3BDOA

Solution structure of apo-biotinyl domain from acetyl coenzyme a carboxylase of escherichia coli determined by triple-resonance nmr spectroscopy
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
82
structure length
82
Chain Sequence
b'AAEISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (ACETYL-COA CARBOXYLASE)
publication title Solution structures of apo and holo biotinyl domains from acetyl coenzyme A carboxylase of Escherichia coli determined by triple-resonance nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biotin
total genus 4
structure length 82
sequence length 82
ec nomenclature ec 6.4.1.2: Acetyl-CoA carboxylase.
pdb deposition date 1999-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bdoA00
1H9KA 2BA0A 3A8IE 2EJMA 4JBWA 4DNRB 3N6RA 2K33A 2R6GA 2O5IC 3CRLC 1E2ZA 4LJZC 4KI0A 2JXMB 1HCZA 2A6EC 1OXVA 2QF7A 3OW7A 2LMCB 3D31A 1VCIA 1E2VA 1GJXA 5BN4A 1VF7A 1TKWB 3VR6A 3M7NA 1V43A 4KMUC 1Q1BA 4G7OC 3U9SA 2E74C 2BE5D 5JEAG 1ZKOA 1FR3A 4L8JA 5C0XG 3RLFA 1H9RA 1Y8PB 1B9NA 2D62A 3VR3A 2BA1A 5BN3A 3I72A 2K32A 2PNRC 1DCZA 1FYCA 1H9MA 1OXUA 2CW0C 4LK1C 4DK0A 2KA7A 3KLRA 1GHKA 3A8KE 1GUOA 3BDOA 2D5DA 2A68C 2AWOA 2A6HD 3ND8A 5C0XH 1LACA 3T53B 1DXMA 1LABA 1O78A 4KN7C 4TQUS 2NN6I 3SE0A 1VF5C 3HGBA 4DNTB 4GZYC 1IW7D 1V8QA 1YNNC 1TU2B 3I73A 3PUXA 2DNEA 1K8OA 1Z6HA 4OGQC 4BA2I 1EWHA 3VR4A 1B9MA 1PMRA 4TKOB 1GUNA 4IQZA 2AUJD 4KKSA 4XTCS 1Y8NB 3P20A 4KKUA 2IT1A 2L5TA 3EQLC 4DK1A 3VA7A 2EDGA 1QJOA 5BN5A 2EVBA 3WDNA 1OXSC 4H44C 2F1MA 3A7LA 2A69C 3M85A 5JEAH 1IYUA 3CRKC 3PUZA 2JEAI 1SMYC 2EJGC 1GUSA 1CFMA 1A6XA 1OXXK 3QG1A 4KHZA 2NN6G 1H9SB 2B8FA 3FPPA 1GHJA 1HQMC 2BDOA 2PCFB 2BE5C 3GQBA 3LWUA 4RCNA 4G7HC 1I6VC 1K8MA 2AUKA 2A6ED 2YYZA 4OO1G 2JEBI 3PUWA 3L7ZC 1H9JA 3IFTA 1Q1EA 3MXUA 3T51B 2DNCA 4XIGS 1HTPA 1IYVA 3A8JE 2O5JC 5K36G 1CI3M 2NN6H 1BDOA 3FMCA 4I7ZC 1T5EA 3TZUA 1OXTA 1HPCA 3PUVA 3DXJC 3NE5B 1Y8OB 3W3AA 2A6HC 3QIAA 3MFYA 3I4LA 2D2CC 5A35A 3A7AB 3H94A 5K36H 2DN8A 3BG3A 1ONLA 3M4YA 1O7LA 1DD2A 1YNJC 2KCCA 1VDZA 1IW7C 1GUTA 3OOCA 3PUYA 3SDZA 2K7VA 5KNCA 2EJFC 4H0LC 2A69D 1GUGA 1Q12A 2A68D 4H13C 5KNBA 3VR5A 2ZT9C 1E2WA 1CTMA 2B8GA 1Q90A 3D4RA 5KNDA 4PV1C 3PV0A 3VR2A 4IFDG 1G291 3LNNA 1H9SA 3IKJA 3OPOA 4G7ZC 3QJYA 1Y69U 2E75C 2E76C 4HR7B 1ZYRC 4KN4C 3AB9A 2Q8IB 3T56B 2JE6I 4KKTA 1Z7TA 4JK1C 4IFDH 3GD7A 4OO1H 4BA1I 2V4DA 2PPBC 3ND9A
chains in the Genus database with same CATH superfamily
4V0BA 3PIPA 4FXKC 2K33A 2B2VC 2LSSA 1ESFA 2RKSA 4B9XA 1T9HA 1CZGA 2FXQA 5GROA 5E7NA 2LMCB 2UXCQ 4X6AH 1ICWA 5DNFA 4DR6L 3S1RH 1FGUA 2ZJRA 4FF4A 3TSSA 4KMUC 2WINB 4X3SA 2XN9C 2F0DA 3RZOH 1FNUA 1SJHD 4KD4A 4PQXA 3I55A 4A3MH 4FF3A 4KY7A 1A2UA 3CP0A 3BDOA 1X3FA 2D5DA 2AWOA 4C3HG 5IYBG 4DAPA 1SJED 4XQNA 4GKJQ 2QA4A 4EQPA 2CH4W 5LMUL 1I50B 3K7UC 4WRDA 3J81j 1CSQA 1V8QA 3GTLB 4AYBB 2VQFL 4OGQC 3LWEA 5T1GA 1L1OB 4PMCA 4KKUA 3K5MA 1UUPA 1R4QB 3C1EA 3GV6A 5BN5A 4X65Q 2E2JB 3PO3H 4U68A 3J81L 2OF1A 3L2PA 2UUAQ 2PZWA 5EKLA 2Y0SE 5NUCA 3S1MH 3S1NB 1K3BC 1OXXK 3QG1A 4EQOA 2UXDL 3MZ5A 1GHJA 1K0RA 2A73B 4KY5A 1RL2A 4LF8Q 4C3HH 5IYBH 4X3UA 1SBBB 2AHOB 4MNOA 4NP5A 1HUNA 2R7FA 1E1TA 5IGCA 3UI2A 4ZUJA 4JI5Q 3NQTA 4CDFC 1B53A 3HOYH 2I46A 3W2DA 1CQFA 4QCLA 3IL8A 3M4YA 5JJLA 1VDZA 3CPWA 4IO9A 4MIUA 3K80C 3AFQA 4DUZQ 1EFID 2G5DA 1LM0A 2EYLA 5KNBA 1PTOD 1K83H 1I4PA 3T1HQ 4BBRH 4LW1A 4LF9L 1PH2A 4UP7A 2SEBD 3I4NB 1I3QH 2F0MA 4JI0Q 2E76C 3B6YA 4JW0A 3T56B 2MUYA 3J7ZC 3J80i 3CCLA 4MTKA 4GOPA 3I4MB 1GXDC 1ASZA 5EPKA 3OMGA 4WJ3M 2JA5G 4KK7A 4C1NK 3GTOH 4OIJA 1B44D 4IFDJ 1HCZA 4NPSA 4PG3A 3UDIA 1CQVA 4B3RQ 1IL8A 1KABA 4N9PA 3T13A 4F8MA 1Y14B 3DWAA 1V43A 1VQAA 4G7OC 4B08A 4N9TA 3MA2B 5EGTA 4R8NA 2H1EA 2I5LX 4IPHA 2BA1A 4OX9L 3EIVA 3TMEA 5J39A 4G57A 4KHPL 3LX0A 5KEEA 1IZ6A 4KV6A 2ICEC 5C0XH 2QCPX 1KL9A 3BZKA 5C4HA 4JPBW 3OMCA 2Z4IA 5FO9B 1PHJA 2JSOA 4K0KL 5KYIA 4P73A 3HGBA 3MXNA 1HRJA 1SROA 4RAUC 3CC2A 4C3IB 2NB0A 1STEA 5I9PA 2JJQA 5LL6X 3EJIA 3DLLA 4CKBA 4A3LG 2B2TA 4HMJA 4JI6L 5FLMG 5C4XG 4N8X1 1N34Q 1B7YB 1RD9D 2R3ZA 4R4OA 1MSHA 3VA5A 1ESRA 3H3VC 3FKIG 2MGSA 1I50H 3GTLH 3V2TA 1Q86C 1L2FA 1VQKA 2JEBI 2O2LD 3MXUA 3WWVA 2MFIA 2EOTA 1EIGA 4XQQA 3NXWA 3PUVA 1B4OA 2NZOA 3SK5A 4BY7B 1PTOB 1EIFA 2E2JH 1C8CA 2XWBB 1SE4A 3BG3A 3H6MA 3RN5A 1BNZA 1D1IA 1IW7C 3A5UA 3S1NH 1U9RA 4QIWB 1PDQA 3KJPA 1EY0A 1X65A 3S15B 4OXPA 2VQFQ 1GUGA 3ERQA 5FLMH 5C4XH 2B2YC 2JA8G 4IUUA 2WAQB 2A74C 3PV0A 3MC0B 1QB5D 1QILA 1S5FD 1QG7A 2FMCA 3FKIH 5D3DA 4M8AA 2E75C 5CV4A 2CWPA 2Q8IB 2JA9A 2FJ2A 4XYOA 1GM5A 5FLXL 4A3KB 4K6DA 1XPUA 4DV3Q 1ET6A 2EYJA 2NTSA 5BR8L 2O5IC 1RIPA 2GVBA 4C3JB 1YEZA 4DV4L 1G2SA 2QF7A 3OW7A 1JJ2A 3KLSA 1VMCA 1IBML 4DV1L 3D3RA 1SAPA 2EE1A 2RVLA 1VQHA 2PW5A 1SNDA 1ILQA 1KDAA 3U9OA 1ML0D 2BE5D 1HZCA 2K05A 1X32A 2CHBD 2K5HA 2JA8H 4OWWB 1H9MA 3I4MH 3HOWB 3I91A 5IGEA 2EPBA 2QILA 3KF8B 4DV6L 4KJNA 5G3LD 4G4KA 2NVQH 1LTLA 2NN6I 3KBGA 3R2IA 1EY4A 5I6WA 1STHA 3FPUB 4LF9Q 4Y52H 3TP6A 5CV8A 1YNNC 3PUXA 4A3DB 4J1MA 1SYGA 4KHVA 1B9MA 4DA2A 4DR2L 5KRUA 3AEVA 3E6ZX 1VQNA 4HIKA 3BYTB 1C0AA 3IFDA 1MGSA 1EYGA 2KECA 4DU9A 1O80A 3SR1A 3CQZB 2NN6G 4BY7G 4RKLA 4C3IH 3I56A 3MEHA 4RHRA 5FLXc 4IFDI 2JK8A 2A6ED 3L7ZC 1IBKQ 5IP9G 4A4IA 4DN4M 1BXTA 4OX9Q 2K1BA 3TZUA 5GAEC 3S1QB 3GTKB 4KHPQ 2N3SA 5I2YA 4V190 2TSSA 1E0BA 2C35B 5FLXE 1WYDA 3UDFA 4HJ7A 1JB3A 2DUDA 4K0KQ 1EY5A 3J81i 2B29A 2EJFC 4LF5L 1XNRQ 2RHSB 3K5LA 4XXEA 2B63B 2VB3X 1WD0A 4A3KG 2QDBA 1C7YA 1F2YA 2K03A 1I94L 4ZAIA 2K75A 4IFDG 5JJKA 1RDPD 3A5ZB 3FVQA 1HUMA 1QCBD 5KGUA 2F3IA 4X66L 4G7ZC 4JI6Q 4LNQA 4BY7H 3ZYYX 1PTOH 1XTCD 3HP3A 1HNZL 3G71A 2BH2A 1D5MC 2D0OA 1STGA 5IP9H 3OTOL 3H0GB 1E2ZA 5GAHC 1S40A 1F2ZA 4O42A 1UAPA 2Z0SA 1VCIA 1SNCA 1H95A 1E2VA 3HOWG 1GJXA 5CBAE 4A3JB 1VF7A 3S16B 4JYAL 4CBVA 1KLUD 2HCCA 1FD7D 1FR3A 3FP9A 2HCIA 3L3OC 3TP5A 1HFGA 4A3KH 1QUQA 1DCZA 2F0VA 2IW3A 1WTHA 3J7YW 3R2TA 1TWFB 4A3DG 3Q0AA 4MZ9A 4H02A 4JVZA 3RD4A 1Y1VG 4TQUS 1GO3E 1SSOA 5C44B 2XSCA 2EZVA 4DNTB 3IAYA 1XX8A 2K14A 1DZ1A 1KNAA 1YI2A 1EQVA 4LF7L 1N33L 1TS4A 2NVTB 5ELNA 4XTCS 5EPJA 2N55A 3ZJYC 3HOWH 2HD3A 1VMPA 5D14A 1BCPD 2QDLA 3D6WA 3PCOB 2KBNA 4KLKA 3Q24A 5FKAC 3W5OA 3VYUA 3QR8A 1EQQA 3TRZA 1X3QA 1ZXTA 2EYFA 2JEAI 4DV1Q 3CKIB 2KCTA 4IPDA 1D5XC 2K50A 2B8FA 4BY1B 2BDOA 4A3DH 1TVXA 1PH8A 1KLGD 2F0TA 2CCZA 2OQKA 2LY7A 3A8JE 2EYMA 2JA6G 3KLSX 4DV6Q 3HOXG 2HQLA 2RDHA 1QOHA 2NVYB 3FRPB 2M2LA 2PNHA 2IWHA 5CMDA 4DAYB 2WB1G 1HNWL 3CXCA 4ME5A 3PIO3 2K7VA 3L0OA 5IT9L 5EJWA 5IYDG 2A69D 2K28A 2A68D 4TSSA 3KYHC 1PRTD 2ZT9C 3H3VI 1CTMA 1N9WA 2F0JA 1NY4A 3VR2A 2N8NA 4OEMB 2F4VL 4DR2Q 2UXCL 2KVMA 3GTKH 2NVXB 2B39A 3RLOA 5IIFA 4A3EB 1Y1WB 1PYWD 3HOZB 2QW7A 5C3EG 2HDLA 4AH6A 4HJ9A 1A62A 1AN8A 2LS01 2IL8A 1VS0A 4Q5VA 2JA6H 2VUMB 1OXVA 3HOXH 3CMEA 1NE3A 1JB7A 2B63H 1DYQA 1LTTD 4DGZA 3MFGA 1NMFA 4L5QA 4IUPA 3DHQA 3S17B 3SK6A 3MWYW 5DEHA 2PI2A 2PQEA 1A8VA 3DWQA 4BBSG 1SMXA 2CW0C 2IY5B 4DR1L 3H0GH 2A6HD 4P71A 5F2DA 2Q2TA 4FYDA 5H1SE 4YCVA 2F3VA 1MBYA 4X65L 1ICFB 4DV7Q 1PH4A 2H4OA 1M4VA 2Q2IA 1I94Q 1PFMA 1IKMA 5FO7B 3MEFA 5C0XJ 1EIHA 5C3EH 3S16H 2RF4A 4K2KA 1KAWA 1A3VA 4QGUA 1EWHA 1VQLA 2IX1A 1HNZQ 3PO2B 4HIOA 3TS0A 3HOVB 5IOCA 1YNXA 1TWCH 2XNAC 5IY0A 1TWFH 3BJUA 4IPGA 1AP0A 5M5XB 1IBLL 3HKZE 2C5CA 4JI5L 4H44C 2RA4A 1ZYRD 1IYUA 5C44H 1QVFA 1K28A 4BBSH 2CQOA 4JYAQ 4QMGA 1YJ9A 3O13A 2K5VA 4HJAA 4RCNA 4RA8A 5EAYA 1I6VC 5EKIA 1TWAB 5L37A 1CKNA 3VYSA 2NVTH 5IWAL 2IHEA 3CPFA 4XIGS 2R61A 5AFWA 1N8RC 1B2TA 1B50A 3T1HL 1C9OA 1QZGA 1O7IA 2ES2A 1PRTB 3L9AX 4DV0L 4QY7A 1S3OA 2EY6A 2DN8A 4JI0L 1V1PB 2K01A 5AJ3L 1E1OA 5CR3A 1PYSB 1GUTA 3DEPA 2X6GA 5E3FA 5KNCA 3BU2A 1SN8A 1VQOA 2HHHQ 4BY1H 1I4XA 4FNFA 1U4PA 4O0AA 3EA6A 1Y1WG 1YVCA 4LF7Q 1N33Q 1QE6A 1LTBD 4B3ML 1MD2D 1DGSA 2SNSA 2VUMG 1EY7A 1U4MA 4KN4C 2NVYH 1XWEA 4POGA 3DEOA 3M4PA 2HIVA 4LF4L 1YIJA 4XT3B 1KAAA 3K0YA 1CUKA 2VL6A 3D31A 3S2DB 1XPOA 2NVXH 4A3MG 3HRZC 4YHHL 4ZQ3A 3RLFA 5M3MB 1B3QA 5BN3A 3E0EA 1HNWQ 1Y1WH 1JJGA 2B2TC 1VQ8A 3HOZH 1MIUA 2KA7A 4RWSC 1PH5A 3QB3A 4E6IA 3ND8A 2UUCL 2VUMH 1EEFD 4KN7C 4U673 1N34L 3HOVG 4R1JA 4YWKA 4CDEC 1F2MA 2ZXOA 1VF5C 3IRBA 5JEAJ 2F4VQ 3S14B 5E4XA 4APVA 5JJIA 1MSGA 2VY3A 2G9DA 1SYEA 4UY8C 2DNEA 3PMFA 4OWTB 1K73C 3S17H 2QEJC 3DWPA 1RCVD 1JMCA 1SNOA 2J0TD 3PO3G 2CKZB 3TDQA 4KKSA 5ISRA 3P20A 2Y0SB 3NTKA 4FDBA 1AW7A 1L1OA 3F2UA 3GTJH 4NB3A 4RFBA 2HUGA 4JC0A 1G6PA 4JI7L 2IX3A 1CFMA 4CJ0B 1GD7A 1H9SB 1RHPA 3STBD 2WIIB 3K81C 1F9PA 2AUKA 2RDFA 3PO2H 4HTHA 