2MP1A

Solution structure of the human chemokine ccl19
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
77
structure length
77
Chain Sequence
GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C motif chemokine 19
publication title Solution Structure of CCL19 and Identification of Overlapping CCR7 and PSGL-1 Binding Sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 8
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2014-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2mp1A00
1B2TA 1F9SA 1WTPA 4ZAIA 2L12A 2FINB 1O7YA 2DY7A 2B2WA 2H1EA 2L1BA 2MPMA 1X3PA 2HCIA 2HDMA 4X3TA 4X3UA 4XT3B 1MI2A 2K05A 2X6LA 5E4XA 1EQTA 1HFGA 1BF4A 2B2TC 3G7LA 2HUGA 3ONAB 1KNAA 4R9WA 5DNFA 4CJ2C 4DN4M 2B2VA 4U68A 3MTSA 4X3SA 3H91A 2D9UA 3Q6SA 5CORA 5JJZA 2MJ8A 2KEDA 4R8IA 5D65A 1HA6A 3F2UA 1IL8A 4HEDA 1HFNA 2EE1A 5COYA 2FJ2A 5CBAE 1WVLA 1AZQA 1PFMA 5E4WC 4RWSC 4ZKCB 2J7ZA 4LMQD 1G91A 1ICWA 5EPLA 1A15A 1G6ZA 2CVRA 4XT1B 3I90A 2RSNA 1EIHA 1VMCA 3TN2A 1SAPA 1U4LA 1B53A 2FFKB 2K1BA 4UAIA 4QUFA 1CA6A 1DOLA 1JE4A 1F9QA 4HAEA 4RAUC 4ZK9B 2R3ZA 3FPUB 1DONA 3FDTA 2L11A 5EJWA 2KUMA 2Q8TA 2DY8A 3DEPA 2Q8RE 4MHEA 3I8ZA 4XDXA 1RHPA 3N52A 4IUTA 1U4MA 1U4PA 5CBEE 4HCSA 2BDNA 1VMPA 2EPBA 2NWGA 2MP1A 1EIGA 1GUWA 1XX8A 2K28A 2IL8A 1X32A 5T1IA 2KOLA 5EPKA 1PFBA 3R93A 1WTQA 3I3CA 1XYIA 1SSOA 1MGSA 1AP0A 1F9PA 1B3AA 1KNEA 4RA8A 2B2YA 1MSHA 2L9HA 1QNKA 3UI2A 1HUMA 1PDQA 1IKLA 2B2WC 4X3KA 3TZDA 1ML0D 1F9RA 2X69A 1BO0A 1LV9A 2JYOA 2K04A 1CM9A 1S4ZA 4MN3A 2FHTA 2KVMA 4CJ0B 1NCVA 4OIKA 1G2SA 4HSVA 4IUPA 4IURA 2NZ1D 1WTXA 1C8CA 2B2VC 3IFDA 3SVMA 2HCCA 4ZLTF 2RVLA 2EOTA 1EOTA 1RODA 2FMMA 3DEOA 2N88A 3QO2A 3GV3A 4QUCA 2B2UA 1QG7A 1E0BA 2NYZD 1B4OA 1SDFA 1PFNA 2RSOA 4O42A 4OIJA 5D14A 1NR2A 2B2YC 2RA4A 1ESRA 1BBXC 1DOMA 2KECA 1HUNA 3P7JA 1WD1A 3MWYW 1DZ1A 1DOKA 3GV6A 2K01A 1JICA 1F2LA 1TVXA 1CA5A 5CMDA 1O7ZA 1WTWA 3D6WA 1J8IA 2KEEA 2VXWA 3KBXA 5AFWA 5EQ0A 2HDLA 1IKMA 2MGSA 4IUVA 5EPJA 1ILPA 1O80A 1QE6A 1ZXTA 1WTVA 1PLFA 1WD0A 2SDFA 2X6GA 1G2TA 3HP3A 1RTNA 2B2TA 2N55A 1M8AA 1X3QA 4CJ1B 2L4NA 1J9OA 2B2UC 1AZPA 1HRJA 3I91A 2K03A 3LWEA 1B50A 4IUQA 1U4RA 5EKIA 1WTOA 1NAPA 4ZKBB 3DM1A 4IUUA 1WTRA 1EL0A 1ILQA 5T1GA 2M2LA 1RJTA 1NR4A 1HHVA 1BNZA 4NW2A 1Q3LA 1RTOA 3KUPA 2XIWA 3IL8A 2JP1A 1MSGA
chains in the Genus database with same CATH superfamily
3G4SA 3NQIA 1B2TA 2A5HA 4A3MH 1UAPA 1A63A 2OWOA 3H15A 3SHLA 4N8FA 2J4XA 2CW0D 3GO5A 3CF5A 2K05A 2UXDQ 3G7LA 3CAMA 3CQZB 2F4VQ 2BDOA 2ZXRA 4DV6L 1RKNA 3MTSA 3OPOA 2KCCA 1YI2A 1SMYC 4BWGB 4O0AA 3H3VH 1JCKB 2DJGC 4HIDA 1STGA 2AUKA 3HZXA 1A15A 5AJ3Q 1JOKA 2RSNA 3TS0A 3RNUA 1VMCA 1NUCA 3R2IA 1HZ9A 1Q12A 5JJIA 4B3RQ 3KLSX 3F2DA 3JAME 3RZOH 1N8RC 3PF5A 1WJJA 1V8QA 2LS01 4KKSA 5F2DA 1JJCB 3CMEA 1KC8C 4MHEA 2NZOA 2SOBA 3K7UC 3ZYYX 2BDNA 3H0GG 4AQYL 2NWGA 3GTOH 1Q90A 2MHVA 1YJ9A 1JWSD 1AP0A 4HMIA 3TP7A 1PDQA 2Q2HA 4DK6C 4FO2A 3TZDA 1Q81C 2O2LD 3J7ZC 2CWPA 4G7ZC 4WJWA 1A62A 5FK9C 4TQUS 2HHHQ 2PMZB 5JOBA 2RVLA 4EX5A 4RKBA 3QO2A 1C48A 4F88A 5KGUA 5GAHC 4H0LC 4JI2Q 2NYZD 5JEAG 3I55A 2B2YC 4X64L 2Z4IA 1ESRA 5FJ8H 1V43A 5IWAQ 1TT2A 3TBIB 4DAYB 4ZYSA 1YHQA 3DWAA 4CHTB 1O80A 2K4KA 3H0GB 1I3QH 1H9JA 3GTQB 4CKCA 2C5CA 2Y0SE 1IBKL 1YBYA 3BYTB 4IALA 4FXGC 2QEJC 2RHQB 5A2QL 5CYUA 1EEID 1LTSD 1JWUD 3IRBA 2EDGA 3BS1A 4YHHL 2CH4A 3KUPA 1S40A 4IFDJ 4FF2A 2VL6A 3ICEA 4LF6L 5ELNA 5CV9A 4XT3B 1V9PA 3C46A 4IPDA 3CPFA 3E3XA 2F0KA 4GOPC 3TREA 4CJ2C 1XMOQ 1QVFA 1DJRD 2K7VA 3M4OH 5K36G 1TWHB 4HEDA 2EE1A 4MTKA 2AQ1B 4OX9L 1HJPA 5IP7H 1TXYA 5E4WC 4ZKCB 1V1PA 2VW9A 1GUSA 1LT4D 4A3KB 3W2DA 4RGNA 1FYCA 4OO1I 1B53A 2A8VA 4JYAL 3TDQA 2JA7G 3HRZC 4JI1L 5C6AA 3EQLC 4JCVE 1S3OA 2J0TD 1SYGA 4Q0FA 2D5DA 3HOYH 2PQAA 5C4XG 4PZ8A 4PNYA 1LABA 1STYA 1EIGA 5EBDA 3MEFA 1E2VA 5A2QE 3S1QB 5KYLA 4B3MQ 1ZYRD 3J7YW 2L55A 1WTQA 4H13C 4FXKC 4JI8L 4J8QA 1Z7TA 4FNFA 1ENAA 1L0YB 1TWAH 1MIUA 1ML0D 2AKWB 1Z6HA 2Q2IA 1A8VA 4DV1Q 4NPSA 4LF8L 1ET9A 2DNCA 4LUOA 1LTTD 3SK5A 3K7AB 3D4WA 2A6ED 1HQRD 1AFPA 3GV3A 1HNZL 3CP0A 1PTOF 3KF8B 1BCPF 1BKBA 3FKIH 4DK3C 3CHBD 1TQOA 1B4OA 2JE6I 3E6ZX 2B8FA 1GUNA 4DV2L 3ER0A 3S1MB 3MWYW 2F0IA 4QIWB 4HJ5A 2RHSB 2G5DA 4KD4A 1C7YA 5K36H 4CDEC 1WTWA 3I70A 4S3SA 2R6GA 2MGSA 5EPJA 1IBML 1C4QA 2QDLA 2NVXH 1WTRA 1GUOA 2JA7H 2EYOA 1O7IA 2JJQA 3BVZA 2UXCQ 3PSIA 3T16A 5JJKA 2OT2A 3J80i 4B3SL 2XIWA 2Y0SG 4C3IH 3CCVA 1N33Q 5FKAC 3HOXH 2JA8H 1C9OA 1OO9B 2YYZA 2NVYB 1HFGA 3A74A 2UUBQ 1K0RA 4HTHA 3PO2H 1VQIA 1SFOH 4A3BG 3KOJA 4R9WA 2NN6G 3D6CA 3I72A 5IP9H 4JBMA 3PUYA 1N36L 1JR0D 3K5OA 5COYA 1AZQA 1R9TB 3SE0A 3X3MA 4LFCL 1LTAD 3U50C 1D1KA 4RKLA 3D4RA 4XQQA 5M5XH 1IYUA 4GNXC 4BA2I 3J80L 4G7OC 4A3IH 2K52A 2BE5C 1R4QB 4CGYB 1PH5A 2EVBA 1F77A 3OWFA 2DY8A 1SR3A 1YNNC 4YCWA 2E2IH 4YCUA 5IYBH 2NTSA 1VMPA 4YY3Q 5LMNL 1QZGA 2UUCL 3PUVA 3L2PA 2Y0SB 1Y8OB 2ZT9C 1W6JA 4HCEA 3DUZA 4XTCS 3AQQA 1HTPA 3MXUA 1KNEA 1O7LA 4OL7A 4A3BB 5HURA 4MTNA 1G2SA 4RGTA 5DAUA 4BBSG 2OQ0A 4A4IA 1XNRQ 2E2HH 1LACA 2N88A 2B2UA 4MIUA 4DGZA 4O42A 1SDFA 2BA1A 2JSOA 2Q8IB 3OIPA 1WD1A 1PRTF 4KJNA 2K01A 1CA5A 1J5EQ 2K32A 3CCJA 3HOWH 2ZM6L 2UU9L 2WFWA 2F0GA 4WORA 5AFWA 1ILPA 2HDLA 2WIIB 1VQAA 1X3QA 3VR2A 4Z9CB 4OHJA 5GAGC 2G9DA 4ALPA 4IO9A 2VB3X 3CXCA 2F0EA 3GTMH 1RD9D 3A0JA 1KRSA 1CUKA 3TP6A 1SYCA 2L0CA 4B3RL 4EQPA 4LFBQ 4BBSB 4LW1A 4LF5L 1EQTA 4QCLA 1KTKA 4DNRB 3HEJA 1EY5A 3TP8A 2BH8A 3A8IE 4HIOA 1YHBA 2Q2TA 1SLJA 3MXGA 2YU9B 1RL2A 4HIKA 1ASZA 2NB0A 2HQLA 4HJAA 2LY7A 2JA6G 2EYFA 1L0WA 1CKNB 2RKSA 3M7NA 4OONA 2EYMA 3T4AC 2F1MA 1S72A 3GTLH 2Z1CA 2IX0A 2R7DA 2HQEA 3MHBA 4JW0A 5IIFA 1STEA 3CPWA 4IFDG 2NVQB 5FLMG 1VQPA 5M3FG 5DM63 3K5MA 1ET6A 1QWYA 5D3IB 2B3GA 3RR5A 2HHHL 4CDFC 2OEOA 3WOFA 3U58A 1SBBB 2AQ2B 5LHY1 4GLAC 1BVSA 4KK7A 3HOUB 2PYKA 4PG3A 5ELDA 3QB3A 2CKZB 3KDFA 3GTKB 2K04A 1PTOB 3CKIB 2XRSD 1BCPB 2V4DA 1MJEA 2C35B 3MAQA 3HKZB 1BUVT 2LXJA 5BN4A 1XMQL 2ZXPA 2JA6B 2NN6I 1G6PA 4ZLTF 1NMGA 1VQ5A 4A93H 4FF4A 4JG2A 1I4QA 3ND8A 2JA9A 4GKJQ 2ALYB 4QB4A 1EU3A 2JEAI 1IXRA 5J1ZA 4K0KL 4NXMQ 2Z6KC 1BBXC 4FDBA 4JI6Q 3PO3G 4J15A 2QKIC 1F2LA 1FNVA 1L1OB 4JV5L 1QUQB 1JOQA 4DR7Q 3D6WA 1IL2A 4BA1I 4Q5VA 1VQCA 3MZ5A 2I5LX 4CJ1B 1TS2A 4IOCA 2F0SA 1TS3A 1SJED 3LNNA 1XTCD 1ILQA 1NTGA 1ZEQX 3UDXA 3AMUA 1P16A 1HPCA 5FLMH 3S2DB 5CR3A 1PZID 3I4NH 3SK4A 3CU7A 4UP9A 3B6YA 2HT1A 4E6IA 3MEHA 5JVG3 5LMUQ 2LSSA 3CCEA 2F0TA 1BF4A 5DNFA 4DV4Q 2F0WA 4XYOA 1T5XD 4X3SA 1N9WA 3CCRA 4JI7Q 1GJXA 2CFMA 4CDDC 2KEDA 4KHPQ 4DR5L 2AQ3B 1IL8A 4A3FG 5IE8A 3BZKA 1K8AC 3PO3B 2E2JH 3CC4A 4MZ9A 2J7ZA 4LMQD 1G91A 2YTVA 1UE5A 4B9XA 2UUAL 3PQIA 2UXBQ 1Y1VH 1VQ6A 4A3EG 1VQGA 4IPCA 1CKMA 2K75A 1Y1WH 3M9BA 2R93B 3DEPA 4QMGA 3ERQA 3V05A 2K5QA 3J7A5 4HCSA 4CBVA 4LAAA 2MP1A 1SMYD 4FP5D 4P72A 2F52A 1Q7YC 3T1YL 3I3CA 3NTHA 5EKKA 2ATWA 4RA8A 1MSHA 3UI2A 4IPHA 3R3OA 5ELOA 1EFID 4MN3A 2NVTH 4IUPA 4LF9L 1HQMC 1BQQT 4GOPA 1PRTB 3A54A 2Q2UA 2FMMA 4C3HB 4QUCA 5C4JB 1JQYD 3LX0A 3DHQA 2VQFQ 1PFNA 4R4TA 4UP7A 3K80C 1ESFA 5I2XA 1SYBA 5HY6A 5IYCG 4DV3Q 5C3EH 3NK9A 4IFDI 1JORA 5I9OA 3EBEA 2VXWA 1NE3A 4FYDA 1CZGA 1YIJA 3IKJA 2K03A 1TWCB 3BJUA 4L6TB 2PZUA 3T1HL 4IUUA 3OHXC 5IGGA 2F3IA 4GN4B 2WKDA 3JAMi 5J3BA 1KLUD 2F3WA 1PYSB 4FF3A 1X65A 1J6QA 4OO1G 4DV5Q 1E3PA 1YZ6A 1NBWA 1I4HA 2B2TC 1KLGD 2VZAA 3ONAB 4GKKL 1EIYB 4RCOA 1LT3D 1WCMH 1TWGB 1TIID 2NTTA 2D0PA 4AH6A 2R92H 5FO9B 3W5OA 4YY3L 2IX3A 5M5WH 1W6KA 4C3JG 1EIHA 2F0PA 1VQ4A 1IYJB 1U4LA 2JA5H 1UE1A 3S1NH 4DR1Q 1B70B 5KNCA 2LFNA 1I6VC 2L11A 2Q8TA 1GXDC 4P73A 3N6RA 1I50H 3N52A 4K14A 3RD4A 4HJ7A 5IYCH 1CHPD 4JI0Q 4LF7L 3ULJA 3O13A 3J81L 4QIWE 1CK1A 4PZ7A 3D31A 3HGBA 2O5JC 4JPBW 4LNQA 4Y7NH 2GA4B 1EFWA 3QIAA 2F0JA 1EQRA 3K0YA 1PH2A 1LM0A 1AW7A 3CQZH 1B7YB 5IY0A 4DUZL 1STHA 3VYUA 2CQOA 4HSPA 1PYBA 2F0FA 2F0QA 3A5ZB 4C3JB 2PQEA 1PH3A 4G7HC 2PQAB 3KYHC 3MVVA 4LJZC 3PIOA 2EXDA 2EJMA 2RSOA 1YJNA 1SNMA 3BDLA 1IYVA 1F2ZA 3UE1A 3PIPA 1SE3A 3NBHA 1HR0W 3TMEA 3GV6A 1JICA 1LTGD 1PFSA 2OXPA 5IGBA 3EVQA 2K5DA 3TP5A 2OTLA 4B3TQ 1O7ZA 4DV7Q 2TMPA 1KL9A 1LT5D 1IKMA 3TQYA 4IUVA 4LFBL 4PQXA 2SDFA 4JI4Q 3K59A 1N32Q 4L5TA 1EWCA 1AZPA 3GTJB 3LWEA 3KF6A 4IUQA 2O5IC 5GROA 1QNUA 3Q24A 3FEWX 3EN2A 4DAPA 1V1OA 2EY1A 1EY0A 4DR6Q 4X66Q 4A3DG 4H7BA 2OTJA 1K83B 2JP1A 5BR8Q 2I07B 2DNEA 2LMCB 3K0XA 2PW5A 2L1BA 4A3KG 1PV4A 5E4XA 4ABNA 1SNOA 2GN5A 4HN7A 4DUYQ 4I65A 1KABA 3GTPB 1I3QB 1E24A 3E0JA 1I94Q 1FD7D 1STBA 4F87A 1TR5A 1LTID 5H1SE 4RGMA 1X9NA 1I6HB 4FF1A 1Z9FA 4DR4L 1NY4A 4DV0L 2QF7A 4RWSC 3J80c 1II3A 4YWKA 3NPPA 4LFAQ 