3T1HQ

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16s rRNA
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3t1hQ00
3HOXH 4LFCQ 2UXBL 4P73A 3AEVA 1I94L 3ULJA 4LF5L 4L5SA 4IJHA 3DLLA 5M5WH 4HIMA 1Y1WG 1PH1A 1HNXQ 1SE8A 4DAYB 3GDEA 1K0RA 1SFOH 2UXDQ 5FLXc 1GO3E 4JI5Q 3D0FA 1Q82C 4DR5L 4LF7L 5LMNQ 4A3LG 1J5EL 5IYCG 4IOCA 4AIMA 3W1BA 3T1HQ 1N9WA 4PMWA 4OO1G 2OCEA 4X64Q 4DUYQ 1UE7A 2NN6I 4B3RL 1EYGA 1IBLL 1Q81C 1Q12A 1Q46A 2Y0SG 3EN2A 3F1ZA 4PZ6A 2ZM6Q 2VQFQ 2HHHQ 4AYBE 2ZJQA 4DR5Q 2YTYA 2GN5A 3KYHC 3HOXG 1GKHA 1YVCA 4DV0L 3OYYA 3KJPA 1BBUA 1Z47A 1Y1VG 3CCSA 1YJNA 1IBMQ 4JI7L 5JJKA 4QJFA 1XMQL 1PFSA 1D7QA 3GTJH 2MO0A 3U4VA 2D62A 4B3RQ 3CCVA 1X55A 1YIJA 3KDFB 4Y52H 2OQKA 4IOAA 1CSPA 4OO1I 1YBYA 4X65Q 1EOVA 3S17H 1VS0A 1CKOA 4L5QA 5GAEC 4A3KH 3CC4A 3SGIA 4DPGA 4LNQA 1VQAA 1X6OA 1XPUA 3KOJA 1XPRA 2IX1A 3CW2C 4JBMA 4NXNQ 4A3EH 4K0KQ 1VQJA 3K8AA 4POFA 5IWAQ 3I56A 3L7ZC 4JCVE 2WP8J 1S72A 3K0XA 2K5NA 3CPFA 1SRUA 2RF4A 2WAQE 3CQZH 3PIOA 1VQKA 1VQIA 4LF9L 1N33Q 2D0PA 3CAMA 1N34Q 4BXXH 4DKAC 4EX5A 4DK3C 4LUOA 4OX9L 3I4MH 1KRSA 2AKWB 4MTNA 4DUZL 2R93H 3AFQA 3J7ZC 4R1JA 1HNXL 2K5VA 4NPSA 1PH8A 2N78A 5LMNW 1UE5A 5IP7H 3S2DH 3PO2G 1O7IA 3KDFA 2VW9A 2K4KA 1HZAA 2LSSA 4J15A 4MZ9A 3S24A 4AYBG 2UUAQ 4AQYL 2JA8H 3A5UA 3PF5A 3I4NG 1YHBA 1FL0A 2Y0SE 3H3VI 1PVOA 1K8GA 3GTPH 3S1QH 4JBKA 2GVAA 2V1CC 4X64L 1P16A 2LXKA 1JJGA 1K73C 4R4OA 4TQUS 1GVPA 3UDGA 1GM5A 1VQLA 4GOPC 4QY7A 4YHHL 1YZ6A 1SROA 4IFDI 2AHOB 2Q2IA 1VQFA 3GTQH 1EQQA 1QVGA 4NXML 1D8LA 1C7YA 1H95A 3I4MG 3UDFA 2IT1A 4A3MG 1VQPA 2EIFA 3HKZE 2OTLA 3ER0A 4C3IH 4GLVB 1PH7A 3HOUG 3HOZG 4OWWB 3PV0A 1TXYA 4Y7NH 2JA8G 2CFMA 5M3FG 4JI6L 4X66Q 1FJGL 2JA9A 2MFIA 1VCIA 1G6PA 1V1QA 4YY3L 2FXQA 4GOPB 3BZCA 1I5FA 4DK6C 4A3IH 3NEMA 4JC0A 1E1TA 1AE3A 4GLAC 3TREA 1QZGA 4QIWE 5C4JH 3PO3H 3T1YL 3H0GG 3CCMA 4JI6Q 2Q2TA 1N33L 1CKNB 2OQ0A 3JAMi 1FJGQ 4YCWA 3S14H 5FJ8H 2Z6KC 2R7ZH 1Y1WH 4PG3A 4O0AA 2B63H 1XMOL 2WB1E 4R4IA 4AH6A 3S1RH 4A3BH 2F52A 5JJLA 3F2CA 2PQAB 4A3DG 3AYHB 3HOVH 3T1YQ 3M85A 1KHIA 2D0OA 3CCQA 1X3GA 1YJWA 3NELA 4GS3A 4BA2I 4P75A 2HIXA 1V43A 4DV6Q 2ES2A 5HY6A 4DR7L 4A3IG 2ZJPA 1W3SA 3JAMc 1XMOQ 2OTJA 3T1HL 4IPGA 2KHJA 3PUWA 1PHJA 2IHEA 3H0GH 2XGTA 4GNXA 1XNQL 1JJCB 1OXSC 1OXXK 3K81C 1Y1VH 2UU9L 4DV4L 5FJ8G 2R7ZG 1XTDA 1CKNA 2CWAA 3RLOA 2B63G 2MQHA 1PH9A 2ZTEA 4A3BG 1PYBA 3M4QA 3K80C 1VQ4A 1TWGH 3HOVG 4YCUA 3CMAA 1KC8C 4RG1A 1RL2A 1PH5A 1J6QA 1YJ9A 1NBWA 1HNWL 4A3EG 2UU9Q 3BJUA 4JI2Q 4YY3Q 3F2DA 2PNHA 4JBJA 4NXNL 2K14A 4H02A 2PQAA 1G51A 3KF6A 1E1OA 4HIOA 2HQLA 3NBHB 4JOIC 2I0QA 3CCJA 3KF8B 2A1AA 2PMZE 3A0JA 4JI1Q 4JI3Q 5H1SE 3J81i 2KBNA 4UP7A 4QL5A 2BA1A 1PH2A 5C0XG 5AJ3L 5IP7G 1C9OA 2H5XA 4GOPA 3PO2H 2N8NA 2UUBL 1HR0L 4LF9Q 2EQSA 2RHSB 1WYDA 2QA4A 1SLJA 2HHHL 3I4NH 1EFWA 3I7FA 2GVBA 4R4QA 3W5OA 4DV6L 4JYAQ 3KJOA 4UPAA 1CUKA 2UUAL 3RLNA 3E9IA 3FHWA 4HJAA 1IBML 5IE8A 4JI4Q 1SR3A 4GLXA 1A62A 2UUBQ 1X54A 4P72A 3I4OA 1K9MC 2CQOA 3AFPA 4X65L 4MNOA 2R92G 4DV4Q 1K3RA 5C0XJ 4A3MH 3S1MH 2UXCL 4HJ9A 4DV7L 2B3GA 2MO1A 3UDIA 1VQ6A 1I3QH 2IY5B 4DV2Q 1EIFA 4XTCS 4DR2L 2VUMH 4C2MH 5M3FH 2K52A 1NMGA 3IRBA 4OWTB 4R4CA 4LUVA 3U50C 1HR0W 1L1OA 2K5HA 2F4VL 3HOYH 2JEBI 1I6HH 1HNWQ 5LMUL 4A3CG 4IFDG 3K7UC 1KL9A 2UXCQ 2YYZA 1LYLA 1MJCA 3FKIH 2C35B 1ASYA 3GD7A 4A3FG 2CKZB 5E7NA 3S16H 2R6GA 5C0XI 1T9HA 1YI2A 4DV5L 4L5TA 4IJLA 5M5XH 1IYJB 4UP8A 1Q1EA 3KFUA 2BA0A 3HOWH 4B3SQ 4NB3A 2NZHA 4KHPL 4LWCA 3CMEA 1UE6A 4GNXB 5AJ3Q 1BVSA 5GAHC 3TRZA 1VQNA 3ULPA 2E2JH 4A3DH 4X6AH 4OXPA 4DR1L 2VUMG 1WI5A 3STBD 4GKKL 1UWVA 4A75A 3RNUA 3I55A 3HOYG 1K83H 1PV4A 4DV5Q 4KLKA 4PZ8A 5GADC 4YHHQ 3CCRA 4JYAL 1HNZL 2AWNA 1X56A 4ALPA 1HJPA 4A3JG 3GTKH 3CPWA 1V9PA 2KENA 3FKIG 3PF4A 1SN8A 4IPDA 4WJ3M 4A3FH 4QQBX 3PUYA 4JI4L 2OWOA 1E22A 4LF4L 3ERSX 4DR4Q 3S2HH 4LFBL 2R7DA 1KQSA 3E0EA 2WB1G 3M7NA 2E2HH 2YV5A 3GTOH 1EWIA 1MKHA 2K50A 3B6YA 3G4SA 4EQ5A 2A8VA 4DR6Q 3HKSA 2PI2E 5ELOA 1JMCA 2K75A 1EUJA 1EQRA 3ULLA 3GTMH 1N32L 1N36Q 4HJ5A 1QVCA 2B29A 3UE1A 1K8AC 5M5YH 2F4VQ 4JI8L 3PGZA 4JV5L 1LUZA 1JB7A 3D31A 5BR8L 4BBSG 1DGSA 4DNIA 2IHFA 4LF8Q 1S3OA 5IYDG 3M4OH 2CWPA 2I5LX 1WJJA 2VL6A 4LUZA 2NVXH 3LGJA 1NMFA 3J81j 2UUCQ 4TVAB 3CF5A 1L2FA 2ID0A 2ASBA 4JV5Q 1NY4A 1HH2P 5JEAG 5IP9G 1OXTA 3H15A 4GNXC 3G6EA 1OXUA 1OTCA 1VQCA 4DV3Q 1VQ7A 4A3GG 4JI1L 5BR8Q 4BY7G 4DR7Q 4ME3A 4C3JH 1G291 4IPCA 2VQEQ 4LF8L 4JI0Q 2BH2A 2BH8A 4APVA 4O2DA 5IY0A 5GQOA 4YCVA 4FDBA 4GN3B 4JOIA 5EAYA 1HR0Q 2UUCL 2E2IH 1TWHH 1Q7YC 2VZAA 1CKMA 1UEBA 1VQDA 2F3IA 3E9HA 3I2ZA 3K7AH 1JJ2A 4BBSH 4IO9A 1PH4A 4DV3L 4HJ8A 5IYDH 5LMNL 1XNRL 1AE2A 3UE0A 5IYBG 2KCMA 2VS1A 5FLMH 1S40A 4JI0L 2JA7H 5C4XG 5GROA 4DR4L 3CXCA 2JJQA 4IFDJ 2ZTDA 4DUYL 2R92H 3ICEA 1LM0A 1PA6A 2VY3A 5IP9H 3M4PA 1KRTA 5C3EH 1WFQA 4A3GH 1E7ZA 3STBC 1Q1BA 2NZOA 1HZBA 2AWOA 3ZJYC 4HIDA 1VQ9A 2NVTH 3DM3A 3RN2A 5JJIA 1XNRQ 4DV0Q 2A19A 4DV7Q 1XJVA 2WAQG 4BA1I 2WFWA 4C3HH 1N36L 2YTXA 4JI7Q 4KHZA 1PH6A 1YEZA 4A3CH 4A4IA 4B3TQ 5M3MH 2JA6H 5C44G 1E24A 3M3YH 2ALYB 3CC7A 1Q8KA 4JI3L 2KCTA 5LMUQ 3J7A5 3TS0A 1MIUA 5FLMG 5GAGC 4DAMA 4BY1H 2JA7G 4XIGS 1YNXA 4YWKA 4LFCL 3OW2A 1PH3A 4K0KL 5IWAL 3KLWA 2UXDL 1VQ5A 1L1OC 1X3EA 4P71A 1KD1C 1E3PA 1QUQB 1Z9FA 3M9BA 2XTIA 4IPHA 4R4TA 5C3EG 2AMCB 3TS2A 1KAWA 1X3FA 2NVYH 2QGQA 4GKJL 4KHPQ 3L0OA 1VQOA 4LF7Q 2HT1A 1YHAA 1PYSB 2MNAA 4X62Q 2N3SA 4B3ML 2I5MX 5IT9c 1B7YB 2VQEL 2RCNA 4HIKA 3CD6A 3U4ZA 3A5ZB 3FP9A 1WOCA 1VQGA 4OONA 4OX9Q 4A3LH 4DUZQ 1FGUA 2IX0A 1JE5A 5IYCH 4POGA 4RMFA 3TQYA 3PIPA 3JC66 1WCMH 3EBEA 3RR5A 1IBLQ 2E5LL 2VQFL 4A3JH 4A76A 4DR3L 4UY8C 1HZ9A 4GKJQ 4GN5A 1HNZQ 1TWAH 1L1OB 4AQYQ 1A8VA 4B3MQ 2Z0SA 2E8GA 3UDXA 1OXVA 3F2BA 3PSIA 4DV2L 2LXJA 5ELNA 3WWVA 1YITA 1XMQQ 1EIYB 1LTLA 2Q2UA 1QUQA 3CCLA 4DR2Q 3PUXA 1R9TH 1IXRA 3OTOL 1M90C 4LF4Q 1X65A 4GKKQ 3RZOH 1BBWA 4BBRH 2YTVA 1KIXA 1SMXA 4DR6L 2QEXA 4NXMQ 2Q2HA 3F8TA 4OWXB 4A3KG 3HOWG 1X9NA 1TWFH 1WCMG 3L2PA 1N32Q 2KHIA 3TEHB 4YWMA 1KXLA 2DUDA 3OTOQ 3S15H 2JQOA 3PCOB 3HFZB 4A93G 1A0IA 5DLQE 1IBKL 3GO5A 4B3SL 3RZDH 2VNUD 3AQQA 1JT8A 1BKBA 2JK8A 1N34L 4LFAL 3CC2A 1NTGA 3GTLH 4DR1Q 1AH9A 1VQEA 2I5HA 1VQ8A 5JEAJ 2RHQB 2UXBQ 4JBWA 1VQBA 1I94Q 4LF5Q 3U58A 4BXXG 3CP0A 4BBRG 1NE3A 1C0AA 3BU2A 4BY7H 3BZKA 3Q8DA 1YHQA 2ZTCA 1ASZA 3J81c 2JE6I 1B70B 1IZ6A 1U5KA 1IBKQ 2ZJRA 1Y14B 2R93G 2PI2A 4X62L 4LFAQ 1VQHA 3CCUA 2L15A 3RLFA 3W1GA 3PUVA 2NVQH 4DV1L 3RN5A 2HIVA 5K36G 2E5LQ 3A74A 4A93H 2CCZA 1Q86C 1GD7A 4DR3Q 1L0WA 3NENA 3KF6B 2ZM6L 4LW1A 1RIPA 5IYBH 1N8RC 2Z6KA 4LF6Q 3GTGH 5C4XH 2JA5G 1I50H 1QZHA 4KI0A 1U0LA 3HKZG 4DV1Q 1UE1A 1M1KC 1TWCH 4HJ7A 1P8LA 1MJEA 1CSQA 1NJIC 4JI8Q 3CCEA 4L5RC 1XNQQ 1B8AA 1VQMA 3MEFA 3J80c 3HOUH 5HGQA 4LF6L 3H3VH 3HOZH 4X66L 1QVFA 4PZ7A 5J3BA 3MXNB 3PUZA 3G48A 1FVIA 2ATWA 4UP9A 3G71A 1IL2A 1HZCA 5M3MG 2JA6G 3S1NH 5C44H 2R7FA 2EXDA 2DGYA 4P74A 4YWLA 2YU9H 4JG2A 4B3TL 4WJ4A 2N49A 4BY1G 4JI5L 4QGUA 1W2BA 1XPOA 4LFBQ 2JA5H 3PO3G 4GN4B 3VDYA 3EIVA 2JEAI 3J80i 1A63A 1J5EQ 4JI2L 2NN6G
chains in the Genus database with same CATH superfamily
3HOXH 1SNDA 4P73A 4LF5L 3ULJA 3DLLA 5C44B 4HSVA 1SE8A 4X3SA 1K0RA 4KJOA 5EJWA 3A7LA 4FO2A 1Q82C 4QCLA 2K01A 1EEID 1SEBD 4AIMA 2EPBA 1UE7A 4ZK9B 1J9OA 2HHHQ 3F1ZA 2EYOA 1B2TA 3KYHC 3SVMA 2K6AA 4JI7L 1GUOA 1G2SA 1PFSA 3G6JB 1SE4A 2NVQB 3H91A 4GZYC 4OO1I 3F2UA 1VS0A 3HOVB 5E4WC 1D1KA 2PW7A 3SGIA 1XPRA 3LNNA 2BOSA 4A3EH 4LMQD 4BY7B 1WTQA 4POFA 2R7ZB 4O42A 2FHTA 1VQKA 1N33Q 2B2UA 3FDTA 1STEA 3T13A 4EX5A 4DK3C 2MPMA 4LUOA 1KRSA 1HNXL 3MA2B 1LTBD 3KLSA 5KGUA 2ZXOA 1RTOA 1O7IA 1JOQA 5I9PA 4J15A 1STYA 4QUCA 2JA8H 4F88A 1PVOA 1KNEA 5KEEA 4P2CB 2XN9C 2DN8A 4GOPC 4YHHL 1B9NA 2A6HC 2AHOB 1TWAB 4XXEA 3A55A 1H95A 1D8LA 1C7YA 5BN4A 3I4MG 2SEBD 3GTPB 1VQPA 3ER0A 1EIHA 1PH7A 3HOUG 4B9XA 4XQQA 3EFXD 1DOKA 2L12A 4Y7NH 4IQZA 3P75A 2L4NA 5M3FG 2PQEA 3GTGB 4IALA 3ND9A 1FJGL 2MFIA 1NR2A 2NVYB 1JE4A 3K0YA 1H9RA 2XIWA 4GOPB 3I4MB 4KHVA 2OF1A 1AE3A 3H0GG 3HRZC 5G3LD 1SJHD 1N33L 3DWAA 1CKNB 4YCWA 3PIO3 4PG3A 2ICEC 4O0AA 2JA6B 1DJRD 2PQAB 3HOVH 1Y8NB 4J8QA 1STHA 3T1YQ 3M85A 1KHIA 4BA2I 3NELA 4P75A 2HIXA 2NVTB 3DHQA 2FFKB 4DV6Q 4A3IG 2ZJPA 4R8NA 2EDGA 2R92B 1Q90A 2JA7B 4GNXA 1B50A 3SK8A 3WOEA 4CJ2C 2RBMA 5FJ8G 1XTDA 1B4OA 1CK1A 3RLOA 1R4QB 3KK7A 3MFYA 1DCZA 2A5HA 3K80C 1VQ4A 1TWGH 4V0BA 4FF3A 1RL2A 1SXTA 2XRQD 2F03A 1QG7A 3BJUA 3F2DA 5AFWA 4N8X1 5LL6S 2K14A 3Q24A 5I6WA 1RHPA 3NBHB 3KBGA 3NK9A 2C9OA 1RJTA 3A8KE 1EWCA 3DM1A 5H1SE 1MSHA 4ZLTF 1C9OA 1HQRD 1F2YA 2N8NA 1HR0L 3MXNA 1WYDA 3EVQA 1SLJA 4DF7A 1CUKA 4HN7A 5K5PA 4WJWA 3L3OC 2HDMA 1M8AA 1X54A 4P72A 4G7ZC 1K9MC 2CQOA 2KHSA 5ELDA 4O1NA 1G2TA 2IPKD 4N9PA 1TS3A 1VQ6A 4DV7L 1DM0B 1I3QH 1STAA 3ND8A 1EIFA 1PZKD 2VUMH 5FLXE 2BDOA 2F4VL 4LK1C 1I6HH 2K5HA 2OT2A 5LMUL 1Q3LA 3K7UC 5CV6A 2HCIA 1KLUD 2UXCQ 2AUKA 3OWFA 3T16A 3DWQA 3MXPA 4KD4A 3A54A 2CKZB 5E7NA 2RDGA 3MFGA 4IJLA 1Q1EA 3KFUA 1FR3A 4HMIA 4GNXB 2KEDA 3BDOA 5AJ3Q 3TRZA 3I90A 1VQNA 3ULPA 1WI5A 2CH4A 3STBD 4A75A 3I55A 1NNXA 4PZ8A 5I6YA 3RZOB 3S1MB 1E2WA 2AWNA 3GQBA 2EYPA 4A3JG 3CPWA 1WTOA 3PF4A 4IPDA 1F77A 4NMZA 4WJ3M 2RDHA 3S2HH 2R7DA 1ZYRC 1HPCA 2ICIA 2D9UA 3E0EA 2WB1G 2E2HH 1MKHA 3G4SA 4ZKCB 5D3IB 2A68C 3HKSA 4N9TA 3I4NB 1EUJA 5KYIA 1JR0D 1N32L 4TSSA 1EQVA 2B29A 2F0IA 4JI8L 1A2TA 2F4VQ 1WD0A 4JV5L 1LUZA 4BBSG 2KA7A 5IYDG 3M4OH 