3BDOA

Solution structure of apo-biotinyl domain from acetyl coenzyme a carboxylase of escherichia coli determined by triple-resonance nmr spectroscopy
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
82
structure length
82
Chain Sequence
AAEISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structures of apo and holo biotinyl domains from acetyl coenzyme A carboxylase of Escherichia coli determined by triple-resonance nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biotin
molecule keywords PROTEIN (ACETYL-COA CARBOXYLASE)
total genus 4
structure length 82
sequence length 82
ec nomenclature ec 6.4.1.2: Acetyl-CoA carboxylase.
pdb deposition date 1999-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bdoA00
1HPCA 2K33A 1OXVA 1PMRA 1OXTA 3CRLC 2E74C 1Q12A 4KKSA 4DK1A 2L5TA 3KLRA 1B9MA 1H9MA 2A68D 1O7LA 2E75C 4H13C 4H44C 5KNCA 1OXXK 5KNDA 2ZT9C 2BDOA 3PUVA 3U9SA 4DK0A 4KMUC 3VA7A 1OXUA 1GHKA 2EJGC 1Z7TA 1ZKOA 2B8GA 3VR5A 2EDGA 2DN8A 1ZYRC 3M7NA 1GUTA 1GUSA 1OXSC 2YYZA 3CRKC 2Q8IB 1VF7A 2IT1A 1FYCA 3A7LA 3VR3A 4RCNA 4OO1G 1A6XA 4KN4C 2AWOA 2NN6G 4KI0A 1VCIA 3ND8A 4HR7B 4OGQC 1IW7C 1G291 1VF5C 2K7VA 4DNRB 3I4LA 5JEAH 3T53B 4BA2I 1H9SA 2A6ED 2DNCA 3GQBA 2D5DA 3N6RA 1T5EA 1DCZA 4GZYC 3VR6A 3H94A 1Y8NB 1GUNA 3A8IE 4JK1C 3TZUA 2BE5C 3PUZA 3OOCA 2JXMB 4H0LC 3FPPA 1V43A 1TKWB 2LMCB 2O5IC 2AUKA 5K36G 2BA0A 4IQZA 2JE6I 4TQUS 3WDNA 3QJYA 2KA7A 2A68C 1K8OA 4LJZC 1IYUA 3MXUA 2CW0C 4OO1H 5KNBA 5C0XH 2BA1A 2NN6I 4L8JA 3SE0A 1H9KA 2EVBA 2A69C 1HCZA 2DNEA 1HQMC 3D31A 4PV1C 1IYVA 1H9RA 1B9NA 4DNTB 1LACA 4KKTA 4XIGS 3MFYA 3T56B 3GD7A 4KHZA 2KCCA 2QF7A 5A35A 3VR4A 3D4RA 4G7OC 3PUWA 2PPBC 1CI3M 1Y8PB 2A6HD 1O78A 1FR3A 2NN6H 1H9SB 4JBWA 1DXMA 2D62A 1E2ZA 3I72A 1SMYC 3L7ZC 3OW7A 1E2WA 5BN3A 2V4DA 4KN7C 5K36H 1VDZA 4G7HC 1V8QA 3W3AA 2JEAI 3IKJA 3QIAA 1YNJC 3SDZA 2JEBI 1YNNC 3P20A 3ND9A 2AUJD 4G7ZC 1CFMA 4IFDH 3DXJC 1TU2B 3PUXA 1Z6HA 3A8KE 4LK1C 3M4YA 1I6VC 2BE5D 1LABA 3EQLC 1Q90A 2B8FA 1BDOA 3A7AB 1HTPA 2A69D 2A6HC 3PV0A 5BN4A 1QJOA 1GJXA 3BDOA 3T51B 4I7ZC 1Q1EA 1GHJA 1IW7D 3A8JE 4KKUA 1CTMA 2O5JC 1Y69U 4BA1I 1ONLA 3RLFA 4TKOB 3FMCA 5BN5A 3IFTA 4IFDG 1DD2A 2E76C 3VR2A 1GUGA 2EJMA 3PUYA 2PCFB 3M85A 3AB9A 2D2CC 3HGBA 3I73A 5C0XG 1Y8OB 1K8MA 2EJFC 2A6EC 1GUOA 3LNNA 3QG1A 2F1MA 3BG3A 1H9JA 1EWHA 2R6GA 1Q1BA 3NE5B 4XTCS 2PNRC 5JEAG 1E2VA 3LWUA 3OPOA 2K32A
chains in the Genus database with same CATH superfamily
1MGSA 2UXCL 1Q12A 5JAVA 4ZK9B 1TWAB 2KCTA 2B2VC 1F9RA 3SK8A 3GTKB 1EY6A 1Y69U 2RKSA 2PZWA 4KMUC 4CKBA 5I4DA 2RDHA 4JI7L 2LS01 3OIQA 3F2CA 1CA6A 2PQEA 2F0KA 1TWHH 5I2XA 4DR1L 1TR5A 4OO1G 5IYDG 3Q22A 3W1GA 4NP5A 2WKDA 4YCWA 2UUAQ 1KDBA 1GOZA 4RA8A 1FJGQ 2OCEA 2XGTA 2HHHL 1WCMG 3C1FA 2GVBA 3UI2A 2IWHA 2A74C 3ULPA 3CQZH 3CCJA 1SEBD 5C3EG 3FPPA 2VB3X 1NUCA 5K36G 1YHBA 2EXDA 4UP9A 3T1YQ 3IRBA 2YTVA 4R8NA 3LWEA 3MXUA 3M3YH 2NN6I 3SR1A 1PZJD 4IUNA 4DV7L 2E2IB 2F0HA 5JVG3 2F0JA 2DY8A 3A5ZB 4HJAA 4BY1G 2OWOA 4DGZA 2UUCQ 3NEMA 1DOKA 1CI3M 1PRTD 1Y8PB 5CC4A 2GA4B 4BWGB 3K57A 2JP1A 4K0KQ 3PO3H 4FF1A 1E3PA 1TS5A 1ESRA 1YI2A 3E3XA 4NDXA 2EYHA 3OW7A 4X65L 3GTPB 1VMCA 4KN7C 1VDZA 4R4CA 4XQJA 4LF9Q 5JJLA 2Z9HA 5A2QL 4A3FG 3HG9A 3E9IA 1QCBD 4JC0A 2I5MX 4ZKCB 1CKOA 5CBEE 1X3EA 1HNZL 2PO4A 2R7FA 3M4YA 4ODGA 4L5TA 3BDOA 3BVMA 3PF4A 2OQ0A 2CQOA 4DV5Q 2ALYB 1EQQA 1K9MC 2HCCA 2MPMA 1CTMA 4IZ8A 1SNQA 3ICEA 4PMCA 1JICA 3OTOQ 4LF5L 4LFCQ 1GUGA 4C2MH 2JA8H 3NBHA 3AEVA 3M4OB 3K81C 1Q1BA 1EEID 1HJPA 1F9SA 2VXWA 2FMMA 1LT5D 1O7ZA 1EZ6A 1BQQT 5KNDA 2WV6D 1TWGB 1ESFA 3U9SA 4DK0A 5E3FA 2KCNA 3GO5A 4JI1L 4IPDA 4X3SA 1QNKA 3HOYG 4Y7NH 1GUTA 4DR7Q 4OX9Q 1KIXA 4XQQA 3MXNB 2WINB 4A3MH 2E2HH 3GQBA 3HFZB 4L5QA 3VR6A 3H94A 1PVOA 4UP7A 5IY0A 3TZUA 4AH6A 2FJ2A 1EZ8A 4DV3L 3BVZA 2NZHA 1F2MA 5IGCA 1AW7A 4RGTA 1O7YA 4DV1Q 4YY3L 3CQZB 2A68C 3AU7A 1A15A 4BY7H 1SYEA 4Q0FA 4AYBG 4LF6Q 3T4AC 1L1OC 2AKWB 5L37A 5CV4A 2EVBA 3RZDB 1HCZA 4PV1C 3WOEA 1LT6D 4JV5L 4UHVA 1Z47A 2FINB 3CP0A 4KY7A 4XT1B 2B2UA 1SFOH 2K5WA 3JAME 1WTXA 3GTPH 3OW2A 2DY7A 3TS2A 3U58A 1MSGA 3ER0A 2R7ZG 2I07B 4KY6A 2XNAC 4AYBB 1XNRL 5K36H 2L0CA 2NTSA 1VQFA 1YNNC 4KD3A 3ULJA 1O7IA 2AUJD 2QW7A 5EKKA 4RHRA 2Y0SB 1LTID 1YJ9A 1E1OA 1PH2A 1BUVT 1R9TH 1J5EL 1STYA 2R3ZA 1L1OA 1K0SA 4LNQA 1TWCH 1NR4A 2ZTCA 3K8AA 3HOXG 1G8ZD 1LLRD 5FLMG 3K58A 4P74A 5C0XI 3KUPA 2EYPA 4B3ML 3A0JA 3L2PA 3RLFA 4NB3A 4FYDA 5BR8L 2MO0A 4DN4M 1XPRA 5FO9B 4A3FH 3AB9A 1V1QA 1Y1VG 1F2LA 1Y8OB 3D4DA 2XWJB 3RN2A 2WAQG 4DPGA 3DEPA 1M4VA 5JEAG 3G71A 3E0JA 4KHPQ 1WD0A 1VQEA 4CGYB 4ZUIA 3TP5A 3A55A 1HNWL 3PIOA 1ET9A 4MTNA 3VR5A 3KBXA 4RGNA 4X62L 5M5YB 2K5NA 3CRKC 5D65A 1RTNA 3V2TA 2CFMA 2WKCA 4CKEA 1S4ZA 1LTLA 2JA7G 4HR7B 4OONA 4M1UB 2NVTH 1K8AC 1DCZA 1Y14B 2BCOA 2BE5C 1LM0A 3J7ZC 4KK7A 2QEXA 4QQBX 4H0LC 3K0XA 2K28A 1WTQA 1U4RA 2BA0A 4NXNL 1Q8KA 1X3FA 1B4OA 5FOBB 5IGFA 1A8VA 3DLLA 1ET6A 2KECA 3TN2A 4JI7Q 2ZM6L 1I94Q 1LT4D 2Z0SA 3UE0A 4K5WA 3PO2H 2Q8RE 3L9AX 4NPSA 3S16B 1IZ6A 5FK9C 2L4NA 4KHZA 1ZEQX 1PH5A 4KLKA 1ZYRD 2MJ8A 3HZXA 1L2FA 2PMZB 3FVQA 4G4KA 1K28A 3DUZA 3HRZC 1KXLA 4LW1A 5DNFA 4GKJQ 1AE2A 4LMQD 1KNAA 4A93B 4LF9L 2KUMA 1I6VC 5DLQE 4RHSA 4JI4L 1Q90A 2K50A 2K5VA 4LF8Q 2A69D 5EKIA 4BBSH 4ZAIA 1EWCA 3VYUA 3CC7A 4KKUA 1F9QA 3AFQA 2R93B 3HOZH 3DMUA 1MHWC 3H0GB 3I2ZA 1MJEA 1BNZA 3IFTA 4IFDG 2R93H 1FNWA 2B2YA 5IGEA 3HOUB 2R7ZB 1R9TB 2K1BA 1EFWA 2F1MA 4YCVA 4A75A 4P73A 2R6GA 1KDCA 1QOHA 2MFIA 4PZ8A 3PSIA 5CV6A 1Y1VH 1CZWA 2WB1E 4R4TA 1S3OA 1BBXC 4DK1A 2DJFC 3PO3G 1S5FD 1JWMD 5M5XH 1NMFA 5C3EH 1A0IA 3HOWG 2DN8A 1GUSA 4CBVA 4GOPC 1N36Q 1IL2A 4A3EG 1TT2A 4OL7A 2IT1A 4K6LA 2Q2TA 5CORA 4MIUA 2XIWA 2NN6G 4ZQ3A 1STEA 5EQ0A 1N33Q 2MUYA 4NW2A 1RJTA 1CK1A 3MZ5A 4BBRH 1C7YA 3M3YB 4A3CH 1R4QB 2F3VA 2HD3A 1DONA 5CV5A 1VQIA 2UXDL 1JCKB 1WTHA 2H1EA 4QUCA 3QJYA 4JG2A 3W2DA 1E1TA 2KVMA 4LFBL 1FD7D 1UE1A 1XJVA 1RODA 1STBA 3MEFA 1BCPC 4GLXA 5C4HA 1IBKL 1WD1A 3G6JB 4DR6L 1GUWA 2QF7A 3D4RA 1D6EC 2R92G 4LWCA 4GN4B 4DR2L 4JV5Q 2JA7B 4C3HH 2YU9B 5I9PA 1TXYA 1F77A 2KHSA 3W3AA 4ALPA 1K73C 1QILA 1KABA 1CFMA 2F0VA 3W5OA 3PO2B 4B3RQ 1TS4A 2B63H 2VNUD 4K6DA 4HEDA 3I8ZA 2MP1A 5LL6S 5CYUA 5FO7B 2PZUA 4B3SQ 3PV0A 1DJRD 5LHY1 2HIXA 4L63B 3NUCA 2ZXOA 3ERSX 5DM73 4R4QA 3MFGA 2JA8B 5GAHC 1ONLA 4ILWA 4BXXG 4A3BB 5TSSA 2C9OA 1EY5A 1L1OB 2NVXH 2K4KA 4BBRB 3Q8DA 1M1KC 5C4ZA 4N8X1 4OIJA 3H15A 4EQOA 4GLVB 2FXQA 3HOXB 4A3BH 3CRLC 3QOLA 1NTGA 3K59A 5GQOA 3R2TA 4PQXA 1MJCA 4IO9A 1FGUA 4ULLA 2B2WA 4QUFA 2RCNA 2ZT9C 3PUVA 1ASZA 2NZ1D 1YNXA 3J81j 3FEWX 4LUOA 4C3IG 2K05A 1VQHA 2E2JH 1Y1VB 1EYCA 1SRUA 2X69A 3CU7A 3GTGH 2CH4W 3FRPB 2EY1A 3I4LA 1ASYA 1SLJA 2E5LQ 2OXPA 3DWAA 2JJQA 4NXMQ 4PMWA 2D5DA 3NK9A 1HNXQ 4JK1C 2L55A 1JJGA 4IPGA 1QZGA 4X64L 1XXGA 2IJ0A 2MQHA 1ZXTA 2KHIA 2JA6B 1IYUA 1JQYD 5C0XH 5C4XG 3X3NA 4JI6Q 3MEHA 2A69C 4F8MA 3OTOL 1SNOA 1J6QA 1SMYD 5GADC 4L5RC 2ZTDA 4JI5L 1LACA 5HGQA 3T56B 1PH8A 2NZOA 4DV2L 1S5DD 3ONAB 4B3TL 1H9SB 5F2DA 2G5DA 2QDLA 3HKZE 4L6TB 1Q86C 3MAQA 1TWGH 1V8QA 3MC0B 3P20A 5FLXc 1G2SA 1ENFA 1HTLD 2ENBA 3URYA 4IJHA 3S16H 3TBIB 2RQXA 3S1MB 2IW3A 4ZYSA 4LUVA 3A7AB 1PDQA 4C1NK 3FDTA 2F4VL 5C44B 3A8JE 4HCSA 3CCVA 4S3SA 1D5ZC 1IXRA 1SYFA 5C4JB 1TS3A 3HGBA 4IPCA 1MBYA 1K8MA 4IUTA 3A56A 5HY6A 1KAAA 1TVXA 1SAPA 2K33A 2F52A 2UXDQ 5I6WA 3F1ZA 1VS0A 1LO5D 1SJHD 5M5YH 1LV9A 2R7ZH 1K3BC 2BDOA 3KLSX 1Y1WG 2FFKB 3D4WA 1OXUA 4LF7L 3Q23A 2R93G 1BKBA 1HRJA 3CCEA 3GTGB 3K0YA 3ULLA 1FYCA 1QUQA 4DV1L 2WIIB 1DZ1A 2LKVA 2NVQB 4OEMB 1VCIA 1X3GA 4B08A 3I4NH 1W6KA 3N52A 2E2JB 3STBC 4UY8C 1SNPA 1J5EQ 2QEJC 1UNSA 2PI2E 3G7LA 2ZJQA 3M7GA 3HOYH 4CJ1B 5AJ3L 1FJGL 5M5WH 2SOBA 2VB2X 2X6LA 2NVYH 1UE5A 4A3EH 2Q2IA 3NPPA 1BOSA 3P1HA 1WTWA 3TP7A 1N34Q 3S1QH 3I4MG 3FKIG 4AIMA 1H9RA 1X54A 3A74A 2F0GA 4DUZL 1JC7A 3R3OA 3S1QB 3PO2G 4DK6C 4G7OC 2GVAA 2OQKA 1YNND 5J1ZA 4XQNA 4GN5A 1ICWA 1OO9B 2VS1A 2UUAL 4F87A 3SVMA 2F0TA 2M2LA 4U673 2V4DA 2N49A 2R61A 1LTAD 2WACA 3JAML 1SE8A 1U4LA 5I6YA 3HOVB 5ELDA 1HA5A 1HFGA 2LY7A 4HN7A 4IFDH 1HFNA 2K75A 1H95A 1PRTF 1YZ6A 2EOTA 4K5VA 4X3UA 4EQPA 3QB3A 4FNFA 4FDBA 1SBBB 4BXXH 2UXCQ 5E4XA 4N8FA 1PFNA 3VYRA 2ATWA 1E7ZA 1D5MC 3RN5A 4FF2A 3HOUG 2PCFB 2TMPA 3MXPA 1JT8A 1N8RC 4LFCL 1AP0A 3BZDB 4DA2A 1H9JA 1CZGA 4POFA 5M9OA 5LMNQ 2K32A 1VQ8A 1OXVA 1I3QH 4YHHL 4KKSA 3J80c 3C46A 4QJFA 3Q6SA 1H9MA 1XPUA 1X56A 2CWAA 3VA7A 1CKNB 2EJGC 4OELB 1PYSB 2EDGA 1LYLA 2VW9A 1VF7A 4CDCC 2CW0D 1EY4A 3KK7A 2MO1A 3VYTA 4LF6L 2BDNA 1CKMA 4DF7A 2B2WC 2J4XA 