3BDOA

Solution structure of apo-biotinyl domain from acetyl coenzyme a carboxylase of escherichia coli determined by triple-resonance nmr spectroscopy
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
82
structure length
82
Chain Sequence
AAEISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (ACETYL-COA CARBOXYLASE)
publication title Solution structures of apo and holo biotinyl domains from acetyl coenzyme A carboxylase of Escherichia coli determined by triple-resonance nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biotin
total genus 4
structure length 82
sequence length 82
ec nomenclature ec 6.4.1.2: Acetyl-CoA carboxylase.
pdb deposition date 1999-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bdoA00
1E2VA 3VR3A 1ONLA 1YNJC 3RLFA 1Y8PB 2IT1A 3PUXA 3D4RA 3OPOA 1O78A 3PUVA 1BDOA 4OO1H 1O7LA 2NN6G 5KNDA 3TZUA 2NN6I 1ZYRC 2E76C 1Q1EA 1H9MA 1VCIA 5A35A 5KNCA 2PPBC 1A6XA 1Z7TA 2AWOA 4H13C 2NN6H 1TKWB 1VF5C 1SMYC 4DNRB 1VDZA 5KNBA 3QG1A 3EQLC 1CFMA 2JEBI 4XIGS 3FMCA 4BA2I 3SDZA 1PMRA 4KN7C 4DK1A 3LNNA 1Y8OB 2A6ED 1Q90A 4H0LC 2A69D 2BE5D 4PV1C 3A7LA 1Z6HA 4HR7B 4G7OC 2BDOA 2EJFC 3BG3A 1I6VC 3PUWA 3SE0A 3T56B 2KA7A 2K7VA 3BDOA 1Y8NB 3MXUA 2O5JC 3CRKC 3QJYA 1OXXK 3PUYA 4DK0A 1Q12A 1LABA 1V8QA 2LMCB 1HPCA 1IYVA 2E74C 4KMUC 3L7ZC 1E2ZA 1VF7A 1Q1BA 1T5EA 2EDGA 3VR6A 3D31A 3KLRA 1G291 3QIAA 2PNRC 3H94A 5BN5A 1GHKA 4KN4C 1GHJA 1V43A 3I73A 1H9SA 5K36G 3A7AB 2KCCA 4KKTA 5JEAG 3CRLC 1DCZA 4G7ZC 4JK1C 1OXUA 3M7NA 3MFYA 3WDNA 4KKSA 2JEAI 3A8KE 1Y69U 2DNEA 2DN8A 4KHZA 3T53B 1GJXA 2O5IC 2R6GA 4L8JA 5K36H 2BA0A 3LWUA 3HGBA 2E75C 1GUGA 2DNCA 4RCNA 3VR5A 5JEAH 3I4LA 1GUTA 1LACA 1OXTA 5C0XG 2JE6I 1OXVA 2V4DA 1IYUA 1E2WA 1EWHA 2JXMB 4TQUS 3IKJA 1GUNA 2Q8IB 2A6HD 1IW7D 4G7HC 1OXSC 4DNTB 1HQMC 3A8JE 2L5TA 3ND8A 5C0XH 3T51B 1GUSA 4BA1I 1QJOA 2D5DA 1H9SB 4OGQC 2A68D 3DXJC 1TU2B 5BN3A 3VR2A 1DD2A 3IFTA 1B9MA 4KI0A 3P20A 1FR3A 2F1MA 2K33A 3FPPA 4JBWA 2EVBA 2CW0C 1HCZA 3PV0A 2A6EC 3AB9A 3VR4A 2A69C 2BE5C 2YYZA 5BN4A 3NE5B 3M4YA 2AUKA 3ND9A 3U9SA 3M85A 4I7ZC 1GUOA 2QF7A 1YNNC 3W3AA 1DXMA 1HTPA 2PCFB 3GD7A 4LK1C 1CTMA 2B8FA 4GZYC 1H9KA 3GQBA 2K32A 4IFDG 2EJGC 2A6HC 1IW7C 2BA1A 2D2CC 2ZT9C 1FYCA 1H9RA 2D62A 2EJMA 1H9JA 1K8MA 1ZKOA 3N6RA 4H44C 4IQZA 4LJZC 4TKOB 1B9NA 3I72A 3OOCA 3VA7A 2A68C 3OW7A 4IFDH 1K8OA 4OO1G 4XTCS 3A8IE 3PUZA 2AUJD 2B8GA 4KKUA 1CI3M
chains in the Genus database with same CATH superfamily
1E2VA 2F0VA 1NNXA 2EQSA 1R9TH 4RFBA 1IBKL 2MNAA 3OPOA 1KABA 4X3TA 1EY0A 1LTTD 1JOQA 3MXGA 5K5PA 1STGA 1DONA 4QMGA 3WWVA 3PO2G 3DWQA 4FP5D 4A3KB 2N88A 3CKIB 3BYYB 1J8IA 1M8AA 2RDHA 2ZJRA 1HR0W 4X64Q 2R92G 3NTIA 3O13A 4IUVA 3H91A 4NXNQ 3J7YW 3GTJB 2AMCB 1FJGL 5FO7B 4A3KH 4RKBA 4C2MB 1AH9A 3BG3A 3NELA 2L0CA 1Z9FA 1TWFB 3CRKC 2WB1E 3F2DA 4A3DB 3C46A 1NCVA 5KYIA 2E74C 1E2ZA 1PH6A 4XQJA 2PI2A 2PNRC 1WTVA 3GTJH 3LX0A 3ULPA 1PFMA 3DWAA 5K36G 1LLRD 4C2MH 3M7NA 1B3QA 1W6KA 2KENA 3WDNA 1Y69U 1TWFH 1GJXA 2RBMA 4AYBB 4A3DH 2X69A 5L37A 3J81c 3HGBA 2F4VQ 4HEDA 3NTHA 3I8ZA 5JEAH 1A63A 1BBUA 1HRJA 1SEBD 4FF3A 1HXYD 1VQOA 4OHJA 3T51B 5FJ8H 1Q46A 3MXNA 2Z8LA 4LWCA 1CA5A 3UDFA 2UXDL 1I94L 3A74A 4GNXB 2L1BA 3P20A 3FPUB 1VS0A 3PGZA 2PQEA 1YJNA 2BE5C 5IYBG 3NE5B 2F0GA 1W3SA 3VYRA 4G4KA 4OX9Q 1YNNC 2RA4A 2QA4A 2CVRA 1AFPA 1RCVD 1UAPA 1X54A 3MZ5A 3OYYA 2Z6KA 1LT3D 4ZUIA 4BY1G 3G7LA 1H9RA 4FO2A 1M90C 2Q2TA 1B9NA 3I91A 1EZ6A 2N3SA 5JVH3 4XTCS 1LO5D 1U5KA 4LF4L 2XRQD 4KLKA 3RLFA 3NUCA 1XYIA 1LTAD 2OQ0A 2K5WA 4HIOA 1WTHA 4N9TA 3BZKA 4IUPA 1SLJA 5C4HA 3UE0A 4K6DA 2PPBC 1LV9A 3E9HA 5EPKA 2IWHA 2CH4W 1SMYC 2UU9L 4AYBE 3QG1A 2UUBL 1VQLA 4B3TQ 4OIKA 4PNYA 4LFCQ 4J8QA 1PTOB 4HIMA 4IUTA 4CDEC 1Z6HA 4HR7B 1ASYA 4DKAC 3SE0A 5HGTA 2B63B 5EKKA 5LHY1 2G9HD 4DAMA 4DAVA 4DV4Q 2EYJA 3R93A 2LMCB 4ZYSA 4ULLA 2IX0A 5DM63 3Q6SA 1PTOH 1JQYD 1TS5A 5ELFA 3GV6A 1EL0A 4A3JG 1Y14B 1HTLD 1STEA 3HZXA 4YY3Q 4DR4L 1X65A 2BA0A 3LWUA 2ZTCA 1ZYRD 4RCNA 5C4ZA 5FLXc 4K2LA 4CHTB 5LMNL 2E5LL 2F3VA 4KHPQ 2IX3A 4ABNA 1V1QA 4XT1B 1TU2B 5BN3A 5KEEA 1XWEA 4JI7Q 2OWOA 1AP0A 2B2WA 3V96A 2IPKD 3K7AB 2PNHA 2G9DA 5M3MB 4HMIA 2F0HA 1KDCA 4DR7Q 1V1PB 1I4GA 3CCEA 2JA8B 1R4PB 5CGKA 4A3IG 4A3CH 1BXTA 3BYTB 5JJIA 1R4QB 2B8FA 5IGBA 4IPHA 4L5TA 1KLGD 4DV2Q 2A6HC 2BA1A 2D2CC 3H09A 2AWNA 3VYTA 5IGDA 2RVLA 1K8GA 4Y52H 1QCBD 3K7AH 5M3MH 1QVFA 2FHTA 4JW0A 1N36Q 2E2IB 2K03A 1F9QA 1TS2A 2AUJD 3T1HL 2JA8H 4BBSB 3D6CA 3E5SA 5JPMC 4X62Q 1ASZA 5GAEC 5TSSA 1CSQA 1BCPD 1BDOA 2B2VA 3DHQA 2JA6G 4K0KQ 1MSGA 2XGTA 4AQYQ 2E2IH 2AWOA 2JP1A 3J80i 1SAPA 2KVMA 4UDUC 4BBSH 4QQBX 3FKIG 4HIDA 3NK9A 2R3ZA 3SDZA 5J22A 1QG7A 1VQPA 2FINB 5LMUL 4X65Q 1MBYA 1B70B 3DMUA 2EE1A 1JOOA 3BJUA 4N9PA 3BDOA 4ODGA 1CKOA 4JI5L 1FNWA 5G3LD 1FNVA 3CW2C 2F03A 3TS2A 1QUQA 1EZ8A 4KK7A 4JI6Q 3G6JB 4YWKA 5I2YA 1DYQA 1KAWA 1WTXA 1II3A 1DZ1A 4HCSA 2QDBA 1SMXA 2CW0D 5M3FG 2DN8A 1VQ7A 4LF5Q 1G6ZA 1HQRD 3IRBA 2HHHQ 5D3IB 1TVXA 1XTDA 2LXJA 2NVTB 2JE6I 4ZCKA 4DV7L 3OMCA 5C4XB 4JI3Q 1EEFD 5DLQE 5EAYA 1JWMD 3AYHB 2ICIA 3S2HB 5J3BA 1HHVA 5IYCG 3OTOQ 3LWEA 3M4OB 2X6GA 1VQHA 5C44G 1ENFA 1K73C 2B2YA 2NVTH 4B9WA 1SBBB 4R1JA 2N78A 1EQVA 2EVBA 1S5CD 5C4XH 2A6EC 1G8ZD 5C6AA 2A69C 2A5HA 2EYFA 3S2HH 4LF9L 2NB0A 3MWYW 2KHJA 4HIKA 1U4LA 3ND9A 1N32Q 2SNMA 1PLFA 4BXXG 3J7AF 1PZJD 3NQIA 3I4MG 3M4OH 4QUFA 3TP7A 1XNQL 4LF8Q 2ICEC 1FYCA 1DM0B 2L9HA 1K8MA 4H44C 4LJZC 3N6RA 2EYLA 5LMNW 4TRDA 1KD1C 2NBFA 3CF5A 4OO1I 1ILPA 1K3RA 4LFBQ 1G2TA 3HOWG 1IXRA 1E0BA 2LS01 3C1FA 3HS0C 4C3IG 2NN6G 3F8TA 1JCKB 5D14A 1A8VA 2ZTEA 3H6MA 4CDFC 4R8IA 1MIUA 1X6OA 5E4XA 2J4XA 3IAYA 2R61A 2XNAC 1K83B 1B44D 1VQJA 4IUUA 5KGUA 4P75A 4GLXA 1KAAA 1N8RC 3S1QB 1MI2A 1K3BC 1KDBA 4P72A 4BA2I 3HOXG 1I4PA 1EOTA 4UAIA 2K01A 1Y1VB 3PIP3 3TDQA 3JAMi 1O7IA 4RCOA 1K83H 2K50A 1A0IA 3CMEA 1WTQA 1Q12A 3S1QH 3DEOA 2PQAA 3L7ZC 3BVMA 1ENCA 1WTRA 1KNAA 3QIAA 3KLRA 1Y1VH 3K81C 1HNZQ 4YIJA 3DM3A 4GNXA 3SGIA 4KKSA 5IP9H 1I3QB 3R2IA 4JI1Q 5C4JB 2DNCA 4MTKA 1S72A 3A54A 3NBIA 4EQOA 2EZVA 3TP6A 1OXSC 1HQMC 3A8JE 3SXHA 2NVXB 5C0XH 1IYJB 4AIMA 1I3QH 1WCMB 4B9XA 3S16B 2PZTA 5BR8Q 5C4JH 3KF8A 1O80A 2IHFA 4GNXC 1CA6A 3NXWA 3PV0A 1P8LA 4PZ6A 3M4YA 1WI5A 4GOPA 4GKJQ 2EY1A 4IJHA 4V0BA 2NVXH 1WCMH 1PA6A 2L15A 3S16H 4LFCL 2VXWA 3NHHA 1IW7C 3W5OA 3BDLA 4JBKA 4J1MA 2MJ8A 4CJ0B 4DV4L 2DJGC 3CCRA 2A8VA 3DLLA 4UY8C 4M8AA 3D0FA 3AQQA 5A2QL 1XPRA 3STBC 2AQ1B 2F0LA 2HUGA 5I9PA 5EJWA 4FXKC 1PFNA 5KNDA 3W2DA 2DJFC 3TZUA 1TWGB 1QWYA 3GTOB 1EU3A 4OL7A 3G48A 1CHPD 1NSNS 4YY3L 1I4XA 4J15A 4XYOA 2RDGA 2R7ZB 1PFSA 1CHQD 4XIGS 1PMRA 2X6LA 1JE5A 4DK1A 1A15A 4FXDA 1TWGH 2BE5D 1HZAA 3J81L 1PTOC 4ME5A 2NTSA 3GTOH 1SR3A 3F1ZA 1RTNA 4A3BG 1WTWA 2BDOA 5IODA 1YNND 2MUYA 4P2CB 2K7VA 2FMCA 2R7ZH 2C9OA 5CORA 5IIFA 1LABA 1EOVA 1VF7A 3B6YA 4DK3C 3E9IA 3TREA 4DR5Q 4DR7L 1UNSA 1M1KC 1V43A 4IUQA 1IKLA 1YI2A 1L0YB 4BY7B 1Z47A 4QY7A 4DF7A 4DV2L 2HCIA 2J7ZA 2Y0SG 4K2KA 1YJWA 4JYAL 4A3GG 1SDFA 4CDDC 1BBXC 4PG3A 1N36L 2OT2A 2AKWB 4X62L 4JG2A 2B2TA 1IBMQ 1EEID 2RCFA 4DNTB 2FMMA 4DR2Q 3ND8A 1UEAB 5IT9L 4YCVA 2CH4A 5GQOA 1KC8C 5M5YB 2JA7B 1L1OB 3SK5A 2ZTDA 1PZKD 4AQYL 2F1MA 5IWAL 1K28A 2G5DA 3UE1A 1RKNA 2LY7A 3QO2A 4JOIA 4A3EG 4DK6C 2UUAQ 3TSSA 2PCFB 4X66Q 5M5YH 2JA7H 5CBAE 2B2TC 3L0OA 4JVZA 2WAQB 4DPGA 4RGOS 4K5WA 4R4CA 5C5LA 4LUZA 4CBVA 4A75A 2F0SA 1X55A 3A56A 3QOJA 3JC66 4QB4A 4BBRG 2LFNA 1EFID 2M2LA 3D4WA 1RD9D 5D3DA 3RLOA 4IFDH 1QOHA 3H0GG 2NVYB 4JI8L 2KECA 3KF6A 1Q8IA 2A74C 3PO2B 1XMQQ 4Q0FA 3PUXA 5EKLA 1GXDC 5IGCA 3GP7A 4P74A 4NKLA 5M5WB 1CKNA 4FXGC 2P5ZX 1Q1EA 2PZUA 2R92B 1A3VA 4B3RQ 3CPFA 1PFBA 4LF5L 1B7YB 2NVYH 2PYKA 2QW7A 2RCNA 4DNRB 1STAA 1YITA 3VDYA 2YTXA 3HOVG 2I0QA 4DR1Q 1PYBA 4JI3L 1Y8OB 1EY9A 3M4QA 5M5WH 1W6JA 3H15A 1NUCA 5FOBB 3OTOL 2R92H 3TRZA 5FLXL 2RHSB 1I6VC 1SJHD 1X3QA 5FKAC 4DV3Q 4WRDA 5CYUA 2MFIA 2GA4B 3VA5A 3W1GA 1A3TA 1QE6A 1U4RA 1D8LA 1CSPA 4RGTA 1XTCD 3WOEA 5JVG3 3K0YA 1NY4A 2QKIC 1N32L 4LUOA 2CFMA 1VQ8A 4DR6Q 3BVGA 3I73A 1NE3A 5NUCA 2B29A 3MEHA 4NMZA 2F0DA 5ELBA 1D7QA 1QILA 4LF8L 2PMZB 4R4QA 2WAQE 5K36H 4DAYB 4A3LG 4P73A 3UDGA 1XXGA 2GVAA 1GUTA 1L2FA 1LTSD 4LFBL 2NZOA 5I2XA 2C5CA 5C3EG 2L5TA 1XNRL 4JV5L 4IN3A 1SE2A 1Q3LA 1ENAA 1UWVA 2WIIB 4KI0A 3VYSA 5I6YA 5IE8A 1DOMA 2OF1A 3E6ZX 3K6OA 2DY7A 4BY1B 2K1BA 1PYWD 4IZ8A 3SK6A 4DUZL 5IYBH 2PQAB 1IBLQ 3M3YB 3EJIA 2Z6BA 1PH7A 3BVZA 2EJMA 3TP5A 4UPAA 2IJ0A 3UDXA 4WJ3M 1JICA 4B3MQ 3A8IE 3PUZA 1CKMA 4CKEA 3I4OA 3Q0AA 4DUYQ 4BY1H 4R8NA 1IHZA 1ONLA 2VL6A 2IT1A 