3T1HQ

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16s rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3t1hQ00
2IX0A 2UXDQ 3SGIA 3CCRA 2R93G 3HOVG 3CC2A 4A3DG 1PH2A 2E8GA 4JI1L 4X66Q 5AJ3L 1IBLQ 1VQAA 1T9HA 4JV5Q 2ZJRA 1K8GA 4OX9L 2NVQH 2JE6I 3HOXG 1XMQL 1QVFA 4GOPC 1K83H 2JA9A 2A8VA 4GKJL 3S15H 3UE1A 3KJPA 1E24A 1HJPA 1Z9FA 4PZ6A 3M85A 4DV2L 1JE5A 1E3PA 3KOJA 4IPDA 4JOIA 5M3FG 4LF5L 1VQ7A 3KF8B 2B63G 3G48A 3CMAA 3RLFA 4JI6Q 1Q1EA 1IBLL 3S1QH 3KF6A 4JV5L 2WAQE 4LW1A 3G6EA 1PVOA 4LFBQ 5IYDH 1Y1VG 3CCJA 1GD7A 2UUAQ 2R7DA 4A3LG 4OONA 5M5YH 3F2BA 1SLJA 4DK3C 3CCEA 4JI5Q 4MNOA 2ID0A 4B3RQ 1HNWQ 4R4QA 4DPGA 1EYGA 4OO1I 4DUZQ 4HJAA 3ERSX 5FLMH 3PO3G 4LF6Q 3I4MG 4JI8Q 3GTKH 4A3GG 4A3MH 4NB3A 4AYBG 2JJQA 4YCVA 4EX5A 1GO3E 5M5WH 1VCIA 1YITA 1FJGQ 1IZ6A 4A3JG 4GNXB 2KENA 5GAHC 2A1AA 2JK8A 4O0AA 4DNIA 1SMXA 1HNWL 3KDFB 3KYHC 1GVPA 3PO2G 2PQAB 2ZTCA 2CQOA 3OTOL 1Q86C 2GVAA 1VQ8A 3PUVA 3LGJA 1JMCA 5GADC 4GS3A 3M4OH 1N9WA 4JI8L 1CKOA 2JA7G 2ES2A 4BY7G 1QZGA 2JEBI 4A3KH 4JI7Q 3K7AH 4IJLA 1FJGL 1WCMG 1I94L 2R7FA 1YHAA 1VQNA 2NVXH 4BBSH 4TQUS 1VQFA 1I50H 4HJ5A 3OW2A 2EQSA 3GTQH 2Z0SA 4QL5A 4C3JH 2VZAA 3F2CA 1VQPA 5EAYA 2WAQG 4JI0Q 1SROA 2WB1E 1IL2A 3F1ZA 3CXCA 2K14A 3KDFA 3K81C 3PUXA 4H02A 4A3BG 2RHQB 4JOIC 4P72A 1VQHA 3PSIA 4APVA 1Q8KA 3M3YH 3HOWH 2I5HA 2FXQA 2MQHA 2GN5A 1VQCA 4X62Q 2Q2UA 4LF7Q 5H1SE 2VNUD 2QA4A 2IHFA 2CCZA 3NBHB 2LXJA 2QGQA 2BH8A 3M4QA 4L5QA 3CCLA 4YY3Q 1VQEA 3JC66 4JI0L 2HHHQ 3HOUG 4AH6A 3JAMc 3NENA 3HFZB 5DLQE 2AHOB 2N78A 4YWKA 2VL6A 2K4KA 1IXRA 5IP9H 1BBUA 1TWHH 4X62L 2A19A 4NXMQ 2K5VA 2YV5A 4DV0Q 5C0XG 4JBKA 4Y52H 1HNZL 4JI4L 2UUBQ 5C4JH 2YTYA 4TVAB 3K8AA 4YY3L 2E2IH 2R7ZH 1PH7A 2HHHL 1OXTA 3PV0A 1X3EA 4O2DA 1YJWA 3JAMi 3GDEA 3L0OA 4YCWA 3CCVA 1JJCB 4GLVB 5GQOA 3K0XA 1PH5A 2V1CC 3HOZG 1I6HH 5C44H 1NE3A 1VQ4A 1NJIC 3J7ZC 4R4TA 4HJ7A 2IX1A 1WI5A 1X56A 1K0RA 2JA8G 2F3IA 2F4VL 1E1TA 2XTIA 1V43A 3GTMH 4Y7NH 2AWNA 4GN3B 4P73A 1Y14B 1N36L 3M4PA 3L2PA 1VQOA 4DV5Q 4LF9Q 1M1KC 4BA1I 3CF5A 1Q7YC 2ASBA 1OXSC 2AWOA 1QUQA 1X3FA 1K73C 1K3RA 1M90C 5C3EG 5GAEC 2NVYH 4LUZA 2RCNA 3E9HA 2RF4A 2KHJA 2VQFQ 3W5OA 4HIKA 1PH8A 4GLAC 2B3GA 1N33L 1W3SA 1YBYA 1SR3A 1QVCA 1YJ9A 1MJEA 4DV5L 2KHIA 4LF9L 5LMUL 3GTLH 2Q2IA 3T1YQ 1XMQQ 3PF5A 4GKJQ 1LTLA 1X6OA 3G4SA 3BU2A 3T1HL 3U58A 3M7NA 4AYBE 4WJ4A 2VQFL 4LF5Q 3I55A 2K50A 1YI2A 1YHQA 2UUCL 4IFDG 4DR1Q 1EIYB 2K75A 2YU9H 4LFAL 1OXVA 3AFPA 2YTVA 2MNAA 2KBNA 3GTGH 2PMZE 4C2MH 1JB7A 2VUMG 5IYDG 1XTDA 3T1YL 5K36G 4A93H 1HZAA 4LUOA 1YJNA 3A0JA 3UDGA 3E9IA 2NZOA 3J81c 2D0PA 2N49A 4JBMA 1V9PA 4X65Q 2WP8J 5FLMG 4DR1L 3CCQA 1JT8A 1VQMA 1V1QA 2RHSB 3HKZG 3GTPH 3MEFA 3PUZA 1KXLA 1B7YB 2YTXA 1AE2A 1SE8A 2JQOA 5GAGC 1EUJA 1CKMA 2JA6H 4IOCA 4DAYB 3J81i 1ASYA 4BBRH 3OTOQ 4X65L 5LMNW 4LUVA 3I2ZA 3KLWA 4LWCA 5JEAG 2I0QA 4BY1H 4IPCA 1VQDA 4OWWB 3FHWA 4A3KG 3W1GA 1QVGA 2R93H 1I94Q 4A3DH 4UY8C 2K52A 1EIFA 4B3SL 4A3EH 4UP9A 1HNXL 4JG2A 1VQBA 1L1OB 1PFSA 2AMCB 4DV3L 1MKHA 3W1BA 3TS0A 1CSPA 2F52A 4LF7L 2K5NA 4X64L 2UU9Q 4AQYQ 1N8RC 5M3FH 1KHIA 3STBC 2VQEL 1SRUA 1H95A 3FKIH 4IOAA 2IHEA 3I4NH 4IPGA 1JJGA 2B29A 2BA0A 1X9NA 2DUDA 3E0EA 4HIDA 4IO9A 4A3IH 4GNXA 5M5XH 1Y1VH 4BXXH 1J5EL 3PIPA 1AH9A 4HIMA 4AQYL 1EWIA 1GKHA 2CFMA 4A75A 4YWLA 2ZM6L 1HR0Q 2PQAA 4LF4L 1J6QA 5JJLA 3TREA 4POFA 2HIXA 3U4ZA 1NMFA 4C3HH 1P16A 1XPUA 1FGUA 2HIVA 1N32Q 1X55A 3UE0A 3J7A5 3Q8DA 2ZJPA 1HNZQ 4JI4Q 3PF4A 3TS2A 1OTCA 4R1JA 5IYCG 4A3JH 1AE3A 3RNUA 2VS1A 1XMOL 2R7ZG 1P8LA 4OO1G 4ALPA 1NBWA 3WWVA 4DV4L 3IRBA 1HR0L 3CC4A 1UE5A 1RL2A 1X54A 4R4OA 4R4IA 2NN6I 3EIVA 5IYBG 1MJCA 1NTGA 4KLKA 5C44G 1IYJB 1C0AA 3J81j 4B3MQ 2JA7H 3ER0A 4BY7H 2ZJQA 4A3CG 2Y0SE 3CPWA 1N32L 3KJOA 1XPOA 3H15A 4A4IA 3UDIA 4GLXA 2F4VQ 1WCMH 3AYHB 1Y1WG 3RN5A 1L0WA 4LF8Q 1HZBA 3RZDH 3HOYH 4GOPB 4PG3A 4KHPL 2KCTA 1HZ9A 1PA6A 1N36Q 1NMGA 3OYYA 3H0GG 1SN8A 2LSSA 3S17H 3DM3A 2R92G 3M9BA 1UWVA 1LM0A 4DR3L 4MZ9A 4HIOA 4B3ML 5M3MH 2JA5H 2E5LL 4A3BH 1EOVA 4P71A 4AIMA 3PIOA 4UPAA 1XNQL 4ME3A 2H5XA 1VQIA 1R9TH 4J15A 4LF8L 3BZCA 5BR8Q 5IP7H 1N33Q 2Q2TA 2IY5B 4JCVE 4R4CA 4A3FH 1PYBA 4JI3Q 1TWGH 2D62A 4MTNA 5GROA 5LMUQ 4GNXC 1CKNB 1I5FA 3CCMA 3F8TA 3HKZE 3T1HQ 3GTOH 4GKKQ 2I5LX 4YWMA 1K9MC 1YNXA 3EBEA 4JI2Q 4OXPA 2OQKA 4PZ7A 3STBD 1BKBA 1OXUA 5FLXc 2UUCQ 2Q2HA 1E22A 1RIPA 5BR8L 2WFWA 5IT9c 3G71A 3AEVA 4LFAQ 3EN2A 4JI3L 1KRTA 2OTLA 2OTJA 2MO1A 2Y0SG 4DUYQ 5FJ8H 4A93G 1KL9A 4C3IH 3D0FA 5IWAQ 3CC7A 4GKKL 2PI2A 1IBMQ 1B70B 4QY7A 4JI2L 4RG1A 1BBWA 4KI0A 4DK6C 3D31A 4DR4L 2ZTEA 2HQLA 2UXCQ 2E2JH 3GO5A 3ICEA 3S14H 3TQYA 1Q81C 5JJKA 4HJ9A 2OWOA 4DUYL 1VQLA 1LYLA 4JYAL 4IJHA 1DGSA 1NY4A 5LMNL 3CAMA 4JC0A 5IWAL 2GVBA 1IBML 1XPRA 2EIFA 2C35B 3U50C 2JA6G 1TXYA 1E1OA 3BJUA 3AQQA 1IBKQ 1A63A 4IFDJ 3GD7A 2UXCL 1KIXA 2CKZB 4BY1G 2CWAA 4X6AH 1GM5A 4QGUA 3K80C 4A3MG 1XNRQ 3NEMA 3TEHB 3KF6B 1WOCA 4XTCS 4NXNQ 1PYSB 1UE7A 4OWTB 4HJ8A 1YZ6A 3S2DH 1UEBA 1CSQA 4P75A 3UDXA 3A5UA 4A3EG 4B3SQ 1HNXQ 1LUZA 4A76A 1PV4A 4DV3Q 5C4XH 1IBKL 3I56A 3S1NH 5IE8A 4DR6L 2EXDA 1BVSA 1HH2P 1D8LA 1S3OA 2L15A 4X64Q 4DV1L 4DR2L 1W2BA 1VQ5A 1C7YA 1XNRL 1PH4A 3A5ZB 1S72A 2UU9L 3CQZH 2VQEQ 2HT1A 4NXNL 2UXDL 3AFQA 3HOVH 2BH2A 1E7ZA 3FKIG 4LFCQ 1TWFH 4OWXB 1G6PA 3I4NG 4X66L 4BBSG 2LXKA 4PZ8A 2VUMH 3CCSA 3RR5A 3HOXH 4A3IG 3S24A 1KC8C 1K8AC 1Q46A 4UP7A 5JEAJ 1J5EQ 3TRZA 4GN4B 4BXXG 3B6YA 4DR7Q 5E7NA 2N8NA 2ZM6Q 4NPSA 4LF4Q 5JJIA 1TWCH 3J80c 4YHHQ 1OXXK 3L7ZC 3HOWG 1FVIA 2B63H 4LFCL 4JI6L 1EQRA 3I4OA 3UDFA 1HZCA 3ULLA 2PI2E 3NELA 2BA1A 4FDBA 1PH1A 1PH3A 4LFBL 2Z6KA 1XMOQ 1Q1BA 1U5KA 2UUAL 1KQSA 4A3LH 5C0XI 1D7QA 1L1OA 3PUYA 4JI5L 3PGZA 4DV4Q 3CD6A 3GTJH 4DR7L 4B3RL 1Z47A 3H3VI 4DUZL 4YHHL 3PO3H 1TWAH 3S1RH 1O7IA 3J80i 5IP9G 4DV7Q 4LF6L 3I4MH 4DKAC 4L5SA 4A3GH 3CW2C 3BZKA 1PH9A 1KD1C 2MO0A 1XJVA 4QJFA 3HOYG 2UXBQ 3A74A 4KHPQ 1KAWA 1VQJA 2KCMA 1JJ2A 4K0KQ 1VQGA 2K5HA 2E2HH 1N34Q 2N3SA 2NZHA 3CMEA 3PO2H 2YYZA 1A62A 5HY6A 4DR3Q 4DV7L 3I7FA 5ELNA 1MIUA 5M3MG 4DV6Q 2JA5G 2E5LQ 4P74A 3MXNB 1FL0A 4RMFA 1XNQQ 4JI7L 4LNQA 2R6GA 5IP7G 1CUKA 2UXBL 1L2FA 1ASZA 5ELOA 4A3FG 4K0KL 2ZTDA 4L5TA 1N34L 3FP9A 4QIWE 2QEXA 1Q12A 4IPHA 2NVTH 1UE6A 3DLLA 4DR5Q 1U0LA 4DV6L 2I5MX 2IT1A 3CPFA 5C0XJ 3ZJYC 4YCUA 4KHZA 1KRSA 4EQ5A 4PMWA 3RLNA 4DAMA 1EFWA 1VQKA 3S2HH 2ATWA 3PUWA 3PCOB 4QQBX 2AKWB 1SFOH 1VS0A 1PHJA 4IFDI 1B8AA 2Z6KC 1YVCA 5IYCH 5FJ8G 4GOPA 3CP0A 4JBWA 1QUQB 4DR5L 4JBJA 3HOUH 1L1OC 2MFIA 1VQ6A 2ALYB 3KFUA 1A8VA 2OQ0A 5IYBH 1C9OA 5J3BA 3F2DA 4DR4Q 2DGYA 1YIJA 4L5RC 1S40A 1G291 4NXML 3RZOH 4A3CH 2WB1G 4DV0L 1WFQA 3ULPA 2XGTA 5IY0A 3VDYA 1HR0W 4GN5A 2UUBL 3H3VH 4JYAQ 1Y1WH 2OCEA 5LMNQ 2NN6G 1X3GA 4B3TQ 3U4VA 2D0OA 1WYDA 3H0GH 1EQQA 1CKNA 2VW9A 3RLOA 3HKSA 3RN2A 2R92H 3HOZH 3K7UC 4UP8A 3S1MH 1I3QH 1VQ9A 4POGA 2PNHA 1YEZA 1YHBA 3CCUA 4XIGS 2JA8H 5HGQA 2JEAI 2CWPA 4JI1Q 5AJ3Q 1Q82C 4B3TL 4BA2I 1PH6A 3ULJA 4OX9Q 1WJJA 4WJ3M 1X65A 4BBRG 5C4XG 1A0IA 4DR6Q 3S16H 5C3EH 4DR2Q 1QZHA 4DV1Q 4DV2Q 2VY3A 1UE1A 1G51A
chains in the Genus database with same CATH superfamily
2ZXRA 3CCRA 1PH2A 4X66Q 4ZYSA 2Y0SB 2NVQH 2JE6I 3BDOA 1QVFA 1K83H 3S15H 2HCCA 4KJNA 1E24A 3VYRA 4DV2L 2F0TA 1E3PA 2Z4HA 5JPNC 1GUSA 4LF5L 3IFTA 5BN4A 2JN4A 3S1QB 1D2BA 1JWMD 4R8NA 4JV5L 3KUPA 4N9TA 1BQQT 1PVOA 4LFBQ 2E74C 3HG9A 1TQOA 5CV5A 4OONA 5M5YH 3F2BA 4JI5Q 2ID0A 4DPGA 4DUZQ 5E1FA 2SNSA 3I4MG 3I91A 1TS3A 5I6WA 4A3GG 3DEPA 5HURA 1GXDC 2KENA 5G3LF 4FXGC 1SMXA 3OOCA 4J6HA 1GVPA 3W2DA 3M4OB 3RD4A 1I4GA 3LGJA 1NUCA 1CKOA 2JA7G 4A3KB 2VB2X 4UDUC 1FJGL 1WCMG 4BBSB 1I50B 3GTQB 4NW2A 1SJED 4HJ5A 3OW2A 4C3JH 5EAYA 2L4NA 2NWGA 1VDZA 3PUXA 3MEHA 1GOZA 4RFBA 3M3YB 3HOWB 3KLRA 4K5WA 2IJ0A 5FO9B 5E4WC 3OW7A 2B39A 2VNUD 5A2QL 3KLSA 2NB0A 5FKAC 3CCLA 3J81L 1VQEA 1K8MA 4JI0L 3MA2B 3JAMc 3NENA 1B3AA 4N8FA 5IP9H 1BBUA 2A19A 5DEHA 4Y52H 1STBA 1JWUD 2E2IH 2R7ZH 5KYLA 5FLXE 1CZGA 1MSGA 3L0OA 1PZJD 4YCWA 4GLVB 5GQOA 3CCVA 5IT9E 3TZUA 1KNAA 5C44H 3VA5A 1AFPA 1HHVA 1NJIC 4R4TA 4KD4A 1JCKB 1DXMA 2F3IA 3W3AA 1E1TA 2XTIA 1V43A 4YIJA 3GTMH 2AWNA 4P73A 1TS4A 3HZXA 1M1KC 3CF5A 2ASBA 2NVYB 1OXSC 2AWOA 1F9PA 3R3OA 1K73C 1M90C 5GAEC 3PMFA 4LUZA 2RCNA 3E9HA 1EQTA 2VQFQ 3W5OA 4HIKA 1D5MC 1T5XD 4RGOS 1SR3A 1MGSA 2QDBA 4LF9L 5LMUL 3GTLH 4HEDA 3PF5A 4GKJQ 4PNYA 1O7YA 3M7NA 3T1HL 2NUCA 4AYBE 4DGZA 3NTKA 1LTSD 4IFDG 1YHQA 3S14B 4DR1Q 2YU9H 3GTGB 3AFPA 2MNAA 3DEOA 2PMZE 2VUMG 3OPOA 1PTOH 4ODGA 2LS01 4HR7B 1TU2B 4X65Q 3C3LA 2WP8J 5KNCA 1JT8A 1EEFD 1V1QA 1VQMA 3MEFA 3S2DB 1KXLA 1SE8A 3OIPA 3NSWA 1CKMA 3TP5A 4IOCA 1PFNA 4ZUJA 3U9SA 4BBRH 4BY1B 3MAQA 4LUVA 1CQVA 5EGTA 2KEEA 2QILA 2NTTA 4IPCA 3AB9A 5EQ0A 4A3DB 3W1GA 4K5VA 5EKIA 2K52A 1EIFA 2HUGA 1EY0A 1FNWA 1SYFA 1LT3D 3TS0A 2F0QA 4X64L 4AQYQ 2RA4A 2KJXA 1RF2D 2VQEL 3I73A 1SBBB 3E0EA 1I4HA 2L55A 3I72A 4HIMA 2C9OA 4A75A 2BDOA 4YWLA 4LF4L 1DONA 1E2WA 4C3HB 2HIXA 3U4ZA 1B3QA 2LY7A 3J7A5 3Q8DA 2ZJPA 3TS2A 4R1JA 1B9NA 5IYCG 4OO1G 4QUFA 4HMJA 1WTHA 1NR2A 4ALPA 3WWVA 1X54A 1DZ1A 2R3ZA 4BY7B 1IYJB 2JA7H 3DWQA 1ILQA 3CPWA 1N32L 3C46A 3KJOA 3T13A 1XPOA 3UDIA 1WCMH 4KY5A 3RZDH 4GOPB 4PG3A 3PIP3 1N36Q 2J4XA 4G7HC 2WAQB 3P75A 4MZ9A 4B3ML 2XVSA 2JA5H 2B2VA 2E5LL 3PIOA 4UPAA 1R9TH 5IP7H 3NE5B 4R4CA 4A3FH 4JI3Q 1TWGH 2D62A 2IW3A 4MTNA 3D4DA 2KEDA 4H44C 2P5ZX 4GNXC 1O78A 4DXGA 3HKZE 3J80L 3T4AC 3WOFA 3EBEA 