3BDOA

Solution structure of apo-biotinyl domain from acetyl coenzyme a carboxylase of escherichia coli determined by triple-resonance nmr spectroscopy
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
82
structure length
82
Chain Sequence
AAEISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Biotin
molecule keywords PROTEIN (ACETYL-COA CARBOXYLASE)
publication title Solution structures of apo and holo biotinyl domains from acetyl coenzyme A carboxylase of Escherichia coli determined by triple-resonance nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Escherichia coli
total genus 4
structure length 82
sequence length 82
ec nomenclature ec 6.4.1.2: Acetyl-CoA carboxylase.
pdb deposition date 1999-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bdoA00
2D2CC 4KN7C 3U9SA 4JK1C 3IFTA 2K33A 1A6XA 4DK0A 1FYCA 1K8MA 4BA1I 2BE5D 3QIAA 1YNNC 3CRKC 4TKOB 2BA0A 3RLFA 1TU2B 1Z7TA 3I72A 4G7ZC 3A8KE 2AUKA 2PCFB 3BDOA 3M85A 1Y69U 3KLRA 3T56B 2CW0C 2EDGA 4KKSA 2DNEA 1GUOA 2KCCA 3PV0A 2Q8IB 3VR3A 1GJXA 3OOCA 3HGBA 2B8GA 1IYVA 1H9RA 3FPPA 4TQUS 1HTPA 2A69C 2E74C 3I73A 1HQMC 2JEBI 3T53B 3P20A 4XTCS 3VR2A 1H9MA 3ND8A 1OXVA 4KI0A 1Q1EA 4OGQC 3GQBA 4RCNA 4DNTB 1HCZA 1DD2A 3EQLC 3A8IE 3L7ZC 1V43A 4KKUA 4DNRB 1GHKA 4I7ZC 3BG3A 1E2VA 1ONLA 2AUJD 3A7AB 4JBWA 2ZT9C 1VF7A 2JEAI 2D5DA 1GUSA 1OXSC 5A35A 1OXXK 1T5EA 1H9SA 1H9JA 1Y8OB 2A6EC 2E76C 2EJGC 3N6RA 4KN4C 1Z6HA 4LJZC 3SE0A 3M7NA 1K8OA 2PNRC 1V8QA 3PUZA 1IW7D 5BN4A 3AB9A 2PPBC 1O7LA 3VR5A 2EJFC 3WDNA 1LABA 2JE6I 5BN5A 4G7OC 1GHJA 2L5TA 3D31A 2EVBA 1Y8NB 2QF7A 4LK1C 2O5JC 1BDOA 1E2ZA 4KKTA 4L8JA 2NN6G 1IYUA 1DXMA 1YNJC 3OPOA 4G7HC 1Q1BA 3VR4A 4H0LC 5KNCA 3T51B 4IFDG 3SDZA 2V4DA 3LWUA 1B9MA 3D4RA 1H9SB 3I4LA 2R6GA 2K7VA 3NE5B 1ZKOA 1Q90A 2E75C 3CRLC 4BA2I 1TKWB 4IQZA 2A6HC 2DN8A 3PUWA 1FR3A 1I6VC 1GUTA 2KA7A 2NN6H 2YYZA 4OO1G 3LNNA 1G291 2AWOA 2A69D 1EWHA 1GUNA 1ZYRC 2JXMB 4HR7B 3GD7A 3QJYA 4GZYC 2NN6I 4KHZA 3VA7A 4IFDH 3A8JE 4DK1A 3PUXA 3A7LA 1E2WA 5K36G 1VF5C 5KNBA 5C0XG 2O5IC 3H94A 2A68C 1CI3M 2LMCB 3IKJA 1OXUA 4H13C 2BDOA 1CFMA 1HPCA 2DNCA 2F1MA 3W3AA 5BN3A 4H44C 1H9KA 4OO1H 4XIGS 1Y8PB 2BE5C 2IT1A 3FMCA 2A6HD 2A6ED 4KMUC 2B8FA 5JEAG 3TZUA 3MXUA 1SMYC 1Q12A 1B9NA 5K36H 1VCIA 5C0XH 2BA1A 3QG1A 1GUGA 1O78A 1DCZA 4PV1C 1CTMA 1IW7C 3M4YA 1PMRA 1QJOA 1VDZA 3VR6A 2EJMA 3MFYA 3DXJC 2D62A 2A68D 1LACA 3ND9A 1OXTA 3OW7A 3PUVA 3PUYA 5KNDA 2K32A 5JEAH
chains in the Genus database with same CATH superfamily
1P16A 3U9SA 1JB7A 2FMMA 4ABNA 1TWAH 3MC0B 2XTIA 3UDGA 3UDFA 1LTGD 1EIHA 4DV4Q 5ELFA 4RH6A 3PO3B 5JJKA 3S1RH 5JPNC 2KHJA 1J5EL 4DV2L 2EXZA 1Q81C 4KKSA 1PTOH 3CPWA 1TWCB 5COYA 1GM5A 4FNFA 1PXUA 1XPRA 2EYOA 1IZ6A 1LTSD 1NSNS 2JEBI 3GTKB 4DR7L 1YVCA 3VR2A 4FF1A 1LTAD 1HCZA 3EQLC 3FVQA 4JOIA 3CD6A 1C0AA 3E3XA 4QB4A 1SR3A 5ELBA 3CC4A 3J7AV 3BU2A 1MIUA 1LO5D 4A3IH 1GUSA 4FXDA 1I3QB 4LAAA 3MAQA 4IALA 3H3VH 4APVA 5M3MG 1V8QA 1WCMG 4O1NA 4DV4L 4OEMB 2EYLA 3K8AA 4KD4A 3PO2G 1J9OA 1U4MA 2IX0A 5IYBG 3HKZG 4KKTA 1OTCA 4PMBA 4JC0A 1LTBD 3K57A 3U58A 4O2DA 1Q1BA 1TY2A 1KL9A 4KD3A 1IL8A 1BCPF 3CCJA 3SDZA 2CWPA 1FGBD 1B9MA 2N8NA 5I2YA 3HOWG 3GO5A 1E0BA 4UDUC 2IHFA 3NP8A 1ZYRC 1F2LA 4HR7B 1I94Q 1IKLA 3M4PA 5I6YA 1KRTA 2K03A 2X6GA 2G9HD 1QUQA 2AHOB 1EQTA 2OTJA 3EBEA 1DOMA 4BBRH 1D2BA 1K83B 1W6JA 1R9TH 4GOPB 4GN4B 1K0RA 1SYFA 1ZYRD 1XNRQ 2B29A 4KK7A 4Q5VA 2FFKB 3TBIB 2F0DA 1F9SA 5I9OA 1GVPA 1VDZA 2F52A 1NUCA 2Y0SE 2MFIA 1K3RA 4ID6A 4LFBQ 1L0YB 4KY7A 4DUZQ 5A2QE 4DV5Q 3U4ZA 4JI8Q 1HNXQ 1IBLQ 4GOPC 3S14B 4KN7C 5KYLA 2L55A 2JA7H 1I94L 2Q8RE 4QIWB 4R8IA 2N78A 2OXPA 3KF8B 3M3YH 1C8CA 4RKBA 1EIYB 4LF6Q 3NBIA 3HOVH 2CW0C 2EDGA 2YTVA 1VQIA 1WTOA 2HHHQ 3AQQA 1I4QA 2K28A 4WJ3M 2QILA 2KBNA 1G51A 5KRUA 1XNRL 1JJGA 3S15B 1VQMA 2LXKA 2R92H 2OEOA 1SFOB 2K6AA 1M8AA 1V43A 4LFBL 2JQOA 4Z9CB 5IT9c 1IL2A 2PZTA 4DUZL 4DV5L 5DM73 4JI8L 5C44H 2NVXH 3H6MA 2F0GA 1HNXL 2CW0D 1IBLL 1K3BC 1OXSC 1T5EA 5C4ZA 1CM9A 3CP0A 3A56A 4G57A 3GTQH 5BN4A 2ZJRA 1U4PA 2F3VA 3N52A 1HNZQ 3K5MA 1GHJA 3S2DH 2EVBA 1BDOA 3M7GA 3A55A 1IYUA 1SE3A 3J80i 2A8VA 3NTHA 1Q46A 3NSWA 4H0LC 4PZ7A 1EY7A 5HY6A 2MUYA 3E5SA 1I6HB 1CHPD 1VQ8A 4CHTB 2E2JB 1EU4A 2XNAC 1L2FA 4EQPA 4FVMA 4OO1G 4HJ9A 5I9PA 3I90A 1TS3A 3I4OA 4C3IB 1QWYA 3G6JB 3VA7A 1NJIC 2I0QA 2O5IC 3H94A 3M4OB 4DU9A 1WTPA 3BZDB 1HNZL 5BN3A 3X3NA 3S1QB 3GTJB 5LHY1 3F2BA 3SVMA 2NVTB 1M4VA 5C0XH 2F0PA 1EFWA 1S5BD 2TSSA 2ES2A 3QO2A 4IUUA 1FNUA 3GTKH 2EXDA 3H09A 2M00A 3PUVA 3QB3A 2B63G 4A3MG 5FLXL 3PMFA 5JEAH 1KLUD 2E2DC 4JK1C 4R4CA 4IPDA 4DV3L 1K8AC 4C3JG 3AFPA 5EJWA 2V1CC 4B9XA 5GADC 2F0VA 5EKLA 2MHVA 3IL8A 3C2PA 2F4VL 4BBSB 2F0TA 4NXML 2Q2TA 2UXBQ 2L0CA 4Y7NB 2Q8IB 2ZXPA 5KYIA 1HZ9A 4DR2Q 1N33Q 3JAMc 2CCZA 1EY0A 3TSSA 2PI2E 3CCLA 3P20A 1TWGH 3ND8A 1EY9A 4YCWA 1Y14B 4DNRB 2M9VA 4IO9A 3MHBA 4K14A 5C3EH 5AJ3Q 1AFPA 3GTMB 1QCBD 3K6OA 4V190 4A3GG 1YNXA 2EY1A 4O42A 3R93A 1Z6HA 1B44D 1LM0A 2EYHA 3RZOB 2E2IB 3PF4A 3WDNA 5BN5A 1LABA 1MJCA 2JE6I 4AYBG 2UXCQ 3A0JA 4JBJA 2F4IA 2L5TA 5FO8B 1CUKA 2O5JC 1E2ZA 2UXBL 5G3LF 1BBWA 3KYHC 5CC4A 4A3FG 1DXMA 2WV6D 4DR2L 3UDXA 3K0YA 3J81E 1SJED 2V4DA 5IGGA 3K58A 1K83H 1UE6A 1TKWB 2K14A 1WD0A 1GXDC 1I6VC 3KF6B 1GUTA 4GOPA 1NCVA 5AJ3L 1G291 2A74C 2A69D 1HA5A 4XQQA 4HJ5A 3M9BA 3QWNA 2NN6I 4IFDH 1NAPA 3A7LA 1VF5C 4A93H 2QKIC 1FNVA 2PZUA 1WVLA 3S14H 4FF3A 3DWAA 2QW7A 3FKIG 2E2HH 2IHEA 4C3HG 3Q0AA 4F7XA 2NVYB 5E1FA 3CAMA 2UXCL 4IOAA 4JI7Q 2F3IA 1QB5D 2EZVA 4ZUJA 1B9NA 1P8LA 1JCKB 2HQEA 4LUZA 2Z0SA 1QOHA 1AZQA 1QJOA 3K5OA 3VR6A 3HOXG 1DOKA 4AQYQ 1SFOH 1LYLA 1BOSA 1MJEA 2UUCQ 3G6EA 1GUWA 3OMCA 4DR4Q 3A54A 1YNNC 4ILWA 4H02A 4A3BG 1QNUA 2AQ1B 5IP9H 4DPGA 1SEBD 3HOUG 1TWFB 3PQIA 3ERQA 5DNFA 4ODGA 3SK4A 1IBMQ 3IRBA 3KLWA 4JI7L 3OOCA 1AW7A 3FPPA 3HOZB 2E74C 4C3JB 2R93G 5C0XI 1EFID 1BCPB 1X9NA 1H9MA 3B6YA 1YNND 1DD2A 1KAAA 3A8IE 4C2MH 2JA8G 4DF7A 3TP5A 3EJIA 2Q8TA 2RSOA 1CKNA 2K5HA 2ZTDA 1BCPC 3CKIB 1K73C 1V1PB 2UUCL 2Q2UA 1G2TA 1HUMA 1KTKA 2A6EC 2EJGC 4DR4L 1Q8KA 3VR5A 4C3IH 2JK8A 4BBRG 1STGA 5IYCG 1KAWA 3D31A 5FLMG 1D8LA 5EPKA 4X3UA 1SROA 3M4OH 3W1GA 1IBML 3S1NB 1VQ9A 1LTLA 2Q2HA 1JT8A 2B2UC 3C3LA 2NUCA 3GTJH 3VYRA 3HOYG 1BCPD 1ZXTA 3DEPA 3KLSA 3NE5B 2GN5A 2K7VA 2NVTH 2Z1CA 2E75C 3KBXA 1S5CD 4A3JH 1D5XC 4YIJA 1CK1A 4A76A 1KLGD 2YYZA 3W2DA 3CQZB 2QDLA 1S40A 2FJ2A 3AFQA 5C3WA 4RWSC 4B3SQ 3NPPA 4WORA 1LT3D 4A3LH 2EYJA 4QY7A 3STBC 1D7QA 4RGNA 5C4XB 1NMFA 1A15A 2WB1E 4M8AA 3T13A 1XYIA 4X6AH 1RL2A 2G5DA 2F0FA 1B70B 2PW5A 5CGKA 4L5TA 4NXNQ 3TS0A 5K36H 1MI2A 1VQFA 5ELOA 5JVG3 4Y7NH 1N8RC 3QG1A 3FKIB 1TVXA 4C3HB 1MD2D 2BDNA 3ULJA 3M4YA 5BR8Q 1QVCA 3RR5A 3ND9A 3J7ZC 5IP7G 1EIFA 1K9MC 1YNJD 1Y1VH 5E3FA 4AIMA 3T1HQ 4NB3A 3TMEA 4TKOB 1LUZA 1ZEQX 4CJ2C 1EY5A 4MIUA 3I72A 5D14A 2KEEA 5JVH3 3HOXB 4Y52H 3TP8A 3RLOA 1I4HA 5M3FB 1MSHA 2K05A 4R8NA 2E2IH 1V9PA 2DNEA 5KIXA 1QNKA 1HTPA 2PMZE 4NXNL 3T4AC 1RHPA 3S2HB 2E8GA 3QOJA 4XTCS 1VQOA 2NTTA 2CQOA 2A19A 4HMJA 1J6QA 2GA4B 3FDTA 3HOUB 4QUCA 2SNSA 4YHHL 4B08A 4R9WA 5BR8L 4LF7Q 2IPKD 4JV5Q 3H0GG 2WACA 1WFQA 1F77A 1H9JA 5KGUA 1C7YA 3T1HL 2XN9C 3BYTB 4ULLA 3AB9A 2JA8B 3NTIA 4C1NK 4POFA 1LT5D 3CCQA 2N88A 5C4JH 1XTCD 2QEXA 4YWMA 3MEFA 3GTPH 3TP7A 2RF4A 2AKWB 1WJJA 3GTOB 1YBYA 3S16B 4X64Q 1TT2A 2NVYH 1JORA 1NNXA 1SNMA 3EVQA 1N36Q 2NZHA 1IHZA 1BVSA 1JQYD 5J1ZA 1ET6A 2LXJA 3NHHA 4IUTA 5DEHA 1I4PA 2UU9Q 4B3ML 1TY0A 3EN2A 1WTWA 4LF7L 3LNNA 3O13A 1GUNA 4JV5L 4GZYC 2XWBB 1YITA 2WAQE 4A75A 2K4KA 1HFGA 3URYA 1QZHA 1PYWD 2IL8A 4KY5A 4RMFA 1PFMA 1F9QA 1YJNA 3E9HA 1DONA 1A3VA 1CSPA 4JI1Q 1MBYA 3HP3A 2OCEA 2RVLA 1YI2A 3I4NG 4EGVA 4X64L 2JA5H 1CA5A 5T1GA 5EKKA 1N36L 3GTLB 2K75A 3HOZH 1PMRA 1ICWA 2RQXA 1ENCA 2D62A 1G6ZA 2UU9L 1X3PA 2JN4A 4DR6Q 1XJVA 4EX5A 2RA4A 2K33A 3R2IA 1K0SA 1VQDA 3SK8A 3CRKC 3I4MG 4LWCA 3M4QA 3OMGA 1SNCA 4G7ZC 3CU7A 4DR5Q 2DY7A 3EROA 2RDHA 1V1PA 2N49A 3TRZA 4KY6A 5FK9C 4HN7A 4A3KG 3PV0A 1BO0A 3K80C 4JI1L 1FD7D 2B2UA 5LL6S 1U9RA 2ZTCA 1N34Q 4RCOA 4RGMA 3CF5A 2KECA 1PFNA 4J6HA 3CCVA 4DR3Q 3S1NH 4LFAQ 3J81j 2WKDA 1PLFA 4DFAA 1GD7A 3L7ZC 4N8X1 2J4XA 2Z8LA 1CZWA 3PSIA 4P2CB 3K5LA 3QR8A 3A5UA 4PMCA 1KRSA 1B7YB 3BG3A 1X3GA 1Y1WH 1BKBA 3UI2A 1L1OC 1STNA 2RHQB 1JWSD 4BY7G 2VQEQ 5NUCA 2F03A 5M5YB 3CQZH 4K5WA 1VQKA 4TRDA 2HDMA 5IT9E 2IWHA 4K8JA 4DR5L 1CKOA 4NW2A 5IGCA 5C4XH 4LK1C 2E5LQ 1TWHB 5IYDG 2N3SA 5G3LD 4PQXA 1CHQD 3DUZA 1LLRD 3LX0A 1OO9B 4F88A 1N34L 2ZXRA 2YU9B 4DR3L 4OELB 1H9SB 4LFAL 4CDCC 3RUZA 1ZKOA 4A3DG 2JA6B 2KA7A 