3K6OA 3HOYG 1QNKA 4O2DA 3NBHB 3HOVH 4OIKA 3CU7A 2L12A 2WFWA 4DR1Q 3URYA 1I4HA 4ZK9B 3W1BA 4R4TA 4RCOA 3TEHB 2ZJPA 5M5XH 1TY2A 2D0PA 3KBXA 2DGYA 1STYA 1EQRA 1HH2P 2XVSA 1SYBA 1UWVA 1YNJC 4BBRG 4B3SQ 1YJNA 4DV3L 2RSOA 3GV3A 1II3A 3K5OA 4HMIA 3R8BA 1TWAH 3ULJA 2B8GA 1NSNS 3H15A 2MP1A 5C0XI 4A3FB 1IBLQ 2VZAA 2LXJA 4EX5A 5CYUA 3ND9A 1SE3A 5JPMC 4JBWA 4IUVA 1Z9FA 4C1NI 2LXKA 2HQEA 5M3MG 1PFSA 2MQHA 3K57A 5IWAQ 3CCUA 1X54A 4B3TL 2MJ8A 1U4LA 3VR6A 2IHFA 3F2CA 2QEXA 3GTGB 2AQ1B 2Q2HA 4IUQA 4Q0FA 4DV0Q 4LFBL 3TP8A 5C0XG 1H9RA 1Y8PB 1A15A 3GTQB 5AJ3Q 1B3AA 4K8IA 2PQAB 5J3BA 5TSSA 4A3IB 1DOKA 1VQGA 1ZEQX 1LABA 2L11A 5IGBA 1TS2A 4FXDA 2R93B 3X3MA 2RBMA 3S2DH 4B3MQ 2JN4A 5M5WB 4GZYC 1NUCA 1TIID 2Z6KC 1TU2B 5D65A 4TRDA 4LUOA 5CV7A 1PFNA 4LF6Q 4A3BB 4UP9A 1EQTA 5M3MH 3OSOA 4CKCA 1SE2A 4Z9CB 1PZJD 1IBKL 1V1QA 4LF4Q 4K5WA 2B2WC 3PSIA 1J5EL 1N32L 4IJHA 4AYBG 1Q46A 1EWCA 1XTDA 1OO9B 2RCFA 4I7AA 4ID6A 1E22A 3A55A 4IN3A 4X3TA 4GNXB 5C3WA 1LYLA 1HXYD 2YV5A 1UEBA 3S14H 1C48A 4J8QA 2PMZE 2BE5C 1OTCA 4YHHQ 4OO1G 3PUWA 1H9JA 4J6HA 1XNRL 1EIYB 2DNCA 2Z6BA 1KDCA 4GOPB 1GVPA 3QIAA 2UUCQ 1SFOB 1EU3A 5I9OA 3PUYA 3SDZA 1IYJB 2PYKA 3RLNA 1K3RA 3EN2A 5KNDA 3CCEA 3ICEA 2YTVA 2LKVA 3UDXA 4FO2A 5T1IA 1K0SA 3KF6B 1D2BA 2JA7B 3H91A 4OO1H 3RZDB 2ICIA 2KHJA 3ULLA 3A8IE 4JI7Q 2B3GA 1S5CD 4ZKCB 1V9PA 2K5DA 3SGIA 2A6EC 3I4NG 1A0IA 1YITA 1Q82C 4JI1Q 4AQYL 1WTVA 2V1CC 5DLQE 3KDFB 1X3GA 4DF7A 1PH3A 3OHXC 3I4MG 1EY8A 3M7NA 3T4AC 2I5HA 1NBWA 1SNPA 1VQIA 5JEAG 4L5RC 2Q8RE 2O4XA 2D62A 4R4CA 3JAMc 2R93G 4YY3Q 5ELEA 4LK1C 4ZUIA 3SXHA 1IHZA 2MHVA 2PO4A 2ZTEA 4K2LA 4RGNA 1F77A 2VS1A 3E3XA 1KRSA 1F2LA 2D9UA 2L4NA 3KF8A 3MXGA 5G3LF 3JAME 3NBIA 1GUWA 1W3SA 3QOLA 4LUVA 2R92B 5EQ0A 1JCKB 2A1AA 5EPLA 1D7QA 1BBWA 3GTGH 1PH6A 1K9MC 4C2MB 2ZJQA 3I4NH 5COYA 2SDFA 3NEMA 2IT1A 2XRSD 4DK1A 3PF5A 2E2IB 1LLRD 3VYTA 1QJOA 2XGTA 4C3IG 3M85A 5JEAH 3C2PA 4LMQD 2DY7A 2R93H 1JWMD 5KIXA 2CWAA 4B3TQ 5M5WH 1D5ZC 3V96A 1TWHB 3GQBA 2IPKD 1SYCA 3TN2A 4LFBQ 3IFTA 4ALPA 3DMUA 4IURA 3BDCA 4A76A 1PV4A 4I7ZC 4PMBA 1OXTA 4HIMA 5CV9A 2IX0A 2BDNA 4DR5Q 3BVZA 2AQ3B 3V05A 2OTJA 4FXGC 4CDCC 3K5NA 2FINB 3MHBA 4GS3A 2KCCA 3MAQA 2N88A 1DM0B 3D4DA 2XRQD 2Z6KA 4PV1C 3ONAB 1G291 3LNNA 3CCQA 1UE1A 4OONA 3HOUB 1PA6A 2SNMA 3PGZA 1BCPC 1J5EQ 2F0KA 1N32Q 1HZAA 2B2WA 3D0FA 1NTGA 4BA1I 4BS9A 1SFOH 4FF2A 2PPBC 2E2HB 2WAQG 3Q8DA 3BVGA 2AQ2B 1BO0A 1YHAA 3K0XA 2XIWA 3R93A 1SMYD 2AWNA 3SEBA 4EVOA 4DV7L 2HDMA 3CCRA 1EL0A 4C3JG 2JA7H 2EY5A 1D6EC 1JT8A 3RZDH 1NR4A 1S5ED 2BH8A 3RN2A 1NAPA 2DJFC 2A68C 1WTRA 1PRTC 3S15H 3P75A 1BQQT 4JI4L 1TY0A 3R3OA 4DXGA 2ZM6L 2J4XA 4X3KA 1RODA 3J7AV 4LFAL 4YWLA 1XNQL 4IQZA 2KEDA 1EYAA 1A3UA 1LT4D 2RDGA 1EYDA 1HZ9A 3NUCA 4ZYSA 4YCUA 4CJ2C 4C56C 1BCPF 4C3JH 4AQYQ 4KHZA 5ELOA 1CHQD 2F0WA 2R92H 1AE3A 1CT1D 4F7XA 2C9OA 1I6HB 1MI2A 4C2MH 2HHHL 3TREA 4L5TA 3KUPA 4TVAB 4A93B 1HTPA 1QVCA 1BDOA 2N78A 3FMCA 2X69A 3BYYB 5CGKA 2ASBA 1E7ZA 2E2IH 2WB1E 1FNWA 2A6HC 2Q2UA 4DXFA 2VB2X 2Z1CA 4GLAC 5A35A 3Q22A 4ZRZA 3H94A 1PFBA 3G6EA 2NTTA 4UDUC 3HOUG 4OELB 1YZ6A 1G51A 1X56A 4H0LC 4DAYA 2KJXA 1TWHH 2KHIA 3K8AA 3VR5A 1WI5A 1YHQA 4YCWA 5JVH3 3NPPA 2EYPA 5JAVA 1PRTF 4K5XA 4LFCQ 3WOFA 5C6AA 1FL0A 3KLWA 3D4WA 1ZYRC 4HIDA 5CC4A 5M5YB 1UE5A 1CZWA 2JE6I 2B63G 4JI2L 1GOZA 1AH9A 1S72A 2BOSA 2CH4A 1WTXA 3UE1A 5I2XA 1STAA 5I4DA 4BWGB 3CQZH 3GTMB 4IJLA 1WCMB 3CAMA 5DAUA 4WORA 2MNAA 2R7DA 1LTGD 4NXML 4LAAA 3HOUH 1TXYA 3ULPA 4FP5D 2F0LA 3H0GG 3TP7A 3S1QH 1PZID 1ZKOA 1M8AA 2F03A 1VQDA 1HZBA 4GN4B 3BZDB 4K6LA 1Q3LA 2RHQB 2E2HH 4F88A 3A8KE 1GUOA 1L1OC 1VQFA 1HQRD 4A3JG 3RR5A 4CJ1B 1SLJA 4HJ5A 2ZTCA 4QUCA 2RSNA 3DUZA 3SE0A 2NUCA 5IGFA 1MHWC 1BR9A 4IOAA 2ID0A 2K5NA 4LUZA 3RNUA 5KYLA 3U58A 2F0NA 1KC8C 3HKZB 1SYDA 2ALYB 1Z47A 4JOIC 4QQBX 2L0CA 4CKEA 5DM63 5C44G 2L5TA 4YIJA 1CHPD 2GA4B 1VQ7A 2R7ZB 3BS1A 4OWXB 3E9IA 2YU9B 4PZ8A 4ZCKA 3A7LA 3BVMA 1A63A 3CRKC 1JWUD 1VQ6A 2KCNA 3G48A 4HAEA 1XMOL 1FJGQ 1VQ4A 2E8GA 1HQMC 4A3JH 4B3SL 4ZLTF 1EOVA 1M90C 5CORA 1AZPA 1TR5A 1PVOA 3RZOB 5M3FB 1SDFA 3UE0A 2EY2A 4BY1G 1PH9A 4WJWA 4DUYQ 1BF4A 4JI4Q 1ONLA 1RTOA 1LTID 3NK9A 2KEEA 1MKHA 1SEBD 4QF4A 2PZUA 4JI8L 3CCSA 1HA6A 1G2TA 3I8ZA 1JOOA 1V1PA 2ZM6Q 1CSPA 1CKOA 4L5SA 5CV5A 1I6HH 4LFAQ 1Q90A 4K8JA 1XNQQ 4A93H 1YBYA 5M9OA 1EOTA 2RQXA 1Q81C 4A3GB 3Q6SA 2ZXRA 3KJOA 4HEDA 4JBKA 3A0JA 2I5MX 2E5LL 3D6CA 2V4DA 3NWSA 2OEOA 5A2QE 4DNRB 1CKMA 3STBC 1HNXL 2LFNA 4KI0A 1T5XD 1JC7A 4P74A 2UU9Q 3J80c 4GKKL 1UE6A 5BN4A 4A3EG 1EUJA 2ZXPA 3HOZG 3SVMA 3OWEB 3NP8A 1LO5D 2F0GA 5M5YH 4QL5A 3J80E 2PI2E 4LF6L 3I72A 2K32A 1VQPA 4X64L 3K59A 5IE8A 4IOCA 3D8GA 4K14A 1WCMH 1TWGB 2J7ZA 1A3TA 2OTLA 1L0YB 3P7JA 1P16A 1JQYD 4QB4A 2R7ZG 1Z6HA 3CC4A 4EQNA 4F87A 1I5FA 3OYYA 4GN3B 2EY1A 1PMRA 2F0OA 4UHVA 4JI2Q 3BZCA 2K04A 4OHJA 2ZTDA 1JOQA 1VQ5A 3MVVA 2NYZD 4A3EH 1PH1A 1OXSC 1TQOA 5E1FA 2HIXA 3PO2G 1PTOC 1GUSA 2RCNA 4NXMQ 3A54A 5M3FG 1F9SA 3S2HB 2DY8A 4G7HC 2YTYA 2UUBL 1HR0L 1L0WA 5IYCG 2KUMA 4OL7A 3T51B 1EYCA 4RKBA 1CI3M 4UP8A 1T5EA 1VQBA 4MTNA 3W3AA 5C5LA 3F8TA 2R7ZH 3NBHA 2D2CC 2YU9H 2B2UC 5K36H 3S9WA 4GLXA 4DR7Q 5HGQA 4RHSA 4A3GG 2JQOA 1I4RA 3N52A 2F3WA 3M3YB 4IPCA 4M1UB 5D3IB 4AIMA 1S5DD 2JA5B 5C4ZA 4JI1L 4PZ6A 2M9VA 1DOLA 2M00A 4JOIA 5EBDA 3GO5A 3QJYA 5M3FH 4WJ4A 5IYCH 1BBUA 4HJ8A 1RF2D 1H9KA 4RMFA 2EJMA 2X6LA 3PQIA 4YY3L 1XMOQ 3M4OB 1IKLA 5FJ8G 1CA6A 4GLVB 1UE7A 1FGBD 1SYFA 1AZQA 1UEAB 4DAMA 5LMNQ 2CQAA 4PZ7A 4NXNL 1TKWB 3CCMA 2NBFA 3AYHB 5ELDA 4A3GH 1Q1BA 1PTOF 1I4QA 4GN5A 2MPMA 3GTPB 1VQCA 3OWFA 2E2DC 4L8JA 3SHLA 2F0EA 1L0XB 4DK0A 3NELA 4JI8Q 1GHKA 1V1OA 2KOLA 4FF1A 1FNVA 4I65A 4JG2A 2QGQA 5FK9C 3EROA 2PQAA 1G6ZA 2K4KA 5C4XB 2DJGC 3I4OA 1MJCA 4YWMA 4KY6A 5FJ8H 2F0FA 1JJCB 3FKIB 4TKOB 3TQYA 2E5LQ 4X62Q 4AYBE 1P8LA 4L63B 1C4QA 2L1BA 1KIXA 1TS5A 3DM3A 2EVBA 1HNXQ 1S4ZA 5GQOA 2PMZB 1ILPA 1YHBA 4DR5L 1TWGH 5K5PA 4GKKQ 1M1KC 2Y0SG 1JE4A 1DONA 1G8ZD 4WFN3 3LWUA 2L9HA 3VYRA 2MO0A 4EGVA 4GNXA 4OO1I 3K7AB 2IJ0A 3EFXD 4RGMA 4X64Q 2Z4HA 3DXJC 4IUTA 5LMNW 2I07B 2JA8B 2JP1A 2WV6D 1ASYA 4DV2L 4JV5L 2EXZA 4DR4Q 4LWCA 1O7LA 1EFWA 3OOCA 2NVQB 3S2HH 4NDXA 3JAML 1Q12A 4J15A 4Y7NB 1IXRA 3J81c 3E5SA 4XT1B 4FVMA 3HFZB 1QNUA 2NZ1D 1SR3A 3FDTA 1VQEA 4JK1C 1X6OA 1JOKA 1BKBA 3KF6A 3U4ZA 4PMWA 3J81E 2R6GA 1KRTA 3QO2A 5CBEE 2JXMB 2UUBQ 1Q8KA 1LTSD 3SK4A 1HR0Q 3M3YH 1Q8IA 2KCMA 2F52A 1YNJD 3Q23A 4A3FG 1KQSA 4JI3L 4PNYA 2JA5H 3A74A 5C4JB 4ZKBB 1QWYA 3ERSX 1UNSA 1KXLA 2K5QA 1RTNA 5JVG3 3KDFA 1R4PB 1WOCA 1B9NA 5FOBB 2EYOA 4R4IA 4CDDC 2PNRC 2F0HA 1OXUA 2B2UA 1SNQA 3M4OH 2B2VA 3MXNB 3T53B 4DR3L 1SNMA 4DR6Q 1LT3D 1K8OA 2AKWB 1BVSA 1LV9A 1JICA 3GTPH 3ER0A 3GDEA 4A3IG 1PH7A 1HHVA 2F0PA 4A3FH 1VQMA 2AUJD 4CHTB 1DOMA 1X3PA 3VA7A 3CMAA 3VDYA 5LMUQ 3NTHA 4A3LH 1SRUA 4A3BG 3PUZA 1KNEA 1SMYC 1U0LA 2EJGC 4NXNQ 1A6XA 2QKIC 1BBXC 4HCSA 4DNIA 3C3LA 2YYZA 1LTAD 1Q1EA 2A8VA 4HCEA 3ITPA 1IYVA 1S5BD 1HR0W 1ET9A 3WOEA 3GTQH 3HS0C 3T1YL 4LFCL 2ATWA 2KHSA 1LT6D 1EEID 4A3IH 2UXDQ 1BUVT 3J7A5 2WACA 2G9HD 2WP8J 5IODA 5J22A 1GKHA 3HKSA 5JJZA 5HGTA 4QUFA 4KTAA 4UAIA 2FHTA 3K7AH 4QIWE 5E4WC 3P1HA 4A3BH 1XPRA 1JWSD 1CM9A 4H7BA 3CHBD 2HT1A 2WAQE 1Y69U 5GADC 1AE2A 2VNUD 5CV6A 4A75A 1XMQL 2BA0A 1B8AA 3N6RA 3OW2A 3CRLC 4LJZC 1LUZA 3A56A 2UXBL 3EVQA 3NQIA 5IGDA 4Y7NH 1EU4A 2JA7G 4IUNA 1RJTA 1Y1VB 1EZ8A 3C1FA 4KD3A 3K58A 3U4VA 3AFPA 3TS2A 3X3NA 3BDLA 3E0JA 4DV2Q 4JV5Q 3VR3A 3H09A 1STBA 4DAVA 5ELCA 1K8AC 3M4QA 3KLRA 1CA5A 4ODGA 2VW9A 4MHEA 1SXTA 3FEWX 4R9WA 1N36L 4R4QA 2I0QA 4P2CB 1R9TB 2A5HA 1RKNA 1IW7D 2NWGA 5C4JH 4BA2I 2PZTA 1FJGL 5DM73 4MN3A 4DV5L 1AEXA 1LT5D 2CFMA 1Y8NB 1WJJA 2XTIA 3DM1A 3CC7A 1F9QA 2EDGA 4DKAC 4A3CG 3RUZA 2VXWA 3MTSA 2R92G 4XQJA 2F1MA 2A69C 2JA6B 4JI3Q 4POFA 4CGYB 4DUYL 3T16A 3HOXB 3FPPA 1EY6A 3I3CA 3C46A 1FVIA 4RGOS 1VQ9A 2PW7A 2WB1B 2WKCA 2NN6H 1HFNA 2H5XA 1D8LA 1ENAA 5ELBA 1EWIA 2BCOA 2AMCB 3NSWA 1F9RA 1NNXA 3MFYA 3OIQA 4NMZA 4DR3Q 1NCVA 2KENA 3A7AB 2JYOA 2EQSA 3I2ZA 4P75A 1NMGA 3TZDA 4A3CH 1X55A 1E2WA 5C3EB 3D4RA 3AMUA 2UU9L 4ULLA 1B1ZA 1STNA 2L55A 1YNND 1KD1C 3KOJA 1X9NA 4HR7B 1TWCB 3CD6A 1J6QA 1SE8A 3JC66 3QOJA 1LTRD 1Z7TA 4IFDH 1NJIC 1JORA 2CVRA 3UDGA 1HA5A 1BOSA 3KFUA 5LL6S 4ABNA 2B2YA 4BBSB 5LHY1 3JAMi 2VQEL 1W6KA 1QUQB 3T1YQ 3QWNA 3GP7A 5FO8B 5BR8Q 3NWTA 1FYCA 1KTKA 2K6AA 3G6JB 3I7FA 1WTQA 3CCJA 3HZXA 4DV4Q 2GN5A 4O1NA 2TMPA 1IBMQ 1DXMA 1WTOA 2GVAA 5JPNC 1NR2A 1PYBA 2Q8TA 3I73A 4IZ8A 4DFAA 1Y1VH 2F0IA 3MXPA 1ENCA 1YJWA 2WKDA 1EZ6A 1JR0D 1XMQQ 1XYIA 3U50C 3EQLC 1TT2A 