3RLFA

Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Snapshots of the maltose transporter during ATP hydrolysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
total genus 106
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2011-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3rlfA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3rlfA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3rlfA01
1TQ4A 4X65L 3F3YA 2B8FA 2JA5H 5CB6A 3CZQA 1SQ5A 2GZDA 4F4JA 2AD5A 4GKKQ 5LB4A 3AVWA 1OKKD 3LBHA 4XIGS 1AS0A 4G5RA 5JEAH 3LX5A 3SBDA 2WSMA 4HI0E 4C0LA 4ASUD 5J5CA 1VIYA 1F2UA 4X6AH 2ZR7A 1VF7A 3CRMA 4Q1CA 4O25A 1GKYA 4BFUA 1SKYB 1B7YB 4BBSG 5HKKD 1TMKA 4U5XA 3VR6A 4LJAA 4Q4LA 3BU2A 2OLJA 2ZYWX 3CD6A 4LJYA 2A69D 1IY2A 1Z0KA 2I5HA 1AIPA 3BFXA 3S1AA 3OEED 2PCFB 1ZIOA 3JAMc 3DVLA 4BLRA 4DUYL 2DHRA 2JJQA 4TWZA 5CIWA 2HIVA 1RL2A 4C3HH 2BWJA 4LF4Q 3BE4A 4ZKEA 4MRVA 4JI4L 1TQ6A 1UBGA 2XNSA 3THXB 2N3SA 4Q7MB 1ZC4A 2VH5R 2H16A 2ES2A 2QN6A 2V9PA 2OFWA 1X6OA 1N6OA 1N5JA 5C1BA 3I92A 2ONKA 2E5LQ 3M3YH 2QMUA 5LD2B 1VQPA 5DLQE 1KSHA 2F9MA 2WAYA 1HNWQ 2VP5A 3EIHA 4JVNA 1U90A 2D62A 2PL3A 4KSCA 4O3MA 4L5TA 3GJ8A 2V54A 4B3TL 1VQ9A 1B23P 3KUDA 4A3LG 2XEXA 1Q3HA 2OE2A 1D2MA 2D7CA 5M5YH 3NBZC 5HZHA 2QAJA 2VY3A 1KSGA 2F55A 3C7KA 3OEHA 2X2FA 5AR1A 5KU1A 1A82A 1YR6A 2QEQA 4JVSB 4UXIA 4CW7A 1M1YE 4Z8YA 1W2HA 3CRQA 2YJTD 1NBWA 2QP9X 4A1FA 2ZJAA 4P3YA 1P9NA 2CBZA 3SJAA 1T3HA 4RG1A 4NB3A 3GJ0A 5E4FA 2PQAB 3RRNA 4Y7NH 1T3LA 2ZYTX 1Z0AA 4TYYA 3FMCA 3MMPA 4JLAA 2IEZA 2FFHA 4XWKA 3NENA 2AWOA 4WBSA 1ONBA 2QGQA 2ZAOA 1N6HA 2IYYA 1I4LD 4QC2A 3GEIA 4DLSA 3T1YQ 3CUEF 3QPWA 4ESVA 3HOWG 2ZETA 4D26A 1EWRA 2GVZC 5IWAL 3BH6A 3N70A 4WIAA 3TAHA 4OGQC 4GMDA 4JJKA 4ZCLA 1R5BA 1XTKA 1JQJC 4PAOA 2HIXA 2C78A 1UF9A 4H1UA 3X1XA 3QXSA 3EIVA 2X1VA 1YNJC 1J5EQ 1AH9A 4V0LA 1P7CA 3LY5A 4DNIA 4KKTA 1KJWA 1E6CA 1G6OA 2D2EA 1CSPA 4KFTA 2JA5G 3MFYA 3U3OA 3GLGB 2UU9Q 1PLLA 3R8FA 1BOFA 4E5UA 4IJMA 3RC3A 2JLYA 2GXSA 4AKHA 2FX3A 2NQ2C 2IYWA 1Z5ZA 3IIKA 3TUZC 1XMOL 2WHXA 4RY2A 2YWEA 2W2TA 5JEAG 4H44C 1DOAA 3BB3A 3BZCA 4FWIB 2HHHL 1GL9B 5LBIA 4A4DA 3K70C 3PUYA 3RZOH 4KLZA 1NLZA 2IC5A 1IJFA 1ASZA 2CNWA 1MO4A 1OFTA 1Z7TA 3AVUA 2VNUD 1IQPA 4A3BH 1U8YA 2ZTCA 1ZAKA 3TR0A 3IEVA 4B3MQ 1Z06A 5CYOA 4OJKA 4HDCA 3JZAA 1OYYA 1W0KA 3B9QA 4A8JA 1D8LA 1E3MA 2QAGA 5EUQB 1DG1G 2FDCA 4IOJA 5FOTA 3E9IA 4NCHA 1ZYRC 2ANBA 3GTOH 1KZGB 3LH5A 1EFRA 5JSZA 4DK0A 2RF4A 2GCNA 5JS7A 1X3SA 2A68C 2YHSA 3GLIE 2OSBA 3QG1A 4M4SA 5J47A 1ZNWA 2OCBA 4IPCA 4LBYA 1RC8A 3BERA 3B78A 3OTOQ 1J8YF 4C9BA 2ORIA 1KNQA 2BA1A 2OESA 4M9ZA 2O8CB 1WF3A 2MO1A 4BPBA 2V7QA 2YOFA 1UDXA 1E79D 4LV8B 1YVDA 4PPQA 1TF7A 1OF1A 1YRAA 4TLCA 1YNNC 1UKYA 4CT4B 3GTMH 4BUJA 3T51B 2JK8A 4YWLA 5IT9c 2JLSA 3JVVA 4IFBA 1GUAA 3AKEA 3LQRA 3EA5A 3KOJA 1Q1QA 4ZIRB 3UKDA 1VYVA 1DO0A 2QZ4A 4G0NA 3BOSA 4NE2A 1GUNA 2RAPA 1VQJA 2WWFA 4U00A 4HLCA 3CNNA 1X8LA 1E2GA 4DLUA 3EC1A 2QEXA 3RRYA 3U6KA 4D80A 3OE7A 4GOPA 1AQUA 3UG6A 2EIFA 1M34E 1YE8A 2ZITA 4EQ6B 2IX3A 1CFMA 4LF8Q 1E0KA 1COWD 2QY9A 4RD3A 1NMZA 2Z0SA 2PJRA 2XZLA 4JI5Q 2WIBA 1N6PA 4DCUA 3A7LA 2OCAA 1T0HB 3OIWA 5EP3A 4OO1H 1MH1A 2RB4A 2WVJA 3FPAA 3CCVA 2F1JA 2QRZA 4QBFA 3AVVA 1OXTA 1W0JD 4TSFA 1MKYA 1I94L 2J87A 4DUGD 4YHHL 1HH2P 1KAOA 4B3XA 2ZRNA 2FF7A 2D7DA 4IDHA 4PX9A 2HT1A 4IFDG 3OF5A 1P61B 4GMXA 1XMJA 5FL3A 4OX9Q 4WVFA 2K33A 1KSFX 3MRSA 3CC2A 3TREA 3HKSA 2C98A 2CHGA 1E96A 3NC1C 2D3WA 3A1VA 4M1OA 2NPFA 3TKLA 3AQ4A 1NSTA 2OV2A 2PCLA 1IW7D 2YOGA 3A58B 3QPVA 4HUTA 3Q5DA 2ZU0C 1HJPA 3K09A 4WXPA 4EJSB 1UKVY 4Q03A 4AYTA 1TWAH 1H9KA 2P2LA 4A3BG 1MJCA 4LYJA 1CKOA 4OHWA 5EE3A 1RE0A 1U8AA 4LDJA 2OXCA 4BWYA 3UE1A 2R62A 3JC66 2VP6A 4AK9A 4C0JA 2BJWA 4URVR 1AN0A 3H0KA 3MGCA 3WHLA 5AUNB 4MUBA 1SXJE 3TEHB 2W6ID 2GF0A 1NBMD 4LK1C 2XB4A 4RD1A 5HY6A 2UUBL 5DSZA 1EWIA 2VQEL 1E2MA 2H18A 3DEFA 1R0ZA 3KFXA 4KKSA 1P16A 3AVPA 5GVSA 4MH0R 4JVLA 1CI3M 3MJRA 1PH3A 2A8VA 1IBLQ 2OBMA 4PXAA 3TMKA 2O0KA 1Z8FA 2QU8A 4RZXA 4OI1A 1CEEA 5B2ZA 2RKOA 3UDIA 1O3YA 1EWQA 2BMEA 3LBNA 1QHYA 2VEDA 4UXJA 1QHGA 3ZH9B 3GJ7A 2GVAA 1XP8A 3KDFB 3E1SA 4RFSB 1PMRA 3BWDD 3O8DA 3A5ZB 4XVRA 4KHPQ 3IHLA 3VX3A 4BRUA 4AQYL 1V43A 1US8B 2W0MA 3QVUA 2XZPA 4CEJB 5C44G 1R9TH 3IPYA 4GLVB 2ZS9A 1HY3A 1XMQL 1VCNA 2BBOA 3NHAA 4JV5L 3BD9A 4XD7D 2LWIA 2E2JH 5AUPB 5BWMA 4KHZA 4N1AA 5LDDC 2LXJA 4JCVE 5AJ3Q 1KJZA 3CF2A 4LF7L 3O8BA 3QKSB 2NO7A 4LF9L 1E2JA 2ZSEA 4GZLA 1FMLA 3NKVA 3VKHA 1GUSA 2IW3A 4XOIA 3U4VA 1ZM4A 1SVMA 4JLNA 3H84A 2ZU6A 2OBNA 2R9VA 1DAEA 1GZSA 3PIOA 1KNXA 1ZU5A 2KCCA 2Q8IB 1EK0A 2QI9C 2ZJZA 3B7GA 4J15A 4HAVA 2YINC 4CEHA 4JLKA 1HQYE 1OXVA 1AKEA 3U58A 3AYHB 4UP7A 3QI2A 5A0FA 4URZR 5J4KA 5K8LA 1E9CA 3K0FB 4OO1G 3ASZA 2WP8J 2AHOA 3S1RH 4PC1A 3EG5A 3GTLH 4LJ4A 1TF5A 4M22A 1HE1C 4TL7A 5JWHA 1NSFA 3TNFA 4IXNA 3FFAA 1FP7A 2O52A 2YWGA 2ZE8A 2G83A 3CLVA 4NYIQ 4CGZA 2G3YA 2JLXA 1L4YA 1BS1A 5FTJA 4URXR 3PITA 3OHMA 5IK2D 3NH9A 1MRNA 5DYGA 5H68A 3TZUA 1KD1C 3S2HH 2BM1A 4LF4L 5CDFA 4TYNA 4IVRA 2CHQA 4DV2L 2CCGA 2VZAA 4HIOA 4LJ9A 2KWIA 4DSTA 1U2RA 3I7FA 