1UAPA 5C5MA 4WFN3 3I3CA 5IGFA 2VQEL 4WRDA 4C56C 1F9RA 2DNCA 1A3TA 1X55A 2F0EA 1H9KA 1SE4A 5JAVA 1PYBA 3PIP3 2E5LL 1SNPA 3JAML 4OO1I 3NQIA 1VCIA 1VQPA 1EEID 1GUGA 3ZYYX 3P75A 4NP5A 1CTMA 1ICFB 3SGIA 4BXXG 2EJMA 1EQRA 4LW1A 4XXEA 2K50A 1E22A 5GAHC 1IXRA 3I4NB 1DM0B 3NUCA 3QIAA 3OHXC 5E7NA 3OIPA 1C9OA 2F0JA 3BDOA 1G6PA 1L0XB 4WJ4A 3T56B 5L37A 2EE1A 4K0KQ 1WTRA 5GAGC 1IYVA 2RCFA 2QEJC 5JJIA 1PH8A 2R7ZB 1S5ED 4F8MA 3L0OA 4V0BA 1B53A 1TIID 4A3CG 1JE5A 5FKAC 2KJXA 4A3KB 1EU3A 4I7ZC 2B2TC 2B39A 1VF7A 4HCEA 4JI2Q 3DM3A 3SE0A 2VUMH 3TDQA 2B2WC 4A3EG 4G4KA 3PUZA 1X32A 1JB3A 2EJFC 4BY1G 4HJ8A 4UAIA 3PF5A 1CSQA 4N9TA 3U4VA 3J81i 3EA6A 3P1HA 2EYPA 1PH3A 1M90C 3GTGB 4K0KL 1PTOF 4B9WA 1EEFD 1PZID 4BY7B 2NYZD 2EYMA 3DLLA 3J7A5 2H5XA 1Q7YC 1Y1VG 3I4LA 4ZYSA 5C6AA 2DN8A 4XYQA 2D9UA 4ZAIA 2NN6H 2DJGC 4L5QA 3W5OA 2EY2A 1E1TA 1LV9A 4JI2L 4DK1A 1FJGQ 4DV7Q 4LF6L 4A4IA 2HIVA 2ZM6Q 3CXCA 1CKNB 4HSPA 1CFMA 2WB1G 4H44C 2HHHL 1NR4A 4IURA 5M3MB 1WCMB 3QOLA 2KEDA 3NBHB 2B8FA 3MFGA 3PO2B 1SMYC 1ENAA 3HKZB 5FJ8H 3V96A 2L4NA 3MXPA 3F8TA 2DGYA 4XQNA 5FO9B 1CA6A 1AE2A 3ZJYC 5K5PA 1L1OA 1KHIA 4B3TQ 1Q82C 3HOWB 2WFWA 1K8MA 1TS4A 1SSOA 3C46A 3RLFA 1FJGL 1SAPA 4DV7L 3A8KE 3PO3H 2ZM6L 4S3SA 4JI3Q 5C3XA 1Y69U 1VQAA 1U5KA 5ELNA 1TWCH 2VZAA 3OWFA 4HAEA 4DV1Q 5M5XB 1Z9FA 4LUOA 4K5VA 3Q6SA 1OXVA 1ESFA 1Q1EA 2C5CA 4RCNA 4DNTB 3H15A 1HFNA 1EWIA 2F0HA 3KJOA 1EYDA 4R4IA 4JI5Q 2UUBQ 2AUJD 3A7AB 2I5HA 2ZT9C 3DWQA 4B3TL 2JEAI 4IUVA 1KQSA 3K7AB 3IAYA 1H9SA 1I3QH 4IPCA 1JE4A 2QA4A 2I5LX 1A8VA 1YIJA 2JA5G 1U4RA 2K5WA 3NELA 2K01A 4L8JA 3MXNA 1JC7A 4KJNA 4DV1L 2B3GA 4RHSA 1VQCA 2L1BA 2XRQD 3GDEA 3EIVA 5IOCA 1F9PA 4QIWE 3F2UA 4BA2I 4DAMA 4UP9A 1X54A 3S9WA 1FR3A 5C5LA 1XMQQ 4OIKA 4JI5L 1WTVA 2UUBL 5CMDA 3Q23A 5FLXE 3RZDB 1I4RA 1N32Q 1SNOA 2LKVA 2VXWA 1NTGA 4GLAC 3JC66 4MHEA 1DGSA 1N33L 3I70A 4XIGS 2Z6KC 2SEBD 2R3ZA 1UNSA 3TQYA 3J80L 1HZBA 3BVGA 4B3RQ 1KD1C 3AEVA 4YWKA 1PH7A 2F0KA 4CDEC 2PW7A 2R7ZH 1X65A 2XWJB 2B2TA 1UWVA 5M5WB 1XMQL 1X3FA 3IFTA 5HGQA 1A6XA 1HZCA 2B2WA 4X3SA 4N8FA 1T9HA 1N32L 1EWCA 1F2YA 4R4OA 4K2LA 1D1IA 2BH8A 4FO2A 2KCCA 1UE1A 3VR3A 1BXTA 4LF8Q 1VQGA 2B8GA 2OWOA 4TQUS 3ITPA 4A3IG 1PDQA 1I50B 3SEBA 3ULPA 2B2YC 3FP9A 2ASBA 4OGQC 2KCMA 3FRPB 3I55A 3I7FA 3S15H 4B3RL 1NR2A 2K5DA 1SYCA 5IWAQ 2MJ8A 4KKUA 2SDFA 1O80A 3G71A 1JOKA 1MKHA 4OHJA 3FPUB 2NZOA 2MP1A 4LJZC 2EY6A 2LS01 5D3IB 1K8OA 2B63B 4P72A 4A3MB 3KJPA 2PPBC 2KENA 4HIKA 4QQBX 5CV7A 4QJFA 4K8IA 2F0IA 2RBMA 2XGTA 2SOBA 4LF8L 1PRTB 4UPAA 5DLQE 3VR4A 1S72A 1YHBA 2YTYA 5M3MH 1WCMH 1LTID 3E6ZX 3D4RA 5ELEA 1AZPA 3PO2H 1I6HH 2MQHA 1HJPA 4ALPA 4AQYL 2E2JH 2O2LD 3NBHA 5IYBH 1E3PA 5IWAL 2JJQA 3OIQA 1HUNA 1EL0A 2F0OA 3UE0A 1PRTC 2AWOA 2JXMB 3PCOB 4PNYA 2CWAA 4JI0Q 2RCNA 4OXPA 2OQ0A 4LF4Q 5FOBB 3HOWH 1S3OA 2ICIA 4A3GB 1OXUA 3K81C 3WWVA 2F1MA 4IJLA 3S1QH 3KBGA 1ET9A 1QG7A 4RAUC 3FMCA 2CVRA 2A6ED 3TZUA 4AYBB 1PHJA 1Q12A 1HXYD 4JBKA 2JA7G 3HG9A 5M5XH 1HR0Q 4A3FB 1FNWA 4IPHA 1KDBA 3SXHA 3AYHB 4KHVA 1UUPA 3BJUA 3MFYA 1PVOA 3HOVG 2OT2A 2AQ3B 3D4WA 2D2CC 1VQ5A 2R61A 2AMCB 1TWAB 4GNXC 3OWEB 1NE3A 2ZTEA 3R3OA 4JI0L 1X3QA 4GN5A 4LF4L 2Z4IA 4ZKBB 4L5SA 2EYFA 2PCFB 4BBSH 2R92G 4IN3A 2PQAA 4MN3A 3M85A 3DHQA 4M1UB 4HEDA 3TREA 1PTOB 1ENFA 4XDXA 3F1ZA 4OX9Q 3STBD 5C44G 3J81c 1O7IA 1FVIA 3MVVA 3T53B 3D3RA 1YZ6A 1DZ1A 4I7AA 1U4LA 1UE5A 2Y0SG 1HR0L 4JW0A 1EOTA 1DYQA 3UDIA 2XRSD 4J15A 4DXGA 1PTOC 4ZRZA 4B3SL 1D6EC 3RN5A 2HDLA 3R8BA 4BS9A 1E2VA 3ER0A 1ONLA 3GTMH 5ELCA 1E1OA 1B3AA 5FO7B 2RHSB 1SN8A 2RDGA 3U50C 1VS0A 3BZKA 3RZOH 2BH2A 3H91A 1JICA 3RZDH 1PH2A 2WP8J 2Z6KA 4A3BB 1UEBA 1KDAA 3J80c 1S5DD 4IJHA 5IE8A 1XTDA 3P7JA 4LF5Q 2FHTA 4OX9L 2IX1A 3H3VC 2R7DA 1PFSA 4MZ9A 1KNAA 2C9OA 2R93B 5GQOA 2P5ZX 2MO1A 1FGUA 1A0IA 1MSGA 1HR0W 3A8JE 1LTTD 1EUJA 3WOFA 1BBXC 5KNBA 3BDCA 5C0XG 2HCCA 5LMUQ 2SNMA 2FXQA 2BDOA 1JR0D 1HPCA 4TSSA 2K5VA 4MNOA 4OO1H 1DOLA 2O4XA 3OYYA 1STAA 5JEAG 2H1EA 4BBRB 4X65Q 1VQNA 2B2YA 5E4WC 1R9TB 5CV8A 4LF5L 2BA1A 3MA2B 4JI4Q 3K0XA 3TZDA 2FINB 2GVBA 2D0PA 1XNQQ 5IY0A 1IW7C 1I50H 4HJ7A 3G48A 3DXJC 3HOYB 2VW9A 1D1KA 2MNAA 3K7UC 3D0FA 5EAYA 1PH4A 2NZ1D 4KLKA 2JA7B 2F0QA 1EOVA 1HTLD 1TU2B 3M3YB 2RDFA 2AUKA 1TWFH 2GVAA 1M1KC 5LMUL 3C1FA 1D5ZC 2B63H 4A3MH 2EQSA 5C3EG 4RKLA 3DM1A 2HD3A 1E7ZA 2ZXOA 4OL7A 4C3JH 1PV4A 4J8QA 4K6DA 4X65L 5DAUA 3Q22A 1UE7A 4JI4L 4X3TA 4DAYB 4XT3B 1KDCA 2PO4A 2DUDA 3CC2A 1CT1D 1VQEA 1WI5A 3I2ZA 1QVGA 2WINB 5CV6A 2NVXB 2D5DA 5A35A 3CCRA 3N6RA 1Y8OB 2E76C 2KHIA 1W3SA 2PNRC 2Y0SB 2KOLA 4LF9Q 1SNDA 4YCUA 1MGSA 5D3DA 4XT1B 2ID0A 1L1OB 4YCVA 1B8AA 4A3GH 4G7HC 4JI6Q 2EOTA 4P71A 1KC8C 4IFDG 2QDBA 4A93G 4POGA 1GOZA 1S4ZA 4FP5D 4OWWB 4DR6L 3KK7A 1U0LA 1SE2A 2JP1A 1TS2A 2ENBA 3PIOA 4A3FH 3GV3A 4IPGA 3L3OC 1SBBB 2H4OA 4DAPA 4JYAQ 5CR3A 4GNXA 1SMXA 4P73A 3NWSA 2OF1A 2QGQA 4KJOA 4KHPQ 1EYCA 2CH4W 4LF9L 1NBWA 3H0GB 4ME3A 3G4SA 4H13C 3W3AA 1ILQA 5EQ0A 1BUVT 2F0NA 3I91A 5IIFA 2XIWA 1F2ZA 1Q3LA 1LTRD 4JI6L 3J7AF 2XSCA 2DJFC 3FKIH 3MWYW 4C3HH 1JWMD 2UUAQ 1RDPD 5IP9G 2F0LA 3MXNB 3K59A 1WD1A 3BVZA 1B2TA 3NENA 5JOBA 4JYAL 1FYCA 1X3EA 3NQTA 1EZ6A 5I6WA 3NXWA 4ZQ3A 1SYGA 4KHPL 3HOXH 5HURA 4UY8C 5M3FH 1N9WA 2VNUD 1PRTF 2Z9HA 1GUOA 1TS5A 2NB0A 4DAVA 4PMWA 1HRJA 3S2HH 4A3BH 1ML0D 1TWGB 4KI0A 3GQBA 2CH4A 2VQFQ 3HOUH 1CQVA 1O7YA 2UUAL 5A2QL 4FXGC 4C3IG 1Q86C 1VQBA 2NBFA 2B2VC 5J3BA 5C3EB 3KOJA 3L9AX 2I5MX 1R4QB 1SYDA 2R93H 3RD4A 1PYSB 3CW2C 3I56A 2JA8H 4EQOA 3RLNA 3G7LA 3I4MB 2QF7A 5H1SE 2VL6A 4A3JG 3S16H 3GTOH 4JBMA 5CBEE 4R1JA 5KEEA 5C0XJ 3AU7A 4K5XA 4A3LG 1A2UA 1QILA 2ICEC 3JAME 2JA9A 1ESRA 4OIJA 5IYCH 3Q8DA 2VQFL 1PH6A 5FLMH 1PZJD 1TXYA 2A6HC 4DV6Q 2R7FA 4QUFA 2RKSA 4UHVA 3TS2A 4XYOA 5JEAJ 5ISRA 1EWHA 3DMUA 3GD7A 3V2TA 4DK6C 4BBSG 4OWXB 3W1BA 4KHZA 3HOYH 4GKKQ 1SYBA 5K36G 4A93B 3BVMA 2MGSA 1PH5A 2A68C 1PH9A 2E2HB 3S17B 2LMCB 1RKNA 2LY7A 3HZXA 1G91A 4QGUA 2YV5A 3SK6A 2VY3A 2BE5C 3E9IA 3X3MA 1PA6A 2A6HD 4NMZA 3KFUA 1PFBA 1HNWQ 4K2KA 2OQKA 1EQVA 1E24A 1SYEA 4CJ0B 3GTLH 3VA5A 4RGOS 2WIIB 2L11A 1W2BA 5LMNQ 4FXKC 3T16A 2A68D 1LACA 4DV6L 2A73B 4F87A 1WYDA 3C1EA 3IFDA 4A3DB 3VYTA 4HCSA 2BE5D 4DAYA 1NMGA 5DM63 1XPOA 5LL6X 4J1MA 1YHQA 4GKKL 1CQFA 2F0SA 4CJ1B 1G2SA 3NWTA 5IP7H 1KNEA 1I4GA 1A63A 1XMOQ 1LT6D 1SDFA 1D5MC 3VYSA 1GJXA 3WOEA 4H7BA 4MTNA 1B50A 2K5NA 4HJAA 4LNQA 1HNWL 2L12A 4DKAC 4E6IA 4FF4A 4IZ8A 1IKMA 4YY3Q 4C2MB 1WTXA 5LMNL 1RF2D 2F3WA 2KUMA 3TEHB 2CHBD 1SMYD 4EQNA 1PH1A 5D65A 3CPFA 4IFDJ 1Z47A 4KN4C 5M5YH 1YEZA 3M7NA 4R4QA 2VS1A 4ME5A 5JJLA 1O7LA 4DV3Q 1V1OA 3LWEA 4QCLA 1RCVD 3TP6A 3H3VI 2NVQB 1AE3A 1TWHH 5GAEC 1KABA 3VDYA 2F4VQ 3ERSX 3H0GH 1XMOL 2A1AA 4NXMQ 3SK5A 1C4QA 4P74A 1RIPA 1WTQA 3LWUA 2YU9H 5HGTA 4QMGA 2R6GA 2PQAB 3MEHA 4YY3L 1BF4A 2JA6H 4A3JB 1HQRD 3KDFB 3T1YQ 4I65A 2BCOA 4DV0Q 3KLSX 3QJYA 4TVAB 3PUXA 3ONAB 3D6CA 5LMNW 4JI3L 1RODA 2AQ2B 1B4OA 4FDBA 1LT4D 4EVOA 3HOZG 1XXGA 2CKZB 3HEJA 2F0WA 1HHVA 4A3EB 2TMPA 1Q8IA 1XPUA 1K8GA 2IT1A 4JVZA 4XQJA 2IJ0A 4BY1B 1JWUD 3J81L 3MXUA 4IUPA 1EY8A 3U9OA 3S1MB 4CGYB 1DCZA 4PZ8A 3UE1A 1W6KA 2B2VA 2CQAA 5KNDA 1OXTA 3OW7A 2IX3A 1STYA 2K32A 1Y1VB 1DJRD 4QF4A 3T1YL 3I4NH 2WAQG 1V1QA 4O0AA 4DV0L 4DK0A 4BA1I 4RGTA 4U68A 1YHAA 1Z7TA 2X69A 3FHWA 4KTAA 5CORA 4DXFA 1YJ9A 1X56A 2EY5A 1PZKD 3A74A 3VYUA 2F0UA 3ICEA 4LUVA 3D6WA 3GV6A 1Y1WG 4OWTB 1QZGA 1HH2P 3I4MH 2A69C 4DN4M 2WB1B 3I73A 1HQMC 4IUNA 4L63B 3MZ5A 4U673 2K52A 3CMEA 3MXGA 3Q24A 3TN2A 1B1ZA 1I4XA 4IUQA 4ZUIA 4A3KH 1WTHA 3PIPA 2X6LA 5C4XG 4JPBW 4JBWA 2NWGA 1OXXK 4QL5A 1VQ7A 2PZWA 1ILPA 2LFNA 4HIOA 2UXDQ 3HKZE 2PI2A 5C4JB 1SXTA 3GTPB 3GTGH 3CHBD 3S17H 4BY7H 3E0JA 3CMAA 2Q2IA 4C1NI 3BS1A 3D8GA 1TQOA 1QE6A 3J80E 2DY8A 3KF8A 3HFZB 5EBCA 4CKCA 4IQZA 1IBKQ 3NEMA 5IYDH 4NKLA 2K04A 2PMZB 2K1BA 4KV6A 4ZK9B 2N55A 3F2DA 1R4PB 1GKHA 2KCTA 1VMPA 5M3FG 2PNHA 4A3DH 5JJZA 2AWNA 1AEXA 2IW3A 1SNQA 2VB2X 4L6TB 2L9HA 2UXDL 2G9DA 2OTLA 2HT1A 4X62Q 2KQ3A 1Y8PB 5EGTA 1JOOA 3A5ZB 2JA5B 2WKCA 4NDXA 1A3UA 3PIO3 2Z6BA 1O78A 5IODA 1VQ4A 5I2XA 3PUYA 1F2MA 1IBKL 1T5XD 3PGZA 3EFXD 2Z4HA 4UP7A 5IGDA 4DR1Q 2JYOA 4JG2A 5CV9A 1EQQA 2PQEA 4BXXH 1K28A 2F0MA 4CDDC 2K5QA 3KLRA 5CYUA 1PRTD 3CCSA 4X62L 2WAQB 4N9PA 4BWGB 4GNXB 3HGBA 3BZCA 1H9RA 2NVQH 4HIDA 1VQLA 1AP0A 2VUMG 1ASZA 1AH9A 4PG3A 1G8ZD 2D0OA 4X66Q 3ULLA 3CC7A 1UEAB 2KVMA 1GO3E 2IY5B 4RA8A 1Y1WB 5FLXc 1A2TA 5IGEA 1EYAA 3K7AH 3FEWX 3E0EA 2J0TD 2J7ZA 5GROA 3S1RB 1EZ8A 2KHSA 4FF2A 1AN8A 1C48A 1SJHD 4DR1L 1EIGA 4A3CH 1VMCA 3RN2A 3KDFA 5CV4A 3K5NA 1YJWA 1FL0A 1Y8NB 4GLXA 2ALYB 