4XDXA 3WDNA 5HY6A 2OXPA 3RMHA 2UXBQ 5A2QL 2Z9HA 2F4IA 5C3XA 1R9TH 1O7ZA 4DR7L 4QJFA 3EBEA 5GAGC 2N49A 1QZHA 2OCEA 3J80L 2F0QA 4L6TB 1E24A 4XYQA 4JBMA 4P72A 5HURA 3NTIA 1N36Q 2NZHA 2XWJB 3PIOA 2EIFA 4A93G 2EYHA 4BXXG 1D1KA 3F2BA 4HN7A 4H13C 4JCVE 4GKJL 5C5MA 4DV5Q 1KDBA 3S1RB 5IYDH 4DPGA 5LMNL 3IKJA 1PXUA 3OPOA 1EY9A 2KQ3A 3SK8A 5EBCA 3AB9A 4KKTA 1PLFA 3GD7A 1KHIA 4R8IA 3OIPA 3GTJB 4LF5Q 4A3MB 2ENBA 4S3SA 4K5VA 3J7AF 4B9WA 4DK6C 2FMMA 1QVGA 2UUAL 1IL2A 1U4RA 1BCPB 1TS3A 4X66Q 5JOBA 3CF5A 1O7YA 5IGGA 1WTWA 5J1ZA 4LF8L 2P5ZX 2E74C 3U9SA 4BXXH 5IT9c 1JE5A 3OTOQ 1WCMG 2Z8LA 3H3VH 3M9BA 1AFPA 3G4SA 3KK7A 1VQJA 1B70B 1U5KA 4X62L 2A19A 1Q7YC 3PO3B 3F1ZA 3PF4A 1LACA 3HEJA 1O78A 4JBJA 4RGTA 5IT9E 3E9HA 3I70A 4UPAA 3S1MB 2YTXA 2L15A 3TBIB 2F0UA 1WFQA 2OT2A 3CW2C 4DUZL 4GNXC 1W2BA 3NENA 3F2DA 4C3HB 1A2TA 3VR4A 1PZKD 3NHHA 1K8GA 1DJRD 2FFKB 1X3EA 1GUNA 5EKKA 5I6YA 1WD1A 4GOPC 3HOYB 4ILWA 1J8IA 3HG9A 3LGJA 1XXGA 3HKZG 1WTPA 2VQEQ 1MJEA 3GTMH 1CKNB 4DR4L 3AU7A 2OWOA 1ENFA 2PCFB 3FHWA 3S24A 5IP7G 1K8MA 4N8FA 4B3RL 1K83B 2OQ0A 3I90A 1G91A 4BBRB 2K52A 4RH6A 5K36G 2O5JC 4KJOA 4DK3C 1HJPA 1HPCA 1I3QB 3NE5B 1Y8OB 1WVLA 4IALA 3W1GA 3I4LA 2EXDA 3PIP3 3AQQA 1HTLD 1DD2A 4NW2A 4RG1A 4EQ5A 2CW0D 2SOBA 3GTOB 4NKLA 1CK1A 3CCVA 1J9OA 1XJVA 1I4GA 2K5WA 4HSPA 1H9SA 1E3PA 3G7LA 2F0SA 4ME3A 5IP7H 5ELFA 2MO1A 1W6JA 4HSVA 3M7GA
chains in the Genus database with same CATH topology
4V0BA 4FXKC 2K33A 2B2VC 1ESFA 2RKSA 4B9XA 1CZGA 2LMCB 1ICWA 5DNFA 4FF4A 3TSSA 4KMUC 2WINB 4X3SA 2XN9C 2F0DA 1FNUA 1SJHD 4KD4A 4PQXA 4FF3A 4KY7A 1A2UA 3BDOA 2D5DA 4C3HG 2AWOA 4DAPA 1SJED 4XQNA 4EQPA 1I50B 4WRDA 1V8QA 3GTLB 4AYBB 4OGQC 3LWEA 5T1GA 4PMCA 4KKUA 3K5MA 1UUPA 1R4QB 3C1EA 3GV6A 5BN5A 2E2JB 4U68A 3J81L 2OF1A 2PZWA 5EKLA 5NUCA 3S1NB 1OXXK 3QG1A 4EQOA 3MZ5A 1GHJA 2A73B 4KY5A 4X3UA 1SBBB 4NP5A 1HUNA 5IGCA 3UI2A 4ZUJA 3NQTA 1B53A 2I46A 3W2DA 1CQFA 4QCLA 3IL8A 3M4YA 1VDZA 4MIUA 1EFID 2EYLA 5KNBA 1PTOD 1I4PA 2SEBD 3I4NB 2F0MA 2E76C 3T56B 2MUYA 3I4MB 1GXDC 5EPKA 3OMGA 4KK7A 4C1NK 4OIJA 1B44D 4IFDJ 1HCZA 1CQVA 1IL8A 1KABA 4N9PA 3T13A 4F8MA 3DWAA 1V43A 4G7OC 4B08A 4N9TA 3MA2B 5EGTA 4R8NA 2H1EA 2BA1A 3TMEA 5J39A 4G57A 3LX0A 5KEEA 4KV6A 2ICEC 5C0XH 2QCPX 5C4HA 3OMCA 2Z4IA 5FO9B 2JSOA 5KYIA 3HGBA 3MXNA 1HRJA 4RAUC 4C3IB 2NB0A 1STEA 5I9PA 5LL6X 3EJIA 4CKBA 2B2TA 4HMJA 1RD9D 2R3ZA 1MSHA 3VA5A 1ESRA 3H3VC 2MGSA 3V2TA 2JEBI 2O2LD 3MXUA 2EOTA 1EIGA 4XQQA 3NXWA 3PUVA 1B4OA 4BY7B 3SK5A 1PTOB 1C8CA 2XWBB 1SE4A 3BG3A 3H6MA 1BNZA 1D1IA 1IW7C 1U9RA 4QIWB 1PDQA 3S15B 1EY0A 1GUGA 3ERQA 2B2YC 4IUUA 2WAQB 2A74C 3PV0A 3MC0B 1QB5D 1S5FD 1QILA 1QG7A 2FMCA 5D3DA 4M8AA 2E75C 5CV4A 2Q8IB 2FJ2A 4XYOA 5FLXL 4A3KB 4K6DA 1ET6A 2EYJA 2NTSA 2O5IC 4C3JB 1G2SA 2QF7A 3OW7A 3KLSA 1VMCA 3D3RA 1SAPA 2EE1A 2RVLA 2PW5A 1SNDA 1ILQA 1KDAA 3U9OA 1ML0D 2BE5D 2K05A 1X32A 2CHBD 1H9MA 3HOWB 3I91A 5IGEA 2EPBA 2QILA 4KJNA 5G3LD 4G4KA 2NN6I 3KBGA 3R2IA 1EY4A 5I6WA 1STHA 3FPUB 3TP6A 5CV8A 1YNNC 3PUXA 4A3DB 4J1MA 1SYGA 4KHVA 1B9MA 4DA2A 5KRUA 3E6ZX 3BYTB 3IFDA 1MGSA 2KECA 4DU9A 1O80A 3SR1A 3CQZB 2NN6G 4RKLA 3MEHA 4RHRA 4IFDI 2A6ED 3L7ZC 4DN4M 1BXTA 2K1BA 3TZUA 3S1QB 3GTKB 5I2YA 4V190 2TSSA 1E0BA 5FLXE 1JB3A 1EY5A 2EJFC 3K5LA 4XXEA 2B63B 2VB3X 1WD0A 2QDBA 1F2YA 2K03A 4ZAIA 4IFDG 1RDPD 3FVQA 1HUMA 1QCBD 5KGUA 4G7ZC 3ZYYX 1PTOH 1XTCD 3HP3A 1D5MC 1STGA 3H0GB 1E2ZA 1F2ZA 4O42A 1UAPA 1VCIA 1SNCA 1E2VA 1GJXA 5CBAE 4A3JB 1VF7A 3S16B 4CBVA 1KLUD 2HCCA 1FD7D 1FR3A 2HCIA 3L3OC 3TP5A 1HFGA 2F0VA 1DCZA 2IW3A 3J7YW 3R2TA 1TWFB 3Q0AA 3RD4A 4TQUS 1SSOA 5C44B 2XSCA 2EZVA 4DNTB 3IAYA 1XX8A 1DZ1A 1KNAA 1EQVA 1TS4A 2NVTB 4XTCS 5EPJA 2N55A 1VMPA 5D14A 1BCPD 3D6WA 3Q24A 5FKAC 3VYUA 1X3QA 1ZXTA 2EYFA 2JEAI 3CKIB 1D5XC 2B8FA 4BY1B 2BDOA 1TVXA 1KLGD 2F0TA 2LY7A 3A8JE 2EYMA 3KLSX 2RDHA 1QOHA 2NVYB 3FRPB 2M2LA 2IWHA 5CMDA 4ME5A 3PIO3 2K7VA 5IT9L 5EJWA 2A69D 2K28A 2A68D 4TSSA 1PRTD 2ZT9C 1CTMA 2F0JA 3VR2A 2KVMA 2NVXB 2B39A 5IIFA 4A3EB 1Y1WB 1PYWD 3HOZB 2HDLA 1AN8A 2LS01 2IL8A 4Q5VA 2VUMB 1OXVA 1DYQA 1LTTD 4DGZA 3MFGA 4IUPA 3DHQA 3S17B 3SK6A 3MWYW 5DEHA 2PQEA 3DWQA 2CW0C 2A6HD 5F2DA 4FYDA 2F3VA 1MBYA 2H4OA 1M4VA 1PFMA 1IKMA 5FO7B 5C0XJ 1EIHA 4K2KA 1A3VA 1EWHA 3PO2B 2IX1A 3HOVB 5IOCA 2XNAC 1AP0A 5M5XB 2C5CA 4H44C 2RA4A 1ZYRD 1IYUA 4QMGA 3O13A 4RCNA 4RA8A 1I6VC 5EKIA 1TWAB 3VYSA 4XIGS 2R61A 5AFWA 1B2TA 1B50A 1PRTB 3L9AX 2EY6A 2DN8A 1V1PB 2K01A 5CR3A 1GUTA 3DEPA 2X6GA 5E3FA 5KNCA 1I4XA 4FNFA 1U4PA 3EA6A 1QE6A 1LTBD 1MD2D 2SNSA 1EY7A 1U4MA 4KN4C 1XWEA 3DEOA 4XT3B 1KAAA 3K0YA 3D31A 3S2DB 3HRZC 4ZQ3A 3RLFA 5M3MB 5BN3A 2B2TC 2KA7A 4RWSC 3QB3A 4E6IA 3ND8A 1EEFD 4KN7C 4U673 1F2MA 2ZXOA 1VF5C 5JEAJ 3S14B 5E4XA 1MSGA 2G9DA 1SYEA 2DNEA 3PMFA 2QEJC 3DWPA 1RCVD 1SNOA 2J0TD 3TDQA 4KKSA 5ISRA 3P20A 2Y0SB 3NTKA 1AW7A 3F2UA 4RFBA 2HUGA 2IX3A 1CFMA 4CJ0B 1RHPA 1H9SB 2WIIB 1F9PA 2AUKA 2RDFA 4HTHA 3K6OA 1QNKA 4OIKA 3CU7A 2L12A 3URYA 1I4HA 4ZK9B 4RCOA 1TY2A 3KBXA 1STYA 2XVSA 1SYBA 1YNJC 2RSOA 3GV3A 1II3A 3K5OA 4HMIA 3R8BA 2B8GA 1NSNS 2MP1A 5C0XI 4A3FB 5CYUA 3ND9A 1SE3A 5JPMC 4JBWA 4IUVA 4C1NI 2HQEA 3K57A 2MJ8A 1U4LA 3VR6A 3GTGB 2AQ1B 4IUQA 4Q0FA 3TP8A 5C0XG 1H9RA 1Y8PB 1A15A 3GTQB 1B3AA 4K8IA 5TSSA 4A3IB 1DOKA 1ZEQX 1LABA 2L11A 5IGBA 1TS2A 4FXDA 2R93B 3X3MA 2RBMA 5M5WB 4GZYC 1NUCA 1TIID 1TU2B 5D65A 4TRDA 5CV7A 1PFNA 4A3BB 1EQTA 3OSOA 4CKCA 1SE2A 4Z9CB 1PZJD 4K5WA 2B2WC 1EWCA 1OO9B 4ID6A 3A55A 4IN3A 4X3TA 5C3WA 1HXYD 1C48A 4J8QA 2BE5C 4OO1G 3PUWA 1H9JA 4J6HA 2DNCA 1KDCA 3QIAA 1SFOB 1EU3A 5I9OA 3PUYA 3SDZA 2PYKA 5KNDA 2LKVA 4FO2A 5T1IA 1D2BA 2JA7B 3H91A 4OO1H 3RZDB 2ICIA 3A8IE 1S5CD 4ZKCB 2K5DA 2A6EC 1WTVA 4DF7A 3OHXC 1EY8A 3M7NA 3T4AC 5JEAG 1SNPA 2Q8RE 2O4XA 2D62A 5ELEA 4LK1C 4ZUIA 3SXHA 1IHZA 2MHVA 2PO4A 4K2LA 4RGNA 1F77A 2D9UA 1F2LA 2L4NA 3KF8A 3MXGA 5G3LF 3JAME 3NBIA 1GUWA 3QOLA 2R92B 5EQ0A 1JCKB 5EPLA 4C2MB 5COYA 2SDFA 2IT1A 2XRSD 4DK1A 2E2IB 1LLRD 3VYTA 1QJOA 4C3IG 3M85A 5JEAH 3C2PA 4LMQD 2DY7A 1JWMD 5KIXA 1D5ZC 3V96A 1TWHB 3GQBA 2IPKD 1SYCA 3TN2A 3IFTA 3DMUA 4IURA 3BDCA 4I7ZC 4PMBA 1OXTA 5CV9A 2IX0A 2BDNA 3BVZA 2AQ3B 3V05A 4FXGC 3K5NA 2FINB 3MHBA 2KCCA 3MAQA 2N88A 1DM0B 3D4DA 2XRQD 4PV1C 3ONAB 1G291 3LNNA 3HOUB 2SNMA 1BCPC 2F0KA 2B2WA 4BA1I 4FF2A 4BS9A 2PPBC 2E2HB 3BVGA 2AQ2B 1BO0A 2XIWA 3R93A 1SMYD 2AWNA 3SEBA 4EVOA 2HDMA 1EL0A 4C3JG 2EY5A 1D6EC 1NR4A 1S5ED 1NAPA 2A68C 1WTRA 1PRTC 3P75A 1BQQT 1TY0A 3R3OA 4DXGA 2J4XA 4X3KA 1RODA 3J7AV 4IQZA 2KEDA 1EYAA 1A3UA 1LT4D 2RDGA 1EYDA 3NUCA 4ZYSA 4CJ2C 4C56C 1BCPF 4KHZA 1CHQD 2F0WA 1CT1D 4F7XA 2C9OA 1I6HB 1MI2A 3KUPA 4A93B 1HTPA 1BDOA 3FMCA 2X69A 3BYYB 5CGKA 1FNWA 2A6HC 4DXFA 2VB2X 2Z1CA 5A35A 3Q22A 4ZRZA 3H94A 1PFBA 2NTTA 4UDUC 4H0LC 4DAYA 2KJXA 3VR5A 5JVH3 3NPPA 2EYPA 5JAVA 1PRTF 4K5XA 3WOFA 5C6AA 3D4WA 1ZYRC 5CC4A 5M5YB 1CZWA 2JE6I 1GOZA 2BOSA 1WTXA 5I2XA 1STAA 5I4DA 4BWGB 3GTMB 1WCMB 5DAUA 4WORA 1LTGD 4LAAA 4FP5D 2F0LA 3TP7A 1PZID 1ZKOA 1M8AA 2F03A 3BZDB 4K6LA 1Q3LA 4F88A 3A8KE 1GUOA 1HQRD 4CJ1B 4QUCA 2RSNA 3DUZA 3SE0A 2NUCA 5IGFA 1BR9A 2ID0A 5KYLA 2F0NA 3HKZB 1SYDA 1Z47A 2L0CA 4CKEA 5DM63 2L5TA 4YIJA 1CHPD 2GA4B 2R7ZB 3BS1A 2YU9B 3A7LA 3BVMA 3CRKC 1JWUD 2KCNA 4HAEA 1HQMC 4ZLTF 5CORA 1AZPA 1TR5A 3RZOB 5M3FB 1SDFA 2EY2A 4WJWA 1BF4A 1ONLA 1RTOA 1LTID 3NK9A 2KEEA 1SEBD 4QF4A 2PZUA 1HA6A 1G2TA 1JOOA 1V1PA 3I8ZA 5CV5A 1Q90A 4K8JA 5M9OA 1EOTA 2RQXA 4A3GB 3Q6SA 2ZXRA 4HEDA 3D6CA 2V4DA 3NWSA 2OEOA 5A2QE 4DNRB 2LFNA 4KI0A 1T5XD 1JC7A 5BN4A 2ZXPA 3SVMA 3OWEB 3NP8A 1LO5D 2F0GA 3J80E 3I72A 2K32A 3K59A 3D8GA 4K14A 1TWGB 2J7ZA 1A3TA 1L0YB 3P7JA 1JQYD 4QB4A 1Z6HA 4EQNA 4F87A 2EY1A 1PMRA 2F0OA 2K04A 4OHJA 1JOQA 3MVVA 2NYZD 1OXSC 1TQOA 5E1FA 1PTOC 1GUSA 3A54A 1F9SA 3S2HB 2DY8A 4G7HC 2KUMA 4OL7A 3T51B 1EYCA 4RKBA 1CI3M 1T5EA 3W3AA 5C5LA 3NBHA 2D2CC 2B2UC 5K36H 3S9WA 4RHSA 1I4RA 3N52A 2F3WA 3M3YB 4M1UB 5D3IB 1S5DD 2JA5B 5C4ZA 2M9VA 1DOLA 2M00A 5EBDA 3GO5A 3QJYA 1RF2D 1H9KA 2EJMA 2X6LA 3M4OB 1IKLA 1CA6A 1FGBD 1SYFA 1AZQA 1UEAB 2CQAA 1TKWB 2NBFA 5ELDA 1Q1BA 1PTOF 1I4QA 2MPMA 3GTPB 3OWFA 2E2DC 4L8JA 3SHLA 2F0EA 1L0XB 4DK0A 1GHKA 1V1OA 2KOLA 4FF1A 1FNVA 4I65A 5FK9C 3EROA 1G6ZA 5C4XB 4KY6A 2F0FA 3FKIB 4TKOB 4L63B 1C4QA 2L1BA 1TS5A 2EVBA 1S4ZA 2PMZB 1ILPA 5K5PA 1JE4A 1DONA 1G8ZD 4WFN3 3LWUA 2L9HA 3VYRA 4EGVA 4OO1I 3K7AB 2IJ0A 3EFXD 4RGMA 2Z4HA 3DXJC 4IUTA 2I07B 2JA8B 2JP1A 2WV6D 2EXZA 1O7LA 3OOCA 2NVQB 4NDXA 3JAML 1Q12A 4Y7NB 3E5SA 4XT1B 4FVMA 1QNUA 2NZ1D 3FDTA 4JK1C 1JOKA 4PMWA 3J81E 2R6GA 3QO2A 