 2R8RA 4OK6A 1TF7A 3GFTA 3HPQA 4MKIA 2IYQA 2VEDA 2IS1A 3FDIA 3AM1A 4LF4Q 2V9PA 3GLGA 4LJZC 4PAOA 2P65A 3AGPA 2NTYC 2HF8A 1OF1A 3HOZG 3RS5A 1I6HH 2KHJA 2CHQA 3CAMA 1U8YA 4HATA 4IJHA 4NL4H 4M9QA 4JLKA 5J4KA 1UE1A 4LC1A 3RSOA 3LW7A 1NY5A 4V02A 1KO1A 4OX9Q 3ADDA 2WWHA 5AJ3Q 1W0KA 1HEIA 1N6OA 2BC9A 5K8UA 4FW9A 4JI4L 3CRLC 1G1MA 1RRCA 2MNAA 4R2HA 2DFLA 2AKWB 4RFVA 2VQEL 3IKJA 3L2PA 4Q21A 1KZGB 3TS0A 1C0AA 1XTQA 2RMKA 3TEHB 1N33L 2WJJA 1KYIA 4DNIA 2FFHA 2ZITA 5D3MB 2A5FA 3VFDA 3W3ZB 4Q18A 1FZQA 5CK5A 3UPUA 2O8FB 1F60A 2RCNA 4IFDI 1LUZA 1J2JA 1G7CA 1R4AA 3I72A 4JI0L 4K0KL 2UXBQ 2VRWA 3F8TA 1IBLQ 4PPFA 1JXOA 3LV8A 4KBFA 3K0XA 1QHHA 4DV6Q 3JAMc 1R0YA 1R10A 4WA7A 1IYVA 3BH7A 1GNQA 1N0WA 1DAKA 1JR6A 3AVQA 2EW1A 4M21A 2XX3A 2CKZB 1TPZA 2CMKA 1JJ2A 3H3VH 2PH1A 4GT1A 4BFYA 1TQDA 3TVDA 1AS0A 4TMZA 1ZKOA 2ORWA 2NVXH 1E0SA 1ESMA 1KSJA 3PFIA 4BFSA 2C78A 2O5VA 3U3RA 4IDOA 1SKYE 1U0LA 2V7QD 4RKFA 3MXUA 4B71A 3FFAA 1X6VA 5C0XG 1E79D 2R62A 1HNXL 3CCMA 3KJIA 1BDOA 2UUCL 3IO5A 3GPLA 3BDOA 1VQAA 4LF6Q 4DR3L 2G88A 1TQ6A 3JVUA 2IWRA 4Q03A 1XEXA 4O25A 1Z6TA 4HZIA 1FUUA 1Z2CA 3RRZA 3CPWA 1TU2B 1PH7A 5BR8Q 1D5CA 1K8MA 4IJLA 5JJLA 2GJ8A 4F93B 3AYHB 1JAHA 2NO6A 4PO1A 3I4OA 1JJCB 4HLUA 3SI7A 3SYLA 3PO2H 4D4KA 4Q4AB 4YMVA 3ETLA 3RZOH 2G6BA 4JBJA 1G3IA 3SEAA 2QT1A 4ON9A 3ZZTA 4A3DH 2YOHA 4JI5Q 3LVRE 1VQCA 1TWGH 2NZHA 2HF9A 2RGXA 4DDUA 4AG5A 2W0MA 3ZDQA 4NKRA 4E07A 1DAGA 3CNOA 2O5IC 5BYJA 3L0PA 2AUJD 1G20E 4OWWB 2ZI3A 4ERNA 1YNNC 1TKWB 4JI1Q 2CJWB 1GUGA 2CWPA 3BZCA 3H15A 4DUYQ 3PUWA 1GUAA 2ZVPX 2UUBQ 3QNUA 1GOTA 1G6PA 3HJNA 2DNEA 3OHMA 4KVAA 1F48A 821PA 2C9CA 3K1JA 1KJZA 2QZ4A 3U44B 2RKOA 2ZJAA 4C0QC 2A1AA 2ZU6A 3OEEA 1YNJC 2ONKA 3TVTA 3EA0A 3W3AA 2Z83A 4B3MQ 1GTVA 1QG4A 2VZAA 3CM0A 3AQQA 4BLSA 3LXXA 2GXQA 2CLCX 2B63H 3CC7A 3MJHA 4RFSB 5GVSA 3SQWA 2X2EA 2JASA 4JVNA 4PO9A 5JMTA 1MJEA 1OHHD 1LACA 3WBKA 4IDHA 2WWFA 4GNXB 1YR6A 3IBYA 4L9WA 1F2UB 4JSTA 3B1VA 2ODBA 1HT2E 1TX4B 5KPJA 2CCGA 1NN3A 3B9QA 2DNCA 3VX3A 2QEXA 2C2HA 2L0XA 1EFUA 5HZHA 2V4DA 4TT3A 2EVBA 2WIAA 2J7PD 4PPGA 4A3BH 1R7RA 3CONA 3MWLA 4LYJA 2OAQ1 1V9PA 4AIMA 4TL9A 2F1JA 1OLOA 4B3CA 3SOPA 4XWKA 2RGNA 4Y0AA 4CT4B 5JI2E 4BBSG 1CR1A 5KYKA 1JJVA 1I2DA 3KQUA 4QL3A 1L1OB 2JA8G 1Y1WG 1KAGA 2AXPA 3NH6A 1OJLA 2DWPA 3T1VA 3THYB 2K7VA 3VX4A 2ZM5A 2JEBI 1UE5A 4KFRA 2ZRFA 1OH5A 1OPXA 1R8SA 1HUQA 2I0QA 2F43B 4PMWA 3AB3A 1JR3D 2PCJA 3L0IB 3EAQA 4L15A 4TYYA 1Q3HA 2CVFA 3TAHA 2KE5A 1SXJD 3CCQA 1IN8A 4P3YA 2D2FA 1E7ZA 3DLLA 4W5HA 4JI4Q 2C35B 4MGKR 3HOVH 2QGNA 5FL7D 5AJZA 2JGNA 1ZUIA 3VKWA 2Q3MA 1T8TA 2ZS7A 1YU9A 1WCMG 4A75A 3CO5A 3H84A 2IL1A 2HJVA 2F1HA 3UMFA 1Q20A 1N33Q 2GXUA 1V5WA 3JZAA 4CDGA 4LJ9A 2CK3D 3T1HL 1G9XA 2H1LA 2ZPTX 4KVGA 4QBGB 2MSCB 1XTJA 5B30A 2X77A 2ATVA 3TQFA 5J4VA 2D2CC 4K0KQ 1JI0A 4B33A 4OQMA 2MO0A 2DYKA 2ZREA 1ZM2A 4H1VA 1SXJC 2O8FA 4P33A 3D3QA 1KO4A 3MUFA 1XD2A 4UXHA 2BEKA 1F2TA 1IN4A 4F4CA 3KKMA 3V9PA 1GDDA 3FKQA 3LQQA 3M0EA 3BIFA 1OW3B 2BBOA 2ZRLA 1C1YA 4ZDJA 4HLDA 2O8DB 4AKIA 1ESNA 1XEFA 3QPVA 2ZJPA 4B35A 621PA 4DR4L 1HZCA 4O2DA 1HNXQ 2WVJA 2HLDA 3RNLA 4DR3Q 1VQ5A 1R8QA 3B78A 1Z7TA 1PYSB 2IUUA 4BUJA 2ZRNA 1E9SA 2ZM6L 3G71A 2A5DA 2W6JD 2JIZD 3EC1A 4LFBL 1XZQA 1R5OA 5IYDH 4Q01A 3TLXA 4TYNA 1ZW6A 1QHNA 3A8KE 3QVUA 4GBMA 4MYCA 4RCYA 1HTPA 5GADC 1SKYB 1ZYUA 2FN4A 5KUTA 4TWZA 3BRWD 3NC0C 1NY6A 1WA5A 3W8NA 2J59A 3F2CA 4BY7H 5CLLA 3V4FA 4ACAA 3FHTA 2GZAA 5FUVA 4A3IG 1NVUQ 2XSZD 3ZIAD 3QE0A 1EWQA 4FINA 4A0RA 4Q1EA 3RANA 1K73C 1X6OA 2Z6KC 3K8YA 1GVPA 2MO1A 3A8JE 3OE7D 1XDBA 1CP2A 2PT5A 3HOWG 2FOLA 3TRFA 1Y3AA 4NB3A 2FH5B 1BS1A 2K4KA 4DSTA 3EASA 1ZM7A 3C4JA 1E0KA 2JK8A 4P74A 2CJWA 3I73A 1YIJA 2QMEA 5AUOB 1YRAA 2J0VA 1V8QA 1MO3A 4G7OC 1N8RC 1GAJA 4RD3A 4ASUD 1KRSA 2XOKD 5J4YA 2IS2A 1KDTA 1ZJ6A 4EJSB 2JJQA 5FUXA 1NMGA 1P7CA 3WMFA 5F9FA 3BB4A 3NBFA 3RDPA 3S17H 1IBML 5ELOA 3SYNA 1UBFA 2J9RA 4OYHA 4D0NA 1JXMA 2I1VB 2GVAA 2V6JA 4RFSA 5HCNA 3SHWA 3JC66 1JNYA 3F0TA 4DLSA 4LHXA 1U94A 4PR0A 3GFPA 3KF6B 1B9MA 1Y69U 3CMEA 3UDGA 1KHTA 4GNXA 4A8JC 3EZ9A 3IHWA 4EFNA 3OIYA 2B8WA 1Z0JA 2Z4SA 2K14A 3E9IA 2GWHA 4NZYA 5GAEC 5FTNA 3Q8XB 3GLFA 4PO8A 1OFHA 2P0EA 4A2WA 1FTNA 4YONB 1G7RA 2Q3HA 4TQUS 2CL7X 2GXSA 3GLHA 5HTKA 3LX8A 2G9NA 1CKNB 3A8IE 1YZQA 4H1UA 2A6HC 4C0BA 4B3XA 5FPTA 5IP9G 1XJVA 1O7LA 4AH6A 2FSIA 4AYBE 2N8NA 3HOZH 2EVWX 5J5CA 5GQOA 3KTAB 2O8BB 4A2QA 4TTPA 1L1OA 4LUCA 1Z07A 4XD7D 4FMBB 1IZ6A 1MKHA 3NWJA 4CF7A 1HJPA 2IY5B 1EWHA 2ZYTX 1NMFA 3S16H 2V8OA 4YMSA 1OH8A 3AVXA 2TMKA 2ZE6A 1ZCAA 5FPKA 1YNXA 1W48A 1S8FA 3LGJA 2CEAA 4CRWB 1NTGA 3TW4A 3T35A 2GVZC 4QXAA 1GKUB 1UDWA 1UJ2A 3DO6A 3AKDA 1TF2A 3MJRA 4A0FA 3CLVA 3EZFA 3SE0A 2QMUA 2ZUDA 4BLOA 1FYCA 3T1HQ 2YV5A 1WMSA 2WPDD 3QBVA 3KL4A 4A3LH 2IEZA 2UXCL 1FNMA 2A5YB 2HYDA 2VF8A 2BKEA 1D2MA 3SFZA 1E2WA 3KQHA 4OHZA 3K09C 2WMOB 3CCRA 2A2ZA 4LW1A 2ZYWX 4V0OA 2GDJA 4EQ6A 1OYWA 1AS2A 4OHWA 1WFQA 4OKSA 2O8CB 3KF8B 4HUTA 2Z0MA 1SMYC 3RWOA 4BZXA 3GTOH 1PA6A 2IYZA 