3RLFA

Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords Maltose-binding periplasmic protein
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
total genus 106
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3rlfA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3rlfA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rlfA01
2RCNA 3IRBA 2QY9A 4Z8XA 2QT1A 2JA8H 4IXMA 3DLLA 1OH7A 2CJWA 1HQYE 1P6XA 3K0XA 4P32A 5CB8A 4JI7L 2FNAA 1MKHA 3KDFA 1I2MA 2G1JA 1IXRA 3M9BA 1HYQA 1KI7A 1QHGA 4X66Q 2FU5C 4LBYA 1YJ9A 4BUJA 3F2CA 4PHHA 4DV6L 1NJFA 3G4SA 5SZKB 4D25A 3KQKA 3HYRA 5EUQB 3VHLB 2VYFA 1LFDB 1VCMA 4KODA 1XXHE 1XMVA 2ORIA 4FMBB 4HZUB 4C0BA 3A8IE 2WM9B 1OF1A 4LC0A 4OHXA 3KB2A 2BWJA 3PO2H 4PV1C 4B3FX 1E9SA 1PYSB 1VQGA 2QPAA 4KFRA 3GJ5A 3MUFA 4BFXA 4JV5L 2C98A 1E2EA 1CR1A 1OFHA 2PBRA 1XB2A 1S1CA 4EFMA 1Y14B 4M1YA 4NXNL 1ESMA 1VQJA 2DHRA 1QVGA 4C4PA 1FP7A 3Q7PA 4CEJA 1JR6A 1F2TA 1N0UA 4S35A 4DPGA 3KX2A 4FW9A 4LJYA 1QUQB 4XSGA 1V8QA 3FPAA 1BO6A 2VQEQ 3GTOH 1G5RA 4DUGD 4YMVA 3S1RH 3NG1A 3ULJA 1J7KA 4HAYA 4ASUD 4RD2A 1GUTA 3DXJC 2N49A 1ZP6A 2PT5A 1UE6A 4LNQA 2QU8A 2XNDD 4GKJQ 4Q4JA 5JEDA 4BFSA 4V0OA 3BAFA 1HR0W 1PYBA 2FFAA 2FSHA 5CITA 4CIDA 2OG2A 4ZDJA 3O8CA 4DV5Q 3CR8A 4UNRA 1E96A 1VTKA 1VQEA 4PPGA 1E4YA 5JFGA 1QBKC 4DV2L 2FPLA 2X2EA 1Q1BA 5ANRB 5FBQB 4DDTA 3KQHA 1NVWQ 2P0EA 5JEAG 3TLXA 4F91B 3NDBB 1GRRA 4KXFB 2NN6I 1XPOA 1I94L 3GO5A 2CJWB 4DBLC 4JSTA 2YV5A 5KOYA 5GJWC 5EP3A 3ICEA 2HJGA 3MWJA 3QKUA 5DYIA 1SHZA 3CNNA 2ZYWX 3U3MA 3K53A 3KDFB 3G0HA 1KJYA 4KU4A 4QRHA 1ZNZA 1P60A 1N6LA 5EE5B 2VSOA 1KI2A 1CI3M 1K73C 2AWOA 4OWXB 1YZKA 1XBTA 1PLLA 3NIBA 3HOZH 4UQOA 3QXJA 4WIAA 1JALA 3BXZA 3GLFE 1JBKA 4KKTA 4OI4A 1NBWA 5GJVC 2ZIAA 2ZRNA 4GKKL 4MRNA 3V00A 4JCVE 2WP8J 3GMTA 3PIPA 4V0ME 5FL3A 2R2AA 1XCGB 3LO5A 2WJGA 3IFTA 1MT0A 1U8ZA 2Q8IB 1XMJA 3QBVA 1N5LA 1SGWA 4HAVA 2A9KA 2Z6KA 1TMKA 1YQTA 4PHGA 5E7JA 1UEIA 4OK5A 1CJMA 4K8OA 1J6QA 1E2QA 1HNXQ 2R6AA 4WVFA 3K70C 4TLDA 5FPYA 1GIAA 3ULPA 1W44A 4B3ML 2IYXA 4QIWE 4P4SA 2Q3FA 4DV0L 3M85A 5G40A 4HYYA 4RCZA 3DM3A 4CEJB 3DPUA 3NBXX 1F2TB 2FFQA 1Y3AA 1MV5A 3WDNA 1KZ7B 1N5KA 3A4LA 1E99A 2AL7A 3VA7A 2C8VA 5IF9A 4D4JA 1I6HH 2MO0A 1BMFA 2ERXA 4L16A 4D0NA 2I3BA 4LF8L 1KO7A 1I6VC 2WKRA 4XWAA 2EWVA 1OXTA 2EQSA 2OM2A 5KSYA 1S1MA 1SVIA 3U3RA 4KLZA 5KPDA 2JLRA 3P1JA 3RRZA 1XP8A 3SYNA 1QHHA 1M74A 3A4MA 2R7FA 3C14C 1KZGB 1N33L 1F60A 3CF5A 1J5EQ 1YZQA 3EWAA 4ZDWA 1Y1VG 1E32A 3HPRA 1T8UA 1ZCBA 2F9MA 3PEUA 5IY0A 2JA9A 2VTKA 4A93H 3PITA 2P6RA 2WFWA 2QEXA 1KJWA 2K14A 4CEIA 1U94A 3G5UA 1CF4A 2VO1A 4KI0A 2J46A 5KDOA 2C95A 3H94A 3K7UC 4TMKA 2PQAA 3SYKA 2OLKA 1X9NA 4X8OA 4AURA 3GLFA 5H1SE 3LV8A 3KKPA 2QAJA 1E7ZA 4U5XA 5AJ3Q 3REFA 1NL3A 1UM8A 4V0MA 2C78A 3L0IB 2PMZE 2HLDA 2IL1A 2MSDB 3HP1A 4GPTA 2I0QA 4JBKA 2BE5D 4F92B 2JJ1D 3CPEA 4ZKEA 2ZRLA 4LFBL 1KY3A 5DHFA 4OQFA 3U5ZB 5KUTA 1G291 3T1OA 2BH2A 1W3SA 3CIOA 3NBYC 1W36C 2NTYC 4AQYL 4A1FA 1QHXA 3RLNA 2UVQA 4L9SA 1QHSA 1ZD8A 2HYDA 3H2YA 4LF6Q 1IXZA 2DFNA 1IJFA 1IOZA 3OE7A 1YNJC 4BEJA 5LD2B 1J99A 2GETA 1KHIA 2WKQA 4KN7C 5CM9C 2KBNA 3FMOB 4G5OA 3KJOA 1CSQA 1XNRL 4C2TA 4TZ6A 1L1OC 4JBJA 4P4SB 1SKQA 4LWCA 3M4QA 1Q3TA 3AF0A 1SVSA 4B76A 1Q7YC 1G8FA 4KITB 5C3EG 4P4TA 1VQNA 1B0UA 2EYQA 2NVXH 1EWRA 3RC8A 4EUNA 3CONA 3HKZG 4I1OA 2F6RA 1UBEA 1FYCA 3HOUG 1GHKA 1OKKD 121PA 1G3UA 1TF7A 4GOPA 3UG6A 5JSZA 1QHHB 5IP9G 1S3OA 4DAYB 2H5XA 3RS2A 3LVQE 2R7ZH 2Q0HA 2WAQE 1W49A 2ZS8A 4DV6Q 1IBLL 4Q19A 2ZJZA 4IVQA 4PHTA 4OO1I 1X1SA 2O5VA 4BBSH 1EX7A 3AP2A 3IILA 1PH1A 2EQBA 3FFBA 3LA6A 2YU9H 4TTPA 1CUKA 2E5LL 3A8JE 1Z6YA 2GNOA 2VP5A 3A1VA 4CEIB 1TXYA 3TQCA 1NJIC 1HH2P 4MRRA 3AVYA 1EWQA 3FHWA 1AS3A 3TK1A 1R2QA 3GLFB 2AR7A 4CW7A 3T53B 1Y69U 1A2KC 3IIKA 3MFYA 2C04A 2DFLA 4DR3L 2Q6TA 1P2VA 2B7BA 1MJCA 2UUCQ 1SXJE 2A5JA 5JMTA 3REGA 1BMFD 2BM0A 5EXSA 1VF5C 2D2CC 4NXNQ 2C99A 4BZPA 1GD7A 2HCJB 5J4YA 5JJIA 2WJJA 4LUOA 3QBTA 2JA8G 4X65L 4OHYA 3I1FA 2CLDX 3OESA 3CRRA 5JBQA 3N5CA 4TZ0A 3UDGA 4TL9A 3RS0A 4P73A 3KKMA 4DLWA 1AZTA 4DSNA 3SBDA 4QHSA 5IDVA 4BE7B 1A4RA 3DKPA 1ZC3A 4RFVA 1EIFA 5ELXA 1IBKQ 4ZIRA 2WWFA 2V1CC 1T3LA 3VKWA 2IT1A 3QOFA 3C15C 1B8AA 1N6NA 2ZSBA 3A37A 3AP1A 3AKCA 1G4UR 2W0SA 3QF7A 4WBSA 5E4FA 4XJXA 1Z6AA 3MXUA 5LB4A 1N6OA 1Z0JA 4YCWA 2H57A 3AV0B 1F6BA 4DCSA 1M1KC 3AVVA 2D74A 2OXCA 4JVSB 4QY7A 1IYUA 1R8QA 4GT1A 1OB5A 3PV0A 4ITRC 1PH9A 1WBDA 3PO2G 1EFRD 2X2FA 3SBEA 4AKHA 1KDTA 1SKYE 2HLDD 1IN7A 1ANKA 4FXPA 4QGAA 3TSWA 4BRWA 1I94Q 3TW4A 3M3YH 3AVUA 1Z07A 4DUYL 3FYHA 5FI0B 4DUZL 3WY9A 3AVXA 1O7IA 5B58C 3EIVA 3LVRE 2DR3A 4GOPB 4PTLA 4PPQA 3HU2A 1JR3E 4G3XA 4Z1MA 1VG1A 2VP0A 1E9FA 2ZYVX 4EX5A 5CDFA 3K80C 2X8AA 2QUZA 3PR1A 1HR0Q 4G5RA 5SZIA 3I5YA 1II0A 3E70C 2FSFA 1G16A 1JJCB 2RGXA 2R6FA 1DTSA 3IO3A 4UNNA 1LYLA 4FI3C 4B71A 4XVUA 2JLZA 3U7GA 4GKKQ 2OFXA 3OE7D 3I8SA 1LF5A 2ZI3A 2GTPA 4XD7D 4BECA 4JOIA 4TT3A 4DV7Q 2QI9C 3NH6A 4B3DA 4P74A 5J5CA 3SNHA 1NLZA 4JBXA 5A4JA 1VECA 4L9WA 1E0AA 3DVLA 1XMSA 4ZDIA 2R6DA 4MYTA 3CF0A 4KN4C 3QXHA 4CF7A 1I4LD 4A3GH 4B3MQ 4GLXA 