2EYLA 3VA7A 4P71A 2LKVA 1S5BD 4QY7A 3AYHB 1HH2P 3UDIA 1Y8NB 5GAEC 2F3VA 3H0GH 2R3ZA 2SEBD 1R4PB 3GTQH 1M90C 4BY1G 2MFIA 4KN7C 2YTXA 1U4MA 3MFYA 5FOBB 2RCNA 4AIMA 3CW2C 4A3DB 2ZXOA 1AN8A 4V190 3E0EA 4DKAC 1PTOC 1BCPC 1LT6D 2Z0SA 4DPGA 3CMAA 2DGYA 1CI3M 4DR3Q 1EY4A 3A56A 3BZDB 1H9KA 4L5SA 4CJ0B 4K8JA 3S15B 4A3JG 2BE5D 2JQOA 4BBRG 5JEAH 4DA2A 1FNWA 1TWHH 1YNND 3T13A 3CCUA 2V1CC 2M9VA 5IYDG 1BXTA 5FO8B 4BXXG 2H4OA 5C3XA 5HGTA 3URYA 2ZJRA 4A3KH 3FP9A 1L1OC 4JI3L 4A75A 1HNXQ 1E2WA 1EY9A 2N78A 2F0LA 4C2MB 2EZVA 4DNIA 4X62Q 1PH9A 4BY1B 3PGZA 4KHVA 1QE6A 3STBC 5C0XI 1P8LA 4CKEA 1TY0A 5FO7B 3E9IA 1V1QA 1NAPA 3SK6A 3S1QH 4LF4L 3NUCA 3C2PA 3RZDB 1YVCA 1RJTA 3FRPB 3C3LA 1Q8KA 3W1BA 3PUXA 1QJOA 4F8MA 4UDUC 3FHWA 3HOVG 3A8JE 1N34L 4A3JB 1HZAA 2FINB 1XPUA 4BBRB 3F2CA 1EIFA 1HNWQ 3NP8A 4M8AA 4KD3A 3K7AH 1U0LA 2EY2A 2XVSA 4U68A 1FR3A 3HOZG 3K81C 3FMCA 4KMUC 1I4GA 1OXVA 4OWXB 2XWBB 5CBAE 2XN9C 1RF2D 3S1MH 4JBKA 5JJLA 5NUCA 3L0OA 3V2TA 2XGTA 1JMCA 5CGKA 5G3LD 3HKZE 1LO5D 3AU7A 2EYPA 3H6MA 2N3SA 4TRDA 4OELB 5C4XH 4HAEA 2K5WA 3CRLC 1SJHD 2VUMG 2ES2A 1I4PA 3PO2B 1SFOB 3PMFA 1EY7A 4NXNL 1IBLQ 1GUTA 2EPBA 1SN8A 3S16H 2F0VA 3I4MG 2XWJB 5ELCA 3VDYA 3HOVB 5EPKA 2RDHA 3WDNA 2VQFL 1ICFB 1XXGA 4K6LA 4X3KA 1F9RA 1GOZA 1LV9A 4A3IB 3HOZB 1PRTC 2LXKA 4HSVA 4JI5Q 2VQEL 1L0XB 4A3LG 1Q8IA 3IFDA 2E2IB 1TWFB 1A6XA 1X54A 1QVCA 4A3GG 4RFBA 1R9TH 1SYDA 2R7FA 2MUYA 3U4ZA 1E0BA 4I7AA 3KLWA 1XNQQ 2NZHA 4C1NI 5D14A 1HUNA 1A3VA 1DZ1A 3A7LA 2VUMB 5CMDA 3M3YB 3KDFB 1W3SA 4RHRA 1K9MC 2A6HD 2MO1A 2RBMA 4IOAA 4KLKA 4K5WA 3I4MB 4M1UB 1G2TA 1RTNA 1EWIA 3S1RB 3T51B 5C5LA 1E7ZA 4DR2Q 5EAYA 3NTIA 5C5MA 2B8GA 4JOIA 1MSGA 4A3BH 1EYGA 4ZAIA 3CCSA 2B63G 2NN6H 2DY7A 5C44G 2H1EA 3J80E 1CHQD 4L8JA 1VQDA 4DV6Q 4A3GB 1VQ9A 2K5HA 3HKSA 3KFUA 3P1HA 2UXDL 5CORA 4RMFA 1VS0A 1KHIA 2RCFA 2F4VL 3I56A 1PA6A 5CC4A 1VF5C 3GP7A 1ICWA 4GLXA 4K5XA 3RUZA 4R4IA 5IGEA 4WJ4A 3OMCA 3PIO3 3NWSA 5AJ3L 3LGJA 1BDOA 3HOUG 3PIP3 1CA6A 3J81j 1K73C 1UNSA 5C0XJ 3OTOQ 1DONA 1KAAA 2KUMA 3I2ZA 2KCTA 4AQYQ 1AE3A 1S5CD 3RN5A 2M00A 1G291 4BY7G 4ZUIA 3HKZG 4EGVA 3AEVA 1DGSA 3K5NA 3PUWA 1B9MA 4DXFA 1FJGQ 2B63B 5C44B 2BOSA 1B44D 1I4RA 1MGSA 1F9PA 1MHWC 3ND9A 1QNKA 4K8IA 3W1GA 1IKLA 1BOSA 4NP5A 4BBSH 2HD3A 2CHBD 5CV8A 2FHTA 1NCVA 1VQEA 4XIGS 2B2VC 2MO0A 4IPGA 2D0OA 2YU9H 1YEZA 4QJFA 5DM73 1IW7C 1S5DD 2KHJA 4X64Q 2BA0A 1K0SA 4CDCC 4JI2L 1DOMA 2PCFB 2WB1E 3GQBA 3I4LA 2IX1A 1VQJA 2H5XA 1VQFA 3NWTA 1DOKA 2WKCA 1KAWA 3MXNA 3P7JA 2G9HD 2NVQH 1JE5A 1NNXA 2A6HC 5IWAL 4XQNA 2KEEA 4RGOS 4BY7B 1KDCA 1ZXTA 4HJ8A 1PLFA 2KA7A 1OXSC 4P2CB 4DUYL 1M8AA 3ERSX 4L5QA 4OEMB 5CV4A 4GOPB 2OF1A 3A55A 3G6EA 5L37A 1EL0A 4A3CG 4YHHQ 2M2LA 1B8AA 3VR5A 1Q3LA 5JPNC 4LF6Q 3KLSA 3A7AB 2ZJPA 1SNCA 4LFAL 3BZCA 3GTKH 1F9SA 1PTOH 4PV1C 1O7YA 1G51A 1E22A 1WYDA 2HDMA 4X3TA 3M4YA 2JA6H 3L9AX 4HJ9A 2IY5B 5E1FA 3W3AA 1B9NA 4DN4M 3H91A 4OX9Q 3S14B 2YV5A 4V0BA 4K6DA 1XMOL 2R93G 1FL0A 3H94A 5CV7A 2SNMA 4IFDH 5EPLA 1FVIA 2PPBC 4JYAQ 2XTIA 1H9RA 1H9SB 1LTRD 1X56A 2EY5A 2P5ZX 4GLVB 5M3FH 1BR9A 3E9HA 3TRZA 5M3MB 2E75C 3I4NB 3NTKA 4C56C 1KQSA 1GHJA 1DOLA 2SNSA 3VYTA 4RAUC 1D2BA 1WOCA 1PH4A 3FDTA 3OW7A 4TVAB 3GTGB 3J81c 1F2YA 2MQHA 5IGCA 2PNRC 2EJFC 1Y8PB 3HS0C 4XXEA 2JK8A 1SEBD 3IAYA 4JI8Q 3S2DH 4C3HG 1CQFA 1VQNA 4B3ML 2B2YA 2L9HA 1HUMA 1SNPA 2B2WC 4ME5A 4GN5A 1LTLA 1LUZA 1MD2D 2JYOA 4LF8Q 1S4ZA 3DXJC 4X62L 1GVPA 3OMGA 2KBNA 2JEBI 2D62A 3U9OA 1HR0Q 2HCCA 4DV1L 3SK8A 1HNZQ 3NXWA 5C4ZA 3PO3H 2F0UA 1Z47A 5I6YA 4POFA 2A19A 3QWNA 4ZQ3A 4DV2Q 1NR2A 3HG9A 2R7ZG 1LYLA 1HXYD 4ODGA 1S5FD 1TVXA 3Q23A 1IBMQ 1JB3A 3KJOA 1S5ED 2R93H 1J8IA 1XPOA 2F03A 1CSPA 2WB1G 1UE6A 1UE7A 3VA5A 4IUNA 3NE5B 3NHHA 2L4NA 3X3NA 1YITA 2B2UC 4KY6A 2QEXA 1E2ZA 4ZKBB 3DM1A 1H95A 2BCOA 4B3SQ 1KD1C 1D5ZC 3VR4A 2ICEC 4WRDA 5DEHA 4ZCKA 2CCZA 2EY6A 4QUFA 2UXCL 1RIPA 2ID0A 2L12A 1XPRA 2GVAA 3K8AA 3NBHB 3VR6A 5C4HA 1N33L 2IHFA 1CTMA 1EYCA 4A3FH 1UUPA 3K58A 3BG3A 4DU9A 4KKTA 3P75A 4A3MG 1T5EA 1N36Q 4KHZA 4C3HH 2WACA 2UUBL 1XJVA 1HFNA 4QGUA 4LFCQ 2R7ZB 3KF6B 4A3EH 2E74C 1G6ZA 4CKBA 4ZUJA 3GDEA 3M4QA 5ISRA 2FFKB 3S2HB 1I5FA 4H02A 4EVOA 2WB1B 1SNQA 1NMFA 2A69C 1JC7A 5LMNQ 1ZKOA 4APVA 5JVH3 1TWCH 2UUCQ 2XRQD 5CBEE 1KDAA 4RG1A 3S17B 3ULLA 5M5YB 2Z9HA 1SXTA 3L7ZC 1DD2A 1F2MA 1XYIA 1SSOA 4K5VA 2EYJA 3JAML 2JA5B 4A3MB 3QR8A 4C1NK 3VYSA 1ASYA 1Q1EA 4NKLA 1VQBA 1C8CA 3PUZA 2EOTA 3NBIA 5C0XG 5KEEA 1EOTA 1I50B 3Q22A 2EJGC 3I4OA 1MJCA 2WINB 4XYQA 2FMCA 1C0AA 1XNRL 2O4XA 1VQKA 1CZWA 3FPPA 4J6HA 3AFQA 4JBWA 2ZM6Q 1PTOD 1V1PB 2PNHA 2UU9Q 1BCPD 2GVBA 1JOOA 2K33A 4EQ5A 2BH2A 1VQLA 1EOVA 1ONLA 3CC7A 4Y7NB 3RN2A 1D1IA 2CWAA 3RZOB 3KBXA 4X65Q 5FJ8G 1J5EL 2IJ0A 5JPMC 1HA5A 2F0HA 1ENCA 1SRUA 4AYBG 1U4RA 1WTOA 5KRUA 1Y69U 4PZ6A 5TSSA 3DMUA 1KRTA 4OO1H 4ILWA 3GTOB 1HHVA 2PZWA 3C1EA 2L15A 3BDOA 3EFXD 4LF5Q 4GNXA 2EQSA 2OQKA 2D2CC 1TU2B 1GM5A 3LWUA 2HUGA 3OTOL 1IHZA 1A2UA 2WAQB 2D9UA 4C3JH 3STBD 3J7AV 1D8LA 1JJGA 5D65A 2EYHA 4N8X1 1PFMA 1X3EA 1FGUA 2Z8LA 1EUJA 4XT1B 3J81E 2PI2A 1FJGL 1PMRA 1SE4A 3KK7A 1EQQA 5IP7G 3ULPA 2K1BA 3KLRA 3KJPA 5C0XH 5ELEA 1JE4A 3OIQA 4FXDA 3FPUB 3OYYA 4LUZA 2A73B 5ELBA 4AYBB 5IT9c 3GTJH 3I8ZA 1RHPA 3TSSA 1W2BA 4IUTA 2F4IA 2E2DC 5IOCA 1HZCA 1XX8A 2K28A 1PH1A 2IL8A 1TS4A 3WWVA 3HOYG 3QOLA 4F7XA 1K83H 3R8BA 3D3RA 3D8GA 5C3WA 1TS5A 2X69A 1BO0A 1X6OA 1XMQQ 5J39A 1QILA 3RMHA 4IURA 3GTPH 1VQ7A 1EWHA 4YIJA 1RODA 1I6HH 2EXZA 4DF7A 1PH6A 1M1KC 2B39A 1PVOA 3M4OB 1A3TA 1DYQA 4UPAA 3SXHA 2E5LQ 2PO4A 4L5RC 5LL6X 4K0KQ 4OIJA 3WOEA 3DM3A 4GKJL 1SYEA 5JAVA 3MFGA 4DK0A 3H3VI 3SR1A 4JV5Q 3FKIG 4NXML 2CW0C 4JI6L 1RDPD 5LMNW 4OWWB 4J1MA 1CT1D 3UE0A 1EEFD 1Q82C 2F0OA 1PRTD 2KCNA 3TS2A 4DR7L 3P20A 1K8MA 2N55A 2RF4A 4KY7A 4GS3A 5EBCA 1K3RA 3HOYB 4A3DH 2K5NA 2I46A 3EROA 1YNJD 3Q8DA 3RLOA 3S9WA 1NR4A 3EJIA 4HIMA 4DK1A 1VQHA 1TKWB 2F0NA 2ZTCA 4LUVA 3CC2A 2NBFA 3DWPA 1Q1BA 3V96A 4X3UA 1TWAB 3S15H 3EIVA 2RQXA 2X6LA 1JWMD 4C3IG 1D6EC 1EU4A 4YCVA 1KNAA 2KHSA 5LMUL 3HOXG 4DR5Q 2JA8G 3C1FA 2B2VA 5EGTA 4DAMA 2RDGA 5JJZA 2MJ8A 1GHKA 4DV4L 4JI7L 3PO2G 1YJWA 4RCNA 2FJ2A 1WVLA 4KHPL 3H09A 5IGFA 3FKIB 2UUAQ 1K3BC 5IP9G 2CVRA 3I90A 4FVMA 1SNDA 4C2MH 5BN5A 1EY6A 2JN4A 4BY1H 3BVGA 1CQVA 4UAIA 2ZTDA 1JB7A 2HIXA 5M9OA 2ENBA 2UXBL 1F9QA 1FGBD 4ZK9B 1AEXA 2KENA 1LTBD 2Q8RE 1VQMA 1STNA 1K28A 4A3IG 1CFMA 1EYAA 1HR0L 4JK1C 1U4PA 4K2LA 2N8NA 3QG1A 1A2TA 4BS9A 4DNTB 3K57A 4G4KA 1PH8A 4LWCA 2IT1A 3RZDH 1GUWA 4KJOA 3T1YQ 3S24A 2NVXB 3SEBA 2JA7B 1PFBA 5IYBG 1Q86C 1SMXA 1B3AA 1SE2A 4O1NA 4DAYA 4A3JH 3CCLA 2Z6KA 4C3IB 1ENFA 2QCPX 4BBRH 4XQJA 1D7QA 3MA2B 3HOXB 4LF9Q 2JA8B 2C9OA 5C4XB 4OIKA 4X6AH 1X55A 2CH4W 2NZ1D 5IYDH 4BXXH 3NSWA 4KTAA 1MKHA 2QA4A 2QGQA 4NB3A 3DEOA 3PV0A 3UDGA 3S16B 3OWEB 1T9HA 5IGDA 1BBWA 5IT9L 2OCEA 2K6AA 2A74C 2KECA 5FLXc 5M5XB 2NVYH 1VQ8A 1AH9A 4DV3L 5CV5A 3IFTA 5I4DA 3HP3A 1OXXK 1FNUA 3T1HQ 3HOWG 3K5LA 4DFAA 1GUGA 1EZ8A 1B50A 2QDBA 1HZBA 5D3DA 3HOVH 1YNJC 1XWEA 3AFPA 1IW7D 2F0MA 1WI5A 3IL8A 4N9TA 1I4XA 1WTPA 3HOZH 2B2WA 3EA6A 2HCIA 1A0IA 3MXNB 4GKKQ 1MI2A 2IHEA 4R1JA 1B1ZA 4DV5L 1TWFH 1YNXA 4YWMA 1EY8A 4R8IA 4KY5A 4OXPA 4B9WA 1IZ6A 4JVZA 5EKLA 1E1TA 2E2HB 4MNOA 1ZYRC 5KYIA 5IT9E 3OOCA 2QW7A 2RDFA 1GKHA 1L2FA 4GZYC 2VUMH 3M3YH 1EZ6A 1CKOA 3K6OA 2HIVA 2N49A 4O2DA 3NQTA 4DXGA 1NJIC 2KCMA 1UWVA 3CD6A 3HOWB 1OXUA 3I4MH 5J22A 4DR1L 1PZKD 2A6EC 1SROA 3S1RH 3KF8A 4HMJA 4LF7Q 5KNBA 1D5XC 1PXUA 1KDBA 1X32A 5T1IA 2ZTEA 3R93A 3DLLA 4JI0L 1BBUA 2DUDA 4A3LH 1DXMA 3GTMB 5KIXA 4DUZQ 1CM9A 4A3GH 1QZHA 4X65L 2I5MX 2KQ3A 3H3VC 1OTCA 4H44C 3L3OC 1QG7A 5I6WA 2XNAC 2PW7A 1VCIA 4A93G 2KHIA 1KIXA 2DJFC 1VF7A 3CRKC 2ASBA 4UP8A 2WV6D 5DLQE 4B08A 5KNDA 1PH7A 5GADC 3GTLB 2YTYA 4B3TL 4KKUA 5HGQA 1WTVA 2B29A 4DV7L 2Z6BA 1NSNS 3F2BA 2B2TA 4LK1C 5I9PA 1O78A 4JI4L 3I91A 5CV6A 5EKIA 1N32L 1Q46A 2B63H 5C44H 2PI2E 3A5UA 2E76C 1G8ZD 1HCZA 3F8TA 4DR6L 4UHVA 4X66L 3U9SA 1X3PA 2TSSA 2ZJQA 5BR8L 1RCVD 5M3MG 3I4NG 3U4VA 1IBKQ 5FLXL 2KJXA 4DR4Q 2AMCB 1DCZA 4DV0Q 3SGIA 1D5MC 3F2UA 3BDCA 4A93B 5A35A 1U9RA 1I94L 3BYYB 5G3LF 3HOUH 1LLRD 1PZJD 4IQZA 2IPKD 3TN2A 4IN3A 1K8OA 1SAPA 1UEBA 2E8GA 3BU2A 3OSOA 4ID6A 1GD7A 4QF4A 3SDZA 2K14A 4BY7H 1U5KA 3Q0AA 1A3UA 1Y1VG 3VYRA 1YHAA 1EQVA 5JEAJ 2ICIA 1MBYA 4R4CA 1Y1WG 4QL5A 2AUJD 1WTHA 3JAMc 1PHJA 2KOLA 2DN8A 2E5LL 4GN3B 4G57A 4WFN3 2WP8J 3PF4A 4JI1Q 4KV6A 4PMBA 5M3FB 5ELFA 3RLNA 4ULLA 1WFQA 5K5PA 2Z4HA 4JBJA 2KVMA 2VY3A 4HR7B 4DR3L 1WTXA 2QILA 3S14H 2AHOB 3UDFA 3CCQA 1JT8A 5FLXE 2A69D 2K50A 3ITPA 3QJYA 4POGA 3I7FA 4Y52H 4JI3Q 3TZUA 2E2JB 4ZRZA 4ME3A 2RA4A 2EIFA 4TSSA 5M3MH 3NELA 3D4DA 1EYDA 3G48A 4K2KA 1HNXL 1Y1VB 2NUCA 2WAQE 4KN4C 4R4OA 4OGQC 2X6GA 1X3GA 1Y1WB 3GTGH 4A3CH 2A68D 5C3EG 4PMWA 2I5HA 4R8NA 1UEAB 1J9OA 4LF4Q 1CKNA 1X3FA 1PYWD 1STAA 2R61A 3G71A 5T1GA 1N34Q 1KXLA 1RTOA 2I0QA 3T56B 2MNAA 2IWHA 2MPMA 2PMZE 4AYBE 3QOJA 5GQOA 2NVTB 4P74A 1AE2A 5IODA 3ZJYC 3AB9A 1HNWL 3DWQA 4N9PA 1M4VA 3Q6SA 4IJHA 2JXMB 1HA6A 2XSCA 3VR3A 3G6JB 1GO3E 4WJ3M 4EQOA 4JOIC 3I73A 1WCMG 4I7ZC 3A8KE 5E7NA 2R92G 1Y14B 2AWNA 4P75A 1E1OA 4U673 1DM0B 5C3EB 4GNXB 4NXNQ 1XTDA 3M7GA 4A3FB 5EJWA 2JA5G 3CCMA 1TY2A 4XDXA 3KBGA 4NMZA 2PZTA 5C4JH 4NDXA 3MC0B 1IBLL 1K8GA 3FVQA 3NENA 3BVMA 3NEMA 4A76A 4A3EB 4RHSA 1L1OA 1QUQA 2FXQA 5LL6S 1SYFA 4JC0A 4EQNA 2VQEQ 3M85A 3D0FA 1VDZA 3R2TA 3SVMA 4JI5L 3TEHB 1CSQA 5BN3A 4IJLA 3F1ZA 1VQOA 1JJ2A 3E5SA 1WCMB 1QCBD 4PMCA 2R7ZH 1B3QA 1H9SA 2R92B 2VS1A 3RLFA 4UY8C 4TKOB 1QVGA 3T53B 2L5TA 3HFZB 5M5WB 2K5VA 4DAVA 1SE8A 3OW2A 1XNQL 3S2HH 2VB2X 2VNUD 3GD7A 2A1AA 2IW3A 3PCOB 5E3FA 4RH6A 3S1NB 5EQ0A 1QB5D 2CQAA 4YWLA 2A68C 1WD0A 4R4QA 4OWTB 1TWGH 4QQBX 2AWOA 1HRJA 3MXPA 1QOHA 3J81i 1H9MA 3S17H 5M5YH 3J7AF 3JC66 2WAQG 2F0DA 4KI0A 5I2YA 4DR2L 1HTLD 4IZ8A 1BNZA 4NW2A 4L63B 3M4PA 1OXTA
