1X3EA

Crystal structure of the single-stranded dna-binding protein from mycobacterium smegmatis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
118
structure length
110
Chain Sequence
GDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRMEWKDGEALFLRCNIWREAAENVAESLTRGSRVIVTGRLKQRSFETREKRTVVEVEVDEIGPSLRYATAKVNKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-strand binding protein
publication title Structure of Mycobacterium smegmatis single-stranded DNA-binding protein and a comparative study involving homologus SSBs: biological implications of structural plasticity and variability in quaternary association.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Dna binding protein
total genus 18
structure length 110
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1x3eA00
2JA5G 1EQQA 4R1JA 5M3FG 3S14H 1JJ2A 2ALYB 3S2HH 4DV4L 5M5WH 2XGTA 1X6OA 4BXXH 4AQYL 4QJFA 4A3LH 3UDGA 2JA8G 4IPCA 2UXDQ 3CCQA 1YJNA 1VQDA 1IBMQ 1IBKL 4JI2L 4Y52H 4GLAC 3HKZE 1A63A 4LF7Q 5M3MG 4JYAQ 3GTJH 4DR4L 3H0GH 4LFBQ 1Q8KA 4DR5Q 3LGJA 3PUVA 5JJIA 1HR0W 1YEZA 2KCMA 4GN4B 3U4ZA 3G6EA 4IO9A 2NVYH 3M85A 2LSSA 4MZ9A 3IRBA 4A3LG 2GVBA 3PUXA 4UP9A 1G6PA 2L15A 1O7IA 3RN2A 4LF4Q 4X64Q 2IX0A 3GD7A 3TREA 2UUAL 4DR6L 4JBWA 4A3DH 2WP8J 1OTCA 4GKJQ 1SRUA 3K7UC 1PH7A 1K9MC 2HHHL 3I55A 4L5RC 3H0GG 2YTYA 3HKSA 4OONA 4AIMA 1K73C 3EBEA 5FLMH 4JI5Q 4RMFA 3RLOA 1ASZA 1MJCA 4JI0L 2R92H 4DR3L 4P71A 1N34Q 5IY0A 2I5MX 4JI3Q 4A3MH 4LF6Q 4JCVE 1XMOQ 1N36L 2IT1A 1SR3A 2PMZE 3PV0A 1CSPA 4HIKA 1VQMA 1PHJA 3HOYH 1QUQB 1YHBA 1JMCA 4A3DG 3FKIH 2UXCQ 3S15H 1GVPA 2WB1G 1P16A 1U0LA 1Q7YC 2OWOA 3DLLA 1EIYB 4B3TL 4B3SL 4X65L 3K7AH 4GN5A 1HNZQ 1VQIA 4OX9L 1MKHA 5FLMG 4JI4L 1PH8A 2R92G 1JJCB 1D8LA 5BR8Q 1AE3A 3MEFA 1SMXA 4UP8A 5H1SE 2WAQG 4A3MG 2B63H 3GTPH 1VQ7A 1KXLA 4PZ7A 3HOYG 2CQOA 4R4TA 3S16H 3FKIG 1I5FA 4JC0A 2PI2E 4P74A 3T1YL 4JG2A 3ERSX 2VL6A 1I94Q 2VS1A 3HFZB 4IOAA 3GTLH 3AYHB 3NEMA 5GAEC 4LF8L 2KBNA 4A76A 1TWHH 4QGUA 2YYZA 3PF4A 4LFCL 4A3KH 4DV6L 1S3OA 1Q86C 5IYCH 4P72A 1B8AA 2UUBL 4TVAB 2K4KA 5IP7H 3W5OA 3PCOB 1YNXA 2NN6I 4HJ8A 4AH6A 3AFQA 1C9OA 1C7YA 3GTGH 2ZJQA 1KQSA 3KF8B 4PZ6A 1I50H 1VQKA 4X6AH 3CAMA 3KLWA 2BA0A 1GO3E 1VS0A 3BJUA 4GNXA 2F4VQ 4IPDA 2E2HH 1YHAA 2N78A 4GKKQ 1WOCA 2Q2HA 4DV5L 4JI8Q 4L5TA 3G71A 1VQHA 4IPGA 4A3KG 3GTOH 3KFUA 3TS0A 5IYCG 3G4SA 4A3GH 5IP7G 1Z9FA 2JEBI 3MXNB 1N34L 4K0KQ 4RG1A 5IP9H 1WI5A 1SFOH 2YTXA 1Y1WH 1CSQA 5JJKA 2IHEA 1XNRL 2QGQA 3B6YA 4YWKA 4ALPA 2KHJA 1LM0A 3U58A 2E5LQ 3F2DA 1XPRA 2JJQA 4IFDG 2K50A 3KDFB 1VQOA 1HJPA 2JA7H 2HT1A 2VQFQ 3ULLA 2UXBL 4A3GG 1Q81C 4R4OA 3W1BA 5IP9G 4YHHL 1VQEA 2JK8A 4R4QA 4KHZA 2E2JH 1Y1WG 2Z6KA 2RCNA 3I4NH 1YBYA 3K80C 4IFDI 2DUDA 2OQKA 4MNOA 1HH2P 1SROA 2D0OA 4YY3Q 1XNQQ 4P75A 1YI2A 3EIVA 1HZAA 2R7FA 3HOUH 1VQPA 3RR5A 3TRZA 2UUCQ 3TQYA 2K75A 3JAMi 2JA7G 4JI1Q 3CXCA 3HOXH 3S17H 3ER0A 4LW1A 4JI7L 5AJ3L 3I7FA 2I5LX 4A75A 4JV5L 2JQOA 3S24A 3H15A 4OO1G 3L0OA 5E7NA 1SLJA 4HIDA 3CMEA 1K3RA 3RLFA 3J80i 2BH2A 3GTMH 3HOUG 1X54A 1GKHA 3ULPA 3A74A 3HKZG 4DV0Q 2Y0SE 4NXMQ 5IWAL 4OO1I 4A3JH 2IHFA 1E1TA 3HOXG 4YCUA 4KI0A 4LF5L 4GKKL 3FP9A 1HNXQ 4LF9L 2Z0SA 1K8AC 4A3IH 3PF5A 1J5EL 4L5QA 3PIOA 3S1NH 1E7ZA 4POFA 4WJ3M 4DUYL 1PYSB 4DUZL 1Q12A 3J81c 4B3MQ 3CC2A 4QY7A 1XMQQ 1KRSA 3STBD 1H95A 4GNXC 5JEAJ 3KOJA 1PA6A 3CW2C 4BXXG 2VQEL 1NE3A 1BVSA 4DNIA 5C4JH 1GD7A 1FL0A 1G51A 2GN5A 1VQ5A 4DV3L 1VQGA 4DR1Q 5EAYA 1A62A 3E0EA 2VQFL 3VDYA 4DAMA 4A3IG 2LXJA 1AH9A 4DV2L 1WYDA 4POGA 2K5NA 1VQAA 3CCMA 1N32L 4DV1Q 3S1QH 1YHQA 3AEVA 3T1HQ 3M4PA 3PUZA 4OWTB 1M1KC 3ICEA 3BZCA 2NVTH 4EQ5A 4LUZA 3PGZA 4DV7L 3CCEA 4X62L 3HOVH 1IBLQ 1BBUA 1Z47A 4YCVA 1K0RA 5LMUL 3ULJA 4JI6Q 2Z6KC 2ZTDA 3CMAA 1NMFA 3OTOL 1FJGQ 4A3BH 1WCMH 2C35B 4YCWA 3CC7A 4B3RL 1C0AA 4GLVB 3WWVA 3NELA 3AFPA 2HIVA 3GO5A 1L0WA 4AYBG 3GTQH 5GADC 3ZJYC 4IFDJ 2JE6I 1EOVA 3K0XA 1JT8A 1SE8A 3KF6A 2UXDL 4JBMA 4NB3A 5ELOA 1RL2A 2KENA 2PNHA 3RN5A 1IBML 2NN6G 1L1OC 5JEAG 5C0XG 4A3BG 1WCMG 2A19A 4L5SA 2Q2UA 3D0FA 4LF7L 4JYAL 3RLNA 4Y7NH 3CPWA 2R6GA 2MQHA 4LFBL 2RF4A 2ATWA 4DR5L 4IJLA 4TQUS 5LMNQ 2B63G 3L2PA 2ZJRA 2VUMH 2HIXA 1EUJA 1I3QH 1YIJA 4DR7Q 4DR2Q 1VQ6A 2UU9Q 1BBWA 4PZ8A 5FLXc 5C0XI 3PUYA 1S72A 2BA1A 1SN8A 4LF4L 1OXTA 3CP0A 4C2MH 4X64L 1UE6A 4GOPA 3PSIA 1W2BA 1OXVA 3J7A5 4GKJL 4KHPQ 1VQFA 4QQBX 1HNWQ 3U4VA 2MO0A 3OW2A 5GAHC 4WJ4A 2PQAA 2WAQE 2CWPA 3D31A 5M5YH 3I2ZA 4JI5L 2VUMG 4LNQA 1OXSC 3OYYA 4LFAQ 1VQ8A 4NXNQ 1PH3A 4JI3L 2ID0A 2OCEA 4YWMA 4LF6L 2RHSB 1XMOL 4BBSH 3HOZH 3W1GA 3M9BA 3A0JA 2UXCL 1N33Q 1FVIA 2ZM6Q 3JAMc 4QL5A 1JB7A 1PVOA 1PFSA 1I6HH 1V9PA 3KF6B 2ES2A 2NZHA 1R9TH 2K52A 2PI2A 3H3VI 4DV4Q 1YITA 1HNZL 2Q2TA 4OWWB 3E9IA 2NVQH 4AQYQ 1LUZA 2B3GA 5BR8L 1P8LA 2WFWA 4J15A 1PH1A 4BBSG 3KJPA 2LXKA 3STBC 3J80c 4LUVA 3CCVA 3HOZG 1V43A 2CWAA 4JI2Q 4JOIA 3F2BA 1VCIA 1KIXA 1IBKQ 2R93H 4GN3B 1KHIA 2K5HA 2OTJA 2IX1A 4DR4Q 3GDEA 1OXUA 1I94L 2RHQB 1YVCA 1IL2A 2CCZA 1X56A 1YZ6A 2N49A 2OTLA 1VQNA 1HZ9A 3JC66 1PH9A 2XTIA 4YWLA 4GNXB 1HZBA 2B29A 1WJJA 2Y0SG 1YJ9A 2UUAQ 1PH5A 4DR6Q 1UE1A 2PQAB 1L1OA 3I4NG 2R93G 2HHHQ 5IYDH 1X9NA 1A0IA 1UWVA 3KJOA 1B70B 2EQSA 1X3GA 4A4IA 1VQCA 4X66Q 3CCRA 1CKMA 2F4VL 4JI0Q 1VQ9A 2KHIA 2N8NA 4DR3Q 4DKAC 4BA2I 3RNUA 1VQJA 1N36Q 4JI8L 3AQQA 1X55A 5JJLA 2E2IH 1PYBA 2NZOA 5GAGC 1GM5A 4K0KL 2AKWB 3UDFA 5IYDG 1CKOA 3M3YH 3M4QA 4GOPC 4C3HH 4DPGA 4B3TQ 3TS2A 4B3SQ 5IE8A 5C44H 3I56A 4A3FH 1N9WA 1XTDA 2I5HA 5C0XJ 2ZM6L 3CCSA 4HJ7A 3CCLA 4BY1H 4OX9Q 2R7ZH 2ZJPA 4JI4Q 1NTGA 4A3JG 1UEBA 2Q2IA 1QUQA 2E5LL 1PH2A 2CKZB 1NJIC 1E24A 1EQRA 2CFMA 3PO3H 1MIUA 3UE1A 5ELNA 1QVCA 1KD1C 4IJHA 2AWOA 4QIWE 4BBRH 3T1YQ 1X65A 1KRTA 1MJEA 3U50C 1IXRA 5C44G 1JJGA 4A3FG 4LF8Q 4BY1G 3CCUA 4HJAA 5C3EH 3BZKA 1QZGA 2R7ZG 3J7ZC 4YY3L 1Y14B 3F1ZA 1XNQL 3GTKH 4PG3A 2KCTA 3CCJA 4LFCQ 1L1OB 1A8VA 1L2FA 3UDXA 4DV6Q 2UUCL 1RIPA 1VQBA 3J81j 2MNAA 2UUBQ 3F8TA 1X3FA 4JI1L 3PO3G 3K8AA 2VNUD 1Q1BA 4UY8C 3M4OH 2EIFA 4BBRG 1XJVA 3NBHB 4IPHA 4JOIC 1V1QA 1JE5A 4O0AA 5DLQE 2QA4A 1NBWA 1QZHA 4BY7H 3K81C 4NPSA 1TWAH 4A3CH 4XTCS 2A1AA 3KYHC 5C3EG 2OQ0A 4P73A 5LMNW 3FHWA 4DV5Q 2IY5B 4DV0L 4X66L 1BKBA 4DK6C 4NXML 3J81i 2QEXA 1E3PA 1Q1EA 3A5ZB 4OXPA 2D62A 1HR0Q 3HOVG 3SGIA 2V1CC 1HZCA 4FDBA 1PV4A 1HNXL 5GQOA 1K8GA 4XIGS 1AE2A 4C3IH 1XNRQ 4A93H 1LTLA 3PIPA 4BY7G 4JBJA 3CPFA 4A3CG 3L7ZC 5FJ8H 4B3ML 3UE0A 1QVGA 2I0QA 1UE7A 1XMQL 2JA6H 2D0PA 1D7QA 2ZTCA 2UXBQ 4JBKA 3NENA 4IOCA 2EXDA 3H3VH 2N3SA 1E22A 3BU2A 4YHHQ 2WB1E 1XPUA 2AMCB 2GVAA 4EX5A 4DK3C 4DR1L 1T9HA 2F3IA 3CF5A 1CUKA 3PO2H 4A93G 2F52A 3KDFA 2FXQA 5FJ8G 1TWGH 1CKNA 1Y1VH 4KLKA 4R4CA 4AYBE 4DV1L 1PH4A 5J3BA 2JA6G 3RZOH 3T1HL 4A3EH 3G48A 3PUWA 2VY3A 1KAWA 4JI7Q 5AJ3Q 2R7DA 1NMGA 2K5VA 5GROA 4GLXA 2MO1A 3E9HA 4O2DA 4PMWA 2A8VA 4JV5Q 1W3SA 3UDIA 4HJ5A 3A5UA 1Q82C 1Q46A 3EN2A 1IBLL 1WFQA 1ASYA 3PO2G 5K36G 4MTNA 4LWCA 4JI6L 1Y1VG 1FJGL 1VQ4A 1XPOA 2AWNA 1KL9A 1TWCH 3I4OA 5IT9c 3CD6A 5IWAQ 1UE5A 4A3EG 4LF5Q 1S40A 1EYGA 4LF9Q 4H02A 1J5EQ 3S1RH 1IZ6A 4GS3A 4HIMA 2ZTEA 1HR0L 3CC4A 4DUYQ 1E1OA 4DUZQ 5IYBH 1QVFA 4HIOA 1FGUA 3CQZH 1OXXK 5C4XH 2DGYA 1N8RC 2NVXH 3I4MH 4C3JH 1X3EA 2VQEQ 4GOPB 3F2CA 1PH6A 4APVA 5LMNL 4DV3Q 2YU9H 4LUOA 4DR7L 4HJ9A 1LYLA 4DR2L 2YV5A 2H5XA 1CKNB 5HY6A 4DV2Q 1VQLA 2HQLA 1EIFA 2UU9L 3S1MH 2MFIA 4R4IA 1M90C 5IYBG 1KC8C 3S2DH 3Q8DA 3HOWH 1N32Q 4UPAA 1NY4A 2AHOB 4KHPL 4BA1I 1HNWL 5C4XG 2YTVA 3I4MG 1B7YB 2JA5H 5M3FH 1YJWA 1EFWA 1TWFH 2E8GA 4ME3A 1U5KA 4DV7Q 4X62Q 4LFAL 4NXNL 1IYJB 2JA8H 2BH8A 1G291 4UP7A 4DAYB 3M7NA 1EWIA 1J6QA 4OWXB 1K83H 1DGSA 2JA9A 2VZAA 2K14A 3DM3A 2VW9A 5LMUQ 5HGQA 5M5XH 1TXYA 3OTOQ 4B3RQ 4X65Q 2JEAI 3HOWG 5M3MH 3TEHB 3RZDH 1N33L 2ASBA
chains in the Genus database with same CATH superfamily