1WE2A 4DV0Q 1JECA 2BOVA 3ZD6A 4C3JH 4A3LH 1VMAA 2G88A 2D62A 1U99A 1GVPA 1CJUC 2IUSA 5TV2A 3STBD 2CHGA 2NIPA 4A8JC 3U60B 3QJYA 2BEJA 2ZVQX 1Z22A 1QF9A 2ZI9A 5EE1A 4LF4Q 3MRSA 4IOAA 1J90A 2JLQA 4NPHA 4ZIRB 1LS6A 1EFHA 2JAQA 2VUMG 1G17A 2CWAA 3CCSA 2ZR7A 4DK1A 5FR1A 4IFDH 2ZRKA 3RWMB 5IHPA 3WBJA 4DCNA 3HOZG 2QG6A 3K0AA 3KF6A 4O25A 1FQJA 1PJRA 2A69D 4Q18A 2GEVA 4ERNA 4IFBA 4MUAA 2JLXA 3T15A 3OFNA 3RRNA 5JLJA 2PEYA 3F2DA 1KK2A 2IHEA 1JR3A 1ZNYA 1M2OB 1P2TA 2L15A 1OHHA 3QE0A 2BMFA 2XZOA 4HIKA 3W6NA 4HLDA 4IDQA 3AVWA 2CCKA 2DYKA 4W5JA 3OIUA 2UXCQ 3NELA 2A68D 2HEIA 4POAA 621PA 4NTZA 1W4AA 3WNCA 5HKKD 4G7OC 1X8JA 1JEDA 4PR0A 4DCUA 3UDFA 4AYXA 3IBYA 1S0UA 1TEXA 3CNOA 4NYJQ 4GS3A 4RCNA 4G5QA 2NPFA 1ZM2A 4LFBQ 3CCJA 3AVQA 1SXJB 3DL0A 2R9VA 5BW8A 3ZVLA 1E1TA 2G0NA 4DR4L 5TARA 3SOPA 4DEXA 2OFWA 4DLZA 1A0IA 1HZBA 1Z28A 4IDHA 2AXPA 2IYVA 5EP2A 3MWKA 1IM2A 4EPWA 1I5FA 4R4TA 3G82C 3H15A 2N46A 4DCTA 2JJ2D 2CL7X 2FFBA 2EFEB 1XNRQ 4A93G 3UATA 2V4DA 1ZU5A 1D8TA 1N34L 1GNQA 2JDIA 4LY6A 5JECA 2NN6H 4OBEA 3VNVA 3ND9A 1L4YA 1CBUA 1E2LA 2QTVB 4I1VA 2H17A 4R4QA 4PZ7A 5EXXA 3RC3A 3KXLA 1DXMA 1N0WA 4QG7A 5DYGA 4RG1A 1KK1A 5JI2E 5F3WB 1GKIA 1XZQA 1KRTA 1UWVA 4DR1Q 1MOZA 2G77B 1XJVA 3RVBA 3BWDD 1E9DA 1S2MA 5M5WH 4DIDA 2NZOA 4IXNA 4HIMA 1G7CA 4QGHA 2H7VA 5CB6A 4ACBA 1CJVC 1PV4A 1O7LA 3CCEA 3PO3G 2ASEA 2ZRPA 3WXMA 2OHFA 3SHFA 1SKYB 3VTKA 1JQJC 4MZ9A 1P61B 4NL4H 4DJTA 3FKIH 4X6AH 3K0AB 3U4QB 3KF6B 2VQFQ 1P73A 2BBOA 4KCGA 1TU3A 1IHUA 4A3EH 1HE1C 2UUAL 1E4VA 1XJ0A 3BB4A 5LD2C 4J0QA 2Z6VA 1KO1A 3KF8B 1VQAA 4HR7B 1XWIA 1YKSA 2E2IH 2E5LQ 2J9RA 4C7OA 1ZKOA 3IIMA 4TL6A 3BU2A 4A3CH 2R62A 2XSZA 2IC5A 3W3AA 3NEMA 1JB1A 1G7RA 1K5DA 3UKDA 3X1XA 4MRPA 1BH2A 3HOVG 2AWNA 3T1HL 4S2EA 2QQEA 3NE5B 1EESA 1M90C 2JA6G 2GA8A 3H1TA 4IFEA 4QJ5A 1QHYA 1XRJA 2FWRA 3AF4A 4AYBE 4NYMR 2K5UA 4FMCF 4HLQB 4M9SA 1W4RA 5C0XJ 5JJKA 2X77A 4WXRA 4TYPA 8OHMA 3UDXA 3JZMA 2BHRA 3GJ8A 3KOJA 4GN4B 3W5OA 4IO9A 4QM6A 3SZRA 1VQCA 2BMJA 3D8BA 3MD0A 2J0UA 4B44A 2FFHA 1I4TD 3K9LA 1TL7C 3SDZA 1XNJA 4RSGA 4Q9KA 4Q7JB 1R0XA 1WOCA 1DG3A 3Q7QA 4RKEA 5E7MA 4LSGA 4E07A 1BBWA 2IYWA 2QMHA 2V9PA 1K8MA 4D0LB 2B63H 2CWPA 3AQQA 1TPZA 1YU9A 2EIFA 1Y1WG 2FEOA 4NCJA 4A3BG 5GVRA 2O8BA 5G3ZA 4NBSA 1VCIA 2J45A 4K0KL 2ZT9C 4OWTB 2OCPA 2UKDA 4DKAC 4HAWA 1K8OA 5B57C 4FINA 1NLFA 4F4JA 4OWWB 4G0NA 1PH8A 1F2UA 3UE1A 4DUZQ 2WB1E 3FHOA 2ZETA 3RSOA 3SJAA 2QA5A 2QF7A 4A3MG 1D5CA 4Y52H 3L2PA 1ZBDA 2GJ8A 2ODWA 1MH1A 1Y63A 2YINC 5AJZA 1MRSA 2FMXA 3ADCA 1H8HA 4M2LA 3UWOA 3K8AA 1GSIA 1JJGA 2IEYA 4IKEA 5L3SA 1RRCA 3EPHA 2K33A 4R98A 2D0PA 1KC8C 2XTZA 1GKHA 1YIJA 1J8MF 4QL3A 4UNSA 4NONA 4C0LA 4IQZA 3I72A 3H0GH 2HHHQ 2RH5A 1M7HA 2JLWA 4C7OB 2GAOA 1X3FA 2PJZA 1ZUHA 2P5SA 3AVPA 2B7CA 2GKSA 1TEVA 3B1YA 3R9WA 3DMDA 4URUR 1G7TA 4Z54A 3KQLA 2KCTA 3BZKA 4KAXA 1C9KA 1JMCA 1E2IA 2GF9A 1FR3A 4R7ZA 4GKJL 2XGJA 3OEED 1JXMA 2IX3A 2QEQA 1GKUB 2ECKA 4DV5L 4G5SA 2AUJD 4JLNA 4M21A 2F3TA 2B92A 4PC7A 3ZH9B 1LM0A 4B6FA 1TTTA 1TADA 4V0LA 1NVVR 1SVKA 1U8YA 2W00A 2D4HA 4QBFA 2OWOA 2JA5H 4H13C 5DE3A 3J80i 4JL5A 3BGWA 3K70B 2AFIE 1S3GA 4P71A 4A3FH 4YDSA 4US0R 4O2DA 3Q5DA 3U2QA 3QIAA 1K6MA 3M1IA 2J0UB 2NGRA 4RD4A 1G5TA 3KFVA 3CMAA 1HNWL 4FMCB 1IW7C 3KLWA 4KHPL 3AB3A 5FPHA 3RS5A 1W48A 5C46F 2A1AA 1GL9B 3TRZA 1AIPA 2RF4A 4HEJA 1KNQA 2VPPA 2CHQA 4ON9A 3BG3A 3RNUA 4LHWA 4IDOA 4WZAE 5BR8L 4JVNA 4EPRA 5L8VA 2IS2A 2O8BB 1QZHA 2WIAA 4LV8B 4PC1A 5JJLA 1LABA 5A0FA 1C4OA 1L2TA 3I3SR 2OCEA 4Q4HA 4XTCS 2RMKA 2V54A 4UPAA 4FCWA 1X86B 5L3VA 2D7DA 2VY3A 1A62A 4GN3B 2R7DA 2NO0A 2O0JA 1G4AE 5BYKA 1F2UB 3FMCA 4A3GG 2B8WA 1WDTA 4TWZA 2HXSA 2WPDD 4DSTA 2IY5B 5EP4A 1H8EA 3PG5A 3TUJC 4BFUA 1B7YB 3F1ZA 4NB3A 3KQNA 2J0SA 2NMVA 5L3SB 1W5TA 2ZU6A 4JT2A 1VPLA 2EFCB 3HOYH 2PCFB 3W34A 2NO6A 4JLBA 1VQ8A 1HEIA 1XDBA 4AWXA 2ZUCA 4RY2A 1EFTA 2NO7A 1IN4A 2V1XA 1KDRA 3W8NA 2ZI6A 5KNDA 3B9PA 2PZFA 3SJBA 2CCGA 4A3KH 1GNRA 4DR4Q 1UJ2A 3J7A5 2PLRA 3LRPA 2XJ4A 4N0DA 1I3QH 5LMNW 4QBIA 5IRCD 2L0XA 2EFDB 5KSZA 2VA8A 1DGSA 1HQMC 4NHOA 4Q9HA 4WW0A 2GEUA 4DC9A 3C7KA 1ESNA 1B9NA 4Z51A 1OB2A 2KCMA 1YR6A 3E2IA 3QEOA 3H84A 3GEHA 4BFYA 2AK3A 2NO9A 3ZJYC 4R4CA 3K9NA 1NG9A 4AKGA 3FDIA 3KUCA 3PUWA 3TGPA 1A7JA 4BFTA 1N34Q 1W36B 4GNXA 3LH5A 4URVR 1Z06A 3VR3A 2OBNA 3S1NH 1MO6A 1XD8A 221PA 3F3YA 1Q44A 3KUDA 4QFMA 1I4DD 2AKAB 3UE0A 1L7VC 2IYRA 4XVRA 1BKDR 1WF3A 1YZTA 1NMFA 2KHIA 4QL5A 2CCZA 3EA0A 4OHZA 3RS7A 3ETLA 2C9CA 4C3IH 5AJ3L 1XJQA 4DLSA 1D9ZA 4QJ3A 1KO5A 5LMNL 4LYHA 1SXJC 5EZ6B 1TNDA 4DIEA 4JI4L 4IVPA 3GJ6A 1Y8NB 1UBCA 4B74A 2XJ9A 2CVFA 3H3VH 1GP2A 1KI1A 3W90A 3CAMA 1UKVY 1WFQA 2OZEA 1XTKA 5EXPA 4M4SA 2IUUA 4IJHA 1XD2A 1YNXA 3ADDA 1NVUQ 3A0JA 2YOGA 5LMUQ 1T8TA 2LSSA 2I5MX 3I56A 1G3RA 2JLYA 1VQ7A 1C1YA 2AKYA 4LBVA 3WMEA 2WAQG 3OEHA 3ZVRA 4D6PA 3RN5A 3VKHA 3X1YA 1E3MA 2ASBA 1DEKA 1NKTA 1EYGA 1C0AA 4LGMA 5FPSA 2AUKA 3CBQA 2GCPA 3K0EA 1MO3A 2F1JA 3T1HQ 2NN6G 1OH8A 4JVMA 4YMWA 1CRPA 1ZM9A 3PSIA 4PAOA 5CK4A 3ND8A 3VKGA 3RRYA 4F7WA 4DXAA 4FN5A 4ZKDA 2Z43A 4Q1EA 3BORA 2BMDA 2ZJ2A 1KKLA 5GVSA 2A5FA 4UJ3A 