3RLFA

Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
371
structure length
371
Chain Sequence
b'ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
total genus 106
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3rlfA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3rlfA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rlfA01
1U8YA 3AF1A 2KHJA 3GCGA 2IY5B 1O78A 1ZUHA 2ECKA 4LJ8A 3NEJA 4B3FX 3CF6R 3OOCA 4Q1FA 3TGPA 2JDID 2W6IA 2JATA 2BDTA 2AK2A 4LHZA 4GKJL 1OJLA 2X19A 1T3SA 3U7GA 1PUJA 3GMTA 2V9PA 2ZVPX 3MMPA 2UU9Q 2UUCQ 1Z6YA 3LBHA 1U99A 1G8YA 2BWJA 3THYB 4P4UA 2HCBA 3M6AA 2A8VA 2R93G 4Q01A 4UNSA 1ZUIA 2PZEA 3BWDD 3GJ7A 2XNDA 5DO9A 2XEXA 4YXWA 1BO6A 4CVNA 3U44A 4DV0Q 5J40A 1IONA 3JZAA 1CP2A 3IHWA 1XEXA 1UBFA 3QPWA 4A3LG 1N6KA 4O25A 1E99A 2NTYC 4F38A 4UP8A 3ASYA 4H02A 4POFA 1YE8A 3FTQA 1OXVA 4L16A 4FDBA 2IK8A 1NLYA 1G7SA 3BERA 4NL4H 4URZR 1SN8A 3RS4A 2EWVA 4PPQA 4IPHA 4V02A 3TVDA 1YZKA 3QKTA 4YCWA 2SHKA 4ZPXA 4GL2A 2AUKA 1YZ6A 1UPTA 4GZMA 1IY0A 4AC9A 1LTLA 1AJEA 3CRKC 1GKUB 3GQBA 4DDWA 1FL9A 2GXQA 3TRZA 2WHXA 4R2IA 3RWMB 2JDIA 2R6CA 4Y0VA 5L3RA 1AGPA 1D6JA 1IOZA 2HJVA 4EX5A 1I94L 2P65A 1H8ED 4LF6L 2A3RA 2QAGB 2H5EA 1TU2B 4IHQA 3AVPA 5EUMA 1NNEA 4LF9L 3LNCA 2BMJA 3IPXA 4OGQC 3U9SA 3TS2A 4G7OC 1XBTA 2ERXA 2WJHA 4TWZA 4PQYA 4EKDA 2B8GA 3TAUA 4ZDWA 1FUKA 2OT3B 2WJJA 4IEIA 4I7ZC 4WXPA 4X8MA 2GDJA 2HHHQ 1Z7TA 2AUJD 1X3GA 4A93G 1S9DA 2J3EA 1TWGH 3A0JA 2D06A 4QNRA 4OI2A 2YYZA 5FOSA 2JLUA 1KAGA 1CU1A 3QUSA 1VF5C 1KQSA 1G291 2NZJA 1VCNA 3BGWA 5JCPA 4BZQA 1XD8A 3S1AB 3O8DA 4YDHB 4C4PA 3CMEA 1OE0A 5L3QA 1NG9A 2EIFA 2AXNA 1M34E 1P73A 3PF4A 1RRFA 3KDFB 1XP8A 2P67A 3B1WA 4R98A 5JLJA 3T1HL 1HQMC 1K83H 2EFGA 3I7FA 4LV6A 4BA1I 3M7NA 1EIFA 1YHBA 4HLQB 4KU4A 4JZKA 2EVWX 1SR3A 3WY9A 3MG9A 1H8EA 4OKSA 2OCAA 2WSSD 4QFMA 1UBGA 1EWRA 3BDOA 2JA7H 3TR0A 3VTKA 1AK2A 5FTJA 2HJGA 2ZAOA 4GNXB 2OAQ1 4HUQA 2O0JA 2O5VA 3KQNA 4F93B 5FJ8G 1E1QD 1E2EA 1R5BA 1ZKOA 3NHBA 2WWHA 1KK0A 2J41A 1VQDA 1ELOA 2D2CC 4BBRG 1J99A 4D81A 4JI2Q 4NCJA 1Q44A 2KA7A 4Y52H 2Z5FA 1VHTA 5EP1A 4D4LA 4A36A 5EQTA 4LW1A 3ADDA 4QL3A 3BIFA 1NVVQ 1X6VA 3AV0B 4X8HA 3SN6A 2BE5C 4DV2L 3ND9A 2ZSEA 4CEIA 2QORA 3H0KA 1R0YA 4XOIA 1EUJA 1JQLB 4KFUA 3VAAA 2IS4A 2XGTA 2A69D 2O5IC 1T91A 2VRWA 4US1R 1NVXQ 2KCCA 1KHTA 1MO6A 1R6BX 2ZYTX 3EZ2A 3KX2A 3AH8A 3F2DA 2FSFA 3CC7A 3B1XA 3RLNA 4BUJA 3MLEA 4JI3L 4TVAB 2LKCA 5JBQA 3BB4A 3GFOA 3BRWD 3X1DA 3K81C 4G7ZC 4F91B 2QMHA 1IXZA 2WSSA 3ZLJA 3U6BA 2QE7D 3FVQA 2A6EC 1VS0A 2DB3A 2I5HA 1N5KA 1J90A 2GJ8A 1OXXK 2IHFA 2KJQA 1VQOA 4MYCA 4PQFA 3G0HA 2MMCA 3MUFA 3AVUA 2YWEA 3J81i 1E1QA 4WZAE 1JJCB 4DR3Q 4C0JA 2E9SA 3LVRE 4YHHL 2XGJA 1P9WA 2G1JA 2D7CA 1TAGA 1YR8A 1E0KA 2F3IA 4ZO4A 2ANCA 2B8WA 4YCVA 1XFAA 2ERYA 1D8LA 1X8JA 5IP9G 4H44C 3KB2A 1AN0A 3KKMA 3HKZG 4OX9Q 1SXJB 3VR6A 5FOXA 2OQ0A 1XTIA 5AWFC 4LNQA 4DLUA 5G3ZA 2Z6KC 1E2PA 1MV5A 3CO5A 3K9GA 3U2QA 1WMSA 2CJWB 4PPNA 3E9IA 4YMUA 2KBEA 3IBGA 1E3PA 5L8VA 3BU2A 1X1RA 2LXKA 3GLIA 3KUDA 1WA5A 1Z6AA 4OYHA 2QE7A 4JLJA 2PT5A 1NBWA 1LNZA 1GDDA 1OFHA 5G53C 4BECA 1Y14B 1KDPA 4N0EA 3ETLA 2NIPA 1TF5A 4CT4B 2B29A 1WB9A 3NDPA 1VMAA 4YWLA 3NIBA 2ZR0A 1W44A 1E98A 4KAXA 2NN6G 1Z3IX 5HCIA 5LB2A 4LYHA 3WWVA 3RRNA 1YKSA 1O7IA 2YINC 2IC5A 3B82A 2K5HA 1RE0A 1N33Q 4GOPB 1P2TA 4C3HH 1XMOQ 5F9HA 3T12A 4MRSA 4YONB 3H0GG 4DR7Q 5IK2D 1RYFA 1E2LA 2D7DA 2IHYA 1Q82C 1UF9A 2PMZE 1E9RA 1R0ZA 5EP2A 3I8SA 1II9A 2VA8A 2UZIR 4HLUA 4DR4Q 5EE5B 3B9QA 2F3TA 2GK6A 4B43A 4LPSA 2AWOA 2VQFL 4MUAA 1LV7A 4A3IG 3P4YA 3C15C 4QM7A 5E4FA 4RCNA 2I5MX 1KL9A 5EZ6B 4OI1A 4Q03A 3WMGA 4XJXA 4P4SB 4AIIA 4A3BG 4TMVA 1CXZA 1X3SA 4FMBB 4JBJA 1LF5A 4JI7L 2HLDD 5JECA 3QVUA 3K0AA 1HR0W 5CK5A 2CQOA 4ZDIA 3RS0A 5D3MA 4KKTA 1WCMG 1QF9A 1HUQA 4Q66C 5LMNQ 2Y0SE 1DO0A 1NN0A 4C0SA 2IF2A 2I5LX 2CXXA 2QSZA 3MXNB 3T34A 1T8TA 3TS0A 5IK2A 1GJXA 3U5ZB 2JXMB 4A8JB 1VQLA 5IDVA 3FWYA 2A68D 1GOTA 2ASEA 1A7JA 1G4AE 1OYWA 5FR2A 4DDUA 1VQBA 4YMVA 5GVSA 3CCMA 1CLUA 1H9RA 1OIVA 2J0UB 4DEXA 1HZBA 2FPMA 2YJTD 1VCIA 4V03A 1EFUA 3GLHE 3KKPA 1KMHB 4EJSC 2DWPA 4RD6A 4A3DG 3SYKA 2NMVA 4IXNA 3ERSX 3AF4A 3CCRA 3A4MA 4BRUA 2RGXA 1ZRHA 3I4NH 3S17H 4A82A 1CKMA 1M6NA 1CR4A 1KO1A 2HLDA 3X1XA 3AUXA 1ZD9A 3GJ3A 1Y63A 2AHOA 1H9SA 2ZANA 5FBLB 1N3BA 4NXNL 2R93H 4HAUA 2GTPA 2HYDA 5HCNA 2GJ9A 3CPWA 1TTTA 4QKQA 3K9HA 4HUTA 3FKIH 5E95A 1RC8A 3ZQJA 5BWMA 1JE5A 1IXRC 4HIKA 4MZ9A 1VF7A 4LBVA 4C2TA 5LPNA 1RIFA 1ZU5A 2WVJA 1A4RA 4JVNA 3PEYA 1IN5A 3CNLA 4PX9A 4IRUB 3AF3A 1PLJA 5A4JA 3THWA 2B63G 2ZM5A 1SVOA 5EZ5A 4PO1A 2JA9A 1Z6XA 2OTLA 2B7CA 1HV8A 4WJ4A 1E9SA 5DI3B 1KJYA 2L5TA 2BIFA 2P5TB 4CEJA 1E22A 5JEAG 4IPCA 3A37A 3JZMA 4DLZA 3OF5A 1ASYA 2OCPA 1YR7A 2A19A 2IX1A 1IN8A 4PPFA 3TVTA 4TLCA 1KO8A 3L8YA 5JHHB 5KSZA 1BVSA 2JLQA 4TMXA 2OLJA 1PUIA 3SBEA 5FH9A 5HGQA 3KTAB 4UQOA 2P2LA 4AYBG 3VHXA 4J15A 3BOSA 4XSHA 4MRNA 3EARA 4ACBA 1YZUA 3M4OH 2C78A 5AUPB 3DDCA 1PH7A 4B3SL 3PO2H 1NBME 2LMCB 2AR7A 2CLCX 3CNOA 4B34A 4JMPA 3LWUA 4JI0L 2QM7A 4MH0R 4BEBA 2ZI9A 3O8RA 4JSTA 4CIDA 1HA3A 2YWFA 1JXMA 