3T1HQ

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16s rRNA
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3t1hQ00
2A8VA 2IHEA 4DR4Q 3ICEA 1GVPA 4TVAB 3RR5A 3AFPA 3B6YA 2ZM6Q 4NXNL 3T1YQ 2R7ZH 4A3BH 3K0XA 4A3FH 2ZJRA 2ZTCA 1XMOL 3TRZA 3W1GA 1CKOA 1X3FA 3HKZG 1J6QA 2ATWA 3K81C 4X65Q 1WOCA 3DLLA 3NBHB 2EQSA 5IYCH 3GTOH 2VUMG 4GN3B 4AQYL 2KHIA 3HOUH 4JI5Q 4YCWA 1X55A 4P72A 3T1YL 5IT9c 3M3YH 1U5KA 2HHHQ 3AEVA 3HOZG 3TS2A 4IFDI 4QL5A 5M3MG 1IBLL 4DV0Q 4AIMA 5IP7G 4HIDA 1YVCA 1SRUA 3AQQA 2NVXH 1O7IA 2PMZE 2BA0A 1SROA 1Q86C 5JJLA 4IFDJ 2R93G 3HOXH 1QVGA 1SLJA 4R1JA 4JI0Q 3PO3H 5C0XI 4A3KG 4OWXB 3GTQH 1VQ7A 2CKZB 3OTOQ 1D8LA 1S3OA 4LF6L 3GTLH 1DGSA 1PH3A 4R4QA 3CF5A 2JA6G 4A3DG 1HNXQ 4DNIA 2I0QA 1SMXA 4FDBA 2VNUD 2V1CC 4JV5L 2YV5A 3PSIA 4LW1A 3UE0A 3ULPA 3K8AA 4JCVE 3H3VH 4IFDG 4GKJQ 1CSPA 1CKMA 1VQ4A 3K7AH 4A3FG 3GTGH 1N36L 4DR6Q 1B7YB 1V1QA 4JG2A 5GROA 1TWCH 4DV3Q 1SN8A 2FXQA 2MO1A 3GDEA 3UDGA 1FVIA 3G48A 1W2BA 3I4MH 4DR7L 1VQHA 1Q82C 4B3MQ 4LFCL 5GAEC 4BY7G 4Y52H 3AYHB 5IYDG 1FJGQ 1X3EA 4JI3L 1VQPA 2F52A 3HOUG 2MO0A 2Z6KC 2HQLA 3TQYA 2QEXA 2GVBA 4P73A 3I2ZA 4DR7Q 4K0KL 3HOZH 4L5RC 4B3TQ 1Y1VH 4HJAA 2ZJQA 3I4NG 2EIFA 3KF8B 4A93H 4OONA 3I55A 1IXRA 1KQSA 3NENA 2K50A 2LXJA 1QVFA 2Q2IA 4GKKL 4LFCQ 4DV2Q 4EQ5A 1HZCA 1G6PA 1XPRA 1Q81C 4HJ8A 4GNXA 3KF6A 5E7NA 3CCUA 1I50H 5IY0A 4LFBQ 4KHZA 1YJWA 4DAYB 2YTYA 2KBNA 3NEMA 1XJVA 1PVOA 1IBKQ 3L0OA 4JI7L 4DR2Q 4IJHA 2K52A 2VW9A 3CCEA 2LXKA 3PUZA 3STBC 3T1HL 1PH9A 2UUCQ 1OXUA 3ER0A 3KDFA 3Q8DA 3RLNA 1XNQL 4IPCA 1JJGA 4GLXA 1GO3E 4OO1I 3FHWA 2CQOA 3CCJA 2EXDA 1X65A 4DV7L 1K73C 3L7ZC 1OTCA 4PZ6A 4UY8C 3BU2A 4GS3A 3PUWA 3I4MG 1QVCA 3CW2C 1T9HA 5FLMG 2WAQE 4YWKA 1QUQB 1LYLA 3FKIH 3S16H 4IOAA 4DV5Q 1J5EQ 4XIGS 5GQOA 4A3MH 3M4PA 5DLQE 5IP9G 3OTOL 3D31A 1RL2A 4R4TA 1Y1VG 5ELOA 2UXCL 2IX1A 2OQ0A 1I6HH 5LMNL 3GTJH 1VQOA 4DKAC 4B3SL 4OO1G 3RNUA 1XMQL 1FL0A 1X54A 3ERSX 1KC8C 4LF7Q 5K36G 5IE8A 1SFOH 2Q2HA 4DV1Q 4J15A 4JI4L 4JBKA 4IPGA 4JI0L 2R7ZG 3I7FA 2PQAA 2BH8A 1YHAA 4JI1L 1FJGL 4KHPL 3RZOH 4X66L 5C44G 4DUZL 1PH6A 5BR8Q 4JV5Q 5FJ8H 3IRBA 2Q2TA 2WFWA 2WB1E 2PQAB 3A5ZB 3CMAA 4A4IA 4OXPA 3GTPH 4A75A 4X62L 1EOVA 2N8NA 4B3TL 3HOWG 2VL6A 4LUVA 3STBD 5AJ3L 5J3BA 4X66Q 4Y7NH 3F2DA 1S72A 3GD7A 1HR0Q 4XTCS 4B3RL 2NVYH 4BA1I 4MNOA 5FLMH 1VS0A 5M3FG 4LNQA 3CD6A 5JJKA 4UP8A 1FGUA 1PHJA 3CC2A 4LF9L 2BA1A 2B29A 5BR8L 5C4JH 1RIPA 4A3MG 1Q46A 2OTLA 4HJ5A 1HZBA 3L2PA 2Q2UA 4NXML 3PF4A 4LFBL 2OTJA 2A19A 2I5LX 1IBKL 3S14H 3CCVA 4A3EG 1N33Q 2UUAQ 1PH2A 1K83H 4LFAQ 2D0OA 1YIJA 4A3LG 1TWHH 2AKWB 4UPAA 4QGUA 5C3EG 4A3KH 4LF4Q 4NXMQ 4GLAC 3GTKH 2UXDQ 4DV6Q 4WJ3M 1VQLA 3S15H 3BJUA 4PZ7A 1R9TH 1U0LA 3S1QH 1E1TA 3H0GG 3AFQA 4OWTB 1C7YA 1BKBA 1A62A 3F1ZA 3KLWA 3PUYA 2I5HA 4MTNA 4AQYQ 2HIVA 2RCNA 3KYHC 1QZHA 1M1KC 4LF4L 4YHHQ 4LFAL 1Z9FA 3I4OA 4YCUA 4AH6A 4EX5A 3CCRA 1KAWA 5C44H 5IWAQ 1JJ2A 4HIKA 2OCEA 5FJ8G 4DR2L 1VQ8A 4RG1A 3OW2A 1BVSA 1YJ9A 2UXDL 3J7ZC 5M5WH 4QIWE 4C3HH 1HNWQ 2R7DA 3HOWH 3PO2G 1MJCA 4BY7H 1UWVA 4DV4L 3PUXA 2DGYA 1OXTA 3UDFA 2WP8J 5M3FH 2N78A 3JC66 4X65L 3ULLA 3JAMc 2PI2A 4AYBG 2KCTA 2VQEL 4IPDA 1N8RC 1VQMA 4A93G 1Q12A 4RMFA 2N3SA 4A3EH 5C0XJ 3TEHB 1YBYA 1Z47A 5HGQA 1VQFA 1MJEA 5IYBH 1CSQA 2VQFQ 3M9BA 3G6EA 4GKJL 4A3LH 1C0AA 5H1SE 5JEAG 2PNHA 3A5UA 4IO9A 3S24A 1Y1WH 4DUYL 4POGA 2K5HA 4C2MH 4HIMA 1OXVA 1X3GA 1HZ9A 1HZAA 3H0GH 3W5OA 2VQFL 4BBSG 1VQIA 1TWAH 4JI2Q 1WI5A 3EBEA 4POFA 1VQ5A 1V43A 2E5LQ 4LF9Q 1HR0W 4KLKA 4LF7L 3M85A 2F4VL 1VQBA 1WJJA 1YHBA 1OXXK 2NN6I 1K9MC 1H95A 4JBMA 1A0IA 2UU9Q 1VQDA 1Q7YC 4R4IA 1Q8KA 1E7ZA 3F2BA 3RN5A 3PO2H 4DK3C 1WFQA 5EAYA 4O0AA 3FKIG 3LGJA 2F4VQ 3CCQA 2K5VA 1VQ9A 4LF5L 2ZJPA 1N36Q 4DR1Q 2R92G 2ES2A 4DR6L 1L1OC 1UEBA 5IP9H 2JA7H 2JA8H 4WJ4A 1UE1A 3F2CA 1AE3A 1TWGH 3RZDH 1KIXA 3HOYH 4A3CG 4YY3Q 4ALPA 1YITA 4PMWA 2B3GA 4LF8L 4P75A 4OWWB 4R4OA 2C35B 1HR0L 1VQJA 3PIPA 4HJ9A 3PGZA 5LMUL 4K0KQ 2JQOA 3CXCA 4JOIA 5GAGC 1UE6A 5IYBG 3CCSA 2XTIA 2NN6G 3J81i 3NELA 1PH4A 4YCVA 1G291 1V9PA 4LF8Q 1ASZA 3J80i 3U50C 4X64Q 1GKHA 1I3QH 1NBWA 3CP0A 3U58A 1A8VA 2UUAL 1X6OA 1EQRA 1EIFA 1VQCA 2AMCB 1E24A 4C3JH 3A74A 1KD1C 2F3IA 4JC0A 3KJPA 3JAMi 2ASBA 3CC4A 3S2HH 4A3JG 1Q1BA 4X64L 4DR4L 3T1HQ 3HKZE 1N34Q 5M5XH 1HNZL 5ELNA 2ZM6L 1N32Q 1K0RA 1I94L 1EFWA 2Y0SG 2IX0A 2LSSA 2PI2E 3TS0A 1QZGA 4DV7Q 1XNQQ 1XMOQ 4LUZA 2CWAA 4UP9A 4DPGA 1WYDA 3CC7A 1XMQQ 2JA5H 3CQZH 2R92H 4X6AH 3J81c 2JA8G 1XNRL 1I94Q 1X9NA 3H15A 1IL2A 5C0XG 1ASYA 3HOVG 3KOJA 5M5YH 1M90C 1IBLQ 1Y14B 4QJFA 2NVQH 3OYYA 3ULJA 3PUVA 4ME3A 4A3GH 5C3EH 1AE2A 4DV0L 1VQGA 3CPFA 5LMNQ 1I5FA 4OX9Q 2A1AA 3RLFA 1PV4A 1LUZA 1JE5A 4JOIC 1XPUA 4A3DH 4QQBX 3J7A5 2E2JH 3EN2A 3BZCA 1YI2A 3U4ZA 4A76A 1YHQA 4O2DA 1E22A 4LF6Q 4JI4Q 1WCMG 2E8GA 2HIXA 5LMNW 4LF5Q 5JJIA 1IYJB 3CMEA 4DV1L 1HJPA 4JI1Q 4A3JH 1YEZA 1HNXL 4DUYQ 5GAHC 1L1OA 4JYAL 1EWIA 5C4XG 4DR5L 3SGIA 2K14A 4OX9L 3S2DH 1KXLA 2VS1A 3KFUA 2XGTA 1B70B 3ZJYC 2AHOB 4YWMA 4IOCA 1E3PA 2NZHA 4IPHA 4JBWA 2JA9A 1NMGA 4GN4B 1XPOA 4A3BG 2E2IH 4DV6L 4DR3L 2JA5G 2K4KA 4B3RQ 4DR5Q 5JEAJ 3MEFA 1NE3A 2UU9L 2YTVA 3BZKA 1BBWA 1VQAA 2YTXA 4GNXB 2JJQA 3HOVH 1CKNB 1IBMQ 1VCIA 1GD7A 5FLXc 4P71A 2GN5A 1NMFA 1LTLA 3F8TA 2OWOA 2QA4A 2VUMH 1Q1EA 2D62A 2K75A 4APVA 4A3GG 4BXXG 4UP7A 1Y1WG 1JT8A 2AWOA 4GOPA 1E1OA 4GKKQ 1PFSA 4KI0A 1HNZQ 3H3VI 1D7QA 2KHJA 2GVAA 2RHSB 4H02A 2JK8A 5M3MH 5IP7H 1S40A 4BBSH 1YZ6A 2I5MX 2JEBI 4BBRH 1VQEA 3E9IA 4GOPB 1B8AA 2KENA 4GOPC 1PH1A 1IBML 2B63G 3GTMH 2WAQG 1A63A 3CCLA 2RHQB 4NXNQ 3DM3A 2H5XA 2R93H 3HOXG 1JJCB 1EQQA 4JI7Q 1WCMH 2UUCL 2BH2A 4MZ9A 2UXBQ 1L2FA 1PYSB 4JI6Q 1XNRQ 3K7UC 1HH2P 3RN2A 5C4XH 5IWAL 3KF6B 3UDXA 1EUJA 4LWCA 3G71A 1L1OB 2ZTDA 4YHHL 4BA2I 4NB3A 1L0WA 1MKHA 2L15A 3HFZB 1N34L 1KRSA 2JA7G 3RLOA 1KHIA 2R6GA 4DV4Q 4L5SA 3HOYG 4A3CH 4HJ7A 1J5EL 3W1BA 3PCOB 1PH5A 1VQNA 1HNWL 4JI5L 4A3IH 2K5NA 1SR3A 5GADC 2HHHL 3PV0A 1KL9A 2VY3A 4YWLA 2E2HH 3E9HA 1BBUA 4JBJA 3CPWA 5IYDH 1CKNA 4R4CA 2YU9H 1AH9A 3J81j 2ZTEA 4GLVB 2NZOA 2R7FA 2WB1G 3K80C 4LUOA 3J80c 2VQEQ 4NPSA 4PZ8A 3S1RH 1PH7A 4BY1H 4BXXH 2IY5B 2UXCQ 2QGQA 3M7NA 1X56A 2MQHA 1VQ6A 3I4NH 2DUDA 1JB7A 1K3RA 3WWVA 1MIUA 3E0EA 3EIVA 4BBRG 2ALYB 4PG3A 2B63H 3S1MH 2MFIA 4C3IH 3FP9A 4HIOA 1EIYB 1PA6A 3CCMA 4L5TA 4DV5L 2MNAA 4DR3Q 1K8GA 4YY3L 2JEAI 1TWFH 4JI2L 2CFMA 1IZ6A 4AYBE 1NTGA 4KHPQ 4DV3L 2E5LL 2UUBQ 4DUZQ 2N49A 4X62Q 3U4VA 1VQKA 2JE6I 1KRTA 1YNXA 4JI8L 4GNXC 3A0JA 3UE1A 1N9WA 3PF5A 4JI3Q 3S1NH 4QY7A 1SE8A 4L5QA 4B3SQ 4JYAQ 3KDFB 3D0FA 1YJNA 1LM0A 3CAMA 4A3IG 1P16A 3S17H 3VDYA 4JI8Q 2CCZA 2HT1A 1UE7A 4GN5A 1GM5A 2CWPA 1TXYA 2Z6KA 3M4QA 5IYCG 3TREA 2UUBL 4DR1L 5HY6A 1N33L 3GO5A 3MXNB 4P74A 1G51A 2Y0SE 2NVTH 2AWNA 1P8LA 1CUKA 2UXBL 1QUQA 1PYBA 4BY1G 4DV2L 4TQUS 3KJOA 1XTDA 4JI6L 1N32L 2VZAA 1JMCA 3UDIA 2YYZA 5LMUQ 2KCMA 3M4OH 2ID0A 2Z0SA 4B3ML 4DK6C 1W3SA 1K8AC 1OXSC 2D0PA 2RF4A 4DAMA 3G4SA 5AJ3Q 3HKSA 2IT1A 2OQKA 4IJLA 2IHFA 3I56A 1EYGA 3PO3G 1NY4A 1NJIC 1UE5A 1C9OA 3PIOA 1PH8A 2JA6H
chains in the Genus database with same CATH superfamily
4FXKC 2CH4W 4WRDA 1R4PB 4HMIA 4DNRB 4TVAB 3B6YA 3T1YQ 4NXNL 3QG1A 3DWAA 4QUFA 1XMOL 3J7AF 4RKLA 3TRZA 3S14B 3HKZG 3MHBA 5CV7A 5D14A 3FPPA 4AQYL 1TWAB 1CA5A 3T1YL 2B39A 3M3YH 1U5KA 2EDGA 4N8X1 3AEVA 3NK9A 3HOZG 3TS2A 4QL5A 5M3MG 1IBLL 5IP7G 4HIDA 5I2YA 3AQQA 1EY7A 5CYUA 3I8ZA 2BA0A 1SROA 4IFDJ 4QF4A 2R93G 2F4IA 4R1JA 4P2CB 3W2DA 5BN3A 1S3OA 4QB4A 4LF6L 2JA6G 4A3DG 1HNXQ 4DNIA 2I0QA 1SMXA 4JV5L 4NP5A 4HCSA 3ERQA 1CSPA 2BOSA 1VQ4A 1VF5C 3K0YA 4A3FG 3GTGH 4DR6Q 1B7YB 1JB7A 1RODA 1W2BA 2B2TC 4LFCL 5JPMC 1H9KA 1VQPA 4E6IA 3CKIB 1TU2B 1HTPA 2ZJQA 3PQIA 4U673 1QVFA 5M9OA 4LFCQ 4DV2Q 4EQ5A 2BE5C 3KF6A 5E7NA 4LFBQ 1YJWA 3NEMA 3DHQA 3MZ5A 1SBBB 3STBC 2UUCQ 3TSSA 4Q0FA 2XRQD 3R8BA 1JJGA 2MPMA 4KMUC 2F0NA 2WIIB 4GLXA 3SEBA 3K7AB 1JC7A 3NSWA 4OO1I 3FHWA 4RHRA 2EXDA 4LJZC 3RD4A 3OIPA 3KLSA 3HG9A 1QVCA 4K5XA 3I4MG 1T9HA 2TSSA 4YWKA 3VR3A 4DV5Q 1J5EQ 4XIGS 2OEOA 3A8IE 4CDCC 3FVQA 3SE0A 3SHLA 3OTOL 2IX1A 3K59A 5K5PA 1I6HH 3GTJH 1VQOA 3SK8A 4DKAC 4OO1G 5K36G 4XT1B 1QNKA 4ILWA 4JBKA 4JI0L 1TS4A 2XRSD 1TVXA 4JI1L 2PPBC 1FJGL 4KHPL 2KECA 2X69A 5CBAE 1I4GA 5FJ8H 4A4IA 1EOVA 4B3TL 3H91A 3SK4A 4K6DA 1TR5A 2DJGC 3C3LA 3GD7A 5JJKA 5M3FG 4LNQA 1VS0A 1RHPA 1U4PA 3TP8A 1HCZA 3A8KE 3OSOA 1JWMD 4G4KA 3TBIB 1QNUA 4A3MG 2CHBD 1CHPD 2DJFC 4NXML 1EQVA 2I5LX 1FNUA 1PH2A 3K5MA 1T5XD 2XIWA 4XYOA 3UI2A 1TWHH 4QGUA 4A3KH 4LF4Q 3GTKH 4DV6Q 2K03A 1A3UA 3VYUA 1KDBA 1E1TA 3H0GG 4OWTB 4ZUJA 4ZKBB 3KLWA 2OXPA 5DM63 1C7YA 2ASBA 2A68C 1M1KC 1B1ZA 2PW5A 4XYQA 1VMPA 1D5MC 1F2LA 2BDNA 4H0LC 2OCEA 5FKAC 2B63B 3OMCA 2EYLA 1BVSA 5CR3A 3R93A 4QIWE 2PNRC 2EPBA 3HOWH 3PO2G 1G2SA 4DV4L 2DGYA 5CMDA 1OXTA 3UDFA 4MHEA 2RVLA 5IGBA 1PRTF 1Q3LA 3J7AV 1O80A 3P7JA 4IPDA 3S2HB 4RMFA 1E2ZA 1YBYA 3I90A 1MJEA 5IYBH 1CSQA 2JA8B 4GKJL 1TWGB 3VYRA 4TSSA 4H13C 4H7BA 2N55A 4DFAA 1Y1WH 2K5HA 1OXVA 1STAA 1HZAA 1EY0A 2B2WC 2VQFL 1BNZA 5C3XA 3KBXA 4NMZA 4LF7L 3M85A 4JVZA 1VQBA 1K9MC 1OXXK 1SNOA 1A0IA 4K8IA 3QB3A 5FO9B 1D1KA 4UAIA 4FO2A 2F4VQ 3GTKB 2K5VA 4DR6L 3TP7A 5I2XA 1UEBA 2KCNA 1TT2A 5FLXL 3N6RA 2G9HD 4YY3Q 4ALPA 1YITA 4P75A 5JJZA 4C1NI 1HFNA 1S5DD 1SYGA 3PGZA 1YNJC 2B2UA 2PO4A 1HFGA 3CCSA 4WORA 2XTIA 3J81i 4DAVA 4KK7A 4LF8Q 1TWCB 1ASZA 2Y0SB 1C48A 2UUAL 2F0DA 2MJ8A 2AMCB 