3SEBA 5E1FA 4DNIA 4LF6L 1HNZL 5JEAJ 3M3YH 1XJVA 4U673 1F77A 1N34Q 4OWTB 1EQRA 2TMPA 3Q23A 2VQFQ 4JI1L 1JORA 2PMZE 4FYDA 1TT2A 4YWMA 1CFMA 4X3SA 5IT9c 3KF8B 2KJXA 1QNKA 2A6ED 1BF4A 2A69D 1LTRD 4RHSA 3SK4A 4JI0Q 2BH2A 4OEMB 2HCCA 5BR8L 4GOPB 3PF5A 3C1EA 4GLAC 4RA8A 1QVGA 1PV4A 2Q8TA 3QJYA 1Y1WG 2WP8J 1IYVA 2F0JA 2Z6KC 3SVMA 1PRTB 4A3JB 1E1OA 4DV5Q 1C4QA 2E2HB 1T9HA 2H1EA 5KIXA 1E7ZA 4JK1C 1Q82C 1FGBD 3A8KE 3RR5A 4KHZA 4OWXB 1UUPA 4B08A 4L8JA 1SE4A 1GM5A 4DR3Q 2E75C 4EQNA 2RKSA 1U4MA 4A3JH 2E8GA 2V4DA 2E2HH 1SE3A 1Q81C 3M4PA 1U0LA 3GTPB 3BS1A 2ZM6Q 1TXYA 1WTPA 1ILQA 1NBWA 5AJ3Q 3EIVA 1LTID 3IL8A 1NJIC 2JJQA 4U68A 4E6IA 1FD7D 3IFTA 3PQIA 4RHRA 1FR3A 4UP9A 4A3IB 3AB9A 4KD4A 5A2QE 3T1YQ 4YHHL 3GTPH 3U9SA 1LT5D 5CV5A 2XVSA 4FNFA 4IPDA 1S3OA 4GN4B 4ZAIA 5KYLA 2KBNA 1EY4A 2DUDA 3GV3A 2ASBA 4A3IH 1ESFA 1KRSA 1U4PA 2F0NA 4LAAA 2D0PA 2Q2IA 4RWSC 1QVCA 1EIFA 1HR0Q 4DV1Q 1BVSA 3J81E 2JA6B 1PH2A 4ALPA 3K0XA 3S1NB 1JWSD 1CZGA 4KTAA 3CC7A 3EROA 4TVAB 2WFWA 2JA5G 4ZLTF 3K59A 3FKIB 1BO0A 4KJOA 4KY5A 3QR8A 2E2JB 1HNWQ 2Q8RE 1ET9A 1D1KA 2VB3X 3HKZG 2JA6H 1MKHA 1LT6D 2ZJPA 2JYOA 2UUCL 3S1NH 1JJCB 3QWNA 1D2BA 4WFN3 2VUMG 2XWBB 5CR3A 1PH8A 3A0JA 2NTTA 2AHOB 4PMCA 5HURA 2B2WC 5IY0A 2Q2HA 3ERQA 1IBML 4HSPA 4DR2L 4PV1C 1AN8A 3FDTA 1VQ4A 3FKIH 1PRTF 4G7OC 3I4NG 2EJFC 2E2JH 4JBJA 4IALA 4GKKQ 3RD4A 4F87A 3GO5A 1F2ZA 2HDLA 3CCMA 1STBA 1PTOF 5IT9E 5M3FB 4EVOA 2WKCA 4DV0L 2J0TD 1GHKA 3AFQA 4RKLA 1PXUA 2UUAL 1L1OA 1GO3E 4LW1A 4X66L 1RJTA 2N8NA 1EYDA 1SYEA 3STBD 3KF6B 1J5EQ 1CK1A 1YHAA 3UI2A 3TN2A 3PIO3 2B2VC 3I4LA 1OXVA 5M3FH 3NWSA 2I46A 5C0XI 1G6PA 1CKNB 2K5HA 3KBGA 4XT3B 4C3HG 5C44B 2NUCA 3P75A 2WACA 1XMOQ 1QJOA 2F0OA 1H9SB 2A68D 3M9BA 5IGEA 1B9MA 5IYCH 1HZ9A 4HJ7A 4MHEA 5D65A 4FF2A 4B3RL 1VQBA 2B2UA 4FF1A 3I4MB 4WJWA 5C44H 1JC7A 1HNXQ 4K5VA 1A2UA 2AUKA 3J81i 1STYA 4DFAA 4DV6Q 4DR1L 1EQTA 2QF7A 1RL2A 3DEPA 2R7DA 4LF7L 4FF4A 4YCUA 1HTPA 1NR4A 2VZAA 1H9KA 3CC2A 3KYHC 4GLVB 3CU7A 2ZXRA 3HOUG 2R7FA 2L4NA 3C2PA 5GROA 1H9JA 1ZKOA 4DV3L 3HOWB 4BXXH 4DAPA 2VW9A 3I4MH 5JJLA 3OOCA 4C3IB 3RLNA 2CQOA 1TIID 4G57A 1Y8PB 3I2ZA 4ZKBB 3A5UA 1OTCA 3A5ZB 5FLXE 4R9WA 2I5LX 1B3AA 4UP8A 1O7LA 4X64L 3HFZB 4DU9A 3HOWH 1YNXA 2Z1CA 3G6EA 1SXTA 2VS1A 2MPMA 2YTVA 4NXNL 4C3IH 1GUWA 3S24A 4RMFA 2NN6H 3TQYA 3U4ZA 2KCTA 3HOXB 4DXFA 4KY6A 4R4OA 2IHEA 1VQEA 5KNBA 1N9WA 3PSIA 3L2PA 1MGSA 2F52A 1K0SA 1G2SA 2AQ3B 1SN8A 2B2YC 3J7AV 4EQ5A 1O7YA 2VY3A 1PYSB 4DAYA 3RNUA 3HOXH 4A3FG 2O5JC 2V1CC 4R4IA 3EBEA 5EQ0A 2MO0A 2F4VL 2PZWA 2RQXA 1LYLA 2JA9A 4MIUA 4QJFA 4G7ZC 3F2CA 2JSOA 5J1ZA 1OXUA 3TZDA 5IOCA 3T53B 3OSOA 2OTLA 3AFPA 1LM0A 3FP9A 4NPSA 1JWUD 1L0WA 2K6AA 2YU9B 3OHXC 5I9OA 4B3ML 2K05A 2JN4A 1EWHA 4DUYL 3IKJA 1MD2D 1VQ5A 3E3XA 1UE1A 4K8JA 3BZDB 1E24A 5M5XB 1NR2A 2EXZA 1I4QA 1W2BA 1STNA 2XRSD 3Q24A 4OGQC 1A3UA 1GD7A 4OX9L 2YU9H 3HP3A 1RDPD 1AE3A 3T4AC 3R8BA 4C1NK 1HZBA 3J81j 2OQKA 2RSOA 1EWIA 3TMEA 4UHVA 3E0EA 1ET6A 4Z9CB 3CCUA 2M9VA 1NTGA 5M5XH 4C3JG 1SNQA 1I94Q 3W3AA 4IPGA 1GVPA 1TWCB 5JJKA 2VQEQ 3H3VH 1CTMA 4JI0L 1CQVA 3GQBA 4K14A 4IFDI 1VQNA 1ZXTA 3J7A5 3RZOB 1AW7A 1FL0A 1ICFB 4YCWA 1J9OA 3SR1A 1KDAA 3KUPA 4IURA 3VYUA 3UDIA 1PH3A 1TWCH 4DV5L 3D4RA 1HH2P 4LMQD 1V9PA 4ZKCB 1WVLA 5HY6A 2I07B 3S9WA 4B3TL 3RZOH 4O42A 4RH6A 1QZHA 5CV4A 4LF4Q 3NENA 1KIXA 2MP1A 1WJJA 1XX8A 1Q86C 4O1NA 4DR3L 5C0XJ 3EN2A 3FEWX 1YEZA 4A3BB 1TWHB 1D5XC 1I50B 1X56A 1YHQA 4L5QA 2ATWA 2L55A 3A7LA 1TWAB 2ZM6L 1K8AC 1B4OA 4HSVA 5AJ3L 2EXDA 2K28A 2LKVA 2KCMA 4GOPC 1QZGA 2UUBQ 2KA7A 1AEXA 1WD0A 3J80L 4RGNA 4DK0A 2NVQB 4A3BH 1TWHH 1I50H 1PRTC 5ISRA 4EX5A 1G291 5BN5A 1X3PA 4TSSA 1GHJA 3F2UA 3KFUA 1TWAH 2A19A 2O4XA 2Y0SB 1HA6A 4A3GB 1SRUA 3NQTA 3K5NA 2JEAI 1IKMA 3MFGA 2PW5A 4KHPL 5EBDA 2NVQH 2F3WA 5I6WA 3K5MA 1GUGA 1SYBA 4OELB 2EYHA 4XQNA 3G4SA 3ZYYX 2JXMB 4DV1L 4JI7L 4POGA 5GAHC 4A3GH 1M4VA 3RN2A 1GUSA 3OMGA 4A3MG 1F9PA 5AFWA 3S2DB 1EYGA 3OW2A 5LMNQ 4POFA 3HOZG 1YIJA 1DD2A 4A3EB 3KJOA 1MJEA 4XQQA 1EQQA 1PZID 3S1MB 3NBHB 4CJ2C 2CW0C 3K58A 1VQAA 4N8FA 5BN4A 4PMWA 2BOSA 3PO3G 3S2DH 1SNOA 2ID0A 1JJGA 4BBRB 2R93G 1ICWA 5EBCA 1SMYD 4A3EH 3H0GB 3MVVA 1EY8A 2QEXA 3S1MH 1HZCA 3KLWA 3I72A 3HOYG 2DY8A 2FFKB 4OO1G 2MHVA 3SHLA 4K0KL 2Z0SA 2XIWA 4NXMQ 1YNJC 3HRZC 5FLMG 4BBRH 3GTKB 1QNUA 2NWGA 3H0GH 2E76C 2Y0SE 3HOVB 4QCLA 3T1HQ 1VCIA 2QILA 1VQFA 1J5EL 4CKBA 4X65L 4IOCA 2FJ2A 1CUKA 3CXCA 1MHWC 4H13C 1VF5C 4GS3A 5IYDG 3EQLC 4ILWA 1RF2D 5CMDA 2CHBD 3GTKH 4Q5VA 3ULJA 3D3RA 1AZPA 5CV8A 3E0JA 4JI6L 1S4ZA 3HOVH 5CC4A 1JMCA 2E2DC 4H02A 3OWEB 3PUWA 4BY7G 3DWPA 4JOIC 1JOKA 5ELDA 1JB3A 2FXQA 3PUYA 1PH5A 3OIPA 5LMUQ 1DOKA 3URYA 2ALYB 2RHQB 3KK7A 1BUVT 1PH4A 5JPNC 4A76A 4QUCA 4KN4C 2HHHL 2Q2UA 1EY6A 1H9SA 3X3MA 3JAML 1Q7YC 4JI5Q 4IFDJ 4KKTA 5IP7G 1C8CA 4CJ1B 2YTYA 3P7JA 4ZUJA 2UXCQ 4N8X1 4WORA 1EIHA 3CCSA 1CM9A 1KRTA 5C3EB 2OCEA 3HEJA 1S40A 1T5XD 1IYUA 1TQOA 2H5XA 2ES2A 2A6HD 4A3LH 2KUMA 3ZJYC 4A93G 3OIQA 2C35B 4DV7Q 3GTQB 5C3EH 2K33A 2F0MA 1SYCA 2WB1G 2KHSA 2YYZA 4OWWB 3CCQA 1C0AA 1KHIA 1S5BD 4OIJA 1I4RA 3CAMA 3GD7A 4LK1C 3RN5A 2D0OA 2MGSA 1TR5A 2K32A 3K7UC 4QL5A 3J80c 2OTJA 3GTQH 1BR9A 1X32A 3D8GA 4LF9Q 4L5RC 2EY2A 2CCZA 3V05A 1K8OA 3A55A 2XWJB 2B8GA 1EY7A 1CI3M 1XNQQ 3L3OC 2HD3A 3IFDA 3PUVA 5DNFA 2BDNA 4KY7A 3CD6A 1H95A 3FVQA 1HUNA 3S14B 2VB2X 1H9MA 3U4VA 3CQZB 1Z7TA 2HT1A 5E7NA 5M9OA 1TKWB 1JT8A 2WINB 2JEBI 4A3KG 4L5SA 4IO9A 5FK9C 3LNNA 3PF4A 3TS0A 2CQAA 2GN5A 1N33Q 3S14H 1Y1WB 3CQZH 3I3CA 1RTOA 2HIVA 2IW3A 4Y7NB 3MXUA 1OXXK 1KLUD 3T13A 3K8AA 1STHA 2EYMA 2EDGA 1EYAA 2JK8A 3D31A 3MXPA 2F0KA 3H94A 1X3EA 3ULLA 1Y1WH 4A3DG 2K5VA 4A4IA 3A7AB 2LSSA 5JEAG 2VQEL 1X3GA 3CRLC 1RODA 2ZXPA 3MFYA 3Q8DA 3NSWA 1JB7A 4Y7NH 2DNEA 5E4WC 5EKIA 5ELOA 1PDQA 4ME3A 3P1HA 1GOZA 1BCPB 4XYQA 5FJ8G 1KL9A 1EYCA 3MHBA 4AYBG 1WD1A 3AEVA 2KCNA 3CC4A 4LFAQ 1KNEA 3KDFA 4BA1I 1U9RA 4GKJL 3H3VC 2Z9HA 2D5DA 2EY6A 3DXJC 1FNUA 4ZQ3A 1IL2A 2D9UA 2NYZD 3EFXD 3K57A 1C9OA 1VQDA 4I7ZC 1A2TA 1TS4A 4NW2A 2K75A 1CQFA 2EIFA 3CHBD 4HTHA 3X3NA 1JR0D 4K5XA 3W1BA 3CCJA 1S5DD 1GKHA 3G71A 4NP5A 2F0UA 2JA5B 3JAMc 1G91A 3KLSX 4JCVE 3J80E 4XXEA 1EIYB 3HKZB 2NN6I 4JI2Q 1IZ6A 1NAPA 1RHPA 4DXGA 2VUMB 2VNUD 2QEJC 1PH1A 2JA5H 1LUZA 4F88A 1TS3A 3HG9A 3I55A 2KOLA 4YWLA 2OEOA 3U58A 1KXLA 1I6HB 1C7YA 2F4IA 3I4NB 4KN7C 2MQHA 2B63H 2KQ3A 4X3UA 1X9NA 1EUJA 1VQKA 5T1GA 4CGYB 4DR5L 2VUMH 4S3SA 4KD3A 4KJNA 1G51A 4HJ8A 1Y8NB 2F0PA 1VMPA 4KV6A 1V8QA 4QGUA 3PCOB 1I6HH 5H1SE 3I4NH 3K80C 4AH6A 2SOBA 3L9AX 1WOCA 1SYFA 2B63G 5JJZA 3GTGB 1J6QA 1FGUA 2A1AA 5LL6X 5J39A 3F2BA 1BCPF 1EU4A 4R4TA 4IOAA 1DCZA 1K9MC 1MSHA 4CDCC 1YVCA 3NBHA 3C3LA 1VMCA 2O5IC 4C3HB 2ZJQA 3SK8A 4FDBA 4UP7A 3RMHA 1HUMA 4TQUS 1CT1D 2K4KA 3GTGH 3GTMB 4NXML 1IW7D 2K5DA 4B3SQ 4JYAQ 4JI4Q 4C3HH 4EQPA 4RGMA 3HKZE 5FO8B 2SEBD 2F0FA 2MO1A 1SNPA 2RDFA 4K8IA 5FO9B 2UXBQ 5G3LF 2M00A 4A3CG 3GTMH 1SNCA 2IX1A 3H3VI 1YHBA 3HOUB 1B53A 5M3MG 4V190 1QB5D 1PRTD 4GZYC 2EOTA 5IWAQ 1BKBA 4M1UB 1BOSA 1XMQL 3ICEA 2JA8G 4TKOB 1AE2A 4KHVA 5HGQA 1L1OC 5T1IA 3HOUH 5CV9A 1PTOD 2ZXOA 5JAVA 2F0IA 1WFQA 1A62A 1F2LA 1LTLA 4HJAA 3NWTA 3DUZA 3KBXA 3MTSA 4BBSG 3R3OA 2K5QA 2K14A 2UXCL 1IL8A 5F2DA 4JI8Q 5KNCA 4WJ4A 4I65A 1VQ9A 5C5MA 4JPBW 3JAME 3KJPA 2RF4A 4LUVA 3D4DA 1E22A 1SSOA 1Q90A 2BH8A 1NMFA 4A3FB 4CKCA 5C3WA 2B2UC 1OO9B 3TBIB 2L12A 5EPJA 1YJ9A 4DR6L 1LTBD 3RUZA 4HN7A 4DGZA 1CZWA 3N52A 1VQ6A 5IGFA 1IBKQ 1EY5A 3CMAA 4A3FH 1EIGA 2WV6D 4EGVA 1Q8KA 4ID6A 2L11A 2ENBA 1V1OA 1YNJD 1FVIA 2XTIA 2RSNA 3D6WA 3ER0A 1B50A 1VQMA 5EGTA 2KEEA 3R2TA 3MEFA 2LXKA 2Q8IB 3KLSA 5CV6A 3MA2B 3OWFA 1NMGA 2I5HA 1FJGQ 1KTKA 5C4XG 2CWPA 1S5FD 2WKDA 3VR2A 1EWCA 1B2TA 2QCPX 4C3JB 3FPPA 1C48A 1D5MC 1SJED 3VR4A 1IBLL 4JBMA 2Z4HA 2N55A 2B39A 1XNRQ 3BU2A 4JV5Q 2AQ2B 3M85A 1GUOA 2NZ1D 1B8AA 5DM73 1ML0D 2SDFA 1N33L 4HJ5A 1VQGA 4OONA 2F0EA 4PMBA 5GAGC 4IPCA 2OXPA 4C3JH 2XSCA 2HIXA 3MXNB 2K04A 4IQZA 2HQLA 3ITPA 5DAUA 4DA2A 1WTOA 3OW7A 1N34L 5ELEA 4DUZQ 2EYPA 2O2LD 4QF4A 2GVBA 1SYDA 2VQFL 2HQEA 2KEDA 2B3GA 3I7FA 1HFNA 1LT4D 1VQIA 4RG1A 1PVOA 1ZYRC 1D5ZC 3HKSA 4MNOA 1DOLA 2UXDQ 1F2YA 3CCVA 1F9SA 1O7ZA 2XN9C 4LF6Q 3KDFB 4GN5A 4APVA 1ESRA 4HCEA 4ZRZA 4H0LC 1BQQT 1UEBA 1SFOB 4O0AA 4I7AA 4LFAL 1D1IA 3QOLA 2Z4IA 2PI2E 1Y1VG 4LNQA 3U50C 1JE4A 2CWAA 1HPCA 2DGYA 3FRPB 4HJ9A 1I4HA 5ELCA 1SE8A 1T5EA 5IP9G 3PIOA 2CKZB 3KOJA 2N49A 1SFOH 2QGQA 1LTGD 2K52A 4PQXA 4P71A 4JC0A 3DM1A 3EVQA 1VQCA 1ZEQX 5KRUA 3FHWA 5DEHA 1DGSA 1KQSA 5LL6S 5JOBA 3VR5A 1SYGA 2UU9Q 4OXPA 1BCPC 1OXTA 5C0XG 