5TDHA 4HJ9A 2HT6A 3SJCA 4M9XA 2WM9B 4R71A 4TTQA 3J80c 1M7HA 1YEZA 4G7HC 5JWHA 2BE5C 1K5GA 4P73A 3JZMA 3QKTA 3MFYA 3DVLA 4RKEA 2O8DA 2CFMA 5DISB 5IT5A 1E2ZA 4KSBA 1YR7A 1Z0AA 4LYAA 1FR3A 1HNWL 3DM5A 4IRUB 2XXAB 3A1WA 3U9SA 2Q3FA 3W6NA 3T56B 5IYBG 1UBEA 3H0KA 1XBTA 1YE8A 2ORVA 3WMEA 4DSOA 1CXZA 2ZAOA 2GRJA 2QE7A 4BRWA 1FUKA 2RGEA 1VQPA 4XJXA 1NKSA 3U4QB 2VPPA 1R5NA 5AUPB 1Z63A 4FXPA 3AVOA 4TN1A 3UWKA 4NCJA 1IONA 5CDFA 4G5SA 2NN6I 2WB1E 4OL0A 3RRNA 1CSPA 4V0LA 2VBCA 4LUVA 1CR2A 3FKSA 5J4HA 2GZHA 2DHRA 3CCUA 1ZNWA 1E9FA 5ANRB 1Y1VG 3U3JA 4O2RA 5IE8A 2I3BA 2ZYVX 1FX0B 3PUZA 2HV8A 3PCOB 3CUEF 5FOTA 1ZU5A 2PJZA 5AJYA 5JZVA 1ONLA 3B1ZA 3SFVA 1OFUX 4KCGA 4P31A 2Z0SA 4DT1B 3S15H 1X3FA 2H7VA 1EESA 4ARZB 3S1AB 5EP3A 2WJVA 4LBZA 1NVVR 2OFOA 2UUAL 4QIWE 2VNUD 4A4IA 4PTLA 2JXMB 1KNQA 4YLGA 1SN8A 4GZYC 2V1XA 1IBMQ 4MNOA 2ZE7A 4LJ4A 3QXXA 3VTKA 4BE7B 3VKGA 5DN6A 4ALPA 1FP6A 1G64A 4FI3C 4Q1CA 3U7FB 1RFLA 3K7UC 1VCNA 2C9OA 1D6JA 2ZSFA 1JMCA 2G0TA 2VP4A 4JLMA 4LV5B 2CE7A 5H1YA 3K81C 4JV5L 3OIUA 4QM7A 4AURA 1WP9A 2KBFA 3EA5A 1UAAA 2GEUA 3FPPA 2ASEA 1GL6A 5JLJA 3KF6A 2CL6X 2IS6A 4JLAA 3BFXA 3T1QA 2FPKA 2BBWA 4X66L 1C7YA 5JJIA 5FR2A 4MRVA 1VHTA 1GNRA 2J0UA 1XTRA 3BERA 3VR6A 3AF3A 4BBRH 3VDYA 2LXJA 1I6VC 4BBSH 1MKYA 2BEJA 2G3YA 4PHTA 3AVYA 2EDGA 1N6PA 1BMFA 2OSBA 2P67A 1WI5A 1KK2A 2LCFA 3EPKA 3F2BA 1Z6XA 5EJEA 1YZNA 2YWFA 1IJFA 3TIFA 2QBYA 5C0XJ 3S14H 5JI3E 4A2PA 1DO0A 4I1OA 4HIMA 4BFXA 4LHYA 1E99A 5CDFE 1W2HA 3SBDA 4S35A 4YMUA 3NH9A 2N3SA 5EXTA 3OEHD 1NVXQ 4DDWA 4IPHA 5EQTA 2ZJZA 1KHIA 2PCFB 4IFEA 4TKOB 4JSYA 4UJ3A 4KU4A 1GHKA 2ONJA 4F91B 1KMQA 4BLQA 3A5ZB 3KUCA 3GTGH 3I8SA 4E22A 4NYIQ 1ZU4A 4IHQA 2JLVA 2WICA 1E32A 3G82C 2OO7A 3NXSA 4B3RL 3OEED 2V1CC 4GN3B 2EFDB 2WSMA 4JLNA 4Q4JB 4XSGA 5IHPA 4POGA 4ITRC 4LBYA 2PNHA 2IHBA 1XMOL 1W4RA 3CIOA 4UNQA 5B2ZA 1TQ2A 3GP8A 2A68C 3FOZA 5FPYA 1EFRA 1G8YA 5CIQA 4A3DG 2YU9H 2GBLC 2QM8A 2OFWA 3SYKA 4X62L 4HIDA 1ZNZA 2JJ1D 4JI8Q 3B7GA 3C16C 4LV8B 4R98A 1T6NA 1SHKA 1JJ7A 3U3MA 2JA1A 1Z0DA 2LWIA 2IC5A 1V43A 1JEEA 1NF3A 4PQYA 4QGAA 4B6EA 4AQYL 4R4IA 1FP7A 221PA 3T12A 3T1TA 2O8CA 3B13B 1D8TA 1K8AC 2QSZA 4NYJR 4LWZA 4DUGA 4NPSA 4LHZA 1Z8FA 1ZC4A 3QBTA 1CIPA 3IIMA 4B74A 2X2FA 3FWYA 1Q12A 1JE5A 2Q2TA 1BKDR 1E1QD 1G8HA 1J70A 4QNMA 3I5XA 4IVRA 4EPXA 5A4JA 3TR5A 4JI2L 3A58B 4XTCS 1A63A 3W1GA 1XD9A 5DYIA 5TY0A 4LBVA 2B63G 2ID0A 4NMMA 4QBFA 2G0NA 4G7ZC 4IEEA 2NVQH 2XXAA 2WBLC 4Z8YA 3TH5A 3HU2A 3K53A 2CVHA 1G7TA 2P5SA 3I4LA 1G5PA 2C98A 4JLOA 1FNNA 4NPHA 2F3TA 1XTIA 1Z0KA 3DMDA 1DARA 3WRXC 2ZU0C 4UP7A 4DR5L 1OSNA 1FMJA 2FSGA 2V55B 3QXHA 3A7AB 4L5RC 3AFPA 4Q4HB 4EDHA 2PPBC 2BV3A 1KDRA 1NIPA 2QF7A 3NELA 2FE4A 1G7SA 2RGNC 4WXRA 3KDFA 3PQCA 2UKDA 1N6IA 4GP7A 4Z1MD 4F7WA 2CDNA 1AZSC 3TW8B 1YHQA 5DLQC 3I61A 4BLPA 2W2VA 3FMCA 1J5EL 1RW4A 2EWWA 1VQFA 4DT1A 3RAPR 1A7JA 4IXNA 4QGGA 4KKTA 1OIVA 2UUAQ 3AKCA 2O0HA 2ZR7A 3A37A 4ARZA 3WBJA 1PH3A 4XH9B 3LNCA 1N0VC 1KQSA 3IBGA 2IWHA 4DCNA 4IO9A 2GZDA 3UMSA 3T5GA 1VQBA 1QHSA 4IPCA 4RZXA 3CX8A 3WYFA 1MH1A 5DIFA 3I4NH 4D6PA 2ZRAA 3NHAA 4HEJA 1O78A 1H8ED 1P73A 3C14C 4JMPA 4XVRA 5DNYB 3OTOL 3CPFA 2J5XA 2FGJA 4C0AC 4JV5Q 4M53A 4Q1DA 3L7ZC 2R7FA 1VG9B 5CIWA 3VHLB 4D2IA 1VECA 1S2MA 1X8KA 1COWA 1VYVA 4C9BA 1Q3TA 1GITA 2GCNA 3WP1B 2UXBL 4X66Q 1IBLL 1DS6A 2RGDA 5L3RA 4RJLA 5LD2C 1NVVQ 4DV6L 3PR1A 3KFVA 4TLDA 2XZOA 3QSYA 1K83H 4IFDH 1Q8KA 4QGUA 1NBMD 3H2YA 2FPMA 1TNDA 1II8B 1WRBA 3L8ZA 4PAMA 2BMDA 4IJMA 4LPSA 1E2PA 1KY2A 2PT7A 1IY2A 2VHUA 3K9LA 2CCJA 4WZAE 5JS8A 2KSQA 1UEBA 1VMAA 4EPVA 3PEYA 3SGIA 1GZSA 5KPDA 2KA7A 2PBRA 1J7KA 3EC2A 4DAMA 3O8BA 4IDQA 1MO4A 2IUSA 5FTJA 2R7DA 3CD6A 1QHIA 2VSFA 1E1OA 4Q7LA 1YHBA 1N6KA 5IDVA 5A5GA 1VQNA 4B44A 2EXDA 3CPEA 2QAGC 1I4LD 1CR0A 1TWCH 2AD5A 2AN9A 3PIOA 1VQ7A 2DY1A 2FFQA 1IW7C 3ZZUA 3IUYA 4QKQA 3CCSA 1VG0B 1CJKC 3HOUH 4B3RQ 3BBPA 3MGCA 1RRPA 5F98A 5IYDG 2I1QA 1QHGA 2D06A 3EWSA 1BBWA 1XMOQ 2C96A 4EFMA 4XSHA 3HOXH 5DYGA 4JI5L 2FXQA 3UANA 2BHRA 2PEYA 1FOEB 1E96A 4Q4JA 4AYWA 4LWCA 4BY7G 3PV0A 1MJCA 4UKDA 3NEMA 4OWTB 3RC3A 1GRRA 4OI1A 2D62A 4LSGA 5HZKA 4JI1L 1OIXA 4LJ7A 4FWTA 4DUYL 3PUVA 4AQYQ 2UUBL 1MT0A 1SQ5A 2QM7A 3L82B 4IXMA 4MKGA 2RF4A 2AKAB 4A15A 1T8UA 2PJRA 2J87A 1W4BA 1CS4C 1RE0A 4M4SA 4WOPA 4GZMA 3SNHA 4A0GA 4B3ML 1PLLA 4AYTA 4GN5A 2XGJA 4FCVA 1QRAA 3CPHA 4XOIA 2IXFA 3DEFA 4JI2Q 4OI2A 5IYBH 2Y0SG 3I4MG 1XCPA 2K33A 3T61A 4CEHB 2KBNA 5HE9A 1XF9A 5AJVB 2EJMA 4TLCA 4EPTA 2X19A 5JCZA 1G19A 2XJ4A 1P2VA 3L2OB 4HAZA 4KLZA 3UXMA 4PC1A 2QRZA 4GOJA 1TQ4A 4J15A 1TWFH 1HZ9A 3HGBA 1I94L 1P62B 1XXHA 2HCJB 4FMCF 4TQ9A 4BEJA 3J81j 2QGQA 3PGZA 2B92A 2BOVA 4NP6A 4NYJQ 4AIIA 1U9IA 4PZLA 1Y1VH 3LXRA 4DLXA 1YJ9A 2QN6A 3M4YA 3QVVA 4GOPB 1Q81C 3K0AB 2Q8IB 2QBYB 4EPYA 1KJWA 5L3SB 2FF7A 4A36A 4JIMA 2KB0A 4DCVA 5TXGA 4Q4HA 4DCTA 1DAHA 2PL3A 4YWMA 4QNRA 4UJ5A 4B32A 2GJKA 1A2BA 5JHHB 1YJNA 3IFTA 1RIFA 3NEJA 1MO6A 1HE1C 3I1FA 2YC2C 1J5EQ 1XTKA 2GJAA 4NU0A 1EFCA 2QP9X 4ZDKA 1IXZA 