4U68A 1MD2D 1U4MA 2B29A 2ICIA 4DV6L 1QNUA 1H9SA 1UE6A 2H4OA 3K5MA 1RDPD 3OMCA 3I3CA 1XNQQ 1NE3A 2PQAA 1PYBA 4DXFA 3HOVH 2K14A 2RDFA 2QCPX 4GKKQ 4TQUS 4JPBW 5J22A 2E2DC 4DV0Q 1I6HB 1VQDA 3NTKA 4A3JB 3KF6A 1WTVA 4RWSC 2UXBQ 1H9KA 1UUPA 3SK6A 1JE5A 2B3GA 2UUBL 4QMGA 2VQEL 5IWAL 2LXJA 1F9PA 5A35A 3JAMc 2B2VA 2XWBB 3P75A 1VQ9A 3GTOB 1FR3A 3HOYB 5H1SE 1E24A 2BH8A 1WI5A 4V0BA 2D0PA 4ABNA 3U9OA 5EBDA 4I65A 1EWIA 1RCVD 1E2WA 2SNMA 2NVYB 3C3LA 2N3SA 4HSVA 3TP8A 3J81c 4MTKA 3UE1A 4DAVA 3CCSA 4DAYB 4LAAA 4YY3Q 2F3IA 4JW0A 1CSQA 3S1NB 4GNXA 3I7FA 3KF8B 2MNAA 4BY7G 1SDFA 3J80i 2EYOA 3DEOA 1G6ZA 4JOIC 2VUMB 1B44D 1QJOA 4J8QA 1D7QA 3T51B 1O80A 4KHPL 4OX9L 1L0YB 1A63A 1B1ZA 3S15B 4GS3A 1KNEA 2MGSA 1T9HA 4IN3A 2IX1A 3HOXH 4C3IH 4C1NI 3CW2C 3KLSA 2PNRC 3EBEA 1PMRA 1TWHB 5C4JH 3K5NA 2A68D 3BZKA 4FVMA 4DR6Q 1GHKA 4A3JH 4BY1B 1ZKOA 1N34L 2NVTB 5DM63 4ZKBB 3GTKH 4ME5A 3T13A 2Y0SE 3NTHA 2ASBA 3FKIH 3NBHB 4I7AA 3NENA 4KI0A 4DV4Q 3CC2A 4DNRB 4K8JA 3IL8A 2PQAB 2F0UA 3NXWA 1VQGA 1K83B 1VQ5A 4R8IA 1PTOC 1Q81C 1SJED 5E7NA 5C3XA 3S1RB 2FMCA 3TEHB 3PO3B 4TVAB 1TKWB 3CPWA 3UDFA 4A3KB 1HZ9A 2QKIC 5EPLA 4IFDJ 1U0LA 2DJGC 5JVH3 2A73B 4QY7A 5C44G 5EAYA 1PTOD 3MXNA 1EU3A 1C0AA 1CQVA 4QL5A 4B9XA 1XNQL 4IUPA 4RCOA 1EOVA 2E2IH 3S17H 5KYIA 1ICFB 3FPUB 4B3SL 3V05A 1YJWA 2D62A 1BCPD 1EYDA 3S2DB 2L15A 3KDFB 3MVVA 4GN3B 4DU9A 3EROA 1TU2B 5KRUA 3C2PA 4HIKA 4MNOA 2F03A 1YEZA 2B2TA 2KQ3A 2KENA 3CKIB 3SK4A 2KEDA 4YWLA 5FJ8H 4Q5VA 1Q3LA 3BDLA 2IPKD 4FXDA 1RL2A 3CAMA 4IOCA 3E9HA 4CKCA 3JAMi 3I56A 2O5JC 4A3GG 3H0GG 2JSOA 2Z6KA 2JA5G 5E4WC 1WCMH 2ICEC 1G91A 1MSHA 4A3KH 1QE6A 4UP8A 5I9OA 4LF7Q 2AMCB 3S2HB 1B3QA 3PIPA 3KJPA 1VQBA 2CH4A 4ZCKA 3S24A 4JI8L 3IFDA 5JPNC 3SHLA 4DV5L 5LL6X 1ILQA 2AQ2B 3KLRA 4IUQA 4ME3A 2JA9A 2N8NA 5C3WA 3PMFA 3UDXA 2ZJRA 1I4RA 4DAMA 1S40A 1EIFA 4PZ7A 3BYTB 4YCUA 2ZXRA 4QGUA 4KTAA 3A7LA 3J7A5 1KAWA 3PF5A 2XN9C 1IHZA 4L5SA 1VF5C 3I55A 1B2TA 5JEAJ 3HKZB 4CDEC 1SNMA 5G3LF 1HNZQ 4HIDA 4Y7NB 5CV9A 4QCLA 1FVIA 2SNSA 2LMCB 1CT1D 2AUKA 5IP9H 1B50A 2CVRA 4A3IB 1E0BA 4DV4L 4LJZC 1PRTC 1EY7A 1K83H 2BA1A 4L8JA 5HGTA 5LMNW 1IYVA 2DNEA 1EIHA 1GD7A 3Q0AA 4Z9CB 5FLMH 1Q82C 2UU9L 1YVCA 5CV7A 1JJ2A 3MWYW 2KCCA 1SMXA 2F4IA 5ELFA 4WJ4A 2NN6H 5GAGC 1FGBD 2VUMG 4XDXA 5IIFA 3C1EA 1TS2A 4G7HC 4O42A 1A62A 4RGMA 1YNJC 4POGA 4E6IA 3S1MH 1C48A 4KJNA 2HDMA 1CSPA 5ELCA 5C5MA 3J7AF 4IUVA 3GTOH 1IKMA 4LK1C 2FHTA 2K5DA 1NR2A 1JOKA 4DNIA 1AEXA 1Q8IA 1VQCA 3VDYA 2QILA 3TRZA 3R8BA 1Z9FA 1FL0A 2Q8TA 4HMIA 1Q1EA 3NQTA 3CMEA 1PV4A 1GXDC 2NBFA 1I6HH 1WFQA 4TKOB 3FMCA 1D8LA 2PI2A 2EJMA 3M85A 3W1BA 1IBKQ 1TQOA 2A6EC 3OYYA 1QWYA 1BVSA 1J9OA 2R92B 1PA6A 2LFNA 1BCPB 1RHPA 2NVQH 1IBMQ 5ELBA 1WYDA 5C4XH 1PH3A 2L12A 5FKAC 1PTOH 1JR0D 4A3LG 4X6AH 3NWTA 4IJLA 2F0WA 1VQNA 2Y0SG 2O2LD 1FNUA 1I4XA 4FP5D 4C3JB 1AH9A 3AFPA 1G6PA 1EY8A 4AQYL 1C4QA 1GO3E 1PH4A 2A8VA 3ERQA 2YYZA 5JJIA 2UUBQ 2KCMA 3J81i 1PTOB 1VQJA 3TMEA 4A3MB 2M00A 2AWOA 4WORA 1DGSA 1V1PB 2RVLA 1HUNA 1G291 1BO0A 3MXGA 5DAUA 3U50C 2GN5A 4A3GB 2OTJA 3I4OA 5IGGA 3K5OA 1MKHA 1NCVA 2K03A 4XXEA 4A3IH 4CDDC 4HJ5A 2JXMB 2K6AA 1I50H 2JE6I 1XPOA 2NUCA 4A3CG 1KLGD 4OO1H 1YNJD 5D3DA 1X65A 1N36L 4OO1I 1CHPD 3GTLH 1HQMC 4R4IA 3EVQA 3MA2B 1AE3A 2JYOA 4IURA 3RZDH 4N9PA 4DFAA 3PUWA 2QDBA 1WTOA 2B2TC 2E5LL 1QVGA 4LF4Q 4P2CB 5D14A 2LSSA 4HTHA 2A5HA 1VQ7A 2JEAI 2C35B 3QIAA 1SE2A 4O2DA 2F0OA 4F88A 5C44H 2RA4A 2YTYA 1HZBA 4Y52H 2N55A 3GV6A 1LTRD 1HH2P 1UWVA 1SYDA 3KJOA 3D3RA 1LABA 4HSPA 4KV6A 2EY6A 4GLAC 1AFPA 1VQKA 2F0QA 2A6HC 3GV3A 2Q2HA 4KY5A 5BN4A 4JI5Q 3CXCA 3H6MA 4X3TA 3T1HL 4YWKA 2PYKA 1IW7D 1HA6A 4O0AA 1Q46A 3OIPA 3T16A 1EY9A 1XWEA 4B3TQ 1GKHA 4RG1A 3GTJH 3OSOA 4FXGC 4DR4Q 1E22A 1WOCA 1XMOQ 2JA5H 2OF1A 4JBMA 1A3VA 4IPHA 2WP8J 3HOVG 1HR0L 1LTBD 2EJFC 2RBMA 3J81E 3AMUA 4A3GH 2JN4A 3BG3A 1HNXL 4MN3A 4DV0L 2AHOB 4HJ8A 4NXML 1WTPA 1EU4A 5IT9L 1E2VA 4DXGA 1BXTA 1PFSA 1QB5D 4GNXB 3S14H 4DR3Q 4A3FB 2L5TA 1EIYB 5IYDH 3KBGA 4LUZA 3S2DH 4DUYQ 1Z7TA 2I46A 3AYHB 4HIOA 1LTGD 5J3BA 1X6OA 5IYBH 1AN8A 1B53A 5EPKA 3CF5A 1KRSA 5EBCA 2VZAA 1ENCA 2NYZD 4RCNA 1C8CA 2F4VQ 4YHHQ 2F0FA 1TWCB 3S9WA 2HIVA 2K7VA 1KTKA 1XMQQ 4K0KL 2PMZE 3N6RA 4DUZQ 4UPAA 1EOTA 4CJ0B 1NBWA 3RZOB 1V43A 4LFBQ 1OTCA 5G3LD 2XRSD 5IYCH 3K5LA 5IP7G 4RKLA 3GTMB 2KJXA 1XTCD 4OWWB 1WVLA 1STAA 2B39A 2ZJPA 1RKNA 4KKTA 2B63B 1D1KA 1M90C 1D1IA 2JK8A 1ML0D 1Y1WB 3VR4A 2EY5A 2PPBC 3OWFA 3J80E 3KDFA 3CPFA 5COYA 4A3EB 5EKLA 4EGVA 1NSNS 4DV2Q 4A76A 3RNUA 2JA7H 1JWSD 3PQIA 3D6WA 2L9HA 1CKNA 3ND9A 2RHSB 4X64Q 3BJUA 4JBKA 3PUXA 4A3JG 4A3DH 1MI2A 2A1AA 3J7AV 2XTIA 3A8KE 1RD9D 2EIFA 4ZUJA 2L11A 1CM9A 1IKLA 1VQPA 2CKZB 2WB1B 4A3DB 2SEBD 1BDOA 2VQFL 1HUMA 1NY4A 4RFBA 5FJ8G 1G51A 4I7ZC 1HZCA 2HQLA 2UUCL 3D8GA 1I4HA 1DOMA 3K7AH 4P72A 2JA5B 2L1BA 3Q24A 3IAYA 1U4PA 2EE1A 5ISRA 1PH6A 5CMDA 3LNNA 3T1YL 3PCOB 3QG1A 4DAYA 3QOJA 1WJJA 4XTCS 2JA6G 4R4OA 3H3VC 1HPCA 5AFWA 1OXTA 5ELEA 4DV3Q 2B2UC 1PRTB 4XT3B 1JORA 4MZ9A 4H44C 3CCUA 4OIKA 4C2MB 4OHJA 2B8GA 4ZLTF 5HURA 5IE8A 3E5SA 1JWUD 5C6AA 2PW7A 3I70A 5IOCA 5BR8Q 1F2YA 4JVZA 2O4XA 1NAPA 1K8GA 2RHQB 3G48A 1A3UA 1IW7C 4JI0L 5JEAH 2AQ3B 2A6ED 3QR8A 4K2KA 2CWPA 3NBIA 4GZYC 3BYYB 4ID6A 1R4PB 2XVSA 3OOCA 4C3HG 3NSWA 4A3MG 3K80C 2BOSA 1EL0A 3SE0A 3D31A 2Z8LA 5JOBA 2QA4A 4XIGS 3L0OA 2WFWA 3GD7A 2F0NA 3DHQA 3K7UC 5LMUQ 4JI4Q 4IOAA 2AQ1B 3BS1A 4KHVA 1S5BD 4XYOA 5E1FA 4K14A 2VQFQ 2BH2A 1AZPA 2Q2UA 4JBJA 3D0FA 3IKJA 4C3JH 1CQFA 4QIWE 4BBRG 4FO2A 1X3PA 1Z6HA 3GP7A 1XMOL 3S17B 1JOQA 3H3VH 4DR3L 4A93H 3GTQH 1N9WA 5T1IA 3RZOH 1TWFH 4JCVE 2PNHA 1NNXA 3G6EA 1IYJB 1UE7A 1T5XD 1TWAH 1F2ZA 4R9WA 4HAEA 3PUYA 1LT3D 2D2CC 5GROA 2KBNA 1PFMA 2LXKA 5EJWA 3NWSA 1X9NA 2SDFA 1GUOA 3L3OC 4KD4A 2N78A 1FNVA 4BBSG 1TY0A 3LWUA 1ENAA 4JI1Q 3UDIA 2E74C 3FKIB 1YBYA 4WJ3M 5KEEA 2UU9Q 4H13C 2HCIA 4TSSA 4JI2Q 2C5CA 1I3QB 2OT2A 1QUQB 1A3TA 2F0SA 3ZJYC 5FLXE 2UXBL 1V1PA 5C3EB 3KF8A 2KOLA 4PG3A 2H5XA 3VR3A 1JE4A 1UAPA 4WRDA 2EYFA 3R2IA 3GTQB 3ND8A 5KGUA 4LF4L 2JA6H 1N32Q 1M8AA 4JI2L 3MHBA 3BU2A 4RGOS 1T5EA 3NP8A 2M9VA 3TS0A 3LX0A 5C0XJ 3U4VA 4DV6Q 3I4MH 1EEFD 3TREA 3F2DA 3CD6A 5JPMC 3WDNA 4DR1Q 5C5LA 2KA7A 4EX5A 4B3RL 2RCFA 2WAQE 1KC8C 5KNBA 3M4OH 1DM0B 4K5XA 4X65Q 2B2YC 4RMFA 5M3FG 1JOOA 1QVCA 1XYIA 3S1NH 4XYQA 1SE3A 3HOWB 3CCRA 1S5ED 4UDUC 3WWVA 4B3MQ 1IL8A 3OWEB 4HJ7A 4JI3Q 2WB1G 4A3DG 4EQ5A 4JBWA 5IP9G 5NUCA 1DXMA 5LMNL 4DAPA 3J81L 1SMYC 3L7ZC 1VMPA 1HR0Q 1I4QA 5M3MG 5M3FB 4RH6A 3F2UA 3DM3A 1SFOB 3DXJC 4OWTB 1Y1WH 3WOFA 5C4XB 3NHHA 3H09A 1IBLQ 4PMBA 3AQQA 1W3SA 2EYMA 4C3IB 1NMGA 2R92H 3ZYYX 3I91A 5K5PA 1XNRQ 1GJXA 2HT1A 4EVOA 4K8IA 3BVGA 2IHFA 3A54A 1EY0A 4M8AA 3TSSA 5LMUL 4BA1I 5IYCG 2ZXPA 3B6YA 1KQSA 2E76C 1IBLL 4C3JG 5IYBG 4BBSB 4AYBE 4GKJL 2OEOA 1EWHA 3CCMA 2EQSA 1EQTA 2IY5B 5JJZA 4DKAC 1G2TA 2K52A 3J7YW 1STHA 1HQRD 3CCLA 3K7AB 3PIO3 1STNA 1O7LA 1OXXK 2CHBD 3H0GH 1U9RA 2F0DA 1ZYRC 1I94L 3TDQA 2K04A 3CCQA 5CR3A 2Q8IB 3I4MB 1SNCA 3OMGA 5KIXA 3J80L 4GNXC 2E2HB 5J39A 4QIWB 4KN4C 1JB3A 3O13A 1SNDA 1CUKA 2JA8G 1RF2D 2F3WA 4DR2Q 1VQ4A 5FO8B 2IL8A 2IX3A 1PFBA 1Y8NB 1GUNA 4LF8L 1PTOF 4J15A 2KHJA 3UDGA 3SGIA 2WAQB 1SR3A 1EUJA 4DR7L 3CMAA 3KLWA 1U5KA 2VL6A 1PZID 2CW0C 2ZTEA 4J6HA 2F0PA 1LTSD 1SE4A 2EPBA 2EYLA 2YTXA 2CQAA 3F8TA 4OWXB 5FLXL 1YHQA 2QGQA 5JJKA 1PYWD 2I5HA 1BCPF 1DYQA 1MIUA 1X55A 3EA6A 3EIVA 3LGJA 1NJIC 2I5LX 5IT9c 1DOLA 3EN2A 3SEBA 1N33L 2TSSA 2V1CC 1HZAA 1E2ZA 1AZQA 3QO2A 5IGBA 1V9PA 1UEAB 4LFAL 3SDZA 4BY1H 2RSOA 1ILPA 2JEBI 1JJCB 3TZDA 4G7ZC 1QVFA 4DUYL 2AWNA 2HQEA 5D3IB 5ELNA 1HHVA 3I90A 1S5CD 1WTRA 2NTTA 3U4ZA 2G9HD 3DM1A 4MHEA 2J7ZA 2P5ZX 3EQLC 4A3IG 2CCZA 1SYGA 3HP3A 3S15H 2B8FA 4TRDA 1S72A 3CHBD 3HOZB 1YIJA 5M3FH 4HCEA 1XMQL 1I50B 1KD1C 1VQAA 4N9TA 2VUMH 2JQOA 4JOIA 5BN5A 4G57A 4HMJA 4YIJA 4JYAQ 1DD2A 3HEJA 5A2QE 4AQYQ 2Z1CA 1P8LA 2F0MA 2RSNA 1SYCA 2NWGA 2HHHQ 3NE5B 3E0EA 2IHEA 3RD4A 3I4NB 3DWQA 1B9MA 4BA2I 2E8GA 1I4PA 1L0WA 5KNCA 1HR0W 4QF4A 3RLOA 1STGA 3PGZA 3S1RH 3OHXC 4HIMA 2I0QA 5IT9E 3M7NA 4JI6L 4FF4A 1OXSC 1SN8A 1W2BA 1KL9A 4CHTB 5IP7H 2KEEA 2F0EA 1BF4A 3I4NG 1A6XA 1EYAA 3KF6B 4RKBA 3DWPA 4OGQC 4GOPA 5EPJA 1HXYD 2DGYA 5IGDA 3T53B 2NVXB 3KYHC 3PIP3 3KOJA 3CC4A 3G4SA 3A8IE 3PUZA 1X3QA 3NELA 2K5HA 5CGKA 1RIPA 5M3MB 1TY2A 4IQZA 3FHWA 1JMCA 3NTIA 1K8OA 1EIGA 1II3A 1BBWA 3BDCA 2ES2A 1CA5A 1D2BA 1SXTA 1XTDA 3EJIA 2F0IA 3TP6A 1QG7A 4X66L 1I5FA 3GDEA 4A93G 1PXUA 3M9BA 2K01A 2N88A 2A6HD 1SYBA 5I2YA 3T1HQ 1KDAA 3I72A 5BN3A 3P7JA 2DUDA 1GM5A 5M5XB 4O1NA 4P71A 