5IYCH 1JNYA 1KI6A 4XWOA 4GDFA 1Q57A 3QSYA 2ZJBA 1CIPA 4JI5L 5HGQA 2O5IC 1P7CA 3K09C 1TF2A 1KI3A 4URWR 3RHFA 2DGYA 3CZPA 3W9YA 3FKIG 5EZ5A 1E79D 5CLQA 3VR5A 3CRKC 4A3EG 1Q3HA 1S96A 4II7A 4A8JA 3KLRA 2K7VA 2A19A 4BXXG 3T61A 2CFMA 1YHNA 4IFDI 4GNXB 1D7QA 2EWWA 2WSMA 1ZAKA 3DZDA 4HB4A 4Q1DA 4OXPA 4A3CG 2F1RA 4D26A 2K5HA 5IP7G 1NJGA 4TVAB 4I1SA 4K0KQ 1H8ED 1GUSA 1W7AA 4A75A 2RGGA 4LJ9A 2KBFA 4ZI2A 2Q9BA 2CK3D 1ZNXA 4A4IA 1H9SA 5J40A 4G01B 3F8TA 1LB1B 4A0RA 3G6EA 3LX5A 3UK6A 2ZM5A 2R8RA 4NCKA 2LXKA 3EBEA 2UUCL 3S1AA 2R93H 4L15A 1YR7A 1YJWA 4YY3Q 3B1XA 4DR7L 5C2JB 2GAAA 2P6UA 3WNBA 3BDOA 1VYTA 4TTQA 2O8EA 3VDYA 3T56B 2BV3A 4MQBA 4OK6A 1ZD1A 5C4XG 2D2EA 2FF7A 4M8NE 1XD2B 2CNWD 4QGGA 3QG5A 3T5DA 1VQ6A 3KDSE 1XMIA 4KSBA 3OIVA 1E0KA 2JEOA 3NKVA 2HDNB 3H0KA 4CT4B 5A35A 1IBKL 4Q01A 4I81A 4IOMA 3E0EA 4BY1H 1KAOA 1RYHA 4DHEA 3VR6A 3HPQA 2B3GA 1KXLA 4UNPA 2JA1A 1MKYA 2FH5B 2V55B 1W0JA 3IGFA 3L43A 5DHAA 1PFSA 1P2SA 3SEAA 1IYVA 2B63G 4Q02A 4AYTA 2B8GA 2QM8A 3A8KE 2R6CA 4ZPXA 3TS2A 3AB9A 2I1QA 1LUZA 1W5SA 2KSQA 4PMWA 4JS0A 3B85A 4LPKA 1Q20A 2IF2A 3B82A 4Y0AA 3RYTC 4L5QA 3THYB 2G1KA 3K81C 3S14H 2KWIA 2G3YA 1IY1A 1IAQA 1KI6B 1HT1E 5DN6A 2BKEA 3M6AA 1DVRA 3KB1A 3LXXA 1BVSA 3HYTA 1BDOA 4TLCA 2OSBA 2QL6A 4BWYA 1KSFX 1R5BA 1XXHA 1GUNA 1E9RA 4G1UC 1FW6A 4UP9A 4OJQA 1E69A 4MRSA 1JPJA 1HNWQ 2ODEA 4KHPQ 2CL0X 2H5EA 2FN4A 5C1BA 4A8JB 3O8DA 3TREA 3CUEF 1HR0L 3A1TA 3RN2A 1P62B 1MJEA 4GZMA 3H0GG 1N36Q 4GSYA 5AUQA 5BR8Q 1RVDA 4BASA 4TSFA 3RS3A 4MGKR 1Z6GA 2P67A 2EFHB 3A1SA 1AN0A 1OXXK 2OUKA 2GEDA 4A76A 2QE7A 3NEYA 1CJKC 4DV7L 1DAGA 1OLOA 4D4LA 2PMKA 3VNUA 3CX7A 4IVRA 2IBMA 3SQWA 2GVDC 5K8TA 1H9SB 1YZGA 1BYIA 4ZI3A 5BN5A 1ZJ6A 3T35A 1R5OA 3T51B 4L5RC 2HT6A 3S1AB 3GTGH 3EARA 3CF6R 1LY1A 4OK3A 2NG1A 4MGYR 2WAYA 1E2GA 1R0ZA 3RNLA 3WMFA 3IPYA 2QTHA 5GAHC 3LBNA 4B2PA 2O8EB 3KTAA 1N32Q 5C44G 5M3MH 3RABA 4D0GA 1DO0A 2GK6A 2PNHA 1OIXA 4A3FG 2ANBA 3EC2A 2YKGA 1H65A 4KBGA 3RWOA 4UXHA 2MSCB 4CYMA 3AKDA 4QHTA 2E74C 4LF4L 1KSHA 3U3OA 4UKDA 2K5VA 2ZUBA 4OO1G 3CCRA 4B3GA 5D3MB 3BIFA 1TWGH 3PCRB 5LPNA 3ZLJA 3I4LA 4PHFA 1U90A 4LFAQ 5FOTA 1VQBA 3FHTA 4HAZA 3C16C 3JVVA 2VL6A 2JQOA 2BKUA 4IOJA 4NE2A 2QMEA 821PA 3UMSA 3S2HH 2R6GA 4NDZA 1CR2A 5BYJA 3SE0A 1U2RA 3B2EA 1R5NA 2GESA 5FI1B 1RKBA 1G9XA 5KPJA 3PUXA 4OGQC 2IXFA 1KK0A 1OYWA 4KJZA 2PI2E 4GN5A 4KLKA 5FJ8G 1TUIA 1E98A 2C5LA 2NO1A 2X19A 3V4RA 3WHKA 3AFPA 2N78A 2ZRMA 2L5TA 1XCPA 1XXHB 4AKIA 1CU1A 1JE5A 5LMNQ 5FLXc 2UXCL 2BDTA 3Q85A 3CRMA 4DK6C 2ZJQA 1N5IA 3NBHB 2WBLC 4JI4Q 4P31A 2E87A 4B3BA 2AFHE 3U4VA 3HOYG 2PL3A 5JHHB 1YZ6A 3CPFA 1G5PA 1GRQA 1TU2B 1P9WA 3MAAC 5GAEC 1X8LA 4KKUA 4LPSA 4JJKA 4QM7A 1XZPA 4L5SA 5E3HA 1Q46A 1VQDA 1XTSA 4A3KG 1HE8B 5JI3E 1EQRA 4Q21A 4DNIA 3HDTA 4C9BA 1RZ3A 1LTLA 2RGCA 5JZVA 2VF7A 2ZYUX 4PAMA 1FZQA 2PEZA 5GJBA 2CCJA 3E1SA 3HR8A 1CS4C 1ZCAA 4LOAA 4XH9B 2IYSA 4KYUA 1T5LA 2QBYA 1Z6XA 1ZD9A 4AC9A 2ZYTX 2QRZA 4M22A 2CLCX 1CKEA 4APVA 5DN6D 2ZXUA 2MFIA 1C9OA 4Y7NH 1PH5A 2IA5A 1UF9A 1IY0A 2G0TA 4X8LA 4AH6A 2EXDA 4M1WA 2JA7H 3FKQA 1YHBA 4P33A 3KTAB 2XOKA 4AIMA 3FE2A 2V6IA 3QPUA 3R8FA 4DR1L 1KAGA 2OESA 4B43A 3SJCA 3EXAA 4AYBG 1YVCA 3W8RA 4JI5Q 4HB2A 2JCSA 4LDJA 3OPOA 2WKPA 1AE3A 3LLUA 5C4JH 2Z83A 4OKSA 2VQFL 5M5XH 3CF2A 2GJAA 4A2QA 1OE0A 3FWYA 5F9HA 3M4YA 2VP9A 3CQZH 4KKSA 3GLGE 2O8FA 1JJ7A 2XTIA 5DLQE 4V0NA 4UP8A 3K8YA 4F38A 1H9JA 2A5GA 1VYVA 3KXIA 3QF4A 3Q8DA 2I1VB 1CXZA 1I50H 5A5GA 1ZM7A 5K36H 3KFXA 2VIIA 5E7NA 5B64A 5KHOC 5G41A 5J3BA 1K9MC 2GJSA 2E1RA 3KKQA 5E95A 2BA1A 2QZ4A 3B1WA 1CKOA 2IS1A 1VIAA 4FDBA 3UDIA 4NYIR 1XX6A 2QPTA 3NBZC 1HZAA 4HSEA 1T3HA 2NVQH 4DR7Q 4BQSA 1K8RA 2Z4RA 1VIYA 2W6IA 1YEZA 1A2BA 1Z0DA 3O8BA 3ER0A 5JS8A 1G8HA 2WWGA 2WB1G 2IHYA 4M1SA 4BEBA 4BY7H 5AUOB 3LLMA 4A0HA 1UBGA 1G8YA 1VQ5A 2MO1A 1IZ6A 1EQQA 3HOXH 1EFUA 4HB3A 1N9WA 1N6RA 4ZCIA 3VFDA 4BFWA 4GNXC 2V7QA 3HU3A 5TXGA 3ONWA 3ICQB 5DI3B 5TB5A 1K0RA 2RGDA 2Z0MA 1WRBA 2FX3A 2EFGA 2ZRFA 3G71A 3VMFA 5FPTA 2GXAA 4KFUA 2QBYB 5IYBH 4HAXA 5BN3A 1ZW6A 2QGNA 1TWAH 4Q48A 2GN5A 4Y0VA 3M4OH 3KL4A 2F4VQ 2DNEA 3BH0A 3NH9A 2IYUA 1Q1EA 3CPJB 4QJ4A 1VQIA 1U0JA 3CRW1 5HE9A 4KLNA 1PLKA 3I55A 5IYDH 1VG9B 3K9GA 4P0TA 5H8WA 1MO5A 2IYYA 1YVDA 3ZJYA 4B3CA 3UANA 4DV3L 2FEMA 1SR3A 1Z3IX 3OAAA 2DPXA 3KZ1E 5EE3A 1EFWA 1Q86C 1FJGL 2R93G 1PZNA 1U9IC 1R4AA 2WWIA 1E9AA 5DO9A 3OTOQ 3GLGA 3AVTA 3K7AH 3GJ0A 2REXB 4A3JH 2X1VA 2NVYH 3AQ4A 2AD1A 3PXGA 3DEFA 3TSOA 3N6RA 2W58A 2OQKA 4YCVA 1RE0A 4KO8A 1ZMXA 2QORA 4PPFA 1U0HC 4RZ3A 3B78A 1OFUX 4TMTA 1PVOA 2JGNA 4O2RA 4Q9LA 3U9SA 4DR2Q 4P4UA 1RPZA 1U5KA 2O8FB 2HHHL 1M8PA 3SFZA 1SXJA 3H3VI 3LQQA 1G7SA 4HZIA 4BY1G 5L3RA 1DD2A 2RHSB 1K5GA 3KJHA 3QF4B 2CL6X 1EXMA 4D4MA 4E5UA 3T1TA 2D3WA 1G6PA 4TLEA 3KKOA 2HUPA 1HT2E 2CE7A 1GUOA 2XOKD 3AM1A 4CT5A 4R9UC 4LK1C 1G1MA 2GILA 3L82B 2ZSAA 4RD3A 1SMYC 1OPXA 3CD6A 3GPLA 4B47A 4JKYA 4GP6A 5HE8A 2HQLA 1L0WA 2FOLA 2W2TA 1UDWA 2QP3A 2Z4SA 3AKYA 4A6PA 3AEZA 4B2IA 1VG8A 1NBME 3EZ6A 2EDGA 2WAXA 1ETUA 2H16A 5M04A 4LUVA 3KJGA 1M1YE 4C0QC 5CYOA 3ZZ0A 1G6HA 1WCV1 5KU1A 