4HUQB 1X1RA 2JDID 4QJ4A 4V0MA 4C0SA 4DNRB 2O8EA 1GRQA 1ZINA 5KNBA 4KYIB 1KI9A 4O2LA 5FTMA 4JI7Q 4W5WA 5FTKA 1HR0W 1XCMA 4IDNA 1FVIA 1OFIA 2ERXA 2HXYA 2JJ2A 4D26A 2VH5R 3IIKA 2G1JA 3A6PC 1K9MC 4US2R 2KJQA 2E75C 3T1YL 1YQTA 1GG2A 1KIXA 5EE5B 1TU3A 1UKYA 1MABA 3OTOQ 1PH8A 2AHOA 2IF0A 5FBQB 1E4VA 1P9RA 4H13C 3IGFA 2JLZA 4NXNL 2Y0SE 3TMKA 2FFBA 4Q1FA 5FOSA 4KI0A 2A5GA 2MMGA 2P3SA 5EP1A 1W5SA 2FX3A 4R4OA 4A3LG 3FMPB 4B48A 2XNSA 2JEAI 1KRTA 1TL7C 3L43A 1ZD8A 3K0FB 2OCAA 3GCGA 2LKDA 3FHWA 4IOAA 5CM9C 1GUTA 1Z6AA 3G0HA 2GHIA 1HZAA 4MYTA 2KCCA 1XMVA 3TJZA 1H9JA 1RRGA 1KXLA 1N25A 2ZJ5A 2BJVA 3MWJA 5EXXA 1E6CA 3SHFA 4M0LA 1M1KC 2XZLA 5G40A 2ZJQA 2NIPA 3U3OA 4GN4B 5GAGC 1II8A 4P72A 1W7AA 4B6FA 2A3RA 2K50A 1GKYA 1A6XA 1GVNB 1M1YE 1S0UA 1X3SA 2QT0A 2VQFL 3KB1A 4B76A 3DHWC 6Q21A 2GNOA 2XTNA 121PA 4MGIR 4ME3A 4DK6C 2XTMA 3MWYW 4MRNA 5EXSA 5BXQC 2QPOA 2E2IH 2F6RA 4KODA 4LJ8A 5EP4A 5HY6A 4Q9IA 4V03A 3S24A 4KMUC 4B47A 2DFTA 1ZYRC 2DGYA 1L2TA 1RVDA 2FSFA 4Q19A 4H02A 1KKLA 3MG9A 1G3QA 4L9SA 2OM2A 4MRSA 4D81A 2ZRBA 3UKDA 3OAAA 1PLKA 3PITA 1P60A 4TMXA 4BXXH 4DLVA 3QF7A 4LF9L 1OYYA 2ZRHA 3KKQA 4LC0A 3X1WA 1EOVA 5IYCG 2I4IA 3A1VA 3VR4A 1A82A 2ZI7A 1II0A 4TLEA 1Z0FA 1PH1A 3GO5A 4R9UC 2ZTSA 3CWZA 1E2GA 4U7DA 1TF5A 2VP0A 4UNPA 4DLZA 3KX2A 2PEZA 3K70B 1US8B 4WZ6A 2A5JA 2IK8A 3ADBA 3MD0A 1VQ8A 4NTZA 4QRHA 4R2IA 4I7ZC 2JA6H 4X6AH 1N9WA 1X55A 1JB7A 1AZTA 1MV5A 1KO7A 3PXGA 3OFNA 4TL8A 2Z4RA 3CX6A 4N0EA 4A92A 3NIBA 1Z9FA 3GJ5A 2NO1A 3IQXA 5J47A 3THWB 2H16A 3C5CA 4QOSA 2HXSA 4URUR 4GKKQ 4KFSA 2LMCB 1T4GA 5K8LA 2LXKA 3PUYA 1G291 2Q2UA 1Q90A 2IHFA 1BMFD 1NNEA 2OHFA 4JBKA 2V54A 3OIWA 3GJ6A 2IA5A 3RN2A 1X8JA 2DFNA 2PQAB 2CHVA 4HDQB 1UE6A 4NXML 3BAFA 3BC1A 1R2QA 4PC7A 1K8OA 2OTJA 1AIPA 2HQLA 4M1TA 4DLYA 3KFXA 1KMHB 2GAOA 1KC8C 1I94Q 3P4XA 4ZI3A 2J46A 2BWJA 4G5GA 5EXPA 2LSSA 4K8OA 4GOKA 3R8CA 2HIXA 2A78A 4TL6A 4ZPXA 4LRWA 3LVQE 4OO1I 1ZVQA 3U2QA 2HCBA 4BBRG 4GOPA 1IYJB 1E98A 2JQOA 1FMLA 1R9TH 3CCVA 4KFTA 3M4PA 4MQBA 5G53C 3J81i 5L3SA 3ICEA 4W7SA 4FCWA 4XVQA 3AVUA 3LY5A 4C7OB 3CW2A 4OQXA 2JLQA 1P2UA 2NOAA 5L3VA 2I5LX 4QG7A 1NRJB 1OXVA 1E9RA 3AQ4A 5GJWC 3PEUA 4A93H 1VCIA 4FMCB 3M6AA 4LF8L 1QF9A 1KGDA 4XTRA 5H68A 1X8LA 1CULC 1E2QA 4JG2A 1G3MA 2HHHL 1XEWX 2A30A 3ASZA 1E2JA 4DEYA 4YCVA 4DV0L 1W36B 1B23P 1QVGA 3T1YQ 2K5HA 2C95A 4LFAL 2WKPA 3HPRA 4IOLA 1DBSA 2RGGA 4HB0A 4DDTA 1YZGA 4DRZA 2WAXA 4KHPQ 1N2CE 4RD2A 4A1FA 4PPQA 4NXNQ 2D0PA 1Z6YA 2CNWA 2N46A 3BK7A 5C1BA 1KI6B 4AY2A 2QG6A 4I4LA 4OHYA 2RGCA 1MO5A 1SVWA 1JR3E 2OG2A 4MRRA 5D3MA 5C2JB 2QTHA 3DKPA 1L0WA 1RPZA 3RSLA 1SXJE 2YWGA 3KUDA 4UP9A 3CMAA 1SFOH 1DAMA 1DG3A 3EXAA 1Z47A 1Z5ZA 3K0FA 2GAAA 3B1YA 4D0GA 1N0UA 1Z6GA 1Z2AA 2OLJA 3CRMA 5FI0B 2Q9CA 2R6CA 2BDTA 4KV9A 4YY3L 3VHXA 5FBVB 2AK3A 1HA3A 2ZSEA 4PSAA 4QGHA 4POFA 1OFTA 3CZPA 2IBMA 2UVQA 1DD2A 2BMJA 2IX1A 3UE0A 2E2JH 2UU9L 3CCJA 4A3GG 2VQFQ 3N5CA 4PXAA 3CH4B 4R1JA 5IK2A 3UG6A 1DXMA 1NLFA 4FDBA 2ZR9A 4DR7L 3QQ5A 4RD6A 1NMZA 3Q5DA 2Z5FA 4JLJA 4WAUA 2OCBA 2K32A 3AFQA 3I92A 4X8OA 4DLUA 4M9ZA 3X1XA 4JCVE 4DLWA 1H8HA 4DJTA 1OIWA 1E2VA 2OCEA 3WMGA 5KSOA 3ASYA 2IEYA 2QA5A 1ZCBA 4TSFA 4LV6A 3ZLJA 1NG1A 1W0JA 3GEHA 4JT4A 4DAYB 1H9KA 3CNNA 2BH8A 2P6UA 2K52A 4GLVB 1ZUHA 3ULLA 2RHQB 4LF9Q 3VA7A 4Q4AA 1T5IA 1Z3IX 3LWNA 4G1UC 4C2MH 3A5UA 2D7DA 4EQ5A 4HJ8A 1ZAKA 3EIHA 3QKUA 1VF5C 5C4XH 3R7WB 3NBXX 3FGNA 4H0LC 4Q47A 1UFQA 2ZRGA 3TGPA 3LBHA 5HCIA 2A19A 2ANCA 2QMOA 1KSFX 3U3KA 2AL7A 3M1IA 2NO0A 4ZCLA 3B5JA 3FB4A 2BVNA 2J45A 3AVPA 4IPDA 1SMXA 3BFVA 4HJ7A 2OT3B 3UDFA 1US8A 4WZBE 2WJYA 3B9PA 3UIEA 4BECA 3U44A 2EIFA 3MMPA 1Q1QA 3I4MH 3ZJYC 4A3MG 3FPAA 1E1RD 3BGWA 4U02A 4DSNA 2XTZA 5GJBA 1LF0A 2O52A 2JLXA 3X2SA 4HDOB 2K5NA 3QEOA 2NPIA 3LLUA 1L7VC 3AV0B 2A6HD 5JJKA 3I4NG 3UMRA 2E1RA 3HP1A 3THWA 1XNRL 1D2NA 3SS8A 4NXMQ 4LJ5A 3SZRA 2J0QA 4PV1C 4MZ9A 5FLMH 1EFTA 2QSYA 2KCTA 4DR1Q 1JEDA 1YJ5A 1CI3M 1CJMA 1F2UA 1PJRA 2R65A 4RCZA 4YDSA 4NE2A 2PQAA 4LX0A 1X3GA 5KDLA 1W47A 2W6IA 2OUKA 3M9BA 2CLDX 3BE4A 3LBIA 1P8LA 1VQDA 2F1IA 1KI7A 1RKBA 5D3QA 1CSQA 3CCEA 2F4VL 4HZUB 4Z51A 3W34A 4G0NA 3NHBA 5BN3A 3BZKA 5C3EH 4IFDG 4WJ4A 1YKSA 2GF9A 2EFCB 3C8UA 4LNQA 1R0ZA 3K0EA 4PC2A 1GD7A 3EPLA 3KLWA 1JPNA 1S3SA 2O8BA 1BO6A 1G51A 1G6HA 1KO5A 4TQAA 4DIDA 4HAUA 1LNZA 4IQZA 1S1CA 1Y8PB 3KXIA 3RVBA 1QVRA 3THYA 3CR8A 1KSHA 2FDCA 3LX5A 4LF8Q 2VP5A 5TMPA 3SQXA 2B7BA 4URVR 5K8IA 2QMHA 2PI2A 2YTYA 8OHMA 4N1AA 2UZ3A 4JOIA 2HHHQ 1PYBA 3KJPA 5C4JH 1XMJA 2F43A 4DV0Q 2VL6A 3BH0A 4Q7KA 5DI9A 3W8RA 4CZ2A 4YXWD 4LFAQ 1EK0A 2C99A 1YZ6A 3GLIE 1RZ3A 3OZXA 2WIBA 3HDTA 3HR7A 5AWFC 2E8GA 1S4QA 2A7QA 4HJ5A 3HKZG 1LFDB 1FQJA 2CE2X 4G3XA 2QPTA 4RZ3A 2WWXA 4L8GA 1HT1E 1P6XA 3HOUG 3F1ZA 2ZIAA 5SZJA 2GF0A 1Q22A 4A3KH 2G83A 2W0SA 2GXAA 1I3QH 1IXRA 1VQGA 5C44H 2NPFA 2BE5D 2PMKA 2W58A 2WP8J 3HOXG 1KI6A 1LTQA 1SVMA 3GJXC 721PA 4JI8L 3DDCA 5HE8A 1NJIC 3OW7A 1J8MF 1CJUC 3OESA 1VQEA 1PH9A 1HV8A 5DSZA 4D80A 5B58C 3AP2A 1OKKD 2VS1A 1VQOA 