3T1HQ

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3t1hQ00
1N8RC 4K0KQ 1UE1A 4A3EH 5M3MG 5IYDH 3HOVH 3ER0A 3UE1A 2BA1A 4YY3L 3HOXG 3CQZH 2WAQE 1N34Q 5JEAG 2EIFA 2UXCQ 1E1TA 1HH2P 4JI8L 2VW9A 3H15A 1OTCA 2E5LQ 1B8AA 4MTNA 5IWAL 4A3FH 5FLMH 3LGJA 3U4ZA 3HOWH 3GTKH 4AH6A 1J5EQ 4PG3A 1CSPA 2B29A 1U0LA 4GKJL 1VQJA 1VQCA 1X3GA 4LFBQ 1KHIA 1Z47A 4OONA 3F2DA 2R6GA 4QGUA 1PH4A 1PH5A 5JJIA 1OXSC 1B7YB 4DAMA 1KIXA 5GAGC 2KHIA 3CC4A 3ERSX 2NN6I 1N32Q 3F2CA 2K5VA 3J7ZC 4B3TL 2N49A 4DV7L 3GTLH 1IBKL 2PQAB 2VUMG 2DGYA 1XNQQ 4NB3A 1WFQA 3TREA 2AWNA 3L2PA 1K8GA 2UUBL 4JI0L 3HOZH 4DV1Q 1VQ8A 1YNXA 2K75A 3CD6A 1UEBA 4DR5Q 4JYAL 1VQNA 5FLXc 1C7YA 1SR3A 5M3FG 2YYZA 2BH2A 2WP8J 4DV3L 3HOYG 3GTPH 4HIDA 2K5HA 4R4IA 3H0GG 4BBRH 4DR7L 1QVCA 4DR4Q 5IP9G 4X65Q 3CCUA 1XMOQ 4K0KL 1QZGA 1VQIA 4QIWE 2Y0SE 3M4QA 4DPGA 3CCSA 1HNXQ 4FDBA 1IBLQ 2VQFQ 1JE5A 2H5XA 4Y7NH 1NJIC 1HR0W 2R7ZG 1OXVA 1WCMG 2NZOA 2V1CC 3WWVA 4DV5Q 4UY8C 1EOVA 1N34L 2UXCL 4KLKA 2JA9A 2E5LL 5HY6A 2JA7G 2GVAA 2VQEQ 3KF6B 4WJ4A 5K36G 3I4NH 1X65A 5AJ3Q 2ZTCA 4DV2Q 2JA8H 3CP0A 4X6AH 1J5EL 2VZAA 3AYHB 2KCMA 2B3GA 1VQFA 3TS2A 2ZJPA 1A63A 4LFBL 2NN6G 4JI3Q 1G291 2VY3A 3KOJA 3E0EA 5M5XH 2LXKA 3F2BA 1H95A 3K0XA 1X54A 2Q2IA 5C3EG 2HQLA 2D0PA 4A3JH 4KHPQ 1N32L 1AH9A 3U50C 2PMZE 1XNRQ 3U4VA 5HGQA 3KFUA 1XNQL 1T9HA 1CKNA 3CCJA 1PH6A 1K9MC 3NEMA 4DV1L 2AMCB 3HOXH 1E1OA 1VQEA 4DR5L 1PH9A 2ES2A 1Q1BA 2ZJRA 1XJVA 1CSQA 5J3BA 1VQBA 4OX9Q 4LF6Q 4BBSG 1X55A 1PYBA 4DR4L 4X65L 1XMOL 1GKHA 4A3IG 1HNXL 2PNHA 1IBLL 3UDXA 2VQFL 1K3RA 3BZKA 1NMFA 2VL6A 1UWVA 1L1OA 4DV5L 5C0XJ 1Q7YC 2R92G 5IYCG 2QA4A 4DUZQ 3PF4A 3SGIA 3GTJH 4PZ6A 2VQEL 3KLWA 3I4OA 4HJ7A 5C4XG 1C0AA 4TQUS 4GLVB 3STBC 3FKIH 5AJ3L 1BVSA 4RG1A 4DV2L 4LF7Q 2ATWA 2Z0SA 1WYDA 4YHHQ 4POGA 2R93H 2F52A 1NE3A 3STBD 1R9TH 4A3GG 4LUOA 4JI3L 3RNUA 2CQOA 4B3RQ 1YJWA 4A4IA 2K4KA 2MO0A 4KHPL 4APVA 4UP7A 4R4CA 1XNRL 2BH8A 3T1YQ 4AQYQ 1VS0A 1Y14B 3PUZA 3AQQA 4HIOA 1A62A 2LSSA 4JI7Q 1WCMH 3A5UA 4TVAB 5JJLA 2EXDA 1KRSA 4HIMA 1E7ZA 3CAMA 2KENA 4P73A 4QL5A 4YWMA 4C3HH 4OX9L 3K7UC 4GNXB 3HKZE 4GOPA 5BR8Q 1EIYB 4LF6L 1X6OA 3S1RH 3I4MH 4BXXH 1I50H 2JE6I 4A3DG 2AWOA 2AHOB 2XTIA 4NPSA 4R1JA 4DR2Q 1M1KC 1JB7A 4LF4Q 1L0WA 1WI5A 1KC8C 3K80C 1PH7A 4HJ9A 4JI1Q 3GO5A 5FJ8G 3OYYA 4DV6Q 3RZDH 1N36Q 2OTLA 2IHEA 1LTLA 2N8NA 4C2MH 5C0XI 3M85A 1RL2A 2JEBI 4DUZL 3H3VI 4J15A 4IOAA 1SMXA 4OWXB 3KJPA 3PIOA 2ZTEA 5C3EH 3J81c 1PHJA 2IX1A 3PO3H 1AE2A 4DV4Q 2HT1A 4PZ7A 4IFDJ 2B63G 1TXYA 1W3SA 1HZ9A 3MEFA 1G51A 2EQSA 1PH1A 4YCVA 3AFPA 4LF7L 1X9NA 4YHHL 4DUYQ 5GAEC 3RLNA 2E2HH 4HIKA 1EQQA 5C4JH 4JBMA 4IPDA 1PA6A 1L1OC 1S3OA 1I6HH 3W5OA 2UU9Q 4A3KH 4LNQA 3M7NA 2RF4A 2N78A 1JJGA 4B3RL 2IY5B 3M4OH 1Q46A 1M90C 2XGTA 2HHHQ 3M3YH 1Y1WG 1SE8A 4HJ5A 4BBSH 3PO2H 3G71A 2OWOA 4DK6C 3T1YL 1XPUA 4A3LG 1BBWA 4AQYL 3OTOQ 2PQAA 2HIXA 2A1AA 2OTJA 4JI7L 4LUVA 3J81i 4KHZA 2WB1G 1HR0Q 2A19A 4R4QA 2L15A 5IYCH 2KHJA 4P74A 1S72A 3RZOH 2C35B 4IPHA 3S14H 1WOCA 4QJFA 5BR8L 5LMUQ 3W1GA 4L5TA 4BY1G 5C4XH 3HKSA 2QEXA 5LMNW 1KXLA 1D7QA 1SROA 2CKZB 5C0XG 4R4TA 3DLLA 3A74A 4DR2L 4LF4L 1YZ6A 1Q81C 1YI2A 2GN5A 4QQBX 1PFSA 3JAMc 4JI6Q 4JI1L 5IYBG 1N36L 5IY0A 4DV6L 4LF5Q 4EQ5A 4A3GH 4EX5A 1V9PA 4A3BG 4Y52H 4IOCA 2UXDQ 4A93G 4MNOA 3OW2A 4GOPC 1ASYA 1E22A 4DKAC 1XTDA 3PUWA 4DV4L 1IYJB 1VQMA 3EBEA 2IHFA 1RIPA 3K8AA 1OXUA 2JA5G 1GO3E 4B3MQ 4P72A 1LYLA 1YVCA 3CCMA 1VQGA 3S15H 4UP8A 4DUYL 1YEZA 2E2IH 1KD1C 2JA7H 1KQSA 3VDYA 2UU9L 1Y1VG 1MIUA 1ASZA 3GDEA 2MFIA 4A3EG 3B6YA 2D62A 5M3MH 5IYDG 3K81C 1EQRA 3UDIA 2HHHL 1Q1EA 3JAMi 3G6EA 4JI5Q 1CKMA 4NXMQ 1HZCA 3PUVA 3OTOL 2F4VQ 4DV0Q 3E9IA 2ASBA 3ICEA 3IRBA 1V43A 4A3FG 4UP9A 1OXXK 5FJ8H 1MJEA 1HR0L 2ZJQA 4B3SQ 3HOWG 3PUXA 1IBMQ 3T1HQ 1PV4A 1CKNB 1YITA 4JC0A 2PI2E 3GTOH 5LMUL 1EYGA 3D31A 1AE3A 1K83H 4BA1I 1VQPA 2JQOA 4YWKA 1NBWA 4XTCS 4ALPA 1HJPA 3W1BA 5GROA 5ELNA 2HIVA 4OWWB 1UE5A 4JI4Q 2QGQA 1OXTA 3BZCA 4JI6L 4LF5L 4AIMA 1X56A 1K0RA 2JJQA 1A8VA 2K14A 4X64Q 1U5KA 1UE6A 1X3EA 4YCWA 2WFWA 1L2FA 4PMWA 1I94Q 4MZ9A 2GVBA 3ULPA 3MXNB 2YU9H 3PV0A 5EAYA 2VUMH 3CMEA 4WJ3M 1UE7A 3HOZG 5GQOA 1Y1WH 1I3QH 2OQKA 2CCZA 1TWFH 1VQKA 4A3CG 4OO1I 4LF9Q 4B3ML 2I5LX 3AEVA 1SFOH 2PI2A 2Z6KC 4KI0A 1QUQA 5M3FH 3HOYH 4A3LH 4LW1A 2VNUD 1J6QA 3I7FA 4GLAC 3S17H 5ELOA 3CCEA 3HFZB 3S1NH 3S2DH 2BA0A 5IE8A 3H0GH 3EIVA 5IP9H 1VQ5A 3J81j 1FVIA 1GD7A 3BU2A 1TWAH 3G4SA 4A76A 1JT8A 1GVPA 3UDFA 2R7ZH 2UUAQ 2YV5A 3ULLA 4HJAA 4JI5L 2YTVA 1VQOA 4NXML 5M5YH 1NY4A 1YHBA 2YTXA 1Q86C 4GLXA 4JOIC 2F4VL 4DV0L 2K50A 4A3MG 3NBHB 1QVFA 2UXDL 4B3SL 3KDFB 3JC66 4LF8Q 4A3BH 1IBML 3T1HL 4C3IH 2JA8G 1FL0A 3TS0A 2LXJA 4YWLA 1VQAA 5GAHC 2ZM6Q 4H02A 3PGZA 4GS3A 2MQHA 1YBYA 1D8LA 3RLOA 5DLQE 3RLFA 4GOPB 4X66Q 4A75A 4JI4L 1CKOA 3PUYA 4A3JG 4X62Q 3HOUG 1Z9FA 1EUJA 4X64L 5H1SE 1IL2A 4C3JH 3J7A5 1I94L 4L5QA 4IJHA 4OO1G 5IP7G 3GTQH 4QY7A 4JG2A 2WAQG 3TRZA 3Q8DA 4O0AA 1VQ4A 4NXNQ 3D0FA 1Q12A 4LF9L 2E2JH 4RMFA 3S1MH 3CMAA 4LFCQ 2I5MX 1YJNA 1W2BA 1EFWA 2RHQB 1N9WA 2DUDA 4GN5A 1VQ6A 1YHQA 3L0OA 1VQHA 2OQ0A 4OXPA 4A3IH 2NVTH 1XMQQ 1KAWA 4L5SA 1G6PA 3RN5A 2JA6G 3K7AH 5E7NA 3CC7A 4DR1Q 2UUAL 1EWIA 1VQ7A 2KBNA 1K8AC 4DR7Q 3S2HH 3PIPA 5LMNQ 2R92H 3J80c 2RCNA 4UPAA 4P75A 1P8LA 3FP9A 1FGUA 1SRUA 2WB1E 2JEAI 1KL9A 3E9HA 1HZAA 2KCTA 4P71A 4LF8L 3FKIG 4POFA 1LUZA 2Q2UA 2Z6KA 1I5FA 2CWPA 3GD7A 3EN2A 4DR3Q 3GTGH 4JBWA 4DR6Q 1NTGA 2R93G 1XPOA 1C9OA 1TWCH 3UE0A 2ZM6L 4A3CH 4AYBG 2A8VA 2R7DA 4BY7G 2CFMA 4BA2I 4X66L 4JV5Q 2D0OA 3S24A 1SLJA 2Y0SG 1PH3A 4AYBE 4X62L 3CPWA 2UUCQ 1KRTA 1TWGH 4IFDI 1P16A 1VQ9A 4GKKQ 2K5NA 3F1ZA 3KF6A 4DK3C 2UXBQ 1MJCA 1S40A 3J80i 1BKBA 4JOIA 3PF5A 4IPGA 3I2ZA 2Q2HA 4NXNL 4GNXC 4L5RC 5C44G 3A0JA 1IXRA 5JEAJ 2NZHA 3M9BA 1CUKA 2E8GA 4GN3B 4LFCL 3CC2A 1PYSB 4YCUA 1JJCB 2MNAA 4BXXG 1EIFA 2IT1A 4IJLA 3U58A 4A3MH 1N33Q 3I4MG 3HOVG 4HJ8A 2RHSB 3UDGA 4A3DH 3CCVA 1IZ6A 1XMQL 1FJGQ 1NMGA 3BJUA 3CF5A 4DNIA 1VCIA 4DR1L 1PH8A 2N3SA 5FLMG 2OCEA 5LMNL 1YJ9A 4PZ8A 2ZTDA 3CCRA 1YIJA 3NELA 1HNZQ 1PH2A 2ALYB 3HOUH 3PO3G 4JBJA 1V1QA 3S16H 5IT9c 2B63H 2NVYH 2VS1A 2IX0A 2F3IA 5IP7H 4IPCA 1QZHA 2I5HA 4DR6L 2I0QA 4LFAQ 4DR3L 1K73C 2K52A 1HNWQ 4OWTB 4JI2Q 1TWHH 4A3KG 3AFQA 3M4PA 3FHWA 4XIGS 3RN2A 3CW2C 4IFDG 2NVQH 1A0IA 3L7ZC 3RR5A 3I55A 1Q8KA 3KJOA 3S1QH 4JV5L 2UUCL 3PSIA 1L1OB 3PO2G 4R4OA 1JMCA 3G48A 1VQDA 3CPFA 4YY3Q 1QVGA 4GKKL 1JJ2A 3KYHC 2UXBL 4IO9A 2FXQA 3ULJA 4JI8Q 2JA6H 1X3FA 3GTMH 1MKHA 5GADC 5IWAQ 4BBRG 1O7IA 4ME3A 2R7FA 1GM5A 4DAYB 2JK8A 1BBUA 1N33L 1LM0A 1SN8A 3A5ZB 3CCQA 1Q82C 4BY1H 3PCOB 1DGSA 4GKJQ 1QUQB 1WJJA 4O2DA 1HZBA 1FJGL 2CWAA 5JJKA 3TQYA 2NVXH 3H3VH 1E3PA 1E24A 2Q2TA 4GN4B 3ZJYC 3CCLA 4JBKA 1PVOA 3DM3A 5IYBH 3KF8B 3TEHB 3F8TA 4B3TQ 3I4NG 4BY7H 3I56A 4DV7Q 4JCVE 1IBKQ 4A93H 1XPRA 1HNZL 2UUBQ 4JI0Q 1YHAA 2MO1A 4GNXA 3CXCA 1B70B 3KDFA 2JA5H 2YTYA 1VQLA 4JYAQ 3NENA 4DV3Q 4LFAL 1HNWL 4JI2L 5M5WH 2ID0A 3HKZG 4LUZA 5C44H 2AKWB 4LWCA 1Y1VH
chains in the Genus database with same CATH superfamily
3A8JE 5M3MG 5KYLA 1D5XC 4XT1B 3VR6A 3UE1A 3HOXG 1MSHA 1I4PA 1RCVD 2WAQE 4H7BA 2B39A 1E1TA 4LAAA 2E5LQ 1HTLD 5E4XA 5KNDA 1Y8PB 1LT3D 1PZJD 4UDUC 4QUFA 1X3GA 4A3DB 1EWHA 2R6GA 3VYRA 1PH4A 3D4DA 5LL6X 1PH5A 1PRTC 3DWPA 3URYA 4RGOS 1A3TA 3F2CA 1V8QA 2N49A 4IFDH 1D1KA 3BYYB 3GTLH 4IN3A 3L2PA 3A8IE 1VQ8A 1LACA 2R61A 1ZEQX 4KD4A 2G9HD 1C7YA 3HP3A 1EIGA 2YYZA 5IGBA 1DJRD 1SJHD 4NMZA 3I73A 4HIDA 4TSSA 2WACA 4RCOA 4DR7L 1VQIA 4QIWE 4DPGA 3CCSA 3BDOA 5DM73 1D2BA 1JE5A 2B8GA 1HR0W 4V0BA 1SNPA 2EYMA 1TY0A 4KLKA 2JA9A 2E5LL 1SFOB 2H1EA 2JA6B 4IUVA 5K36G 3I4NH 2SNMA 2GA4B 3SK6A 5AJ3Q 2JA8H 5IGDA 3RMHA 3QOLA 3LWEA 1A63A 5HGTA 2NN6G 5IT9L 3F2BA 1H95A 1LV9A 3PIO3 5C3EG 4GZYC 4A3JH 4KHPQ 1PTOH 1JR0D 2CH4W 3U50C 2PMZE 4KY7A 5HGQA 1T9HA 5CV5A 5FKAC 4A93B 1BO0A 2OEOA 2Y0SB 5I4DA 2B2UC 1PH9A 2ZJRA 4OX9Q 4FP5D 2EZVA 2K01A 4BBSG 1X55A 1EY7A 1KDBA 2F0EA 5C44B 2PNHA 4A3EB 1H9SB 1L0YB 5BN3A 2EYLA 3IL8A 1AZPA 3ND8A 2R92G 2HCIA 2EJFC 4PZ6A 2WKCA 1E2VA 1ESRA 3A7AB 4TQUS 2NTTA 4GLVB 4L6TB 5AJ3L 1CQFA 1HFNA 5ELBA 4YHHQ 1H9RA 2KUMA 2L5TA 5L37A 2CQOA 4A4IA 2MO0A 4KHPL 5KEEA 1HQRD 4R4CA 1U4RA 2IW3A 4AQYQ 2PW7A 3T16A 3AQQA 1JWMD 1A62A 1WCMH 1ILQA 4TVAB 5JJLA 2RKSA 4QL5A 4OX9L 2JA7H 1X6OA 3S1RH 3I4MH 2JE6I 4NW2A 5IIFA 5EKLA 2AHOB 2XTIA 4BBRB 1JB7A 4J8QA 1SYDA 2N88A 3OYYA 4DV6Q 3TN2A 2IHEA 4C2MH 4HR7B 3M85A 1GOZA 2IX1A 2ZTEA 5T1GA 3K59A 1RTOA 4IFDJ 4KD3A 2HT1A 1TXYA 1CHQD 1TS2A 1X9NA 4YHHL 1YNNC 1I6HH 4IPDA 4PQXA 1TY2A 4LNQA 5IGGA 2DY7A 3K5LA 2SOBA 5IT9E 3M3YH 4DK6C 4A3LG 1BBWA 4AQYL 2JYOA 4IUPA 2A1AA 2OTJA 3J81i 2WB1G 5EKIA 2L15A 4P74A 1GUGA 1H9JA 2C35B 3RZOH 1WOCA 3BZDB 4HMJA 3W1GA 4BY1G 3HKSA 2QEXA 4N8X1 2A6ED 3JAMc 5COYA 4LF5Q 1I4HA 5IY0A 4DV6L 4A3GH 2Q8IB 4A3BG 1ZYRC 4LJZC 1WTHA 2UXDQ 3I70A 4Y52H 3LX0A 4EQNA 5I6WA 2FMMA 1F9QA 4DKAC 1RIPA 3K8AA 4HEDA 3VR4A 4B3MQ 5C5MA 1G6ZA 2R93B 2NBFA 4CDEC 1ASZA 1R9TB 1FYCA 3B6YA 1DOKA 1SYCA 1KTKA 4ZYSA 1QILA 1HRJA 1CKMA 5C4HA 2ASBA 2RDGA 4O42A 2B2YC 1V43A 4UP9A 1OXXK 3TP7A 1PV4A 1CKNB 1MSGA 1UNSA 4JC0A 2L9HA 3SDZA 2PI2E 4FNFA 2F0GA 4BA1I 3PIP3 1NBWA 4ALPA 2HIVA 4LF5L 1K0RA 2JJQA 1A8VA 2F0FA 1X3EA 1UE6A 4YCWA 1I94Q 2UXDL 3ULPA 3QR8A 4TKOB 4WJ3M 2KVMA 3FEWX 1I3QH 1VQKA 1GXDC 1QNKA 2FMCA 5G3LD 4B3ML 3AEVA 1FNVA 4KI0A 5M3FH 1PFBA 1UUPA 2IJ0A 1BCPF 1UAPA 