chains in the Genus database with same CATH topology
3NQIA 1B2TA 2A5HA 1UAPA 3SHLA 2J4XA 2CW0D 3GO5A 2K05A 3G7LA 3CQZB 2BDOA 2ZXRA 1RKNA 3MTSA 3OPOA 2KCCA 1SMYC 4BWGB 1JCKB 1STGA 2AUKA 3HZXA 1A15A 1JOKA 2RSNA 1VMCA 1NUCA 3R2IA 1Q12A 3KLSX 3JAME 1V8QA 2LS01 4KKSA 5F2DA 4MHEA 2SOBA 3ZYYX 2BDNA 2NWGA 1Q90A 2MHVA 1JWSD 1AP0A 4HMIA 3TP7A 1PDQA 4FO2A 3TZDA 2O2LD 4G7ZC 4WJWA 5FK9C 4TQUS 2PMZB 5JOBA 2RVLA 4RKBA 3QO2A 1C48A 4F88A 5KGUA 4H0LC 5JEAG 2NYZD 2B2YC 2Z4IA 1ESRA 1V43A 1TT2A 3TBIB 4ZYSA 3DWAA 4CHTB 1O80A 3H0GB 1H9JA 3GTQB 4CKCA 2C5CA 3BYTB 4IALA 4FXGC 2QEJC 5A2QL 5CYUA 1EEID 1LTSD 1JWUD 2EDGA 3BS1A 3KUPA 4IFDJ 4FF2A 5CV9A 4XT3B 3C46A 2F0KA 4CJ2C 1DJRD 2K7VA 5K36G 1TWHB 4HEDA 2EE1A 2AQ1B 5E4WC 4ZKCB 1V1PA 1GUSA 1LT4D 4A3KB 3W2DA 4RGNA 1FYCA 4OO1I 1B53A 3TDQA 3HRZC 5C6AA 3EQLC 2J0TD 1SYGA 4Q0FA 2D5DA 4PNYA 1LABA 1STYA 1EIGA 5EBDA 5A2QE 1E2VA 3S1QB 5KYLA 1ZYRD 3J7YW 2L55A 1WTQA 4H13C 4FXKC 4J8QA 1Z7TA 4FNFA 1ENAA 1L0YB 1ML0D 1Z6HA 1ET9A 2DNCA 1LTTD 3SK5A 3K7AB 3D4WA 2A6ED 1HQRD 1AFPA 3GV3A 1PTOF 1BCPF 3CHBD 1TQOA 1B4OA 2JE6I 3E6ZX 2B8FA 1GUNA 3S1MB 3MWYW 2F0IA 4QIWB 4KD4A 5K36H 1WTWA 3I70A 4S3SA 2R6GA 2MGSA 5EPJA 1C4QA 1WTRA 1GUOA 2EYOA 3BVZA 3T16A 2OT2A 2XIWA 5FKAC 1OO9B 2YYZA 2NVYB 1HFGA 4HTHA 4R9WA 2NN6G 3D6CA 3I72A 3PUYA 1JR0D 3K5OA 5COYA 1AZQA 1R9TB 3SE0A 3X3MA 1LTAD 1D1KA 4RKLA 3D4RA 4XQQA 1IYUA 4BA2I 3J80L 4G7OC 2BE5C 1R4QB 4CGYB 2EVBA 1F77A 3OWFA 2DY8A 1YNNC 2NTSA 1VMPA 3PUVA 2Y0SB 1Y8OB 2ZT9C 1W6JA 4HCEA 3DUZA 4XTCS 1HTPA 3MXUA 1KNEA 1O7LA 4OL7A 4A3BB 5HURA 1G2SA 4RGTA 5DAUA 1LACA 2N88A 2B2UA 4MIUA 4DGZA 4O42A 1SDFA 2BA1A 2JSOA 2Q8IB 3OIPA 1WD1A 1PRTF 4KJNA 2K01A 1CA5A 2K32A 2F0GA 4WORA 5AFWA 1ILPA 2HDLA 2WIIB 1X3QA 3VR2A 4Z9CB 4OHJA 2G9DA 2VB3X 2F0EA 1RD9D 3TP6A 1SYCA 2L0CA 4EQPA 4BBSB 1EQTA 4QCLA 1KTKA 4DNRB 3HEJA 1EY5A 3TP8A 3A8IE 3MXGA 2YU9B 2NB0A 2LY7A 2EYFA 2RKSA 3M7NA 2EYMA 3T4AC 2F1MA 2Z1CA 2IX0A 2HQEA 3MHBA 5IIFA 1STEA 4IFDG 2NVQB 5DM63 3K5MA 1ET6A 1QWYA 5D3IB 2OEOA 3WOFA 1SBBB 2AQ2B 5LHY1 4KK7A 3HOUB 2PYKA 5ELDA 3QB3A 3GTKB 2K04A 1PTOB 3CKIB 2XRSD 1BCPB 2V4DA 3MAQA 3HKZB 1BUVT 5BN4A 2ZXPA 2JA6B 2NN6I 4ZLTF 4FF4A 1I4QA 3ND8A 4QB4A 1EU3A 2JEAI 5J1ZA 1BBXC 2QKIC 1F2LA 1FNVA 1JOQA 3D6WA 4BA1I 4Q5VA 3MZ5A 4CJ1B 1TS2A 2F0SA 1TS3A 1SJED 3LNNA 1XTCD 1ILQA 1ZEQX 3AMUA 1HPCA 3S2DB 5CR3A 1PZID 3SK4A 3CU7A 4E6IA 3MEHA 5JVG3 2F0TA 1BF4A 5DNFA 2F0WA 4XYOA 1T5XD 4X3SA 1GJXA 2KEDA 2AQ3B 1IL8A 3PO3B 2J7ZA 4LMQD 1G91A 4B9XA 2R93B 3DEPA 4QMGA 3ERQA 3V05A 2K5QA 4HCSA 4CBVA 4LAAA 2MP1A 1SMYD 4FP5D 3I3CA 3NTHA 5EKKA 4RA8A 1MSHA 3UI2A 3R3OA 1EFID 4MN3A 4IUPA 1HQMC 1BQQT 1PRTB 3A54A 2FMMA 4C3HB 4QUCA 5C4JB 1JQYD 3LX0A 3DHQA 1PFNA 1ESFA 5I2XA 1SYBA 3NK9A 4IFDI 1JORA 5I9OA 2VXWA 4FYDA 1CZGA 3IKJA 2K03A 1TWCB 4L6TB 2PZUA 4IUUA 3OHXC 5IGGA 2WKDA 1KLUD 2F3WA 4FF3A 4OO1G 1I4HA 2B2TC 1KLGD 3ONAB 4RCOA 1LT3D 1TWGB 1TIID 2NTTA 5FO9B 2IX3A 1W6KA 4C3JG 1EIHA 2F0PA 1U4LA 5KNCA 2LFNA 1I6VC 2L11A 2Q8TA 1GXDC 3N6RA 3N52A 4K14A 3RD4A 1CHPD 3O13A 3J81L 1CK1A 3D31A 3HGBA 2O5JC 2GA4B 3QIAA 2F0JA 3K0YA 1AW7A 1STHA 3VYUA 4HSPA 2F0FA 2F0QA 4C3JB 2PQEA 4G7HC 3MVVA 4LJZC 2EJMA 2RSOA 1SNMA 3BDLA 1IYVA 1F2ZA 1SE3A 3NBHA 3TMEA 3GV6A 1JICA 1LTGD 2OXPA 5IGBA 3EVQA 2K5DA 3TP5A 1O7ZA 2TMPA 1LT5D 1IKMA 4IUVA 4PQXA 2SDFA 3K59A 1EWCA 1AZPA 3GTJB 3LWEA 2O5IC 4IUQA 1QNUA 3Q24A 3FEWX 4DAPA 1V1OA 2EY1A 1EY0A 4H7BA 1K83B 2JP1A 2I07B 2DNEA 2LMCB 2PW5A 2L1BA 5E4XA 4ABNA 1SNOA 4HN7A 4I65A 1KABA 3GTPB 1I3QB 3E0JA 1FD7D 1STBA 4F87A 1TR5A 1LTID 4RGMA 1I6HB 4FF1A 2QF7A 4RWSC 1II3A 3NPPA 2EYLA 3VA7A 2LKVA 1S5BD 1Y8NB 2F3VA 2R3ZA 2SEBD 1R4PB 4KN7C 1U4MA 3MFYA 5FOBB 4A3DB 2ZXOA 1AN8A 4V190 1PTOC 1BCPC 1LT6D 1CI3M 1EY4A 3A56A 3BZDB 1H9KA 4CJ0B 4K8JA 3S15B 2BE5D 5JEAH 4DA2A 1FNWA 1YNND 3T13A 2M9VA 1BXTA 5FO8B 2H4OA 5C3XA 5HGTA 3URYA 1E2WA 1EY9A 2F0LA 4C2MB 2EZVA 4BY1B 4KHVA 1QE6A 5C0XI 4CKEA 1TY0A 5FO7B 1NAPA 3SK6A 3NUCA 3C2PA 3RZDB 1RJTA 3FRPB 3C3LA 3PUXA 1QJOA 4F8MA 4UDUC 3A8JE 4A3JB 2FINB 4BBRB 3NP8A 4M8AA 4KD3A 2EY2A 2XVSA 4U68A 1FR3A 3FMCA 4KMUC 1I4GA 1OXVA 2XWBB 5CBAE 2XN9C 1RF2D 5NUCA 3V2TA 5CGKA 5G3LD 1LO5D 3AU7A 2EYPA 3H6MA 4TRDA 4HAEA 2K5WA 3CRLC 1SJHD 1I4PA 3PO2B 1SFOB 3PMFA 1EY7A 1GUTA 2EPBA 2F0VA 2XWJB 5ELCA 3HOVB 5EPKA 2RDHA 3WDNA 1XXGA 4K6LA 4X3KA 1F9RA 1GOZA 1LV9A 4A3IB 3HOZB 1PRTC 4HSVA 1L0XB 1Q8IA 3IFDA 2E2IB 1TWFB 1A6XA 4RFBA 1SYDA 2MUYA 1E0BA 4C1NI 5D14A 1HUNA 1A3VA 1DZ1A 3A7LA 2VUMB 5CMDA 3M3YB 4RHRA 2A6HD 2RBMA 4K5WA 3I4MB 4M1UB 1G2TA 1RTNA 3S1RB 3T51B 5C5LA 3NTIA 5C5MA 2B8GA 1MSGA 4ZAIA 2NN6H 2DY7A 2H1EA 3J80E 1CHQD 4L8JA 4A3GB 3P1HA 5CORA 5CC4A 1VF5C 3GP7A 1ICWA 4K5XA 3RUZA 5IGEA 3OMCA 3PIO3 3NWSA 1BDOA 3PIP3 1CA6A 1UNSA 5C0XJ 1DONA 1KAAA 2KUMA 1S5CD 2M00A 1G291 4ZUIA 4EGVA 3K5NA 3PUWA 1B9MA 4DXFA 2B63B 5C44B 2BOSA 1B44D 1I4RA 1MGSA 1F9PA 3ND9A 1QNKA 4K8IA 1IKLA 1BOSA 4NP5A 2CHBD 5CV8A 2FHTA 1NCVA 4XIGS 2B2VC 5DM73 1IW7C 1S5DD 2BA0A 1DOMA 2PCFB 3GQBA 3I4LA 2IX1A 3P7JA 3NWTA 1DOKA 2WKCA 3MXNA 2G9HD 2A6HC 4XQNA 2KEEA 4RGOS 4BY7B 1KDCA 1ZXTA 1PLFA 2KA7A 1OXSC 4P2CB 1M8AA 5CV4A 2OF1A 3A55A 1EL0A 2M2LA 3VR5A 1Q3LA 5JPNC 3KLSA 3A7AB 1SNCA 1F9SA 1PTOH 4PV1C 1O7YA 2HDMA 4X3TA 3M4YA 3L9AX 5E1FA 3W3AA 1B9NA 4DN4M 3H91A 3S14B 4V0BA 4K6DA 3H94A 5CV7A 2SNMA 4IFDH 5EPLA 2PPBC 1H9RA 1H9SB 1LTRD 2EY5A 1BR9A 5M3MB 2E75C 3I4NB 3NTKA 4C56C 1GHJA 1DOLA 2SNSA 3VYTA 4RAUC 1D2BA 3FDTA 3OW7A 3GTGB 1F2YA 5IGCA 2PNRC 2EJFC 1Y8PB 3HS0C 4XXEA 1SEBD 3IAYA 4C3HG 1CQFA 2B2YA 2L9HA 1HUMA 1SNPA 2B2WC 4ME5A 1MD2D 2JYOA 1S4ZA 3DXJC 3OMGA 2JEBI 2D62A 3U9OA 2HCCA 3SK8A 3NXWA 5C4ZA 2F0UA 1Z47A 5I6YA 3QWNA 4ZQ3A 1NR2A 3HG9A 1HXYD 4ODGA 1S5FD 1TVXA 3Q23A 1JB3A 1J8IA 1S5ED 2F03A 3VA5A 4IUNA 3NE5B 3NHHA 2L4NA 3X3NA 2B2UC 4KY6A 1E2ZA 4ZKBB 3DM1A 2BCOA 1D5ZC 3VR4A 2ICEC 4WRDA 5DEHA 2EY6A 4QUFA 2ID0A 2L12A 3VR6A 5C4HA 1CTMA 1EYCA 1UUPA 3K58A 3BG3A 4DU9A 4KKTA 3P75A 1T5EA 4KHZA 2WACA 1HFNA 2R7ZB 2E74C 1G6ZA 4CKBA 4ZUJA 5ISRA 2FFKB 3S2HB 4EVOA 2WB1B 1SNQA 2A69C 1JC7A 1ZKOA 5JVH3 2XRQD 5CBEE 1KDAA 3S17B 5M5YB 1SXTA 3L7ZC 1DD2A 1F2MA 1XYIA 1SSOA 4K5VA 2EYJA 3JAML 2JA5B 4A3MB 4C1NK 3VYSA 1Q1EA 4NKLA 1C8CA 3PUZA 2EOTA 3NBIA 5C0XG 5KEEA 1EOTA 1I50B 3Q22A 2EJGC 2WINB 4XYQA 2FMCA 2O4XA 1CZWA 3FPPA 4J6HA 4JBWA 1PTOD 1V1PB 1BCPD 1JOOA 2K33A 1ONLA 4Y7NB 1D1IA 3RZOB 3KBXA 2IJ0A 5JPMC 1HA5A 2F0HA 1ENCA 1U4RA 1WTOA 5KRUA 1Y69U 5TSSA 3DMUA 4OO1H 4ILWA 3GTOB 1HHVA 2PZWA 3C1EA 3BDOA 3EFXD 2D2CC 1TU2B 3LWUA 2HUGA 1IHZA 1A2UA 2WAQB 2D9UA 3J7AV 5D65A 2EYHA 1PFMA 2Z8LA 4XT1B 3J81E 1PMRA 1SE4A 3KK7A 2K1BA 3KLRA 5C0XH 5ELEA 1JE4A 3OIQA 4FXDA 3FPUB 2A73B 5ELBA 4AYBB 3I8ZA 1RHPA 3TSSA 4IUTA 2F4IA 2E2DC 5IOCA 1XX8A 2K28A 2IL8A 1TS4A 3QOLA 4F7XA 3R8BA 3D3RA 3D8GA 5C3WA 1TS5A 2X69A 1BO0A 5J39A 1QILA 3RMHA 4IURA 1EWHA 4YIJA 1RODA 2EXZA 4DF7A 2B39A 3M4OB 1A3TA 1DYQA 3SXHA 2PO4A 5LL6X 4OIJA 3WOEA 1SYEA 5JAVA 3MFGA 4DK0A 3SR1A 2CW0C 1RDPD 4J1MA 1CT1D 1EEFD 2F0OA 1PRTD 2KCNA 3P20A 1K8MA 2N55A 4KY7A 5EBCA 3HOYB 2I46A 3EROA 1YNJD 3S9WA 1NR4A 3EJIA 4DK1A 1TKWB 2F0NA 2NBFA 3DWPA 1Q1BA 3V96A 4X3UA 1TWAB 2RQXA 2X6LA 1JWMD 4C3IG 1D6EC 1EU4A 1KNAA 2KHSA 3C1FA 2B2VA 5EGTA 2RDGA 5JJZA 2MJ8A 1GHKA 4RCNA 2FJ2A 1WVLA 3H09A 5IGFA 3FKIB 