1QVFA 5CBAE 1EYGA 1I5FA 4CBVA 1SRUA 2NN6G 2QCPX 1YNJC 5KNCA 4A3EH 3I8ZA 4UP8A 1HZAA 4AH6A 4GS3A 4ZLTF 4BY1H 1Q90A 4GLVB 4A3IB 4JOIC 4X66L 3HS0C 1KXLA 3S1MH 3NK9A 3GP7A 4YHHQ 5J39A 3OW2A 4RHRA 2L15A 3BDLA 1BNZA 1XWEA 1E2WA 4DUYQ 5C4HA 4LFCQ 2HQLA 1WOCA 5FJ8G 4IFDI 1HA6A 3SR1A 1PTOD 1CI3M 3IKJA 4HMIA 3HRZC 2I07B 2LSSA 5E4XA 3OTOQ 4KMUC 3LGJA 4R4TA 3DWPA 2VB3X 4HSVA 5M9OA 2HUGA 5T1IA 2RSNA 4PV1C 3D4DA 2ZJPA 3PO3G 4EQ5A 4K6LA 2MPMA 2PYKA 4MTKA 5M5WH 4DK3C 1CZGA 1QUQB 4B3MQ 4HTHA 1X6OA 1SLJA 2BA0A 2NTSA 5J22A 4DUYL 2A5HA 1STEA 4LFCL 4DGZA 2HCIA 1BQQT 5F2DA 4LMQD 1XX8A 2KCNA 3DEOA 3KF6A 4NPSA 4RFBA 3OTOL 1EY6A 4JCVE 4WJWA 1JJ2A 1H95A 2JA6G 2HIXA 2MO0A 2BOSA 2M2LA 5JPMC 3V05A 3KUPA 3S24A 1GHKA 1ASYA 1RTOA 1IYJB 4ZCKA 2JSOA 3SHLA 3CCEA 4GKJQ 2VUMB 1NY4A 5EPLA 2XVSA 1RD9D 3HOVB 1S5FD 4AYBE 1IW7D 1MHWC 4CDFC 1KIXA 3RMHA 1BBUA 4G7OC 4DNIA 2ATWA 2EIFA 1EY4A 5ELDA 1JOQA 3JAMi 1J8IA 1SE8A 2I46A 1BR9A 1STBA 1B3QA 1II3A 1TR5A 3OPOA 4PZ6A 4L5RC 4CKBA 2R92B 1VQ6A 3HKSA 1XNQL 3T51B 1L0WA 3BYYB 1VQHA 2ZJQA 2CFMA 5C44B 3CRLC 1A62A 3PUWA 3CCUA 3J7YW 4YWLA 3L2PA 3GTQB 3CCMA 4OONA 4IOCA 3MTSA 5IGBA 5IT9L 1CKMA 4GKJL 3S2DB 4HIMA 1STHA 2EPBA 4RG1A 4CKEA 4DA2A 1J5EQ 1RJTA 4DV2Q 5CV5A 5EBDA 3OSOA 2R7ZG 1JJCB 5AFWA 1JMCA 3RNUA 4Q0FA 2FMCA 4P75A 3R2TA 5TSSA 2C35B 4DR7Q 4X3KA 5I4DA 4GN3B 4ZKCB 1VQJA 4FYDA 5EPJA 1RTNA 1O7ZA 5EKIA 3AMUA 3F2CA 2YTXA 3NTKA
chains in the Genus database with same CATH topology
3U9SA 2FMMA 4ABNA 3MC0B 1LTGD 1EIHA 5ELFA 4RH6A 3PO3B 5JPNC 2EXZA 4KKSA 1PTOH 1TWCB 5COYA 4FNFA 1PXUA 2EYOA 1LTSD 1NSNS 2JEBI 3GTKB 3VR2A 4FF1A 1LTAD 1HCZA 3EQLC 3FVQA 4QB4A 5ELBA 3J7AV 1LO5D 1GUSA 4FXDA 1I3QB 4LAAA 3MAQA 4IALA 1V8QA 4O1NA 2EYLA 4KD4A 1J9OA 1U4MA 2IX0A 4KKTA 4PMBA 1LTBD 3K57A 1Q1BA 1TY2A 4KD3A 1IL8A 1BCPF 3SDZA 1FGBD 1B9MA 5I2YA 3GO5A 1E0BA 4UDUC 3NP8A 1ZYRC 1F2LA 4HR7B 1IKLA 5I6YA 2K03A 2X6GA 2G9HD 1EQTA 1DOMA 1D2BA 1K83B 1W6JA 1SYFA 1ZYRD 4KK7A 4Q5VA 2FFKB 3TBIB 2F0DA 1F9SA 5I9OA 1VDZA 1NUCA 4ID6A 1L0YB 4KY7A 5A2QE 3S14B 4KN7C 5KYLA 2L55A 2Q8RE 4QIWB 4R8IA 2OXPA 1C8CA 4RKBA 3NBIA 2CW0C 2EDGA 1WTOA 1I4QA 2K28A 2QILA 5KRUA 3S15B 2OEOA 1SFOB 2K6AA 1M8AA 1V43A 4Z9CB 2PZTA 5DM73 3H6MA 2F0GA 2CW0D 1OXSC 1T5EA 5C4ZA 1CM9A 3A56A 4G57A 5BN4A 1U4PA 2F3VA 3N52A 3K5MA 1GHJA 2EVBA 1BDOA 3M7GA 3A55A 1IYUA 1SE3A 3NTHA 3NSWA 4H0LC 1EY7A 2MUYA 3E5SA 1I6HB 1CHPD 4CHTB 2E2JB 1EU4A 2XNAC 4EQPA 4FVMA 4OO1G 5I9PA 3I90A 1TS3A 4C3IB 1QWYA 3G6JB 3VA7A 2O5IC 3H94A 3M4OB 4DU9A 1WTPA 3BZDB 5BN3A 3X3NA 3S1QB 3GTJB 5LHY1 3SVMA 2NVTB 1M4VA 5C0XH 2F0PA 1S5BD 2TSSA 3QO2A 4IUUA 1FNUA 3H09A 2M00A 3PUVA 3QB3A 5FLXL 3PMFA 5JEAH 1KLUD 2E2DC 4JK1C 4C3JG 5EJWA 4B9XA 2F0VA 5EKLA 2MHVA 3IL8A 3C2PA 4BBSB 2F0TA 2L0CA 4Y7NB 2Q8IB 2ZXPA 5KYIA 1EY0A 3TSSA 3P20A 3ND8A 1EY9A 4DNRB 2M9VA 3MHBA 4K14A 1AFPA 3GTMB 1QCBD 3K6OA 4V190 2EY1A 4O42A 3R93A 1Z6HA 1B44D 2E2IB 2EYHA 3RZOB 3WDNA 5BN5A 1LABA 2JE6I 2F4IA 2L5TA 5FO8B 2O5JC 1E2ZA 5G3LF 5CC4A 1DXMA 2WV6D 3K0YA 3J81E 1SJED 2V4DA 5IGGA 3K58A 1TKWB 1WD0A 1GXDC 1I6VC 1GUTA 1NCVA 1G291 2A74C 2A69D 1HA5A 4XQQA 3QWNA 2NN6I 4IFDH 1NAPA 3A7LA 1VF5C 2QKIC 1FNVA 2PZUA 1WVLA 4FF3A 3DWAA 4C3HG 3Q0AA 4F7XA 2NVYB 5E1FA 1QB5D 2EZVA 4ZUJA 1B9NA 1JCKB 2HQEA 1QOHA 1AZQA 1QJOA 3K5OA 3VR6A 1DOKA 1BOSA 1GUWA 3OMCA 3A54A 1YNNC 4ILWA 1QNUA 2AQ1B 1SEBD 1TWFB 3ERQA 5DNFA 4ODGA 3SK4A 3OOCA 1AW7A 3FPPA 3HOZB 2E74C 4C3JB 5C0XI 1EFID 1BCPB 1H9MA 1DD2A 1YNND 1KAAA 3A8IE 4DF7A 3TP5A 3EJIA 2Q8TA 2RSOA 1BCPC 3CKIB 1V1PB 1G2TA 1HUMA 1KTKA 2A6EC 2EJGC 3VR5A 1STGA 3D31A 5EPKA 4X3UA 3S1NB 2B2UC 3C3LA 2NUCA 3VYRA 1BCPD 1ZXTA 3DEPA 3KLSA 3NE5B 2K7VA 2Z1CA 2E75C 3KBXA 1S5CD 1D5XC 4YIJA 1CK1A 1KLGD 2YYZA 3W2DA 3CQZB 2FJ2A 5C3WA 4RWSC 3NPPA 4WORA 1LT3D 2EYJA 4RGNA 5C4XB 1A15A 4M8AA 3T13A 1XYIA 2F0FA 2PW5A 5CGKA 5K36H 1MI2A 5JVG3 3QG1A 3FKIB 1TVXA 4C3HB 1MD2D 2BDNA 3M4YA 3ND9A 1YNJD 5E3FA 3TMEA 4TKOB 1ZEQX 4CJ2C 1EY5A 4MIUA 3I72A 5D14A 2KEEA 5JVH3 3HOXB 3TP8A 1I4HA 5M3FB 1MSHA 2K05A 4R8NA 2DNEA 5KIXA 1QNKA 1HTPA 3T4AC 1RHPA 3S2HB 3QOJA 4XTCS 2NTTA 4HMJA 2GA4B 3FDTA 3HOUB 4QUCA 2SNSA 4B08A 4R9WA 2IPKD 2WACA 1F77A 1H9JA 5KGUA 2XN9C 3BYTB 4ULLA 3AB9A 2JA8B 3NTIA 4C1NK 1LT5D 2N88A 1XTCD 3TP7A 3S16B 3GTOB 1TT2A 1JORA 1SNMA 3EVQA 1IHZA 1JQYD 5J1ZA 1ET6A 3NHHA 4IUTA 5DEHA 1I4PA 1TY0A 1WTWA 3LNNA 3O13A 1GUNA 4GZYC 2XWBB 1HFGA 3URYA 1PYWD 2IL8A 4KY5A 1PFMA 1F9QA 1DONA 1A3VA 1MBYA 3HP3A 2RVLA 4EGVA 1CA5A 5T1GA 5EKKA 3GTLB 1PMRA 1ICWA 2RQXA 1ENCA 2D62A 1G6ZA 1X3PA 2RA4A 2K33A 3R2IA 3SK8A 3CRKC 3OMGA 1SNCA 4G7ZC 3CU7A 2DY7A 3EROA 2RDHA 1V1PA 4KY6A 5FK9C 4HN7A 3PV0A 1BO0A 1FD7D 2B2UA 5LL6S 1U9RA 4RCOA 4RGMA 2KECA 1PFNA 4J6HA 2WKDA 1PLFA 4DFAA 3L7ZC 2J4XA 2Z8LA 1CZWA 4P2CB 3K5LA 4PMCA 3BG3A 3UI2A 1STNA 1JWSD 5M5YB 5NUCA 2F03A 4K5WA 4TRDA 2HDMA 5IT9E 2IWHA 4K8JA 4NW2A 5IGCA 4LK1C 1TWHB 5G3LD 4PQXA 1CHQD 3DUZA 1LLRD 3LX0A 1OO9B 4F88A 2ZXRA 2YU9B 1H9SB 3RUZA 1ZKOA 2JA6B 2KA7A 1UAPA 5C5MA 4WFN3 3I3CA 5IGFA 4WRDA 4C56C 1F9RA 2DNCA 1A3TA 2F0EA 1H9KA 1SE4A 5JAVA 3PIP3 1SNPA 3JAML 4OO1I 3NQIA 1VCIA 1EEID 1GUGA 3ZYYX 3P75A 4NP5A 1CTMA 2EJMA 4XXEA 3I4NB 1DM0B 3NUCA 3QIAA 3OHXC 3OIPA 2F0JA 3BDOA 1L0XB 3T56B 2EE1A 1WTRA 1IYVA 2QEJC 2R7ZB 1S5ED 4F8MA 4V0BA 1B53A 1TIID 5FKAC 2KJXA 4A3KB 1EU3A 4I7ZC 2B2TC 2B39A 1VF7A 4HCEA 3SE0A 3TDQA 2B2WC 4G4KA 3PUZA 1X32A 1JB3A 2EJFC 4UAIA 4N9TA 3EA6A 3P1HA 2EYPA 3GTGB 1PTOF 4B9WA 1EEFD 1PZID 4BY7B 2NYZD 2EYMA 3I4LA 4ZYSA 5C6AA 2DN8A 4XYQA 2D9UA 4ZAIA 2NN6H 2EY2A 1LV9A 4DK1A 4HSPA 1CFMA 4H44C 1NR4A 4IURA 5M3MB 1WCMB 3QOLA 2KEDA 2B8FA 3MFGA 3PO2B 1SMYC 1ENAA 3HKZB 3V96A 2L4NA 3MXPA 4XQNA 5FO9B 1CA6A 5K5PA 3HOWB 1K8MA 1TS4A 1SSOA 3C46A 3RLFA 1SAPA 3A8KE 4S3SA 5C3XA 1Y69U 3OWFA 4HAEA 5M5XB 4K5VA 3Q6SA 1OXVA 1ESFA 1Q1EA 2C5CA 4RCNA 4DNTB 1HFNA 2F0HA 1EYDA 2AUJD 3A7AB 2ZT9C 3DWQA 2JEAI 4IUVA 3K7AB 3IAYA 1H9SA 1JE4A 1U4RA 2K5WA 2K01A 4L8JA 3MXNA 1JC7A 4KJNA 4RHSA 2L1BA 2XRQD 5IOCA 1F9PA 3F2UA 4BA2I 3S9WA 1FR3A 5C5LA 4OIKA 1WTVA 5CMDA 3Q23A 5FLXE 3RZDB 1I4RA 1SNOA 2LKVA 2VXWA 4MHEA 3I70A 4XIGS 2SEBD 2R3ZA 1UNSA 3J80L 3BVGA 2F0KA 2PW7A 2XWJB 2B2TA 5M5WB 3IFTA 1A6XA 2B2WA 4X3SA 1EWCA 1F2YA 4K2LA 1D1IA 4FO2A 2KCCA 3VR3A 1BXTA 2B8GA 4TQUS 3ITPA 1PDQA 1I50B 3SEBA 2B2YC 4OGQC 3FRPB 1NR2A 2K5DA 1SYCA 2MJ8A 4KKUA 2SDFA 1O80A 1JOKA 4OHJA 3FPUB 2MP1A 4LJZC 2EY6A 2LS01 5D3IB 1K8OA 2B63B 4A3MB 2PPBC 5CV7A 4K8IA 2F0IA 2RBMA 2SOBA 1PRTB 3VR4A 1LTID 3E6ZX 3D4RA 5ELEA 1AZPA 2O2LD 3NBHA 3OIQA 1HUNA 1EL0A 2F0OA 1PRTC 2AWOA 2JXMB 4PNYA 5FOBB 2ICIA 4A3GB 1OXUA 2F1MA 3KBGA 1ET9A 1QG7A 4RAUC 3FMCA 2CVRA 2A6ED 3TZUA 4AYBB 1Q12A 1HXYD 3HG9A 4A3FB 1FNWA 1KDBA 3SXHA 4KHVA 1UUPA 3MFYA 2OT2A 2AQ3B 3D4WA 2D2CC 2R61A 1TWAB 3OWEB 3R3OA 1X3QA 2Z4IA 4ZKBB 2EYFA 2PCFB 4IN3A 4MN3A 3M85A 3DHQA 4M1UB 4HEDA 1PTOB 1ENFA 4XDXA 3MVVA 3T53B 3D3RA 1DZ1A 1U4LA 1EOTA 1DYQA 2XRSD 4DXGA 1PTOC 4ZRZA 1D6EC 2HDLA 3R8BA 4BS9A 1E2VA 1ONLA 5ELCA 1B3AA 5FO7B 2RDGA 3H91A 1JICA 2WP8J 4A3BB 1KDAA 1S5DD 3P7JA 2IX1A 2FHTA 3H3VC 1KNAA 2C9OA 2R93B 1MSGA 3A8JE 1LTTD 3WOFA 1BBXC 5KNBA 3BDCA 5C0XG 2HCCA 2SNMA 2BDOA 1JR0D 1HPCA 4TSSA 4OO1H 1DOLA 2O4XA 1STAA 5JEAG 2H1EA 4BBRB 2B2YA 5E4WC 1R9TB 5CV8A 2BA1A 3MA2B 3TZDA 2FINB 1IW7C 3DXJC 3HOYB 1D1KA 2NZ1D 2JA7B 2F0QA 1HTLD 1TU2B 3M3YB 2RDFA 2AUKA 3C1FA 1D5ZC 4RKLA 3DM1A 2ZXOA 4OL7A 4J8QA 4K6DA 5DAUA 3Q22A 4X3TA 4XT3B 1KDCA 2PO4A 1CT1D 2WINB 5CV6A 2NVXB 2D5DA 5A35A 1Y8OB 3N6RA 2E76C 2PNRC 2Y0SB 2KOLA 1SNDA 1MGSA 5D3DA 4XT1B 2ID0A 4G7HC 2EOTA 4IFDG 2QDBA 1GOZA 1S4ZA 4FP5D 3KK7A 1SE2A 2JP1A 1TS2A 2ENBA 3GV3A 3L3OC 1SBBB 2H4OA 4DAPA 5CR3A 3NWSA 2OF1A 4KJOA 1EYCA 3H0GB 4H13C 3W3AA 1ILQA 5EQ0A 1BUVT 2F0NA 3I91A 5IIFA 2XIWA 1F2ZA 1Q3LA 1LTRD 3J7AF 2XSCA 3MWYW 1JWMD 1RDPD 2F0LA 3K59A 1WD1A 3BVZA 1B2TA 5JOBA 1FYCA 3NQTA 1EZ6A 5I6WA 3NXWA 4ZQ3A 1SYGA 5HURA 2VNUD 1PRTF 1GUOA 1TS5A 2NB0A 4DAVA 4PMWA 1HRJA 1ML0D 1TWGB 4KI0A 3GQBA 1CQVA 1O7YA 5A2QL 4FXGC 4C3IG 2NBFA 2B2VC 5C3EB 3L9AX 1R4QB 1SYDA 3RD4A 4EQOA 3G7LA 3I4MB 2QF7A 5CBEE 5KEEA 5C0XJ 3AU7A 4K5XA 1A2UA 1QILA 2ICEC 3JAME 1ESRA 4OIJA 1PZJD 2A6HC 4QUFA 2RKSA 4XYOA 5JEAJ 5ISRA 1EWHA 3DMUA 3GD7A 3V2TA 4KHZA 1SYBA 5K36G 4A93B 3BVMA 2MGSA 2A68C 2E2HB 3S17B 2LMCB 1RKNA 2LY7A 3HZXA 1G91A 3SK6A 2BE5C 3X3MA 2A6HD 4NMZA 1PFBA 4K2KA 1EQVA 1SYEA 4CJ0B 3VA5A 4RGOS 2WIIB 2L11A 4FXKC 3T16A 2A68D 1LACA 2A73B 4F87A 3C1EA 3IFDA 4A3DB 3VYTA 4HCSA 2BE5D 4DAYA 5DM63 5LL6X 4J1MA 1CQFA 2F0SA 4CJ1B 1G2SA 3NWTA 1KNEA 1I4GA 