1O78A 1SE4A 2ZT9C 5E1FA 2E2HB 4A3KB 3BU2A 4CJ0B 3QB3A 1TWAH 3H6MA 1DXMA 1MBYA 1EU3A 1KLGD 2R7ZH 1IHZA 4OL7A 3NPPA 3MEHA 4GLXA 4JOIC 4IUTA 2K50A 4K6LA 1IKLA 3H09A 3KDFB 3AB9A 3C46A 1II3A 2JA8G 1FL0A 3ERQA 3SR1A 3R8BA 5GAHC 3S14B 1TKWB 4H02A 4GS3A 1YBYA 5DLQE 2MPMA 4X66Q 1CKOA 1CT1D 4A3JG 1ONLA 4FVMA 4C3JH 1VMCA 1I94L 1IL2A 3Q0AA 2B2VA 3I4NB 4JG2A 2WAQG 1QWYA 3W3AA 3Q8DA 3ITPA 4O0AA 4NXNQ 3TRZA 1Q12A 4RMFA 3CMAA 2O2LD 2I5MX 1YJNA 1W2BA 3H94A 4QMGA 1YHQA 4OXPA 1PDQA 2F3WA 1G6PA 3RN5A 2ZXRA 4ZCKA 4KTAA 1A3UA 3J80c 2RCNA 1NNXA 3S9WA 1FGUA 1SRUA 3E9HA 3JAML 1HPCA 5CYUA 2Q2UA 2AUKA 3EN2A 1XPOA 1C9OA 1TWCH 3FMCA 2A8VA 4G7ZC 2LFNA 4HSPA 4X66L 2D0OA 2UUCQ 4IFDI 1P16A 3NQTA 2K5NA 3F1ZA 4DK3C 1SMYD 2A69C 2UXBQ 4FF4A 1EZ6A 4C56C 5JPMC 3PF5A 4NXNL 4GNXC 1PRTF 4L5RC 1Y1WB 3A0JA 1TWFB 2OT2A 1CUKA 3FVQA 1PYSB 5C4ZA 4A3MH 2IT1A 4IJLA 4DGZA 1K28A 3I4MG 4A3DH 3S17B 3H0GB 1FJGQ 1JOQA 4F7XA 2N3SA 5FLMG 3A7LA 1YJ9A 4PZ8A 3ONAB 2AQ3B 3CCRA 5M5YB 1PH2A 3HOUH 2XRSD 1V1QA 3C1FA 2JA7B 3QOJA 5C3XA 1VDZA 2VS1A 2VB3X 3BVZA 2I5HA 4LFAQ 1S5FD 4H0LC 2N55A 3CW2C 2X6LA 3I55A 1Q8KA 3KJOA 2AQ2B 2UUCL 1I4RA 2EE1A 1VQDA 3CPFA 1QVGA 5A2QE 3KYHC 2UXBL 2JA6H 1MKHA 5GADC 3NK9A 1I6HB 1FNWA 1T5EA 1U4PA 2ZXOA 3DWAA 2R7FA 3S1MB 1BBUA 2B2WC 3CCQA 1EY9A 3PCOB 2F0QA 4HCSA 1WJJA 1HZBA 1PMRA 2K04A 4CHTB 1FJGL 4A3IB 2Q2TA 1PVOA 3ZJYC 1JWUD 5IYBH 3K7AB 4K2KA 3TEHB 3F8TA 4B3TQ 4JCVE 3S2HB 4A93H 2F0JA 3MXUA 2EVBA 1YHAA 2B2TA 3KDFA 1YNJD 2NTSA 2YTYA 3E0JA 4LFAL 1O7ZA 3D6WA 4HAEA 2ID0A 3F2UA 5C44H 2AKWB 3OMGA 1N8RC 2QF7A 4A3GB 4A3EH 5IYDH 4IALA 3VYUA 3HOVH 4H13C 3HGBA 1TWGB 1E2ZA 3HEJA 2EIFA 2VW9A 3H15A 3C1EA 4DXFA 1EL0A 1B8AA 2D9UA 3NP8A 1XYIA 4OGQC 4CKCA 3FDTA 3J80L 4PG3A 2QILA 1CSPA 3SXHA 2B29A 1U0LA 1AW7A 1VQJA 3QG1A 3BG3A 4IUQA 4OONA 1M8AA 2G5DA 2JP1A 4QGUA 4KK7A 4WORA 1B7YB 1X3QA 4DAMA 5GAGC 2KHIA 1KIXA 1TS5A 2RBMA 4B3TL 2PQAB 2AWNA 1K8GA 4I7ZC 1WD0A 1O7YA 3CD6A 5T1IA 1KDAA 3OOCA 3MXGA 1SR3A 2NVYB 5M3FG 1VQNA 2BH2A 2F0PA 4BBRH 1QVCA 4DR4Q 1LLRD 3NUCA 1ENAA 3L3OC 4KKSA 4FDBA 1B1ZA 2H5XA 4DNTB 2R7ZG 1OXVA 1TT2A 4N9PA 1I3QB 4G7HC 4DK1A 4C3HG 2GVAA 2VQEQ 3D4WA 4X6AH 3N52A 2B3GA 1TWAB 2ZJPA 4WRDA 1G291 3E0EA 1BCPC 2LXKA 4G7OC 3BDCA 3DWQA 4KN7C 2D0PA 5CBEE 4AYBB 1LT4D 4ZKCB 5AFWA 1K9MC 3NEMA 3VR5A 2ES2A 2J4XA 3MTSA 2JA5B 5KYIA 4NKLA 1E2WA 1PYBA 4DR4L 5M5WB 1GKHA 4C3JB 2CHBD 2VL6A 2EJMA 1DCZA 2OF1A 1Q7YC 2X69A 1PYWD 3CQZB 1BNZA 3WDNA 2Z4HA 2VQEL 3Q6SA 3X3NA 5C4XG 1C0AA 4RG1A 3GTKB 3V96A 2R93H 3V2TA 3J80E 4Q0FA 5EPJA 1R9TH 4LUOA 4CDDC 3RNUA 2KCCA 1GUWA 4B3RQ 1LTAD 1Y8OB 4DN4M 2IX3A 4MHEA 3TSSA 2LSSA 5FK9C 1WTWA 3A5UA 1X3PA 2Z6BA 1KRSA 5CMDA 3CAMA 1PTOF 3IKJA 2B8FA 3CU7A 4GOPA 3NE5B 3TP5A 4A3DG 4DU9A 3QO2A 3KBGA 3GTPB 4DR2Q 1M1KC 4LF4Q 2SEBD 1SJED 1WI5A 3BDLA 4K8IA 1B53A 3TZDA 4HJ9A 5C0XI 1RL2A 3H3VI 1AN8A 4J15A 3KJPA 4OWXB 2M00A 4DV4Q 2F0TA 4A3MB 3E5SA 1BCPB 3T13A 2EQSA 3AFPA 4QB4A 2E2HH 1LTBD 2QDLA 1EQQA 4JBMA 1PA6A 1E0BA 1L1OC 1S3OA 4A3KH 1G2SA 2PZWA 4B3RL 2Q8TA 4C1NK 5ELCA 2XGTA 4JVZA 1BOSA 2NUCA 5D3IB 3G71A 2OWOA 3HOUB 2PQAA 1EY4A 1AEXA 1GUOA 2HIXA 2PO4A 3UI2A 1HR0Q 4R4QA 5IYCH 3TP6A 2F0LA 3I4LA 1S72A 3S14H 5LMUQ 1B44D 1SYBA 5LMNW 3J7AF 3VYSA 4DR2L 4LF4L 3DLLA 1AFPA 1YI2A 1PFSA 5IYBG 2EY6A 4EQ5A 3BVGA 5J39A 1STEA 1HUNA 1XX8A 4IOCA 4A93G 4MNOA 1ASYA 1XTDA 3PUWA 4DV4L 4EVOA 2IHFA 1GO3E 1ZYRD 4P72A 3CCMA 3FKIB 5JJZA 2RDFA 4WFN3 3TDQA 2E2IH 3VDYA 3MWYW 1NCVA 1CI3M 5M9OA 4A3EG 5IYDG 3UDIA 1EQRA 1Q1EA 4JI5Q 2B2VC 2M2LA 4NXMQ 1HZCA 2QCPX 3E9IA 2E76C 4B3SQ 5FJ8H 1HR0L 4E6IA 3SVMA 3CHBD 1IBMQ 2EY5A 4FF3A 4ODGA 3GTOH 5LMUL 1EYGA 1STGA 4CKEA 1VQPA 2JQOA 4YWKA 3HOVB 4XTCS 3DXJC 2L1BA 4ZRZA 1RKNA 3MFGA 1X56A 1KABA 1IYUA 1GUNA 2A6HC 4ILWA 4X64Q 2WFWA 3MXNB 5EAYA 1PRTB 3I3CA 4DAYA 3KLRA 5GQOA 1Y1WH 2OQKA 5C3EB 1TWFH 2DN8A 4LF9Q 3MHBA 2PI2A 1IW7C 1QUQA 2VNUD 1J6QA 3GV3A 3K5MA 3S17H 3HFZB 1WTQA 2BA0A 3H0GH 5C4JB 4FYDA 3KF8A 1VQ5A 3PQIA 5CV8A 4A76A 4FO2A 1U4LA 3UDFA 1EYDA 4FXGC 1R4PB 4BBSB 5I9PA 4JI5L 2MP1A 2YTVA 4NXML 5M5YH 1FR3A 1NY4A 2PW5A 4MTKA 1Q86C 3FPPA 5D14A 3NBHB 4B3SL 3JC66 5IGEA 1IBML 1EU4A 3TS0A 3PMFA 3G7LA 4B9XA 1D8LA 3NWTA 4RA8A 5IODA 1ILPA 4IUNA 1FGBD 5IOCA 1TVXA 4X3TA 3FPUB 4X64L 3J7A5 4H44C 1F2LA 1MGSA 3A8KE 4QY7A 4FXDA 2HQEA 3D0FA 4LF9L 3S1MH 3OWFA 1Q90A 4GN5A 2DUDA 3X3MA 1IKMA 5JVH3 2OQ0A 3HKZB 2K33A 4A3IH 1DD2A 1KAWA 4L5SA 3K7AH 1TR5A 2HCCA 5E7NA 5J1ZA 4FF1A 1VQ7A 1JICA 3S2HH 1O7LA 4UPAA 2F0NA 2CVRA 2EYOA 2JEAI 4U68A 1KL9A 3K5NA 4BWGB 3U9SA 1C4QA 1EQTA 4DFAA 4DR6Q 3GD7A 1BQQT 2R93G 1RTNA 1G8ZD 1STNA 3UE0A 4A3CH 1JE4A 2CFMA 2MUYA 1EY6A 4ZQ3A 2EPBA 2K32A 3S24A 1IL8A 1PH3A 5IGFA 4AYBE 1SNDA 1TWGH 2JXMB 1VQ9A 4KKUA 1NAPA 1HFGA 3A54A 1MJCA 2VUMB 2B2TC 1J8IA 4ZUIA 4GN3B 2A69D 3CC2A 1MD2D 2E8GA 2MNAA 3HOYB 1EIFA 2F3VA 1N33Q 4HJ8A 2RHSB 1IZ6A 2WV6D 1BF4A 4DNIA 4CBVA 1VCIA 1NUCA 4FF2A 1I4GA 2ENBA 1HNZQ 4OO1H 2NVYH 3EFXD 2QW7A 2F3IA 5IP7H 4A3BB 4DR6L 2I0QA 1SYEA 4C3IB 4NDXA 1HNWQ 4OWTB 1H9SA 4A3KG 2LKVA 3AFQA 3FHWA 3M4PA 4RAUC 4IFDG 1PTOC 3L7ZC 1HTPA 1HUMA 3SK8A 3PSIA 4MN3A 4R4OA 4B9WA 3GTQB 1X3FA 3G6JB 5IWAQ 2I07B 4ME3A 3TMEA 5ELFA 1N33L 1LM0A 4K5XA 3A5ZB 1CA5A 2XNAC 5KNBA 4O2DA 1EOTA 5C0XH 2CWAA 2I46A 3TQYA 3H3VH 1E3PA 1JB3A 3RUZA 5EPKA 2KHSA 3M7GA 3MVVA 4LMQD 3I4NG 4BY7H 1JORA 4XQJA 4JI0Q 2E74C 1HNZL 3NBHA 1I4QA 2VB2X 2JA5H 2XN9C 4JYAQ 1VQLA 4DV3Q 2DJFC 3P7JA 2RCFA 2O5IC 1HNWL 1STAA 5M5WH 3GTGB 4G4KA 4LWCA 5EBDA 3QWNA 1UE1A 2JSOA 3V05A 4HTHA 2BA1A 3CQZH 3NHHA 1N34Q 2UXCQ 3CRLC 1HH2P 4MTNA 5IWAL 1F9PA 4XT3B 2E2IB 5CR3A 4DXGA 3GTKH 4AH6A 4BS9A 5IGCA 2D5DA 1J5EQ 1SAPA 2FINB 1Z47A 4IQZA 3D3RA 3O13A 5ELEA 1W6JA 2K7VA 3ERSX 1PFMA 3VYTA 1KDCA 1WFQA 4JI0L 3GTOB 2F0UA 4JK1C 4RH6A 4DNRB 5KRUA 1UEBA 4JYAL 2K5WA 5ISRA 5FLXc 2B63B 3S16B 2L55A 4DV3L 4ZAIA 3GTPH 4LK1C 2PPBC 3H0GG 3OHXC 4K14A 1XMOQ 2Y0SE 3M4QA 2ZXPA 2NVQB 3H91A 1RODA 4ZUJA 3S1QB 1WCMG 2V1CC 4TRDA 3WWVA 4DV5Q 4X3SA 4UY8C 2K28A 1EOVA 1L0XB 1N34L 1V1PB 2UXCL 1DOMA 2JA7G 1QB5D 1K0SA 3KF6B 4WJ4A 4DA2A 2F0WA 3MC0B 4DV2Q 3CP0A 2BOSA 1J5EL 1HHVA 2EY2A 2XIWA 4JI3Q 3KOJA 2VY3A 5M5XH 1S4ZA 2HQLA 1AH9A 2F1MA 2KECA 1WTXA 3U4VA 1BCPD 3KFUA 1SYFA 1WTRA 1CKNA 1C8CA 1AZQA 2AMCB 3HOXH 1SNQA 1Q1BA 5DM63 1CSQA 5J3BA 1Y69U 1VQBA 3J7YW 1XMOL 4A3IG 1Y1VB 2C9OA 4XYQA 1K3RA 1RHPA 2VXWA 1NMFA 1SE3A 4HMIA 1VMPA 5C0XJ 4DV5L 2QA4A 1X32A 3PF4A 3SGIA 3GTJH 3I90A 2Z9HA 5CV9A 4HJ7A 3KLWA 3IAYA 3STBC 4A3FB 3FKIH 4MIUA 1BVSA 4X3KA 4DV2L 4LF7Q 3HOWB 3OW7A 4POGA 4XXEA 1NE3A 4A3GG 4JI3L 1Q8IA 1SNOA 5KIXA 4UP7A 1EZ8A 2BH8A 5DNFA 3DEPA 4CJ2C 2KEEA 5NUCA 3JAME 3PUZA 4N8FA 5JAVA 4HIOA 2DNCA 3HOZB 1ET6A 2DNEA 3DHQA 4YWMA 2KENA 1I4XA 1K3BC 3HKZE 5CC4A 5BR8Q 4GNXB 5HURA 4U673 2AWOA 2IPKD 5BN4A 4NPSA 1GHJA 4R1JA 4M8AA 1L0WA 2DJGC 4KHVA 4ID6A 3KBXA 4Y7NB 1TS4A 1LTLA 1SMXA 1JOOA 4EGVA 3PIOA 5C3EH 3J81c 2K6AA 3T51B 1SEBD 4RGTA 5C5LA 4PZ7A 2F0MA 3BVMA 3T56B 4LF7L 1PH1A 4YCVA 4HIKA 5C4JH 3CRKC 3M7NA 5DAUA 2PZUA 2IY5B 3M4OH 3TZUA 1PRTD 3R2IA 2OXPA 4BBSH 1BUVT 3TBIB 1XPUA 1STHA 2RQXA 3N6RA 3Q24A 2F0HA 4KHZA 2A19A 1J9OA 2BDNA 2KHJA 1K8OA 1B4OA 4IPHA 1R4QB 1RF2D 5BR8L 4XQQA 4DAPA 2IWHA 4ZKBB 1D5MC 2AQ1B 1KXLA 1D7QA 5C0XG 5FO8B 3T53B 1YZ6A 1Q81C 3HZXA 4L63B 4QQBX 4EX5A 1V9PA 1TS3A 4KJNA 1ESFA 1VQMA 2CW0C 4PMCA 2JA5G 1FNUA 2A73B 4UHVA 1LYLA 1YVCA 1HCZA 1D1IA 1VQGA 3R2TA 3FRPB 1QE6A 1KQSA 1S5BD 3DM1A 4K8JA 4C3JG 1F2MA 2MGSA 5ELDA 4BY7B 4QCLA 5BN5A 4RKLA 2ICIA 3JAMi 5JEAH 4PNYA 2F4VQ 4DV0Q 1K8MA 1MJEA 4RHRA 3PUXA 5LHY1 1YITA 4OIKA 1U9RA 5TSSA 1TQOA 2TSSA 1OO9B 5ELNA 3MAQA 1OXTA 1CZGA 4AIMA 2K14A 3EROA 1VF5C 3NQIA 2K5DA 4PMWA 4QF4A 2A68C 2VUMH 3PV0A 1XWEA 1UE7A 2BCOA 3M4YA 4OO1I 2CCZA 2F0KA 2A5HA 3PO3B 5I9OA 2I5LX 4A3LH 3WOFA 3HOYH 4LW1A 3I7FA 4GLAC 5ELOA 3MZ5A 3S2DH 3EIVA 4Z9CB 5IP9H 3OIQA 1FVIA 2Z8LA 1WTVA 1S5ED 2WINB 1JT8A 1GVPA 2Z1CA 3ULLA 3PO2B 2L0CA 2F4VL 2MJ8A 4DV0L 4F87A 4A3MG 1QVFA 2EXZA 4A3BH 1RD9D 4C3IH 4YWLA 4K2LA 3J81L 1HA6A 1Z6HA 2E2DC 3PGZA 3NXWA 2BE5C 1LO5D 2CQAA 4A75A 3Q23A 3PUYA 4X62Q 3HOUG 1Z9FA 5H1SE 2RA4A 3GTQH 4I7AA 4RGMA 2EYFA 1VQ4A 2HDMA 4X3UA 2XWJB 1SNCA 2K5QA 3ZYYX 1HQMC 4LFCQ 5M5XB 1YNND 1STBA 3S15B 3HG9A 1N9WA 1D5ZC 3W2DA 1VQ6A 5I2XA 1VQHA 2NVTH 3VR3A 1QCBD 1ML0D 2HUGA 3CC7A 2JA6G 5M3MB 2KJXA 1EWIA 2KBNA 1K8AC 1EY0A 3PIPA 2PNRC 5LMNQ 3HOXB 4KKTA 2NZ1D 4P75A 1P8LA 1EYCA 4JPBW 1HZAA 2KCTA 3D4RA 4P71A 5C3WA 3FKIG 1LUZA 2Z6KA 1I5FA 2CWPA 5JOBA 4DR3Q 3GTGH 3AMUA 4XYOA 1SDFA 1V1OA 1K83B 3TP8A 4JV5Q 2Y0SG 4X62L 2B2WA 3GTJB 3C2PA 1KNEA 1KRTA 5CGKA 2R3ZA 1PFNA 4GKKQ 2QDBA 4FXKC 1NR4A 3J80i 1BKBA 1GUTA 2YU9B 2Q2HA 1DM0B 5C44G 5JEAJ 1IXRA 4LFCL 1QJOA 3HOVG 1I6VC 3SK4A 3S1NB 2BDOA 1B9NA 1WTOA 3SEBA 4P2CB 2F0DA 1NMGA 1SSOA 3BJUA 3KLSA 3CF5A 1DOLA 1PH8A 3ND9A 5LMNL 1ICFB 2ZTDA 3LWUA 3S16H 2B63H 3NTKA 2CH4A 4IPCA 4R8IA 1QZHA 1T5XD 4DR3L 1K73C 4WJWA 2PYKA 5F2DA 4RCNA 3HRZC 5D3DA 3SK5A 1TWHH 1KAAA 4KY6A 3RN2A 2WIIB 3J81E 2MHVA 2NVQH 2QEJC 1A0IA 4JV5L 3RR5A 3S1QH 2F0SA 1L1OB 1MHWC 3DEOA 1JMCA 4YY3Q 4GKKL 3NWSA 1JJ2A 2EDGA 1PTOD 4M1UB 2V4DA 2LY7A 4JI8Q 1GUSA 1JCKB 1AP0A 1QNUA 4BBRG 4I65A 2EYPA 3GP7A 1XXGA 2E2JB 1O7IA 1GM5A 5I2YA 1SBBB 5CV4A 1F77A 3QIAA 4JW0A 1A2TA 1SN8A 1Q82C 3M4OB 4GKJQ 1DGSA 1GHKA 1EFID 5FOBB 5JJKA 4CDFC 2NVXH 1W6KA 4JBKA 3DM3A 3KUPA 3BS1A 3I56A 4IURA 