1X3EA

Crystal structure of the single-stranded dna-binding protein from mycobacterium smegmatis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
118
structure length
110
Chain Sequence
GDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRMEWKDGEALFLRCNIWREAAENVAESLTRGSRVIVTGRLKQRSFETREKRTVVEVEVDEIGPSLRYATAKVNKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Single-strand binding protein
publication title Structure of Mycobacterium smegmatis single-stranded DNA-binding protein and a comparative study involving homologus SSBs: biological implications of structural plasticity and variability in quaternary association.
pubmed doi rcsb
source organism Mycobacterium smegmatis
total genus 18
structure length 110
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1x3eA00
4P72A 3K7UC 3RLNA 1OTCA 4OX9L 3KFUA 4KHPL 4DUZQ 2K5NA 1O7IA 5GAGC 1KRTA 4DV0L 1Q81C 1QVCA 1YHAA 4R4TA 1VQGA 1X65A 2K75A 4JYAL 4MNOA 2Z0SA 4A3EH 1D8LA 1N33L 4DR4L 4YHHQ 4BXXG 1N34Q 2NVYH 2XTIA 4MZ9A 3HOUG 1PVOA 2AMCB 2VZAA 5IYDG 3K0XA 4IFDI 2YTYA 3CCLA 2HIXA 1QVGA 5C44G 5FLMG 4HJ5A 3W1GA 3L2PA 1HR0Q 1IBLL 2VQEL 2E2JH 3GTOH 1HZAA 2ALYB 2IHFA 4IPCA 2CCZA 5HGQA 4A3KH 4LF7Q 1PYBA 1M1KC 3PSIA 1SN8A 2WP8J 3A5UA 4LF9Q 4LF5L 1HR0W 2Z6KA 4DKAC 4LF8Q 3GTQH 4DR1L 2OQKA 4QIWE 2YYZA 4DV5L 2NZHA 2Y0SE 4A3JG 3DLLA 2NVTH 1FL0A 1GO3E 4YWMA 1I94L 4JG2A 2CFMA 4DPGA 3JC66 2ID0A 4X65L 4C2MH 3D0FA 5IWAQ 4BA1I 1IZ6A 1CSPA 4IPDA 4QQBX 1S3OA 1Q8KA 2JA9A 1OXSC 3F2CA 2ZM6Q 1KXLA 4P74A 4JI7L 1VQOA 3TS2A 3JAMc 1KQSA 5C4XG 3CC2A 4HJ8A 4GOPA 1PYSB 4LUVA 2UUAQ 1UE6A 1WCMH 4A3MH 5AJ3Q 1VQMA 3PUYA 3CXCA 4TVAB 4DK3C 2UUBL 3TRZA 4A93G 3WWVA 5BR8L 2JEBI 1A63A 1T9HA 1UE5A 4BBSG 1KC8C 3AFQA 4JI1Q 2ZTEA 3ULPA 1X55A 2KHIA 2MO0A 1IBML 2Q2TA 4B3MQ 4A76A 1PHJA 3L0OA 5LMNL 3HOZG 3HFZB 1IBKQ 4DV3L 4A75A 4YCUA 3UDXA 2R92G 5J3BA 1L0WA 1GKHA 5IP9G 1GM5A 5M5YH 1OXVA 5M3FG 4B3RL 4LF4L 1Q46A 4A3CG 1VQHA 4HIDA 4JBKA 2K14A 2Q2IA 5IYCH 3FKIG 3ULJA 3CCSA 4GKKL 4UP7A 1YZ6A 1HNWQ 1NMFA 2UXBL 1E22A 3GDEA 1WYDA 4A3FH 1Y1WG 3HKZE 4DV1L 4A3DH 1JT8A 2Q2UA 4DV4L 2I5LX 1X56A 5LMUQ 3FHWA 3I56A 1XMOQ 3AEVA 4AIMA 1SMXA 3STBD 1ASZA 3PUXA 5GQOA 3I4MH 3K81C 5M5XH 2MO1A 3H0GH 3JAMi 4PZ8A 5FJ8H 2AHOB 4GKJL 5C4JH 4MTNA 4R4IA 4BY7G 1SRUA 1X3EA 1SROA 4PZ6A 1BBUA 1PH1A 3I4NH 3TEHB 1MIUA 4B3TQ 4GNXB 1EQQA 4JBMA 4DR5Q 1VQKA 3PUZA 2YTXA 4XIGS 3EN2A 2VW9A 4POFA 4DAMA 3RN2A 3GTGH 1N32L 1XPUA 4NXMQ 2HQLA 5IYBH 1EWIA 2JE6I 3U58A 3GTMH 2D0PA 3E9IA 3HOYH 1FGUA 1LTLA 2KCTA 3S15H 3BZCA 4BBRG 4LFCQ 5E7NA 3E9HA 5C0XG 4JI0Q 3FP9A 3PUVA 2K50A 4HJAA 4QJFA 5JEAG 2Z6KC 4GS3A 1EIFA 4NXNQ 3I55A 3PGZA 5H1SE 3GTLH 4DV6L 2JA8G 2CWAA 3GO5A 1XNRL 1RIPA 3J7ZC 2F3IA 2IY5B 2VQFL 1VCIA 1HZ9A 2JA5G 2KCMA 3Q8DA 3S24A 4DR2Q 2WB1E 1Q1EA 1YHQA 3S1QH 1V1QA 4DV7L 3MEFA 3NENA 5HY6A 1CKMA 1GVPA 4LFBL 3RLFA 4JI1L 1VQLA 3MXNB 2AWNA 2UUCL 4GOPB 4B3SL 4R1JA 4JI4Q 4J15A 4LF6Q 1PH3A 3G4SA 4K0KQ 3H3VH 4GOPC 4DR7Q 4A3LH 4IO9A 4UP8A 1JE5A 1HNZL 3TS0A 3T1YL 3F8TA 4GLAC 3J80i 2KBNA 5GADC 5C3EG 1YIJA 1J5EL 4BY1H 5M3MG 3SGIA 2E5LQ 4JI3L 3CC7A 3GD7A 4GNXA 4IFDG 1HNWL 1PH6A 4AYBE 3S17H 3M4PA 3W5OA 1X9NA 4ME3A 1MKHA 4WJ3M 2DGYA 4JI5Q 4AQYL 4IOAA 1XPOA 1Q86C 3PO2G 1X6OA 3CCJA 1BKBA 2CQOA 2L15A 2E2HH 4POGA 4BXXH 2VY3A 4JV5L 1KRSA 1V9PA 3M9BA 4YCWA 2UXCL 3HOUH 2KHJA 4JI6Q 3M4OH 5IYDH 1U5KA 4YWLA 2UU9Q 3M7NA 1FJGQ 1I50H 1OXXK 1WOCA 1K73C 3RNUA 5C44H 5FLMH 2Y0SG 1C0AA 4APVA 5IT9c 2UXDL 2JA7G 1A62A 1PFSA 1VQ9A 5IY0A 2I5HA 1XMQL 1QUQA 3HOVG 2GN5A 2ZJQA 1N36L 2YV5A 3GTKH 1B8AA 4HJ7A 3EIVA 2HHHL 2AKWB 3T1HQ 1H95A 4NXML 3CPFA 2A1AA 2KENA 4A3JH 1NE3A 4YY3L 1Q12A 2K4KA 4JBJA 1G291 3CCQA 4DUYL 1A8VA 3KF8B 4DV2Q 4LFCL 3UE0A 5IP7G 2D62A 3F2BA 1VQNA 4JI8Q 4P71A 2R93G 1VQAA 3A74A 3NELA 4LW1A 3F1ZA 3ULLA 3S2HH 4NXNL 4FDBA 1VQ4A 4P75A 3J81j 5C4XH 3PIPA 3RN5A 1W2BA 1PH5A 3S1NH 1TWGH 2CKZB 4A3IG 3KOJA 4JI2L 1YHBA 1HZBA 1S40A 1Q7YC 1UWVA 4X64L 4X66L 1N8RC 2ZJPA 1VQFA 3HKSA 3CAMA 4X62L 1I5FA 1XJVA 5C0XJ 1EOVA 4RMFA 5ELOA 1PV4A 1UE1A 2VL6A 2A19A 4LFAQ 4DR3Q 2B63G 3LGJA 1JJCB 4A93H 1HNXQ 3U50C 3CC4A 2N49A 5JEAJ 1VQBA 1J6QA 1CSQA 1IL2A 2JA6G 4BBSH 1C7YA 1C9OA 1EQRA 2WAQE 2QEXA 2EQSA 3CP0A 4LF6L 3K80C 2F4VQ 2N78A 4A4IA 4DK6C 4DUZL 3OW2A 5FLXc 3I2ZA 3J81c 3HOZH 3HKZG 3OYYA 1P8LA 3DM3A 3BJUA 1TWCH 2R92H 5IP9H 1CKNB 1VQ6A 2AWOA 3CMEA 5M3FH 2NVXH 4YHHL 3GTPH 3E0EA 1N34L 4A3CH 3S1MH 2ZTDA 4NB3A 1TWAH 1VQDA 3EBEA 3FKIH 4OX9Q 4KHPQ 2PI2E 2K5HA 1V43A 5EAYA 1Y1WH 1L1OA 2NVQH 3D31A 1HR0L 4TQUS 1EYGA 1YJNA 3S2DH 3KF6A 4YWKA 4LF7L 3KDFA 4GLXA 4OWWB 4JYAQ 4DR4Q 1N33Q 1RL2A 4LF9L 1FVIA 3K8AA 4WJ4A 4LF8L 2R7ZG 1TWFH 3I7FA 1WFQA 3F2DA 4GNXC 2HT1A 4IFDJ 1PH8A 2R6GA 3CCUA 3CW2C 2JJQA 1IBLQ 3A0JA 1KHIA 3I4OA 2VQEQ 4BY7H 4LUZA 4B3RQ 1I3QH 2VS1A 1XTDA 3S16H 2IX0A 3U4ZA 1YITA 3AQQA 4GN3B 1HJPA 1AH9A 4HIOA 4LF5Q 1NMGA 3TQYA 5IWAL 5K36G 4C3JH 2YTVA 2Q2HA 4DV5Q 4DR6Q 2ZM6L 3UE1A 2BH8A 3KJOA 1R9TH 1EFWA 4X6AH 2BA0A 4HIKA 1I94Q 2N3SA 2LSSA 3RZDH 4R4CA 3J7A5 1JJ2A 1JMCA 1QUQB 4KHZA 4R4QA 4BBRH 3CPWA 1GD7A 2UUAL 4KLKA 4A3BG 1K83H 4A3GG 1MJCA 5AJ3L 2GVBA 4JOIA 3HOXG 1TXYA 3KLWA 4QL5A 2WB1G 2I5MX 1CKNA 1OXUA 4C3HH 1K0RA 1ASYA 3L7ZC 1LM0A 2JA8H 1PH2A 3PO3G 2XGTA 4B3ML 1D7QA 2IX1A 2NN6I 2F52A 3PUWA 4IPGA 4OONA 2JA5H 2C35B 3GTJH 1LYLA 1K8AC 1IBKL 1X3GA 4DR3L 2UUBQ 4RG1A 1Q82C 3ERSX 3G6EA 1VQ7A 3CCEA 5IE8A 1Y1VG 5BR8Q 4HJ9A 1E3PA 1VQ5A 2VUMG 1IBMQ 3HOWG 2A8VA 1E7ZA 2DUDA 1Q1BA 2MNAA 5LMNQ 3H3VI 3CCVA 4AYBG 1AE2A 2K52A 4DV3Q 2EIFA 1SFOH 2NZOA 5M5WH 5C3EH 1G6PA 5ELNA 3B6YA 1UEBA 1XMOL 5M3MH 5LMUL 4A3EG 1YI2A 2RHQB 2BA1A 1BBWA 4GN5A 3U4VA 5LMNW 4LF4Q 3RZOH 4GKKQ 4JBWA 4IJHA 2PQAA 3BU2A 1EIYB 2UXBQ 4IOCA 4DV1Q 2R7DA 1KAWA 3G71A 2B29A 1YVCA 4DV4Q 4NPSA 4PMWA 1UE7A 4A3KG 3PO2H 1PH9A 4JCVE 3M85A 1K3RA 4B3TL 4EX5A 2JK8A 3AYHB 4DR5L 1AE3A 4EQ5A 1DGSA 3PCOB 1VQPA 2B3GA 4GKJQ 3S14H 1L1OB 1X3FA 1KD1C 2JA7H 1IXRA 2ASBA 5GROA 1S72A 1E24A 3KF6B 1L1OC 3KDFB 3HOVH 1IYJB 1LUZA 4UY8C 4Y52H 2QA4A 2D0OA 1G51A 4JI0L 5GAEC 1N32Q 4LWCA 3PIOA 1WJJA 3ZJYC 4L5SA 4AH6A 4DR6L 5GAHC 1EUJA 3PF5A 1VQJA 2RF4A 3CMAA 4KI0A 1NTGA 1X54A 1NJIC 3TREA 2E2IH 5IP7H 1JJGA 1P16A 3ICEA 1B7YB 2LXJA 1WCMG 3IRBA 4A3MG 2R93H 4DR2L 1XNQQ 3OTOQ 2ZTCA 3RLOA 1Z9FA 4PZ7A 2IHEA 4H02A 4DV6Q 5JJLA 2K5VA 4A3IH 1XNRQ 4DAYB 2VQFQ 2WAQG 4JI4L 4IPHA 4K0KL 4BA2I 4DR7L 5DLQE 1QZHA 1QVFA 1K8GA 1OXTA 1XPRA 4DV7Q 5JJIA 2N8NA 1K9MC 2RCNA 2ZJRA 2B63H 4JOIC 3A5ZB 2E5LL 4LFBQ 2JA6H 5IYCG 2UUCQ 4B3SQ 4L5QA 2H5XA 3KYHC 4OO1G 2OCEA 4A3FG 4OO1I 1HNZQ 4A3DG 4DV0Q 4JI5L 3H15A 3T1YQ 2I0QA 3ER0A 1J5EQ 1YJWA 4GN4B 4OWTB 4QY7A 4JI3Q 1HH2P 2BH2A 3M4QA 4OWXB 2OTLA 4JI6L 1YBYA 1WI5A 4R4OA 2ES2A 3NEMA 1W3SA 4UP9A 2MFIA 2UU9L 1FJGL 3I4MG 3H0GG 3PF4A 2PMZE 1SR3A 1VQIA 5FJ8G 1CUKA 3PV0A 1TWHH 2E8GA 2MQHA 3UDIA 4AQYQ 1BVSA 4Y7NH 2YU9H 2GVAA 3G48A 4P73A 1SLJA 4UPAA 4ALPA 3VDYA 4JV5Q 3K7AH 3I4NG 2UXCQ 1SE8A 1B70B 3T1HL 2IT1A 4JC0A 2R7ZH 1Y14B 4IJLA 4O0AA 4DR1Q 2OWOA 2PQAB 2QGQA 4LUOA 1U0LA 3AFPA 2PNHA 3STBC 4C3IH 1NBWA 5IYBG 3CD6A 3HOYG 2UXDQ 1PH4A 1L2FA 1XMQQ 1QZGA 4DV2L 3J81i 1E1OA 1YJ9A 1N36Q 3J80c 4X65Q 1N9WA 2HHHQ 1KL9A 4HIMA 3RR5A 4JI8L 3UDFA 2EXDA 1NY4A 1PA6A 1VS0A 1A0IA 2VNUD 4YY3Q 2LXKA 1PH7A 3M3YH 3CCRA 3CF5A 4JI7Q 4YCVA 3UDGA 2HIVA 4DUYQ 2ATWA 3NBHB 4QGUA 1YNXA 4DNIA 2OQ0A 2NN6G 4L5TA 4O2DA 1M90C 4A3BH 4A3GH 5JJKA 3W1BA 2WFWA 1E1TA 5C0XI 2CWPA 1XNQL 3OTOL 4XTCS 3BZKA 3HOXH 4L5RC 4OXPA 1JB7A 1HZCA 1VQCA 4LFAL 3CQZH 3S1RH 4PG3A 1HNXL 2FXQA 3PO3H 1YEZA 4JI2Q 2PI2A 2RHSB 3KJPA 4X64Q 4X66Q 1CKOA 1VQ8A 4LNQA 2F4VL 3CCMA 4A3LG 2R7FA 4X62Q 1MJEA 2V1CC 1I6HH 1VQEA 2JEAI 4BY1G 2JQOA 1Y1VH 4GLVB 2OTJA 1KIXA 2VUMH 3HOWH 1Z47A
chains in the Genus database with same CATH superfamily
1U9RA 1CQVA 2VB3X 3QIAA 3TN2A 2IPKD 1QVCA 1U4LA 5KNCA 1KNEA 1GUTA 2K75A 2MPMA 4Z9CB 4YHHQ 3TDQA 3VA7A 3HOUG 4MZ9A 5IYDG 1GUOA 5FOBB 4CKBA 2HIXA 5EKKA 2E2JH 3L2PA 1HR0Q 2VQEL 3GTOH 2IHFA 2CCZA 5E4WC 5IGEA 2O2LD 1YNJC 3C3LA 2NUCA 2WP8J 5IODA 3HOUB 5E3FA 1HCZA 2L0CA 2F0LA 1SJHD 1ESFA 5CC4A 2NZHA 2NVTH 1GO3E 4YWMA 3TSSA 4JG2A 3L3OC 4DPGA 4X65L 3SR1A 1IZ6A 4FF1A 1CSPA 1S3OA 1Q8KA 3HG9A 3BG3A 2WKCA 4P74A 2XRSD 5DNFA 3CC2A 4GOPA 2UUAQ 4MHEA 4ZRZA 1GUGA 1WCMH 4A3MH 1LACA 3PUYA 1LTID 3DWAA 2EPBA 5EPLA 3I70A 1ZEQX 1KC8C 1B50A 2K33A 1F2LA 1X55A 2KHIA 5IT9E 1EYDA 4QF4A 3QO2A 4QCLA 3MTSA 1IBKQ 2H1EA 1I4HA 4A75A 4YCUA 1Y8NB 3H94A 1L0WA 5IP9G 3HRZC 1E2WA 5M3FG 2F0JA 3FVQA 4KD3A 4HIDA 1BNZA 4JBKA 1GOZA 3DEOA 1YZ6A 4J8QA 3GDEA 1GUWA 1WYDA 3CKIB 1Y1WG 3J7AF 3D4RA 4QB4A 2EY5A 1DD2A 5BN3A 1D5ZC 3PUXA 5M5XB 3MHBA 3QJYA 3K81C 1BR9A 2MO1A 3NUCA 5C4JB 2AHOB 1EY9A 4GKJL 4BY7G 2B2UA 4PZ6A 3I4NB 3T51B 1JICA 4B3TQ 4JBMA 4DR5Q 2RKSA 3PUZA 4XIGS 1N32L 2PYKA 3IFTA 4NXMQ 3GTMB 2HQLA 3U58A 1I3QB 3HOYH 2KCTA 3BZCA 4B08A 4KJOA 2GA4B 1TY2A 4PV1C 4FF2A 5E7NA 5CORA 5D3IB 4MIUA 2Z6KC 1EIFA 1VF5C 4NXNQ 4DV6L 4FXKC 2CWAA 1XNRL 1K83B 1PZKD 3Q8DA 4FP5D 4OELB 1YHQA 1HA6A 3FMCA 1S4ZA 3I4LA 4HMIA 1CKMA 2HCCA 1EL0A 1SMYD 3Q6SA 4JI1L 3MXNB 1KABA 2AWNA 1AZQA 5FK9C 4LF6Q 4A3LH 2CW0C 4BY1B 2F0UA 3F8TA 2KBNA 4DNTB 3SGIA 3R2TA 4GNXA 5LL6S 1A3UA 3S17B 3DEPA 3EVQA 4AYBE 1MKHA 5IIFA 2PCFB 3OOCA 1Q86C 2E2HB 1BKBA 3MXUA 4JV5L 4IUTA 4JI6Q 1STEA 2CQAA 1I50B 1K73C 3KLSA 5C44H 5FLMH 2Y0SG 2OT2A 1A62A 2K5QA 1EY5A 1PFSA 3X3NA 3HOVG 1NUCA 2MHVA 2YV5A 1B8AA 4HJ7A 3EIVA 4DN4M 1H95A 2Y0SB 1E0BA 4KY5A 