2CWPA 3FMCA 1LTAD 3RUZA 2NVXH 1STBA 1MI2A 1L2FA 2ID0A 5JEAG 3H15A 1OXTA 4LFBL 4CDFC 4DR7Q 2A74C 4C3JH 4IPCA 3TP7A 5F2DA 4JI0Q 4LF8L 2BH2A 3R2IA 4O2DA 1AZPA 5IY0A 2V4DA 4JOIA 4FXGC 2Z4HA 4CKBA 2K03A 2E2IH 1TWHH 3K7AH 3E9HA 1VMCA 3I2ZA 4L6TB 1SNQA 5LMNL 1XNRL 1AE2A 3P7JA 2Z9HA 2Z8LA 1RCVD 1S40A 3H0GB 5GROA 2ZTDA 2DNCA 3ICEA 1SNOA 1HXYD 2VY3A 1HUNA 5C3EH 1BDOA 1E7ZA 2E2IB 2NZOA 4G4KA 3ZJYC 1BCPD 5D14A 4JPBW 1VQ9A 4DV0Q 1QJOA 2WAQG 2EY6A 4C3HH 1PH6A 5CBAE 4A3CH 4A4IA 1C8CA 5DNFA 3S14B 3MVVA 3CC7A 2KCTA 5CV8A 5GAGC 2JA7G 4YWKA 3OW2A 3VR5A 2QDLA 2N55A 4P71A 4RCOA 5CMDA 1B3AA 1VMPA 4IPHA 1Z9FA 4A3IB 1KD1C 3ITPA 1F2LA 1JORA 4LF7Q 1PYSB 1JCKB 1GUNA 1EY6A 1PMRA 2RCNA 4HIKA 2F0NA 4CKEA 2O5IC 3A5ZB 4OONA 1WOCA 1VQGA 2IW3A 4KD3A 4OX9Q 4DUZQ 4C3IB 4POGA 1JE5A 3TQYA 3PIPA 1IBLQ 3GTOB 1VF7A 4K8JA 1L0XB 2VQFL 5JPNC 4DR3L 1GHKA 1HZ9A 4GKJQ 4GN5A 3DEOA 2ZXRA 4B3MQ 2B2YA 1A8VA 1PRTD 2E8GA 4DAYA 1OXVA 3F2BA 5C4ZA 2LXJA 1EIYB 2A69C 4LF4Q 1RF2D 3HS0C 4BBRH 2B2WA 4IUUA 1K83B 1SMXA 4F7XA 4OWXB 4A3KG 1JOOA 2KHIA 2E75C 2DUDA 1QNUA 4FF1A 3PCOB 3HOWB 5DLQE 1DOLA 3I4LA 1JOKA 3GO5A 1BKBA 3GTLH 2LMCB 1VQ8A 2EJMA 1LTTD 1HQMC 5FO7B 3Q8DA 2ZTCA 2FJ2A 3J81c 1IBKQ 1U5KA 1I6HB 2ZJRA 2PI2A 3T53B 1ZEQX 1VQHA 4LFAQ 3S17B 3CCUA 4FVMA 1WD1A 2HIVA 5DM73 5J39A 2CCZA 4A3MB 1EEFD 2E74C 3SDZA 4DXGA 4DR3Q 2IX3A 3KF6B 1YNJD 2KCCA 2Z6KA 5C4XH 1BNZA 4ZQ3A 3H09A 4DV1Q 1TWCH 1BQQT 1P8LA 3QOLA 1CSQA 1A15A 3V2TA 2MHVA 1B8AA 3P1HA 3MEFA 3HOUH 3GV3A 4AYBB 1QVFA 2K04A 1PXUA 4C1NK 4CJ1B 3DEPA 3PUZA 2WIIB 1U4LA 3G71A 5M3MG 1SNMA 2HD3A 5M5WB 3I73A 4YWLA 2YU9H 4JG2A 2LS01 3FEWX 1HFNA 4JI5L 4QGUA 1IKLA 3VDYA 1A63A 2RCFA 2IJ0A 4ULLA 3QOJA 1ENFA 5JOBA 4H7BA 4L5SA 2XNAC 5M5WH 3A8JE 1Y1WG 1LABA 4DAYB 1E0BA 3GDEA 2B2YC 4EQOA 1STGA 1TY2A 3TDQA 4DR5L 4J1MA 1J5EL 1EY5A 3W1BA 1N9WA 4X64Q 2M2LA 4B3RL 1ZKOA 1Q12A 3DUZA 1FNVA 2Y0SG 3R93A 5I4DA 4EQPA 4ODGA 3HOXG 2LFNA 1I4RA 2Y0SB 2NYZD 1Z47A 3LWEA 1IBMQ 3NE5B 5JJKA 4QJFA 1D7QA 1U9RA 2F0QA 2AQ3B 3SE0A 4XQJA 4IOAA 4X65Q 1EOVA 3CC4A 1CKOA 3NPPA 4DPGA 2FMCA 1VQAA 3KOJA 3CW2C 3S1RB 3SK5A 4JBMA 4HTHA 3QJYA 4KV6A 4K0KQ 1YNNC 2Z1CA 3K8AA 3HKZB 4OELB 3L7ZC 4JCVE 2B2WC 3GTLB 5M9OA 2K5NA 3PIOA 5TSSA 1HA5A 2TMPA 2D0PA 3RZDB 3CAMA 3I4MH 1ML0D 1VF5C 3J7ZC 4R1JA 3M4YA 3S2DH 1SNPA 3R8BA 2K5DA 4FF4A 1HZAA 2LSSA 2UUAQ 3I4NG 1FL0A 3K6OA 4KN4C 3H3VI 1G8ZD 1NAPA 2JXMB 1LTRD 3S1QH 4JBKA 4X64L 1KLGD 2LXKA 2WB1B 3TP5A 5HURA 1JJGA 1GVPA 3UDGA 2K5WA 1VQLA 4QY7A 4IFDI 2Q2IA 2QILA 5KNDA 3GTQH 1I4PA 1EQQA 3UDFA 4A3JB 2IT1A 4A3MG 2F0UA 5JVG3 1CHQD 4C3IH 1QWYA 2E2DC 3HOZG 4XT3B 4HCEA 3FPUB 4JI6L 4X66Q 1VCIA 1SYEA 1V1QA 1IYUA 4JK1C 3TZDA 3BZCA 1I5FA 4DK6C 4A3IH 1E1TA 4GLAC 3TREA 1QOHA 5C4JH 1A2UA 3CCMA 2NN6H 1WTWA 2PNRC 2Q2TA 1EU3A 1LTID 2OQ0A 3JAMi 3S14H 3VYUA 3J81E 3J7AV 3AMUA 3T56B 2QEJC 1NUCA 5JJLA 5IIFA 4CDDC 2J4XA 3AYHB 4GS3A 5CV5A 2F0SA 1Y8OB 1F9SA 1FYCA 3GTJB 4A3GB 5C3EB 1W3SA 5DM63 1EU4A 2OTJA 3T1HL 1YNJC 4IPGA 5ELCA 2F3WA 3PUWA 4OIJA 4G57A 1XNQL 1HCZA 1JJCB 1OXSC 3K81C 2F0HA 2UU9L 4F8MA 2R7ZG 2B63G 2MQHA 1C48A 2PO4A 2ZTEA 3BDLA 4A3BG 1SYDA 3M4QA 2B2VC 3HOVG 1A3UA 1K28A 5IGEA 1ONLA 1V1PB 1EIGA 4R9WA 1YJ9A 1NBWA 5D65A 1HNWL 4A3EG 1CFMA 2HQEA 4JI2Q 2DJGC 1G91A 4FP5D 2C5CA 4HIOA 2I07B 4JOIC 5CYUA 2PMZE 2YU9B 4JI3Q 3J81i 4C1NI 2BA1A 1L0YB 1SYBA 3PQIA 2H5XA 3PO2H 3VR6A 4LF9Q 3GTMB 1MBYA 3HOZB 1KDAA 1EFWA 1HFGA 4R4QA 4DV6L 1ICWA 1PTOB 1TIID 2MP1A 3E9IA 3FHWA 2EY5A 3T4AC 3VA7A 1A62A 2UUBQ 5C5MA 3I4OA 1V1PA 3KLSX 5C0XH 3MAQA 4HJ9A 2MO1A 4DV2Q 4XTCS 2F0FA 4DR2L 5M3FH 2K52A 4UAIA 1L1OA 2JEBI 3KUPA 4A3CG 2PZUA 1KL9A 2O5JC 5IOCA 3FKIH 2C35B 4KY5A 3GD7A 4RCNA 5KYLA 3S16H 5C0XI 1T9HA 1YI2A 4DV5L 1K0SA 4L5TA 3E3XA 4UP8A 2BA0A 5T1IA 3HOWH 1H9SB 4B3SQ 3S15B 1W6JA 4LWCA 1UE6A 5GAHC 1TWFB 3HOYB 4DR1L 2EVBA 5IT9E 3RNUA 2J7ZA 1K83H 3BYTB 4KLKA 1Z6HA 4YHHQ 3E0JA 1B44D 1X56A 2KENA 3D6WA 1SN8A 3E6ZX 1PRTB 2TSSA 4Q5VA 3ERSX 3VR3A 1KQSA 1GUGA 3MXGA 2PW5A 3M7NA 2YV5A 1PTOH 3UI2A 2F1MA 3I70A 1LTSD 1EZ8A 2PI2E 2K75A 5IGFA 1EQRA 5HGTA 1EY8A 3PGZA 2EOTA 3D31A 1S5CD 5JPMC 2CW0D 3V96A 1DGSA 1DONA 2SOBA 4DAVA 4EGVA 3QG1A 2UUCQ 4TVAB 3CF5A 1GHJA 1LACA 1STNA 5IP9G 4GNXC 1VQ7A 1OXUA 1XWEA 4DV3Q 3DMUA 1D5MC 5BR8Q 2CHBD 3TMEA 1G291 1BF4A 4WFN3 5A2QL 1K8MA 4KTAA 1VDZA 4FDBA 2QCPX 2F0OA 1IYVA 3I8ZA 1Q7YC 1MSGA 1UEBA 1G6ZA 4XYOA 5C3WA 3OSOA 4IO9A 1PH4A 1WTXA 2L55A 5IYBG 1EYCA 3OMCA 4F87A 1I4HA 4DUYL 3BVZA 2R92H 1LM0A 3K7AB 1KRTA 1TWHB 1BR9A 1Q1BA 3STBC 1CQFA 4C3JG 2AWOA 1O78A 1XNRQ 1XJVA 4BA1I 4QB4A 2WFWA 1JC7A 4FXDA 1YEZA 3MEHA 5L37A 1ZXTA 2JA6H 1Y1WB 1E24A 1YNND 2ALYB 3RD4A 1Q8KA 2VXWA 5EKKA 3M4OB 5E3FA 5IWAL 4M8AA 3H3VC 1VQ5A 1L1OC 3M9BA 1E3PA 2XTIA 4ZCKA 2A73B 3TS2A 1KAWA 1X3FA 5LHY1 2QGQA 2A6ED 1VQOA 4FYDA 3CHBD 1EY4A 4X62Q 5IT9c 3M7GA 1LT5D 3U4ZA 3FP9A 2IX0A 5IYCH 4RMFA 1WCMH 3EBEA 2E5LL 4A3JH 1HNZQ 1L1OB 3KBXA 5JAVA 2K7VA 2XVSA 1D2BA 2Q2UA 1YITA 4MTKA 1R9TH 2B8FA 1IXRA 2EYFA 1EOTA 3NUCA 3OTOL 2RQXA 4QF4A 3RZOH 1IHZA 2DY8A 1KDCA 4DR6L 1XYIA 3F8TA 4NKLA 1TWFH 1ZYRD 3L2PA 2JQOA 3HFZB 1A0IA 4NW2A 2VNUD 3AQQA 1JT8A 2AUJD 3FKIB 1PTOF 2B39A 5T1GA 2UXBQ 3NWSA 1F9RA 4BXXG 2F0EA 2K28A 4BBRG 4A3EB 1BO0A 1I4QA 3BZKA 4BY7H 2JE6I 5BN3A 1Y14B 2WV6D 3J80E 4A3KB 2D2CC 2VUMB 3HP3A 4PMCA 3IAYA 1I3QB 2B2UC 3VA5A 1H9SA 5K36G 2KOLA 2E5LQ 4A93H 1GD7A 3AB9A 4K8IA 2G9HD 2ZM6L 4LW1A 1RIPA 3JAME 4LF6Q 4DGZA 1SDFA 4KKUA 2JA5G 1I50H 3I91A 3OHXC 1QZHA 1U0LA 3IFDA 1NJIC 4JI8Q 2KJXA 3I72A 3BVMA 3URYA 2F0VA 1F9PA 2RDFA 3H3VH 3HOZH 4X66L 3K5LA 3G48A 1RKNA 4ZAIA 1SFOB 1HZCA 2MGSA 1AEXA 2QF7A 2EXDA 1EL0A 1PRTC 2QKIC 2F0GA 4B3TL 2OEOA 3ZYYX 4WJ4A 1XPOA 1BBXC 3X3MA 1JWMD 3SXHA 2JEAI 3J80i 4ID6A 2UXBL 1TT2A 3VYSA 4HIMA 4I7ZC 1PH1A 2UXDQ 3S1NB 2XWBB 2PPBC 3D0FA 4Q0FA 2WAQB 2NWGA 3HOUB 3J7YW 5C3XA 3MXUA 4OO1G 2L5TA 1GXDC 1TWCB 4DA2A 2NN6I 1Q81C 5ISRA 2EZVA 1EFID 4PZ6A 3MZ5A 2ZJQA 4DR5Q 2GN5A 1YVCA 3OYYA 3QWNA 1Y1VG 2JP1A 3CCSA 1PFNA 4A93B 1XMQL 3W3AA 2MO0A 4B3RQ 2AQ2B 2OQKA 1CSPA 1YBYA 4DNRB 4A3KH 1V1OA 4HR7B 4L5QA 5GAEC 3BS1A 4LNQA 1XPUA 4LJZC 2PYKA 2IX1A 2RA4A 3A56A 1Q8IA 4IUVA 3NWTA 1VQJA 1X3PA 1DYQA 1A3TA 4ZUJA 5FLXL 3K0XA 1B3QA 2WAQE 1VQIA 2NBFA 3Q6SA 3K5MA 4DKAC 1U4MA 4L8JA 4G7HC 3AFQA 2K5VA 2N78A 5LMNW 1UE5A 3PO2G 3MC0B 4K5WA 2EYHA 4MZ9A 4AYBG 4C56C 4AQYL 3A5UA 1YHBA 5C5LA 3TZUA 3TP6A 2GVAA 2V1CC 1P16A 1EYDA 4R4OA 4TQUS 1GM5A 2K32A 1YZ6A 4IUQA 2F0PA 5BN5A 2K5QA 4NXML 3FVQA 1WCMB 2DJFC 2OTLA 4GLVB 2JA8B 4OWWB 1DOMA 1TXYA 2BE5D 1J8IA 2LY7A 2JA9A 1G6PA 2R93B 1XTCD 3K59A 4YY3L 3MTSA 2F0DA 5COYA 1WTPA 1I6VC 2F0MA 3NEMA 3V05A 1GUWA 2D5DA 1QZGA 1S4ZA 1SBBB 3EJIA 2RSOA 1CQVA 4DAPA 5IGBA 4BY1B 4JI6Q 5DAUA 1FJGQ 1JWSD 2A6HD 2A68D 2R7ZH 1Y1WH 2B63H 4KJNA 1T5XD 5M3MB 5LL6X 1XMOL 1HRJA 2XSCA 4A3BH 3F2CA 3H6MA 3A7AB 1ESFA 4K2LA 1QILA 2F4IA 4WORA 4Z9CB 3U9SA 4EVOA 3CCQA 5CV7A 1YJWA 1HTPA 3IKJA 3D8GA 1A3VA 2B2TC 5KNCA 3JAMc 1JICA 1PHJA 2IHEA 4FF2A 2XGTA 1JB3A 5I2XA 4MIUA 2EYLA 4DV4L 1CKNA 2CWAA 1QNKA 2K05A 4K5XA 3K57A 1I4XA 3DXJC 3CMAA 1KC8C 2PZTA 4RG1A 1PH5A 2SNSA 3SEBA 1DZ1A 2IWHA 4IUTA 3VYRA 2PNHA 4JBJA 4PQXA 4NXNL 4H02A 1C4QA 2PQAA 1K3BC 1ESRA 1RD9D 2MUYA 3QB3A 4JVZA 2HQLA 2JA5B 1SMYD 2I0QA 3CCJA 3KF8B 3OPOA 3A0JA 2KBNA 4RGNA 4UP7A 1LT6D 5ELFA 1O7ZA 3JAML 5ELBA 5C0XG 1TVXA 5IP7G 4LAAA 5M5YB 4GOPA 1QB5D 1H9KA 2HHHL 1JQYD 3I4NH 4PMBA 2GVBA 3W5OA 1BXTA 1TU2B 4JYAQ 3TP8A 3RLNA 3VR4A 1MD2D 2EJGC 5IE8A 4JI4Q 3S2HB 1SR3A 4GLXA 4KMUC 4A3FB 3AFPA 3OIQA 4B08A 5CGKA 4X65L 4MNOA 2R92G 4DV4Q 3GTKB 2NTTA 3BZDB 4A3MH 3S1MH 3AU7A 4C3IG 2B3GA 3UDIA 2JSOA 4CHTB 5FOBB 2DY7A 4E6IA 2J0TD 5DEHA 4C2MH 3IRBA 4OWTB 4R4CA 3U50C 4GKKL 1HNWQ 4IFDG 1SE3A 2YYZA 1CZWA 4S3SA 1WTVA 4OGQC 1ASYA 2KQ3A 4A3FG 3S16B 5M5XH 4PV1C 1D1IA 1DD2A 3CMEA 5NUCA 4A3DH 2E2JH 4CKCA 2Z6BA 1TS5A 5M3FB 3HOYG 2CW0C 1PV4A 4DV5Q 3SHLA 3CCRA 2FMMA 4BBRB 4JYAL 3GTKH 3GV6A 3SR1A 3FKIG 3HGBA 4LF4L 1E22A 1H9MA 3H94A 4UHVA 1KDBA 3GP7A 5D3DA 1FNUA 3NSWA 1D5XC 3QO2A 2M00A 3GTOH 2EY1A 2A8VA 4DR6Q 3NQIA 4CJ0B 1BCPB 3CU7A 5ELOA 1II3A 3ULLA 1CM9A 3KF8A 1N36Q 1ENCA 1QVCA 3P20A 3UE1A 2IL8A 4HJ5A 3U9OA 2FINB 1K8AC 1JB7A 5KRUA 1S5DD 2BDNA 3WOFA 4DNIA 2IHFA 4LF8Q 1S3OA 2I5LX 1RTNA 5JVH3 4MHEA 1WJJA 3FRPB 4LUZA 4ZKBB 3LGJA 2WACA 1NMFA 3J81j 4XYQA 3NHHA 4RA8A 5FKAC 1B9MA 2ASBA 1BCPC 4JV5Q 3M3YB 2A69D 3G6EA 4A3GG 4KHPL 4BY7G 4JI1L 4ME3A 1IKMA 2VQEQ 4M1UB 2BH8A 4HEDA 2JYOA 4FXKC 5GQOA 1TWGB 4GN3B 1HR0Q 4H44C 3HEJA 2UUCL 1O80A 2N88A 4RFBA 2VB2X 1QE6A 1CKMA 2VZAA 5EGTA 3OWEB 1JJ2A 5K36H 3C2PA 3MWYW 1R4PB 4DV3L 1UEAB 3LWUA 3UE0A 1CA5A 4CDCC 2CQAA 2VS1A 1SNCA 5FLMH 4JI0L 2P5ZX 3CXCA 2JJQA 3D4DA 1DXMA 1ICFB 1PA6A 5IP9H 3BVGA 3M4PA 1WFQA 4ABNA 3HG9A 5JJIA 2RSNA 4DV7Q 4R8IA 3NTIA 1RDPD 4JI7Q 4B3TQ 3R3OA 5C44G 3C3LA 2L11A 4HAEA 4JI3L 3TS0A 1MIUA 2NVXB 4BY1H 4DAMA 4KY7A 4XIGS 4CDEC 4X3UA 1SE2A 1LLRD 2UXDL 3HOWG 1F9QA 1MGSA 3MHBA 3CRKC 3L0OA 4CGYB 1YHAA 4RWSC 3GTGH 2N3SA 3CD6A 2I5MX 2VQEL 4MN3A 2ZT9C 4NDXA 3RR5A 1HA6A 4ZYSA 4UY8C 3GTQB 1TWAH 2EE1A 3UDXA 1K8OA 4RHRA 3OMGA 5I9OA 4DV2L 1AZQA 2X6GA 3WWVA 1ET6A 2HT1A 1LTLA 1QUQA 4DR2Q 3PUXA 3OW7A 3S1QB 1BBWA 3D3RA 2AQ1B 2NZ1D 1PTOC 1WCMG 3A8IE 1N32Q 1U4PA 1KXLA 4YWMA 5JJZA 3OTOQ 4BS9A 4UDUC 4A93G 1A6XA 3K58A 4CBVA 3CQZB 3Q0AA 1CI3M 3CC2A 1NTGA 1M4VA 4DR1Q 1VQEA 1AH9A 1CHPD 4JBWA 4KK7A 