3OPOA 2JA5G 5M3FG 3RD4A 3GP7A 3T51B 3S14H 2BDNA 1KNEA 1QCBD 1TQOA 5BN4A 1ZXTA 5M5WH 2XNAC 4AQYL 4BY7B 4IUQA 3UDGA 2JA8G 5EGTA 5I6WA 2UXDQ 4J1MA 3VYUA 1YJNA 4KD4A 5M3MG 4LFBQ 1B2TA 1EY4A 2XVSA 3LGJA 2Z8LA 3EVQA 3ND8A 3NP8A 4IO9A 3M85A 4XT3B 2LSSA 4MZ9A 2GVBA 2UUAL 4IN3A 2E74C 3I55A 4QF4A 4KKSA 4L5RC 3H0GG 1O78A 1SYDA 4KKTA 4AIMA 3M4YA 1EY7A 4J6HA 3RLOA 1MJCA 4DR3L 4P71A 1CQFA 4JI3Q 1U4PA 4K8IA 4HIKA 1HFGA 2F1MA 1JMCA 1EQVA 1A3VA 1U0LA 5DM63 2MUYA 3DLLA 1SMYC 1EIYB 4B3TL 1QJOA 1ZYRD 2KJXA 3QB3A 4GN5A 4EQNA 1HNZQ 1SAPA 2R92G 1JJCB 1EY6A 2A6EC 1SMXA 3MEFA 4A3MG 1YNNC 1SSOA 2WAQG 4DXGA 2F0GA 3S16H 3FKIG 4L8JA 4P74A 2VS1A 3GTLH 3NEMA 5GAEC 4A76A 3S1RB 2CH4A 3MWYW 5HURA 2OEOA 4BS9A 4PQXA 1S3OA 4FVMA 1STNA 2HQEA 2UUBL 2K4KA 4HMJA 3PCOB 3FEWX 1C9OA 1VMPA 2ZJQA 1SYGA 4NKLA 1TR5A 2CVRA 2YU9B 4NMZA 3TP8A 1LO5D 4UAIA 4GNXA 4IPDA 1S5CD 1EEID 3MXUA 3OIQA 4GKKQ 1WOCA 3X3NA 4IFDH 4JI8Q 3G71A 1FGBD 3CU7A 3TS0A 1Z9FA 4RGMA 4U673 1SFOH 3CHBD 3H94A 2L12A 3B6YA 4ALPA 4FYDA 2X69A 1D2BA 3U58A 3H09A 4ZUIA 1K83B 5ELCA 3U9OA 1XPRA 2F03A 2H4OA 3KDFB 1VQOA 3ULLA 3RZDB 3OWEB 5IP9G 4RCOA 1VQEA 1WTVA 1Y1WG 3I4NH 4QB4A 2DUDA 4MNOA 1YI2A 2B8FA 1VQPA 1SDFA 1LTTD 3CXCA 5EJWA 3QOJA 3ER0A 5ISRA 4ZKCB 2JQOA 3S24A 4DGZA 2EJMA 3L0OA 4IUVA 1SLJA 2EE1A 5FO7B 1O7YA 4NXMQ 4OO1I 3BVZA 4IUPA 4LF5L 3EQLC 4PNYA 3K6OA 1LT6D 3PF5A 3A56A 3S1NH 1E7ZA 4POFA 4WJ3M 4DUYL 1PYSB 1Y8OB 4DUZL 3J81c 3MFGA 1KRSA 3HOYB 4XQJA 3R8BA 3KOJA 2VQEL 1FL0A 1G51A 4DV3L 1VQGA 1A62A 5CV7A 1HQRD 3FPPA 2VQFL 3VDYA 4A3IG 3K7AB 2A68D 2KOLA 3HEJA 3A8JE 4POGA 1G91A 3SK5A 1N32L 1YHQA 3DHQA 1M4VA 3M4PA 2A74C 4OWTB 2G9DA 4JK1C 1Y1VB 1O80A 1BBUA 5C3XA 2EYJA 3WOEA 1LTGD 5JOBA 1WTXA 2HCCA 4JI6Q 1I4RA 2ZTDA 5HGTA 4A3KB 3OTOL 5JEAH 5C0XH 2F3VA 2C35B 4PMBA 2I07B 1II3A 3AFPA 3GTGB 3ZJYC 3J80E 4IFDJ 1EOVA 3E6ZX 3K0XA 1I50B 3SK4A 2UXDL 4OL7A 3J7YW 4JBMA 2KENA 4A3BG 4L5SA 2A19A 3BVGA 4LFBL 2MQHA 4KJOA 2B63G 2VUMH 3R2TA 2HIXA 1YIJA 2UU9Q 2XRQD 2PYKA 3PUYA 2AUJD 3VR2A 4GOPA 1UE6A 2RCFA 2EYHA 2MO0A 2PQAA 1LT3D 5C4ZA 2NYZD 2E2JB 4QIWB 4JI3L 4BBSH 4YWMA 3MVVA 2JYOA 3CKIB 1SNDA 2B2UC 4DA2A 5KNCA 3K59A 4NW2A 1B9NA 1PVOA 1PFSA 1V9PA 1GUWA 4Z9CB 3AMUA 1YITA 1HNZL 4H7BA 2NVQH 3NHHA 4J15A 2LXKA 3STBC 3J80c 2A69D 4XXEA 3F2BA 1KIXA 2R93H 2PZWA 4DAPA 1XXGA 1OXUA 5TSSA 2B2TC 5JVH3 2B2YC 1JOKA 1X56A 1YZ6A 1GUNA 4C56C 1JOOA 2XTIA 4YWLA 2PMZB 1HZBA 2B29A 5FLXL 1YJ9A 2SOBA 1UE1A 2PQAB 2RDFA 2HHHQ 1J9OA 2VXWA 1A0IA 3KJOA 4CDCC 3BVMA 1CKMA 2K1BA 2EJGC 3I73A 1VQJA 1HA5A 4ZCKA 1N36Q 4JI8L 2E76C 1X55A 2MHVA 2K5WA 1S5BD 2NZOA 2AKWB 5IYDG 2ZXRA 3M3YH 3J7AV 4C3HH 2I5HA 3CCSA 4BY1H 5C0XJ 4HJ7A 1LT5D 1NTGA 4A3JG 4JI4Q 1I4QA 1JQYD 1RHPA 2CFMA 3PO3H 5ELNA 4QIWE 2EY5A 4BBRH 3T1YQ 2D5DA 1NSNS 1STBA 3WDNA 3GTQB 2R7ZG 2C9OA 5C3EH 1A8VA 3UDXA 4DV6Q 1RIPA 3P7JA 4ZRZA 4EQPA 1E2VA 4V190 2AQ3B 5DLQE 2B2TA 1QZHA 4BY7H 4NPSA 4C1NK 3KYHC 5FO8B 3FHWA 4DV5Q 2F0QA 4QCLA 1JWSD 4DK6C 4NXML 3J81i 1E3PA 1Q1EA 3A5ZB 3D4WA 5IIFA 1HZCA 3MFYA 4M8AA 4KD3A 1M8AA 3DWQA 1MI2A 3UE0A 5IGEA 3HOZB 3H91A 1AZQA 2ZTCA 2UXBQ 1WD1A 3H3VH 4YHHQ 2AMCB 2DY8A 1BUVT 3CF5A 4C3IG 4G7ZC 2F52A 2F0FA 1CKNA 4R4CA 1E2ZA 2Y0SB 4GZYC 1LACA 3BG3A 3I4NB 3G48A 2VY3A 3FPUB 2R7DA 5GROA 4PMWA 2Q8RE 4HJ5A 3A5UA 1Q82C 3EN2A 1ASYA 5K36G 1SXTA 5KEEA 1KDBA 3ERQA 4MTNA 3C3LA 4JI6L 1GUGA 1Y1VG 1EY8A 1VQ4A 2AWNA 1KL9A 2GA4B 5IWAQ 2JP1A 1H9KA 1TT2A 2HCIA 1PXUA 1EYGA 1HUNA 4LF9Q 3S1RH 2ZTEA 1HR0L 1GUOA 1QVFA 5CGKA 4HIOA 1OXXK 4DAVA 1VF7A 3LX0A 5D3IB 2BCOA 2YU9H 4LUOA 1ICWA 5C44B 4A3FB 1CKNB 1MD2D 2UU9L 1W6JA 4R4IA 5IYBG 1YNJD 1NY4A 4BA1I 2A6HD 4ZKBB 1A3TA 2XRSD 5CV4A 2G9HD 1F9PA 1HTPA 3I8ZA 5EKKA 4DV7Q 1CHPD 2QKIC 3T13A 3R3OA 2B39A 1K83H 1MHWC 1R4PB 2K14A 3S9WA 4HTHA 4R9WA 1BXTA 5HGQA 3GTKB 1TXYA 3TEHB 3RZDH 2ASBA 1FD7D 1EQQA 4R1JA 4J8QA 3M4OB 2ZT9C 1ENCA 1PTOF 2ALYB 3DMUA 4BXXH 2XGTA 4QJFA 4A3LH 1TWAB 1X3QA 2Z6BA 2NB0A 3TDQA 1IBMQ 4GLAC 3EROA 4WFN3 3KBXA 5EKLA 1Q8KA 4HR7B 1JB3A 1PTOH 4DR5Q 3GV3A 5JJIA 1VDZA 1HR0W 2KCMA 3G6EA 4A93B 2EOTA 1PDQA 3PUXA 1G6PA 3TN2A 3IAYA 2L15A 4X64Q 2KCNA 3GD7A 2WP8J 1PH7A 2HHHL 1Z7TA 1AFPA 4OONA 5FLMH 4HSVA 4RMFA 1ASZA 2XSCA 3PO2B 2EYPA 3I72A 3K58A 5IY0A 4LF6Q 1N36L 1XMOQ 1TWGB 3PV0A 1PHJA 3HOYH 2EYOA 3E3XA 1QUQB 1YHBA 2EY6A 3RZOB 5IGBA 2E2DC 4A3EB 3VYSA 3MHBA 2LKVA 3K7AH 5CV5A 4K5XA 1MKHA 4JI4L 1PH8A 2C5CA 3HRZC 5BR8Q 2B2WC 5H1SE 3C2PA 1KXLA 4KN4C 2CH4W 4KY5A 1I5FA 4K5VA 4TRDA 4IOAA 3T1YL 1A6XA 4R8IA 3AYHB 5CBAE 1GOZA 5ELDA 3QR8A 2PNRC 4A3KH 1X3PA 1ET9A 4DV6L 3CQZB 2OXPA 4I7ZC 2NVXB 2NN6I 4DNRB 1JWMD 4AH6A 3AFQA 2SNMA 1K8MA 1SE3A 4IALA 3R93A 3GTGH 1HA6A 4KV6A 1KQSA 4PZ6A 4X6AH 1I50H 3KLWA 2BA0A 3OHXC 1KDAA 2PW7A 4CGYB 2QF7A 3S1MB 1YHAA 2F0PA 1H9SB 3HZXA 4DV5L 1VQHA 1X32A 1IW7D 4CDDC 3G4SA 4K0KQ 2YTXA 1BNZA 1CSQA 5JJKA 2IHEA 2K32A 1GHKA 1LM0A 5DAUA 2E5LQ 2JJQA 4IFDG 2K50A 1HJPA 2VQFQ 2UXBL 2VB2X 1Q81C 4FF1A 1GUSA 3W1BA 4YHHL 1AP0A 2JK8A 4ZYSA 2E2JH 1YBYA 2SEBD 2TSSA 2OQKA 1SROA 2WV6D 3VA7A 5JVG3 2J7ZA 2R7FA 3Q22A 3TRZA 3V05A 2UUCQ 2K75A 3BDCA 3JAMi 5DNFA 4JI1Q 4DU9A 1HRJA 3MEHA 4DN4M 2KHSA 3GQBA 2F0EA 1V1PB 1QILA 5E7NA 1K3RA 2NVYB 4O42A 2K5QA 1SEBD 3BS1A 5IWAL 4A3DB 1IHZA 4YCUA 2WB1B 4KI0A 4RAUC 1HNXQ 4LF9L 2HUGA 4HN7A 3PIOA 3W3AA 1XX8A 1Q12A 1Q3LA 3CC2A 1EEFD 1HUMA 1S5ED 2SDFA 3DM1A 1XMQQ 1MSHA 1S4ZA 1H95A 4GNXC 1IKMA 3CW2C 1PTOC 2FHTA 3SEBA 5FLXE 1GD7A 5A35A 2CQAA 5CYUA 4DR1Q 5EAYA 3E0EA 5D65A 2LXJA 2XIWA 2Z4IA 2K5NA 5LL6S 3LNNA 1CZWA 1WTPA 4DV1Q 4DNTB 2PPBC 4ZUJA 5ELBA 2R61A 4DV7L 3K57A 1LLRD 1HTLD 1TWHB 3X3MA 2L0CA 1FNUA 1B1ZA 4NP5A 1TIID 1A3UA 4K5WA 4RGOS 3D6WA 2IJ0A 1L0WA 3GTQH 4RWSC 2RVLA 2A73B 2JSOA 2E2HB 2L5TA 4K6DA 3RN5A 4JPBW 1IBML 3QO2A 1WTWA 1U9RA 2NN6G 5JEAG 1I4PA 5C0XG 4ABNA 4A3GB 1WTRA 5T1IA 2RF4A 2A69C 4DR5L 4IJLA 3NQTA 3L2PA 2ZJRA 4DR7Q 1EUJA 4DR2Q 4PZ8A 5FLXc 4XT1B 2BA1A 1PRTD 1SN8A 2KVMA 4X64L 1K28A 3PSIA 1HNWQ 2JA7B 4XQQA 2DJFC 3U4VA 4MTKA 3OW2A 4FF3A 2CWPA 2RQXA 2LMCB 2NBFA 2VUMG 3OYYA 1NAPA 4LFAQ 1D1IA 1WTQA 4XDXA 4LF6L 2RHSB 1XMOL 3HOZH 3M9BA 3A0JA 3HOUB 3HKZB 1N33Q 1FVIA 3MTSA 3HOXB 1WVLA 3I3CA 1SYCA 1JB7A 2ES2A 3H3VI 2K52A 2PI2A 4DV4Q 2Q2TA 5I4DA 3D4RA 2B3GA 5BR8L 1P8LA 1PH1A 4BBSG 1V43A 2CWAA 1G2SA 1LABA 2L1BA 5COYA 4RGNA 4IQZA 2IX1A 1QNKA 1SYFA 4DR4Q 3GDEA 4DK0A 1YVCA 3RMHA 2AUKA 2N49A 5KNDA 1Q8IA 1S5DD 5IGFA 4FO2A 4K8JA 4GNXB 1PTOB 5CC4A 2R93G 3SHLA 5C6AA 1OO9B 5C4JB 2J0TD 1FYCA 2Q8IB 3T56B 3NUCA 3OSOA 2F0SA 2Z9HA 3GV6A 3NBHA 1VQ9A 4JI0Q 1LTID 3AU7A 5E3FA 3AQQA 2Q8TA 2IPKD 5JJLA 1GM5A 4K0KL 1AN8A 1DD2A 4AYBB 1RCVD 4GOPC 4DPGA 3TS2A 4B3SQ 5C44H 4A3FH 1XTDA 3FMCA 2ZM6L 3CCLA 4IURA 2K01A 3K5NA 1DOKA 2BE5D 2E5LL 1B50A 4M1UB 4PV1C 3VYRA 3UE1A 2AWOA 3BYTB 2TMPA 2I46A 4C3HG 5C4HA 1JJGA 3KUPA 4LF8Q 4BY1G 1QZGA 1ENAA 3U9SA 3CCJA 4LFCQ 3GTKH 1L2FA 1EOTA 2UUCL 4JI1L 1X3FA 2FFKB 3PO3G 4QMGA 1NUCA 5FK9C 4Y7NB 3M4OH 4BBRG 3NBHB 1F2ZA 1JE5A 5JPNC 3TP7A 4A3CH 1I3QB 1TWAH 1SNQA 5C3EG 1BF4A 2PO4A 4P73A 2SNSA 4B9WA 2IY5B 2NZ1D 4H44C 4C2MB 2X6GA 3NWSA 1HXYD 2D62A 4OXPA 1HR0Q 3HOVG 2V1CC 1PV4A 4FDBA 1HNXL 1TY2A 4JW0A 5GQOA 1GJXA 4U68A 1EYAA 1A15A 1XNRQ 5T1GA 4A93H 2O5JC 3PIPA 4BY7G 4JBJA 3CPFA 3L7ZC 5FJ8H 4IUNA 1QVGA 3MXNA 1XMQL 5FOBB 1D7QA 3N52A 4IOCA 2EXDA 1XPUA 2BDOA 4XYOA 4DR1L 1WTOA 2EYMA 1T9HA 2F3IA 3PO2H 3EA6A 1TWGH 4KLKA 1ZEQX 1PH4A 4AYBE 4DV1L 3RZOH 3A7AB 4A3EH 3PUWA 1LTAD 1YNJC 4JI7Q 4X3SA 2K5VA 4JV5Q 1LV9A 4O2DA 2A6HC 5CR3A 1Q46A 2HD3A 3I91A 1XPOA 2KUMA 1SBBB 2KCCA 1S40A 4UHVA 4H02A 2EZVA 5IODA 1SMYD 1J5EQ 4HIMA 1F2YA 3CQZH 2A6ED 4O1NA 1YNND 5C4XH 3P75A 2DGYA 5K5PA 4LAAA 4HMIA 4CDFC 2NVXH 2E2IB 3TMEA 4GOPB 4APVA 4DR7L 2ICEC 1Y8PB 1LYLA 4DR2L 2YV5A 2H5XA 1VQLA 3S1MH 1MBYA 1KNAA 3S2DH 3QWNA 4RA8A 2CW0C 2EVBA 4KTAA 1HNWL 2E75C 2RDHA 1Y8NB 4X3UA 5I2XA 5A2QL 3TP5A 1EFWA 1BQQT 4DK1A 1A2UA 4X62Q 4LFAL 2F0NA 1PZKD 1G291 4L6TB 4CKEA 4YIJA 4OWXB 1JE4A 3ND9A 1DGSA 2HDMA 5LL6X 5LMUQ 1ET6A 2JEAI 1E0BA 1N33L 3F2UA 2L11A 4DV4L 1STGA 1X6OA 4IPCA 3CCQA 2J4XA 1LTSD 4Y52H 3BZDB 4WJWA 1SJHD 4DR4L 4JYAQ 3PUVA 1YEZA 1HQMC 4GN4B 3U4ZA 2NVYH 4A3LG 3VR3A 4UP9A 2MGSA 3BDOA 1O7IA 4LF4Q 2JA6B 3TREA 4A3DH 3KLSX 4JBWA 4CKBA 1OTCA 4CKCA 1RTOA 2YTYA 1DJRD 1STEA 3E0JA 5DEHA 3IKJA 3HKSA 3URYA 1J8IA 1K73C 1EWHA 4N8FA 4JI5Q 4JI0L 5I2YA 1SJED 1CK1A 3C1FA 3I4LA 4FF4A 1VMCA 1SR3A 2PMZE 2AQ2B 2V4DA 3HP3A 1VQMA 1EY9A 2UXCQ 1NCVA 3JAME 1P16A 2EXZA 3P1HA 1HFNA 3H6MA 4X65L 4B3SL 1NNXA 1VQIA 5FLMG 1V8QA 1TS5A 2B63H 3HOYG 2A5HA 4HCEA 2CQOA 4R4TA 4RHSA 4JC0A 4ULLA 4K2KA 2QILA 4JG2A 3HFZB 3J81L 1S5FD 3OWFA 2KBNA 4LF8L 1TWHH 2YYZA 2WACA 3PF4A 4LFCL 2N88A 1Q86C 5IYCH 5IP7H 4C3JB 3G6JB 1C7YA 1GO3E 3BJUA 2E2HH 4ZK9B 1I4XA 1F9SA 3MXGA 3D3RA 4A3KG 3HOWB 4A3GH 3A55A 1CA5A 1N34L 2LFNA 4RG1A 1WI5A 2JA5B 4OIJA 5L37A 3LWUA 1GXDC 1BCPD 1XNRL 3ONAB 2QGQA 1XWEA 2JA8B 2JXMB 3A54A 1JWUD 3F2DA 2NWGA 5KYIA 1Q90A 2JA7H 4R8NA 1F2LA 4KHVA 5M3MB 5KIXA 2K6AA 4R4OA 4OO1H 2EPBA 4S3SA 2Z6KA 1B9MA 4IFDI 3S2HB 3ZYYX 1HH2P 4YY3Q 3HOUH 1B53A 1HZAA 2HDLA 3EIVA 3BDLA 3HOXH 1O7LA 3IFTA 1ICFB 4JI7L 3H0GB 4JV5L 3H15A 3E5SA 1SNCA 4HIDA 2F0WA 3CMEA 3RLFA 3J80i 1F77A 3KLRA 