2MP1A

Solution structure of the human chemokine ccl19
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
77
structure length
77
Chain Sequence
GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords C-C motif chemokine 19
publication title Solution Structure of CCL19 and Identification of Overlapping CCR7 and PSGL-1 Binding Sites.
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2014-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2mp1A00
1DOMA 2K01A 1WTPA 1PDQA 1WTVA 1Q3LA 1DOKA 1VMPA 1RODA 1U4LA 4ZKBB 2L9HA 3H91A 5D65A 3UI2A 1B3AA 2IL8A 1WD0A 2DY8A 1F2LA 2L12A 1X3QA 1HFGA 2K05A 2RA4A 3G7LA 1RTOA 2KECA 1F9RA 2KVMA 3DM1A 3LWEA 1WD1A 4IURA 1HUNA 2N55A 3N52A 1RTNA 1WTWA 1WTXA 2M2LA 3KUPA 1WVLA 1F9PA 1QG7A 4ZK9B 3DEOA 3R93A 1HHVA 5EPKA 3IL8A 1E0BA 1G2TA 1IKMA 5EQ0A 1GUWA 2Q8TA 1EL0A 1ML0D 1EIGA 4DN4M 5CORA 4CJ2C 1CA6A 5EKIA 2JP1A 1CA5A 4MHEA 3SVMA 1HRJA 3I91A 2N88A 1ICWA 1NAPA 4IUUA 5DNFA 4O42A 1BF4A 3GV6A 2B2WA 2H1EA 2R3ZA 2XIWA 2B2VA 3FDTA 1G2SA 1WTRA 1PFBA 1SSOA 3IFDA 5EPLA 2X6GA 1AP0A 1BNZA 3DEPA 1O80A 1IL8A 1U4PA 2B2TC 4HAEA 1RJTA 2D9UA 2L4NA 1B2TA 2SDFA 1HFNA 2NYZD 4UAIA 1SAPA 1DONA 1O7ZA 1EQTA 3D6WA 1TVXA 4IUPA 2MP1A 3HP3A 2MGSA 1BBXC 2KEDA 2B2UC 4MN3A 4LMQD 1ESRA 2JYOA 2RSOA 4OIJA 2K03A 1DOLA 2FHTA 2EOTA 2KEEA 1PLFA 1PFNA 2K04A 4RA8A 4R8IA 3F2UA 3TN2A 1ILPA 1J8IA 1DZ1A 1RHPA 2FMMA 3I8ZA 4NW2A 1WTOA 2EE1A 4XDXA 1VMCA 4X3TA 4QUCA 2FJ2A 1EIHA 1XX8A 4HSVA 5E4WC 1QNKA 1AZPA 1MGSA 2DY7A 3ONAB 1MSHA 4X3UA 4ZLTF 5CBAE 1HUMA 2MJ8A 2NWGA 4R9WA 1PFMA 2B2YC 2K1BA 1BO0A 2K28A 1MSGA 2FFKB 1ZXTA 2B2TA 1O7YA 3I3CA 3I90A 1EOTA 4OIKA 1G6ZA 1F9SA 4ZKCB 4X3SA 1ILQA 5JJZA 5CMDA 1JICA 4X3KA 2B2WC 4CJ1B 1B50A 1G91A 1J9OA 2B2VC 4RAUC 2BDNA 4QUFA 1KNAA 2B2UA 1KNEA 2EPBA 5COYA 1C8CA 1X3PA 4HEDA 2CVRA 2HCCA 5T1IA 3QO2A 3TZDA 1NCVA 2X6LA 2HCIA 1AZQA 1S4ZA 5E4XA 1LV9A 2HDLA 2NZ1D 3FPUB 3GV3A 2HUGA 2RVLA 1SDFA 1QE6A 5EJWA 5AFWA 1XYIA 4XT1B 1CM9A 3Q6SA 1F9QA 2Q8RE 1M8AA 1U4RA 4HCSA 3MWYW 2MPMA 1JE4A 1IKLA 4IUQA 1B53A 2KUMA 4IUVA 2L11A 1NR4A 2HDMA 3MTSA 1A15A 4IUTA 4XT3B 2L1BA 1B4OA 1WTQA 4CJ0B 2FINB 2KOLA 2VXWA 2RSNA 1MI2A 1NR2A 2B2YA 1U4MA 4RWSC 5D14A 5T1GA 4ZAIA 1HA6A 4U68A 2J7ZA 3KBXA 1X32A 5EPJA 5CBEE 3P7JA 2X69A
chains in the Genus database with same CATH superfamily
4A3LH 2DNCA 1F2ZA 1LT6D 2R7ZB 2Z6KC 1K8MA 4Q0FA 3U58A 3I73A 3BJUA 1X3QA 1SYFA 2R93G 4FDBA 2EZVA 1DCZA 5EAYA 5E3FA 1TWFB 4L63B 3IFTA 3DEOA 1HNWL 1XNQQ 4GKKL 3IL8A 3CCMA 1G2TA 2K6AA 2Q8TA 1SYDA 2IJ0A 1EIGA 3CCLA 1EL0A 4CJ2C 2CW0D 1VQIA 5IP9H 2B63G 2I07B 5I9OA 3SVMA 4LF6Q 1I50H 2BH8A 2PNHA 3FEWX 4AYBE 1S40A 2YTVA 3BVZA 2R61A 1IL8A 2B2TC 1NY4A 1JQYD 2D9UA 2L4NA 5IGFA 3E6ZX 3J7AV 1IBLL 5C4XB 1DONA 1O7ZA 4QGUA 2Q2IA 3EQLC 3OW2A 5KYIA 2Z4IA 1EY9A 4K2KA 4R4QA 4Y7NH 3M4YA 1YJWA 3R2IA 1K3BC 1XMOQ 3NTKA 1I6HH 5FJ8H 1CUKA 4LFAL 1QZGA 4CDCC 4A93G 1STGA 1SYEA 1XTDA 2Y0SG 5LMNW 2JA7B 2F0HA 1E24A 5CC4A 1LTBD 1SR3A 1TS4A 1H9SA 1WCMG 4A3IG 4X6AH 1N34L 3K5MA 3NBIA 1VQJA 2VQEQ 2BDOA 2LY7A 1J9OA 4B3MQ 4RAUC 1HCZA 1HXYD 1ESFA 4V0BA 1F2YA 1NMFA 4CKCA 4IQZA 4B3RQ 3PUWA 3SXHA 1S5ED 2HDLA 4A3DB 2F0MA 1EEFD 4A3CH 1GJXA 1SDFA 1X56A 2K32A 3MVVA 2UXBL 1JT8A 4XT1B 4KN7C 1TWGH 3B6YA 5M5WH 5GAGC 4DR6Q 4HCSA 3J80c 3F2BA 1IKLA 1YEZA 3S1NH 1XPRA 1WTQA 1AFPA 2CW0C 2RSNA 1B3QA 3IAYA 3SR1A 4AH6A 1RKNA 4LWCA 1K8GA 4C2MB 1DOMA 1JWUD 1SNMA 4HIDA 5M5XB 1PTOB 5IT9c 4BWGB 2K7VA 4O1NA 2PPBC 3A54A 2QDLA 2JEBI 5C4JB 1UE5A 4C3IH 2HD3A 2PQAA 2KECA 5JEAJ 1WD1A 5I9PA 3RN2A 1BCPD 4X62Q 1WTWA 3KUPA 4JI4Q 2R92H 1JOQA 3J7A5 1IKMA 1ML0D 2C5CA 2L55A 3ER0A 2WFWA 1CA5A 3A56A 2F0EA 3T1YQ 4K14A 4G7HC 4A3JH 4A3MG 2UUBL 3CC4A 2JA8B 3RR5A 1GUTA 1PFBA 1UUPA 2PZTA 3CAMA 5TSSA 1Y1WH 4DK6C 1N32L 1FL0A 3CMEA 4MTNA 5CV6A 4FF3A 4RKLA 2E2JB 2XTIA 2F4VL 3BZDB 2KEDA 3CKIB 1ESRA 4CKBA 3AMUA 2GA4B 3GTGH 2PZWA 2WKCA 4EQPA 5D3IB 3I4MB 5M3MG 2K50A 4ID6A 4C56C 2OTLA 3MEFA 4C3JG 2B3GA 1SXTA 4QF4A 3ERQA 4HSVA 3T53B 4ZLTF 1AE2A 5BN5A 5ELCA 3D3RA 1YHQA 2K1BA 2K4KA 2K28A 1MJEA 4O2DA 2IX1A 1DJRD 4X3SA 3VA5A 1VQFA 3DWQA 4X3KA 1DD2A 1A2TA 1G91A 3GTJB 1XPOA 1VQ7A 1WJJA 5T1IA 1EFWA 5IP7H 4KHVA 5JEAG 3J81E 2I0QA 4GS3A 2BE5D 5BR8Q 5E4XA 1YZ6A 2NZ1D 5ELBA 3MXGA 3Q6SA 4FF1A 3NE5B 1BCPC 1L1OA 1VQ4A 1EU3A 1Y69U 2A68D 2K5QA 3Q22A 4IFDI 1NJIC 1WOCA 3J80i 2AUJD 1S3OA 2A6ED 3HKSA 3TP6A 3CD6A 1LTGD 2ATWA 4ZUJA 1LTLA 1FGBD 1TWCH 3M4OB 4YHHQ 1X54A 3PQIA 2B39A 4QIWE 2WIIB 5EBDA 5C3XA 3HOWH 2ZTCA 1IXRA 1LABA 2L12A 5M9OA 4RGOS 1I3QH 4R4IA 3JAMc 2CWPA 2NVYH 1EYAA 1F9RA 1SN8A 2F4IA 2JA5B 3K58A 1HUNA 3J7YW 2F3IA 2WB1G 4TKOB 2XVSA 1YNJD 4DUYQ 4DR2Q 5J22A 1LTRD 3KK7A 4UPAA 1A0IA 2MFIA 3VYRA 1HZCA 3S9WA 3GTMH 3GV6A 3S1QB 1WTRA 1L1OC 3NELA 1KRSA 4MNOA 3H0GG 3OOCA 3DEPA 1PYBA 4A3BH 2NVXH 4R4OA 2K5WA 4ZCKA 2HT1A 2WAQE 5M5YH 1QCBD 1EYCA 5G3LF 1PVOA 1CK1A 1EWCA 1H95A 1F2MA 4CHTB 1CKMA 1PZJD 1Y1VH 1VQEA 2FJ2A 3M4PA 3G4SA 4PZ8A 1A62A 3SEBA 1EY8A 2A68C 1SEBD 1PXUA 1CHPD 1BO0A 1C4QA 3HOUH 1F9SA 4C3HH 4DR5Q 4I65A 3H6MA 3QOLA 5FO8B 3RLOA 1Q7YC 1TU2B 3EBEA 1ENFA 1LT5D 4GN5A 2F0GA 3V2TA 4DV6L 1C8CA 3I2ZA 1V8QA 5GROA 3K80C 2HCIA 2UUCL 1LUZA 2G9DA 3MHBA 1SE2A 3HOYH 4N9PA 2ZTEA 4EQNA 4DV2Q 1BXTA 1VQBA 5LMNL 4DR1Q 4KY5A 4ZQ3A 1I50B 1JJGA 1PRTD 1Q46A 2OXPA 1EIYB 1PYSB 1JE4A 5EGTA 1B53A 1YNJC 1KLGD 2ZJRA 2Q2UA 4K0KL 4F7XA 1S5FD 2I5LX 4U68A 4UP7A 3KBXA 2XRSD 3SK6A 1JOOA 3KF8B 1E22A 4P74A 4Y7NB 1B3AA 1SE3A 1VF5C 2O2LD 3CCUA 1HR0W 1BQQT 1JMCA 3FPPA 2K05A 2GVBA 1LTAD 3MXUA 2L5TA 5C5LA 4OONA 4DK1A 5FLXL 2KHIA 3VR5A 1GUGA 4PZ7A 1AW7A 3JAMi 2EDGA 4IJLA 5EBCA 1E2WA 4DK0A 2JK8A 4BY1G 2AWOA 3OTOQ 2AUKA 1SE8A 2WV6D 4NDXA 4RCNA 1HZBA 4K5WA 4LF7Q 3R3OA 3IFDA 3MXNB 5KNCA 3I72A 1LLRD 3T1HQ 1H9MA 2ZJPA 2IT1A 4AYBB 1EY4A 2NTSA 2RBMA 1ET9A 1TVXA 2LSSA 1S5CD 5BN4A 4LK1C 4IPGA 2F1MA 2EJMA 2O5IC 1NMGA 5M5WB 1Q12A 3GDEA 4TRDA 3PF4A 4OO1I 1GUSA 1TWHH 2PMZE 3I8ZA 1EIFA 3S1NB 4UY8C 3ULLA 1VQ8A 2E74C 1YNND 5JAVA 4FP5D 2A5HA 1PH9A 2UXDQ 4JI0L 3HOZG 1ET6A 4AQYL 1PRTC 2NN6H 1HUMA 2MJ8A 4KHPL 1FJGQ 5IYCG 4HSPA 2FFKB 2DN8A 4DXFA 5K5PA 3D4WA 2FXQA 3TBIB 2DJFC 3KBGA 4CJ1B 2EQSA 4C3IB 3N6RA 1N33Q 5ISRA 3QB3A 1GXDC 2QEXA 1SMXA 2X6LA 3NP8A 2KCNA 2R92B 3E3XA 1HNZQ 4IZ8A 1NBWA 5IYDH 3HG9A 2ZM6L 3P75A 4OL7A 1Q1BA 3SK8A 4IFDH 1D5XC 2MPMA 3EROA 4A3JB 1CKNA 1KLUD 1KABA 2HHHL 3F8TA 2VZAA 4JI1Q 1EY6A 2KOLA 1Y1WB 2OQKA 4OGQC 4KI0A 1HA6A 3TP7A 2F0UA 4DR4Q 3T16A 1JB3A 1KAAA 1HZ9A 2R7ZG 3DHQA 4ZUIA 1A63A 1V43A 2NUCA 2RDGA 3GTGB 4DNTB 3CF5A 3PO3H 4YCUA 4V190 4UDUC 1EUJA 3ZJYC 3F2CA 1U9RA 4NP5A 1B8AA 4DF7A 3N52A 1EZ6A 1HH2P 1OO9B 1B9NA 5EPKA 2EYOA 5EQ0A 4KLKA 4I7ZC 4IJHA 1K9MC 2E8GA 3OPOA 2D2CC 1ZKOA 3MZ5A 2RCFA 1YNNC 2F03A 1QVFA 4GKJQ 1MJCA 3BDLA 5IYBG 1HNXL 5A2QE 2JA9A 5IWAQ 3CQZH 4X66Q 5IGCA 5C4XG 4OELB 1ZYRD 2NZOA 2K52A 3HEJA 3GTJH 1CZGA 3NWTA 4LUZA 3VR6A 2D0OA 3X3NA 4J6HA 3NBHA 4GNXB 4BBRH 3KDFB 4LMQD 1R4PB 2A19A 1D5ZC 2K03A 4JI6Q 4R8NA 5FLMG 1PH5A 1DZ1A 2JA7G 2LMCB 1EY0A 2PW5A 4XIGS 4QUCA 2L0CA 1KD1C 4DV5Q 4UP8A 3HGBA 2DY7A 3PUZA 4JI3L 1CFMA 2NWGA 4PQXA 1TWCB 4C1NK 1GHJA 2JEAI 2UUAL 3S14H 4ZKCB 4H44C 4MIUA 3EIVA 5IGBA 4DV3L 2LXJA 1BVSA 1I3QB 2BDNA 4RGTA 3UDXA 1C0AA 3WDNA 4GZYC 1P8LA 3SDZA 2PI2E 4JI2L 2AQ2B 4DA2A 1OXUA 4A3DG 2SEBD 2KBNA 2VQFQ 1UWVA 2JA6H 1D6EC 4NXMQ 3G6EA 1XNRQ 3I70A 4FNFA 3KF6B 2SOBA 3GTMB 4DV1Q 2XN9C 1Z7TA 3OYYA 1STNA 4Q5VA 1A15A 3PUYA 3NK9A 3K5LA 3LGJA 2E76C 4H02A 5D14A 4A3BB 4HJAA 2V1CC 2NVXB 4KKTA 5EPJA 2QF7A 2OWOA 4L8JA 1ZEQX 3PSIA 4PMWA 4LF8L 3K7AH 1VS0A 2N8NA 1PH8A 2A69D 1N36Q 5M5YB 4LFCL 1ICFB 1IBML 2AKWB 3MEHA 1HPCA 5DAUA 2RA4A 4J1MA 1BCPF 4QIWB 3M7NA 1WYDA 3QJYA 4IURA 3A0JA 4KY7A 4GKKQ 1RTNA 2MNAA 1Y1VB 4CDDC 1HHVA 4OX9Q 4JPBW 4DAPA 3VR3A 3RZOH 4ODGA 1E0BA 3J80E 2QW7A 1PV4A 5EKIA 4HTHA 4ZYSA 1H9KA 3HOUB 4DAYA 3AB9A 4IUUA 3F1ZA 3CCJA 4C3HB 2JA8G 1FR3A 5JJLA 2H1EA 1D8LA 1N8RC 3I4NH 1DYQA 1II3A 5K36G 3NTIA 1NSNS 2NYZD 1C9OA 2R7FA 5JVH3 5IT9E 4JYAQ 4HCEA 4LF9L 1UE1A 1HR0L 1DGSA 4JI7L 3HOYB 1LTTD 2FHTA 4OO1H 3VA7A 2E5LL 2OT2A 4LFAQ 4QY7A 2VNUD 3I4MG 1YHBA 4FXDA 2WAQB 4PNYA 3BYYB 1QOHA 1I4QA 4H0LC 4H7BA 3T13A 1A3TA 1H9RA 1N9WA 4IPHA 1SMYC 3QWNA 2RCNA 1TS3A 3NEMA 4L6TB 5LMUQ 1L2FA 3GTKH 2DUDA 3ND8A 3ONAB 2NVQH 4QCLA 1N34Q 3UE1A 2SNMA 3FVQA 5ELEA 3CPWA 1HQRD 2F3VA 4GLXA 1M4VA 5CMDA 2XSCA 2MO0A 4LF5Q 1VQ5A 3PO2H 4DR3L 4LAAA 2CKZB 1JB7A 4DV0L 2UXBQ 4X65L 3OWEB 5FK9C 2A6HC 2KCCA 4A3GH 4J8QA 1XYIA 3RLFA 1VQMA 2RKSA 4ZRZA 4IPCA 1Q82C 4KD4A 3TSSA 3W2DA 4IUVA 2HDMA 2L1BA 2D0PA 