4DV7Q 1ET9A 1IBKQ 2R92B 4RHSA 2UUBQ 5CV6A 3CXCA 2PCFB 2F0VA 3A56A 3NENA 1B9MA 1JQYD 3HKZG 4LUZA 1Y1VH 4K0KQ 5G3LF 4KMUC 3ER0A 4ABNA 4YY3L 5CORA 4CKBA 5JEAG 2NWGA 4JI8L 2H4OA 1B3QA 1OTCA 4A3FH 2M9VA 1IYVA 5FLMH 3LGJA 2IL8A 3U4ZA 3HOWH 1LTSD 4PMBA 2SNSA 4GKJL 1BR9A 2XWBB 1VQCA 4LFBQ 1KHIA 3F2DA 2JN4A 3EVQA 5JJIA 1OXSC 1S5CD 3CC4A 1N32Q 2NN6I 3P20A 2K5VA 3K6OA 4F88A 3J7ZC 4DV7L 1IBKL 2VUMG 2DGYA 3WOEA 1XNQQ 4NB3A 2UUBL 3TREA 1LABA 3HOZH 3C3LA 4DV1Q 1YNXA 2K75A 1DONA 4DR5Q 4UAIA 3HOYG 2WP8J 1EIHA 1MI2A 2PZTA 2K5HA 4R4IA 5IP9G 4X65Q 1F2YA 3CCUA 4K0KL 1QZGA 1ICWA 1HNXQ 1IBLQ 2VQFQ 4Y7NH 1NJIC 2NZOA 1SXTA 4HCEA 2F4IA 5HY6A 2Q8RE 3GTMB 3S2DB 1X65A 2WB1B 2ZTCA 3D8GA 5CV7A 4C3IG 2VZAA 1LT5D 3AYHB 2KCMA 3L9AX 3MXPA 1VQFA 3TS2A 5CBAE 4LFBL 1ZXTA 4BY1B 3K0XA 1X54A 2QKIC 2Q2IA 1N32L 1XNRQ 2F03A 4DK0A 3R93A 1XNQL 2AUJD 3CCJA 1PH6A 2L11A 4DV1L 4PV1C 2C5CA 5JVG3 1E1OA 1VQEA 3KK7A 4DR5L 1NSNS 1A6XA 5K5PA 1XJVA 4LF6Q 1Y8NB 4X65L 3BYTB 1HNXL 1IBLL 3UDXA 2XRQD 2VQFL 3MXNA 3BZKA 1QOHA 1UWVA 1L1OA 3K57A 5IYCG 4DUZQ 1A2UA 4G57A 3I4OA 3MA2B 5EQ0A 4EQPA 3AU7A 2ATWA 2Z0SA 1JC7A 1WYDA 2NVTB 3NSWA 2F52A 3D6CA 4KY5A 3STBD 5A35A 1EYAA 4K5VA 1YJWA 4O1NA 2K4KA 1PXUA 4APVA 1JWSD 1F9SA 3NTHA 1XNRL 4OELB 3T1YQ 3Q22A 1PZKD 1ENFA 1VS0A 1Y14B 3GTLB 1EY8A 1CQVA 3MFYA 3VA7A 2EYJA 4JI7Q 1B50A 2EXDA 4HIMA 1E7ZA 3LNNA 4P73A 4C3HH 3K7UC 4BXXH 1EIYB 2SDFA 4LF6L 1I50H 3E6ZX 4KJOA 4OIJA 5EGTA 1GJXA 4RKBA 1KC8C 1G2TA 3K80C 1H9MA 1PH7A 4JI1Q 3GO5A 5FJ8G 4CJ1B 3RZDH 1N36Q 2OTLA 2N8NA 4IOAA 4DUZL 2JEBI 2G9DA 3P1HA 3J7AV 1PHJA 1BXTA 1RJTA 5A2QL 5DEHA 1AE2A 3PO3H 4R8NA 2B63G 1TU2B 1W3SA 1HZ9A 2B2UA 3MEFA 1G51A 5FO7B 3E3XA 4DUYQ 5GAEC 3RLNA 2JA8B 3R3OA 4L8JA 3U9OA 3W5OA 2UU9Q 2RF4A 2N78A 1JJGA 1Q46A 1M90C 2HHHQ 3SHLA 4ZLTF 1Y1WG 1HA5A 1SE8A 2DY8A 4HJ5A 2A74C 1SYGA 3PO2H 4A3JB 3T1YL 4RFBA 4XQNA 1PTOB 4OEMB 3OTOQ 4JI7L 2WAQB 4LUVA 4ULLA 4N9TA 4IUUA 1TWHB 5I6YA 2E75C 1STYA 5E3FA 1CZWA 1Q3LA 2PQEA 4QJFA 2O5JC 3K58A 2A6EC 4L5TA 5C4XH 1B2TA 2P5ZX 1F9RA 1SROA 1A15A 2CKZB 2HD3A 4R4TA 3A74A 5EJWA 2GN5A 1EQVA 4YIJA 3EA6A 4JI6Q 4JI1L 4IZ8A 1N36L 4V190 4KN4C 4CGYB 1F2ZA 3OW2A 4J1MA 4GOPC 1CFMA 1E22A 1IYJB 3EBEA 1LTGD 4K5WA 2KOLA 1OXUA 1KNAA 2K1BA 3S15H 5FO9B 1CTMA 2EOTA 4UP8A 4DUYL 1YEZA 4F8MA 1KD1C 2NVXB 1S5DD 1EY5A 2CW0D 2UU9L 2RSNA 1Y1VG 1MIUA 4S3SA 1PZID 3GDEA 2MFIA 1RDPD 2D62A 3A55A 5M3MH 3K81C 3VA5A 2HHHL 1QG7A 4QIWB 2EJGC 4OHJA 2WKDA 3G6EA 3PUVA 3OTOL 2XVSA 1EWCA 3ICEA 1A3VA 1XTCD 3IRBA 4A3FG 2ZJQA 2NYZD 5C6AA 3HOWG 1WCMB 5EBCA 4DF7A 3T1HQ 3RD4A 3D31A 1AE3A 1K83H 4DAVA 3S1RB 3I4MB 1LTID 1HJPA 3W1BA 5GROA 4OWWB 1UE5A 4JI4Q 2QGQA 3BZCA 1WVLA 4JI6L 4NP5A 1U5KA 4J6HA 1L2FA 4MZ9A 2GVBA 4C2MB 2YU9H 1CA6A 3CMEA 2PMZB 3HOZG 1FD7D 4A3CG 4QUCA 1SFOH 2A68D 2Z6KC 2LMCB 3CCEA 3S1NH 3I91A 5IE8A 1TIID 4EQOA 4R9WA 3EJIA 3J81j 1GD7A 2RVLA 4RWSC 1SNMA 2X6GA 2D2CC 3G4SA 1KLUD 2UUAQ 2YV5A 4HJAA 3M3YB 1VQOA 1YHBA 2YTXA 1C48A 5D65A 5K36H 4LF8Q 2XSCA 2J0TD 1G91A 5KGUA 3T1HL 2NB0A 2LXJA 1BBXC 3RZOB 3I72A 1VQAA 2ZM6Q 3H3VC 2RSOA 2MQHA 1HXYD 2EYHA 3RLOA 2NN6H 3RLFA 2K05A 4GOPB 3HS0C 3KLSX 4JI4L 1EUJA 1UEAB 4OO1G 4L5QA 2L12A 4IJHA 2BE5D 5IP7G 1LTTD 5E4WC 2FFKB 2KEDA 2B2YA 2E2JH 3OIPA 1EFWA 5FLXL 2FJ2A 2RHQB 1LTRD 5J22A 3L0OA 1Z7TA 1LT6D 1VF7A 1XMQQ 2KQ3A 4DR1Q 2UUAL 1ENCA 1CM9A 2R92H 3GV6A 4HSVA 5JPNC 3FP9A 2WB1E 2KA7A 4LF8L 4POFA 2EY1A 1WTPA 3NBIA 2J7ZA 4JBWA 1NTGA 1ZKOA 2ZM6L 4ME5A 4AYBG 2R7DA 3I8ZA 4KV6A 3T4AC 4BY7G 4BA2I 1CK1A 1SMYC 2O4XA 1SLJA 1NR2A 1V1PA 3CPWA 4B08A 3GQBA 4XDXA 3KF6A 1O80A 1S40A 4JOIA 1EEID 1DYQA 3I2ZA 4IPGA 1WD1A 5LL6S 3IFTA 2KCNA 2NZHA 3M9BA 3OPOA 1D6EC 1JJCB 4YCUA 1PLFA 1DZ1A 5M3FB 4BXXG 3U58A 4CDCC 3UDGA 3CCVA 1M4VA 4Q5VA 2F0IA 2TMPA 1XMQL 3P75A 4RGNA 4DR1L 4HN7A 2OCEA 2R7ZB 1YIJA 3NELA 2ALYB 4C3HB 3PO3G 4JBJA 5IT9c 2IX0A 1I50B 2L4NA 2K52A 4JI2Q 3OSOA 3DMUA 4XIGS 3RZDB 3IFDA 3PO2G 1U4MA 3G48A 2LS01 2A6HD 3DUZA 3VR2A 4IO9A 2FXQA 3CKIB 3ULJA 3GTMH 3QJYA 2Z4IA 2ICEC 4K6DA 4ZK9B 1IW7D 4DAYB 2JK8A 1H9KA 5KNCA 4BY1H 5FLXE 1BDOA 2HDLA 1QUQB 3NTIA 1E24A 3CCLA 4GN4B 1SE2A 2RDHA 5EKKA 3KF8B 3OMCA 1YNJC 1JOKA 1B3AA 3EQLC 1CHPD 2F0OA 3K5OA 1EEFD 1XPRA 3K0YA 2MO1A 4GNXA 1B70B 5C4XB 3SE0A 2K03A 4C1NI 4JI2L 2FHTA 5EPLA 3OWEB 4DR7Q 1TWCB
chains in the Genus database with same CATH topology
1N8RC 4K0KQ 1UE1A 4A3EH 5M3MG 5IYDH 3HOVH 3ER0A 3UE1A 2BA1A 4YY3L 3HOXG 3CQZH 2WAQE 1N34Q 5JEAG 2EIFA 2UXCQ 1E1TA 1HH2P 4JI8L 2VW9A 3H15A 1OTCA 2E5LQ 1B8AA 4MTNA 5IWAL 4A3FH 5FLMH 3LGJA 3U4ZA 3HOWH 3GTKH 4AH6A 1J5EQ 4PG3A 1CSPA 2B29A 1U0LA 4GKJL 1VQJA 1VQCA 1X3GA 4LFBQ 1KHIA 1Z47A 4OONA 3F2DA 2R6GA 4QGUA 1PH4A 1PH5A 5JJIA 1OXSC 1B7YB 4DAMA 1KIXA 5GAGC 2KHIA 3CC4A 3ERSX 2NN6I 1N32Q 3F2CA 2K5VA 3J7ZC 4B3TL 2N49A 4DV7L 3GTLH 1IBKL 2PQAB 2VUMG 2DGYA 1XNQQ 4NB3A 1WFQA 3TREA 2AWNA 3L2PA 1K8GA 2UUBL 4JI0L 3HOZH 4DV1Q 1VQ8A 1YNXA 2K75A 3CD6A 1UEBA 4DR5Q 4JYAL 1VQNA 5FLXc 1C7YA 1SR3A 5M3FG 2YYZA 2BH2A 2WP8J 4DV3L 3HOYG 3GTPH 4HIDA 2K5HA 4R4IA 3H0GG 4BBRH 4DR7L 1QVCA 4DR4Q 5IP9G 4X65Q 3CCUA 1XMOQ 4K0KL 1QZGA 1VQIA 4QIWE 2Y0SE 3M4QA 4DPGA 3CCSA 1HNXQ 4FDBA 1IBLQ 2VQFQ 1JE5A 2H5XA 4Y7NH 1NJIC 1HR0W 2R7ZG 1OXVA 1WCMG 2NZOA 2V1CC 3WWVA 4DV5Q 4UY8C 1EOVA 1N34L 2UXCL 4KLKA 2JA9A 2E5LL 5HY6A 2JA7G 2GVAA 2VQEQ 3KF6B 4WJ4A 5K36G 3I4NH 1X65A 5AJ3Q 2ZTCA 4DV2Q 2JA8H 3CP0A 4X6AH 1J5EL 2VZAA 3AYHB 2KCMA 2B3GA 1VQFA 3TS2A 2ZJPA 1A63A 4LFBL 2NN6G 4JI3Q 1G291 2VY3A 3KOJA 3E0EA 5M5XH 2LXKA 3F2BA 1H95A 3K0XA 1X54A 2Q2IA 5C3EG 2HQLA 2D0PA 4A3JH 4KHPQ 1N32L 1AH9A 3U50C 2PMZE 1XNRQ 3U4VA 5HGQA 3KFUA 1XNQL 1T9HA 1CKNA 3CCJA 1PH6A 1K9MC 3NEMA 4DV1L 2AMCB 3HOXH 1E1OA 1VQEA 4DR5L 1PH9A 2ES2A 1Q1BA 2ZJRA 1XJVA 1CSQA 5J3BA 1VQBA 4OX9Q 4LF6Q 4BBSG 1X55A 1PYBA 4DR4L 4X65L 1XMOL 1GKHA 4A3IG 1HNXL 2PNHA 1IBLL 3UDXA 2VQFL 1K3RA 3BZKA 1NMFA 2VL6A 1UWVA 1L1OA 4DV5L 5C0XJ 1Q7YC 2R92G 5IYCG 2QA4A 4DUZQ 3PF4A 3SGIA 3GTJH 4PZ6A 2VQEL 3KLWA 3I4OA 4HJ7A 5C4XG 1C0AA 4TQUS 4GLVB 3STBC 3FKIH 5AJ3L 1BVSA 4RG1A 4DV2L 4LF7Q 2ATWA 2Z0SA 1WYDA 4YHHQ 4POGA 2R93H 2F52A 1NE3A 3STBD 1R9TH 4A3GG 4LUOA 4JI3L 3RNUA 2CQOA 4B3RQ 1YJWA 4A4IA 2K4KA 2MO0A 4KHPL 4APVA 4UP7A 4R4CA 1XNRL 2BH8A 3T1YQ 4AQYQ 1VS0A 1Y14B 3PUZA 3AQQA 4HIOA 1A62A 2LSSA 4JI7Q 1WCMH 3A5UA 4TVAB 5JJLA 2EXDA 1KRSA 4HIMA 1E7ZA 3CAMA 2KENA 4P73A 4QL5A 4YWMA 4C3HH 4OX9L 3K7UC 4GNXB 3HKZE 4GOPA 5BR8Q 1EIYB 4LF6L 1X6OA 3S1RH 3I4MH 4BXXH 1I50H 2JE6I 4A3DG 2AWOA 2AHOB 2XTIA 4NPSA 4R1JA 4DR2Q 1M1KC 1JB7A 4LF4Q 1L0WA 1WI5A 1KC8C 3K80C 1PH7A 4HJ9A 4JI1Q 3GO5A 5FJ8G 3OYYA 4DV6Q 3RZDH 1N36Q 2OTLA 2IHEA 1LTLA 2N8NA 4C2MH 5C0XI 3M85A 1RL2A 2JEBI 4DUZL 3H3VI 4J15A 4IOAA 1SMXA 4OWXB 3KJPA 3PIOA 2ZTEA 5C3EH 3J81c 1PHJA 2IX1A 3PO3H 1AE2A 4DV4Q 2HT1A 4PZ7A 4IFDJ 2B63G 1TXYA 1W3SA 1HZ9A 3MEFA 1G51A 2EQSA 1PH1A 4YCVA 3AFPA 4LF7L 1X9NA 4YHHL 4DUYQ 5GAEC 3RLNA 2E2HH 4HIKA 1EQQA 5C4JH 4JBMA 4IPDA 1PA6A 1L1OC 1S3OA 1I6HH 3W5OA 2UU9Q 4A3KH 4LNQA 3M7NA 2RF4A 2N78A 1JJGA 4B3RL 2IY5B 3M4OH 1Q46A 1M90C 2XGTA 2HHHQ 3M3YH 1Y1WG 1SE8A 4HJ5A 4BBSH 3PO2H 3G71A 2OWOA 4DK6C 3T1YL 1XPUA 4A3LG 1BBWA 4AQYL 3OTOQ 2PQAA 2HIXA 2A1AA 2OTJA 4JI7L 4LUVA 3J81i 4KHZA 2WB1G 1HR0Q 2A19A 4R4QA 2L15A 5IYCH 2KHJA 4P74A 1S72A 3RZOH 2C35B 4IPHA 3S14H 1WOCA 4QJFA 5BR8L 5LMUQ 3W1GA 4L5TA 4BY1G 5C4XH 3HKSA 2QEXA 5LMNW 1KXLA 1D7QA 1SROA 2CKZB 5C0XG 4R4TA 3DLLA 3A74A 4DR2L 4LF4L 1YZ6A 1Q81C 1YI2A 2GN5A 4QQBX 1PFSA 3JAMc 4JI6Q 4JI1L 5IYBG 1N36L 5IY0A 4DV6L 4LF5Q 4EQ5A 4A3GH 4EX5A 1V9PA 4A3BG 4Y52H 4IOCA 2UXDQ 4A93G 4MNOA 3OW2A 4GOPC 1ASYA 1E22A 4DKAC 1XTDA 3PUWA 4DV4L 1IYJB 1VQMA 3EBEA 2IHFA 1RIPA 3K8AA 1OXUA 2JA5G 1GO3E 4B3MQ 4P72A 1LYLA 1YVCA 3CCMA 1VQGA 3S15H 4UP8A 4DUYL 1YEZA 2E2IH 1KD1C 2JA7H 1KQSA 3VDYA 2UU9L 1Y1VG 1MIUA 1ASZA 3GDEA 2MFIA 4A3EG 3B6YA 2D62A 5M3MH 5IYDG 3K81C 1EQRA 3UDIA 2HHHL 1Q1EA 3JAMi 3G6EA 4JI5Q 1CKMA 4NXMQ 1HZCA 3PUVA 3OTOL 2F4VQ 4DV0Q 3E9IA 2ASBA 3ICEA 3IRBA 1V43A 4A3FG 4UP9A 1OXXK 5FJ8H 1MJEA 1HR0L 2ZJQA 4B3SQ 3HOWG 3PUXA 1IBMQ 3T1HQ 1PV4A 1CKNB 1YITA 4JC0A 2PI2E 3GTOH 5LMUL 1EYGA 3D31A 1AE3A 1K83H 4BA1I 1VQPA 2JQOA 4YWKA 1NBWA 4XTCS 4ALPA 1HJPA 3W1BA 5GROA 5ELNA 2HIVA 4OWWB 1UE5A 4JI4Q 2QGQA 1OXTA 3BZCA 4JI6L 4LF5L 4AIMA 1X56A 1K0RA 2JJQA 1A8VA 2K14A 4X64Q 1U5KA 1UE6A 1X3EA 4YCWA 2WFWA 1L2FA 4PMWA 1I94Q 4MZ9A 2GVBA 3ULPA 3MXNB 2YU9H 3PV0A 5EAYA 2VUMH 3CMEA 4WJ3M 1UE7A 3HOZG 5GQOA 1Y1WH 1I3QH 2OQKA 2CCZA 1TWFH 1VQKA 4A3CG 4OO1I 4LF9Q 4B3ML 2I5LX 3AEVA 1SFOH 2PI2A 2Z6KC 4KI0A 1QUQA 5M3FH 3HOYH 4A3LH 4LW1A 2VNUD 1J6QA 3I7FA 4GLAC 3S17H 5ELOA 3CCEA 3HFZB 3S1NH 3S2DH 2BA0A 5IE8A 3H0GH 3EIVA 5IP9H 1VQ5A 3J81j 1FVIA 1GD7A 3BU2A 1TWAH 3G4SA 4A76A 1JT8A 1GVPA 3UDFA 2R7ZH 2UUAQ 2YV5A 3ULLA 4HJAA 4JI5L 2YTVA 1VQOA 4NXML 5M5YH 1NY4A 1YHBA 2YTXA 1Q86C 4GLXA 4JOIC 2F4VL 4DV0L 2K50A 4A3MG 3NBHB 1QVFA 2UXDL 4B3SL 3KDFB 3JC66 4LF8Q 4A3BH 1IBML 3T1HL 4C3IH 2JA8G 1FL0A 3TS0A 2LXJA 4YWLA 1VQAA 5GAHC 2ZM6Q 4H02A 3PGZA 4GS3A 2MQHA 1YBYA 1D8LA 3RLOA 5DLQE 3RLFA 4GOPB 4X66Q 4A75A 4JI4L 1CKOA 3PUYA 4A3JG 4X62Q 3HOUG 1Z9FA 1EUJA 4X64L 5H1SE 1IL2A 4C3JH 3J7A5 1I94L 4L5QA 4IJHA 4OO1G 5IP7G 3GTQH 4QY7A 4JG2A 2WAQG 3TRZA 3Q8DA 4O0AA 1VQ4A 4NXNQ 3D0FA 1Q12A 4LF9L 2E2JH 4RMFA 3S1MH 3CMAA 4LFCQ 2I5MX 1YJNA 1W2BA 1EFWA 2RHQB 1N9WA 2DUDA 4GN5A 1VQ6A 1YHQA 3L0OA 1VQHA 