4JYBA 4EPTA 2CHQA 1Z0JA 3L43A 5K8TA 1RW4A 1Q1EA 1OIXA 4L15A 5TMPA 3DL0A 5FUWA 2OLKA 1TMKA 4IOCA 3T56B 4BY1H 1NMFA 2WMNB 2GBLA 1SE8A 2H57A 5HKKD 4DT1B 2ZS7A 3KXIA 3LLMA 4LUVA 4QBIA 2GNOA 3BAFA 4NYMQ 5EXPA 4AG6A 4IQZA 1TX4B 4BLQA 3M4PA 3FP9A 3LQQA 4QXAA 2CL7X 2XZOA 2ZTDA 1Z6HA 2GILA 1NL3A 4JC0A 2VQEL 3OFND 1VYVA 4L9WA 4MGKR 3CM0A 3NKVA 2DBYA 1U90A 1D8TA 3SFZA 3U50C 2ZITA 1AM4D 3HFZB 3EZ9A 2OCEA 4X64L 4HLDA 2QBYA 1KSJA 1F2UA 3RNUA 4IOLA 1PH4A 4BQSA 1VG8A 1B7YB 2ORVA 5EE1A 3SYLA 5E7MA 4MTNA 1W2HA 4MDFA 4W5JA 5TXGA 2OXRA 1X3FA 4BLSA 3HOXG 4I81A 4NCIA 5K8LA 1EX7A 1PV4A 1P2VA 3GTOH 2YWGA 4NHOA 4QIWE 1BYUA 3KJIA 5KPJA 1N0UA 1HNXL 2QTFA 1G7CA 4ON9A 4DR6L 4QOSA 4DWJA 4IOAA 2ATXA 4BZXA 2CDNA 1ZM4A 3A1SA 1HZAA 3KF8B 1ZBDA 3WXMA 1EFHA 5CB6A 5HKKA 5LD2C 4EQ6A 1HH4A 1GUTA 1OH7A 5TARA 2Q0HA 2YHSA 3BFKA 3GLHA 3VX3A 3RC8A 5F9FA 1LACA 5GROA 2ZE7A 3M0EA 3T1HQ 3ND8A 1FJGL 3UDFA 3F2BA 1KKMA 2D2FA 2PX3A 2ZRLA 3B8HA 4IFDI 3OFNA 1PLKA 1G3MA 4QC2A 1M1KC 1JJGA 1Z8FA 2GESA 4MRPA 2AD5A 2WZQA 3OTOL 2NN6I 1XTJA 5KOYA 4HZUA 1CI3M 5LBIA 3TSZA 5EAYA 4GOXA 2BH8A 1U8ZA 1T0HB 4IEEA 3SS8A 4F4IA 3DOEA 4O3MA 2BBOA 1RJ9B 1OFTA 1MO3A 1N5IA 4GMDA 4Q48A 1K8RA 3WBKA 4FI3C 4C2UA 1AH9A 4AI6A 1T3LA 4Q21A 2VLIA 4MUBA 4LWCA 1V43A 4RZ2A 3RS5A 2FEMA 3S1MH 5B30A 1SHKA 1ZYRC 1S1CA 2RMKA 5EP3A 1JR6A 1CS4C 2IUTA 4MGYR 4EAQA 2VY3A 1C4OA 1TADA 4LF5L 1TF2A 2ZE6A 3R9XA 1OTCA 3KJPA 3NH9A 4TYNA 1UWVA 5EUQB 2V6JA 5KTYA 2NVTH 3ULLA 1MABA 3DOFA 4P72A 1E2HA 2EJFC 1GIAA 4DCTA 3QPVA 2KCTA 2R7DA 3L0SA 4IXMA 4IFDH 3K09A 4HAVA 1KI6B 1R5OA 3T1TA 2FZ4A 2G9NA 2MNAA 2IYUA 2A1AA 2J0VA 4BLOA 1Q22A 2ZJYA 4APVA 4NCNA 1T9HA 1KZGB 1S0UA 1ZCBA 1VPLA 2GA8A 2N78A 4TZ6A 4B3MQ 3S24A 1FTNA 2ZJOA 4NXML 1NRJB 4HB0A 3P32A 4LI0A 1S40A 5DLQC 4E09A 3THXA 4M22A 5IP7H 2NPIA 1GM5A 1NJGA 3QVVA 3VR4A 1CUKA 2J0QA 2WKRA 3THOA 2IYXA 4LFAL 4A3MH 4LF4Q 2BMFA 2J5XA 1EWIA 3N2IA 5KDDA 1VQFA 1X55A 4DV4L 3QY0A 4WJ3M 3C14C 4DJTA 2RKOA 2IUUA 5JMTA 1OXTA 1TQ6A 1XPOA 1E2FA 3C16C 1KGDA 4Q1BA 3EWAA 4R2HA 4OJQA 3OIYA 1G7TA 3UE1A 2IEZA 1P9NA 2GHIA 3SC3A 2WJGA 3K7UC 4RZXA 2IS6A 4Q4JB 4DUZL 1FNMA 4HAXA 4TMTA 4Q4AB 3ZQ6A 2EFDB 4PZ8A 1M90C 3EW9A 2D5DA 1XDBA 1N5LA 3M3YH 1IBLQ 1G7RA 2ZSDA 4KSBA 5J47A 1VQEA 1ZW6A 3I62A 3EPKA 3X2SA 4IPDA 1DARA 1VYUA 1HR0L 1OLOA 1NY5A 1SKQA 1W2GA 1YZQA 1Q3TA 4DLYA 2C9OA 3V4RA 4DK0A 2UXCL 3REGA 2I0QA 4H1VA 1GKHA 5AR1A 4M4SA 2ZTEA 1K0RA 1A0IA 3OYYA 2LXJA 1AQUA 1R2QA 1XZPA 2ASBA 4DR1L 1FP7A 4DRZA 2JLZA 1KC8C 1YRAA 3ZS9A 1W0JD 2VF8A 3ICEA 3Q85A 4ZV4A 2F7SA 4DDTA 2WSMA 1HURA 1ZM3A 3KKOA 3LX8A 2XB2A 4KXFB 2MO1A 1KDOA 1YBYA 1Q0UA 2Q6TA 3VR3A 2NOAA 3E5HA 4PG3A 1M2OB 4ASUD 3CRQA 1E9EA 3LLUA 1HE1C 1GP2A 1CKNA 3T51B 3W34A 3U4QA 3G82C 5FBQB 3CPHA 4TLEA 4LV5B 4Y7NH 3GTJH 1UBEA 1BBWA 1G3QA 4LF7L 1M1YE 1YVDA 2BEJA 1NMYA 4IOJA 2DHRA 4DV7L 2RHQB 4FINA 1Q20A 1WP9A 2V1UA 3R20A 3SEAA 5C2JB 5FPKA 3I5XA 2OBLA 2G3YA 2J7KA 1GUOA 2GWHA 2J87A 3QXSA 4L5TA 2OFWA 3IQXA 2UXBL 4NH0A 4D0GA 3LO5A 4JLMA 2JA7G 2VTKA 3A1WA 1S8FA 3QKRA 4JI8Q 3BZCA 4FMDB 2QP9X 1UKEA 2QUZA 4MQBA 4B6EA 1SKYE 1Z6GA 3X1YA 3I73A 3THYA 3IFTA 1YZGA 2L0XA 4V0ME 1W0JA 1Y3AA 4MDEA 2B63H 3W6NA 4RFSB 4KLNA 4JVMA 3G48A 3O47A 4PXAA 1GRQA 2FJUA 1N6OA 2W2XA 3BH0A 3GEEA 3B5JA 1TEXA 4ASUA 4DXAA 2O8EB 5HY6A 3GFTA 4PZYA 4H0LC 5GJBA 4OQLA 3M4QA 5JEAH 2RGDA 3IEUA 4CEHA 1GITA 1EWQA 2RGNC 1S3GA 2R65A 3E2IA 4POAA 2A2ZA 2ZYVX 4QQBX 1LFDB 2ODBA 2X2FA 2NZHA 1EFWA 4DV3Q 2IXFA 4A6XA 1R0XA 4LGMA 5IRCD 1KRSA 4LFBQ 2WJYA 1HH2P 2ZT9C 4C2MH 1EQRA 4LHVA 3PFIA 1G51A 2QAGA 2R92H 3M1IA 4E22A 2YOGA 4G3XA 4U02A 2OV2A 3W5JA 3SJCA 1XPUA 1QHXA 5P21A 4DIEA 4LJ9A 2WFWA 1E2IA 1WDTA 2Y8EA 3LA6A 1XWIA 3TQYA 1N36L 3AVTA 3GTKH 2F3RA 3GJ8A 2OQKA 4B47A 1NY4A 3VR5A 1UADA 5JWHA 3U3MA 2NZ8A 3GO5A 2ODWA 5IWAL 3KFVA 1IBRA 2ZRNA 3M85A 4L8GA 1EWHA 4UXHA 4MGZR 3MRSA 5M04A 3PSIA 1G8FA 4LJYA 3DMNA 4JLPA 4DR5L 4X8LA 3SBDA 3KJGA 4KO8A 4HAWA 5BYJA 3S1AA 1W36C 3LBIA 3CX6A 1U8AA 4A3FH 4DLTA 1OV4A 3PQCA 1Q8KA 3KDFA 2N3SA 2QG6A 3H94A 4PSKA 2XJ9A 2GZAA 4C3ZA 4TL6A 3GFPA 2QMEA 2PJZA 4WZ6A 5EXXA 3RR5A 1XTKA 2HV8A 5JWOA 3A8JE 1X54A 1W48A 1UJ2A 2X2EA 4BE7B 5JHGB 3K8YA 4PC1A 4GNXA 5GVRA 3RDPA 4LOAA 4B3SQ 4YY3Q 2CHGA 5DGXA 1S72A 2I3BA 5FL7D 4EUNA 3NBZC 3EAQA 2A5JA 5M5YH 3UATA 1E9AA 1EOVA 4DKAC 2FH5B 2XTNA 2BVNA 3ZVRA 4KFSA 1XEWY 3U61B 1G3UA 1IN7A 2FFHA 1N6RA 3KF6B 4LUOA 4KMUC 1NN5A 1MJCA 3G4SA 1KI7A 1PH1A 4UJ3A 2WKPA 3H1TA 4Q1CA 2J46A 4ZCIA 1P6XA 2HXSA 4IOKA 2PLFA 4W5HA 4B48A 1SXJD 2CWPA 3PITA 2JJ2D 3W5IA 3AFQA 3LNNA 1VQ7A 1Z0DA 4GOKA 3VHLB 1XNQQ 1N6HA 5CK4A 1GL9B 4EJSB 1UKZA 1O7LA 4I1SA 3GEIA 1Y8OB 1QVRA 1IY1A 4DLVA 4JJZA 1I4TD 4DV5Q 1VQ6A 5KSPA 2G0TA 4FIDA 2PEZA 2YWHA 4WAUA 1SROA 1C1YA 4FCTA 3EPJA 2JEAI 4DAMA 1DPFA 2CCKA 2P5SA 1R9TH 1EQQA 2VL7A 5CLQA 4LBZA 2Y0SG 3W6OA 2FSGA 3DMDA 5FL7A 4IFDJ 4LHXA 2G83A 3CMAA 2HDNB 5BN3A 3EBEA 4HLCA 3PO3H 3RABA 3R7WB 1W0KD 5J4LA 3DZDA 3BD9A 1HQCA 1HNXQ 3HR7A 4DR6Q 1KHIA 1SLJA 5KSOA 2Q3MA 1VYTA 2KHIA 3A7AB 1M74A 3J80c 1J8MF 1AKEA 1DAEA 1PJRA 1SXJA 2JJ2A 2AN9A 4HB4A 4B2PA 4URVR 