5M9OA 3GTMH 1X54A 3ULPA 2K05A 4DV0Q 2Y0SE 5C3WA 4A3JH 2IHFA 3V2TA 5D14A 5JAVA 3FP9A 2D2CC 1E2WA 3K0YA 1ZYRC 5IGGA 2P5ZX 1J5EL 1PFBA 2MJ8A 3TBIB 4A3MB 2WAQB 3NBIA 1B44D 3STBD 1TU2B 4IZ8A 4XYQA 1NE3A 3FKIB 5C4JH 2GN5A 1VQ5A 3OMCA 1TS4A 4DAMA 1AH9A 3PIO3 1VQAA 5KYLA 3GTPB 3CCMA 2QCPX 3S1QH 3AEVA 3T1HQ 1CM9A 3VR5A 3ICEA 3BZCA 2OT2A 4EQ5A 4LUZA 4X62L 1CFMA 3IL8A 4YCVA 5CMDA 1K0RA 5LMUL 2F0HA 1WCMH 4ID6A 1VF5C 3CC7A 5IT9E 4TSSA 1RODA 4GLVB 4KY6A 2K03A 3A8IE 2HIVA 3A8KE 5GADC 4F88A 2JE6I 1JT8A 1EQTA 4H0LC 3KF6A 3EFXD 1JORA 4L63B 4NB3A 5ELOA 1RL2A 2PNHA 2F0VA 4HAEA 1L1OC 2DNEA 1CQVA 3D0FA 4JYAL 3DUZA 1ILQA 4Y7NH 1EIGA 3CPWA 2R6GA 2ATWA 1UNSA 1Y1WB 1I3QH 5C4XB 1VQ6A 2DNCA 1IYVA 1BBWA 3FDTA 5C0XI 3EJIA 1S72A 2F3WA 4V0BA 4CBVA 4LF4L 4CJ0B 3CP0A 4C2MH 1B4OA 1W2BA 4QQBX 1L0XB 1CZGA 1DONA 2WAQE 2O5IC 3S2DB 1BBXC 5M5YH 3I2ZA 4JI5L 4LNQA 1I6VC 1XYIA 1VQ8A 4RGTA 2BOSA 5EKIA 1B3QA 1PH3A 4X3KA 2OCEA 4RHRA 3W1GA 2FMMA 2UXCL 3Q0AA 2ZM6Q 3S17B 3PMFA 4QL5A 5EBDA 3PQIA 1I6HH 3KF6B 1R9TH 2B2VC 3E9IA 5LHY1 1AW7A 1QNUA 3HOZG 4LUVA 3CCVA 2F0DA 4JI2Q 1IBKQ 4JOIA 1VCIA 1T5XD 2F0IA 1KHIA 2K5HA 3P20A 2BE5C 2OTJA 2F0TA 1PZID 4QUCA 3C46A 4KY7A 1IL2A 2CCZA 4A3IB 2A68C 1GUTA 2OTLA 1CTMA 1HZ9A 1VQNA 1IKLA 3JC66 1PH9A 3M7GA 5J1ZA 2Y0SG 1EZ8A 1F9RA 3DEPA 4DR6Q 1L1OA 3I4NG 1I4GA 2N55A 2IWHA 2EQSA 1X3GA 4A4IA 3CCRA 4FP5D 2KHIA 2N8NA 3HG9A 4OHJA 4DKAC 3RNUA 3NTIA 2E2IH 1K3BC 1PYBA 1U4MA 2PW5A 4I7AA 1CKOA 2NVTB 3M4QA 3JAML 5IE8A 3I56A 5EQ0A 4OX9Q 4MHEA 3SR1A 1KLGD 5I9OA 1E24A 2EY1A 1ENFA 1EQRA 4A3BB 1JC7A 1MIUA 2PZTA 1QVCA 1KD1C 1ESRA 2L55A 1QWYA 1X65A 2DJGC 1O7ZA 5IOCA 3NXWA 1KRTA 1CA6A 2B63B 1IXRA 5A2QE 5C44G 4A3FG 4HJAA 1C4QA 3BZKA 1D6EC 2B2VA 4K6LA 4YY3L 5CV8A 3F1ZA 4PG3A 2KCTA 5JPMC 1L1OB 1RD9D 1D5XC 1VQBA 2MNAA 1F2MA 3F8TA 4UDUC 2MP1A 3K8AA 2VNUD 5E4WC 4UY8C 3OOCA 3W2DA 4IPHA 2CHBD 2QA4A 3QJYA 1EYCA 2KEDA 4XTCS 2A1AA 5LMNW 3MA2B 1QE6A 4DV0L 4X66L 1H9JA 1BCPF 5I6YA 3SGIA 1K8GA 1NR4A 4XIGS 3C1EA 5IGDA 2WINB 3Q23A 4N8X1 4A3CG 1L0YB 2ZXOA 1G8ZD 2JA6H 2D0PA 4JBKA 3NENA 1EL0A 2N3SA 3BU2A 2WB1E 3T16A 4RFBA 2GVAA 4HEDA 4EX5A 4KK7A 4LJZC 2KA7A 2K04A 4A93G 3KDFA 3NQIA 4K2LA 2FXQA 5FJ8G 5ELEA 3PIP3 5J3BA 3T1HL 1KABA 2EDGA 5AJ3Q 3SXHA 1W3SA 3PO2G 1WFQA 1LTRD 4LWCA 2FINB 5CORA 4DAYA 1PFNA 1KLUD 4NDXA 1Y69U 3IFDA 1JR0D 1MSGA 1UE5A 4A3EG 2QEJC 4DF7A 2ICIA 3GTMB 1IZ6A 4G7OC 4A3JB 1K0SA 3J81E 1TVXA 1ZKOA 2M9VA 1FGUA 3J7AF 1N8RC 3I4MH 2IL8A 4C3JH 1X3EA 1D5ZC 5BN5A 1DOLA 1DOMA 2NTTA 2X6LA 4HJ9A 3ITPA 2IW3A 5HY6A 4DV2Q 2HQLA 3DXJC 2R7ZB 3VR6A 2MFIA 3HOWH 2L9HA 4UPAA 1C48A 2ENBA 5C4XG 1B7YB 2JA5H 5M3FH 1YJWA 2E8GA 3OW7A 4G4KA 1U4LA 3T53B 4XQNA 3S1QB 2JA8H 4DAYB 2MPMA 2JA9A 3S15B 3Q24A 3FRPB 4FXGC 4B3RQ 4X65Q 3SDZA 5M3MH 1FNWA 2XWJB 1AEXA 1G6ZA 5IT9L 2WIIB 1BO0A 1CT1D 1JJ2A 3S2HH 1WCMB 3NTHA 1VQDA 2RSNA 4RKLA 4JI2L 1IBKL 3HKZE 5E1FA 1A63A 4LF7Q 3GTJH 2QW7A 3H0GH 3MAQA 4RCNA 3NK9A 4C3IB 1F9QA 4EGVA 3NSWA 3IRBA 4MIUA 3KLSA 3RN2A 2IX0A 4DR6L 1KTKA 4JVZA 4EVOA 4GKJQ 1SRUA 3K7UC 1K9MC 3K5OA 2LY7A 3AB9A 2NTSA 4QUFA 3EBEA 3N6RA 2R92H 3KF8A 1N34Q 2I5MX 4A3MH 4JCVE 2M2LA 3TZDA 2IT1A 5DM73 4CJ1B 1CSPA 5G3LD 4A3DG 5M5YB 3FKIH 3KK7A 5F2DA 1GVPA 2WB1G 3NTKA 2XWBB 1ONLA 1Q7YC 2OWOA 2NN6H 2K33A 4RH6A 1SE2A 1EU4A 1A2TA 4OX9L 1ESFA 1SNOA 2K5DA 1D8LA 3OMGA 1AE3A 4UP8A 3GTPH 1BCPC 1VQ7A 4P2CB 1I6HB 4PZ7A 2EJFC 1R9TB 1RDPD 1TWCB 1PTOD 2PI2E 3K5MA 3SK6A 3ERSX 2VL6A 3VR4A 1I94Q 4FNFA 3NE5B 4QGUA 5EBCA 4P72A 1B8AA 1H9RA 1H9MA 1KDCA 4N9TA 4TVAB 3W5OA 1YNXA 4HJ8A 4CHTB 2KQ3A 4I65A 3V96A 3L9AX 3KF8B 2F0JA 4LMQD 2WKDA 1VQKA 3CAMA 1QB5D 1VS0A 3D6CA 2F4VQ 2Z4HA 2N78A 2Q2HA 4L5TA 3GTOH 4IPGA 2LS01 3KFUA 5IYCG 4E6IA 3MXNB 2JEBI 5EPJA 3OIPA 5IP7G 5IP9H 5KGUA 2RBMA 1Y1WH 1TWFB 3FVQA 2F0LA 4YWKA 2KHJA 4F87A 1SYEA 4HSPA 4F7XA 1TS3A 1GHJA 5M5XB 2HT1A 4A3GG 1NR2A 4CDEC 4R4QA 4KHZA 3S14B 2G5DA 2RCNA 5C5MA 3K80C 4DXFA 5M5WB 2D0OA 3Q6SA 1XNQQ 4P75A 1DYQA 2RSOA 3RR5A 3TQYA 2JA7G 3T4AC 3S17H 3HS0C 4LW1A 1PMRA 2L4NA 5AJ3L 3I7FA 2I5LX 1EIHA 4A75A 2EYLA 2OF1A 3UI2A 4OO1G 1RTNA 2XN9C 1BOSA 4K14A 4KJNA 2Z1CA 2BH2A 4H13C 1JCKB 3HOUG 1WTHA 1GKHA 3A74A 3HKZG 1CHQD 1E1TA 3HOXG 5J22A 4GKKL 3LWEA 2JN4A 2Z0SA 1K8AC 4A3IH 4L5QA 4B9XA 4B3MQ 1I4HA 4QY7A 1AZPA 1FNVA 5JEAJ 3D8GA 1PA6A 4Q5VA 1PRTF 1DM0B 4BXXG 4DNIA 1BVSA 4IUTA 1RJTA 2B2UA 4DV2L 4Q0FA 1WYDA 4BWGB 1T5EA 1BCPB 3QIAA 5FO9B 4KN7C 3TP6A 5KRUA 2NUCA 3PUZA 1IL8A 1WD0A 1M1KC 3S16B 2NVTH 2D9UA 4B08A 3PGZA 1G2TA 3CCEA 1C8CA 3GTLB 3HOVH 3NPPA 1IBLQ 1Z47A 5FKAC 1IW7C 3ULJA 2Z6KC 3CMAA 1NMFA 1FJGQ 4A3BH 4B3RL 2EY2A 2B2YA 4YCWA 1C0AA 4ZAIA 3MZ5A 3CRLC 3WWVA 3KBGA 3NELA 3GO5A 4AYBG 3SK8A 1SE8A 2O4XA 1TKWB 4C1NI 1CI3M 3VYTA 3BYYB 1WCMG 4LF7L 5AFWA 2Q2UA 3RLNA 3RUZA 1SFOB 3VA5A 4TQUS 5LMNQ 1LT4D 1JOQA 1ML0D 3SE0A 3I4MB 1RKNA 3WOFA 2ZXPA 1D1KA 1OXTA 3J7A5 4KHPQ 1BDOA 1OXVA 4GKJL 1VQFA 2PQEA 3I70A 4WJ4A 1TY0A 1KAAA 2M00A 5GAHC 3D31A 4N9PA 1OXSC 4NXNQ 2ID0A 1EU3A 1EYDA 5M3FB 4TKOB 4HCSA 2KECA 1DXMA 2AQ1B 2RKSA 1PYWD 3JAMc 1EY0A 1HPCA 2EYFA 4OEMB 5J39A 2VB3X 3SVMA 2NZHA 4G7HC 4ME5A 4OWWB 1PFMA 4AQYQ 1LUZA 2WFWA 5CV9A 3KJPA 2DY7A 5EPLA 4GN3B 1EZ6A 5ELFA 3I90A 1I94L 2RHQB 2IX3A 3S1NB 4WRDA 5JJZA 3GTJB 1WJJA 2UUAQ 3MXPA 1PH5A 1EFID 1PZJD 1QOHA 1PLFA 5IYDH 1X9NA 1UWVA 4DFAA 1B70B 1VQCA 4X66Q 1RF2D 1UEAB 2F4VL 1R4QB 4DR3Q 4BA2I 5G3LF 1XTCD 2H1EA 1W6KA 1Z6HA 5GAGC 5D3DA 2R92B 3UDFA 1STYA 2F0UA 4IUUA 2F4IA 4B3TQ 1N9WA 3TZUA 2R7ZH 2ZJPA 3DWAA 4KKUA 1UEBA 2Q2IA 1QUQA 1MGSA 2B8GA 1PH2A 1IYUA 2CKZB 1NJIC 1BR9A 3J80L 2PZUA 1EWCA 4IJHA 2R3ZA 1UUPA 1STAA 1DCZA 1MJEA 3U50C 3CCUA 3J7ZC 1Y14B 1XNQL 3S15H 1PRTC 5NUCA 3TSSA 4F8MA 3D4DA 5CBEE 3J81j 2UUBQ 2CW0D 5IGCA 4ODGA 1Q1BA 2K28A 4FF2A 2EIFA 1XJVA 4JOIC 1V1QA 4O0AA 1B3AA 1NBWA 2VUMB 3K81C 2OQ0A 5EPKA 3L3OC 1BKBA 3A7LA 1STHA 3DWPA 2QEXA 4OELB 1AE2A 4RKBA 4C3IH 1H9SA 3GTOB 4MN3A 2F0OA 1LTLA 5BN3A 4B3ML 1U4RA 2I0QA 4BBSB 1UE7A 4G57A 2DN8A 2O2LD 1FR3A 1HCZA 4PMCA 4CJ2C 3K5LA 1D5MC 1E22A 4DK3C 3H3VC 1SNMA 4ZQ3A 1CUKA 5K36H 1UAPA 2NVQB 2WKCA 1Y1VH 4OIKA 2JA6G 2K7VA 2R93B 3O13A 4EQOA 2RA4A 2RDGA 1KAWA 3DEOA 4ILWA 1NMGA 4KMUC 4GLXA 2MO1A 3E9HA 2A8VA 1SYBA 3UDIA 1IBLL 3QOLA 3MC0B 3R2IA 2F0KA 1SNPA 3HGBA 1FJGL 4FXDA 3I4OA 1TWCH 4WORA 5IT9c 3CD6A 1V1PA 4LF5Q 2QDLA 2FMCA 1JICA 3CC4A 4GS3A 2KEEA 4DUYQ 1E1OA 4LK1C 4DUZQ 5IYBH 4FXKC 1ILPA 5I9PA 2VQEQ 1LTBD 3F2CA 1PH6A 3M3YB 5LMNL 4DV3Q 4X3TA 4C3HB 5E4XA 4BY1B 1DZ1A 1EIFA 2F0MA 1M90C 1KC8C 3Q8DA 1N32Q 2FJ2A 4KHPL 2AHOB 4ZLTF 2PCFB 2YTVA 3I4MG 4C3JG 3PO3B 1EY5A 2QDBA 1QG7A 1TWFH 2B2WA 3QG1A 1V1OA 4ME3A 4BBRB 1U5KA 3CRKC 3G7LA 4NXNL 1IYJB 3M7NA 2BH8A 4UP7A 1PRTB 1EWIA 1J6QA 4OGQC 5C3EB 2VZAA 3DM3A 3NWTA 2VW9A 5M5XH 3OTOQ 1HHVA 3HOWG 1SE4A 1TS2A 5C5LA 1K8OA 3HOVB 5CV6A 5KNBA
chains in the Genus database with same CATH topology
2JA5G 1EQQA 4R1JA 5M3FG 3S14H 1JJ2A 2ALYB 3S2HH 4DV4L 5M5WH 2XGTA 1X6OA 4BXXH 4AQYL 4QJFA 4A3LH 3UDGA 2JA8G 4IPCA 2UXDQ 3CCQA 1YJNA 1VQDA 1IBMQ 1IBKL 4JI2L 4Y52H 4GLAC 3HKZE 1A63A 4LF7Q 5M3MG 4JYAQ 3GTJH 4DR4L 3H0GH 4LFBQ 1Q8KA 4DR5Q 3LGJA 3PUVA 5JJIA 1HR0W 1YEZA 2KCMA 4GN4B 3U4ZA 3G6EA 4IO9A 2NVYH 3M85A 2LSSA 4MZ9A 3IRBA 4A3LG 2GVBA 3PUXA 4UP9A 1G6PA 2L15A 1O7IA 3RN2A 4LF4Q 4X64Q 2IX0A 3GD7A 3TREA 2UUAL 4DR6L 4JBWA 4A3DH 2WP8J 1OTCA 4GKJQ 1SRUA 3K7UC 1PH7A 1K9MC 2HHHL 3I55A 4L5RC 3H0GG 2YTYA 3HKSA 4OONA 4AIMA 1K73C 3EBEA 5FLMH 4JI5Q 4RMFA 3RLOA 1ASZA 1MJCA 4JI0L 2R92H 4DR3L 4P71A 1N34Q 5IY0A 2I5MX 4JI3Q 4A3MH 4LF6Q 4JCVE 1XMOQ 1N36L 2IT1A 1SR3A 2PMZE 3PV0A 1CSPA 4HIKA 1VQMA 1PHJA 3HOYH 1QUQB 1YHBA 1JMCA 4A3DG 3FKIH 2UXCQ 3S15H 1GVPA 2WB1G 1P16A 1U0LA 1Q7YC 2OWOA 3DLLA 1EIYB 4B3TL 4B3SL 4X65L 3K7AH 4GN5A 1HNZQ 1VQIA 4OX9L 1MKHA 5FLMG 4JI4L 1PH8A 2R92G 1JJCB 1D8LA 5BR8Q 1AE3A 3MEFA 1SMXA 4UP8A 5H1SE 2WAQG 4A3MG 2B63H 3GTPH 1VQ7A 1KXLA 4PZ7A 3HOYG 2CQOA 4R4TA 3S16H 3FKIG 1I5FA 4JC0A 2PI2E 4P74A 3T1YL 4JG2A 3ERSX 2VL6A 1I94Q 2VS1A 3HFZB 4IOAA 3GTLH 3AYHB 3NEMA 5GAEC 4LF8L 2KBNA 4A76A 1TWHH 4QGUA 2YYZA 3PF4A 4LFCL 4A3KH 4DV6L 1S3OA 1Q86C 5IYCH 4P72A 1B8AA 2UUBL 4TVAB 2K4KA 5IP7H 3W5OA 3PCOB 1YNXA 2NN6I 4HJ8A 4AH6A 3AFQA 1C9OA 1C7YA 3GTGH 2ZJQA 1KQSA 3KF8B 4PZ6A 1I50H 1VQKA 4X6AH 3CAMA 3KLWA 2BA0A 1GO3E 1VS0A 3BJUA 4GNXA 2F4VQ 4IPDA 2E2HH 1YHAA 2N78A 4GKKQ 1WOCA 2Q2HA 4DV5L 4JI8Q 4L5TA 3G71A 1VQHA 4IPGA 4A3KG 3GTOH 3KFUA 3TS0A 5IYCG 3G4SA 4A3GH 5IP7G 1Z9FA 2JEBI 3MXNB 1N34L 4K0KQ 4RG1A 5IP9H 1WI5A 1SFOH 