2K5QA

Nmr solution structure of membrane associated protein from bacillus cereus: northeast structural genomics consortium target: bcr97a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
105
structure length
105
Chain Sequence
MDLNRMGKDEYYVQITVDGKEVHSKADNGQKYKDYEYKLTGFDKDGKEKELEFTAQKNLRKEAFLRVYHSDKKGVSAWEEVKKDELPAKVKEKLGVKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution Structure of Membrane associated protein from Bacillus cereus: Northeast Structural Genomics Consortium Target: BcR97A
rcsb
source organism Bacillus cereus atcc 14579
molecule tags Membrane protein
molecule keywords Hypothetical Membrane Associated Protein BcR97A
total genus 14
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06486 DUF1093 Protein of unknown function (DUF1093)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.480 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k5qA00
2K5WA 2K5QA 3NPPA
chains in the Genus database with same CATH superfamily
4P71A 5H1SE 3V05A 1BCPC 2UUBL 4DR7L 3PQIA 2EY5A 1GUWA 3E5SA 1PRTD 2CCZA 1N36L 1PV4A 2K75A 2EYOA 1VQJA 4Z9CB 1C7YA 4ME5A 5IYBG 1GHJA 3DWPA 3I56A 1NBWA 2Z4HA 5HGTA 4KKUA 1A62A 1II3A 3RZOH 4HAEA 4GN5A 2D0PA 3EIVA 1SNPA 2YTVA 4RAUC 1MSGA 2RSOA 3DM1A 1ESRA 3TS0A 1SAPA 4X64Q 1IBML 3HOZH 1NR4A 3J81E 4TQUS 3N52A 1PH6A 4NKLA 1UEAB 3K8AA 4HSPA 3CPFA 1VQMA 3J7AF 2EJMA 1I3QH 1A3VA 4BY1G 4IALA 3MXUA 4CJ0B 2JA6G 1TWCB 2HT1A 1S72A 2JA7H 1AH9A 1E24A 4DAVA 1LTID 4POGA 4C3JG 3CQZB 1LV9A 5C3XA 2AQ1B 5KNDA 1SXTA 2YV5A 2JA5B 1EIHA 5JJLA 5K36H 3PGZA 4Y7NH 5C5LA 2KEDA 1KIXA 4DPGA 1D1IA 1D5ZC 4A3BG 2BOSA 2A68C 3ONAB 1WVLA 3PF5A 5M5WH 3JAMi 1EYDA 1WD1A 2E2HB 3HOVG 2HCIA 4J1MA 3NE5B 1VQNA 3O13A 1KTKA 3A5ZB 4M1UB 1LO5D 3CAMA 3SVMA 3VYRA 1S3OA 1IBLQ 3KF8A 4LFCQ 1BCPD 4C3IG 3AFQA 4RCOA 4DV7L 1I3QB 3VYTA 4CDCC 2IPKD 5C4HA 3FP9A 3G48A 3GTOB 4JCVE 4C1NI 4DUZQ 2B63B 3D3RA 5JAVA 4DNRB 3U4VA 1YVCA 3A7AB 4JI0Q 4EX5A 4LFAL 3S2HH 5K5PA 1CTMA 4U673 3E9IA 5IOCA 3GTJH 1PH8A 2QDLA 4DR4L 1K3BC 2YTYA 2R92B 4F7XA 5GADC 1Y1WH 5IWAQ 1C0AA 2E2IH 1H95A 2LMCB 3I4LA 1O78A 2RA4A 4C3IH 5GQOA 1KRSA 2A73B 3ICEA 1S5CD 3S1NH 4ZUJA 2DY8A 3Q0AA 1U9RA 1PXUA 3M4OB 2F0JA 3HOWG 2Q8RE 1SYEA 3VYSA 5IODA 2EDGA 5C4JB 1GUTA 4IPGA 4WJ3M 3I90A 1N33L 1G2SA 4HJ7A 4IJLA 1HJPA 2YYZA 2PO4A 3LGJA 3F2DA 2DN8A 4PZ8A 2J0TD 2CQAA 1PMRA 5FJ8H 4K2LA 4DV5L 1WTPA 5E4XA 2OQKA 2OWOA 5NUCA 3HOWB 2AWOA 3FPPA 1EYCA 1PTOB 4JOIA 1WTHA 1LUZA 4YCWA 1HA6A 3V96A 3TEHB 1XXGA 4LF6L 2K5WA 4DK6C 1K9MC 3NK9A 3K81C 4O42A 4IJHA 4NXNQ 2Y0SG 2KCMA 1DZ1A 1HFGA 5CV6A 2IHEA 3G71A 4NB3A 3S17B 2WAQE 5J3BA 4DAMA 1TWGB 1CSPA 2WB1E 3ZYYX 1VQGA 1JWSD 2M2LA 4CDFC 3R93A 2F52A 4R8NA 4RGMA 1A2UA 4A3MB 2VB2X 2Q2UA 4NDXA 1JJGA 4C3HH 4KHVA 3LWEA 1VQPA 1LT3D 3S2DB 4OONA 3CP0A 3CRLC 3Q23A 4DR5Q 3S15B 2D62A 1C48A 4MNOA 4HCSA 4PZ7A 2A74C 4KI0A 2NBFA 2VB3X 5IIFA 1QVCA 2PPBC 3I4MH 1PZKD 1JOQA 1FGBD 3R2TA 3HOUB 1BCPF 3S17H 1PTOD 5IYCH 1R4QB 1ASZA 4JBWA 1EWCA 2B2VC 4RGTA 1ASYA 2ASBA 4R4OA 4DR1Q 3B6YA 1V43A 3C1EA 1SNCA 2LS01 1V9PA 2MJ8A 5GAHC 3RN2A 4KN4C 2NN6I 2EZVA 4IFDJ 4JOIC 3GTGB 1V8QA 2NZHA 4C3HG 1I50H 5FOBB 4BY7B 2K01A 3J80c 2XGTA 2JA7G 2K05A 3SE0A 4KD3A 1I5FA 1OO9B 2ES2A 1HZCA 2EYHA 2K32A 3S15H 2KHJA 2X69A 3NQTA 2K03A 5DM63 5K36G 1Q90A 4DV4Q 4A3IG 1U4RA 3GTLH 1X3PA 3NBIA 1KAWA 1F9RA 2HHHL 3CU7A 1D5XC 3I4NH 1A2TA 2DNEA 4B3SQ 2QCPX 3F1ZA 2TSSA 3Q6SA 4A3LG 4LF8Q 2RVLA 3VA5A 1DM0B 2A1AA 1XTDA 3GD7A 1SYDA 5FO9B 2NVXB 1MHWC 1W6KA 4AIMA 4LF9L 2K6AA 1S5DD 1EL0A 1VS0A 5EBCA 4YY3Q 2XIWA 2R7ZH 3HOYB 1L2FA 2D5DA 3S16B 4KD4A 4IFDH 1ENCA 4LWCA 4S3SA 2LKVA 3FDTA 3MVVA 4DA2A 2NWGA 1F2MA 2WB1B 3PO3B 1WTOA 1H9SB 3M9BA 1K0SA 1PZJD 2DNCA 4ZUIA 1J8IA 1HNXQ 2A6ED 3J81i 2K5VA 2IY5B 5CV8A 5M3MB 4KKSA 4NXML 1B2TA 3PO2H 4X3KA 1EIGA 3H94A 4WRDA 1UWVA 1X6OA 1YI2A 5C4JH 1BKBA 1STBA 1Y1VH 2VUMG 1FGUA 3UE0A 2LXKA 2WB1G 3F2BA 3HOYH 1Q46A 3HKZG 5C0XH 3HOXH 3URYA 2SEBD 5CBEE 5CGKA 3ND9A 5CORA 2K52A 4DK1A 3S1NB 3DEOA 2Q2HA 1BCPB 4DN4M 2CKZB 1TXYA 4JI4Q 1B50A 1YNXA 4ZAIA 4JI6L 5T1GA 1D5MC 2PNHA 2DJFC 2EIFA 1DGSA 1IYVA 1ENAA 1NE3A 2BDOA 2FJ2A 4OXPA 5HY6A 2E5LL 4HIDA 4R4QA 4ZLTF 1YHQA 2EE1A 3OMCA 1WTRA 4WJWA 2RQXA 3KDFB 5ISRA 1TY2A 3ULPA 3CC2A 2PQAB 4DR3L 4RA8A 1RCVD 3DWQA 2KA7A 4DXFA 4J8QA 1IKLA 2AQ2B 5M9OA 2K4KA 1B9NA 5EPKA 4UP9A 1G291 1TU2B 4QUFA 5I2YA 4EVOA 4A3MG 4KY5A 3NENA 2MPMA 3S1RB 3P1HA 2Z0SA 1CKMA 5DM73 5AJ3L 3FHWA 1XPRA 4LF4Q 2B2YC 4IFDI 1O80A 4K0KQ 3IFTA 4G57A 4IUUA 4K5WA 3NEMA 1JMCA 4XQQA 1MJCA 5FLXL 1PH1A 4EQNA 3BZDB 1D7QA 1Q81C 1X32A 5C0XJ 3SK5A 3I4MB 4IUNA 4DU9A 3RN5A 2BCOA 3PCOB 1WTQA 2N88A 1FVIA 1EIYB 2R93B 1UE5A 2QEXA 4GKKQ 4DKAC 1B44D 2JE6I 2FHTA 1S40A 4L5RC 1Z9FA 1VF7A 4X3TA 5KNCA 2EY2A 3K80C 2ALYB 2M00A 5EJWA 2L12A 2NVQB 3G7LA 1J9OA 1BO0A 2KOLA 1QVGA 1WFQA 4KY7A 1UE6A 3TREA 1C9OA 1VMCA 2Z8LA 3FVQA 2SOBA 1J5EQ 2JA8B 1EY4A 4DR5L 1W3SA 2E2IB 5JJZA 2RCNA 5G3LD 1DYQA 1KDAA 5KRUA 4YY3L 3EROA 1KQSA 3GP7A 2DGYA 5IT9L 2VW9A 5M5XB 3L9AX 5C3EG 1NMGA 4A3FG 2EXDA 2NB0A 1TS3A 3HOUH 3I8ZA 5BN4A 3A54A 5IP7G 4G7ZC 5FLXE 3EA6A 5IGFA 1Q82C 1Q7YC 2KEEA 5I9PA 3X3MA 1QZGA 3OPOA 4JV5L 3CCMA 1LT4D 3M7GA 1MJEA 1L1OC 2NVQH 1EIFA 2RDGA 3ND8A 2ID0A 3BDOA 4GNXB 2F0WA 1E2VA 1TT2A 2K28A 1O7IA 2JA5G 1EY8A 2N8NA 5E1FA 3HOZB 2JYOA 1WTWA 4GNXA 2MFIA 1K28A 5FKAC 3A5UA 4RCNA 4CKCA 2BDNA 3QIAA 1EWHA 5FO7B 2E2JB 3PO3H 5IP7H 3I4NB 4RMFA 5CBAE 3OIQA 2B2UC 1YIJA 3IKJA 1LM0A 3QJYA 3QOJA 2PZUA 1WI5A 4XIGS 3HOZG 2IT1A 5D14A 4XTCS 1WCMB 5EKLA 4B3RL 4K6LA 1EOVA 1VQ9A 3GV6A 4AYBB 1GUGA 1Q1BA 3LNNA 2K7VA 4X3SA 4K5XA 3TMEA 1VDZA 1QILA 2ZM6L 1GKHA 2WIIB 3CCQA 4QQBX 1JQYD 3ZJYC 3M4YA 1D1KA 4DV1L 3I91A 4KTAA 4KK7A 1Y1VG 4QJFA 2HQLA 4L5QA 3TZUA 1RDPD 4DV0L 3HKZE 3CD6A 4GKJQ 2F0TA 1CHQD 2XN9C 2VQFL 2HIXA 1I6HB 1HR0W 2ZTEA 4E6IA 2JA7B 2RF4A 4LW1A 3OIPA 1BBWA 4QF4A 4WFN3 2C35B 3HOXB 1AZPA 4GKJL 1FYCA 3E0EA 1UNSA 1Y14B 2NVYB 4BA1I 3JAME 4ABNA 3PIPA 3L2PA 1BOSA 1SYFA 3A8KE 4B9XA 2MP1A 3SXHA 3GDEA 4AYBE 2F0MA 2E2HH 1S5FD 5CV4A 5LHY1 1HRJA 5D3DA 1TKWB 3NSWA 4IURA 4BY7H 3S14B 2EYFA 1WD0A 1BBUA 4DV2Q 5IP9H 4LF6Q 1TWHB 1A15A 3S1MH 2EYMA 4JI5Q 4DV5Q 3VA7A 1KD1C 4YWMA 4A3DG 3PIO3 3GTJB 1Y1WG 3KBGA 2JXMB 2CW0D 1B9MA 1PFBA 1IZ6A 4DR1L 1EWIA 2F0PA 2NTTA 3SK8A 1BR9A 1OXTA 4M8AA 1Y8OB 3MFYA 1SE8A 2D0OA 2VQEL 1VMPA 2PNRC 4H0LC 1FD7D 2O2LD 3KLWA 4C2MH 4V0BA 4PQXA 3NUCA 1YNJC 5IP9G 1CQVA 1Z47A 5C44G 5LMNW 1IHZA 1EQQA 3K7AB 3MEHA 4APVA 2AQ3B 2VL6A 2G9DA 4ULLA 3TP7A 4KMUC 5IWAL 3HG9A 3DMUA 2WACA 2JQOA 1KL9A 1Q8IA 1SYCA 1TVXA 3NTKA 4IOAA 1KDBA 2F0LA 4YCVA 4B9WA 1ICFB 4MN3A 2GN5A 5M3MG 1UE1A 1M1KC 2P5ZX 1K8MA 4OEMB 1ILPA 2EY1A 3KLSA 4KV6A 2QF7A 1JICA 2ICIA 2K5DA 4DR2Q 3SEBA 4IUTA 5JOBA 3RZOB 1PTOF 2H5XA 4A4IA 4L6TB 4A3GB 1IKMA 2GVBA 3MAQA 4MTNA 4G4KA 1NNXA 1EZ8A 2PW5A 3TSSA 2F0SA 1IW7D 1VQFA 1FJGL 3I7FA 1SE2A 2UUAQ 1D8LA 2O5JC 4YCUA 1PFSA 1AZQA 4LUZA 3I2ZA 3GV3A 2UXBQ 4H13C 2R92G 2PW7A 3SK4A 1M90C 4GKKL 4HR7B 4F88A 2GVAA 3NTIA 4A93H 1QUQA 4IOCA 1HUNA 2CH4W 3D31A 5I6WA 1Y1VB 1QNKA 3U9SA 4HJ8A 4ILWA 3TZDA 3GTOH 1X55A 5C3EH 3NTHA 2Z6BA 4RWSC 1H9SA 1X56A 1KRTA 4IPCA 4A3EH 1M4VA 2ZJPA 1K8AC 3GTGH 3RR5A 4G7HC 4IO9A 3PIP3 4RH6A 3QG1A 4BBSH 4AYBG 1SJED 4X64L 1RKNA 5J1ZA 2NUCA 4BWGB 1XNRL 1FNUA 4JI7L 3M7NA 1IW7C 1TWAH 5ELNA 4ZQ3A 2NN6H 2M9VA 4PG3A 4PMBA 1SRUA 3CCUA 4GLXA 2V1CC 3NXWA 2KQ3A 2B63G 1RF2D 3DWAA 2CVRA 3T1YQ 5I2XA 1I6HH 1VQ7A 3MZ5A 3RZDH 3PO3G 3OWFA 4P73A 3OOCA 1SE3A 4MIUA 5CV5A 4BY1B 1V1OA 2YTXA 4CHTB 1UAPA 1JWMD 4A3EB 2F0IA 3VR4A 1NSNS 2KECA 1X65A 3CCJA 4YWLA 4CKBA 3BDCA 1XYIA 3STBD 1A0IA 1HUMA 3MXPA 4JBKA 2JEAI 3HOVH 4V190 2ZTDA 2WINB 5ELEA 4QCLA 1HHVA 2Z6KA 2L15A 1VQEA 2A19A 1NY4A 2K04A 3STBC 5FLXc 4A3JB 4A93B 2ENBA 1N32Q 1DJRD 2F4VL 1HCZA 4B3TL 1LACA 1RJTA 5ELDA 3HEJA 3ERSX 3EQLC 1BNZA 5KYIA 2NVYH 2R93H 4XYOA 3PO2B 2EY6A 2DUDA 2F3VA 3SDZA 3J7AV 1CKOA 3MWYW 3GTMH 4LF7Q 1VQ4A 3QO2A 1HXYD 5CV7A 1QE6A 4A3JG 4NW2A 4GOPC 4BBSB 1YNNC 2XWJB 3W2DA 3F2UA 4K6DA 5GAEC 1EY6A 1JC7A 3S1QB 