3RLFA

Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
molecule keywords Maltose-binding periplasmic protein
total genus 106
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3rlfA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3rlfA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rlfA01
1KAWA 3GJ7A 1GJXA 3IIJA 1E2IA 4JYCA 2JJQA 3QKRA 1M7GA 3V4RA 2XNDA 3RYTC 2WAQE 3NENA 3EAQA 1Q1BA 1HH2P 5DN6A 3BFKA 2PH1A 1H9KA 1J6QA 1EFRA 3X1DA 1X8JA 3PFIA 1ASYA 1N6IA 1Z6AA 3WBKA 4BXXH 1TMKA 1MRNA 3N6RA 3GCGA 2A7QA 2X2FA 5IWAL 1SVLA 4LUZA 4A3BH 4KVGA 4BQSA 4RD4A 4OHWA 5DHFA 1ZU5A 4EJSA 2LKDA 1XB2A 1R8SA 1P4SA 4KITB 3AVXA 1OFUX 1KMHB 3T34A 4C0KA 5C18A 2DNEA 2OHFA 4Q00A 4N0EA 3VHXA 4JI3L 1E99A 2RGGA 4QXAA 5EXTA 1P62B 4B3BA 3M0EA 3AQQA 1OYYA 1IN4A 2JLXA 2QI9C 3D6TB 1W47A 1QHSA 4PC1A 2WPDA 3HYRA 2J46A 1N33Q 1AKEA 2REOA 4DSOA 4X64Q 4DCSA 4DDUA 4JOIC 2QZ4A 4HB4A 3RANA 3MRSA 2QT1A 4BFUA 3AP3A 2NGRA 4BZQA 2JJ2A 2RGBA 3D0FA 4HAWA 2VP0A 4A3IH 4Q9HA 4DK0A 4EFMA 4BLOA 4EFNA 4DDVA 4I81A 4OGQC 4HAZA 1N0UA 4PZZA 2OG2A 4TTRA 2DHRA 2J1LA 2GJAA 4JJZA 2NN6I 1FTNA 1I4DD 4M2LA 3CMEA 2Q9BA 3ULLA 1YZ6A 4FXPA 4OI1A 4C3ZA 2EW1A 1S4QA 3FHWA 3EIHA 3QPUA 3AVWA 1W1WA 2KJQA 3AVOA 2GXQA 3GJ3A 1D8TA 3TUIC 2A5YB 2ZS8A 3A5ZB 1Q81C 1ZC3A 2J0SA 3WP1B 4Q4JB 2D0OA 3U60B 3QXXA 4A4IA 1VYTA 1Q12A 2LWIA 4D0NA 3ZVLA 5C1BA 1N34L 4RCYA 3DO6A 3A7AB 4AG6A 1IXRA 1DG3A 4A3EG 3TS0A 1TPZA 4A92A 2ERXA 4DBLC 3MEFA 1KI2A 4W9MC 1L2TA 2ZM6L 2F4VQ 3S1MH 1NKTA 1J99A 3LWUA 2WKPA 3K9GA 4PV1C 4DR6L 4C2UA 2ZT9C 5K36G 4PZLA 2IC5A 4G7ZC 2NN6G 2CNWD 1NSFA 2JDIA 3HPRA 5DI9A 4GOKA 2IUTA 4DV2Q 3GPLA 4JBKA 4AURA 1K9MC 4A0FA 4JVLA 3A8JE 1GAJA 2Q2TA 1HE8B 1J5EQ 4LFBQ 1PH1A 2JE6I 2IYQA 5LPNA 1RRFA 4M1OA 1K83H 4OK5A 2Q3HA 3K0AB 1DTSA 1FX0A 1K6MA 3LXXA 3CWQA 4LOAA 1E2KA 3MWJA 1EX7A 1KY2A 3VR2A 5B58C 4MGYR 521PA 5DLQE 2YU9H 1H8HA 1LS6A 3SE0A 1W2HA 4XD7D 1DAGA 4JBMA 1I6HH 2VHTA 4HLUC 4US2R 1Z63A 5LMUL 1GL7A 3AVPA 3GEEA 1XTQA 4IOAA 1E32A 2J0VA 3WMFA 4DPGA 4WAUA 5DLQC 4AG5A 3G6EA 2ZIAA 1FL9A 1S9HA 3PUWA 2XJ4A 4DRZA 3CB4A 1NKSA 2IF0A 2YNMA 2C9OA 3SYNA 1MH1A 2J45A 2ORIA 2OQ0A 3U3RA 1RC8A 2L5TA 1Y8OB 1JAHA 1YJNA 5K8TA 2L15A 1Z29A 4AY2A 3F5FA 2ZTDA 1EWRA 5G41A 4I99A 1FOEB 1SVIA 5GROA 4P4SA 3UG6A 4JI2Q 3SS8A 2K32A 5IRCD 2BMJA 2V55B 4JLKA 2ZRIA 4GOJA 4YDHB 2ODBA 2OAQ1 4LYJA 2FU5C 1MJEA 4BA2I 1NMZA 4Q4AA 4DHEA 4KFSA 2W2VA 1GKHA 2R44A 4ARZA 1T9HA 2OO7A 4BECA 1KDPA 3CD6A 1HYQA 6Q21A 1Q8KA 1CR2A 1QF9A 1IY2A 4JI4Q 1E96A 2Z0MA 1KK3A 1Q57A 2FE4A 2OUKA 2Z6VA 1QVAA 3I5YA 1XMSA 1Z2CA 3TREA 2QMEA 1DBSA 2CL6X 4OWXB 1J2JA 4JBYA 5FTNA 1Y69U 1QZXA 2ZU6A 4FDBA 3EA5A 2IY5B 1QZGA 3I72A 3L2OB 2QP4A 4DV3L 4WVFA 5EP4A 621PA 5C44G 3CP0A 3BAFA 5CYOA 3FHCB 3E9IA 1XD9A 2JAQA 2GA8A 3CO5A 2ZE6A 4JLAA 3K70B 2OSBA 3CQZH 1X65A 2HXSA 1AIPA 3N70A 3F2CA 3NC0C 4I4LA 4X6AH 4WBSA 2E1RA 1F2UA 3P4XA 4A3CH 2G3YA 4MGIR 3KUCA 1OTCA 2NPIA 2VIIA 3NWJA 4UNPA 5F9HA 2VHQA 4BLSA 4B48A 1DAFA 1O78A 1IW7D 3HKZE 3IBGA 3SBEA 3RLOA 1XTIA 3TNFA 5EE5B 2FNAA 3KQUA 3TAHA 3L8YA 1L1OB 4DR4L 4OJKA 4YWKA 1E0SA 4Q48A 1K3RA 2FZLA 3PEYA 3HR7A 2V1XA 1VTKA 1RKBA 5GJCA 2CXXA 2MMGA 1V8QA 1PVOA 1NMXA 5P21A 2FPMA 4BLRA 3PF4A 4C2TA 2C99A 4M0LA 3DM3A 3PUVA 3BOSA 8OHMA 2UXCQ 4EPRA 3J81i 4LYHA 5DHAA 1LV7A 2GK6A 4EKDA 1XMIA 2ZVQX 3MWYW 5IYCG 2GRJA 4WJ3M 2ZRGA 4RJLA 3M4OH 4I7ZC 1NTGA 1CR4A 1C7YA 1OXXK 5SZJA 2F43B 3B9PA 3H94A 5IYDH 4OYHA 2O8BB 3H4MA 2F9LA 2UZ3A 2CCZA 3IDQA 4TZ6A 2QPOA 2O8EB 1CKNB 2MMCA 1SKYB 4HUQB 5ANRB 2XAUA 4K8OA 4C3JH 2GZAA 4R4OA 1QHHB 2KBFA 3PIRA 2PI2A 1BOFA 1TF5A 4D4JA 3TH5A 4GNKA 1V5WA 4EX5A 1PH4A 1YVDA 2ZS9A 4QBGB 3D31A 1CR0A 1YNXA 4JK1C 4TZ0A 4OX9L 1L7VC 2B63H 1OV4A 4A15A 1VQ6A 5KSPA 3CCMA 1NVWQ 4JI6L 3T1VA 1YEZA 2JLRA 2V9PA 4YMUA 5HR5A 3FP9A 1XJQA 5AUPB 3G4SA 3J7ZC 2C35B 2ODNA 3BJIC 4B3FX 4LJ5A 4GOPB 4PAMA 1L4UA 2PEZA 5G3YA 4D2IA 2DN8A 3BDOA 4OO1G 1KGDA 2OQKA 1CJVC 4O3MA 3BS4A 2O8CA 1YR7A 2BV3A 5FBQB 4TLBA 1KSGA 4EJSB 4OK6A 1WB9A 1M90C 2J87A 4HLDA 3RRNA 1MRSA 4DXAA 3GLFB 3T12A 5DSZA 1QUQA 3SHWA 3QY0A 1S3GA 4P31A 5SZKB 1H95A 3IRBA 1XDBA 2AK2A 4A0RA 4KBGA 3SJBA 4AYTA 3T56B 1CI3M 4GLVB 4Q4HA 3I8XA 1E7ZA 3QBTA 3GLHA 4I1OA 3AF4A 4IOLA 3MWLA 2OEPA 4QGGA 1YRBA 3EWSA 1IQPA 4OI4A 3CCUA 1KAGA 2RHMA 2Z4SA 2CWAA 4LUCA 3WMEA 4D4LA 2PNHA 4BY1H 1D7QA 3CRW1 4CEHA 5FLXc 2Q6TA 2BBSA 3SJCA 1HZCA 1XEXB 3SJAA 1XPRA 2GILA 1GHJA 4Z54A 5IT5A 2VZAA 1FP7A 4TMVA 2CCJA 4RD3A 4B3DA 1IYVA 3OTOL 1UM8A 1J90A 1GUSA 1TQ6A 2D62A 2D2CC 1XNRL 3QG5A 4B43A 3GJ5A 1UE6A 1ZNYA 5IP9G 1XTDA 1G3UA 4GBMA 2WSSA 3U5ZB 4GL2A 3Q7PA 4KBFA 3M4YA 3RZOH 3IEUA 1JJ2A 1RE0A 4B3ML 1T0JB 4YWLA 4BBRG 2HDNB 2HYIC 2XXAB 1X54A 2FJUA 1S0UA 4DLWA 3QE0A 3LW7A 4ZIRA 2QGQA 4A36A 1VQJA 3STBD 1C1YA 1IY0A 2UVQA 3KFVA 4PZ7A 4Y0VA 3Q8DA 3CUEF 4LRWA 4DK6C 4NXML 1ESMA 3U3OA 5F98A 4C7OA 2CHVA 1SR3A 2WB1E 2NZJA 1JEEA 2RGXA 4R2IA 3PQCA 4PC3A 4YXWA 3RNUA 1OXTA 1DVRA 1OPXA 1HR0W 3H84A 3HJNA 1IJFA 3D7MA 3K0AA 1G21E 1U94A 3BE4A 3W5OA 2XZOA 4Q9JA 5GJBA 4BLPA 1WDTA 4A75A 2GVDC 3BFXA 4KN7C 5IT9c 2UXDL 