1LT6D 1SDFA 1D5MC 3VYSA 1GJXA 3WOEA 4H7BA 1B50A 2L12A 4E6IA 4FF4A 4IZ8A 1IKMA 4C2MB 1WTXA 1RF2D 2F3WA 2KUMA 2CHBD 1SMYD 4EQNA 5D65A 4IFDJ 1Z47A 4KN4C 3M7NA 4ME5A 1O7LA 1V1OA 3LWEA 4QCLA 1RCVD 3TP6A 2NVQB 1KABA 3SK5A 1C4QA 1WTQA 3LWUA 5HGTA 4QMGA 2R6GA 3MEHA 1BF4A 4A3JB 1HQRD 4I65A 2BCOA 3KLSX 3QJYA 3PUXA 3ONAB 3D6CA 1RODA 2AQ2B 1B4OA 1LT4D 4EVOA 1XXGA 3HEJA 2F0WA 1HHVA 4A3EB 2TMPA 1Q8IA 2IT1A 4XQJA 2IJ0A 4BY1B 1JWUD 3J81L 3MXUA 4IUPA 1EY8A 3U9OA 3S1MB 4CGYB 1DCZA 1W6KA 2B2VA 2CQAA 5KNDA 1OXTA 3OW7A 2IX3A 1STYA 2K32A 1Y1VB 1DJRD 4QF4A 4DK0A 4BA1I 4RGTA 4U68A 1Z7TA 2X69A 4KTAA 5CORA 4DXFA 2EY5A 1PZKD 3VYUA 2F0UA 3D6WA 3GV6A 2A69C 4DN4M 2WB1B 3I73A 1HQMC 4IUNA 4L63B 3MZ5A 4U673 3MXGA 3Q24A 3TN2A 1B1ZA 1I4XA 4IUQA 4ZUIA 2X6LA 4JBWA 2NWGA 1OXXK 2PZWA 1ILPA 2LFNA 5C4JB 1SXTA 3GTPB 3CHBD 3E0JA 4C1NI 3BS1A 3D8GA 1TQOA 1QE6A 3J80E 2DY8A 3KF8A 4CKCA 5EBCA 4IQZA 4NKLA 2K04A 2PMZB 2K1BA 4KV6A 4ZK9B 2N55A 1R4PB 1VMPA 5JJZA 2AWNA 1AEXA 2IW3A 1SNQA 2VB2X 4L6TB 2L9HA 2G9DA 2KQ3A 1Y8PB 5EGTA 1JOOA 2JA5B 2WKCA 4NDXA 1A3UA 3PIO3 1O78A 5IODA 5I2XA 3PUYA 1F2MA 1T5XD 3EFXD 2Z4HA 5IGDA 2JYOA 5CV9A 2PQEA 2F0MA 2K5QA 3KLRA 5CYUA 1PRTD 2WAQB 4N9PA 4BWGB 3HGBA 1H9RA 1AP0A 1G8ZD 1UEAB 2KVMA 4RA8A 1Y1WB 1A2TA 5IGEA 1EYAA 3FEWX 2J0TD 2J7ZA 3S1RB 1EZ8A 2KHSA 4FF2A 1AN8A 1C48A 1SJHD 1EIGA 1VMCA 5CV4A 3K5NA 1Y8NB 5CBAE 4CBVA 2NN6G 2QCPX 1YNJC 5KNCA 3I8ZA 4ZLTF 1Q90A 4A3IB 3HS0C 3NK9A 3GP7A 5J39A 4RHRA 3BDLA 1BNZA 1XWEA 1E2WA 5C4HA 4IFDI 1HA6A 3SR1A 1PTOD 1CI3M 3IKJA 4HMIA 3HRZC 2I07B 5E4XA 4KMUC 3DWPA 2VB3X 4HSVA 5M9OA 2HUGA 5T1IA 2RSNA 4PV1C 3D4DA 4K6LA 2MPMA 2PYKA 1CZGA 4HTHA 2BA0A 2NTSA 5J22A 2A5HA 1STEA 4DGZA 2HCIA 1BQQT 5F2DA 4LMQD 1XX8A 2KCNA 3DEOA 4RFBA 1EY6A 4WJWA 2BOSA 2M2LA 5JPMC 3V05A 3KUPA 1GHKA 1RTOA 2JSOA 3SHLA 2VUMB 5EPLA 2XVSA 1RD9D 3HOVB 1S5FD 1IW7D 3RMHA 4G7OC 5ELDA 1EY4A 1JOQA 1J8IA 2I46A 1BR9A 1STBA 1II3A 1TR5A 3OPOA 2R92B 4CKBA 3T51B 3BYYB 5C44B 3CRLC 3PUWA 3J7YW 3GTQB 3MTSA 5IGBA 5IT9L 3S2DB 1STHA 2EPBA 4CKEA 4DA2A 1RJTA 5CV5A 5EBDA 3OSOA 5AFWA 4Q0FA 2FMCA 3R2TA 5TSSA 4X3KA 5I4DA 4ZKCB 4FYDA 5EPJA 1RTNA 1O7ZA 5EKIA 3AMUA 3NTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D2C C;  4KN7 C;  3U9S A;  4JK1 C;  3IFT A;  2K33 A;  1A6X A;  4DK0 A;  1FYC A;  1K8M A;  4BA1 I;  2BE5 D;  3QIA A;  1YNN C;  3CRK C;  4TKO B;  2BA0 A;  3RLF A;  1TU2 B;  1Z7T A;  3I72 A;  4G7Z C;  3A8K E;  2AUK A;  2PCF B;  3BDO A;  3M85 A;  1Y69 U;  3KLR A;  3T56 B;  2CW0 C;  2EDG A;  4KKS A;  2DNE A;  1GUO A;  2KCC A;  3PV0 A;  2Q8I B;  3VR3 A;  1GJX A;  3OOC A;  3HGB A;  2B8G A;  1IYV A;  1H9R A;  3FPP A;  4TQU S;  1HTP A;  2A69 C;  2E74 C;  3I73 A;  1HQM C;  2JEB I;  3T53 B;  3P20 A;  4XTC S;  3VR2 A;  1H9M A;  3ND8 A;  1OXV A;  4KI0 A;  1Q1E A;  4OGQ C;  3GQB A;  4RCN A;  4DNT B;  1HCZ A;  1DD2 A;  3EQL C;  3A8I E;  3L7Z C;  1V43 A;  4KKU A;  4DNR B;  1GHK A;  4I7Z C;  3BG3 A;  1E2V A;  1ONL A;  2AUJ D;  3A7A B;  4JBW A;  2ZT9 C;  1VF7 A;  2JEA I;  2D5D A;  1GUS A;  1OXS C;  5A35 A;  1OXX K;  1T5E A;  1H9S A;  1H9J A;  1Y8O B;  2A6E C;  2E76 C;  2EJG C;  3N6R A;  4KN4 C;  1Z6H A;  4LJZ C;  3SE0 A;  3M7N A;  1K8O A;  2PNR C;  1V8Q A;  3PUZ A;  1IW7 D;  5BN4 A;  3AB9 A;  2PPB C;  1O7L A;  3VR5 A;  2EJF C;  3WDN A;  1LAB A;  2JE6 I;  5BN5 A;  4G7O C;  1GHJ A;  2L5T A;  3D31 A;  2EVB A;  1Y8N B;  2QF7 A;  4LK1 C;  2O5J C;  1BDO A;  1E2Z A;  4KKT A;  4L8J A;  2NN6 G;  1IYU A;  1DXM A;  1YNJ C;  3OPO A;  4G7H C;  1Q1B A;  3VR4 A;  4H0L C;  5KNC A;  3T51 B;  4IFD G;  3SDZ A;  2V4D A;  3LWU A;  1B9M A;  3D4R A;  1H9S B;  3I4L A;  2R6G A;  2K7V A;  3NE5 B;  1ZKO A;  1Q90 A;  2E75 C;  3CRL C;  4BA2 I;  1TKW B;  4IQZ A;  2A6H C;  2DN8 A;  3PUW A;  1FR3 A;  1I6V C;  1GUT A;  2KA7 A;  2NN6 H;  2YYZ A;  4OO1 G;  3LNN A;  1G29 1;  2AWO A;  2A69 D;  1EWH A;  1GUN A;  1ZYR C;  2JXM B;  4HR7 B;  3GD7 A;  3QJY A;  4GZY C;  2NN6 I;  4KHZ A;  3VA7 A;  4IFD H;  3A8J E;  4DK1 A;  3PUX A;  3A7L A;  1E2W A;  5K36 G;  1VF5 C;  5KNB A;  5C0X G;  2O5I C;  3H94 A;  2A68 C;  1CI3 M;  2LMC B;  3IKJ A;  1OXU A;  4H13 C;  2BDO A;  1CFM A;  1HPC A;  2DNC A;  2F1M A;  3W3A A;  5BN3 A;  4H44 C;  1H9K A;  4OO1 H;  4XIG S;  1Y8P B;  2BE5 C;  2IT1 A;  3FMC A;  2A6H D;  2A6E D;  4KMU C;  2B8F A;  5JEA G;  3TZU A;  3MXU A;  1SMY C;  1Q12 A;  1B9N A;  5K36 H;  1VCI A;  5C0X H;  2BA1 A;  3QG1 A;  1GUG A;  1O78 A;  1DCZ A;  4PV1 C;  1CTM A;  1IW7 C;  3M4Y A;  1PMR A;  1QJO A;  1VDZ A;  3VR6 A;  2EJM A;  3MFY A;  3DXJ C;  2D62 A;  2A68 D;  1LAC A;  3ND9 A;  1OXT A;  3OW7 A;  3PUV A;  3PUY A;  5KND A;  2K32 A;  5JEA H; 
#chains in the Genus database with same CATH topology
 1P16 A;  3U9S A;  1JB7 A;  2FMM A;  4ABN A;  1TWA H;  3MC0 B;  2XTI A;  3UDG A;  3UDF A;  1LTG D;  1EIH A;  4DV4 Q;  5ELF A;  4RH6 A;  3PO3 B;  5JJK A;  3S1R H;  5JPN C;  2KHJ A;  1J5E L;  4DV2 L;  2EXZ A;  1Q81 C;  4KKS A;  1PTO H;  3CPW A;  1TWC B;  5COY A;  1GM5 A;  4FNF A;  1PXU A;  1XPR A;  2EYO A;  1IZ6 A;  1LTS D;  1NSN S;  2JEB I;  3GTK B;  4DR7 L;  1YVC A;  3VR2 A;  4FF1 A;  1LTA D;  1HCZ A;  3EQL C;  3FVQ A;  4JOI A;  3CD6 A;  1C0A A;  3E3X A;  4QB4 A;  1SR3 A;  5ELB A;  3CC4 A;  3J7A V;  3BU2 A;  1MIU A;  1LO5 D;  4A3I H;  1GUS A;  4FXD A;  1I3Q B;  4LAA A;  3MAQ A;  4IAL A;  3H3V H;  4APV A;  5M3M G;  1V8Q A;  1WCM G;  4O1N A;  4DV4 L;  4OEM B;  2EYL A;  3K8A A;  4KD4 A;  3PO2 G;  1J9O A;  1U4M A;  2IX0 A;  5IYB G;  3HKZ G;  4KKT A;  1OTC A;  4PMB A;  4JC0 A;  1LTB D;  3K57 A;  3U58 A;  4O2D A;  1Q1B A;  1TY2 A;  1KL9 A;  4KD3 A;  1IL8 A;  1BCP F;  3CCJ A;  3SDZ A;  2CWP A;  1FGB D;  1B9M A;  2N8N A;  5I2Y A;  3HOW G;  3GO5 A;  1E0B A;  4UDU C;  2IHF A;  3NP8 A;  1ZYR C;  1F2L A;  4HR7 B;  1I94 Q;  1IKL A;  3M4P A;  5I6Y A;  1KRT A;  2K03 A;  2X6G A;  2G9H D;  1QUQ A;  2AHO B;  1EQT A;  2OTJ A;  3EBE A;  1DOM A;  4BBR H;  1D2B A;  1K83 B;  1W6J A;  1R9T H;  4GOP B;  4GN4 B;  1K0R A;  1SYF A;  1ZYR D;  1XNR Q;  2B29 A;  4KK7 A;  4Q5V A;  2FFK B;  3TBI B;  2F0D A;  1F9S A;  5I9O A;  1GVP A;  1VDZ A;  2F52 A;  1NUC A;  2Y0S E;  2MFI A;  1K3R A;  4ID6 A;  4LFB Q;  1L0Y B;  4KY7 A;  4DUZ Q;  5A2Q E;  4DV5 Q;  3U4Z A;  4JI8 Q;  1HNX Q;  1IBL Q;  4GOP C;  3S14 B;  4KN7 C;  5KYL A;  2L55 A;  2JA7 H;  1I94 L;  2Q8R E;  4QIW B;  4R8I A;  2N78 A;  2OXP A;  3KF8 B;  3M3Y H;  1C8C A;  4RKB A;  1EIY B;  4LF6 Q;  3NBI A;  3HOV H;  2CW0 C;  2EDG A;  2YTV A;  1VQI A;  1WTO A;  2HHH Q;  3AQQ A;  1I4Q A;  2K28 A;  4WJ3 M;  2QIL A;  2KBN A;  1G51 A;  5KRU A;  1XNR L;  1JJG A;  3S15 B;  1VQM A;  2LXK A;  2R92 H;  2OEO A;  1SFO B;  2K6A A;  1M8A A;  1V43 A;  4LFB L;  2JQO A;  4Z9C B;  5IT9 c;  1IL2 A;  2PZT A;  4DUZ L;  4DV5 L;  5DM7 3;  4JI8 L;  5C44 H;  2NVX H;  3H6M A;  2F0G A;  1HNX L;  2CW0 D;  1IBL L;  1K3B C;  1OXS C;  1T5E A;  5C4Z A;  1CM9 A;  3CP0 A;  3A56 A;  4G57 A;  3GTQ H;  5BN4 A;  2ZJR A;  1U4P A;  2F3V A;  3N52 A;  1HNZ Q;  3K5M A;  1GHJ A;  3S2D H;  2EVB A;  1BDO A;  3M7G A;  3A55 A;  1IYU A;  1SE3 A;  3J80 i;  2A8V A;  3NTH A;  1Q46 A;  3NSW A;  4H0L C;  4PZ7 A;  1EY7 A;  5HY6 A;  2MUY A;  3E5S A;  1I6H B;  1CHP D;  1VQ8 A;  4CHT B;  2E2J B;  1EU4 A;  2XNA C;  1L2F A;  4EQP A;  4FVM A;  4OO1 G;  4HJ9 A;  5I9P A;  3I90 A;  1TS3 A;  3I4O A;  4C3I B;  1QWY A;  3G6J B;  3VA7 A;  1NJI C;  2I0Q A;  2O5I C;  3H94 A;  3M4O B;  4DU9 A;  1WTP A;  3BZD B;  1HNZ L;  5BN3 A;  3X3N A;  3S1Q B;  3GTJ B;  5LHY 1;  3F2B A;  3SVM A;  2NVT B;  1M4V A;  5C0X H;  2F0P A;  1EFW A;  1S5B D;  2TSS A;  2ES2 A;  3QO2 A;  4IUU A;  1FNU A;  3GTK H;  2EXD A;  3H09 A;  2M00 A;  3PUV A;  3QB3 A;  2B63 G;  4A3M G;  5FLX L;  3PMF A;  5JEA H;  1KLU D;  2E2D C;  4JK1 C;  4R4C A;  4IPD A;  4DV3 L;  1K8A C;  4C3J G;  3AFP A;  5EJW A;  2V1C C;  4B9X A;  5GAD C;  2F0V A;  5EKL A;  2MHV A;  3IL8 A;  3C2P A;  2F4V L;  4BBS B;  2F0T A;  4NXM L;  2Q2T A;  2UXB Q;  2L0C A;  4Y7N B;  2Q8I B;  2ZXP A;  5KYI A;  1HZ9 A;  4DR2 Q;  1N33 Q;  3JAM c;  2CCZ A;  1EY0 A;  3TSS A;  2PI2 E;  3CCL A;  3P20 A;  1TWG H;  3ND8 A;  1EY9 A;  4YCW A;  1Y14 B;  4DNR B;  2M9V A;  4IO9 A;  3MHB A;  4K14 A;  5C3E H;  5AJ3 Q;  1AFP A;  3GTM B;  1QCB D;  3K6O A;  4V19 0;  4A3G G;  1YNX A;  2EY1 A;  4O42 A;  3R93 A;  1Z6H A;  1B44 D;  1LM0 A;  2EYH A;  3RZO B;  2E2I B;  3PF4 A;  3WDN A;  5BN5 A;  1LAB A;  1MJC A;  2JE6 I;  4AYB G;  2UXC