2BCOA 4A3MB 3U9OA 2F0QA 1XPUA 3HOZB 1HJPA 3V2TA 5IGGA 3LGJA 1WYDA 3T1YL 2KHIA 4JI2L 1TY2A 2IL8A 1HFGA 3PO3B 1WCMG 1HCZA 4A3MH 4GN3B 3Q22A 4L6TB 5C3XA 2R93B 3M7GA 3HOZH 2H4OA 3I70A 2PW7A 1EFWA 1RIPA 3K5LA 3S15B 1E1TA 3CP0A 1DXMA 1HR0L 3HOYB 1SROA 2EJGC 3TP8A 2ZT9C 2YV5A 4DR4Q 1BBWA 2SNSA 4PZ8A 4YHHQ 3PO3H 1SNDA 2PO4A 4F7XA 4PZ7A 1L0XB 3ONAB 2EPBA 2A68C 2R93H 2EY5A 1AZQA 4IUNA 2E5LQ 3S1RB 3VR3A 3S15H 1HNWL 2F3IA 1I5FA 3HOYH 1O78A 4OO1H 2IY5B 2JQOA 4IJLA 4L63B 4NB3A 5FLMH 4XDXA 4C56C 1D6EC 5A35A 1A6XA 1PHJA 1YBYA 4HAEA 4QIWB 4BWGB 1VDZA 3S1RH 3GTLB 2F0WA 3FMCA 4GKKL 1F9RA 4MTNA 3NP8A 3NPPA 2K5NA 2R7ZG 5IYDH 4FVMA 4HMJA 1B1ZA 4B3SL 4O2DA 1YZ6A 2TSSA 4JI4L 3EA6A 2UUCQ 3T56B 1V1PA 1X3FA 5CV7A 3GTLH 4RAUC 3MC0B 2UXBL 3TEHB 5CBEE 2F0TA 4KMUC 3PIPA 4BY7H 1Q1BA 1S5ED 1TY0A 3VR6A 3NTKA 2KCCA 1SNMA 4DN4M 3CCLA 3MAQA 3S17B 1P16A 4K6LA 2R6GA 4DV0Q 5IP7H 1XMOL 1BNZA 1LACA 3BDCA 5E3FA 3T16A 4BS9A 4A93B 1E3PA 3WOFA 1DJRD 1E2WA 4MZ9A 1QUQB 5ELNA 4X3KA 4X6AH 1GUNA 2EYOA 3BZCA 4G7HC 3PMFA 1K0RA 2HDMA 3ERSX 3I56A 3S17H 1HNXL 3I90A 4DV6L 2WB1B 2I5MX 4F8MA 5I4DA 3J7ZC 2QDLA 3K5OA 4JBWA 5GADC 1JJ2A 4ZK9B 4A93H 2JA7G 1HA5A 3RZDB 1F2MA 1UE5A 3AU7A 4QIWE 1PH9A 2NZHA 3CPWA 3AMUA 4MN3A 1R9TB 3GDEA 4IFDG 4C1NI 1XPOA 4J6HA 3QB3A 4NDXA 2A73B 1UE6A 5COYA 3PO2H 1MJCA 1UE7A 3VA7A 2WAQG 3RZDH 4LF7Q 5EPLA 3NEMA 4KKUA 2D62A 4H7BA
chains in the Genus database with same CATH topology
1E2VA 2F0VA 4RFBA 3OPOA 1KABA 4X3TA 1EY0A 1LTTD 1JOQA 3MXGA 5K5PA 1STGA 1DONA 4QMGA 3DWQA 4FP5D 4A3KB 2N88A 3CKIB 3BYYB 1J8IA 1M8AA 2RDHA 3NTIA 3O13A 4IUVA 3H91A 3J7YW 3GTJB 5FO7B 4RKBA 4C2MB 3BG3A 2L0CA 1TWFB 3CRKC 4A3DB 3C46A 1NCVA 5KYIA 2E74C 1E2ZA 4XQJA 2PNRC 1WTVA 3LX0A 1PFMA 3DWAA 5K36G 1LLRD 3M7NA 3WDNA 1W6KA 1Y69U 1GJXA 2RBMA 4AYBB 2X69A 3HGBA 4HEDA 3NTHA 3I8ZA 5JEAH 1HRJA 1SEBD 4FF3A 1HXYD 4OHJA 3T51B 3MXNA 2Z8LA 1CA5A 2L1BA 3P20A 3FPUB 2PQEA 2BE5C 3NE5B 2F0GA 3VYRA 4G4KA 1YNNC 2RA4A 2CVRA 1AFPA 1RCVD 1UAPA 3MZ5A 1LT3D 4ZUIA 3G7LA 1H9RA 4FO2A 1B9NA 3I91A 1EZ6A 5JVH3 4XTCS 1LO5D 2XRQD 3RLFA 3NUCA 1XYIA 1LTAD 2K5WA 4N9TA 4IUPA 5C4HA 4K6DA 2PPBC 1LV9A 5EPKA 2IWHA 1SMYC 3QG1A 4OIKA 4PNYA 4J8QA 1PTOB 4IUTA 1Z6HA 4HR7B 3SE0A 5HGTA 2B63B 5EKKA 5LHY1 2G9HD 4DAVA 2EYJA 3R93A 2LMCB 4ZYSA 4ULLA 2IX0A 5DM63 3Q6SA 1PTOH 1JQYD 1TS5A 5ELFA 3GV6A 1EL0A 1HTLD 1STEA 3HZXA 2BA0A 3LWUA 1ZYRD 4RCNA 5C4ZA 4K2LA 4CHTB 2F3VA 2IX3A 4ABNA 4XT1B 1TU2B 5BN3A 5KEEA 1XWEA 1AP0A 2B2WA 3V96A 2IPKD 3K7AB 5M3MB 2G9DA 4HMIA 2F0HA 1KDCA 1V1PB 1I4GA 2JA8B 1R4PB 5CGKA 1BXTA 3BYTB 1R4QB 2B8FA 5IGBA 1KLGD 3VYTA 2A6HC 2BA1A 2D2CC 2AWNA 3H09A 5IGDA 2RVLA 1QCBD 2FHTA 2E2IB 2K03A 1F9QA 1TS2A 2AUJD 4BBSB 3D6CA 3E5SA 5JPMC 5TSSA 1BCPD 1BDOA 2B2VA 3DHQA 1MSGA 2AWOA 2JP1A 1SAPA 2KVMA 4UDUC 3NK9A 2R3ZA 3SDZA 5J22A 1QG7A 2FINB 1MBYA 3DMUA 2EE1A 1JOOA 4N9PA 3BDOA 4ODGA 1FNWA 5G3LD 1FNVA 2F03A 1EZ8A 4KK7A 3G6JB 5I2YA 1DYQA 1WTXA 1II3A 1DZ1A 4HCSA 2QDBA 2CW0D 2DN8A 1G6ZA 1HQRD 5D3IB 1TVXA 2NVTB 2JE6I 3OMCA 5C4XB 1EEFD 1JWMD 3S2HB 2ICIA 1HHVA 3LWEA 3M4OB 2X6GA 1ENFA 2B2YA 4B9WA 1SBBB 1EQVA 2EVBA 1S5CD 2A6EC 1G8ZD 5C6AA 2A69C 2A5HA 2EYFA 2NB0A 3MWYW 1U4LA 3ND9A 2SNMA 1PLFA 3J7AF 1PZJD 3NQIA 4QUFA 3TP7A 2ICEC 1FYCA 1DM0B 2L9HA 1K8MA 4H44C 4LJZC 3N6RA 2EYLA 4TRDA 2NBFA 4OO1I 1ILPA 1G2TA 1E0BA 2LS01 3C1FA 3HS0C 4C3IG 2NN6G 1JCKB 5D14A 3H6MA 4R8IA 5E4XA 2J4XA 3IAYA 2R61A 2XNAC 1K83B 1B44D 4IUUA 5KGUA 1KAAA 3S1QB 1MI2A 1KDBA 4BA2I 1I4PA 1EOTA 4UAIA 2K01A 1Y1VB 3PIP3 3TDQA 4RCOA 1WTQA 1Q12A 3DEOA 3L7ZC 3BVMA 1ENCA 1WTRA 1KNAA 3KLRA 3QIAA 4YIJA 4KKSA 1I3QB 3R2IA 5C4JB 2DNCA 3A54A 3NBIA 4EQOA 2EZVA 3TP6A 1OXSC 1HQMC 3A8JE 3SXHA 2NVXB 5C0XH 1WCMB 4B9XA 3S16B 2PZTA 3KF8A 1O80A 1CA6A 3NXWA 3PV0A 3M4YA 2EY1A 4V0BA 2VXWA 3NHHA 1IW7C 3BDLA 4J1MA 2MJ8A 4CJ0B 4M8AA 5A2QL 2AQ1B 2F0LA 2HUGA 5I9PA 5EJWA 4FXKC 1PFNA 5KNDA 3W2DA 3TZUA 1TWGB 1QWYA 3GTOB 1EU3A 4OL7A 1CHPD 1NSNS 1I4XA 4XYOA 2RDGA 2R7ZB 1CHQD 4XIGS 1PMRA 2X6LA 4DK1A 4FXDA 1A15A 2BE5D 3J81L 1PTOC 4ME5A 2NTSA 1RTNA 1WTWA 2BDOA 5IODA 1YNND 2MUYA 4P2CB 2K7VA 2FMCA 2C9OA 5CORA 5IIFA 1LABA 1VF7A 1UNSA 1V43A 4IUQA 1IKLA 1L0YB 4BY7B 1Z47A 4DF7A 2HCIA 2J7ZA 4K2KA 1SDFA 1BBXC 2OT2A 2B2TA 1EEID 4DNTB 2FMMA 3ND8A 1UEAB 5IT9L 5M5YB 2JA7B 3SK5A 1PZKD 2F1MA 1RKNA 2LY7A 3QO2A 3TSSA 2PCFB 5CBAE 2B2TC 2WAQB 4RGOS 4K5WA 5C5LA 4CBVA 2F0SA 3A56A 3QOJA 4QB4A 2LFNA 1EFID 2M2LA 3D4WA 1RD9D 5D3DA 4IFDH 1QOHA 2NVYB 2KECA 1Q8IA 2A74C 3PO2B 4Q0FA 3PUXA 5EKLA 1GXDC 5IGCA 3GP7A 4NKLA 5M5WB 4FXGC 1Q1EA 2PZUA 2R92B 1A3VA 1PFBA 2PYKA 4DNRB 1STAA 1Y8OB 1EY9A 1W6JA 1NUCA 5FOBB 5FLXL 1I6VC 1SJHD 1X3QA 5FKAC 4WRDA 5CYUA 3VA5A 2GA4B 1A3TA 1QE6A 1U4RA 4RGTA 1XTCD 3WOEA 5JVG3 3K0YA 2QKIC 3BVGA 3I73A 5NUCA 3MEHA 4NMZA 2F0DA 5ELBA 1QILA 2PMZB 5K36H 1XXGA 1GUTA 1LTSD 5I2XA 2C5CA 2L5TA 4IN3A 1SE2A 1Q3LA 1ENAA 2WIIB 4KI0A 3VYSA 5I6YA 1DOMA 2OF1A 3E6ZX 3K6OA 2DY7A 4BY1B 2K1BA 1PYWD 4IZ8A 3SK6A 3M3YB 3EJIA 3BVZA 2EJMA 3TP5A 2IJ0A 1JICA 3A8IE 3PUZA 4CKEA 3Q0AA 4R8NA 1IHZA 1ONLA 2IT1A 3SEBA 5E1FA 5JEAJ 4U673 1F77A 2TMPA 3Q23A 1JORA 4FYDA 1TT2A 1CFMA 4X3SA 2KJXA 1QNKA 2A6ED 1BF4A 2A69D 1LTRD 4RHSA 3SK4A 2HCCA 3C1EA 4RA8A 2Q8TA 3QJYA 2WP8J 1IYVA 2F0JA 3SVMA 1PRTB 4A3JB 1C4QA 2E2HB 2H1EA 5KIXA 4JK1C 1FGBD 3A8KE 4KHZA 1UUPA 4B08A 4L8JA 1SE4A 2E75C 4EQNA 2RKSA 1U4MA 2V4DA 1SE3A 3GTPB 3BS1A 1WTPA 1ILQA 1LTID 3IL8A 4E6IA 4U68A 1FD7D 3IFTA 4RHRA 1FR3A 4A3IB 3AB9A 4KD4A 5A2QE 3U9SA 1LT5D 5CV5A 2XVSA 4FNFA 4ZAIA 5KYLA 1EY4A 3GV3A 1ESFA 1U4PA 2F0NA 4LAAA 4RWSC 3J81E 2JA6B 3S1NB 1JWSD 1CZGA 4KTAA 3EROA 4ZLTF 3K59A 3FKIB 1BO0A 4KJOA 4KY5A 2E2JB 2Q8RE 1ET9A 1D1KA 2VB3X 1LT6D 2JYOA 3QWNA 1D2BA 4WFN3 2XWBB 5CR3A 4PMCA 2NTTA 5HURA 2B2WC 3ERQA 4HSPA 4PV1C 1AN8A 3FDTA 1PRTF 4G7OC 2EJFC 4IALA 3RD4A 4F87A 3GO5A 1F2ZA 2HDLA 1STBA 1PTOF 5IT9E 5M3FB 4EVOA 2WKCA 2J0TD 1GHKA 4RKLA 1PXUA 1RJTA 1EYDA 1SYEA 1CK1A 3UI2A 3TN2A 3PIO3 2B2VC 3I4LA 1OXVA 2I46A 3NWSA 5C0XI 3KBGA 4XT3B 4C3HG 5C44B 2NUCA 3P75A 2WACA 1QJOA 2F0OA 1H9SB 2A68D 5IGEA 1B9MA 4MHEA 5D65A 4FF2A 2B2UA 4FF1A 3I4MB 4WJWA 1JC7A 4K5VA 1A2UA 2AUKA 1STYA 4DFAA 1EQTA 2QF7A 3DEPA 4FF4A 1HTPA 1NR4A 1H9KA 3CU7A 2ZXRA 2L4NA 3C2PA 1H9JA 1ZKOA 3HOWB 4DAPA 3OOCA 4C3IB 1TIID 4G57A 1Y8PB 4ZKBB 5FLXE 4R9WA 1B3AA 1O7LA 4DU9A 2Z1CA 1SXTA 1GUWA 2MPMA 2NN6H 3HOXB 4DXFA 4KY6A 5KNBA 1MGSA 1G2SA 2AQ3B 2B2YC 3J7AV 1O7YA 4DAYA 2O5JC 5EQ0A 2PZWA 2RQXA 4MIUA 4G7ZC 2JSOA 5J1ZA 1OXUA 3TZDA 5IOCA 3T53B 3OSOA 1JWUD 2K6AA 2YU9B 3OHXC 5I9OA 2K05A 1EWHA 3IKJA 1MD2D 4K8JA 3BZDB 5M5XB 1NR2A 2EXZA 1I4QA 1STNA 2XRSD 3Q24A 4OGQC 1A3UA 3HP3A 1RDPD 3T4AC 3R8BA 4C1NK 2RSOA 3TMEA 1ET6A 4Z9CB 2M9VA 4C3JG 1SNQA 3W3AA 1TWCB 1CTMA 1CQVA 3GQBA 4K14A 4IFDI 1ZXTA 3RZOB 1AW7A 1J9OA 3SR1A 1KDAA 3KUPA 4IURA 3VYUA 3D4RA 4LMQD 4ZKCB 1WVLA 2I07B 3S9WA 4O42A 4RH6A 5CV4A 2MP1A 1XX8A 4O1NA 5C0XJ 3FEWX 4A3BB 1TWHB 1D5XC 1I50B 2L55A 3A7LA 1TWAB 1B4OA 4HSVA 2K28A 2LKVA 2KA7A 1AEXA 1WD0A 3J80L 4RGNA 4DK0A 2NVQB 1PRTC 5ISRA 1G291 5BN5A 1X3PA 4TSSA 1GHJA 3F2UA 2O4XA 2Y0SB 1HA6A 4A3GB 3NQTA 3K5NA 2JEAI 1IKMA 3MFGA 2PW5A 5EBDA 2F3WA 5I6WA 3K5MA 1GUGA 1SYBA 2EYHA 4XQNA 3ZYYX 2JXMB 1M4VA 1GUSA 3OMGA 1F9PA 5AFWA 3S2DB 1DD2A 4A3EB 4XQQA 1PZID 3S1MB 4CJ2C 2CW0C 3K58A 5BN4A 4PMWA 2BOSA 1SNOA 2ID0A 4BBRB 1ICWA 5EBCA 1SMYD 3H0GB 3MVVA 1EY8A 3I72A 2DY8A 2FFKB 4OO1G 2MHVA 3SHLA 2XIWA 1YNJC 3HRZC 3GTKB 1QNUA 2NWGA 2E76C 3HOVB 4QCLA 1VCIA 2QILA 4CKBA 2FJ2A 4H13C 1VF5C 3EQLC 4ILWA 1RF2D 5CMDA 2CHBD 4Q5VA 3D3RA 1AZPA 5CV8A 3E0JA 1S4ZA 5CC4A 2E2DC 3OWEB 3PUWA 3DWPA 1JOKA 5ELDA 1JB3A 3PUYA 3OIPA 1DOKA 3URYA 3KK7A 1BUVT 5JPNC 4QUCA 4KN4C 1EY6A 1H9SA 3X3MA 3JAML 4IFDJ 4KKTA 1C8CA 4CJ1B 3P7JA 4ZUJA 4WORA 1EIHA 1CM9A 5C3EB 3HEJA 1T5XD 1IYUA 1TQOA 2A6HD 2KUMA 3OIQA 3GTQB 2K33A 2F0MA 1SYCA 2KHSA 2YYZA 1S5BD 4OIJA 1I4RA 3GD7A 4LK1C 2MGSA 1TR5A 2K32A 1BR9A 1X32A 3D8GA 2EY2A 3V05A 1K8OA 3A55A 2XWJB 2B8GA 1EY7A 1CI3M 3L3OC 3IFDA 3PUVA 5DNFA 2BDNA 4KY7A 3FVQA 1HUNA 3S14B 2VB2X 1H9MA 3CQZB 1Z7TA 5M9OA 1TKWB 2WINB 2JEBI 5FK9C 3LNNA 2CQAA 1Y1WB 3I3CA 1RTOA 2IW3A 4Y7NB 3MXUA 1OXXK 1KLUD 3T13A 1STHA 2EYMA 2EDGA 1EYAA 3D31A 3MXPA 2F0KA 3H94A 3A7AB 5JEAG 3CRLC 1RODA 2ZXPA 3MFYA 3NSWA 2DNEA 5E4WC 5EKIA 1PDQA 3P1HA 1GOZA 1BCPB 4XYQA 1EYCA 3MHBA 1WD1A 2KCNA 1KNEA 4BA1I 1U9RA 3H3VC 2D5DA 2EY6A 3DXJC 1FNUA 4ZQ3A 2D9UA 2NYZD 3EFXD 3K57A 4I7ZC 1A2TA 1TS4A 4NW2A 1CQFA 3X3NA 3CHBD 4HTHA 1JR0D 4K5XA 1S5DD 4NP5A 2F0UA 2JA5B 1G91A 3KLSX 3J80E 4XXEA 