4E5UA 4HJ7A 4GZYC 4L4UA 4IPCA 1VPLA 5AK0A 4K0KQ 3S1AA 1GUOA 4GOPC 5EJEA 2WTUA 2DCUA 1E1RA 4CW7A 2YINC 2ZRCA 4DB2A 2B29A 2DFTA 3OE7A 1WF3A 3W90A 5TVKA 4DKXA 3ULJA 4NCHA 4QC2A 4A2WA 1NBME 4LF5Q 3B1WA 5K8UA 5HKKA 2NVYH 4TL7A 4LZZA 1ZKOA 3I32A 2BOVA 4LF4Q 2G77B 4OK3A 5C46F 1A8VA 2KHJA 4A3KG 1AS2A 2EVWX 1IBLQ 2XZPA 4Q4JA 2AWOA 1JB1A 3NDBB 1DGSA 4RD1A 4ZPXA 2E2JH 5GJWC 4EPTA 4XWKA 1PH7A 2UXBL 1P2VA 1ZIOA 1XJCA 4BBSG 3H0GG 1E0JA 2J0UB 3T35A 1RIFA 1AH9A 4UJ3A 2X19A 3HOYG 2OESA 4TLAA 3U6BA 5EXPA 3DMDA 4Q7LA 5GVSA 4LFCL 3AQ4A 2GVBA 1M74A 3N2EA 2Z6KC 3SQWA 2EXDA 5JJLA 2VSOA 4B2PA 4X66L 2QA5A 3Q9LA 1JECA 4DNIA 4A8JA 5AJXA 2JGNA 4X66Q 5FPHA 1DADA 4JI6Q 4ZV4A 2QT0A 3FKSA 1VQKA 4XTRA 1K8RA 3ZJYC 1KRSA 3AVQA 4LBWA 5UKDA 2IWRA 3CM0A 1GRNA 1QG2A 2NO9A 2GNOA 3RWMB 3UMSA 2H8KA 4B3RL 2IWHA 4ESHA 2PPBC 3ER0A 3GTQH 4JC0A 4O0AA 3HOUH 1G3QA 1TQ2A 3IGFA 2V1UA 3K0XA 2WAQG 1FQJA 3IO3A 1CJUC 2IBMA 2YWHA 5L3SA 1Z6GA 4F4IA 3MWKA 2GTPA 3B13B 4CF7A 4TTPA 3NH6A 1EFUA 3PVSA 2NG1A 3CPJB 3U61B 2NVXH 1CKEA 3HOZH 4A82A 1CEEA 4A3DG 2QP9X 4IOCA 4ZDKA 5L8VA 2B63G 3A4NA 2AXNA 2VHUA 4AC9A 3CRLC 4AIMA 4PQRA 3P20A 2ZSDA 2F7SA 3SYKA 1PLKA 1XTJA 4H13C 1A7JA 2V4DA 4CVNA 1WFQA 5IWAQ 4CEJA 1NVXQ 1GL6A 1DO0A 3H3VH 1KYIA 3B1XA 2NIPA 2ZAOA 4MDEA 4B71A 3TS2A 1DPFA 1JJCB 2Q3MA 2VTKA 5TARA 5JSZB 3CR7A 2HLDD 3DM9B 2BHRA 2ZI6A 2PT5A 3CCVA 2QGNA 5CDFA 1E79D 4KSBA 1G18A 4ZCIA 3CRRA 2QTVB 3BRWD 3QXHA 2I5LX 2BCJQ 4A3FH 2KSQA 1AE3A 2ZETA 1Z7TA 3CAMA 4PHGA 1FUKA 2XOKD 2ZJPA 4FINA 1CTMA 2UUCQ 1Z47A 3MG9A 3P1JA 2E87A 5EAYA 2VSXA 4NHOA 2GZHA 5EP2A 1W7AA 2KHIA 3KTAB 1HUQA 1L4YA 4ZO4A 1TNDA 1M6NA 3NBZC 1HURA 4C0SA 2XSZA 4BFWA 5LB4A 1CJKC 4C0JA 3AUYA 3K0SA 3GTLH 4LWCA 1W4AA 4YMTA 1AJEA 4NXNL 3U4QA 3EA0A 5K8LA 2IEZA 3R20A 1NLFA 2H5XA 1QHNA 2CCKA 4YDSA 5IF9A 1J5EL 2ZPTX 4ACAA 4Q7MB 3S1AB 4JI0L 4QRHA 3BGWA 2OILA 4H0LC 1N6HA 1J8MF 1KDTA 3KL4A 2RGAA 3GJ0A 1DAIA 3L82B 4A2QA 2DUDA 3J80i 2NMVA 3L0OA 1MKHA 4K0KL 2O8FA 2B8WA 4JLBA 3R9XA 4MKGA 4MUBA 1Y1VG 1QBKC 2A78A 3IQXA 3W8RA 2X8AA 5CIWA 1VDZA 4BWYA 2ASEA 1TF7A 4AK9A 5AJYA 2HXYA 1K8MA 5JZVA 1UE1A 3CRQA 5DI3A 2R7FA 5LMUQ 1R0XA 3T1HQ 3PUZA 4A3CG 2J9RA 2RB4A 3AVYA 2PMKA 4QKQA 1XNJA 4FCVA 4IVPA 1A62A 1SN8A 2BKEA 4G5RA 2ZR7A 3T1HL 2GCPA 1XZQA 3BB4A 5TY0A 3HR8A 1GTVA 1F48A 3CCRA 1GO3E 4B47A 1Z0DA 3I4NG 3U50C 3WHKA 5FJ8G 4JJKA 1E0AA 4PQFA 3UWKA 2PZFA 2ZJ2A 2ZRHA 4KLNA 3SOPA 2XGTA 4TMZA 3KDFB 5KDLA 4CRWB 5LMNW 4FIDA 2XB4A 3EASA 1F60A 2QY9A 4G5SA 1HV8A 4ZI3A 2XSZD 3J81c 3ZZTA 2IA5A 4KKUA 1EIYB 4NYJR 4IHQA 3CH4B 4V0MA 4E03A 4EQ6A 2R92G 2XOKA 4XOIA 2J5XA 5BXQC 3ETLA 221PA 4V0LA 3X1XA 1NJFA 4DB4A 4DAYB 4D0GA 2JIZD 1WCMH 1GIAA 3NBXX 4S2EA 1K5GA 3TKLA 1B0UA 4TYYA 2QBYA 3K09A 2VQFQ 1GDDA 1G51A 1QUQB 1BYIA 2P0EA 1UBGA 5J5CA 1NN1A 2Q21A 4KYUA 2C77A 2E74C 2UUBL 3GLHB 1L0WA 4HIMA 1TU3A 3UE0A 2QBYB 2FX3A 4QL5A 3ULPA 4KAXA 4Q9LA 3SNHA 1DEKA 1SQ5A 1NSTA 2H17A 2GXAA 5C44H 1NN5A 4A0GA 3LFUA 3PITA 2ZJ8A 5JWOA 1XD2A 1X6VA 1PUJA 1WMSA 1UDWA 1R0YA 3A1WA 4IDNA 4KXFB 4Q66C 2VW9A 4NKRA 3AF3A 3CNLA 4UXHA 1FNNA 3I92A 4Q7KA 3EIVA 2EU8A 2IYLD 4DR4Q 3AEZA 2HT6A 2O8DB 2JASA 2ODEA 1M34E 1G7RA 4DCTA 2Z6KA 1I94L 3CNOA 1NMYA 3CLVA 4NTZA 1WCMG 5JWHA 1BKBA 2RCNA 1CIPA 2CHGA 1N5IA 2FOLA 4LHXA 4B3CA 1LVGA 1UE7A 5C0XJ 4IPDA 4M4SA 3UWOA 3KOJA 4A3EH 1ZD9A 2GETA 4C0LA 1Y3AA 2IHBA 1T6NA 3FKSD 3BB1A 4QNMA 4B3GA 2VL6A 2QAJA 4A1FA 1HY3A 1XMJA 3TE6A 1O7LA 1LF5A 2PQAB 3H3VI 1FMJA 2KE5A 4NZYA 4LF8Q 2WIAA 3GJ6A 2ZRJA 1ZJ6A 1UKVY 2WJYA 1KSJA 4Q9KA 1VG9B 4LF8L 1CJMA 4A6XA 5ELXA 1EFTA 4HIDA 4DV4Q 3BH7A 4M9QA 4NXNQ 4Q1AA 4HB2A 2OXCA 1XFAA 2FV8A 4DV3Q 1TWAH 3GJ4A 3OESA 4LV6A 4DV0Q 4Z8YA 1OXUA 4B73A 1E2VA 3JZAA 3OEHD 3RDPA 2PBRA 4MRVA 4C2MH 4QJ5A 3ADDA 4Z8XA 3GEIA 1OH6A 2BBWA 3VX3A 5DO9A 2WVJA 3RS5A 4CT4B 3PEVA 1CLUA 1GOTA 1DG1G 1E2EA 1X8LA 2V7QD 1KQSA 1P73A 2CW0C 4GZLA 4PSVA 3LDAA 1UF9A 2ZANA 5HKKD 3TZUA 4DKAC 3HU2A 1D9XA 2ZRKA 3KX2A 2ZI7A 1FTSA 2WJHA 4GOXA 4RZ3A 4DZZA 3CCQA 1HR0Q 1R4AA 2ZJ5A 1Z6YA 1M7HA 1HZ9A 1B8AA 3E9HA 4HJ5A 2BM1A 3NDPA 5FH9A 3ZVNA 5H70A 3A8IE 2PI2E 4URZR 5FTJA 2DGYA 1KI7A 3KKNA 4AD8A 1HZBA 1VYUA 3DOFA 3GFOA 4GNXB 4IJMA 3FMPB 3V9PA 3ICQB 1TF2A 4QM6A 4DVGA 1V1QA 3RS3A 2A3RA 5L3VA 3THWA 3KYHC 4YMSA 4DUGA 5TDHA 3CRKC 1P5ZB 1Z22A 1PHJA 3CX8A 2VP6A 4LPSA 3AEVA 3OIWA 4XH9B 4BFVA 2O8FB 3HOZG 1EOVA 4HYYA 3NEMA 1HNWL 1II0A 3I4OA 4L5SA 3SDZA 1RFLA 3SHFA 3WXMA 5F9FA 2ZRDA 1GWNA 2I1QA 2IS2A 2Q0HA 2H5EA 4GOPA 2JA1A 4PG3A 5JCZA 5GADC 1F6BA 5JHGB 2Y0SG 3QXCA 4B35A 5FPKA 1N6OA 4XIGS 4GKKL 4P4SB 4C30A 4KCGA 2CMKA 3PJRA 4J0QA 3E1SA 3IO5A 2DWOA 1KI6A 4P72A 2VA8A 1TWHH 3G0HA 2I0QA 5G40A 4IO9A 1NRJB 1P7CA 2CHQA 4ABYA 2YVUA 2WICA 5FBVB 2R2AA 2FZ4A 2EQSA 1Y1WG 2P6RA 4H02A 4V0ME 5IP7G 3A37A 4NBSA 1UEBA 1YIJA 1QJOA 2EJMA 2ZE5A 3UANA 3BK7A 3FE2A 5AR1A 1GRQA 2YWGA 2KBNA 1ZD1A 1G3IA 3QNUA 1LABA 3FKIG 5HE8A 4U00A 2IS6A 4Q19A 2HEIA 5FFMA 4DDWA 3AP1A 5JI2E 1WBDA 1CKOA 2BDOA 4YC7A 1VG8A 4NB3A 1OYWA 2WWGA 1RRCA 3MLEA 2PMDA 2ZEJA 2Y8EA 1VQDA 3CMAA 4JZKA 3F2DA 2R65A 2ZAMA 3H0GH 2ZREA 3NIBA 1YNNC 