2ZXRA 4XDXA 1E2ZA 3J80L 4LF4L 4IN3A 5JVH3 4DV3Q 1CA5A 1BF4A 5BN3A 4H02A 3SR1A 4A3KH 3CXCA 3T1YL 2EJFC 2NVTB 1IYJB 1EFID 2BE5C 2HCCA 2FFKB 1BQQT 3U58A 3OW7A 4JG2A 3DXJC 3T13A 1G91A 4P75A 1SNQA 1B7YB 4OGQC 1K0RA 3A8IE 4N9TA 3K5LA 5JPMC 1EY0A 2B8FA 4QY7A 1TWGH 2E2JH 1LABA 1PH5A 2MO1A 4HCEA 2O4XA 4GLAC 1R4PB 2HHHQ 5LMNL 3IFDA 4UDUC 4MHEA 2F0DA 4X6AH 5F2DA 4UPAA 1PH2A 2B2WC 4P74A 2PZTA 3CW2C 4UHVA 2Z1CA 3K5NA 5J39A 1HPCA 3KBXA 3CC4A 3VDYA 1LT5D 3AFPA 2QW7A 4HN7A 4A75A 3OTOL 4JI4L 4Q5VA 3GQBA 3CMAA 1DOLA 3KJPA 5DNFA 1VQIA 3VR6A 4R1JA 3DM3A 3T53B 4LF7L 2L9HA 3OWEB 2F4VQ 3K7UC 1B1ZA 5TSSA 1HA5A 1NUCA 5CMDA 4TVAB 1MSHA 2G5DA 3W1BA 2UXBL 2KCNA 2VS1A 1CZWA 4JI3Q 2L4NA 4A3BB 4N9PA 1Q12A 5C4ZA 1UEBA 2F03A 5IT9c 2VXWA 1RL2A 5C3EB 2R92H 1TR5A 4JBMA 1E7ZA 5LMUL 3WOEA 1G6ZA 2BE5D 1NJIC 1KXLA 2MO0A 4FXGC 2LXJA 2R7ZB 1YJWA 2YU9H 4LF9Q 2TMPA 1WOCA 4DR3Q 2K33A 4NMZA 2I46A 3GTPH 2B2WA 1KNAA 4R4CA 5JJIA 1EY9A 4CKEA 3AEVA 4X62Q 1BDOA 1UUPA 3K5OA 4Y52H 4OX9Q 3RLOA 2SNSA 5C44B 4TKOB 4ZKCB 3CC7A 1LTBD 2ZT9C 1SDFA 4A93G 4CDEC 1CZGA 1SSOA 4DV3L 4LF8L 4KHPL 2K5HA 3CHBD 3A74A 3D4DA 2ZJRA 4JI8Q 5D3IB 3HKZB 1I4PA 2Y0SE 3TN2A 1G51A 4H7BA 1G8ZD 3NPPA 2C9OA 2E76C 3UDGA 1S4ZA 1L1OB 1PYBA 4HJ9A 1C4QA 1LTSD 4C2MB 2KENA 4WORA 4GOPA 1WTXA 3VYUA 4BBSG 4FVMA 3GTPB 1T5XD 4K8JA 4JPBW 2JEBI 1EQRA 5BN5A 1X54A 3A0JA 2KBNA 2HDLA 2WFWA 1N32L 1QG7A 2RHSB 2F0KA 1VQOA 4NP5A 4UAIA 4OHJA 1YEZA 3T51B 3BVMA 3R3OA 3A7LA 1CFMA 2UXDL 4BY1H 5GROA 3PO2G 1CHPD 4DNTB 2A6HC 1PFMA 2JA6H 2AHOB 2Z6KC 2R7ZG 1WCMG 2N3SA 1NTGA 3GTQH 1JWUD 4BA2I 3PUYA 4C3HB 4BY7G 1HZBA 1F9PA 1H9KA 1L0XB 2XRQD 4IFDG 5D65A 1GHKA 2OT2A 1A6XA 5DLQE 1GVPA 1XPUA 1T5EA 2JN4A 5IGGA 4GOPB 1S5BD 5EKKA 4RKBA 1F2ZA 1W6JA 3GO5A 2RSNA 3UI2A 4RHSA 3S2HB 4DAYB 2UXCL 5ELCA 3I4OA 3PF4A 4HIKA 1U4PA 3SGIA 4HIMA 4FXDA 2EVBA 2WKDA 4DV7Q 2IX0A 1AE3A 1RTOA 1WCMH 2RHQB 4R4IA 4ZCKA 2PQAA 2JA6B 2L0CA 1PYSB 2XVSA 3NELA 2B29A 1VQCA 3KF8B 4MZ9A 4U68A 2PMZE 1I4QA 3ERQA 3UDIA 1O7ZA 1CK1A 5IYDG 4UP7A 5EAYA 3D4RA 1PTOH 2AUJD 2LSSA 2D9UA 4KKTA 4DK0A 2ATWA 2K1BA 1YITA 4O1NA 2HD3A 2Y0SB 2A6HD 3NQIA 2IL8A 4LF5Q 3M4PA 3T16A 2HIVA 1VQLA 2A69C 2R3ZA 2VY3A 2PCFB 3D8GA 5I6YA 2WKCA 2L11A 2K5QA 5JPNC 2A6EC 2F0UA 3HFZB 1X3GA 2UXCQ 1GO3E 2VUMB 1RHPA 4R8IA 1ONLA 4A76A 1DXMA 5JJKA 4OO1I 3S1MB 1DCZA 3BJUA 5M5WB 4BBRG 5DAUA 1CM9A 4A3MH 1STNA 2BA0A 1OXVA 4DR2L 3A55A 5J22A 3PUVA 4QUCA 4RKLA 1J6QA 1B3QA 2AMCB 2RDFA 4ZK9B 2J4XA 1JORA 5IGCA 1KDCA 2PZWA 2L55A 1IBLL 3CPWA 4POFA 2A68D 4XXEA 4QIWB 3T1HQ 3G6EA 4A3CH 1STAA 4FO2A 1EOTA 3M85A 5C4XG 4KY6A 1WYDA 3H0GG 4CGYB 4OIJA 4DUZL 1L0WA 4B3RQ 1CI3M 3IRBA 4KLKA 3BDLA 2OTJA 3DEPA 3QWNA 5M5YB 1CSQA 4A3GH 4TRDA 2ICEC 2HUGA 1RD9D 1LLRD 1WJJA 2ZM6Q 2VQEQ 4EQPA 1I50B 4UY8C 1F2LA 3D6CA 4LFBQ 3BS1A 3RLNA 4H44C 1ZYRD 2SDFA 2SNMA 1PH3A 1NAPA 1MI2A 4J6HA 4FF2A 1TY0A 1OXSC 2OCEA 2B63H 2MUYA 1U0LA 2RDHA 1BXTA 3KDFA 2ZXPA 1CKNA 3VR3A 3GTLB 1X3FA 1LTGD 3NBHA 4NPSA 3H3VC 2J7ZA 4GS3A 3KF6A 2F1MA 4DF7A 1L0YB 4KHPQ 3FPUB 2IWHA 1PH7A 4LK1C 1VQAA 4B08A 1X3EA 1E1OA 4FF3A 2IW3A 2CHBD 3KK7A 4TSSA 3MXNB 4LNQA 2JJQA 2NYZD 4RGOS 4PV1C 1HQMC 3M4QA 1HZ9A 4OX9L 4ALPA 4IUVA 3OW2A 1EYAA 2KCCA 2R7FA 2B2TC 2CFMA 2WAQB 3MTSA 3MXNA 4DGZA 2N78A 5M5YH 1MD2D 3FKIG 4KHZA 1R9TH 2PI2E 3KJOA 3L7ZC 1H9JA 2B2YA 2XNAC 2UUBQ 2FINB 1MGSA 1ILQA 2F0GA 5JVG3 3HZXA 1MIUA 3U4ZA 3UDFA 4JI0L 1SBBB 5L37A 1XJVA 3BVGA 1I94Q 2KVMA 2IHFA 1KLGD 3BU2A 4XQNA 5I9OA 4MTKA 2MGSA 1RODA 1RIPA 4X65L 5FK9C 3E6ZX 3ITPA 2ZXOA 4LMQD 1SFOH 4A3LH 3RUZA 1ZYRC 1YNND 3P7JA 5C3WA 3BZKA 3S14H 1DONA 5I4DA 2BH8A 3FKIH 4OWTB 5IGBA 2V4DA 1XPOA 2VZAA 2I5MX 1YHAA 1VF5C 1XTCD 4QIWE 4X66L 1E1TA 2L1BA 4JI3L 3Q24A 2IX1A 1AFPA 1EFWA 4JI1Q 3HS0C 1N9WA 3CCEA 5ELFA 4DV6L 2PQEA 1HNXL 1KAAA 4RGNA 5FLMH 1TS5A 3K0XA 1EZ6A 4UP8A 2E2DC 2KHSA 1I94L 5ELOA 5LMNQ 2G9HD 4FXKC 5IGEA 3D0FA 3D4WA 3PIOA 3C46A 4XQJA 3GTMB 2R6GA 1Q3LA 3TBIB 1VQHA 1PHJA 3VR2A 1JR0D 3FKIB 5M3FG 1E0BA 4LUVA 3AQQA 2CWAA 4I7AA 2LFNA 4RFBA 1B4OA 2H4OA 3E0JA 3NWSA 2NTSA 3BYTB 1PLFA 3HOYG 4AH6A 3H15A 1O7YA 1JT8A 3FMCA 1JOOA 1QB5D 4FF4A 1N36Q 3MA2B 3CCRA 1XNRQ 2RKSA 1JJCB 1OXXK 1KLUD 4N8X1 5KYLA 4OWWB 4B3ML 1D6EC 1XMQL 3H3VI 2E75C 1K8OA 4DV4L 2EYJA 2MQHA 3I55A 1SR3A 3H3VH 4OO1G 2IJ0A 1EU4A 3J7YW 1ENFA 4DUYQ 3H91A 1LYLA 2OQ0A 5G3LF 3S1QH 4KN7C 2BH2A 2CW0C 4K8IA 5EGTA 1YNJD 3QOLA 4HIOA 1V1PB 3H0GB 3OMGA 3S1RH 4Q0FA 2KCTA 1IBKQ 2UU9Q 4RG1A 4BXXH 5A2QL 4ZKBB 3HOUG 4OL7A 3HKSA 1N34L 2FXQA 1LTRD 4JI1L 1PRTB 3K59A 1SE4A 3PUZA 4XT3B 4BBRH 1WTVA 1DOMA 1NCVA 1IBKL 2UU9L 4X66Q 4AQYL 4X65Q 1TIID 2UUAL 1O7LA 1VQDA 1SROA 4QMGA 1K83H 3W3AA 5EPLA 3NHHA 1BBXC 1LT6D 1EEFD 2FMMA 3J81c 2N49A 3H6MA 3OTOQ 1K8GA 2AKWB 3RLFA 3CKIB 3N6RA 5AJ3Q 3MC0B 4ODGA 2CQOA 5C0XI 3AB9A 3I73A 3CRKC 1PZID 3KF6B 3NWTA 3P75A 1HH2P 2XTIA 3I70A 2B2VA 1AN8A 1G2TA 3NP8A 1HQRD 2EOTA 4CDDC 5JEAG 1XMQQ 3R2IA 4BXXG 2GA4B 4BS9A 1B8AA 5A35A 2XWBB 4JVZA 3MHBA 4YHHQ 1V1PA 4EGVA 4ID6A 4K2KA 1E2WA 4LAAA 4R4TA 1SYBA 3D6WA 4C1NK 2QGQA 2JSOA 1GOZA 3J81j 2UUCQ 4F8MA 3J7ZC 4PMCA 3I4NG 1AP0A 1ESFA 2I0QA 1JE5A 4IZ8A 3J81L 2JA9A 2BA1A 2QEJC 1EQTA 5IGDA 4BBRB 3TDQA 1EU3A 1A3TA 1LTLA 5HGQA 4JI6Q 2Q2TA 4JI7Q 1K73C 5FO8B 1TWFH 4Y7NB 1JB7A 4HJ5A 1LTAD 5LL6S 1Q86C 1I4RA 2WV6D 4DXGA 5EPJA 1P16A 2ZJQA 4RHRA 5CYUA 4QGUA 3TRZA 4K5VA 2C5CA 5COYA 3AYHB 1HNWQ 3CF5A 2MHVA 4DV6Q 4A3IH 3SHLA 1AW7A 2QA4A 1PA6A 4P2CB 2N55A 5LL6X 1SNMA 3J80E 1HTLD 2R7DA 5T1IA 1BUVT 2NN6G 4PZ6A 1SMXA 1FJGQ 3K0YA 2EJGC 3QR8A 3I72A 2OTLA 2I07B 1G6PA 3I3CA 2K5NA 3SK6A 2XRSD 3S24A 1I4HA 1Z7TA 4DNIA 3JAMc 2E74C 1W2BA 1STGA 1KHIA 2B2TA 4OIKA 3W1GA 4C3JH 3C3LA 2VUMH 1X9NA 5EKIA 1F9SA 3BYYB 5C4XB 3BZCA 1QOHA 1I4GA 3T1HL 3TP5A 3LWUA 3T56B 1XMOQ 4FF1A 1JOKA 2I5LX 1EY7A 3E9HA 5HURA 1XMOL 2NVTH 1A3UA 1YJ9A 4K14A 4L5TA 1JCKB 5DEHA 3ER0A 1HR0L 3E3XA 1TWAB 3H09A 2X6LA 1Q1EA 1HNZL 2F0QA 3T4AC 2JP1A 4JYAQ 5M5XH 4QB4A 1Q8KA 4DV1Q 5M3FH 2NVXH 4LFCL 1OXUA 2ZTCA 2DY7A 3MXGA 4NXNL 2IX3A 2A8VA 4LJZC 4L5SA 3FRPB 1QZHA 3M3YB 1U4MA 5KGUA 5C0XG 3HOXG 3TP8A 1I6VC 3VR5A 1YZ6A 1DD2A 2EPBA 1VQKA 5E3FA 4L63B 1H9RA 3PUXA 1B53A 3KYHC 1JE4A 4JC0A 2R61A 3HP3A 1D2BA 5KEEA 4LF5L 2E8GA 1RTNA 2WAQG 3RNUA 1QWYA 1VCIA 1JJ2A 4GNXC 1HNWL 4OO1H 3S2DH 2A69D 2Z9HA 1PRTF 3AU7A 4O2DA 2H1EA 1QNUA 3KOJA 4DV2L 4WJ4A 4A3KG 1CQFA 2D2CC 1B3AA 5EQ0A 1ET9A 3PMFA 3CCVA 2YU9B 1NMFA 2EQSA 1EEID 1R9TB 4JI2L 1L1OA 2QDBA 5E4WC 5M3FB 4JI5L 1EYGA 5AFWA 1FL0A 4DAYA 1K83B 1TS2A 3NBHB 3HGBA 1P8LA 1SEBD 3K5MA 3KFUA 3M3YH 4C3JB 4A3CG 3UE1A 1PH9A 2RBMA 1HTPA 2FMCA 4PNYA 4G7OC 1EUJA 1TQOA 4PMWA 5IYDH 1IYUA 3DUZA 2JA8G 5GAGC 4IPDA 3CCLA 1QVFA 4A3GG 1U4LA 4X62L 1LTTD 1M8AA 5C6AA 3W5OA 1PYWD 1HNZQ 3WDNA 4FNFA 5JEAJ 1ZXTA 2KHIA 3Q22A 3RMHA 4YHHL 4HMIA 3U9OA 1T9HA 4DR4Q 5CV9A 4JBJA 1ZEQX 3EN2A 3U50C 1J5EL 1GUNA 1SN8A 1A8VA 1EY5A 5JEAH 1SJHD 4LFAQ 3IAYA 2UXDQ 5C44H 3OHXC 2DJGC 3WWVA 1KC8C 1EQVA 2CH4A 1DOKA 2F4IA 4A3EG 5IYBH 2I5HA 3M4OH 4GN3B 4HEDA 1IXRA 4JW0A 1FR3A 3EFXD 3JC66 4AQYQ 2OXPA 4JI2Q 1QUQB 5KNBA 4FP5D 5CC4A 3LX0A 2LY7A 3ULJA 3ULLA 3WOFA 1CUKA 1STEA 2OEOA 2KUMA 4R9WA 3DLLA 1GM5A 2CWPA 2F0FA 4FDBA 1NR2A 4XT1B 1GXDC 1KABA 3F8TA 2K50A 4XYQA 3L3OC 1MBYA 1SLJA 4A3FH 4DR6Q 3TS2A 3QB3A 3A56A 1N33Q 1TWHH 1PH4A 4DFAA 3DHQA 3UDXA 3RD4A 3X3NA 1SMYC 2QKIC 1C8CA 4ME3A 1U5KA 1PTOC 4JV5Q 4A3BH 2KJXA 4JI8L 1JB3A 5IYCG 1ML0D 1QJOA 4JYAL 4YWKA 1TWCH 3GTQB 1I4XA 2F0NA 1IL2A 2PYKA 3PSIA 3OYYA 1HR0Q 2EXZA 1X3QA 2UUCL 1STHA 4OWXB 2F0OA 4I65A 4CJ2C 3A8JE 4HJAA 2E5LQ 3FEWX 1VQ6A 2PI2A 2B39A 2Q2IA 1XWEA 3BVZA 3C2PA 2VQFQ 1CA6A 2R93G 2XSCA 4GLVB 2F0VA 3L0OA 4DV0Q 4QL5A 3V2TA 5IT9E 4A3DB 2K14A 5FLMG 1KNEA 4YIJA 4DR7Q 5C5MA 3CMEA 3RZDB 2VNUD 4A3JH 1GD7A 4FYDA 1A63A 2B2UA 4L8JA 3CQZH 4IUPA 4O0AA 4CJ1B 3CCSA 1AE2A 1XX8A 4DAPA 5BR8L 3K58A 1PFNA 2B3GA 2F0EA 4IPHA 4N8FA 1FNWA 1UE7A 2OF1A 3EBEA 1YHBA 2B8GA 3EJIA 2Q8IB 2AWNA 4P72A 1QCBD 2Q8TA 4IQZA 3S9WA 3HOVB 2AUKA 5IY0A 2F3WA 3G4SA 4HMJA 1CT1D 1F2YA 2EYLA 4K0KL 4OELB 1SNDA 4C3IB 1Y1WB 3EVQA 3TP6A 2JK8A 1F77A 1STYA 1B70B 2NZ1D 3G6JB 5KIXA 4IUQA 1OTCA 3JAML 4A3KB 4B3MQ 1GUOA 1K3RA 3J80i 2QILA 3KLSX 3IL8A 1SFOB 5FJ8G 4DUYL 1PDQA 3MEFA 4LUOA 3PV0A 1SMYD 3HRZC 3GTKB 1F9QA 4ZYSA 3Q8DA 1S5ED 1Y8NB 4J15A 5EBDA 1IBMQ 1YJNA 1IL8A 2Z4IA 1Y69U 2HQEA 2L5TA 2WP8J 1E3PA 1V1QA 3HOWH 3KLRA 2EYPA 1HFNA 3TQYA 4ZRZA 4C56C 1PVOA 1N8RC 4GN4B 2HDMA 4B3SL 3PUWA 2X6GA 4HTHA 4A3DH 1ZKOA 1VQBA 3J7A5 4KJNA 4A3IB 2F3IA 1HZAA 1TS4A 4GZYC 1Z6HA 4JK1C 4EQ5A 1GJXA 3P20A 5LMUQ 2PMZB 4HSVA 1SNOA 1TWFB 5ELBA 2MNAA 4DR6L 3GTKH 2A5HA 5IE8A 1VQ8A 1SYGA 1CKNB 1ICWA 5A2QE 3C1FA 3S16H 1FNVA 1Y8PB 3OSOA 1XNQL 3MFGA 1N34Q 4EQOA 1E22A 1BVSA 4LFBL 1XNQQ 3AMUA 4KJOA 2RCFA 5C4XH 5BR8Q 3H0GH 2JA8H 4CBVA 4F87A 4B3TQ 1VQ5A 5E7NA 1AEXA 3R8BA 3F2CA 3I4MG 4I7ZC 1YBYA 1MKHA 3K6OA 5M3MH 3K7AH 4X3UA 4NXMQ 1ET6A 3KUPA 4DK3C 3K57A 4A3FB 2NZOA 2O5IC 1PRTC 3BG3A 5CR3A 1GUSA 1H9MA 2JA5H 2F0HA