1OXUA 3SK8A 2UUCQ 2EYHA 5BR8L 3G71A 3AEVA 4LFAQ 3IKJA 3KK7A 2OTLA 4RHRA 2OTJA 1LTTD 2H1EA 4A93G 4C3IH 3N6RA 3NBIA 5IWAQ 4TKOB 4GKKL 4CKBA 1IBMQ 4CHTB 1S5DD 1XYIA 2E2JB 1CHQD 3PQIA 3S14H 2KVMA 5JJKA 2O2LD 2PYKA 4DUYL 1B53A 2F0WA 4RKBA 4WJWA 4EQPA 3QIAA 2C35B 2JA6G 4QMGA 4KY7A 1E1OA 5C3EB 4IFDJ 2UXCL 1H9MA 4BWGB 2GA4B 2CWAA 5JVG3 4FXDA 4P2CB 4A3MG 3NEMA 2K04A 3KF6B 4NXNQ 1UE7A 1BOSA 5LL6X 3S2DH 3UDXA 2K5DA 4C1NK 1QWYA 3DHQA 2PZWA 1RTNA 4RWSC 4DR6L 4FNFA 1D8LA 5BN5A 1W2BA 2V4DA 1TS5A 1BXTA 1EOTA 3A5ZB 1XNRL 3CQZH 3HOVB 2UXDL 1TWFB 4IFDH 1LT4D 2F0EA 1Z6HA 2KOLA 3HOXB 4KKUA 1HQRD 2VUMH 3CCSA 4A3IG 2BOSA 3Q23A 1J5EQ 1FYCA 3TRZA 5E7NA 1TWCB 1A2UA 2ZM6Q 1CI3M 2B63B 4YHHQ 1FVIA 2B2WC 2XRQD 1Q90A 1W6JA 5ISRA 1PH1A 1JQYD 1PZKD 4X3UA 1XMOQ 2UUAL 1KQSA 3GTJB 4WRDA 3PGZA 4B3RL 3H3VI 3BYTB 3S1RH 1O7IA 4DFAA 4LF6L 5KNDA 2F0HA 1LO5D 3BZKA 5IODA 3LWEA 5C4ZA 4KHPQ 4K0KQ 1N34Q 2N3SA 3CMEA 3DWAA 1EY9A 1EIHA 2RDHA 5M3MG 4DV6Q 3MXNB 2H4OA 4HSPA 2R61A 4JI7L 4IUQA 4LNQA 2JSOA 1L2FA 3TMEA 1ASZA 3F2UA 3FP9A 2NVTB 5DM73 4QIWE 1PRTF 2QEXA 4B9WA 3SVMA 4DR5Q 4K8IA 4G7ZC 4KHZA 4EQ5A 4RHSA 3V2TA 1A15A 4DA2A 3S2HB 3RLNA 3TP7A 3PCOB 1PHJA 2Z6KC 1YVCA 5IYCH 4GOPA 3HOUH 4JBJA 3QG1A 1L1OC 1DOLA 3K5NA 4TSSA 2ALYB 1SJHD 5J3BA 2XNAC 2DGYA 5FO7B 2K6AA 3Q0AA 4NXML 4MTKA 1J8IA 4DV0L 1Y1WB 4GN5A 3H3VH 2B2YC 3VYUA 4DAPA 1K8OA 4B3TQ 3URYA 2D0OA 1WYDA 1EQQA 3HOZB 2R92B 3S1MB 2BDNA 3MWYW 3RLOA 3HKSA 1L0YB 2AQ3B 5ELFA 3OWFA 4FXKC 2PNHA 2J0TD 4XIGS 2JA8H 3SEBA 2CWPA 1PXUA 3I90A 1WJJA 2B8FA 1X65A 3S16B 5C4XG 1VMPA 5C3EH 4DV2Q 2NVXH 1HFNA 2MUYA 3R2TA 1DD2A 2E2DC 3SGIA 2R93G 2EY2A 5AJ3L 2NVQB 3OIQA 1VQAA 1T9HA 1WD1A 4JV5Q 1K8GA 4OX9L 3V96A 1K83B 3JAML 3S15B 1HRJA 2X6GA 2FMMA 2PW5A 1Z9FA 1BCPC 2Z6BA 4N8X1 2KA7A 5EPLA 1V1OA 2B2UC 1ML0D 4K14A 1IBLL 3KF6A 1WTQA 1XTCD 3EROA 5M5YB 1GD7A 2TMPA 2J7ZA 3LNNA 4A3LG 4XQQA 4DK3C 4MNOA 1HXYD 5FO8B 3ERSX 5FLMH 3PO3G 1Q3LA 4ID6A 2E76C 3MZ5A 4A3MH 2JJQA 4YCVA 4ZAIA 4EX5A 1GO3E 1VCIA 5KEEA 1V8QA 1IKLA 3ONAB 1FJGQ 1GUWA 4A3EB 1EL0A 5GAHC 1B9MA 2JK8A 1HNWL 1QJOA 4PQXA 4KHVA 2JXMB 2PQAB 2GVAA 4XXEA 1JMCA 5EBCA 1KDCA 4GS3A 1N9WA 2A68C 2NBFA 3C1EA 4JI8L 2JEBI 1VQNA 2A73B 4U68A 4TQUS 1F77A 1CT1D 2EJMA 4C3JB 4IQZA 2F0OA 4IALA 2VZAA 1ZEQX 4JI0Q 2WB1E 3F1ZA 3CXCA 4A3BG 4JOIC 1VQHA 3PSIA 3QWNA 2QKIC 2FXQA 5D65A 2GN5A 5T1GA 2KCNA 3MXPA 2QA4A 3MHBA 2LXJA 3KBGA 4L5QA 1RD9D 2AQ2B 4AH6A 4L63B 1BCPD 2AHOB 2K7VA 2N78A 4K2LA 4YWKA 3BZDB 4JW0A 1IXRA 4TRDA 3MXNA 4DK0A 3VA7A 2E2IB 1HNZL 4JI4L 2R7ZB 1LT6D 4YY3L 5IOCA 1NR4A 2HHHL 1UUPA 1I4RA 4S3SA 1JR0D 3GDEA 1I6HH 2V1CC 5ELEA 4EVOA 2L0CA 1QG7A 2DNCA 1WI5A 1X56A 3GTMB 3K5MA 4Y7NH 4XYOA 3SK5A 4LF9Q 1E0BA 3CU7A 4BA1I 1Q7YC 5KGUA 1B1ZA 2A68D 1LTBD 1IYVA 5EBDA 3GQBA 5D3IB 1PH8A 1CA6A 3VR6A 2B3GA 4GZYC 4NMZA 4I65A 5IGBA 1W3SA 3MTSA 3GTLB 3T53B 1YJ9A 1PTOD 1MJEA 1RJTA 3P20A 3HP3A 1XMQQ 1F2MA 3U58A 1A3VA 3A7AB 3P7JA 3I55A 2K50A 3EA6A 1YI2A 2MGSA 2YU9B 1II3A 1SSOA 1IYUA 2LMCB 2M00A 3J7AV 4K5XA 4C2MH 1JB7A 1PTOB 3K6OA 3NXWA 5IYDG 5K36G 2LKVA 2D0PA 1SMYC 2HD3A 2RDGA 2EJGC 3FRPB 3EJIA 1B7YB 1AE2A 1LTAD 4BBRB 3J81i 1WTVA 1ASYA 3OTOQ 1STHA 2AUKA 3KLWA 4LWCA 3DUZA 2CVRA 4OWWB 4A3KG 5COYA 2R93H 1I94Q 4UY8C 5CC4A 4A3EH 4ZKCB 1C8CA 2WINB 1HNXL 1PFSA 4FF4A 4DV3L 2F0JA 4WFN3 1MKHA 2B2TA 3D3RA 3A8KE 2RQXA 2F52A 4LF7L 2F0GA 1JICA 4CDEC 3FKIH 3I4NH 1JJGA 4IO9A 4PMBA 5M5XH 4DK1A 1O7LA 2G5DA 5G3LD 4L6TB 2PQAA 5CYUA 2M2LA 4A3GB 3NHHA 1NMFA 2EZVA 1FGUA 1S5BD 1X55A 4KKTA 3UE0A 1N32Q 4KJOA 3ZYYX 3NUCA 1GHKA 1D6EC 5CV8A 2BE5C 1NCVA 1K0SA 1RL2A 4R4IA 1SMYD 5IYBG 1MJCA 2JA7B 4B3MQ 2ZJQA 1WCMB 3H15A 3RZDB 2F4VQ 2KCCA 2MPMA 3HOYH 1SYCA 3AMUA 1PA6A 3FEWX 1SN8A 3BS1A 1U4PA 2O5IC 3A7LA 1UWVA 4X3TA 2BCOA 4DR3L 2JA5B 4HIOA 1EEID 4A3BH 3T56B 1R9TB 4DNTB 1XNQL 4CDFC 4ME3A 4LF8L 1GUTA 5BR8Q 4A3FB 1N33Q 2Q2TA 2IY5B 1TWGB 1U4RA 3Q6SA 1DCZA 4O42A 5GROA 1M8AA 2SEBD 1QB5D 1CKNB 1XX8A 4KY6A 4H7BA 1PYWD 2CH4W 4GKKQ 2I5LX 4YWMA 3SDZA 4CJ0B 1G2TA 4PZ7A 1PZID 5FLXc 1DOKA 3VR5A 5IT9c 1RDPD 4KK7A 1KRTA 3D8GA 2MO1A 4RKLA 4ZK9B 4DUYQ 3IFDA 4CJ2C 4C3IB 5NUCA 3R2IA 3D0FA 3L3OC 1EZ6A 3OMCA 4KI0A 4DK6C 4DR4L 2HQLA 2UXCQ 3BDLA 2ENBA 3ICEA 3TQYA 5CV9A 1TR5A 1SNDA 2Z4IA 2OEOA 4K8JA 1LYLA 4IJHA 3MXGA 3CAMA 4ZRZA 2GVBA 2WIIB 3ERQA 1XPRA 3NTIA 3U50C 3BJUA 3AQQA 1SXTA 3M7GA 2K28A 3GD7A 1QILA 3X3NA 4BY1G 3K80C 1XNRQ 2QDLA 4QF4A 3TEHB 4XTCS 1FNUA 1GUNA 4OWTB 2K03A 1YZ6A 4B3SQ 1LUZA 3BYYB 4A76A 1PFMA 2IPKD 3FDTA 3I56A 4J8QA 1TY0A 2L15A 2QCPX 3D4WA 3CQZB 1CK1A 4HSVA 5DAUA 1C7YA 1VQ5A 2HT1A 3RUZA 1WD0A 3AFQA 4OWXB 2A69C 4X66L 1ENCA 3IAYA 4CBVA 2VUMB 1XXGA 1RODA 4BXXG 5E3FA 4OIJA 4NPSA 1SE3A 3I8ZA 2F0SA 4LFCL 1LTRD 4C3HG 4V190 1BDOA 3ULLA 2N88A 2PI2E 3NELA 2IL8A 4LFBL 1HUMA 1Q1BA 1GUOA 4HCEA 4IUPA 3SHLA 1I6VC 4JI5L 4DV4Q 3S1RB 4DUZL 2SOBA 1KLUD 3J80i 3I4MH 4AYBB 4L5SA 4A3GH 1CTMA 3CW2C 4RH6A 1HUNA 5CV7A 3D4RA 4DAVA 3BVGA 2F0IA 1V1PB 1VQGA 2F0PA 2NZHA 2YYZA 4EQOA 4DV7L 3I7FA 3OWEB 1MIUA 4P74A 4RMFA 2XWJB 1EY8A 2KECA 4ILWA 2UXBL 2RKSA 5ELOA 2ZTDA 4IPHA 3DLLA 2Z9HA 1U0LA 3CKIB 1I4QA 4KN7C 4PMWA 1EFWA 4DAMA 2A69D 1VQKA 2ATWA 3PUWA 4QQBX 1VS0A 4IFDI 1B8AA 5FJ8G 2PZTA 3HOUB 2EY1A 2CQAA 1VQ6A 2OQ0A 5IYBH 1C9OA 2A74C 3RZOH 1WFQA 2WV6D 2XSCA 4ME5A 3VDYA 3VR3A 2EJFC 1EY6A 4JYAQ 1GUGA 2OXPA 2OCEA 5LMNQ 2NN6G 1YNNC 1JOKA 4M1UB 1CKNA 1A3UA 3RN2A 1MHWC 5C3WA 1VQ9A 3A8IE 3GV3A 4POGA 1STAA 1QNKA 1YHBA 3S9WA 2JA8B 3CCUA 1SNOA 5HGQA 1LT5D 3J81E 5AJ3Q 2B8GA 4OX9Q 3J7YW 3ITPA 1A0IA 2NVXB 4DR2Q 1JE4A 4DV1Q 2Q8TA 4R8IA 2UU9Q 1J9OA 3H91A 2NTSA 4KV6A 3HOVG 3CC2A 1JC7A 3E3XA 1IBLQ 2ZJRA 4DXFA 1XWEA 1LABA 3HOXG 2A8VA 4GKJL 2JA9A 1ONLA 3KJPA 1EQVA 3M85A 1CZWA 1JE5A 1F2ZA 3KOJA 2G9DA 5M3FG 1HQMC 4Z9CB 3NQTA 5I9PA 2B63G 4NDXA 4JI6Q 1Q1EA 2HQEA 1E2ZA 3L9AX 3G6EA 1WTRA 1Y1VG 4L8JA 2R7DA 2JA6B 1FGBD 1SLJA 3T16A 4F8MA 1HNWQ 5EKKA 4FF1A 2DJFC 4OO1I 4HJAA 1H9RA 3HKZB 4I7AA 1PRTC 5CR3A 4A3MB 4JI8Q 5CBEE 3GTKH 3KLSX 2EDGA 4NB3A 5I4DA 5M5WH 1YITA 4A3JG 4GNXB 2A1AA 1YNND 4DNIA 5CGKA 3ND8A 3PO2G 3D6CA 2F0MA 5IGDA 1VQ8A 1DM0B 5M9OA 3HGBA 2NZ1D 2FMCA 2XIWA 4IJLA 2R7FA 1YHAA 1VQFA 4B08A 3QOLA 3F2CA 2EPBA 1SROA 1ET9A 3KDFA 2CW0C 3K81C 4P72A 4OGQC 4UAIA 1Q8KA 3CRLC 2MQHA 1SE4A 2Q8IB 4CKCA 3NBHB 2DNEA 2XRSD 4OELB 2RBMA 2FHTA 5HGTA 4YY3Q 3JC66 2ICEC 1V1PA 2HHHQ 2IWHA 3DMUA 5DM63 3HFZB 5DLQE 3TP8A 2VL6A 2K4KA 4X62L 1TWHH 2K5VA 2YV5A 4DU9A 4RCOA 5C0XG 1ESFA 1WTOA 2UUBQ 5F2DA 5C4JH 4TVAB 4OO1H 3K58A 1PH7A 1OXTA 3NWTA 3PV0A 1MSHA 1X3EA 2EYOA 4F87A 1YJWA 3JAMi 1I6HB 2G9HD 4CJ1B 1JJCB 1PH5A 3K0XA 3HOZG 5M3MB 1VQ4A 3J7ZC 2IX1A 4IZ8A 3Q22A 4Y7NB 3H09A 4O1NA 1EYCA 1NSNS 1Y14B 1N36L 2NYZD 1JOQA 1ET6A 3CRKC 1VQ7A 1G6ZA 1K3RA 2RF4A 2EYLA 2KHJA 4IURA 4DNRB 4RGNA 4GLAC 5I2YA 1NAPA 3EVQA 5I2XA 4DV5L 2KHIA 1LTLA 3BU2A 4WJ4A 3P1HA 1CHPD 4RGTA 4LF5Q 2UUCL 1EIYB 3TBIB 4LFAL 4C2MB 2KBNA 4Q0FA 3NP8A 1XTDA 4HN7A 3T1YL 4A93H 2L1BA 2NN6H 4LUOA 3UDGA 4M8AA 3SXHA 4NKLA 4QIWB 5CORA 2N49A 1V9PA 1A6XA 5FOBB 1MD2D 4IUVA 2RHSB 1RTOA 3C2PA 5FK9C 3R8BA 3PUZA 4N9PA 5GAGC 5JVH3 3K0YA 1D5ZC 3D6WA 1IW7C 1SNCA 3J80E 5C4XB 2JA6H 1F2LA 1SE2A 2SDFA 5LMNW 3I2ZA 1SYDA 4V0BA 1VQDA 2R93B 3FHWA 1Y8OB 3ND9A 1B2TA 5A35A 5LHY1 1KDAA 1VQBA 1L1OB 2AMCB 1LLRD 3EQLC 4Q5VA 3K5LA 5FLXL 1N8RC 1EY4A 1EFID 5M3FH 5IT9L 3FKIB 4ULLA 5ELBA 1SRUA 4XQJA 3I4NB 1DOMA 4IOAA 2IHEA 4IPGA 3TN2A 2B29A 2BA0A 1X9NA 5M5XB 4A3IH 1A2TA 2F0UA 2K1BA 4GNXA 1Y1VH 1J5EL 1S5ED 4U673 3PIPA 1AH9A 1EWIA 2CFMA 2ZM6L 1KDBA 3PO3B 2FFKB 5JJLA 4KTAA 4DN4M 4POFA 4F88A 1SDFA 5EPKA 3V05A 2HIVA 4FF2A 1VF7A 1FNVA 3SK4A 1OTCA 1XMOL 4A3JH 1AE3A 2R7ZG 2VS1A 1P8LA 4LMQD 1EU4A 1D1IA 4EQNA 1NBWA 4ABNA 3I4LA 4OL7A 1HR0L 1UE5A 1QCBD 5DNFA 4R4OA 3EIVA 1NTGA 4KLKA 4CKEA 5C44G 1U4MA 3ER0A 5EJWA 5KIXA 4A3CG 2Y0SE 2PCFB 3SK6A 4A4IA 3HOYB 4G7OC 3AYHB 2LFNA 4LF8Q 1L0WA 1ENAA 4KHPL 3NBHA 2PZUA 5C5LA 1NMGA 3OYYA 1STYA 2LSSA 3H0GG 3BVMA 3S17H 3DM3A 1BCPB 4RCNA 3T51B 1LM0A 1HCZA 4A3BB 1EZ8A 5M3MH 3AU7A 1NNXA 4OIKA 4P71A 5JJZA 1SNQA 4AIMA 3G7LA 1C4QA 2H5XA 1VQIA 1EY7A 1PYBA 1R4QB 3DWPA 5LMUQ 1I5FA 3F8TA 4IUTA 3T1HQ 3GTOH 4UHVA 1K9MC 4OXPA 1BKBA 3NTHA 2Q2HA 1E22A 1RIPA 3R93A 1PTOF 1HA5A 3EN2A 2EYMA 3VYSA 2Y0SG 3OSOA 2PNRC 2EYPA 1KL9A 3E0JA 3CHBD 5IIFA 1U9RA 2A5HA 4JI2L 2Q8RE 5JPMC 1I3QB 2ZTEA 2WB1B 1AP0A 2B2WA 2SNMA 3GO5A 4EGVA 1Q81C 4LK1C 3WDNA 1X32A 2OWOA 4G57A 4IUUA 2DY7A 1VQLA 1L0XB 1DGSA 1NY4A 4OEMB 2EIFA 1WVLA 1A63A 2EVBA 2FJ2A 3I3CA 1LTID 1SAPA 2CKZB 2B2VC 4X6AH 4FP5D 1JWSD 1PYSB 3TDQA 4P75A 4QB4A 1PV4A 1Q8IA 5C4XH 3IL8A 1IBKL 4CGYB 1HH2P 4X64Q 1S3OA 4C56C 1QE6A 4RA8A 4NP5A 1PH4A 2VQEQ 1D5XC 2BH2A 1E7ZA 4LFCQ 3BVZA 1G6PA 4BBSG 1O80A 3VR2A 2LXKA 4PZ8A 3M4YA 1BNZA 1K8AC 2D5DA 4UP7A 3B6YA 4LF4Q 1G8ZD 5JJIA 2MP1A 1HTPA 3HOWG 1ILPA 1DYQA 4KMUC 3UDFA 1HZCA 4K6LA 4FDBA 2Z6KA 1U5KA 4A3LH 2A6HC 1S5CD 1L1OA 4DR7L 3CD6A 4FYDA 1Z47A 5D14A 3DM1A 3I4MB 3PO3H 1TWAH 1LV9A 2F3WA 4DV7Q 5I9OA 3QR8A 1SNMA 1PMRA 3K7AB 1PH9A 2MO0A 1OO9B 3GP7A 3JAME 2B2YA 4QJFA 2UXBQ 3A74A 1KAWA 2K5QA 1VQJA 3C1FA 2K5HA 2E2HH 1GHJA 1Y8NB 1A62A 5HY6A 5ELNA 4LAAA 4E6IA 2E5LQ 4I7ZC 2JA5G 3MVVA 2MHVA 1H9SB 2K05A 1F2YA 2R6GA 5IP7G 2I46A 4A3FG 3WOEA 1Q12A 1UE6A 3HRZC 1ICFB 2L5TA 5EKLA 4FO2A 2IT1A 3CPFA 1TY2A 5IGEA 3ZJYC 4YCUA 2D9UA 5KRUA 5I6YA 4JVZA 2HCIA 2L12A 1SFOH 4JBWA 4C3IG 1QUQB 