2CVRA 3I90A 4FVMA 1SNDA 5BN5A 1EY6A 3BVGA 1CQVA 4UAIA 5M9OA 2ENBA 1F9QA 1FGBD 4ZK9B 1AEXA 1LTBD 2Q8RE 1STNA 1CFMA 1EYAA 4JK1C 1U4PA 4K2LA 3QG1A 4BS9A 1A2TA 4DNTB 3K57A 4G4KA 2IT1A 1GUWA 4KJOA 2NVXB 3SEBA 2JA7B 1PFBA 1B3AA 1SE2A 4O1NA 4DAYA 4C3IB 1ENFA 2QCPX 4XQJA 3MA2B 3HOXB 2JA8B 2C9OA 5C4XB 4OIKA 2NZ1D 3NSWA 4KTAA 3DEOA 3PV0A 3S16B 3OWEB 5IGDA 5IT9L 2K6AA 2A74C 2KECA 5M5XB 5CV5A 3IFTA 5I4DA 3HP3A 1OXXK 1FNUA 3K5LA 4DFAA 1GUGA 1EZ8A 1B50A 2QDBA 5D3DA 1YNJC 1XWEA 1IW7D 2F0MA 3IL8A 4N9TA 1I4XA 1WTPA 2B2WA 3EA6A 2HCIA 1MI2A 1B1ZA 1EY8A 4R8IA 4KY5A 4B9WA 5EKLA 2E2HB 1ZYRC 5KYIA 5IT9E 3OOCA 2RDFA 4GZYC 1EZ6A 3K6OA 4DXGA 3NQTA 3HOWB 1OXUA 5J22A 1PZKD 2A6EC 3KF8A 4HMJA 5KNBA 1D5XC 1PXUA 1KDBA 1X32A 5T1IA 3R93A 1DXMA 3GTMB 5KIXA 1CM9A 2KQ3A 3H3VC 4H44C 3L3OC 1QG7A 5I6WA 2XNAC 2PW7A 1VCIA 1VF7A 3CRKC 2WV6D 4B08A 5KNDA 3GTLB 4KKUA 1WTVA 1NSNS 2B2TA 4LK1C 5I9PA 1O78A 3I91A 5CV6A 5EKIA 2E76C 1G8ZD 1HCZA 3U9SA 1X3PA 2TSSA 1RCVD 5FLXL 2KJXA 1DCZA 1D5MC 3F2UA 3BDCA 4A93B 5A35A 1U9RA 3BYYB 5G3LF 1LLRD 1PZJD 4IQZA 2IPKD 3TN2A 4IN3A 1K8OA 1SAPA 3OSOA 4ID6A 4QF4A 3SDZA 3Q0AA 1A3UA 3VYRA 1EQVA 5JEAJ 2ICIA 1MBYA 2AUJD 2KOLA 2DN8A 4G57A 4WFN3 2WP8J 4KV6A 4PMBA 5M3FB 5ELFA 4ULLA 5K5PA 2Z4HA 2KVMA 4HR7B 1WTXA 2QILA 5FLXE 2A69D 3ITPA 3QJYA 3TZUA 2E2JB 4ZRZA 2RA4A 4TSSA 3D4DA 1EYDA 4K2KA 1Y1VB 2NUCA 4KN4C 4OGQC 2X6GA 1Y1WB 2A68D 4PMWA 4R8NA 1UEAB 1J9OA 1PYWD 1STAA 2R61A 5T1GA 1RTOA 3T56B 2IWHA 2MPMA 3QOJA 2NVTB 5IODA 3AB9A 3DWQA 4N9PA 1M4VA 3Q6SA 2JXMB 1HA6A 2XSCA 3VR3A 3G6JB 4EQOA 3I73A 4I7ZC 3A8KE 2AWNA 4U673 1DM0B 5C3EB 3M7GA 4A3FB 5EJWA 1TY2A 4XDXA 3KBGA 4NMZA 2PZTA 4NDXA 3MC0B 3FVQA 3BVMA 4A3EB 4RHSA 5LL6S 1SYFA 4EQNA 3M85A 1VDZA 3R2TA 3SVMA 5BN3A 3E5SA 1WCMB 1QCBD 4PMCA 1H9SA 2R92B 3RLFA 4TKOB 3T53B 2L5TA 5M5WB 4DAVA 2VB2X 2VNUD 3GD7A 2IW3A 5E3FA 4RH6A 3S1NB 5EQ0A 1QB5D 2CQAA 2A68C 1WD0A 2AWOA 1HRJA 3MXPA 1QOHA 1H9MA 3J7AF 2F0DA 4KI0A 5I2YA 1HTLD 4IZ8A 1BNZA 4NW2A 4L63B 1OXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B2T A;  1F9S A;  1WTP A;  4ZAI A;  2L12 A;  2FIN B;  1O7Y A;  2DY7 A;  2B2W A;  2H1E A;  2L1B A;  2MPM A;  1X3P A;  2HCI A;  2HDM A;  4X3T A;  4X3U A;  4XT3 B;  1MI2 A;  2K05 A;  2X6L A;  5E4X A;  1EQT A;  1HFG A;  1BF4 A;  2B2T C;  3G7L A;  2HUG A;  3ONA B;  1KNA A;  4R9W A;  5DNF A;  4CJ2 C;  4DN4 M;  2B2V A;  4U68 A;  3MTS A;  4X3S A;  3H91 A;  2D9U A;  3Q6S A;  5COR A;  5JJZ A;  2MJ8 A;  2KED A;  4R8I A;  5D65 A;  1HA6 A;  3F2U A;  1IL8 A;  4HED A;  1HFN A;  2EE1 A;  5COY A;  2FJ2 A;  5CBA E;  1WVL A;  1AZQ A;  1PFM A;  5E4W C;  4RWS C;  4ZKC B;  2J7Z A;  4LMQ D;  1G91 A;  1ICW A;  5EPL A;  1A15 A;  1G6Z A;  2CVR A;  4XT1 B;  3I90 A;  2RSN A;  1EIH A;  1VMC A;  3TN2 A;  1SAP A;  1U4L A;  1B53 A;  2FFK B;  2K1B A;  4UAI A;  4QUF A;  1CA6 A;  1DOL A;  1JE4 A;  1F9Q A;  4HAE A;  4RAU C;  4ZK9 B;  2R3Z A;  3FPU B;  1DON A;  3FDT A;  2L11 A;  5EJW A;  2KUM A;  2Q8T A;  2DY8 A;  3DEP A;  2Q8R E;  4MHE A;  3I8Z A;  4XDX A;  1RHP A;  3N52 A;  4IUT A;  1U4M A;  1U4P A;  5CBE E;  4HCS A;  2BDN A;  1VMP A;  2EPB A;  2NWG A;  2MP1 A;  1EIG A;  1GUW A;  1XX8 A;  2K28 A;  2IL8 A;  1X32 A;  5T1I A;  2KOL A;  5EPK A;  1PFB A;  3R93 A;  1WTQ A;  3I3C A;  1XYI A;  1SSO A;  1MGS A;  1AP0 A;  1F9P A;  1B3A A;  1KNE A;  4RA8 A;  2B2Y A;  1MSH A;  2L9H A;  1QNK A;  3UI2 A;  1HUM A;  1PDQ A;  1IKL A;  2B2W C;  4X3K A;  3TZD A;  1ML0 D;  1F9R A;  2X69 A;  1BO0 A;  1LV9 A;  2JYO A;  2K04 A;  1CM9 A;  1S4Z A;  4MN3 A;  2FHT A;  2KVM A;  4CJ0 B;  1NCV A;  4OIK A;  1G2S A;  4HSV A;  4IUP A;  4IUR A;  2NZ1 D;  1WTX A;  1C8C A;  2B2V C;  3IFD A;  3SVM A;  2HCC A;  4ZLT F;  2RVL A;  2EOT A;  1EOT A;  1ROD A;  2FMM A;  3DEO A;  2N88 A;  3QO2 A;  3GV3 A;  4QUC A;  2B2U A;  1QG7 A;  1E0B A;  2NYZ D;  1B4O A;  1SDF A;  1PFN A;  2RSO A;  4O42 A;  4OIJ A;  5D14 A;  1NR2 A;  2B2Y C;  2RA4 A;  1ESR A;  1BBX C;  1DOM A;  2KEC A;  1HUN A;  3P7J A;  1WD1 A;  3MWY W;  1DZ1 A;  1DOK A;  3GV6 A;  2K01 A;  1JIC A;  1F2L A;  1TVX A;  1CA5 A;  5CMD A;  1O7Z A;  1WTW A;  3D6W A;  1J8I A;  2KEE A;  2VXW A;  3KBX A;  5AFW A;  5EQ0 A;  2HDL A;  1IKM A;  2MGS A;  4IUV A;  5EPJ A;  1ILP A;  1O80 A;  1QE6 A;  1ZXT A;  1WTV A;  1PLF A;  1WD0 A;  2SDF A;  2X6G A;  1G2T A;  3HP3 A;  1RTN A;  2B2T A;  2N55 A;  1M8A A;  1X3Q A;  4CJ1 B;  2L4N A;  1J9O A;  2B2U C;  1AZP A;  1HRJ A;  3I91 A;  2K03 A;  3LWE A;  1B50 A;  4IUQ A;  1U4R A;  5EKI A;  1WTO A;  1NAP A;  4ZKB B;  3DM1 A;  4IUU A;  1WTR A;  1EL0 A;  1ILQ A;  5T1G A;  2M2L A;  1RJT A;  1NR4 A;  1HHV A;  1BNZ A;  4NW2 A;  1Q3L A;  1RTO A;  3KUP A;  2XIW A;  3IL8 A;  2JP1 A;  1MSG A; 
#chains in the Genus database with same CATH topology
 3G4S A;  3NQI A;  1B2T A;  2A5H A;  4A3M H;  1UAP A;  1A63 A;  2OWO A;  3H15 A;  3SHL A;  4N8F A;  2J4X A;  2CW0 D;  3GO5 A;  3CF5 A;  2K05 A;  2UXD Q;  3G7L A;  3CAM A;  3CQZ B;  2F4V Q;  2BDO A;  2ZXR A;  4DV6 L;  1RKN A;  3MTS A;  3OPO A;  2KCC A;  1YI2 A;  1SMY C;  4BWG B;  4O0A A;  3H3V H;  1JCK B;  2DJG C;  4HID A;  1STG A;  2AUK A;  3HZX A;  1A15 A;  5AJ3 Q;  1JOK A;  2RSN A;  3TS0 A;  3RNU A;  1VMC A;  1NUC A;  3R2I A;  1HZ9 A;  1Q12 A;  5JJI A;  4B3R Q;  3KLS X;  3F2D A;  3JAM E;  3RZO H;  1N8R C;  3PF5 A;  1WJJ A;  1V8Q A;  2LS0 1;  4KKS A;  5F2D A;  1JJC B;  3CME A;  1KC8 C;  4MHE A;  2NZO A;  2SOB A;  3K7U C;  3ZYY X;  2BDN A;  3H0G G;  4AQY L;  2NWG A;  3GTO H;  1Q90 A;  2MHV A;  1YJ9 A;  1JWS D;  1AP0 A;  4HMI A;  3TP7 A;  1PDQ A;  2Q2H A;  4DK6 C;  4FO2 A;  3TZD A;  1Q81 C;  2O2L D;  3J7Z C;  2CWP A;  4G7Z C;  4WJW A;  1A62 A;  5FK9 C;  4TQU S;  2HHH Q;  2PMZ B;  5JOB A;  2RVL A;  4EX5 A;  4RKB A;  3QO2 A;  1C48 A;  4F88 A;  5KGU A;  5GAH C;  4H0L C;  4JI2 Q;  2NYZ D;  5JEA G;  3I55 A;  2B2Y C;  4X64 L;  2Z4I A;  1ESR A;  5FJ8 H;  1V43 A;  5IWA Q;  1TT2 A;  3TBI B;  4DAY B;  4ZYS A;  1YHQ A;  3DWA A;  4CHT B;  1O80 A;  2K4K A;  3H0G B;  1I3Q H;  1H9J A;  3GTQ B;  4CKC A;  2C5C A;  2Y0S E;  1IBK L;  1YBY A;  3BYT B;  4IAL A;  4FXG C;  2QEJ C;  2RHQ B;  5A2Q L;  5CYU A;  1EEI D;  1LTS D;  1JWU D;  3IRB A;  2EDG A;  3BS1 A;  4YHH L;  2CH4 A;  3KUP A;  1S40 A;  4IFD J;  4FF2 A;  2VL6 A;  3ICE A;  4LF6 L;  5ELN A;  5CV9 A;  4XT3 B;  1V9P A;  3C46 A;  4IPD A;  3CPF A;  3E3X A;  2F0K A;  4GOP C;  3TRE A;  4CJ2 C;  1XMO Q;  1QVF A;  1DJR D;  2K7V A;  3M4O H;  5K36 G;  1TWH B;  4HED A;  2EE1 A;  4MTK A;  2AQ1 B;  4OX9 L;  1HJP A;  5IP7 H;  1TXY A;  5E4W C;  4ZKC B;  1V1P A;  2VW9 A;  1GUS A;  1LT4 D;  4A3K B;  3W2D A;  4RGN A;  1FYC A;  4OO1 I;  1B53 A;  2A8V A;  4JYA L;  3TDQ A;  2JA7 G;  3HRZ C;  4JI1 L;  5C6A A;  3EQL C;  4JCV E;  1S3O A;  2J0T D;  1SYG A;  4Q0F A;  2D5D A;  3HOY H;  2PQA A;  5C4X G;  4PZ8 A;  4PNY A;  1LAB A;  1STY A;  1EIG A;  5EBD A;  3MEF A;  1E2V A;  5A2Q E;  3S1Q B;  5KYL A;  4B3M Q;  1ZYR D;  3J7Y W;  2L55 A;  1WTQ A;  4H13 C;  4FXK C;  4JI8 L;  4J8Q A;  1Z7T A;  4FNF A;  1ENA A;  1L0Y B;  1TWA H;  1MIU A;  1ML0 D;  2AKW B;  1Z6H A;  2Q2I A;  1A8V A;  4DV1 Q;  4NPS A;  4LF8 L;  1ET9 A;  2DNC A;  4LUO A;  1LTT D;  3SK5 A;  3K7A B;  3D4W A;  2A6E D;  1HQR D;  1AFP A;  3GV3 A;  1HNZ L;  3CP0 A;  1PTO F;  3KF8 B;  1BCP F;  1BKB A;  3FKI H;  4DK3 C;  3CHB D;  1TQO A;  1B4O A;  2JE6 I;  3E6Z X;  2B8F A;  1GUN A;  4DV2 L;  3ER0 A;  3S1M B;  3MWY W;  2F0I A;  4QIW B;  4HJ5 A;  2RHS B;  2G5D A;  4KD4 A;  1C7Y A;  5K36 H;  4CDE C;  1WTW A;  3I70 A;  4S3S A;  2R6G A;  2MGS A;  5EPJ A;  1IBM L;  1C4Q A;  2QDL A;  2NVX H;  1WTR A;  1GUO A;  2JA7 H;  2EYO A;  1O7I A;  2JJQ A;  3BVZ A;  2UXC Q;  3PSI A;  3T16 A;  5JJK A;  2OT2 A;  3J80 i;  4B3S L;  2XIW A;  2Y0S G;  4C3I H;  3CCV A;  1N33 Q;  5FKA C;  3HOX H;  2JA8 H;  1C9O A;  1OO9 B;  2YYZ A;  2NVY B;  1HFG A;  3A74 A;  2UUB Q;  1K0R A;  4HTH A;  3PO2 H;  1VQI A;  1SFO H;  4A3B G;  3KOJ A;  4R9W A;  2NN6 G;  3D6C A;  3I72 A;  5IP9 H;  4JBM A;  3PUY A;  1N36 L;  1JR0 D;  3K5O A;  5COY A;  1AZQ A;  1R9T B;  3SE0 A;  3X3M A;  4LFC L;  1LTA D;  3U50 C;  1D1K A;  4RKL A;  3D4R A;  4XQQ A;  5M5X H;  1IYU A;  4GNX C;  4BA2 I;  3J80 L;  4G7O C;  4A3I H;  2K52 A;  2BE5 C;  1R4Q B;  4CGY B;  1PH5 A;  2EVB A;  1F77 A;  3OWF A;  2DY8 A;  1SR3 A;  1YNN C;  4YCW A;  2E2I H;  4YCU A;  5IYB H;  2NTS A;  1VMP A;  4YY3 Q;  5LMN L;  1QZG A;  2UUC L;  3PUV A;  3L2P A;  2Y0S B;  1Y8O B;  2ZT9 