chains in the Genus database with same CATH topology
3V05A 1BCPC 2EY5A 1GUWA 3E5SA 1PRTD 2EYOA 4Z9CB 4ME5A 1GHJA 3DWPA 2Z4HA 5HGTA 4KKUA 1II3A 4HAEA 1SNPA 4RAUC 1MSGA 2RSOA 3DM1A 1ESRA 1SAPA 1NR4A 3J81E 4TQUS 3N52A 4NKLA 1UEAB 4HSPA 3J7AF 2EJMA 1A3VA 4IALA 3MXUA 4CJ0B 1TWCB 4DAVA 1LTID 4C3JG 3CQZB 1LV9A 5C3XA 2AQ1B 5KNDA 1SXTA 2JA5B 1EIHA 5K36H 5C5LA 2KEDA 1D1IA 1D5ZC 2BOSA 2A68C 3ONAB 1WVLA 1EYDA 1WD1A 2E2HB 2HCIA 4J1MA 3NE5B 3O13A 1KTKA 4M1UB 1LO5D 3SVMA 3VYRA 3KF8A 1BCPD 4C3IG 4RCOA 1I3QB 3VYTA 2IPKD 5C4HA 3GTOB 4C1NI 2B63B 3D3RA 5JAVA 4DNRB 3A7AB 5K5PA 1CTMA 4U673 5IOCA 2R92B 4F7XA 2LMCB 3I4LA 1O78A 2RA4A 2A73B 1S5CD 4ZUJA 2DY8A 3Q0AA 1U9RA 1PXUA 3M4OB 2F0JA 2Q8RE 1SYEA 3VYSA 5IODA 2EDGA 5C4JB 1GUTA 3I90A 1G2SA 2YYZA 2PO4A 2DN8A 2J0TD 2CQAA 1PMRA 4K2LA 1WTPA 5E4XA 5NUCA 3HOWB 2AWOA 3FPPA 1EYCA 1PTOB 1HA6A 3V96A 1XXGA 2K5WA 3NK9A 4O42A 1DZ1A 1HFGA 5CV6A 3S17B 1TWGB 3ZYYX 1JWSD 2M2LA 3R93A 4R8NA 4RGMA 1A2UA 4A3MB 2VB2X 4NDXA 4KHVA 3LWEA 1LT3D 3S2DB 3CRLC 3Q23A 3S15B 2D62A 1C48A 4HCSA 2A74C 2NBFA 2VB3X 4KI0A 5IIFA 2PPBC 1PZKD 1JOQA 1FGBD 3R2TA 3HOUB 1BCPF 1PTOD 1R4QB 4JBWA 1EWCA 2B2VC 4RGTA 1V43A 1SNCA 2LS01 3C1EA 2EZVA 2MJ8A 4IFDJ 4KN4C 2NN6I 3GTGB 1V8QA 4C3HG 5FOBB 4BY7B 2K01A 2K05A 3SE0A 4KD3A 1OO9B 2EYHA 2K32A 2X69A 3NQTA 2K03A 5DM63 5K36G 1Q90A 1U4RA 1X3PA 3NBIA 1F9RA 3CU7A 1D5XC 1A2TA 2DNEA 2QCPX 2TSSA 3Q6SA 2RVLA 3VA5A 1DM0B 3GD7A 1SYDA 5FO9B 2NVXB 1W6KA 2K6AA 1S5DD 1EL0A 5EBCA 2XIWA 3HOYB 2D5DA 3S16B 4KD4A 4IFDH 1ENCA 4S3SA 2LKVA 3FDTA 3MVVA 4DA2A 2NWGA 1F2MA 2WB1B 3PO3B 1WTOA 1H9SB 1PZJD 2DNCA 4ZUIA 1J8IA 2A6ED 5CV8A 5M3MB 4KKSA 1B2TA 4X3KA 1EIGA 3H94A 4WRDA 1STBA 5C0XH 3URYA 2SEBD 5CBEE 5CGKA 3ND9A 5CORA 4DK1A 3S1NB 3DEOA 1BCPB 4DN4M 1B50A 4ZAIA 5T1GA 1D5MC 1IYVA 1ENAA 2BDOA 2FJ2A 4ZLTF 2EE1A 3OMCA 1WTRA 4WJWA 2RQXA 5ISRA 1TY2A 4RA8A 1RCVD 3DWQA 2KA7A 4DXFA 4J8QA 1IKLA 2AQ2B 5M9OA 1B9NA 5EPKA 1G291 1TU2B 4QUFA 5I2YA 4EVOA 4KY5A 3S1RB 2MPMA 3P1HA 5DM73 4IFDI 2B2YC 1O80A 3IFTA 4G57A 4IUUA 4K5WA 4XQQA 5FLXL 4EQNA 3BZDB 1X32A 5C0XJ 3SK5A 3I4MB 4IUNA 4DU9A 2BCOA 1WTQA 2N88A 2R93B 1B44D 2JE6I 2FHTA 1VF7A 4X3TA 5KNCA 2EY2A 2M00A 5EJWA 2L12A 2NVQB 3G7LA 1J9OA 1BO0A 2KOLA 4KY7A 2Z8LA 1VMCA 3FVQA 2SOBA 2JA8B 1EY4A 2E2IB 5JJZA 5G3LD 1DYQA 1KDAA 5KRUA 3EROA 3GP7A 5IT9L 5M5XB 3L9AX 2NB0A 1TS3A 3I8ZA 5BN4A 3A54A 4G7ZC 5FLXE 3EA6A 5IGFA 2KEEA 5I9PA 3X3MA 3OPOA 1LT4D 3M7GA 2RDGA 3ND8A 2ID0A 3BDOA 2F0WA 1E2VA 1TT2A 2K28A 1EY8A 5E1FA 3HOZB 2JYOA 1WTWA 5FKAC 4RCNA 4CKCA 2BDNA 3QIAA 1EWHA 5FO7B 2E2JB 3I4NB 5CBAE 3OIQA 2B2UC 3IKJA 3QJYA 3QOJA 2PZUA 4XIGS 2IT1A 5D14A 4XTCS 1WCMB 5EKLA 4K6LA 3GV6A 4AYBB 1GUGA 1Q1BA 3LNNA 2K7VA 4X3SA 4K5XA 3TMEA 1VDZA 1QILA 2WIIB 1JQYD 3M4YA 1D1KA 3I91A 4KTAA 4KK7A 3TZUA 1RDPD 2F0TA 1CHQD 2XN9C 1I6HB 4E6IA 2JA7B 3OIPA 4QF4A 4WFN3 3HOXB 1AZPA 1FYCA 1UNSA 2NVYB 4BA1I 3JAME 4ABNA 1BOSA 1SYFA 3A8KE 4B9XA 2MP1A 3SXHA 2F0MA 1S5FD 5CV4A 5LHY1 1HRJA 5D3DA 1TKWB 3NSWA 4IURA 3S14B 2EYFA 1WD0A 1TWHB 1A15A 2EYMA 3VA7A 3PIO3 3GTJB 3KBGA 2JXMB 2CW0D 1B9MA 1PFBA 2F0PA 2NTTA 3SK8A 1BR9A 1OXTA 4M8AA 1Y8OB 3MFYA 1VMPA 2PNRC 4H0LC 1FD7D 2O2LD 4V0BA 4PQXA 3NUCA 1YNJC 1CQVA 1Z47A 1IHZA 3K7AB 3MEHA 2AQ3B 2G9DA 4ULLA 3TP7A 4KMUC 3HG9A 3DMUA 2WACA 1Q8IA 1SYCA 1TVXA 3NTKA 1KDBA 2F0LA 4B9WA 4MN3A 1K8MA 1ILPA 2EY1A 3KLSA 4KV6A 2QF7A 1JICA 2ICIA 2K5DA 3SEBA 4IUTA 5JOBA 3RZOB 1PTOF 4L6TB 4A3GB 1IKMA 3MAQA 4G4KA 1EZ8A 2PW5A 3TSSA 2F0SA 1IW7D 1SE2A 2O5JC 1AZQA 3GV3A 4H13C 2PW7A 3SK4A 4HR7B 4F88A 3NTIA 1HUNA 3D31A 5I6WA 1Y1VB 1QNKA 3U9SA 4ILWA 3TZDA 3NTHA 4RWSC 1H9SA 1M4VA 4G7HC 3PIP3 4RH6A 3QG1A 1SJED 1RKNA 5J1ZA 2NUCA 4BWGB 1FNUA 3M7NA 1IW7C 4ZQ3A 2NN6H 2M9VA 4PMBA 3NXWA 2KQ3A 1RF2D 3DWAA 2CVRA 5I2XA 3MZ5A 3OWFA 3OOCA 1SE3A 4MIUA 5CV5A 4BY1B 1V1OA 4CHTB 1UAPA 1JWMD 4A3EB 2F0IA 3VR4A 1NSNS 2KECA 4CKBA 3BDCA 1XYIA 1HUMA 3MXPA 2JEAI 4V190 2WINB 5ELEA 4QCLA 1HHVA 2K04A 4A3JB 4A93B 2ENBA 1DJRD 1HCZA 1LACA 1RJTA 5ELDA 3HEJA 3EQLC 1BNZA 5KYIA 4XYOA 3PO2B 2EY6A 2F3VA 3SDZA 3J7AV 3MWYW 3QO2A 1HXYD 5CV7A 1QE6A 4NW2A 4BBSB 1YNNC 2XWJB 3W2DA 3F2UA 4K6DA 1EY6A 1JC7A 3S1QB 2ZXRA 4XDXA 1E2ZA 3J80L 4IN3A 5JVH3 1CA5A 1BF4A 5BN3A 3SR1A 2EJFC 2NVTB 2BE5C 1EFID 2HCCA 2FFKB 1BQQT 3OW7A 3DXJC 3T13A 1G91A 1SNQA 4OGQC 3A8IE 4N9TA 3K5LA 5JPMC 1EY0A 2B8FA 1LABA 4HCEA 2O4XA 1R4PB 3IFDA 4UDUC 4MHEA 2F0DA 5F2DA 2B2WC 2PZTA 2Z1CA 3K5NA 5J39A 1HPCA 3KBXA 1LT5D 4HN7A 4Q5VA 3GQBA 1DOLA 5DNFA 3VR6A 3T53B 2L9HA 3OWEB 1B1ZA 5TSSA 1HA5A 1NUCA 5CMDA 1MSHA 2KCNA 1CZWA 2L4NA 4A3BB 4N9PA 1Q12A 5C4ZA 2F03A 2VXWA 5C3EB 1TR5A 3WOEA 1G6ZA 2BE5D 4FXGC 2R7ZB 2TMPA 2K33A 4NMZA 2I46A 2B2WA 1KNAA 1EY9A 4CKEA 1BDOA 1UUPA 3K5OA 2SNSA 5C44B 4TKOB 4ZKCB 1LTBD 2ZT9C 1SDFA 1CZGA 1SSOA 3CHBD 3D4DA 5D3IB 3HKZB 1I4PA 3TN2A 4H7BA 1G8ZD 3NPPA 2C9OA 2E76C 1S4ZA 1C4QA 1LTSD 4C2MB 4WORA 1WTXA 3VYUA 4FVMA 3GTPB 1T5XD 4K8JA 2JEBI 5BN5A 2HDLA 1QG7A 2F0KA 4NP5A 4UAIA 4OHJA 3T51B 3BVMA 3R3OA 3A7LA 1CFMA 1CHPD 4DNTB 2A6HC 1PFMA 1JWUD 4BA2I 3PUYA 4C3HB 1F9PA 1H9KA 1L0XB 2XRQD 4IFDG 5D65A 1GHKA 2OT2A 1A6XA 1T5EA 5IGGA 1S5BD 5EKKA 4RKBA 1F2ZA 1W6JA 3GO5A 2RSNA 3UI2A 4RHSA 3S2HB 5ELCA 1U4PA 4FXDA 2EVBA 2WKDA 2IX0A 1RTOA 2JA6B 2L0CA 2XVSA 4U68A 1I4QA 3ERQA 1O7ZA 1CK1A 3D4RA 1PTOH 2AUJD 2D9UA 4KKTA 4DK0A 2K1BA 4O1NA 2Y0SB 2A6HD 3NQIA 2IL8A 3T16A 2A69C 2R3ZA 2PCFB 3D8GA 5I6YA 2WKCA 2L11A 2K5QA 5JPNC 2A6EC 2F0UA 2VUMB 1RHPA 4R8IA 1ONLA 1DXMA 4OO1I 3S1MB 1DCZA 5M5WB 5DAUA 1CM9A 1STNA 2BA0A 1OXVA 3A55A 5J22A 3PUVA 4QUCA 4RKLA 2RDFA 4ZK9B 2J4XA 1JORA 5IGCA 1KDCA 2PZWA 2L55A 2A68D 4XXEA 4QIWB 1STAA 4FO2A 1EOTA 3M85A 4KY6A 4CGYB 4OIJA 1CI3M 3BDLA 3DEPA 3QWNA 5M5YB 4TRDA 2ICEC 2HUGA 1RD9D 1LLRD 4EQPA 1I50B 1F2LA 3D6CA 3BS1A 4H44C 1ZYRD 2SDFA 2SNMA 1NAPA 1MI2A 4J6HA 4FF2A 1TY0A 1OXSC 2MUYA 2RDHA 1BXTA 2ZXPA 3VR3A 3GTLB 1LTGD 3NBHA 3H3VC 2J7ZA 4DF7A 2F1MA 1L0YB 3FPUB 2IWHA 4LK1C 4B08A 4FF3A 2IW3A 2CHBD 3KK7A 4TSSA 2NYZD 4RGOS 4PV1C 1HQMC 4IUVA 1EYAA 2KCCA 2B2TC 2WAQB 3MTSA 3MXNA 4DGZA 1MD2D 4KHZA 3L7ZC 1H9JA 2B2YA 2XNAC 2FINB 1MGSA 1ILQA 2F0GA 5JVG3 3HZXA 1SBBB 3BVGA 2KVMA 1KLGD 4XQNA 5I9OA 2MGSA 1RODA 5FK9C 3E6ZX 3ITPA 2ZXOA 4LMQD 3RUZA 1ZYRC 1YNND 3P7JA 5C3WA 1DONA 5I4DA 5IGBA 2V4DA 1VF5C 1XTCD 3Q24A 2L1BA 1AFPA 2IX1A 3HS0C 5ELFA 2PQEA 1KAAA 4RGNA 1TS5A 1EZ6A 2E2DC 2KHSA 2G9HD 4FXKC 5IGEA 3D4WA 3C46A 4XQJA 3GTMB 2R6GA 1Q3LA 3TBIB 3VR2A 1JR0D 3FKIB 1E0BA 2LFNA 4RFBA 1B4OA 2H4OA 3E0JA 3NWSA 2NTSA 3BYTB 1PLFA 1O7YA 3FMCA 1JOOA 1QB5D 4FF4A 3MA2B 2RKSA 1OXXK 1KLUD 5KYLA 1D6EC 2E75C 1K8OA 2EYJA 4OO1G 2IJ0A 1EU4A 3J7YW 1ENFA 3H91A 5G3LF 4KN7C 2CW0C 4K8IA 5EGTA 1YNJD 3QOLA 1V1PB 3H0GB 3OMGA 4Q0FA 5A2QL 4ZKBB 4OL7A 1LTRD 1PRTB 3K59A 1SE4A 3PUZA 4XT3B 1WTVA 1DOMA 1NCVA 1TIID 1O7LA 4QMGA 3W3AA 5EPLA 3NHHA 1BBXC 1LT6D 1EEFD 2FMMA 3H6MA 3RLFA 3CKIB 3N6RA 3MC0B 4ODGA 5C0XI 3AB9A 3I73A 3CRKC 1PZID 3NWTA 3P75A 3I70A 2B2VA 1AN8A 1G2TA 3NP8A 1HQRD 2EOTA 5JEAG 3R2IA 2GA4B 4BS9A 5A35A 2XWBB 3MHBA 1V1PA 4EGVA 4ID6A 4K2KA 1E2WA 4LAAA 1SYBA 3D6WA 4C1NK 2JSOA 1GOZA 4F8MA 4PMCA 1AP0A 1ESFA 