3QOLA 1NE3A 2NB0A 1Q12A 2F0GA 4IUNA 4J1MA 3CCQA 4X3KA 2F0EA 2PPBC 4LFCL 3M7GA 3UE0A 1VQNA 4B9XA 3NELA 2B2YC 4CBVA 5C4XB 3J81j 2E2IB 1TWGH 1YHBA 3D8GA 2AQ1B 5BN5A 3NTIA 3CAMA 1I5FA 5C0XJ 1PV4A 1UE1A 2A19A 1JJCB 3CC4A 3A8IE 3IL8A 1ENFA 1IL2A 2MGSA 1HQMC 4XQJA 3VYTA 1RDPD 2F4VQ 3OW2A 5FLXc 3HOZH 1TWCB 1DOMA 2R92H 2AWOA 5T1GA 3CMEA 3C1EA 4YHHL 3S1MB 1D2BA 1TWAB 1F9QA 3EBEA 2K5HA 4O42A 4RGMA 1RTNA 3D31A 1HR0L 3S2DH 5KGUA 3KF8A 4GLXA 1N33Q 2NTSA 1SE2A 2KCCA 3K8AA 4WJ4A 4RWSC 4ZQ3A 1PTOC 1HFNA 1TWFH 1BCPD 3I7FA 1STNA 1RJTA 4IFDJ 4H0LC 1PH8A 2VS1A 1XTDA 2E75C 2IL8A 2IX0A 2K1BA 4K8IA 1HJPA 2B39A 1AH9A 5IGBA 1NMGA 3CRKC 5CR3A 2CH4A 1SNMA 2AQ3B 4C3JH 2NWGA 3KJOA 2B2VA 1EFWA 1I94Q 3IFDA 2TSSA 3LX0A 2HQEA 4KHZA 4R4QA 2UUAL 4K6LA 1SDFA 5C0XH 4IQZA 2Q8IB 2GVBA 3HOXG 3KLWA 1KDAA 3FRPB 1EY4A 1GUNA 1GUSA 1UAPA 1ZKOA 2JA8H 2XVSA 1TQOA 2XGTA 2IX1A 3PUWA 1IBKL 1ZXTA 4K5WA 1JOKA 4M8AA 2L12A 3VYUA 4DR3L 4RG1A 3TP5A 4QMGA 2BCOA 4KV6A 4HJ9A 3PIO3 2FMMA 1E7ZA 2DUDA 2MUYA 4DV3Q 1AE2A 1BBXC 2LS01 4KN4C 1D1IA 4OIJA 5M3MB 4A3EG 2DY8A 3DUZA 2O5IC 4ABNA 1AZPA 1ET6A 1EWHA 4JBWA 4IFDH 5G3LD 3T16A 3MZ5A 2K03A 5CV5A 2LKVA 1A2UA 2X69A 4DV4Q 3M85A 3TP8A 4B3TL 1LT6D 4DR5L 1IYVA 2FINB 1CK1A 1VQPA 1TR5A 2JA7B 1L1OB 1SYBA 3NBHA 3EQLC 4CDEC 1E24A 3KF6B 1LTAD 2QEJC 1LTGD 2BOSA 4DR6L 3ZJYC 4L5SA 3HEJA 1VQJA 3J81L 3KBXA 3CMAA 1NJIC 3TREA 3R93A 3ICEA 2R93H 2K5DA 1XNQQ 4G7ZC 4CJ1B 1XTCD 2IHEA 1YNND 4A3IB 1J8IA 2WAQG 3SE0A 3ERQA 1QVFA 3G7LA 4F88A 1EY8A 5E4XA 1K9MC 2RCNA 2B63H 4LFBQ 1EY0A 2MJ8A 1CM9A 2A69C 4OO1G 1F2ZA 4YIJA 3H6MA 5EKLA 4RAUC 1CZWA 3DM1A 4A3DG 3R2IA 2I0QA 3ER0A 1J5EQ 2DJFC 1R4QB 4IZ8A 3BYTB 4OHJA 2F0MA 4JI6L 3ZYYX 2ES2A 3H0GG 3PF4A 1VQIA 2PMZE 3OHXC 4Y7NB 4AQYQ 2YU9H 2KEDA 3K7AB 2K7VA 1EIHA 2UXCQ 1B70B 3H0GB 4LK1C 1LT3D 1H9JA 4IJLA 4O0AA 4C3IB 1HFGA 2SNSA 1L2FA 2RDFA 1GJXA 1N36Q 1E1OA 4X65Q 2K5WA 1E2VA 3HZXA 3HGBA 3GV6A 1A0IA 3Q22A 1PH7A 1DOLA 1DCZA 2ATWA 4QGUA 2D2CC 1NSNS 5NUCA 2EXZA 4A3BH 4A3GH 3W1BA 2CWPA 3BZKA 4OXPA 5C5MA 1SE3A 1HZCA 1VQCA 1LABA 2EOTA 4Q5VA 3S1RB 1TT2A 1FGBD 2ICIA 3PO3B 1L0XB 2AQ2B 4JI2Q 2RHSB 4X64Q 5HURA 1VQ8A 2F4VL 1EQVA 3CCMA 4X62Q 1PYWD 2FJ2A 1I6HB 1MJEA 1Y1VB 2JQOA 2F0VA 4GLVB 2VUMB 4RH6A 1KIXA 3NQTA 4P72A 4C1NK 2JP1A 4LMQD 3KUPA 4AYBB 2K5NA 1O7IA 1KRTA 2N55A 1Q81C 1H9SA 1BDOA 4FYDA 5ELFA 4BXXG 1N33L 1LV9A 1N34Q 1SBBB 4DAVA 4DA2A 1PVOA 2Q8TA 2YTYA 2LFNA 4NKLA 2B2WC 4LF7Q 4IPCA 4A3KH 2JXMB 3PSIA 1K8OA 4KHVA 4CGYB 2Z8LA 1ICWA 1HR0W 4DR1L 2F0IA 2Y0SE 4A3JG 2PO4A 2V4DA 1A3TA 1AEXA 1I94L 1K3BC 5JPMC 3JC66 3D0FA 5IWAQ 4BA1I 4IPDA 4QQBX 5ELCA 5KEEA 1KXLA 2PZWA 4DU9A 3TS2A 3JAMc 1KQSA 2EYHA 1GHKA 1PYSB 2WIIB 2L1BA 4K8JA 5AJ3Q 1MSHA 3TRZA 4QUFA 3RUZA 1JOQA 3K5OA 1VF7A 1IHZA 1T9HA 1AP0A 4BBSG 3AFQA 4JI1Q 2Q2TA 4KTAA 4A76A 1PHJA 3HFZB 1FNUA 4DV3L 2K32A 3OIPA 5CYUA 5M5YH 4A3CG 3FKIG 4V0BA 3ULJA 4N8X1 4A3FB 3J80L 4IUUA 5JOBA 4DV4L 2I5LX 1X56A 5LMUQ 1XMOQ 3H09A 1G2SA 4AIMA 1SMXA 3STBD 1ASZA 1VMPA 3I4MB 3A56A 2F0NA 5M5XH 4PZ8A 5FJ8H 5DAUA 4RFBA 5C4JH 4MTNA 1SRUA 4FF4A 4B9WA 1F9RA 3O13A 3SHLA 3I4NH 1MIUA 4GNXB 1EQQA 1VQKA 2VW9A 3Q0AA 4DAMA 3RN2A 1XPUA 4M1UB 1RF2D 3GTMH 2D0PA 1S5BD 3S16B 3J81E 4BBRG 4LFCQ 1IKLA 1UNSA 4CKCA 3PUVA 2HD3A 2WKDA 1IW7C 4XYOA 5JEAG 1B2TA 4DK1A 2DNEA 4C3HG 3PGZA 3DXJC 3A55A 4K6DA 1TS3A 3GO5A 5FO7B 2K05A 2NN6H 1CQFA 3E3XA 1VCIA 4N9PA 2KCMA 4OIKA 4DR2Q 3MEFA 3NENA 5HY6A 1B3QA 4LFBL 2EYMA 4X3UA 4I7AA 4KKSA 2G5DA 3K57A 4JI4Q 1HUNA 1PH3A 4K0KQ 2E76C 3H3VH 1EIGA 4GOPC 1Y69U 4UP8A 1JE5A 3TS0A 5GADC 5C3EG 1YIJA 4BY1H 1J5EL 3N52A 1HNWL 2XNAC 3PIP3 3S17H 3QWNA 1X9NA 4ME3A 4IOAA 4AQYL 1TS2A 3PO2G 1X6OA 1PTOF 2E2HH 1KRSA 2UXCL 4ULLA 3VR4A 2UU9Q 3M7NA 1I50H 3A8JE 1LTSD 1V1PA 4OEMB 5IY0A 1WTOA 5JVH3 2JN4A 3V96A 1N36L 2IWHA 1K0SA 2LMCB 1S5FD 2NZ1D 5KNBA 2K01A 1LT4D 2F0SA 1AFPA 3S14B 3T56B 1SNDA 3KF8B 4QUCA 4DV2Q 1LT5D 5IP7G 1JWUD 3NWTA 1Q8IA 4NMZA 1V8QA 4LW1A 3S2HH 1EY7A 5KRUA 5C4XH 1W2BA 1PH5A 1A15A 2QF7A 4JI2L 1S40A 1Q7YC 1N8RC 1B9NA 4X64L 2RVLA 1VQFA 2BDOA 3I90A 2F0KA 2L55A 4XXEA 4X62L 3P1HA 4DR3Q 3IKJA 4LFAQ 2L4NA 4E6IA 3RN5A 2B2TA 4A93H 3U50C 2O5JC 2JA6G 1VQBA 1J6QA 1C7YA 2WAQE 4ZKBB 2QEXA 4NP5A 2EJGC 2N78A 2EJMA 4A4IA 4DK6C 5C3XA 1STHA 1PDQA 3DM3A 3BJUA 1TWCH 1WD1A 5M3FB 2NVXB 4ZKCB 3S9WA 2PZUA 4TSSA 1N34L 3S1MH 1TWAH 4OX9Q 4BS9A 2PI2E 2PMZB 1Y1WB 1QOHA 4FXDA 2NVQB 1V43A 5EAYA 3F2UA 4TQUS 2A6EC 4LF7L 3KDFA 4JYAQ 4DR4Q 1T5XD 1PTOB 1FVIA 1NAPA 2R7ZG 1KAAA 4GNXC 4R8NA 2EYOA 3CW2C 4BY7B 1EEID 4B3RQ 3A7AB 4HIOA 4LF5Q 5IWAL 4DR6Q 1R9TB 3RZDB 2LSSA 3AU7A 1JJ2A 1JMCA 1QUQB 3CPWA 1GD7A 3PMFA 4KLKA 5AJ3L 1EU3A 5IOCA 1TXYA 4QL5A 4CJ0B 2FMCA 2I5MX 4G7HC 1B53A 1I4XA 4DK0A 1SNPA 1ASYA 2B8GA 5EGTA 4X3SA 1D7QA 3A7LA 2JA5H 1NNXA 1X3GA 2DNCA 3NE5B 4ZCKA 5EPKA 1PRTF 5IE8A 1VQ7A 3U9OA 1E3PA 1RODA 1VQ5A 3HOWG 5JAVA 5LMNQ 2RBMA 1SFOB 3J80E 3EFXD 5M5WB 1BO0A 5ELNA 3OW7A 5M3MH 1I6VC 5LMUL 1XMOL 3RZOB 1BBWA 3HOWB 5D65A 1SMYC 2UXBQ 4IOCA 4DV1Q 3G71A 1YVCA 5ELDA 4NPSA 4PMWA 1UE7A 2Z6BA 1PH9A 4JCVE 1DM0B 1K3RA 3AYHB 1PXUA 1JCKB 4XYQA 1DGSA 3PCOB 4L6TB 1K8MA 3GTOB 2XN9C 1DYQA 1KD1C 2JA7H 3HOVB 3NWSA 2ASBA 1JR0D 1LUZA 1ONLA 4UY8C 3NHHA 2QA4A 1G51A 1PFBA 5J39A 1EUJA 3PF5A 1QNUA 2CHBD 5FLXL 4KI0A 1NTGA 3D4WA 1P16A 1B7YB 1WCMG 4A3MG 2F0OA 4DR2L 1SYCA 4U68A 5I6YA 2QILA 5C6AA 5JJLA 3MEHA 1JQYD 3SDZA 4A3IH 3LWUA 2B2VC 2VQFQ 4JI4L 1JB3A 4K0KL 4BA2I 4ZUJA 4N9TA 1OXTA 1C4QA 2N8NA 3DWPA 4PMCA 1PRTB 3NSWA 1B44D 4B3SQ 2H5XA 1HNZQ 5J1ZA 2RQXA 3T1YQ 4K5XA 4EQNA 3E0JA 4JI3Q 1CHQD 1HH2P 2KOLA 2ENBA 4OWXB 4ILWA 3SK8A 2PQEA 2UU9L 4UP9A 2MFIA 5I6WA 1F9SA 1SR3A 1TWHB 4XQNA 2RDGA 2E8GA 4Y7NH 2GVAA 3G48A 4P73A 4KMUC 2EVBA 2RSNA 3K7AH 3NQIA 4CJ2C 5COYA 1ESRA 4JC0A 2F3WA 3URYA 4DR1Q 2PQAB 2QGQA 1U0LA 4C3IH 3CD6A 3HOYG 2A6HD 4O1NA 1PH4A 1H9SB 4NW2A 3T53B 3UI2A 4DV2L 4DAYA 1YJ9A 2HHHQ 1KL9A 3BDLA 1H9MA 5K36H 2EXDA 1NY4A 3TBIB 1VS0A 1BCPC 3M3YB 3CF5A 2X6GA 2F0PA 1YNXA 4DNIA 2ZXOA 3VR3A 2WFWA 1O78A 3HOXB 3BYYB 5I4DA 2D9UA 3OTOL 3E6ZX 3K0YA 1J9OA 3AMUA 3CQZB 4LFAL 3S1RH 5CBEE 2BE5C 2FXQA 3PO3H 2PW5A 4HEDA 4X66Q 1U4MA 3MA2B 1S5ED 4A3LG 2R7FA 3FPPA 1I6HH 1Y1VH 4GZYC 1K28A 1X3PA 2VUMH 2EDGA 1Z47A 1VQLA 4OX9L 2AUJD 3RLNA 3KFUA 1Y8PB 5GAGC 4DV0L 4R4TA 2G9DA 4A3EB 2A68D 4JYAL 4MNOA 2Z0SA 3KLSX 4DR4L 1HTPA 2NVYB 1FNWA 2XTIA 1LO5D 4KY6A 2L11A 1RHPA 5C44G 5FLMG 2D5DA 3W1GA 4PMBA 4B3RL 2A73B 4LF5L 2KCNA 2XRQD 3GTQH 4LF8Q 5CGKA 2A5HA 5ELBA 2YYZA 1SSOA 3D4DA 3DLLA 3MVVA 1OO9B 5F2DA 2CFMA 4C2MB 2R3ZA 4HCEA 4ID6A 1CA5A 2JA9A 2BDNA 2ICEC 3F2CA 1QG7A 2TMPA 3H91A 4JI7L 1VQOA 1EWCA 1STBA 3MXNA 2HCIA 1HQRD 1LTTD 1EZ6A 3P20A 1UE6A 3EJIA 3CXCA 1QJOA 4ODGA 4KJNA 1D5XC 1I4GA 3BZDB 4J6HA 1KDBA 1T5EA 2JEBI 1A63A 2WAQB 2SNMA 2ZTEA 2MO0A 4NDXA 4B3MQ 3GP7A 1PRTC 3L0OA 5LMNL 3HOZG 1ZYRD 3UDXA 2R92G 3OWFA 4KN7C 2EZVA 5KYLA 5IYCH 4UP7A 3HOZB 1HNWQ 2UXBL 1E22A 4A3DB 4A3FH 1NCVA 4DV1L 1JT8A 1XWEA 2Q2UA 4EQPA 3AEVA 5GQOA 4DAPA 1KLGD 1UUPA 4WFN3 3I4MH 4EQOA 4R4IA 1SROA 1CT1D 1BBUA 1PH1A 2XWBB 4WRDA 2EE1A 3GTGB 3DWQA 4C3JG 4P2CB 5IYBH 3S15H 3E9IA 2Z4IA 1TY0A 1LTLA 1X32A 5FLXE 5C0XG 2FFKB 2K50A 1TKWB 2QKIC 5CV7A 5FO8B 1SNQA 3L9AX 4GS3A 2IX3A 1GHJA 3GTLH 2JA8G 2F0WA 5A35A 1RIPA 3EA6A 2VQFL 3FDTA 4DNRB 2CVRA 1Q1EA 3SK6A 2RDHA 3S1QH 3C1FA 1EZ8A 1G8ZD 3NTHA 3RLFA 2KECA 1RTOA 4GOPB 4B3SL 4CHTB 1CFMA 3G4SA 4FVMA 1ILPA 4DR7Q 1HNZL 5M9OA 3T1YL 1O80A 1FYCA 4WORA 4JI3L 3GD7A 4IFDG 1BUVT 3J7AV 1D1KA 2A74C 1PH6A 3W5OA 3K5NA 4JI5Q 1JC7A 5K5PA 3QOJA 2CQOA 2L15A 3FEWX 3CCJA 2VY3A 3M4OB 2XWJB 3HOUH 2KHJA 5IYDH 3JAML 1U5KA 1WOCA 4RGNA 1MHWC 2KEEA 4KD4A 1C0AA 3R8BA 4APVA 5IT9c 3E5SA 1VQ9A 2I5HA 3GTKB 4G57A 1D5MC 2HHHL 2KUMA 3T1HQ 3MFYA 3C46A 1RCVD 3V05A 4QIWB 1ET9A 4A3JB 3SK4A 2KENA 2FHTA 4L8JA 4JBJA 1Z7TA 1A8VA 1JWMD 3OMGA 5I2YA 4I65A 2R93G 4OGQC 3ULLA 4IURA 4FDBA 1VQ4A 3S1NB 4P75A 3KOJA 1HZBA 4X66L 3IAYA 2ZJPA 3HKSA 4FO2A 4CDDC 1XJVA 4MN3A 1EOVA 1G91A 2DJGC 2B63G 2LY7A 5ISRA 2N49A 4BBSB 1CSQA 2NTTA 4L63B 1C9OA 3K80C 1EOTA 3I2ZA 3I91A 3HKZG 3OYYA 3J7YW 3NTKA 4EVOA 1M4VA 4IALA 5IP9H 2O4XA 1TIID 3GTPB 4ZLTF 5M3FH 2NVXH 1B4OA 3E0EA 3FKIB 2ZTDA 4KHPQ 1Y1WH 1L1OA 2NVQH 4RKBA 1MGSA 1MSGA 3KF6A 4DGZA 2ZXPA 3BDCA 1PTOH 4LF8L 4H44C 5IGDA 1XX8A 3AB9A 4F87A 5I2XA 4DF7A 1CA6A 2EYLA 2HT1A 2EY6A 2R6GA 1IBLQ 3I4OA 4BY7H 4LUZA 1I3QH 3A54A 1IL8A 2J0TD 4N8FA 1YITA 3AQQA 4GN3B 1EEFD 3TQYA 3T4AC 1L0YB 2YTVA 2Q2HA 4DV5Q 4RGTA 1WTQA 3UE1A 2BH8A 1R9TH 4HIKA 3RZDH 4R4CA 4BBRB 3J7A5 4A3BG 1K83H 4A3GG 3OIQA 4JOIA 2WB1G 1MI2A 4C3HB 1CKNA 1OXUA 1K0RA 1LM0A 1PH2A 4F8MA 4B3ML 3GTJB 4IPGA 2SEBD 2C35B 1LYLA 1PZID 5EBCA 3K58A 3RMHA 2UUBQ 1Q82C 4JW0A 3G6EA 5BR8Q 3TZDA 4FF3A 3BVMA 1IBMQ 3TMEA 2A8VA 4JPBW 1Q1BA 3KBGA 1F77A 2EIFA 3NPPA 1SFOH 5C3EB 5M5WH 1YNJD 1G6PA 2B8FA 3B6YA 2IJ0A 1YI2A 5JJZA 2BA1A 3U4VA 5LMNW 4LF4Q 3RZOH 4GKKQ 2B2TC 2M00A 2XSCA 4R8IA 4H7BA 1EIYB 1SYEA 2VB2X 2R7DA 1KAWA 3ND9A 2B29A 3PO2B 3MAQA 1S5DD 1W6KA 1JWSD 4MTKA 4A3KG 2JK8A 3NK9A 2OEOA 1AE3A 3VYSA 5EQ0A 1EQTA 2RCFA 4EQ5A 1NR4A 1QB5D 4A3KB 1SXTA 2M2LA 2EYJA 3T13A 1S72A 3OPOA 3HOVH 3N6RA 4Y52H 4IUVA 1BCPF 2B2UC 4LWCA 1TVXA 3PIOA 1MBYA 1WJJA 4AH6A 1TS5A 3GQBA 1KTKA 5GAHC 5D3DA 3BDOA 2RF4A 1X54A 5JVG3 2E2IH 2LXJA 3IRBA 3OTOQ 3D6CA 4H02A 1WTXA 2K5VA 3OWEB 4DAYB 4HCSA 1JOOA 2F0FA 4IPHA 4DR7L 5DLQE 1QZHA 1K8GA 1CI3M 5JJIA 4DV7Q 3BS1A 2JA6B 4XT1B 3K5LA 1ML0D 2UUCQ 4L5QA 1WTPA 2F03A 4ME5A 