2K5QA

Nmr solution structure of membrane associated protein from bacillus cereus: northeast structural genomics consortium target: bcr97a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
105
structure length
105
Chain Sequence
MDLNRMGKDEYYVQITVDGKEVHSKADNGQKYKDYEYKLTGFDKDGKEKELEFTAQKNLRKEAFLRVYHSDKKGVSAWEEVKKDELPAKVKEKLGVKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical Membrane Associated Protein BcR97A
publication title NMR solution Structure of Membrane associated protein from Bacillus cereus: Northeast Structural Genomics Consortium Target: BcR97A
rcsb
source organism Bacillus cereus atcc 14579
molecule tags Membrane protein
total genus 14
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06486 DUF1093 Protein of unknown function (DUF1093)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.480 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k5qA00
3NPPA 2K5WA 2K5QA
chains in the Genus database with same CATH superfamily
3VYRA 2MO0A 3CPFA 5IYCH 5JJZA 3CC2A 4LF8Q 1RJTA 1X9NA 3S15B 4JI7L 3A8IE 2EYPA 3K0XA 4A3KG 5K5PA 3NWTA 1PVOA 1GUSA 4HMIA 2MHVA 3OPOA 1CKMA 3ULPA 3ULJA 3JAML 4U673 2MO1A 5JAVA 3CQZH 3LWUA 3NELA 1WTPA 3NPPA 4RGTA 2FMCA 3K57A 5JJLA 4JOIA 4JI7Q 1S72A 2BH8A 1NMFA 1SMYD 5C3EH 2VB2X 1F9RA 3DWPA 2BA0A 3BDCA 2IX3A 2B39A 4TSSA 1GUTA 4LF5L 1PH5A 2HT1A 3AQQA 1H9RA 1ZXTA 2RCFA 3EA6A 3STBD 1PFSA 4K14A 3PIOA 3BZCA 2M9VA 1SYBA 3MEFA 3AMUA 1PFNA 4DAYA 3D0FA 1PLFA 2LMCB 1GOZA 2WAQG 5BR8L 5CBEE 4DR6L 1FNWA 1VDZA 5G3LD 1Y1VB 1HNZQ 2WB1E 2XGTA 1H9MA 5JJIA 1J5EQ 1UNSA 2JP1A 2UXDL 4YCWA 2BOSA 1PRTF 4DK1A 4LMQD 2CW0D 1S5CD 3A5ZB 1J9OA 1F2MA 4YIJA 3QO2A 3SE0A 1K8MA 2EZVA 5BR8Q 3HKZE 1LTRD 4DNRB 3VYUA 1VQFA 3QG1A 4BY1B 4DAMA 3G6JB 2B2TA 5FJ8G 1Y1WB 3OW2A 4HJ8A 2VB3X 2UXDQ 1L0YB 3WOFA 4Q0FA 4DR2Q 1HPCA 2ATWA 1XNQL 2XWBB 4C3JH 2L1BA 5HGQA 1X3GA 4A93G 2RSNA 1SMXA 3GV3A 3RLFA 4BWGB 4IOCA 2KCNA 2ZM6L 4LFBL 4YWKA 3W3AA 4DU9A 1GUNA 2WV6D 1YHBA 3CC7A 3HOXH 5CC4A 2A6HD 5IGEA 3G71A 2E2HB 2L12A 4RKLA 1PDQA 2D62A 3S2DH 1E2WA 2XSCA 4JI5Q 4ZKBB 4QUFA 2E5LQ 3GQBA 4P74A 5J1ZA 3U9OA 3U58A 2AUKA 2R92H 3KLRA 2ZM6Q 1X32A 4LFBQ 2L11A 5IE8A 1SE2A 2E2IB 4IFDG 2MUYA 1PTOC 3A5UA 1K73C 5ELNA 4HN7A 3UDGA 4BBRG 1KNAA 2D0OA 4B08A 1E0BA 4EQOA 1B3QA 4RMFA 1SBBB 4C3IG 1Q8IA 1EYGA 4OX9L 2KENA 4C3HB 2KVMA 3DHQA 1WTWA 3FHWA 3A8KE 4DR4L 5JPMC 2EYHA 4LF7L 1EZ6A 1MBYA 1Q1EA 1S5BD 1EY5A 4UP9A 1BDOA 1GUOA 1B53A 4JBMA 1D1KA 3KBXA 2F0FA 1TWAB 1GO3E 1MKHA 3E3XA 3C2PA 2QEXA 4A3DG 4I7AA 2BA1A 4NW2A 4FNFA 4CHTB 1S4ZA 1D1IA 1JB3A 3UE0A 4DR4Q 4X3SA 2VUMG 4DKAC 2CKZB 4QGUA 3S17B 2WFWA 4ZLTF 2KOLA 2LY7A 3KDFB 5JEAJ 2K1BA 3VR2A 2PZWA 4DPGA 1VMPA 5M5XB 1KQSA 2RHQB 3ICEA 3S2HH 2F3VA 4N8FA 4KY6A 1L1OC 1QILA 3HG9A 2EXZA 1B70B 1UWVA 2JA5G 3K80C 1VQBA 2L5TA 1BKBA 1K83H 1B8AA 2PO4A 1D6EC 1EQVA 2IJ0A 2AMCB 1RCVD 2JSOA 1U0LA 1CT1D 2Z1CA 3GTPH 4EQ5A 2F0NA 3GD7A 2A68C 4KY5A 3HOVH 1YBYA 4R4CA 1PMRA 3S1RB 3PMFA 2MFIA 4XQQA 4JI1L 3ERQA 4IZ8A 3M3YB 1LTID 4JI2Q 3AFPA 4KI0A 1H9JA 5C5MA 1HCZA 1YHAA 4A93H 4RKBA 3GTKH 1ENFA 1FGBD 2B2YA 2HIXA 1CA5A 4IPDA 2H5XA 2NTTA 1OXVA 4F87A 2EIFA 2E75C 2KCMA 5KGUA 1IL8A 2R93G 1LT3D 2AQ2B 4AYBE 2NVYB 4JI1Q 4POGA 2F0GA 2DJFC 3P7JA 1QZHA 1Y8NB 2HHHQ 2CCZA 1IYUA 1JB7A 3QOLA 3Q24A 1BOSA 3Q6SA 2BDOA 4FF1A 4B3SQ 2R61A 1SE3A 2L55A 2FMMA 3CD6A 1D2BA 1CHQD 4JYAL 1QZGA 1ESFA 1STYA 4A3MH 3M4QA 1GM5A 2UUAL 5EJWA 1HZCA 4F8MA 3V05A 1KRTA 1JWSD 1YNJC 3BYTB 4X64L 1F9PA 5LL6S 3Q22A 3CHBD 4Y7NB 4RGMA 1C9OA 4PG3A 4A76A 3T1HL 2EPBA 3CC4A 3BYYB 1GD7A 1KLUD 3HOUG 2UUAQ 3HOWH 3M4PA 1ILPA 1ET9A 3CAMA 4L8JA 5HY6A 3VR3A 1BCPF 1YJ9A 2ASBA 3D6WA 1QUQB 4Q5VA 1I3QB 1QVGA 2JJQA 1JE4A 1O7LA 3ULLA 2DY8A 4DR3L 2F0MA 3T1HQ 4DR5Q 3FDTA 3J80L 1Y8OB 1R4PB 2LSSA 2EYMA 1YNXA 2KQ3A 1XPOA 2D9UA 4EQPA 1EQQA 1SRUA 1I5FA 1X3EA 1TWGH 3H3VH 3RN2A 3DLLA 4QJFA 5IGDA 1DD2A 2J4XA 3C3LA 2EOTA 3CCEA 2JA5H 1JWMD 2VNUD 1ONLA 5GADC 4AH6A 4OO1H 2EE1A 5I6WA 4RH6A 4XIGS 4L5QA 1I4XA 4DR3Q 3KBGA 3TRZA 1E1OA 1KDCA 2A69C 4OHJA 4A3IB 3I72A 3TZUA 3C46A 1DYQA 1B9MA 2K01A 3ZJYC 1A8VA 3CCUA 3I4NH 3P75A 3MTSA 3UI2A 2JA7B 5M3FG 1NBWA 2FINB 4K2LA 4K8JA 2E76C 4NDXA 3PGZA 1EY8A 5IGCA 2LS01 2F0UA 5IY0A 2TSSA 4GOPC 5AFWA 5GAHC 4XT3B 3RNUA 3DXJC 1SE8A 2SOBA 5ELBA 2ZJRA 2EQSA 4GN5A 1A62A 1ZYRD 3BZKA 3PO2B 1YNNC 3NTIA 3VA7A 2AHOB 2K33A 4L5SA 2F1MA 1QNKA 5G3LF 4GZYC 3IKJA 1KIXA 4A3CH 5M3MH 4IUVA 1LABA 1X54A 4LUOA 2Y0SB 1ASZA 2K5DA 1FR3A 1IL2A 2RBMA 4RA8A 3EVQA 2KEDA 1OTCA 2SEBD 2I5LX 1QVFA 1C4QA 1F9QA 2GA4B 3I4MH 2JEAI 4ID6A 1S5DD 2JN4A 4TQUS 1ET6A 4KN7C 5C4XG 3WWVA 5BN5A 1WCMH 3G7LA 1G6PA 1IW7D 2VY3A 2WP8J 2F4VQ 3S15H 1CK1A 1CI3M 3EIVA 3BU2A 2Q2IA 3D3RA 2F0LA 5FO7B 2B2WA 1JOQA 3NTHA 4DUYL 4FXGC 1VQGA 5JVH3 4YY3Q 1IZ6A 3EBEA 1JC7A 2K5NA 2VQFL 5A35A 2EYFA 3RUZA 1RHPA 5IP7G 2F3IA 1O7YA 3PO3B 1S5FD 2V1CC 3K6OA 1IHZA 2HUGA 2JYOA 1A3TA 5FLMH 2YTYA 1W6JA 5BN4A 4YHHL 4ME3A 1DOKA 1CQFA 2PCFB 1PA6A 1SN8A 3L0OA 5IT9E 2F0PA 5ELCA 4HCEA 3NHHA 3CCLA 3SVMA 4OGQC 3VA5A 1CUKA 5IYCG 3OOCA 4ME5A 1EYDA 3MXGA 3DUZA 4OEMB 5I2XA 2KHIA 1DJRD 1NNXA 3BS1A 3TSSA 1Y1VH 3E9HA 1N9WA 1MJEA 3V96A 1BCPB 3GTQB 1D7QA 4A4IA 3K5MA 2PW7A 2K14A 4K0KL 3CKIB 1A63A 2ZTEA 1EFID 5EPKA 2G9DA 4KKUA 3K7AB 4C2MB 1QE6A 2IPKD 1WTVA 1AZPA 3BDLA 4G7OC 1A2UA 4G7HC 1VQOA 2E8GA 3S1NB 5A2QL 1FD7D 2Q8RE 4BY1H 1HR0L 3NUCA 5C3EG 4RHRA 2WB1B 3D4RA 1CSPA 4ZQ3A 1Y1WH 1HZAA 2WIIB 4QCLA 4PNYA 1L0WA 2N3SA 3RZDH 4K0KQ 1TT2A 1SDFA 5LL6X 5C44B 2KEEA 5K36H 4C56C 3HKZB 2A69D 5IWAQ 4RCNA 1DGSA 4JBKA 5KNCA 2AQ1B 4LJZC 2RF4A 3CCJA 1HR0Q 3BVZA 1S5ED 5D65A 2QA4A 1CKOA 3F2BA 4J6HA 3H3VI 1XX8A 2D2CC 1Z6HA 4UP7A 3DM1A 5C6AA 1JOKA 4RGNA 3EJIA 4YCUA 1PH1A 2B2UC 3DM3A 1DONA 1VQNA 1K3RA 4JI8L 2VXWA 2X6LA 2Q8TA 2ZXRA 4A3FB 3T51B 4M1UB 5EBDA 1PYWD 3FMCA 2SNSA 1UE7A 1E2VA 4H02A 1YJNA 1TU2B 3URYA 2L9HA 4C3HH 4DK3C 4C3JG 1EEID 1X65A 1EIFA 3Q0AA 4DF7A 4DXFA 5C3WA 4DV2L 3J80c 2G5DA 1MIUA 4LF8L 4KD4A 3TQYA 4HCSA 1SNPA 4DAVA 5E4WC 1TWAH 1MD2D 3I55A 1EY0A 1FJGQ 3D4DA 1IKLA 1I50B 3R93A 1BCPD 1SNQA 3W2DA 4RGOS 4N9TA 1D5XC 1G2SA 2R92G 4DV2Q 2MJ8A 3FEWX 2IL8A 1W2BA 4XT1B 4X62L 2AQ3B 4WRDA 3S17H 3PF4A 2IY5B 3TMEA 2D0PA 4ZYSA 3GTLB 2UUCQ 1EFWA 5M5XH 2M2LA 5EKIA 4GNXA 3Q23A 2LKVA 2YU9B 1HHVA 1NJIC 3NQIA 2B8FA 4BBSB 4KKSA 4XQNA 4DR1Q 1F9SA 1SNDA 3KF6A 4ODGA 5D3IB 1C8CA 3PV0A 1LTLA 4X62Q 5KEEA 4Z9CB 3GDEA 5IYBH 3PUYA 3R3OA 1GXDC 1B7YB 1PTOF 2C35B 4QQBX 2BE5D 1HNZL 1CKNA 5M9OA 3S1RH 2KECA 1XMQL 4NMZA 1J5EL 3M3YH 4HJ9A 3W1GA 4HJ5A 3S1MB 1MSHA 3C1FA 5CV9A 2V4DA 4R9WA 2Q2HA 1Y8PB 1UUPA 1HR0W 3CCVA 4GS3A 2EXDA 4GNXB 1XNRL 5IT9c 4R8NA 1CHPD 1KHIA 2NVYH 3OIPA 3KF6B 1XMQQ 1BBXC 4JV5L 4OWXB 3U50C 3B6YA 1SJHD 4DR2L 2LXKA 1M1KC 3KLSX 2EVBA 3ERSX 2NVQB 2BDNA 1AP0A 3OMGA 2EJFC 1WOCA 3J81c 2UXBL 3HOZB 4X3TA 2K5QA 1HH2P 1CKNB 1XNRQ 1ENAA 4MTKA 1XMOQ 1XTDA 4MHEA 4NXML 4NXNQ 4R1JA 2JA8B 4AYBB 4CDCC 3HOVG 2EDGA 1FNVA 3RZOB 4JV5Q 2I46A 4A3BB 4JI5L 3K7UC 4KY7A 4A3GB 1T5XD 2E5LL 3A55A 3SGIA 4K6DA 1SE4A 4DAYB 1PYBA 3JAMi 2UXBQ 4BA1I 4UAIA 1R9TB 1H9SA 4KJOA 4Y7NH 3CPWA 5M5YB 4NB3A 1XPRA 5J39A 2JA6B 5AJ3Q 4X65Q 4PZ7A 4NXMQ 5FKAC 4B3RQ 2LFNA 4KHPL 2VL6A 3VDYA 1Q46A 3GTMB 4Y52H 1EZ8A 1P16A 1WYDA 1IYJB 3X3NA 1BR9A 2O2LD 2NZ1D 4QL5A 2A19A 1I3QH 1LO5D 3H0GB 2NB0A 4A3JG 1PH6A 3I70A 2XTIA 4JPBW 1IBLL 4KHPQ 4A3MG 3MC0B 1KXLA 1HZBA 1UE6A 3EROA 4XYQA 1R4QB 1EL0A 3DMUA 1VQLA 2RDGA 1E1TA 2X69A 3NP8A 4ZRZA 1H9SB 1V8QA 2WKDA 2KBNA 5ELEA 1B4OA 2ENBA 1N32L 4O1NA 4CGYB 4XQJA 4A3IH 2Z6KA 1I4RA 1AN8A 3NEMA 3OW7A 2DJGC 2K52A 1WTRA 1UEBA 1IBLQ 1EIHA 5JEAH 2PPBC 4HTHA 2YTXA 1Z9FA 4GLXA 4PZ8A 2O5IC 3HOWG 4J8QA 5GAEC 2F03A 4JI4Q 2ZTDA 1XPUA 4BA2I 3A56A 5I4DA 3TREA 1NAPA 1VCIA 2L15A 2DNEA 1SYEA 3CCSA 5L37A 1N34Q 1N32Q 1RTOA 2XRSD 1TKWB 3M7NA 1SFOB 2HCCA 1A3UA 4QMGA 4UHVA 2WB1G 1AFPA 1KC8C 2PI2A 3PO2H 3FRPB 1G51A 5CR3A 1NE3A 1NY4A 4AQYL 1PRTC 1YJWA 5FLXE 1JWUD 1WJJA 5CORA 4PV1C 1NUCA 1X56A 4F7XA 4JI2L 1PHJA 2XIWA 2PNHA 1PTOB 4HMJA 2QKIC 5IGGA 2CQAA 4V190 