1I94Q 1JWUD 1C0AA 4RKLA 1NE3A 3BU2A 1IZ6A 1GUSA 2K1BA 4X62L 2QW7A 2L15A 3RLFA 2NVQH 3RN5A 1D5ZC 3A74A 1Q86C 1L0WA 3K5OA 3NENA 5IYBH 4IUPA 2LKVA 4L63B 3D4RA 1TS2A 2KUMA 2ZXPA 4KI0A 4NP5A 1M1KC 4HJ7A 1O7YA 3CRLC 3CCEA 3VYTA 4XT1B 1VQMA 1SYCA 1KNAA 5HGQA 2KEEA 1SYFA 4ME5A 5J3BA 3MXNB 1Y8PB 4UP9A 5FO9B 1IL2A 2X6LA 2EYJA 1Y69U 2JA6G 3QR8A 3S1NH 2DGYA 4PNYA 4P74A 1PZJD 3C1FA 2N49A 1W2BA 4LFBQ 2JA5H 1J5EQ 4EQNA 3QIAA 3FPPA 4H0LC 4LFCQ 3AEVA 2SDFA 1I94L 3J7AF 4IJHA 1HNXQ 1SFOH 3N52A 5FLXc 1GO3E 2MJ8A 3NTHA 4JI5Q 3ONAB 4XDXA 4LF7L 5LMNQ 4A3LG 3EA6A 1PDQA 4DK1A 5IYCG 4IOCA 5CR3A 4K6LA 3T1HQ 4PMWA 2OCEA 4DUYQ 1EYGA 1IBLL 2K33A 1Q46A 3EN2A 2VQFQ 2ZM6Q 1I50B 2XWJB 4AYBE 5C4XB 1EY9A 1MHWC 2QDBA 2YTYA 4DV0L 1GKHA 3K5NA 4H13C 3KJPA 1BBUA 1EZ6A 1YJNA 3GTJH 2BCOA 3U4VA 3E5SA 2D62A 3CCVA 1X55A 2KECA 3KDFB 1BCPF 4OHJA 3C1EA 1YIJA 4Y52H 4DU9A 3S17H 5EQ0A 1X6OA 4DN4M 4NXNQ 2B63B 1PFMA 1H9JA 5IWAQ 3I56A 1CTMA 5CC4A 2WP8J 1S72A 1GOZA 3IFTA 3CPFA 1RODA 1SRUA 2RF4A 3CQZH 1EWHA 1KTKA 4TKOB 3PO3B 1IW7D 1F2ZA 1UUPA 1N34Q 4BXXH 5IGDA 4OX9L 1HHVA 2AKWB 4MTNA 4DUZL 2R93H 1KABA 2RVLA 1SAPA 4NPSA 1PH8A 2A6EC 4QIWB 5IP7H 3KDFA 1SMYC 2VW9A 1AN8A 1S5BD 2K4KA 3EQLC 1AP0A 3S24A 1KAAA 3PF5A 2Y0SE 3SK6A 1PFBA 1K8GA 3GTPH 2XRSD 1AW7A 1K73C 1F2MA 2HUGA 1SROA 2CVRA 1VQFA 1O7LA 1QVGA 1XXGA 2H1EA 2O4XA 2PZWA 2EIFA 3HKZE 4HMJA 1HTLD 3PV0A 5J1ZA 2F0KA 2F3VA 2JA8G 3S2DB 2CFMA 3VR2A 2FXQA 3G7LA 2M9VA 3LX0A 4IFDH 4JC0A 2BE5C 1W6KA 4QIWE 3PO3H 3T51B 3T1YL 1UNSA 2Z4IA 4B9WA 5CV4A 5FJ8H 2Z6KC 2WB1E 4R4IA 4AH6A 3S1RH 2F52A 4IZ8A 4A3DG 1FGBD 4RH6A 2D0OA 4RGTA 1X3GA 2Q8IB 4U673 1V43A 1WVLA 2ES2A 3C46A 3W2DA 5HY6A 3Q23A 4DR7L 3BDCA 4OO1H 2SNMA 1XMOQ 1ET9A 2KHJA 3H0GH 4G7OC 5A2QE 1CT1D 1OXXK 4K5VA 1Y1VH 3TBIB 1NSNS 5C4HA 5IODA 4BBSB 5A35A 4DK0A 1WTHA 4OEMB 1PH9A 1PYBA 2R3ZA 5E4XA 4YCUA 2NUCA 1OO9B 1J6QA 4ILWA 2UU9Q 4YY3Q 4WRDA 5IGGA 4X3TA 5E1FA 1G51A 3KF6A 1LO5D 1E1OA 1T5EA 2B8GA 3HZXA 2A1AA 4JI1Q 4HCSA 4QL5A 1PH2A 5AJ3L 3NQTA 2KCNA 2UUBL 3R2TA 2G5DA 2EQSA 2O2LD 2RHSB 2QA4A 4FNFA 2JN4A 1TKWB 1GUTA 3PMFA 1UAPA 3I7FA 4RGMA 3KJOA 4UPAA 2F0LA 2UUAL 5EPKA 4HJAA 1IBML 3X3NA 1TR5A 5FK9C 5EKLA 2NB0A 4KN7C 2ENBA 4KKTA 1K3RA 3TN2A 5C0XJ 2UXCL 2PCFB 2IY5B 2R61A 5I2YA 3EROA 3SK4A 1EY7A 3NBIA 1NR4A 1B1ZA 1NMGA 1HR0W 2E76C 4LUVA 3HOYH 4C3HG 2E2JB 2PMZB 3DWPA 5C6AA 2WKCA 3OIPA 2WKDA 2EXZA 4BWGB 5M5XB 1LYLA 1MJCA 1X32A 4QMGA 2R6GA 5FO8B 3L9AX 1IYJB 1IW7C 4NB3A 2NZHA 4JW0A 1BVSA 4TRDA 4X6AH 4OXPA 2VUMG 4C2MB 1UWVA 1V8QA 3BYYB 4N8FA 5GADC 1TQOA 1HNZL 2L0CA 4ALPA 5KIXA 1HJPA 1R9TB 1V9PA 2B2VA 4IUNA 2G9DA 4A3FH 3O13A 3PUYA 2OWOA 4JI4L 4QQBX 1LTGD 4DR4Q 2HCCA 1ILPA 1EY0A 2F0TA 1WTRA 1EWIA 1BOSA 2K50A 3B6YA 3CKIB 4EQ5A 5JEAH 1ENAA 2CH4W 1XX8A 1JMCA 3GTMH 4DNTB 5EPJA 3PO2B 5M5YH 1BUVT 4RAUC 1U4RA 4K2KA 5EPLA 5BR8L 3WDNA 1PLFA 1TY0A 2WINB 2VL6A 2B2TA 5IGCA 1PZID 5CV9A 1NY4A 1HH2P 1OTCA 1SSOA 1VQCA 4K14A 4C3HB 2F0WA 2EJFC 3NXWA 4APVA 1TS4A 4K6DA 4YCVA 5EAYA 2Q8TA 2L9HA 1FNWA 2F3IA 1VQDA 5KNBA 4BBSH 3NTKA 2H4OA 1Y1VB 4HJ8A 5IYDH 2L1BA 4KKSA 2KCMA 4XQNA 2JA7H 5C4XG 4DR4L 4IFDJ 2OXPA 2GA4B 3IL8A 1ILQA 3TSSA 3RMHA 4A3GH 1LV9A 3BG3A 1HZBA 1X3QA 2NVTH 4HIDA 4DFAA 3DM3A 3RN2A 2A19A 3N6RA 1N36L 1HUMA 2YTXA 4C3JB 4KHZA 4A3BB 5M3MH 1CA6A 3M3YH 2Q8RE 1PRTF 5LMUQ 5IT9L 5CBEE 4J6HA 3S9WA 3J7A5 5FLMG 1LT3D 4KY6A 4ZUIA 1YNXA 4LFCL 1PH3A 5C4JB 4K0KL 3KLWA 4LF9L 1X3EA 1QUQB 2NTSA 1EYAA 1IL8A 4R4TA 5C3EG 1PTOD 2AMCB 2X69A 4I7AA 2NVYH 4GKJL 4KHPQ 4B3ML 2HDLA 2MNAA 1B7YB 4Y7NB 1AFPA 4DXFA 4A3LH 1FGUA 5EBDA 3JC66 2F0JA 2E2HB 4A76A 3KLRA 2EYMA 5CORA 4AQYQ 1NCVA 2EY2A 2Z0SA 3NBHA 3PSIA 5ELNA 1XMQQ 3CCLA 1M90C 1QCBD 1X65A 4GKKQ 2YTVA 1KIXA 2QEXA 1I4GA 5J22A 3D6CA 4NXMQ 3OOCA 1SYGA 2Q2HA 3D4WA 1X9NA 4A3DB 4RHSA 2RKSA 3TEHB 4V190 3S15H 1Z7TA 1IBKL 4B3SL 3RZDH 5G3LF 1GJXA 1LT4D 4IN3A 4LFAL 2JK8A 1N34L 1S5ED 4RGOS 2I5HA 5JEAJ 1B53A 2RHQB 4LF5Q 1VQBA 4ZRZA 3U58A 3CP0A 1YHQA 1CZGA 1S5FD 1ASZA 3ERQA 1B70B 2R93G 4HSPA 4QUFA 3Q22A 3W1GA 3PUVA 1SJED 4DV1L 1PYWD 3NP8A 4U68A 5EBCA 4OIKA 1N8RC 2DNEA 4IURA 3PIP3 3HKZG 1UE1A 1EQTA 1MJEA 4L5RC 4I65A 3J81L 3J80L 2VB3X 1XNQQ 4OL7A 1D6EC 3J80c 1FD7D 4LF6L 1E2ZA 5EKIA 4PZ7A 3I3CA 2ATWA 1FVIA 4RKBA 5C44H 2R7FA 1E2VA 2I46A 4X3KA 3HOXB 4BY1G 2KVMA 3PO3G 4GN4B 3EIVA 5ELEA 4JI2L 2NN6G 4YIJA
chains in the Genus database with same CATH topology
3HOXH 4LFCQ 2UXBL 4P73A 3AEVA 1I94L 3ULJA 4LF5L 4L5SA 4IJHA 3DLLA 5M5WH 4HIMA 1Y1WG 1PH1A 1HNXQ 1SE8A 4DAYB 3GDEA 1K0RA 1SFOH 2UXDQ 5FLXc 1GO3E 4JI5Q 3D0FA 1Q82C 4DR5L 4LF7L 5LMNQ 4A3LG 1J5EL 5IYCG 4IOCA 4AIMA 3W1BA 3T1HQ 1N9WA 4PMWA 4OO1G 2OCEA 4X64Q 4DUYQ 1UE7A 2NN6I 4B3RL 1EYGA 1IBLL 1Q81C 1Q12A 1Q46A 2Y0SG 3EN2A 3F1ZA 4PZ6A 2ZM6Q 2VQFQ 2HHHQ 4AYBE 2ZJQA 4DR5Q 2YTYA 2GN5A 3KYHC 3HOXG 1GKHA 1YVCA 4DV0L 3OYYA 3KJPA 1BBUA 1Z47A 1Y1VG 3CCSA 1YJNA 1IBMQ 4JI7L 5JJKA 4QJFA 1XMQL 1PFSA 1D7QA 3GTJH 2MO0A 3U4VA 2D62A 4B3RQ 3CCVA 1X55A 1YIJA 3KDFB 4Y52H 2OQKA 4IOAA 1CSPA 4OO1I 1YBYA 4X65Q 1EOVA 3S17H 1VS0A 1CKOA 4L5QA 5GAEC 4A3KH 3CC4A 3SGIA 4DPGA 4LNQA 1VQAA 1X6OA 1XPUA 3KOJA 1XPRA 2IX1A 3CW2C 4JBMA 4NXNQ 4A3EH 4K0KQ 1VQJA 3K8AA 4POFA 5IWAQ 3I56A 3L7ZC 4JCVE 2WP8J 1S72A 3K0XA 2K5NA 3CPFA 1SRUA 2RF4A 2WAQE 3CQZH 3PIOA 1VQKA 1VQIA 4LF9L 1N33Q 2D0PA 3CAMA 1N34Q 4BXXH 4DKAC 4EX5A 4DK3C 4LUOA 4OX9L 3I4MH 1KRSA 2AKWB 4MTNA 4DUZL 2R93H 3AFQA 3J7ZC 4R1JA 1HNXL 2K5VA 4NPSA 1PH8A 2N78A 5LMNW 1UE5A 5IP7H 3S2DH 3PO2G 1O7IA 3KDFA 2VW9A 2K4KA 1HZAA 2LSSA 4J15A 4MZ9A 3S24A 4AYBG 2UUAQ 4AQYL 2JA8H 3A5UA 3PF5A 3I4NG 1YHBA 1FL0A 2Y0SE 3H3VI 1PVOA 1K8GA 3GTPH 3S1QH 4JBKA 2GVAA 2V1CC 4X64L 1P16A 2LXKA 1JJGA 1K73C 4R4OA 4TQUS 1GVPA 3UDGA 1GM5A 1VQLA 4GOPC 4QY7A 4YHHL 1YZ6A 1SROA 4IFDI 2AHOB 2Q2IA 1VQFA 3GTQH 1EQQA 1QVGA 4NXML 1D8LA 1C7YA 1H95A 3I4MG 3UDFA 2IT1A 4A3MG 1VQPA 2EIFA 3HKZE 2OTLA 3ER0A 4C3IH 4GLVB 1PH7A 3HOUG 3HOZG 4OWWB 3PV0A 1TXYA 4Y7NH 2JA8G 2CFMA 5M3FG 4JI6L 4X66Q 1FJGL 2JA9A 2MFIA 1VCIA 1G6PA 1V1QA 4YY3L 2FXQA 4GOPB 3BZCA 1I5FA 4DK6C 4A3IH 3NEMA 4JC0A 1E1TA 1AE3A 4GLAC 3TREA 1QZGA 4QIWE 5C4JH 3PO3H 3T1YL 3H0GG 3CCMA 4JI6Q 2Q2TA 1N33L 1CKNB 2OQ0A 3JAMi 1FJGQ 4YCWA 3S14H 5FJ8H 2Z6KC 2R7ZH 1Y1WH 4PG3A 4O0AA 2B63H 1XMOL 2WB1E 4R4IA 4AH6A 3S1RH 4A3BH 2F52A 5JJLA 3F2CA 2PQAB 4A3DG 3AYHB 3HOVH 3T1YQ 3M85A 1KHIA 2D0OA 3CCQA 1X3GA 1YJWA 3NELA 4GS3A 4BA2I 4P75A 2HIXA 1V43A 4DV6Q 2ES2A 5HY6A 4DR7L 4A3IG 2ZJPA 1W3SA 3JAMc 1XMOQ 2OTJA 3T1HL 4IPGA 2KHJA 3PUWA 1PHJA 2IHEA 3H0GH 2XGTA 4GNXA 1XNQL 1JJCB 1OXSC 1OXXK 3K81C 1Y1VH 2UU9L 4DV4L 5FJ8G 2R7ZG 1XTDA 1CKNA 2CWAA 3RLOA 2B63G 2MQHA 1PH9A 2ZTEA 4A3BG 1PYBA 3M4QA 3K80C 1VQ4A 1TWGH 3HOVG 4YCUA 3CMAA 1KC8C 4RG1A 1RL2A 1PH5A 1J6QA 1YJ9A 1NBWA 1HNWL 4A3EG 2UU9Q 3BJUA 4JI2Q 4YY3Q 3F2DA 2PNHA 4JBJA 4NXNL 2K14A 4H02A 2PQAA 1G51A 3KF6A 1E1OA 4HIOA 2HQLA 3NBHB 4JOIC 2I0QA 3CCJA 3KF8B 2A1AA 2PMZE 3A0JA 4JI1Q 4JI3Q 5H1SE 3J81i 2KBNA 4UP7A 4QL5A 2BA1A 1PH2A 5C0XG 5AJ3L 5IP7G 1C9OA 2H5XA 4GOPA 3PO2H 2N8NA 2UUBL 1HR0L 4LF9Q 2EQSA 2RHSB 1WYDA 2QA4A 1SLJA 2HHHL 3I4NH 1EFWA 3I7FA 2GVBA 4R4QA 3W5OA 4DV6L 4JYAQ 3KJOA 4UPAA 1CUKA 2UUAL 3RLNA 3E9IA 3FHWA 4HJAA 1IBML 5IE8A 4JI4Q 1SR3A 4GLXA 1A62A 2UUBQ 1X54A 4P72A 3I4OA 1K9MC 2CQOA 3AFPA 4X65L 4MNOA 2R92G 4DV4Q 1K3RA 5C0XJ 4A3MH 3S1MH 2UXCL 4HJ9A 4DV7L 2B3GA 2MO1A 3UDIA 1VQ6A 1I3QH 2IY5B 4DV2Q 1EIFA 4XTCS 4DR2L 2VUMH 4C2MH 5M3FH 2K52A 1NMGA 3IRBA 4OWTB 4R4CA 4LUVA 3U50C 1HR0W 1L1OA 2K5HA 2F4VL 3HOYH 2JEBI 1I6HH 1HNWQ 5LMUL 4A3CG 4IFDG 3K7UC 1KL9A 2UXCQ 2YYZA 1LYLA 1MJCA 3FKIH 2C35B 1ASYA 3GD7A 4A3FG 2CKZB 5E7NA 3S16H 2R6GA 5C0XI 1T9HA 1YI2A 4DV5L 4L5TA 4IJLA 5M5XH 1IYJB 4UP8A 1Q1EA 3KFUA 2BA0A 3HOWH 4B3SQ 4NB3A 2NZHA 4KHPL 4LWCA 3CMEA 1UE6A 4GNXB 5AJ3Q 1BVSA 5GAHC 3TRZA 1VQNA 3ULPA 2E2JH 4A3DH 4X6AH 4OXPA 4DR1L 2VUMG 1WI5A 3STBD 4GKKL 1UWVA 4A75A 3RNUA 3I55A 3HOYG 1K83H 1PV4A 4DV5Q 4KLKA 4PZ8A 5GADC 4YHHQ 3CCRA 4JYAL 1HNZL 2AWNA 1X56A 4ALPA 1HJPA 4A3JG 3GTKH 3CPWA 1V9PA 2KENA 3FKIG 3PF4A 1SN8A 4IPDA 4WJ3M 4A3FH 4QQBX 3PUYA 4JI4L 2OWOA 1E22A 4LF4L 3ERSX 4DR4Q 3S2HH 4LFBL 2R7DA 1KQSA 3E0EA 2WB1G 3M7NA 2E2HH 2YV5A 3GTOH 1EWIA 1MKHA 2K50A 3B6YA 3G4SA 4EQ5A 2A8VA 4DR6Q 3HKSA 2PI2E 5ELOA 1JMCA 2K75A 1EUJA 1EQRA 3ULLA 3GTMH 1N32L 1N36Q 4HJ5A 1QVCA 2B29A 3UE1A 1K8AC 5M5YH 2F4VQ 4JI8L 3PGZA 4JV5L 1LUZA 1JB7A 3D31A 5BR8L 4BBSG 1DGSA 4DNIA 2IHFA 4LF8Q 1S3OA 5IYDG 3M4OH 2CWPA 2I5LX 1WJJA 2VL6A 4LUZA 2NVXH 3LGJA 1NMFA 3J81j 2UUCQ 4TVAB 3CF5A 1L2FA 2ID0A 2ASBA 4JV5Q 1NY4A 1HH2P 5JEAG 5IP9G 1OXTA 3H15A 4GNXC 3G6EA 1OXUA 1OTCA 1VQCA 4DV3Q 1VQ7A 4A3GG 4JI1L 5BR8Q 4BY7G 4DR7Q 4ME3A 4C3JH 1G291 4IPCA 2VQEQ 4LF8L 4JI0Q 2BH2A 2BH8A 4APVA 4O2DA 5IY0A 5GQOA 4YCVA 4FDBA 4GN3B 4JOIA 5EAYA 1HR0Q 2UUCL 2E2IH 1TWHH 1Q7YC 2VZAA 1CKMA 1UEBA 1VQDA 2F3IA 3E9HA 3I2ZA 3K7AH 1JJ2A 4BBSH 4IO9A 1PH4A 4DV3L 4HJ8A 5IYDH 5LMNL 1XNRL 1AE2A 3UE0A 5IYBG 2KCMA 2VS1A 5FLMH 1S40A 4JI0L 2JA7H 5C4XG 5GROA 4DR4L 3CXCA 2JJQA 4IFDJ 2ZTDA 4DUYL 2R92H 3ICEA 1LM0A 1PA6A 2VY3A 5IP9H 3M4PA 1KRTA 5C3EH 1WFQA 4A3GH 1E7ZA 3STBC 1Q1BA 2NZOA 1HZBA 2AWOA 3ZJYC 4HIDA 1VQ9A 2NVTH 3DM3A 3RN2A 5JJIA 1XNRQ 4DV0Q 2A19A 4DV7Q 1XJVA 2WAQG 4BA1I 2WFWA 4C3HH 1N36L 2YTXA 4JI7Q 4KHZA 1PH6A 1YEZA 4A3CH 4A4IA 4B3TQ 5M3MH 2JA6H 5C44G 1E24A 3M3YH 2ALYB 3CC7A 1Q8KA 4JI3L 2KCTA 5LMUQ 3J7A5 