3C5HA 1P2UA 3QBVA 5CIQA 3TKLA 4DBLC 1UKYA 4GLAC 3RZOH 2EQBA 5LMUL 3E1SA 3WRXC 2CJWA 2QGZA 2YTXA 2EWWA 1TU3A 1H9MA 4WZBE 4B75A 3DKPA 3KKQA 4M53A 2R7ZH 2BA1A 5IHPA 1VIYA 3RHFA 4AKEA 4R4TA 2QF7A 1MIUA 3I4NG 3AVYA 1R5NA 3OTOQ 4IDPA 4Q1EA 2GJKA 4CDGA 5JRJA 3VU9B 1J70A 2BM1A 3VKHA 2C77A 4TLBA 1W0KA 4ZCMA 3T06B 4QGAA 2WTUA 3PG5A 1N9WA 3FKIG 5ELOA 3A4NA 1TWHH 2LCFA 2H8KA 2JJ1D 1AS0A 4GOPA 4A2WA 1OH8A 2ZI4A 1KI8A 4X66L 1XNRL 4Q5IA 2Q3HA 2C03A 3T1YQ 5FBVB 3WNDA 2GAOA 3LQRA 1XB2A 4ZCLA 4WVFA 1S3OA 3PUVA 3D7MA 3IHLA 8OHMA 4BPBA 4BY7H 2X8AA 4DSNA 4HAYA 4POGA 1XEWX 5H68A 3WYFA 4PC7A 3A5ZB 2ZJPA 4RMFA 1TUIA 1US8B 3GLIE 3A5UA 4LJ4A 3U3OA 1W46A 3K0CC 1QHYA 3F5FA 4UXIA 2O8DB 2K7VA 2ES2A 5IF9A 3BFVA 5CJ2A 2QENA 1EG7A 2CVFA 3QKSB 4XTCS 4P4SA 3A8IE 4DNTB 2Q2TA 1QVAA 1GNPA 4ZKEA 4D82A 1I5FA 3NWJA 1KJZA 3ECCA 4BFSA 3LGJA 1U81A 5CDFA 1VQCA 4AYXA 3CRMA 4QM6A 3S1NH 4TQUS 4OWWB 4EPYA 1HNZL 4M1MA 1NTGA 3RYTC 3AVVA 3QEJA 4B3GA 2C5LA 3S16H 4DKXA 1IN6A 2E5LQ 2JJ1A 3PO2G 3W3AA 1N32Q 2ZRJA 5FLMH 4C0BA 5BR8L 2F9MA 4LPKA 1B9NA 4JI4L 1DELA 2EW1A 3KFXA 4DV1Q 1UEIA 1WXQA 4A8JA 1G41A 3EIQA 5DYIA 3IIKA 3HGBA 3OEED 1ZD8A 1KI1A 1ZU4A 1ZD1A 1MO4A 1Z0IA 4D0NA 5JEEA 2E2JH 2J0UA 2WWIA 5DNYB 2HIVA 5DI9A 3LW8A 3CP0A 4OHXA 5LD2B 1BYIA 1GILA 1KMHA 1SFOH 5BN4A 4BY1G 4DUZQ 4JYAQ 2WB1E 4EQ5A 2QPAA 5IYDH 4YWKA 1S3SA 1DAFA 3TUIC 5JEAJ 1W3SA 4Q4LA 3ZVNA 1IBKL 3HOWH 2H17A 4QNMA 4M9SA 5J4HA 2ANBA 1NVUQ 5GQOA 1RZ3A 4A2PA 4A0GA 1PYBA 3CAMA 4DDVA 1YQTA 5GADl 1SVWA 2KB0A 4Z8XA 2FN4A 1S4QA 3HR8A 2MMGA 1G5RA 2NVQH 3EIHA 5L3SB 3FOZA 4GSYA 4TLAA 1Q1BA 4P71A 2QROA 3CCUA 3BS4A 3L0IB 1BKDR 2YVUA 2PQAB 3OZXA 3FKSD 4C3JH 3W6PA 1Z08A 4HB2A 4CW7A 1NMGA 3OEEA 3UMSA 1Z6TA 1GRNA 4JG2A 1RFLA 2FSIA 2BC9A 5KO2A 1EYGA 4Q1AA 2BDOA 1N34Q 4QJFA 2ZYWX 4RZUA 1XMVA 4M1SA 3QIAA 2JQOA 2D3WA 3FE2A 1EESA 5DI3A 1ZNWA 2W83A 2ZU0C 3GTPH 2VNUD 2Z6VA 5EP4A 3UG6A 5EE3A 2XOKD 1E2VA 5FI0B 5C3EG 2XB4A 2C04A 4YWMA 4LZZA 3HYRA 1QUQB 5DHFA 1E9FA 2EXDA 1PA6A 1IM2A 3PV0A 1E69A 4A2QA 2WWWA 3V9PA 4RKEA 1IJEA 1ZAKA 5KPDA 5J5CA 4UP9A 2BHRA 5DIFA 3UK6A 2DGYA 2OFXA 2GXAA 4AQYL 4JJKA 3GLGB 5C44G 1CR1A 5DH9A 621PA 3CRRA 3QXCA 4O2RA 1H65A 4L8JA 1E9DA 1KOFA 4KBFA 1PH8A 1K6MA 1YEZA 1XJ0A 2KWIA 3R9WA 3FKSA 3LDAA 4BFTA 3CRW1 3IILA 4JI6L 1TQ2A 1PH6A 4YMTA 3SHWA 1UBCA 2R2AA 1QBKC 4GMXA 1J5EL 2V6IA 4GKKL 1WQ1R 1XTQA 4UNPA 2NO6A 2FDCA 2YC2C 3STBC 1E4VA 3WYGA 1II0A 4NYMR 4QGFA 5GJVC 3O8CA 5AJ3Q 2IYTA 3HYTA 1TEVA 2ZRBA 3KLWA 2XOKA 3OE7D 1D5CA 1ZUNB 2ZJ8A 4DV6L 5DISB 2IWRA 4DT1A 1L0WA 5CITA 3I1FA 3AKDA 1ZMXA 4LJAA 1TQDA 3NELA 2A6HC 3HOVH 1U94A 2B6HA 4LJ6A 4BLPA 3UDGA 2GZHA 4Z1MD 5B58C 4IFDG 1L7VC 4MNOA 1VKJA 2D0OA 4A3CG 3TSWA 1B9MA 1MJEA 2D62A 4LFCQ 2ODNA 2KCMA 4QHSA 3K0EA 1E1OA 3M4YA 1GAJA 5SZKB 4Q7MB 2IHBA 4AKIA 1NY6A 3D0FA 1W2BA 2WIBA 4TTQA 3K9NA 4UJ5A 4NZYA 4KODA 1YITA 2ID0A 1W5TA 4MA4A 5IP7G 1J7KA 4B71A 3UMFA 3VX4A 3DKVA 1Y1WH 1YZTA 4HDCA 2UUBQ 2R44A 2VHTA 3NTUA 4RCZA 5KUTA 2WPDD 4A3MG 1A2KC 1NN3A 1QVFA 2ZM6L 1XTSA 3CZPA 4ZI2A 3KXKA 1I2DA 5TY0A 3H86A 4JKYA 4C0HA 2ZYUX 4DR5Q 4B3DA 1CTQA 3OE7A 4NDZA 1X1SA 2V55B 3T15A 1P7CA 3B6EA 4LYAA 4BA2I 4B3RQ 1GO3E 4PZ6A 1G6HA 2CE2X 2VH5R 4Z1MA 2FOLA 3WDNA 4JS0A 2PNHA 2V54A 1U98A 1XEXB 2IT1A 2RB4A 3S15H 3EA0A 4UNNA 1P8LA 4EFLA 3AM1A 4IJHA 2BKUA 2W2TA 4TMWA 4A0HA 1TU4A 4LX0A 5K36H 3AGQA 3ADKA 3B13B 4U7DA 2VP9A 3ZZUA 1ESMA 1RJ9A 2GN5A 3TR5A 4OWTB 2HXYA 3WNBA 1GNRA 3GJ5A 2BV3A 3U4VA 2WPDA 1Z9FA 2WWXA 2Z83A 3NBHB 2CK3D 2NVYH 4ZDKA 4B35A 4QGUA 3A6PC 3S1RH 5DN6D 3N5CA 4PAOA 2AD1A 4WW0A 4A3KH 2IF0A 2OBNA 3QBTA 2F4VL 1YJNA 5C4JH 4HJ9A 1GSIA 1KDTA 1KO7A 2JA1A 2Z4RA 4KFTA 3AYHB 3PUXA 4D6PA 1CRPA 2MSCB 3MFYA 2C96A 4B33A 2OCYC 5TVKA 3OESA 2F1IA 5H1SE 3P1JA 4PTLA 1FX0B 2RGEA 4GS3A 2QT0A 4RD0A 1KI6A 4MKFA 3NBXX 3AFPA 3B1VA 4PAQA 1KY2A 4L5SA 2ZJ2A 4OHWA 1F2TB 4DSUA 3OPOA 4IDOA 1I2MA 1L1OC 2AKYA 3UANA 1CRQA 4O0AA 3VA7A 3FMOB 2EVBA 2WIAA 1CJKC 1E1TA 3S2DH 3D31A 1QZGA 2FGKA 1T5IA 4B74A 2CK3A 3I5YA 1WBDA 4G5GA 4JT4A 5DN6A 1N6IA 5M3MH 2XITA 2DWOA 1E2KA 1B70B 3ZZ0A 3QG1A 2ZRHA 2JLSA 1S96A 4JVSB 4CRWB 5FOUA 1NG1A 1ZP6A 4AWXA 5IYBH 1ETUA 1L8QA 1V5WA 3CF0A 1OIWA 4HUQB 4B73A 4E03A 3ICQB 5LMUQ 1XXHB 1HZCA 2BE5D 4YCUA 4D2IA 1BKBA 2Q9BA 4U00A 1Q12A 4LRWA 2JA8H 1NKTA 3HPRA 4OL0A 4YLGA 1W36B 2P6RA 3AVQA 2V4ZA 3KJHA 3QF7A 4Q4JA 5KNDA 5JEDA 2IS2A 4Q4AA 3K70B 4LK2A 1X3EA 3FPPA 3JC66 1C0AA 2YTYA 2G77B 4OBEA 3GP8A 1N0VC 1IYVA 4GKJQ 1QHGA 4JOIC 1QVGA 1BBUA 2OCBA 1R0WA 4NYJR 2QEXA 2R7FA 2PEYA 1TPZA 2K5UA 5J4KA 1XF9A 4HIMA 2A6ED 4IO9A 2R92G 2QAJA 1XJVA 3LW7A 2MSDB 2PCJA 2F9LA 4TSFD 4QJ3A 3NDBB 4GT1A 2ZJQA 1P16A 2AWNA 2C9YA 2FX3A 2V1CC 2RGAA 5GAEC 3QKUA 4YDSA 4B44A 4R71A 4ZIRB 1Q90A 3N6RA 2WBLC 1VG0B 1KI4A 3TNFA 4GPTA 1D2NA 2RHSB 2ZTSA 4ARZB 4URXR 4LJZC 2JK8A 1W5SA 1U9IC 1UKVY 2V8OA 2KBNA 3EZ6A 3ADCA 1XD2B 3FPAA 5CYOA 4YMSA 1TXYA 1ZNZA 4B3TL 4Q7JB 4A76A 5KSYA 3C41J 1XZQA 2OBMA 3CPEA 2FA9A 4LJ7A 3CC2A 2K4KA 1X86B 1E3MA 2CCGA 2Q8IB 1T3HA 2PMDA 3N70A 1WFQA 3TJZA 3ZGXA 4H1UA 3STBD 5E7IA 5HPYB 4BFYA 1T0JB 3MWJA 4A3FG 4FMCF 