3RLFA

Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
molecule keywords Maltose-binding periplasmic protein
total genus 106
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3rlfA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3rlfA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rlfA01
4JC0A 4U7DA 3DZ8A 1SZPA 2AKWB 4LW1A 2W58A 1U5KA 2R92H 3CCQA 1TF7A 5LPNA 5IY0A 3QE0A 4BRWA 5C44H 4A3LH 4ZIRB 4PQFA 2OV2A 2WSMA 4A2WA 1DS6A 4JYCA 4NE2A 4DB4A 1CR0A 3N70A 5JWOA 4ZO4A 1X3GA 2P3SA 3NVAA 1YRAA 1TEVA 3MAAC 3PVSA 4RD0A 4A93H 3A1UA 3GLIE 4X66Q 1E0KA 5IWAL 3EQLC 4TKOB 4UNPA 1VS0A 3T06B 4F91B 3CRKC 4KKUA 2VRWA 5M5YH 4D0GA 1WI5A 1OSNA 3LAWA 4OHXA 2QPTA 3IRBA 3X1YA 3EW9A 4ZI2A 4TYQA 1Z6GA 4PHTA 1X8JA 2PL3A 4PV1C 2E5LQ 1NBMA 5B58C 4QQBX 4NYIR 5LB2A 1VQ8A 1E3MA 3ZVNA 2XTMA 4YMTA 4TT3A 2PCFB 2XTIA 4A3IH 1GVPA 1IBKL 2CQOA 2RGDA 2PH1A 2W0MA 3AGPA 4FCTA 3S1AB 4AKGA 1A7JA 1II9A 1A1VA 5JEAH 3NENA 1FFHA 3UE0A 3PO2H 3TS2A 4B6FA 4BZQA 5FPTA 1XF9A 4A82A 4JK1C 3AVPA 3HOXH 1VQ9A 1CU1A 2A68D 2ZREA 3L2PA 3JC66 1SKYE 2R8RA 4A8JA 5HZKA 4P74A 3A74A 2ZYUX 4XTRA 1X3FA 2BVNA 2R6FA 3M7NA 4YONB 5C4XG 4BZPA 4C3HH 1UM8A 2KBNA 4LGMA 4TZ6A 1NN0A 2ODEA 3N2IA 2BHRA 2FEOA 1KI2A 5FH9A 4DR7Q 2RGXA 4LUCA 1E1QD 1R0WA 3JVUA 1CIPA 4U02A 4Q9IA 4LF6Q 4A3DH 4DHEA 5LMNL 2UUBQ 5CIWA 3WHKA 1F60A 4X8OA 4QGGA 2IS6A 4YY3Q 4A3MH 3GTKH 1HTWA 1U8YA 2FPKA 3K7UC 4A3GH 3GJ6A 1CJUC 3R9IA 3RHFA 4EAQA 1G6PA 3UATA 3T15A 4B3FX 4JOIC 2FZLA 1XD2A 3CUEF 4DB2A 1U90A 1UJ2A 2A6EC 4POFA 2IYQA 3LQQA 1BMFD 1XMIA 4S2EA 4D81A 5JCZA 4PZZA 1QZXA 2IX1A 3M9BA 1ZKOA 1ZC4A 4IRUB 1K8MA 1NE3A 1VQFA 1S9HA 1R0XA 5FPYA 2VL7A 3AVXA 3BZCA 3CW2C 2OBMA 2J46A 2G88A 3UKDA 5KPJA 1CR2A 2AD5A 1A6XA 4I4LA 3ICQB 1E2HA 3HJNA 2D0PA 3HKZE 2BM0A 4KMUC 1YR8A 2C99A 2HCBA 1YVDA 2ANBA 3KOJA 4AYBE 3ADKA 2K52A 2WPDA 3Q8XB 3PUZA 3RS3A 3TAUA 1XTSA 3T34A 4I1UA 2OLKA 4GN3B 3HDTA 2I5LX 1TL7C 4Q1AA 2IA5A 5EE5B 5IT9c 1Z06A 2C95A 4OYHA 3ECCA 5DISB 3REGA 3EA0A 4JL6A 2D74A 3BJIC 4JI0Q 4MTNA 2K32A 4PSAA 3SJZA 3DOEA 4JYBA 3AVYA 3H94A 2V1CC 3U4VA 2PNRC 4DR3L 2RGNA 2ODBA 4DLTA 5IF9A 4GNXC 1FTSA 4CT4B 2IXEA 1RE0A 2Z0SA 3EWAA 1HUQA 4GN5A 3HR7A 4ITRC 4DLWA 1OB5A 3BRWD 3DPUA 5C44G 4A3LG 4B35A 4BZXA 3H4MA 4CRWB 2XNSA 1RL2A 4KFTA 3U6KA 1I5FA 4LPSA 4QG7A 3B9PA 3RN5A 1OKKD 4FW9A 5GJBA 1HR0W 3NBXX 3PG5A 5J5CA 2ZI7A 2GBLC 2MMGA 3BC1A 3D0FA 4A6XA 5JS8A 1F2TA 2GWHA 4JYAQ 3SNHA 3D4RA 4J15A 1Q1QA 2GHIA 2LKCA 3I4LA 2J3EA 3LX8A 5G53C 2DNEA 4DC9A 1TEXA 1YNJC 2ZM5A 2F7SA 2GK7A 2OCYC 2EJGC 1Q1EA 4Q01A 1D7QA 4DAMA 5IWAQ 1P2VA 1VCOA 5BYJA 4BRUA 4LZZA 4DCTA 1WF3A 1GHJA 4OHYA 4M9ZA 4P72A 2ZRIA 3K0AA 1H9SB 1T91A 2CNWD 4OONA 1GRQA 4JLDA 4X8LA 2GEDA 3CZPA 2G0NA 4Y0VA 1DPFA 1E2DA 2XB4A 4UJ3A 1ZUIA 3THXB 4D26A 1FQJA 1G7RA 3BG3A 2Z0MA 3LA6A 1YNNC 2DWQA 2REOA 4LRWA 5IP7H 2P6UA 2ZJ5A 4A3MG 4DV5Q 3CCEA 3IO5A 2GVAA 3VU9A 4DLVA 5JEDA 5L3QA 3R9WA 2H5XA 4JI5L 1G7CA 4B6EA 4DV4L 3M3YH 1OIWA 2R6GA 4KLKA 1NSFA 2YNMA 4TTPA 4M53A 821PA 4HDQB 1L8QA 2IYVA 3BBPA 1OV4A 2A68C 2I0QA 2D7DA 5H1SE 2FPMA 3VX3A 4AYWA 2V1XA 4LFCQ 5B2ZA 2AHOB 1G3RA 4P71A 1Q3TA 3LD9A 3VR4A 1SVSA 4OQNA 4C3ZA 3FMCA 2IT1A 2DR3A 4DV0Q 1GUTA 4I81A 2GAAA 4LFBL 2QN6A 2A69D 4WZ6A 1NBME 1RIFA 3BD9A 4LC1A 5UKDA 3K80C 3PO2G 2LXJA 1EUJA 4OJQA 1GHKA 2ODNA 4Z1MA 5DYGA 4DR7L 1M1KC 2J45A 1DD2A 3M4YA 1VQBA 3JAMi 1BVSA 3K09A 4LJ4A 1IY2A 3ASZA 4JLJA 4RZUA 4ILEA 4MKGA 4OJKA 3KF6A 2PEYA 5KDOA 3N5CA 1HJPA 1GITA 3U50C 1NTGA 3TZUA 1T3LA 2WOJA 3GLHB 3O8BA 1VYUA 1K5DA 4US1R 4G5OA 5HKKA 2NVXH 3S1RH 2BIFA 2ZUBA 3M6AA 4OBEA 4ZDJA 1XCMA 3UPUA 3PEUA 1R2QA 4LF4Q 2CJWB 5FUXA 1VQDA 3NTUA 5FOUA 1P8LA 4R2HA 3M4PA 3PGZA 4M1WA 4RFSB 4JI6L 3LW8A 3MJHA 2ZRCA 3LH5A 1TU3A 4PZLA 3A8IE 1YIJA 5KSZA 2DB3A 3CPWA 4DV5L 2JLXA 3U7HB 3PIRA 3K1JA 3AGQA 2A9KA 1MABB 4PC1A 4KYUA 2W00A 5LBIA 1HQYE 4X8HA 1NMZA 2GBLA 4YCUA 1XZPA 4RCZA 4A93G 1KHTA 1SGWA 4JCVE 1FL0A 4IVPA 5AJXA 2JLUA 4JI0L 4DDTA 1N6KA 5FOXA 2IS4A 1A82A 3GTJH 1HZBA 3Q85A 3I4OA 4FMDB 5TARA 4A92A 1GL6A 2QEQA 4JT4A 1S3OA 3CX8A 1UE5A 3S1AA 1IBMQ 4DSNA 3RN2A 4ZPXA 4V0LA 2E2JH 4GKKQ 1SQ5A 1Z3IX 2CL6X 2BEJA 1G3MA 3SJAA 2EFGA 2IS2A 3VR1A 1DCZA 4JLKA 5FOWA 3FHWA 421PA 1VQAA 4OI2A 1N0VC 2I1QA 2LKDA 2VW9A 1AA9A 1GTVA 2J9RA 2XJ4A 2BDOA 4B2LA 1XFAA 2SHKA 2ZRGA 2KCCA 2F4VL 2AWNA 3PFIA 4NYIQ 1FW6A 3BFKA 3HR8A 2BMEA 4BWYA 1IQPA 2JXMB 1WBBA 4BECA 3BK7A 4K8OA 2D0OA 3L82B 2B92A 3T1YQ 3ZVRA 4GBMA 1VHLA 2JLYA 2E8GA 5TY0A 2AWOA 1X56A 2G83A 2OCPA 4I1VA 5KDLA 3CW2A 3T1HQ 4HUQB 1OTCA 4JI6Q 2VZAA 1HH4A 1E4YA 2C96A 3P4XA 3PCRB 4AQYL 4HEJA 3ZVMA 2GDJA 4PZYA 4F4CA 3LWUA 2OESA 3P32A 2F43A 5AJZA 1XB2A 5FBRB 5CB8A 1AQUA 2YWGA 4JI2L 2QP4A 3Q5EA 3V9PA 1ZNWA 4RVCA 5J4LA 3KYHC 4GI7A 4POGA 4CDGA 4DUYQ 5JSZB 2QE7D 4DWJA 1D8TA 4MYHA 2QA5A 4WW0A 1NMXA 2VP6A 3IBGA 3T5GA 1TWFH 3PXGA 1OXSC 1N32Q 1KY2A 2DBYA 4ASUD 5HR5A 3GDEA 4OWWB 2IUTA 4DCVA 1RYHA 1YEZA 4K0KQ 1TWGH 4PANA 3DM5A 2ZYVX 2O8BA 4K0KL 1NLZA 2NN6H 2A69C 3HOVH 4DBLC 5HKKD 5AUOB 2QU8A 2DFLA 2WMNB 3THOA 5F98A 3GLHE 3CXCA 3QXSA 5KTYA 1KK0A 2YC4C 