C;  1W6J A;  4HCE A;  3DUZ A;  4XTC S;  3AQQ A;  1HTP A;  3MXU A;  1KNE A;  1O7L A;  4OL7 A;  4A3B B;  5HUR A;  4MTN A;  1G2S A;  4RGT A;  5DAU A;  4BBS G;  2OQ0 A;  4A4I A;  1XNR Q;  2E2H H;  1LAC A;  2N88 A;  2B2U A;  4MIU A;  4DGZ A;  4O42 A;  1SDF A;  2BA1 A;  2JSO A;  2Q8I B;  3OIP A;  1WD1 A;  1PRT F;  4KJN A;  2K01 A;  1CA5 A;  1J5E Q;  2K32 A;  3CCJ A;  3HOW H;  2ZM6 L;  2UU9 L;  2WFW A;  2F0G A;  4WOR A;  5AFW A;  1ILP A;  2HDL A;  2WII B;  1VQA A;  1X3Q A;  3VR2 A;  4Z9C B;  4OHJ A;  5GAG C;  2G9D A;  4ALP A;  4IO9 A;  2VB3 X;  3CXC A;  2F0E A;  3GTM H;  1RD9 D;  3A0J A;  1KRS A;  1CUK A;  3TP6 A;  1SYC A;  2L0C A;  4B3R L;  4EQP A;  4LFB Q;  4BBS B;  4LW1 A;  4LF5 L;  1EQT A;  4QCL A;  1KTK A;  4DNR B;  3HEJ A;  1EY5 A;  3TP8 A;  2BH8 A;  3A8I E;  4HIO A;  1YHB A;  2Q2T A;  1SLJ A;  3MXG A;  2YU9 B;  1RL2 A;  4HIK A;  1ASZ A;  2NB0 A;  2HQL A;  4HJA A;  2LY7 A;  2JA6 G;  2EYF A;  1L0W A;  1CKN B;  2RKS A;  3M7N A;  4OON A;  2EYM A;  3T4A C;  2F1M A;  1S72 A;  3GTL H;  2Z1C A;  2IX0 A;  2R7D A;  2HQE A;  3MHB A;  4JW0 A;  5IIF A;  1STE A;  3CPW A;  4IFD G;  2NVQ B;  5FLM G;  1VQP A;  5M3F G;  5DM6 3;  3K5M A;  1ET6 A;  1QWY A;  5D3I B;  2B3G A;  3RR5 A;  2HHH L;  4CDF C;  2OEO A;  3WOF A;  3U58 A;  1SBB B;  2AQ2 B;  5LHY 1;  4GLA C;  1BVS A;  4KK7 A;  3HOU B;  2PYK A;  4PG3 A;  5ELD A;  3QB3 A;  2CKZ B;  3KDF A;  3GTK B;  2K04 A;  1PTO B;  3CKI B;  2XRS D;  1BCP B;  2V4D A;  1MJE A;  2C35 B;  3MAQ A;  3HKZ B;  1BUV T;  2LXJ A;  5BN4 A;  1XMQ L;  2ZXP A;  2JA6 B;  2NN6 I;  1G6P A;  4ZLT F;  1NMG A;  1VQ5 A;  4A93 H;  4FF4 A;  4JG2 A;  1I4Q A;  3ND8 A;  2JA9 A;  4GKJ Q;  2ALY B;  4QB4 A;  1EU3 A;  2JEA I;  1IXR A;  5J1Z A;  4K0K L;  4NXM Q;  2Z6K C;  1BBX C;  4FDB A;  4JI6 Q;  3PO3 G;  4J15 A;  2QKI C;  1F2L A;  1FNV A;  1L1O B;  4JV5 L;  1QUQ B;  1JOQ A;  4DR7 Q;  3D6W A;  1IL2 A;  4BA1 I;  4Q5V A;  1VQC A;  3MZ5 A;  2I5L X;  4CJ1 B;  1TS2 A;  4IOC A;  2F0S A;  1TS3 A;  1SJE D;  3LNN A;  1XTC D;  1ILQ A;  1NTG A;  1ZEQ X;  3UDX A;  3AMU A;  1P16 A;  1HPC A;  5FLM H;  3S2D B;  5CR3 A;  1PZI D;  3I4N H;  3SK4 A;  3CU7 A;  4UP9 A;  3B6Y A;  2HT1 A;  4E6I A;  3MEH A;  5JVG 3;  5LMU Q;  2LSS A;  3CCE A;  2F0T A;  1BF4 A;  5DNF A;  4DV4 Q;  2F0W A;  4XYO A;  1T5X D;  4X3S A;  1N9W A;  3CCR A;  4JI7 Q;  1GJX A;  2CFM A;  4CDD C;  2KED A;  4KHP Q;  4DR5 L;  2AQ3 B;  1IL8 A;  4A3F G;  5IE8 A;  3BZK A;  1K8A C;  3PO3 B;  2E2J H;  3CC4 A;  4MZ9 A;  2J7Z A;  4LMQ D;  1G91 A;  2YTV A;  1UE5 A;  4B9X A;  2UUA L;  3PQI A;  2UXB Q;  1Y1V H;  1VQ6 A;  4A3E G;  1VQG A;  4IPC A;  1CKM A;  2K75 A;  1Y1W H;  3M9B A;  2R93 B;  3DEP A;  4QMG A;  3ERQ A;  3V05 A;  2K5Q A;  3J7A 5;  4HCS A;  4CBV A;  4LAA A;  2MP1 A;  1SMY D;  4FP5 D;  4P72 A;  2F52 A;  1Q7Y C;  3T1Y L;  3I3C A;  3NTH A;  5EKK A;  2ATW A;  4RA8 A;  1MSH A;  3UI2 A;  4IPH A;  3R3O A;  5ELO A;  1EFI D;  4MN3 A;  2NVT H;  4IUP A;  4LF9 L;  1HQM C;  1BQQ T;  4GOP A;  1PRT B;  3A54 A;  2Q2U A;  2FMM A;  4C3H B;  4QUC A;  5C4J B;  1JQY D;  3LX0 A;  3DHQ A;  2VQF Q;  1PFN A;  4R4T A;  4UP7 A;  3K80 C;  1ESF A;  5I2X A;  1SYB A;  5HY6 A;  5IYC G;  4DV3 Q;  5C3E H;  3NK9 A;  4IFD I;  1JOR A;  5I9O A;  3EBE A;  2VXW A;  1NE3 A;  4FYD A;  1CZG A;  1YIJ A;  3IKJ A;  2K03 A;  1TWC B;  3BJU A;  4L6T B;  2PZU A;  3T1H L;  4IUU A;  3OHX C;  5IGG A;  2F3I A;  4GN4 B;  2WKD A;  3JAM i;  5J3B A;  1KLU D;  2F3W A;  1PYS B;  4FF3 A;  1X65 A;  1J6Q A;  4OO1 G;  4DV5 Q;  1E3P A;  1YZ6 A;  1NBW A;  1I4H A;  2B2T C;  1KLG D;  2VZA A;  3ONA B;  4GKK L;  1EIY B;  4RCO A;  1LT3 D;  1WCM H;  1TWG B;  1TII D;  2NTT A;  2D0P A;  4AH6 A;  2R92 H;  5FO9 B;  3W5O A;  4YY3 L;  2IX3 A;  5M5W H;  1W6K A;  4C3J G;  1EIH A;  2F0P A;  1VQ4 A;  1IYJ B;  1U4L A;  2JA5 H;  1UE1 A;  3S1N H;  4DR1 Q;  1B70 B;  5KNC A;  2LFN A;  1I6V C;  2L11 A;  2Q8T A;  1GXD C;  4P73 A;  3N6R A;  1I50 H;  3N52 A;  4K14 A;  3RD4 A;  4HJ7 A;  5IYC H;  1CHP D;  4JI0 Q;  4LF7 L;  3ULJ A;  3O13 A;  3J81 L;  4QIW E;  1CK1 A;  4PZ7 A;  3D31 A;  3HGB A;  2O5J C;  4JPB W;  4LNQ A;  4Y7N H;  2GA4 B;  1EFW A;  3QIA A;  2F0J A;  1EQR A;  3K0Y A;  1PH2 A;  1LM0 A;  1AW7 A;  3CQZ H;  1B7Y B;  5IY0 A;  4DUZ L;  1STH A;  3VYU A;  2CQO A;  4HSP A;  1PYB A;  2F0F A;  2F0Q A;  3A5Z B;  4C3J B;  2PQE A;  1PH3 A;  4G7H C;  2PQA B;  3KYH C;  3MVV A;  4LJZ C;  3PIO A;  2EXD A;  2EJM A;  2RSO A;  1YJN A;  1SNM A;  3BDL A;  1IYV A;  1F2Z A;  3UE1 A;  3PIP A;  1SE3 A;  3NBH A;  1HR0 W;  3TME A;  3GV6 A;  1JIC A;  1LTG D;  1PFS A;  2OXP A;  5IGB A;  3EVQ A;  2K5D A;  3TP5 A;  2OTL A;  4B3T Q;  1O7Z A;  4DV7 Q;  2TMP A;  1KL9 A;  1LT5 D;  1IKM A;  3TQY A;  4IUV A;  4LFB L;  4PQX A;  2SDF A;  4JI4 Q;  3K59 A;  1N32 Q;  4L5T A;  1EWC A;  1AZP A;  3GTJ B;  3LWE A;  3KF6 A;  4IUQ A;  2O5I C;  5GRO A;  1QNU A;  3Q24 A;  3FEW X;  3EN2 A;  4DAP A;  1V1O A;  2EY1 A;  1EY0 A;  4DR6 Q;  4X66 Q;  4A3D G;  4H7B A;  2OTJ A;  1K83 B;  2JP1 A;  5BR8 Q;  2I07 B;  2DNE A;  2LMC B;  3K0X A;  2PW5 A;  2L1B A;  4A3K G;  1PV4 A;  5E4X A;  4ABN A;  1SNO A;  2GN5 A;  4HN7 A;  4DUY Q;  4I65 A;  1KAB A;  3GTP B;  1I3Q B;  1E24 A;  3E0J A;  1I94 Q;  1FD7 D;  1STB A;  4F87 A;  1TR5 A;  1LTI D;  5H1S E;  4RGM A;  1X9N A;  1I6H B;  4FF1 A;  1Z9F A;  4DR4 L;  1NY4 A;  4DV0 L;  2QF7 A;  4RWS C;  3J80 c;  1II3 A;  4YWK A;  3NPP A;  4LFA Q;  2EYL A;  3VA7 A;  4P71 A;  2LKV A;  1S5B D;  4QY7 A;  3AYH B;  1HH2 P;  3UDI A;  1Y8N B;  5GAE C;  2F3V A;  3H0G H;  2R3Z A;  2SEB D;  1R4P B;  3GTQ H;  1M90 C;  4BY1 G;  2MFI A;  4KN7 C;  2YTX A;  1U4M A;  3MFY A;  5FOB B;  2RCN A;  4AIM A;  3CW2 C;  4A3D B;  2ZXO A;  1AN8 A;  4V19 0;  3E0E A;  4DKA C;  1PTO C;  1BCP C;  1LT6 D;  2Z0S A;  4DPG A;  3CMA A;  2DGY A;  1CI3 M;  4DR3 Q;  1EY4 A;  3A56 A;  3BZD B;  1H9K A;  4L5S A;  4CJ0 B;  4K8J A;  3S15 B;  4A3J G;  2BE5 D;  2JQO A;  4BBR G;  5JEA H;  4DA2 A;  1FNW A;  1TWH H;  1YNN D;  3T13 A;  3CCU A;  2V1C C;  2M9V A;  5IYD G;  1BXT A;  5FO8 B;  4BXX G;  2H4O A;  5C3X A;  5HGT A;  3URY A;  2ZJR A;  4A3K H;  3FP9 A;  1L1O C;  4JI3 L;  4A75 A;  1HNX Q;  1E2W A;  1EY9 A;  2N78 A;  2F0L A;  4C2M B;  2EZV A;  4DNI A;  4X62 Q;  1PH9 A;  4BY1 B;  3PGZ A;  4KHV A;  1QE6 A;  3STB C;  5C0X I;  1P8L A;  4CKE A;  1TY0 A;  5FO7 B;  3E9I A;  1V1Q A;  1NAP A;  3SK6 A;  3S1Q H;  4LF4 L;  3NUC A;  3C2P A;  3RZD B;  1YVC A;  1RJT A;  3FRP B;  3C3L A;  1Q8K A;  3W1B A;  3PUX A;  1QJO A;  4F8M A;  4UDU C;  3FHW A;  3HOV G;  3A8J E;  1N34 L;  4A3J B;  1HZA A;  2FIN B;  1XPU A;  4BBR B;  3F2C A;  1EIF A;  1HNW Q;  3NP8 A;  4M8A A;  4KD3 A;  3K7A H;  1U0L A;  2EY2 A;  2XVS A;  4U68 A;  1FR3 A;  3HOZ G;  3K81 C;  3FMC A;  4KMU C;  1I4G A;  1OXV A;  4OWX B;  2XWB B;  5CBA E;  2XN9 C;  1RF2 D;  3S1M H;  4JBK A;  5JJL A;  5NUC A;  3L0O A;  3V2T A;  2XGT A;  1JMC A;  5CGK A;  5G3L D;  3HKZ E;  1LO5 D;  3AU7 A;  2EYP A;  3H6M A;  2N3S A;  4TRD A;  4OEL B;  5C4X H;  4HAE A;  2K5W A;  3CRL C;  1SJH D;  2VUM G;  2ES2 A;  1I4P A;  3PO2 B;  1SFO B;  3PMF A;  1EY7 A;  4NXN L;  1IBL Q;  1GUT A;  2EPB A;  1SN8 A;  3S16 H;  2F0V A;  3I4M G;  2XWJ B;  5ELC A;  3VDY A;  3HOV B;  5EPK A;  2RDH A;  3WDN A;  2VQF L;  1ICF B;  1XXG A;  4K6L A;  4X3K A;  1F9R A;  1GOZ A;  1LV9 A;  4A3I B;  3HOZ B;  1PRT C;  2LXK A;  4HSV A;  4JI5 Q;  2VQE L;  1L0X B;  4A3L G;  1Q8I A;  3IFD A;  2E2I B;  1TWF B;  1A6X A;  1X54 A;  1QVC A;  4A3G G;  4RFB A;  1R9T H;  1SYD A;  2R7F A;  2MUY A;  3U4Z A;  1E0B A;  4I7A A;  3KLW A;  1XNQ Q;  2NZH A;  4C1N I;  5D14 A;  1HUN A;  1A3V A;  1DZ1 A;  3A7L A;  2VUM B;  5CMD A;  3M3Y B;  3KDF B;  1W3S A;  4RHR A;  1K9M C;  2A6H D;  2MO1 A;  2RBM A;  4IOA A;  4KLK A;  4K5W A;  3I4M B;  4M1U B;  1G2T A;  1RTN A;  1EWI A;  3S1R B;  3T51 B;  5C5L A;  1E7Z A;  4DR2 Q;  5EAY A;  3NTI A;  5C5M A;  2B8G A;  4JOI A;  1MSG A;  4A3B H;  1EYG A;  4ZAI A;  3CCS A;  2B63 G;  2NN6 H;  2DY7 A;  5C44 G;  2H1E A;  3J80 E;  1CHQ D;  4L8J A;  1VQD A;  4DV6 Q;  4A3G B;  1VQ9 A;  2K5H A;  3HKS A;  3KFU A;  3P1H A;  2UXD L;  5COR A;  4RMF A;  1VS0 A;  1KHI A;  2RCF A;  2F4V L;  3I56 A;  1PA6 A;  5CC4 A;  1VF5 C;  3GP7 A;  1ICW A;  4GLX A;  4K5X A;  3RUZ A;  4R4I A;  5IGE A;  4WJ4 A;  3OMC A;  3PIO 3;  3NWS A;  5AJ3 L;  3LGJ A;  1BDO A;  3HOU G;  3PIP 3;  1CA6 A;  3J81 j;  1K73 C;  1UNS A;  5C0X J;  3OTO Q;  