5CBEE 2JXMB 1LTSD 3SK4A 1Q8IA 3Q23A 1YNJD 4PNYA 5C4JB 4ZKBB 1QWYA 1UNSA 2K5QA 1RTNA 5JVG3 1R4PB 1B9NA 5FOBB 2EYOA 2PNRC 2F0HA 1OXUA 2B2UA 1SNQA 2B2VA 3T53B 1SNMA 1LT3D 1K8OA 1LV9A 1JICA 1HHVA 2F0PA 2AUJD 4CHTB 1DOMA 1X3PA 3VA7A 3NTHA 3PUZA 1KNEA 1SMYC 2EJGC 1A6XA 2QKIC 1BBXC 4HCSA 3C3LA 2YYZA 1LTAD 1Q1EA 4HCEA 3ITPA 1IYVA 1S5BD 1ET9A 3WOEA 3HS0C 2KHSA 1LT6D 1EEID 1BUVT 2WACA 2G9HD 2WP8J 5IODA 5J22A 5JJZA 5HGTA 4QUFA 4KTAA 4UAIA 2FHTA 5E4WC 3P1HA 1JWSD 1CM9A 4H7BA 3CHBD 1Y69U 2VNUD 5CV6A 2BA0A 3N6RA 3CRLC 4LJZC 3A56A 3EVQA 3NQIA 5IGDA 1EU4A 4IUNA 1RJTA 1Y1VB 1EZ8A 3C1FA 4KD3A 3K58A 3X3NA 3BDLA 3E0JA 3VR3A 3H09A 1STBA 4DAVA 5ELCA 3KLRA 1CA5A 4ODGA 4MHEA 1SXTA 3FEWX 4R9WA 4P2CB 1R9TB 2A5HA 1RKNA 1IW7D 2NWGA 4BA2I 2PZTA 5DM73 4MN3A 1AEXA 1LT5D 1Y8NB 3DM1A 1F9QA 2EDGA 3RUZA 2VXWA 3MTSA 4XQJA 2F1MA 2A69C 2JA6B 4CGYB 3T16A 3HOXB 3FPPA 1EY6A 3I3CA 3C46A 4RGOS 2PW7A 2WB1B 2WKCA 2NN6H 1HFNA 1ENAA 5ELBA 2BCOA 3NSWA 1F9RA 3MFYA 3OIQA 4NMZA 1NCVA 3A7AB 2JYOA 3TZDA 1E2WA 5C3EB 3D4RA 3AMUA 4ULLA 1B1ZA 1STNA 2L55A 1YNND 4HR7B 1TWCB 3QOJA 1LTRD 1Z7TA 4IFDH 1JORA 2CVRA 1HA5A 1BOSA 5LL6S 4ABNA 2B2YA 4BBSB 5LHY1 1W6KA 3QWNA 3GP7A 5FO8B 3NWTA 1FYCA 1KTKA 2K6AA 3G6JB 1WTQA 3HZXA 4O1NA 2TMPA 1DXMA 1WTOA 5JPNC 1NR2A 2Q8TA 3I73A 4IZ8A 4DFAA 2F0IA 3MXPA 1ENCA 2WKDA 1EZ6A 1JR0D 1XYIA 3EQLC 1TT2A 4XDXA 3WDNA 2OXPA 3RMHA 5A2QL 2F4IA 5C3XA 1O7ZA 3J80L 2F0QA 4L6TB 4XYQA 5HURA 3NTIA 2XWJB 2EYHA 1D1KA 4HN7A 4H13C 5C5MA 1KDBA 3S1RB 3IKJA 1PXUA 3OPOA 1EY9A 2KQ3A 3SK8A 5EBCA 3AB9A 4KKTA 1PLFA 3GD7A 4R8IA 3OIPA 3GTJB 4A3MB 2ENBA 4S3SA 4K5VA 3J7AF 4B9WA 2FMMA 1U4RA 1BCPB 1TS3A 5JOBA 1O7YA 5IGGA 1WTWA 5J1ZA 3U9SA 2E74C 2Z8LA 1AFPA 3KK7A 3PO3B 1LACA 3HEJA 1O78A 4RGTA 5IT9E 3I70A 3S1MB 3TBIB 2F0UA 2OT2A 4C3HB 1A2TA 3VR4A 1PZKD 3NHHA 1DJRD 2FFKB 1GUNA 5EKKA 5I6YA 1WD1A 3HOYB 4ILWA 1J8IA 3HG9A 1XXGA 1WTPA 3AU7A 1ENFA 2PCFB 1K8MA 1K83B 3I90A 1G91A 4BBRB 4RH6A 5K36G 2O5JC 4KJOA 1HPCA 1I3QB 3NE5B 1Y8OB 1WVLA 4IALA 3I4LA 3PIP3 1HTLD 1DD2A 4NW2A 2CW0D 2SOBA 3GTOB 4NKLA 1CK1A 1J9OA 1I4GA 2K5WA 4HSPA 1H9SA 3G7LA 2F0SA 5ELFA 1W6JA 4HSVA 3M7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H9K A;  2BA0 A;  3A8I E;  2EJM A;  4JBW A;  4DNR B;  3N6R A;  2K33 A;  2R6G A;  2O5I C;  3CRL C;  1E2Z A;  4LJZ C;  4KI0 A;  2JXM B;  1HCZ A;  2A6E C;  1OXV A;  2QF7 A;  3OW7 A;  2LMC B;  3D31 A;  1VCI A;  1E2V A;  1GJX A;  5BN4 A;  1VF7 A;  1TKW B;  3VR6 A;  3M7N A;  1V43 A;  4KMU C;  1Q1B A;  4G7O C;  3U9S A;  2E74 C;  2BE5 D;  5JEA G;  1ZKO A;  1FR3 A;  4L8J A;  5C0X G;  3RLF A;  1H9R A;  1Y8P B;  1B9N A;  2D62 A;  3VR3 A;  2BA1 A;  5BN3 A;  3I72 A;  2K32 A;  2PNR C;  1DCZ A;  1FYC A;  1H9M A;  1OXU A;  2CW0 C;  4LK1 C;  4DK0 A;  2KA7 A;  3KLR A;  1GHK A;  3A8K E;  1GUO A;  3BDO A;  2D5D A;  2A68 C;  2AWO A;  2A6H D;  3ND8 A;  5C0X H;  1LAC A;  3T53 B;  1DXM A;  1LAB A;  1O78 A;  4KN7 C;  4TQU S;  2NN6 I;  3SE0 A;  1VF5 C;  3HGB A;  4DNT B;  4GZY C;  1IW7 D;  1V8Q A;  1YNN C;  1TU2 B;  3I73 A;  3PUX A;  2DNE A;  1K8O A;  1Z6H A;  4OGQ C;  4BA2 I;  1EWH A;  3VR4 A;  1B9M A;  1PMR A;  4TKO B;  1GUN A;  4IQZ A;  2AUJ D;  4KKS A;  4XTC S;  1Y8N B;  3P20 A;  4KKU A;  2IT1 A;  2L5T A;  3EQL C;  4DK1 A;  3VA7 A;  2EDG A;  1QJO A;  5BN5 A;  2EVB A;  3WDN A;  1OXS C;  4H44 C;  2F1M A;  3A7L A;  2A69 C;  3M85 A;  5JEA H;  1IYU A;  3CRK C;  3PUZ A;  2JEA I;  1SMY C;  2EJG C;  1GUS A;  1CFM A;  1A6X A;  1OXX K;  3QG1 A;  4KHZ A;  2NN6 G;  1H9S B;  2B8F A;  3FPP A;  1GHJ A;  1HQM C;  2BDO A;  2PCF B;  2BE5 C;  3GQB A;  3LWU A;  4RCN A;  4G7H C;  1I6V C;  1K8M A;  2AUK A;  2A6E D;  2YYZ A;  4OO1 G;  2JEB I;  3PUW A;  3L7Z C;  1H9J A;  3IFT A;  1Q1E A;  3MXU A;  3T51 B;  2DNC A;  4XIG S;  1HTP A;  1IYV A;  3A8J E;  2O5J C;  5K36 G;  1CI3 M;  2NN6 H;  1BDO A;  3FMC A;  4I7Z C;  1T5E A;  3TZU A;  1OXT A;  1HPC A;  3PUV A;  3DXJ C;  3NE5 B;  1Y8O B;  3W3A A;  2A6H C;  3QIA A;  3MFY A;  3I4L A;  2D2C C;  5A35 A;  3A7A B;  3H94 A;  5K36 H;  2DN8 A;  3BG3 A;  1ONL A;  3M4Y A;  1O7L A;  1DD2 A;  1YNJ C;  2KCC A;  1VDZ A;  1IW7 C;  1GUT A;  3OOC A;  3PUY A;  3SDZ A;  2K7V A;  5KNC A;  2EJF C;  4H0L C;  2A69 D;  1GUG A;  1Q12 A;  2A68 D;  4H13 C;  5KNB A;  3VR5 A;  2ZT9 C;  1E2W A;  1CTM A;  2B8G A;  1Q90 A;  3D4R A;  5KND A;  4PV1 C;  3PV0 A;  3VR2 A;  4IFD G;  1G29 1;  3LNN A;  1H9S A;  3IKJ A;  3OPO A;  4G7Z C;  3QJY A;  1Y69 U;  2E75 C;  2E76 C;  4HR7 B;  1ZYR C;  4KN4 C;  3AB9 A;  2Q8I B;  3T56 B;  2JE6 I;  4KKT A;  1Z7T A;  4JK1 C;  4IFD H;  3GD7 A;  4OO1 H;  4BA1 I;  2V4D A;  2PPB C;  3ND9 A; 
#chains in the Genus database with same CATH topology
 4V0B A;  3PIP A;  4FXK C;  2K33 A;  2B2V C;  2LSS A;  1ESF A;  2RKS A;  4B9X A;  1T9H A;  1CZG A;  2FXQ A;  5GRO A;  5E7N A;  2LMC B;  2UXC Q;  4X6A H;  1ICW A;  5DNF A;  4DR6 L;  3S1R H;  1FGU A;  2ZJR A;  4FF4 A;  3TSS A;  4KMU C;  2WIN B;  4X3S A;  2XN9 C;  2F0D A;  3RZO H;  1FNU A;  1SJH D;  4KD4 A;  4PQX A;  3I55 A;  4A3M H;  4FF3 A;  4KY7 A;  1A2U A;  3CP0 A;  3BDO A;  1X3F A;  2D5D A;  2AWO A;  4C3H G;  5IYB G;  4DAP A;  1SJE D;  4XQN A;  4GKJ Q;  2QA4 A;  4EQP A;  2CH4 W;  5LMU L;  1I50 B;  3K7U C;  4WRD A;  3J81 j;  1CSQ A;  1V8Q A;  3GTL B;  4AYB B;  2VQF L;  4OGQ C;  3LWE A;  5T1G A;  1L1O B;  4PMC A;  4KKU A;  3K5M A;  1UUP A;  1R4Q B;  3C1E A;  3GV6 A;  5BN5 A;  4X65 Q;  2E2J B;  3PO3 H;  4U68 A;  3J81 L;  2OF1 A;  3L2P A;  2UUA Q;  2PZW A;  5EKL A;  2Y0S E;  5NUC A;  3S1M H;  3S1N B;  1K3B C;  1OXX K;  3QG1 A;  4EQO A;  2UXD L;  3MZ5 A;  1GHJ A;  1K0R A;  2A73 B;  4KY5 A;  1RL2 A;  4LF8 Q;  4C3H H;  5IYB H;  4X3U A;  1SBB B;  2AHO B;  4MNO A;  4NP5 A;  1HUN A;  2R7F A;  1E1T A;  5IGC A;  3UI2 A;  4ZUJ A;  4JI5 Q;  3NQT A;  4CDF C;  1B53 A;  3HOY H;  2I46 A;  3W2D A;  1CQF A;  4QCL A;  3IL8 A;  3M4Y A;  5JJL A;  1VDZ A;  3CPW A;  4IO9 A;  4MIU A;  3K80 C;  3AFQ A;  4DUZ Q;  1EFI D;  2G5D A;  1LM0 A;  2EYL A;  5KNB A;  1PTO D;  1K83 H;  1I4P A;  3T1H Q;  4BBR H;  4LW1 A;  4LF9 L;  1PH2 A;  4UP7 A;  2SEB D;  3I4N B;  1I3Q H;  2F0M A;  4JI0 Q;  2E76 C;  3B6Y A;  4JW0 A;  3T56 B;  2MUY A;  3J7Z C;  3J80 i;  3CCL A;  4MTK A;  4GOP A;  3I4M B;  1GXD C;  1ASZ A;  5EPK A;  3OMG A;  4WJ3 M;  2JA5 G;  4KK7 A;  4C1N K;  3GTO H;  4OIJ A;  1B44 D;  4IFD J;  1HCZ A;  4NPS A;  4PG3 A;  3UDI A;  1CQV A;  4B3R Q;  1IL8 A;  1KAB A;  4N9P A;  3T13 A;  4F8M A;  1Y14 B;  3DWA A;  1V43 A;  1VQA A;  4G7O C;  4B08 A;  4N9T A;  3MA2 B;  5EGT A;  4R8N A;  2H1E A;  2I5L X;  4IPH A;  2BA1 A;  4OX9 L;  3EIV A;  3TME A;  5J39 A;  4G57 A;  4KHP L;  3LX0 A;  5KEE A;  1IZ6 A;  4KV6 A;  2ICE C;  5C0X H;  2QCP X;  1KL9 A;  3BZK A;  5C4H A;  4JPB W;  3OMC A;  2Z4I A;  5FO9 B;  1PHJ A;  2JSO A;  4K0K L;  5KYI A;  4P73 A;  3HGB A;  3MXN A;  1HRJ A;  1SRO A;  4RAU C;  3CC2 A;  4C3I B;  2NB0 A;  1STE A;  5I9P A;  2JJQ A;  5LL6 X;  3EJI A;  3DLL A;  4CKB A;  4A3L G;  2B2T A;  4HMJ A;  4JI6 L;  5FLM G;  5C4X G;  4N8X 1;  1N34 Q;  1B7Y B;  1RD9 D;  2R3Z A;  4R4O A;  1MSH A;  3VA5 A;  1ESR A;  3H3V C;  3FKI G;  2MGS A;  1I50 H;  3GTL H;  3V2T A;  1Q86 C;  1L2F A;  1VQK A;  2JEB I;  2O2L D;  3MXU A;  3WWV A;  2MFI A;  2EOT A;  1EIG A;  4XQQ A;  3NXW A;  3PUV A;  1B4O A;  2NZO A;  3SK5 A;  4BY7 B;  1PTO B;  1EIF A;  2E2J H;  1C8C A;  2XWB B;  1SE4 A;  3BG3 A;  3H6M A;  3RN5 A;  1BNZ A;  1D1I A;  1IW7 C;  3A5U A;  3S1N H;  1U9R A;  4QIW B;  1PDQ A;  3KJP A;  1EY0 A;  1X65 A;  3S15 B;  4OXP A;  2VQF Q;  1GUG A;  3ERQ A;  5FLM H;  5C4X H;  2B2Y C;  2JA8 G;  4IUU A;  2WAQ B;  2A74 C;  3PV0 A;  3MC0 B;  1QB5 D;  1QIL A;  1S5F D;  1QG7 A;  2FMC A;  3FKI H;  5D3D A;  4M8A A;  2E75 C;  5CV4 A;  2CWP A;  2Q8I B;  2JA9 A;  2FJ2 A;  4XYO A;  1GM5 A;  5FLX L;  4A3K B;  4K6D A;  1XPU A;  4DV3 Q;  1ET6 A;  2EYJ A;  2NTS A;  5BR8 L;  2O5I C;  1RIP A;  2GVB A;  4C3J B;  1YEZ A;  4DV4 L;  1G2S A;  2QF7 A;  3OW7 A;  1JJ2 A;  3KLS A;  1VMC A;  1IBM L;  4DV1 L;  3D3R A;  1SAP A;  2EE1 A;  2RVL A;  1VQH A;  2PW5 A;  1SND A;  1ILQ A;  1KDA A;  3U9O A;  1ML0 D;  2BE5 D;  1HZC A;  2K05 A;  1X32 A;  2CHB D;  2K5H A;  2JA8 H;  4OWW B;  1H9M A;  3I4M H;  3HOW B;  3I91 A;  5IGE A;  2EPB A;  2QIL A;  3KF8 B;  4DV6 L;  4KJN A;  5G3L D;  4G4K A;  2NVQ H;  1LTL A;  2NN6 I;  3KBG A;  3R2I A;  1EY4 A;  5I6W A;  1STH A;  3FPU B;  4LF9 Q;  4Y52 H;  3TP6 A;  5CV8 A;  