2OQ0A 4OXPA 4A3IH 2NVTH 1XMQQ 1KAWA 4L5SA 1G6PA 3RN5A 2JA6G 3K7AH 5E7NA 3CC7A 4DR1Q 2UUAL 1EWIA 1VQ7A 2KBNA 1K8AC 4DR7Q 3S2HH 3PIPA 5LMNQ 2R92H 3J80c 2RCNA 4UPAA 4P75A 1P8LA 3FP9A 1FGUA 1SRUA 2WB1E 2JEAI 1KL9A 3E9HA 1HZAA 2KCTA 4P71A 4LF8L 3FKIG 4POFA 1LUZA 2Q2UA 2Z6KA 1I5FA 2CWPA 3GD7A 3EN2A 4DR3Q 3GTGH 4JBWA 4DR6Q 1NTGA 2R93G 1XPOA 1C9OA 1TWCH 3UE0A 2ZM6L 4A3CH 4AYBG 2A8VA 2R7DA 4BY7G 2CFMA 4BA2I 4X66L 4JV5Q 2D0OA 3S24A 1SLJA 2Y0SG 1PH3A 4AYBE 4X62L 3CPWA 2UUCQ 1KRTA 1TWGH 4IFDI 1P16A 1VQ9A 4GKKQ 2K5NA 3F1ZA 3KF6A 4DK3C 2UXBQ 1MJCA 1S40A 3J80i 1BKBA 4JOIA 3PF5A 4IPGA 3I2ZA 2Q2HA 4NXNL 4GNXC 4L5RC 5C44G 3A0JA 1IXRA 5JEAJ 2NZHA 3M9BA 1CUKA 2E8GA 4GN3B 4LFCL 3CC2A 1PYSB 4YCUA 1JJCB 2MNAA 4BXXG 1EIFA 2IT1A 4IJLA 3U58A 4A3MH 1N33Q 3I4MG 3HOVG 4HJ8A 2RHSB 3UDGA 4A3DH 3CCVA 1IZ6A 1XMQL 1FJGQ 1NMGA 3BJUA 3CF5A 4DNIA 1VCIA 4DR1L 1PH8A 2N3SA 5FLMG 2OCEA 5LMNL 1YJ9A 4PZ8A 2ZTDA 3CCRA 1YIJA 3NELA 1HNZQ 1PH2A 2ALYB 3HOUH 3PO3G 4JBJA 1V1QA 3S16H 5IT9c 2B63H 2NVYH 2VS1A 2IX0A 2F3IA 5IP7H 4IPCA 1QZHA 2I5HA 4DR6L 2I0QA 4LFAQ 4DR3L 1K73C 2K52A 1HNWQ 4OWTB 4JI2Q 1TWHH 4A3KG 3AFQA 3M4PA 3FHWA 4XIGS 3RN2A 3CW2C 4IFDG 2NVQH 1A0IA 3L7ZC 3RR5A 3I55A 1Q8KA 3KJOA 3S1QH 4JV5L 2UUCL 3PSIA 1L1OB 3PO2G 4R4OA 1JMCA 3G48A 1VQDA 3CPFA 4YY3Q 1QVGA 4GKKL 1JJ2A 3KYHC 2UXBL 4IO9A 2FXQA 3ULJA 4JI8Q 2JA6H 1X3FA 3GTMH 1MKHA 5GADC 5IWAQ 4BBRG 1O7IA 4ME3A 2R7FA 1GM5A 4DAYB 2JK8A 1BBUA 1N33L 1LM0A 1SN8A 3A5ZB 3CCQA 1Q82C 4BY1H 3PCOB 1DGSA 4GKJQ 1QUQB 1WJJA 4O2DA 1HZBA 1FJGL 2CWAA 5JJKA 3TQYA 2NVXH 3H3VH 1E3PA 1E24A 2Q2TA 4GN4B 3ZJYC 3CCLA 4JBKA 1PVOA 3DM3A 5IYBH 3KF8B 3TEHB 3F8TA 4B3TQ 3I4NG 4BY7H 3I56A 4DV7Q 4JCVE 1IBKQ 4A93H 1XPRA 1HNZL 2UUBQ 4JI0Q 1YHAA 2MO1A 4GNXA 3CXCA 1B70B 3KDFA 2JA5H 2YTYA 1VQLA 4JYAQ 3NENA 4DV3Q 4LFAL 1HNWL 4JI2L 5M5WH 2ID0A 3HKZG 4LUZA 5C44H 2AKWB 4LWCA 1Y1VH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R C;  4K0K Q;  1UE1 A;  4A3E H;  5M3M G;  5IYD H;  3HOV H;  3ER0 A;  3UE1 A;  2BA1 A;  4YY3 L;  3HOX G;  3CQZ H;  2WAQ E;  1N34 Q;  5JEA G;  2EIF A;  2UXC Q;  1E1T A;  1HH2 P;  4JI8 L;  2VW9 A;  3H15 A;  1OTC A;  2E5L Q;  1B8A A;  4MTN A;  5IWA L;  4A3F H;  5FLM H;  3LGJ A;  3U4Z A;  3HOW H;  3GTK H;  4AH6 A;  1J5E Q;  4PG3 A;  1CSP A;  2B29 A;  1U0L A;  4GKJ L;  1VQJ A;  1VQC A;  1X3G A;  4LFB Q;  1KHI A;  1Z47 A;  4OON A;  3F2D A;  2R6G A;  4QGU A;  1PH4 A;  1PH5 A;  5JJI A;  1OXS C;  1B7Y B;  4DAM A;  1KIX A;  5GAG C;  2KHI A;  3CC4 A;  3ERS X;  2NN6 I;  1N32 Q;  3F2C A;  2K5V A;  3J7Z C;  4B3T L;  2N49 A;  4DV7 L;  3GTL H;  1IBK L;  2PQA B;  2VUM G;  2DGY A;  1XNQ Q;  4NB3 A;  1WFQ A;  3TRE A;  2AWN A;  3L2P A;  1K8G A;  2UUB L;  4JI0 L;  3HOZ H;  4DV1 Q;  1VQ8 A;  1YNX A;  2K75 A;  3CD6 A;  1UEB A;  4DR5 Q;  4JYA L;  1VQN A;  5FLX c;  1C7Y A;  1SR3 A;  5M3F G;  2YYZ A;  2BH2 A;  2WP8 J;  4DV3 L;  3HOY G;  3GTP H;  4HID A;  2K5H A;  4R4I A;  3H0G G;  4BBR H;  4DR7 L;  1QVC A;  4DR4 Q;  5IP9 G;  4X65 Q;  3CCU A;  1XMO Q;  4K0K L;  1QZG A;  1VQI A;  4QIW E;  2Y0S E;  3M4Q A;  4DPG A;  3CCS A;  1HNX Q;  4FDB A;  1IBL Q;  2VQF Q;  1JE5 A;  2H5X A;  4Y7N H;  1NJI C;  1HR0 W;  2R7Z G;  1OXV A;  1WCM G;  2NZO A;  2V1C C;  3WWV A;  4DV5 Q;  4UY8 C;  1EOV A;  1N34 L;  2UXC L;  4KLK A;  2JA9 A;  2E5L L;  5HY6 A;  2JA7 G;  2GVA A;  2VQE Q;  3KF6 B;  4WJ4 A;  5K36 G;  3I4N H;  1X65 A;  5AJ3 Q;  2ZTC A;  4DV2 Q;  2JA8 H;  3CP0 A;  4X6A H;  1J5E L;  2VZA A;  3AYH B;  2KCM A;  2B3G A;  1VQF A;  3TS2 A;  2ZJP A;  1A63 A;  4LFB L;  2NN6 G;  4JI3 Q;  1G29 1;  2VY3 A;  3KOJ A;  3E0E A;  5M5X H;  2LXK A;  3F2B A;  1H95 A;  3K0X A;  1X54 A;  2Q2I A;  5C3E G;  2HQL A;  2D0P A;  4A3J H;  4KHP Q;  1N32 L;  1AH9 A;  3U50 C;  2PMZ E;  1XNR Q;  3U4V A;  5HGQ A;  3KFU A;  1XNQ L;  1T9H A;  1CKN A;  3CCJ A;  1PH6 A;  1K9M C;  3NEM A;  4DV1 L;  2AMC B;  3HOX H;  1E1O A;  1VQE A;  4DR5 L;  1PH9 A;  2ES2 A;  1Q1B A;  2ZJR A;  1XJV A;  1CSQ A;  5J3B A;  1VQB A;  4OX9 Q;  4LF6 Q;  4BBS G;  1X55 A;  1PYB A;  4DR4 L;  4X65 L;  1XMO L;  1GKH A;  4A3I G;  1HNX L;  2PNH A;  1IBL L;  3UDX A;  2VQF L;  1K3R A;  3BZK A;  1NMF A;  2VL6 A;  1UWV A;  1L1O A;  4DV5 L;  5C0X J;  1Q7Y C;  2R92 G;  5IYC G;  2QA4 A;  4DUZ Q;  3PF4 A;  3SGI A;  3GTJ H;  4PZ6 A;  2VQE L;  3KLW A;  3I4O A;  4HJ7 A;  5C4X G;  1C0A A;  4TQU S;  4GLV B;  3STB C;  3FKI H;  5AJ3 L;  1BVS A;  4RG1 A;  4DV2 L;  4LF7 Q;  2ATW A;  2Z0S A;  1WYD A;  4YHH Q;  4POG A;  2R93 H;  2F52 A;  1NE3 A;  3STB D;  1R9T H;  4A3G G;  4LUO A;  4JI3 L;  3RNU A;  2CQO A;  4B3R Q;  1YJW A;  4A4I A;  2K4K A;  2MO0 A;  4KHP L;  4APV A;  4UP7 A;  4R4C A;  1XNR L;  2BH8 A;  3T1Y Q;  4AQY Q;  1VS0 A;  1Y14 B;  3PUZ A;  3AQQ A;  4HIO A;  1A62 A;  2LSS A;  4JI7 Q;  1WCM H;  3A5U A;  4TVA B;  5JJL A;  2EXD A;  1KRS A;  4HIM A;  1E7Z A;  3CAM A;  2KEN A;  4P73 A;  4QL5 A;  4YWM A;  4C3H H;  4OX9 L;  3K7U C;  4GNX B;  3HKZ E;  4GOP A;  5BR8 Q;  1EIY B;  4LF6 L;  1X6O A;  3S1R H;  3I4M H;  4BXX H;  1I50 H;  2JE6 I;  4A3D G;  2AWO A;  2AHO B;  2XTI A;  4NPS A;  4R1J A;  4DR2 Q;  1M1K C;  1JB7 A;  4LF4 Q;  1L0W A;  1WI5 A;  1KC8 C;  3K80 C;  1PH7 A;  4HJ9 A;  4JI1 Q;  3GO5 A;  5FJ8 G;  3OYY A;  4DV6 Q;  3RZD H;  1N36 Q;  2OTL A;  2IHE A;  1LTL A;  2N8N A;  4C2M H;  5C0X I;  3M85 A;  1RL2 A;  2JEB I;  4DUZ L;  3H3V I;  4J15 A;  4IOA A;  1SMX A;  4OWX B;  3KJP A;  3PIO A;  2ZTE A;  5C3E H;  3J81 c;  1PHJ A;  2IX1 A;  3PO3 H;  1AE2 A;  4DV4 Q;  2HT1 A;  4PZ7 A;  4IFD J;  2B63 G;  1TXY A;  1W3S A;  1HZ9 A;  3MEF A;  1G51 A;  2EQS A;  1PH1 A;  4YCV A;  3AFP A;  4LF7 L;  1X9N A;  4YHH L;  4DUY Q;  5GAE C;  3RLN A;  2E2H H;  4HIK A;  1EQQ A;  5C4J H;  4JBM A;  4IPD A;  1PA6 A;  1L1O C;  1S3O A;  1I6H H;  3W5O A;  2UU9 Q;  4A3K H;  4LNQ A;  3M7N A;  2RF4 A;  2N78 A;  1JJG A;  4B3R L;  2IY5 B;  3M4O H;  1Q46 A;  1M90 C;  2XGT A;  2HHH Q;  3M3Y H;  1Y1W G;  1SE8 A;  4HJ5 A;  4BBS H;  3PO2 H;  3G71 A;  2OWO A;  4DK6 C;  3T1Y L;  1XPU A;  4A3L G;  1BBW A;  4AQY L;  3OTO Q;  2PQA A;  2HIX A;  2A1A A;  2OTJ A;  4JI7 L;  4LUV A;  3J81 i;  4KHZ A;  2WB1 G;  1HR0 Q;  2A19 A;  4R4Q A;  2L15 A;  5IYC H;  2KHJ A;  4P74 A;  1S72 A;  3RZO H;  2C35 B;  4IPH A;  3S14 H;  1WOC A;  4QJF A;  5BR8 L;  5LMU Q;  3W1G A;  4L5T A;  4BY1 G;  5C4X H;  3HKS A;  2QEX A;  5LMN W;  1KXL A;  1D7Q A;  1SRO A;  2CKZ B;  5C0X G;  4R4T A;  3DLL A;  3A74 A;  4DR2 L;  4LF4 L;  1YZ6 A;  1Q81 C;  1YI2 A;  2GN5 A;  4QQB X;  1PFS A;  3JAM c;  4JI6 Q;  4JI1 L;  5IYB G;  1N36 L;  5IY0 A;  4DV6 L;  4LF5 Q;  4EQ5 A;  4A3G H;  4EX5 A;  1V9P A;  4A3B G;  4Y52 H;  4IOC A;  2UXD Q;  4A93 G;  4MNO A;  3OW2 A;  4GOP C;  1ASY A;  1E22 A;  4DKA C;  1XTD A;  3PUW A;  4DV4 L;  1IYJ B;  1VQM A;  3EBE A;  2IHF A;  1RIP A;  3K8A A;  1OXU A;  2JA5 G;  1GO3 E;  4B3M Q;  4P72 A;  1LYL A;  1YVC A;  3CCM A;  1VQG A;  3S15 H;  4UP8 A;  4DUY L;  1YEZ A;  2E2I H;  1KD1 C;  2JA7 H;  1KQS A;  3VDY A;  2UU9 L;  1Y1V G;  1MIU A;  1ASZ A;  3GDE A;  2MFI A;  4A3E G;  3B6Y A;  2D62 A;  5M3M H;  5IYD G;  3K81 C;  1EQR A;  3UDI A;  2HHH L;  1Q1E A;  3JAM i;  3G6E A;  4JI5 Q;  1CKM A;  4NXM Q;  1HZC A;  3PUV A;  3OTO L;  2F4V Q;  4DV0 Q;  3E9I A;  2ASB A;  3ICE A;  3IRB A;  1V43 A;  4A3F G;  4UP9 A;  1OXX K;  5FJ8 H;  1MJE A;  1HR0 L;  2ZJQ A;  4B3S Q;  3HOW G;  3PUX A;  1IBM Q;  3T1H Q;  1PV4 A;  1CKN B;  1YIT A;  4JC0 A;  2PI2 E;  3GTO H;  5LMU L;  1EYG A;  3D31 A;  1AE3 A;  1K83 H;  4BA1 I;  1VQP A;  2JQO A;  4YWK A;  1NBW A;  4XTC S;  4ALP A;  1HJP A;  3W1B A;  5GRO A;  5ELN A;  2HIV A;  4OWW B;  1UE5 A;  4JI4 Q;  2QGQ A;  1OXT A;  3BZC A;  4JI6 L;  4LF5 L;  4AIM A;  1X56 A;  1K0R A;  2JJQ A;  1A8V A;  2K14 A;  4X64 Q;  1U5K A;  1UE6 A;  1X3E A;  4YCW A;  2WFW A;  1L2F A;  4PMW A;  1I94 Q;  4MZ9 A;  2GVB A;  3ULP A;  3MXN B;  2YU9 H;  3PV0 A;  5EAY A;  2VUM H;  3CME A;  4WJ3 M;  1UE7 A;  3HOZ G;  5GQO A;  1Y1W H;  1I3Q H;  2OQK A;  2CCZ A;  1TWF H;  1VQK A;  4A3C G;  4OO1 I;  4LF9 Q;  4B3M L;  2I5L X;  3AEV A;  1SFO H;  2PI2 A;  2Z6K C;  4KI0 A;  1QUQ A;  5M3F H;  3HOY H;  4A3L H;  4LW1 A;  2VNU D;  1J6Q A;  3I7F A;  4GLA C;  3S17 H;  5ELO A;  3CCE A;  3HFZ B;  3S1N H;  3S2D H;  2BA0 A;  5IE8 A;  3H0G H;  3EIV A;  5IP9 H;  1VQ5 A;  3J81 j;  1FVI A;  1GD7 A;  3BU2 A;  1TWA H;  3G4S A;  4A76 A;  1JT8 A;  1GVP A;  3UDF A;  2R7Z H;  2UUA Q;  2YV5 A;  3ULL A;  4HJA A;  4JI5 L;  2YTV A;  1VQO A;  4NXM L;  5M5Y H;  1NY4 A;  1YHB A;  2YTX A;  1Q86 C;  4GLX A;  4JOI C;  2F4V L;  4DV0 L;  2K50 A;  4A3M G;  3NBH B;  1QVF A;  2UXD L;  4B3S L;  3KDF B;  3JC6 6;  4LF8 Q;  4A3B H;  1IBM L;  3T1H L;  4C3I H;  2JA8 G;  1FL0 A;  3TS0 A;  2LXJ A;  4YWL A;  1VQA A;  5GAH C;  2ZM6 Q;  4H02 A;  3PGZ A;  4GS3 A;  2MQH A;  1YBY A;  1D8L A;  3RLO A;  5DLQ E;  3RLF A;  4GOP B;  4X66 Q;  4A75 A;  4JI4 L;  1CKO A;  3PUY A;  4A3J G;  4X62 Q;  3HOU G;  1Z9F A;  1EUJ A;  4X64 L;  5H1S E;  1IL2 A;  4C3J H;  3J7A 5;  1I94 L;  4L5Q A;  4IJH A;  4OO1 G;  5IP7 G;  3GTQ H;  4QY7 A;  4JG2 A;  2WAQ G;  3TRZ A;  3Q8D A;  4O0A A;  1VQ4 A;  4NXN Q;  3D0F A;  1Q12 A;  4LF9 L;  2E2J H;  4RMF A;  3S1M H;  3CMA A;  4LFC Q;  2I5M X;  1YJN A;  1W2B