2K5QA

Nmr solution structure of membrane associated protein from bacillus cereus: northeast structural genomics consortium target: bcr97a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
105
structure length
105
Chain Sequence
MDLNRMGKDEYYVQITVDGKEVHSKADNGQKYKDYEYKLTGFDKDGKEKELEFTAQKNLRKEAFLRVYHSDKKGVSAWEEVKKDELPAKVKEKLGVKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Hypothetical Membrane Associated Protein BcR97A
publication title NMR solution Structure of Membrane associated protein from Bacillus cereus: Northeast Structural Genomics Consortium Target: BcR97A
rcsb
source organism Bacillus cereus atcc 14579
total genus 14
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06486 DUF1093 Protein of unknown function (DUF1093)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.480 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k5qA00
2K5QA 2K5WA 3NPPA
chains in the Genus database with same CATH superfamily
1Q8KA 3M4QA 4R4CA 4U673 4R1JA 3UDIA 4RCOA 4OHJA 4O2DA 4XQQA 4DV2L 4G7OC 3Q24A 1E7ZA 3TSSA 1YIJA 2H1EA 4P73A 4A4IA 1EQQA 2B63B 1HNWQ 1KLUD 3RLFA 1YVCA 4A3CH 1STGA 1EYAA 2KVMA 3FRPB 2F03A 2O2LD 3MC0B 2MPMA 3OWEB 4JYAL 1K8AC 1Y8PB 3Q6SA 4WJ4A 4E6IA 4XQNA 3PO3B 2VUMB 2VB2X 3A56A 1V1QA 4QJFA 4KJNA 1GUOA 3E9IA 2E2DC 4L5RC 3H0GH 3Q0AA 4V190 4IURA 4DV6Q 2GN5A 2OQ0A 1S72A 4JBJA 2G5DA 2F0PA 4ABNA 4A3DH 2QDLA 3KDFA 2D9UA 1UNSA 4FYDA 1Q3LA 5K36H 1SE8A 1Q8IA 4B3SQ 1GVPA 3FHWA 4DK6C 4KHVA 3D3RA 2L55A 3EA6A 2VY3A 1BDOA 4FXKC 4L6TB 1PHJA 2E2HB 1GO3E 1JQYD 3MWYW 3D4DA 1MSHA 4K2LA 1UE6A 2F0TA 1LV9A 3VYUA 4LMQD 1QCBD 1N34Q 5E3FA 3URYA 4XQJA 1RF2D 3CAMA 1PFMA 3NK9A 5M3FB 2NWGA 4LUZA 2VXWA 3FPPA 3GTQB 5HGTA 1SYGA 3L3OC 4V0BA 1VQMA 4GOPB 3AYHB 5J1ZA 1SSOA 2NVYH 4DNIA 3BZCA 4OIKA 4KMUC 1NBWA 2QILA 1EEFD 3A5ZB 1B3AA 4C2MB 4M8AA 2OXPA 5KIXA 4IFDJ 1RKNA 5JPNC 1KNEA 1GD7A 1JC7A 2JP1A 1STHA 4HMIA 1PTOB 1LT6D 3ERSX 4DR7Q 3HOYH 1I50H 5IGBA 1HA5A 1I4QA 1U0LA 2A74C 3CCLA 1EFID 1PYBA 3GD7A 3A74A 3G7LA 2NVXH 3HKZB 5C44B 1D1KA 4X66Q 3J80L 5BN5A 2N88A 4N8FA 3S9WA 5FLMG 2PMZB 3W2DA 1K3BC 2HD3A 2F0IA 2CWPA 3SDZA 3U9SA 4CJ1B 5G3LF 4RKLA 1SJED 2R7ZB 4MZ9A 4QIWB 1O7YA 1S40A 1EWHA 3CRLC 4F88A 4A93G 1KABA 4X65Q 1EEID 5DM73 1L0YB 2HHHL 3NWSA 2IHFA 4JI5Q 4X64L 3S1RH 2RA4A 1TU2B 1ZYRC 3U58A 1WTVA 4IO9A 1Z6HA 2P5ZX 3SXHA 2B39A 1EIHA 2XRQD 3J80E 2QGQA 1EY7A 5EQ0A 4A3LH 2H5XA 4C3JB 2WP8J 2JA6B 1EY5A 4A3KH 2D0PA 5C3EB 4YY3L 1HCZA 2AKWB 1PH4A 4BXXH 4AH6A 4DV1Q 5CV6A 1H95A 1LTSD 1WI5A 3HOXG 2JA8B 2PQAA 4DAMA 5C4ZA 5CV8A 3KUPA 3HOUH 3NTHA 3NP8A 5IGEA 3X3NA 2K05A 1SR3A 1PRTD 3EIVA 1K8OA 1G51A 2LY7A 1ENAA 4APVA 4FO2A 3W1BA 1VCIA 5I6WA 1BCPF 1D5XC 4IFDH 5IWAL 1TWCH 1VQ4A 2Q8RE 4IUNA 3K7AH 2EXDA 3TS2A 3SEBA 4KTAA 1GUTA 3M7GA 2PW7A 1M8AA 4TVAB 1S3OA 3ULLA 1ICFB 4DV3Q 2Y0SB 2UXBL 1ML0D 3KF8B 2A68C 2B2UA 2RCFA 1IBLQ 3AMUA 4K2KA 1MJEA 1GHKA 3TMEA 1S5FD 1JORA 1OTCA 1STNA 3UDXA 1CTMA 4ME3A 3T1HQ 1M90C 4OX9Q 5IY0A 4UP7A 4Y7NH 4DUZQ 2VL6A 3ICEA 4LFCL 4OONA 3KK7A 3U50C 2BDNA 4IPCA 3CMEA 1YNJC 3HZXA 5EBDA 2YTYA 2PO4A 4NB3A 4A3EB 1EQTA 1IBMQ 4JI7L 3E0JA 4AYBG 2HQLA 5GAHC 4JI3Q 4UY8C 5FLXL 4IOCA 3JC66 2YTXA 1F2ZA 4JI6L 1D7QA 4LF9Q 4BBSG 1J5EL 3AFQA 1A2TA 1SJHD 3J7ZC 1JCKB 1QB5D 3G48A 1JB3A 4BA1I 2R92B 3BS1A 2PCFB 2F0MA 1NR4A 1HPCA 3KLSX 2A73B 4DAYB 5CV7A 3S15H 1UE5A 3OTOL 3CC4A 1CHPD 1NAPA 1VQHA 4QGUA 3J7AV 1YJ9A 5FLXE 3N6RA 4PMWA 4DXFA 1I4PA 5I4DA 3ERQA 1KRTA 2Z4IA 1HNXQ 5CYUA 5M5WH 5J3BA 4JBWA 4RG1A 3I4MG 1VQFA 3R93A 4ME5A 1A62A 4C3IH 1XNQL 4JG2A 4H02A 1RIPA 3J7A5 1LYLA 4TKOB 1WTQA 4Y52H 2CQAA 1N36Q 4R9WA 1N32Q 5C5MA 2AHOB 1BBXC 3H09A 1JJGA 2Q8IB 2B2VA 2VQEQ 4G4KA 2F0LA 2GVBA 3PIPA 2JEBI 3TEHB 2VS1A 1SNDA 3HOVG 4WFN3 4F8MA 1QG7A 2L4NA 5CBEE 4X62L 1VQCA 4KLKA 1HNZL 1X32A 2B8GA 2CW0D 4DAVA 3GV3A 1K0SA 1EY0A 2C9OA 4YHHL 2DY7A 3D4WA 5CBAE 1YNXA 5ISRA 5GAEC 2QCPX 3T53B 2B2TC 3K57A 3H3VC 2RKSA 4LF7L 1CQFA 5KEEA 4DR4L 3TDQA 4DV4Q 1UEAB 2PW5A 1VQBA 1VF5C 1PTOC 4DK1A 2B2WC 1BR9A 3J81i 4LF5Q 3K80C 2B2TA 4GOPA 3GTLB 3OYYA 2E2JB 4DR5Q 1T5EA 4DPGA 4A3LG 4N9PA 3NUCA 3QR8A 2Q2IA 1SMXA 1Y1VG 4FVMA 4QUFA 1Z9FA 1PH5A 1C9OA 3I7FA 5IODA 4LFAQ 1ASYA 2FMMA 4UAIA 4O0AA 2PNHA 3HOUG 2I5LX 2UXDL 4OL7A 2D5DA 3L7ZC 5BR8L 2A6HD 3FPUB 3HRZC 3QOLA 1ILPA 4DR1L 4DV5Q 3BZKA 4BBRH 4AQYQ 4C3HH 4A3JG 1FJGL 2SOBA 4HIMA 4A3BB 2F0QA 5LMUQ 3L9AX 3U9OA 3IAYA 2XRSD 3AFPA 3QG1A 3S1NH 5CR3A 5JJIA 4QY7A 1TT2A 2K5QA 3GTGH 4GN5A 4IPHA 2EOTA 3OMCA 4GKJL 1EYDA 2RDFA 4UDUC 4ULLA 1QVGA 1IHZA 1D6EC 1SNMA 3F2BA 1Q82C 1CA6A 2BCOA 3C3LA 2LMCB 3CCSA 3GTMB 2E5LQ 1BBUA 4G57A 2F0DA 4ZYSA 1KDBA 2RCNA 1I3QH 4JI4L 3PO2B 1B70B 1FGUA 1Q1BA 2O4XA 2NZ1D 3I56A 4BY1B 1S5CD 1Q86C 1F77A 3M4OH 3Q8DA 2KECA 3D6WA 4QMGA 3VR5A 3S17H 3K5MA 3M3YH 1E22A 3V2TA 2KCTA 4B9XA 2Z1CA 1UWVA 3DM1A 4R4OA 3S14B 4QUCA 4GKKL 5C4XB 1A3VA 4DR2L 1IYVA 4ZUIA 3VYRA 5AJ3Q 3OIPA 2I46A 1SBBB 2ATWA 1VQ9A 5M3MB 1JT8A 1TWAH 1CKMA 3U4VA 2CH4A 3FVQA 3IRBA 2QKIC 1GOZA 2KHIA 1ZXTA 4OELB 2HCCA 4JI8L 2UXCL 4LNQA 2AQ3B 3H91A 5A2QL 2XTIA 1XXGA 2DNEA 3L2PA 2OTLA 2EDGA 4MTKA 4FF2A 2XGTA 2JA5B 1U4LA 1D2BA 2KCNA 3HOZB 5JAVA 1TY2A 2AWNA 4A3FB 1TWHH 4ZLTF 2ZM6L 4UP8A 1QNUA 3OOCA 1A6XA 3H94A 3BYYB 5A2QE 1PFSA 1CSPA 5D65A 4RHSA 2OF1A 5FLMH 3RZOB 2HIVA 5LMNW 1HUMA 4DFAA 3I55A 3MAQA 1VQ7A 1A8VA 1XNRQ 1TS2A 1ILQA 1K83B 2QDBA 4XIGS 5IGGA 1RL2A 4B3TL 1O7IA 1K9MC 1DOKA 3L0OA 3MZ5A 4DAYA 5JEAG 4JI2L 4A93H 4R8IA 1WOCA 2L0CA 3GV6A 4B3RQ 1N8RC 1FL0A 4R4QA 1S5DD 4C1NK 1Q1EA 4BY7G 3S1QH 3OPOA 4KHZA 1CKNA 2TSSA 4A3GB 3I4NB 4PQXA 4O42A 2L1BA 3FP9A 1RTOA 3SGIA 3P7JA 2ALYB 2BH8A 3FKIB 4LW1A 1GUGA 5M5XH 1XYIA 3G4SA 2EYMA 5LHY1 4IN3A 2DN8A 3HOXH 4POFA 2E76C 2F0EA 3MTSA 4J15A 3TZUA 1RODA 1H9JA 1PVOA 3RLOA 1IZ6A 2F0FA 1L0XB 2E74C 1LACA 3MFGA 2KJXA 1FNUA 3S1MB 1VQDA 1Z47A 3D0FA 4H44C 5C4JH 4FP5D 1ET6A 4EVOA 3TS0A 4CHTB 1EY9A 5IP7G 4IQZA 4ALPA 3TQYA 1B50A 3LX0A 4LF8L 4BBRG 1R4QB 1A0IA 1XPRA 2R93G 2N78A 1KHIA 1EZ8A 2WIIB 2AQ2B 4JW0A 3G71A 1NMFA 2V4DA 3K81C 4A3IB 3S24A 5KNBA 2FJ2A 1BXTA 4NXMQ 5D3IB 2VQFQ 1X3EA 4EQ5A 4EX5A 3PUWA 3TRZA 3Q22A 1C7YA 2NUCA 1VQ8A 1VF7A 4OWTB 4LFBL 4RAUC 2Z8LA 1WCMB 2EVBA 2MP1A 4EQNA 3RN5A 1B1ZA 1PYWD 1I94L 3T56B 5E4XA 2R61A 1XMOQ 1LTTD 1MD2D 3E9HA 5LMNL 4A3MB 1LT5D 1CQVA 3MEFA 4DUYQ 4ZCKA 1EFWA 2E2HH 1K28A 4X3UA 5T1IA 4BBSH 4ODGA 3WOEA 1KAWA 3G6EA 3K6OA 3GQBA 2YTVA 2E2IB 1VQAA 4F7XA 3GP7A 2XIWA 5G3LD 5M3FH 1C0AA 5FO9B 2UUBQ 3GTQH 1B7YB 3RN2A 3I72A 3CPFA 4RGNA 4GN3B 4CGYB 5T1GA 2EQSA 2L11A 1TWGH 4PZ8A 3T13A 4KKUA 1HQRD 3BDCA 4WRDA 2HHHQ 1JOOA 4X64Q 2RQXA 3M7NA 2JA7G 2A68D 4ZK9B 4HJAA 3KF6B 5A35A 2IHEA 4DR6Q 5ELEA 1EL0A 2EIFA 2I5HA 3I4MH 4J6HA 3AB9A 2WAQE 4NDXA 1KDCA 4YY3Q 4KHPL 2UU9L 3GTPH 3H0GB 3RLNA 1U4RA 3K5NA 1SDFA 1HJPA 2QA4A 4CKBA 4A3DB 3HFZB 4DV0Q 1E2VA 3PUYA 3T1YL 1D1IA 3HOVH 1NE3A 2N55A 1Y1WG 1BCPD 5E7NA 4JVZA 2NVTB 5C5LA 1AE3A 4A3GG 1D8LA 3W3AA 3T4AC 2A69C 3MHBA 4OWXB 1QE6A 2Z6KC 1PH9A 2KENA 1IW7D 4RA8A 3HOWG 5EGTA 1L1OB 3VR3A 4J1MA 2ZXPA 3S2DH 4B9WA 1I6VC 1JWUD 3ER0A 2EE1A 2A8VA 2UXBQ 3OIQA 4OWWB 2HIXA 3RD4A 1PH7A 2DUDA 4DV6L 2I0QA 5DNFA 1RJTA 4X3TA 1SN8A 4PZ7A 1JE5A 2NVYB 3K58A 4EQPA 1IKMA 2CFMA 1F2LA 1SE4A 2RHSB 1QZHA 4FF4A 2B8FA 3SHLA 4B3SL 2K50A 4LFCQ 3F2UA 4GLVB 3K0YA 1L0WA 1N33L 3HOYB 1I50B 3P75A 5CORA 5EPJA 1Y1VH 3ZJYC 3QWNA 1V1OA 2H4OA 2AUKA 1WYDA 1SE3A 2HDMA 1KRSA 1CUKA 2SDFA 1LT3D 1N34L 2IX1A 1F9RA 1IBKQ 3VR2A 2IT1A 2EPBA 4POGA 1SYFA 1CKOA 2X6LA 2CCZA 3VDYA 4LWCA 2RSNA 4MHEA 1V9PA 2NVQB 1XTCD 1VQLA 3MXNB 4KKSA 1U9RA 3FDTA 1STEA 4A3JH 2YYZA 1DOMA 5C0XH 1HHVA 5CV5A 1H9MA 2WINB 1BKBA 3S1RB 2WB1E 2ZTCA 3QIAA 4DR7L 4B08A 1TS4A 2EYHA 2ICEC 2WFWA 3EBEA 3CRKC 3HEJA 2B63G 1X3GA 2L5TA 3KOJA 1G291 1UUPA 3PUZA 4A3EH 2VNUD 3OTOQ 4ZUJA 3A5UA 5FLXc 1UEBA 4CBVA 4X66L 4A3KB 1I4RA 1WTRA 4M1UB 3CF5A 2K75A 1SFOB 2OT2A 3SR1A 4RFBA 4RMFA 2F4IA 3DUZA 3PO3G 2VUMG 3CCVA 5IP9G 1PTOD 4MIUA 1YBYA 1IL2A 3PCOB 3QOJA 4DU9A 1U4PA 2BOSA 3NE5B 2M9VA 2UUCQ 2F0NA 3SK8A 3J7YW 5IYDG 2AMCB 