1IN4A 1YVCA 5LD2C 1IXSB 2DR3A 4IHQA 2O8FA 2DCUA 1UKZA 2R65A 4IPGA 4Z8XA 2GK7A 1G3MA 2O5JC 2E5LL 4URUR 2BBSA 4JI2Q 2AUKA 1JECA 3QQ5A 4HLUC 5EXSA 3BJIC 1HZCA 3KX2A 4U02A 3ECCA 1W2GA 3TR5A 4Z1MD 2QTVB 3RANA 2PBRA 2WPDD 2IBMA 2A5JA 2CQOA 5EE5B 3RRMA 3MWYW 3AM1A 1KKMA 2IXEA 1IBMQ 5JJIA 5IY0A 4L4UA 2FA9A 4BZPA 3A7AB 5IT5A 2J7PA 1AE2A 1OT3A 2GEVA 2ZAMA 3GLHE 3IKJA 1AKYA 3AUXA 2NZOA 3I73A 1VQDA 1VQ5A 4Q4JB 1R0XA 4JSTA 5HR5A 1G5PA 2VHQA 3WYAA 2N49A 3AFQA 4JLDA 5D3QA 1IXRC 5CJPA 2V4DA 4TMWA 3NBYC 5KPDA 5LMNQ 2YU9H 1S96A 4IOAA 4NP6A 3IEUA 4MKHA 4O0AA 4DR2Q 4BEBA 3KJGA 2QORA 4O2LA 3K53A 3NIBA 2DFTA 1VQHA 2JAQA 1PH8A 3T1YL 3GTGH 1FUUA 1K9MC 2ZRLA 3ZVRA 3I61A 3G4SA 1OJLA 2QNRA 2GJ9A 3P26A 4GNXB 5AJYA 2GF9A 3UK6A 2OQKA 2Q2HA 1Q8KA 4P32A 4ON9A 2CVFA 5EP1A 4NONA 3ICQB 4BE7B 1RZ3A 1P75A 2W2VA 1J5EL 5AJVB 2PJZA 1IZ6A 3HOXG 1EXMA 4BASA 3J81k 3IIJA 4LYHA 3X1DA 1DEKA 2HT6A 1OFIA 2UU9L 1ZKOA 4PO1A 1KL9A 3QF4A 4I1UA 3RR5A 4AD8A 1EOVA 2UUCL 3KB2A 4D4LA 1VCOA 3X1WA 1D7QA 2PI2E 3D31A 4NXMQ 3EZ9A 1T4GA 1T8UA 2VA8A 3LA6A 4IOMA 2NPIA 1Q57A 1JJVA 3FP9A 2I3BA 2NZHA 1A5TA 2G0TA 1XXHA 5CB8A 721PA 2HEIA 1WA5A 2DY1A 3KF6B 4NYIR 1YR8A 3QF7A 4IJHA 2K75A 1TWCH 1ZW6A 2QF7A 1BVSA 1QUQB 1UEJA 1W1WA 4L5BA 3LO5A 1V8QA 2I5LX 1K8RA 3IIMA 4A0HA 4GS3A 3X1YA 4B47A 3R9XA 1SKQA 1SRUA 2QMHA 3VHLB 4TMTA 5M04A 4G5QA 4APVA 1YZUA 3VX4A 4MGYR 1E0SA 3PUZA 2WWGA 5FPKA 1L2FA 3K8YA 3P1JA 2W83A 3F2DA 5HE8A 3ND9A 5AUOB 3CC7A 2FGKA 4LZZA 2IYLD 1G3UA 2WAQG 1ELOA 2OAQ1 2WB1E 1HYQA 3GFTA 1A1VA 4AKIA 4JLJA 3RNUA 3EPHA 3EARA 3CCLA 3DDCA 2W6JA 3T1QA 1QVAA 2AK2A 4HB0A 1YI2A 3UMSA 1IYUA 4NBSA 1YZ6A 4NU0A 1OHHD 1WFQA 4PZ8A 4PAMA 4LBWA 2N1BA 4DLYA 2ZE6A 2AFIE 1JJGA 221PA 3LX8A 4OQXA 1IM2A 1N5LA 4PQRA 5FPYA 4PZ7A 2O0HA 1TXYA 1E9AA 3ZS8A 2QQEA 2JDID 3CONA 4A75A 2BM0A 2YYZA 4OKSA 4Q9JA 4DLTA 1XPRA 1NJFA 1QHSA 4JT4A 1IHUA 3J7A5 1YEZA 3BG3A 1NVVQ 3WP1B 1VIAA 1Y8PB 1N6IA 3T06B 5FBVB 3S2DH 1P9RA 4ZPXA 4LF8L 4JSYA 4Q9IA 1JR3A 2R7ZH 2BOVA 3AFPA 1TWFH 1IBKQ 2BKEA 3EZ7A 5GAEC 3HR7A 1U94A 2KB0A 1E94E 3OW2A 2B63G 2ATVA 4LV5B 4WAUA 3TRFA 2VL6A 1JEDA 2ZRMA 4Q1EA 3PEUA 4PHFA 4Z54A 4RCNA 4LJ7A 4M9SA 2EYUA 5SZKB 5L8VA 4PSVA 2CL6X 1C4OA 5BN3A 4P4SB 2J9RA 1G18A 1Z22A 4RZ2A 4B32A 3BRWD 3GFPA 4FW9A 4MQBA 4TYQA 4Q5IA 5EUMA 4V0KA 3THXA 2JQOA 2R93H 1II8B 1KRTA 3W6OA 3ULJA 4TL6A 5EZ5A 3SYKA 2GXAA 2AR7A 1S72A 1RJ9B 1YZTA 3LVRE 3HR8A 4FMBB 1TU2B 1E9FA 1N6LA 2NO6A 1DBSA 1XTRA 5FI0B 4OX9L 1KMQA 1R6BX 4NCKA 3GLFB 1E2KA 1VECA 4C0HA 3TJZA 3OFNA 3RC8A 3M4OH 2Q3HA 4KN7C 5DN6D 3IPXA 3UPUA 3U5ZB 3G0HA 5FH9A 1G7CA 4P73A 3AH8A 3QG5A 4RSGA 5FUXA 2NVQH 1D9XA 1EFTA 2UUAL 2YVUA 2F4VQ 3PSIA 1CR0A 1VHTA 5KNBA 3L2OB 3QEJA 4UKDA 4HLUA 4BQSA 4JI1L 3AGPA 1HR0Q 2FPMA 5EXPA 2KBNA 2R44A 2XXAA 1YITA 5KO2A 2PX3A 3AP2A 3I1FA 1O7IA 2CJWB 2HLDA 2FSHA 3GD7A 4LGMA 4DUZQ 3R9WA 1NVXQ 2OCPA 4DPGA 1H95A 2OUKA 1GG2A 1A62A 4OYHA 1CKMA 4QQBX 3L8YA 2JLZA 1AJEA 3QXCA 4QOSA 2PNHA 2QROA 4DWJA 1B8AA 4XVQA 1JEEA 4KBGA 5FFMA 4D81A 3KB1A 2Q21A 3RNLA 5CK4A 5IYCH 5CLQA 5JCZA 4V02A 3E9HA 4JL5A 4IFEA 1N2CE 4C7OB 2JA9A 2QMEA 3RHFA 5FR2A 2YV5A 2WKQA 2C2HA 3ULPA 2FXQA 1KI6B 4LW1A 3KTAA 4GKJL 3QUSA 3UATA 2P5SA 5ELNA 4LFBQ 1FX0A 3U44B 2WKRA 3A8TA 4A92A 1EYGA 1XZPA 4TTRA 1CJKC 3SEAA 1SN8A 3CF5A 1L2TA 3Q85A 4LRWA 4US2R 4Q47A 4HJ9A 2IYQA 1U99A 4OBEA 3TUJC 1M7BA 4DLVA 1N34Q 1NVVR 1E2FA 3TH5A 2BV3A 4Q1DA 2RHSB 2VHCA 4Q7JB 2IF0A 3OAAD 2REXB 2WOOA 1X3EA 3I4MH 3S14H 4ME3A 4Q21A 3R8CA 4I1VA 4MYHA 2NVXH 4KU4A 1PH7A 1VYUA 4DV4L 3F8TA 1ETUA 2UXBL 4JI6Q 5AJWA 2R7ZG 2FJUA 1N3BA 3FKIH 5JEEA 4UNNA 1YZQA 2Q2UA 3B9PA 4C0SA 3WY9A 4HAXA 1P9WA 2GJ8A 3S1MH 3RS0A 5D3MB 3KFUA 5FOSA 4A3EH 3U61B 1MV5A 4M1YA 4AYBG 2ZS7A 4BECA 2PPBC 1KI4A 1C9OA 2R93G 1LYLA 1G16A 1Q20A 3BH7A 2R6GA 1X3FA 4AKEA 1XNQQ 1U0LA 1L0WA 3TW8B 2JA7G 1DE0A 1JI0A 2ZI5A 4RD6A 2V6IA 2F1IA 1E24A 4PQYA 1Q1BA 2PNRC 3W5OA 3U3KA 3ZZUA 3A1UA 2A5DA 4F38A 1SGWA 3NBFA 5IRCD 5L3QB 1M90C 4JT2A 1CKEA 4JLOA 4LHZA 4JBKA 5B58C 5LMUQ 2PT5A 2XAUA 1UADA 2ZSFA 4C30A 1N0UA 4R4TA 4A9AA 3TSWA 1KK1A 1VTKA 3H1TA 3QPUA 4ZIRA 1CS4C 2Z43A 1KGDA 2ZYUX 4TT3D 3CRW1 4BEJA 4FCVA 1YQTA 5JEAJ 1GKUB 3LWUA 1M2OB 1QF9A 2CDNA 1MT0A 4KODA 3PENA 4LC1A 4MRSA 1S1CA 2FN4A 4OXPA 4QGUA 3QJYA 2MNAA 3SBEA 2K50A 1IBML 1R8QA 4LHYA 1KMHA 1DARA 3CIOA 3J80i 1ODFA 1OXUA 1T5EA 1E9RA 1R0YA 2F1HA 3ASYA 1Q3TA 3M4YA 3HOYH 1YJNA 5FPSA 4EQ6A 2Q2IA 1KI2A 4TLDA 4YLGA 5IYCG 2SHKA 5FUWA 4F93B 4JI8Q 4LPKA 1NMXA 2I0QA 2D74A 3B1ZA 3QBTA 2RGCA 5FPTA 3RWOA 5KUTA 1W4RA 3K0CC 3BORA 2J0SA 3ADDA 4HIKA 4NCIA 4PHHA 3CX7A 1UEBA 1XCMA 3LV8A 5C4GB 1FL9A 2A19A 4DR2L 3T1HQ 1XCGB 4QJ3A 3NDBB 4GNXC 2KENA 3QKTA 5L3RA 4D2IA 2DNEA 4JYCA 4D4JA 4FMCF 3GJ5A 1XTQA 3RLFA 1E1OA 1E9SA 1UDWA 5DLQC 2FSFA 2FPKA 4DK3C 4CEIB 2A5GA 4AKGA 4YMSA 2BE5D 3PEVA 1LTLA 3CAMA 2ZRKA 4XTCS 2UXCQ 2EQSA 4MYTA 3CWZA 3VR3A 2JJ8A 2RHQB 5DHAA 1AGRA 4DB4A 4EJSA 1W46A 3D3QA 3WNDA 1FJGQ 2H8KA 2FSGA 4I1SA 4JI0L 3I4MG 1E2IA 3ADCA 1BBWA 3RN2A 1Q12A 3UDGA 4NH0A 4WZAE 1II9A 2F43A 5JI3E 4DR4Q 1XCPA 1T3SA 2VS1A 3U3JA 1GHJA 2BJVA 1E0JA 