3TS0A 1MIUA 5FLMG 5GAGC 4DAMA 4BY1H 2JA7G 4XIGS 1YNXA 4YWKA 4LFCL 3OW2A 1PH3A 4K0KL 5IWAL 3KLWA 2UXDL 1VQ5A 1L1OC 1X3EA 4P71A 1KD1C 1E3PA 1QUQB 1Z9FA 3M9BA 2XTIA 4IPHA 4R4TA 5C3EG 2AMCB 3TS2A 1KAWA 1X3FA 2NVYH 2QGQA 4GKJL 4KHPQ 3L0OA 1VQOA 4LF7Q 2HT1A 1YHAA 1PYSB 2MNAA 4X62Q 2N3SA 4B3ML 2I5MX 5IT9c 1B7YB 2VQEL 2RCNA 4HIKA 3CD6A 3U4ZA 3A5ZB 3FP9A 1WOCA 1VQGA 4OONA 4OX9Q 4A3LH 4DUZQ 1FGUA 2IX0A 1JE5A 5IYCH 4POGA 4RMFA 3TQYA 3PIPA 3JC66 1WCMH 3EBEA 3RR5A 1IBLQ 2E5LL 2VQFL 4A3JH 4A76A 4DR3L 4UY8C 1HZ9A 4GKJQ 4GN5A 1HNZQ 1TWAH 1L1OB 4AQYQ 1A8VA 4B3MQ 2Z0SA 2E8GA 3UDXA 1OXVA 3F2BA 3PSIA 4DV2L 2LXJA 5ELNA 3WWVA 1YITA 1XMQQ 1EIYB 1LTLA 2Q2UA 1QUQA 3CCLA 4DR2Q 3PUXA 1R9TH 1IXRA 3OTOL 1M90C 4LF4Q 1X65A 4GKKQ 3RZOH 1BBWA 4BBRH 2YTVA 1KIXA 1SMXA 4DR6L 2QEXA 4NXMQ 2Q2HA 3F8TA 4OWXB 4A3KG 3HOWG 1X9NA 1TWFH 1WCMG 3L2PA 1N32Q 2KHIA 3TEHB 4YWMA 1KXLA 2DUDA 3OTOQ 3S15H 2JQOA 3PCOB 3HFZB 4A93G 1A0IA 5DLQE 1IBKL 3GO5A 4B3SL 3RZDH 2VNUD 3AQQA 1JT8A 1BKBA 2JK8A 1N34L 4LFAL 3CC2A 1NTGA 3GTLH 4DR1Q 1AH9A 1VQEA 2I5HA 1VQ8A 5JEAJ 2RHQB 2UXBQ 4JBWA 1VQBA 1I94Q 4LF5Q 3U58A 4BXXG 3CP0A 4BBRG 1NE3A 1C0AA 3BU2A 4BY7H 3BZKA 3Q8DA 1YHQA 2ZTCA 1ASZA 3J81c 2JE6I 1B70B 1IZ6A 1U5KA 1IBKQ 2ZJRA 1Y14B 2R93G 2PI2A 4X62L 4LFAQ 1VQHA 3CCUA 2L15A 3RLFA 3W1GA 3PUVA 2NVQH 4DV1L 3RN5A 2HIVA 5K36G 2E5LQ 3A74A 4A93H 2CCZA 1Q86C 1GD7A 4DR3Q 1L0WA 3NENA 3KF6B 2ZM6L 4LW1A 1RIPA 5IYBH 1N8RC 2Z6KA 4LF6Q 3GTGH 5C4XH 2JA5G 1I50H 1QZHA 4KI0A 1U0LA 3HKZG 4DV1Q 1UE1A 1M1KC 1TWCH 4HJ7A 1P8LA 1MJEA 1CSQA 1NJIC 4JI8Q 3CCEA 4L5RC 1XNQQ 1B8AA 1VQMA 3MEFA 3J80c 3HOUH 5HGQA 4LF6L 3H3VH 3HOZH 4X66L 1QVFA 4PZ7A 5J3BA 3MXNB 3PUZA 3G48A 1FVIA 2ATWA 4UP9A 3G71A 1IL2A 1HZCA 5M3MG 2JA6G 3S1NH 5C44H 2R7FA 2EXDA 2DGYA 4P74A 4YWLA 2YU9H 4JG2A 4B3TL 4WJ4A 2N49A 4BY1G 4JI5L 4QGUA 1W2BA 1XPOA 4LFBQ 2JA5H 3PO3G 4GN4B 3VDYA 3EIVA 2JEAI 3J80i 1A63A 1J5EQ 4JI2L 2NN6G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOX H;  4LFC Q;  2UXB L;  4P73 A;  3AEV A;  1I94 L;  3ULJ A;  4LF5 L;  4L5S A;  4IJH A;  3DLL A;  5M5W H;  4HIM A;  1Y1W G;  1PH1 A;  1HNX Q;  1SE8 A;  4DAY B;  3GDE A;  1K0R A;  1SFO H;  2UXD Q;  5FLX c;  1GO3 E;  4JI5 Q;  3D0F A;  1Q82 C;  4DR5 L;  4LF7 L;  5LMN Q;  4A3L G;  1J5E L;  5IYC G;  4IOC A;  4AIM A;  3W1B A;  3T1H Q;  1N9W A;  4PMW A;  4OO1 G;  2OCE A;  4X64 Q;  4DUY Q;  1UE7 A;  2NN6 I;  4B3R L;  1EYG A;  1IBL L;  1Q81 C;  1Q12 A;  1Q46 A;  2Y0S G;  3EN2 A;  3F1Z A;  4PZ6 A;  2ZM6 Q;  2VQF Q;  2HHH Q;  4AYB E;  2ZJQ A;  4DR5 Q;  2YTY A;  2GN5 A;  3KYH C;  3HOX G;  1GKH A;  1YVC A;  4DV0 L;  3OYY A;  3KJP A;  1BBU A;  1Z47 A;  1Y1V G;  3CCS A;  1YJN A;  1IBM Q;  4JI7 L;  5JJK A;  4QJF A;  1XMQ L;  1PFS A;  1D7Q A;  3GTJ H;  2MO0 A;  3U4V A;  2D62 A;  4B3R Q;  3CCV A;  1X55 A;  1YIJ A;  3KDF B;  4Y52 H;  2OQK A;  4IOA A;  1CSP A;  4OO1 I;  1YBY A;  4X65 Q;  1EOV A;  3S17 H;  1VS0 A;  1CKO A;  4L5Q A;  5GAE C;  4A3K H;  3CC4 A;  3SGI A;  4DPG A;  4LNQ A;  1VQA A;  1X6O A;  1XPU A;  3KOJ A;  1XPR A;  2IX1 A;  3CW2 C;  4JBM A;  4NXN Q;  4A3E H;  4K0K Q;  1VQJ A;  3K8A A;  4POF A;  5IWA Q;  3I56 A;  3L7Z C;  4JCV E;  2WP8 J;  1S72 A;  3K0X A;  2K5N A;  3CPF A;  1SRU A;  2RF4 A;  2WAQ E;  3CQZ H;  3PIO A;  1VQK A;  1VQI A;  4LF9 L;  1N33 Q;  2D0P A;  3CAM A;  1N34 Q;  4BXX H;  4DKA C;  4EX5 A;  4DK3 C;  4LUO A;  4OX9 L;  3I4M H;  1KRS A;  2AKW B;  4MTN A;  4DUZ L;  2R93 H;  3AFQ A;  3J7Z C;  4R1J A;  1HNX L;  2K5V A;  4NPS A;  1PH8 A;  2N78 A;  5LMN W;  1UE5 A;  5IP7 H;  3S2D H;  3PO2 G;  1O7I A;  3KDF A;  2VW9 A;  2K4K A;  1HZA A;  2LSS A;  4J15 A;  4MZ9 A;  3S24 A;  4AYB G;  2UUA Q;  4AQY L;  2JA8 H;  3A5U A;  3PF5 A;  3I4N G;  1YHB A;  1FL0 A;  2Y0S E;  3H3V I;  1PVO A;  1K8G A;  3GTP H;  3S1Q H;  4JBK A;  2GVA A;  2V1C C;  4X64 L;  1P16 A;  2LXK A;  1JJG A;  1K73 C;  4R4O A;  4TQU S;  1GVP A;  3UDG A;  1GM5 A;  1VQL A;  4GOP C;  4QY7 A;  4YHH L;  1YZ6 A;  1SRO A;  4IFD I;  2AHO B;  2Q2I A;  1VQF A;  3GTQ H;  1EQQ A;  1QVG A;  4NXM L;  1D8L A;  1C7Y A;  1H95 A;  3I4M G;  3UDF A;  2IT1 A;  4A3M G;  1VQP A;  2EIF A;  3HKZ E;  2OTL A;  3ER0 A;  4C3I H;  4GLV B;  1PH7 A;  3HOU G;  3HOZ G;  4OWW B;  3PV0 A;  1TXY A;  4Y7N H;  2JA8 G;  2CFM A;  5M3F G;  4JI6 L;  4X66 Q;  1FJG L;  2JA9 A;  2MFI A;  1VCI A;  1G6P A;  1V1Q A;  4YY3 L;  2FXQ A;  4GOP B;  3BZC A;  1I5F A;  4DK6 C;  4A3I H;  3NEM A;  4JC0 A;  1E1T A;  1AE3 A;  4GLA C;  3TRE A;  1QZG A;  4QIW E;  5C4J H;  3PO3 H;  3T1Y L;  3H0G G;  3CCM A;  4JI6 Q;  2Q2T A;  1N33 L;  1CKN B;  2OQ0 A;  3JAM i;  1FJG Q;  4YCW A;  3S14 H;  5FJ8 H;  2Z6K C;  2R7Z H;  1Y1W H;  4PG3 A;  4O0A A;  2B63 H;  1XMO L;  2WB1 E;  4R4I A;  4AH6 A;  3S1R H;  4A3B H;  2F52 A;  5JJL A;  3F2C A;  2PQA B;  4A3D G;  3AYH B;  3HOV H;  3T1Y Q;  3M85 A;  1KHI A;  2D0O A;  3CCQ A;  1X3G A;  1YJW A;  3NEL A;  4GS3 A;  4BA2 I;  4P75 A;  2HIX A;  1V43 A;  4DV6 Q;  2ES2 A;  5HY6 A;  4DR7 L;  4A3I G;  2ZJP A;  1W3S A;  3JAM c;  1XMO Q;  2OTJ A;  3T1H L;  4IPG A;  2KHJ A;  3PUW A;  1PHJ A;  2IHE A;  3H0G H;  2XGT A;  4GNX A;  1XNQ L;  1JJC B;  1OXS C;  1OXX K;  3K81 C;  1Y1V H;  2UU9 L;  4DV4 L;  5FJ8 G;  2R7Z G;  1XTD A;  1CKN A;  2CWA A;  3RLO A;  2B63 G;  2MQH A;  1PH9 A;  2ZTE A;  4A3B G;  1PYB A;  3M4Q A;  3K80 C;  1VQ4 A;  1TWG H;  3HOV G;  4YCU A;  3CMA A;  1KC8 C;  4RG1 A;  1RL2 A;  1PH5 A;  1J6Q A;  1YJ9 A;  1NBW A;  1HNW L;  4A3E G;  2UU9 Q;  3BJU A;  4JI2 Q;  4YY3 Q;  3F2D A;  2PNH A;  4JBJ A;  4NXN L;  2K14 A;  4H02 A;  2PQA A;  1G51 A;  3KF6 A;  1E1O A;  4HIO A;  2HQL A;  3NBH B;  4JOI C;  2I0Q A;  3CCJ A;  3KF8 B;  2A1A A;  2PMZ E;  3A0J A;  4JI1 Q;  4JI3 Q;  5H1S E;  3J81 i;  2KBN A;  4UP7 A;  4QL5 A;  2BA1 A;  1PH2 A;  5C0X G;  5AJ3 L;  5IP7 G;  1C9O A;  2H5X A;  4GOP A;  3PO2 H;  2N8N A;  2UUB L;  1HR0 L;  4LF9 Q;  2EQS A;  2RHS B;  1WYD A;  2QA4 A;  1SLJ A;  2HHH L;  3I4N H;  1EFW A;  3I7F A;  2GVB A;  4R4Q A;  3W5O A;  4DV6 L;  4JYA Q;  3KJO A;  4UPA A;  1CUK A;  2UUA L;  3RLN A;  3E9I A;  3FHW A;  4HJA A;  1IBM L;  5IE8 A;  4JI4 Q;  1SR3 A;  4GLX A;  1A62 A;  2UUB Q;  1X54 A;  4P72 A;  3I4O A;  1K9M C;  2CQO A;  3AFP A;  4X65 L;  4MNO A;  2R92 G;  4DV4 Q;  1K3R A;  5C0X J;  4A3M H;  3S1M H;  2UXC L;  4HJ9 A;  4DV7 L;  2B3G A;  2MO1 A;  3UDI A;  1VQ6 A;  1I3Q H;  2IY5 B;  4DV2 Q;  1EIF A;  4XTC S;  4DR2 L;  2VUM H;  4C2M H;  5M3F H;  2K52 A;  1NMG A;  3IRB A;  4OWT B;  4R4C A;  4LUV A;  3U50 C;  1HR0 W;  1L1O A;  2K5H A;  2F4V L;  3HOY H;  2JEB I;  1I6H H;  1HNW Q;  5LMU L;  4A3C G;  4IFD G;  3K7U C;  1KL9 A;  2UXC Q;  2YYZ A;  1LYL A;  1MJC A;  3FKI H;  2C35 B;  1ASY A;  3GD7 A;  4A3F G;  2CKZ B;  5E7N A;  3S16 H;  2R6G A;  5C0X I;  1T9H A;  1YI2 A;  4DV5 L;  4L5T A;  4IJL A;  5M5X H;  1IYJ B;  4UP8 A;  1Q1E A;  3KFU A;  2BA0 A;  3HOW H;  4B3S Q;  4NB3 A;  2NZH A;  4KHP L;  4LWC A;  3CME A;  1UE6 A;  4GNX B;  5AJ3 Q;  1BVS A;  5GAH C;  3TRZ A;  1VQN A;  3ULP A;  2E2J H;  4A3D H;  4X6A H;  4OXP A;  4DR1 L;  2VUM G;  1WI5 A;  3STB D;  4GKK L;  1UWV A;  4A75 A;  3RNU A;  3I55 A;  3HOY G;  1K83 H;  1PV4 A;  4DV5 Q;  4KLK A;  4PZ8 A;  5GAD C;  4YHH Q;  3CCR A;  4JYA L;  1HNZ L;  2AWN A;  1X56 A;  4ALP A;  1HJP A;  4A3J G;  3GTK H;  3CPW A;  1V9P A;  2KEN A;  3FKI G;  3PF4 A;  1SN8 A;  4IPD A;  4WJ3 M;  4A3F H;  4QQB X;  3PUY A;  4JI4 L;  2OWO A;  1E22 A;  4LF4 L;  3ERS X;  4DR4 Q;  3S2H H;  4LFB L;  2R7D A;  1KQS A;  3E0E A;  2WB1 G;  3M7N A;  2E2H H;  2YV5 A;  3GTO H;  1EWI A;  1MKH A;  2K50 A;  3B6Y A;  3G4S A;  4EQ5 A;  2A8V A;  4DR6 Q;  3HKS A;  2PI2 E;  5ELO A;  1JMC A;  2K75 A;  1EUJ A;  1EQR A;  3ULL A;  3GTM H;  1N32 L;  1N36 Q;  4HJ5 A;  1QVC A;  2B29 A;  3UE1 A;  1K8A C;  5M5Y H;  2F4V Q;  4JI8 L;  3PGZ A;  4JV5 L;  1LUZ A;  1JB7 A;  3D31 A;  5BR8 L;  4BBS G;  1DGS A;  4DNI A;  2IHF A;  4LF8 Q;  1S3O A;  5IYD G;  3M4O H;  2CWP A;  2I5L X;  1WJJ A;  2VL6 A;  4LUZ A;  2NVX H;  3LGJ A;  1NMF A;  3J81 j;  2UUC Q;  4TVA B;  3CF5 A;  1L2F A;  2ID0 A;  2ASB A;  4JV5 Q;  1NY4 A;  1HH2 P;  5JEA G;  5IP9 G;  1OXT A;  3H15 A;  4GNX C;  3G6E A;  1OXU A;  1OTC A;  1VQC A;  4DV3 Q;  1VQ7 A;  4A3G G;  4JI1 L;  5BR8 Q;  4BY7 G;  4DR7 Q;  4ME3 A;  4C3J H;  1G29 1;  4IPC A;  2VQE Q;  4LF8 L;  4JI0 Q;  2BH2 A;  2BH8 A;  4APV A;  4O2D A;  5IY0 A;  5GQO A;  4YCV A;  4FDB A;  4GN3 B;  4JOI A;  5EAY A;  1HR0 Q;  2UUC L;  2E2I H;  1TWH H;  1Q7Y C;  2VZA A;  1CKM A;  1UEB A;  1VQD A;  2F3I A;  3E9H A;  3I2Z A;  3K7A H;  1JJ2 A;  4BBS H;  4IO9 A;  1PH4 A;  4DV3 L;  4HJ8 A;  5IYD H;  5LMN L;  1XNR L;  1AE2 A;  3UE0 A;  5IYB G;  2KCM A;  2VS1 A;  5FLM H;  1S40 A;  4JI0 L;  2JA7 H;  5C4X G;  5GRO A;  4DR4 L;  3CXC A;  2JJQ A;  4IFD J;  2ZTD A;  4DUY L;  2R92 H;  3ICE A;  1LM0 A;  1PA6 A;  2VY3 A;  5IP9 H;  3M4P A;  1KRT A;  5C3E H;  1WFQ A;  4A3G H;  1E7Z A;  3STB C;  1Q1B A;  2NZO A;  1HZB A;  2AWO A;  3ZJY C;  4HID A;  1VQ9 A;  2NVT H;  3DM3 A;  3RN2 A;  5JJI A;  1XNR Q;  4DV0 Q;  2A19 A;  4DV7 Q;  1XJV A;  2WAQ G;  4BA1 I;  2WFW A;  4C3H H;  1N36 L;  2YTX A;  4JI7 Q;  4KHZ A;  1PH6 A;  1YEZ A;  4A3C H;  4A4I A;  4B3T Q;  5M3M H;  2JA6 H;  5C44 G;  1E24 A;  3M3Y H;  2ALY B;  