3QENA 3T35A 4R4IA 3B7GA 3V00A 1ZJ6A 3QQ5A 1I94Q 1OH6A 3UDIA 4LF6Q 4MGIR 1IBML 3MWKA 4LF9Q 4G7HC 3KQLA 4A3JH 5FTNA 3DO6A 2QMOA 2WAQE 4K0KL 2WKQA 2NO1A 3VQTA 4BFUA 2F55A 2GCOB 2WICA 4TSFA 1Z07A 3RRZA 2E8GA 4H13C 1CSQA 4OWXB 1D9XA 1YJ5A 2QP3A 2R6AA 3A1TA 4P75A 1FMJA 3A58B 4K81B 3RLFA 1J8YF 4C3IH 1KJWA 4EPVA 2YOFA 2MQHA 3FMCA 4JI5L 1EIYB 4ZI3A 2ZIAA 4A9AA 4RFSA 1W4AA 1DXMA 2KBFA 5FFMA 3DM9B 3R8CA 1Z2AA 2R9VA 1R8QA 1CFMA 1JB7A 2WMOB 2WV9A 2K52A 5HZKA 2O8EA 4DUYL 2GVZC 4MYUA 1KZ7B 2F1HA 3CX7A 2DFLA 3L82B 3MCAA 4KFRA 4DR2L 5C3EH 4KHPL 2VHQA 4HR7B 2Z6KA 4MKIA 3AEZA 3AP2A 3CNNA 1N6PA 3BORA 4PZZA 3VR1A 1EFTA 1N8RC 4E07A 1AA9A 1AZTA 4URWR 1VCOA 1NJIC 3NBYC 3W1BA 3PF5A 4GZLA 4NTZA 1IAQA 4QJ4A 3TE6A 3ADBA 4M2LA 2WWYA 1VQKA 4RSGA 4R1JA 1LTQA 2ORIA 2Z4SA 3SYNA 4P3YA 4Q9IA 5C44H 1VQ4A 2ZRFA 4DSOA 3B1ZA 1UE5A 2X77A 3OIWA 2WJVA 3MJHA 1T4GA 3IUYA 4ILEA 2O8BB 4A75A 4CGZA 4AG5A 5ELNA 3RN5A 2UUAL 3J7A5 1IY2A 2BMDA 1Q21A 3U7EB 1E2QA 2VW9A 4C9BA 3SOPA 3IRBA 2IHEA 2B92A 3PO3G 1M7HA 3PCRB 4PC6A 5C4MA 2G88A 3KQHA 3BJIC 2PI2E 4L4UA 1JMCA 3QF4A 4DV2Q 1P72A 3NVAA 2DWQA 2A5YB 1MKYA 3BK7A 2PPBC 1KIXA 1GUNA 3KUCA 2VL6A 1GVNB 1VG1A 2CCJA 5D3MB 5AJXA 3ZD7A 4AH6A 2ZR7A 2CFMA 4OHZA 2UU9L 2UUCL 4JI3Q 1ANKA 4FD2A 4HJ8A 5HE9A 1CKEA 1TQ4A 1YR6A 2ZEJA 2LSSA 2FF7A 4A3CH 1P4SA 2ZRGA 2KSQA 1XJQA 2J45A 3LWNA 1TWAH 2CEAA 4DV0L 2R7ZG 3HU2A 4Y0AA 5D3QA 4Q18A 2CL6X 3T1QA 1ESNA 4I4LA 1KSGA 4L9SA 2X1VA 3WRYC 3LVQE 2K75A 3L2OB 4IDHA 4YHHQ 4YQFA 4I1UA 1QHHB 3KOJA 2AL7A 1SVMA 2QZ4A 2EJMA 1X6OA 1KY3A 1VQ5A 2QGNA 3Q7PA 1HTWA 1KKLA 4KVAA 1X65A 3ZH9B 3CONA 4P32A 4S35A 4B76A 5FTLA 2XTIA 2R6GA 5J3BA 5CJPA 1IL2A 5A5GA 2OO7A 2REXB 2QRNA 2VP0A 1T6NA 3KF6A 4GKKQ 3LX5A 3ULPA 2W0SA 4QRHA 2FPKA 4RZ3A 2H1LA 3DM3A 1J2JA 1WF3A 2BBWA 5B64A 4BRWA 3KQUA 3C5CA 5JJIA 3ZJYC 3RANA 1NJFA 3CD6A 3M9BA 2K32A 1G5PA 4BY7G 4MRVA 4A4IA 1G8HA 4DV6Q 3BB1A 1SVLA 4EJSA 1YHAA 4HIOA 2VUMH 4LCBA 5HTKA 2RGCA 4K46A 1JJVA 4LBYA 4QHTA 1FW6A 2HHHL 1GKYA 2AX4A 3EN2A 2VP4A 4UKDA 2ZJRA 5JS8A 2V3CC 5SZHB 4QY7A 2VHUA 4URUR 3VNUA 3TREA 1FOEB 2Z43A 2ZSBA 3OIVA 3NEYA 1F6BA 3R8FA 1JPJA 4IJMA 4KYIB 4NYJQ 3KFUA 3A4LA 4BWYA 5FUXA 2W2VA 3KDSE 1NF3A 2Q9CA 3R7WA 5F3WB 1HNWL 4AKHA 2GK7A 1IXRA 4LC0A 4FXPA 2GETA 2K50A 5FLMG 3KJEA 4JLNA 1VQIA 3S14H 4M1TA 3W90A 3D6TB 2W6JD 1QHNA 1NSTA 4AYTA 3IKJA 5A35A 1HT2E 1KAOA 3L2PA 2I4IA 3LH5A 2WB1G 4RKFA 4Z8YA 2OZEA 2VQFQ 1G8PA 2HT6A 3T5DA 2DCUA 2Q9AA 3TUZC 4IPGA 1HE8B 2ZJBA 3HU1A 4NBSA 3RS3A 3H84A 5FI1B 821PA 2C8VA 1Q86C 4JBKA 1CBUA 1JPNA 4JI2L 4LC1A 2JASA 4JI7Q 5IYDG 4BASA 4ERNA 1G6OA 1OHHD 2E75C 4EPXA 2C35B 3HOWG 1YJWA 1KSHA 4RD4A 3PENA 2UXDL 1E0JA 1CEEA 4RCYA 3S2HH 3VU9A 2PCFB 3U6KA 5LB4A 1NP6A 2ONJA 2A5FA 2G0NA 4DLXA 4D26A 3L8ZA 5HR5A 2GVDC 3CWZA 2JLVA 4TN1A 2J0SA 4TYPA 2PI2A 1Z2CA 3HOUG 2BH2A 4JT2A 4JBWA 1BMFD 4KSCA 1SXJE 1O3YA 2Q2HA 2W6JA 2ZJZA 3OAAD 4JBYA 4JIMA 4IJLA 1P75A 3QXHA 4PANA 2O8CB 2C95A 4NKRA 1AGRA 5GJWC 2A7QA 4DR3L 4NPHA 4DLRA 3CXCA 2XNSA 1DAHA 3P4XA 1V8QA 3HOZG 5SZJA 1D7QA 4F7WA 1GNQA 3HPQA 2EQSA 1US8A 3U58A 2H92A 4M1KA 2TMKA 4DAYB 4UNQA 4B2LA 2O8DA 1II8B 4M9QA 5H70A 2V4DA 4JLKA 1OHHA 4EFMA 4A0FA 4V0NA 3RSLA 1R8SA 4NXNQ 1N5JA 4G01B 3Q8DA 4OX9L 1DTSA 3U3JA 1S2MA 1IZ6A 4UP7A 4KKSA 3K0XA 2K5NA 1D2MA 2FFAA 2OG2A 2WOOA 1IXSB 4HAZA 4HSEA 3GLHB 3ONWA 5FR1A 2VYFA 3EG5A 1C7YA 1H8HD 4H9GA 4EPWA 1K8AC 1RRCA 2GZDA 4NP6A 2ZXUA 3RC3A 3DVLA 3TW4A 3SJAA 1JJ2A 1BMFA 2VSFA 1ZNXA 2O5JC 1DE0A 2A5GA 1VHLA 5C4XH 2QM8A 1D2EA 3OAAA 4PSVA 3U3RA 3W3ZB 4DCVA 2JLWA 1VQNA 3OW2A 3FHWA 3BFXA 3UPUA 4PHHA 4DK6C 5IYCH 1T8UA 1Q1ZA 4A4DA 5EXTA 1Z0FA 4Q1DA 1ASZA 2WWFA 2YU9H 1LM0A 2F43B 1DEKA 2C98A 1T5EA 1IQPA 3I72A 1CULC 1W1WA 2QY9A 3P26A 3Q72A 3REFA 4DHEA 3K70C 1SGWA 2CL0X 5CB8A 1N33L 1DG3A 4JLOA 3HOVG 1GD7A 1E2DA 4DR7L 2ZVQX 5JS7A 5F98A 2GF9A 4KCGA 121PA 5CDFE 3ZZTA 2PNRC 2VSOA 2F1JA 3AUYA 2VO1A 1AE2A 1AKYA 1A6XA 1GTVA 2PT7A 3WHKA 4XSGA 4C0AC 2QT1A 1H8HA 1COWD 4DR4L 1G3IA 1VIAA 2QTVB 5G40A 2BBSA 4PHTA 4JI0Q 3GTMH 2E74C 5E3HA 1VQJA 2GVBA 1W47A 2EYUA 2H7VA 2XTMA 4HDQB 4US2R 4XVUA 5K8UA 2NQ2C 2PQAA 3NHAA 3B9PA 4D0LB 3RS2A 1Y1WG 2IYQA 2IYRA 2R6DA 4J0QA 4TMKA 1TUEA 3WMEA 3DHWC 2QU8A 2FFBA 4HI0E 2FEOA 1P60A 1Z06A 2EDGA 3GLFB 2GRJA 1DCZA 1RPZA 3TK1A 3BB3A 1LS6A 1M7GA 5LMNL 3PEVA 1W7AA 4OQNA 4G0NA 2IUSA 5AJWA 2ATWA 4G5SA 4EFNA 2VQEQ 3HDTA 2A69C 3GTGH 5E7NA 4KN4C 1G16A 3GJ0A 4NE2A 1QUQA 1YZLA 4UY8C 4JVLA 2DFTA 2OSBA 4QGHA 1XTRA 3X1WA 3CCJA 3CCQA 2C99A 1P3JA 4X62L 4IDNA 4C0QC 4M9XA 4X64Q 1DG1G 2W0MA 3KZ1E 2CWAA 1G4UR 1LVGA 1COWA 2DN8A 2OHFA 5KDLA 3QXXA 5BQ5A 1HYQA 2ONKA 4AIMA 1HT1E 1L1OB 3ASZA 4BLTA 3GLGA 4A92A 5K36G 1ZNYA 4Q02A 1K5DA 1MO5A 1AE3A 1E9BA 1HY3A 1ONBA 1U0JA 1XTDA 2MFIA 3GDEA 1QG2A 4O2DA 1WE2A 2CKZB 3EIEA 4FN5A 1N25A 2LWIA 2VP6A 2CLSA 1SMYC 4GBMA 1LF0A 1UM8A 2HF8A 2Z0SA 3AQQA 3RAPR 4RY2A 3L7ZC 1FVIA 2J9RA 1KK1A 2P6UA 4A3KG 1NI3A 3IIJA 3ZD6A 4URYR 4KHPQ 1U2RA 1FJGQ 2IYZA 4NCKA 4TYQA 1DGSA 1VQ9A 4I99A 4BFWA 3K0FB 3OHMA 2GEUA 3TMKA 3FMPB 2D0PA 2N46A 4XH9B 3A1UA 1MT0A 1W4RA 4QBHA 1P5ZB 