2A6ED 1FR3A 2OCEA 3HP3A 4OL7A 4DXGA 4OO1I 1DZ1A 1DONA 4DV0Q 1HXYD 4JI5L 5M5YB 4QY7A 2BH2A 1JORA 1YBYA 1CZGA 5I9PA 3NEMA 3JAME 3VR6A 5C4ZA 4PNYA 5FJ8G 2F0QA 1TWHH 2MQHA 2F0HA 3SEBA 1SLJA 2RSOA 3I4NG 5G3LF 1SE8A 2R7ZB 3T1HL 2IT1A 2NBFA 5EBDA 1EU4A 4RA8A 1Y14B 2PNHA 1NBWA 1C48A 2UXDQ 4RCNA 1HHVA 4IUQA 1XMQQ 2J4XA 1X3QA 3J81i 1AW7A 1KNAA 3RR5A 1STYA 1BCPB 3QR8A 1U4RA 2K28A 1W6JA 2VNUD 4YY3Q 2LXKA 3M3YH 4JI7Q 3UDGA 2HIVA 4DUYQ 3NBHB 2OQ0A 2NN6G 2ZXRA 4L5TA 4O2DA 3SK5A 1E1TA 5C0XI 2CW0D 2ZT9C 4XTCS 3HOXH 1SJED 1DOKA 1WD0A 1BF4A 1F9PA 2QDLA 3CQZH 3SXHA 2VXWA 1LTRD 1B3AA 1GXDC 1CKOA 4LNQA 2V1CC 1VMCA 2JEAI 2F4IA 4BY1G 1HTLD 4F7XA 2QCPX 1BXTA 1II3A 3NBIA 4L5RC 2OTJA 2Z4HA 1C8CA 1OTCA 3K7UC 1RD9D 4KHPL 2EYPA 4DUZQ 1YHAA 4K14A 1VQGA 4LJZC 1X65A 3OMCA 4A3EH 1D8LA 4HMJA 2NVYH 4XDXA 2AMCB 2VZAA 4IFDI 3K0XA 3VR5A 3CCLA 4RHRA 1QVGA 2E2JB 1ENCA 4HJ5A 1IBLL 4FNFA 2HDLA 5JJKA 1HZAA 2ALYB 5HGQA 3MXPA 1PYBA 1M1KC 3A5UA 1SN8A 4LF9Q 2Z6KA 4DKAC 5LL6X 1I4PA 2OQKA 1PLFA 4KY7A 1ICFB 1RKNA 4QIWE 2KJXA 4DV5L 2NVTB 1TS4A 3TP6A 4C56C 1FL0A 1S5CD 2H4OA 5KNDA 2ID0A 4C2MH 2PNRC 5C3WA 5D14A 3QB3A 1XXGA 1OXSC 1STGA 3I3CA 2ZM6Q 1QWYA 1KDCA 5C4XG 4UHVA 4HJ8A 2JYOA 2N88A 3ITPA 4G7OC 4LUVA 4V190 1WCMB 2R61A 3K59A 4A3MB 4PQXA 1VQMA 4X3TA 3S2HB 2Q8RE 4TVAB 1SNCA 5EPJA 3TZUA 4DK3C 2UUBL 3NXWA 4A93G 3WWVA 5FO9B 5BR8L 1UE5A 2SOBA 3ULPA 1IBML 2QW7A 4K2KA 1PFMA 2L9HA 2SDFA 4RGOS 1XYIA 4UDUC 4A93B 2K04A 1QE6A 1GKHA 5J3BA 1GM5A 1OXVA 4LF4L 1Q46A 1PTOD 1VQHA 4GKKL 2K14A 2Q2IA 3CCSA 2C5CA 1NMFA 4OO1H 1E2ZA 4Q0FA 3HKZE 4A3DH 4FXGC 1STAA 1JE4A 3MC0B 5EJWA 3FHWA 3ND8A 3I56A 4KKTA 5J22A 2F0DA 3JAMi 3H0GH 5CBAE 1H9RA 1X3EA 1M8AA 3TEHB 2B2YA 2YTXA 3EN2A 1Q3LA 4POFA 3GTGH 3HOYB 1NR2A 1EWIA 2JE6I 1FGUA 2EY2A 1O7YA 3EROA 1G2TA 3E9HA 3KK7A 5BN4A 4JI0Q 1LTBD 3FP9A 2P5ZX 1ILQA 5IGCA 4HJAA 4QJFA 1PZJD 4U673 2BE5D 3I55A 5H1SE 2XIWA 2A6HC 3J7ZC 4JK1C 2F3IA 2IY5B 3KLRA 1HZ9A 2JA5G 3VA5A 2Z1CA 3S24A 2WB1E 1V1QA 4DV7L 1GVPA 2WINB 2JA5B 2UUCL 4R1JA 4J15A 4S3SA 4IO9A 4HR7B 3H3VC 4GLAC 3J80i 2E74C 3W3AA 5M3MG 2E5LQ 3CC7A 5IGFA 2J7ZA 3FPUB 1HA5A 2EJFC 3M4PA 4WJ3M 2DGYA 1XPOA 4XQQA 4ZAIA 4POGA 4BXXH 3NP8A 1V9PA 3M9BA 1WTRA 4YCWA 4R9WA 3HS0C 2KHSA 3M4OH 4YWLA 1FJGQ 1OXXK 5C44B 3RNUA 4HSVA 2UXDL 2JA7G 5A2QL 1XMQL 1QUQA 4HTHA 2GN5A 1FNVA 2ZJQA 2A68C 3GTKH 4TRDA 2DY7A 2AKWB 1VDZA 5JPNC 3CPFA 2A1AA 5KYIA 4NXML 4IN3A 5E1FA 1TU2B 4A3JH 4YY3L 2K4KA 3WOEA 1G291 3P75A 4DUYL 5LHY1 3ONAB 3GV3A 2MP1A 3MWYW 2D62A 3F2BA 4JI8Q 4P71A 1VQAA 3A74A 4ZK9B 1HPCA 3F1ZA 3BVZA 4NXNL 3PIPA 1TWGB 1PFNA 3P7JA 2A69D 1B1ZA 1PRTD 2CKZB 4H13C 4JVZA 5FKAC 4A3IG 3S1NH 1UWVA 2IW3A 5C5LA 5I9OA 3X3MA 1EFID 3R3OA 4CDCC 4RMFA 5ELOA 1EYAA 2VL6A 2Z9HA 3LGJA 5CV4A 2NYZD 3VYRA 1HNXQ 2M9VA 1SYDA 5JEAJ 3PQIA 4BBSH 4RHSA 3QG1A 1YNNC 1EQRA 2CH4W 4LF6L 1G6ZA 2EQSA 3CP0A 3A8KE 4DUZL 3J81c 3CU7A 5ELEA 2R92B 1P8LA 3K6OA 1CKNB 1VQ6A 3SVMA 3GTPH 4A3CH 4NB3A 1VQDA 3FKIH 2I46A 1A6XA 1CHPD 1HUMA 5DM63 1O7LA 3S2DB 1ZYRC 1EYGA 1YJNA 4YWKA 4OWWB 1RL2A 4ZYSA 4LF9L 1TWFB 4HSPA 1WFQA 3F2DA 4C3IG 3CCUA 2JJQA 3A0JA 1KHIA 5T1IA 2VQEQ 1F2MA 3S16H 2KVMA 3D6WA 3U4ZA 5CV9A 1SEBD 4RKLA 4C3JB 1SYGA 5K36G 2ZM6L 1V1PB 1SAPA 4X6AH 2BA0A 2N3SA 3C2PA 4G4KA 4RCOA 4BBRH 4DXFA 3WOFA 2KA7A 3Q24A 1MJCA 3W2DA 5C4HA 1A2TA 2PZTA 5JEAH 2X6LA 4C3HH 2JA8B 2AUKA 3L7ZC 3OSOA 3PO3G 2NN6I 2F52A 4OONA 3MXGA 2F3VA 3GTJH 2I07B 1K8AC 5EKIA 1SNOA 3ERSX 3G6JB 3CCEA 3I72A 1Y1VG 1I4RA 3CRLC 5IT9L 2VUMG 2EY1A 4HAEA 2MNAA 3H3VI 3CCVA 4AYBG 2K52A 1U4PA 2RA4A 1DXMA 1UEAB 2NZOA 5C3EH 1LLRD 1UEBA 3U9SA 2RHQB 2OXPA 4GN5A 4BWGB 3Q23A 4IJHA 2PQAA 5AFWA 3BU2A 4CDFC 4KKUA 5KIXA 1D6EC 1DJRD 2OF1A 1F2YA 3PO2H 3M4YA 1Z6HA 1QNKA 4UAIA 4EX5A 3DHQA 1WTVA 3TP7A 1Y8OB 2B3GA 4GKJQ 5HGTA 3S14H 1X3FA 1IXRA 2K6AA 5GROA 1L1OC 3KDFB 1IYJB 3GTQB 2D0OA 2JSOA 2KQ3A 4JI0L 5GAEC 1N32Q 1PMRA 5L37A 2F1MA 3I8ZA 3D3RA 4XT3B 1FD7D 3BVGA 5IP7H 1JJGA 3RD4A 2R93B 3LWEA 2L5TA 2QDBA 4LAAA 2ZTCA 3RLOA 3WDNA 1Z9FA 4PZ7A 3LNNA 5IGGA 4DV6Q 2EYFA 1O7ZA 1XNRQ 5DEHA 1HRJA 4KK7A 1QILA 2B63B 1XPRA 3VR2A 2ZJRA 1MD2D 1BQQT 4EGVA 4JOIC 1WVLA 3A5ZB 2E5LL 1AN8A 1CTMA 2JA6H 5IYCG 2B2WA 3KYHC 3HKZB 4A3FG 1H9KA 3H15A 1I4QA 5CV6A 5TSSA 1YJWA 4GN4B 4OWTB 1WTWA 3M4QA 2OTLA 4IUPA 1WI5A 4R4OA 1W3SA 1FJGL 3I4MG 2HDMA 5DM73 1CUKA 3PV0A 3UDIA 1BVSA 2YU9B 5A2QE 4UPAA 4ALPA 3VDYA 1A3VA 4JV5Q 2WV6D 1WTHA 1EY6A 2F0TA 2R7ZH 1SE4A 3I73A 1IW7D 2OWOA 3V2TA 4HN7A 4LUOA 3STBC 3AFPA 5IYBG 1B9MA 1Q90A 1QZGA 1R4PB 3J80c 1N9WA 4C1NI 4HIMA 4JI8L 3UDFA 1EYCA 3S15B 1PA6A 1IYUA 3DMUA 4TKOB 1SYFA 3CCRA 1IKMA 4YCVA 4K5VA 4WJWA 5CMDA 4A3GB 1M90C 4A3BB 2C9OA 4ZUIA 3K5MA 1XNQL 2WB1B 2G9HD 2HUGA 3MFGA 1JB7A 3GTLB 1BOSA 1HNXL 4PG3A 1ENAA 4CKEA 1YEZA 2E2DC 2PI2A 3KJPA 3S1QB 4DFAA 2WACA 5CV8A 3CHBD 1VQEA 2PW7A 4I7ZC 1QCBD 2DN8A 1KLUD 4K2LA 3HOWH 1V1OA
chains in the Genus database with same CATH topology
4P72A 3K7UC 3RLNA 1OTCA 4OX9L 3KFUA 4KHPL 4DUZQ 2K5NA 1O7IA 5GAGC 1KRTA 4DV0L 1Q81C 1QVCA 1YHAA 4R4TA 1VQGA 1X65A 2K75A 4JYAL 4MNOA 2Z0SA 4A3EH 1D8LA 1N33L 4DR4L 4YHHQ 4BXXG 1N34Q 2NVYH 2XTIA 4MZ9A 3HOUG 1PVOA 2AMCB 2VZAA 5IYDG 3K0XA 4IFDI 2YTYA 3CCLA 2HIXA 1QVGA 5C44G 5FLMG 4HJ5A 3W1GA 3L2PA 1HR0Q 1IBLL 2VQEL 2E2JH 3GTOH 1HZAA 2ALYB 2IHFA 4IPCA 2CCZA 5HGQA 4A3KH 4LF7Q 1PYBA 1M1KC 3PSIA 1SN8A 2WP8J 3A5UA 4LF9Q 4LF5L 1HR0W 2Z6KA 4DKAC 4LF8Q 3GTQH 4DR1L 2OQKA 4QIWE 2YYZA 4DV5L 2NZHA 2Y0SE 4A3JG 3DLLA 2NVTH 1FL0A 1GO3E 4YWMA 1I94L 4JG2A 2CFMA 4DPGA 3JC66 2ID0A 4X65L 4C2MH 3D0FA 5IWAQ 4BA1I 1IZ6A 1CSPA 4IPDA 4QQBX 1S3OA 1Q8KA 2JA9A 1OXSC 3F2CA 2ZM6Q 1KXLA 4P74A 4JI7L 1VQOA 3TS2A 3JAMc 1KQSA 5C4XG 3CC2A 4HJ8A 4GOPA 1PYSB 4LUVA 2UUAQ 1UE6A 1WCMH 4A3MH 5AJ3Q 1VQMA 3PUYA 3CXCA 4TVAB 4DK3C 2UUBL 3TRZA 4A93G 3WWVA 5BR8L 2JEBI 1A63A 1T9HA 1UE5A 4BBSG 1KC8C 3AFQA 4JI1Q 2ZTEA 3ULPA 1X55A 2KHIA 2MO0A 1IBML 2Q2TA 4B3MQ 4A76A 1PHJA 3L0OA 5LMNL 3HOZG 3HFZB 1IBKQ 4DV3L 4A75A 4YCUA 3UDXA 2R92G 5J3BA 1L0WA 1GKHA 5IP9G 1GM5A 5M5YH 1OXVA 5M3FG 4B3RL 4LF4L 1Q46A 4A3CG 1VQHA 4HIDA 4JBKA 2K14A 2Q2IA 5IYCH 3FKIG 3ULJA 3CCSA 4GKKL 4UP7A 1YZ6A 1HNWQ 1NMFA 2UXBL 1E22A 3GDEA 1WYDA 4A3FH 1Y1WG 3HKZE 4DV1L 4A3DH 1JT8A 2Q2UA 4DV4L 2I5LX 1X56A 5LMUQ 3FHWA 3I56A 1XMOQ 3AEVA 4AIMA 1SMXA 3STBD 1ASZA 3PUXA 5GQOA 3I4MH 3K81C 5M5XH 2MO1A 3H0GH 3JAMi 4PZ8A 5FJ8H 2AHOB 4GKJL 5C4JH 4MTNA 4R4IA 4BY7G 1SRUA 1X3EA 1SROA 4PZ6A 1BBUA 1PH1A 3I4NH 3TEHB 1MIUA 4B3TQ 4GNXB 1EQQA 4JBMA 4DR5Q 1VQKA 3PUZA 2YTXA 4XIGS 3EN2A 2VW9A 4POFA 4DAMA 3RN2A 3GTGH 1N32L 1XPUA 4NXMQ 2HQLA 5IYBH 1EWIA 2JE6I 3U58A 3GTMH 2D0PA 3E9IA 3HOYH 1FGUA 1LTLA 2KCTA 3S15H 3BZCA 4BBRG 4LFCQ 5E7NA 3E9HA 5C0XG 4JI0Q 3FP9A 3PUVA 2K50A 4HJAA 4QJFA 5JEAG 2Z6KC 4GS3A 1EIFA 4NXNQ 3I55A 3PGZA 5H1SE 3GTLH 4DV6L 2JA8G 2CWAA 3GO5A 1XNRL 1RIPA 3J7ZC 2F3IA 2IY5B 2VQFL 1VCIA 1HZ9A 2JA5G 2KCMA 3Q8DA 3S24A 4DR2Q 2WB1E 1Q1EA 1YHQA 3S1QH 1V1QA 4DV7L 3MEFA 3NENA 5HY6A 1CKMA 1GVPA 4LFBL 3RLFA 4JI1L 1VQLA 3MXNB 2AWNA 2UUCL 4GOPB 4B3SL 4R1JA 4JI4Q 4J15A 4LF6Q 1PH3A 3G4SA 4K0KQ 3H3VH 4GOPC 4DR7Q 4A3LH 4IO9A 4UP8A 1JE5A 1HNZL 3TS0A 3T1YL 3F8TA 4GLAC 3J80i 2KBNA 5GADC 5C3EG 1YIJA 1J5EL 4BY1H 5M3MG 3SGIA 2E5LQ 4JI3L 3CC7A 3GD7A 4GNXA 4IFDG 1HNWL 1PH6A 4AYBE 3S17H 3M4PA 3W5OA 1X9NA 4ME3A 1MKHA 4WJ3M 2DGYA 4JI5Q 4AQYL 4IOAA 1XPOA 1Q86C 3PO2G 1X6OA 3CCJA 1BKBA 2CQOA 2L15A 2E2HH 4POGA 4BXXH 2VY3A 4JV5L 1KRSA 1V9PA 3M9BA 4YCWA 2UXCL 3HOUH 2KHJA 4JI6Q 3M4OH 5IYDH 1U5KA 4YWLA 2UU9Q 3M7NA 1FJGQ 1I50H 1OXXK 1WOCA 1K73C 3RNUA 5C44H 5FLMH 2Y0SG 1C0AA 4APVA 5IT9c 2UXDL 2JA7G 1A62A 1PFSA 1VQ9A 5IY0A 2I5HA 1XMQL 1QUQA 3HOVG 2GN5A 2ZJQA 1N36L 2YV5A 3GTKH 1B8AA 4HJ7A 3EIVA 2HHHL 2AKWB 3T1HQ 1H95A 4NXML 3CPFA 2A1AA 2KENA 4A3JH 1NE3A 4YY3L 1Q12A 2K4KA 4JBJA 1G291 3CCQA 4DUYL 1A8VA 3KF8B 4DV2Q 4LFCL 3UE0A 5IP7G 2D62A 3F2BA 1VQNA 4JI8Q 4P71A 2R93G 1VQAA 3A74A 3NELA 4LW1A 3F1ZA 3ULLA 3S2HH 4NXNL 4FDBA 1VQ4A 4P75A 3J81j 5C4XH 3PIPA 3RN5A 1W2BA 1PH5A 3S1NH 1TWGH 2CKZB 4A3IG 3KOJA 4JI2L 1YHBA 1HZBA 1S40A 1Q7YC 1UWVA 4X64L 4X66L 1N8RC 2ZJPA 1VQFA 3HKSA 3CAMA 4X62L 1I5FA 1XJVA 5C0XJ 1EOVA 4RMFA 5ELOA 1PV4A 1UE1A 2VL6A 2A19A 4LFAQ 4DR3Q 2B63G 3LGJA 1JJCB 4A93H 1HNXQ 3U50C 3CC4A 2N49A 5JEAJ 1VQBA 1J6QA 1CSQA 1IL2A 2JA6G 4BBSH 1C7YA 1C9OA 1EQRA 2WAQE 2QEXA 2EQSA 3CP0A 4LF6L 3K80C 2F4VQ 2N78A 4A4IA 4DK6C 4DUZL 3OW2A 5FLXc 3I2ZA 3J81c 3HOZH 3HKZG 3OYYA 1P8LA 3DM3A 3BJUA 1TWCH 2R92H 5IP9H 1CKNB 1VQ6A 2AWOA 3CMEA 5M3FH 2NVXH 4YHHL 3GTPH 3E0EA 1N34L 4A3CH 3S1MH 2ZTDA 4NB3A 1TWAH 1VQDA 3EBEA 3FKIH 4OX9Q 4KHPQ 2PI2E 2K5HA 1V43A 5EAYA 1Y1WH 1L1OA 2NVQH 3D31A 1HR0L 4TQUS 1EYGA 1YJNA 3S2DH 3KF6A 4YWKA 4LF7L 3KDFA 4GLXA 4OWWB 4JYAQ 4DR4Q 1N33Q 1RL2A 4LF9L 1FVIA 3K8AA 4WJ4A 4LF8L 2R7ZG 1TWFH 3I7FA 1WFQA 3F2DA 4GNXC 2HT1A 4IFDJ 1PH8A 2R6GA 3CCUA 3CW2C 2JJQA 1IBLQ 3A0JA 1KHIA 3I4OA 2VQEQ 4BY7H 4LUZA 4B3RQ 1I3QH 2VS1A 1XTDA 3S16H 2IX0A 3U4ZA 1YITA 3AQQA 4GN3B 1HJPA 1AH9A 4HIOA 4LF5Q 1NMGA 3TQYA 5IWAL 5K36G 4C3JH 2YTVA 2Q2HA 4DV5Q 4DR6Q 2ZM6L 3UE1A 2BH8A 3KJOA 1R9TH 1EFWA 4X6AH 2BA0A 4HIKA 1I94Q 2N3SA 2LSSA 3RZDH 4R4CA 3J7A5 1JJ2A 1JMCA 1QUQB 4KHZA 4R4QA 4BBRH 3CPWA 1GD7A 2UUAL 4KLKA 4A3BG 1K83H 4A3GG 1MJCA 5AJ3L 2GVBA 4JOIA 3HOXG 1TXYA 3KLWA 4QL5A 2WB1G 2I5MX 1CKNA 1OXUA 4C3HH 1K0RA 1ASYA 3L7ZC 1LM0A 2JA8H 1PH2A 3PO3G 2XGTA 4B3ML 1D7QA 2IX1A 2NN6I 2F52A 3PUWA 4IPGA 4OONA 2JA5H 2C35B 3GTJH 1LYLA 1K8AC 1IBKL 1X3GA 