2EJFC 4X65L 3VR6A 1MIUA 5GADC 3H15A 5H1SE 1HR0Q 1LT4D 2Q2HA 3HP3A 1TWCB 1WTXA 1SLJA 2LXJA 1DYQA 3C2PA 1BF4A 3K7AB 1GM5A 3TBIB 4IZ8A 1LUZA 2JK8A 4RHRA 1R9TH 3GTKB 1D5ZC 4N9TA 1LTGD 3BYTB 3A8KE 4X62Q 3FMCA 1Y14B 2PI2E 2IPKD 1HZAA 3WWVA 2ZXRA 5M3FG 4F87A 3I90A 5IGCA 1I4XA 2RHQB 5EJWA 2EYOA 4K5VA 2EYFA 3CW2C 4WJWA 3O13A 4Y7NB 1CZWA 4ZRZA 1CFMA 2IY5B 2YU9H 4IPDA 4DR4Q 3UI2A 2K5VA 1LABA 4C56C 4JOIC 1PV4A 5M5YH 3HKZG 4HR7B 2N3SA 5C44G 4FXDA 2YV5A 2K5HA 1PTOF 3IFTA 4CJ2C 1VQGA 4GLXA 3VYSA 3I70A 2VZAA 3RZDH 2EY6A 1IBLL 2PZWA 3S2HB 1B2TA 2E75C 2JE6I 3OHXC 2AQ1B 4RWSC 3E5SA 1EYGA 2O5JC 3T1HL 4OX9L 2V1CC 2R7ZG 2JA9A 2WAQB 4DUZL 3PGZA 3KBGA 5C4HA 3R8BA 4AIMA 5DAUA 1MSGA 4CKEA 3VA5A 4C1NI 1PFBA 2K5WA 3CQZB 3NQIA 3S15B 5JEAH 3NEMA 1E1TA 1IBML 2FFKB 2F0OA 4CJ0B 2E2JH 2SNSA 4K0KQ 4BY7H 4JI3L 5CV4A 2KEEA 3CHBD 4C3JG 4Q5VA 2CVRA 2JA6G 4GLAC 1TS3A 4YIJA 5C3EG 2QEJC 3TN2A 1BNZA 4CDEC 3KF6A 5D3DA 4OO1G 3AU7A 2JSOA 4C3IB 3GTOH 2JA8G 3M4PA 1B9NA 3J81L 1GHJA 1JOQA 4KV6A 5IT9L 4TSSA 2BE5D 3E3XA 1YHQA 4JV5Q 4JI4Q 4OXPA 2OEOA 5FOBB 3G6JB 4GN4B 4H7BA 5CC4A 3K59A 4NXNQ 3PSIA 1A2UA 1WVLA 1Q90A 2NN6G 2B2WA 1UE1A 5EAYA 4A3BH 2L9HA 1QOHA 5IYCH 1PZID 1W6JA 1RD9D 4QF4A 1DJRD 3A54A 1OXVA 2PNRC 1CM9A 3R3OA 4GNXB 2DJGC 4N8X1 1L1OC 1HNXL 1G6ZA 1OXUA 1J8IA 2Y0SG 4K5WA 3A7AB 2TMPA 4P71A 3J81E 2K28A 1B8AA 2AWOA 4UPAA 3DLLA 5IP7H 3R2IA 4L5QA 4ZKBB 5IT9E 1H9RA 1L1OA 2R93H 1XX8A 3WDNA 5GROA 5C0XG 2MQHA 3NENA 3F2CA 4J8QA 1N32L 4P74A 4LF4Q 1EIFA 2F4VQ 2MUYA 3A8JE 2VQEL 1X55A 1M4VA 3EJIA 5BN4A 2WKDA 2PZTA 3LWEA 1UE7A 3NTKA 1PH6A 3STBC 5LL6S 2UXCQ 4A3EG 2UUAQ 1SAPA 3VYTA 1HZ9A 5IYBG 5KGUA 1ENCA 1HZCA 4L63B 5JPMC 2WB1B 1F9PA 3S14H 1PZJD 4K8IA 5C4XH 3GTJB 1ZKOA 4NP5A 2O5IC 3EROA 4YCVA 4ID6A 3JAML 2A6EC 1QVCA 2EY5A 4XYQA 4OIJA 1NCVA 2JYOA 3CXCA 3DWQA 1EY4A 3KBXA 1AW7A 1F2YA 2XVSA 3CCQA 3VR4A 4RGTA 4JI0Q 4DV4L 1EY8A 2R92G 3UE1A 2ID0A 2ASBA 4LUVA 4C3HB 2GA4B 5L37A 2KEDA 4LF5L 1FYCA 4YWKA 4TRDA 1HTLD 4DR5L 2M2LA 4B3MQ 4P72A 1II3A 3S1NB 3MFYA 3Q23A 1KQSA 1F2MA 3NTIA 5EKKA 4LF6Q 2EYLA 4X6AH 1KD1C 1DONA 4TQUS 2RVLA 4AYBE 5I6YA 1DD2A 4HTHA 3NBHB 4LFAL 2PZUA 3JAME 3D4RA 1VQKA 3EVQA 3ULPA 2QF7A 5KRUA 4HJ9A 2K1BA 3KF8A 2MO1A 2JA7H 1NTGA 1TWFH 2K14A 4FXGC 4QQBX 3J7AF 3MXUA 3QJYA 1I6HH 5GQOA 2L15A 4P2CB 3A55A 5EPKA 1DGSA 2MNAA 4DV5L 4AQYL 1XJVA 1IL8A 2CW0C 3NXWA 5I2YA 4FF1A 3M4OB 5LMUL 3QB3A 4WJ3M 3N52A 2EYJA 1V43A 1A3UA 5GAGC 3NHHA 3I8ZA 3M3YB 2QW7A 1YJNA 1EY6A 2DY8A 3ULJA 4OO1I 1J9OA 2KA7A 2EJGC 1RDPD 1NUCA 1FNVA 1EZ6A 2N8NA 1MKHA 4I65A 4JI1Q 1F9QA 3S16H 1Y1WH 2NBFA 2E5LL 1BO0A 1KNAA 1SEBD 2M00A 2OCEA 5C3XA 2F52A 4A3GH 1D5MC 4MNOA 3W5OA 4DV7Q 1TWAB 3MA2B 1IYJB 3BU2A 2KQ3A 1SYCA 3RNUA 4OEMB 3HOWH 3C46A 2NN6I 4DK3C 2MGSA 4DKAC 5I9OA 1JMCA 1EOVA 1NY4A 2NTTA 1VQPA 2JXMB 1XMQQ 5EKLA 1AZQA 4G7ZC 1WTHA 1ONLA 2ENBA 5JVG3 1KTKA 1PH2A 1LO5D 1UAPA 1TWHB 3CKIB 4DV2Q 2EYPA 5AJ3L 1EYCA 1QJOA 3K8AA 5C0XI 4IUVA 4WORA 1ET9A 2WKCA 1S4ZA 2LSSA 4LK1C 3PF4A 2FHTA 4PNYA 1TY0A 4BS9A 4PZ6A 4JYAQ 1YNNC 4DA2A 2ZJQA 2Z9HA 1CI3M 5EPLA 3I4LA 4FDBA 4A3BG 3SK6A 5IYCG 1G2TA 2CQOA 4A93B 2J7ZA 1Q12A 4PV1C 5I9PA 3QO2A 4PMBA 1NMGA 1DOLA 1SYDA 2CWAA 1B3QA 1LTBD 3S1QB 3I4OA 3H6MA 3E0EA 1CZGA 5IGFA 2B63H 1NSNS 2G9DA 1SROA 4I7ZC 1WCMH 1Z7TA 5CV9A 3KJOA 3V05A 4LAAA 2JQOA 4HJ8A 1ESRA 2CKZB 5M5XB 3PO2G 1JWMD 2K03A 1HZBA 4DR3L 4BY1G 1SMYC 4DN4M 1SNCA 3PO3H 1ZYRD 4HEDA 4RGOS 3HOXB 2VUMH 5IP9H 1XNRL 1STYA 2KHSA 2F3WA 3PF5A 2SNMA 1OO9B 3UDFA 5IYDH 1A15A 4GNXC 1AH9A 2MHVA 4DAPA 1CT1D 4B3RL 1YHAA 1BBWA 2IL8A 2VW9A 1LTLA 2NYZD 3CCMA 3ZYYX 5C4XG 2EXZA 1X65A 4UHVA 1JR0D 4GNXA 2K4KA 5C4JB 2R7DA 1MI2A 5ELBA 5M3MG 1K8MA 3ONAB 3PUVA 3T1YQ 1I5FA 4IUTA 4YWLA 1ESFA 1MJCA 1WTOA 3CC2A 2EZVA 4DF7A 1GJXA 3A7LA 4ZAIA 2X6GA 5FKAC 4ZKCB 5FO8B 1TQOA 5C3WA 2IX3A 3CCJA 3EFXD 1EUJA 1T5XD 1S5BD 2JA5G 1DM0B 3H3VH 2D0OA 3DWAA 3HOZG 3C1FA 4A3FG 3KLWA 1AZPA 5HURA 1PFNA 4U68A 1YHBA 4C2MH 1IYUA 1VQJA 1HTPA 4KKTA 1E2WA 4A75A 1N9WA 1PTOH 1LTAD 1PDQA 4KD3A 1V1PB 1KAAA 3J80c 2DNCA 2EY2A 2DJFC 4AYBB 1WTPA 4KJOA 2NVTH 5C44H 3CCEA 2JJQA 1PRTB 2Q2TA 4BA2I 5JJZA 3CC7A 2F3IA 1ICWA 1LTID 1EIYB 1N33Q 4BBSB 3KJPA 4NMZA 3UDGA 1YNJD 5C0XJ 3HS0C 3B6YA 4NXML 1PXUA 5KYLA 2R7ZH 1FD7D 1EIGA 1WJJA 2VQFL 4K8JA 1MBYA 4XT3B 1E24A 1WD0A 1JICA 2Q8TA 1G6PA 2FXQA 1HNWL 1NNXA 1KDAA 2L12A 4FNFA 1P8LA 2F0WA 3KLSA 3DEPA 3I4NG 1TWGB 4DNRB 3BG3A 3NBHA 5IWAQ 1XMOL 3RMHA 4C3JH 2JA6H 2B2YC 4R4IA 1PZKD 1GXDC 3FKIG 4DUYL 5C3EH 3U4ZA 1YITA 5BN3A 1PH3A 1HH2P 4QL5A 4OO1H 3I4MB 1CA5A 4R4TA 4HSPA 2JA8H 1SNPA 1SNQA 1O78A 2Z6KA 2CHBD 5TSSA 4L8JA 2B2YA 4XXEA 4K6LA 2EY1A 1X54A 4OGQC 1E1OA 2PI2A 3J80i 4GZYC 4CKCA 5CGKA 2K5DA 1F9SA 3GTPB 1VQEA 2UUBL 3D6CA 1C48A 2NVQH 3DMUA 3W1GA 1AFPA 1H9SB 3NWTA 1HA6A 3I2ZA 2LKVA 3ND8A 2Q2UA 4UP9A 3RUZA 3M9BA 5FJ8H 3AEVA 2A19A 4IPGA 2NN6H 2F1MA 3HOVB 2NVXB 2I5MX 1LTRD 3K5OA 1G8ZD 4KI0A 4JI7Q 5HGQA 3A0JA 1TKWB 3MVVA 1X3QA 2F0GA 3I73A 4DR6L 4DGZA 4JI6Q 1G91A 2ZTEA 4L5TA 1J5EQ 2KCMA 5E1FA 3S2DB 4H0LC 2HUGA 3KLRA 1PH1A 5IGDA 1SFOH 1VQ6A 2C5CA 4A3IG 3WOFA 3GDEA 1X3FA 4HCSA 1B53A 3D31A 5FK9C 2F0VA 5J39A 1JJ2A 4CDCC 4CDFC 4DV0L 4HAEA 5DM63 1WCMG 1HRJA 4RKBA 4HJ7A 5E4WC 2E8GA 5HY6A 1CHQD 5IYBH 1HR0W 1K73C 1HUNA 4RGMA 1SXTA 3CCUA 1AN8A 1Y1VB 1E0BA 4A3MG 1LLRD 1JOKA 2Z4HA 2A5HA 1QWYA 2B2UC 5ELCA 3GTKH 1HXYD 3HOUB 1J6QA 1WTWA 1XNQQ 1XWEA 2B3GA 1O80A 4ZQ3A 4JI5L 2R92H 5JEAJ 5KNDA 3OSOA 2R3ZA 4A3JB 2G9HD 3TZDA 2GVAA 2BDOA 4RH6A 3T51B 1QUQB 3P20A 4IJLA 2D62A 4DV1L 4DXGA 3PQIA 2BH2A 4A3CG 1NR2A 1HNZQ 1PH8A 2X69A 1E3PA 1IBKL 3EN2A 3D8GA 4YHHQ 3HKSA 2XWBB 1EQRA 1YZ6A 2ZJRA 5LL6X 1EOTA 5DLQE 2K52A 1QNKA 1BCPC 3V96A 1FR3A 4K5XA 3S2HH 3M85A 3PUXA 3STBD 3BDLA 4ILWA 3H0GG 4A76A 1PRTF 2K7VA 3SE0A 4LF7Q 4IALA 1RCVD 3CD6A 1IW7C 4BWGB 4A3DG 3IL8A 2KOLA 1GKHA 2ES2A 1VQ5A 1W6KA 3KYHC 3PMFA 3F8TA 5K36G 5IOCA 4DV3L 2MO0A 3CQZH 4JBMA 1AP0A 1FGBD 1R4PB 2A6ED 1Q81C 4PG3A 1ZEQX 3CP0A 4YCUA 1SNOA 4XT1B 5C6AA 1R9TB 5EKIA 4JOIA 4MN3A 2BA0A 1CKNB 3TP8A 4KD4A 1T9HA 1B9MA 3K7UC 1M1KC 1BQQT 2R6GA 2AUJD 3AQQA 3J81c 2UXDQ 5D14A 2ZTDA 2OTJA 1MGSA 2DGYA 2UUCL 1QVFA 1NJIC 4NW2A 5IT9c 5BR8Q 1VQOA 1Q7YC 2B2VC 4DR1Q 5ELNA 1PLFA 3F1ZA 3GTLH 2Z6BA 4YCWA 2HQEA 5JOBA 4HCEA 3T16A 1FJGQ 4IUUA 1HR0L 1K0RA 1VS0A 4HIOA 5JVH3 3PIOA 2YU9B 1Q46A 1PRTC 3HOYG 4LF9L 3RR5A 4GKJQ 5M5WB 1A3TA 1V1PA 3P1HA 4HMJA 1ASZA 1GUNA 2NZHA 5M5YB 2HCIA 4EQOA 3LGJA 4DK0A 4L5SA 3A8IE 3RZDB 3OMGA 4RCNA 4HIKA 2RDGA 2F0SA 1DZ1A 1OXSC 4JCVE 4G7HC 2PPBC 1O7ZA 1KIXA 1KL9A 1HFNA 5FJ8G 4GOPC 1KXLA 3BZDB 1L2FA 1LM0A 3SK5A 5AFWA 2OQKA 1Y8OB 1XTDA 1MHWC 3GO5A 5DEHA 4NKLA 2KCCA 2XNAC 4S3SA 2IW3A 5IIFA 2R7FA 1PYSB 4BY7B 4GKKQ 2BA1A 1TS5A 1TR5A 4DR2Q 4A3KG 3GTMH 2K01A 4KN4C 1VMPA 1B4OA 1XPUA 4BXXG 4GS3A 1X9NA 1N36L 1FNWA 3JAMc 4X3SA 3PIO3 2HT1A 1JWSD 1HFGA 2NZOA 3GTOB 3GTJH 3CPWA 3PIP3 4IOAA 5J22A 3PO2H 2EJMA 3NBIA 3TP7A 4BY1H 1EWIA 1AEXA 3SK4A 1KLGD 3CMAA 4JI8Q 1K3RA 1SE2A 4LUOA 2RSOA 2IJ0A 4CDDC 1DXMA 2Z0SA 2ICIA 3F2DA 2IX0A 1YJWA 1H9SA 2A1AA 3KDFB 1EQVA 3DHQA 3OW7A 5JJKA 3UE0A 5M9OA 4IFDG 4K0KL 4FF3A 5EBCA 1I4GA 1X56A 3KFUA 1QZGA 3H3VI 1ENFA 1X6OA 5M3MH 2ZM6Q 5F2DA 1IKLA 2I07B 5CMDA 1STBA 2LS01 1JJCB 3LNNA 1YNND 4JK1C 1JB7A 3NSWA 3X3MA 4BBRB 2R93B 3MXNA 1WD1A 3R2TA 4JV5L 5JJLA 4I7AA 4R8NA 2D2CC 4NXNL 1QILA 3GTGB 1BOSA 2CH4W 2K32A 1A63A 2KBNA 3HGBA 2JA5H 1AE2A 2WACA 3K0XA 1P16A 1EU4A 3JAMi 4B3TQ 4P75A 1EU3A 1JE4A 5COYA 3HOZH 4MTNA 4A3FH 1CSQA 4JI2Q 4KY6A 1TIID 4DNTB 4K6DA 3PV0A 4KN7C 5FO7B 2LFNA 1B44D 1GUSA 3BDOA 2NB0A 1PMRA 2RF4A 1X3PA 1I3QB 1SMYD 3DM3A 1TVXA 1VDZA 1DCZA 2OWOA 3I91A 2PYKA 2K6AA 4LF4L 3RZOH 3DXJC 2WAQG 4H13C 2F4VL 3S17B 3NELA 5I2XA 1K83H 3DEOA 2IWHA 1RTNA 1V8QA 2QEXA 3DWPA 3J81j 2UUAL 1EWCA 1OXXK 1VQIA 5ELDA 3MXGA 1I4HA 1RHPA 2RDHA 3BJUA 2ZJPA 1QUQA 1FVIA 1VMCA 3NPPA 4KK7A 1TXYA 2BE5C 3HKZE 1YI2A 4Z9CB 4KY5A 3I4NH 2FINB 2ZXOA 3E6ZX 2F0JA 1WFQA 2LXKA 5NUCA 4JBKA 2PMZE 4C3IG 5KYIA 2JA7B 3FKIH 3CU7A 1TWFB 1K8GA 2K04A 4O1NA 4LF8Q 2VB3X 2F0HA 3OW2A 1I6HB 2PQAB 3ITPA 3BVMA 1W2BA 4JI0L 4QIWE 3IKJA 1SRUA 4LJZC 1STAA 2JN4A 2N49A 1H9KA 3MXPA 4B3ML 1VQNA 4DR3Q 2A6HC 4X3KA 1BVSA 2ZT9C 4XYOA 4HSVA 4IUQA 4HJ5A 4LF6L 1Y69U 3TP6A 3M4YA 5ELFA 1C4QA 4IUPA 3S1MH 1OXTA 3C1EA 1PA6A 1SYEA 2C35B 3LWUA 3OWFA 3VA7A 4LFBQ 3I3CA 3S16B 1Y1WB 1I94Q 5IE8A 1W3SA 3HG9A 2KHJA 1E2ZA 2J4XA 1U4MA 5LMNQ 3SVMA 2SEBD 4XTCS 2KUMA 3IFDA 4K14A 3HOWB 3MEHA 1G2SA 4Q0FA 2NTSA 2XN9C 3FEWX 4QCLA 3TREA 4IFDI 4QB4A 2FMCA 4A3IH 1GUWA 3K5LA 4XDXA 1BUVT 4JC0A 2J0TD 1C8CA 1YEZA 2MFIA 2A69D 2RBMA 4JI1L 1CK1A 1IXRA 2WV6D 2WB1G 4IJHA 2Y0SE 3BVGA 1S5ED 3TP5A 2PQEA 1HQMC 3ND9A 3EQLC 4EGVA 2JEAI 2F3VA 3CCRA 1Y8NB 2XSCA 1XPOA 4DV7L 2K33A 2F0KA 1U5KA 4A3MH 3NQTA 4NPSA 4YWMA 2F0UA 1O7LA 2HDLA 1KC8C 2K5NA 5K5PA 2B29A 4KY7A 5ELOA 1SYBA 4C3HG 2E2IH 2MJ8A 4HIDA 4JPBW 5KNCA 1BCPB 4HN7A 4PMCA 1XMQL 3BVZA 4KHPQ 2UU9Q 2XWJB