4QOSA 1UBCA 2DYKA 4L8JA 3MG9A 4PC3A 4X65Q 1IBLQ 1W1WA 1XMSA 2OFOA 4Q4JB 5FTJA 2O8DB 5K8LA 1SXJC 1TF5A 3QSYA 2GJAA 4WAUA 4AIIA 1NJIC 2PPBC 4C0BA 4IOAA 1C0AA 1G21E 1TADA 4OXPA 4M9QA 4PFSA 1L4UA 2YWEA 1VCIA 4PO1A 3CRLC 1BO6A 4LJ9A 3W90A 2QGZA 1EWIA 1AZSC 4M8NE 4OK5A 4BLRA 1E1RA 1G9XA 4C0QC 3PEYA 2WM9B 1E2JA 1ODFA 2ZI4A 4FXPA 2GF0A 4JZKA 3TSOA 4QRHA 2WZQA 1EGAA 1ZMXA 4LYHA 4I1SA 3TSZA 1SXJE 1CSPA 1TUEA 2FE4A 1OXTA 4A8JB 5L8VA 4LHXA 1AM4D 5GVSA 3T5DA 4GLVB 1KZGB 2A5JA 4JOIA 4IFDG 2QF7A 2XOKA 1PA6A 3GEHA 4LBYA 1UKEA 1JNYA 2PCJA 2QQEA 2GETA 2UKDA 5GAGC 1DAHA 4HI0E 4IDHA 3FHTA 4A36A 1KJYA 1JQLB 4BLPA 2FPLA 4MYTA 1FUUA 2I4IA 4NPSA 1RJ9A 3DMNA 5SZKB 4MDFA 3Q8DA 2C2HA 5FL7A 1XXHB 3EPLA 1GSIA 1AN0A 2ZJYA 4HLCA 1Q44A 1XBTA 4HAWA 1N36L 2HXSA 2XAUA 4P4TA 4RSGA 1OB2A 2GXAA 2AUJD 2JA6H 1IONA 3K0EA 4O0AA 2IY5B 1W5SA 1XWIA 2JA9A 2VQFQ 2XJ9A 2EVWX 4JVMA 3SI7A 3ZIAA 3QENA 4DV2L 1A5TA 1MO5A 1TX4B 4GKKL 2ZE5A 3QXXA 4K46A 3RYTC 3U3JA 2EFHB 4DNTB 1NIPA 2BV3A 2LXKA 4B2PA 4E09A 5F9HA 4LI0A 3BERA 4DZZA 1X54A 3O8RA 2YTYA 5F2EA 2YHSA 1UF9A 3TE6A 1RKBA 3ONWA 4KSBA 1FJGL 1SVMA 1O7IA 3THXA 3STBC 1VQHA 2F1MA 4M1SA 2IWHA 1X8KA 2XXAB 2UZ3A 4RD6A 3AVUA 4JI1L 4TLCA 2EQBA 1ZRHA 2XNDA 5H70A 3I1FA 5GVRA 5KO2A 2NO1A 3RZOH 1KO7A 2PI2A 1X86B 4HIOA 1JJVA 1KI8A 3BIFA 1TQ4A 5GADC 1P61B 3FOZA 2I5MX 2AKAB 1D9XA 2MNAA 2VSXA 2K5UA 4LJZC 3S1QH 2YJTD 4UXJA 1WRBA 3SN6A 4F4JA 1OYWA 1MIUA 4TLEA 4DCSA 4OQXA 5A4JA 1PMRA 3QKUA 2ZS7A 4RFSA 2QMEA 4B2IA 1YZNA 2A7QA 4UXHA 1WCMG 3QUSA 4DR4Q 3W8NA 3R9XA 4GKJL 1ZYRC 3NEYA 121PA 1P7CA 1CTMA 1N2CE 2R7FA 3H0GG 3W6NA 3T1TA 1TU2B 1N32L 3I5XA 4DNRB 4DLZA 2A30A 1XJ0A 3TUJC 1XMOL 2R7ZG 1KSJA 2IX0A 1ZIOA 4JKYA 2OZEA 1EESA 1KXLA 1FX0B 2FSFA 3CR7A 2GNOA 3OAAD 1ZM7A 3KF6B 4YMUA 1HR0Q 1S40A 1Y1WG 1TXYA 1W3SA 1QHXA 4WXPA 4B75A 4P75A 3D3QA 4ZV4A 2WSSD 3M1IA 5FBVB 2Q9CA 3AM1A 1XMJA 2G3YA 4ACAA 2A6HC 3CRW1 2C78A 3GJ8A 3K09C 3A1TA 4GS3A 3UG7A 3FMOB 3X1XA 3K0FA 1EFRD 5GAHC 3SGIA 2IEYA 2X8AA 4Q4AA 5FTMA 3TH5A 1G41A 1M74A 3MWKA 5AUPB 1QHGA 4GOXA 2O5IC 4L8GA 2JATA 2O8EA 2AKYA 4QJ4A 2RGBA 1CULC 3MEFA 4BA2I 2RHSB 1KMQA 2KE5A 4AYBG 1XD9A 5LMUL 1LACA 3ZH9B 1E22A 1XTQA 3W5OA 3FMIA 4DUZL 2JA7G 1E9DA 1II8A 2WSSA 1WA5A 1Y3AA 2ZU6A 2ZJAA 3B82A 3J81k 1LW7A 4EPRA 2A1AA 4L5RC 2F1IA 2ZYTX 5B30A 3DKVA 4Z54A 3LRPA 4DK6C 2ZXUA 5DNYB 1S8FA 2A5YB 2YOFA 4DR2Q 2ZRNA 2PEZA 3QXCA 5FFMA 4QFMA 5FR1A 2BBTA 4KYIB 1G8PA 2HEIA 2ZI9A 3KKNA 1E24A 2VA8A 1IY1A 2B7CA 2QAGC 3OZXA 2G77B 3AF0A 3KKPA 3TBKA 5J4HA 1NG1A 1Q57A 5TVKA 4JT2A 4DDVA 4YCVA 2UXBQ 1FYCA 3E1SA 2FXQA 3IEVA 4UY8C 3HOXG 3R20A 5KOYA 1V1QA 1VQ4A 2CL0X 2WWYA 2JIZD 3U3OA 1DAKA 2GZHA 4DXAA 4HIKA 4HB3A 3FVQA 3A6PC 1GIAA 5DYIA 4DEYA 3BZKA 4DV7L 4X65L 1IBLL 1ZINA 1G6OA 2AXNA 2ODWA 2BH8A 2N42A 4NL4H 3U9SA 4PAQA 1N0UA 2VHUA 3CQZH 2Q3FA 2KCMA 2QG6A 1XNQL 2CCGA 4C7OB 1R0ZA 1ZW6A 3PJRA 3D7MA 3KJHA 2Q6TA 3CRRA 3DM3A 2R62A 4TYNA 2WJGA 4LDJA 1AS2A 2BBWA 1YZQA 1VQOA 2UU9L 3H84A 4W7SA 2P6RA 3VNVA 2XSZD 4EQ6B 2PX0A 1XJVA 3A4LA 3K53A 4HATA 5FBLB 3F2BA 4LF6L 4OI1A 1XU4A 1YJWA 3KJEA 3LQRA 2ZJQA 2P5TB 2W83A 5EP4A 3I3SR 1HH2P 1L4YA 1GUNA 1X6OA 2NZ8A 3EC2A 1E6CA 4KCGA 4A3EH 1NN5A 3CONA 1UKVY 4ZIRA 5EP1A 1QVCA 1U2RA 3OEEA 3A8JE 2I1VB 2WWXA 3T1OA 3GJXC 2D5DA 2K5NA 5IP9H 4R4QA 2OWOA 1T3HA 3HGBA 2ZE6A 3PR1A 4UQOA 2F1HA 4C30A 3UDIA 2BBSA 1E2EA 1QHHA 2CE7A 3I62A 4PHHA 2OM2A 1R8SA 4DV3L 1PH1A 3BB1A 1DE0A 1C9KA 4YWMA 4DR6L 1KIMA 1GWNA 4LY6A 1FNMA 1MRSA 3SZRA 3I4MH 4LCBA 1MKHA 1IN4A 1E9RA 5E7JA 1H9JA 4HAUA 2GXQA 2Q2HA 4TMTA 1I2DA 2GCOA 1V43A 1UE1A 1W36D 2CCJA 2YTXA 2B8TA 1Z9FA 2ZIAA 2AMCB 1L7VC 1C1YA 1KI4A 2BMDA 2CK3D 1AGPA 2QZ4A 3SBDA 4DR5L 1HNXL 1E9BA 1AQYA 1N6NA 5C18A 2EW1A 4RZ2A 4WZBE 1GJXA 2A8VA 4RFVA 5CLLA 4BFSA 1X1SA 2VYFA 3GLGE 4B3MQ 1NIJA 4LJ5A 2ZRAA 1N6OA 5J40A 1PYBA 3EIVA 4PG3A 4DV0L 3LX5A 5F3WB 5M3MH 4A3BG 5IE8A 3DMDA 2D2CC 1SXJD 1FNNA 3D8BA 1KSFX 4B3CA 4D4KA 4IDNA 1P3JA 5SZHB 3DLLA 1Q1BA 2WTUA 4A4DA 1JT8A 2J41A 2JLRA 3K7AH 1ZUHA 1Z8FA 2C77A 2G1KA 1F2UA 4TQUS 2D3WA 2OEPA 4QHYA 4R2IA 3NXSA 4RMFA 1YI2A 1SVOA 5TV2A 2H1LA 2QAGA 2FH5B 2V4ZA 3BH6A 2F6RA 5JZVA 1NP6A 2EQSA 1EYGA 1Z29A 3B1XA 2RHDA 5BQ5A 3GP8A 4QBFA 2ZT9C 5DHAA 2E2HH 5IYDH 2EU8A 2QSYA 5CK5A 5GROA 3KQUA 1LB1B 2OT3B 1W2HA 1E4VA 4MZ9A 3B1WA 2C9YA 4NYJQ 3SOPA 4P0TA 2WAQG 4KITB 1E1TA 1QHIA 2P5SA 3CO5A 1LABA 3UWKA 4YLGA 1G4AE 1NNEA 2REXB 1EX6A 1ZM2A 2GKSA 3L0OA 1V9PA 1G5TA 2WICA 1IN5A 1EIFA 3SU8A 1PH7A 4GRAA 5K8TA 1O78A 4LC0A 4QGFA 3PENA 4H1UA 1IW7D 1II8B 4YDSA 3U61B 1HNWQ 2PZGA 2ZJRA 4OK6A 2IWRA 4HJ7A 3TW8B 4TYYA 3GLFA 3NBHB 1X55A 3JVVA 4Y0AA 2XEXA 1PFSA 3LV8A 3GO5A 4IPDA 2N46A 3AUYA 3SS8A 2PLFA 1G3IA 1H8ED 1Q21A 3SYKA 3BXZA 5M3FG 2JDID 3QPWA 1QRAA 4FDBA 1CFMA 4JKIA 4MGKR 4R98A 3GD7A 3SC3A 3OW7A 1YHAA 3E0EA 1N5JA 2QI9C 2W2TA 4D2IA 1XJQA 2O8EB 5C1BA 2GK6A 1Z2AA 4BLSA 3S17H 4EJSA 3NHAA 5FI0B 2OG2A 4DEXA 3H86A 4GZLA 4TN1A 3EPHA 3PV0A 1GDDA 2A78A 1XTRA 4PSVA 3TVDA 2FJUA 2NO6A 5CIQA 1GAJA 4DLXA 2IK8A 1GNPA 4EJSB 3KF8B 4XWKA 3EIEA 2AXPA 2RMKA 2MFIA 1F2TB 1NL3A 3F5FA 2REBA 