1PFBA 3KFUA 1A8VA 1D1KA 2EOTA 3BDCA 3RZOB 2B2UA 1CQFA 4A3CH 2XGTA 3VYTA 2WKDA 5IY0A 3LWUA 3N52A 2A6HD 1X3GA 3NQIA 4QUCA 2ZXOA 3H0GH 2F0KA 1IKMA 2VW9A 3K7UC 1B50A 4LJZC 4ZLTF 1I3QH 1AZQA 1MI2A 2K01A 2PQEA 1PLFA 3A54A 1AEXA 5K5PA 4X3SA 1KLGD 2JEAI 4HCSA 1Q82C 4BA2I 3ULJA 2BE5D 2XN9C 4K6DA 4DR6Q 1UAPA 3K59A 4XT3B 1AW7A 1G51A 2IX0A 2UXDQ 4A3DG 1S4ZA 2E8GA 4JI1L 2C5CA 3MFYA 4ZCKA 1XMQL 5CBAE 4GOPC 3UE1A 2MJ8A 1JORA 4XQNA 1HJPA 1TIID 4PZ6A 4IPDA 4JOIA 2DY8A 3KF8B 4X3KA 2F0VA 3G48A 3CMAA 5ELCA 1JOOA 4J1MA 3RLFA 3S1QH 3GTPB 4ZKBB 2WAQE 4LW1A 2F03A 5IYDH 5K36H 1LTGD 3NK9A 3CCJA 2UUAQ 4B3RQ 3CCEA 4ZQ3A 4R4QA 1O7ZA 1EYGA 4LF6Q 3GTKB 1EWCA 1QOHA 1G2SA 2HDMA 2JP1A 4AYBG 5M5WB 3E6ZX 2EE1A 1IZ6A 2CHBD 4O0AA 3H3VC 1QNUA 3RMHA 3KDFB 3KYHC 3OTOL 2ZTCA 2CQOA 1Q86C 1STGA 2QF7A 3PUVA 4K2KA 5GADC 3M4OH 4BY7G 1PDQA 2ES2A 5JAVA 1KNEA 1QZGA 4A3KH 2WKCA 2DN8A 4JI7Q 3K7AH 1I94L 2RSOA 3E5SA 1FR3A 4BBSH 1I50H 3GTQH 2EQSA 2Z0SA 2PMZB 4QL5A 3NPPA 1VQPA 2WAQG 5EPJA 1IL2A 1UNSA 2F0LA 2K14A 4H02A 3K5OA 2RHQB 1KAAA 4APVA 1X3PA 2EY5A 3HOWH 2I5HA 2Q2UA 3M3YH 1GJXA 1VQCA 3UI2A 4X62Q 5H1SE 2CCZA 2IHFA 2QGQA 1B44D 2BH8A 2L11A 3M4QA 1ENFA 1I4PA 3HOUG 1U4LA 2KHSA 1TWHB 2VB3X 5C4HA 4NXMQ 4DV0Q 1EYAA 1H9SA 4JBKA 2F3VA 5C4JB 2YTYA 3K8AA 4H0LC 1S5FD 1CFMA 1KABA 5C6AA 4O2DA 2L9HA 4MIUA 1NE3A 2EYJA 3FPPA 4HJ7A 1KTKA 1HTLD 1K0RA 3SE0A 2JA8G 2F4VL 2X6LA 1RKNA 3G6JB 1EY5A 4GN3B 3M4PA 3L2PA 1VQOA 4DV5Q 3QO2A 1JJ2A 1QUQA 1X3FA 2K33A 1SYEA 5C3EG 2NVYH 2HDLA 5A2QE 1VMCA 1SNPA 3FMCA 5J1ZA 1N33L 2ICIA 1YBYA 3BG3A 1QVCA 1EU3A 3MFGA 3A8JE 2Q2IA 4RAUC 3VR4A 1F9SA 3T1YQ 1X6OA 1W6KA 4DF7A 3G4SA 5BN3A 2VQFL 4QCLA 1SYBA 1ZXTA 1EWHA 3DXJC 4CDCC 2JYOA 1F9QA 2K75A 1OXVA 2YTVA 3GTGH 4A93B 4FF3A 1HZAA 4XDXA 1YJNA 3A0JA 3E9IA 2NZOA 3J81c 1STEA 4JBMA 1H9KA 5FLMG 4DR1L 3CCQA 3HKZG 2XWBB 3GTPH 5T1IA 3FPUB 2YTXA 2JQOA 1EUJA 1YNJC 1MBYA 4DAYB 3S1NB 2OF1A 4X65L 5C3XA 5L37A 5JEAG 2I0QA 4BY1H 3GV6A 3KF8A 1STNA 3MC0B 4KKSA 4ZUIA 1QVGA 1BBXC 4A3DH 2A6EC 4B3SL 4UP9A 2WACA 4JG2A 4IN3A 3W1BA 1CSPA 2KQ3A 2K5NA 5M3FB 4R9WA 1KHIA 1IL8A 3STBC 1ICWA 3A56A 5TSSA 1H95A 1VF5C 3TSSA 4A3IB 3NWSA 2DUDA 1C48A 1Y1VB 3MXUA 4HIDA 1AZPA 4BXXH 4AQYL 4HMIA 1GKHA 1K3BC 1HR0Q 5D3DA 1J6QA 4IUNA 3TREA 1H9JA 1CA5A 4C3HH 1P16A 1XPUA 1RCVD 4A3JB 1Y69U 1HNZQ 4JI4Q 3PF4A 3EFXD 3RNUA 5CV6A 1HA6A 2EY6A 2RDFA 1R4PB 4DV4L 3IRBA 3PO2B 3H94A 1DJRD 3CC4A 2E75C 2NN6I 1C0AA 1UEAB 3J81j 4KN4C 4BY7H 3TP6A 1WTPA 1WTXA 4GLXA 1Y1WG 3RN5A 1HZBA 1ESRA 1HZ9A 2KCTA 5CV4A 3QB3A 3S17B 1YNJD 1K28A 2R92G 3M9BA 2B2TC 1PRTD 1T5EA 1WTWA 1EOVA 3FVQA 4J15A 2X69A 3BZCA 4WORA 2A6ED 3X3MA 4H13C 4G4KA 4JCVE 2F4IA 1M4VA 3U9OA 4BS9A 3CCMA 3GTOB 4JPBW 1PRTB 1EYDA 1YNXA 2RVLA 4JI2Q 2OQKA 3STBD 2N55A 1CM9A 2PO4A 2K32A 2WFWA 2PPBC 4JI3L 3KBXA 1ZKOA 5FJ8H 5E4XA 1TKWB 3CC7A 2PI2A 2CW0D 4CDDC 1B70B 4QY7A 4RG1A 1BBWA 1SYGA 2F0FA 3D31A 5IGFA 5KNBA 1TS2A 3Q24A 2E2JH 4HJ9A 5J39A 4KD3A 3OHXC 4JYAL 1ZYRC 1IHZA 5LMNL 4JC0A 5IWAL 2Z1CA 1IBML 2AQ1B 2F0NA 1TXYA 1IBKQ 4XYQA 1Y8PB 1G91A 1KIXA 1GM5A 1E2VA 4QGUA 1BF4A 1WOCA 2O5JC 4HJ8A 1UEBA 1CSQA 3A5UA 4A3EG 2K5WA 2KUMA 1HNXQ 4DV3Q 3S1NH 2OT2A 5IE8A 2EXDA 1BVSA 4DR2L 4DV1L 4LF7Q 2PW7A 4F7XA 2UU9L 1S72A 3K57A 4NXNL 4B9XA 3J7AF 3HOVH 5KYIA 3FKIG 1TWFH 3I4NG 3OMGA 3QOJA 4C3JG 3RR5A 3HOXH 3S24A 2RCFA 4PMCA 1KC8C 1Q46A 5JEAJ 4GN4B 4DR7Q 4DAYA 2N8NA 2Z8LA 1F9RA 1TWCH 4JK1C 3J80c 1OXXK 3L7ZC 5LL6S 2B63H 4JI6L 1EQRA 4XT1B 1LACA 3I4OA 1I4XA 1B4OA 4OHJA 1HPCA 2BA1A 1PH3A 5C5MA 3TZDA 5C0XI 1D7QA 3PUYA 3GTJH 1SEBD 2VXWA 5ELDA 1TWAB 4YHHL 5IP9G 5JEAH 4DKAC 1EIGA 5JOBA 1KD1C 1XJVA 1ZYRD 1FD7D 3HOYG 2CH4A 1BCPF 2E2HB 2KCMA 4PV1C 1PTOC 3PO2H 3HS0C 1JB3A 4DR3Q 1FL0A 1RHPA 5IGCA 2EYFA 1XNQQ 4HAEA 1A3TA 1CUKA 3H6MA 4K0KL 1IW7D 5IGGA 4L5TA 1N34L 2NVTH 5J22A 3LX0A 2O4XA 3I70A 2F0DA 3A55A 4DV6L 2I5MX 5C0XJ 1KRSA 3S2HH 2QEJC 1SFOB 3O13A 2AKWB 5AFWA 1TT2A 3CP0A 4DR5L 2D2CC 2MFIA 2EXZA 1Z7TA 2ZXPA 1BR9A 5C44B 4DR4Q 1AN8A 3F2DA 1YIJA 4L5RC 1S40A 2RSNA 1BUVT 1G291 1HFGA 2WB1G 4MHEA 2DJGC 4RGMA 3SR1A 5C0XH 2IX3A 1BO0A 3ULPA 1HR0W 4FVMA 2UUBL 1Y1WH 2TSSA 3H0GB 3U4VA 2R92H 3HOZH 3PIO3 2AUJD 4UP8A 4C1NI 3S1MH 1X3QA 1YEZA 4MN3A 2FINB 4HTHA 3QJYA 5CMDA 2M9VA 2F1MA 3HEJA 4JI1Q 2I07B 2ZT9C 4B3TL 1PH6A 1TVXA 4WJ3M 4BBRG 3S16H 1QZHA 2QW7A 2VY3A 1UE1A
chains in the Genus database with same CATH topology
2IX0A 2UXDQ 3SGIA 3CCRA 2R93G 3HOVG 3CC2A 4A3DG 1PH2A 2E8GA 4JI1L 4X66Q 5AJ3L 1IBLQ 1VQAA 1T9HA 4JV5Q 2ZJRA 1K8GA 4OX9L 2NVQH 2JE6I 3HOXG 1XMQL 1QVFA 4GOPC 1K83H 2JA9A 2A8VA 4GKJL 3S15H 3UE1A 3KJPA 1E24A 1HJPA 1Z9FA 4PZ6A 3M85A 4DV2L 1JE5A 1E3PA 3KOJA 4IPDA 4JOIA 5M3FG 4LF5L 1VQ7A 3KF8B 2B63G 3G48A 3CMAA 3RLFA 4JI6Q 1Q1EA 1IBLL 3S1QH 3KF6A 4JV5L 2WAQE 4LW1A 3G6EA 1PVOA 4LFBQ 5IYDH 1Y1VG 3CCJA 1GD7A 2UUAQ 2R7DA 4A3LG 4OONA 5M5YH 3F2BA 1SLJA 4DK3C 3CCEA 4JI5Q 4MNOA 2ID0A 4B3RQ 1HNWQ 4R4QA 4DPGA 1EYGA 4OO1I 4DUZQ 4HJAA 3ERSX 5FLMH 3PO3G 4LF6Q 3I4MG 4JI8Q 3GTKH 4A3GG 4A3MH 4NB3A 4AYBG 2JJQA 4YCVA 4EX5A 1GO3E 5M5WH 1VCIA 1YITA 1FJGQ 1IZ6A 4A3JG 4GNXB 2KENA 5GAHC 2A1AA 2JK8A 4O0AA 4DNIA 1SMXA 1HNWL 3KDFB 3KYHC 1GVPA 3PO2G 2PQAB 2ZTCA 2CQOA 3OTOL 1Q86C 2GVAA 1VQ8A 3PUVA 3LGJA 1JMCA 5GADC 4GS3A 3M4OH 1N9WA 4JI8L 1CKOA 2JA7G 2ES2A 4BY7G 1QZGA 2JEBI 4A3KH 4JI7Q 3K7AH 4IJLA 1FJGL 1WCMG 1I94L 2R7FA 1YHAA 1VQNA 2NVXH 4BBSH 4TQUS 1VQFA 1I50H 4HJ5A 3OW2A 2EQSA 3GTQH 2Z0SA 4QL5A 4C3JH 2VZAA 3F2CA 1VQPA 5EAYA 2WAQG 4JI0Q 1SROA 2WB1E 1IL2A 3F1ZA 3CXCA 2K14A 3KDFA 3K81C 3PUXA 4H02A 4A3BG 2RHQB 4JOIC 4P72A 1VQHA 3PSIA 4APVA 1Q8KA 3M3YH 3HOWH 2I5HA 2FXQA 2MQHA 2GN5A 1VQCA 4X62Q 2Q2UA 4LF7Q 5H1SE 2VNUD 2QA4A 2IHFA 2CCZA 3NBHB 2LXJA 2QGQA 2BH8A 3M4QA 4L5QA 3CCLA 4YY3Q 1VQEA 3JC66 4JI0L 2HHHQ 3HOUG 4AH6A 3JAMc 3NENA 3HFZB 5DLQE 2AHOB 2N78A 4YWKA 2VL6A 2K4KA 1IXRA 5IP9H 1BBUA 1TWHH 4X62L 2A19A 4NXMQ 2K5VA 2YV5A 4DV0Q 5C0XG 4JBKA 4Y52H 1HNZL 4JI4L 2UUBQ 5C4JH 2YTYA 4TVAB 3K8AA 4YY3L 2E2IH 2R7ZH 1PH7A 2HHHL 1OXTA 3PV0A 1X3EA 4O2DA 1YJWA 3JAMi 3GDEA 3L0OA 4YCWA 3CCVA 1JJCB 4GLVB 5GQOA 3K0XA 1PH5A 2V1CC 3HOZG 1I6HH 5C44H 1NE3A 1VQ4A 1NJIC 3J7ZC 4R4TA 4HJ7A 2IX1A 1WI5A 1X56A 1K0RA 2JA8G 2F3IA 2F4VL 1E1TA 2XTIA 1V43A 3GTMH 4Y7NH 2AWNA 4GN3B 4P73A 1Y14B 1N36L 3M4PA 3L2PA 1VQOA 4DV5Q 4LF9Q 1M1KC 4BA1I 3CF5A 1Q7YC 2ASBA 1OXSC 2AWOA 1QUQA 1X3FA 1K73C 1K3RA 1M90C 5C3EG 5GAEC 2NVYH 4LUZA 2RCNA 3E9HA 2RF4A 2KHJA 2VQFQ 3W5OA 4HIKA 1PH8A 4GLAC 2B3GA 1N33L 1W3SA 1YBYA 1SR3A 1QVCA 1YJ9A 1MJEA 4DV5L 2KHIA 4LF9L 5LMUL 3GTLH 2Q2IA 3T1YQ 1XMQQ 3PF5A 4GKJQ 1LTLA 1X6OA 3G4SA 3BU2A 3T1HL 3U58A 3M7NA 4AYBE 4WJ4A 2VQFL 4LF5Q 3I55A 2K50A 1YI2A 1YHQA 2UUCL 4IFDG 4DR1Q 1EIYB 2K75A 2YU9H 4LFAL 1OXVA 3AFPA 2YTVA 2MNAA 2KBNA 3GTGH 2PMZE 4C2MH 1JB7A 2VUMG 5IYDG 1XTDA 3T1YL 5K36G 4A93H 1HZAA 4LUOA 1YJNA 3A0JA 3UDGA 3E9IA 2NZOA 3J81c 2D0PA 2N49A 4JBMA 1V9PA 4X65Q 2WP8J 5FLMG 4DR1L 3CCQA 1JT8A 1VQMA 1V1QA 2RHSB 3HKZG 3GTPH 3MEFA 3PUZA 1KXLA 1B7YB 2YTXA 1AE2A 1SE8A 2JQOA 5GAGC 1EUJA 1CKMA 2JA6H 4IOCA 4DAYB 3J81i 1ASYA 4BBRH 3OTOQ 4X65L 5LMNW 4LUVA 3I2ZA 3KLWA 4LWCA 5JEAG 2I0QA 4BY1H 4IPCA 1VQDA 4OWWB 3FHWA 4A3KG 3W1GA 1QVGA 2R93H 1I94Q 4A3DH 4UY8C 2K52A 1EIFA 4B3SL 4A3EH 4UP9A 1HNXL 4JG2A 1VQBA 1L1OB 1PFSA 2AMCB 4DV3L 1MKHA 3W1BA 3TS0A 1CSPA 2F52A 4LF7L 2K5NA 4X64L 2UU9Q 4AQYQ 1N8RC 5M3FH 1KHIA 3STBC 2VQEL 1SRUA 1H95A 3FKIH 4IOAA 2IHEA 3I4NH 4IPGA 1JJGA 2B29A 2BA0A 1X9NA 2DUDA 3E0EA 4HIDA 4IO9A 4A3IH 4GNXA 5M5XH 1Y1VH 4BXXH 1J5EL 3PIPA 1AH9A 4HIMA 4AQYL 1EWIA 1GKHA 2CFMA 4A75A 4YWLA 2ZM6L 1HR0Q 2PQAA 4LF4L 1J6QA 5JJLA 3TREA 4POFA 2HIXA 3U4ZA 1NMFA 4C3HH 1P16A 1XPUA 1FGUA 2HIVA 1N32Q 1X55A 3UE0A 3J7A5 3Q8DA 2ZJPA 1HNZQ 4JI4Q 3PF4A 3TS2A 1OTCA 4R1JA 5IYCG 4A3JH 1AE3A 3RNUA 2VS1A 1XMOL 2R7ZG 1P8LA 4OO1G 4ALPA 1NBWA 3WWVA 4DV4L 3IRBA 1HR0L 3CC4A 1UE5A 1RL2A 1X54A 4R4OA 4R4IA 2NN6I 3EIVA 5IYBG 1MJCA 1NTGA 4KLKA 5C44G 1IYJB 1C0AA 3J81j 4B3MQ 2JA7H 3ER0A 4BY7H 2ZJQA 4A3CG 2Y0SE 3CPWA 1N32L 3KJOA 1XPOA 3H15A 4A4IA 3UDIA 4GLXA 2F4VQ 1WCMH 3AYHB 1Y1WG 3RN5A 1L0WA 4LF8Q 1HZBA 3RZDH 3HOYH 4GOPB 4PG3A 4KHPL 2KCTA 1HZ9A 1PA6A 1N36Q 1NMGA 3OYYA 3H0GG 1SN8A 2LSSA 3S17H 3DM3A 2R92G 3M9BA 1UWVA 1LM0A 4DR3L 4MZ9A 4HIOA 4B3ML 5M3MH 2JA5H 2E5LL 4A3BH 1EOVA 4P71A 4AIMA 3PIOA 4UPAA 1XNQL 4ME3A 2H5XA 1VQIA 1R9TH 4J15A 4LF8L 3BZCA 5BR8Q 5IP7H 1N33Q 2Q2TA 2IY5B 4JCVE 4R4CA 4A3FH 1PYBA 4JI3Q 1TWGH 2D62A 4MTNA 5GROA 5LMUQ 4GNXC 1CKNB 1I5FA 3CCMA 3F8TA 3HKZE 3T1HQ 3GTOH 4GKKQ 2I5LX 4YWMA 1K9MC 1YNXA 3EBEA 4JI2Q 4OXPA 2OQKA 4PZ7A 3STBD 1BKBA 1OXUA 5FLXc 2UUCQ 2Q2HA 1E22A 1RIPA 5BR8L 2WFWA 5IT9c 3G71A 3AEVA 4LFAQ 3EN2A 4JI3L 1KRTA 2OTLA 2OTJA 2MO1A 2Y0SG 4DUYQ 5FJ8H 4A93G 1KL9A 4C3IH 3D0FA 5IWAQ 3CC7A 4GKKL 2PI2A 1IBMQ 1B70B 4QY7A 4JI2L 4RG1A 1BBWA 4KI0A 4DK6C 3D31A 4DR4L 2ZTEA 2HQLA 2UXCQ 2E2JH 3GO5A 3ICEA 3S14H 3TQYA 1Q81C 5JJKA 4HJ9A 2OWOA 4DUYL 1VQLA 1LYLA 4JYAL 4IJHA 1DGSA 1NY4A 5LMNL 3CAMA 4JC0A 5IWAL 2GVBA 1IBML 1XPRA 2EIFA 2C35B 3U50C 2JA6G 1TXYA 1E1OA 3BJUA 3AQQA 1IBKQ 1A63A 4IFDJ 3GD7A 2UXCL 1KIXA 2CKZB 4BY1G 2CWAA 4X6AH 1GM5A 4QGUA 3K80C 4A3MG 1XNRQ 3NEMA 3TEHB 3KF6B 1WOCA 4XTCS 4NXNQ 1PYSB 1UE7A 4OWTB 4HJ8A 1YZ6A 3S2DH 1UEBA 1CSQA 4P75A 3UDXA 3A5UA 4A3EG 4B3SQ 1HNXQ 1LUZA 4A76A 1PV4A 4DV3Q 5C4XH 1IBKL 3I56A 3S1NH 5IE8A 4DR6L 2EXDA 1BVSA 1HH2P 1D8LA 