4IZ8A 3J81L 2BA1A 2QEJC 1EQTA 5IGDA 4BBRB 3TDQA 1EU3A 1A3TA 5FO8B 4Y7NB 1LTAD 5LL6S 1I4RA 2WV6D 4DXGA 5EPJA 4RHRA 5CYUA 4K5VA 2C5CA 5COYA 2MHVA 3SHLA 1AW7A 4P2CB 2N55A 5LL6X 1SNMA 3J80E 1HTLD 5T1IA 1BUVT 2NN6G 3K0YA 2EJGC 3I72A 2I07B 3I3CA 3SK6A 2XRSD 1I4HA 1Z7TA 2E74C 1STGA 4OIKA 2B2TA 3C3LA 5EKIA 1F9SA 3BYYB 5C4XB 1QOHA 1I4GA 3TP5A 3LWUA 3T56B 4FF1A 1JOKA 1EY7A 5HURA 1A3UA 4K14A 1JCKB 5DEHA 1TWAB 3H09A 2X6LA 1Q1EA 2F0QA 3T4AC 2JP1A 4QB4A 1OXUA 2DY7A 3MXGA 2IX3A 4LJZC 3M3YB 3FRPB 1U4MA 5KGUA 5C0XG 3TP8A 1I6VC 3VR5A 1DD2A 2EPBA 5E3FA 4L63B 1H9RA 3PUXA 1B53A 1JE4A 2R61A 3HP3A 1D2BA 5KEEA 1RTNA 1QWYA 1VCIA 4OO1H 2A69D 1PRTF 3AU7A 2H1EA 1QNUA 1CQFA 2D2CC 1B3AA 5EQ0A 1ET9A 3PMFA 2YU9B 1EEID 1R9TB 2QDBA 5E4WC 5M3FB 5AFWA 4DAYA 1K83B 1TS2A 3HGBA 1SEBD 3K5MA 4C3JB 2RBMA 1HTPA 2FMCA 4PNYA 4G7OC 1TQOA 4PMWA 1IYUA 3DUZA 1U4LA 1LTTD 1M8AA 5C6AA 1PYWD 3WDNA 4FNFA 5JEAJ 1ZXTA 3Q22A 3RMHA 4HMIA 3U9OA 5CV9A 1ZEQX 1GUNA 1EY5A 5JEAH 1SJHD 3IAYA 3OHXC 1EQVA 2F4IA 1DOKA 4HEDA 1FR3A 3EFXD 2OXPA 5KNBA 4FP5D 5CC4A 3LX0A 2LY7A 3WOFA 1STEA 2OEOA 2KUMA 4R9WA 2F0FA 1NR2A 4XT1B 1GXDC 1KABA 4XYQA 3L3OC 1MBYA 3QB3A 3A56A 4DFAA 3DHQA 3RD4A 3X3NA 1SMYC 2QKIC 1C8CA 1PTOC 2KJXA 1JB3A 1ML0D 1QJOA 3GTQB 1I4XA 2F0NA 2PYKA 2EXZA 1X3QA 1STHA 2F0OA 4I65A 4CJ2C 3A8JE 3FEWX 2B39A 1XWEA 3BVZA 3C2PA 1CA6A 2XSCA 2F0VA 3V2TA 5IT9E 4A3DB 1KNEA 4YIJA 5C5MA 3RZDB 2VNUD 4FYDA 2B2UA 4L8JA 4IUPA 4CJ1B 1XX8A 4DAPA 3K58A 1PFNA 2F0EA 1FNWA 2OF1A 2B8GA 3EJIA 2Q8IB 2AWNA 1QCBD 2Q8TA 4IQZA 3S9WA 3HOVB 2AUKA 2F3WA 4HMJA 1CT1D 1F2YA 2EYLA 1Y1WB 1SNDA 4C3IB 3EVQA 3TP6A 1F77A 1STYA 2NZ1D 3G6JB 5KIXA 4IUQA 3JAML 4A3KB 1GUOA 2QILA 3KLSX 3IL8A 1SFOB 1PDQA 3PV0A 1SMYD 3HRZC 3GTKB 1F9QA 4ZYSA 1S5ED 1Y8NB 5EBDA 1IL8A 2Z4IA 1Y69U 2HQEA 2L5TA 2WP8J 3KLRA 2EYPA 1HFNA 4ZRZA 4C56C 2HDMA 3PUWA 2X6GA 4HTHA 1ZKOA 4KJNA 4A3IB 1TS4A 4GZYC 1Z6HA 4JK1C 1GJXA 3P20A 2PMZB 4HSVA 1SNOA 1TWFB 5ELBA 2A5HA 1SYGA 1ICWA 5A2QE 3C1FA 1FNVA 1Y8PB 3OSOA 3MFGA 4EQOA 3AMUA 4KJOA 4CBVA 4F87A 1AEXA 3R8BA 4I7ZC 3K6OA 4X3UA 1ET6A 3KUPA 3K57A 4A3FB 2O5IC 1PRTC 3BG3A 5CR3A 1GUSA 1H9MA 2F0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5W A;  2K5Q A;  3NPP A; 
#chains in the Genus database with same CATH topology
 4P71 A;  5H1S E;  3V05 A;  1BCP C;  2UUB L;  4DR7 L;  3PQI A;  2EY5 A;  1GUW A;  3E5S A;  1PRT D;  2CCZ A;  1N36 L;  1PV4 A;  2K75 A;  2EYO A;  1VQJ A;  4Z9C B;  1C7Y A;  4ME5 A;  5IYB G;  1GHJ A;  3DWP A;  3I56 A;  1NBW A;  2Z4H A;  5HGT A;  4KKU A;  1A62 A;  1II3 A;  3RZO H;  4HAE A;  4GN5 A;  2D0P A;  3EIV A;  1SNP A;  2YTV A;  4RAU C;  1MSG A;  2RSO A;  3DM1 A;  1ESR A;  3TS0 A;  1SAP A;  4X64 Q;  1IBM L;  3HOZ H;  1NR4 A;  3J81 E;  4TQU S;  3N52 A;  1PH6 A;  4NKL A;  1UEA B;  3K8A A;  4HSP A;  3CPF A;  1VQM A;  3J7A F;  2EJM A;  1I3Q H;  1A3V A;  4BY1 G;  4IAL A;  3MXU A;  4CJ0 B;  2JA6 G;  1TWC B;  2HT1 A;  1S72 A;  2JA7 H;  1AH9 A;  1E24 A;  4DAV A;  1LTI D;  4POG A;  4C3J G;  3CQZ B;  1LV9 A;  5C3X A;  2AQ1 B;  5KND A;  1SXT A;  2YV5 A;  2JA5 B;  1EIH A;  5JJL A;  5K36 H;  3PGZ A;  4Y7N H;  5C5L A;  2KED A;  1KIX A;  4DPG A;  1D1I A;  1D5Z C;  4A3B G;  2BOS A;  2A68 C;  3ONA B;  1WVL A;  3PF5 A;  5M5W H;  3JAM i;  1EYD A;  1WD1 A;  2E2H B;  3HOV G;  2HCI A;  4J1M A;  3NE5 B;  1VQN A;  3O13 A;  1KTK A;  3A5Z B;  4M1U B;  1LO5 D;  3CAM A;  3SVM A;  3VYR A;  1S3O A;  1IBL Q;  3KF8 A;  4LFC Q;  1BCP D;  4C3I G;  3AFQ A;  4RCO A;  4DV7 L;  1I3Q B;  3VYT A;  4CDC C;  2IPK D;  5C4H A;  3FP9 A;  3G48 A;  3GTO B;  4JCV E;  4C1N I;  4DUZ Q;  2B63 B;  3D3R A;  5JAV A;  4DNR B;  3U4V A;  1YVC A;  3A7A B;  4JI0 Q;  4EX5 A;  4LFA L;  3S2H H;  5K5P A;  1CTM A;  4U67 3;  3E9I A;  5IOC A;  3GTJ H;  1PH8 A;  2QDL A;  4DR4 L;  1K3B C;  2YTY A;  2R92 B;  4F7X A;  5GAD C;  1Y1W H;  5IWA Q;  1C0A A;  2E2I H;  1H95 A;  2LMC B;  3I4L A;  1O78 A;  2RA4 A;  4C3I H;  5GQO A;  1KRS A;  2A73 B;  3ICE A;  1S5C D;  3S1N H;  4ZUJ A;  2DY8 A;  3Q0A A;  1U9R A;  1PXU A;  3M4O B;  2F0J A;  3HOW G;  2Q8R E;  1SYE A;  3VYS A;  5IOD A;  2EDG A;  5C4J B;  1GUT A;  4IPG A;  4WJ3 M;  3I90 A;  1N33 L;  1G2S A;  4HJ7 A;  4IJL A;  1HJP A;  2YYZ A;  2PO4 A;  3LGJ A;  3F2D A;  2DN8 A;  4PZ8 A;  2J0T D;  2CQA A;  1PMR A;  5FJ8 H;  4K2L A;  4DV5 L;  1WTP A;  5E4X A;  2OQK A;  2OWO A;  5NUC A;  3HOW B;  2AWO A;  3FPP A;  1EYC A;  1PTO B;  4JOI A;  1WTH A;  1LUZ A;  4YCW A;  1HA6 A;  3V96 A;  3TEH B;  1XXG A;  4LF6 L;  2K5W A;  4DK6 C;  1K9M C;  3NK9 A;  3K81 C;  4O42 A;  4IJH A;  4NXN Q;  2Y0S G;  2KCM A;  1DZ1 A;  1HFG A;  5CV6 A;  2IHE A;  3G71 A;  4NB3 A;  3S17 B;  2WAQ E;  5J3B A;  4DAM A;  1TWG B;  1CSP A;  2WB1 E;  3ZYY X;  1VQG A;  1JWS D;  2M2L A;  4CDF C;  3R93 A;  2F52 A;  4R8N A;  4RGM A;  1A2U A;  4A3M B;  2VB2 X;  2Q2U A;  4NDX A;  1JJG A;  4C3H H;  4KHV A;  3LWE A;  1VQP A;  1LT3 D;  3S2D B;  4OON A;  3CP0 A;  3CRL C;  3Q23 A;  4DR5 Q;  3S15 B;  2D62 A;  1C48 A;  4MNO A;  4HCS A;  4PZ7 A;  2A74 C;  4KI0 A;  2NBF A;  2VB3 X;  5IIF A;  1QVC A;  2PPB C;  3I4M H;  1PZK D;  1JOQ A;  1FGB D;  3R2T A;  3HOU B;  1BCP F;  3S17 H;  1PTO D;  5IYC H;  1R4Q B;  1ASZ A;  4JBW A;  1EWC A;  2B2V C;  4RGT A;  1ASY A;  2ASB A;  4R4O A;  4DR1 Q;  3B6Y A;  1V43 A;  3C1E A;  1SNC A;  2LS0 1;  1V9P A;  2MJ8 A;  5GAH C;  3RN2 A;  4KN4 C;  2NN6 I;  2EZV A;  4IFD J;  4JOI C;  3GTG B;  1V8Q A;  2NZH A;  4C3H G;  1I50 H;  5FOB B;  4BY7 B;  2K01 A;  3J80 c;  2XGT A;  2JA7 G;  2K05 A;  3SE0 A;  4KD3 A;  1I5F A;  1OO9 B;  2ES2 A;  1HZC A;  2EYH A;  2K32 A;  3S15 H;  2KHJ A;  2X69 A;  3NQT A;  2K03 A;  5DM6 3;  5K36 G;  1Q90 A;  4DV4 Q;  4A3I G;  1U4R A;  3GTL H;  1X3P A;  3NBI A;  1KAW A;  1F9R A;  2HHH L;  3CU7 A;  1D5X C;  3I4N H;  1A2T A;  2DNE A;  4B3S Q;  2QCP X;  3F1Z A;  2TSS A;  3Q6S A;  4A3L G;  4LF8 Q;  2RVL A;  3VA5 A;  1DM0 B;  2A1A A;  1XTD A;  3GD7 A;  1SYD A;  5FO9 B;  2NVX B;  1MHW C;  1W6K A;  4AIM A;  4LF9 L;  2K6A A;  1S5D D;  1EL0 A;  1VS0 A;  5EBC A;  4YY3 Q;  2XIW A;  2R7Z H;  3HOY B;  1L2F A;  2D5D A;  3S16 B;  4KD4 A;  4IFD H;  1ENC A;  4LWC A;  4S3S A;  2LKV A;  3FDT A;  3MVV A;  4DA2 A;  2NWG A;  1F2M A;  2WB1 B;  3PO3 B;  1WTO A;  1H9S B;  3M9B A;  1K0S A;  1PZJ D;  2DNC A;  4ZUI A;  1J8I A;  1HNX Q;  2A6E D;  3J81 i;  2K5V A;  2IY5 B;  5CV8 A;  5M3M B;  4KKS A;  4NXM L;  1B2T A;  3PO2 H;  4X3K A;  1EIG A;  3H94 A;  4WRD A;  1UWV A;  1X6O A;  1YI2 A;  5C4J H;  1BKB A;  1STB A;  1Y1V H;  2VUM G;  1FGU A;  3UE0 A;  2LXK A;  2WB1 G;  3F2B A;  3HOY H;  1Q46 A;  3HKZ G;  5C0X H;  3HOX H;  3URY A;  2SEB D;  5CBE E;  5CGK A;  3ND9 A;  5COR A;  2K52 A;  4DK1 A;  3S1N B;  3DEO A;  2Q2H A;  1BCP B;  4DN4 M;  2CKZ B;  1TXY A;  4JI4 Q;  1B50 A;  1YNX A;  4ZAI A;  4JI6 L;  5T1G A;  1D5M C;  2PNH A;  2DJF C;  2EIF A;  1DGS A;  1IYV A;  1ENA A;  1NE3 A;  2BDO A;  2FJ2 A;  4OXP A;  5HY6 A;  2E5L L;  4HID A;  4R4Q A;  4ZLT F;  1YHQ A;  2EE1 A;  3OMC A;  1WTR A;  4WJW A;  2RQX A;  3KDF B;  5ISR A;  1TY2 A;  3ULP A;  3CC2 A;  2PQA B;  4DR3 L;  4RA8 A;  1RCV D;  3DWQ A;  2KA7 A;  4DXF A;  4J8Q A;  1IKL A;  2AQ2 B;  5M9O A;  2K4K A;  1B9N A;  5EPK A;  4UP9 A;  1G29 1;  1TU2 B;  4QUF A;  5I2Y A;  4EVO A;  4A3M G;  4KY5 A;  3NEN A;  2MPM A;  3S1R B;  3P1H A;  2Z0S A;  1CKM A;  5DM7 3;  5AJ3 L;  3FHW A;  1XPR A;  4LF4 Q;  2B2Y C;  4IFD I;  1O80 A;  4K0K Q;  3IFT A;  4G57 A;  4IUU A;  4K5W A;  3NEM A;  1JMC A;  4XQQ A;  1MJC A;  5FLX L;  1PH1 A;  4EQN A;  3BZD B;  1D7Q A;  1Q81 C;  1X32 A;  5C0X J;  3SK5 A;  3I4M B;  4IUN A;  4DU9 A;  3RN5 A;  2BCO A;  3PCO B;  1WTQ A;  2N88 A;  1FVI A;  1EIY B;  2R93 B;  1UE5 A;  2QEX A;  4GKK Q;  4DKA C;  1B44 D;  2JE6 I;  2FHT A;  1S40 A;  4L5R C;  1Z9F A;  1VF7 A;  4X3T A;  5KNC A;  2EY2 A;  3K80 C;  2ALY B;  2M00 A;  5EJW A;  2L12 A;  2NVQ B;  3G7L A;  1J9O A;  1BO0 A;  2KOL A;  1QVG A;  1WFQ A;  4KY7 A;  1UE6 A;  