1YR9A 5FFMA 5J4LA 2VHCA 4MYCA 2WWHA 4Q66C 4A4DA 3GFPA 3QXCA 4BBRH 5FBLB 4QC2A 2ZU0C 1XEFA 1H9MA 2NQ2C 3KJIA 4JZKA 4US2R 2QP9X 3U4QA 1IW7D 4RZXA 5FLMH 2PLFA 2ZSEA 1E6CA 4LUCA 2JLVA 2BCJQ 2GJ9A 3A1WA 4Q9JA 3I4OA 5HCNA 3U7EB 2BDOA 1E22A 1JB7A 2C9OA 2AN9A 3PGZA 4US1R 1K83H 4NYJR 2LXJA 2VH5R 4TMZA 3K09A 5J47A 3EZ2A 3PUZA 1NVXQ 2WWYA 3KQUA 1XF9A 3KKNA 3BFKA 1U8AA 2J1LA 2ODNA 4DNTB 4K46A 5TVKA 3ECCA 1KRSA 4AG5A 4BLPA 4OL0A 4PO8A 1VQOA 2ZRDA 4MA4A 3GLGB 4B3SL 2RB4A 5HKKA 3GLHE 4BA1I 2B8FA 5DNYB 3I61A 2OO7A 2RAPA 4HJAA 3CCQA 4JI2L 1IN8A 1G21E 1XJCA 2RHMA 2GK7A 2GWHA 4GFDA 4N0EA 2KJQA 1CULC 3GTJH 3HU1A 2YOFA 5CYPA 3BB1A 3T06B 3VR1A 5C18A 2YWHA 3F2BA 1JJ2A 2REOA 3A36A 4R4IA 1DOAA 4HDOB 4URYR 4C0SA 4NZYA 4C0HA 2JEBI 3UMRA 3IHLA 2JXMB 2WSSA 4H44C 1DG1G 1L4UA 2N1BA 1TWFH 4W7SA 2AHOA 2C2HA 1NBMA 3E5HA 4EPXA 2CKZB 2FA9A 3S16H 5KSPA 2BA0A 1Z6HA 1S4QA 3BJIC 3LD9A 2UU9Q 2IYZA 2RHDA 2WMOB 3J81k 3OAAD 2QROA 3KJEA 3R7WB 1KD1C 1G8GA 1OFIA 2BE5C 2IX0A 3K9HA 1O78A 3N70A 3R20A 4HLCA 5CLLA 3LW8A 4HUQB 4A0GA 4URXR 1HNZQ 4O2LA 4Z1MD 4R2IA 3LBHA 2YOHA 5FOXA 2V6JA 1VS0A 3HOWH 2UXDQ 3BBPA 2FPMA 3MGCA 2BMEA 1NY4A 2WJIA 1FNNA 1W0KA 4B3RQ 2YZ2A 3A1UA 1SXJD 4HATA 1II9A 1CSPA 1NY6A 2IWRA 5JS7A 2B21A 2A6HD 1DS6A 1XCMA 1LV7A 4OONA 1AM4D 4TT3D 3CX8A 1EIYB 1Z9FA 1E2JA 4I1UA 1OTCA 3K0SA 1FL9A 1AJEA 3S2DH 1ZVQA 2E2HH 1Z83A 3J80c 2A3RA 2HXYA 1UEBA 4HLUC 5K8IA 2YTVA 3L8YA 4PXAA 5HZHA 2HYIC 2J0VA 5LMUL 3RZDH 3MCAA 4R2HA 3HKSA 1P2UA 4GMDA 3WRYC 2AK2A 2BBSA 2YWFA 1QVAA 3NWJA 4L5BA 5CJPA 2QTFA 3ZDQA 2ZR9A 1CRQA 3WHLA 3P20A 3WP1B 4IPCA 1XMQQ 3MMPA 4YMTA 4H9GA 1R6BX 4JI3Q 2HF9A 2ZS7A 1VHTA 1IQPA 1HH4A 4L4UA 3TVTA 3U3KA 2OV2A 1R7RA 2DY1A 1S72A 2GDJA 4JG2A 5FUYA 3QVVA 1A63A 5FBVB 4DK0A 2FJUA 3FFAA 5HPYB 3PENA 2AHOB 3OFND 1EUJA 1QZGA 4EQ5A 3PIOA 4JLKA 2R7ZG 1NIPA 1WQ1R 1T9HA 3GFOA 4JC0A 1JR3D 3QNUA 4PSVA 3B5JA 4BBSG 4CZ2A 1OHHD 2GZDA 3DM9B 1ASYA 3M0EA 1KO4A 4DVGA 2E76C 2WZQA 3GDEA 1KYIA 4IPDA 4MKGA 5HY6A 1XTRA 4IEEA 3C5CA 4OQNA 2ZJPA 1GKYA 1CKMA 3CCUA 2G6BA 1A82A 3OIWA 1TQ4A 1AH9A 3CXCA 1T91A 3TRFA 3WMGA 1AS0A 4OX9Q 4DV3Q 3I4MH 4UXIA 4MTNA 4DR6Q 2EJGC 2A2ZA 4IFDJ 2F1MA 4PZ8A 4POGA 1FJGQ 1XEXA 2Q3MA 3LGJA 1DE0A 3DOFA 3CP0A 5IE8A 4C0JA 1OT3A 1P5ZB 4HI0E 4YWKA 2CXXA 2JJQA 2VP6A 4YY3L 3OHMA 5FBWB 521PA 2CHVA 1LS1A 3TE6A 5UKDA 3TUIC 2UZIR 2XNSA 1R0YA 4CEHB 2ID0A 2Q2IA 1X56A 4JLVA 1XNQQ 2O5JC 4HAUA 5DIFA 1OV4A 1PMRA 2YVUA 3CC7A 1J8YF 2QMUA 4MKIA 3B1ZA 2JDID 1RIFA 4AKEA 2BCGY 3FHCB 5AJVB 5KO2A 3QI2A 1V5WA 1QG4A 4YCUA 4PQFA 1WA5A 4YLGA 2NVTH 3W6PA 4MYUA 2QSZA 1FPMA 2BM1A 3OF5A 1X6OA 2IXEA 2ZRJA 3FMIA 4O0MA 1HA3A 3RLFA 2PH1A 2WJVA 3B8HA 3BRWD 3MSXA 4MUBA 4URZR 5AJXA 1E2ZA 1WYDA 1ZINA 4RD6A 1TU4A 4B35A 2ZJYA 4NXMQ 1UE1A 2Q9AA 1XTIA 4YQFA 1COWA 4PZ6A 4ZCMA 3NVAA 2Q2TA 1UPTA 2LMCB 2MMGA 4TL7A 3TAUA 4E09A 4QNMA 4UP7A 1KIMA 4TMWA 4EJSA 2VQSA 4R71A 3A74A 3MJRA 4YMSA 4F93B 2UZ3A 4OQMA 5BN4A 3BH6A 3THWB 2VBCA 3ASZA 2DNCA 2KENA 3D6TB 3W3ZB 2HT1A 2XITA 1RFLA 2XSZD 4TMVA 4POFA 3PEVA 4O3MA 2FSGA 1N36L 4LF9Q 1RRPA 2BJVA 1IONA 1E2KA 1YR8A 2DFTA 2YNMA 3ZS9A 1SVOA 2BH8A 2VW9A 4A2PA 1G3MA 3STBC 2IF0A 1Z8FA 2F9LA 3L2OB 1ZC4A 3CZQA 5FUVA 1R8SA 4BA2I 1M7BA 4XWKA 1EG7A 4OHVA 4E22A 4BGDA 1HUQA 2ZM6L 2OFOA 1XPUA 3PF5A 1G64A 1R10A 1BKBA 1TWCH 4ZCLA 4IEIA 2VNUD 1XEXB 3EN2A 1GFIA 2KCCA 1EWIA 5AWFC 2PZEA 2ZTCA 3I5XA 2ZTDA 2CLSA 2QAGC 3CWZA 4B3SQ 1D2EA 2WICA 1RYFA 4TQ9A 2C96A 4K81B 2A69C 3K70D 3GD7A 1X54A 4A3LG 1T3SA 2DWOA 4IJMA 4YWMA 4JI2Q 1YITA 2A78A 2GBLC 2FSIA 2OCBA 4BZXA 3P4YA 3TQYA 2UUBL 1LW7A 1N32L 2E9SA 2GF0A 1NVVQ 1Z0IA 2QNRA 4L8GA 3SFVA 1QHIA 3CWQA 3OZXA 4NU0A 4ZV4A 4JYCA 4QHYA 3A58B 4NCHA 1Z08A 2YC4C 3CLVA 4LRWA 3SJZA 4CVNA 4W9MC 1GNPA 2FDCA 4IFDG 1VDZA 4HDQB 1IBMQ 2VEDA 2QPOA 5AJYA 3X2SA 2F52A 2A68C 4LFAL 3WBKA 5KTYA 1SFOH 4JLJA 4G7HC 1QG2A 3CW2C 1DO2A 2BVNA 2CVHA 4L5TA 1OSNA 3Q3JB 4RFSB 2DUDA 4LV6A 3DMNA 1FX0A 2NZJA 3TNFA 3ZVNA 2GVZC 1K3RA 2IXGA 2A7QA 5DLQC 4BLRA 1IN6A 4RMFA 2MMCA 1KAWA 1YJNA 2R65A 2ZS9A 3P26A 4V0KA 3VU9B 4MKFA 2ZI4A 3RANA 2O8CA 1CTQA 1ZM4A 1H8HD 3WWVA 1Q12A 1X6VA 2ZSFA 4FD2A 4PZYA 4YC7A 4EJSB 2W2VA 2AD5A 3QVUA 3A7AB 4LF7Q 5AJWA 3VX4A 1Y8OB 1WBBA 1FMLA 4JMPA 1HZ9A 2WVJA 1CTMA 1NMYA 1UFQA 1NSTA 3GJ3A 1BIFA 1FMJA 1RJ9A 1U81A 4NCIA 4PQYA 5IT5A 3EPKA 2K32A 4LW1A 3W1GA 1N6KA 4DRZA 2A5DA 1IXSB 4KMUC 4QJFA 4ASUA 3BD9A 4C3ZA 1FQKA 1OFTA 2ANCA 3C41J 2ZITA 3RR5A 1CFMA 4C3HH 3CCLA 3GJ7A 1DAKA 1VHLA 3CO5A 3P27A 4LX0A 4XSHA 5JRZA 1NNEA 1U9IA 1VKJA 5FUXA 2AXNA 3CRVA 4B75A 5J4HA 1PA6A 2Z5FA 5B30A 5C3EH 2I4IA 4P72A 1E94E 1JI0A 1P3JA 5G53C 4LHVA 2ZE5A 3SU8A 1W36D 2K50A 3IPXA 4MDFA 1OJLA 1D9XA 3U50C 4DWJA 4DK3C 3T1QA 1AA9A 4AI6A 3A5ZB 1NN0A 1ZUIA 3HOUH 4TL8A 4KHZA 1AE2A 2EW1A 4F4CA 3W1BA 2GVBA 1M6NA 3EX7C 4IHQA 1EX6A 5FPKA 2IHBA 1WCMH 3M4PA 3BFVA 1NMZA 5IP9H 2P2LA 4DLTA 1YBYA 2F3IA 1YZNA 2NZ8A 4TYNA 5KNCA 3SQXA 2Q9CA 1Q1QA 2MSEB 2R92H 4ESVA 1TF5A 4NPSA 2IK8A 5FR2A 4A6XA 2IEZA 2LKCA 2O52A 3Q72A 2OTLA 2QGQA 2JASA 2NPIA 3M7NA 3AGQA 3BK7A 3CM0A 2J3EA 3F5FA 1XEWY 4DEYA 5GADC 