4HLUC 4AYWA 1E32A 4C7OB 3U7HB 1DD2A 4BZPA 3H4MA 2DFNA 2DPXA 2PH1A 2VQSA 2IYYA 1UAAA 3VFDA 3HOYH 2YTVA 1GZSA 4LWZA 1MKHA 1YNXA 1KSFX 3QPUA 1AS2A 1N0WA 2NO9A 2OESA 1JB1A 3TUJC 2XXAB 4A0RA 2GCNA 2OAP1 3KYHC 3A8TA 2VS1A 3LXXA 2ZRCA 1QDEA 3TSOA 1OXUA 1GFIA 3CH5A 4AK9A 1PYSB 2LKDA 5M3MG 4LF5Q 3L0OA 2O8FB 2CCZA 3RS7A 4KBGA 1FMLA 4BXXH 3AEVA 1Y8NB 2F52A 5G3YA 4A3EG 3IGFA 4XD7D 2NVXH 4OQXA 2JIZD 3O8BA 4OK6A 4QBFA 5IYBG 3AVWA 2GEVA 3SDZA 4JLAA 4DUGD 1U0LA 3GJ4A 2XX3A 5ANRB 3I32A 4BLRA 2JA8G 4P74A 4ALPA 3PUYA 1Q7YC 1DOAA 1S1MA 4P31A 3I4LA 3TBKA 1W4CA 1E24A 3PJRA 5JSZA 3F8TA 2JA6H 1FUUA 3H3VI 1EFCA 2E2HH 4NXMQ 4JBXA 4TMZA 1FQJA 5EE9A 5IE8A 5J4VA 4L5BA 3WHLA 4NB3A 1JECA 3KB1A 1LABA 3KL4A 1OB5A 2JA5H 1SHZA 4OQFA 2FXQA 1IW7C 4LFAQ 3NXSA 4Q9KA 5TDHA 1E1RD 2ZE8A 4P4TA 2A5DA 1KAWA 5FPSA 4DV4Q 3UE0A 3CQZH 2E1RA 3EC2A 1EFRD 4RJLA 5M3FH 4OONA 3I4MG 1LS1A 1OKKD 2IBMA 3S1QH 3OEHD 4M0LA 1TWFH 4P0TA 4F92B 4EPRA 4OO1I 3ZVMA 3LV8A 4M8NE 1SRUA 4YC7A 3F2CA 2EU8A 4E5UA 4XD7A 4CYMA 2QTHA 1FTSA 4JLVA 2JIZA 1P62B 3FHOA 3EPLA 1FR3A 2NPFA 3LD9A 2QL6A 4DUGA 3VR2A 5JRZA 3RN2A 4PO8A 2A68C 2FMXA 2RGNA 2OEPA 3C7KA 5IY0A 1CF4A 4GN4B 2VIIA 4Q4HB 1GHKA 1K8MA 3TEHB 1FZQA 1XX6A 3FB4A 3SE0A 4DB2A 3AB9A 4HATA 1FX0A 5FTKA 3VMFA 5LDDC 2ZI5A 1KO4A 1OT3A 2WAQG 3SR0A 5H1YA 2REBA 1HR0Q 1WRBA 3H3VH 3K70D 4C30A 1OB2A 4QL5A 3SNHA 2UXCQ 1F2TA 2ZS9A 1E6CA 5CM8B 3PXGA 4DPGA 3GEHA 4ITRC 1PVOA 4A3JG 1DS6A 4LYJA 6Q21A 1V1QA 2Q2UA 2RF4A 1E1RA 3ULJA 4DR1Q 1HCZA 2HUPA 2IW3A 3T5GA 4DVGA 3IO5A 3UXMA 2ZRMA 3HOUH 3CRLC 1Q81C 1HNWQ 1EFRA 4JBMA 1FP6A 3OEHA 1OKKA 3FHTA 1F5NA 2ZR9A 3WP1B 2O0HA 3CCSA 2RH5A 1XEFA 1FNNA 1YR9A 4IW3B 4TKOB 4TQAA 5AUNB 4OO1H 1PLLA 2K33A 2OWOA 3TW8B 3DXJC 1QG4A 1FGUA 3LXRA 2QA5A 4DK1A 3HOZH 3AQ4A 4KHZA 2H16A 2FG5A 1E0AA 3AKCA 4GP7A 5DE3A 3Q8XB 4LBWA 1XXHA 3I92A 1L2TA 2QRZA 4QJ5A 3K8AA 3AP3A 1GHJA 2Q3FA 4LF7Q 1E94E 2VEDA 2BCGY 1CJVC 3BBPA 2H18A 3EZFA 1OFIA 4ACAA 721PA 4DV7Q 1LYLA 2XTZA 4LHWA 3UKDA 3KJOA 1KIMA 3CPJB 5B2ZA 2ZUBA 3KTAA 2REOA 1YU9A 4MYHA 4JSYA 2UXBQ 2UXDQ 2GBLC 1OPXA 2L15A 3HKSA 1D9ZA 1DVRA 2RGBA 3B1YA 4KVGA 3WP0A 3I2ZA 5C0XI 1L4YA 1PZNA 2AK3A 3EZ7A 1CR2A 3FHCB 3Q7QA 3VKGA 5FOWA 1OH5A 4X6AH 4R4OA 2GJAA 2ZI6A 3H15A 3NC0C 4ZIRA 3K53A 2F6RA 1ZM9A 3B6YA 2NO0A 2ZRIA 4GP6A 4PV1C 1RIPA 1VTKA 5GAHC 4A3GH 4HYYA 4DB4A 3CX8A 4ARZA 3QE0A 1R7RA 4V0OA 1I6VC 1B8AA 1G9XA 1XD2A 4B3ML 2ATVA 2DUDA 1NN1A 3E70C 5AJYA 2ZETA 2ZUCA 3MSXA 1OXSC 2YNMA 3CCVA 1SKYB 2R6FA 4TT3D 5GADC 2J59A 2CW0C 2E76C 3T1VA 2CBZA 1WBBA 1GKIA 4GNKA 2B7BA 2RHDA 2PLRA 3F3YA 4B2IA 4LF4L 1A82A 1DAIA 4LF8L 2BMEA 2KE5A 2WJIA 1TKWB 3A7LA 1YVCA 1K8OA 3NBFA 4BFXA 3ZVLA 4D80A 1GWNA 4TYWA 3A74A 2EFCB 2V1XA 1DAGA 2JLRA 2GCOA 4Q19A 1UE1A 3W1GA 1N36Q 1K8GA 4RFVA 5C0XH 5C46F 4G5RA 4X65L 2HF9A 1Z63A 4NYIR 1GUGA 1V9PA 4L5RC 2N1BA 1LY1A 2XJ4A 3FKQA 1OYYA 5IWAQ 3PEUA 3PIRA 4IFEA 2QNRA 1FPMA 1KD1C 2OTJA 1KXLA 1XRJA 1IBLL 1ZC4A 1PH9A 2Z0MA 4FCVA 4JKIA 3T61A 4XWKA 1ZM2A 3FMFA 1GVPA 4WOPA 1NMXA 3MXUA 4DNRB 1MR3F 2CVHA 2ZRPA 4TT3A 3U44B 2F1RA 1I3QH 2WWGA 2PZFA 5C4GB 2B8FA 5IT9c 3K80C 2WM9B 1E2GA 4QBGB 3NC1C 2VUMG 4Q47A 4LUZA 4Z51A 1XMQL 3RWOA 2O0KA 3QEOA 1Q46A 3AP1A 1UE7A 3AB3A 2BA0A 1I4DD 1XMIA 2O8BA 2KI5A 4UNRA 2EFEB 1ZCAA 3K09C 1Z83A 5C18A 4XWOA 1MH1A 3U4ZA 1ZIOA 5FUYA 4IVQA 4ZKDA 4KITB 1CSPA 3D3QA 4NONA 4M1WA 1IW7D 3SJZA 2FE4A 5TB5A 4C0LA 4P33A 4HJ7A 2ZRAA 5FLXc 2NGRA 5L3VA 4B32A 4MITA 3J81k 1TL7C 4LY6A 1E79D 2PCLA 5EJEA 2GCPA 3KLRA 3CRVA 4KV9A 2IX3A 3TLXA 4JI8L 2YZ2A 4PZLA 2IWHA 5BXQC 3RZDH 2QEQA 3T53B 1F48A 1FQKA 1G19A 2FGJA 1HTPA 2IYSA 1KYIA 3LFUA 4WIAA 4DNIA 3I56A 5KHOC 1RL2A 3K0CA 1HQYE 1G6PA 1A8VA 2IXEA 4PHGA 2JEBI 4X62Q 2NZOA 1Z0AA 1Z28A 3A1VA 2ZI7A 3NEMA 3HU3A 4QGGA 5JWRA 1Y8PB 3PUZA 3CPFA 5L3QB 1QHHA 5HZHA 1O87A 1ODFA 1XCPA 2QP4A 4BBSG 1T5LA 4Q9JA 3B60A 3HWSA 4FMDF 4GFDA 1PH3A 3RRMA 5AJVB 3KQKA 2IX0A 3AVXA 2IYLD 2ZREA 3AGPA 4DV3L 4HZIA 4A1FA 1G64A 4U5XA 1Q3HA 4TL8A 4A3EH 4LFBL 4R7ZA 2GEDA 2QSYA 4AKGA 1X9NA 3QG5A 4W7SA 2QQEA 1E79A 4RVCA 3KXLA 2BEKA 3JAMc 2HQLA 1F60A 5KU1A 1GL6A 3EIVA 4TTRA 2DFKB 4JL6A 4Q7KA 3FFAA 2Q21A 2K14A 1DADA 1W49A 1CKOA 4A3LH 1VCMA 1QJOA 221PA 4O0MA 2FWRA 4KLZA 3IO3A 4CEIB 3J80i 1IN4A 3SI7A 5FOTA 4EIWA 1AQYA 4GLVB 2YOHA 4HIDA 1JXOA 1ZVQA 2PMKA 1HZ9A 4JL5A 2P3SA 1HEIA 1OSNA 3WBJA 2Q2IA 2QA4A 2HEIA 4PO9A 3I4MH 1IJFA 3G5UA 3QI2A 5BN5A 3F1ZA 1G21E 3PGZA 3BH7A 3PCOB 3CUEF 4FCWA 2JEOA 3I3SR 4OK5A 3TH5A 4X66Q 1XNRQ 1XD9A 3N2EA 5FL3A 3W9YA 4R4QA 3SFVA 1CTMA 4N0DA 1OF1A 3I4OA 1E2MA 3U60B 4PSAA 5C4XG 5DHAA 3G71A 4PFSA 1IYUA 3NH6A 3MGCA 3CH4B 2C9CA 5IYCG 4A93H 3PVSA 3GLFE 4YY3L 3J7ZC 4DEYA 3IBYA 3CW2C 3V4FA 1ZINA 1SVIA 4M21A 1H95A 2D4HA 2JCSA 3CIOA 5KYKA 2W58A 1SQ5A 4OJKA 4PC3A 3U3KA 4OI0A 2XZLA 2JAQA 3GJ6A 4R4CA 3C8UA 2BKEA 2DNCA 3K1JA 5FPTA 3U7FB 1X8KA 4DZZA 2E87A 2J1LA 1KI2A 1OW3B 3E9HA 1L4UA 4LDJA 2A6HD 1Z29A 2GXUA 4BEJA 1VDZA 1HNZQ 1E2ZA 3BH6A 5FUVA 2CE7A 4KJZA 4C0KA 3MJRA 4JI1L 3I55A 1UDWA 3SJBA 1JEEA 4MKHA 4MYTA 4D4KA 1XNQL 4W9MC 3GLIB 3RLOA 5BR8Q 5IT5A 5AK0A 4JI4Q 