4OO1G 2IX1A 3T1YQ 3IRBA 1HNWL 1A15A 3AYHB 1K8GA 4CDDC 3S1QB 3H6MA 4CDFC 2BCOA 5IIFA 3I4NG 3IAYA 3T53B 1K8OA 4AQYQ 4HIOA 1Q12A 3R8BA 2B63B 2R7ZB 1NR2A 1D8LA 2K04A 3OMCA 3ZYYX 4HIKA 3SK6A 1L1OA 2HHHL 1O80A 1PH7A 3P20A 5EPLA 4KV6A 3A0JA 4ILWA 2NTSA 1LT5D 1HNWQ 4H0LC 1U4PA 1YIJA 1TQOA 3D8GA 2UUBL 4B3SL 2G9HD 1U4MA 2KJXA 2K03A 3K81C 1IBML 4P71A 2EYOA 5TSSA 4ZK9B 5CV6A 5I6YA 2O5JC 3BVGA 3TP5A 4A3CG 4FYDA 5M3MG 3OSOA 4X66Q 2VQEL 3GP7A 3HOYB 3KJPA 2HCIA 4H44C 3IL8A 4A3EB 4LFCQ 3PO3H 4X3KA 4WJ4A 1OXSC 2UUBQ 3K59A 1IBMQ 4A3JH 2DNCA 1VQPA 4FO2A 5E4XA 1O7ZA 3EN2A 3AFQA 3I4MG 3SK8A 4CJ1B 1HNXQ 4BS9A 1G6ZA 1KDBA 2I5HA 3T16A 1FL0A 4KN4C 5C4HA 1WCMG 2OWOA 1Q8KA 2VQEQ 1I6VC 1GKHA 5JPNC 3K0YA 4TRDA 3T4AC 1S40A 1M4VA 2ES2A 1JJGA 3V2TA 2KHJA 1KL9A 3PIP3 4DR5L 3A74A 4DAPA 1K3BC 2PW5A 2XWJB 1KABA 2OEOA 5CBAE 2R6GA 2ALYB 3GTQH 4APVA 3J7AV 3BJUA 2MPMA 1LYLA 1LTBD 4QIWB 4EVOA 4EX5A 1AH9A 2OTJA 4G57A 3MWYW 1BQQT 3K7AH 4C2MH 3CXCA 4BXXH 1JR0D 3TZDA 1HUMA 2J0TD 3S1NH 1PTOD 2GVAA 4P72A 1PZJD 5GROA 1F77A 5J22A 4IFDJ 2F0VA 4IJLA 5CV4A 5FLMG 2A6EC 3UDIA 4CJ2C 2HDLA 2K4KA 3SEBA 4FF3A 2P5ZX 3I7FA 4FXKC 2D5DA 4DV1L 2RDFA 1ZKOA 3L3OC 2N88A 3FKIB 1JCKB 5C44H 4QY7A 2MGSA 4OONA 1HFGA 2N8NA 4L5TA 5FO8B 3RMHA 2IX0A 3J7YW 3M85A 1GUWA 3OWFA 2NN6I 1I4PA 1Y1VG 3N52A 1G8ZD 4A3KB 4X3UA 1W3SA 3M7GA 1QB5D 1K0SA 3CP0A 3KFUA 4DV1Q 3OIQA 4FF4A 1W6KA 1VMCA 2KHSA 1P8LA 3I91A 4K6LA 1Y69U 3HOZG 3VYSA 1JICA 4A3FH 1EWCA 3GTJB 2ICEC 1KLGD 1TS3A 1TVXA 2C5CA 3FP9A 1IXRA 4BY1G 2PMZE 1RD9D 1Y1WG 3MFYA 1BBWA 2R3ZA 4ZUIA 2MP1A 3SR1A 4HJAA 4CDEC 1VQ4A 1DXMA 2BH2A 2N49A 3VR6A 3RN5A 4M8AA 1J8IA 4LF6L 1V43A 2KCCA 1SSOA 4GOPA 5K36G 2NVXB 1SAPA 2F4VL 2OF1A 2PI2E 3M9BA 4DK0A 5FLXc 4A75A 2A68D 4JI3L 1ESRA 5LMNQ 1I50H 2CWAA 2HD3A 3J80i 1N33L 1ICWA 4YY3L 5C4JB 4NKLA 2OQKA 5IT9L 1ILQA 4LF6Q 1SEBD 3D4WA 4IUTA 4LK1C 3MXUA 1RIPA 4R4QA 1K83B 3GV6A 4DFAA 1LT6D 2JEBI 3NE5B 3J81L 1Q7YC 3GTLH 2JQOA 4JI3Q 4LNQA 4TKOB 1CZWA 1N33Q 4DV5L 2F3WA 3SXHA 3O13A 1WFQA 4C3HG 2YU9H 4POFA 4BBSH 4GOPB 4GLVB 2EY1A 1TXYA 3HEJA 3S24A 3TS0A 4KLKA 3W5OA 4S3SA 1VQ9A 1B9NA 4U68A 3I90A 1QWYA 1YI2A 3EQLC 5EPJA 4DV5Q 2PZUA 5KYIA 2H1EA 4DNIA 3LX0A 3D6CA 3KLSA 1YNJD 1I94L 4WFN3 4B3TL 3K5NA 4QIWE 3S1MH 4KMUC 3H3VC 1U4LA 4DK6C 4B9WA 3GTGB 1FGUA 1L0XB 1WI5A 1ICFB 4L63B 4PMBA 5IGBA 1LTGD 1J6QA 3F2DA 2ID0A 3F2CA 4HR7B 2RQXA 5CV5A 2IT1A 4BBRB 1TY0A 2IHEA 4C3IB 3OYYA 4CKEA 3S14B 1I94Q 1Q1BA 4B3TQ 2UXCQ 3KLWA 2AUJD 2NVQH 4IPHA 5FOBB 2Z6BA 3TN2A 3DEOA 3STBC 1DZ1A 3K8AA 3HOZH 1CM9A 4N8X1 2JA9A 2YTVA 3NK9A 1EQRA 2RA4A 4HAEA 5IYBG 1VQKA 4IFDI 4BY7B 4H13C 1PFBA 2CVRA 4OWTB 5IWAL 2M00A 2B2VC 2I0QA 2NUCA 2JA8H 4JI6Q 2F0IA 2L4NA 3J81i 1AEXA 4G4KA 3RZOH 4A3BH 1I4QA 2R7ZG 3AB9A 2JK8A 4JBJA 5KIXA 1EUJA 4A3GH 4A3DB 1BUVT 3S16B 1QJOA 4LUZA 3PQIA 3LNNA 1UAPA 1V1PA 2B8GA 2DN8A 2EJGC 4RWSC 2CW0C 1R9TH 5M5YH 2VUMB 1UE5A 2F0KA 4I65A 1VQAA 3MAQA 2JA6H 4OL7A 3KF8A 4L5RC 1HZ9A 2E2HH 5LMNW 2Z9HA 2F4IA 3IFDA 3GTMH 3NBHA 5C0XJ 1YZ6A 2Z8LA 4KHVA 1Q82C 3PSIA 4B9XA 3CRKC 1PH3A 3I56A 1I6HB 1EY4A 1WTQA 1STEA 2JA5B 2NVTB 1M8AA 4JG2A 5GQOA 4DUZQ 1OXTA 3H0GH 3ND8A 2E2IH 1Q86C 2ZJQA 1JE5A 1YNND 2DGYA 1YEZA 4GN4B 2WAQE 2A6HC 2VS1A 1FJGL 5GAGC 1JOOA 1E24A 1STBA 1TWHB 1VS0A 3KK7A 2E2DC 1V1PB 5M5WB 3SK5A 4B3ML 1I4HA 1WD1A 3HZXA 2QCPX 3H09A 3HFZB 2EY5A 1U9RA 3KF8B 1SNOA 1STAA 1IYVA 3Q8DA 4F88A 3FVQA 3JC66 1OO9B 4K2KA 3OWEB 1EY7A 3TEHB 3NBHB 1SR3A 1BF4A 2UUCL 1LACA 3RD4A 4IN3A 4KKTA 2R93B 4DV4L 1VQDA 2K50A 4HEDA 4B3MQ 1B44D 3WOEA 5FO9B 3BZDB 1EIGA 1KDAA 4EGVA 1JORA 1LUZA 4DR1L 3TS2A 4H7BA 4TVAB 5EQ0A 1EYCA 2J7ZA 1EOTA 2C9OA 3E0JA 2MNAA 1SFOH 1C7YA 4C1NI 3MEHA 2YV5A 4R4TA 1EU4A 1PH8A 3CU7A 3DEPA 2H4OA 2JXMB 4FVMA 4DV4Q 2NYZD 5JVG3 4GNXC 2K32A 3MHBA 5DAUA 4QF4A 1PZID 3HRZC 1FNUA 3KUPA 4LAAA 3FKIG 2RDHA 2QF7A 4DV3Q 2QW7A 2RCNA 1LTAD 1PTOH 3FPUB 1BBUA 1HQMC 1YVCA 1SYDA 3CMEA 4IQZA 3A54A 4JOIC 4A3IG 1QVCA 5JEAG 3S1QH 3SK4A 1WTOA 1EOVA 2JA7G 1C0AA 1C48A 2B63H 5IGFA 2R7ZH 3HOUB 1V1OA 2AKWB 2HIVA 3RLNA 2GVBA 4IALA 3SHLA 2SNMA 3GTOB 5E3FA 2IWHA 1CZGA 1MGSA 1U5KA 3OTOL 2K05A 5ELDA 2E2JB 1O7IA 4WJ3M 1VQJA 3PO2G 1XMOL 4IUPA 1HQRD 3TDQA 4NXNL 4R4IA 1Z47A 1SXTA 4RFBA 3X3MA 2F0EA 4HIDA 1EEFD 3PUXA 1WTHA 2Y0SG 3HOYH 3AU7A 4DNTB 2FFKB 4R4OA 2NBFA 3NWSA 4A3EH 4OWWB 1EWIA 5KYLA 2PQAA 3E5SA 3OTOQ 2CH4A 3M4OB 4UPAA 4GKKL 1EWHA 3NBIA 5AJ3L 2N78A 4X65L 2B2TC 4B3RL 4LF5Q 3I4OA 3U9SA 1VQEA 1SNMA 2L0CA 1AZQA 4A3LG 2IHFA 5M3FB 4KK7A 3JAME 1PH4A 2I07B 3L7ZC 1MI2A 4CBVA 2Q8IB 2AWNA 2OT2A 2ZXPA 4CKCA 2NZHA 4P73A 1BXTA 4DR6Q 3NTKA 4DV0L 1HJPA 4GKKQ 3OHXC 1DOMA 5C0XI 2VW9A 1X3PA 5T1IA 4ULLA 3J7AF 1JMCA 3QWNA 3AEVA 5F2DA 2OQ0A 1CQVA 5D14A 2EYJA 2R7DA 1JJ2A 4IUQA 1PH9A 3RZDB 2WINB 3GO5A 4IO9A 2PQAB 4LF9L 4YWMA 1PXUA 1T9HA 3PO3G 3I8ZA 4DV0Q 1ENCA 2VZAA 1VQIA 5IP9H 5H1SE 1QCBD 2ZXOA 1VQ6A 1Q3LA 4G7ZC 2NN6H 3ER0A 5FLXL 2GN5A 1XNQQ 4RAUC 4YWLA 4ABNA 4JI4L 3M4YA 4LF9Q 1DOLA 3FKIH 4K5XA 1A6XA 3CW2C 5C4XB 4E6IA 1EIYB 5EGTA 1G291 5I2YA 4P2CB 4WORA 1N34L 1D5ZC 1LTTD 4R8IA 1VQ7A 3UDXA 2Z6KC 1E22A 1RDPD 1TWCB 2QILA 4LW1A 5NUCA 1SROA 4A3KH 1K9MC 2Q2TA 4OIJA 5ELFA 3QB3A 3KDFA 2JA7H 3J7ZC 2NZOA 1QG7A 2LXJA 4WJWA 5E7NA 5C4ZA 1X6OA 2FHTA 1H95A 2K5HA 5CMDA 4N9PA 1XJVA 4BXXG 5HGTA 2ICIA 3GTJH 4BY7G 4NP5A 4IOAA 1TWFB 2MQHA 1WTXA 3T1YL 5COYA 1RKNA 2K5WA 1GJXA 3I2ZA 4OX9Q 1HRJA 2QEJC 3NQTA 4LF4L 4O0AA 4PZ6A 1TS5A 1XXGA 4RHSA 4LWCA 4XYOA 5C44G 1M90C 1BVSA 5EAYA 3KYHC 3J81j 3HKZG 1XTCD 2NVXH 3LWEA 4LF7Q 4LUVA 4XXEA 1FYCA 1IBKL 1EY9A 2KUMA 2PMZB 4JI0L 2CQOA 3R2TA 2PNRC 4IPGA 1ZYRC 1KRSA 4I7ZC 5C4JH 4LF4Q 4X6AH 1STNA 1B3AA 4FDBA 4K8IA 4A3LH 2K28A 4JBWA 2AWOA 3CQZB 2OXPA 4A3FG 3ITPA 1HTLD 3W1BA 4X66L 1IBKQ 4GN3B 4MTNA 3A8JE 2B2YC 3ONAB 4HJ7A 3DWQA 4JI0Q 1EYAA 4LFCL 3QR8A 2WKCA 5EBCA 4J15A 2F0TA 5C3EB 5FJ8H 2HQEA 1N8RC 5I9PA 4YCVA 3MA2B 1MSGA 1SYFA 3K5LA 4EQNA 1PYSB 1HNXL 2F0WA 1TY2A 2A8VA 4IJHA 2F0QA 3ND9A 4CKBA 5IYDG 1SNCA 1AW7A 4P75A 1AE2A 1IW7C 1CTMA 3UDFA 1I4GA 1LT4D 2XRQD 2F0DA 2XVSA 4OXPA 1PRTB 1STGA 2K5VA 1KTKA 4NPSA 4IUNA 5ISRA 5CV7A 2PQEA 4FP5D 1L1OB 5FK9C 4L6TB 1KAAA 3RLOA 4J1MA 2EJMA 2A5HA 4MN3A 5DEHA 1XWEA 3GTGH 5BN3A 4KHZA 1N36L 1ASYA 3A7LA 3NXWA 1QUQA 4ZCKA 4IFDH 1X3QA 1SJED 3JAMc 2Z0SA 4AIMA 4BBRH 4C3IH 1B50A 2EYLA 3S14H 1X3FA 4BBSG 2O4XA 5I9OA 3MFGA 3HP3A 4C3JB 3QJYA 3CRLC 1HA6A 2OTLA 2QDBA 2RHSB 1N36Q 1CFMA 1BNZA 4BY7H 2K75A 1QNUA 3TP7A 4JYAQ 3FPPA 3HOXB 3TBIB 3S2DB 4C1NK 4ZKCB 4A3DH 4DA2A 3S16H 3PCOB 2KCTA 1HA5A 4RCOA 2HDMA 2A73B 5J3BA 4OELB 4X64Q 3VR5A 2F0OA 2DUDA 3A7AB 3NENA 1YITA 2VUMH 3PUVA 2R92B 3PUWA 1B1ZA 1LTSD 1PZKD 1O78A 1VQHA 3IFTA 4DV7L 2CWPA 2FXQA 4ZAIA 1NSNS 1Y14B 3TP8A 1HUNA 1KAWA 1YHQA 4DV6L 2TMPA 3H91A 4JVZA 2B29A 3CCMA 4ZUJA 5CV8A 1SYGA 2ZTCA 3F2UA 3L2PA 4FF2A 2EY6A 1SLJA 1I6HH 2F0HA 1JT8A 3PIPA 2NVTH 1KNEA 4DV7Q 1X55A 2IW3A 1K0RA 5CGKA 4DV6Q 1VQ8A 2JA8G 1LLRD 4AYBG 5LMUL 1II3A 4OIKA 4A3BG 3RR5A 4DGZA 5LMNL 1PRTD 2FJ2A 3P1HA 5KNDA 5C0XG 1F2YA 1TWHH 1NR4A 5DM63 1A3VA 1BO0A 2EY2A 5M5WH 4A3GG 1RF2D 4QUCA 1WD0A 5DM73 1HTPA 2CH4W 5KNBA 2CFMA 5IYDH 1E3PA 2WACA 1TR5A 3T13A 2XNAC 4RG1A 2JA6G 3NSWA 2N55A 3CMAA 2WAQB 5LMUQ 1PV4A 3J80E 1F2LA 4DR7L 2R93H 1U4RA 5E1FA 3S2HB 4MNOA 5EKKA 2UU9L 5HURA 1DM0B 2F52A 3H0GG 1Z7TA 1E7ZA 4K5WA 3D31A 5D3DA 5JJKA 1JQYD 2B2WC 1F2ZA 1QOHA 3GTPB 1Q81C 4DR7Q 2Z4HA 1CA6A 1RODA 1V1QA 4HSPA 3HOVB 2I5MX 1A2TA 2PZTA 4JW0A 2UU9Q 1RTNA 1BCPC 2DY7A 1VQMA 2SDFA 2OCEA 4A93B 3GTKB 1KD1C 5DNFA 5IOCA 1UE1A 3U4ZA 3S9WA 3VR4A 4IPCA 1H9KA 4UP8A 2Z4IA 2RKSA 2B3GA 3LGJA 3MXNA 1JJCB 3L9AX 1ML0D 2JE6I 5LHY1 1DCZA 3HOUH 3F1ZA 3G4SA 3KOJA 4IUUA 2A74C 3UE1A 3CCRA 2UXCL 3K5OA 1MJCA 3HS0C 1LM0A 3GTOH 4JK1C 5C3XA 1OXXK 1S3OA 2E2JH 3E6ZX 4A3JB 4KJNA 3T56B 4DXGA 4DUYQ 3G6EA 4PMCA 5EKLA 1STHA 1SMYC 3VYTA 4CJ0B 4A3MB 4JI6L 4FXDA 2BE5C 2VQFQ 1VF5C 1OXUA 3R2IA 3MZ5A 1VQCA 4GLAC 1V9PA 3MXNB 3U4VA 3SDZA 3M4OH 2K6AA 2RVLA 4ALPA 2A1AA 4JC0A 2A6ED 2NWGA 3J81E 3J7A5 3H94A 2Q2UA 1E2ZA 4YHHQ 4KTAA 1NCVA 1WVLA 1GHJA 5C0XH 4PQXA 4XDXA 2B63G 3HOWB 5M3FH 4MZ9A 2PYKA 3DWAA 1XYIA 1PH2A 2E74C 5KRUA 1FVIA 3MXPA 4PMWA 3HKSA 4DUZL 1K28A 1HFNA 3E0EA 2B2VA 5T1GA 5IODA 3I73A 4UY8C 2QGQA 4JCVE 4MIUA 4O2DA 5ELOA 1NTGA 2XN9C 2ZJPA 2CHBD 4GKJL 1TWGB 4K5VA 1Q90A 5CYUA 1TIID 3HOYG 1CSQA 3TP6A 3EFXD 1PFMA 4UDUC 4DN4M 2QDLA 1A0IA 4A3EG 3QIAA 4O42A 3BG3A 1MHWC 4HSVA 5DLQE 3MVVA 2RSOA 1G91A 4KD3A 1LV9A 3BDOA 2HQLA 2KA7A 1ZEQX 1AE3A 2YYZA 1SYCA 1GVPA 1K8AC 1RL2A 1GHKA 4GKJQ 3I4NB 3BVMA 3H15A 2F0JA 5C4XH 4QB4A 2B2UA 3HGBA 4OO1I 1EQTA 1NMGA 3N6RA 3K58A 4HIMA 1VQ5A 3CF5A 1EY6A 3PUZA 4IURA 3G48A 2Y0SE 1TWCH 3QOJA 5A2QE 1EU3A 2X6GA 3I3CA 2R7FA 3KJOA 2K7VA 3I4LA 3PF5A 3CCQA 1UEAB 1B2TA 1GUGA 1HXYD 4JI8Q 1G2TA 4XTCS 5M3MB 4DV3L 4LFAL 1TS2A 5IP7H 1VF7A 1TWFH 1TS4A 5C5LA 3HOXG 5IP9G 1T5EA 3F8TA 1D5MC 4V0BA 3PIO3 1IKMA 2NN6G 3C1EA 3I4MB 3E9IA 5JOBA 2F0SA 4LFAQ 1WCMB 2ZT9C 3WDNA 1L2FA
