3T1HQ

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16s rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3t1hQ00
4TQUS 3U4VA 5IP9G 4PG3A 4O2DA 1VQEA 4OWXB 4YCUA 2VQEQ 5IYCH 3ER0A 1EQRA 1QUQB 1KHIA 1TXYA 1NJIC 4PZ7A 4KLKA 3PV0A 5JJIA 1VS0A 4BY1H 4YWLA 4KHZA 1X55A 4LFCL 5C4JH 4ALPA 2CKZB 1XMQL 1S72A 1SROA 4POGA 2VNUD 3EBEA 4DR3L 1QUQA 4P74A 4GNXB 4DV0L 1L2FA 4JV5L 1VQAA 3RNUA 1CKNB 2VQEL 4A3IH 2F4VL 3TRZA 4JBKA 2Q2IA 4BBSG 1ASZA 4DV6Q 3CCEA 2NVXH 2YU9H 1FVIA 4LF9Q 1YI2A 4HIOA 5H1SE 2JK8A 2H5XA 1SR3A 3RR5A 4HJ5A 4BBRG 2HHHQ 3LGJA 3ULPA 4A3DG 4BY7H 4AYBG 3K80C 3I56A 4XTCS 4A3LG 1IXRA 2WB1G 1UWVA 3I2ZA 1SRUA 4OO1G 3A5ZB 1HR0W 4WJ3M 1Q12A 3CCLA 2MQHA 2JA7H 1XPUA 1OXTA 4LF9L 1YHAA 3S1QH 4NXNL 2B63H 4DPGA 1PH7A 1KRSA 5ELOA 2HHHL 3PUVA 4JI4Q 4DV4Q 1UEBA 3H0GG 4OX9L 5C44H 5LMUQ 3HOWH 4LUOA 2ZJPA 3U58A 1U0LA 2ALYB 2Z0SA 3M4QA 4LF4Q 1WOCA 2IX0A 3PF4A 3J7A5 1YHQA 4YCWA 4EX5A 1I94Q 3D0FA 2UUCQ 4IJHA 3HOVG 4JYAL 3CPFA 1L1OA 3KDFB 3I55A 3CCQA 5IYDH 1SLJA 5IYCG 4LF7Q 4R4OA 2GVAA 2VS1A 1K8GA 3RLOA 1HNXL 4LW1A 3W1BA 5M5WH 2JA6G 5IWAQ 4JI4L 1JE5A 4BY1G 3CCUA 1EOVA 3AEVA 1QVFA 4LF4L 4DUZQ 2WFWA 3L0OA 1KQSA 5HGQA 1VQIA 4GNXC 4BXXH 3I4NH 2UUCL 3M85A 1T9HA 3PF5A 3J7ZC 3KJOA 2K5NA 4RG1A 4DR7L 4A3IG 2R93H 3AQQA 2OQKA 4JI8L 2Y0SE 3ULJA 4Y7NH 1Y1WH 3ERSX 2VY3A 2ZTCA 3BZCA 1IBKQ 3E9IA 3NEMA 1PH1A 2KHIA 1GD7A 4DUZL 1SE8A 5IP9H 2ASBA 3S15H 3S1NH 4BY7G 1Q1BA 1QZGA 3F2DA 4NXML 3MXNB 5FLXc 1PH3A 1UE5A 1K73C 4B3SL 1B7YB 4DK3C 2Z6KA 4JI2Q 4A3FH 4DR5Q 4A93H 4BA2I 4QIWE 4JG2A 1LUZA 1AE2A 3KFUA 1BBUA 4XIGS 1IBKL 4JOIA 2A19A 1B70B 1I3QH 4X65Q 2RHSB 3GD7A 3J81c 1OTCA 1NMGA 3I4OA 1IBMQ 3MEFA 1JJ2A 4KHPL 3NBHB 3UDFA 5C44G 4DV2Q 1KD1C 4DV7Q 1DGSA 3B6YA 4QY7A 3HOWG 4L5SA 1HNWQ 1AH9A 4A76A 4JI2L 4GN5A 4UPAA 4OXPA 1Q86C 1Z9FA 2R7FA 4BBSH 4IFDG 2I5LX 1PA6A 3CC4A 3PGZA 1VQHA 1PH4A 2N8NA 1PH2A 2HT1A 3TEHB 2QA4A 2CWAA 3K7UC 3CQZH 1Y14B 2AWNA 5GAGC 4A75A 4LF8Q 2UUAQ 3ICEA 4OONA 4X62Q 4OO1I 3RZDH 2YYZA 1TWFH 1VQBA 2GN5A 1IBML 2I0QA 5K36G 4A3LH 1HNWL 3CMEA 3KF6A 2R92H 4BXXG 1YHBA 4JBJA 3PO3H 2VQFQ 4GS3A 4JI0L 2N78A 5LMNW 2R93G 2OQ0A 3NELA 3GDEA 4MNOA 3PIPA 4JI6Q 2EIFA 3CMAA 1Y1WG 1KAWA 4MZ9A 4JI3Q 3TREA 3H0GH 1VQ7A 2E2IH 1OXXK 4P71A 2PI2E 1M1KC 4DR4Q 1E3PA 4JI1Q 1K8AC 4YY3L 3OTOL 2AHOB 2I5HA 3K7AH 4GLVB 3AFQA 4JOIC 5AJ3L 2R7ZH 1VQ5A 2AWOA 3HOVH 2JE6I 4IPHA 2K50A 5GROA 2VQFL 5J3BA 1E24A 1NTGA 1N32L 2UXBQ 2YTXA 4HIKA 4A3FG 4JI6L 3A5UA 4A93G 1PV4A 2CFMA 4TVAB 2JA6H 1X65A 1LM0A 2MNAA 4DKAC 5IYBG 4GOPA 1XPRA 1I6HH 1L0WA 4PZ8A 4IO9A 2R6GA 1VQLA 4R1JA 4JI1L 4GN4B 2K5VA 2OWOA 3CPWA 1TWAH 4QGUA 3UDXA 4A3EH 1PH9A 2CCZA 4IFDJ 2MFIA 2KHJA 1YVCA 2UXBL 1WI5A 1K0RA 2B29A 1QVGA 3PUXA 3CCMA 3RN2A 2IX1A 1JJGA 2D0PA 3UE0A 2JEBI 3SGIA 1E1TA 4OWWB 1J6QA 1NE3A 4C3IH 3E0EA 2XGTA 1A62A 1NY4A 1N9WA 3STBD 4UP7A 1EUJA 3EIVA 1V9PA 3CC7A 1G6PA 1XMOQ 2VL6A 2R92G 2PNHA 3OW2A 1YJ9A 1VQMA 1N8RC 4DV6L 3PO3G 2FXQA 2KCTA 3CCRA 3S16H 3H3VI 3HKZE 3HFZB 5IP7H 4OWTB 2QEXA 3GTKH 3S1MH 1L1OB 3RN5A 1I50H 4L5QA 4IFDI 4AIMA 2IHEA 2L15A 1K83H 4R4IA 3H3VH 1R9TH 3HOYH 3PO2H 4HJ8A 2IT1A 4PMWA 2PI2A 4GOPC 1CUKA 2YV5A 5ELNA 1XMOL 2ZJQA 1AE3A 2R7ZG 1PFSA 2UXDQ 4LF6Q 2E2HH 2WAQG 1OXSC 1Q46A 1VQKA 3J80i 1BKBA 4B3MQ 3WWVA 1YIJA 1YJWA 1EQQA 4DV4L 3FHWA 1BVSA 1X54A 5LMUL 1ASYA 4K0KL 3NENA 2JEAI 1HZAA 2MO1A 3FKIG 3GTOH 3GTLH 1C0AA 2LXJA 1I94L 1HNZQ 2UXDL 1KRTA 4A3EG 1OXUA 4DAYB 3G6EA 1EWIA 4LF7L 4DV3Q 1X6OA 3GTPH 1KC8C 4APVA 4IPCA 3BJUA 1QVCA 4JBWA 5HY6A 5IWAL 2DGYA 2YTVA 1VQCA 3UDIA 3T1YQ 2BA1A 1IZ6A 4A3KH 1EYGA 2PQAA 5C3EH 2JA5H 1G291 3G4SA 1HNZL 5GAHC 1YNXA 4LUVA 5JEAG 1HR0Q 2NVTH 2HIXA 1CSPA 5IY0A 4DV3L 1TWGH 2KBNA 3CP0A 4DNIA 5M5XH 1LTLA 4A3GH 3GTMH 3DM3A 1VQ9A 2ZJRA 5IYBH 5JJLA 5IP7G 1N36Q 1PH6A 2ZM6Q 1IL2A 1L1OC 1IYJB 2A1AA 5M3MG 3HOXH 2JA8G 1M90C 1O7IA 3J80c 2Q2HA 2OTLA 5FLMH 3W5OA 3HOYG 1HR0L 3PO2G 4DR5L 3L7ZC 4DUYQ 4JBMA 3GTQH 1PVOA 1HH2P 2VUMH 1K3RA 1UE6A 4AYBE 2PMZE 3KF6B 1N36L 3U50C 2ZM6L 3ULLA 4X65L 4L5TA 2WB1E 1V43A 4IPDA 4A3MH 2BH8A 4DV2L 1A63A 3RLNA 4DV7L 4C2MH 2IY5B 1X56A 2UUBQ 1MKHA 1VQPA 1KXLA 3S2DH 4DUYL 1VQ4A 2RF4A 3GO5A 4A4IA 4YCVA 1VQ8A 4HJ7A 4LFBQ 2D62A 1NBWA 4RMFA 1X9NA 4B3TQ 5E7NA 2Z6KC 2N3SA 2UUAL 4LF8L 4X62L 1CSQA 1RIPA 4A3BH 1A0IA 3S24A 1D7QA 3GTJH 1X3FA 4UP9A 5GADC 1WYDA 1Z47A 4A3KG 4JI7Q 4GOPB 5C3EG 1E7ZA 2JA5G 2Q2UA 2UU9Q 4DV1Q 5FJ8G 3DLLA 1N34Q 4LFBL 3CC2A 1UE1A 2YTYA 3TQYA 4LWCA 2KENA 3BZKA 1K9MC 1Q7YC 4A3GG 2ZTDA 1GM5A 3KYHC 4JI3L 1VQGA 2JA9A 2NZHA 1PH8A 3HOXG 4DR4L 2XTIA 4JI7L 3FKIH 1XPOA 4J15A 2UU9L 1A8VA 3W1GA 4GKJQ 5FLMG 4DV1L 1XJVA 4X66Q 2NN6G 1XNQQ 1BBWA 4X64Q 1JJCB 1RL2A 1VQJA 2RCNA 2Y0SG 4LFCQ 3U4ZA 4IOAA 4IJLA 4FDBA 3A74A 1JB7A 3CF5A 4DR3Q 3JAMi 2VUMG 2D0OA 4DV0Q 1U5KA 1PYSB 1Q8KA 1YBYA 2JJQA 3S2HH 4JV5Q 1XNRQ 2F4VQ 1OXVA 1C9OA 1WFQA 3KF8B 3OYYA 4A3MG 1IBLQ 1X3GA 1EIYB 3HOZH 4QQBX 2BA0A 3RZOH 4GKJL 2MO0A 4X66L 1XNQL 5DLQE 1VQ6A 1WJJA 1YEZA 1FL0A 4X64L 1VCIA 4LNQA 3IRBA 3ZJYC 4X6AH 2DUDA 1TWCH 5LMNQ 4GKKQ 2NVQH 4LF5Q 4GLAC 3HOUH 2OCEA 5C0XI 5C4XH 1FGUA 1YJNA 1JMCA 1XNRL 2R7DA 5M3MH 3JC66 2JA8H 2E5LQ 3BU2A 3K81C 5IE8A 1IBLL 4A3BG 4YWMA 4YHHQ 2KCMA 2E8GA 2CQOA 2EXDA 1SN8A 3TS0A 4L5RC 4O0AA 4NXNQ 1VQDA 4GNXA 3S14H 3M4OH 4NB3A 5M3FH 1CKNA 5LMNL 3CW2C 4GKKL 1Q1EA 2K14A 4MTNA 3F2BA 4POFA 4LF5L 4JCVE 4OX9Q 3RLFA 4H02A 4DV5Q 3CCVA 1G51A 4DK6C 3VDYA 4DR1Q 4JYAQ 3HKSA 2VW9A 2E5LL 3TS2A 2GVBA 4YHHL 4DR2Q 2ZTEA 3JAMc 3FP9A 4P73A 2C35B 1HNXQ 3CCJA 1HZ9A 1KIXA 1HZBA 1VQOA 2CWPA 3L2PA 4A3JH 2PQAB 4R4QA 3PUZA 4LF6L 2V1CC 4DV5L 1C7YA 1PYBA 4B3ML 2WP8J 2HQLA 3AYHB 4DR1L 1X3EA 1GKHA 3I4MH 2K75A 4GLXA 2AKWB 2NVYH 3F1ZA 3J81i 4R4TA 3PUWA 4LUZA 3KJPA 1YZ6A 3G48A 4DR2L 4DR7Q 1JT8A 4JI8Q 1LYLA 2JQOA 3S1RH 1YITA 4HJ9A 3HOZG 2K52A 3PIOA 5FJ8H 1VQFA 4KI0A 1GVPA 2F3IA 3G71A 4WJ4A 4A3CH 1H95A 3KDFA 4BA1I 2ATWA 1E1OA 1EFWA 2N49A 4GN3B 1PH5A 4NXMQ 3HOUG 1WCMH 1Q82C 5C4XG 4B3SQ 4HJAA 2NN6I 4UY8C 1B8AA 4K0KQ 5JJKA 3F8TA 3T1YL 2K4KA 4IOCA 1EIFA 2LSSA 1S3OA 1FJGQ 1P8LA 1Y1VH 5BR8Q 3CXCA 1SMXA 2ID0A 5C0XG 1HZCA 1TWHH 4DAMA 1W3SA 2BH2A 3M7NA 5M3FG 5IT9c 1SFOH 1D8LA 1GO3E 3I7FA 4KHPQ 4C3JH 3UDGA 3S17H 4Y52H 1HJPA 4HIMA 3M4PA 4DR6Q 3PSIA 2EQSA 4PZ6A 2A8VA 2IHFA 1MIUA 2F52A 1E22A 1FJGL 3K8AA 2RHQB 1J5EQ 2JA7G 5BR8L 1P16A 5GAEC 4QJFA 4B3RQ 2B3GA 2HIVA 2B63G 2I5MX 2Q2TA 3T1HQ 3HKZG 3J81j 3GTGH 4A3JG 3M9BA 1PHJA 1MJEA 3Q8DA 3KOJA 3K0XA 3CAMA 4AH6A 4DR6L 1QZHA 4IPGA 4AQYQ 3CCSA 1XMQQ 1N33Q 3EN2A 3I4MG 1J5EL 2OTJA 1NMFA 4JC0A 4UP8A 4JI0Q 1CKMA 3PCOB 2QGQA 3D31A 5IYDG 1W2BA 1Q81C 2UXCQ 4B3RL 1S40A 4LFAQ 4P75A 1XTDA 2WAQE 5JEAJ 2E2JH 4BBRH 2UUBL 4A3DH 3T1HL 2AMCB 3PUYA 1UE7A 1MJCA 4JI5Q 1VQNA 4QL5A 3F2CA 4A3CG 4EQ5A 4YY3Q 5GQOA 3OTOQ 2LXKA 3KLWA 3H15A 4NPSA 3STBC 4AQYL 4B3TL 4YWKA 1N33L 5AJ3Q 3I4NG 3M3YH 3AFPA 3E9HA 4C3HH 1WCMG 3A0JA 1N32Q 2UXCL 5C0XJ 4P72A 2ES2A 4LFAL 3CD6A 2NZOA 2VZAA 1CKOA 1V1QA 1Y1VG 4ME3A 2K5HA 4HIDA 4JI5L 1KL9A 3UE1A 1N34L 4R4CA 5EAYA 5M5YH 1I5FA
chains in the Genus database with same CATH superfamily
2WB1B 4YCUA 2PW7A 3R8BA 3ER0A 1EQRA 1KHIA 1TXYA 4PZ7A 2BE5C 2NYZD 4TSSA 2LKVA 3NQIA 1X55A 2BCOA 4KHZA 1XMQL 2CKZB 4JVZA 1BCPF 1SROA 4POGA 1IYVA 1A3UA 3EBEA 2EZVA 4GNXB 1CFMA 4P74A 1VQAA 2VQEL 2JA6B 4K2LA 2NVXH 2VB3X 2H5XA 4RWSC 3MA2B 4FO2A 3T13A 2HHHQ 3ULPA 4FXKC 2QW7A 2SDFA 3I56A 1IXRA 1B9MA 1K8MA 2CVRA 3I2ZA 2ZXPA 2J4XA 2CHBD 1HRJA 1Q12A 4JPBW 2MQHA 1XPUA 1OXTA 2YU9B 2HDMA 1BUVT 3O13A 4LF9L 1YHAA 4KKTA 4HTHA 3M7GA 4DV4Q 3H0GG 3HOWH 5LMUQ 4LUOA 3M4QA 2NB0A 1WOCA 4MTKA 1ILPA 3PF4A 1YHQA 1JOOA 4YCWA 4IFDH 3HOVG 3KDFB 3KBGA 4IN3A 3IFDA 3TMEA 3TSSA 1H9SA 5M5WH 4KHVA 1I50B 5CR3A 1G8ZD 4K14A 3VR4A 5C44B 1JR0D 3CCUA 3OIQA 4LF4L 2Z8LA 2WKCA 4BXXH 3I4NH 1EWCA 3KJOA 2K5NA 3AQQA 4JI8L 5IGCA 4Y7NH 1Y1WH 2KEDA 4UAIA 3A7LA 1IBKQ 1LTID 1PH1A 3SR1A 3S15H 5BN4A 2RDHA 3F2DA 1ICFB 4A3FH 2F0FA 4QIWE 1LUZA 3A8JE 2X69A 1BBUA 4JOIA 2A19A 2H4OA 3GD7A 1OTCA 1EY4A 1NMGA 3D4RA 3I4OA 1STYA 5C3EB 2Z9HA 3MEFA 1IBMQ 3HOWG 1KD1C 4OIKA 3X3MA 4L5SA 1SYGA 4JI2L 4GN5A 4OXPA 4IUPA 5E4WC 4BBSH 2I5LX 4IFDG 1GUTA 5E4XA 2N8NA 1JB3A 3I3CA 3K7UC 1I3QB 3HOXB 1Y14B 4A75A 3SEBA 4LF8Q 3ICEA 2MJ8A 3TP8A 4OONA 4OO1I 1YNNC 3RZDH 1VQBA 2I0QA 2GN5A 5K36G 2XVSA 5EPKA 2KCCA 1HNWL 2WIIB 1F2ZA 4BXXG 3I90A 2G9HD 1KDCA 2SNSA 4JI6Q 3DEOA 2EIFA 1SYDA 1Y1WG 3VYTA 1STAA 1STHA 2E2IH 4P71A 2PI2E 4DR4Q 1KNAA 1JWUD 4JI1Q 1BQQT 2R92B 5AJ3L 2R7ZH 2K50A 2VQFL 5J3BA 1N32L 4HIKA 3D3RA 4A3FG 3KBXA 2MNAA 1I6HH 4PZ8A 5IGFA 4OIJA 1TWAH 4A3EH 1BCPB 4RAUC 5CMDA 1EY0A 1K3BC 1QVGA 1AW7A 5JVG3 2IX1A 4X3KA 2IW3A 1DXMA 3QR8A 1A3VA 5JOBA 1LACA 4KY5A 4K5WA 2B2TA 3EIVA 1V9PA 3WOEA 2VL6A 1SE3A 1VQMA 2VXWA 2FXQA 4OGQC 3H3VI 3HFZB 3PQIA 1HFGA 2QEXA 4DNTB 1K0SA 3OMCA 4L5QA 1ET6A 2IHEA 1PDQA 1K83H 4R4IA 5FLXL 2IT1A 5DNFA 2N88A 5ELNA 1PRTF 2RVLA 2XWBB 2R7ZG 1PFSA 2NVQB 1X3QA 3N52A 2KQ3A 4LF6Q 3S16B 1VQKA 1QWYA 1Q90A 1BKBA 1EY8A 1B4OA 5M3MB 1YIJA 4L63B 3P1HA 4F8MA 1YJWA 1EQQA 2KA7A 3FEWX 3FHWA 2EYOA 1A15A 3S14B 3NENA 2JEAI 5K5PA 3FKIG 4NDXA 3A54A 1HNZQ 4A3EG 4CHTB 1X6OA 3F2UA 1KC8C 4APVA 3MFYA 3BJUA 1QVCA 5HY6A 2DGYA 1VQCA 3UDIA 2PZUA 3T1YQ 1JE4A 1XWEA 2D5DA 4LUVA 5JEAG 2I07B 4DV3L 1LT4D 1DOMA 1U9RA 5IYBH 3K57A 1N36Q 1PH6A 3ITPA 3QOLA 1L1OC 1IYJB 2A1AA 2PZTA 1WTOA 2DNCA 3T56B 3S1RB 1O7IA 