1FR3A 3TW8B 3LRPA 1EFWA 4MYTA 2ANCA 4JKIA 4P4TA 4Q01A 2ZSEA 3RWOA 1CSPA 4FI3C 4UXIA 4P74A 1DARA 1JALA 1NNEA 3PCRB 1BMFA 3CF6R 3QJYA 2A5GA 3RSLA 2E2IH 5HTKA 3FWYA 3FFBA 4BFZA 2A5FA 3MAAC 2RKOA 4RCNA 2FGJA 3GD7A 3A8TA 1G3MA 2ZTSA 3HU3A 3KKPA 4H1UA 4DUZL 3LVQE 3V4FA 4CEJB 4NXMQ 2NTYC 3NHBA 3KJGA 4JKYA 1JEDA 2A6EC 2J7PD 2XTMA 4AIIA 3CXCA 4AYBG 2EVBA 2BWJA 2F1JA 3FMOB 4QBIA 4B33A 2B3GA 1KIMA 3U6KA 3BXZA 2D7CA 2OFXA 2BBTA 1LACA 3W8NA 1VQPA 3J80c 4KHPL 1Z06A 3R8FA 2O8DA 1WOCA 2JA5H 1IONA 3ZGXA 2BMEA 4UPAA 3QIAA 1HNXL 1Z0IA 3PO2G 2AD1A 3THYB 1ZU4A 3B7GA 5IK2D 1U8AA 3UMRA 4N3NA 3W1BA 3ICEA 4Q7JB 1NE3A 2IYWA 3VR3A 2C5LA 1CJTC 2W2XA 2GN5A 1PH9A 1IXRC 3L43A 1NY4A 2ZR9A 4PZYA 2IYYA 3IKJA 3CW2C 4BY7H 1WCV1 3EC1A 4CYMA 1CF4A 1N32L 5FUWA 5KU1A 4OONA 2GHIA 2QQEA 4OHZA 4TQUS 4LW1A 5GAEC 5G3ZA 2K50A 4W7SA 2KA7A 1NMGA 4BASA 3LVRE 5C4XH 4LJ8A 3JAMi 1MO3A 1DAMA 1XEWX 4AH6A 1S1CA 1NIJA 4YCVA 3PIPA 4DNRB 4DR1Q 4EDHA 2VHCA 1E9AA 2OFWA 1OT3A 5LD2B 4OXPA 1JR3E 2RF4A 2ONKA 4KI0A 3KLRA 1EFHA 2IYUA 3E5HA 3MJHA 3RVBA 3TQCA 1SROA 2WV9A 3ZVRA 3UPUA 4DR7L 1OIVA 1N25A 1XEFA 2XTIA 2B8GA 2BVNA 2DFLA 2JJ1A 4KKSA 3BFVA 5J4LA 2YKGA 4C4PA 4UNRA 2HIVA 4GKJQ 1YZTA 4A3MG 1ZCAA 2BBOA 2GCOB 2V6IA 3UDFA 4A9AA 3TUZC 1KXLA 2DNCA 5AWFC 4OBEA 3LX8A 3BB3A 1EG7A 1XJVA 2GF9A 2P5TB 2A5DA 2WP8J 2AUJD 2VP4A 3S15H 3HKSA 4A76A 4GKKQ 1M1KC 3KJEA 4PHFA 4MNOA 5J4HA 4LFCQ 4DLXA 4O0MA 3KQHA 3M7NA 2CL7X 5M04A 2B7BA 2PMZE 2K5NA 4JVNA 1NVVR 3U4VA 2B21A 4WJ4A 2UKDA 5HCNA 5E7IA 2CFMA 4OWTB 5C4JH 3BWDD 2WJGA 4UXJA 1S72A 1ZYUA 4DV6L 1KD1C 1ZIPA 1Z0FA 4US0R 2F1MA 1WXQA 3VKHA 1G8PA 3OPOA 1RRGA 2QMHA 2OLKA 5EP1A 3OZXA 1RYFA 3OFND 1WYDA 1CS4C 4PMWA 1KTVA 1UBCA 4G7HC 3PG5A 4P0TA 1TQDA 2NPFA 3VU9B 1US8A 5JCPA 4KKTA 1IXSB 4L5RC 1N6RA 5FBWB 2QG6A 1U5KA 3S17H 4LJZC 2VYFA 4MITA 3KB1A 4DV7Q 3O47A 2C98A 4JL8A 3TLXA 2O0JA 4LHYA 2FA9A 3UXMA 5KNBA 2PCJA 1MO6A 1VHLA 1PMRA 3T06B 1IBML 2VP5A 2PQAA 2RHSB 2ZYWX 3D8BA 4R4TA 2MSCB 4M53A 4ERNA 1J7KA 1Z2AA 5FBLB 4PZ6A 3K9HA 3PEWA 3DOEA 1BS1A 5DISB 4DLYA 5GAGC 1ZYRC 3IILA 3HOVG 4HAYA 4P33A 5EZ5A 5HGQA 1PH8A 5AUQA 3UE1A 1PV4A 3LNNA 2DR3A 2IYXA 1BO6A 4DV5L 1H8HD 2ZR0A 3AGQA 1R8QA 4HZUB 5FUVA 5JJIA 2D3WA 1SVWA 1Z07A 4XVQA 1LYLA 5M3MG 5FPTA 1HT1E 1SKQA 4LV5B 1XMVA 1NI3A 4CDGA 1U99A 3K9NA 2VSFA 1H8EA 3MXNB 3H86A 3DL0A 2JLQA 4A8JC 4IDQA 5KSZA 2DPXA 3TSOA 4OQFA 2JDID 3NC1C 2IHEA 3GLFE 1BDOA 1QVRA 1D2NA 3QF4B 5BQ5A 4URVR 1P2TA 3CBQA 2ATWA 4U5XA 4DV5Q 3LQQA 1YZUA 3W3AA 1JJGA 1KO4A 4LC1A 2W00A 4OQLA 3A1VA 1EK0A 4PR0A 2FWRA 3BC1A 1JJVA 5KNCA 4A3FG 5LDDC 4FWIB 2OTJA 1MO5A 3IUYA 1VKJA 4C0QC 4IEIA 4KYIB 3T1QA 1L1OA 3C5CA 4PTLA 3HGBA 1KI1A 4DDTA 3J7A5 4F93B 5JEAG 2IW3A 3A58B 4F38A 1W2GA 3ZDQA 3ZQ6A 3L0IB 3WYFA 1H9RA 4O2DA 2QQ0A 4JYBA 2G1JA 3LBNA 2WIBA 1EESA 3L8ZA 4KN4C 1JAIA 3GJ8A 2I4IA 4D81A 5FTLA 2WFWA 2FSHA 3RRYA 5E95A 3QVUA 3CR8A 3ZLJA 1ZAKA 5D3MB 1P72A 3T5GA 4LFBL 1GNPA 2ID0A 3RN2A 2D2FA 3SR0A 4YY3Q 1Z0KA 4XD7A 4IJHA 3AVTA 3CCLA 2NOAA 1IBKL 3U3KA 4WZAE 4AWXA 1RPZA 4EAQA 2XGJA 4RCZA 2AR7A 3ZH9B 1R5OA 2A6HC 1KC8C 1MT0A 1OHHD 2JLZA 1ZC4A 3FMCA 4YMWA 4NPSA 4G0NA 2WPDD 4PO9A 1OSNA 3SC3A 1OHHA 4LFAL 4NU0A 3VKWA 4LY6A 2TMKA 1G4AE 2G0NA 5BR8Q 1OIXA 3KQKA 1GSIA 3AV0B 1FZQA 1SFOH 2IXFA 3RS4A 4AKIA 1TEXA 4TYQA 1B23P 4V03A 2GAOA 1KK2A 2YJTD 4LBYA 4P4UA 4TL9A 3WRXC 1GG2A 1A63A 3I56A 2VY3A 4JI7Q 1SGWA 1G8HA 5AJ3L 3GTKH 4Q1FA 2CE2X 3S16H 1T8UA 1EFRD 4NCNA 1KO5A 1NVVQ 2OCBA 2ERYA 1KI6B 1TL7C 3EPHA 4MRNA 4DJTA 2VUMG 4Q18A 3REGA 4NYIR 2VQFL 1HEIA 4JSYA 3NTUA 2ZE8A 5FUYA 3I4MG 3EW9A 1G16A 1OXVA 3HPQA 4X64L 3IEVA 4GP6A 3P32A 2V8OA 1NY5A 4POAA 1NP6A 1V43A 2HT1A 1E9DA 1LB1B 1UEJA 2XNSA 2CBZA 2ZTEA 1XD2B 4WA7A 1GD7A 2PZGA 4QJ3A 2JLWA 2A19A 4R2HA 4WXPA 1II8A 2V1CC 4LUVA 4RY2A 2F43A 3AUXA 1G5TA 2QNRA 3ZQJA 1E1TA 2QL6A 1FJGQ 4NYIQ 4JI3Q 1W3SA 1XRJA 2GXSA 2OAP1 2F3IA 2QMUA 1A0IA 3RAPR 5DGXA 5CK5A 2KCMA 4X8LA 1YKSA 4CIDA 3EQLC 4QQBX 1G7SA 3SYLA 4DV4L 1H8ED 5JBQA 1E2QA 1KKMA 3D3QA 1TXYA 1E2ZA 1RL2A 4OHXA 2AMCB 5BW8A 2VP2A 1GKIA 1GKUB 5ELNA 1LS1A 1NIPA 2XJ9A 2ZSAA 3B6EA 4ZKEA 1XNQQ 1KHTA 1XPOA 1E9FA 1ZW6A 2E2HH 2A9KA 4TL6A 2V6JA 4DR5L 4B3TQ 3A7LA 4BUJA 1R6BX 2R7ZG 4RZXA 1GITA 5FOVA 3ADBA 3PR1A 2GKSA 4KFTA 4B3TL 3VR6A 2CLSA 5JMTA 3KDSE 2P6UA 1O87A 3U7FB 1G8GA 4MRPA 2A1AA 2O8CB 2RGCA 3Q85A 3SU8A 1XXHE 2GJ9A 3I2ZA 2BH2A 4H44C 1U8ZA 2ZYUX 4ZCMA 4A8JB 5BYKA 5BN4A 1BVSA 5IY0A 1AZSC 3AKYA 4K46A 1E9RA 4JL5A 4KSCA 4R4IA 5IP9H 3E70C 3DMNA 2XITA 3I8SA 3WP0A 1HTWA 5JEAJ 4JV5Q 5IYBG 4OO1I 2FPLA 1E2GA 3M6AA 1TQ4A 1XNQL 2JLSA 2ZM5A 1FPMA 2QENA 3FTQA 4IFDJ 1MIUA 4GPTA 3GLFA 5J47A 3AF0A 2C96A 2I5MX 3PO2H 4LK2A 2VQSA 3ERSX 1W0JD 4DUYQ 3J81j 4F7WA 1NVUQ 5EP3A 2N3SA 1PH6A 1XBTA 3K0EA 3OFNA 2A6ED 3R9WA 4GRAA 1LM0A 1TWCH 4UNQA 3FGNA 3MUFA 4X8HA 1JT8A 1IJEA 4IDOA 1G7CA 4B74A 4IJLA 2GXUA 2Q3FA 2IUUA 3FOZA 1CSQA 5FOUA 5HZKA 3K70D 2EJGC 1P61B 3QPVA 1YHAA 2HCBA 4X62Q 1Y1WH 4GNXA 2NO7A 1E2JA 2FFQA 4TLCA 3U9SA 3R7WA 3W6OA 1VQ4A 4J15A 4NMMA 1PH3A 4BLTA 2OTLA 2F55A 1G19A 2A30A 4U02A 1E1QD 4A93H 2R6GA 