chains in the Genus database with same CATH topology
3VYRA 5JJZA 1RJTA 3S15B 3A8IE 2EYPA 5K5PA 3NWTA 1GUSA 4HMIA 2MHVA 3OPOA 3JAML 4U673 5JAVA 3LWUA 1WTPA 3NPPA 4RGTA 2FMCA 3K57A 1SMYD 2VB2X 1F9RA 3DWPA 2BA0A 3BDCA 2IX3A 2B39A 4TSSA 1GUTA 1H9RA 1ZXTA 3EA6A 4K14A 2M9VA 1SYBA 3AMUA 1PFNA 4DAYA 1PLFA 2LMCB 1GOZA 5CBEE 1FNWA 1VDZA 5G3LD 1Y1VB 1H9MA 1UNSA 2JP1A 2BOSA 1PRTF 4DK1A 4LMQD 2CW0D 1S5CD 1J9OA 1F2MA 4YIJA 3QO2A 3SE0A 1K8MA 2EZVA 1LTRD 4DNRB 3VYUA 3QG1A 4BY1B 3G6JB 2B2TA 1Y1WB 2VB3X 1L0YB 3WOFA 4Q0FA 1HPCA 2XWBB 2L1BA 2RSNA 3RLFA 3GV3A 4BWGB 2KCNA 3W3AA 4DU9A 1GUNA 2WV6D 5CC4A 2A6HD 5IGEA 2E2HB 2L12A 4RKLA 1PDQA 2D62A 1E2WA 2XSCA 4ZKBB 4QUFA 3GQBA 5J1ZA 3U9OA 2AUKA 3KLRA 1X32A 2L11A 1SE2A 2E2IB 4IFDG 2MUYA 1PTOC 4HN7A 1KNAA 4B08A 1E0BA 4EQOA 4C3IG 1SBBB 1Q8IA 4C3HB 2KVMA 3DHQA 1WTWA 3A8KE 5JPMC 2EYHA 1EZ6A 1MBYA 1Q1EA 1S5BD 1EY5A 1BDOA 1GUOA 1B53A 1D1KA 3KBXA 2F0FA 1TWAB 3C2PA 2BA1A 4NW2A 4FNFA 4CHTB 1S4ZA 1D1IA 1JB3A 4X3SA 3S17B 4ZLTF 2KOLA 2LY7A 5JEAJ 2K1BA 3VR2A 2PZWA 1VMPA 5M5XB 2F3VA 4KY6A 3HG9A 1QILA 2EXZA 2L5TA 2PO4A 1D6EC 1EQVA 2IJ0A 1RCVD 2JSOA 1CT1D 2Z1CA 2F0NA 3GD7A 2A68C 4KY5A 1PMRA 3S1RB 3PMFA 4XQQA 3ERQA 4IZ8A 3M3YB 1LTID 4KI0A 1H9JA 5C5MA 1HCZA 4RKBA 1ENFA 1FGBD 2B2YA 1CA5A 2NTTA 1OXVA 4F87A 2E75C 5KGUA 1IL8A 1LT3D 2AQ2B 2NVYB 2F0GA 3P7JA 1Y8NB 1IYUA 3QOLA 3Q24A 1BOSA 3Q6SA 2BDOA 4FF1A 2R61A 1SE3A 2L55A 2FMMA 1D2BA 1CHQD 1ESFA 1STYA 5EJWA 4F8MA 3V05A 1JWSD 1YNJC 3BYTB 1F9PA 5LL6S 3Q22A 3CHBD 4Y7NB 4RGMA 2EPBA 3BYYB 1KLUD 1ILPA 1ET9A 4L8JA 3VR3A 1BCPF 3D6WA 4Q5VA 1I3QB 1JE4A 1O7LA 2DY8A 2F0MA 3FDTA 3J80L 1Y8OB 1R4PB 2EYMA 2KQ3A 2D9UA 4EQPA 5IGDA 1DD2A 2J4XA 3C3LA 2EOTA 1JWMD 2VNUD 1ONLA 4OO1H 2EE1A 5I6WA 4RH6A 4XIGS 1I4XA 3KBGA 2A69C 1KDCA 4OHJA 4A3IB 3I72A 3TZUA 3C46A 1DYQA 1B9MA 2K01A 3P75A 3MTSA 3UI2A 2JA7B 2FINB 4K2LA 4K8JA 2E76C 4NDXA 1EY8A 5IGCA 2LS01 2F0UA 2TSSA 5AFWA 4XT3B 3DXJC 2SOBA 5ELBA 1ZYRD 3PO2B 1YNNC 3NTIA 3VA7A 2K33A 2F1MA 1QNKA 5G3LF 4GZYC 3IKJA 4IUVA 1LABA 2Y0SB 2K5DA 1FR3A 2RBMA 4RA8A 3EVQA 2KEDA 2SEBD 1C4QA 1F9QA 2GA4B 2JEAI 4ID6A 1S5DD 4TQUS 1ET6A 4KN7C 5BN5A 3G7LA 1IW7D 2WP8J 1CK1A 1CI3M 5FO7B 3D3RA 2F0LA 2B2WA 1JOQA 3NTHA 4FXGC 5JVH3 1JC7A 5A35A 2EYFA 3RUZA 1RHPA 1O7YA 3PO3B 1S5FD 3K6OA 1IHZA 2HUGA 2JYOA 1A3TA 1W6JA 5BN4A 1DOKA 1CQFA 2PCFB 5IT9E 2F0PA 5ELCA 4HCEA 3NHHA 3SVMA 4OGQC 3VA5A 3OOCA 4ME5A 1EYDA 3MXGA 3DUZA 5I2XA 1DJRD 3BS1A 3TSSA 3V96A 1BCPB 3GTQB 3K5MA 2PW7A 3CKIB 5EPKA 1EFID 2G9DA 4KKUA 3K7AB 4C2MB 1QE6A 2IPKD 1WTVA 1AZPA 3BDLA 4G7OC 1A2UA 4G7HC 3S1NB 5A2QL 1FD7D 2Q8RE 3NUCA 4RHRA 2WB1B 3D4RA 4ZQ3A 2WIIB 4QCLA 4PNYA 1TT2A 1SDFA 5LL6X 5C44B 2KEEA 5K36H 4C56C 3HKZB 2A69D 4RCNA 5KNCA 2AQ1B 4LJZC 3BVZA 1S5ED 5D65A 4J6HA 1XX8A 2D2CC 1Z6HA 3DM1A 5C6AA 1JOKA 4RGNA 3EJIA 2B2UC 1DONA 2VXWA 2X6LA 2Q8TA 2ZXRA 4A3FB 3T51B 4M1UB 5EBDA 1PYWD 3FMCA 2SNSA 1E2VA 1TU2B 3URYA 2L9HA 4C3JG 1EEID 3Q0AA 4DF7A 4DXFA 5C3WA 4KD4A 4HCSA 1SNPA 4DAVA 5E4WC 1MD2D 1EY0A 3D4DA 1IKLA 1I50B 3R93A 1BCPD 1SNQA 3W2DA 4RGOS 4N9TA 1D5XC 1G2SA 2MJ8A 3FEWX 2IL8A 4XT1B 2AQ3B 4WRDA 3TMEA 4ZYSA 3GTLB 2M2LA 5EKIA 3Q23A 2LKVA 2YU9B 1HHVA 3NQIA 2B8FA 4BBSB 4KKSA 4XQNA 1F9SA 1SNDA 4ODGA 5D3IB 1C8CA 3PV0A 5KEEA 4Z9CB 3PUYA 3R3OA 1GXDC 1PTOF 2BE5D 5M9OA 2KECA 4NMZA 3S1MB 1MSHA 3C1FA 5CV9A 2V4DA 4R9WA 1Y8PB 1UUPA 4R8NA 1CHPD 3OIPA 1BBXC 1SJHD 3KLSX 2EVBA 2NVQB 2BDNA 1AP0A 3OMGA 2EJFC 3HOZB 4X3TA 2K5QA 1ENAA 4MHEA 2JA8B 4AYBB 2EDGA 1FNVA 3RZOB 4A3BB 2I46A 4KY7A 4A3GB 1T5XD 3A55A 4K6DA 1SE4A 4BA1I 4UAIA 1R9TB 1H9SA 4KJOA 5M5YB 5J39A 2JA6B 5FKAC 2LFNA 3GTMB 1EZ8A 3X3NA 1BR9A 2O2LD 2NZ1D 1LO5D 3H0GB 2NB0A 3I70A 3MC0B 3EROA 4XYQA 1R4QB 1EL0A 3DMUA 2RDGA 2X69A 3NP8A 4ZRZA 1H9SB 1V8QA 2WKDA 5ELEA 1B4OA 2ENBA 4O1NA 4CGYB 4XQJA 1I4RA 1AN8A 3OW7A 1WTRA 1EIHA 5JEAH 2PPBC 4HTHA 2O5IC 4J8QA 2F03A 4BA2I 3A56A 5I4DA 1NAPA 1VCIA 2DNEA 1SYEA 1RTOA 2XRSD 1TKWB 3M7NA 1SFOB 2HCCA 1A3UA 4QMGA 1AFPA 3FRPB 5CR3A 1PRTC 5FLXE 1JWUD 5CORA 4PV1C 1NUCA 4F7XA 2XIWA 4HMJA 1PTOB 2QKIC 5IGGA 2CQAA 4V190 4OO1G 2IX1A 1A15A 3S1QB 3H6MA 2BCOA 5IIFA 3IAYA 3T53B 1K8OA 1Q12A 3R8BA 2B63B 2R7ZB 1NR2A 3OMCA 2K04A 3ZYYX 3SK6A 1O80A 3P20A 5EPLA 4KV6A 4ILWA 2NTSA 1LT5D 4H0LC 1U4PA 1TQOA 3D8GA 2G9HD 1U4MA 2KJXA 2K03A 2EYOA 5TSSA 4ZK9B 5CV6A 5I6YA 2O5JC 3BVGA 3TP5A 4FYDA 3OSOA 3GP7A 3HOYB 2HCIA 4H44C 3IL8A 4A3EB 4X3KA 1OXSC 3K59A 2DNCA 4FO2A 5E4XA 1O7ZA 3SK8A 4CJ1B 4BS9A 1G6ZA 1KDBA 3T16A 4KN4C 5C4HA 1I6VC 5JPNC 3K0YA 4TRDA 3T4AC 1M4VA 3V2TA 3PIP3 4DAPA 2PW5A 2XWJB 1KABA 2OEOA 5CBAE 2R6GA 3J7AV 2MPMA 1LTBD 4QIWB 4EVOA 3MWYW 4G57A 1BQQT 1JR0D 3TZDA 1HUMA 2J0TD 1PTOD 1PZJD 1F77A 5J22A 4IFDJ 2F0VA 5CV4A 2A6EC 4CJ2C 2HDLA 3SEBA 4FF3A 4FXKC 2D5DA 2RDFA 1ZKOA 3L3OC 2N88A 3FKIB 1JCKB 2MGSA 1HFGA 5FO8B 3RMHA 2IX0A 3J7YW 3M85A 1GUWA 3OWFA 2NN6I 1I4PA 3N52A 1G8ZD 4A3KB 4X3UA 3M7GA 1QB5D 3OIQA 4FF4A 1W6KA 1VMCA 2KHSA 3I91A 4K6LA 1Y69U 3VYSA 1JICA 1EWCA 3GTJB 2ICEC 1KLGD 1TS3A 1TVXA 2C5CA 1RD9D 3MFYA 2R3ZA 4ZUIA 2MP1A 3SR1A 1DXMA 3VR6A 4M8AA 1J8IA 1V43A 2KCCA 1SSOA 5K36G 2NVXB 1SAPA 2OF1A 4DK0A 2A68D 1ESRA 1ICWA 5C4JB 4NKLA 5IT9L 1ILQA 1SEBD 3D4WA 4IUTA 4LK1C 3MXUA 1K83B 3GV6A 4DFAA 1LT6D 2JEBI 3NE5B 3J81L 4TKOB 1CZWA 2F3WA 3SXHA 3O13A 4C3HG 2EY1A 3HEJA 4S3SA 1B9NA 4U68A 3I90A 1QWYA 3EQLC 5EPJA 2PZUA 5KYIA 2H1EA 3LX0A 3D6CA 3KLSA 1YNJD 4WFN3 3K5NA 4KMUC 3H3VC 1U4LA 3GTGB 4B9WA 1L0XB 4L63B 4PMBA 5IGBA 1LTGD 2ID0A 4HR7B 2RQXA 5CV5A 2IT1A 4BBRB 1TY0A 4C3IB 4CKEA 3S14B 1Q1BA 2AUJD 5FOBB 3TN2A 3DEOA 1DZ1A 1CM9A 3NK9A 4IFDI 4HAEA 2RA4A 4BY7B 4H13C 1PFBA 2CVRA 2M00A 2B2VC 2NUCA 2F0IA 2L4NA 1AEXA 4G4KA 1I4QA 3AB9A 5KIXA 4A3DB 1BUVT 3S16B 1QJOA 3LNNA 1UAPA 1V1PA 2B8GA 2DN8A 2EJGC 4RWSC 2CW0C 2VUMB 2F0KA 4I65A 3MAQA 4OL7A 3KF8A 2F4IA 3IFDA 3NBHA 5C0XJ 2Z8LA 4KHVA 4B9XA 3CRKC 1I6HB 1EY4A 1WTQA 1STEA 2JA5B 2NVTB 1M8AA 1OXTA 3ND8A 1YNND 2A6HC 1JOOA 1TWHB 1STBA 3KK7A 2E2DC 1V1PB 5M5WB 3SK5A 1I4HA 1WD1A 3HZXA 2QCPX 3H09A 2EY5A 1U9RA 1SNOA 1STAA 1IYVA 4F88A 3FVQA 1OO9B 4K2KA 1EY7A 3OWEB 1BF4A 1LACA 3RD4A 4IN3A 4KKTA 2R93B 4HEDA 1B44D 3WOEA 5FO9B 3BZDB 1EIGA 1KDAA 4EGVA 1JORA 4H7BA 5EQ0A 1EYCA 2J7ZA 1EOTA 2C9OA 3E0JA 4C1NI 3MEHA 1EU4A 3CU7A 3DEPA 2H4OA 2JXMB 4FVMA 2NYZD 5JVG3 2K32A 3MHBA 5DAUA 4QF4A 1PZID 3HRZC 1FNUA 3KUPA 4LAAA 2RDHA 2QF7A 1LTAD 1PTOH 3FPUB 1HQMC 1SYDA 4IQZA 3A54A 5JEAG 3SK4A 1WTOA 1C48A 3HOUB 5IGFA 1V1OA 4IALA 3SHLA 2SNMA 3GTOB 5E3FA 2IWHA 1CZGA 1MGSA 2K05A 5ELDA 2E2JB 4IUPA 1HQRD 3TDQA 1Z47A 1SXTA 4RFBA 3X3MA 2F0EA 1EEFD 3PUXA 3AU7A 4DNTB 2FFKB 2NBFA 3NWSA 5KYLA 3E5SA 3M4OB 1EWHA 3NBIA 2B2TC 3U9SA 1SNMA 2L0CA 1AZQA 5M3FB 4KK7A 3JAME 2I07B 3L7ZC 1MI2A 4CBVA 2Q8IB 2AWNA 2OT2A 2ZXPA 4CKCA 1BXTA 3NTKA 3OHXC 1DOMA 5C0XI 1X3PA 5T1IA 4ULLA 3J7AF 3QWNA 5F2DA 1CQVA 5D14A 2EYJA 4IUQA 3RZDB 2WINB 3GO5A 1PXUA 3I8ZA 1ENCA 1QCBD 2ZXOA 1Q3LA 4G7ZC 2NN6H 5FLXL 4RAUC 4ABNA 3M4YA 1DOLA 4K5XA 1A6XA 5C4XB 4E6IA 5EGTA 1G291 5I2YA 4P2CB 4WORA 1D5ZC 1LTTD 4R8IA 1TWCB 1RDPD 2QILA 5NUCA 4OIJA 5ELFA 3QB3A 1QG7A 4WJWA 5C4ZA 2FHTA 5CMDA 4N9PA 5HGTA 2ICIA 