4C3JH 4JC0A 2PW7A 3KJPA 4X64L 4IZ8A 4EQOA 1N32Q 1K0RA 2CQAA 1KLGD 2Y0SG 3Q22A 4IURA 2KA7A 3TS0A 4DV7Q 1QZGA 2H4OA 4TRDA 1Y1WB 2ICIA 4RCNA 4DPGA 1STEA 1WYDA 2EJMA 3CQZH 4XDXA 3A55A 2JA8G 1Q90A 2EJFC 3HOVG 3GTLB 5IGCA 3OYYA 1XXGA 1AE2A 1MHWC 1D5ZC 2BDOA 2B2YC 1LT3D 2A1AA 1LUZA 1JE5A 1I3QB 1M4VA 2SDFA 4QQBX 1BQQT 2A74C 3EN2A 2E2JH 1GUWA 1YHQA 1XX8A 1PZID 1X3QA 4LF5Q 1NR2A 3NUCA 4JYAL 4DR5L 3S2DH 1D2BA 3KFUA 4KV6A 1U4RA 2AHOB 3CHBD 2NZHA 4I7ZC 4CJ2C 4JBWA 3AMUA 1NMGA 5T1IA 5LL6S 4A3BG 2E2IH 2Z1CA 2JA5G 1EWHA 1SE2A 2HCIA 4GNXB 1VQAA 2YTXA 3I72A 2JJQA 5C0XH 1ENAA 2FINB 4P71A 3F8TA 1LTLA 1JR0D 4X3TA 2VUMH 1Q1EA 2M00A 3AU7A 4APVA 1JT8A 4A3IB 4BXXG 2CW0C 3SK6A 1ICFB 2LY7A 4ODGA 3NWSA 3TZUA 4KI0A 3MTSA 4K8JA 3I91A 1D7QA 2KHJA 1B3AA 2GVAA 5A2QE 2I5MX 4BBRH 2X6GA 2A6HD 2KENA 2SOBA 2KHSA 3VR4A 2GA4B 5ELCA 3DM3A 1JJCB 1Y8OB 1ZEQX 4JI7Q 4ZKCB 1TWFB 3K7UC 3SDZA 3KF6B 3UDXA 1AP0A 2QCPX 2MGSA 3G71A 1L1OB 1LTRD 3MFYA 5I9OA 1YNNC 4IUNA 2R6GA 4K2LA 3DEPA 1DJRD 1HHVA 3G7LA 1ET6A 1STGA 3R3OA 2RBMA 3CPWA 2NN6H 2K5QA 2WB1G 2NVYB 2IY5B 2EZVA 2UXCQ 1Q8IA 1TS2A 2C9OA 1VQ6A 1PYWD 1EEFD 1AW7A 3WWVA 1MIUA 4IUTA 3GTOB 3FP9A 2Q8IB 4HIOA 4POGA 4DR3Q 4DV5L 2MNAA 1TWFH 1IZ6A 2NWGA 4AYBE 4DV3L 2I07B 2E5LL 1CQVA 2N49A 4DAYA 5J39A 2JE6I 3D6WA 4F88A 5C5LA 3PF5A 1EU3A 3S2DB 4A3IG 1CTMA 3VDYA 4G7HC 4JI8Q 1N33L 3TREA 3GP7A 5HY6A 3H09A 4MTKA 2NVTH 2MUYA 3X3MA 1F9SA 2UXBL 1QUQA 1RTNA 2TMPA 4BY1G 3I73A 4DV2L 1XTDA 4JI6L 5EPJA 1KDCA 4HTHA 4LMQD 1HQRD 1JQYD 1J9OA 2BCOA 1OXSC 3Q23A 3L9AX 3HKSA 5A2QL 3P20A 1KLUD 1EYGA 1NY4A 1UE5A 1TKWB 1EY5A 3ZYYX 2NB0A 1F9QA 1QE6A 1EYCA 2QDBA 4A3JB 2IHEA 4DR4Q 2Z9HA 4FF3A 1RCVD 2L0CA 1GVPA 1KDAA 3RR5A 1H9RA 5COYA 5KNDA 2ZM6Q 1WTVA 2R7ZH 3NPPA 4OEMB 3GTGB 1O7LA 1J8IA 1JCKB 1NR4A 2WB1B 3H94A 1H9SA 3FDTA 1J6QA 1JOOA 4X65Q 3GTOH 3NBHB 1VDZA 2R61A 2VUMG 1EU4A 3V96A 2KHIA 1IW7C 4EQPA 3NBHA 1WTPA 4IFDI 4DV0Q 2JA7B 3J81E 3MXGA 1PLFA 2ZXRA 3DWPA 4ZQ3A 1O7IA 2EYHA 1EZ6A 3HOZB 3PO3H 4JI0Q 1EIHA 5EKLA 5I4DA 1D8LA 1DGSA 4XXEA 2JA6B 4A3DB 3CF5A 1G2TA 2VNUD 2YV5A 4KKSA 4LW1A 1GUGA 1D5XC 3UE0A 3ULPA 3H3VH 5D3DA 4GKJQ 1CKMA 3K7AH 2B2YA 4I65A 2E74C 4JG2A 1LTAD 2SEBD 1SN8A 2M2LA 2MO1A 1FVIA 3I4MH 1VQHA 5G3LF 3RMHA 1Q82C 3AYHB 4TKOB 2KEDA 5IYDG 2D5DA 3MC0B 1FGBD 1CZWA 2Z4HA 2GVBA 3L3OC 3I2ZA 2A6HC 4M8AA 3OW7A 2VB3X 4L5RC 2R92B 4A93H 4Q5VA 3I55A 3S16B 4GKKL 1HZCA 1XPRA 1Q81C 1I50H 5IY0A 4KHZA 4DAYB 3PIO3 1XJVA 1PVOA 1IBKQ 3L0OA 4BS9A 1HXYD 3LWUA 3HKZB 1QCBD 2E2IB 3PUZA 1HUMA 1PH9A 3ER0A 3QIAA 3D8GA 1TIID 3RLNA 1XNQL 4IPCA 1GO3E 1PTOC 2QDLA 5E3FA 3CCJA 1Z6HA 1X65A 1K73C 2MP1A 3L7ZC 4UY8C 3MEHA 4GS3A 5FLMG 3BVMA 4IUVA 3S17B 1QUQB 2RDFA 2G9DA 3KLRA 3NTKA 3D31A 1RL2A 4ZAIA 3KK7A 1QB5D 1EOTA 1W6JA 1LT4D 4J6HA 3PMFA 1KC8C 1FYCA 2MHVA 2Q2HA 1GHJA 1RTOA 2R7ZG 3I7FA 4HAEA 2QILA 5F2DA 3TN2A 4X66L 2RCFA 3FEWX 3E5SA 5C44G 2Q2TA 2WFWA 1SNCA 3CMAA 2O2LD 4A75A 1PTOD 2E75C 3U9OA 5IT9L 3HOWG 4X3UA 3TZDA 5M3MB 3MAQA 4B3RL 1S72A 2NVYH 3NQIA 4MNOA 5C4XB 1PRTB 1XTCD 1FGUA 3A54A 1JB3A 1PHJA 2HCCA 1Z7TA 1CQFA 4LF9L 5C4JH 2OTLA 4LFBL 4HJ5A 2OTJA 3DEOA 3S14H 1N33Q 3PIP3 5M3FB 1K83H 4LFAQ 4OHJA 2D0OA 3EROA 2KEEA 1TS5A 4UPAA 5C3EG 1XWEA 2L4NA 3BZDB 4IN3A 4NXMQ 1I4XA 3BJUA 4PZ7A 3VA7A 1U0LA 1WTXA 2F0WA 3DUZA 1BKBA 1A62A 4CHTB 3PUYA 4HEDA 2HIVA 4LFAL 1QZHA 4LF4L 4YHHQ 4WFN3 1DCZA 4YCUA 4AH6A 4EX5A 3CCRA 1KAWA 1JJ2A 4HIKA 2H1EA 4DR2L 1VQ8A 1YJ9A 3J7ZC 5D65A 5JOBA 1WD0A 2PZTA 4K6LA 2F3VA 3ULLA 3H3VC 2KCTA 2VQEL 1DONA 1JORA 1A3VA 1N8RC 1NSNS 1Y69U 4QUCA 2N3SA 1EY6A 5C4HA 3NE5B 5C6AA 3G6EA 1C0AA 5H1SE 3A5UA 1MBYA 1PFMA 5EKKA 3S24A 4IO9A 1SE4A 5EPKA 4FNFA 2I46A 4HIMA 1X3GA 1GHKA 1VQIA 4DA2A 3HOUB 4JI2Q 1EWCA 1K0SA 2IX3A 1H95A 2UU9Q 1VQDA 2EY1A 1Q7YC 4R4IA 1Q8KA 1WFQA 2AQ1B 1QILA 4O0AA 2KJXA 1ESRA 3LGJA 2ZJPA 4DR1Q 2JA7H 2JA8H 1PMRA 1AE3A 1TWGH 2E2HB 4PMWA 2C35B 4XQJA 1HR0L 1VQJA 1U4MA 5LMUL 2JQOA 4G57A 4JOIA 5GAGC 5DEHA 4CKEA 5ELDA 1RF2D 2Q8RE 1I3QH 1NUCA 1NBWA 1I4QA 3CP0A 4RGOS 1X6OA 1PZJD 5EBDA 1E24A 3VR2A 3LX0A 5ISRA 1MGSA 3CC4A 1Q1BA 4YIJA 3RZOB 1EFWA 3GTPB 2IX0A 2JYOA 1XNQQ 4ZLTF 4LUZA 4UP9A 2B8FA 2R92H 4X6AH 1XNRL 5C0XG 4JK1C 1ASYA 2RQXA 3X3NA 1Y14B 1BCPF 3I4MB 1SNDA 5C3EH 5DM73 1VQGA 3M4OB 2K28A 3RLFA 1AFPA 4HCEA 1V1OA 3J7A5 3BZCA 3U4ZA 4A93B 1E22A 5KNCA 1WCMG 2E8GA 2HIXA 3C1FA 1HJPA 4JI1Q 1YEZA 2F0VA 4DUYQ 1WTRA 1L1OA 1LABA 1SNPA 1KXLA 1I50B 2XGTA 1B70B 3ZJYC 2R93B 4YWMA 1F2YA 4J8QA 5KRUA 5DNFA 4LK1C 2K4KA 2OF1A 4DR5Q 5JEAJ 3MEFA 2F0LA 1BF4A 1GUTA 3BZKA 1BBWA 1BCPC 3NTIA 2GN5A 1NMFA 3VYTA 4RGNA 2K75A 3WDNA 4UP7A 2E76C 1Y1WG 1PFNA 1F9RA 3FKIB 1E2VA 3H3VI 3CU7A 1S40A 2RHSB 1BDOA 2NTTA 4EVOA 1PH1A 2B63G 3GTMH 1S5FD 3CRKC 4NXNQ 3HOXG 1ZKOA 5AFWA 2L1BA 5LL6X 5C4XH 1AN8A 2J4XA 2CH4A 4LWCA 3WOEA 4YHHL 1MKHA 2IL8A 3HFZB 2NZ1D 1KRSA 2JA7G 1KAAA 1KTKA 4RH6A 1DM0B 4DV4Q 4L5SA 3PCOB 3SXHA 1PH5A 3CRLC 1A2UA 4C1NK 2FMCA 3PV0A 1BBUA 4MN3A 2EY5A 1CKNA 4R4CA 3CQZB 2ZTEA 2PQEA 2K32A 2VQEQ 3S1RH 1R9TB 2F1MA 4PZ8A 4BY1H 1ML0D 2F0OA 2QGQA 5E4XA 1SXTA 1X56A 3K5OA 2MQHA 3HOWB 4N8FA 3I4NH 1K3RA 2KOLA 4C56C 2FFKB 3E0EA 1V8QA 5T1GA 3KF8A 3S1MH 4C3IH 3WOFA 2UXCL 2K6AA 2WKDA 5IT9E 4CJ0B 1F77A 1DOLA 4L8JA 2UUBQ 4DUZQ 2A68D 4X62Q 3U4VA 2WAQB 1VQKA 3S1QB 4GNXC 4A3BB 1NCVA 2F0JA 3A0JA 3S1NH 4QY7A 4A3FB 1D1IA 1K28A 3KDFB 2HT1A 2UUBL 1TXYA 2DY8A 2N88A 2B2VA 1UNSA 4DR1L 4FYDA 3V2TA 3A7LA 4P74A 5KGUA 2Y0SE 2AWNA 4K5VA 1LO5D 3K5NA 4QIWB 2IWHA 1JMCA 1I6HB 5LMUQ 4B3ML 2P5ZX 4DK6C 1GOZA 4DAMA 5EJWA 4B08A 4IJLA 2OQKA 2K7VA 1K8OA 1NJIC 2LS01 2IW3A 2Z6BA 1II3A 1DOKA 1U9RA 1PH8A 4OIKA 2JA6H 4KD4A 4A3DH 3GV6A 3ONAB 2Q8TA 3AFPA 2M9VA 3D3RA 4A3BH 1GUOA 4CKBA 4A3FH 2ZTCA 3BDOA 1BCPD 2RKSA 1DYQA 3W1GA 1I4PA 1CKOA 4F8MA 3K81C 1WOCA 2QEJC 5IYCH 1IYUA 4YCWA 1X55A 2RSNA 4F7XA 5IT9c 1SDFA 2HHHQ 2QF7A 2CVRA 2VB2X 1U4LA 4AIMA 1YVCA 2HUGA 5G3LD 3NXWA 1Q86C 5JJLA 1STYA 2L9HA 2K01A 5EPLA 3GTQH 1CT1D 5L37A 1PH3A 4R4QA 4BY7B 2F0IA 3EJIA 1CHQD 2V1CC 3PSIA 2F0TA 3K8AA 1EFID 1MD2D 1PH4A 2FXQA 3GDEA 4DR7L 3P1HA 3QO2A 4BY7G 2ZT9C 3Q6SA 4JI3L 2F52A 3HOUG 2MO0A 2Z6KC 1WD1A 2JP1A 3D6CA 4P73A 4C2MB 4K0KL 2JA5B 2EIFA 3KF8B 1IXRA 1KQSA 2K50A 2LXJA 5KYIA 3JAML 1G6PA 1SJED 3HS0C 3BS1A 4HJ8A 2NBFA 2FHTA 3CCUA 2KVMA 2YTYA 2KBNA 3NWTA 4RA8A 1ZYRC 4JI7L 2F0SA 2RSOA 4G7ZC 4DR2Q 4IJHA 2K52A 1A3TA 2AQ2B 1L0XB 2LXKA 3T1HL 4K2KA 5C3WA 1OXUA 4UHVA 1SMYC 3HEJA 3KDFA 3Q8DA 3KBGA 2VXWA 5KEEA 3TMEA 1CA6A 2JSOA 1BCPB 2CQOA 1OTCA 4DAPA 2B2UC 3BU2A 3PUWA 3CW2C 1D6EC 1WTHA 2J7ZA 4HMJA 5FK9C 2R3ZA 3FKIH 4IOAA 3S16H 4I7AA 3LNNA 4A3MH 3M4PA 2RDHA 5DLQE 5IP9G 2SNSA 3IFTA 1FD7D 2LMCB 4NW2A 2EYOA 1Y1VG 2XNAC 2RA4A 3OWFA 4CDEC 1SYEA 5LMNL 3ND9A 4B3SL 4J1MA 1DD2A 3ERSX 4LF7Q 5IE8A 1F2MA 4JI4L 4IPGA 4N9TA 2PQAA 2BH8A 1YHAA 4A3KB 2PZUA 4L63B 4RCOA 1PH6A 1JE4A 3HGBA 5BR8Q 1IKLA 2WB1E 2PQAB 3GTPH 1S4ZA 5IGFA 1H9MA 4OXPA 4ZCKA 4X62L 1G8ZD 2N8NA 3DM1A 1TY0A 1V1PA 2VL6A 3STBD 5AJ3L 5J3BA 1UUPA 3SK5A 1QWYA 4X66Q 4Y7NH 3F2DA 4XTCS 4BY1B 4BA1I 4UP8A 2EOTA 2BA1A 4HSPA 1EL0A 2B29A 5BR8L 1RIPA 1PZKD 1HZBA 3L2PA 3PF4A 2A19A 1IBKL 4PMCA 5FOBB 3CCVA 2UUAQ 2A6EC 3U9SA 1EIGA 4OO1H 3FMCA 4WJ3M 4ZRZA 4GLAC 1LT6D 3GV3A 3M4YA 2ICEC 3S15H 3S1QH 1R9TH 2NTSA 1O78A 3BDCA 4FXGC 1E2WA 3ND8A 3F1ZA 4NDXA 2K33A 3DMUA 2RCNA 3KYHC 1Z9FA 3A8JE 3O13A 5IWAQ 5FJ8G 4FXDA 3OW2A 3GTQB 3C46A 5M5WH 1QJOA 4C3HH 5LHY1 1MJCA 4O1NA 4KD3A 4ID6A 2WP8J 4KY5A 4HSVA 2EYPA 3VR5A 3NHHA 4X65L 3RZDB 3I70A 4AYBB 1VQMA 1S5ED 4A93G 1Q12A 1SNMA 4A3EH 1SAPA 3TEHB 3NP8A 1Z47A 4ZUIA 1I4RA 1VQFA 3QWNA 2F0GA 3MFGA 4A3LH 5JEAG 2F0KA 1HZ9A 3NQTA 4BBSG 3URYA 4ZK9B 4C3JG 5M5YB 1TWAH 4DXGA 2C5CA 1WI5A 5EBCA 1WTQA 3EBEA 1EYDA 4POFA 1V43A 4LF9Q 1HR0W 1R4QB 1YHBA 5JAVA 1LTBD 1E7ZA 3F2BA 3RN5A 3PO2H 1B2TA 4DK3C 5EAYA 3EVQA 3FKIG 3T56B 2R92G 2ES2A 1L1OC 5IP9H 2F0FA 1UE1A 3F2CA 3RZDH 1KIXA 1PTOH 3T16A 1B44D 2B3GA 4DXFA 4OWWB 2FMMA 2K1BA 3F2UA 2EY2A 2B8GA 1ESFA 4HJ9A 2AUKA 4FP5D 5FO7B 4DN4M 5IYBG 4FVMA 1MI2A 2A73B 2J0TD 3NELA 5M5WB 4YCVA 1G291 5IGGA 1B9NA 2Z4IA 5NUCA 3U58A 1A8VA 5CV8A 4FF4A 2O4XA 4QCLA 1LTGD 1VQCA 5FO8B 1KD1C 2F3IA 3JAMi 1PRTD 4B9WA 5I6YA 4CDDC 4OGQC 1A15A 1HNZL 5ELNA 5CV6A 1I94L 2F03A 1LLRD 3PO2B 2F0MA 1XMOQ 2CWAA 1ILQA 3CC7A 1XMQQ 2A5HA 4KJOA 2JA5H 1HRJA 1SEBD 2FJ2A 1LV9A 4KN4C 2HQEA 3SR1A 1IL2A 2XSCA 4CDFC 3KOJA 3QOLA 5M5YH 5JVH3 1M90C 4QJFA 4S3SA 3Q0AA 3ULJA 3PUVA 4ME3A 3DXJC 5CORA 1I5FA 4OX9Q 4K5WA 5KIXA 1PV4A 1K8MA 1KABA 2EJGC 1WTOA 4LF6Q 5LMNW 3C1EA 2F0QA 1IYJB 4A3JH 1HNXL 5GAHC 4C3HG 5C4XG 3SGIA 4OX9L 2JN4A 2VS1A 2L5TA 1BXTA 1E3PA 2JA9A 4GN4B 5IIFA 3MXUA 4B3RQ 3OHXC 1BBXC 1YNND 4C3HB 3HOVH 1CKNB 4IUPA 3C2PA 1MSGA 1VCIA 3QJYA 3I4LA 1WVLA 2OWOA 4KKTA 4QMGA 4RGTA 1X32A 4A3GG 3FPUB 4L6TB 2E2JB 1Y8PB 4DGZA 2JK8A 1TS3A 1SYFA 1YZ6A 2JEBI 1B9MA 1O7YA 3CCLA 4C3IG 3S1MB 2XWBB 2BH2A 2AUJD 4MZ9A 1PYSB 1XNRQ 2XVSA 3T53B 3RN2A 1BR9A 4OELB 2K05A 3VA5A 1L0WA 1PTOF 1N34L 1BUVT 3GTJB 1EY9A 4NKLA 4HJ7A 3A56A 4A3IH 2L55A 1SR3A 3BYTB 1PRTC 1STNA 2HHHL 2RDGA 1KL9A 3E9HA 1FR3A 2YU9H 4BBRB 1AH9A 3J81j 4LUOA 2NZOA 2R7FA 1LTTD 3K80C 3ITPA 3K58A 2EYJA 1PH7A 4GZYC 1PTOB 5C4ZA 4DK1A 2WKCA 3T13A 3EIVA 4PG3A 5ELBA 1T5EA 4L5TA 1K8GA 4RFBA 1ET9A 4R8IA 3HOVB 4JI2L 2Z8LA 1NTGA 4KHPQ 3RUZA 5HURA 1KRTA 3G6JB 3UE1A 1SE8A 4L5QA 4B3SQ 4JYAQ 1YJNA 2R7ZB 3S17H 1PDQA 