4ME5A 2KCMA 2DGYA 4OWTB 2X69A 1J6QA 2PYKA 3Q23A 1Q86C 4LF6L 4IN3A 3S2HH 2DY8A 4UP9A 3K59A 2KCTA 1TWHB 2JA5G 1FYCA 1PTOD 2UXCL 3U4ZA 3HOXH 1AE3A 4NPSA 4ME3A 4BBSH 1R9TH 2K5DA 3EN2A 4H13C 1XMOL 1ICWA 2F0KA 5D3DA 1SNQA 1SNCA 1V9PA 3HKZE 2XIWA 1X3EA 3DMUA 4A3FH 1UEAB 4IALA 1N32Q 3C46A 3D6CA 3MC0B 2F4VQ 4ULLA 1HFNA 4UAIA 2C9OA 2WINB 3U4VA 3D8GA 2B29A 3BU2A 3W1GA 4N8FA 3I55A 3JAME 3GTPB 2VQEL 4PMCA 1Z47A 3FKIH 4RA8A 2F0TA 3GO5A 4TVAB 1BBWA 1UE7A 1IYVA 4NW2A 3K0XA 5C0XI 4XDXA 1SE4A 4BA2I 4K8IA 2PMZB 1QNKA 4JG2A 3GD7A 3CRLC 4P73A 4A3LG 1XXGA 3H3VC 3UDFA 3SK5A 4FVMA 4A3KH 1OTCA 3PO3B 2H5XA 2QGQA 3FMCA 5C3WA 2V4DA 5COYA 2BOSA 3CP0A 2YV5A 4HEDA 4JC0A 1BCPB 1SJHD 5CYUA 3PV0A 3RD4A 2F0DA 1CKOA 5IP9G 1F9QA 3P20A 1PRTF 2L15A 4DPGA 1M8AA 1STYA 1BDOA 3PIO3 2NN6I 1SFOH 1QJOA 1B4OA 3CQZB 1G6PA 1VCIA 1EFID 2B2YA 4X64Q 2EXDA 3H3VI 2J0TD 1SYGA 3UE0A 3G48A 2OQ0A 1PDQA 1WTVA 2F0WA 4U673 4BBRB 1Q3LA 4JVZA 1VMPA 1KC8C 3PF5A 1A3VA 1HTPA 4FF4A 1E7ZA 3VYTA 3NTHA 5FJ8G 1SNOA 1E3PA 1OXXK 1JR0D 3VR4A 1IW7D 3RNUA 3AYHB 4ZK9B 2PNRC 4BA1I 4G7OC 4A3EH 2ES2A 1VF7A 2AQ3B 1G291 4P75A 4CBVA 1L1OB 4GN3B 3PIOA 4B3SL 4DV7L 2K33A 5DM63 2R7DA 2K5NA 3PGZA 1HRJA 2N88A 2YTYA 3S14B 1SSOA 3LNNA 4AYBG 1RJTA 3EVQA 1GD7A 3NUCA 3TDQA 4JCVE 1XMQL 4IUPA 3A7AB 3NQTA 1TWAH 1STBA 4A3CG 5JJKA 4HMJA 1D5MC 1QUQB 2Q2HA 4OXPA 2JA6B 1JE5A 1GO3E 1KXLA 2HQLA 4DXGA 4RFBA 1I4PA 3S24A 3T56B 1J8IA 1WTOA 1G8ZD 1YJNA 1SRUA 2MHVA 3STBD 1PH1A 4GLAC 3BG3A 1L0XB 1C48A 5BR8L 5DM73 1Y8NB 4X3UA 1K8AC 3K7AB 3A7LA 3MA2B 5J3BA 1W6JA 1O7YA 4FO2A 1NNXA 4N8X1 4DV6Q 3R2TA 5HGTA 4C3IG 4KY6A 4B3TQ 2WP8J 5ELFA 2B2UA 4A4IA 3C2PA 2UU9L 4L5SA 3QO2A 2BE5C 3TZDA 3UDGA 1JJ2A 1NCVA 2R92G 3GP7A 3U9OA 3RZOB 5LMNQ 5M3FB 3RMHA 5CV9A 3H15A 5I6YA 4YHHL 1GM5A 2MQHA 1FNWA 3CU7A 4A3JG 1IW7C 4K0KQ 5GAHC 3I4NB 2O5JC 1TXYA 3C1FA 1CZWA 1A2UA 2ZXRA 1TY0A 5JPNC 1Y1WG 1K0RA 5FOBB 5KIXA 2A6EC 3GTOH 2J7ZA 3CRKC 4DUYL 3A55A 3J81L 3L0OA 5KYLA 2PW7A 3DUZA 2R6GA 2ASBA 1ONLA 4HJ7A 1T9HA 1PA6A 4HR7B 1V1PB 1I4XA 1S5BD 3DM1A 4RHSA 4OWXB 2IHEA 1YNXA 1QG7A 3BS1A 3OSOA 3GTKB 1QVCA 1STAA 1Z6HA 3A74A 3NHHA 4YWKA 2NVQB 1TS2A 4DGZA 4HJ9A 2NZHA 2G9HD 2EY1A 3OMGA 4QB4A 4O42A 1TIID 3FDTA 1G2SA 2E75C 4C3JB 2CH4W 4DR7L 3PO2B 3A8JE 1SNPA 4L5TA 3H94A 4NB3A 1I94L 1KIXA 5IP7G 2G5DA 1VQCA 1B70B 2I46A 1BBXC 1VQDA 3KF8A 5I6WA 4HIKA 4A3GB 1WFQA 2EOTA 4KV6A 4DR5L 3ICEA 1M90C 2AHOB 5C0XH 1YBYA 4HMIA 1VQLA 1C7YA 4JI0Q 1RIPA 3QOJA 2KENA 4DUZL 4JBKA 1T5XD 4KHPQ 4O0AA 2LFNA 1IBKL 2YU9H 3S1MH 3T51B 5FLXc 4LFBQ 3S17H 3A5ZB 1PYWD 4DV2L 5FKAC 1QVGA 1B44D 3X3MA 5HGQA 4F88A 1L0YB 3HOWG 4WJ4A 4KN4C 5NUCA 1VQKA 1RDPD 2M00A 3S2HB 5KRUA 4I7AA 2EXZA 3MXNA 3EA6A 3M3YH 1UNSA 3HOXB 2B8GA 3CPFA 2JE6I 4BBSB 4JBJA 2ZM6Q 3FPUB 2NB0A 1R9TB 3HOVH 1EQQA 2Q8IB 5IGEA 4YY3L 3W1BA 3L2PA 4A3FB 1UE6A 3H3VH 4XT3B 3PUVA 3CHBD 1XJVA 3S1RH 1E2VA 3I7FA 4A3BG 1KQSA 4ZAIA 1I4HA 2AQ1B 1LT3D 4XYOA 5GAEC 4KMUC 1DOKA 1RODA 2JXMB 3U9SA 5JPMC 3H91A 2EYLA 2WKDA 2VUMH 3FKIB 5I2YA 3RUZA 3E9HA 3GTPH 4YCWA 5C3EH 5CV8A 4BXXH 1Y1VG 4RG1A 1F9PA 1U0LA 2F0QA 2F0VA 4NXNL 3GTQH 1CKNB 3HOUG 4JW0A 4MHEA 4C3HG 3TMEA 2B2WA 4KK7A 4A3KB 4BY7H 1IYUA 1CHQD 4B08A 5C5MA 4WRDA 3HKZB 2JSOA 2VB3X 5CGKA 2UXDL 5C6AA 1D2BA 4JI5Q 1X3FA 4JBWA 2A1AA 1L0WA 1QB5D 3TS0A 4YIJA 1FJGL 3HOYG 1A8VA 3EJIA 1DOLA 3CXCA 5EKKA 3TS2A 3MFGA 3K7UC 3QIAA 2WAQG 5FO9B 2F0LA 1S5DD 1ILPA 1A3UA 1W3SA 2Y0SE 1N33L 1YJ9A 2R93H 1SFOB 3BVGA 1VMCA 5CR3A 3OIPA 3WWVA 5HURA 5GADC 5IOCA 1XX8A 5E4WC 1HNZL 5LL6X 2UUAQ 1NE3A 1PHJA 2QKIC 2DJGC 1PFMA 4R9WA 1ASYA 4DV3Q 1GKHA 2B63H 3QR8A 4A75A 1ZXTA 3CCVA 3GTLB 1G6ZA 1UAPA 4CGYB 1ILQA 5JJZA 1JICA 2B2WC 4FF2A 4JI2Q 2GN5A 1SYBA 2F3WA 4JI1L 2F0PA 2XWJB 2Z6BA 3NBHB 2VL6A 2HCCA 3TEHB 2Z8LA 4A3EB 4QQBX 4GNXA 4L5QA 2B8FA 3KDFA 4IFDJ 3FHWA 2RHQB 2XGTA 2K14A 4LNQA 1CSQA 2JJQA 3QG1A 2BH2A 4IUQA 2EYHA 1RD9D 2RQXA 3P1HA 4DK3C 4GOPB 1PH6A 1P16A 3IKJA 4A93H 4FXGC 1NUCA 4LF8Q 3PIP3 3G6JB 3TRZA 2OTJA 1JWMD 3S2DH 3CCEA 1TWAB 2EYFA 4YWMA 2QEJC 3VDYA 2ZT9C 1IL2A 1KAWA 4B9XA 1B1ZA 1WCMH 2VW9A 4A3IH 4GKJL 5IE8A 5CV4A 1AEXA 1X6OA 1PTOF 5IWAL 3LWEA 2HIVA 4OWWB 1SROA 2N55A 1WTXA 4QL5A 1JOKA 2OF1A 2NN6G 1HA5A 1D1KA 1EEID 1O78A 5CORA 3CCSA 3I91A 2BCOA 3VR2A 3PIPA 4PMBA 3KF6A 1CA6A 2EY6A 2PCFB 3R8BA 1VQNA 1BNZA 1ZYRC 2VY3A 2Z1CA 2Z6KA 1FGUA 1HZAA 4HIMA 4JI7Q 3S15H 2H4OA 1HNWQ 1AH9A 5IYDG 1PFSA 1AN8A 1UEBA 5JOBA 3KLRA 5IGDA 4DV4L 4JI8L 4G4KA 1PLFA 4IFDG 5M3FH 2K04A 1LYLA 4JV5L 3TP5A 1RHPA 1Z9FA 5A2QL 4RKBA 3HFZB 2E2HB 3BZCA 2ALYB 2EYPA 3K8AA 1IBLQ 3GTOB 3PUXA 1LO5D 2ENBA 4KTAA 4DAYB 4DFAA 1MSHA 2VQFL 2CQOA 2LS01 1STHA 4N9TA 4LF4L 2IX0A 4NXML 3KYHC 1DXMA 1WTHA 2B2TA 3CW2C 3I3CA 1XNRL 4IPDA 1HTLD 4DR3Q 4A3MH 3PO3G 5LHY1 1B50A 4HJ8A 4K8JA 1KNEA 3D0FA 1F77A 3C3LA 1GHKA 3EFXD 5AJ3L 3CCQA 4HIOA 5BN3A 4P72A 1FNUA 3VYSA 3SGIA 1N36L 1U4RA 1BKBA 3D31A 2LKVA 5M3MH 1GOZA 2L11A 1J5EL 4CJ0B 3LWUA 1CQFA 4C3JH 5C44B 4RWSC 5T1GA 4OX9L 1MBYA 2YTXA 2CVRA 3P7JA 4F87A 4BBRG 4DKAC 2A69C 1EQVA 1U4LA 4ZKBB 4OHJA 1Q8KA 2IL8A 5LL6S 1F2LA 5IGGA 2UXCQ 4XTCS 4NMZA 3G7LA 2AMCB 1EY5A 2WB1E 3K5OA 4JYAL 4LW1A 1KRTA 1SLJA 2JQOA 5JEAH 1EWIA 3S1MB 2YU9B 4POGA 1VQAA 3S17B 2IW3A 3S16H 1XNQL 1H9SB 1H9JA 1NAPA 5A35A 2B2VA 2ZXPA 3AFQA 1AP0A 2X6GA 4MZ9A 4HAEA 4EX5A 2D62A 3M3YB 2F0OA 1FVIA 5LMUL 1E1TA 4DNIA 5JJIA 5KNBA 1ASZA 5ELOA 2N3SA 1PZID 1BR9A 2MUYA 5F2DA 3TQYA 2JA6G 3J80L 1KTKA 3BDCA 3HOVB 3D4DA 1PFNA 1I6VC 1QWYA 3URYA 2YYZA 4PG3A 4R8IA 4PV1C 2UUBQ 1CI3M 1IHZA 3Q0AA 4LF5L 1WI5A 1XTCD 2F0NA 2EJGC 4JOIA 1CTMA 3S1RB 1YI2A 1W2BA 5JVG3 2CFMA 1EIHA 1ENAA 1MGSA 5E1FA 5IT9L 3A8KE 3MFYA 5IODA 2KQ3A 4DAVA 1S72A 1K73C 4E6IA 3I90A 2KJXA 3J7ZC 3CCRA 2VUMB 4ABNA 4XQQA 3NPPA 5L37A 2B2VC 2PQAB 1JWSD 4QUFA 3H0GH 4BS9A 5C3EB 2CCZA 4K6DA 4B3ML 2IHFA 1E1OA 1X55A 3WOFA 1S4ZA 5GQOA 5M3FG 2EIFA 1QE6A 1Y14B 3ULJA 1VDZA 3GTQB 3CC7A 4MTKA 5I2XA 1MIUA 4B3RL 1EZ8A 3T4AC 1K83H 1VQOA 3I4NG 4K5XA 4BY7B 2KUMA 4IUTA 2RDFA 4DR6L 4EQ5A 4J15A 4JOIC 1U4MA 3A5UA 1BBUA 4RHRA 1WTPA 2K01A 2CWAA 3RZDH 4OO1G 2O4XA 3Q8DA 4F8MA 5J39A 1WD0A 2QA4A 2ICIA 2EYJA 1PTOC 2A74C 4KJOA 3I4OA 1Y8OB 3AQQA 2R93B 1GVPA 3V96A 4B3SQ 3L3OC 2M2LA 4DV7Q 2TMPA 3R93A 3SE0A 4X62L 3TREA 1TKWB 3L7ZC 4DN4M 4JI4L 2PO4A 4R1JA 2B63B 1OXSC 4LUVA 2RDHA 2F0FA 1XMQQ 3T1YL 3GTLH 1EWHA 3PO2G 4B9WA 1Q1EA 1EOVA 4ALPA 4YWLA 2E2DC 3M4QA 3NXWA 4K6LA 1TR5A 3DWAA 4A3GG 3KJPA 1OXTA 3KLWA 4EVOA 3OMCA 4WJWA 1K8OA 2PQEA 3HZXA 2MO1A 4A93B 1SYCA 2XWBB 3OWFA 4RMFA 2Y0SB 1A6XA 2PZUA 2IY5B 3S2DB 1X9NA 1KDCA 3LX0A 2NBFA 3NENA 2B2YC 2IPKD 1EQRA 5FO7B 4BY1H 1V1QA 4OIKA 1RF2D 1EOTA 1WCMB 4DNRB 4IOCA 4EGVA 3JAML 4A3IB 4KKUA 3HS0C 1TT2A 2QILA 3WOEA 3BZKA 4TQUS 4XYQA 4RH6A 2UU9Q 3AEVA 4X64L 1X3PA 3HOXG 4BBSG 1HQMC 4WJ3M 1LV9A 5C4HA 3GV3A 3O13A 2GVAA 1QUQA 1CSPA 3W5OA 1QILA 5H1SE 3SHLA 2CH4A 5EKLA 4KJNA 3E9IA 1LTID 4A3FG 4NKLA 2K5VA 5FLXE 1OXVA 2KA7A 1G51A 4P2CB 1MI2A 4Z9CB 2F0SA 3HOZH 3S15B 2LXKA 2UUCQ 5DEHA 2WACA 2Z4HA 5IYCH 3UI2A 3G71A 3FKIG 2AWNA 4GLVB 4AIMA 4HN7A 3W3AA 3BVMA 2E2IH 2EYMA 3OW7A 1IZ6A 2E2HH 2NVTH 2PI2A 2M9VA 3RLNA 2N49A 4DR2L 2A73B 4A3KG 4DR7Q 1X65A 1BF4A 1I94Q 4A3MB 3M85A 1SNDA 5EPLA 3CMAA 1O80A 3HKZG 5ELNA 3DWPA 1B2TA 4R4TA 1EQTA 1TS5A 3D6WA 4KHZA 4WORA 4L5RC 3HP3A 2Q2TA 2MGSA 3NWSA 2B2UC 4EQOA 2R7ZH 2JYOA 4OIJA 3K5NA 4LJZC 3J81c 2ICEC 1PH3A 3F2UA 3TN2A 1V1PA 4DUZQ 4B3TL 3KLSX 1LTSD 5M3MB 4Y52H 1VQGA 1TWFH 2ZTDA 3STBC 1PH4A 1IBKQ 3GQBA 1Q90A 4FXKC 4ILWA 2HQEA 5IY0A 5CBAE 5C44H 1QNUA 4TSSA 2EY5A 1HJPA 2RHSB 2I5MX 1VQ6A 4WFN3 2C35B 5IYBH 1FNVA 1EU4A 3L9AX 1M1KC 3OHXC 4K2LA 3ULPA 2I5HA 1STEA 3A8IE 4G57A 5C4XH 1EYGA 3J81j 4HJ5A 1PRTB 4A3EG 4AQYQ 1Q8IA 2OCEA 2HUGA 2ID0A 5EJWA 1TQOA 4YY3Q 1YIJA 3S16B 1I6HB 1TY2A 4GN4B 2KHJA 1MHWC 4M8AA 5FLMH 3CC2A 1K0SA 3KFUA 4DR1L 2EJFC 3K0YA 4OEMB 2VXWA 5C4ZA 5I4DA 1PH7A 2JA7H 3E0JA 1NR2A 1Y8PB 1SBBB 2Z9HA 4PZ6A 1K3RA 1XWEA 1YVCA 4LUOA 5D65A 3RN5A 2HIXA 1E2ZA 1KDBA 4XQJA 1DM0B 2BA0A 1RTOA 2KVMA 3ND9A 2HHHQ 2IWHA 4NXNQ 1WVLA 3E0EA 1TWGB 4FYDA 2WB1B 4A3DH 1GUWA 4S3SA 4RCOA 2JP1A 5IIFA 1KDAA 1O7IA 3U50C 5DNFA 3M9BA 3TP8A 2R3ZA 3NQIA 3NSWA 3OTOL 3MXPA 1NTGA 4IO9A 3M7GA 1LT4D 3E5SA 3H0GB 4LF7L 2SDFA 1VQ9A 1ENCA 2F52A 4XQNA 3K81C 3T1HL 4LFBL 4C2MH 4MN3A 1PTOH 2XRQD 1EY7A 5M5XH 2RSOA 5C0XJ 4IUNA 4KD3A 2KEEA 3FP9A 3AFPA 4A76A 1K83B 2N78A 5C4JH 1HNXQ 5G3LD 2FMMA 4RGNA 2JN4A 3J81i 2OEOA 3I4LA 1BUVT 3ERSX 3RZDB 3JC66 3K6OA 1MKHA 2ZXOA 2JA8H 4QJFA 2J4XA 1SJED 1CT1D 2KHSA 5K36H 1KNAA 5DLQE 3OIQA 1RCVD 1V1OA 1X3GA 4XXEA 1FD7D 3F2DA 1BOSA 2E2JH 3DM3A 1AZQA 2ZJQA 3K57A 4JI3Q 3FRPB 5KNDA 2F0IA 2Q8RE 5CV7A 4G7ZC 5CV5A 4APVA 3I4MH 2D5DA 2K5HA 3D4RA 3V05A 4DU9A 1D7QA 3MTSA 1MD2D 2DNEA 4QMGA 2FINB 5C44G 4JBMA 5ELDA 4JK1C 4POFA 1I5FA 2QDBA 3BDOA 5HY6A 1I4GA 1W6KA 4RGMA 1QZHA 4YCVA 4DR4L 2L9HA 3KJOA 5C0XG 1U5KA 3IRBA 2A8VA 1HFGA 1K28A 5KEEA 1CQVA 4C1NI 4JI5L 3MAQA 1GUOA 4DAMA 3H09A 3PCOB 5KGUA 1LACA 1PMRA 1PH2A 4BY1B 2VB2X 2XNAC 1KL9A 4LFCQ 1EYDA 2IX3A 1IBMQ 1XPUA 3PMFA 1JC7A 4GOPA 3C1EA 4K5VA 1U4PA 3DXJC 1VQPA 1SAPA 4X66L 2MP1A 2Z0SA 3HRZC 4DV4Q 4JI8Q 3HOWB 4KKSA 1GUNA 3M4OH 4JV5Q 3HOVG 1PZKD 1B9MA 2NVYB 1I4RA 2NTTA 4CKEA 4GNXC 4JI6L 1JCKB 1KHIA 2SNSA 2JA5H 2VS1A 2EE1A 4X3TA 1SMYD 2FMCA 4LF4Q 4UHVA 3TZUA 1AZPA 3HOZB 1YHAA 2QCPX 4LF9Q 2EVBA 3J7AF 4R4CA 2P5ZX 1HR0Q 4DV5L 5J1ZA 4CDEC 1O7LA 1MSGA 3I56A 2E5LQ 2VUMG 3S1QH 3BYTB 2CHBD 3ZYYX 1VQHA 5E7NA 3SK4A 5C3EG 2TSSA 5AJ3Q 4BXXG 4GOPC 2EPBA 3UDIA 1YITA 3Q24A 3VYUA 4CDFC 3DLLA 2E2IB 3KOJA 1LM0A 4IOAA 2NVTB 4M1UB 2RVLA 2A6HD 2BA1A 5AFWA 1JORA 1CM9A 1D1IA 1R4QB 1JJCB 3MWYW 1RL2A 1T5EA 2EY2A 1J5EQ 4BY7G 3KLSA 3ITPA 1NR4A 1IYJB 3AU7A 4DV1L 1B7YB 2CQAA 2K75A 4P71A 4DV0Q 1Q81C 1X32A 5CBEE 2RF4A 2F0JA 4X65Q