4M0LA 4HYYA 1XTIA 3HYTA 2N8NA 5G3ZA 1FX0A 2FX3A 1YVCA 5K36H 2F3TA 3OIUA 3TNFA 4X66L 5JJLA 5CDFE 3EZ7A 4A3DG 4A76A 4EPXA 2W2XA 1A0IA 2B8GA 1NBWA 4YMVA 1QHSA 4F93B 1WB9A 1HNZL 2ZE7A 3NG1A 2ES2A 4HUTA 3ICEA 3RLNA 1OXUA 3U7GA 1PH4A 4BBRG 1JR3D 4HDOB 4BY7G 4URWR 4P33A 3WBKA 5JFGA 3RRZA 2J0UB 5C4XH 2YTVA 3KFUA 4LF5L 1D2EA 1L1OB 4NKRA 1D8LA 4KLNA 1RRFA 2W6JD 1NN1A 1GM5A 4ZCLA 3ZQ6A 1FUKA 4EIWA 4KODA 3ULLA 1ZNZA 5ELNA 3MXUA 4Q4AB 1I94L 4YDHB 2QGQA 3T1VA 3RNLA 3GFTA 3TR5A 1NVVQ 2PZEA 1U0LA 1KJWA 2OLJA 2ZM6L 1E2WA 3J81j 1RJ9B 1J7KA 2JGNA 1HNXQ 4PHGA 3DO6A 2ZM6Q 4A0GA 1CBUA 4LX0A 1Y8NB 1KI3A 2Z5FA 3LBNA 4D4LA 1CKNA 3CPHA 5JWRA 2ZRDA 4HB2A 1SMXA 1S96A 2ZRPA 5JI2E 1TU4A 2GEVA 3CBQA 1HV8A 4BEJA 4A3JH 1IXSB 3FKQA 3DDCA 3QF4B 4NBSA 5DN6A 2BJVA 2FDCA 1N5LA 2UU9Q 3GJ7A 3RWOA 4HJ8A 3GTOH 1GFIA 3UDGA 2AK2A 2JJ8A 2RAPA 3N2EA 5K8UA 3KXIA 4IOCA 1KAGA 4TQ9A 3VFDA 2NZHA 1GKIA 1T5LA 2YC2C 4OI0A 1MABA 1Z6YA 4IEIA 4M2LA 5GJCA 3TSWA 5LDDC 3RS4A 3HPRA 2BMJA 1DAEA 5M3FH 3ULJA 3R8CA 3OESA 4HB0A 3ASYA 1N8RC 1R5NA 2OCAA 3VR5A 2QM8A 3WP1B 4V03A 4F38A 4KI0A 2ORIA 2NPFA 2EFDB 4V0ME 1EQQA 1UE7A 3PCOB 1VHTA 2A6HD 2ZSBA 1GD7A 4Q7LA 2NVYH 3F2CA 5E7NA 4KKTA 2CJWA 4AY2A 2WP8J 4GLXA 3FKSA 4HJ9A 4FN5A 4EFLA 3H0GH 4HR7B 4E22A 2HQLA 3E70C 4QC2A 4UXIA 1E2PA 1EFHA 3TRFA 1IXRA 3A8KE 2QT0A 2WBLC 4P4SB 3SQWA 4OO1H 4TMKA 4BFTA 3R8FA 3B60A 3W3AA 1OH5A 1HA3A 5JRJA 1G17A 5ELXA 1I94Q 2GJ9A 3CPJB 4TLBA 1SVKA 2C8VA 2HCJB 3PEVA 4N0EA 1PUIA 4A15A 1WBDA 1QUQB 3VKGA 1GUAA 2BE5C 4LUZA 2FSIA 8OHMA 1KI1A 3L8ZA 1P5ZB 4A9AA 1VPLA 2CK3A 3RSLA 3CM0A 2ALYB 3GJ0A 3KQNA 3TEHB 2EWVA 4IJMA 1R0YA 4IFBA 1XMQQ 1HZAA 2B6HA 3C16C 4M1MA 1HURA 1W4RA 1R8QA 4QJ3A 4JBXA 3TR0A 3K0XA 3L7ZC 3IBYA 4JI4L 1LUZA 1T9HA 3J80i 2L0XA 1Q86C 3T12A 4QHTA 1TNDA 1H9MA 1SRUA 2OFXA 2J0UA 1JAIA 5HE9A 3X1WA 6Q21A 3DKPA 2F9MA 2E2IH 3KDFB 3MJRA 2AFIE 1J5EQ 3P4YA 4RCYA 2J0QA 3E9IA 5DE3A 1KI6B 1TKWB 3C4JA 4NYJR 3RC3A 1NG9A 2RGNC 4C3IH 3C5HA 4DCNA 1NKSA 2UUBL 5CDFA 1VQ6A 2NO7A 2EXDA 4HLUA 2HJGA 2V6JA 1G20E 1SMYC 4C2MH 4DLRA 1FPMA 1XEWX 1ELOA 3S16H 4QIWE 2FFQA 3K9HA 3CF2A 3JZAA 4N0DA 4HZUA 4R9UC 2CLDX 4WBSA 1GKYA 3ZZ0A 2AK3A 1AJEA 2GJ8A 3U60B 1E69A 1KSHA 4Y52H 2ORVA 4XVRA 4O2LA 1N6RA 3EZ2A 3TUIC 2C03A 1ANKA 4M1KA 3U58A 2NVQH 3LNNA 4AQYQ 4A3EG 1SVLA 3CRQA 3AFPA 4BXXG 1XMVA 4OQFA 3VKHA 1MKYA 1N6HA 1JPNA 4LF8L 1DAMA 2WWHA 3NKVA 4GPTA 1XNJA 1ZM9A 3CCVA 3NC1C 5IP9G 4JV5L 4IOMA 1RC8A 2FGJA 4C0KA 4Q47A 2BCGY 1JJCB 4M1TA 4DUYL 1Y14B 1OIXA 1W44A 2ZE8A 5SZJA 1KHIA 4WXRA 4JMPA 1E9CA 4A0FA 2JK8A 1N36Q 3KDFA 3M4OH 4BFYA 4GP6A 2OAQ1 1M90C 3EZ9A 1WFQA 4C4PA 1WJJA 4KBFA 1VECA 5AR1A 2PMKA 2X77A 3HU1A 4YWKA 3ZS9A 4Q9LA 3G71A 1TUIA 3AKCA 4W5JA 1J6QA 5C3EG 5FUVA 4R4IA 3PITA 1U0JA 3MWLA 4HIMA 2ZJ2A 3EPJA 4DRZA 4ARZB 4Q9JA 1Q1ZA 1KRSA 4JI3Q 2IF0A 3AKYA 4TL8A 1KK1A 1M8PA 2G0TA 2QENA 2CMKA 3Q7PA 3UK6A 1FJGQ 3L0SA 4R1JA 1XEXB 1J8MF 2DFTA 4IFEA 5EZ5A 1DAGA 2R7DA 1FTNA 2A5DA 1KJZA 4EJSC 4MH0R 2EWWA 2P67A 4LJYA 2KB0A 1K8OA 4MKFA 4HZUB 2J59A 3EBEA 3RZDH 3PUXA 3OEED 2ZI3A 4NCIA 4YHHL 5CB6A 3WMFA 2F3IA 3T1YL 2XZLA 3K0CC 3TREA 3RWMB 3QJYA 5LMUQ 2UXDL 3EN2A 1FL9A 3BB4A 1Z5ZA 1II0A 3NC0C 3R7WA 4TL6A 1SVWA 4Z51A 1A8VA 3HPQA 2ZRFA 4U00A 4RZXA 3OOCA 3E2IA 1OFUX 4JLPA 2WB1E 1QG2A 4YC7A 4F7WA 1KAWA 2K14A 3FGNA 2GEUA 3CLVA 1IN8A 3V00A 1KMHB 4DDWA 3AF4A 2CNWA 5BW8A 3LFUA 4GOKA 1P9WA 4PXAA 4AIMA 2MMCA 4L5QA 4B71A 3OYYA 4FWTA 4JBWA 4NXMQ 1XP8A 1FP7A 3K0SA 2FGKA 1LNZA 2OO7A 5AJVB 4TZ0A 4LFCL 4XD7D 3RC8A 2IYWA 1SR3A 4BBSH 2BMFA 2R6AA 2K33A 5A5GA 5ELOA 1PZNA 3QKTA 1MRNA 4EX5A 4O3MA 4LUOA 3AF2A 3DEFA 2PNHA 2EYUA 3UANA 1XEFA 5HCNA 1D9ZA 4FWIB 1DG1G 4NH0A 1ZD9A 2JLQA 2JIZA 2WWFA 4P4SA 2B3GA 4GL2A 2GRJA 4DT1B 2I3BA 2B8FA 1Y1WH 2PZFA 2O8CA 1SHKA 2JE6I 1G7SA 3W9YA 1XEXA 4M4SA 4B47A 2JJ2A 1SFOH 3M85A 1Y1VG 4GOPC 5B57C 1KL9A 2RGEA 4QKQA 3VMFA 1ZBDA 2YU9H 4Q19A 1M1YE 4Q4HB 3K70C 3B1VA 3CCRA 5C46F 3HOYG 4OX9L 5SZIA 1W47A 3CNOA 2Q8IB 4KBGA 4W5WA 5DI3B 1TQ2A 4Q48A 5FLMG 2ZS9A 3AVWA 2Z43A 4PR0A 1U0HC 1YITA 1ZJ6A 3GTMH 1GILA 2BA0A 4C3JH 2FEMA 4JLVA 1R10A 4EQ6A 5J47A 1X3EA 1TWHH 2MO0A 2H92A 2JA5H 1W4CA 2ZI5A 3A7LA 4QL5A 4DUZQ 3AKDA 3G6EA 1N5IA 1HCZA 2KENA 2R6CA 4V02A 3CMAA 4YY3L 3A36A 3GTQH 2X19A 4HB4A 4JJKA 1B8AA 1HY3A 1VIAA 3U2QA 2IHYA 3AVVA 3CF5A 1G4UR 5KNCA 1M2OB 1YJNA 2ATVA 2QRZA 3EWSA 3L43A 5H1YA 4AI6A 3CX7A 2YV5A 3GLHA 1X65A 5LB4A 2Q2IA 5HY6A 2NO9A 3T1QA 3U7EB 3WYAA 1E1RD 4B33A 4C0LA 1LTQA 3OTOL 1I4TD 4PHFA 3GJ4A 2K50A 5LD2C 3HWSA 1KO5A 2QQ0A 4IO9A 2JQOA 4JBKA 2V55B 2ZSAA 5DIFA 1QVAA 4UNSA 2ZR0A 5D3MA 2FMXA 2ZRHA 1UBFA 2ZRKA 3KKOA 3T61A 1CF4A 3CZQA 4JIMA 3HOWH 1DBSA 2XOKD 3SR0A 5D3MB 2LSSA 4LHZA 5JCPA 2GTPA 3BFXA 2F52A 5JRZA 2XZPA 1Z63A 1W0JD 2F1RA 1Z0AA 3B7GA 5KHOC 2CCZA 2IHEA 2AHOA 3A1WA 3CIOA 2Z6VA 2Z83A 4B3SQ 1SKQA 1NSTA 4QBGB 4WZAE 1T3SA 4B3SL 2P65A 4IOLA 4Q66C 2NN6I 1OXVA 1WCV1 2C5LA 2KWIA 2Q3HA 3CKLA 3QKSB 4EPYA 1E79D 1Z07A 4Y7NH 4CVNA 3C5CA 1YHBA 2VF7A 4MQBA 3X1ZA 4LUVA 2N49A 5EJEA 3Q72A 4TL7A 4R4OA 2H57A 3B6YA 1RRPA 3A4MA 3I72A 1ZIPA 5AJWA 