Q;  3A0J A;  4JBJ A;  2F4I A;  2L5T A;  5FO8 B;  1CUK A;  2O5J C;  1E2Z A;  2UXB L;  5G3L F;  1BBW A;  3KYH C;  5CC4 A;  4A3F G;  1DXM A;  2WV6 D;  4DR2 L;  3UDX A;  3K0Y A;  3J81 E;  1SJE D;  2V4D A;  5IGG A;  3K58 A;  1K83 H;  1UE6 A;  1TKW B;  2K14 A;  1WD0 A;  1GXD C;  1I6V C;  3KF6 B;  1GUT A;  4GOP A;  1NCV A;  5AJ3 L;  1G29 1;  2A74 C;  2A69 D;  1HA5 A;  4XQQ A;  4HJ5 A;  3M9B A;  3QWN A;  2NN6 I;  4IFD H;  1NAP A;  3A7L A;  1VF5 C;  4A93 H;  2QKI C;  1FNV A;  2PZU A;  1WVL A;  3S14 H;  4FF3 A;  3DWA A;  2QW7 A;  3FKI G;  2E2H H;  2IHE A;  4C3H G;  3Q0A A;  4F7X A;  2NVY B;  5E1F A;  3CAM A;  2UXC L;  4IOA A;  4JI7 Q;  2F3I A;  1QB5 D;  2EZV A;  4ZUJ A;  1B9N A;  1P8L A;  1JCK B;  2HQE A;  4LUZ A;  2Z0S A;  1QOH A;  1AZQ A;  1QJO A;  3K5O A;  3VR6 A;  3HOX G;  1DOK A;  4AQY Q;  1SFO H;  1LYL A;  1BOS A;  1MJE A;  2UUC Q;  3G6E A;  1GUW A;  3OMC A;  4DR4 Q;  3A54 A;  1YNN C;  4ILW A;  4H02 A;  4A3B G;  1QNU A;  2AQ1 B;  5IP9 H;  4DPG A;  1SEB D;  3HOU G;  1TWF B;  3PQI A;  3ERQ A;  5DNF A;  4ODG A;  3SK4 A;  1IBM Q;  3IRB A;  3KLW A;  4JI7 L;  3OOC A;  1AW7 A;  3FPP A;  3HOZ B;  2E74 C;  4C3J B;  2R93 G;  5C0X I;  1EFI D;  1BCP B;  1X9N A;  1H9M A;  3B6Y A;  1YNN D;  1DD2 A;  1KAA A;  3A8I E;  4C2M H;  2JA8 G;  4DF7 A;  3TP5 A;  3EJI A;  2Q8T A;  2RSO A;  1CKN A;  2K5H A;  2ZTD A;  1BCP C;  3CKI B;  1K73 C;  1V1P B;  2UUC L;  2Q2U A;  1G2T A;  1HUM A;  1KTK A;  2A6E C;  2EJG C;  4DR4 L;  1Q8K A;  3VR5 A;  4C3I H;  2JK8 A;  4BBR G;  1STG A;  5IYC G;  1KAW A;  3D31 A;  5FLM G;  1D8L A;  5EPK A;  4X3U A;  1SRO A;  3M4O H;  3W1G A;  1IBM L;  3S1N B;  1VQ9 A;  1LTL A;  2Q2H A;  1JT8 A;  2B2U C;  3C3L A;  2NUC A;  3GTJ H;  3VYR A;  3HOY G;  1BCP D;  1ZXT A;  3DEP A;  3KLS A;  3NE5 B;  2GN5 A;  2K7V A;  2NVT H;  2Z1C A;  2E75 C;  3KBX A;  1S5C D;  4A3J H;  1D5X C;  4YIJ A;  1CK1 A;  4A76 A;  1KLG D;  2YYZ A;  3W2D A;  3CQZ B;  2QDL A;  1S40 A;  2FJ2 A;  3AFQ A;  5C3W A;  4RWS C;  4B3S Q;  3NPP A;  4WOR A;  1LT3 D;  4A3L H;  2EYJ A;  4QY7 A;  3STB C;  1D7Q A;  4RGN A;  5C4X B;  1NMF A;  1A15 A;  2WB1 E;  4M8A A;  3T13 A;  1XYI A;  4X6A H;  1RL2 A;  2G5D A;  2F0F A;  1B70 B;  2PW5 A;  5CGK A;  4L5T A;  4NXN Q;  3TS0 A;  5K36 H;  1MI2 A;  1VQF A;  5ELO A;  5JVG 3;  4Y7N H;  1N8R C;  3QG1 A;  3FKI B;  1TVX A;  4C3H B;  1MD2 D;  2BDN A;  3ULJ A;  3M4Y A;  5BR8 Q;  1QVC A;  3RR5 A;  3ND9 A;  3J7Z C;  5IP7 G;  1EIF A;  1K9M C;  1YNJ D;  1Y1V H;  5E3F A;  4AIM A;  3T1H Q;  4NB3 A;  3TME A;  4TKO B;  1LUZ A;  1ZEQ X;  4CJ2 C;  1EY5 A;  4MIU A;  3I72 A;  5D14 A;  2KEE A;  5JVH 3;  3HOX B;  4Y52 H;  3TP8 A;  3RLO A;  1I4H A;  5M3F B;  1MSH A;  2K05 A;  4R8N A;  2E2I H;  1V9P A;  2DNE A;  5KIX A;  1QNK A;  1HTP A;  2PMZ E;  4NXN L;  3T4A C;  1RHP A;  3S2H B;  2E8G A;  3QOJ A;  4XTC S;  1VQO A;  2NTT A;  2CQO A;  2A19 A;  4HMJ A;  1J6Q A;  2GA4 B;  3FDT A;  3HOU B;  4QUC A;  2SNS A;  4YHH L;  4B08 A;  4R9W A;  5BR8 L;  4LF7 Q;  2IPK D;  4JV5 Q;  3H0G G;  2WAC A;  1WFQ A;  1F77 A;  1H9J A;  5KGU A;  1C7Y A;  3T1H L;  2XN9 C;  3BYT B;  4ULL A;  3AB9 A;  2JA8 B;  3NTI A;  4C1N K;  4POF A;  1LT5 D;  3CCQ A;  2N88 A;  5C4J H;  1XTC D;  2QEX A;  4YWM A;  3MEF A;  3GTP H;  3TP7 A;  2RF4 A;  2AKW B;  1WJJ A;  3GTO B;  1YBY A;  3S16 B;  4X64 Q;  1TT2 A;  2NVY H;  1JOR A;  1NNX A;  1SNM A;  3EVQ A;  1N36 Q;  2NZH A;  1IHZ A;  1BVS A;  1JQY D;  5J1Z A;  1ET6 A;  2LXJ A;  3NHH A;  4IUT A;  5DEH A;  1I4P A;  2UU9 Q;  4B3M L;  1TY0 A;  3EN2 A;  1WTW A;  4LF7 L;  3LNN A;  3O13 A;  1GUN A;  4JV5 L;  4GZY C;  2XWB B;  1YIT A;  2WAQ E;  4A75 A;  2K4K A;  1HFG A;  3URY A;  1QZH A;  1PYW D;  2IL8 A;  4KY5 A;  4RMF A;  1PFM A;  1F9Q A;  1YJN A;  3E9H A;  1DON A;  1A3V A;  1CSP A;  4JI1 Q;  1MBY A;  3HP3 A;  2OCE A;  2RVL A;  1YI2 A;  3I4N G;  4EGV A;  4X64 L;  2JA5 H;  1CA5 A;  5T1G A;  5EKK A;  1N36 L;  3GTL B;  2K75 A;  3HOZ H;  1PMR A;  1ICW A;  2RQX A;  1ENC A;  2D62 A;  1G6Z A;  2UU9 L;  1X3P A;  2JN4 A;  4DR6 Q;  1XJV A;  4EX5 A;  2RA4 A;  2K33 A;  3R2I A;  1K0S A;  1VQD A;  3SK8 A;  3CRK C;  3I4M G;  4LWC A;  3M4Q A;  3OMG A;  1SNC A;  4G7Z C;  3CU7 A;  4DR5 Q;  2DY7 A;  3ERO A;  2RDH A;  1V1P A;  2N49 A;  3TRZ A;  4KY6 A;  5FK9 C;  4HN7 A;  4A3K G;  3PV0 A;  1BO0 A;  3K80 C;  4JI1 L;  1FD7 D;  2B2U A;  5LL6 S;  1U9R A;  2ZTC A;  1N34 Q;  4RCO A;  4RGM A;  3CF5 A;  2KEC A;  1PFN A;  4J6H A;  3CCV A;  4DR3 Q;  3S1N H;  4LFA Q;  3J81 j;  2WKD A;  1PLF A;  4DFA A;  1GD7 A;  3L7Z C;  4N8X 1;  2J4X A;  2Z8L A;  1CZW A;  3PSI A;  4P2C B;  3K5L A;  3QR8 A;  3A5U A;  4PMC A;  1KRS A;  1B7Y B;  3BG3 A;  1X3G A;  1Y1W H;  1BKB A;  3UI2 A;  1L1O C;  1STN A;  2RHQ B;  1JWS D;  4BY7 G;  2VQE Q;  5NUC A;  2F03 A;  5M5Y B;  3CQZ H;  4K5W A;  1VQK A;  4TRD A;  2HDM A;  5IT9 E;  2IWH A;  4K8J A;  4DR5 L;  1CKO A;  4NW2 A;  5IGC A;  5C4X H;  4LK1 C;  2E5L Q;  1TWH B;  5IYD G;  2N3S A;  5G3L D;  4PQX A;  1CHQ D;  3DUZ A;  1LLR D;  3LX0 A;  1OO9 B;  4F88 A;  1N34 L;  2ZXR A;  2YU9 B;  4DR3 L;  4OEL B;  1H9S B;  4LFA L;  4CDC C;  3RUZ A;  1ZKO A;  4A3D G;  2JA6 B;  2KA7 A;  1UAP A;  5C5M A;  4WFN 3;  3I3C A;  5IGF A;  2VQE L;  4WRD A;  4C56 C;  1F9R A;  2DNC A;  1A3T A;  1X55 A;  2F0E A;  1H9K A;  1SE4 A;  5JAV A;  1PYB A;  3PIP 3;  2E5L L;  1SNP A;  3JAM L;  4OO1 I;  3NQI A;  1VCI A;  1VQP A;  1EEI D;  1GUG A;  3ZYY X;  3P75 A;  4NP5 A;  1CTM A;  1ICF B;  3SGI A;  4BXX G;  2EJM A;  1EQR A;  4LW1 A;  4XXE A;  2K50 A;  1E22 A;  5GAH C;  1IXR A;  3I4N B;  1DM0 B;  3NUC A;  3QIA A;  3OHX C;  5E7N A;  3OIP A;  1C9O A;  2F0J A;  3BDO A;  1G6P A;  1L0X B;  4WJ4 A;  3T56 B;  5L37 A;  2EE1 A;  4K0K Q;  1WTR A;  5GAG C;  1IYV A;  2RCF A;  2QEJ C;  5JJI A;  1PH8 A;  2R7Z B;  1S5E D;  4F8M A;  3L0O A;  4V0B A;  1B53 A;  1TII D;  4A3C G;  1JE5 A;  5FKA C;  2KJX A;  4A3K B;  1EU3 A;  4I7Z C;  2B2T C;  2B39 A;  1VF7 A;  4HCE A;  4JI2 Q;  3DM3 A;  3SE0 A;  2VUM H;  3TDQ A;  2B2W C;  4A3E G;  4G4K A;  3PUZ A;  1X32 A;  1JB3 A;  2EJF C;  4BY1 G;  4HJ8 A;  4UAI A;  3PF5 A;  1CSQ A;  4N9T A;  3U4V A;  3J81 i;  3EA6 A;  3P1H A;  2EYP A;  1PH3 A;  1M90 C;  3GTG B;  4K0K L;  1PTO F;  4B9W A;  1EEF D;  1PZI D;  4BY7 B;  2NYZ D;  2EYM A;  3DLL A;  3J7A 5;  2H5X A;  1Q7Y C;  1Y1V G;  3I4L A;  4ZYS A;  5C6A A;  2DN8 A;  4XYQ A;  2D9U A;  4ZAI A;  2NN6 H;  2DJG C;  4L5Q A;  3W5O A;  2EY2 A;  1E1T A;  1LV9 A;  4JI2 L;  4DK1 A;  1FJG Q;  4DV7 Q;  4LF6 L;  4A4I A;  2HIV A;  2ZM6 Q;  3CXC A;  1CKN B;  4HSP A;  1CFM A;  2WB1 G;  4H44 C;  2HHH L;  1NR4 A;  4IUR A;  5M3M B;  1WCM B;  3QOL A;  2KED A;  3NBH B;  2B8F A;  3MFG A;  3PO2 B;  1SMY C;  1ENA A;  3HKZ B;  5FJ8 H;  3V96 A;  2L4N A;  3MXP A;  3F8T A;  2DGY A;  4XQN A;  5FO9 B;  1CA6 A;  1AE2 A;  3ZJY C;  5K5P A;  1L1O A;  1KHI A;  4B3T Q;  1Q82 C;  3HOW B;  2WFW A;  1K8M A;  1TS4 A;  1SSO A;  3C46 A;  3RLF A;  1FJG L;  1SAP A;  4DV7 L;  3A8K E;  3PO3 H;  2ZM6 L;  4S3S A;  4JI3 Q;  5C3X A;  1Y69 U;  1VQA A;  1U5K A;  5ELN A;  1TWC H;  2VZA A;  3OWF A;  4HAE A;  4DV1 Q;  5M5X B;  1Z9F A;  4LUO A;  4K5V A;  3Q6S A;  1OXV A;  1ESF A;  1Q1E A;  2C5C A;  4RCN A;  4DNT B;  3H15 A;  1HFN A;  1EWI A;  2F0H A;  3KJO A;  1EYD A;  4R4I A;  4JI5 Q;  2UUB Q;  2AUJ D;  3A7A B;  2I5H A;  2ZT9 C;  3DWQ A;  4B3T L;  2JEA I;  4IUV A;  1KQS A;  3K7A B;  3IAY A;  1H9S A;  1I3Q H;  4IPC A;  1JE4 A;  2QA4 A;  2I5L X;  1A8V A;  1YIJ A;  2JA5 G;  1U4R A;  2K5W A;  3NEL A;  2K01 A;  4L8J A;  3MXN A;  1JC7 A;  4KJN A;  4DV1 L;  2B3G A;  4RHS A;  1VQC A;  2L1B A;  2XRQ D;  3GDE A;  3EIV A;  5IOC A;  1F9P A;  4QIW E;  3F2U A;  4BA2 I;  4DAM A;  4UP9 A;  1X54 A;  3S9W A;  1FR3 A;  5C5L A;  1XMQ Q;  4OIK A;  4JI5 L;  1WTV A;  2UUB L;  5CMD A;  3Q23 A;  5FLX E;  3RZD B;  1I4R A;  1N32 Q;  1SNO A;  2LKV A;  2VXW A;  1NTG A;  4GLA C;  3JC6 6;  4MHE A;  1DGS A;  1N33 L;  3I70 A;  4XIG S;  2Z6K C;  2SEB D;  2R3Z A;  1UNS A;  3TQY A;  3J80 L;  1HZB A;  3BVG A;  4B3R Q;  1KD1 C;  3AEV A;  4YWK A;  1PH7 A;  2F0K A;  4CDE C;  2PW7 A;  2R7Z H;  1X65 A;  2XWJ B;  2B2T A;  1UWV A;  5M5W B;  1XMQ L;  1X3F A;  3IFT A;  5HGQ A;  1A6X A;  1HZC A;  2B2W A;  4X3S A;  4N8F A;  1T9H A;  1N32 L;  1EWC A;  1F2Y A;  4R4O A;  4K2L A;  1D1I A;  2BH8 A;  4FO2 A;  2KCC A;  1UE1 A;  3VR3 A;  1BXT A;  4LF8 Q;  1VQG A;  2B8G A;  2OWO A;  4TQU S;  3ITP A;  