4DR3L 2UUBQ 4RG1A 1Q82C 3ERSX 3G6EA 1VQ7A 3CCEA 5IE8A 1Y1VG 5BR8Q 4HJ9A 1E3PA 1VQ5A 2VUMG 1IBMQ 3HOWG 2A8VA 1E7ZA 2DUDA 1Q1BA 2MNAA 5LMNQ 3H3VI 3CCVA 4AYBG 1AE2A 2K52A 4DV3Q 2EIFA 1SFOH 2NZOA 5M5WH 5C3EH 1G6PA 5ELNA 3B6YA 1UEBA 1XMOL 5M3MH 5LMUL 4A3EG 1YI2A 2RHQB 2BA1A 1BBWA 4GN5A 3U4VA 5LMNW 4LF4Q 3RZOH 4GKKQ 4JBWA 4IJHA 2PQAA 3BU2A 1EIYB 2UXBQ 4IOCA 4DV1Q 2R7DA 1KAWA 3G71A 2B29A 1YVCA 4DV4Q 4NPSA 4PMWA 1UE7A 4A3KG 3PO2H 1PH9A 4JCVE 3M85A 1K3RA 4B3TL 4EX5A 2JK8A 3AYHB 4DR5L 1AE3A 4EQ5A 1DGSA 3PCOB 1VQPA 2B3GA 4GKJQ 3S14H 1L1OB 1X3FA 1KD1C 2JA7H 1IXRA 2ASBA 5GROA 1S72A 1E24A 3KF6B 1L1OC 3KDFB 3HOVH 1IYJB 1LUZA 4UY8C 4Y52H 2QA4A 2D0OA 1G51A 4JI0L 5GAEC 1N32Q 4LWCA 3PIOA 1WJJA 3ZJYC 4L5SA 4AH6A 4DR6L 5GAHC 1EUJA 3PF5A 1VQJA 2RF4A 3CMAA 4KI0A 1NTGA 1X54A 1NJIC 3TREA 2E2IH 5IP7H 1JJGA 1P16A 3ICEA 1B7YB 2LXJA 1WCMG 3IRBA 4A3MG 2R93H 4DR2L 1XNQQ 3OTOQ 2ZTCA 3RLOA 1Z9FA 4PZ7A 2IHEA 4H02A 4DV6Q 5JJLA 2K5VA 4A3IH 1XNRQ 4DAYB 2VQFQ 2WAQG 4JI4L 4IPHA 4K0KL 4BA2I 4DR7L 5DLQE 1QZHA 1QVFA 1K8GA 1OXTA 1XPRA 4DV7Q 5JJIA 2N8NA 1K9MC 2RCNA 2ZJRA 2B63H 4JOIC 3A5ZB 2E5LL 4LFBQ 2JA6H 5IYCG 2UUCQ 4B3SQ 4L5QA 2H5XA 3KYHC 4OO1G 2OCEA 4A3FG 4OO1I 1HNZQ 4A3DG 4DV0Q 4JI5L 3H15A 3T1YQ 2I0QA 3ER0A 1J5EQ 1YJWA 4GN4B 4OWTB 4QY7A 4JI3Q 1HH2P 2BH2A 3M4QA 4OWXB 2OTLA 4JI6L 1YBYA 1WI5A 4R4OA 2ES2A 3NEMA 1W3SA 4UP9A 2MFIA 2UU9L 1FJGL 3I4MG 3H0GG 3PF4A 2PMZE 1SR3A 1VQIA 5FJ8G 1CUKA 3PV0A 1TWHH 2E8GA 2MQHA 3UDIA 4AQYQ 1BVSA 4Y7NH 2YU9H 2GVAA 3G48A 4P73A 1SLJA 4UPAA 4ALPA 3VDYA 4JV5Q 3K7AH 3I4NG 2UXCQ 1SE8A 1B70B 3T1HL 2IT1A 4JC0A 2R7ZH 1Y14B 4IJLA 4O0AA 4DR1Q 2OWOA 2PQAB 2QGQA 4LUOA 1U0LA 3AFPA 2PNHA 3STBC 4C3IH 1NBWA 5IYBG 3CD6A 3HOYG 2UXDQ 1PH4A 1L2FA 1XMQQ 1QZGA 4DV2L 3J81i 1E1OA 1YJ9A 1N36Q 3J80c 4X65Q 1N9WA 2HHHQ 1KL9A 4HIMA 3RR5A 4JI8L 3UDFA 2EXDA 1NY4A 1PA6A 1VS0A 1A0IA 2VNUD 4YY3Q 2LXKA 1PH7A 3M3YH 3CCRA 3CF5A 4JI7Q 4YCVA 3UDGA 2HIVA 4DUYQ 2ATWA 3NBHB 4QGUA 1YNXA 4DNIA 2OQ0A 2NN6G 4L5TA 4O2DA 1M90C 4A3BH 4A3GH 5JJKA 3W1BA 2WFWA 1E1TA 5C0XI 2CWPA 1XNQL 3OTOL 4XTCS 3BZKA 3HOXH 4L5RC 4OXPA 1JB7A 1HZCA 1VQCA 4LFAL 3CQZH 3S1RH 4PG3A 1HNXL 2FXQA 3PO3H 1YEZA 4JI2Q 2PI2A 2RHSB 3KJPA 4X64Q 4X66Q 1CKOA 1VQ8A 4LNQA 2F4VL 3CCMA 4A3LG 2R7FA 4X62Q 1MJEA 2V1CC 1I6HH 1VQEA 2JEAI 4BY1G 2JQOA 1Y1VH 4GLVB 2OTJA 1KIXA 2VUMH 3HOWH 1Z47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P72 A;  3K7U C;  3RLN A;  1OTC A;  4OX9 L;  3KFU A;  4KHP L;  4DUZ Q;  2K5N A;  1O7I A;  5GAG C;  1KRT A;  4DV0 L;  1Q81 C;  1QVC A;  1YHA A;  4R4T A;  1VQG A;  1X65 A;  2K75 A;  4JYA L;  4MNO A;  2Z0S A;  4A3E H;  1D8L A;  1N33 L;  4DR4 L;  4YHH Q;  4BXX G;  1N34 Q;  2NVY H;  2XTI A;  4MZ9 A;  3HOU G;  1PVO A;  2AMC B;  2VZA A;  5IYD G;  3K0X A;  4IFD I;  2YTY A;  3CCL A;  2HIX A;  1QVG A;  5C44 G;  5FLM G;  4HJ5 A;  3W1G A;  3L2P A;  1HR0 Q;  1IBL L;  2VQE L;  2E2J H;  3GTO H;  1HZA A;  2ALY B;  2IHF A;  4IPC A;  2CCZ A;  5HGQ A;  4A3K H;  4LF7 Q;  1PYB A;  1M1K C;  3PSI A;  1SN8 A;  2WP8 J;  3A5U A;  4LF9 Q;  4LF5 L;  1HR0 W;  2Z6K A;  4DKA C;  4LF8 Q;  3GTQ H;  4DR1 L;  2OQK A;  4QIW E;  2YYZ A;  4DV5 L;  2NZH A;  2Y0S E;  4A3J G;  3DLL A;  2NVT H;  1FL0 A;  1GO3 E;  4YWM A;  1I94 L;  4JG2 A;  2CFM A;  4DPG A;  3JC6 6;  2ID0 A;  4X65 L;  4C2M H;  3D0F A;  5IWA Q;  4BA1 I;  1IZ6 A;  1CSP A;  4IPD A;  4QQB X;  1S3O A;  1Q8K A;  2JA9 A;  1OXS C;  3F2C A;  2ZM6 Q;  1KXL A;  4P74 A;  4JI7 L;  1VQO A;  3TS2 A;  3JAM c;  1KQS A;  5C4X G;  3CC2 A;  4HJ8 A;  4GOP A;  1PYS B;  4LUV A;  2UUA Q;  1UE6 A;  1WCM H;  4A3M H;  5AJ3 Q;  1VQM A;  3PUY A;  3CXC A;  4TVA B;  4DK3 C;  2UUB L;  3TRZ A;  4A93 G;  3WWV A;  5BR8 L;  2JEB I;  1A63 A;  1T9H A;  1UE5 A;  4BBS G;  1KC8 C;  3AFQ A;  4JI1 Q;  2ZTE A;  3ULP A;  1X55 A;  2KHI A;  2MO0 A;  1IBM L;  2Q2T A;  4B3M Q;  4A76 A;  1PHJ A;  3L0O A;  5LMN L;  3HOZ G;  3HFZ B;  1IBK Q;  4DV3 L;  4A75 A;  4YCU A;  3UDX A;  2R92 G;  5J3B A;  1L0W A;  1GKH A;  5IP9 G;  1GM5 A;  5M5Y H;  1OXV A;  5M3F G;  4B3R L;  4LF4 L;  1Q46 A;  4A3C G;  1VQH A;  4HID A;  4JBK A;  2K14 A;  2Q2I A;  5IYC H;  3FKI G;  3ULJ A;  3CCS A;  4GKK L;  4UP7 A;  1YZ6 A;  1HNW Q;  1NMF A;  2UXB L;  1E22 A;  3GDE A;  1WYD A;  4A3F H;  1Y1W G;  3HKZ E;  4DV1 L;  4A3D H;  1JT8 A;  2Q2U A;  4DV4 L;  2I5L X;  1X56 A;  5LMU Q;  3FHW A;  3I56 A;  1XMO Q;  3AEV A;  4AIM A;  1SMX A;  3STB D;  1ASZ A;  3PUX A;  5GQO A;  3I4M H;  3K81 C;  5M5X H;  2MO1 A;  3H0G H;  3JAM i;  4PZ8 A;  5FJ8 H;  2AHO B;  4GKJ L;  5C4J H;  4MTN A;  4R4I A;  4BY7 G;  1SRU A;  1X3E A;  1SRO A;  4PZ6 A;  1BBU A;  1PH1 A;  3I4N H;  3TEH B;  1MIU A;  4B3T Q;  4GNX B;  1EQQ A;  4JBM A;  4DR5 Q;  1VQK A;  3PUZ A;  2YTX A;  4XIG S;  3EN2 A;  2VW9 A;  4POF A;  4DAM A;  3RN2 A;  3GTG H;  1N32 L;  1XPU A;  4NXM Q;  2HQL A;  5IYB H;  1EWI A;  2JE6 I;  3U58 A;  3GTM H;  2D0P A;  3E9I A;  3HOY H;  1FGU A;  1LTL A;  2KCT A;  3S15 H;  3BZC A;  4BBR G;  4LFC Q;  5E7N A;  3E9H A;  5C0X G;  4JI0 Q;  3FP9 A;  3PUV A;  2K50 A;  4HJA A;  4QJF A;  5JEA G;  2Z6K C;  4GS3 A;  1EIF A;  4NXN Q;  3I55 A;  3PGZ A;  5H1S E;  3GTL H;  4DV6 L;  2JA8 G;  2CWA A;  3GO5 A;  1XNR L;  1RIP A;  3J7Z C;  2F3I A;  2IY5 B;  2VQF L;  1VCI A;  1HZ9 A;  2JA5 G;  2KCM A;  3Q8D A;  3S24 A;  4DR2 Q;  2WB1 E;  1Q1E A;  1YHQ A;  3S1Q H;  1V1Q A;  4DV7 L;  3MEF A;  3NEN A;  5HY6 A;  1CKM A;  1GVP A;  4LFB L;  3RLF A;  4JI1 L;  1VQL A;  3MXN B;  2AWN A;  2UUC L;  4GOP B;  4B3S L;  4R1J A;  4JI4 Q;  4J15 A;  4LF6 Q;  1PH3 A;  3G4S A;  4K0K Q;  3H3V H;  4GOP C;  4DR7 Q;  4A3L H;  4IO9 A;  4UP8 A;  1JE5 A;  1HNZ L;  3TS0 A;  3T1Y L;  3F8T A;  4GLA C;  3J80 i;  2KBN A;  5GAD C;  5C3E G;  1YIJ A;  1J5E L;  4BY1 H;  5M3M G;  3SGI A;  2E5L Q;  4JI3 L;  3CC7 A;  3GD7 A;  4GNX A;  4IFD G;  1HNW L;  1PH6 A;  4AYB E;  3S17 H;  3M4P A;  3W5O A;  1X9N A;  4ME3 A;  1MKH A;  4WJ3 M;  2DGY A;  4JI5 Q;  4AQY L;  4IOA A;  1XPO A;  1Q86 C;  3PO2 G;  1X6O A;  3CCJ A;  1BKB A;  2CQO A;  2L15 A;  2E2H H;  4POG A;  4BXX H;  2VY3 A;  4JV5 L;  1KRS A;  1V9P A;  3M9B A;  4YCW A;  2UXC L;  3HOU H;  2KHJ A;  4JI6 Q;  3M4O H;  5IYD H;  1U5K A;  4YWL A;  2UU9 Q;  3M7N A;  1FJG Q;  1I50 H;  1OXX K;  1WOC A;  1K73 C;  3RNU A;  5C44 H;  5FLM H;  2Y0S G;  1C0A A;  4APV A;  5IT9 c;  2UXD L;  2JA7 G;  1A62 A;  1PFS A;  1VQ9 A;  5IY0 A;  2I5H A;  1XMQ L;  1QUQ A;  3HOV G;  2GN5 A;  2ZJQ A;  1N36 L;  2YV5 A;  3GTK H;  1B8A A;  4HJ7 A;  3EIV A;  2HHH L;  2AKW B;  3T1H Q;  1H95 A;  4NXM L;  3CPF A;  2A1A A;  2KEN A;  4A3J H;  1NE3 A;  4YY3 L;  1Q12 A;  2K4K A;  4JBJ A;  1G29 1;  3CCQ A;  4DUY L;  1A8V A;  3KF8 B;  4DV2 Q;  4LFC L;  3UE0 A;  5IP7 G;  2D62 A;  3F2B A;  1VQN A;  4JI8 Q;  4P71 A;  2R93 G;  1VQA A;  3A74 A;  3NEL A;  4LW1 A;  3F1Z A;  3ULL A;  3S2H H;  4NXN L;  4FDB A;  1VQ4 A;  4P75 A;  3J81 j;  5C4X H;  3PIP A;  3RN5 A;  1W2B A;  1PH5 A;  3S1N H;  1TWG H;  2CKZ B;  4A3I G;  3KOJ A;  4JI2 L;  1YHB A;  1HZB A;  1S40 A;  1Q7Y C;  1UWV A;  4X64 L;  4X66 L;  1N8R C;  2ZJP A;  1VQF A;  3HKS A;  3CAM A;  4X62 L;  1I5F A;  1XJV A;  5C0X J;  1EOV A;  4RMF A;  5ELO A;  1PV4 A;  1UE1 A;  2VL6 A;  2A19 A;  4LFA Q;  4DR3 Q;  2B63 G;  3LGJ A;  1JJC B;  4A93 H;  1HNX Q;  3U50 C;  3CC4 A;  2N49 A;  5JEA J;  1VQB A;  1J6Q A;  1CSQ A;  1IL2 A;  2JA6 G;  4BBS H;  1C7Y A;  1C9O A;  1EQR A;  2WAQ E;  2QEX A;  2EQS A;  3CP0 A;  4LF6 L;  3K80 C;  2F4V Q;  2N78 A;  4A4I A;  4DK6 C;  4DUZ L;  3OW2 A;  5FLX c;  3I2Z A;  3J81 c;  3HOZ H;  3HKZ G;  3OYY A;  1P8L A;  3DM3 A;  3BJU A;  1TWC H;  2R92 H;  5IP9 H;  1CKN B;  1VQ6 A;  2AWO A;  3CME A;  5M3F H;  2NVX H;  4YHH L;  3GTP H;  3E0E A;  1N34 L;  4A3C H;  3S1M H;  2ZTD A;  4NB3 A;  1TWA H;  1VQD A;  3EBE A;  3FKI H;  4OX9 Q;  4KHP Q;  2PI2 E;  2K5H A;  1V43 A;  5EAY A;  1Y1W H;  1L1O A;  2NVQ H;  3D31 A;  1HR0 L;  4TQU S;  1EYG A;  1YJN A;  3S2D H;  3KF6 A;  4YWK A;  4LF7 L;  3KDF A;  4GLX A;  4OWW B;  4JYA Q;  4DR4 Q;  1N33 Q;  1RL2 A;  4LF9 L;  1FVI A;  3K8A A;  4WJ4 A;  4LF8 L;  2R7Z G;  1TWF H;  3I7F A;  1WFQ A;  3F2D A;  4GNX C;  2HT1 A;  4IFD J;  1PH8 A;  2R6G A;  3CCU A;  3CW2 C;  2JJQ A;  1IBL Q;  3A0J A;  1KHI A;  3I4O A;  2VQE Q;  4BY7 H;  4LUZ A;  4B3R Q;  1I3Q H;  2VS1 A;  1XTD A;  3S16 H;  2IX0 A;  3U4Z A;  1YIT A;  3AQQ A;  4GN3 B;  1HJP A;  1AH9 A;  4HIO A;  4LF5 Q;  1NMG A;  3TQY A;  5IWA L;  5K36 G;  4C3J H;  2YTV A;  2Q2H A;  4DV5 Q;  4DR6 Q;  2ZM6 L;  3UE1 A;  2BH8 A;  3KJO A;  1R9T H;  1EFW A;  4X6A H;  2BA0 A;  4HIK A;  1I94 Q;  2N3S A;  2LSS A;  3RZD H;  4R4C A;  3J7A 5;  1JJ2 A;  1JMC A;  1QUQ B;  4KHZ A;  4R4Q A;  4BBR H;  3CPW A;  1GD7 A;  2UUA L;  4KLK A;  4A3B G;  1K83 H;  4A3G G;  1MJC A;  5AJ3 L;  2GVB A;  4JOI A;  3HOX G;  1TXY A;  3KLW A;  4QL5 A;  2WB1 G;  2I5M X;  1CKN A;  1OXU A;  4C3H H;  1K0R A;  1ASY A;  3L7Z C;  1LM0 A;  2JA8 H;  1PH2 A;  3PO3 G;  2XGT A;  4B3M L;  1D7Q A;  2IX1 A;  2NN6 I;  2F52 A;  3PUW A;  4IPG A;  4OON A;  2JA5 H;  2C35 B;  3GTJ H;  1LYL A;  1K8A C;  1IBK L;  1X3G A;  4DR3 L;  2UUB Q;  4RG1 A;  1Q82 C;  3ERS X;  3G6E A;  1VQ7 A;  3CCE A;  5IE8 A;  1Y1V G;  5BR8 Q;  4HJ9 A;  1E3P A;  1VQ5 A;  2VUM G;  1IBM Q;  3HOW G;  2A8V A;  1E7Z A;  2DUD A;  1Q1B A;  2MNA A;  5LMN Q;  3H3V I;  3CCV A;  4AYB