4NP5A 1TWFB 1WTXA 5COYA 1RKNA 2K5WA 1GJXA 1HRJA 2QEJC 3NQTA 1TS5A 1XXGA 4RHSA 4XYOA 1XTCD 3LWEA 4XXEA 1FYCA 1EY9A 2KUMA 2PMZB 3R2TA 2PNRC 1ZYRC 4I7ZC 1STNA 1B3AA 4K8IA 2K28A 4JBWA 2AWOA 3CQZB 2OXPA 3ITPA 1HTLD 3A8JE 2B2YC 3ONAB 3DWQA 1EYAA 2WKCA 5EBCA 2F0TA 5C3EB 2HQEA 5I9PA 3MA2B 1MSGA 1SYFA 3K5LA 4EQNA 2F0WA 1TY2A 2F0QA 3ND9A 4CKBA 1SNCA 1AW7A 1IW7C 1CTMA 1I4GA 1LT4D 2XRQD 2F0DA 2XVSA 1PRTB 1STGA 1KTKA 4IUNA 5ISRA 5CV7A 2PQEA 4FP5D 5FK9C 4L6TB 1KAAA 4J1MA 2EJMA 2A5HA 4MN3A 5DEHA 1XWEA 5BN3A 4KHZA 3A7LA 3NXWA 4IFDH 1X3QA 1SJED 1B50A 2EYLA 2O4XA 5I9OA 3MFGA 3HP3A 4C3JB 3QJYA 3CRLC 1HA6A 2QDBA 1CFMA 1BNZA 1QNUA 3TP7A 3FPPA 3HOXB 3TBIB 3S2DB 4ZKCB 4C1NK 4DA2A 1HA5A 4RCOA 2HDMA 2A73B 3VR5A 2F0OA 3A7AB 2R92B 3PUVA 3PUWA 1B1ZA 1LTSD 1PZKD 1O78A 3IFTA 4ZAIA 1NSNS 3TP8A 1HUNA 2TMPA 3H91A 4ZUJA 5CV8A 1SYGA 3F2UA 4FF2A 2EY6A 2F0HA 1KNEA 2IW3A 5CGKA 1LLRD 1II3A 4OIKA 4DGZA 1PRTD 2FJ2A 3P1HA 5KNDA 5C0XG 1F2YA 1NR4A 5DM63 1A3VA 1BO0A 2EY2A 1RF2D 4QUCA 1WD0A 5DM73 1HTPA 5KNBA 2WACA 1TR5A 3T13A 2XNAC 3NSWA 2N55A 2WAQB 3J80E 1F2LA 1U4RA 5E1FA 3S2HB 5EKKA 5HURA 1DM0B 1Z7TA 4K5WA 3D31A 5D3DA 1JQYD 2B2WC 1F2ZA 1QOHA 3GTPB 2Z4HA 1CA6A 1RODA 4HSPA 3HOVB 1A2TA 2PZTA 1RTNA 1BCPC 2DY7A 2SDFA 4A93B 3GTKB 5DNFA 5IOCA 3S9WA 3VR4A 1H9KA 2Z4IA 2RKSA 3MXNA 3L9AX 1ML0D 2JE6I 5LHY1 1DCZA 4IUUA 2A74C 3K5OA 3HS0C 4JK1C 5C3XA 1OXXK 3E6ZX 4A3JB 4KJNA 3T56B 4DXGA 4PMCA 5EKLA 1STHA 1SMYC 3VYTA 4CJ0B 4A3MB 4FXDA 2BE5C 1VF5C 1OXUA 3R2IA 3MZ5A 3SDZA 2K6AA 2RVLA 2A6ED 2NWGA 3J81E 3H94A 1E2ZA 4KTAA 1NCVA 1WVLA 1GHJA 5C0XH 4PQXA 4XDXA 3HOWB 2PYKA 3DWAA 1XYIA 2E74C 5KRUA 3MXPA 4PMWA 1HFNA 5T1GA 2B2VA 5IODA 3I73A 4MIUA 2XN9C 2CHBD 1TWGB 4K5VA 1Q90A 5CYUA 1TIID 3TP6A 3EFXD 1PFMA 4UDUC 4DN4M 3QIAA 4O42A 3BG3A 4HSVA 3MVVA 2RSOA 1G91A 4KD3A 1LV9A 3BDOA 2KA7A 1ZEQX 2YYZA 1SYCA 1GHKA 3I4NB 3BVMA 2F0JA 4QB4A 2B2UA 3HGBA 4OO1I 1EQTA 3N6RA 3K58A 1EY6A 3PUZA 4IURA 3QOJA 5A2QE 1EU3A 2X6GA 3I3CA 2K7VA 3I4LA 1UEAB 1B2TA 1GUGA 1HXYD 1G2TA 4XTCS 5M3MB 1TS2A 1VF7A 1TS4A 5C5LA 1T5EA 1D5MC 4V0BA 3PIO3 1IKMA 2NN6G 3C1EA 3I4MB 5JOBA 2F0SA 1WCMB 2ZT9C 3WDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NPP A;  2K5W A;  2K5Q A; 
#chains in the Genus database with same CATH topology
 3VYR A;  2MO0 A;  3CPF A;  5IYC H;  5JJZ A;  3CC2 A;  4LF8 Q;  1RJT A;  1X9N A;  3S15 B;  4JI7 L;  3A8I E;  2EYP A;  3K0X A;  4A3K G;  5K5P A;  3NWT A;  1PVO A;  1GUS A;  4HMI A;  2MHV A;  3OPO A;  1CKM A;  3ULP A;  3ULJ A;  3JAM L;  4U67 3;  2MO1 A;  5JAV A;  3CQZ H;  3LWU A;  3NEL A;  1WTP A;  3NPP A;  4RGT A;  2FMC A;  3K57 A;  5JJL A;  4JOI A;  4JI7 Q;  1S72 A;  2BH8 A;  1NMF A;  1SMY D;  5C3E H;  2VB2 X;  1F9R A;  3DWP A;  2BA0 A;  3BDC A;  2IX3 A;  2B39 A;  4TSS A;  1GUT A;  4LF5 L;  1PH5 A;  2HT1 A;  3AQQ A;  1H9R A;  1ZXT A;  2RCF A;  3EA6 A;  3STB D;  1PFS A;  4K14 A;  3PIO A;  3BZC A;  2M9V A;  1SYB A;  3MEF A;  3AMU A;  1PFN A;  4DAY A;  3D0F A;  1PLF A;  2LMC B;  1GOZ A;  2WAQ G;  5BR8 L;  5CBE E;  4DR6 L;  1FNW A;  1VDZ A;  5G3L D;  1Y1V B;  1HNZ Q;  2WB1 E;  2XGT A;  1H9M A;  5JJI A;  1J5E Q;  1UNS A;  2JP1 A;  2UXD L;  4YCW A;  2BOS A;  1PRT F;  4DK1 A;  4LMQ D;  2CW0 D;  1S5C D;  3A5Z B;  1J9O A;  1F2M A;  4YIJ A;  3QO2 A;  3SE0 A;  1K8M A;  2EZV A;  5BR8 Q;  3HKZ E;  1LTR D;  4DNR B;  3VYU A;  1VQF A;  3QG1 A;  4BY1 B;  4DAM A;  3G6J B;  2B2T A;  5FJ8 G;  1Y1W B;  3OW2 A;  4HJ8 A;  2VB3 X;  2UXD Q;  1L0Y B;  3WOF A;  4Q0F A;  4DR2 Q;  1HPC A;  2ATW A;  1XNQ L;  2XWB B;  4C3J H;  2L1B A;  5HGQ A;  1X3G A;  4A93 G;  2RSN A;  1SMX A;  3GV3 A;  3RLF A;  4BWG B;  4IOC A;  2KCN A;  2ZM6 L;  4LFB L;  4YWK A;  3W3A A;  4DU9 A;  1GUN A;  2WV6 D;  1YHB A;  3CC7 A;  3HOX H;  5CC4 A;  2A6H D;  5IGE A;  3G71 A;  2E2H B;  2L12 A;  4RKL A;  1PDQ A;  2D62 A;  3S2D H;  1E2W A;  2XSC A;  4JI5 Q;  4ZKB B;  4QUF A;  2E5L Q;  3GQB A;  4P74 A;  5J1Z A;  3U9O A;  3U58 A;  2AUK A;  2R92 H;  3KLR A;  2ZM6 Q;  1X32 A;  4LFB Q;  2L11 A;  5IE8 A;  1SE2 A;  2E2I B;  4IFD G;  2MUY A;  1PTO C;  3A5U A;  1K73 C;  5ELN A;  4HN7 A;  3UDG A;  4BBR G;  1KNA A;  2D0O A;  4B08 A;  1E0B A;  4EQO A;  1B3Q A;  4RMF A;  1SBB B;  4C3I G;  1Q8I A;  1EYG A;  4OX9 L;  2KEN A;  4C3H B;  2KVM A;  3DHQ A;  1WTW A;  3FHW A;  3A8K E;  4DR4 L;  5JPM C;  2EYH A;  4LF7 L;  1EZ6 A;  1MBY A;  1Q1E A;  1S5B D;  1EY5 A;  4UP9 A;  1BDO A;  1GUO A;  1B53 A;  4JBM A;  1D1K A;  3KBX A;  2F0F A;  1TWA B;  1GO3 E;  1MKH A;  3E3X A;  3C2P A;  2QEX A;  4A3D G;  4I7A A;  2BA1 A;  4NW2 A;  4FNF A;  4CHT B;  1S4Z A;  1D1I A;  1JB3 A;  3UE0 A;  4DR4 Q;  4X3S A;  2VUM G;  4DKA C;  2CKZ B;  4QGU A;  3S17 B;  2WFW A;  4ZLT F;  2KOL A;  2LY7 A;  3KDF B;  5JEA J;  2K1B A;  3VR2 A;  2PZW A;  4DPG A;  1VMP A;  5M5X B;  1KQS A;  2RHQ B;  3ICE A;  3S2H H;  2F3V A;  4N8F A;  4KY6 A;  1L1O C;  1QIL A;  3HG9 A;  2EXZ A;  1B70 B;  1UWV A;  2JA5 G;  3K80 C;  1VQB A;  2L5T A;  1BKB A;  1K83 H;  1B8A A;  2PO4 A;  1D6E C;  1EQV A;  2IJ0 A;  2AMC B;  1RCV D;  2JSO A;  1U0L A;  1CT1 D;  2Z1C A;  3GTP H;  4EQ5 A;  2F0N A;  3GD7 A;  2A68 C;  4KY5 A;  3HOV H;  1YBY A;  4R4C A;  1PMR A;  3S1R B;  3PMF A;  2MFI A;  4XQQ A;  4JI1 L;  3ERQ A;  4IZ8 A;  3M3Y B;  1LTI D;  4JI2 Q;  3AFP A;  4KI0 A;  1H9J A;  5C5M A;  1HCZ A;  1YHA A;  4A93 H;  4RKB A;  3GTK H;  1ENF A;  1FGB D;  2B2Y A;  2HIX A;  1CA5 A;  4IPD A;  2H5X A;  2NTT A;  1OXV A;  4F87 A;  2EIF A;  2E75 C;  2KCM A;  5KGU A;  1IL8 A;  2R93 G;  1LT3 D;  2AQ2 B;  4AYB E;  2NVY B;  4JI1 Q;  4POG A;  2F0G A;  2DJF C;  3P7J A;  1QZH A;  1Y8N B;  2HHH Q;  2CCZ A;  1IYU A;  1JB7 A;  3QOL A;  3Q24 A;  1BOS A;  3Q6S A;  2BDO A;  4FF1 A;  4B3S Q;  2R61 A;  1SE3 A;  2L55 A;  2FMM A;  3CD6 A;  1D2B A;  1CHQ D;  4JYA L;  1QZG A;  1ESF A;  1STY A;  4A3M H;  3M4Q A;  1GM5 A;  2UUA L;  5EJW A;  1HZC A;  4F8M A;  3V05 A;  1KRT A;  1JWS D;  1YNJ C;  3BYT B;  4X64 L;  1F9P A;  5LL6 S;  3Q22 A;  3CHB D;  4Y7N B;  4RGM A;  1C9O A;  4PG3 A;  4A76 A;  3T1H L;  2EPB A;  3CC4 A;  3BYY B;  1GD7 A;  1KLU D;  3HOU G;  2UUA Q;  3HOW H;  3M4P A;  1ILP A;  1ET9 A;  3CAM A;  4L8J A;  5HY6 A;  3VR3 A;  1BCP F;  1YJ9 A;  2ASB A;  3D6W A;  1QUQ B;  4Q5V A;  1I3Q B;  1QVG A;  2JJQ A;  1JE4 A;  1O7L A;  3ULL A;  2DY8 A;  4DR3 L;  2F0M A;  3T1H Q;  4DR5 Q;  3FDT A;  3J80 L;  1Y8O B;  1R4P B;  2LSS A;  2EYM A;  1YNX A;  2KQ3 A;  1XPO A;  2D9U A;  4EQP A;  1EQQ A;  1SRU A;  1I5F A;  1X3E A;  1TWG H;  3H3V H;  3RN2 A;  3DLL A;  4QJF A;  5IGD A;  1DD2 A;  2J4X A;  3C3L A;  2EOT A;  3CCE A;  2JA5 H;  1JWM D;  2VNU D;  1ONL A;  5GAD C;  4AH6 A;  4OO1 H;  2EE1 A;  5I6W A;  4RH6 A;  4XIG S;  4L5Q A;  1I4X A;  4DR3 Q;  3KBG A;  3TRZ A;  1E1O A;  1KDC A;  2A69 C;  4OHJ A;  4A3I B;  3I72 A;  3TZU A;  3C46 A;  1DYQ A;  1B9M A;  2K01 A;  3ZJY C;  1A8V A;  3CCU A;  3I4N H;  3P75 A;  3MTS A;  3UI2 A;  2JA7 B;  5M3F G;  1NBW A;  2FIN B;  4K2L A;  4K8J A;  2E76 C;  4NDX A;  3PGZ A;  1EY8 A;  5IGC A;  2LS0 1;  2F0U A;  5IY0 A;  2TSS A;  4GOP C;  5AFW A;  5GAH C;  4XT3 B;  3RNU A;  3DXJ C;  1SE8 A;  2SOB A;  5ELB A;  2ZJR A;  2EQS A;  4GN5 A;  1A62 A;  1ZYR D;  3BZK A;  3PO2 B;  1YNN C;  3NTI A;  3VA7 A;  2AHO B;  2K33 A;  4L5S A;  2F1M A;  1QNK A;  5G3L F;  4GZY C;  3IKJ A;  1KIX A;  4A3C H;  5M3M H;  4IUV A;  1LAB A;  1X54 A;  4LUO A;  2Y0S B;  1ASZ A;  2K5D A;  1FR3 A;  1IL2 A;  2RBM A;  4RA8 A;  3EVQ A;  2KED A;  1OTC A;  2SEB D;  2I5L X;  1QVF A;  1C4Q A;  1F9Q A;  2GA4 B;  3I4M H;  2JEA I;  4ID6 A;  1S5D D;  2JN4 A;  4TQU S;  1ET6 A;  4KN7 C;  5C4X G;  3WWV A;  5BN5 A;  1WCM H;  3G7L A;  1G6P A;  1IW7 D;  2VY3 A;  2WP8 J;  2F4V Q;  3S15 H;  1CK1 A;  1CI3 M;  3EIV A;  3BU2 A;  2Q2I A;  3D3R A;  2F0L A;  5FO7 B;  2B2W A;  1JOQ A;  3NTH A;  4DUY L;  4FXG C;  1VQG A;  5JVH 3;  4YY3 Q;  1IZ6 A;  3EBE A;  1JC7 A;  2K5N A;  2VQF L;  5A35 A;  2EYF A;  3RUZ A;  1RHP A;  5IP7 G;  