2OWOA 5JS7A 2QM8A 2BIFA 3HOUG 5FL7D 3TJZA 2DYKA 4FW9A 3DXJC 4DAMA 1TUIA 4IEEA 4JIMA 3KFXA 4OQNA 1M2OB 4L5QA 3CC4A 3PF5A 2IYZA 4FCTA 4HATA 5EE1A 5TB5A 1BBUA 4R7ZA 2PNRC 4G01B 4A4DA 4FMCB 4DT1A 4LUOA 2O8BA 3T1TA 4OHYA 2IL1A 1SULA 2FFHA 2K5UA 4Q02A 4TYWA 4AKGA 3PENA 1X3SA 3CCSA 2WAXA 3LNCA 1JXOA 4BFXA 2W2TA 1F2TB 1CUKA 1Z3IX 4G1UC 3T51B 5LMNL 3T53B 2JJ1D 4M22A 3QF7A 1X56A 5FI1B 3IQWA 3SBDA 3X1ZA 2ZYTX 2K14A 2JA8G 3HOYH 3BH0A 3CWZA 4R71A 2D2EA 1CKMA 1XPUA 2GZDA 3WYAA 1OKKA 1QHYA 1SZPA 5BWMA 4D26A 4AYXA 1O7IA 3TRZA 3TVTA 1Q46A 3I61A 4GN5A 1VQ8A 4ZDWA 2AN9A 1IY1A 2QE7D 2C2HA 1P6XA 1X86B 4DK1A 1X3FA 3PO3G 1IBMQ 2YTYA 4H9GA 5HPYB 3JC66 2REXB 4TN1A 1DD2A 4BA1I 4LF9L 1E6CA 4RKEA 3EZ6A 2GJ8A 5GVRA 1ZMXA 5LMNQ 2W0SA 3A1TA 3VX4A 1PZNA 4PZ8A 4GN3B 4ZIRB 3KXIA 4CZ2A 1RVDA 1UKEA 3OW2A 4BLQA 3W34A 2GEDA 3W1GA 5LD2C 4WZ6A 1RJ9B 5IK2A 2CJWB 3OIYA 3WNBA 4B32A 2LXJA 1OLOA 4HJ8A 1VCIA 5M5XH 1YI2A 2VNUD 1XEXA 2A2ZA 4KODA 1G5RA 5KDDA 4CGZA 1CR1A 3IHWA 3W5IA 2FG5A 1U2RA 3D4RA 5JSZA 4A3LH 4DCUA 3VA7A 1FFHA 1XP8A 1WI5A 4XVRA 5CJPA 5E3HA 2JEAI 4IDPA 4C3HH 1XXHB 4LYAA 1PH5A 3GQBA 3EPKA 2PT7A 3VHLB 2F6RA 2E76C 1N8RC 2J7PA 1KZ7B 1IAQA 4KFUA 5M5YH 1R5BA 4C0BA 4ESVA 2NVTH 4LYFA 2P3SA 3A4LA 1ODFA 1YJWA 3THXA 2OCEA 1NMFA 2EFEB 1YHQA 2ZUCA 4Q1CA 1JBKA 3B78A 3IIMA 1L8QA 1OFTA 3WMGA 5TXGA 1E4VA 5H1SE 2K7VA 2ZJQA 1BMFD 1E2MA 2F9MA 4NCJA 3C16C 4LX0A 1LUZA 2VS1A 2CVHA 3U4QB 1G4UR 1FYCA 4MKFA 1N5KA 2WM9B 4GMDA 5DNYB 4HJAA 1FGUA 1Q3HA 1WA5A 1Z0AA 5B64A 2Q9AA 3U2QA 5JLJA 3VNVA 2X1VA 1TEVA 2L0XA 3AH8A 4QJ4A 2Z5FA 3HOXH 4UP8A 5C3EH 2ZJRA 2WHXA 3QBVA 4UJ5A 1DO2A 4DR1L 2OCAA 3DDCA 4IW3B 2IUSA 1I3QH 1VIAA 4HB0A 3LX5A 2N78A 2JA5G 1I50H 2Z83A 3B6YA 2WKQA 2IX0A 2IYVA 4QL3A 1KIXA 1Q1ZA 4L9WA 2ZYVX 3RC8A 3L2PA 1OFIA 3HU1A 4B3XA 3GFTA 4P32A 3LXRA 3GLHE 1IBKQ 4MDFA 2MO0A 1AZTA 1GUNA 3GTPH 3EZ9A 3WWVA 3LV8A 2IYRA 2ORWA 3MCAA 3DPUA 2D5DA 1KMHA 1ASZA 2WSMA 2ZQ5A 3A36A 4FCWA 3OTOQ 1YHNA 1T8TA 1OE0A 2AFIE 3LO5A 5FTMA 3TBKA 4JG2A 2GF0A 1QHIA 1UEIA 4LSGA 5E7JA 4BZXA 2C78A 4R1JA 1E22A 1KO8A 4XVUA 2WBLC 5CM9C 4UY8C 1GZSA 4E09A 2C04A 4TSFA 2EFDB 2VHJA 4DV6Q 3RLNA 1WBBA 2W58A 4MGZR 5HZHA 4JSTA 4Y7NH 4Q47A 2UUCL 1AQUA 2A8VA 2WMOB 5F2EA 3KKOA 1D2EA 1Z0JA 5KYKA 2R62A 4Y0AA 3K53A 1UWVA 2QAGA 4PANA 4TYPA 1Z6HA 3RS7A 1GUAA 1Q22A 3I4NH 2QSYA 1T91A 5BN3A 3DKPA 1IL2A 4L5TA 1G7TA 1KI3A 3W6PA 2ZI4A 1WRBA 2X2EA 2YOFA 2LMCB 1XEWY 2IT1A 1Q21A 2V4ZA 3K81C 3DVLA 2ZTCA 4DUGD 3TQYA 1ESNA 3TW4A 1PYSB 3DM5A 2DB3A 3K80C 4TT3D 3TMKA 2K75A 4DV7L 1VIYA 4URYR 1Q44A 1CTQA 4BPBA 1XU4A 3WRYC 3I4LA 4YWMA 1G6HA 2PX0A 1KDRA 4EJSC 1I4TD 1YZKA 4TMXA 1EYGA 3KTAA 1DAKA 1SLJA 3SI7A 2P65A 2XXAA 1FJGL 3Q3JB 4YHHL 1NG9A 4DR6Q 1D5CA 1KK1A 1ZCBA 2HCJB 2HJGA 2P67A 3K7AH 3JVVA 4R4QA 4NYMQ 4O2RA 5TV2A 4ZDIA 1KSHA 3PIOA 1PLLA 2OLJA 2QU8A 5EE9A 2V7QA 1W36D 1CRQA 1X8KA 1P2SA 2H7VA 3BH6A 5JEEA 2EFHB 1LF0A 1N33L 1SVKA 2EJFC 1Z6XA 5CB6A 3QEJA 1EIFA 1IYUA 3U7EB 4GNXC 5EZ6B 4DEYA 1GUTA 1NL3A 2FFBA 4E07A 2FEOA 3TEHB 4RFSB 3OEHA 4M1YA 1VQMA 1HQCA 1VF7A 1R5NA 1T4GA 1P9RA 1CULC 1ZNWA 4IFDH 4DR5Q 2BCGY 2RAPA 4MTNA 2YV5A 3WBJA 3G71A 1D9ZA 1TWFH 1E3PA 4P3YA 3TK1A 1HCZA 3THWB 4YHHQ 4XTCS 1T0HB 3ZJYA 2AKYA 2BE5D 1I4LD 2BEKA 1MABB 1KDOA 2IXGA 4G5GA 5EQTA 5FR2A 1C4OA 5L3QA 1PUIA 3ZVMA 3QXJA 2P2LA 4GFDA 4HIOA 4P73A 1MO4A 3GLIA 2YOHA 4QGAA 4RD6A 2ZU0C 3AB9A 3G48A 2UXDQ 1NJGA 2K33A 2FMXA 4LHWA 1JXMA 4MRSA 1ZUHA 4F92B 2ZJYA 2PEYA 4IFDG 2QORA 5H1YA 1H9JA 2Q2HA 4PQYA 3R7WB 2UXBQ 1HA3A 1SKYE 2UZIR 3B1YA 4L15A 1X6OA 2ZITA 4RG1A 2VPPA 1L1OC 3ASYA 5M3MH 2QRNA 2ZJOA 4JS0A 1QG4A 3ZS9A 1D6JA 1UKZA 1X3EA 2OT3B 3KB2A 1YZNA 5J4YA 1UFQA 2G0TA 2CLDX 1VQ7A 1YU9A 2Q9CA 4OJQA 3AFPA 1YBYA 3CCEA 1FP6A 4LBZA 4G3XA 3H15A 1HE1C 1X1SA 4CEIB 3TQFA 1P75A 2ZUBA 2J59A 1AGPA 4MYHA 3K70C 5JFGA 1A2BA 2ZI3A 2YTVA 2BMDA 1HPCA 1VQ9A 1C0AA 3STBC 4ALPA 2A69C 1QHGA 2EYQA 3T15A 1OXSC 2O5IC 1S2MA 2ODWA 3E2IA 3M9BA 2JIZA 1RW4A 2PJZA 2WKRA 3Q7QA 4M1WA 5H68A 4ZI2A 2Y0SE 4HAXA 2QEXA 5FTKA 1SXJD 3TVDA 4POFA 2J7KA 3CIOA 4LI0A 4YONB 2MFIA 1KK0A 5KOYA 1P9WA 2CVFA 3K0CC 2EQBA 3UIEA 4TKOB 4DV1Q 4HSEA 4YY3L 3T61A 5CK4A 3DEFA 4B3RQ 4O25A 1A4RA 1ONBA 2W6JA 1BYUA 3BU2A 1CXZA 1YNJC 5AJ3Q 4HJ9A 2IYTA 2N8NA 2XEXA 2ZRMA 3EC2A 4TLDA 4GS3A 3MXUA 2BEJA 4DCVA 3S14H 1E4YA 1YR8A 1FW6A 1K0RA 4O2LA 2VRWA 4PC6A 3S2HH 4URXR 5IYBH 4XSGA 1VCNA 2C9YA 2JA9A 1AN0A 1I2MA 4RZUA 2UUBQ 3FDIA 3ZYCA 1NJIC 1OW3B 1D8LA 5BR8L 1RIPA 4GP7A 5KPDA 4US1R 4ASUA 5J3BA 3FMIA 4LF6L 4II7A 1II8B 1Y63A 3R8CA 4JT2A 5KPJA 4L5BA 2FGKA 3F3YA 4DLUA 1E2PA 4BRWA 3W9YA 2VP9A 5K36H 4AYBE 1QRAA 2AUKA 4QIWE 4B3SQ 3VR5A 4JI4L 2G1KA 4V0KA 3LAWA 3SFZA 5GQOA 3ZS8A 3VR4A 3CONA 1W2BA 1UADA 1HJPA 4LJ4A 3C4JA 3ADKA 3S1NH 1XTKA 2ZE7A 1XX6A 5BN5A 2OBMA 4GT1A 1U0LA 2CKZB 2DFKB 1G1MA 3AFQA 3IHLA 3DHWC 4FD2A 4MYCA 2GESA 2HQLA 3TR5A 4EPVA 4ZKDA 1G41A 3K7UC 3T1YL 2YYZA 1KO7A 4UP9A 4RD2A 4DSNA 2QSZA 3ASZA 4AKHA 2JATA 3FHTA 3QKUA 3MSXA 3THXB 4YMVA 2J0QA 2WWIA 1YITA 2RMKA 3ZIAD 1AQYA 2JXMB 2I1VB 3KJIA 3I4MH 5FPYA 4KO8A 2EWVA 4BBSH 4JT4A 