1TWFB 1SSOA 1KLUD 4DV7Q 2RF4A 4JYAL 4ZRZA 3H3VI 3RMHA 3TQYA 1TIID 4CJ2C 1J8IA 5GAEC 3JC66 2K5QA 1EFID 4A3KG 3A5UA 3H91A 2D0OA 1K3RA 4PZ6A 4HJ9A 1IBML 4GOPB 1GVPA 3E6ZX 4X3KA 1B8AA 3BZCA 1GHJA 3RR5A 4A3BG 4JI0Q 1X32A 4IFDI 1A2TA 4DR5Q 4KJOA 4UAIA 1JB7A 1P16A 3I73A 4OXPA 1VQLA 1L0XB 1KRTA 4V190 4H7BA 4EQNA 2Z6KC 4LFAQ 2EZVA 4DR4L 2G9DA 1SROA 3KFUA 4BS9A 3GTMH 2Z6BA 1W6JA 4IUUA 1QZHA 3S2HH 1BBUA 2EXZA 4WFN3 5AJ3Q 1D5XC 1V1OA 1N32L 2E75C 4B9WA 1LTTD 2X6GA 4H02A 5M3MH 1YITA 4P75A 3RUZA 3V96A 2ZM6Q 4NMZA 3MTSA 4FXKC 4LF5Q 3FP9A 4DK3C 3HOUH 2Z4IA 1LUZA 4YWMA 1PHJA 3M4QA 1A2UA 2DNCA 2EY2A 3QWNA 5M5WB 2PZTA 5IWAQ 4APVA 4X66Q 2RDGA 2Z4HA 3HKZG 1B3AA 4C56C 2PW5A 1WCMB 1C9OA 2EYJA 4BY7B 3HKSA 5EGTA 3SK5A 3S14B 2O5IC 4WJWA 5KYLA 1XX8A 4K2LA 5CV8A 3HS0C 4GKKL 3HOWH 2VY3A 5IODA 4X62Q 1BR9A 1B9NA 4DNTB 3ITPA 1VQOA 3MFYA 1UEBA 4IALA 1CHQD 1PZKD 2R7DA 1EYGA 5DEHA 3X3MA 1O78A 2NB0A 5ELOA 1PH1A 3M4PA 3STBD 4RAUC 2XRQD 3R93A 1B70B 1K0RA 4C3HB 2YU9H 3GTJB 1VQ6A 3VA5A 2HDLA 1VQMA 2ID0A 4DR5L 3EFXD 4QB4A 1RTOA 4NXNQ 2MHVA 4A3LH 2XSCA 1EQRA 2F0LA 4A4IA 2BE5D 4J1MA 1PH9A 1HTPA 2J0TD 3VYSA 1YJNA 1I4GA 1EQVA 4JI8Q 3F2BA 3K6OA 4FF3A 1KHIA 3SXHA 4R1JA 4JI3L 5CBAE 2A19A 4NKLA 4PNYA 2YV5A 4F7XA 1B7YB 1YHAA 3VR2A 2IX0A 2VQEQ 2OTLA 1PH7A 2B63G 1Q7YC 1PLFA 5C0XG 3D6CA 4CDFC 2D9UA 3NQIA 2HUGA 5T1GA 3HOZG 3GTLB 1HNWQ 3OPOA 3RLNA
chains in the Genus database with same CATH topology
1MGSA 1Q12A 5JAVA 4ZK9B 1TWAB 2B2VC 1F9RA 3SK8A 3GTKB 1EY6A 1Y69U 2RKSA 2PZWA 4KMUC 4CKBA 5I4DA 2RDHA 2LS01 3OIQA 1CA6A 2PQEA 2F0KA 5I2XA 1TR5A 4OO1G 3Q22A 4NP5A 2WKDA 1KDBA 1GOZA 4RA8A 3C1FA 3UI2A 2IWHA 2A74C 1SEBD 3FPPA 2VB3X 1NUCA 5K36G 4R8NA 3LWEA 3MXUA 2NN6I 3SR1A 1PZJD 4IUNA 2E2IB 2F0HA 5JVG3 2F0JA 2DY8A 4DGZA 1DOKA 5CC4A 1CI3M 1PRTD 1Y8PB 2GA4B 4BWGB 3K57A 2JP1A 4FF1A 1TS5A 1ESRA 4NDXA 2EYHA 3OW7A 3GTPB 1VMCA 4KN7C 1VDZA 4XQJA 5A2QL 3HG9A 1QCBD 4ZKCB 5CBEE 2PO4A 3M4YA 4ODGA 3BDOA 3BVMA 2HCCA 2MPMA 1CTMA 4IZ8A 1SNQA 4PMCA 1JICA 1GUGA 3NBHA 3M4OB 1Q1BA 1EEID 1F9SA 2VXWA 2FMMA 1LT5D 1O7ZA 1EZ6A 1BQQT 5KNDA 2WV6D 1TWGB 1ESFA 3U9SA 4DK0A 5E3FA 2KCNA 3GO5A 4X3SA 1QNKA 1GUTA 4XQQA 2WINB 3GQBA 3VR6A 3H94A 3TZUA 2FJ2A 1EZ8A 3BVZA 1F2MA 5IGCA 1AW7A 4RGTA 1O7YA 3CQZB 2A68C 3AU7A 1A15A 1SYEA 4Q0FA 3T4AC 3RZDB 5CV4A 2EVBA 4PV1C 1HCZA 3WOEA 1LT6D 1Z47A 2FINB 4KY7A 4XT1B 2B2UA 2K5WA 3JAME 1WTXA 2DY7A 1MSGA 2I07B 4KY6A 2XNAC 4AYBB 5K36H 2L0CA 2NTSA 1YNNC 4KD3A 2AUJD 5EKKA 4RHRA 2Y0SB 1LTID 1BUVT 1STYA 2R3ZA 1NR4A 1G8ZD 1LLRD 3K58A 5C0XI 3KUPA 2EYPA 3RLFA 4FYDA 4DN4M 5FO9B 3AB9A 1F2LA 1Y8OB 3D4DA 2XWJB 3DEPA 1M4VA 5JEAG 3E0JA 1WD0A 4CGYB 4ZUIA 3TP5A 3A55A 1ET9A 3VR5A 3KBXA 4RGNA 5M5YB 3CRKC 3V2TA 5D65A 1RTNA 2WKCA 4CKEA 1S4ZA 4HR7B 4M1UB 1DCZA 2BCOA 2BE5C 4KK7A 4H0LC 2K28A 1WTQA 1U4RA 2BA0A 1B4OA 5FOBB 5IGFA 1ET6A 2KECA 3TN2A 1LT4D 4K5WA 2Q8RE 3L9AX 3S16B 5FK9C 2L4NA 4KHZA 1ZEQX 1ZYRD 2MJ8A 3HZXA 2PMZB 3FVQA 4G4KA 3DUZA 3HRZC 5DNFA 4LMQD 1KNAA 4A93B 2KUMA 1I6VC 4RHSA 1Q90A 2A69D 5EKIA 4ZAIA 1EWCA 3VYUA 4KKUA 1F9QA 2R93B 3DMUA 3H0GB 1BNZA 3IFTA 4IFDG 1FNWA 2B2YA 5IGEA 3HOUB 2R7ZB 1R9TB 2K1BA 2F1MA 2R6GA 1KDCA 1QOHA 5CV6A 1CZWA 1BBXC 4DK1A 1S5FD 1JWMD 2DN8A 1GUSA 4CBVA 1TT2A 4OL7A 2IT1A 4K6LA 5CORA 4MIUA 2XIWA 2NN6G 4ZQ3A 1STEA 5EQ0A 2MUYA 4NW2A 1RJTA 1CK1A 3MZ5A 3M3YB 1R4QB 2F3VA 1DONA 5CV5A 1JCKB 2H1EA 4QUCA 3QJYA 3W2DA 2KVMA 1FD7D 1RODA 1STBA 1BCPC 5C4HA 1WD1A 3G6JB 1GUWA 2QF7A 3D4RA 1D6EC 2JA7B 2YU9B 5I9PA 1F77A 2KHSA 3W3AA 1QILA 1KABA 1CFMA 2F0VA 3PO2B 1TS4A 2VNUD 4K6DA 4HEDA 3I8ZA 2MP1A 5LL6S 5CYUA 5FO7B 2PZUA 3PV0A 1DJRD 5LHY1 3NUCA 4L63B 2ZXOA 5DM73 3MFGA 2JA8B 1ONLA 4ILWA 4A3BB 5TSSA 2C9OA 1EY5A 4BBRB 5C4ZA 4OIJA 4EQOA 3HOXB 3CRLC 3QOLA 3K59A 3R2TA 4PQXA 4ULLA 2B2WA 4QUFA 2ZT9C 3PUVA 2NZ1D 3FEWX 4C3IG 2K05A 1Y1VB 1EYCA 2X69A 3CU7A 3FRPB 2EY1A 3I4LA 2OXPA 3DWAA 4PMWA 2D5DA 3NK9A 4JK1C 2L55A 1XXGA 2IJ0A 1ZXTA 2JA6B 1IYUA 1JQYD 5C0XH 3X3NA 3MEHA 2A69C 4F8MA 1SNOA 1SMYD 1LACA 3T56B 1S5DD 3ONAB 1H9SB 5F2DA 4L6TB 3MAQA 1V8QA 3MC0B 3P20A 1G2SA 1ENFA 1HTLD 2ENBA 3URYA 3TBIB 2RQXA 3S1MB 2IW3A 4ZYSA 3A7AB 1PDQA 4C1NK 3FDTA 5C44B 3A8JE 4HCSA 4S3SA 1D5ZC 1SYFA 5C4JB 1TS3A 3HGBA 1MBYA 1K8MA 4IUTA 3A56A 1KAAA 1TVXA 1SAPA 2K33A 5I6WA 1LO5D 1SJHD 1LV9A 2BDOA 3KLSX 2FFKB 3D4WA 1OXUA 3Q23A 1HRJA 3GTGB 3K0YA 1FYCA 2WIIB 1DZ1A 2LKVA 2NVQB 1VCIA 4B08A 1W6KA 3N52A 2E2JB 1SNPA 2QEJC 1UNSA 3G7LA 3M7GA 4CJ1B 2SOBA 2VB2X 2X6LA 3NPPA 1BOSA 3P1HA 1WTWA 3TP7A 1H9RA 2F0GA 1JC7A 3R3OA 3S1QB 4G7OC 1YNND 5J1ZA 4XQNA 1ICWA 1OO9B 4F87A 3SVMA 2F0TA 2M2LA 4U673 2V4DA 2R61A 1LTAD 2WACA 3JAML 1U4LA 5I6YA 3HOVB 5ELDA 1HA5A 1HFGA 2LY7A 4HN7A 4IFDH 1HFNA 1PRTF 2EOTA 4K5VA 4X3UA 4EQPA 3QB3A 4FNFA 1SBBB 5E4XA 1PFNA 3VYRA 1D5MC 4FF2A 2PCFB 2TMPA 3MXPA 1AP0A 3BZDB 4DA2A 1H9JA 1CZGA 5M9OA 2K32A 1OXVA 4KKSA 3C46A 3Q6SA 1H9MA 3VA7A 2EJGC 2EDGA 1VF7A 2CW0D 1EY4A 3KK7A 3VYTA 2BDNA 4DF7A 2B2WC 2J4XA 4U68A 1MD2D 1U4MA 2ICIA 1QNUA 1H9SA 2H4OA 3K5MA 1RDPD 3OMCA 3I3CA 4DXFA 2RDFA 2QCPX 4TQUS 5J22A 2E2DC 1I6HB 3NTKA 4A3JB 1WTVA 4RWSC 1H9KA 1UUPA 3SK6A 4QMGA 1F9PA 5A35A 2B2VA 2XWBB 3P75A 3GTOB 1FR3A 3HOYB 4V0BA 4ABNA 3U9OA 5EBDA 4I65A 1RCVD 1E2WA 2SNMA 2NVYB 3C3LA 4HSVA 3TP8A 4DAVA 4LAAA 3S1NB 1SDFA 2EYOA 3DEOA 1G6ZA 2VUMB 1B44D 1QJOA 4J8QA 3T51B 1O80A 1L0YB 1B1ZA 3S15B 1KNEA 2MGSA 4IN3A 2IX1A 4C1NI 3KLSA 2PNRC 1PMRA 1TWHB 3K5NA 2A68D 4FVMA 1GHKA 4BY1B 1ZKOA 2NVTB 5DM63 4ZKBB 4ME5A 3T13A 3NTHA 4KI0A 4DNRB 4K8JA 3IL8A 2F0UA 3NXWA 1K83B 4R8IA 1PTOC 1SJED 5C3XA 3S1RB 2FMCA 3PO3B 1TKWB 4A3KB 2QKIC 5EPLA 4IFDJ 5JVH3 2A73B 1PTOD 3MXNA 1EU3A 1CQVA 4B9XA 4IUPA 4RCOA 5KYIA 3FPUB 3V05A 2D62A 1BCPD 1EYDA 3S2DB 3MVVA 4DU9A 3EROA 1TU2B 5KRUA 3C2PA 2F03A 2B2TA 2KQ3A 3CKIB 3SK4A 2KEDA 4Q5VA 1Q3LA 3BDLA 2IPKD 4FXDA 4CKCA 2O5JC 2JSOA 5E4WC 2ICEC 1G91A 1MSHA 1QE6A 5I9OA 3S2HB 3IFDA 5JPNC 3SHLA 5LL6X 1ILQA 2AQ2B 3KLRA 4IUQA 5C3WA 3PMFA 1I4RA 3BYTB 2ZXRA 4KTAA 3A7LA 2XN9C 1IHZA 1VF5C 1B2TA 5JEAJ 3HKZB 1SNMA 5G3LF 4Y7NB 5CV9A 4QCLA 2SNSA 2LMCB 1CT1D 2AUKA 1B50A 2CVRA 4A3IB 1E0BA 4LJZC 1PRTC 1EY7A 2BA1A 4L8JA 5HGTA 1IYVA 2DNEA 1EIHA 3Q0AA 4Z9CB 5CV7A 3MWYW 2KCCA 2F4IA 5ELFA 2NN6H 1FGBD 4XDXA 5IIFA 3C1EA 1TS2A 4G7HC 4O42A 4RGMA 1YNJC 4E6IA 1C48A 4KJNA 2HDMA 5ELCA 5C5MA 3J7AF 4IUVA 1IKMA 4LK1C 2FHTA 2K5DA 1NR2A 1JOKA 1AEXA 1Q8IA 2QILA 3R8BA 2Q8TA 4HMIA 1Q1EA 3NQTA 1GXDC 2NBFA 4TKOB 3FMCA 2EJMA 3M85A 1TQOA 2A6EC 1QWYA 1J9OA 2R92B 2LFNA 1BCPB 1RHPA 5ELBA 2L12A 5FKAC 1PTOH 1JR0D 3NWTA 2F0WA 2O2LD 1FNUA 1I4XA 4FP5D 4C3JB 1EY8A 1C4QA 3ERQA 2YYZA 1PTOB 3TMEA 4A3MB 2M00A 2AWOA 4WORA 1V1PB 2RVLA 1HUNA 1G291 1BO0A 3MXGA 5DAUA 4A3GB 5IGGA 3K5OA 1NCVA 2K03A 4XXEA 2JXMB 2K6AA 2JE6I 2NUCA 1KLGD 4OO1H 1YNJD 5D3DA 4OO1I 1CHPD 1HQMC 3EVQA 3MA2B 2JYOA 4IURA 4N9PA 4DFAA 3PUWA 2QDBA 1WTOA 2B2TC 4P2CB 5D14A 4HTHA 2A5HA 2JEAI 3QIAA 1SE2A 2F0OA 4F88A 2RA4A 2N55A 3GV6A 1LTRD 1SYDA 3D3RA 1LABA 4HSPA 4KV6A 2EY6A 1AFPA 2F0QA 2A6HC 3GV3A 4KY5A 5BN4A 3H6MA 4X3TA 2PYKA 1IW7D 1HA6A 3OIPA 3T16A 1EY9A 1XWEA 3OSOA 4FXGC 2OF1A 1A3VA 2WP8J 1LTBD 2EJFC 2RBMA 3J81E 3AMUA 3BG3A 4MN3A 1WTPA 1EU4A 5IT9L 1E2VA 4DXGA 1BXTA 1QB5D 4A3FB 2L5TA 3KBGA 1Z7TA 2I46A 1LTGD 1AN8A 1B53A 5EPKA 5EBCA 1ENCA 2NYZD 4RCNA 1C8CA 2F0FA 1TWCB 3S9WA 2K7VA 1KTKA 3N6RA 1EOTA 4CJ0B 3RZOB 1V43A 5G3LD 2XRSD 3K5LA 4RKLA 3GTMB 2KJXA 1XTCD 1WVLA 1STAA 2B39A 1RKNA 4KKTA 2B63B 1D1KA 1D1IA 1ML0D 1Y1WB 3VR4A 2EY5A 2PPBC 3OWFA 3J80E 4A3EB 5COYA 5EKLA 4EGVA 1NSNS 1JWSD 3D6WA 2L9HA 3ND9A 3PUXA 1MI2A 3J7AV 3A8KE 1RD9D 4ZUJA 2L11A 1CM9A 1IKLA 2WB1B 4A3DB 2SEBD 1BDOA 1HUMA 4RFBA 4I7ZC 3D8GA 1I4HA 1DOMA 2JA5B 2L1BA 3Q24A 3IAYA 1U4PA 2EE1A 5ISRA 5CMDA 3LNNA 3QG1A 4DAYA 3QOJA 4XTCS 3H3VC 1HPCA 5AFWA 1OXTA 5ELEA 2B2UC 1PRTB 4XT3B 1JORA 4H44C 4OIKA 4C2MB 4OHJA 2B8GA 4ZLTF 5HURA 3E5SA 1JWUD 5C6AA 2PW7A 3I70A 5IOCA 1F2YA 2O4XA 1NAPA 1A3UA 1IW7C 5JEAH 2AQ3B 2A6ED 4K2KA 3NBIA 4GZYC 3BYYB 4ID6A 1R4PB 2XVSA 3OOCA 4C3HG 3NSWA 2BOSA 1EL0A 3SE0A 3D31A 2Z8LA 5JOBA 4XIGS 3GD7A 2F0NA 3DHQA 2AQ1B 3BS1A 4KHVA 1S5BD 4XYOA 5E1FA 4K14A 1AZPA 3IKJA 1CQFA 4FO2A 1X3PA 1Z6HA 3GP7A 3S17B 1JOQA 5T1IA 1T5XD 1F2ZA 4R9WA 4HAEA 3PUYA 1LT3D 2D2CC 1PFMA 5EJWA 3NWSA 2SDFA 1GUOA 3L3OC 4KD4A 1FNVA 1TY0A 3LWUA 1ENAA 2E74C 3FKIB 5KEEA 4H13C 2HCIA 4TSSA 2C5CA 1I3QB 2OT2A 1A3TA 2F0SA 5FLXE 1V1PA 5C3EB 3KF8A 2KOLA 3VR3A 1JE4A 1UAPA 4WRDA 2EYFA 3R2IA 3GTQB 3ND8A 5KGUA 1M8AA 3MHBA 4RGOS 1T5EA 3NP8A 2M9VA 3LX0A 5C0XJ 1EEFD 5JPMC 