4NP5A 2OTLA 3W5OA 2PQEA 1SNPA 2JYOA 3D6WA 4DR5L 3HGBA 4AYBE 3ULLA 4X65L 4L5TA 1V43A 1R4PB 1S5DD 5LHY1 4C2MH 2Y0SB 2B2VA 5IT9E 2UUBQ 1MKHA 1VQPA 2EDGA 3S2DH 2RF4A 5FLXE 4YCVA 2NBFA 4LFBQ 3QB3A 3NWSA 1EYCA 3BDCA 2EY5A 4DU9A 5KGUA 4RMFA 4X62L 1JC7A 4A3BH 5G3LD 1Z47A 4S3SA 4GOPB 1E7ZA 3DXJC 3MXGA 5CYUA 2Q2UA 2UU9Q 1DZ1A 1V1PA 2O4XA 5FJ8G 3SE0A 3CC2A 3KLSX 4LWCA 2H1EA 2ZTDA 3X3NA 1L0YB 1GM5A 1FR3A 2XTIA 1XPOA 1I4GA 4G7ZC 1A8VA 5J1ZA 3U9OA 4FYDA 4QF4A 1RL2A 1VQJA 2OF1A 2LS01 3A55A 4IJLA 1QNUA 3KK7A 4XQJA 2D0OA 1PYSB 4G57A 1YBYA 1XNRQ 1C9OA 2MUYA 1IKMA 2F0VA 3VYRA 1F9QA 4KTAA 3PIO3 4GKJL 4EQPA 2MO0A 4X66L 1F2MA 1YEZA 4X64L 1A6XA 1D1IA 3OSOA 4X6AH 1TWCH 4U68A 1NNXA 3S2HB 2DY8A 5C3XA 3JC66 1G91A 4GZYC 1TR5A 3HOZB 4A3BG 3RZOB 2KCMA 2CQOA 1SN8A 1LABA 4GNXA 3LX0A 1EZ6A 4J1MA 2FJ2A 2Q8RE 4GKKL 3F2BA 4POFA 5DAUA 3RLFA 4H02A 3VYSA 1B44D 1CHPD 4DK6C 2VW9A 3TS2A 5ELEA 1TQOA 2NVXB 4DK1A 2FMCA 2C35B 3CCJA 1HZ9A 1SXTA 5M3FB 4JW0A 2DJGC 4DV5L 2FMMA 4UHVA 1PYBA 2WP8J 3IFTA 4DR1L 1GKHA 1PTOD 4KMUC 3H91A 4FXGC 1KAAA 2IPKD 2AKWB 4I7ZC 1YZ6A 4DF7A 3KJPA 1JT8A 4JI8Q 1LYLA 2JQOA 1Y8OB 3T51B 2RSNA 5KNCA 3QO2A 4A3JB 3G71A 4WJ4A 3KDFA 4BA1I 5JJZA 2RKSA 2N49A 2K5QA 1Q82C 1PYWD 2K05A 2NVYB 1B8AA 1EQTA 3F8TA 4IOCA 1WTXA 1IHZA 2LSSA 5M5WB 1P8LA 1ZKOA 2ZXOA 1U4RA 1AP0A 3Q23A 1Q3LA 2AQ1B 3I4NB 2F0UA 2F4IA 2EQSA 1RJTA 1ICWA 1MIUA 2F52A 1Y1WB 1E22A 4QB4A 3K8AA 5I6WA 3L9AX 4Y7NB 1FJGL 2PO4A 1LTTD 4K8JA 3QG1A 1EEID 1PHJA 3Q8DA 3KOJA 3CAMA 4AH6A 4DR6L 1QZHA 3TZUA 1F2YA 4UP8A 1XTCD 1CKMA 2QGQA 4B3RL 5KYIA 2WAQE 3J80E 1MSHA 4A3DH 1FNWA 3PUYA 1UE7A 3E3XA 4HMIA 3KUPA 4NPSA 4AQYL 2LMCB 4K6DA 2IX3A 3AFPA 4C3HH 5AJ3Q 4BBSB 3BG3A 1WD1A 3ND9A 2PCFB 1N32Q 5C0XJ 4IQZA 2ES2A 1E2VA 5EKLA 2DY7A 4ME3A 4HIDA 2PMZB 5I6YA 2HCIA 1N34L 1EY7A 4R4CA 2R61A 3U4VA 1ZXTA 4O2DA 1RODA 2F0QA 1F77A 3MWYW 1RKNA 1QUQB 4UDUC 3MEHA 5IOCA 4OL7A 2E2IB 1ZYRD 4OELB 1UEAB 2VNUD 2NTSA 4DR3L 3OHXC 4JV5L 3RNUA 1CKNB 3R3OA 5BN5A 4JBKA 2EY6A 2Q2IA 3TRZA 4X3UA 1HA6A 4LAAA 4BY1B 2JK8A 4J8QA 1CA6A 1I6HB 1TY0A 4HJ5A 4A3DG 4CGYB 1O7YA 4AYBG 2EPBA 1TWAB 4A3LG 1LTAD 4A3IB 5NUCA 4NKLA 1HR0W 3CCLA 4C3HG 1C48A 2K7VA 2JA7H 1ENAA 2K1BA 5D3DA 3CKIB 4BY7B 4ZQ3A 2L12A 5CV5A 2MGSA 4XXEA 1HA5A 4TRDA 4JYAL 4IJHA 3CPFA 3OW7A 3NPPA 5IYDH 1SLJA 3S1QB 2F03A 1HNXL 4LW1A 3J81L 4JI4L 5D14A 3AEVA 2CH4W 2HCCA 3L0OA 4ZYSA 4RGMA 4DNRB 1B3AA 2G9DA 2UUCL 1T9HA 3PF5A 1SNDA 4RG1A 4K5VA 1JWSD 2ZTCA 4NW2A 3JAME 5KEEA 4HAEA 4DUZL 1SE8A 3IL8A 4RCOA 4C3IG 2ASBA 4M8AA 2D9UA 3FDTA 1QZGA 4WRDA 2KJXA 4NXML 3MXNB 5FLXc 3DUZA 4DK3C 5HGTA 2R93B 2L11A 4DR5Q 1NUCA 4RH6A 4BA2I 4JG2A 4IUUA 1X3PA 1F9RA 1AE2A 1M4VA 3KFUA 2A69D 1TU2B 4X65Q 3DWPA 3S1NB 1VF7A 1JOQA 3B6YA 4XYOA 1Y8NB 3BDLA 2IJ0A 1Q86C 1Z9FA 5CV7A 1PA6A 3C46A 5JAVA 5ELFA 3TEHB 2QA4A 2CWAA 1WTPA 1UAPA 4X62Q 2YYZA 1TWFH 2B2UA 1TY2A 1VMPA 2M00A 3CMEA 2JN4A 1SAPA 3PO3H 1LO5D 5LMNW 4MNOA 3CQZB 3MAQA 4CKBA 4MZ9A 3R2IA 3H0GH 1VQ7A 3DMUA 4C2MB 3OTOL 4CDEC 4JOIC 3S2DB 4HSPA 3HOVH 2JE6I 5GROA 1E24A 1NTGA 2UXBQ 2RCFA 5JPNC 1SNOA 4TVAB 1X65A 1LM0A 2EVBA 4ZKBB 5LL6X 4GOPA 3VA7A 1HXYD 4Z9CB 3HEJA 1SJED 3M4YA 3K7AB 2RBMA 1LT5D 2K5VA 1PH9A 4QGUA 2KHJA 1YVCA 1WI5A 2QF7A 1K0RA 3PUXA 2EY2A 3UE0A 3NXWA 2JEBI 3SGIA 4DGZA 1PMRA 1GHJA 1PTOC 2O5IC 3VR6A 1A62A 1LTGD 1N9WA 2O2LD 4UP7A 3BZDB 2EJFC 3EJIA 2CW0D 1HCZA 1EOTA 2PNHA 1YJ9A 3NTIA 1N8RC 3PO3G 3HKZE 1SE4A 5IP7H 1SYEA 2K03A 1L1OB 4KN4C 4AIMA 2PZWA 1R9TH 3HOYH 3PO2H 4K0KQ 4G4KA 5EBCA 4PMWA 2ZJQA 1CUKA 4QUFA 1XMOL 3TP6A 1HPCA 3EROA 1E2WA 2C9OA 1TWCB 2UXDQ 3SVMA 4CDCC 2E2HH 2WAQG 3MFGA 3MHBA 3OMGA 4PMCA 2LFNA 2N55A 3GTKB 3S1MB 2ENBA 4PQXA 5K36H 1ASYA 3V05A 4DN4M 3GTOH 3GTLH 5J22A 1CHQD 2LXJA 1I94L 1KRTA 5EKIA 4Q5VA 1MSGA 4LF7L 1BOSA 4BWGB 4O1NA 2M9VA 4JBWA 1PFNA 5F2DA 4A3KH 2Q8IB 1EYGA 1EL0A 3SHLA 1G291 4DA2A 2HD3A 2NVTH 4ZKCB 4J6HA 1TS3A 1STGA 1LTLA 2F0SA 5FO7B 5HURA 4FF3A 3GTPB 2E74C 4A3GH 1KDAA 2F0LA 5IP7G 2XN9C 1IL2A 3L3OC 1PTOH 2JA8G 2JA5B 3J80c 2Q2HA 3MVVA 3HOYG 1HR0L 3PO2G 1F9PA 1GJXA 2RA4A 3EVQA 4P2CB 3L7ZC 4JBMA 3GTQH 2EJMA 1ET9A 1UE6A 3KF6B 2ZM6L 2F1MA 2WB1E 5FKAC 4HR7B 2B2YA 1I6VC 2BH8A 3I73A 4JK1C 3LWUA 4CJ2C 5C5MA 1BCPD 1ML0D 1O78A 3ZYYX 1KXLA 4DUYL 1VQ4A 1NCVA 1K8OA 2VUMB 3BYTB 1EU4A 4A4IA 4HJ7A 1D6EC 1ZYRC 1GUWA 1SYBA 1NBWA 3HZXA 1C4QA 2F0JA 2N3SA 2XSCA 2Z6KC 4A3MB 2UUAL 1CSQA 3NQTA 4QMGA 1X3FA 5CC4A 5I2XA 1J8IA 4A3KG 1GUGA 4JI7Q 2J7ZA 4DV1Q 1N34Q 2F0GA 1KDBA 2EE1A 3TQYA 4A3GG 1Z7TA 1AZQA 4JI3L 3K6OA 3FKIH 4EQNA 4A3DB 1EU3A 1U4PA 2MP1A 1XJVA 2KHSA 2RCNA 1CZWA 2Z6BA 1I4PA 4C3JG 3CF5A 4DR3Q 2EYFA 4V190 1U5KA 1Q8KA 4JV5Q 1T5XD 4KKSA 4QCLA 1IBLQ 4QQBX 4KD3A 1XNQL 1WJJA 2FINB 1FL0A 5C3WA 5JEAH 4RGNA 1D2BA 4LF5Q 1QB5D 3KF8A 3HOUH 5C4XH 1YJNA 1XXGA 1SE2A 1VF5C 4H7BA 3OWFA 2L0CA 4CBVA 1S5FD 3BU2A 2K32A 1SNCA 4YWMA 4YHHQ 2E8GA 4XT1B 4L5RC 1M8AA 1ESFA 3WOFA 3SK6A 1JORA 1CKNA 1U4LA 5LMNL 3CW2C 3ND8A 2K14A 4IZ8A 4DK0A 1JCKB 4JYAQ 2E5LL 2GVBA 4DR2Q 3JAMc 1TS5A 4P73A 1HNXQ 4EVOA 1VQOA 2A69C 2WV6D 3BYYB 3H6MA 1K28A 4R4QA 1GUSA 4K5XA 1B53A 1C7YA 2HQLA 3I4MH 1X3EA 3HRZC 1MD2D 1R4QB 2BDOA 2JA7B 4GLXA 1JICA 4PV1C 4LUZA 3G48A 1YITA 4ZCKA 1TS4A 2K52A 4HEDA 1ONLA 2SOBA 2L4NA 5FJ8H 3FPUB 1GVPA 1CQVA 2ATWA 2EYLA 4NXMQ 4GN3B 2K28A 1PH5A 3HOUG 5C4XG 1HTPA 2NN6I 2B2WC 4FF4A 2K4KA 1Y1VH 3CXCA 4HCEA 2ID0A 1CT1D 5D3IB 3Q6SA 1A3TA 3G6JB 1SFOH 1D8LA 1GO3E 2A73B 2PYKA 1W6KA 3UDGA 4Y52H 1WTQA 3PSIA 4L6TB 4PZ6A 2A8VA 4R8NA 2JP1A 5BR8L 1P16A 3E0JA 2QKIC 2B63G 3MXNA 2I5MX 3HKZG 3J81j 5D65A 5EPLA 1LT6D 4F87A 3I4MG 1J5EL 1Z6HA 1NMFA 3KLRA 5IGGA 4WFN3 2JXMB 1SMYD 1S40A 2RSOA 1XTDA 2E2JH 4BBRH 4IUQA 3T1HL 1B1ZA 4JI5Q 3GTGB 4QL5A 1O80A 3P75A 3OTOQ 3H15A 2FFKB 4YWKA 1CA5A 1N33L 2CW0C 3K58A 3A0JA 2UXCL 4P72A 4LFAL 2ICEC 3CD6A 1V1QA 1Y1VG 4EQOA 2K5HA 1TWFB 3UE1A 4NMZA 3W2DA 4OHJA 1PRTD 5M5YH 1I5FA 1XMQQ 4C1NK 5IP9G 4PG3A 3M3YB 1VQEA 3PO3B 4OWXB 2VQEQ 1NJIC 5JJIA 1VS0A 1HQMC 3H0GB 3K5OA 2G5DA 3W3AA 3HOVB 4DV0L 1L2FA 2R3ZA 2WAQB 4L8JA 5EPJA 2F4VL 1ASZA 2OEOA 1RTOA 3CCEA 2YU9H 4LF9Q 5H1SE 3MTSA 1SR3A 4BS9A 4BBRG 2MPMA 2D2CC 2QEJC 4XTCS 4XQNA 2WB1G 5CBAE 1SRUA 4OO1G 1STEA 1PH7A 1IW7D 3J7YW 2AUKA 2HHHL 3VR2A 1ESRA 2QCPX 5C44H 1H9SB 2ZJPA 1U0LA 2Z0SA 2GA4B 4ILWA 4LF4Q 2IX0A 3GQBA 1I94Q 3D0FA 2HQEA 5DM63 1L1OA 4LF7Q 3RLOA 2F0DA 4N8FA 4DAVA 2JA6G 1DCZA 1JE5A 1S4ZA 4G7OC 3HOWB 1LV9A 3I72A 1QVFA 3HOYB 3PO2B 2WFWA 1WVLA 5HGQA 1KQSA 1VQIA 4G7HC 3M85A 1BCPC 4IUVA 3NSWA 2E2HB 1S5CD 3NK9A 2OQKA 2Y0SE 3ERSX 3BZCA 2F0KA 3GV3A 3NEMA 3VR3A 1GD7A 3GTLB 3GTOB 5T1IA 1QNKA 1UE5A 1K73C 1B7YB 3DHQA 4JI2Q 1BR9A 3NBIA 4A93H 2NTTA 4XIGS 4CJ1B 1IBKL 1I3QH 4A3KB 1J9OA 1WD0A 2CH4A 3S15B 4KHPL 1JJ2A 5C44G 3CRLC 1PLFA 3OOCA 4N9PA 1HNWQ 1GXDC 3CRKC 4UPAA 4A3FB 3K5LA 4A3GB 3PGZA 4FVMA 1VQHA 5IGDA 1PH4A 1PH2A 3TP5A 2AWNA 5GAGC 1PTOB 2UUAQ 2PPBC 1IBML 1RDPD 4A3LH 2F0MA 4XT3B 4B9WA 3KF6A 2R92H 5I4DA 2VQFQ 4GS3A 2SNMA 2N78A 2OQ0A 3GDEA 3PIPA 4K2KA 4KKUA 3CMAA 5CV6A 1CM9A 5CV4A 4JI3Q 3RZDB 1GOZA 1OXXK 1HHVA 1LLRD 2EXZA 1SJHD 2I5HA 2Z1CA 3D6CA 4GLVB 3I91A 1FYCA 3CU7A 1VQ5A 2AWOA 1DJRD 4I65A 4IPHA 5ELDA 4JI6L 3A5UA 4A93G 1PV4A 2K04A 2CFMA 1L0WA 2R6GA 4E6IA 4JI1L 4K6LA 2R7ZB 3GV6A 4IFDJ 1KLGD 3UDXA 5FOBB 5IODA 2B2UC 2B29A 3I8ZA 3RN2A 1JJGA 2WACA 3BS1A 1E1TA 1J6QA 1NE3A 3FKIB 4C3IH 1B3QA 1EUJA 4A3EB 3CC7A 3C1EA 2KOLA 4WORA 4KK7A 1BF4A 2FHTA 2R92G 2F3WA 2ZT9C 3OW2A 4DV6L 2KCTA 1IL8A 2A6HD 3S16H 1DOKA 3R2TA 3CHBD 4OWTB 1AFPA 5CBEE 1BNZA 4IFDI 4ODGA 4LJZC 4IURA 2L15A 4HJ8A 1SYCA 3ONAB 4GOPC 2F0OA 4RGOS 3H09A 1DM0B 1D5ZC 1NAPA 1QG7A 2Z4IA 4OEMB 3VR5A 3WWVA 5EQ0A 1O7ZA 2A5HA 1X54A 1K83B 2KCNA 2MO1A 3SK5A 4DXFA 4DAYB 4DV3Q 3TP7A 4H0LC 1JWMD 5I2YA 1I4QA 4IPCA 5IWAL 5A2QL 3I70A 4X3SA 2BA1A 4KY6A 3QJYA 2EJGC 3IKJA 5ELCA 3G4SA 1HNZL 1SMYC 1TWGH 3CP0A 5M5XH 2TSSA 3PMFA 3GTMH 3DM3A 3DEPA 2ZJRA 2L9HA 3NHHA 4H13C 1VQ9A 3HP3A 5JJLA 5M3MG 4B9XA 4XQQA 5CV9A 2OT2A 1VDZA 1RF2D 1PXUA 1K3RA 1PRTC 4IUNA 2PMZE 2DN8A 1GUNA 3U50C 1N36L 1QE6A 4B08A 4DV2L 4DV7L 3K0YA 1X56A 2AUJD 4LMQD 1FGBD 1SFOB 3GO5A 1VQ8A 5DM73 4CKCA 2D62A 4EGVA 5E7NA 1HFNA 4MN3A 1B9NA 3GTJH 4UP9A 3J81E 4QIWB 1EIGA 2L1BA 1BO0A 4LFBL 2J0TD 2KENA 3BZKA 1Q7YC 1HQRD 4A3BB 4CDDC 1VQGA 2JA9A 4J15A 2UU9L 3W1GA 4GKJQ 1RD9D 1EY5A 4X66Q 1IW7C 1BBWA 4X64Q 2Y0SG 2B2YC 4KV6A 4R9WA 3U4ZA 4IOAA 5E3FA 3A74A 4DV0Q 3S2HH 2JJQA 2F4VQ 2E2DC 1WFQA 1YNJD 3A7AB 1EIYB 4ZUJA 2OXPA 3HOZH 1IYUA 3RZOH 1KTKA 3TDQA 4LNQA 5M5YB 1MGSA 2DUDA 1HUMA 4GKKQ 2OCEA 1FGUA 4KY7A 3QOJA 2NZ1D 3EA6A 1JMCA 1XNRL 1NR2A 1TKWB 2JA8H 1NSNS 4I7AA 5C0XH 2EXDA 1TIID 4O0AA 3M4OH 1VQDA 1G2SA 4C56C 5M3FH 1F2LA 2F0NA 1ZEQX 4JCVE 1ENFA 1V1OA 3I4LA 1TS2A 4DV5Q 3WDNA 4RHSA 1V8QA 2V4DA 3T4AC 1A2TA 2BOSA 3VDYA 5FO8B 4ZUIA 4DR1Q 1I4XA 2ZTEA 1PFMA 2CWPA 4A3JH 2PQAB 1Y69U 3PUZA 1CI3M 2X6LA 2B2TC 4B3ML 1O7LA 3AYHB 5ISRA 3UI2A 2NVYH 3F1ZA 3NP8A 4R4TA 3PUWA 3P20A 5AFWA 1LTBD 4RGTA 5A35A 2MHVA 3HOZG 1D5XC 4WJWA 2ICIA 4KI0A 1SNMA 3E5SA 4A3CH 1E1OA 3D4DA 1SNQA 1WCMH 4FP5D 4HJAA 2DNEA 1MBYA 5JVH3 2C5CA 1EIFA 2BDNA 1FJGQ 4LK1C 5C0XG 2P5ZX 1HZCA 1TWHH 1W3SA 2BH2A 3FRPB 4TKOB 5M3FG 2KUMA 4KHPQ 4C3JH 1BXTA 3S17H 4HIMA 1OO9B 4DR6Q 1VMCA 1NR4A 3V2TA 3N6RA 2RHQB 1MI2A 2KEEA 4QJFA 4B3RQ 2HIVA 3BVGA 4KJNA 2Q2TA 2E76C 4MIUA 2A74C 4A3JG 1MJEA 1H9RA 4Q0FA 4AQYQ 4A93B 3CCSA 1DONA 