1S3OA 2L15A 4X64Q 4DV1L 4DR2L 1W2BA 1VQ5A 1C7YA 1XNRL 1PH4A 3A5ZB 1S72A 2UU9L 3CQZH 2VQEQ 2HT1A 4NXNL 2UXDL 3AFQA 3HOVH 2BH2A 1E7ZA 3FKIG 4LFCQ 1TWFH 4OWXB 1G6PA 3I4NG 4X66L 4BBSG 2LXKA 4PZ8A 2VUMH 3CCSA 3RR5A 3HOXH 4A3IG 3S24A 1KC8C 1K8AC 1Q46A 4UP7A 5JEAJ 1J5EQ 3TRZA 4GN4B 4BXXG 3B6YA 4DR7Q 5E7NA 2N8NA 2ZM6Q 4NPSA 4LF4Q 5JJIA 1TWCH 3J80c 4YHHQ 1OXXK 3L7ZC 3HOWG 1FVIA 2B63H 4LFCL 4JI6L 1EQRA 3I4OA 3UDFA 1HZCA 3ULLA 2PI2E 3NELA 2BA1A 4FDBA 1PH1A 1PH3A 4LFBL 2Z6KA 1XMOQ 1Q1BA 1U5KA 2UUAL 1KQSA 4A3LH 5C0XI 1D7QA 1L1OA 3PUYA 4JI5L 3PGZA 4DV4Q 3CD6A 3GTJH 4DR7L 4B3RL 1Z47A 3H3VI 4DUZL 4YHHL 3PO3H 1TWAH 3S1RH 1O7IA 3J80i 5IP9G 4DV7Q 4LF6L 3I4MH 4DKAC 4L5SA 4A3GH 3CW2C 3BZKA 1PH9A 1KD1C 2MO0A 1XJVA 4QJFA 3HOYG 2UXBQ 3A74A 4KHPQ 1KAWA 1VQJA 2KCMA 1JJ2A 4K0KQ 1VQGA 2K5HA 2E2HH 1N34Q 2N3SA 2NZHA 3CMEA 3PO2H 2YYZA 1A62A 5HY6A 4DR3Q 4DV7L 3I7FA 5ELNA 1MIUA 5M3MG 4DV6Q 2JA5G 2E5LQ 4P74A 3MXNB 1FL0A 4RMFA 1XNQQ 4JI7L 4LNQA 2R6GA 5IP7G 1CUKA 2UXBL 1L2FA 1ASZA 5ELOA 4A3FG 4K0KL 2ZTDA 4L5TA 1N34L 3FP9A 4QIWE 2QEXA 1Q12A 4IPHA 2NVTH 1UE6A 3DLLA 4DR5Q 1U0LA 4DV6L 2I5MX 2IT1A 3CPFA 5C0XJ 3ZJYC 4YCUA 4KHZA 1KRSA 4EQ5A 4PMWA 3RLNA 4DAMA 1EFWA 1VQKA 3S2HH 2ATWA 3PUWA 3PCOB 4QQBX 2AKWB 1SFOH 1VS0A 1PHJA 4IFDI 1B8AA 2Z6KC 1YVCA 5IYCH 5FJ8G 4GOPA 3CP0A 4JBWA 1QUQB 4DR5L 4JBJA 3HOUH 1L1OC 2MFIA 1VQ6A 2ALYB 3KFUA 1A8VA 2OQ0A 5IYBH 1C9OA 5J3BA 3F2DA 4DR4Q 2DGYA 1YIJA 4L5RC 1S40A 1G291 4NXML 3RZOH 4A3CH 2WB1G 4DV0L 1WFQA 3ULPA 2XGTA 5IY0A 3VDYA 1HR0W 4GN5A 2UUBL 3H3VH 4JYAQ 1Y1WH 2OCEA 5LMNQ 2NN6G 1X3GA 4B3TQ 3U4VA 2D0OA 1WYDA 3H0GH 1EQQA 1CKNA 2VW9A 3RLOA 3HKSA 3RN2A 2R92H 3HOZH 3K7UC 4UP8A 3S1MH 1I3QH 1VQ9A 4POGA 2PNHA 1YEZA 1YHBA 3CCUA 4XIGS 2JA8H 5HGQA 2JEAI 2CWPA 4JI1Q 5AJ3Q 1Q82C 4B3TL 4BA2I 1PH6A 3ULJA 4OX9Q 1WJJA 4WJ3M 1X65A 4BBRG 5C4XG 1A0IA 4DR6Q 3S16H 5C3EH 4DR2Q 1QZHA 4DV1Q 4DV2Q 2VY3A 1UE1A 1G51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IX0 A;  2UXD Q;  3SGI A;  3CCR A;  2R93 G;  3HOV G;  3CC2 A;  4A3D G;  1PH2 A;  2E8G A;  4JI1 L;  4X66 Q;  5AJ3 L;  1IBL Q;  1VQA A;  1T9H A;  4JV5 Q;  2ZJR A;  1K8G A;  4OX9 L;  2NVQ H;  2JE6 I;  3HOX G;  1XMQ L;  1QVF A;  4GOP C;  1K83 H;  2JA9 A;  2A8V A;  4GKJ L;  3S15 H;  3UE1 A;  3KJP A;  1E24 A;  1HJP A;  1Z9F A;  4PZ6 A;  3M85 A;  4DV2 L;  1JE5 A;  1E3P A;  3KOJ A;  4IPD A;  4JOI A;  5M3F G;  4LF5 L;  1VQ7 A;  3KF8 B;  2B63 G;  3G48 A;  3CMA A;  3RLF A;  4JI6 Q;  1Q1E A;  1IBL L;  3S1Q H;  3KF6 A;  4JV5 L;  2WAQ E;  4LW1 A;  3G6E A;  1PVO A;  4LFB Q;  5IYD H;  1Y1V G;  3CCJ A;  1GD7 A;  2UUA Q;  2R7D A;  4A3L G;  4OON A;  5M5Y H;  3F2B A;  1SLJ A;  4DK3 C;  3CCE A;  4JI5 Q;  4MNO A;  2ID0 A;  4B3R Q;  1HNW Q;  4R4Q A;  4DPG A;  1EYG A;  4OO1 I;  4DUZ Q;  4HJA A;  3ERS X;  5FLM H;  3PO3 G;  4LF6 Q;  3I4M G;  4JI8 Q;  3GTK H;  4A3G G;  4A3M H;  4NB3 A;  4AYB G;  2JJQ A;  4YCV A;  4EX5 A;  1GO3 E;  5M5W H;  1VCI A;  1YIT A;  1FJG Q;  1IZ6 A;  4A3J G;  4GNX B;  2KEN A;  5GAH C;  2A1A A;  2JK8 A;  4O0A A;  4DNI A;  1SMX A;  1HNW L;  3KDF B;  3KYH C;  1GVP A;  3PO2 G;  2PQA B;  2ZTC A;  2CQO A;  3OTO L;  1Q86 C;  2GVA A;  1VQ8 A;  3PUV A;  3LGJ A;  1JMC A;  5GAD C;  4GS3 A;  3M4O H;  1N9W A;  4JI8 L;  1CKO A;  2JA7 G;  2ES2 A;  4BY7 G;  1QZG A;  2JEB I;  4A3K H;  4JI7 Q;  3K7A H;  4IJL A;  1FJG L;  1WCM G;  1I94 L;  2R7F A;  1YHA A;  1VQN A;  2NVX H;  4BBS H;  4TQU S;  1VQF A;  1I50 H;  4HJ5 A;  3OW2 A;  2EQS A;  3GTQ H;  2Z0S A;  4QL5 A;  4C3J H;  2VZA A;  3F2C A;  1VQP A;  5EAY A;  2WAQ G;  4JI0 Q;  1SRO A;  2WB1 E;  1IL2 A;  3F1Z A;  3CXC A;  2K14 A;  3KDF A;  3K81 C;  3PUX A;  4H02 A;  4A3B G;  2RHQ B;  4JOI C;  4P72 A;  1VQH A;  3PSI A;  4APV A;  1Q8K A;  3M3Y H;  3HOW H;  2I5H A;  2FXQ A;  2MQH A;  2GN5 A;  1VQC A;  4X62 Q;  2Q2U A;  4LF7 Q;  5H1S E;  2VNU D;  2QA4 A;  2IHF A;  2CCZ A;  3NBH B;  2LXJ A;  2QGQ A;  2BH8 A;  3M4Q A;  4L5Q A;  3CCL A;  4YY3 Q;  1VQE A;  3JC6 6;  4JI0 L;  2HHH Q;  3HOU G;  4AH6 A;  3JAM c;  3NEN A;  3HFZ B;  5DLQ E;  2AHO B;  2N78 A;  4YWK A;  2VL6 A;  2K4K A;  1IXR A;  5IP9 H;  1BBU A;  1TWH H;  4X62 L;  2A19 A;  4NXM Q;  2K5V A;  2YV5 A;  4DV0 Q;  5C0X G;  4JBK A;  4Y52 H;  1HNZ L;  4JI4 L;  2UUB Q;  5C4J H;  2YTY A;  4TVA B;  3K8A A;  4YY3 L;  2E2I H;  2R7Z H;  1PH7 A;  2HHH L;  1OXT A;  3PV0 A;  1X3E A;  4O2D A;  1YJW A;  3JAM i;  3GDE A;  3L0O A;  4YCW A;  3CCV A;  1JJC B;  4GLV B;  5GQO A;  3K0X A;  1PH5 A;  2V1C C;  3HOZ G;  1I6H H;  5C44 H;  1NE3 A;  1VQ4 A;  1NJI C;  3J7Z C;  4R4T A;  4HJ7 A;  2IX1 A;  1WI5 A;  1X56 A;  1K0R A;  2JA8 G;  2F3I A;  2F4V L;  1E1T A;  2XTI A;  1V43 A;  3GTM H;  4Y7N H;  2AWN A;  4GN3 B;  4P73 A;  1Y14 B;  1N36 L;  3M4P A;  3L2P A;  1VQO A;  4DV5 Q;  4LF9 Q;  1M1K C;  4BA1 I;  3CF5 A;  1Q7Y C;  2ASB A;  1OXS C;  2AWO A;  1QUQ A;  1X3F A;  1K73 C;  1K3R A;  1M90 C;  5C3E G;  5GAE C;  2NVY H;  4LUZ A;  2RCN A;  3E9H A;  2RF4 A;  2KHJ A;  2VQF Q;  3W5O A;  4HIK A;  1PH8 A;  4GLA C;  2B3G A;  1N33 L;  1W3S A;  1YBY A;  1SR3 A;  1QVC A;  1YJ9 A;  1MJE A;  4DV5 L;  2KHI A;  4LF9 L;  5LMU L;  3GTL H;  2Q2I A;  3T1Y Q;  1XMQ Q;  3PF5 A;  4GKJ Q;  1LTL A;  1X6O A;  3G4S A;  3BU2 A;  3T1H L;  3U58 A;  3M7N A;  4AYB E;  4WJ4 A;  2VQF L;  4LF5 Q;  3I55 A;  2K50 A;  1YI2 A;  1YHQ A;  2UUC L;  4IFD G;  4DR1 Q;  1EIY B;  2K75 A;  2YU9 H;  4LFA L;  1OXV A;  3AFP A;  2YTV A;  2MNA A;  2KBN A;  3GTG H;  2PMZ E;  4C2M H;  1JB7 A;  2VUM G;  5IYD G;  1XTD A;  3T1Y L;  5K36 G;  4A93 H;  1HZA A;  4LUO A;  1YJN A;  3A0J A;  3UDG A;  3E9I A;  2NZO A;  3J81 c;  2D0P A;  2N49 A;  4JBM A;  1V9P A;  4X65 Q;  2WP8 J;  5FLM G;  4DR1 L;  3CCQ A;  1JT8 A;  1VQM A;  1V1Q A;  2RHS B;  3HKZ G;  3GTP H;  3MEF A;  3PUZ A;  1KXL A;  1B7Y B;  2YTX A;  1AE2 A;  1SE8 A;  2JQO A;  5GAG C;  1EUJ A;  1CKM A;  2JA6 H;  4IOC A;  4DAY B;  3J81 i;  1ASY A;  4BBR H;  3OTO Q;  4X65 L;  5LMN W;  4LUV A;  3I2Z A;  3KLW A;  4LWC A;  5JEA G;  2I0Q A;  4BY1 H;  4IPC A;  1VQD A;  4OWW B;  3FHW A;  4A3K G;  3W1G A;  1QVG A;  2R93 H;  1I94 Q;  4A3D H;  4UY8 C;  2K52 A;  1EIF A;  4B3S L;  4A3E H;  4UP9 A;  1HNX L;  4JG2 A;  1VQB A;  1L1O B;  1PFS A;  2AMC B;  4DV3 L;  1MKH A;  3W1B A;  3TS0 A;  1CSP A;  2F52 A;  4LF7 L;  2K5N A;  4X64 L;  2UU9 Q;  4AQY Q;  1N8R C;  5M3F H;  1KHI A;  3STB C;  2VQE L;  1SRU A;  1H95 A;  3FKI H;  4IOA A;  2IHE A;  3I4N H;  4IPG A;  1JJG A;  2B29 A;  2BA0 A;  1X9N A;  2DUD A;  3E0E A;  4HID A;  4IO9 A;  4A3I H;  4GNX A;  5M5X H;  1Y1V H;  4BXX H;  1J5E L;  3PIP A;  1AH9 A;  4HIM A;  4AQY L;  1EWI A;  1GKH A;  2CFM A;  4A75 A;  4YWL A;  2ZM6 L;  1HR0 Q;  2PQA A;  4LF4 L;  1J6Q A;  5JJL A;  3TRE A;  4POF A;  2HIX A;  3U4Z A;  1NMF A;  4C3H H;  1P16 A;  1XPU A;  1FGU A;  2HIV A;  1N32 Q;  1X55 A;  3UE0 A;  3J7A 5;  3Q8D A;  2ZJP A;  1HNZ Q;  4JI4 Q;  3PF4 A;  3TS2 A;  1OTC A;  4R1J A;  5IYC G;  4A3J H;  1AE3 A;  3RNU A;  2VS1 A;  1XMO L;  2R7Z G;  1P8L A;  4OO1 G;  4ALP A;  1NBW A;  3WWV A;  4DV4 L;  3IRB A;  1HR0 L;  3CC4 A;  1UE5 A;  1RL2 A;  1X54 A;  4R4O A;  4R4I A;  2NN6 I;  3EIV A;  5IYB G;  1MJC A;  1NTG A;  4KLK A;  5C44 G;  1IYJ B;  1C0A A;  3J81 j;  4B3M Q;  2JA7 H;  3ER0 A;  4BY7 H;  2ZJQ A;  4A3C G;  2Y0S E;  3CPW A;  1N32 L;  3KJO A;  1XPO A;  3H15 A;  4A4I A;  3UDI A;  4GLX A;  2F4V Q;  1WCM H;  3AYH B;  1Y1W G;  3RN5 A;  1L0W A;  4LF8 Q;  1HZB A;  3RZD H;  3HOY H;  4GOP B;  4PG3 A;  4KHP L;  2KCT A;  1HZ9 A;  1PA6 A;  1N36 Q;  1NMG A;  3OYY A;  3H0G G;  1SN8 A;  2LSS A;  3S17 H;  3DM3 A;  2R92 G;  3M9B A;  1UWV A;  1LM0 A;  4DR3 L;  4MZ9 A;  4HIO A;  4B3M L;  5M3M H;  2JA5 H;  2E5L L;  4A3B H;  1EOV A;  4P71 A;  4AIM A;  3PIO A;  4UPA A;  1XNQ L;  4ME3 A;  2H5X A;  1VQI A;  1R9T H;  4J15 A;  4LF8 L;  3BZC A;  5BR8 Q;  5IP7 H;  1N33 Q;  2Q2T A;  2IY5 B;  4JCV E;  4R4C A;  4A3F H;  1PYB A;  4JI3 Q;  1TWG H;  2D62 A;  4MTN A;  5GRO A;  5LMU Q;  4GNX C;  1CKN B;  1I5F A;  3CCM A;  3F8T A;  3HKZ E;  3T1H Q;  3GTO H;  4GKK Q;  2I5L X;  4YWM A;  1K9M C;  1YNX A;  3EBE A;  4JI2 Q;  4OXP A;  2OQK A;  4PZ7 A;  3STB D;  1BKB A;  1OXU A;  5FLX c;  2UUC Q;  2Q2H A;  1E22 A;  1RIP A;  5BR8 L;  2WFW A;  5IT9 c;  3G71 A;  3AEV A;  4LFA Q;  3EN2 A;  4JI3 L;  1KRT A;  2OTL A;  2OTJ A;  2MO1 A;  2Y0S G;  4DUY Q;  5FJ8 H;  4A93 G;  1KL9 A;  4C3I H;  3D0F A;  5IWA Q;  3CC7 A;  4GKK L;  2PI2 A;  1IBM Q;  1B70 B;  4QY7 A;  4JI2 L;  4RG1 A;  1BBW A;  4KI0 A;  4DK6 C;  3D31 A;  4DR4 L;  2ZTE A;  2HQL A;  2UXC Q;  2E2J H;  3GO5 A;  3ICE A;  3S14 H;  3TQY A;  1Q81 C;  5JJK A;  4HJ9 A;  2OWO A;  4DUY L;  1VQL A;  1LYL A;  4JYA L;  4IJH A;  1DGS A;  1NY4 A;  5LMN L;  3CAM A;  4JC0 A;  5IWA L;  2GVB A;  1IBM L;  1XPR A;  2EIF A;  2C35 B;  3U50 C;  2JA6 G;  1TXY A;  1E1O A;  3BJU A;  3AQQ A;  1IBK Q;  1A63 A;  4IFD J;  3GD7 A;  2UXC L;  1KIX A;  2CKZ B;  4BY1 G;  2CWA A;  4X6A H;  1GM5 A;  4QGU A;  3K80 C;  4A3M G;  1XNR Q;  3NEM A;  3TEH B;  3KF6 B;  1WOC A;  4XTC S;  4NXN Q;  1PYS B;  1UE7 A;  4OWT B;  4HJ8 A;  1YZ6 A;  3S2D H;  1UEB A;  1CSQ A;  4P75 A;  3UDX A;  3A5U A;  4A3E G;  4B3S Q;  1HNX Q;  1LUZ A;  4A76 A;  1PV4 A;  4DV3 Q;  5C4X H;  1IBK L;  3I56 A;  