3WDNA 5C5LA 2KA7A 5KNBA 1DM0B 4K5XA 2B2YC 1JOOA 1XYIA 4XYQA 1SE3A 3HOWB 1S5ED 4UDUC 1IL8A 3OWEB 4JBWA 5NUCA 1DXMA 4DAPA 3J81L 1SMYC 3L7ZC 1VMPA 1I4QA 5M3FB 4RH6A 3F2UA 1SFOB 3DXJC 3WOFA 5C4XB 3NHHA 3H09A 4PMBA 2EYMA 4C3IB 3ZYYX 3I91A 5K5PA 1GJXA 4EVOA 4K8IA 3BVGA 3A54A 1EY0A 4M8AA 3TSSA 4BA1I 2ZXPA 2E76C 4C3JG 4BBSB 2OEOA 1EWHA 1EQTA 5JJZA 1G2TA 3J7YW 1STHA 1HQRD 3PIO3 3K7AB 1STNA 1O7LA 1OXXK 2CHBD 1U9RA 2F0DA 1ZYRC 3TDQA 2K04A 5CR3A 2Q8IB 3I4MB 1SNCA 3OMGA 5KIXA 3J80L 2E2HB 5J39A 4QIWB 4KN4C 1JB3A 3O13A 1SNDA 1RF2D 2F3WA 5FO8B 2IL8A 2IX3A 1PFBA 1Y8NB 1GUNA 1PTOF 2WAQB 1PZID 2CW0C 4J6HA 2F0PA 1SE4A 1LTSD 2EPBA 2EYLA 2CQAA 5FLXL 1PYWD 1BCPF 1DYQA 3EA6A 1DOLA 3SEBA 2TSSA 1E2ZA 1AZQA 3QO2A 5IGBA 1UEAB 3SDZA 1ILPA 2RSOA 2JEBI 3TZDA 4G7ZC 2AWNA 2HQEA 5D3IB 1HHVA 3I90A 1WTRA 1S5CD 2NTTA 2G9HD 3DM1A 4MHEA 2J7ZA 3EQLC 1SYGA 3HP3A 2B8FA 4TRDA 3CHBD 3HOZB 4HCEA 1I50B 4N9TA 5BN5A 4G57A 4HMJA 4YIJA 1DD2A 3HEJA 5A2QE 2Z1CA 2F0MA 2RSNA 1SYCA 2NWGA 3NE5B 3RD4A 3I4NB 3DWQA 1B9MA 4BA2I 1I4PA 5KNCA 4QF4A 1STGA 3OHXC 5IT9E 3M7NA 4FF4A 1OXSC 4CHTB 2KEEA 2F0EA 1BF4A 1A6XA 1EYAA 4RKBA 3DWPA 4OGQC 5EPJA 1HXYD 5IGDA 3T53B 2NVXB 3PIP3 3A8IE 3PUZA 1X3QA 5CGKA 5M3MB 1TY2A 4IQZA 3NTIA 1K8OA 1EIGA 1II3A 3BDCA 1CA5A 1D2BA 1SXTA 3EJIA 2F0IA 3TP6A 1QG7A 1PXUA 2K01A 2N88A 2A6HD 1SYBA 5I2YA 1KDAA 3I72A 5BN3A 3P7JA 5M5XB 4O1NA 1TWFB 1SSOA 1KLUD 4ZRZA 3RMHA 1TIID 4CJ2C 1J8IA 2K5QA 1EFID 3H91A 3E6ZX 4X3KA 1GHJA 1X32A 4IFDI 1A2TA 4KJOA 4UAIA 3I73A 1L0XB 4V190 4H7BA 4EQNA 2EZVA 2G9DA 4BS9A 1W6JA 4IUUA 2EXZA 4WFN3 1D5XC 1V1OA 2E75C 4B9WA 1LTTD 2X6GA 3V96A 3RUZA 4NMZA 3MTSA 4FXKC 2Z4IA 1A2UA 2DNCA 2EY2A 3QWNA 5M5WB 2PZTA 2RDGA 2Z4HA 1B3AA 4C56C 2PW5A 1WCMB 2EYJA 4BY7B 5EGTA 3SK5A 3S14B 2O5IC 4WJWA 5KYLA 1XX8A 4K2LA 5CV8A 3HS0C 5IODA 1BR9A 1B9NA 4DNTB 3ITPA 3MFYA 4IALA 1CHQD 1PZKD 5DEHA 3X3MA 1O78A 2NB0A 4RAUC 2XRQD 3R93A 4C3HB 3GTJB 3VA5A 2HDLA 2ID0A 3EFXD 4QB4A 1RTOA 2MHVA 2XSCA 2F0LA 2BE5D 4J1MA 1HTPA 2J0TD 3VYSA 1I4GA 1EQVA 3K6OA 4FF3A 3SXHA 5CBAE 4NKLA 4PNYA 4F7XA 3VR2A 2IX0A 1PLFA 5C0XG 3D6CA 2D9UA 3NQIA 2HUGA 5T1GA 3GTLB 3OPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HPC A;  2K33 A;  1OXV A;  1PMR A;  1OXT A;  3CRL C;  2E74 C;  1Q12 A;  4KKS A;  4DK1 A;  2L5T A;  3KLR A;  1B9M A;  1H9M A;  2A68 D;  1O7L A;  2E75 C;  4H13 C;  4H44 C;  5KNC A;  1OXX K;  5KND A;  2ZT9 C;  2BDO A;  3PUV A;  3U9S A;  4DK0 A;  4KMU C;  3VA7 A;  1OXU A;  1GHK A;  2EJG C;  1Z7T A;  1ZKO A;  2B8G A;  3VR5 A;  2EDG A;  2DN8 A;  1ZYR C;  3M7N A;  1GUT A;  1GUS A;  1OXS C;  2YYZ A;  3CRK C;  2Q8I B;  1VF7 A;  2IT1 A;  1FYC A;  3A7L A;  3VR3 A;  4RCN A;  4OO1 G;  1A6X A;  4KN4 C;  2AWO A;  2NN6 G;  4KI0 A;  1VCI A;  3ND8 A;  4HR7 B;  4OGQ C;  1IW7 C;  1G29 1;  1VF5 C;  2K7V A;  4DNR B;  3I4L A;  5JEA H;  3T53 B;  4BA2 I;  1H9S A;  2A6E D;  2DNC A;  3GQB A;  2D5D A;  3N6R A;  1T5E A;  1DCZ A;  4GZY C;  3VR6 A;  3H94 A;  1Y8N B;  1GUN A;  3A8I E;  4JK1 C;  3TZU A;  2BE5 C;  3PUZ A;  3OOC A;  2JXM B;  4H0L C;  3FPP A;  1V43 A;  1TKW B;  2LMC B;  2O5I C;  2AUK A;  5K36 G;  2BA0 A;  4IQZ A;  2JE6 I;  4TQU S;  3WDN A;  3QJY A;  2KA7 A;  2A68 C;  1K8O A;  4LJZ C;  1IYU A;  3MXU A;  2CW0 C;  4OO1 H;  5KNB A;  5C0X H;  2BA1 A;  2NN6 I;  4L8J A;  3SE0 A;  1H9K A;  2EVB A;  2A69 C;  1HCZ A;  2DNE A;  1HQM C;  3D31 A;  4PV1 C;  1IYV A;  1H9R A;  1B9N A;  4DNT B;  1LAC A;  4KKT A;  4XIG S;  3MFY A;  3T56 B;  3GD7 A;  4KHZ A;  2KCC A;  2QF7 A;  5A35 A;  3VR4 A;  3D4R A;  4G7O C;  3PUW A;  2PPB C;  1CI3 M;  1Y8P B;  2A6H D;  1O78 A;  1FR3 A;  2NN6 H;  1H9S B;  4JBW A;  1DXM A;  2D62 A;  1E2Z A;  3I72 A;  1SMY C;  3L7Z C;  3OW7 A;  1E2W A;  5BN3 A;  2V4D A;  4KN7 C;  5K36 H;  1VDZ A;  4G7H C;  1V8Q A;  3W3A A;  2JEA I;  3IKJ A;  3QIA A;  1YNJ C;  3SDZ A;  2JEB I;  1YNN C;  3P20 A;  3ND9 A;  2AUJ D;  4G7Z C;  1CFM A;  4IFD H;  3DXJ C;  1TU2 B;  3PUX A;  1Z6H A;  3A8K E;  4LK1 C;  3M4Y A;  1I6V C;  2BE5 D;  1LAB A;  3EQL C;  1Q90 A;  2B8F A;  1BDO A;  3A7A B;  1HTP A;  2A69 D;  2A6H C;  3PV0 A;  5BN4 A;  1QJO A;  1GJX A;  3BDO A;  3T51 B;  4I7Z C;  1Q1E A;  1GHJ A;  1IW7 D;  3A8J E;  4KKU A;  1CTM A;  2O5J C;  1Y69 U;  4BA1 I;  1ONL A;  3RLF A;  4TKO B;  3FMC A;  5BN5 A;  3IFT A;  4IFD G;  1DD2 A;  2E76 C;  3VR2 A;  1GUG A;  2EJM A;  3PUY A;  2PCF B;  3M85 A;  3AB9 A;  2D2C C;  3HGB A;  3I73 A;  5C0X G;  1Y8O B;  1K8M A;  2EJF C;  2A6E C;  1GUO A;  3LNN A;  3QG1 A;  2F1M A;  3BG3 A;  1H9J A;  1EWH A;  2R6G A;  1Q1B A;  3NE5 B;  4XTC S;  2PNR C;  5JEA G;  1E2V A;  3LWU A;  3OPO A;  2K32 A; 
#chains in the Genus database with same CATH topology
 1MGS A;  2UXC L;  1Q12 A;  5JAV A;  4ZK9 B;  1TWA B;  2KCT A;  2B2V C;  1F9R A;  3SK8 A;  3GTK B;  1EY6 A;  1Y69 U;  2RKS A;  2PZW A;  4KMU C;  4CKB A;  5I4D A;  2RDH A;  4JI7 L;  2LS0 1;  3OIQ A;  3F2C A;  1CA6 A;  2PQE A;  2F0K A;  1TWH H;  5I2X A;  4DR1 L;  1TR5 A;  4OO1 G;  5IYD G;  3Q22 A;  3W1G A;  4NP5 A;  2WKD A;  4YCW A;  2UUA Q;  1KDB A;  1GOZ A;  4RA8 A;  1FJG Q;  2OCE A;  2XGT A;  2HHH L;  1WCM G;  3C1F A;  2GVB A;  3UI2 A;  2IWH A;  2A74 C;  3ULP A;  3CQZ H;  3CCJ A;  1SEB D;  5C3E G;  3FPP A;  2VB3 X;  1NUC A;  5K36 G;  1YHB A;  2EXD A;  4UP9 A;  3T1Y Q;  3IRB A;  2YTV A;  4R8N A;  3LWE A;  3MXU A;  3M3Y H;  2NN6 I;  3SR1 A;  1PZJ D;  4IUN A;  4DV7 L;  2E2I B;  2F0H A;  5JVG 3;  2F0J A;  2DY8 A;  3A5Z B;  4HJA A;  4BY1 G;  2OWO A;  4DGZ A;  2UUC Q;  3NEM A;  1DOK A;  1CI3 M;  1PRT D;  1Y8P B;  5CC4 A;  2GA4 B;  4BWG B;  3K57 A;  2JP1 A;  4K0K Q;  3PO3 H;  4FF1 A;  1E3P A;  1TS5 A;  1ESR A;  1YI2 A;  3E3X A;  4NDX A;  2EYH A;  3OW7 A;  4X65 L;  3GTP B;  1VMC A;  4KN7 C;  1VDZ A;  4R4C A;  4XQJ A;  4LF9 Q;  5JJL A;  2Z9H A;  5A2Q L;  4A3F G;  3HG9 A;  3E9I A;  1QCB D;  4JC0 A;  2I5M X;  4ZKC B;  1CKO A;  5CBE E;  1X3E A;  1HNZ L;  2PO4 A;  2R7F A;  3M4Y A;  4ODG A;  4L5T A;  3BDO A;  3BVM A;  3PF4 A;  2OQ0 A;  2CQO A;  4DV5 Q;  2ALY B;  1EQQ A;  1K9M C;  2HCC A;  2MPM A;  1CTM A;  4IZ8 A;  1SNQ A;  3ICE A;  4PMC A;  1JIC A;  3OTO Q;  4LF5 L;  4LFC Q;  1GUG A;  4C2M H;  2JA8 H;  3NBH A;  3AEV A;  3M4O B;  3K81 C;  1Q1B A;  1EEI D;  1HJP A;  1F9S A;  2VXW A;  2FMM A;  1LT5 D;  1O7Z A;  1EZ6 A;  1BQQ T;  5KND A;  2WV6 D;  1TWG B;  1ESF A;  3U9S A;  4DK0 A;  5E3F A;  2KCN A;  3GO5 A;  4JI1 L;  4IPD A;  4X3S A;  1QNK A;  3HOY G;  4Y7N H;  1GUT A;  4DR7 Q;  4OX9 Q;  1KIX A;  4XQQ A;  3MXN B;  2WIN B;  4A3M H;  2E2H H;  3GQB A;  3HFZ B;  4L5Q A;  3VR6 A;  3H94 A;  1PVO A;  4UP7 A;  5IY0 A;  3TZU A;  4AH6 A;  2FJ2 A;  1EZ8 A;  4DV3 L;  3BVZ A;  2NZH A;  1F2M A;  5IGC A;  1AW7 A;  4RGT A;  1O7Y A;  4DV1 Q;  4YY3 L;  3CQZ B;  2A68 C;  3AU7 A;  1A15 A;  4BY7 H;  1SYE A;  4Q0F A;  4AYB G;  4LF6 Q;  3T4A C;  1L1O C;  2AKW B;  5L37 A;  5CV4 A;  2EVB A;  3RZD B;  1HCZ A;  4PV1 C;  3WOE A;  1LT6 D;  4JV5 L;  4UHV A;  1Z47 A;  2FIN B;  3CP0 A;  4KY7 A;  4XT1 B;  2B2U A;  1SFO H;  2K5W A;  3JAM E;  1WTX A;  3GTP H;  3OW2 A;  2DY7 A;  3TS2 A;  3U58 A;  1MSG A;  3ER0 A;  2R7Z G;  2I07 B;  4KY6 A;  2XNA C;  4AYB B;  1XNR L;  5K36 H;  2L0C A;  2NTS A;  1VQF A;  1YNN C;  4KD3 A;  3ULJ A;  1O7I A;  2AUJ D;  2QW7 A;  5EKK A;  4RHR A;  2Y0S B;  1LTI D;  1YJ9 A;  1E1O A;  1PH2 A;  1BUV T;  1R9T H;  1J5E L;  1STY A;  2R3Z A;  1L1O A;  1K0S A;  4LNQ A;  1TWC H;  1NR4 A;  2ZTC A;  3K8A A;  3HOX G;  1G8Z D;  1LLR D;  5FLM G;  3K58 A;  4P74 A;  5C0X I;  3KUP A;  2EYP A;  4B3M L;  3A0J A;  3L2P A;  3RLF A;  4NB3 A;  4FYD A;  5BR8 L;  2MO0 A;  4DN4 M;  1XPR A;  5FO9 B;  4A3F H;  3AB9 A;  1V1Q A;  1Y1V G;  1F2L A;  1Y8O B;  3D4D A;  2XWJ B;  3RN2 A;  2WAQ G;  4DPG A;  3DEP A;  1M4V A;  5JEA G;  3G71 A;  3E0J A;  4KHP Q;  1WD0 A;  1VQE A;  4CGY B;  4ZUI A;  3TP5 A;  3A55 A;  1HNW L;  3PIO A;  1ET9 A;  4MTN A;  3VR5 A;  3KBX A;  4RGN A;  4X62 L;  5M5Y B;  2K5N A;  3CRK C;  5D65 A;  1RTN A;  3V2T A;  2CFM A;  2WKC A;  4CKE A;  1S4Z A;  1LTL A;  2JA7 G;  4HR7 B;  4OON A;  4M1U B;  2NVT H;  1K8A C;  1DCZ A;  1Y14 B;  2BCO A;  2BE5 C;  1LM0 A;  3J7Z C;  4KK7 A;  2QEX A;  4QQB X;  4H0L C;  3K0X A;  2K28 A;  1WTQ A;  1U4R A;  2BA0 A;  4NXN L;  1Q8K A;  1X3F A;  1B4O A;  5FOB B;  5IGF A;  1A8V A;  3DLL A;  1ET6 A;  2KEC A;  3TN2 A;  4JI7 Q;  2ZM6 L;  1I94 Q;  1LT4 D;  2Z0S A;  3UE0 A;  4K5W A;  3PO2 H;  2Q8R E;  3L9A X;  4NPS A;  