2DCUA 3THOA 1WOCA 1Q44A 5HKKA 3B1XA 4D82A 4YY3Q 4TTRA 3I62A 4DR6L 1E24A 4X65L 1NSFA 4DV1L 2UU9Q 1ANKA 1G3UA 4I1UA 2ZROA 3CF2A 1DO2A 4DHEA 1SXJB 4DR7Q 2BIFA 4ZCMA 4Q66C 3B2EA 2IXEA 5DI3B 1DELA 5JSZB 1IBRA 4CT5A 3ZZ0A 3DKVA 5EAYA 4GS3A 4LUZA 4LPKA 4CGZA 3DPUA 1K8GA 3KQNA 2K5VA 4UY8C 4C0HA 3C7KA 2ZT9C 3GJ8A 5JCPA 3BH6A 3U60B 4PQFA 4JKYA 5JBQA 1NBWA 2KI5A 3ZD6A 3HYRA 3A36A 5IYCH 4Z8XA 3L0OA 1U9IC 5IRCD 1ZBDA 4BFTA 3HKZE 4KHZA 2A8VA 5G41A 1W0KD 3AVVA 1QZXA 4QJ3A 4IOMA 3CNLA 4YDHB 2FGKA 2QPAA 5GVRA 3A1TA 5F3WB 2IYVA 3WWVA 1Y63A 4FWIB 2OLKA 4DWJA 1M34E 2ZJ2A 2HUPA 4NYMR 4ZKDA 3E1SA 4MYHA 1VQLA 4IDPA 3QJYA 3NDBB 1JAIA 1VIAA 1DG1G 4POAA 3CR7A 4R7ZA 2P6NA 1ETUA 2V7QA 3NDPA 1M7BA 4CVNA 4MYUA 1UF9A 1E79A 2D3WA 1S9DA 3ND8A 1XFAA 5J4LA 1DADA 3K0CA 3PCRB 5AJWA 4EJSA 3KYHC 5LDDC 3BOSA 3C15C 1XNRQ 4C3HH 2XGTA 2WHXA 2WWYA 4NCKA 3TS2A 2C04A 4DV3Q 4HLCA 4E03A 4NCHA 2RHMA 2FFAA 2YWHA 3ERSX 1O3YA 4JL6A 4X8HA 3QOFA 3K9NA 5EP2A 3KXKA 3UDIA 1VQ4A 3NE5B 2B8TA 2E9SA 3LAWA 1DVRA 5LMNW 3LBNA 3G48A 1UPTA 1UM8A 3QXCA 3W5OA 3EPHA 4B3DA 2WTUA 4URZR 1DGSA 2Y8EA 3IO3A 3AUYA 2F4VQ 1VKJA 3T51B 2H5XA 1YVCA 1E94E 2ANBA 5KSZA 2MQHA 1KD1C 2ATXA 1S3OA 5P21A 4Q9LA 3W1BA 4AK9A 4EKDA 2ZI5A 2GVBA 3Q8DA 1AS3A 1CKNA 1XX6A 5CYPA 2BM0A 1H9RA 4A8JB 2GETA 2QEQA 3SR0A 3CRRA 4KXFB 4DR2L 2FWRA 5M5YH 1G4UR 1VIYA 3B82A 3LH5A 3VAAA 1TADA 2A68D 1UKVY 4GKJQ 3KTAA 4GRAA 4RCNA 1NL3A 4F92B 4TMTA 4MKFA 1YRBA 5JEAG 421PA 3TQCA 4CEIB 3HR8A 4KN7C 3F3YA 1N3BA 4HLUC 1N34L 3PSIA 2HEIA 1OHHA 4YQFA 1VTKA 3U6BA 4AD8A 1RYHA 4JLPA 3ZVMA 3SDZA 1EGAA 2IX0A 1AQUA 2PCLA 4HJAA 1NKTA 2AFHE 1HPCA 2YHSA 5ELXA 4IOKA 4NCIA 2OESA 1EG7A 4Q7JB 5BN5A 4BXXG 2E5LQ 4OQFA 3O47A 2HYIC 3VU9B 5JEEA 1KDPA 5HPYB 1Q86C 2J7PA 3EPJA 1B7YB 3GLIB 1U81A 1HH4A 1YVDA 3B6YA 4JYAQ 1VQIA 1RIPA 4C2UA 4A82A 2OCPA 1EXMA 2F9MA 4DCSA 1N36L 2WFWA 3Q7QA 4DR6Q 2RGAA 3O8RA 1G41A 4A3GH 2BDOA 1YI2A 4X65Q 2EWVA 2XAUA 4DV1Q 3Q5EA 1KZ7B 4Q48A 3RHFA 3RWMB 4TT3D 5M04A 2JA6G 4JI6L 3VR3A 5CM8B 1GL9B 2XB4A 4GOXA 4X8LA 2VIIA 5FOWA 2JE6I 4AC9A 1RC8A 1OT3A 5FJ8G 3RS4A 2OAP1 4B3BA 5CB6A 2XNDA 1SXJA 1AE2A 2OXRA 5E4FA 4OHXA 3T5DA 4D4LA 5C0XI 4LF5L 5FL7A 5JSZA 4BZPA 2QU8A 1P16A 1P9NA 1HR0L 3Q85A 2KCMA 1NN1A 1LB1B 5BW8A 3EQLC 4LZZA 2ZI4A 4DV7L 1E4YA 1VQJA 1B9NA 2CK3A 2VTKA 4NCNA 3U4QA 2ATWA 1VCOA 4TYWA 1XRJA 2H5EA 3AUXA 1CTQA 3BS4A 3PIRA 4A3JG 3DXJC 4NDZA 4O0MA 3W9YA 4GLAC 2H57A 3CRKC 1W49A 3U4VA 1YR8A 1FGUA 3ECCA 3WY9A 3D31A 2GCOB 2MSDB 1XZPA 3FYHA 1IM2A 2Q6TA 4APVA 3QKRB 4URWR 3HU1A 2KENA 5EE1A 2CCKA 3L0SA 1FX0A 2L15A 3SBEA 1ASZA 3RS2A 4PQRA 4Q9HA 1PH6A 1IAQA 5DLQE 2QI9C 5FL3A 4JBWA 4L5BA 1S3GA 2MMCA 3TRZA 4HAYA 4EX5A 4A3MH 2ORIA 1T91A 3IDQA 2HJGA 1SGWA 3D4RA 4KFUA 3U50C 2F3RA 2YNMA 1E1TA 4KAXA 1F5NA 4JI7L 2FZ4A 4A93G 4BASA 2OEPA 1CFMA 1HNZL 4GFDA 5FBRB 3J7A5 3AF4A 4RD1A 4TZ0A 2BKUA 1XMIA 2NGRA 1KOFA 4YMTA 5JFGA 2IF2A 2CXXA 5TVKA 2W6JA 2JIZA 5EE0A 1QHXA 1NIJA 4ZDIA 3P20A 4PAQA 2IHEA 4G5RA 4WXPA 1E2IA 3S2DH 2IYTA 2YWEA 4G5OA 5A0FA 4JK1C 1SVSA 1CRQA 4LFCQ 1XMQL 5KU1A 2F9LA 2HLDD 1SVLA 2IXGA 3HWSA 4NYMQ 2D0OA 5DGXA 3MXNB 4LI0A 1XB2A 1FQKA 3PEVA 3FHCB 3H86A 3IEVA 1GRNA 2XSZA 3ZIAA 3KKOA 1P3JA 5E7MA 1FTSA 2VSXA 3KQKA 3IEUA 4GL2A 3K9GA 1EWRA 2ZVQX 4PC6A 1OH7A 1IW7D 3CX7A 4NBSA 3S1AA 3OE7A 4B73A 2OBMA 1E9EA 2J1LA 2JA5H 1DCZA 2QA4A 3RR5A 2P5TB 2YOGA 2IHYA 4DR2Q 1K3RA 1VYUA 2AWOA 1TUEA 1QZGA 3O8DA 4A4DA 5LPNA 4CEJB 4A8JA 1Q1ZA 4DXAA 4MGYR 3GTJH 4ASUA 3K80C 2WAQG 1IBKL 2XOKA 2IYRA 4ZV4A 1PMRA 4U00A 1E2DA 4MDEA 5JHGB 2YKGA 1TEVA 3F5FA 5DHFA 1AQYA 1NBME 2Q21A 1N34Q 3I8XA 4S2EA 1N32L 2FEOA 3LW8A 4HLQB 1X9NA 5C4GB 3LQRA 4CEIA 4EFLA 3FVQA 4H44C 2VA8A 1K8RA 3CC2A 2PX3A 1UBCA 2P6RA 4M1SA 3ZVLA 3TSWA 1XJQA 2NZ8A 3RLFA 2Q2IA 4LOAA 3RC8A 4B2PA 4BPBA 5J3BA 5CJ2A 1B8AA 4DNTB 3ND9A 2O0KA 2Z43A 4QC2A 1XEXB 2FPLA 3GEIA 3SJAA 1X56A 5HR5A 2OXCA 1KDOA 2XEXA 4MA4A 1OXSC 3PO3H 4WBSA 5C4XG 2ZJRA 2B3GA 2E74C 1XD8A 2IW3A 3RYTC 3ULJA 4DC9A 1UWVA 3S1QH 2NN6G 2IYXA 3OYYA 2DBYA 2ZJOA 1HTWA 3GLIA 4DK3C 1N36Q 2REBA 2E76C 1QVFA 1E22A 2ZI9A 1GL7A 1G17A 1EIFA 1X86B 2OCYC 1PZNA 1PFSA 2RB4A 3CZQA 3P4YA 4JI6Q 1AM4D 4QJFA 2GESA 4G01B 2ZR0A 3UWOA 4Z54A 2VP2A 3D0FA 1LVGA 1BIFA 2JLSA 3CBQA 2IS4A 4GKKL 1NP6A 1EYGA 4DSUA 5GROA 3ICQB 4HDCA 4LF5Q 1K5DA 3KJEA 4C4PA 2ZAMA 4M1OA 1EFHA 3QG1A 4GNXC 3Q7PA 2WAQE 1HR0Q 1AJEA 4IVPA 1P2TA 3TQYA 2HDNB 3CRW1 3B8HA 2O5JC 2B8GA 2RGBA 5TARA 5FLMG 4BLTA 5J40A 5KHOC 4DV7Q 1U99A 3KXLA 1RL2A 1D7QA 3T15A 3TR0A 2WPDA 1P75A 3GLFE 2ERYA 5FBWB 1IXSB 1XPOA 3G6EA 5EE3A 5IP7G 1T5LA 2BCGY 2WZQA 3IIJA 2WKRA 3GLHE 3ZQJA 4DEXA 4HSEA 4IFDJ 3I56A 2REXB 5LBIA 3TSZA 2PLRA 1A0IA 3F2DA 3VNUA 3UATA 3SJBA 4K81B 4MTNA 5E7JA 2R44A 3RLOA 4A3EH 3QF4B 4MKHA 3S1RH 1KI2A 1GUSA 5C3EG 2GCOA 2D7CA 1ZIOA 4BQSA 2W00A 3GDEA 3ZD7A 4DPGA 2NZOA 4II7A 1L1OC 1CUKA 1OV4A 2VHTA 4TMWA 4TYPA 1KAOA 4AKHA 1AN0A 5H70A 1UKEA 4FMDB 1CBUA 1FL0A 2MSEB 4QM6A 5FI1B 3NENA 5ELNA 3IRBA 4JOIC 2HT1A 1ZD1A 2IYWA 3A4MA 1RJ9B 1HNZQ 4OK5A 3AP3A 1JJGA 2ZSBA 4Q9KA 3GTQH 2GTPA 5EE9A 1G8PA 1GILA 1W4CA 2NQ2C 3N2EA 2W2XA 1KI8A 3BORA 5LB2A 4OWXB 4I99A 1F6BA 2AKYA 1VS0A 2RAPA 4JVSB 5SZIA 5JECA 1QG2A 4KHPL 2F3IA 2DWQA 5GJCA 2ZETA 3BJUA 4B3SQ 1IXRC 1Q0UA 2LKCA 4JLVA 1XMSA 1XMQQ 1AGPA 1R6BX 1G16A 2DWOA 3H0GG 2ZTDA 4A3KG 3LD9A 2GILA 2DUDA 5C44G 1VYTA 1CKOA 2YZ2A 3M7NA 2XITA 4OHVA 2A69D 4BEBA 2ZXUA 4UNRA 3W5JA 4ZDWA 3NBYC 1J8YF 2B21A 1YZTA 2R6DA 1Y14B 3GJ3A 1Q82C 1T3LA 3MEFA 3M85A 2QE7D 4JLDA 3HYTA 5GJVC 4B2LA 4AKGA 3BXZA 4QJ5A 4KKSA 4X64L 4PZ8A 2F1MA 1TTTA 3AGQA 3RRMA 5KSYA 1FJGL 1NMXA 3CPJB 4FN5A 2DB3A 1VQ9A 4UP8A 1S40A 3A4NA 1Q1BA 3FKSD 1SULA 1XD2B 2A69C 5JEAH 2N42A 1F2TB 1IBKQ 1NMYA 1KAWA 3UE1A 1ZP6A 3B6EA 4RD4A 5LD2B 2REOA 2I5HA 4LJ6A 4JS0A 4CEJA 3ZVNA 2R2AA 3KFUA 1U98A 4Q4LA 4TLBA 3EZ2A 1E3MA 1TWAH 3I55A 4KKUA 1N32Q 3GJ0A 3I3SR 2ZQ5A 5FBLB 1CRPA 2P2LA 4W5JA 2GJ9A 5DHAA 1GM5A 1KI4A 2Q9AA 5F2EA 4LYHA 4M1YA 4EAQA 3R9WA 3LNNA 2QP4A 3QEJA 2R93G 4C0KA 2VYFA 2OBNA 1S72A 2R6FA 2VO1A 2VHCA 4M22A 2PZGA 1K0RA 4A3CH 1CU1A 2QAGB 2VHJA 3P32A 1CJTC 3FMIA 5M5WH 3AEVA 1DAIA 3GEEA 3GJ4A 1G8FA 3CF0A 5DN6D 1F3OA 3WNCA 2OE2A 3I5YA 4P32A 3S1NH 2VSOA 1FFHA 3P26A 1W1WA 3NEYA 1M90C 4MGZR 5GAHC 5BYKA 2ZE8A 2FG5A 1X3EA 4DV5Q 5G3ZA 4A3FH 3R9XA 4US0R 4RMFA 2VHQA 4ACBA 3QXSA 1E2NA 1WBBA 2R9VA 4OQLA 4C0LA 1JBKA 4K46A 4PSKA 4ABYA 1KK1A 5FJ8H 3CH5A 3IPXA 2BBTA 1BH2A 2V1UA 1P61B 1TXYA 3K0CC 4I81A 4CW7A 4EJSC 4IKEA 2NVYH 4PZ6A 1A62A 1I50H 5LMUL 3EIEA 3OEHA 4L16A 4QFMA 3TSOA 3CWQA 4YHHL 1IN7A 1VF7A 3E9HA 1P9WA 1GHJA 1PUIA 2CHGA 2C9YA 4YWLA 2GJSA 4N3NA 1UKZA 2R7ZH 1BYUA 4DVGA 3TKLA 4CEHA 4PC3A 1GSIA 2KWIA 5EZ5A 5IT9c 1W4AA 1N5KA 4US1R 4DR1L 3I32A 1VDZA 4C0JA 1L4YA 4YMWA 1OE0A 1TEXA 2F55A 2JATA 3ZGXA 3K7AH 4A3JH 4PSVA 1KSGA 1QVCA 1TMKA 1M74A 2YOFA 1E9DA 3SJZA 3H4MA 4LJYA 3RLNA 4Q5IA 3O8CA 2JJ1A 4JKIA 5KTYA 5CITA 2SHKA 2NZJA 1HH2P 1N5LA 4F4IA 3K0AA 5FTLA 2IYUA 3KQLA 4TZ6A 2WWIA 1IN5A 1ZC3A 4L5QA 1II9A 1D2EA 2VL7A 2QNRA 1W2BA 4GP6A 2Q9BA 4B3FX 3QF4A 1CJVC 1WB9A 4TYQA 4C2TA 4ILEA 1RYFA 1Z83A 3GLFB 1EFRD 5AJXA 5JEAJ 1E69A 1JT8A 3GLHB 3UG7A 4C3ZA 3FMOB 3KDSE 4HUQA 1E1QA 5K8TA 4BFZA 4AI6A 1C4OA 3LA6A 1MIUA 3ADKA 3TUZC 2O0JA 1RJ9A 1D9ZA 5JRZA 1B0UA 4JBMA 4RSGA 2BMFA 2PZFA 1TWHH 3N2IA 4IVQA 4DIEA 1DAFA 5JS7A 2L5TA 3V4RA 4RZ2A 1L2FA 3E5HA 2H17A 3UK6A 3STBD 1EQQA 2JLUA 4HB3A 3GTKH 4RD0A 4WJ3M 1HY3A 2IT1A 1DTSA 3MLEA 5JWOA 3N6RA 5KDOA 3MRSA 3QUSA 2D4HA 3DOEA 4Q1AA 2XNDD 4LK1C 1P5ZB 1PUJA 1PH4A 1SKQA 1ZIPA 4JL5A 2ZTCA 5FOVA 4B43A 2ALYB 5KO2A 1U90A 1L4UA 1EIYB 2N78A 4QL5A 2DR3A 3EIVA 2JA7G 2HIVA 4QQBX 3CF5A 1Q46A 5KNDA 4X64Q 4OI4A 5EUMA 4PG3A 2VQEQ 4M9SA 4Z1MA 3W5IA 3STBC 4CIDA 2V4ZA 5CB8A 4DZZA 1ZNXA 1FJGQ 2VLIA 3W90A 1A2KC 4A6PA 4EQ6B 2GKSA 3RS0A 5M3FG 4IEIA 4AYXA 4DBLC 4LJAA 4MITA 2G77B 3E2IA 2QROA 4JI0Q 3UDXA 1AH9A 4UQOA 4DKXA 2EQBA 3WYGA 4F38A 3H3VI 1PHJA 1OTCA 1KO8A 2QUZA 5FOUA 3J81k 1W5TA 3WXMA 1W2GA 4OK3A 5JWRA 1T3SA 4L5TA 1NJGA 3LO5A 2ZANA 1P2SA 2B6HA 1GUOA 1UBGA 3ZVRA 3EN2A 1H8EA 2C77A 4QHYA 4UXIA 1T5EA 3WNBA 1IQPA 3IHLA 3HFZB 4PANA 4IOJA 2RHDA 4A9AA 3X1DA 2GBLA 3KJHA 1N6HA 1SRUA 4QBIA 3PF5A 2GCPA 3AF1A 1Z06A 3PUXA 3RRYA 2R92G 2ZSDA 1SLJA 4TMVA 1NE3A 2UUCQ 1MRNA 3NKVA 1S96A 3FKIG 1AKYA 2JEOA 1LYLA 4BY1G 1NN5A 2QORA 3LRPA 2JA9A 1ZMXA 2DN8A 2NN6H 1SR3A 1XU4A 2ZJBA 1ODFA 2BA1A 2QAGA 3A1SA 2ZRMA 2FMXA 4QHSA 3VR1A 1NBMA 5LMNL 5UKDA 3E0EA 4MRPA 1VQHA 1KY3A 3LFUA 2WOJA 1COWD 4GPTA 4RVCA 3CQZH 2IYSA 2BA0A 4AKEA 1HE8B 1XCGB 2RHSB 4RG1A 2ZTEA 5LMUQ 2JAQA 2WWWA 4A6XA 3S1MH 4AYBG 2WV9A 4YHHQ 2OFXA 3JVVA 4JVMA 4LDJA 3U7EB 5JEDA 3TUIC 3FMFA 1G5RA 1SVOA 1LTLA 2QENA 4DB2A 1KKMA 2D5DA 2VUMG 1XNJA 3HKSA 2QY9A 4NH0A 1SROA 1AK2A 4TMKA 2WSSA 4UNNA 2PNRC 2QP3A 1OB2A 1T9HA 2E87A 2QTVB 2A6ED 5K36H 3R20A 4DV3L 5AUQA 1JECA 3ZS8A 2OQKA 1E2FA 1SHZA 1HZBA 3TUJC 2GA8A 5IP7H 5FH9A 2PZEA 3KKNA 4JJKA 1KMHA 3AB9A 2EFEB 1HURA 1XPRA 1LV7A 3EZ7A 5KOYA 4TLAA 2B7CA 3VQTA 1EQRA 1WXQA 3C41J 3LWUA 5H1SE 5M3MH 1C9KA 1VCMA 4BFWA 5SZHB 2QAJA 1ZNYA 4XVUA 4Q00A 3QKSB 2A6EC 2XB2A 4YWKA 2QTFA 2B8FA 3NBZC 1H95A 4JT2A 2MFIA 2JA5G 1E9CA 4DDVA 3L8YA 3A74A 2JCSA 4QGFA 1W44A 3X1ZA 4C7OA 2W2TA 1W46A 3NG1A 4M1MA 2J0UB 4GKJL 1EUJA 1XJ0A 3OPOA 1YZLA 4HB2A 1G5TA 4PHFA 4AG6A 1GJXA 1WE2A 2KHIA 4HAVA 3CKLA 2XTIA 4NYIR 1B70B 3WNDA 3K0SA 1TUIA 2KBEA 5CJPA 5FUYA 2OILA 4KLKA 2IX3A 2YVUA 3J7ZC 3BB1A 4MDFA 1QHYA 1AA9A 1KTVA 3R8FA 2F1RA 2ZYUX 1D9XA 3CRQA 5TV2A 4P4SB 2AX4A 1CTMA 1H9SB 3CXCA 3H0GH 3JAMi 1VQMA 2B29A 1GKHA 1IJEA 1A4RA 3M3YH 1QBKC 1VG1A 3GJ7A 4QHTA 1J6QA 2E5LL 2ZRIA 3MAAC 4YCUA 3QPWA 1WF3A 2ZJ8A 1IL2A 5EZ6B 4LYFA 2EU8A 3TK1A 1GO3E 4Q9JA 1ZM3A 2AR7A 4JYAL 3CRVA 2AWNA 3PO3G 3DOFA 3MCAA 2WB1G 4W9MC 1NJFA 1X65A 1E3PA 3S2HH 3T34A 1E0JA 5A35A 2JLWA 4ZKEA 3TREA 4GSYA 3VNVA 3ZQ6A 4PFSA 4PZ7A 2ZEJA 2ZRDA 4TVAB 3VR2A 3NBHB 3IPYA 2JDIA 5SZKB 1NY4A 1R0WA 2FV8A 4P71A 1Z6HA 2QQEA 2E2HH 4LCBA 1X54A 2R6GA 3K9HA 1PH2A 1XP8A 1EX6A 4DCUA 1SVKA 