4A3I G;  1PDQ A;  1I50 B;  3SEB A;  3ULP A;  2B2Y C;  3FP9 A;  2ASB A;  4OGQ C;  2KCM A;  3FRP B;  3I55 A;  3I7F A;  3S15 H;  4B3R L;  1NR2 A;  2K5D A;  1SYC A;  5IWA Q;  2MJ8 A;  4KKU A;  2SDF A;  1O80 A;  3G71 A;  1JOK A;  1MKH A;  4OHJ A;  3FPU B;  2NZO A;  2MP1 A;  4LJZ C;  2EY6 A;  2LS0 1;  5D3I B;  1K8O A;  2B63 B;  4P72 A;  4A3M B;  3KJP A;  2PPB C;  2KEN A;  4HIK A;  4QQB X;  5CV7 A;  4QJF A;  4K8I A;  2F0I A;  2RBM A;  2XGT A;  2SOB A;  4LF8 L;  1PRT B;  4UPA A;  5DLQ E;  3VR4 A;  1S72 A;  1YHB A;  2YTY A;  5M3M H;  1WCM H;  1LTI D;  3E6Z X;  3D4R A;  5ELE A;  1AZP A;  3PO2 H;  1I6H H;  2MQH A;  1HJP A;  4ALP A;  4AQY L;  2E2J H;  2O2L D;  3NBH A;  5IYB H;  1E3P A;  5IWA L;  2JJQ A;  3OIQ A;  1HUN A;  1EL0 A;  2F0O A;  3UE0 A;  1PRT C;  2AWO A;  2JXM B;  3PCO B;  4PNY A;  2CWA A;  4JI0 Q;  2RCN A;  4OXP A;  2OQ0 A;  4LF4 Q;  5FOB B;  3HOW H;  1S3O A;  2ICI A;  4A3G B;  1OXU A;  3K81 C;  3WWV A;  2F1M A;  4IJL A;  3S1Q H;  3KBG A;  1ET9 A;  1QG7 A;  4RAU C;  3FMC A;  2CVR A;  2A6E D;  3TZU A;  4AYB B;  1PHJ A;  1Q12 A;  1HXY D;  4JBK A;  2JA7 G;  3HG9 A;  5M5X H;  1HR0 Q;  4A3F B;  1FNW A;  4IPH A;  1KDB A;  3SXH A;  3AYH B;  4KHV A;  1UUP A;  3BJU A;  3MFY A;  1PVO A;  3HOV G;  2OT2 A;  2AQ3 B;  3D4W A;  2D2C C;  1VQ5 A;  2R61 A;  2AMC B;  1TWA B;  4GNX C;  3OWE B;  1NE3 A;  2ZTE A;  3R3O A;  4JI0 L;  1X3Q A;  4GN5 A;  4LF4 L;  2Z4I A;  4ZKB B;  4L5S A;  2EYF A;  2PCF B;  4BBS H;  2R92 G;  4IN3 A;  2PQA A;  4MN3 A;  3M85 A;  3DHQ A;  4M1U B;  4HED A;  3TRE A;  1PTO B;  1ENF A;  4XDX A;  3F1Z A;  4OX9 Q;  3STB D;  5C44 G;  3J81 c;  1O7I A;  1FVI A;  3MVV A;  3T53 B;  3D3R A;  1YZ6 A;  1DZ1 A;  4I7A A;  1U4L A;  1UE5 A;  2Y0S G;  1HR0 L;  4JW0 A;  1EOT A;  1DYQ A;  3UDI A;  2XRS D;  4J15 A;  4DXG A;  1PTO C;  4ZRZ A;  4B3S L;  1D6E C;  3RN5 A;  2HDL A;  3R8B A;  4BS9 A;  1E2V A;  3ER0 A;  1ONL A;  3GTM H;  5ELC A;  1E1O A;  1B3A A;  5FO7 B;  2RHS B;  1SN8 A;  2RDG A;  3U50 C;  1VS0 A;  3BZK A;  3RZO H;  2BH2 A;  3H91 A;  1JIC A;  3RZD H;  1PH2 A;  2WP8 J;  2Z6K A;  4A3B B;  1UEB A;  1KDA A;  3J80 c;  1S5D D;  4IJH A;  5IE8 A;  1XTD A;  3P7J A;  4LF5 Q;  2FHT A;  4OX9 L;  2IX1 A;  3H3V C;  2R7D A;  1PFS A;  4MZ9 A;  1KNA A;  2C9O A;  2R93 B;  5GQO A;  2P5Z X;  2MO1 A;  1FGU A;  1A0I A;  1MSG A;  1HR0 W;  3A8J E;  1LTT D;  1EUJ A;  3WOF A;  1BBX C;  5KNB A;  3BDC A;  5C0X G;  2HCC A;  5LMU Q;  2SNM A;  2FXQ A;  2BDO A;  1JR0 D;  1HPC A;  4TSS A;  2K5V A;  4MNO A;  4OO1 H;  1DOL A;  2O4X A;  3OYY A;  1STA A;  5JEA G;  2H1E A;  4BBR B;  4X65 Q;  1VQN A;  2B2Y A;  5E4W C;  1R9T B;  5CV8 A;  4LF5 L;  2BA1 A;  3MA2 B;  4JI4 Q;  3K0X A;  3TZD A;  2FIN B;  2GVB A;  2D0P A;  1XNQ Q;  5IY0 A;  1IW7 C;  1I50 H;  4HJ7 A;  3G48 A;  3DXJ C;  3HOY B;  2VW9 A;  1D1K A;  2MNA A;  3K7U C;  3D0F A;  5EAY A;  1PH4 A;  2NZ1 D;  4KLK A;  2JA7 B;  2F0Q A;  1EOV A;  1HTL D;  1TU2 B;  3M3Y B;  2RDF A;  2AUK A;  1TWF H;  2GVA A;  1M1K C;  5LMU L;  3C1F A;  1D5Z C;  2B63 H;  4A3M H;  2EQS A;  5C3E G;  4RKL A;  3DM1 A;  2HD3 A;  1E7Z A;  2ZXO A;  4OL7 A;  4C3J H;  1PV4 A;  4J8Q A;  4K6D A;  4X65 L;  5DAU A;  3Q22 A;  1UE7 A;  4JI4 L;  4X3T A;  4DAY B;  4XT3 B;  1KDC A;  2PO4 A;  2DUD A;  3CC2 A;  1CT1 D;  1VQE A;  1WI5 A;  3I2Z A;  1QVG A;  2WIN B;  5CV6 A;  2NVX B;  2D5D A;  5A35 A;  3CCR A;  3N6R A;  1Y8O B;  2E76 C;  2KHI A;  1W3S A;  2PNR C;  2Y0S B;  2KOL A;  4LF9 Q;  1SND A;  4YCU A;  1MGS A;  5D3D A;  4XT1 B;  2ID0 A;  1L1O B;  4YCV A;  1B8A A;  4A3G H;  4G7H C;  4JI6 Q;  2EOT A;  4P71 A;  1KC8 C;  4IFD G;  2QDB A;  4A93 G;  4POG A;  1GOZ A;  1S4Z A;  4FP5 D;  4OWW B;  4DR6 L;  3KK7 A;  1U0L A;  1SE2 A;  2JP1 A;  1TS2 A;  2ENB A;  3PIO A;  4A3F H;  3GV3 A;  4IPG A;  3L3O C;  1SBB B;  2H4O A;  4DAP A;  4JYA Q;  5CR3 A;  4GNX A;  1SMX A;  4P73 A;  3NWS A;  2OF1 A;  2QGQ A;  4KJO A;  4KHP Q;  1EYC A;  2CH4 W;  4LF9 L;  1NBW A;  3H0G B;  4ME3 A;  3G4S A;  4H13 C;  3W3A A;  1ILQ A;  5EQ0 A;  1BUV T;  2F0N A;  3I91 A;  5IIF A;  2XIW A;  1F2Z A;  1Q3L A;  1LTR D;  4JI6 L;  3J7A F;  2XSC A;  2DJF C;  3FKI H;  3MWY W;  4C3H H;  1JWM D;  2UUA Q;  1RDP D;  5IP9 G;  2F0L A;  3MXN B;  3K59 A;  1WD1 A;  3BVZ A;  1B2T A;  3NEN A;  5JOB A;  4JYA L;  1FYC A;  1X3E A;  3NQT A;  1EZ6 A;  5I6W A;  3NXW A;  4ZQ3 A;  1SYG A;  4KHP L;  3HOX H;  5HUR A;  4UY8 C;  5M3F H;  1N9W A;  2VNU D;  1PRT F;  2Z9H A;  1GUO A;  1TS5 A;  2NB0 A;  4DAV A;  4PMW A;  1HRJ A;  3S2H H;  4A3B H;  1ML0 D;  1TWG B;  4KI0 A;  3GQB A;  2CH4 A;  2VQF Q;  3HOU H;  1CQV A;  1O7Y A;  2UUA L;  5A2Q L;  4FXG C;  4C3I G;  1Q86 C;  1VQB A;  2NBF A;  2B2V C;  5J3B A;  5C3E B;  3KOJ A;  3L9A X;  2I5M X;  1R4Q B;  1SYD A;  2R93 H;  3RD4 A;  1PYS B;  3CW2 C;  3I56 A;  2JA8 H;  4EQO A;  3RLN A;  3G7L A;  3I4M B;  2QF7 A;  5H1S E;  2VL6 A;  4A3J G;  3S16 H;  3GTO H;  4JBM A;  5CBE E;  4R1J A;  5KEE A;  5C0X J;  3AU7 A;  4K5X A;  4A3L G;  1A2U A;  1QIL A;  2ICE C;  3JAM E;  2JA9 A;  1ESR A;  4OIJ A;  5IYC H;  3Q8D A;  2VQF L;  1PH6 A;  5FLM H;  1PZJ D;  1TXY A;  2A6H C;  4DV6 Q;  2R7F A;  4QUF A;  2RKS A;  4UHV A;  3TS2 A;  4XYO A;  5JEA J;  5ISR A;  1EWH A;  3DMU A;  3GD7 A;  3V2T A;  4DK6 C;  4BBS G;  4OWX B;  3W1B A;  4KHZ A;  3HOY H;  4GKK Q;  1SYB A;  5K36 G;  4A93 B;  3BVM A;  2MGS A;  1PH5 A;  2A68 C;  1PH9 A;  2E2H B;  3S17 B;  2LMC B;  1RKN A;  2LY7 A;  3HZX A;  1G91 A;  4QGU A;  2YV5 A;  3SK6 A;  2VY3 A;  2BE5 C;  3E9I A;  3X3M A;  1PA6 A;  2A6H D;  4NMZ A;  3KFU A;  1PFB A;  1HNW Q;  4K2K A;  2OQK A;  1EQV A;  1E24 A;  1SYE A;  4CJ0 B;  3GTL H;  3VA5 A;  4RGO S;  2WII B;  2L11 A;  1W2B A;  5LMN Q;  4FXK C;  3T16 A;  2A68 D;  1LAC A;  4DV6 L;  2A73 B;  4F87 A;  1WYD A;  3C1E A;  3IFD A;  4A3D B;  3VYT A;  4HCS A;  2BE5 D;  4DAY A;  1NMG A;  5DM6 3;  1XPO A;  5LL6 X;  4J1M A;  1YHQ A;  4GKK L;  1CQF A;  2F0S A;  4CJ1 B;  1G2S A;  3NWT A;  5IP7 H;  1KNE A;  1I4G A;  1A63 A;  1XMO Q;  1LT6 D;  1SDF A;  1D5M C;  3VYS A;  1GJX A;  3WOE A;  4H7B A;  4MTN A;  1B50 A;  2K5N A;  4HJA A;  4LNQ A;  1HNW L;  2L12 A;  4DKA C;  4E6I A;  4FF4 A;  4IZ8 A;  1IKM A;  4YY3 Q;  4C2M B;  1WTX A;  5LMN L;  1RF2 D;  2F3W A;  2KUM A;  3TEH B;  2CHB D;  1SMY D;  4EQN A;  1PH1 A;  5D65 A;  3CPF A;  4IFD J;  1Z47 A;  4KN4 C;  5M5Y H;  1YEZ A;  3M7N A;  4R4Q A;  2VS1 A;  4ME5 A;  5JJL A;  1O7L A;  4DV3 Q;  1V1O A;  3LWE A;  4QCL A;  1RCV D;  3TP6 A;  3H3V I;  2NVQ B;  1AE3 A;  1TWH H;  5GAE C;  1KAB A;  3VDY A;  2F4V Q;  3ERS X;  3H0G H;  1XMO L;  2A1A A;  4NXM Q;  3SK5 A;  1C4Q A;  4P74 A;  1RIP A;  1WTQ A;  3LWU A;  2YU9 H;  5HGT A;  4QMG A;  2R6G A;  2PQA B;  3MEH A;  4YY3 L;  1BF4 A;  2JA6 H;  4A3J B;  1HQR D;  3KDF B;  3T1Y Q;  4I65 A;  2BCO A;  4DV0 Q;  3KLS X;  3QJY A;  4TVA B;  3PUX A;  3ONA B;  3D6C A;  5LMN W;  4JI3 L;  1ROD A;  2AQ2 B;  1B4O A;  4FDB A;  1LT4 D;  4EVO A;  3HOZ G;  1XXG A;  2CKZ B;  3HEJ A;  2F0W A;  1HHV A;  4A3E B;  2TMP A;  1Q8I A;  1XPU A;  1K8G A;  2IT1 A;  4JVZ A;  4XQJ A;  2IJ0 A;  4BY1 B;  1JWU D;  3J81 L;  3MXU A;  4IUP A;  1EY8 A;  3U9O A;  3S1M B;  4CGY B;  1DCZ A;  4PZ8 A;  3UE1 A;  1W6K A;  2B2V A;  2CQA A;  5KND A;  1OXT A;  3OW7 A;  2IX3 A;  1STY A;  2K32 A;  1Y1V B;  1DJR D;  4QF4 A;  3T1Y L;  3I4N H;  2WAQ G;  1V1Q A;  4O0A A;  4DV0 L;  4DK0 A;  4BA1 I;  4RGT A;  4U68 A;  1YHA A;  1Z7T A;  2X69 A;  3FHW A;  4KTA A;  5COR A;  4DXF A;  1YJ9 A;  1X56 A;  2EY5 A;  1PZK D;  3A74 A;  3VYU A;  2F0U A;  3ICE A;  4LUV A;  3D6W A;  3GV6 A;  1Y1W G;  4OWT B;  1QZG A;  1HH2 P;  3I4M H;  2A69 C;  4DN4 M;  2WB1 B;  3I73 A;  1HQM C;  4IUN A;  4L63 B;  3MZ5 A;  4U67 3;  2K52 A;  3CME A;  3MXG A;  3Q24 A;  3TN2 A;  1B1Z A;  1I4X A;  4IUQ A;  4ZUI A;  4A3K H;  1WTH A;  3PIP A;  2X6L A;  5C4X G;  4JPB W;  4JBW A;  2NWG A;  1OXX K;  4QL5 A;  1VQ7 A;  2PZW A;  1ILP A;  2LFN A;  4HIO A;  2UXD Q;  3HKZ E;  2PI2 A;  5C4J B;  1SXT A;  3GTP B;  3GTG H;  3CHB D;  3S17 H;  4BY7 H;  3E0J A;  3CMA A;  2Q2I A;  4C1N I;  3BS1 A;  3D8G A;  1TQO A;  1QE6 A;  3J80 E;  2DY8 A;  3KF8 A;  3HFZ B;  5EBC A;  4CKC A;  4IQZ A;  1IBK Q;  3NEM A;  5IYD H;  4NKL A;  2K04 A;  2PMZ B;  2K1B A;  4KV6 A;  4ZK9 B;  2N55 A;  3F2D A;  1R4P B;  1GKH A;  2KCT A;  1VMP A;  5M3F G;  2PNH A;  4A3D H;  5JJZ A;  2AWN A;  1AEX A;  2IW3 A;  1SNQ A;  2VB2 X;  4L6T B;  2L9H A;  