1NLYA 1NVUQ 4R7ZA 1CP2A 1J99A 1P9RA 2QL6A 1JB7A 3EAQA 3MGCA 4D0NA 4A3FH 2KCTA 3BAFA 2QBYB 2O8BB 1U9IA 2OUKA 2VY3A 3AVQA 4DKXA 1NN3A 4UP7A 4II7A 3THYA 4ABYA 3RANA 3RS7A 3J81c 2W6JA 4DIDA 4Q03A 1AKYA 5KSOA 3H3VI 3B6EA 4LHWA 2HF9A 1H8HD 2IHFA 1ZP6A 1Q8KA 4L9SA 4NXML 1EIYB 1CRQA 2CKZB 2FFAA 2XNDD 2XXAA 1BKDR 1F2UB 2CLCX 3W6PA 2JA8G 4APVA 4Z1MD 4LBVA 3SE0A 3QKRB 4RY2A 1PYSB 5FTNA 1DELA 1KIXA 3HOUH 1TPZA 4HUQA 3L8YA 5JWHA 1G3UA 3ERSX 1XPOA 2LWIA 1RFLA 2BE5D 4LJ7A 3SBEA 1OFHA 3WP0A 4DV2Q 4XOIA 1Q46A 3L0PA 2G6BA 1GZSA 3ZDQA 1K8RA 3U3RA 3NEMA 4M9XA 1VQ7A 5LMNW 1Q12A 4JI3L 3NDPA 1I6HH 2CVHA 5B64A 3VQTA 5JI3E 3F0TA 1VF5C 1K8GA 2NOAA 4NXNQ 3NBFA 4PC2A 4LFAQ 1FP6A 3T56B 1NI3A 1ZC3A 1PUJA 3BH0A 5IYBG 2OAP1 2VH5R 2WAXA 3O47A 4C9BA 2HHHQ 2JLSA 5C2JB 5FI1B 3ADBA 3GLGA 2ZRJA 1RRGA 1C9OA 1EQRA 2GCOB 2IYRA 2WIAA 1XXHA 5FPKA 1P62B 3FPAA 2AL7A 1JR6A 1E2LA 2BKEA 1S72A 4M22A 1OW3B 1OIVA 3UXMA 4MUBA 1G291 1E1QA 2R93H 4CEIA 2JEBI 5DSZA 1VQMA 4FCWA 1W0KA 2ONKA 4LK2A 4OQLA 4Q21A 5FTKA 3EPKA 3IILA 3VA7A 2XTNA 1CKMA 1VIYA 1Z6AA 1OPXA 4TT3D 4QY7A 2IF2A 2E9SA 1EG7A 3T35A 3WY9A 3ZJYA 1VQ5A 2WKPA 4LYAA 2EJFC 4TSFD 4KXFB 4DSUA 1U8AA 2KHJA 4DR4L 1ESNA 1UPTA 5HZHA 3HKZG 4V0KA 2EIFA 1VCMA 1YR6A 3OIWA 2O8FB 3AF1A 1Z47A 4LJAA 3OTOQ 4IFDI 3RABA 3O8CA 4U5XA 4CYMA 5TMPA 2OFWA 2WJYA 4TLDA 1VG0B 3FFBA 1OH8A 2NGRA 1Z83A 2QSZA 4G5RA 1DEKA 1CEEA 4PC7A 4JI5Q 1CI3M 4B3RL 2PJZA 3WWVA 1HR0L 4FMCF 1GNRA 2DPXA 4JL8A 4HSEA 5KDDA 4X6AH 1LV7A 1MV5A 5J4KA 3VU9B 2E75C 5L3QB 3FWYA 1EK0A 2AD1A 1P2TA 3QF4A 4E5UA 3I8SA 3GEIA 1KZ7B 4DR3Q 3BWDD 2YWFA 4L5BA 4BFWA 1GNQA 4US0R 4Q18A 4HAZA 3CF0A 5DGXA 3OF5A 3ZVLA 2R7ZH 1X8LA 1FR3A 4Q4LA 2JJQA 2E87A 3PO3G 1KO4A 3I73A 2IUSA 3EXAA 1VYVA 4GMXA 2BJWA 2VSOA 5DLQC 1WCMH 3QPVA 3ZD6A 1ETUA 1UKZA 1A2KC 4D80A 1G64A 1T5EA 2VHCA 1U81A 3AEVA 4EDHA 2FF7A 4ZKDA 2MSCB 3BU2A 1E99A 2PJRA 5JEAG 2BEKA 3HKSA 3FMFA 4PO8A 3MLEA 1UKYA 1N34Q 4JI1Q 1SULA 1UFQA 3IFTA 1UEBA 4LNQA 3IDQA 5EUMA 3RRMA 5KYKA 2QRNA 4B32A 1E3PA 3IGFA 4JG2A 2B63G 4A75A 1N25A 3RVBA 4DUGD 1NVXQ 3CCSA 2F1JA 3VR6A 1SE8A 1NMFA 2VQSA 4FMBB 4PQRA 3LO5A 1O87A 4KSCA 2VUMH 3NWJA 2NIPA 4AD8A 4CEJB 1JMCA 2YWHA 2ZJBA 1FMJA 3A7AB 1ZYUA 1PHJA 1XZQA 4DUGA 4BFXA 1L2TA 3LXXA 4ZDIA 4XJXA 3RRNA 1LTLA 2UXCQ 4Q1CA 1KDTA 2CHGA 3SFZA 3LY5A 3VAAA 4B76A 5L3VA 1Y8OB 2L5TA 2WIBA 2ZU0C 1H9KA 1YBYA 2HLDA 3D31A 4LOAA 1QVFA 1TWAH 5GJWC 5JS7A 1XMOQ 1HQMC 5DI9A 4B3ML 1DTSA 3REFA 1DXMA 3IEUA 2PMZE 2QMOA 4JI8Q 4GOJA 4A3KH 1U99A 3CB4A 1DARA 1SN8A 1EX7A 2UZIR 3FE2A 3W8RA 3WNBA 3P27A 5IDVA 2VP2A 3J80c 1VQNA 5GADl 4JLOA 5TB5A 2VBCA 3C7KA 4R4TA 1UBGA 5HGQA 2GESA 2GJSA 2GAOA 3QIAA 2ZJZA 2VP9A 2BA1A 3RNUA 3V4FA 3W5IA 5IP7G 5CITA 4ACBA 1G51A 4X62Q 2H7VA 1P4SA 3TIFA 4GNXB 4X62L 4LF4L 2VL6A 3AEZA 4HAXA 3KJPA 1XNRL 5AUQA 3WRXC 3TS0A 1BOFA 3KQKA 4URUR 2KSQA 3AVOA 3U44B 1JALA 1T8TA 3GJ5A 4XD7A 1OYYA 2B29A 2JLVA 4AURA 2DGYA 2PBRA 2RKOA 2WKRA 1IJFA 1N3BA 3I4NG 3NH6A 3HOWG 1KSGA 2VHJA 3CCMA 3UWOA 1NY5A 1XPRA 2VLIA 2ANCA 1LVGA 2FA9A 1CRPA 2R65A 3TRZA 1MJCA 1SHZA 3U4QB 4JV5Q 3CCLA 2H18A 1WP9A 1W49A 2WJHA 1JR3A 1VQPA 5E3HA 4DR2L 4B3GA 3WYFA 1WYDA 4KHZA 3I56A 2OXRA 2FSHA 2UUCQ 2CW0C 3CCJA 5HE8A 2XGJA 3CF6R 1VDZA 3NBYC 3QNUA 1IAQA 3DZDA 2HHHL 2D06A 1YRBA 3ETLA 1H8EA 2XSZA 1BS1A 4B44A 4YWLA 1SLJA 5IYBH 4B3TL 1J8YF 2Q9BA 2WHXA 3MMPA 5AWFC 1L1OA 2OHFA 5JBQA 4Q1BA 4RD4A 4JI8L 1BDOA 3OW2A 3NHBA 5FR2A 3B9QA 2IYTA 2BH2A 4OHWA 4UNNA 1ZU4A 2J0VA 3ZD7A 1DO2A 2KJQA 1PLLA 5FLMH 5FOVA 3GLIB 4H13C 3I32A 3RS5A 4JYAL 1DGSA 4M1YA 4UPAA 1P2UA 3QG5A 3BB3A 1FQKA 4P73A 1LY1A 2PCLA 4Q7JB 1YR7A 1IZ6A 2GCNA 2VP4A 3OAAA 3PEWA 2JA8H 3QBTA 4CEHB 1ZU5A 2Y8EA 4MRPA 3C15C 4WIAA 1ZD8A 2DCUA 2O52A 3R7WB 4TYWA 1GRNA 1JB1A 1HQCA 1XNRQ 3VHXA 1JR3E 1ZM3A 2ZVPX 5FOTA 4D4MA 2NMVA 3G0HA 3EC1A 3FFAA 2CHQA 4LF9Q 4L5SA 3HOUG 3LXRA 4RJLA 2HIVA 1T0JB 4RD3A 1N0WA 3GQBA 3N6RA 5KU1A 2KA7A 4NCKA 1IYUA 4GT1A 3IQWA 4TTQA 1Z6TA 2HXYA 2L15A 4JBYA 1CLUA 2Z4RA 2IEZA 4JSYA 3UG6A 4PZ8A 521PA 3TAHA 3BS4A 4KN7C 1CXZA 5AK0A 4HLUC 1BYUA 1CTQA 1E2NA 3IUYA 3CC4A 2B8WA 2Q3MA 3WYGA 1PH5A 1X3SA 3QVVA 3B85A 4AWXA 4W9MC 2LMCB 4A3GG 1N33L 1IYJB 3A0JA 4QJFA 3U4ZA 2DN8A 1RZ3A 2HUPA 5IT5A 4KHPL 2MSEB 1W46A 2DHRA 2ZR7A 3QBVA 2D4HA 4KU4A 4A0HA 4KHPQ 1N5KA 1MO4A 1COWD 1KKMA 3BGWA 3QQ5A 2C9OA 4DR6Q 1D2NA 3KDSE 3BFVA 4C7OA 1B23P 1P16A 4OL0A 4AH6A 2VIIA 2D62A 1RRCA 2XB2A 4GNKA 5G3YA 5K8IA 3S14H 4LV8B 1QZGA 3CH4B 1CS4C 3J81i 3KZ1E 4ZKEA 4DVGA 5AJYA 5BR8L 4DJTA 4BGDA 1MOZA 4HIDA 1VQIA 4XSGA 2QEXA 2WVJA 3SYLA 4QM6A 4NCHA 2E1RA 3V4RA 2EVBA 3FMPB 3IHWA 1GKUB 5BN4A 2OXCA 3SJCA 3VHLB 3K70D 4US2R 4QNMA 4CGZA 3I55A 2ZJPA 1VQJA 1T6NA 1UWVA 2C35B 1TQ6A 3WNCA 3P26A 2FWRA 3EG5A 4O2DA 1E9FA 2NO0A 5FPSA 2F55A 5IK2D 4L15A 3THWB 3W1GA 3X2SA 1FGUA 4CEJA 3UDXA 1K3RA 1JXMA 5TXGA 4DLYA 2QMUA 3W6OA 4LF5Q 4DKAC 1JBKA 3PQCA 5JECA 2PT5A 4NYMQ 4OK3A 1NMYA 3IKJA 2Q2UA 1KNQA 1KTVA 2PQAA 1G5PA 2A5GA 5AUNB 4BLTA 1K0RA 4LV5B 5DHFA 1YZKA 3CRMA 1IBKQ 4DDUA 3IIKA 4XVQA 1LF5A 1VQGA 4NP6A 4Q02A 5FJ8G 5CJ2A 3S1MH 1U9IC 3SJBA 