3S1N H;  5IE8 A;  4DR6 L;  2EXD A;  1BVS A;  1HH2 P;  1D8L A;  1S3O A;  2L15 A;  4X64 Q;  4DV1 L;  4DR2 L;  1W2B A;  1VQ5 A;  1C7Y A;  1XNR L;  1PH4 A;  3A5Z B;  1S72 A;  2UU9 L;  3CQZ H;  2VQE Q;  2HT1 A;  4NXN L;  2UXD L;  3AFQ A;  3HOV H;  2BH2 A;  1E7Z A;  3FKI G;  4LFC Q;  1TWF H;  4OWX B;  1G6P A;  3I4N G;  4X66 L;  4BBS G;  2LXK A;  4PZ8 A;  2VUM H;  3CCS A;  3RR5 A;  3HOX H;  4A3I G;  3S24 A;  1KC8 C;  1K8A C;  1Q46 A;  4UP7 A;  5JEA J;  1J5E Q;  3TRZ A;  4GN4 B;  4BXX G;  3B6Y A;  4DR7 Q;  5E7N A;  2N8N A;  2ZM6 Q;  4NPS A;  4LF4 Q;  5JJI A;  1TWC H;  3J80 c;  4YHH Q;  1OXX K;  3L7Z C;  3HOW G;  1FVI A;  2B63 H;  4LFC L;  4JI6 L;  1EQR A;  3I4O A;  3UDF A;  1HZC A;  3ULL A;  2PI2 E;  3NEL A;  2BA1 A;  4FDB A;  1PH1 A;  1PH3 A;  4LFB L;  2Z6K A;  1XMO Q;  1Q1B A;  1U5K A;  2UUA L;  1KQS A;  4A3L H;  5C0X I;  1D7Q A;  1L1O A;  3PUY A;  4JI5 L;  3PGZ A;  4DV4 Q;  3CD6 A;  3GTJ H;  4DR7 L;  4B3R L;  1Z47 A;  3H3V I;  4DUZ L;  4YHH L;  3PO3 H;  1TWA H;  3S1R H;  1O7I A;  3J80 i;  5IP9 G;  4DV7 Q;  4LF6 L;  3I4M H;  4DKA C;  4L5S A;  4A3G H;  3CW2 C;  3BZK A;  1PH9 A;  1KD1 C;  2MO0 A;  1XJV A;  4QJF A;  3HOY G;  2UXB Q;  3A74 A;  4KHP Q;  1KAW A;  1VQJ A;  2KCM A;  1JJ2 A;  4K0K Q;  1VQG A;  2K5H A;  2E2H H;  1N34 Q;  2N3S A;  2NZH A;  3CME A;  3PO2 H;  2YYZ A;  1A62 A;  5HY6 A;  4DR3 Q;  4DV7 L;  3I7F A;  5ELN A;  1MIU A;  5M3M G;  4DV6 Q;  2JA5 G;  2E5L Q;  4P74 A;  3MXN B;  1FL0 A;  4RMF A;  1XNQ Q;  4JI7 L;  4LNQ A;  2R6G A;  5IP7 G;  1CUK A;  2UXB L;  1L2F A;  1ASZ A;  5ELO A;  4A3F G;  4K0K L;  2ZTD A;  4L5T A;  1N34 L;  3FP9 A;  4QIW E;  2QEX A;  1Q12 A;  4IPH A;  2NVT H;  1UE6 A;  3DLL A;  4DR5 Q;  1U0L A;  4DV6 L;  2I5M X;  2IT1 A;  3CPF A;  5C0X J;  3ZJY C;  4YCU A;  4KHZ A;  1KRS A;  4EQ5 A;  4PMW A;  3RLN A;  4DAM A;  1EFW A;  1VQK A;  3S2H H;  2ATW A;  3PUW A;  3PCO B;  4QQB X;  2AKW B;  1SFO H;  1VS0 A;  1PHJ A;  4IFD I;  1B8A A;  2Z6K C;  1YVC A;  5IYC H;  5FJ8 G;  4GOP A;  3CP0 A;  4JBW A;  1QUQ B;  4DR5 L;  4JBJ A;  3HOU H;  1L1O C;  2MFI A;  1VQ6 A;  2ALY B;  3KFU A;  1A8V A;  2OQ0 A;  5IYB H;  1C9O A;  5J3B A;  3F2D A;  4DR4 Q;  2DGY A;  1YIJ A;  4L5R C;  1S40 A;  1G29 1;  4NXM L;  3RZO H;  4A3C H;  2WB1 G;  4DV0 L;  1WFQ A;  3ULP A;  2XGT A;  5IY0 A;  3VDY A;  1HR0 W;  4GN5 A;  2UUB L;  3H3V H;  4JYA Q;  1Y1W H;  2OCE A;  5LMN Q;  2NN6 G;  1X3G A;  4B3T Q;  3U4V A;  2D0O A;  1WYD A;  3H0G H;  1EQQ A;  1CKN A;  2VW9 A;  3RLO A;  3HKS A;  3RN2 A;  2R92 H;  3HOZ H;  3K7U C;  4UP8 A;  3S1M H;  1I3Q H;  1VQ9 A;  4POG A;  2PNH A;  1YEZ A;  1YHB A;  3CCU A;  4XIG S;  2JA8 H;  5HGQ A;  2JEA I;  2CWP A;  4JI1 Q;  5AJ3 Q;  1Q82 C;  4B3T L;  4BA2 I;  1PH6 A;  3ULJ A;  4OX9 Q;  1WJJ A;  4WJ3 M;  1X65 A;  4BBR G;  5C4X G;  1A0I A;  4DR6 Q;  3S16 H;  5C3E H;  4DR2 Q;  1QZH A;  4DV1 Q;  4DV2 Q;  2VY3 A;  1UE1 A;  1G51 A; 
#chains in the Genus database with same CATH topology
 2ZXR A;  3CCR A;  1PH2 A;  4X66 Q;  4ZYS A;  2Y0S B;  2NVQ H;  2JE6 I;  3BDO A;  1QVF A;  1K83 H;  3S15 H;  2HCC A;  4KJN A;  1E24 A;  3VYR A;  4DV2 L;  2F0T A;  1E3P A;  2Z4H A;  5JPN C;  1GUS A;  4LF5 L;  3IFT A;  5BN4 A;  2JN4 A;  3S1Q B;  1D2B A;  1JWM D;  4R8N A;  4JV5 L;  3KUP A;  4N9T A;  1BQQ T;  1PVO A;  4LFB Q;  2E74 C;  3HG9 A;  1TQO A;  5CV5 A;  4OON A;  5M5Y H;  3F2B A;  4JI5 Q;  2ID0 A;  4DPG A;  4DUZ Q;  5E1F A;  2SNS A;  3I4M G;  3I91 A;  1TS3 A;  5I6W A;  4A3G G;  3DEP A;  5HUR A;  1GXD C;  2KEN A;  5G3L F;  4FXG C;  1SMX A;  3OOC A;  4J6H A;  1GVP A;  3W2D A;  3M4O B;  3RD4 A;  1I4G A;  3LGJ A;  1NUC A;  1CKO A;  2JA7 G;  4A3K B;  2VB2 X;  4UDU C;  1FJG L;  1WCM G;  4BBS B;  1I50 B;  3GTQ B;  4NW2 A;  1SJE D;  4HJ5 A;  3OW2 A;  4C3J H;  5EAY A;  2L4N A;  2NWG A;  1VDZ A;  3PUX A;  3MEH A;  1GOZ A;  4RFB A;  3M3Y B;  3HOW B;  3KLR A;  4K5W A;  2IJ0 A;  5FO9 B;  5E4W C;  3OW7 A;  2B39 A;  2VNU D;  5A2Q L;  3KLS A;  2NB0 A;  5FKA C;  3CCL A;  3J81 L;  1VQE A;  1K8M A;  4JI0 L;  3MA2 B;  3JAM c;  3NEN A;  1B3A A;  4N8F A;  5IP9 H;  1BBU A;  2A19 A;  5DEH A;  4Y52 H;  1STB A;  1JWU D;  2E2I H;  2R7Z H;  5KYL A;  5FLX E;  1CZG A;  1MSG A;  3L0O A;  1PZJ D;  4YCW A;  4GLV B;  5GQO A;  3CCV A;  5IT9 E;  3TZU A;  1KNA A;  5C44 H;  3VA5 A;  1AFP A;  1HHV A;  1NJI C;  4R4T A;  4KD4 A;  1JCK B;  1DXM A;  2F3I A;  3W3A A;  1E1T A;  2XTI A;  1V43 A;  4YIJ A;  3GTM H;  2AWN A;  4P73 A;  1TS4 A;  3HZX A;  1M1K C;  3CF5 A;  2ASB A;  2NVY B;  1OXS C;  2AWO A;  1F9P A;  3R3O A;  1K73 C;  1M90 C;  5GAE C;  3PMF A;  4LUZ A;  2RCN A;  3E9H A;  1EQT A;  2VQF Q;  3W5O A;  4HIK A;  1D5M C;  1T5X D;  4RGO S;  1SR3 A;  1MGS A;  2QDB A;  4LF9 L;  5LMU L;  3GTL H;  4HED A;  3PF5 A;  4GKJ Q;  4PNY A;  1O7Y A;  3M7N A;  3T1H L;  2NUC A;  4AYB E;  4DGZ A;  3NTK A;  1LTS D;  4IFD G;  1YHQ A;  3S14 B;  4DR1 Q;  2YU9 H;  3GTG B;  3AFP A;  2MNA A;  3DEO A;  2PMZ E;  2VUM G;  3OPO A;  1PTO H;  4ODG A;  2LS0 1;  4HR7 B;  1TU2 B;  4X65 Q;  3C3L A;  2WP8 J;  5KNC A;  1JT8 A;  1EEF D;  1V1Q A;  1VQM A;  3MEF A;  3S2D B;  1KXL A;  1SE8 A;  3OIP A;  3NSW A;  1CKM A;  3TP5 A;  4IOC A;  1PFN A;  4ZUJ A;  3U9S A;  4BBR H;  4BY1 B;  3MAQ A;  4LUV A;  1CQV A;  5EGT A;  2KEE A;  2QIL A;  2NTT A;  4IPC A;  3AB9 A;  5EQ0 A;  4A3D B;  3W1G A;  4K5V A;  5EKI A;  2K52 A;  1EIF A;  2HUG A;  1EY0 A;  1FNW A;  1SYF A;  1LT3 D;  3TS0 A;  2F0Q A;  4X64 L;  4AQY Q;  2RA4 A;  2KJX A;  1RF2 D;  2VQE L;  3I73 A;  1SBB B;  3E0E A;  1I4H A;  2L55 A;  3I72 A;  4HIM A;  2C9O A;  4A75 A;  2BDO A;  4YWL A;  4LF4 L;  1DON A;  1E2W A;  4C3H B;  2HIX A;  3U4Z A;  1B3Q A;  2LY7 A;  3J7A 5;  3Q8D A;  2ZJP A;  3TS2 A;  4R1J A;  1B9N A;  5IYC G;  4OO1 G;  4QUF A;  4HMJ A;  1WTH A;  1NR2 A;  4ALP A;  3WWV A;  1X54 A;  1DZ1 A;  2R3Z A;  4BY7 B;  1IYJ B;  2JA7 H;  3DWQ A;  1ILQ A;  3CPW A;  1N32 L;  3C46 A;  3KJO A;  3T13 A;  1XPO A;  3UDI A;  1WCM H;  4KY5 A;  3RZD H;  4GOP B;  4PG3 A;  3PIP 3;  1N36 Q;  2J4X A;  4G7H C;  2WAQ B;  3P75 A;  4MZ9 A;  4B3M L;  2XVS A;  2JA5 H;  2B2V A;  2E5L L;  3PIO A;  4UPA A;  1R9T H;  5IP7 H;  3NE5 B;  4R4C A;  4A3F H;  4JI3 Q;  1TWG H;  2D62 A;  2IW3 A;  4MTN A;  3D4D A;  2KED A;  4H44 C;  2P5Z X;  4GNX C;  1O78 A;  4DXG A;  3HKZ E;  3J80 L;  3T4A C;  3WOF A;  3EBE A;  1OXU A;  3SK8 A;  2UUC Q;  2EYH A;  5BR8 L;  3G71 A;  3AEV A;  4LFA Q;  3IKJ A;  3KK7 A;  2OTL A;  4RHR A;  2OTJ A;  1LTT D;  2H1E A;  4A93 G;  4C3I H;  3N6R A;  3NBI A;  5IWA Q;  4TKO B;  4GKK L;  4CKB A;  1IBM Q;  4CHT B;  1S5D D;  1XYI A;  2E2J B;  1CHQ D;  3PQI A;  3S14 H;  2KVM A;  5JJK A;  2O2L D;  2PYK A;  4DUY L;  1B53 A;  2F0W A;  4RKB A;  4WJW A;  4EQP A;  3QIA A;  2C35 B;  2JA6 G;  4QMG A;  4KY7 A;  1E1O A;  5C3E B;  4IFD J;  2UXC L;  1H9M A;  4BWG B;  2GA4 B;  2CWA A;  5JVG 3;  4FXD A;  4P2C B;  4A3M G;  3NEM A;  2K04 A;  3KF6 B;  4NXN Q;  1UE7 A;  1BOS A;  5LL6 X;  3S2D H;  3UDX A;  2K5D A;  4C1N K;  1QWY A;  3DHQ A;  2PZW A;  1RTN A;  4RWS C;  4DR6 L;  4FNF A;  1D8L A;  5BN5 A;  1W2B A;  2V4D A;  1TS5 A;  1BXT A;  1EOT A;  3A5Z B;  1XNR L;  3CQZ H;  3HOV B;  2UXD L;  1TWF B;  4IFD H;  1LT4 D;  2F0E A;  1Z6H A;  2KOL A;  3HOX B;  4KKU A;  1HQR D;  2VUM H;  3CCS A;  4A3I G;  2BOS A;  3Q23 A;  1J5E Q;  1FYC A;  3TRZ A;  5E7N A;  1TWC B;  1A2U A;  2ZM6 Q;  1CI3 M;  2B63 B;  4YHH Q;  1FVI A;  2B2W C;  2XRQ D;  1Q90 A;  1W6J A;  5ISR A;  1PH1 A;  1JQY D;  1PZK D;  4X3U A;  1XMO Q;  2UUA L;  1KQS A;  3GTJ B;  4WRD A;  3PGZ A;  4B3R L;  3H3V I;  3BYT B;  3S1R H;  1O7I A;  4DFA A;  4LF6 L;  5KND A;  2F0H A;  1LO5 D;  3BZK A;  5IOD A;  3LWE A;  5C4Z A;  4KHP Q;  4K0K Q;  1N34 Q;  2N3S A;  3CME A;  3DWA A;  1EY9 A;  1EIH A;  2RDH A;  5M3M G;  4DV6 Q;  3MXN B;  2H4O A;  4HSP A;  2R61 A;  4JI7 L;  4IUQ A;  4LNQ A;  2JSO A;  1L2F A;  3TME A;  1ASZ A;  3F2U A;  3FP9 A;  2NVT B;  5DM7 3;  4QIW E;  1PRT F;  2QEX A;  4B9W A;  3SVM A;  4DR5 Q;  4K8I A;  4G7Z C;  4KHZ A;  4EQ5 A;  4RHS A;  3V2T A;  1A15 A;  4DA2 A;  3S2H B;  3RLN A;  3TP7 A;  3PCO B;  1PHJ A;  2Z6K C;  1YVC A;  5IYC H;  4GOP A;  3HOU H;  4JBJ A;  3QG1 A;  1L1O C;  1DOL A;  3K5N A;  4TSS A;  2ALY B;  1SJH D;  5J3B A;  2XNA C;  2DGY A;  5FO7 B;  2K6A A;  3Q0A A;  4NXM L;  4MTK A;  1J8I A;  4DV0 L;  1Y1W B;  4GN5 A;  3H3V H;  2B2Y C;  3VYU A;  4DAP A;  1K8O A;  4B3T Q;  3URY A;  2D0O A;  1WYD A;  1EQQ A;  3HOZ B;  2R92 B;  3S1M B;  2BDN A;  3MWY W;  3RLO A;  3HKS A;  1L0Y B;  2AQ3 B;  5ELF A;  3OWF A;  4FXK C;  2PNH A;  2J0T D;  4XIG S;  2JA8 H;  3SEB A;  2CWP A;  1PXU A;  3I90 A;  1WJJ A;  2B8F A;  1X65 A;  3S16 B;  5C4X G;  1VMP A;  5C3E H;  4DV2 Q;  2NVX H;  1HFN A;  2MUY A;  3R2T A;  1DD2 A;  2E2D C;  3SGI A;  2R93 G;  2EY2 A;  5AJ3 L;  2NVQ B;  3OIQ A;  1VQA A;  1T9H A;  1WD1 A;  4JV5 Q;  1K8G A;  4OX9 L;  3V96 A;  1K83 B;  3JAM L;  3S15 B;  1HRJ A;  2X6G A;  2FMM A;  2PW5 A;  1Z9F A;  1BCP C;  2Z6B A;  4N8X 1;  2KA7 A;  5EPL A;  1V1O A;  2B2U C;  1ML0 D;  4K14 A;  1IBL L;  3KF6 A;  1WTQ A;  1XTC D;  3ERO A;  5M5Y B;  1GD7 A;  2TMP A;  2J7Z A;  3LNN A;  4A3L G;  4XQQ A;  4DK3 C;  4MNO A;  1HXY D;  5FO8 B;  3ERS X;  5FLM H;  3PO3 G;  1Q3L