2F3I A;  1O7Y A;  3PO3 B;  1S5F D;  2V1C C;  3K6O A;  1IHZ A;  2HUG A;  2JYO A;  1A3T A;  5FLM H;  2YTY A;  1W6J A;  5BN4 A;  4YHH L;  4ME3 A;  1DOK A;  1CQF A;  2PCF B;  1PA6 A;  1SN8 A;  3L0O A;  5IT9 E;  2F0P A;  5ELC A;  4HCE A;  3NHH A;  3CCL A;  3SVM A;  4OGQ C;  3VA5 A;  1CUK A;  5IYC G;  3OOC A;  4ME5 A;  1EYD A;  3MXG A;  3DUZ A;  4OEM B;  5I2X A;  2KHI A;  1DJR D;  1NNX A;  3BS1 A;  3TSS A;  1Y1V H;  3E9H A;  1N9W A;  1MJE A;  3V96 A;  1BCP B;  3GTQ B;  1D7Q A;  4A4I A;  3K5M A;  2PW7 A;  2K14 A;  4K0K L;  3CKI B;  1A63 A;  2ZTE A;  1EFI D;  5EPK A;  2G9D A;  4KKU A;  3K7A B;  4C2M B;  1QE6 A;  2IPK D;  1WTV A;  1AZP A;  3BDL A;  4G7O C;  1A2U A;  4G7H C;  1VQO A;  2E8G A;  3S1N B;  5A2Q L;  1FD7 D;  2Q8R E;  4BY1 H;  1HR0 L;  3NUC A;  5C3E G;  4RHR A;  2WB1 B;  3D4R A;  1CSP A;  4ZQ3 A;  1Y1W H;  1HZA A;  2WII B;  4QCL A;  4PNY A;  1L0W A;  2N3S A;  3RZD H;  4K0K Q;  1TT2 A;  1SDF A;  5LL6 X;  5C44 B;  2KEE A;  5K36 H;  4C56 C;  3HKZ B;  2A69 D;  5IWA Q;  4RCN A;  1DGS A;  4JBK A;  5KNC A;  2AQ1 B;  4LJZ C;  2RF4 A;  3CCJ A;  1HR0 Q;  3BVZ A;  1S5E D;  5D65 A;  2QA4 A;  1CKO A;  3F2B A;  4J6H A;  3H3V I;  1XX8 A;  2D2C C;  1Z6H A;  4UP7 A;  3DM1 A;  5C6A A;  1JOK A;  4RGN A;  3EJI A;  4YCU A;  1PH1 A;  2B2U C;  3DM3 A;  1DON A;  1VQN A;  1K3R A;  4JI8 L;  2VXW A;  2X6L A;  2Q8T A;  2ZXR A;  4A3F B;  3T51 B;  4M1U B;  5EBD A;  1PYW D;  3FMC A;  2SNS A;  1UE7 A;  1E2V A;  4H02 A;  1YJN A;  1TU2 B;  3URY A;  2L9H A;  4C3H H;  4DK3 C;  4C3J G;  1EEI D;  1X65 A;  1EIF A;  3Q0A A;  4DF7 A;  4DXF A;  5C3W A;  4DV2 L;  3J80 c;  2G5D A;  1MIU A;  4LF8 L;  4KD4 A;  3TQY A;  4HCS A;  1SNP A;  4DAV A;  5E4W C;  1TWA H;  1MD2 D;  3I55 A;  1EY0 A;  1FJG Q;  3D4D A;  1IKL A;  1I50 B;  3R93 A;  1BCP D;  1SNQ A;  3W2D A;  4RGO S;  4N9T A;  1D5X C;  1G2S A;  2R92 G;  4DV2 Q;  2MJ8 A;  3FEW X;  2IL8 A;  1W2B A;  4XT1 B;  4X62 L;  2AQ3 B;  4WRD A;  3S17 H;  3PF4 A;  2IY5 B;  3TME A;  2D0P A;  4ZYS A;  3GTL B;  2UUC Q;  1EFW A;  5M5X H;  2M2L A;  5EKI A;  4GNX A;  3Q23 A;  2LKV A;  2YU9 B;  1HHV A;  1NJI C;  3NQI A;  2B8F A;  4BBS B;  4KKS A;  4XQN A;  4DR1 Q;  1F9S A;  1SND A;  3KF6 A;  4ODG A;  5D3I B;  1C8C A;  3PV0 A;  1LTL A;  4X62 Q;  5KEE A;  4Z9C B;  3GDE A;  5IYB H;  3PUY A;  3R3O A;  1GXD C;  1B7Y B;  1PTO F;  2C35 B;  4QQB X;  2BE5 D;  1HNZ L;  1CKN A;  5M9O A;  3S1R H;  2KEC A;  1XMQ L;  4NMZ A;  1J5E L;  3M3Y H;  4HJ9 A;  3W1G A;  4HJ5 A;  3S1M B;  1MSH A;  3C1F A;  5CV9 A;  2V4D A;  4R9W A;  2Q2H A;  1Y8P B;  1UUP A;  1HR0 W;  3CCV A;  4GS3 A;  2EXD A;  4GNX B;  1XNR L;  5IT9 c;  4R8N A;  1CHP D;  1KHI A;  2NVY H;  3OIP A;  3KF6 B;  1XMQ Q;  1BBX C;  4JV5 L;  4OWX B;  3U50 C;  3B6Y A;  1SJH D;  4DR2 L;  2LXK A;  1M1K C;  3KLS X;  2EVB A;  3ERS X;  2NVQ B;  2BDN A;  1AP0 A;  3OMG A;  2EJF C;  1WOC A;  3J81 c;  2UXB L;  3HOZ B;  4X3T A;  2K5Q A;  1HH2 P;  1CKN B;  1XNR Q;  1ENA A;  4MTK A;  1XMO Q;  1XTD A;  4MHE A;  4NXM L;  4NXN Q;  4R1J A;  2JA8 B;  4AYB B;  4CDC C;  3HOV G;  2EDG A;  1FNV A;  3RZO B;  4JV5 Q;  2I46 A;  4A3B B;  4JI5 L;  3K7U C;  4KY7 A;  4A3G B;  1T5X D;  2E5L L;  3A55 A;  3SGI A;  4K6D A;  1SE4 A;  4DAY B;  1PYB A;  3JAM i;  2UXB Q;  4BA1 I;  4UAI A;  1R9T B;  1H9S A;  4KJO A;  4Y7N H;  3CPW A;  5M5Y B;  4NB3 A;  1XPR A;  5J39 A;  2JA6 B;  5AJ3 Q;  4X65 Q;  4PZ7 A;  4NXM Q;  5FKA C;  4B3R Q;  2LFN A;  4KHP L;  2VL6 A;  3VDY A;  1Q46 A;  3GTM B;  4Y52 H;  1EZ8 A;  1P16 A;  1WYD A;  1IYJ B;  3X3N A;  1BR9 A;  2O2L D;  2NZ1 D;  4QL5 A;  2A19 A;  1I3Q H;  1LO5 D;  3H0G B;  2NB0 A;  4A3J G;  1PH6 A;  3I70 A;  2XTI A;  4JPB W;  1IBL L;  4KHP Q;  4A3M G;  3MC0 B;  1KXL A;  1HZB A;  1UE6 A;  3ERO A;  4XYQ A;  1R4Q B;  1EL0 A;  3DMU A;  1VQL A;  2RDG A;  1E1T A;  2X69 A;  3NP8 A;  4ZRZ A;  1H9S B;  1V8Q A;  2WKD A;  2KBN A;  5ELE A;  1B4O A;  2ENB A;  1N32 L;  4O1N A;  4CGY B;  4XQJ A;  4A3I H;  2Z6K A;  1I4R A;  1AN8 A;  3NEM A;  3OW7 A;  2DJG C;  2K52 A;  1WTR A;  1UEB A;  1IBL Q;  1EIH A;  5JEA H;  2PPB C;  4HTH A;  2YTX A;  1Z9F A;  4GLX A;  4PZ8 A;  2O5I C;  3HOW G;  4J8Q A;  5GAE C;  2F03 A;  4JI4 Q;  2ZTD A;  1XPU A;  4BA2 I;  3A56 A;  5I4D A;  3TRE A;  1NAP A;  1VCI A;  2L15 A;  2DNE A;  1SYE A;  3CCS A;  5L37 A;  1N34 Q;  1N32 Q;  1RTO A;  2XRS D;  1TKW B;  3M7N A;  1SFO B;  2HCC A;  1A3U A;  4QMG A;  4UHV A;  2WB1 G;  1AFP A;  1KC8 C;  2PI2 A;  3PO2 H;  3FRP B;  1G51 A;  5CR3 A;  1NE3 A;  1NY4 A;  4AQY L;  1PRT C;  1YJW A;  5FLX E;  1JWU D;  1WJJ A;  5COR A;  4PV1 C;  1NUC A;  1X56 A;  4F7X A;  4JI2 L;  1PHJ A;  2XIW A;  2PNH A;  1PTO B;  4HMJ A;  2QKI C;  5IGG A;  2CQA A;  4V19 0;  4OO1 G;  2IX1 A;  3T1Y Q;  3IRB A;  1HNW L;  1A15 A;  3AYH B;  1K8G A;  4CDD C;  3S1Q B;  3H6M A;  4CDF C;  2BCO A;  5IIF A;  3I4N G;  3IAY A;  3T53 B;  1K8O A;  4AQY Q;  4HIO A;  1Q12 A;  3R8B A;  2B63 B;  2R7Z B;  1NR2 A;  1D8L A;  2K04 A;  3OMC A;  3ZYY X;  4HIK A;  3SK6 A;  1L1O A;  2HHH L;  1O80 A;  1PH7 A;  3P20 A;  5EPL A;  4KV6 A;  3A0J A;  4ILW A;  2NTS A;  1LT5 D;  1HNW Q;  4H0L C;  1U4P A;  1YIJ A;  1TQO A;  3D8G A;  2UUB L;  4B3S L;  2G9H D;  1U4M A;  2KJX A;  2K03 A;  3K81 C;  1IBM L;  4P71 A;  2EYO A;  5TSS A;  4ZK9 B;  5CV6 A;  5I6Y A;  2O5J C;  3BVG A;  3TP5 A;  4A3C G;  4FYD A;  5M3M G;  3OSO A;  4X66 Q;  2VQE L;  3GP7 A;  3HOY B;  3KJP A;  2HCI A;  4H44 C;  3IL8 A;  4A3E B;  4LFC Q;  3PO3 H;  4X3K A;  4WJ4 A;  1OXS C;  2UUB Q;  3K59 A;  1IBM Q;  4A3J H;  2DNC A;  1VQP A;  4FO2 A;  5E4X A;  1O7Z A;  3EN2 A;  3AFQ A;  3I4M G;  3SK8 A;  4CJ1 B;  1HNX Q;  4BS9 A;  1G6Z A;  1KDB A;  2I5H A;  3T16 A;  1FL0 A;  4KN4 C;  5C4H A;  1WCM G;  2OWO A;  1Q8K A;  2VQE Q;  1I6V C;  1GKH A;  5JPN C;  3K0Y A;  4TRD A;  3T4A C;  1S40 A;  1M4V A;  2ES2 A;  1JJG A;  3V2T A;  2KHJ A;  1KL9 A;  3PIP 3;  4DR5 L;  3A74 A;  4DAP A;  1K3B C;  2PW5 A;  2XWJ B;  1KAB A;  2OEO A;  5CBA E;  2R6G A;  2ALY B;  3GTQ H;  4APV A;  3J7A V;  3BJU A;  2MPM A;  1LYL A;  1LTB D;  4QIW B;  4EVO A;  4EX5 A;  1AH9 A;  2OTJ A;  4G57 A;  3MWY W;  1BQQ T;  3K7A H;  4C2M H;  3CXC A;  4BXX H;  1JR0 D;  3TZD A;  1HUM A;  2J0T D;  3S1N H;  1PTO D;  2GVA A;  4P72 A;  1PZJ D;  5GRO A;  1F77 A;  5J22 A;  4IFD J;  2F0V A;  4IJL A;  5CV4 A;  5FLM G;  2A6E C;  3UDI A;  4CJ2 C;  2HDL A;  2K4K A;  3SEB A;  4FF3 A;  2P5Z X;  3I7F A;  4FXK C;  2D5D A;  4DV1 L;  2RDF A;  1ZKO A;  3L3O C;  2N88 A;  3FKI B;  1JCK B;  5C44 H;  4QY7 A;  2MGS A;  4OON A;  1HFG A;  2N8N A;  4L5T A;  5FO8 B;  3RMH A;  2IX0 A;  3J7Y W;  3M85 A;  1GUW A;  3OWF A;  2NN6 I;  1I4P A;  1Y1V G;  3N52 A;  1G8Z D;  4A3K B;  4X3U A;  1W3S A;  3M7G A;  1QB5 D;  1K0S A;  3CP0 A;  3KFU A;  4DV1 Q;  3OIQ A;  4FF4 A;  1W6K A;  1VMC A;  2KHS A;  1P8L A;  3I91 A;  4K6L A;  1Y69 U;  3HOZ G;  3VYS A;  1JIC A;  4A3F H;  1EWC A;  3GTJ B;  2ICE C;  1KLG D;  1TS3 A;  1TVX A;  2C5C A;  3FP9 A;  1IXR A;  4BY1 G;  2PMZ E;  1RD9 D;  1Y1W G;  3MFY A;  1BBW A;  2R3Z A;  4ZUI A;  2MP1 A;  3SR1 A;  4HJA A;  4CDE C;  1VQ4 A;  1DXM A;  2BH2 A;  2N49 A;  3VR6 A;  3RN5 A;  4M8A A;  1J8I A;  4LF6 L;  1V43 A;  2KCC A;  1SSO A;  4GOP A;  5K36 G;  2NVX B;  1SAP A;  2F4V L;  2OF1 A;  2PI2 E;  3M9B A;  4DK0 A;  5FLX c;  4A75 A;  2A68 D;  4JI3 L;  1ESR A;  5LMN Q;  1I50 H;  2CWA A;  2HD3 A;  3J80 i;  1N33 L;  1ICW A;  4YY3 L;  5C4J B;  4NKL A;  2OQK A;  5IT9 L;  1ILQ A;  4LF6 Q;  1SEB D;  3D4W A;  4IUT A;  4LK1 C;  3MXU A;  1RIP A;  4R4Q A;  1K83 B;  3GV6 A;  4DFA A;  1LT6 D;  2JEB I;  3NE5 B;  3J81 L;  1Q7Y C;  3GTL H;  2JQO A;  4JI3 Q;  4LNQ A;  4TKO B;  1CZW A;  1N33 Q;  4DV5 L;  2F3W A;  3SXH A;  3O13 A;  1WFQ A;  4C3H G;  2YU9 H;  4POF A;  4BBS H;  4GOP B;  4GLV B;  2EY1 A;  1TXY A;  3HEJ A;  3S24 A;  3TS0 A;  4KLK A;  3W5O A;  4S3S A;  1VQ9 A;  1B9N A;  4U68 A;  3I90 A;  1QWY A;  1YI2 A;  3EQL C;  5EPJ A;  4DV5 