1KNQA 4NYIQ 4JV5L 4K8OA 4BFVA 3G6EA 2PZGA 3SGIA 1YZNA 3BXZA 1WJJA 4M1OA 4G1UC 4DV5L 2QAGC 5CIWA 3SQXA 3IIMA 2QMUA 3K0SA 4PZ7A 3CLVA 2B3GA 2HIXA 4V0KA 5BYKA 4D4JA 1UEBA 1Z22A 4I1OA 2FU5C 5FJ8H 2O8CA 3MAAC 5JJLA 3IPYA 3FGNA 3OIUA 4B3BA 1NIPA 4BBRH 4GI7A 3EQLC 2A78A 3B2EA 3SQWA 1B23P 5LMNW 1KK3A 4IVRA 4WA7A 1NIJA 1WCV1 3DZ8A 2OM2A 1KK2A 1Z5ZA 1IBKQ 4NCHA 4A15A 4DLWA 3RSOA 4BFZA 1II8A 1K5GA 4BGDA 1G20E 3P20A 2BBTA 1WOCA 2RHMA 1LB1B 3FYHA 3TAHA 1LW7A 3MEFA 2DNEA 2YV5A 3CF5A 2B21A 1QHIA 3Q3JB 1MRSA 1VQGA 4FWIB 4ESVA 1G17A 1KI9A 1W4BA 2UVQA 2ZRKA 5M5XH 1VQPA 3RRYA 2IXGA 2AFIE 1YI2A 2WOJA 1NLZA 3CWQA 5JSZB 2QPTA 2XAUA 3JVUA 4RD2A 3SU8A 4LUCA 1YHQA 2VPPA 3AF0A 2DY1A 4OHVA 3PR1A 2IEYA 3K0AB 3UDXA 5C0XJ 4JLDA 4GNXC 2K5VA 1XMJA 5TV2A 3ZYCA 1RYHA 1JBKA 1QZXA 1RVDA 4HJAA 1MRNA 3UG7A 4HDOB 1E4YA 3CKLA 4PC2A 3MWYW 1P2SA 2IA5A 5JZVA 3RNLA 3R9IA 1E96A 3WYAA 2F43A 3UWOA 4DIDA 3CR8A 1JNYA 4X8OA 3NENA 2DYKA 2PBRA 1UDXA 5IP9H 2ZI3A 2ORWA 1EXMA 1VQHA 1XCGB 3L0PA 1NBMD 4CT5A 2WAXA 1PH5A 4TL7A 1KDRA 3SHFA 3IEVA 3TZUA 2G1KA 3QXJA 4FW9A 1PH2A 3T1OA 1NKSA 4TZ0A 3CB4A 5CLLA 1QHSA 2FFQA 4AQYQ 3T1YL 3CZQA 1TWCH 2ZSAA 1ONLA 3HKZE 1DBSA 4Q00A 4PQRA 1PMRA 2NO7A 4NPSA 5EXSA 3UMRA 1Y1VG 1CJTC 1N2CE 4GOJA 3LY5A 2UZ3A 1FYCA 4JI6Q 3HOYG 1EK0A 1R10A 1U0HC 4JYCA 2AKWB 4YMWA 4TLDA 1VQAA 1M7BA 1J5EQ 2AHOB 1H9SB 5F2EA 2XSZD 2F1MA 5SZIA 4GDFA 3NE5B 2NN6H 4N1AA 4XWAA 1JR3E 5JI3E 3TQFA 1S9HA 4M1YA 2HT1A 4O2LA 4BXXG 1BS1A 3H2YA 4XVQA 2UKDA 5AUQA 3QOFA 5KDOA 1NE3A 3GLFA 1NBMA 2N49A 1SVSA 2OXCA 4KYUA 2YKGA 3H0GH 2E5LL 5G41A 2XZPA 1N32L 1CR0A 1KNXA 3THWB 4LF8Q 1SXJC 2ZRDA 1RKBA 1YIJA 1DAMA 2BOVA 4DK3C 3BC1A 4Q9HA 1FL0A 4DV1L 5FTMA 4ABYA 4GN5A 3ZIAD 3J81j 3VDYA 1FFHA 2ZPTX 4PHFA 5HE8A 5JFGA 1ZC3A 3GPLA 2JA6G 4DCSA 3EPHA 1A1VA 3K9LA 2AKAB 2FV8A 2B8TA 4KN7C 4RG1A 1Q1QA 4HEJA 4A3IH 4CEJB 3PUWA 4X65Q 1L1OA 3AVOA 3WNCA 3GD7A 3P27A 4A6PA 2JA5G 4RD3A 3EASA 4ME3A 1L2FA 2PL3A 1PFSA 4JYAL 2EYQA 4A3BH 2FZLA 1N6NA 3D8BA 4FWTA 2ZM6Q 2FNAA 4I1VA 5DYGA 1W36D 3IDQA 2IYWA 2XSZA 4TTPA 4OHYA 1BDOA 4PAMA 1Q57A 1WCMH 2GVAA 5M3FG 1G3RA 4UPAA 1OFUX 2AFHE 4KI0A 5JJKA 1AZSC 1KO5A 4JL8A 4AY2A 4V0LA 2ZJAA 1EGAA 2JGNA 2GKSA 5JCZA 2H5XA 4JLBA 3QKRB 2IYVA 5KNBA 4GOPC 1C9OA 4TL9A 5BW8A 1Y69U 3A36A 1CJMA 3PIPA 3Q5DA 2JJQA 2J7PD 2ZJ5A 1R4AA 5FOVA 4LK1C 3EXAA 3GJXC 3K0FA 1VQ8A 2KENA 2G6BA 5GJCA 2D2EA 2I1VB 1ZIPA 2A30A 3ZIAA 1XMQQ 3FFBA 4GN3B 1ZM7A 1DO2A 2OFOA 4DCUA 1P61B 4BBSH 4QG7A 4C7OA 3J81c 1WYDA 1VQMA 1QVCA 1G5TA 4A3DH 2GXSA 2QQ0A 3EWSA 5DLQE 1MOZA 4JOIA 3HP1A 1M8PA 1N34L 4XVRA 421PA 4D4MA 3QSYA 2E2IH 4PPGA 3IQWA 4Q7LA 4IVPA 2CHVA 4II7A 1JJ7A 4WXRA 2VP2A 3B85A 4W5WA 1E2NA 1AS3A 2W00A 1UEJA 2XXAA 3I61A 3DM5A 4DCNA 1GG2A 1K73C 3GTQH 3CC4A 2GAAA 2F4VQ 5UKDA 2VHJA 2O8FA 2QBYB 4JK1C 4CF7A 4OO1G 2CNWD 5AUOB 1F2UB 4L5QA 5ELXA 1U9IA 1NMZA 1SULA 2BJWA 1IYJB 1E2JA 1JR3D 2P6NA 1Z47A 2ALYB 2MSEB 1I50H 4HJ5A 1YRBA 2OUKA 1XPRA 3OW7A 4PMWA 1JEDA 2J7PA 2VP5A 3DEFA 3KKNA 4A8JC 4EDHA 3MD0A 5EE0A 5FBRB 2ODEA 3QKSA 1E9CA 2WP8J 1JT8A 1U5KA 2GF0A 3CW2A 3W8NA 1TF7A 4NU0A 5A0FA 3K7AH 521PA 4WBSA 4TQ9A 4EQ6B 1YNNC 1G1MA 3FMIA 4R9UC 2VZAA 3E0EA 5AJ3L 5FPHA 1RRPA 4NMMA 4OXPA 1CIPA 1E2WA 2QN6A 1RRGA 2V7QD 5AJZA 3TIFA 3TQCA 4KLKA 1I6HH 1XU4A 5B57C 4CZ2A 1NSFA 1SVKA 1TNDA 1UFQA 4HB3A 4GRAA 2R8RA 4HZUB 2CNWA 4A3GG 3UWKA 2P0EA 3ZS8A 4AD8A 3DPUA 1A62A 3QNUA 4LFCL 1JR3A 3SZRA 4AYBE 1H9JA 4XIGS 4GZYC 5K8IA 2NG1A 1E0SA 3AF2A 4IFBA 3DLLA 1GUAA 3LRPA 3ER0A 4Q4HA 1Z0KA 2VHCA 4P73A 4DSTA 1XMOL 5C1BA 1SMXA 3QF4B 1ZYUA 1GRRA 4DLSA 1H9KA 2UUBL 5KNCA 3EA5A 4M9ZA 5CYPA 1P9RA 1X8LA 1A63A 4XTRA 1BIFA 5FBWB 3W8RA 4F4JA 5JI2E 3PEWA 2JLYA 2RGGA 1I4LD 3RVBA 2WAYA 2CMKA 1JAHA 2CLDX 1K3RA 3W5OA 3JAMi 1MABB 5L3SA 3CCLA 1JI0A 2V7QA 2ZROA 2GJSA 3X1ZA 4D25A 3NG1A 4FMCB 4UXJA 1LUZA 2OE2A 1JAIA 1KRTA 4B3RL 2ZUDA 5C0XG 2IS1A 1NVWQ 4IKEA 2D74A 4PR0A 4US0R 1A5TA 3CF2A 2A9KA 1XNJA 3CCEA 2VBCA 3TRFA 4G5OA 4OK3A 4B3TQ 3THXB 4B3XA 1JQJC 1KTVA 4AURA 1BH2A 4OI4A 4F4CA 3D4RA 4OQMA 3EX7C 4MKGA 3PIOA 3HOXH 3EC1A 2VSXA 1JALA 1VG9B 4GLXA 2R62A 3B78A 3A8KE 4JCVE 1HJPA 4LHYA 2QGQA 4Q9LA 5DSZA 3GLGE 1GUSA 1DAKA 2PX0A 2ZAMA 3BZKA 1NVVR 4MRRA 3HJNA 1E7ZA 2VF7A 2MO0A 4ESHA 5GAGC 4N3NA 1IBMQ 4DC9A 3QJYA 1KMQA 4G5QA 3Q9LA 4K0KQ 2FPLA 4CEHB 2O52A 3C4JA 5M5WH 3VKWA 1XCMA 1BOFA 1QRAA 1A2BA 4JI1Q 5J4YA 1CJUC 1NLFA 1AIPA 5H8WA 3BG3A 1UE6A 4JI5Q 1SZPA 2IL1A 1YHNA 2ZTCA 2BJVA 4JV5Q 2YC4C 2ZQ5A 2EJGC 2DR3A 3BE4A 3UIEA 2AMCB 3AKEA 1XJCA 1XMSA 4Z54A 4B6FA 4LJ5A 4DUYQ 2RAPA 1B0UA 3JVVA 2BM0A 3FDIA 4LSGA 4LYFA 2W6ID 4TYYA 2QPOA 1G18A 2AXPA 1KI3A 4DR2Q 1C9KA 2FSHA 2OILA 1XXHE 3WMFA 1G8GA 4S2EA 3ZDQA 1J6QA 2QI9C 4IOMA 1IHUA 4B3CA 2N8NA 1K9MC 3CR7A 3ZJYA 2HYIC 4IDQA 5FPYA 3BJUA 5E7JA 2HCJB 3I8XA 2JJ8A 2ZS8A 4LV8B 4V0MA 4YXWD 2XNDD 1PHJA 2I1QA 2C2HA 3F0TA 1GL7A 2BCJQ 2RCNA 4ZDJA 1YNJC 1X56A 2PJRA 2ZSFA 1YJ9A 1WI5A 2EFHB 1Y1VH 4RD1A 4QHYA 1CKNB 3GTLH 2UUAQ 3Q5EA 1F3OA 3MWLA 1HPCA 2JLXA 3AKYA 2ZE5A 1N6LA 3LBNA 4KKUA 1VECA 2N42A 2ZU6A 3CBQA 5CM9C 3U4QB 3VNVA 3LAWA 1EX6A 1QZHA 2JE6I