1DON A;  1KAA A;  2KUM A;  3I2Z A;  2KCT A;  4AQY Q;  1AE3 A;  1S5C D;  3RN5 A;  2M00 A;  1G29 1;  4BY7 G;  4ZUI A;  3HKZ G;  4EGV A;  3AEV A;  1DGS A;  3K5N A;  3PUW A;  1B9M A;  4DXF A;  1FJG Q;  2B63 B;  5C44 B;  2BOS A;  1B44 D;  1I4R A;  1MGS A;  1F9P A;  1MHW C;  3ND9 A;  1QNK A;  4K8I A;  3W1G A;  1IKL A;  1BOS A;  4NP5 A;  4BBS H;  2HD3 A;  2CHB D;  5CV8 A;  2FHT A;  1NCV A;  1VQE A;  4XIG S;  2B2V C;  2MO0 A;  4IPG A;  2D0O A;  2YU9 H;  1YEZ A;  4QJF A;  5DM7 3;  1IW7 C;  1S5D D;  2KHJ A;  4X64 Q;  2BA0 A;  1K0S A;  4CDC C;  4JI2 L;  1DOM A;  2PCF B;  2WB1 E;  3GQB A;  3I4L A;  2IX1 A;  1VQJ A;  2H5X A;  1VQF A;  3NWT A;  1DOK A;  2WKC A;  1KAW A;  3MXN A;  3P7J A;  2G9H D;  2NVQ H;  1JE5 A;  1NNX A;  2A6H C;  5IWA L;  4XQN A;  2KEE A;  4RGO S;  4BY7 B;  1KDC A;  1ZXT A;  4HJ8 A;  1PLF A;  2KA7 A;  1OXS C;  4P2C B;  4DUY L;  1M8A A;  3ERS X;  4L5Q A;  4OEM B;  5CV4 A;  4GOP B;  2OF1 A;  3A55 A;  3G6E A;  5L37 A;  1EL0 A;  4A3C G;  4YHH Q;  2M2L A;  1B8A A;  3VR5 A;  1Q3L A;  5JPN C;  4LF6 Q;  3KLS A;  3A7A B;  2ZJP A;  1SNC A;  4LFA L;  3BZC A;  3GTK H;  1F9S A;  1PTO H;  4PV1 C;  1O7Y A;  1G51 A;  1E22 A;  1WYD A;  2HDM A;  4X3T A;  3M4Y A;  2JA6 H;  3L9A X;  4HJ9 A;  2IY5 B;  5E1F A;  3W3A A;  1B9N A;  4DN4 M;  3H91 A;  4OX9 Q;  3S14 B;  2YV5 A;  4V0B A;  4K6D A;  1XMO L;  2R93 G;  1FL0 A;  3H94 A;  5CV7 A;  2SNM A;  4IFD H;  5EPL A;  1FVI A;  2PPB C;  4JYA Q;  2XTI A;  1H9R A;  1H9S B;  1LTR D;  1X56 A;  2EY5 A;  2P5Z X;  4GLV B;  5M3F H;  1BR9 A;  3E9H A;  3TRZ A;  5M3M B;  2E75 C;  3I4N B;  3NTK A;  4C56 C;  1KQS A;  1GHJ A;  1DOL A;  2SNS A;  3VYT A;  4RAU C;  1D2B A;  1WOC A;  1PH4 A;  3FDT A;  3OW7 A;  4TVA B;  3GTG B;  3J81 c;  1F2Y A;  2MQH A;  5IGC A;  2PNR C;  2EJF C;  1Y8P B;  3HS0 C;  4XXE A;  2JK8 A;  1SEB D;  3IAY A;  4JI8 Q;  3S2D H;  4C3H G;  1CQF A;  1VQN A;  4B3M L;  2B2Y A;  2L9H A;  1HUM A;  1SNP A;  2B2W C;  4ME5 A;  4GN5 A;  1LTL A;  1LUZ A;  1MD2 D;  2JYO A;  4LF8 Q;  1S4Z A;  3DXJ C;  4X62 L;  1GVP A;  3OMG A;  2KBN A;  2JEB I;  2D62 A;  3U9O A;  1HR0 Q;  2HCC A;  4DV1 L;  3SK8 A;  1HNZ Q;  3NXW A;  5C4Z A;  3PO3 H;  2F0U A;  1Z47 A;  5I6Y A;  4POF A;  2A19 A;  3QWN A;  4ZQ3 A;  4DV2 Q;  1NR2 A;  3HG9 A;  2R7Z G;  1LYL A;  1HXY D;  4ODG A;  1S5F D;  1TVX A;  3Q23 A;  1IBM Q;  1JB3 A;  3KJO A;  1S5E D;  2R93 H;  1J8I A;  1XPO A;  2F03 A;  1CSP A;  2WB1 G;  1UE6 A;  1UE7 A;  3VA5 A;  4IUN A;  3NE5 B;  3NHH A;  2L4N A;  3X3N A;  1YIT A;  2B2U C;  4KY6 A;  2QEX A;  1E2Z A;  4ZKB B;  3DM1 A;  1H95 A;  2BCO A;  4B3S Q;  1KD1 C;  1D5Z C;  3VR4 A;  2ICE C;  4WRD A;  5DEH A;  4ZCK A;  2CCZ A;  2EY6 A;  4QUF A;  2UXC L;  1RIP A;  2ID0 A;  2L12 A;  1XPR A;  2GVA A;  3K8A A;  3NBH B;  3VR6 A;  5C4H A;  1N33 L;  2IHF A;  1CTM A;  1EYC A;  4A3F H;  1UUP A;  3K58 A;  3BG3 A;  4DU9 A;  4KKT A;  3P75 A;  4A3M G;  1T5E A;  1N36 Q;  4KHZ A;  4C3H H;  2WAC A;  2UUB L;  1XJV A;  1HFN A;  4QGU A;  4LFC Q;  2R7Z B;  3KF6 B;  4A3E H;  2E74 C;  1G6Z A;  4CKB A;  4ZUJ A;  3GDE A;  3M4Q A;  5ISR A;  2FFK B;  3S2H B;  1I5F A;  4H02 A;  4EVO A;  2WB1 B;  1SNQ A;  1NMF A;  2A69 C;  1JC7 A;  5LMN Q;  1ZKO A;  4APV A;  5JVH 3;  1TWC H;  2UUC Q;  2XRQ D;  5CBE E;  1KDA A;  4RG1 A;  3S17 B;  3ULL A;  5M5Y B;  2Z9H A;  1SXT A;  3L7Z C;  1DD2 A;  1F2M A;  1XYI A;  1SSO A;  4K5V A;  2EYJ A;  3JAM L;  2JA5 B;  4A3M B;  3QR8 A;  4C1N K;  3VYS A;  1ASY A;  1Q1E A;  4NKL A;  1VQB A;  1C8C A;  3PUZ A;  2EOT A;  3NBI A;  5C0X G;  5KEE A;  1EOT A;  1I50 B;  3Q22 A;  2EJG C;  3I4O A;  1MJC A;  2WIN B;  4XYQ A;  2FMC A;  1C0A A;  1XNR L;  2O4X A;  1VQK A;  1CZW A;  3FPP A;  4J6H A;  3AFQ A;  4JBW A;  2ZM6 Q;  1PTO D;  1V1P B;  2PNH A;  2UU9 Q;  1BCP D;  2GVB A;  1JOO A;  2K33 A;  4EQ5 A;  2BH2 A;  1VQL A;  1EOV A;  1ONL A;  3CC7 A;  4Y7N B;  3RN2 A;  1D1I A;  2CWA A;  3RZO B;  3KBX A;  4X65 Q;  5FJ8 G;  1J5E L;  2IJ0 A;  5JPM C;  1HA5 A;  2F0H A;  1ENC A;  1SRU A;  4AYB G;  1U4R A;  1WTO A;  5KRU A;  1Y69 U;  4PZ6 A;  5TSS A;  3DMU A;  1KRT A;  4OO1 H;  4ILW A;  3GTO B;  1HHV A;  2PZW A;  3C1E A;  2L15 A;  3BDO A;  3EFX D;  4LF5 Q;  4GNX A;  2EQS A;  2OQK A;  2D2C C;  1TU2 B;  1GM5 A;  3LWU A;  2HUG A;  3OTO L;  1IHZ A;  1A2U A;  2WAQ B;  2D9U A;  4C3J H;  3STB D;  3J7A V;  1D8L A;  1JJG A;  5D65 A;  2EYH A;  4N8X 1;  1PFM A;  1X3E A;  1FGU A;  2Z8L A;  1EUJ A;  4XT1 B;  3J81 E;  2PI2 A;  1FJG L;  1PMR A;  1SE4 A;  3KK7 A;  1EQQ A;  5IP7 G;  3ULP A;  2K1B A;  3KLR A;  3KJP A;  5C0X H;  5ELE A;  1JE4 A;  3OIQ A;  4FXD A;  3FPU B;  3OYY A;  4LUZ A;  2A73 B;  5ELB A;  4AYB B;  5IT9 c;  3GTJ H;  3I8Z A;  1RHP A;  3TSS A;  1W2B A;  4IUT A;  2F4I A;  2E2D C;  5IOC A;  1HZC A;  1XX8 A;  2K28 A;  1PH1 A;  2IL8 A;  1TS4 A;  3WWV A;  3HOY G;  3QOL A;  4F7X A;  1K83 H;  3R8B A;  3D3R A;  3D8G A;  5C3W A;  1TS5 A;  2X69 A;  1BO0 A;  1X6O A;  1XMQ Q;  5J39 A;  1QIL A;  3RMH A;  4IUR A;  3GTP H;  1VQ7 A;  1EWH A;  4YIJ A;  1ROD A;  1I6H H;  2EXZ A;  4DF7 A;  1PH6 A;  1M1K C;  2B39 A;  1PVO A;  3M4O B;  1A3T A;  1DYQ A;  4UPA A;  3SXH A;  2E5L Q;  2PO4 A;  4L5R C;  5LL6 X;  4K0K Q;  4OIJ A;  3WOE A;  3DM3 A;  4GKJ L;  1SYE A;  5JAV A;  3MFG A;  4DK0 A;  3H3V I;  3SR1 A;  4JV5 Q;  3FKI G;  4NXM L;  2CW0 C;  4JI6 L;  1RDP D;  5LMN W;  4OWW B;  4J1M A;  1CT1 D;  3UE0 A;  1EEF D;  1Q82 C;  2F0O A;  1PRT D;  2KCN A;  3TS2 A;  4DR7 L;  3P20 A;  1K8M A;  2N55 A;  2RF4 A;  4KY7 A;  4GS3 A;  5EBC A;  1K3R A;  3HOY B;  4A3D H;  2K5N A;  2I46 A;  3ERO A;  1YNJ D;  3Q8D A;  3RLO A;  3S9W A;  1NR4 A;  3EJI A;  4HIM A;  4DK1 A;  1VQH A;  1TKW B;  2F0N A;  2ZTC A;  4LUV A;  3CC2 A;  2NBF A;  3DWP A;  1Q1B A;  3V96 A;  4X3U A;  1TWA B;  3S15 H;  3EIV A;  2RQX A;  2X6L A;  1JWM D;  4C3I G;  1D6E C;  1EU4 A;  4YCV A;  1KNA A;  2KHS A;  5LMU L;  3HOX G;  4DR5 Q;  2JA8 G;  3C1F A;  2B2V A;  5EGT A;  4DAM A;  2RDG A;  5JJZ A;  2MJ8 A;  1GHK A;  4DV4 L;  4JI7 L;  3PO2 G;  1YJW A;  4RCN A;  2FJ2 A;  1WVL A;  4KHP L;  3H09 A;  5IGF A;  3FKI B;  2UUA Q;  1K3B C;  5IP9 G;  2CVR A;  3I90 A;  4FVM A;  1SND A;  4C2M H;  5BN5 A;  1EY6 A;  2JN4 A;  4BY1 H;  3BVG A;  1CQV A;  4UAI A;  2ZTD A;  1JB7 A;  2HIX A;  5M9O A;  2ENB A;  2UXB L;  1F9Q A;  1FGB D;  4ZK9 B;  1AEX A;  2KEN A;  1LTB D;  2Q8R E;  1VQM A;  1STN A;  1K28 A;  4A3I G;  1CFM A;  1EYA A;  1HR0 L;  4JK1 C;  1U4P A;  4K2L A;  2N8N A;  3QG1 A;  1A2T A;  4BS9 A;  4DNT B;  3K57 A;  4G4K A;  1PH8 A;  4LWC A;  2IT1 A;  3RZD H;  1GUW A;  4KJO A;  3T1Y Q;  3S24 A;  2NVX B;  3SEB A;  2JA7 B;  1PFB A;  5IYB G;  1Q86 C;  1SMX A;  1B3A A;  1SE2 A;  4O1N A;  4DAY A;  4A3J H;  3CCL A;  2Z6K A;  4C3I B;  1ENF A;  2QCP X;  4BBR H;  4XQJ A;  1D7Q A;  3MA2 B;  3HOX B;  4LF9 Q;  2JA8 B;  2C9O A;  5C4X B;  4OIK A;  4X6A H;  1X55 A;  2CH4 W;  2NZ1 D;  5IYD H;  4BXX H;  3NSW A;  4KTA A;  1MKH A;  2QA4 A;  2QGQ A;  4NB3 A;  3DEO A;  3PV0 A;  3UDG A;  3S16 B;  3OWE B;  1T9H A;  5IGD A;  1BBW A;  5IT9 L;  2OCE A;  2K6A A;  2A74 C;  2KEC A;  5FLX c;  5M5X B;  2NVY H;  1VQ8 A;  1AH9 A;  4DV3 L;  5CV5 A;  3IFT A;  5I4D A;  3HP3 A;  1OXX K;  1FNU A;  3T1H Q;  3HOW G;  3K5L A;  4DFA A;  1GUG A;  1EZ8 A;  1B50 A;  2QDB A;  1HZB A;  5D3D A;  3HOV H;  1YNJ C;  1XWE A;  3AFP A;  1IW7 D;  2F0M A;  1WI5 A;  3IL8 A;  4N9T A;  1I4X A;  1WTP A;  3HOZ H;  2B2W A;  3EA6 A;  2HCI A;  1A0I A;  3MXN B;  4GKK Q;  1MI2 A;  2IHE A;  4R1J A;  1B1Z A;  4DV5 L;  1TWF H;  1YNX A;  4YWM A;  1EY8 A;  4R8I A;  4KY5 A;  4OXP A;  4B9W A;  1IZ6 A;  4JVZ A;  5EKL A;  1E1T A;  2E2H B;  4MNO A;  1ZYR C;  5KYI A;  5IT9 E;  3OOC A;  2QW7 A;  2RDF A;  1GKH A;  1L2F A;  4GZY C;  2VUM H;  3M3Y H;  1EZ6 A;  1CKO A;  3K6O A;  2HIV A;  2N49 A;  4O2D A;  3NQT A;  4DXG A;  1NJI C;  2KCM A;  1UWV A;  3CD6 A;  3HOW B;  1OXU A;  3I4M H;  5J22 A;  4DR1 L;  1PZK D;  2A6E C;  1SRO A;  3S1R H;  3KF8 A;  4HMJ A;  4LF7 Q;  5KNB A;  1D5X C;  1PXU A;  1KDB A;  1X32 A;  5T1I A;  2ZTE A;  3R93 A;  3DLL A;  4JI0 L;  1BBU A;  2DUD A;  4A3L H;  1DXM A;  3GTM B;  5KIX A;  4DUZ Q;  1CM9 A;  4A3G H;  1QZH A;  4X65 L;  2I5M X;  2KQ3 A;  3H3V C;  1OTC A;  4H44 C;  3L3O C;  1QG7 A;  5I6W A;  2XNA C;  2PW7 A;  1VCI A;  4A93 G;  2KHI A;  1KIX A;  2DJF C;  1VF7 A;  3CRK C;  2ASB A;  4UP8 A;  2WV6 D;  5DLQ E;  4B08 A;  5KND A;  1PH7 A;  5GAD C;  3GTL B;  2YTY A;  