chains in the Genus database with same CATH topology
2DNCA 1F2ZA 1LT6D 2R7ZB 1K8MA 4Q0FA 3I73A 1X3QA 1SYFA 2EZVA 1DCZA 5E3FA 1TWFB 4L63B 3IFTA 3DEOA 3IL8A 1G2TA 2K6AA 2Q8TA 1SYDA 2IJ0A 1EIGA 1EL0A 4CJ2C 2CW0D 2I07B 5I9OA 3SVMA 3FEWX 3BVZA 2R61A 1IL8A 2B2TC 2D9UA 1JQYD 2L4NA 5IGFA 3E6ZX 3J7AV 5C4XB 1DONA 1O7ZA 3EQLC 5KYIA 2Z4IA 1EY9A 4K2KA 3M4YA 3R2IA 3NTKA 1STGA 1SYEA 2JA7B 2F0HA 5CC4A 1LTBD 1TS4A 1H9SA 3K5MA 3NBIA 2BDOA 2LY7A 1J9OA 4RAUC 1HCZA 1HXYD 1ESFA 4V0BA 1F2YA 4CKCA 4IQZA 3PUWA 3SXHA 1S5ED 2HDLA 4A3DB 2F0MA 1EEFD 1GJXA 1SDFA 2K32A 3MVVA 4XT1B 4KN7C 4HCSA 1IKLA 1WTQA 1AFPA 2CW0C 2RSNA 3IAYA 3SR1A 1RKNA 4C2MB 1DOMA 1JWUD 1SNMA 5M5XB 1PTOB 4BWGB 2K7VA 4O1NA 2PPBC 3A54A 2JEBI 5C4JB 2KECA 5JEAJ 1WD1A 5I9PA 1BCPD 1WTWA 3KUPA 1JOQA 1IKMA 1ML0D 2C5CA 2L55A 1CA5A 3A56A 2F0EA 4K14A 4G7HC 2JA8B 1GUTA 1PFBA 1UUPA 2PZTA 5TSSA 5CV6A 4FF3A 4RKLA 2E2JB 3BZDB 2KEDA 3CKIB 1ESRA 4CKBA 3AMUA 2GA4B 2PZWA 2WKCA 4EQPA 5D3IB 3I4MB 4ID6A 4C56C 4C3JG 1SXTA 4QF4A 3ERQA 4HSVA 3T53B 4ZLTF 5BN5A 5ELCA 3D3RA 2K1BA 2K28A 2IX1A 1DJRD 4X3SA 3VA5A 3DWQA 4X3KA 1DD2A 1A2TA 1G91A 3GTJB 5T1IA 4KHVA 5JEAG 3J81E 2BE5D 5E4XA 2NZ1D 5ELBA 3MXGA 3Q6SA 4FF1A 3NE5B 1BCPC 1EU3A 1Y69U 2A68D 2K5QA 3Q22A 4IFDI 2AUJD 2A6ED 3TP6A 1LTGD 4ZUJA 1FGBD 3M4OB 2B39A 2WIIB 5EBDA 5C3XA 1LABA 2L12A 5M9OA 4RGOS 2JA5B 1EYAA 1F9RA 2F4IA 3K58A 1HUNA 3J7YW 4TKOB 2XVSA 1YNJD 5J22A 1LTRD 3KK7A 3VYRA 3S9WA 3GV6A 3S1QB 1WTRA 3OOCA 3DEPA 2K5WA 1QCBD 1EYCA 5G3LF 1CK1A 1EWCA 1F2MA 4CHTB 1PZJD 2FJ2A 3SEBA 1EY8A 2A68C 1SEBD 1PXUA 1CHPD 1BO0A 1C4QA 1F9SA 4I65A 3H6MA 3QOLA 5FO8B 1TU2B 1ENFA 1LT5D 1C8CA 3V2TA 2F0GA 1V8QA 2HCIA 2G9DA 3MHBA 1SE2A 4N9PA 4EQNA 1BXTA 4KY5A 4ZQ3A 1I50B 1PRTD 2OXPA 1JE4A 5EGTA 1B53A 1YNJC 1KLGD 4F7XA 1S5FD 4U68A 3KBXA 2XRSD 3SK6A 1JOOA 4Y7NB 1B3AA 1SE3A 1VF5C 2O2LD 1BQQT 3FPPA 2K05A 1LTAD 3MXUA 2L5TA 5C5LA 4DK1A 5FLXL 3VR5A 1GUGA 1AW7A 2EDGA 5EBCA 1E2WA 4DK0A 2AWOA 2AUKA 2WV6D 4NDXA 4RCNA 4K5WA 3R3OA 3IFDA 5KNCA 3I72A 1LLRD 1H9MA 2IT1A 4AYBB 1EY4A 2NTSA 2RBMA 1ET9A 1TVXA 1S5CD 5BN4A 4LK1C 2F1MA 2EJMA 2O5IC 5M5WB 1Q12A 4TRDA 4OO1I 1GUSA 3I8ZA 3S1NB 2E74C 1YNND 5JAVA 4FP5D 2A5HA 1ET6A 1PRTC 2NN6H 1HUMA 2MJ8A 4HSPA 2FFKB 2DN8A 4DXFA 5K5PA 3D4WA 3TBIB 3KBGA 4CJ1B 4C3IB 3N6RA 5ISRA 3QB3A 1GXDC 3NP8A 2X6LA 2KCNA 2R92B 4IZ8A 3HG9A 3P75A 4OL7A 1Q1BA 3SK8A 4IFDH 1D5XC 2MPMA 3EROA 4A3JB 1KLUD 1KABA 1EY6A 2KOLA 1Y1WB 4OGQC 4KI0A 1HA6A 3TP7A 2F0UA 3T16A 1JB3A 1KAAA 3DHQA 4ZUIA 1V43A 2NUCA 2RDGA 3GTGB 4DNTB 4V190 4UDUC 1U9RA 4NP5A 4DF7A 3N52A 1EZ6A 1OO9B 1B9NA 5EPKA 2EYOA 5EQ0A 4I7ZC 3OPOA 2D2CC 1ZKOA 3MZ5A 1YNNC 2F03A 3BDLA 5A2QE 5IGCA 1ZYRD 3HEJA 1CZGA 3NWTA 3VR6A 3X3NA 4J6HA 3NBHA 4LMQD 1R4PB 1D5ZC 2K03A 4R8NA 1DZ1A 2LMCB 1EY0A 2PW5A 4XIGS 4QUCA 2L0CA 3HGBA 2DY7A 3PUZA 1CFMA 2NWGA 4PQXA 1TWCB 4C1NK 1GHJA 2JEAI 4ZKCB 4H44C 4MIUA 5IGBA 1I3QB 4RGTA 2BDNA 3WDNA 4GZYC 3SDZA 2AQ2B 4DA2A 1OXUA 2SEBD 1D6EC 3I70A 4FNFA 2SOBA 3GTMB 2XN9C 1Z7TA 1STNA 4Q5VA 1A15A 3PUYA 3NK9A 3K5LA 2E76C 5D14A 4A3BB 2NVXB 4KKTA 5EPJA 2QF7A 4L8JA 1ZEQX 4PMWA 2A69D 5M5YB 3MEHA 1HPCA 5DAUA 2RA4A 4J1MA 1BCPF 4QIWB 3M7NA 3QJYA 4IURA 4KY7A 1RTNA 1Y1VB 1HHVA 4DAPA 3VR3A 4ODGA 1E0BA 3J80E 5EKIA 4HTHA 4ZYSA 1H9KA 3HOUB 4DAYA 3AB9A 4IUUA 4C3HB 1FR3A 2H1EA 1DYQA 1II3A 5K36G 3NTIA 1NSNS 2NYZD 5IT9E 5JVH3 4HCEA 3HOYB 1LTTD 2FHTA 4OO1H 3VA7A 2OT2A 2VNUD 4FXDA 2WAQB 4PNYA 3BYYB 1QOHA 1I4QA 4H0LC 4H7BA 3T13A 1A3TA 1H9RA 1SMYC 3QWNA 1TS3A 4L6TB 3ND8A 3ONAB 4QCLA 2SNMA 3FVQA 5ELEA 1HQRD 2F3VA 1M4VA 5CMDA 2XSCA 4LAAA 3OWEB 5FK9C 2A6HC 2KCCA 4J8QA 1XYIA 3RLFA 2RKSA 4ZRZA 4KD4A 3TSSA 3W2DA 4IUVA 2HDMA 2L1BA 4ME5A 2X69A 2PYKA 3Q23A 4IN3A 2DY8A 3K59A 1TWHB 1FYCA 1PTOD 2K5DA 4H13C 1ICWA 2F0KA 5D3DA 1SNQA 1SNCA 2XIWA 3DMUA 1UEAB 4IALA 3C46A 3D6CA 3MC0B 4ULLA 1HFNA 4UAIA 2C9OA 2WINB 3D8GA 3JAME 3GTPB 4PMCA 1Z47A 4RA8A 2F0TA 3GO5A 1IYVA 4NW2A 5C0XI 4XDXA 1SE4A 4BA2I 4K8IA 2PMZB 1QNKA 3GD7A 3CRLC 1XXGA 3H3VC 3SK5A 4FVMA 3PO3B 3FMCA 5C3WA 2V4DA 5COYA 2BOSA 4HEDA 1BCPB 1SJHD 5CYUA 3PV0A 3RD4A 2F0DA 1F9QA 3P20A 1PRTF 1M8AA 1STYA 1BDOA 3PIO3 2NN6I 1QJOA 1B4OA 3CQZB 1VCIA 1EFID 2B2YA 2J0TD 1SYGA 1PDQA 1WTVA 2F0WA 4U673 4BBRB 1Q3LA 1VMPA 1A3VA 1HTPA 4FF4A 3VYTA 3NTHA 1SNOA 1OXXK 1JR0D 3VR4A 1IW7D 4ZK9B 2PNRC 4BA1I 4G7OC 1VF7A 2AQ3B 1G291 4CBVA 2K33A 5DM63 1HRJA 2N88A 3S14B 1SSOA 3LNNA 1RJTA 3EVQA 3NUCA 3TDQA 4IUPA 3A7AB 3NQTA 1STBA 4HMJA 1D5MC 2JA6B 4DXGA 4RFBA 1I4PA 3T56B 1J8IA 1WTOA 1G8ZD 2MHVA 3BG3A 1L0XB 1C48A 5DM73 1Y8NB 4X3UA 3K7AB 3A7LA 3MA2B 1W6JA 1O7YA 4FO2A 3R2TA 5HGTA 4C3IG 4KY6A 2WP8J 5ELFA 2B2UA 3C2PA 3QO2A 2BE5C 3TZDA 1NCVA 3GP7A 3U9OA 3RZOB 5M3FB 3RMHA 5CV9A 5I6YA 1FNWA 3CU7A 1IW7C 3I4NB 2O5JC 3C1FA 1CZWA 1A2UA 2ZXRA 1TY0A 5JPNC 5FOBB 5KIXA 2A6EC 2J7ZA 3CRKC 3A55A 3J81L 5KYLA 2PW7A 3DUZA 2R6GA 1ONLA 4HR7B 1V1PB 1I4XA 1S5BD 3DM1A 4RHSA 1QG7A 3BS1A 3OSOA 3GTKB 1STAA 1Z6HA 3NHHA 2NVQB 1TS2A 4DGZA 2G9HD 2EY1A 3OMGA 4QB4A 4O42A 1TIID 3FDTA 1G2SA 2E75C 4C3JB 3PO2B 3A8JE 1SNPA 3H94A 2I46A 1BBXC 3KF8A 5I6WA 4A3GB 2EOTA 4KV6A 5C0XH 4HMIA 3QOJA 1T5XD 2LFNA 3T51B 1PYWD 5FKAC 1B44D 3X3MA 4F88A 1L0YB 4KN4C 5NUCA 3S2HB 1RDPD 2M00A 5KRUA 2EXZA 3MXNA 3EA6A 1UNSA 3HOXB 2B8GA 2JE6I 4BBSB 3FPUB 2NB0A 1R9TB 2Q8IB 5IGEA 4A3FB 4XT3B 3PUVA 3CHBD 1E2VA 4ZAIA 1I4HA 2AQ1B 1LT3D 4XYOA 4KMUC 1DOKA 1RODA 2JXMB 3U9SA 5JPMC 3H91A 2EYLA 2WKDA 3FKIB 5I2YA 3RUZA 5CV8A 1F9PA 2F0QA 2F0VA 4MHEA 4C3HG 3TMEA 2B2WA 4KK7A 4A3KB 1IYUA 1CHQD 4B08A 5C5MA 4WRDA 3HKZB 2JSOA 2VB3X 5CGKA 5C6AA 1D2BA 4JBWA 1QB5D 4YIJA 3EJIA 1DOLA 5EKKA 3MFGA 3QIAA 5FO9B 2F0LA 1S5DD 1ILPA 1A3UA 1SFOB 3BVGA 1VMCA 5CR3A 3OIPA 5HURA 5IOCA 1XX8A 5E4WC 5LL6X 2QKIC 4R9WA 1PFMA 1G6ZA 1ZXTA 3GTLB 1UAPA 4CGYB 1ILQA 5JJZA 1JICA 2B2WC 4FF2A 1SYBA 2F3WA 2F0PA 2XWJB 2HCCA 2Z8LA 4A3EB 2B8FA 4IFDJ 3QG1A 4IUQA 2EYHA 1RD9D 2RQXA 3P1HA 3IKJA 4FXGC 1NUCA 3PIP3 3G6JB 1JWMD 1TWAB 2EYFA 2QEJC 2ZT9C 4B9XA 1B1ZA 5CV4A 1AEXA 1PTOF 3LWEA 2N55A 1WTXA 1JOKA 2OF1A 2NN6G 1HA5A 1D1KA 1EEID 1O78A 5CORA 3I91A 2BCOA 3VR2A 4PMBA 1CA6A 2EY6A 2PCFB 3R8BA 1BNZA 1ZYRC 2Z1CA 2H4OA 1AN8A 5JOBA 3KLRA 5IGDA 4G4KA 1PLFA 4IFDG 2K04A 3TP5A 1RHPA 5A2QL 4RKBA 2E2HB 2EYPA 3GTOB 3PUXA 1LO5D 2ENBA 4KTAA 4DFAA 1MSHA 2LS01 1STHA 4N9TA 2IX0A 1DXMA 3I3CA 2B2TA 1HTLD 5LHY1 1B50A 4K8JA 1KNEA 1F77A 3C3LA 1GHKA 3EFXD 5BN3A 1FNUA 3VYSA 1U4RA 3D31A 2LKVA 1GOZA 2L11A 4CJ0B 3LWUA 1CQFA 5C44B 4RWSC 5T1GA 1MBYA 2CVRA 3P7JA 4F87A 2A69C 1EQVA 1U4LA 4ZKBB 4OHJA 2IL8A 5LL6S 1F2LA 5IGGA 4XTCS 4NMZA 3G7LA 1EY5A 3K5OA 5JEAH 3S1MB 2YU9B 3S17B 2IW3A 1H9SB 1H9JA 1NAPA 5A35A 2B2VA 2ZXPA 1AP0A 2X6GA 4HAEA 2D62A 3M3YB 2F0OA 5KNBA 1PZID 1BR9A 2MUYA 5F2DA 3J80L 1KTKA 3BDCA 3HOVB 3D4DA 3URYA 1PFNA 1I6VC 1QWYA 2YYZA 4R8IA 4PV1C 1CI3M 1IHZA 3Q0AA 1XTCD 2F0NA 2EJGC 1CTMA 3S1RB 5JVG3 1EIHA 1ENAA 1MGSA 5E1FA 5IT9L 3A8KE 3MFYA 5IODA 2KQ3A 4DAVA 4E6IA 3I90A 2KJXA 2VUMB 4ABNA 4XQQA 3NPPA 2B2VC 1JWSD 4QUFA 4BS9A 5C3EB 4K6DA 3WOFA 1S4ZA 1QE6A 3GTQB 1VDZA 5I2XA 1EZ8A 3T4AC 4K5XA 4BY7B 2KUMA 4IUTA 2RDFA 1U4MA 4RHRA 1WTPA 2K01A 4OO1G 2O4XA 4F8MA 5J39A 1WD0A 2ICIA 2EYJA 1PTOC 2A74C 4KJOA 2R93B 1Y8OB 3V96A 3L3OC 2M2LA 2TMPA 3R93A 3SE0A 1TKWB 3L7ZC 4DN4M 2PO4A 2B63B 1OXSC 2RDHA 2F0FA 1EWHA 4B9WA 1Q1EA 