3HKZB 2NN6I 1NAPA 1RHPA 4DXGA 2VUMB 2VNUD 2QEJC 4F88A 1TS3A 3HG9A 2KOLA 2OEOA 1I6HB 2F4IA 3I4NB 4KN7C 2KQ3A 4X3UA 5T1GA 4CGYB 4S3SA 4KD3A 4KJNA 1Y8NB 2F0PA 1VMPA 4KV6A 1V8QA 2SOBA 3L9AX 1SYFA 5JJZA 3GTGB 5LL6X 5J39A 1BCPF 1EU4A 1DCZA 1MSHA 3NBHA 3C3LA 1VMCA 2O5IC 4C3HB 3SK8A 3RMHA 1HUMA 4TQUS 1CT1D 3GTMB 1IW7D 2K5DA 4EQPA 4RGMA 5FO8B 2SEBD 2F0FA 1SNPA 2RDFA 4K8IA 5FO9B 5G3LF 2M00A 1SNCA 2IX1A 3HOUB 1B53A 4V190 1QB5D 1PRTD 4GZYC 2EOTA 4M1UB 1BOSA 4TKOB 4KHVA 5T1IA 5CV9A 1PTOD 2ZXOA 5JAVA 2F0IA 1F2LA 3NWTA 3DUZA 3KBXA 3MTSA 3R3OA 2K5QA 1IL8A 5F2DA 5KNCA 4I65A 5C5MA 3JAME 3D4DA 1SSOA 1Q90A 4A3FB 4CKCA 5C3WA 2B2UC 1OO9B 3TBIB 2L12A 5EPJA 1LTBD 3RUZA 4HN7A 4DGZA 1CZWA 3N52A 5IGFA 1EY5A 1EIGA 2WV6D 4EGVA 4ID6A 2L11A 2ENBA 1V1OA 1YNJD 2RSNA 3D6WA 1B50A 5EGTA 2KEEA 3R2TA 2Q8IB 3KLSA 5CV6A 3MA2B 3OWFA 1KTKA 1S5FD 2WKDA 3VR2A 1EWCA 1B2TA 4C3JB 2QCPX 3FPPA 1C48A 1D5MC 1SJED 3VR4A 2Z4HA 2N55A 2B39A 2AQ2B 3M85A 1GUOA 2NZ1D 5DM73 1ML0D 2SDFA 2F0EA 4PMBA 2OXPA 2XSCA 4DA2A 1WTOA 2K04A 4IQZA 3ITPA 5DAUA 3OW7A 5ELEA 2EYPA 2O2LD 4QF4A 1SYDA 2HQEA 2KEDA 1HFNA 1LT4D 1ZYRC 1D5ZC 1DOLA 1F2YA 1F9SA 1O7ZA 2XN9C 1ESRA 4HCEA 4ZRZA 4H0LC 1BQQT 1SFOB 1D1IA 3QOLA 2Z4IA 1JE4A 1HPCA 3FRPB 1I4HA 5ELCA 1T5EA 1LTGD 4PQXA 3DM1A 3EVQA 1ZEQX 5KRUA 5DEHA 5LL6S 5JOBA 3VR5A 1SYGA 1BCPC 1OXTA 5C0XG 2BCOA 4A3MB 3U9OA 2F0QA 3HOZB 3V2TA 5IGGA 1TY2A 2IL8A 1HFGA 3PO3B 1HCZA 3Q22A 4L6TB 5C3XA 2R93B 3M7GA 2H4OA 3I70A 2PW7A 3K5LA 3S15B 1DXMA 3HOYB 2EJGC 3TP8A 2ZT9C 2SNSA 1SNDA 2PO4A 4F7XA 1L0XB 3ONAB 2EPBA 2A68C 2EY5A 1AZQA 4IUNA 3S1RB 3VR3A 1O78A 4OO1H 4L63B 4XDXA 4C56C 1D6EC 5A35A 1A6XA 4HAEA 4QIWB 4BWGB 1VDZA 3GTLB 2F0WA 3FMCA 1F9RA 3NP8A 3NPPA 4FVMA 4HMJA 1B1ZA 2TSSA 3EA6A 3T56B 1V1PA 5CV7A 4RAUC 3MC0B 5CBEE 2F0TA 4KMUC 1Q1BA 3VR6A 1S5ED 1TY0A 3NTKA 2KCCA 1SNMA 4DN4M 3MAQA 3S17B 4K6LA 2R6GA 1BNZA 1LACA 3T16A 3BDCA 4BS9A 5E3FA 4A93B 3WOFA 1DJRD 1E2WA 4X3KA 1GUNA 2EYOA 4G7HC 3PMFA 2HDMA 3I90A 2WB1B 4F8MA 5I4DA 3K5OA 4JBWA 4ZK9B 1HA5A 3RZDB 1F2MA 3AU7A 3AMUA 4MN3A 1R9TB 4IFDG 4C1NI 4J6HA 3QB3A 4NDXA 2A73B 5COYA 3VA7A 5EPLA 4KKUA 2D62A 4H7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E2V A;  3VR3 A;  1ONL A;  1YNJ C;  3RLF A;  1Y8P B;  2IT1 A;  3PUX A;  3D4R A;  3OPO A;  1O78 A;  3PUV A;  1BDO A;  4OO1 H;  1O7L A;  2NN6 G;  5KND A;  3TZU A;  2NN6 I;  1ZYR C;  2E76 C;  1Q1E A;  1H9M A;  1VCI A;  5A35 A;  5KNC A;  2PPB C;  1A6X A;  1Z7T A;  2AWO A;  4H13 C;  2NN6 H;  1TKW B;  1VF5 C;  1SMY C;  4DNR B;  1VDZ A;  5KNB A;  3QG1 A;  3EQL C;  1CFM A;  2JEB I;  4XIG S;  3FMC A;  4BA2 I;  3SDZ A;  1PMR A;  4KN7 C;  4DK1 A;  3LNN A;  1Y8O B;  2A6E D;  1Q90 A;  4H0L C;  2A69 D;  2BE5 D;  4PV1 C;  3A7L A;  1Z6H A;  4HR7 B;  4G7O C;  2BDO A;  2EJF C;  3BG3 A;  1I6V C;  3PUW A;  3SE0 A;  3T56 B;  2KA7 A;  2K7V A;  3BDO A;  1Y8N B;  3MXU A;  2O5J C;  3CRK C;  3QJY A;  1OXX K;  3PUY A;  4DK0 A;  1Q12 A;  1LAB A;  1V8Q A;  2LMC B;  1HPC A;  1IYV A;  2E74 C;  4KMU C;  3L7Z C;  1E2Z A;  1VF7 A;  1Q1B A;  1T5E A;  2EDG A;  3VR6 A;  3D31 A;  3KLR A;  1G29 1;  3QIA A;  2PNR C;  3H94 A;  5BN5 A;  1GHK A;  4KN4 C;  1GHJ A;  1V43 A;  3I73 A;  1H9S A;  5K36 G;  3A7A B;  2KCC A;  4KKT A;  5JEA G;  3CRL C;  1DCZ A;  4G7Z C;  4JK1 C;  1OXU A;  3M7N A;  3MFY A;  3WDN A;  4KKS A;  2JEA I;  3A8K E;  1Y69 U;  2DNE A;  2DN8 A;  4KHZ A;  3T53 B;  1GJX A;  2O5I C;  2R6G A;  4L8J A;  5K36 H;  2BA0 A;  3LWU A;  3HGB A;  2E75 C;  1GUG A;  2DNC A;  4RCN A;  3VR5 A;  5JEA H;  3I4L A;  1GUT A;  1LAC A;  1OXT A;  5C0X G;  2JE6 I;  1OXV A;  2V4D A;  1IYU A;  1E2W A;  1EWH A;  2JXM B;  4TQU S;  3IKJ A;  1GUN A;  2Q8I B;  2A6H D;  1IW7 D;  4G7H C;  1OXS C;  4DNT B;  1HQM C;  3A8J E;  2L5T A;  3ND8 A;  5C0X H;  3T51 B;  1GUS A;  4BA1 I;  1QJO A;  2D5D A;  1H9S B;  4OGQ C;  2A68 D;  3DXJ C;  1TU2 B;  5BN3 A;  3VR2 A;  1DD2 A;  3IFT A;  1B9M A;  4KI0 A;  3P20 A;  1FR3 A;  2F1M A;  2K33 A;  3FPP A;  4JBW A;  2EVB A;  2CW0 C;  1HCZ A;  3PV0 A;  2A6E C;  3AB9 A;  3VR4 A;  2A69 C;  2BE5 C;  2YYZ A;  5BN4 A;  3NE5 B;  3M4Y A;  2AUK A;  3ND9 A;  3U9S A;  3M85 A;  4I7Z C;  1GUO A;  2QF7 A;  1YNN C;  3W3A A;  1DXM A;  1HTP A;  2PCF B;  3GD7 A;  4LK1 C;  1CTM A;  2B8F A;  4GZY C;  1H9K A;  3GQB A;  2K32 A;  4IFD G;  2EJG C;  2A6H C;  1IW7 C;  2BA1 A;  2D2C C;  2ZT9 C;  1FYC A;  1H9R A;  2D62 A;  2EJM A;  1H9J A;  1K8M A;  1ZKO A;  3N6R A;  4H44 C;  4IQZ A;  4LJZ C;  4TKO B;  1B9N A;  3I72 A;  3OOC A;  3VA7 A;  2A68 C;  3OW7 A;  4IFD H;  1K8O A;  4OO1 G;  4XTC S;  3A8I E;  3PUZ A;  2AUJ D;  2B8G A;  4KKU A;  1CI3 M; 
#chains in the Genus database with same CATH topology
 1E2V A;  2F0V A;  1NNX A;  2EQS A;  1R9T H;  4RFB A;  1IBK L;  2MNA A;  3OPO A;  1KAB A;  4X3T A;  1EY0 A;  1LTT D;  1JOQ A;  3MXG A;  5K5P A;  1STG A;  1DON A;  4QMG A;  3WWV A;  3PO2 G;  3DWQ A;  4FP5 D;  4A3K B;  2N88 A;  3CKI B;  3BYY B;  1J8I A;  1M8A A;  2RDH A;  2ZJR A;  1HR0 W;  4X64 Q;  2R92 G;  3NTI A;  3O13 A;  4IUV A;  3H91 A;  4NXN Q;  3J7Y W;  3GTJ B;  2AMC B;  1FJG L;  5FO7 B;  4A3K H;  4RKB A;  4C2M B;  1AH9 A;  3BG3 A;  3NEL A;  2L0C A;  1Z9F A;  1TWF B;  3CRK C;  2WB1 E;  3F2D A;  4A3D B;  3C46 A;  1NCV A;  5KYI A;  2E74 C;  1E2Z A;  1PH6 A;  4XQJ A;  2PI2 A;  2PNR C;  1WTV A;  3GTJ H;  3LX0 A;  3ULP A;  1PFM A;  3DWA A;  5K36 G;  1LLR D;  4C2M H;  3M7N A;  1B3Q A;  1W6K A;  2KEN A;  3WDN A;  1Y69 U;  1TWF H;  1GJX A;  2RBM A;  4AYB B;  4A3D H;  2X69 A;  5L37 A;  3J81 c;  3HGB A;  2F4V Q;  4HED A;  3NTH A;  3I8Z A;  5JEA H;  1A63 A;  1BBU A;  1HRJ A;  1SEB D;  4FF3 A;  1HXY D;  1VQO A;  4OHJ A;  3T51 B;  5FJ8 H;  1Q46 A;  3MXN A;  2Z8L A;  4LWC A;  1CA5 A;  3UDF A;  2UXD L;  1I94 L;  3A74 A;  4GNX B;  2L1B A;  3P20 A;  3FPU B;  1VS0 A;  3PGZ A;  2PQE A;  1YJN A;  2BE5 C;  5IYB G;  3NE5 B;  2F0G A;  1W3S A;  3VYR A;  4G4K A;  4OX9 Q;  1YNN C;  2RA4 A;  2QA4 A;  2CVR A;  1AFP A;  1RCV D;  1UAP A;  1X54 A;  3MZ5 A;  3OYY A;  2Z6K A;  1LT3 D;  4ZUI A;  4BY1 G;  3G7L A;  1H9R A;  4FO2 A;  1M90 C;  2Q2T A;  1B9N A;  3I91 A;  1EZ6 A;  2N3S A;  5JVH 3;  4XTC S;  1LO5 D;  1U5K A;  4LF4 L;  2XRQ D;  4KLK A;  3RLF A;  3NUC A;  1XYI A;  1LTA D;  2OQ0 A;  2K5W A;  4HIO A;  1WTH A;  4N9T A;  3BZK A;  4IUP A;  1SLJ A;  5C4H A;  3UE0 A;  4K6D A;  2PPB C;  1LV9 A;  3E9H A;  5EPK A;  2IWH A;  2CH4 W;  1SMY C;  2UU9 L;  4AYB E;  3QG1 A;  2UUB L;  1VQL A;  4B3T Q;  4OIK A;  4PNY A;  4LFC Q;  4J8Q A;  1PTO B;  4HIM A;  4IUT A;  4CDE C;  1Z6H A;  4HR7 B;  1ASY A;  4DKA C;  3SE0 A;  5HGT A;  2B63 B;  5EKK A;  5LHY 1;  2G9H D;  4DAM A;  4DAV A;  4DV4 Q;  2EYJ A;  3R93 A;  2LMC B;  4ZYS A;  4ULL A;  2IX0 A;  5DM6 3;  3Q6S A;  1PTO H;  1JQY D;  1TS5 A;  5ELF A;  3GV6 A;  1EL0 A;  4A3J G;  1Y14 B;  1HTL D;  1STE A;  3HZX A;  4YY3 Q;  4DR4 L;  1X65 A;  2BA0 A;  3LWU A;  2ZTC A;  1ZYR D;  4RCN A;  5C4Z A;  5FLX c;  4K2L A;  4CHT B;  5LMN L;  2E5L L;  2F3V A;  4KHP Q;  2IX3 A;  4ABN A;  1V1Q A;  4XT1 B;  1TU2 B;  5BN3 A;  5KEE A;  1XWE A;  4JI7 Q;  2OWO A;  1AP0 A;  2B2W A;  3V96 A;  2IPK D;  3K7A B;  2PNH A;  2G9D A;  5M3M B;  4HMI A;  2F0H A;  1KDC A;  4DR7 Q;  1V1P B;  1I4G A;  3CCE A;  2JA8 B;  1R4P B;  5CGK A;  4A3I G;  4A3C H;  1BXT A;  3BYT B;  5JJI A;  1R4Q B;  2B8F A;  5IGB A;  4IPH A;  4L5T A;  1KLG D;  4DV2 Q;  2A6H C;  2BA1 A;  2D2C C;  3H09 A;  2AWN A;  3VYT A;  5IGD A;  2RVL A;  1K8G A;  4Y52 H;  1QCB D;  3K7A H;  5M3M H;  1QVF A;  2FHT A;  4JW0 A;  1N36 Q;  2E2I B;  2K03 A;  1F9Q A;  1TS2 A;  2AUJ D;  3T1H L;  2JA8 H;  4BBS B;  3D6C A;  3E5S A;  5JPM C;  4X62 Q;  1ASZ A;  5GAE C;  5TSS A;  1CSQ A;  1BCP D;  1BDO A;  2B2V A;  3DHQ A;  2JA6 G;  4K0K Q;  1MSG A;  2XGT A;  4AQY Q;  2E2I H;  2AWO A;  2JP1 A;  3J80 i;  1SAP A;  2KVM A;  4UDU C;  4BBS H;  4QQB X;  3FKI G;  4HID A;  3NK9 A;  2R3Z A;  3SDZ A;  5J22 A;  1QG7 A;  1VQP A;  2FIN B;  5LMU L;  4X65 Q;  1MBY A;  1B70 B;  3DMU A;  2EE1 A;  1JOO A;  3BJU A;  4N9P A;  3BDO A;  4ODG A;  1CKO A;  4JI5 L;  1FNW A;  5G3L D;  1FNV A;  3CW2 C;  2F03 A;  3TS2 A;  1QUQ A;  1EZ8 A;  4KK7 A;  4JI6 Q;  3G6J B;  4YWK A;  5I2Y A;  1DYQ A;  1KAW A;  1WTX A;  1II3 A;  1DZ1 A;  4HCS A;  2QDB A;  1SMX A;  2CW0 D;  5M3F G;  2DN8 A;  1VQ7 A;  4LF5 Q;  1G6Z A;  1HQR D;  3IRB A;  2HHH Q;  5D3I B;  1TVX A;  1XTD A;  2LXJ A;  2NVT B;  2JE6 I;  4ZCK A;  4DV7 L;  3OMC A;  