4B3T L;  4KKU A;  5HGQ A;  1WTV A;  2B29 A;  4DV7 L;  2Z6B A;  1NSN S;  3F2B A;  2B2T A;  4LK1 C;  5I9P A;  1O78 A;  4JI4 L;  3I91 A;  5CV6 A;  5EKI A;  1N32 L;  1Q46 A;  2B63 H;  5C44 H;  2PI2 E;  3A5U A;  2E76 C;  1G8Z D;  1HCZ A;  3F8T A;  4DR6 L;  4UHV A;  4X66 L;  3U9S A;  1X3P A;  2TSS A;  2ZJQ A;  5BR8 L;  1RCV D;  5M3M G;  3I4N G;  3U4V A;  1IBK Q;  5FLX L;  2KJX A;  4DR4 Q;  2AMC B;  1DCZ A;  4DV0 Q;  3SGI A;  1D5M C;  3F2U A;  3BDC A;  4A93 B;  5A35 A;  1U9R A;  1I94 L;  3BYY B;  5G3L F;  3HOU H;  1LLR D;  1PZJ D;  4IQZ A;  2IPK D;  3TN2 A;  4IN3 A;  1K8O A;  1SAP A;  1UEB A;  2E8G A;  3BU2 A;  3OSO A;  4ID6 A;  1GD7 A;  4QF4 A;  3SDZ A;  2K14 A;  4BY7 H;  1U5K A;  3Q0A A;  1A3U A;  1Y1V G;  3VYR A;  1YHA A;  1EQV A;  5JEA J;  2ICI A;  1MBY A;  4R4C A;  1Y1W G;  4QL5 A;  2AUJ D;  1WTH A;  3JAM c;  1PHJ A;  2KOL A;  2DN8 A;  2E5L L;  4GN3 B;  4G57 A;  4WFN 3;  2WP8 J;  3PF4 A;  4JI1 Q;  4KV6 A;  4PMB A;  5M3F B;  5ELF A;  3RLN A;  4ULL A;  1WFQ A;  5K5P A;  2Z4H A;  4JBJ A;  2KVM A;  2VY3 A;  4HR7 B;  4DR3 L;  1WTX A;  2QIL A;  3S14 H;  2AHO B;  3UDF A;  3CCQ A;  1JT8 A;  5FLX E;  2A69 D;  2K50 A;  3ITP A;  3QJY A;  4POG A;  3I7F A;  4Y52 H;  4JI3 Q;  3TZU A;  2E2J B;  4ZRZ A;  4ME3 A;  2RA4 A;  2EIF A;  4TSS A;  5M3M H;  3NEL A;  3D4D A;  1EYD A;  3G48 A;  4K2K A;  1HNX L;  1Y1V B;  2NUC A;  2WAQ E;  4KN4 C;  4R4O A;  4OGQ C;  2X6G A;  1X3G A;  1Y1W B;  3GTG H;  4A3C H;  2A68 D;  5C3E G;  4PMW A;  2I5H A;  4R8N A;  1UEA B;  1J9O A;  4LF4 Q;  1CKN A;  1X3F A;  1PYW D;  1STA A;  2R61 A;  3G71 A;  5T1G A;  1N34 Q;  1KXL A;  1RTO A;  2I0Q A;  3T56 B;  2MNA A;  2IWH A;  2MPM A;  2PMZ E;  4AYB E;  3QOJ A;  5GQO A;  2NVT B;  4P74 A;  1AE2 A;  5IOD A;  3ZJY C;  3AB9 A;  1HNW L;  3DWQ A;  4N9P A;  1M4V A;  3Q6S A;  4IJH A;  2JXM B;  1HA6 A;  2XSC A;  3VR3 A;  3G6J B;  1GO3 E;  4WJ3 M;  4EQO A;  4JOI C;  3I73 A;  1WCM G;  4I7Z C;  3A8K E;  5E7N A;  2R92 G;  1Y14 B;  2AWN A;  4P75 A;  1E1O A;  4U67 3;  1DM0 B;  5C3E B;  4GNX B;  4NXN Q;  1XTD A;  3M7G A;  4A3F B;  5EJW A;  2JA5 G;  3CCM A;  1TY2 A;  4XDX A;  3KBG A;  4NMZ A;  2PZT A;  5C4J H;  4NDX A;  3MC0 B;  1IBL L;  1K8G A;  3FVQ A;  3NEN A;  3BVM A;  3NEM A;  4A76 A;  4A3E B;  4RHS A;  1L1O A;  1QUQ A;  2FXQ A;  5LL6 S;  1SYF A;  4JC0 A;  4EQN A;  2VQE Q;  3M85 A;  3D0F A;  1VDZ A;  3R2T A;  3SVM A;  4JI5 L;  3TEH B;  1CSQ A;  5BN3 A;  4IJL A;  3F1Z A;  1VQO A;  1JJ2 A;  3E5S A;  1WCM B;  1QCB D;  4PMC A;  2R7Z H;  1B3Q A;  1H9S A;  2R92 B;  2VS1 A;  3RLF A;  4UY8 C;  4TKO B;  1QVG A;  3T53 B;  2L5T A;  3HFZ B;  5M5W B;  2K5V A;  4DAV A;  1SE8 A;  3OW2 A;  1XNQ L;  3S2H H;  2VB2 X;  2VNU D;  3GD7 A;  2A1A A;  2IW3 A;  3PCO B;  5E3F A;  4RH6 A;  3S1N B;  5EQ0 A;  1QB5 D;  2CQA A;  4YWL A;  2A68 C;  1WD0 A;  4R4Q A;  4OWT B;  1TWG H;  4QQB X;  2AWO A;  1HRJ A;  3MXP A;  1QOH A;  3J81 i;  1H9M A;  3S17 H;  5M5Y H;  3J7A F;  3JC6 6;  2WAQ G;  2F0D A;  4KI0 A;  5I2Y A;  4DR2 L;  1HTL D;  4IZ8 A;  1BNZ A;  4NW2 A;  4L63 B;  3M4P A;  1OXT A; 
#chains in the Genus database with same CATH homology
 3NQI A;  1B2T A;  2A5H A;  1UAP A;  3SHL A;  2J4X A;  2CW0 D;  3GO5 A;  2K05 A;  3G7L A;  3CQZ B;  2BDO A;  2ZXR A;  1RKN A;  3MTS A;  3OPO A;  2KCC A;  1SMY C;  4BWG B;  1JCK B;  1STG A;  2AUK A;  3HZX A;  1A15 A;  1JOK A;  2RSN A;  1VMC A;  1NUC A;  3R2I A;  1Q12 A;  3KLS X;  3JAM E;  1V8Q A;  2LS0 1;  4KKS A;  5F2D A;  4MHE A;  2SOB A;  3ZYY X;  2BDN A;  2NWG A;  1Q90 A;  2MHV A;  1JWS D;  1AP0 A;  4HMI A;  3TP7 A;  1PDQ A;  4FO2 A;  3TZD A;  2O2L D;  4G7Z C;  4WJW A;  5FK9 C;  4TQU S;  2PMZ B;  5JOB A;  2RVL A;  4RKB A;  3QO2 A;  1C48 A;  4F88 A;  5KGU A;  4H0L C;  5JEA G;  2NYZ D;  2B2Y C;  2Z4I A;  1ESR A;  1V43 A;  1TT2 A;  3TBI B;  4ZYS A;  3DWA A;  4CHT B;  1O80 A;  3H0G B;  1H9J A;  3GTQ B;  4CKC A;  2C5C A;  3BYT B;  4IAL A;  4FXG C;  2QEJ C;  5A2Q L;  5CYU A;  1EEI D;  1LTS D;  1JWU D;  2EDG A;  3BS1 A;  3KUP A;  4IFD J;  4FF2 A;  5CV9 A;  4XT3 B;  3C46 A;  2F0K A;  4CJ2 C;  1DJR D;  2K7V A;  5K36 G;  1TWH B;  4HED A;  2EE1 A;  2AQ1 B;  5E4W C;  4ZKC B;  1V1P A;  1GUS A;  1LT4 D;  4A3K B;  3W2D A;  4RGN A;  1FYC A;  4OO1 I;  1B53 A;  3TDQ A;  3HRZ C;  5C6A A;  3EQL C;  2J0T D;  1SYG A;  4Q0F A;  2D5D A;  4PNY A;  1LAB A;  1STY A;  1EIG A;  5EBD A;  5A2Q E;  1E2V A;  3S1Q B;  5KYL A;  1ZYR D;  3J7Y W;  2L55 A;  1WTQ A;  4H13 C;  4FXK C;  4J8Q A;  1Z7T A;  4FNF A;  1ENA A;  1L0Y B;  1ML0 D;  1Z6H A;  1ET9 A;  2DNC A;  1LTT D;  3SK5 A;  3K7A B;  3D4W A;  2A6E D;  1HQR D;  1AFP A;  3GV3 A;  1PTO F;  1BCP F;  3CHB D;  1TQO A;  1B4O A;  2JE6 I;  3E6Z X;  2B8F A;  1GUN A;  3S1M B;  3MWY W;  2F0I A;  4QIW B;  4KD4 A;  5K36 H;  1WTW A;  3I70 A;  4S3S A;  2R6G A;  2MGS A;  5EPJ A;  1C4Q A;  1WTR A;  1GUO A;  2EYO A;  3BVZ A;  3T16 A;  2OT2 A;  2XIW A;  5FKA C;  1OO9 B;  2YYZ A;  2NVY B;  1HFG A;  4HTH A;  4R9W A;  2NN6 G;  3D6C A;  3I72 A;  3PUY A;  1JR0 D;  3K5O A;  5COY A;  1AZQ A;  1R9T B;  3SE0 A;  3X3M A;  1LTA D;  1D1K A;  4RKL A;  3D4R A;  4XQQ A;  1IYU A;  4BA2 I;  3J80 L;  4G7O C;  2BE5 C;  1R4Q B;  4CGY B;  2EVB A;  1F77 A;  3OWF A;  2DY8 A;  1YNN C;  2NTS A;  1VMP A;  3PUV A;  2Y0S B;  1Y8O B;  2ZT9 C;  1W6J A;  4HCE A;  3DUZ A;  4XTC S;  1HTP A;  3MXU A;  1KNE A;  1O7L A;  4OL7 A;  4A3B B;  5HUR A;  1G2S A;  4RGT A;  5DAU A;  1LAC A;  2N88 A;  2B2U A;  4MIU A;  4DGZ A;  4O42 A;  1SDF A;  2BA1 A;  2JSO A;  2Q8I B;  3OIP A;  1WD1 A;  1PRT F;  4KJN A;  2K01 A;  1CA5 A;  2K32 A;  2F0G A;  4WOR A;  5AFW A;  1ILP A;  2HDL A;  2WII B;  1X3Q A;  3VR2 A;  4Z9C B;  4OHJ A;  2G9D A;  2VB3 X;  2F0E A;  1RD9 D;  3TP6 A;  1SYC A;  2L0C A;  4EQP A;  4BBS B;  1EQT A;  4QCL A;  1KTK A;  4DNR B;  3HEJ A;  1EY5 A;  3TP8 A;  3A8I E;  3MXG A;  2YU9 B;  2NB0 A;  2LY7 A;  2EYF A;  2RKS A;  3M7N A;  2EYM A;  3T4A C;  2F1M A;  2Z1C A;  2IX0 A;  2HQE A;  3MHB A;  5IIF A;  1STE A;  4IFD G;  2NVQ B;  5DM6 3;  3K5M A;  1ET6 A;  1QWY A;  5D3I B;  2OEO A;  3WOF A;  1SBB B;  2AQ2 B;  5LHY 1;  4KK7 A;  3HOU B;  2PYK A;  5ELD A;  3QB3 A;  3GTK B;  2K04 A;  1PTO B;  3CKI B;  2XRS D;  1BCP B;  2V4D A;  3MAQ A;  3HKZ B;  1BUV T;  5BN4 A;  2ZXP A;  2JA6 B;  2NN6 I;  4ZLT F;  4FF4 A;  1I4Q A;  3ND8 A;  4QB4 A;  1EU3 A;  2JEA I;  5J1Z A;  1BBX C;  2QKI C;  1F2L A;  1FNV A;  1JOQ A;  3D6W A;  4BA1 I;  4Q5V A;  3MZ5 A;  4CJ1 B;  1TS2 A;  2F0S A;  1TS3 A;  1SJE D;  3LNN A;  1XTC D;  1ILQ A;  1ZEQ X;  3AMU A;  1HPC A;  3S2D B;  5CR3 A;  1PZI D;  3SK4 A;  3CU7 A;  4E6I A;  3MEH A;  5JVG 3;  2F0T A;  1BF4 A;  5DNF A;  2F0W A;  4XYO A;  1T5X D;  4X3S A;  1GJX A;  2KED A;  2AQ3 B;  1IL8 A;  3PO3 B;  2J7Z A;  4LMQ D;  1G91 A;  4B9X A;  2R93 B;  3DEP A;  4QMG A;  3ERQ A;  3V05 A;  2K5Q A;  4HCS A;  4CBV A;  4LAA A;  2MP1 A;  1SMY D;  4FP5 D;  3I3C A;  3NTH A;  5EKK A;  4RA8 A;  1MSH A;  3UI2 A;  3R3O A;  1EFI D;  4MN3 A;  4IUP A;  1HQM C;  1BQQ T;  1PRT B;  3A54 A;  2FMM A;  4C3H B;  4QUC A;  5C4J B;  1JQY D;  3LX0 A;  3DHQ A;  1PFN A;  1ESF A;  5I2X A;  1SYB A;  3NK9 A;  4IFD I;  1JOR A;  5I9O A;  2VXW A;  4FYD A;  1CZG A;  3IKJ A;  2K03 A;  1TWC B;  4L6T B;  2PZU A;  4IUU A;  3OHX C;  5IGG A;  2WKD A;  1KLU D;  2F3W A;  4FF3 A;  4OO1 G;  1I4H A;  2B2T C;  1KLG D;  3ONA B;  4RCO A;  1LT3 D;  1TWG B;  1TII D;  2NTT A;  5FO9 B;  2IX3 A;  1W6K A;  4C3J G;  1EIH A;  2F0P A;  1U4L A;  5KNC A;  2LFN A;  1I6V C;  2L11 A;  2Q8T A;  1GXD C;  3N6R A;  3N52 A;  4K14 A;  3RD4 A;  1CHP D;  3O13 A;  3J81 L;  1CK1 A;  3D31 A;  3HGB A;  2O5J C;  2GA4 B;  3QIA A;  2F0J A;  3K0Y A;  1AW7 A;  1STH A;  3VYU A;  4HSP A;  2F0F A;  2F0Q A;  4C3J B;  2PQE A;  4G7H C;  3MVV A;  4LJZ C;  2EJM A;  2RSO A;  1SNM A;  3BDL A;  1IYV A;  1F2Z A;  1SE3 A;  3NBH A;  3TME A;  3GV6 A;  1JIC A;  1LTG D;  2OXP A;  5IGB A;  3EVQ A;  2K5D A;  3TP5 A;  1O7Z A;  2TMP A;  1LT5 D;  1IKM A;  4IUV A;  4PQX A;  2SDF A;  3K59 A;  1EWC A;  1AZP A;  3GTJ B;  3LWE A;  2O5I C;  4IUQ A;  1QNU A;  3Q24 A;  3FEW X;  4DAP A;  1V1O A;  2EY1 A;  1EY0 A;  4H7B A;  1K83 B;  2JP1 A;  2I07 B;  2DNE A;  2LMC B;  2PW5 A;  2L1B A;  5E4X A;  4ABN A;  1SNO A;  4HN7 A;  4I65 A;  1KAB A;  3GTP B;  1I3Q B;  3E0J A;  1FD7 D;  1STB A;  4F87 A;  1TR5 A;  1LTI D;  4RGM A;  1I6H B;  4FF1 A;  2QF7 A;  4RWS C;  1II3 A;  3NPP A;  2EYL A;  3VA7 A;  2LKV