4DDTA 3FKIG 3P4XA 3GTQH 4JYAL 3K0AB 1EESA 3KLRA 3CQZH 4WA7A 4FDBA 3F2CA 1FVIA 2N42A 2QP4A 2A69C 1Z3IX 2ZRJA 3MUFA 3N2EA 1RIPA 4RD4A 4LX0A 3AF0A 4LUVA 4R4QA 1QHNA 3KYHC 4BFWA 3FOZA 4GL2A 4AG6A 1X55A 1ZCAA 2J3EA 4RZUA 2NO0A 4A6XA 3GJXC 2QE7D 3Q9LA 1GP2A 1HNZQ 4UY8C 3CMEA 2GDJA 3KDFA 2A3RA 2PEZA 3E70C 4A4IA 1VQCA 2GKSA 1GVNB 4P0TA 4X8LA 3RABA 1D8TA 5JCPA 1US8A 2PT7A 5GQOA 5TB5A 2EFHB 4YMVA 1YJWA 2RGEA 3TQCA 3AKYA 4B6EA 4CEJA 2YTYA 1GL7A 1NE3A 4V0MA 4F92B 1K8MA 2CNWD 1EFWA 2EFGA 2B21A 1G8FA 2ZJ8A 3KKNA 4HATA 3KF8B 2XOKD 1AZSC 4OK6A 4WZ6A 2C77A 1XPUA 4DZZA 2ERYA 2ZIAA 3LXRA 3QKSA 1EWHA 1N6RA 1F5NA 3HWSA 2PLFA 4CVNA 4EFLA 4DLXA 2A6ED 1UAAA 3AF1A 3UWKA 1G3IA 4DV7Q 2EFDB 1PH6A 1J6QA 2OTLA 1G4AE 5GJVC 3RDPA 3TBKA 5H70A 2AMCB 3TVDA 4RKEA 1F2TA 3HOYG 5G41A 1FP6A 5K8TA 3PXGA 3FDIA 4KFSA 4DC9A 1EFRD 5JWRA 2JA8H 1GNPA 4NL4H 2CLDX 3K0FA 3B1XA 4X66Q 1G41A 2F3TA 2ZRGA 1Z2AA 5GJBA 2OWOA 1BKDR 3TIFA 2NVTH 1YR7A 4QNRA 1N33L 1VQ8A 1ZVQA 3ZDQA 3QBVA 5M5XH 3EW9A 3JAMi 4B75A 1IBKL 4DR3L 3DKVA 2BBTA 5B64A 5GAHC 1XEXB 4EDHA 5E7NA 3IBGA 4BXXH 2WSSA 4B34A 2A6HD 1GIAA 1TL7C 3K9HA 4MRRA 5CLLA 4B3RL 3IFTA 1EIYB 3VHXA 4C2MH 1CR2A 4TMZA 4KCGA 5TY0A 3O47A 2OO7A 4TVAB 1FYCA 4IKEA 2XGJA 4MITA 3VR1A 4JI7Q 2H7VA 4GRAA 3T34A 1E9EA 1SVSA 3GCGA 4P31A 5JJKA 5JI2E 2R7FA 1YR9A 1WYDA 1UE7A 4C3ZA 2CE2X 3ZJYC 5BXQC 3ICEA 2F4VL 3TGPA 1KI3A 1LY1A 1HR0L 1TEVA 1KK0A 1SMYC 3HFZB 1QBKC 1DS6A 2UXDL 2J45A 3FTQA 3MG9A 3S1QH 1OIXA 4LF6Q 3QVVA 4HB4A 5FUVA 4IEEA 4UP8A 1T5LA 2I5MX 3I4LA 4WXRA 4A3KG 4TSFD 4W9MC 4Q4JA 1GHKA 4RCYA 5J4VA 5EXTA 4IFDH 2D2CC 4P72A 1KDOA 5F3WB 4IOKA 1FUKA 4POAA 3C14C 3UXMA 4B3DA 2ASBA 3A8JE 4DEXA 1G51A 3S17H 4M0LA 1KDTA 3T61A 3CW2C 3LWNA 3GP8A 1QHHA 821PA 1HPCA 4OWWB 3QXHA 1A6XA 2MFIA 1E2PA 1PH1A 1FTNA 4HEJA 2RGBA 2GXQA 1TWHH 3EXAA 4E09A 4IDOA 4GNXA 1H8ED 1YNXA 1XD8A 4LUZA 4I4LA 4HZIA 2QBYB 4GOXA 5A4JA 4Q19A 1CR1A 1LW7A 1JJ7A 1OTCA 1M7HA 2MMGA 1A4RA 2REBA 2EW1A 2CWPA 2I1QA 4EAQA 3T15A 3J81c 5JRJA 2PX0A 2W58A 5HCNA 2IYUA 2V6JA 521PA 6Q21A 1JJCB 2IS6A 1OKKA 4DV3L 3CCMA 1O87A 3CPFA 4O0MA 5J4LA 3WBJA 2QM8A 2KBEA 2NO1A 3FPPA 3NEMA 1CIPA 1SR3A 1MOZA 3RS4A 4GN4B 1SVOA 5C0XG 4DNRB 1P8LA 3RN5A 1HTWA 1K5DA 1ZNZA 2WIAA 2ZI6A 4UNQA 4ASUA 1JR6A 4DK1A 2JA8G 1F6BA 3L2PA 3SU8A 4CDGA 1OLOA 3SJBA 1WCMG 2Z5FA 1NI3A 4Q4AB 4O2RA 1W49A 4DEYA 5E7IA 1G6HA 5CM8B 3TW4A 2H57A 4PV1C 1D6JA 3EZ6A 1KI7A 4JLVA 3CPWA 2ATXA 4C4PA 4MUAA 2PMKA 1QUQA 4DR6Q 2C8VA 2PZEA 3AEZA 3OEEA 1G1MA 2I4IA 4DCTA 1Z28A 4JK1C 4A3JH 5UKDA 2E9SA 1GVPA 1JAIA 2FEMA 4BXXG 1XWIA 5C44H 4B3SQ 1N32L 4AH6A 4NDZA 2O5VA 4FWTA 4NYMQ 4YWKA 3ZIAD 3G6EA 2WWWA 3CX8A 1F48A 2AXPA 1KO4A 3LBIA 4PPNA 4PTLA 1GDDA 4W5WA 3P20A 3VKGA 2O8DB 1HZBA 2ONJA 5E7MA 4GOKA 3F5FA 4HYYA 4BBRG 3J81j 4C0KA 1BMFA 2OFOA 2CK3A 4QG7A 3R9IA 5SZHB 1IW7C 2ZQ5A 1UJ2A 1I50H 1SXJD 3WBKA 4XTRA 4JI3Q 1OFHA 3SHWA 1HTPA 1XFAA 4B43A 2EQBA 2FU5C 1M6NA 1QZHA 2YTXA 1AK2A 2NVYH 3LAWA 5M5WH 4ZCIA 2EJMA 2GN5A 3GPLA 2IYRA 2VQFQ 2REOA 4LWCA 4LOAA 1IN7A 3NXSA 1CUKA 2RH5A 1LS6A 4LHXA 5DO9A 3A8KE 1J7KA 4JOIC 1OV4A 3DM9B 2XZOA 4B74A 1ZUIA 2GJSA 5M3MH 5FLMH 2RCNA 3M1IA 4RCZA 2YWHA 1M1KC 1L8QA 4ILEA 1Q82C 2H92A 3Q7PA 2R6FA 4FD2A 3ZYCA 5J4HA 1VYTA 2H5EA 2EDGA 2MMCA 4D82A 4MKFA 1G19A 1UE6A 4UNSA 4MYCA 3U4QA 1NTGA 5H1SE 4DXAA 2IHFA 5HGQA 2GRJA 3IRBA 1KDRA 4DSOA 5FTKA 3HOVG 4QFMA 2NO9A 1DAMA 1YU9A 1AQYA 3AF4A 3L82B 4FMDB 4P4SA 2B8GA 4YCWA 2GJAA 3H94A 2A7QA 1I6VC 1ZM9A 2E75C 1Q22A 1SVKA 1II8A 1MO5A 4DCVA 5FTNA 3V4FA 4A36A 1CBUA 4G1UC 1RJ9A 4KBFA 3PJRA 3PEYA 5AJXA 5CM9C 2ZTSA 1PYSB 2OBLA 2GK6A 4GBMA 3GLFA 1VQAA 5EE9A 2CEAA 1VG9B 3IUYA 3L43A 3K80C 2F3RA 2A1AA 3EN2A 4DKXA 5C4JH 1GTVA 3N2IA 1GILA 1SE8A 1L4UA 2C5LA 1GL6A 4PZYA 3WRYC 1Q46A 5EQTA 4PAQA 5FR1A 3MWJA 2EVWX 4TTPA 1DD2A 4DT1B 1AS3A 4M1WA 1YHQA 4QBIA 2E2IH 5CJ2A 4V0OA 2C35B 4DR4L 1CLUA 2NTYC 4UJ3A 3UG7A 1VQFA 2RHDA 3A4MA 1NJGA 1OB5A 2CJWA 1EX6A 2CL7X 4NYMR 2XTZA 3O8RA 1MABB 1KYIA 1NN1A 3EPKA 4L8JA 2VHTA 4LWZA 2J0VA 4A3JG 1IJEA 3B82A 4RD0A 5BW8A 2F9LA 5CDFE 4P4TA 2XSZD 2ZRIA 1A2KC 1VHLA 4YXWA 1G17A 2BKUA 4OK5A 3EQLC 1T5IA 4R98A 2V3CC 1NNEA 1TADA 2JIZD 1H9MA 1Y8OB 4KKUA 2Z6KC 2FG5A 4B3GA 1N5IA 3G82C 1CRPA 3HOXH 4DCNA 1JXOA 1GNQA 4OQLA 1HNZL 4DR5Q 3CW2A 1NRJB 4C7OA 2ZR0A 1HEIA 1XZQA 3H86A 1RW4A 4F4CA 2K7VA 4GKKL 2JLUA 3A36A 3REFA 4BFYA 3KQKA 1XX6A 1E79A 5FTMA 1KTVA 1ZJ6A 2GAOA 1PHJA 4Y0VA 3CCJA 2ZI4A 3FE2A 4XWAA 1VQ4A 1WBDA 4ZDJA 2HCJB 3VNUA 2F52A 4QL3A 4L5QA 2ZJQA 1UFQA 2G1KA 2ZROA 4QHTA 3SJCA 4DR1Q 2XTMA 4B3FX 2ZYVX 3CBQA 2WFWA 2JLQA 4PC7A 2OM2A 4NCJA 4X62Q 5M3MG 5FLMG 2PZFA 1F3OA 4K81B 4ZI2A 3U4ZA 2ODEA 2GAAA 2OCYC 2EJFC 1UM8A 4DV7L 4QL5A 1P3JA 1AM4D 4DNTB 1VCMA 3TK1A 4DR7Q 3AVQA 1JALA 2IYZA 3KKPA 3D0FA 5C2JB 4LF5Q 4LSGA 3HU1A 1DELA 2IS4A 1FL0A 3CWQA 4FI3C 3NBHB 2D2FA 1CRQA 1U0HC 2B6HA 4ITRC 4X66L 2DUDA 5D3MA 3R7WB 5FBLB 5G53C 1QHXA 2OTJA 1W0JA 1P5ZB 1JMCA 2V1UA 4C0QC 4DUGA 3FKSD 2VYFA 3KXIA 3NDPA 3OIVA 2DNCA 1GO3E 1HNWL 3ZQJA 2WZQA 1DG3A 4B3CA 1LF5A 1HT2E 4P4UA 1H8HD 2ZE5A 4DV5Q 1WCV1 4DV6Q 2VO1A 1UE5A 4BRWA 