2E2DC 3NXWA 4K6LA 1TR5A 3DWAA 1OXTA 4EVOA 3OMCA 4WJWA 1K8OA 2PQEA 3HZXA 4A93B 1SYCA 2XWBB 3OWFA 2Y0SB 1A6XA 2PZUA 3S2DB 1KDCA 3LX0A 2NBFA 2B2YC 2IPKD 5FO7B 4OIKA 1RF2D 1EOTA 1WCMB 4DNRB 4A3IB 4EGVA 3JAML 4KKUA 3HS0C 1TT2A 2QILA 3WOEA 4TQUS 4XYQA 4RH6A 1X3PA 1HQMC 1LV9A 5C4HA 3GV3A 3O13A 1QILA 3SHLA 5EKLA 4KJNA 1LTID 4NKLA 5FLXE 1OXVA 2KA7A 4P2CB 1MI2A 4Z9CB 2F0SA 3S15B 5DEHA 2WACA 2Z4HA 3UI2A 2AWNA 4HN7A 3W3AA 3BVMA 2EYMA 3OW7A 2M9VA 2A73B 1BF4A 4A3MB 3M85A 1SNDA 5EPLA 1O80A 3DWPA 1B2TA 1EQTA 1TS5A 3D6WA 4KHZA 4WORA 3HP3A 2MGSA 3NWSA 2B2UC 4EQOA 2JYOA 4OIJA 3K5NA 4LJZC 2ICEC 3F2UA 3TN2A 1V1PA 3KLSX 1LTSD 5M3MB 3GQBA 1Q90A 4FXKC 4ILWA 2HQEA 5CBAE 1QNUA 4TSSA 2EY5A 4WFN3 1FNVA 1EU4A 3L9AX 3OHXC 4K2LA 4G57A 1STEA 3A8IE 1PRTB 1Q8IA 2HUGA 2ID0A 5EJWA 1TQOA 3S16B 1I6HB 1TY2A 4M8AA 2EJFC 3K0YA 2VXWA 5C4ZA 5I4DA 3E0JA 1NR2A 1Y8PB 1SBBB 1XWEA 5D65A 1E2ZA 1KDBA 4XQJA 1DM0B 2BA0A 1RTOA 2KVMA 3ND9A 2IWHA 1WVLA 1TWGB 4FYDA 2WB1B 1GUWA 4S3SA 4RCOA 2JP1A 5IIFA 1KDAA 5DNFA 3TP8A 2R3ZA 3NQIA 3NSWA 3MXPA 3M7GA 1LT4D 3E5SA 3H0GB 2SDFA 1ENCA 4XQNA 4MN3A 1PTOH 2XRQD 1EY7A 2RSOA 5C0XJ 4IUNA 4KD3A 2KEEA 1K83B 5G3LD 2FMMA 4RGNA 2OEOA 3I4LA 1BUVT 3RZDB 3K6OA 2ZXOA 2J4XA 1SJED 1CT1D 2KHSA 5K36H 1KNAA 1RCVD 3OIQA 1V1OA 4XXEA 1FD7D 1BOSA 1AZQA 3K57A 3FRPB 5KNDA 2F0IA 2Q8RE 5CV7A 4G7ZC 5CV5A 2D5DA 3D4RA 3V05A 4DU9A 3MTSA 1MD2D 2DNEA 4QMGA 2FINB 5ELDA 4JK1C 2QDBA 3BDOA 1I4GA 1W6KA 4RGMA 2L9HA 5C0XG 1HFGA 5KEEA 1CQVA 4C1NI 3MAQA 1GUOA 3H09A 5KGUA 1LACA 1PMRA 4BY1B 2VB2X 2XNAC 1EYDA 2IX3A 3PMFA 1JC7A 3C1EA 4K5VA 1U4PA 3DXJC 1SAPA 2MP1A 3HRZC 3HOWB 4KKSA 1GUNA 1PZKD 1B9MA 2NVYB 1I4RA 2NTTA 4CKEA 1JCKB 2SNSA 2EE1A 4X3TA 1SMYD 2FMCA 3TZUA 1AZPA 3HOZB 2QCPX 3J7AF 2EVBA 5J1ZA 1O7LA 1MSGA 3BYTB 2CHBD 3ZYYX 3SK4A 2TSSA 2EPBA 3Q24A 3VYUA 2E2IB 2NVTB 4M1UB 2RVLA 2A6HD 2BA1A 5AFWA 1JORA 1CM9A 1D1IA 1R4QB 3MWYW 1T5EA 2EY2A 3KLSA 3ITPA 1NR4A 3AU7A 2CQAA 1X32A 5CBEE 2F0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOM A;  2K01 A;  1WTP A;  1PDQ A;  1WTV A;  1Q3L A;  1DOK A;  1VMP A;  1ROD A;  1U4L A;  4ZKB B;  2L9H A;  3H91 A;  5D65 A;  3UI2 A;  1B3A A;  2IL8 A;  1WD0 A;  2DY8 A;  1F2L A;  2L12 A;  1X3Q A;  1HFG A;  2K05 A;  2RA4 A;  3G7L A;  1RTO A;  2KEC A;  1F9R A;  2KVM A;  3DM1 A;  3LWE A;  1WD1 A;  4IUR A;  1HUN A;  2N55 A;  3N52 A;  1RTN A;  1WTW A;  1WTX A;  2M2L A;  3KUP A;  1WVL A;  1F9P A;  1QG7 A;  4ZK9 B;  3DEO A;  3R93 A;  1HHV A;  5EPK A;  3IL8 A;  1E0B A;  1G2T A;  1IKM A;  5EQ0 A;  1GUW A;  2Q8T A;  1EL0 A;  1ML0 D;  1EIG A;  4DN4 M;  5COR A;  4CJ2 C;  1CA6 A;  5EKI A;  2JP1 A;  1CA5 A;  4MHE A;  3SVM A;  1HRJ A;  3I91 A;  2N88 A;  1ICW A;  1NAP A;  4IUU A;  5DNF A;  4O42 A;  1BF4 A;  3GV6 A;  2B2W A;  2H1E A;  2R3Z A;  2XIW A;  2B2V A;  3FDT A;  1G2S A;  1WTR A;  1PFB A;  1SSO A;  3IFD A;  5EPL A;  2X6G A;  1AP0 A;  1BNZ A;  3DEP A;  1O80 A;  1IL8 A;  1U4P A;  2B2T C;  4HAE A;  1RJT A;  2D9U A;  2L4N A;  1B2T A;  2SDF A;  1HFN A;  2NYZ D;  4UAI A;  1SAP A;  1DON A;  1O7Z A;  1EQT A;  3D6W A;  1TVX A;  4IUP A;  2MP1 A;  3HP3 A;  2MGS A;  1BBX C;  2KED A;  2B2U C;  4MN3 A;  4LMQ D;  1ESR A;  2JYO A;  2RSO A;  4OIJ A;  2K03 A;  1DOL A;  2FHT A;  2EOT A;  2KEE A;  1PLF A;  1PFN A;  2K04 A;  4RA8 A;  4R8I A;  3F2U A;  3TN2 A;  1ILP A;  1J8I A;  1DZ1 A;  1RHP A;  2FMM A;  3I8Z A;  4NW2 A;  1WTO A;  2EE1 A;  4XDX A;  1VMC A;  4X3T A;  4QUC A;  2FJ2 A;  1EIH A;  1XX8 A;  4HSV A;  5E4W C;  1QNK A;  1AZP A;  1MGS A;  2DY7 A;  3ONA B;  1MSH A;  4X3U A;  4ZLT F;  5CBA E;  1HUM A;  2MJ8 A;  2NWG A;  4R9W A;  1PFM A;  2B2Y C;  2K1B A;  1BO0 A;  2K28 A;  1MSG A;  2FFK B;  1ZXT A;  2B2T A;  1O7Y A;  3I3C A;  3I90 A;  1EOT A;  4OIK A;  1G6Z A;  1F9S A;  4ZKC B;  4X3S A;  1ILQ A;  5JJZ A;  5CMD A;  1JIC A;  4X3K A;  2B2W C;  4CJ1 B;  1B50 A;  1G91 A;  1J9O A;  2B2V C;  4RAU C;  2BDN A;  4QUF A;  1KNA A;  2B2U A;  1KNE A;  2EPB A;  5COY A;  1C8C A;  1X3P A;  4HED A;  2CVR A;  2HCC A;  5T1I A;  3QO2 A;  3TZD A;  1NCV A;  2X6L A;  2HCI A;  1AZQ A;  1S4Z A;  5E4X A;  1LV9 A;  2HDL A;  2NZ1 D;  3FPU B;  3GV3 A;  2HUG A;  2RVL A;  1SDF A;  1QE6 A;  5EJW A;  5AFW A;  1XYI A;  4XT1 B;  1CM9 A;  3Q6S A;  1F9Q A;  2Q8R E;  1M8A A;  1U4R A;  4HCS A;  3MWY W;  2MPM A;  1JE4 A;  1IKL A;  4IUQ A;  1B53 A;  2KUM A;  4IUV A;  2L11 A;  1NR4 A;  2HDM A;  3MTS A;  1A15 A;  4IUT A;  4XT3 B;  2L1B A;  1B4O A;  1WTQ A;  4CJ0 B;  2FIN B;  2KOL A;  2VXW A;  2RSN A;  1MI2 A;  1NR2 A;  2B2Y A;  1U4M A;  4RWS C;  5D14 A;  5T1G A;  4ZAI A;  1HA6 A;  4U68 A;  2J7Z A;  3KBX A;  1X32 A;  5EPJ A;  5CBE E;  3P7J A;  2X69 A; 
#chains in the Genus database with same CATH topology
 4A3L H;  2DNC A;  1F2Z A;  1LT6 D;  2R7Z B;  2Z6K C;  1K8M A;  4Q0F A;  3U58 A;  3I73 A;  3BJU A;  1X3Q A;  1SYF A;  2R93 G;  4FDB A;  2EZV A;  1DCZ A;  5EAY A;  5E3F A;  1TWF B;  4L63 B;  3IFT A;  3DEO A;  1HNW L;  1XNQ Q;  4GKK L;  3IL8 A;  3CCM A;  1G2T A;  2K6A A;  2Q8T A;  1SYD A;  2IJ0 A;  1EIG A;  3CCL A;  1EL0 A;  4CJ2 C;  2CW0 D;  1VQI A;  5IP9 H;  2B63 G;  2I07 B;  5I9O A;  3SVM A;  4LF6 Q;  1I50 H;  2BH8 A;  2PNH A;  3FEW X;  4AYB E;  1S40 A;  2YTV A;  3BVZ A;  2R61 A;  1IL8 A;  2B2T C;  1NY4 A;  1JQY D;  2D9U A;  2L4N A;  5IGF A;  3E6Z X;  3J7A V;  1IBL L;  5C4X B;  1DON A;  1O7Z A;  4QGU A;  2Q2I A;  3EQL C;  3OW2 A;  5KYI A;  2Z4I A;  1EY9 A;  4K2K A;  4R4Q A;  4Y7N H;  3M4Y A;  1YJW A;  3R2I A;  1K3B C;  1XMO Q;  3NTK A;  1I6H H;  5FJ8 H;  1CUK A;  4LFA L;  1QZG A;  4CDC C;  4A93 G;  1STG A;  1SYE A;  1XTD A;  2Y0S G;  5LMN W;  2JA7 B;  2F0H A;  1E24 A;  5CC4 A;  1LTB D;  1SR3 A;  1TS4 A;  1H9S A;  1WCM G;  4A3I G;  4X6A H;  1N34 L;  3K5M A;  3NBI A;  1VQJ A;  2VQE Q;  2BDO A;  2LY7 A;  1J9O A;  4B3M Q;  4RAU C;  1HCZ A;  1HXY D;  1ESF A;  4V0B A;  1F2Y A;  1NMF A;  4CKC A;  4IQZ A;  4B3R Q;  3PUW A;  3SXH A;  1S5E D;  2HDL A;  4A3D B;  2F0M A;  1EEF D;  4A3C H;  1GJX A;  1SDF A;  1X56 A;  2K32 A;  3MVV A;  2UXB L;  1JT8 A;  4XT1 B;  4KN7 C;  1TWG H;  3B6Y A;  5M5W H;  5GAG C;  4DR6 Q;  4HCS A;  3J80 c;  3F2B A;  1IKL A;  1YEZ A;  3S1N H;  1XPR A;  1WTQ A;  1AFP A;  2CW0 C;  2RSN A;  1B3Q A;  3IAY A;  3SR1 A;  4AH6 A;  1RKN A;  4LWC A;  1K8G A;  4C2M B;  1DOM A;  1JWU D;  1SNM A;  4HID A;  5M5X B;  1PTO B;  5IT9 c;  4BWG B;  2K7V A;  4O1N A;  2PPB C;  3A54 A;  2QDL A;  2JEB I;  5C4J B;  1UE5 A;  4C3I H;  2HD3 A;  2PQA A;  2KEC A;  5JEA J;  1WD1 A;  5I9P A;  3RN2 A;  1BCP D;  4X62 Q;  1WTW A;  3KUP A;  4JI4 Q;  2R92 H;  1JOQ A;  3J7A 5;  1IKM A;  1ML0 D;  2C5C A;  2L55 A;  3ER0 A;  2WFW A;  1CA5 A;  3A56 A;  2F0E A;  3T1Y Q;  4K14 A;  4G7H C;  4A3J H;  4A3M G;  2UUB L;  3CC4 A;  2JA8 B;  3RR5 A;  1GUT A;  1PFB A;  1UUP A;  2PZT A;  3CAM A;  5TSS A;  1Y1W H;  4DK6 C;  1N32 L;  1FL0 A;  3CME A;  4MTN A;  5CV6 A;  4FF3 A;  4RKL A;  2E2J B;  2XTI A;  2F4V L;  3BZD B;  2KED A;  3CKI B;  1ESR A;  4CKB A;  3AMU A;  2GA4 B;  3GTG H;  2PZW A;  2WKC A;  4EQP A;  5D3I B;  3I4M B;  5M3M G;  2K50 A;  4ID6 A;  4C56 C;  2OTL A;  3MEF A;  4C3J G;  2B3G A;  1SXT A;  4QF4 A;  3ERQ A;  4HSV A;  3T53 B;  4ZLT F;  1AE2 A;  5BN5 A;  5ELC A;  3D3R A;  1YHQ A;  2K1B A;  2K4K A;  2K28 A;  1MJE A;  4O2D A;  2IX1 A;  1DJR D;  4X3S A;  3VA5 A;  1VQF A;  3DWQ A;  4X3K A;  1DD2 A;  1A2T A;  1G91 A;  3GTJ B;  1XPO A;  1VQ7 A;  1WJJ A;  5T1I A;  1EFW A;  5IP7 H;  4KHV A;  5JEA G;  3J81 E;  2I0Q A;  4GS3 A;  2BE5 D;  5BR8 Q;  5E4X A;  1YZ6 A;  2NZ1 D;  5ELB A;  3MXG A;  3Q6S A;  4FF1 A;  3NE5 B;  1BCP C;  1L1O A;  1VQ4 A;  1EU3 A;  1Y69 U;  2A68 D;  2K5Q A;  3Q22 A;  4IFD I;  1NJI C;  1WOC A;  3J80 i;  2AUJ D;  1S3O A;  2A6E D;  3HKS A;  3TP6 A;  3CD6 A;  1LTG D;  2ATW A;  4ZUJ A;  1LTL A;  1FGB D;  1TWC H;  3M4O B;  4YHH Q;  1X54 A;  3PQI A;  2B39 A;  4QIW E;  2WII B;  5EBD A;  5C3X A;  3HOW H;  2ZTC A;  1IXR A;  1LAB A;  2L12 A;  5M9O A;  4RGO S;  1I3Q H;  4R4I A;  3JAM c;  2CWP A;  2NVY H;  1EYA A;  1F9R A;  1SN8 A;  2F4I A;  2JA5 B;  3K58 A;  1HUN A;  3J7Y W;  2F3I A;  2WB1 G;  4TKO B;  2XVS A;  1YNJ D;  4DUY Q;  4DR2 Q;  5J22 A;  1LTR D;  3KK7 A;  4UPA A;  1A0I A;  2MFI A;  3VYR A;  1HZC A;  3S9W A;  3GTM H;  3GV6 A;  3S1Q B;  1WTR A;  1L1O C;  3NEL A;  1KRS A;  4MNO A;  3H0G G;  3OOC A;  3DEP A;  1PYB A;  4A3B H;  2NVX H;  4R4O A;  2K5W A;  4ZCK A;  2HT1 A;  2WAQ E;  5M5Y H;  