3EN2A 1AZPA 2OTJA 4JC0A 1CQFA 3PCOB 3BVZA 1W2BA 5EJWA 4P75A 1WTRA 1IKLA 2AMCB 4YIJA 1MJCA 4FNFA 1W6JA 4A3CG 5GQOA 2LXKA 3KLWA 4B3TL 1A2UA 3I4NG 3E9HA 1WCMG 1MHWC 3AMUA 1BDOA 1STNA 2K01A 1DD2A 2NZOA 2VZAA 1CKOA 1RTNA 2A6HC 2F0IA 1FD7D 4AYBB 1T5EA 3FPPA 1KL9A 2F0EA 3NWTA 1L0XB 1FNUA 3LNNA 4TQUS 5DLQE 3NUCA 2B2VC 4C3HB 5IYCH 5E1FA 5T1GA 2L5TA 4KLKA 3PV0A 1AEXA 4MHEA 4BY1H 4YWLA 3ERQA 4LFCL 5C4JH 2LY7A 4ALPA 1S72A 1QUQA 3BDOA 4A3IH 4HMJA 4BBSG 4DV6Q 1FVIA 3VA5A 1YI2A 4HIOA 4FXDA 3RR5A 5G3LF 3LGJA 4BY7H 1B2TA 4CKEA 3K80C 5L37A 1B50A 1UWVA 1I4RA 3A5ZB 2XWJB 5DEHA 4WJ3M 1EYAA 1RCVD 3KLSA 5C5LA 3BVMA 3SDZA 3S1QH 4NXNL 5LL6S 4DPGA 2B63H 1KRSA 2EYMA 4C3IB 5ELOA 5C4HA 3PUVA 4JI4Q 5IT9L 2AQ3B 1UEBA 4OX9L 3U58A 2ALYB 2M2LA 3J7A5 4EX5A 3LWEA 2UUCQ 3I55A 3CCQA 5IYCG 4R4OA 2GVAA 2VS1A 1K8GA 4X3TA 3W1BA 3QWNA 4KJOA 5IWAQ 4FF1A 1EY9A 4BY1G 2K5DA 1EOVA 4DUZQ 1EQVA 4HCSA 3NTKA 5C6AA 4GNXC 2NWGA 1KABA 3J7ZC 4DR7L 4A3IG 2R93H 3PIP3 3Q22A 3ULJA 2VY3A 3EFXD 3E9IA 2KHIA 4DAYA 3S1NH 5IP9H 4BY7G 1Q1BA 3HG9A 1Q8IA 1PH3A 4B3SL 1E0BA 2Z6KA 1SYFA 5KIXA 2AQ2B 1B70B 2F0PA 3NTHA 5CGKA 2RHSB 3DM1A 5JPMC 3J81c 1G6ZA 5EKKA 5KNDA 1SEBD 3NBHB 3UDFA 4DV2Q 4RA8A 1DGSA 4QY7A 4DV7Q 1AH9A 1PZKD 4A76A 1QJOA 1TWGB 2R7FA 5M5XB 2Z4HA 3CC4A 3GTMB 1PTOF 2HT1A 3E6ZX 5M9OA 3CQZH 5TSSA 5CV8A 5KRUA 3H3VC 1G2TA 3A8IE 1YNJC 4OO1H 1YHBA 2HDLA 4JBJA 2F3VA 4DAPA 2RDGA 4RKBA 4JI0L 2R93G 3NELA 1KAWA 1HTLD 3TREA 3QIAA 3DWQA 2A68D 1M1KC 3NE5B 2A6ED 1E3PA 5EGTA 1K8AC 4YY3L 3URYA 2AHOB 2EYHA 3K7AH 3AFQA 2QILA 4PNYA 4F7XA 2B8FA 2YTXA 1GUOA 3A56A 3AU7A 1TVXA 2JA6H 4DKAC 5IYBG 2B39A 2PNRC 3RUZA 1XPRA 1U4MA 3GTJB 4IO9A 1EIHA 1VQLA 4PMBA 4R1JA 2XNAC 1XYIA 4GN4B 2OWOA 1LT3D 3CPWA 2CCZA 1DOLA 2MFIA 2UXBL 3SXHA 3CCMA 3U9SA 1F9SA 2D0PA 4OWWB 3C2PA 1AN8A 3E0EA 2XGTA 1NY4A 4ID6A 1X32A 4ZRZA 4HN7A 3STBD 5C4ZA 2EYPA 1G6PA 1XMOQ 4N9TA 1II3A 3CCRA 5COYA 2WINB 3GTKH 3S1MH 3MZ5A 3RN5A 1I50H 1D1KA 3H3VH 4R8IA 5CORA 2PI2A 2YV5A 4O42A 1I4HA 1AE3A 2B2WA 5IIFA 2BE5D 1WTHA 2KVMA 1PRTB 4FF2A 1OXSC 1Q46A 3TBIB 3J80i 4B3MQ 3IAYA 2JA8B 1JQYD 2IWHA 4DV4L 3J80L 5LMUL 1BVSA 1C8CA 1ENCA 1R9TB 3M4OB 4K0KL 1HZAA 1C0AA 2XRQD 2UXDL 5EBDA 1OXUA 3G6EA 1EWIA 3GTPH 3Q24A 4DXGA 1LTRD 1EYDA 4CJ0B 1DYQA 2YTVA 3OWEB 5KYLA 1WTVA 1IZ6A 1PZID 2PQAA 5C3EH 2JA5H 5GAHC 1YNXA 3S9WA 1HR0Q 4XYQA 2HIXA 1CSPA 5IY0A 2KBNA 3D8GA 4DNIA 4IUTA 2ZM6Q 4ABNA 3HOXH 1H9KA 1M90C 3P7JA 3RMHA 5FLMH 2NN6H 5ELBA 4DFAA 2NVTB 2PW5A 1S5ED 1E2ZA 1STBA 4DUYQ 2WKDA 1PVOA 1HH2P 2VUMH 1WCMB 5KNBA 1QCBD 1RHPA 1SSOA 4IALA 4A3MH 3MC0B 4IPDA 1A63A 3RLNA 2IY5B 1TWHB 3V96A 3GTQB 3DWAA 4C3JB 3MXPA 5I9PA 2K5WA 3OIPA 3K5MA 3S17B 4F88A 4KD4A 1X9NA 4B3TQ 4LF8L 4ZK9B 1RIPA 1A0IA 3S24A 1D7QA 1KLUD 4KN7C 5GADC 1WYDA 5C3EG 2JA5G 1EY6A 2I46A 3DLLA 3H94A 3TZDA 1EWHA 1UE1A 2YTYA 2E75C 3K59A 1K9MC 1PFBA 3KYHC 4RKLA 2NZHA 3T53B 1PH8A 3HOXG 4DR4L 4JI7L 2CQAA 5FLMG 4DV1L 5BN3A 2NN6G 1XNQQ 4LFCQ 1JJCB 2HUGA 2QDLA 4FDBA 1JB7A 2VUMG 2L55A 3JAMi 1YNND 2NUCA 1OXVA 3EQLC 3KF8B 3JAML 3OYYA 4A3MG 4K8IA 1X3GA 1CTMA 5IGEA 2BA0A 1VQ6A 4C1NI 3AB9A 1VCIA 3IRBA 3ZJYC 1TT2A 1GHKA 5LMNQ 3J7AV 2NVQH 5I9OA 4GLAC 5C0XI 2F0WA 2R7DA 5M3MH 2E5LQ 3RD4A 3K81C 5IE8A 1IBLL 3TS0A 3VYUA 4NXNQ 1PZJD 4V0BA 3A8KE 5FK9C 5C4JB 3S14H 4NB3A 2JSOA 3G7LA 3C1FA 1LTSD 1Q1EA 4MTNA 1WTWA 4LF5L 4OX9Q 3HOUB 5C4XB 1UNSA 3CCVA 1H9JA 2F0TA 1G51A 2Q8TA 3HKSA 4RFBA 4YHHL 3FP9A 2EOTA 1KIXA 1HZBA 3TN2A 3L2PA 3T16A 4CDFC 2VB2X 2V1CC 3FVQA 4LF6L 4XDXA 2EY1A 1SDFA 1D5MC 4H44C 2K75A 2KECA 3C3LA 3J81i 4DR2L 4DR7Q 3SK8A 2B63B 4N8X1 1BBXC 3S1RH 4HJ9A 1CK1A 3HKZB 4ZLTF 3PIOA 1H95A 1VQFA 2F3IA 2RDFA 1EEFD 3Q0AA 1QILA 4RCNA 3I4MB 1EFWA 1FNVA 1SBBB 4RHRA 4B3SQ 4UY8C 5JJKA 2B8GA 3K5NA 3T1YL 1S3OA 2ZXRA 1HUNA 2O5JC 5BR8Q 1H9MA 1SMXA 1XX8A 3R93A 4DAMA 1EZ8A 3M7NA 5IT9c 1EFID 3I7FA 2A68C 2A6EC 1HJPA 3M4PA 3HS0C 1QOHA 2K6AA 2IHFA 1S5BD 3D4WA 1CZGA 1J5EQ 2JA7G 1Y1VB 5GAEC 1KNEA 2B3GA 2K33A 2X6GA 2XIWA 4QUCA 2EYJA 3T1HQ 3GTGH 3M9BA 3GP7A 3K0XA 2DJFC 3SK4A 2F0HA 4IPGA 1N33Q 1V1PB 4JI0Q 2SEBD 3D31A 5IYDG 1Q81C 2UXCQ 4U673 3OPOA 3NBHA 4LFAQ 5JEAJ 5J39A 2UUBL 2IL8A 1VQNA 2RQXA 4M1UB 3F2CA 2QDBA 4EQ5A 4YY3Q 4ZAIA 3STBC 3M3YH 2XRSD 1JOKA 4HSVA 1Y8PB 5A2QE 2E2JB 4BBRB 5FO9B 3J7AF 5IGBA 1UUPA 2TMPA 4JI5L 3MXUA 4ME5A 4ULLA 1ILQA 5EAYA 3FMCA
chains in the Genus database with same CATH topology
4TQUS 3U4VA 5IP9G 4PG3A 4O2DA 1VQEA 4OWXB 4YCUA 2VQEQ 5IYCH 3ER0A 1EQRA 1QUQB 1KHIA 1TXYA 1NJIC 4PZ7A 4KLKA 3PV0A 5JJIA 1VS0A 4BY1H 4YWLA 4KHZA 1X55A 4LFCL 5C4JH 4ALPA 2CKZB 1XMQL 1S72A 1SROA 4POGA 2VNUD 3EBEA 4DR3L 1QUQA 4P74A 4GNXB 4DV0L 1L2FA 4JV5L 1VQAA 3RNUA 1CKNB 2VQEL 4A3IH 2F4VL 3TRZA 4JBKA 2Q2IA 4BBSG 1ASZA 4DV6Q 3CCEA 2NVXH 2YU9H 1FVIA 4LF9Q 1YI2A 4HIOA 5H1SE 2JK8A 2H5XA 1SR3A 3RR5A 4HJ5A 4BBRG 2HHHQ 3LGJA 3ULPA 4A3DG 4BY7H 4AYBG 3K80C 3I56A 4XTCS 4A3LG 1IXRA 2WB1G 1UWVA 3I2ZA 1SRUA 4OO1G 3A5ZB 1HR0W 4WJ3M 1Q12A 3CCLA 2MQHA 2JA7H 1XPUA 1OXTA 4LF9L 1YHAA 3S1QH 4NXNL 2B63H 4DPGA 1PH7A 1KRSA 5ELOA 2HHHL 3PUVA 4JI4Q 4DV4Q 1UEBA 3H0GG 4OX9L 5C44H 5LMUQ 3HOWH 4LUOA 2ZJPA 3U58A 1U0LA 2ALYB 2Z0SA 3M4QA 4LF4Q 1WOCA 2IX0A 3PF4A 3J7A5 1YHQA 4YCWA 4EX5A 1I94Q 3D0FA 2UUCQ 4IJHA 3HOVG 4JYAL 3CPFA 1L1OA 3KDFB 3I55A 3CCQA 5IYDH 1SLJA 5IYCG 4LF7Q 4R4OA 2GVAA 2VS1A 1K8GA 3RLOA 1HNXL 4LW1A 3W1BA 5M5WH 2JA6G 5IWAQ 4JI4L 1JE5A 4BY1G 3CCUA 1EOVA 3AEVA 1QVFA 4LF4L 4DUZQ 2WFWA 3L0OA 1KQSA 5HGQA 1VQIA 4GNXC 4BXXH 3I4NH 2UUCL 3M85A 1T9HA 3PF5A 3J7ZC 3KJOA 2K5NA 4RG1A 4DR7L 4A3IG 2R93H 3AQQA 2OQKA 4JI8L 2Y0SE 3ULJA 4Y7NH 1Y1WH 3ERSX 2VY3A 2ZTCA 3BZCA 1IBKQ 3E9IA 3NEMA 1PH1A 2KHIA 1GD7A 4DUZL 1SE8A 5IP9H 2ASBA 3S15H 3S1NH 4BY7G 1Q1BA 1QZGA 3F2DA 4NXML 3MXNB 5FLXc 1PH3A 1UE5A 1K73C 4B3SL 1B7YB 4DK3C 2Z6KA 4JI2Q 4A3FH 4DR5Q 4A93H 4BA2I 4QIWE 4JG2A 1LUZA 1AE2A 3KFUA 1BBUA 4XIGS 1IBKL 4JOIA 2A19A 1B70B 1I3QH 4X65Q 2RHSB 3GD7A 3J81c 1OTCA 1NMGA 3I4OA 1IBMQ 3MEFA 1JJ2A 4KHPL 3NBHB 3UDFA 5C44G 4DV2Q 1KD1C 4DV7Q 1DGSA 3B6YA 4QY7A 3HOWG 4L5SA 1HNWQ 1AH9A 4A76A 4JI2L 4GN5A 4UPAA 4OXPA 1Q86C 1Z9FA 2R7FA 4BBSH 4IFDG 2I5LX 1PA6A 3CC4A 3PGZA 1VQHA 1PH4A 2N8NA 1PH2A 2HT1A 3TEHB 2QA4A 2CWAA 3K7UC 3CQZH 1Y14B 2AWNA 5GAGC 4A75A 4LF8Q 2UUAQ 3ICEA 4OONA 4X62Q 4OO1I 3RZDH 2YYZA 1TWFH 1VQBA 2GN5A 1IBML 2I0QA 5K36G 4A3LH 1HNWL 3CMEA 3KF6A 2R92H 4BXXG 1YHBA 4JBJA 3PO3H 2VQFQ 4GS3A 4JI0L 2N78A 5LMNW 2R93G 2OQ0A 3NELA 3GDEA 4MNOA 3PIPA 4JI6Q 2EIFA 3CMAA 1Y1WG 1KAWA 4MZ9A 4JI3Q 3TREA 3H0GH 1VQ7A 2E2IH 1OXXK 4P71A 2PI2E 1M1KC 4DR4Q 1E3PA 4JI1Q 1K8AC 4YY3L 3OTOL 2AHOB 2I5HA 3K7AH 4GLVB 3AFQA 4JOIC 5AJ3L 2R7ZH 1VQ5A 2AWOA 3HOVH 2JE6I 4IPHA 2K50A 5GROA 2VQFL 5J3BA 1E24A 1NTGA 1N32L 2UXBQ 2YTXA 4HIKA 4A3FG 4JI6L 3A5UA 4A93G 1PV4A 2CFMA 4TVAB 2JA6H 1X65A 1LM0A 2MNAA 4DKAC 5IYBG 4GOPA 1XPRA 1I6HH 1L0WA 4PZ8A 4IO9A 2R6GA 1VQLA 4R1JA 4JI1L 4GN4B 2K5VA 2OWOA 3CPWA 1TWAH 4QGUA 3UDXA 4A3EH 1PH9A 2CCZA 4IFDJ 2MFIA 2KHJA 1YVCA 2UXBL 1WI5A 1K0RA 2B29A 1QVGA 3PUXA 3CCMA 3RN2A 2IX1A 1JJGA 2D0PA 3UE0A 2JEBI 3SGIA 1E1TA 4OWWB 1J6QA 1NE3A 4C3IH 3E0EA 2XGTA 1A62A 1NY4A 1N9WA 3STBD 4UP7A 1EUJA 3EIVA 1V9PA 3CC7A 1G6PA 1XMOQ 2VL6A 2R92G 2PNHA 3OW2A 1YJ9A 1VQMA 1N8RC 4DV6L 3PO3G 2FXQA 2KCTA 3CCRA 3S16H 3H3VI 3HKZE 3HFZB 5IP7H 4OWTB 2QEXA 3GTKH 3S1MH 1L1OB 3RN5A 1I50H 4L5QA 4IFDI 4AIMA 2IHEA 2L15A 1K83H 4R4IA 3H3VH 1R9TH 3HOYH 3PO2H 4HJ8A 2IT1A 4PMWA 2PI2A 4GOPC 1CUKA 2YV5A 5ELNA 1XMOL 2ZJQA 1AE3A 2R7ZG 1PFSA 2UXDQ 4LF6Q 2E2HH 2WAQG 1OXSC 1Q46A 1VQKA 3J80i 1BKBA 4B3MQ 3WWVA 1YIJA 1YJWA 1EQQA 4DV4L 3FHWA 1BVSA 1X54A 5LMUL 1ASYA 4K0KL 3NENA 2JEAI 1HZAA 2MO1A 3FKIG 3GTOH 3GTLH 1C0AA 2LXJA 1I94L 1HNZQ 2UXDL 1KRTA 4A3EG 1OXUA 4DAYB 3G6EA 1EWIA 4LF7L 4DV3Q 1X6OA 3GTPH 1KC8C 4APVA 4IPCA 3BJUA 1QVCA 4JBWA 5HY6A 5IWAL 2DGYA 2YTVA 1VQCA 3UDIA 3T1YQ 2BA1A 1IZ6A 4A3KH 1EYGA 2PQAA 5C3EH 2JA5H 1G291 3G4SA 1HNZL 5GAHC 1YNXA 4LUVA 5JEAG 1HR0Q 2NVTH 2HIXA 1CSPA 5IY0A 4DV3L 1TWGH 2KBNA 3CP0A 4DNIA 5M5XH 1LTLA 4A3GH 3GTMH 3DM3A 1VQ9A 2ZJRA 5IYBH 5JJLA 5IP7G 1N36Q 1PH6A 2ZM6Q 1IL2A 1L1OC 1IYJB 2A1AA 5M3MG 3HOXH 2JA8G 1M90C 1O7IA 3J80c 2Q2HA 2OTLA 5FLMH 3W5OA 3HOYG 1HR0L 3PO2G 4DR5L 3L7ZC 4DUYQ 4JBMA 3GTQH 1PVOA 1HH2P 2VUMH 1K3RA 1UE6A 4AYBE 2PMZE 3KF6B 1N36L 3U50C 2ZM6L 3ULLA 4X65L 4L5TA 2WB1E 1V43A 4IPDA 4A3MH 2BH8A 4DV2L 1A63A 3RLNA 4DV7L 4C2MH 2IY5B 1X56A 2UUBQ 1MKHA 1VQPA 1KXLA 3S2DH 4DUYL 1VQ4A 2RF4A 3GO5A 4A4IA 4YCVA 1VQ8A 4HJ7A 4LFBQ 2D62A 1NBWA 4RMFA 1X9NA 4B3TQ 5E7NA 2Z6KC 2N3SA 2UUAL 4LF8L 4X62L 1CSQA 1RIPA 4A3BH 1A0IA 3S24A 1D7QA 3GTJH 1X3FA 4UP9A 5GADC 1WYDA 1Z47A 4A3KG 4JI7Q 4GOPB 5C3EG 1E7ZA 2JA5G 2Q2UA 2UU9Q 4DV1Q 5FJ8G 3DLLA 1N34Q 4LFBL 3CC2A 1UE1A 2YTYA 3TQYA 4LWCA 2KENA 3BZKA 1K9MC 1Q7YC 4A3GG 2ZTDA 1GM5A 3KYHC 4JI3L 1VQGA 2JA9A 2NZHA 1PH8A 3HOXG 4DR4L 2XTIA 4JI7L 3FKIH 1XPOA 4J15A 2UU9L 1A8VA 3W1GA 4GKJQ 5FLMG 4DV1L 1XJVA 4X66Q 2NN6G 1XNQQ 1BBWA 4X64Q 1JJCB 1RL2A 1VQJA 2RCNA 2Y0SG 4LFCQ 3U4ZA 4IOAA 4IJLA 4FDBA 3A74A 1JB7A 3CF5A 4DR3Q 3JAMi 2VUMG 2D0OA 4DV0Q 1U5KA 1PYSB 1Q8KA 1YBYA 2JJQA 3S2HH 4JV5Q 1XNRQ 2F4VQ 1OXVA 1C9OA 1WFQA 3KF8B 3OYYA 4A3MG 1IBLQ 1X3GA 1EIYB 3HOZH 4QQBX 2BA0A 3RZOH 4GKJL 2MO0A 4X66L 1XNQL 5DLQE 1VQ6A 1WJJA 1YEZA 1FL0A 4X64L 1VCIA 4LNQA 3IRBA 3ZJYC 4X6AH 2DUDA 1TWCH 5LMNQ 4GKKQ 2NVQH 4LF5Q 4GLAC 3HOUH 2OCEA 5C0XI 5C4XH 