1Z9FA 4LFAQ 5L3SB 2AX4A 1Z07A 2NGRA 3LW8A 4G5GA 1LUZA 2X77A 1IL2A 4KSBA 4B48A 2UKDA 1Z6TA 1H9SB 3EWAA 1J2JA 3S1AB 5L3QA 2QQ0A 4KI0A 1XXHE 1NKTA 2GWHA 4UNPA 2ZSBA 1U8ZA 3FMFA 3GFOA 1LM0A 1R10A 4OI4A 5ELXA 2EWVA 1KK2A 4JI7L 4HJAA 5JHHB 3WP0A 4NMMA 5GAGC 3L8ZA 4N0DA 4C2UA 1NBMA 1TNDA 2J7KA 1QG2A 2I1VB 2QA4A 2WTUA 1Y63A 1WOCA 2B7BA 3FGNA 3I4NH 1KI9A 4QBHA 1FFHA 1NVWQ 1TTTA 4AYWA 2CXXA 1XNJA 2ZJPA 4DSUA 2B63H 4JOIA 1XF9A 3A4NA 2WWXA 4A93H 1TQDA 3PIRA 3TAUA 1LF0A 4OHXA 1LACA 4LF6L 2QM7A 3UDFA 4GT1A 5G40A 3G71A 1NY6A 4DHEA 3K9NA 4DV0Q 3MJHA 1M74A 4IDPA 1Z0IA 3TQFA 3UDXA 3D6TB 2RHMA 1DADA 3DMDA 4K0KQ 2N78A 1A63A 2ZTDA 3FHWA 3QSYA 1K83H 3EZ2A 2ZXUA 3OIYA 4PC3A 3FHCB 1K6MA 4XD7A 4PQFA 1FTSA 2FV8A 2UZ3A 1G7TA 2EJGC 1XMIA 1PLKA 2A5YB 4CEIA 2J0QA 5F9HA 1NN3A 1UBCA 3PIPA 4B3ML 4LBZA 4UJ5A 1CSQA 2B92A 4IPDA 2OAP1 1E69A 4A3CH 1CJMA 4IXMA 1VQEA 5EJEA 3EIQA 4LBVA 4DIEA 3BFVA 3Q8XB 1W5SA 2NN6H 1SKYE 3A37A 2KCMA 4EFNA 2AFHE 3AVOA 3DPUA 2QPTA 2G9NA 1E3PA 2PH1A 3EAQA 3FFBA 1JR3E 1KI8A 2WJVA 4PSAA 4E03A 2ZI9A 4HDOB 2F7SA 4QGFA 2ODWA 1UE1A 2JJ1D 3K0AA 4DDVA 4F91B 1Q90A 4GZYC 4M21A 2F1RA 4OJQA 1SROA 3K9GA 2ZR9A 1U98A 4JJZA 2AUJD 2BDOA 3OTOL 3GJ6A 3EZFA 4NXNQ 4DR6L 1UBFA 3BZKA 4N0EA 1ZD8A 1KO7A 2CW0C 4LUCA 1KHIA 3H0GH 1PJRA 1VCIA 5IK2A 1CF4A 4X65Q 5FOXA 2KA7A 2ZUCA 1TAGA 3KFVA 3E0EA 3B13B 4OI0A 2OILA 2Z6KA 2IX1A 1E1QD 3ND8A 3DHWC 4LJ6A 1R5NA 4YDHB 4B76A 421PA 1RYFA 3M7NA 4P33A 2HDNB 2VF7A 5JWOA 4DKAC 4D0GA 1MKHA 3RS5A 5TVKA 4LK2A 3WMEA 1OH6A 4KXFB 5TMPA 1P72A 2K4KA 1S9DA 4P74A 1LS1A 2QPOA 4RFVA 4Z1MA 4YY3Q 1U9IC 1Z29A 1ZU4A 3GO5A 2LKCA 3HDTA 4Q1AA 3WNBA 5FUYA 2WPDA 3I4NG 1G3RA 2HCBA 4G7HC 4US1R 4JI5L 4DLZA 4B6FA 2WBLC 1Y8NB 3STBC 1G8HA 3CRVA 4A93G 1W4AA 3GLIB 2AD1A 2VQFL 3T12A 3OOCA 1GM5A 1JT8A 5GADl 4R4CA 1IONA 3JZMA 2IYSA 2FFQA 4IW3B 5F98A 2B8TA 1T6NA 1E2VA 2RGNC 5DISB 2ASEA 2QSYA 1SLJA 3CR7A 4X8MA 4D25A 4KVAA 5GJCA 4DSNA 1RIFA 2JA7H 5FL7D 4KFRA 4D4KA 3L0PA 1Z47A 3U7FB 4OI2A 5DIFA 3J7ZC 1E0AA 2QL6A 3QKRB 1VQLA 3THWB 4BLPA 1CP2A 2C96A 4BLTA 1ZMXA 3KQLA 3GQBA 1NG1A 3B1VA 4ZDWA 1XEFA 1FNMA 2PMDA 4JVMA 4B3TQ 5DE3A 3GLGE 3I62A 3IQXA 1XEXA 2VP4A 1QVGA 1ONLA 5IP7G 1BH2A 4B71A 5E3HA 2AKYA 1OYWA 4F4IA 1SULA 1FNNA 2Q0HA 2YC4C 3DM3A 4LV6A 4HAWA 3RYTC 4UQOA 1X8KA 4PG3A 4A3CG 1PV4A 1I3QH 3PF4A 3U9SA 4TMVA 4X8HA 5GJWC 1L1OB 5HCIA 1NKSA 3VMFA 3STBD 4HIDA 4Z51A 3GMTA 2NN6G 3CCRA 4YWMA 1IN6A 3CMAA 1KQSA 2BMDA 1W4CA 1PH2A 2HF8A 2WJGA 2Z6VA 2PQAA 1W3SA 4HLDA 4OQNA 5G3YA 3UIEA 2XGTA 1E1RA 3RS2A 3HOZG 1IBLL 1XTDA 2BMFA 5FI1B 1IXRA 4B2PA 3DZ8A 3A8IE 1X8JA 3TSOA 1PH5A 3WHKA 4AI6A 4KLKA 1I4DD 4EFMA 1MO3A 1X6VA 2IYXA 1JJ2A 2DB3A 5IWAQ 5C46F 4JS0A 2DWPA 2VSFA 2IF2A 4PC6A 3X1ZA 1QHIA 2J0UB 1V1QA 4DB2A 4L5SA 4RD2A 2F1MA 1XU4A 5LPNA 4KHPL 1UPTA 2PMZE 2Q9BA 3TRZA 1GRRA 2ECKA 3H0GG 2P67A 2JCSA 3GEEA 1WXQA 1DO2A 2XNDA 2A30A 5AJZA 2QUZA 3GLGA 3WWVA 2DYKA 2PCJA 2VP2A 5BQ5A 4PPGA 1M8PA 1U5KA 3W9YA 1RRPA 5LB2A 1TU3A 3Q3JB 3HKZE 2XJ9A 5AJ3L 3FKQA 2OCEA 4LYAA 5KSZA 4JC0A 2KHJA 2E76C 1SXJB 2BMJA 1QVRA 1X1SA 2E74C 3QIAA 5DHFA 2LSSA 1LVGA 3NE5B 2Y8EA 3CC4A 2ZRDA 3DOFA 4GSYA 1W4BA 3EWSA 4IFDI 4GOJA 4DDWA 2R2AA 4LHWA 3HGBA 4BFSA 4IEIA 4URYR 5IYBH 3H15A 4A2WA 4EPYA 4YMTA 1T0JB 1PZNA 3LFUA 1OHHA 3LQQA 4B44A 2BHRA 2E87A 4JKYA 3V4RA 2OG2A 3SHFA 2IS1A 2JLRA 3D7MA 1UWVA 4GLXA 3KXKA 4L15A 3A1WA 2AHOB 1UBEA 1E2ZA 1Q86C 2ANCA 2ZJYA 4P71A 5JS8A 2VW9A 2ZANA 4JG2A 1EIFA 2J5XA 2XX3A 1VMAA 2JDIA 4HZUB 3BB1A 1JQLB 5KDOA 4X62L 2WB1G 3CPHA 2QG6A 2IA5A 1B0UA 2FOLA 1G8GA 4Q4AA 621PA 5P21A 1E4YA 2KCTA 1W5TA 4US0R 3EX7C 1EX7A 2QPAA 1PFSA 3CCSA 1QG4A 1S9HA 1Z6AA 1LB1B 2GEUA 2WMOB 3LVQE 1S3SA 3EPJA 2YTVA 2OLKA 1QZXA 3L0OA 1KO1A 1S4QA 2O8CA 2ZI7A 5IDVA 1W47A 5IF9A 2C99A 1RRCA 4FCWA 4UXHA 4MDFA 4EPWA 1WRBA 3SN6A 4Q00A 3CCUA 5J40A 1U81A 5C4XH 3VTKA 4PC2A 2V8OA 4HLQB 4C0BA 2LCFA 4BY7H 4LJZC 2CKZB 5FBWB 4JI2L 3QE0A 4L9WA 2O8DA 2JATA 2BE5C 2QGZA 3WDNA 3CP0A 3N6RA 3BS4A 1A8VA 1VQGA 1WMSA 2BVNA 4KFUA 4QGAA 3I72A 4DV5L 3A74A 4DV6L 2QT0A 2GCPA 3MEFA 4RMFA 3H2YA 4LUOA 2HYDA 1CKNB 3BDOA 1YKSA 3LGJA 4BFVA 1HT1E 2QP3A 1PUIA 1HUQA 3GDEA 1U9IA 5HTKA 1TKWB 1CU1A 5TDHA 3VR5A 3VDYA 2ZEJA 4Q01A 2NIPA 5LMNL 1XJVA 4M1TA 3U3MA 1XTSA 1N25A 5AUQA 3ZVNA 4GZMA 2IHEA 4G7ZC 1NMGA 3DMNA 4HUQB 2A5FA 2EYQA 2RGXA 3I2ZA 4MGIR 2P3SA 2FGJA 2VUMH 1YBYA 1KJYA 1ZC3A 3SYLA 1G8PA 1E7ZA 2WAXA 2HXYA 2RGNA 4KVGA 1TX4B 2ORWA 1J70A 1XEWY 2NOAA 2YNMA 4OO1I 2WSSD 3DKPA 5FPHA 2D0PA 4JLBA 1XNRQ 4EQ5A 2O5IC 4NPSA 3OEHD 1WB9A 4C2TA 4DV0L 1LV7A 3NBXX 2MSEB 2QTHA 3ZZ0A 1Q1ZA 2W00A 4V0ME 1R7RA 4MRPA 4LFCQ 3MLEA 3W34A 1WJJA 4TQ9A 5C18A 1DAFA 3K8AA 2YWFA 5IYBG 3PR1A 1ZCBA 2D4HA 4L8GA 1SVWA 5E7JA 4NXML 4HSEA 1LFDB 4X8OA 1XMVA 3GLHB 4OHZA 2UUBQ 1R2QA 4OHYA 1E2DA 2N46A 5HZKA 2L5TA 1VQOA 2IUTA 2K14A 4A3IG 2MSCB 4ACAA 4CRWB 2A6EC 4A8JC 2E2HH 2GHIA 1IYVA 1WBBA 3CH5A 3SNHA 1K8AC 3QKUA 3H3VH 1ZBDA 3TE6A 5B57C 2J1LA 2FMXA 4Q1BA 4D0LB 3QY0A 4MTNA 3U2QA 1HH4A 1F60A 3SE0A 3TVTA 2AWNA 3BFKA 2O8BB 4A3KH 3OAAA 4TN1A 5F2EA 4OONA 3B60A 5JECA 3KQNA 4MKIA 1R5OA 2JEOA 