1YNN C;  3PUX A;  4A3D B;  4J1M A;  1SYG A;  4KHV A;  1B9M A;  4DA2 A;  4DR2 L;  5KRU A;  3AEV A;  3E6Z X;  1VQN A;  4HIK A;  3BYT B;  1C0A A;  3IFD A;  1MGS A;  1EYG A;  2KEC A;  4DU9 A;  1O80 A;  3SR1 A;  3CQZ B;  2NN6 G;  4BY7 G;  4RKL A;  4C3I H;  3I56 A;  3MEH A;  4RHR A;  5FLX c;  4IFD I;  2JK8 A;  2A6E D;  3L7Z C;  1IBK Q;  5IP9 G;  4A4I A;  4DN4 M;  1BXT A;  4OX9 Q;  2K1B A;  3TZU A;  5GAE C;  3S1Q B;  3GTK B;  4KHP Q;  2N3S A;  5I2Y A;  4V19 0;  2TSS A;  1E0B A;  2C35 B;  5FLX E;  1WYD A;  3UDF A;  4HJ7 A;  1JB3 A;  2DUD A;  4K0K Q;  1EY5 A;  3J81 i;  2B29 A;  2EJF C;  4LF5 L;  1XNR Q;  2RHS B;  3K5L A;  4XXE A;  2B63 B;  2VB3 X;  1WD0 A;  4A3K G;  2QDB A;  1C7Y A;  1F2Y A;  2K03 A;  1I94 L;  4ZAI A;  2K75 A;  4IFD G;  5JJK A;  1RDP D;  3A5Z B;  3FVQ A;  1HUM A;  1QCB D;  5KGU A;  2F3I A;  4X66 L;  4G7Z C;  4JI6 Q;  4LNQ A;  4BY7 H;  3ZYY X;  1PTO H;  1XTC D;  3HP3 A;  1HNZ L;  3G71 A;  2BH2 A;  1D5M C;  2D0O A;  1STG A;  5IP9 H;  3OTO L;  3H0G B;  1E2Z A;  5GAH C;  1S40 A;  1F2Z A;  4O42 A;  1UAP A;  2Z0S A;  1VCI A;  1SNC A;  1H95 A;  1E2V A;  3HOW G;  1GJX A;  5CBA E;  4A3J B;  1VF7 A;  3S16 B;  4JYA L;  4CBV A;  1KLU D;  2HCC A;  1FD7 D;  1FR3 A;  3FP9 A;  2HCI A;  3L3O C;  3TP5 A;  1HFG A;  4A3K H;  1QUQ A;  1DCZ A;  2F0V A;  2IW3 A;  1WTH A;  3J7Y W;  3R2T A;  1TWF B;  4A3D G;  3Q0A A;  4MZ9 A;  4H02 A;  4JVZ A;  3RD4 A;  1Y1V G;  4TQU S;  1GO3 E;  1SSO A;  5C44 B;  2XSC A;  2EZV A;  4DNT B;  3IAY A;  1XX8 A;  2K14 A;  1DZ1 A;  1KNA A;  1YI2 A;  1EQV A;  4LF7 L;  1N33 L;  1TS4 A;  2NVT B;  5ELN A;  4XTC S;  5EPJ A;  2N55 A;  3ZJY C;  3HOW H;  2HD3 A;  1VMP A;  5D14 A;  1BCP D;  2QDL A;  3D6W A;  3PCO B;  2KBN A;  4KLK A;  3Q24 A;  5FKA C;  3W5O A;  3VYU A;  3QR8 A;  1EQQ A;  3TRZ A;  1X3Q A;  1ZXT A;  2EYF A;  2JEA I;  4DV1 Q;  3CKI B;  2KCT A;  4IPD A;  1D5X C;  2K50 A;  2B8F A;  4BY1 B;  2BDO A;  4A3D H;  1TVX A;  1PH8 A;  1KLG D;  2F0T A;  2CCZ A;  2OQK A;  2LY7 A;  3A8J E;  2EYM A;  2JA6 G;  3KLS X;  4DV6 Q;  3HOX G;  2HQL A;  2RDH A;  1QOH A;  2NVY B;  3FRP B;  2M2L A;  2PNH A;  2IWH A;  5CMD A;  4DAY B;  2WB1 G;  1HNW L;  3CXC A;  4ME5 A;  3PIO 3;  2K7V A;  3L0O A;  5IT9 L;  5EJW A;  5IYD G;  2A69 D;  2K28 A;  2A68 D;  4TSS A;  3KYH C;  1PRT D;  2ZT9 C;  3H3V I;  1CTM A;  1N9W A;  2F0J A;  1NY4 A;  3VR2 A;  2N8N A;  4OEM B;  2F4V L;  4DR2 Q;  2UXC L;  2KVM A;  3GTK H;  2NVX B;  2B39 A;  3RLO A;  5IIF A;  4A3E B;  1Y1W B;  1PYW D;  3HOZ B;  2QW7 A;  5C3E G;  2HDL A;  4AH6 A;  4HJ9 A;  1A62 A;  1AN8 A;  2LS0 1;  2IL8 A;  1VS0 A;  4Q5V A;  2JA6 H;  2VUM B;  1OXV A;  3HOX H;  3CME A;  1NE3 A;  1JB7 A;  2B63 H;  1DYQ A;  1LTT D;  4DGZ A;  3MFG A;  1NMF A;  4L5Q A;  4IUP A;  3DHQ A;  3S17 B;  3SK6 A;  3MWY W;  5DEH A;  2PI2 A;  2PQE A;  1A8V A;  3DWQ A;  4BBS G;  1SMX A;  2CW0 C;  2IY5 B;  4DR1 L;  3H0G H;  2A6H D;  4P71 A;  5F2D A;  2Q2T A;  4FYD A;  5H1S E;  4YCV A;  2F3V A;  1MBY A;  4X65 L;  1ICF B;  4DV7 Q;  1PH4 A;  2H4O A;  1M4V A;  2Q2I A;  1I94 Q;  1PFM A;  1IKM A;  5FO7 B;  3MEF A;  5C0X J;  1EIH A;  5C3E H;  3S16 H;  2RF4 A;  4K2K A;  1KAW A;  1A3V A;  4QGU A;  1EWH A;  1VQL A;  2IX1 A;  1HNZ Q;  3PO2 B;  4HIO A;  3TS0 A;  3HOV B;  5IOC A;  1YNX A;  1TWC H;  2XNA C;  5IY0 A;  1TWF H;  3BJU A;  4IPG A;  1AP0 A;  5M5X B;  1IBL L;  3HKZ E;  2C5C A;  4JI5 L;  4H44 C;  2RA4 A;  1ZYR D;  1IYU A;  5C44 H;  1QVF A;  1K28 A;  4BBS H;  2CQO A;  4JYA Q;  4QMG A;  1YJ9 A;  3O13 A;  2K5V A;  4HJA A;  4RCN A;  4RA8 A;  5EAY A;  1I6V C;  5EKI A;  1TWA B;  5L37 A;  1CKN A;  3VYS A;  2NVT H;  5IWA L;  2IHE A;  3CPF A;  4XIG S;  2R61 A;  5AFW A;  1N8R C;  1B2T A;  1B50 A;  3T1H L;  1C9O A;  1QZG A;  1O7I A;  2ES2 A;  1PRT B;  3L9A X;  4DV0 L;  4QY7 A;  1S3O A;  2EY6 A;  2DN8 A;  4JI0 L;  1V1P B;  2K01 A;  5AJ3 L;  1E1O A;  5CR3 A;  1PYS B;  1GUT A;  3DEP A;  2X6G A;  5E3F A;  5KNC A;  3BU2 A;  1SN8 A;  1VQO A;  2HHH Q;  4BY1 H;  1I4X A;  4FNF A;  1U4P A;  4O0A A;  3EA6 A;  1Y1W G;  1YVC A;  4LF7 Q;  1N33 Q;  1QE6 A;  1LTB D;  4B3M L;  1MD2 D;  1DGS A;  2SNS A;  2VUM G;  1EY7 A;  1U4M A;  4KN4 C;  2NVY H;  1XWE A;  4POG A;  3DEO A;  3M4P A;  2HIV A;  4LF4 L;  1YIJ A;  4XT3 B;  1KAA A;  3K0Y A;  1CUK A;  2VL6 A;  3D31 A;  3S2D B;  1XPO A;  2NVX H;  4A3M G;  3HRZ C;  4YHH L;  4ZQ3 A;  3RLF A;  5M3M B;  1B3Q A;  5BN3 A;  3E0E A;  1HNW Q;  1Y1W H;  1JJG A;  2B2T C;  1VQ8 A;  3HOZ H;  1MIU A;  2KA7 A;  4RWS C;  1PH5 A;  3QB3 A;  4E6I A;  3ND8 A;  2UUC L;  2VUM H;  1EEF D;  4KN7 C;  4U67 3;  1N34 L;  3HOV G;  4R1J A;  4YWK A;  4CDE C;  1F2M A;  2ZXO A;  1VF5 C;  3IRB A;  5JEA J;  2F4V Q;  3S14 B;  5E4X A;  4APV A;  5JJI A;  1MSG A;  2VY3 A;  2G9D A;  1SYE A;  4UY8 C;  2DNE A;  3PMF A;  4OWT B;  1K73 C;  3S17 H;  2QEJ C;  3DWP A;  1RCV D;  1JMC A;  1SNO A;  2J0T D;  3PO3 G;  2CKZ B;  3TDQ A;  4KKS A;  5ISR A;  3P20 A;  2Y0S B;  3NTK A;  4FDB A;  1AW7 A;  1L1O A;  3F2U A;  3GTJ H;  4NB3 A;  4RFB A;  2HUG A;  4JC0 A;  1G6P A;  4JI7 L;  2IX3 A;  1CFM A;  4CJ0 B;  1GD7 A;  1H9S B;  1RHP A;  3STB D;  2WII B;  3K81 C;  1F9P A;  2AUK A;  2RDF A;  3PO2 H;  4HTH A;  3K6O A;  3HOY G;  1QNK A;  4O2D A;  3NBH B;  3HOV H;  4OIK A;  3CU7 A;  2L12 A;  2WFW A;  4DR1 Q;  3URY A;  1I4H A;  4ZK9 B;  3W1B A;  4R4T A;  4RCO A;  3TEH B;  2ZJP A;  5M5X H;  1TY2 A;  2D0P A;  3KBX A;  2DGY A;  1STY A;  1EQR A;  1HH2 P;  2XVS A;  1SYB A;  1UWV A;  1YNJ C;  4BBR G;  4B3S Q;  1YJN A;  4DV3 L;  2RSO A;  3GV3 A;  1II3 A;  3K5O A;  4HMI A;  3R8B A;  1TWA H;  3ULJ A;  2B8G A;  1NSN S;  3H15 A;  2MP1 A;  5C0X I;  4A3F B;  1IBL Q;  2VZA A;  2LXJ A;  4EX5 A;  5CYU A;  3ND9 A;  1SE3 A;  5JPM C;  4JBW A;  4IUV A;  1Z9F A;  4C1N I;  2LXK A;  2HQE A;  5M3M G;  1PFS A;  2MQH A;  3K57 A;  5IWA Q;  3CCU A;  1X54 A;  4B3T L;  2MJ8 A;  1U4L A;  3VR6 A;  2IHF A;  3F2C A;  2QEX A;  3GTG B;  2AQ1 B;  2Q2H A;  4IUQ A;  4Q0F A;  4DV0 Q;  4LFB L;  3TP8 A;  5C0X G;  1H9R A;  1Y8P B;  1A15 A;  3GTQ B;  5AJ3 Q;  1B3A A;  4K8I A;  2PQA B;  5J3B A;  5TSS A;  4A3I B;  1DOK A;  1VQG A;  1ZEQ X;  1LAB A;  2L11 A;  5IGB A;  1TS2 A;  4FXD A;  2R93 B;  3X3M A;  2RBM A;  3S2D H;  4B3M Q;  2JN4 A;  5M5W B;  4GZY C;  1NUC A;  1TII D;  2Z6K C;  1TU2 B;  5D65 A;  4TRD A;  4LUO A;  5CV7 A;  1PFN A;  4LF6 Q;  4A3B B;  4UP9 A;  1EQT A;  5M3M H;  3OSO A;  4CKC A;  1SE2 A;  4Z9C B;  1PZJ D;  1IBK L;  1V1Q A;  4LF4 Q;  4K5W A;  2B2W C;  3PSI A;  1J5E L;  1N32 L;  4IJH A;  4AYB G;  1Q46 A;  1EWC A;  1XTD A;  1OO9 B;  2RCF A;  4I7A A;  4ID6 A;  1E22 A;  3A55 A;  4IN3 A;  4X3T A;  4GNX B;  5C3W A;  1LYL A;  1HXY D;  2YV5 A;  1UEB A;  3S14 H;  1C48 A;  4J8Q A;  2PMZ E;  2BE5 C;  1OTC A;  4YHH Q;  4OO1 G;  3PUW A;  1H9J A;  4J6H A;  1XNR L;  1EIY B;  2DNC A;  2Z6B A;  1KDC A;  4GOP B;  1GVP A;  3QIA A;  2UUC Q;  1SFO B;  1EU3 A;  5I9O A;  3PUY A;  3SDZ A;  1IYJ B;  2PYK A;  3RLN A;  1K3R A;  3EN2 A;  5KND A;  3CCE A;  3ICE A;  2YTV A;  2LKV A;  3UDX A;  4FO2 A;  5T1I A;  1K0S A;  3KF6 B;  1D2B A;  2JA7 B;  3H91 A;  4OO1 H;  3RZD B;  2ICI A;  2KHJ A;  3ULL A;  3A8I E;  4JI7 Q;  2B3G A;  1S5C D;  4ZKC B;  1V9P A;  2K5D A;  3SGI A;  2A6E C;  3I4N G;  1A0I A;  1YIT A;  1Q82 C;  4JI1 Q;  4AQY L;  1WTV A;  2V1C C;  5DLQ E;  3KDF B;  1X3G A;  4DF7 A;  1PH3 A;  3OHX C;  3I4M G;  1EY8 A;  3M7N A;  3T4A C;  2I5H A;  1NBW A;  1SNP A;  1VQI A;  5JEA G;  4L5R C;  2Q8R E;  2O4X A;  2D62 A;  4R4C A;  3JAM c;  2R93 G;  4YY3 Q;  5ELE A;  4LK1 C;  4ZUI A;  3SXH A;  1IHZ A;  2MHV A;  2PO4 A;  2ZTE A;  4K2L A;  4RGN A;  1F77 A;  2VS1 A;  3E3X A;  1KRS A;  1F2L A;  2D9U A;  2L4N A;  3KF8 A;  3MXG A;  5G3L F;  3JAM E;  3NBI A;  1GUW A;  1W3S A;  3QOL A;  4LUV A;  2R92 B;  5EQ0 A;  1JCK B;  2A1A A;  5EPL A;  1D7Q A;  1BBW A;  3GTG H;  1PH6 A;  1K9M C;  4C2M B;  2ZJQ A;  3I4N H;  5COY A;  2SDF A;  3NEM A;  2IT1 A;  2XRS D;  4DK1 A;  3PF5 A;  2E2I B;  1LLR D;  3VYT A;  1QJO A;  2XGT A;  4C3I G;  3M85 A;  5JEA H;  3C2P A;  4LMQ D;  2DY7 A;  2R93 H;  1JWM D;  5KIX A;  2CWA A;  4B3T Q;  5M5W H;  1D5Z C;  3V96 A;  1TWH B;  3GQB A;  2IPK D;  1SYC A;  3TN2 A;  4LFB Q;  3IFT A;  4ALP A;  3DMU A;  4IUR A;  3BDC A;  4A76 A;  1PV4 A;  4I7Z C;  4PMB A;  1OXT A;  4HIM A;  5CV9 A;  2IX0 A;  2BDN A;  4DR5 Q;  3BVZ A;  2AQ3 B;  3V05 A;  2OTJ A;  4FXG C;  4CDC C;  3K5N A;  2FIN