3S16 B;  1IZ6 A;  5FK9 C;  2L4N A;  4KHZ A;  1ZEQ X;  1PH5 A;  4KLK A;  1ZYR D;  2MJ8 A;  3HZX A;  1L2F A;  2PMZ B;  3FVQ A;  4G4K A;  1K28 A;  3DUZ A;  3HRZ C;  1KXL A;  4LW1 A;  5DNF A;  4GKJ Q;  1AE2 A;  4LMQ D;  1KNA A;  4A93 B;  4LF9 L;  2KUM A;  1I6V C;  5DLQ E;  4RHS A;  4JI4 L;  1Q90 A;  2K50 A;  2K5V A;  4LF8 Q;  2A69 D;  5EKI A;  4BBS H;  4ZAI A;  1EWC A;  3VYU A;  3CC7 A;  4KKU A;  1F9Q A;  3AFQ A;  2R93 B;  3HOZ H;  3DMU A;  1MHW C;  3H0G B;  3I2Z A;  1MJE A;  1BNZ A;  3IFT A;  4IFD G;  2R93 H;  1FNW A;  2B2Y A;  5IGE A;  3HOU B;  2R7Z B;  1R9T B;  2K1B A;  1EFW A;  2F1M A;  4YCV A;  4A75 A;  4P73 A;  2R6G A;  1KDC A;  1QOH A;  2MFI A;  4PZ8 A;  3PSI A;  5CV6 A;  1Y1V H;  1CZW A;  2WB1 E;  4R4T A;  1S3O A;  1BBX C;  4DK1 A;  2DJF C;  3PO3 G;  1S5F D;  1JWM D;  5M5X H;  1NMF A;  5C3E H;  1A0I A;  3HOW G;  2DN8 A;  1GUS A;  4CBV A;  4GOP C;  1N36 Q;  1IL2 A;  4A3E G;  1TT2 A;  4OL7 A;  2IT1 A;  4K6L A;  2Q2T A;  5COR A;  4MIU A;  2XIW A;  2NN6 G;  4ZQ3 A;  1STE A;  5EQ0 A;  1N33 Q;  2MUY A;  4NW2 A;  1RJT A;  1CK1 A;  3MZ5 A;  4BBR H;  1C7Y A;  3M3Y B;  4A3C H;  1R4Q B;  2F3V A;  2HD3 A;  1DON A;  5CV5 A;  1VQI A;  2UXD L;  1JCK B;  1WTH A;  2H1E A;  4QUC A;  3QJY A;  4JG2 A;  3W2D A;  1E1T A;  2KVM A;  4LFB L;  1FD7 D;  1UE1 A;  1XJV A;  1ROD A;  1STB A;  3MEF A;  1BCP C;  4GLX A;  5C4H A;  1IBK L;  1WD1 A;  3G6J B;  4DR6 L;  1GUW A;  2QF7 A;  3D4R A;  1D6E C;  2R92 G;  4LWC A;  4GN4 B;  4DR2 L;  4JV5 Q;  2JA7 B;  4C3H H;  2YU9 B;  5I9P A;  1TXY A;  1F77 A;  2KHS A;  3W3A A;  4ALP A;  1K73 C;  1QIL A;  1KAB A;  1CFM A;  2F0V A;  3W5O A;  3PO2 B;  4B3R Q;  1TS4 A;  2B63 H;  2VNU D;  4K6D A;  4HED A;  3I8Z A;  2MP1 A;  5LL6 S;  5CYU A;  5FO7 B;  2PZU A;  4B3S Q;  3PV0 A;  1DJR D;  5LHY 1;  2HIX A;  4L63 B;  3NUC A;  2ZXO A;  3ERS X;  5DM7 3;  4R4Q A;  3MFG A;  2JA8 B;  5GAH C;  1ONL A;  4ILW A;  4BXX G;  4A3B B;  5TSS A;  2C9O A;  1EY5 A;  1L1O B;  2NVX H;  2K4K A;  4BBR B;  3Q8D A;  1M1K C;  5C4Z A;  4N8X 1;  4OIJ A;  3H15 A;  4EQO A;  4GLV B;  2FXQ A;  3HOX B;  4A3B H;  3CRL C;  3QOL A;  1NTG A;  3K59 A;  5GQO A;  3R2T A;  4PQX A;  1MJC A;  4IO9 A;  1FGU A;  4ULL A;  2B2W A;  4QUF A;  2RCN A;  2ZT9 C;  3PUV A;  1ASZ A;  2NZ1 D;  1YNX A;  3J81 j;  3FEW X;  4LUO A;  4C3I G;  2K05 A;  1VQH A;  2E2J H;  1Y1V B;  1EYC A;  1SRU A;  2X69 A;  3CU7 A;  3GTG H;  2CH4 W;  3FRP B;  2EY1 A;  3I4L A;  1ASY A;  1SLJ A;  2E5L Q;  2OXP A;  3DWA A;  2JJQ A;  4NXM Q;  4PMW A;  2D5D A;  3NK9 A;  1HNX Q;  4JK1 C;  2L55 A;  1JJG A;  4IPG A;  1QZG A;  4X64 L;  1XXG A;  2IJ0 A;  2MQH A;  1ZXT A;  2KHI A;  2JA6 B;  1IYU A;  1JQY D;  5C0X H;  5C4X G;  3X3N A;  4JI6 Q;  3MEH A;  2A69 C;  4F8M A;  3OTO L;  1SNO A;  1J6Q A;  1SMY D;  5GAD C;  4L5R C;  2ZTD A;  4JI5 L;  1LAC A;  5HGQ A;  3T56 B;  1PH8 A;  2NZO A;  4DV2 L;  1S5D D;  3ONA B;  4B3T L;  1H9S B;  5F2D A;  2G5D A;  2QDL A;  3HKZ E;  4L6T B;  1Q86 C;  3MAQ A;  1TWG H;  1V8Q A;  3MC0 B;  3P20 A;  5FLX c;  1G2S A;  1ENF A;  1HTL D;  2ENB A;  3URY A;  4IJH A;  3S16 H;  3TBI B;  2RQX A;  3S1M B;  2IW3 A;  4ZYS A;  4LUV A;  3A7A B;  1PDQ A;  4C1N K;  3FDT A;  2F4V L;  5C44 B;  3A8J E;  4HCS A;  3CCV A;  4S3S A;  1D5Z C;  1IXR A;  1SYF A;  5C4J B;  1TS3 A;  3HGB A;  4IPC A;  1MBY A;  1K8M A;  4IUT A;  3A56 A;  5HY6 A;  1KAA A;  1TVX A;  1SAP A;  2K33 A;  2F52 A;  2UXD Q;  5I6W A;  3F1Z A;  1VS0 A;  1LO5 D;  1SJH D;  5M5Y H;  1LV9 A;  2R7Z H;  1K3B C;  2BDO A;  3KLS X;  1Y1W G;  2FFK B;  3D4W A;  1OXU A;  4LF7 L;  3Q23 A;  2R93 G;  1BKB A;  1HRJ A;  3CCE A;  3GTG B;  3K0Y A;  3ULL A;  1FYC A;  1QUQ A;  4DV1 L;  2WII B;  1DZ1 A;  2LKV A;  2NVQ B;  4OEM B;  1VCI A;  1X3G A;  4B08 A;  3I4N H;  1W6K A;  3N52 A;  2E2J B;  3STB C;  4UY8 C;  1SNP A;  1J5E Q;  2QEJ C;  1UNS A;  2PI2 E;  3G7L A;  2ZJQ A;  3M7G A;  3HOY H;  4CJ1 B;  5AJ3 L;  1FJG L;  5M5W H;  2SOB A;  2VB2 X;  2X6L A;  2NVY H;  1UE5 A;  4A3E H;  2Q2I A;  3NPP A;  1BOS A;  3P1H A;  1WTW A;  3TP7 A;  1N34 Q;  3S1Q H;  3I4M G;  3FKI G;  4AIM A;  1H9R A;  1X54 A;  3A74 A;  2F0G A;  4DUZ L;  1JC7 A;  3R3O A;  3S1Q B;  3PO2 G;  4DK6 C;  4G7O C;  2GVA A;  2OQK A;  1YNN D;  5J1Z A;  4XQN A;  4GN5 A;  1ICW A;  1OO9 B;  2VS1 A;  2UUA L;  4F87 A;  3SVM A;  2F0T A;  2M2L A;  4U67 3;  2V4D A;  2N49 A;  2R61 A;  1LTA D;  2WAC A;  3JAM L;  1SE8 A;  1U4L A;  5I6Y A;  3HOV B;  5ELD A;  1HA5 A;  1HFG A;  2LY7 A;  4HN7 A;  4IFD H;  1HFN A;  2K75 A;  1H95 A;  1PRT F;  1YZ6 A;  2EOT A;  4K5V A;  4X3U A;  4EQP A;  3QB3 A;  4FNF A;  4FDB A;  1SBB B;  4BXX H;  2UXC Q;  5E4X A;  4N8F A;  1PFN A;  3VYR A;  2ATW A;  1E7Z A;  1D5M C;  3RN5 A;  4FF2 A;  3HOU G;  2PCF B;  2TMP A;  3MXP A;  1JT8 A;  1N8R C;  4LFC L;  1AP0 A;  3BZD B;  4DA2 A;  1H9J A;  1CZG A;  4POF A;  5M9O A;  5LMN Q;  2K32 A;  1VQ8 A;  1OXV A;  1I3Q H;  4YHH L;  4KKS A;  3J80 c;  3C46 A;  4QJF A;  3Q6S A;  1H9M A;  1XPU A;  1X56 A;  2CWA A;  3VA7 A;  1CKN B;  2EJG C;  4OEL B;  1PYS B;  2EDG A;  1LYL A;  2VW9 A;  1VF7 A;  4CDC C;  2CW0 D;  1EY4 A;  3KK7 A;  2MO1 A;  3VYT A;  4LF6 L;  2BDN A;  1CKM A;  4DF7 A;  2B2W C;  2J4X A;  4U68 A;  1MD2 D;  1U4M A;  2B29 A;  2ICI A;  4DV6 L;  1QNU A;  1H9S A;  1UE6 A;  2H4O A;  3K5M A;  1RDP D;  3OMC A;  3I3C A;  1XNQ Q;  1NE3 A;  2PQA A;  1PYB A;  4DXF A;  3HOV H;  2K14 A;  2RDF A;  2QCP X;  4GKK Q;  4TQU S;  4JPB W;  5J22 A;  2E2D C;  4DV0 Q;  1I6H B;  1VQD A;  3NTK A;  4A3J B;  3KF6 A;  1WTV A;  4RWS C;  2UXB Q;  1H9K A;  1UUP A;  3SK6 A;  1JE5 A;  2B3G A;  2UUB L;  4QMG A;  2VQE L;  5IWA L;  2LXJ A;  1F9P A;  5A35 A;  3JAM c;  2B2V A;  2XWB B;  3P75 A;  1VQ9 A;  3GTO B;  1FR3 A;  3HOY B;  5H1S E;  1E24 A;  2BH8 A;  1WI5 A;  4V0B A;  2D0P A;  4ABN A;  3U9O A;  5EBD A;  4I65 A;  1EWI A;  1RCV D;  1E2W A;  2SNM A;  2NVY B;  3C3L A;  2N3S A;  4HSV A;  3TP8 A;  3J81 c;  4MTK A;  3UE1 A;  4DAV A;  3CCS A;  4DAY B;  4LAA A;  4YY3 Q;  2F3I A;  4JW0 A;  1CSQ A;  3S1N B;  4GNX A;  3I7F A;  3KF8 B;  2MNA A;  4BY7 G;  1SDF A;  3J80 i;  2EYO A;  3DEO A;  1G6Z A;  4JOI C;  2VUM B;  1B44 D;  1QJO A;  4J8Q A;  1D7Q A;  3T51 B;  1O80 A;  4KHP L;  4OX9 L;  1L0Y B;  1A63 A;  1B1Z A;  3S15 B;  4GS3 A;  1KNE A;  2MGS A;  1T9H A;  4IN3 A;  2IX1 A;  3HOX H;  4C3I H;  4C1N I;  3CW2 C;  3KLS A;  2PNR C;  3EBE A;  1PMR A;  1TWH B;  5C4J H;  3K5N A;  2A68 D;  3BZK A;  4FVM A;  4DR6 Q;  1GHK A;  4A3J H;  4BY1 B;  1ZKO A;  1N34 L;  2NVT B;  5DM6 3;  4ZKB B;  3GTK H;  4ME5 A;  3T13 A;  2Y0S E;  3NTH A;  2ASB A;  3FKI H;  3NBH B;  4I7A A;  3NEN A;  4KI0 A;  4DV4 Q;  3CC2 A;  4DNR B;  4K8J A;  3IL8 A;  2PQA B;  2F0U A;  3NXW A;  1VQG A;  1K83 B;  1VQ5 A;  4R8I A;  1PTO C;  1Q81 C;  1SJE D;  5E7N A;  5C3X A;  3S1R B;  2FMC A;  3TEH B;  3PO3 B;  4TVA B;  1TKW B;  3CPW A;  3UDF A;  4A3K B;  1HZ9 A;  2QKI C;  5EPL A;  4IFD J;  1U0L A;  2DJG C;  5JVH 3;  2A73 B;  4QY7 A;  5C44 G;  5EAY A;  1PTO D;  3MXN A;  1EU3 A;  1C0A A;  1CQV A;  4QL5 A;  4B9X A;  1XNQ L;  4IUP A;  4RCO A;  1EOV A;  2E2I H;  3S17 H;  5KYI A;  1ICF B;  3FPU B;  4B3S L;  3V05 A;  1YJW A;  2D62 A;  1BCP D;  1EYD A;  3S2D B;  2L15 A;  3KDF B;  3MVV A;  4GN3 B;  4DU9 A;  3ERO A;  1TU2 B;  5KRU A;  3C2P A;  4HIK A;  4MNO A;  2F03 A;  1YEZ A;  2B2T A;  2KQ3 A;  2KEN A;  3CKI B;  3SK4 A;  2KED A;  4YWL A;  5FJ8 H;  4Q5V A;  1Q3L A;  3BDL A;  2IPK D;  4FXD A;  1RL2 A;  3CAM A;  4IOC A;  3E9H A;  4CKC A;  3JAM i;  3I56 A;  2O5J C;  4A3G G;  3H0G G;  2JSO A;  2Z6K A;  2JA5 G;  5E4W C;  1WCM H;  2ICE C;  1G91 A;  1MSH A;  4A3K H;  1QE6 A;  4UP8 A;  5I9O A;  4LF7 Q;  2AMC B;  3S2H B;  1B3Q A;  3PIP A;  3KJP A;  1VQB A;  2CH4 A;  4ZCK A;  3S24 A;  4JI8 L;  3IFD A;  5JPN C;  3SHL A;  4DV5 L;  5LL6 X;  1ILQ A;  2AQ2 B;  3KLR A;  4IUQ A;  4ME3 A;  2JA9 A;  2N8N A;  5C3W A;  3PMF A;  3UDX A;  2ZJR A;  1I4R A;  4DAM A;  1S40 A;  1EIF A;  4PZ7 A;  3BYT B;  4YCU A;  2ZXR A;  4QGU A;  4KTA A;  3A7L A;  3J7A 5;  1KAW A;  3PF5 A;  2XN9 C;  1IHZ A;  4L5S A;  1VF5 C;  3I55 A;  1B2T A;  5JEA J;  3HKZ B;  4CDE C;  1SNM A;  5G3L F;  1HNZ Q;  4HID A;  4Y7N B;  5CV9 A;  4QCL A;  1FVI A;  2SNS A;  2LMC B;  1CT1 D;  2AUK A;  5IP9 H;  1B50 A;  2CVR A;  4A3I B;  1E0B A;  4DV4 L;  4LJZ C;  1PRT C;  1EY7 A;  1K83 H;  2BA1 A;  4L8J A;  5HGT A;  5LMN W;  1IYV A;  2DNE A;  1EIH A;  1GD7 A;  3Q0A