G;  1AE2 A;  2K52 A;  4DV3 Q;  2EIF A;  1SFO H;  2NZO A;  5M5W H;  5C3E H;  1G6P A;  5ELN A;  3B6Y A;  1UEB A;  1XMO L;  5M3M H;  5LMU L;  4A3E G;  1YI2 A;  2RHQ B;  2BA1 A;  1BBW A;  4GN5 A;  3U4V A;  5LMN W;  4LF4 Q;  3RZO H;  4GKK Q;  4JBW A;  4IJH A;  2PQA A;  3BU2 A;  1EIY B;  2UXB Q;  4IOC A;  4DV1 Q;  2R7D A;  1KAW A;  3G71 A;  2B29 A;  1YVC A;  4DV4 Q;  4NPS A;  4PMW A;  1UE7 A;  4A3K G;  3PO2 H;  1PH9 A;  4JCV E;  3M85 A;  1K3R A;  4B3T L;  4EX5 A;  2JK8 A;  3AYH B;  4DR5 L;  1AE3 A;  4EQ5 A;  1DGS A;  3PCO B;  1VQP A;  2B3G A;  4GKJ Q;  3S14 H;  1L1O B;  1X3F A;  1KD1 C;  2JA7 H;  1IXR A;  2ASB A;  5GRO A;  1S72 A;  1E24 A;  3KF6 B;  1L1O C;  3KDF B;  3HOV H;  1IYJ B;  1LUZ A;  4UY8 C;  4Y52 H;  2QA4 A;  2D0O A;  1G51 A;  4JI0 L;  5GAE C;  1N32 Q;  4LWC A;  3PIO A;  1WJJ A;  3ZJY C;  4L5S A;  4AH6 A;  4DR6 L;  5GAH C;  1EUJ A;  3PF5 A;  1VQJ A;  2RF4 A;  3CMA A;  4KI0 A;  1NTG A;  1X54 A;  1NJI C;  3TRE A;  2E2I H;  5IP7 H;  1JJG A;  1P16 A;  3ICE A;  1B7Y B;  2LXJ A;  1WCM G;  3IRB A;  4A3M G;  2R93 H;  4DR2 L;  1XNQ Q;  3OTO Q;  2ZTC A;  3RLO A;  1Z9F A;  4PZ7 A;  2IHE A;  4H02 A;  4DV6 Q;  5JJL A;  2K5V A;  4A3I H;  1XNR Q;  4DAY B;  2VQF Q;  2WAQ G;  4JI4 L;  4IPH A;  4K0K L;  4BA2 I;  4DR7 L;  5DLQ E;  1QZH A;  1QVF A;  1K8G A;  1OXT A;  1XPR A;  4DV7 Q;  5JJI A;  2N8N A;  1K9M C;  2RCN A;  2ZJR A;  2B63 H;  4JOI C;  3A5Z B;  2E5L L;  4LFB Q;  2JA6 H;  5IYC G;  2UUC Q;  4B3S Q;  4L5Q A;  2H5X A;  3KYH C;  4OO1 G;  2OCE A;  4A3F G;  4OO1 I;  1HNZ Q;  4A3D G;  4DV0 Q;  4JI5 L;  3H15 A;  3T1Y Q;  2I0Q A;  3ER0 A;  1J5E Q;  1YJW A;  4GN4 B;  4OWT B;  4QY7 A;  4JI3 Q;  1HH2 P;  2BH2 A;  3M4Q A;  4OWX B;  2OTL A;  4JI6 L;  1YBY A;  1WI5 A;  4R4O A;  2ES2 A;  3NEM A;  1W3S A;  4UP9 A;  2MFI A;  2UU9 L;  1FJG L;  3I4M G;  3H0G G;  3PF4 A;  2PMZ E;  1SR3 A;  1VQI A;  5FJ8 G;  1CUK A;  3PV0 A;  1TWH H;  2E8G A;  2MQH A;  3UDI A;  4AQY Q;  1BVS A;  4Y7N H;  2YU9 H;  2GVA A;  3G48 A;  4P73 A;  1SLJ A;  4UPA A;  4ALP A;  3VDY A;  4JV5 Q;  3K7A H;  3I4N G;  2UXC Q;  1SE8 A;  1B70 B;  3T1H L;  2IT1 A;  4JC0 A;  2R7Z H;  1Y14 B;  4IJL A;  4O0A A;  4DR1 Q;  2OWO A;  2PQA B;  2QGQ A;  4LUO A;  1U0L A;  3AFP A;  2PNH A;  3STB C;  4C3I H;  1NBW A;  5IYB G;  3CD6 A;  3HOY G;  2UXD Q;  1PH4 A;  1L2F A;  1XMQ Q;  1QZG A;  4DV2 L;  3J81 i;  1E1O A;  1YJ9 A;  1N36 Q;  3J80 c;  4X65 Q;  1N9W A;  2HHH Q;  1KL9 A;  4HIM A;  3RR5 A;  4JI8 L;  3UDF A;  2EXD A;  1NY4 A;  1PA6 A;  1VS0 A;  1A0I A;  2VNU D;  4YY3 Q;  2LXK A;  1PH7 A;  3M3Y H;  3CCR A;  3CF5 A;  4JI7 Q;  4YCV A;  3UDG A;  2HIV A;  4DUY Q;  2ATW A;  3NBH B;  4QGU A;  1YNX A;  4DNI A;  2OQ0 A;  2NN6 G;  4L5T A;  4O2D A;  1M90 C;  4A3B H;  4A3G H;  5JJK A;  3W1B A;  2WFW A;  1E1T A;  5C0X I;  2CWP A;  1XNQ L;  3OTO L;  4XTC S;  3BZK A;  3HOX H;  4L5R C;  4OXP A;  1JB7 A;  1HZC A;  1VQC A;  4LFA L;  3CQZ H;  3S1R H;  4PG3 A;  1HNX L;  2FXQ A;  3PO3 H;  1YEZ A;  4JI2 Q;  2PI2 A;  2RHS B;  3KJP A;  4X64 Q;  4X66 Q;  1CKO A;  1VQ8 A;  4LNQ A;  2F4V L;  3CCM A;  4A3L G;  2R7F A;  4X62 Q;  1MJE A;  2V1C C;  1I6H H;  1VQE A;  2JEA I;  4BY1 G;  2JQO A;  1Y1V H;  4GLV B;  2OTJ A;  1KIX A;  2VUM H;  3HOW H;  1Z47 A; 
#chains in the Genus database with same CATH topology
 1U9R A;  1CQV A;  2VB3 X;  3QIA A;  3TN2 A;  2IPK D;  1QVC A;  1U4L A;  5KNC A;  1KNE A;  1GUT A;  2K75 A;  2MPM A;  4Z9C B;  4YHH Q;  3TDQ A;  3VA7 A;  3HOU G;  4MZ9 A;  5IYD G;  1GUO A;  5FOB B;  4CKB A;  2HIX A;  5EKK A;  2E2J H;  3L2P A;  1HR0 Q;  2VQE L;  3GTO H;  2IHF A;  2CCZ A;  5E4W C;  5IGE A;  2O2L D;  1YNJ C;  3C3L A;  2NUC A;  2WP8 J;  5IOD A;  3HOU B;  5E3F A;  1HCZ A;  2L0C A;  2F0L A;  1SJH D;  1ESF A;  5CC4 A;  2NZH A;  2NVT H;  1GO3 E;  4YWM A;  3TSS A;  4JG2 A;  3L3O C;  4DPG A;  4X65 L;  3SR1 A;  1IZ6 A;  4FF1 A;  1CSP A;  1S3O A;  1Q8K A;  3HG9 A;  3BG3 A;  2WKC A;  4P74 A;  2XRS D;  5DNF A;  3CC2 A;  4GOP A;  2UUA Q;  4MHE A;  4ZRZ A;  1GUG A;  1WCM H;  4A3M H;  1LAC A;  3PUY A;  1LTI D;  3DWA A;  2EPB A;  5EPL A;  3I70 A;  1ZEQ X;  1KC8 C;  1B50 A;  2K33 A;  1F2L A;  1X55 A;  2KHI A;  5IT9 E;  1EYD A;  4QF4 A;  3QO2 A;  4QCL A;  3MTS A;  1IBK Q;  2H1E A;  1I4H A;  4A75 A;  4YCU A;  1Y8N B;  3H94 A;  1L0W A;  5IP9 G;  3HRZ C;  1E2W A;  5M3F G;  2F0J A;  3FVQ A;  4KD3 A;  4HID A;  1BNZ A;  4JBK A;  1GOZ A;  3DEO A;  1YZ6 A;  4J8Q A;  3GDE A;  1GUW A;  1WYD A;  3CKI B;  1Y1W G;  3J7A F;  3D4R A;  4QB4 A;  2EY5 A;  1DD2 A;  5BN3 A;  1D5Z C;  3PUX A;  5M5X B;  3MHB A;  3QJY A;  3K81 C;  1BR9 A;  2MO1 A;  3NUC A;  5C4J B;  2AHO B;  1EY9 A;  4GKJ L;  4BY7 G;  2B2U A;  4PZ6 A;  3I4N B;  3T51 B;  1JIC A;  4B3T Q;  4JBM A;  4DR5 Q;  2RKS A;  3PUZ A;  4XIG S;  1N32 L;  2PYK A;  3IFT A;  4NXM Q;  3GTM B;  2HQL A;  3U58 A;  1I3Q B;  3HOY H;  2KCT A;  3BZC A;  4B08 A;  4KJO A;  2GA4 B;  1TY2 A;  4PV1 C;  4FF2 A;  5E7N A;  5COR A;  5D3I B;  4MIU A;  2Z6K C;  1EIF A;  1VF5 C;  4NXN Q;  4DV6 L;  4FXK C;  2CWA A;  1XNR L;  1K83 B;  1PZK D;  3Q8D A;  4FP5 D;  4OEL B;  1YHQ A;  1HA6 A;  3FMC A;  1S4Z A;  3I4L A;  4HMI A;  1CKM A;  2HCC A;  1EL0 A;  1SMY D;  3Q6S A;  4JI1 L;  3MXN B;  1KAB A;  2AWN A;  1AZQ A;  5FK9 C;  4LF6 Q;  4A3L H;  2CW0 C;  4BY1 B;  2F0U A;  3F8T A;  2KBN A;  4DNT B;  3SGI A;  3R2T A;  4GNX A;  5LL6 S;  1A3U A;  3S17 B;  3DEP A;  3EVQ A;  4AYB E;  1MKH A;  5IIF A;  2PCF B;  3OOC A;  1Q86 C;  2E2H B;  1BKB A;  3MXU A;  4JV5 L;  4IUT A;  4JI6 Q;  1STE A;  2CQA A;  1I50 B;  1K73 C;  3KLS A;  5C44 H;  5FLM H;  2Y0S G;  2OT2 A;  1A62 A;  2K5Q A;  1EY5 A;  1PFS A;  3X3N A;  3HOV G;  1NUC A;  2MHV A;  2YV5 A;  1B8A A;  4HJ7 A;  3EIV A;  4DN4 M;  1H95 A;  2Y0S B;  1E0B A;  4KY5 A;  3QOL A;  1NE3 A;  2NB0 A;  1Q12 A;  2F0G A;  4IUN A;  4J1M A;  3CCQ A;  4X3K A;  2F0E A;  2PPB C;  4LFC L;  3M7G A;  3UE0 A;  1VQN A;  4B9X A;  3NEL A;  2B2Y C;  4CBV A;  5C4X B;  3J81 j;  2E2I B;  1TWG H;  1YHB A;  3D8G A;  2AQ1 B;  5BN5 A;  3NTI A;  3CAM A;  1I5F A;  5C0X J;  1PV4 A;  1UE1 A;  2A19 A;  1JJC B;  3CC4 A;  3A8I E;  3IL8 A;  1ENF A;  1IL2 A;  2MGS A;  1HQM C;  4XQJ A;  3VYT A;  1RDP D;  2F4V Q;  3OW2 A;  5FLX c;  3HOZ H;  1TWC B;  1DOM A;  2R92 H;  2AWO A;  5T1G A;  3CME A;  3C1E A;  4YHH L;  3S1M B;  1D2B A;  1TWA B;  1F9Q A;  3EBE A;  2K5H A;  4O42 A;  4RGM A;  1RTN A;  3D31 A;  1HR0 L;  3S2D H;  5KGU A;  3KF8 A;  4GLX A;  1N33 Q;  2NTS A;  1SE2 A;  2KCC A;  3K8A A;  4WJ4 A;  4RWS C;  4ZQ3 A;  1PTO C;  1HFN A;  1TWF H;  1BCP D;  3I7F A;  1STN A;  1RJT A;  4IFD J;  4H0L C;  1PH8 A;  2VS1 A;  1XTD A;  2E75 C;  2IL8 A;  2IX0 A;  2K1B A;  4K8I A;  1HJP A;  2B39 A;  1AH9 A;  5IGB A;  1NMG A;  3CRK C;  5CR3 A;  2CH4 A;  1SNM A;  2AQ3 B;  4C3J H;  2NWG A;  3KJO A;  2B2V A;  1EFW A;  1I94 Q;  3IFD A;  2TSS A;  3LX0 A;  2HQE A;  4KHZ A;  4R4Q A;  2UUA L;  4K6L A;  1SDF A;  5C0X H;  4IQZ A;  2Q8I B;  2GVB A;  3HOX G;  3KLW A;  1KDA A;  3FRP B;  1EY4 A;  1GUN A;  1GUS A;  1UAP A;  1ZKO A;  2JA8 H;  2XVS A;  1TQO A;  2XGT A;  2IX1 A;  3PUW A;  1IBK L;  1ZXT A;  4K5W A;  1JOK A;  4M8A A;  2L12 A;  3VYU A;  4DR3 L;  4RG1 A;  3TP5 A;  4QMG A;  2BCO A;  4KV6 A;  4HJ9 A;  3PIO 3;  2FMM A;  1E7Z A;  2DUD A;  2MUY A;  4DV3 Q;  1AE2 A;  1BBX C;  2LS0 1;  4KN4 C;  1D1I A;  4OIJ A;  5M3M B;  4A3E G;  2DY8 A;  3DUZ A;  2O5I C;  4ABN A;  1AZP A;  1ET6 A;  1EWH A;  4JBW A;  4IFD H;  5G3L D;  3T16 A;  3MZ5 A;  2K03 A;  5CV5 A;  2LKV A;  1A2U A;  2X69 A;  4DV4 Q;  3M85 A;  3TP8 A;  4B3T L;  1LT6 D;  4DR5 L;  1IYV A;  2FIN B;  1CK1 A;  1VQP A;  1TR5 A;  2JA7 B;  1L1O B;  1SYB A;  3NBH A;  3EQL C;  4CDE C;  1E24 A;  3KF6 B;  1LTA D;  2QEJ C;  1LTG D;  2BOS A;  4DR6 L;  3ZJY C;  4L5S A;  3HEJ A;  1VQJ A;  3J81 L;  3KBX A;  3CMA A;  1NJI C;  3TRE A;  3R93 A;  3ICE A;  2R93 H;  2K5D A;  1XNQ Q;  4G7Z C;  4CJ1 B;  1XTC D;  2IHE A;  1YNN D;  4A3I B;  1J8I A;  2WAQ G;  3SE0 A;  3ERQ A;  1QVF A;  3G7L A;  4F88 A;  1EY8 A;  5E4X A;  1K9M C;  2RCN A;  2B63 H;  4LFB Q;  1EY0 A;  2MJ8 A;  1CM9 A;  2A69 C;  4OO1 G;  1F2Z A;  4YIJ A;  3H6M A;  5EKL A;  4RAU C;  1CZW A;  3DM1 A;  4A3D G;  3R2I A;  2I0Q A;  3ER0 A;  1J5E Q;  2DJF C;  1R4Q B;  4IZ8 A;  3BYT B;  4OHJ A;  2F0M A;  4JI6 L;  3ZYY X;  2ES2 A;  3H0G G;  3PF4 A;  1VQI A;  2PMZ E;  3OHX C;  4Y7N B;  4AQY Q;  2YU9 H;  2KED A;  3K7A B;  2K7V A;  1EIH A;  2UXC Q;  1B70 B;  3H0G B;  4LK1 C;  1LT3 D;  1H9J A;  4IJL A;  4O0A A;  4C3I B;  1HFG A;  2SNS A;  1L2F A;  2RDF A;  1GJX A;  1N36 Q;  1E1O A;  4X65 Q;  2K5W A;  1E2V A;  3HZX A;  3HGB A;  3GV6 A;  1A0I A;  3Q22 A;  1PH7 A;  1DOL A;  1DCZ A;  2ATW A;  4QGU A;  2D2C C;  1NSN S;  5NUC A;  2EXZ A;  4A3B H;  4A3G H;  3W1B A;  2CWP A;  3BZK A;  4OXP A;  5C5M A;  1SE3 A;  1HZC A;  1VQC A;  1LAB A;  2EOT A;  4Q5V A;  3S1R B;  1TT2 A;  1FGB D;  2ICI A;  3PO3 B;  1L0X B;  2AQ2 B;  4JI2 Q;  2RHS B;  4X64 Q;  5HUR A;  1VQ8 A;  2F4V L;  1EQV A;  3CCM A;  4X62 Q;  1PYW D;  2FJ2 A;  1I6H B;  1MJE A;  1Y1V B;  2JQO A;  2F0V A;  4GLV B;  2VUM B;  4RH6 A;  1KIX A;  3NQT A;  4P72 A;  4C1N K;  2JP1 A;  4LMQ D;  3KUP A;  4AYB B;  2K5N A;  1O7I A;  1KRT A;  2N55 A;  1Q81 C;  1H9S A;  1BDO A;  4FYD A;  5ELF A;  4BXX G;  1N33 L;  1LV9 A;  1N34 Q;  