A;  1EFW A;  2RHQ B;  1N9W A;  2DUD A;  4GN5 A;  1VQ6 A;  1YHQ A;  3L0O A;  1VQH A;  2OQ0 A;  4OXP A;  4A3I H;  2NVT H;  1XMQ Q;  1KAW A;  4L5S A;  1G6P A;  3RN5 A;  2JA6 G;  3K7A H;  5E7N A;  3CC7 A;  4DR1 Q;  2UUA L;  1EWI A;  1VQ7 A;  2KBN A;  1K8A C;  4DR7 Q;  3S2H H;  3PIP A;  5LMN Q;  2R92 H;  3J80 c;  2RCN A;  4UPA A;  4P75 A;  1P8L A;  3FP9 A;  1FGU A;  1SRU A;  2WB1 E;  2JEA I;  1KL9 A;  3E9H A;  1HZA A;  2KCT A;  4P71 A;  4LF8 L;  3FKI G;  4POF A;  1LUZ A;  2Q2U A;  2Z6K A;  1I5F A;  2CWP A;  3GD7 A;  3EN2 A;  4DR3 Q;  3GTG H;  4JBW A;  4DR6 Q;  1NTG A;  2R93 G;  1XPO A;  1C9O A;  1TWC H;  3UE0 A;  2ZM6 L;  4A3C H;  4AYB G;  2A8V A;  2R7D A;  4BY7 G;  2CFM A;  4BA2 I;  4X66 L;  4JV5 Q;  2D0O A;  3S24 A;  1SLJ A;  2Y0S G;  1PH3 A;  4AYB E;  4X62 L;  3CPW A;  2UUC Q;  1KRT A;  1TWG H;  4IFD I;  1P16 A;  1VQ9 A;  4GKK Q;  2K5N A;  3F1Z A;  3KF6 A;  4DK3 C;  2UXB Q;  1MJC A;  1S40 A;  3J80 i;  1BKB A;  4JOI A;  3PF5 A;  4IPG A;  3I2Z A;  2Q2H A;  4NXN L;  4GNX C;  4L5R C;  5C44 G;  3A0J A;  1IXR A;  5JEA J;  2NZH A;  3M9B A;  1CUK A;  2E8G A;  4GN3 B;  4LFC L;  3CC2 A;  1PYS B;  4YCU A;  1JJC B;  2MNA A;  4BXX G;  1EIF A;  2IT1 A;  4IJL A;  3U58 A;  4A3M H;  1N33 Q;  3I4M G;  3HOV G;  4HJ8 A;  2RHS B;  3UDG A;  4A3D H;  3CCV A;  1IZ6 A;  1XMQ L;  1FJG Q;  1NMG A;  3BJU A;  3CF5 A;  4DNI A;  1VCI A;  4DR1 L;  1PH8 A;  2N3S A;  5FLM G;  2OCE A;  5LMN L;  1YJ9 A;  4PZ8 A;  2ZTD A;  3CCR A;  1YIJ A;  3NEL A;  1HNZ Q;  1PH2 A;  2ALY B;  3HOU H;  3PO3 G;  4JBJ A;  1V1Q A;  3S16 H;  5IT9 c;  2B63 H;  2NVY H;  2VS1 A;  2IX0 A;  2F3I A;  5IP7 H;  4IPC A;  1QZH A;  2I5H A;  4DR6 L;  2I0Q A;  4LFA Q;  4DR3 L;  1K73 C;  2K52 A;  1HNW Q;  4OWT B;  4JI2 Q;  1TWH H;  4A3K G;  3AFQ A;  3M4P A;  3FHW A;  4XIG S;  3RN2 A;  3CW2 C;  4IFD G;  2NVQ H;  1A0I A;  3L7Z C;  3RR5 A;  3I55 A;  1Q8K A;  3KJO A;  3S1Q H;  4JV5 L;  2UUC L;  3PSI A;  1L1O B;  3PO2 G;  4R4O A;  1JMC A;  3G48 A;  1VQD A;  3CPF A;  4YY3 Q;  1QVG A;  4GKK L;  1JJ2 A;  3KYH C;  2UXB L;  4IO9 A;  2FXQ A;  3ULJ A;  4JI8 Q;  2JA6 H;  1X3F A;  3GTM H;  1MKH A;  5GAD C;  5IWA Q;  4BBR G;  1O7I A;  4ME3 A;  2R7F A;  1GM5 A;  4DAY B;  2JK8 A;  1BBU A;  1N33 L;  1LM0 A;  1SN8 A;  3A5Z B;  3CCQ A;  1Q82 C;  4BY1 H;  3PCO B;  1DGS A;  4GKJ Q;  1QUQ B;  1WJJ A;  4O2D A;  1HZB A;  1FJG L;  2CWA A;  5JJK A;  3TQY A;  2NVX H;  3H3V H;  1E3P A;  1E24 A;  2Q2T A;  4GN4 B;  3ZJY C;  3CCL A;  4JBK A;  1PVO A;  3DM3 A;  5IYB H;  3KF8 B;  3TEH B;  3F8T A;  4B3T Q;  3I4N G;  4BY7 H;  3I56 A;  4DV7 Q;  4JCV E;  1IBK Q;  4A93 H;  1XPR A;  1HNZ L;  2UUB Q;  4JI0 Q;  1YHA A;  2MO1 A;  4GNX A;  3CXC A;  1B70 B;  3KDF A;  2JA5 H;  2YTY A;  1VQL A;  4JYA Q;  3NEN A;  4DV3 Q;  4LFA L;  1HNW L;  4JI2 L;  5M5W H;  2ID0 A;  3HKZ G;  4LUZ A;  5C44 H;  2AKW B;  4LWC A;  1Y1V H; 
#chains in the Genus database with same CATH topology
 3A8J E;  5M3M G;  5KYL A;  1D5X C;  4XT1 B;  3VR6 A;  3UE1 A;  3HOX G;  1MSH A;  1I4P A;  1RCV D;  2WAQ E;  4H7B A;  2B39 A;  1E1T A;  4LAA A;  2E5L Q;  1HTL D;  5E4X A;  5KND A;  1Y8P B;  1LT3 D;  1PZJ D;  4UDU C;  4QUF A;  1X3G A;  4A3D B;  1EWH A;  2R6G A;  3VYR A;  1PH4 A;  3D4D A;  5LL6 X;  1PH5 A;  1PRT C;  3DWP A;  3URY A;  4RGO S;  1A3T A;  3F2C A;  1V8Q A;  2N49 A;  4IFD H;  1D1K A;  3BYY B;  3GTL H;  4IN3 A;  3L2P A;  3A8I E;  1VQ8 A;  1LAC A;  2R61 A;  1ZEQ X;  4KD4 A;  2G9H D;  1C7Y A;  3HP3 A;  1EIG A;  2YYZ A;  5IGB A;  1DJR D;  1SJH D;  4NMZ A;  3I73 A;  4HID A;  4TSS A;  2WAC A;  4RCO A;  4DR7 L;  1VQI A;  4QIW E;  4DPG A;  3CCS A;  3BDO A;  5DM7 3;  1D2B A;  1JE5 A;  2B8G A;  1HR0 W;  4V0B A;  1SNP A;  2EYM A;  1TY0 A;  4KLK A;  2JA9 A;  2E5L L;  1SFO B;  2H1E A;  2JA6 B;  4IUV A;  5K36 G;  3I4N H;  2SNM A;  2GA4 B;  3SK6 A;  5AJ3 Q;  2JA8 H;  5IGD A;  3RMH A;  3QOL A;  3LWE A;  1A63 A;  5HGT A;  2NN6 G;  5IT9 L;  3F2B A;  1H95 A;  1LV9 A;  3PIO 3;  5C3E G;  4GZY C;  4A3J H;  4KHP Q;  1PTO H;  1JR0 D;  2CH4 W;  3U50 C;  2PMZ E;  4KY7 A;  5HGQ A;  1T9H A;  5CV5 A;  5FKA C;  4A93 B;  1BO0 A;  2OEO A;  2Y0S B;  5I4D A;  2B2U C;  1PH9 A;  2ZJR A;  4OX9 Q;  4FP5 D;  2EZV A;  2K01 A;  4BBS G;  1X55 A;  1EY7 A;  1KDB A;  2F0E A;  5C44 B;  2PNH A;  4A3E B;  1H9S B;  1L0Y B;  5BN3 A;  2EYL A;  3IL8 A;  1AZP A;  3ND8 A;  2R92 G;  2HCI A;  2EJF C;  4PZ6 A;  2WKC A;  1E2V A;  1ESR A;  3A7A B;  4TQU S;  2NTT A;  4GLV B;  4L6T B;  5AJ3 L;  1CQF A;  1HFN A;  5ELB A;  4YHH Q;  1H9R A;  2KUM A;  2L5T A;  5L37 A;  2CQO A;  4A4I A;  2MO0 A;  4KHP L;  5KEE A;  1HQR D;  4R4C A;  1U4R A;  2IW3 A;  4AQY Q;  2PW7 A;  3T16 A;  3AQQ A;  1JWM D;  1A62 A;  1WCM H;  1ILQ A;  4TVA B;  5JJL A;  2RKS A;  4QL5 A;  4OX9 L;  2JA7 H;  1X6O A;  3S1R H;  3I4M H;  2JE6 I;  4NW2 A;  5IIF A;  5EKL A;  2AHO B;  2XTI A;  4BBR B;  1JB7 A;  4J8Q A;  1SYD A;  2N88 A;  3OYY A;  4DV6 Q;  3TN2 A;  2IHE A;  4C2M H;  4HR7 B;  3M85 A;  1GOZ A;  2IX1 A;  2ZTE A;  5T1G A;  3K59 A;  1RTO A;  4IFD J;  4KD3 A;  2HT1 A;  1TXY A;  1CHQ D;  1TS2 A;  1X9N A;  4YHH L;  1YNN C;  1I6H H;  4IPD A;  4PQX A;  1TY2 A;  4LNQ A;  5IGG A;  2DY7 A;  3K5L A;  2SOB A;  5IT9 E;  3M3Y H;  4DK6 C;  4A3L G;  1BBW A;  4AQY L;  2JYO A;  4IUP A;  2A1A A;  2OTJ A;  3J81 i;  2WB1 G;  5EKI A;  2L15 A;  4P74 A;  1GUG A;  1H9J A;  2C35 B;  3RZO H;  1WOC A;  3BZD B;  4HMJ A;  3W1G A;  4BY1 G;  3HKS A;  2QEX A;  4N8X 1;  2A6E D;  3JAM c;  5COY A;  4LF5 Q;  1I4H A;  5IY0 A;  4DV6 L;  4A3G H;  2Q8I B;  4A3B G;  1ZYR C;  4LJZ C;  1WTH A;  2UXD Q;  3I70 A;  4Y52 H;  3LX0 A;  4EQN A;  5I6W A;  2FMM A;  1F9Q A;  4DKA C;  1RIP A;  3K8A A;  4HED A;  3VR4 A;  4B3M Q;  5C5M A;  1G6Z A;  2R93 B;  2NBF A;  4CDE C;  1ASZ A;  1R9T B;  1FYC A;  3B6Y A;  1DOK A;  1SYC A;  1KTK A;  4ZYS A;  1QIL A;  1HRJ A;  1CKM A;  5C4H A;  2ASB A;  2RDG A;  4O42 A;  2B2Y C;  1V43 A;  4UP9 A;  1OXX K;  3TP7 A;  1PV4 A;  1CKN B;  1MSG A;  1UNS A;  4JC0 A;  2L9H A;  3SDZ A;  2PI2 E;  4FNF A;  2F0G A;  4BA1 I;  3PIP 3;  1NBW A;  4ALP A;  2HIV A;  4LF5 L;  1K0R A;  2JJQ A;  1A8V A;  2F0F A;  1X3E A;  1UE6 A;  4YCW A;  1I94 Q;  2UXD L;  3ULP A;  3QR8 A;  4TKO B;  4WJ3 M;  2KVM A;  3FEW X;  1I3Q H;  1VQK A;  1GXD C;  1QNK A;  2FMC A;  5G3L D;  4B3M L;  3AEV A;  1FNV A;  4KI0 A;  5M3F H;  1PFB A;  1UUP A;  2IJ0 A;  1BCP F;  1UAP A;  1O78 A;  1SE4 A;  2ZT9 C;  5E1F A;  2E2H B;  4A3K B;  3BU2 A;  4CJ0 B;  3QB3 A;  1TWA H;  3H6M A;  1DXM A;  1MBY A;  1EU3 A;  1KLG D;  2R7Z H;  1IHZ A;  4OL7 A;  3NPP A;  3MEH A;  4GLX A;  4JOI C;  4IUT A;  2K50 A;  4K6L A;  1IKL A;  3H09 A;  3KDF B;  3AB9 A;  3C46 A;  1II3 A;  2JA8 G;  1FL0 A;  3ERQ A;  3SR1 A;  3R8B A;  5GAH C;  3S14 B;  1TKW B;  4H02 A;  4GS3 A;  1YBY A;  5DLQ E;  2MPM A;  4X66 Q;  1CKO A;  1CT1 D;  4A3J G;  1ONL A;  4FVM A;  4C3J H;  1VMC A;  1I94 L;  1IL2 A;  3Q0A A;  2B2V A;  3I4N B;  4JG2 A;  2WAQ G;  1QWY A;  3W3A A;  3Q8D A;  3ITP A;  4O0A A;  4NXN Q;  3TRZ A;  1Q12 A;  4RMF A;  3CMA A;  2O2L D;  2I5M X;  1YJN A;  1W2B A;  3H94 A;  4QMG A;  1YHQ A;  4OXP A;  1PDQ A;  2F3W A;  1G6P A;  3RN5 A;  2ZXR A;  4ZCK A;  4KTA A;  1A3U A;  3J80 c;  2RCN A;  1NNX A;  3S9W A;  1FGU A;  1SRU A;  3E9H A;  3JAM L;  1HPC A;  5CYU A;  2Q2U A;  2AUK A;  3EN2 A;  1XPO A;  1C9O A;  1TWC H;  3FMC A;  2A8V A;  4G7Z C;  2LFN A;  4HSP A;  4X66 L;  2D0O A;  2UUC Q;  4IFD I;  1P16 A;  3NQT A;  2K5N A;  3F1Z A;  4DK3 C;  1SMY D;  2A69 C;  2UXB Q;  4FF4 A;  1EZ6 A;  4C56 C;  5JPM C;  3PF5 A;  4NXN L;  4GNX C;  1PRT F;  4L5R C;  1Y1W B;  3A0J A;  1TWF B;  2OT2 A;  1CUK A;  3FVQ A;  1PYS B;  5C4Z A;  4A3M H;  2IT1 A;  4IJL A;  4DGZ A;  1K28 A;  3I4M G;  4A3D H;  3S17 B;  3H0G B;  1FJG Q;  1JOQ A;  4F7X A;  2N3S A;  5FLM G;  3A7L A;  1YJ9 A;  4PZ8 A;  3ONA B;  2AQ3 B;  3CCR A;  5M5Y B;  1PH2 A;  3HOU H;  2XRS D;  1V1Q A;  3C1F A;  2JA7 B;  3QOJ A;  5C3X A;  1VDZ A;  2VS1 A;  2VB3 X;  3BVZ A;  2I5H A;  4LFA Q;  1S5F D;  4H0L C;  2N55 A;  3CW2 C;  2X6L A;  3I55 A;  1Q8K A;  3KJO A;  2AQ2 B;  2UUC L;  1I4R A;  2EE1 A;  1VQD A;  3CPF A;  1QVG A;  5A2Q E;  3KYH C;  2UXB L;  2JA6 H;  1MKH A;  5GAD C;  3NK9 A;  1I6H B;  1FNW A;  1T5E A;  1U4P A;  2ZXO A;  3DWA A;  2R7F A;  3S1M B;  1BBU A;  2B2W C;  3CCQ A;  1EY9 A;  3PCO B;  2F0Q A;  4HCS A;  1WJJ A;  1HZB A;  1PMR A;  2K04 A;  4CHT B;  1FJG L;  4A3I B;  2Q2T A;  1PVO A;  3ZJY C;  1JWU D;  5IYB H;  3K7A B;  4K2K A;  3TEH B;  3F8T A;  4B3T Q;  4JCV E;  3S2H B;  4A93 H;  2F0J A;  3MXU A;  2EVB A;  1YHA A;  2B2T A;  3KDF A;  1YNJ D;  2NTS A;  2YTY A;  3E0J A;  4LFA L;  1O7Z A;  3D6W A;  4HAE A;  2ID0 A;  3F2U A;  5C44 H;  2AKW B;  3OMG A;  1N8R C;  2QF7 A;  4A3G B;  4A3E H;  5IYD H;  4IAL A;  3VYU A;  3HOV H;  4H13 C;  3HGB A;  1TWG B;  1E2Z A;  3HEJ A;  2EIF A;  2VW9 A;  3H15 A;  3C1E A;  4DXF A;  1EL0 A;  1B8A A;  2D9U A;  3NP8 A;  1XYI A;  4OGQ C;  4CKC A;  3FDT A;  3J80 L;  4PG3 A;  2QIL A;  1CSP A;  3SXH A;  2B29 A;  1U0L A;  1AW7 A;  1VQJ A;  3QG1 A;  3BG3 A;  4IUQ A;  4OON A;  1M8A A;  2G5D A;  2JP1 A;  4QGU A;  4KK7 A;  4WOR A;  1B7Y B;  1X3Q A;  4DAM A;  5GAG C;  2KHI A;  1KIX A;  1TS5 A;  2RBM A;  