2YTXA 1Y1WH 1CSQA 5JJKA 2IHEA 1XNRL 2QGQA 3B6YA 4YWKA 4ALPA 2KHJA 1LM0A 3U58A 2E5LQ 3F2DA 1XPRA 2JJQA 4IFDG 2K50A 3KDFB 1VQOA 1HJPA 2JA7H 2HT1A 2VQFQ 3ULLA 2UXBL 4A3GG 1Q81C 4R4OA 3W1BA 5IP9G 4YHHL 1VQEA 2JK8A 4R4QA 4KHZA 2E2JH 1Y1WG 2Z6KA 2RCNA 3I4NH 1YBYA 3K80C 4IFDI 2DUDA 2OQKA 4MNOA 1HH2P 1SROA 2D0OA 4YY3Q 1XNQQ 4P75A 1YI2A 3EIVA 1HZAA 2R7FA 3HOUH 1VQPA 3RR5A 3TRZA 2UUCQ 3TQYA 2K75A 3JAMi 2JA7G 4JI1Q 3CXCA 3HOXH 3S17H 3ER0A 4LW1A 4JI7L 5AJ3L 3I7FA 2I5LX 4A75A 4JV5L 2JQOA 3S24A 3H15A 4OO1G 3L0OA 5E7NA 1SLJA 4HIDA 3CMEA 1K3RA 3RLFA 3J80i 2BH2A 3GTMH 3HOUG 1X54A 1GKHA 3ULPA 3A74A 3HKZG 4DV0Q 2Y0SE 4NXMQ 5IWAL 4OO1I 4A3JH 2IHFA 1E1TA 3HOXG 4YCUA 4KI0A 4LF5L 4GKKL 3FP9A 1HNXQ 4LF9L 2Z0SA 1K8AC 4A3IH 3PF5A 1J5EL 4L5QA 3PIOA 3S1NH 1E7ZA 4POFA 4WJ3M 4DUYL 1PYSB 4DUZL 1Q12A 3J81c 4B3MQ 3CC2A 4QY7A 1XMQQ 1KRSA 3STBD 1H95A 4GNXC 5JEAJ 3KOJA 1PA6A 3CW2C 4BXXG 2VQEL 1NE3A 1BVSA 4DNIA 5C4JH 1GD7A 1FL0A 1G51A 2GN5A 1VQ5A 4DV3L 1VQGA 4DR1Q 5EAYA 1A62A 3E0EA 2VQFL 3VDYA 4DAMA 4A3IG 2LXJA 1AH9A 4DV2L 1WYDA 4POGA 2K5NA 1VQAA 3CCMA 1N32L 4DV1Q 3S1QH 1YHQA 3AEVA 3T1HQ 3M4PA 3PUZA 4OWTB 1M1KC 3ICEA 3BZCA 2NVTH 4EQ5A 4LUZA 3PGZA 4DV7L 3CCEA 4X62L 3HOVH 1IBLQ 1BBUA 1Z47A 4YCVA 1K0RA 5LMUL 3ULJA 4JI6Q 2Z6KC 2ZTDA 3CMAA 1NMFA 3OTOL 1FJGQ 4A3BH 1WCMH 2C35B 4YCWA 3CC7A 4B3RL 1C0AA 4GLVB 3WWVA 3NELA 3AFPA 2HIVA 3GO5A 1L0WA 4AYBG 3GTQH 5GADC 3ZJYC 4IFDJ 2JE6I 1EOVA 3K0XA 1JT8A 1SE8A 3KF6A 2UXDL 4JBMA 4NB3A 5ELOA 1RL2A 2KENA 2PNHA 3RN5A 1IBML 2NN6G 1L1OC 5JEAG 5C0XG 4A3BG 1WCMG 2A19A 4L5SA 2Q2UA 3D0FA 4LF7L 4JYAL 3RLNA 4Y7NH 3CPWA 2R6GA 2MQHA 4LFBL 2RF4A 2ATWA 4DR5L 4IJLA 4TQUS 5LMNQ 2B63G 3L2PA 2ZJRA 2VUMH 2HIXA 1EUJA 1I3QH 1YIJA 4DR7Q 4DR2Q 1VQ6A 2UU9Q 1BBWA 4PZ8A 5FLXc 5C0XI 3PUYA 1S72A 2BA1A 1SN8A 4LF4L 1OXTA 3CP0A 4C2MH 4X64L 1UE6A 4GOPA 3PSIA 1W2BA 1OXVA 3J7A5 4GKJL 4KHPQ 1VQFA 4QQBX 1HNWQ 3U4VA 2MO0A 3OW2A 5GAHC 4WJ4A 2PQAA 2WAQE 2CWPA 3D31A 5M5YH 3I2ZA 4JI5L 2VUMG 4LNQA 1OXSC 3OYYA 4LFAQ 1VQ8A 4NXNQ 1PH3A 4JI3L 2ID0A 2OCEA 4YWMA 4LF6L 2RHSB 1XMOL 4BBSH 3HOZH 3W1GA 3M9BA 3A0JA 2UXCL 1N33Q 1FVIA 2ZM6Q 3JAMc 4QL5A 1JB7A 1PVOA 1PFSA 1I6HH 1V9PA 3KF6B 2ES2A 2NZHA 1R9TH 2K52A 2PI2A 3H3VI 4DV4Q 1YITA 1HNZL 2Q2TA 4OWWB 3E9IA 2NVQH 4AQYQ 1LUZA 2B3GA 5BR8L 1P8LA 2WFWA 4J15A 1PH1A 4BBSG 3KJPA 2LXKA 3STBC 3J80c 4LUVA 3CCVA 3HOZG 1V43A 2CWAA 4JI2Q 4JOIA 3F2BA 1VCIA 1KIXA 1IBKQ 2R93H 4GN3B 1KHIA 2K5HA 2OTJA 2IX1A 4DR4Q 3GDEA 1OXUA 1I94L 2RHQB 1YVCA 1IL2A 2CCZA 1X56A 1YZ6A 2N49A 2OTLA 1VQNA 1HZ9A 3JC66 1PH9A 2XTIA 4YWLA 4GNXB 1HZBA 2B29A 1WJJA 2Y0SG 1YJ9A 2UUAQ 1PH5A 4DR6Q 1UE1A 2PQAB 1L1OA 3I4NG 2R93G 2HHHQ 5IYDH 1X9NA 1A0IA 1UWVA 3KJOA 1B70B 2EQSA 1X3GA 4A4IA 1VQCA 4X66Q 3CCRA 1CKMA 2F4VL 4JI0Q 1VQ9A 2KHIA 2N8NA 4DR3Q 4DKAC 4BA2I 3RNUA 1VQJA 1N36Q 4JI8L 3AQQA 1X55A 5JJLA 2E2IH 1PYBA 2NZOA 5GAGC 1GM5A 4K0KL 2AKWB 3UDFA 5IYDG 1CKOA 3M3YH 3M4QA 4GOPC 4C3HH 4DPGA 4B3TQ 3TS2A 4B3SQ 5IE8A 5C44H 3I56A 4A3FH 1N9WA 1XTDA 2I5HA 5C0XJ 2ZM6L 3CCSA 4HJ7A 3CCLA 4BY1H 4OX9Q 2R7ZH 2ZJPA 4JI4Q 1NTGA 4A3JG 1UEBA 2Q2IA 1QUQA 2E5LL 1PH2A 2CKZB 1NJIC 1E24A 1EQRA 2CFMA 3PO3H 1MIUA 3UE1A 5ELNA 1QVCA 1KD1C 4IJHA 2AWOA 4QIWE 4BBRH 3T1YQ 1X65A 1KRTA 1MJEA 3U50C 1IXRA 5C44G 1JJGA 4A3FG 4LF8Q 4BY1G 3CCUA 4HJAA 5C3EH 3BZKA 1QZGA 2R7ZG 3J7ZC 4YY3L 1Y14B 3F1ZA 1XNQL 3GTKH 4PG3A 2KCTA 3CCJA 4LFCQ 1L1OB 1A8VA 1L2FA 3UDXA 4DV6Q 2UUCL 1RIPA 1VQBA 3J81j 2MNAA 2UUBQ 3F8TA 1X3FA 4JI1L 3PO3G 3K8AA 2VNUD 1Q1BA 4UY8C 3M4OH 2EIFA 4BBRG 1XJVA 3NBHB 4IPHA 4JOIC 1V1QA 1JE5A 4O0AA 5DLQE 2QA4A 1NBWA 1QZHA 4BY7H 3K81C 4NPSA 1TWAH 4A3CH 4XTCS 2A1AA 3KYHC 5C3EG 2OQ0A 4P73A 5LMNW 3FHWA 4DV5Q 2IY5B 4DV0L 4X66L 1BKBA 4DK6C 4NXML 3J81i 2QEXA 1E3PA 1Q1EA 3A5ZB 4OXPA 2D62A 1HR0Q 3HOVG 3SGIA 2V1CC 1HZCA 4FDBA 1PV4A 1HNXL 5GQOA 1K8GA 4XIGS 1AE2A 4C3IH 1XNRQ 4A93H 1LTLA 3PIPA 4BY7G 4JBJA 3CPFA 4A3CG 3L7ZC 5FJ8H 4B3ML 3UE0A 1QVGA 2I0QA 1UE7A 1XMQL 2JA6H 2D0PA 1D7QA 2ZTCA 2UXBQ 4JBKA 3NENA 4IOCA 2EXDA 3H3VH 2N3SA 1E22A 3BU2A 4YHHQ 2WB1E 1XPUA 2AMCB 2GVAA 4EX5A 4DK3C 4DR1L 1T9HA 2F3IA 3CF5A 1CUKA 3PO2H 4A93G 2F52A 3KDFA 2FXQA 5FJ8G 1TWGH 1CKNA 1Y1VH 4KLKA 4R4CA 4AYBE 4DV1L 1PH4A 5J3BA 2JA6G 3RZOH 3T1HL 4A3EH 3G48A 3PUWA 2VY3A 1KAWA 4JI7Q 5AJ3Q 2R7DA 1NMGA 2K5VA 5GROA 4GLXA 2MO1A 3E9HA 4O2DA 4PMWA 2A8VA 4JV5Q 1W3SA 3UDIA 4HJ5A 3A5UA 1Q82C 1Q46A 3EN2A 1IBLL 1WFQA 1ASYA 3PO2G 5K36G 4MTNA 4LWCA 4JI6L 1Y1VG 1FJGL 1VQ4A 1XPOA 2AWNA 1KL9A 1TWCH 3I4OA 5IT9c 3CD6A 5IWAQ 1UE5A 4A3EG 4LF5Q 1S40A 1EYGA 4LF9Q 4H02A 1J5EQ 3S1RH 1IZ6A 4GS3A 4HIMA 2ZTEA 1HR0L 3CC4A 4DUYQ 1E1OA 4DUZQ 5IYBH 1QVFA 4HIOA 1FGUA 3CQZH 1OXXK 5C4XH 2DGYA 1N8RC 2NVXH 3I4MH 4C3JH 1X3EA 2VQEQ 4GOPB 3F2CA 1PH6A 4APVA 5LMNL 4DV3Q 2YU9H 4LUOA 4DR7L 4HJ9A 1LYLA 4DR2L 2YV5A 2H5XA 1CKNB 5HY6A 4DV2Q 1VQLA 2HQLA 1EIFA 2UU9L 3S1MH 2MFIA 4R4IA 1M90C 5IYBG 1KC8C 3S2DH 3Q8DA 3HOWH 1N32Q 4UPAA 1NY4A 2AHOB 4KHPL 4BA1I 1HNWL 5C4XG 2YTVA 3I4MG 1B7YB 2JA5H 5M3FH 1YJWA 1EFWA 1TWFH 2E8GA 4ME3A 1U5KA 4DV7Q 4X62Q 4LFAL 4NXNL 1IYJB 2JA8H 2BH8A 1G291 4UP7A 4DAYB 3M7NA 1EWIA 1J6QA 4OWXB 1K83H 1DGSA 2JA9A 2VZAA 2K14A 3DM3A 2VW9A 5LMUQ 5HGQA 5M5XH 1TXYA 3OTOQ 4B3RQ 4X65Q 2JEAI 3HOWG 5M3MH 3TEHB 3RZDH 1N33L 2ASBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA5 G;  1EQQ A;  4R1J A;  5M3F G;  3S14 H;  1JJ2 A;  2ALY B;  3S2H H;  4DV4 L;  5M5W H;  2XGT A;  1X6O A;  4BXX H;  4AQY L;  4QJF A;  4A3L H;  3UDG A;  2JA8 G;  4IPC A;  2UXD Q;  3CCQ A;  1YJN A;  1VQD A;  1IBM Q;  1IBK L;  4JI2 L;  4Y52 H;  4GLA C;  3HKZ E;  1A63 A;  4LF7 Q;  5M3M G;  4JYA Q;  3GTJ H;  4DR4 L;  3H0G H;  4LFB Q;  1Q8K A;  4DR5 Q;  3LGJ A;  3PUV A;  5JJI A;  1HR0 W;  1YEZ A;  2KCM A;  4GN4 B;  3U4Z A;  3G6E A;  4IO9 A;  2NVY H;  3M85 A;  2LSS A;  4MZ9 A;  3IRB A;  4A3L G;  2GVB A;  3PUX A;  4UP9 A;  1G6P A;  2L15 A;  1O7I A;  3RN2 A;  4LF4 Q;  4X64 Q;  2IX0 A;  3GD7 A;  3TRE A;  2UUA L;  4DR6 L;  4JBW A;  4A3D H;  2WP8 J;  1OTC A;  4GKJ Q;  1SRU A;  3K7U C;  1PH7 A;  1K9M C;  2HHH L;  3I55 A;  4L5R C;  3H0G G;  2YTY A;  3HKS A;  4OON A;  4AIM A;  1K73 C;  3EBE A;  5FLM H;  4JI5 Q;  4RMF A;  3RLO A;  1ASZ A;  1MJC A;  4JI0 L;  2R92 H;  4DR3 L;  4P71 A;  1N34 Q;  5IY0 A;  2I5M X;  4JI3 Q;  4A3M H;  4LF6 Q;  4JCV E;  1XMO Q;  1N36 L;  2IT1 A;  1SR3 A;  2PMZ E;  3PV0 A;  1CSP A;  4HIK A;  1VQM A;  1PHJ A;  3HOY H;  1QUQ B;  1YHB A;  1JMC A;  4A3D G;  3FKI H;  2UXC Q;  3S15 H;  1GVP A;  2WB1 G;  1P16 A;  1U0L A;  1Q7Y C;  2OWO A;  3DLL A;  1EIY B;  4B3T L;  4B3S L;  4X65 L;  3K7A H;  4GN5 A;  1HNZ Q;  1VQI A;  4OX9 L;  1MKH A;  5FLM G;  4JI4 L;  1PH8 A;  2R92 G;  1JJC B;  1D8L A;  5BR8 Q;  1AE3 A;  3MEF A;  1SMX A;  4UP8 A;  5H1S E;  2WAQ G;  4A3M G;  2B63 H;  3GTP H;  1VQ7 A;  1KXL A;  4PZ7 A;  3HOY G;  2CQO A;  4R4T A;  3S16 H;  3FKI G;  1I5F A;  4JC0 A;  2PI2 E;  4P74 A;  3T1Y L;  4JG2 A;  3ERS X;  2VL6 A;  1I94 Q;  2VS1 A;  3HFZ B;  4IOA A;  3GTL H;  3AYH B;  3NEM A;  5GAE C;  4LF8 L;  2KBN A;  4A76 A;  1TWH H;  4QGU A;  2YYZ A;  3PF4 A;  4LFC L;  4A3K H;  4DV6 L;  1S3O A;  1Q86 C;  5IYC H;  4P72 A;  1B8A A;  2UUB L;  4TVA B;  2K4K A;  5IP7 H;  3W5O A;  3PCO B;  1YNX A;  2NN6 I;  4HJ8 A;  4AH6 A;  3AFQ A;  1C9O A;  1C7Y A;  3GTG H;  2ZJQ A;  1KQS A;  3KF8 B;  4PZ6 A;  1I50 H;  1VQK A;  4X6A H;  3CAM A;  3KLW A;  2BA0 A;  1GO3 E;  1VS0 A;  3BJU A;  4GNX A;  2F4V Q;  4IPD A;  2E2H H;  1YHA A;  2N78 A;  4GKK Q;  1WOC A;  2Q2H A;  4DV5 L;  4JI8 Q;  4L5T A;  3G71 A;  1VQH A;  4IPG A;  4A3K G;  3GTO H;  3KFU A;  3TS0 A;  5IYC G;  3G4S A;  4A3G H;  5IP7 G;  1Z9F A;  2JEB I;  3MXN B;  1N34 L;  4K0K Q;  4RG1 A;  5IP9 H;  1WI5 A;  1SFO H;  2YTX A;  1Y1W H;  1CSQ A;  5JJK A;  2IHE A;  1XNR L;  2QGQ A;  3B6Y A;  4YWK A;  4ALP A;  2KHJ A;  1LM0 A;  3U58 A;  2E5L Q;  3F2D A;  1XPR A;  2JJQ A;  4IFD G;  2K50 A;  3KDF B;  1VQO A;  1HJP A;  2JA7 H;  2HT1 A;  2VQF Q;  3ULL A;  2UXB L;  4A3G G;  1Q81 C;  4R4O A;  3W1B A;  5IP9 G;  4YHH L;  1VQE A;  2JK8 A;  4R4Q A;  4KHZ A;  2E2J H;  1Y1W G;  2Z6K A;  2RCN A;  3I4N H;  1YBY A;  3K80 C;  4IFD I;  2DUD A;  2OQK A;  4MNO A;  1HH2 P;  1SRO A;  2D0O A;  4YY3 Q;  1XNQ Q;  4P75 A;  1YI2 A;  3EIV A;  1HZA A;  2R7F A;  3HOU H;  1VQP A;  3RR5 A;  3TRZ A;  2UUC Q;  3TQY A;  2K75 A;  3JAM i;  2JA7 G;  4JI1 Q;  3CXC A;  3HOX H;  3S17 H;  3ER0 A;  4LW1 A;  4JI7 L;  5AJ3 L;  3I7F A;  2I5L X;  