1SBB B;  4DAV A;  4DA2 A;  1PVO A;  2Q8T A;  2YTY A;  2LFN A;  4NKL A;  2B2W C;  4LF7 Q;  4IPC A;  4A3K H;  2JXM B;  3PSI A;  1K8O A;  4KHV A;  4CGY B;  2Z8L A;  1ICW A;  1HR0 W;  4DR1 L;  2F0I A;  2Y0S E;  4A3J G;  2PO4 A;  2V4D A;  1A3T A;  1AEX A;  1I94 L;  1K3B C;  5JPM C;  3JC6 6;  3D0F A;  5IWA Q;  4BA1 I;  4IPD A;  4QQB X;  5ELC A;  5KEE A;  1KXL A;  2PZW A;  4DU9 A;  3TS2 A;  3JAM c;  1KQS A;  2EYH A;  1GHK A;  1PYS B;  2WII B;  2L1B A;  4K8J A;  5AJ3 Q;  1MSH A;  3TRZ A;  4QUF A;  3RUZ A;  1JOQ A;  3K5O A;  1VF7 A;  1IHZ A;  1T9H A;  1AP0 A;  4BBS G;  3AFQ A;  4JI1 Q;  2Q2T A;  4KTA A;  4A76 A;  1PHJ A;  3HFZ B;  1FNU A;  4DV3 L;  2K32 A;  3OIP A;  5CYU A;  5M5Y H;  4A3C G;  3FKI G;  4V0B A;  3ULJ A;  4N8X 1;  4A3F B;  3J80 L;  4IUU A;  5JOB A;  4DV4 L;  2I5L X;  1X56 A;  5LMU Q;  1XMO Q;  3H09 A;  1G2S A;  4AIM A;  1SMX A;  3STB D;  1ASZ A;  1VMP A;  3I4M B;  3A56 A;  2F0N A;  5M5X H;  4PZ8 A;  5FJ8 H;  5DAU A;  4RFB A;  5C4J H;  4MTN A;  1SRU A;  4FF4 A;  4B9W A;  1F9R A;  3O13 A;  3SHL A;  3I4N H;  1MIU A;  4GNX B;  1EQQ A;  1VQK A;  2VW9 A;  3Q0A A;  4DAM A;  3RN2 A;  1XPU A;  4M1U B;  1RF2 D;  3GTM H;  2D0P A;  1S5B D;  3S16 B;  3J81 E;  4BBR G;  4LFC Q;  1IKL A;  1UNS A;  4CKC A;  3PUV A;  2HD3 A;  2WKD A;  1IW7 C;  4XYO A;  5JEA G;  1B2T A;  4DK1 A;  2DNE A;  4C3H G;  3PGZ A;  3DXJ C;  3A55 A;  4K6D A;  1TS3 A;  3GO5 A;  5FO7 B;  2K05 A;  2NN6 H;  1CQF A;  3E3X A;  1VCI A;  4N9P A;  2KCM A;  4OIK A;  4DR2 Q;  3MEF A;  3NEN A;  5HY6 A;  1B3Q A;  4LFB L;  2EYM A;  4X3U A;  4I7A A;  4KKS A;  2G5D A;  3K57 A;  4JI4 Q;  1HUN A;  1PH3 A;  4K0K Q;  2E76 C;  3H3V H;  1EIG A;  4GOP C;  1Y69 U;  4UP8 A;  1JE5 A;  3TS0 A;  5GAD C;  5C3E G;  1YIJ A;  4BY1 H;  1J5E L;  3N52 A;  1HNW L;  2XNA C;  3PIP 3;  3S17 H;  3QWN A;  1X9N A;  4ME3 A;  4IOA A;  4AQY L;  1TS2 A;  3PO2 G;  1X6O A;  1PTO F;  2E2H H;  1KRS A;  2UXC L;  4ULL A;  3VR4 A;  2UU9 Q;  3M7N A;  1I50 H;  3A8J E;  1LTS D;  1V1P A;  4OEM B;  5IY0 A;  1WTO A;  5JVH 3;  2JN4 A;  3V96 A;  1N36 L;  2IWH A;  1K0S A;  2LMC B;  1S5F D;  2NZ1 D;  5KNB A;  2K01 A;  1LT4 D;  2F0S A;  1AFP A;  3S14 B;  3T56 B;  1SND A;  3KF8 B;  4QUC A;  4DV2 Q;  1LT5 D;  5IP7 G;  1JWU D;  3NWT A;  1Q8I A;  4NMZ A;  1V8Q A;  4LW1 A;  3S2H H;  1EY7 A;  5KRU A;  5C4X H;  1W2B A;  1PH5 A;  1A15 A;  2QF7 A;  4JI2 L;  1S40 A;  1Q7Y C;  1N8R C;  1B9N A;  4X64 L;  2RVL A;  1VQF A;  2BDO A;  3I90 A;  2F0K A;  2L55 A;  4XXE A;  4X62 L;  3P1H A;  4DR3 Q;  3IKJ A;  4LFA Q;  2L4N A;  4E6I A;  3RN5 A;  2B2T A;  4A93 H;  3U50 C;  2O5J C;  2JA6 G;  1VQB A;  1J6Q A;  1C7Y A;  2WAQ E;  4ZKB B;  2QEX A;  4NP5 A;  2EJG C;  2N78 A;  2EJM A;  4A4I A;  4DK6 C;  5C3X A;  1STH A;  1PDQ A;  3DM3 A;  3BJU A;  1TWC H;  1WD1 A;  5M3F B;  2NVX B;  4ZKC B;  3S9W A;  2PZU A;  4TSS A;  1N34 L;  3S1M H;  1TWA H;  4OX9 Q;  4BS9 A;  2PI2 E;  2PMZ B;  1Y1W B;  1QOH A;  4FXD A;  2NVQ B;  1V43 A;  5EAY A;  3F2U A;  4TQU S;  2A6E C;  4LF7 L;  3KDF A;  4JYA Q;  4DR4 Q;  1T5X D;  1PTO B;  1FVI A;  1NAP A;  2R7Z G;  1KAA A;  4GNX C;  4R8N A;  2EYO A;  3CW2 C;  4BY7 B;  1EEI D;  4B3R Q;  3A7A B;  4HIO A;  4LF5 Q;  5IWA L;  4DR6 Q;  1R9T B;  3RZD B;  2LSS A;  3AU7 A;  1JJ2 A;  1JMC A;  1QUQ B;  3CPW A;  1GD7 A;  3PMF A;  4KLK A;  5AJ3 L;  1EU3 A;  5IOC A;  1TXY A;  4QL5 A;  4CJ0 B;  2FMC A;  2I5M X;  4G7H C;  1B53 A;  1I4X A;  4DK0 A;  1SNP A;  1ASY A;  2B8G A;  5EGT A;  4X3S A;  1D7Q A;  3A7L A;  2JA5 H;  1NNX A;  1X3G A;  2DNC A;  3NE5 B;  4ZCK A;  5EPK A;  1PRT F;  5IE8 A;  1VQ7 A;  3U9O A;  1E3P A;  1ROD A;  1VQ5 A;  3HOW G;  5JAV A;  5LMN Q;  2RBM A;  1SFO B;  3J80 E;  3EFX D;  5M5W B;  1BO0 A;  5ELN A;  3OW7 A;  5M3M H;  1I6V C;  5LMU L;  1XMO L;  3RZO B;  1BBW A;  3HOW B;  5D65 A;  1SMY C;  2UXB Q;  4IOC A;  4DV1 Q;  3G71 A;  1YVC A;  5ELD A;  4NPS A;  4PMW A;  1UE7 A;  2Z6B A;  1PH9 A;  4JCV E;  1DM0 B;  1K3R A;  3AYH B;  1PXU A;  1JCK B;  4XYQ A;  1DGS A;  3PCO B;  4L6T B;  1K8M A;  3GTO B;  2XN9 C;  1DYQ A;  1KD1 C;  2JA7 H;  3HOV B;  3NWS A;  2ASB A;  1JR0 D;  1LUZ A;  1ONL A;  4UY8 C;  3NHH A;  2QA4 A;  1G51 A;  1PFB A;  5J39 A;  1EUJ A;  3PF5 A;  1QNU A;  2CHB D;  5FLX L;  4KI0 A;  1NTG A;  3D4W A;  1P16 A;  1B7Y B;  1WCM G;  4A3M G;  2F0O A;  4DR2 L;  1SYC A;  4U68 A;  5I6Y A;  2QIL A;  5C6A A;  5JJL A;  3MEH A;  1JQY D;  3SDZ A;  4A3I H;  3LWU A;  2B2V C;  2VQF Q;  4JI4 L;  1JB3 A;  4K0K L;  4BA2 I;  4ZUJ A;  4N9T A;  1OXT A;  1C4Q A;  2N8N A;  3DWP A;  4PMC A;  1PRT B;  3NSW A;  1B44 D;  4B3S Q;  2H5X A;  1HNZ Q;  5J1Z A;  2RQX A;  3T1Y Q;  4K5X A;  4EQN A;  3E0J A;  4JI3 Q;  1CHQ D;  1HH2 P;  2KOL A;  2ENB A;  4OWX B;  4ILW A;  3SK8 A;  2PQE A;  2UU9 L;  4UP9 A;  2MFI A;  5I6W A;  1F9S A;  1SR3 A;  1TWH B;  4XQN A;  2RDG A;  2E8G A;  4Y7N H;  2GVA A;  3G48 A;  4P73 A;  4KMU C;  2EVB A;  2RSN A;  3K7A H;  3NQI A;  4CJ2 C;  5COY A;  1ESR A;  4JC0 A;  2F3W A;  3URY A;  4DR1 Q;  2PQA B;  2QGQ A;  1U0L A;  4C3I H;  3CD6 A;  3HOY G;  2A6H D;  4O1N A;  1PH4 A;  1H9S B;  4NW2 A;  3T53 B;  3UI2 A;  4DV2 L;  4DAY A;  1YJ9 A;  2HHH Q;  1KL9 A;  3BDL A;  1H9M A;  5K36 H;  2EXD A;  1NY4 A;  3TBI B;  1VS0 A;  1BCP C;  3M3Y B;  3CF5 A;  2X6G A;  2F0P A;  1YNX A;  4DNI A;  2ZXO A;  3VR3 A;  2WFW A;  1O78 A;  3HOX B;  3BYY B;  5I4D A;  2D9U A;  3OTO L;  3E6Z X;  3K0Y A;  1J9O A;  3AMU A;  3CQZ B;  4LFA L;  3S1R H;  5CBE E;  2BE5 C;  2FXQ A;  3PO3 H;  2PW5 A;  4HED A;  4X66 Q;  1U4M A;  3MA2 B;  1S5E D;  4A3L G;  2R7F A;  3FPP A;  1I6H H;  1Y1V H;  4GZY C;  1K28 A;  1X3P A;  2VUM H;  2EDG A;  1Z47 A;  1VQL A;  4OX9 L;  2AUJ D;  3RLN A;  3KFU A;  1Y8P B;  5GAG C;  4DV0 L;  4R4T A;  2G9D A;  4A3E B;  2A68 D;  4JYA L;  4MNO A;  2Z0S A;  3KLS X;  4DR4 L;  1HTP A;  2NVY B;  1FNW A;  2XTI A;  1LO5 D;  4KY6 A;  2L11 A;  1RHP A;  5C44 G;  5FLM G;  2D5D A;  3W1G A;  4PMB A;  4B3R L;  2A73 B;  4LF5 L;  2KCN A;  2XRQ D;  3GTQ H;  4LF8 Q;  5CGK A;  2A5H A;  5ELB A;  2YYZ A;  1SSO A;  3D4D A;  3DLL A;  3MVV A;  1OO9 B;  5F2D A;  2CFM A;  4C2M B;  2R3Z A;  4HCE A;  4ID6 A;  1CA5 A;  2JA9 A;  2BDN A;  2ICE C;  3F2C A;  1QG7 A;  2TMP A;  3H91 A;  4JI7 L;  1VQO A;  1EWC A;  1STB A;  3MXN A;  2HCI A;  1HQR D;  1LTT D;  1EZ6 A;  3P20 A;  1UE6 A;  3EJI A;  3CXC A;  1QJO A;  4ODG A;  4KJN A;  1D5X C;  1I4G A;  3BZD B;  4J6H A;  1KDB A;  1T5E A;  2JEB I;  1A63 A;  2WAQ B;  2SNM A;  2ZTE A;  2MO0 A;  4NDX A;  4B3M Q;  3GP7 A;  1PRT C;  3L0O A;  5LMN L;  3HOZ G;  1ZYR D;  3UDX A;  2R92 G;  3OWF A;  4KN7 C;  2EZV A;  5KYL A;  5IYC H;  4UP7 A;  3HOZ B;  1HNW Q;  2UXB L;  1E22 A;  4A3D B;  4A3F H;  1NCV A;  4DV1 L;  1JT8 A;  1XWE A;  2Q2U A;  4EQP A;  3AEV A;  5GQO A;  4DAP A;  1KLG D;  1UUP A;  4WFN 3;  3I4M H;  4EQO A;  4R4I A;  1SRO A;  1CT1 D;  1BBU A;  1PH1 A;  2XWB B;  4WRD A;  2EE1 A;  3GTG B;  3DWQ A;  4C3J G;  4P2C B;  5IYB H;  3S15 H;  3E9I A;  2Z4I A;  1TY0 A;  1LTL A;  1X32 A;  5FLX E;  5C0X G;  2FFK B;  2K50 A;  1TKW B;  2QKI C;  5CV7 A;  5FO8 B;  1SNQ A;  3L9A X;  4GS3 A;  2IX3 A;  1GHJ A;  3GTL H;  2JA8 G;  2F0W A;  5A35 A;  1RIP A;  3EA6 A;  2VQF L;  3FDT A;  4DNR B;  2CVR A;  1Q1E A;  3SK6 A;  2RDH A;  3S1Q H;  3C1F A;  1EZ8 A;  1G8Z D;  3NTH A;  3RLF A;  2KEC A;  1RTO A;  4GOP B;  4B3S L;  4CHT B;  1CFM A;  3G4S A;  4FVM A;  1ILP A;  4DR7 Q;  1HNZ L;  5M9O A;  3T1Y L;  1O80 A;  1FYC A;  4WOR A;  4JI3 L;  3GD7 A;  4IFD G;  1BUV T;  3J7A V;  1D1K A;  2A74 C;  1PH6 A;  3W5O A;  3K5N A;  4JI5 Q;  1JC7 A;  5K5P A;  3QOJ A;  2CQO A;  2L15 A;  3FEW X;  3CCJ A;  2VY3 A;  3M4O B;  2XWJ B;  3HOU H;  2KHJ A;  5IYD H;  3JAM L;  1U5K A;  1WOC A;  4RGN A;  1MHW C;  2KEE A;  4KD4 A;  1C0A A;  3R8B A;  4APV A;  5IT9 c;  3E5S A;  1VQ9 A;  2I5H A;  3GTK B;  4G57 A;  1D5M C;  2HHH L;  2KUM A;  3T1H Q;  3MFY A;  3C46 A;  1RCV D;  3V05 A;  4QIW B;  1ET9 A;  4A3J B;  3SK4 A;  2KEN A;  2FHT A;  4L8J A;  4JBJ A;  1Z7T A;  1A8V A;  1JWM D;  3OMG A;  5I2Y A;  4I65 A;  2R93 G;  4OGQ C;  3ULL A;  4IUR A;  4FDB A;  1VQ4 A;  3S1N B;  4P75 A;  3KOJ A;  1HZB A;  4X66 L;  3IAY A;  2ZJP A;  3HKS A;  4FO2 A;  4CDD C;  1XJV A;  4MN3 A;  1EOV A;  1G91 A;  2DJG C;  2B63 G;  2LY7 A;  5ISR A;  2N49 A;  4BBS B;  1CSQ A;  2NTT A;  4L63 B;  1C9O A;  3K80 C;  1EOT A;  3I2Z A;  3I91 A;  3HKZ G;  3OYY A;  3J7Y W;  3NTK A;  4EVO A;  1M4V A;  4IAL A;  5IP9 H;  2O4X A;  1TII D;  3GTP B;  4ZLT F;  5M3F H;  2NVX H;  1B4O A;  3E0E A;  3FKI B;  2ZTD A;  4KHP Q;  1Y1W H;  1L1O A;  2NVQ H;  4RKB A;  1MGS A;  1MSG A;  3KF6 A;  4DGZ A;  2ZXP A;  3BDC A;  1PTO H;  4LF8 L;  4H44 C;  5IGD A;  1XX8 A;  3AB9 A;  4F87 A;  5I2X A;  4DF7 A;  1CA6 A;  2EYL A;  2HT1 A;  2EY6 A;  2R6G A;  1IBL Q;  3I4O A;  4BY7 H;  4LUZ A;  1I3Q H;  3A54 A;  1IL8 A;  2J0T D;  4N8F A;  1YIT A;  3AQQ A;  4GN3 B;  1EEF D;  3TQY A;  3T4A C;  1L0Y B;  2YTV A;  2Q2H A;  4DV5 Q;  4RGT A;  1WTQ A;  3UE1 A;  2BH8 A;  1R9T H;  4HIK A;  3RZD H;  4R4C A;  4BBR B;  3J7A 5;  4A3B G;  1K83 H;  4A3G G;  3OIQ A;  4JOI A;  2WB1 G;  1MI2 A;  4C3H B;  1CKN A;  1OXU A;  1K0R A;  1LM0 A;  1PH2 A;  4F8M A;  4B3M L;  3GTJ B;  4IPG A;  2SEB D;  2C35 B;  1LYL A;  1PZI D;  5EBC A;  3K58 A;  3RMH A;  2UUB Q;  1Q82 C;  4JW0 A;  3G6E