chains in the Genus database with same CATH topology
4U673 4RCOA 4OHJA 4XQQA 4G7OC 3Q24A 3TSSA 2H1EA 2B63B 1KLUD 3RLFA 1STGA 1EYAA 2KVMA 3FRPB 2F03A 2O2LD 3MC0B 2MPMA 3OWEB 1Y8PB 3Q6SA 4E6IA 4XQNA 3PO3B 2VUMB 2VB2X 3A56A 4KJNA 1GUOA 2E2DC 3Q0AA 4V190 4IURA 2F0PA 4ABNA 2D9UA 1UNSA 4FYDA 1Q3LA 5K36H 1Q8IA 4KHVA 3D3RA 2L55A 3EA6A 1BDOA 4FXKC 4L6TB 2E2HB 1JQYD 3MWYW 3D4DA 1MSHA 4K2LA 2F0TA 1LV9A 3VYUA 4LMQD 1QCBD 5E3FA 3URYA 4XQJA 1RF2D 1PFMA 3NK9A 5M3FB 2NWGA 2VXWA 3FPPA 3GTQB 5HGTA 1SYGA 3L3OC 4V0BA 5J1ZA 1SSOA 4OIKA 4KMUC 2QILA 1EEFD 1B3AA 4C2MB 4M8AA 2OXPA 5KIXA 4IFDJ 1RKNA 5JPNC 1KNEA 1JC7A 2JP1A 1STHA 4HMIA 1PTOB 1LT6D 5IGBA 1HA5A 1I4QA 2A74C 1EFID 3GD7A 3G7LA 3HKZB 5C44B 1D1KA 3J80L 5BN5A 2N88A 3S9WA 2PMZB 3W2DA 2F0IA 3SDZA 3U9SA 4CJ1B 5G3LF 4RKLA 1SJED 2R7ZB 4QIWB 1O7YA 1EWHA 3CRLC 4F88A 1KABA 1EEID 5DM73 1L0YB 3NWSA 2RA4A 1TU2B 1ZYRC 1WTVA 1Z6HA 3SXHA 2B39A 1EIHA 2XRQD 3J80E 1EY7A 5EQ0A 4C3JB 2WP8J 2JA6B 1EY5A 5C3EB 1HCZA 5CV6A 1LTSD 2JA8B 5C4ZA 5CV8A 3KUPA 3NTHA 3NP8A 5IGEA 3X3NA 2K05A 1PRTD 1K8OA 2LY7A 1ENAA 4FO2A 1VCIA 5I6WA 1BCPF 1D5XC 4IFDH 2Q8RE 4IUNA 3SEBA 4KTAA 1GUTA 3M7GA 2PW7A 1M8AA 2Y0SB 1ML0D 2A68C 2B2UA 3AMUA 4K2KA 1GHKA 3TMEA 1S5FD 1JORA 1STNA 1CTMA 3KK7A 2BDNA 1YNJC 3HZXA 5EBDA 2PO4A 4A3EB 1EQTA 3E0JA 5FLXL 1F2ZA 1A2TA 1SJHD 1JCKB 1QB5D 1JB3A 4BA1I 2R92B 3BS1A 2PCFB 2F0MA 1NR4A 1HPCA 3KLSX 2A73B 5CV7A 1CHPD 1NAPA 3J7AV 5FLXE 3N6RA 4PMWA 4DXFA 1I4PA 5I4DA 3ERQA 2Z4IA 5CYUA 4JBWA 3R93A 4ME5A 4TKOB 1WTQA 2CQAA 4R9WA 5C5MA 1BBXC 3H09A 2Q8IB 2B2VA 4G4KA 2F0LA 2JEBI 1SNDA 4WFN3 4F8MA 1QG7A 2L4NA 5CBEE 1X32A 2B8GA 2CW0D 4DAVA 3GV3A 1EY0A 2C9OA 2DY7A 3D4WA 5CBAE 5ISRA 2QCPX 3T53B 2B2TC 3K57A 3H3VC 2RKSA 1CQFA 5KEEA 3TDQA 1UEAB 2PW5A 1VF5C 1PTOC 4DK1A 2B2WC 1BR9A 3GTLB 2B2TA 2E2JB 1T5EA 4N9PA 3NUCA 4FVMA 4QUFA 5IODA 2FMMA 4UAIA 4OL7A 2D5DA 3L7ZC 2A6HD 3FPUB 3HRZC 3QOLA 1ILPA 2SOBA 4A3BB 2F0QA 3L9AX 3U9OA 3IAYA 2XRSD 3QG1A 5CR3A 1TT2A 2K5QA 2EOTA 3OMCA 1EYDA 2RDFA 4UDUC 4ULLA 1IHZA 1D6EC 1SNMA 1CA6A 2BCOA 3C3LA 2LMCB 3GTMB 4G57A 2F0DA 4ZYSA 1KDBA 3PO2B 1Q1BA 2O4XA 2NZ1D 4BY1B 1S5CD 1F77A 2KECA 3D6WA 4QMGA 3VR5A 3K5MA 3V2TA 4B9XA 2Z1CA 3DM1A 3S14B 4QUCA 5C4XB 1A3VA 1IYVA 4ZUIA 3VYRA 3OIPA 2I46A 1SBBB 5M3MB 3FVQA 2QKIC 1GOZA 1ZXTA 2HCCA 2AQ3B 3H91A 5A2QL 1XXGA 2DNEA 4FF2A 2EDGA 2JA5B 1U4LA 1D2BA 2KCNA 3HOZB 5JAVA 1TY2A 2AWNA 4A3FB 4ZLTF 1QNUA 3OOCA 1A6XA 3H94A 3BYYB 5A2QE 5D65A 4RHSA 2OF1A 3RZOB 1HUMA 4DFAA 3MAQA 1TS2A 1ILQA 1K83B 2QDBA 4XIGS 5IGGA 1DOKA 3MZ5A 4DAYA 5JEAG 4R8IA 2L0CA 3GV6A 1S5DD 4C1NK 1Q1EA 3OPOA 4KHZA 2TSSA 4A3GB 3I4NB 4PQXA 4O42A 2L1BA 1RTOA 3P7JA 3FKIB 1GUGA 1XYIA 2EYMA 5LHY1 4IN3A 2DN8A 2E76C 2F0EA 3MTSA 3TZUA 1RODA 1H9JA 2F0FA 1L0XB 2E74C 1LACA 3MFGA 2KJXA 1FNUA 3S1MB 1Z47A 4H44C 4FP5D 1ET6A 4EVOA 4CHTB 1EY9A 4IQZA 1B50A 3LX0A 1R4QB 1EZ8A 2WIIB 2AQ2B 2V4DA 4A3IB 5KNBA 2FJ2A 1BXTA 5D3IB 3PUWA 3Q22A 2NUCA 1VF7A 4RAUC 2Z8LA 1WCMB 2EVBA 2MP1A 4EQNA 1B1ZA 1PYWD 3T56B 5E4XA 2R61A 1LTTD 1MD2D 4A3MB 1LT5D 1CQVA 4X3UA 5T1IA 4ODGA 3WOEA 3K6OA 3GQBA 2E2IB 4F7XA 3GP7A 2XIWA 5G3LD 5FO9B 3I72A 4RGNA 4CGYB 5T1GA 2L11A 3T13A 4KKUA 1HQRD 3BDCA 4WRDA 1JOOA 2RQXA 3M7NA 2A68D 4ZK9B 5A35A 1EL0A 5ELEA 4J6HA 3AB9A 4NDXA 1KDCA 3H0GB 1U4RA 3K5NA 1SDFA 4CKBA 4A3DB 1E2VA 3PUYA 1D1IA 2N55A 1BCPD 2NVTB 5C5LA 3W3AA 3T4AC 2A69C 3MHBA 1QE6A 1IW7D 4RA8A 5EGTA 3VR3A 4J1MA 2ZXPA 4B9WA 1I6VC 1JWUD 2EE1A 3OIQA 3RD4A 5DNFA 1RJTA 4X3TA 2NVYB 3K58A 4EQPA 1IKMA 1F2LA 1SE4A 4FF4A 2B8FA 3SHLA 3F2UA 3K0YA 3HOYB 1I50B 3P75A 5CORA 5EPJA 3QWNA 1V1OA 2H4OA 2AUKA 1SE3A 2HDMA 2SDFA 1LT3D 2IX1A 1F9RA 3VR2A 2IT1A 2EPBA 1SYFA 2X6LA 2RSNA 4MHEA 2NVQB 1XTCD 4KKSA 1U9RA 3FDTA 1STEA 2YYZA 1DOMA 5C0XH 1HHVA 5CV5A 1H9MA 2WINB 3S1RB 3QIAA 4B08A 1TS4A 2EYHA 2ICEC 3CRKC 3HEJA 2L5TA 1G291 1UUPA 3PUZA 2VNUD 4ZUJA 4CBVA 4A3KB 1I4RA 1WTRA 4M1UB 1SFOB 2OT2A 3SR1A 4RFBA 2F4IA 3DUZA 1PTOD 4MIUA 3QOJA 4DU9A 1U4PA 2BOSA 3NE5B 2M9VA 2F0NA 3SK8A 3J7YW 2EJFC 3VR6A 1LT4D 3HP3A 1TWCB 1WTXA 1DYQA 3C2PA 1BF4A 3K7AB 3TBIB 4IZ8A 4RHRA 3GTKB 1D5ZC 4N9TA 1LTGD 3BYTB 3A8KE 3FMCA 2IPKD 2ZXRA 4F87A 3I90A 5IGCA 1I4XA 5EJWA 2EYOA 4K5VA 2EYFA 4WJWA 3O13A 4Y7NB 1CZWA 4ZRZA 1CFMA 3UI2A 1LABA 4C56C 4HR7B 4FXDA 1PTOF 3IFTA 4CJ2C 3VYSA 3I70A 2EY6A 3S2HB 2PZWA 1B2TA 2E75C 2JE6I 3OHXC 2AQ1B 4RWSC 3E5SA 2O5JC 2WAQB 3KBGA 5C4HA 3R8BA 5DAUA 1MSGA 4CKEA 3VA5A 4C1NI 1PFBA 2K5WA 3CQZB 3NQIA 3S15B 5JEAH 2FFKB 2F0OA 4CJ0B 2SNSA 5CV4A 2KEEA 3CHBD 4C3JG 4Q5VA 2CVRA 1TS3A 4YIJA 2QEJC 3TN2A 1BNZA 5D3DA 4OO1G 3AU7A 2JSOA 4C3IB 1B9NA 3J81L 1GHJA 1JOQA 4KV6A 5IT9L 4TSSA 2BE5D 2OEOA 5FOBB 3G6JB 4H7BA 5CC4A 3K59A 1A2UA 1WVLA 1Q90A 2NN6G 2B2WA 2L9HA 1QOHA 1PZID 1W6JA 1RD9D 4QF4A 1DJRD 3A54A 1OXVA 2PNRC 1CM9A 3R3OA 1G6ZA 1OXUA 1J8IA 4K5WA 3A7AB 2TMPA 3J81E 2K28A 2AWOA 3R2IA 4ZKBB 5IT9E 1H9RA 1XX8A 3WDNA 5C0XG 4J8QA 2MUYA 3A8JE 1M4VA 3EJIA 5BN4A 2WKDA 2PZTA 3LWEA 3NTKA 5LL6S 1SAPA 3VYTA 5KGUA 1ENCA 4L63B 5JPMC 2WB1B 1F9PA 1PZJD 4K8IA 3GTJB 1ZKOA 4NP5A 2O5IC 3EROA 4ID6A 3JAML 2A6EC 2EY5A 4XYQA 4OIJA 1NCVA 2JYOA 3DWQA 1EY4A 3KBXA 1AW7A 1F2YA 2XVSA 3VR4A 4RGTA 1EY8A 2ID0A 4C3HB 2GA4B 2KEDA 1FYCA 4TRDA 1HTLD 2M2LA 1II3A 3S1NB 3MFYA 3Q23A 1F2MA 3NTIA 5EKKA 2EYLA 1DONA 4TQUS 2RVLA 5I6YA 1DD2A 4HTHA 2PZUA 3JAME 3D4RA 3EVQA 2QF7A 5KRUA 2K1BA 3KF8A 4FXGC 3J7AF 3MXUA 3QJYA 4P2CB 3A55A 5EPKA 1IL8A 2CW0C 3NXWA 5I2YA 4FF1A 3M4OB 3QB3A 3N52A 2EYJA 1V43A 1A3UA 3NHHA 3I8ZA 3M3YB 1EY6A 2DY8A 4OO1I 1J9OA 2KA7A 2EJGC 1RDPD 1NUCA 1FNVA 1EZ6A 4I65A 1F9QA 2NBFA 1BO0A 1KNAA 1SEBD 2M00A 5C3XA 1D5MC 1TWAB 3MA2B 2KQ3A 1SYCA 3C46A 2NN6I 2MGSA 5I9OA 2NTTA 2JXMB 5EKLA 1AZQA 4G7ZC 1ONLA 2ENBA 5JVG3 1KTKA 1LO5D 1UAPA 1TWHB 3CKIB 2EYPA 1EYCA 1QJOA 5C0XI 4IUVA 4WORA 1ET9A 2WKCA 1S4ZA 4LK1C 2FHTA 4PNYA 1TY0A 4BS9A 1YNNC 4DA2A 1CI3M 5EPLA 3I4LA 3SK6A 1G2TA 4A93B 2J7ZA 1Q12A 4PV1C 5I9PA 3QO2A 4PMBA 1DOLA 1SYDA 1LTBD 3S1QB 3H6MA 1CZGA 5IGFA 1NSNS 2G9DA 4I7ZC 1Z7TA 5CV9A 3V05A 4LAAA 1ESRA 5M5XB 1JWMD 2K03A 1SMYC 4DN4M 1SNCA 1ZYRD 4HEDA 4RGOS 3HOXB 1STYA 2KHSA 2F3WA 2SNMA 1OO9B 1A15A 2MHVA 4DAPA 1CT1D 2IL8A 2NYZD 3ZYYX 2EXZA 1JR0D 5C4JB 1MI2A 5ELBA 1K8MA 3ONAB 3PUVA 4IUTA 1ESFA 1WTOA 2EZVA 4DF7A 1GJXA 3A7LA 4ZAIA 2X6GA 5FKAC 4ZKCB 5FO8B 1TQOA 5C3WA 2IX3A 1T5XD 3EFXD 1S5BD 1DM0B 3DWAA 3C1FA 1AZPA 5HURA 1PFNA 4U68A 1IYUA 1HTPA 4KKTA 1E2WA 1PTOH 1LTAD 1PDQA 4KD3A 1V1PB 1KAAA 2DNCA 2EY2A 4AYBB 1WTPA 4KJOA 1PRTB 4BA2I 5JJZA 1ICWA 1LTID 4BBSB 4NMZA 1YNJD 5C0XJ 3HS0C 1PXUA 5KYLA 1FD7D 1EIGA 4K8JA 1MBYA 4XT3B 1WD0A 1JICA 2Q8TA 1KDAA 2L12A 4FNFA 2F0WA 3KLSA 3DEPA 1TWGB 4DNRB 3BG3A 3NBHA 3RMHA 2B2YC 1PZKD 1GXDC 5BN3A 4OO1H 3I4MB 1CA5A 4HSPA 5TSSA 4XXEA 1SNPA 1SNQA 1O78A 2CHBD 4L8JA 2B2YA 4K6LA 2EY1A 4OGQC 4GZYC 4CKCA 5CGKA 2K5DA 1F9SA 3GTPB 3D6CA 1C48A 3DMUA 1AFPA 1H9SB 3NWTA 1HA6A 2LKVA 3ND8A 3RUZA 2NN6H 2F1MA 3HOVB 2NVXB 1LTRD 3K5OA 1G8ZD 4KI0A 1TKWB 3MVVA 1X3QA 2F0GA 3I73A 4DGZA 1G91A 5E1FA 3S2DB 4H0LC 2HUGA 3KLRA 5IGDA 2C5CA 3WOFA 4HCSA 1B53A 3D31A 5FK9C 2F0VA 5J39A 4HAEA 5DM63 1HRJA 4RKBA 5E4WC 1CHQD 1HUNA 4RGMA 1SXTA 