B;  3MHB A;  4GS3 A;  2KCC A;  3MAQ A;  2N88 A;  1DM0 B;  3D4D A;  2XRQ D;  2Z6K A;  4PV1 C;  3ONA B;  1G29 1;  3LNN A;  3CCQ A;  1UE1 A;  4OON A;  3HOU B;  1PA6 A;  2SNM A;  3PGZ A;  1BCP C;  1J5E Q;  2F0K A;  1N32 Q;  1HZA A;  2B2W A;  3D0F A;  1NTG A;  4BA1 I;  4BS9 A;  1SFO H;  4FF2 A;  2PPB C;  2E2H B;  2WAQ G;  3Q8D A;  3BVG A;  2AQ2 B;  1BO0 A;  1YHA A;  3K0X A;  2XIW A;  3R93 A;  1SMY D;  2AWN A;  3SEB A;  4EVO A;  4DV7 L;  2HDM A;  3CCR A;  1EL0 A;  4C3J G;  2JA7 H;  2EY5 A;  1D6E C;  1JT8 A;  3RZD H;  1NR4 A;  1S5E D;  2BH8 A;  3RN2 A;  1NAP A;  2DJF C;  2A68 C;  1WTR A;  1PRT C;  3S15 H;  3P75 A;  1BQQ T;  4JI4 L;  1TY0 A;  3R3O A;  4DXG A;  2ZM6 L;  2J4X A;  4X3K A;  1ROD A;  3J7A V;  4LFA L;  4YWL A;  1XNQ L;  4IQZ A;  2KED A;  1EYA A;  1A3U A;  1LT4 D;  2RDG A;  1EYD A;  1HZ9 A;  3NUC A;  4ZYS A;  4YCU A;  4CJ2 C;  4C56 C;  1BCP F;  4C3J H;  4AQY Q;  4KHZ A;  5ELO A;  1CHQ D;  2F0W A;  2R92 H;  1AE3 A;  1CT1 D;  4F7X A;  2C9O A;  1I6H B;  1MI2 A;  4C2M H;  2HHH L;  3TRE A;  4L5T A;  3KUP A;  4TVA B;  4A93 B;  1HTP A;  1QVC A;  1BDO A;  2N78 A;  3FMC A;  2X69 A;  3BYY B;  5CGK A;  2ASB A;  1E7Z A;  2E2I H;  2WB1 E;  1FNW A;  2A6H C;  2Q2U A;  4DXF A;  2VB2 X;  2Z1C A;  4GLA C;  5A35 A;  3Q22 A;  4ZRZ A;  3H94 A;  1PFB A;  3G6E A;  2NTT A;  4UDU C;  3HOU G;  4OEL B;  1YZ6 A;  1G51 A;  1X56 A;  4H0L C;  4DAY A;  2KJX A;  1TWH H;  2KHI A;  3K8A A;  3VR5 A;  1WI5 A;  1YHQ A;  4YCW A;  5JVH 3;  3NPP A;  2EYP A;  5JAV A;  1PRT F;  4K5X A;  4LFC Q;  3WOF A;  5C6A A;  1FL0 A;  3KLW A;  3D4W A;  1ZYR C;  4HID A;  5CC4 A;  5M5Y B;  1UE5 A;  1CZW A;  2JE6 I;  2B63 G;  4JI2 L;  1GOZ A;  1AH9 A;  1S72 A;  2BOS A;  2CH4 A;  1WTX A;  3UE1 A;  5I2X A;  1STA A;  5I4D A;  4BWG B;  3CQZ H;  3GTM B;  4IJL A;  1WCM B;  3CAM A;  5DAU A;  4WOR A;  2MNA A;  2R7D A;  1LTG D;  4NXM L;  4LAA A;  3HOU H;  1TXY A;  3ULP A;  4FP5 D;  2F0L A;  3H0G G;  3TP7 A;  3S1Q H;  1PZI D;  1ZKO A;  1M8A A;  2F03 A;  1VQD A;  1HZB A;  4GN4 B;  3BZD B;  4K6L A;  1Q3L A;  2RHQ B;  2E2H H;  4F88 A;  3A8K E;  1GUO A;  1L1O C;  1VQF A;  1HQR D;  4A3J G;  3RR5 A;  4CJ1 B;  1SLJ A;  4HJ5 A;  2ZTC A;  4QUC A;  2RSN A;  3DUZ A;  3SE0 A;  2NUC A;  5IGF A;  1MHW C;  1BR9 A;  4IOA A;  2ID0 A;  2K5N A;  4LUZ A;  3RNU A;  5KYL A;  3U58 A;  2F0N A;  1KC8 C;  3HKZ B;  1SYD A;  2ALY B;  1Z47 A;  4JOI C;  4QQB X;  2L0C A;  4CKE A;  5DM6 3;  5C44 G;  2L5T A;  4YIJ A;  1CHP D;  2GA4 B;  1VQ7 A;  2R7Z B;  3BS1 A;  4OWX B;  3E9I A;  2YU9 B;  4PZ8 A;  4ZCK A;  3A7L A;  3BVM A;  1A63 A;  3CRK C;  1JWU D;  1VQ6 A;  2KCN A;  3G48 A;  4HAE A;  1XMO L;  1FJG Q;  1VQ4 A;  2E8G A;  1HQM C;  4A3J H;  4B3S L;  4ZLT F;  1EOV A;  1M90 C;  5COR A;  1AZP A;  1TR5 A;  1PVO A;  3RZO B;  5M3F B;  1SDF A;  3UE0 A;  2EY2 A;  4BY1 G;  1PH9 A;  4WJW A;  4DUY Q;  1BF4 A;  4JI4 Q;  1ONL A;  1RTO A;  1LTI D;  3NK9 A;  2KEE A;  1MKH A;  1SEB D;  4QF4 A;  2PZU A;  4JI8 L;  3CCS A;  1HA6 A;  1G2T A;  3I8Z A;  1JOO A;  1V1P A;  2ZM6 Q;  1CSP A;  1CKO A;  4L5S A;  5CV5 A;  1I6H H;  4LFA Q;  1Q90 A;  4K8J A;  1XNQ Q;  4A93 H;  1YBY A;  5M9O A;  1EOT A;  2RQX A;  1Q81 C;  4A3G B;  3Q6S A;  2ZXR A;  3KJO A;  4HED A;  4JBK A;  3A0J A;  2I5M X;  2E5L L;  3D6C A;  2V4D A;  3NWS A;  2OEO A;  5A2Q E;  4DNR B;  1CKM A;  3STB C;  1HNX L;  2LFN A;  4KI0 A;  1T5X D;  1JC7 A;  4P74 A;  2UU9 Q;  3J80 c;  4GKK L;  1UE6 A;  5BN4 A;  4A3E G;  1EUJ A;  2ZXP A;  3HOZ G;  3SVM A;  3OWE B;  3NP8 A;  1LO5 D;  2F0G A;  5M5Y H;  4QL5 A;  3J80 E;  2PI2 E;  4LF6 L;  3I72 A;  2K32 A;  1VQP A;  4X64 L;  3K59 A;  5IE8 A;  4IOC A;  3D8G A;  4K14 A;  1WCM H;  1TWG B;  2J7Z A;  1A3T A;  2OTL A;  1L0Y B;  3P7J A;  1P16 A;  1JQY D;  4QB4 A;  2R7Z G;  1Z6H A;  3CC4 A;  4EQN A;  4F87 A;  1I5F A;  3OYY A;  4GN3 B;  2EY1 A;  1PMR A;  2F0O A;  4UHV A;  4JI2 Q;  3BZC A;  2K04 A;  4OHJ A;  2ZTD A;  1JOQ A;  1VQ5 A;  3MVV A;  2NYZ D;  4A3E H;  1PH1 A;  1OXS C;  1TQO A;  5E1F A;  2HIX A;  3PO2 G;  1PTO C;  1GUS A;  2RCN A;  4NXM Q;  3A54 A;  5M3F G;  1F9S A;  3S2H B;  2DY8 A;  4G7H C;  2YTY A;  2UUB L;  1HR0 L;  1L0W A;  5IYC G;  2KUM A;  4OL7 A;  3T51 B;  1EYC A;  4RKB A;  1CI3 M;  4UP8 A;  1T5E A;  1VQB A;  4MTN A;  3W3A A;  5C5L A;  3F8T A;  2R7Z H;  3NBH A;  2D2C C;  2YU9 H;  2B2U C;  5K36 H;  3S9W A;  4GLX A;  4DR7 Q;  5HGQ A;  4RHS A;  4A3G G;  2JQO A;  1I4R A;  3N52 A;  2F3W A;  3M3Y B;  4IPC A;  4M1U B;  5D3I B;  4AIM A;  1S5D D;  2JA5 B;  5C4Z A;  4JI1 L;  4PZ6 A;  2M9V A;  1DOL A;  2M00 A;  4JOI A;  5EBD A;  3GO5 A;  3QJY A;  5M3F H;  4WJ4 A;  5IYC H;  1BBU A;  4HJ8 A;  1RF2 D;  1H9K A;  4RMF A;  2EJM A;  2X6L A;  3PQI A;  4YY3 L;  1XMO Q;  3M4O B;  1IKL A;  5FJ8 G;  1CA6 A;  4GLV B;  1UE7 A;  1FGB D;  1SYF A;  1AZQ A;  1UEA B;  4DAM A;  5LMN Q;  2CQA A;  4PZ7 A;  4NXN L;  1TKW B;  3CCM A;  2NBF A;  3AYH B;  5ELD A;  4A3G H;  1Q1B A;  1PTO F;  1I4Q A;  4GN5 A;  2MPM A;  3GTP B;  1VQC A;  3OWF A;  2E2D C;  4L8J A;  3SHL A;  2F0E A;  1L0X B;  4DK0 A;  3NEL A;  4JI8 Q;  1GHK A;  1V1O A;  2KOL A;  4FF1 A;  1FNV A;  4I65 A;  4JG2 A;  2QGQ A;  5FK9 C;  3ERO A;  2PQA A;  1G6Z A;  2K4K A;  5C4X B;  2DJG C;  3I4O A;  1MJC A;  4YWM A;  4KY6 A;  5FJ8 H;  2F0F A;  1JJC B;  3FKI B;  4TKO B;  3TQY A;  2E5L Q;  4X62 Q;  4AYB E;  1P8L A;  4L63 B;  1C4Q A;  2L1B A;  1KIX A;  1TS5 A;  3DM3 A;  2EVB A;  1HNX Q;  1S4Z A;  5GQO A;  2PMZ B;  1ILP A;  1YHB A;  4DR5 L;  1TWG H;  5K5P A;  4GKK Q;  1M1K C;  2Y0S G;  1JE4 A;  1DON A;  1G8Z D;  4WFN 3;  3LWU A;  2L9H A;  3VYR A;  2MO0 A;  4EGV A;  4GNX A;  4OO1 I;  3K7A B;  2IJ0 A;  3EFX D;  4RGM A;  4X64 Q;  2Z4H A;  3DXJ C;  4IUT A;  5LMN W;  2I07 B;  2JA8 B;  2JP1 A;  2WV6 D;  1ASY A;  4DV2 L;  4JV5 L;  2EXZ A;  4DR4 Q;  4LWC A;  1O7L A;  1EFW A;  3OOC A;  2NVQ B;  3S2H H;  4NDX A;  3JAM L;  1Q12 A;  4J15 A;  4Y7N B;  1IXR A;  3J81 c;  3E5S A;  4XT1 B;  4FVM A;  3HFZ B;  1QNU A;  2NZ1 D;  1SR3 A;  3FDT A;  1VQE A;  4JK1 C;  1X6O A;  1JOK A;  1BKB A;  3KF6 A;  3U4Z A;  4PMW A;  3J81 E;  2R6G A;  1KRT A;  3QO2 A;  5CBE E;  2JXM B;  2UUB Q;  1Q8K A;  1LTS D;  3SK4 A;  1HR0 Q;  3M3Y H;  1Q8I A;  2KCM A;  2F52 A;  1YNJ D;  3Q23 A;  4A3F G;  1KQS A;  4JI3 L;  4PNY A;  2JA5 H;  3A74 A;  5C4J B;  4ZKB B;  1QWY A;  3ERS X;  1UNS A;  1KXL A;  2K5Q A;  1RTN A;  5JVG 3;  3KDF A;  1R4P B;  1WOC A;  1B9N A;  5FOB B;  2EYO A;  4R4I A;  4CDD C;  2PNR C;  2F0H A;  1OXU A;  2B2U A;  1SNQ A;  3M4O H;  2B2V A;  3MXN B;  3T53 B;  4DR3 L;  1SNM A;  4DR6 Q;  1LT3 D;  1K8O A;  2AKW B;  1BVS A;  1LV9 A;  1JIC A;  3GTP H;  3ER0 A;  3GDE A;  4A3I G;  1PH7 A;  1HHV A;  2F0P A;  4A3F H;  1VQM A;  2AUJ D;  4CHT B;  1DOM A;  1X3P A;  3VA7 A;  3CMA A;  3VDY A;  5LMU Q;  3NTH A;  4A3L H;  1SRU A;  4A3B G;  3PUZ A;  1KNE A;  1SMY C;  1U0L A;  2EJG C;  4NXN Q;  1A6X A;  2QKI C;  1BBX C;  4HCS A;  4DNI A;  3C3L A;  2YYZ A;  1LTA D;  1Q1E A;  2A8V A;  4HCE A;  3ITP A;  1IYV A;  1S5B D;  1HR0 W;  1ET9 A;  3WOE A;  3GTQ H;  3HS0 C;  3T1Y L;  4LFC L;  2ATW A;  2KHS A;  1LT6 D;  1EEI D;  4A3I H;  2UXD Q;  1BUV T;  3J7A 5;  2WAC A;  2G9H D;  2WP8 J;  5IOD A;  5J22 A;  1GKH A;  3HKS A;  5JJZ A;  5HGT A;  4QUF A;  4KTA A;  4UAI A;  2FHT A;  3K7A H;  4QIW E;  5E4W C;  3P1H A;  4A3B H;  1XPR A;  1JWS D;  1CM9 A;  4H7B A;  3CHB D;  2HT1 A;  2WAQ E;  1Y69 U;  5GAD C;  1AE2 A;  2VNU D;  5CV6 A;  4A75 A;  1XMQ L;  2BA0 A;  1B8A A;  3N6R A;  3OW2 A;  3CRL C;  4LJZ C;  1LUZ A;  3A56 A;  2UXB L;  3EVQ A;  3NQI A;  5IGD A;  4Y7N H;  1EU4 A;  2JA7 G;  4IUN A;  1RJT A;  1Y1V B;  1EZ8 A;  3C1F A;  4KD3 A;  3K58 A;  3U4V A;  3AFP A;  3TS2 A;  3X3N A;  3BDL A;  3E0J A;  4DV2 Q;  4JV5 Q;  3VR3 A;  3H09 A;  1STB A;  4DAV A;  5ELC A;  1K8A C;  3M4Q A;  3KLR A;  1CA5 A;  4ODG A;  2VW9 A;  4MHE A;  1SXT A;  3FEW X;  4R9W A;  1N36 L;  4R4Q A;  2I0Q A;  4P2C B;  1R9T B;  2A5H A;  1RKN A;  1IW7 D;  2NWG A;  5C4J H;  4BA2 I;  2PZT A;  1FJG L;  5DM7 3;  4MN3 A;  4DV5 L;  1AEX A;  1LT5 D;  2CFM A;  1Y8N B;  1WJJ A;  2XTI A;  3DM1 A;  3CC7 A;  1F9Q A;  2EDG A;  4DKA C;  4A3C G;  3RUZ A;  2VXW A;  3MTS A;  2R92 G;  4XQJ A;  2F1M A;  2A69 C;  2JA6 B;  4JI3 Q;  4POF A;  4CGY B;  4DUY L;  3T16 A;  3HOX B;  3FPP A;  1EY6 A;  3I3C A;  3C46 A;  1FVI A;  4RGO S;  1VQ9 A;  2PW7 A;  2WB1 B;  2WKC A;  2NN6 H;  1HFN A;  2H5X A;  