4A75 A;  4JV5 L;  2JQO A;  3S24 A;  3H15 A;  4OO1 G;  3L0O A;  5E7N A;  1SLJ A;  4HID A;  3CME A;  1K3R A;  3RLF A;  3J80 i;  2BH2 A;  3GTM H;  3HOU G;  1X54 A;  1GKH A;  3ULP A;  3A74 A;  3HKZ G;  4DV0 Q;  2Y0S E;  4NXM Q;  5IWA L;  4OO1 I;  4A3J H;  2IHF A;  1E1T A;  3HOX G;  4YCU A;  4KI0 A;  4LF5 L;  4GKK L;  3FP9 A;  1HNX Q;  4LF9 L;  2Z0S A;  1K8A C;  4A3I H;  3PF5 A;  1J5E L;  4L5Q A;  3PIO A;  3S1N H;  1E7Z A;  4POF A;  4WJ3 M;  4DUY L;  1PYS B;  4DUZ L;  1Q12 A;  3J81 c;  4B3M Q;  3CC2 A;  4QY7 A;  1XMQ Q;  1KRS A;  3STB D;  1H95 A;  4GNX C;  5JEA J;  3KOJ A;  1PA6 A;  3CW2 C;  4BXX G;  2VQE L;  1NE3 A;  1BVS A;  4DNI A;  5C4J H;  1GD7 A;  1FL0 A;  1G51 A;  2GN5 A;  1VQ5 A;  4DV3 L;  1VQG A;  4DR1 Q;  5EAY A;  1A62 A;  3E0E A;  2VQF L;  3VDY A;  4DAM A;  4A3I G;  2LXJ A;  1AH9 A;  4DV2 L;  1WYD A;  4POG A;  2K5N A;  1VQA A;  3CCM A;  1N32 L;  4DV1 Q;  3S1Q H;  1YHQ A;  3AEV A;  3T1H Q;  3M4P A;  3PUZ A;  4OWT B;  1M1K C;  3ICE A;  3BZC A;  2NVT H;  4EQ5 A;  4LUZ A;  3PGZ A;  4DV7 L;  3CCE A;  4X62 L;  3HOV H;  1IBL Q;  1BBU A;  1Z47 A;  4YCV A;  1K0R A;  5LMU L;  3ULJ A;  4JI6 Q;  2Z6K C;  2ZTD A;  3CMA A;  1NMF A;  3OTO L;  1FJG Q;  4A3B H;  1WCM H;  2C35 B;  4YCW A;  3CC7 A;  4B3R L;  1C0A A;  4GLV B;  3WWV A;  3NEL A;  3AFP A;  2HIV A;  3GO5 A;  1L0W A;  4AYB G;  3GTQ H;  5GAD C;  3ZJY C;  4IFD J;  2JE6 I;  1EOV A;  3K0X A;  1JT8 A;  1SE8 A;  3KF6 A;  2UXD L;  4JBM A;  4NB3 A;  5ELO A;  1RL2 A;  2KEN A;  2PNH A;  3RN5 A;  1IBM L;  2NN6 G;  1L1O C;  5JEA G;  5C0X G;  4A3B G;  1WCM G;  2A19 A;  4L5S A;  2Q2U A;  3D0F A;  4LF7 L;  4JYA L;  3RLN A;  4Y7N H;  3CPW A;  2R6G A;  2MQH A;  4LFB L;  2RF4 A;  2ATW A;  4DR5 L;  4IJL A;  4TQU S;  5LMN Q;  2B63 G;  3L2P A;  2ZJR A;  2VUM H;  2HIX A;  1EUJ A;  1I3Q H;  1YIJ A;  4DR7 Q;  4DR2 Q;  1VQ6 A;  2UU9 Q;  1BBW A;  4PZ8 A;  5FLX c;  5C0X I;  3PUY A;  1S72 A;  2BA1 A;  1SN8 A;  4LF4 L;  1OXT A;  3CP0 A;  4C2M H;  4X64 L;  1UE6 A;  4GOP A;  3PSI A;  1W2B A;  1OXV A;  3J7A 5;  4GKJ L;  4KHP Q;  1VQF A;  4QQB X;  1HNW Q;  3U4V A;  2MO0 A;  3OW2 A;  5GAH C;  4WJ4 A;  2PQA A;  2WAQ E;  2CWP A;  3D31 A;  5M5Y H;  3I2Z A;  4JI5 L;  2VUM G;  4LNQ A;  1OXS C;  3OYY A;  4LFA Q;  1VQ8 A;  4NXN Q;  1PH3 A;  4JI3 L;  2ID0 A;  2OCE A;  4YWM A;  4LF6 L;  2RHS B;  1XMO L;  4BBS H;  3HOZ H;  3W1G A;  3M9B A;  3A0J A;  2UXC L;  1N33 Q;  1FVI A;  2ZM6 Q;  3JAM c;  4QL5 A;  1JB7 A;  1PVO A;  1PFS A;  1I6H H;  1V9P A;  3KF6 B;  2ES2 A;  2NZH A;  1R9T H;  2K52 A;  2PI2 A;  3H3V I;  4DV4 Q;  1YIT A;  1HNZ L;  2Q2T A;  4OWW B;  3E9I A;  2NVQ H;  4AQY Q;  1LUZ A;  2B3G A;  5BR8 L;  1P8L A;  2WFW A;  4J15 A;  1PH1 A;  4BBS G;  3KJP A;  2LXK A;  3STB C;  3J80 c;  4LUV A;  3CCV A;  3HOZ G;  1V43 A;  2CWA A;  4JI2 Q;  4JOI A;  3F2B A;  1VCI A;  1KIX A;  1IBK Q;  2R93 H;  4GN3 B;  1KHI A;  2K5H A;  2OTJ A;  2IX1 A;  4DR4 Q;  3GDE A;  1OXU A;  1I94 L;  2RHQ B;  1YVC A;  1IL2 A;  2CCZ A;  1X56 A;  1YZ6 A;  2N49 A;  2OTL A;  1VQN A;  1HZ9 A;  3JC6 6;  1PH9 A;  2XTI A;  4YWL A;  4GNX B;  1HZB A;  2B29 A;  1WJJ A;  2Y0S G;  1YJ9 A;  2UUA Q;  1PH5 A;  4DR6 Q;  1UE1 A;  2PQA B;  1L1O A;  3I4N G;  2R93 G;  2HHH Q;  5IYD H;  1X9N A;  1A0I A;  1UWV A;  3KJO A;  1B70 B;  2EQS A;  1X3G A;  4A4I A;  1VQC A;  4X66 Q;  3CCR A;  1CKM A;  2F4V L;  4JI0 Q;  1VQ9 A;  2KHI A;  2N8N A;  4DR3 Q;  4DKA C;  4BA2 I;  3RNU A;  1VQJ A;  1N36 Q;  4JI8 L;  3AQQ A;  1X55 A;  5JJL A;  2E2I H;  1PYB A;  2NZO A;  5GAG C;  1GM5 A;  4K0K L;  2AKW B;  3UDF A;  5IYD G;  1CKO A;  3M3Y H;  3M4Q A;  4GOP C;  4C3H H;  4DPG A;  4B3T Q;  3TS2 A;  4B3S Q;  5IE8 A;  5C44 H;  3I56 A;  4A3F H;  1N9W A;  1XTD A;  2I5H A;  5C0X J;  2ZM6 L;  3CCS A;  4HJ7 A;  3CCL A;  4BY1 H;  4OX9 Q;  2R7Z H;  2ZJP A;  4JI4 Q;  1NTG A;  4A3J G;  1UEB A;  2Q2I A;  1QUQ A;  2E5L L;  1PH2 A;  2CKZ B;  1NJI C;  1E24 A;  1EQR A;  2CFM A;  3PO3 H;  1MIU A;  3UE1 A;  5ELN A;  1QVC A;  1KD1 C;  4IJH A;  2AWO A;  4QIW E;  4BBR H;  3T1Y Q;  1X65 A;  1KRT A;  1MJE A;  3U50 C;  1IXR A;  5C44 G;  1JJG A;  4A3F G;  4LF8 Q;  4BY1 G;  3CCU A;  4HJA A;  5C3E H;  3BZK A;  1QZG A;  2R7Z G;  3J7Z C;  4YY3 L;  1Y14 B;  3F1Z A;  1XNQ L;  3GTK H;  4PG3 A;  2KCT A;  3CCJ A;  4LFC Q;  1L1O B;  1A8V A;  1L2F A;  3UDX A;  4DV6 Q;  2UUC L;  1RIP A;  1VQB A;  3J81 j;  2MNA A;  2UUB Q;  3F8T A;  1X3F A;  4JI1 L;  3PO3 G;  3K8A A;  2VNU D;  1Q1B A;  4UY8 C;  3M4O H;  2EIF A;  4BBR G;  1XJV A;  3NBH B;  4IPH A;  4JOI C;  1V1Q A;  1JE5 A;  4O0A A;  5DLQ E;  2QA4 A;  1NBW A;  1QZH A;  4BY7 H;  3K81 C;  4NPS A;  1TWA H;  4A3C H;  4XTC S;  2A1A A;  3KYH C;  5C3E G;  2OQ0 A;  4P73 A;  5LMN W;  3FHW A;  4DV5 Q;  2IY5 B;  4DV0 L;  4X66 L;  1BKB A;  4DK6 C;  4NXM L;  3J81 i;  2QEX A;  1E3P A;  1Q1E A;  3A5Z B;  4OXP A;  2D62 A;  1HR0 Q;  3HOV G;  3SGI A;  2V1C C;  1HZC A;  4FDB A;  1PV4 A;  1HNX L;  5GQO A;  1K8G A;  4XIG S;  1AE2 A;  4C3I H;  1XNR Q;  4A93 H;  1LTL A;  3PIP A;  4BY7 G;  4JBJ A;  3CPF A;  4A3C G;  3L7Z C;  5FJ8 H;  4B3M L;  3UE0 A;  1QVG A;  2I0Q A;  1UE7 A;  1XMQ L;  2JA6 H;  2D0P A;  1D7Q A;  2ZTC A;  2UXB Q;  4JBK A;  3NEN A;  4IOC A;  2EXD A;  3H3V H;  2N3S A;  1E22 A;  3BU2 A;  4YHH Q;  2WB1 E;  1XPU A;  2AMC B;  2GVA A;  4EX5 A;  4DK3 C;  4DR1 L;  1T9H A;  2F3I A;  3CF5 A;  1CUK A;  3PO2 H;  4A93 G;  2F52 A;  3KDF A;  2FXQ A;  5FJ8 G;  1TWG H;  1CKN A;  1Y1V H;  4KLK A;  4R4C A;  4AYB E;  4DV1 L;  1PH4 A;  5J3B A;  2JA6 G;  3RZO H;  3T1H L;  4A3E H;  3G48 A;  3PUW A;  2VY3 A;  1KAW A;  4JI7 Q;  5AJ3 Q;  2R7D A;  1NMG A;  2K5V A;  5GRO A;  4GLX A;  2MO1 A;  3E9H A;  4O2D A;  4PMW A;  2A8V A;  4JV5 Q;  1W3S A;  3UDI A;  4HJ5 A;  3A5U A;  1Q82 C;  1Q46 A;  3EN2 A;  1IBL L;  1WFQ A;  1ASY A;  3PO2 G;  5K36 G;  4MTN A;  4LWC A;  4JI6 L;  1Y1V G;  1FJG L;  1VQ4 A;  1XPO A;  2AWN A;  1KL9 A;  1TWC H;  3I4O A;  5IT9 c;  3CD6 A;  5IWA Q;  1UE5 A;  4A3E G;  4LF5 Q;  1S40 A;  1EYG A;  4LF9 Q;  4H02 A;  1J5E Q;  3S1R H;  1IZ6 A;  4GS3 A;  4HIM A;  2ZTE A;  1HR0 L;  3CC4 A;  4DUY Q;  1E1O A;  4DUZ Q;  5IYB H;  1QVF A;  4HIO A;  1FGU A;  3CQZ H;  1OXX K;  5C4X H;  2DGY A;  1N8R C;  2NVX H;  3I4M H;  4C3J H;  1X3E A;  2VQE Q;  4GOP B;  3F2C A;  1PH6 A;  4APV A;  5LMN L;  4DV3 Q;  2YU9 H;  4LUO A;  4DR7 L;  4HJ9 A;  1LYL A;  4DR2 L;  2YV5 A;  2H5X A;  1CKN B;  5HY6 A;  4DV2 Q;  1VQL A;  2HQL A;  1EIF A;  2UU9 L;  3S1M H;  2MFI A;  4R4I A;  1M90 C;  5IYB G;  1KC8 C;  3S2D H;  3Q8D A;  3HOW H;  1N32 Q;  4UPA A;  1NY4 A;  2AHO B;  4KHP L;  4BA1 I;  1HNW L;  5C4X G;  2YTV A;  3I4M G;  1B7Y B;  2JA5 H;  5M3F H;  1YJW A;  1EFW A;  1TWF H;  2E8G A;  4ME3 A;  1U5K A;  4DV7 Q;  4X62 Q;  4LFA L;  4NXN L;  1IYJ B;  2JA8 H;  2BH8 A;  1G29 1;  4UP7 A;  4DAY B;  3M7N A;  1EWI A;  1J6Q A;  4OWX B;  1K83 H;  1DGS A;  2JA9 A;  2VZA A;  2K14 A;  3DM3 A;  2VW9 A;  5LMU Q;  5HGQ A;  5M5X H;  1TXY A;  3OTO Q;  4B3R Q;  4X65 Q;  2JEA I;  3HOW G;  5M3M H;  3TEH B;  3RZD H;  1N33 L;  2ASB A; 
#chains in the Genus database with same CATH topology