2KQ3A 4GN5A 5BN4A 5IYCG 4JV5Q 2Z6KA 3M4QA 4RAUC 3AB9A 3GO5A 3MXNB 3V05A 1G51A 2D2CC 4OIJA 1AEXA 1CUKA 1UEAB 1PYBA 3OIQA 4TQUS 1HPCA 3MXNA 3BDLA 1SMYD 2KCMA 1W3SA 4G7OC 2D0PA 4CGYB 3G4SA 5AJ3Q 2IT1A 3I56A 3PO3G 2LFNA 4V0BA 3PIOA 2F0UA 3NTHA 2A8VA 1I6VC 3ICEA 2F0PA 3DWQA 1LT5D 1KNAA 4RWSC 1H9JA 2PCFB 3K0XA 2DN8A 2ZJRA 1GUSA 1SE3A 1B3QA 2A69D 1W6KA 1X3FA 2EXZA 2ATWA 3DLLA 2EQSA 4GN3B 3HOUH 4JI5Q 4P72A 5CV4A 3BG3A 5CC4A 3K57A 2VUMB 1F9PA 1TQOA 1SRUA 2NVXH 1LACA 3K6OA 1HA6A 2PMZE 3R2TA 2PMZB 3J80E 2LKVA 1X3PA 2YU9B 3HOXH 1QVGA 1IL8A 3MWYW 5C44B 1SLJA 4RHSA 2DNCA 5C0XI 4A3KG 1IYVA 4OWXB 1B53A 4H44C 1VQ7A 2CKZB 3OTOQ 3GTLH 3JAME 1STBA 1EQTA 1KNEA 4FDBA 3GTMB 4ULLA 5EKIA 4JCVE 1E0BA 4IFDG 1NNXA 2PYKA 1N36L 4IOCA 1EYAA 1V1QA 5GROA 1TWCH 4DV3Q 4O42A 3UDGA 3G48A 4Y52H 4B3MQ 5GAEC 4IUQA 1FJGQ 4CBVA 1X3EA 2O5IC 1CI3M 3TDQA 4EQNA 1EY8A 2HQLA 3TQYA 3J81L 2QEXA 4DR7Q 3HOZH 3PO3B 4B3TQ 1Y1VH 4HJAA 3I4NG 4V190 4OONA 3NENA 1JOQA 2IJ0A 2Q2IA 5A35A 2X6LA 1EY4A 4Y7NB 1SJHD 4GNXA 1STHA 2NYZD 1LTSD 3VR6A 2VW9A 3CCEA 1H9SB 5JPNC 5J1ZA 5CBEE 4DV7L 3T4AC 3OPOA 4PZ6A 4DNTB 1OO9B 2WAQE 1LYLA 1ZYRD 5GQOA 1CM9A 1V1PB 3KUPA 1C8CA 4WJWA 1VMCA 2ENBA 4X3SA 4R4TA 5ELOA 1IKMA 5BN5A 2OQ0A 3LWEA 5D3IB 3T51B 1G91A 2A6ED 2EVBA 4DK0A 5E1FA 3GQBA 3RNUA 1FL0A 1X54A 1XMQL 2K5DA 3HRZC 2JXMB 5M5XB 4KY7A 1SFOH 3D4WA 4ME5A 4DV1Q 3I3CA 4J15A 2SNMA 1RD9D 2B2VC 3S9WA 4MIUA 3K5LA 5E4WC 1RDPD 3RZOH 2F0EA 4BBSB 2K04A 4DUZL 2DNEA 3MA2B 3IRBA 3A5ZB 1HUNA 4K14A 3NBIA 3KLSX 2E2DC 4LUVA 1HR0Q 3CD6A 1BO0A 5FLMH 3CC2A 5KNBA 1Q46A 2Q2UA 3M3YB 4OL7A 5CV5A 4A3EG 4RKBA 5C3EB 1YIJA 4A3LG 5JEAH 3S1NB 2AKWB 2UXDQ 2NUCA 3IFDA 5J22A 1LTID 1VQLA 3E3XA 5HGTA 2KUMA 3AFQA 1PFBA 4MTNA 2HDLA 2I5HA 4AQYQ 3N52A 4IALA 1VF7A 3I4OA 3HOXB 4IFDH 1B4OA 5C44H 4RG1A 2UXDL 2WACA 1HNWQ 2R7DA 4BY7H 1UWVA 3PUXA 1RJTA 2D9UA 5M3FH 4A3GB 2N78A 5IODA 3JC66 1Y8NB 3JAMc 2PI2A 4AYBG 4HN7A 2ZXOA 2BE5D 5C0XJ 2K5WA 5HGQA 2VQFQ 3M9BA 3HZXA 1DOMA 2PNHA 5ELEA 1UAPA 3EA6A 4IQZA 2O5JC 3P75A 4DUYL 4C2MH 1A2TA 5EQ0A 1WTWA 1AZQA 1JOKA 1CK1A 2L12A 4Z9CB 3H0GH 3W5OA 4R9WA 1JWSD 2A69C 4BWGB 1VQ5A 2E5LQ 2F4VL 4KLKA 1WJJA 2NN6I 4JBMA 1QOHA 1HQMC 3BVGA 3R2IA 3MXPA 4A3EB 3CCQA 1VQ9A 4LF5L 1N36Q 2EE1A 5KYLA 3TP5A 4WJ4A 3HOYH 4A3CG 3SVMA 1GJXA 1QG7A 4LF8L 4R4OA 2DY7A 1ZXTA 3PIPA 3D4DA 1JWUD 4K0KQ 3CXCA 1UE6A 4KHVA 2NN6G 4IUUA 2XWJB 5TSSA 1V9PA 3I4NB 4KKUA 2HDMA 3J80i 3U50C 1B50A 3EQLC 1GKHA 4X64Q 1L0YB 1EQRA 5FLXE 3J80L 1EIFA 4DU9A 4JW0A 3OOCA 3A74A 3E0JA 4B9XA 4DF7A 3S2HH 4A3JG 4DR4L 3T1HQ 3HKZE 1N34Q 5I6WA 2QKIC 5M5XH 1SFOB 2ZM6L 2L11A 4PQXA 1HA5A 2LSSA 4KTAA 2PI2E 4KY6A 3J81c 3QR8A 1I94Q 1X9NA 3H15A 5C5MA 2EYMA 1YNJD 3Q24A 1JICA 2F3WA 3W3AA 1IBLQ 2NVQH 1RKNA 4A3GH 1K83B 1I4HA 4DV0L 4UDUC 3CPFA 5LMNQ 1TWHB 1IW7D 3OMGA 1DXMA 2F0HA 3BVZA 4KJNA 4JOIC 1EZ8A 1XPUA 4CKCA 1Y1VB 1YI2A 4A76A 4FF1A 4O2DA 3BYYB 4JI4Q 5JJIA 4A3MB 1EEID 3CMEA 1IHZA 4DV1L 1CFMA 5CGKA 1EWIA 2K14A 4KN7C 3H0GB 1ONLA 3J7YW 1ICWA 4IPHA 5JVG3 3OWEB 1HTLD 1XPOA 4DV6L 1O7ZA 4DR3L 3TP6A 1SSOA 1SYCA 2WINB 1K3BC 3FRPB 1NE3A 1TY2A 2UU9L 2YTVA 1DZ1A 3E6ZX 1IBMQ 5EGTA 4N9PA 1GD7A 3QOJA 5FLXc 2B2WA 2QA4A 2D62A 4HR7B 1SNQA 2AWOA 4PV1C 4GOPA 4JPBW 1E1OA 4GKKQ 1PFSA 4RGMA 4M1UB 1HNZQ 4H02A 5M3MH 4BBSH 5IP7H 5IOCA 4GOPB 1VQEA 3E9IA 4GOPC 1B8AA 5DAUA 3S1RB 1IBML 1NAPA 1A63A 2WAQG 1G6ZA 2RHQB 4R8NA 2H5XA 3MVVA 2R93H 1EQQA 2ZXPA 1WCMH 2UUCL 5C4JB 2UXBQ 1L2FA 1F2ZA 2QW7A 3EFXD 4JI6Q 1MSHA 1SYBA 1ILPA 1FNVA 1HH2P 2G5DA 2V4DA 5IWAL 1EUJA 2ZTDA 4XQQA 3VYSA 4C3IB 4BA2I 4NB3A 3IL8A 2L15A 1S5CD 3RLOA 1KHIA 1BOSA 4XT3B 3HOYG 4A3CH 5I9PA 1J5EL 3W1BA 4LAAA 1VQNA 4XQNA 4JI5L 4EGVA 2K5NA 1HNWL 5GADC 1FNWA 2VY3A 1C4QA 4YWLA 4ABNA 2E2HH 2XN9C 2CW0D 4X3KA 3M7GA 1A6XA 4JBJA 2OT2A 5IGEA 5IYDH 4CJ1B 2EYFA 3IAYA 4GLVB 1ENCA 3J80c 4FF2A 4BXXH 4NPSA 3HOYB 3M7NA 2DUDA 4BBRG 2NVTB 2ALYB 2IPKD 2B63H 2MFIA 4U68A 1EIYB 1XYIA 1PA6A 3CCMA 4C3JB 2KCCA 4YY3L 2JEAI 1ENFA 2CFMA 5IGDA 2PZWA 5ELFA 3A7AB 3HP3A 1YNXA 4JI8L 4F87A 1GUNA 4JI3Q 1N9WA 5CV9A 2AQ3B 2WV6D 3D0FA 1AZPA 1LM0A 3S15B 3CAMA 1S5BD 1P16A 2CCZA 1UE7A 1GM5A 2CWPA 1GXDC 1WCMB 2EY6A 1P8LA 4ZYSA 2B2TA 3H6MA 1N32L 3KJOA 2VZAA 1CZGA 1SYDA 3UDIA 2YYZA 3IKJA 1M8AA 3D4RA 3M4OH 2NVXB 2ID0A 2Z0SA 1K8AC 2RF4A 2NVQB 2IHFA 4PMBA 2HD3A 1PXUA 1C9OA 5K36H 4PNYA
chains in the Genus database with same CATH topology
2A8VA 2IHEA 4DR4Q 3ICEA 1GVPA 4TVAB 3RR5A 3AFPA 3B6YA 2ZM6Q 4NXNL 3T1YQ 2R7ZH 4A3BH 3K0XA 4A3FH 2ZJRA 2ZTCA 1XMOL 3TRZA 3W1GA 1CKOA 1X3FA 3HKZG 1J6QA 2ATWA 3K81C 4X65Q 1WOCA 3DLLA 3NBHB 2EQSA 5IYCH 3GTOH 2VUMG 4GN3B 4AQYL 2KHIA 3HOUH 4JI5Q 4YCWA 1X55A 4P72A 3T1YL 5IT9c 3M3YH 1U5KA 2HHHQ 3AEVA 3HOZG 3TS2A 4IFDI 4QL5A 5M3MG 1IBLL 4DV0Q 4AIMA 5IP7G 4HIDA 1YVCA 1SRUA 3AQQA 2NVXH 1O7IA 2PMZE 2BA0A 1SROA 1Q86C 5JJLA 4IFDJ 2R93G 3HOXH 1QVGA 1SLJA 4R1JA 4JI0Q 3PO3H 5C0XI 4A3KG 4OWXB 3GTQH 1VQ7A 2CKZB 3OTOQ 1D8LA 1S3OA 4LF6L 3GTLH 1DGSA 1PH3A 4R4QA 3CF5A 2JA6G 4A3DG 1HNXQ 4DNIA 2I0QA 1SMXA 4FDBA 2VNUD 2V1CC 4JV5L 2YV5A 3PSIA 4LW1A 3UE0A 3ULPA 3K8AA 4JCVE 3H3VH 4IFDG 4GKJQ 1CSPA 1CKMA 1VQ4A 3K7AH 4A3FG 3GTGH 1N36L 4DR6Q 1B7YB 1V1QA 4JG2A 5GROA 1TWCH 4DV3Q 1SN8A 2FXQA 2MO1A 3GDEA 3UDGA 1FVIA 3G48A 1W2BA 3I4MH 4DR7L 1VQHA 1Q82C 4B3MQ 4LFCL 5GAEC 4BY7G 4Y52H 3AYHB 5IYDG 1FJGQ 1X3EA 4JI3L 1VQPA 2F52A 3HOUG 2MO0A 2Z6KC 2HQLA 3TQYA 2QEXA 2GVBA 4P73A 3I2ZA 4DR7Q 4K0KL 3HOZH 4L5RC 4B3TQ 1Y1VH 4HJAA 2ZJQA 3I4NG 2EIFA 3KF8B 4A93H 4OONA 3I55A 1IXRA 1KQSA 3NENA 2K50A 2LXJA 1QVFA 2Q2IA 4GKKL 4LFCQ 4DV2Q 4EQ5A 1HZCA 1G6PA 1XPRA 1Q81C 4HJ8A 4GNXA 3KF6A 5E7NA 3CCUA 1I50H 5IY0A 4LFBQ 4KHZA 1YJWA 4DAYB 2YTYA 2KBNA 3NEMA 1XJVA 1PVOA 1IBKQ 3L0OA 4JI7L 4DR2Q 4IJHA 2K52A 2VW9A 3CCEA 2LXKA 3PUZA 3STBC 3T1HL 1PH9A 2UUCQ 1OXUA 3ER0A 3KDFA 3Q8DA 3RLNA 1XNQL 4IPCA 1JJGA 4GLXA 1GO3E 4OO1I 3FHWA 2CQOA 3CCJA 2EXDA 1X65A 4DV7L 1K73C 3L7ZC 1OTCA 4PZ6A 4UY8C 3BU2A 4GS3A 3PUWA 3I4MG 1QVCA 3CW2C 1T9HA 5FLMG 2WAQE 4YWKA 1QUQB 1LYLA 3FKIH 3S16H 4IOAA 4DV5Q 1J5EQ 4XIGS 5GQOA 4A3MH 3M4PA 5DLQE 5IP9G 3OTOL 3D31A 1RL2A 4R4TA 1Y1VG 5ELOA 2UXCL 2IX1A 2OQ0A 1I6HH 5LMNL 3GTJH 1VQOA 4DKAC 4B3SL 4OO1G 3RNUA 1XMQL 1FL0A 1X54A 3ERSX 1KC8C 4LF7Q 5K36G 5IE8A 1SFOH 2Q2HA 4DV1Q 4J15A 4JI4L 4JBKA 4IPGA 4JI0L 2R7ZG 3I7FA 2PQAA 2BH8A 1YHAA 4JI1L 1FJGL 4KHPL 3RZOH 4X66L 5C44G 4DUZL 1PH6A 5BR8Q 4JV5Q 5FJ8H 3IRBA 2Q2TA 2WFWA 2WB1E 2PQAB 3A5ZB 3CMAA 4A4IA 4OXPA 3GTPH 4A75A 4X62L 1EOVA 2N8NA 4B3TL 3HOWG 2VL6A 4LUVA 3STBD 5AJ3L 5J3BA 4X66Q 4Y7NH 3F2DA 1S72A 3GD7A 1HR0Q 4XTCS 4B3RL 2NVYH 4BA1I 4MNOA 5FLMH 1VS0A 5M3FG 4LNQA 3CD6A 5JJKA 4UP8A 1FGUA 1PHJA 3CC2A 4LF9L 2BA1A 2B29A 5BR8L 5C4JH 1RIPA 4A3MG 1Q46A 2OTLA 4HJ5A 1HZBA 3L2PA 2Q2UA 4NXML 3PF4A 4LFBL 2OTJA 2A19A 2I5LX 1IBKL 3S14H 3CCVA 4A3EG 1N33Q 2UUAQ 1PH2A 1K83H 4LFAQ 2D0OA 1YIJA 4A3LG 1TWHH 2AKWB 4UPAA 4QGUA 5C3EG 4A3KH 4LF4Q 4NXMQ 4GLAC 3GTKH 2UXDQ 4DV6Q 4WJ3M 1VQLA 3S15H 3BJUA 4PZ7A 1R9TH 1U0LA 3S1QH 1E1TA 3H0GG 3AFQA 4OWTB 1C7YA 1BKBA 1A62A 3F1ZA 3KLWA 3PUYA 2I5HA 4MTNA 4AQYQ 2HIVA 2RCNA 3KYHC 1QZHA 1M1KC 4LF4L 4YHHQ 4LFAL 1Z9FA 3I4OA 4YCUA 4AH6A 4EX5A 3CCRA 1KAWA 5C44H 5IWAQ 1JJ2A 4HIKA 2OCEA 5FJ8G 4DR2L 1VQ8A 4RG1A 3OW2A 1BVSA 1YJ9A 2UXDL 3J7ZC 5M5WH 4QIWE 4C3HH 1HNWQ 2R7DA 3HOWH 3PO2G 1MJCA 4BY7H 1UWVA 4DV4L 3PUXA 2DGYA 1OXTA 3UDFA 2WP8J 5M3FH 2N78A 3JC66 4X65L 3ULLA 3JAMc 2PI2A 4AYBG 2KCTA 2VQEL 4IPDA 1N8RC 1VQMA 4A93G 1Q12A 4RMFA 2N3SA 4A3EH 5C0XJ 3TEHB 1YBYA 1Z47A 5HGQA 1VQFA 1MJEA 5IYBH 1CSQA 2VQFQ 3M9BA 3G6EA 4GKJL 4A3LH 1C0AA 5H1SE 5JEAG 2PNHA 3A5UA 4IO9A 3S24A 1Y1WH 4DUYL 4POGA 2K5HA 4C2MH 4HIMA 1OXVA 1X3GA 1HZ9A 1HZAA 3H0GH 3W5OA 2VQFL 4BBSG 1VQIA 1TWAH 4JI2Q 1WI5A 3EBEA 4POFA 1VQ5A 1V43A 2E5LQ 4LF9Q 1HR0W 4KLKA 4LF7L 3M85A 2F4VL 1VQBA 1WJJA 1YHBA 1OXXK 2NN6I 1K9MC 1H95A 4JBMA 1A0IA 2UU9Q 1VQDA 1Q7YC 4R4IA 1Q8KA 1E7ZA 3F2BA 3RN5A 3PO2H 4DK3C 1WFQA 5EAYA 4O0AA 3FKIG 3LGJA 2F4VQ 3CCQA 2K5VA 1VQ9A 4LF5L 2ZJPA 1N36Q 4DR1Q 2R92G 2ES2A 4DR6L 1L1OC 1UEBA 5IP9H 2JA7H 2JA8H 4WJ4A 1UE1A 3F2CA 1AE3A 1TWGH 3RZDH 1KIXA 3HOYH 4A3CG 4YY3Q 4ALPA 1YITA 4PMWA 2B3GA 4LF8L 4P75A 4OWWB 4R4OA 2C35B 1HR0L 1VQJA 3PIPA 4HJ9A 3PGZA 5LMUL 4K0KQ 2JQOA 3CXCA 4JOIA 5GAGC 1UE6A 5IYBG 3CCSA 2XTIA 2NN6G 3J81i 3NELA 1PH4A 4YCVA 1G291 1V9PA 4LF8Q 1ASZA 3J80i 3U50C 4X64Q 1GKHA 1I3QH 1NBWA 3CP0A 3U58A 1A8VA 2UUAL 1X6OA 1EQRA 1EIFA 1VQCA 2AMCB 1E24A 4C3JH 3A74A 1KD1C 2F3IA 4JC0A 3KJPA 3JAMi 2ASBA 3CC4A 3S2HH 4A3JG 1Q1BA 4X64L 4DR4L 3T1HQ 3HKZE 1N34Q 5M5XH 1HNZL 5ELNA 2ZM6L 1N32Q 1K0RA 1I94L 1EFWA 2Y0SG 2IX0A 2LSSA 2PI2E 3TS0A 1QZGA 4DV7Q 1XNQQ 1XMOQ 4LUZA 2CWAA 4UP9A 4DPGA 1WYDA 3CC7A 1XMQQ 2JA5H 3CQZH 2R92H 4X6AH 3J81c 2JA8G 1XNRL 1I94Q 1X9NA 3H15A 1IL2A 5C0XG 1ASYA 3HOVG 3KOJA 5M5YH 1M90C 1IBLQ 1Y14B 4QJFA 2NVQH 3OYYA 3ULJA 3PUVA 4ME3A 4A3GH 5C3EH 1AE2A 4DV0L 1VQGA 3CPFA 5LMNQ 1I5FA 4OX9Q 2A1AA 3RLFA 1PV4A 1LUZA 1JE5A 4JOIC 1XPUA 4A3DH 4QQBX 3J7A5 2E2JH 3EN2A 3BZCA 1YI2A 3U4ZA 4A76A 1YHQA 4O2DA 1E22A 4LF6Q 4JI4Q 1WCMG 2E8GA 2HIXA 5LMNW 4LF5Q 5JJIA 1IYJB 3CMEA 4DV1L 1HJPA 4JI1Q 4A3JH 1YEZA 1HNXL 4DUYQ 5GAHC 1L1OA 4JYAL 1EWIA 5C4XG 4DR5L 3SGIA 2K14A 4OX9L 3S2DH 1KXLA 2VS1A 3KFUA 2XGTA 1B70B 3ZJYC 2AHOB 4YWMA 4IOCA 1E3PA 2NZHA 4IPHA 4JBWA 2JA9A 1NMGA 4GN4B 1XPOA 4A3BG 2E2IH 4DV6L 4DR3L 2JA5G 2K4KA 4B3RQ 