1AN8A 1Y1VB 1E0BA 1LLRD 1JOKA 2Z4HA 2A5HA 1QWYA 2B2UC 5ELCA 1HXYD 3HOUB 1WTWA 1XWEA 1O80A 4ZQ3A 5JEAJ 5KNDA 3OSOA 2R3ZA 4A3JB 2G9HD 3TZDA 2BDOA 4RH6A 3T51B 3P20A 2D62A 4DXGA 1NR2A 2X69A 3D8GA 2XWBB 5LL6X 1EOTA 1QNKA 1BCPC 3V96A 1FR3A 4K5XA 3M85A 3PUXA 3BDLA 4ILWA 1PRTF 2K7VA 3SE0A 4IALA 1RCVD 1IW7C 4BWGB 3IL8A 2KOLA 1W6KA 3PMFA 5K36G 5IOCA 1AP0A 1FGBD 1R4PB 2A6ED 1ZEQX 1SNOA 4XT1B 5C6AA 1R9TB 5EKIA 4MN3A 2BA0A 3TP8A 4KD4A 1B9MA 1BQQT 2R6GA 2AUJD 5D14A 1MGSA 4NW2A 2B2VC 1PLFA 3T16A 2HQEA 5JOBA 4HCEA 4IUUA 2YU9B 5JVH3 1PRTC 5M5WB 1A3TA 1V1PA 3P1HA 4HMJA 1GUNA 5M5YB 2HCIA 4EQOA 4DK0A 3A8IE 3RZDB 3OMGA 4RCNA 2RDGA 2F0SA 1DZ1A 1OXSC 4G7HC 2PPBC 1HFNA 1O7ZA 3BZDB 3SK5A 5AFWA 1Y8OB 3GO5A 5DEHA 4NKLA 2KCCA 2XNAC 4S3SA 2IW3A 5IIFA 4BY7B 2BA1A 1TS5A 1TR5A 2K01A 4KN4C 1VMPA 1B4OA 1FNWA 4X3SA 3PIO3 1JWSD 1HFGA 3GTOB 3PIP3 5J22A 2EJMA 3NBIA 3TP7A 1AEXA 3SK4A 1KLGD 1SE2A 2RSOA 2IJ0A 1DXMA 2ICIA 2IX0A 1H9SA 1EQVA 3DHQA 3OW7A 5M9OA 4IFDG 4FF3A 5EBCA 1I4GA 1ENFA 5F2DA 1IKLA 2I07B 5CMDA 1STBA 2LS01 3LNNA 1YNND 4JK1C 3NSWA 3X3MA 4BBRB 2R93B 3MXNA 1WD1A 3R2TA 4R8NA 2D2CC 1QILA 3GTGB 1BOSA 2K32A 3HGBA 2WACA 1EU4A 1EU3A 1JE4A 5COYA 4KY6A 1TIID 4DNTB 4K6DA 3PV0A 4KN7C 5FO7B 2LFNA 1B44D 1GUSA 3BDOA 2NB0A 1PMRA 1X3PA 1I3QB 1SMYD 1TVXA 1VDZA 1DCZA 3I91A 2PYKA 2K6AA 3DXJC 4H13C 3S17B 5I2XA 3DEOA 2IWHA 1RTNA 1V8QA 3DWPA 1EWCA 1OXXK 5ELDA 3MXGA 1I4HA 1RHPA 2RDHA 3NPPA 1VMCA 4KK7A 2BE5C 4Z9CB 4KY5A 2FINB 2ZXOA 2F0JA 3E6ZX 5NUCA 4C3IG 5KYIA 2JA7B 3CU7A 1TWFB 2K04A 4O1NA 2VB3X 2F0HA 1I6HB 3ITPA 3BVMA 3IKJA 4LJZC 1STAA 1H9KA 3MXPA 2A6HC 4X3KA 2ZT9C 4XYOA 4HSVA 4IUQA 1Y69U 3TP6A 3M4YA 5ELFA 1C4QA 4IUPA 1OXTA 3C1EA 1SYEA 3LWUA 3OWFA 3VA7A 3I3CA 3S16B 1Y1WB 3HG9A 1E2ZA 2J4XA 1U4MA 3SVMA 2SEBD 4XTCS 2KUMA 3IFDA 4K14A 3HOWB 3MEHA 1G2SA 4Q0FA 2NTSA 2XN9C 3FEWX 4QCLA 4IFDI 4QB4A 2FMCA 1GUWA 3K5LA 4XDXA 1BUVT 2J0TD 1C8CA 2A69D 2RBMA 1CK1A 2WV6D 3BVGA 1S5ED 3TP5A 2PQEA 1HQMC 3ND9A 3EQLC 4EGVA 2JEAI 2F3VA 1Y8NB 2XSCA 2K33A 2F0KA 3NQTA 2F0UA 1O7LA 2HDLA 5K5PA 4KY7A 1SYBA 4C3HG 2MJ8A 5KNCA 1BCPB 4HN7A 4PMCA 3BVZA 2XWJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5Q A;  2K5W A;  3NPP A; 
#chains in the Genus database with same CATH topology
 1Q8K A;  3M4Q A;  4R4C A;  4U67 3;  4R1J A;  3UDI A;  4RCO A;  4OHJ A;  4O2D A;  4XQQ A;  4DV2 L;  4G7O C;  3Q24 A;  1E7Z A;  3TSS A;  1YIJ A;  2H1E A;  4P73 A;  4A4I A;  1EQQ A;  2B63 B;  1HNW Q;  1KLU D;  3RLF A;  1YVC A;  4A3C H;  1STG A;  1EYA A;  2KVM A;  3FRP B;  2F03 A;  2O2L D;  3MC0 B;  2MPM A;  3OWE B;  4JYA L;  1K8A C;  1Y8P B;  3Q6S A;  4WJ4 A;  4E6I A;  4XQN A;  3PO3 B;  2VUM B;  2VB2 X;  3A56 A;  1V1Q A;  4QJF A;  4KJN A;  1GUO A;  3E9I A;  2E2D C;  4L5R C;  3H0G H;  3Q0A A;  4V19 0;  4IUR A;  4DV6 Q;  2GN5 A;  2OQ0 A;  1S72 A;  4JBJ A;  2G5D A;  2F0P A;  4ABN A;  4A3D H;  2QDL A;  3KDF A;  2D9U A;  1UNS A;  4FYD A;  1Q3L A;  5K36 H;  1SE8 A;  1Q8I A;  4B3S Q;  1GVP A;  3FHW A;  4DK6 C;  4KHV A;  3D3R A;  2L55 A;  3EA6 A;  2VY3 A;  1BDO A;  4FXK C;  4L6T B;  1PHJ A;  2E2H B;  1GO3 E;  1JQY D;  3MWY W;  3D4D A;  1MSH A;  4K2L A;  1UE6 A;  2F0T A;  1LV9 A;  3VYU A;  4LMQ D;  1QCB D;  1N34 Q;  5E3F A;  3URY A;  4XQJ A;  1RF2 D;  3CAM A;  1PFM A;  3NK9 A;  5M3F B;  2NWG A;  4LUZ A;  2VXW A;  3FPP A;  3GTQ B;  5HGT A;  1SYG A;  3L3O C;  4V0B A;  1VQM A;  4GOP B;  3AYH B;  5J1Z A;  1SSO A;  2NVY H;  4DNI A;  3BZC A;  4OIK A;  4KMU C;  1NBW A;  2QIL A;  1EEF D;  3A5Z B;  1B3A A;  4C2M B;  4M8A A;  2OXP A;  5KIX A;  4IFD J;  1RKN A;  5JPN C;  1KNE A;  1GD7 A;  1JC7 A;  2JP1 A;  1STH A;  4HMI A;  1PTO B;  1LT6 D;  3ERS X;  4DR7 Q;  3HOY H;  1I50 H;  5IGB A;  1HA5 A;  1I4Q A;  1U0L A;  2A74 C;  3CCL A;  1EFI D;  1PYB A;  3GD7 A;  3A74 A;  3G7L A;  2NVX H;  3HKZ B;  5C44 B;  1D1K A;  4X66 Q;  3J80 L;  5BN5 A;  2N88 A;  4N8F A;  3S9W A;  5FLM G;  2PMZ B;  3W2D A;  1K3B C;  2HD3 A;  2F0I A;  2CWP A;  3SDZ A;  3U9S A;  4CJ1 B;  5G3L F;  4RKL A;  1SJE D;  2R7Z B;  4MZ9 A;  4QIW B;  1O7Y A;  1S40 A;  1EWH A;  3CRL C;  4F88 A;  4A93 G;  1KAB A;  4X65 Q;  1EEI D;  5DM7 3;  1L0Y B;  2HHH L;  3NWS A;  2IHF A;  4JI5 Q;  4X64 L;  3S1R H;  2RA4 A;  1TU2 B;  1ZYR C;  3U58 A;  1WTV A;  4IO9 A;  1Z6H A;  2P5Z X;  3SXH A;  2B39 A;  1EIH A;  2XRQ D;  3J80 E;  2QGQ A;  1EY7 A;  5EQ0 A;  4A3L H;  2H5X A;  4C3J B;  2WP8 J;  2JA6 B;  1EY5 A;  4A3K H;  2D0P A;  5C3E B;  4YY3 L;  1HCZ A;  2AKW B;  1PH4 A;  4BXX H;  4AH6 A;  4DV1 Q;  5CV6 A;  1H95 A;  1LTS D;  1WI5 A;  3HOX G;  2JA8 B;  2PQA A;  4DAM A;  5C4Z A;  5CV8 A;  3KUP A;  3HOU H;  3NTH A;  3NP8 A;  5IGE A;  3X3N A;  2K05 A;  1SR3 A;  1PRT D;  3EIV A;  1K8O A;  1G51 A;  2LY7 A;  1ENA A;  4APV A;  4FO2 A;  3W1B A;  1VCI A;  5I6W A;  1BCP F;  1D5X C;  4IFD H;  5IWA L;  1TWC H;  1VQ4 A;  2Q8R E;  4IUN A;  3K7A H;  2EXD A;  3TS2 A;  3SEB A;  4KTA A;  1GUT A;  3M7G A;  2PW7 A;  1M8A A;  4TVA B;  1S3O A;  3ULL A;  1ICF B;  4DV3 Q;  2Y0S B;  2UXB L;  1ML0 D;  3KF8 B;  2A68 C;  2B2U A;  2RCF A;  1IBL Q;  3AMU A;  4K2K A;  1MJE A;  1GHK A;  3TME A;  1S5F D;  1JOR A;  1OTC A;  1STN A;  3UDX A;  1CTM A;  4ME3 A;  3T1H Q;  1M90 C;  4OX9 Q;  5IY0 A;  4UP7 A;  4Y7N H;  4DUZ Q;  2VL6 A;  3ICE A;  4LFC L;  4OON A;  3KK7 A;  3U50 C;  2BDN A;  4IPC A;  3CME A;  1YNJ C;  3HZX A;  5EBD A;  2YTY A;  2PO4 A;  4NB3 A;  4A3E B;  1EQT A;  1IBM Q;  4JI7 L;  3E0J A;  4AYB G;  2HQL A;  5GAH C;  4JI3 Q;  4UY8 C;  5FLX L;  4IOC A;  3JC6 6;  2YTX A;  1F2Z A;  4JI6 L;  1D7Q A;  4LF9 Q;  4BBS G;  1J5E L;  3AFQ A;  1A2T A;  1SJH D;  3J7Z C;  1JCK B;  1QB5 D;  3G48 A;  1JB3 A;  4BA1 I;  2R92 B;  3BS1 A;  2PCF B;  2F0M A;  1NR4 A;  1HPC A;  3KLS X;  2A73 B;  4DAY B;  5CV7 A;  3S15 H;  1UE5 A;  3OTO L;  3CC4 A;  1CHP D;  1NAP A;  1VQH A;  4QGU A;  3J7A V;  1YJ9 A;  5FLX E;  3N6R A;  4PMW A;  4DXF A;  1I4P A;  5I4D A;  3ERQ A;  1KRT A;  2Z4I A;  1HNX Q;  5CYU A;  5M5W H;  5J3B A;  4JBW A;  4RG1 A;  3I4M G;  1VQF A;  3R93 A;  4ME5 A;  1A62 A;  4C3I H;  1XNQ L;  4JG2 A;  4H02 A;  1RIP A;  3J7A 5;  1LYL A;  4TKO B;  1WTQ A;  4Y52 H;  2CQA A;  1N36 Q;  4R9W A;  1N32 Q;  5C5M A;  2AHO B;  1BBX C;  3H09 A;  1JJG A;  2Q8I B;  2B2V A;  2VQE Q;  4G4K A;  2F0L A;  2GVB A;  3PIP A;  2JEB I;  3TEH B;  2VS1 A;  1SND A;  3HOV G;  4WFN 3;  4F8M A;  1QG7 A;  2L4N A;  5CBE E;  4X62 L;  1VQC A;  4KLK A;  1HNZ L;  1X32 A;  2B8G A;  2CW0 D;  4DAV A;  3GV3 A;  1K0S A;  1EY0 A;  2C9O A;  4YHH L;  2DY7 A;  3D4W A;  5CBA E;  1YNX A;  5ISR A;  5GAE C;  2QCP X;  3T53 B;  2B2T C;  3K57 A;  3H3V C;  2RKS A;  4LF7 L;  1CQF A;  5KEE A;  4DR4 L;  3TDQ A;  4DV4 Q;  1UEA B;  2PW5 A;  1VQB A;  1VF5 C;  1PTO C;  4DK1 A;  2B2W C;  1BR9 A;  3J81 i;  4LF5 Q;  3K80 C;  2B2T A;  4GOP A;  3GTL B;  3OYY A;  2E2J B;  4DR5 Q;  1T5E A;  4DPG A;  4A3L G;  4N9P A;  3NUC A;  3QR8 A;  2Q2I A;  1SMX A;  1Y1V G;  4FVM A;  4QUF A;  1Z9F A;  1PH5 A;  1C9O A;  3I7F A;  5IOD A;  4LFA Q;  1ASY A;  2FMM A;  4UAI A;  4O0A A;  2PNH A;  3HOU G;  2I5L X;  2UXD L;  4OL7 A;  2D5D A;  3L7Z C;  5BR8 L;  2A6H D;  3FPU B;  3HRZ C;  3QOL A;  1ILP A;  4DR1 L;  4DV5 Q;  3BZK A;  4BBR H;  4AQY Q;  4C3H H;  4A3J G;  1FJG L;  2SOB A;  4HIM A;  4A3B B;  2F0Q A;  5LMU Q;  3L9A X;  3U9O A;  3IAY A;  2XRS D;  3AFP A;  3QG1 A;  3S1N H;  5CR3 A;  5JJI A;  4QY7 A;  1TT2 A;  2K5Q A;  3GTG H;  4GN5 A;  4IPH A;  2EOT A;  3OMC A;  4GKJ L;  1EYD A;  2RDF A;  4UDU C;  4ULL A;  1QVG A;  1IHZ A;  1D6E C;  1SNM A;  3F2B A;  1Q82 C;  1CA6 A;  2BCO A;  3C3L A;  2LMC B;  3CCS A;  3GTM B;  2E5L Q;  1BBU A;  4G57 A;  2F0D A;  4ZYS A;  1KDB A;  2RCN A;  1I3Q H;  4JI4 L;  3PO2 B;  1B70 B;  1FGU A;  1Q1B A;  2O4X A;  2NZ1 D;  3I56 A;  4BY1 B;  1S5C D;  1Q86 C;  1F77 A;  3M4O H;  3Q8D A;  2KEC A;  3D6W A;  4QMG A;  3VR5 A;  3S17 H;  3K5M A;  3M3Y H;  1E22 A;  3V2T A;  2KCT A;  4B9X A;  2Z1C A;  1UWV A;  3DM1 