2WJIA 3CAMA 4DR1L 1EXMA 1QDEA 2V9PA 4BLOA 3AB9A 2ZJ8A 1KDPA 3PO3H 1YJ9A 1VCNA 4ESVA 2OTJA 4E07A 1QVGA 1CJTC 221PA 4A8JC 1E32A 2VHQA 3ADCA 5EUQB 5C0XJ 2KI5A 4R71A 1YU9A 4QXAA 3H3VH 4BY1H 4DV6L 5FBWB 1E98A 4MITA 2FOLA 4QGUA 1NY6A 1EOVA 5GJVC 2J5XA 3BH7A 2A5FA 5FL3A 1Z0KA 4IKEA 1D2MA 2R44A 3AKEA 3HOYH 1NF3A 4JL5A 5BR8Q 1XD8A 2GVZC 3C41J 2ZRMA 1KQSA 1Y69U 1W4AA 2ERXA 3W1BA 4UJ5A 2ZI6A 1AK2A 3BE4A 3GLFE 4RKFA 1HEIA 3STBD 4AYXA 2ZANA 2BDTA 4IQZA 1NJGA 1P75A 3DVLA 2B7BA 1G5RA 4G7ZC 1I4DD 3WNDA 1GKHA 2P0EA 2QP9X 1MO3A 2Q0HA 1KC8C 3HYRA 2ZEJA 4BEBA 3CWZA 2FN4A 2QUZA 4NMMA 4CW7A 1R9TH 2HDNB 4MUAA 4TYPA 3WMEA 3AP1A 1H8HA 2QTHA 4ZCIA 1VMAA 2OTLA 3HOZG 3UMRA 4XWAA 3PIOA 2UUAQ 1S1MA 2ZS8A 3LDAA 4LPKA 621PA 4EPWA 1IXRC 2YVUA 3ZLJA 3BOSA 2JAQA 4LF8Q 4I1OA 1LYLA 4Q1FA 5CM9C 1XRJA 3H2YA 4TTRA 2RHQB 4GOPB 2WFWA 2BC9A 3AP3A 3GEEA 1N34L 1U8ZA 1TF2A 4CZ2A 1TTTA 3FHCB 4JI7L 1RVDA 3AF3A 4EUNA 4L4UA 4QNRA 5G41A 3GCGA 1WDTA 4A3KG 3PF5A 5E7MA 2QMHA 3U4QA 2ZYWX 4UNQA 1C7YA 4UP8A 5M5XH 3K81C 4OQMA 3K0AB 1MJEA 4OO1I 4NCJA 1U98A 2ONJA 1JJGA 1P6XA 4X64L 2QPOA 4IJHA 1JAHA 1WE2A 4TLAA 1VKJA 1E0SA 4ME3A 2IYLD 2IYXA 3OFNA 1S9DA 4OHZA 3RR5A 1HE1C 4ARZA 2DY1A 1J5EL 2LCFA 1OXXK 5FJ8H 1ASYA 2EFCB 5J4YA 2QM7A 2JDIA 5KNBA 3F3YA 1KK2A 3H0KA 4HLDA 2O5VA 3X1DA 2QBYA 5BXQC 2QA4A 5DLQE 2CCKA 3EIQA 5EE9A 5FUYA 1DO0A 3DM9B 4XVUA 1EFRA 1I2MA 4FMDF 2AFHE 4OX9Q 1CJKC 2O8FA 1CUKA 3NELA 2O0KA 1GL9B 4CF7A 721PA 4P4UA 1AZTA 3L0IB 2ZQ5A 3RS0A 1IN6A 1GRRA 1NBMD 2NTYC 2ZTCA 3CRVA 3F8TA 3AVTA 2CWPA 1XX6A 1NVWQ 4MRVA 3Q3JB 4TMVA 5CK4A 4KN4C 4TMXA 5CYPA 1VTKA 2R6DA 1GUOA 1YNXA 3Q9LA 1IM2A 1AKEA 4DSTA 4BXXH 3S24A 2VNUD 2Z4SA 1Z6XA 2FV8A 2EYQA 2ZITA 4FMCB 4GSYA 4QGAA 5J3BA 4NONA 1Q7YC 1G8YA 5CJPA 3FDIA 1B7YB 5J4VA 1AE2A 3HU2A 4N3NA 2GN5A 4G01B 1ZM4A 2JCSA 4PX9A 1QBKC 3L2OB 4E03A 1XPUA 2GZAA 1E2QA 1XEWY 4KV9A 1JJ7A 1J90A 3PUWA 1A2BA 1AIPA 4B3BA 3CWQA 4H02A 4HJ5A 5C4JH 3K9NA 4C0HA 3QI2A 4ZDKA 1MR3F 5EP3A 2HYIC 1R4AA 3A5UA 2CBZA 4ESHA 4TVAB 2O8CB 3A5ZB 4ALPA 4IW3B 1VQEA 2ZRBA 2PQAB 4IFDJ 4OKSA 4PQYA 3KUDA 4DK3C 3MCAA 4Q4JA 1BBWA 4DCUA 4G7OC 1R5BA 1UEIA 4HAVA 4JBMA 4KFUA 1M7HA 4ZI3A 3M4QA 4NXNL 1AGRA 1SXJB 1UBEA 4M9SA 4TQAA 2JA7H 1XMQL 1QHNA 3S1NH 3K8YA 2NG1A 4LWZA 3KLWA 1ONBA 3B1ZA 4XSHA 4XIGS 1W0JA 5FL7D 5A0FA 1ASZA 4JI4Q 3GJ3A 4PAMA 1E9EA 1E2KA 5IYCG 3A1VA 2FFBA 3A8TA 4G3XA 3TJZA 1W2GA 4GFDA 1E9AA 3AH8A 3CH5A 3JAMc 1MH1A 2QAGB 2VEDA 1SVIA 1B0UA 4HZIA 3OE7D 4XTCS 3FP9A 4PZ7A 1WQ1R 2W2VA 4AK9A 3K0CA 3RLFA 2IXGA 1K83H 3ZGXA 2JLZA 4Q1EA 1CSQA 1KO8A 1F6BA 2QY9A 1F3OA 1PH6A 1O7LA 1HZCA 1A62A 1NRJB 3WMGA 2WB1G 4YXWA 3VTKA 2R93G 3MFYA 1W48A 2C98A 2VP5A 3HP1A 3WBJA 3KFXA 4V0NA 4BQSA 4CIDA 5FTLA 1GUGA 2ZSDA 3G5UA 3AB3A 2KBEA 2ZAOA 3GFPA 1NJFA 5KSYA 1XD2B 3P1JA 2K7VA 1E0AA 4FCVA 1EFCA 1EFUA 1K8AC 1Q3HA 3B78A 4IDOA 4QM7A 1RIPA 4NTZA 2RHMA 3PIPA 5TDHA 1N6IA 2QPAA 1LFDB 1XCPA 2V6IA 1U94A 3HU3A 3LW7A 1X1RA 4QBHA 5E95A 4DV4Q 1W36C 3TQYA 5P21A 3QXHA 2HJVA 2QORA 2WWIA 1YZLA 3TUZC 2AR7A 4JLNA 4QHSA 2DWPA 1UDXA 1S0UA 2R2AA 4BFVA 4GMDA 1W4BA 2W6ID 4Q7MB 1CKOA 1XTDA 1CJMA 4G7HC 1XTKA 1Y1VH 4X8MA 4PC6A 4RCNA 2AUKA 2ZUDA 2ZSFA 2OCBA 1ZNXA 4KFRA 4MA4A 5ANRB 4EQ5A 5CM8B 2Q2TA 4BBSG 3P20A 2J7KA 2EFEB 4C0SA 1J2JA 1E2IA 2V8OA 4AKHA 4NDZA 4LFBQ 4MRSA 2DUDA 4DSOA 1OHHD 1H9RA 4MKIA 1Q22A 4C2TA 3SHFA 2GXUA 4PSKA 4WA7A 5C0XG 3OIYA 3QY0A 1ZD1A 5DH9A 1BBUA 4AG5A 5GAEC 1XJCA 4AC9A 2JEAI 3GLGB 1GUSA 1E1OA 1KDRA 1TAGA 1DVRA 2ZJOA 4TWZA 2N78A 1W2BA 2F3RA 4KKSA 4Q1DA 2G9NA 2JEOA 1G1MA 2J1LA 3GLIA 1E2ZA 4TSFA 5JLJA 4BASA 1P72A 1T8UA 3LBIA 4KAXA 5EXXA 2W0SA 3UE1A 1P9NA 1E79A 1SXJA 3ZJYC 1HT1E 1SKYB 5G40A 3FKIG 2J87A 3K70B 3T53B 1ESMA 2YOGA 1JI0A 1W0KD 1EWQA 3KX2A 1ZUNB 1H95A 3TW4A 2E5LL 4A3CG 1S4QA 4PAOA 3UMFA 2FFHA 2H17A 2RGCA 2Z6KC 5AJ3Q 1K5GA 4BY7H 3KKQA 2BBOA 3QEJA 3QVUA 1IW7C 1DG3A 4JI2Q 5C0XI 4O2RA 1W5TA 4OGQC 4F92B 3FKIH 3TVTA 3U3KA 2CL7X 5EXSA 3EZ6A 2RCNA 4JSTA 1T0HB 4KO8A 5BYKA 5K36G 5BWMA 3GTGH 4S35A 4YMWA 3OE7A 2UUCL 3DXJC 2YINC 3GPLA 1G8HA 1Z2CA 3ZZUA 4N1AA 4LFAL 1XNQQ 3KXKA 1E0JA 2QAJA 1G16A 2ATWA 1JQJC 1RYFA 4MGIR 1C4OA 4O0MA 2CFMA 1G7TA 2OBLA 2IL1A 4IXNA 4PTLA 4V0OA 4ZDWA 3KTAA 4WOPA 1UDWA 2OQKA 2VTKA 4C0AC 2B63H 1GG2A 2CE2X 3DL0A 3KL4A 4IEEA 4LF7Q 2ZPTX 5C3EH 5HCIA 2E74C 4UKDA 1OH7A 1M34E 3MD0A 5M5WH 1E94E 4IJLA 5LMNQ 1P2SA 4F4IA 1BYIA 1ZAKA 2C04A 3LLUA 2ECKA 4IDQA 3LWNA 3KLRA 4GZMA 4ON9A 3KJIA 1BKBA 5E4FA 5EE1A 1YR9A 2OILA 4LV6A 2ORWA 1GOTA 3QKRA 3CCUA 2F9LA 3SDZA 3EA5A 2O5JC 2VQEL 2YYZA 2JA5G 3ER0A 1ONLA 3PUVA 4RG1A 2O0HA 2MQHA 1CR4A 2VQEQ 4A2QA 2WPDD 1B70B 1GO3E 3S15H 2XX3A 1H9SA 3MSXA 1Z22A 2WOOA 3EARA 5IRCD 2TMKA 3H15A 1CJVC 2IXFA 2A19A 1VG9B 1MO6A 1NY4A 1D6JA 4B43A 5HTKA 1P73A 3HFZB 3LNCA 5H68A 4L9WA 5AJ3L 2ASEA 2NZOA 3AV0B 4R4CA 1PH9A 2CDNA 1E2MA 1HYQA 3I92A 4DLUA 3VNUA 2WV9A 4C2UA 3UDFA 3KJOA 2JLWA 4QBIA 5FLXc 2WAYA 4D82A 3KQLA 3AQQA 1Z0IA 3ND8A 4EKDA 1V5WA 2UXCL 1XDBA 2WMOB 2IX3A 3K9GA 4W5HA 3OEHA 4DV1L 1I6VC 3MRSA 2D2EA 2G1JA 2W6IA 4DV1Q 1YZGA 3CNNA 1JEDA 1E2VA 3CC2A 1FOEB 