 3OPO A;  2JA5 G;  5M3F G;  3RD4 A;  3GP7 A;  3T51 B;  3S14 H;  2BDN A;  1KNE A;  1QCB D;  1TQO A;  5BN4 A;  1ZXT A;  5M5W H;  2XNA C;  4AQY L;  4BY7 B;  4IUQ A;  3UDG A;  2JA8 G;  5EGT A;  5I6W A;  2UXD Q;  4J1M A;  3VYU A;  1YJN A;  4KD4 A;  5M3M G;  4LFB Q;  1B2T A;  1EY4 A;  2XVS A;  3LGJ A;  2Z8L A;  3EVQ A;  3ND8 A;  3NP8 A;  4IO9 A;  3M85 A;  4XT3 B;  2LSS A;  4MZ9 A;  2GVB A;  2UUA L;  4IN3 A;  2E74 C;  3I55 A;  4QF4 A;  4KKS A;  4L5R C;  3H0G G;  1O78 A;  1SYD A;  4KKT A;  4AIM A;  3M4Y A;  1EY7 A;  4J6H A;  3RLO A;  1MJC A;  4DR3 L;  4P71 A;  1CQF A;  4JI3 Q;  1U4P A;  4K8I A;  4HIK A;  1HFG A;  2F1M A;  1JMC A;  1EQV A;  1A3V A;  1U0L A;  5DM6 3;  2MUY A;  3DLL A;  1SMY C;  1EIY B;  4B3T L;  1QJO A;  1ZYR D;  2KJX A;  3QB3 A;  4GN5 A;  4EQN A;  1HNZ Q;  1SAP A;  2R92 G;  1JJC B;  1EY6 A;  2A6E C;  1SMX A;  3MEF A;  4A3M G;  1YNN C;  1SSO A;  2WAQ G;  4DXG A;  2F0G A;  3S16 H;  3FKI G;  4L8J A;  4P74 A;  2VS1 A;  3GTL H;  3NEM A;  5GAE C;  4A76 A;  3S1R B;  2CH4 A;  3MWY W;  5HUR A;  2OEO A;  4BS9 A;  4PQX A;  1S3O A;  4FVM A;  1STN A;  2HQE A;  2UUB L;  2K4K A;  4HMJ A;  3PCO B;  3FEW X;  1C9O A;  1VMP A;  2ZJQ A;  1SYG A;  4NKL A;  1TR5 A;  2CVR A;  2YU9 B;  4NMZ A;  3TP8 A;  1LO5 D;  4UAI A;  4GNX A;  4IPD A;  1S5C D;  1EEI D;  3MXU A;  3OIQ A;  4GKK Q;  1WOC A;  3X3N A;  4IFD H;  4JI8 Q;  3G71 A;  1FGB D;  3CU7 A;  3TS0 A;  1Z9F A;  4RGM A;  4U67 3;  1SFO H;  3CHB D;  3H94 A;  2L12 A;  3B6Y A;  4ALP A;  4FYD A;  2X69 A;  1D2B A;  3U58 A;  3H09 A;  4ZUI A;  1K83 B;  5ELC A;  3U9O A;  1XPR A;  2F03 A;  2H4O A;  3KDF B;  1VQO A;  3ULL A;  3RZD B;  3OWE B;  5IP9 G;  4RCO A;  1VQE A;  1WTV A;  1Y1W G;  3I4N H;  4QB4 A;  2DUD A;  4MNO A;  1YI2 A;  2B8F A;  1VQP A;  1SDF A;  1LTT D;  3CXC A;  5EJW A;  3QOJ A;  3ER0 A;  5ISR A;  4ZKC B;  2JQO A;  3S24 A;  4DGZ A;  2EJM A;  3L0O A;  4IUV A;  1SLJ A;  2EE1 A;  5FO7 B;  1O7Y A;  4NXM Q;  4OO1 I;  3BVZ A;  4IUP A;  4LF5 L;  3EQL C;  4PNY A;  3K6O A;  1LT6 D;  3PF5 A;  3A56 A;  3S1N H;  1E7Z A;  4POF A;  4WJ3 M;  4DUY L;  1PYS B;  1Y8O B;  4DUZ L;  3J81 c;  3MFG A;  1KRS A;  3HOY B;  4XQJ A;  3R8B A;  3KOJ A;  2VQE L;  1FL0 A;  1G51 A;  4DV3 L;  1VQG A;  1A62 A;  5CV7 A;  1HQR D;  3FPP A;  2VQF L;  3VDY A;  4A3I G;  3K7A B;  2A68 D;  2KOL A;  3HEJ A;  3A8J E;  4POG A;  1G91 A;  3SK5 A;  1N32 L;  1YHQ A;  3DHQ A;  1M4V A;  3M4P A;  2A74 C;  4OWT B;  2G9D A;  4JK1 C;  1Y1V B;  1O80 A;  1BBU A;  5C3X A;  2EYJ A;  3WOE A;  1LTG D;  5JOB A;  1WTX A;  2HCC A;  4JI6 Q;  1I4R A;  2ZTD A;  5HGT A;  4A3K B;  3OTO L;  5JEA H;  5C0X H;  2F3V A;  2C35 B;  4PMB A;  2I07 B;  1II3 A;  3AFP A;  3GTG B;  3ZJY C;  3J80 E;  4IFD J;  1EOV A;  3E6Z X;  3K0X A;  1I50 B;  3SK4 A;  2UXD L;  4OL7 A;  3J7Y W;  4JBM A;  2KEN A;  4A3B G;  4L5S A;  2A19 A;  3BVG A;  4LFB L;  2MQH A;  4KJO A;  2B63 G;  2VUM H;  3R2T A;  2HIX A;  1YIJ A;  2UU9 Q;  2XRQ D;  2PYK A;  3PUY A;  2AUJ D;  3VR2 A;  4GOP A;  1UE6 A;  2RCF A;  2EYH A;  2MO0 A;  2PQA A;  1LT3 D;  5C4Z A;  2NYZ D;  2E2J B;  4QIW B;  4JI3 L;  4BBS H;  4YWM A;  3MVV A;  2JYO A;  3CKI B;  1SND A;  2B2U C;  4DA2 A;  5KNC A;  3K59 A;  4NW2 A;  1B9N A;  1PVO A;  1PFS A;  1V9P A;  1GUW A;  4Z9C B;  3AMU A;  1YIT A;  1HNZ L;  4H7B A;  2NVQ H;  3NHH A;  4J15 A;  2LXK A;  3STB C;  3J80 c;  2A69 D;  4XXE A;  3F2B A;  1KIX A;  2R93 H;  2PZW A;  4DAP A;  1XXG A;  1OXU A;  5TSS A;  2B2T C;  5JVH 3;  2B2Y C;  1JOK A;  1X56 A;  1YZ6 A;  1GUN A;  4C56 C;  1JOO A;  2XTI A;  4YWL A;  2PMZ B;  1HZB A;  2B29 A;  5FLX L;  1YJ9 A;  2SOB A;  1UE1 A;  2PQA B;  2RDF A;  2HHH Q;  1J9O A;  2VXW A;  1A0I A;  3KJO A;  4CDC C;  3BVM A;  1CKM A;  2K1B A;  2EJG C;  3I73 A;  1VQJ A;  1HA5 A;  4ZCK A;  1N36 Q;  4JI8 L;  2E76 C;  1X55 A;  2MHV A;  2K5W A;  1S5B D;  2NZO A;  2AKW B;  5IYD G;  2ZXR A;  3M3Y H;  3J7A V;  4C3H H;  2I5H A;  3CCS A;  4BY1 H;  5C0X J;  4HJ7 A;  1LT5 D;  1NTG A;  4A3J G;  4JI4 Q;  1I4Q A;  1JQY D;  1RHP A;  2CFM A;  3PO3 H;  5ELN A;  4QIW E;  2EY5 A;  4BBR H;  3T1Y Q;  2D5D A;  1NSN S;  1STB A;  3WDN A;  3GTQ B;  2R7Z G;  2C9O A;  5C3E H;  1A8V A;  3UDX A;  4DV6 Q;  1RIP A;  3P7J A;  4ZRZ A;  4EQP A;  1E2V A;  4V19 0;  2AQ3 B;  5DLQ E;  2B2T A;  1QZH A;  4BY7 H;  4NPS A;  4C1N K;  3KYH C;  5FO8 B;  3FHW A;  4DV5 Q;  2F0Q A;  4QCL A;  1JWS D;  4DK6 C;  4NXM L;  3J81 i;  1E3P A;  1Q1E A;  3A5Z B;  3D4W A;  5IIF A;  1HZC A;  3MFY A;  4M8A A;  4KD3 A;  1M8A A;  3DWQ A;  1MI2 A;  3UE0 A;  5IGE A;  3HOZ B;  3H91 A;  1AZQ A;  2ZTC A;  2UXB Q;  1WD1 A;  3H3V H;  4YHH Q;  2AMC B;  2DY8 A;  1BUV T;  3CF5 A;  4C3I G;  4G7Z C;  2F52 A;  2F0F A;  1CKN A;  4R4C A;  1E2Z A;  2Y0S B;  4GZY C;  1LAC A;  3BG3 A;  3I4N B;  3G48 A;  2VY3 A;  3FPU B;  2R7D A;  5GRO A;  4PMW A;  2Q8R E;  4HJ5 A;  3A5U A;  1Q82 C;  3EN2 A;  1ASY A;  5K36 G;  1SXT A;  5KEE A;  1KDB A;  3ERQ A;  4MTN A;  3C3L A;  4JI6 L;  1GUG A;  1Y1V G;  1EY8 A;  1VQ4 A;  2AWN A;  1KL9 A;  2GA4 B;  5IWA Q;  2JP1 A;  1H9K A;  1TT2 A;  2HCI A;  1PXU A;  1EYG A;  1HUN A;  4LF9 Q;  3S1R H;  2ZTE A;  1HR0 L;  1GUO A;  1QVF A;  5CGK A;  4HIO A;  1OXX K;  4DAV A;  1VF7 A;  3LX0 A;  5D3I B;  2BCO A;  2YU9 H;  4LUO A;  1ICW A;  5C44 B;  4A3F B;  1CKN B;  1MD2 D;  2UU9 L;  1W6J A;  4R4I A;  5IYB G;  1YNJ D;  1NY4 A;  4BA1 I;  2A6H D;  4ZKB B;  1A3T A;  2XRS D;  5CV4 A;  2G9H D;  1F9P A;  1HTP A;  3I8Z A;  5EKK A;  4DV7 Q;  1CHP D;  2QKI C;  3T13 A;  3R3O A;  2B39 A;  1K83 H;  1MHW C;  1R4P B;  2K14 A;  3S9W A;  4HTH A;  4R9W A;  1BXT A;  5HGQ A;  3GTK B;  1TXY A;  3TEH B;  3RZD H;  2ASB A;  1FD7 D;  1EQQ A;  4R1J A;  4J8Q A;  3M4O B;  2ZT9 C;  1ENC A;  1PTO F;  2ALY B;  3DMU A;  4BXX H;  2XGT A;  4QJF A;  4A3L H;  1TWA B;  1X3Q A;  2Z6B A;  2NB0 A;  3TDQ A;  1IBM Q;  4GLA C;  3ERO A;  4WFN 3;  3KBX A;  5EKL A;  1Q8K A;  4HR7 B;  1JB3 A;  1PTO H;  4DR5 Q;  3GV3 A;  5JJI A;  1VDZ A;  1HR0 W;  2KCM A;  3G6E A;  4A93 B;  2EOT A;  1PDQ A;  3PUX A;  1G6P A;  3TN2 A;  3IAY A;  2L15 A;  4X64 Q;  2KCN A;  3GD7 A;  2WP8 J;  1PH7 A;  2HHH L;  1Z7T A;  1AFP A;  4OON A;  5FLM H;  4HSV A;  4RMF A;  1ASZ A;  2XSC A;  3PO2 B;  2EYP A;  3I72 A;  3K58 A;  5IY0 A;  4LF6 Q;  1N36 L;  1XMO Q;  1TWG B;  3PV0 A;  1PHJ A;  3HOY H;  2EYO A;  3E3X A;  1QUQ B;  1YHB A;  2EY6 A;  3RZO B;  5IGB A;  2E2D C;  4A3E B;  3VYS A;  3MHB A;  2LKV A;  3K7A H;  5CV5 A;  4K5X A;  1MKH A;  4JI4 L;  1PH8 A;  2C5C A;  3HRZ C;  5BR8 Q;  2B2W C;  5H1S E;  3C2P A;  1KXL A;  4KN4 C;  2CH4 W;  4KY5 A;  1I5F A;  4K5V A;  4TRD A;  4IOA A;  3T1Y L;  1A6X A;  4R8I A;  3AYH B;  5CBA E;  1GOZ A;  5ELD A;  3QR8 A;  2PNR C;  4A3K H;  1X3P A;  1ET9 A;  4DV6 L;  3CQZ B;  2OXP A;  4I7Z C;  2NVX B;  2NN6 I;  4DNR B;  1JWM D;  4AH6 A;  3AFQ A;  2SNM A;  1K8M A;  1SE3 A;  4IAL A;  3R93 A;  3GTG H;  1HA6 A;  4KV6 A;  1KQS A;  4PZ6 A;  4X6A H;  1I50 H;  3KLW A;  2BA0 A;  3OHX C;  1KDA A;  2PW7 A;  4CGY B;  2QF7 A;  3S1M B;  1YHA A;  2F0P A;  1H9S B;  3HZX A;  4DV5 L;  1VQH A;  1X32 A;  1IW7 D;  4CDD C;  3G4S A;  4K0K Q;  2YTX A;  1BNZ A;  1CSQ A;  5JJK A;  2IHE A;  2K32 A;  1GHK A;  1LM0 A;  5DAU A;  2E5L Q;  2JJQ A;  4IFD G;  2K50 A;  1HJP A;  2VQF Q;  2UXB L;  2VB2 X;  1Q81 C;  4FF1 A;  1GUS A;  3W1B A;  4YHH L;  1AP0 A;  2JK8 A;  4ZYS A;  2E2J H;  1YBY A;  2SEB D;  2TSS A;  2OQK A;  1SRO A;  2WV6 D;  3VA7 A;  5JVG 3;  2J7Z A;  2R7F A;  3Q22 A;  3TRZ A;  3V05 A;  2UUC Q;  2K75 A;  3BDC A;  3JAM i;  5DNF A;  4JI1 Q;  4DU9 A;  1HRJ A;  3MEH A;  4DN4 M;  2KHS A;  3GQB A;  2F0E A;  1V1P B;  1QIL A;  5E7N A;  1K3R A;  2NVY B;  4O42 A;  2K5Q A;  1SEB D;  3BS1 A;  5IWA L;  4A3D B;  1IHZ A;  4YCU A;  2WB1 B;  4KI0 A;  4RAU C;  1HNX Q;  4LF9 L;  2HUG A;  4HN7 A;  3PIO A;  3W3A A;  1XX8 A;  1Q12 A;  1Q3L A;  3CC2 A;  1EEF D;  1HUM A;  1S5E D;  2SDF A;  3DM1 A;  1XMQ Q;  1MSH A;  1S4Z A;  1H95 A;  4GNX C;  1IKM A;  3CW2 C;  1PTO C;  2FHT A;  3SEB A;  5FLX E;  1GD7 A;  5A35 A;  2CQA A;  5CYU A;  4DR1 Q;  5EAY A;  3E0E A;  5D65 A;  2LXJ A;  2XIW A;  2Z4I A;  2K5N A;  5LL6 S;  3LNN A;  1CZW A;  1WTP A;  4DV1 Q;  4DNT B;  2PPB C;  4ZUJ A;  5ELB A;  2R61 A;  4DV7 L;  3K57 A;  1LLR D;  1HTL D;  1TWH B;  3X3M A;  2L0C A;  1FNU A;  1B1Z A;  4NP5 A;  1TII D;  1A3U A;  4K5W A;  4RGO S;  3D6W A;  2IJ0 A;  1L0W A;  3GTQ H;  4RWS C;  2RVL A;  2A73 B;  2JSO A;  2E2H B;  2L5T A;  4K6D A;  3RN5 A;  4JPB W;  1IBM L;  3QO2 A;  1WTW A;  1U9R A;  2NN6 G;  5JEA G;  1I4P A;  5C0X G;  4ABN A;  4A3G B;  1WTR A;  5T1I A;  2RF4 A;  2A69 C;  4DR5 L;  4IJL A;  3NQT A;  3L2P A;  2ZJR A;  4DR7 Q;  1EUJ A;  4DR2 Q;  4PZ8 A;  5FLX c;  4XT1 B;  2BA1 A;  1PRT D;  1SN8 A;  2KVM A;  4X64 L;  1K28 A;  3PSI A;  1HNW Q;  2JA7 B;  4XQQ A;  2DJF C;  3U4V A;  4MTK A;  3OW2 A;  4FF3 A;  2CWP A;  2RQX A;  2LMC B;  2NBF A;  2VUM G;  3OYY A;  1NAP A;  4LFA Q;  1D1I A;  1WTQ A;  4XDX A;  4LF6 L;  2RHS B;  1XMO L;  3HOZ H;  3M9B A;  3A0J A;  3HOU B;  3HKZ B;  1N33 Q;  1FVI A;  3MTS A;  3HOX B;  1WVL A;  3I3C A;  1SYC A;  1JB7 A;  2ES2 A;  3H3V I;  2K52 A;  2PI2 A;  4DV4 Q;  2Q2T A;  5I4D A;  3D4R A;  2B3G A;  5BR8 L;  1P8L A;  1PH1 A;  4BBS G;  1V43 A;  2CWA A;  1G2S A;  1LAB A;  2L1B A;  5COY A;  4RGN A;  4IQZ A;  2IX1 A;  1QNK A;  1SYF A;  4DR4 Q;  3GDE A;  4DK0 A;  1YVC A;  3RMH A;  2AUK A;  2N49 A;  5KND A;  1Q8I A;  1S5D D;  5IGF A;  4FO2 A;  4K8J A;  4GNX B;  1PTO B;  5CC4 A;  2R93 G;  3SHL A;  5C6A A;  1OO9 B;  5C4J B;  2J0T D;  1FYC A;  2Q8I B;  3T56 B;  3NUC A;  3OSO A;  2F0S A;  2Z9H A;  3GV6 