3IBGA 3S1QH 2H18A 1IN5A 4MGZR 5SZHB 2ZE8A 1ONBA 5KNBA 4LJAA 1VCNA 1S9DA 2QENA 4W5WA 4EIWA 4JK1C 4LJ5A 1SN8A 4AY2A 1FX0B 1TQ2A 1OW3B 5TMPA 2AKWB 1Q81C 4MYHA 3WP0A 3FTQA 3VQTA 1WP9A 2F7SA 3VR2A 3RLOA 2YWGA 2O8CB 1W2HA 3CCVA 1WMSA 3JAMc 4EQ6A 3TBKA 3AKEA 4GLAC 4HUTA 3PQCA 3RRMA 2ZRCA 1EOVA 2ONKA 3BE4A 2HJVA 2Q2UA 1E1RA 2ZROA 4IDPA 3THWA 3A4NA 2A6EC 4DSOA 1RJ9B 4QKQA 2YTYA 4EFNA 4GOJA 4Q1FA 2B29A 2PJRA 1GAJA 1WJJA 3H4MA 2K5NA 2BBWA 3EZFA 4EKDA 3QG1A 2E2JH 3CPHA 5H68A 1QZXA 1GL6A 4DLRA 1JT8A 2CE2X 5G3YA 4ZO4A 1JAHA 3KXKA 4C0AC 1NKSA 2H8KA 3MWLA 2WWXA 4PSAA 4BRUA 3AP3A 5D3MA 5EE0A 5AR1A 3PEYA 3K0CC 2VZAA 2F55A 4X62Q 4OI1A 4GL2A 2GVAA 4LJ8A 3CB4A 4C2MH 4U7DA 2RGNC 2F4VL 2IS4A 5DH9A 1QRAA 4G5GA 1N6IA 2JIZA 3AF3A 1NLYA 2IYLD 2JJ8A 4LC1A 3FVQA 3DDCA 2V1UA 1E9EA 5IWAL 1D2NA 4FCVA 5K8LA 1PUIA 3LFUA 2R44A 3QQ5A 4UNQA 4YHHL 3I4MG 2BC9A 1Y8PB 3D0FA 1NG1A 4YDHB 1C7YA 3HGBA 1NMXA 1TQDA 1UBFA 2GCOA 1NMGA 2C77A 1KMQA 3RSLA 3OTOL 4HLUA 2JJ1A 4QGFA 3ZS8A 3ZZTA 1KY2A 2J87A 2ZTEA 1XD9A 2DWPA 3NENA 2D06A 2WOJA 4ZDKA 4C2UA 2EJMA 2P3SA 3OEHD 5FOWA 2FPKA 3SR0A 4ACAA 5KYKA 4C30A 4DR2L 4PSKA 1D8LA 1Z47A 2BBTA 2OBMA 2ZE7A 2ZI5A 2CW0C 4DAMA 4DB4A 5ELOA 1A5TA 3N2EA 1SVMA 4LHZA 2OCYC 3PJRA 2KE5A 4U02A 2ZM6Q 4JBWA 2ORWA 4B48A 5HR5A 1Q82C 2HIXA 3WYGA 2ZJRA 3CNLA 3CMEA 3LAWA 4Q7LA 4QXAA 3QEJA 421PA 5JWOA 1SRUA 4BPBA 5CIQA 3I62A 2VUMH 4AK9A 2XB2A 3CPWA 1F5NA 2Q3HA 1BS1A 1T4GA 4HJ9A 2RGBA 3I32A 1B70B 4JI6L 4LF5L 3IO5A 1Q0UA 4PZLA 5KDDA 2CBZA 1JAIA 2JA5G 1CP2A 1FTSA 2OT3B 2UUBQ 1OKKA 2F43A 1NTGA 2OILA 2O0HA 4M9QA 4Q9IA 1HQCA 4N3NA 3TEHB 1KHTA 1ZYUA 3L7ZC 3UWKA 3MJHA 1J2JA 4WXPA 2KI5A 1X8KA 4B3XA 3GJ4A 3U7HB 5FBRB 4GZYC 1GJXA 4OI0A 1IYJB 4JI0Q 2V8OA 2ZQ5A 3TIFA 1QJOA 2ZRIA 1OXUA 4M1KA 3JAMi 3OIYA 3QENA 4LBZA 4NKRA 3DZ8A 1PH3A 2F3RA 1SULA 5FUWA 3WNDA 2QM7A 2GZHA 4JI1L 1SVWA 1KSJA 5D3QA 4A2WA 4KYIB 2W6JA 1EWHA 3BZCA 1HURA 2F1IA 1F48A 3NEJA 2VRWA 2EVWX 4KFTA 1YI2A 1E1RD 3I4NH 1E2HA 4MRVA 3OW7A 4YWLA 1N6PA 1XMOL 2PX3A 1ZM3A 3TR0A 5FTJA 2KHJA 2TMKA 5F9FA 2GCOB 3U4ZA 1FGUA 1DAFA 3IEUA 3MG9A 3I92A 2OE2A 1E2NA 1LACA 1HJPA 1NN3A 4JBYA 3W6OA 1US8A 1G19A 2J59A 4A3IH 4Q4JB 5C4GB 2P5TB 1ONLA 3JC66 1KI4A 1OXSC 1XU4A 2XEXA 4M1OA 4TQUS 1ZUNB 2I5HA 4HB0A 5HCIA 1OH5A 3SHWA 3SGIA 4B73A 3BJUA 2QMOA 2MQHA 2IX1A 1AKEA 1G3QA 3GTMH 1JXOA 4LWZA 3X1WA 3HJNA 1UDXA 2PT7A 3DOEA 4M9ZA 1W0JD 5KDLA 4PZZA 4UY8C 4ARZA 3E9HA 1K8AC 3ZVMA 3ZGXA 3D4RA 5DI3A 2JIZD 3C8UA 3AF1A 3LDAA 5EE9A 4EPVA 1VQLA 2Y8EA 4RCYA 5F2EA 5K8UA 3TSZA 3ULLA 2A30A 2PZGA 3PFIA 1EFRA 3D3QA 1I2DA 2YTXA 3EWSA 3JZAA 3QUSA 4EJSC 4PANA 4RZUA 1GUGA 2UU9L 3PO3H 4JL8A 4TQAA 2J0QA 1E1OA 1A6XA 3TH5A 4DV1L 3CRQA 1N25A 4DB2A 1DAHA 4LK2A 4U00A 1SZPA 3I8XA 3A7LA 2MNAA 3K1JA 4QBGB 1X3SA 5FTMA 2F43B 1E2MA 2PCJA 2VHUA 1HNZL 3IQXA 4DLYA 2ZRBA 1CJTC 1ZYRC 1E2PA 2ZUDA 4LBWA 2UXBL 1NN1A 1YRBA 3IDQA 5EUMA 3U7FB 5FL7A 2UXDL 3CC4A 3UPUA 4TLBA 1PH7A 5LBIA 4M53A 3TKLA 4Q1BA 3FOZA 4B3RL 1S9HA 4TSFD 5DGXA 1ZIPA 3AYHB 4A82A 4OQXA 2FZLA 2QE7D 4B34A 4BLQA 4XD7A 2FXQA 4JVLA 1RW4A 1Q8KA 2PI2A 3U58A 4DLXA 3HOVH 1UADA 1S8FA 1DELA 4LZZA 2Y0SE 1GTVA 3R8CA 3T1VA 1R0WA 1GO3E 2A8VA 2JA6H 4B6EA 1FTNA 4DV4Q 4DR5L 5AK0A 2KB0A 1SROA 1W4BA 4L8JA 2K75A 1AS2A 1CLUA 5JCPA 1VQFA 1XTDA 1E0SA 1T5IA 3GQBA 1XPRA 4IPHA 3J81j 1SLJA 3UXMA 4HIOA 1VQPA 4F4IA 4JI7Q 1LF0A 4PO9A 1OH6A 5JWRA 2ATWA 4D4KA 3AH8A 4A9AA 4N1AA 4NCNA 3GTPH 1US8B 3UIEA 3DO6A 3B6EA 1GZSA 1O3YA 1WCMG 2Q21A 1XMQL 1GDDA 2ZTSA 4JL6A 2IWHA 4CRWB 5TDHA 5EJEA 3GJXC 2R92G 3IEVA 4JI3L 5IYCG 2BJWA 4EAQA 4HIDA 1K8GA 1QDEA 2G9NA 4EPTA 3I7FA 5LDDC 2QAGA 4H1VA 1Y1WH 4BFZA 4ARZB 4A3BH 5CDFE 3ZQJA 1TUEA 3S17H 1HTPA 2PQAB 3BERA 4C0KA 4GZLA 2W6JD 1N6HA 1A1VA 3LNNA 4JV5Q 2GBLA 1SQ5A 2GXUA 2LKDA 2QRNA 4GI7A 5FTLA 4Q4LA 3DKVA 5L3QA 1T5EA 2D5DA 2JE6I 1NSFA 4HJ7A 3RZOH 1LVGA 4A3MH 1ASZA 1DAIA 4P75A 1KQSA 4HJ5A 5JEEA 3IKJA 4PO1A 1MO4A 2JEAI 1GOTA 1NY5A 4RD0A 3L0OA 4QOSA 4OYHA 5IWAQ 4IJLA 1Z29A 3R9IA 4AIIA 1VQKA 4JLMA 2XGTA 4PQRA 4YHHQ 4WA7A 3IUYA 2J41A 3CW2A 4DKXA 4OX9L 1L8QA 1NRJB 4EPYA 1YJ5A 4DR6L 1MR3F 4ESHA 1MABA 1W2GA 1X1RA 4JT4A 5H1YA 4FMDF 4D2IA 4Q7MB 3GTKH 3EG5A 4LCBA 4IOKA 1N8RC 4EQ6B 4NYIQ 4MDEA 3R9XA 3QY0A 4MNOA 1TWHH 1UKYA 4KFSA 3RDPA 3SC3A 1V1QA 3GEIA 4DV2Q 1XNQL 2GCNA 1NP6A 4GOKA 4DT1A 5BWMA 2DBYA 3TQFA 2JJ2A 1KDPA 5DISB 4TYQA 3CRLC 1DAMA 1JQLB 1NN5A 2XTMA 3DM5A 3O47A 3SN6A 3VX3A 2ALYB 3PVSA 4LJZC 4D82A 1J70A 5BXQC 5JCZA 1GUAA 3TUZC 3P32A 3DHWC 4UJ5A 4FWTA 2F1HA 4M0LA 3ZD7A 5JSZB 1E2WA 2E8GA 5GQOA 3U3JA 3IIJA 3QKSA 2ERYA 1S40A 2CEAA 3FMFA 4LF5Q 4JI6Q 1FOEB 3NC0C 5FL7D 3R7WA 3TJZA 2OTJA 2VSFA 3A6PC 3MWYW 5EAYA 2JATA 1CEEA 1CKNA 4NXML 4HUQA 3MXNB 4X64L 5C0XH 2OAP1 5ELNA 1KJZA 4OI2A 2QAGB 4WAUA 2DN8A 3KFUA 2CQOA 1AQUA 1FFHA 3H86A 1YZUA 1XTJA 3EQLC 4JIMA 1AK2A 1P72A 2ZI7A 3C5HA 1H95A 3QKTA 3ADBA 1OXVA 1JPNA 2CMKA 3J81c 3OW2A 1P9RA 5L3QB 3IHWA 4Q1AA 5TY0A 2OBLA 2FGJA 4GBMA 4Q4AA 3PUYA 1P8LA 1M7GA 4TYYA 2K4KA 4WZ6A 4JI1Q 4LYFA 4LF9L 721PA 2EYUA 2GZAA 1Z2CA 1IXRC 4FWIB 1TKWB 1P9NA 4YMUA 3LWUA 1ZRHA 