4JJZA 2K5VA 2CLSA 4UP9A 3UIEA 2KBFA 3LVRE 3MWYW 4AKEA 3KJGA 2HT6A 3LVQE 3E5HA 3RSOA 1G6HA 2IUUA 4X64Q 4JS0A 3PUYA 5D3QA 2PI2E 5C4MA 1COWA 4B3TQ 2QE7A 1GVNB 3B5JA 2K5HA 3F1ZA 5IYCH 2N1BA 3QKSA 4L16A 1IYVA 3WRYC 5BN5A 3OHMA 5L3RA 4G5QA 1KKLA 2GILA 4G1UC 2QTVB 4OWTB 3NE5B 1KK3A 4JVLA 4URXR 2K75A 2QROA 2WWGA 3EASA 2PX3A 4LYFA 1US8A 3F2DA 2NQ2C 1B9NA 1G8GA 4MGZR 1Q20A 1EFWA 3MXNB 4MKHA 2C9CA 3K0FB 1VG8A 3AUXA 1BH2A 2VP0A 1XXHE 3ZQJA 3ZZTA 1QHHB 2V7QD 2X1VA 2RGGA 2IYZA 4AKIA 2BOVA 1R7RA 1UE6A 4QGHA 4BFUA 1AH9A 4YHHQ 3A58B 3NIBA 3VDYA 1VQKA 4P31A 2P6NA 3WXMA 2EJMA 4BA1I 4EFNA 3U6BA 2GXSA 5KPDA 3U7FB 1V8QA 5BN3A 2I5HA 1DADA 3S2HH 2UXDQ 4IDPA 4JLMA 4QL3A 4RZ3A 4LWCA 1H65A 4YMSA 2CWAA 2WAQE 1I3QH 2GA8A 5IK2A 1Q0UA 2A3RA 2Z6KA 3W5JA 4IHQA 1EWHA 2NZJA 4DV3Q 1T4GA 4M1OA 1KOFA 2V4DA 1NKTA 2FG5A 4DK1A 4GOPA 3QXJA 2BCJQ 1WXQA 1ZCAA 3TGPA 5E7IA 1NLFA 1FZQA 1PJRA 2PMDA 3BJUA 3GMTA 1N33Q 2D2FA 3KB2A 2VUMG 4URZR 2DWOA 5DI3A 5KUTA 4GN4B 1K6MA 2YZ2A 1E2GA 2JJ1A 1YHNA 1G8FA 4FD2A 3RLOA 2E76C 3GFOA 4UNRA 5L3SB 1IBML 1HE8B 4PPGA 1G19A 5DN6D 1L1OC 1AS3A 1KRTA 1Q81C 2CVFA 5FOSA 3VX4A 3QF7A 2VHTA 1YKSA 1Z0DA 2HF8A 4IPCA 4LF7L 1BIFA 1PLJA 3CR8A 1FVIA 4KFSA 2A2ZA 4XH9B 4KVGA 3ZYCA 1OF1A 2GVDC 3CPEA 3OEHD 3Q5DA 2OBNA 3IPYA 1UADA 1MT0A 2QNRA 5GQOA 3C8UA 1ZNYA 1YZTA 3B1YA 1OT3A 1Z0FA 4D6PA 1S2MA 2ZROA 2GJKA 1M6NA 4PZ6A 5JSZA 1S1CA 5EP2A 5JEAJ 3CC7A 4WJ3M 4K81B 3RS2A 2ERYA 1IL2A 4YCWA 2JJ1D 2ZSEA 3IIJA 4BBRH 3AYHB 3U44A 2HYDA 2IYYA 1OH6A 3D6TB 4C0JA 2WJVA 1DOAA 2XTZA 1B9MA 3T1HL 1KMHA 2K4KA 3TKLA 2Y0SG 1PH8A 4A3CH 1OHHA 5EZ6B 5DO9A 3WHLA 2UXBL 2YKGA 4GLAC 1UEJA 3FTQA 4MRNA 5F9FA 4LJ8A 1BMFA 4BFZA 1Z0JA 2J7PA 2O8DA 3EZFA 3ZS8A 4BLQA 2H16A 4HDCA 3BDOA 3B13B 3ADDA 4LJ6A 2DFNA 4FI3C 2QTFA 4MNOA 2VF8A 4LBZA 2J7PD 1L2FA 1W36B 2JASA 2CEAA 4Z8XA 4JVSB 1EWRA 2V1UA 1TWCH 4GZYC 3A4NA 3AP2A 4EFMA 1JJ2A 2V7QA 4WVFA 1IBRA 3DOFA 2AN9A 4KLZA 3B2EA 2Q9AA 4RD2A 3CMEA 4DLSA 1YZ6A 2DNCA 3QG1A 1QUQA 1VYTA 1YJ5A 2ZR9A 2OCEA 2ZUCA 2CHVA 2IYSA 2PLRA 1TQDA 3CPFA 1OFIA 2F43B 1K73C 3A1SA 3BORA 3W3ZB 3THYB 3QEOA 4OO1G 1KI9A 2CXXA 1HPCA 1LM0A 1Z7TA 1LS1A 2QT1A 1KDOA 4MGYR 4O25A 2BKUA 1KO1A 4B3XA 4ASUA 1A63A 3EX7C 1UAAA 3KUCA 4H9GA 2IYUA 3VKWA 4YXWD 1HTPA 2R92G 1JE5A 5FBQB 1KI6A 4BY1G 2H8KA 5JEEA 4NZYA 1X6VA 3WDNA 1OFTA 2FNAA 1E2FA 3PSIA 1VQLA 1KI7A 2ZAMA 4WJ4A 3HOVG 3IPXA 4TMWA 5EXPA 3TLXA 3THWA 2UUAL 4JBJA 1QF9A 4GP7A 3I8XA 4LHYA 1F48A 4B74A 2QGNA 4B48A 3KQHA 3KTAB 5EQTA 3I5YA 2IHBA 5LD2B 1M7BA 5H8WA 4A2PA 1G3QA 3GTPH 3SHWA 2VS1A 1E96A 1OE0A 4Q5IA 3FKSD 4B73A 3J7A5 1Q90A 3J7ZC 2GVBA 3FB4A 3LLMA 4JI7Q 3SFVA 5KSPA 1LF0A 4HLQB 1L0WA 4DR1Q 4MDEA 2N3SA 1QZHA 3B8HA 4A3JG 2HIXA 5EE3A 2HLDD 4H44C 3K8AA 4BUJA 1JEEA 3MUFA 4OWXB 1XTJA 4PPNA 3G48A 1CKNB 2IC5A 1W7AA 3IIMA 4DK0A 3OIVA 4CEIB 3CX6A 2IBMA 2WJJA 4DV6Q 2GZDA 4FINA 1KY3A 3TQFA 3AQ4A 2VQFL 1Q82C 1R6BX 5L3SA 4G5SA 3T51B 4CEHA 2RB4A 3RDPA 3S2DH 5CLQA 3C14C 1OJLA 1FMLA 5IHPA 3NDBB 2HV8A 2X2FA 1IXZA 1KAOA 2WWWA 4AYTA 3OPOA 4TL9A 4B34A 1VQCA 1SROA 3IQXA 4EPTA 3QOFA 3TQCA 1JPJA 2DFKB 3I4MG 1KYIA 4A3FG 2GF9A 2XGTA 1YHQA 1K9MC 3FHOA 5JHHB 3KKMA 4IOKA 3SEAA 1N9WA 3OFND 4OHVA 3LBHA 3TK1A 1HT2E 1S3GA 1I50H 2IW3A 2O0JA 2RH5A 2MO1A 4MYCA 4PPQA 5CYOA 4L5TA 3RAPR 1Z28A 3U3MA 1YZUA 4OI4A 1E9SA 1GP2A 4CT5A 2JA6G 1RPZA 1NMGA 3CP0A 1IN7A 4A6PA 4URVR 5JJIA 3KXLA 4I99A 3K9LA 2KHIA 4PPFA 3NBZC 1HZ9A 4DPGA 1P60A 4GDFA 1A4RA 4MRRA 4IOJA 1WMSA 4G5GA 4P3YA 2FZ4A 4URYR 4Q9KA 5FUWA 4QJ5A 2GCPA 3UMSA 2NPIA 2ZTSA 3QPUA 1O3YA 4NU0A 4B3DA 2ZETA 1Y63A 3LGJA 2X2EA 4A3IG 2EDGA 1US8B 4LSGA 1VF7A 3AFQA 1QG4A 4MYUA 2BM1A 4IFDH 1LS6A 3CNLA 5EXTA 2ZTEA 2JJ2D 5A35A 1G18A 1AS0A 1OKKA 1KNXA 2R9VA 5EAYA 2V54A 3KB1A 4G0NA 2RF4A 4IVQA 2UVQA 2VO1A 3VR3A 1CR1A 1YE8A 4NHOA 4Z8YA 1NVVR 2ZRLA 4GNXA 4JLAA 5EE0A 3MWJA 3E9HA 3VR2A 3G4SA 1PH2A 4IVRA 4XWOA 2MSDB 3ULPA 3H1TA 4D4JA 2D7CA 3ND9A 3EIHA 1JECA 2B21A 3TMKA 3PF4A 4IXMA 1PH3A 1DAFA 1IHUA 4DNIA 4FIDA 1D5CA 2ZTDA 3RRYA 5FPHA 1N6PA 1ZVQA 4D25A 4J0QA 4ERNA 3CD6A 2Q21A 3NEJA 2V3CC 1QHYA 4LHVA 1Z6HA 2YOHA 3KFVA 3GTLH 4NPHA 2VPPA 4I7ZC 1EFTA 2FU5C 4Q00A 4A0RA 1IOZA 4POAA 4YQFA 5IYDG 3O8DA 1X9NA 5HPYB 4BPBA 1I4LD 2NN6G 2P2LA 4LF9L 1J70A 1ZCBA 4BE7B 1M7GA 3W34A 3DHWC 5M04A 1F5NA 4A4IA 1JXOA 2FSGA 1IJEA 4HJAA 4JLBA 2J0SA 3JZMA 4V0MA 5C4GB 4LBWA 4KVAA 3FYHA 2WKQA 1QVRA 3U5ZB 3HOZH 4DAYB 4PO9A 2XZOA 1HNZQ 2PT7A 3I2ZA 2H5EA 1KD1C 1Y8PB 1KGDA 2ZVQX 3GLFB 5JHGB 1E7ZA 3SQXA 4GKJQ 2HT1A 5C0XH 2QP3A 4RKEA 1CKEA 4M21A 2Y0SE 2A6ED 5M3MG 4A3BH 2XITA 4H0LC 1WOCA 1GL7A 2VSFA 1QJOA 2RGAA 3IO3A 3FPPA 1RW4A 1PV4A 4HAYA 1IY0A 5KNDA 3I4NH 2OSBA 4D0LB 4ZCMA 1Z08A 1XCGB 2OE2A 4PMWA 1PVOA 1OLOA 1PLKA 3G82C 4A1FA 3I61A 4IPGA 1HNWL 1TMKA 3A37A 4B3RQ 2OQ0A 3NH9A 4NCNA 4RD1A 4DIEA 2AX4A 4Q9HA 4NYMR 4NB3A 4IPHA 1R5OA 1S3SA 2JA1A 1YQTA 1T5IA 3Q7QA 4DV7Q 4LYJA 2NVTH 4TMZA 2ID0A 4Q7KA 4H1VA 1VG1A 4DR5Q 4JVNA 4P32A 4Q4HA 3SYNA 4KJZA 1DAIA 2ASBA 5JMTA 4LK1C 5JJKA 1AE3A 3M0EA 2BWJA 3ZIAD 2IS1A 2F4VQ 3I7FA 4DT1A 2ATXA 1N6LA 4AG6A 4EPVA 3IHLA