3ERSX 4ABYA 4DT1A 3T53B 1Q44A 4G5OA 1VDZA 3IDQA 1ZYUA 4RFSA 1BDOA 1KO5A 1IN5A 3HP1A 4YDSA 3RS7A 4KAXA 1E98A 2CHVA 5B30A 1UEIA 3FYHA 1EG7A 4TYPA 1E22A 2PEYA 3S1NH 1K73C 3NTUA 1J90A 1T8TA 3T56B 1Z0FA 4JBXA 2WWYA 2JLVA 4ARZB 1XD2B 1G4UR 2BH8A 1VQMA 121PA 4IFDJ 5C4XG 2K5UA 4G3XA 3T5GA 3THYB 4JV5Q 4H02A 3IILA 2ZRCA 4G5SA 1NMYA 4BY7G 1OXXK 2ZJBA 2LMCB 2A6HC 3AGQA 3BJUA 4LF7Q 3OW7A 4LF9Q 1G6PA 1IN8A 2IXGA 3CR8A 1KIMA 1OFUX 2WJYA 3SFZA 2BDTA 3A4LA 2B7CA 1W0KD 2FFBA 1GITA 5JMTA 1XBTA 5J4YA 3B1YA 2RGGA 3WYGA 4EIWA 2OHFA 1XEWX 1YHAA 2F3IA 4IVQA 2P5TB 4DRZA 1KI1A 3PO3H 2ZSDA 5C0XH 4MGKR 3M4QA 3MSXA 4QJ4A 4K8OA 4QRHA 4GOPC 4DLRA 3CF6R 2LKDA 4DAYB 1G7RA 1QJOA 1WCMH 3CB4A 4PZZA 1DAKA 4TT3A 4X64Q 2Z0MA 2BCJQ 2HJGA 4JBYA 4YY3L 5JRZA 5BYKA 2ZRHA 1SHZA 2IL1A 3GEHA 4NZYA 4A3FG 3EC2A 1PA6A 2WMNB 3PO2G 2VUMG 1XTIA 1N6KA 2V7QD 3OPOA 1CJUC 2CLCX 4IOCA 2R8RA 3RAPR 1Z63A 5K36H 4ALPA 2OZEA 4KYUA 4R1JA 1I4TD 3P32A 4DV2Q 1B9NA 2HF9A 1ZM3A 1KZ7B 1C0AA 2FNAA 4TYWA 3AUYA 4GP6A 4BBRH 2WOJA 4DV1Q 1ESNA 1HA3A 1H65A 1DPFA 1BMFD 3R7WA 2CK3D 1X9NA 1E2NA 3SJZA 1G3QA 2VQSA 5H1YA 5BR8Q 3K09C 5EAYA 2RGAA 3ADKA 3U7EB 2QA5A 1M7GA 1TUEA 3OE7D 5DYIA 1G7SA 2JJ2A 4KLNA 2G0NA 4Q9KA 3RRZA 4M1MA 2FFAA 1VG0B 4A0GA 2KI5A 2ZE7A 4GN5A 3BIFA 2D0OA 3ZZTA 1YZGA 1NN0A 2XXAB 1L1OC 4GLAC 3GTKH 4H0LC 1BKBA 5L3SA 1E2HA 4AIIA 4TQAA 1VQNA 1NN5A 2DFNA 2JE6I 2J41A 3AP1A 3KJEA 4Q02A 4OWTB 4DUZL 2GCOB 3LNNA 1H9SA 3RLNA 1H9JA 2VLIA 2R6CA 3FMPB 4PHGA 5GADC 3G5UA 4YC7A 4ZO4A 3W6PA 3AF2A 3R20A 4LPSA 2P6RA 3OZXA 1KSJA 3I55A 1NLYA 3HOUH 2CMKA 3KKOA 5TV2A 3BH0A 1GUTA 2GXUA 3I8SA 4TMXA 4A76A 4XJXA 2ATWA 2H17A 3VQTA 3WRXC 3O8CA 1KIXA 2LXKA 3K0CA 4HJ8A 1OPXA 3C5HA 3KKMA 4RKFA 1LTQA 4LHVA 1MIUA 4PR0A 4HJ7A 2C9OA 3IGFA 1Y69U 4YCUA 3EASA 3HYRA 5AWFC 3K0SA 3CNOA 1KKLA 1QVCA 3HOVH 2W0SA 4NPHA 4YMWA 1Z6GA 3KTAB 2IWHA 2KSQA 1ZNXA 4OQFA 2CCZA 1NLFA 3H4MA 4DDUA 1HQMC 4LJ5A 4TLAA 2UZIR 5TARA 4ZDIA 4LFBL 2QE7A 1GD7A 1K8GA 1FX0B 1TPZA 4NKRA 5EE0A 4ACBA 3ZD6A 2R7DA 1EFHA 2VIIA 2JA6H 3VU9A 3PV0A 4PMWA 4BLOA 1JE5A 1A0IA 2VPPA 2G1JA 2WWHA 4XH9B 4TKOB 2UUCQ 1SXJC 3CCQA 3S16H 4JKIA 3K81C 2X19A 4W5JA 3PO3G 1DCZA 4PSKA 3C41J 3CF0A 1N34L 2MO0A 1OH8A 4A2PA 2ZS8A 4DAMA 3NEYA 1T91A 2XOKA 1KAGA 3DLLA 2EWWA 4A3GH 3UE0A 3KF6A 1Q21A 1TUIA 3CO5A 3GJ4A 5HKKA 4PO8A 1YRBA 2PLRA 3J81i 4PFSA 1Z2CA 4JI6L 5K8UA 5DNYB 3A6PC 2OT3B 2Y0SG 1E2LA 2G6BA 1KY3A 3AV0B 4I81A 1W36C 1N6NA 1II0A 1NMFA 1QRAA 4GFDA 4PPFA 4O2DA 4EPXA 5A5GA 5K36G 2GA8A 3AKDA 2NMVA 1I2MA 4KV9A 3M4PA 4YXWD 3PCOB 1YZNA 1AA9A 3I8XA 4DVGA 1XNQL 2GBLC 3LRPA 3TS2A 2F6RA 3D4RA 2AN9A 4NYJQ 1X65A 4R7ZA 4Q9HA 2NN6I 1Q7YC 5BN5A 1GKIA 2FZ4A 1G5TA 4LI0A 4TLEA 4JBJA 3K70D 3KJIA 4R4IA 1PH9A 3OYYA 2ZRPA 1HQCA 4DBLC 5FBQB 2ZUBA 1GAJA 1A7JA 5LMUL 2OQ0A 3UMRA 1S3OA 3GLFE 2KHIA 1W44A 3THOA 3W8RA 4IRUB 1Z83A 1Q0UA 1W2BA 4IPHA 4JIMA 4QM7A 5JHGB 1W36D 1Q81C 4BFXA 4QKQA 4HIMA 3QXJA 4WOPA 3PQCA 1ZP6A 3ZVLA 3HOUG 1EFUA 1DAGA 2GVBA 1E2EA 1KMHB 1N0VC 3W5IA 1CTQA 2DN8A 1TEXA 2VHUA 2A68D 1K5GA 2WJHA 2R92H 3Q72A 1DAIA 1TWGH 3KLWA 3UWOA 1NIPA 2ID0A 4JI8L 3W1BA 3B6EA 3KKQA 3Q8DA 4QXAA 4DLWA 3GLIA 4TQUS 3NG1A 4XSHA 2JLWA 1P60A 1E2QA 4IJLA 1IY0A 1WP9A 4DCSA 4HAZA 2H1LA 1V5WA 1NJIC 3W5JA 4G01B 1BO6A 4Q7KA 2CE7A 4JBWA 5DI3B 3T1HL 1VG1A 2A9KA 1KO8A 3W1GA 5JBQA 3Q7QA 2V1CC 3AB3A 2O8EB 1TU4A 1HZAA 2V4ZA 1Y1WH 2JA6G 2XTIA 1IOZA 4GP7A 1SVLA 1DGSA 1J8MF 5JLJA 1KK3A 2BIFA 2BCGY 2Q6TA 3QKRA 3THWA 4E22A 2CVHA 3CM0A 5SZJA 5KDLA 1XNRL 1JAHA 4DIDA 4CF7A 5KTYA 2UXCL 2DWQA 2ZM5A 2Q3MA 3C8UA 4ZCMA 2XB2A 2J7PD 4A6PA 1KDPA 1GRQA 2NZJA 2V1XA 5EZ6B 2UUAQ 1H8EA 3VR4A 2VSOA 1FJGL 2K52A 4LFCL 3LLUA 4G7OC 4JI1Q 3B8HA 4A3GG 5ANRB 2GZAA 1VPLA 2P65A 2F43B 3SI7A 1KRSA 5C4MA 4QY7A 3M6AA 3BGWA 1PLJA 2GTPA 2JEBI 4JBMA 2YC2C 3F0TA 5KDDA 1L1OA 4CT5A 3AP3A 2P6UA 2VHJA 5EP2A 3NH6A 1SZPA 5IE8A 2EU8A 2WM9B 4QHYA 4Q4HB 3ZGXA 2AKAB 2P0EA 3WXMA 4K46A 3FWYA 5A35A 2DFKB 2FEOA 3B85A 4NYJR 4QHSA 5CK5A 5DH9A 2IK8A 2WWIA 1EUJA 4H1VA 4OHVA 4FCTA 4ZV4A 5H8WA 2R6DA 1YJ9A 1FMJA 2Z4SA 2HQLA 1HZ9A 1OW3B 5F9FA 4PO9A 4WJ3M 4L9SA 2J0UA 4UP9A 3CKLA 5CIQA 3PCRB 1N8RC 1KI6A 4GKJQ 1LNZA 4UNRA 2EXDA 4BGDA 1NG9A 3ZJYA 1P2TA 1YZLA 2PZGA 5FJ8H 1Z08A 4I1OA 4L16A 2VP0A 1P2UA 4I99A 4H13C 4NTZA 1MRSA 4S2EA 5EP4A 2HJVA 2JA1A 3W3AA 2VP9A 3U44A 2ZJ2A 2ZTEA 1BYUA 1F2UB 2WAQE 1OE0A 2GETA 3ZIAA 2YKGA 3GJ3A 3AF3A 1E1TA 2C9CA 3NC0C 4YCVA 1OH5A 1ANKA 1X1RA 5C3EH 5ELOA 1E99A 2L0XA 5JFGA 3JVUA 2JEAI 3P27A 1JB1A 2C95A 4FN5A 1SXJA 2C03A 4MKGA 1NVUQ 3MCAA 4P75A 3SQXA 1IBRA 3IO3A 2ZSAA 1X86B 2BH2A 2YZ2A 1S1MA 1E9DA 4FMDF 1F2TB 1NBME 4IDNA 1LABA 4BA1I 3MXNB 4DV4Q 3S15H 1COWA 2UXBQ 1FPMA 3KQHA 2R92G 1GUGA 2IY5B 3Q5EA 3AVXA 4B2LA 5FBRB 2OXRA 4EPRA 4QM6A 4C3JH 1I2DA 2DBYA 3SGIA 2ZJ5A 3MXUA 4RZ3A 1NF3A 3CZPA 2XTNA 3L7ZC 4X64L 1S40A 1ZM7A 1D2EA 2W2XA 3BB4A 3SR0A 1E4VA 4R4OA 3VR2A 5KNCA 2K5HA 1EQRA 3LLMA 2W6JD 1IAQA 4HZUA 5E95A 4YONB 4B33A 1HNXQ 1Y1WG 3VKWA 5EE1A 2E1RA 2D5DA 3REGA 1CULC 2ZM6Q 3DL0A 4JZKA 4B35A 2GBLA 1N36Q 1ASYA 1G291 3NEJA 4QJFA 4TZ6A 1OXSC 1Y14B 2A2ZA 5BYJA 