4DR5Q 5JEAJ 3MEFA 1NE3A 2UU9L 2YTVA 3BZKA 1BBWA 1VQAA 2YTXA 4GNXB 2JJQA 3HOVH 1CKNB 1IBMQ 1VCIA 1GD7A 5FLXc 4P71A 2GN5A 1NMFA 1LTLA 3F8TA 2OWOA 2QA4A 2VUMH 1Q1EA 2D62A 2K75A 4APVA 4A3GG 4BXXG 4UP7A 1Y1WG 1JT8A 2AWOA 4GOPA 1E1OA 4GKKQ 1PFSA 4KI0A 1HNZQ 3H3VI 1D7QA 2KHJA 2GVAA 2RHSB 4H02A 2JK8A 5M3MH 5IP7H 1S40A 4BBSH 1YZ6A 2I5MX 2JEBI 4BBRH 1VQEA 3E9IA 4GOPB 1B8AA 2KENA 4GOPC 1PH1A 1IBML 2B63G 3GTMH 2WAQG 1A63A 3CCLA 2RHQB 4NXNQ 3DM3A 2H5XA 2R93H 3HOXG 1JJCB 1EQQA 4JI7Q 1WCMH 2UUCL 2BH2A 4MZ9A 2UXBQ 1L2FA 1PYSB 4JI6Q 1XNRQ 3K7UC 1HH2P 3RN2A 5C4XH 5IWAL 3KF6B 3UDXA 1EUJA 4LWCA 3G71A 1L1OB 2ZTDA 4YHHL 4BA2I 4NB3A 1L0WA 1MKHA 2L15A 3HFZB 1N34L 1KRSA 2JA7G 3RLOA 1KHIA 2R6GA 4DV4Q 4L5SA 3HOYG 4A3CH 4HJ7A 1J5EL 3W1BA 3PCOB 1PH5A 1VQNA 1HNWL 4JI5L 4A3IH 2K5NA 1SR3A 5GADC 2HHHL 3PV0A 1KL9A 2VY3A 4YWLA 2E2HH 3E9HA 1BBUA 4JBJA 3CPWA 5IYDH 1CKNA 4R4CA 2YU9H 1AH9A 3J81j 2ZTEA 4GLVB 2NZOA 2R7FA 2WB1G 3K80C 4LUOA 3J80c 2VQEQ 4NPSA 4PZ8A 3S1RH 1PH7A 4BY1H 4BXXH 2IY5B 2UXCQ 2QGQA 3M7NA 1X56A 2MQHA 1VQ6A 3I4NH 2DUDA 1JB7A 1K3RA 3WWVA 1MIUA 3E0EA 3EIVA 4BBRG 2ALYB 4PG3A 2B63H 3S1MH 2MFIA 4C3IH 3FP9A 4HIOA 1EIYB 1PA6A 3CCMA 4L5TA 4DV5L 2MNAA 4DR3Q 1K8GA 4YY3L 2JEAI 1TWFH 4JI2L 2CFMA 1IZ6A 4AYBE 1NTGA 4KHPQ 4DV3L 2E5LL 2UUBQ 4DUZQ 2N49A 4X62Q 3U4VA 1VQKA 2JE6I 1KRTA 1YNXA 4JI8L 4GNXC 3A0JA 3UE1A 1N9WA 3PF5A 4JI3Q 3S1NH 4QY7A 1SE8A 4L5QA 4B3SQ 4JYAQ 3KDFB 3D0FA 1YJNA 1LM0A 3CAMA 4A3IG 1P16A 3S17H 3VDYA 4JI8Q 2CCZA 2HT1A 1UE7A 4GN5A 1GM5A 2CWPA 1TXYA 2Z6KA 3M4QA 5IYCG 3TREA 2UUBL 4DR1L 5HY6A 1N33L 3GO5A 3MXNB 4P74A 1G51A 2Y0SE 2NVTH 2AWNA 1P8LA 1CUKA 2UXBL 1QUQA 1PYBA 4BY1G 4DV2L 4TQUS 3KJOA 1XTDA 4JI6L 1N32L 2VZAA 1JMCA 3UDIA 2YYZA 5LMUQ 2KCMA 3M4OH 2ID0A 2Z0SA 4B3ML 4DK6C 1W3SA 1K8AC 1OXSC 2D0PA 2RF4A 4DAMA 3G4SA 5AJ3Q 3HKSA 2IT1A 2OQKA 4IJLA 2IHFA 3I56A 1EYGA 3PO3G 1NY4A 1NJIC 1UE5A 1C9OA 3PIOA 1PH8A 2JA6H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A8V A;  2IHE A;  4DR4 Q;  3ICE A;  1GVP A;  4TVA B;  3RR5 A;  3AFP A;  3B6Y A;  2ZM6 Q;  4NXN L;  3T1Y Q;  2R7Z H;  4A3B H;  3K0X A;  4A3F H;  2ZJR A;  2ZTC A;  1XMO L;  3TRZ A;  3W1G A;  1CKO A;  1X3F A;  3HKZ G;  1J6Q A;  2ATW A;  3K81 C;  4X65 Q;  1WOC A;  3DLL A;  3NBH B;  2EQS A;  5IYC H;  3GTO H;  2VUM G;  4GN3 B;  4AQY L;  2KHI A;  3HOU H;  4JI5 Q;  4YCW A;  1X55 A;  4P72 A;  3T1Y L;  5IT9 c;  3M3Y H;  1U5K A;  2HHH Q;  3AEV A;  3HOZ G;  3TS2 A;  4IFD I;  4QL5 A;  5M3M G;  1IBL L;  4DV0 Q;  4AIM A;  5IP7 G;  4HID A;  1YVC A;  1SRU A;  3AQQ A;  2NVX H;  1O7I A;  2PMZ E;  2BA0 A;  1SRO A;  1Q86 C;  5JJL A;  4IFD J;  2R93 G;  3HOX H;  1QVG A;  1SLJ A;  4R1J A;  4JI0 Q;  3PO3 H;  5C0X I;  4A3K G;  4OWX B;  3GTQ H;  1VQ7 A;  2CKZ B;  3OTO Q;  1D8L A;  1S3O A;  4LF6 L;  3GTL H;  1DGS A;  1PH3 A;  4R4Q A;  3CF5 A;  2JA6 G;  4A3D G;  1HNX Q;  4DNI A;  2I0Q A;  1SMX A;  4FDB A;  2VNU D;  2V1C C;  4JV5 L;  2YV5 A;  3PSI A;  4LW1 A;  3UE0 A;  3ULP A;  3K8A A;  4JCV E;  3H3V H;  4IFD G;  4GKJ Q;  1CSP A;  1CKM A;  1VQ4 A;  3K7A H;  4A3F G;  3GTG H;  1N36 L;  4DR6 Q;  1B7Y B;  1V1Q A;  4JG2 A;  5GRO A;  1TWC H;  4DV3 Q;  1SN8 A;  2FXQ A;  2MO1 A;  3GDE A;  3UDG A;  1FVI A;  3G48 A;  1W2B A;  3I4M H;  4DR7 L;  1VQH A;  1Q82 C;  4B3M Q;  4LFC L;  5GAE C;  4BY7 G;  4Y52 H;  3AYH B;  5IYD G;  1FJG Q;  1X3E A;  4JI3 L;  1VQP A;  2F52 A;  3HOU G;  2MO0 A;  2Z6K C;  2HQL A;  3TQY A;  2QEX A;  2GVB A;  4P73 A;  3I2Z A;  4DR7 Q;  4K0K L;  3HOZ H;  4L5R C;  4B3T Q;  1Y1V H;  4HJA A;  2ZJQ A;  3I4N G;  2EIF A;  3KF8 B;  4A93 H;  4OON A;  3I55 A;  1IXR A;  1KQS A;  3NEN A;  2K50 A;  2LXJ A;  1QVF A;  2Q2I A;  4GKK L;  4LFC Q;  4DV2 Q;  4EQ5 A;  1HZC A;  1G6P A;  1XPR A;  1Q81 C;  4HJ8 A;  4GNX A;  3KF6 A;  5E7N A;  3CCU A;  1I50 H;  5IY0 A;  4LFB Q;  4KHZ A;  1YJW A;  4DAY B;  2YTY A;  2KBN A;  3NEM A;  1XJV A;  1PVO A;  1IBK Q;  3L0O A;  4JI7 L;  4DR2 Q;  4IJH A;  2K52 A;  2VW9 A;  3CCE A;  2LXK A;  3PUZ A;  3STB C;  3T1H L;  1PH9 A;  2UUC Q;  1OXU A;  3ER0 A;  3KDF A;  3Q8D A;  3RLN A;  1XNQ L;  4IPC A;  1JJG A;  4GLX A;  1GO3 E;  4OO1 I;  3FHW A;  2CQO A;  3CCJ A;  2EXD A;  1X65 A;  4DV7 L;  1K73 C;  3L7Z C;  1OTC A;  4PZ6 A;  4UY8 C;  3BU2 A;  4GS3 A;  3PUW A;  3I4M G;  1QVC A;  3CW2 C;  1T9H A;  5FLM G;  2WAQ E;  4YWK A;  1QUQ B;  1LYL A;  3FKI H;  3S16 H;  4IOA A;  4DV5 Q;  1J5E Q;  4XIG S;  5GQO A;  4A3M H;  3M4P A;  5DLQ E;  5IP9 G;  3OTO L;  3D31 A;  1RL2 A;  4R4T A;  1Y1V G;  5ELO A;  2UXC L;  2IX1 A;  2OQ0 A;  1I6H H;  5LMN L;  3GTJ H;  1VQO A;  4DKA C;  4B3S L;  4OO1 G;  3RNU A;  1XMQ L;  1FL0 A;  1X54 A;  3ERS X;  1KC8 C;  4LF7 Q;  5K36 G;  5IE8 A;  1SFO H;  2Q2H A;  4DV1 Q;  4J15 A;  4JI4 L;  4JBK A;  4IPG A;  4JI0 L;  2R7Z G;  3I7F A;  2PQA A;  2BH8 A;  1YHA A;  4JI1 L;  1FJG L;  4KHP L;  3RZO H;  4X66 L;  5C44 G;  4DUZ L;  1PH6 A;  5BR8 Q;  4JV5 Q;  5FJ8 H;  3IRB A;  2Q2T A;  2WFW A;  2WB1 E;  2PQA B;  3A5Z B;  3CMA A;  4A4I A;  4OXP A;  3GTP H;  4A75 A;  4X62 L;  1EOV A;  2N8N A;  4B3T L;  3HOW G;  2VL6 A;  4LUV A;  3STB D;  5AJ3 L;  5J3B A;  4X66 Q;  4Y7N H;  3F2D A;  1S72 A;  3GD7 A;  1HR0 Q;  4XTC S;  4B3R L;  2NVY H;  4BA1 I;  4MNO A;  5FLM H;  1VS0 A;  5M3F G;  4LNQ A;  3CD6 A;  5JJK A;  4UP8 A;  1FGU A;  1PHJ A;  3CC2 A;  4LF9 L;  2BA1 A;  2B29 A;  5BR8 L;  5C4J H;  1RIP A;  4A3M G;  1Q46 A;  2OTL A;  4HJ5 A;  1HZB A;  3L2P A;  2Q2U A;  4NXM L;  3PF4 A;  4LFB L;  2OTJ A;  2A19 A;  2I5L X;  1IBK L;  3S14 H;  3CCV A;  4A3E G;  1N33 Q;  2UUA Q;  1PH2 A;  1K83 H;  4LFA Q;  2D0O A;  1YIJ A;  4A3L G;  1TWH H;  2AKW B;  4UPA A;  4QGU A;  5C3E G;  4A3K H;  4LF4 Q;  4NXM Q;  4GLA C;  3GTK H;  2UXD Q;  4DV6 Q;  4WJ3 M;  1VQL A;  3S15 H;  3BJU A;  4PZ7 A;  1R9T H;  1U0L A;  3S1Q H;  1E1T A;  3H0G G;  3AFQ A;  4OWT B;  1C7Y A;  1BKB A;  1A62 A;  3F1Z A;  3KLW A;  3PUY A;  2I5H A;  4MTN A;  4AQY Q;  2HIV A;  2RCN A;  3KYH C;  1QZH A;  1M1K C;  4LF4 L;  4YHH Q;  4LFA L;  1Z9F A;  3I4O A;  4YCU A;  4AH6 A;  4EX5 A;  3CCR A;  1KAW A;  5C44 H;  5IWA Q;  1JJ2 A;  4HIK A;  2OCE A;  5FJ8 G;  4DR2 L;  1VQ8 A;  4RG1 A;  3OW2 A;  1BVS A;  1YJ9 A;  2UXD L;  3J7Z C;  5M5W H;  4QIW E;  4C3H H;  1HNW Q;  2R7D A;  3HOW H;  3PO2 G;  1MJC A;  4BY7 H;  1UWV A;  4DV4 L;  3PUX A;  2DGY A;  1OXT A;  3UDF A;  2WP8 J;  5M3F H;  2N78 A;  3JC6 6;  4X65 L;  3ULL A;  3JAM c;  2PI2 A;  4AYB G;  2KCT A;  2VQE L;  4IPD A;  1N8R C;  1VQM A;  4A93 G;  1Q12 A;  4RMF A;  2N3S A;  4A3E H;  5C0X J;  3TEH B;  1YBY A;  1Z47 A;  5HGQ A;  1VQF A;  1MJE A;  5IYB H;  1CSQ A;  2VQF Q;  3M9B A;  3G6E A;  4GKJ L;  4A3L H;  1C0A A;  5H1S E;  5JEA G;  2PNH A;  3A5U A;  4IO9 A;  3S24 A;  1Y1W H;  4DUY L;  4POG A;  2K5H A;  4C2M H;  4HIM A;  1OXV A;  1X3G A;  1HZ9 A;  1HZA A;  3H0G H;  3W5O A;  2VQF L;  4BBS G;  1VQI A;  1TWA H;  4JI2 Q;  1WI5 A;  3EBE A;  4POF A;  1VQ5 A;  1V43 A;  2E5L Q;  4LF9 Q;  1HR0 W;  4KLK A;  4LF7 L;  3M85 A;  2F4V L;  1VQB A;  1WJJ A;  1YHB A;  1OXX K;  2NN6 I;  1K9M C;  1H95 A;  4JBM A;  1A0I A;  2UU9 Q;  1VQD A;  1Q7Y C;  4R4I A;  1Q8K A;  1E7Z A;  3F2B A;  3RN5 A;  3PO2 H;  4DK3 C;  1WFQ A;  5EAY A;  4O0A A;  3FKI G;  3LGJ A;  2F4V Q;  3CCQ A;  2K5V A;  1VQ9 A;  4LF5 L;  2ZJP A;  1N36 Q;  4DR1 Q;  2R92 G;  2ES2 A;  4DR6 L;  1L1O C;  1UEB A;  5IP9 H;  2JA7 H;  2JA8 H;  4WJ4 A;  1UE1 A;  3F2C A;  1AE3 A;  1TWG H;  3RZD H;  1KIX A;  3HOY H;  4A3C G;  4YY3 Q;  4ALP A;  1YIT A;  4PMW A;  2B3G A;  4LF8 L;  4P75 A;  4OWW B;  4R4O A;  2C35 B;  1HR0 L;  1VQJ A;  3PIP A;  4HJ9 A;  3PGZ A;  5LMU L;  4K0K Q;  2JQO A;  3CXC A;  4JOI A;  5GAG C;  1UE6 A;  5IYB G;  3CCS A;  2XTI A;  2NN6 G;  3J81 i;  3NEL A;  1PH4 A;  4YCV A;  1G29 1;  1V9P A;  4LF8 Q;  1ASZ A;  3J80 i;  3U50 C;  4X64 Q;  1GKH A;  1I3Q H;  1NBW A;  3CP0 A;  3U58 A;  1A8V A;  2UUA L;  1X6O A;  1EQR A;  1EIF A;  1VQC A;  2AMC B;  1E24 A;  4C3J H;  3A74 A;  1KD1 C;  2F3I A;  4JC0 A;  3KJP A;  3JAM i;  2ASB A;  3CC4 A;  3S2H H;  4A3J G;  1Q1B A;  4X64 L;  4DR4 L;  3T1H Q;  3HKZ E;  1N34 Q;  5M5X H;  1HNZ L;  5ELN A;  2ZM6 L;  1N32 Q;  1K0R A;  1I94 L;  1EFW A;  2Y0S G;  2IX0 A;  2LSS A;  2PI2 E;  3TS0 A;  1QZG A;  4DV7 Q;  1XNQ Q;  1XMO Q;  4LUZ A;  2CWA A;  4UP9 A;  4DPG A;  1WYD A;  3CC7 A;  1XMQ Q;  2JA5 H;  3CQZ H;  2R92 H;  4X6A H;  3J81 c;  2JA8 G;  1XNR L;  1I94 Q;  1X9N A;  3H15 A;  1IL2 A;  5C0X G;  1ASY A;  3HOV G;  3KOJ A;  5M5Y H;  1M90 C;  1IBL Q;  1Y14 B;  4QJF A;  2NVQ H;  3OYY A;  3ULJ A;  3PUV A;  4ME3 A;  4A3G H;  5C3E H;  1AE2 A;  4DV0 L;  1VQG A;  3CPF A;  5LMN Q;  1I5F A;  4OX9 Q;  2A1A A;  3RLF A;  1PV4 A;  1LUZ A;  1JE5 A;  4JOI C;  1XPU A;  4A3D H;  4QQB X;  3J7A 5;  2E2J H;  3EN2 A;  3BZC A;  1YI2 A;  3U4Z A;  4A76 A;  1YHQ A;  4O2D A;  1E22 A;  4LF6 Q;  4JI4 Q;  1WCM G;  2E8G A;  2HIX A;  5LMN W;  4LF5 Q;  5JJI A;  1IYJ B;  3CME A;  4DV1 L;  1HJP A;  4JI1 Q;  4A3J H;  1YEZ A;  1HNX L;  4DUY Q;  5GAH C;  1L1O A;  4JYA L;  1EWI A;  5C4X G;  4DR5 L;  3SGI A;  2K14 A;  4OX9 L;  3S2D H;  1KXL A;  2VS1 A;  3KFU A;  2XGT A;  1B70 B;  3ZJY C;  2AHO B;  4YWM A;  4IOC A;  1E3P A;  2NZH A;  4IPH A;  4JBW A;  2JA9 A;  1NMG A;  4GN4 B;  1XPO A;  4A3B G;  