A;  5BR8 Q;  3TZD A;  4FF3 A;  3BVM A;  1IBM Q;  3TME A;  2A8V A;  4JPB W;  1Q1B A;  3KBG A;  1F77 A;  2EIF A;  3NPP A;  1SFO H;  5C3E B;  5M5W H;  1YNJ D;  1G6P A;  2B8F A;  3B6Y A;  2IJ0 A;  1YI2 A;  5JJZ A;  2BA1 A;  3U4V A;  5LMN W;  4LF4 Q;  3RZO H;  4GKK Q;  2B2T C;  2M00 A;  2XSC A;  4R8I A;  4H7B A;  1EIY B;  1SYE A;  2VB2 X;  2R7D A;  1KAW A;  3ND9 A;  2B29 A;  3PO2 B;  3MAQ A;  1S5D D;  1W6K A;  1JWS D;  4MTK A;  4A3K G;  2JK8 A;  3NK9 A;  2OEO A;  1AE3 A;  3VYS A;  5EQ0 A;  1EQT A;  2RCF A;  4EQ5 A;  1NR4 A;  1QB5 D;  4A3K B;  1SXT A;  2M2L A;  2EYJ A;  3T13 A;  1S72 A;  3OPO A;  3HOV H;  3N6R A;  4Y52 H;  4IUV A;  1BCP F;  2B2U C;  4LWC A;  1TVX A;  3PIO A;  1MBY A;  1WJJ A;  4AH6 A;  1TS5 A;  3GQB A;  1KTK A;  5GAH C;  5D3D A;  3BDO A;  2RF4 A;  1X54 A;  5JVG 3;  2E2I H;  2LXJ A;  3IRB A;  3OTO Q;  3D6C A;  4H02 A;  1WTX A;  2K5V A;  3OWE B;  4DAY B;  4HCS A;  1JOO A;  2F0F A;  4IPH A;  4DR7 L;  5DLQ E;  1QZH A;  1K8G A;  1CI3 M;  5JJI A;  4DV7 Q;  3BS1 A;  2JA6 B;  4XT1 B;  3K5L A;  1ML0 D;  2UUC Q;  4L5Q A;  1WTP A;  2F03 A;  4ME5 A;  2A6E D;  1FR3 A;  2OCE A;  3HP3 A;  4OL7 A;  4DXG A;  4OO1 I;  1DZ1 A;  1DON A;  4DV0 Q;  1HXY D;  4JI5 L;  5M5Y B;  4QY7 A;  2BH2 A;  1JOR A;  1YBY A;  1CZG A;  5I9P A;  3NEM A;  3JAM E;  3VR6 A;  5C4Z A;  4PNY A;  5FJ8 G;  2F0Q A;  1TWH H;  2MQH A;  2F0H A;  3SEB A;  1SLJ A;  2RSO A;  3I4N G;  5G3L F;  1SE8 A;  2R7Z B;  3T1H L;  2IT1 A;  2NBF A;  5EBD A;  1EU4 A;  4RA8 A;  1Y14 B;  2PNH A;  1NBW A;  1C48 A;  2UXD Q;  4RCN A;  1HHV A;  4IUQ A;  1XMQ Q;  2J4X A;  1X3Q A;  3J81 i;  1AW7 A;  1KNA A;  3RR5 A;  1STY A;  1BCP B;  3QR8 A;  1U4R A;  2K28 A;  1W6J A;  2VNU D;  4YY3 Q;  2LXK A;  3M3Y H;  4JI7 Q;  3UDG A;  2HIV A;  4DUY Q;  3NBH B;  2OQ0 A;  2NN6 G;  2ZXR A;  4L5T A;  4O2D A;  3SK5 A;  1E1T A;  5C0X I;  2CW0 D;  2ZT9 C;  4XTC S;  3HOX H;  1SJE D;  1DOK A;  1WD0 A;  1BF4 A;  1F9P A;  2QDL A;  3CQZ H;  3SXH A;  2VXW A;  1LTR D;  1B3A A;  1GXD C;  1CKO A;  4LNQ A;  2V1C C;  1VMC A;  2JEA I;  2F4I A;  4BY1 G;  1HTL D;  4F7X A;  2QCP X;  1BXT A;  1II3 A;  3NBI A;  4L5R C;  2OTJ A;  2Z4H A;  1C8C A;  1OTC A;  3K7U C;  1RD9 D;  4KHP L;  2EYP A;  4DUZ Q;  1YHA A;  4K14 A;  1VQG A;  4LJZ C;  1X65 A;  3OMC A;  4A3E H;  1D8L A;  4HMJ A;  2NVY H;  4XDX A;  2AMC B;  2VZA A;  4IFD I;  3K0X A;  3VR5 A;  3CCL A;  4RHR A;  1QVG A;  2E2J B;  1ENC A;  4HJ5 A;  1IBL L;  4FNF A;  2HDL A;  5JJK A;  1HZA A;  2ALY B;  5HGQ A;  3MXP A;  1PYB A;  1M1K C;  3A5U A;  1SN8 A;  4LF9 Q;  2Z6K A;  4DKA C;  5LL6 X;  1I4P A;  2OQK A;  1PLF A;  4KY7 A;  1ICF B;  1RKN A;  4QIW E;  2KJX A;  4DV5 L;  2NVT B;  1TS4 A;  3TP6 A;  4C56 C;  1FL0 A;  1S5C D;  2H4O A;  5KND A;  2ID0 A;  4C2M H;  2PNR C;  5C3W A;  5D14 A;  3QB3 A;  1XXG A;  1OXS C;  1STG A;  3I3C A;  2ZM6 Q;  1QWY A;  1KDC A;  5C4X G;  4UHV A;  4HJ8 A;  2JYO A;  2N88 A;  3ITP A;  4G7O C;  4LUV A;  4V19 0;  1WCM B;  2R61 A;  3K59 A;  4A3M B;  4PQX A;  1VQM A;  4X3T A;  3S2H B;  2Q8R E;  4TVA B;  1SNC A;  5EPJ A;  3TZU A;  4DK3 C;  2UUB L;  3NXW A;  4A93 G;  3WWV A;  5FO9 B;  5BR8 L;  1UE5 A;  2SOB A;  3ULP A;  1IBM L;  2QW7 A;  4K2K A;  1PFM A;  2L9H A;  2SDF A;  4RGO S;  1XYI A;  4UDU C;  4A93 B;  2K04 A;  1QE6 A;  1GKH A;  5J3B A;  1GM5 A;  1OXV A;  4LF4 L;  1Q46 A;  1PTO D;  1VQH A;  4GKK L;  2K14 A;  2Q2I A;  3CCS A;  2C5C A;  1NMF A;  4OO1 H;  1E2Z A;  4Q0F A;  3HKZ E;  4A3D H;  4FXG C;  1STA A;  1JE4 A;  3MC0 B;  5EJW A;  3FHW A;  3ND8 A;  3I56 A;  4KKT A;  5J22 A;  2F0D A;  3JAM i;  3H0G H;  5CBA E;  1H9R A;  1X3E A;  1M8A A;  3TEH B;  2B2Y A;  2YTX A;  3EN2 A;  1Q3L A;  4POF A;  3GTG H;  3HOY B;  1NR2 A;  1EWI A;  2JE6 I;  1FGU A;  2EY2 A;  1O7Y A;  3ERO A;  1G2T A;  3E9H A;  3KK7 A;  5BN4 A;  4JI0 Q;  1LTB D;  3FP9 A;  2P5Z X;  1ILQ A;  5IGC A;  4HJA A;  4QJF A;  1PZJ D;  4U67 3;  2BE5 D;  3I55 A;  5H1S E;  2XIW A;  2A6H C;  3J7Z C;  4JK1 C;  2F3I A;  2IY5 B;  3KLR A;  1HZ9 A;  2JA5 G;  3VA5 A;  2Z1C A;  3S24 A;  2WB1 E;  1V1Q A;  4DV7 L;  1GVP A;  2WIN B;  2JA5 B;  2UUC L;  4R1J A;  4J15 A;  4S3S A;  4IO9 A;  4HR7 B;  3H3V C;  4GLA C;  3J80 i;  2E74 C;  3W3A A;  5M3M G;  2E5L Q;  3CC7 A;  5IGF A;  2J7Z A;  3FPU B;  1HA5 A;  2EJF C;  3M4P A;  4WJ3 M;  2DGY A;  1XPO A;  4XQQ A;  4ZAI A;  4POG A;  4BXX H;  3NP8 A;  1V9P A;  3M9B A;  1WTR A;  4YCW A;  4R9W A;  3HS0 C;  2KHS A;  3M4O H;  4YWL A;  1FJG Q;  1OXX K;  5C44 B;  3RNU A;  4HSV A;  2UXD L;  2JA7 G;  5A2Q L;  1XMQ L;  1QUQ A;  4HTH A;  2GN5 A;  1FNV A;  2ZJQ A;  2A68 C;  3GTK H;  4TRD A;  2DY7 A;  2AKW B;  1VDZ A;  5JPN C;  3CPF A;  2A1A A;  5KYI A;  4NXM L;  4IN3 A;  5E1F A;  1TU2 B;  4A3J H;  4YY3 L;  2K4K A;  3WOE A;  1G29 1;  3P75 A;  4DUY L;  5LHY 1;  3ONA B;  3GV3 A;  2MP1 A;  3MWY W;  2D62 A;  3F2B A;  4JI8 Q;  4P71 A;  1VQA A;  3A74 A;  4ZK9 B;  1HPC A;  3F1Z A;  3BVZ A;  4NXN L;  3PIP A;  1TWG B;  1PFN A;  3P7J A;  2A69 D;  1B1Z A;  1PRT D;  2CKZ B;  4H13 C;  4JVZ A;  5FKA C;  4A3I G;  3S1N H;  1UWV A;  2IW3 A;  5C5L A;  5I9O A;  3X3M A;  1EFI D;  3R3O A;  4CDC C;  4RMF A;  5ELO A;  1EYA A;  2VL6 A;  2Z9H A;  3LGJ A;  5CV4 A;  2NYZ D;  3VYR A;  1HNX Q;  2M9V A;  1SYD A;  5JEA J;  3PQI A;  4BBS H;  4RHS A;  3QG1 A;  1YNN C;  1EQR A;  2CH4 W;  4LF6 L;  1G6Z A;  2EQS A;  3CP0 A;  3A8K E;  4DUZ L;  3J81 c;  3CU7 A;  5ELE A;  2R92 B;  1P8L A;  3K6O A;  1CKN B;  1VQ6 A;  3SVM A;  3GTP H;  4A3C H;  4NB3 A;  1VQD A;  3FKI H;  2I46 A;  1A6X A;  1CHP D;  1HUM A;  5DM6 3;  1O7L A;  3S2D B;  1ZYR C;  1EYG A;  1YJN A;  4YWK A;  4OWW B;  1RL2 A;  4ZYS A;  4LF9 L;  1TWF B;  4HSP A;  1WFQ A;  3F2D A;  4C3I G;  3CCU A;  2JJQ A;  3A0J A;  1KHI A;  5T1I A;  2VQE Q;  1F2M A;  3S16 H;  2KVM A;  3D6W A;  3U4Z A;  5CV9 A;  1SEB D;  4RKL A;  4C3J B;  1SYG A;  5K36 G;  2ZM6 L;  1V1P B;  1SAP A;  4X6A H;  2BA0 A;  2N3S A;  3C2P A;  4G4K A;  4RCO A;  4BBR H;  4DXF A;  3WOF A;  2KA7 A;  3Q24 A;  1MJC A;  3W2D A;  5C4H A;  1A2T A;  2PZT A;  5JEA H;  2X6L A;  4C3H H;  2JA8 B;  2AUK A;  3L7Z C;  3OSO A;  3PO3 G;  2NN6 I;  2F52 A;  4OON A;  3MXG A;  2F3V A;  3GTJ H;  2I07 B;  1K8A C;  5EKI A;  1SNO A;  3ERS X;  3G6J B;  3CCE A;  3I72 A;  1Y1V G;  1I4R A;  3CRL C;  5IT9 L;  2VUM G;  2EY1 A;  4HAE A;  2MNA A;  3H3V I;  3CCV A;  4AYB G;  2K52 A;  1U4P A;  2RA4 A;  1DXM A;  1UEA B;  2NZO A;  5C3E H;  1LLR D;  1UEB A;  3U9S A;  2RHQ B;  2OXP A;  4GN5 A;  4BWG B;  3Q23 A;  4IJH A;  2PQA A;  5AFW A;  3BU2 A;  4CDF C;  4KKU A;  5KIX A;  1D6E C;  1DJR D;  2OF1 A;  1F2Y A;  3PO2 H;  3M4Y A;  1Z6H A;  1QNK A;  4UAI A;  4EX5 A;  3DHQ A;  1WTV A;  3TP7 A;  1Y8O B;  2B3G A;  4GKJ Q;  5HGT A;  3S14 H;  1X3F A;  1IXR A;  2K6A A;  5GRO A;  1L1O C;  3KDF B;  1IYJ B;  3GTQ B;  2D0O A;  2JSO A;  2KQ3 A;  4JI0 L;  5GAE C;  1N32 Q;  1PMR A;  5L37 A;  2F1M A;  3I8Z A;  3D3R A;  4XT3 B;  1FD7 D;  3BVG A;  5IP7 H;  1JJG A;  3RD4 A;  2R93 B;  3LWE A;  2L5T A;  2QDB A;  4LAA A;  2ZTC A;  3RLO A;  3WDN A;  1Z9F A;  4PZ7 A;  3LNN A;  5IGG A;  4DV6 Q;  2EYF A;  1O7Z A;  1XNR Q;  5DEH A;  1HRJ A;  4KK7 A;  1QIL A;  2B63 B;  1XPR A;  3VR2 A;  2ZJR A;  1MD2 D;  1BQQ T;  4EGV A;  4JOI C;  1WVL A;  3A5Z B;  2E5L L;  1AN8 A;  1CTM A;  2JA6 H;  5IYC G;  2B2W A;  3KYH C;  3HKZ B;  4A3F G;  1H9K A;  3H15 A;  1I4Q A;  5CV6 A;  5TSS A;  1YJW A;  4GN4 B;  4OWT B;  1WTW A;  3M4Q A;  2OTL A;  4IUP A;  1WI5 A;  4R4O A;  1W3S A;  1FJG L;  3I4M G;  2HDM A;  5DM7 3;  1CUK A;  3PV0 A;  3UDI A;  1BVS A;  2YU9 B;  5A2Q E;  4UPA A;  4ALP A;  3VDY A;  1A3V A;  4JV5 Q;  2WV6 D;  1WTH A;  1EY6 A;  2F0T A;  2R7Z H;  1SE4 A;  3I73 A;  1IW7 D;  2OWO A;  3V2T A;  4HN7 A;  4LUO A;  3STB C;  3AFP A;  5IYB G;  1B9M A;  1Q90 A;  1QZG A;  1R4P B;  3J80 c;  1N9W A;  4C1N I;  4HIM A;  4JI8 L;  3UDF A;  1EYC A;  3S15 B;  1PA6 A;  1IYU A;  3DMU A;  4TKO B;  1SYF A;  3CCR A;  1IKM A;  4YCV A;  4K5V A;  4WJW A;  5CMD A;  4A3G B;  1M90 C;  4A3B B;  2C9O A;  4ZUI A;  3K5M A;  1XNQ L;  2WB1 B;  2G9H D;  2HUG A;  3MFG A;  1JB7 A;  3GTL B;  1BOS A;  1HNX L;  4PG3 A;  1ENA A;  4CKE A;  1YEZ A;  2E2D C;  2PI2 A;  3KJP A;  3S1Q B;  4DFA A;  2WAC A;  5CV8 A;  3CHB D;  1VQE A;  2PW7 A;  4I7Z C;  1QCB D;  2DN8 A;  1KLU D;  4K2L A;  3HOW H;  1V1O A; 
#chains in the Genus database with same CATH homology