1FGUA 1YJNA 1JMCA 1XNRL 2R7DA 5M3MH 3JC66 2JA8H 2E5LQ 3BU2A 3K81C 5IE8A 1IBLL 4A3BG 4YWMA 4YHHQ 2KCMA 2E8GA 2CQOA 2EXDA 1SN8A 3TS0A 4L5RC 4O0AA 4NXNQ 1VQDA 4GNXA 3S14H 3M4OH 4NB3A 5M3FH 1CKNA 5LMNL 3CW2C 4GKKL 1Q1EA 2K14A 4MTNA 3F2BA 4POFA 4LF5L 4JCVE 4OX9Q 3RLFA 4H02A 4DV5Q 3CCVA 1G51A 4DK6C 3VDYA 4DR1Q 4JYAQ 3HKSA 2VW9A 2E5LL 3TS2A 2GVBA 4YHHL 4DR2Q 2ZTEA 3JAMc 3FP9A 4P73A 2C35B 1HNXQ 3CCJA 1HZ9A 1KIXA 1HZBA 1VQOA 2CWPA 3L2PA 4A3JH 2PQAB 4R4QA 3PUZA 4LF6L 2V1CC 4DV5L 1C7YA 1PYBA 4B3ML 2WP8J 2HQLA 3AYHB 4DR1L 1X3EA 1GKHA 3I4MH 2K75A 4GLXA 2AKWB 2NVYH 3F1ZA 3J81i 4R4TA 3PUWA 4LUZA 3KJPA 1YZ6A 3G48A 4DR2L 4DR7Q 1JT8A 4JI8Q 1LYLA 2JQOA 3S1RH 1YITA 4HJ9A 3HOZG 2K52A 3PIOA 5FJ8H 1VQFA 4KI0A 1GVPA 2F3IA 3G71A 4WJ4A 4A3CH 1H95A 3KDFA 4BA1I 2ATWA 1E1OA 1EFWA 2N49A 4GN3B 1PH5A 4NXMQ 3HOUG 1WCMH 1Q82C 5C4XG 4B3SQ 4HJAA 2NN6I 4UY8C 1B8AA 4K0KQ 5JJKA 3F8TA 3T1YL 2K4KA 4IOCA 1EIFA 2LSSA 1S3OA 1FJGQ 1P8LA 1Y1VH 5BR8Q 3CXCA 1SMXA 2ID0A 5C0XG 1HZCA 1TWHH 4DAMA 1W3SA 2BH2A 3M7NA 5M3FG 5IT9c 1SFOH 1D8LA 1GO3E 3I7FA 4KHPQ 4C3JH 3UDGA 3S17H 4Y52H 1HJPA 4HIMA 3M4PA 4DR6Q 3PSIA 2EQSA 4PZ6A 2A8VA 2IHFA 1MIUA 2F52A 1E22A 1FJGL 3K8AA 2RHQB 1J5EQ 2JA7G 5BR8L 1P16A 5GAEC 4QJFA 4B3RQ 2B3GA 2HIVA 2B63G 2I5MX 2Q2TA 3T1HQ 3HKZG 3J81j 3GTGH 4A3JG 3M9BA 1PHJA 1MJEA 3Q8DA 3KOJA 3K0XA 3CAMA 4AH6A 4DR6L 1QZHA 4IPGA 4AQYQ 3CCSA 1XMQQ 1N33Q 3EN2A 3I4MG 1J5EL 2OTJA 1NMFA 4JC0A 4UP8A 4JI0Q 1CKMA 3PCOB 2QGQA 3D31A 5IYDG 1W2BA 1Q81C 2UXCQ 4B3RL 1S40A 4LFAQ 4P75A 1XTDA 2WAQE 5JEAJ 2E2JH 4BBRH 2UUBL 4A3DH 3T1HL 2AMCB 3PUYA 1UE7A 1MJCA 4JI5Q 1VQNA 4QL5A 3F2CA 4A3CG 4EQ5A 4YY3Q 5GQOA 3OTOQ 2LXKA 3KLWA 3H15A 4NPSA 3STBC 4AQYL 4B3TL 4YWKA 1N33L 5AJ3Q 3I4NG 3M3YH 3AFPA 3E9HA 4C3HH 1WCMG 3A0JA 1N32Q 2UXCL 5C0XJ 4P72A 2ES2A 4LFAL 3CD6A 2NZOA 2VZAA 1CKOA 1V1QA 1Y1VG 4ME3A 2K5HA 4HIDA 4JI5L 1KL9A 3UE1A 1N34L 4R4CA 5EAYA 5M5YH 1I5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TQU S;  3U4V A;  5IP9 G;  4PG3 A;  4O2D A;  1VQE A;  4OWX B;  4YCU A;  2VQE Q;  5IYC H;  3ER0 A;  1EQR A;  1QUQ B;  1KHI A;  1TXY A;  1NJI C;  4PZ7 A;  4KLK A;  3PV0 A;  5JJI A;  1VS0 A;  4BY1 H;  4YWL A;  4KHZ A;  1X55 A;  4LFC L;  5C4J H;  4ALP A;  2CKZ B;  1XMQ L;  1S72 A;  1SRO A;  4POG A;  2VNU D;  3EBE A;  4DR3 L;  1QUQ A;  4P74 A;  4GNX B;  4DV0 L;  1L2F A;  4JV5 L;  1VQA A;  3RNU A;  1CKN B;  2VQE L;  4A3I H;  2F4V L;  3TRZ A;  4JBK A;  2Q2I A;  4BBS G;  1ASZ A;  4DV6 Q;  3CCE A;  2NVX H;  2YU9 H;  1FVI A;  4LF9 Q;  1YI2 A;  4HIO A;  5H1S E;  2JK8 A;  2H5X A;  1SR3 A;  3RR5 A;  4HJ5 A;  4BBR G;  2HHH Q;  3LGJ A;  3ULP A;  4A3D G;  4BY7 H;  4AYB G;  3K80 C;  3I56 A;  4XTC S;  4A3L G;  1IXR A;  2WB1 G;  1UWV A;  3I2Z A;  1SRU A;  4OO1 G;  3A5Z B;  1HR0 W;  4WJ3 M;  1Q12 A;  3CCL A;  2MQH A;  2JA7 H;  1XPU A;  1OXT A;  4LF9 L;  1YHA A;  3S1Q H;  4NXN L;  2B63 H;  4DPG A;  1PH7 A;  1KRS A;  5ELO A;  2HHH L;  3PUV A;  4JI4 Q;  4DV4 Q;  1UEB A;  3H0G G;  4OX9 L;  5C44 H;  5LMU Q;  3HOW H;  4LUO A;  2ZJP A;  3U58 A;  1U0L A;  2ALY B;  2Z0S A;  3M4Q A;  4LF4 Q;  1WOC A;  2IX0 A;  3PF4 A;  3J7A 5;  1YHQ A;  4YCW A;  4EX5 A;  1I94 Q;  3D0F A;  2UUC Q;  4IJH A;  3HOV G;  4JYA L;  3CPF A;  1L1O A;  3KDF B;  3I55 A;  3CCQ A;  5IYD H;  1SLJ A;  5IYC G;  4LF7 Q;  4R4O A;  2GVA A;  2VS1 A;  1K8G A;  3RLO A;  1HNX L;  4LW1 A;  3W1B A;  5M5W H;  2JA6 G;  5IWA Q;  4JI4 L;  1JE5 A;  4BY1 G;  3CCU A;  1EOV A;  3AEV A;  1QVF A;  4LF4 L;  4DUZ Q;  2WFW A;  3L0O A;  1KQS A;  5HGQ A;  1VQI A;  4GNX C;  4BXX H;  3I4N H;  2UUC L;  3M85 A;  1T9H A;  3PF5 A;  3J7Z C;  3KJO A;  2K5N A;  4RG1 A;  4DR7 L;  4A3I G;  2R93 H;  3AQQ A;  2OQK A;  4JI8 L;  2Y0S E;  3ULJ A;  4Y7N H;  1Y1W H;  3ERS X;  2VY3 A;  2ZTC A;  3BZC A;  1IBK Q;  3E9I A;  3NEM A;  1PH1 A;  2KHI A;  1GD7 A;  4DUZ L;  1SE8 A;  5IP9 H;  2ASB A;  3S15 H;  3S1N H;  4BY7 G;  1Q1B A;  1QZG A;  3F2D A;  4NXM L;  3MXN B;  5FLX c;  1PH3 A;  1UE5 A;  1K73 C;  4B3S L;  1B7Y B;  4DK3 C;  2Z6K A;  4JI2 Q;  4A3F H;  4DR5 Q;  4A93 H;  4BA2 I;  4QIW E;  4JG2 A;  1LUZ A;  1AE2 A;  3KFU A;  1BBU A;  4XIG S;  1IBK L;  4JOI A;  2A19 A;  1B70 B;  1I3Q H;  4X65 Q;  2RHS B;  3GD7 A;  3J81 c;  1OTC A;  1NMG A;  3I4O A;  1IBM Q;  3MEF A;  1JJ2 A;  4KHP L;  3NBH B;  3UDF A;  5C44 G;  4DV2 Q;  1KD1 C;  4DV7 Q;  1DGS A;  3B6Y A;  4QY7 A;  3HOW G;  4L5S A;  1HNW Q;  1AH9 A;  4A76 A;  4JI2 L;  4GN5 A;  4UPA A;  4OXP A;  1Q86 C;  1Z9F A;  2R7F A;  4BBS H;  4IFD G;  2I5L X;  1PA6 A;  3CC4 A;  3PGZ A;  1VQH A;  1PH4 A;  2N8N A;  1PH2 A;  2HT1 A;  3TEH B;  2QA4 A;  2CWA A;  3K7U C;  3CQZ H;  1Y14 B;  2AWN A;  5GAG C;  4A75 A;  4LF8 Q;  2UUA Q;  3ICE A;  4OON A;  4X62 Q;  4OO1 I;  3RZD H;  2YYZ A;  1TWF H;  1VQB A;  2GN5 A;  1IBM L;  2I0Q A;  5K36 G;  4A3L H;  1HNW L;  3CME A;  3KF6 A;  2R92 H;  4BXX G;  1YHB A;  4JBJ A;  3PO3 H;  2VQF Q;  4GS3 A;  4JI0 L;  2N78 A;  5LMN W;  2R93 G;  2OQ0 A;  3NEL A;  3GDE A;  4MNO A;  3PIP A;  4JI6 Q;  2EIF A;  3CMA A;  1Y1W G;  1KAW A;  4MZ9 A;  4JI3 Q;  3TRE A;  3H0G H;  1VQ7 A;  2E2I H;  1OXX K;  4P71 A;  2PI2 E;  1M1K C;  4DR4 Q;  1E3P A;  4JI1 Q;  1K8A C;  4YY3 L;  3OTO L;  2AHO B;  2I5H A;  3K7A H;  4GLV B;  3AFQ A;  4JOI C;  5AJ3 L;  2R7Z H;  1VQ5 A;  2AWO A;  3HOV H;  2JE6 I;  4IPH A;  2K50 A;  5GRO A;  2VQF L;  5J3B A;  1E24 A;  1NTG A;  1N32 L;  2UXB Q;  2YTX A;  4HIK A;  4A3F G;  4JI6 L;  3A5U A;  4A93 G;  1PV4 A;  2CFM A;  4TVA B;  2JA6 H;  1X65 A;  1LM0 A;  2MNA A;  4DKA C;  5IYB G;  4GOP A;  1XPR A;  1I6H H;  1L0W A;  4PZ8 A;  4IO9 A;  2R6G A;  1VQL A;  4R1J A;  4JI1 L;  4GN4 B;  2K5V A;  2OWO A;  3CPW A;  1TWA H;  4QGU A;  3UDX A;  4A3E H;  1PH9 A;  2CCZ A;  4IFD J;  2MFI A;  2KHJ A;  1YVC A;  2UXB L;  1WI5 A;  1K0R A;  2B29 A;  1QVG A;  3PUX A;  3CCM A;  3RN2 A;  2IX1 A;  1JJG A;  2D0P A;  3UE0 A;  2JEB I;  3SGI A;  1E1T A;  4OWW B;  1J6Q A;  1NE3 A;  4C3I H;  3E0E A;  2XGT A;  1A62 A;  1NY4 A;  1N9W A;  3STB D;  4UP7 A;  1EUJ A;  3EIV A;  1V9P A;  3CC7 A;  1G6P A;  1XMO Q;  2VL6 A;  2R92 G;  2PNH A;  3OW2 A;  1YJ9 A;  1VQM A;  1N8R C;  4DV6 L;  3PO3 G;  2FXQ A;  2KCT A;  3CCR A;  3S16 H;  3H3V I;  3HKZ E;  3HFZ B;  5IP7 H;  4OWT B;  2QEX A;  3GTK H;  3S1M H;  1L1O B;  3RN5 A;  1I50 H;  4L5Q A;  4IFD I;  4AIM A;  2IHE A;  2L15 A;  1K83 H;  4R4I A;  3H3V H;  1R9T H;  3HOY H;  3PO2 H;  4HJ8 A;  2IT1 A;  4PMW A;  2PI2 A;  4GOP C;  1CUK A;  2YV5 A;  5ELN A;  1XMO L;  2ZJQ A;  1AE3 A;  2R7Z G;  1PFS A;  2UXD Q;  4LF6 Q;  2E2H H;  2WAQ G;  1OXS C;  1Q46 A;  1VQK A;  3J80 i;  1BKB A;  4B3M Q;  3WWV A;  1YIJ A;  1YJW A;  1EQQ A;  4DV4 L;  3FHW A;  1BVS A;  1X54 A;  5LMU L;  1ASY A;  4K0K L;  3NEN A;  2JEA I;  1HZA A;  2MO1 A;  3FKI G;  3GTO H;  3GTL H;  1C0A A;  2LXJ A;  1I94 L;  1HNZ Q;  2UXD L;  1KRT A;  4A3E G;  1OXU A;  4DAY B;  3G6E A;  1EWI A;  4LF7 L;  4DV3 Q;  1X6O A;  3GTP H;  1KC8 C;  4APV A;  4IPC A;  3BJU A;  1QVC A;  4JBW A;  5HY6 A;  5IWA L;  2DGY A;  2YTV A;  1VQC A;  3UDI A;  3T1Y Q;  2BA1 A;  1IZ6 A;  4A3K H;  1EYG A;  2PQA A;  5C3E H;  2JA5 H;  1G29 1;  3G4S A;  1HNZ L;  5GAH C;  1YNX A;  4LUV A;  5JEA G;  1HR0 Q;  2NVT H;  2HIX A;  1CSP A;  5IY0 A;  4DV3 L;  1TWG H;  2KBN A;  3CP0 A;  4DNI A;  5M5X H;  1LTL A;  4A3G H;  3GTM H;  3DM3 A;  1VQ9 A;  2ZJR A;  5IYB H;  5JJL A;  5IP7 G;  1N36 Q;  1PH6 A;  2ZM6 Q;  1IL2 A;  1L1O C;  1IYJ B;  2A1A A;  5M3M G;  3HOX H;  2JA8 G;  1M90 C;  1O7I A;  3J80 c;  2Q2H A;  2OTL A;  5FLM H;  3W5O A;  3HOY G;  1HR0 L;  3PO2 G;  4DR5 L;  3L7Z C;  4DUY Q;  4JBM A;  3GTQ H;  1PVO A;  1HH2 P;  2VUM H;  1K3R A;  1UE6 A;  4AYB E;  2PMZ E;  3KF6 B;  1N36 L;  3U50 C;  2ZM6 L;  3ULL A;  4X65 L;  4L5T A;  2WB1 E;  1V43 A;  4IPD A;  4A3M H;  2BH8 A;  4DV2 L;  1A63 A;  3RLN A;  4DV7 L;  4C2M H;  2IY5 B;  1X56 A;  2UUB Q;  1MKH A;  1VQP A;  1KXL A;  3S2D H;  4DUY L;  1VQ4 A;  2RF4 A;  3GO5 A;  4A4I A;  4YCV A;  1VQ8 A;  4HJ7 A;  4LFB Q;  2D62 A;  1NBW A;  4RMF A;  1X9N A;  4B3T Q;  5E7N A;  2Z6K C;  2N3S A;  2UUA L;  4LF8 L;  4X62 L;  1CSQ A;  1RIP A;  4A3B H;  1A0I A;  3S24 A;  1D7Q A;  3GTJ H;  1X3F A;  4UP9 A;  5GAD C;  1WYD A;  1Z47 A;  4A3K G;  4JI7 Q;  4GOP B;  5C3E G;  1E7Z A;  2JA5 G;  2Q2U A;  2UU9 Q;  4DV1 Q;  5FJ8 G;  3DLL A;  1N34 Q;  4LFB L;  3CC2 A;  1UE1 A;  2YTY A;  3TQY A;  4LWC A;  2KEN A;  3BZK A;  1K9M C;  1Q7Y C;  4A3G G;  2ZTD A;  1GM5 A;  3KYH C;  4JI3 L;  1VQG A;  2JA9 A;  2NZH A;  1PH8 A;  3HOX G;  4DR4 L;  2XTI A;  4JI7 L;  3FKI H;  1XPO A;  4J15 A;  2UU9 L;  1A8V A;  3W1G A;  4GKJ Q;  5FLM G;  4DV1 L;  1XJV A;  4X66 Q;  2NN6 G;  1XNQ Q;  1BBW A;  4X64 Q;  1JJC B;  1RL2 A;  1VQJ A;  2RCN A;  2Y0S G;  4LFC Q;  3U4Z A;  4IOA A;  4IJL A;  4FDB A;  3A74 A;  1JB7 A;  3CF5 A;  4DR3 Q;  3JAM i;  2VUM G;  2D0O A;  4DV0 Q;  1U5K A;  1PYS B;  1Q8K A;  1YBY A;  2JJQ A;  3S2H H;  4JV5 Q;  1XNR Q;  2F4V Q;  1OXV A;  1C9O A;  1WFQ A;  3KF8 B;  3OYY A;  4A3M G;  1IBL Q;  1X3G A;  1EIY B;  3HOZ H;  4QQB X;  2BA0 A;  3RZO H;  4GKJ L;  2MO0 A;  4X66 L;  1XNQ L;  5DLQ E;  1VQ6 A;  1WJJ A;  1YEZ A;  1FL0 A;  4X64 L;  1VCI A;  4LNQ A;  3IRB A;  3ZJY C;  4X6A H;  2DUD A;  1TWC H;  5LMN Q;  4GKK Q;  