2ORVA 4QIWE 2NZ8A 1RRGA 1AE3A 1JBKA 1JXMA 1NIJA 2YOHA 4M53A 3RWMB 3TSZA 4DV1L 4BLQA 2OFXA 4MDEA 3CX6A 1O78A 2ODNA 4A0FA 3M9BA 3E2IA 3NELA 2XJ4A 5BR8L 1HURA 2ZVPX 1EFCA 1VKJA 2W6IA 3KUCA 3EPLA 1KC8C 3SS8A 2OEPA 2AK3A 5FOUA 1OIWA 2IHBA 1JR3D 4GI7A 4KYIB 1U0JA 2KJQA 4Q18A 4A3MH 1CKNA 1P2VA 4LC0A 3VAAA 2CCKA 5FOVA 2VRWA 4A15A 2WV9A 2CCJA 2FE4A 3W6NA 4EUNA 4POFA 1K3RA 3BBPA 3PFIA 2O0JA 3I32A 4JLPA 1XDBA 3C5CA 1KAWA 1BIFA 1D9ZA 5FJ8G 2KBFA 1QHHB 4HUQA 1SHKA 3F1ZA 3B1WA 3HJNA 3AKCA 4NCNA 3M0EA 3OFND 4YQFA 4MYUA 4ZI3A 3A1TA 2WICA 4KITB 3VNVA 1BBUA 1Z0DA 4QGGA 2XSZA 4D6PA 5IP7H 4FIDA 1D2NA 1X3GA 1MO6A 5K8IA 3DXJC 4M2LA 3A1SA 4N3NA 3I4OA 3KQUA 1IYJB 5C3EG 3C4JA 2JIZA 2Z83A 3RSLA 4A0RA 1P62B 4A8JB 1KXLA 1GUOA 1VQ7A 1GSIA 2HLDD 1VG8A 3DZDA 1TF2A 4KMUC 2HUPA 3KDSE 3C15C 4V03A 3X2SA 2B3GA 1VQ6A 4JI0Q 2Q2TA 1IY1A 1FQJA 4HDQB 1R8SA 4POGA 2QAGB 3U3RA 4II7A 3HPRA 3ZQ6A 3CXCA 2IXFA 4D4MA 3RZDH 1X54A 3CNLA 3I3SR 4BZQA 5JSZB 3HOZH 2QTFA 1E1RD 2ZPTX 4EX5A 4JYAQ 3GLHA 3NHBA 1QVFA 1CJVC 1E32A 1P4SA 3U60B 2BC9A 5JJLA 1E9BA 4IO9A 2FZLA 2FWRA 1V9PA 3P4YA 3QENA 3ER0A 2KE5A 2ERXA 1G9XA 4AWXA 2BBWA 1VQBA 4AURA 1UKEA 4JL6A 1RFLA 4FXPA 2EFEB 3KL4A 2O8BA 4W7SA 1GOTA 2ZJOA 1QDEA 5M3FH 3N5CA 4HAUA 4NHOA 4EKDA 2ZT9C 1N9WA 4HR7B 2XNDD 4B3SL 4PZ6A 2Q9CA 1CXZA 4Q7LA 3UMFA 2V55B 2N8NA 3K9LA 3OIUA 4S35A 4TTQA 3H3VI 4B3BA 2L15A 3I5YA 4AYBE 2P6NA 1ZRHA 3WNCA 2IT1A 3WMFA 4ARZA 1XD2A 1FZQA 4EPTA 3PF5A 3CRLC 4URWR 4LNQA 2TMKA 4MGZR 3FKSA 3T35A 3RS3A 4JI3L 3EIEA 5KOYA 3THYA 1SMXA 4GOPB 4BFZA 5JZVA 4TL9A 3HU2A 3UANA 2BA0A 4OWXB 3RVBA 1Q1EA 1H8HA 2ALYB 1AS2A 1NY4A 2PI2A 4GN3B 3ZVMA 5JEDA 4IQZA 1WI5A 2R6AA 5LMNW 4CYMA 1J99A 3A5UA 1YJ5A 4DUYQ 2IS2A 5J3BA 4A3MG 5KHOC 1SVIA 2G77B 3U7GA 3ZS9A 1R4AA 1I5FA 2J59A 3PUWA 1CJTC 1EGAA 1NL3A 4JI4Q 1ZUHA 1ZUNB 1D5CA 5KSYA 3EBEA 3FMIA 4A3DH 3G48A 4AIMA 2A78A 1YZKA 3U50C 1P6XA 2RMKA 4M9XA 4GPTA 1RPZA 3PVSA 4OQMA 2AXNA 2Z4RA 1N33Q 1GWNA 2IWRA 4MZ9A 3ZLJA 4QJ5A 3I56A 2IUUA 1L7VC 4OK3A 1KOFA 2ZREA 1NP6A 2X2EA 2HV8A 5CYPA 3U4QB 4DR3Q 1XJQA 3MWKA 5HE9A 5KNDA 5C0XI 5IYDH 4A2QA 4GDFA 4AC9A 2VBCA 1XPOA 3BAFA 3HYTA 3K7AH 4MA4A 3GTPH 3K7UC 2EVBA 3CPJB 1Z6HA 4B3RQ 3WYFA 4DJTA 1GKHA 1K8OA 2NG1A 4RJLA 3LD9A 3CRRA 4DK6C 3W3ZB 4PZLA 4OL0A 4QGHA 1ZD9A 3B6YA 3WMGA 2VF8A 1XTJA 3F2BA 3B5JA 3CPEA 1VS0A 4EJSC 4HB2A 3DOEA 3BXZA 4Q1FA 2ZJRA 2GESA 3RSOA 3T1VA 2ODBA 1G21E 3KZ1E 1RYHA 1Y1VH 1JPNA 2K5NA 1C7YA 4XVUA 2JXMB 1ZD1A 1T9HA 2BEKA 2UXDQ 2HXSA 2UVQA 3TLXA 4TZ0A 2ZVQX 2J46A 3W90A 1GRNA 4I7ZC 4J0QA 1MR3F 2QENA 1GNRA 1PH4A 2GCOA 3KJHA 3QEOA 2D06A 5M3FG 1Z6XA 4M9QA 3IBYA 1YIJA 3U7HB 3MD0A 2ZUDA 4ESHA 3M85A 4U7DA 4Q9LA 3VFDA 2JJ1A 5GROA 1XMOQ 3SC3A 4EPVA 5CITA 5KSOA 1OIVA 1YHNA 2HHHQ 4WW0A 3LNCA 1ESMA 2JASA 4CZ2A 3T1TA 3LW7A 3QNUA 4BLSA 4DR5L 3IO5A 3K70B 4IOLA 3I5XA 2X8AA 4YMUA 2QBYA 4TL8A 3MAAC 4AYXA 4CEHB 3PGZA 4LYFA 4LCBA 3CCEA 2AKWB 3SOPA 1C1YA 2K32A 1FOEB 3RLOA 4R2IA 3TUIC 3L0IB 4DV3Q 1PYBA 3CH4B 1E1QA 4A3IH 3AVYA 1S2MA 2CFMA 1TQ2A 4V0NA 4W5HA 4DR1L 3AEVA 3NWJA 1FGUA 1W36B 1S0UA 3ONWA 4XWOA 3AB9A 3K0XA 4A3DG 4E07A 2GILA 5AK0A 1VQIA 1AGPA 4FMCB 4WJ4A 3AVTA 3LDAA 1KHTA 4FINA 4QNMA 4KN4C 4MNOA 2IHYA 2WKPA 4KJZA 3S24A 1PVOA 1DTSA 1GFIA 4RVCA 1XMSA 3BK7A 2FSIA 4DR7L 4B73A 2EFCB 1G20E 2C04A 1WQ1R 4LF5L 3U6BA 1DAHA 1HE8B 1S3GA 5IYDG 2JGNA 3BC1A 4A82A 1H9RA 4BY1H 1SFOH 3FHTA 2ZI3A 5FOWA 2O8FB 4R71A 1VF5C 4TMKA 1N32Q 3ETLA 2E8GA 2CL0X 3T5DA 4C0AC 1XB2A 5SZIA 3C16C 1VQKA 1B70B 2DGYA 4Y52H 1MJEA 5IP9H 1ZM2A 4BFTA 4QBGB 3K0EA 3B2EA 2VSXA 1A2BA 3TQYA 1R0WA 1O7LA 3IHWA 1HNXL 1HR0W 5FL7A 1S8FA 2ZM6L 4WZBE 1G64A 2GNOA 4F7WA 5KYKA 1OSNA 1CR4A 4LFAL 3D8BA 4MRNA 1N36L 2DPXA 5DN6A 1G5RA 1YHBA 3VA7A 3L0SA 3A0JA 1EQQA 3J80c 3QOFA 1CTMA 4R2HA 4M1SA 8OHMA 4AG5A 1Y1VG 1ZNYA 2QRNA 1DVRA 4UPAA 4Y0AA 1QZGA 3FHOA 5TXGA 5DI9A 4JYBA 1XRJA 3NVAA 4ZDKA 2B29A 2IEYA 3KXLA 4BBSH 5L3VA 3ZD7A 5BN4A 1HCZA 1I94Q 1XD9A 1XJ0A 5C0XJ 2CLSA 4YHHQ 3K1JA 4KO8A 3FB4A 4CIDA 2IUSA 3PG5A 4PHTA 4A3FH 1B9MA 4LJ8A 3SFVA 3PO2H 2MSDB 1JPJA 1N0WA 3LXXA 3FMOB 2BEJA 5FLXc 2DFLA 2DWOA 1DXMA 4C3IH 1BYIA 3PUXA 1PUJA 4GNKA 3AQQA 5FTLA 4L5RC 4XSGA 1FW6A 5KSPA 4Q48A 2GVDC 3ULLA 3FVQA 2ZRAA 5G3ZA 3PEWA 2H5XA 3SDZA 3DM5A 3HPQA 3IQWA 2HYIC 1Z0JA 4Q66C 1RRFA 2WJIA 2Q3FA 4K0KL 1IXZA 2XITA 3QF4B 1RKBA 5GVRA 4BZXA 5HPYB 1XJCA 4PANA 1P2SA 5DI3A 2QT1A 2CWAA 1AZTA 3E5HA 4B2IA 4IDQA 2O8EA 4ERNA 3CRKC 3KJPA 3DO6A 5EXXA 2JJ2D 4IVPA 3TS0A 3V00A 2VL7A 2WJJA 4R9UC 4A3LH 1G8YA 3HU3A 4HJ5A 1XXHB 2VQEQ 3T1OA 3ADBA 1Z6YA 2RGDA 1GJXA 3KJOA 3EA0A 3SQWA 1W48A 4BA2I 2ZRFA 4JL8A 2Q9AA 4LY6A 1NY5A 2IYVA 3VU9B 4HB3A 1Y3AA 4JMPA 3W8NA 2QAGC 3OESA 2MQHA 1ZIPA 4M8NE 1WDTA 1JB7A 2AL7A 2FH5B 2K5VA 3SZRA 1E2WA 2IYTA 4AY2A 1P73A 1FQKA 3MWLA 2GZHA 4H9GA 4M1KA 5KPJA 3PUVA 1I6HH 1RVDA 4D0NA 3V9PA 4AQYQ 1K0RA 2G88A 1MABA 2VTKA 2IX0A 4BY1G 1X56A 1C9KA 2QMOA 1WE2A 2GEDA 2QSZA 3QXXA 4HAYA 4ZKDA 4TLBA 1HV8A 1FR3A 3GTJH 3HOWH 4JLMA 1XMQQ 1OB2A 4A3EG 2C9YA 1OH7A 3HKZG 4Q4HA 1ZINA 3SYNA 5IHPA 5IP9G 1JNYA 2GJKA 2QGNA 5DGXA 4NXNL 1N5KA 1KY2A 2FPLA 2B8WA 1W7AA 2Y0SE 2ZRBA