Q;  2PZU A;  5KYI A;  2H1E A;  4DNI A;  3LX0 A;  3D6C A;  3KLS A;  1YNJ D;  1I94 L;  4WFN 3;  4B3T L;  3K5N A;  4QIW E;  3S1M H;  4KMU C;  3H3V C;  1U4L A;  4DK6 C;  4B9W A;  3GTG B;  1FGU A;  1L0X B;  1WI5 A;  1ICF B;  4L63 B;  4PMB A;  5IGB A;  1LTG D;  1J6Q A;  3F2D A;  2ID0 A;  3F2C A;  4HR7 B;  2RQX A;  5CV5 A;  2IT1 A;  4BBR B;  1TY0 A;  2IHE A;  4C3I B;  3OYY A;  4CKE A;  3S14 B;  1I94 Q;  1Q1B A;  4B3T Q;  2UXC Q;  3KLW A;  2AUJ D;  2NVQ H;  4IPH A;  5FOB B;  2Z6B A;  3TN2 A;  3DEO A;  3STB C;  1DZ1 A;  3K8A A;  3HOZ H;  1CM9 A;  4N8X 1;  2JA9 A;  2YTV A;  3NK9 A;  1EQR A;  2RA4 A;  4HAE A;  5IYB G;  1VQK A;  4IFD I;  4BY7 B;  4H13 C;  1PFB A;  2CVR A;  4OWT B;  5IWA L;  2M00 A;  2B2V C;  2I0Q A;  2NUC A;  2JA8 H;  4JI6 Q;  2F0I A;  2L4N A;  3J81 i;  1AEX A;  4G4K A;  3RZO H;  4A3B H;  1I4Q A;  2R7Z G;  3AB9 A;  2JK8 A;  4JBJ A;  5KIX A;  1EUJ A;  4A3G H;  4A3D B;  1BUV T;  3S16 B;  1QJO A;  4LUZ A;  3PQI A;  3LNN A;  1UAP A;  1V1P A;  2B8G A;  2DN8 A;  2EJG C;  4RWS C;  2CW0 C;  1R9T H;  5M5Y H;  2VUM B;  1UE5 A;  2F0K A;  4I65 A;  1VQA A;  3MAQ A;  2JA6 H;  4OL7 A;  3KF8 A;  4L5R C;  1HZ9 A;  2E2H H;  5LMN W;  2Z9H A;  2F4I A;  3IFD A;  3GTM H;  3NBH A;  5C0X J;  1YZ6 A;  2Z8L A;  4KHV A;  1Q82 C;  3PSI A;  4B9X A;  3CRK C;  1PH3 A;  3I56 A;  1I6H B;  1EY4 A;  1WTQ A;  1STE A;  2JA5 B;  2NVT B;  1M8A A;  4JG2 A;  5GQO A;  4DUZ Q;  1OXT A;  3H0G H;  3ND8 A;  2E2I H;  1Q86 C;  2ZJQ A;  1JE5 A;  1YNN D;  2DGY A;  1YEZ A;  4GN4 B;  2WAQ E;  2A6H C;  2VS1 A;  1FJG L;  5GAG C;  1JOO A;  1E24 A;  1STB A;  1TWH B;  1VS0 A;  3KK7 A;  2E2D C;  1V1P B;  5M5W B;  3SK5 A;  4B3M L;  1I4H A;  1WD1 A;  3HZX A;  2QCP X;  3H09 A;  3HFZ B;  2EY5 A;  1U9R A;  3KF8 B;  1SNO A;  1STA A;  1IYV A;  3Q8D A;  4F88 A;  3FVQ A;  3JC6 6;  1OO9 B;  4K2K A;  3OWE B;  1EY7 A;  3TEH B;  3NBH B;  1SR3 A;  1BF4 A;  2UUC L;  1LAC A;  3RD4 A;  4IN3 A;  4KKT A;  2R93 B;  4DV4 L;  1VQD A;  2K50 A;  4HED A;  4B3M Q;  1B44 D;  3WOE A;  5FO9 B;  3BZD B;  1EIG A;  1KDA A;  4EGV A;  1JOR A;  1LUZ A;  4DR1 L;  3TS2 A;  4H7B A;  4TVA B;  5EQ0 A;  1EYC A;  2J7Z A;  1EOT A;  2C9O A;  3E0J A;  2MNA A;  1SFO H;  1C7Y A;  4C1N I;  3MEH A;  2YV5 A;  4R4T A;  1EU4 A;  1PH8 A;  3CU7 A;  3DEP A;  2H4O A;  2JXM B;  4FVM A;  4DV4 Q;  2NYZ D;  5JVG 3;  4GNX C;  2K32 A;  3MHB A;  5DAU A;  4QF4 A;  1PZI D;  3HRZ C;  1FNU A;  3KUP A;  4LAA A;  3FKI G;  2RDH A;  2QF7 A;  4DV3 Q;  2QW7 A;  2RCN A;  1LTA D;  1PTO H;  3FPU B;  1BBU A;  1HQM C;  1YVC A;  1SYD A;  3CME A;  4IQZ A;  3A54 A;  4JOI C;  4A3I G;  1QVC A;  5JEA G;  3S1Q H;  3SK4 A;  1WTO A;  1EOV A;  2JA7 G;  1C0A A;  1C48 A;  2B63 H;  5IGF A;  2R7Z H;  3HOU B;  1V1O A;  2AKW B;  2HIV A;  3RLN A;  2GVB A;  4IAL A;  3SHL A;  2SNM A;  3GTO B;  5E3F A;  2IWH A;  1CZG A;  1MGS A;  1U5K A;  3OTO L;  2K05 A;  5ELD A;  2E2J B;  1O7I A;  4WJ3 M;  1VQJ A;  3PO2 G;  1XMO L;  4IUP A;  1HQR D;  3TDQ A;  4NXN L;  4R4I A;  1Z47 A;  1SXT A;  4RFB A;  3X3M A;  2F0E A;  4HID A;  1EEF D;  3PUX A;  1WTH A;  2Y0S G;  3HOY H;  3AU7 A;  4DNT B;  2FFK B;  4R4O A;  2NBF A;  3NWS A;  4A3E H;  4OWW B;  1EWI A;  5KYL A;  2PQA A;  3E5S A;  3OTO Q;  2CH4 A;  3M4O B;  4UPA A;  4GKK L;  1EWH A;  3NBI A;  5AJ3 L;  2N78 A;  4X65 L;  2B2T C;  4B3R L;  4LF5 Q;  3I4O A;  3U9S A;  1VQE A;  1SNM A;  2L0C A;  1AZQ A;  4A3L G;  2IHF A;  5M3F B;  4KK7 A;  3JAM E;  1PH4 A;  2I07 B;  3L7Z C;  1MI2 A;  4CBV A;  2Q8I B;  2AWN A;  2OT2 A;  2ZXP A;  4CKC A;  2NZH A;  4P73 A;  1BXT A;  4DR6 Q;  3NTK A;  4DV0 L;  1HJP A;  4GKK Q;  3OHX C;  1DOM A;  5C0X I;  2VW9 A;  1X3P A;  5T1I A;  4ULL A;  3J7A F;  1JMC A;  3QWN A;  3AEV A;  5F2D A;  2OQ0 A;  1CQV A;  5D14 A;  2EYJ A;  2R7D A;  1JJ2 A;  4IUQ A;  1PH9 A;  3RZD B;  2WIN B;  3GO5 A;  4IO9 A;  2PQA B;  4LF9 L;  4YWM A;  1PXU A;  1T9H A;  3PO3 G;  3I8Z A;  4DV0 Q;  1ENC A;  2VZA A;  1VQI A;  5IP9 H;  5H1S E;  1QCB D;  2ZXO A;  1VQ6 A;  1Q3L A;  4G7Z C;  2NN6 H;  3ER0 A;  5FLX L;  2GN5 A;  1XNQ Q;  4RAU C;  4YWL A;  4ABN A;  4JI4 L;  3M4Y A;  4LF9 Q;  1DOL A;  3FKI H;  4K5X A;  1A6X A;  3CW2 C;  5C4X B;  4E6I A;  1EIY B;  5EGT A;  1G29 1;  5I2Y A;  4P2C B;  4WOR A;  1N34 L;  1D5Z C;  1LTT D;  4R8I A;  1VQ7 A;  3UDX A;  2Z6K C;  1E22 A;  1RDP D;  1TWC B;  2QIL A;  4LW1 A;  5NUC A;  1SRO A;  4A3K H;  1K9M C;  2Q2T A;  4OIJ A;  5ELF A;  3QB3 A;  3KDF A;  2JA7 H;  3J7Z C;  2NZO A;  1QG7 A;  2LXJ A;  4WJW A;  5E7N A;  5C4Z A;  1X6O A;  2FHT A;  1H95 A;  2K5H A;  5CMD A;  4N9P A;  1XJV A;  4BXX G;  5HGT A;  2ICI A;  3GTJ H;  4BY7 G;  4NP5 A;  4IOA A;  1TWF B;  2MQH A;  1WTX A;  3T1Y L;  5COY A;  1RKN A;  2K5W A;  1GJX A;  3I2Z A;  4OX9 Q;  1HRJ A;  2QEJ C;  3NQT A;  4LF4 L;  4O0A A;  4PZ6 A;  1TS5 A;  1XXG A;  4RHS A;  4LWC A;  4XYO A;  5C44 G;  1M90 C;  1BVS A;  5EAY A;  3KYH C;  3J81 j;  3HKZ G;  1XTC D;  2NVX H;  3LWE A;  4LF7 Q;  4LUV A;  4XXE A;  1FYC A;  1IBK L;  1EY9 A;  2KUM A;  2PMZ B;  4JI0 L;  2CQO A;  3R2T A;  2PNR C;  4IPG A;  1ZYR C;  1KRS A;  4I7Z C;  5C4J H;  4LF4 Q;  4X6A H;  1STN A;  1B3A A;  4FDB A;  4K8I A;  4A3L H;  2K28 A;  4JBW A;  2AWO A;  3CQZ B;  2OXP A;  4A3F G;  3ITP A;  1HTL D;  3W1B A;  4X66 L;  1IBK Q;  4GN3 B;  4MTN A;  3A8J E;  2B2Y C;  3ONA B;  4HJ7 A;  3DWQ A;  4JI0 Q;  1EYA A;  4LFC L;  3QR8 A;  2WKC A;  5EBC A;  4J15 A;  2F0T A;  5C3E B;  5FJ8 H;  2HQE A;  1N8R C;  5I9P A;  4YCV A;  3MA2 B;  1MSG A;  1SYF A;  3K5L A;  4EQN A;  1PYS B;  1HNX L;  2F0W A;  1TY2 A;  2A8V A;  4IJH A;  2F0Q A;  3ND9 A;  4CKB A;  5IYD G;  1SNC A;  1AW7 A;  4P75 A;  1AE2 A;  1IW7 C;  1CTM A;  3UDF A;  1I4G A;  1LT4 D;  2XRQ D;  2F0D A;  2XVS A;  4OXP A;  1PRT B;  1STG A;  2K5V A;  1KTK A;  4NPS A;  4IUN A;  5ISR A;  5CV7 A;  2PQE A;  4FP5 D;  1L1O B;  5FK9 C;  4L6T B;  1KAA A;  3RLO A;  4J1M A;  2EJM A;  2A5H A;  4MN3 A;  5DEH A;  1XWE A;  3GTG H;  5BN3 A;  4KHZ A;  1N36 L;  1ASY A;  3A7L A;  3NXW A;  1QUQ A;  4ZCK A;  4IFD H;  1X3Q A;  1SJE D;  3JAM c;  2Z0S A;  4AIM A;  4BBR H;  4C3I H;  1B50 A;  2EYL A;  3S14 H;  1X3F A;  4BBS G;  2O4X A;  5I9O A;  3MFG A;  3HP3 A;  4C3J B;  3QJY A;  3CRL C;  1HA6 A;  2OTL A;  2QDB A;  2RHS B;  1N36 Q;  1CFM A;  1BNZ A;  4BY7 H;  2K75 A;  1QNU A;  3TP7 A;  4JYA Q;  3FPP A;  3HOX B;  3TBI B;  3S2D B;  4C1N K;  4ZKC B;  4A3D H;  4DA2 A;  3S16 H;  3PCO B;  2KCT A;  1HA5 A;  4RCO A;  2HDM A;  2A73 B;  5J3B A;  4OEL B;  4X64 Q;  3VR5 A;  2F0O A;  2DUD A;  3A7A B;  3NEN A;  1YIT A;  2VUM H;  3PUV A;  2R92 B;  3PUW A;  1B1Z A;  1LTS D;  1PZK D;  1O78 A;  1VQH A;  3IFT A;  4DV7 L;  2CWP A;  2FXQ A;  4ZAI A;  1NSN S;  1Y14 B;  3TP8 A;  1HUN A;  1KAW A;  1YHQ A;  4DV6 L;  2TMP A;  3H91 A;  4JVZ A;  2B29 A;  3CCM A;  4ZUJ A;  5CV8 A;  1SYG A;  2ZTC A;  3F2U A;  3L2P A;  4FF2 A;  2EY6 A;  1SLJ A;  1I6H H;  2F0H A;  1JT8 A;  3PIP A;  2NVT H;  1KNE A;  4DV7 Q;  1X55 A;  2IW3 A;  1K0R A;  5CGK A;  4DV6 Q;  1VQ8 A;  2JA8 G;  1LLR D;  4AYB G;  5LMU L;  1II3 A;  4OIK A;  4A3B G;  3RR5 A;  4DGZ A;  5LMN L;  1PRT D;  2FJ2 A;  3P1H A;  5KND A;  5C0X G;  1F2Y A;  1TWH H;  1NR4 A;  5DM6 3;  1A3V A;  1BO0 A;  2EY2 A;  5M5W H;  4A3G G;  1RF2 D;  4QUC A;  1WD0 A;  5DM7 3;  1HTP A;  2CH4 W;  5KNB A;  2CFM A;  5IYD H;  1E3P A;  2WAC A;  1TR5 A;  3T13 A;  2XNA C;  4RG1 A;  2JA6 G;  3NSW A;  2N55 A;  3CMA A;  2WAQ B;  5LMU Q;  1PV4 A;  3J80 E;  1F2L A;  4DR7 L;  2R93 H;  1U4R A;  5E1F A;  3S2H B;  4MNO A;  5EKK A;  2UU9 L;  5HUR A;  1DM0 B;  2F52 A;  3H0G G;  1Z7T A;  1E7Z A;  4K5W A;  3D31 A;  5D3D A;  5JJK A;  1JQY D;  2B2W C;  1F2Z A;  1QOH A;  3GTP B;  1Q81 C;  4DR7 Q;  2Z4H A;  1CA6 A;  1ROD A;  1V1Q A;  4HSP A;  3HOV B;  2I5M X;  1A2T A;  2PZT A;  4JW0 A;  2UU9 Q;  1RTN A;  1BCP C;  2DY7 A;  1VQM A;  2SDF A;  2OCE A;  4A93 B;  3GTK B;  1KD1 C;  5DNF A;  5IOC A;  1UE1 A;  3U4Z A;  3S9W A;  3VR4 