A;  1S5B D;  1Y8N B;  2F3V A;  2R3Z A;  2SEB D;  1R4P B;  4KN7 C;  1U4M A;  3MFY A;  5FOB B;  4A3D B;  2ZXO A;  1AN8 A;  4V19 0;  1PTO C;  1BCP C;  1LT6 D;  1CI3 M;  1EY4 A;  3A56 A;  3BZD B;  1H9K A;  4CJ0 B;  4K8J A;  3S15 B;  2BE5 D;  5JEA H;  4DA2 A;  1FNW A;  1YNN D;  3T13 A;  2M9V A;  1BXT A;  5FO8 B;  2H4O A;  5C3X A;  5HGT A;  3URY A;  1E2W A;  1EY9 A;  2F0L A;  4C2M B;  2EZV A;  4BY1 B;  4KHV A;  1QE6 A;  5C0X I;  4CKE A;  1TY0 A;  5FO7 B;  1NAP A;  3SK6 A;  3NUC A;  3C2P A;  3RZD B;  1RJT A;  3FRP B;  3C3L A;  3PUX A;  1QJO A;  4F8M A;  4UDU C;  3A8J E;  4A3J B;  2FIN B;  4BBR B;  3NP8 A;  4M8A A;  4KD3 A;  2EY2 A;  2XVS A;  4U68 A;  1FR3 A;  3FMC A;  4KMU C;  1I4G A;  1OXV A;  2XWB B;  5CBA E;  2XN9 C;  1RF2 D;  5NUC A;  3V2T A;  5CGK A;  5G3L D;  1LO5 D;  3AU7 A;  2EYP A;  3H6M A;  4TRD A;  4HAE A;  2K5W A;  3CRL C;  1SJH D;  1I4P A;  3PO2 B;  1SFO B;  3PMF A;  1EY7 A;  1GUT A;  2EPB A;  2F0V A;  2XWJ B;  5ELC A;  3HOV B;  5EPK A;  2RDH A;  3WDN A;  1XXG A;  4K6L A;  4X3K A;  1F9R A;  1GOZ A;  1LV9 A;  4A3I B;  3HOZ B;  1PRT C;  4HSV A;  1L0X B;  1Q8I A;  3IFD A;  2E2I B;  1TWF B;  1A6X A;  4RFB A;  1SYD A;  2MUY A;  1E0B A;  4C1N I;  5D14 A;  1HUN A;  1A3V A;  1DZ1 A;  3A7L A;  2VUM B;  5CMD A;  3M3Y B;  4RHR A;  2A6H D;  2RBM A;  4K5W A;  3I4M B;  4M1U B;  1G2T A;  1RTN A;  3S1R B;  3T51 B;  5C5L A;  3NTI A;  5C5M A;  2B8G A;  1MSG A;  4ZAI A;  2NN6 H;  2DY7 A;  2H1E A;  3J80 E;  1CHQ D;  4L8J A;  4A3G B;  3P1H A;  5COR A;  5CC4 A;  1VF5 C;  3GP7 A;  1ICW A;  4K5X A;  3RUZ A;  5IGE A;  3OMC A;  3PIO 3;  3NWS A;  1BDO A;  3PIP 3;  1CA6 A;  1UNS A;  5C0X J;  1DON A;  1KAA A;  2KUM A;  1S5C D;  2M00 A;  1G29 1;  4ZUI A;  4EGV A;  3K5N A;  3PUW A;  1B9M A;  4DXF A;  2B63 B;  5C44 B;  2BOS A;  1B44 D;  1I4R A;  1MGS A;  1F9P A;  3ND9 A;  1QNK A;  4K8I A;  1IKL A;  1BOS A;  4NP5 A;  2CHB D;  5CV8 A;  2FHT A;  1NCV A;  4XIG S;  2B2V C;  5DM7 3;  1IW7 C;  1S5D D;  2BA0 A;  1DOM A;  2PCF B;  3GQB A;  3I4L A;  2IX1 A;  3P7J A;  3NWT A;  1DOK A;  2WKC A;  3MXN A;  2G9H D;  2A6H C;  4XQN A;  2KEE A;  4RGO S;  4BY7 B;  1KDC A;  1ZXT A;  1PLF A;  2KA7 A;  1OXS C;  4P2C B;  1M8A A;  5CV4 A;  2OF1 A;  3A55 A;  1EL0 A;  2M2L A;  3VR5 A;  1Q3L A;  5JPN C;  3KLS A;  3A7A B;  1SNC A;  1F9S A;  1PTO H;  4PV1 C;  1O7Y A;  2HDM A;  4X3T A;  3M4Y A;  3L9A X;  5E1F A;  3W3A A;  1B9N A;  4DN4 M;  3H91 A;  3S14 B;  4V0B A;  4K6D A;  3H94 A;  5CV7 A;  2SNM A;  4IFD H;  5EPL A;  2PPB C;  1H9R A;  1H9S B;  1LTR D;  2EY5 A;  1BR9 A;  5M3M B;  2E75 C;  3I4N B;  3NTK A;  4C56 C;  1GHJ A;  1DOL A;  2SNS A;  3VYT A;  4RAU C;  1D2B A;  3FDT A;  3OW7 A;  3GTG B;  1F2Y A;  5IGC A;  2PNR C;  2EJF C;  1Y8P B;  3HS0 C;  4XXE A;  1SEB D;  3IAY A;  4C3H G;  1CQF A;  2B2Y A;  2L9H A;  1HUM A;  1SNP A;  2B2W C;  4ME5 A;  1MD2 D;  2JYO A;  1S4Z A;  3DXJ C;  3OMG A;  2JEB I;  2D62 A;  3U9O A;  2HCC A;  3SK8 A;  3NXW A;  5C4Z A;  2F0U A;  1Z47 A;  5I6Y A;  3QWN A;  4ZQ3 A;  1NR2 A;  3HG9 A;  1HXY D;  4ODG A;  1S5F D;  1TVX A;  3Q23 A;  1JB3 A;  1J8I A;  1S5E D;  2F03 A;  3VA5 A;  4IUN A;  3NE5 B;  3NHH A;  2L4N A;  3X3N A;  2B2U C;  4KY6 A;  1E2Z A;  4ZKB B;  3DM1 A;  2BCO A;  1D5Z C;  3VR4 A;  2ICE C;  4WRD A;  5DEH A;  2EY6 A;  4QUF A;  2ID0 A;  2L12 A;  3VR6 A;  5C4H A;  1CTM A;  1EYC A;  1UUP A;  3K58 A;  3BG3 A;  4DU9 A;  4KKT A;  3P75 A;  1T5E A;  4KHZ A;  2WAC A;  1HFN A;  2R7Z B;  2E74 C;  1G6Z A;  4CKB A;  4ZUJ A;  5ISR A;  2FFK B;  3S2H B;  4EVO A;  2WB1 B;  1SNQ A;  2A69 C;  1JC7 A;  1ZKO A;  5JVH 3;  2XRQ D;  5CBE E;  1KDA A;  3S17 B;  5M5Y B;  1SXT A;  3L7Z C;  1DD2 A;  1F2M A;  1XYI A;  1SSO A;  4K5V A;  2EYJ A;  3JAM L;  2JA5 B;  4A3M B;  4C1N K;  3VYS A;  1Q1E A;  4NKL A;  1C8C A;  3PUZ A;  2EOT A;  3NBI A;  5C0X G;  5KEE A;  1EOT A;  1I50 B;  3Q22 A;  2EJG C;  2WIN B;  4XYQ A;  2FMC A;  2O4X A;  1CZW A;  3FPP A;  4J6H A;  4JBW A;  1PTO D;  1V1P B;  1BCP D;  1JOO A;  2K33 A;  1ONL A;  4Y7N B;  1D1I A;  3RZO B;  3KBX A;  2IJ0 A;  5JPM C;  1HA5 A;  2F0H A;  1ENC A;  1U4R A;  1WTO A;  5KRU A;  1Y69 U;  5TSS A;  3DMU A;  4OO1 H;  4ILW A;  3GTO B;  1HHV A;  2PZW A;  3C1E A;  3BDO A;  3EFX D;  2D2C C;  1TU2 B;  3LWU A;  2HUG A;  1IHZ A;  1A2U A;  2WAQ B;  2D9U A;  3J7A V;  5D65 A;  2EYH A;  1PFM A;  2Z8L A;  4XT1 B;  3J81 E;  1PMR A;  1SE4 A;  3KK7 A;  2K1B A;  3KLR A;  5C0X H;  5ELE A;  1JE4 A;  3OIQ A;  4FXD A;  3FPU B;  2A73 B;  5ELB A;  4AYB B;  3I8Z A;  1RHP A;  3TSS A;  4IUT A;  2F4I A;  2E2D C;  5IOC A;  1XX8 A;  2K28 A;  2IL8 A;  1TS4 A;  3QOL A;  4F7X A;  3R8B A;  3D3R A;  3D8G A;  5C3W A;  1TS5 A;  2X69 A;  1BO0 A;  5J39 A;  1QIL A;  3RMH A;  4IUR A;  1EWH A;  4YIJ A;  1ROD A;  2EXZ A;  4DF7 A;  2B39 A;  3M4O B;  1A3T A;  1DYQ A;  3SXH A;  2PO4 A;  5LL6 X;  4OIJ A;  3WOE A;  1SYE A;  5JAV A;  3MFG A;  4DK0 A;  3SR1 A;  2CW0 C;  1RDP D;  4J1M A;  1CT1 D;  1EEF D;  2F0O A;  1PRT D;  2KCN A;  3P20 A;  1K8M A;  2N55 A;  4KY7 A;  5EBC A;  3HOY B;  2I46 A;  3ERO A;  1YNJ D;  3S9W A;  1NR4 A;  3EJI A;  4DK1 A;  1TKW B;  2F0N A;  2NBF A;  3DWP A;  1Q1B A;  3V96 A;  4X3U A;  1TWA B;  2RQX A;  2X6L A;  1JWM D;  4C3I G;  1D6E C;  1EU4 A;  1KNA A;  2KHS A;  3C1F A;  2B2V A;  5EGT A;  2RDG A;  5JJZ A;  2MJ8 A;  1GHK A;  4RCN A;  2FJ2 A;  1WVL A;  3H09 A;  5IGF A;  3FKI B;  2CVR A;  3I90 A;  4FVM A;  1SND A;  5BN5 A;  1EY6 A;  3BVG A;  1CQV A;  4UAI A;  5M9O A;  2ENB A;  1F9Q A;  1FGB D;  4ZK9 B;  1AEX A;  1LTB D;  2Q8R E;  1STN A;  1CFM A;  1EYA A;  4JK1 C;  1U4P A;  4K2L A;  3QG1 A;  4BS9 A;  1A2T A;  4DNT B;  3K57 A;  4G4K A;  2IT1 A;  1GUW A;  4KJO A;  2NVX B;  3SEB A;  2JA7 B;  1PFB A;  1B3A A;  1SE2 A;  4O1N A;  4DAY A;  4C3I B;  1ENF A;  2QCP X;  4XQJ A;  3MA2 B;  3HOX B;  2JA8 B;  2C9O A;  5C4X B;  4OIK A;  2NZ1 D;  3NSW A;  4KTA A;  3DEO A;  3PV0 A;  3S16 B;  3OWE B;  5IGD A;  5IT9 L;  2K6A A;  2A74 C;  2KEC A;  5M5X B;  5CV5 A;  3IFT A;  5I4D A;  3HP3 A;  1OXX K;  1FNU A;  3K5L A;  4DFA A;  1GUG A;  1EZ8 A;  1B50 A;  2QDB A;  5D3D A;  1YNJ C;  1XWE A;  1IW7 D;  2F0M A;  3IL8 A;  4N9T A;  1I4X A;  1WTP A;  2B2W A;  3EA6 A;  2HCI A;  1MI2 A;  1B1Z A;  1EY8 A;  4R8I A;  4KY5 A;  4B9W A;  5EKL A;  2E2H B;  1ZYR C;  5KYI A;  5IT9 E;  3OOC A;  2RDF A;  4GZY C;  1EZ6 A;  3K6O A;  4DXG A;  3NQT A;  3HOW B;  1OXU A;  5J22 A;  1PZK D;  2A6E C;  3KF8 A;  4HMJ A;  5KNB A;  1D5X C;  1PXU A;  1KDB A;  1X32 A;  5T1I A;  3R93 A;  1DXM A;  3GTM B;  5KIX A;  1CM9 A;  2KQ3 A;  3H3V C;  4H44 C;  3L3O C;  1QG7 A;  5I6W A;  2XNA C;  2PW7 A;  1VCI A;  1VF7 A;  3CRK C;  2WV6 D;  4B08 A;  5KND A;  3GTL B;  4KKU A;  1WTV A;  1NSN S;  2B2T A;  4LK1 C;  5I9P A;  1O78 A;  3I91 A;  5CV6 A;  5EKI A;  2E76 C;  1G8Z D;  1HCZ A;  3U9S A;  1X3P A;  2TSS A;  1RCV D;  5FLX L;  2KJX A;  1DCZ A;  1D5M C;  3F2U A;  3BDC A;  4A93 B;  5A35 A;  1U9R A;  3BYY B;  5G3L F;  1LLR D;  1PZJ D;  4IQZ A;  2IPK D;  3TN2 A;  4IN3 A;  1K8O A;  1SAP A;  3OSO A;  4ID6 A;  4QF4 A;  3SDZ A;  3Q0A A;  1A3U A;  3VYR A;  1EQV A;  5JEA J;  2ICI A;  1MBY A;  2AUJ D;  2KOL A;  2DN8 A;  4G57 A;  4WFN 3;  2WP8 J;  4KV6 A;  4PMB A;  5M3F B;  5ELF A;  4ULL A;  5K5P A;  2Z4H A;  2KVM A;  4HR7 B;  1WTX A;  2QIL A;  5FLX E;  2A69 D;  3ITP A;  3QJY A;  3TZU A;  2E2J B;  4ZRZ A;  2RA4 A;  4TSS A;  3D4D A;  1EYD A;  4K2K A;  1Y1V B;  2NUC A;  4KN4 C;  4OGQ C;  2X6G A;  1Y1W B;  2A68 D;  4PMW A;  4R8N A;  1UEA B;  1J9O A;  1PYW D;  1STA A;  2R61 A;  5T1G A;  1RTO A;  3T56 B;  2IWH A;  2MPM A;  3QOJ A;  2NVT B;  5IOD A;  3AB9 A;  3DWQ A;  4N9P A;  1M4V A;  3Q6S A;  2JXM B;  1HA6 A;  2XSC A;  3VR3 A;  3G6J B;  4EQO A;  3I73 A;  4I7Z C;  3A8K E;  2AWN A;  4U67 3;  1DM0 B;  5C3E B;  3M7G A;  4A3F B;  5EJW A;  1TY2 A;  4XDX A;  3KBG A;  4NMZ A;  2PZT A;  4NDX A;  3MC0 B;  3FVQ A;  3BVM A;  4A3E B;  4RHS A;  5LL6 S;  1SYF A;  4EQN A;  3M85 A;  1VDZ A;  3R2T A;  3SVM A;  5BN3 A;  3E5S A;  1WCM B;  1QCB D;  4PMC A;  1H9S A;  2R92 B;  3RLF A;  4TKO B;  3T53 B;  2L5T A;  5M5W B;  4DAV A;  2VB2 X;  2VNU D;  3GD7 A;  2IW3 A;  5E3F A;  4RH6 A;  3S1N B;  5EQ0 A;  1QB5 D;  2CQA A;  2A68 C;  1WD0 A;  2AWO A;  1HRJ A;  3MXP A;  1QOH A;  1H9M A;  3J7A F;  2F0D A;  4KI0 A;  5I2Y A;  1HTL D;  4IZ8 A;  1BNZ A;  4NW2 A;  4L63 B;  1OXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...