1QCB D;  1EYC A;  5G3L F;  1PVO A;  1CK1 A;  1EWC A;  1H95 A;  1F2M A;  4CHT B;  1CKM A;  1PZJ D;  1Y1V H;  1VQE A;  2FJ2 A;  3M4P A;  3G4S A;  4PZ8 A;  1A62 A;  3SEB A;  1EY8 A;  2A68 C;  1SEB D;  1PXU A;  1CHP D;  1BO0 A;  1C4Q A;  3HOU H;  1F9S A;  4C3H H;  4DR5 Q;  4I65 A;  3H6M A;  3QOL A;  5FO8 B;  3RLO A;  1Q7Y C;  1TU2 B;  3EBE A;  1ENF A;  1LT5 D;  4GN5 A;  2F0G A;  3V2T A;  4DV6 L;  1C8C A;  3I2Z A;  1V8Q A;  5GRO A;  3K80 C;  2HCI A;  2UUC L;  1LUZ A;  2G9D A;  3MHB A;  1SE2 A;  3HOY H;  4N9P A;  2ZTE A;  4EQN A;  4DV2 Q;  1BXT A;  1VQB A;  5LMN L;  4DR1 Q;  4KY5 A;  4ZQ3 A;  1I50 B;  1JJG A;  1PRT D;  1Q46 A;  2OXP A;  1EIY B;  1PYS B;  1JE4 A;  5EGT A;  1B53 A;  1YNJ C;  1KLG D;  2ZJR A;  2Q2U A;  4K0K L;  4F7X A;  1S5F D;  2I5L X;  4U68 A;  4UP7 A;  3KBX A;  2XRS D;  3SK6 A;  1JOO A;  3KF8 B;  1E22 A;  4P74 A;  4Y7N B;  1B3A A;  1SE3 A;  1VF5 C;  2O2L D;  3CCU A;  1HR0 W;  1BQQ T;  1JMC A;  3FPP A;  2K05 A;  2GVB A;  1LTA D;  3MXU A;  2L5T A;  5C5L A;  4OON A;  4DK1 A;  5FLX L;  2KHI A;  3VR5 A;  1GUG A;  4PZ7 A;  1AW7 A;  3JAM i;  2EDG A;  4IJL A;  5EBC A;  1E2W A;  4DK0 A;  2JK8 A;  4BY1 G;  2AWO A;  3OTO Q;  2AUK A;  1SE8 A;  2WV6 D;  4NDX A;  4RCN A;  1HZB A;  4K5W A;  4LF7 Q;  3R3O A;  3IFD A;  3MXN B;  5KNC A;  3I72 A;  1LLR D;  3T1H Q;  1H9M A;  2ZJP A;  2IT1 A;  4AYB B;  1EY4 A;  2NTS A;  2RBM A;  1ET9 A;  1TVX A;  2LSS A;  1S5C D;  5BN4 A;  4LK1 C;  4IPG A;  2F1M A;  2EJM A;  2O5I C;  1NMG A;  5M5W B;  1Q12 A;  3GDE A;  4TRD A;  3PF4 A;  4OO1 I;  1GUS A;  1TWH H;  2PMZ E;  3I8Z A;  1EIF A;  3S1N B;  4UY8 C;  3ULL A;  1VQ8 A;  2E74 C;  1YNN D;  5JAV A;  4FP5 D;  2A5H A;  1PH9 A;  2UXD Q;  4JI0 L;  3HOZ G;  1ET6 A;  4AQY L;  1PRT C;  2NN6 H;  1HUM A;  2MJ8 A;  4KHP L;  1FJG Q;  5IYC G;  4HSP A;  2FFK B;  2DN8 A;  4DXF A;  5K5P A;  3D4W A;  2FXQ A;  3TBI B;  2DJF C;  3KBG A;  4CJ1 B;  2EQS A;  4C3I B;  3N6R A;  1N33 Q;  5ISR A;  3QB3 A;  1GXD C;  2QEX A;  1SMX A;  2X6L A;  3NP8 A;  2KCN A;  2R92 B;  3E3X A;  1HNZ Q;  4IZ8 A;  1NBW A;  5IYD H;  3HG9 A;  2ZM6 L;  3P75 A;  4OL7 A;  1Q1B A;  3SK8 A;  4IFD H;  1D5X C;  2MPM A;  3ERO A;  4A3J B;  1CKN A;  1KLU D;  1KAB A;  2HHH L;  3F8T A;  2VZA A;  4JI1 Q;  1EY6 A;  2KOL A;  1Y1W B;  2OQK A;  4OGQ C;  4KI0 A;  1HA6 A;  3TP7 A;  2F0U A;  4DR4 Q;  3T16 A;  1JB3 A;  1KAA A;  1HZ9 A;  2R7Z G;  3DHQ A;  4ZUI A;  1A63 A;  1V43 A;  2NUC A;  2RDG A;  3GTG B;  4DNT B;  3CF5 A;  3PO3 H;  4YCU A;  4V19 0;  4UDU C;  1EUJ A;  3ZJY C;  3F2C A;  1U9R A;  4NP5 A;  1B8A A;  4DF7 A;  3N52 A;  1EZ6 A;  1HH2 P;  1OO9 B;  1B9N A;  5EPK A;  2EYO A;  5EQ0 A;  4KLK A;  4I7Z C;  4IJH A;  1K9M C;  2E8G A;  3OPO A;  2D2C C;  1ZKO A;  3MZ5 A;  2RCF A;  1YNN C;  2F03 A;  1QVF A;  4GKJ Q;  1MJC A;  3BDL A;  5IYB G;  1HNX L;  5A2Q E;  2JA9 A;  5IWA Q;  3CQZ H;  4X66 Q;  5IGC A;  5C4X G;  4OEL B;  1ZYR D;  2NZO A;  2K52 A;  3HEJ A;  3GTJ H;  1CZG A;  3NWT A;  4LUZ A;  3VR6 A;  2D0O A;  3X3N A;  4J6H A;  3NBH A;  4GNX B;  4BBR H;  3KDF B;  4LMQ D;  1R4P B;  2A19 A;  1D5Z C;  2K03 A;  4JI6 Q;  4R8N A;  5FLM G;  1PH5 A;  1DZ1 A;  2JA7 G;  2LMC B;  1EY0 A;  2PW5 A;  4XIG S;  4QUC A;  2L0C A;  1KD1 C;  4DV5 Q;  4UP8 A;  3HGB A;  2DY7 A;  3PUZ A;  4JI3 L;  1CFM A;  2NWG A;  4PQX A;  1TWC B;  4C1N K;  1GHJ A;  2JEA I;  2UUA L;  3S14 H;  4ZKC B;  4H44 C;  4MIU A;  3EIV A;  5IGB A;  4DV3 L;  2LXJ A;  1BVS A;  1I3Q B;  2BDN A;  4RGT A;  3UDX A;  1C0A A;  3WDN A;  4GZY C;  1P8L A;  3SDZ A;  2PI2 E;  4JI2 L;  2AQ2 B;  4DA2 A;  1OXU A;  4A3D G;  2SEB D;  2KBN A;  2VQF Q;  1UWV A;  2JA6 H;  1D6E C;  4NXM Q;  3G6E A;  1XNR Q;  3I70 A;  4FNF A;  3KF6 B;  2SOB A;  3GTM B;  4DV1 Q;  2XN9 C;  1Z7T A;  3OYY A;  1STN A;  4Q5V A;  1A15 A;  3PUY A;  3NK9 A;  3K5L A;  3LGJ A;  2E76 C;  4H02 A;  5D14 A;  4A3B B;  4HJA A;  2V1C C;  2NVX B;  4KKT A;  5EPJ A;  2QF7 A;  2OWO A;  4L8J A;  1ZEQ X;  3PSI A;  4PMW A;  4LF8 L;  3K7A H;  1VS0 A;  2N8N A;  1PH8 A;  2A69 D;  1N36 Q;  5M5Y B;  4LFC L;  1ICF B;  1IBM L;  2AKW B;  3MEH A;  1HPC A;  5DAU A;  2RA4 A;  4J1M A;  1BCP F;  4QIW B;  3M7N A;  1WYD A;  3QJY A;  4IUR A;  3A0J A;  4KY7 A;  4GKK Q;  1RTN A;  2MNA A;  1Y1V B;  4CDD C;  1HHV A;  4OX9 Q;  4JPB W;  4DAP A;  3VR3 A;  3RZO H;  4ODG A;  1E0B A;  3J80 E;  2QW7 A;  1PV4 A;  5EKI A;  4HTH A;  4ZYS A;  1H9K A;  3HOU B;  4DAY A;  3AB9 A;  4IUU A;  3F1Z A;  3CCJ A;  4C3H B;  2JA8 G;  1FR3 A;  5JJL A;  2H1E A;  1D8L A;  1N8R C;  3I4N H;  1DYQ A;  1II3 A;  5K36 G;  3NTI A;  1NSN S;  2NYZ D;  1C9O A;  2R7F A;  5JVH 3;  5IT9 E;  4JYA Q;  4HCE A;  4LF9 L;  1UE1 A;  1HR0 L;  1DGS A;  4JI7 L;  3HOY B;  1LTT D;  2FHT A;  4OO1 H;  3VA7 A;  2E5L L;  2OT2 A;  4LFA Q;  4QY7 A;  2VNU D;  3I4M G;  1YHB A;  4FXD A;  2WAQ B;  4PNY A;  3BYY B;  1QOH A;  1I4Q A;  4H0L C;  4H7B A;  3T13 A;  1A3T A;  1H9R A;  1N9W A;  4IPH A;  1SMY C;  3QWN A;  2RCN A;  1TS3 A;  3NEM A;  4L6T B;  5LMU Q;  1L2F A;  3GTK H;  2DUD A;  3ND8 A;  3ONA B;  2NVQ H;  4QCL A;  1N34 Q;  3UE1 A;  2SNM A;  3FVQ A;  5ELE A;  3CPW A;  1HQR D;  2F3V A;  4GLX A;  1M4V A;  5CMD A;  2XSC A;  2MO0 A;  4LF5 Q;  1VQ5 A;  3PO2 H;  4DR3 L;  4LAA A;  2CKZ B;  1JB7 A;  4DV0 L;  2UXB Q;  4X65 L;  3OWE B;  5FK9 C;  2A6H C;  2KCC A;  4A3G H;  4J8Q A;  1XYI A;  3RLF A;  1VQM A;  2RKS A;  4ZRZ A;  4IPC A;  1Q82 C;  4KD4 A;  3TSS A;  3W2D A;  4IUV A;  2HDM A;  2L1B A;  2D0P A;  4ME5 A;  2KCM A;  2DGY A;  4OWT B;  2X69 A;  1J6Q A;  2PYK A;  3Q23 A;  1Q86 C;  4LF6 L;  4IN3 A;  3S2H H;  2DY8 A;  4UP9 A;  3K59 A;  2KCT A;  1TWH B;  2JA5 G;  1FYC A;  1PTO D;  2UXC L;  3U4Z A;  3HOX H;  1AE3 A;  4NPS A;  4ME3 A;  4BBS H;  1R9T H;  2K5D A;  3EN2 A;  4H13 C;  1XMO L;  1ICW A;  2F0K A;  5D3D A;  1SNQ A;  1SNC A;  1V9P A;  3HKZ E;  2XIW A;  1X3E A;  3DMU A;  4A3F H;  1UEA B;  4IAL A;  1N32 Q;  3C46 A;  3D6C A;  3MC0 B;  2F4V Q;  4ULL A;  1HFN A;  4UAI A;  2C9O A;  2WIN B;  3U4V A;  3D8G A;  2B29 A;  3BU2 A;  3W1G A;  4N8F A;  3I55 A;  3JAM E;  3GTP B;  2VQE L;  4PMC A;  1Z47 A;  3FKI H;  4RA8 A;  2F0T A;  3GO5 A;  4TVA B;  1BBW A;  1UE7 A;  1IYV A;  4NW2 A;  3K0X A;  5C0X I;  4XDX A;  1SE4 A;  4BA2 I;  4K8I A;  2PMZ B;  1QNK A;  4JG2 A;  3GD7 A;  3CRL C;  4P73 A;  4A3L G;  1XXG A;  3H3V C;  3UDF A;  3SK5 A;  4FVM A;  4A3K H;  1OTC A;  3PO3 B;  2H5X A;  2QGQ A;  3FMC A;  5C3W A;  2V4D A;  5COY A;  2BOS A;  3CP0 A;  2YV5 A;  4HED A;  4JC0 A;  1BCP B;  1SJH D;  5CYU A;  3PV0 A;  3RD4 A;  2F0D A;  1CKO A;  5IP9 G;  1F9Q A;  3P20 A;  1PRT F;  2L15 A;  4DPG A;  1M8A A;  1STY A;  1BDO A;  3PIO 3;  2NN6 I;  1SFO H;  1QJO A;  1B4O A;  3CQZ B;  1G6P A;  1VCI A;  1EFI D;  2B2Y A;  4X64 Q;  2EXD A;  3H3V I;  2J0T D;  1SYG A;  3UE0 A;  3G48 A;  2OQ0 A;  1PDQ A;  1WTV A;  2F0W A;  4U67 3;  4BBR B;  1Q3L A;  4JVZ A;  1VMP A;  1KC8 C;  3PF5 A;  1A3V A;  1HTP A;  4FF4 A;  1E7Z A;  3VYT A;  3NTH A;  5FJ8 G;  1SNO A;  1E3P A;  1OXX K;  1JR0 D;  3VR4 A;  1IW7 D;  3RNU A;  3AYH B;  4ZK9 B;  2PNR C;  4BA1 I;  4G7O C;  4A3E H;  2ES2 A;  1VF7 A;  2AQ3 B;  1G29 1;  4P75 A;  4CBV A;  1L1O B;  4GN3 B;  3PIO A;  4B3S L;  4DV7 L;  2K33 A;  5DM6 3;  2R7D A;  2K5N A;  3PGZ A;  1HRJ A;  2N88 A;  2YTY A;  3S14 B;  1SSO A;  3LNN A;  4AYB G;  1RJT A;  3EVQ A;  1GD7 A;  3NUC A;  3TDQ A;  4JCV E;  1XMQ L;  4IUP A;  3A7A B;  3NQT A;  1TWA H;  1STB A;  4A3C G;  5JJK A;  4HMJ A;  1D5M C;  1QUQ B;  2Q2H A;  4OXP A;  2JA6 B;  1JE5 A;  1GO3 E;  1KXL A;  2HQL A;  4DXG A;  4RFB A;  1I4P A;  3S24 A;  3T56 B;  1J8I A;  1WTO A;  1G8Z D;  1YJN A;  1SRU A;  2MHV A;  3STB D;  1PH1 A;  4GLA C;  3BG3 A;  1L0X B;  1C48 A;  5BR8 L;  5DM7 3;  1Y8N B;  4X3U A;  1K8A C;  3K7A B;  3A7L A;  3MA2 B;  5J3B A;  1W6J A;  1O7Y A;  4FO2 A;  1NNX A;  4N8X 1;  4DV6 Q;  3R2T A;  5HGT A;  4C3I G;  4KY6 A;  4B3T Q;  2WP8 J;  5ELF A;  2B2U A;  4A4I A;  3C2P A;  2UU9 L;  4L5S A;  3QO2 A;  2BE5 C;  3TZD A;  3UDG A;  1JJ2 A;  1NCV A;  2R92 G;  3GP7 A;  3U9O A;  3RZO B;  5LMN Q;  5M3F B;  3RMH A;  5CV9 A;  3H15 A;  5I6Y A;  4YHH L;  1GM5 A;  2MQH A;  1FNW A;  3CU7 A;  4A3J G;  1IW7 C;  4K0K Q;  5GAH C;  3I4N B;  2O5J C;  1TXY A;  3C1F A;  1CZW A;  1A2U A;  2ZXR A;  1TY0 A;  5JPN C;  1Y1W G;  1K0R A;  5FOB B;  5KIX A;  2A6E C;  3GTO H;  2J7Z A;  3CRK C;  4DUY L;  3A55 A;  3J81 L;  3L0O A;  5KYL A;  2PW7 A;  3DUZ A;  2R6G A;  