A;  4Z9C B;  5FLM H;  1Q82 C;  2UU9 L;  1YVC A;  5CV7 A;  1JJ2 A;  3MWY W;  2KCC A;  1SMX A;  2F4I A;  5ELF A;  4WJ4 A;  2NN6 H;  5GAG C;  1FGB D;  2VUM G;  4XDX A;  5IIF A;  3C1E A;  1TS2 A;  4G7H C;  4O42 A;  1A62 A;  4RGM A;  1YNJ C;  4POG A;  4E6I A;  3S1M H;  1C48 A;  4KJN A;  2HDM A;  1CSP A;  5ELC A;  5C5M A;  3J7A F;  4IUV A;  3GTO H;  1IKM A;  4LK1 C;  2FHT A;  2K5D A;  1NR2 A;  1JOK A;  4DNI A;  1AEX A;  1Q8I A;  1VQC A;  3VDY A;  2QIL A;  3TRZ A;  3R8B A;  1Z9F A;  1FL0 A;  2Q8T A;  4HMI A;  1Q1E A;  3NQT A;  3CME A;  1PV4 A;  1GXD C;  2NBF A;  1I6H H;  1WFQ A;  4TKO B;  3FMC A;  1D8L A;  2PI2 A;  2EJM A;  3M85 A;  3W1B A;  1IBK Q;  1TQO A;  2A6E C;  3OYY A;  1QWY A;  1BVS A;  1J9O A;  2R92 B;  1PA6 A;  2LFN A;  1BCP B;  1RHP A;  2NVQ H;  1IBM Q;  5ELB A;  1WYD A;  5C4X H;  1PH3 A;  2L12 A;  5FKA C;  1PTO H;  1JR0 D;  4A3L G;  4X6A H;  3NWT A;  4IJL A;  2F0W A;  1VQN A;  2Y0S G;  2O2L D;  1FNU A;  1I4X A;  4FP5 D;  4C3J B;  1AH9 A;  3AFP A;  1G6P A;  1EY8 A;  4AQY L;  1C4Q A;  1GO3 E;  1PH4 A;  2A8V A;  3ERQ A;  2YYZ A;  5JJI A;  2UUB Q;  2KCM A;  3J81 i;  1PTO B;  1VQJ A;  3TME A;  4A3M B;  2M00 A;  2AWO A;  4WOR A;  1DGS A;  1V1P B;  2RVL A;  1HUN A;  1G29 1;  1BO0 A;  3MXG A;  5DAU A;  3U50 C;  2GN5 A;  4A3G B;  2OTJ A;  3I4O A;  5IGG A;  3K5O A;  1MKH A;  1NCV A;  2K03 A;  4XXE A;  4A3I H;  4CDD C;  4HJ5 A;  2JXM B;  2K6A A;  1I50 H;  2JE6 I;  1XPO A;  2NUC A;  4A3C G;  1KLG D;  4OO1 H;  1YNJ D;  5D3D A;  1X65 A;  1N36 L;  4OO1 I;  1CHP D;  3GTL H;  1HQM C;  4R4I A;  3EVQ A;  3MA2 B;  1AE3 A;  2JYO A;  4IUR A;  3RZD H;  4N9P A;  4DFA A;  3PUW A;  2QDB A;  1WTO A;  2B2T C;  2E5L L;  1QVG A;  4LF4 Q;  4P2C B;  5D14 A;  2LSS A;  4HTH A;  2A5H A;  1VQ7 A;  2JEA I;  2C35 B;  3QIA A;  1SE2 A;  4O2D A;  2F0O A;  4F88 A;  5C44 H;  2RA4 A;  2YTY A;  1HZB A;  4Y52 H;  2N55 A;  3GV6 A;  1LTR D;  1HH2 P;  1UWV A;  1SYD A;  3KJO A;  3D3R A;  1LAB A;  4HSP A;  4KV6 A;  2EY6 A;  4GLA C;  1AFP A;  1VQK A;  2F0Q A;  2A6H C;  3GV3 A;  2Q2H A;  4KY5 A;  5BN4 A;  4JI5 Q;  3CXC A;  3H6M A;  4X3T A;  3T1H L;  4YWK A;  2PYK A;  1IW7 D;  1HA6 A;  4O0A A;  1Q46 A;  3OIP A;  3T16 A;  1EY9 A;  1XWE A;  4B3T Q;  1GKH A;  4RG1 A;  3GTJ H;  3OSO A;  4FXG C;  4DR4 Q;  1E22 A;  1WOC A;  1XMO Q;  2JA5 H;  2OF1 A;  4JBM A;  1A3V A;  4IPH A;  2WP8 J;  3HOV G;  1HR0 L;  1LTB D;  2EJF C;  2RBM A;  3J81 E;  3AMU A;  4A3G H;  2JN4 A;  3BG3 A;  1HNX L;  4MN3 A;  4DV0 L;  2AHO B;  4HJ8 A;  4NXM L;  1WTP A;  1EU4 A;  5IT9 L;  1E2V A;  4DXG A;  1BXT A;  1PFS A;  1QB5 D;  4GNX B;  3S14 H;  4DR3 Q;  4A3F B;  2L5T A;  1EIY B;  5IYD H;  3KBG A;  4LUZ A;  3S2D H;  4DUY Q;  1Z7T A;  2I46 A;  3AYH B;  4HIO A;  1LTG D;  5J3B A;  1X6O A;  5IYB H;  1AN8 A;  1B53 A;  5EPK A;  3CF5 A;  1KRS A;  5EBC A;  2VZA A;  1ENC A;  2NYZ D;  4RCN A;  1C8C A;  2F4V Q;  4YHH Q;  2F0F A;  1TWC B;  3S9W A;  2HIV A;  2K7V A;  1KTK A;  1XMQ Q;  4K0K L;  2PMZ E;  3N6R A;  4DUZ Q;  4UPA A;  1EOT A;  4CJ0 B;  1NBW A;  3RZO B;  1V43 A;  4LFB Q;  1OTC A;  5G3L D;  2XRS D;  5IYC H;  3K5L A;  5IP7 G;  4RKL A;  3GTM B;  2KJX A;  1XTC D;  4OWW B;  1WVL A;  1STA A;  2B39 A;  2ZJP A;  1RKN A;  4KKT A;  2B63 B;  1D1K A;  1M90 C;  1D1I A;  2JK8 A;  1ML0 D;  1Y1W B;  3VR4 A;  2EY5 A;  2PPB C;  3OWF A;  3J80 E;  3KDF A;  3CPF A;  5COY A;  4A3E B;  5EKL A;  4EGV A;  1NSN S;  4DV2 Q;  4A76 A;  3RNU A;  2JA7 H;  1JWS D;  3PQI A;  3D6W A;  2L9H A;  1CKN A;  3ND9 A;  2RHS B;  4X64 Q;  3BJU A;  4JBK A;  3PUX A;  4A3J G;  4A3D H;  1MI2 A;  2A1A A;  3J7A V;  2XTI A;  3A8K E;  1RD9 D;  2EIF A;  4ZUJ A;  2L11 A;  1CM9 A;  1IKL A;  1VQP A;  2CKZ B;  2WB1 B;  4A3D B;  2SEB D;  1BDO A;  2VQF L;  1HUM A;  1NY4 A;  4RFB A;  5FJ8 G;  1G51 A;  4I7Z C;  1HZC A;  2HQL A;  2UUC L;  3D8G A;  1I4H A;  1DOM A;  3K7A H;  4P72 A;  2JA5 B;  2L1B A;  3Q24 A;  3IAY A;  1U4P A;  2EE1 A;  5ISR A;  1PH6 A;  5CMD A;  3LNN A;  3T1Y L;  3PCO B;  3QG1 A;  4DAY A;  3QOJ A;  1WJJ A;  4XTC S;  2JA6 G;  4R4O A;  3H3V C;  1HPC A;  5AFW A;  1OXT A;  5ELE A;  4DV3 Q;  2B2U C;  1PRT B;  4XT3 B;  1JOR A;  4MZ9 A;  4H44 C;  3CCU A;  4OIK A;  4C2M B;  4OHJ A;  2B8G A;  4ZLT F;  5HUR A;  5IE8 A;  3E5S A;  1JWU D;  5C6A A;  2PW7 A;  3I70 A;  5IOC A;  5BR8 Q;  1F2Y A;  4JVZ A;  2O4X A;  1NAP A;  1K8G A;  2RHQ B;  3G48 A;  1A3U A;  1IW7 C;  4JI0 L;  5JEA H;  2AQ3 B;  2A6E D;  3QR8 A;  4K2K A;  2CWP A;  3NBI A;  4GZY C;  3BYY B;  4ID6 A;  1R4P B;  2XVS A;  3OOC A;  4C3H G;  3NSW A;  4A3M G;  3K80 C;  2BOS A;  1EL0 A;  3SE0 A;  3D31 A;  2Z8L A;  5JOB A;  2QA4 A;  4XIG S;  3L0O A;  2WFW A;  3GD7 A;  2F0N A;  3DHQ A;  3K7U C;  5LMU Q;  4JI4 Q;  4IOA A;  2AQ1 B;  3BS1 A;  4KHV A;  1S5B D;  4XYO A;  5E1F A;  4K14 A;  2VQF Q;  2BH2 A;  1AZP A;  2Q2U A;  4JBJ A;  3D0F A;  3IKJ A;  4C3J H;  1CQF A;  4QIW E;  4BBR G;  4FO2 A;  1X3P A;  1Z6H A;  3GP7 A;  1XMO L;  3S17 B;  1JOQ A;  3H3V H;  4DR3 L;  4A93 H;  3GTQ H;  1N9W A;  5T1I A;  3RZO H;  1TWF H;  4JCV E;  2PNH A;  1NNX A;  3G6E A;  1IYJ B;  1UE7 A;  1T5X D;  1TWA H;  1F2Z A;  4R9W A;  4HAE A;  3PUY A;  1LT3 D;  2D2C C;  5GRO A;  2KBN A;  1PFM A;  2LXK A;  5EJW A;  3NWS A;  1X9N A;  2SDF A;  1GUO A;  3L3O C;  4KD4 A;  2N78 A;  1FNV A;  4BBS G;  1TY0 A;  3LWU A;  1ENA A;  4JI1 Q;  3UDI A;  2E74 C;  3FKI B;  1YBY A;  4WJ3 M;  5KEE A;  2UU9 Q;  4H13 C;  2HCI A;  4TSS A;  4JI2 Q;  2C5C A;  1I3Q B;  2OT2 A;  1QUQ B;  1A3T A;  2F0S A;  3ZJY C;  5FLX E;  2UXB L;  1V1P A;  5C3E B;  3KF8 A;  2KOL A;  4PG3 A;  2H5X A;  3VR3 A;  1JE4 A;  1UAP A;  4WRD A;  2EYF A;  3R2I A;  3GTQ B;  3ND8 A;  5KGU A;  4LF4 L;  2JA6 H;  1N32 Q;  1M8A A;  4JI2 L;  3MHB A;  3BU2 A;  4RGO S;  1T5E A;  3NP8 A;  2M9V A;  3TS0 A;  3LX0 A;  5C0X J;  3U4V A;  4DV6 Q;  3I4M H;  1EEF D;  3TRE A;  3F2D A;  3CD6 A;  5JPM C;  3WDN A;  4DR1 Q;  5C5L A;  2KA7 A;  4EX5 A;  4B3R L;  2RCF A;  2WAQ E;  1KC8 C;  5KNB A;  3M4O H;  1DM0 B;  4K5X A;  4X65 Q;  2B2Y C;  4RMF A;  5M3F G;  1JOO A;  1QVC A;  1XYI A;  3S1N H;  4XYQ A;  1SE3 A;  3HOW B;  3CCR A;  1S5E D;  4UDU C;  3WWV A;  4B3M Q;  1IL8 A;  3OWE B;  4HJ7 A;  4JI3 Q;  2WB1 G;  4A3D G;  4EQ5 A;  4JBW A;  5IP9 G;  5NUC A;  1DXM A;  5LMN L;  4DAP A;  3J81 L;  1SMY C;  3L7Z C;  1VMP A;  1HR0 Q;  1I4Q A;  5M3M G;  5M3F B;  4RH6 A;  3F2U A;  3DM3 A;  1SFO B;  3DXJ C;  4OWT B;  1Y1W H;  3WOF A;  5C4X B;  3NHH A;  3H09 A;  1IBL Q;  4PMB A;  3AQQ A;  1W3S A;  2EYM A;  4C3I B;  1NMG A;  2R92 H;  3ZYY X;  3I91 A;  5K5P A;  1XNR Q;  1GJX A;  2HT1 A;  4EVO A;  4K8I A;  3BVG A;  2IHF A;  3A54 A;  1EY0 A;  4M8A A;  3TSS A;  5LMU L;  4BA1 I;  5IYC G;  2ZXP A;  3B6Y A;  1KQS A;  2E76 C;  1IBL L;  4C3J G;  5IYB G;  4BBS B;  4AYB E;  4GKJ L;  2OEO A;  1EWH A;  3CCM A;  2EQS A;  1EQT A;  2IY5 B;  5JJZ A;  4DKA C;  1G2T A;  2K52 A;  3J7Y W;  1STH A;  1HQR D;  3CCL A;  3K7A B;  3PIO 3;  1STN A;  1O7L A;  1OXX K;  2CHB D;  3H0G H;  1U9R A;  2F0D A;  1ZYR C;  1I94 L;  3TDQ A;  2K04 A;  3CCQ A;  5CR3 A;  2Q8I B;  3I4M B;  1SNC A;  3OMG A;  5KIX A;  3J80 L;  4GNX C;  2E2H B;  5J39 A;  4QIW B;  4KN4 C;  1JB3 A;  3O13 A;  1SND A;  1CUK A;  2JA8 G;  1RF2 D;  2F3W A;  4DR2 Q;  1VQ4 A;  5FO8 B;  2IL8 A;  2IX3 A;  1PFB A;  1Y8N B;  1GUN A;  4LF8 L;  1PTO F;  4J15 A;  2KHJ A;  3UDG A;  3SGI A;  2WAQ B;  1SR3 A;  1EUJ A;  4DR7 L;  3CMA A;  3KLW A;  1U5K A;  2VL6 A;  1PZI D;  2CW0 C;  2ZTE A;  4J6H A;  2F0P A;  1LTS D;  1SE4 A;  2EPB A;  2EYL A;  2YTX A;  2CQA A;  3F8T A;  4OWX B;  5FLX L;  1YHQ A;  2QGQ A;  5JJK A;  1PYW D;  2I5H A;  1BCP F;  1DYQ A;  1MIU A;  1X55 A;  3EA6 A;  3EIV A;  3LGJ A;  1NJI C;  2I5L X;  5IT9 c;  1DOL A;  3EN2 A;  3SEB A;  1N33 L;  2TSS A;  2V1C C;  1HZA A;  1E2Z A;  1AZQ A;  3QO2 A;  5IGB A;  1V9P A;  1UEA B;  4LFA L;  3SDZ A;  4BY1 H;  2RSO A;  1ILP A;  2JEB I;  1JJC B;  3TZD A;  4G7Z C;  1QVF A;  4DUY L;  2AWN A;  2HQE A;  5D3I B;  5ELN A;  1HHV A;  3I90 A;  1S5C D;  1WTR A;  2NTT A;  3U4Z A;  2G9H D;  3DM1 A;  4MHE A;  2J7Z A;  2P5Z X;  3EQL C;  4A3I G;  2CCZ A;  1SYG A;  3HP3 A;  3S15 H;  2B8F A;  4TRD A;  1S72 A;  3CHB D;  3HOZ B;  1YIJ A;  5M3F H;  4HCE A;  1XMQ L;  1I50 B;  1KD1 C;  1VQA A;  4N9T A;  2VUM H;  2JQO A;  4JOI A;  5BN5 A;  4G57 A;  4HMJ A;  4YIJ A;  4JYA Q;  1DD2 A;  3HEJ A;  5A2Q E;  4AQY Q;  2Z1C A;  1P8L A;  2F0M A;  2RSN