chains in the Genus database with same CATH superfamily
1JWSD 2B8FA 1H2WA 4E5SA 4EOGA 2AF3C 5ITVA 3VR0A 1MZVA 1ZJ4A 1Y7IA 3AR4A 2P2CA 4PLGA 1VIYA 2ZR7A 2VYQA 3VZPA 5AESA 1PLFA 4MTCA 3CEHA 1P33A 2ZYWX 2QLMA 1Y3DE 1JPUA 4N3CA 4HS9A 3RVDA 1ZSYA 4KQFA 2IIQA 1XG5A 3TTVA 1HF3A 2VH5R 2DKOA 2Q8TA 4MLZA 1HUNA 3R2JA 3T5BA 4UD6A 2K6GA 3IUSA 4O3MA 2QG4A 3EIHA 4E70A 3C6ZA 2V54A 4A3LG 2OE2A 5FNZA 3STTA 2B8JA 3QH4A 2D7CA 2L11A 1WDWB 3TJMA 1NI4A 3KLSX 4UDUC 4QT0A 3R7NA 2MR5A 4O4JA 3M4OB 4Z8YA 3FVTA 4RHYA 4TTTS 3NASA 1L4FA 1XRRA 4XWKA 1WCYA 1RBMA 1QYIA 3P71T 4ZOLB 4X64B 4POOA 3JD3A 3L4EA 1WD0A 2ORED 1RRMA 4IHJB 3MXOA 4LVCA 3ZHOA 4GBJA 3TUZC 3KTOA 1GL9B 3VPXA 1LLUA 2ZWAA 3PUYA 4H0NA 5K0EA 1CT1D 3D4OA 4S0XA 5CYOA 3OD1A 1P6QA 4JT8A 4RWEA 3H13A 4GX0A 1L9XA 3FCXA 3AUKA 4FZ5A 1DWUA 1DG1G 3BIWA 3PA8A 2R1VB 1PGOA 4CMJA 2ZIXA 2R00A 3UO8B 4GKAA 1K0FA 4RSRA 2VATA 3OTOQ 2IP1A 1UDXA 4AKSA 5CXXA 4BUJA 4E13A 1I36A 4BNMA 1AUVA 3KOJA 3UKDA 2XKKA 2BKXA 3NEPX 4NE2A 2PKCA 3SQLA 2GSWA 4D80A 3H1EA 1THMA 2JFFA 5KQRA 1NMZA 2D8MA 4WJWA 1Y48E 4G0YA 5C7IO 2HK8A 3FMVA 2Z57A 3A58B 1IW7D 3C2QA 2VJCA 2I33A 2XGGA 4OHWA 5EE3A 2JHAA 4URVR 2F0UA 1SXJE 1KGSA 4IJUA 4NNPA 3L1VA 1P16A 1DBIA 1J0CA 4ZI7F 1PZJD 1I6HB 2ISQA 4OI1A 3UDIA 1L4NA 3CQZB 5ALTA 1N5RA 2NZ1D 3BWDD 3O8DA 1ZD3A 1T2AA 3QVUA 2XZPA 3MC0B 1K3UB 2X1LA 3NHAA 4NU8X 1WU7A 3GRKA 1BVRA 1RWQA 3U4VA 4TN5A 1PFKA 1DAEA 3DD5A 4HAVA 1VPDA 1V16B 3E5RA 4JLKA 1HQYE 1OXVA 2XCQA 4BZZA 3U56A 3KUPA 1Y3IA 5IG2A 4NAVA 1M0WA 1M6YA 2YWGA 4PZUA 4TYNA 3LP6A 1U2RA 3D8HA 3MC1A 4F6RA 3AOEC 5BNTA 3RC9A 4ETNA 3TP8A 1BFUA 1SA0B 1Z4IA 5EXSA 3IQEA 1PEDA 2NVOA 1S5DD 3WDSA 2FCRA 5BT9A 4A6EA 5EE5B 1LDGA 5JJIA 1D2BA 3EGCA 4XQJA 4TMFA 2B1QA 2NZOA 2VHQA 3AC0A 1IHXA 2RCFA 4WFIA 1EYZA 1S96A 2KUMA 4TKVA 2FEPA 5CTAA 4I4TB 5LQUA 4GPIB 2GF9A 2Q2HA 1B0ZA 5EP1A 4NONA 1HNXB 1DEKA 3RV3A 4BOYA 1B8PA 1YI0A 1JJVA 3ZHQA 3GP5A 1IE3A 1WA5A 2BUAA 1TZBA 2L2QA 3A04A 3T3HA 2NSDA 1BVSA 1K8RA 4A0HA 2HHLA 3PDIB 4MB2A 1E0SA 1H0HA 2J8ZA 1ORVA 1OU4A 1QQ7A 2JH8A 4GNRA 4ZRMA 1W4ZA 2VPIA 2ZIZA 3EPHA 1H0RA 4QDUA 4J9VA 3RO7A 1N5LA 2IDMA 2BFFB 3IP5A 1PU2A 1RYZA 3ZLTA 3ZDCA 4A75A 3HL4A 3OA0A 2WQ6A 1H22A 2VK8A 3KVYA 4WDQA 5MFZA 5DXFA 3TDMA 1J9GA 2PUEA 1NU8A 4PZ9A 2EYUA 1C4OA 5BN3A 1PWZA 2YZ7A 4TYQA 4RDCA 4HRXA 1PR3A 3C6KA 2FQQA 5BP7A 4Y9TA 3JQGB 1MAHA 5FOBB 4DJAA 2UUAL 3ROKA 3MLAA 1TYZA 1KH1A 3VR5D 2AZTA 2CJWB 1C9YA 3TXYA 3EYWA 4Y6SA 4C03A 4I5FA 1B8AA 4XVQA 3WOVA 1PCXA 4JI4B 1C3OA 4IFEA 2IP4A 2WKQA 2E49A 4Q82A 1U7OA 2G36A 3ANTA 1FX0A 4DR3B 1N57A 3T9DA 1PEKE 3HOXB 4TV8B 3DBIA 5CA1F 4DRXA 1V3TA 3S2FA 4X6XA 3HO1A 1X3EA 4ME3A 2F2TA 3B9BA 2BR5A 3ZWMA 5LWQA 3IESA 1QWOA 4LISA 2C8KA 5LP6B 1Z5UA 3O93A 1MV5A 4M1YA 1PK8A 2PPBC 2F03A 3BH7A 3GXOA 4AJHA 1TJYA 3EAGA 1HE5A 1QKJA 4P82A 2A5DA 1L5WA 5GONF 1YZVA 1G2OA 4GECA 2AN5A 4FPXA 1CS4C 2H4ZA 2I4OA 4FFPA 3L1UA 4PSCA 4MR9B 1TS2A 1KMHA 3JQ8A 4X84A 4TLDA 4ARCA 4LPKA 1NMXA 4PIPA 1PQ4A 5BV1A 1IIRA 1SUCA 1UEBA 1DRKA 5DXJA 2Z2ZA 2GASA 3BSWA 2A5GA 2F0WA 2IHJA 2BE5D 3CRZA 3OZRA 2RHQB 1A2OA 1U80A 3NBAA 3R6GA 4I1SA 3RN2A 4CJXA 4L08A 3ENNA 5CDSA 3F2CA 2ZRJA 3W5DA 3MEHA 1CFZA 1GLGA 1JCKB 4J8QA 2V03A 3E70C 2UUOA 1SCUB 1VI2A 5DBHX 1UZMA 4B6EA 1KZ9A 1W8IA 3H0GB 3QB3A 5HE8A 1J9OA 1XPUA 1JHPA 4CVNA 3U16A 4P3PA 3JAWB 5I47A 2AMCB 4BNNA 5J1TB 3CCBA 4MP3A 1FP6A 1HKUA 3LGSA 4DC9A 4YRBA 1N33L 5SY4A 4TV9F 1YQEA 1IBKL 3HWRA 1E18A 4ICIA 3H2BA 4BQIA 3GARA 2J4FA 3C1TA 1CR2A 1NF9A 4JYZA 3GCGA 4MKRA 1UE7A 3EVTA 2VDNB 2IY9A 4LF6Q 4G1FA 4OB8A 1E6UA 5EPKA 2D2CC 5FIUA 3BVPA 3TWOA 3GP8A 821PA 2WVGA 1E2PA 1UBJS 5HGJA 5K8CA 2ID7A 1DRVA 1FCJA 4IDOA 4UAUA 5NULA 1YNXA 4MV0A 4GOXA 4DIKA 2BFNA 2C2BA 1G21B 5DTIA 1O87A 3CCMA 4FJ2A 1AHIA 3I2IA 1SG9A 1I2ZA 2VHVA 1UWKA 4FLEA 2C7QA 2QRKA 1NJ2A 4NDZA 3TLGA 4B3SQ 4JENA 4NYMQ 2MDTA 3G6EA 3LBIA 3VKGA 2ECPA 3F5FA 4TVBA 4QG7A 1IW7C 4RE6A 1M6NA 4EHDA 5TMEA 2I6FA 1OV4A 2ABWA 1P1JA 1SG0A 4J8PA 1VJRA 1K4MA 1GR0A 3ZYCA 3URYA 3QU2A 5H1SE 4QFMA 4P4SA 3A70A 3VR4H 1UUPA 3ZLBA 2ZJ7A 1EIZA 2Q0XA 4A36A 3LCUA 3L1KA 1UMDA 4YCAA 1GILA 1XXGA 3QVTA 3HSYA 5TT0A 5FR1A 4D79A 1YHQA 2C5BA 1H23A 2CL7X 1ZQ9A 3BHMA 2YXEA 1R88A 2H4YA 4W5OA 1CRPA 2K7VA 4BN5A 3T0IA 3ZLUA 3LDHA 4HEDA 4B0OA 8ABPA 2YR0A 1M83A 1TA0A 4GI3A 4FYDA 2J0EA 4U7FA 4WEOA 1MX3A 1GGHA 1USGA 3DUFB 5E0OA 2Y66A 5D3MA 4EM6A 2R7AA 4EHIA 1P5ZB 2WYUA 1CQWA 2DNCA 3BRSA 2ZDQA 4P4UA 1PFYA 1SWWA 4BRWA 4QUIA 2OAGA 2NGRA 2R3ZA 1Z6TA 5L7YA 1XXHE 1R10A 3BXHA 2J7KA 1JFSA 2CHUA 3HCFA 1IHZA 2F62A 2QM7A 3VVCA 3DEKA 2GBFA 2HDHA 1Z0IA 4D0RA 1XLVA 2RHMA 3H5WA 4K0KQ 3FOEC 3NDIA 3NP8A 3OIYA 4NDAA 3EXEB 4X24A 4IIEA 3DL4A 3HBAA 2B92A 1YZFA 1E69A 2B4TO 1HSZA 3VH3A 4FJ1A 3QITA 5EA2A 1C8BA 2VDUE 2ZR8A 3N2GB 3HA5A 4D9EA 1EX9A 3TIIA 3EZFA 4NXNQ 3QEKA 1JLMA 4DR6L 1KO7A 1VI6A 3L07A 2O3SA 2Z95A 1V7ZA 2KA7A 1PZGA 1XMXA 3JSAA 2CFSA 2YFKA 4RHRA 4GPBA 1NJ6A 4BAUA 4ZVPA 1XJWA 3STBC 1H5UA 2QSYA 4HNTA 4DSNA 2ZSKA 4KFRA 3JQ9C 1JQ3A 1Q7BA 5ERYA 2HB6A 3UCXA 5LQCA 3Q3EA 3CLTD 4EKYA 4FQ7A 4DG9A 4F4IA 1LRJA 4D9BA 