A;  3NBH A;  1VQ9 A;  4JI0 Q;  1LTI D;  3AU7 A;  5E3F A;  3AQQ A;  2Q8T A;  2IPK D;  5JJL A;  1GM5 A;  4K0K L;  1AN8 A;  1DD2 A;  4AYB B;  1RCV D;  4GOP C;  4DPG A;  3TS2 A;  4B3S Q;  5C44 H;  4A3F H;  1XTD A;  3FMC A;  2ZM6 L;  3CCL A;  4IUR A;  2K01 A;  3K5N A;  1DOK A;  2BE5 D;  2E5L L;  1B50 A;  4M1U B;  4PV1 C;  3VYR A;  3UE1 A;  2AWO A;  3BYT B;  2TMP A;  2I46 A;  4C3H G;  5C4H A;  1JJG A;  3KUP A;  4LF8 Q;  4BY1 G;  1QZG A;  1ENA A;  3U9S A;  3CCJ A;  4LFC Q;  3GTK H;  1L2F A;  1EOT A;  2UUC L;  4JI1 L;  1X3F A;  2FFK B;  3PO3 G;  4QMG A;  1NUC A;  5FK9 C;  4Y7N B;  3M4O H;  4BBR G;  3NBH B;  1F2Z A;  1JE5 A;  5JPN C;  3TP7 A;  4A3C H;  1I3Q B;  1TWA H;  1SNQ A;  5C3E G;  1BF4 A;  2PO4 A;  4P73 A;  2SNS A;  4B9W A;  2IY5 B;  2NZ1 D;  4H44 C;  4C2M B;  2X6G A;  3NWS A;  1HXY D;  2D62 A;  4OXP A;  1HR0 Q;  3HOV G;  2V1C C;  1PV4 A;  4FDB A;  1HNX L;  1TY2 A;  4JW0 A;  5GQO A;  1GJX A;  4U68 A;  1EYA A;  1A15 A;  1XNR Q;  5T1G A;  4A93 H;  2O5J C;  3PIP A;  4BY7 G;  4JBJ A;  3CPF A;  3L7Z C;  5FJ8 H;  4IUN A;  1QVG A;  3MXN A;  1XMQ L;  5FOB B;  1D7Q A;  3N52 A;  4IOC A;  2EXD A;  1XPU A;  2BDO A;  4XYO A;  4DR1 L;  1WTO A;  2EYM A;  1T9H A;  2F3I A;  3PO2 H;  3EA6 A;  1TWG H;  4KLK A;  1ZEQ X;  1PH4 A;  4AYB E;  4DV1 L;  3RZO H;  3A7A B;  4A3E H;  3PUW A;  1LTA D;  1YNJ C;  4JI7 Q;  4X3S A;  2K5V A;  4JV5 Q;  1LV9 A;  4O2D A;  2A6H C;  5CR3 A;  1Q46 A;  2HD3 A;  3I91 A;  1XPO A;  2KUM A;  1SBB B;  2KCC A;  1S40 A;  4UHV A;  4H02 A;  2EZV A;  5IOD A;  1SMY D;  1J5E Q;  4HIM A;  1F2Y A;  3CQZ H;  2A6E D;  4O1N A;  1YNN D;  5C4X H;  3P75 A;  2DGY A;  5K5P A;  4LAA A;  4HMI A;  4CDF C;  2NVX H;  2E2I B;  3TME A;  4GOP B;  4APV A;  4DR7 L;  2ICE C;  1Y8P B;  1LYL A;  4DR2 L;  2YV5 A;  2H5X A;  1VQL A;  3S1M H;  1MBY A;  1KNA A;  3S2D H;  3QWN A;  4RA8 A;  2CW0 C;  2EVB A;  4KTA A;  1HNW L;  2E75 C;  2RDH A;  1Y8N B;  4X3U A;  5I2X A;  5A2Q L;  3TP5 A;  1EFW A;  1BQQ T;  4DK1 A;  1A2U A;  4X62 Q;  4LFA L;  2F0N A;  1PZK D;  1G29 1;  4L6T B;  4CKE A;  4YIJ A;  4OWX B;  1JE4 A;  3ND9 A;  1DGS A;  2HDM A;  5LL6 X;  5LMU Q;  1ET6 A;  2JEA I;  1E0B A;  1N33 L;  3F2U A;  2L11 A;  4DV4 L;  1STG A;  1X6O A;  4IPC A;  3CCQ A;  2J4X A;  1LTS D;  4Y52 H;  3BZD B;  4WJW A;  1SJH D;  4DR4 L;  4JYA Q;  3PUV A;  1YEZ A;  1HQM C;  4GN4 B;  3U4Z A;  2NVY H;  4A3L G;  3VR3 A;  4UP9 A;  2MGS A;  3BDO A;  1O7I A;  4LF4 Q;  2JA6 B;  3TRE A;  4A3D H;  3KLS X;  4JBW A;  4CKB A;  1OTC A;  4CKC A;  1RTO A;  2YTY A;  1DJR D;  1STE A;  3E0J A;  5DEH A;  3IKJ A;  3HKS A;  3URY A;  1J8I A;  1K73 C;  1EWH A;  4N8F A;  4JI5 Q;  4JI0 L;  5I2Y A;  1SJE D;  1CK1 A;  3C1F A;  3I4L A;  4FF4 A;  1VMC A;  1SR3 A;  2PMZ E;  2AQ2 B;  2V4D A;  3HP3 A;  1VQM A;  1EY9 A;  2UXC Q;  1NCV A;  3JAM E;  1P16 A;  2EXZ A;  3P1H A;  1HFN A;  3H6M A;  4X65 L;  4B3S L;  1NNX A;  1VQI A;  5FLM G;  1V8Q A;  1TS5 A;  2B63 H;  3HOY G;  2A5H A;  4HCE A;  2CQO A;  4R4T A;  4RHS A;  4JC0 A;  4ULL A;  4K2K A;  2QIL A;  4JG2 A;  3HFZ B;  3J81 L;  1S5F D;  3OWF A;  2KBN A;  4LF8 L;  1TWH H;  2YYZ A;  2WAC A;  3PF4 A;  4LFC L;  2N88 A;  1Q86 C;  5IYC H;  5IP7 H;  4C3J B;  3G6J B;  1C7Y A;  1GO3 E;  3BJU A;  2E2H H;  4ZK9 B;  1I4X A;  1F9S A;  3MXG A;  3D3R A;  4A3K G;  3HOW B;  4A3G H;  3A55 A;  1CA5 A;  1N34 L;  2LFN A;  4RG1 A;  1WI5 A;  2JA5 B;  4OIJ A;  5L37 A;  3LWU A;  1GXD C;  1BCP D;  1XNR L;  3ONA B;  2QGQ A;  1XWE A;  2JA8 B;  2JXM B;  3A54 A;  1JWU D;  3F2D A;  2NWG A;  5KYI A;  1Q90 A;  2JA7 H;  4R8N A;  1F2L A;  4KHV A;  5M3M B;  5KIX A;  2K6A A;  4R4O A;  4OO1 H;  2EPB A;  4S3S A;  2Z6K A;  1B9M A;  4IFD I;  3S2H B;  3ZYY X;  1HH2 P;  4YY3 Q;  3HOU H;  1B53 A;  1HZA A;  2HDL A;  3EIV A;  3BDL A;  3HOX H;  1O7L A;  3IFT A;  1ICF B;  4JI7 L;  3H0G B;  4JV5 L;  3H15 A;  3E5S A;  1SNC A;  4HID A;  2F0W A;  3CME A;  3RLF A;  3J80 i;  1F77 A;  3KLR A;  5M9O A;  3GTM H;  1X54 A;  3ULP A;  2K05 A;  4DV0 Q;  2Y0S E;  5C3W A;  4A3J H;  2IHF A;  3V2T A;  5D14 A;  5JAV A;  3FP9 A;  2D2C C;  1E2W A;  3K0Y A;  1ZYR C;  5IGG A;  2P5Z X;  1J5E L;  1PFB A;  2MJ8 A;  3TBI B;  4A3M B;  2WAQ B;  3NBI A;  1B44 D;  3STB D;  1TU2 B;  4IZ8 A;  4XYQ A;  1NE3 A;  3FKI B;  5C4J H;  2GN5 A;  1VQ5 A;  3OMC A;  1TS4 A;  4DAM A;  1AH9 A;  3PIO 3;  1VQA A;  5KYL A;  3GTP B;  3CCM A;  2QCP X;  3S1Q H;  3AEV A;  3T1H Q;  1CM9 A;  3VR5 A;  3ICE A;  3BZC A;  2OT2 A;  4EQ5 A;  4LUZ A;  4X62 L;  1CFM A;  3IL8 A;  4YCV A;  5CMD A;  1K0R A;  5LMU L;  2F0H A;  1WCM H;  4ID6 A;  1VF5 C;  3CC7 A;  5IT9 E;  4TSS A;  1ROD A;  4GLV B;  4KY6 A;  2K03 A;  3A8I E;  2HIV A;  3A8K E;  5GAD C;  4F88 A;  2JE6 I;  1JT8 A;  1EQT A;  4H0L C;  3KF6 A;  3EFX D;  1JOR A;  4L63 B;  4NB3 A;  5ELO A;  1RL2 A;  2PNH A;  2F0V A;  4HAE A;  1L1O C;  2DNE A;  1CQV A;  3D0F A;  4JYA L;  3DUZ A;  1ILQ A;  4Y7N H;  1EIG A;  3CPW A;  2R6G A;  2ATW A;  1UNS A;  1Y1W B;  1I3Q H;  5C4X B;  1VQ6 A;  2DNC A;  1IYV A;  1BBW A;  3FDT A;  5C0X I;  3EJI A;  1S72 A;  2F3W A;  4V0B A;  4CBV A;  4LF4 L;  4CJ0 B;  3CP0 A;  4C2M H;  1B4O A;  1W2B A;  4QQB X;  1L0X B;  1CZG A;  1DON A;  2WAQ E;  2O5I C;  3S2D B;  1BBX C;  5M5Y H;  3I2Z A;  4JI5 L;  4LNQ A;  1I6V C;  1XYI A;  1VQ8 A;  4RGT A;  2BOS A;  5EKI A;  1B3Q A;  1PH3 A;  4X3K A;  2OCE A;  4RHR A;  3W1G A;  2FMM A;  2UXC L;  3Q0A A;  2ZM6 Q;  3S17 B;  3PMF A;  4QL5 A;  5EBD A;  3PQI A;  1I6H H;  3KF6 B;  1R9T H;  2B2V C;  3E9I A;  5LHY 1;  1AW7 A;  1QNU A;  3HOZ G;  4LUV A;  3CCV A;  2F0D A;  4JI2 Q;  1IBK Q;  4JOI A;  1VCI A;  1T5X D;  2F0I A;  1KHI A;  2K5H A;  3P20 A;  2BE5 C;  2OTJ A;  2F0T A;  1PZI D;  4QUC A;  3C46 A;  4KY7 A;  1IL2 A;  2CCZ A;  4A3I B;  2A68 C;  1GUT A;  2OTL A;  1CTM A;  1HZ9 A;  1VQN A;  1IKL A;  3JC6 6;  1PH9 A;  3M7G A;  5J1Z A;  2Y0S G;  1EZ8 A;  1F9R A;  3DEP A;  4DR6 Q;  1L1O A;  3I4N G;  1I4G A;  2N55 A;  2IWH A;  2EQS A;  1X3G A;  4A4I A;  3CCR A;  4FP5 D;  2KHI A;  2N8N A;  3HG9 A;  4OHJ A;  4DKA C;  3RNU A;  3NTI A;  2E2I H;  1K3B C;  1PYB A;  1U4M A;  2PW5 A;  4I7A A;  1CKO A;  2NVT B;  3M4Q A;  3JAM L;  5IE8 A;  3I56 A;  5EQ0 A;  4OX9 Q;  4MHE A;  3SR1 A;  1KLG D;  5I9O A;  1E24 A;  2EY1 A;  1ENF A;  1EQR A;  4A3B B;  1JC7 A;  1MIU A;  2PZT A;  1QVC A;  1KD1 C;  1ESR A;  2L55 A;  1QWY A;  1X65 A;  2DJG C;  1O7Z A;  5IOC A;  3NXW A;  1KRT A;  1CA6 A;  2B63 B;  1IXR A;  5A2Q E;  5C44 G;  4A3F G;  4HJA A;  1C4Q A;  3BZK A;  1D6E C;  2B2V A;  4K6L A;  4YY3 L;  5CV8 A;  3F1Z A;  4PG3 A;  2KCT A;  5JPM C;  1L1O B;  1RD9 D;  1D5X C;  1VQB A;  2MNA A;  1F2M A;  3F8T A;  4UDU C;  2MP1 A;  3K8A A;  2VNU D;  5E4W C;  4UY8 C;  3OOC A;  3W2D A;  4IPH A;  2CHB D;  2QA4 A;  3QJY A;  1EYC A;  2KED A;  4XTC S;  2A1A A;  5LMN W;  3MA2 B;  1QE6 A;  4DV0 L;  4X66 L;  1H9J A;  1BCP F;  5I6Y A;  3SGI A;  1K8G A;  1NR4 A;  4XIG S;  3C1E A;  5IGD A;  2WIN B;  3Q23 A;  4N8X 1;  4A3C G;  1L0Y B;  2ZXO A;  1G8Z D;  2JA6 H;  2D0P A;  4JBK A;  3NEN A;  1EL0 A;  2N3S A;  3BU2 A;  2WB1 E;  3T16 A;  4RFB A;  2GVA A;  4HED A;  4EX5 A;  4KK7 A;  4LJZ C;  2KA7 A;  2K04 A;  4A93 G;  3KDF A;  3NQI A;  4K2L A;  2FXQ A;  5FJ8 G;  5ELE A;  3PIP 3;  5J3B A;  3T1H L;  1KAB A;  2EDG A;  5AJ3 Q;  3SXH A;  1W3S A;  3PO2 G;  1WFQ A;  1LTR D;  4LWC A;  2FIN B;  5COR A;  4DAY A;  1PFN A;  1KLU D;  4NDX A;  1Y69 U;  3IFD A;  1JR0 D;  1MSG A;  1UE5 A;  4A3E G;  2QEJ C;  4DF7 A;  2ICI A;  3GTM B;  1IZ6 A;  4G7O C;  4A3J B;  1K0S A;  3J81 E;  1TVX A;  1ZKO A;  2M9V A;  1FGU A;  3J7A F;  1N8R C;  3I4M H;  2IL8 A;  4C3J H;  1X3E A;  1D5Z C;  5BN5 A;  1DOL A;  1DOM A;  2NTT A;  2X6L A;  4HJ9 A;  3ITP A;  2IW3 A;  5HY6 A;  4DV2 Q;  2HQL A;  3DXJ C;  2R7Z B;  3VR6 A;  2MFI A;  3HOW H;  2L9H A;  4UPA A;  1C48 A;  2ENB A;  5C4X G;  1B7Y B;  2JA5 H;  5M3F H;  1YJW A;  2E8G A;  3OW7 A;  4G4K A;  1U4L A;  3T53 B;  4XQN A;  3S1Q B;  2JA8 H;  4DAY B;  2MPM A;  2JA9 A;  3S15 B;  3Q24 A;  3FRP B;  4FXG C;  4B3R Q;  4X65 Q;  3SDZ A;  5M3M H;  1FNW A;  2XWJ B;  1AEX A;  1G6Z A;  5IT9 L;  2WII B;  1BO0 A;  1CT1 D;  1JJ2 A;  3S2H H;  1WCM B;  3NTH A;  1VQD A;  2RSN A;  4RKL A;  4JI2 L;  1IBK L;  3HKZ E;  5E1F A;  1A63 A;  4LF7 Q;  3GTJ H;  2QW7 A;  3H0G H;  3MAQ A;  4RCN A;  3NK9 A;  4C3I B;  1F9Q A;  4EGV A;  3NSW A;  3IRB A;  