A;  4ID6 A;  2E76 C;  3MZ5 A;  4A3M H;  2JJQ A;  4YCV A;  4ZAI A;  4EX5 A;  1GO3 E;  1VCI A;  5KEE A;  1V8Q A;  1IKL A;  3ONA B;  1FJG Q;  1GUW A;  4A3E B;  1EL0 A;  5GAH C;  1B9M A;  2JK8 A;  1HNW L;  1QJO A;  4PQX A;  4KHV A;  2JXM B;  2PQA B;  2GVA A;  4XXE A;  1JMC A;  5EBC A;  1KDC A;  4GS3 A;  1N9W A;  2A68 C;  2NBF A;  3C1E A;  4JI8 L;  2JEB I;  1VQN A;  2A73 B;  4U68 A;  4TQU S;  1F77 A;  1CT1 D;  2EJM A;  4C3J B;  4IQZ A;  2F0O A;  4IAL A;  2VZA A;  1ZEQ X;  4JI0 Q;  2WB1 E;  3F1Z A;  3CXC A;  4A3B G;  4JOI C;  1VQH A;  3PSI A;  3QWN A;  2QKI C;  2FXQ A;  5D65 A;  2GN5 A;  5T1G A;  2KCN A;  3MXP A;  2QA4 A;  3MHB A;  2LXJ A;  3KBG A;  4L5Q A;  1RD9 D;  2AQ2 B;  4AH6 A;  4L63 B;  1BCP D;  2AHO B;  2K7V A;  2N78 A;  4K2L A;  4YWK A;  3BZD B;  4JW0 A;  1IXR A;  4TRD A;  3MXN A;  4DK0 A;  3VA7 A;  2E2I B;  1HNZ L;  4JI4 L;  2R7Z B;  1LT6 D;  4YY3 L;  5IOC A;  1NR4 A;  2HHH L;  1UUP A;  1I4R A;  4S3S A;  1JR0 D;  3GDE A;  1I6H H;  2V1C C;  5ELE A;  4EVO A;  2L0C A;  1QG7 A;  2DNC A;  1WI5 A;  1X56 A;  3GTM B;  3K5M A;  4Y7N H;  4XYO A;  3SK5 A;  4LF9 Q;  1E0B A;  3CU7 A;  4BA1 I;  1Q7Y C;  5KGU A;  1B1Z A;  2A68 D;  1LTB D;  1IYV A;  5EBD A;  3GQB A;  5D3I B;  1PH8 A;  1CA6 A;  3VR6 A;  2B3G A;  4GZY C;  4NMZ A;  4I65 A;  5IGB A;  1W3S A;  3MTS A;  3GTL B;  3T53 B;  1YJ9 A;  1PTO D;  1MJE A;  1RJT A;  3P20 A;  3HP3 A;  1XMQ Q;  1F2M A;  3U58 A;  1A3V A;  3A7A B;  3P7J A;  3I55 A;  2K50 A;  3EA6 A;  1YI2 A;  2MGS A;  2YU9 B;  1II3 A;  1SSO A;  1IYU A;  2LMC B;  2M00 A;  3J7A V;  4K5X A;  4C2M H;  1JB7 A;  1PTO B;  3K6O A;  3NXW A;  5IYD G;  5K36 G;  2LKV A;  2D0P A;  1SMY C;  2HD3 A;  2RDG A;  2EJG C;  3FRP B;  3EJI A;  1B7Y B;  1AE2 A;  1LTA D;  4BBR B;  3J81 i;  1WTV A;  1ASY A;  3OTO Q;  1STH A;  2AUK A;  3KLW A;  4LWC A;  3DUZ A;  2CVR A;  4OWW B;  4A3K G;  5COY A;  2R93 H;  1I94 Q;  4UY8 C;  5CC4 A;  4A3E H;  4ZKC B;  1C8C A;  2WIN B;  1HNX L;  1PFS A;  4FF4 A;  4DV3 L;  2F0J A;  4WFN 3;  1MKH A;  2B2T A;  3D3R A;  3A8K E;  2RQX A;  2F52 A;  4LF7 L;  2F0G A;  1JIC A;  4CDE C;  3FKI H;  3I4N H;  1JJG A;  4IO9 A;  4PMB A;  5M5X H;  4DK1 A;  1O7L A;  2G5D A;  5G3L D;  4L6T B;  2PQA A;  5CYU A;  2M2L A;  4A3G B;  3NHH A;  1NMF A;  2EZV A;  1FGU A;  1S5B D;  1X55 A;  4KKT A;  3UE0 A;  1N32 Q;  4KJO A;  3ZYY X;  3NUC A;  1GHK A;  1D6E C;  5CV8 A;  2BE5 C;  1NCV A;  1K0S A;  1RL2 A;  4R4I A;  1SMY D;  5IYB G;  1MJC A;  2JA7 B;  4B3M Q;  2ZJQ A;  1WCM B;  3H15 A;  3RZD B;  2F4V Q;  2KCC A;  2MPM A;  3HOY H;  1SYC A;  3AMU A;  1PA6 A;  3FEW X;  1SN8 A;  3BS1 A;  1U4P A;  2O5I C;  3A7L A;  1UWV A;  4X3T A;  2BCO A;  4DR3 L;  2JA5 B;  4HIO A;  1EEI D;  4A3B H;  3T56 B;  1R9T B;  4DNT B;  1XNQ L;  4CDF C;  4ME3 A;  4LF8 L;  1GUT A;  5BR8 Q;  4A3F B;  1N33 Q;  2Q2T A;  2IY5 B;  1TWG B;  1U4R A;  3Q6S A;  1DCZ A;  4O42 A;  5GRO A;  1M8A A;  2SEB D;  1QB5 D;  1CKN B;  1XX8 A;  4KY6 A;  4H7B A;  1PYW D;  2CH4 W;  4GKK Q;  2I5L X;  4YWM A;  3SDZ A;  4CJ0 B;  1G2T A;  4PZ7 A;  1PZI D;  5FLX c;  1DOK A;  3VR5 A;  5IT9 c;  1RDP D;  4KK7 A;  1KRT A;  3D8G A;  2MO1 A;  4RKL A;  4ZK9 B;  4DUY Q;  3IFD A;  4CJ2 C;  4C3I B;  5NUC A;  3R2I A;  3D0F A;  3L3O C;  1EZ6 A;  3OMC A;  4KI0 A;  4DK6 C;  4DR4 L;  2HQL A;  2UXC Q;  3BDL A;  2ENB A;  3ICE A;  3TQY A;  5CV9 A;  1TR5 A;  1SND A;  2Z4I A;  2OEO A;  4K8J A;  1LYL A;  4IJH A;  3MXG A;  3CAM A;  4ZRZ A;  2GVB A;  2WII B;  3ERQ A;  1XPR A;  3NTI A;  3U50 C;  3BJU A;  3AQQ A;  1SXT A;  3M7G A;  2K28 A;  3GD7 A;  1QIL A;  3X3N A;  4BY1 G;  3K80 C;  1XNR Q;  2QDL A;  4QF4 A;  3TEH B;  4XTC S;  1FNU A;  1GUN A;  4OWT B;  2K03 A;  1YZ6 A;  4B3S Q;  1LUZ A;  3BYY B;  4A76 A;  1PFM A;  2IPK D;  3FDT A;  3I56 A;  4J8Q A;  1TY0 A;  2L15 A;  2QCP X;  3D4W A;  3CQZ B;  1CK1 A;  4HSV A;  5DAU A;  1C7Y A;  1VQ5 A;  2HT1 A;  3RUZ A;  1WD0 A;  3AFQ A;  4OWX B;  2A69 C;  4X66 L;  1ENC A;  3IAY A;  4CBV A;  2VUM B;  1XXG A;  1ROD A;  4BXX G;  5E3F A;  4OIJ A;  4NPS A;  1SE3 A;  3I8Z A;  2F0S A;  4LFC L;  1LTR D;  4C3H G;  4V19 0;  1BDO A;  3ULL A;  2N88 A;  2PI2 E;  3NEL A;  2IL8 A;  4LFB L;  1HUM A;  1Q1B A;  1GUO A;  4HCE A;  4IUP A;  3SHL A;  1I6V C;  4JI5 L;  4DV4 Q;  3S1R B;  4DUZ L;  2SOB A;  1KLU D;  3J80 i;  3I4M H;  4AYB B;  4L5S A;  4A3G H;  1CTM A;  3CW2 C;  4RH6 A;  1HUN A;  5CV7 A;  3D4R A;  4DAV A;  3BVG A;  2F0I A;  1V1P B;  1VQG A;  2F0P A;  2NZH A;  2YYZ A;  4EQO A;  4DV7 L;  3I7F A;  3OWE B;  1MIU A;  4P74 A;  4RMF A;  2XWJ B;  1EY8 A;  2KEC A;  4ILW A;  2UXB L;  2RKS A;  5ELO A;  2ZTD A;  4IPH A;  3DLL A;  2Z9H A;  1U0L A;  3CKI B;  1I4Q A;  4KN7 C;  4PMW A;  1EFW A;  4DAM A;  2A69 D;  1VQK A;  2ATW A;  3PUW A;  4QQB X;  1VS0 A;  4IFD I;  1B8A A;  5FJ8 G;  2PZT A;  3HOU B;  2EY1 A;  2CQA A;  1VQ6 A;  2OQ0 A;  5IYB H;  1C9O A;  2A74 C;  3RZO H;  1WFQ A;  2WV6 D;  2XSC A;  4ME5 A;  3VDY A;  3VR3 A;  2EJF C;  1EY6 A;  4JYA Q;  1GUG A;  2OXP A;  2OCE A;  5LMN Q;  2NN6 G;  1YNN C;  1JOK A;  4M1U B;  1CKN A;  1A3U A;  3RN2 A;  1MHW C;  5C3W A;  1VQ9 A;  3A8I E;  3GV3 A;  4POG A;  1STA A;  1QNK A;  1YHB A;  3S9W A;  2JA8 B;  3CCU A;  1SNO A;  5HGQ A;  1LT5 D;  3J81 E;  5AJ3 Q;  2B8G A;  4OX9 Q;  3J7Y W;  3ITP A;  1A0I A;  2NVX B;  4DR2 Q;  1JE4 A;  4DV1 Q;  2Q8T A;  4R8I A;  2UU9 Q;  1J9O A;  3H91 A;  2NTS A;  4KV6 A;  3HOV G;  3CC2 A;  1JC7 A;  3E3X A;  1IBL Q;  2ZJR A;  4DXF A;  1XWE A;  1LAB A;  3HOX G;  2A8V A;  4GKJ L;  2JA9 A;  1ONL A;  3KJP A;  1EQV A;  3M85 A;  1CZW A;  1JE5 A;  1F2Z A;  3KOJ A;  2G9D A;  5M3F G;  1HQM C;  4Z9C B;  3NQT A;  5I9P A;  2B63 G;  4NDX A;  4JI6 Q;  1Q1E A;  2HQE A;  1E2Z A;  3L9A X;  3G6E A;  1WTR A;  1Y1V G;  4L8J A;  2R7D A;  2JA6 B;  1FGB D;  1SLJ A;  3T16 A;  4F8M A;  1HNW Q;  5EKK A;  4FF1 A;  2DJF C;  4OO1 I;  4HJA A;  1H9R A;  3HKZ B;  4I7A A;  1PRT C;  5CR3 A;  4A3M B;  4JI8 Q;  5CBE E;  3GTK H;  3KLS X;  2EDG A;  4NB3 A;  5I4D A;  5M5W H;  1YIT A;  4A3J G;  4GNX B;  2A1A A;  1YNN D;  4DNI A;  5CGK A;  3ND8 A;  3PO2 G;  3D6C A;  2F0M A;  5IGD A;  1VQ8 A;  1DM0 B;  5M9O A;  3HGB A;  2NZ1 D;  2FMC A;  2XIW A;  4IJL A;  2R7F A;  1YHA A;  1VQF A;  4B08 A;  3QOL A;  3F2C A;  2EPB A;  1SRO A;  1ET9 A;  3KDF A;  2CW0 C;  3K81 C;  4P72 A;  4OGQ C;  4UAI A;  1Q8K A;  3CRL C;  2MQH A;  1SE4 A;  2Q8I B;  4CKC A;  3NBH B;  2DNE A;  2XRS D;  4OEL B;  2RBM A;  2FHT A;  5HGT A;  4YY3 Q;  3JC6 6;  2ICE C;  1V1P A;  2HHH Q;  2IWH A;  3DMU A;  5DM6 3;  3HFZ B;  5DLQ E;  3TP8 A;  2VL6 A;  2K4K A;  4X62 L;  1TWH H;  2K5V A;  2YV5 A;  4DU9 A;  4RCO A;  5C0X G;  1ESF A;  1WTO A;  2UUB Q;  5F2D A;  5C4J H;  4TVA B;  4OO1 H;  3K58 A;  1PH7 A;  1OXT A;  3NWT A;  3PV0 A;  1MSH A;  1X3E A;  2EYO A;  4F87 A;  1YJW A;  3JAM i;  1I6H B;  2G9H D;  4CJ1 B;  1JJC B;  1PH5 A;  3K0X A;  3HOZ G;  5M3M B;  1VQ4 A;  3J7Z C;  2IX1 A;  4IZ8 A;  3Q22 A;  4Y7N B;  3H09 A;  4O1N A;  1EYC A;  1NSN S;  1Y14 B;  1N36 L;  2NYZ D;  1JOQ A;  1ET6 A;  3CRK C;  1VQ7 A;  1G6Z A;  1K3R A;  2RF4 A;  2EYL A;  2KHJ A;  4IUR A;  4DNR B;  4RGN A;  4GLA C;  5I2Y A;  1NAP A;  3EVQ A;  5I2X A;  4DV5 L;  2KHI A;  1LTL A;  3BU2 A;  4WJ4 A;  3P1H A;  1CHP D;  4RGT A;  4LF5 Q;  2UUC L;  1EIY B;  3TBI B;  4LFA L;  4C2M B;  2KBN A;  4Q0F A;  3NP8 A;  1XTD A;  4HN7 A;  3T1Y L;  4A93 H;  2L1B A;  2NN6 H;  4LUO A;  3UDG A;  4M8A A;  3SXH A;  4NKL A;  4QIW B;  5COR A;  2N49 A;  1V9P A;  1A6X A;  5FOB B;  1MD2 D;  4IUV A;  2RHS B;  1RTO A;  3C2P A;  5FK9 C;  3R8B A;  3PUZ A;  4N9P A;  5GAG C;  5JVH 3;  3K0Y A;  1D5Z C;  3D6W A;  1IW7 C;  1SNC A;  3J80 E;  5C4X B;  2JA6 H;  1F2L A;  1SE2 A;  2SDF A;  5LMN W;  3I2Z A;  1SYD A;  4V0B A;  1VQD A;  2R93 B;  3FHW A;  1Y8O B;  3ND9 A;  1B2T A;  5A35 A;  5LHY 1;  1KDA A;  1VQB A;  1L1O B;  2AMC B;  1LLR D;  3EQL C;  4Q5V A;  3K5L A;  5FLX L;  1N8R C;  1EY4 A;  1EFI D;  5M3F H;  5IT9 L;  3FKI B;  4ULL A;  5ELB A;  1SRU A;  4XQJ A;  3I4N B;  1DOM A;  4IOA A;  2IHE A;  4IPG A;  3TN2 A;  2B29 A;  2BA0 A;  1X9N A;  5M5X B;  4A3I H;  1A2T A;  2F0U A;  2K1B A;  4GNX A;  1Y1V H;  1J5E L;  1S5E D;  4U67 3;  3PIP A;  1AH9 A;  1EWI A;  2CFM A;  2ZM6 L;  1KDB A;  3PO3 B;  2FFK B;  5JJL A;  4KTA A;  4DN4 M;  4POF A;  4F88 A;  1SDF A;  5EPK A;  3V05 A;  2HIV A;  4FF2 A;  1VF7 A;  1FNV A;  3SK4 A;  1OTC A;  1XMO L;  4A3J H;  1AE3 A;  2R7Z G;  2VS1 A;  1P8L A;  4LMQ D;  1EU4 A;  1D1I A;  4EQN A;  1NBW A;  4ABN A;  3I4L A;  4OL7 A;  1HR0 L;  1UE5 A;  1QCB D;  5DNF A;  4R4O A;  3EIV A;  1NTG A;  4KLK A;  4CKE A;  5C44 G;  1U4M A;  3ER0 A;  5EJW A;  5KIX A;  4A3C G;  2Y0S E;  2PCF B;  3SK6 A;  4A4I A;  3HOY B;  4G7O C;  3AYH B;  2LFN A;  4LF8 Q;  1L0W A;  1ENA A;  4KHP L;  3NBH A;  2PZU A;  5C5L A;  1NMG A;  3OYY A;  1STY A;  2LSS A;  3H0G G;  3BVM A;  3S17 H;  3DM3 A;  1BCP B;  4RCN A;  3T51 B;  1LM0 A;  1HCZ A;  4A3B B;  1EZ8 A;  5M3M H;  3AU7 A;  1NNX A;  4OIK A;  4P71 A;  5JJZ A;  1SNQ A;  4AIM A;  3G7L A;  1C4Q A;  2H5X A;  1VQI A;  1EY7 A;  1PYB A;  1R4Q B;  3DWP A;  5LMU Q;  1I5F A;  3F8T A;  4IUT A;  3T1H Q;  3GTO H;  4UHV A;  1K9M C;  4OXP A;  1BKB A;  3NTH A;  2Q2H A;  1E22 A;  1RIP A;  