5C4X B;  4JI3 Q;  1EEF D;  5DLQ E;  5EAY A;  1JWM D;  3AYH B;  2ICI A;  3S2H B;  5J3B A;  1HHV A;  5IYC G;  3OTO Q;  3LWE A;  3M4O B;  2X6G A;  1VQH A;  5C44 G;  1ENF A;  1K73 C;  2B2Y A;  2NVT H;  4B9W A;  1SBB B;  4R1J A;  2N78 A;  1EQV A;  2EVB A;  1S5C D;  5C4X H;  2A6E C;  1G8Z D;  5C6A A;  2A69 C;  2A5H A;  2EYF A;  3S2H H;  4LF9 L;  2NB0 A;  3MWY W;  2KHJ A;  4HIK A;  1U4L A;  3ND9 A;  1N32 Q;  2SNM A;  1PLF A;  4BXX G;  3J7A F;  1PZJ D;  3NQI A;  3I4M G;  3M4O H;  4QUF A;  3TP7 A;  1XNQ L;  4LF8 Q;  2ICE C;  1FYC A;  1DM0 B;  2L9H A;  1K8M A;  4H44 C;  4LJZ C;  3N6R A;  2EYL A;  5LMN W;  4TRD A;  1KD1 C;  2NBF A;  3CF5 A;  4OO1 I;  1ILP A;  1K3R A;  4LFB Q;  1G2T A;  3HOW G;  1IXR A;  1E0B A;  2LS0 1;  3C1F A;  3HS0 C;  4C3I G;  2NN6 G;  3F8T A;  1JCK B;  5D14 A;  1A8V A;  2ZTE A;  3H6M A;  4CDF C;  4R8I A;  1MIU A;  1X6O A;  5E4X A;  2J4X A;  3IAY A;  2R61 A;  2XNA C;  1K83 B;  1B44 D;  1VQJ A;  4IUU A;  5KGU A;  4P75 A;  4GLX A;  1KAA A;  1N8R C;  3S1Q B;  1MI2 A;  1K3B C;  1KDB A;  4P72 A;  4BA2 I;  3HOX G;  1I4P A;  1EOT A;  4UAI A;  2K01 A;  1Y1V B;  3PIP 3;  3TDQ A;  3JAM i;  1O7I A;  4RCO A;  1K83 H;  2K50 A;  1A0I A;  3CME A;  1WTQ A;  1Q12 A;  3S1Q H;  3DEO A;  2PQA A;  3L7Z C;  3BVM A;  1ENC A;  1WTR A;  1KNA A;  3QIA A;  3KLR A;  1Y1V H;  3K81 C;  1HNZ Q;  4YIJ A;  3DM3 A;  4GNX A;  3SGI A;  4KKS A;  5IP9 H;  1I3Q B;  3R2I A;  4JI1 Q;  5C4J B;  2DNC A;  4MTK A;  1S72 A;  3A54 A;  3NBI A;  4EQO A;  2EZV A;  3TP6 A;  1OXS C;  1HQM C;  3A8J E;  3SXH A;  2NVX B;  5C0X H;  1IYJ B;  4AIM A;  1I3Q H;  1WCM B;  4B9X A;  3S16 B;  2PZT A;  5BR8 Q;  5C4J H;  3KF8 A;  1O80 A;  2IHF A;  4GNX C;  1CA6 A;  3NXW A;  3PV0 A;  1P8L A;  4PZ6 A;  3M4Y A;  1WI5 A;  4GOP A;  4GKJ Q;  2EY1 A;  4IJH A;  4V0B A;  2NVX H;  1WCM H;  1PA6 A;  2L15 A;  3S16 H;  4LFC L;  2VXW A;  3NHH A;  1IW7 C;  3W5O A;  3BDL A;  4JBK A;  4J1M A;  2MJ8 A;  4CJ0 B;  4DV4 L;  2DJG C;  3CCR A;  2A8V A;  3DLL A;  4UY8 C;  4M8A A;  3D0F A;  3AQQ A;  5A2Q L;  1XPR A;  3STB C;  2AQ1 B;  2F0L A;  2HUG A;  5I9P A;  5EJW A;  4FXK C;  1PFN A;  5KND A;  3W2D A;  2DJF C;  3TZU A;  1TWG B;  1QWY A;  3GTO B;  1EU3 A;  4OL7 A;  3G48 A;  1CHP D;  1NSN S;  4YY3 L;  1I4X A;  4J15 A;  4XYO A;  2RDG A;  2R7Z B;  1PFS A;  1CHQ D;  4XIG S;  1PMR A;  2X6L A;  1JE5 A;  4DK1 A;  1A15 A;  4FXD A;  1TWG H;  2BE5 D;  1HZA A;  3J81 L;  1PTO C;  4ME5 A;  2NTS A;  3GTO H;  1SR3 A;  3F1Z A;  1RTN A;  4A3B G;  1WTW A;  2BDO A;  5IOD A;  1YNN D;  2MUY A;  4P2C B;  2K7V A;  2FMC A;  2R7Z H;  2C9O A;  5COR A;  5IIF A;  1LAB A;  1EOV A;  1VF7 A;  3B6Y A;  4DK3 C;  3E9I A;  3TRE A;  4DR5 Q;  4DR7 L;  1UNS A;  1M1K C;  1V43 A;  4IUQ A;  1IKL A;  1YI2 A;  1L0Y B;  4BY7 B;  1Z47 A;  4QY7 A;  4DF7 A;  4DV2 L;  2HCI A;  2J7Z A;  2Y0S G;  4K2K A;  1YJW A;  4JYA L;  4A3G G;  1SDF A;  4CDD C;  1BBX C;  4PG3 A;  1N36 L;  2OT2 A;  2AKW B;  4X62 L;  4JG2 A;  2B2T A;  1IBM Q;  1EEI D;  2RCF A;  4DNT B;  2FMM A;  4DR2 Q;  3ND8 A;  1UEA B;  5IT9 L;  4YCV A;  2CH4 A;  5GQO A;  1KC8 C;  5M5Y B;  2JA7 B;  1L1O B;  3SK5 A;  2ZTD A;  1PZK D;  4AQY L;  2F1M A;  5IWA L;  1K28 A;  2G5D A;  3UE1 A;  1RKN A;  2LY7 A;  3QO2 A;  4JOI A;  4A3E G;  4DK6 C;  2UUA Q;  3TSS A;  2PCF B;  4X66 Q;  5M5Y H;  2JA7 H;  5CBA E;  2B2T C;  3L0O A;  4JVZ A;  2WAQ B;  4DPG A;  4RGO S;  4K5W A;  4R4C A;  5C5L A;  4LUZ A;  4CBV A;  4A75 A;  2F0S A;  1X55 A;  3A56 A;  3QOJ A;  3JC6 6;  4QB4 A;  4BBR G;  2LFN A;  1EFI D;  2M2L A;  3D4W A;  1RD9 D;  5D3D A;  3RLO A;  4IFD H;  1QOH A;  3H0G G;  2NVY B;  4JI8 L;  2KEC A;  3KF6 A;  1Q8I A;  2A74 C;  3PO2 B;  1XMQ Q;  4Q0F A;  3PUX A;  5EKL A;  1GXD C;  5IGC A;  3GP7 A;  4P74 A;  4NKL A;  5M5W B;  1CKN A;  4FXG C;  2P5Z X;  1Q1E A;  2PZU A;  2R92 B;  1A3V A;  4B3R Q;  3CPF A;  1PFB A;  4LF5 L;  1B7Y B;  2NVY H;  2PYK A;  2QW7 A;  2RCN A;  4DNR B;  1STA A;  1YIT A;  3VDY A;  2YTX A;  3HOV G;  2I0Q A;  4DR1 Q;  1PYB A;  4JI3 L;  1Y8O B;  1EY9 A;  3M4Q A;  5M5W H;  1W6J A;  3H15 A;  1NUC A;  5FOB B;  3OTO L;  2R92 H;  3TRZ A;  5FLX L;  2RHS B;  1I6V C;  1SJH D;  1X3Q A;  5FKA C;  4DV3 Q;  4WRD A;  5CYU A;  2MFI A;  2GA4 B;  3VA5 A;  3W1G A;  1A3T A;  1QE6 A;  1U4R A;  1D8L A;  1CSP A;  4RGT A;  1XTC D;  3WOE A;  5JVG 3;  3K0Y A;  1NY4 A;  2QKI C;  1N32 L;  4LUO A;  2CFM A;  1VQ8 A;  4DR6 Q;  3BVG A;  3I73 A;  1NE3 A;  5NUC A;  2B29 A;  3MEH A;  4NMZ A;  2F0D A;  5ELB A;  1D7Q A;  1QIL A;  4LF8 L;  2PMZ B;  4R4Q A;  2WAQ E;  5K36 H;  4DAY B;  4A3L G;  4P73 A;  3UDG A;  1XXG A;  2GVA A;  1GUT A;  1L2F A;  1LTS D;  4LFB L;  2NZO A;  5I2X A;  2C5C A;  5C3E G;  2L5T A;  1XNR L;  4JV5 L;  4IN3 A;  1SE2 A;  1Q3L A;  1ENA A;  1UWV A;  2WII B;  4KI0 A;  3VYS A;  5I6Y A;  5IE8 A;  1DOM A;  2OF1 A;  3E6Z X;  3K6O A;  2DY7 A;  4BY1 B;  2K1B A;  1PYW D;  4IZ8 A;  3SK6 A;  4DUZ L;  5IYB H;  2PQA B;  1IBL Q;  3M3Y B;  3EJI A;  2Z6B A;  1PH7 A;  3BVZ A;  2EJM A;  3TP5 A;  4UPA A;  2IJ0 A;  3UDX A;  4WJ3 M;  1JIC A;  4B3M Q;  3A8I E;  3PUZ A;  1CKM A;  4CKE A;  3I4O A;  3Q0A A;  4DUY Q;  4BY1 H;  4R8N A;  1IHZ A;  1ONL A;  2VL6 A;  2IT1 A;  3SEB A;  5E1F A;  4DNI A;  4LF6 L;  1HNZ L;  5JEA J;  3M3Y H;  1XJV A;  4U67 3;  1F77 A;  1N34 Q;  4OWT B;  1EQR A;  2TMP A;  3Q23 A;  2VQF Q;  4JI1 L;  1JOR A;  2PMZ E;  4FYD A;  1TT2 A;  4YWM A;  1CFM A;  4X3S A;  5IT9 c;  3KF8 B;  2KJX A;  1QNK A;  2A6E D;  1BF4 A;  2A69 D;  1LTR D;  4RHS A;  3SK4 A;  4JI0 Q;  2BH2 A;  4OEM B;  2HCC A;  5BR8 L;  4GOP B;  3PF5 A;  3C1E A;  4GLA C;  4RA8 A;  1QVG A;  1PV4 A;  2Q8T A;  3QJY A;  1Y1W G;  2WP8 J;  1IYV A;  2F0J A;  2Z6K C;  3SVM A;  1PRT B;  4A3J B;  1E1O A;  4DV5 Q;  1C4Q A;  2E2H B;  1T9H A;  2H1E A;  5KIX A;  1E7Z A;  4JK1 C;  1Q82 C;  1FGB D;  3A8K E;  3RR5 A;  4KHZ A;  4OWX B;  1UUP A;  4B08 A;  4L8J A;  1SE4 A;  1GM5 A;  4DR3 Q;  2E75 C;  4EQN A;  2RKS A;  1U4M A;  4A3J H;  2E8G A;  2V4D A;  2E2H H;  1SE3 A;  1Q81 C;  3M4P A;  1U0L A;  3GTP B;  3BS1 A;  2ZM6 Q;  1TXY A;  1WTP A;  1ILQ A;  1NBW A;  5AJ3 Q;  3EIV A;  1LTI D;  3IL8 A;  1NJI C;  2JJQ A;  4U68 A;  4E6I A;  1FD7 D;  3IFT A;  3PQI A;  4RHR A;  1FR3 A;  4UP9 A;  4A3I B;  3AB9 A;  4KD4 A;  5A2Q E;  3T1Y Q;  4YHH L;  3GTP H;  3U9S A;  1LT5 D;  5CV5 A;  2XVS A;  4FNF A;  4IPD A;  1S3O A;  4GN4 B;  4ZAI A;  5KYL A;  2KBN A;  1EY4 A;  2DUD A;  3GV3 A;  2ASB A;  4A3I H;  1ESF A;  1KRS A;  1U4P A;  2F0N A;  4LAA A;  2D0P A;  2Q2I A;  4RWS C;  1QVC A;  1EIF A;  1HR0 Q;  4DV1 Q;  1BVS A;  3J81 E;  2JA6 B;  1PH2 A;  4ALP A;  3K0X A;  3S1N B;  1JWS D;  1CZG A;  4KTA A;  3CC7 A;  3ERO A;  4TVA B;  2WFW A;  2JA5 G;  4ZLT F;  3K59 A;  3FKI B;  1BO0 A;  4KJO A;  4KY5 A;  3QR8 A;  2E2J B;  1HNW Q;  2Q8R E;  1ET9 A;  1D1K A;  2VB3 X;  3HKZ G;  2JA6 H;  1MKH A;  1LT6 D;  2ZJP A;  2JYO A;  2UUC L;  3S1N H;  1JJC B;  3QWN A;  1D2B A;  4WFN 3;  2VUM G;  2XWB B;  5CR3 A;  1PH8 A;  3A0J A;  2NTT A;  2AHO B;  4PMC A;  5HUR A;  2B2W C;  5IY0 A;  2Q2H A;  3ERQ A;  1IBM L;  4HSP A;  4DR2 L;  4PV1 C;  1AN8 A;  3FDT A;  1VQ4 A;  3FKI H;  1PRT F;  4G7O C;  3I4N G;  2EJF C;  2E2J H;  4JBJ A;  4IAL A;  4GKK Q;  3RD4 A;  4F87 A;  3GO5 A;  1F2Z A;  2HDL A;  3CCM A;  1STB A;  1PTO F;  5IT9 E;  5M3F B;  4EVO A;  2WKC A;  4DV0 L;  2J0T D;  1GHK A;  3AFQ A;  4RKL A;  1PXU A;  2UUA L;  1L1O A;  1GO3 E;  4LW1 A;  4X66 L;  1RJT A;  2N8N A;  1EYD A;  1SYE A;  3STB D;  3KF6 B;  1J5E Q;  1CK1 A;  1YHA A;  3UI2 A;  3TN2 A;  3PIO 3;  2B2V C;  3I4L A;  1OXV A;  5M3F H;  3NWS A;  2I46 A;  5C0X I;  1G6P A;  1CKN B;  2K5H A;  3KBG A;  4XT3 B;  4C3H G;  5C44 B;  2NUC A;  3P75 A;  2WAC A;  1XMO Q;  1QJO A;  2F0O A;  1H9S B;  2A68 D;  3M9B A;  5IGE A;  1B9M A;  5IYC H;  1HZ9 A;  4HJ7 A;  4MHE A;  5D65 A;  4FF2 A;  4B3R L;  1VQB A;  2B2U A;  4FF1 A;  3I4M B;  4WJW A;  5C44 H;  1JC7 A;  1HNX Q;  4K5V A;  1A2U A;  2AUK A;  3J81 i;  1STY A;  4DFA A;  4DV6 Q;  4DR1 L;  1EQT A;  2QF7 A;  1RL2 A;  3DEP A;  2R7D A;  4LF7 L;  4FF4 A;  4YCU A;  1HTP A;  1NR4 A;  2VZA A;  1H9K A;  3CC2 A;  3KYH C;  4GLV B;  3CU7 A;  2ZXR A;  3HOU G;  2R7F A;  2L4N A;  3C2P A;  5GRO A;  1H9J A;  1ZKO A;  4DV3 L;  3HOW B;  4BXX H;  4DAP A;  2VW9 A;  3I4M H;  5JJL A;  3OOC A;  4C3I B;  3RLN A;  2CQO A;  1TII D;  4G57 A;  1Y8P B;  3I2Z A;  4ZKB B;  3A5U A;  1OTC A;  3A5Z B;  5FLX