2E2I H;  4DV6 L;  4DR3 L;  2JA5 G;  2K4K A;  4B3R Q;  4DR5 Q;  5JEA J;  3MEF A;  1NE3 A;  2UU9 L;  2YTV A;  3BZK A;  1BBW A;  1VQA A;  2YTX A;  4GNX B;  2JJQ A;  3HOV H;  1CKN B;  1IBM Q;  1VCI A;  1GD7 A;  5FLX c;  4P71 A;  2GN5 A;  1NMF A;  1LTL A;  3F8T A;  2OWO A;  2QA4 A;  2VUM H;  1Q1E A;  2D62 A;  2K75 A;  4APV A;  4A3G G;  4BXX G;  4UP7 A;  1Y1W G;  1JT8 A;  2AWO A;  4GOP A;  1E1O A;  4GKK Q;  1PFS A;  4KI0 A;  1HNZ Q;  3H3V I;  1D7Q A;  2KHJ A;  2GVA A;  2RHS B;  4H02 A;  2JK8 A;  5M3M H;  5IP7 H;  1S40 A;  4BBS H;  1YZ6 A;  2I5M X;  2JEB I;  4BBR H;  1VQE A;  3E9I A;  4GOP B;  1B8A A;  2KEN A;  4GOP C;  1PH1 A;  1IBM L;  2B63 G;  3GTM H;  2WAQ G;  1A63 A;  3CCL A;  2RHQ B;  4NXN Q;  3DM3 A;  2H5X A;  2R93 H;  3HOX G;  1JJC B;  1EQQ A;  4JI7 Q;  1WCM H;  2UUC L;  2BH2 A;  4MZ9 A;  2UXB Q;  1L2F A;  1PYS B;  4JI6 Q;  1XNR Q;  3K7U C;  1HH2 P;  3RN2 A;  5C4X H;  5IWA L;  3KF6 B;  3UDX A;  1EUJ A;  4LWC A;  3G71 A;  1L1O B;  2ZTD A;  4YHH L;  4BA2 I;  4NB3 A;  1L0W A;  1MKH A;  2L15 A;  3HFZ B;  1N34 L;  1KRS A;  2JA7 G;  3RLO A;  1KHI A;  2R6G A;  4DV4 Q;  4L5S A;  3HOY G;  4A3C H;  4HJ7 A;  1J5E L;  3W1B A;  3PCO B;  1PH5 A;  1VQN A;  1HNW L;  4JI5 L;  4A3I H;  2K5N A;  1SR3 A;  5GAD C;  2HHH L;  3PV0 A;  1KL9 A;  2VY3 A;  4YWL A;  2E2H H;  3E9H A;  1BBU A;  4JBJ A;  3CPW A;  5IYD H;  1CKN A;  4R4C A;  2YU9 H;  1AH9 A;  3J81 j;  2ZTE A;  4GLV B;  2NZO A;  2R7F A;  2WB1 G;  3K80 C;  4LUO A;  3J80 c;  2VQE Q;  4NPS A;  4PZ8 A;  3S1R H;  1PH7 A;  4BY1 H;  4BXX H;  2IY5 B;  2UXC Q;  2QGQ A;  3M7N A;  1X56 A;  2MQH A;  1VQ6 A;  3I4N H;  2DUD A;  1JB7 A;  1K3R A;  3WWV A;  1MIU A;  3E0E A;  3EIV A;  4BBR G;  2ALY B;  4PG3 A;  2B63 H;  3S1M H;  2MFI A;  4C3I H;  3FP9 A;  4HIO A;  1EIY B;  1PA6 A;  3CCM A;  4L5T A;  4DV5 L;  2MNA A;  4DR3 Q;  1K8G A;  4YY3 L;  2JEA I;  1TWF H;  4JI2 L;  2CFM A;  1IZ6 A;  4AYB E;  1NTG A;  4KHP Q;  4DV3 L;  2E5L L;  2UUB Q;  4DUZ Q;  2N49 A;  4X62 Q;  3U4V A;  1VQK A;  2JE6 I;  1KRT A;  1YNX A;  4JI8 L;  4GNX C;  3A0J A;  3UE1 A;  1N9W A;  3PF5 A;  4JI3 Q;  3S1N H;  4QY7 A;  1SE8 A;  4L5Q A;  4B3S Q;  4JYA Q;  3KDF B;  3D0F A;  1YJN A;  1LM0 A;  3CAM A;  4A3I G;  1P16 A;  3S17 H;  3VDY A;  4JI8 Q;  2CCZ A;  2HT1 A;  1UE7 A;  4GN5 A;  1GM5 A;  2CWP A;  1TXY A;  2Z6K A;  3M4Q A;  5IYC G;  3TRE A;  2UUB L;  4DR1 L;  5HY6 A;  1N33 L;  3GO5 A;  3MXN B;  4P74 A;  1G51 A;  2Y0S E;  2NVT H;  2AWN A;  1P8L A;  1CUK A;  2UXB L;  1QUQ A;  1PYB A;  4BY1 G;  4DV2 L;  4TQU S;  3KJO A;  1XTD A;  4JI6 L;  1N32 L;  2VZA A;  1JMC A;  3UDI A;  2YYZ A;  5LMU Q;  2KCM A;  3M4O H;  2ID0 A;  2Z0S A;  4B3M L;  4DK6 C;  1W3S A;  1K8A C;  1OXS C;  2D0P A;  2RF4 A;  4DAM A;  3G4S A;  5AJ3 Q;  3HKS A;  2IT1 A;  2OQK A;  4IJL A;  2IHF A;  3I56 A;  1EYG A;  3PO3 G;  1NY4 A;  1NJI C;  1UE5 A;  1C9O A;  3PIO A;  1PH8 A;  2JA6 H; 
#chains in the Genus database with same CATH topology
 4FXK C;  2CH4 W;  4WRD A;  1R4P B;  4HMI A;  4DNR B;  4TVA B;  3B6Y A;  3T1Y Q;  4NXN L;  3QG1 A;  3DWA A;  4QUF A;  1XMO L;  3J7A F;  4RKL A;  3TRZ A;  3S14 B;  3HKZ G;  3MHB A;  5CV7 A;  5D14 A;  3FPP A;  4AQY L;  1TWA B;  1CA5 A;  3T1Y L;  2B39 A;  3M3Y H;  1U5K A;  2EDG A;  4N8X 1;  3AEV A;  3NK9 A;  3HOZ G;  3TS2 A;  4QL5 A;  5M3M G;  1IBL L;  5IP7 G;  4HID A;  5I2Y A;  3AQQ A;  1EY7 A;  5CYU A;  3I8Z A;  2BA0 A;  1SRO A;  4IFD J;  4QF4 A;  2R93 G;  2F4I A;  4R1J A;  4P2C B;  3W2D A;  5BN3 A;  1S3O A;  4QB4 A;  4LF6 L;  2JA6 G;  4A3D G;  1HNX Q;  4DNI A;  2I0Q A;  1SMX A;  4JV5 L;  4NP5 A;  4HCS A;  3ERQ A;  1CSP A;  2BOS A;  1VQ4 A;  1VF5 C;  3K0Y A;  4A3F G;  3GTG H;  4DR6 Q;  1B7Y B;  1JB7 A;  1ROD A;  1W2B A;  2B2T C;  4LFC L;  5JPM C;  1H9K A;  1VQP A;  4E6I A;  3CKI B;  1TU2 B;  1HTP A;  2ZJQ A;  3PQI A;  4U67 3;  1QVF A;  5M9O A;  4LFC Q;  4DV2 Q;  4EQ5 A;  2BE5 C;  3KF6 A;  5E7N A;  4LFB Q;  1YJW A;  3NEM A;  3DHQ A;  3MZ5 A;  1SBB B;  3STB C;  2UUC Q;  3TSS A;  4Q0F A;  2XRQ D;  3R8B A;  1JJG A;  2MPM A;  4KMU C;  2F0N A;  2WII B;  4GLX A;  3SEB A;  3K7A B;  1JC7 A;  3NSW A;  4OO1 I;  3FHW A;  4RHR A;  2EXD A;  4LJZ C;  3RD4 A;  3OIP A;  3KLS A;  3HG9 A;  1QVC A;  4K5X A;  3I4M G;  1T9H A;  2TSS A;  4YWK A;  3VR3 A;  4DV5 Q;  1J5E Q;  4XIG S;  2OEO A;  3A8I E;  4CDC C;  3FVQ A;  3SE0 A;  3SHL A;  3OTO L;  2IX1 A;  3K59 A;  5K5P A;  1I6H H;  3GTJ H;  1VQO A;  3SK8 A;  4DKA C;  4OO1 G;  5K36 G;  4XT1 B;  1QNK A;  4ILW A;  4JBK A;  4JI0 L;  1TS4 A;  2XRS D;  1TVX A;  4JI1 L;  2PPB C;  1FJG L;  4KHP L;  2KEC A;  2X69 A;  5CBA E;  1I4G A;  5FJ8 H;  4A4I A;  1EOV A;  4B3T L;  3H91 A;  3SK4 A;  4K6D A;  1TR5 A;  2DJG C;  3C3L A;  3GD7 A;  5JJK A;  5M3F G;  4LNQ A;  1VS0 A;  1RHP A;  1U4P A;  3TP8 A;  1HCZ A;  3A8K E;  3OSO A;  1JWM D;  4G4K A;  3TBI B;  1QNU A;  4A3M G;  2CHB D;  1CHP D;  2DJF C;  4NXM L;  1EQV A;  2I5L X;  1FNU A;  1PH2 A;  3K5M A;  1T5X D;  2XIW A;  4XYO A;  3UI2 A;  1TWH H;  4QGU A;  4A3K H;  4LF4 Q;  3GTK H;  4DV6 Q;  2K03 A;  1A3U A;  3VYU A;  1KDB A;  1E1T A;  3H0G G;  4OWT B;  4ZUJ A;  4ZKB B;  3KLW A;  2OXP A;  5DM6 3;  1C7Y A;  2ASB A;  2A68 C;  1M1K C;  1B1Z A;  2PW5 A;  4XYQ A;  1VMP A;  1D5M C;  1F2L A;  2BDN A;  4H0L C;  2OCE A;  5FKA C;  2B63 B;  3OMC A;  2EYL A;  1BVS A;  5CR3 A;  3R93 A;  4QIW E;  2PNR C;  2EPB A;  3HOW H;  3PO2 G;  1G2S A;  4DV4 L;  2DGY A;  5CMD A;  1OXT A;  3UDF A;  4MHE A;  2RVL A;  5IGB A;  1PRT F;  1Q3L A;  3J7A V;  1O80 A;  3P7J A;  4IPD A;  3S2H B;  4RMF A;  1E2Z A;  1YBY A;  3I90 A;  1MJE A;  5IYB H;  1CSQ A;  2JA8 B;  4GKJ L;  1TWG B;  3VYR A;  4TSS A;  4H13 C;  4H7B A;  2N55 A;  4DFA A;  1Y1W H;  2K5H A;  1OXV A;  1STA A;  1HZA A;  1EY0 A;  2B2W C;  2VQF L;  1BNZ A;  5C3X A;  3KBX A;  4NMZ A;  4LF7 L;  3M85 A;  4JVZ A;  1VQB A;  1K9M C;  1OXX K;  1SNO A;  1A0I A;  4K8I A;  3QB3 A;  5FO9 B;  1D1K A;  4UAI A;  4FO2 A;  2F4V Q;  3GTK B;  2K5V A;  4DR6 L;  3TP7 A;  5I2X A;  1UEB A;  2KCN A;  1TT2 A;  5FLX L;  3N6R A;  2G9H D;  4YY3 Q;  4ALP A;  1YIT A;  4P75 A;  5JJZ A;  4C1N I;  1HFN A;  1S5D D;  1SYG A;  3PGZ A;  1YNJ C;  2B2U A;  2PO4 A;  1HFG A;  3CCS A;  4WOR A;  2XTI A;  3J81 i;  4DAV A;  4KK7 A;  4LF8 Q;  1TWC B;  1ASZ A;  2Y0S B;  1C48 A;  2UUA L;  2F0D A;  2MJ8 A;  2AMC B;  4C3J H;  4JC0 A;  2PW7 A;  3KJP A;  4X64 L;  4IZ8 A;  4EQO A;  1N32 Q;  1K0R A;  2CQA A;  1KLG D;  2Y0S G;  3Q22 A;  4IUR A;  2KA7 A;  3TS0 A;  4DV7 Q;  1QZG A;  2H4O A;  4TRD A;  1Y1W B;  2ICI A;  4RCN A;  4DPG A;  1STE A;  1WYD A;  2EJM A;  3CQZ H;  4XDX A;  3A55 A;  2JA8 G;  1Q90 A;  2EJF C;  3HOV G;  3GTL B;  5IGC A;  3OYY A;  1XXG A;  1AE2 A;  1MHW C;  1D5Z C;  2BDO A;  2B2Y C;  1LT3 D;  2A1A A;  1LUZ A;  1JE5 A;  1I3Q B;  1M4V A;  2SDF A;  4QQB X;  1BQQ T;  2A74 C;  3EN2 A;  2E2J H;  1GUW A;  1YHQ A;  1XX8 A;  1PZI D;  1X3Q A;  4LF5 Q;  1NR2 A;  3NUC A;  4JYA L;  4DR5 L;  3S2D H;  1D2B A;  3KFU A;  4KV6 A;  1U4R A;  2AHO B;  3CHB D;  2NZH A;  4I7Z C;  4CJ2 C;  4JBW A;  3AMU A;  1NMG A;  5T1I A;  5LL6 S;  4A3B G;  2E2I H;  2Z1C A;  2JA5 G;  1EWH A;  1SE2 A;  2HCI A;  4GNX B;  1VQA A;  2YTX A;  3I72 A;  2JJQ A;  5C0X H;  1ENA A;  2FIN B;  4P71 A;  3F8T A;  1LTL A;  1JR0 D;  4X3T A;  2VUM H;  1Q1E A;  2M00 A;  3AU7 A;  4APV A;  1JT8 A;  4A3I B;  4BXX G;  2CW0 C;  3SK6 A;  1ICF B;  2LY7 A;  4ODG A;  3NWS A;  3TZU A;  4KI0 A;  3MTS A;  4K8J A;  3I91 A;  1D7Q A;  2KHJ A;  1B3A A;  2GVA A;  5A2Q E;  2I5M X;  4BBR H;  2X6G A;  2A6H D;  2KEN A;  2SOB A;  2KHS A;  3VR4 A;  2GA4 B;  5ELC A;  3DM3 A;  1JJC B;  1Y8O B;  1ZEQ X;  4JI7 Q;  4ZKC B;  1TWF B;  3K7U C;  3SDZ A;  3KF6 B;  3UDX A;  1AP0 A;  2QCP X;  2MGS A;  3G71 A;  1L1O B;  1LTR D;  3MFY A;  5I9O A;  1YNN C;  4IUN A;  2R6G A;  4K2L A;  3DEP A;  1DJR D;  1HHV A;  3G7L A;  1ET6 A;  1STG A;  3R3O A;  2RBM A;  3CPW A;  2NN6 H;  2K5Q A;  2WB1 G;  2NVY B;  2IY5 B;  2EZV A;  2UXC Q;  1Q8I A;  1TS2 A;  2C9O A;  1VQ6 A;  1PYW D;  1EEF D;  1AW7 A;  3WWV A;  1MIU A;  4IUT A;  3GTO B;  3FP9 A;  2Q8I B;  4HIO A;  4POG A;  4DR3 Q;  4DV5 L;  2MNA A;  1TWF H;  1IZ6 A;  2NWG A;  4AYB E;  4DV3 L;  2I07 B;  2E5L L;  1CQV A;  2N49 A;  4DAY A;  5J39 A;  2JE6 I;  3D6W A;  4F88 A;  5C5L A;  3PF5 A;  1EU3 A;  3S2D B;  4A3I G;  1CTM A;  3VDY A;  4G7H C;  4JI8 Q;  1N33 L;  3TRE A;  3GP7 A;  5HY6 A;  3H09 A;  4MTK A;  2NVT H;  2MUY A;  3X3M A;  1F9S A;  2UXB L;  1QUQ A;  1RTN A;  2TMP A;  4BY1 G;  3I73 A;  4DV2 L;  1XTD A;  4JI6 L;  5EPJ A;  1KDC A;  4HTH A;  4LMQ D;  1HQR D;  1JQY D;  1J9O A;  2BCO A;  1OXS C;  3Q23 A;  3L9A X;  3HKS A;  5A2Q L;  3P20 A;  1KLU D;  1EYG A;  1NY4 A;  1UE5 A;  1TKW B;  1EY5 A;  3ZYY X;  2NB0 A;  1F9Q A;  1QE6 A;  1EYC A;  2QDB A;  4A3J B;  2IHE A;  4DR4 Q;  2Z9H A;  4FF3 A;  1RCV D;  2L0C A;  1GVP A;  1KDA A;  3RR5 A;  1H9R A;  5COY A;  5KND A;  2ZM6 Q;  1WTV A;  2R7Z H;  3NPP A;  4OEM B;  3GTG B;  1O7L A;  1J8I A;  1JCK B;  1NR4 A;  2WB1 B;  3H94 A;  1H9S A;  3FDT A;  1J6Q A;  1JOO A;  4X65 Q;  3GTO H;  3NBH B;  1VDZ A;  2R61 A;  2VUM G;  1EU4 A;  3V96 A;  2KHI A;  1IW7 C;  4EQP A;  3NBH A;  1WTP A;  4IFD I;  4DV0 Q;  2JA7 B;  3J81 E;  3MXG