chains in the Genus database with same CATH superfamily
4L0MA 4D9GA 1QANA 1TTHA 5FWAA 4JC0A 4XT3B 5JPCA 1YQGA 1JE4A 1SZPA 1M1XB 3DZ8A 4NNJA 4QYXA 1FA9A 1U5KA 2R92H 3CCQA 1TF7A 2ILTA 4R2MA 4BRWA 3HOWB 4A3LH 4BDSA 4A2WA 2OV2A 4DARA 4NE2A 1M6WA 3I9MA 1QU2A 1OLXA 3DQZA 1TQ8A 4IIJF 4AULA 5JWOA 4ZO4A 4F3TA 3DUFB 3MAAC 4A93H 3A3PA 4B6RA 4Y9SA 3UENA 3F1LA 3MA0A 3ONDA 3EQLC 4WESB 5T64A 2NYVA 3T06B 4ZOLB 4YV1A 3CRKC 3GLVA 4NBTA 4KKUA 3TN7A 5M5YH 4D0GA 2PXHA 3LAWA 5KYUB 4EVRA 3IRBA 2DG2A 2ABWA 3QLUA 4M9CA 4CF4A 5CV7A 1LBTA 4CKZA 1AUQA 2EZVA 4EL5A 3WYNA 1AK1A 1VE9A 3O26A 2GPBA 2PL3A 1RPAA 1VE1A 2E5LQ 4KH0A 4PHTA 4UEWA 2CWWA 2FG7C 5B58C 2CV0A 1YCGA 4IH1A 1B42A 1VQ8A 2PLWA 3W2HA 4CCWA 2PCFB 2W0MA 2IFTA 1GVPA 5HRAA 2VWGA 3IV6A 1UP4A 1WXHA 4LDQA 4LQ4A 1F7UA 4E51A 5JIBA 2FQYA 3KL2A 3A55A 1YR2A 4P3XA 3OHSX 3KOZA 5EVCA 5FPTA 2Y2VA 4BZQA 4LF4B 1PJTA 3WR5A 1CU1A 1VQ9A 4J0IA 1JH8A 4CLXA 1EY0A 2C8JA 2FCRA 1A7AA 3E5SA 1NZFA 2GZMA 3GXOA 4QDXA 3A74A 4A8JA 5A4IS 5CDUA 3H9JA 4YIHA 1TO1E 2YV2A 3FTPA 1X3FA 4CFZA 2R6FA 2X1LA 4YONB 4BZPA 2Z6UA 1UM8A 4R16A 2KBNA 4LGMA 4YJDA 2VUUA 5LP1A 4HQFA 2ODEA 4KAJA 2FEOA 1CQVA 1XHFA 2MYUA 3ITEA 4GQAA 4B7UA 5ALGA 2A14A 4AMZA 4LUCA 3R40A 1USVA 4F2PA 5LL6S 5BQOA 4O8CA 4CTNA 4BMOB 1ZQ1A 4IMPA 4Q9IA 1C14A 1RM0A 3WHKA 1DOZA 1GPH1 1KP9A 1F60A 1HG1A 2CXUA 2OECA 2QWXA 1PR5A 1XDSA 1XEAA 3FSGA 4ZT3A 1U8YA 2FPKA 3E23A 3ROGA 1CJUC 1RHQA 1VLVA 3RHFA 4ZFNA 1G6PA 1WDLA 2NTNA 1SNMA 4B3FX 3CUEF 4QATA 1UJ2A 2OBXA 1AGXA 2QUIA 5JCZA 2O48X 3UK2A 2EYFA 1MGOA 3OD5A 1UP7A 3R2JA 1EZ8A 1CRZA 3V34A 3M9BA 1Q15A 4RESA 3RHSA 3S40A 4KZKA 1NE3A 1VQFA 4BO5A 1S9HA 4XLTA 1K75A 1U0FA 1EVEA 3CW2C 4L4YA 1F0KA 4MWBA 1L5NA 4EEKA 2G88A 5KPJA 1QDUA 2A5LA 4KR7A 4LGCA 2HWUA 1QNUA 2ZKLA 5AW4A 2D0PA 2IU4A 3NHYA 1YVDA 3ISJA 4AYBE 1Z7EA 4M37A 3Q8XB 1YVEI 4MB6A 3PUZA 3TAUA 3E6AA 1XTSA 2Q4OA 4K7JA 1O80A 4GN3B 4Q1AA 1E3WA 1L7QA 1TL7C 5EE5B 1STNA 4H31A 3SLRA 1XZEA 1X94A 3JWGA 1I1OA 3KYBA 4O59O 3BJIC 2QTBA 4IJ6A 4MTNA 5BSTA 4PSAA 3IE1A 3HN2A 4QLOA 1XQYA 3AVYA 4DQUA 4EKNB 4OELB 2PNRC 2F64A 4GNXC 1SOWA 5I8WA 4ITRC 3ZE2B 3ZCRA 5JDIA 5C44G 5JQWA 3L79A 4GRIA 2WAQB 2I46A 4C3JG 4KUGA 1RL2A 4CRWB 4LPSA 5D5PA 2BEUA 2W70A 3LF1A 1MHTA 5GJBA 3AETB 4IHJA 4ZT7A 3STHA 5LZ9A 3NBXX 3HYLA 3KZCA 4FYYA 2GN8A 2WTNA 2QNIA 3MGAA 5JS8A 4A6XA 3GP7A 2YQ5A 4BWFB 4I8DA 2GHIA 2O0LA 4S1TA 1BJKA 1Z4IA 2J3EA 3LX8A 2AXEA 1LU9A 1S5PA 2FPPA 4O8ZA 4DC9A 1TEXA 3WWCA 2GK7A 1EDZA 1GNSA 2K6GA 1CNMA 2OCYC 3N07A 3QM1A 4NZZA 3FUWA 2EJGC 1XA4A 5D7BA 1D7QA 4DAMA 1BVYF 5BYJA 1T5XD 3VSEA 3WL8A 4DCTA 4YRSA 1WF3A 3I2JA 4OHYA 2J3JA 4P72A 1UUPA 3TI7A 4JJEA 3N75A 1HR0B 3QE3A 3RS2A 4G5XA 4OONA 5AVSA 4Y0VA 4UJ3A 3NATA 5TNXA 4RIFA 1V1RA 1RMQA 3H2HA 4I36A 4X1YB 3E1KA 4LTMA 2K03A 5FO1A 1UJBA 4HAIA 1RJGA 2DWQA 3M6MD 3N7UA 5SV2A 2P6UA 2ZJ5A 1YB4A 3IO5A 3O90A 1LVUA 4XGNA 3WIBA 4BE9A 5C32A 1G7CA 4DV4L 4Y9TA 4BVAA 5KTMA 2R6GA 1NSFA 3BTOA 1M2WA 3OIFA 3DQQA 4TTPA 821PA 4FDLA 4IWXA 4LY9A 1QGUB 4U4AA 3BBPA 1XWEA 2I0QA 5KX5F 5H1SE 4WMLA 3MLAA 2ZLBA 3A31A 2FPMA 4OP3A 2V1XA 1LI5A 2XUIA 3HCRA 1LNSA 1G3RA 3JQBA 1MHPA 3AWDA 4JBNA 3I76A 4Z9BA 1H05A 5T4HA 1RKVA 2C7QA 1ZD3A 4OQNA 2I6XA 2YDXA 4OXIA 2C54A 3PPVA 5KHAA 4DV0Q 1QFYA 1ZSYA 5AK4A 1JFSA 4UBKA 3F4LA 2QN6A 1QH8A 2A69D 3LQ4A 5EC8A 1IRIA 3CMCO 5UKDA 5PGMA 4B9EA 3UWPA 2PR2A 3PO2G 3ZH2A 3WSTA 1I8TA 4OHOA 1LI4A 1JEYB 1M8GA 1XRMA 1IOLA 1DD2A 2I67A 2XCUA 4AJJA 2VF4X 2CMFA 1Q0QA 2QLMA 2W2LD 3K09A 3BYYB 3ASZA 1VMIA 3L0ZA 3QTBA 1K4MA 4MKGA 4D3YA 4OJKA 4JY7A 3KAQA 3TOXA 3B9RA 5BRJA 5KDOA 3U50C 1NTGA 3TZUA 1TM2A 4EI7A 3OP4A 2EF1A 4RHYA 4U7TB 4DWWA 1POXA 5HKKA 3EROA 3CSDA 4EGAA 3H11A 4LF4Q 1C1XB 3F78A 5FUXA 3UK0A 4FWBA 4KE6A 4CQLA 2YCBA 3A9VA 5IGBA 2JGDA 3AY6A 4KLRA 4X44A 1H23A 3BDCA 3K9WA 1BVUA 3EVQA 3AOEC 3PPXA 4DXDA 2GJ4A 4I3FA 4PSUA 4U8GA 4JI6L 1WL8A 4XDXA 3GBVA 1HFEL 3LW8A 3RBVA 3RH0A 4P0PB 1Q7CA 3A8IE 3QB3A 2HZ7A 1BC5A 2VBGA 1MJGM 3PDHA 4HRAA 4QXPA 5ITSA 2JLXA 1CC1S 3U7HB 2XMGA 4YQYA 1M67A 3BXOA 3FUTA 2ZSHA 2A9KA 1IY8A 1MC5A 1JQ3A 4IIFA 5LBIA 2OYCA 4AQ7A 3WDLA 4Z99A 2B0CA 2X0IA 4RELA 1JJIA 3PKIA 4JCVE 3D7RA 2YIJA 5FF9A 2JLUA 4DDTA 4A23A 3ZHTA 2Q2OA 3AL2A 3OM8A 3DCJA 3EUAA 5TARA 1QCYA 1QIMA 2Q2NA 4FMDB 4NCBA 3VDQA 4DCPA 2ZT7A 3S1AA 4DSNA 2JIQA 4CUZA 4N5DA 1XKXA 3D6AA 4V0LA 3WGHA 3SAJA 1Z3IX 3ASVA 3IS3A 1G3MA 2G40A 4PZ0A 2PM8A 3SJAA 3VR1A 3L4KA 2AQ8A 1DCZA 4FFSA 4M0CA 4JLKA 4NPCA 3W4IA 2P4QA 4B2YA 5IT9E 1P3DA 1GTVA 1TU0A 3VYSA 2J9RA 4BX8A 4B2LA 1B50A 1A7UA 1ATIA 2ZRGA 1J25A 1WPXA 3KBOA 3NQIA 2EP5A 1FW6A 1T15A 3BFKA 3HR8A 3LPDA 2BMEA 4CM6A 4KR6A 2B9VA 3O3CA 5TEWA 5LMUB 4Z2YA 2IOQA 2OCKA 3L82B 5C5CA 2B4YA 2E2WA 2CXRA 2AUNA 3S17B 1CJBA 3T1YQ 1ISJA 1ONNA 3IALA 2CDBA 2PGXA 1VHLA 4MS4A 1VA4A 1XNRB 3TNDA 2HDWA 1X56A 2NXWA 2R97A 4S0ZA 5K0TA 1AU9A 2VT7A 3IA7A 1A15A 3GA5A 4JI6Q 1VLHA 2C3MA 2P35A 1F2ZA 2PA0A 3DC7A 4AQYL 3P4XA 4WFIA 5DW3A 2ECQA 4XQEA 5C4XB 1UK7A 1WD5A 3D1VA 1PK7A 3SJBA 3B6IA 3AHEA 4PIMA 2BFDB 3ZEAA 5CB8A 2HRZA 1AQUA 5AXAA 4JI2L 2QP4A 3V9PA 1P19A 1ZXXA 3I9JA 