2VH5R 1K5DA 1S1MA 1ZVQA 1PJRA 1E2NA 3CKLA 3GO5A 3EZFA 3MGCA 4JBJA 1DS6A 1YQTA 4JLDA 4QY7A 3TUJC 1I5FA 3NBYC 1U9IC 1P9NA 4MA4A 1N6PA 1TU4A 1NF3A 4HZIA 1TADA 1Z83A 4BRUA 5TMPA 1Q20A 1YZQA 2CCGA 4I1VA 3BIFA 3F2BA 1E69A 4QM7A 2N49A 3FMFA 4M1MA 4Z1MD 1E79A 2OE2A 1Q86C 3U44A 5B30A 4A3LG 2BA0A 4Q5IA 2UUAQ 2HLDA 2KB0A 3SN6A 2GWHA 2VL7A 5DI3B 5CITA 3LBHA 2GEUA 1COWA 5A35A 4BY1G 3UDIA 5CDFE 4ZCLA 4M8NE 3VAAA 1Q0UA 1KI4A 3C5HA 4PX9A 4TMWA 2E8GA 1JJ7A 3QOFA 5DH9A 1HH4A 5SZIA 2FSIA 4EPWA 2AX4A 1Z08A 2IF2A 3OAAA 4PXAA 3AKDA 1GNRA 1XTRA 1MABA 3L0SA 1VQNA 1I2DA 3NE5B 1OFHA 3QSYA 2ES2A 1E2LA 3WNDA 3OF5A 1WE2A 4V0NA 2YZ2A 4PSKA 3VMFA 2BKUA 1UPTA 3EX7C 2D06A 2GCOA 3NG1A 4OQXA 1CKNA 5DIFA 4NONA 1ZRHA 1EXMA 1GNQA 1KI9A 1GVPA 2RHQB 3PXGA 3KQNA 2D0PA 5ELOA 5AJVB 4IRUB 4DR3L 2KWIA 3IBYA 3CW2A 1OH7A 3K0FB 2A68C 3G82C 4OI2A 4DR2L 1BKDR 1ZP6A 3M3YH 2YTXA 1VQLA 1JPNA 4PAOA 1SMYC 4Q4HB 5HE9A 1T5IA 1EGAA 2AL7A 4EPXA 5LBIA 1Y14B 1YJ9A 1JPJA 3ND9A 3BD9A 4WW0A 4JI7L 4XSHA 5KTYA 3LW8A 4Q21A 5HCIA 1FL0A 2G83A 4DLZA 4N1AA 1S9DA 2AKAB 1Y8NB 4YCUA 4PC2A 4ME3A 1RYHA 2R93H 2Q2IA 2R6CA 1SRUA 3TSZA 4JLPA 2EIFA 2BM0A 2QP3A 2RHDA 2WOJA 3FPPA 4A3GH 2C8VA 2QROA 3HDTA 5EE3A 5IP7H 5JJKA 2P6NA 4BEBA 3ZZUA 2NO6A 5FLMG 1YE8A 4TYNA 4W5JA 1R0ZA 2W6ID 3QVVA 4LF6Q 2ORVA 4A93G 3CX6A 1N2CE 2DY1A 3DKVA 5KO2A 1K8AC 1DAEA 1JNYA 1KJWA 1V9PA 1W36C 1II9A 1E2FA 4DIDA 2KI5A 2R7DA 2H92A 3EXAA 3QF4A 2D4HA 3GTJH 1VQFA 1E9CA 3OE7D 3QKSB 5J40A 3O8DA 4BFSA 3CZQA 1H65A 1NBMD 4C0HA 3TRFA 2REBA 1E1RD 3HOVH 1XWIA 1YVCA 3CCJA 1EWHA 1Z28A 1QDEA 1W5TA 2F1IA 3IPYA 5FL3A 2O8EA 3GLGA 2K4KA 2ZSFA 4MGKR 5BYJA 1Q3TA 1DOAA 2CK3A 4MRRA 1S3SA 4AQYL 3QPWA 3I62A 3T1YQ 1E2HA 3Q8XB 4LWZA 2HUPA 3HOWG 4YXWD 1LW7A 5J4KA 1PLJA 1NN3A 2P5SA 2WAYA 2ZRAA 3B8HA 3I73A 3TIFA 2ASBA 4URUR 4DUZQ 3U3MA 1MOZA 3GLIB 1GRRA 1ZUIA 4D4MA 2NO1A 4PPQA 4EQ5A 2G9NA 1EWQA 1SVOA 5L3QB 5C4MA 3VNUA 1YR6A 4JI8Q 4YCWA 4BEJA 2J0UA 1SVSA 2CK3D 5JWRA 1PH2A 3C41J 1VECA 1SXJC 2PLRA 5FUXA 2E5LQ 2WSSD 3Q5EA 3R9IA 4PPFA 1XCGB 1T3HA 2GCNA 1NN0A 4JI1L 2QN6A 2Z0SA 2AHOA 2YHSA 3RRZA 1KMQA 3NKVA 4NCKA 1NBMA 3KKMA 1N0WA 2F52A 1QVCA 2OBLA 3C14C 1HNZL 1K8GA 1ZM7A 4HEJA 1BIFA 1F5NA 3EIEA 3UMFA 2W83A 3RR5A 4OX9Q 4Y52H 3AKEA 5M5WH 4G5QA 1S8FA 4LBVA 4UKDA 2FSGA 3A4MA 4C9BA 1SXJB 1NY6A 2WOOA 4IXMA 1N6LA 1IW7C 1VQOA 5HY6A 2W6IA 4JI8L 3GLIE 1G17A 1NG1A 2GBLA 2SHKA 3MJRA 3QI2A 4QOSA 4RSGA 1FX0B 1ZUNB 4LHZA 1DE0A 1C9OA 4GZMA 2JLUA 4PHHA 4QFMA 2NZHA 1X1RA 4KU4A 4M9SA 3PV0A 2CLCX 5H8WA 5M3FG 2YC2C 3SJZA 3TAUA 4B44A 1P2UA 4LJ7A 1ZD8A 3NH9A 1HNZQ 3FVQA 3JVUA 4AYWA 1G9XA 4NP6A 3RRMA 3OIVA 3G5UA 421PA 4R98A 2BJVA 1N6NA 1FVIA 5E7NA 4GLAC 1FNMA 5CLLA 3NXSA 3IFTA 5C3EG 5JEDA 4M1SA 1E0KA 1GP2A 3E0EA 1UE5A 2WB1G 5FJ8H 4GKJL 4MKIA 3EPJA 4OL0A 3S1QH 1KJYA 5FR1A 4JYAQ 2VBCA 2ZJZA 1QZHA 4HDOB 3HFZB 3PSIA 2QAGB 4QHSA 5CJ2A 3H0KA 3VU9A 2WZQA 3FKQA 3CPFA 1EQRA 2BDTA 4CEIA 4Q1BA 5JEAH 4IOMA 2F1HA 1JE5A 4JVSB 5AUOB 3I7FA 4LC0A 1IBRA 3PUYA 2HF9A 3HWSA 4WXRA 1E3MA 5L3SB 4V02A 2OBNA 3RLFA 5FOSA 1KNXA 2O0KA 1ZNZA 5GJVC 4H1VA 2WJIA 3HKZG 4PPGA 3HOWH 2XB2A 1U0HC 3H2YA 2QGZA 4GSYA 4QG7A 3RS0A 1R9TH 3OAAD 3NHAA 1DELA 1U8YA 4DLSA 3ND8A 4B3MQ 2QUZA 3CPHA 4NYJQ 2IK8A 4LF9Q 1N36Q 2OZEA 3CPEA 1Z5ZA 2J3EA 1ZM9A 1COWD 1XMQL 1K73C 3CRVA 1VQAA 2NZOA 3A74A 4QJFA 1N36L 4DNTB 2R6DA 1KL9A 4BFTA 3PEUA 4LJ6A 2N42A 4CEHB 3SEAA 1ZINA 1QHHA 5JHHB 3OYYA 2XZLA 2R6FA 2RGEA 4D6PA 4Z1MA 1CBUA 4PSAA 3U58A 3B82A 4TLEA 3C15C 2E75C 2C9CA 1U90A 2PL3A 2RGNA 3B9QA 3RABA 3KKQA 3NEJA 4IOJA 5EUQB 1GUGA 4JLNA 2FPKA 4KHPQ 1VQGA 3K9LA 4ITRC 3L0PA 4OQMA 1YHBA 3HOXG 1XMOQ 2ATXA 1M7BA 2RH5A 1SHKA 3K8YA 4IOKA 1W4CA 3I5XA 3A6PC 4BY7G 2F3TA 4HZUA 1FMLA 2GJSA 3ZIAA 1PA6A 4C0AC 2Q2UA 4HUTA 1F3OA 1B9NA 2JA6H 3GLGE 4QGHA 3PO3H 2O5JC 2DWPA 1HZAA 4F4JA 1W48A 2QPTA 1KSFX 4DIEA 1DXMA 2AWNA 2I3BA 2CQOA 1QVGA 1ANKA 1C9KA 4IQZA 2NN6H 2IXEA 3QKSA 3QXSA 2YC4C 4HUQA 4EFLA 3NVAA 5IYCH 2ZRNA 3UG7A 4CT5A 2Z4RA 1HNXQ 5C4GB 1KO1A 4JI1Q 4RZ2A 2GDJA 2WWFA 3CF2A 2QMOA 1H9MA 3QEOA 1YZLA 4IVQA 3RS2A 4A0HA 2GBLC 2WWHA 4HDQB 1I6VC 2MO1A 4TQAA 1W4RA 3A1SA 4I1SA 2G6BA 3LLMA 4B6EA 1KZGB 1ZM3A 4E22A 4EPYA 2MSEB 5KUTA 3M1IA 5LB2A 3DLLA 3CH5A 2VQEL 3N2IA 3SQXA 2CEAA 2KCCA 2LSSA 2AFHE 1VQBA 4UP7A 1IBLL 2ZJBA 5EXXA 3KF6B 2OCYC 1G5PA 1J70A 4QHTA 4A3IG 3MFYA 4Q9IA 1KOFA 4ASUD 5JRZA 3UDXA 2BC9A 3NEYA 3LD9A 4TQ9A 3KQLA 2W0MA 5C0XH 4NCIA 3RC3A 1B7YB 4A3GG 2OXRA 2K52A 4QNRA 4IPGA 5DYIA 1KKLA 3HP1A 3U7HB 5FLMH 5JI3E 4URWR 5C2JB 3L7ZC 4DR2Q 2W6JD 4DR7Q 1G6OA 4NDZA 2BA1A 2OV2A 1Y8PB 4F4CA 3K0FA 1VF5C 4IFDI 2Z43A 3FFAA 4I1UA 2GVAA 1A2KC 1E98A 2CDNA 2ZRBA 4IDHA 4NH0A 4DWJA 2IS4A 3LBIA 4R4CA 4B3SL 2JA8H 3REFA 4DV1L 1SXJA 4BGDA 1VQCA 2K5HA 2MQHA 5K8IA 4RMFA 2B92A 1G8FA 1TKWB 2PX3A 3ECCA 4KLKA 5B2ZA 5CB8A 1EUJA 1X3GA 1OH5A 2RGDA 1JQLB 4A3DH 3QUSA 3S1RH 4A3BG 1E2DA 121PA 1XD8A 3LLUA 4FMDF 2JEBI 3AGPA 4JI0Q 4ILEA 1KJZA 3N5CA 2BJWA 1TAGA 4HLCA 1XCMA 2RGNC 3GP8A 5C0XG 4DSTA 2A69D 4P71A 1UJ2A 2DBYA 3VR1A 2JA6G 3KXLA 4B34A 5AUNB 3KFUA 1OIWA 4PO8A 1U0JA 2UXCL 