2NVQ H;  4LF5 Q;  4GLA C;  3HOU H;  2OCE A;  5C0X I;  5C4X H;  1FGU A;  1YJN A;  1JMC A;  1XNR L;  2R7D A;  5M3M H;  3JC6 6;  2JA8 H;  2E5L Q;  3BU2 A;  3K81 C;  5IE8 A;  1IBL L;  4A3B G;  4YWM A;  4YHH Q;  2KCM A;  2E8G A;  2CQO A;  2EXD A;  1SN8 A;  3TS0 A;  4L5R C;  4O0A A;  4NXN Q;  1VQD A;  4GNX A;  3S14 H;  3M4O H;  4NB3 A;  5M3F H;  1CKN A;  5LMN L;  3CW2 C;  4GKK L;  1Q1E A;  2K14 A;  4MTN A;  3F2B A;  4POF A;  4LF5 L;  4JCV E;  4OX9 Q;  3RLF A;  4H02 A;  4DV5 Q;  3CCV A;  1G51 A;  4DK6 C;  3VDY A;  4DR1 Q;  4JYA Q;  3HKS A;  2VW9 A;  2E5L L;  3TS2 A;  2GVB A;  4YHH L;  4DR2 Q;  2ZTE A;  3JAM c;  3FP9 A;  4P73 A;  2C35 B;  1HNX Q;  3CCJ A;  1HZ9 A;  1KIX A;  1HZB A;  1VQO A;  2CWP A;  3L2P A;  4A3J H;  2PQA B;  4R4Q A;  3PUZ A;  4LF6 L;  2V1C C;  4DV5 L;  1C7Y A;  1PYB A;  4B3M L;  2WP8 J;  2HQL A;  3AYH B;  4DR1 L;  1X3E A;  1GKH A;  3I4M H;  2K75 A;  4GLX A;  2AKW B;  2NVY H;  3F1Z A;  3J81 i;  4R4T A;  3PUW A;  4LUZ A;  3KJP A;  1YZ6 A;  3G48 A;  4DR2 L;  4DR7 Q;  1JT8 A;  4JI8 Q;  1LYL A;  2JQO A;  3S1R H;  1YIT A;  4HJ9 A;  3HOZ G;  2K52 A;  3PIO A;  5FJ8 H;  1VQF A;  4KI0 A;  1GVP A;  2F3I A;  3G71 A;  4WJ4 A;  4A3C H;  1H95 A;  3KDF A;  4BA1 I;  2ATW A;  1E1O A;  1EFW A;  2N49 A;  4GN3 B;  1PH5 A;  4NXM Q;  3HOU G;  1WCM H;  1Q82 C;  5C4X G;  4B3S Q;  4HJA A;  2NN6 I;  4UY8 C;  1B8A A;  4K0K Q;  5JJK A;  3F8T A;  3T1Y L;  2K4K A;  4IOC A;  1EIF A;  2LSS A;  1S3O A;  1FJG Q;  1P8L A;  1Y1V H;  5BR8 Q;  3CXC A;  1SMX A;  2ID0 A;  5C0X G;  1HZC A;  1TWH H;  4DAM A;  1W3S A;  2BH2 A;  3M7N A;  5M3F G;  5IT9 c;  1SFO H;  1D8L A;  1GO3 E;  3I7F A;  4KHP Q;  4C3J H;  3UDG A;  3S17 H;  4Y52 H;  1HJP A;  4HIM A;  3M4P A;  4DR6 Q;  3PSI A;  2EQS A;  4PZ6 A;  2A8V A;  2IHF A;  1MIU A;  2F52 A;  1E22 A;  1FJG L;  3K8A A;  2RHQ B;  1J5E Q;  2JA7 G;  5BR8 L;  1P16 A;  5GAE C;  4QJF A;  4B3R Q;  2B3G A;  2HIV A;  2B63 G;  2I5M X;  2Q2T A;  3T1H Q;  3HKZ G;  3J81 j;  3GTG H;  4A3J G;  3M9B A;  1PHJ A;  1MJE A;  3Q8D A;  3KOJ A;  3K0X A;  3CAM A;  4AH6 A;  4DR6 L;  1QZH A;  4IPG A;  4AQY Q;  3CCS A;  1XMQ Q;  1N33 Q;  3EN2 A;  3I4M G;  1J5E L;  2OTJ A;  1NMF A;  4JC0 A;  4UP8 A;  4JI0 Q;  1CKM A;  3PCO B;  2QGQ A;  3D31 A;  5IYD G;  1W2B A;  1Q81 C;  2UXC Q;  4B3R L;  1S40 A;  4LFA Q;  4P75 A;  1XTD A;  2WAQ E;  5JEA J;  2E2J H;  4BBR H;  2UUB L;  4A3D H;  3T1H L;  2AMC B;  3PUY A;  1UE7 A;  1MJC A;  4JI5 Q;  1VQN A;  4QL5 A;  3F2C A;  4A3C G;  4EQ5 A;  4YY3 Q;  5GQO A;  3OTO Q;  2LXK A;  3KLW A;  3H15 A;  4NPS A;  3STB C;  4AQY L;  4B3T L;  4YWK A;  1N33 L;  5AJ3 Q;  3I4N G;  3M3Y H;  3AFP A;  3E9H A;  4C3H H;  1WCM G;  3A0J A;  1N32 Q;  2UXC L;  5C0X J;  4P72 A;  2ES2 A;  4LFA L;  3CD6 A;  2NZO A;  2VZA A;  1CKO A;  1V1Q A;  1Y1V G;  4ME3 A;  2K5H A;  4HID A;  4JI5 L;  1KL9 A;  3UE1 A;  1N34 L;  4R4C A;  5EAY A;  5M5Y H;  1I5F A; 
#chains in the Genus database with same CATH topology
 2WB1 B;  4YCU A;  2PW7 A;  3R8B A;  3ER0 A;  1EQR A;  1KHI A;  1TXY A;  4PZ7 A;  2BE5 C;  2NYZ D;  4TSS A;  2LKV A;  3NQI A;  1X55 A;  2BCO A;  4KHZ A;  1XMQ L;  2CKZ B;  4JVZ A;  1BCP F;  1SRO A;  4POG A;  1IYV A;  1A3U A;  3EBE A;  2EZV A;  4GNX B;  1CFM A;  4P74 A;  1VQA A;  2VQE L;  2JA6 B;  4K2L A;  2NVX H;  2VB3 X;  2H5X A;  4RWS C;  3MA2 B;  4FO2 A;  3T13 A;  2HHH Q;  3ULP A;  4FXK C;  2QW7 A;  2SDF A;  3I56 A;  1IXR A;  1B9M A;  1K8M A;  2CVR A;  3I2Z A;  2ZXP A;  2J4X A;  2CHB D;  1HRJ A;  1Q12 A;  4JPB W;  2MQH A;  1XPU A;  1OXT A;  2YU9 B;  2HDM A;  1BUV T;  3O13 A;  4LF9 L;  1YHA A;  4KKT A;  4HTH A;  3M7G A;  4DV4 Q;  3H0G G;  3HOW H;  5LMU Q;  4LUO A;  3M4Q A;  2NB0 A;  1WOC A;  4MTK A;  1ILP A;  3PF4 A;  1YHQ A;  1JOO A;  4YCW A;  4IFD H;  3HOV G;  3KDF B;  3KBG A;  4IN3 A;  3IFD A;  3TME A;  3TSS A;  1H9S A;  5M5W H;  4KHV A;  1I50 B;  5CR3 A;  1G8Z D;  4K14 A;  3VR4 A;  5C44 B;  1JR0 D;  3CCU A;  3OIQ A;  4LF4 L;  2Z8L A;  2WKC A;  4BXX H;  3I4N H;  1EWC A;  3KJO A;  2K5N A;  3AQQ A;  4JI8 L;  5IGC A;  4Y7N H;  1Y1W H;  2KED A;  4UAI A;  3A7L A;  1IBK Q;  1LTI D;  1PH1 A;  3SR1 A;  3S15 H;  5BN4 A;  2RDH A;  3F2D A;  1ICF B;  4A3F H;  2F0F A;  4QIW E;  1LUZ A;  3A8J E;  2X69 A;  1BBU A;  4JOI A;  2A19 A;  2H4O A;  3GD7 A;  1OTC A;  1EY4 A;  1NMG A;  3D4R A;  3I4O A;  1STY A;  5C3E B;  2Z9H A;  3MEF A;  1IBM Q;  3HOW G;  1KD1 C;  4OIK A;  3X3M A;  4L5S A;  1SYG A;  4JI2 L;  4GN5 A;  4OXP A;  4IUP A;  5E4W C;  4BBS H;  2I5L X;  4IFD G;  1GUT A;  5E4X A;  2N8N A;  1JB3 A;  3I3C A;  3K7U C;  1I3Q B;  3HOX B;  1Y14 B;  4A75 A;  3SEB A;  4LF8 Q;  3ICE A;  2MJ8 A;  3TP8 A;  4OON A;  4OO1 I;  1YNN C;  3RZD H;  1VQB A;  2I0Q A;  2GN5 A;  5K36 G;  2XVS A;  5EPK A;  2KCC A;  1HNW L;  2WII B;  1F2Z A;  4BXX G;  3I90 A;  2G9H D;  1KDC A;  2SNS A;  4JI6 Q;  3DEO A;  2EIF A;  1SYD A;  1Y1W G;  3VYT A;  1STA A;  1STH A;  2E2I H;  4P71 A;  2PI2 E;  4DR4 Q;  1KNA A;  1JWU D;  4JI1 Q;  1BQQ T;  2R92 B;  5AJ3 L;  2R7Z H;  2K50 A;  2VQF L;  5J3B A;  1N32 L;  4HIK A;  3D3R A;  4A3F G;  3KBX A;  2MNA A;  1I6H H;  4PZ8 A;  5IGF A;  4OIJ A;  1TWA H;  4A3E H;  1BCP B;  4RAU C;  5CMD A;  1EY0 A;  1K3B C;  1QVG A;  1AW7 A;  5JVG 3;  2IX1 A;  4X3K A;  2IW3 A;  1DXM A;  3QR8 A;  1A3V A;  5JOB A;  1LAC A;  4KY5 A;  4K5W A;  2B2T A;  3EIV A;  1V9P A;  3WOE A;  2VL6 A;  1SE3 A;  1VQM A;  2VXW A;  2FXQ A;  4OGQ C;  3H3V I;  3HFZ B;  3PQI A;  1HFG A;  2QEX A;  4DNT B;  1K0S A;  3OMC A;  4L5Q A;  1ET6 A;  2IHE A;  1PDQ A;  1K83 H;  4R4I A;  5FLX L;  2IT1 A;  5DNF A;  2N88 A;  5ELN A;  1PRT F;  2RVL A;  2XWB B;  2R7Z G;  1PFS A;  2NVQ B;  1X3Q A;  3N52 A;  2KQ3 A;  4LF6 Q;  3S16 B;  1VQK A;  1QWY A;  1Q90 A;  1BKB A;  1EY8 A;  1B4O A;  5M3M B;  1YIJ A;  4L63 B;  3P1H A;  4F8M A;  1YJW A;  1EQQ A;  2KA7 A;  3FEW X;  3FHW A;  2EYO A;  1A15 A;  3S14 B;  3NEN A;  2JEA I;  5K5P A;  3FKI G;  4NDX A;  3A54 A;  1HNZ Q;  4A3E G;  4CHT B;  1X6O A;  3F2U A;  1KC8 C;  4APV A;  3MFY A;  3BJU A;  1QVC A;  5HY6 A;  2DGY A;  1VQC A;  3UDI A;  2PZU A;  3T1Y Q;  1JE4 A;  1XWE A;  2D5D A;  4LUV A;  5JEA G;  2I07 B;  4DV3 L;  1LT4 D;  1DOM A;  1U9R A;  5IYB H;  3K57 A;  1N36 Q;  1PH6 A;  3ITP A;  3QOL A;  1L1O C;  1IYJ B;  2A1A A;  2PZT A;  1WTO A;  2DNC A;  3T56 B;  3S1R B;  1O7I A;  4NP5 A;  2OTL A;  3W5O A;  2PQE A;  1SNP A;  2JYO A;  3D6W A;  4DR5 L;  3HGB A;  4AYB E;  3ULL A;  4X65 L;  4L5T A;  1V43 A;  1R4P B;  1S5D D;  5LHY 1;  4C2M H;  2Y0S B;  2B2V A;  5IT9 E;  2UUB Q;  1MKH A;  1VQP A;  2EDG A;  3S2D H;  2RF4 A;  5FLX E;  4YCV A;  2NBF A;  4LFB Q;  3QB3 A;  3NWS A;  1EYC A;  3BDC A;  2EY5 A;  4DU9 A;  5KGU A;  4RMF A;  4X62 L;  1JC7 A;  4A3B H;  5G3L D;  1Z47 A;  4S3S A;  4GOP B;  1E7Z A;  3DXJ C;  3MXG A;  5CYU A;  2Q2U A;  2UU9 Q;  1DZ1 A;  1V1P A;  2O4X A;  5FJ8 G;  3SE0 A;  3CC2 A;  3KLS X;  4LWC A;  2H1E A;  2ZTD A;  3X3N A;  1L0Y B;  1GM5 A;  1FR3 A;  2XTI A;  1XPO A;  1I4G A;  4G7Z C;  1A8V A;  5J1Z A;  3U9O A;  4FYD A;  4QF4 A;  1RL2 A;  1VQJ A;  2OF1 A;  2LS0 1;  3A55 A;  4IJL A;  1QNU A;  3KK7 A;  4XQJ A;  2D0O A;  1PYS B;  4G57 A;  1YBY A;  1XNR Q;  1C9O A;  2MUY A;  1IKM A;  2F0V A;  3VYR A;  1F9Q A;  4KTA A;  3PIO 3;  4GKJ L;  4EQP A;  2MO0 A;  4X66 L;  1F2M A;  1YEZ A;  4X64 L;  1A6X A;  1D1I A;  3OSO A;  4X6A H;  1TWC H;  4U68 A;  1NNX A;  3S2H B;  2DY8 A;  5C3X A;  3JC6 6;  1G91 A;  4GZY C;  1TR5 A;  3HOZ B;  4A3B G;  3RZO B;  2KCM A;  2CQO A;  1SN8 A;  1LAB A;  4GNX A;  3LX0 A;  1EZ6 A;  4J1M A;  2FJ2 A;  2Q8R E;  4GKK L;  3F2B A;  4POF A;  5DAU A;  3RLF A;  4H02 A;  3VYS A;  1B44 D;  1CHP D;  4DK6 C;  2VW9 A;  3TS2 A;  5ELE A;  1TQO A;  2NVX B;  4DK1 A;  2FMC A;  2C35 B;  3CCJ A;  1HZ9 A;  1SXT A;  5M3F B;  4JW0 A;  2DJG C;  4DV5 L;  2FMM A;  4UHV A;  1PYB A;  2WP8 J;  3IFT A;  4DR1 L;  1GKH A;  1PTO D;  4KMU C;  3H91 A;  4FXG C;  1KAA A;  2IPK D;  2AKW B;  4I7Z C;  1YZ6 A;  4DF7 A;  3KJP A;  1JT8 A;  4JI8 Q;  1LYL A;  2JQO A;  1Y8O B;  3T51 B;  2RSN A;  5KNC A;  3QO2 A;  4A3J B;  3G71 A;  4WJ4 A;  3KDF A;  4BA1 I;  5JJZ A;  2RKS A;  2N49 A;  2K5Q A;  1Q82 C;  1PYW D;  2K05 A;  2NVY B;  1B8A A;  1EQT A;  3F8T A;  4IOC A;  1WTX A;  1IHZ A;  2LSS A;  5M5W B;  1P8L A;  1ZKO A;  2ZXO A;  1U4R A;  1AP0 A;  3Q23 A;  1Q3L A;  2AQ1 B;  3I4N B;  2F0U A;  2F4I A;  2EQS A;  1RJT A;  1ICW A;  1MIU A;  2F52 A;  1Y1W B;  1E22 A;  4QB4 A;  3K8A A;  5I6W A;  3L9A X;  4Y7N B;  1FJG L;  2PO4 A;  1LTT D;  4K8J A;  3QG1 A;  1EEI D;  1PHJ A;  3Q8D A;  3KOJ A;  3CAM A;  4AH6 A;  4DR6 L;  1QZH A;  3TZU A;  1F2Y A;  4UP8 A;  1XTC D;  1CKM A;  2QGQ A;  4B3R L;  5KYI A;  2WAQ E;  3J80 E;  1MSH A;  4A3D H;  1FNW A;  3PUY A;  1UE7 A;  3E3X A;  4HMI A;  3KUP A;  4NPS A;  4AQY L;  2LMC B;  4K6D A;  2IX3 A;  3AFP A;  4C3H H;  5AJ3 Q;  4BBS B;  3BG3 A;  1WD1 A;  3ND9 A;  2PCF B;  1N32 Q;  5C0X J;  4IQZ A;  2ES2 A;  1E2V A;  5EKL A;  2DY7 A;  4ME3 A;  4HID A;  2PMZ B;  5I6Y A;  2HCI A;  1N34 L;  1EY7 A;  4R4C A;  2R61 A;  3U4V A;  1ZXT A;  4O2D A;  1ROD A;  2F0Q A;  1F77 A;  3MWY W;  1RKN A;  1QUQ B;  4UDU C;  3MEH A;  5IOC A;  4OL7 A;  2E2I B;  1ZYR D;  4OEL B;  1UEA B;  2VNU D;  2NTS