E;  4R9W A;  2I5L X;  1B3A A;  4UP8 A;  1O7L A;  4X64 L;  3HFZ B;  4DU9 A;  3HOW H;  1YNX A;  2Z1C A;  3G6E A;  1SXT A;  2VS1 A;  2MPM A;  2YTV A;  4NXN L;  4C3I H;  1GUW A;  3S24 A;  4RMF A;  2NN6 H;  3TQY A;  3U4Z A;  2KCT A;  3HOX B;  4DXF A;  4KY6 A;  4R4O A;  2IHE A;  1VQE A;  5KNB A;  1N9W A;  3PSI A;  3L2P A;  1MGS A;  2F52 A;  1K0S A;  1G2S A;  2AQ3 B;  1SN8 A;  2B2Y C;  3J7A V;  4EQ5 A;  1O7Y A;  2VY3 A;  1PYS B;  4DAY A;  3RNU A;  3HOX H;  4A3F G;  2O5J C;  2V1C C;  4R4I A;  3EBE A;  5EQ0 A;  2MO0 A;  2F4V L;  2PZW A;  2RQX A;  1LYL A;  2JA9 A;  4MIU A;  4QJF A;  4G7Z C;  3F2C A;  2JSO A;  5J1Z A;  1OXU A;  3TZD A;  5IOC A;  3T53 B;  3OSO A;  2OTL A;  3AFP A;  1LM0 A;  3FP9 A;  4NPS A;  1JWU D;  1L0W A;  2K6A A;  2YU9 B;  3OHX C;  5I9O A;  4B3M L;  2K05 A;  2JN4 A;  1EWH A;  4DUY L;  3IKJ A;  1MD2 D;  1VQ5 A;  3E3X A;  1UE1 A;  4K8J A;  3BZD B;  1E24 A;  5M5X B;  1NR2 A;  2EXZ A;  1I4Q A;  1W2B A;  1STN A;  2XRS D;  3Q24 A;  4OGQ C;  1A3U A;  1GD7 A;  4OX9 L;  2YU9 H;  3HP3 A;  1RDP D;  1AE3 A;  3T4A C;  3R8B A;  4C1N K;  1HZB A;  3J81 j;  2OQK A;  2RSO A;  1EWI A;  3TME A;  4UHV A;  3E0E A;  1ET6 A;  4Z9C B;  3CCU A;  2M9V A;  1NTG A;  5M5X H;  4C3J G;  1SNQ A;  1I94 Q;  3W3A A;  4IPG A;  1GVP A;  1TWC B;  5JJK A;  2VQE Q;  3H3V H;  1CTM A;  4JI0 L;  1CQV A;  3GQB A;  4K14 A;  4IFD I;  1VQN A;  1ZXT A;  3J7A 5;  3RZO B;  1AW7 A;  1FL0 A;  1ICF B;  4YCW A;  1J9O A;  3SR1 A;  1KDA A;  3KUP A;  4IUR A;  3VYU A;  3UDI A;  1PH3 A;  1TWC H;  4DV5 L;  3D4R A;  1HH2 P;  4LMQ D;  1V9P A;  4ZKC B;  1WVL A;  5HY6 A;  2I07 B;  3S9W A;  4B3T L;  3RZO H;  4O42 A;  4RH6 A;  1QZH A;  5CV4 A;  4LF4 Q;  3NEN A;  1KIX A;  2MP1 A;  1WJJ A;  1XX8 A;  1Q86 C;  4O1N A;  4DR3 L;  5C0X J;  3EN2 A;  3FEW X;  1YEZ A;  4A3B B;  1TWH B;  1D5X C;  1I50 B;  1X56 A;  1YHQ A;  4L5Q A;  2ATW A;  2L55 A;  3A7L A;  1TWA B;  2ZM6 L;  1K8A C;  1B4O A;  4HSV A;  5AJ3 L;  2EXD A;  2K28 A;  2LKV A;  2KCM A;  4GOP C;  1QZG A;  2UUB Q;  2KA7 A;  1AEX A;  1WD0 A;  3J80 L;  4RGN A;  4DK0 A;  2NVQ B;  4A3B H;  1TWH H;  1I50 H;  1PRT C;  5ISR A;  4EX5 A;  1G29 1;  5BN5 A;  1X3P A;  4TSS A;  1GHJ A;  3F2U A;  3KFU A;  1TWA H;  2A19 A;  2O4X A;  2Y0S B;  1HA6 A;  4A3G B;  1SRU A;  3NQT A;  3K5N A;  2JEA I;  1IKM A;  3MFG A;  2PW5 A;  4KHP L;  5EBD A;  2NVQ H;  2F3W A;  5I6W A;  3K5M A;  1GUG A;  1SYB A;  4OEL B;  2EYH A;  4XQN A;  3G4S A;  3ZYY X;  2JXM B;  4DV1 L;  4JI7 L;  4POG A;  5GAH C;  4A3G H;  1M4V A;  3RN2 A;  1GUS A;  3OMG A;  4A3M G;  1F9P A;  5AFW A;  3S2D B;  1EYG A;  3OW2 A;  5LMN Q;  4POF A;  3HOZ G;  1YIJ A;  1DD2 A;  4A3E B;  3KJO A;  1MJE A;  4XQQ A;  1EQQ A;  1PZI D;  3S1M B;  3NBH B;  4CJ2 C;  2CW0 C;  3K58 A;  1VQA A;  4N8F A;  5BN4 A;  4PMW A;  2BOS A;  3PO3 G;  3S2D H;  1SNO A;  2ID0 A;  1JJG A;  4BBR B;  2R93 G;  1ICW A;  5EBC A;  1SMY D;  4A3E H;  3H0G B;  3MVV A;  1EY8 A;  2QEX A;  3S1M H;  1HZC A;  3KLW A;  3I72 A;  3HOY G;  2DY8 A;  2FFK B;  4OO1 G;  2MHV A;  3SHL A;  4K0K L;  2Z0S A;  2XIW A;  4NXM Q;  1YNJ C;  3HRZ C;  5FLM G;  4BBR H;  3GTK B;  1QNU A;  2NWG A;  3H0G H;  2E76 C;  2Y0S E;  3HOV B;  4QCL A;  3T1H Q;  1VCI A;  2QIL A;  1VQF A;  1J5E L;  4CKB A;  4X65 L;  4IOC A;  2FJ2 A;  1CUK A;  3CXC A;  1MHW C;  4H13 C;  1VF5 C;  4GS3 A;  5IYD G;  3EQL C;  4ILW A;  1RF2 D;  5CMD A;  2CHB D;  3GTK H;  4Q5V A;  3ULJ A;  3D3R A;  1AZP A;  5CV8 A;  3E0J A;  4JI6 L;  1S4Z A;  3HOV H;  5CC4 A;  1JMC A;  2E2D C;  4H02 A;  3OWE B;  3PUW A;  4BY7 G;  3DWP A;  4JOI C;  1JOK A;  5ELD A;  1JB3 A;  2FXQ A;  3PUY A;  1PH5 A;  3OIP A;  5LMU Q;  1DOK A;  3URY A;  2ALY B;  2RHQ B;  3KK7 A;  1BUV T;  1PH4 A;  5JPN C;  4A76 A;  4QUC A;  4KN4 C;  2HHH L;  2Q2U A;  1EY6 A;  1H9S A;  3X3M A;  3JAM L;  1Q7Y C;  4JI5 Q;  4IFD J;  4KKT A;  5IP7 G;  1C8C A;  4CJ1 B;  2YTY A;  3P7J A;  4ZUJ A;  2UXC Q;  4N8X 1;  4WOR A;  1EIH A;  3CCS A;  1CM9 A;  1KRT A;  5C3E B;  2OCE A;  3HEJ A;  1S40 A;  1T5X D;  1IYU A;  1TQO A;  2H5X A;  2ES2 A;  2A6H D;  4A3L H;  2KUM A;  3ZJY C;  4A93 G;  3OIQ A;  2C35 B;  4DV7 Q;  3GTQ B;  5C3E H;  2K33 A;  2F0M A;  1SYC A;  2WB1 G;  2KHS A;  2YYZ A;  4OWW B;  3CCQ A;  1C0A A;  1KHI A;  1S5B D;  4OIJ A;  1I4R A;  3CAM A;  3GD7 A;  4LK1 C;  3RN5 A;  2D0O A;  2MGS A;  1TR5 A;  2K32 A;  3K7U C;  4QL5 A;  3J80 c;  2OTJ A;  3GTQ H;  1BR9 A;  1X32 A;  3D8G A;  4LF9 Q;  4L5R C;  2EY2 A;  2CCZ A;  3V05 A;  1K8O A;  3A55 A;  2XWJ B;  2B8G A;  1EY7 A;  1CI3 M;  1XNQ Q;  3L3O C;  2HD3 A;  3IFD A;  3PUV A;  5DNF A;  2BDN A;  4KY7 A;  3CD6 A;  1H95 A;  3FVQ A;  1HUN A;  3S14 B;  2VB2 X;  1H9M A;  3U4V A;  3CQZ B;  1Z7T A;  2HT1 A;  5E7N A;  5M9O A;  1TKW B;  1JT8 A;  2WIN B;  2JEB I;  4A3K G;  4L5S A;  4IO9 A;  5FK9 C;  3LNN A;  3PF4 A;  3TS0 A;  2CQA A;  2GN5 A;  1N33 Q;  3S14 H;  1Y1W B;  3CQZ H;  3I3C A;  1RTO A;  2HIV A;  2IW3 A;  4Y7N B;  3MXU A;  1OXX K;  1KLU D;  3T13 A;  3K8A A;  1STH A;  2EYM A;  2EDG A;  1EYA A;  2JK8 A;  3D31 A;  3MXP A;  2F0K A;  3H94 A;  1X3E A;  3ULL A;  1Y1W H;  4A3D G;  2K5V A;  4A4I A;  3A7A B;  2LSS A;  5JEA G;  2VQE L;  1X3G A;  3CRL C;  1ROD A;  2ZXP A;  3MFY A;  3Q8D A;  3NSW A;  1JB7 A;  4Y7N H;  2DNE A;  5E4W C;  5EKI A;  5ELO A;  1PDQ A;  4ME3 A;  3P1H A;  1GOZ A;  1BCP B;  4XYQ A;  5FJ8 G;  1KL9 A;  1EYC A;  3MHB A;  4AYB G;  1WD1 A;  3AEV A;  2KCN A;  3CC4 A;  4LFA Q;  1KNE A;  3KDF A;  4BA1 I;  1U9R A;  4GKJ L;  3H3V C;  2Z9H A;  2D5D A;  2EY6 A;  3DXJ C;  1FNU A;  4ZQ3 A;  1IL2 A;  2D9U A;  2NYZ D;  3EFX D;  3K57 A;  1C9O A;  1VQD A;  4I7Z C;  1A2T A;  1TS4 A;  4NW2 A;  2K75 A;  1CQF A;  2EIF A;  3CHB D;  4HTH A;  3X3N A;  1JR0 D;  4K5X A;  3W1B A;  3CCJ A;  1S5D D;  1GKH A;  3G71 A;  4NP5 A;  2F0U A;  2JA5 B;  3JAM c;  1G91 A;  3KLS X;  4JCV E;  3J80 E;  4XXE A;  1EIY B;  3HKZ B;  2NN6 I;  4JI2 Q;  1IZ6 A;  1NAP A;  1RHP A;  4DXG A;  2VUM B;  2VNU D;  2QEJ C;  1PH1 A;  2JA5 H;  1LUZ A;  4F88 A;  1TS3 A;  3HG9 A;  3I55 A;  2KOL A;  4YWL A;  2OEO A;  3U58 A;  1KXL A;  1I6H B;  1C7Y A;  2F4I A;  3I4N B;  4KN7 C;  2MQH A;  2B63 H;  2KQ3 A;  4X3U A;  1X9N A;  1EUJ A;  1VQK A;  5T1G A;  4CGY B;  4DR5 L;  2VUM H;  4S3S A;  4KD3 A;  4KJN A;  1G51 A;  4HJ8 A;  1Y8N B;  2F0P A;  1VMP A;  4KV6 A;  1V8Q A;  4QGU A;  3PCO B;  1I6H H;  5H1S E;  3I4N H;  3K80 C;  4AH6 A;  2SOB A;  3L9A X;  1WOC A;  1SYF A;  2B63 G;  5JJZ A;  3GTG B;  1J6Q A;  1FGU A;  2A1A A;  5LL6 X;  5J39 A;  3F2B A;  1BCP F;  1EU4 A;  4R4T A;  4IOA A;  1DCZ A;  1K9M C;  1MSH A;  4CDC C;  1YVC A;  3NBH A;  3C3L A;  1VMC A;  2O5I C;  4C3H B;  2ZJQ A;  3SK8 A;  4FDB A;  4UP7 A;  3RMH A;  1HUM A;  4TQU S;  1CT1 D;  2K4K A;  3GTG H;  3GTM B;  4NXM L;  1IW7 D;  2K5D A;  4B3S Q;  4JYA Q;  4JI4 Q;  4C3H H;  4EQP A;  4RGM A;  3HKZ E;  5FO8 B;  2SEB D;  2F0F A;  2MO1 A;  1SNP A;  2RDF A;  4K8I A;  5FO9 B;  2UXB Q;  5G3L F;  2M00 A;  4A3C G;  3GTM H;  1SNC A;  2IX1 A;  3H3V I;  1YHB A;  3HOU B;  1B53 A;  5M3M G;  4V19 0;  1QB5 D;  1PRT D;  4GZY C;  2EOT A;  5IWA Q;  1BKB A;  4M1U B;  1BOS A;  1XMQ L;  3ICE A;  2JA8 G;  4TKO B;  1AE2 A;  4KHV A;  5HGQ A;  1L1O C;  5T1I A;  3HOU H;  5CV9 A;  1PTO D;  2ZXO A;  5JAV A;  2F0I A;  1WFQ A;  1A62 A;  1F2L A;  1LTL A;  4HJA A;  3NWT A;  3DUZ A;  3KBX A;  3MTS A;  4BBS G;  3R3O A;  2K5Q A;  2K14 A;  2UXC L;  1IL8 A;  5F2D A;  4JI8 Q;  5KNC A;  4WJ4 A;  4I65 A;  1VQ9 A;  5C5M A;  4JPB W;  3JAM E;  3KJP A;  2RF4 A;  4LUV A;  3D4D A;  1E22 A;  1SSO A;  1Q90 A;  2BH8 A;  1NMF A;  4A3F B;  4CKC A;  5C3W A;  2B2U C;  1OO9 B;  3TBI B;  2L12 A;  5EPJ A;  1YJ9 A;  4DR6 L;  1LTB D;  3RUZ A;  4HN7 A;  4DGZ A;  1CZW A;  3N52 A;  1VQ6 A;  5IGF A;  1IBK Q;  1EY5 A;  3CMA A;  4A3F H;  1EIG A;  2WV6 D;  4EGV A;  1Q8K A;  4ID6 A;  2L11 A;  2ENB A;  1V1O A;  1YNJ D;  1FVI A;  2XTI A;  2RSN A;  3D6W A;  3ER0 A;  1B50 A;  1VQM A;  5EGT A;  2KEE A;  3R2T A;  3MEF A;  2LXK A;  2Q8I B;  3KLS A;  5CV6 A;  3MA2 B;  3OWF A;  1NMG A;  2I5H A;  1FJG Q;  1KTK A;  5C4X G;  2CWP A;  1S5F D;  2WKD A;  3VR2 A;  1EWC A;  1B2T A;  2QCP X;  4C3J B;  3FPP A;  1C48 A;  1D5M C;  1SJE D;  3VR4 A;  1IBL L;  4JBM A;  2Z4H A;  2N55 A;  2B39 A;  1XNR Q;  3BU2 A;  4JV5 Q;  2AQ2 B;  3M85 A;  1GUO A;  2NZ1 D;  1B8A A;  5DM7 3;  1ML0 D;  2SDF A;  1N33 L;  4HJ5 A;  1VQG A;  4OON A;  2F0E A;  4PMB A;  5GAG