4DLTA 4C7OB 1XTSA 1W44A 3H1TA 1GVNB 3C7KA 4DCNA 1E94E 3ONWA 1UKYA 2YWEA 2ZS7A 4IFEA 1Q7YC 2CNWA 4M1TA 3X1YA 3AM1A 2R7ZH 1JI0A 2F1RA 2HV8A 2PJRA 3S24A 1G64A 4FWTA 1S96A 2JQOA 4DV2L 2QPAA 4MYUA 2ZXUA 1T3LA 4IPHA 4IFBA 5EXSA 1VS0A 2KENA 1X9NA 3WYGA 3Q72A 4QBHA 2C95A 1TUEA 4ZDJA 1I94Q 1L2FA 2CJWA 2B8TA 3DZDA 5KDOA 1VHTA 4HAVA 4LJYA 3BBPA 4HIKA 4AQYQ 3RNLA 5FBRB 1A5TA 1VQHA 1RRPA 2WMNB 3AVUA 2AD5A 3GLGB 3OIUA 1N34Q 1EWIA 2EFCB 3SGIA 4RKFA 4FMCF 5E4FA 2ZSBA 4N0DA 3CF0A 2YOGA 2ATVA 2NQ2C 3A1UA 5EUMA 3UKDA 2VF7A 1NLZA 4MQBA 3EPLA 4A3KH 1IN8A 1OJLA 1AS3A 2R6AA 2O5VA 4M1KA 5D3MA 1VMAA 3OOCA 4G7OC 4PPNA 5C4XG 4TMKA 1SE8A 2IX1A 2NZ8A 1Q90A 2AKWB 4HLQB 5D3QA 3EARA 1AK2A 4KV9A 1G6PA 2GEVA 3NBFA 4OKSA 1N6KA 4D4KA 1CFMA 1DCZA 4P75A 1AS0A 4L9SA 1PYBA 2ZVPX 3GFPA 4HI0E 1XZPA 2C03A 4M9ZA 5AJZA 4JV5L 1MJCA 1HQMC 1R7RA 2JJ2D 3KF6A 4WZBE 3J81k 4LF7L 3B85A 4LK1C 1Q1EA 3U3JA 4YQFA 3GTOH 3KJOA 5FPSA 4DK3C 5IDVA 2KBEA 3WNCA 3ZD6A 4B75A 4B2LA 1E2WA 4LNQA 1EFCA 2J41A 3P26A 4RFVA 3M4QA 3RSOA 1TU2B 3WY9A 4NPHA 1NBWA 1DAHA 3PUXA 2F4VL 3U44B 3FYHA 2H18A 4RD0A 5B57C 5IE8A 1EQQA 4JI2L 2ZI9A 4FMDB 3A8KE 1U81A 2DWQA 1YR9A 2NO0A 1E9BA 1XF9A 4LJAA 5A0FA 3VTKA 3AYHB 4TTQA 3SFVA 3GTMH 1Q1QA 2FEMA 1R2QA 1HR0L 4TMTA 4APVA 4L16A 2GAAA 3IPXA 1KI8A 3CX7A 1T5LA 2VLIA 1FUUA 2BMFA 3K8AA 4JL6A 3RN5A 5FOXA 2JLVA 4BBRH 2ZRFA 5DN6D 4JLOA 3DZ8A 4A2PA 4OO1H 2XNDD 4TVAB 2FDCA 2WJVA 1LTQA 1M8PA 4TT3A 3GMTA 3GJXC 3B1ZA 1H9SA 2UUAL 4PC7A 4B2IA 4ARZB 2JCSA 1IZ6A 3GTGH 2V3CC 4DT1B 2VUMH 1BH2A 4GDFA 4LFAQ 1AM4D 3FHOA 1VCMA 1UBEA 3EIQA 1U98A 4POGA 2KCTA 2D74A 1M1YE 2R9VA 2JK8A 3QQ5A 4JLMA 1Q82C 4JLJA 5CLQA 4JYAL 2WJJA 3BERA 2ONJA 2ZI5A 4UNSA 3FKIH 4X62L 3M85A 3C8UA 1W4BA 2IHYA 1D2MA 1JQJC 2LXKA 4K81B 4HB3A 4C3IH 2VF8A 4TSFD 4YLGA 3LY5A 4MUAA 1G291 4RVCA 2BE5C 2XTNA 3CPWA 4LCBA 4ACBA 1G8YA 5EE0A 5KSYA 4L8JA 1EX6A 1W0KA 821PA 3QG1A 2HJVA 2IYSA 1TX4B 3MMPA 4D25A 3KJHA 1W46A 1ONLA 5A4JA 4KVAA 2B6HA 2FFAA 1SXJE 1B70B 4A3JH 3X1WA 5KSOA 4OWWB 2PCFB 2B7CA 3P27A 3BZKA 2QA4A 1GILA 3OEED 1N0VC 4BZPA 1PFSA 2G88A 3CZPA 2XTZA 4EIWA 1HQYE 2ZRPA 4LF4L 1P3JA 1QVFA 1MR3F 3UATA 2HIXA 3K1JA 3B2EA 1K8OA 1IHUA 3MD0A 2JEOA 2ZRLA 2QAGC 4NYMR 2LCFA 2FXQA 1XXHA 1GL9B 2D7DA 2QTFA 4UQOA 4DC9A 4DV0L 1WJJA 4GLXA 1KY3A 2QEQA 4LGMA 1TTTA 1UDXA 3FPAA 1O3YA 1XCPA 1RZ3A 4A3JG 1LY1A 1XJ0A 4G5OA 1WP9A 1OF1A 1IYJB 3UK6A 3W5JA 4BE7B 2FF7A 1ZM4A 2HHHL 1U9IA 3EN2A 2ZROA 5CYPA 4HAUA 1KRTA 1N9WA 1AE2A 1B9MA 1UBFA 1LTLA 1MKYA 2PZEA 1R0WA 2WWXA 3B5JA 4HLUA 3ADCA 4ON9A 1W36B 5FOWA 3GDEA 1HNWQ 2PLFA 4PFSA 4EUNA 2QM7A 1Z8FA 1MV5A 4X8MA 4NE2A 4X8OA 4AKEA 5IYDG 2H1LA 2CWPA 1SMXA 4X65Q 4D80A 4KMUC 4KHZA 5JS8A 3AF2A 5DE3A 3F1ZA 3LQRA 3F0TA 4X65L 1J8YF 4KJZA 2IEYA 4MZ9A 4KFRA 3W6NA 2CL0X 1T5EA 1JMCA 4LJ9A 2EYUA 4KLZA 3V00A 3ZZ0A 3VDYA 3I1FA 3K0CA 4LHVA 2IX3A 4D82A 1AA9A 1GFIA 2HHHQ 5CIQA 1P60A 3M4PA 4Q03A 1KNQA 2UU9L 2A6HD 4JOIA 2VEDA 3HYTA 4Q4AB 1TWGH 1CP2A 4JBWA 4DUYL 4XJXA 1F2TA 5CM8B 2ANBA 2GJKA 1W5SA 3EG5A 2FN4A 3TR0A 1VQ5A 1S3OA 1ZM2A 3OHMA 3AKCA 4TWZA 2I5HA 1IN7A 1AKYA 4GMXA 4NL4H 1CRPA 1BBWA 3B1VA 2AHOB 4EQ6B 3VQTA 4JI5Q 2QE7A 1ETUA 3QKTA 4Z51A 1YRAA 5M3FH 1JR3A 2H16A 1IN6A 3EZ2A 4JI5L 4DLRA 2BH8A 1AGRA 2QRZA 4V0OA 1OKKD 2ECKA 2Q8IB 4PAQA 3EWAA 2JA7H 1YJ5A 2MSDB 1JR3D 2R93G 2OFOA 5KNDA 2R8RA 3TSWA 3WHLA 4DLVA 4XWOA 2QTHA 3KLWA 1H9SB 2IHFA 4D0LB 4JMPA 1P16A 2HF8A 2DFNA 3WDNA 1N5JA 3IIKA 4M21A 2N46A 4OI0A 3BG3A 1IM2A 3PGZA 1S40A 3QENA 1VQIA 3LGJA 3AP2A 4JVMA 3I55A 1E9SA 2YWFA 3OW7A 2WWYA 3U4ZA 1GKYA 5FI0B 3AF1A 4UNNA 3X2SA 2VO1A 1LFDB 1SVMA 4QBFA 3W3ZB 4DEXA 5KHOC 1E9EA 5SZHB 4F91B 3KZ1E 3I3SR 5GADl 3QKRB 5FL7A 2A5JA 1Z9FA 1E24A 2ZUDA 2QF7A 3LWNA 1E1QA 3UDGA 1GM5A 5AJWA 5F3WB 2O0HA 4JCVE 4JLVA 4DR3Q 1US8B 4U7DA 3B60A 2JLYA 3JZMA 1F2UB 1A82A 1KAOA 4W5HA 3O8BA 3CF5A 2AK3A 3P4YA 1A1VA 3AB3A 1IN5A 2JA7G 4JBXA 3A5UA 3O8RA 5DYGA 2OM2A 3GEHA 4IVRA 3RHFA 3VFDA 1LNZA 3CRMA 4IKEA 5IHPA 4QGUA 1XMQQ 2V54A 1VQEA 3AVVA 1VG1A 2IS1A 4QHYA 1X55A 1P8LA 4LF5L 1JB7A 2LKCA 1E1OA 1W0JA 4Q1EA 1R10A 2NVQH 4AI6A 2R92H 3FB4A 3K09C 3VKGA 4A3MH 4MKHA 1XNRQ 1N32Q 5A5GA 3ZD7A 4GN4B 1UAAA 3SZRA 5G53C 1SHZA 4LPKA 1G3RA 4TL8A 4B76A 2ZJAA 3NELA 1G20E 2E9SA 2AXPA 2GK7A 3EZ7A 4LDJA 4XWAA 4R9UC 3THOA 4B6FA 3KXKA 2B8FA 2EFGA 4MH0R 2ZM6Q 2FH5B 4RFSA 1OB2A 4FMBB 2N1BA 2WWWA 1IXZA 3BORA 4PHTA 5L3RA 4PO1A 1NLYA 3EBEA 1ELOA 4M9XA 3RZDH 1HTPA 1XMOL 1Z6TA 1OB5A 1RJ9A 2F3RA 4IXNA 1ZBDA 3KUDA 1QHXA 3OEEA 3T1OA 2HYDA 4LV8B 1CU1A 3JAMc 4S35A 4DSUA 4LF7Q 4L8GA 3BZCA 3KJPA 5J4VA 1WQ1R 1VCOA 1T3SA 4WOPA 4FN5A 3T5DA 4OHVA 5C0XI 3KDFA 1W49A 4Q1DA 1W0KD 4W5WA 3THYA 2E5LL 2A68D 1ZNXA 2EWWA 1N3BA 1VYVA 4BFYA 1Y1VH 2ALYB 2K5VA 721PA 2H57A 2X77A 4WIAA 1JR6A 4QGFA 1N5LA 3A0JA 3BJUA 5JRJA 3CNNA 1OH8A 2OCPA 3Q5DA 3CC7A 3KF8B 3S2DH 4HR7B 3NBHB 1A6XA 3PCOB 2VQEQ 2UU9Q 1HT2E 2GVZC 2PCLA 5JECA 4HDCA 5E7MA 3TGPA 3O8CA 1IOZA 1YZGA 4GI7A 4A6PA 3CC2A 4BXXG 3U7GA 4Q4LA 1KHIA 2JJ8A 1GHKA 2XX3A 2EDGA 5FOTA 1VG0B 1FQKA 2FSFA 3LA6A 2MNAA 3LH5A 3F8TA 5GAHC 2CE7A 2O52A