A;  4R4O A;  3S14 B;  4QUC A;  4GKK L;  5C4X B;  1A3V A;  4DR2 L;  1IYV A;  4ZUI A;  3VYR A;  5AJ3 Q;  3OIP A;  2I46 A;  1SBB B;  2ATW A;  1VQ9 A;  5M3M B;  1JT8 A;  1TWA H;  1CKM A;  3U4V A;  2CH4 A;  3FVQ A;  3IRB A;  2QKI C;  1GOZ A;  2KHI A;  1ZXT A;  4OEL B;  2HCC A;  4JI8 L;  2UXC L;  4LNQ A;  2AQ3 B;  3H91 A;  5A2Q L;  2XTI A;  1XXG A;  2DNE A;  3L2P A;  2OTL A;  2EDG A;  4MTK A;  4FF2 A;  2XGT A;  2JA5 B;  1U4L A;  1D2B A;  2KCN A;  3HOZ B;  5JAV A;  1TY2 A;  2AWN A;  4A3F B;  1TWH H;  4ZLT F;  2ZM6 L;  4UP8 A;  1QNU A;  3OOC A;  1A6X A;  3H94 A;  3BYY B;  5A2Q E;  1PFS A;  1CSP A;  5D65 A;  4RHS A;  2OF1 A;  5FLM H;  3RZO B;  2HIV A;  5LMN W;  1HUM A;  4DFA A;  3I55 A;  3MAQ A;  1VQ7 A;  1A8V A;  1XNR Q;  1TS2 A;  1ILQ A;  1K83 B;  2QDB A;  4XIG S;  5IGG A;  1RL2 A;  4B3T L;  1O7I A;  1K9M C;  1DOK A;  3L0O A;  3MZ5 A;  4DAY A;  5JEA G;  4JI2 L;  4A93 H;  4R8I A;  1WOC A;  2L0C A;  3GV6 A;  4B3R Q;  1N8R C;  1FL0 A;  4R4Q A;  1S5D D;  4C1N K;  1Q1E A;  4BY7 G;  3S1Q H;  3OPO A;  4KHZ A;  1CKN A;  2TSS A;  4A3G B;  3I4N B;  4PQX A;  4O42 A;  2L1B A;  3FP9 A;  1RTO A;  3SGI A;  3P7J A;  2ALY B;  2BH8 A;  3FKI B;  4LW1 A;  1GUG A;  5M5X H;  1XYI A;  3G4S A;  2EYM A;  5LHY 1;  4IN3 A;  2DN8 A;  3HOX H;  4POF A;  2E76 C;  2F0E A;  3MTS A;  4J15 A;  3TZU A;  1ROD A;  1H9J A;  1PVO A;  3RLO A;  1IZ6 A;  2F0F A;  1L0X B;  2E74 C;  1LAC A;  3MFG A;  2KJX A;  1FNU A;  3S1M B;  1VQD A;  1Z47 A;  3D0F A;  4H44 C;  5C4J H;  4FP5 D;  1ET6 A;  4EVO A;  3TS0 A;  4CHT B;  1EY9 A;  5IP7 G;  4IQZ A;  4ALP A;  3TQY A;  1B50 A;  3LX0 A;  4LF8 L;  4BBR G;  1R4Q B;  1A0I A;  1XPR A;  2R93 G;  2N78 A;  1KHI A;  1EZ8 A;  2WII B;  2AQ2 B;  4JW0 A;  3G71 A;  1NMF A;  2V4D A;  3K81 C;  4A3I B;  3S24 A;  5KNB A;  2FJ2 A;  1BXT A;  4NXM Q;  5D3I B;  2VQF Q;  1X3E A;  4EQ5 A;  4EX5 A;  3PUW A;  3TRZ A;  3Q22 A;  1C7Y A;  2NUC A;  1VQ8 A;  1VF7 A;  4OWT B;  4LFB L;  4RAU C;  2Z8L A;  1WCM B;  2EVB A;  2MP1 A;  4EQN A;  3RN5 A;  1B1Z A;  1PYW D;  1I94 L;  3T56 B;  5E4X A;  2R61 A;  1XMO Q;  1LTT D;  1MD2 D;  3E9H A;  5LMN L;  4A3M B;  1LT5 D;  1CQV A;  3MEF A;  4DUY Q;  4ZCK A;  1EFW A;  2E2H H;  1K28 A;  4X3U A;  5T1I A;  4BBS H;  4ODG A;  3WOE A;  1KAW A;  3G6E A;  3K6O A;  3GQB A;  2YTV A;  2E2I B;  1VQA A;  4F7X A;  3GP7 A;  2XIW A;  5G3L D;  5M3F H;  1C0A A;  5FO9 B;  2UUB Q;  3GTQ H;  1B7Y B;  3RN2 A;  3I72 A;  3CPF A;  4RGN A;  4GN3 B;  4CGY B;  5T1G A;  2EQS A;  2L11 A;  1TWG H;  4PZ8 A;  3T13 A;  4KKU A;  1HQR D;  3BDC A;  4WRD A;  2HHH Q;  1JOO A;  4X64 Q;  2RQX A;  3M7N A;  2JA7 G;  2A68 D;  4ZK9 B;  4HJA A;  3KF6 B;  5A35 A;  2IHE A;  4DR6 Q;  5ELE A;  1EL0 A;  2EIF A;  2I5H A;  3I4M H;  4J6H A;  3AB9 A;  2WAQ E;  4NDX A;  1KDC A;  4YY3 Q;  4KHP L;  2UU9 L;  3GTP H;  3H0G B;  3RLN A;  1U4R A;  3K5N A;  1SDF A;  1HJP A;  2QA4 A;  4CKB A;  4A3D B;  3HFZ B;  4DV0 Q;  1E2V A;  3PUY A;  3T1Y L;  1D1I A;  3HOV H;  1NE3 A;  2N55 A;  1Y1W G;  1BCP D;  5E7N A;  4JVZ A;  2NVT B;  5C5L A;  1AE3 A;  4A3G G;  1D8L A;  3W3A A;  3T4A C;  2A69 C;  3MHB A;  4OWX B;  1QE6 A;  2Z6K C;  1PH9 A;  2KEN A;  1IW7 D;  4RA8 A;  3HOW G;  5EGT A;  1L1O B;  3VR3 A;  4J1M A;  2ZXP A;  3S2D H;  4B9W A;  1I6V C;  1JWU D;  3ER0 A;  2EE1 A;  2A8V A;  2UXB Q;  3OIQ A;  4OWW B;  2HIX A;  3RD4 A;  1PH7 A;  2DUD A;  4DV6 L;  2I0Q A;  5DNF A;  1RJT A;  4X3T A;  1SN8 A;  4PZ7 A;  1JE5 A;  2NVY B;  3K58 A;  4EQP A;  1IKM A;  2CFM A;  1F2L A;  1SE4 A;  2RHS B;  1QZH A;  4FF4 A;  2B8F A;  3SHL A;  4B3S L;  2K50 A;  4LFC Q;  3F2U A;  4GLV B;  3K0Y A;  1L0W A;  1N33 L;  3HOY B;  1I50 B;  3P75 A;  5COR A;  5EPJ A;  1Y1V H;  3ZJY C;  3QWN A;  1V1O A;  2H4O A;  2AUK A;  1WYD A;  1SE3 A;  2HDM A;  1KRS A;  1CUK A;  2SDF A;  1LT3 D;  1N34 L;  2IX1 A;  1F9R A;  1IBK Q;  3VR2 A;  2IT1 A;  2EPB A;  4POG A;  1SYF A;  1CKO A;  2X6L A;  2CCZ A;  3VDY A;  4LWC A;  2RSN A;  4MHE A;  1V9P A;  2NVQ B;  1XTC D;  1VQL A;  3MXN B;  4KKS A;  1U9R A;  3FDT A;  1STE A;  4A3J H;  2YYZ A;  1DOM A;  5C0X H;  1HHV A;  5CV5 A;  1H9M A;  2WIN B;  1BKB A;  3S1R B;  2WB1 E;  2ZTC A;  3QIA A;  4DR7 L;  4B08 A;  1TS4 A;  2EYH A;  2ICE C;  2WFW A;  3EBE A;  3CRK C;  3HEJ A;  2B63 G;  1X3G A;  2L5T A;  3KOJ A;  1G29 1;  1UUP A;  3PUZ A;  4A3E H;  2VNU D;  3OTO Q;  4ZUJ A;  3A5U A;  5FLX c;  1UEB A;  4CBV A;  4X66 L;  4A3K B;  1I4R A;  1WTR A;  4M1U B;  3CF5 A;  2K75 A;  1SFO B;  2OT2 A;  3SR1 A;  4RFB A;  4RMF A;  2F4I A;  3DUZ A;  3PO3 G;  2VUM G;  3CCV A;  5IP9 G;  1PTO D;  4MIU A;  1YBY A;  1IL2 A;  3PCO B;  3QOJ A;  4DU9 A;  1U4P A;  2BOS A;  3NE5 B;  2M9V A;  2UUC Q;  2F0N A;  3SK8 A;  3J7Y W;  5IYD G;  2AMC B;  2EJF C;  4X65 L;  3VR6 A;  1MIU A;  5GAD C;  3H15 A;  5H1S E;  1HR0 Q;  1LT4 D;  2Q2H A;  3HP3 A;  1TWC B;  1WTX A;  1SLJ A;  2LXJ A;  1DYQ A;  3C2P A;  1BF4 A;  3K7A B;  1GM5 A;  3TBI B;  4IZ8 A;  1LUZ A;  2JK8 A;  4RHR A;  1R9T H;  3GTK B;  1D5Z C;  4N9T A;  1LTG D;  3BYT B;  3A8K E;  4X62 Q;  3FMC A;  1Y14 B;  2PI2 E;  2IPK D;  1HZA A;  3WWV A;  2ZXR A;  5M3F G;  4F87 A;  3I90 A;  5IGC A;  1I4X A;  2RHQ B;  5EJW A;  2EYO A;  4K5V A;  2EYF A;  3CW2 C;  4WJW A;  3O13 A;  4Y7N B;  1CZW A;  4ZRZ A;  1CFM A;  2IY5 B;  2YU9 H;  4IPD A;  4DR4 Q;  3UI2 A;  2K5V A;  1LAB A;  4C56 C;  4JOI C;  1PV4 A;  5M5Y H;  3HKZ G;  4HR7 B;  2N3S A;  5C44 G;  4FXD A;  2YV5 A;  2K5H A;  1PTO F;  3IFT A;  4CJ2 C;  1VQG A;  4GLX A;  3VYS A;  3I70 A;  2VZA A;  3RZD H;  2EY6 A;  1IBL L;  2PZW A;  3S2H B;  1B2T A;  2E75 C;  2JE6 I;  3OHX C;  2AQ1 B;  4RWS C;  3E5S A;  1EYG A;  2O5J C;  3T1H L;  4OX9 L;  2V1C C;  2R7Z G;  2JA9 A;  2WAQ B;  4DUZ L;  3PGZ A;  3KBG A;  5C4H A;  3R8B A;  4AIM A;  5DAU A;  1MSG A;  4CKE A;  3VA5 A;  4C1N I;  1PFB A;  2K5W A;  3CQZ B;  3NQI A;  3S15 B;  5JEA H;  3NEM A;  1E1T A;  1IBM L;  2FFK B;  2F0O A;  4CJ0 B;  2E2J H;  2SNS A;  4K0K Q;  4BY7 H;  4JI3 L;  5CV4 A;  2KEE A;  3CHB D;  4C3J G;  4Q5V A;  2CVR A;  2JA6 G;  4GLA C;  1TS3 A;  4YIJ A;  5C3E G;  2QEJ C;  3TN2 A;  1BNZ A;  4CDE C;  3KF6 A;  5D3D A;  4OO1 G;  3AU7 A;  2JSO A;  4C3I B;  3GTO H;  2JA8 G;  3M4P A;  1B9N A;  3J81 L;  1GHJ A;  1JOQ A;  4KV6 A;  5IT9 L;  4TSS A;  2BE5 D;  3E3X A;  1YHQ A;  4JV5 Q;  4JI4 Q;  4OXP A;  2OEO A;  5FOB B;  3G6J B;  4GN4 B;  4H7B A;  5CC4 A;  3K59 A;  4NXN Q;  3PSI A;  1A2U A;  1WVL A;  1Q90 A;  2NN6 G;  2B2W A;  1UE1 A;  5EAY A;  4A3B H;  2L9H A;  1QOH A;  5IYC H;  1PZI D;  1W6J A;  1RD9 D;  4QF4 A;  1DJR D;  3A54 A;  1OXV A;  2PNR C;  1CM9 A;  3R3O A;  4GNX B;  2DJG C;  4N8X 1;  1L1O C;  1HNX L;  1G6Z A;  1OXU A;  1J8I A;  2Y0S G;  4K5W A;  3A7A B;  2TMP A;  4P71 A;  3J81 E;  2K28 A;  1B8A A;  2AWO A;  4UPA A;  3DLL A;  5IP7 H;  3R2I A;  4L5Q A;  4ZKB B;  5IT9 E;  1H9R A;  1L1O A;  2R93 H;  1XX8 A;  3WDN A;  5GRO A;  5C0X G;  2MQH A;  3NEN A;  3F2C A;  4J8Q A;  1N32 L;  4P74 A;  4LF4 Q;  1EIF A;  2F4V Q;  2MUY A;  3A8J E;  2VQE L;  1X55 A;  1M4V A;  3EJI A;  5BN4 A;  2WKD A;  2PZT A;  3LWE A;  1UE7 A;  3NTK A;  1PH6 A;  3STB C;  5LL6 S;  2UXC Q;  4A3E G;  2UUA Q;  1SAP A;  3VYT A;  1HZ9 A;  5IYB G;  5KGU A;  1ENC A;  1HZC A;  4L63 B;  5JPM C;  2WB1 B;  1F9P A;  3S14 H;  1PZJ D;  4K8I A;  5C4X H;  3GTJ B;  1ZKO A;  4NP5 A;  2O5I C;  3ERO A;  4YCV A;  4ID6 A;  3JAM L;  2A6E C;  1QVC A;  2EY5 A;  4XYQ A;  4OIJ A;  1NCV A;  2JYO A;  3CXC A;  3DWQ A;  1EY4 A;  3KBX A;  1AW7 A;  1F2Y A;  2XVS A;  3CCQ A;  3VR4 A;  4RGT A;  4JI0 Q;  4DV4 L;  1EY8 A;  2R92 G;  3UE1 A;  2ID0 A;  2ASB A;  4LUV A;  4C3H B;  2GA4 B;  5L37 A;  2KED A;  4LF5 L;  1FYC A;  4YWK A;  4TRD A;  1HTL D;  4DR5 L;  2M2L A;  4B3M Q;  4P72 A;  1II3 A;  3S1N B;  3MFY A;  3Q23 A;  1KQS A;  1F2M A;  3NTI A;  5EKK A;  4LF6 Q;  2EYL A;  4X6A H;  1KD1 C;  1DON A;  4TQU S;  2RVL A;  4AYB E;  5I6Y A;  1DD2 A;  4HTH A;  3NBH B;  4LFA