3WKEA 5CBKA 3TQHA 2Y0CA 2N55A 1RLMA 1I80A 2QE7D 2H51A 5JSFA 3UF0A 4MYHA 4KV6A 1R00A 3DE5X 2CXHA 4WRRA 2VWPA 3PHBE 4WW0A 4NNOA 1OXSC 1N32Q 2QRMA 3HJGA 4OWWB 2UVPB 3GRYA 1JWBB 1UMBB 2IUTA 2J08A 1PFBA 4XYOA 4IG9A 4LZAA 4GL4A 4K0KQ 3ZU5A 4R4JA 2QJTA 1NLZA 1UOPA 2ETVA 5HKKD 1PZID 2YUTA 3EH1A 2EXXA 3DR3A 1JQ5A 2FMHA 2LTAA 4GLOA 3S2SA 5F98A 1SXPA 3GLHE 4QMGA 3BRWA 5KTYA 3HA5A 1JSZA 1EY8A 2VUTA 2YC4C 3ZHSA 4PQGA 4EX6A 4X65Q 1IBLQ 2Q5HA 3K2QA 4MQMA 1HE2A 1TF5A 3NXKA 5F77A 3VPHA 3AI1A 2OBFA 4WAUA 1SUWA 2PPBC 4C6TB 3WQSB 3I2YX 1G21E 1C0AA 1HDGO 1ORIA 1N2XA 2M2LA 1TADA 2WDPA 5CW2A 1VCIA 4EDFA 1XF1A 3CRLC 3Q10A 5EZYB 4BLRA 2QGZA 1EWIA 4M8NE 2ID9A 4LMAA 4ZVQA 1G9XA 4GP9A 1DCFA 2Z1CA 1X80A 3H5VA 3EZXA 1A9SA 3B3FA 1Y8RA 3FUVA 3N7AA 4N5IX 4O4IA 4UBNA 1EGAA 4LYHA 4ZK2A 4RA6B 4RVHA 1P4AA 1CUWA 1RZVA 3CFYA 4F9FA 4G89A 5IXYA 5FIUA 3TL6A 5GVSA 3KO8A 4KXUA 4RUKA 2O05A 1KZGB 1M8FA 2A5JA 5C37A 5FX2A 2VYCA 4LBYA 1K06A 2DXIA 1THMA 1UKEA 1UQTA 3BGSA 3GUVA 5FWNA 2AIRA 2QLNA 1RTNA 2ZBQA 2XVSA 2OQIA 2OCIA 1W59A 4FIZA 3S8EA 1SXQA 4XUCA 2GYUA 1XYVA 3BWXA 3I1IA 1FUUA 4HDRA 3ZD9A 2I4IA 1RJ9A 3PI6A 2ZIEA 3HDVA 5SZKB 1A98A 3J81A 1NFRA 4G56A 3ZHCA 5EMHA 5KWIA 4MDFA 1W6UA 2LP4Y 3EWIA 2IE8A 1SJHD 4N49A 1K0FA 1MNAA 2PYKA 1PR2A 3E22B 1KDBA 3IXLA 3LT2A 3V8VA 4L8WB 5JYDA 4NNPA 2FZCA 1K4YA 4RSGA 2LR0A 1GPAA 3K0EA 3UK1A 4DE5A 3STUA 3PF8A 2IY5B 4P4GA 2JA9A 1UXHA 1AKMA 3INYA 1JHRA 4QXQA 3VBCA 4QLBA 2WWTA 3S8MA 5GM2A 1TX4B 5DX0A 3NTXA 3QXXA 1QTNA 4MDHA 3QVXA 4OO3A 1PRTB 3OE4A 4IXTA 3RYTC 3TBFA 2BV3A 4B2PA 4E09A 3CNHA 2CLFB 4HRXA 4RJJA 1TKRA 4V38A 1V7QA 3GFFA 5ALQA 1FFYA 1LC0A 3O8RA 2YTYA 3ME5A 5A1TA 2YHSA 2GLXA 3TE6A 1NHWA 1HC7A 3NJRA 1RKBA 3ONWA 1P3Y1 1FJGL 3EZYA 1O7IA 1I4PA 5ESRA 4EK9A 3DFKA 3C1EA 2H06A 4R7GA 4ZK9B 5EJ2A 2W90A 1X8KA 1YD7A 2UZ3A 4GXRA 5FLKA 4TMFA 3KJXA 4DR4B 1M6VA 2IPMA 3SHVA 2GBPA 5ED0A 1Z33A 4UCQA 1I7LA 1OYOA 3TPCA 2AMLA 2H4FA 2O4CA 1KO7A 3ANLA 1OO9B 2AQ1B 2PI2A 3H6GA 5E4TA 1JJVA 3BK2A 3T95A 2RQXA 3NTHA 1O77A 5GADC 2ONCA 3FOZA 2I5MX 2GUGA 1D9XA 2MNAA 3KT6A 3W5UA 4HWOA 2WKSA 2HR1A 1WRBA 3NBAA 4UCFA 5AKGA 3SN6A 1MIUA 1CM9A 1RMYA 2ECFA 3WLRA 1TJPB 5A4JA 2IYAA 1FJ2A 1JU3A 4HMIA 1EFPB 2Q5OA 1FW8A 4F2HA 5KTRA 1YZNA 1SRQA 1JDJA 3QUSA 4DR4Q 3D6JA 4FHDA 5IANA 2O59A 3W8NA 4EYQA 5KNLA 3D4OA 3R9XA 4CMIA 1TAHA 1WPRA 4LE2A 3RYIA 4UTNA 1CTMA 1N2CE 4TRJA 2ZBGA 3H0GG 5D6NA 1TU2B 1N32L 5IGEA 3U4CA 4EQPA 4DLZA 1EINA 2R7ZG 1ZIOA 2JI9A 2IZOA 4TRDA 3PDIB 4HFNA 4OJNA 3CR7A 2GNOA 3OTGA 1JEAA 2I7DA 4RCVA 3D02A 4YJ3B 5FWXB 2I71A 2HRDA 5A5EA 4C4TA 1Y1WG 1YGPA 3LGSA 4N6OA 4NE9A 4AIRA 3OPYB 3D3QA 4ZJPA 3M1IA 2Q9CA 3TQFA 3CS3A 2D2VA 1HQKA 4K6FA 4XYGA 2ZULA 3JWEA 5GONA 3KHSA 2A6HC 1Z75A 2WM2A 5CV8A 3JALA 4MVWA 4OP2A 3OY7A 4E5YA 3UG7A 4DFDA 3RC7A 1CQIA 5BW4A 1L7EA 5IJZA 2YASA 3LVBA 2IEYA 4W9RA 3TLCA 4EBBA 1G41A 3I91A 1QAQA 1PCXA 4LVUA 4P5EA 2Y6VA 2GM3A 4GWGA 3L01A 5B2FA 4L8GA 3HKDB 4YQEA 5DNYB 1EQUA 2AKYA 3R3JA 3CY6A 1X7HA 2W2MA 4QJ4A 3ZGYA 1OZFA 4OSOA 4E6PA 4F8EA 3TRIA 2RHSB 2KE5A 1KMQA 3BILA 1XD9A 1CCWA 1LACA 3H18A 3W06A 1E22A 3W5OA 1PZHA 1VXOA 1GZ4A 1YAHA 4DUZL 2ZU6A 3DFFA 5DGXA 3QPCA 5IPFA 2ZJAA 2X2OA 4BMPB 3LHSA 3M5PA 3Q3CA 2A1AA 3VO8A 2OSVA 2A5HA 2AOVA 2F1IA 2ZYTX 3AJ9A 4U673 3IJEB 3P9QA 3VNSA 1XAIA 2QSJA 4WCFB 3U80A 4LJ4A 3S1NB 2J6BA 2DULA 2YOFA 5EJ6A 1ZS9A 2HEIA 2VA8A 1IPFA 1IOWA 1O57A 2FW7A 2QAGC 4K5XA 1H9BA 3GTQB 3G2IA 4RY2A 2G5DA 4UW9A 2HKIA 1GVHA 2SNIE 4LKOA 1TM5E 4AS3A 3H09A 3PTLA 4UDYX 1UBMS 3FRPB 3NK9A 1B0AA 3B20A 1TWHB 1B14A 4YAIA 2WWYA 2F8MA 3I01M 5FWYA 4MO2A 3HWX1 3FVQA 5I6YA 3BK1A 3PQ7A 3GWZA 1NVFA 4DV7L 1JE0A 1JPVA 2DLNA 2ODWA 2YV1A 2YTZA 3RIYA 3UW1A 5A5FA 2P5ZX 1GTRA 3L0CA 4RMJA 3U9SA 1RHJA 1C1DB 3JZFA 4R9VA 1ZCJA 3W77A 3O31A 3AQIA 4C1BA 4DIBA 7ABPA 4WKNA 1ZW6A 4NICA 1E7MA 3D7MA 4TKVB 1FJHA 3TMAA 3PJRA 4IAOA 5KX5A 1K3UB 4M6WA 2VDQB 4TYNA 2WJGA 2Z8LA 4NP5A 1ULSA 4JJ6A 3RG8A 4XQQA 5TQVA 5ABPA 2F4VB 3G13A 1YZQA 3N6VA 3ZHVA 4DVJA 1GZ7A 4JEIA 4Y8VA 4PZDA 4RX1A 4TZKA 4NFLA 1CEXA 4OYLA 2XSZD 4WADA 3VNVA 1EUCA 1DRKA 1YBVA 4JGBA 3R23A 2E37A 2IZ0A 3AR2A 4LXQA 3J80E 4ZV9A 3H97A 5AQ1A 4MICA 1JLLA 4ZEOA 3KJEA 3LQRA 2P5TB 2W83A 3VH4A 3I3SR 3QWBA 2O8FA 3C1FA 1QZ3A 2JFHA 5DSTA 4KCGA 4A3EH 3CONA 2ZM6B 1UKVY 4WKGA 1BBXC 3CZAA 4RQBA 1XIVA 5EP1A 1TKCA 4CCSA 1KFJB 1JC7A 1U2RA 3IVMA 2BTEA 3A8JE 4P7GA 4CKYA 4KI7A 5MGBA 2XV1A 1G42A 2NSHA 2D5DA 3D3WA 3T1OA 2VTBA 1ZOOA 1V9CA 3ZBUA 1JRLA 2F1HA 4AICA 3W1VA 5GONF 2VF2A 1BHO1 3DE7X 2BBSA 1IU9A 3AUTA 4W6QA 1BEUB 2R4QA 2OHHA 5D3MA 1VKOA 1MORA 2OM2A 1R8SA 2PQ0A 1JKJB 1PH1A 2O7SA 1K8XB 3BB1A 3JVIA 5EWLB 1KIMA 1Z17A 4K2AA 1J1ZA 1FNMA 4PLGA 4AECA 2K2QB 4XX0A 3INGA 3UAVA 1L7OA 2W48A 2Q2HA 4TMTA 2NSJA 5B7QA 3DYIA 3FSEA 4IO1A 4DZRA 2CCJA 4D9BA 5JTTA 1IXYA 4X20B 3KRTA 3DZFA 1QWYA 1C1YA 2BMDA 2CK3D 4YTEA 4F8JA 5LQAA 5FNVF 3K72B 1NMSA 1XR3A 2RH8A 3QU7A 1HLPA 2Q5EA 2A8VA 3BMXA 3IAFA 3ZGVA 1X1SA 4X5OA 5L7WA 3UMYA 1STEA 2OO5C 5J40A 3WKBA 4PG3A 1CEQA 1XI2A 2FZKA 3AI3A 3C3YA 1W6KA 2C1XA 3C3LA 2DH6A 2W6ZA 2WUFA 5EMNA 2ZPUA 2QUJA