1D8L A;  1ENA A;  5ELB A;  1EWI A;  2BCO A;  2AMC B;  3NSW A;  1F9R A;  1NNX A;  3MFY A;  3OIQ A;  4NMZ A;  4DR3 Q;  1NCV A;  2KEN A;  3A7A B;  2JYO A;  2EQS A;  3I2Z A;  4P75 A;  1NMG A;  3TZD A;  4A3C H;  1X55 A;  1E2W A;  5C3E B;  3D4R A;  3AMU A;  2UU9 L;  4ULL A;  1B1Z A;  1STN A;  2L55 A;  1YNN D;  1KD1 C;  3KOJ A;  1X9N A;  4HR7 B;  1TWC B;  3CD6 A;  1J6Q A;  1SE8 A;  3JC6 6;  3QOJ A;  1LTR D;  1Z7T A;  4IFD H;  1NJI C;  1JOR A;  2CVR A;  3UDG A;  1HA5 A;  1BOS A;  3KFU A;  5LL6 S;  4ABN A;  2B2Y A;  4BBS B;  5LHY 1;  3JAM i;  2VQE L;  1W6K A;  1QUQ B;  3T1Y Q;  3QWN A;  3GP7 A;  5FO8 B;  5BR8 Q;  3NWT A;  1FYC A;  1KTK A;  2K6A A;  3G6J B;  3I7F A;  1WTQ A;  3CCJ A;  3HZX A;  4DV4 Q;  2GN5 A;  4O1N A;  2TMP A;  1IBM Q;  1DXM A;  1WTO A;  2GVA A;  5JPN C;  1NR2 A;  1PYB A;  2Q8T A;  3I73 A;  4IZ8 A;  4DFA A;  1Y1V H;  2F0I A;  3MXP A;  1ENC A;  1YJW A;  2WKD A;  1EZ6 A;  1JR0 D;  1XMQ Q;  1XYI A;  3U50 C;  3EQL C;  1TT2 A;  4XDX A;  3WDN A;  5HY6 A;  2OXP A;  3RMH A;  2UXB Q;  5A2Q L;  2Z9H A;  2F4I A;  5C3X A;  1R9T H;  1O7Z A;  4DR7 L;  4QJF A;  3EBE A;  5GAG C;  2N49 A;  1QZH A;  2OCE A;  3J80 L;  2F0Q A;  4L6T B;  1E24 A;  4XYQ A;  4JBM A;  4P72 A;  5HUR A;  3NTI A;  1N36 Q;  2NZH A;  2XWJ B;  3PIO A;  2EIF A;  4A93 G;  2EYH A;  4BXX G;  1D1K A;  3F2B A;  4HN7 A;  4H13 C;  4JCV E;  4GKJ L;  5C5M A;  4DV5 Q;  1KDB A;  3S1R B;  5IYD H;  4DPG A;  5LMN L;  3IKJ A;  1PXU A;  3OPO A;  1EY9 A;  2KQ3 A;  3SK8 A;  5EBC A;  3AB9 A;  4KKT A;  1PLF A;  3GD7 A;  1KHI A;  4R8I A;  3OIP A;  3GTJ B;  4LF5 Q;  4A3M B;  2ENB A;  4S3S A;  4K5V A;  3J7A F;  4B9W A;  4DK6 C;  2FMM A;  1QVG A;  2UUA L;  1IL2 A;  1U4R A;  1BCP B;  1TS3 A;  4X66 Q;  5JOB A;  3CF5 A;  1O7Y A;  5IGG A;  1WTW A;  5J1Z A;  4LF8 L;  2P5Z X;  2E74 C;  3U9S A;  4BXX H;  5IT9 c;  1JE5 A;  3OTO Q;  1WCM G;  2Z8L A;  3H3V H;  3M9B A;  1AFP A;  3G4S A;  3KK7 A;  1VQJ A;  1B70 B;  1U5K A;  4X62 L;  2A19 A;  1Q7Y C;  3PO3 B;  3F1Z A;  3PF4 A;  1LAC A;  3HEJ A;  1O78 A;  4JBJ A;  4RGT A;  5IT9 E;  3E9H A;  3I70 A;  4UPA A;  3S1M B;  2YTX A;  2L15 A;  3TBI B;  2F0U A;  1WFQ A;  2OT2 A;  3CW2 C;  4DUZ L;  4GNX C;  1W2B A;  3NEN A;  3F2D A;  4C3H B;  1A2T A;  3VR4 A;  1PZK D;  3NHH A;  1K8G A;  1DJR D;  2FFK B;  1X3E A;  1GUN A;  5EKK A;  5I6Y A;  1WD1 A;  4GOP C;  3HOY B;  4ILW A;  1J8I A;  3HG9 A;  3LGJ A;  1XXG A;  3HKZ G;  1WTP A;  2VQE Q;  1MJE A;  3GTM H;  1CKN B;  4DR4 L;  3AU7 A;  2OWO A;  1ENF A;  2PCF B;  3FHW A;  3S24 A;  5IP7 G;  1K8M A;  4N8F A;  4B3R L;  1K83 B;  2OQ0 A;  3I90 A;  1G91 A;  4BBR B;  2K52 A;  4RH6 A;  5K36 G;  2O5J C;  4KJO A;  4DK3 C;  1HJP A;  1HPC A;  1I3Q B;  3NE5 B;  1Y8O B;  1WVL A;  4IAL A;  3W1G A;  3I4L A;  2EXD A;  3PIP 3;  3AQQ A;  1HTL D;  1DD2 A;  4NW2 A;  4RG1 A;  4EQ5 A;  2CW0 D;  2SOB A;  3GTO B;  4NKL A;  1CK1 A;  3CCV A;  1J9O A;  1XJV A;  1I4G A;  2K5W A;  4HSP A;  1H9S A;  1E3P A;  3G7L A;  2F0S A;  4ME3 A;  5IP7 H;  5ELF A;  2MO1 A;  1W6J A;  4HSV A;  3M7G A; 
#chains in the Genus database with same CATH homology
 4V0B A;  4FXK C;  2K33 A;  2B2V C;  1ESF A;  2RKS A;  4B9X A;  1CZG A;  2LMC B;  1ICW A;  5DNF A;  4FF4 A;  3TSS A;  4KMU C;  2WIN B;  4X3S A;  2XN9 C;  2F0D A;  1FNU A;  1SJH D;  4KD4 A;  4PQX A;  4FF3 A;  4KY7 A;  1A2U A;  3BDO A;  2D5D A;  4C3H G;  2AWO A;  4DAP A;  1SJE D;  4XQN A;  4EQP A;  1I50 B;  4WRD A;  1V8Q A;  3GTL B;  4AYB B;  4OGQ C;  3LWE A;  5T1G A;  4PMC A;  4KKU A;  3K5M A;  1UUP A;  1R4Q B;  3C1E A;  3GV6 A;  5BN5 A;  2E2J B;  4U68 A;  3J81 L;  2OF1 A;  2PZW A;  5EKL A;  5NUC A;  3S1N B;  1OXX K;  3QG1 A;  4EQO A;  3MZ5 A;  1GHJ A;  2A73 B;  4KY5 A;  4X3U A;  1SBB B;  4NP5 A;  1HUN A;  5IGC A;  3UI2 A;  4ZUJ A;  3NQT A;  1B53 A;  2I46 A;  3W2D A;  1CQF A;  4QCL A;  3IL8 A;  3M4Y A;  1VDZ A;  4MIU A;  1EFI D;  2EYL A;  5KNB A;  1PTO D;  1I4P A;  2SEB D;  3I4N B;  2F0M A;  2E76 C;  3T56 B;  2MUY A;  3I4M B;  1GXD C;  5EPK A;  3OMG A;  4KK7 A;  4C1N K;  4OIJ A;  1B44 D;  4IFD J;  1HCZ A;  1CQV A;  1IL8 A;  1KAB A;  4N9P A;  3T13 A;  4F8M A;  3DWA A;  1V43 A;  4G7O C;  4B08 A;  4N9T A;  3MA2 B;  5EGT A;  4R8N A;  2H1E A;  2BA1 A;  3TME A;  5J39 A;  4G57 A;  3LX0 A;  5KEE A;  4KV6 A;  2ICE C;  5C0X H;  2QCP X;  5C4H A;  3OMC A;  2Z4I A;  5FO9 B;  2JSO A;  5KYI A;  3HGB A;  3MXN A;  1HRJ A;  4RAU C;  4C3I B;  2NB0 A;  1STE A;  5I9P A;  5LL6 X;  3EJI A;  4CKB A;  2B2T A;  4HMJ A;  1RD9 D;  2R3Z A;  1MSH A;  3VA5 A;  1ESR A;  3H3V C;  2MGS A;  3V2T A;  2JEB I;  2O2L D;  3MXU A;  2EOT A;  1EIG A;  4XQQ A;  3NXW A;  3PUV A;  1B4O A;  4BY7 B;  3SK5 A;  1PTO B;  1C8C A;  2XWB B;  1SE4 A;  3BG3 A;  3H6M A;  1BNZ A;  1D1I A;  1IW7 C;  1U9R A;  4QIW B;  1PDQ A;  3S15 B;  1EY0 A;  1GUG A;  3ERQ A;  2B2Y C;  4IUU A;  2WAQ B;  2A74 C;  3PV0 A;  3MC0 B;  1QB5 D;  1S5F D;  1QIL A;  1QG7 A;  2FMC A;  5D3D A;  4M8A A;  2E75 C;  5CV4 A;  2Q8I B;  2FJ2 A;  4XYO A;  5FLX L;  4A3K B;  4K6D A;  1ET6 A;  2EYJ A;  2NTS A;  2O5I C;  4C3J B;  1G2S A;  2QF7 A;  3OW7 A;  3KLS A;  1VMC A;  3D3R A;  1SAP A;  2EE1 A;  2RVL A;  2PW5 A;  1SND A;  1ILQ A;  1KDA A;  3U9O A;  1ML0 D;  2BE5 D;  2K05 A;  1X32 A;  2CHB D;  1H9M A;  3HOW B;  3I91 A;  5IGE A;  2EPB A;  2QIL A;  4KJN A;  5G3L D;  4G4K A;  2NN6 I;  3KBG A;  3R2I A;  1EY4 A;  5I6W A;  1STH A;  3FPU B;  3TP6 A;  5CV8 A;  1YNN C;  3PUX A;  4A3D B;  4J1M A;  1SYG A;  4KHV A;  1B9M A;  4DA2 A;  5KRU A;  3E6Z X;  3BYT B;  3IFD A;  1MGS A;  2KEC A;  4DU9 A;  1O80 A;  3SR1 A;  3CQZ B;  2NN6 G;  4RKL A;  3MEH A;  4RHR A;  4IFD I;  2A6E D;  3L7Z C;  4DN4 M;  1BXT A;  2K1B A;  3TZU A;  3S1Q B;  3GTK B;  5I2Y A;  4V19 0;  2TSS A;  1E0B A;  5FLX E;  1JB3 A;  1EY5 A;  2EJF C;  3K5L A;  4XXE A;  2B63 B;  2VB3 X;  1WD0 A;  2QDB A;  1F2Y A;  2K03 A;  4ZAI A;  4IFD G;  1RDP D;  3FVQ A;  1HUM A;  1QCB D;  5KGU A;  4G7Z C;  3ZYY X;  1PTO H;  1XTC D;  3HP3 A;  1D5M C;  1STG A;  3H0G B;  1E2Z A;  1F2Z A;  4O42 A;  1UAP A;  1VCI A;  1SNC A;  1E2V A;  1GJX A;  5CBA E;  4A3J B;  1VF7 A;  3S16 B;  4CBV A;  1KLU D;  2HCC A;  1FD7 D;  1FR3 A;  2HCI A;  3L3O C;  3TP5 A;  1HFG A;  2F0V A;  1DCZ A;  2IW3 A;  3J7Y W;  3R2T A;  1TWF B;  3Q0A A;  3RD4 A;  4TQU S;  1SSO A;  5C44 B;  2XSC A;  2EZV A;  4DNT B;  3IAY A;  1XX8 A;  1DZ1 A;  1KNA A;  1EQV A;  1TS4 A;  2NVT B;  4XTC S;  5EPJ A;  2N55 A;  1VMP A;  5D14 A;  1BCP D;  3D6W A;  3Q24 A;  5FKA C;  3VYU A;  1X3Q A;  1ZXT A;  2EYF A;  2JEA I;  3CKI B;  1D5X C;  2B8F A;  4BY1 B;  2BDO A;  1TVX A;  1KLG D;  2F0T A;  2LY7 A;  3A8J E;  2EYM A;  3KLS X;  2RDH A;  1QOH A;  2NVY B;  3FRP B;  2M2L A;  2IWH A;  5CMD A;  4ME5 A;  3PIO 3;  2K7V A;  5IT9 L;  5EJW A;  2A69 D;  2K28 A;  2A68 D;  4TSS A;  1PRT D;  2ZT9 C;  1CTM A;  2F0J A;  3VR2 A;  2KVM A;  2NVX B;  2B39 A;  5IIF A;  4A3E B;  1Y1W B;  1PYW D;  3HOZ B;  2HDL A;  1AN8 A;  2LS0 1;  2IL8 A;  4Q5V A;  2VUM B;  1OXV A;  1DYQ A;  1LTT D;  4DGZ A;  3MFG A;  4IUP A;  3DHQ A;  3S17 B;  3SK6 A;  3MWY W;  5DEH A;  2PQE A;  3DWQ A;  2CW0 C;  2A6H D;  5F2D A;  4FYD A;  2F3V A;  1MBY A;  2H4O A;  1M4V A;  1PFM A;  1IKM A;  5FO7 B;  5C0X J;  1EIH A;  4K2K A;  1A3V A;  1EWH A;  3PO2 B;  2IX1 A;  3HOV B;  5IOC A;  2XNA C;  1AP0 A;  5M5X B;  2C5C A;  4H44 C;  2RA4 A;  1ZYR D;  1IYU A;  4QMG A;  3O13 A;  4RCN A;  4RA8 A;  1I6V C;  5EKI A;  1TWA B;  3VYS A;  4XIG S;  2R61 A;  5AFW A;  1B2T A;  1B50 A;  1PRT B;  3L9A X;  2EY6 A;  2DN8 A;  1V1P B;  2K01 A;  5CR3 A;  1GUT A;  3DEP A;  2X6G A;  5E3F A;  5KNC A;  1I4X A;  4FNF A;  1U4P A;  3EA6 A;  1QE6 A;  1LTB D;  1MD2 D;  2SNS A;  1EY7 A;  1U4M A;  4KN4 C;  1XWE A;  3DEO A;  4XT3 B;  1KAA A;  3K0Y A;  3D31 A;  3S2D B;  3HRZ C;  4ZQ3 A;  3RLF A;  5M3M B;  5BN3 A;  2B2T C;  2KA7 A;  4RWS C;  3QB3 A;  4E6I A;  3ND8 A;  1EEF D;  4KN7 C;  4U67 3;  1F2M A;  2ZXO A;  1VF5 C;  5JEA J;  3S14 B;  5E4X A;  1MSG A;  2G9D A;  1SYE A;  2DNE A;  3PMF A;  2QEJ C;  3DWP A;  1RCV D;  1SNO A;  2J0T D;  3TDQ A;  4KKS A;  5ISR A;  3P20 A;  2Y0S B;  3NTK A;  1AW7 A;  3F2U A;  4RFB A;  2HUG A;  2IX3 A;  1CFM A;  4CJ0 B;  1RHP A;  1H9S B;  2WII B;  1F9P A;  2AUK A;  2RDF A;  4HTH A;  3K6O A;  1QNK A;  4OIK A;  3CU7 A;  2L12 A;  3URY A;  1I4H A;  4ZK9 B;  4RCO A;  1TY2 A;  3KBX A;  1STY A;  2XVS A;  1SYB A;  1YNJ C;  2RSO A;  3GV3 A;  1II3 A;  