A;  1PLF A;  2ZXR A;  3DWP A;  4ZQ3 A;  1O7I A;  2EYH A;  1EZ6 A;  3HOZ B;  3PO3 H;  4JI0 Q;  1EIH A;  5EKL A;  5I4D A;  1D8L A;  1DGS A;  4XXE A;  2JA6 B;  4A3D B;  3CF5 A;  1G2T A;  2VNU D;  2YV5 A;  4KKS A;  4LW1 A;  1GUG A;  1D5X C;  3UE0 A;  3ULP A;  3H3V H;  5D3D A;  4GKJ Q;  1CKM A;  3K7A H;  2B2Y A;  4I65 A;  2E74 C;  4JG2 A;  1LTA D;  2SEB D;  1SN8 A;  2M2L A;  2MO1 A;  1FVI A;  3I4M H;  1VQH A;  5G3L F;  3RMH A;  1Q82 C;  3AYH B;  4TKO B;  2KED A;  5IYD G;  2D5D A;  3MC0 B;  1FGB D;  1CZW A;  2Z4H A;  2GVB A;  3L3O C;  3I2Z A;  2A6H C;  4M8A A;  3OW7 A;  2VB3 X;  4L5R C;  2R92 B;  4A93 H;  4Q5V A;  3I55 A;  3S16 B;  4GKK L;  1HZC A;  1XPR A;  1Q81 C;  1I50 H;  5IY0 A;  4KHZ A;  4DAY B;  3PIO 3;  1XJV A;  1PVO A;  1IBK Q;  3L0O A;  4BS9 A;  1HXY D;  3LWU A;  3HKZ B;  1QCB D;  2E2I B;  3PUZ A;  1HUM A;  1PH9 A;  3ER0 A;  3QIA A;  3D8G A;  1TII D;  3RLN A;  1XNQ L;  4IPC A;  1GO3 E;  1PTO C;  2QDL A;  5E3F A;  3CCJ A;  1Z6H A;  1X65 A;  1K73 C;  2MP1 A;  3L7Z C;  4UY8 C;  3MEH A;  4GS3 A;  5FLM G;  3BVM A;  4IUV A;  3S17 B;  1QUQ B;  2RDF A;  2G9D A;  3KLR A;  3NTK A;  3D31 A;  1RL2 A;  4ZAI A;  3KK7 A;  1QB5 D;  1EOT A;  1W6J A;  1LT4 D;  4J6H A;  3PMF A;  1KC8 C;  1FYC A;  2MHV A;  2Q2H A;  1GHJ A;  1RTO A;  2R7Z G;  3I7F A;  4HAE A;  2QIL A;  5F2D A;  3TN2 A;  4X66 L;  2RCF A;  3FEW X;  3E5S A;  5C44 G;  2Q2T A;  2WFW A;  1SNC A;  3CMA A;  2O2L D;  4A75 A;  1PTO D;  2E75 C;  3U9O A;  5IT9 L;  3HOW G;  4X3U A;  3TZD A;  5M3M B;  3MAQ A;  4B3R L;  1S72 A;  2NVY H;  3NQI A;  4MNO A;  5C4X B;  1PRT B;  1XTC D;  1FGU A;  3A54 A;  1JB3 A;  1PHJ A;  2HCC A;  1Z7T A;  1CQF A;  4LF9 L;  5C4J H;  2OTL A;  4LFB L;  4HJ5 A;  2OTJ A;  3DEO A;  3S14 H;  1N33 Q;  3PIP 3;  5M3F B;  1K83 H;  4LFA Q;  4OHJ A;  2D0O A;  3ERO A;  2KEE A;  1TS5 A;  4UPA A;  5C3E G;  1XWE A;  2L4N A;  3BZD B;  4IN3 A;  4NXM Q;  1I4X A;  3BJU A;  4PZ7 A;  3VA7 A;  1U0L A;  1WTX A;  2F0W A;  3DUZ A;  1BKB A;  1A62 A;  4CHT B;  3PUY A;  4HED A;  2HIV A;  4LFA L;  1QZH A;  4LF4 L;  4YHH Q;  4WFN 3;  1DCZ A;  4YCU A;  4AH6 A;  4EX5 A;  3CCR A;  1KAW A;  1JJ2 A;  4HIK A;  2H1E A;  4DR2 L;  1VQ8 A;  1YJ9 A;  3J7Z C;  5D65 A;  5JOB A;  1WD0 A;  2PZT A;  4K6L A;  2F3V A;  3ULL A;  3H3V C;  2KCT A;  2VQE L;  1DON A;  1JOR A;  1A3V A;  1N8R C;  1NSN S;  1Y69 U;  4QUC A;  2N3S A;  1EY6 A;  5C4H A;  3NE5 B;  5C6A A;  3G6E A;  1C0A A;  5H1S E;  3A5U A;  1MBY A;  1PFM A;  5EKK A;  3S24 A;  4IO9 A;  1SE4 A;  5EPK A;  4FNF A;  2I46 A;  4HIM A;  1X3G A;  1GHK A;  1VQI A;  4DA2 A;  3HOU B;  4JI2 Q;  1EWC A;  1K0S A;  2IX3 A;  1H95 A;  2UU9 Q;  1VQD A;  2EY1 A;  1Q7Y C;  4R4I A;  1Q8K A;  1WFQ A;  2AQ1 B;  1QIL A;  4O0A A;  2KJX A;  1ESR A;  3LGJ A;  2ZJP A;  4DR1 Q;  2JA7 H;  2JA8 H;  1PMR A;  1AE3 A;  1TWG H;  2E2H B;  4PMW A;  2C35 B;  4XQJ A;  1HR0 L;  1VQJ A;  1U4M A;  5LMU L;  2JQO A;  4G57 A;  4JOI A;  5GAG C;  5DEH A;  4CKE A;  5ELD A;  1RF2 D;  2Q8R E;  1I3Q H;  1NUC A;  1NBW A;  1I4Q A;  3CP0 A;  4RGO S;  1X6O A;  1PZJ D;  5EBD A;  1E24 A;  3VR2 A;  3LX0 A;  5ISR A;  1MGS A;  3CC4 A;  1Q1B A;  4YIJ A;  3RZO B;  1EFW A;  3GTP B;  2IX0 A;  2JYO A;  1XNQ Q;  4ZLT F;  4LUZ A;  4UP9 A;  2B8F A;  2R92 H;  4X6A H;  1XNR L;  5C0X G;  4JK1 C;  1ASY A;  2RQX A;  3X3N A;  1Y14 B;  1BCP F;  3I4M B;  1SND A;  5C3E H;  5DM7 3;  1VQG A;  3M4O B;  2K28 A;  3RLF A;  1AFP A;  4HCE A;  1V1O A;  3J7A 5;  3BZC A;  3U4Z A;  4A93 B;  1E22 A;  5KNC A;  1WCM G;  2E8G A;  2HIX A;  3C1F A;  1HJP A;  4JI1 Q;  1YEZ A;  2F0V A;  4DUY Q;  1WTR A;  1L1O A;  1LAB A;  1SNP A;  1KXL A;  1I50 B;  2XGT A;  1B70 B;  3ZJY C;  2R93 B;  4YWM A;  1F2Y A;  4J8Q A;  5KRU A;  5DNF A;  4LK1 C;  2K4K A;  2OF1 A;  4DR5 Q;  5JEA J;  3MEF A;  2F0L A;  1BF4 A;  1GUT A;  3BZK A;  1BBW A;  1BCP C;  3NTI A;  2GN5 A;  1NMF A;  3VYT A;  4RGN A;  2K75 A;  3WDN A;  4UP7 A;  2E76 C;  1Y1W G;  1PFN A;  1F9R A;  3FKI B;  1E2V A;  3H3V I;  3CU7 A;  1S40 A;  2RHS B;  1BDO A;  2NTT A;  4EVO A;  1PH1 A;  2B63 G;  3GTM H;  1S5F D;  3CRK C;  4NXN Q;  3HOX G;  1ZKO A;  5AFW A;  2L1B A;  5LL6 X;  5C4X H;  1AN8 A;  2J4X A;  2CH4 A;  4LWC A;  3WOE A;  4YHH L;  1MKH A;  2IL8 A;  3HFZ B;  2NZ1 D;  1KRS A;  2JA7 G;  1KAA A;  1KTK A;  4RH6 A;  1DM0 B;  4DV4 Q;  4L5S A;  3PCO B;  3SXH A;  1PH5 A;  3CRL C;  1A2U A;  4C1N K;  2FMC A;  3PV0 A;  1BBU A;  4MN3 A;  2EY5 A;  1CKN A;  4R4C A;  3CQZ B;  2ZTE A;  2PQE A;  2K32 A;  2VQE Q;  3S1R H;  1R9T B;  2F1M A;  4PZ8 A;  4BY1 H;  1ML0 D;  2F0O A;  2QGQ A;  5E4X A;  1SXT A;  1X56 A;  3K5O A;  2MQH A;  3HOW B;  4N8F A;  3I4N H;  1K3R A;  2KOL A;  4C56 C;  2FFK B;  3E0E A;  1V8Q A;  5T1G A;  3KF8 A;  3S1M H;  4C3I H;  3WOF A;  2UXC L;  2K6A A;  2WKD A;  5IT9 E;  4CJ0 B;  1F77 A;  1DOL A;  4L8J A;  2UUB Q;  4DUZ Q;  2A68 D;  4X62 Q;  3U4V A;  2WAQ B;  1VQK A;  3S1Q B;  4GNX C;  4A3B B;  1NCV A;  2F0J A;  3A0J A;  3S1N H;  4QY7 A;  4A3F B;  1D1I A;  1K28 A;  3KDF B;  2HT1 A;  2UUB L;  1TXY A;  2DY8 A;  2N88 A;  2B2V A;  1UNS A;  4DR1 L;  4FYD A;  3V2T A;  3A7L A;  4P74 A;  5KGU A;  2Y0S E;  2AWN A;  4K5V A;  1LO5 D;  3K5N A;  4QIW B;  2IWH A;  1JMC A;  1I6H B;  5LMU Q;  4B3M L;  2P5Z X;  4DK6 C;  1GOZ A;  4DAM A;  5EJW A;  4B08 A;  4IJL A;  2OQK A;  2K7V A;  1K8O A;  1NJI C;  2LS0 1;  2IW3 A;  2Z6B A;  1II3 A;  1DOK A;  1U9R A;  1PH8 A;  4OIK A;  2JA6 H;  4KD4 A;  4A3D H;  3GV6 A;  3ONA B;  2Q8T A;  3AFP A;  2M9V A;  3D3R A;  4A3B H;  1GUO A;  4CKB A;  4A3F H;  2ZTC A;  3BDO A;  1BCP D;  2RKS A;  1DYQ A;  3W1G A;  1I4P A;  1CKO A;  4F8M A;  3K81 C;  1WOC A;  2QEJ C;  5IYC H;  1IYU A;  4YCW A;  1X55 A;  2RSN A;  4F7X A;  5IT9 c;  1SDF A;  2HHH Q;  2QF7 A;  2CVR A;  2VB2 X;  1U4L A;  4AIM A;  1YVC A;  2HUG A;  5G3L D;  3NXW A;  1Q86 C;  5JJL A;  1STY A;  2L9H A;  2K01 A;  5EPL A;  3GTQ H;  1CT1 D;  5L37 A;  1PH3 A;  4R4Q A;  4BY7 B;  2F0I A;  3EJI A;  1CHQ D;  2V1C C;  3PSI A;  2F0T A;  3K8A A;  1EFI D;  1MD2 D;  1PH4 A;  2FXQ A;  3GDE A;  4DR7 L;  3P1H A;  3QO2 A;  4BY7 G;  2ZT9 C;  3Q6S A;  4JI3 L;  2F52 A;  3HOU G;  2MO0 A;  2Z6K C;  1WD1 A;  2JP1 A;  3D6C A;  4P73 A;  4C2M B;  4K0K L;  2JA5 B;  2EIF A;  3KF8 B;  1IXR A;  1KQS A;  2K50 A;  2LXJ A;  5KYI A;  3JAM L;  1G6P A;  1SJE D;  3HS0 C;  3BS1 A;  4HJ8 A;  2NBF A;  2FHT A;  3CCU A;  2KVM A;  2YTY A;  2KBN A;  3NWT A;  4RA8 A;  1ZYR C;  4JI7 L;  2F0S A;  2RSO A;  4G7Z C;  4DR2 Q;  4IJH A;  2K52 A;  1A3T A;  2AQ2 B;  1L0X B;  2LXK A;  3T1H L;  4K2K A;  5C3W A;  1OXU A;  4UHV A;  1SMY C;  3HEJ A;  3KDF A;  3Q8D A;  3KBG A;  2VXW A;  5KEE A;  3TME A;  1CA6 A;  2JSO A;  1BCP B;  2CQO A;  1OTC A;  4DAP A;  2B2U C;  3BU2 A;  3PUW A;  3CW2 C;  1D6E C;  1WTH A;  2J7Z A;  4HMJ A;  5FK9 C;  2R3Z A;  3FKI H;  4IOA A;  3S16 H;  4I7A A;  3LNN A;  4A3M H;  3M4P A;  2RDH A;  5DLQ E;  5IP9 G;  2SNS A;  3IFT A;  1FD7 D;  2LMC B;  4NW2 A;  2EYO A;  1Y1V G;  2XNA C;  2RA4 A;  3OWF A;  4CDE C;  1SYE A;  5LMN L;  3ND9 A;  4B3S L;  4J1M A;  1DD2 A;  3ERS X;  4LF7 Q;  5IE8 A;  1F2M A;  4JI4 L;  4IPG A;  4N9T A;  2PQA A;  2BH8 A;  1YHA A;  4A3K B;  2PZU A;  4L63 B;  4RCO A;  1PH6 A;  1JE4 A;  3HGB A;  5BR8 Q;  1IKL A;  2WB1 E;  2PQA B;  3GTP H;  1S4Z A;  5IGF A;  1H9M A;  4OXP A;  4ZCK A;  4X62 L;  1G8Z D;  2N8N A;  3DM1 A;  1TY0 A;  1V1P A;  2VL6 A;  3STB D;  5AJ3 L;  5J3B A;  1UUP A;  3SK5 A;  1QWY A;  4X66 Q;  4Y7N H;  3F2D A;  4XTC S;  4BY1 B;  4BA1 I;  4UP8 A;  2EOT A;  2BA1 A;  4HSP A;  1EL0 A;  2B29 A;  5BR8 L;  1RIP A;  1PZK D;  1HZB A;  3L2P A;  3PF4 A;  2A19 A;  1IBK L;  4PMC A;  5FOB B;  3CCV A;  2UUA Q;  2A6E C;  3U9S A;  1EIG A;  4OO1 H;  3FMC A;  4WJ3 M;  4ZRZ A;  4GLA C;  1LT6 D;  3GV3 A;  3M4Y A;  2ICE C;  3S15 H;  3S1Q H;  1R9T H;  2NTS A;  1O78 A;  3BDC A;  4FXG C;  1E2W A;  3ND8 A;  3F1Z A;  4NDX A;  2K33 A;  3DMU A;  2RCN A;  3KYH C;  1Z9F A;  3A8J E;  3O13 A;  5IWA Q;  5FJ8 G;  4FXD A;  3OW2 A;  3GTQ B;  3C46 A;  5M5W H;  1QJO A;  4C3H H;  5LHY 1;  1MJC A;  4O1N A;  4KD3 A;  4ID6 A;  2WP8 J;  4KY5 A;  4HSV A;  2EYP A;  3VR5 A;  3NHH A;  4X65 L;  3RZD B;  3I70 A;  4AYB B;  1VQM A;  1S5E D;  4A93 G;  1Q12 A;  1SNM A;  4A3E H;  1SAP A;  3TEH B;  3NP8 A;  1Z47 A;  4ZUI A;  1I4R A;  1VQF A;  3QWN A;  2F0G A;  3MFG A;  4A3L H;  5JEA G;  2F0K A;  1HZ9 A;  3NQT A;  4BBS G;  3URY A;  4ZK9 B;  4C3J G;  5M5Y B;  1TWA H;  4DXG A;  2C5C A;  1WI5 A;  5EBC A;  1WTQ A;  3EBE A;  1EYD A;  4POF A;  1V43 A;  4LF9 Q;  1HR0 W;  1R4Q B;  1YHB A;  5JAV A;  1LTB D;  1E7Z A;  3F2B A;  3RN5 A;  3PO2 H;  1B2T A;  4DK3 C;  5EAY A;  3EVQ A;  3FKI G;  3T56 B;  2R92 G;  2ES2 A;  1L1O C;  5IP9 H;  2F0F A;  1UE1 A;  3F2C A;  3RZD H;  1KIX A;  1PTO H;  3T16 A;  1B44 D;  2B3G A;  4DXF A;  4OWW B;  2FMM A;  2K1B A;  3F2U A;  2EY2 A;  2B8G A;  1ESF A;  4HJ9 A;  2AUK A;  4FP5 D;  5FO7 B;  4DN4 M;  5IYB G;  4FVM A;  1MI2 A;  2A73 B;  2J0T D;  3NEL A;  5M5W B;  4YCV A;  1G29 1;  5IGG A;  1B9N A;  2Z4I A;  5NUC A;  3U58 A;  1A8V A;  5CV8 A;  4FF4 A;  2O4X A;  4QCL A;  1LTG D;  1VQC A;  5FO8 B;  1KD1 C;  2F3I A;  3JAM i;  1PRT D;  4B9W A;  5I6Y A;  4CDD C;  4OGQ C;  1A15 A;  1HNZ L;  