2ASB A;  1ONL A;  4HJ7 A;  1T9H A;  1PA6 A;  4HR7 B;  1V1P B;  1I4X A;  1S5B D;  3DM1 A;  4RHS A;  4OWX B;  2IHE A;  1YNX A;  1QG7 A;  3BS1 A;  3OSO A;  3GTK B;  1QVC A;  1STA A;  1Z6H A;  3A74 A;  3NHH A;  4YWK A;  2NVQ B;  1TS2 A;  4DGZ A;  4HJ9 A;  2NZH A;  2G9H D;  2EY1 A;  3OMG A;  4QB4 A;  4O42 A;  1TII D;  3FDT A;  1G2S A;  2E75 C;  4C3J B;  2CH4 W;  4DR7 L;  3PO2 B;  3A8J E;  1SNP A;  4L5T A;  3H94 A;  4NB3 A;  1I94 L;  1KIX A;  5IP7 G;  2G5D A;  1VQC A;  1B70 B;  2I46 A;  1BBX C;  1VQD A;  3KF8 A;  5I6W A;  4HIK A;  4A3G B;  1WFQ A;  2EOT A;  4KV6 A;  4DR5 L;  3ICE A;  1M90 C;  2AHO B;  5C0X H;  1YBY A;  4HMI A;  1VQL A;  1C7Y A;  4JI0 Q;  1RIP A;  3QOJ A;  2KEN A;  4DUZ L;  4JBK A;  1T5X D;  4KHP Q;  4O0A A;  2LFN A;  1IBK L;  2YU9 H;  3S1M H;  3T51 B;  5FLX c;  4LFB Q;  3S17 H;  3A5Z B;  1PYW D;  4DV2 L;  5FKA C;  1QVG A;  1B44 D;  3X3M A;  5HGQ A;  4F88 A;  1L0Y B;  3HOW G;  4WJ4 A;  4KN4 C;  5NUC A;  1VQK A;  1RDP D;  2M00 A;  3S2H B;  5KRU A;  4I7A A;  2EXZ A;  3MXN A;  3EA6 A;  3M3Y H;  1UNS A;  3HOX B;  2B8G A;  3CPF A;  2JE6 I;  4BBS B;  4JBJ A;  2ZM6 Q;  3FPU B;  2NB0 A;  1R9T B;  3HOV H;  1EQQ A;  2Q8I B;  5IGE A;  4YY3 L;  3W1B A;  3L2P A;  4A3F B;  1UE6 A;  3H3V H;  4XT3 B;  3PUV A;  3CHB D;  1XJV A;  3S1R H;  1E2V A;  3I7F A;  4A3B G;  1KQS A;  4ZAI A;  1I4H A;  2AQ1 B;  1LT3 D;  4XYO A;  5GAE C;  4KMU C;  1DOK A;  1ROD A;  2JXM B;  3U9S A;  5JPM C;  3H91 A;  2EYL A;  2WKD A;  2VUM H;  3FKI B;  5I2Y A;  3RUZ A;  3E9H A;  3GTP H;  4YCW A;  5C3E H;  5CV8 A;  4BXX H;  1Y1V G;  4RG1 A;  1F9P A;  1U0L A;  2F0Q A;  2F0V A;  4NXN L;  3GTQ H;  1CKN B;  3HOU G;  4JW0 A;  4MHE A;  4C3H G;  3TME A;  2B2W A;  4KK7 A;  4A3K B;  4BY7 H;  1IYU A;  1CHQ D;  4B08 A;  5C5M A;  4WRD A;  3HKZ B;  2JSO A;  2VB3 X;  5CGK A;  2UXD L;  5C6A A;  1D2B A;  4JI5 Q;  1X3F A;  4JBW A;  2A1A A;  1L0W A;  1QB5 D;  3TS0 A;  4YIJ A;  1FJG L;  3HOY G;  1A8V A;  3EJI A;  1DOL A;  3CXC A;  5EKK A;  3TS2 A;  3MFG A;  3K7U C;  3QIA A;  2WAQ G;  5FO9 B;  2F0L A;  1S5D D;  1ILP A;  1A3U A;  1W3S A;  2Y0S E;  1N33 L;  1YJ9 A;  2R93 H;  1SFO B;  3BVG A;  1VMC A;  5CR3 A;  3OIP A;  3WWV A;  5HUR A;  5GAD C;  5IOC A;  1XX8 A;  5E4W C;  1HNZ L;  5LL6 X;  2UUA Q;  1NE3 A;  1PHJ A;  2QKI C;  2DJG C;  1PFM A;  4R9W A;  1ASY A;  4DV3 Q;  1GKH A;  2B63 H;  3QR8 A;  4A75 A;  1ZXT A;  3CCV A;  3GTL B;  1G6Z A;  1UAP A;  4CGY B;  1ILQ A;  5JJZ A;  1JIC A;  2B2W C;  4FF2 A;  4JI2 Q;  2GN5 A;  1SYB A;  2F3W A;  4JI1 L;  2F0P A;  2XWJ B;  2Z6B A;  3NBH B;  2VL6 A;  2HCC A;  3TEH B;  2Z8L A;  4A3E B;  4QQB X;  4GNX A;  4L5Q A;  2B8F A;  3KDF A;  4IFD J;  3FHW A;  2RHQ B;  2XGT A;  2K14 A;  4LNQ A;  1CSQ A;  2JJQ A;  3QG1 A;  2BH2 A;  4IUQ A;  2EYH A;  1RD9 D;  2RQX A;  3P1H A;  4DK3 C;  4GOP B;  1PH6 A;  1P16 A;  3IKJ A;  4A93 H;  4FXG C;  1NUC A;  4LF8 Q;  3PIP 3;  3G6J B;  3TRZ A;  2OTJ A;  1JWM D;  3S2D H;  3CCE A;  1TWA B;  2EYF A;  4YWM A;  2QEJ C;  3VDY A;  2ZT9 C;  1IL2 A;  1KAW A;  4B9X A;  1B1Z A;  1WCM H;  2VW9 A;  4A3I H;  4GKJ L;  5IE8 A;  5CV4 A;  1AEX A;  1X6O A;  1PTO F;  5IWA L;  3LWE A;  2HIV A;  4OWW B;  1SRO A;  2N55 A;  1WTX A;  4QL5 A;  1JOK A;  2OF1 A;  2NN6 G;  1HA5 A;  1D1K A;  1EEI D;  1O78 A;  5COR A;  3CCS A;  3I91 A;  2BCO A;  3VR2 A;  3PIP A;  4PMB A;  3KF6 A;  1CA6 A;  2EY6 A;  2PCF B;  3R8B A;  1VQN A;  1BNZ A;  1ZYR C;  2VY3 A;  2Z1C A;  2Z6K A;  1FGU A;  1HZA A;  4HIM A;  4JI7 Q;  3S15 H;  2H4O A;  1HNW Q;  1AH9 A;  5IYD G;  1PFS A;  1AN8 A;  1UEB A;  5JOB A;  3KLR A;  5IGD A;  4DV4 L;  4JI8 L;  4G4K A;  1PLF A;  4IFD G;  5M3F H;  2K04 A;  1LYL A;  4JV5 L;  3TP5 A;  1RHP A;  1Z9F A;  5A2Q L;  4RKB A;  3HFZ B;  2E2H B;  3BZC A;  2ALY B;  2EYP A;  3K8A A;  1IBL Q;  3GTO B;  3PUX A;  1LO5 D;  2ENB A;  4KTA A;  4DAY B;  4DFA A;  1MSH A;  2VQF L;  2CQO A;  2LS0 1;  1STH A;  4N9T A;  4LF4 L;  2IX0 A;  4NXM L;  3KYH C;  1DXM A;  1WTH A;  2B2T A;  3CW2 C;  3I3C A;  1XNR L;  4IPD A;  1HTL D;  4DR3 Q;  4A3M H;  3PO3 G;  5LHY 1;  1B50 A;  4HJ8 A;  4K8J A;  1KNE A;  3D0F A;  1F77 A;  3C3L A;  1GHK A;  3EFX D;  5AJ3 L;  3CCQ A;  4HIO A;  5BN3 A;  4P72 A;  1FNU A;  3VYS A;  3SGI A;  1N36 L;  1U4R A;  1BKB A;  3D31 A;  2LKV A;  5M3M H;  1GOZ A;  2L11 A;  1J5E L;  4CJ0 B;  3LWU A;  1CQF A;  4C3J H;  5C44 B;  4RWS C;  5T1G A;  4OX9 L;  1MBY A;  2YTX A;  2CVR A;  3P7J A;  4F87 A;  4BBR G;  4DKA C;  2A69 C;  1EQV A;  1U4L A;  4ZKB B;  4OHJ A;  1Q8K A;  2IL8 A;  5LL6 S;  1F2L A;  5IGG A;  2UXC Q;  4XTC S;  4NMZ A;  3G7L A;  2AMC B;  1EY5 A;  2WB1 E;  3K5O A;  4JYA L;  4LW1 A;  1KRT A;  1SLJ A;  2JQO A;  5JEA H;  1EWI A;  3S1M B;  2YU9 B;  4POG A;  1VQA A;  3S17 B;  2IW3 A;  3S16 H;  1XNQ L;  1H9S B;  1H9J A;  1NAP A;  5A35 A;  2B2V A;  2ZXP A;  3AFQ A;  1AP0 A;  2X6G A;  4MZ9 A;  4HAE A;  4EX5 A;  2D62 A;  3M3Y B;  2F0O A;  1FVI A;  5LMU L;  1E1T A;  4DNI A;  5JJI A;  5KNB A;  1ASZ A;  5ELO A;  2N3S A;  1PZI D;  1BR9 A;  2MUY A;  5F2D A;  3TQY A;  2JA6 G;  3J80 L;  1KTK A;  3BDC A;  3HOV B;  3D4D A;  1PFN A;  1I6V C;  1QWY A;  3URY A;  2YYZ A;  4PG3 A;  4R8I A;  4PV1 C;  2UUB Q;  1CI3 M;  1IHZ A;  3Q0A A;  4LF5 L;  1WI5 A;  1XTC D;  2F0N A;  2EJG C;  4JOI A;  1CTM A;  3S1R B;  1YI2 A;  1W2B A;  5JVG 3;  2CFM A;  1EIH A;  1ENA A;  1MGS A;  5E1F A;  5IT9 L;  3A8K E;  3MFY A;  5IOD A;  2KQ3 A;  4DAV A;  1S72 A;  1K73 C;  4E6I A;  3I90 A;  2KJX A;  3J7Z C;  3CCR A;  2VUM B;  4ABN A;  4XQQ A;  3NPP A;  5L37 A;  2B2V C;  2PQA B;  1JWS D;  4QUF A;  3H0G H;  4BS9 A;  5C3E B;  2CCZ A;  4K6D A;  4B3M L;  2IHF A;  1E1O A;  1X55 A;  3WOF A;  1S4Z A;  5GQO A;  5M3F G;  2EIF A;  1QE6 A;  1Y14 B;  3ULJ A;  1VDZ A;  3GTQ B;  3CC7 A;  4MTK A;  5I2X A;  1MIU A;  4B3R L;  1EZ8 A;  3T4A C;  1K83 H;  1VQO A;  3I4N G;  4K5X A;  4BY7 B;  2KUM A;  4IUT A;  2RDF A;  4DR6 L;  4EQ5 A;  4J15 A;  4JOI C;  1U4M A;  3A5U A;  1BBU A;  4RHR A;  1WTP A;  2K01 A;  2CWA A;  3RZD H;  4OO1 G;  2O4X A;  3Q8D A;  4F8M A;  5J39 A;  1WD0 A;  2QA4 A;  2ICI A;  2EYJ A;  1PTO C;  2A74 C;  4KJO A;  3I4O A;  1Y8O B;  3AQQ A;  2R93 B;  1GVP A;  3V96 A;  4B3S Q;  3L3O C;  2M2L A;  4DV7 Q;  2TMP A;  3R93 A;  3SE0 A;  4X62 L;  3TRE A;  1TKW B;  3L7Z C;  4DN4 M;  4JI4 L;  2PO4 A;  4R1J A;  2B63 B;  1OXS C;  4LUV A;  2RDH A;  2F0F A;  1XMQ Q;  3T1Y L;  3GTL H;  1EWH A;  3PO2 G;  4B9W A;  1Q1E A;  1EOV A;  4ALP A;  4YWL A;  2E2D C;  3M4Q A;  3NXW A;  4K6L A;  1TR5 A;  3DWA A;  4A3G G;  3KJP A;  1OXT A;  3KLW A;  4EVO A;  3OMC A;  4WJW A;  1K8O A;  2PQE A;  3HZX A;  2MO1 A;  4A93 B;  1SYC A;  2XWB B;  3OWF A;  4RMF A;  2Y0S B;  1A6X A;  2PZU A;  2IY5 B;  3S2D B;  1X9N A;  1KDC A;  3LX0 A;  2NBF A;  3NEN A;  2B2Y C;  2IPK D;  1EQR A;  5FO7 B;  4BY1 H;  1V1Q A;  4OIK A;  1RF2 D;  1EOT A;  1WCM B;  4DNR B;  4IOC A;  4EGV A;  3JAM L;  4A3I B;  4KKU A;  3HS0 C;  1TT2 A;  2QIL A;  3WOE A;  3BZK A;  4TQU S;  4XYQ A;  4RH6 A;  2UU9 Q;  3AEV A;  4X64 L;  1X3P A;  3HOX G;  4BBS G;  1HQM C;  4WJ3 M;  1LV9 A;  5C4H A;  3GV3 A;  3O13 A;  2GVA A;  1QUQ A;  1CSP A;  3W5O A;  1QIL A;  5H1S E;  3SHL A;  2CH4 A;  5EKL A;  4KJN A;  3E9I A;  1LTI D;  4A3F G;  4NKL A;  2K5V A;  5FLX E;  1OXV A;  2KA7 A;  1G51 A;  4P2C B;  1MI2 A;  4Z9C B;  2F0S A;  3HOZ H;  3S15 B;  2LXK A;  2UUC Q;  5DEH A;  2WAC A;  2Z4H A;  5IYC H;  3UI2 A;  3G71 A;  3FKI G;  2AWN A;  4GLV B;  4AIM A;  4HN7 A;  3W3A A;  3BVM A;  2E2I H;  2EYM A;  3OW7 A;  1IZ6 A;  2E2H H;  2NVT H;  2PI2 A;  2M9V A;  3RLN A;  2N49 A;  4DR2 L;  2A73 B;  4A3K G;  4DR7 Q;  1X65 A;  1BF4 A;  1I94 Q;  4A3M B;  3M85 A;  1SND A;  5EPL A;  3CMA A;  1O80 A;  3HKZ G;  5ELN A;  3DWP A;  1B2T A;  4R4T A;  1EQT A;  1TS5 A;  3D6W A;  4KHZ A;  4WOR A;  4L5R C;  3HP3 A;  2Q2T A;  2MGS A;  3NWS A;  2B2U C;  4EQO A;  2R7Z H;  2JYO A;  4OIJ A;  3K5N A;  4LJZ C;  3J81 c;  2ICE C;  1PH3 A;  3F2U A;  3TN2 A;  1V1P A;  4DUZ Q;  4B3T L;  3KLS X;  1LTS D;  5M3M B;  4Y52 H;  1VQG A;  1TWF H;  2ZTD A;  3STB C;  1PH4 A;  1IBK Q;  3GQB A;  1Q90 A;  4FXK C;  4ILW A;  2HQE A;  5IY0 A;  5CBA E;  5C44 H;  1QNU A;  4TSS A;  2EY5 A;  1HJP A;  2RHS B;  2I5M X;  1VQ6 A;  4WFN 3;  2C35 B;  5IYB H;  1FNV A;  1EU4 A;  3L9A X;  1M1K C;  3OHX C;  4K2L A;  3ULP A;  2I5H A;  1STE A;  3A8I E;  4G57 A;  5C4X H;  1EYG A;  3J81 j;  4HJ5 A;  1PRT B;  4A3E G;  4AQY