3CC7 A;  1Q8K A;  4JI3 L;  2KCT A;  5LMU Q;  3J7A 5;  3TS0 A;  1MIU A;  5FLM G;  5GAG C;  4DAM A;  4BY1 H;  2JA7 G;  4XIG S;  1YNX A;  4YWK A;  4LFC L;  3OW2 A;  1PH3 A;  4K0K L;  5IWA L;  3KLW A;  2UXD L;  1VQ5 A;  1L1O C;  1X3E A;  4P71 A;  1KD1 C;  1E3P A;  1QUQ B;  1Z9F A;  3M9B A;  2XTI A;  4IPH A;  4R4T A;  5C3E G;  2AMC B;  3TS2 A;  1KAW A;  1X3F A;  2NVY H;  2QGQ A;  4GKJ L;  4KHP Q;  3L0O A;  1VQO A;  4LF7 Q;  2HT1 A;  1YHA A;  1PYS B;  2MNA A;  4X62 Q;  2N3S A;  4B3M L;  2I5M X;  5IT9 c;  1B7Y B;  2VQE L;  2RCN A;  4HIK A;  3CD6 A;  3U4Z A;  3A5Z B;  3FP9 A;  1WOC A;  1VQG A;  4OON A;  4OX9 Q;  4A3L H;  4DUZ Q;  1FGU A;  2IX0 A;  1JE5 A;  5IYC H;  4POG A;  4RMF A;  3TQY A;  3PIP A;  3JC6 6;  1WCM H;  3EBE A;  3RR5 A;  1IBL Q;  2E5L L;  2VQF L;  4A3J H;  4A76 A;  4DR3 L;  4UY8 C;  1HZ9 A;  4GKJ Q;  4GN5 A;  1HNZ Q;  1TWA H;  1L1O B;  4AQY Q;  1A8V A;  4B3M Q;  2Z0S A;  2E8G A;  3UDX A;  1OXV A;  3F2B A;  3PSI A;  4DV2 L;  2LXJ A;  5ELN A;  3WWV A;  1YIT A;  1XMQ Q;  1EIY B;  1LTL A;  2Q2U A;  1QUQ A;  3CCL A;  4DR2 Q;  3PUX A;  1R9T H;  1IXR A;  3OTO L;  1M90 C;  4LF4 Q;  1X65 A;  4GKK Q;  3RZO H;  1BBW A;  4BBR H;  2YTV A;  1KIX A;  1SMX A;  4DR6 L;  2QEX A;  4NXM Q;  2Q2H A;  3F8T A;  4OWX B;  4A3K G;  3HOW G;  1X9N A;  1TWF H;  1WCM G;  3L2P A;  1N32 Q;  2KHI A;  3TEH B;  4YWM A;  1KXL A;  2DUD A;  3OTO Q;  3S15 H;  2JQO A;  3PCO B;  3HFZ B;  4A93 G;  1A0I A;  5DLQ E;  1IBK L;  3GO5 A;  4B3S L;  3RZD H;  2VNU D;  3AQQ A;  1JT8 A;  1BKB A;  2JK8 A;  1N34 L;  4LFA L;  3CC2 A;  1NTG A;  3GTL H;  4DR1 Q;  1AH9 A;  1VQE A;  2I5H A;  1VQ8 A;  5JEA J;  2RHQ B;  2UXB Q;  4JBW A;  1VQB A;  1I94 Q;  4LF5 Q;  3U58 A;  4BXX G;  3CP0 A;  4BBR G;  1NE3 A;  1C0A A;  3BU2 A;  4BY7 H;  3BZK A;  3Q8D A;  1YHQ A;  2ZTC A;  1ASZ A;  3J81 c;  2JE6 I;  1B70 B;  1IZ6 A;  1U5K A;  1IBK Q;  2ZJR A;  1Y14 B;  2R93 G;  2PI2 A;  4X62 L;  4LFA Q;  1VQH A;  3CCU A;  2L15 A;  3RLF A;  3W1G A;  3PUV A;  2NVQ H;  4DV1 L;  3RN5 A;  2HIV A;  5K36 G;  2E5L Q;  3A74 A;  4A93 H;  2CCZ A;  1Q86 C;  1GD7 A;  4DR3 Q;  1L0W A;  3NEN A;  3KF6 B;  2ZM6 L;  4LW1 A;  1RIP A;  5IYB H;  1N8R C;  2Z6K A;  4LF6 Q;  3GTG H;  5C4X H;  2JA5 G;  1I50 H;  1QZH A;  4KI0 A;  1U0L A;  3HKZ G;  4DV1 Q;  1UE1 A;  1M1K C;  1TWC H;  4HJ7 A;  1P8L A;  1MJE A;  1CSQ A;  1NJI C;  4JI8 Q;  3CCE A;  4L5R C;  1XNQ Q;  1B8A A;  1VQM A;  3MEF A;  3J80 c;  3HOU H;  5HGQ A;  4LF6 L;  3H3V H;  3HOZ H;  4X66 L;  1QVF A;  4PZ7 A;  5J3B A;  3MXN B;  3PUZ A;  3G48 A;  1FVI A;  2ATW A;  4UP9 A;  3G71 A;  1IL2 A;  1HZC A;  5M3M G;  2JA6 G;  3S1N H;  5C44 H;  2R7F A;  2EXD A;  2DGY A;  4P74 A;  4YWL A;  2YU9 H;  4JG2 A;  4B3T L;  4WJ4 A;  2N49 A;  4BY1 G;  4JI5 L;  4QGU A;  1W2B A;  1XPO A;  4LFB Q;  2JA5 H;  3PO3 G;  4GN4 B;  3VDY A;  3EIV A;  2JEA I;  3J80 i;  1A63 A;  1J5E Q;  4JI2 L;  2NN6 G; 
#chains in the Genus database with same CATH topology
 3HOX H;  1SND A;  4P73 A;  4LF5 L;  3ULJ A;  3DLL A;  5C44 B;  4HSV A;  1SE8 A;  4X3S A;  1K0R A;  4KJO A;  5EJW A;  3A7L A;  4FO2 A;  1Q82 C;  4QCL A;  2K01 A;  1EEI D;  1SEB D;  4AIM A;  2EPB A;  1UE7 A;  4ZK9 B;  1J9O A;  2HHH Q;  3F1Z A;  2EYO A;  1B2T A;  3KYH C;  3SVM A;  2K6A A;  4JI7 L;  1GUO A;  1G2S A;  1PFS A;  3G6J B;  1SE4 A;  2NVQ B;  3H91 A;  4GZY C;  4OO1 I;  3F2U A;  1VS0 A;  3HOV B;  5E4W C;  1D1K A;  2PW7 A;  3SGI A;  1XPR A;  3LNN A;  2BOS A;  4A3E H;  4LMQ D;  4BY7 B;  1WTQ A;  4POF A;  2R7Z B;  4O42 A;  2FHT A;  1VQK A;  1N33 Q;  2B2U A;  3FDT A;  1STE A;  3T13 A;  4EX5 A;  4DK3 C;  2MPM A;  4LUO A;  1KRS A;  1HNX L;  3MA2 B;  1LTB D;  3KLS A;  5KGU A;  2ZXO A;  1RTO A;  1O7I A;  1JOQ A;  5I9P A;  4J15 A;  1STY A;  4QUC A;  2JA8 H;  4F88 A;  1PVO A;  1KNE A;  5KEE A;  4P2C B;  2XN9 C;  2DN8 A;  4GOP C;  4YHH L;  1B9N A;  2A6H C;  2AHO B;  1TWA B;  4XXE A;  3A55 A;  1H95 A;  1D8L A;  1C7Y A;  5BN4 A;  3I4M G;  2SEB D;  3GTP B;  1VQP A;  3ER0 A;  1EIH A;  1PH7 A;  3HOU G;  4B9X A;  4XQQ A;  3EFX D;  1DOK A;  2L12 A;  4Y7N H;  4IQZ A;  3P75 A;  2L4N A;  5M3F G;  2PQE A;  3GTG B;  4IAL A;  3ND9 A;  1FJG L;  2MFI A;  1NR2 A;  2NVY B;  1JE4 A;  3K0Y A;  1H9R A;  2XIW A;  4GOP B;  3I4M B;  4KHV A;  2OF1 A;  1AE3 A;  3H0G G;  3HRZ C;  5G3L D;  1SJH D;  1N33 L;  3DWA A;  1CKN B;  4YCW A;  3PIO 3;  4PG3 A;  2ICE C;  4O0A A;  2JA6 B;  1DJR D;  2PQA B;  3HOV H;  1Y8N B;  4J8Q A;  1STH A;  3T1Y Q;  3M85 A;  1KHI A;  4BA2 I;  3NEL A;  4P75 A;  2HIX A;  2NVT B;  3DHQ A;  2FFK B;  4DV6 Q;  4A3I G;  2ZJP A;  4R8N A;  2EDG A;  2R92 B;  1Q90 A;  2JA7 B;  4GNX A;  1B50 A;  3SK8 A;  3WOE A;  4CJ2 C;  2RBM A;  5FJ8 G;  1XTD A;  1B4O A;  1CK1 A;  3RLO A;  1R4Q B;  3KK7 A;  3MFY A;  1DCZ A;  2A5H A;  3K80 C;  1VQ4 A;  1TWG H;  4V0B A;  4FF3 A;  1RL2 A;  1SXT A;  2XRQ D;  2F03 A;  1QG7 A;  3BJU A;  3F2D A;  5AFW A;  4N8X 1;  5LL6 S;  2K14 A;  3Q24 A;  5I6W A;  1RHP A;  3NBH B;  3KBG A;  3NK9 A;  2C9O A;  1RJT A;  3A8K E;  1EWC A;  3DM1 A;  5H1S E;  1MSH A;  4ZLT F;  1C9O A;  1HQR D;  1F2Y A;  2N8N A;  1HR0 L;  3MXN A;  1WYD A;  3EVQ A;  1SLJ A;  4DF7 A;  1CUK A;  4HN7 A;  5K5P A;  4WJW A;  3L3O C;  2HDM A;  1M8A A;  1X54 A;  4P72 A;  4G7Z C;  1K9M C;  2CQO A;  2KHS A;  5ELD A;  4O1N A;  1G2T A;  2IPK D;  4N9P A;  1TS3 A;  1VQ6 A;  4DV7 L;  1DM0 B;  1I3Q H;  1STA A;  3ND8 A;  1EIF A;  1PZK D;  2VUM H;  5FLX E;  2BDO A;  2F4V L;  4LK1 C;  1I6H H;  2K5H A;  2OT2 A;  5LMU L;  1Q3L A;  3K7U C;  5CV6 A;  2HCI A;  1KLU D;  2UXC Q;  2AUK A;  3OWF A;  3T16 A;  3DWQ A;  3MXP A;  4KD4 A;  3A54 A;  2CKZ B;  5E7N A;  2RDG A;  3MFG A;  4IJL A;  1Q1E A;  3KFU A;  1FR3 A;  4HMI A;  4GNX B;  2KED A;  3BDO A;  5AJ3 Q;  3TRZ A;  3I90 A;  1VQN A;  3ULP A;  1WI5 A;  2CH4 A;  3STB D;  4A75 A;  3I55 A;  1NNX A;  4PZ8 A;  5I6Y A;  3RZO B;  3S1M B;  1E2W A;  2AWN A;  3GQB A;  2EYP A;  4A3J G;  3CPW A;  1WTO A;  3PF4 A;  4IPD A;  1F77 A;  4NMZ A;  4WJ3 M;  2RDH A;  3S2H H;  2R7D A;  1ZYR C;  1HPC A;  2ICI A;  2D9U A;  3E0E A;  2WB1 G;  2E2H H;  1MKH A;  3G4S A;  4ZKC B;  5D3I B;  2A68 C;  3HKS A;  4N9T A;  3I4N B;  1EUJ A;  5KYI A;  1JR0 D;  1N32 L;  4TSS A;  1EQV A;  2B29 A;  2F0I A;  4JI8 L;  1A2T A;  2F4V Q;  1WD0 A;  4JV5 L;  1LUZ A;  4BBS G;  2KA7 A;  5IYD G;  3M4O H;  2CWP A;  3FMC A;  1LTA D;  3RUZ A;  2NVX H;  1STB A;  1MI2 A;  1L2F A;  2ID0 A;  5JEA G;  3H15 A;  1OXT A;  4LFB L;  4CDF C;  4DR7 Q;  2A74 C;  4C3J H;  4IPC A;  3TP7 A;  5F2D A;  4JI0 Q;  4LF8 L;  2BH2 A;  3R2I A;  4O2D A;  1AZP A;  5IY0 A;  2V4D A;  4JOI A;  4FXG C;  2Z4H A;  4CKB A;  2K03 A;  2E2I H;  1TWH H;  3K7A H;  3E9H A;  1VMC A;  3I2Z A;  4L6T B;  1SNQ A;  5LMN L;  1XNR L;  1AE2 A;  3P7J A;  2Z9H A;  2Z8L A;  1RCV D;  1S40 A;  3H0G B;  5GRO A;  2ZTD A;  2DNC A;  3ICE A;  1SNO A;  1HXY D;  2VY3 A;  1HUN A;  5C3E H;  1BDO A;  1E7Z A;  2E2I B;  2NZO A;  4G4K A;  3ZJY C;  1BCP D;  5D14 A;  4JPB W;  1VQ9 A;  4DV0 Q;  1QJO A;  2WAQ G;  2EY6 A;  4C3H H;  1PH6 A;  5CBA E;  4A3C H;  4A4I A;  1C8C A;  5DNF A;  3S14 B;  3MVV A;  3CC7 A;  2KCT A;  5CV8 A;  5GAG C;  2JA7 G;  4YWK A;  3OW2 A;  3VR5 A;  2QDL A;  2N55 A;  4P71 A;  4RCO A;  5CMD A;  1B3A A;  1VMP A;  4IPH A;  1Z9F A;  4A3I B;  1KD1 C;  3ITP A;  1F2L A;  1JOR A;  4LF7 Q;  1PYS B;  1JCK B;  1GUN A;  1EY6 A;  1PMR A;  2RCN A;  4HIK A;  2F0N A;  4CKE A;  2O5I C;  3A5Z B;  4OON A;  1WOC A;  1VQG A;  2IW3 A;  4KD3 A;  4OX9 Q;  4DUZ Q;  4C3I B;  4POG A;  1JE5 A;  3TQY A;  3PIP A;  1IBL Q;  3GTO B;  1VF7 A;  4K8J A;  1L0X B;  2VQF L;  5JPN C;  4DR3 L;  1GHK A;  1HZ9 A;  4GKJ Q;  4GN5 A;  3DEO A;  2ZXR A;  4B3M Q;  2B2Y A;  1A8V A;  1PRT D;  2E8G A;  4DAY A;  1OXV A;  3F2B A;  5C4Z A;  2LXJ A;  1EIY B;  2A69 C;  4LF4 Q;  1RF2 D;  3HS0 C;  4BBR H;  2B2W A;  4IUU A;  1K83 B;  1SMX A;  4F7X A;  4OWX B;  4A3K G;  1JOO A;  2KHI A;  2E75 C;  2DUD A;  1QNU A;  4FF1 A;  3PCO B;  3HOW B;  5DLQ E;  1DOL A;  3I4L A;  1JOK A;  3GO5 A;  1BKB A;  3GTL H;  2LMC B;  1VQ8 A;  2EJM A;  1LTT D;  1HQM C;  5FO7 B;  3Q8D A;  2ZTC A;  2FJ2 A;  3J81 c;  1IBK Q;  1U5K A;  1I6H B;  2ZJR A;  2PI2 A;  3T53 B;  1ZEQ X;  1VQH A;  4LFA Q;  3S17 B;  3CCU A;  4FVM A;  1WD1 A;  2HIV A;  5DM7 3;  5J39 A;  2CCZ A;  4A3M B;  1EEF D;  2E74 C;  3SDZ A;  4DXG A;  4DR3 Q;  2IX3 A;  3KF6 B;  1YNJ D;  2KCC A;  2Z6K A;  5C4X H;  1BNZ A;  4ZQ3 A;  3H09 A;  4DV1 Q;  1TWC H;  1BQQ T;  1P8L A;  3QOL A;  1CSQ A;  1A15 A;  3V2T A;  2MHV A;  1B8A A;  3P1H A;  3MEF A;  3HOU H;  3GV3 A;  4AYB B;  1QVF A;  2K04 A;  1PXU A;  4C1N K;  4CJ1 B;  3DEP A;  3PUZ A;  2WII B;  1U4L A;  3G71 A;  5M3M G;  1SNM A;  2HD3 A;  5M5W B;  3I73 A;  4YWL A;  2YU9 H;  4JG2 A;  2LS0 1;  3FEW X;  1HFN A;  4JI5 L;  4QGU A;  1IKL A;  3VDY A;  1A63 A;  2RCF A;  2IJ0 A;  4ULL A;  3QOJ A;  1ENF A;  5JOB A;  4H7B A;  4L5S A;  2XNA C;  5M5W H;  3A8J E;  1Y1W G;  1LAB A;  4DAY B;  1E0B A;  3GDE A;  2B2Y C;  4EQO A;  1STG A;  1TY2 A;  3TDQ A;  4DR5 L;  4J1M A;  1J5E L;  1EY5 A;  3W1B A;  1N9W A;  4X64 Q;  2M2L A;  4B3R L;  1ZKO A;  1Q12 A;  3DUZ A;  1FNV A;  2Y0S G;  3R93 A;  5I4D A;  4EQP A;  4ODG A;  3HOX G;  2LFN A;  1I4R A;  2Y0S