4B3T L;  2PQA B;  2AWN A;  1K8G A;  4I7Z C;  1WD0 A;  1O7Y A;  3CD6 A;  5T1I A;  1KDA A;  3OOC A;  3MXG A;  1SR3 A;  2NVY B;  5M3F G;  1VQN A;  2BH2 A;  2F0P A;  4BBR H;  1QVC A;  4DR4 Q;  1LLR D;  3NUC A;  1ENA A;  3L3O C;  4KKS A;  4FDB A;  1B1Z A;  2H5X A;  4DNT B;  2R7Z G;  1OXV A;  1TT2 A;  4N9P A;  1I3Q B;  4G7H C;  4DK1 A;  4C3H G;  2GVA A;  2VQE Q;  3D4W A;  4X6A H;  3N52 A;  2B3G A;  1TWA B;  2ZJP A;  4WRD A;  1G29 1;  3E0E A;  1BCP C;  2LXK A;  4G7O C;  3BDC A;  3DWQ A;  4KN7 C;  2D0P A;  5CBE E;  4AYB B;  1LT4 D;  4ZKC B;  5AFW A;  1K9M C;  3NEM A;  3VR5 A;  2ES2 A;  2J4X A;  3MTS A;  2JA5 B;  5KYI A;  4NKL A;  1E2W A;  1PYB A;  4DR4 L;  5M5W B;  1GKH A;  4C3J B;  2CHB D;  2VL6 A;  2EJM A;  1DCZ A;  2OF1 A;  1Q7Y C;  2X69 A;  1PYW D;  3CQZ B;  1BNZ A;  3WDN A;  2Z4H A;  2VQE L;  3Q6S A;  3X3N A;  5C4X G;  1C0A A;  4RG1 A;  3GTK B;  3V96 A;  2R93 H;  3V2T A;  3J80 E;  4Q0F A;  5EPJ A;  1R9T H;  4LUO A;  4CDD C;  3RNU A;  2KCC A;  1GUW A;  4B3R Q;  1LTA D;  1Y8O B;  4DN4 M;  2IX3 A;  4MHE A;  3TSS A;  2LSS A;  5FK9 C;  1WTW A;  3A5U A;  1X3P A;  2Z6B A;  1KRS A;  5CMD A;  3CAM A;  1PTO F;  3IKJ A;  2B8F A;  3CU7 A;  4GOP A;  3NE5 B;  3TP5 A;  4A3D G;  4DU9 A;  3QO2 A;  3KBG A;  3GTP B;  4DR2 Q;  1M1K C;  4LF4 Q;  2SEB D;  1SJE D;  1WI5 A;  3BDL A;  4K8I A;  1B53 A;  3TZD A;  4HJ9 A;  5C0X I;  1RL2 A;  3H3V I;  1AN8 A;  4J15 A;  3KJP A;  4OWX B;  2M00 A;  4DV4 Q;  2F0T A;  4A3M B;  3E5S A;  1BCP B;  3T13 A;  2EQS A;  3AFP A;  4QB4 A;  2E2H H;  1LTB D;  2QDL A;  1EQQ A;  4JBM A;  1PA6 A;  1E0B A;  1L1O C;  1S3O A;  4A3K H;  1G2S A;  2PZW A;  4B3R L;  2Q8T A;  4C1N K;  5ELC A;  2XGT A;  4JVZ A;  1BOS A;  2NUC A;  5D3I B;  3G71 A;  2OWO A;  3HOU B;  2PQA A;  1EY4 A;  1AEX A;  1GUO A;  2HIX A;  2PO4 A;  3UI2 A;  1HR0 Q;  4R4Q A;  5IYC H;  3TP6 A;  2F0L A;  3I4L A;  1S72 A;  3S14 H;  5LMU Q;  1B44 D;  1SYB A;  5LMN W;  3J7A F;  3VYS A;  4DR2 L;  4LF4 L;  3DLL A;  1AFP A;  1YI2 A;  1PFS A;  5IYB G;  2EY6 A;  4EQ5 A;  3BVG A;  5J39 A;  1STE A;  1HUN A;  1XX8 A;  4IOC A;  4A93 G;  4MNO A;  1ASY A;  1XTD A;  3PUW A;  4DV4 L;  4EVO A;  2IHF A;  1GO3 E;  1ZYR D;  4P72 A;  3CCM A;  3FKI B;  5JJZ A;  2RDF A;  4WFN 3;  3TDQ A;  2E2I H;  3VDY A;  3MWY W;  1NCV A;  1CI3 M;  5M9O A;  4A3E G;  5IYD G;  3UDI A;  1EQR A;  1Q1E A;  4JI5 Q;  2B2V C;  2M2L A;  4NXM Q;  1HZC A;  2QCP X;  3E9I A;  2E76 C;  4B3S Q;  5FJ8 H;  1HR0 L;  4E6I A;  3SVM A;  3CHB D;  1IBM Q;  2EY5 A;  4FF3 A;  4ODG A;  3GTO H;  5LMU L;  1EYG A;  1STG A;  4CKE A;  1VQP A;  2JQO A;  4YWK A;  3HOV B;  4XTC S;  3DXJ C;  2L1B A;  4ZRZ A;  1RKN A;  3MFG A;  1X56 A;  1KAB A;  1IYU A;  1GUN A;  2A6H C;  4ILW A;  4X64 Q;  2WFW A;  3MXN B;  5EAY A;  1PRT B;  3I3C A;  4DAY A;  3KLR A;  5GQO A;  1Y1W H;  2OQK A;  5C3E B;  1TWF H;  2DN8 A;  4LF9 Q;  3MHB A;  2PI2 A;  1IW7 C;  1QUQ A;  2VNU D;  1J6Q A;  3GV3 A;  3K5M A;  3S17 H;  3HFZ B;  1WTQ A;  2BA0 A;  3H0G H;  5C4J B;  4FYD A;  3KF8 A;  1VQ5 A;  3PQI A;  5CV8 A;  4A76 A;  4FO2 A;  1U4L A;  3UDF A;  1EYD A;  4FXG C;  1R4P B;  4BBS B;  5I9P A;  4JI5 L;  2MP1 A;  2YTV A;  4NXM L;  5M5Y H;  1FR3 A;  1NY4 A;  2PW5 A;  4MTK A;  1Q86 C;  3FPP A;  5D14 A;  3NBH B;  4B3S L;  3JC6 6;  5IGE A;  1IBM L;  1EU4 A;  3TS0 A;  3PMF A;  3G7L A;  4B9X A;  1D8L A;  3NWT A;  4RA8 A;  5IOD A;  1ILP A;  4IUN A;  1FGB D;  5IOC A;  1TVX A;  4X3T A;  3FPU B;  4X64 L;  3J7A 5;  4H44 C;  1F2L A;  1MGS A;  3A8K E;  4QY7 A;  4FXD A;  2HQE A;  3D0F A;  4LF9 L;  3S1M H;  3OWF A;  1Q90 A;  4GN5 A;  2DUD A;  3X3M A;  1IKM A;  5JVH 3;  2OQ0 A;  3HKZ B;  2K33 A;  4A3I H;  1DD2 A;  1KAW A;  4L5S A;  3K7A H;  1TR5 A;  2HCC A;  5E7N A;  5J1Z A;  4FF1 A;  1VQ7 A;  1JIC A;  3S2H H;  1O7L A;  4UPA A;  2F0N A;  2CVR A;  2EYO A;  2JEA I;  4U68 A;  1KL9 A;  3K5N A;  4BWG B;  3U9S A;  1C4Q A;  1EQT A;  4DFA A;  4DR6 Q;  3GD7 A;  1BQQ T;  2R93 G;  1RTN A;  1G8Z D;  1STN A;  3UE0 A;  4A3C H;  1JE4 A;  2CFM A;  2MUY A;  1EY6 A;  4ZQ3 A;  2EPB A;  2K32 A;  3S24 A;  1IL8 A;  1PH3 A;  5IGF A;  4AYB E;  1SND A;  1TWG H;  2JXM B;  1VQ9 A;  4KKU A;  1NAP A;  1HFG A;  3A54 A;  1MJC A;  2VUM B;  2B2T C;  1J8I A;  4ZUI A;  4GN3 B;  2A69 D;  3CC2 A;  1MD2 D;  2E8G A;  2MNA A;  3HOY B;  1EIF A;  2F3V A;  1N33 Q;  4HJ8 A;  2RHS B;  1IZ6 A;  2WV6 D;  1BF4 A;  4DNI A;  4CBV A;  1VCI A;  1NUC A;  4FF2 A;  1I4G A;  2ENB A;  1HNZ Q;  4OO1 H;  2NVY H;  3EFX D;  2QW7 A;  2F3I A;  5IP7 H;  4A3B B;  4DR6 L;  2I0Q A;  1SYE A;  4C3I B;  4NDX A;  1HNW Q;  4OWT B;  1H9S A;  4A3K G;  2LKV A;  3AFQ A;  3FHW A;  3M4P A;  4RAU C;  4IFD G;  1PTO C;  3L7Z C;  1HTP A;  1HUM A;  3SK8 A;  3PSI A;  4MN3 A;  4R4O A;  4B9W A;  3GTQ B;  1X3F A;  3G6J B;  5IWA Q;  2I07 B;  4ME3 A;  3TME A;  5ELF A;  1N33 L;  1LM0 A;  4K5X A;  3A5Z B;  1CA5 A;  2XNA C;  5KNB A;  4O2D A;  1EOT A;  5C0X H;  2CWA A;  2I46 A;  3TQY A;  3H3V H;  1E3P A;  1JB3 A;  3RUZ A;  5EPK A;  2KHS A;  3M7G A;  3MVV A;  4LMQ D;  3I4N G;  4BY7 H;  1JOR A;  4XQJ A;  4JI0 Q;  2E74 C;  1HNZ L;  3NBH A;  1I4Q A;  2VB2 X;  2JA5 H;  2XN9 C;  4JYA Q;  1VQL A;  4DV3 Q;  2DJF C;  3P7J A;  2RCF A;  2O5I C;  1HNW L;  1STA A;  5M5W H;  3GTG B;  4G4K A;  4LWC A;  5EBD A;  3QWN A;  1UE1 A;  2JSO A;  3V05 A;  4HTH A;  2BA1 A;  3CQZ H;  3NHH A;  1N34 Q;  2UXC Q;  3CRL C;  1HH2 P;  4MTN A;  5IWA L;  1F9P A;  4XT3 B;  2E2I B;  5CR3 A;  4DXG A;  3GTK H;  4AH6 A;  4BS9 A;  5IGC A;  2D5D A;  1J5E Q;  1SAP A;  2FIN B;  1Z47 A;  4IQZ A;  3D3R A;  3O13 A;  5ELE A;  1W6J A;  2K7V A;  3ERS X;  1PFM A;  3VYT A;  1KDC A;  1WFQ A;  4JI0 L;  3GTO B;  2F0U A;  4JK1 C;  4RH6 A;  4DNR B;  5KRU A;  1UEB A;  4JYA L;  2K5W A;  5ISR A;  5FLX c;  2B63 B;  3S16 B;  2L55 A;  4DV3 L;  4ZAI A;  3GTP H;  4LK1 C;  2PPB C;  3H0G G;  3OHX C;  4K14 A;  1XMO Q;  2Y0S E;  3M4Q A;  2ZXP A;  2NVQ B;  3H91 A;  1ROD A;  4ZUJ A;  3S1Q B;  1WCM G;  2V1C C;  4TRD A;  3WWV A;  4DV5 Q;  4X3S A;  4UY8 C;  2K28 A;  1EOV A;  1L0X B;  1N34 L;  1V1P B;  2UXC L;  1DOM A;  2JA7 G;  1QB5 D;  1K0S A;  3KF6 B;  4WJ4 A;  4DA2 A;  2F0W A;  3MC0 B;  4DV2 Q;  3CP0 A;  2BOS A;  1J5E L;  1HHV A;  2EY2 A;  2XIW A;  4JI3 Q;  3KOJ A;  2VY3 A;  5M5X H;  1S4Z A;  2HQL A;  1AH9 A;  2F1M A;  2KEC A;  1WTX A;  3U4V A;  1BCP D;  3KFU A;  1SYF A;  1WTR A;  1CKN A;  1C8C A;  1AZQ A;  2AMC B;  3HOX H;  1SNQ A;  1Q1B A;  5DM6 3;  1CSQ A;  5J3B A;  1Y69 U;  1VQB A;  3J7Y W;  1XMO L;  4A3I G;  1Y1V B;  2C9O A;  4XYQ A;  1K3R A;  1RHP A;  2VXW A;  1NMF A;  1SE3 A;  4HMI A;  1VMP A;  5C0X J;  4DV5 L;  2QA4 A;  1X32 A;  3PF4 A;  3SGI A;  3GTJ H;  3I90 A;  2Z9H A;  5CV9 A;  4HJ7 A;  3KLW A;  3IAY A;  3STB C;  4A3F B;  3FKI H;  4MIU A;  1BVS A;  4X3K A;  4DV2 L;  4LF7 Q;  3HOW B;  3OW7 A;  4POG A;  4XXE A;  1NE3 A;  4A3G G;  4JI3 L;  1Q8I A;  1SNO A;  5KIX A;  4UP7 A;  1EZ8 A;  2BH8 A;  5DNF A;  3DEP A;  4CJ2 C;  2KEE A;  5NUC A;  3JAM E;  3PUZ A;  4N8F A;  5JAV A;  4HIO A;  2DNC A;  3HOZ B;  1ET6 A;  2DNE A;  3DHQ A;  4YWM A;  2KEN A;  1I4X A;  1K3B C;  3HKZ E;  5CC4 A;  5BR8 Q;  4GNX B;  5HUR A;  4U67 3;  2AWO A;  2IPK D;  5BN4 A;  4NPS A;  1GHJ A;  4R1J A;  4M8A A;  1L0W A;  2DJG C;  4KHV A;  4ID6 A;  3KBX A;  4Y7N B;  1TS4 A;  1LTL A;  1SMX A;  1JOO A;  4EGV A;  3PIO A;  5C3E H;  3J81 c;  2K6A A;  3T51 B;  1SEB D;  4RGT A;  5C5L A;  4PZ7 A;  2F0M A;  3BVM A;  3T56 B;  4LF7 L;  1PH1 A;  4YCV A;  4HIK A;  5C4J H;  3CRK C;  3M7N A;  5DAU A;  2PZU A;  2IY5 B;  3M4O H;  3TZU A;  1PRT D;  3R2I A;  2OXP A;  4BBS H;  1BUV T;  3TBI B;  1XPU A;  1STH A;  2RQX A;  3N6R A;  3Q24 A;  2F0H A;  4KHZ A;  2A19 A;  1J9O A;  2BDN A;  2KHJ A;  1K8O A;  1B4O A;  4IPH A;  1R4Q B;  1RF2 D;  5BR8 L;  4XQQ A;  4DAP A;  2IWH A;  4ZKB B;  1D5M C;  2AQ1 B;  1KXL A;  1D7Q A;  5C0X G;  5FO8 B;  3T53 B;  1YZ6 A;  1Q81 C;  3HZX A;  4L63 B;  4QQB X;  4EX5 A;  1V9P A;  1TS3 A;  4KJN A;  1ESF A;  1VQM A;  2CW0 C;  4PMC A;  2JA5 G;  1FNU A;  2A73 B;  4UHV A;  1LYL A;  1YVC A;  1HCZ A;  1D1I A;  1VQG A;  3R2T A;  3FRP B;  1QE6 A;  1KQS A;  1S5B D;  3DM1 A;  4K8J A;  4C3J G;  1F2M A;  2MGS A;  5ELD A;  4BY7 B;  4QCL A;  5BN5 A;  4RKL A;  2ICI A;  3JAM i;  5JEA H;  4PNY A;  2F4V Q;  4DV0 Q;  1K8M A;  1MJE A;  4RHR A;  3PUX A;  5LHY 1;  1YIT A;  4OIK A;  1U9R A;  5TSS A;  1TQO A;  2TSS A;  1OO9 B;  5ELN A;  3MAQ A;  1OXT A;  1CZG A;  4AIM A;  2K14 A;  3ERO A;  1VF5 C;  3NQI A;  2K5D A;  4PMW A;  4QF4 A;  2A68 C;  2VUM H;  3PV0 A;  1XWE A;  1UE7 A;  2BCO A;  3M4Y A;  4OO1 I;  2CCZ A;  2F0K A;  2A5H A;  3PO3 B;  5I9O A;  2I5L X;  4A3L H;  3WOF A;  3HOY H;  4LW1 A;  3I7F A;  4GLA C;  5ELO A;  3MZ5 A;  3S2D H;  3EIV A;  4Z9C B;  5IP9 H;  3OIQ A;  1FVI A;  2Z8L A;  1WTV A;  1S5E D;  2WIN B;  1JT8 A;  1GVP A;  2Z1C A;  3ULL A;  3PO2 B;  2L0C A;  2F4V L;  2MJ8 A;  4DV0 L;  4F87 A;  4A3M G;  1QVF A;  2EXZ A;  4A3B H;  1RD9 D;  4C3I H;  4YWL A;  4K2L A;  3J81 L;  1HA6 A;  1Z6H A;  2E2D C;  3PGZ A;  3NXW A;  2BE5 C;  1LO5 D;  2CQA A;  4A75 A;  3Q23 A;  3PUY A;  4X62 Q;  3HOU G;  1Z9F A;  5H1S E;  2RA4 A;  3GTQ H;  4I7A A;  4RGM A;  2EYF A;  1VQ4 A;  2HDM A;  4X3U A;  2XWJ B;  1SNC A;  2K5Q A;  3ZYY X;  1HQM C;  4LFC Q;  5M5X B;  1YNN D;  1STB A;  3S15 B;  3HG9 A;  1N9W A;  1D5Z C;  3W2D A;  1VQ6 A;  5I2X A;  1VQH A;  2NVT H;  3VR3 A;  1QCB D;  1ML0 D;  2HUG A;  3CC7 A;  2JA6 G;  5M3M B;  2KJX A;  1EWI A;  2KBN A;  1K8A C;  1EY0 A;  3PIP A;  2PNR C;  5LMN Q;  3HOX B;  4KKT A;  2NZ1 D;  4P75 A;  1P8L A;  1EYC A;  4JPB W;  1HZA A;  2KCT A;  3D4R A;  4P71 A;  5C3W A;  3FKI G;  1LUZ A;  2Z6K A;  1I5F A;  2CWP A;  5JOB A;  4DR3 Q;  3GTG H;  3AMU A;  4XYO A;  1SDF A;  1V1O A;  1K83 B;  3TP8 A;  4JV5 Q;  2Y0S G;  4X62 L;  2B2W A;  3GTJ B;  3C2P A;  1KNE A;  1KRT A;  5CGK A;  2R3Z A;  1PFN A;  4GKK Q;  2QDB A;  4FXK C;  1NR4 A;  3J80 i;  1BKB A;  1GUT A;  2YU9 B;  2Q2H A;  1DM0 B;  5C44 G;  5JEA J;  1IXR A;  4LFC L;  1QJO A;  3HOV G;  1I6V C;  3SK4 A;  3S1N B;  2BDO A;  1B9N A;  1WTO A;  3SEB A;  4P2C B;  2F0D A;  1NMG A;  1SSO A;  3BJU A;  3KLS A;  3CF5 A;  1DOL A;  1PH8 A;  3ND9 A;  5LMN L;  1ICF B;  2ZTD A;  3LWU A;  3S16 H;  2B63 H;  3NTK A;  2CH4 A;  4IPC A;  4R8I A;  1QZH A;  1T5X D;  4DR3 L;  1K73 C;  4WJW A;  2PYK A;  5F2D A;  4RCN A;  3HRZ C;  5D3D A;  3SK5 A;  1TWH H;  1KAA A;  4KY6 A;  3RN2 A;  2WII B;  3J81 E;  2MHV A;  2NVQ H;  2QEJ C;  1A0I A;  4JV5 L;  3RR5 A;  3S1Q H;  2F0S A;  1L1O B;  1MHW C;  3DEO A;  1JMC A;  4YY3 Q;  4GKK L;  3NWS A;  1JJ2 A;  2EDG A;  1PTO D;  4M1U B;  2V4D A;  2LY7 A;  4JI8 Q;  1GUS A;  1JCK B;  1AP0 A;  1QNU A;  4BBR G;  4I65 A;  2EYP A;  3GP7 A;  1XXG A;  2E2J B;  1O7I A;  1GM5 A;  5I2Y A;  1SBB B;  5CV4 A;  1F77 A;  3QIA A;  4JW0 A;  1A2T A;  1SN8 A;  1Q82 C;  3M4O B;  4GKJ Q;  1DGS A;  1GHK A;  1EFI D;  5FOB B;  5JJK A;  4CDF C;  2NVX H;  1W6K A;  4JBK A;  3DM3 A;  3KUP A;  3BS1 A;  3I56 A;  4IUR A;  4DV7 Q;  1ET9 A;  1IBK Q;  2R92 B;  4RHS A;  2UUB Q;  5CV6 A;  3CXC A;  2PCF B;  2F0V A;  3A56 A;  3NEN A;  1B9M A;  1JQY D;  3HKZ G;  4LUZ A;  1Y1V H;  4K0K Q;  5G3L F;  4KMU C;  3ER0 A;  4ABN A;  4YY3 L;  5COR A;  4CKB A;  5JEA G;  2NWG A;  4JI8 L;  2H4O A;  1B3Q A;  1OTC A;  4A3F H;  2M9V A;  1IYV A;  5FLM H;  3LGJ A;  2IL8 A;  3U4Z A;  3HOW H;  1LTS D;  4PMB A;  2SNS A;  4GKJ L;  1BR9 A;  2XWB B;  1VQC A;  4LFB Q;  1KHI A;  3F2D A;  2JN4 A;  3EVQ A;  5JJI A;  1OXS C;  1S5C D;  3CC4 A;  1N32 Q;  2NN6 I;  3P20 A;  2K5V A;  3K6O A;  4F88 A;  3J7Z C;  4DV7 L;  1IBK L;  2VUM G;  2DGY A;  3WOE A;  1XNQ Q;  4NB3 A;  2UUB L;  3TRE A;  1LAB A;  3HOZ H;  3C3L A;  4DV1 Q;  1YNX A;  2K75 A;  1DON A;  4DR5 Q;  4UAI A;  3HOY G;  2WP8 J;  1EIH A;  1MI2 A;  2PZT A;  2K5H A;  4R4I A;  5IP9 G;  4X65 Q;  1F2Y A;  3CCU A;  4K0K L;  1QZG A;  1ICW A;  1HNX Q;  1IBL Q;  2VQF Q;  4Y7N H;  1NJI C;  2NZO A;  1SXT A;  4HCE A;  2F4I A;  5HY6 A;  2Q8R E;  3GTM B;  3S2D B;  1X65 A;  2WB1 B;  2ZTC A;  3D8G A;  5CV7 A;  4C3I G;  2VZA A;  1LT5 D;  3AYH B;  2KCM A;  3L9A X;  3MXP A;  1VQF A;  3TS2 A;  5CBA E;  4LFB L;  1ZXT A;  4BY1 B;  3K0X A;  1X54 A;  2QKI C;  2Q2I A;  1N32 L;  1XNR Q;  2F03 A;  4DK0 A;  3R93 A;  1XNQ L;  2AUJ D;  3CCJ A;  1PH6 A;  2L11 A;  4DV1 L;  4PV1 C;  2C5C A;  5JVG 3;  1E1O A;  1VQE A;  3KK7 A;  4DR5 L;  1NSN S;  1A6X A;  5K5P A;  1XJV A;  4LF6 Q;  1Y8N B;  4X65 L;  3BYT B;  1HNX L;  1IBL L;  3UDX A;  2XRQ D;  2VQF L;  3MXN A;  3BZK A;  1QOH A;  1UWV A;  1L1O A;  3K57 A;  5IYC G;  4DUZ Q;  1A2U A;  4G57 A;  3I4O A;  3MA2 B;  5EQ0 A;  4EQP A;  3AU7 A;  2ATW A;  2Z0S A;  1JC7 A;  1WYD A;  2NVT B;  3NSW A;  2F52 A;  3D6C A;  4KY5 A;  3STB D;  5A35 A;  1EYA A;  4K5V A;  1YJW A;  4O1N A;  2K4K A;  1PXU A;  4APV A;  1JWS D;  1F9S A;  3NTH A;  1XNR L;  4OEL B;  3T1Y Q;  3Q22 A;  1PZK D;  1ENF A;  1VS0 A;  1Y14 B;  3GTL B;  1EY8 A;  1CQV A;  3MFY A;  3VA7 A;  2EYJ A;  4JI7 Q;  1B50 A;  2EXD A;  4HIM A;  1E7Z A;  3LNN A;  4P73 A;  4C3H H;  3K7U C;  4BXX H;  1EIY B;  2SDF A;  4LF6 L;  1I50 H;  3E6Z X;  4KJO A;  4OIJ A;  5EGT A;  1GJX A;  4RKB A;  1KC8 C;  1G2T A;  3K80 C;  1H9M A;  1PH7 A;  4JI1 Q;  3GO5 A;  5FJ8 G;  4CJ1 B;  3RZD H;  1N36 Q;  2OTL A;  2N8N A;  4IOA A;  4DUZ L;  2JEB I;  2G9D A;  3P1H A;  3J7A V;  1PHJ A;  1BXT A;  1RJT A;  5A2Q L;  5DEH A;  1AE2 A;  3PO3 H;  4R8N A;  2B63 G;  1TU2 B;  1W3S A;  1HZ9 A;  2B2U A;  3MEF A;  1G51 A;  5FO7 B;  3E3X A;  4DUY Q;  5GAE C;  3RLN A;  2JA8 B;  3R3O A;  4L8J A;  3U9O A;  3W5O A;  2UU9 Q;  2RF4 A;  2N78 A;  1JJG A;  1Q46 A;  1M90 C;  2HHH Q;  3SHL A;  4ZLT F;  1Y1W G;  1HA5 A;  1SE8 A;  2DY8 A;  4HJ5 A;  2A74 C;  1SYG A;  3PO2 H;  4A3J B;  3T1Y L;  4RFB A;  4XQN A;  1PTO B;  4OEM B;  3OTO Q;  4JI7 L;  2WAQ B;  4LUV A;  4ULL A;  4N9T A;  4IUU A;  1TWH B;  5I6Y A;  2E75 C;  1STY A;  5E3F A;  1CZW A;  1Q3L A;  2PQE A;  4QJF A;  2O5J C;  3K58 A;  2A6E C;  4L5T A;  5C4X H;  1B2T A;  2P5Z X;  1F9R A;  1SRO A;  1A15 A;  2CKZ B;  2HD3 A;  4R4T A;  3A74 A;  5EJW A;  2GN5 A;  1EQV A;  4YIJ A;  3EA6 A;  4JI6 Q;  4JI1 L;  4IZ8 A;  1N36 L;  4V19 0;  4KN4 C;  4CGY B;  1F2Z A;  3OW2 A;  4J1M A;  4GOP C;  1CFM A;  1E22 A;  1IYJ B;  3EBE A;  1LTG D;  4K5W A;  2KOL A;  1OXU A;  1KNA A;  2K1B A;  3S15 H;  5FO9 B;  1CTM A;  2EOT A;  4UP8 A;  4DUY L;  1YEZ A;  4F8M A;  1KD1 C;  2NVX B;  1S5D D;  1EY5 A;  2CW0 D;  2UU9 L;  2RSN A;  1Y1V G;  1MIU A;  4S3S A;  1PZI D;  3GDE A;  2MFI A;  1RDP D;  2D62 A;  3A55 A;  5M3M H;  3K81 C;  3VA5 A;  2HHH L;  1QG7 A;  4QIW B;  2EJG C;  4OHJ A;  2WKD A;  3G6E A;  3PUV A;  3OTO L;  2XVS A;  1EWC A;  3ICE A;  1A3V A;  1XTC D;  3IRB A;  4A3F G;  2ZJQ A;  2NYZ D;  5C6A A;  3HOW G;  1WCM B;  5EBC A;  4DF7 A;  3T1H Q;  3RD4 A;  3D31 A;  1AE3 A;  1K83 H;  4DAV A;  3S1R B;  3I4M B;  1LTI D;  1HJP A;  3W1B A;  5GRO A;  4OWW B;  1UE5 A;  4JI4 Q;  2QGQ A;  3BZC A;  1WVL A;  4JI6 L;  4NP5 A;  1U5K A;  4J6H A;  1L2F A;  4MZ9 A;  2GVB A;  4C2M B;  2YU9 H;  1CA6 A;  3CME A;  2PMZ B;  3HOZ G;  1FD7 D;  4A3C G;  4QUC A;  1SFO H;  2A68 D;  2Z6K C;  2LMC B;  3CCE A;  3S1N H;  3I91 A;  5IE8 A;  1TII D;  4EQO A;  4R9W A;  3EJI A;  3J81 j;  1GD7 A;  2RVL A;  4RWS C;  1SNM A;  2X6G A;  2D2C C;  3G4S A;  1KLU D;  2UUA Q;  2YV5 A;  4HJA A;  3M3Y B;  1VQO A;  1YHB A;  2YTX A;  1C48 A;  5D65 A;  5K36 H;  4LF8 Q;  2XSC A;  2J0T D;  1G91 A;  5KGU A;  3T1H L;  2NB0 A;  2LXJ A;  1BBX C;  3RZO B;  3I72 A;  1VQA A;  2ZM6 Q;  3H3V C;  2RSO A;  2MQH A;  1HXY D;  2EYH A;  3RLO A;  2NN6 H;  3RLF A;  2K05 A;  4GOP B;  3HS0 C;  3KLS X;  4JI4 L;  1EUJ A;  1UEA B;  4OO1 G;  4L5Q A;  2L12 A;  4IJH A;  2BE5 D;  5IP7 G;  1LTT D;  5E4W C;  2FFK B;  2KED A;  2B2Y A;  2E2J H;  3OIP A;  1EFW A;  5FLX L;  2FJ2 A;  2RHQ B;  1LTR D;  5J22 A;  3L0O A;  1Z7T A;  1LT6 D;  1VF7 A;  1XMQ Q;  2KQ3 A;  4DR1 Q;  2UUA L;  1ENC A;  1CM9 A;  2R92 H;  3GV6 A;  4HSV A;  5JPN C;  3FP9 A;  2WB1 E;  2KA7 A;  4LF8 L;  4POF A;  2EY1 A;  1WTP A;  3NBI A;  2J7Z A;  4JBW A;  1NTG A;  1ZKO A;  2ZM6 L;  4ME5 A;  4AYB G;  2R7D A;  3I8Z A;  4KV6 A;  3T4A C;  4BY7 G;  4BA2 I;  1CK1 A;  1SMY C;  2O4X A;  1SLJ A;  1NR2 A;  1V1P A;  3CPW A;  4B08 A;  3GQB A;  4XDX A;  3KF6 A;  1O80 A;  1S40 A;  4JOI A;  1EEI D;  1DYQ A;  3I2Z A;  4IPG A;  1WD1 A;  5LL6 S;  3IFT A;  2KCN A;  2NZH A;  3M9B A;  3OPO A;  1D6E C;  1JJC B;  4YCU A;  1PLF A;  1DZ1 A;  5M3F B;  4BXX G;  3U58 A;  4CDC C;  3UDG A;  3CCV A;  1M4V A;  4Q5V A;  2F0I A;  2TMP A;  1XMQ L;  3P75 A;  4RGN A;  4DR1 L;  4HN7 A;  2OCE A;  2R7Z B;  1YIJ A;  3NEL A;  2ALY B;  4C3H B;  3PO3 G;  4JBJ A;  5IT9 c;  2IX0 A;  1I50 B;  2L4N A;  2K52 A;  4JI2 Q;  3OSO A;  3DMU A;  4XIG S;  3RZD B;  3IFD A;  3PO2 G;  1U4M A;  3G48 A;  2LS0 1;  2A6H D;  3DUZ A;  3VR2 A;  4IO9 A;  2FXQ A;  3CKI B;  3ULJ A;  3GTM H;  3QJY A;  2Z4I A;  2ICE C;  4K6D A;  4ZK9 B;  1IW7 D;  4DAY B;  2JK8 A;  1H9K A;  5KNC A;  4BY1 H;  5FLX E;  1BDO A;  2HDL A;  1QUQ B;  3NTI A;  1E24 A;  3CCL A;  4GN4 B;  1SE2 A;  2RDH A;  5EKK A;  3KF8 B;  3OMC A;  1YNJ C;  1JOK A;  1B3A A;  3EQL C;  1CHP D;  2F0O A;  3K5O A;  1EEF D;  1XPR A;  3K0Y A;  2MO1 A;  4GNX A;  1B70 B;  5C4X B;  3SE0 A;  2K03 A;  4C1N I;  4JI2 L;  2FHT A;  5EPL A;  3OWE B;  4DR7 Q;  1TWC B; 
#chains in the Genus database with same CATH homology