3R93 A;  1PTO F;  1HA5 A;  3EN2 A;  2EYM A;  3VYS A;  2Y0S G;  3OSO A;  2PNR C;  2EYP A;  1KL9 A;  3E0J A;  3CHB D;  5IIF A;  1U9R A;  2A5H A;  4JI2 L;  2Q8R E;  5JPM C;  1I3Q B;  2ZTE A;  2WB1 B;  1AP0 A;  2B2W A;  2SNM A;  3GO5 A;  4EGV A;  1Q81 C;  4LK1 C;  3WDN A;  1X32 A;  2OWO A;  4G57 A;  4IUU A;  2DY7 A;  1VQL A;  1L0X B;  1DGS A;  1NY4 A;  4OEM B;  2EIF A;  1WVL A;  1A63 A;  2EVB A;  2FJ2 A;  3I3C A;  1LTI D;  1SAP A;  2CKZ B;  2B2V C;  4X6A H;  4FP5 D;  1JWS D;  1PYS B;  3TDQ A;  4P75 A;  4QB4 A;  1PV4 A;  1Q8I A;  5C4X H;  3IL8 A;  1IBK L;  4CGY B;  1HH2 P;  4X64 Q;  1S3O A;  4C56 C;  1QE6 A;  4RA8 A;  4NP5 A;  1PH4 A;  2VQE Q;  1D5X C;  2BH2 A;  1E7Z A;  4LFC Q;  3BVZ A;  1G6P A;  4BBS G;  1O80 A;  3VR2 A;  2LXK A;  4PZ8 A;  3M4Y A;  1BNZ A;  1K8A C;  2D5D A;  4UP7 A;  3B6Y A;  4LF4 Q;  1G8Z D;  5JJI A;  2MP1 A;  1HTP A;  3HOW G;  1ILP A;  1DYQ A;  4KMU C;  3UDF A;  1HZC A;  4K6L A;  4FDB A;  2Z6K A;  1U5K A;  4A3L H;  2A6H C;  1S5C D;  1L1O A;  4DR7 L;  3CD6 A;  4FYD A;  1Z47 A;  5D14 A;  3DM1 A;  3I4M B;  3PO3 H;  1TWA H;  1LV9 A;  2F3W A;  4DV7 Q;  5I9O A;  3QR8 A;  1SNM A;  1PMR A;  3K7A B;  1PH9 A;  2MO0 A;  1OO9 B;  3GP7 A;  3JAM E;  2B2Y A;  4QJF A;  2UXB Q;  3A74 A;  1KAW A;  2K5Q A;  1VQJ A;  3C1F A;  2K5H A;  2E2H H;  1GHJ A;  1Y8N B;  1A62 A;  5HY6 A;  5ELN A;  4LAA A;  4E6I A;  2E5L Q;  4I7Z C;  2JA5 G;  3MVV A;  2MHV A;  1H9S B;  2K05 A;  1F2Y A;  2R6G A;  5IP7 G;  2I46 A;  4A3F G;  3WOE A;  1Q12 A;  1UE6 A;  3HRZ C;  1ICF B;  2L5T A;  5EKL A;  4FO2 A;  2IT1 A;  3CPF A;  1TY2 A;  5IGE A;  3ZJY C;  4YCU A;  2D9U A;  5KRU A;  5I6Y A;  4JVZ A;  2HCI A;  2L12 A;  1SFO H;  4JBW A;  4C3I G;  1QUQ B;  1PFB A;  3KFU A;  1A8V A;  1D1K A;  2EOT A;  3BDC A;  3RZO B;  2B2U A;  1CQF A;  4A3C H;  2XGT A;  3VYT A;  2WKD A;  5IY0 A;  3LWU A;  3N52 A;  2A6H D;  1X3G A;  3NQI A;  4QUC A;  2ZXO A;  3H0G H;  2F0K A;  1IKM A;  2VW9 A;  3K7U C;  1B50 A;  4LJZ C;  4ZLT F;  1I3Q H;  1AZQ A;  1MI2 A;  2K01 A;  2PQE A;  1PLF A;  3A54 A;  1AEX A;  5K5P A;  4X3S A;  1KLG D;  2JEA I;  4HCS A;  1Q82 C;  4BA2 I;  3ULJ A;  2BE5 D;  2XN9 C;  4K6D A;  4DR6 Q;  1UAP A;  3K59 A;  4XT3 B;  1AW7 A;  1G51 A;  2IX0 A;  2UXD Q;  4A3D G;  1S4Z A;  2E8G A;  4JI1 L;  2C5C A;  3MFY A;  4ZCK A;  1XMQ L;  5CBA E;  4GOP C;  3UE1 A;  2MJ8 A;  1JOR A;  4XQN A;  1HJP A;  1TII D;  4PZ6 A;  4IPD A;  4JOI A;  2DY8 A;  3KF8 B;  4X3K A;  2F0V A;  3G48 A;  3CMA A;  5ELC A;  1JOO A;  4J1M A;  3RLF A;  3S1Q H;  3GTP B;  4ZKB B;  2WAQ E;  4LW1 A;  2F03 A;  5IYD H;  5K36 H;  1LTG D;  3NK9 A;  3CCJ A;  2UUA Q;  4B3R Q;  3CCE A;  4ZQ3 A;  4R4Q A;  1O7Z A;  1EYG A;  4LF6 Q;  3GTK B;  1EWC A;  1QOH A;  1G2S A;  2HDM A;  2JP1 A;  4AYB G;  5M5W B;  3E6Z X;  2EE1 A;  1IZ6 A;  2CHB D;  4O0A A;  3H3V C;  1QNU A;  3RMH A;  3KDF B;  3KYH C;  3OTO L;  2ZTC A;  2CQO A;  1Q86 C;  1STG A;  2QF7 A;  3PUV A;  4K2K A;  5GAD C;  3M4O H;  4BY7 G;  1PDQ A;  2ES2 A;  5JAV A;  1KNE A;  1QZG A;  4A3K H;  2WKC A;  2DN8 A;  4JI7 Q;  3K7A H;  1I94 L;  2RSO A;  3E5S A;  1FR3 A;  4BBS H;  1I50 H;  3GTQ H;  2EQS A;  2Z0S A;  2PMZ B;  4QL5 A;  3NPP A;  1VQP A;  2WAQ G;  5EPJ A;  1IL2 A;  1UNS A;  2F0L A;  2K14 A;  4H02 A;  3K5O A;  2RHQ B;  1KAA A;  4APV A;  1X3P A;  2EY5 A;  3HOW H;  2I5H A;  2Q2U A;  3M3Y H;  1GJX A;  1VQC A;  3UI2 A;  4X62 Q;  5H1S E;  2CCZ A;  2IHF A;  2QGQ A;  1B44 D;  2BH8 A;  2L11 A;  3M4Q A;  1ENF A;  1I4P A;  3HOU G;  1U4L A;  2KHS A;  1TWH B;  2VB3 X;  5C4H A;  4NXM Q;  4DV0 Q;  1EYA A;  1H9S A;  4JBK A;  2F3V A;  5C4J B;  2YTY A;  3K8A A;  4H0L C;  1S5F D;  1CFM A;  1KAB A;  5C6A A;  4O2D A;  2L9H A;  4MIU A;  1NE3 A;  2EYJ A;  3FPP A;  4HJ7 A;  1KTK A;  1HTL D;  1K0R A;  3SE0 A;  2JA8 G;  2F4V L;  2X6L A;  1RKN A;  3G6J B;  1EY5 A;  4GN3 B;  3M4P A;  3L2P A;  1VQO A;  4DV5 Q;  3QO2 A;  1JJ2 A;  1QUQ A;  1X3F A;  2K33 A;  1SYE A;  5C3E G;  2NVY H;  2HDL A;  5A2Q E;  1VMC A;  1SNP A;  3FMC A;  5J1Z A;  1N33 L;  2ICI A;  1YBY A;  3BG3 A;  1QVC A;  1EU3 A;  3MFG A;  3A8J E;  2Q2I A;  4RAU C;  3VR4 A;  1F9S A;  3T1Y Q;  1X6O A;  1W6K A;  4DF7 A;  3G4S A;  5BN3 A;  2VQF L;  4QCL A;  1SYB A;  1ZXT A;  1EWH A;  3DXJ C;  4CDC C;  2JYO A;  1F9Q A;  2K75 A;  1OXV A;  2YTV A;  3GTG H;  4A93 B;  4FF3 A;  1HZA A;  4XDX A;  1YJN A;  3A0J A;  3E9I A;  2NZO A;  3J81 c;  1STE A;  4JBM A;  1H9K A;  5FLM G;  4DR1 L;  3CCQ A;  3HKZ G;  2XWB B;  3GTP H;  5T1I A;  3FPU B;  2YTX A;  2JQO A;  1EUJ A;  1YNJ C;  1MBY A;  4DAY B;  3S1N B;  2OF1 A;  4X65 L;  5C3X A;  5L37 A;  5JEA G;  2I0Q A;  4BY1 H;  3GV6 A;  3KF8 A;  1STN A;  3MC0 B;  4KKS A;  4ZUI A;  1QVG A;  1BBX C;  4A3D H;  2A6E C;  4B3S L;  4UP9 A;  2WAC A;  4JG2 A;  4IN3 A;  3W1B A;  1CSP A;  2KQ3 A;  2K5N A;  5M3F B;  4R9W A;  1KHI A;  1IL8 A;  3STB C;  1ICW A;  3A56 A;  5TSS A;  1H95 A;  1VF5 C;  3TSS A;  4A3I B;  3NWS A;  2DUD A;  1C48 A;  1Y1V B;  3MXU A;  4HID A;  1AZP A;  4BXX H;  4AQY L;  4HMI A;  1GKH A;  1K3B C;  1HR0 Q;  5D3D A;  1J6Q A;  4IUN A;  3TRE A;  1H9J A;  1CA5 A;  4C3H H;  1P16 A;  1XPU A;  1RCV D;  4A3J B;  1Y69 U;  1HNZ Q;  4JI4 Q;  3PF4 A;  3EFX D;  3RNU A;  5CV6 A;  1HA6 A;  2EY6 A;  2RDF A;  1R4P B;  4DV4 L;  3IRB A;  3PO2 B;  3H94 A;  1DJR D;  3CC4 A;  2E75 C;  2NN6 I;  1C0A A;  1UEA B;  3J81 j;  4KN4 C;  4BY7 H;  3TP6 A;  1WTP A;  1WTX A;  4GLX A;  1Y1W G;  3RN5 A;  1HZB A;  1ESR A;  1HZ9 A;  2KCT A;  5CV4 A;  3QB3 A;  3S17 B;  1YNJ D;  1K28 A;  2R92 G;  3M9B A;  2B2T C;  1PRT D;  1T5E A;  1WTW A;  1EOV A;  3FVQ A;  4J15 A;  2X69 A;  3BZC A;  4WOR A;  2A6E D;  3X3M A;  4H13 C;  4G4K A;  4JCV E;  2F4I A;  1M4V A;  3U9O A;  4BS9 A;  3CCM A;  3GTO B;  4JPB W;  1PRT B;  1EYD A;  1YNX A;  2RVL A;  4JI2 Q;  2OQK A;  3STB D;  2N55 A;  1CM9 A;  2PO4 A;  2K32 A;  2WFW A;  2PPB C;  4JI3 L;  3KBX A;  1ZKO A;  5FJ8 H;  5E4X A;  1TKW B;  3CC7 A;  2PI2 A;  2CW0 D;  4CDD C;  1B70 B;  4QY7 A;  4RG1 A;  1BBW A;  1SYG A;  2F0F A;  3D31 A;  5IGF A;  5KNB A;  1TS2 A;  3Q24 A;  2E2J H;  4HJ9 A;  5J39 A;  4KD3 A;  3OHX C;  4JYA L;  1ZYR C;  1IHZ A;  5LMN L;  4JC0 A;  5IWA L;  2Z1C A;  1IBM L;  2AQ1 B;  2F0N A;  1TXY A;  1IBK Q;  4XYQ A;  1Y8P B;  1G91 A;  1KIX A;  1GM5 A;  1E2V A;  4QGU A;  1BF4 A;  1WOC A;  2O5J C;  4HJ8 A;  1UEB A;  1CSQ A;  3A5U A;  4A3E G;  2K5W A;  2KUM A;  1HNX Q;  4DV3 Q;  3S1N H;  2OT2 A;  5IE8 A;  2EXD A;  1BVS A;  4DR2 L;  4DV1 L;  4LF7 Q;  2PW7 A;  4F7X A;  2UU9 L;  1S72 A;  3K57 A;  4NXN L;  4B9X A;  3J7A F;  3HOV H;  5KYI A;  3FKI G;  1TWF H;  3I4N G;  3OMG A;  3QOJ A;  4C3J G;  3RR5 A;  3HOX H;  3S24 A;  2RCF A;  4PMC A;  1KC8 C;  1Q46 A;  5JEA J;  4GN4 B;  4DR7 Q;  4DAY A;  2N8N A;  2Z8L A;  1F9R A;  1TWC H;  4JK1 C;  3J80 c;  1OXX K;  3L7Z C;  5LL6 S;  2B63 H;  4JI6 L;  1EQR A;  4XT1 B;  1LAC A;  3I4O A;  1I4X A;  1B4O A;  4OHJ A;  1HPC A;  2BA1 A;  1PH3 A;  5C5M A;  3TZD A;  5C0X I;  1D7Q A;  3PUY A;  3GTJ H;  1SEB D;  2VXW A;  5ELD A;  1TWA B;  4YHH L;  5IP9 G;  5JEA H;  4DKA C;  1EIG A;  5JOB A;  1KD1 C;  1XJV A;  1ZYR D;  1FD7 D;  3HOY G;  2CH4 A;  1BCP F;  2E2H B;  2KCM A;  4PV1 C;  1PTO C;  3PO2 H;  3HS0 C;  1JB3 A;  4DR3 Q;  1FL0 A;  1RHP A;  5IGC A;  2EYF A;  1XNQ Q;  4HAE A;  1A3T A;  1CUK A;  3H6M A;  4K0K L;  1IW7 D;  5IGG A;  4L5T A;  1N34 L;  2NVT H;  5J22 A;  3LX0 A;  2O4X A;  3I70 A;  2F0D A;  3A55 A;  4DV6 L;  2I5M X;  5C0X J;  1KRS A;  3S2H H;  2QEJ C;  1SFO B;  3O13 A;  2AKW B;  5AFW A;  1TT2 A;  3CP0 A;  4DR5 L;  2D2C C;  2MFI A;  2EXZ A;  1Z7T A;  2ZXP A;  1BR9 A;  5C44 B;  4DR4 Q;  1AN8 A;  3F2D A;  1YIJ A;  4L5R C;  1S40 A;  2RSN A;  1BUV T;  1G29 1;  1HFG A;  2WB1 G;  4MHE A;  2DJG C;  4RGM A;  3SR1 A;  5C0X H;  2IX3 A;  1BO0 A;  3ULP A;  1HR0 W;  4FVM A;  2UUB L;  1Y1W H;  2TSS A;  3H0G B;  3U4V A;  2R92 H;  3HOZ H;  3PIO 3;  2AUJ D;  4UP8 A;  4C1N I;  3S1M H;  1X3Q A;  1YEZ A;  4MN3 A;  2FIN B;  4HTH A;  3QJY A;  5CMD A;  2M9V A;  2F1M A;  3HEJ A;  4JI1 Q;  2I07 B;  2ZT9 C;  4B3T L;  1PH6 A;  1TVX A;  4WJ3 M;  4BBR G;  3S16 H;  1QZH A;  2QW7 A;  2VY3 A;  1UE1 A; 
#chains in the Genus database with same CATH homology