A;  4DR3 L;  3OHX C;  4JV5 L;  3RNU A;  1CKN B;  3R3O A;  5BN5 A;  4JBK A;  2EY6 A;  2Q2I A;  3TRZ A;  4X3U A;  1HA6 A;  4LAA A;  4BY1 B;  2JK8 A;  4J8Q A;  1CA6 A;  1I6H B;  1TY0 A;  4HJ5 A;  4A3D G;  4CGY B;  1O7Y A;  4AYB G;  2EPB A;  1TWA B;  4A3L G;  1LTA D;  4A3I B;  5NUC A;  4NKL A;  1HR0 W;  3CCL A;  4C3H G;  1C48 A;  2K7V A;  2JA7 H;  1ENA A;  2K1B A;  5D3D A;  3CKI B;  4BY7 B;  4ZQ3 A;  2L12 A;  5CV5 A;  2MGS A;  4XXE A;  1HA5 A;  4TRD A;  4JYA L;  4IJH A;  3CPF A;  3OW7 A;  3NPP A;  5IYD H;  1SLJ A;  3S1Q B;  2F03 A;  1HNX L;  4LW1 A;  3J81 L;  4JI4 L;  5D14 A;  3AEV A;  2CH4 W;  2HCC A;  3L0O A;  4ZYS A;  4RGM A;  4DNR B;  1B3A A;  2G9D A;  2UUC L;  1T9H A;  3PF5 A;  1SND A;  4RG1 A;  4K5V A;  1JWS D;  2ZTC A;  4NW2 A;  3JAM E;  5KEE A;  4HAE A;  4DUZ L;  1SE8 A;  3IL8 A;  4RCO A;  4C3I G;  2ASB A;  4M8A A;  2D9U A;  3FDT A;  1QZG A;  4WRD A;  2KJX A;  4NXM L;  3MXN B;  5FLX c;  3DUZ A;  4DK3 C;  5HGT A;  2R93 B;  2L11 A;  4DR5 Q;  1NUC A;  4RH6 A;  4BA2 I;  4JG2 A;  4IUU A;  1X3P A;  1F9R A;  1AE2 A;  1M4V A;  3KFU A;  2A69 D;  1TU2 B;  4X65 Q;  3DWP A;  3S1N B;  1VF7 A;  1JOQ A;  3B6Y A;  4XYO A;  1Y8N B;  3BDL A;  2IJ0 A;  1Q86 C;  1Z9F A;  5CV7 A;  1PA6 A;  3C46 A;  5JAV A;  5ELF A;  3TEH B;  2QA4 A;  2CWA A;  1WTP A;  1UAP A;  4X62 Q;  2YYZ A;  1TWF H;  2B2U A;  1TY2 A;  1VMP A;  2M00 A;  3CME A;  2JN4 A;  1SAP A;  3PO3 H;  1LO5 D;  5LMN W;  4MNO A;  3CQZ B;  3MAQ A;  4CKB A;  4MZ9 A;  3R2I A;  3H0G H;  1VQ7 A;  3DMU A;  4C2M B;  3OTO L;  4CDE C;  4JOI C;  3S2D B;  4HSP A;  3HOV H;  2JE6 I;  5GRO A;  1E24 A;  1NTG A;  2UXB Q;  2RCF A;  5JPN C;  1SNO A;  4TVA B;  1X65 A;  1LM0 A;  2EVB A;  4ZKB B;  5LL6 X;  4GOP A;  3VA7 A;  1HXY D;  4Z9C B;  3HEJ A;  1SJE D;  3M4Y A;  3K7A B;  2RBM A;  1LT5 D;  2K5V A;  1PH9 A;  4QGU A;  2KHJ A;  1YVC A;  1WI5 A;  2QF7 A;  1K0R A;  3PUX A;  2EY2 A;  3UE0 A;  3NXW A;  2JEB I;  3SGI A;  4DGZ A;  1PMR A;  1GHJ A;  1PTO C;  2O5I C;  3VR6 A;  1A62 A;  1LTG D;  1N9W A;  2O2L D;  4UP7 A;  3BZD B;  2EJF C;  3EJI A;  2CW0 D;  1HCZ A;  1EOT A;  2PNH A;  1YJ9 A;  3NTI A;  1N8R C;  3PO3 G;  3HKZ E;  1SE4 A;  5IP7 H;  1SYE A;  2K03 A;  1L1O B;  4KN4 C;  4AIM A;  2PZW A;  1R9T H;  3HOY H;  3PO2 H;  4K0K Q;  4G4K A;  5EBC A;  4PMW A;  2ZJQ A;  1CUK A;  4QUF A;  1XMO L;  3TP6 A;  1HPC A;  3ERO A;  1E2W A;  2C9O A;  1TWC B;  2UXD Q;  3SVM A;  4CDC C;  2E2H H;  2WAQ G;  3MFG A;  3MHB A;  3OMG A;  4PMC A;  2LFN A;  2N55 A;  3GTK B;  3S1M B;  2ENB A;  4PQX A;  5K36 H;  1ASY A;  3V05 A;  4DN4 M;  3GTO H;  3GTL H;  5J22 A;  1CHQ D;  2LXJ A;  1I94 L;  1KRT A;  5EKI A;  4Q5V A;  1MSG A;  4LF7 L;  1BOS A;  4BWG B;  4O1N A;  2M9V A;  4JBW A;  1PFN A;  5F2D A;  4A3K H;  2Q8I B;  1EYG A;  1EL0 A;  3SHL A;  1G29 1;  4DA2 A;  2HD3 A;  2NVT H;  4ZKC B;  4J6H A;  1TS3 A;  1STG A;  1LTL A;  2F0S A;  5FO7 B;  5HUR A;  4FF3 A;  3GTP B;  2E74 C;  4A3G H;  1KDA A;  2F0L A;  5IP7 G;  2XN9 C;  1IL2 A;  3L3O C;  1PTO H;  2JA8 G;  2JA5 B;  3J80 c;  2Q2H A;  3MVV A;  3HOY G;  1HR0 L;  3PO2 G;  1F9P A;  1GJX A;  2RA4 A;  3EVQ A;  4P2C B;  3L7Z C;  4JBM A;  3GTQ H;  2EJM A;  1ET9 A;  1UE6 A;  3KF6 B;  2ZM6 L;  2F1M A;  2WB1 E;  5FKA C;  4HR7 B;  2B2Y A;  1I6V C;  2BH8 A;  3I73 A;  4JK1 C;  3LWU A;  4CJ2 C;  5C5M A;  1BCP D;  1ML0 D;  1O78 A;  3ZYY X;  1KXL A;  4DUY L;  1VQ4 A;  1NCV A;  1K8O A;  2VUM B;  3BYT B;  1EU4 A;  4A4I A;  4HJ7 A;  1D6E C;  1ZYR C;  1GUW A;  1SYB A;  1NBW A;  3HZX A;  1C4Q A;  2F0J A;  2N3S A;  2XSC A;  2Z6K C;  4A3M B;  2UUA L;  1CSQ A;  3NQT A;  4QMG A;  1X3F A;  5CC4 A;  5I2X A;  1J8I A;  4A3K G;  1GUG A;  4JI7 Q;  2J7Z A;  4DV1 Q;  1N34 Q;  2F0G A;  1KDB A;  2EE1 A;  3TQY A;  4A3G G;  1Z7T A;  1AZQ A;  4JI3 L;  3K6O A;  3FKI H;  4EQN A;  4A3D B;  1EU3 A;  1U4P A;  2MP1 A;  1XJV A;  2KHS A;  2RCN A;  1CZW A;  2Z6B A;  1I4P A;  4C3J G;  3CF5 A;  4DR3 Q;  2EYF A;  4V19 0;  1U5K A;  1Q8K A;  4JV5 Q;  1T5X D;  4KKS A;  4QCL A;  1IBL Q;  4QQB X;  4KD3 A;  1XNQ L;  1WJJ A;  2FIN B;  1FL0 A;  5C3W A;  5JEA H;  4RGN A;  1D2B A;  4LF5 Q;  1QB5 D;  3KF8 A;  3HOU H;  5C4X H;  1YJN A;  1XXG A;  1SE2 A;  1VF5 C;  4H7B A;  3OWF A;  2L0C A;  4CBV A;  1S5F D;  3BU2 A;  2K32 A;  1SNC A;  4YWM A;  4YHH Q;  2E8G A;  4XT1 B;  4L5R C;  1M8A A;  1ESF A;  3WOF A;  3SK6 A;  1JOR A;  1CKN A;  1U4L A;  5LMN L;  3CW2 C;  3ND8 A;  2K14 A;  4IZ8 A;  4DK0 A;  1JCK B;  4JYA Q;  2E5L L;  2GVB A;  4DR2 Q;  3JAM c;  1TS5 A;  4P73 A;  1HNX Q;  4EVO A;  1VQO A;  2A69 C;  2WV6 D;  3BYY B;  3H6M A;  1K28 A;  4R4Q A;  1GUS A;  4K5X A;  1B53 A;  1C7Y A;  2HQL A;  3I4M H;  1X3E A;  3HRZ C;  1MD2 D;  1R4Q B;  2BDO A;  2JA7 B;  4GLX A;  1JIC A;  4PV1 C;  4LUZ A;  3G48 A;  1YIT A;  4ZCK A;  1TS4 A;  2K52 A;  4HED A;  1ONL A;  2SOB A;  2L4N A;  5FJ8 H;  3FPU B;  1GVP A;  1CQV A;  2ATW A;  2EYL A;  4NXM Q;  4GN3 B;  2K28 A;  1PH5 A;  3HOU G;  5C4X G;  1HTP A;  2NN6 I;  2B2W C;  4FF4 A;  2K4K A;  1Y1V H;  3CXC A;  4HCE A;  2ID0 A;  1CT1 D;  5D3I B;  3Q6S A;  1A3T A;  3G6J B;  1SFO H;  1D8L A;  1GO3 E;  2A73 B;  2PYK A;  1W6K A;  3UDG A;  4Y52 H;  1WTQ A;  3PSI A;  4L6T B;  4PZ6 A;  2A8V A;  4R8N A;  2JP1 A;  5BR8 L;  1P16 A;  3E0J A;  2QKI C;  2B63 G;  3MXN A;  2I5M X;  3HKZ G;  3J81 j;  5D65 A;  5EPL A;  1LT6 D;  4F87 A;  3I4M G;  1J5E L;  1Z6H A;  1NMF A;  3KLR A;  5IGG A;  4WFN 3;  2JXM B;  1SMY D;  1S40 A;  2RSO A;  1XTD A;  2E2J H;  4BBR H;  4IUQ A;  3T1H L;  1B1Z A;  4JI5 Q;  3GTG B;  4QL5 A;  1O80 A;  3P75 A;  3OTO Q;  3H15 A;  2FFK B;  4YWK A;  1CA5 A;  1N33 L;  2CW0 C;  3K58 A;  3A0J A;  2UXC L;  4P72 A;  4LFA L;  2ICE C;  3CD6 A;  1V1Q A;  1Y1V G;  4EQO A;  2K5H A;  1TWF B;  3UE1 A;  4NMZ A;  3W2D A;  4OHJ A;  1PRT D;  5M5Y H;  1I5F A;  1XMQ Q;  4C1N K;  5IP9 G;  4PG3 A;  3M3Y B;  1VQE A;  3PO3 B;  4OWX B;  2VQE Q;  1NJI C;  5JJI A;  1VS0 A;  1HQM C;  3H0G B;  3K5O A;  2G5D A;  3W3A A;  3HOV B;  4DV0 L;  1L2F A;  2R3Z A;  2WAQ B;  4L8J A;  5EPJ A;  2F4V L;  1ASZ A;  2OEO A;  1RTO A;  3CCE A;  2YU9 H;  4LF9 Q;  5H1S E;  3MTS A;  1SR3 A;  4BS9 A;  4BBR G;  2MPM A;  2D2C C;  2QEJ C;  4XTC S;  4XQN A;  2WB1 G;  5CBA E;  1SRU A;  4OO1 G;  1STE A;  1PH7 A;  1IW7 D;  3J7Y W;  2AUK A;  2HHH L;  3VR2 A;  1ESR A;  2QCP X;  5C44 H;  1H9S B;  2ZJP A;  1U0L A;  2Z0S A;  2GA4 B;  4ILW A;  4LF4 Q;  2IX0 A;  3GQB A;  1I94 Q;  3D0F A;  2HQE A;  5DM6 3;  1L1O A;  4LF7 Q;  3RLO A;  2F0D A;  4N8F A;  4DAV A;  2JA6 G;  1DCZ A;  1JE5 A;  1S4Z A;  4G7O C;  3HOW B;  1LV9 A;  3I72 A;  1QVF A;  3HOY B;  3PO2 B;  2WFW A;  1WVL A;  5HGQ A;  1KQS A;  1VQI A;  4G7H C;  3M85 A;  1BCP C;  4IUV A;  3NSW A;  2E2H B;  1S5C D;  3NK9 A;  2OQK A;  2Y0S E;  3ERS X;  3BZC A;  2F0K A;  3GV3 A;  3NEM A;  3VR3 A;  1GD7 A;  3GTL B;  3GTO B;  5T1I A;  1QNK A;  1UE5 A;  1K73 C;  1B7Y B;  3DHQ A;  4JI2 Q;  1BR9 A;  3NBI A;  4A93 H;  2NTT A;  4XIG S;  4CJ1 B;  1IBK L;  1I3Q H;  4A3K B;  1J9O A;  1WD0 A;  2CH4 A;  3S15 B;  4KHP L;  1JJ2 A;  5C44 G;  3CRL C;  1PLF A;  3OOC A;  4N9P A;  1HNW Q;  1GXD C;  3CRK C;  4UPA A;  4A3F B;  3K5L A;  4A3G B;  3PGZ A;  4FVM A;  1VQH A;  5IGD A;  1PH4 A;  1PH2 A;  3TP5 A;  2AWN A;  5GAG C;  1PTO B;  2UUA Q;  2PPB C;  1IBM L;  1RDP D;  4A3L H;  2F0M A;  4XT3 B;  4B9W A;  3KF6 A;  2R92 H;  5I4D A;  2VQF Q;  4GS3 A;  2SNM A;  2N78 A;  2OQ0 A;  3GDE A;  3PIP A;  4K2K A;  4KKU A;  3CMA A;  5CV6 A;  1CM9 A;  5CV4 A;  4JI3 Q;  3RZD B;  1GOZ A;  1OXX K;  1HHV A;  1LLR D;  2EXZ A;  1SJH D;  2I5H A;  2Z1C A;  3D6C A;  4GLV B;  3I91 A;  1FYC A;  3CU7 A;  1VQ5 A;  2AWO A;  1DJR D;  4I65 A;  4IPH A;  5ELD A;  4JI6 L;  3A5U A;  4A93 G;  1PV4 A;  2K04 A;  2CFM A;  1L0W A;  2R6G A;  4E6I A;  4JI1 L;  4K6L A;  2R7Z B;  3GV6 A;  4IFD J;  1KLG D;  3UDX A;  5FOB B;  5IOD A;  2B2U C;  2B29 A;  3I8Z A;  3RN2 A;  1JJG A;  2WAC A;  3BS1 A;  1E1T A;  1J6Q A;  1NE3 A;  3FKI B;  4C3I H;  1B3Q A;  1EUJ A;  4A3E B;  3CC7 A;  3C1E A;  2KOL A;  4WOR A;  4KK7 A;  1BF4 A;  2FHT A;  2R92 G;  2F3W A;  2ZT9 C;  3OW2 A;  4DV6 L;  2KCT A;  1IL8 A;  2A6H D;  3S16 H;  1DOK A;  3R2T A;  3CHB D;  4OWT B;  1AFP A;  5CBE E;  1BNZ A;  4IFD I;  4ODG A;  4LJZ C;  4IUR A;  2L15 A;  4HJ8 A;  1SYC A;  3ONA B;  4GOP C;  2F0O A;  4RGO S;  3H09 A;  1DM0 B;  1D5Z C;  1NAP A;  1QG7 A;  2Z4I A;  4OEM B;  3VR5 A;  3WWV A;  5EQ0 A;  1O7Z A;  2A5H A;  1X54 A;  1K83 B;  2KCN A;  2MO1 A;  3SK5 A;  4DXF A;  4DAY B;  4DV3 Q;  3TP7 A;  4H0L C;  1JWM D;  5I2Y A;  1I4Q A;  4IPC A;  5IWA L;  5A2Q L;  3I70 A;  4X3S A;  2BA1 A;  4KY6 A;  3QJY A;  2EJG C;  3IKJ A;  5ELC A;  3G4S A;  1HNZ L;  1SMY C;  1TWG H;  3CP0 A;  5M5X H;  2TSS A;  3PMF A;  3GTM H;  3DM3 A;  3DEP A;  2ZJR A;  2L9H A;  3NHH A;  4H13 C;  1VQ9 A;  3HP3 A;  5JJL A;  5M3M G;  4B9X A;  4XQQ A;  5CV9 A;  2OT2 A;  1VDZ A;  1RF2 D;  1PXU A;  1K3R A;  1PRT C;  4IUN A;  2PMZ E;  2DN8 A;  1GUN A;  3U50 C;  1N36 L;  1QE6 A;  4B08 A;  4DV2 L;  4DV7 L;  3K0Y A;  1X56 A;  2AUJ D;  4LMQ D;  1FGB D;  1SFO B;  3GO5 A;  1VQ8 A;  5DM7 3;  4CKC A;  2D62 A;  4EGV A;  5E7N A;  1HFN A;  4MN3 A;  1B9N A;  3GTJ H;  4UP9 A;  3J81 E;  4QIW B;  1EIG A;  2L1B A;  1BO0 A;  4LFB L;  2J0T D;  2KEN A;  3BZK A;  1Q7Y C;  1HQR D;  4A3B B;  4CDD C;  1VQG A;  2JA9 A;  4J15 A;  2UU9 L;  3W1G A;  4GKJ Q;  1RD9 D;  1EY5 A;  4X66 Q;  1IW7 C;  1BBW A;  4X64 Q;  2Y0S G;  2B2Y C;  4KV6 A;  4R9W A;  3U4Z A;  4IOA A;  5E3F A;  3A74 A;  4DV0 Q;  3S2H H;  2JJQ A;  2F4V Q;  2E2D C;  1WFQ A;  1YNJ D;  3A7A B;  1EIY B;  4ZUJ A;  2OXP A;  3HOZ H;  1IYU A;  3RZO H;  1KTK A;  3TDQ A;  4LNQ A;  5M5Y B;  1MGS A;  2DUD A;  1HUM A;  4GKK Q;  2OCE A;  1FGU A;  4KY7 A;  3QOJ A;  2NZ1 D;  3EA6 A;  1JMC A;  1XNR L;  1NR2 A;  1TKW B;  2JA8 H;  1NSN S;  4I7A A;  5C0X H;  2EXD A;  1TII D;  4O0A A;  3M4O H;  1VQD A;  1G2S A;  4C56 C;  5M3F H;  1F2L A;  2F0N A;  1ZEQ X;  4JCV E;  1ENF A;  1V1O A;  3I4L A;  1TS2 A;  4DV5 Q;  3WDN A;  4RHS A;  1V8Q A;  2V4D A;  3T4A C;  1A2T A;  2BOS A;  3VDY A;  5FO8 B;  4ZUI A;  4DR1 Q;  1I4X A;  2ZTE A;  1PFM A;  2CWP A;  4A3J H;  2PQA B;  1Y69 U;  3PUZ A;  1CI3 M;  2X6L A;  2B2T C;  4B3M L;  1O7L A;  3AYH B;  5ISR A;  3UI2 A;  2NVY H;  3F1Z A;  3NP8 A;  4R4T A;  3PUW A;  3P20 A;  5AFW A;  1LTB D;  4RGT A;  5A35 A;  2MHV A;  3HOZ G;  1D5X C;  4WJW A;  2ICI A;  4KI0 A;  1SNM A;  3E5S A;  4A3C H;  1E1O A;  3D4D A;  1SNQ A;  1WCM H;  4FP5 D;  4HJA A;  2DNE A;  1MBY A;  5JVH 3;  2C5C A;  1EIF A;  2BDN A;  1FJG Q;  4LK1 C;  5C0X G;  2P5Z X;  1HZC A;  1TWH H;  1W3S A;  2BH2 A;  3FRP B;  4TKO B;  5M3F G;  2KUM A;  4KHP Q;  4C3J H;  1BXT A;  3S17 H;  4HIM A;  1OO9 B;  4DR6 Q;  1VMC A;  1NR4 A;  3V2T A;  3N6R A;  2RHQ B;  1MI2 A;  2KEE A;  4QJF A;  4B3R Q;  2HIV A;  3BVG A;  4KJN A;  2Q2T A;  2E76 C;  4MIU A;  2A74 C;  4A3J G;  1MJE A;  1H9R A;  4Q0F A;  4AQY Q;  4A93 B;  3CCS A;  1DON A;  3EN2 A;  1AZP A;  2OTJ A;  4JC0 A;  1CQF A;  3PCO B;  3BVZ A;  1W2B A;  5EJW A;  4P75 A;  1WTR A;  1IKL A;  2AMC B;  4YIJ A;  1MJC A;  4FNF A;  1W6J A;  4A3C G;  5GQO A;  2LXK A;  3KLW A;  4B3T L;  1A2U A;  3I4N G;  3E9H A;  1WCM G;  1MHW C;  3AMU A;  1BDO A;  1STN A;  2K01 A;  1DD2 A;  2NZO A;  2VZA A;  1CKO A;  1RTN A;  2A6H C;  2F0I A;  1FD7 D;  4AYB B;  1T5E A;  3FPP A;  1KL9 A;  2F0E A;  3NWT A;  1L0X B;  1FNU A;  3LNN A;  4TQU S;  5DLQ E;  3NUC A;  2B2V C;  4C3H B;  5IYC H;  5E1F A;  5T1G A;  2L5T A;  4KLK A;  3PV0 A;  1AEX A;  4MHE A;  4BY1 H;  4YWL A;  3ERQ A;  4LFC L;  5C4J H;  2LY7 A;  4ALP A;  1S72 A;  1QUQ A;  3BDO A;  4A3I H;  4HMJ A;  4BBS G;  4DV6 Q;  1FVI A;  3VA5 A;  1YI2 A;  4HIO A;  4FXD A;  3RR5 A;  5G3L F;  3LGJ A;  4BY7 H;  1B2T A;  4CKE A;  3K80 C;  5L37 A;  1B50 A;  1UWV A;  1I4R A;  3A5Z B;  2XWJ B;  5DEH A;  4WJ3 M;  1EYA A;  1RCV D;  3KLS A;  5C5L A;  3BVM A;  3SDZ A;  3S1Q H;  4NXN L;  5LL6 S;  4DPG A;  2B63 H;  1KRS A;  2EYM A;  4C3I B;  5ELO A;  5C4H A;  3PUV A;  4JI4 Q;  5IT9 L;  2AQ3 B;  1UEB A;  4OX9 L;  3U58 A;  2ALY B;  2M2L A;  3J7A 5;  4EX5 A;  3LWE A;  2UUC Q;  3I55 A;  3CCQ A;  5IYC G;  4R4O A;  2GVA A;  2VS1 A;  1K8G A;  4X3T A;  3W1B A;  3QWN A;  4KJO A;  5IWA Q;  4FF1 A;  1EY9 A;  4BY1 G;  2K5D A;  1EOV A;  4DUZ Q;  1EQV A;  4HCS A;  3NTK A;  5C6A A;  4GNX C;  2NWG A;  1KAB A;  3J7Z C;  4DR7 L;  4A3I G;  2R93 H;  3PIP 3;  3Q22 A;  3ULJ A;  2VY3 A;  3EFX D;  3E9I A;  2KHI A;  4DAY A;  3S1N H;  5IP9 H;  4BY7 G;  1Q1B A;  3HG9 A;  1Q8I A;  1PH3 A;  4B3S L;  1E0B A;  2Z6K A;  1SYF A;  5KIX A;  2AQ2 B;  1B70 B;  2F0P A;  3NTH A;  5CGK A;  2RHS B;  3DM1 A;  5JPM C;  3J81 c;  1G6Z A;  5EKK A;  5KND A;  1SEB D;  3NBH B;  3UDF A;  4DV2 Q;  4RA8 A;  1DGS A;  4QY7 A;  4DV7 Q;  1AH9 A;  1PZK D;  4A76 A;  1QJO A;  1TWG B;  2R7F A;  5M5X B;  2Z4H A;  3CC4 A;  3GTM B;  1PTO F;  2HT1 A;  3E6Z X;  5M9O A;  3CQZ H;  5TSS A;  5CV8 A;  5KRU A;  3H3V C;  1G2T A;  3A8I E;  1YNJ C;  4OO1 H;  1YHB A;  2HDL A;  4JBJ A;  2F3V A;  4DAP A;  2RDG A;  4RKB A;  4JI0 L;  2R93 G;  3NEL A;  1KAW A;  1HTL D;  3TRE A;  3QIA A;  3DWQ A;  2A68 D;  1M1K C;  3NE5 B;  2A6E D;  1E3P A;  5EGT A;  1K8A C;  4YY3 L;  3URY A;  2AHO B;  2EYH A;  3K7A H;  3AFQ A;  2QIL A;  4PNY A;  4F7X A;  2B8F A;  2YTX A;  1GUO A;  3A56 A;  3AU7 A;  1TVX A;  2JA6 H;  4DKA C;  5IYB G;  2B39 A;  2PNR C;  3RUZ A;  1XPR A;  1U4M A;  3GTJ B;  4IO9 A;  1EIH A;  1VQL A;  4PMB A;  4R1J A;  2XNA C;  1XYI A;  4GN4 B;  2OWO A;  1LT3 D;  3CPW A;  2CCZ A;  1DOL A;  2MFI A;  2UXB L;  3SXH A;  3CCM A;  3U9S A;  1F9S A;  2D0P A;  4OWW B;  3C2P A;  1AN8 A;  3E0E A;  2XGT A;  1NY4 A;  4ID6 A;  1X32 A;  4ZRZ A;  4HN7 A;  3STB D;  5C4Z A;  2EYP A;  1G6P A;  1XMO Q;  4N9T A;  1II3 A;  3CCR A;  5COY A;  2WIN B;  3GTK H;  3S1M H;  3MZ5 A;  3RN5 A;  1I50 H;  1D1K A;  3H3V H;  4R8I A;  5COR A;  2PI2 A;  2YV5 A;  4O42 A;  1I4H A;  1AE3 A;  2B2W A;  5IIF A;  2BE5 D;  1WTH A;  2KVM A;  1PRT B;  4FF2 A;  1OXS C;  1Q46 A;  3TBI B;  3J80 i;  4B3M Q;  3IAY A;  2JA8 B;  1JQY D;  2IWH A;  4DV4 L;  3J80 L;  5LMU L;  1BVS A;  1C8C A;  1ENC A;  1R9T B;  3M4O B;  4K0K L;  1HZA A;  1C0A A;  2XRQ D;  2UXD L;  5EBD A;  1OXU A;  3G6E A;  1EWI A;  3GTP H;  3Q24 A;  4DXG A;  1LTR D;  1EYD A;  4CJ0 B;  1DYQ A;  2YTV A;  3OWE B;  5KYL A;  1WTV A;  1IZ6 A;  1PZI D;  2PQA A;  5C3E H;  2JA5 H;  5GAH C;  1YNX A;  3S9W A;  1HR0 Q;  4XYQ A;  2HIX A;  1CSP A;  5IY0 A;  2KBN A;  3D8G A;  4DNI A;  4IUT A;  2ZM6 Q;  4ABN A;  3HOX H;  1H9K A;  1M90 C;  3P7J A;  3RMH A;  5FLM H;  2NN6 H;  5ELB A;  4DFA A;  2NVT B;  2PW5 A;  1S5E D;  1E2Z A;  1STB A;  4DUY Q;  2WKD A;  1PVO A;  1HH2 P;  2VUM H;  1WCM B;  5KNB A;  1QCB D;  1RHP A;  1SSO A;  4IAL A;  4A3M H;  3MC0 B;  4IPD A;  1A63 A;  3RLN A;  2IY5 B;  1TWH B;  3V96 A;  3GTQ B;  3DWA A;  4C3J B;  3MXP A;  5I9P A;  2K5W A;  3OIP A;  3K5M A;  3S17 B;  4F88 A;  4KD4 A;  1X9N A;  4B3T Q;  4LF8 L;  4ZK9 B;  1RIP A;  1A0I A;  3S24 A;  1D7Q A;  1KLU D;  4KN7 C;  5GAD C;  1WYD A;  5C3E G;  2JA5 G;  1EY6 A;  2I46 A;  3DLL A;  3H94 A;  3TZD A;  1EWH A;  1UE1 A;  2YTY A;  2E75 C;  3K59 A;  1K9M C;  1PFB A;  3KYH C;  4RKL A;  2NZH A;  3T53 B;  1PH8 A;  3HOX G;  4DR4 L;  4JI7 L;  2CQA A;  5FLM G;  4DV1 L;  5BN3 A;  2NN6 G;  1XNQ Q;  4LFC Q;  1JJC B;  2HUG A;  2QDL A;  4FDB A;  1JB7 A;  2VUM G;  2L55 A;  3JAM i;  1YNN D;  2NUC A;  1OXV A;  3EQL C;  3KF8 B;  3JAM L;  3OYY A;  4A3M G;  4K8I A;  1X3G A;  1CTM A;  5IGE A;  2BA0 A;  1VQ6 A;  4C1N I;  3AB9 A;  1VCI A;  3IRB A;  3ZJY C;  1TT2 A;  1GHK A;  5LMN Q;  3J7A V;  2NVQ H;  5I9O A;  4GLA C;  5C0X I;  2F0W A;  2R7D A;  5M3M H;  2E5L Q;  3RD4 A;  3K81 C;  5IE8 A;  1IBL L;  3TS0 A;  3VYU A;  4NXN Q;  1PZJ D;  4V0B A;  3A8K E;  5FK9 C;  5C4J B;  3S14 H;  4NB3 A;  2JSO A;  3G7L A;  3C1F A;  1LTS D;  1Q1E A;  4MTN A;  1WTW A;  4LF5 L;  4OX9 Q;  3HOU B;  5C4X B;  1UNS A;  3CCV A;  1H9J A;  2F0T A;  1G51 A;  2Q8T A;  3HKS A;  4RFB A;  4YHH L;  3FP9 A;  2EOT A;  1KIX A;  1HZB A;  3TN2 A;  3L2P A;  3T16 A;  4CDF C;  2VB2 X;  2V1C C;  3FVQ A;  4LF6 L;  4XDX A;  2EY1 A;  1SDF A;  1D5M C;  4H44 C;  2K75 A;  2KEC A;  3C3L A;  3J81 i;  4DR2 L;  4DR7 Q;  3SK8 A;  2B63 B;  4N8X 1;  1BBX C;  3S1R H;  4HJ9 A;  1CK1 A;  3HKZ B;  4ZLT F;  3PIO A;  1H95 A;  1VQF A;  2F3I A;  2RDF A;  1EEF D;  3Q0A A;  1QIL A;  4RCN A;  3I4M B;  1EFW A;  1FNV A;  1SBB B;  4RHR A;  4B3S Q;  4UY8 C;  5JJK A;  2B8G A;  3K5N A;  3T1Y L;  1S3O A;  2ZXR A;  1HUN A;  2O5J C;  5BR8 Q;  1H9M A;  1SMX A;  1XX8 A;  3R93 A;  4DAM A;  1EZ8 A;  3M7N A;  5IT9 c;  1EFI D;  3I7F A;  2A68 C;  2A6E C;  1HJP A;  3M4P A;  3HS0 C;  1QOH A;  2K6A A;  2IHF A;  1S5B D;  3D4W A;  1CZG A;  1J5E Q;  2JA7 G;  1Y1V B;  5GAE C;  1KNE A;  2B3G A;  2K33 A;  2X6G A;  2XIW A;  4QUC A;  2EYJ A;  3T1H Q;  3GTG H;  3M9B A;  3GP7 A;  3K0X A;  2DJF C;  3SK4 A;  2F0H A;  4IPG A;  1N33 Q;  1V1P B;  4JI0 Q;  2SEB D;  3D31 A;  5IYD G;  1Q81 C;  2UXC Q;  4U67 3;  3OPO A;  3NBH A;  4LFA Q;  5JEA J;  5J39 A;  2UUB L;  2IL8 A;  1VQN A;  2RQX A;  4M1U B;  3F2C A;  2QDB A;  4EQ5 A;  4YY3 Q;  4ZAI A;  3STB C;  3M3Y H;  2XRS D;  1JOK A;  4HSV A;  1Y8P B;  5A2Q E;  2E2J B;  4BBR B;  5FO9 B;  3J7A F;  5IGB A;  1UUP A;  2TMP A;  4JI5 L;  3MXU A;  4ME5 A;  4ULL A;  1ILQ A;  5EAY A;  3FMC A; 
#chains in the Genus database with same CATH homology