L;  2PZU A;  3JAM E;  3D4R A;  1VQK A;  3EVQ A;  3ULP A;  2QF7 A;  5KRU A;  4HJ9 A;  2K1B A;  3KF8 A;  2MO1 A;  2JA7 H;  1NTG A;  1TWF H;  2K14 A;  4FXG C;  4QQB X;  3J7A F;  3MXU A;  3QJY A;  1I6H H;  5GQO A;  2L15 A;  4P2C B;  3A55 A;  5EPK A;  1DGS A;  2MNA A;  4DV5 L;  4AQY L;  1XJV A;  1IL8 A;  2CW0 C;  3NXW A;  5I2Y A;  4FF1 A;  3M4O B;  5LMU L;  3QB3 A;  4WJ3 M;  3N52 A;  2EYJ A;  1V43 A;  1A3U A;  5GAG C;  3NHH A;  3I8Z A;  3M3Y B;  2QW7 A;  1YJN A;  1EY6 A;  2DY8 A;  3ULJ A;  4OO1 I;  1J9O A;  2KA7 A;  2EJG C;  1RDP D;  1NUC A;  1FNV A;  1EZ6 A;  2N8N A;  1MKH A;  4I65 A;  4JI1 Q;  1F9Q A;  3S16 H;  1Y1W H;  2NBF A;  2E5L L;  1BO0 A;  1KNA A;  1SEB D;  2M00 A;  2OCE A;  5C3X A;  2F52 A;  4A3G H;  1D5M C;  4MNO A;  3W5O A;  4DV7 Q;  1TWA B;  3MA2 B;  1IYJ B;  3BU2 A;  2KQ3 A;  1SYC A;  3RNU A;  4OEM B;  3HOW H;  3C46 A;  2NN6 I;  4DK3 C;  2MGS A;  4DKA C;  5I9O A;  1JMC A;  1EOV A;  1NY4 A;  2NTT A;  1VQP A;  2JXM B;  1XMQ Q;  5EKL A;  1AZQ A;  4G7Z C;  1WTH A;  1ONL A;  2ENB A;  5JVG 3;  1KTK A;  1PH2 A;  1LO5 D;  1UAP A;  1TWH B;  3CKI B;  4DV2 Q;  2EYP A;  5AJ3 L;  1EYC A;  1QJO A;  3K8A A;  5C0X I;  4IUV A;  4WOR A;  1ET9 A;  2WKC A;  1S4Z A;  2LSS A;  4LK1 C;  3PF4 A;  2FHT A;  4PNY A;  1TY0 A;  4BS9 A;  4PZ6 A;  4JYA Q;  1YNN C;  4DA2 A;  2ZJQ A;  2Z9H A;  1CI3 M;  5EPL A;  3I4L A;  4FDB A;  4A3B G;  3SK6 A;  5IYC G;  1G2T A;  2CQO A;  4A93 B;  2J7Z A;  1Q12 A;  4PV1 C;  5I9P A;  3QO2 A;  4PMB A;  1NMG A;  1DOL A;  1SYD A;  2CWA A;  1B3Q A;  1LTB D;  3S1Q B;  3I4O A;  3H6M A;  3E0E A;  1CZG A;  5IGF A;  2B63 H;  1NSN S;  2G9D A;  1SRO A;  4I7Z C;  1WCM H;  1Z7T A;  5CV9 A;  3KJO A;  3V05 A;  4LAA A;  2JQO A;  4HJ8 A;  1ESR A;  2CKZ B;  5M5X B;  3PO2 G;  1JWM D;  2K03 A;  1HZB A;  4DR3 L;  4BY1 G;  1SMY C;  4DN4 M;  1SNC A;  3PO3 H;  1ZYR D;  4HED A;  4RGO S;  3HOX B;  2VUM H;  5IP9 H;  1XNR L;  1STY A;  2KHS A;  2F3W A;  3PF5 A;  2SNM A;  1OO9 B;  3UDF A;  5IYD H;  1A15 A;  4GNX C;  1AH9 A;  2MHV A;  4DAP A;  1CT1 D;  4B3R L;  1YHA A;  1BBW A;  2IL8 A;  2VW9 A;  1LTL A;  2NYZ D;  3CCM A;  3ZYY X;  5C4X G;  2EXZ A;  1X65 A;  4UHV A;  1JR0 D;  4GNX A;  2K4K A;  5C4J B;  2R7D A;  1MI2 A;  5ELB A;  5M3M G;  1K8M A;  3ONA B;  3PUV A;  3T1Y Q;  1I5F A;  4IUT A;  4YWL A;  1ESF A;  1MJC A;  1WTO A;  3CC2 A;  2EZV A;  4DF7 A;  1GJX A;  3A7L A;  4ZAI A;  2X6G A;  5FKA C;  4ZKC B;  5FO8 B;  1TQO A;  5C3W A;  2IX3 A;  3CCJ A;  3EFX D;  1EUJ A;  1T5X D;  1S5B D;  2JA5 G;  1DM0 B;  3H3V H;  2D0O A;  3DWA A;  3HOZ G;  3C1F A;  4A3F G;  3KLW A;  1AZP A;  5HUR A;  1PFN A;  4U68 A;  1YHB A;  4C2M H;  1IYU A;  1VQJ A;  1HTP A;  4KKT A;  1E2W A;  4A75 A;  1N9W A;  1PTO H;  1LTA D;  1PDQ A;  4KD3 A;  1V1P B;  1KAA A;  3J80 c;  2DNC A;  2EY2 A;  2DJF C;  4AYB B;  1WTP A;  4KJO A;  2NVT H;  5C44 H;  3CCE A;  2JJQ A;  1PRT B;  2Q2T A;  4BA2 I;  5JJZ A;  3CC7 A;  2F3I A;  1ICW A;  1LTI D;  1EIY B;  1N33 Q;  4BBS B;  3KJP A;  4NMZ A;  3UDG A;  1YNJ D;  5C0X J;  3HS0 C;  3B6Y A;  4NXM L;  1PXU A;  5KYL A;  2R7Z H;  1FD7 D;  1EIG A;  1WJJ A;  2VQF L;  4K8J A;  1MBY A;  4XT3 B;  1E24 A;  1WD0 A;  1JIC A;  2Q8T A;  1G6P A;  2FXQ A;  1HNW L;  1NNX A;  1KDA A;  2L12 A;  4FNF A;  1P8L A;  2F0W A;  3KLS A;  3DEP A;  3I4N G;  1TWG B;  4DNR B;  3BG3 A;  3NBH A;  5IWA Q;  1XMO L;  3RMH A;  4C3J H;  2JA6 H;  2B2Y C;  4R4I A;  1PZK D;  1GXD C;  3FKI G;  4DUY L;  5C3E H;  3U4Z A;  1YIT A;  5BN3 A;  1PH3 A;  1HH2 P;  4QL5 A;  4OO1 H;  3I4M B;  1CA5 A;  4R4T A;  4HSP A;  2JA8 H;  1SNP A;  1SNQ A;  1O78 A;  2Z6K A;  2CHB D;  5TSS A;  4L8J A;  2B2Y A;  4XXE A;  4K6L A;  2EY1 A;  1X54 A;  4OGQ C;  1E1O A;  2PI2 A;  3J80 i;  4GZY C;  4CKC A;  5CGK A;  2K5D A;  1F9S A;  3GTP B;  1VQE A;  2UUB L;  3D6C A;  1C48 A;  2NVQ H;  3DMU A;  3W1G A;  1AFP A;  1H9S B;  3NWT A;  1HA6 A;  3I2Z A;  2LKV A;  3ND8 A;  2Q2U A;  4UP9 A;  3RUZ A;  3M9B A;  5FJ8 H;  3AEV A;  2A19 A;  4IPG A;  2NN6 H;  2F1M A;  3HOV B;  2NVX B;  2I5M X;  1LTR D;  3K5O A;  1G8Z D;  4KI0 A;  4JI7 Q;  5HGQ A;  3A0J A;  1TKW B;  3MVV A;  1X3Q A;  2F0G A;  3I73 A;  4DR6 L;  4DGZ A;  4JI6 Q;  1G91 A;  2ZTE A;  4L5T A;  1J5E Q;  2KCM A;  5E1F A;  3S2D B;  4H0L C;  2HUG A;  3KLR A;  1PH1 A;  5IGD A;  1SFO H;  1VQ6 A;  2C5C A;  4A3I G;  3WOF A;  3GDE A;  1X3F A;  4HCS A;  1B53 A;  3D31 A;  5FK9 C;  2F0V A;  5J39 A;  1JJ2 A;  4CDC C;  4CDF C;  4DV0 L;  4HAE A;  5DM6 3;  1WCM G;  1HRJ A;  4RKB A;  4HJ7 A;  5E4W C;  2E8G A;  5HY6 A;  1CHQ D;  5IYB H;  1HR0 W;  1K73 C;  1HUN A;  4RGM A;  1SXT A;  3CCU A;  1AN8 A;  1Y1V B;  1E0B A;  4A3M G;  1LLR D;  1JOK A;  2Z4H A;  2A5H A;  1QWY A;  2B2U C;  5ELC A;  3GTK H;  1HXY D;  3HOU B;  1J6Q A;  1WTW A;  1XNQ Q;  1XWE A;  2B3G A;  1O80 A;  4ZQ3 A;  4JI5 L;  2R92 H;  5JEA J;  5KND A;  3OSO A;  2R3Z A;  4A3J B;  2G9H D;  3TZD A;  2GVA A;  2BDO A;  4RH6 A;  3T51 B;  1QUQ B;  3P20 A;  4IJL A;  2D62 A;  4DV1 L;  4DXG A;  3PQI A;  2BH2 A;  4A3C G;  1NR2 A;  1HNZ Q;  1PH8 A;  2X69 A;  1E3P A;  1IBK L;  3EN2 A;  3D8G A;  4YHH Q;  3HKS A;  2XWB B;  1EQR A;  1YZ6 A;  2ZJR A;  5LL6 X;  1EOT A;  5DLQ E;  2K52 A;  1QNK A;  1BCP C;  3V96 A;  1FR3 A;  4K5X A;  3S2H H;  3M85 A;  3PUX A;  3STB D;  3BDL A;  4ILW A;  3H0G G;  4A76 A;  1PRT F;  2K7V A;  3SE0 A;  4LF7 Q;  4IAL A;  1RCV D;  3CD6 A;  1IW7 C;  4BWG B;  4A3D G;  3IL8 A;  2KOL A;  1GKH A;  2ES2 A;  1VQ5 A;  1W6K A;  3KYH C;  3PMF A;  3F8T A;  5K36 G;  5IOC A;  4DV3 L;  2MO0 A;  3CQZ H;  4JBM A;  1AP0 A;  1FGB D;  1R4P B;  2A6E D;  1Q81 C;  4PG3 A;  1ZEQ X;  3CP0 A;  4YCU A;  1SNO A;  4XT1 B;  5C6A A;  1R9T B;  5EKI A;  4JOI A;  4MN3 A;  2BA0 A;  1CKN B;  3TP8 A;  4KD4 A;  1T9H A;  1B9M A;  3K7U C;  1M1K C;  1BQQ T;  2R6G A;  2AUJ D;  3AQQ A;  3J81 c;  2UXD Q;  5D14 A;  2ZTD A;  2OTJ A;  1MGS A;  2DGY A;  2UUC L;  1QVF A;  1NJI C;  4NW2 A;  5IT9 c;  5BR8 Q;  1VQO A;  1Q7Y C;  2B2V C;  4DR1 Q;  5ELN A;  1PLF A;  3F1Z A;  3GTL H;  2Z6B A;  4YCW A;  2HQE A;  5JOB A;  4HCE A;  3T16 A;  1FJG Q;  4IUU A;  1HR0 L;  1K0R A;  1VS0 A;  4HIO A;  5JVH 3;  3PIO A;  2YU9 B;  1Q46 A;  1PRT C;  3HOY G;  4LF9 L;  3RR5 A;  4GKJ Q;  5M5W B;  1A3T A;  1V1P A;  3P1H A;  4HMJ A;  1ASZ A;  1GUN A;  2NZH A;  5M5Y B;  2HCI A;  4EQO A;  3LGJ A;  4DK0 A;  4L5S A;  3A8I E;  3RZD B;  3OMG A;  4RCN A;  4HIK A;  2RDG A;  2F0S A;  1DZ1 A;  1OXS C;  4JCV E;  4G7H C;  2PPB C;  1O7Z A;  1KIX A;  1KL9 A;  1HFN A;  5FJ8 G;  4GOP C;  1KXL A;  3BZD B;  1L2F A;  1LM0 A;  3SK5 A;  5AFW A;  2OQK A;  1Y8O B;  1XTD A;  1MHW C;  3GO5 A;  5DEH A;  4NKL A;  2KCC A;  2XNA C;  4S3S A;  2IW3 A;  5IIF A;  2R7F A;  1PYS B;  4BY7 B;  4GKK Q;  2BA1 A;  1TS5 A;  1TR5 A;  4DR2 Q;  4A3K G;  3GTM H;  2K01 A;  4KN4 C;  1VMP A;  1B4O A;  1XPU A;  4BXX G;  4GS3 A;  1X9N A;  1N36 L;  1FNW A;  3JAM c;  4X3S A;  3PIO 3;  2HT1 A;  1JWS D;  1HFG A;  2NZO A;  3GTO B;  3GTJ H;  3CPW A;  3PIP 3;  4IOA A;  5J22 A;  3PO2 H;  2EJM A;  3NBI A;  3TP7 A;  4BY1 H;  1EWI A;  1AEX A;  3SK4 A;  1KLG D;  3CMA A;  4JI8 Q;  1K3R A;  1SE2 A;  4LUO A;  2RSO A;  2IJ0 A;  4CDD C;  1DXM A;  2Z0S A;  2ICI A;  3F2D A;  2IX0 A;  1YJW A;  1H9S A;  2A1A A;  3KDF B;  1EQV A;  3DHQ A;  3OW7 A;  5JJK A;  3UE0 A;  5M9O A;  4IFD G;  4K0K L;  4FF3 A;  5EBC A;  1I4G A;  1X56 A;  3KFU A;  1QZG A;  3H3V I;  1ENF A;  1X6O A;  5M3M H;  2ZM6 Q;  5F2D A;  1IKL A;  2I07 B;  5CMD A;  1STB A;  2LS0 1;  1JJC B;  3LNN A;  1YNN D;  4JK1 C;  1JB7 A;  3NSW A;  3X3M A;  4BBR B;  2R93 B;  3MXN A;  1WD1 A;  3R2T A;  4JV5 L;  5JJL A;  4I7A A;  4R8N A;  2D2C C;  4NXN L;  1QIL A;  3GTG B;  1BOS A;  2CH4 W;  2K32 A;  1A63 A;  2KBN A;  3HGB A;  2JA5 H;  1AE2 A;  2WAC A;  3K0X A;  1P16 A;  1EU4 A;  3JAM i;  4B3T Q;  4P75 A;  1EU3 A;  1JE4 A;  5COY A;  3HOZ H;  4MTN A;  4A3F H;  1CSQ A;  4JI2 Q;  4KY6 A;  1TII D;  4DNT B;  4K6D A;  