Q;  1Q8I A;  2OCE A;  2HUG A;  2ID0 A;  5EJW A;  1TQO A;  4YY3 Q;  1YIJ A;  3S16 B;  1I6H B;  1TY2 A;  4GN4 B;  2KHJ A;  1MHW C;  4M8A A;  5FLM H;  3CC2 A;  1K0S A;  3KFU A;  4DR1 L;  2EJF C;  3K0Y A;  4OEM B;  2VXW A;  5C4Z A;  5I4D A;  1PH7 A;  2JA7 H;  3E0J A;  1NR2 A;  1Y8P B;  1SBB B;  2Z9H A;  4PZ6 A;  1K3R A;  1XWE A;  1YVC A;  4LUO A;  5D65 A;  3RN5 A;  2HIX A;  1E2Z A;  1KDB A;  4XQJ A;  1DM0 B;  2BA0 A;  1RTO A;  2KVM A;  3ND9 A;  2HHH Q;  2IWH A;  4NXN Q;  1WVL A;  3E0E A;  1TWG B;  4FYD A;  2WB1 B;  4A3D H;  1GUW A;  4S3S A;  4RCO A;  2JP1 A;  5IIF A;  1KDA A;  1O7I A;  3U50 C;  5DNF A;  3M9B A;  3TP8 A;  2R3Z A;  3NQI A;  3NSW A;  3OTO L;  3MXP A;  1NTG A;  4IO9 A;  3M7G A;  1LT4 D;  3E5S A;  3H0G B;  4LF7 L;  2SDF A;  1VQ9 A;  1ENC A;  2F52 A;  4XQN A;  3K81 C;  3T1H L;  4LFB L;  4C2M H;  4MN3 A;  1PTO H;  2XRQ D;  1EY7 A;  5M5X H;  2RSO A;  5C0X J;  4IUN A;  4KD3 A;  2KEE A;  3FP9 A;  3AFP A;  4A76 A;  1K83 B;  2N78 A;  5C4J H;  1HNX Q;  5G3L D;  2FMM A;  4RGN A;  2JN4 A;  3J81 i;  2OEO A;  3I4L A;  1BUV T;  3ERS X;  3RZD B;  3JC6 6;  3K6O A;  1MKH A;  2ZXO A;  2JA8 H;  4QJF A;  2J4X A;  1SJE D;  1CT1 D;  2KHS A;  5K36 H;  1KNA A;  5DLQ E;  3OIQ A;  1RCV D;  1V1O A;  1X3G A;  4XXE A;  1FD7 D;  3F2D A;  1BOS A;  2E2J H;  3DM3 A;  1AZQ A;  2ZJQ A;  3K57 A;  4JI3 Q;  3FRP B;  5KND A;  2F0I A;  2Q8R E;  5CV7 A;  4G7Z C;  5CV5 A;  4APV A;  3I4M H;  2D5D A;  2K5H A;  3D4R A;  3V05 A;  4DU9 A;  1D7Q A;  3MTS A;  1MD2 D;  2DNE A;  4QMG A;  2FIN B;  5C44 G;  4JBM A;  5ELD A;  4JK1 C;  4POF A;  1I5F A;  2QDB A;  3BDO A;  5HY6 A;  1I4G A;  1W6K A;  4RGM A;  1QZH A;  4YCV A;  4DR4 L;  2L9H A;  3KJO A;  5C0X G;  1U5K A;  3IRB A;  2A8V A;  1HFG A;  1K28 A;  5KEE A;  1CQV A;  4C1N I;  4JI5 L;  3MAQ A;  1GUO A;  4DAM A;  3H09 A;  3PCO B;  5KGU A;  1LAC A;  1PMR A;  1PH2 A;  4BY1 B;  2VB2 X;  2XNA C;  1KL9 A;  4LFC Q;  1EYD A;  2IX3 A;  1IBM Q;  1XPU A;  3PMF A;  1JC7 A;  4GOP A;  3C1E A;  4K5V A;  1U4P A;  3DXJ C;  1VQP A;  1SAP A;  4X66 L;  2MP1 A;  2Z0S A;  3HRZ C;  4DV4 Q;  4JI8 Q;  3HOW B;  4KKS A;  1GUN A;  3M4O H;  4JV5 Q;  3HOV G;  1PZK D;  1B9M A;  2NVY B;  1I4R A;  2NTT A;  4CKE A;  4GNX C;  4JI6 L;  1JCK B;  1KHI A;  2SNS A;  2JA5 H;  2VS1 A;  2EE1 A;  4X3T A;  1SMY D;  2FMC A;  4LF4 Q;  4UHV A;  3TZU A;  1AZP A;  3HOZ B;  1YHA A;  2QCP X;  4LF9 Q;  2EVB A;  3J7A F;  4R4C A;  2P5Z X;  1HR0 Q;  4DV5 L;  5J1Z A;  4CDE C;  1O7L A;  1MSG A;  3I56 A;  2E5L Q;  2VUM G;  3S1Q H;  3BYT B;  2CHB D;  3ZYY X;  1VQH A;  5E7N A;  3SK4 A;  5C3E G;  2TSS A;  5AJ3 Q;  4BXX G;  4GOP C;  2EPB A;  3UDI A;  1YIT A;  3Q24 A;  3VYU A;  4CDF C;  3DLL A;  2E2I B;  3KOJ A;  1LM0 A;  4IOA A;  2NVT B;  4M1U B;  2RVL A;  2A6H D;  2BA1 A;  5AFW A;  1JOR A;  1CM9 A;  1D1I A;  1R4Q B;  1JJC B;  3MWY W;  1RL2 A;  1T5E A;  2EY2 A;  1J5E Q;  4BY7 G;  3KLS A;  3ITP A;  1NR4 A;  1IYJ B;  3AU7 A;  4DV1 L;  1B7Y B;  2CQA A;  2K75 A;  4P71 A;  4DV0 Q;  1Q81 C;  1X32 A;  5CBE E;  2RF4 A;  2F0J A;  4X65 Q; 
#chains in the Genus database with same CATH homology
 2DNC A;  1F2Z A;  1LT6 D;  2R7Z B;  1K8M A;  4Q0F A;  3I73 A;  1X3Q A;  1SYF A;  2EZV A;  1DCZ A;  5E3F A;  1TWF B;  4L63 B;  3IFT A;  3DEO A;  3IL8 A;  1G2T A;  2K6A A;  2Q8T A;  1SYD A;  2IJ0 A;  1EIG A;  1EL0 A;  4CJ2 C;  2CW0 D;  2I07 B;  5I9O A;  3SVM A;  3FEW X;  3BVZ A;  2R61 A;  1IL8 A;  2B2T C;  2D9U A;  1JQY D;  2L4N A;  5IGF A;  3E6Z X;  3J7A V;  5C4X B;  1DON A;  1O7Z A;  3EQL C;  5KYI A;  2Z4I A;  1EY9 A;  4K2K A;  3M4Y A;  3R2I A;  3NTK A;  1STG A;  1SYE A;  2JA7 B;  2F0H A;  5CC4 A;  1LTB D;  1TS4 A;  1H9S A;  3K5M A;  3NBI A;  2BDO A;  2LY7 A;  1J9O A;  4RAU C;  1HCZ A;  1HXY D;  1ESF A;  4V0B A;  1F2Y A;  4CKC A;  4IQZ A;  3PUW A;  3SXH A;  1S5E D;  2HDL A;  4A3D B;  2F0M A;  1EEF D;  1GJX A;  1SDF A;  2K32 A;  3MVV A;  4XT1 B;  4KN7 C;  4HCS A;  1IKL A;  1WTQ A;  1AFP A;  2CW0 C;  2RSN A;  3IAY A;  3SR1 A;  1RKN A;  4C2M B;  1DOM A;  1JWU D;  1SNM A;  5M5X B;  1PTO B;  4BWG B;  2K7V A;  4O1N A;  2PPB C;  3A54 A;  2JEB I;  5C4J B;  2KEC A;  5JEA J;  1WD1 A;  5I9P A;  1BCP D;  1WTW A;  3KUP A;  1JOQ A;  1IKM A;  1ML0 D;  2C5C A;  2L55 A;  1CA5 A;  3A56 A;  2F0E A;  4K14 A;  4G7H C;  2JA8 B;  1GUT A;  1PFB A;  1UUP A;  2PZT A;  5TSS A;  5CV6 A;  4FF3 A;  4RKL A;  2E2J B;  3BZD B;  2KED A;  3CKI B;  1ESR A;  4CKB A;  3AMU A;  2GA4 B;  2PZW A;  2WKC A;  4EQP A;  5D3I B;  3I4M B;  4ID6 A;  4C56 C;  4C3J G;  1SXT A;  4QF4 A;  3ERQ A;  4HSV A;  3T53 B;  4ZLT F;  5BN5 A;  5ELC A;  3D3R A;  2K1B A;  2K28 A;  2IX1 A;  1DJR D;  4X3S A;  3VA5 A;  3DWQ A;  4X3K A;  1DD2 A;  1A2T A;  1G91 A;  3GTJ B;  5T1I A;  4KHV A;  5JEA G;  3J81 E;  2BE5 D;  5E4X A;  2NZ1 D;  5ELB A;  3MXG A;  3Q6S A;  4FF1 A;  3NE5 B;  1BCP C;  1EU3 A;  1Y69 U;  2A68 D;  2K5Q A;  3Q22 A;  4IFD I;  2AUJ D;  2A6E D;  3TP6 A;  1LTG D;  4ZUJ A;  1FGB D;  3M4O B;  2B39 A;  2WII B;  5EBD A;  5C3X A;  1LAB A;  2L12 A;  5M9O A;  4RGO S;  2JA5 B;  1EYA A;  1F9R A;  2F4I A;  3K58 A;  1HUN A;  3J7Y W;  4TKO B;  2XVS A;  1YNJ D;  5J22 A;  1LTR D;  3KK7 A;  3VYR A;  3S9W A;  3GV6 A;  3S1Q B;  1WTR A;  3OOC A;  3DEP A;  2K5W A;  1QCB D;  1EYC A;  5G3L F;  1CK1 A;  1EWC A;  1F2M A;  4CHT B;  1PZJ D;  2FJ2 A;  3SEB A;  1EY8 A;  2A68 C;  1SEB D;  1PXU A;  1CHP D;  1BO0 A;  1C4Q A;  1F9S A;  4I65 A;  3H6M A;  3QOL A;  5FO8 B;  1TU2 B;  1ENF A;  1LT5 D;  1C8C A;  3V2T A;  2F0G A;  1V8Q A;  2HCI A;  2G9D A;  3MHB A;  1SE2 A;  4N9P A;  4EQN A;  1BXT A;  4KY5 A;  4ZQ3 A;  1I50 B;  1PRT D;  2OXP A;  1JE4 A;  5EGT A;  1B53 A;  1YNJ C;  1KLG D;  4F7X A;  1S5F D;  4U68 A;  3KBX A;  2XRS D;  3SK6 A;  1JOO A;  4Y7N B;  1B3A A;  1SE3 A;  1VF5 C;  2O2L D;  1BQQ T;  3FPP A;  2K05 A;  1LTA D;  3MXU A;  2L5T A;  5C5L A;  4DK1 A;  5FLX L;  3VR5 A;  1GUG A;  1AW7 A;  2EDG A;  5EBC A;  1E2W A;  4DK0 A;  2AWO A;  2AUK A;  2WV6 D;  4NDX A;  4RCN A;  4K5W A;  3R3O A;  3IFD A;  5KNC A;  3I72 A;  1LLR D;  1H9M A;  2IT1 A;  4AYB B;  1EY4 A;  2NTS A;  2RBM A;  1ET9 A;  1TVX A;  1S5C D;  5BN4 A;  4LK1 C;  2F1M A;  2EJM A;  2O5I C;  5M5W B;  1Q12 A;  4TRD A;  4OO1 I;  1GUS A;  3I8Z A;  3S1N B;  2E74 C;  1YNN D;  5JAV A;  4FP5 D;  2A5H A;  1ET6 A;  1PRT C;  2NN6 H;  1HUM A;  2MJ8 A;  4HSP A;  2FFK B;  2DN8 A;  4DXF A;  5K5P A;  3D4W A;  3TBI B;  3KBG A;  4CJ1 B;  4C3I B;  3N6R A;  5ISR A;  3QB3 A;  1GXD C;  3NP8 A;  2X6L A;  2KCN A;  2R92 B;  4IZ8 A;  3HG9 A;  3P75 A;  4OL7 A;  1Q1B A;  3SK8 A;  4IFD H;  1D5X C;  2MPM A;  3ERO A;  4A3J B;  1KLU D;  1KAB A;  1EY6 A;  2KOL A;  1Y1W B;  4OGQ C;  4KI0 A;  1HA6 A;  3TP7 A;  2F0U A;  3T16 A;  1JB3 A;  1KAA A;  3DHQ A;  4ZUI A;  1V43 A;  2NUC A;  2RDG A;  3GTG B;  4DNT B;  4V19 0;  4UDU C;  1U9R A;  4NP5 A;  4DF7 A;  3N52 A;  1EZ6 A;  1OO9 B;  1B9N A;  5EPK A;  2EYO A;  5EQ0 A;  4I7Z C;  3OPO A;  2D2C C;  1ZKO A;  3MZ5 A;  1YNN C;  2F03 A;  3BDL A;  5A2Q E;  5IGC A;  1ZYR D;  3HEJ A;  1CZG A;  3NWT A;  3VR6 A;  3X3N A;  4J6H A;  3NBH A;  4LMQ D;  1R4P B;  1D5Z C;  2K03 A;  4R8N A;  1DZ1 A;  2LMC B;  1EY0 A;  2PW5 A;  4XIG S;  4QUC A;  2L0C A;  3HGB A;  2DY7 A;  3PUZ A;  1CFM A;  2NWG A;  4PQX A;  1TWC B;  4C1N K;  1GHJ A;  2JEA I;  4ZKC B;  4H44 C;  4MIU A;  5IGB A;  1I3Q B;  4RGT A;  2BDN A;  3WDN A;  4GZY C;  3SDZ A;  2AQ2 B;  4DA2 A;  1OXU A;  2SEB D;  1D6E C;  3I70 A;  4FNF A;  2SOB A;  3GTM B;  2XN9 C;  1Z7T A;  1STN A;  4Q5V A;  1A15 A;  3PUY A;  3NK9 A;  3K5L A;  2E76 C;  5D14 A;  4A3B B;  2NVX B;  4KKT A;  5EPJ A;  2QF7 A;  4L8J A;  1ZEQ X;  4PMW A;  2A69 D;  5M5Y B;  3MEH A;  1HPC A;  5DAU A;  2RA4 A;  4J1M A;  1BCP F;  4QIW B;  3M7N A;  3QJY A;  4IUR A;  4KY7 A;  1RTN A;  1Y1V B;  1HHV A;  4DAP A;  3VR3 A;  4ODG A;  1E0B A;  3J80 E;  5EKI A;  4HTH A;  4ZYS A;  1H9K A;  3HOU B;  4DAY A;  3AB9 A;  4IUU A;  4C3H B;  1FR3 A;  2H1E A;  1DYQ A;  1II3 A;  5K36 G;  3NTI A;  1NSN S;  2NYZ D;  5IT9 E;  5JVH 3;  4HCE A;  3HOY B;  1LTT D;  2FHT A;  4OO1 H;  3VA7 A;  2OT2 A;  2VNU D;  4FXD A;  2WAQ B;  4PNY A;  3BYY B;  1QOH A;  1I4Q A;  4H0L C;  4H7B A;  3T13 A;  1A3T A;  1H9R A;  1SMY C;  3QWN A;  1TS3 A;  4L6T B;  3ND8 A;  3ONA B;  4QCL A;  2SNM A;  3FVQ A;  5ELE A;  1HQR D;  2F3V A;  1M4V A;  5CMD A;  2XSC A;  4LAA A;  3OWE B;  5FK9 C;  2A6H C;  2KCC A;  4J8Q A;  1XYI A;  