2OAQ1 3LBIA 1Q22A 4Q47A 1XMOQ 2NOAA 1AQYA 3FGNA 2WTUA 5J4KA 4LF8Q 3T1YL 2VHQA 4Q00A 2XZLA 2W6ID 3AUYA 3ERSX 2ZRGA 2ATVA 4DZZA 1MABB 2RHQB 5LB2A 3EW9A 1SE8A 4A0FA 4GNKA 4H1UA 1N33Q 1E9BA 3OYYA 2V7QD 1Z0FA 3CC2A 2FGKA 3AEVA 2VLIA 5M3MG 1GHJA 4TLAA 3T5GA 2XX3A 1KKMA 4B2LA 4M9XA 3TVDA 1W47A 4LJ4A 3B13B 4PC6A 4TTRA 4H02A 4DT1B 2OLJA 1SVLA 4FMDB 4JI8L 3GEEA 2I5LX 1YHAA 2K52A 4R1JA 5M3FH 4D80A 3WRXC 2GHIA 4A36A 1Z2AA 3CCMA 2G83A 4JJZA 4JKIA 3FP9A 5GAGC 1IBML 2LWIA 1AZSC 3VHXA 5FH9A 3S15H 2V3CC 4LYJA 1QHNA 1FP6A 5DSZA 1TAGA 1UAAA 2OCAA 2WWWA 3QXSA 3T34A 5IK2A 1BYUA 3QKSB 2Z0SA 2D0OA 4HJ8A 2XAUA 3BOSA 4DV1Q 1N5JA 3I4NG 4LHXA 1N2CE 3B6YA 1SMXA 3I2ZA 4PG3A 1NF3A 1VG0B 1CKNB 2J7KA 2ZE6A 3ASYA 3B60A 1MRNA 3L8ZA 2WV9A 1QVRA 3NDPA 3THYA 4X8MA 3K0CA 3V4FA 6Q21A 3PEWA 3FPPA 4TMXA 4ME3A 3U61B 2UXBQ 2RGNA 1T6NA 4AQYQ 4LF7L 2OXRA 2YWEA 3TMKA 3KJPA 4LI0A 1O87A 5GROA 4A3IG 4OQLA 4Q1CA 4B3TL 2DFKB 2QSYA 3TR5A 5J4VA 2Q2HA 4A15A 2ZANA 3NXSA 4BLTA 1ZNWA 2VHTA 2N3SA 1RRFA 4MH0R 2O8DA 3S24A 1FUUA 3B7GA 4Q4AB 3GP8A 4CGZA 3VR4A 3W5IA 3F0TA 1VQMA 4QQBX 1U0LA 4A3DH 4DLUA 4CEHA 1CR0A 3AUXA 3NHAA 5HTKA 3EPLA 2J7PA 3N2IA 3X1ZA 2XXAA 2RKOA 4DR5Q 4WOPA 4PAQA 3WYFA 5H70A 3SYLA 3OEEA 2VF8A 3Q5EA 1F3OA 3GLHA 4V03A 1G6OA 3CH5A 4Q7KA 4LHYA 2N42A 3K0FA 4IRUB 3FB4A 4BZQA 1B9MA 1G51A 4TN1A 5KSOA 2ONJA 2CDNA 3LWNA 1GRNA 4JBMA 3I73A 3BFXA 1UEJA 2JA7G 3J81i 2JLUA 4GOXA 3TZUA 1GM5A 1KO8A 3VAAA 1P16A 1IBLQ 2ZRHA 4MITA 3AGPA 4JLOA 4MKHA 1HZCA 3ZQ6A 3GLIE 1MIUA 4G7ZC 2Z6KC 1VCOA 4BXXH 1ZIOA 2VL7A 2ZJ8A 1DPFA 3JVUA 3LNCA 4KBFA 5HZKA 3O8RA 1G8PA 2HV8A 1S3SA 4DNRB 4JYAL 1KGDA 2DCUA 5FTNA 2IHFA 2ZREA 2KA7A 1Z63A 1W4CA 5IP7H 1R9TH 3CX6A 4M1TA 4YXWA 2ODBA 4LFCL 2FV8A 3HFZB 4XVQA 3BH7A 4DR3Q 1ODFA 5FOUA 1KSGA 2EU8A 1Z0AA 4JLPA 2YC2C 3EA5A 1Q1ZA 3HKZE 1L2FA 2NZHA 4IDNA 3X1DA 1UKEA 1KOFA 1IJEA 1YRAA 1NI3A 4PC2A 1PH6A 2P6NA 3T12A 2YHSA 3BC1A 1V43A 1XEWX 3FKSA 2H1LA 4X8HA 1VQ4A 3C4JA 4DCVA 3THXA 4HDCA 2ZPTX 4X65Q 2N8NA 5IT9c 1W2BA 1JJVA 2KBEA 2WPDA 3AVOA 3SI7A 4ABYA 3HR7A 4V02A 2BEKA 5K36G 5C4XH 1II8A 3GCGA 3QPVA 1BOFA 1VQ9A 1EK0A 4JLDA 3WYAA 4DDUA 4H0LC 1GILA 1DCZA 2HCBA 5CK5A 1IBRA 1Q21A 5E7IA 3U44A 1RC8A 3BS4A 4R4OA 2YJTD 3LW7A 4IW3B 1EFCA 3PCOB 4GP7A 1VQHA 4BLSA 4X66L 4ILEA 2VS1A 1U98A 1WB9A 2O8DB 2A6ED 5C4MA 2W2XA 1YHQA 2XB4A 5JRJA 2ORVA 1W46A 1YZLA 3B1VA 2WSSD 4B33A 4BY7G 3QXXA 1B23P 1PH2A 4BLOA 4NYMQ 1LNZA 3HOXG 1NBMD 2PCLA 2XXAB 3U6BA 1N3BA 1PH4A 5EQTA 1HPCA 2P65A 4P3YA 4IOLA 5BQ5A 1E1QA 2QN6A 3PIRA 1KK3A 1NE3A 3GLHB 5IK2D 3QKRA 3G48A 5JEAH 4LYAA 5FOVA 2FE4A 3GLIA 5IYBG 4DUYQ 1SHKA 1UE7A 3K0FB 1E3PA 1X3GA 4X62L 3EZ7A 3ZIAA 2OEPA 2RGEA 2GJKA 2WHXA 1Z7TA 1QVCA 1FNMA 4GRAA 3RAPR 4RFSA 3UMFA 3NBFA 3GTLH 2BIFA 4JSYA 2GRJA 5IYDG 1HTWA 5EP1A 3CH4B 4DLVA 4WJ3M 1Z5ZA 2DB3A 1W0KD 1KMHA 1N0VC 4X64Q 3P4XA 4RVCA 3VU9A 2H92A 2PX0A 1T0HB 2VQEL 2C9YA 5B2ZA 2D2FA 2WJHA 2B6HA 2WJYA 3GFTA 4OJKA 1DADA 1BBUA 3L0SA 1X3EA 4M1MA 4YONB 2IW3A 4A3JG 4PX9A 4QBHA 2AMCB 2J7PD 3EIQA 1KIXA 1H9RA 1VYUA 2JK8A 3S1MH 2PMDA 1E9CA 4PFSA 4I7ZC 1CR4A 3LQRA 3Q9LA 1LTQA 2J5XA 1X55A 4JYBA 4LUZA 1NIJA 2EJFC 4RD1A 2W0MA 4RKFA 1UE5A 1GG2A 1RRGA 2D7CA 2IUTA 3LX8A 5CJ2A 4GOPC 5JWHA 3THXB 5F98A 1GL7A 3EASA 1PUJA 3IQWA 4KSCA 1KTVA 2GXSA 4WZBE 3EPJA 4Z8YA 1D6JA 1QVFA 2WIBA 5C44H 1II8B 3J7ZC 5CM8B 2SHKA 1PLJA 1L1OA 3T1YQ 2IYQA 1V9PA 1GITA 3HWSA 3U44B 1G3IA 1OIWA 2ZAMA 4PC3A 5CIWA 4TYWA 1D2MA 4WJ4A 1XFAA 2AX4A 4OO1H 3A8TA 4CDGA 5M5YH 2ZJOA 3AFQA 1ELOA 3BB3A 1G20E 4OHWA 3MEFA 3KYHC 2EVBA 2IS6A 1A8VA 3EIHA 4UXJA 4JLAA 2LCFA 3RS4A 4YXWD 3GTQH 2OQ0A 5C0XG 1TX4B 3EZ9A 4QNRA 1Y1VH 1G18A 1KI9A 3TS0A 3W5JA 1GVNB 4DUGA 1Q90A 1E79A 1XTQA 5GADl 1FVIA 1P4SA 4NMMA 1H9KA 4JI8Q 4ALPA 4D81A 4EFLA 2RGAA 3AF2A 2QQ0A 5EXTA 1E2FA 5P21A 4BBRG 3QKRB 4JI0L 2QT0A 3GLIB 3FKSD 4LJ6A 5FLMG 3ADKA 2ATXA 3PUVA 5FJ8H 2A5YB 2ES2A 3FMPB 3SS8A 2HF8A 5DI9A 4B32A 5JHGB 1FUKA 3NHBA 2PNRC 1HNXL 4Q03A 4RZ2A 1X65A 3Q8XB 4NP6A 2GXQA 5AUNB 3PF4A 4GLVB 1T0JB 4KVAA 2CK3A 5GJCA 4XIGS 4AG6A 1HV8A 1KMHB 4LJ7A 1HY3A 4LV5B 4PPNA 4W5HA 4DDVA 2PPBC 4FIDA 1DARA 2XTNA 4E03A 3QPWA 1RL2A 2WOOA 1KNXA 1E2DA 3MLEA 3LXRA 3NTUA 3CKLA 1DAEA 1WI5A 1HCZA 4B3TQ 2CNWA 1AGRA 2ZVPX 2WMNB 5AUPB 1AKYA 2ZEJA 2HIVA 1E1QD 1J5EL 1TQ6A 1ZU4A 2ZR0A 3L0PA 2FG5A 1IL2A 4IPGA 5SZJA 3A5UA 1WXQA 1Z6TA 4HZUA 1DBSA 3EIEA 3NC1C 3ZIAD 5M3FG 4IOCA 1G41A 2E75C 2XNDA 3EC1A 5FTKA 3THOA 4DSUA 4DDWA 2ZSDA 2VSXA 3TW8B 1RIPA 4TKOB 2VP2A 2ZRAA 4MGIR 1AGPA 1KI8A 2Y0SG 1L1OB 3B9QA 2DWQA 2REBA 1W1WA 2C03A 2VHJA 1YE8A 4XTRA 4AYWA 1YNNC 4XOIA 1COWD 2ZJAA 4JOIC 2A6HC 4J15A 1KDOA 4A92A 2VP4A 4I99A 4KV9A 4I4LA 1UKZA 4GMXA 3V9PA 1Z0KA 4O0AA 2UUAQ 3ZZUA 4Q5IA 3EAQA 2C35B 2IYTA 2ZJ5A 1QUQA 2QGZA 1OYYA 4NH0A 4RJLA 4JYAQ 1P75A 3TAHA 3HOWG 5JEAJ 3D7MA 2QP4A 4QGUA 4Q4HB 3OOCA 4KVGA 4FCTA 1E0JA 5C0XI 4LF6L 1VF7A 1JEEA 4LFCQ 2QA4A 1E2VA 1M34E 3U6KA 3D31A 3LY5A 2FZ4A 2V4ZA 1KL9A 1E24A 2B8TA 3ZYCA 1OIVA 4A3DG 2W83A 3E9IA 2O0KA 3CR7A 4BFVA 1FL0A 5FOSA 1PHJA 4AD8A 2JLSA 4EDHA 2ZAOA 1EGAA 3UG7A 4DV4L 2YYZA 1IY2A 1GWNA 2XZPA