chains in the Genus database with same CATH superfamily
1U8YA 3IXMA 3AEQB 3NEJA 4B3FX 4WXYB 4ZJZA 3IQIX 2UU9Q 2UUCQ 4LGYA 1U99A 3M6AA 2R93G 4UUQA 3PQ2A 5JXJA 3D3KA 1AHHA 1E8NA 2IK8A 1YC2A 2CNDA 3TVDA 4DMLA 2QTWB 1AKTA 5CB4F 1LTLA 4DDWA 5L3RA 4JCOA 3MGBA 4MTCA 3AVPA 5AW2A 3VPGA 4PQYA 1HXYD 3HDQA 1BFUA 1X3GA 4W8OA 5JW6A 3QUSA 4XW2A 1UC5B 1WXGA 1SIBE 3E05A 1HQMC 2WYVA 1KARA 1DRKA 3NTKA 4HLQB 4JZYA 5DZSA 3BPSA 2HMVA 4KIGA 1N4AA 3RM3A 2IH4A 2EKQA 4RGTA 1ELOA 4D81A 2OBYA 5TNXA 3PLRA 2I34A 3DEPA 3TF5A 4CMCA 3CC7A 3RLNA 4HDNB 1X7YB 1EY7A 1R6XA 5E1MA 3NYRA 2IPLA 2LCIA 4W99A 1NQWA 2I5HA 3BEDA 1J90A 1OXXK 4PYQA 1E1QA 1JJCB 4C0JA 2PTGA 4M0FA 4CDFC 4MUNA 2BF4A 4AX4A 5FFNA 3RC2A 1XTIA 5G3ZA 3K9GA 2FG7C 3U2QA 4B8YA 4H2DA 3C3KA 3L05A 2ZYRA 2PT5A 1NBWA 1WMAA 3CUYA 3QUTA 5HCIA 3KU4A 1Z3IX 3WGNA 2O3SA 2K5HA 4GOPB 1P2TA 3D6WA 4C4AA 2QJRA 2HK6A 1CUUA 3HSSA 3BSWA 3P2KA 2GTIA 4QM7A 3AR8A 5FWNA 5EZ6B 2WWRA 4X1KA 4KHPB 4OKIA 5TMDA 3ZR4B 1PJ8A 4K9QA 3G9QA 3CFYA 3PHLA 4E5NA 5K0SA 4C2AA 2XIQA 2NYVA 2A1IA 3QLVC 2FPMA 4PLVA 2BGMA 3OZTA 4REOA 5BN4B 4IXNA 4ZQIA 4LJRA 3H19A 2GYUA 4GI2A 4V0RA 1TTTA 2AEEA 1W581 3CNLA 5HIJA 2AOTB 1Z16A 4D3DA 5CVVA 3OF5A 4NDXA 2HMYB 4B9XA 1PUIA 4AYBG 1MW9X 2Q45A 2CLCX 1YVPA 1P1IA 2AR7A 5LU9A 1J2TA 1HT0A 1B1AA 4MH0R 1Q11A 5JDIA 5IGEA 3HOYB 1H22A 2CHQA 4JYBA 4ZJUA 3LDUA 4CLHA 3V2HA 1V1JA 3VPAA 5A9SA 5AI5A 4IH4A 5HKKD 4AG6A 3COYA 2HD3A 2IU4A 4JC0A 3KSUA 2QLTA 4FTWA 1KSJA 3ZGZA 3O83A 1VG8A 5TXGA 1BBXC 1N5DA 3MK31 3MHPA 2CN1A 3UFXA 2FMFA 3S1QB 5K3FA 3T1HQ 2V9ZA 1FFSA 3NUCA 3W1VA 1Q8IA 1C1HA 1YS9A 4HXEB 4GMDA 4ND3A 1NUCA 4DPLA 5HG0A 1AA6A 1UDRA 1UZNA 2ZE6A 2H7YA 1I9CA 1DLJA 1PS9A 4TYNA 2V6JA 1MEEA 1MABA 2EJFC 3PKIA 2OV4A 3F3SA 2EKDA 3JQ8B 2ZJYA 4BQEA 3THXA 2RHBA 2VT7A 1TO1E 2UV8A 4ZK6A 5FO9B 4W82A 3ENZA 1VQFA 4B31A 4OJQA 3THSA 1NM5C 4UC0A 1WU7A 2DAPA 1XGKA 2VJOA 3JQCA 1K7CA 1WZCA 3HJCA 1N5LA 3IBTA 1IY9A 2NO5A 4R8VA 4CDCC 1NY5A 4DK0A 1XHLA 1GKHA 4H6PA 1R2QA 4M8KA 5LQDA 2R6R1 4FOLA 1G3QA 3BDVA 4WD3A 4DWOA 3HFSA 3HQ4O 3W77A 5C2JB 1F9SA 3IQXA 3C3PA 3KEQA 1KOJA 1S8FA 3A9SA 2C58A 2B63H 4IUQA 2AE2A 2XOXA 3R6TA 2IBTA 2YZMA 3PX2A 2VKQA 4AIRA 4J9UE 3R7AA 1ZEMA 3E2IA 4G36A 4ZGWA 5BR4A 2QAGA 4KWIA 4RIFA 4U6NA 4DIEA 1ZN7A 1E2IA 2YJ4A 4B47A 5G4KB 2OHIA 3L7MA 1S3FA 3EOAI 2CEKA 4HAWA 2I2BA 1ZRMA 2CMDA 3HG9A 1W48A 3UUGA 3MFGA 3O8OA 3K8YA 3F78A 1MQ9A 4YCNA 1GGVA 5FL7D 4G23A 3LM8A 3H9EO 3DR5A 2ICAA 3U61B 1OBOA 1ECFA 2K28A 3UMCA 1GSOA 1I6KA 4EJSB 2HQ1A 4DLVA 1UMBB 3MMSA 3EPJA 3GCXA 4M46A 4HXYA 2VL7A 2O1WA 3DMDA 4HLCA 3HR7A 1SLJA 4DNXA 2Q3MA 4PAWA 4HB4A 3RZOH 1Z8HA 3DQZA 4O4LA 3RHFA 1MPXA 1ZQ9A 4EVRA 3PFNA 2V5AA 3OZDA 4B9WA 1W0KA 2VQDA 4H7DA 1TWHH 3TCNA 3BWBA 2K7FA 1UBOS 4FGZA 3PUVA 1MIHA 2ZM6B 1Z75A 4YT8A 1YNND 3LP6A 1UK6A 3DWFA 4B4DA 3ECAA 3BG5A 1I5FA 4WJZA 4JENA 3ECCA 4Z0TA 2EXZA 4MB0A 9GPBA 4EPYA 2R5FA 1FF9A 2XGOA 3I52A 2E5LQ 2JJ1A 1H5QA 3HMQA 5C51B 2ZRJA 1ZH6A 5H59A 5LIRA 5DB4A 3JAMA 4DGSA 3ZVNA 2H17A 5DM60 3MTEA 3HR8A 2AMFA 5G0WA 3RIEA 3IYLW 5JZBA 3EGXA 4C3JH 4HB2A 1Y0BA 1PZMA 4L72A 4I7AA 2AFHB 4A3BB 2WF9A 1PWEA 5K2MA 5C3EG 1B44D 2RARA 2O05A 2C04A 3CF4A 1E9FA 1W52X 3RH0A 2GM9A 2R1TA 4AQYL 5E6SA 3AHCA 5KI6A 1K6MA 3HA5A 3ILSA 3DAFA 3SHWA 5D5QA 2ZAYA 3RBVA 3NWPA 4Q16A 4HBGA 3O8CA 1RU3A 1RAFA 1ZMXA 2PFGA 2XF2A 4YA6A 4QQ8A 3U7QA 2IU3A 5JAHA 1B9MA 4CLOA 1NY6A 2AZMA 2ID0A 1I30A 1YZTA 4RCZA 1NVKA 1QVFA 5CFLA 5JY1A 4JKYA 3C39A 1JEOA 4BKMA 4ZHQB 4NDZA 3B6EA 4P22A 1MQ8B 1XQ9A 3ZIDA 1MDFA 2PNHA 4DR2B 4QIHA 4EFLA 2VSQA 5BWLA 3GMIA 5K36H 4I5EA 5IJAA 3OU2A 3WNBA 3GZ4A 3ESCA 3N5CA 4FKZA 3TM4A 1STBA 5C4JH 4TSRA 4N7RA 4BNHA 1I4XA 4P98A 2RGEA 4DCCA 1YA6A 3DC2A 1LU9A 3MILA 1Q14A 1ZK2A 4EABA 4YP5A 1NV9A 3PWSA 2Q7OE 3U62A 1L1OC 3EJIA 3W6ZA 1U6KA 2A7XA 4EAAA 4FNFA 3GLTA 1YDHA 3PRYA 1XXLA 1MU0A 5JOBA 1JZSA 1W76A 3ICVA 2P6RA 2V4ZA 2EYHA 1QWOA 1THMA 1VP9A 4OSEA 4JX8A 2G5GX 1P16A 1UZMA 2RGAA 2VFAA 3F97A 3UEOA 2OA0A 2L9HA 2V8OA 4KLRA 2Z3VA 4I46A 4A76A 3G2PA 3RGGA 2CCGA 2Q8IB 4PMCA 1ETHA 1E7QA 4FFBB 2XVXA 4H1UA 1ISPA 2C2OA 5E7QA 5LBTA 1WULS 1I94Q 4LF6Q 4YAJA 1UJ5A 4AJHA 4G9GA 2GCOB 3X3NA 1ENOA 2AX3A 4Y1EA 2R8PA 2L11A 5BMVF 5FV7A 4CQMD 1CNFA 4X00A 4Y9RA 4K9SA 4DUYL 3OM1A 2F1HA 2C2XA 4HR7B 2JHAA 1JFSA 1AZTA 2WWYA 4JGIA 5CA1B 2N9UA 3J7A5 2PNFA 1IG0A 4MQ4A 2YMMA 3EDYA 3I9V6 1B0PA 4HL6A 3LG2A 1BCPB 1GVNB 4PX3A 3UFBA 4X3PA 4MS3B 1GN8A 5G0TA 2NW6A 3ENVA 2CEAA 3S27A 4I4LA 4GYWA 1KSGA 3LVQE 2N0SA 4IDHA 3F8WA 4YHHQ 3HKEA 4X54A 2QZ4A 2EJMA 1QOPB 4RV5A 3K4QA 1KKLA 3ZH9B 2G0AA 2R1VB 3SCZA 2BH9A 2QRNA 4JGBA 5F78A 1J2JA 1WF3A 5ELEA 2JCXA 1NJFA 4OGLA 5CBKA 3BB1A 2PS1A 1MPTA 3QXGA 3QR8A 4U63A 1JB3A 2VHUA 3Q88A 2AJDA 1ZVVA 1GU7A 1F6BA 3LK6A 1CJCA 5I7WA 1TZMA 4R0MA 4EYKA 4AKHA 2GK7A 1IXRA 4N3CA 4H3VA 1MEOA 4FYIA 3GBSA 2BD0A 2H4WA 2PH3A 1WVMA 1GDHA 4PVDA 4V2IA 3H84A 2AVDA 3M1YA 1GA6A 2WJPA 3RQSA 1XHEA 1RAGA 3I64A 5ENZA 1E6WA 5C7OO 3CWZA 3KJNA 2ID9A 1QMGA 2AFIA 2BEWA 1BMFD 3LUFA 3OAAD 2P35A 2XVMA 3VPSA 5A7FA 5GJWC 3HI6A 2XMZA 3BKXA 4LMPA 3AO0B 1ZWKA 2O8DA 4M9QA 