2UXD L;  2G9D A;  2OTL A;  2HT1 A;  4X62 Q;  2KQ3 A;  1Y8P B;  5EGT A;  1JOO A;  3A5Z B;  2JA5 B;  2WKC A;  4NDX A;  1A3U A;  3PIO 3;  2Z6B A;  1O78 A;  5IOD A;  1VQ4 A;  5I2X A;  3PUY A;  1F2M A;  1IBK L;  1T5X D;  3PGZ A;  3EFX D;  2Z4H A;  4UP7 A;  5IGD A;  4DR1 Q;  2JYO A;  4JG2 A;  5CV9 A;  1EQQ A;  2PQE A;  4BXX H;  1K28 A;  2F0M A;  4CDD C;  2K5Q A;  3KLR A;  5CYU A;  1PRT D;  3CCS A;  4X62 L;  2WAQ B;  4N9P A;  4BWG B;  4GNX B;  3HGB A;  3BZC A;  1H9R A;  2NVQ H;  4HID A;  1VQL A;  1AP0 A;  2VUM G;  1ASZ A;  1AH9 A;  4PG3 A;  1G8Z D;  2D0O A;  4X66 Q;  3ULL A;  3CC7 A;  1UEA B;  2KVM A;  1GO3 E;  2IY5 B;  4RA8 A;  1Y1W B;  5FLX c;  1A2T A;  5IGE A;  1EYA A;  3K7A H;  3FEW X;  3E0E A;  2J0T D;  2J7Z A;  5GRO A;  3S1R B;  1EZ8 A;  2KHS A;  4FF2 A;  1AN8 A;  1C48 A;  1SJH D;  4DR1 L;  1EIG A;  4A3C H;  1VMC A;  3RN2 A;  3KDF A;  5CV4 A;  3K5N A;  1YJW A;  1FL0 A;  1Y8N B;  4GLX A;  2ALY B;  1QVF A;  5CBA E;  1EYG A;  1I5F A;  4CBV A;  1SRU A;  2NN6 G;  2QCP X;  1YNJ C;  5KNC A;  4A3E H;  3I8Z A;  4UP8 A;  1HZA A;  4AH6 A;  4GS3 A;  4ZLT F;  4BY1 H;  1Q90 A;  4GLV B;  4A3I B;  4JOI C;  4X66 L;  3HS0 C;  1KXL A;  3S1M H;  3NK9 A;  3GP7 A;  4YHH Q;  5J39 A;  3OW2 A;  4RHR A;  2L15 A;  3BDL A;  1BNZ A;  1XWE A;  1E2W A;  4DUY Q;  5C4H A;  4LFC Q;  2HQL A;  1WOC A;  5FJ8 G;  4IFD I;  1HA6 A;  3SR1 A;  1PTO D;  1CI3 M;  3IKJ A;  4HMI A;  3HRZ C;  2I07 B;  2LSS A;  5E4X A;  3OTO Q;  4KMU C;  3LGJ A;  4R4T A;  3DWP A;  2VB3 X;  4HSV A;  5M9O A;  2HUG A;  5T1I A;  2RSN A;  4PV1 C;  3D4D A;  2ZJP A;  3PO3 G;  4EQ5 A;  4K6L A;  2MPM A;  2PYK A;  4MTK A;  5M5W H;  4DK3 C;  1CZG A;  1QUQ B;  4B3M Q;  4HTH A;  1X6O A;  1SLJ A;  2BA0 A;  2NTS A;  5J22 A;  4DUY L;  2A5H A;  1STE A;  4LFC L;  4DGZ A;  2HCI A;  1BQQ T;  5F2D A;  4LMQ D;  1XX8 A;  2KCN A;  3DEO A;  3KF6 A;  4NPS A;  4RFB A;  3OTO L;  1EY6 A;  4JCV E;  4WJW A;  1JJ2 A;  1H95 A;  2JA6 G;  2HIX A;  2MO0 A;  2BOS A;  2M2L A;  5JPM C;  3V05 A;  3KUP A;  3S24 A;  1GHK A;  1ASY A;  1RTO A;  1IYJ B;  4ZCK A;  2JSO A;  3SHL A;  3CCE A;  4GKJ Q;  2VUM B;  1NY4 A;  5EPL A;  2XVS A;  1RD9 D;  3HOV B;  1S5F D;  4AYB E;  1IW7 D;  1MHW C;  4CDF C;  1KIX A;  3RMH A;  1BBU A;  4G7O C;  4DNI A;  2ATW A;  2EIF A;  1EY4 A;  5ELD A;  1JOQ A;  3JAM i;  1J8I A;  1SE8 A;  2I46 A;  1BR9 A;  1STB A;  1B3Q A;  1II3 A;  1TR5 A;  3OPO A;  4PZ6 A;  4L5R C;  4CKB A;  2R92 B;  1VQ6 A;  3HKS A;  1XNQ L;  3T51 B;  1L0W A;  3BYY B;  1VQH A;  2ZJQ A;  2CFM A;  5C44 B;  3CRL C;  1A62 A;  3PUW A;  3CCU A;  3J7Y W;  4YWL A;  3L2P A;  3GTQ B;  3CCM A;  4OON A;  4IOC A;  3MTS A;  5IGB A;  5IT9 L;  1CKM A;  4GKJ L;  3S2D B;  4HIM A;  1STH A;  2EPB A;  4RG1 A;  4CKE A;  4DA2 A;  1J5E Q;  1RJT A;  4DV2 Q;  5CV5 A;  5EBD A;  3OSO A;  2R7Z G;  1JJC B;  5AFW A;  1JMC A;  3RNU A;  4Q0F A;  2FMC A;  4P75 A;  3R2T A;  5TSS A;  2C35 B;  4DR7 Q;  4X3K A;  5I4D A;  4GN3 B;  4ZKC B;  1VQJ A;  4FYD A;  5EPJ A;  1RTN A;  1O7Z A;  5EKI A;  3AMU A;  3F2C A;  2YTX A;  3NTK A; 
#chains in the Genus database with same CATH homology
 3U9S A;  2FMM A;  4ABN A;  3MC0 B;  1LTG D;  1EIH A;  5ELF A;  4RH6 A;  3PO3 B;  5JPN C;  2EXZ A;  4KKS A;  1PTO H;  1TWC B;  5COY A;  4FNF A;  1PXU A;  2EYO A;  1LTS D;  1NSN S;  2JEB I;  3GTK B;  3VR2 A;  4FF1 A;  1LTA D;  1HCZ A;  3EQL C;  3FVQ A;  4QB4 A;  5ELB A;  3J7A V;  1LO5 D;  1GUS A;  4FXD A;  1I3Q B;  4LAA A;  3MAQ A;  4IAL A;  1V8Q A;  4O1N A;  2EYL A;  4KD4 A;  1J9O A;  1U4M A;  2IX0 A;  4KKT A;  4PMB A;  1LTB D;  3K57 A;  1Q1B A;  1TY2 A;  4KD3 A;  1IL8 A;  1BCP F;  3SDZ A;  1FGB D;  1B9M A;  5I2Y A;  3GO5 A;  1E0B A;  4UDU C;  3NP8 A;  1ZYR C;  1F2L A;  4HR7 B;  1IKL A;  5I6Y A;  2K03 A;  2X6G A;  2G9H D;  1EQT A;  1DOM A;  1D2B A;  1K83 B;  1W6J A;  1SYF A;  1ZYR D;  4KK7 A;  4Q5V A;  2FFK B;  3TBI B;  2F0D A;  1F9S A;  5I9O A;  1VDZ A;  1NUC A;  4ID6 A;  1L0Y B;  4KY7 A;  5A2Q E;  3S14 B;  4KN7 C;  5KYL A;  2L55 A;  2Q8R E;  4QIW B;  4R8I A;  2OXP A;  1C8C A;  4RKB A;  3NBI A;  2CW0 C;  2EDG A;  1WTO A;  1I4Q A;  2K28 A;  2QIL A;  5KRU A;  3S15 B;  2OEO A;  1SFO B;  2K6A A;  1M8A A;  1V43 A;  4Z9C B;  2PZT A;  5DM7 3;  3H6M A;  2F0G A;  2CW0 D;  1OXS C;  1T5E A;  5C4Z A;  1CM9 A;  3A56 A;  4G57 A;  5BN4 A;  1U4P A;  2F3V A;  3N52 A;  3K5M A;  1GHJ A;  2EVB A;  1BDO A;  3M7G A;  3A55 A;  1IYU A;  1SE3 A;  3NTH A;  3NSW A;  4H0L C;  1EY7 A;  2MUY A;  3E5S A;  1I6H B;  1CHP D;  4CHT B;  2E2J B;  1EU4 A;  2XNA C;  4EQP A;  4FVM A;  4OO1 G;  5I9P A;  3I90 A;  1TS3 A;  4C3I B;  1QWY A;  3G6J B;  3VA7 A;  2O5I C;  3H94 A;  3M4O B;  4DU9 A;  1WTP A;  3BZD B;  5BN3 A;  3X3N A;  3S1Q B;  3GTJ B;  5LHY 1;  3SVM A;  2NVT B;  1M4V A;  5C0X H;  2F0P A;  1S5B D;  2TSS A;  3QO2 A;  4IUU A;  1FNU A;  3H09 A;  2M00 A;  3PUV A;  3QB3 A;  5FLX L;  3PMF A;  5JEA H;  1KLU D;  2E2D C;  4JK1 C;  4C3J G;  5EJW A;  4B9X A;  2F0V A;  5EKL A;  2MHV A;  3IL8 A;  3C2P A;  4BBS B;  2F0T A;  2L0C A;  4Y7N B;  2Q8I B;  2ZXP A;  5KYI A;  1EY0 A;  3TSS A;  3P20 A;  3ND8 A;  1EY9 A;  4DNR B;  2M9V A;  3MHB A;  4K14 A;  1AFP A;  3GTM B;  1QCB D;  3K6O A;  4V19 0;  2EY1 A;  4O42 A;  3R93 A;  1Z6H A;  1B44 D;  2E2I B;  2EYH A;  3RZO B;  3WDN A;  5BN5 A;  1LAB A;  2JE6 I;  2F4I A;  2L5T A;  5FO8 B;  2O5J C;  1E2Z A;  5G3L F;  5CC4 A;  1DXM A;  2WV6 D;  3K0Y A;  3J81 E;  1SJE D;  2V4D A;  5IGG A;  3K58 A;  1TKW B;  1WD0 A;  1GXD C;  1I6V C;  1GUT A;  1NCV A;  1G29 1;  2A74 C;  2A69 D;  1HA5 A;  4XQQ A;  3QWN A;  2NN6 I;  4IFD H;  1NAP A;  3A7L A;  1VF5 C;  2QKI C;  1FNV A;  2PZU A;  1WVL A;  4FF3 A;  3DWA A;  4C3H G;  3Q0A A;  4F7X A;  2NVY B;  5E1F A;  1QB5 D;  2EZV A;  4ZUJ A;  1B9N A;  1JCK B;  2HQE A;  1QOH A;  1AZQ A;  1QJO A;  3K5O A;  3VR6 A;  1DOK A;  1BOS A;  1GUW A;  3OMC A;  3A54 A;  1YNN C;  4ILW A;  1QNU A;  2AQ1 B;  1SEB D;  1TWF B;  3ERQ A;  5DNF A;  4ODG A;  3SK4 A;  3OOC A;  1AW7 A;  3FPP A;  3HOZ B;  2E74 C;  4C3J B;  5C0X I;  1EFI D;  1BCP B;  1H9M A;  1DD2 A;  1YNN D;  1KAA A;  3A8I E;  4DF7 A;  3TP5 A;  3EJI A;  2Q8T A;  2RSO A;  1BCP C;  3CKI B;  1V1P B;  1G2T A;  1HUM A;  1KTK A;  2A6E C;  2EJG C;  3VR5 A;  1STG A;  3D31 A;  5EPK A;  4X3U A;  3S1N B;  2B2U C;  3C3L A;  2NUC A;  3VYR A;  1BCP D;  1ZXT A;  3DEP A;  3KLS A;  3NE5 B;  2K7V A;  2Z1C A;  2E75 C;  3KBX A;  1S5C D;  1D5X C;  4YIJ A;  1CK1 A;  1KLG D;  2YYZ A;  3W2D A;  3CQZ B;  2FJ2 A;  5C3W A;  4RWS C;  3NPP A;  4WOR A;  1LT3 D;  2EYJ A;  4RGN A;  5C4X B;  1A15 A;  4M8A A;  3T13 A;  1XYI A;  2F0F A;  2PW5 A;  5CGK A;  5K36 H;  1MI2 A;  5JVG 3;  3QG1 A;  3FKI B;  1TVX A;  4C3H B;  1MD2 D;  2BDN A;  3M4Y A;  3ND9 A;  1YNJ D;  5E3F A;  3TME A;  4TKO B;  1ZEQ X;  4CJ2 C;  1EY5 A;  4MIU A;  3I72 A;  5D14 A;  2KEE A;  5JVH 3;  3HOX B;  3TP8 A;  1I4H A;  5M3F B;  1MSH A;  2K05 A;  4R8N A;  2DNE A;  5KIX A;  1QNK A;  1HTP A;  3T4A C;  1RHP A;  3S2H B;  3QOJ A;  4XTC S;  2NTT A;  4HMJ A;  2GA4 B;  3FDT A;  3HOU B;  4QUC A;  2SNS A;  4B08 A;  4R9W A;  2IPK D;  2WAC A;  1F77 A;  1H9J A;  5KGU A;  2XN9 C;  3BYT B;  4ULL A;  3AB9 A;  2JA8 B;  3NTI A;  4C1N K;  1LT5 D;  2N88 A;  1XTC D;  3TP7 A;  3S16 B;  3GTO B;  1TT2 A;  1JOR A;  1SNM A;  3EVQ A;  1IHZ A;  1JQY D;  5J1Z A;  1ET6 A;  3NHH A;  4IUT A;  5DEH A;  1I4P A;  1TY0 A;  1WTW A;  3LNN A;  3O13 A;  1GUN A;  4GZY C;  2XWB B;  1HFG A;  3URY A;  1PYW D;  2IL8 A;  4KY5 A;  1PFM A;  1F9Q A;  1DON A;  1A3V A;  1MBY A;  3HP3 A;  2RVL A;  4EGV A;  1CA5 A;  5T1G A;  5EKK A;  3GTL B;  1PMR A;  1ICW A;  2RQX A;  1ENC A;  2D62 A;  1G6Z A;  1X3P A;  2RA4 A;  2K33 A;  3R2I A;  3SK8 A;  3CRK C;  3OMG A;  1SNC A;  4G7Z C;  3CU7 A;  2DY7 A;  3ERO A;  2RDH A;  1V1P A;  4KY6 A;  5FK9 C;  4HN7 A;  3PV0 A;  1BO0 A;  1FD7 D;  2B2U A;  5LL6 S;  1U9R A;  4RCO A;  4RGM A;  2KEC A;  1PFN A;  4J6H A;  2WKD A;  1PLF A;  4DFA A;  3L7Z C;  2J4X A;  2Z8L A;  1CZW A;  4P2C B;  3K5L A;  4PMC A;  3BG3 A;  3UI2 A;  1STN A;  1JWS D;  5M5Y B;  5NUC A;  2F03 A;  4K5W A;  4TRD A;  2HDM A;  5IT9 E;  2IWH A;  4K8J A;  4NW2 A;  5IGC A;  4LK1 C;  1TWH B;  5G3L D;  4PQX A;  1CHQ D;  3DUZ A;  1LLR D;  3LX0 A;  1OO9 B;  4F88 A;  2ZXR A;  2YU9 B;  1H9S B;  3RUZ A;  1ZKO A;  2JA6 B;  2KA7 A;  1UAP A;  5C5M A;  4WFN 3;  3I3C A;  5IGF A;  4WRD A;  4C56 C;  1F9R A;  2DNC A;  1A3T A;  2F0E A;  1H9K