B;  2NYZ D;  1Z47 A;  3LWE A;  1IBM Q;  3NE5 B;  5JJK A;  4QJF A;  1D7Q A;  1U9R A;  2F0Q A;  2AQ3 B;  3SE0 A;  4XQJ A;  4IOA A;  4X65 Q;  1EOV A;  3CC4 A;  1CKO A;  3NPP A;  4DPG A;  2FMC A;  1VQA A;  3KOJ A;  3CW2 C;  3S1R B;  3SK5 A;  4JBM A;  4HTH A;  3QJY A;  4KV6 A;  4K0K Q;  1YNN C;  2Z1C A;  3K8A A;  3HKZ B;  4OEL B;  3L7Z C;  4JCV E;  2B2W C;  3GTL B;  5M9O A;  2K5N A;  3PIO A;  5TSS A;  1HA5 A;  2TMP A;  2D0P A;  3RZD B;  3CAM A;  3I4M H;  1ML0 D;  1VF5 C;  3J7Z C;  4R1J A;  3M4Y A;  3S2D H;  1SNP A;  3R8B A;  2K5D A;  4FF4 A;  1HZA A;  2LSS A;  2UUA Q;  3I4N G;  1FL0 A;  3K6O A;  4KN4 C;  3H3V I;  1G8Z D;  1NAP A;  2JXM B;  1LTR D;  3S1Q H;  4JBK A;  4X64 L;  1KLG D;  2LXK A;  2WB1 B;  3TP5 A;  5HUR A;  1JJG A;  1GVP A;  3UDG A;  2K5W A;  1VQL A;  4QY7 A;  4IFD I;  2Q2I A;  2QIL A;  5KND A;  3GTQ H;  1I4P A;  1EQQ A;  3UDF A;  4A3J B;  2IT1 A;  4A3M G;  2F0U A;  5JVG 3;  1CHQ D;  4C3I H;  1QWY A;  2E2D C;  3HOZ G;  4XT3 B;  4HCE A;  3FPU B;  4JI6 L;  4X66 Q;  1VCI A;  1SYE A;  1V1Q A;  1IYU A;  4JK1 C;  3TZD A;  3BZC A;  1I5F A;  4DK6 C;  4A3I H;  1E1T A;  4GLA C;  3TRE A;  1QOH A;  5C4J H;  1A2U A;  3CCM A;  2NN6 H;  1WTW A;  2PNR C;  2Q2T A;  1EU3 A;  1LTI D;  2OQ0 A;  3JAM i;  3S14 H;  3VYU A;  3J81 E;  3J7A V;  3AMU A;  3T56 B;  2QEJ C;  1NUC A;  5JJL A;  5IIF A;  4CDD C;  2J4X A;  3AYH B;  4GS3 A;  5CV5 A;  2F0S A;  1Y8O B;  1F9S A;  1FYC A;  3GTJ B;  4A3G B;  5C3E B;  1W3S A;  5DM6 3;  1EU4 A;  2OTJ A;  3T1H L;  1YNJ C;  4IPG A;  5ELC A;  2F3W A;  3PUW A;  4OIJ A;  4G57 A;  1XNQ L;  1HCZ A;  1JJC B;  1OXS C;  3K81 C;  2F0H A;  2UU9 L;  4F8M A;  2R7Z G;  2B63 G;  2MQH A;  1C48 A;  2PO4 A;  2ZTE A;  3BDL A;  4A3B G;  1SYD A;  3M4Q A;  2B2V C;  3HOV G;  1A3U A;  1K28 A;  5IGE A;  1ONL A;  1V1P B;  1EIG A;  4R9W A;  1YJ9 A;  1NBW A;  5D65 A;  1HNW L;  4A3E G;  1CFM A;  2HQE A;  4JI2 Q;  2DJG C;  1G91 A;  4FP5 D;  2C5C A;  4HIO A;  2I07 B;  4JOI C;  5CYU A;  2PMZ E;  2YU9 B;  4JI3 Q;  3J81 i;  4C1N I;  2BA1 A;  1L0Y B;  1SYB A;  3PQI A;  2H5X A;  3PO2 H;  3VR6 A;  4LF9 Q;  3GTM B;  1MBY A;  3HOZ B;  1KDA A;  1EFW A;  1HFG A;  4R4Q A;  4DV6 L;  1ICW A;  1PTO B;  1TII D;  2MP1 A;  3E9I A;  3FHW A;  2EY5 A;  3T4A C;  3VA7 A;  1A62 A;  2UUB Q;  5C5M A;  3I4O A;  1V1P A;  3KLS X;  5C0X H;  3MAQ A;  4HJ9 A;  2MO1 A;  4DV2 Q;  4XTC S;  2F0F A;  4DR2 L;  5M3F H;  2K52 A;  4UAI A;  1L1O A;  2JEB I;  3KUP A;  4A3C G;  2PZU A;  1KL9 A;  2O5J C;  5IOC A;  3FKI H;  2C35 B;  4KY5 A;  3GD7 A;  4RCN A;  5KYL A;  3S16 H;  5C0X I;  1T9H A;  1YI2 A;  4DV5 L;  1K0S A;  4L5T A;  3E3X A;  4UP8 A;  2BA0 A;  5T1I A;  3HOW H;  1H9S B;  4B3S Q;  3S15 B;  1W6J A;  4LWC A;  1UE6 A;  5GAH C;  1TWF B;  3HOY B;  4DR1 L;  2EVB A;  5IT9 E;  3RNU A;  2J7Z A;  1K83 H;  3BYT B;  4KLK A;  1Z6H A;  4YHH Q;  3E0J A;  1B44 D;  1X56 A;  2KEN A;  3D6W A;  1SN8 A;  3E6Z X;  1PRT B;  2TSS A;  4Q5V A;  3ERS X;  3VR3 A;  1KQS A;  1GUG A;  3MXG A;  2PW5 A;  3M7N A;  2YV5 A;  1PTO H;  3UI2 A;  2F1M A;  3I70 A;  1LTS D;  1EZ8 A;  2PI2 E;  2K75 A;  5IGF A;  1EQR A;  5HGT A;  1EY8 A;  3PGZ A;  2EOT A;  3D31 A;  1S5C D;  5JPM C;  2CW0 D;  3V96 A;  1DGS A;  1DON A;  2SOB A;  4DAV A;  4EGV A;  3QG1 A;  2UUC Q;  4TVA B;  3CF5 A;  1GHJ A;  1LAC A;  1STN A;  5IP9 G;  4GNX C;  1VQ7 A;  1OXU A;  1XWE A;  4DV3 Q;  3DMU A;  1D5M C;  5BR8 Q;  2CHB D;  3TME A;  1G29 1;  1BF4 A;  4WFN 3;  5A2Q L;  1K8M A;  4KTA A;  1VDZ A;  4FDB A;  2QCP X;  2F0O A;  1IYV A;  3I8Z A;  1Q7Y C;  1MSG A;  1UEB A;  1G6Z A;  4XYO A;  5C3W A;  3OSO A;  4IO9 A;  1PH4 A;  1WTX A;  2L55 A;  5IYB G;  1EYC A;  3OMC A;  4F87 A;  1I4H A;  4DUY L;  3BVZ A;  2R92 H;  1LM0 A;  3K7A B;  1KRT A;  1TWH B;  1BR9 A;  1Q1B A;  3STB C;  1CQF A;  4C3J G;  2AWO A;  1O78 A;  1XNR Q;  1XJV A;  4BA1 I;  4QB4 A;  2WFW A;  1JC7 A;  4FXD A;  1YEZ A;  3MEH A;  5L37 A;  1ZXT A;  2JA6 H;  1Y1W B;  1E24 A;  1YNN D;  2ALY B;  3RD4 A;  1Q8K A;  2VXW A;  5EKK A;  3M4O B;  5E3F A;  5IWA L;  4M8A A;  3H3V C;  1VQ5 A;  1L1O C;  3M9B A;  1E3P A;  2XTI A;  4ZCK A;  2A73 B;  3TS2 A;  1KAW A;  1X3F A;  5LHY 1;  2QGQ A;  2A6E D;  1VQO A;  4FYD A;  3CHB D;  1EY4 A;  4X62 Q;  5IT9 c;  3M7G A;  1LT5 D;  3U4Z A;  3FP9 A;  2IX0 A;  5IYC H;  4RMF A;  1WCM H;  3EBE A;  2E5L L;  4A3J H;  1HNZ Q;  1L1O B;  3KBX A;  5JAV A;  2K7V A;  2XVS A;  1D2B A;  2Q2U A;  1YIT A;  4MTK A;  1R9T H;  2B8F A;  1IXR A;  2EYF A;  1EOT A;  3NUC A;  3OTO L;  2RQX A;  4QF4 A;  3RZO H;  1IHZ A;  2DY8 A;  1KDC A;  4DR6 L;  1XYI A;  3F8T A;  4NKL A;  1TWF H;  1ZYR D;  3L2P A;  2JQO A;  3HFZ B;  1A0I A;  4NW2 A;  2VNU D;  3AQQ A;  1JT8 A;  2AUJ D;  3FKI B;  1PTO F;  2B39 A;  5T1G A;  2UXB Q;  3NWS A;  1F9R A;  4BXX G;  2F0E A;  2K28 A;  4BBR G;  4A3E B;  1BO0 A;  1I4Q A;  3BZK A;  4BY7 H;  2JE6 I;  5BN3 A;  1Y14 B;  2WV6 D;  3J80 E;  4A3K B;  2D2C C;  2VUM B;  3HP3 A;  4PMC A;  3IAY A;  1I3Q B;  2B2U C;  3VA5 A;  1H9S A;  5K36 G;  2KOL A;  2E5L Q;  4A93 H;  1GD7 A;  3AB9 A;  4K8I A;  2G9H D;  2ZM6 L;  4LW1 A;  1RIP A;  3JAM E;  4LF6 Q;  4DGZ A;  1SDF A;  4KKU A;  2JA5 G;  1I50 H;  3I91 A;  3OHX C;  1QZH A;  1U0L A;  3IFD A;  1NJI C;  4JI8 Q;  2KJX A;  3I72 A;  3BVM A;  3URY A;  2F0V A;  1F9P A;  2RDF A;  3H3V H;  3HOZ H;  4X66 L;  3K5L A;  3G48 A;  1RKN A;  4ZAI A;  1SFO B;  1HZC A;  2MGS A;  1AEX A;  2QF7 A;  2EXD A;  1EL0 A;  1PRT C;  2QKI C;  2F0G A;  4B3T L;  2OEO A;  3ZYY X;  4WJ4 A;  1XPO A;  1BBX C;  3X3M A;  1JWM D;  3SXH A;  2JEA I;  3J80 i;  4ID6 A;  2UXB L;  1TT2 A;  3VYS A;  4HIM A;  4I7Z C;  1PH1 A;  2UXD Q;  3S1N B;  2XWB B;  2PPB C;  3D0F A;  4Q0F A;  2WAQ B;  2NWG A;  3HOU B;  3J7Y W;  5C3X A;  3MXU A;  4OO1 G;  2L5T A;  1GXD C;  1TWC B;  4DA2 A;  2NN6 I;  1Q81 C;  5ISR A;  2EZV A;  1EFI D;  4PZ6 A;  3MZ5 A;  2ZJQ A;  4DR5 Q;  2GN5 A;  1YVC A;  3OYY A;  3QWN A;  1Y1V G;  2JP1 A;  3CCS A;  1PFN A;  4A93 B;  1XMQ L;  3W3A A;  2MO0 A;  4B3R Q;  2AQ2 B;  2OQK A;  1CSP A;  1YBY A;  4DNR B;  4A3K H;  1V1O A;  4HR7 B;  4L5Q A;  5GAE C;  3BS1 A;  4LNQ A;  1XPU A;  4LJZ C;  2PYK A;  2IX1 A;  2RA4 A;  3A56 A;  1Q8I A;  4IUV A;  3NWT A;  1VQJ A;  1X3P A;  1DYQ A;  1A3T A;  4ZUJ A;  5FLX L;  3K0X A;  1B3Q A;  2WAQ E;  1VQI A;  2NBF A;  3Q6S A;  3K5M A;  4DKA C;  1U4M A;  4L8J A;  4G7H C;  3AFQ A;  2K5V A;  2N78 A;  5LMN W;  1UE5 A;  3PO2 G;  3MC0 B;  4K5W A;  2EYH A;  4MZ9 A;  4AYB G;  4C56 C;  4AQY L;  3A5U A;  1YHB A;  5C5L A;  3TZU A;  3TP6 A;  2GVA A;  2V1C C;  1P16 A;  1EYD A;  4R4O A;  4TQU S;  1GM5 A;  2K32 A;  1YZ6 A;  4IUQ A;  2F0P A;  5BN5 A;  2K5Q A;  4NXM L;  3FVQ A;  1WCM B;  2DJF C;  2OTL A;  4GLV B;  2JA8 B;  4OWW B;  1DOM A;  1TXY A;  2BE5 D;  1J8I A;  2LY7 A;  2JA9 A;  1G6P A;  2R93 B;  1XTC D;  3K59 A;  4YY3 L;  3MTS A;  2F0D A;  5COY A;  1WTP A;  1I6V C;  2F0M A;  3NEM A;  3V05 A;  1GUW A;  2D5D A;  1QZG A;  1S4Z A;  1SBB B;  3EJI A;  2RSO A;  1CQV A;  4DAP A;  5IGB A;  4BY1 B;  4JI6 Q;  5DAU A;  1FJG Q;  1JWS D;  2A6H D;  2A68 D;  2R7Z H;  1Y1W H;  2B63 H;  4KJN A;  1T5X D;  5M3M B;  5LL6 X;  1XMO L;  1HRJ A;  2XSC A;  4A3B H;  3F2C A;  3H6M A;  3A7A B;  1ESF A;  4K2L A;  1QIL A;  2F4I A;  4WOR A;  4Z9C B;  3U9S A;  4EVO A;  3CCQ A;  5CV7 A;  1YJW A;  1HTP A;  3IKJ A;  3D8G A;  1A3V A;  2B2T C;  5KNC A;  3JAM c;  1JIC A;  1PHJ A;  2IHE A;  4FF2 A;  2XGT A;  1JB3 A;  5I2X A;  4MIU A;  2EYL A;  4DV4 L;  1CKN A;  2CWA A;  1QNK A;  2K05 A;  4K5X A;  3K57 A;  1I4X A;  3DXJ C;  3CMA A;  1KC8 C;  2PZT A;  4RG1 A;  1PH5 A;  2SNS A;  3SEB A;  1DZ1 A;  2IWH A;  4IUT A;  3VYR A;  2PNH A;  4JBJ A;  4PQX A;  4NXN L;  4H02 A;  1C4Q A;  2PQA A;  1K3B C;  1ESR A;  1RD9 D;  2MUY A;  3QB3 A;  4JVZ A;  2HQL A;  2JA5 B;  1SMY D;  2I0Q A;  3CCJ A;  3KF8 B;  3OPO A;  3A0J A;  2KBN A;  4RGN A;  4UP7 A;  1LT6 D;  5ELF A;  1O7Z A;  3JAM L;  5ELB A;  5C0X G;  1TVX A;  5IP7 G;  4LAA A;  5M5Y B;  4GOP A;  1QB5 D;  1H9K A;  2HHH L;  1JQY D;  3I4N H;  4PMB A;  2GVB A;  3W5O A;  1BXT A;  1TU2 B;  4JYA Q;  3TP8 A;  3RLN A;  3VR4 A;  1MD2 D;  2EJG C;  5IE8 A;  4JI4 Q;  3S2H B;  1SR3 A;  4GLX A;  4KMU C;  4A3F B;  3AFP A;  3OIQ A;  4B08 A;  5CGK A;  4X65 L;  4MNO A;  2R92 G;  4DV4 Q;  3GTK B;  2NTT A;  3BZD B;  4A3M H;  3S1M H;  3AU7 A;  4C3I G;  2B3G A;  3UDI A;  2JSO A;  4CHT B;  5FOB B;  2DY7 A;  4E6I A;  2J0T D;  5DEH A;  4C2M H;  3IRB A;  4OWT B;  4R4C A;  3U50 C;  4GKK L;  1HNW Q;  4IFD G;  1SE3 A;  2YYZ A;  1CZW A;  4S3S A;  1WTV A;  4OGQ C;  1ASY A;  2KQ3 A;  4A3F G;  3S16 B;  5M5X H;  4PV1 C;  1D1I A;  1DD2 A;  3CME A;  5NUC A;  4A3D H;  2E2J H;  4CKC A;  2Z6B A;  1TS5 A;  5M3F B;  3HOY G;  2CW0 C;  1PV4 A;  4DV5 Q;  3SHL A;  3CCR A;  2FMM A;  4BBR B;  4JYA L;  3GTK H;  3GV6 A;  3SR1 A;  3FKI G;  3HGB A;  4LF4 L;  1E22 A;  1H9M A;  3H94 A;  4UHV A;  1KDB A;  3GP7 A;  5D3D A;  1FNU A;  3NSW A;  1D5X C;  3QO2 A;  2M00 A;  3GTO H;  2EY1 A;  2A8V A;  4DR6 Q;  3NQI A;  4CJ0 B;  1BCP B;  3CU7 A;  5ELO A;  1II3 A;  3ULL A;  1CM9 A;  3KF8 A;  1N36 Q;  1ENC A;  1QVC A;  3P20 A;  3UE1 A;  2IL8 A;  4HJ5 A;  3U9O A;  2FIN B;  1K8A C;  1JB7 A;  5KRU A;  1S5D D;  2BDN A;  3WOF A;  