3PV0 A;  4KN7 C;  5FO7 B;  2LFN A;  1B44 D;  1GUS A;  3BDO A;  2NB0 A;  1PMR A;  2RF4 A;  1X3P A;  1I3Q B;  1SMY D;  3DM3 A;  1TVX A;  1VDZ A;  1DCZ A;  2OWO A;  3I91 A;  2PYK A;  2K6A A;  4LF4 L;  3RZO H;  3DXJ C;  2WAQ G;  4H13 C;  2F4V L;  3S17 B;  3NEL A;  5I2X A;  1K83 H;  3DEO A;  2IWH A;  1RTN A;  1V8Q A;  2QEX A;  3DWP A;  3J81 j;  2UUA L;  1EWC A;  1OXX K;  1VQI A;  5ELD A;  3MXG A;  1I4H A;  1RHP A;  2RDH A;  3BJU A;  2ZJP A;  1QUQ A;  1FVI A;  1VMC A;  3NPP A;  4KK7 A;  1TXY A;  2BE5 C;  3HKZ E;  1YI2 A;  4Z9C B;  4KY5 A;  3I4N H;  2FIN B;  2ZXO A;  3E6Z X;  2F0J A;  1WFQ A;  2LXK A;  5NUC A;  4JBK A;  2PMZ E;  4C3I G;  5KYI A;  2JA7 B;  3FKI H;  3CU7 A;  1TWF B;  1K8G A;  2K04 A;  4O1N A;  4LF8 Q;  2VB3 X;  2F0H A;  3OW2 A;  1I6H B;  2PQA B;  3ITP A;  3BVM A;  1W2B A;  4JI0 L;  4QIW E;  3IKJ A;  1SRU A;  4LJZ C;  1STA A;  2JN4 A;  2N49 A;  1H9K A;  3MXP A;  4B3M L;  1VQN A;  4DR3 Q;  2A6H C;  4X3K A;  1BVS A;  2ZT9 C;  4XYO A;  4HSV A;  4IUQ A;  4HJ5 A;  4LF6 L;  1Y69 U;  3TP6 A;  3M4Y A;  5ELF A;  1C4Q A;  4IUP A;  3S1M H;  1OXT A;  3C1E A;  1PA6 A;  1SYE A;  2C35 B;  3LWU A;  3OWF A;  3VA7 A;  4LFB Q;  3I3C A;  3S16 B;  1Y1W B;  1I94 Q;  5IE8 A;  1W3S A;  3HG9 A;  2KHJ A;  1E2Z A;  2J4X A;  1U4M A;  5LMN Q;  3SVM A;  2SEB D;  4XTC S;  2KUM A;  3IFD A;  4K14 A;  3HOW B;  3MEH A;  1G2S A;  4Q0F A;  2NTS A;  2XN9 C;  3FEW X;  4QCL A;  3TRE A;  4IFD I;  4QB4 A;  2FMC A;  4A3I H;  1GUW A;  3K5L A;  4XDX A;  1BUV T;  4JC0 A;  2J0T D;  1C8C A;  1YEZ A;  2MFI A;  2A69 D;  2RBM A;  4JI1 L;  1CK1 A;  1IXR A;  2WV6 D;  2WB1 G;  4IJH A;  2Y0S E;  3BVG A;  1S5E D;  3TP5 A;  2PQE A;  1HQM C;  3ND9 A;  3EQL C;  4EGV A;  2JEA I;  2F3V A;  3CCR A;  1Y8N B;  2XSC A;  1XPO A;  4DV7 L;  2K33 A;  2F0K A;  1U5K A;  4A3M H;  3NQT A;  4NPS A;  4YWM A;  2F0U A;  1O7L A;  2HDL A;  1KC8 C;  2K5N A;  5K5P A;  2B29 A;  4KY7 A;  5ELO A;  1SYB A;  4C3H G;  2E2I H;  2MJ8 A;  4HID A;  4JPB W;  5KNC A;  1BCP B;  4HN7 A;  4PMC A;  1XMQ L;  3BVZ A;  4KHP Q;  2UU9 Q;  2XWJ B; 
#chains in the Genus database with same CATH homology
 4U67 3;  4RCO A;  4OHJ A;  4XQQ A;  4G7O C;  3Q24 A;  3TSS A;  2H1E A;  2B63 B;  1KLU D;  3RLF A;  1STG A;  1EYA A;  2KVM A;  3FRP B;  2F03 A;  2O2L D;  3MC0 B;  2MPM A;  3OWE B;  1Y8P B;  3Q6S A;  4E6I A;  4XQN A;  3PO3 B;  2VUM B;  2VB2 X;  3A56 A;  4KJN A;  1GUO A;  2E2D C;  3Q0A A;  4V19 0;  4IUR A;  2F0P A;  4ABN A;  2D9U A;  1UNS A;  4FYD A;  1Q3L A;  5K36 H;  1Q8I A;  4KHV A;  3D3R A;  2L55 A;  3EA6 A;  1BDO A;  4FXK C;  4L6T B;  2E2H B;  1JQY D;  3MWY W;  3D4D A;  1MSH A;  4K2L A;  2F0T A;  1LV9 A;  3VYU A;  4LMQ D;  1QCB D;  5E3F A;  3URY A;  4XQJ A;  1RF2 D;  1PFM A;  3NK9 A;  5M3F B;  2NWG A;  2VXW A;  3FPP A;  3GTQ B;  5HGT A;  1SYG A;  3L3O C;  4V0B A;  5J1Z A;  1SSO A;  4OIK A;  4KMU C;  2QIL A;  1EEF D;  1B3A A;  4C2M B;  4M8A A;  2OXP A;  5KIX A;  4IFD J;  1RKN A;  5JPN C;  1KNE A;  1JC7 A;  2JP1 A;  1STH A;  4HMI A;  1PTO B;  1LT6 D;  5IGB A;  1HA5 A;  1I4Q A;  2A74 C;  1EFI D;  3GD7 A;  3G7L A;  3HKZ B;  5C44 B;  1D1K A;  3J80 L;  5BN5 A;  2N88 A;  3S9W A;  2PMZ B;  3W2D A;  2F0I A;  3SDZ A;  3U9S A;  4CJ1 B;  5G3L F;  4RKL A;  1SJE D;  2R7Z B;  4QIW B;  1O7Y A;  1EWH A;  3CRL C;  4F88 A;  1KAB A;  1EEI D;  5DM7 3;  1L0Y B;  3NWS A;  2RA4 A;  1TU2 B;  1ZYR C;  1WTV A;  1Z6H A;  3SXH A;  2B39 A;  1EIH A;  2XRQ D;  3J80 E;  1EY7 A;  5EQ0 A;  4C3J B;  2WP8 J;  2JA6 B;  1EY5 A;  5C3E B;  1HCZ A;  5CV6 A;  1LTS D;  2JA8 B;  5C4Z A;  5CV8 A;  3KUP A;  3NTH A;  3NP8 A;  5IGE A;  3X3N A;  2K05 A;  1PRT D;  1K8O A;  2LY7 A;  1ENA A;  4FO2 A;  1VCI A;  5I6W A;  1BCP F;  1D5X C;  4IFD H;  2Q8R E;  4IUN A;  3SEB A;  4KTA A;  1GUT A;  3M7G A;  2PW7 A;  1M8A A;  2Y0S B;  1ML0 D;  2A68 C;  2B2U A;  3AMU A;  4K2K A;  1GHK A;  3TME A;  1S5F D;  1JOR A;  1STN A;  1CTM A;  3KK7 A;  2BDN A;  1YNJ C;  3HZX A;  5EBD A;  2PO4 A;  4A3E B;  1EQT A;  3E0J A;  5FLX L;  1F2Z A;  1A2T A;  1SJH D;  1JCK B;  1QB5 D;  1JB3 A;  4BA1 I;  2R92 B;  3BS1 A;  2PCF B;  2F0M A;  1NR4 A;  1HPC A;  3KLS X;  2A73 B;  5CV7 A;  1CHP D;  1NAP A;  3J7A V;  5FLX E;  3N6R A;  4PMW A;  4DXF A;  1I4P A;  5I4D A;  3ERQ A;  2Z4I A;  5CYU A;  4JBW A;  3R93 A;  4ME5 A;  4TKO B;  1WTQ A;  2CQA A;  4R9W A;  5C5M A;  1BBX C;  3H09 A;  2Q8I B;  2B2V A;  4G4K A;  2F0L A;  2JEB I;  1SND A;  4WFN 3;  4F8M A;  1QG7 A;  2L4N A;  5CBE E;  1X32 A;  2B8G A;  2CW0 D;  4DAV A;  3GV3 A;  1EY0 A;  2C9O A;  2DY7 A;  3D4W A;  5CBA E;  5ISR A;  2QCP X;  3T53 B;  2B2T C;  3K57 A;  3H3V C;  2RKS A;  1CQF A;  5KEE A;  3TDQ A;  1UEA B;  2PW5 A;  1VF5 C;  1PTO C;  4DK1 A;  2B2W C;  1BR9 A;  3GTL B;  2B2T A;  2E2J B;  1T5E A;  4N9P A;  3NUC A;  4FVM A;  4QUF A;  5IOD A;  2FMM A;  4UAI A;  4OL7 A;  2D5D A;  3L7Z C;  2A6H D;  3FPU B;  3HRZ C;  3QOL A;  1ILP A;  2SOB A;  4A3B B;  2F0Q A;  3L9A X;  3U9O A;  3IAY A;  2XRS D;  3QG1 A;  5CR3 A;  1TT2 A;  2K5Q A;  2EOT A;  3OMC A;  1EYD A;  2RDF A;  4UDU C;  4ULL A;  1IHZ A;  1D6E C;  1SNM A;  1CA6 A;  2BCO A;  3C3L A;  2LMC B;  3GTM B;  4G57 A;  2F0D A;  4ZYS A;  1KDB A;  3PO2 B;  1Q1B A;  2O4X A;  2NZ1 D;  4BY1 B;  1S5C D;  1F77 A;  2KEC A;  3D6W A;  4QMG A;  3VR5 A;  3K5M A;  3V2T A;  4B9X A;  2Z1C A;  3DM1 A;  3S14 B;  4QUC A;  5C4X B;  1A3V A;  1IYV A;  4ZUI A;  3VYR A;  3OIP A;  2I46 A;  1SBB B;  5M3M B;  3FVQ A;  2QKI C;  1GOZ A;  1ZXT A;  2HCC A;  2AQ3 B;  3H91 A;  5A2Q L;  1XXG A;  2DNE A;  4FF2 A;  2EDG A;  2JA5 B;  1U4L A;  1D2B A;  2KCN A;  3HOZ B;  5JAV A;  1TY2 A;  2AWN A;  4A3F B;  4ZLT F;  1QNU A;  3OOC A;  1A6X A;  3H94 A;  3BYY B;  5A2Q E;  5D65 A;  4RHS A;  2OF1 A;  3RZO B;  1HUM A;  4DFA A;  3MAQ A;  1TS2 A;  1ILQ A;  1K83 B;  2QDB A;  4XIG S;  5IGG A;  1DOK A;  3MZ5 A;  4DAY A;  5JEA G;  4R8I A;  2L0C A;  3GV6 A;  1S5D D;  4C1N K;  1Q1E A;  3OPO A;  4KHZ A;  2TSS A;  4A3G B;  3I4N B;  4PQX A;  4O42 A;  2L1B A;  1RTO A;  3P7J A;  3FKI B;  1GUG A;  1XYI A;  2EYM A;  5LHY 1;  4IN3 A;  2DN8 A;  2E76 C;  2F0E A;  3MTS A;  3TZU A;  1ROD A;  1H9J A;  2F0F A;  1L0X B;  2E74 C;  1LAC A;  3MFG A;  2KJX A;  1FNU A;  3S1M B;  1Z47 A;  4H44 C;  4FP5 D;  1ET6 A;  4EVO A;  4CHT B;  1EY9 A;  4IQZ A;  1B50 A;  3LX0 A;  1R4Q B;  1EZ8 A;  2WII B;  2AQ2 B;  2V4D A;  4A3I B;  5KNB A;  2FJ2 A;  1BXT A;  5D3I B;  3PUW A;  3Q22 A;  2NUC A;  1VF7 A;  4RAU C;  2Z8L A;  1WCM B;  2EVB A;  2MP1 A;  4EQN A;  1B1Z A;  1PYW D;  3T56 B;  5E4X A;  2R61 A;  1LTT D;  1MD2 D;  4A3M B;  1LT5 D;  1CQV A;  4X3U A;  5T1I A;  4ODG A;  3WOE A;  3K6O A;  3GQB A;  2E2I B;  4F7X A;  3GP7 A;  2XIW A;  5G3L D;  5FO9 B;  3I72 A;  4RGN A;  4CGY B;  5T1G A;  2L11 A;  3T13 A;  4KKU A;  1HQR D;  3BDC A;  4WRD A;  1JOO A;  2RQX A;  3M7N A;  2A68 D;  4ZK9 B;  5A35 A;  1EL0 A;  5ELE A;  4J6H A;  3AB9 A;  4NDX A;  1KDC A;  3H0G B;  1U4R A;  3K5N A;  1SDF A;  4CKB A;  4A3D B;  1E2V A;  3PUY A;  1D1I A;  2N55 A;  1BCP D;  2NVT B;  5C5L A;  3W3A A;  3T4A C;  2A69 C;  3MHB A;  1QE6 A;  1IW7 D;  4RA8 A;  5EGT A;  3VR3 A;  4J1M A;  2ZXP A;  4B9W A;  1I6V C;  1JWU D;  2EE1 A;  3OIQ A;  3RD4 A;  5DNF A;  1RJT A;  4X3T A;  2NVY B;  3K58 A;  4EQP A;  1IKM A;  1F2L A;  1SE4 A;  4FF4 A;  2B8F A;  3SHL A;  3F2U A;  3K0Y A;  3HOY B;  1I50 B;  3P75 A;  5COR A;  5EPJ A;  3QWN A;  1V1O A;  2H4O A;  2AUK A;  1SE3 A;  2HDM A;  2SDF A;  1LT3 D;  2IX1 A;  1F9R A;  3VR2 A;  2IT1 A;  2EPB A;  1SYF A;  2X6L A;  2RSN A;  4MHE A;  2NVQ B;  1XTC D;  4KKS A;  1U9R A;  3FDT A;  1STE A;  2YYZ A;  1DOM A;  5C0X H;  1HHV A;  5CV5 A;  1H9M A;  2WIN B;  3S1R B;  3QIA A;  4B08 A;  1TS4 A;  2EYH A;  2ICE C;  3CRK C;  3HEJ A;  2L5T A;  1G29 1;  1UUP A;  3PUZ A;  2VNU D;  4ZUJ A;  4CBV A;  4A3K B;  1I4R A;  1WTR A;  4M1U B;  1SFO B;  2OT2 A;  3SR1 A;  4RFB A;  2F4I A;  3DUZ A;  1PTO D;  4MIU A;  3QOJ A;  4DU9 A;  1U4P A;  2BOS A;  3NE5 B;  2M9V A;  2F0N A;  3SK8 A;  3J7Y W;  2EJF C;  3VR6 A;  1LT4 D;  3HP3 A;  1TWC B;  1WTX A;  1DYQ A;  3C2P A;  1BF4 A;  3K7A B;  3TBI B;  4IZ8 A;  4RHR A;  3GTK B;  1D5Z C;  4N9T A;  1LTG D;  3BYT B;  3A8K E;  3FMC A;  2IPK D;  2ZXR A;  4F87 A;  3I90 A;  5IGC A;  1I4X A;  5EJW A;  2EYO A;  4K5V A;  2EYF A;  4WJW A;  3O13 A;  4Y7N B;  1CZW A;  4ZRZ A;  1CFM A;  3UI2 A;  1LAB A;  4C56 C;  4HR7 B;  4FXD A;  1PTO F;  3IFT A;  4CJ2 C;  3VYS A;  3I70 A;  2EY6 A;  3S2H B;  2PZW A;  1B2T A;  2E75 C;  2JE6 I;  3OHX C;  2AQ1 B;  4RWS C;  3E5S A;  2O5J C;  2WAQ B;  3KBG A;  5C4H A;  3R8B A;  5DAU A;  1MSG A;  4CKE A;  3VA5 A;  4C1N I;  1PFB A;  2K5W A;  3CQZ B;  3NQI A;  3S15 B;  5JEA H;  2FFK B;  2F0O A;  4CJ0 B;  2SNS A;  5CV4 A;  2KEE A;  3CHB D;  4C3J G;  4Q5V A;  2CVR A;  1TS3 A;  4YIJ A;  2QEJ C;  3TN2 A;  1BNZ A;  5D3D A;  4OO1 G;  3AU7 A;  2JSO A;  4C3I B;  1B9N A;  3J81 L;  1GHJ A;  1JOQ A;  4KV6 A;  5IT9 L;  4TSS A;  2BE5 D;  2OEO A;  5FOB B;  3G6J B;  4H7B A;  5CC4 A;  3K59 A;  1A2U A;  1WVL A;  1Q90 A;  2NN6 G;  2B2W A;  2L9H A;  1QOH A;  1PZI D;  1W6J A;  1RD9 D;  4QF4 A;  1DJR D;  3A54 A;  1OXV A;  2PNR C;  1CM9 A;  3R3O A;  1G6Z A;  1OXU A;  1J8I A;  4K5W A;  3A7A B;  2TMP A;  3J81 E;  2K28 A;  2AWO A;  3R2I A;  4ZKB B;  5IT9 E;  1H9R A;  1XX8 A;  3WDN A;  5C0X G;  4J8Q A;  2MUY A;  3A8J E;  1M4V A;  3EJI A;  5BN4 A;  2WKD A;  2PZT A;  3LWE A;  3NTK A;  5LL6 S;  1SAP A;  3VYT A;  5KGU A;  1ENC A;  4L63 B;  5JPM C;  2WB1 B;  1F9P A;  1PZJ D;  4K8I A;  3GTJ B;  1ZKO A;  4NP5 A;  2O5I C;  3ERO A;  4ID6 A;  3JAM L;  2A6E C;  2EY5 A;  4XYQ A;  4OIJ A;  1NCV A;  2JYO A;  3DWQ A;  1EY4 A;  3KBX A;  1AW7 A;  1F2Y A;  2XVS A;  3VR4 A;  4RGT A;  1EY8 A;  2ID0 A;  4C3H B;  2GA4 B;  2KED A;  1FYC A;  4TRD A;  1HTL D;  2M2L A;  1II3 A;  3S1N B;  3MFY A;  3Q23 A;  1F2M A;  3NTI A;  5EKK A;  2EYL A;  1DON A;  4TQU S;  2RVL A;  5I6Y A;  1DD2 A;  4HTH A;  2PZU A;  3JAM E;  3D4R A;  3EVQ A;  2QF7 A;  5KRU A;  2K1B A;  3KF8 A;  4FXG C;  3J7A F;  3MXU A;  3QJY A;  4P2C B;  3A55 A;  5EPK A;  1IL8 A;  2CW0 C;  3NXW A;  5I2Y A;  4FF1 A;  3M4O B;  3QB3 A;  3N52 A;  2EYJ A;  1V43 A;  1A3U A;  3NHH A;  3I8Z A;  3M3Y B;  1EY6 A;  2DY8 A;  4OO1 I;  1J9O A;  2KA7 A;  2EJG C;  1RDP D;  1NUC A;  1FNV A;  1EZ6 A;  4I65 A;  1F9Q A;  2NBF A;  1BO0 A;  1KNA A;  1SEB D;  2M00 A;  5C3X A;  1D5M C;  1TWA B;  3MA2 B;  2KQ3 A;  1SYC A;  3C46 A;  2NN6 I;  2MGS A;  5I9O A;  2NTT A;  2JXM B;  5EKL A;  1AZQ A;  4G7Z C;  1ONL A;  2ENB A;  5JVG 3;  1KTK A;  1LO5 D;  1UAP A;  1TWH B;  3CKI B;  2EYP A;  1EYC A;  1QJO A;  5C0X I;  4IUV A;  4WOR A;  1ET9 A;  2WKC A;  1S4Z A;  4LK1 C;  2FHT A;  4PNY A;  1TY0 A;  4BS9 A;  1YNN C;  4DA2 A;  1CI3 M;  5EPL A;  3I4L A;  3SK6 A;  1G2T A;  4A93 B;  2J7Z A;  1Q12 A;  4PV1 C;  5I9P A;  3QO2 A;  4PMB A;  1DOL A;  1SYD A;  1LTB D;  3S1Q B;  3H6M A;  1CZG A;  5IGF A;  1NSN S;  2G9D A;  4I7Z C;  1Z7T A;  5CV9 A;  3V05 A;  4LAA A;  1ESR A;  5M5X B;  1JWM D;  2K03 A;  1SMY C;  4DN4 M;  1SNC A;  1ZYR D;  4HED A;  4RGO S;  3HOX B;  1STY A;  2KHS A;  2F3W A;  2SNM A;  1OO9 B;  1A15 A;  2MHV A;  4DAP A;  1CT1 D;  2IL8 A;  2NYZ D;  3ZYY X;  2EXZ A;  1JR0 D;  5C4J B;  1MI2 A;  5ELB A;  1K8M A;  3ONA B;  3PUV A;  4IUT A;  1ESF A;  1WTO A;  2EZV A;  4DF7 A;  1GJX A;  3A7L A;  4ZAI A;  2X6G A;  5FKA C;  4ZKC B;  5FO8 B;  1TQO A;  5C3W A;  2IX3 A;  1T5X D;  3EFX D;  1S5B D;  1DM0 B;  3DWA A;  3C1F A;  1AZP A;  5HUR A;  1PFN A;  4U68 A;  1IYU A;  1HTP A;  4KKT A;  1E2W A;  1PTO H;  1LTA D;  1PDQ A;  4KD3 A;  1V1P B;  1KAA A;  2DNC A;  2EY2 A;  4AYB B;  1WTP A;  4KJO A;  1PRT B;  4BA2 I;  5JJZ A;  1ICW A;  1LTI D;  4BBS B;  4NMZ A;  1YNJ D;  5C0X J;  3HS0 C;  1PXU A;  5KYL A;  1FD7 D;  1EIG A;  4K8J A;  1MBY A;  4XT3 B;  1WD0 A;  1JIC A;  2Q8T A;  1KDA A;  2L12 A;  4FNF A;  2F0W A;  3KLS A;  3DEP A;  1TWG B;  4DNR B;  3BG3 A;  3NBH A;  3RMH A;  2B2Y C;  1PZK D;  1GXD C;  5BN3 A;  4OO1 H;  3I4M B;  1CA5 A;  4HSP A;  5TSS A;  4XXE A;  1SNP A;  1SNQ A;  1O78 A;  2CHB D;  4L8J A;  2B2Y A;  4K6L A;  2EY1 A;  4OGQ C;  4GZY C;  4CKC A;  5CGK A;  2K5D A;  1F9S A;  3GTP B;  3D6C A;  1C48 A;  3DMU A;  1AFP A;  1H9S B;  3NWT A;  1HA6 A;  2LKV A;  3ND8 A;  3RUZ A;  2NN6 H;  2F1M A;  3HOV B;  2NVX B;  1LTR D;  3K5O A;  1G8Z D;  4KI0 A;  1TKW B;  3MVV A;  1X3Q A;  2F0G A;  3I73 A;  4DGZ A;  1G91 A;  5E1F A;  3S2D B;  4H0L C;  2HUG A;  3KLR A;  5IGD A;  2C5C A;  3WOF A;  4HCS A;  1B53 A;  3D31 A;  5FK9 C;  2F0V A;  5J39 A;  4HAE A;  5DM6 3;  1HRJ A;  4RKB A;  5E4W C;  1CHQ D;  1HUN A;  4RGM A;  1SXT A;  1AN8 A;  1Y1V B;  1E0B A;  1LLR D;  1JOK A;  2Z4H A;  2A5H A;  1QWY A;  2B2U C;  5ELC A;  1HXY D;  3HOU B;  1WTW A;  1XWE A;  1O80 A;  4ZQ3 A;  5JEA J;  5KND A;  3OSO A;  2R3Z A;  4A3J B;  2G9H D;  3TZD A;  2BDO A;  4RH6 A;  3T51 B;  3P20 A;  2D62 A;  4DXG A;  1NR2 A;  2X69 A;  3D8G A;  2XWB B;  5LL6 X;  1EOT A;  1QNK A;  1BCP C;  3V96 A;  1FR3 A;  4K5X A;  3M85 A;  3PUX A;  3BDL A;  4ILW A;  1PRT F;  2K7V A;  3SE0 A;  4IAL A;  1RCV D;  1IW7 C;  4BWG B;  3IL8 A;  2KOL A;  1W6K A;  3PMF A;  5K36 G;  5IOC A;  1AP0 A;  1FGB D;  1R4P B;  2A6E D;  1ZEQ X;  1SNO A;  4XT1 B;  5C6A A;  1R9T B;  5EKI A;  4MN3 A;  2BA0 A;  3TP8 A;  4KD4 A;  1B9M A;  1BQQ T;  2R6G A;  2AUJ D;  5D14 A;  1MGS A;  4NW2 A;  2B2V C;  1PLF A;  3T16 A;  2HQE A;  5JOB A;  4HCE A;  4IUU A;  2YU9 B;  5JVH 3;  1PRT C;  5M5W B;  1A3T A;  1V1P A;  3P1H A;  4HMJ A;  1GUN A;  5M5Y B;  2HCI A;  4EQO A;  4DK0 A;  3A8I E;  3RZD B;  3OMG A;  4RCN A;  2RDG A;  2F0S A;  1DZ1 A;  1OXS C;  4G7H C;  2PPB C;  1HFN A;  1O7Z A;  3BZD B;  3SK5 A;  5AFW A;  1Y8O B;  3GO5 A;  5DEH A;  4NKL A;  2KCC A;  2XNA C;  4S3S A;  2IW3 A;  5IIF A;  4BY7 B;  2BA1 A;  1TS5 A;  1TR5 A;  2K01 A;  4KN4 C;  1VMP A;  1B4O A;  1FNW A;  4X3S A;  3PIO 3;  1JWS D;  1HFG A;  3GTO B;  3PIP 3;  5J22 A;  2EJM A;  3NBI A;  3TP7 A;  1AEX A;  3SK4 A;  1KLG D;  1SE2 A;  2RSO A;  2IJ0 A;  1DXM A;  2ICI A;  2IX0 A;  1H9S A;  1EQV A;  3DHQ A;  3OW7 A;  5M9O A;  4IFD G;  4FF3 A;  5EBC A;  1I4G A;  1ENF A;  5F2D A;  1IKL A;  2I07 B;  5CMD A;  1STB A;  2LS0 1;  3LNN A;  1YNN D;  4JK1 C;  3NSW A;  3X3M A;  4BBR B;  2R93 B;  3MXN A;  1WD1 A;  3R2T A;  4R8N A;  2D2C C;  1QIL A;  3GTG B;  1BOS A;  2K32 A;  3HGB A;  2WAC A;  1EU4 A;  1EU3 A;  1JE4 A;  5COY A;  4KY6 A;  1TII D;  4DNT B;  4K6D A;  3PV0 A;  4KN7 C;  5FO7 B;  2LFN A;  1B44 D;  1GUS A;  3BDO A;  2NB0 A;  1PMR A;  1X3P A;  1I3Q B;  1SMY D;  1TVX A;  1VDZ A;  1DCZ A;  3I91 A;  2PYK A;  2K6A A;  3DXJ C;  4H13 C;  3S17 B;  5I2X A;  3DEO A;  2IWH A;  1RTN A;  1V8Q A;  3DWP A;  1EWC A;  1OXX K;  5ELD A;  3MXG A;  1I4H A;  1RHP A;  2RDH A;  3NPP A;  1VMC A;  4KK7 A;  2BE5 C;  4Z9C B;  4KY5 A;  2FIN B;  2ZXO A;  2F0J A;  3E6Z X;  5NUC A;  4C3I G;  5KYI A;  2JA7 B;  3CU7 A;  1TWF B;  2K04 A;  4O1N A;  2VB3 X;  2F0H A;  1I6H B;  3ITP A;  3BVM A;  3IKJ A;  4LJZ C;  1STA A;  1H9K A;  3MXP A;  2A6H C;  4X3K A;  2ZT9 C;  4XYO A;  4HSV A;  4IUQ A;  1Y69 U;  3TP6 A;  3M4Y A;  5ELF A;  1C4Q A;  4IUP A;  1OXT A;  3C1E A;  1SYE A;  3LWU A;  3OWF A;  3VA7 A;  3I3C A;  3S16 B;  1Y1W B;  3HG9 A;  1E2Z A;  2J4X A;  1U4M A;  3SVM A;  2SEB D;  4XTC S;  2KUM A;  3IFD A;  4K14 A;  3HOW B;  3MEH A;  1G2S A;  4Q0F A;  2NTS A;  2XN9 C;  3FEW X;  4QCL A;  4IFD I;  4QB4 A;  2FMC A;  1GUW A;  3K5L A;  4XDX A;  1BUV T;  2J0T D;  1C8C A;  2A69 D;  2RBM A;  1CK1 A;  2WV6 D;  3BVG A;  1S5E D;  3TP5 A;  2PQE A;  1HQM C;  3ND9 A;  3EQL C;  4EGV A;  2JEA I;  2F3V A;  1Y8N B;  2XSC A;  2K33 A;  2F0K A;  3NQT A;  2F0U A;  1O7L A;  2HDL A;  5K5P A;  4KY7 A;  1SYB A;  4C3H G;  2MJ8 A;  5KNC A;  1BCP B;  4HN7 A;  4PMC A;  3BVZ A;  2XWJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...