1AKEA 4JJZA 4EIWA 3WRYC 1AE3A 1J99A 3FTQA 2WAYA 3FP9A 1XJCA 1CF4A 4LUOA 4OBEA 1N5IA 5C46F 4BFVA 4D25A 1E9BA 4R4CA 1O7IA 2R93H 1CKMA 3U58A 1XXHE 5C0XH 2J41A 1NG9A 5CYOA 5AR1A 1X1SA 4LGMA 4B3TL 4ZIRB 1KI3A 1S1MA 4Q02A 1CEEA 4DR4Q 4LBWA 1Z29A 3IILA 2YJTD 3SC3A 1LABA 4CYMA 3EX7C 2JJ2D 3QIAA 1G6OA 4MUBA 4C30A 1Q7YC 1JPJA 1SE8A 2GK7A 3AKEA 4NONA 3TNFA 2ZM6Q 1YITA 2YYZA 4R4QA 4LHWA 5LB4A 1PLJA 3MWKA 1OXTA 4LFBQ 1G8GA 4KN4C 4C3IH 5LMNQ 2H92A 1G3RA 1KI1A 2R6AA 1UE7A 3R7WA 4D0LB 4HYYA 3QY0A 4BZQA 3GLGE 4A3EG 2FSHA 2WJHA 4BLRA 2VP6A 3RNUA 1WQ1R 2AUKA 2ODWA 1ZD9A 2BBSA 3HOYG 4OO1G 2AK2A 2BJWA 4GZLA 3NC1C 3QENA 1IOZA 4V0ME 5G3YA 4B2IA 3M4OH 5M5XH 1HQMC 3U4ZA 3PENA 4BA2I 4I1SA 1OB5A 1HCZA 3KDFB 2ZUCA 5HGQA 4KLNA 2N49A 4D4JA 2WJIA 4KJZA 5CLQA 5L8VA 2OTLA 1O87A 3PVSA 5FUWA 2QL6A 4E09A 3ZS9A 4DB4A 1ELOA 3D6TB 1G21E 2NO7A 2Q0HA 5IF9A 3VR5A 3CF6R 2OWOA 3GQBA 2EYQA 1TU4A 4KSCA 1KIMA 1UADA 4LFCL 4JVLA 3PJRA 2ES2A 2J3EA 1XEWY 3TZUA 1N6RA 4P4TA 2NMVA 1E0AA 4HIOA 4OONA 2GEDA 1VHLA 3BG3A 4XIGS 2NVTH 4BFUA 3QPUA 4U5XA 2GN5A 4HB4A 1S9HA 1T3HA 2C5LA 3Q3JB 4AWXA 4OGQC 1H65A 1WDTA 1YR9A 1CLUA 4GMDA 2FA9A 3TBKA 3FHOA 4HZUA 4GLXA 3PEWA 3OAAD 1YZUA 1LF5A 1A5TA 1LS1A 1M6NA 1T0HB 4FIDA 4MUAA 4NHOA 1E2HA 2AMCB 1MRSA 2ODEA 3QKSA 1HQYE 2CW0C 4HIKA 2JJ8A 2OQ0A 2NO9A 3A7LA 3H94A 2H18A 1E2MA 2JLRA 1LS6A 3DM9B 3E70C 1G4AE 4JC0A 1KK3A 1GNPA 1H9MA 1SZPA 2YC4C 4QY7A 2VW9A 2ODNA 4BWYA 2X8AA 4PHHA 4UXJA 3TAUA 3I7FA 2CCZA 1Y1WH 1XNQL 4YCWA 2JA8H 2ZRCA 4O3MA 3TE6A 2WMNB 4GNKA 1DOAA 2PMZE 4DV4L 4YC7A 3GFOA 1SVIA 5DE3A 3RS3A 3EIQA 4PZZA 3VMFA 3U7HB 4KO8A 5KSPA 4LY6A 3OFND 2GEVA 3OIVA 2QQ0A 1JQLB 2GK6A 2VQSA 1YBYA 3K8AA 1NLZA 3DZDA 4P4SA 1H9SA 2EFGA 3Q72A 4V0NA 2QGZA 2V3CC 3AVWA 3DMNA 1C9OA 1Q57A 1YJWA 4A3CG 1UDXA 1HYQA 2JA7H 1NSTA 2VY3A 1MOZA 3V00A 1N5JA 5C18A 1WBDA 4JI3L 1ZUNB 1WCMH 3OOCA 3FFBA 4DK0A 2YTVA 1I4TD 1YHNA 3B1WA 3THXB 1J90A 3GTLH 1AGRA 1K6MA 2W83A 1LW7A 1U0HC 5M3FH 3BWDD 1N6NA 2BCJQ 2ZUBA 3SN6A 1ONBA 1NVWQ 2Z6VA 4P0TA 4WVFA 521PA 4A3FG 3PO2G 4A76A 1BKBA 2UXCQ 3REFA 3RS7A 4ESVA 5BN4A 4O0AA 4L5SA 1T0JB 1LM0A 1Y8NB 5GADl 3ULPA 5IWAL 3RN5A 2RH5A 4DLTA 2FEMA 1QZHA 1JR3A 2Q2HA 4EUNA 2JLYA 2WOOA 1W3SA 1QDEA 3ER0A 3H1TA 1LY1A 5H8WA 2UXDL 4OJQA 4HAXA 4P75A 5BWMA 3M4QA 1PV4A 3FE2A 5DI3A 5FPSA 4XWOA 2FZLA 4N0DA 1U8AA 3NVAA 2R7ZG 1U5KA 1WYDA 1WJJA 4F4JA 1I2MA 4OI0A 2PX0A 4FMDF 1UEIA 1Z22A 4M1KA 4RY2A 4DUZL 3T06B 4URXR 3U6KA 4LF7L 3WHLA 4B3TQ 2R92H 2ZJYA 3U5ZB 1XPUA 2AFIE 4DLRA 5FFMA 3GD7A 3FKIH 2EYUA 4BY1H 5FR1A 3AKYA 4PPNA 4ZIRA 1HNWQ 2AXNA 4M2LA 4DK1A 4KITB 1YZKA 4G5QA 4GOPC 1QVAA 1G18A 5JRJA 4MH0R 3U61B 1Z28A 1VQKA 3C5HA 3CW2C 3EW9A 2XJ9A 2BH2A 1KL9A 2CNWD 3LDAA 4H9GA 1XXHB 3BJIC 1QUQB 4JYCA 3ADCA 1V1QA 5L3QB 4DV2L 2NG1A 5IY0A 5AUNB 3RZDH 4B34A 1BVSA 4A3IH 2ZS9A 1M8PA 1I4DD 1XTDA 3OF5A 4IFBA 4JZKA 4LHVA 1EFWA 1Q21A 3DL0A 4Y7NH 4TL7A 1NI3A 3KJGA 4OJKA 3X1YA 2F52A 1VQ6A 3G4SA 1KJYA 3EWAA 3AF2A 1HQCA 1GP2A 4UNSA 2VUMH 1IY1A 3KB2A 3HOWH 3WHKA 2VP9A 4WW0A 4Q1BA 2GVDC 1Q1EA 1P72A 5E7IA 5KDDA 2Z6KA 4A3BG 2BMEA 1IYUA 5EUQB 3GLGB 4R4TA 1R5BA 2D2EA 2ZRJA 4OXPA 3VKHA 1YHAA 3WP0A 4JBXA 5FOXA 4B3SL 4LF4L 4BRUA 4ESHA 4V0KA 2O8EB 3IQWA 4UPAA 1ZM9A 1FW6A 1DAEA 5IK2D 2BM1A 1JALA 2DFKB 1U0JA 3J81c 4FD2A 2EQSA 2WJGA 1E9AA 5FLXc 3QXJA 4OX9L 1H8HD 2AHOB 1PVOA 1MABB 5AJ3L 1FPMA 3NTUA 4M8NE 3ZJYA 1Y8OB 1ZRHA 1IHUA 3KOJA 3T53B 3P1JA 3PG5A 4TSFD 5FPHA 3REGA 1W0JD 4FCTA 4E5UA 1GUNA 3HOVG 1BYIA 3I2ZA 4J0QA 4HAWA 4QBHA 5KNCA 1CR4A 4GI7A 3GTPH 4IW3B 1L8QA 4IOCA 3N70A 2UZIR 3A0JA 1UEJA 3WYAA 1QHHB 4PHGA 3T1OA 2X1VA 1VPLA 3OW2A 1IY0A 2ZSAA 3W6OA 1GFIA 4RZUA 5BQ5A 3QG5A 3CP0A 4JYBA 1Z08A 3KLRA 3GTMH 4DKAC 2OV2A 1E1RA 1MR3F 1JQJC 1I5FA 1OXXK 1CKEA 2ZS8A 4I1VA 2YTXA 3P27A 1NN0A 2ZRPA 4ZI2A 5IP9H 3AVTA 1XNQQ 1XTSA 5F9HA 1N6LA 1OH6A 4DV4Q 2DPXA 2WKQA 3CC4A 3HU3A 3G5UA 4X8MA 1EWIA 4URYR 2CQOA 3EG5A 4M1WA 4WIAA 1Z0IA 3K70D 1KK0A 4OQNA 3RABA 5TB5A 4KBGA 3ONWA 1RRFA 4A0HA 2IUTA 4GDFA 3A4LA 1VG8A 1DEKA 2CL0X 4Y52H 4LF6L 4ZO4A 1A1VA 4PZYA 5E7NA 2EJFC 4IPGA 3J80i 3BD9A 1DE0A 4Q7MB 1D8LA 3KJOA 4L8JA 4B3GA 2J7KA 4JI3Q 2FJUA 3A1UA 2ZE5A 3U7GA 3VU9A 2WSSD 5BR8L 4DUGD 2IYYA 2IYLD 1U8ZA 4DV5L 2ZRKA 3MSXA 3K70C 3Q9LA 3D7MA 2W6ID 3THXA 2C8VA 3KZ1E 4C3JH 3PIPA 5IWAQ 4JBYA 4BGDA 3LLMA 5DO9A 4XD7A 3K09A 4JL8A 4JLBA 5DH9A 4HR7B 4X62Q 4EPWA 3A8TA 5CK4A 5B64A 5E95A 2WWGA 4Y0VA 2UXDQ 2PMDA 1M2OB 1NLYA 4YXWA 3GMTA 2AD1A 1GKIA 2A9KA 2OZEA 4GMXA 1E2EA 3AH8A 4XWAA 1U2RA 3EARA 5AK0A 5B57C 3BU2A 2YINC 2K75A 4DUZQ 3WDNA 1TAGA 4LF7Q 1E2LA 2ECKA 5K36G 2CWAA 2K5UA 3ZYCA 4ZCIA 2OBLA 3B60A 4L4UA 2D74A 2N1BA 2J0SA 3AF0A 1DPFA 2EFHB 3AP1A 3QI2A 1PH5A 1XWIA 1KNXA 3CB4A 4HI0E 2H8KA 4P4UA 4B75A 1IN6A 4D4MA 3DM3A 4KYUA 3D8BA 2PLFA 1BBUA 1FL9A 1W36D 4LK2A 4EPRA 3B85A
chains in the Genus database with same CATH superfamily