3TRE A;  1C9O A;  1VMC A;  2Z8L A;  3FVQ A;  2SOB A;  1J5E Q;  2JA8 B;  1EY4 A;  4DR5 L;  1W3S A;  2E2I B;  5JJZ A;  2RCN A;  5G3L D;  1DYQ A;  1KDA A;  5KRU A;  4YY3 L;  3ERO A;  1KQS A;  3GP7 A;  2DGY A;  5IT9 L;  2VW9 A;  5M5X B;  3L9A X;  5C3E G;  1NMG A;  4A3F G;  2EXD A;  2NB0 A;  1TS3 A;  3HOU H;  3I8Z A;  5BN4 A;  3A54 A;  5IP7 G;  4G7Z C;  5FLX E;  3EA6 A;  5IGF A;  1Q82 C;  1Q7Y C;  2KEE A;  5I9P A;  3X3M A;  1QZG A;  3OPO A;  4JV5 L;  3CCM A;  1LT4 D;  3M7G A;  1MJE A;  1L1O C;  2NVQ H;  1EIF A;  2RDG A;  3ND8 A;  2ID0 A;  3BDO A;  4GNX B;  2F0W A;  1E2V A;  1TT2 A;  2K28 A;  1O7I A;  2JA5 G;  1EY8 A;  2N8N A;  5E1F A;  3HOZ B;  2JYO A;  1WTW A;  4GNX A;  2MFI A;  1K28 A;  5FKA C;  3A5U A;  4RCN A;  4CKC A;  2BDN A;  3QIA A;  1EWH A;  5FO7 B;  2E2J B;  3PO3 H;  5IP7 H;  3I4N B;  4RMF A;  5CBA E;  3OIQ A;  2B2U C;  1YIJ A;  3IKJ A;  1LM0 A;  3QJY A;  3QOJ A;  2PZU A;  1WI5 A;  4XIG S;  3HOZ G;  2IT1 A;  5D14 A;  4XTC S;  1WCM B;  5EKL A;  4B3R L;  4K6L A;  1EOV A;  1VQ9 A;  3GV6 A;  4AYB B;  1GUG A;  1Q1B A;  3LNN A;  2K7V A;  4X3S A;  4K5X A;  3TME A;  1VDZ A;  1QIL A;  2ZM6 L;  1GKH A;  2WII B;  3CCQ A;  4QQB X;  1JQY D;  3ZJY C;  3M4Y A;  1D1K A;  4DV1 L;  3I91 A;  4KTA A;  4KK7 A;  1Y1V G;  4QJF A;  2HQL A;  4L5Q A;  3TZU A;  1RDP D;  4DV0 L;  3HKZ E;  3CD6 A;  4GKJ Q;  2F0T A;  1CHQ D;  2XN9 C;  2VQF L;  2HIX A;  1I6H B;  1HR0 W;  2ZTE A;  4E6I A;  2JA7 B;  2RF4 A;  4LW1 A;  3OIP A;  1BBW A;  4QF4 A;  4WFN 3;  2C35 B;  3HOX B;  1AZP A;  4GKJ L;  1FYC A;  3E0E A;  1UNS A;  1Y14 B;  2NVY B;  4BA1 I;  3JAM E;  4ABN A;  3PIP A;  3L2P A;  1BOS A;  1SYF A;  3A8K E;  4B9X A;  2MP1 A;  3SXH A;  3GDE A;  4AYB E;  2F0M A;  2E2H H;  1S5F D;  5CV4 A;  5LHY 1;  1HRJ A;  5D3D A;  1TKW B;  3NSW A;  4IUR A;  4BY7 H;  3S14 B;  2EYF A;  1WD0 A;  1BBU A;  4DV2 Q;  5IP9 H;  4LF6 Q;  1TWH B;  1A15 A;  3S1M H;  2EYM A;  4JI5 Q;  4DV5 Q;  3VA7 A;  1KD1 C;  4YWM A;  4A3D G;  3PIO 3;  3GTJ B;  1Y1W G;  3KBG A;  2JXM B;  2CW0 D;  1B9M A;  1PFB A;  1IZ6 A;  4DR1 L;  1EWI A;  2F0P A;  2NTT A;  3SK8 A;  1BR9 A;  1OXT A;  4M8A A;  1Y8O B;  3MFY A;  1SE8 A;  2D0O A;  2VQE L;  1VMP A;  2PNR C;  4H0L C;  1FD7 D;  2O2L D;  3KLW A;  4C2M H;  4V0B A;  4PQX A;  3NUC A;  1YNJ C;  5IP9 G;  1CQV A;  1Z47 A;  5C44 G;  5LMN W;  1IHZ A;  1EQQ A;  3K7A B;  3MEH A;  4APV A;  2AQ3 B;  2VL6 A;  2G9D A;  4ULL A;  3TP7 A;  4KMU C;  5IWA L;  3HG9 A;  3DMU A;  2WAC A;  2JQO A;  1KL9 A;  1Q8I A;  1SYC A;  1TVX A;  3NTK A;  4IOA A;  1KDB A;  2F0L A;  4YCV A;  4B9W A;  1ICF B;  4MN3 A;  2GN5 A;  5M3M G;  1UE1 A;  1M1K C;  2P5Z X;  1K8M A;  4OEM B;  1ILP A;  2EY1 A;  3KLS A;  4KV6 A;  2QF7 A;  1JIC A;  2ICI A;  2K5D A;  4DR2 Q;  3SEB A;  4IUT A;  5JOB A;  3RZO B;  1PTO F;  2H5X A;  4A4I A;  4L6T B;  4A3G B;  1IKM A;  2GVB A;  3MAQ A;  4MTN A;  4G4K A;  1NNX A;  1EZ8 A;  2PW5 A;  3TSS A;  2F0S A;  1IW7 D;  1VQF A;  1FJG L;  3I7F A;  1SE2 A;  2UUA Q;  1D8L A;  2O5J C;  4YCU A;  1PFS A;  1AZQ A;  4LUZ A;  3I2Z A;  3GV3 A;  2UXB Q;  4H13 C;  2R92 G;  2PW7 A;  3SK4 A;  1M90 C;  4GKK L;  4HR7 B;  4F88 A;  2GVA A;  3NTI A;  4A93 H;  1QUQ A;  4IOC A;  1HUN A;  2CH4 W;  3D31 A;  5I6W A;  1Y1V B;  1QNK A;  3U9S A;  4HJ8 A;  4ILW A;  3TZD A;  3GTO H;  1X55 A;  5C3E H;  3NTH A;  2Z6B A;  4RWS C;  1H9S A;  1X56 A;  1KRT A;  4IPC A;  4A3E H;  1M4V A;  2ZJP A;  1K8A C;  3GTG H;  3RR5 A;  4G7H C;  4IO9 A;  3PIP 3;  4RH6 A;  3QG1 A;  4BBS H;  4AYB G;  1SJE D;  4X64 L;  1RKN A;  5J1Z A;  2NUC A;  4BWG B;  1XNR L;  1FNU A;  4JI7 L;  3M7N A;  1IW7 C;  1TWA H;  5ELN A;  4ZQ3 A;  2NN6 H;  2M9V A;  4PG3 A;  4PMB A;  1SRU A;  3CCU A;  4GLX A;  2V1C C;  3NXW A;  2KQ3 A;  2B63 G;  1RF2 D;  3DWA A;  2CVR A;  3T1Y Q;  5I2X A;  1I6H H;  1VQ7 A;  3MZ5 A;  3RZD H;  3PO3 G;  3OWF A;  4P73 A;  3OOC A;  1SE3 A;  4MIU A;  5CV5 A;  4BY1 B;  1V1O A;  2YTX A;  4CHT B;  1UAP A;  1JWM D;  4A3E B;  2F0I A;  3VR4 A;  1NSN S;  2KEC A;  1X65 A;  3CCJ A;  4YWL A;  4CKB A;  3BDC A;  1XYI A;  3STB D;  1A0I A;  1HUM A;  3MXP A;  4JBK A;  2JEA I;  3HOV H;  4V19 0;  2ZTD A;  2WIN B;  5ELE A;  4QCL A;  1HHV A;  2Z6K A;  2L15 A;  1VQE A;  2A19 A;  1NY4 A;  2K04 A;  3STB C;  5FLX c;  4A3J B;  4A93 B;  2ENB A;  1N32 Q;  1DJR D;  2F4V L;  1HCZ A;  4B3T L;  1LAC A;  1RJT A;  5ELD A;  3HEJ A;  3ERS X;  3EQL C;  1BNZ A;  5KYI A;  2NVY H;  2R93 H;  4XYO A;  3PO2 B;  2EY6 A;  2DUD A;  2F3V A;  3SDZ A;  3J7A V;  1CKO A;  3MWY W;  3GTM H;  4LF7 Q;  1VQ4 A;  3QO2 A;  1HXY D;  5CV7 A;  1QE6 A;  4A3J G;  4NW2 A;  4GOP C;  4BBS B;  1YNN C;  2XWJ B;  3W2D A;  3F2U A;  4K6D A;  5GAE C;  1EY6 A;  1JC7 A;  3S1Q B;  2ZXR A;  4XDX A;  1E2Z A;  3J80 L;  4LF4 L;  4IN3 A;  5JVH 3;  4DV3 Q;  1CA5 A;  1BF4 A;  5BN3 A;  4H02 A;  3SR1 A;  4A3K H;  3CXC A;  3T1Y L;  2EJF C;  2NVT B;  1IYJ B;  1EFI D;  2BE5 C;  2HCC A;  2FFK B;  1BQQ T;  3U58 A;  3OW7 A;  4JG2 A;  3DXJ C;  3T13 A;  1G91 A;  4P75 A;  1SNQ A;  1B7Y B;  4OGQ C;  1K0R A;  3A8I E;  4N9T A;  3K5L A;  5JPM C;  1EY0 A;  2B8F A;  4QY7 A;  1TWG H;  2E2J H;  1LAB A;  1PH5 A;  2MO1 A;  4HCE A;  2O4X A;  4GLA C;  1R4P B;  2HHH Q;  5LMN L;  3IFD A;  4UDU C;  4MHE A;  2F0D A;  4X6A H;  5F2D A;  4UPA A;  1PH2 A;  2B2W C;  4P74 A;  2PZT A;  3CW2 C;  4UHV A;  2Z1C A;  3K5N A;  5J39 A;  1HPC A;  3KBX A;  3CC4 A;  3VDY A;  1LT5 D;  3AFP A;  2QW7 A;  4HN7 A;  4A75 A;  3OTO L;  4JI4 L;  4Q5V A;  3GQB A;  3CMA A;  1DOL A;  3KJP A;  5DNF A;  1VQI A;  3VR6 A;  4R1J A;  3DM3 A;  3T53 B;  4LF7 L;  2L9H A;  3OWE B;  2F4V Q;  3K7U C;  1B1Z A;  5TSS A;  1HA5 A;  1NUC A;  5CMD A;  4TVA B;  1MSH A;  2G5D A;  3W1B A;  2UXB L;  2KCN A;  2VS1 A;  1CZW A;  4JI3 Q;  2L4N A;  4A3B B;  4N9P A;  1Q12 A;  5C4Z A;  1UEB A;  2F03 A;  5IT9 c;  2VXW A;  1RL2 A;  5C3E B;  2R92 H;  1TR5 A;  4JBM A;  1E7Z A;  5LMU L;  3WOE A;  1G6Z A;  2BE5 D;  1NJI C;  1KXL A;  2MO0 A;  4FXG C;  2LXJ A;  2R7Z B;  1YJW A;  2YU9 H;  4LF9 Q;  2TMP A;  1WOC A;  4DR3 Q;  2K33 A;  4NMZ A;  2I46 A;  3GTP H;  2B2W A;  1KNA A;  4R4C A;  5JJI A;  1EY9 A;  4CKE A;  3AEV A;  4X62 Q;  1BDO A;  1UUP A;  3K5O A;  4Y52 H;  4OX9 Q;  3RLO A;  2SNS A;  5C44 B;  4TKO B;  4ZKC B;  3CC7 A;  1LTB D;  2ZT9 C;  1SDF A;  4A93 G;  4CDE C;  1CZG A;  1SSO A;  4DV3 L;  4LF8 L;  4KHP L;  2K5H A;  3CHB D;  3A74 A;  3D4D A;  2ZJR A;  4JI8 Q;  5D3I B;  3HKZ B;  1I4P A;  2Y0S E;  3TN2 A;  1G51 A;  4H7B A;  1G8Z D;  3NPP A;  2C9O A;  2E76 C;  3UDG A;  1S4Z A;  1L1O B;  1PYB A;  4HJ9 A;  1C4Q A;  1LTS D;  4C2M B;  2KEN A;  4WOR A;  4GOP A;  1WTX A;  3VYU A;  4BBS G;  4FVM A;  3GTP B;  1T5X D;  4K8J A;  4JPB W;  2JEB I;  1EQR A;  5BN5 A;  1X54 A;  3A0J A;  2KBN A;  2HDL A;  2WFW A;  1N32 L;  1QG7 A;  2RHS B;  2F0K A;  1VQO A;  4NP5 A;  4UAI A;  4OHJ A;  1YEZ A;  3T51 B;  3BVM A;  3R3O A;  3A7L A;  1CFM A;  2UXD L;  4BY1 H;  5GRO A;  3PO2 G;  1CHP D;  4DNT B;  2A6H C;  1PFM A;  2JA6 H;  2AHO B;  2Z6K C;  2R7Z G;  1WCM G;  2N3S A;  1NTG A;  3GTQ H;  1JWU D;  4BA2 I;  3PUY A;  4C3H B;  4BY7 G;  1HZB A;  1F9P A;  1H9K A;  1L0X B;  2XRQ D;  4IFD G;  5D65 A;  1GHK A;  2OT2 A;  1A6X A;  5DLQ E;  1GVP A;  1XPU A;  1T5E A;  2JN4 A;  5IGG A;  4GOP B;  1S5B D;  5EKK A;  4RKB A;  1F2Z A;  1W6J A;  3GO5 A;  2RSN A;  3UI2 A;  4RHS A;  3S2H B;  4DAY B;  2UXC L;  5ELC A;  3I4O A;  3PF4 A;  4HIK A;  1U4P A;  3SGI A;  4HIM A;  4FXD A;  2EVB A;  2WKD A;  4DV7 Q;  2IX0 A;  1AE3 A;  1RTO A;  1WCM H;  2RHQ B;  4R4I A;  4ZCK A;  2PQA A;  2JA6 B;  2L0C A;  1PYS B;  2XVS A;  3NEL A;  2B29 A;  1VQC A;  3KF8 B;  4MZ9 A;  4U68 A;  2PMZ E;  1I4Q A;  3ERQ A;  3UDI A;  1O7Z A;  1CK1 A;  5IYD G;  4UP7 A;  5EAY A;  3D4R A;  1PTO H;  2AUJ D;  2LSS A;  2D9U A;  4KKT A;  4DK0 A;  2ATW A;  2K1B A;  1YIT A;  4O1N A;  2HD3 A;  2Y0S B;  2A6H D;  3NQI A;  2IL8 A;  4LF5 Q;  3M4P A;  3T16 A;  2HIV A;  1VQL