A;  1SYC A;  2NWG A;  2HHH Q;  3NE5 B;  3E0E A;  2IHE A;  3RD4 A;  3I4N B;  3DWQ A;  1B9M A;  4BA2 I;  2E8G A;  1I4P A;  1L0W A;  5KNC A;  1HR0 W;  4QF4 A;  3RLO A;  1STG A;  3PGZ A;  3S1R H;  3OHX C;  4HIM A;  2I0Q A;  5IT9 E;  3M7N A;  4JI6 L;  4FF4 A;  1OXS C;  1SN8 A;  1W2B A;  1KL9 A;  4CHT B;  5IP7 H;  2KEE A;  2F0E A;  1BF4 A;  3I4N G;  1A6X A;  1EYA A;  3KF6 B;  4RKB A;  3DWP A;  4OGQ C;  4GOP A;  5EPJ A;  1HXY D;  2DGY A;  5IGD A;  3T53 B;  2NVX B;  3KYH C;  3PIP 3;  3KOJ A;  3CC4 A;  3G4S A;  3A8I E;  3PUZ A;  1X3Q A;  3NEL A;  2K5H A;  5CGK A;  1RIP A;  5M3M B;  1TY2 A;  4IQZ A;  3FHW A;  1JMC A;  3NTI A;  1K8O A;  1EIG A;  1II3 A;  1BBW A;  3BDC A;  2ES2 A;  1CA5 A;  1D2B A;  1SXT A;  1XTD A;  3EJI A;  2F0I A;  3TP6 A;  1QG7 A;  4X66 L;  1I5F A;  3GDE A;  4A93 G;  1PXU A;  3M9B A;  2K01 A;  2N88 A;  2A6H D;  1SYB A;  5I2Y A;  3T1H Q;  1KDA A;  3I72 A;  5BN3 A;  3P7J A;  2DUD A;  1GM5 A;  5M5X B;  4O1N A;  4P71 A;  1TWF B;  1SSO A;  1KLU D;  4DV7 Q;  2RF4 A;  4JYA L;  4ZRZ A;  3H3V I;  3RMH A;  3TQY A;  1TII D;  4CJ2 C;  1J8I A;  5GAE C;  3JC6 6;  2K5Q A;  1EFI D;  4A3K G;  3A5U A;  3H91 A;  2D0O A;  1K3R A;  4PZ6 A;  4HJ9 A;  1IBM L;  4GOP B;  1GVP A;  3E6Z X;  4X3K A;  1B8A A;  3BZC A;  1GHJ A;  3RR5 A;  4A3B G;  4JI0 Q;  1X32 A;  4IFD I;  1A2T A;  4DR5 Q;  4KJO A;  4UAI A;  1JB7 A;  1P16 A;  3I73 A;  4OXP A;  1VQL A;  1L0X B;  1KRT A;  4V19 0;  4H7B A;  4EQN A;  2Z6K C;  4LFA Q;  2EZV A;  4DR4 L;  2G9D A;  1SRO A;  3KFU A;  4BS9 A;  3GTM H;  2Z6B A;  1W6J A;  4IUU A;  1QZH A;  3S2H H;  1BBU A;  2EXZ A;  4WFN 3;  5AJ3 Q;  1D5X C;  1V1O A;  1N32 L;  2E75 C;  4B9W A;  1LTT D;  2X6G A;  4H02 A;  5M3M H;  1YIT A;  4P75 A;  3RUZ A;  3V96 A;  2ZM6 Q;  4NMZ A;  3MTS A;  4FXK C;  4LF5 Q;  3FP9 A;  4DK3 C;  3HOU H;  2Z4I A;  1LUZ A;  4YWM A;  1PHJ A;  3M4Q A;  1A2U A;  2DNC A;  2EY2 A;  3QWN A;  5M5W B;  2PZT A;  5IWA Q;  4APV A;  4X66 Q;  2RDG A;  2Z4H A;  3HKZ G;  1B3A A;  4C56 C;  2PW5 A;  1WCM B;  1C9O A;  2EYJ A;  4BY7 B;  3HKS A;  5EGT A;  3SK5 A;  3S14 B;  2O5I C;  4WJW A;  5KYL A;  1XX8 A;  4K2L A;  5CV8 A;  3HS0 C;  4GKK L;  3HOW H;  2VY3 A;  5IOD A;  4X62 Q;  1BR9 A;  1B9N A;  4DNT B;  3ITP A;  1VQO A;  3MFY A;  1UEB A;  4IAL A;  1CHQ D;  1PZK D;  2R7D A;  1EYG A;  5DEH A;  3X3M A;  1O78 A;  2NB0 A;  5ELO A;  1PH1 A;  3M4P A;  3STB D;  4RAU C;  2XRQ D;  3R93 A;  1B70 B;  1K0R A;  4C3H B;  2YU9 H;  3GTJ B;  1VQ6 A;  3VA5 A;  2HDL A;  1VQM A;  2ID0 A;  4DR5 L;  3EFX D;  4QB4 A;  1RTO A;  4NXN Q;  2MHV A;  4A3L H;  2XSC A;  1EQR A;  2F0L A;  4A4I A;  2BE5 D;  4J1M A;  1PH9 A;  1HTP A;  2J0T D;  3VYS A;  1YJN A;  1I4G A;  1EQV A;  4JI8 Q;  3F2B A;  3K6O A;  4FF3 A;  1KHI A;  3SXH A;  4R1J A;  4JI3 L;  5CBA E;  2A19 A;  4NKL A;  4PNY A;  2YV5 A;  4F7X A;  1B7Y B;  1YHA A;  3VR2 A;  2IX0 A;  2VQE Q;  2OTL A;  1PH7 A;  2B63 G;  1Q7Y C;  1PLF A;  5C0X G;  3D6C A;  4CDF C;  2D9U A;  3NQI A;  2HUG A;  5T1G A;  3HOZ G;  3GTL B;  1HNW Q;  3OPO A;  3RLN A; 
#chains in the Genus database with same CATH homology
 1MGS A;  1Q12 A;  5JAV A;  4ZK9 B;  1TWA B;  2B2V C;  1F9R A;  3SK8 A;  3GTK B;  1EY6 A;  1Y69 U;  2RKS A;  2PZW A;  4KMU C;  4CKB A;  5I4D A;  2RDH A;  2LS0 1;  3OIQ A;  1CA6 A;  2PQE A;  2F0K A;  5I2X A;  1TR5 A;  4OO1 G;  3Q22 A;  4NP5 A;  2WKD A;  1KDB A;  1GOZ A;  4RA8 A;  3C1F A;  3UI2 A;  2IWH A;  2A74 C;  1SEB D;  3FPP A;  2VB3 X;  1NUC A;  5K36 G;  4R8N A;  3LWE A;  3MXU A;  2NN6 I;  3SR1 A;  1PZJ D;  4IUN A;  2E2I B;  2F0H A;  5JVG 3;  2F0J A;  2DY8 A;  4DGZ A;  1DOK A;  5CC4 A;  1CI3 M;  1PRT D;  1Y8P B;  2GA4 B;  4BWG B;  3K57 A;  2JP1 A;  4FF1 A;  1TS5 A;  1ESR A;  4NDX A;  2EYH A;  3OW7 A;  3GTP B;  1VMC A;  4KN7 C;  1VDZ A;  4XQJ A;  5A2Q L;  3HG9 A;  1QCB D;  4ZKC B;  5CBE E;  2PO4 A;  3M4Y A;  4ODG A;  3BDO A;  3BVM A;  2HCC A;  2MPM A;  1CTM A;  4IZ8 A;  1SNQ A;  4PMC A;  1JIC A;  1GUG A;  3NBH A;  3M4O B;  1Q1B A;  1EEI D;  1F9S A;  2VXW A;  2FMM A;  1LT5 D;  1O7Z A;  1EZ6 A;  1BQQ T;  5KND A;  2WV6 D;  1TWG B;  1ESF A;  3U9S A;  4DK0 A;  5E3F A;  2KCN A;  3GO5 A;  4X3S A;  1QNK A;  1GUT A;  4XQQ A;  2WIN B;  3GQB A;  3VR6 A;  3H94 A;  3TZU A;  2FJ2 A;  1EZ8 A;  3BVZ A;  1F2M A;  5IGC A;  1AW7 A;  4RGT A;  1O7Y A;  3CQZ B;  2A68 C;  3AU7 A;  1A15 A;  1SYE A;  4Q0F A;  3T4A C;  3RZD B;  5CV4 A;  2EVB A;  4PV1 C;  1HCZ A;  3WOE A;  1LT6 D;  1Z47 A;  2FIN B;  4KY7 A;  4XT1 B;  2B2U A;  2K5W A;  3JAM E;  1WTX A;  2DY7 A;  1MSG A;  2I07 B;  4KY6 A;  2XNA C;  4AYB B;  5K36 H;  2L0C A;  2NTS A;  1YNN C;  4KD3 A;  2AUJ D;  5EKK A;  4RHR A;  2Y0S B;  1LTI D;  1BUV T;  1STY A;  2R3Z A;  1NR4 A;  1G8Z D;  1LLR D;  3K58 A;  5C0X I;  3KUP A;  2EYP A;  3RLF A;  4FYD A;  4DN4 M;  5FO9 B;  3AB9 A;  1F2L A;  1Y8O B;  3D4D A;  2XWJ B;  3DEP A;  1M4V A;  5JEA G;  3E0J A;  1WD0 A;  4CGY B;  4ZUI A;  3TP5 A;  3A55 A;  1ET9 A;  3VR5 A;  3KBX A;  4RGN A;  5M5Y B;  3CRK C;  3V2T A;  5D65 A;  1RTN A;  2WKC A;  4CKE A;  1S4Z A;  4HR7 B;  4M1U B;  1DCZ A;  2BCO A;  2BE5 C;  4KK7 A;  4H0L C;  2K28 A;  1WTQ A;  1U4R A;  2BA0 A;  1B4O A;  5FOB B;  5IGF A;  1ET6 A;  2KEC A;  3TN2 A;  1LT4 D;  4K5W A;  2Q8R E;  3L9A X;  3S16 B;  5FK9 C;  2L4N A;  4KHZ A;  1ZEQ X;  1ZYR D;  2MJ8 A;  3HZX A;  2PMZ B;  3FVQ A;  4G4K A;  3DUZ A;  3HRZ C;  5DNF A;  4LMQ D;  1KNA A;  4A93 B;  2KUM A;  1I6V C;  4RHS A;  1Q90 A;  2A69 D;  5EKI A;  4ZAI A;  1EWC A;  3VYU A;  4KKU A;  1F9Q A;  2R93 B;  3DMU A;  3H0G B;  1BNZ A;  3IFT A;  4IFD G;  1FNW A;  2B2Y A;  5IGE A;  3HOU B;  2R7Z B;  1R9T B;  2K1B A;  2F1M A;  2R6G A;  1KDC A;  1QOH A;  5CV6 A;  1CZW A;  1BBX C;  4DK1 A;  1S5F D;  1JWM D;  2DN8 A;  1GUS A;  4CBV A;  1TT2 A;  4OL7 A;  2IT1 A;  4K6L A;  5COR A;  4MIU A;  2XIW A;  2NN6 G;  4ZQ3 A;  1STE A;  5EQ0 A;  2MUY A;  4NW2 A;  1RJT A;  1CK1 A;  3MZ5 A;  3M3Y B;  1R4Q B;  2F3V A;  1DON A;  5CV5 A;  1JCK B;  2H1E A;  4QUC A;  3QJY A;  3W2D A;  2KVM A;  1FD7 D;  1ROD A;  1STB A;  1BCP C;  5C4H A;  1WD1 A;  3G6J B;  1GUW A;  2QF7 A;  3D4R A;  1D6E C;  2JA7 B;  2YU9 B;  5I9P A;  1F77 A;  2KHS A;  3W3A A;  1QIL A;  1KAB A;  1CFM A;  2F0V A;  3PO2 B;  1TS4 A;  2VNU D;  4K6D A;  4HED A;  3I8Z A;  2MP1 A;  5LL6 S;  5CYU A;  5FO7 B;  2PZU A;  3PV0 A;  1DJR D;  5LHY 1;  3NUC A;  4L63 B;  2ZXO A;  5DM7 3;  3MFG A;  2JA8 B;  1ONL A;  4ILW A;  4A3B B;  5TSS A;  2C9O A;  1EY5 A;  4BBR B;  5C4Z A;  4OIJ A;  4EQO A;  3HOX B;  3CRL C;  3QOL A;  3K59 A;  3R2T A;  4PQX A;  4ULL A;  2B2W A;  4QUF A;  2ZT9 C;  3PUV A;  2NZ1 D;  3FEW X;  4C3I G;  2K05 A;  1Y1V B;  1EYC A;  2X69 A;  3CU7 A;  3FRP B;  2EY1 A;  3I4L A;  2OXP A;  3DWA A;  4PMW A;  2D5D A;  3NK9 A;  4JK1 C;  2L55 A;  1XXG A;  2IJ0 A;  1ZXT A;  2JA6 B;  1IYU A;  1JQY D;  5C0X H;  3X3N A;  3MEH A;  2A69 C;  4F8M A;  1SNO A;  1SMY D;  1LAC A;  3T56 B;  1S5D D;  3ONA B;  1H9S B;  5F2D A;  4L6T B;  3MAQ A;  1V8Q A;  3MC0 B;  3P20 A;  1G2S A;  1ENF A;  1HTL D;  2ENB A;  3URY A;  3TBI B;  2RQX A;  3S1M B;  2IW3 A;  4ZYS A;  3A7A B;  1PDQ A;  4C1N K;  3FDT A;  5C44 B;  3A8J E;  4HCS A;  4S3S A;  1D5Z C;  1SYF A;  5C4J B;  1TS3 A;  3HGB A;  1MBY A;  1K8M A;  4IUT A;  3A56 A;  1KAA A;  1TVX A;  1SAP A;  2K33 A;  5I6W A;  1LO5 D;  1SJH D;  1LV9 A;  2BDO A;  3KLS X;  2FFK B;  3D4W A;  1OXU A;  3Q23 A;  1HRJ A;  3GTG B;  3K0Y A;  1FYC A;  2WII B;  1DZ1 A;  2LKV A;  2NVQ B;  1VCI A;  4B08 A;  1W6K A;  3N52 A;  2E2J B;  1SNP A;  2QEJ C;  1UNS A;  3G7L A;  3M7G A;  4CJ1 B;  2SOB A;  2VB2 X;  2X6L A;  3NPP A;  1BOS A;  3P1H A;  1WTW A;  3TP7 A;  1H9R A;  2F0G A;  1JC7 A;  3R3O A;  3S1Q B;  4G7O C;  1YNN D;  5J1Z A;  4XQN A;  1ICW A;  1OO9 B;  4F87 A;  3SVM A;  2F0T A;  2M2L A;  4U67 3;  2V4D A;  2R61 A;  1LTA D;  2WAC A;  3JAM L;  1U4L A;  5I6Y A;  3HOV B;  5ELD A;  1HA5 A;  1HFG A;  2LY7 A;  4HN7 A;  4IFD H;  1HFN A;  1PRT F;  2EOT A;  4K5V A;  4X3U A;  4EQP A;  3QB3 A;  4FNF A;  1SBB B;  5E4X A;  1PFN A;  3VYR A;  1D5M C;  4FF2 A;  2PCF B;  2TMP A;  3MXP A;  1AP0 A;  3BZD B;  4DA2 A;  1H9J A;  1CZG A;  5M9O A;  2K32 A;  1OXV A;  4KKS A;  3C46 A;  3Q6S A;  1H9M A;  3VA7 A;  2EJG C;  2EDG A;  1VF7 A;  2CW0 D;  1EY4 A;  3KK7 A;  3VYT A;  2BDN A;  4DF7 A;  2B2W C;  2J4X A;  4U68 A;  1MD2 D;  1U4M A;  2ICI A;  1QNU A;  1H9S A;  2H4O A;  3K5M A;  1RDP D;  3OMC A;  