chains in the Genus database with same CATH superfamily
1EK5A 1JZQA 5CDGA 1U9JA 2AC7A 3GJ7A 1RLMA 2JFOA 1RXVA 3E0JA 4KJNA 1OX6A 4D98A 4DFAA 4U2FA 3V4RA 2WAQE 3O21A 3L49A 3NENA 1FJXA 3R3JA 1R4MA 4QUDA 2XLCA 2BFOA 3TQOA 5FUBA 1RM3A 3OEYA 5JCJA 4MTKA 1Z6AA 1YMVA 4UHVA 1TWAB 1TMKA 1XYYA 1Q7TA 2P9ZA 2WYOA 3GCGA 3KHTA 2X2FA 3N2KB 3PHIA 4RETA 1SVLA 4F3KA 1YJQA 3OURA 4RD4A 4WEQA 1W4ZA 1ZU5A 5DHFA 4EY3A 1E0DA 4KITB 1UKBA 2O05A 3T38A 3T34A 4C0KA 3MZ5A 2XVMA 4JI1B 3LTNC 3KDAA 3EA4A 5H9VA 1F14A 4N0EA 4B3TB 4WBNA 1W88A 1YB6A 1DV2A 5KHLB 4AUEA 3QH4A 1QHSA 3MUEA 4KUHA 3HYRA 1Y9JA 5A0VA 5BW4A 1AKEA 1SYDA 2REOA 1ZXTA 1E2BA 1JHDA 5JXJA 2YJ3A 3FBWA 1DUVG 4RNCA 4BDTA 1H2BA 4WESB 1EQVA 1HQDA 4PLHA 4ZU1X 2WDZA 3RSSA 2QD1A 2EYJA 2E5LB 1UAGA 3F4KA 4Q9HA 2BGMA 3OJXA 3LUDA 5AKKA 2LDBA 1KS9A 2OG2A 1ZXBA 3GFBA 2AC4A 2J1LA 2OHVA 4JJZA 3TQRA 1QRUA 4BX9A 5IBCA 1E58A 4MDYA 3SX4A 2Q9BA 4E7PA 2WFMA 4OQPA 1BZYA 1K83B 3ZBUA 3FHWA 3EIHA 3QPUA 2GUGA 1W1WA 3AVOA 3D0RA 5TJHA 1D8TA 2A0YA 3GXOA 4HEA6 2A5YB 3T9DA 3A5ZB 1Q81C 1Z39A 1WCIB 1ZC3A 1YVUA 1W581 3KJQA 3HEJA 1NASA 4Q4JB 5LQSA 3WP1B 4D0NA 5TLSA 3ZD8A 3PTZA 3ZVLA 1N34L 2GN9A 4HAOA 3S2IA 4DJFC 5JY6A 1IXRA 1SNCA 4COKA 1DG3A 4A3EG 3QWAA 3WV5A 3FDJA 3MEFA 1KI2A 1LRLA 1SBBB 2ZM6L 2G9VA 3S1MH 4Z0PA 5LQDA 5HP4A 1DKMA 3WWEA 4PV1C 1B00A 3K4QA 1L6RA 5AK6A 4JBHA 4F8MA 3M7GA 3HPRA 4Q6BA 1FFEA 2IUTA 4MO9A 5J5VA 2R8OA 4AJLA 4CTNA 4AURA 3TRIA 3U3MA 2HMWA 3GPLA 4A0FA 1GAJA 4FI3F 2ERCA 3KLSX 3BD8A 4D43A 1F9SA 3C3KA 1PWYE 1RRFA 2LXNA 1OXMA 1LBQA 1JSRA 1RWVA 1Y5LA 4OK5A 2QPLA 3K0AB 4WK0B 1FX0A 3ST7A 5JRDS 3CWQA 3QEKA 2AQ3B 1OLSA 5IJ0B 2BGWA 5KNCH 2I91A 1E2KA 1L7EA 4OXXA 3K1AA 4UU7A 4ND8A 3RHTA 1MJ5A 2X7HA 2FZGA 4RAUC 2YU9H 4QTYA 1U9CA 2VTVA 5SYAA 1DAGA 4IV0A 1I6HH 2P2DA 2VHTA 2ZATA 4FILA 4WCVA 2ZQYA 5F35A 4ZT5A 1WCMB 5LMUL 1BHO1 1C3OB 1HLDA 3SR1A 3AVPA 2J07A 1XTQA 3PR2B 4JGGA 1WZEA 5DHQA 3ECSA 1QZZA 3BL8A 4AG5A 3G6EA 1YHYA 1AG9A 3RS9A 4DQUA 3EGEA 2Z4TA 3IVCA 5BRNA 1H5QA 3PUWA 1JSLA 1RCUA 2P75A 4KY7A 1NKSA 5AJUA 3DF9A 1YBVA 4KK4A 1X7GA 2ORIA 4TWIA 3UQZA 3QM1A 2IEIA 3PTLA 3RFXA 1JAHA 2L15A 1X38A 4J6HA 1LDBA 3CE9A 4QUFA 3DHQA 1ZPDA 4OSOA 5GROA 1H0HA 3A1CA 3QPCA 2BM9A 2QRPA 4CLOA 3H9EO 4NOJA 1IKMA 1N9GA 5A04A 1XUOA 2K32A 5COAA 2V55B 3MPUA 3NYRA 3DMTC 3JX9A 3KCNA 4PQGA 4XM0A 1I36A 3SEZA 2FZCA 1YNND 2VTDA 3N1UA 2FU5C 1T8PA 2EYPA 2FQQA 1NMZA 1TKAA 3C45A 4UAUA 3WAKA 1SC4A 2W2VA 1GKHA 3CTPA 4JBGA 1T9HA 1VL2A 3J81k 3EVEA 3CD6A 4WK4B 6Q21A 2IZ1A 1C9JA 2GD6A 1Z33A 1QF9A 1KFCB 1TYAE 2P11A 3DE5X 4RHYA 5TGTA 5IAOA 1ECPA 2Z0MA 1Q57A 2FE4A 3AEUB 5FUVA 2VJLA 2QRQA 3FSGD 4FOLA 3AR2A 3I5YA 4OWXB 5THQA 4E70A 3PD1A 4B7XA 1MB2A 3T7TA 3EA5A 3G8DA 4V0BA 2C5GA 5H81A 4BZZA 2J9XB 3WFJA 4DV3L 1S6YA 4RTMA 4TMYA 2R7MA 3DVAA 1DC8A 1C7FA 5C44G 3CP0A 3HDGA 3FHCB 5FA8A 5LQNA 4H3KB 3ZKWB 3DLBA 2VDOB 1UC8A 1N92A 1X65A 2G63A 1AIPA 1EGHA 3F2CA 2H1VA 2W93A 4X6AH 3OJCA 4I4LA 2E1RA 2PHZA 3A1FA 2RBMA 3VVBA 3VSAA 5H4GA 1OTCA 3C7AA 2VIIA 4F4UA 5F9HA 1C7RA 4PLGA 1O78A 3EIXA 3IEXA 3IBGA 1Z2NX 4HGQA 1XTIA 1SNYA 1QZ3A 4PG8A 1M83A 1T43A 3GP5A 3MTGA 3P9SA 4RVFA 3H9BA 5EE5B 3TAHA 4AP5A 4NXNB 3VZPA 4X7MA 1F4VA 1BEUB 4YWKA 4HJXA 4OJKA 4ETMA 6YASA 4Q48A 2NUAA 1K3RA 2V1XA 1VTKA 4IDAA 5GJCA 1C9YA 2CXXA 4XRRA 5AM1A 1Z5NA 3LUFA 1Y6FA 3OT1B 2HF2A 3WWDA 2C99A 4NMXB 3RU2A 2H7CA 4K2AA 4EPRA 2W11A 4LYHA 1LV7A 4GMKA 1A9PA 5EMKA 1RADA 2B2YA 2C5EA 2ZRGA 3FNFA 2CN1A 1YC5A 4RJLA 1UL1X 1CR4A 2OUIA 4BJHB 1XR3A 1I33A 2WYVA 1UC5B 4ODGA 1WD0A 1H2EA 3H94A 1Z7WA 1S2NA 1B2LA 2F43B 2F9LA 2UZ3A 1EYCA 2CCZA 3COVA 1NPDA 4NMLA 1CKNB 3PBKA 4O59O 4HUQB 1OLXB 5FBZA 5IG2A 4XWTA 3PQ8A 2FMIA 2GZAA 2X5NA 1DQPA 2XLBA 1O9BA 3AESA 2HW8A 3E0QA 2WMDA 4II3A 1AUPA 3L40A 1COZA 1O8BA 4NSNA 1HNXB 4DR5B 4EX5A 3EIOA 2PMEA 1CR0A 1JJFA 1P1KA 2Q6LA 5FV7A 3FCCA 4JK1C 5IUJC 2Z2IA 1YQ9A 2JAXA 1VQ6A 1JYSA 5KSPA 4BHTA 2X8JB 1EBUA 1EFVA 2FPRA 2ZJ6A 1W85A 1Z4LA 3DT8A 3IT1A 3UGTA 4AN4A 2N0SA 4N8FA 2CW5A 3J7ZC 2H4XA 2ODNA 2PBFA 3K0BA 4DJDC 2PEZA 4ARVA 5G3YA 4D2IA 3ZLTA 2HK7A 2SNIE 4J8PA 4J9UE 4OO1G 3HSKA 2VT7A 4O3MA 3BS4A 1XYGA 1KSGA 3OLZA 2GQ0A 3N7TA 4OK6A 4Z49A 3P45A 3QLVC 3DFKA 2YRWA 3WGQA 3RRNA 2WSYB 3PU6A 1C3EA 3T12A 3QKIA 3E8XA 4YJFB 3HBFA 4R1QA 3VHQA 1H4QA 1H95A 1UBTS 2FQXA 2C2ZA 2JIRA 1UQTA 4KBGA 8GPBA 1Z13A 4Z7JA 1PTJC 1B0PA 2J6HA 3G3EA 4B5KA 2GBFA 1T8WA 3RJTA 3QBTA 3GLHA 2GPBA 2NU6A 4I1OA 4R51A 4WZAB 4WCFC 3MWLA 4PLZA 2D2XA 1YRBA 3LPDA 4UMDA 3BSSA 3U40A 4KY5A 3EODA 4H31A 4AM8A 3CCUA 1KAGA 2ZUWA 2YV3A 4LUCA 1RDPD 1DQYA 4ARUA 2YJGA 3Q3IA 3F5QA 3IP9A 5KWVA 3SJAA 1XPRA 4UEKA 2CT8A 1XNQB 3QOJA 3K5MA 4TTTS 1XL0A 1R9NA 2ATCA 1FP7A 2IVZA 2Y6UA 3HJTA 3L4BC 4RD3A 3ZE2B 1LQ2A 4KR3A 3DCYA 3H75A 1T2UA 2QW1A 1RNLA 3OCYA 3TB4A 4GLJA 1GUSA 1TQ6A 2D62A 3S1QB 1XNRL 1J0BA 4LI3X 2LTAA 2RHWA 2A84A 4PZ0A 2ACEA 5BVHA 3U5ZB 4HQOA 5EYPB 2AYYA 3GFSA 3T5AA 3M4YA 3L1UA 3QK7A 3RZOH 1NNI1 3IEUA 3PWSA 4UBJA 3EOZA 3WMWA 3V5NA 2CH4A 4BBRG 2HDNB 4BGIA 3OQNA 2Z8XA 1ZAYA 1B8NA 5EYPA 1EAMA 3PF9A 3LW7A 1VBKA 1VSQA 3OSUA 2IUEA 2VHXA 