4DNI A;  2IHF A;  4LF8 Q;  1S3O A;  2I5L X;  1RTN A;  5JVH 3;  4MHE A;  1WJJ A;  3FRP B;  4LUZ A;  4ZKB B;  3LGJ A;  2WAC A;  1NMF A;  3J81 j;  4XYQ A;  3NHH A;  4RA8 A;  5FKA C;  1B9M A;  2ASB A;  1BCP C;  4JV5 Q;  3M3Y B;  2A69 D;  3G6E A;  4A3G G;  4KHP L;  4BY7 G;  4JI1 L;  4ME3 A;  1IKM A;  2VQE Q;  4M1U B;  2BH8 A;  4HED A;  2JYO A;  4FXK C;  5GQO A;  1TWG B;  4GN3 B;  1HR0 Q;  4H44 C;  3HEJ A;  2UUC L;  1O80 A;  2N88 A;  4RFB A;  2VB2 X;  1QE6 A;  1CKM A;  2VZA A;  5EGT A;  3OWE B;  1JJ2 A;  5K36 H;  3C2P A;  3MWY W;  1R4P B;  4DV3 L;  1UEA B;  3LWU A;  3UE0 A;  1CA5 A;  4CDC C;  2CQA A;  2VS1 A;  1SNC A;  5FLM H;  4JI0 L;  2P5Z X;  3CXC A;  2JJQ A;  3D4D A;  1DXM A;  1ICF B;  1PA6 A;  5IP9 H;  3BVG A;  3M4P A;  1WFQ A;  4ABN A;  3HG9 A;  5JJI A;  2RSN A;  4DV7 Q;  4R8I A;  3NTI A;  1RDP D;  4JI7 Q;  4B3T Q;  3R3O A;  5C44 G;  3C3L A;  2L11 A;  4HAE A;  4JI3 L;  3TS0 A;  1MIU A;  2NVX B;  4BY1 H;  4DAM A;  4KY7 A;  4XIG S;  4CDE C;  4X3U A;  1SE2 A;  1LLR D;  2UXD L;  3HOW G;  1F9Q A;  1MGS A;  3MHB A;  3CRK C;  3L0O A;  4CGY B;  1YHA A;  4RWS C;  3GTG H;  2N3S A;  3CD6 A;  2I5M X;  2VQE L;  4MN3 A;  2ZT9 C;  4NDX A;  3RR5 A;  1HA6 A;  4ZYS A;  4UY8 C;  3GTQ B;  1TWA H;  2EE1 A;  3UDX A;  1K8O A;  4RHR A;  3OMG A;  5I9O A;  4DV2 L;  1AZQ A;  2X6G A;  3WWV A;  1ET6 A;  2HT1 A;  1LTL A;  1QUQ A;  4DR2 Q;  3PUX A;  3OW7 A;  3S1Q B;  1BBW A;  3D3R A;  2AQ1 B;  2NZ1 D;  1PTO C;  1WCM G;  3A8I E;  1N32 Q;  1U4P A;  1KXL A;  4YWM A;  5JJZ A;  3OTO Q;  4BS9 A;  4UDU C;  4A93 G;  1A6X A;  3K58 A;  4CBV A;  3CQZ B;  3Q0A A;  1CI3 M;  3CC2 A;  1NTG A;  1M4V A;  4DR1 Q;  1VQE A;  1AH9 A;  1CHP D;  4JBW A;  4KK7 A;  1I94 Q;  1JWU D;  1C0A A;  4RKL A;  1NE3 A;  3BU2 A;  1IZ6 A;  1GUS A;  2K1B A;  4X62 L;  2QW7 A;  2L15 A;  3RLF A;  2NVQ H;  3RN5 A;  1D5Z C;  3A74 A;  1Q86 C;  1L0W A;  3K5O A;  3NEN A;  5IYB H;  4IUP A;  2LKV A;  4L63 B;  3D4R A;  1TS2 A;  2KUM A;  2ZXP A;  4KI0 A;  4NP5 A;  1M1K C;  4HJ7 A;  1O7Y A;  3CRL C;  3CCE A;  3VYT A;  4XT1 B;  1VQM A;  1SYC A;  1KNA A;  5HGQ A;  2KEE A;  1SYF A;  4ME5 A;  5J3B A;  3MXN B;  1Y8P B;  4UP9 A;  5FO9 B;  1IL2 A;  2X6L A;  2EYJ A;  1Y69 U;  2JA6 G;  3QR8 A;  3S1N H;  2DGY A;  4PNY A;  4P74 A;  1PZJ D;  3C1F A;  2N49 A;  1W2B A;  4LFB Q;  2JA5 H;  1J5E Q;  4EQN A;  3QIA A;  3FPP A;  4H0L C;  4LFC Q;  3AEV A;  2SDF A;  1I94 L;  3J7A F;  4IJH A;  1HNX Q;  1SFO H;  3N52 A;  5FLX c;  1GO3 E;  2MJ8 A;  3NTH A;  4JI5 Q;  3ONA B;  4XDX A;  4LF7 L;  5LMN Q;  4A3L G;  3EA6 A;  1PDQ A;  4DK1 A;  5IYC G;  4IOC A;  5CR3 A;  4K6L A;  3T1H Q;  4PMW A;  2OCE A;  4DUY Q;  1EYG A;  1IBL L;  2K33 A;  1Q46 A;  3EN2 A;  2VQF Q;  2ZM6 Q;  1I50 B;  2XWJ B;  4AYB E;  5C4X B;  1EY9 A;  1MHW C;  2QDB A;  2YTY A;  4DV0 L;  1GKH A;  3K5N A;  4H13 C;  3KJP A;  1BBU A;  1EZ6 A;  1YJN A;  3GTJ H;  2BCO A;  3U4V A;  3E5S A;  2D62 A;  3CCV A;  1X55 A;  2KEC A;  3KDF B;  1BCP F;  4OHJ A;  3C1E A;  1YIJ A;  4Y52 H;  4DU9 A;  3S17 H;  5EQ0 A;  1X6O A;  4DN4 M;  4NXN Q;  2B63 B;  1PFM A;  1H9J A;  5IWA Q;  3I56 A;  1CTM A;  5CC4 A;  2WP8 J;  1S72 A;  1GOZ A;  3IFT A;  3CPF A;  1ROD A;  1SRU A;  2RF4 A;  3CQZ H;  1EWH A;  1KTK A;  4TKO B;  3PO3 B;  1IW7 D;  1F2Z A;  1UUP A;  1N34 Q;  4BXX H;  5IGD A;  4OX9 L;  1HHV A;  2AKW B;  4MTN A;  4DUZ L;  2R93 H;  1KAB A;  2RVL A;  1SAP A;  4NPS A;  1PH8 A;  2A6E C;  4QIW B;  5IP7 H;  3KDF A;  1SMY C;  2VW9 A;  1AN8 A;  1S5B D;  2K4K A;  3EQL C;  1AP0 A;  3S24 A;  1KAA A;  3PF5 A;  2Y0S E;  3SK6 A;  1PFB A;  1K8G A;  3GTP H;  2XRS D;  1AW7 A;  1K73 C;  1F2M A;  2HUG A;  1SRO A;  2CVR A;  1VQF A;  1O7L A;  1QVG A;  1XXG A;  2H1E A;  2O4X A;  2PZW A;  2EIF A;  3HKZ E;  4HMJ A;  1HTL D;  3PV0 A;  5J1Z A;  2F0K A;  2F3V A;  2JA8 G;  3S2D B;  2CFM A;  3VR2 A;  2FXQ A;  3G7L A;  2M9V A;  3LX0 A;  4IFD H;  4JC0 A;  2BE5 C;  1W6K A;  4QIW E;  3PO3 H;  3T51 B;  3T1Y L;  1UNS A;  2Z4I A;  4B9W A;  5CV4 A;  5FJ8 H;  2Z6K C;  2WB1 E;  4R4I A;  4AH6 A;  3S1R H;  2F52 A;  4IZ8 A;  4A3D G;  1FGB D;  4RH6 A;  2D0O A;  4RGT A;  1X3G A;  2Q8I B;  4U67 3;  1V43 A;  1WVL A;  2ES2 A;  3C46 A;  3W2D A;  5HY6 A;  3Q23 A;  4DR7 L;  3BDC A;  4OO1 H;  2SNM A;  1XMO Q;  1ET9 A;  2KHJ A;  3H0G H;  4G7O C;  5A2Q E;  1CT1 D;  1OXX K;  4K5V A;  1Y1V H;  3TBI B;  1NSN S;  5C4H A;  5IOD A;  4BBS B;  5A35 A;  4DK0 A;  1WTH A;  4OEM B;  1PH9 A;  1PYB A;  2R3Z A;  5E4X A;  4YCU A;  2NUC A;  1OO9 B;  1J6Q A;  4ILW A;  2UU9 Q;  4YY3 Q;  4WRD A;  5IGG A;  4X3T A;  5E1F A;  1G51 A;  3KF6 A;  1LO5 D;  1E1O A;  1T5E A;  2B8G A;  3HZX A;  2A1A A;  4JI1 Q;  4HCS A;  4QL5 A;  1PH2 A;  5AJ3 L;  3NQT A;  2KCN A;  2UUB L;  3R2T A;  2G5D A;  2EQS A;  2O2L D;  2RHS B;  2QA4 A;  4FNF A;  2JN4 A;  1TKW B;  1GUT A;  3PMF A;  1UAP A;  3I7F A;  4RGM A;  3KJO A;  4UPA A;  2F0L A;  2UUA L;  5EPK A;  4HJA A;  1IBM L;  3X3N A;  1TR5 A;  5FK9 C;  5EKL A;  2NB0 A;  4KN7 C;  2ENB A;  4KKT A;  1K3R A;  3TN2 A;  5C0X J;  2UXC L;  2PCF B;  2IY5 B;  2R61 A;  5I2Y A;  3ERO A;  3SK4 A;  1EY7 A;  3NBI A;  1NR4 A;  1B1Z A;  1NMG A;  1HR0 W;  2E76 C;  4LUV A;  3HOY H;  4C3H G;  2E2J B;  2PMZ B;  3DWP A;  5C6A A;  2WKC A;  3OIP A;  2WKD A;  2EXZ A;  4BWG B;  5M5X B;  1LYL A;  1MJC A;  1X32 A;  4QMG A;  2R6G A;  5FO8 B;  3L9A X;  1IYJ B;  1IW7 C;  4NB3 A;  2NZH A;  4JW0 A;  1BVS A;  4TRD A;  4X6A H;  4OXP A;  2VUM G;  4C2M B;  1UWV A;  1V8Q A;  3BYY B;  4N8F A;  5GAD C;  1TQO A;  1HNZ L;  2L0C A;  4ALP A;  5KIX A;  1HJP A;  1R9T B;  1V9P A;  2B2V A;  4IUN A;  2G9D A;  4A3F H;  3O13 A;  3PUY A;  2OWO A;  4JI4 L;  4QQB X;  1LTG D;  4DR4 Q;  2HCC A;  1ILP A;  1EY0 A;  2F0T A;  1WTR A;  1EWI A;  1BOS A;  2K50 A;  3B6Y A;  3CKI B;  4EQ5 A;  5JEA H;  1ENA A;  2CH4 W;  1XX8 A;  1JMC A;  3GTM H;  4DNT B;  5EPJ A;  3PO2 B;  5M5Y H;  1BUV T;  4RAU C;  1U4R A;  4K2K A;  5EPL A;  5BR8 L;  3WDN A;  1PLF A;  1TY0 A;  2WIN B;  2VL6 A;  2B2T A;  5IGC A;  1PZI D;  5CV9 A;  1NY4 A;  1HH2 P;  1OTC A;  1SSO A;  1VQC A;  4K14 A;  4C3H B;  2F0W A;  2EJF C;  3NXW A;  4APV A;  1TS4 A;  4K6D A;  4YCV A;  5EAY A;  2Q8T A;  2L9H A;  1FNW A;  2F3I A;  1VQD A;  5KNB A;  4BBS H;  3NTK A;  2H4O A;  1Y1V B;  4HJ8 A;  5IYD H;  2L1B A;  4KKS A;  2KCM A;  4XQN A;  2JA7 H;  5C4X G;  4DR4 L;  4IFD J;  2OXP A;  2GA4 B;  3IL8 A;  1ILQ A;  3TSS A;  3RMH A;  4A3G H;  1LV9 A;  3BG3 A;  1HZB A;  1X3Q A;  2NVT H;  4HID A;  4DFA A;  3DM3 A;  3RN2 A;  2A19 A;  3N6R A;  1N36 L;  1HUM A;  2YTX A;  4C3J B;  4KHZ A;  4A3B B;  5M3M H;  1CA6 A;  3M3Y H;  2Q8R E;  1PRT F;  5LMU Q;  5IT9 L;  5CBE E;  4J6H A;  3S9W A;  3J7A 5;  5FLM G;  1LT3 D;  4KY6 A;  4ZUI A;  1YNX A;  4LFC L;  1PH3 A;  5C4J B;  4K0K L;  3KLW A;  4LF9 L;  1X3E A;  1QUQ B;  2NTS A;  1EYA A;  1IL8 A;  4R4T A;  5C3E G;  1PTO D;  2AMC B;  2X69 A;  4I7A A;  2NVY H;  4GKJ L;  4KHP Q;  4B3M L;  2HDL A;  2MNA A;  1B7Y B;  4Y7N B;  1AFP A;  4DXF A;  4A3L H;  1FGU A;  5EBD A;  3JC6 6;  2F0J A;  2E2H B;  4A76 A;  3KLR A;  2EYM A;  5COR A;  4AQY Q;  1NCV A;  2EY2 A;  2Z0S A;  3NBH A;  3PSI A;  5ELN A;  1XMQ Q;  3CCL A;  1M90 C;  1QCB D;  1X65 A;  4GKK Q;  2YTV A;  1KIX A;  2QEX A;  1I4G A;  5J22 A;  3D6C A;  4NXM Q;  3OOC A;  1SYG A;  2Q2H A;  3D4W A;  1X9N A;  4A3D B;  4RHS A;  2RKS A;  3TEH B;  4V19 0;  3S15 H;  1Z7T A;  1IBK L;  4B3S L;  3RZD H;  5G3L F;  1GJX A;  1LT4 D;  4IN3 A;  4LFA L;  2JK8 A;  1N34 L;  1S5E D;  4RGO S;  2I5H A;  5JEA J;  1B53 A;  2RHQ B;  4LF5 Q;  1VQB A;  4ZRZ A;  3U58 A;  3CP0 A;  1YHQ A;  1CZG A;  1S5F D;  1ASZ A;  3ERQ A;  1B70 B;  2R93 G;  4HSP A;  4QUF A;  3Q22 A;  3W1G A;  3PUV A;  1SJE D;  4DV1 L;  1PYW D;  3NP8 A;  4U68 A;  5EBC A;  4OIK A;  1N8R C;  2DNE A;  4IUR A;  3PIP 3;  3HKZ G;  1UE1 A;  1EQT A;  1MJE A;  4L5R C;  4I65 A;  3J81 L;  3J80 L;  2VB3 X;  1XNQ Q;  4OL7 A;  1D6E C;  3J80 c;  1FD7 D;  4LF6 L;  1E2Z A;  5EKI A;  4PZ7 A;  3I3C A;  2ATW A;  1FVI A;  4RKB A;  5C44 H;  2R7F A;  1E2V A;  2I46 A;  4X3K A;  3HOX B;  4BY1 G;  2KVM A;  3PO3 G;  4GN4 B;  3EIV A;  5ELE A;  4JI2 L;  2NN6 G;  4YIJ A; 
#chains in the Genus database with same CATH homology