A;  4IPC A;  1H9K A;  4UP8 A;  2Z4I A;  2RKS A;  2B3G A;  3LGJ A;  3MXN A;  1JJC B;  3L9A X;  1ML0 D;  2JE6 I;  5LHY 1;  1DCZ A;  3HOU H;  3F1Z A;  3G4S A;  3KOJ A;  4IUU A;  2A74 C;  3UE1 A;  3CCR A;  2UXC L;  3K5O A;  1MJC A;  3HS0 C;  1LM0 A;  3GTO H;  4JK1 C;  5C3X A;  1OXX K;  1S3O A;  2E2J H;  3E6Z X;  4A3J B;  4KJN A;  3T56 B;  4DXG A;  4DUY Q;  3G6E A;  4PMC A;  5EKL A;  1STH A;  1SMY C;  3VYT A;  4CJ0 B;  4A3M B;  4JI6 L;  4FXD A;  2BE5 C;  2VQF Q;  1VF5 C;  1OXU A;  3R2I A;  3MZ5 A;  1VQC A;  4GLA C;  1V9P A;  3MXN B;  3U4V A;  3SDZ A;  3M4O H;  2K6A A;  2RVL A;  4ALP A;  2A1A A;  4JC0 A;  2A6E D;  2NWG A;  3J81 E;  3J7A 5;  3H94 A;  2Q2U A;  1E2Z A;  4YHH Q;  4KTA A;  1NCV A;  1WVL A;  1GHJ A;  5C0X H;  4PQX A;  4XDX A;  2B63 G;  3HOW B;  5M3F H;  4MZ9 A;  2PYK A;  3DWA A;  1XYI A;  1PH2 A;  2E74 C;  5KRU A;  1FVI A;  3MXP A;  4PMW A;  3HKS A;  4DUZ L;  1K28 A;  1HFN A;  3E0E A;  2B2V A;  5T1G A;  5IOD A;  3I73 A;  4UY8 C;  2QGQ A;  4JCV E;  4MIU A;  4O2D A;  5ELO A;  1NTG A;  2XN9 C;  2ZJP A;  2CHB D;  4GKJ L;  1TWG B;  4K5V A;  1Q90 A;  5CYU A;  1TII D;  3HOY G;  1CSQ A;  3TP6 A;  3EFX D;  1PFM A;  4UDU C;  4DN4 M;  2QDL A;  1A0I A;  4A3E G;  3QIA A;  4O42 A;  3BG3 A;  1MHW C;  4HSV A;  5DLQ E;  3MVV A;  2RSO A;  1G91 A;  4KD3 A;  1LV9 A;  3BDO A;  2HQL A;  2KA7 A;  1ZEQ X;  1AE3 A;  2YYZ A;  1SYC A;  1GVP A;  1K8A C;  1RL2 A;  1GHK A;  4GKJ Q;  3I4N B;  3BVM A;  3H15 A;  2F0J A;  5C4X H;  4QB4 A;  2B2U A;  3HGB A;  4OO1 I;  1EQT A;  1NMG A;  3N6R A;  3K58 A;  4HIM A;  1VQ5 A;  3CF5 A;  1EY6 A;  3PUZ A;  4IUR A;  3G48 A;  2Y0S E;  1TWC H;  3QOJ A;  5A2Q E;  1EU3 A;  2X6G A;  3I3C A;  2R7F A;  3KJO A;  2K7V A;  3I4L A;  3PF5 A;  3CCQ A;  1UEA B;  1B2T A;  1GUG A;  1HXY D;  4JI8 Q;  1G2T A;  4XTC S;  5M3M B;  4DV3 L;  4LFA L;  1TS2 A;  5IP7 H;  1VF7 A;  1TWF H;  1TS4 A;  5C5L A;  3HOX G;  5IP9 G;  1T5E A;  3F8T A;  1D5M C;  4V0B A;  3PIO 3;  1IKM A;  2NN6 G;  3C1E A;  3I4M B;  3E9I A;  5JOB A;  2F0S A;  4LFA Q;  1WCM B;  2ZT9 C;  3WDN A;  1L2F A; 
#chains in the Genus database with same CATH homology
 3VYR A;  5JJZ A;  1RJT A;  3S15 B;  3A8I E;  2EYP A;  5K5P A;  3NWT A;  1GUS A;  4HMI A;  2MHV A;  3OPO A;  3JAM L;  4U67 3;  5JAV A;  3LWU A;  1WTP A;  3NPP A;  4RGT A;  2FMC A;  3K57 A;  1SMY D;  2VB2 X;  1F9R A;  3DWP A;  2BA0 A;  3BDC A;  2IX3 A;  2B39 A;  4TSS A;  1GUT A;  1H9R A;  1ZXT A;  3EA6 A;  4K14 A;  2M9V A;  1SYB A;  3AMU A;  1PFN A;  4DAY A;  1PLF A;  2LMC B;  1GOZ A;  5CBE E;  1FNW A;  1VDZ A;  5G3L D;  1Y1V B;  1H9M A;  1UNS A;  2JP1 A;  2BOS A;  1PRT F;  4DK1 A;  4LMQ D;  2CW0 D;  1S5C D;  1J9O A;  1F2M A;  4YIJ A;  3QO2 A;  3SE0 A;  1K8M A;  2EZV A;  1LTR D;  4DNR B;  3VYU A;  3QG1 A;  4BY1 B;  3G6J B;  2B2T A;  1Y1W B;  2VB3 X;  1L0Y B;  3WOF A;  4Q0F A;  1HPC A;  2XWB B;  2L1B A;  2RSN A;  3RLF A;  3GV3 A;  4BWG B;  2KCN A;  3W3A A;  4DU9 A;  1GUN A;  2WV6 D;  5CC4 A;  2A6H D;  5IGE A;  2E2H B;  2L12 A;  4RKL A;  1PDQ A;  2D62 A;  1E2W A;  2XSC A;  4ZKB B;  4QUF A;  3GQB A;  5J1Z A;  3U9O A;  2AUK A;  3KLR A;  1X32 A;  2L11 A;  1SE2 A;  2E2I B;  4IFD G;  2MUY A;  1PTO C;  4HN7 A;  1KNA A;  4B08 A;  1E0B A;  4EQO A;  4C3I G;  1SBB B;  1Q8I A;  4C3H B;  2KVM A;  3DHQ A;  1WTW A;  3A8K E;  5JPM C;  2EYH A;  1EZ6 A;  1MBY A;  1Q1E A;  1S5B D;  1EY5 A;  1BDO A;  1GUO A;  1B53 A;  1D1K A;  3KBX A;  2F0F A;  1TWA B;  3C2P A;  2BA1 A;  4NW2 A;  4FNF A;  4CHT B;  1S4Z A;  1D1I A;  1JB3 A;  4X3S A;  3S17 B;  4ZLT F;  2KOL A;  2LY7 A;  5JEA J;  2K1B A;  3VR2 A;  2PZW A;  1VMP A;  5M5X B;  2F3V A;  4KY6 A;  3HG9 A;  1QIL A;  2EXZ A;  2L5T A;  2PO4 A;  1D6E C;  1EQV A;  2IJ0 A;  1RCV D;  2JSO A;  1CT1 D;  2Z1C A;  2F0N A;  3GD7 A;  2A68 C;  4KY5 A;  1PMR A;  3S1R B;  3PMF A;  4XQQ A;  3ERQ A;  4IZ8 A;  3M3Y B;  1LTI D;  4KI0 A;  1H9J A;  5C5M A;  1HCZ A;  4RKB A;  1ENF A;  1FGB D;  2B2Y A;  1CA5 A;  2NTT A;  1OXV A;  4F87 A;  2E75 C;  5KGU A;  1IL8 A;  1LT3 D;  2AQ2 B;  2NVY B;  2F0G A;  3P7J A;  1Y8N B;  1IYU A;  3QOL A;  3Q24 A;  1BOS A;  3Q6S A;  2BDO A;  4FF1 A;  2R61 A;  1SE3 A;  2L55 A;  2FMM A;  1D2B A;  1CHQ D;  1ESF A;  1STY A;  5EJW A;  4F8M A;  3V05 A;  1JWS D;  1YNJ C;  3BYT B;  1F9P A;  5LL6 S;  3Q22 A;  3CHB D;  4Y7N B;  4RGM A;  2EPB A;  3BYY B;  1KLU D;  1ILP A;  1ET9 A;  4L8J A;  3VR3 A;  1BCP F;  3D6W A;  4Q5V A;  1I3Q B;  1JE4 A;  1O7L A;  2DY8 A;  2F0M A;  3FDT A;  3J80 L;  1Y8O B;  1R4P B;  2EYM A;  2KQ3 A;  2D9U A;  4EQP A;  5IGD A;  1DD2 A;  2J4X A;  3C3L A;  2EOT A;  1JWM D;  2VNU D;  1ONL A;  4OO1 H;  2EE1 A;  5I6W A;  4RH6 A;  4XIG S;  1I4X A;  3KBG A;  2A69 C;  1KDC A;  4OHJ A;  4A3I B;  3I72 A;  3TZU A;  3C46 A;  1DYQ A;  1B9M A;  2K01 A;  3P75 A;  3MTS A;  3UI2 A;  2JA7 B;  2FIN B;  4K2L A;  4K8J A;  2E76 C;  4NDX A;  1EY8 A;  5IGC A;  2LS0 1;  2F0U A;  2TSS A;  5AFW A;  4XT3 B;  3DXJ C;  2SOB A;  5ELB A;  1ZYR D;  3PO2 B;  1YNN C;  3NTI A;  3VA7 A;  2K33 A;  2F1M A;  1QNK A;  5G3L F;  4GZY C;  3IKJ A;  4IUV A;  1LAB A;  2Y0S B;  2K5D A;  1FR3 A;  2RBM A;  4RA8 A;  3EVQ A;  2KED A;  2SEB D;  1C4Q A;  1F9Q A;  2GA4 B;  2JEA I;  4ID6 A;  1S5D D;  4TQU S;  1ET6 A;  4KN7 C;  5BN5 A;  3G7L A;  1IW7 D;  2WP8 J;  1CK1 A;  1CI3 M;  5FO7 B;  3D3R A;  2F0L A;  2B2W A;  1JOQ A;  3NTH A;  4FXG C;  5JVH 3;  1JC7 A;  5A35 A;  2EYF A;  3RUZ A;  1RHP A;  1O7Y A;  3PO3 B;  1S5F D;  3K6O A;  1IHZ A;  2HUG A;  2JYO A;  1A3T A;  1W6J A;  5BN4 A;  1DOK A;  1CQF A;  2PCF B;  5IT9 E;  2F0P A;  5ELC A;  4HCE A;  3NHH A;  3SVM A;  4OGQ C;  3VA5 A;  3OOC A;  4ME5 A;  1EYD A;  3MXG A;  3DUZ A;  5I2X A;  1DJR D;  3BS1 A;  3TSS A;  3V96 A;  1BCP B;  3GTQ B;  3K5M A;  2PW7 A;  3CKI B;  5EPK A;  1EFI D;  2G9D A;  4KKU A;  3K7A B;  4C2M B;  1QE6 A;  2IPK D;  1WTV A;  1AZP A;  3BDL A;  4G7O C;  1A2U A;  4G7H C;  3S1N B;  5A2Q L;  1FD7 D;  2Q8R E;  3NUC A;  4RHR A;  2WB1 B;  3D4R A;  4ZQ3 A;  2WII B;  4QCL A;  4PNY A;  1TT2 A;  1SDF A;  5LL6 X;  5C44 B;  2KEE A;  5K36 H;  4C56 C;  3HKZ B;  2A69 D;  4RCN A;  5KNC A;  2AQ1 B;  4LJZ C;  3BVZ A;  1S5E D;  5D65 A;  4J6H A;  1XX8 A;  2D2C C;  1Z6H A;  3DM1 A;  5C6A A;  1JOK A;  4RGN A;  3EJI A;  2B2U C;  1DON A;  2VXW A;  2X6L A;  2Q8T A;  2ZXR A;  4A3F B;  3T51 B;  4M1U B;  5EBD A;  1PYW D;  3FMC A;  2SNS A;  1E2V A;  1TU2 B;  3URY A;  2L9H A;  4C3J G;  1EEI D;  3Q0A A;  4DF7 A;  4DXF A;  5C3W A;  4KD4 A;  4HCS A;  1SNP A;  4DAV A;  5E4W C;  1MD2 D;  1EY0 A;  3D4D A;  1IKL A;  1I50 B;  3R93 A;  1BCP D;  1SNQ A;  3W2D A;  4RGO S;  4N9T A;  1D5X C;  1G2S A;  2MJ8 A;  3FEW X;  2IL8 A;  4XT1 B;  2AQ3 B;  4WRD A;  3TME A;  4ZYS A;  3GTL B;  2M2L A;  5EKI A;  3Q23 A;  2LKV A;  2YU9 B;  1HHV A;  3NQI A;  2B8F A;  4BBS B;  4KKS A;  4XQN A;  1F9S A;  1SND A;  4ODG A;  5D3I B;  1C8C A;  3PV0 A;  5KEE A;  4Z9C B;  3PUY A;  3R3O A;  1GXD C;  1PTO F;  2BE5 D;  5M9O A;  2KEC A;  4NMZ A;  3S1M B;  1MSH A;  3C1F A;  5CV9 A;  2V4D A;  4R9W A;  1Y8P B;  1UUP A;  4R8N A;  1CHP D;  3OIP A;  1BBX C;  1SJH D;  3KLS X;  2EVB A;  2NVQ B;  2BDN A;  1AP0 A;  3OMG A;  2EJF C;  3HOZ B;  4X3T A;  2K5Q A;  1ENA A;  4MHE A;  2JA8 B;  4AYB B;  2EDG A;  1FNV A;  3RZO B;  4A3B B;  2I46 A;  4KY7 A;  4A3G B;  1T5X D;  3A55 A;  4K6D A;  1SE4 A;  4BA1 I;  4UAI A;  1R9T B;  1H9S A;  4KJO A;  5M5Y B;  5J39 A;  2JA6 B;  5FKA C;  2LFN A;  3GTM B;  1EZ8 A;  3X3N A;  1BR9 A;  2O2L D;  2NZ1 D;  1LO5 D;  3H0G B;  2NB0 A;  3I70 A;  3MC0 B;  3ERO A;  4XYQ A;  1R4Q B;  1EL0 A;  3DMU A;  2RDG A;  2X69 A;  3NP8 A;  4ZRZ A;  1H9S B;  1V8Q A;  2WKD A;  5ELE A;  1B4O A;  2ENB A;  4O1N A;  4CGY B;  4XQJ A;  1I4R A;  1AN8 A;  3OW7 A;  1WTR A;  1EIH A;  5JEA H;  2PPB C;  4HTH A;  2O5I C;  4J8Q A;  2F03 A;  4BA2 I;  3A56 A;  5I4D A;  1NAP A;  1VCI A;  2DNE A;  1SYE A;  1RTO A;  2XRS D;  1TKW B;  3M7N A;  1SFO B;  