 4P72 A;  3K7U C;  3RLN A;  1OTC A;  4OX9 L;  3KFU A;  4KHP L;  4DUZ Q;  2K5N A;  1O7I A;  5GAG C;  1KRT A;  4DV0 L;  1Q81 C;  1QVC A;  1YHA A;  4R4T A;  1VQG A;  1X65 A;  2K75 A;  4JYA L;  4MNO A;  2Z0S A;  4A3E H;  1D8L A;  1N33 L;  4DR4 L;  4YHH Q;  4BXX G;  1N34 Q;  2NVY H;  2XTI A;  4MZ9 A;  3HOU G;  1PVO A;  2AMC B;  2VZA A;  5IYD G;  3K0X A;  4IFD I;  2YTY A;  3CCL A;  2HIX A;  1QVG A;  5C44 G;  5FLM G;  4HJ5 A;  3W1G A;  3L2P A;  1HR0 Q;  1IBL L;  2VQE L;  2E2J H;  3GTO H;  1HZA A;  2ALY B;  2IHF A;  4IPC A;  2CCZ A;  5HGQ A;  4A3K H;  4LF7 Q;  1PYB A;  1M1K C;  3PSI A;  1SN8 A;  2WP8 J;  3A5U A;  4LF9 Q;  4LF5 L;  1HR0 W;  2Z6K A;  4DKA C;  4LF8 Q;  3GTQ H;  4DR1 L;  2OQK A;  4QIW E;  2YYZ A;  4DV5 L;  2NZH A;  2Y0S E;  4A3J G;  3DLL A;  2NVT H;  1FL0 A;  1GO3 E;  4YWM A;  1I94 L;  4JG2 A;  2CFM A;  4DPG A;  3JC6 6;  2ID0 A;  4X65 L;  4C2M H;  3D0F A;  5IWA Q;  4BA1 I;  1IZ6 A;  1CSP A;  4IPD A;  4QQB X;  1S3O A;  1Q8K A;  2JA9 A;  1OXS C;  3F2C A;  2ZM6 Q;  1KXL A;  4P74 A;  4JI7 L;  1VQO A;  3TS2 A;  3JAM c;  1KQS A;  5C4X G;  3CC2 A;  4HJ8 A;  4GOP A;  1PYS B;  4LUV A;  2UUA Q;  1UE6 A;  1WCM H;  4A3M H;  5AJ3 Q;  1VQM A;  3PUY A;  3CXC A;  4TVA B;  4DK3 C;  2UUB L;  3TRZ A;  4A93 G;  3WWV A;  5BR8 L;  2JEB I;  1A63 A;  1T9H A;  1UE5 A;  4BBS G;  1KC8 C;  3AFQ A;  4JI1 Q;  2ZTE A;  3ULP A;  1X55 A;  2KHI A;  2MO0 A;  1IBM L;  2Q2T A;  4B3M Q;  4A76 A;  1PHJ A;  3L0O A;  5LMN L;  3HOZ G;  3HFZ B;  1IBK Q;  4DV3 L;  4A75 A;  4YCU A;  3UDX A;  2R92 G;  5J3B A;  1L0W A;  1GKH A;  5IP9 G;  1GM5 A;  5M5Y H;  1OXV A;  5M3F G;  4B3R L;  4LF4 L;  1Q46 A;  4A3C G;  1VQH A;  4HID A;  4JBK A;  2K14 A;  2Q2I A;  5IYC H;  3FKI G;  3ULJ A;  3CCS A;  4GKK L;  4UP7 A;  1YZ6 A;  1HNW Q;  1NMF A;  2UXB L;  1E22 A;  3GDE A;  1WYD A;  4A3F H;  1Y1W G;  3HKZ E;  4DV1 L;  4A3D H;  1JT8 A;  2Q2U A;  4DV4 L;  2I5L X;  1X56 A;  5LMU Q;  3FHW A;  3I56 A;  1XMO Q;  3AEV A;  4AIM A;  1SMX A;  3STB D;  1ASZ A;  3PUX A;  5GQO A;  3I4M H;  3K81 C;  5M5X H;  2MO1 A;  3H0G H;  3JAM i;  4PZ8 A;  5FJ8 H;  2AHO B;  4GKJ L;  5C4J H;  4MTN A;  4R4I A;  4BY7 G;  1SRU A;  1X3E A;  1SRO A;  4PZ6 A;  1BBU A;  1PH1 A;  3I4N H;  3TEH B;  1MIU A;  4B3T Q;  4GNX B;  1EQQ A;  4JBM A;  4DR5 Q;  1VQK A;  3PUZ A;  2YTX A;  4XIG S;  3EN2 A;  2VW9 A;  4POF A;  4DAM A;  3RN2 A;  3GTG H;  1N32 L;  1XPU A;  4NXM Q;  2HQL A;  5IYB H;  1EWI A;  2JE6 I;  3U58 A;  3GTM H;  2D0P A;  3E9I A;  3HOY H;  1FGU A;  1LTL A;  2KCT A;  3S15 H;  3BZC A;  4BBR G;  4LFC Q;  5E7N A;  3E9H A;  5C0X G;  4JI0 Q;  3FP9 A;  3PUV A;  2K50 A;  4HJA A;  4QJF A;  5JEA G;  2Z6K C;  4GS3 A;  1EIF A;  4NXN Q;  3I55 A;  3PGZ A;  5H1S E;  3GTL H;  4DV6 L;  2JA8 G;  2CWA A;  3GO5 A;  1XNR L;  1RIP A;  3J7Z C;  2F3I A;  2IY5 B;  2VQF L;  1VCI A;  1HZ9 A;  2JA5 G;  2KCM A;  3Q8D A;  3S24 A;  4DR2 Q;  2WB1 E;  1Q1E A;  1YHQ A;  3S1Q H;  1V1Q A;  4DV7 L;  3MEF A;  3NEN A;  5HY6 A;  1CKM A;  1GVP A;  4LFB L;  3RLF A;  4JI1 L;  1VQL A;  3MXN B;  2AWN A;  2UUC L;  4GOP B;  4B3S L;  4R1J A;  4JI4 Q;  4J15 A;  4LF6 Q;  1PH3 A;  3G4S A;  4K0K Q;  3H3V H;  4GOP C;  4DR7 Q;  4A3L H;  4IO9 A;  4UP8 A;  1JE5 A;  1HNZ L;  3TS0 A;  3T1Y L;  3F8T A;  4GLA C;  3J80 i;  2KBN A;  5GAD C;  5C3E G;  1YIJ A;  1J5E L;  4BY1 H;  5M3M G;  3SGI A;  2E5L Q;  4JI3 L;  3CC7 A;  3GD7 A;  4GNX A;  4IFD G;  1HNW L;  1PH6 A;  4AYB E;  3S17 H;  3M4P A;  3W5O A;  1X9N A;  4ME3 A;  1MKH A;  4WJ3 M;  2DGY A;  4JI5 Q;  4AQY L;  4IOA A;  1XPO A;  1Q86 C;  3PO2 G;  1X6O A;  3CCJ A;  1BKB A;  2CQO A;  2L15 A;  2E2H H;  4POG A;  4BXX H;  2VY3 A;  4JV5 L;  1KRS A;  1V9P A;  3M9B A;  4YCW A;  2UXC L;  3HOU H;  2KHJ A;  4JI6 Q;  3M4O H;  5IYD H;  1U5K A;  4YWL A;  2UU9 Q;  3M7N A;  1FJG Q;  1I50 H;  1OXX K;  1WOC A;  1K73 C;  3RNU A;  5C44 H;  5FLM H;  2Y0S G;  1C0A A;  4APV A;  5IT9 c;  2UXD L;  2JA7 G;  1A62 A;  1PFS A;  1VQ9 A;  5IY0 A;  2I5H A;  1XMQ L;  1QUQ A;  3HOV G;  2GN5 A;  2ZJQ A;  1N36 L;  2YV5 A;  3GTK H;  1B8A A;  4HJ7 A;  3EIV A;  2HHH L;  2AKW B;  3T1H Q;  1H95 A;  4NXM L;  3CPF A;  2A1A A;  2KEN A;  4A3J H;  1NE3 A;  4YY3 L;  1Q12 A;  2K4K A;  4JBJ A;  1G29 1;  3CCQ A;  4DUY L;  1A8V A;  3KF8 B;  4DV2 Q;  4LFC L;  3UE0 A;  5IP7 G;  2D62 A;  3F2B A;  1VQN A;  4JI8 Q;  4P71 A;  2R93 G;  1VQA A;  3A74 A;  3NEL A;  4LW1 A;  3F1Z A;  3ULL A;  3S2H H;  4NXN L;  4FDB A;  1VQ4 A;  4P75 A;  3J81 j;  5C4X H;  3PIP A;  3RN5 A;  1W2B A;  1PH5 A;  3S1N H;  1TWG H;  2CKZ B;  4A3I G;  3KOJ A;  4JI2 L;  1YHB A;  1HZB A;  1S40 A;  1Q7Y C;  1UWV A;  4X64 L;  4X66 L;  1N8R C;  2ZJP A;  1VQF A;  3HKS A;  3CAM A;  4X62 L;  1I5F A;  1XJV A;  5C0X J;  1EOV A;  4RMF A;  5ELO A;  1PV4 A;  1UE1 A;  2VL6 A;  2A19 A;  4LFA Q;  4DR3 Q;  2B63 G;  3LGJ A;  1JJC B;  4A93 H;  1HNX Q;  3U50 C;  3CC4 A;  2N49 A;  5JEA J;  1VQB A;  1J6Q A;  1CSQ A;  1IL2 A;  2JA6 G;  4BBS H;  1C7Y A;  1C9O A;  1EQR A;  2WAQ E;  2QEX A;  2EQS A;  3CP0 A;  4LF6 L;  3K80 C;  2F4V Q;  2N78 A;  4A4I A;  4DK6 C;  4DUZ L;  3OW2 A;  5FLX c;  3I2Z A;  3J81 c;  3HOZ H;  3HKZ G;  3OYY A;  1P8L A;  3DM3 A;  3BJU A;  1TWC H;  2R92 H;  5IP9 H;  1CKN B;  1VQ6 A;  2AWO A;  3CME A;  5M3F H;  2NVX H;  4YHH L;  3GTP H;  3E0E A;  1N34 L;  4A3C H;  3S1M H;  2ZTD A;  4NB3 A;  1TWA H;  1VQD A;  3EBE A;  3FKI H;  4OX9 Q;  4KHP Q;  2PI2 E;  2K5H A;  1V43 A;  5EAY A;  1Y1W H;  1L1O A;  2NVQ H;  3D31 A;  1HR0 L;  4TQU S;  1EYG A;  1YJN A;  3S2D H;  3KF6 A;  4YWK A;  4LF7 L;  3KDF A;  4GLX A;  4OWW B;  4JYA Q;  4DR4 Q;  1N33 Q;  1RL2 A;  4LF9 L;  1FVI A;  3K8A A;  4WJ4 A;  4LF8 L;  2R7Z G;  1TWF H;  3I7F A;  1WFQ A;  3F2D A;  4GNX C;  2HT1 A;  4IFD J;  1PH8 A;  2R6G A;  3CCU A;  3CW2 C;  2JJQ A;  1IBL Q;  3A0J A;  1KHI A;  3I4O A;  2VQE Q;  4BY7 H;  4LUZ A;  4B3R Q;  1I3Q H;  2VS1 A;  1XTD A;  3S16 H;  2IX0 A;  3U4Z A;  1YIT A;  3AQQ A;  4GN3 B;  1HJP A;  1AH9 A;  4HIO A;  4LF5 Q;  1NMG A;  3TQY A;  5IWA L;  5K36 G;  4C3J H;  2YTV A;  2Q2H A;  4DV5 Q;  4DR6 Q;  2ZM6 L;  3UE1 A;  2BH8 A;  3KJO A;  1R9T H;  1EFW A;  4X6A H;  2BA0 A;  4HIK A;  1I94 Q;  2N3S A;  2LSS A;  3RZD H;  4R4C A;  3J7A 5;  1JJ2 A;  1JMC A;  1QUQ B;  4KHZ A;  4R4Q A;  4BBR H;  3CPW A;  1GD7 A;  2UUA L;  4KLK A;  4A3B G;  1K83 H;  4A3G G;  1MJC A;  5AJ3 L;  2GVB A;  4JOI A;  3HOX G;  1TXY A;  3KLW A;  4QL5 A;  2WB1 G;  2I5M X;  1CKN A;  1OXU A;  4C3H H;  1K0R A;  1ASY A;  3L7Z C;  1LM0 A;  2JA8 H;  1PH2 A;  3PO3 G;  2XGT A;  4B3M L;  1D7Q A;  2IX1 A;  2NN6 I;  2F52 A;  3PUW A;  4IPG A;  4OON A;  2JA5 H;  2C35 B;  3GTJ H;  1LYL A;  1K8A C;  1IBK L;  1X3G A;  4DR3 L;  2UUB Q;  4RG1 A;  1Q82 C;  3ERS X;  3G6E A;  1VQ7 A;  3CCE A;  5IE8 A;  1Y1V G;  5BR8 Q;  4HJ9 A;  1E3P A;  1VQ5 A;  2VUM G;  1IBM Q;  3HOW G;  2A8V A;  1E7Z A;  2DUD A;  1Q1B A;  2MNA A;  5LMN Q;  3H3V I;  3CCV A;  4AYB G;  1AE2 A;  2K52 A;  4DV3 Q;  2EIF A;  1SFO H;  2NZO A;  5M5W H;  5C3E H;  1G6P A;  5ELN A;  3B6Y A;  1UEB A;  1XMO L;  5M3M H;  5LMU L;  4A3E G;  1YI2 A;  2RHQ B;  2BA1 A;  1BBW A;  4GN5 A;  3U4V A;  5LMN W;  4LF4 Q;  3RZO H;  4GKK Q;  4JBW A;  4IJH A;  2PQA A;  3BU2 A;  1EIY B;  2UXB Q;  4IOC A;  4DV1 Q;  2R7D A;  1KAW A;  3G71 A;  2B29 A;  1YVC A;  4DV4 Q;  4NPS A;  4PMW A;  1UE7 A;  4A3K G;  3PO2 H;  1PH9 A;  4JCV E;  3M85 A;  1K3R A;  4B3T L;  4EX5 A;  2JK8 A;  3AYH B;  4DR5 L;  1AE3 A;  4EQ5 A;  1DGS A;  3PCO B;  1VQP A;  2B3G A;  4GKJ Q;  3S14 H;  1L1O B;  1X3F A;  1KD1 C;  2JA7 H;  1IXR A;  2ASB A;  5GRO A;  1S72 A;  1E24 A;  3KF6 B;  1L1O C;  3KDF B;  3HOV H;  1IYJ B;  1LUZ A;  4UY8 C;  4Y52 H;  2QA4 A;  2D0O A;  1G51 A;  4JI0 L;  5GAE C;  1N32 Q;  4LWC A;  3PIO A;  1WJJ A;  3ZJY C;  4L5S A;  4AH6 A;  4DR6 L;  5GAH C;  1EUJ A;  3PF5 A;  1VQJ A;  2RF4 A;  3CMA A;  4KI0 A;  1NTG A;  1X54 A;  1NJI C;  3TRE A;  2E2I H;  5IP7 H;  1JJG A;  1P16 A;  3ICE A;  1B7Y B;  2LXJ A;  1WCM G;  3IRB A;  4A3M G;  2R93 H;  4DR2 L;  1XNQ Q;  3OTO Q;  2ZTC A;  3RLO A;  1Z9F A;  4PZ7 A;  2IHE A;  4H02 A;  4DV6 Q;  5JJL A;  2K5V A;  4A3I H;  1XNR Q;  4DAY B;  2VQF Q;  2WAQ G;  4JI4 L;  4IPH A;  4K0K L;  4BA2 I;  4DR7 L;  5DLQ E;  1QZH A;  1QVF A;  1K8G A;  1OXT A;  1XPR A;  4DV7 Q;  5JJI A;  2N8N A;  1K9M C;  2RCN A;  2ZJR A;  2B63 H;  4JOI C;  3A5Z B;  2E5L L;  4LFB Q;  2JA6 H;  5IYC G;  2UUC Q;  4B3S Q;  4L5Q A;  2H5X A;  3KYH C;  4OO1 G;  2OCE A;  4A3F G;  4OO1 I;  1HNZ Q;  4A3D G;  4DV0 Q;  4JI5 L;  3H15 A;  3T1Y Q;  2I0Q A;  3ER0 A;  1J5E Q;  1YJW A;  4GN4 B;  4OWT B;  4QY7 A;  4JI3 Q;  1HH2 P;  2BH2 A;  3M4Q A;  4OWX B;  2OTL A;  4JI6 L;  1YBY A;  1WI5 A;  4R4O A;  2ES2 A;  3NEM A;  1W3S A;  4UP9 A;  2MFI A;  2UU9 L;  1FJG L;  3I4M G;  3H0G G;  3PF4 A;  2PMZ E;  1SR3 A;  1VQI A;  5FJ8 G;  1CUK A;  3PV0 A;  1TWH H;  2E8G A;  2MQH A;  3UDI A;  4AQY Q;  1BVS A;  4Y7N H;  2YU9 H;  2GVA A;  3G48 A;  4P73 A;  1SLJ A;  4UPA A;  4ALP A;  3VDY A;  4JV5 Q;  3K7A H;  3I4N G;  2UXC Q;  1SE8 A;  1B70 B;  3T1H L;  2IT1 A;  4JC0 A;  2R7Z H;  1Y14 B;  4IJL A;  4O0A A;  4DR1 Q;  2OWO A;  2PQA B;  2QGQ A;  4LUO A;  1U0L A;  3AFP A;  2PNH A;  3STB C;  4C3I H;  1NBW A;  5IYB G;  3CD6 A;  3HOY G;  2UXD Q;  1PH4 A;  1L2F A;  1XMQ Q;  1QZG A;  4DV2 L;  3J81 i;  1E1O A;  1YJ9 A;  1N36 Q;  3J80 c;  4X65 Q;  1N9W A;  2HHH Q;  1KL9 A;  4HIM A;  3RR5 A;  4JI8 L;  3UDF A;  2EXD A;  1NY4 A;  1PA6 A;  1VS0 A;  1A0I A;  2VNU D;  4YY3 Q;  2LXK A;  1PH7 A;  3M3Y H;  3CCR A;  3CF5 A;  4JI7 Q;  4YCV A;  3UDG A;  2HIV A;  4DUY Q;  2ATW A;  3NBH B;  4QGU A;  1YNX A;  4DNI A;  2OQ0 A;  2NN6 G;  4L5T A;  4O2D A;  1M90 C;  4A3B H;  4A3G H;  5JJK A;  3W1B A;  2WFW A;  1E1T A;  5C0X I;  2CWP A;  1XNQ L;  3OTO L;  4XTC S;  3BZK A;  3HOX H;  4L5R C;  4OXP A;  1JB7 A;  1HZC A;  1VQC A;  4LFA L;  3CQZ H;  3S1R H;  4PG3 A;  1HNX L;  2FXQ A;  3PO3 H;  1YEZ A;  4JI2 Q;  2PI2 A;  2RHS B;  3KJP A;  4X64 Q;  4X66 Q;  1CKO A;  1VQ8 A;  4LNQ A;  2F4V L;  3CCM A;  4A3L G;  2R7F A;  4X62 Q;  1MJE A;  2V1C C;  1I6H H;  1VQE A;  2JEA I;  4BY1 G;  2JQO A;  1Y1V H;  4GLV B;  2OTJ A;  1KIX A;  2VUM H;  3HOW H;  1Z47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...