3RLF A;  2RKS A;  4ZRZ A;  4KD4 A;  3TSS A;  3W2D A;  4IUV A;  2HDM A;  2L1B A;  4ME5 A;  2X69 A;  2PYK A;  3Q23 A;  4IN3 A;  2DY8 A;  3K59 A;  1TWH B;  1FYC A;  1PTO D;  2K5D A;  4H13 C;  1ICW A;  2F0K A;  5D3D A;  1SNQ A;  1SNC A;  2XIW A;  3DMU A;  1UEA B;  4IAL A;  3C46 A;  3D6C A;  3MC0 B;  4ULL A;  1HFN A;  4UAI A;  2C9O A;  2WIN B;  3D8G A;  3JAM E;  3GTP B;  4PMC A;  1Z47 A;  4RA8 A;  2F0T A;  3GO5 A;  1IYV A;  4NW2 A;  5C0X I;  4XDX A;  1SE4 A;  4BA2 I;  4K8I A;  2PMZ B;  1QNK A;  3GD7 A;  3CRL C;  1XXG A;  3H3V C;  3SK5 A;  4FVM A;  3PO3 B;  3FMC A;  5C3W A;  2V4D A;  5COY A;  2BOS A;  4HED A;  1BCP B;  1SJH D;  5CYU A;  3PV0 A;  3RD4 A;  2F0D A;  1F9Q A;  3P20 A;  1PRT F;  1M8A A;  1STY A;  1BDO A;  3PIO 3;  2NN6 I;  1QJO A;  1B4O A;  3CQZ B;  1VCI A;  1EFI D;  2B2Y A;  2J0T D;  1SYG A;  1PDQ A;  1WTV A;  2F0W A;  4U67 3;  4BBR B;  1Q3L A;  1VMP A;  1A3V A;  1HTP A;  4FF4 A;  3VYT A;  3NTH A;  1SNO A;  1OXX K;  1JR0 D;  3VR4 A;  1IW7 D;  4ZK9 B;  2PNR C;  4BA1 I;  4G7O C;  1VF7 A;  2AQ3 B;  1G29 1;  4CBV A;  2K33 A;  5DM6 3;  1HRJ A;  2N88 A;  3S14 B;  1SSO A;  3LNN A;  1RJT A;  3EVQ A;  3NUC A;  3TDQ A;  4IUP A;  3A7A B;  3NQT A;  1STB A;  4HMJ A;  1D5M C;  2JA6 B;  4DXG A;  4RFB A;  1I4P A;  3T56 B;  1J8I A;  1WTO A;  1G8Z D;  2MHV A;  3BG3 A;  1L0X B;  1C48 A;  5DM7 3;  1Y8N B;  4X3U A;  3K7A B;  3A7L A;  3MA2 B;  1W6J A;  1O7Y A;  4FO2 A;  3R2T A;  5HGT A;  4C3I G;  4KY6 A;  2WP8 J;  5ELF A;  2B2U A;  3C2P A;  3QO2 A;  2BE5 C;  3TZD A;  1NCV A;  3GP7 A;  3U9O A;  3RZO B;  5M3F B;  3RMH A;  5CV9 A;  5I6Y A;  1FNW A;  3CU7 A;  1IW7 C;  3I4N B;  2O5J C;  3C1F A;  1CZW A;  1A2U A;  2ZXR A;  1TY0 A;  5JPN C;  5FOB B;  5KIX A;  2A6E C;  2J7Z A;  3CRK C;  3A55 A;  3J81 L;  5KYL A;  2PW7 A;  3DUZ A;  2R6G A;  1ONL A;  4HR7 B;  1V1P B;  1I4X A;  1S5B D;  3DM1 A;  4RHS A;  1QG7 A;  3BS1 A;  3OSO A;  3GTK B;  1STA A;  1Z6H A;  3NHH A;  2NVQ B;  1TS2 A;  4DGZ A;  2G9H D;  2EY1 A;  3OMG A;  4QB4 A;  4O42 A;  1TII D;  3FDT A;  1G2S A;  2E75 C;  4C3J B;  3PO2 B;  3A8J E;  1SNP A;  3H94 A;  2I46 A;  1BBX C;  3KF8 A;  5I6W A;  4A3G B;  2EOT A;  4KV6 A;  5C0X H;  4HMI A;  3QOJ A;  1T5X D;  2LFN A;  3T51 B;  1PYW D;  5FKA C;  1B44 D;  3X3M A;  4F88 A;  1L0Y B;  4KN4 C;  5NUC A;  3S2H B;  1RDP D;  2M00 A;  5KRU A;  2EXZ A;  3MXN A;  3EA6 A;  1UNS A;  3HOX B;  2B8G A;  2JE6 I;  4BBS B;  3FPU B;  2NB0 A;  1R9T B;  2Q8I B;  5IGE A;  4A3F B;  4XT3 B;  3PUV A;  3CHB D;  1E2V A;  4ZAI A;  1I4H A;  2AQ1 B;  1LT3 D;  4XYO A;  4KMU C;  1DOK A;  1ROD A;  2JXM B;  3U9S A;  5JPM C;  3H91 A;  2EYL A;  2WKD A;  3FKI B;  5I2Y A;  3RUZ A;  5CV8 A;  1F9P A;  2F0Q A;  2F0V A;  4MHE A;  4C3H G;  3TME A;  2B2W A;  4KK7 A;  4A3K B;  1IYU A;  1CHQ D;  4B08 A;  5C5M A;  4WRD A;  3HKZ B;  2JSO A;  2VB3 X;  5CGK A;  5C6A A;  1D2B A;  4JBW A;  1QB5 D;  4YIJ A;  3EJI A;  1DOL A;  5EKK A;  3MFG A;  3QIA A;  5FO9 B;  2F0L A;  1S5D D;  1ILP A;  1A3U A;  1SFO B;  3BVG A;  1VMC A;  5CR3 A;  3OIP A;  5HUR A;  5IOC A;  1XX8 A;  5E4W C;  5LL6 X;  2QKI C;  4R9W A;  1PFM A;  1G6Z A;  1ZXT A;  3GTL B;  1UAP A;  4CGY B;  1ILQ A;  5JJZ A;  1JIC A;  2B2W C;  4FF2 A;  1SYB A;  2F3W A;  2F0P A;  2XWJ B;  2HCC A;  2Z8L A;  4A3E B;  2B8F A;  4IFD J;  3QG1 A;  4IUQ A;  2EYH A;  1RD9 D;  2RQX A;  3P1H A;  3IKJ A;  4FXG C;  1NUC A;  3PIP 3;  3G6J B;  1JWM D;  1TWA B;  2EYF A;  2QEJ C;  2ZT9 C;  4B9X A;  1B1Z A;  5CV4 A;  1AEX A;  1PTO F;  3LWE A;  2N55 A;  1WTX A;  1JOK A;  2OF1 A;  2NN6 G;  1HA5 A;  1D1K A;  1EEI D;  1O78 A;  5COR A;  3I91 A;  2BCO A;  3VR2 A;  4PMB A;  1CA6 A;  2EY6 A;  2PCF B;  3R8B A;  1BNZ A;  1ZYR C;  2Z1C A;  2H4O A;  1AN8 A;  5JOB A;  3KLR A;  5IGD A;  4G4K A;  1PLF A;  4IFD G;  2K04 A;  3TP5 A;  1RHP A;  5A2Q L;  4RKB A;  2E2H B;  2EYP A;  3GTO B;  3PUX A;  1LO5 D;  2ENB A;  4KTA A;  4DFA A;  1MSH A;  2LS0 1;  1STH A;  4N9T A;  2IX0 A;  1DXM A;  3I3C A;  2B2T A;  1HTL D;  5LHY 1;  1B50 A;  4K8J A;  1KNE A;  1F77 A;  3C3L A;  1GHK A;  3EFX D;  5BN3 A;  1FNU A;  3VYS A;  1U4R A;  3D31 A;  2LKV A;  1GOZ A;  2L11 A;  4CJ0 B;  3LWU A;  1CQF A;  5C44 B;  4RWS C;  5T1G A;  1MBY A;  2CVR A;  3P7J A;  4F87 A;  2A69 C;  1EQV A;  1U4L A;  4ZKB B;  4OHJ A;  2IL8 A;  5LL6 S;  1F2L A;  5IGG A;  4XTC S;  4NMZ A;  3G7L A;  1EY5 A;  3K5O A;  5JEA H;  3S1M B;  2YU9 B;  3S17 B;  2IW3 A;  1H9S B;  1H9J A;  1NAP A;  5A35 A;  2B2V A;  2ZXP A;  1AP0 A;  2X6G A;  4HAE A;  2D62 A;  3M3Y B;  2F0O A;  5KNB A;  1PZI D;  1BR9 A;  2MUY A;  5F2D A;  3J80 L;  1KTK A;  3BDC A;  3HOV B;  3D4D A;  3URY A;  1PFN A;  1I6V C;  1QWY A;  2YYZ A;  4R8I A;  4PV1 C;  1CI3 M;  1IHZ A;  3Q0A A;  1XTC D;  2F0N A;  2EJG C;  1CTM A;  3S1R B;  5JVG 3;  1EIH A;  1ENA A;  1MGS A;  5E1F A;  5IT9 L;  3A8K E;  3MFY A;  5IOD A;  2KQ3 A;  4DAV A;  4E6I A;  3I90 A;  2KJX A;  2VUM B;  4ABN A;  4XQQ A;  3NPP A;  2B2V C;  1JWS D;  4QUF A;  4BS9 A;  5C3E B;  4K6D A;  3WOF A;  1S4Z A;  1QE6 A;  3GTQ B;  1VDZ A;  5I2X A;  1EZ8 A;  3T4A C;  4K5X A;  4BY7 B;  2KUM A;  4IUT A;  2RDF A;  1U4M A;  4RHR A;  1WTP A;  2K01 A;  4OO1 G;  2O4X A;  4F8M A;  5J39 A;  1WD0 A;  2ICI A;  2EYJ A;  1PTO C;  2A74 C;  4KJO A;  2R93 B;  1Y8O B;  3V96 A;  3L3O C;  2M2L A;  2TMP A;  3R93 A;  3SE0 A;  1TKW B;  3L7Z C;  4DN4 M;  2PO4 A;  2B63 B;  1OXS C;  2RDH A;  2F0F A;  1EWH A;  4B9W A;  1Q1E A;  2E2D C;  3NXW A;  4K6L A;  1TR5 A;  3DWA A;  1OXT A;  4EVO A;  3OMC A;  4WJW A;  1K8O A;  2PQE A;  3HZX A;  4A93 B;  1SYC A;  2XWB B;  3OWF A;  2Y0S B;  1A6X A;  2PZU A;  3S2D B;  1KDC A;  3LX0 A;  2NBF A;  2B2Y C;  2IPK D;  5FO7 B;  4OIK A;  1RF2 D;  1EOT A;  1WCM B;  4DNR B;  4A3I B;  4EGV A;  3JAM L;  4KKU A;  3HS0 C;  1TT2 A;  2QIL A;  3WOE A;  4TQU S;  4XYQ A;  4RH6 A;  1X3P A;  1HQM C;  1LV9 A;  5C4H A;  3GV3 A;  3O13 A;  1QIL A;  3SHL A;  5EKL A;  4KJN A;  1LTI D;  4NKL A;  5FLX E;  1OXV A;  2KA7 A;  4P2C B;  1MI2 A;  4Z9C B;  2F0S A;  3S15 B;  5DEH A;  2WAC A;  2Z4H A;  3UI2 A;  2AWN A;  4HN7 A;  3W3A A;  3BVM A;  2EYM A;  3OW7 A;  2M9V A;  2A73 B;  1BF4 A;  4A3M B;  3M85 A;  1SND A;  5EPL A;  1O80 A;  3DWP A;  1B2T A;  1EQT A;  1TS5 A;  3D6W A;  4KHZ A;  4WOR A;  3HP3 A;  2MGS A;  3NWS A;  2B2U C;  4EQO A;  2JYO A;  4OIJ A;  3K5N A;  4LJZ C;  2ICE C;  3F2U A;  3TN2 A;  1V1P A;  3KLS X;  1LTS D;  5M3M B;  3GQB A;  1Q90 A;  4FXK C;  4ILW A;  2HQE A;  5CBA E;  1QNU A;  4TSS A;  2EY5 A;  4WFN 3;  1FNV A;  1EU4 A;  3L9A X;  3OHX C;  4K2L A;  4G57 A;  1STE A;  3A8I E;  1PRT B;  1Q8I A;  2HUG A;  2ID0 A;  5EJW A;  1TQO A;  3S16 B;  1I6H B;  1TY2 A;  4M8A A;  2EJF C;  3K0Y A;  2VXW A;  5C4Z A;  5I4D A;  3E0J A;  1NR2 A;  1Y8P B;  1SBB B;  1XWE A;  5D65 A;  1E2Z A;  1KDB A;  4XQJ A;  1DM0 B;  2BA0 A;  1RTO A;  2KVM A;  3ND9 A;  2IWH A;  1WVL A;  1TWG B;  4FYD A;  2WB1 B;  1GUW A;  4S3S A;  4RCO A;  2JP1 A;  5IIF A;  1KDA A;  5DNF A;  3TP8 A;  2R3Z A;  3NQI A;  3NSW A;  3MXP A;  3M7G A;  1LT4 D;  3E5S A;  3H0G B;  2SDF A;  1ENC A;  4XQN A;  4MN3 A;  1PTO H;  2XRQ D;  1EY7 A;  2RSO A;  5C0X J;  4IUN A;  4KD3 A;  2KEE A;  1K83 B;  5G3L D;  2FMM A;  4RGN A;  2OEO A;  3I4L A;  1BUV T;  3RZD B;  3K6O A;  2ZXO A;  2J4X A;  1SJE D;  1CT1 D;  2KHS A;  5K36 H;  1KNA A;  1RCV D;  3OIQ A;  1V1O A;  4XXE A;  1FD7 D;  1BOS A;  1AZQ A;  3K57 A;  3FRP B;  5KND A;  2F0I A;  2Q8R E;  5CV7 A;  4G7Z C;  5CV5 A;  2D5D A;  3D4R A;  3V05 A;  4DU9 A;  3MTS A;  1MD2 D;  2DNE A;  4QMG A;  2FIN B;  5ELD A;  4JK1 C;  2QDB A;  3BDO A;  1I4G A;  1W6K A;  4RGM A;  2L9H A;  5C0X G;  1HFG A;  5KEE A;  1CQV A;  4C1N I;  3MAQ A;  1GUO A;  3H09 A;  5KGU A;  1LAC A;  1PMR A;  4BY1 B;  2VB2 X;  2XNA C;  1EYD A;  2IX3 A;  3PMF A;  1JC7 A;  3C1E A;  4K5V A;  1U4P A;  3DXJ C;  1SAP A;  2MP1 A;  3HRZ C;  3HOW B;  4KKS A;  1GUN A;  1PZK D;  1B9M A;  2NVY B;  1I4R A;  2NTT A;  4CKE A;  1JCK B;  2SNS A;  2EE1 A;  4X3T A;  1SMY D;  2FMC A;  3TZU A;  1AZP A;  3HOZ B;  2QCP X;  3J7A F;  2EVB A;  5J1Z A;  1O7L A;  1MSG A;  3BYT B;  2CHB D;  3ZYY X;  3SK4 A;  2TSS A;  2EPB A;  3Q24 A;  3VYU A;  2E2I B;  2NVT B;  4M1U B;  2RVL A;  2A6H D;  2BA1 A;  5AFW A;  1JOR A;  1CM9 A;  1D1I A;  1R4Q B;  3MWY W;  1T5E A;  2EY2 A;  3KLS A;  3ITP A;  1NR4 A;  3AU7 A;  2CQA A;  1X32 A;  5CBE E;  2F0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...