5ELN A;  5CV6 A;  1I94 L;  2F03 A;  1LLR D;  3PO2 B;  2F0M A;  1XMO Q;  2CWA A;  1ILQ A;  3CC7 A;  1XMQ Q;  2A5H A;  4KJO A;  2JA5 H;  1HRJ A;  1SEB D;  2FJ2 A;  1LV9 A;  4KN4 C;  2HQE A;  3SR1 A;  1IL2 A;  2XSC A;  4CDF C;  3KOJ A;  3QOL A;  5M5Y H;  5JVH 3;  1M90 C;  4QJF A;  4S3S A;  3Q0A A;  3ULJ A;  3PUV A;  4ME3 A;  3DXJ C;  5COR A;  1I5F A;  4OX9 Q;  4K5W A;  5KIX A;  1PV4 A;  1K8M A;  1KAB A;  2EJG C;  1WTO A;  4LF6 Q;  5LMN W;  3C1E A;  2F0Q A;  1IYJ B;  4A3J H;  1HNX L;  5GAH C;  4C3H G;  5C4X G;  3SGI A;  4OX9 L;  2JN4 A;  2VS1 A;  2L5T A;  1BXT A;  1E3P A;  2JA9 A;  4GN4 B;  5IIF A;  3MXU A;  4B3R Q;  3OHX C;  1BBX C;  1YNN D;  4C3H B;  3HOV H;  1CKN B;  4IUP A;  3C2P A;  1MSG A;  1VCI A;  3QJY A;  3I4L A;  1WVL A;  2OWO A;  4KKT A;  4QMG A;  4RGT A;  1X32 A;  4A3G G;  3FPU B;  4L6T B;  2E2J B;  1Y8P B;  4DGZ A;  2JK8 A;  1TS3 A;  1SYF A;  1YZ6 A;  2JEB I;  1B9M A;  1O7Y A;  3CCL A;  4C3I G;  3S1M B;  2XWB B;  2BH2 A;  2AUJ D;  4MZ9 A;  1PYS B;  1XNR Q;  2XVS A;  3T53 B;  3RN2 A;  1BR9 A;  4OEL B;  2K05 A;  3VA5 A;  1L0W A;  1PTO F;  1N34 L;  1BUV T;  3GTJ B;  1EY9 A;  4NKL A;  4HJ7 A;  3A56 A;  4A3I H;  2L55 A;  1SR3 A;  3BYT B;  1PRT C;  1STN A;  2HHH L;  2RDG A;  1KL9 A;  3E9H A;  1FR3 A;  2YU9 H;  4BBR B;  1AH9 A;  3J81 j;  4LUO A;  2NZO A;  2R7F A;  1LTT D;  3K80 C;  3ITP A;  3K58 A;  2EYJ A;  1PH7 A;  4GZY C;  1PTO B;  5C4Z A;  4DK1 A;  2WKC A;  3T13 A;  3EIV A;  4PG3 A;  5ELB A;  1T5E A;  4L5T A;  1K8G A;  4RFB A;  1ET9 A;  4R8I A;  3HOV B;  4JI2 L;  2Z8L A;  1NTG A;  4KHP Q;  3RUZ A;  5HUR A;  1KRT A;  3G6J B;  3UE1 A;  1SE8 A;  4L5Q A;  4B3S Q;  4JYA Q;  1YJN A;  2R7Z B;  3S17 H;  1PDQ A;  2KQ3 A;  4GN5 A;  5BN4 A;  5IYC G;  4JV5 Q;  2Z6K A;  3M4Q A;  4RAU C;  3AB9 A;  3GO5 A;  3MXN B;  3V05 A;  1G51 A;  2D2C C;  4OIJ A;  1AEX A;  1CUK A;  1UEA B;  1PYB A;  3OIQ A;  4TQU S;  1HPC A;  3MXN A;  3BDL A;  1SMY D;  2KCM A;  1W3S A;  4G7O C;  2D0P A;  4CGY B;  3G4S A;  5AJ3 Q;  2IT1 A;  3I56 A;  3PO3 G;  2LFN A;  4V0B A;  3PIO A;  2F0U A;  3NTH A;  2A8V A;  1I6V C;  3ICE A;  2F0P A;  3DWQ A;  1LT5 D;  1KNA A;  4RWS C;  1H9J A;  2PCF B;  3K0X A;  2DN8 A;  2ZJR A;  1GUS A;  1SE3 A;  1B3Q A;  2A69 D;  1W6K A;  1X3F A;  2EXZ A;  2ATW A;  3DLL A;  2EQS A;  4GN3 B;  3HOU H;  4JI5 Q;  4P72 A;  5CV4 A;  3BG3 A;  5CC4 A;  3K57 A;  2VUM B;  1F9P A;  1TQO A;  1SRU A;  2NVX H;  1LAC A;  3K6O A;  1HA6 A;  2PMZ E;  3R2T A;  2PMZ B;  3J80 E;  2LKV A;  1X3P A;  2YU9 B;  3HOX H;  1QVG A;  1IL8 A;  3MWY W;  5C44 B;  1SLJ A;  4RHS A;  2DNC A;  5C0X I;  4A3K G;  1IYV A;  4OWX B;  1B53 A;  4H44 C;  1VQ7 A;  2CKZ B;  3OTO Q;  3GTL H;  3JAM E;  1STB A;  1EQT A;  1KNE A;  4FDB A;  3GTM B;  4ULL A;  5EKI A;  4JCV E;  1E0B A;  4IFD G;  1NNX A;  2PYK A;  1N36 L;  4IOC A;  1EYA A;  1V1Q A;  5GRO A;  1TWC H;  4DV3 Q;  4O42 A;  3UDG A;  3G48 A;  4Y52 H;  4B3M Q;  5GAE C;  4IUQ A;  1FJG Q;  4CBV A;  1X3E A;  2O5I C;  1CI3 M;  3TDQ A;  4EQN A;  1EY8 A;  2HQL A;  3TQY A;  3J81 L;  2QEX A;  4DR7 Q;  3HOZ H;  3PO3 B;  4B3T Q;  1Y1V H;  4HJA A;  3I4N G;  4V19 0;  4OON A;  3NEN A;  1JOQ A;  2IJ0 A;  2Q2I A;  5A35 A;  2X6L A;  1EY4 A;  4Y7N B;  1SJH D;  4GNX A;  1STH A;  2NYZ D;  1LTS D;  3VR6 A;  2VW9 A;  3CCE A;  1H9S B;  5JPN C;  5J1Z A;  5CBE E;  4DV7 L;  3T4A C;  3OPO A;  4PZ6 A;  4DNT B;  1OO9 B;  2WAQ E;  1LYL A;  1ZYR D;  5GQO A;  1CM9 A;  1V1P B;  3KUP A;  1C8C A;  4WJW A;  1VMC A;  2ENB A;  4X3S A;  4R4T A;  5ELO A;  1IKM A;  5BN5 A;  2OQ0 A;  3LWE A;  5D3I B;  3T51 B;  1G91 A;  2A6E D;  2EVB A;  4DK0 A;  5E1F A;  3GQB A;  3RNU A;  1FL0 A;  1X54 A;  1XMQ L;  2K5D A;  3HRZ C;  2JXM B;  5M5X B;  4KY7 A;  1SFO H;  3D4W A;  4ME5 A;  4DV1 Q;  3I3C A;  4J15 A;  2SNM A;  1RD9 D;  2B2V C;  3S9W A;  4MIU A;  3K5L A;  5E4W C;  1RDP D;  3RZO H;  2F0E A;  4BBS B;  2K04 A;  4DUZ L;  2DNE A;  3MA2 B;  3IRB A;  3A5Z B;  1HUN A;  4K14 A;  3NBI A;  3KLS X;  2E2D C;  4LUV A;  1HR0 Q;  3CD6 A;  1BO0 A;  5FLM H;  3CC2 A;  5KNB A;  1Q46 A;  2Q2U A;  3M3Y B;  4OL7 A;  5CV5 A;  4A3E G;  4RKB A;  5C3E B;  1YIJ A;  4A3L G;  5JEA H;  3S1N B;  2AKW B;  2UXD Q;  2NUC A;  3IFD A;  5J22 A;  1LTI D;  1VQL A;  3E3X A;  5HGT A;  2KUM A;  3AFQ A;  1PFB A;  4MTN A;  2HDL A;  2I5H A;  4AQY Q;  3N52 A;  4IAL A;  1VF7 A;  3I4O A;  3HOX B;  4IFD H;  1B4O A;  5C44 H;  4RG1 A;  2UXD L;  2WAC A;  1HNW Q;  2R7D A;  4BY7 H;  1UWV A;  3PUX A;  1RJT A;  2D9U A;  5M3F H;  4A3G B;  2N78 A;  5IOD A;  3JC6 6;  1Y8N B;  3JAM c;  2PI2 A;  4AYB G;  4HN7 A;  2ZXO A;  2BE5 D;  5C0X J;  2K5W A;  5HGQ A;  2VQF Q;  3M9B A;  3HZX A;  1DOM A;  2PNH A;  5ELE A;  1UAP A;  3EA6 A;  4IQZ A;  2O5J C;  3P75 A;  4DUY L;  4C2M H;  1A2T A;  5EQ0 A;  1WTW A;  1AZQ A;  1JOK A;  1CK1 A;  2L12 A;  4Z9C B;  3H0G H;  3W5O A;  4R9W A;  1JWS D;  2A69 C;  4BWG B;  1VQ5 A;  2E5L Q;  2F4V L;  4KLK A;  1WJJ A;  2NN6 I;  4JBM A;  1QOH A;  1HQM C;  3BVG A;  3R2I A;  3MXP A;  4A3E B;  3CCQ A;  1VQ9 A;  4LF5 L;  1N36 Q;  2EE1 A;  5KYL A;  3TP5 A;  4WJ4 A;  3HOY H;  4A3C G;  3SVM A;  1GJX A;  1QG7 A;  4LF8 L;  4R4O A;  2DY7 A;  1ZXT A;  3PIP A;  3D4D A;  1JWU D;  4K0K Q;  3CXC A;  1UE6 A;  4KHV A;  2NN6 G;  4IUU A;  2XWJ B;  5TSS A;  1V9P A;  3I4N B;  4KKU A;  2HDM A;  3J80 i;  3U50 C;  1B50 A;  3EQL C;  1GKH A;  4X64 Q;  1L0Y B;  1EQR A;  5FLX E;  3J80 L;  1EIF A;  4DU9 A;  4JW0 A;  3OOC A;  3A74 A;  3E0J A;  4B9X A;  4DF7 A;  3S2H H;  4A3J G;  4DR4 L;  3T1H Q;  3HKZ E;  1N34 Q;  5I6W A;  2QKI C;  5M5X H;  1SFO B;  2ZM6 L;  2L11 A;  4PQX A;  1HA5 A;  2LSS A;  4KTA A;  2PI2 E;  4KY6 A;  3J81 c;  3QR8 A;  1I94 Q;  1X9N A;  3H15 A;  5C5M A;  2EYM A;  1YNJ D;  3Q24 A;  1JIC A;  2F3W A;  3W3A A;  1IBL Q;  2NVQ H;  1RKN A;  4A3G H;  1K83 B;  1I4H A;  4DV0 L;  4UDU C;  3CPF A;  5LMN Q;  1TWH B;  1IW7 D;  3OMG A;  1DXM A;  2F0H A;  3BVZ A;  4KJN A;  4JOI C;  1EZ8 A;  1XPU A;  4CKC A;  1Y1V B;  1YI2 A;  4A76 A;  4FF1 A;  4O2D A;  3BYY B;  4JI4 Q;  5JJI A;  4A3M B;  1EEI D;  3CME A;  1IHZ A;  4DV1 L;  1CFM A;  5CGK A;  1EWI A;  2K14 A;  4KN7 C;  3H0G B;  1ONL A;  3J7Y W;  1ICW A;  4IPH A;  5JVG 3;  3OWE B;  1HTL D;  1XPO A;  4DV6 L;  1O7Z A;  4DR3 L;  3TP6 A;  1SSO A;  1SYC A;  2WIN B;  1K3B C;  3FRP B;  1NE3 A;  1TY2 A;  2UU9 L;  2YTV A;  1DZ1 A;  3E6Z X;  1IBM Q;  5EGT A;  4N9P A;  1GD7 A;  3QOJ A;  5FLX c;  2B2W A;  2QA4 A;  2D62 A;  4HR7 B;  1SNQ A;  2AWO A;  4PV1 C;  4GOP A;  4JPB W;  1E1O A;  4GKK Q;  1PFS A;  4RGM A;  4M1U B;  1HNZ Q;  4H02 A;  5M3M H;  4BBS H;  5IP7 H;  5IOC A;  4GOP B;  1VQE A;  3E9I A;  4GOP C;  1B8A A;  5DAU A;  3S1R B;  1IBM L;  1NAP A;  1A63 A;  2WAQ G;  1G6Z A;  2RHQ B;  4R8N A;  2H5X A;  3MVV A;  2R93 H;  1EQQ A;  2ZXP A;  1WCM H;  2UUC L;  5C4J B;  2UXB Q;  1L2F A;  1F2Z A;  2QW7 A;  3EFX D;  4JI6 Q;  1MSH A;  1SYB A;  1ILP A;  1FNV A;  1HH2 P;  2G5D A;  2V4D A;  5IWA L;  1EUJ A;  2ZTD A;  4XQQ A;  3VYS A;  4C3I B;  4BA2 I;  4NB3 A;  3IL8 A;  2L15 A;  1S5C D;  3RLO A;  1KHI A;  1BOS A;  4XT3 B;  3HOY G;  4A3C H;  5I9P A;  1J5E L;  3W1B A;  4LAA A;  1VQN A;  4XQN A;  4JI5 L;  4EGV A;  2K5N A;  1HNW L;  5GAD C;  1FNW A;  2VY3 A;  1C4Q A;  4YWL A;  4ABN A;  2E2H H;  2XN9 C;  2CW0 D;  4X3K A;  3M7G A;  1A6X A;  4JBJ A;  2OT2 A;  5IGE A;  5IYD H;  4CJ1 B;  2EYF A;  3IAY A;  4GLV B;  1ENC A;  3J80 c;  4FF2 A;  4BXX H;  4NPS A;  3HOY B;  3M7N A;  2DUD A;  4BBR G;  2NVT B;  2ALY B;  2IPK D;  2B63 H;  2MFI A;  4U68 A;  1EIY B;  1XYI A;  1PA6 A;  3CCM A;  4C3J B;  2KCC A;  4YY3 L;  2JEA I;  1ENF A;  2CFM A;  5IGD A;  2PZW A;  5ELF A;  3A7A B;  3HP3 A;  1YNX A;  4JI8 L;  4F87 A;  1GUN A;  4JI3 Q;  1N9W A;  5CV9 A;  2AQ3 B;  2WV6 D;  3D0F A;  1AZP A;  1LM0 A;  3S15 B;  3CAM A;  1S5B D;  1P16 A;  2CCZ A;  1UE7 A;  1GM5 A;  2CWP A;  1GXD C;  1WCM B;  2EY6 A;  1P8L A;  4ZYS A;  2B2T A;  3H6M A;  1N32 L;  3KJO A;  2VZA A;  1CZG A;  1SYD A;  3UDI A;  2YYZ A;  3IKJ A;  1M8A A;  3D4R A;  3M4O H;  2NVX B;  2ID0 A;  2Z0S A;  1K8A C;  2RF4 A;  2NVQ B;  2IHF A;  4PMB A;  2HD3 A;  1PXU A;  1C9O A;  5K36 H;  4PNY A; 
#chains in the Genus database with same CATH homology