A;  2A69 C;  2R3Z A;  2VY3 A;  2PCF B;  3D8G A;  5I6Y A;  2WKC A;  2L11 A;  2K5Q A;  5JPN C;  2A6E C;  2F0U A;  3HFZ B;  1X3G A;  2UXC Q;  1GO3 E;  2VUM B;  1RHP A;  4R8I A;  1ONL A;  4A76 A;  1DXM A;  5JJK A;  4OO1 I;  3S1M B;  1DCZ A;  3BJU A;  5M5W B;  4BBR G;  5DAU A;  1CM9 A;  4A3M H;  1STN A;  2BA0 A;  1OXV A;  4DR2 L;  3A55 A;  5J22 A;  3PUV A;  4QUC A;  4RKL A;  1J6Q A;  1B3Q A;  2AMC B;  2RDF A;  4ZK9 B;  2J4X A;  1JOR A;  5IGC A;  1KDC A;  2PZW A;  2L55 A;  1IBL L;  3CPW A;  4POF A;  2A68 D;  4XXE A;  4QIW B;  3T1H Q;  3G6E A;  4A3C H;  1STA A;  4FO2 A;  1EOT A;  3M85 A;  5C4X G;  4KY6 A;  1WYD A;  3H0G G;  4CGY B;  4OIJ A;  4DUZ L;  1L0W A;  4B3R Q;  1CI3 M;  3IRB A;  4KLK A;  3BDL A;  2OTJ A;  3DEP A;  3QWN A;  5M5Y B;  1CSQ A;  4A3G H;  4TRD A;  2ICE C;  2HUG A;  1RD9 D;  1LLR D;  1WJJ A;  2ZM6 Q;  2VQE Q;  4EQP A;  1I50 B;  4UY8 C;  1F2L A;  3D6C A;  4LFB Q;  3BS1 A;  3RLN A;  4H44 C;  1ZYR D;  2SDF A;  2SNM A;  1PH3 A;  1NAP A;  1MI2 A;  4J6H A;  4FF2 A;  1TY0 A;  1OXS C;  2OCE A;  2B63 H;  2MUY A;  1U0L A;  2RDH A;  1BXT A;  3KDF A;  2ZXP A;  1CKN A;  3VR3 A;  3GTL B;  1X3F A;  1LTG D;  3NBH A;  4NPS A;  3H3V C;  2J7Z A;  4GS3 A;  3KF6 A;  2F1M A;  4DF7 A;  1L0Y B;  4KHP Q;  3FPU B;  2IWH A;  1PH7 A;  4LK1 C;  1VQA A;  4B08 A;  1X3E A;  1E1O A;  4FF3 A;  2IW3 A;  2CHB D;  3KK7 A;  4TSS A;  3MXN B;  4LNQ A;  2JJQ A;  2NYZ D;  4RGO S;  4PV1 C;  1HQM C;  3M4Q A;  1HZ9 A;  4OX9 L;  4ALP A;  4IUV A;  3OW2 A;  1EYA A;  2KCC A;  2R7F A;  2B2T C;  2CFM A;  2WAQ B;  3MTS A;  3MXN A;  4DGZ A;  2N78 A;  5M5Y H;  1MD2 D;  3FKI G;  4KHZ A;  1R9T H;  2PI2 E;  3KJO A;  3L7Z C;  1H9J A;  2B2Y A;  2XNA C;  2UUB Q;  2FIN B;  1MGS A;  1ILQ A;  2F0G A;  5JVG 3;  3HZX A;  1MIU A;  3U4Z A;  3UDF A;  4JI0 L;  1SBB B;  5L37 A;  1XJV A;  3BVG A;  1I94 Q;  2KVM A;  2IHF A;  1KLG D;  3BU2 A;  4XQN A;  5I9O A;  4MTK A;  2MGS A;  1ROD A;  1RIP A;  4X65 L;  5FK9 C;  3E6Z X;  3ITP A;  2ZXO A;  4LMQ D;  1SFO H;  4A3L H;  3RUZ A;  1ZYR C;  1YNN D;  3P7J A;  5C3W A;  3BZK A;  3S14 H;  1DON A;  5I4D A;  2BH8 A;  3FKI H;  4OWT B;  5IGB A;  2V4D A;  1XPO A;  2VZA A;  2I5M X;  1YHA A;  1VF5 C;  1XTC D;  4QIW E;  4X66 L;  1E1T A;  2L1B A;  4JI3 L;  3Q24 A;  2IX1 A;  1AFP A;  1EFW A;  4JI1 Q;  3HS0 C;  1N9W A;  3CCE A;  5ELF A;  4DV6 L;  2PQE A;  1HNX L;  1KAA A;  4RGN A;  5FLM H;  1TS5 A;  3K0X A;  1EZ6 A;  4UP8 A;  2E2D C;  2KHS A;  1I94 L;  5ELO A;  5LMN Q;  2G9H D;  4FXK C;  5IGE A;  3D0F A;  3D4W A;  3PIO A;  3C46 A;  4XQJ A;  3GTM B;  2R6G A;  1Q3L A;  3TBI B;  1VQH A;  1PHJ A;  3VR2 A;  1JR0 D;  3FKI B;  5M3F G;  1E0B A;  4LUV A;  3AQQ A;  2CWA A;  4I7A A;  2LFN A;  4RFB A;  1B4O A;  2H4O A;  3E0J A;  3NWS A;  2NTS A;  3BYT B;  1PLF A;  3HOY G;  4AH6 A;  3H15 A;  1O7Y A;  1JT8 A;  3FMC A;  1JOO A;  1QB5 D;  4FF4 A;  1N36 Q;  3MA2 B;  3CCR A;  1XNR Q;  2RKS A;  1JJC B;  1OXX K;  1KLU D;  4N8X 1;  5KYL A;  4OWW B;  4B3M L;  1D6E C;  1XMQ L;  3H3V I;  2E75 C;  1K8O A;  4DV4 L;  2EYJ A;  2MQH A;  3I55 A;  1SR3 A;  3H3V H;  4OO1 G;  2IJ0 A;  1EU4 A;  3J7Y W;  1ENF A;  4DUY Q;  3H91 A;  1LYL A;  2OQ0 A;  5G3L F;  3S1Q H;  4KN7 C;  2BH2 A;  2CW0 C;  4K8I A;  5EGT A;  1YNJ D;  3QOL A;  4HIO A;  1V1P B;  3H0G B;  3OMG A;  3S1R H;  4Q0F A;  2KCT A;  1IBK Q;  2UU9 Q;  4RG1 A;  4BXX H;  5A2Q L;  4ZKB B;  3HOU G;  4OL7 A;  3HKS A;  1N34 L;  2FXQ A;  1LTR D;  4JI1 L;  1PRT B;  3K59 A;  1SE4 A;  3PUZ A;  4XT3 B;  4BBR H;  1WTV A;  1DOM A;  1NCV A;  1IBK L;  2UU9 L;  4X66 Q;  4AQY L;  4X65 Q;  1TII D;  2UUA L;  1O7L A;  1VQD A;  1SRO A;  4QMG A;  1K83 H;  3W3A A;  5EPL A;  3NHH A;  1BBX C;  1LT6 D;  1EEF D;  2FMM A;  3J81 c;  2N49 A;  3H6M A;  3OTO Q;  1K8G A;  2AKW B;  3RLF A;  3CKI B;  3N6R A;  5AJ3 Q;  3MC0 B;  4ODG A;  2CQO A;  5C0X I;  3AB9 A;  3I73 A;  3CRK C;  1PZI D;  3KF6 B;  3NWT A;  3P75 A;  1HH2 P;  2XTI A;  3I70 A;  2B2V A;  1AN8 A;  1G2T A;  3NP8 A;  1HQR D;  2EOT A;  4CDD C;  5JEA G;  1XMQ Q;  3R2I A;  4BXX G;  2GA4 B;  4BS9 A;  1B8A A;  5A35 A;  2XWB B;  4JVZ A;  3MHB A;  4YHH Q;  1V1P A;  4EGV A;  4ID6 A;  4K2K A;  1E2W A;  4LAA A;  4R4T A;  1SYB A;  3D6W A;  4C1N K;  2QGQ A;  2JSO A;  1GOZ A;  3J81 j;  2UUC Q;  4F8M A;  3J7Z C;  4PMC A;  3I4N G;  1AP0 A;  1ESF A;  2I0Q A;  1JE5 A;  4IZ8 A;  3J81 L;  2JA9 A;  2BA1 A;  2QEJ C;  1EQT A;  5IGD A;  4BBR B;  3TDQ A;  1EU3 A;  1A3T A;  1LTL A;  5HGQ A;  4JI6 Q;  2Q2T A;  4JI7 Q;  1K73 C;  5FO8 B;  1TWF H;  4Y7N B;  1JB7 A;  4HJ5 A;  1LTA D;  5LL6 S;  1Q86 C;  1I4R A;  2WV6 D;  4DXG A;  5EPJ A;  1P16 A;  2ZJQ A;  4RHR A;  5CYU A;  4QGU A;  3TRZ A;  4K5V A;  2C5C A;  5COY A;  3AYH B;  1HNW Q;  3CF5 A;  2MHV A;  4DV6 Q;  4A3I H;  3SHL A;  1AW7 A;  2QA4 A;  1PA6 A;  4P2C B;  2N55 A;  5LL6 X;  1SNM A;  3J80 E;  1HTL D;  2R7D A;  5T1I A;  1BUV T;  2NN6 G;  4PZ6 A;  1SMX A;  1FJG Q;  3K0Y A;  2EJG C;  3QR8 A;  3I72 A;  2OTL A;  2I07 B;  1G6P A;  3I3C A;  2K5N A;  3SK6 A;  2XRS D;  3S24 A;  1I4H A;  1Z7T A;  4DNI A;  3JAM c;  2E74 C;  1W2B A;  1STG A;  1KHI A;  2B2T A;  4OIK A;  3W1G A;  4C3J H;  3C3L A;  2VUM H;  1X9N A;  5EKI A;  1F9S A;  3BYY B;  5C4X B;  3BZC A;  1QOH A;  1I4G A;  3T1H L;  3TP5 A;  3LWU A;  3T56 B;  1XMO Q;  4FF1 A;  1JOK A;  2I5L X;  1EY7 A;  3E9H A;  5HUR A;  1XMO L;  2NVT H;  1A3U A;  1YJ9 A;  4K14 A;  4L5T A;  1JCK B;  5DEH A;  3ER0 A;  1HR0 L;  3E3X A;  1TWA B;  3H09 A;  2X6L A;  1Q1E A;  1HNZ L;  2F0Q A;  3T4A C;  2JP1 A;  4JYA Q;  5M5X H;  4QB4 A;  1Q8K A;  4DV1 Q;  5M3F H;  2NVX H;  4LFC L;  1OXU A;  2ZTC A;  2DY7 A;  3MXG A;  4NXN L;  2IX3 A;  2A8V A;  4LJZ C;  4L5S A;  3FRP B;  1QZH A;  3M3Y B;  1U4M A;  5KGU A;  5C0X G;  3HOX G;  3TP8 A;  1I6V C;  3VR5 A;  1YZ6 A;  1DD2 A;  2EPB A;  1VQK A;  5E3F A;  4L63 B;  1H9R A;  3PUX A;  1B53 A;  3KYH C;  1JE4 A;  4JC0 A;  2R61 A;  3HP3 A;  1D2B A;  5KEE A;  4LF5 L;  2E8G A;  1RTN A;  2WAQ G;  3RNU A;  1QWY A;  1VCI A;  1JJ2 A;  4GNX C;  1HNW L;  4OO1 H;  3S2D H;  2A69 D;  2Z9H A;  1PRT F;  3AU7 A;  4O2D A;  2H1E A;  1QNU A;  3KOJ A;  4DV2 L;  4WJ4 A;  4A3K G;  1CQF A;  2D2C C;  1B3A A;  5EQ0 A;  1ET9 A;  3PMF A;  3CCV A;  2YU9 B;  1NMF A;  2EQS A;  1EEI D;  1R9T B;  4JI2 L;  1L1O A;  2QDB A;  5E4W C;  5M3F B;  4JI5 L;  1EYG A;  5AFW A;  1FL0 A;  4DAY A;  1K83 B;  1TS2 A;  3NBH B;  3HGB A;  1P8L A;  1SEB D;  3K5M A;  3KFU A;  3M3Y H;  4C3J B;  4A3C G;  3UE1 A;  1PH9 A;  2RBM A;  1HTP A;  2FMC A;  4PNY A;  4G7O C;  1EUJ A;  1TQO A;  4PMW A;  5IYD H;  1IYU A;  3DUZ A;  2JA8 G;  5GAG C;  4IPD A;  3CCL A;  1QVF A;  4A3G G;  1U4L A;  4X62 L;  1LTT D;  1M8A A;  5C6A A;  3W5O A;  1PYW D;  1HNZ Q;  3WDN A;  4FNF A;  5JEA J;  1ZXT A;  2KHI A;  3Q22 A;  3RMH A;  4YHH L;  4HMI A;  3U9O A;  1T9H A;  4DR4 Q;  5CV9 A;  4JBJ A;  1ZEQ X;  3EN2 A;  3U50 C;  1J5E L;  1GUN A;  1SN8 A;  1A8V A;  1EY5 A;  5JEA H;  1SJH D;  4LFA Q;  3IAY A;  2UXD Q;  5C44 H;  3OHX C;  2DJG C;  3WWV A;  1KC8 C;  1EQV A;  2CH4 A;  1DOK A;  2F4I A;  4A3E G;  5IYB H;  2I5H A;  3M4O H;  4GN3 B;  4HED A;  1IXR A;  4JW0 A;  1FR3 A;  3EFX D;  3JC6 6;  4AQY Q;  2OXP A;  4JI2 Q;  1QUQ B;  5KNB A;  4FP5 D;  5CC4 A;  3LX0 A;  2LY7 A;  3ULJ A;  3ULL A;  3WOF A;  1CUK A;  1STE A;  2OEO A;  2KUM A;  4R9W A;  3DLL A;  1GM5 A;  2CWP A;  2F0F A;  4FDB A;  1NR2 A;  4XT1 B;  1GXD C;  1KAB A;  3F8T A;  2K50 A;  4XYQ A;  3L3O C;  1MBY A;  1SLJ A;  4A3F H;  4DR6 Q;  3TS2 A;  3QB3 A;  3A56 A;  1N33 Q;  1TWH H;  1PH4 A;  4DFA A;  3DHQ A;  3UDX A;  3RD4 A;  3X3N A;  1SMY C;  2QKI C;  1C8C A;  4ME3 A;  1U5K A;  1PTO C;  4JV5 Q;  4A3B H;  2KJX A;  4JI8 L;  1JB3 A;  5IYC G;  1ML0 D;  1QJO A;  4JYA L;  4YWK A;  1TWC H;  3GTQ B;  1I4X A;  2F0N A;  1IL2 A;  2PYK A;  3PSI A;  3OYY A;  1HR0 Q;  2EXZ A;  1X3Q A;  2UUC L;  1STH A;  4OWX B;  2F0O A;  4I65 A;  4CJ2 C;  3A8J E;  4HJA A;  2E5L Q;  3FEW