C;  4IPC A;  2OXP A;  4C3J H;  2XSC A;  2HIX A;  3MXN B;  2K04 A;  4IQZ A;  2HQL A;  3ITP A;  5DAU A;  4DA2 A;  1WTO A;  3OW7 A;  1N34 L;  5ELE A;  4DUZ Q;  2EYP A;  2O2L D;  4QF4 A;  2GVB A;  1SYD A;  2VQF L;  2HQE A;  2KED A;  2B3G A;  3I7F A;  1HFN A;  1LT4 D;  1VQI A;  4RG1 A;  1PVO A;  1ZYR C;  1D5Z C;  3HKS A;  4MNO A;  1DOL A;  2UXD Q;  1F2Y A;  3CCV A;  1F9S A;  1O7Z A;  2XN9 C;  4LF6 Q;  3KDF B;  4GN5 A;  4APV A;  1ESR A;  4HCE A;  4ZRZ A;  4H0L C;  1BQQ T;  1UEB A;  1SFO B;  4O0A A;  4I7A A;  4LFA L;  1D1I A;  3QOL A;  2Z4I A;  2PI2 E;  1Y1V G;  4LNQ A;  3U50 C;  1JE4 A;  2CWA A;  1HPC A;  2DGY A;  3FRP B;  4HJ9 A;  1I4H A;  5ELC A;  1SE8 A;  1T5E A;  5IP9 G;  3PIO A;  2CKZ B;  3KOJ A;  2N49 A;  1SFO H;  2QGQ A;  1LTG D;  2K52 A;  4PQX A;  4P71 A;  4JC0 A;  3DM1 A;  3EVQ A;  1VQC A;  1ZEQ X;  5KRU A;  3FHW A;  5DEH A;  1DGS A;  1KQS A;  5LL6 S;  5JOB A;  3VR5 A;  1SYG A;  2UU9 Q;  4OXP A;  1BCP C;  1OXT A;  5C0X G;  2BCO A;  4A3M B;  3U9O A;  2F0Q A;  1XPU A;  3HOZ B;  1HJP A;  3V2T A;  5IGG A;  3LGJ A;  1WYD A;  3T1Y L;  2KHI A;  4JI2 L;  1TY2 A;  2IL8 A;  1HFG A;  3PO3 B;  1WCM G;  1HCZ A;  4A3M H;  4GN3 B;  3Q22 A;  4L6T B;  5C3X A;  2R93 B;  3M7G A;  3HOZ H;  2H4O A;  3I70 A;  2PW7 A;  1EFW A;  1RIP A;  3K5L A;  3S15 B;  1E1T A;  3CP0 A;  1DXM A;  1HR0 L;  3HOY B;  1SRO A;  2EJG C;  3TP8 A;  2ZT9 C;  2YV5 A;  4DR4 Q;  1BBW A;  2SNS A;  4PZ8 A;  4YHH Q;  3PO3 H;  1SND A;  2PO4 A;  4F7X A;  4PZ7 A;  1L0X B;  3ONA B;  2EPB A;  2A68 C;  2R93 H;  2EY5 A;  1AZQ A;  4IUN A;  2E5L Q;  3S1R B;  3VR3 A;  3S15 H;  1HNW L;  2F3I A;  1I5F A;  3HOY H;  1O78 A;  4OO1 H;  2IY5 B;  2JQO A;  4IJL A;  4L63 B;  4NB3 A;  5FLM H;  4XDX A;  4C56 C;  1D6E C;  5A35 A;  1A6X A;  1PHJ A;  1YBY A;  4HAE A;  4QIW B;  4BWG B;  1VDZ A;  3S1R H;  3GTL B;  2F0W A;  3FMC A;  4GKK L;  1F9R A;  4MTN A;  3NP8 A;  3NPP A;  2K5N A;  2R7Z G;  5IYD H;  4FVM A;  4HMJ A;  1B1Z A;  4B3S L;  4O2D A;  1YZ6 A;  2TSS A;  4JI4 L;  3EA6 A;  2UUC Q;  3T56 B;  1V1P A;  1X3F A;  5CV7 A;  3GTL H;  4RAU C;  3MC0 B;  2UXB L;  3TEH B;  5CBE E;  2F0T A;  4KMU C;  3PIP A;  4BY7 H;  1Q1B A;  1S5E D;  1TY0 A;  3VR6 A;  3NTK A;  2KCC A;  1SNM A;  4DN4 M;  3CCL A;  3MAQ A;  3S17 B;  1P16 A;  4K6L A;  2R6G A;  4DV0 Q;  5IP7 H;  1XMO L;  1BNZ A;  1LAC A;  3BDC A;  5E3F A;  3T16 A;  4BS9 A;  4A93 B;  1E3P A;  3WOF A;  1DJR D;  1E2W A;  4MZ9 A;  1QUQ B;  5ELN A;  4X3K A;  4X6A H;  1GUN A;  2EYO A;  3BZC A;  4G7H C;  3PMF A;  1K0R A;  2HDM A;  3ERS X;  3I56 A;  3S17 H;  1HNX L;  3I90 A;  4DV6 L;  2WB1 B;  2I5M X;  4F8M A;  5I4D A;  3J7Z C;  2QDL A;  3K5O A;  4JBW A;  5GAD C;  1JJ2 A;  4ZK9 B;  4A93 H;  2JA7 G;  1HA5 A;  3RZD B;  1F2M A;  1UE5 A;  3AU7 A;  4QIW E;  1PH9 A;  2NZH A;  3CPW A;  3AMU A;  4MN3 A;  1R9T B;  3GDE A;  4IFD G;  4C1N I;  1XPO A;  4J6H A;  3QB3 A;  4NDX A;  2A73 B;  1UE6 A;  5COY A;  3PO2 H;  1MJC A;  1UE7 A;  3VA7 A;  2WAQ G;  3RZD H;  4LF7 Q;  5EPL A;  3NEM A;  4KKU A;  2D62 A;  4H7B A; 
#chains in the Genus database with same CATH homology
 1E2V A;  2F0V A;  4RFB A;  3OPO A;  1KAB A;  4X3T A;  1EY0 A;  1LTT D;  1JOQ A;  3MXG A;  5K5P A;  1STG A;  1DON A;  4QMG A;  3DWQ A;  4FP5 D;  4A3K B;  2N88 A;  3CKI B;  3BYY B;  1J8I A;  1M8A A;  2RDH A;  3NTI A;  3O13 A;  4IUV A;  3H91 A;  3J7Y W;  3GTJ B;  5FO7 B;  4RKB A;  4C2M B;  3BG3 A;  2L0C A;  1TWF B;  3CRK C;  4A3D B;  3C46 A;  1NCV A;  5KYI A;  2E74 C;  1E2Z A;  4XQJ A;  2PNR C;  1WTV A;  3LX0 A;  1PFM A;  3DWA A;  5K36 G;  1LLR D;  3M7N A;  3WDN A;  1W6K A;  1Y69 U;  1GJX A;  2RBM A;  4AYB B;  2X69 A;  3HGB A;  4HED A;  3NTH A;  3I8Z A;  5JEA H;  1HRJ A;  1SEB D;  4FF3 A;  1HXY D;  4OHJ A;  3T51 B;  3MXN A;  2Z8L A;  1CA5 A;  2L1B A;  3P20 A;  3FPU B;  2PQE A;  2BE5 C;  3NE5 B;  2F0G A;  3VYR A;  4G4K A;  1YNN C;  2RA4 A;  2CVR A;  1AFP A;  1RCV D;  1UAP A;  3MZ5 A;  1LT3 D;  4ZUI A;  3G7L A;  1H9R A;  4FO2 A;  1B9N A;  3I91 A;  1EZ6 A;  5JVH 3;  4XTC S;  1LO5 D;  2XRQ D;  3RLF A;  3NUC A;  1XYI A;  1LTA D;  2K5W A;  4N9T A;  4IUP A;  5C4H A;  4K6D A;  2PPB C;  1LV9 A;  5EPK A;  2IWH A;  1SMY C;  3QG1 A;  4OIK A;  4PNY A;  4J8Q A;  1PTO B;  4IUT A;  1Z6H A;  4HR7 B;  3SE0 A;  5HGT A;  2B63 B;  5EKK A;  5LHY 1;  2G9H D;  4DAV A;  2EYJ A;  3R93 A;  2LMC B;  4ZYS A;  4ULL A;  2IX0 A;  5DM6 3;  3Q6S A;  1PTO H;  1JQY D;  1TS5 A;  5ELF A;  3GV6 A;  1EL0 A;  1HTL D;  1STE A;  3HZX A;  2BA0 A;  3LWU A;  1ZYR D;  4RCN A;  5C4Z A;  4K2L A;  4CHT B;  2F3V A;  2IX3 A;  4ABN A;  4XT1 B;  1TU2 B;  5BN3 A;  5KEE A;  1XWE A;  1AP0 A;  2B2W A;  3V96 A;  2IPK D;  3K7A B;  5M3M B;  2G9D A;  4HMI A;  2F0H A;  1KDC A;  1V1P B;  1I4G A;  2JA8 B;  1R4P B;  5CGK A;  1BXT A;  3BYT B;  1R4Q B;  2B8F A;  5IGB A;  1KLG D;  3VYT A;  2A6H C;  2BA1 A;  2D2C C;  2AWN A;  3H09 A;  5IGD A;  2RVL A;  1QCB D;  2FHT A;  2E2I B;  2K03 A;  1F9Q A;  1TS2 A;  2AUJ D;  4BBS B;  3D6C A;  3E5S A;  5JPM C;  5TSS A;  1BCP D;  1BDO A;  2B2V A;  3DHQ A;  1MSG A;  2AWO A;  2JP1 A;  1SAP A;  2KVM A;  4UDU C;  3NK9 A;  2R3Z A;  3SDZ A;  5J22 A;  1QG7 A;  2FIN B;  1MBY A;  3DMU A;  2EE1 A;  1JOO A;  4N9P A;  3BDO A;  4ODG A;  1FNW A;  5G3L D;  1FNV A;  2F03 A;  1EZ8 A;  4KK7 A;  3G6J B;  5I2Y A;  1DYQ A;  1WTX A;  1II3 A;  1DZ1 A;  4HCS A;  2QDB A;  2CW0 D;  2DN8 A;  1G6Z A;  1HQR D;  5D3I B;  1TVX A;  2NVT B;  2JE6 I;  3OMC A;  5C4X B;  1EEF D;  1JWM D;  3S2H B;  2ICI A;  1HHV A;  3LWE A;  3M4O B;  2X6G A;  1ENF A;  2B2Y A;  4B9W A;  1SBB B;  1EQV A;  2EVB A;  1S5C D;  2A6E C;  1G8Z D;  5C6A A;  2A69 C;  2A5H A;  2EYF A;  2NB0 A;  3MWY W;  1U4L A;  3ND9 A;  2SNM A;  1PLF A;  3J7A F;  1PZJ D;  3NQI A;  4QUF A;  3TP7 A;  2ICE C;  1FYC A;  1DM0 B;  2L9H A;  1K8M A;  4H44 C;  4LJZ C;  3N6R A;  2EYL A;  4TRD A;  2NBF A;  4OO1 I;  1ILP A;  1G2T A;  1E0B A;  2LS0 1;  3C1F A;  3HS0 C;  4C3I G;  2NN6 G;  1JCK B;  5D14 A;  3H6M A;  4R8I A;  5E4X A;  2J4X A;  3IAY A;  2R61 A;  2XNA C;  1K83 B;  1B44 D;  4IUU A;  5KGU A;  1KAA A;  3S1Q B;  1MI2 A;  1KDB A;  4BA2 I;  1I4P A;  1EOT A;  4UAI A;  2K01 A;  1Y1V B;  3PIP 3;  3TDQ A;  4RCO A;  1WTQ A;  1Q12 A;  3DEO A;  3L7Z C;  3BVM A;  1ENC A;  1WTR A;  1KNA A;  3KLR A;  3QIA A;  4YIJ A;  4KKS A;  1I3Q B;  3R2I A;  5C4J B;  2DNC A;  3A54 A;  3NBI A;  4EQO A;  2EZV A;  3TP6 A;  1OXS C;  1HQM C;  3A8J E;  3SXH A;  2NVX B;  5C0X H;  1WCM B;  4B9X A;  3S16 B;  2PZT A;  3KF8 A;  1O80 A;  1CA6 A;  3NXW A;  3PV0 A;  3M4Y A;  2EY1 A;  4V0B A;  2VXW A;  3NHH A;  1IW7 C;  3BDL A;  4J1M A;  2MJ8 A;  4CJ0 B;  4M8A A;  5A2Q L;  2AQ1 B;  2F0L A;  2HUG A;  5I9P A;  5EJW A;  4FXK C;  1PFN A;  5KND A;  3W2D A;  3TZU A;  1TWG B;  1QWY A;  3GTO B;  1EU3 A;  4OL7 A;  1CHP D;  1NSN S;  1I4X A;  4XYO A;  2RDG A;  2R7Z B;  1CHQ D;  4XIG S;  1PMR A;  2X6L A;  4DK1 A;  4FXD A;  1A15 A;  2BE5 D;  3J81 L;  1PTO C;  4ME5 A;  2NTS A;  1RTN A;  1WTW A;  2BDO A;  5IOD A;  1YNN D;  2MUY A;  4P2C B;  2K7V A;  2FMC A;  2C9O A;  5COR A;  5IIF A;  1LAB A;  1VF7 A;  1UNS A;  1V43 A;  4IUQ A;  1IKL A;  1L0Y B;  4BY7 B;  1Z47 A;  4DF7 A;  2HCI A;  2J7Z A;  4K2K A;  1SDF A;  1BBX C;  2OT2 A;  2B2T A;  1EEI D;  4DNT B;  2FMM A;  3ND8 A;  1UEA B;  5IT9 L;  5M5Y B;  2JA7 B;  3SK5 A;  1PZK D;  2F1M A;  1RKN A;  2LY7 A;  3QO2 A;  3TSS A;  2PCF B;  5CBA E;  2B2T C;  2WAQ B;  4RGO S;  4K5W A;  5C5L A;  4CBV A;  2F0S A;  3A56 A;  3QOJ A;  4QB4 A;  2LFN A;  1EFI D;  2M2L A;  3D4W A;  1RD9 D;  5D3D A;  4IFD H;  1QOH A;  2NVY B;  2KEC A;  1Q8I A;  2A74 C;  3PO2 B;  4Q0F A;  3PUX A;  5EKL A;  1GXD C;  5IGC A;  3GP7 A;  4NKL A;  5M5W B;  4FXG C;  1Q1E A;  2PZU A;  2R92 B;  1A3V A;  1PFB A;  2PYK A;  4DNR B;  1STA A;  1Y8O B;  1EY9 A;  1W6J A;  1NUC A;  5FOB B;  5FLX L;  1I6V C;  1SJH D;  1X3Q A;  5FKA C;  4WRD A;  5CYU A;  3VA5 A;  2GA4 B;  1A3T A;  1QE6 A;  1U4R A;  4RGT A;  1XTC D;  3WOE A;  5JVG 3;  3K0Y A;  2QKI C;  3BVG A;  3I73 A;  5NUC A;  3MEH A;  4NMZ A;  2F0D A;  5ELB A;  1QIL A;  2PMZ B;  5K36 H;  1XXG A;  1GUT A;  1LTS D;  5I2X A;  2C5C A;  2L5T A;  4IN3 A;  1SE2 A;  1Q3L A;  1ENA A;  2WII B;  4KI0 A;  3VYS A;  5I6Y A;  1DOM A;  2OF1 A;  3E6Z X;  3K6O A;  2DY7 A;  4BY1 B;  2K1B A;  1PYW D;  4IZ8 A;  3SK6 A;  3M3Y B;  3EJI A;  3BVZ A;  2EJM A;  3TP5 A;  2IJ0 A;  1JIC A;  3A8I E;  3PUZ A;  4CKE A;  