3K5O A;  4HMI A;  3R8B A;  2B8G A;  1NSN S;  2MP1 A;  5C0X I;  4A3F B;  5CYU A;  3ND9 A;  1SE3 A;  5JPM C;  4JBW A;  4IUV A;  4C1N I;  2HQE A;  3K57 A;  2MJ8 A;  1U4L A;  3VR6 A;  3GTG B;  2AQ1 B;  4IUQ A;  4Q0F A;  3TP8 A;  5C0X G;  1H9R A;  1Y8P B;  1A15 A;  3GTQ B;  1B3A A;  4K8I A;  5TSS A;  4A3I B;  1DOK A;  1ZEQ X;  1LAB A;  2L11 A;  5IGB A;  1TS2 A;  4FXD A;  2R93 B;  3X3M A;  2RBM A;  5M5W B;  4GZY C;  1NUC A;  1TII D;  1TU2 B;  5D65 A;  4TRD A;  5CV7 A;  1PFN A;  4A3B B;  1EQT A;  3OSO A;  4CKC A;  1SE2 A;  4Z9C B;  1PZJ D;  4K5W A;  2B2W C;  1EWC A;  1OO9 B;  4ID6 A;  3A55 A;  4IN3 A;  4X3T A;  5C3W A;  1HXY D;  1C48 A;  4J8Q A;  2BE5 C;  4OO1 G;  3PUW A;  1H9J A;  4J6H A;  2DNC A;  1KDC A;  3QIA A;  1SFO B;  1EU3 A;  5I9O A;  3PUY A;  3SDZ A;  2PYK A;  5KND A;  2LKV A;  4FO2 A;  5T1I A;  1D2B A;  2JA7 B;  3H91 A;  4OO1 H;  3RZD B;  2ICI A;  3A8I E;  1S5C D;  4ZKC B;  2K5D A;  2A6E C;  1WTV A;  4DF7 A;  3OHX C;  1EY8 A;  3M7N A;  3T4A C;  5JEA G;  1SNP A;  2Q8R E;  2O4X A;  2D62 A;  5ELE A;  4LK1 C;  4ZUI A;  3SXH A;  1IHZ A;  2MHV A;  2PO4 A;  4K2L A;  4RGN A;  1F77 A;  2D9U A;  1F2L A;  2L4N A;  3KF8 A;  3MXG A;  5G3L F;  3JAM E;  3NBI A;  1GUW A;  3QOL A;  2R92 B;  5EQ0 A;  1JCK B;  5EPL A;  4C2M B;  5COY A;  2SDF A;  2IT1 A;  2XRS D;  4DK1 A;  2E2I B;  1LLR D;  3VYT A;  1QJO A;  4C3I G;  3M85 A;  5JEA H;  3C2P A;  4LMQ D;  2DY7 A;  1JWM D;  5KIX A;  1D5Z C;  3V96 A;  1TWH B;  3GQB A;  2IPK D;  1SYC A;  3TN2 A;  3IFT A;  3DMU A;  4IUR A;  3BDC A;  4I7Z C;  4PMB A;  1OXT A;  5CV9 A;  2IX0 A;  2BDN A;  3BVZ A;  2AQ3 B;  3V05 A;  4FXG C;  3K5N A;  2FIN B;  3MHB A;  2KCC A;  3MAQ A;  2N88 A;  1DM0 B;  3D4D A;  2XRQ D;  4PV1 C;  3ONA B;  1G29 1;  3LNN A;  3HOU B;  2SNM A;  1BCP C;  2F0K A;  2B2W A;  4BA1 I;  4FF2 A;  4BS9 A;  2PPB C;  2E2H B;  3BVG A;  2AQ2 B;  1BO0 A;  2XIW A;  3R93 A;  1SMY D;  2AWN A;  3SEB A;  4EVO A;  2HDM A;  1EL0 A;  4C3J G;  2EY5 A;  1D6E C;  1NR4 A;  1S5E D;  1NAP A;  2A68 C;  1WTR A;  1PRT C;  3P75 A;  1BQQ T;  1TY0 A;  3R3O A;  4DXG A;  2J4X A;  4X3K A;  1ROD A;  3J7A V;  4IQZ A;  2KED A;  1EYA A;  1A3U A;  1LT4 D;  2RDG A;  1EYD A;  3NUC A;  4ZYS A;  4CJ2 C;  4C56 C;  1BCP F;  4KHZ A;  1CHQ D;  2F0W A;  1CT1 D;  4F7X A;  2C9O A;  1I6H B;  1MI2 A;  3KUP A;  4A93 B;  1HTP A;  1BDO A;  3FMC A;  2X69 A;  3BYY B;  5CGK A;  1FNW A;  2A6H C;  4DXF A;  2VB2 X;  2Z1C A;  5A35 A;  3Q22 A;  4ZRZ A;  3H94 A;  1PFB A;  2NTT A;  4UDU C;  4H0L C;  4DAY A;  2KJX A;  3VR5 A;  5JVH 3;  3NPP A;  2EYP A;  5JAV A;  1PRT F;  4K5X A;  3WOF A;  5C6A A;  3D4W A;  1ZYR C;  5CC4 A;  5M5Y B;  1CZW A;  2JE6 I;  1GOZ A;  2BOS A;  1WTX A;  5I2X A;  1STA A;  5I4D A;  4BWG B;  3GTM B;  1WCM B;  5DAU A;  4WOR A;  1LTG D;  4LAA A;  4FP5 D;  2F0L A;  3TP7 A;  1PZI D;  1ZKO A;  1M8A A;  2F03 A;  3BZD B;  4K6L A;  1Q3L A;  4F88 A;  3A8K E;  1GUO A;  1HQR D;  4CJ1 B;  4QUC A;  2RSN A;  3DUZ A;  3SE0 A;  2NUC A;  5IGF A;  1BR9 A;  2ID0 A;  5KYL A;  2F0N A;  3HKZ B;  1SYD A;  1Z47 A;  2L0C A;  4CKE A;  5DM6 3;  2L5T A;  4YIJ A;  1CHP D;  2GA4 B;  2R7Z B;  3BS1 A;  2YU9 B;  3A7L A;  3BVM A;  3CRK C;  1JWU D;  2KCN A;  4HAE A;  1HQM C;  4ZLT F;  5COR A;  1AZP A;  1TR5 A;  3RZO B;  5M3F B;  1SDF A;  2EY2 A;  4WJW A;  1BF4 A;  1ONL A;  1RTO A;  1LTI D;  3NK9 A;  2KEE A;  1SEB D;  4QF4 A;  2PZU A;  1HA6 A;  1G2T A;  1JOO A;  1V1P A;  3I8Z A;  5CV5 A;  1Q90 A;  4K8J A;  5M9O A;  1EOT A;  2RQX A;  4A3G B;  3Q6S A;  2ZXR A;  4HED A;  3D6C A;  2V4D A;  3NWS A;  2OEO A;  5A2Q E;  4DNR B;  2LFN A;  4KI0 A;  1T5X D;  1JC7 A;  5BN4 A;  2ZXP A;  3SVM A;  3OWE B;  3NP8 A;  1LO5 D;  2F0G A;  3J80 E;  3I72 A;  2K32 A;  3K59 A;  3D8G A;  4K14 A;  1TWG B;  2J7Z A;  1A3T A;  1L0Y B;  3P7J A;  1JQY D;  4QB4 A;  1Z6H A;  4EQN A;  4F87 A;  2EY1 A;  1PMR A;  2F0O A;  2K04 A;  4OHJ A;  1JOQ A;  3MVV A;  2NYZ D;  1OXS C;  1TQO A;  5E1F A;  1PTO C;  1GUS A;  3A54 A;  1F9S A;  3S2H B;  2DY8 A;  4G7H C;  2KUM A;  4OL7 A;  3T51 B;  1EYC A;  4RKB A;  1CI3 M;  1T5E A;  3W3A A;  5C5L A;  3NBH A;  2D2C C;  2B2U C;  5K36 H;  3S9W A;  4RHS A;  1I4R A;  3N52 A;  2F3W A;  3M3Y B;  4M1U B;  5D3I B;  1S5D D;  2JA5 B;  5C4Z A;  2M9V A;  1DOL A;  2M00 A;  5EBD A;  3GO5 A;  3QJY A;  1RF2 D;  1H9K A;  2EJM A;  2X6L A;  3M4O B;  1IKL A;  1CA6 A;  1FGB D;  1SYF A;  1AZQ A;  1UEA B;  2CQA A;  1TKW B;  2NBF A;  5ELD A;  1Q1B A;  1PTO F;  1I4Q A;  2MPM A;  3GTP B;  3OWF A;  2E2D C;  4L8J A;  3SHL A;  2F0E A;  1L0X B;  4DK0 A;  1GHK A;  1V1O A;  2KOL A;  4FF1 A;  1FNV A;  4I65 A;  5FK9 C;  3ERO A;  1G6Z A;  5C4X B;  4KY6 A;  2F0F A;  3FKI B;  4TKO B;  4L63 B;  1C4Q A;  2L1B A;  1TS5 A;  2EVB A;  1S4Z A;  2PMZ B;  1ILP A;  5K5P A;  1JE4 A;  1DON A;  1G8Z D;  4WFN 3;  3LWU A;  2L9H A;  3VYR A;  4EGV A;  4OO1 I;  3K7A B;  2IJ0 A;  3EFX D;  4RGM A;  2Z4H A;  3DXJ C;  4IUT A;  2I07 B;  2JA8 B;  2JP1 A;  2WV6 D;  2EXZ A;  1O7L A;  3OOC A;  2NVQ B;  4NDX A;  3JAM L;  1Q12 A;  4Y7N B;  3E5S A;  4XT1 B;  4FVM A;  1QNU A;  2NZ1 D;  3FDT A;  4JK1 C;  1JOK A;  4PMW A;  3J81 E;  2R6G A;  3QO2 A;  5CBE E;  2JXM B;  1LTS D;  3SK4 A;  1Q8I A;  3Q23 A;  1YNJ D;  4PNY A;  5C4J B;  4ZKB B;  1QWY A;  1UNS A;  2K5Q A;  1RTN A;  5JVG 3;  1R4P B;  1B9N A;  5FOB B;  2EYO A;  2PNR C;  2F0H A;  1OXU A;  2B2U A;  1SNQ A;  2B2V A;  3T53 B;  1SNM A;  1LT3 D;  1K8O A;  1LV9 A;  1JIC A;  1HHV A;  2F0P A;  2AUJ D;  4CHT B;  1DOM A;  1X3P A;  3VA7 A;  3NTH A;  3PUZ A;  1KNE A;  1SMY C;  2EJG C;  1A6X A;  2QKI C;  1BBX C;  4HCS A;  3C3L A;  2YYZ A;  1LTA D;  1Q1E A;  4HCE A;  3ITP A;  1IYV A;  1S5B D;  1ET9 A;  3WOE A;  3HS0 C;  2KHS A;  1LT6 D;  1EEI D;  1BUV T;  2WAC A;  2G9H D;  2WP8 J;  5IOD A;  5J22 A;  5JJZ A;  5HGT A;  4QUF A;  4KTA A;  4UAI A;  2FHT A;  5E4W C;  3P1H A;  1JWS D;  1CM9 A;  4H7B A;  3CHB D;  1Y69 U;  2VNU D;  5CV6 A;  2BA0 A;  3N6R A;  3CRL C;  4LJZ C;  3A56 A;  3EVQ A;  3NQI A;  5IGD A;  1EU4 A;  4IUN A;  1RJT A;  1Y1V B;  1EZ8 A;  3C1F A;  4KD3 A;  3K58 A;  3X3N A;  3BDL A;  3E0J A;  3VR3 A;  3H09 A;  1STB A;  4DAV A;  5ELC A;  3KLR A;  1CA5 A;  4ODG A;  4MHE A;  1SXT A;  3FEW X;  4R9W A;  4P2C B;  1R9T B;  2A5H A;  1RKN A;  1IW7 D;  2NWG A;  4BA2 I;  2PZT A;  5DM7 3;  4MN3 A;  1AEX A;  1LT5 D;  1Y8N B;  3DM1 A;  1F9Q A;  2EDG A;  3RUZ A;  2VXW A;  3MTS A;  4XQJ A;  2F1M A;  2A69 C;  2JA6 B;  4CGY B;  3T16 A;  3HOX B;  3FPP A;  1EY6 A;  3I3C A;  3C46 A;  4RGO S;  2PW7 A;  2WB1 B;  2WKC A;  2NN6 H;  1HFN A;  1ENA A;  5ELB A;  2BCO A;  3NSW A;  1F9R A;  3MFY A;  3OIQ A;  4NMZ A;  1NCV A;  3A7A B;  2JYO A;  3TZD A;  1E2W A;  5C3E B;  3D4R A;  3AMU A;  4ULL A;  1B1Z A;  1STN A;  2L55 A;  1YNN D;  4HR7 B;  1TWC B;  3QOJ A;  1LTR D;  1Z7T A;  4IFD H;  1JOR A;  2CVR A;  1HA5 A;  1BOS A;  5LL6 S;  4ABN A;  2B2Y A;  4BBS B;  5LHY 1;  1W6K A;  3QWN A;  3GP7 A;  5FO8 B;  3NWT A;  1FYC A;  1KTK A;  2K6A A;  3G6J B;  1WTQ A;  3HZX A;  4O1N A;  2TMP A;  1DXM A;  1WTO A;  5JPN C;  1NR2 A;  2Q8T A;  3I73 A;  4IZ8 A;  4DFA A;  2F0I A;  3MXP A;  1ENC A;  2WKD A;  1EZ6 A;  1JR0 D;  1XYI A;  3EQL C;  1TT2 A;  4XDX A;  3WDN A;  2OXP A;  3RMH A;  5A2Q L;  2F4I A;  5C3X A;  1O7Z A;  3J80 L;  2F0Q A;  4L6T B;  4XYQ A;  5HUR A;  3NTI A;  2XWJ B;  2EYH A;  1D1K A;  4HN7 A;  4H13 C;  5C5M A;  1KDB A;  3S1R B;  3IKJ A;  1PXU A;  3OPO A;  1EY9 A;  2KQ3 A;  3SK8 A;  5EBC A;  3AB9 A;  4KKT A;  1PLF A;  3GD7 A;  4R8I A;  3OIP A;  3GTJ B;  4A3M B;  2ENB A;  4S3S A;  4K5V A;  3J7A F;  4B9W A;  2FMM A;  1U4R A;  1BCP B;  1TS3 A;  5JOB A;  1O7Y A;  5IGG A;  1WTW A;  5J1Z A;  3U9S A;  2E74 C;  2Z8L A;  1AFP A;  3KK7 A;  3PO3 B;  1LAC A;  3HEJ A;  1O78 A;  4RGT A;  5IT9 E;  3I70 A;  3S1M B;  3TBI B;  2F0U A;  2OT2 A;  4C3H B;  1A2T A;  3VR4 A;  1PZK D;  3NHH A;  1DJR D;  2FFK B;  1GUN A;  5EKK A;  5I6Y A;  1WD1 A;  3HOY B;  4ILW A;  1J8I A;  3HG9 A;  1XXG A;  1WTP A;  3AU7 A;  1ENF A;  2PCF B;  1K8M A;  1K83 B;  3I90 A;  1G91 A;  4BBR B;  4RH6 A;  5K36 G;  2O5J C;  4KJO A;  1HPC A;  1I3Q B;  3NE5 B;  1Y8O B;  1WVL A;  4IAL A;  3I4L A;  3PIP 3;  1HTL D;  1DD2 A;  4NW2 A;  2CW0 D;  2SOB A;  3GTO B;  4NKL A;  1CK1 A;  1J9O A;  1I4G A;  2K5W A;  4HSP A;  1H9S A;  3G7L A;  2F0S A;  5ELF A;  1W6J A;  4HSV A;  3M7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...