2HCC A;  1A3U A;  4QMG A;  1AFP A;  3FRP B;  5CR3 A;  1PRT C;  5FLX E;  1JWU D;  5COR A;  4PV1 C;  1NUC A;  4F7X A;  2XIW A;  4HMJ A;  1PTO B;  2QKI C;  5IGG A;  2CQA A;  4V19 0;  4OO1 G;  2IX1 A;  1A15 A;  3S1Q B;  3H6M A;  2BCO A;  5IIF A;  3IAY A;  3T53 B;  1K8O A;  1Q12 A;  3R8B A;  2B63 B;  2R7Z B;  1NR2 A;  3OMC A;  2K04 A;  3ZYY X;  3SK6 A;  1O80 A;  3P20 A;  5EPL A;  4KV6 A;  4ILW A;  2NTS A;  1LT5 D;  4H0L C;  1U4P A;  1TQO A;  3D8G A;  2G9H D;  1U4M A;  2KJX A;  2K03 A;  2EYO A;  5TSS A;  4ZK9 B;  5CV6 A;  5I6Y A;  2O5J C;  3BVG A;  3TP5 A;  4FYD A;  3OSO A;  3GP7 A;  3HOY B;  2HCI A;  4H44 C;  3IL8 A;  4A3E B;  4X3K A;  1OXS C;  3K59 A;  2DNC A;  4FO2 A;  5E4X A;  1O7Z A;  3SK8 A;  4CJ1 B;  4BS9 A;  1G6Z A;  1KDB A;  3T16 A;  4KN4 C;  5C4H A;  1I6V C;  5JPN C;  3K0Y A;  4TRD A;  3T4A C;  1M4V A;  3V2T A;  3PIP 3;  4DAP A;  2PW5 A;  2XWJ B;  1KAB A;  2OEO A;  5CBA E;  2R6G A;  3J7A V;  2MPM A;  1LTB D;  4QIW B;  4EVO A;  3MWY W;  4G57 A;  1BQQ T;  1JR0 D;  3TZD A;  1HUM A;  2J0T D;  1PTO D;  1PZJ D;  1F77 A;  5J22 A;  4IFD J;  2F0V A;  5CV4 A;  2A6E C;  4CJ2 C;  2HDL A;  3SEB A;  4FF3 A;  4FXK C;  2D5D A;  2RDF A;  1ZKO A;  3L3O C;  2N88 A;  3FKI B;  1JCK B;  2MGS A;  1HFG A;  5FO8 B;  3RMH A;  2IX0 A;  3J7Y W;  3M85 A;  1GUW A;  3OWF A;  2NN6 I;  1I4P A;  3N52 A;  1G8Z D;  4A3K B;  4X3U A;  3M7G A;  1QB5 D;  3OIQ A;  4FF4 A;  1W6K A;  1VMC A;  2KHS A;  3I91 A;  4K6L A;  1Y69 U;  3VYS A;  1JIC A;  1EWC A;  3GTJ B;  2ICE C;  1KLG D;  1TS3 A;  1TVX A;  2C5C A;  1RD9 D;  3MFY A;  2R3Z A;  4ZUI A;  2MP1 A;  3SR1 A;  1DXM A;  3VR6 A;  4M8A A;  1J8I A;  1V43 A;  2KCC A;  1SSO A;  5K36 G;  2NVX B;  1SAP A;  2OF1 A;  4DK0 A;  2A68 D;  1ESR A;  1ICW A;  5C4J B;  4NKL A;  5IT9 L;  1ILQ A;  1SEB D;  3D4W A;  4IUT A;  4LK1 C;  3MXU A;  1K83 B;  3GV6 A;  4DFA A;  1LT6 D;  2JEB I;  3NE5 B;  3J81 L;  4TKO B;  1CZW A;  2F3W A;  3SXH A;  3O13 A;  4C3H G;  2EY1 A;  3HEJ A;  4S3S A;  1B9N A;  4U68 A;  3I90 A;  1QWY A;  3EQL C;  5EPJ A;  2PZU A;  5KYI A;  2H1E A;  3LX0 A;  3D6C A;  3KLS A;  1YNJ D;  4WFN 3;  3K5N A;  4KMU C;  3H3V C;  1U4L A;  3GTG B;  4B9W A;  1L0X B;  4L63 B;  4PMB A;  5IGB A;  1LTG D;  2ID0 A;  4HR7 B;  2RQX A;  5CV5 A;  2IT1 A;  4BBR B;  1TY0 A;  4C3I B;  4CKE A;  3S14 B;  1Q1B A;  2AUJ D;  5FOB B;  3TN2 A;  3DEO A;  1DZ1 A;  1CM9 A;  3NK9 A;  4IFD I;  4HAE A;  2RA4 A;  4BY7 B;  4H13 C;  1PFB A;  2CVR A;  2M00 A;  2B2V C;  2NUC A;  2F0I A;  2L4N A;  1AEX A;  4G4K A;  1I4Q A;  3AB9 A;  5KIX A;  4A3D B;  1BUV T;  3S16 B;  1QJO A;  3LNN A;  1UAP A;  1V1P A;  2B8G A;  2DN8 A;  2EJG C;  4RWS C;  2CW0 C;  2VUM B;  2F0K A;  4I65 A;  3MAQ A;  4OL7 A;  3KF8 A;  2F4I A;  3IFD A;  3NBH A;  5C0X J;  2Z8L A;  4KHV A;  4B9X A;  3CRK C;  1I6H B;  1EY4 A;  1WTQ A;  1STE A;  2JA5 B;  2NVT B;  1M8A A;  1OXT A;  3ND8 A;  1YNN D;  2A6H C;  1JOO A;  1TWH B;  1STB A;  3KK7 A;  2E2D C;  1V1P B;  5M5W B;  3SK5 A;  1I4H A;  1WD1 A;  3HZX A;  2QCP X;  3H09 A;  2EY5 A;  1U9R A;  1SNO A;  1STA A;  1IYV A;  4F88 A;  3FVQ A;  1OO9 B;  4K2K A;  1EY7 A;  3OWE B;  1BF4 A;  1LAC A;  3RD4 A;  4IN3 A;  4KKT A;  2R93 B;  4HED A;  1B44 D;  3WOE A;  5FO9 B;  3BZD B;  1EIG A;  1KDA A;  4EGV A;  1JOR A;  4H7B A;  5EQ0 A;  1EYC A;  2J7Z A;  1EOT A;  2C9O A;  3E0J A;  4C1N I;  3MEH A;  1EU4 A;  3CU7 A;  3DEP A;  2H4O A;  2JXM B;  4FVM A;  2NYZ D;  5JVG 3;  2K32 A;  3MHB A;  5DAU A;  4QF4 A;  1PZI D;  3HRZ C;  1FNU A;  3KUP A;  4LAA A;  2RDH A;  2QF7 A;  1LTA D;  1PTO H;  3FPU B;  1HQM C;  1SYD A;  4IQZ A;  3A54 A;  5JEA G;  3SK4 A;  1WTO A;  1C48 A;  3HOU B;  5IGF A;  1V1O A;  4IAL A;  3SHL A;  2SNM A;  3GTO B;  5E3F A;  2IWH A;  1CZG A;  1MGS A;  2K05 A;  5ELD A;  2E2J B;  4IUP A;  1HQR D;  3TDQ A;  1Z47 A;  1SXT A;  4RFB A;  3X3M A;  2F0E A;  1EEF D;  3PUX A;  3AU7 A;  4DNT B;  2FFK B;  2NBF A;  3NWS A;  5KYL A;  3E5S A;  3M4O B;  1EWH A;  3NBI A;  2B2T C;  3U9S A;  1SNM A;  2L0C A;  1AZQ A;  5M3F B;  4KK7 A;  3JAM E;  2I07 B;  3L7Z C;  1MI2 A;  4CBV A;  2Q8I B;  2AWN A;  2OT2 A;  2ZXP A;  4CKC A;  1BXT A;  3NTK A;  3OHX C;  1DOM A;  5C0X I;  1X3P A;  5T1I A;  4ULL A;  3J7A F;  3QWN A;  5F2D A;  1CQV A;  5D14 A;  2EYJ A;  4IUQ A;  3RZD B;  2WIN B;  3GO5 A;  1PXU A;  3I8Z A;  1ENC A;  1QCB D;  2ZXO A;  1Q3L A;  4G7Z C;  2NN6 H;  5FLX L;  4RAU C;  4ABN A;  3M4Y A;  1DOL A;  4K5X A;  1A6X A;  5C4X B;  4E6I A;  5EGT A;  1G29 1;  5I2Y A;  4P2C B;  4WOR A;  1D5Z C;  1LTT D;  4R8I A;  1TWC B;  1RDP D;  2QIL A;  5NUC A;  4OIJ A;  5ELF A;  3QB3 A;  1QG7 A;  4WJW A;  5C4Z A;  2FHT A;  5CMD A;  4N9P A;  5HGT A;  2ICI A;  4NP5 A;  1TWF B;  1WTX A;  5COY A;  1RKN A;  2K5W A;  1GJX A;  1HRJ A;  2QEJ C;  3NQT A;  1TS5 A;  1XXG A;  4RHS A;  4XYO A;  1XTC D;  3LWE A;  4XXE A;  1FYC A;  1EY9 A;  2KUM A;  2PMZ B;  3R2T A;  2PNR C;  1ZYR C;  4I7Z C;  1STN A;  1B3A A;  4K8I A;  2K28 A;  4JBW A;  2AWO A;  3CQZ B;  2OXP A;  3ITP A;  1HTL D;  3A8J E;  2B2Y C;  3ONA B;  3DWQ A;  1EYA A;  2WKC A;  5EBC A;  2F0T A;  5C3E B;  2HQE A;  5I9P A;  3MA2 B;  1MSG A;  1SYF A;  3K5L A;  4EQN A;  2F0W A;  1TY2 A;  2F0Q A;  3ND9 A;  4CKB A;  1SNC A;  1AW7 A;  1IW7 C;  1CTM A;  1I4G A;  1LT4 D;  2XRQ D;  2F0D A;  2XVS A;  1PRT B;  1STG A;  1KTK A;  4IUN A;  5ISR A;  5CV7 A;  2PQE A;  4FP5 D;  5FK9 C;  4L6T B;  1KAA A;  4J1M A;  2EJM A;  2A5H A;  4MN3 A;  5DEH A;  1XWE A;  5BN3 A;  4KHZ A;  3A7L A;  3NXW A;  4IFD H;  1X3Q A;  1SJE D;  1B50 A;  2EYL A;  2O4X A;  5I9O A;  3MFG A;  3HP3 A;  4C3J B;  3QJY A;  3CRL C;  1HA6 A;  2QDB A;  1CFM A;  1BNZ A;  1QNU A;  3TP7 A;  3FPP A;  3HOX B;  3TBI B;  3S2D B;  4ZKC B;  4C1N K;  4DA2 A;  1HA5 A;  4RCO A;  2HDM A;  2A73 B;  3VR5 A;  2F0O A;  3A7A B;  2R92 B;  3PUV A;  3PUW A;  1B1Z A;  1LTS D;  1PZK D;  1O78 A;  3IFT A;  4ZAI A;  1NSN S;  3TP8 A;  1HUN A;  2TMP A;  3H91 A;  4ZUJ A;  5CV8 A;  1SYG A;  3F2U A;  4FF2 A;  2EY6 A;  2F0H A;  1KNE A;  2IW3 A;  5CGK A;  1LLR D;  1II3 A;  4OIK A;  4DGZ A;  1PRT D;  2FJ2 A;  3P1H A;  5KND A;  5C0X G;  1F2Y A;  1NR4 A;  5DM6 3;  1A3V A;  1BO0 A;  2EY2 A;  1RF2 D;  4QUC A;  1WD0 A;  5DM7 3;  1HTP A;  5KNB A;  2WAC A;  1TR5 A;  3T13 A;  2XNA C;  3NSW A;  2N55 A;  2WAQ B;  3J80 E;  1F2L A;  1U4R A;  5E1F A;  3S2H B;  5EKK A;  5HUR A;  1DM0 B;  1Z7T A;  4K5W A;  3D31 A;  5D3D A;  1JQY D;  2B2W C;  1F2Z A;  1QOH A;  3GTP B;  2Z4H A;  1CA6 A;  1ROD A;  4HSP A;  3HOV B;  1A2T A;  2PZT A;  1RTN A;  1BCP C;  2DY7 A;  2SDF A;  4A93 B;  3GTK B;  5DNF A;  5IOC A;  3S9W A;  3VR4 A;  1H9K A;  2Z4I A;  2RKS A;  3MXN A;  3L9A X;  1ML0 D;  2JE6 I;  5LHY 1;  1DCZ A;  4IUU A;  2A74 C;  3K5O A;  3HS0 C;  4JK1 C;  5C3X A;  1OXX K;  3E6Z X;  4A3J B;  4KJN A;  3T56 B;  4DXG A;  4PMC A;  5EKL A;  1STH A;  1SMY C;  3VYT A;  4CJ0 B;  4A3M B;  4FXD A;  2BE5 C;  1VF5 C;  1OXU A;  3R2I A;  3MZ5 A;  3SDZ A;  2K6A A;  2RVL A;  2A6E D;  2NWG A;  3J81 E;  3H94 A;  1E2Z A;  4KTA A;  1NCV A;  1WVL A;  1GHJ A;  5C0X H;  4PQX A;  4XDX A;  3HOW B;  2PYK A;  3DWA A;  1XYI A;  2E74 C;  5KRU A;  3MXP A;  4PMW A;  1HFN A;  5T1G A;  2B2V A;  5IOD A;  3I73 A;  4MIU A;  2XN9 C;  2CHB D;  1TWG B;  4K5V A;  1Q90 A;  5CYU A;  1TII D;  3TP6 A;  3EFX D;  1PFM A;  4UDU C;  4DN4 M;  3QIA A;  4O42 A;  3BG3 A;  4HSV A;  3MVV A;  2RSO A;  1G91 A;  4KD3 A;  1LV9 A;  3BDO A;  2KA7 A;  1ZEQ X;  2YYZ A;  1SYC A;  1GHK A;  3I4N B;  3BVM A;  2F0J A;  4QB4 A;  2B2U A;  3HGB A;  4OO1 I;  1EQT A;  3N6R A;  3K58 A;  1EY6 A;  3PUZ A;  4IUR A;  3QOJ A;  5A2Q E;  1EU3 A;  2X6G A;  3I3C A;  2K7V A;  3I4L A;  1UEA B;  1B2T A;  1GUG A;  1HXY D;  1G2T A;  4XTC S;  5M3M B;  1TS2 A;  1VF7 A;  1TS4 A;  5C5L A;  1T5E A;  1D5M C;  4V0B A;  3PIO 3;  1IKM A;  2NN6 G;  3C1E A;  3I4M B;  5JOB A;  2F0S A;  1WCM B;  2ZT9 C;  3WDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...