3I3C A;  4DXF A;  2RDF A;  2QCP X;  4TQU S;  5J22 A;  2E2D C;  1I6H B;  3NTK A;  4A3J B;  1WTV A;  4RWS C;  1H9K A;  1UUP A;  3SK6 A;  4QMG A;  1F9P A;  5A35 A;  2B2V A;  2XWB B;  3P75 A;  3GTO B;  1FR3 A;  3HOY B;  4V0B A;  4ABN A;  3U9O A;  5EBD A;  4I65 A;  1RCV D;  1E2W A;  2SNM A;  2NVY B;  3C3L A;  4HSV A;  3TP8 A;  4DAV A;  4LAA A;  3S1N B;  1SDF A;  2EYO A;  3DEO A;  1G6Z A;  2VUM B;  1B44 D;  1QJO A;  4J8Q A;  3T51 B;  1O80 A;  1L0Y B;  1B1Z A;  3S15 B;  1KNE A;  2MGS A;  4IN3 A;  2IX1 A;  4C1N I;  3KLS A;  2PNR C;  1PMR A;  1TWH B;  3K5N A;  2A68 D;  4FVM A;  1GHK A;  4BY1 B;  1ZKO A;  2NVT B;  5DM6 3;  4ZKB B;  4ME5 A;  3T13 A;  3NTH A;  4KI0 A;  4DNR B;  4K8J A;  3IL8 A;  2F0U A;  3NXW A;  1K83 B;  4R8I A;  1PTO C;  1SJE D;  5C3X A;  3S1R B;  2FMC A;  3PO3 B;  1TKW B;  4A3K B;  2QKI C;  5EPL A;  4IFD J;  5JVH 3;  2A73 B;  1PTO D;  3MXN A;  1EU3 A;  1CQV A;  4B9X A;  4IUP A;  4RCO A;  5KYI A;  3FPU B;  3V05 A;  2D62 A;  1BCP D;  1EYD A;  3S2D B;  3MVV A;  4DU9 A;  3ERO A;  1TU2 B;  5KRU A;  3C2P A;  2F03 A;  2B2T A;  2KQ3 A;  3CKI B;  3SK4 A;  2KED A;  4Q5V A;  1Q3L A;  3BDL A;  2IPK D;  4FXD A;  4CKC A;  2O5J C;  2JSO A;  5E4W C;  2ICE C;  1G91 A;  1MSH A;  1QE6 A;  5I9O A;  3S2H B;  3IFD A;  5JPN C;  3SHL A;  5LL6 X;  1ILQ A;  2AQ2 B;  3KLR A;  4IUQ A;  5C3W A;  3PMF A;  1I4R A;  3BYT B;  2ZXR A;  4KTA A;  3A7L A;  2XN9 C;  1IHZ A;  1VF5 C;  1B2T A;  5JEA J;  3HKZ B;  1SNM A;  5G3L F;  4Y7N B;  5CV9 A;  4QCL A;  2SNS A;  2LMC B;  1CT1 D;  2AUK A;  1B50 A;  2CVR A;  4A3I B;  1E0B A;  4LJZ C;  1PRT C;  1EY7 A;  2BA1 A;  4L8J A;  5HGT A;  1IYV A;  2DNE A;  1EIH A;  3Q0A A;  4Z9C B;  5CV7 A;  3MWY W;  2KCC A;  2F4I A;  5ELF A;  2NN6 H;  1FGB D;  4XDX A;  5IIF A;  3C1E A;  1TS2 A;  4G7H C;  4O42 A;  4RGM A;  1YNJ C;  4E6I A;  1C48 A;  4KJN A;  2HDM A;  5ELC A;  5C5M A;  3J7A F;  4IUV A;  1IKM A;  4LK1 C;  2FHT A;  2K5D A;  1NR2 A;  1JOK A;  1AEX A;  1Q8I A;  2QIL A;  3R8B A;  2Q8T A;  4HMI A;  1Q1E A;  3NQT A;  1GXD C;  2NBF A;  4TKO B;  3FMC A;  2EJM A;  3M85 A;  1TQO A;  2A6E C;  1QWY A;  1J9O A;  2R92 B;  2LFN A;  1BCP B;  1RHP A;  5ELB A;  2L12 A;  5FKA C;  1PTO H;  1JR0 D;  3NWT A;  2F0W A;  2O2L D;  1FNU A;  1I4X A;  4FP5 D;  4C3J B;  1EY8 A;  1C4Q A;  3ERQ A;  2YYZ A;  1PTO B;  3TME A;  4A3M B;  2M00 A;  2AWO A;  4WOR A;  1V1P B;  2RVL A;  1HUN A;  1G29 1;  1BO0 A;  3MXG A;  5DAU A;  4A3G B;  5IGG A;  3K5O A;  1NCV A;  2K03 A;  4XXE A;  2JXM B;  2K6A A;  2JE6 I;  2NUC A;  1KLG D;  4OO1 H;  1YNJ D;  5D3D A;  4OO1 I;  1CHP D;  1HQM C;  3EVQ A;  3MA2 B;  2JYO A;  4IUR A;  4N9P A;  4DFA A;  3PUW A;  2QDB A;  1WTO A;  2B2T C;  4P2C B;  5D14 A;  4HTH A;  2A5H A;  2JEA I;  3QIA A;  1SE2 A;  2F0O A;  4F88 A;  2RA4 A;  2N55 A;  3GV6 A;  1LTR D;  1SYD A;  3D3R A;  1LAB A;  4HSP A;  4KV6 A;  2EY6 A;  1AFP A;  2F0Q A;  2A6H C;  3GV3 A;  4KY5 A;  5BN4 A;  3H6M A;  4X3T A;  2PYK A;  1IW7 D;  1HA6 A;  3OIP A;  3T16 A;  1EY9 A;  1XWE A;  3OSO A;  4FXG C;  2OF1 A;  1A3V A;  2WP8 J;  1LTB D;  2EJF C;  2RBM A;  3J81 E;  3AMU A;  3BG3 A;  4MN3 A;  1WTP A;  1EU4 A;  5IT9 L;  1E2V A;  4DXG A;  1BXT A;  1QB5 D;  4A3F B;  2L5T A;  3KBG A;  1Z7T A;  2I46 A;  1LTG D;  1AN8 A;  1B53 A;  5EPK A;  5EBC A;  1ENC A;  2NYZ D;  4RCN A;  1C8C A;  2F0F A;  1TWC B;  3S9W A;  2K7V A;  1KTK A;  3N6R A;  1EOT A;  4CJ0 B;  3RZO B;  1V43 A;  5G3L D;  2XRS D;  3K5L A;  4RKL A;  3GTM B;  2KJX A;  1XTC D;  1WVL A;  1STA A;  2B39 A;  1RKN A;  4KKT A;  2B63 B;  1D1K A;  1D1I A;  1ML0 D;  1Y1W B;  3VR4 A;  2EY5 A;  2PPB C;  3OWF A;  3J80 E;  4A3E B;  5COY A;  5EKL A;  4EGV A;  1NSN S;  1JWS D;  3D6W A;  2L9H A;  3ND9 A;  3PUX A;  1MI2 A;  3J7A V;  3A8K E;  1RD9 D;  4ZUJ A;  2L11 A;  1CM9 A;  1IKL A;  2WB1 B;  4A3D B;  2SEB D;  1BDO A;  1HUM A;  4RFB A;  4I7Z C;  3D8G A;  1I4H A;  1DOM A;  2JA5 B;  2L1B A;  3Q24 A;  3IAY A;  1U4P A;  2EE1 A;  5ISR A;  5CMD A;  3LNN A;  3QG1 A;  4DAY A;  3QOJ A;  4XTC S;  3H3V C;  1HPC A;  5AFW A;  1OXT A;  5ELE A;  2B2U C;  1PRT B;  4XT3 B;  1JOR A;  4H44 C;  4OIK A;  4C2M B;  4OHJ A;  2B8G A;  4ZLT F;  5HUR A;  3E5S A;  1JWU D;  5C6A A;  2PW7 A;  3I70 A;  5IOC A;  1F2Y A;  2O4X A;  1NAP A;  1A3U A;  1IW7 C;  5JEA H;  2AQ3 B;  2A6E D;  4K2K A;  3NBI A;  4GZY C;  3BYY B;  4ID6 A;  1R4P B;  2XVS A;  3OOC A;  4C3H G;  3NSW A;  2BOS A;  1EL0 A;  3SE0 A;  3D31 A;  2Z8L A;  5JOB A;  4XIG S;  3GD7 A;  2F0N A;  3DHQ A;  2AQ1 B;  3BS1 A;  4KHV A;  1S5B D;  4XYO A;  5E1F A;  4K14 A;  1AZP A;  3IKJ A;  1CQF A;  4FO2 A;  1X3P A;  1Z6H A;  3GP7 A;  3S17 B;  1JOQ A;  5T1I A;  1T5X D;  1F2Z A;  4R9W A;  4HAE A;  3PUY A;  1LT3 D;  2D2C C;  1PFM A;  5EJW A;  3NWS A;  2SDF A;  1GUO A;  3L3O C;  4KD4 A;  1FNV A;  1TY0 A;  3LWU A;  1ENA A;  2E74 C;  3FKI B;  5KEE A;  4H13 C;  2HCI A;  4TSS A;  2C5C A;  1I3Q B;  2OT2 A;  1A3T A;  2F0S A;  5FLX E;  1V1P A;  5C3E B;  3KF8 A;  2KOL A;  3VR3 A;  1JE4 A;  1UAP A;  4WRD A;  2EYF A;  3R2I A;  3GTQ B;  3ND8 A;  5KGU A;  1M8A A;  3MHB A;  4RGO S;  1T5E A;  3NP8 A;  2M9V A;  3LX0 A;  5C0X J;  1EEF D;  5JPM C;  3WDN A;  5C5L A;  2KA7 A;  5KNB A;  1DM0 B;  4K5X A;  2B2Y C;  1JOO A;  1XYI A;  4XYQ A;  1SE3 A;  3HOW B;  1S5E D;  4UDU C;  1IL8 A;  3OWE B;  4JBW A;  5NUC A;  1DXM A;  4DAP A;  3J81 L;  1SMY C;  3L7Z C;  1VMP A;  1I4Q A;  5M3F B;  4RH6 A;  3F2U A;  1SFO B;  3DXJ C;  3WOF A;  5C4X B;  3NHH A;  3H09 A;  4PMB A;  2EYM A;  4C3I B;  3ZYY X;  3I91 A;  5K5P A;  1GJX A;  4EVO A;  4K8I A;  3BVG A;  3A54 A;  1EY0 A;  4M8A A;  3TSS A;  4BA1 I;  2ZXP A;  2E76 C;  4C3J G;  4BBS B;  2OEO A;  1EWH A;  1EQT A;  5JJZ A;  1G2T A;  3J7Y W;  1STH A;  1HQR D;  3PIO 3;  3K7A B;  1STN A;  1O7L A;  1OXX K;  2CHB D;  1U9R A;  2F0D A;  1ZYR C;  3TDQ A;  2K04 A;  5CR3 A;  2Q8I B;  3I4M B;  1SNC A;  3OMG A;  5KIX A;  3J80 L;  2E2H B;  5J39 A;  4QIW B;  4KN4 C;  1JB3 A;  3O13 A;  1SND A;  1RF2 D;  2F3W A;  5FO8 B;  2IL8 A;  2IX3 A;  1PFB A;  1Y8N B;  1GUN A;  1PTO F;  2WAQ B;  1PZI D;  2CW0 C;  4J6H A;  2F0P A;  1SE4 A;  1LTS D;  2EPB A;  2EYL A;  2CQA A;  5FLX L;  1PYW D;  1BCP F;  1DYQ A;  3EA6 A;  1DOL A;  3SEB A;  2TSS A;  1E2Z A;  1AZQ A;  3QO2 A;  5IGB A;  1UEA B;  3SDZ A;  1ILP A;  2RSO A;  2JEB I;  3TZD A;  4G7Z C;  2AWN A;  2HQE A;  5D3I B;  1HHV A;  3I90 A;  1WTR A;  1S5C D;  2NTT A;  2G9H D;  3DM1 A;  4MHE A;  2J7Z A;  3EQL C;  1SYG A;  3HP3 A;  2B8F A;  4TRD A;  3CHB D;  3HOZ B;  4HCE A;  1I50 B;  4N9T A;  5BN5 A;  4G57 A;  4HMJ A;  4YIJ A;  1DD2 A;  3HEJ A;  5A2Q E;  2Z1C A;  2F0M A;  2RSN A;  1SYC A;  2NWG A;  3NE5 B;  3RD4 A;  3I4N B;  3DWQ A;  1B9M A;  4BA2 I;  1I4P A;  5KNC A;  4QF4 A;  1STG A;  3OHX C;  5IT9 E;  3M7N A;  4FF4 A;  1OXS C;  4CHT B;  2KEE A;  2F0E A;  1BF4 A;  1A6X A;  1EYA A;  4RKB A;  3DWP A;  4OGQ C;  5EPJ A;  1HXY D;  5IGD A;  3T53 B;  2NVX B;  3PIP 3;  3A8I E;  3PUZ A;  1X3Q A;  5CGK A;  5M3M B;  1TY2 A;  4IQZ A;  3NTI A;  1K8O A;  1EIG A;  1II3 A;  3BDC A;  1CA5 A;  1D2B A;  1SXT A;  3EJI A;  2F0I A;  3TP6 A;  1QG7 A;  1PXU A;  2K01 A;  2N88 A;  2A6H D;  1SYB A;  5I2Y A;  1KDA A;  3I72 A;  5BN3 A;  3P7J A;  5M5X B;  4O1N A;  1TWF B;  1SSO A;  1KLU D;  4ZRZ A;  3RMH A;  1TII D;  4CJ2 C;  1J8I A;  2K5Q A;  1EFI D;  3H91 A;  3E6Z X;  4X3K A;  1GHJ A;  1X32 A;  4IFD I;  1A2T A;  4KJO A;  4UAI A;  3I73 A;  1L0X B;  4V19 0;  4H7B A;  4EQN A;  2EZV A;  2G9D A;  4BS9 A;  1W6J A;  4IUU A;  2EXZ A;  4WFN 3;  1D5X C;  1V1O A;  2E75 C;  4B9W A;  1LTT D;  2X6G A;  3V96 A;  3RUZ A;  4NMZ A;  3MTS A;  4FXK C;  2Z4I A;  1A2U A;  2DNC A;  2EY2 A;  3QWN A;  5M5W B;  2PZT A;  2RDG A;  2Z4H A;  1B3A A;  4C56 C;  2PW5 A;  1WCM B;  2EYJ A;  4BY7 B;  5EGT A;  3SK5 A;  3S14 B;  2O5I C;  4WJW A;  5KYL A;  1XX8 A;  4K2L A;  5CV8 A;  3HS0 C;  5IOD A;  1BR9 A;  1B9N A;  4DNT B;  3ITP A;  3MFY A;  4IAL A;  1CHQ D;  1PZK D;  5DEH A;  3X3M A;  1O78 A;  2NB0 A;  4RAU C;  2XRQ D;  3R93 A;  4C3H B;  3GTJ B;  3VA5 A;  2HDL A;  2ID0 A;  3EFX D;  4QB4 A;  1RTO A;  2MHV A;  2XSC A;  2F0L A;  2BE5 D;  4J1M A;  1HTP A;  2J0T D;  3VYS A;  1I4G A;  1EQV A;  3K6O A;  4FF3 A;  3SXH A;  5CBA E;  4NKL A;  4PNY A;  4F7X A;  3VR2 A;  2IX0 A;  1PLF A;  5C0X G;  3D6C A;  2D9U A;  3NQI A;  2HUG A;  5T1G A;  3GTL B;  3OPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...