 3HOX H;  4LFC Q;  2UXB L;  4P73 A;  3AEV A;  1I94 L;  3ULJ A;  4LF5 L;  4L5S A;  4IJH A;  3DLL A;  5M5W H;  4HIM A;  1Y1W G;  1PH1 A;  1HNX Q;  1SE8 A;  4DAY B;  3GDE A;  1K0R A;  1SFO H;  2UXD Q;  5FLX c;  1GO3 E;  4JI5 Q;  3D0F A;  1Q82 C;  4DR5 L;  4LF7 L;  5LMN Q;  4A3L G;  1J5E L;  5IYC G;  4IOC A;  4AIM A;  3W1B A;  3T1H Q;  1N9W A;  4PMW A;  4OO1 G;  2OCE A;  4X64 Q;  4DUY Q;  1UE7 A;  2NN6 I;  4B3R L;  1EYG A;  1IBL L;  1Q81 C;  1Q12 A;  1Q46 A;  2Y0S G;  3EN2 A;  3F1Z A;  4PZ6 A;  2ZM6 Q;  2VQF Q;  2HHH Q;  4AYB E;  2ZJQ A;  4DR5 Q;  2YTY A;  2GN5 A;  3KYH C;  3HOX G;  1GKH A;  1YVC A;  4DV0 L;  3OYY A;  3KJP A;  1BBU A;  1Z47 A;  1Y1V G;  3CCS A;  1YJN A;  1IBM Q;  4JI7 L;  5JJK A;  4QJF A;  1XMQ L;  1PFS A;  1D7Q A;  3GTJ H;  2MO0 A;  3U4V A;  2D62 A;  4B3R Q;  3CCV A;  1X55 A;  1YIJ A;  3KDF B;  4Y52 H;  2OQK A;  4IOA A;  1CSP A;  4OO1 I;  1YBY A;  4X65 Q;  1EOV A;  3S17 H;  1VS0 A;  1CKO A;  4L5Q A;  5GAE C;  4A3K H;  3CC4 A;  3SGI A;  4DPG A;  4LNQ A;  1VQA A;  1X6O A;  1XPU A;  3KOJ A;  1XPR A;  2IX1 A;  3CW2 C;  4JBM A;  4NXN Q;  4A3E H;  4K0K Q;  1VQJ A;  3K8A A;  4POF A;  5IWA Q;  3I56 A;  3L7Z C;  4JCV E;  2WP8 J;  1S72 A;  3K0X A;  2K5N A;  3CPF A;  1SRU A;  2RF4 A;  2WAQ E;  3CQZ H;  3PIO A;  1VQK A;  1VQI A;  4LF9 L;  1N33 Q;  2D0P A;  3CAM A;  1N34 Q;  4BXX H;  4DKA C;  4EX5 A;  4DK3 C;  4LUO A;  4OX9 L;  3I4M H;  1KRS A;  2AKW B;  4MTN A;  4DUZ L;  2R93 H;  3AFQ A;  3J7Z C;  4R1J A;  1HNX L;  2K5V A;  4NPS A;  1PH8 A;  2N78 A;  5LMN W;  1UE5 A;  5IP7 H;  3S2D H;  3PO2 G;  1O7I A;  3KDF A;  2VW9 A;  2K4K A;  1HZA A;  2LSS A;  4J15 A;  4MZ9 A;  3S24 A;  4AYB G;  2UUA Q;  4AQY L;  2JA8 H;  3A5U A;  3PF5 A;  3I4N G;  1YHB A;  1FL0 A;  2Y0S E;  3H3V I;  1PVO A;  1K8G A;  3GTP H;  3S1Q H;  4JBK A;  2GVA A;  2V1C C;  4X64 L;  1P16 A;  2LXK A;  1JJG A;  1K73 C;  4R4O A;  4TQU S;  1GVP A;  3UDG A;  1GM5 A;  1VQL A;  4GOP C;  4QY7 A;  4YHH L;  1YZ6 A;  1SRO A;  4IFD I;  2AHO B;  2Q2I A;  1VQF A;  3GTQ H;  1EQQ A;  1QVG A;  4NXM L;  1D8L A;  1C7Y A;  1H95 A;  3I4M G;  3UDF A;  2IT1 A;  4A3M G;  1VQP A;  2EIF A;  3HKZ E;  2OTL A;  3ER0 A;  4C3I H;  4GLV B;  1PH7 A;  3HOU G;  3HOZ G;  4OWW B;  3PV0 A;  1TXY A;  4Y7N H;  2JA8 G;  2CFM A;  5M3F G;  4JI6 L;  4X66 Q;  1FJG L;  2JA9 A;  2MFI A;  1VCI A;  1G6P A;  1V1Q A;  4YY3 L;  2FXQ A;  4GOP B;  3BZC A;  1I5F A;  4DK6 C;  4A3I H;  3NEM A;  4JC0 A;  1E1T A;  1AE3 A;  4GLA C;  3TRE A;  1QZG A;  4QIW E;  5C4J H;  3PO3 H;  3T1Y L;  3H0G G;  3CCM A;  4JI6 Q;  2Q2T A;  1N33 L;  1CKN B;  2OQ0 A;  3JAM i;  1FJG Q;  4YCW A;  3S14 H;  5FJ8 H;  2Z6K C;  2R7Z H;  1Y1W H;  4PG3 A;  4O0A A;  2B63 H;  1XMO L;  2WB1 E;  4R4I A;  4AH6 A;  3S1R H;  4A3B H;  2F52 A;  5JJL A;  3F2C A;  2PQA B;  4A3D G;  3AYH B;  3HOV H;  3T1Y Q;  3M85 A;  1KHI A;  2D0O A;  3CCQ A;  1X3G A;  1YJW A;  3NEL A;  4GS3 A;  4BA2 I;  4P75 A;  2HIX A;  1V43 A;  4DV6 Q;  2ES2 A;  5HY6 A;  4DR7 L;  4A3I G;  2ZJP A;  1W3S A;  3JAM c;  1XMO Q;  2OTJ A;  3T1H L;  4IPG A;  2KHJ A;  3PUW A;  1PHJ A;  2IHE A;  3H0G H;  2XGT A;  4GNX A;  1XNQ L;  1JJC B;  1OXS C;  1OXX K;  3K81 C;  1Y1V H;  2UU9 L;  4DV4 L;  5FJ8 G;  2R7Z G;  1XTD A;  1CKN A;  2CWA A;  3RLO A;  2B63 G;  2MQH A;  1PH9 A;  2ZTE A;  4A3B G;  1PYB A;  3M4Q A;  3K80 C;  1VQ4 A;  1TWG H;  3HOV G;  4YCU A;  3CMA A;  1KC8 C;  4RG1 A;  1RL2 A;  1PH5 A;  1J6Q A;  1YJ9 A;  1NBW A;  1HNW L;  4A3E G;  2UU9 Q;  3BJU A;  4JI2 Q;  4YY3 Q;  3F2D A;  2PNH A;  4JBJ A;  4NXN L;  2K14 A;  4H02 A;  2PQA A;  1G51 A;  3KF6 A;  1E1O A;  4HIO A;  2HQL A;  3NBH B;  4JOI C;  2I0Q A;  3CCJ A;  3KF8 B;  2A1A A;  2PMZ E;  3A0J A;  4JI1 Q;  4JI3 Q;  5H1S E;  3J81 i;  2KBN A;  4UP7 A;  4QL5 A;  2BA1 A;  1PH2 A;  5C0X G;  5AJ3 L;  5IP7 G;  1C9O A;  2H5X A;  4GOP A;  3PO2 H;  2N8N A;  2UUB L;  1HR0 L;  4LF9 Q;  2EQS A;  2RHS B;  1WYD A;  2QA4 A;  1SLJ A;  2HHH L;  3I4N H;  1EFW A;  3I7F A;  2GVB A;  4R4Q A;  3W5O A;  4DV6 L;  4JYA Q;  3KJO A;  4UPA A;  1CUK A;  2UUA L;  3RLN A;  3E9I A;  3FHW A;  4HJA A;  1IBM L;  5IE8 A;  4JI4 Q;  1SR3 A;  4GLX A;  1A62 A;  2UUB Q;  1X54 A;  4P72 A;  3I4O A;  1K9M C;  2CQO A;  3AFP A;  4X65 L;  4MNO A;  2R92 G;  4DV4 Q;  1K3R A;  5C0X J;  4A3M H;  3S1M H;  2UXC L;  4HJ9 A;  4DV7 L;  2B3G A;  2MO1 A;  3UDI A;  1VQ6 A;  1I3Q H;  2IY5 B;  4DV2 Q;  1EIF A;  4XTC S;  4DR2 L;  2VUM H;  4C2M H;  5M3F H;  2K52 A;  1NMG A;  3IRB A;  4OWT B;  4R4C A;  4LUV A;  3U50 C;  1HR0 W;  1L1O A;  2K5H A;  2F4V L;  3HOY H;  2JEB I;  1I6H H;  1HNW Q;  5LMU L;  4A3C G;  4IFD G;  3K7U C;  1KL9 A;  2UXC Q;  2YYZ A;  1LYL A;  1MJC A;  3FKI H;  2C35 B;  1ASY A;  3GD7 A;  4A3F G;  2CKZ B;  5E7N A;  3S16 H;  2R6G A;  5C0X I;  1T9H A;  1YI2 A;  4DV5 L;  4L5T A;  4IJL A;  5M5X H;  1IYJ B;  4UP8 A;  1Q1E A;  3KFU A;  2BA0 A;  3HOW H;  4B3S Q;  4NB3 A;  2NZH A;  4KHP L;  4LWC A;  3CME A;  1UE6 A;  4GNX B;  5AJ3 Q;  1BVS A;  5GAH C;  3TRZ A;  1VQN A;  3ULP A;  2E2J H;  4A3D H;  4X6A H;  4OXP A;  4DR1 L;  2VUM G;  1WI5 A;  3STB D;  4GKK L;  1UWV A;  4A75 A;  3RNU A;  3I55 A;  3HOY G;  1K83 H;  1PV4 A;  4DV5 Q;  4KLK A;  4PZ8 A;  5GAD C;  4YHH Q;  3CCR A;  4JYA L;  1HNZ L;  2AWN A;  1X56 A;  4ALP A;  1HJP A;  4A3J G;  3GTK H;  3CPW A;  1V9P A;  2KEN A;  3FKI G;  3PF4 A;  1SN8 A;  4IPD A;  4WJ3 M;  4A3F H;  4QQB X;  3PUY A;  4JI4 L;  2OWO A;  1E22 A;  4LF4 L;  3ERS X;  4DR4 Q;  3S2H H;  4LFB L;  2R7D A;  1KQS A;  3E0E A;  2WB1 G;  3M7N A;  2E2H H;  2YV5 A;  3GTO H;  1EWI A;  1MKH A;  2K50 A;  3B6Y A;  3G4S A;  4EQ5 A;  2A8V A;  4DR6 Q;  3HKS A;  2PI2 E;  5ELO A;  1JMC A;  2K75 A;  1EUJ A;  1EQR A;  3ULL A;  3GTM H;  1N32 L;  1N36 Q;  4HJ5 A;  1QVC A;  2B29 A;  3UE1 A;  1K8A C;  5M5Y H;  2F4V Q;  4JI8 L;  3PGZ A;  4JV5 L;  1LUZ A;  1JB7 A;  3D31 A;  5BR8 L;  4BBS G;  1DGS A;  4DNI A;  2IHF A;  4LF8 Q;  1S3O A;  5IYD G;  3M4O H;  2CWP A;  2I5L X;  1WJJ A;  2VL6 A;  4LUZ A;  2NVX H;  3LGJ A;  1NMF A;  3J81 j;  2UUC Q;  4TVA B;  3CF5 A;  1L2F A;  2ID0 A;  2ASB A;  4JV5 Q;  1NY4 A;  1HH2 P;  5JEA G;  5IP9 G;  1OXT A;  3H15 A;  4GNX C;  3G6E A;  1OXU A;  1OTC A;  1VQC A;  4DV3 Q;  1VQ7 A;  4A3G G;  4JI1 L;  5BR8 Q;  4BY7 G;  4DR7 Q;  4ME3 A;  4C3J H;  1G29 1;  4IPC A;  2VQE Q;  4LF8 L;  4JI0 Q;  2BH2 A;  2BH8 A;  4APV A;  4O2D A;  5IY0 A;  5GQO A;  4YCV A;  4FDB A;  4GN3 B;  4JOI A;  5EAY A;  1HR0 Q;  2UUC L;  2E2I H;  1TWH H;  1Q7Y C;  2VZA A;  1CKM A;  1UEB A;  1VQD A;  2F3I A;  3E9H A;  3I2Z A;  3K7A H;  1JJ2 A;  4BBS H;  4IO9 A;  1PH4 A;  4DV3 L;  4HJ8 A;  5IYD H;  5LMN L;  1XNR L;  1AE2 A;  3UE0 A;  5IYB G;  2KCM A;  2VS1 A;  5FLM H;  1S40 A;  4JI0 L;  2JA7 H;  5C4X G;  5GRO A;  4DR4 L;  3CXC A;  2JJQ A;  4IFD J;  2ZTD A;  4DUY L;  2R92 H;  3ICE A;  1LM0 A;  1PA6 A;  2VY3 A;  5IP9 H;  3M4P A;  1KRT A;  5C3E H;  1WFQ A;  4A3G H;  1E7Z A;  3STB C;  1Q1B A;  2NZO A;  1HZB A;  2AWO A;  3ZJY C;  4HID A;  1VQ9 A;  2NVT H;  3DM3 A;  3RN2 A;  5JJI A;  1XNR Q;  4DV0 Q;  2A19 A;  4DV7 Q;  1XJV A;  2WAQ G;  4BA1 I;  2WFW A;  4C3H H;  1N36 L;  2YTX A;  4JI7 Q;  4KHZ A;  1PH6 A;  1YEZ A;  4A3C H;  4A4I A;  4B3T Q;  5M3M H;  2JA6 H;  5C44 G;  1E24 A;  3M3Y H;  2ALY B;  3CC7 A;  1Q8K A;  4JI3 L;  2KCT A;  5LMU Q;  3J7A 5;  3TS0 A;  1MIU A;  5FLM G;  5GAG C;  4DAM A;  4BY1 H;  2JA7 G;  4XIG S;  1YNX A;  4YWK A;  4LFC L;  3OW2 A;  1PH3 A;  4K0K L;  5IWA L;  3KLW A;  2UXD L;  1VQ5 A;  1L1O C;  1X3E A;  4P71 A;  1KD1 C;  1E3P A;  1QUQ B;  1Z9F A;  3M9B A;  2XTI A;  4IPH A;  4R4T A;  5C3E G;  2AMC B;  3TS2 A;  1KAW A;  1X3F A;  2NVY H;  2QGQ A;  4GKJ L;  4KHP Q;  3L0O A;  1VQO A;  4LF7 Q;  2HT1 A;  1YHA A;  1PYS B;  2MNA A;  4X62 Q;  2N3S A;  4B3M L;  2I5M X;  5IT9 c;  1B7Y B;  2VQE L;  2RCN A;  4HIK A;  3CD6 A;  3U4Z A;  3A5Z B;  3FP9 A;  1WOC A;  1VQG A;  4OON A;  4OX9 Q;  4A3L H;  4DUZ Q;  1FGU A;  2IX0 A;  1JE5 A;  5IYC H;  4POG A;  4RMF A;  3TQY A;  3PIP A;  3JC6 6;  1WCM H;  3EBE A;  3RR5 A;  1IBL Q;  2E5L L;  2VQF L;  4A3J H;  4A76 A;  4DR3 L;  4UY8 C;  1HZ9 A;  4GKJ Q;  4GN5 A;  1HNZ Q;  1TWA H;  1L1O B;  4AQY Q;  1A8V A;  4B3M Q;  2Z0S A;  2E8G A;  3UDX A;  1OXV A;  3F2B A;  3PSI A;  4DV2 L;  2LXJ A;  5ELN A;  3WWV A;  1YIT A;  1XMQ Q;  1EIY B;  1LTL A;  2Q2U A;  1QUQ A;  3CCL A;  4DR2 Q;  3PUX A;  1R9T H;  1IXR A;  3OTO L;  1M90 C;  4LF4 Q;  1X65 A;  4GKK Q;  3RZO H;  1BBW A;  4BBR H;  2YTV A;  1KIX A;  1SMX A;  4DR6 L;  2QEX A;  4NXM Q;  2Q2H A;  3F8T A;  4OWX B;  4A3K G;  3HOW G;  1X9N A;  1TWF H;  1WCM G;  3L2P A;  1N32 Q;  2KHI A;  3TEH B;  4YWM A;  1KXL A;  2DUD A;  3OTO Q;  3S15 H;  2JQO A;  3PCO B;  3HFZ B;  4A93 G;  1A0I A;  5DLQ E;  1IBK L;  3GO5 A;  4B3S L;  3RZD H;  2VNU D;  3AQQ A;  1JT8 A;  1BKB A;  2JK8 A;  1N34 L;  4LFA L;  3CC2 A;  1NTG A;  3GTL H;  4DR1 Q;  1AH9 A;  1VQE A;  2I5H A;  1VQ8 A;  5JEA J;  2RHQ B;  2UXB Q;  4JBW A;  1VQB A;  1I94 Q;  4LF5 Q;  3U58 A;  4BXX G;  3CP0 A;  4BBR G;  1NE3 A;  1C0A A;  3BU2 A;  4BY7 H;  3BZK A;  3Q8D A;  1YHQ A;  2ZTC A;  1ASZ A;  3J81 c;  2JE6 I;  1B70 B;  1IZ6 A;  1U5K A;  1IBK Q;  2ZJR A;  1Y14 B;  2R93 G;  2PI2 A;  4X62 L;  4LFA Q;  1VQH A;  3CCU A;  2L15 A;  3RLF A;  3W1G A;  3PUV A;  2NVQ H;  4DV1 L;  3RN5 A;  2HIV A;  5K36 G;  2E5L Q;  3A74 A;  4A93 H;  2CCZ A;  1Q86 C;  1GD7 A;  4DR3 Q;  1L0W A;  3NEN A;  3KF6 B;  2ZM6 L;  4LW1 A;  1RIP A;  5IYB H;  1N8R C;  2Z6K A;  4LF6 Q;  3GTG H;  5C4X H;  2JA5 G;  1I50 H;  1QZH A;  4KI0 A;  1U0L A;  3HKZ G;  4DV1 Q;  1UE1 A;  1M1K C;  1TWC H;  4HJ7 A;  1P8L A;  1MJE A;  1CSQ A;  1NJI C;  4JI8 Q;  3CCE A;  4L5R C;  1XNQ Q;  1B8A A;  1VQM A;  3MEF A;  3J80 c;  3HOU H;  5HGQ A;  4LF6 L;  3H3V H;  3HOZ H;  4X66 L;  1QVF A;  4PZ7 A;  5J3B A;  3MXN B;  3PUZ A;  3G48 A;  1FVI A;  2ATW A;  4UP9 A;  3G71 A;  1IL2 A;  1HZC A;  5M3M G;  2JA6 G;  3S1N H;  5C44 H;  2R7F A;  2EXD A;  2DGY A;  4P74 A;  4YWL A;  2YU9 H;  4JG2 A;  4B3T L;  4WJ4 A;  2N49 A;  4BY1 G;  4JI5 L;  4QGU A;  1W2B A;  1XPO A;  4LFB Q;  2JA5 H;  3PO3 G;  4GN4 B;  3VDY A;  3EIV A;  2JEA I;  3J80 i;  1A63 A;  1J5E Q;  4JI2 L;  2NN6 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...