2EF1A 2M9VA 5F35A 5T8KA 3KE9A 4DR5Q 4Y67A 1QJOA 1WCV1 2ASBA 4BA1I 3NAZA 4DC1A 1E3WB 2HIGA 4ZYYA 1YBVA 3TAXA 5HKKD 1ENYA 2ZWMA 4U7FA 3KKEA 2X2OA 1ZRNA 4RYDA 2V9PA 4PZEA 3RRFA 5BSGA 1OF1A 4PFQA 4OSPA 3ZJUA 3Q8WA 8ABPA 1SE2A 2MNAA 2QN1A 3TS0A 5CGQB 4DNIA 2R7ZB 2Z56A 2FSPA 1BCPD 3A28A 1IYVA 1PX2A 5CB4A 2AJLI 4GT1A 1M54A 4CMEA 4TMZA 3JQFC 5EC8A 1CRWG 3U3RA 1LW6E 1E79D 3G68A 4YO8A 4W5QA 1G98A 1EYDA 4WKBA 4M49A 3CPWA 1CUCA 3PO2H 4KE7A 3LVRE 4NKRA 3OQ1A 3BZCA 3OSZA 1JGTA 1ZWLA 2O7QA 4G97A 3RHSA 3CM0A 3G89A 5J1TB 3V5NA 3R2JA 4AUKA 2QL7A 1AKTA 5EMJA 1VOTA 5K6TA 3K05A 5DLEA 3Q9NA 3SOPA 5KYKA 4R16A 1EEFD 4N0QA 4OQYA 3T1VA 3NHRA 1TECE 1J6UA 3J7AV 4ZUJA 1HDCA 4PMWA 2L9HA 2QNIA 4TYYA 2JC3A 3TQSA 3AKZA 3TNYA 2JGNA 2Q3MA 2MSCB 4QYTA 1SXJC 4ZC8A 1IHXA 1VPWA 4LWOA 1MB9A 1RJWA 3ROEA 4XQNA 4DAOA 1QGOA 1JX6A 1JIUA 1XZLA 1V4VA 1U4OA 4GQAA 4MK4A 4CMGA 1Y8AA 3L4SO 2XA1A 2JLBA 4HHEA 1X1EA 4WCFB 5FLXA 1Q1AA 4X1YB 3I12A 2W8ZA 1G2OA 2O19A 3D9QX 4RGBA 1GZ3A 5M3BA 2IS2A 2R86A 1IBML 1PL7A 2GVAA 1UXOA 4O4IA 3OE1A 1B9MA 4G26A 4U0KA 2HL6A 4NZYA 5GAEC 1ZSYA 3Q8XB 4N6GA 1A8IA 4MX8A 2C5CA 1O5TA 2CL7X 4BKPA 1ECJA 2C8KA 4B17A 5DTMA 2TMGA 1XZ8A 2C92A 3PRJA 3OU7A 5KOHB 1C8KA 3AVXA 1YNXA 4B7XA 4LGVA 1XRSB 3SE0A 4R84A 3T1HQ 3EGIA 3KL4A 4D25A 2GDJA 2VHZA 1W9HA 4DCPA 2Z0MA 3EYAA 1SD5A 3KKZA 2IZZA 3JZMA 1P4JA 1QOHA 3W5SA 4MB0A 1PJTA 5LN1A 2O2HA 1UBEA 2QE7A 4BRWA 4XWWA 2C2WA 2BGIA 2VPPA 1P39A 2QL5A 3UXEA 1IONA 2QVBA 2PMBA 3GUUA 5J4HA 3U3JA 4HSPA 3R5FA 2YS6A 1UZLA 4IV8A 2QTVA 1NNUA 2OFOA 2UYHA 3I9KA 4UUPA 2JXMB 3GTLB 2V1XA 5MGBA 1D6JA 5D5PA 2MIIA 1XAIA 4QM7A 1EJ2A 1YULA 3PPVA 3EDOA 4MRVA 3VR6A 1MKYA 4FNAA 4XA8A 3EPKA 3PT5A 4G0PA 4I1OA 1W2HA 4AX4A 2ZJZA 3L77A 5KX5A 2Z9CA 3RBVA 4F91B 3KUCA 3H1PA 5F1KA 4AYBB 1C1XA 2WICA 4HSGA 5I9OA 1TKBA 3DSRA 2J4XA 1DSSG 2ISSD 3HHPA 2XWJI 1SCKA 1QUFA 1GFZA 1ACLA 1TUGA 4JBGA 1EEXB 1JE0A 2F90A 5TQ2B 2QSZA 3R3UA 4F46A 1D0VA 5LL6S 5EHZA 2CYBA 2HRZA 4EBBA 4YQZA 5AKLA 4YT4A 2JHFA 1BQ4A 3TH5A 2FVYA 2X9GA 1XTIA 1BWQA 3KYCB 1WXWA 1NUHA 2XWSA 2HK9A 3UMGA 4BKMA 3S40A 1WDWB 3GX1A 1RKVA 1ZLXA 5LWQA 1U4SA 3KALA 1GSOA 2UUAQ 4XEHA 3AR6A 3VC2A 3RRJA 1N5OX 4RTNA 2IEGA 3NHFA 4F9TA 2YJ5A 4E2WA 2R7FA 1A2QA 1S2MA 1ONNA 3ZLTA 1OLXB 1IBLL 2CQAA 3PC8A 1X92A 3WOVA 3AHDA 3BXHA 4JI7B 1NW3A 4IJMA 2POQX 5EIAA 1AH2A 3QYAA 2JAHA 4ONEA 3ZC3A 4ZJZA 3FPSA 1JJIA 5I9LA 4G0VA 3MYRA 2ZB2A 4FD3A 3E5MA 2D06A 3QKIA 1D5WA 4E2YA 4LWCA 1MJCA 3TDKA 3OG9A 4U6NA 1VKZA 2RHJA 2G80A 5LQCA 3IIIA 1S8AA 1ZICA 4NYJQ 3CISA 4JIMA 4DCVA 2GTIA 3DF7A 2GJKA 3TLMA 1EJ6A 5DHPA 3PKZA 2FLWA 1VXOA 3WGTA 1VIVA 3VPGA 4HUQB 2HDLA 3TW8A 4DNRB 1VBKA 2IHJA 1KE2A 3IIKA 4US2R 3ROZA 5LYJA 1TTPB 1TWGB 1GG2A 1KIXA 2JLZA 4NXNL 2YY5A 4BFCA 5TE9A 4EK9A 2J3IA 3EA4A 2EX0A 5G40A 5JQGB 3BHIA 4WQMA 2BM9A 2E48A 2VDMB 1EP2B 3SYTA 1GNSA 1N1DA 1P2BA 2TS1A 4KR6A 3QF7A 4TTVA 3X1WA 4E3WA 1NR7A 1USIA 2EIHA 4DM7A 3PJEA 3DHEA 1QNUA 1ONSA 5CV4A 2ZKIA 2C3YA 4X6AH 1N9WA 3CX6A 2ACWA 1Z9FA 1ODSA 3EFXD 3QE4A 3ADPA 4URUR 1R8XA 2VTBB 1OLSA 1LLUA 2DFNA 1SOUA 2FWIA 4EO7A 5I5EA 4C3HG 2Z57A 3VU8A 2GAOA 1TS2A 1NX9A 2ON6A 1L8AA 4RTMA 1M1NB 5DEIA 1UBJS 1GG5A 3CW2A 4OQXA 1LDYA 4QG7A 4L6TB 1ZO8A 1FY2A 4HO1X 1XF1A 3ITKA 3IULA 1PZJD 4IQ4A 1HHVA 3F46A 1HTTA 1J8IA 1ENAA 2WKPA 4HQOA 4KHPQ 4J90A 3Q0EA 4BQEA 1CDDA 1AXGA 4Z49A 1EK1A 4AG3A 4HEQA 1DG3A 3UZUA 5H3HA 1UR5A 2OLJA 4F6RA 2Q7OE 4POFA 1OFTA 1EGHA 3VAYA 5JFOA 3UG6A 5EUBA 5AOAA 1SC4A 4PQGA 2WIJA 5KSOA 3OTIA 4DSAA 2IEYA 3R2IA 1UPFA 4AKTA 1W0JA 2BH8A 4GLVB 3ZJ4A 4LF9Q 2IPKD 2GF2A 4LOLA 3HYLA 3OQIA 1XQ9A 4V0SA 4BWGA 4GL4A 1HI9A 4BNDA 4HQRA 4O4LA 3LP6A 2O20A 3NBXX 3VC3A 5HCIA 3U3KA 2NO0A 3G7SA 3BGSA 2OBYA 1LDMA 4IPDA 5FEMA 4BECA 1KY5A 1IU9A 2XUHA 3LLUA 3IL8A 4PV1C 4E33A 1YJ5A 4RA8A 4YDSA 1CJMA 3TRKA 1X1AA 3D8NA 3ZCSA 1JFRA 3EQ7A 4N7RA 3HXTA 1ICEA 4KBYA 3E7DA 4ODIA 3T7SA 3MEHA 1S3SA 1T4CB 2BELA 3UAXA 4XGKA 3HO8A 5TMPA 2B7BA 1PTKA 3QOWA 2C99A 3DZFA 2NZXA 4FZRA 3HO1A 4L8GA 4J7CA 2ZIAA 5C44H 1TE2A 5B7QA 2JL1A 3GEBA 3OJWA 4XGRA 2KHSA 3RUPA 4RWSC 1MPTA 4TTRA 5L40A 1E8NA 3UAWA 3WLJA 4R1OA 3VI3B 3NNSA 3JPYA 5J43A 2BIFA 3VJLA 2H4JA 3B2EA 4GGMX 3PXCX 2NBFA 1PEKE 4UY8C 3U60B 5EOVA 1A3CA 2YHUA 4JYAB 4FPXA 3JWIA 2C2BA 1H9CA 4YRKA 4OXXA 1ZBDA 4A16A 1OILA 3NAQA 3W7AA 3T9CA 4UHHA 3WQSB 2HUPA 3BTSA 4OX9Y 3LNTA 3RG2A 2CDRA 3AIKA 2JD1A 1UF9A 2HWWA 4H16A 2R47A 3GO4A 4RKYA 3WGHA 2N9UA 4NCKA 1V9CA 4DV3Q 4HLCA 2GN4A 4JL6A 3EF1A 4YRGA 3KXKA 3UDIA 2E9SA 3LBNA 3LAWA 4RVDA 3NATA 1EGQA 2MQHA 1OR8A 4G8BA 1TEHA 1ZD5A 2C83A 1RBQA 2NVQB 1TADA 4MKFA 4O1IA 5AK5A 2NACA 3VJRA 4HLUC 2Q99A 1RYHA 2GZMA 4PRKA 1U3WA 3LWEA 1EGAA 2B4TO 1L5GB 4C4XA 4IOKA 1QDLB 2IV2X 5JLAA 3LZDA 4KPFC 1BHSA 3ZNPA 1G41A 5M7EA 2A9RA 5FOWA 4KTTE 2VIIA 1RC8A 4AC9A 3HL4A 4Q93A 1GXDC 3T5DA 4OHXA 3A55A 2OFPA 4DXGA 2L18A 1P9NA 1NN1A 4FGWA 3FXAA 4M0EA 1AV6A 4DV7L 1VQJA 5CFRA 2IITA 1CUJA 1P1BA 3W1VA 3N2NA 3JXEA 3GPIA 2NT3A 2YTZA 4PWYA 1O96A 1E3TA 1R4NB 3ZGNA 2YNMA 3HB1A 3FGZA 3WGMA 4A93G 1QQ5A 4P38A 1FRVA 4YMTA 1XMIA 2C9DA 1QCCA 4PNYA 4UD6A 3IMEA 1Q92A 4RIFA 1SVSA 3HZOA 