chains in the Genus database with same CATH superfamily
2RCNA 1SYDA 5B3JC 4DY6A 5CHEA 4X00A 2JA8H 2CJWA 1P6XA 3ZDDA 1MKHA 1K68A 5LDHA 4A1OA 3ISTA 3CTMA 1NKVA 4UTRA 4RZSA 1XMVA 4KQWA 5CFLA 3BIWA 4C4TA 4ZCKA 3JYQA 1HRJA 2Y1WA 5FQOA 1K6EA 2H0AA 4M9UA 2DHRA 4WY5A 5BOVA 5JOBA 3HDGA 3OLQA 2VK8A 4S35A 3IP1A 5K6AA 1QUQB 1ABEA 3LHDA 5CV4A 5E9JA 1VPVA 3UAYA 4MVWA 1Z35A 3AI1A 3E48A 5F12A 1SQSA 2X2EA 1DFIA 1L0BA 3F6CA 3WTBA 3NVKI 3GO5A 4GX2A 4FKBA 1EJ2A 4CMGA 3MPOA 4DOMA 1TKCA 5IS2A 1SXHA 2AWOA 4J29A 1EY0A 1XBTA 5DBGA 3TI9A 3QNMA 1FP4B 1U8ZA 2OBYA 3V8NA 5JY6A 1Q0HA 4W1SA 8ABPA 5FNZA 3I04A 4BYMA 2P2ZA 5G40A 4HYYA 1I6HH 2X0KA 1ULAA 1V1RA 3N74A 2PFKA 3PO3B 3QLVA 3SYNA 4ZOBA 4WMLA 3WGNA 1HUNA 2VC2B 4QU0A 2C95A 1G8AA 3O03A 2JIQA 4X8OA 5H1SE 1JSLA 5AM4A 4N9QA 5DKFA 3KBGA 4GPTA 1IBLB 4D45A 4LRSB 5DHFA 2BH2A 4YRSA 2CMDA 3H2ZA 4DWWA 1FW8A 3KJOA 4R83A 1TKBA 3RHTA 2Z3VA 4UAJA 1B0UA 3GR6A 1UBLS 3RK1A 6GPBA 1IPEA 1C8LA 5AVWA 1KMNA 1U3VA 1V0JA 4EYSA 4A3MB 4GOPA 2Y3IA 3AR6A 5AOVA 4CIYA 1S3OA 4DAYB 2X6QA 1EVQA 4JDUA 4C6SA 4IHJF 4MKGA 3AF5A 3R7LA 1EFID 3FFBA 1KKUA 4TTPA 3A8JE 4EBFA 5DWDA 2O48X 2J30A 4M89A 1A2KC 2C04A 3BRCA 3GYBA 2UUCQ 3GVIA 4NXNQ 2C99A 3F74A 5F52A 1BCPB 3NHMA 4MPDA 5EJ7A 4X65L 4FEAA 2RKSA 2G9DA 1A4RA 4BAUA 2V1CC 1VKRA 1QZ3A 2ZSBA 1DEXA 2H57A 1LTTD 4JODA 1QG6A 1R8QA 3TQHA 3C24A 2ORYA 3T1YB 5GAJA 3QVMA 5FI0B 2OEOA 3IBTA 4PTLA 3BJMA 3PR1A 3RFXA 2HQOA 4XD7D 1RD4A 4AXXA 3FWZA 4E13A 1VLMA 1E0AA 4JT9A 2Q8PA 4W8GA 3JATB 1WE2A 5AKGA 3ZD6A 1LI5A 4YUAA 3L7DA 1OX5A 2ZI9A 1SCJA 4JHXA 1J90A 4DK1A 1FQJA 1C48A 3MIZA 2LGJA 1Y4ZA 5TC4A 4HR7A 1PJ3A 4OQYA 2O2JA 1M2OB 2BF7A 1CETA 1Z88A 5KTTA 4W5JA 4LVNA 4R2MA 1SMKA 4OYRA 3GMIA 1JN0A 3K9QO 2XUIA 3ZU2A 3TZ6A 4RCNA 4I9FA 1GTSA 4L28A 3SOPA 3N53A 3PFKA 1RZUA 3PUKA 1I7PA 4D9EA 3VNVA 4LDAA 2O3TA 4PZ7A 2D5IA 4E1BA 1KRTA 2G77B 1OBOA 2EZTA 3BWDD 2AI3A 2C9MA 2DR0A 2H7VA 2ASEA 3CCEA 2YS7A 3TQRA 3KF6B 4ECEA 2EGGA 1E4VA 5J39A 1IB6A 4DA6A 5FWYA 1JB1A 1RI3A 4QOIA 2NTNA 3E7FA 5FWXB 1VCHA 4BL5A 1UDBA 4M9SA 1GCAA 3KT0A 1THTA 3A7EA 4F3CA 4GN4B 2Z5VA 2BMJA 1SXQA 4B5LA 4B44A 3EDOA 5CM2Z 4RADA 4CTNA 4WXEA 2WFZA 1VJ1A 3AQQA 1TPZA 4GLLA 4A3BG 2J45A 1E4OA 1KVUA 1LC0A 2AMYA 3ESYA 4G0NA 1IEXA 2WB1E 2XQIA 1MH1A 2IVFA 4IKEA 1GSIA 3KLNA 1CZUA 3UGJA 4UNSA 1J8MF 1AQIA 1F4VA 4JU9A 4HH1A 4YMLA 1QIFA 1C9KA 2GF9A 2QNIA 3ITKA 1C3OB 1JXMA 4TWIA 1VYHA 1ESZA 2JGEA 7YASA 2QW7A 4XI9A 3K0YA 3TW8A 2AFIE 5I3ZA 2NGRA 1WLSA 1IW7C 1MQAA 2XXJA 3NAGA 1R8YA 2PSJA 4MQEB 2V7WA 4JAVC 4K6MA 4JVNA 2WIAA 2QTGA 2Z2XA 3BCSA 2OCEA 3MTGA 2VWPA 5LWQA 2QKIC 3PBKA 4FYIA 1XQVA 3TM5A 4IO0A 4AWXA 2ZIZA 4FWBA 4YS6A 4C3IB 5KNDA 4ZYTA 5H3LA 3J7A5 1JKIA 2GZMA 2XMZA 4R3NA 1HQMC 4BFYA 3VBCA 5AVXA 4JOSA 3C3JA 1K8YB 3PUWA 2EG9A 1XIVA 1T4CB 3WRVA 5JT1A 3F3YA 3VO2A 1WXGA 3Q23A 2C2MA 3TPCA 3IUEA 4DLSA 4M86A 1LZKA 2NUAB 1LLQA 3C43A 4OLFA 1KI1A 5TPWA 3A0JA 3H99A 1VQ7A 2J08A 1PG5A 4KQGA 1OD6A 2BEWB 1ZCJA 4FUQA 2G4LA 2OGTA 4ENUA 4XWOA 4KZPA 4URWR 4KHVA 4S1NA 2J3HA 4M7RA 5AXDA 4A3EG 3CRZA 4R0NA 3KLRA 2XVMA 2WSMA 3DCJA 3RTCA 1F8GA 3HSSA 3RMHA 1H8ED 3TDQA 1YA6A 3TNJA 3G0GA 4MQBA 1JC7A 4JUCA 3IESA 3HB7A 3KDSE 2MPMA 1N4DA 4EB0A 3H0KA 4DV7B 1V4VA 1KXLA 5CGQB 1IQ0A 4A0SA 5EESA 2QM8A 4O2AA 1IAQA 1GU7A 4MZDA 4GQIA 5BQXA 5BWLA 5KYTA 2O6HA 2XF8A 4A8JB 3HK2A 1O6GA 4N7BA 1QNUA 1QU3A 5BR8Q 4BKUA 4A76A 2YJ5A 3LCVB 3I6YA 3RUEA 3SQWA 2AN4A 1BYIA 4ZI3A 1I3KA 1ZJ6A 4RWZA 4CUZA 4DQXA 1XFDA 5AI6A 2OHOA 2R1VA 3IPYA 4YRAA 1ZK1A 1N32Q 3OM1A 4OLJA 1BDBA 1QE5A 2PNHA 2OYRA 1H65A 1PR4A 1KSHA 2PANA 5LPNA 4EL0A 5JDCA 2ONZA 2QMEA 3S2HH 3IV6A 4OF4A 5KWSA 5EIHA 3NXWA 1OBHA 4MWDA 3TECE 5A2QL 3D4OA 1MXFA 5FLXc 1V5EA 1MEJA 1G5PA 3SHLA 4QM7A 4L5YA 1Y7TA 2H07A 1KDYA 3KG2A 2A33A 4B9WA 1WQ4A 2FK7A 3QLTA 1T5LA 1O6ZA 4M22A 2M2LA 1VGRA 2DT8A 5C6AA 1FDTA 2CMGA 3HMQA 1TZKA 2XOKA 1LBIA 1YVCA 1DRUA 3FPCA 2Z83A 1JKJB 3WL4A 3H7IA 4GI5A 3AEQA 3M4YA 3N6XA 1EUZA 5JROA 2A5GA 1MG5A 1ICEA 1SNCA 3ZHZA 1WULS 5J3BA 1SA0B 3KYCB 1VIAA 1T3HA 3L6EA 2NVQH 4DR7Q 3RK0A 4RDHA 3M3YB 3K5HA 1VGQA 3RFCA 4IHKA 4HAXA 1NSNS 3KL4A 4EHKA 1NZJA 1M1NA 3LRTA 4EHIA 3PT9A 2XRQD 3WVNA 2QIOA 4R8IA 1E9AA 4HDKB 3U17A 1LKZA 4HGYA 4F7DA 5BMVB 4KO8A 2O8FB 3LUFA 2N3ZA 4ZQHA 2A3NA 5MN5A 5BV0A 3Q6IA 1SMYC 1U8EA 4CF5A 1PAUA 1XG5A 2HQLA 1UBJS 2QP3A 1TW3A 1Y6GA 4CQMA 2VPXA 2JHAA 3ZZ0A 1R66A 1K92A 1FFYA 2DERA 3TQTA 4F9EA 2R6JA 3I0ZA 4US2R 5FLMH 5CBPA 1L8LA 4KK4A 2AN9A 3FF1A 1NU8A 3ZR4B 4GPIB 3PUZA 4GUDA 1RHRA 2WINI 3KQUA 2QR3A 1IEVA 2O8VA 1T8WA 3ZWNA 1XJCA 2QRJA 1CZGA 4ZRZA 4NZYA 5B1YA 3BEDA 4H31A 5KTMA 1OLSB 2FA9A 1RSZA 3FBGA 2IPNA 4V39A 4P6VF 3K9HA 4ZK9B 1QHFA 3EVFA 1PR1A 1MU0A 4KQKA 2V6JA 4ALMA 2R8OA 3DTTA 1PSWA 1ORRA 2FPIA 2PTHA 2BCOA 1R00A 2YY6A 1AM4D 5DGTA 4S3SA 4Y9TA 1CF2O 2N55A 5HZHA 2A9OA 3VR0A 4R2HA 1P2UA 3CMMA 3WRYC 1U28A 4ZVUA 3QE4A 2RCYA 4NZOA 5HKOA 1UJCA 1OQAA 3R2TA 4D9IA 1J49A 4JLWA 2OV2A 5FBVB 3ZTTA 2AHOB 4KL8S 4S04A 4PSVA 4CZ2A 3WXBA 1KYIA 3CNQS 4NF2A 3CCUA 3O9ZA 4RIEA 4DR6Q 2CXXA 4RF3A 6REQB 1LS1A 5SY9A 2HU2A 2I78A 3OCCA 4YUYA 