5IN5A 4KMRA 1JHUA 4D02A 1N5JA 4M60A 2R4QA 3ONWA 1NUHA 1TQ8A 1BOSA 2WU0A 2CBXA 4E13A 1YR3A 5I7AA 1II3A 3BF7A 1UDAA 1OC4A 4DK6C 3OA2A 4MP6A 3E81A 2ZB2A 2OXIA 3I01A 3OOYA 2IV7A 3I72A 2ZIXB 3WLMA 2PZTA 2OYSA 3LT4A 3MTQA 4JLOA 2FPWA 3PC8C 1MB0A 4G4SO 5LVAA 1IXYA 2J4XA 2EYUA 3NM4A 2NO4A 2PQAA 4D0LB 4U39A 1AHIA 3GT4A 4MQEA 1Y1WG 3M6MD 1P60A 1W75A 1W7AA 3K58A 5CGZA 1VJRA 3GTGH 5FWXB 3DV0A 4EELA 4O2DA 2FAXA 4PRLA 1U1GA 1DQZA 2H29A 2XWPA 2Z0SA 4RY2A 3BUSA 1KK1A 1Z0SA 1B6GA 3K2QA 2HWUA 4TYQA 4J90A 1VIVA 4XH9B 5AHKA 4U4AA 1KVTA 2I62A 4KXLA 4YWHA 5LXTB 2ZRCA 2P79A 5TVGA 5LYJB 5M3MG 2I67A 2EY1A 2W5UA 3AEVA 5F2KA 3PFCA 2J3IA 2JA8G 4X92A 5EE9A 2QTMA 3CLSD 3FTPA 1Y7LA 1ESCA 4I9FA 4FJ1A 3UE0A 3TQRA 4F92B 3ZNPA 1C8VB 3FB4A 2MYNA 3WL3A 4RMJA 5TT0A 4CL8A 2ZI5A 2WAQG 1DEOA 3K70D 1PDQA 1H4SA 3P0HA 3OT1A 2FN8A 4RL6A 4CKWA 4OELB 5AP9A 1QH9A 5EBCA 1AKUA 1X39A 3HOUH 1EFRA 2QXUA 3ILXA 2W2KB 3WP1B 2X22A 1FGUA 5KQLA 4RW0A 4RA8A 1YL6A 1NVEA 2Q3FA 3AJDA 2Z2IA 3E5MA 2WTAA 4EO7A 3KJOA 1V6SA 4MEBA 4BNXA 1CZNA 3ZJVA 2X8JA 3R9KA 5B1SA 3WP0A 1V5IA 4GYKA 4MAFA 1TVKB 3EZLA 1OH5A 3NC0C 2CZCA 2ZI6A 3H15A 2XDQB 1ZM9A 4EB0A 2OR3A 4L5YA 5EJ9A 1R7RA 5FA8A 4UTVA 1XD2A 4CM5A 2YWRA 3QK7A 4GQBA 2P1ZA 2BFMA 3T1VA 1GKIA 2YRFA 3ZWQA 4HMIA 4TYWA 3FGOA 4PLYA 3DBIA 3VVBA 3JVDA 3K5PA 5CV8A 4WY2A 4YRGA 4UM9D 5DNAA 3N8DA 2XD4A 1JR2A 1PJLA 4D3YA 5KYGA 3AP1A 3AB3A 3HRIA 4UNRA 4S12A 3JQBC 4JITA 1E9VA 4HCSA 3FCYA 4ZKDA 4KITB 1CSPA 4Q4DA 4UE3S 3S4YA 3SJZA 4H1TA 3PE6A 1E6UA 2JFQA 4D9KA 3RG2A 1LPAB 1CVLA 4BBSG 4AP5A 4W8HA 4YNBA 2GEDA 4CWAA 1DWQA 1SK8A 2BEKA 1SYDA 5I9IA 3TFQA 4MV0A 1FGBD 3OMCA 1OX4B 5IT0A 1PL0A 2R4UA 3E0JA 5EIXA 1KABA 1EFVB 1OSNA 1L5HA 2HD4A 4EW2A 3C97A 4RTMA 5HX7A 3IL2A 2MINB 3GDWA 2FYTA 1L7MA 4JYAB 1KZ1A 4Q3NA 1SUIA 3CH4B 4K5VA 2NZ2A 2FWMX 3FCXA 4OJKA 1RKNA 3QSGA 1S89A 1X8KA 5LLDA 1TTHA 2WTXA 1FP4A 3P75A 1L4UA 1ECLA 2JF0A 5BW6B 3A3PA 4BX0A 4JI4Q 2FUG1 1TVCA 2BFCB 5BYKA 4D4JA 3MAAC 4ZZ2A 3FGNA 4BBRH 4PNEA 3PWTA 1VMDA 4Z6KA 1NVDA 1SBTA 3WYBA 1IBKQ 4CPDA 4XCXA 2VDUE 1T1RA 3P20A 4AUKA 1QK4A 2HRRA 1P2BA 1I1HA 1W4BA 2HKIA 5IJ9B 4YRSA 3HXKA 3N8GA 4UAGA 1QCCA 2P2CA 2EPBA 2IEYA 3G7NA 1NMQA 1JBKA 1E96A 3CO0S 1VQHA 2NVQB 3AJRA 1QHSA 4YAEA 1PMRA 1N2CE 3OWHA 2UZ3A 1EK0A 4EA8A 1H9SB 3KT8A 4MW2A 2NN6H 4HGYA 4M1YA 3IAUA 2LTAA 3N2LA 4JB8A 4KTVE 4Q9HA 3P9NA 1FL0A 3GUVA 4GN5A 3JD4A 1EIHA 1I2BA 3MMZA 4KN7C 2MT9A 3CZ9A 3MNFA 8ATCA 3IOMA 4C6TB 4JA2A 3AZOA 3QLUC 1TC2A 2I4LA 2ZJAA 4I9NA 5KNBA 4GOPC 5CBPA 4AJEA 2JJQA 1C0EA 2B78A 4X95A 4BMZA 3RYFB 4DNOA 6GPBA 1L8LA 4TLMB 3T12A 2QQ0A 3RUPA 1N34L 4Q7LA 4ABNA 2B2WA 2O2ZA 1G91A 3HFRA 4XARA 2O8FA 4L5QA 4PMWA 4EVOA 1JEDA 4GKJB 3NWTA 1X1BA 4C7XA 1S01A 1AHPA 2ZTUA 4EQ6B 3MT7A 1SNMA 3I1IA 5FPHA 4AKTA 3TYXA 3LX4A 4RDHA 3TQCA 4CZ2A 5I4DA 3UWKA 5JBIA 5D6OA 1XDDA 2FJPA 1O03A 4IFBA 1PW5A 4EG8A 3Q24A 4L3WA 2O2YA 4ZANA 1H9KA 4XTRA 2ZTHA 3CMMA 3JAMi 1WUKS 4KR2A 2OE2A 4G1FA 4RULA 4R1PA 3NNSA 2JYOA 1ZL2A 3DBRB 3C70A 2B1QA 2ZR8A 4F4CA 4OQMA 3EC1A 3B52X 4K1LA 3EJWA 2VF7A 5CXXA 3AUAA 2O7NA 2NU6A 4RYLA 4JP8A 2PL9A 3GRVA 3WKBA 1NE2A 2HO4A 2OT2A 2QWXA 5B2FA 4RZQA 4DA8A 3SF8B 4JI3B 3VMMA 1T1SA 3FDIA 4RORA 1G18A 1R0LA 1SBIA 5I6WA 3ZDQA 1X1QA 2FRVA 5FPYA 2P62A 1YNJC 3H1PA 2UUAQ 3CVOA 4X3SA 2JLXA 1C7IA 1VECA 1Y9ZA 3MC0B 2J4CA 1J2UA 5LP6B 1D0IA 1QZHA 1MA0A 1DHRA 1ZUHA 4N47A 2JATA 1XRNA 2H1SA 3H11B 2WIKA 2V9PA 1TRHA 1VB3A 1UMDB 2XTAA 2NV0A 3GNTA 1T4DA 5KOJA 1CQZA 1G8SA 4HDRB 4O25A 4CIWA 3H6GA 1AE1A 1NLYA 3EPPA 2W93A 1UBRS 4NCAA 4DZRA 4GQAA 4AECA 5E9JA 3GQBA 5E4JA 2C5AA 2WHXA 1CQJA 2PR2A 3W05A 2C0QA 1XBTA 2OXFA 1F4PA 4ZDWA 3C85A 2EIHA 3ICPA 4OP2A 2AUJD 3DE3X 4C1NA 2OYCA 4GF5A 4OI2A 1EFPB 3G85A 5SYAA 5FOSA 1WVGA 2KCNA 1VI5A 2EIFA 3X2SA 3GT3A 4W6QA 4WCDA 1U9YA 4NMXB 2PUGA 1UBUS 1E5DA 2O5VA 3TB6A 3T16A 1ZKOA 3NXKA 1OWOA 1VJ0A 5KMGA 1VHTA 4QL3A 1NFFA 2B5VA 4N3BA 2A69D 1JDBC 4QQFA 4TV8F 2PMCA 3KKZA 2PUEA 4B79A 3W2IA 2KJXA 4YRDA 4ER5A 1U63A 4WZAE 1WD1A 3IMFA 1HYBA 2X4IA 3CLUD 3NBQA 5GONA 3P9SA 1SXJB 4LNQA 5JPNC 2CJWB 5CMDA 3LXUX 2FWIA 3PDJA 4B6JA 1SU6A 4F4HA 4ZJYA 1TF5A 1W96A 2W2NA 4A91A 3I34X 4DA0A 5LB2A 3V80A 3WWVA 3D4NA 3MWDA 1I2AA 1HDCA 2P0AA 1DDGA 1WVIA 2B4YA 1QE5A 3DMHA 4MRAA 1V48A 1NXWA 3SIRA 2F3TA 2TMGA 3KOMA 3IVAA 4QFBA 2WWTA 4RUKA 5JECA 1MQSA 4PO3X 3HHPA 2IIPA 1OFUA 1QP0A 4Q66C 2PGIA 3LZDA 4C3OB 3U5ZB 3F6SA 2A68D 1OIVA 4EJSC 2J6HA 3T9EA 1BAPA 1S8OA 1Z26A 3FI0A 5EJAA 4FBMA 3AUXA 2BZSA 5JADA 2AHOA 2H2WA 4K2AA 3FRIA 3N2KB 3F6CA 4CU2A 5LPNA 4Z0NA 1A4RA 3TN7A 5COYA 3T3OA 1IN5A 3WKEA 3AEUA 1QUEA 1YR1A 3CVUA 3NQ41 4ISCA 1E22A 3DLAA 2V3WA 3I8OA 2FWNA 5LQNA 2RH9B 2JLQA 3SBEA 5DHQA 3MXPA 4XSHA 4B3SL 3PO2H 1HXHA 3NGMA 1T9KA 1X80A 1NUUA 3W8FA 1V0JA 1PD1A 3PQEA 4KQ6A 1RCFA 1Z0JA 4DR1B 5LQSA 3UC9A 3R74A 2C1EA 2D5IA 4NP5A 4HQKA 1A27A 2CL7X 1Z6HA 2VQEL 3L7NA 3ZDBA 1J2RA 2EP7A 3E61A 2HRZA 2GEKA 4IOLA 3KR1A 1ATIA 1W2HA 3ENQA 3U48A 5K8LA 2PRYA 3CIFA 3T38A 5E9QA 3BBLA 1M1UA 3CKMA 3EVZA 4TKVB 5KOHB 5M3FB 2HPZA 3MYYA 4MW1A 3WR5A 3F2BA 2ETXA 1EZ6A 1PLKA 2JFFA 4H6WA