 2IX0 A;  2UXD Q;  3SGI A;  3CCR A;  2R93 G;  3HOV G;  3CC2 A;  4A3D G;  1PH2 A;  2E8G A;  4JI1 L;  4X66 Q;  5AJ3 L;  1IBL Q;  1VQA A;  1T9H A;  4JV5 Q;  2ZJR A;  1K8G A;  4OX9 L;  2NVQ H;  2JE6 I;  3HOX G;  1XMQ L;  1QVF A;  4GOP C;  1K83 H;  2JA9 A;  2A8V A;  4GKJ L;  3S15 H;  3UE1 A;  3KJP A;  1E24 A;  1HJP A;  1Z9F A;  4PZ6 A;  3M85 A;  4DV2 L;  1JE5 A;  1E3P A;  3KOJ A;  4IPD A;  4JOI A;  5M3F G;  4LF5 L;  1VQ7 A;  3KF8 B;  2B63 G;  3G48 A;  3CMA A;  3RLF A;  4JI6 Q;  1Q1E A;  1IBL L;  3S1Q H;  3KF6 A;  4JV5 L;  2WAQ E;  4LW1 A;  3G6E A;  1PVO A;  4LFB Q;  5IYD H;  1Y1V G;  3CCJ A;  1GD7 A;  2UUA Q;  2R7D A;  4A3L G;  4OON A;  5M5Y H;  3F2B A;  1SLJ A;  4DK3 C;  3CCE A;  4JI5 Q;  4MNO A;  2ID0 A;  4B3R Q;  1HNW Q;  4R4Q A;  4DPG A;  1EYG A;  4OO1 I;  4DUZ Q;  4HJA A;  3ERS X;  5FLM H;  3PO3 G;  4LF6 Q;  3I4M G;  4JI8 Q;  3GTK H;  4A3G G;  4A3M H;  4NB3 A;  4AYB G;  2JJQ A;  4YCV A;  4EX5 A;  1GO3 E;  5M5W H;  1VCI A;  1YIT A;  1FJG Q;  1IZ6 A;  4A3J G;  4GNX B;  2KEN A;  5GAH C;  2A1A A;  2JK8 A;  4O0A A;  4DNI A;  1SMX A;  1HNW L;  3KDF B;  3KYH C;  1GVP A;  3PO2 G;  2PQA B;  2ZTC A;  2CQO A;  3OTO L;  1Q86 C;  2GVA A;  1VQ8 A;  3PUV A;  3LGJ A;  1JMC A;  5GAD C;  4GS3 A;  3M4O H;  1N9W A;  4JI8 L;  1CKO A;  2JA7 G;  2ES2 A;  4BY7 G;  1QZG A;  2JEB I;  4A3K H;  4JI7 Q;  3K7A H;  4IJL A;  1FJG L;  1WCM G;  1I94 L;  2R7F A;  1YHA A;  1VQN A;  2NVX H;  4BBS H;  4TQU S;  1VQF A;  1I50 H;  4HJ5 A;  3OW2 A;  2EQS A;  3GTQ H;  2Z0S A;  4QL5 A;  4C3J H;  2VZA A;  3F2C A;  1VQP A;  5EAY A;  2WAQ G;  4JI0 Q;  1SRO A;  2WB1 E;  1IL2 A;  3F1Z A;  3CXC A;  2K14 A;  3KDF A;  3K81 C;  3PUX A;  4H02 A;  4A3B G;  2RHQ B;  4JOI C;  4P72 A;  1VQH A;  3PSI A;  4APV A;  1Q8K A;  3M3Y H;  3HOW H;  2I5H A;  2FXQ A;  2MQH A;  2GN5 A;  1VQC A;  4X62 Q;  2Q2U A;  4LF7 Q;  5H1S E;  2VNU D;  2QA4 A;  2IHF A;  2CCZ A;  3NBH B;  2LXJ A;  2QGQ A;  2BH8 A;  3M4Q A;  4L5Q A;  3CCL A;  4YY3 Q;  1VQE A;  3JC6 6;  4JI0 L;  2HHH Q;  3HOU G;  4AH6 A;  3JAM c;  3NEN A;  3HFZ B;  5DLQ E;  2AHO B;  2N78 A;  4YWK A;  2VL6 A;  2K4K A;  1IXR A;  5IP9 H;  1BBU A;  1TWH H;  4X62 L;  2A19 A;  4NXM Q;  2K5V A;  2YV5 A;  4DV0 Q;  5C0X G;  4JBK A;  4Y52 H;  1HNZ L;  4JI4 L;  2UUB Q;  5C4J H;  2YTY A;  4TVA B;  3K8A A;  4YY3 L;  2E2I H;  2R7Z H;  1PH7 A;  2HHH L;  1OXT A;  3PV0 A;  1X3E A;  4O2D A;  1YJW A;  3JAM i;  3GDE A;  3L0O A;  4YCW A;  3CCV A;  1JJC B;  4GLV B;  5GQO A;  3K0X A;  1PH5 A;  2V1C C;  3HOZ G;  1I6H H;  5C44 H;  1NE3 A;  1VQ4 A;  1NJI C;  3J7Z C;  4R4T A;  4HJ7 A;  2IX1 A;  1WI5 A;  1X56 A;  1K0R A;  2JA8 G;  2F3I A;  2F4V L;  1E1T A;  2XTI A;  1V43 A;  3GTM H;  4Y7N H;  2AWN A;  4GN3 B;  4P73 A;  1Y14 B;  1N36 L;  3M4P A;  3L2P A;  1VQO A;  4DV5 Q;  4LF9 Q;  1M1K C;  4BA1 I;  3CF5 A;  1Q7Y C;  2ASB A;  1OXS C;  2AWO A;  1QUQ A;  1X3F A;  1K73 C;  1K3R A;  1M90 C;  5C3E G;  5GAE C;  2NVY H;  4LUZ A;  2RCN A;  3E9H A;  2RF4 A;  2KHJ A;  2VQF Q;  3W5O A;  4HIK A;  1PH8 A;  4GLA C;  2B3G A;  1N33 L;  1W3S A;  1YBY A;  1SR3 A;  1QVC A;  1YJ9 A;  1MJE A;  4DV5 L;  2KHI A;  4LF9 L;  5LMU L;  3GTL H;  2Q2I A;  3T1Y Q;  1XMQ Q;  3PF5 A;  4GKJ Q;  1LTL A;  1X6O A;  3G4S A;  3BU2 A;  3T1H L;  3U58 A;  3M7N A;  4AYB E;  4WJ4 A;  2VQF L;  4LF5 Q;  3I55 A;  2K50 A;  1YI2 A;  1YHQ A;  2UUC L;  4IFD G;  4DR1 Q;  1EIY B;  2K75 A;  2YU9 H;  4LFA L;  1OXV A;  3AFP A;  2YTV A;  2MNA A;  2KBN A;  3GTG H;  2PMZ E;  4C2M H;  1JB7 A;  2VUM G;  5IYD G;  1XTD A;  3T1Y L;  5K36 G;  4A93 H;  1HZA A;  4LUO A;  1YJN A;  3A0J A;  3UDG A;  3E9I A;  2NZO A;  3J81 c;  2D0P A;  2N49 A;  4JBM A;  1V9P A;  4X65 Q;  2WP8 J;  5FLM G;  4DR1 L;  3CCQ A;  1JT8 A;  1VQM A;  1V1Q A;  2RHS B;  3HKZ G;  3GTP H;  3MEF A;  3PUZ A;  1KXL A;  1B7Y B;  2YTX A;  1AE2 A;  1SE8 A;  2JQO A;  5GAG C;  1EUJ A;  1CKM A;  2JA6 H;  4IOC A;  4DAY B;  3J81 i;  1ASY A;  4BBR H;  3OTO Q;  4X65 L;  5LMN W;  4LUV A;  3I2Z A;  3KLW A;  4LWC A;  5JEA G;  2I0Q A;  4BY1 H;  4IPC A;  1VQD A;  4OWW B;  3FHW A;  4A3K G;  3W1G A;  1QVG A;  2R93 H;  1I94 Q;  4A3D H;  4UY8 C;  2K52 A;  1EIF A;  4B3S L;  4A3E H;  4UP9 A;  1HNX L;  4JG2 A;  1VQB A;  1L1O B;  1PFS A;  2AMC B;  4DV3 L;  1MKH A;  3W1B A;  3TS0 A;  1CSP A;  2F52 A;  4LF7 L;  2K5N A;  4X64 L;  2UU9 Q;  4AQY Q;  1N8R C;  5M3F H;  1KHI A;  3STB C;  2VQE L;  1SRU A;  1H95 A;  3FKI H;  4IOA A;  2IHE A;  3I4N H;  4IPG A;  1JJG A;  2B29 A;  2BA0 A;  1X9N A;  2DUD A;  3E0E A;  4HID A;  4IO9 A;  4A3I H;  4GNX A;  5M5X H;  1Y1V H;  4BXX H;  1J5E L;  3PIP A;  1AH9 A;  4HIM A;  4AQY L;  1EWI A;  1GKH A;  2CFM A;  4A75 A;  4YWL A;  2ZM6 L;  1HR0 Q;  2PQA A;  4LF4 L;  1J6Q A;  5JJL A;  3TRE A;  4POF A;  2HIX A;  3U4Z A;  1NMF A;  4C3H H;  1P16 A;  1XPU A;  1FGU A;  2HIV A;  1N32 Q;  1X55 A;  3UE0 A;  3J7A 5;  3Q8D A;  2ZJP A;  1HNZ Q;  4JI4 Q;  3PF4 A;  3TS2 A;  1OTC A;  4R1J A;  5IYC G;  4A3J H;  1AE3 A;  3RNU A;  2VS1 A;  1XMO L;  2R7Z G;  1P8L A;  4OO1 G;  4ALP A;  1NBW A;  3WWV A;  4DV4 L;  3IRB A;  1HR0 L;  3CC4 A;  1UE5 A;  1RL2 A;  1X54 A;  4R4O A;  4R4I A;  2NN6 I;  3EIV A;  5IYB G;  1MJC A;  1NTG A;  4KLK A;  5C44 G;  1IYJ B;  1C0A A;  3J81 j;  4B3M Q;  2JA7 H;  3ER0 A;  4BY7 H;  2ZJQ A;  4A3C G;  2Y0S E;  3CPW A;  1N32 L;  3KJO A;  1XPO A;  3H15 A;  4A4I A;  3UDI A;  4GLX A;  2F4V Q;  1WCM H;  3AYH B;  1Y1W G;  3RN5 A;  1L0W A;  4LF8 Q;  1HZB A;  3RZD H;  3HOY H;  4GOP B;  4PG3 A;  4KHP L;  2KCT A;  1HZ9 A;  1PA6 A;  1N36 Q;  1NMG A;  3OYY A;  3H0G G;  1SN8 A;  2LSS A;  3S17 H;  3DM3 A;  2R92 G;  3M9B A;  1UWV A;  1LM0 A;  4DR3 L;  4MZ9 A;  4HIO A;  4B3M L;  5M3M H;  2JA5 H;  2E5L L;  4A3B H;  1EOV A;  4P71 A;  4AIM A;  3PIO A;  4UPA A;  1XNQ L;  4ME3 A;  2H5X A;  1VQI A;  1R9T H;  4J15 A;  4LF8 L;  3BZC A;  5BR8 Q;  5IP7 H;  1N33 Q;  2Q2T A;  2IY5 B;  4JCV E;  4R4C A;  4A3F H;  1PYB A;  4JI3 Q;  1TWG H;  2D62 A;  4MTN A;  5GRO A;  5LMU Q;  4GNX C;  1CKN B;  1I5F A;  3CCM A;  3F8T A;  3HKZ E;  3T1H Q;  3GTO H;  4GKK Q;  2I5L X;  4YWM A;  1K9M C;  1YNX A;  3EBE A;  4JI2 Q;  4OXP A;  2OQK A;  4PZ7 A;  3STB D;  1BKB A;  1OXU A;  5FLX c;  2UUC Q;  2Q2H A;  1E22 A;  1RIP A;  5BR8 L;  2WFW A;  5IT9 c;  3G71 A;  3AEV A;  4LFA Q;  3EN2 A;  4JI3 L;  1KRT A;  2OTL A;  2OTJ A;  2MO1 A;  2Y0S G;  4DUY Q;  5FJ8 H;  4A93 G;  1KL9 A;  4C3I H;  3D0F A;  5IWA Q;  3CC7 A;  4GKK L;  2PI2 A;  1IBM Q;  1B70 B;  4QY7 A;  4JI2 L;  4RG1 A;  1BBW A;  4KI0 A;  4DK6 C;  3D31 A;  4DR4 L;  2ZTE A;  2HQL A;  2UXC Q;  2E2J H;  3GO5 A;  3ICE A;  3S14 H;  3TQY A;  1Q81 C;  5JJK A;  4HJ9 A;  2OWO A;  4DUY L;  1VQL A;  1LYL A;  4JYA L;  4IJH A;  1DGS A;  1NY4 A;  5LMN L;  3CAM A;  4JC0 A;  5IWA L;  2GVB A;  1IBM L;  1XPR A;  2EIF A;  2C35 B;  3U50 C;  2JA6 G;  1TXY A;  1E1O A;  3BJU A;  3AQQ A;  1IBK Q;  1A63 A;  4IFD J;  3GD7 A;  2UXC L;  1KIX A;  2CKZ B;  4BY1 G;  2CWA A;  4X6A H;  1GM5 A;  4QGU A;  3K80 C;  4A3M G;  1XNR Q;  3NEM A;  3TEH B;  3KF6 B;  1WOC A;  4XTC S;  4NXN Q;  1PYS B;  1UE7 A;  4OWT B;  4HJ8 A;  1YZ6 A;  3S2D H;  1UEB A;  1CSQ A;  4P75 A;  3UDX A;  3A5U A;  4A3E G;  4B3S Q;  1HNX Q;  1LUZ A;  4A76 A;  1PV4 A;  4DV3 Q;  5C4X H;  1IBK L;  3I56 A;  3S1N H;  5IE8 A;  4DR6 L;  2EXD A;  1BVS A;  1HH2 P;  1D8L A;  1S3O A;  2L15 A;  4X64 Q;  4DV1 L;  4DR2 L;  1W2B A;  1VQ5 A;  1C7Y A;  1XNR L;  1PH4 A;  3A5Z B;  1S72 A;  2UU9 L;  3CQZ H;  2VQE Q;  2HT1 A;  4NXN L;  2UXD L;  3AFQ A;  3HOV H;  2BH2 A;  1E7Z A;  3FKI G;  4LFC Q;  1TWF H;  4OWX B;  1G6P A;  3I4N G;  4X66 L;  4BBS G;  2LXK A;  4PZ8 A;  2VUM H;  3CCS A;  3RR5 A;  3HOX H;  4A3I G;  3S24 A;  1KC8 C;  1K8A C;  1Q46 A;  4UP7 A;  5JEA J;  1J5E Q;  3TRZ A;  4GN4 B;  4BXX G;  3B6Y A;  4DR7 Q;  5E7N A;  2N8N A;  2ZM6 Q;  4NPS A;  4LF4 Q;  5JJI A;  1TWC H;  3J80 c;  4YHH Q;  1OXX K;  3L7Z C;  3HOW G;  1FVI A;  2B63 H;  4LFC L;  4JI6 L;  1EQR A;  3I4O A;  3UDF A;  1HZC A;  3ULL A;  2PI2 E;  3NEL A;  2BA1 A;  4FDB A;  1PH1 A;  1PH3 A;  4LFB L;  2Z6K A;  1XMO Q;  1Q1B A;  1U5K A;  2UUA L;  1KQS A;  4A3L H;  5C0X I;  1D7Q A;  1L1O A;  3PUY A;  4JI5 L;  3PGZ A;  4DV4 Q;  3CD6 A;  3GTJ H;  4DR7 L;  4B3R L;  1Z47 A;  3H3V I;  4DUZ L;  4YHH L;  3PO3 H;  1TWA H;  3S1R H;  1O7I A;  3J80 i;  5IP9 G;  4DV7 Q;  4LF6 L;  3I4M H;  4DKA C;  4L5S A;  4A3G H;  3CW2 C;  3BZK A;  1PH9 A;  1KD1 C;  2MO0 A;  1XJV A;  4QJF A;  3HOY G;  2UXB Q;  3A74 A;  4KHP Q;  1KAW A;  1VQJ A;  2KCM A;  1JJ2 A;  4K0K Q;  1VQG A;  2K5H A;  2E2H H;  1N34 Q;  2N3S A;  2NZH A;  3CME A;  3PO2 H;  2YYZ A;  1A62 A;  5HY6 A;  4DR3 Q;  4DV7 L;  3I7F A;  5ELN A;  1MIU A;  5M3M G;  4DV6 Q;  2JA5 G;  2E5L Q;  4P74 A;  3MXN B;  1FL0 A;  4RMF A;  1XNQ Q;  4JI7 L;  4LNQ A;  2R6G A;  5IP7 G;  1CUK A;  2UXB L;  1L2F A;  1ASZ A;  5ELO A;  4A3F G;  4K0K L;  2ZTD A;  4L5T A;  1N34 L;  3FP9 A;  4QIW E;  2QEX A;  1Q12 A;  4IPH A;  2NVT H;  1UE6 A;  3DLL A;  4DR5 Q;  1U0L A;  4DV6 L;  2I5M X;  2IT1 A;  3CPF A;  5C0X J;  3ZJY C;  4YCU A;  4KHZ A;  1KRS A;  4EQ5 A;  4PMW A;  3RLN A;  4DAM A;  1EFW A;  1VQK A;  3S2H H;  2ATW A;  3PUW A;  3PCO B;  4QQB X;  2AKW B;  1SFO H;  1VS0 A;  1PHJ A;  4IFD I;  1B8A A;  2Z6K C;  1YVC A;  5IYC H;  5FJ8 G;  4GOP A;  3CP0 A;  4JBW A;  1QUQ B;  4DR5 L;  4JBJ A;  3HOU H;  1L1O C;  2MFI A;  1VQ6 A;  2ALY B;  3KFU A;  1A8V A;  2OQ0 A;  5IYB H;  1C9O A;  5J3B A;  3F2D A;  4DR4 Q;  2DGY A;  1YIJ A;  4L5R C;  1S40 A;  1G29 1;  4NXM L;  3RZO H;  4A3C H;  2WB1 G;  4DV0 L;  1WFQ A;  3ULP A;  2XGT A;  5IY0 A;  3VDY A;  1HR0 W;  4GN5 A;  2UUB L;  3H3V H;  4JYA Q;  1Y1W H;  2OCE A;  5LMN Q;  2NN6 G;  1X3G A;  4B3T Q;  3U4V A;  2D0O A;  1WYD A;  3H0G H;  1EQQ A;  1CKN A;  2VW9 A;  3RLO A;  3HKS A;  3RN2 A;  2R92 H;  3HOZ H;  3K7U C;  4UP8 A;  3S1M H;  1I3Q H;  1VQ9 A;  4POG A;  2PNH A;  1YEZ A;  1YHB A;  3CCU A;  4XIG S;  2JA8 H;  5HGQ A;  2JEA I;  2CWP A;  4JI1 Q;  5AJ3 Q;  1Q82 C;  4B3T L;  4BA2 I;  1PH6 A;  3ULJ A;  4OX9 Q;  1WJJ A;  4WJ3 M;  1X65 A;  4BBR G;  5C4X G;  1A0I A;  4DR6 Q;  3S16 H;  5C3E H;  4DR2 Q;  1QZH A;  4DV1 Q;  4DV2 Q;  2VY3 A;  1UE1 A;  1G51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...