2YH2A 3CNHA 1EFPA 3UEOA 4ZIRA 5KJ6A 1VLLA 4NABA 1WTWA 3KQTA 2B35A 3KFVA 4PZ7A 3BZBA 3Q8DA 5DEOA 4DK6C 1GR1A 1LLUA 3MT0A 2OPBA 5FAXA 1SR3A 2MUYA 3IBCA 3MGKA 5I9BA 3RNUA 1OXTA 1DVRA 3HJNA 1HR0W 1ZVKA 2GVNA 4GZ3A 1G21E 1SUCA 4E5KA 5K5EA 3K32A 4UUPA 3RYFA 3BGSA 1I3KA 2GVDC 1RM5A 2XW6A 2UXDL 3BFXA 2GCGA 3C8ZA 4HJ7A 3DCIA 2PKXA 4E5UA 4F87A 4IHJB 1QGAA 3S81A 4GOPC 4ZLTF 2DCUA 3KSRA 1H2FA 4DCJA 4EZEA 2ZRCA 2B29A 4X62B 1NUHA 1T1GA 1WF3A 5TVKA 5BUSA 3ULJA 4OGLA 3TLCA 5HOEA 4NCHA 2AI1A 3W2TA 3COZA 1DC6A 3B1WA 5BUZA 2NVYH 1JEQB 3JWJA 2PRZA 4NBWA 3ZX5A 2BOVA 4LF4Q 1CB0A 4AJ2A 4L2IB 2R3SA 4ID9A 1IBLQ 5DWVA 1T2AA 2PWBA 2HCRA 1QNLA 3OX3A 1PUXA 3L7JA 2QDXA 4GR5A 1EB9A 4ERXA 1SB8A 4N5HX 2E89A 2CWWA 4L8YA 5EZYB 3CLHA 1WVLA 1QIGA 1R50A 1JSXA 2V9ZA 1NT2A 3E1KA 3UYKA 4ICIA 4ZMSA 4LRUA 4CIAA 1XZEA 4P82A 2Z6KC 2B34A 2I34A 3U1BA 2VSOA 3CMMA 4W1SA 4X66L 2Z9DA 4F46A 4A8JA 3GQVA 5AJXA 1DBWA 4KMOA 2ZIUB 3OQIB 5FPHA 1DTEA 4XTRA 1VQKA 3KFLA 4Y2SA 3ZU6A 3BMCB 5UKDA 1XYVA 2IWRA 3AU9A 1BCSB 1H5NA 3CM0A 4HQNA 1IH8A 5CR3A 5J22A 3N59A 3UMSA 2YIVX 5IEBA 5LWHA 2IWHA 5T3UA 4Y6SA 3UWSA 2GSDA 3ER0A 2PPBC 2PA3A 3GTQH 4JC0A 4O0AA 1H3FA 1TQ2A 1Z25A 2XHZA 3O4GA 4LKOA 5TEVA 4KR7A 1CJUC 1NGSA 1FP4A 4J0HA 4F4IA 4MB6A 1WW8A 3B13B 1IQ0A 1UUPA 1CNFA 4ZJPA 1QE5A 3QWIA 3U61B 2NVXH 1CSEE 1CEEA 1GTJ1 4CV0A 1E8MA 2B63G 3H5RA 4H18A 4R1LA 2VHUA 3CRLC 2J9ZB 3JD2A 3R74A 1HKUA 1KYXA 1D5ZC 4B46A 1EIWA 2Y77A 4IGFA 3CEHA 1RAIA 4NOMA 2CSUA 3VBEA 3SIXA 3HJAA 3OHSX 4CVNA 4GECA 2EIXA 4HQ0A 3QQPA 1SOMA 3UK1A 5HJ7A 1NVXQ 4HXYA 1KYIA 3H3VH 3B1XA 5IJ9B 2F62A 2NIPA 2ZAOA 4UMEA 3F6EX 2LNDA 4FDAA 4OMDA 1U3CA 2EXZA 1JHAA 2V7WA 3IBFA 3FZYA 4JENA 4X1OA 3DDWA 2WUVA 1Y5NA 2P6PA 3CR7A 4V24A 4X1KB 1S5CD 3GT3A 1UKAA 2PT5A 1TAUA 2OG1A 1RQ7A 2WD8A 1E79D 4KSBA 5JPCA 1SD1A 2XBUA 2NU8A 3I0ZA 5H0IA 1MGPA 1LUAA 2KSQA 1GPLA 4LVCA 1CRZA 3DVAB 4G09A 1QLJA 4W63A 4FB4A 2R8BA 4PHGA 5U9CA 3VO8A 1FUKA 3ZIUA 1CTMA 1Z47A 1O8CA 2XRYA 2BGJA 1XX8A 3O38A 4UBNA 5EP2A 1BDBA 2KHIA 2LCIA 1M6NA 1EJ0A 4AJKA 2COUA 5CNIA 1HURA 5E9WA 5EERA 2IZ6A 5LB4A 3RJ9A 4EF4A 2WAAA 4NJMB 1Q7GA 1SIBE 1VKHA 1E5VA 4FVTA 4YMTA 1AJEA 3U4QA 2VA9A 2YXDA 4IILA 1B8VA 3R20A 4OQZA 3R3ZA 1N5MA 1NLFA 3AMUA 1LK7A 1T0PA 2EX1A 2H1WA 5AXAA 1XU9A 1ZH0A 2ZPTX 1HDEA 3HG9A 3GPIA 2R0QC 3NAGA 3S1AB 4JI0L 1CS0B 3TI9A 5IGDA 1XTCD 1G0NA 2D54A 4DIOA 1XWWA 1QFZA 3R9XB 4WFIA 2APJA 5ECDA 5KTMA 3ES9A 2PIDA 3FN4A 1U3UA 3NQIA 1YFKA 4X24A 3AT1A 1HK7A 1CVLA 1T10A 4BWYA 5CIWA 2QXTA 2QX6A 4U7TB 5KX5B 1MV8A 2HXYA 1GDHA 5DEHA 1V3TA 1K98A 1YRWA 3PYLA 4UMFA 2VRNA 4ZO6A 5CB4B 2PUEA 2R7FA 1R0XA 3USZA 4EO7A 5B3KA 2W42A 1XNJA 2PVSA 1SN8A 4ZKBB 1N1MA 3T1HL 1XZQA 3BB4A 3NTVA 4EG1A 4JUCA 1O5TA 4QCLA 3SSAA 1RAGA 3SIPA 3CCRA 1GO3E 2F3SA 1F8UA 4B47A 1ICFB 3DAGA 3F9CA 3R7FA 4LOLA 3AJ8A 2BI8A 1S3IA 3KOOA 1DC5A 4DM7A 1DAPA 2L42A 3UWKA 1V9CA 1L1FA 1WTQA 2OB1A 2ZJ2A 2ZRHA 1PJCA 3LUPA 2Q7OE 4KLNA 2XGTA 4TMZA 3KDFB 3IUPA 4XVHA 5LMNW 3KQOA 5DK6A 1K2VN 3EASA 1GQYA 2QY9A 3H8VA 1CB7A 3NUQA 4X66B 3T5PA 2OO3A 4KKUA 1EIYB 4NYJR 3G88A 1CE8B 4IHQA 5JXGA 1STHA 1MX1A 1JR0D 3DPIA 3GUHA 4S2UA 1U5AA 2R92G 1W6RA 3CX4A 4PWZA 4Q7QA 1KEUA 3NGXA 3EXEA 1HL3A 2GB4A 3WIEA 1NJFA 5LKRA 2VJKA 3T7SA 4DB4A 1ADGA 2R5WA 3NBXX 4U673 3A06A 4I3HA 3IP1A 3TKLA 3NOOA 4F9EA 1ZYRD 1F0PA 4K8JA 1XC7A 5J5CA 5EJ6A 3HCAA 5BSGA 2VHWA 2C88A 3UXHA 2Q4DA 4TN5A 2W7TA 3L41A 2IU6A 3JWIA 3K5LA 4BAZA 1H85A 1MC8A 1K89A 3HMQA 4AZVA 4CQLA 5HGJA 5HURA 3ULPA 1IDOA 3MQFA 1DEKA 3SNHA 2WQ7A 1D1KA 1NSTA 2GXAA 3JQ6A 4MW4A 3OY7A 3AU8A 1QZUA 3PITA 1IZYA 1VB3A 4H16A 1U5BA 3X2FA 2SECE 4ZVUA 4CXMA 1UDWA 1R0YA 2VB2X 3A1WA 4IDNA 5I9OA 1XVAA 5EHGA 4Q66C 5IGBA 3GAFA 2VPWA 3CNLA 1POWA 3PE4A 4LIPD 4Q7KA 4CGYA 1R6DA 2OGZA 2ZBEA 3EZLA 2BYTA 1GPWB 1L8LA 4G0WA 2UVPB 1RI3A 3AEZA 2ODEA 3ZE6A 4DCTA 1B1ZA 1KABA 1BBXC 1G7RA 2B37A 4OV6B 5KWEA 1KIAA 1MAVA 3OZFA 4QE3A 1NMYA 1MHTA 2SEBD 4NTZA 3ZR4B 2P91A 4ZOEA 1L1QA 2HPVA 1JAYA 2RCNA 1O94A 4IPDA 5F5LA 3KOJA 4LRQA 4MWDA 1Y3AA 2IHBA 4IS2A 2C5CA 5CV4A 1FDTA 1P31A 2IEGA 2VL6A 3IAM6 4B3GA 3S15B 4I8IA 1O7LA 2X8LA 2DFVA 1FMJA 4NZYA 4CEHA 3ADPA 4YS6A 1PW7A 3KQHA 4J1NA 1HQRD 4FKMA 1VG9B 5CFNA 1EFTA 4DV4Q 1GYRA 4M9QA 4NXNQ 4HB2A 3W5SA 1SD2A 4LV6A 3GJ4A 4C7XA 2L69A 1O7ZA 2PDAA 3GLUA 3GQBB 1ESFA 5BSKA 1EHCA 2HRBA 3R9KA 4C7MA 2A94A 4GS5A 2C9ZA 2Z1MA 4B73A 5A4MS 1RWPA 2R84A 4KR0A 2FF5A 2I2FA 2XKAA 1ULTA 3HEMA 1PGOA 3DBOB 4OXRA 5ALEA 3ADDA 1ISHA 3RT9A 4E0BA 1B44D 1DFHA 1RLIA 3RS5A 4P81A 4JW0A 2GMWA 1RLJA 1GOTA 4HFMA 4HWKA 4REMA 3UPTA 1X8LA 1T5HX 2FMUA 2CW0C 4CKCA 2NZWA 4BU0A 1ST2A 1GG8A 1AGXA 1ZBQA 3F3KA 1X94A 3KHKA 4LEIA 3TZUA 1V45E 3HU2A 4PLFA 5FPKA 2ZRKA 3RC2A 1Q3KA 3KX2A 3KR9A 5EJMA 5I7UA 5GV7A 3GHHA 1LT6D 3SVMA 1E7SA 1MBZA 1XZCA 2RARA 2ZRQA 3FUVA 3NTLA 4RZ3A 4AKSA 2DF8A 5JAOA 3CCQA 2ZJ5A 1R4AA 4F9TA 4LFBB 5CBEE 3E9HA 5AXBA 1VM6A 4IGIA 4XWWA 3FJYA 1CRWG 1V41E 3G0BA 3A8IE 4MJXA 4PZEA 2O2LD 2DGYA 1KI7A 1SIOA 2G4LA 2N75A 2OGWA 2OORA 3BGVA 3KKNA 4AD8A 3GFOA 3I9JA 3S8YA 1J24A 3NT2A 3ZDDA 1K0FA 1KY5A 9ABPA 1UZUA 4EL5A 3HZHA