A;  1SE4 A;  5JAV A;  3PIP 3;  1SNP A;  3JAM L;  4OO1 I;  3NQI A;  1VCI A;  1EEI D;  1GUG A;  3ZYY X;  3P75 A;  4NP5 A;  1CTM A;  2EJM A;  4XXE A;  3I4N B;  1DM0 B;  3NUC A;  3QIA A;  3OHX C;  3OIP A;  2F0J A;  3BDO A;  1L0X B;  3T56 B;  2EE1 A;  1WTR A;  1IYV A;  2QEJ C;  2R7Z B;  1S5E D;  4F8M A;  4V0B A;  1B53 A;  1TII D;  5FKA C;  2KJX A;  4A3K B;  1EU3 A;  4I7Z C;  2B2T C;  2B39 A;  1VF7 A;  4HCE A;  3SE0 A;  3TDQ A;  2B2W C;  4G4K A;  3PUZ A;  1X32 A;  1JB3 A;  2EJF C;  4UAI A;  4N9T A;  3EA6 A;  3P1H A;  2EYP A;  3GTG B;  1PTO F;  4B9W A;  1EEF D;  1PZI D;  4BY7 B;  2NYZ D;  2EYM A;  3I4L A;  4ZYS A;  5C6A A;  2DN8 A;  4XYQ A;  2D9U A;  4ZAI A;  2NN6 H;  2EY2 A;  1LV9 A;  4DK1 A;  4HSP A;  1CFM A;  4H44 C;  1NR4 A;  4IUR A;  5M3M B;  1WCM B;  3QOL A;  2KED A;  2B8F A;  3MFG A;  3PO2 B;  1SMY C;  1ENA A;  3HKZ B;  3V96 A;  2L4N A;  3MXP A;  4XQN A;  5FO9 B;  1CA6 A;  5K5P A;  3HOW B;  1K8M A;  1TS4 A;  1SSO A;  3C46 A;  3RLF A;  1SAP A;  3A8K E;  4S3S A;  5C3X A;  1Y69 U;  3OWF A;  4HAE A;  5M5X B;  4K5V A;  3Q6S A;  1OXV A;  1ESF A;  1Q1E A;  2C5C A;  4RCN A;  4DNT B;  1HFN A;  2F0H A;  1EYD A;  2AUJ D;  3A7A B;  2ZT9 C;  3DWQ A;  2JEA I;  4IUV A;  3K7A B;  3IAY A;  1H9S A;  1JE4 A;  1U4R A;  2K5W A;  2K01 A;  4L8J A;  3MXN A;  1JC7 A;  4KJN A;  4RHS A;  2L1B A;  2XRQ D;  5IOC A;  1F9P A;  3F2U A;  4BA2 I;  3S9W A;  1FR3 A;  5C5L A;  4OIK A;  1WTV A;  5CMD A;  3Q23 A;  5FLX E;  3RZD B;  1I4R A;  1SNO A;  2LKV A;  2VXW A;  4MHE A;  3I70 A;  4XIG S;  2SEB D;  2R3Z A;  1UNS A;  3J80 L;  3BVG A;  2F0K A;  2PW7 A;  2XWJ B;  2B2T A;  5M5W B;  3IFT A;  1A6X A;  2B2W A;  4X3S A;  1EWC A;  1F2Y A;  4K2L A;  1D1I A;  4FO2 A;  2KCC A;  3VR3 A;  1BXT A;  2B8G A;  4TQU S;  3ITP A;  1PDQ A;  1I50 B;  3SEB A;  2B2Y C;  4OGQ C;  3FRP B;  1NR2 A;  2K5D A;  1SYC A;  2MJ8 A;  4KKU A;  2SDF A;  1O80 A;  1JOK A;  4OHJ A;  3FPU B;  2MP1 A;  4LJZ C;  2EY6 A;  2LS0 1;  5D3I B;  1K8O A;  2B63 B;  4A3M B;  2PPB C;  5CV7 A;  4K8I A;  2F0I A;  2RBM A;  2SOB A;  1PRT B;  3VR4 A;  1LTI D;  3E6Z X;  3D4R A;  5ELE A;  1AZP A;  2O2L D;  3NBH A;  3OIQ A;  1HUN A;  1EL0 A;  2F0O A;  1PRT C;  2AWO A;  2JXM B;  4PNY A;  5FOB B;  2ICI A;  4A3G B;  1OXU A;  2F1M A;  3KBG A;  1ET9 A;  1QG7 A;  4RAU C;  3FMC A;  2CVR A;  2A6E D;  3TZU A;  4AYB B;  1Q12 A;  1HXY D;  3HG9 A;  4A3F B;  1FNW A;  1KDB A;  3SXH A;  4KHV A;  1UUP A;  3MFY A;  2OT2 A;  2AQ3 B;  3D4W A;  2D2C C;  2R61 A;  1TWA B;  3OWE B;  3R3O A;  1X3Q A;  2Z4I A;  4ZKB B;  2EYF A;  2PCF B;  4IN3 A;  4MN3 A;  3M85 A;  3DHQ A;  4M1U B;  4HED A;  1PTO B;  1ENF A;  4XDX A;  3MVV A;  3T53 B;  3D3R A;  1DZ1 A;  1U4L A;  1EOT A;  1DYQ A;  2XRS D;  4DXG A;  1PTO C;  4ZRZ A;  1D6E C;  2HDL A;  3R8B A;  4BS9 A;  1E2V A;  1ONL A;  5ELC A;  1B3A A;  5FO7 B;  2RDG A;  3H91 A;  1JIC A;  2WP8 J;  4A3B B;  1KDA A;  1S5D D;  3P7J A;  2IX1 A;  2FHT A;  3H3V C;  1KNA A;  2C9O A;  2R93 B;  1MSG A;  3A8J E;  1LTT D;  3WOF A;  1BBX C;  5KNB A;  3BDC A;  5C0X G;  2HCC A;  2SNM A;  2BDO A;  1JR0 D;  1HPC A;  4TSS A;  4OO1 H;  1DOL A;  2O4X A;  1STA A;  5JEA G;  2H1E A;  4BBR B;  2B2Y A;  5E4W C;  1R9T B;  5CV8 A;  2BA1 A;  3MA2 B;  3TZD A;  2FIN B;  1IW7 C;  3DXJ C;  3HOY B;  1D1K A;  2NZ1 D;  2JA7 B;  2F0Q A;  1HTL D;  1TU2 B;  3M3Y B;  2RDF A;  2AUK A;  3C1F A;  1D5Z C;  4RKL A;  3DM1 A;  2ZXO A;  4OL7 A;  4J8Q A;  4K6D A;  5DAU A;  3Q22 A;  4X3T A;  4XT3 B;  1KDC A;  2PO4 A;  1CT1 D;  2WIN B;  5CV6 A;  2NVX B;  2D5D A;  5A35 A;  1Y8O B;  3N6R A;  2E76 C;  2PNR C;  2Y0S B;  2KOL A;  1SND A;  1MGS A;  5D3D A;  4XT1 B;  2ID0 A;  4G7H C;  2EOT A;  4IFD G;  2QDB A;  1GOZ A;  1S4Z A;  4FP5 D;  3KK7 A;  1SE2 A;  2JP1 A;  1TS2 A;  2ENB A;  3GV3 A;  3L3O C;  1SBB B;  2H4O A;  4DAP A;  5CR3 A;  3NWS A;  2OF1 A;  4KJO A;  1EYC A;  3H0G B;  4H13 C;  3W3A A;  1ILQ A;  5EQ0 A;  1BUV T;  2F0N A;  3I91 A;  5IIF A;  2XIW A;  1F2Z A;  1Q3L A;  1LTR D;  3J7A F;  2XSC A;  3MWY W;  1JWM D;  1RDP D;  2F0L A;  3K59 A;  1WD1 A;  3BVZ A;  1B2T A;  5JOB A;  1FYC A;  3NQT A;  1EZ6 A;  5I6W A;  3NXW A;  4ZQ3 A;  1SYG A;  5HUR A;  2VNU D;  1PRT F;  1GUO A;  1TS5 A;  2NB0 A;  4DAV A;  4PMW A;  1HRJ A;  1ML0 D;  1TWG B;  4KI0 A;  3GQB A;  1CQV A;  1O7Y A;  5A2Q L;  4FXG C;  4C3I G;  2NBF A;  2B2V C;  5C3E B;  3L9A X;  1R4Q B;  1SYD A;  3RD4 A;  4EQO A;  3G7L A;  3I4M B;  2QF7 A;  5CBE E;  5KEE A;  5C0X J;  3AU7 A;  4K5X A;  1A2U A;  1QIL A;  2ICE C;  3JAM E;  1ESR A;  4OIJ A;  1PZJ D;  2A6H C;  4QUF A;  2RKS A;  4XYO A;  5JEA J;  5ISR A;  1EWH A;  3DMU A;  3GD7 A;  3V2T A;  4KHZ A;  1SYB A;  5K36 G;  4A93 B;  3BVM A;  2MGS A;  2A68 C;  2E2H B;  3S17 B;  2LMC B;  1RKN A;  2LY7 A;  3HZX A;  1G91 A;  3SK6 A;  2BE5 C;  3X3M A;  2A6H D;  4NMZ A;  1PFB A;  4K2K A;  1EQV A;  1SYE A;  4CJ0 B;  3VA5 A;  4RGO S;  2WII B;  2L11 A;  4FXK C;  3T16 A;  2A68 D;  1LAC A;  2A73 B;  4F87 A;  3C1E A;  3IFD A;  4A3D B;  3VYT A;  4HCS A;  2BE5 D;  4DAY A;  5DM6 3;  5LL6 X;  4J1M A;  1CQF A;  2F0S A;  4CJ1 B;  1G2S A;  3NWT A;  1KNE A;  1I4G A;  1LT6 D;  1SDF A;  1D5M C;  3VYS A;  1GJX A;  3WOE A;  4H7B A;  1B50 A;  2L12 A;  4E6I A;  4FF4 A;  4IZ8 A;  1IKM A;  4C2M B;  1WTX A;  1RF2 D;  2F3W A;  2KUM A;  2CHB D;  1SMY D;  4EQN A;  5D65 A;  4IFD J;  1Z47 A;  4KN4 C;  3M7N A;  4ME5 A;  1O7L A;  1V1O A;  3LWE A;  4QCL A;  1RCV D;  3TP6 A;  2NVQ B;  1KAB A;  3SK5 A;  1C4Q A;  1WTQ A;  3LWU A;  5HGT A;  4QMG A;  2R6G A;  3MEH A;  1BF4 A;  4A3J B;  1HQR D;  4I65 A;  2BCO A;  3KLS X;  3QJY A;  3PUX A;  3ONA B;  3D6C A;  1ROD A;  2AQ2 B;  1B4O A;  1LT4 D;  4EVO A;  1XXG A;  3HEJ A;  2F0W A;  1HHV A;  4A3E B;  2TMP A;  1Q8I A;  2IT1 A;  4XQJ A;  2IJ0 A;  4BY1 B;  1JWU D;  3J81 L;  3MXU A;  4IUP A;  1EY8 A;  3U9O A;  3S1M B;  4CGY B;  1DCZ A;  1W6K A;  2B2V A;  2CQA A;  5KND A;  1OXT A;  3OW7 A;  2IX3 A;  1STY A;  2K32 A;  1Y1V B;  1DJR D;  4QF4 A;  4DK0 A;  4BA1 I;  4RGT A;  4U68 A;  1Z7T A;  2X69 A;  4KTA A;  5COR A;  4DXF A;  2EY5 A;  1PZK D;  3VYU A;  2F0U A;  3D6W A;  3GV6 A;  2A69 C;  4DN4 M;  2WB1 B;  3I73 A;  1HQM C;  4IUN A;  4L63 B;  3MZ5 A;  4U67 3;  3MXG A;  3Q24 A;  3TN2 A;  1B1Z A;  1I4X A;  4IUQ A;  4ZUI A;  2X6L A;  4JBW A;  2NWG A;  1OXX K;  2PZW A;  1ILP A;  2LFN A;  5C4J B;  1SXT A;  3GTP B;  3CHB D;  3E0J A;  4C1N I;  3BS1 A;  3D8G A;  1TQO A;  1QE6 A;  3J80 E;  2DY8 A;  3KF8 A;  4CKC A;  5EBC A;  4IQZ A;  4NKL A;  2K04 A;  2PMZ B;  2K1B A;  4KV6 A;  4ZK9 B;  2N55 A;  1R4P B;  1VMP A;  5JJZ A;  2AWN A;  1AEX A;  2IW3 A;  1SNQ A;  2VB2 X;  4L6T B;  2L9H A;  2G9D A;  2KQ3 A;  1Y8P B;  5EGT A;  1JOO A;  2JA5 B;  2WKC A;  4NDX A;  1A3U A;  3PIO 3;  1O78 A;  5IOD A;  5I2X A;  3PUY A;  1F2M A;  1T5X D;  3EFX D;  2Z4H A;  5IGD A;  2JYO A;  5CV9 A;  2PQE A;  2F0M A;  2K5Q A;  3KLR A;  5CYU A;  1PRT D;  2WAQ B;  4N9P A;  4BWG B;  3HGB A;  1H9R A;  1AP0 A;  1G8Z D;  1UEA B;  2KVM A;  4RA8 A;  1Y1W B;  1A2T A;  5IGE A;  1EYA A;  3FEW X;  2J0T D;  2J7Z A;  3S1R B;  1EZ8 A;  2KHS A;  4FF2 A;  1AN8 A;  1C48 A;  1SJH D;  1EIG A;  1VMC A;  5CV4 A;  3K5N A;  1Y8N B;  5CBA E;  4CBV A;  2NN6 G;  2QCP X;  1YNJ C;  5KNC A;  3I8Z A;  4ZLT F;  1Q90 A;  4A3I B;  3HS0 C;  3NK9 A;  3GP7 A;  5J39 A;  4RHR A;  3BDL A;  1BNZ A;  1XWE A;  1E2W A;  5C4H A;  4IFD I;  1HA6 A;  3SR1 A;  1PTO D;  1CI3 M;  3IKJ A;  4HMI A;  3HRZ C;  2I07 B;  5E4X A;  4KMU C;  3DWP A;  2VB3 X;  4HSV A;  5M9O A;  2HUG A;  5T1I A;  2RSN A;  4PV1 C;  3D4D A;  4K6L A;  2MPM A;  2PYK A;  1CZG A;  4HTH A;  2BA0 A;  2NTS A;  5J22 A;  2A5H A;  1STE A;  4DGZ A;  2HCI A;  1BQQ T;  5F2D A;  4LMQ D;  1XX8 A;  2KCN A;  3DEO A;  4RFB A;  1EY6 A;  4WJW A;  2BOS A;  2M2L A;  5JPM C;  3V05 A;  3KUP A;  1GHK A;  1RTO A;  2JSO A;  3SHL A;  2VUM B;  5EPL A;  2XVS A;  1RD9 D;  3HOV B;  1S5F D;  1IW7 D;  3RMH A;  4G7O C;  5ELD A;  1EY4 A;  1JOQ A;  1J8I A;  2I46 A;  1BR9 A;  1STB A;  1II3 A;  1TR5 A;  3OPO A;  2R92 B;  4CKB A;  3T51 B;  3BYY B;  5C44 B;  3CRL C;  3PUW A;  3J7Y W;  3GTQ B;  3MTS A;  5IGB A;  5IT9 L;  3S2D B;  1STH A;  2EPB A;  4CKE A;  4DA2 A;  1RJT A;  5CV5 A;  5EBD A;  3OSO A;  5AFW A;  4Q0F A;  2FMC A;  3R2T A;  5TSS A;  4X3K A;  5I4D A;  4ZKC B;  4FYD A;  5EPJ A;  1RTN A;  1O7Z A;  5EKI A;  3AMU A;  3NTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...