3U9SA 1M34B 3EJWA 4N9WA 3VMFA 1TCVA 4YCCA 2BMDA 1PH2A 1MC8A 4HLDA 2PQAA 1W3SA 2JRCA 3RBZA 4QUEA 3TSOA 2JH3A 2BFEA 1NATA 5EPOA 1AHPA 1U11A 3ORFA 1LK5A 1WDKA 3IQHX 3PWKA 1RAGA 5AJ3L 1JFRA 3R2IA 5KSZA 3UAZA 2EQ5A 2IU4A 1PGQA 5LMCA 3CC8A 3CC4A 1BS9A 3DOFA 4AJ2A 4DDWA 2AG8A 4BFSA 1WW8A 1ODIA 4LRXA 4LY0A 3QFCA 4PXSA 1UWVA 1TKAA 3KXKA 2ZYIA 1HWYA 5AVOA 4N0PA 4YCSA 3P1HA 4FHDA 3DGFC 3I8ZA 4KR2A 4X1KB 4C3OB 1QG4A 1S9HA 5I7AA 2QVZX 1S4QA 1AQLA 1WTCA 2ZSJA 2LVBA 2C99A 4UXHA 2V9CA 2V7WA 4BMNA 2V8OA 3HVIA 4M8SA 4DUPA 2CKZB 2BE5C 3ESDA 1BSVA 2BVNA 3O95A 2I78A 1WEKA 3HA2A 1SCJA 3I9LA 4MOWA 4BNGA 1N34B 4RTOA 1JHRA 3VDYA 3OU7A 2G72A 3E0XA 4G57A 5GZ3A 3TTYA 1T5DX 1O7JA 3W8DA 2C83A 4Q9NA 2D0PA 3DEOA 4TQ9A 2GT1A 4NBKA 5I7UA 3DCIA 3GY0A 2MSCB 4B4OA 3QK7A 1WBBA 3CLUD 3H3VH 1RXEA 3ZK7A 1PWXA 1SOAA 1C7IA 3ERSX 3T53B 1WXXA 4DAPA 3PQEA 4RHUA 3ZUGA 4JI8B 4GKBA 4AF8A 1OXXK 4FVTA 4MIEA 2V7VA 5EESA 4EHNA 3EVDA 4EIWA 4IVQA 1RLMA 3MSXA 4JELA 1G7RA 1WCMH 4G5YA 5CG2A 1WEHA 4GWKA 3JQEA 1D1KA 1ZWLA 2NUAA 1Z63A 4R1JA 5BRNA 3EGVA 4BBRH 4OHOA 1HA3A 1H65A 4DNPA 3VRHA 3SWWA 4L3VA 2WUGA 3AESB 3BIFA 4D9FA 4GN5A 3LKDA 4ZZ1A 1KNAA 3DYVA 5L3SA 3GU3A 2PQ0A 3RUAA 2JE6I 1GO2A 4PHGA 1SPXA 2VJLA 4YRLA 5K6TA 1PWEA 4P81A 4B7XA 5IKPA 5JY6A 3S55A 1P1FA 4NF2A 4YCUA 2MU1A 1HT3A 2IWHA 4CIVA 3OLCX 5TARA 1Y89A 3F7MA 4R8SA 4NV1A 1AY0A 2UUCQ 2YMMA 1EWYA 1Z13A 3C41J 4A2PA 5HKKA 3KF6A 2X42A 4A3IB 4JI6L 1SBQA 4KX3A 2PUDA 4I81A 1W36C 1YL7A 3QNWA 5A4AA 3H1AA 1LBIA 4AJIA 2GA8A 4NENA 5ELCA 3R0IA 1YZNA 1W2WB 1QFSA 2WIFA 1JQYD 1Q7YC 4A91A 5JQGB 4XXHA 2HDLA 3NATA 2OBXA 3B5IA 5FBQB 1EK5A 4K86A 3RIHA 3GRVA 2FFJA 1L4MA 4JIMA 5AW4A 3WFIA 3F3MA 2GVBA 4YI3A 3UW3A 3GGPA 1E4OA 1DHTA 3ECAA 1C7ZA 4OLJA 2VTEA 5H0IA 2Z9CA 3KWJA 2WVAA 4JYMA 4X54A 5JLJA 1CVLA 1W73A 3K2EA 3PXDA 2C7PA 4K40A 2NZJA 2RH4A 3GJYA 3ENZA 2VSOA 3BZDB 3PRJA 4ZK2A 3KUXA 1RWWA 1VLHA 2DJ5A 3F0TA 3JS5A 3V7UA 3QTTA 1EP1B 3TL3A 2DFKB 5KB3A 3FPEA 3HUTA 2HSZA 2JI7A 2Z4SA 1T5HX 3E81A 5EPUA 1CS0B 3SKVA 1Y6GA 4BGDA 2QYSA 2OORC 5HUJA 4K6FA 3PIP3 3IVCA 3PXBA 4IPTA 2Q1YA 2QUKA 1JG6A 5C3EH 3Q7RA 5J2TF 5DIZA 1SXJA 1XZAA 5DYTA 1LABA 3NLLA 2NT3A 4CM9A 1X15A 5HFAA 4FEEA 3W5CA 2ZJ5A 2M6KA 5TQ0B 1KPHA 3KQQA 5KNCA 3U49A 4B33A 5EE1A 3REGA 4N3AA 5EJFA 1ZD2P 1VA4A 1G291 3IDFA 3FIUA 5D6OA 2GYVA 4QLBA 4GICA 4EABA 1WTHA 4DV1L 4A0FA 3BWVA 4O1IA 1IUPA 3HYCA 3H9JA 1KC8C 3JY6A 3H5TA 1WUYA 1U8FO 2O3JA 3S5JA 5IXSA 2W2PA 4X62B 2AI2A 2K7FA 1KAWA 3UMJA 3F1ZA 3RFCA 3PC3A 3RFTA 5SYAA 2P1RA 3DXJC 3IIEA 3KQUA 5C3EG 1A3VA 3NVMB 1P62B 3UUGA 3B3QA 4E5YA 3P2EA 4YT2A 4JQSA 1TF2A 1MH9A 2IOHA 4E08A 2XWJI 1TT7A 2XUIA 4QPCA 2NYZD 1L3BA 1ZJYA 4XQ9A 2W8ZA 2Y92A 1GOTA 3N5CA 3ZLVA 4K5XA 1BWQA 1LX7A 2R4UA 4BRSA 1GPAA 1UXIA 2V7EA 1OLUA 4IINA 5EPEA 1PWHA 2AS0A 2HMSA 3CLTC 3EXHB 3C1AA 3RS3A 3TSAA 1GXSB 2EE1A 2ALYB 5DBIA 1W35A 1XI2A 3QMPA 1YJ5A 4LXUA 5FA5A 2B61A 4EF6A 1I5FA 1HMPA 2M6SA 4BU1A 1CJTC 4KPGA 2HHCA 2YQ4A 1UMKA 3M83A 4YAUA 1GWNA 2IUUA 3C6XA 2HV8A 2J9ZB 4GDFA 2DSTA 1HQRD 1Y1WB 2ZYDA 4B3RQ 1NUSA 3D4IA 1SKBA 3WGMA 1QGZA 4BB9A 1A9XB 5LKAA 1ZD9A 2M2IA 4BHTA 1A9SA 1V7CA 4X65B 3J81L 5EWMB 2CL5A 4P7FA 4Q1FA 2R751 1KBQA 2J07A 4YK7A 3RUIA 2JGRA 2QLFA 2BFPA 1CUYA 2C9DA 1T2EA 2VJQA 3RCBA 3DBLA 4GMGA 3EQ7A 2HHHQ 1L5FA 2CLEB 2LNDA 2QBYA 4IGIA 4Q3LA 3TUIC 2X4GA 3E9EA 3WA6A 4H4CA 2WYVA 1LKZA 1S0UA 2RBKA 4XWOA 4RXTA 2F59A 4QNMA 3BVMA 4LCJA 3IMEA 1EEID 2C04A 3U6BA 3UZUA 2IL8A 4G9GA 1NGSA 3QOLA 2O8FB 4P38A 1N32Q 1Y1RA 3C16C 2DGYA 5FADA 3L6OO 1KDBA 3BYYB 5F1KA 2OFFA 3BYTB 2WWRA 1ZNYA 5TXGA 4OYLA 3EF3A 2B29A 3CLUC 4YHHQ 2VHYA 1JHZA 2KPOA 1E61A 3RYFA 3CG4A 3ELYA 1V7PC 2GUGA 2WHPB 3SDZA 5CV5A 3KNZA 4ARUA 1SNQA 1ZH8A 2XT0A 3OZWA 1RKBA 1DWPA 4EMUA 2W22A 3HU3A 3O7WA 3SC6A 4YTEA 1ZIPA 1WDTA 5GIOE 1FDUA 1FQKA 2IEIA 3AY0A 3LPNA 2VTKA 4HAYA 2QJTA 1YZYA 5DGXA 1EUDA 1VI5A 2W11A 5T1IA 3P75A 2AD5A 1IC6A 4ENPA 4P93A 4W1PA 5DKFA 2BHSA 2C92A 4C6TA 3AO0B 1CR6A 1X7WB 3ETNA 4I65A 4TWZA 3AONB 2FSUA 4OU4A 2CLKB 3DZFA 1Q0HA 4KGZA 2FW8A 3I92A 2TECE 2QDLA 1MNAA 1YRYE 3M3YH 3GTPB 1HNWQ 1J20A 4NICA 1VKHA 2HU2A 1SURA 1FXWA 3EH2A 2PD4A 1XMQB 2LUOA 3U13A 2YJTD 1OA0A 5E4FA 4A73A 3ZZNA 2A9FA 4RPLA 2B36A 1O8BA 1NYQA 1PQPA 5JH7A 4NEGA 3OX3A 4KFTA 3MFYA 2F3VA 2UU9Q 4IJMA 4R51A 5BMVF 5F2NA 1XMOL 4H44C 3NALA 2WABA 1ASZA 5H4HA 1U8YA 3K4PA 1XWFA 2XYQA 3QOWA 4CDFC 3RAFC 2YHIA 4GMFA 3SR3A 5B36A 2BE9A 5JS7A 2JI9A 4L5CA 1I3MA 3RIMA 4TKUA 2G08A 3U4IA 4CMBA 2V7QA 3JVVA 1NFRA 3GAFA 5F12A 2W6CX 1STGA 1WU8A 3OE7A 2BP7A 2Y99A 1YAJA 2FUG1 1E0KA 1P9OA 3RNOA 2B35A 2JAWA 2VNJA 3L84A 1I94L 4YT8A 1Z8DA 2NSJA 1NSTA 5FLEX 3OURA 4PQGA 4EJSB 1CKOA 3C7DB 4YRMA 4C0JA 2BJWA 4DYDA 1TA9A 3EODA 4EJ0A 3DAGA 1EWIA 3V7FA 1EUQA 2CMHA 2A67A 3QVLA 3KJNA 1EWQA 1UZNA 5IJ0A 2ZFUA 4A10A 4BKPA 3E1SA 1Y1PA 5I4BA 3VX3A 3GCDA 2ZSHA 3HCEA 2W4QA 5ALRA 2BBOA 2IEGA 5T6BA 2VJAA 1BU5A 4O08A 4JCVE 1JKJA 1KJZA 3NKVA 3GVXA 4K05A 1JF8A 2YINC 5H3LA 2YIVX 5A0FA 3CVYA 1G2TA 1JVBA 2FW0A 3O3MB 4M22A 1R74A 5KYIA 1L5VA 1L4YA 2JYOA 2JA8B 1WR8A 2M98A 4XI9A 3UMMA 5AOAA 5KX5B 1GGKA