 4TQU S;  3U4V A;  5IP9 G;  4PG3 A;  4O2D A;  1VQE A;  4OWX B;  4YCU A;  2VQE Q;  5IYC H;  3ER0 A;  1EQR A;  1QUQ B;  1KHI A;  1TXY A;  1NJI C;  4PZ7 A;  4KLK A;  3PV0 A;  5JJI A;  1VS0 A;  4BY1 H;  4YWL A;  4KHZ A;  1X55 A;  4LFC L;  5C4J H;  4ALP A;  2CKZ B;  1XMQ L;  1S72 A;  1SRO A;  4POG A;  2VNU D;  3EBE A;  4DR3 L;  1QUQ A;  4P74 A;  4GNX B;  4DV0 L;  1L2F A;  4JV5 L;  1VQA A;  3RNU A;  1CKN B;  2VQE L;  4A3I H;  2F4V L;  3TRZ A;  4JBK A;  2Q2I A;  4BBS G;  1ASZ A;  4DV6 Q;  3CCE A;  2NVX H;  2YU9 H;  1FVI A;  4LF9 Q;  1YI2 A;  4HIO A;  5H1S E;  2JK8 A;  2H5X A;  1SR3 A;  3RR5 A;  4HJ5 A;  4BBR G;  2HHH Q;  3LGJ A;  3ULP A;  4A3D G;  4BY7 H;  4AYB G;  3K80 C;  3I56 A;  4XTC S;  4A3L G;  1IXR A;  2WB1 G;  1UWV A;  3I2Z A;  1SRU A;  4OO1 G;  3A5Z B;  1HR0 W;  4WJ3 M;  1Q12 A;  3CCL A;  2MQH A;  2JA7 H;  1XPU A;  1OXT A;  4LF9 L;  1YHA A;  3S1Q H;  4NXN L;  2B63 H;  4DPG A;  1PH7 A;  1KRS A;  5ELO A;  2HHH L;  3PUV A;  4JI4 Q;  4DV4 Q;  1UEB A;  3H0G G;  4OX9 L;  5C44 H;  5LMU Q;  3HOW H;  4LUO A;  2ZJP A;  3U58 A;  1U0L A;  2ALY B;  2Z0S A;  3M4Q A;  4LF4 Q;  1WOC A;  2IX0 A;  3PF4 A;  3J7A 5;  1YHQ A;  4YCW A;  4EX5 A;  1I94 Q;  3D0F A;  2UUC Q;  4IJH A;  3HOV G;  4JYA L;  3CPF A;  1L1O A;  3KDF B;  3I55 A;  3CCQ A;  5IYD H;  1SLJ A;  5IYC G;  4LF7 Q;  4R4O A;  2GVA A;  2VS1 A;  1K8G A;  3RLO A;  1HNX L;  4LW1 A;  3W1B A;  5M5W H;  2JA6 G;  5IWA Q;  4JI4 L;  1JE5 A;  4BY1 G;  3CCU A;  1EOV A;  3AEV A;  1QVF A;  4LF4 L;  4DUZ Q;  2WFW A;  3L0O A;  1KQS A;  5HGQ A;  1VQI A;  4GNX C;  4BXX H;  3I4N H;  2UUC L;  3M85 A;  1T9H A;  3PF5 A;  3J7Z C;  3KJO A;  2K5N A;  4RG1 A;  4DR7 L;  4A3I G;  2R93 H;  3AQQ A;  2OQK A;  4JI8 L;  2Y0S E;  3ULJ A;  4Y7N H;  1Y1W H;  3ERS X;  2VY3 A;  2ZTC A;  3BZC A;  1IBK Q;  3E9I A;  3NEM A;  1PH1 A;  2KHI A;  1GD7 A;  4DUZ L;  1SE8 A;  5IP9 H;  2ASB A;  3S15 H;  3S1N H;  4BY7 G;  1Q1B A;  1QZG A;  3F2D A;  4NXM L;  3MXN B;  5FLX c;  1PH3 A;  1UE5 A;  1K73 C;  4B3S L;  1B7Y B;  4DK3 C;  2Z6K A;  4JI2 Q;  4A3F H;  4DR5 Q;  4A93 H;  4BA2 I;  4QIW E;  4JG2 A;  1LUZ A;  1AE2 A;  3KFU A;  1BBU A;  4XIG S;  1IBK L;  4JOI A;  2A19 A;  1B70 B;  1I3Q H;  4X65 Q;  2RHS B;  3GD7 A;  3J81 c;  1OTC A;  1NMG A;  3I4O A;  1IBM Q;  3MEF A;  1JJ2 A;  4KHP L;  3NBH B;  3UDF A;  5C44 G;  4DV2 Q;  1KD1 C;  4DV7 Q;  1DGS A;  3B6Y A;  4QY7 A;  3HOW G;  4L5S A;  1HNW Q;  1AH9 A;  4A76 A;  4JI2 L;  4GN5 A;  4UPA A;  4OXP A;  1Q86 C;  1Z9F A;  2R7F A;  4BBS H;  4IFD G;  2I5L X;  1PA6 A;  3CC4 A;  3PGZ A;  1VQH A;  1PH4 A;  2N8N A;  1PH2 A;  2HT1 A;  3TEH B;  2QA4 A;  2CWA A;  3K7U C;  3CQZ H;  1Y14 B;  2AWN A;  5GAG C;  4A75 A;  4LF8 Q;  2UUA Q;  3ICE A;  4OON A;  4X62 Q;  4OO1 I;  3RZD H;  2YYZ A;  1TWF H;  1VQB A;  2GN5 A;  1IBM L;  2I0Q A;  5K36 G;  4A3L H;  1HNW L;  3CME A;  3KF6 A;  2R92 H;  4BXX G;  1YHB A;  4JBJ A;  3PO3 H;  2VQF Q;  4GS3 A;  4JI0 L;  2N78 A;  5LMN W;  2R93 G;  2OQ0 A;  3NEL A;  3GDE A;  4MNO A;  3PIP A;  4JI6 Q;  2EIF A;  3CMA A;  1Y1W G;  1KAW A;  4MZ9 A;  4JI3 Q;  3TRE A;  3H0G H;  1VQ7 A;  2E2I H;  1OXX K;  4P71 A;  2PI2 E;  1M1K C;  4DR4 Q;  1E3P A;  4JI1 Q;  1K8A C;  4YY3 L;  3OTO L;  2AHO B;  2I5H A;  3K7A H;  4GLV B;  3AFQ A;  4JOI C;  5AJ3 L;  2R7Z H;  1VQ5 A;  2AWO A;  3HOV H;  2JE6 I;  4IPH A;  2K50 A;  5GRO A;  2VQF L;  5J3B A;  1E24 A;  1NTG A;  1N32 L;  2UXB Q;  2YTX A;  4HIK A;  4A3F G;  4JI6 L;  3A5U A;  4A93 G;  1PV4 A;  2CFM A;  4TVA B;  2JA6 H;  1X65 A;  1LM0 A;  2MNA A;  4DKA C;  5IYB G;  4GOP A;  1XPR A;  1I6H H;  1L0W A;  4PZ8 A;  4IO9 A;  2R6G A;  1VQL A;  4R1J A;  4JI1 L;  4GN4 B;  2K5V A;  2OWO A;  3CPW A;  1TWA H;  4QGU A;  3UDX A;  4A3E H;  1PH9 A;  2CCZ A;  4IFD J;  2MFI A;  2KHJ A;  1YVC A;  2UXB L;  1WI5 A;  1K0R A;  2B29 A;  1QVG A;  3PUX A;  3CCM A;  3RN2 A;  2IX1 A;  1JJG A;  2D0P A;  3UE0 A;  2JEB I;  3SGI A;  1E1T A;  4OWW B;  1J6Q A;  1NE3 A;  4C3I H;  3E0E A;  2XGT A;  1A62 A;  1NY4 A;  1N9W A;  3STB D;  4UP7 A;  1EUJ A;  3EIV A;  1V9P A;  3CC7 A;  1G6P A;  1XMO Q;  2VL6 A;  2R92 G;  2PNH A;  3OW2 A;  1YJ9 A;  1VQM A;  1N8R C;  4DV6 L;  3PO3 G;  2FXQ A;  2KCT A;  3CCR A;  3S16 H;  3H3V I;  3HKZ E;  3HFZ B;  5IP7 H;  4OWT B;  2QEX A;  3GTK H;  3S1M H;  1L1O B;  3RN5 A;  1I50 H;  4L5Q A;  4IFD I;  4AIM A;  2IHE A;  2L15 A;  1K83 H;  4R4I A;  3H3V H;  1R9T H;  3HOY H;  3PO2 H;  4HJ8 A;  2IT1 A;  4PMW A;  2PI2 A;  4GOP C;  1CUK A;  2YV5 A;  5ELN A;  1XMO L;  2ZJQ A;  1AE3 A;  2R7Z G;  1PFS A;  2UXD Q;  4LF6 Q;  2E2H H;  2WAQ G;  1OXS C;  1Q46 A;  1VQK A;  3J80 i;  1BKB A;  4B3M Q;  3WWV A;  1YIJ A;  1YJW A;  1EQQ A;  4DV4 L;  3FHW A;  1BVS A;  1X54 A;  5LMU L;  1ASY A;  4K0K L;  3NEN A;  2JEA I;  1HZA A;  2MO1 A;  3FKI G;  3GTO H;  3GTL H;  1C0A A;  2LXJ A;  1I94 L;  1HNZ Q;  2UXD L;  1KRT A;  4A3E G;  1OXU A;  4DAY B;  3G6E A;  1EWI A;  4LF7 L;  4DV3 Q;  1X6O A;  3GTP H;  1KC8 C;  4APV A;  4IPC A;  3BJU A;  1QVC A;  4JBW A;  5HY6 A;  5IWA L;  2DGY A;  2YTV A;  1VQC A;  3UDI A;  3T1Y Q;  2BA1 A;  1IZ6 A;  4A3K H;  1EYG A;  2PQA A;  5C3E H;  2JA5 H;  1G29 1;  3G4S A;  1HNZ L;  5GAH C;  1YNX A;  4LUV A;  5JEA G;  1HR0 Q;  2NVT H;  2HIX A;  1CSP A;  5IY0 A;  4DV3 L;  1TWG H;  2KBN A;  3CP0 A;  4DNI A;  5M5X H;  1LTL A;  4A3G H;  3GTM H;  3DM3 A;  1VQ9 A;  2ZJR A;  5IYB H;  5JJL A;  5IP7 G;  1N36 Q;  1PH6 A;  2ZM6 Q;  1IL2 A;  1L1O C;  1IYJ B;  2A1A A;  5M3M G;  3HOX H;  2JA8 G;  1M90 C;  1O7I A;  3J80 c;  2Q2H A;  2OTL A;  5FLM H;  3W5O A;  3HOY G;  1HR0 L;  3PO2 G;  4DR5 L;  3L7Z C;  4DUY Q;  4JBM A;  3GTQ H;  1PVO A;  1HH2 P;  2VUM H;  1K3R A;  1UE6 A;  4AYB E;  2PMZ E;  3KF6 B;  1N36 L;  3U50 C;  2ZM6 L;  3ULL A;  4X65 L;  4L5T A;  2WB1 E;  1V43 A;  4IPD A;  4A3M H;  2BH8 A;  4DV2 L;  1A63 A;  3RLN A;  4DV7 L;  4C2M H;  2IY5 B;  1X56 A;  2UUB Q;  1MKH A;  1VQP A;  1KXL A;  3S2D H;  4DUY L;  1VQ4 A;  2RF4 A;  3GO5 A;  4A4I A;  4YCV A;  1VQ8 A;  4HJ7 A;  4LFB Q;  2D62 A;  1NBW A;  4RMF A;  1X9N A;  4B3T Q;  5E7N A;  2Z6K C;  2N3S A;  2UUA L;  4LF8 L;  4X62 L;  1CSQ A;  1RIP A;  4A3B H;  1A0I A;  3S24 A;  1D7Q A;  3GTJ H;  1X3F A;  4UP9 A;  5GAD C;  1WYD A;  1Z47 A;  4A3K G;  4JI7 Q;  4GOP B;  5C3E G;  1E7Z A;  2JA5 G;  2Q2U A;  2UU9 Q;  4DV1 Q;  5FJ8 G;  3DLL A;  1N34 Q;  4LFB L;  3CC2 A;  1UE1 A;  2YTY A;  3TQY A;  4LWC A;  2KEN A;  3BZK A;  1K9M C;  1Q7Y C;  4A3G G;  2ZTD A;  1GM5 A;  3KYH C;  4JI3 L;  1VQG A;  2JA9 A;  2NZH A;  1PH8 A;  3HOX G;  4DR4 L;  2XTI A;  4JI7 L;  3FKI H;  1XPO A;  4J15 A;  2UU9 L;  1A8V A;  3W1G A;  4GKJ Q;  5FLM G;  4DV1 L;  1XJV A;  4X66 Q;  2NN6 G;  1XNQ Q;  1BBW A;  4X64 Q;  1JJC B;  1RL2 A;  1VQJ A;  2RCN A;  2Y0S G;  4LFC Q;  3U4Z A;  4IOA A;  4IJL A;  4FDB A;  3A74 A;  1JB7 A;  3CF5 A;  4DR3 Q;  3JAM i;  2VUM G;  2D0O A;  4DV0 Q;  1U5K A;  1PYS B;  1Q8K A;  1YBY A;  2JJQ A;  3S2H H;  4JV5 Q;  1XNR Q;  2F4V Q;  1OXV A;  1C9O A;  1WFQ A;  3KF8 B;  3OYY A;  4A3M G;  1IBL Q;  1X3G A;  1EIY B;  3HOZ H;  4QQB X;  2BA0 A;  3RZO H;  4GKJ L;  2MO0 A;  4X66 L;  1XNQ L;  5DLQ E;  1VQ6 A;  1WJJ A;  1YEZ A;  1FL0 A;  4X64 L;  1VCI A;  4LNQ A;  3IRB A;  3ZJY C;  4X6A H;  2DUD A;  1TWC H;  5LMN Q;  4GKK Q;  2NVQ H;  4LF5 Q;  4GLA C;  3HOU H;  2OCE A;  5C0X I;  5C4X H;  1FGU A;  1YJN A;  1JMC A;  1XNR L;  2R7D A;  5M3M H;  3JC6 6;  2JA8 H;  2E5L Q;  3BU2 A;  3K81 C;  5IE8 A;  1IBL L;  4A3B G;  4YWM A;  4YHH Q;  2KCM A;  2E8G A;  2CQO A;  2EXD A;  1SN8 A;  3TS0 A;  4L5R C;  4O0A A;  4NXN Q;  1VQD A;  4GNX A;  3S14 H;  3M4O H;  4NB3 A;  5M3F H;  1CKN A;  5LMN L;  3CW2 C;  4GKK L;  1Q1E A;  2K14 A;  4MTN A;  3F2B A;  4POF A;  4LF5 L;  4JCV E;  4OX9 Q;  3RLF A;  4H02 A;  4DV5 Q;  3CCV A;  1G51 A;  4DK6 C;  3VDY A;  4DR1 Q;  4JYA Q;  3HKS A;  2VW9 A;  2E5L L;  3TS2 A;  2GVB A;  4YHH L;  4DR2 Q;  2ZTE A;  3JAM c;  3FP9 A;  4P73 A;  2C35 B;  1HNX Q;  3CCJ A;  1HZ9 A;  1KIX A;  1HZB A;  1VQO A;  2CWP A;  3L2P A;  4A3J H;  2PQA B;  4R4Q A;  3PUZ A;  4LF6 L;  2V1C C;  4DV5 L;  1C7Y A;  1PYB A;  4B3M L;  2WP8 J;  2HQL A;  3AYH B;  4DR1 L;  1X3E A;  1GKH A;  3I4M H;  2K75 A;  4GLX A;  2AKW B;  2NVY H;  3F1Z A;  3J81 i;  4R4T A;  3PUW A;  4LUZ A;  3KJP A;  1YZ6 A;  3G48 A;  4DR2 L;  4DR7 Q;  1JT8 A;  4JI8 Q;  1LYL A;  2JQO A;  3S1R H;  1YIT A;  4HJ9 A;  3HOZ G;  2K52 A;  3PIO A;  5FJ8 H;  1VQF A;  4KI0 A;  1GVP A;  2F3I A;  3G71 A;  4WJ4 A;  4A3C H;  1H95 A;  3KDF A;  4BA1 I;  2ATW A;  1E1O A;  1EFW A;  2N49 A;  4GN3 B;  1PH5 A;  4NXM Q;  3HOU G;  1WCM H;  1Q82 C;  5C4X G;  4B3S Q;  4HJA A;  2NN6 I;  4UY8 C;  1B8A A;  4K0K Q;  5JJK A;  3F8T A;  3T1Y L;  2K4K A;  4IOC A;  1EIF A;  2LSS A;  1S3O A;  1FJG Q;  1P8L A;  1Y1V H;  5BR8 Q;  3CXC A;  1SMX A;  2ID0 A;  5C0X G;  1HZC A;  1TWH H;  4DAM A;  1W3S A;  2BH2 A;  3M7N A;  5M3F G;  5IT9 c;  1SFO H;  1D8L A;  1GO3 E;  3I7F A;  4KHP Q;  4C3J H;  3UDG A;  3S17 H;  4Y52 H;  1HJP A;  4HIM A;  3M4P A;  4DR6 Q;  3PSI A;  2EQS A;  4PZ6 A;  2A8V A;  2IHF A;  1MIU A;  2F52 A;  1E22 A;  1FJG L;  3K8A A;  2RHQ B;  1J5E Q;  2JA7 G;  5BR8 L;  1P16 A;  5GAE C;  4QJF A;  4B3R Q;  2B3G A;  2HIV A;  2B63 G;  2I5M X;  2Q2T A;  3T1H Q;  3HKZ G;  3J81 j;  3GTG H;  4A3J G;  3M9B A;  1PHJ A;  1MJE A;  3Q8D A;  3KOJ A;  3K0X A;  3CAM A;  4AH6 A;  4DR6 L;  1QZH A;  4IPG A;  4AQY Q;  3CCS A;  1XMQ Q;  1N33 Q;  3EN2 A;  3I4M G;  1J5E L;  2OTJ A;  1NMF A;  4JC0 A;  4UP8 A;  4JI0 Q;  1CKM A;  3PCO B;  2QGQ A;  3D31 A;  5IYD G;  1W2B A;  1Q81 C;  2UXC Q;  4B3R L;  1S40 A;  4LFA Q;  4P75 A;  1XTD A;  2WAQ E;  5JEA J;  2E2J H;  4BBR H;  2UUB L;  4A3D H;  3T1H L;  2AMC B;  3PUY A;  1UE7 A;  1MJC A;  4JI5 Q;  1VQN A;  4QL5 A;  3F2C A;  4A3C G;  4EQ5 A;  4YY3 Q;  5GQO A;  3OTO Q;  2LXK A;  3KLW A;  3H15 A;  4NPS A;  3STB C;  4AQY L;  4B3T L;  4YWK A;  1N33 L;  5AJ3 Q;  3I4N G;  3M3Y H;  3AFP A;  3E9H A;  4C3H H;  1WCM G;  3A0J A;  1N32 Q;  2UXC L;  5C0X J;  4P72 A;  2ES2 A;  4LFA L;  3CD6 A;  2NZO A;  2VZA A;  1CKO A;  1V1Q A;  1Y1V G;  4ME3 A;  2K5H A;  4HID A;  4JI5 L;  1KL9 A;  3UE1 A;  1N34 L;  4R4C A;  5EAY A;  5M5Y H;  1I5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...