3Q0A A;  4R8N A;  1IHZ A;  1ONL A;  2IT1 A;  3SEB A;  5E1F A;  5JEA J;  4U67 3;  1F77 A;  2TMP A;  3Q23 A;  1JOR A;  4FYD A;  1TT2 A;  1CFM A;  4X3S A;  2KJX A;  1QNK A;  2A6E D;  1BF4 A;  2A69 D;  1LTR D;  4RHS A;  3SK4 A;  2HCC A;  3C1E A;  4RA8 A;  2Q8T A;  3QJY A;  2WP8 J;  1IYV A;  2F0J A;  3SVM A;  1PRT B;  4A3J B;  1C4Q A;  2E2H B;  2H1E A;  5KIX A;  4JK1 C;  1FGB D;  3A8K E;  4KHZ A;  1UUP A;  4B08 A;  4L8J A;  1SE4 A;  2E75 C;  4EQN A;  2RKS A;  1U4M A;  2V4D A;  1SE3 A;  3GTP B;  3BS1 A;  1WTP A;  1ILQ A;  1LTI D;  3IL8 A;  4E6I A;  4U68 A;  1FD7 D;  3IFT A;  4RHR A;  1FR3 A;  4A3I B;  3AB9 A;  4KD4 A;  5A2Q E;  3U9S A;  1LT5 D;  5CV5 A;  2XVS A;  4FNF A;  4ZAI A;  5KYL A;  1EY4 A;  3GV3 A;  1ESF A;  1U4P A;  2F0N A;  4LAA A;  4RWS C;  3J81 E;  2JA6 B;  3S1N B;  1JWS D;  1CZG A;  4KTA A;  3ERO A;  4ZLT F;  3K59 A;  3FKI B;  1BO0 A;  4KJO A;  4KY5 A;  2E2J B;  2Q8R E;  1ET9 A;  1D1K A;  2VB3 X;  1LT6 D;  2JYO A;  3QWN A;  1D2B A;  4WFN 3;  2XWB B;  5CR3 A;  4PMC A;  2NTT A;  5HUR A;  2B2W C;  3ERQ A;  4HSP A;  4PV1 C;  1AN8 A;  3FDT A;  1PRT F;  4G7O C;  2EJF C;  4IAL A;  3RD4 A;  4F87 A;  3GO5 A;  1F2Z A;  2HDL A;  1STB A;  1PTO F;  5IT9 E;  5M3F B;  4EVO A;  2WKC A;  2J0T D;  1GHK A;  4RKL A;  1PXU A;  1RJT A;  1EYD A;  1SYE A;  1CK1 A;  3UI2 A;  3TN2 A;  3PIO 3;  2B2V C;  3I4L A;  1OXV A;  2I46 A;  3NWS A;  5C0X I;  3KBG A;  4XT3 B;  4C3H G;  5C44 B;  2NUC A;  3P75 A;  2WAC A;  1QJO A;  2F0O A;  1H9S B;  2A68 D;  5IGE A;  1B9M A;  4MHE A;  5D65 A;  4FF2 A;  2B2U A;  4FF1 A;  3I4M B;  4WJW A;  1JC7 A;  4K5V A;  1A2U A;  2AUK A;  1STY A;  4DFA A;  1EQT A;  2QF7 A;  3DEP A;  4FF4 A;  1HTP A;  1NR4 A;  1H9K A;  3CU7 A;  2ZXR A;  2L4N A;  3C2P A;  1H9J A;  1ZKO A;  3HOW B;  4DAP A;  3OOC A;  4C3I B;  1TII D;  4G57 A;  1Y8P B;  4ZKB B;  5FLX E;  4R9W A;  1B3A A;  1O7L A;  4DU9 A;  2Z1C A;  1SXT A;  1GUW A;  2MPM A;  2NN6 H;  3HOX B;  4DXF A;  4KY6 A;  5KNB A;  1MGS A;  1G2S A;  2AQ3 B;  2B2Y C;  3J7A V;  1O7Y A;  4DAY A;  2O5J C;  5EQ0 A;  2PZW A;  2RQX A;  4MIU A;  4G7Z C;  2JSO A;  5J1Z A;  1OXU A;  3TZD A;  5IOC A;  3T53 B;  3OSO A;  1JWU D;  2K6A A;  2YU9 B;  3OHX C;  5I9O A;  2K05 A;  1EWH A;  3IKJ A;  1MD2 D;  4K8J A;  3BZD B;  5M5X B;  1NR2 A;  2EXZ A;  1I4Q A;  1STN A;  2XRS D;  3Q24 A;  4OGQ C;  1A3U A;  3HP3 A;  1RDP D;  3T4A C;  3R8B A;  4C1N K;  2RSO A;  3TME A;  1ET6 A;  4Z9C B;  2M9V A;  4C3J G;  1SNQ A;  3W3A A;  1TWC B;  1CTM A;  1CQV A;  3GQB A;  4K14 A;  4IFD I;  1ZXT A;  3RZO B;  1AW7 A;  1J9O A;  3SR1 A;  1KDA A;  3KUP A;  4IUR A;  3VYU A;  3D4R A;  4LMQ D;  4ZKC B;  1WVL A;  2I07 B;  3S9W A;  4O42 A;  4RH6 A;  5CV4 A;  2MP1 A;  1XX8 A;  4O1N A;  5C0X J;  3FEW X;  4A3B B;  1TWH B;  1D5X C;  1I50 B;  2L55 A;  3A7L A;  1TWA B;  1B4O A;  4HSV A;  2K28 A;  2LKV A;  2KA7 A;  1AEX A;  1WD0 A;  3J80 L;  4RGN A;  4DK0 A;  2NVQ B;  1PRT C;  5ISR A;  1G29 1;  5BN5 A;  1X3P A;  4TSS A;  1GHJ A;  3F2U A;  2O4X A;  2Y0S B;  1HA6 A;  4A3G B;  3NQT A;  3K5N A;  2JEA I;  1IKM A;  3MFG A;  2PW5 A;  5EBD A;  2F3W A;  5I6W A;  3K5M A;  1GUG A;  1SYB A;  2EYH A;  4XQN A;  3ZYY X;  2JXM B;  1M4V A;  1GUS A;  3OMG A;  1F9P A;  5AFW A;  3S2D B;  1DD2 A;  4A3E B;  4XQQ A;  1PZI D;  3S1M B;  4CJ2 C;  2CW0 C;  3K58 A;  5BN4 A;  4PMW A;  2BOS A;  1SNO A;  2ID0 A;  4BBR B;  1ICW A;  5EBC A;  1SMY D;  3H0G B;  3MVV A;  1EY8 A;  3I72 A;  2DY8 A;  2FFK B;  4OO1 G;  2MHV A;  3SHL A;  2XIW A;  1YNJ C;  3HRZ C;  3GTK B;  1QNU A;  2NWG A;  2E76 C;  3HOV B;  4QCL A;  1VCI A;  2QIL A;  4CKB A;  2FJ2 A;  4H13 C;  1VF5 C;  3EQL C;  4ILW A;  1RF2 D;  5CMD A;  2CHB D;  4Q5V A;  3D3R A;  1AZP A;  5CV8 A;  3E0J A;  1S4Z A;  5CC4 A;  2E2D C;  3OWE B;  3PUW A;  3DWP A;  1JOK A;  5ELD A;  1JB3 A;  3PUY A;  3OIP A;  1DOK A;  3URY A;  3KK7 A;  1BUV T;  5JPN C;  4QUC A;  4KN4 C;  1EY6 A;  1H9S A;  3X3M A;  3JAM L;  4IFD J;  4KKT A;  1C8C A;  4CJ1 B;  3P7J A;  4ZUJ A;  4WOR A;  1EIH A;  1CM9 A;  5C3E B;  3HEJ A;  1T5X D;  1IYU A;  1TQO A;  2A6H D;  2KUM A;  3OIQ A;  3GTQ B;  2K33 A;  2F0M A;  1SYC A;  2KHS A;  2YYZ A;  1S5B D;  4OIJ A;  1I4R A;  3GD7 A;  4LK1 C;  2MGS A;  1TR5 A;  2K32 A;  1BR9 A;  1X32 A;  3D8G A;  2EY2 A;  3V05 A;  1K8O A;  3A55 A;  2XWJ B;  2B8G A;  1EY7 A;  1CI3 M;  3L3O C;  3IFD A;  3PUV A;  5DNF A;  2BDN A;  4KY7 A;  3FVQ A;  1HUN A;  3S14 B;  2VB2 X;  1H9M A;  3CQZ B;  1Z7T A;  5M9O A;  1TKW B;  2WIN B;  2JEB I;  5FK9 C;  3LNN A;  2CQA A;  1Y1W B;  3I3C A;  1RTO A;  2IW3 A;  4Y7N B;  3MXU A;  1OXX K;  1KLU D;  3T13 A;  1STH A;  2EYM A;  2EDG A;  1EYA A;  3D31 A;  3MXP A;  2F0K A;  3H94 A;  3A7A B;  5JEA G;  3CRL C;  1ROD A;  2ZXP A;  3MFY A;  3NSW A;  2DNE A;  5E4W C;  5EKI A;  1PDQ A;  3P1H A;  1GOZ A;  1BCP B;  4XYQ A;  1EYC A;  3MHB A;  1WD1 A;  2KCN A;  1KNE A;  4BA1 I;  1U9R A;  3H3V C;  2D5D A;  2EY6 A;  3DXJ C;  1FNU A;  4ZQ3 A;  2D9U A;  2NYZ D;  3EFX D;  3K57 A;  4I7Z C;  1A2T A;  1TS4 A;  4NW2 A;  1CQF A;  3X3N A;  3CHB D;  4HTH A;  1JR0 D;  4K5X A;  1S5D D;  4NP5 A;  2F0U A;  2JA5 B;  1G91 A;  3KLS X;  3J80 E;  4XXE A;  3HKZ B;  2NN6 I;  1NAP A;  1RHP A;  4DXG A;  2VUM B;  2VNU D;  2QEJ C;  4F88 A;  1TS3 A;  3HG9 A;  2KOL A;  2OEO A;  1I6H B;  2F4I A;  3I4N B;  4KN7 C;  2KQ3 A;  4X3U A;  5T1G A;  4CGY B;  4S3S A;  4KD3 A;  4KJN A;  1Y8N B;  2F0P A;  1VMP A;  4KV6 A;  1V8Q A;  2SOB A;  3L9A X;  1SYF A;  5JJZ A;  3GTG B;  5LL6 X;  5J39 A;  1BCP F;  1EU4 A;  1DCZ A;  1MSH A;  3NBH A;  3C3L A;  1VMC A;  2O5I C;  4C3H B;  3SK8 A;  3RMH A;  1HUM A;  4TQU S;  1CT1 D;  3GTM B;  1IW7 D;  2K5D A;  4EQP A;  4RGM A;  5FO8 B;  2SEB D;  2F0F A;  1SNP A;  2RDF A;  4K8I A;  5FO9 B;  5G3L F;  2M00 A;  1SNC A;  2IX1 A;  3HOU B;  1B53 A;  4V19 0;  1QB5 D;  1PRT D;  4GZY C;  2EOT A;  4M1U B;  1BOS A;  4TKO B;  4KHV A;  5T1I A;  5CV9 A;  1PTO D;  2ZXO A;  5JAV A;  2F0I A;  1F2L A;  3NWT A;  3DUZ A;  3KBX A;  3MTS A;  3R3O A;  2K5Q A;  1IL8 A;  5F2D A;  5KNC A;  4I65 A;  5C5M A;  3JAM E;  3D4D A;  1SSO A;  1Q90 A;  4A3F B;  4CKC A;  5C3W A;  2B2U C;  1OO9 B;  3TBI B;  2L12 A;  5EPJ A;  1LTB D;  3RUZ A;  4HN7 A;  4DGZ A;  1CZW A;  3N52 A;  5IGF A;  1EY5 A;  1EIG A;  2WV6 D;  4EGV A;  4ID6 A;  2L11 A;  2ENB A;  1V1O A;  1YNJ D;  2RSN A;  3D6W A;  1B50 A;  5EGT A;  2KEE A;  3R2T A;  2Q8I B;  3KLS A;  5CV6 A;  3MA2 B;  3OWF A;  1KTK A;  1S5F D;  2WKD A;  3VR2 A;  1EWC A;  1B2T A;  4C3J B;  2QCP X;  3FPP A;  1C48 A;  1D5M C;  1SJE D;  3VR4 A;  2Z4H A;  2N55 A;  2B39 A;  2AQ2 B;  3M85 A;  1GUO A;  2NZ1 D;  5DM7 3;  1ML0 D;  2SDF A;  2F0E A;  4PMB A;  2OXP A;  2XSC A;  4DA2 A;  1WTO A;  2K04 A;  4IQZ A;  3ITP A;  5DAU A;  3OW7 A;  5ELE A;  2EYP A;  2O2L D;  4QF4 A;  1SYD A;  2HQE A;  2KED A;  1HFN A;  1LT4 D;  1ZYR C;  1D5Z C;  1DOL A;  1F2Y A;  1F9S A;  1O7Z A;  2XN9 C;  1ESR A;  4HCE A;  4ZRZ A;  4H0L C;  1BQQ T;  1SFO B;  1D1I A;  3QOL A;  2Z4I A;  1JE4 A;  1HPC A;  3FRP B;  1I4H A;  5ELC A;  1T5E A;  1LTG D;  4PQX A;  3DM1 A;  3EVQ A;  1ZEQ X;  5KRU A;  5DEH A;  5LL6 S;  5JOB A;  3VR5 A;  1SYG A;  1BCP C;  1OXT A;  5C0X G;  2BCO A;  4A3M B;  3U9O A;  2F0Q A;  3HOZ B;  3V2T A;  5IGG A;  1TY2 A;  2IL8 A;  1HFG A;  3PO3 B;  1HCZ A;  3Q22 A;  4L6T B;  5C3X A;  2R93 B;  3M7G A;  2H4O A;  3I70 A;  2PW7 A;  3K5L A;  3S15 B;  1DXM A;  3HOY B;  2EJG C;  3TP8 A;  2ZT9 C;  2SNS A;  1SND A;  2PO4 A;  4F7X A;  1L0X B;  3ONA B;  2EPB A;  2A68 C;  2EY5 A;  1AZQ A;  4IUN A;  3S1R B;  3VR3 A;  1O78 A;  4OO1 H;  4L63 B;  4XDX A;  4C56 C;  1D6E C;  5A35 A;  1A6X A;  4HAE A;  4QIW B;  4BWG B;  1VDZ A;  3GTL B;  2F0W A;  3FMC A;  1F9R A;  3NP8 A;  3NPP A;  4FVM A;  4HMJ A;  1B1Z A;  2TSS A;  3EA6 A;  3T56 B;  1V1P A;  5CV7 A;  4RAU C;  3MC0 B;  5CBE E;  2F0T A;  4KMU C;  1Q1B A;  3VR6 A;  1S5E D;  1TY0 A;  3NTK A;  2KCC A;  1SNM A;  4DN4 M;  3MAQ A;  3S17 B;  4K6L A;  2R6G A;  1BNZ A;  1LAC A;  3T16 A;  3BDC A;  4BS9 A;  5E3F A;  4A93 B;  3WOF A;  1DJR D;  1E2W A;  4X3K A;  1GUN A;  2EYO A;  4G7H C;  3PMF A;  2HDM A;  3I90 A;  2WB1 B;  4F8M A;  5I4D A;  3K5O A;  4JBW A;  4ZK9 B;  1HA5 A;  3RZD B;  1F2M A;  3AU7 A;  3AMU A;  4MN3 A;  1R9T B;  4IFD G;  4C1N I;  4J6H A;  3QB3 A;  4NDX A;  2A73 B;  5COY A;  3VA7 A;  5EPL A;  4KKU A;  2D62 A;  4H7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...