4ERXA 3MYYA 1GRNA 4NPAA 1XDGA 3QXGA 1EXVA 1GQYA 3NFYA 1PQWA 3I39X 3CEAA 4H0FA 1DI0A 1PZHA 4LDZA 1SJED 2NZ1D 4YRPA 5A4KA 1E2DA 5CB4B 5JHGB 2K6AA 3L92A 1P44A 2X13A 4EY7A 3NTRA 4EFLA 1GUBA 2VPZA 4F5WA 2B1RA 1TJYA 2W70A 3BFJA 4CL8A 1X56A 1ZIDA 4CMKA 3PO3H 2R7KA 2IW3A 3A4YA 5H9WA 3OYYA 3W9BA 1QVFA 3RVKA 2N75A 4I14A 5BR7A 2V74B 4RF3A 1I1OA 1AJEA 1EFHA 2AV6A 2WK1A 5CM2Z 2AXQA 2O5JC 5TARA 5FLMG 4NVRA 2HCIA 3E7FA 3DBOB 5EE3A 1NWHA 4DEXA 2BMVA 4GOMD 1LBHA 1FDIA 1BWPA 3R23A 1CQJA 3FPHA 3X2EA 1EY7A 5H70A 4FMDB 3M4ZA 1NBOA 1JQKA 3R5HA 2H1CA 1QG2A 3CHBD 3GFVA 1XMQQ 1UCFA 1VYTA 2H85A 2A0XA 1T3LA 3IAM6 2B8EA 5I7EA 2GPYA 5E2IA 2A69C 4ML3A 5EIXA 4KNYA 4RTJA 4JS0A 3KFUA 1KQOA 3EZ2A 3F6RA 1I2ZA 1PVVA 3EVBA 2Q9AA 4LYHA 4PBTA 1Y1KE 1KAHA 1NQOA 1L6IA 4CL2A 3AEVA 1YS9A 4P32A 3OHPA 1JRLA 3P26A 5JAVA 4FXDA 5TPWA 4Z4EA 2Z2XA 3S2IA 1E2NA 1Q83A 4IYRA 1PQ4A 4OUKX 4FNFA 2GN9A 3H2IA 1A27A 1A62A 4IMIB 1PUIA 3IUQA 3DOHA 1UKZA 4DVGA 1H2YA 2WV7A 3OECA 3LSYA 3I45A 1W8DA 4EEZA 5CITA 2E2JB 1E2BA 4R3UC 2H5IA 1RJTA 2QZJA 5D3IB 5AJXA 4BFZA 3GYBA 2HQOA 2X0KA 1D9ZA 5DYNA 3PNYA 2V0GA 4OMDA 4NZPA 1DKRA 2EKBA 1DTSA 3C5WP 4OF4A 2D4HA 3DOEA 1FLAA 3A6EA 2N78A 1AUPA 3D5QA 1VHDA 3NM5A 2R25B 3SSMA 4LQ4A 4RAUC 2EGHA 3KR1A 1FLNA 1W2GA 1T3SA 4L5TA 1NJGA 1U2DC 1WPQA 1X2EA 4ZJYA 4XW2A 3IHLA 4JC5A 3OM1A 3JWGA 3X1DA 3C74A 2SBTA 4HAIA 3FKIG 3NM6B 3QPCA 3H42B 1CHPD 2ZJBA 1RWOA 4CJXA 5D5HA 1ZH6A 4LOKA 4E5YA 2B25A 1QO9A 2FZEA 1DRKA 1W8IA 2WWWA 4A6XA 4LKRA 1JHZA 3JVVA 3PUIA 4LDJA 3O4IA 1SROA 2QRQA 4TKLA 2VJMA 2QTVB 2Y1WA 2FEAA 2JGRA 3KKNA 4DYHA 3DQZA 5DBIA 1JP7A 2WFZA 1GCUA 5F7JA 5M3MH 2ZBEA 2XB2A 3LHIA 1ZHOA 2XUQA 1W44A 5SV2A 5EJMA 5DOVA 4ECEA 1RNLA 2E4WA 1TM4E 3NTIA 1VE3A 4KQIA 1QBKC 3GJ7A 3PCTA 5LQMA 2A1IA 3R5JA 1C1XB 3DAFA 1X38A 1ZEQX 4IMRA 1CEYA 4A73A 3LSTA 4CG2A 3X3HA 5SZKB 2JH9A 4GAEA 1PZMA 1QNLA 1KWGA 4IRXA 4LGMA 3HKCA 4LBWA 1PV1A 1SN7A 2AUTA 1ODKA 3CO0S 2B4QA 1W5BA 3I5UA 3AV3A 4LFBQ 1EYAA 5LMNQ 4C3IH 3GLGE 3PFFA 1VI6A 3AY0A 3ZQ6A 1JDBB 3U4ZA 1A9XA 5LQJA 2WJIA 5AKYA 3T6KA 4UM5A 4RWZA 5ABPA 3VR5A 2DTXA 3BYYB 2IPLA 3TZUA 3KQYA 2AN3A 1VHLA 4ZHSA 4A3GB 3JZDA 1B1AA 1LS1A 1Z5VA 1WDMA 1C81A 3HRIA 2NO9A 3M6UA 2UV8A 3IV6A 4JC0A 4NBWA 1AKNA 5BURA 1PTJC 4TVOA 4KR3A 2EY6A 4GNKA 1JS1X 1Y3DE 3SYMA 4A3CG 1OI2A 1AUXA 3WZMA 2XT0A 3OOCA 3PR3A 4X66B 1YHNA 4WN3A 2JGDB 5HKLA 2Z6VA 4P0TA 2PT9A 3C46A 4LXHA 2IE8A 1QC5A 3MGBA 2C5BA 4J6EA 1BQ3A 4RY9A 3FE2A 3ETGA 1U8AA 1U5KA 4HTAA 4KSYA 3U6KA 4B3RB 4GOPC 4NEGA 1Z28A 2YV2A 1MA0A 5HEKA 3I9NA 1VLQA 1CZNA 1J33A 4IFBA 2XLCA 4LHVA 1TR5A 4Z7QB 1NI3A 2MHCA 1KJYA 3D5EA 1TLTA 5LYYA 3ROGA 3A2KA 5EUQB 2P2DA 5HOEA 4XWGA 1YHAA 5MN6A 2Y0BA 1TIID 2YN2A 4JX8A 4KHVA 1AZPA 1H8HD 1NFQA 1REQB 3VBCA 3I2ZA 2FMIA 4RANA 3GTPH 1L8QA 1UMDA 2CFSA 2X1VA 1B6TA 2OGWA 4E6PA 4DKAC 3Q8KA 1CKEA 4G0YA 1NN0A 3ZHTA 1C3OA 2DPXA 5DULA 3OZUA 4JK3A 3W5HA 1BXTA 2XUKA 4PZYA 5E7NA 4B1FA 4X3UA 2QYSA 2FXVA 3VU9A 2WSSD 2UXBB 2PMZB 2FVXA 2C42A 2PKXA 1ATZA 1JHRA 2XLBA 3TWOA 2ZWIA 4OHBA 2XYGA 4BN0A 1K68A 4X62Q 1ILEA 2EZ4A 1F7UA 1NLUA 3Q40A 1A8QA 2ECKA 3KPVA 3JQGB 1OLSB 1FMCA 2AQ8A 2E4AA 4WLUA 1E5VA 4D4MA 3PQ8A 4FTWA 4JJGA 3P52A 5LZ8A 3B2NA 2AFIB 3GHYA 2CC2A 4RO0A 4ZZ1A 3EZ6A 3H6GA 3BB3A 4QLBA 4HQ6A 2AZTA 1M33A 3Q24A 3O7MA 3Q6SA 4ZLTF 3BWCA 3A6LA 4N6OA 1QG7A 3F2VA 5DGHA 4DA2A 3EQZA 3RSOA 2CNBA 4JXKA 1E66A 4DXFA 2PO4A 1VKOA 4EGAA 4FW9A 4X1KB 2IU0A 2DFVA 1RHUA 4BWFB 4L8FA 1I4EB 3UPUA 1N3YA 2G67A 4K0KL 3FIUA 3BVPA 2P9CA 1VLLA 5M2QA 1DAKA 3R7FA 3MTBA 1ZGZA 2OD2A 4H7JA 1DP4A 1PBNA 3PFIA 5EJEA 5CDFE 4IDOA 1U0LA 1AMOA 1X6VA 4L5IA 1UOEA 3VGJA 4OUDA 4M7OA 2VAVA 1NXVA 2NO6A 3OC0A 4WBNB 4RK5A 3VSDA 4BNDB 2AFHA 5DLYA 3CPSA 4O4LB 3U16A 2IHZA 2BFBA 4DABA 1G20E 4KVAA 4YDQA 3HJNA 2O1XA 1ABEA 2ZJAA 2A1AA 1RBMA 2XGMA 4S3MA 1ENOA 3L40A 1L4BA 1QG4A 1QCDA 3FZQA 4RGYA 1RYDA 1B3AA 2AQ2B 2X2EA 1H2WA 2Q5OA 1A8PA 2ZXOA 4ZYVA 2WTBA 4FT2A 1L9XA 4XE5A 2ODBA 5KZMB 1HT2E 1PR6A 1NN3A 1SXIA 2V4DA 1C0PA 2EVBA 2J7PD 3NDRA 3G9QA 1AY0A 5D65A 1QOQB 1OLOA 5LXTF 2DJGC 3I0MA 2CNNA 1KAGA 4RIEA 3I2JA 4DCOA 2D2FA 3ZHYA 2C35B 4Z4IA 1KQGA 1Q20A 4NULA 3G0OA 2QUIA 4B33A 1SIUA 3JQEA 1UT6A 3MBKA 3V9PA 4UCQA 4MUEA 1A7KA 5FBKA 1DQYA 1QFSA 4ZDJA 2O8DB 3TL6A 3JY6A 2JI8A 2HLDA 4Z1OA 2BI8A 4ARVA 4EI9A 4AJ9A 3LL7A 4UU7A 5F9MA 1RM3A 3RKSA 2FN4A 1AXRA 3QE0A 1QMPA 3K8YA 3I6MA 3M3YB 3A4VA 3NGXA 4OYYA 3OHXC 2ZIEA 3VSCA 5EJ5A 1P9LA 4RPIA 1E0KA 5AUOB 4NIMA 2IZ1A 4YASA 5LJLA 4RD3A 2R7NA 3DZBA 3WMFA 1R6UA 1LO5D 4C88A 4KOAA 2PNJA 3W4IA 5HDQA 1JSCA 1QGAA 3WSWA 1KHTA 4A8JC 1RPTA 5G1OA 3V48A 4Y0NA 5HK9A 3ND6A 1QNFA 2GXSA 2G36A 3KYDB 2UZ0A 3T4XA 4B3XA 3GY0A 2FSIA 1W93A 2H1SA 3R7LA 1A4UA 3TN2A 4Q6BA 4X24A 2O48X 3JPWA 3SX4A 4G5FA 5E4TA 2A35A 3MJRA 3C3WA 3FF4A 2A5YB 3RIHA 3V6LA 4ILKA 2ZAGA 2ZYWX 1Y8RB 1OYWA 2C0QA 5DXJA 1MU0A 3TCXB 3CKKA 2EERA 3F4KA 3AJ8A 3ENKA 1JAXA 2Q9UA 1QV6A 1A72A 4Y6RA 4RKEA 2EIXA 3O4HA 3QBEA 2WJ3A 1VQ1A 1D5ZC 1TA0A 1T2FA 3ZU2A 1YAJA 2LY7A 1DIAA