 1N8R C;  4K0K Q;  1UE1 A;  4A3E H;  5M3M G;  5IYD H;  3HOV H;  3ER0 A;  3UE1 A;  2BA1 A;  4YY3 L;  3HOX G;  3CQZ H;  2WAQ E;  1N34 Q;  5JEA G;  2EIF A;  2UXC Q;  1E1T A;  1HH2 P;  4JI8 L;  2VW9 A;  3H15 A;  1OTC A;  2E5L Q;  1B8A A;  4MTN A;  5IWA L;  4A3F H;  5FLM H;  3LGJ A;  3U4Z A;  3HOW H;  3GTK H;  4AH6 A;  1J5E Q;  4PG3 A;  1CSP A;  2B29 A;  1U0L A;  4GKJ L;  1VQJ A;  1VQC A;  1X3G A;  4LFB Q;  1KHI A;  1Z47 A;  4OON A;  3F2D A;  2R6G A;  4QGU A;  1PH4 A;  1PH5 A;  5JJI A;  1OXS C;  1B7Y B;  4DAM A;  1KIX A;  5GAG C;  2KHI A;  3CC4 A;  3ERS X;  2NN6 I;  1N32 Q;  3F2C A;  2K5V A;  3J7Z C;  4B3T L;  2N49 A;  4DV7 L;  3GTL H;  1IBK L;  2PQA B;  2VUM G;  2DGY A;  1XNQ Q;  4NB3 A;  1WFQ A;  3TRE A;  2AWN A;  3L2P A;  1K8G A;  2UUB L;  4JI0 L;  3HOZ H;  4DV1 Q;  1VQ8 A;  1YNX A;  2K75 A;  3CD6 A;  1UEB A;  4DR5 Q;  4JYA L;  1VQN A;  5FLX c;  1C7Y A;  1SR3 A;  5M3F G;  2YYZ A;  2BH2 A;  2WP8 J;  4DV3 L;  3HOY G;  3GTP H;  4HID A;  2K5H A;  4R4I A;  3H0G G;  4BBR H;  4DR7 L;  1QVC A;  4DR4 Q;  5IP9 G;  4X65 Q;  3CCU A;  1XMO Q;  4K0K L;  1QZG A;  1VQI A;  4QIW E;  2Y0S E;  3M4Q A;  4DPG A;  3CCS A;  1HNX Q;  4FDB A;  1IBL Q;  2VQF Q;  1JE5 A;  2H5X A;  4Y7N H;  1NJI C;  1HR0 W;  2R7Z G;  1OXV A;  1WCM G;  2NZO A;  2V1C C;  3WWV A;  4DV5 Q;  4UY8 C;  1EOV A;  1N34 L;  2UXC L;  4KLK A;  2JA9 A;  2E5L L;  5HY6 A;  2JA7 G;  2GVA A;  2VQE Q;  3KF6 B;  4WJ4 A;  5K36 G;  3I4N H;  1X65 A;  5AJ3 Q;  2ZTC A;  4DV2 Q;  2JA8 H;  3CP0 A;  4X6A H;  1J5E L;  2VZA A;  3AYH B;  2KCM A;  2B3G A;  1VQF A;  3TS2 A;  2ZJP A;  1A63 A;  4LFB L;  2NN6 G;  4JI3 Q;  1G29 1;  2VY3 A;  3KOJ A;  3E0E A;  5M5X H;  2LXK A;  3F2B A;  1H95 A;  3K0X A;  1X54 A;  2Q2I A;  5C3E G;  2HQL A;  2D0P A;  4A3J H;  4KHP Q;  1N32 L;  1AH9 A;  3U50 C;  2PMZ E;  1XNR Q;  3U4V A;  5HGQ A;  3KFU A;  1XNQ L;  1T9H A;  1CKN A;  3CCJ A;  1PH6 A;  1K9M C;  3NEM A;  4DV1 L;  2AMC B;  3HOX H;  1E1O A;  1VQE A;  4DR5 L;  1PH9 A;  2ES2 A;  1Q1B A;  2ZJR A;  1XJV A;  1CSQ A;  5J3B A;  1VQB A;  4OX9 Q;  4LF6 Q;  4BBS G;  1X55 A;  1PYB A;  4DR4 L;  4X65 L;  1XMO L;  1GKH A;  4A3I G;  1HNX L;  2PNH A;  1IBL L;  3UDX A;  2VQF L;  1K3R A;  3BZK A;  1NMF A;  2VL6 A;  1UWV A;  1L1O A;  4DV5 L;  5C0X J;  1Q7Y C;  2R92 G;  5IYC G;  2QA4 A;  4DUZ Q;  3PF4 A;  3SGI A;  3GTJ H;  4PZ6 A;  2VQE L;  3KLW A;  3I4O A;  4HJ7 A;  5C4X G;  1C0A A;  4TQU S;  4GLV B;  3STB C;  3FKI H;  5AJ3 L;  1BVS A;  4RG1 A;  4DV2 L;  4LF7 Q;  2ATW A;  2Z0S A;  1WYD A;  4YHH Q;  4POG A;  2R93 H;  2F52 A;  1NE3 A;  3STB D;  1R9T H;  4A3G G;  4LUO A;  4JI3 L;  3RNU A;  2CQO A;  4B3R Q;  1YJW A;  4A4I A;  2K4K A;  2MO0 A;  4KHP L;  4APV A;  4UP7 A;  4R4C A;  1XNR L;  2BH8 A;  3T1Y Q;  4AQY Q;  1VS0 A;  1Y14 B;  3PUZ A;  3AQQ A;  4HIO A;  1A62 A;  2LSS A;  4JI7 Q;  1WCM H;  3A5U A;  4TVA B;  5JJL A;  2EXD A;  1KRS A;  4HIM A;  1E7Z A;  3CAM A;  2KEN A;  4P73 A;  4QL5 A;  4YWM A;  4C3H H;  4OX9 L;  3K7U C;  4GNX B;  3HKZ E;  4GOP A;  5BR8 Q;  1EIY B;  4LF6 L;  1X6O A;  3S1R H;  3I4M H;  4BXX H;  1I50 H;  2JE6 I;  4A3D G;  2AWO A;  2AHO B;  2XTI A;  4NPS A;  4R1J A;  4DR2 Q;  1M1K C;  1JB7 A;  4LF4 Q;  1L0W A;  1WI5 A;  1KC8 C;  3K80 C;  1PH7 A;  4HJ9 A;  4JI1 Q;  3GO5 A;  5FJ8 G;  3OYY A;  4DV6 Q;  3RZD H;  1N36 Q;  2OTL A;  2IHE A;  1LTL A;  2N8N A;  4C2M H;  5C0X I;  3M85 A;  1RL2 A;  2JEB I;  4DUZ L;  3H3V I;  4J15 A;  4IOA A;  1SMX A;  4OWX B;  3KJP A;  3PIO A;  2ZTE A;  5C3E H;  3J81 c;  1PHJ A;  2IX1 A;  3PO3 H;  1AE2 A;  4DV4 Q;  2HT1 A;  4PZ7 A;  4IFD J;  2B63 G;  1TXY A;  1W3S A;  1HZ9 A;  3MEF A;  1G51 A;  2EQS A;  1PH1 A;  4YCV A;  3AFP A;  4LF7 L;  1X9N A;  4YHH L;  4DUY Q;  5GAE C;  3RLN A;  2E2H H;  4HIK A;  1EQQ A;  5C4J H;  4JBM A;  4IPD A;  1PA6 A;  1L1O C;  1S3O A;  1I6H H;  3W5O A;  2UU9 Q;  4A3K H;  4LNQ A;  3M7N A;  2RF4 A;  2N78 A;  1JJG A;  4B3R L;  2IY5 B;  3M4O H;  1Q46 A;  1M90 C;  2XGT A;  2HHH Q;  3M3Y H;  1Y1W G;  1SE8 A;  4HJ5 A;  4BBS H;  3PO2 H;  3G71 A;  2OWO A;  4DK6 C;  3T1Y L;  1XPU A;  4A3L G;  1BBW A;  4AQY L;  3OTO Q;  2PQA A;  2HIX A;  2A1A A;  2OTJ A;  4JI7 L;  4LUV A;  3J81 i;  4KHZ A;  2WB1 G;  1HR0 Q;  2A19 A;  4R4Q A;  2L15 A;  5IYC H;  2KHJ A;  4P74 A;  1S72 A;  3RZO H;  2C35 B;  4IPH A;  3S14 H;  1WOC A;  4QJF A;  5BR8 L;  5LMU Q;  3W1G A;  4L5T A;  4BY1 G;  5C4X H;  3HKS A;  2QEX A;  5LMN W;  1KXL A;  1D7Q A;  1SRO A;  2CKZ B;  5C0X G;  4R4T A;  3DLL A;  3A74 A;  4DR2 L;  4LF4 L;  1YZ6 A;  1Q81 C;  1YI2 A;  2GN5 A;  4QQB X;  1PFS A;  3JAM c;  4JI6 Q;  4JI1 L;  5IYB G;  1N36 L;  5IY0 A;  4DV6 L;  4LF5 Q;  4EQ5 A;  4A3G H;  4EX5 A;  1V9P A;  4A3B G;  4Y52 H;  4IOC A;  2UXD Q;  4A93 G;  4MNO A;  3OW2 A;  4GOP C;  1ASY A;  1E22 A;  4DKA C;  1XTD A;  3PUW A;  4DV4 L;  1IYJ B;  1VQM A;  3EBE A;  2IHF A;  1RIP A;  3K8A A;  1OXU A;  2JA5 G;  1GO3 E;  4B3M Q;  4P72 A;  1LYL A;  1YVC A;  3CCM A;  1VQG A;  3S15 H;  4UP8 A;  4DUY L;  1YEZ A;  2E2I H;  1KD1 C;  2JA7 H;  1KQS A;  3VDY A;  2UU9 L;  1Y1V G;  1MIU A;  1ASZ A;  3GDE A;  2MFI A;  4A3E G;  3B6Y A;  2D62 A;  5M3M H;  5IYD G;  3K81 C;  1EQR A;  3UDI A;  2HHH L;  1Q1E A;  3JAM i;  3G6E A;  4JI5 Q;  1CKM A;  4NXM Q;  1HZC A;  3PUV A;  3OTO L;  2F4V Q;  4DV0 Q;  3E9I A;  2ASB A;  3ICE A;  3IRB A;  1V43 A;  4A3F G;  4UP9 A;  1OXX K;  5FJ8 H;  1MJE A;  1HR0 L;  2ZJQ A;  4B3S Q;  3HOW G;  3PUX A;  1IBM Q;  3T1H Q;  1PV4 A;  1CKN B;  1YIT A;  4JC0 A;  2PI2 E;  3GTO H;  5LMU L;  1EYG A;  3D31 A;  1AE3 A;  1K83 H;  4BA1 I;  1VQP A;  2JQO A;  4YWK A;  1NBW A;  4XTC S;  4ALP A;  1HJP A;  3W1B A;  5GRO A;  5ELN A;  2HIV A;  4OWW B;  1UE5 A;  4JI4 Q;  2QGQ A;  1OXT A;  3BZC A;  4JI6 L;  4LF5 L;  4AIM A;  1X56 A;  1K0R A;  2JJQ A;  1A8V A;  2K14 A;  4X64 Q;  1U5K A;  1UE6 A;  1X3E A;  4YCW A;  2WFW A;  1L2F A;  4PMW A;  1I94 Q;  4MZ9 A;  2GVB A;  3ULP A;  3MXN B;  2YU9 H;  3PV0 A;  5EAY A;  2VUM H;  3CME A;  4WJ3 M;  1UE7 A;  3HOZ G;  5GQO A;  1Y1W H;  1I3Q H;  2OQK A;  2CCZ A;  1TWF H;  1VQK A;  4A3C G;  4OO1 I;  4LF9 Q;  4B3M L;  2I5L X;  3AEV A;  1SFO H;  2PI2 A;  2Z6K C;  4KI0 A;  1QUQ A;  5M3F H;  3HOY H;  4A3L H;  4LW1 A;  2VNU D;  1J6Q A;  3I7F A;  4GLA C;  3S17 H;  5ELO A;  3CCE A;  3HFZ B;  3S1N H;  3S2D H;  2BA0 A;  5IE8 A;  3H0G H;  3EIV A;  5IP9 H;  1VQ5 A;  3J81 j;  1FVI A;  1GD7 A;  3BU2 A;  1TWA H;  3G4S A;  4A76 A;  1JT8 A;  1GVP A;  3UDF A;  2R7Z H;  2UUA Q;  2YV5 A;  3ULL A;  4HJA A;  4JI5 L;  2YTV A;  1VQO A;  4NXM L;  5M5Y H;  1NY4 A;  1YHB A;  2YTX A;  1Q86 C;  4GLX A;  4JOI C;  2F4V L;  4DV0 L;  2K50 A;  4A3M G;  3NBH B;  1QVF A;  2UXD L;  4B3S L;  3KDF B;  3JC6 6;  4LF8 Q;  4A3B H;  1IBM L;  3T1H L;  4C3I H;  2JA8 G;  1FL0 A;  3TS0 A;  2LXJ A;  4YWL A;  1VQA A;  5GAH C;  2ZM6 Q;  4H02 A;  3PGZ A;  4GS3 A;  2MQH A;  1YBY A;  1D8L A;  3RLO A;  5DLQ E;  3RLF A;  4GOP B;  4X66 Q;  4A75 A;  4JI4 L;  1CKO A;  3PUY A;  4A3J G;  4X62 Q;  3HOU G;  1Z9F A;  1EUJ A;  4X64 L;  5H1S E;  1IL2 A;  4C3J H;  3J7A 5;  1I94 L;  4L5Q A;  4IJH A;  4OO1 G;  5IP7 G;  3GTQ H;  4QY7 A;  4JG2 A;  2WAQ G;  3TRZ A;  3Q8D A;  4O0A A;  1VQ4 A;  4NXN Q;  3D0F A;  1Q12 A;  4LF9 L;  2E2J H;  4RMF A;  3S1M H;  3CMA A;  4LFC Q;  2I5M X;  1YJN A;  1W2B A;  1EFW A;  2RHQ B;  1N9W A;  2DUD A;  4GN5 A;  1VQ6 A;  1YHQ A;  3L0O A;  1VQH A;  2OQ0 A;  4OXP A;  4A3I H;  2NVT H;  1XMQ Q;  1KAW A;  4L5S A;  1G6P A;  3RN5 A;  2JA6 G;  3K7A H;  5E7N A;  3CC7 A;  4DR1 Q;  2UUA L;  1EWI A;  1VQ7 A;  2KBN A;  1K8A C;  4DR7 Q;  3S2H H;  3PIP A;  5LMN Q;  2R92 H;  3J80 c;  2RCN A;  4UPA A;  4P75 A;  1P8L A;  3FP9 A;  1FGU A;  1SRU A;  2WB1 E;  2JEA I;  1KL9 A;  3E9H A;  1HZA A;  2KCT A;  4P71 A;  4LF8 L;  3FKI G;  4POF A;  1LUZ A;  2Q2U A;  2Z6K A;  1I5F A;  2CWP A;  3GD7 A;  3EN2 A;  4DR3 Q;  3GTG H;  4JBW A;  4DR6 Q;  1NTG A;  2R93 G;  1XPO A;  1C9O A;  1TWC H;  3UE0 A;  2ZM6 L;  4A3C H;  4AYB G;  2A8V A;  2R7D A;  4BY7 G;  2CFM A;  4BA2 I;  4X66 L;  4JV5 Q;  2D0O A;  3S24 A;  1SLJ A;  2Y0S G;  1PH3 A;  4AYB E;  4X62 L;  3CPW A;  2UUC Q;  1KRT A;  1TWG H;  4IFD I;  1P16 A;  1VQ9 A;  4GKK Q;  2K5N A;  3F1Z A;  3KF6 A;  4DK3 C;  2UXB Q;  1MJC A;  1S40 A;  3J80 i;  1BKB A;  4JOI A;  3PF5 A;  4IPG A;  3I2Z A;  2Q2H A;  4NXN L;  4GNX C;  4L5R C;  5C44 G;  3A0J A;  1IXR A;  5JEA J;  2NZH A;  3M9B A;  1CUK A;  2E8G A;  4GN3 B;  4LFC L;  3CC2 A;  1PYS B;  4YCU A;  1JJC B;  2MNA A;  4BXX G;  1EIF A;  2IT1 A;  4IJL A;  3U58 A;  4A3M H;  1N33 Q;  3I4M G;  3HOV G;  4HJ8 A;  2RHS B;  3UDG A;  4A3D H;  3CCV A;  1IZ6 A;  1XMQ L;  1FJG Q;  1NMG A;  3BJU A;  3CF5 A;  4DNI A;  1VCI A;  4DR1 L;  1PH8 A;  2N3S A;  5FLM G;  2OCE A;  5LMN L;  1YJ9 A;  4PZ8 A;  2ZTD A;  3CCR A;  1YIJ A;  3NEL A;  1HNZ Q;  1PH2 A;  2ALY B;  3HOU H;  3PO3 G;  4JBJ A;  1V1Q A;  3S16 H;  5IT9 c;  2B63 H;  2NVY H;  2VS1 A;  2IX0 A;  2F3I A;  5IP7 H;  4IPC A;  1QZH A;  2I5H A;  4DR6 L;  2I0Q A;  4LFA Q;  4DR3 L;  1K73 C;  2K52 A;  1HNW Q;  4OWT B;  4JI2 Q;  1TWH H;  4A3K G;  3AFQ A;  3M4P A;  3FHW A;  4XIG S;  3RN2 A;  3CW2 C;  4IFD G;  2NVQ H;  1A0I A;  3L7Z C;  3RR5 A;  3I55 A;  1Q8K A;  3KJO A;  3S1Q H;  4JV5 L;  2UUC L;  3PSI A;  1L1O B;  3PO2 G;  4R4O A;  1JMC A;  3G48 A;  1VQD A;  3CPF A;  4YY3 Q;  1QVG A;  4GKK L;  1JJ2 A;  3KYH C;  2UXB L;  4IO9 A;  2FXQ A;  3ULJ A;  4JI8 Q;  2JA6 H;  1X3F A;  3GTM H;  1MKH A;  5GAD C;  5IWA Q;  4BBR G;  1O7I A;  4ME3 A;  2R7F A;  1GM5 A;  4DAY B;  2JK8 A;  1BBU A;  1N33 L;  1LM0 A;  1SN8 A;  3A5Z B;  3CCQ A;  1Q82 C;  4BY1 H;  3PCO B;  1DGS A;  4GKJ Q;  1QUQ B;  1WJJ A;  4O2D A;  1HZB A;  1FJG L;  2CWA A;  5JJK A;  3TQY A;  2NVX H;  3H3V H;  1E3P A;  1E24 A;  2Q2T A;  4GN4 B;  3ZJY C;  3CCL A;  4JBK A;  1PVO A;  3DM3 A;  5IYB H;  3KF8 B;  3TEH B;  3F8T A;  4B3T Q;  3I4N G;  4BY7 H;  3I56 A;  4DV7 Q;  4JCV E;  1IBK Q;  4A93 H;  1XPR A;  1HNZ L;  2UUB Q;  4JI0 Q;  1YHA A;  2MO1 A;  4GNX A;  3CXC A;  1B70 B;  3KDF A;  2JA5 H;  2YTY A;  1VQL A;  4JYA Q;  3NEN A;  4DV3 Q;  4LFA L;  1HNW L;  4JI2 L;  5M5W H;  2ID0 A;  3HKZ G;  4LUZ A;  5C44 H;  2AKW B;  4LWC A;  1Y1V H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...