X;  1VQ6 A;  2PI2 A;  2B39 A;  2Q2I A;  1XWE A;  3BVZ A;  3C2P A;  2VQF Q;  1CA6 A;  2R93 G;  2XSC A;  4GLV B;  2F0V A;  3L0O A;  4DV0 Q;  4QL5 A;  3V2T A;  5IT9 E;  4A3D B;  2K14 A;  5FLM G;  1KNE A;  4YIJ A;  4DR7 Q;  5C5M A;  3CME A;  3RZD B;  2VNU D;  4A3J H;  1GD7 A;  4FYD A;  1A63 A;  2B2U A;  4L8J A;  3CQZ H;  4IUP A;  4O0A A;  4CJ1 B;  3CCS A;  1AE2 A;  1XX8 A;  4DAP A;  5BR8 L;  3K58 A;  1PFN A;  2B3G A;  2F0E A;  4IPH A;  4N8F A;  1FNW A;  1UE7 A;  2OF1 A;  3EBE A;  1YHB A;  2B8G A;  3EJI A;  2Q8I B;  2AWN A;  4P72 A;  1QCB D;  2Q8T A;  4IQZ A;  3S9W A;  3HOV B;  2AUK A;  5IY0 A;  2F3W A;  3G4S A;  4HMJ A;  1CT1 D;  1F2Y A;  2EYL A;  4K0K L;  4OEL B;  1SND A;  4C3I B;  1Y1W B;  3EVQ A;  3TP6 A;  2JK8 A;  1F77 A;  1STY A;  1B70 B;  2NZ1 D;  3G6J B;  5KIX A;  4IUQ A;  1OTC A;  3JAM L;  4A3K B;  4B3M Q;  1GUO A;  1K3R A;  3J80 i;  2QIL A;  3KLS X;  3IL8 A;  1SFO B;  5FJ8 G;  4DUY L;  1PDQ A;  3MEF A;  4LUO A;  3PV0 A;  1SMY D;  3HRZ C;  3GTK B;  1F9Q A;  4ZYS A;  3Q8D A;  1S5E D;  1Y8N B;  4J15 A;  5EBD A;  1IBM Q;  1YJN A;  1IL8 A;  2Z4I A;  1Y69 U;  2HQE A;  2L5T A;  2WP8 J;  1E3P A;  1V1Q A;  3HOW H;  3KLR A;  2EYP A;  1HFN A;  3TQY A;  4ZRZ A;  4C56 C;  1PVO A;  1N8R C;  4GN4 B;  2HDM A;  4B3S L;  3PUW A;  2X6G A;  4HTH A;  4A3D H;  1ZKO A;  1VQB A;  3J7A 5;  4KJN A;  4A3I B;  2F3I A;  1HZA A;  1TS4 A;  4GZY C;  1Z6H A;  4JK1 C;  4EQ5 A;  1GJX A;  3P20 A;  5LMU Q;  2PMZ B;  4HSV A;  1SNO A;  1TWF B;  5ELB A;  2MNA A;  4DR6 L;  3GTK H;  2A5H A;  5IE8 A;  1VQ8 A;  1SYG A;  1CKN B;  1ICW A;  5A2Q E;  3C1F A;  3S16 H;  1FNV A;  1Y8P B;  3OSO A;  1XNQ L;  3MFG A;  1N34 Q;  4EQO A;  1E22 A;  1BVS A;  4LFB L;  1XNQ Q;  3AMU A;  4KJO A;  2RCF A;  5C4X H;  5BR8 Q;  3H0G H;  2JA8 H;  4CBV A;  4F87 A;  4B3T Q;  1VQ5 A;  5E7N A;  1AEX A;  3R8B A;  3F2C A;  3I4M G;  4I7Z C;  1YBY A;  1MKH A;  3K6O A;  5M3M H;  3K7A H;  4X3U A;  4NXM Q;  1ET6 A;  3KUP A;  4DK3 C;  3K57 A;  4A3F B;  2NZO A;  2O5I C;  1PRT C;  3BG3 A;  5CR3 A;  1GUS A;  1H9M A;  2JA5 H;  2F0H A; 
#chains in the Genus database with same CATH homology
 3V05 A;  1BCP C;  2EY5 A;  1GUW A;  3E5S A;  1PRT D;  2EYO A;  4Z9C B;  4ME5 A;  1GHJ A;  3DWP A;  2Z4H A;  5HGT A;  4KKU A;  1II3 A;  4HAE A;  1SNP A;  4RAU C;  1MSG A;  2RSO A;  3DM1 A;  1ESR A;  1SAP A;  1NR4 A;  3J81 E;  4TQU S;  3N52 A;  4NKL A;  1UEA B;  4HSP A;  3J7A F;  2EJM A;  1A3V A;  4IAL A;  3MXU A;  4CJ0 B;  1TWC B;  4DAV A;  1LTI D;  4C3J G;  3CQZ B;  1LV9 A;  5C3X A;  2AQ1 B;  5KND A;  1SXT A;  2JA5 B;  1EIH A;  5K36 H;  5C5L A;  2KED A;  1D1I A;  1D5Z C;  2BOS A;  2A68 C;  3ONA B;  1WVL A;  1EYD A;  1WD1 A;  2E2H B;  2HCI A;  4J1M A;  3NE5 B;  3O13 A;  1KTK A;  4M1U B;  1LO5 D;  3SVM A;  3VYR A;  3KF8 A;  1BCP D;  4C3I G;  4RCO A;  1I3Q B;  3VYT A;  2IPK D;  5C4H A;  3GTO B;  4C1N I;  2B63 B;  3D3R A;  5JAV A;  4DNR B;  3A7A B;  5K5P A;  1CTM A;  4U67 3;  5IOC A;  2R92 B;  4F7X A;  2LMC B;  3I4L A;  1O78 A;  2RA4 A;  2A73 B;  1S5C D;  4ZUJ A;  2DY8 A;  3Q0A A;  1U9R A;  1PXU A;  3M4O B;  2F0J A;  2Q8R E;  1SYE A;  3VYS A;  5IOD A;  2EDG A;  5C4J B;  1GUT A;  3I90 A;  1G2S A;  2YYZ A;  2PO4 A;  2DN8 A;  2J0T D;  2CQA A;  1PMR A;  4K2L A;  1WTP A;  5E4X A;  5NUC A;  3HOW B;  2AWO A;  3FPP A;  1EYC A;  1PTO B;  1HA6 A;  3V96 A;  1XXG A;  2K5W A;  3NK9 A;  4O42 A;  1DZ1 A;  1HFG A;  5CV6 A;  3S17 B;  1TWG B;  3ZYY X;  1JWS D;  2M2L A;  3R93 A;  4R8N A;  4RGM A;  1A2U A;  4A3M B;  2VB2 X;  4NDX A;  4KHV A;  3LWE A;  1LT3 D;  3S2D B;  3CRL C;  3Q23 A;  3S15 B;  2D62 A;  1C48 A;  4HCS A;  2A74 C;  2NBF A;  2VB3 X;  4KI0 A;  5IIF A;  2PPB C;  1PZK D;  1JOQ A;  1FGB D;  3R2T A;  3HOU B;  1BCP F;  1PTO D;  1R4Q B;  4JBW A;  1EWC A;  2B2V C;  4RGT A;  1V43 A;  1SNC A;  2LS0 1;  3C1E A;  2EZV A;  2MJ8 A;  4IFD J;  4KN4 C;  2NN6 I;  3GTG B;  1V8Q A;  4C3H G;  5FOB B;  4BY7 B;  2K01 A;  2K05 A;  3SE0 A;  4KD3 A;  1OO9 B;  2EYH A;  2K32 A;  2X69 A;  3NQT A;  2K03 A;  5DM6 3;  5K36 G;  1Q90 A;  1U4R A;  1X3P A;  3NBI A;  1F9R A;  3CU7 A;  1D5X C;  1A2T A;  2DNE A;  2QCP X;  2TSS A;  3Q6S A;  2RVL A;  3VA5 A;  1DM0 B;  3GD7 A;  1SYD A;  5FO9 B;  2NVX B;  1W6K A;  2K6A A;  1S5D D;  1EL0 A;  5EBC A;  2XIW A;  3HOY B;  2D5D A;  3S16 B;  4KD4 A;  4IFD H;  1ENC A;  4S3S A;  2LKV A;  3FDT A;  3MVV A;  4DA2 A;  2NWG A;  1F2M A;  2WB1 B;  3PO3 B;  1WTO A;  1H9S B;  1PZJ D;  2DNC A;  4ZUI A;  1J8I A;  2A6E D;  5CV8 A;  5M3M B;  4KKS A;  1B2T A;  4X3K A;  1EIG A;  3H94 A;  4WRD A;  1STB A;  5C0X H;  3URY A;  2SEB D;  5CBE E;  5CGK A;  3ND9 A;  5COR A;  4DK1 A;  3S1N B;  3DEO A;  1BCP B;  4DN4 M;  1B50 A;  4ZAI A;  5T1G A;  1D5M C;  1IYV A;  1ENA A;  2BDO A;  2FJ2 A;  4ZLT F;  2EE1 A;  3OMC A;  1WTR A;  4WJW A;  2RQX A;  5ISR A;  1TY2 A;  4RA8 A;  1RCV D;  3DWQ A;  2KA7 A;  4DXF A;  4J8Q A;  1IKL A;  2AQ2 B;  5M9O A;  1B9N A;  5EPK A;  1G29 1;  1TU2 B;  4QUF A;  5I2Y A;  4EVO A;  4KY5 A;  3S1R B;  2MPM A;  3P1H A;  5DM7 3;  4IFD I;  2B2Y C;  1O80 A;  3IFT A;  4G57 A;  4IUU A;  4K5W A;  4XQQ A;  5FLX L;  4EQN A;  3BZD B;  1X32 A;  5C0X J;  3SK5 A;  3I4M B;  4IUN A;  4DU9 A;  2BCO A;  1WTQ A;  2N88 A;  2R93 B;  1B44 D;  2JE6 I;  2FHT A;  1VF7 A;  4X3T A;  5KNC A;  2EY2 A;  2M00 A;  5EJW A;  2L12 A;  2NVQ B;  3G7L A;  1J9O A;  1BO0 A;  2KOL A;  4KY7 A;  2Z8L A;  1VMC A;  3FVQ A;  2SOB A;  2JA8 B;  1EY4 A;  2E2I B;  5JJZ A;  5G3L D;  1DYQ A;  1KDA A;  5KRU A;  3ERO A;  3GP7 A;  5IT9 L;  5M5X B;  3L9A X;  2NB0 A;  1TS3 A;  3I8Z A;  5BN4 A;  3A54 A;  4G7Z C;  5FLX E;  3EA6 A;  5IGF A;  2KEE A;  5I9P A;  3X3M A;  3OPO A;  1LT4 D;  3M7G A;  2RDG A;  3ND8 A;  2ID0 A;  3BDO A;  2F0W A;  1E2V A;  1TT2 A;  2K28 A;  1EY8 A;  5E1F A;  3HOZ B;  2JYO A;  1WTW A;  5FKA C;  4RCN A;  4CKC A;  2BDN A;  3QIA A;  1EWH A;  5FO7 B;  2E2J B;  3I4N B;  5CBA E;  3OIQ A;  2B2U C;  3IKJ A;  3QJY A;  3QOJ A;  2PZU A;  4XIG S;  2IT1 A;  5D14 A;  4XTC S;  1WCM B;  5EKL A;  4K6L A;  3GV6 A;  4AYB B;  1GUG A;  1Q1B A;  3LNN A;  2K7V A;  4X3S A;  4K5X A;  3TME A;  1VDZ A;  1QIL A;  2WII B;  1JQY D;  3M4Y A;  1D1K A;  3I91 A;  4KTA A;  4KK7 A;  3TZU A;  1RDP D;  2F0T A;  1CHQ D;  2XN9 C;  1I6H B;  4E6I A;  2JA7 B;  3OIP A;  4QF4 A;  4WFN 3;  3HOX B;  1AZP A;  1FYC A;  1UNS A;  2NVY B;  4BA1 I;  3JAM E;  4ABN A;  1BOS A;  1SYF A;  3A8K E;  4B9X A;  2MP1 A;  3SXH A;  2F0M A;  1S5F D;  5CV4 A;  5LHY 1;  1HRJ A;  5D3D A;  1TKW B;  3NSW A;  4IUR A;  3S14 B;  2EYF A;  1WD0 A;  1TWH B;  1A15 A;  2EYM A;  3VA7 A;  3PIO 3;  3GTJ B;  3KBG A;  2JXM B;  2CW0 D;  1B9M A;  1PFB A;  2F0P A;  2NTT A;  3SK8 A;  1BR9 A;  1OXT A;  4M8A A;  1Y8O B;  3MFY A;  1VMP A;  2PNR C;  4H0L C;  1FD7 D;  2O2L D;  4V0B A;  4PQX A;  3NUC A;  1YNJ C;  1CQV A;  1Z47 A;  1IHZ A;  3K7A B;  3MEH A;  2AQ3 B;  2G9D A;  4ULL A;  3TP7 A;  4KMU C;  3HG9 A;  3DMU A;  2WAC A;  1Q8I A;  1SYC A;  1TVX A;  3NTK A;  1KDB A;  2F0L A;  4B9W A;  4MN3 A;  1K8M A;  1ILP A;  2EY1 A;  3KLS A;  4KV6 A;  2QF7 A;  1JIC A;  2ICI A;  2K5D A;  3SEB A;  4IUT A;  5JOB A;  3RZO B;  1PTO F;  4L6T B;  4A3G B;  1IKM A;  3MAQ A;  4G4K A;  1EZ8 A;  2PW5 A;  3TSS A;  2F0S A;  1IW7 D;  1SE2 A;  2O5J C;  1AZQ A;  3GV3 A;  4H13 C;  2PW7 A;  3SK4 A;  4HR7 B;  4F88 A;  3NTI A;  1HUN A;  3D31 A;  5I6W A;  1Y1V B;  1QNK A;  3U9S A;  4ILW A;  3TZD A;  3NTH A;  4RWS C;  1H9S A;  1M4V A;  4G7H C;  3PIP 3;  4RH6 A;  3QG1 A;  1SJE D;  1RKN A;  5J1Z A;  2NUC A;  4BWG B;  1FNU A;  3M7N A;  1IW7 C;  4ZQ3 A;  2NN6 H;  2M9V A;  4PMB A;  3NXW A;  2KQ3 A;  1RF2 D;  3DWA A;  2CVR A;  5I2X A;  3MZ5 A;  3OWF A;  3OOC A;  1SE3 A;  4MIU A;  5CV5 A;  4BY1 B;  1V1O A;  4CHT B;  1UAP A;  1JWM D;  4A3E B;  2F0I A;  3VR4 A;  1NSN S;  2KEC A;  4CKB A;  3BDC A;  1XYI A;  1HUM A;  3MXP A;  2JEA I;  4V19 0;  2WIN B;  5ELE A;  4QCL A;  1HHV A;  2K04 A;  