2PKXA 4U8HA 1MJNA 1IWBB 4DMFA 2O1EA 3B8HA 1ZOLA 3ZGLA 5I8ZA 1UOOA 1K63A 2YVKA 2Y76A 4TL7A 4F93B 2XUAA 4Z7OB 4WVLA 4FZJA 4G09A 2P2CA 1YD7A 1PO7A 1VPDA 2C4MA 3BM5A 3ZWWA 3DXZA 5F2NA 2F90A 4F6LA 1CUGA 3AETB 1XU9A 1KAAA 3HE3A 3C7TA 2X42A 4XOUA 2ZTDA 3CWZA 1A7KA 1RAAA 4MPJA 4ZHQF 3BD6A 4BZXA 5CYGA 4FBMA 4AJ4A 2HTEA 4IGKA 4B09A 3CCFA 3CEHA 2A68C 2WKDA 4KK3A 4MCIA 2DUDA 5T4FA 3ZVNA 4QFBA 3RANA 4JMPA 4F5DA 5IIFA 3RBVA 2ZITA 4C3HH 3GJ7A 4RMJA 2O2ZA 4B75A 4D3DA 2GZRA 4XGQA 3OPYA 4ZD6A 3DDWA 3SU8A 4LHVA 1RLUA 5JE8A 1EX6A 1FVXA 3K4PA 2GARA 4J0GA 2JW5A 4H4CA 3IBGA 4GKAA 2O20A 4EMSA 1YNSA 4CMIB 4LTMA 2NSHA 3AI2A 4BZZA 4QZVA 2A9FA 2X4IA 4YHHB 3WNVA 3D4LA 1VLZA 5BRJA 2WFLA 3NKLA 4W1PA 1E1RA 3OTOB 3E5RA 1DO8A 4RH1A 2PJRA 4OP1A 2BTQB 5C8YA 1XWFA 3GP3A 5CG2A 3UOAB 3MTQA 3ILYA 4ER0A 4U7DA 4N5DA 5CDHA 1D2NA 1E5LA 1ZRNA 3LC2O 2BGLA 1TQDA 5K3SA 4Z49A 2C77A 1W8DA 2Z2YA 4UOZA 3NENA 3D8HA 1KC3A 3HLYA 4XM0A 2Q6VA 4TWBA 5EFOA 3F6RA 1CQIA 2A35A 1XMOB 2L11A 4UD6A 2KE5A 1BD4A 1KJ9A 2C88A 4J0IA 5JWOA 2PRSA 4AK9A 3FPUB 1F5NA 4P0QB 5EQDA 2GHTA 2OILA 3O26A 4L50A 4BO1A 1G91A 2X4DA 3TQSA 3TIFA 2GTIA 5IWCA 3L0YA 2GFHA 4X3TA 2EVWX 1YI2A 1A4IA 4UPEA 1RF2D 2I6QA 2VCYA 3DVAB 5F9FA 3DTVD 1EDOA 5IOCA 1F5SA 3M6LA 4B3RB 4D6XA 1T2NA 4HB0A 2B9VA 2BFMA 2PL5A 4BWFB 5HBRA 1SUPA 2HBYA 4YJHA 2EAUA 2JIZD 1Y3HA 2BRUC 4G0XA 2FDRA 1GSHA 5CT9A 1TVKB 1SCDA 1TKAA 4O08A 4DMGA 4HDAA 1LQUA 3L8HA 1KY4A 4JI3B 3U7FB 3HYCA 3CUYA 4NOMA 4TSFD 3OKPA 3E9ZA 4XD7A 1XRRA 5IT4A 2JA6H 2KB0A 1SNYA 4IV8A 3L1JA 4C78A 3LIPA 3NGXA 4PSDA 5I6YA 4YN3A 2WB4A 5IYCG 3G3EA 1V35A 1C50A 5KQSA 5HXAA 3K7AB 2NVYB 4TLMB 5CVUA 4Q4LA 3DKVA 5L3QA 2RH4A 1GOTA 3VYRB 4FPXA 4R9NA 3AY3A 2FJ2A 1Q7TA 2R5WA 3RU7A 1YQGA 1H9AA 4NYIQ 1PR9A 3MTJA 4WCFB 1T9AA 1R4PB 1KDPA 2K87A 2ZR8A 4LJZC 4O4LB 5JCZA 1OV6A 3AJ9A 4KR2A 2ERYA 5K5EA 4ER6A 3KPJA 5C3MA 1K2WA 3EZLA 4HUQA 3UCFA 3D9QX 3R41A 1TTHA 3WZ2A 3GG2A 4RS4A 1F0KA 1KEWA 4Q1AA 5FULA 3FRJA 3GIWA 2WV6D 2PLAA 2H4XA 3F6BX 3NHKA 4HQNA 1F7UA 3SG0A 4LF8Q 1V8BA 2FHPA 3AUYA 3D8UA 4KQXA 1TMGE 1E9BA 1YBHA 3CC2A 1NF8A 3CLRD 3G1UA 4PLTA 3B13B 4KAJA 1IXYA 2HDOA 3HOWB 1R27A 5B5SA 4JKIA 3FP9A 3VHXA 1ECCA 1I3LA 1VE3A 5KIAA 2Z0SA 3SK8A 4D9JA 4DV1Q 4LHXA 1VG0B 1Q7BA 4PHCA 1P4RA 1DEOA 1QVRA 3LP6A 5AM3A 1YJBA 4JWKA 1H4VB 3KPVA 2WMYA 3IBCA 1O94C 1D5WA 4DGSA 4M7OA 3OSOA 2GKOA 1MP0A 3N2IA 1KJQA 2NU6A 4IRUB 2GFIA 2EF1A 3I73A 3K94A 2XPCA 4MKHA 3MM4A 1DIBA 1DPFA 2HV8A 2G5TA 4CU5A 3DP7A 4YXWA 5BPFA 4E30A 4UTXA 4JLPA 3TRHA 1Q1ZA 1XEWX 2PS1A 2ZWMA 2UYCA 5C8ZA 3GCGA 4AXBA 1EK0A 3HJHA 4LYGA 1WTOA 4BLSA 1G2IA 1U98A 5HKBA 1YUBA 5J1TB 4V2UA 1NC3A 1J9OA 6CHYA 5A1JA 2D2VA 3GJZA 3P0HA 1BCPC 3G0BA 1WJGA 2Z2JA 2NP6A 1IIRA 4GRAA 1QFSA 4YJFA 2XI4A 2A67A 1D6NA 1GEGA 4HX2A 4PZ9A 3VU9A 4LA4A 4O63O 2JZCA 5E4JA 4EMUA 4ID6A 1PRYA 1UM9A 3BWEA 3K6OA 4LUZA 5CORA 2ES4A 2XBMA 5JWHA 5JFOA 1HETA 1RKQA 2B4YA 3W3AH 5JSUA 3HB1A 1A8VA 4UXJA 5EA2A 1PYGA 4HVTA 5GADl 1Y0BA 1K66A 2EC5A 3S99A 2Q4TA 2QD5A 2DH6A 4RHRA 3M1AA 1W6RA 3OT4A 4KE6A 2PNRC 2Q2NA 1ND6A 5GJCA 4KY6A 1STGA 2X6GA 4EMTA 4EG3A 4CL2A 3HKZB 1RL2A 1HEUA 3U3ZA 4BX2A 4OXNA 3J81E 1R16A 3L0PA 2FG5A 4G85A 5JSQA 5FF9A 1Z6TA 4DV4B 4MVXA 2HIAA 1P9LA 2I1WA 5AOBA 1GGEA 4GRIA 4LE0A 2XA2A 1B6RA 1HDGO 3EJIA 4LZWA 5LNK6 3FPSA 2IYTA 3BE5A 2KX7A 2QP4A 3L8EA 3RU3A 2W2LD 3I2JA 4IXWA 4KXYA 1BJRE 3GAMA 5KTNA 4J1NA 2AZTA 3K0KA 5HGTA 4QUEA 1E6EA 3B36A 5HUJA 2ILTA 2E89A 4ZEOA 2RGRA 5GINE 1PJ2A 4EY5A 5FK9C 1X92A 1FU8A 2FRVA 2C2KA 4R1LA 1WZUA 4MROA 5EHZA 4OYLA 5CTJA 2PBRA 1EBUA 3NHHA 5IODA 5B58T 3ERCA 1FP7A 2B39A 4WNCA 1EY4A 4DPGA 3QLUC 5JD4A 1UEXC 2WM3A 3X1KA 1NUUA 3PZRA 3T6KA 3DGFC 4GICA 1HR0W 2OG2A 4D1YA 4DV5Q 2VN8A 3SS9X 4ODGA 5JEAG 4G0VA 4HS4A 4RTNA 5D01A 3UHOA 4DBLC 5EP3A 2V6GA 5MGNA 2X5KO 3E5NA 5G1OA 4YH1A 3MGAA 1KEUA 5GJVC 3SF0A 4DABA 1Q7CA 1XPJA 2C0PA 3H1FA 3KQTA 4EW3A 2FE1A 2OCLA 4WVFA 4A93B 3JD3A 4Y2RA 3QWHA 1N77A 4F8EA 4L16A 3HDHA 1KO7A 5KSYA 2J5QA 5KJCA 5DYYA 1CERA 3PQ2A 1H0HA 2HA7A 1GUFA 2OF1A 4WPGA 1O95C 2ZK7A 4UHEA 1AE1A 1BCPF 4B17A 1X9NA 3URKA 5JMWA 1IZ7A 5U4XA 4K9RA 4HEDA 5AVUA 1YXMA 3LECA 4BHTA 4XIYA 5FB3A 1NBWB 3VBEA 5LIRA 2HRCA 4UQLA 1A4XA 1QHXA 4Z7NB 5H4HA 5DHQA 1K4MA 4LXIA 1CSQA 4HWSA 1A97A 2FW1A 5F3RA 2NUTB 1GHKA 4QT4A 5IP9G 3LPLA 1W49A 2ZJZA 3A1VA 1X3LA 5DBEX 1JOQA 1RDFA 2FB9A 4ZT7A 1R2QA 3T53B 4S0XA 4XUDA 1PEDA 4AS3A 2ZYIA 2QYTA 1PFGA 5AQ1A 4TL9A 4BVHA 1ATZA 4L5CA 4R9WA 2CXTA 3A37A 5E4FA 3VVCA 4XJXA 3MXUA 5GMOA 3QFHA 3RHSA 1OB5A 3G8AA 4ITRC 1YGPA 4TQGA 4AKHA 2YVAA 4E2FA 4KLRA 4F06A 3VKFA 1RDPD 4A3GB 2EBWA 2JAOA 3K80C 4N3AA 1LI7A 3S8EA 3UEOA 1MJ5A 2F17A 4F71A 3DD1A 1X1EA 4JOIA 1YI0A 2SEBD 2P30A 3NO4A 1JKFA 2HSGA 2YV3A 3OQPA 1I4LD 2V65A 3A31A 4OFXA 1NJ2A 4B3MQ 3MS4A 2X5JO 5DXFA 4OOFA 4NEGA 4RJJA 3NVMB 1GVPA 4A8JC 1UC8A 1L1QA 5LXTA 2L82A 4XJTA 4D56A 4FF3A 3TD9A 3I9OA 1VLVA 4FS3A 4MV5A 2JCVA 3AUTA 3KF8A 3RRNA 4M76B 9LDBA 2AKEA 4TKZA 4U2DA 1ZOIA 3S2EA 5EMHA 3N8IA 2HEIA 3L4KA 4R8SA 4RCOA 2Y77A 2ZYHA 3N8NA 4HQRA 4C2AA 3V2TA 3UUFA 2XZTA 4C88A 4DLZA 5ADVA 5EP2A