 2A8V A;  2IHE A;  4DR4 Q;  3ICE A;  1GVP A;  4TVA B;  3RR5 A;  3AFP A;  3B6Y A;  2ZM6 Q;  4NXN L;  3T1Y Q;  2R7Z H;  4A3B H;  3K0X A;  4A3F H;  2ZJR A;  2ZTC A;  1XMO L;  3TRZ A;  3W1G A;  1CKO A;  1X3F A;  3HKZ G;  1J6Q A;  2ATW A;  3K81 C;  4X65 Q;  1WOC A;  3DLL A;  3NBH B;  2EQS A;  5IYC H;  3GTO H;  2VUM G;  4GN3 B;  4AQY L;  2KHI A;  3HOU H;  4JI5 Q;  4YCW A;  1X55 A;  4P72 A;  3T1Y L;  5IT9 c;  3M3Y H;  1U5K A;  2HHH Q;  3AEV A;  3HOZ G;  3TS2 A;  4IFD I;  4QL5 A;  5M3M G;  1IBL L;  4DV0 Q;  4AIM A;  5IP7 G;  4HID A;  1YVC A;  1SRU A;  3AQQ A;  2NVX H;  1O7I A;  2PMZ E;  2BA0 A;  1SRO A;  1Q86 C;  5JJL A;  4IFD J;  2R93 G;  3HOX H;  1QVG A;  1SLJ A;  4R1J A;  4JI0 Q;  3PO3 H;  5C0X I;  4A3K G;  4OWX B;  3GTQ H;  1VQ7 A;  2CKZ B;  3OTO Q;  1D8L A;  1S3O A;  4LF6 L;  3GTL H;  1DGS A;  1PH3 A;  4R4Q A;  3CF5 A;  2JA6 G;  4A3D G;  1HNX Q;  4DNI A;  2I0Q A;  1SMX A;  4FDB A;  2VNU D;  2V1C C;  4JV5 L;  2YV5 A;  3PSI A;  4LW1 A;  3UE0 A;  3ULP A;  3K8A A;  4JCV E;  3H3V H;  4IFD G;  4GKJ Q;  1CSP A;  1CKM A;  1VQ4 A;  3K7A H;  4A3F G;  3GTG H;  1N36 L;  4DR6 Q;  1B7Y B;  1V1Q A;  4JG2 A;  5GRO A;  1TWC H;  4DV3 Q;  1SN8 A;  2FXQ A;  2MO1 A;  3GDE A;  3UDG A;  1FVI A;  3G48 A;  1W2B A;  3I4M H;  4DR7 L;  1VQH A;  1Q82 C;  4B3M Q;  4LFC L;  5GAE C;  4BY7 G;  4Y52 H;  3AYH B;  5IYD G;  1FJG Q;  1X3E A;  4JI3 L;  1VQP A;  2F52 A;  3HOU G;  2MO0 A;  2Z6K C;  2HQL A;  3TQY A;  2QEX A;  2GVB A;  4P73 A;  3I2Z A;  4DR7 Q;  4K0K L;  3HOZ H;  4L5R C;  4B3T Q;  1Y1V H;  4HJA A;  2ZJQ A;  3I4N G;  2EIF A;  3KF8 B;  4A93 H;  4OON A;  3I55 A;  1IXR A;  1KQS A;  3NEN A;  2K50 A;  2LXJ A;  1QVF A;  2Q2I A;  4GKK L;  4LFC Q;  4DV2 Q;  4EQ5 A;  1HZC A;  1G6P A;  1XPR A;  1Q81 C;  4HJ8 A;  4GNX A;  3KF6 A;  5E7N A;  3CCU A;  1I50 H;  5IY0 A;  4LFB Q;  4KHZ A;  1YJW A;  4DAY B;  2YTY A;  2KBN A;  3NEM A;  1XJV A;  1PVO A;  1IBK Q;  3L0O A;  4JI7 L;  4DR2 Q;  4IJH A;  2K52 A;  2VW9 A;  3CCE A;  2LXK A;  3PUZ A;  3STB C;  3T1H L;  1PH9 A;  2UUC Q;  1OXU A;  3ER0 A;  3KDF A;  3Q8D A;  3RLN A;  1XNQ L;  4IPC A;  1JJG A;  4GLX A;  1GO3 E;  4OO1 I;  3FHW A;  2CQO A;  3CCJ A;  2EXD A;  1X65 A;  4DV7 L;  1K73 C;  3L7Z C;  1OTC A;  4PZ6 A;  4UY8 C;  3BU2 A;  4GS3 A;  3PUW A;  3I4M G;  1QVC A;  3CW2 C;  1T9H A;  5FLM G;  2WAQ E;  4YWK A;  1QUQ B;  1LYL A;  3FKI H;  3S16 H;  4IOA A;  4DV5 Q;  1J5E Q;  4XIG S;  5GQO A;  4A3M H;  3M4P A;  5DLQ E;  5IP9 G;  3OTO L;  3D31 A;  1RL2 A;  4R4T A;  1Y1V G;  5ELO A;  2UXC L;  2IX1 A;  2OQ0 A;  1I6H H;  5LMN L;  3GTJ H;  1VQO A;  4DKA C;  4B3S L;  4OO1 G;  3RNU A;  1XMQ L;  1FL0 A;  1X54 A;  3ERS X;  1KC8 C;  4LF7 Q;  5K36 G;  5IE8 A;  1SFO H;  2Q2H A;  4DV1 Q;  4J15 A;  4JI4 L;  4JBK A;  4IPG A;  4JI0 L;  2R7Z G;  3I7F A;  2PQA A;  2BH8 A;  1YHA A;  4JI1 L;  1FJG L;  4KHP L;  3RZO H;  4X66 L;  5C44 G;  4DUZ L;  1PH6 A;  5BR8 Q;  4JV5 Q;  5FJ8 H;  3IRB A;  2Q2T A;  2WFW A;  2WB1 E;  2PQA B;  3A5Z B;  3CMA A;  4A4I A;  4OXP A;  3GTP H;  4A75 A;  4X62 L;  1EOV A;  2N8N A;  4B3T L;  3HOW G;  2VL6 A;  4LUV A;  3STB D;  5AJ3 L;  5J3B A;  4X66 Q;  4Y7N H;  3F2D A;  1S72 A;  3GD7 A;  1HR0 Q;  4XTC S;  4B3R L;  2NVY H;  4BA1 I;  4MNO A;  5FLM H;  1VS0 A;  5M3F G;  4LNQ A;  3CD6 A;  5JJK A;  4UP8 A;  1FGU A;  1PHJ A;  3CC2 A;  4LF9 L;  2BA1 A;  2B29 A;  5BR8 L;  5C4J H;  1RIP A;  4A3M G;  1Q46 A;  2OTL A;  4HJ5 A;  1HZB A;  3L2P A;  2Q2U A;  4NXM L;  3PF4 A;  4LFB L;  2OTJ A;  2A19 A;  2I5L X;  1IBK L;  3S14 H;  3CCV A;  4A3E G;  1N33 Q;  2UUA Q;  1PH2 A;  1K83 H;  4LFA Q;  2D0O A;  1YIJ A;  4A3L G;  1TWH H;  2AKW B;  4UPA A;  4QGU A;  5C3E G;  4A3K H;  4LF4 Q;  4NXM Q;  4GLA C;  3GTK H;  2UXD Q;  4DV6 Q;  4WJ3 M;  1VQL A;  3S15 H;  3BJU A;  4PZ7 A;  1R9T H;  1U0L A;  3S1Q H;  1E1T A;  3H0G G;  3AFQ A;  4OWT B;  1C7Y A;  1BKB A;  1A62 A;  3F1Z A;  3KLW A;  3PUY A;  2I5H A;  4MTN A;  4AQY Q;  2HIV A;  2RCN A;  3KYH C;  1QZH A;  1M1K C;  4LF4 L;  4YHH Q;  4LFA L;  1Z9F A;  3I4O A;  4YCU A;  4AH6 A;  4EX5 A;  3CCR A;  1KAW A;  5C44 H;  5IWA Q;  1JJ2 A;  4HIK A;  2OCE A;  5FJ8 G;  4DR2 L;  1VQ8 A;  4RG1 A;  3OW2 A;  1BVS A;  1YJ9 A;  2UXD L;  3J7Z C;  5M5W H;  4QIW E;  4C3H H;  1HNW Q;  2R7D A;  3HOW H;  3PO2 G;  1MJC A;  4BY7 H;  1UWV A;  4DV4 L;  3PUX A;  2DGY A;  1OXT A;  3UDF A;  2WP8 J;  5M3F H;  2N78 A;  3JC6 6;  4X65 L;  3ULL A;  3JAM c;  2PI2 A;  4AYB G;  2KCT A;  2VQE L;  4IPD A;  1N8R C;  1VQM A;  4A93 G;  1Q12 A;  4RMF A;  2N3S A;  4A3E H;  5C0X J;  3TEH B;  1YBY A;  1Z47 A;  5HGQ A;  1VQF A;  1MJE A;  5IYB H;  1CSQ A;  2VQF Q;  3M9B A;  3G6E A;  4GKJ L;  4A3L H;  1C0A A;  5H1S E;  5JEA G;  2PNH A;  3A5U A;  4IO9 A;  3S24 A;  1Y1W H;  4DUY L;  4POG A;  2K5H A;  4C2M H;  4HIM A;  1OXV A;  1X3G A;  1HZ9 A;  1HZA A;  3H0G H;  3W5O A;  2VQF L;  4BBS G;  1VQI A;  1TWA H;  4JI2 Q;  1WI5 A;  3EBE A;  4POF A;  1VQ5 A;  1V43 A;  2E5L Q;  4LF9 Q;  1HR0 W;  4KLK A;  4LF7 L;  3M85 A;  2F4V L;  1VQB A;  1WJJ A;  1YHB A;  1OXX K;  2NN6 I;  1K9M C;  1H95 A;  4JBM A;  1A0I A;  2UU9 Q;  1VQD A;  1Q7Y C;  4R4I A;  1Q8K A;  1E7Z A;  3F2B A;  3RN5 A;  3PO2 H;  4DK3 C;  1WFQ A;  5EAY A;  4O0A A;  3FKI G;  3LGJ A;  2F4V Q;  3CCQ A;  2K5V A;  1VQ9 A;  4LF5 L;  2ZJP A;  1N36 Q;  4DR1 Q;  2R92 G;  2ES2 A;  4DR6 L;  1L1O C;  1UEB A;  5IP9 H;  2JA7 H;  2JA8 H;  4WJ4 A;  1UE1 A;  3F2C A;  1AE3 A;  1TWG H;  3RZD H;  1KIX A;  3HOY H;  4A3C G;  4YY3 Q;  4ALP A;  1YIT A;  4PMW A;  2B3G A;  4LF8 L;  4P75 A;  4OWW B;  4R4O A;  2C35 B;  1HR0 L;  1VQJ A;  3PIP A;  4HJ9 A;  3PGZ A;  5LMU L;  4K0K Q;  2JQO A;  3CXC A;  4JOI A;  5GAG C;  1UE6 A;  5IYB G;  3CCS A;  2XTI A;  2NN6 G;  3J81 i;  3NEL A;  1PH4 A;  4YCV A;  1G29 1;  1V9P A;  4LF8 Q;  1ASZ A;  3J80 i;  3U50 C;  4X64 Q;  1GKH A;  1I3Q H;  1NBW A;  3CP0 A;  3U58 A;  1A8V A;  2UUA L;  1X6O A;  1EQR A;  1EIF A;  1VQC A;  2AMC B;  1E24 A;  4C3J H;  3A74 A;  1KD1 C;  2F3I A;  4JC0 A;  3KJP A;  3JAM i;  2ASB A;  3CC4 A;  3S2H H;  4A3J G;  1Q1B A;  4X64 L;  4DR4 L;  3T1H Q;  3HKZ E;  1N34 Q;  5M5X H;  1HNZ L;  5ELN A;  2ZM6 L;  1N32 Q;  1K0R A;  1I94 L;  1EFW A;  2Y0S G;  2IX0 A;  2LSS A;  2PI2 E;  3TS0 A;  1QZG A;  4DV7 Q;  1XNQ Q;  1XMO Q;  4LUZ A;  2CWA A;  4UP9 A;  4DPG A;  1WYD A;  3CC7 A;  1XMQ Q;  2JA5 H;  3CQZ H;  2R92 H;  4X6A H;  3J81 c;  2JA8 G;  1XNR L;  1I94 Q;  1X9N A;  3H15 A;  1IL2 A;  5C0X G;  1ASY A;  3HOV G;  3KOJ A;  5M5Y H;  1M90 C;  1IBL Q;  1Y14 B;  4QJF A;  2NVQ H;  3OYY A;  3ULJ A;  3PUV A;  4ME3 A;  4A3G H;  5C3E H;  1AE2 A;  4DV0 L;  1VQG A;  3CPF A;  5LMN Q;  1I5F A;  4OX9 Q;  2A1A A;  3RLF A;  1PV4 A;  1LUZ A;  1JE5 A;  4JOI C;  1XPU A;  4A3D H;  4QQB X;  3J7A 5;  2E2J H;  3EN2 A;  3BZC A;  1YI2 A;  3U4Z A;  4A76 A;  1YHQ A;  4O2D A;  1E22 A;  4LF6 Q;  4JI4 Q;  1WCM G;  2E8G A;  2HIX A;  5LMN W;  4LF5 Q;  5JJI A;  1IYJ B;  3CME A;  4DV1 L;  1HJP A;  4JI1 Q;  4A3J H;  1YEZ A;  1HNX L;  4DUY Q;  5GAH C;  1L1O A;  4JYA L;  1EWI A;  5C4X G;  4DR5 L;  3SGI A;  2K14 A;  4OX9 L;  3S2D H;  1KXL A;  2VS1 A;  3KFU A;  2XGT A;  1B70 B;  3ZJY C;  2AHO B;  4YWM A;  4IOC A;  1E3P A;  2NZH A;  4IPH A;  4JBW A;  2JA9 A;  1NMG A;  4GN4 B;  1XPO A;  4A3B G;  2E2I H;  4DV6 L;  4DR3 L;  2JA5 G;  2K4K A;  4B3R Q;  4DR5 Q;  5JEA J;  3MEF A;  1NE3 A;  2UU9 L;  2YTV A;  3BZK A;  1BBW A;  1VQA A;  2YTX A;  4GNX B;  2JJQ A;  3HOV H;  1CKN B;  1IBM Q;  1VCI A;  1GD7 A;  5FLX c;  4P71 A;  2GN5 A;  1NMF A;  1LTL A;  3F8T A;  2OWO A;  2QA4 A;  2VUM H;  1Q1E A;  2D62 A;  2K75 A;  4APV A;  4A3G G;  4BXX G;  4UP7 A;  1Y1W G;  1JT8 A;  2AWO A;  4GOP A;  1E1O A;  4GKK Q;  1PFS A;  4KI0 A;  1HNZ Q;  3H3V I;  1D7Q A;  2KHJ A;  2GVA A;  2RHS B;  4H02 A;  2JK8 A;  5M3M H;  5IP7 H;  1S40 A;  4BBS H;  1YZ6 A;  2I5M X;  2JEB I;  4BBR H;  1VQE A;  3E9I A;  4GOP B;  1B8A A;  2KEN A;  4GOP C;  1PH1 A;  1IBM L;  2B63 G;  3GTM H;  2WAQ G;  1A63 A;  3CCL A;  2RHQ B;  4NXN Q;  3DM3 A;  2H5X A;  2R93 H;  3HOX G;  1JJC B;  1EQQ A;  4JI7 Q;  1WCM H;  2UUC L;  2BH2 A;  4MZ9 A;  2UXB Q;  1L2F A;  1PYS B;  4JI6 Q;  1XNR Q;  3K7U C;  1HH2 P;  3RN2 A;  5C4X H;  5IWA L;  3KF6 B;  3UDX A;  1EUJ A;  4LWC A;  3G71 A;  1L1O B;  2ZTD A;  4YHH L;  4BA2 I;  4NB3 A;  1L0W A;  1MKH A;  2L15 A;  3HFZ B;  1N34 L;  1KRS A;  2JA7 G;  3RLO A;  1KHI A;  2R6G A;  4DV4 Q;  4L5S A;  3HOY G;  4A3C H;  4HJ7 A;  1J5E L;  3W1B A;  3PCO B;  1PH5 A;  1VQN A;  1HNW L;  4JI5 L;  4A3I H;  2K5N A;  1SR3 A;  5GAD C;  2HHH L;  3PV0 A;  1KL9 A;  2VY3 A;  4YWL A;  2E2H H;  3E9H A;  1BBU A;  4JBJ A;  3CPW A;  5IYD H;  1CKN A;  4R4C A;  2YU9 H;  1AH9 A;  3J81 j;  2ZTE A;  4GLV B;  2NZO A;  2R7F A;  2WB1 G;  3K80 C;  4LUO A;  3J80 c;  2VQE Q;  4NPS A;  4PZ8 A;  3S1R H;  1PH7 A;  4BY1 H;  4BXX H;  2IY5 B;  2UXC Q;  2QGQ A;  3M7N A;  1X56 A;  2MQH A;  1VQ6 A;  3I4N H;  2DUD A;  1JB7 A;  1K3R A;  3WWV A;  1MIU A;  3E0E A;  3EIV A;  4BBR G;  2ALY B;  4PG3 A;  2B63 H;  3S1M H;  2MFI A;  4C3I H;  3FP9 A;  4HIO A;  1EIY B;  1PA6 A;  3CCM A;  4L5T A;  4DV5 L;  2MNA A;  4DR3 Q;  1K8G A;  4YY3 L;  2JEA I;  1TWF H;  4JI2 L;  2CFM A;  1IZ6 A;  4AYB E;  1NTG A;  4KHP Q;  4DV3 L;  2E5L L;  2UUB Q;  4DUZ Q;  2N49 A;  4X62 Q;  3U4V A;  1VQK A;  2JE6 I;  1KRT A;  1YNX A;  4JI8 L;  4GNX C;  3A0J A;  3UE1 A;  1N9W A;  3PF5 A;  4JI3 Q;  3S1N H;  4QY7 A;  1SE8 A;  4L5Q A;  4B3S Q;  4JYA Q;  3KDF B;  3D0F A;  1YJN A;  1LM0 A;  3CAM A;  4A3I G;  1P16 A;  3S17 H;  3VDY A;  4JI8 Q;  2CCZ A;  2HT1 A;  1UE7 A;  4GN5 A;  1GM5 A;  2CWP A;  1TXY A;  2Z6K A;  3M4Q A;  5IYC G;  3TRE A;  2UUB L;  4DR1 L;  5HY6 A;  1N33 L;  3GO5 A;  3MXN B;  4P74 A;  1G51 A;  2Y0S E;  2NVT H;  2AWN A;  1P8L A;  1CUK A;  2UXB L;  1QUQ A;  1PYB A;  4BY1 G;  4DV2 L;  4TQU S;  3KJO A;  1XTD A;  4JI6 L;  1N32 L;  2VZA A;  1JMC A;  3UDI A;  2YYZ A;  5LMU Q;  2KCM A;  3M4O H;  2ID0 A;  2Z0S A;  4B3M L;  4DK6 C;  1W3S A;  1K8A C;  1OXS C;  2D0P A;  2RF4 A;  4DAM A;  3G4S A;  5AJ3 Q;  3HKS A;  2IT1 A;  2OQK A;  4IJL A;  2IHF A;  3I56 A;  1EYG A;  3PO3 G;  1NY4 A;  1NJI C;  1UE5 A;  1C9O A;  3PIO A;  1PH8 A;  2JA6 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...