4A3J B;  4A93 B;  2ENB A;  1DJR D;  1HCZ A;  1LAC A;  1RJT A;  5ELD A;  3HEJ A;  3EQL C;  1BNZ A;  5KYI A;  4XYO A;  3PO2 B;  2EY6 A;  2F3V A;  3SDZ A;  3J7A V;  3MWY W;  3QO2 A;  1HXY D;  5CV7 A;  1QE6 A;  4NW2 A;  4BBS B;  1YNN C;  2XWJ B;  3W2D A;  3F2U A;  4K6D A;  1EY6 A;  1JC7 A;  3S1Q B;  2ZXR A;  4XDX A;  1E2Z A;  3J80 L;  4IN3 A;  5JVH 3;  1CA5 A;  1BF4 A;  5BN3 A;  3SR1 A;  2EJF C;  2NVT B;  2BE5 C;  1EFI D;  2HCC A;  2FFK B;  1BQQ T;  3OW7 A;  3DXJ C;  3T13 A;  1G91 A;  1SNQ A;  4OGQ C;  3A8I E;  4N9T A;  3K5L A;  5JPM C;  1EY0 A;  2B8F A;  1LAB A;  4HCE A;  2O4X A;  1R4P B;  3IFD A;  4UDU C;  4MHE A;  2F0D A;  5F2D A;  2B2W C;  2PZT A;  2Z1C A;  3K5N A;  5J39 A;  1HPC A;  3KBX A;  1LT5 D;  4HN7 A;  4Q5V A;  3GQB A;  1DOL A;  5DNF A;  3VR6 A;  3T53 B;  2L9H A;  3OWE B;  1B1Z A;  5TSS A;  1HA5 A;  1NUC A;  5CMD A;  1MSH A;  2KCN A;  1CZW A;  2L4N A;  4A3B B;  4N9P A;  1Q12 A;  5C4Z A;  2F03 A;  2VXW A;  5C3E B;  1TR5 A;  3WOE A;  1G6Z A;  2BE5 D;  4FXG C;  2R7Z B;  2TMP A;  2K33 A;  4NMZ A;  2I46 A;  2B2W A;  1KNA A;  1EY9 A;  4CKE A;  1BDO A;  1UUP A;  3K5O A;  2SNS A;  5C44 B;  4TKO B;  4ZKC B;  1LTB D;  2ZT9 C;  1SDF A;  1CZG A;  1SSO A;  3CHB D;  3D4D A;  5D3I B;  3HKZ B;  1I4P A;  3TN2 A;  4H7B A;  1G8Z D;  3NPP A;  2C9O A;  2E76 C;  1S4Z A;  1C4Q A;  1LTS D;  4C2M B;  4WOR A;  1WTX A;  3VYU A;  4FVM A;  3GTP B;  1T5X D;  4K8J A;  2JEB I;  5BN5 A;  2HDL A;  1QG7 A;  2F0K A;  4NP5 A;  4UAI A;  4OHJ A;  3T51 B;  3BVM A;  3R3O A;  3A7L A;  1CFM A;  1CHP D;  4DNT B;  2A6H C;  1PFM A;  1JWU D;  4BA2 I;  3PUY A;  4C3H B;  1F9P A;  1H9K A;  1L0X B;  2XRQ D;  4IFD G;  5D65 A;  1GHK A;  2OT2 A;  1A6X A;  1T5E A;  5IGG A;  1S5B D;  5EKK A;  4RKB A;  1F2Z A;  1W6J A;  3GO5 A;  2RSN A;  3UI2 A;  4RHS A;  3S2H B;  5ELC A;  1U4P A;  4FXD A;  2EVB A;  2WKD A;  2IX0 A;  1RTO A;  2JA6 B;  2L0C A;  2XVS A;  4U68 A;  1I4Q A;  3ERQ A;  1O7Z A;  1CK1 A;  3D4R A;  1PTO H;  2AUJ D;  2D9U A;  4KKT A;  4DK0 A;  2K1B A;  4O1N A;  2Y0S B;  2A6H D;  3NQI A;  2IL8 A;  3T16 A;  2A69 C;  2R3Z A;  2PCF B;  3D8G A;  5I6Y A;  2WKC A;  2L11 A;  2K5Q A;  5JPN C;  2A6E C;  2F0U A;  2VUM B;  1RHP A;  4R8I A;  1ONL A;  1DXM A;  4OO1 I;  3S1M B;  1DCZ A;  5M5W B;  5DAU A;  1CM9 A;  1STN A;  2BA0 A;  1OXV A;  3A55 A;  5J22 A;  3PUV A;  4QUC A;  4RKL A;  2RDF A;  4ZK9 B;  2J4X A;  1JOR A;  5IGC A;  1KDC A;  2PZW A;  2L55 A;  2A68 D;  4XXE A;  4QIW B;  1STA A;  4FO2 A;  1EOT A;  3M85 A;  4KY6 A;  4CGY B;  4OIJ A;  1CI3 M;  3BDL A;  3DEP A;  3QWN A;  5M5Y B;  4TRD A;  2ICE C;  2HUG A;  1RD9 D;  1LLR D;  4EQP A;  1I50 B;  1F2L A;  3D6C A;  3BS1 A;  4H44 C;  1ZYR D;  2SDF A;  2SNM A;  1NAP A;  1MI2 A;  4J6H A;  4FF2 A;  1TY0 A;  1OXS C;  2MUY A;  2RDH A;  1BXT A;  2ZXP A;  3VR3 A;  3GTL B;  1LTG D;  3NBH A;  3H3V C;  2J7Z A;  4DF7 A;  2F1M A;  1L0Y B;  3FPU B;  2IWH A;  4LK1 C;  4B08 A;  4FF3 A;  2IW3 A;  2CHB D;  3KK7 A;  4TSS A;  2NYZ D;  4RGO S;  4PV1 C;  1HQM C;  4IUV A;  1EYA A;  2KCC A;  2B2T C;  2WAQ B;  3MTS A;  3MXN A;  4DGZ A;  1MD2 D;  4KHZ A;  3L7Z C;  1H9J A;  2B2Y A;  2XNA C;  2FIN B;  1MGS A;  1ILQ A;  2F0G A;  5JVG 3;  3HZX A;  1SBB B;  3BVG A;  2KVM A;  1KLG D;  4XQN A;  5I9O A;  2MGS A;  1ROD A;  5FK9 C;  3E6Z X;  3ITP A;  2ZXO A;  4LMQ D;  3RUZ A;  1ZYR C;  1YNN D;  3P7J A;  5C3W A;  1DON A;  5I4D A;  5IGB A;  2V4D A;  1VF5 C;  1XTC D;  3Q24 A;  2L1B A;  1AFP A;  2IX1 A;  3HS0 C;  5ELF A;  2PQE A;  1KAA A;  4RGN A;  1TS5 A;  1EZ6 A;  2E2D C;  2KHS A;  2G9H D;  4FXK C;  5IGE A;  3D4W A;  3C46 A;  4XQJ A;  3GTM B;  2R6G A;  1Q3L A;  3TBI B;  3VR2 A;  1JR0 D;  3FKI B;  1E0B A;  2LFN A;  4RFB A;  1B4O A;  2H4O A;  3E0J A;  3NWS A;  2NTS A;  3BYT B;  1PLF A;  1O7Y A;  3FMC A;  1JOO A;  1QB5 D;  4FF4 A;  3MA2 B;  2RKS A;  1OXX K;  1KLU D;  5KYL A;  1D6E C;  2E75 C;  1K8O A;  2EYJ A;  4OO1 G;  2IJ0 A;  1EU4 A;  3J7Y W;  1ENF A;  3H91 A;  5G3L F;  4KN7 C;  2CW0 C;  4K8I A;  5EGT A;  1YNJ D;  3QOL A;  1V1P B;  3H0G B;  3OMG A;  4Q0F A;  5A2Q L;  4ZKB B;  4OL7 A;  1LTR D;  1PRT B;  3K59 A;  1SE4 A;  3PUZ A;  4XT3 B;  1WTV A;  1DOM A;  1NCV A;  1TII D;  1O7L A;  4QMG A;  3W3A A;  5EPL A;  3NHH A;  1BBX C;  1LT6 D;  1EEF D;  2FMM A;  3H6M A;  3RLF A;  3CKI B;  3N6R A;  3MC0 B;  4ODG A;  5C0X I;  3AB9 A;  3I73 A;  3CRK C;  1PZI D;  3NWT A;  3P75 A;  3I70 A;  2B2V A;  1AN8 A;  1G2T A;  3NP8 A;  1HQR D;  2EOT A;  5JEA G;  3R2I A;  2GA4 B;  4BS9 A;  5A35 A;  2XWB B;  3MHB A;  1V1P A;  4EGV A;  4ID6 A;  4K2K A;  1E2W A;  4LAA A;  1SYB A;  3D6W A;  4C1N K;  2JSO A;  1GOZ A;  4F8M A;  4PMC A;  1AP0 A;  1ESF A;  4IZ8 A;  3J81 L;  2BA1 A;  2QEJ C;  1EQT A;  5IGD A;  4BBR B;  3TDQ A;  1EU3 A;  1A3T A;  5FO8 B;  4Y7N B;  1LTA D;  5LL6 S;  1I4R A;  2WV6 D;  4DXG A;  5EPJ A;  4RHR A;  5CYU A;  4K5V A;  2C5C A;  5COY A;  2MHV A;  3SHL A;  1AW7 A;  4P2C B;  2N55 A;  5LL6 X;  1SNM A;  3J80 E;  1HTL D;  5T1I A;  1BUV T;  2NN6 G;  3K0Y A;  2EJG C;  3I72 A;  2I07 B;  3I3C A;  3SK6 A;  2XRS D;  1I4H A;  1Z7T A;  2E74 C;  1STG A;  4OIK A;  2B2T A;  3C3L A;  5EKI A;  1F9S A;  3BYY B;  5C4X B;  1QOH A;  1I4G A;  3TP5 A;  3LWU A;  3T56 B;  4FF1 A;  1JOK A;  1EY7 A;  5HUR A;  1A3U A;  4K14 A;  1JCK B;  5DEH A;  1TWA B;  3H09 A;  2X6L A;  1Q1E A;  2F0Q A;  3T4A C;  2JP1 A;  4QB4 A;  1OXU A;  2DY7 A;  3MXG A;  2IX3 A;  4LJZ C;  3M3Y B;  3FRP B;  1U4M A;  5KGU A;  5C0X G;  3TP8 A;  1I6V C;  3VR5 A;  1DD2 A;  2EPB A;  5E3F A;  4L63 B;  1H9R A;  3PUX A;  1B53 A;  1JE4 A;  2R61 A;  3HP3 A;  1D2B A;  5KEE A;  1RTN A;  1QWY A;  1VCI A;  4OO1 H;  2A69 D;  1PRT F;  3AU7 A;  2H1E A;  1QNU A;  1CQF A;  2D2C C;  1B3A A;  5EQ0 A;  1ET9 A;  3PMF A;  2YU9 B;  1EEI D;  1R9T B;  2QDB A;  5E4W C;  5M3F B;  5AFW A;  4DAY A;  1K83 B;  1TS2 A;  3HGB A;  1SEB D;  3K5M A;  4C3J B;  2RBM A;  1HTP A;  2FMC A;  4PNY A;  4G7O C;  1TQO A;  4PMW A;  1IYU A;  3DUZ A;  1U4L A;  1LTT D;  1M8A A;  5C6A A;  1PYW D;  3WDN A;  4FNF A;  5JEA J;  1ZXT A;  3Q22 A;  3RMH A;  4HMI A;  3U9O A;  5CV9 A;  1ZEQ X;  1GUN A;  1EY5 A;  5JEA H;  1SJH D;  3IAY A;  3OHX C;  1EQV A;  2F4I A;  1DOK A;  4HED A;  1FR3 A;  3EFX D;  2OXP A;  5KNB A;  4FP5 D;  5CC4 A;  3LX0 A;  2LY7 A;  3WOF A;  1STE A;  2OEO A;  2KUM A;  4R9W A;  2F0F A;  1NR2 A;  4XT1 B;  1GXD C;  1KAB A;  4XYQ A;  3L3O C;  1MBY A;  3QB3 A;  3A56 A;  4DFA A;  3DHQ A;  3RD4 A;  3X3N A;  1SMY C;  2QKI C;  1C8C A;  1PTO C;  2KJX A;  1JB3 A;  1ML0 D;  1QJO A;  3GTQ B;  1I4X A;  2F0N A;  2PYK A;  2EXZ A;  1X3Q A;  1STH A;  2F0O A;  4I65 A;  4CJ2 C;  3A8J E;  3FEW X;  2B39 A;  1XWE A;  3BVZ A;  3C2P A;  1CA6 A;  2XSC A;  2F0V A;  3V2T A;  5IT9 E;  4A3D B;  1KNE A;  4YIJ A;  5C5M A;  3RZD B;  2VNU D;  4FYD A;  2B2U A;  4L8J A;  4IUP A;  4CJ1 B;  1XX8 A;  4DAP A;  3K58 A;  1PFN A;  2F0E A;  1FNW A;  2OF1 A;  2B8G A;  3EJI A;  2Q8I B;  2AWN A;  1QCB D;  2Q8T A;  4IQZ A;  3S9W A;  3HOV B;  2AUK A;  2F3W A;  4HMJ A;  1CT1 D;  1F2Y A;  2EYL A;  1Y1W B;  1SND A;  4C3I B;  3EVQ A;  3TP6 A;  1F77 A;  1STY A;  2NZ1 D;  3G6J B;  5KIX A;  4IUQ A;  3JAM L;  4A3K B;  1GUO A;  2QIL A;  3KLS X;  3IL8 A;  1SFO B;  1PDQ A;  3PV0 A;  1SMY D;  3HRZ C;  3GTK B;  1F9Q A;  4ZYS A;  1S5E D;  1Y8N B;  5EBD A;  1IL8 A;  2Z4I A;  1Y69 U;  2HQE A;  2L5T A;  2WP8 J;  3KLR A;  2EYP A;  1HFN A;  4ZRZ A;  4C56 C;  2HDM A;  3PUW A;  2X6G A;  4HTH A;  1ZKO A;  4KJN A;  4A3I B;  1TS4 A;  4GZY C;  1Z6H A;  4JK1 C;  1GJX A;  3P20 A;  2PMZ B;  4HSV A;  1SNO A;  1TWF B;  5ELB A;  2A5H A;  1SYG A;  1ICW A;  5A2Q E;  3C1F A;  1FNV A;  1Y8P B;  3OSO A;  3MFG A;  4EQO A;  3AMU A;  4KJO A;  4CBV A;  4F87 A;  1AEX A;  3R8B A;  4I7Z C;  3K6O A;  4X3U A;  1ET6 A;  3KUP A;  3K57 A;  4A3F B;  2O5I C;  1PRT C;  3BG3 A;  5CR3 A;  1GUS A;  1H9M A;  2F0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...