4MIU A;  3KLS A;  3RN2 A;  2IX0 A;  4DR6 L;  1KTK A;  4JVZ A;  4EVO A;  4GKJ Q;  1SRU A;  3K7U C;  1K9M C;  3K5O A;  2LY7 A;  3AB9 A;  2NTS A;  4QUF A;  3EBE A;  3N6R A;  2R92 H;  3KF8 A;  1N34 Q;  2I5M X;  4A3M H;  4JCV E;  2M2L A;  3TZD A;  2IT1 A;  5DM7 3;  4CJ1 B;  1CSP A;  5G3L D;  4A3D G;  5M5Y B;  3FKI H;  3KK7 A;  5F2D A;  1GVP A;  2WB1 G;  3NTK A;  2XWB B;  1ONL A;  1Q7Y C;  2OWO A;  2NN6 H;  2K33 A;  4RH6 A;  1SE2 A;  1EU4 A;  1A2T A;  4OX9 L;  1ESF A;  1SNO A;  2K5D A;  1D8L A;  3OMG A;  1AE3 A;  4UP8 A;  3GTP H;  1BCP C;  1VQ7 A;  4P2C B;  1I6H B;  4PZ7 A;  2EJF C;  1R9T B;  1RDP D;  1TWC B;  1PTO D;  2PI2 E;  3K5M A;  3SK6 A;  3ERS X;  2VL6 A;  3VR4 A;  1I94 Q;  4FNF A;  3NE5 B;  4QGU A;  5EBC A;  4P72 A;  1B8A A;  1H9R A;  1H9M A;  1KDC A;  4N9T A;  4TVA B;  3W5O A;  1YNX A;  4HJ8 A;  4CHT B;  2KQ3 A;  4I65 A;  3V96 A;  3L9A X;  3KF8 B;  2F0J A;  4LMQ D;  2WKD A;  1VQK A;  3CAM A;  1QB5 D;  1VS0 A;  3D6C A;  2F4V Q;  2Z4H A;  2N78 A;  2Q2H A;  4L5T A;  3GTO H;  4IPG A;  2LS0 1;  3KFU A;  5IYC G;  4E6I A;  3MXN B;  2JEB I;  5EPJ A;  3OIP A;  5IP7 G;  5IP9 H;  5KGU A;  2RBM A;  1Y1W H;  1TWF B;  3FVQ A;  2F0L A;  4YWK A;  2KHJ A;  4F87 A;  1SYE A;  4HSP A;  4F7X A;  1TS3 A;  1GHJ A;  5M5X B;  2HT1 A;  4A3G G;  1NR2 A;  4CDE C;  4R4Q A;  4KHZ A;  3S14 B;  2G5D A;  2RCN A;  5C5M A;  3K80 C;  4DXF A;  5M5W B;  2D0O A;  3Q6S A;  1XNQ Q;  4P75 A;  1DYQ A;  2RSO A;  3RR5 A;  3TQY A;  2JA7 G;  3T4A C;  3S17 H;  3HS0 C;  4LW1 A;  1PMR A;  2L4N A;  5AJ3 L;  3I7F A;  2I5L X;  1EIH A;  4A75 A;  2EYL A;  2OF1 A;  3UI2 A;  4OO1 G;  1RTN A;  2XN9 C;  1BOS A;  4K14 A;  4KJN A;  2Z1C A;  2BH2 A;  4H13 C;  1JCK B;  3HOU G;  1WTH A;  1GKH A;  3A74 A;  3HKZ G;  1CHQ D;  1E1T A;  3HOX G;  5J22 A;  4GKK L;  3LWE A;  2JN4 A;  2Z0S A;  1K8A C;  4A3I H;  4L5Q A;  4B9X A;  4B3M Q;  1I4H A;  4QY7 A;  1AZP A;  1FNV A;  5JEA J;  3D8G A;  1PA6 A;  4Q5V A;  1PRT F;  1DM0 B;  4BXX G;  4DNI A;  1BVS A;  4IUT A;  1RJT A;  2B2U A;  4DV2 L;  4Q0F A;  1WYD A;  4BWG B;  1T5E A;  1BCP B;  3QIA A;  5FO9 B;  4KN7 C;  3TP6 A;  5KRU A;  2NUC A;  3PUZ A;  1IL8 A;  1WD0 A;  1M1K C;  3S16 B;  2NVT H;  2D9U A;  4B08 A;  3PGZ A;  1G2T A;  3CCE A;  1C8C A;  3GTL B;  3HOV H;  3NPP A;  1IBL Q;  1Z47 A;  5FKA C;  1IW7 C;  3ULJ A;  2Z6K C;  3CMA A;  1NMF A;  1FJG Q;  4A3B H;  4B3R L;  2EY2 A;  2B2Y A;  4YCW A;  1C0A A;  4ZAI A;  3MZ5 A;  3CRL C;  3WWV A;  3KBG A;  3NEL A;  3GO5 A;  4AYB G;  3SK8 A;  1SE8 A;  2O4X A;  1TKW B;  4C1N I;  1CI3 M;  3VYT A;  3BYY B;  1WCM G;  4LF7 L;  5AFW A;  2Q2U A;  3RLN A;  3RUZ A;  1SFO B;  3VA5 A;  4TQU S;  5LMN Q;  1LT4 D;  1JOQ A;  1ML0 D;  3SE0 A;  3I4M B;  1RKN A;  3WOF A;  2ZXP A;  1D1K A;  1OXT A;  3J7A 5;  4KHP Q;  1BDO A;  1OXV A;  4GKJ L;  1VQF A;  2PQE A;  3I70 A;  4WJ4 A;  1TY0 A;  1KAA A;  2M00 A;  5GAH C;  3D31 A;  4N9P A;  1OXS C;  4NXN Q;  2ID0 A;  1EU3 A;  1EYD A;  5M3F B;  4TKO B;  4HCS A;  2KEC A;  1DXM A;  2AQ1 B;  2RKS A;  1PYW D;  3JAM c;  1EY0 A;  1HPC A;  2EYF A;  4OEM B;  5J39 A;  2VB3 X;  3SVM A;  2NZH A;  4G7H C;  4ME5 A;  4OWW B;  1PFM A;  4AQY Q;  1LUZ A;  2WFW A;  5CV9 A;  3KJP A;  2DY7 A;  5EPL A;  4GN3 B;  1EZ6 A;  5ELF A;  3I90 A;  1I94 L;  2RHQ B;  2IX3 A;  3S1N B;  4WRD A;  5JJZ A;  3GTJ B;  1WJJ A;  2UUA Q;  3MXP A;  1PH5 A;  1EFI D;  1PZJ D;  1QOH A;  1PLF A;  5IYD H;  1X9N A;  1UWV A;  4DFA A;  1B70 B;  1VQC A;  4X66 Q;  1RF2 D;  1UEA B;  2F4V L;  1R4Q B;  4DR3 Q;  4BA2 I;  5G3L F;  1XTC D;  2H1E A;  1W6K A;  1Z6H A;  5GAG C;  5D3D A;  2R92 B;  3UDF A;  1STY A;  2F0U A;  4IUU A;  2F4I A;  4B3T Q;  1N9W A;  3TZU A;  2R7Z H;  2ZJP A;  3DWA A;  4KKU A;  1UEB A;  2Q2I A;  1QUQ A;  1MGS A;  2B8G A;  1PH2 A;  1IYU A;  2CKZ B;  1NJI C;  1BR9 A;  3J80 L;  2PZU A;  1EWC A;  4IJH A;  2R3Z A;  1UUP A;  1STA A;  1DCZ A;  1MJE A;  3U50 C;  3CCU A;  3J7Z C;  1Y14 B;  1XNQ L;  3S15 H;  1PRT C;  5NUC A;  3TSS A;  4F8M A;  3D4D A;  5CBE E;  3J81 j;  2UUB Q;  2CW0 D;  5IGC A;  4ODG A;  1Q1B A;  2K28 A;  4FF2 A;  2EIF A;  1XJV A;  4JOI C;  1V1Q A;  4O0A A;  1B3A A;  1NBW A;  2VUM B;  3K81 C;  2OQ0 A;  5EPK A;  3L3O C;  1BKB A;  3A7L A;  1STH A;  3DWP A;  2QEX A;  4OEL B;  1AE2 A;  4RKB A;  4C3I H;  1H9S A;  3GTO B;  4MN3 A;  2F0O A;  1LTL A;  5BN3 A;  4B3M L;  1U4R A;  2I0Q A;  4BBS B;  1UE7 A;  4G57 A;  2DN8 A;  2O2L D;  1FR3 A;  1HCZ A;  4PMC A;  4CJ2 C;  3K5L A;  1D5M C;  1E22 A;  4DK3 C;  3H3V C;  1SNM A;  4ZQ3 A;  1CUK A;  5K36 H;  1UAP A;  2NVQ B;  2WKC A;  1Y1V H;  4OIK A;  2JA6 G;  2K7V A;  2R93 B;  3O13 A;  4EQO A;  2RA4 A;  2RDG A;  1KAW A;  3DEO A;  4ILW A;  1NMG A;  4KMU C;  4GLX A;  2MO1 A;  3E9H A;  2A8V A;  1SYB A;  3UDI A;  1IBL L;  3QOL A;  3MC0 B;  3R2I A;  2F0K A;  1SNP A;  3HGB A;  1FJG L;  4FXD A;  3I4O A;  1TWC H;  4WOR A;  5IT9 c;  3CD6 A;  1V1P A;  4LF5 Q;  2QDL A;  2FMC A;  1JIC A;  3CC4 A;  4GS3 A;  2KEE A;  4DUY Q;  1E1O A;  4LK1 C;  4DUZ Q;  5IYB H;  4FXK C;  1ILP A;  5I9P A;  2VQE Q;  1LTB D;  3F2C A;  1PH6 A;  3M3Y B;  5LMN L;  4DV3 Q;  4X3T A;  4C3H B;  5E4X A;  4BY1 B;  1DZ1 A;  1EIF A;  2F0M A;  1M90 C;  1KC8 C;  3Q8D A;  1N32 Q;  2FJ2 A;  4KHP L;  2AHO B;  4ZLT F;  2PCF B;  2YTV A;  3I4M G;  4C3J G;  3PO3 B;  1EY5 A;  2QDB A;  1QG7 A;  1TWF H;  2B2W A;  3QG1 A;  1V1O A;  4ME3 A;  4BBR B;  1U5K A;  3CRK C;  3G7L A;  4NXN L;  1IYJ B;  3M7N A;  2BH8 A;  4UP7 A;  1PRT B;  1EWI A;  1J6Q A;  4OGQ C;  5C3E B;  2VZA A;  3DM3 A;  3NWT A;  2VW9 A;  5M5X H;  3OTO Q;  1HHV A;  3HOW G;  1SE4 A;  1TS2 A;  5C5L A;  1K8O A;  3HOV B;  5CV6 A;  5KNB A; 
#chains in the Genus database with same CATH homology
 2JA5 G;  1EQQ A;  4R1J A;  5M3F G;  3S14 H;  1JJ2 A;  2ALY B;  3S2H H;  4DV4 L;  5M5W H;  2XGT A;  1X6O A;  4BXX H;  4AQY L;  4QJF A;  4A3L H;  3UDG A;  2JA8 G;  4IPC A;  2UXD Q;  3CCQ A;  1YJN A;  1VQD A;  1IBM Q;  1IBK L;  4JI2 L;  4Y52 H;  4GLA C;  3HKZ E;  1A63 A;  4LF7 Q;  5M3M G;  4JYA Q;  3GTJ H;  4DR4 L;  3H0G H;  4LFB Q;  1Q8K A;  4DR5 Q;  3LGJ A;  3PUV A;  5JJI A;  1HR0 W;  1YEZ A;  2KCM A;  4GN4 B;  3U4Z A;  3G6E A;  4IO9 A;  2NVY H;  3M85 A;  2LSS A;  4MZ9 A;  3IRB A;  4A3L G;  2GVB A;  3PUX A;  4UP9 A;  1G6P A;  2L15 A;  1O7I A;  3RN2 A;  4LF4 Q;  4X64 Q;  2IX0 A;  3GD7 A;  3TRE A;  2UUA L;  4DR6 L;  4JBW A;  4A3D H;  2WP8 J;  1OTC A;  4GKJ Q;  1SRU A;  3K7U C;  1PH7 A;  1K9M C;  2HHH L;  3I55 A;  4L5R C;  3H0G G;  2YTY A;  3HKS A;  4OON A;  4AIM A;  1K73 C;  3EBE A;  5FLM H;  4JI5 Q;  4RMF A;  3RLO A;  1ASZ A;  1MJC A;  4JI0 L;  2R92 H;  4DR3 L;  4P71 A;  1N34 Q;  5IY0 A;  2I5M X;  4JI3 Q;  4A3M H;  4LF6 Q;  4JCV E;  1XMO Q;  1N36 L;  2IT1 A;  1SR3 A;  2PMZ E;  3PV0 A;  1CSP A;  4HIK A;  1VQM A;  1PHJ A;  3HOY H;  1QUQ B;  1YHB A;  1JMC A;  4A3D G;  3FKI H;  2UXC Q;  3S15 H;  1GVP A;  2WB1 G;  1P16 A;  1U0L A;  1Q7Y C;  2OWO A;  3DLL A;  1EIY B;  4B3T L;  4B3S L;  4X65 L;  3K7A H;  4GN5 A;  1HNZ Q;  1VQI A;  4OX9 L;  1MKH A;  5FLM G;  4JI4 L;  1PH8 A;  2R92 G;  1JJC B;  1D8L A;  5BR8 Q;  1AE3 A;  3MEF A;  1SMX A;  4UP8 A;  5H1S E;  2WAQ G;  4A3M G;  2B63 H;  3GTP H;  1VQ7 A;  1KXL A;  4PZ7 A;  3HOY G;  2CQO A;  4R4T A;  3S16 H;  3FKI G;  1I5F A;  4JC0 A;  2PI2 E;  4P74 A;  3T1Y L;  4JG2 A;  3ERS X;  2VL6 A;  1I94 Q;  2VS1 A;  3HFZ B;  4IOA A;  3GTL H;  3AYH B;  3NEM A;  5GAE C;  4LF8 L;  2KBN A;  4A76 A;  1TWH H;  4QGU A;  2YYZ A;  3PF4 A;  4LFC L;  4A3K H;  4DV6 L;  1S3O A;  1Q86 C;  5IYC H;  4P72 A;  1B8A A;  2UUB L;  4TVA B;  2K4K A;  5IP7 H;  3W5O A;  3PCO B;  1YNX A;  2NN6 I;  4HJ8 A;  4AH6 A;  3AFQ A;  1C9O A;  1C7Y A;  3GTG H;  2ZJQ A;  1KQS A;  3KF8 B;  4PZ6 A;  1I50 H;  1VQK A;  4X6A H;  3CAM A;  3KLW A;  2BA0 A;  1GO3 E;  1VS0 A;  3BJU A;  4GNX A;  2F4V Q;  4IPD A;  2E2H H;  1YHA A;  2N78 A;  4GKK Q;  1WOC A;  2Q2H A;  4DV5 L;  4JI8 Q;  4L5T A;  3G71 A;  1VQH A;  4IPG A;  4A3K G;  3GTO H;  3KFU A;  3TS0 A;  5IYC G;  3G4S A;  4A3G H;  5IP7 G;  1Z9F A;  2JEB I;  3MXN B;  1N34 L;  4K0K Q;  4RG1 A;  5IP9 H;  1WI5 A;  1SFO H;  2YTX A;  1Y1W H;  1CSQ A;  5JJK A;  2IHE A;  1XNR L;  2QGQ A;  3B6Y A;  4YWK A;  4ALP A;  2KHJ A;  1LM0 A;  3U58 A;  2E5L Q;  3F2D A;  1XPR A;  2JJQ A;  4IFD G;  2K50 A;  3KDF B;  1VQO A;  1HJP A;  2JA7 H;  2HT1 A;  2VQF Q;  3ULL A;  2UXB L;  4A3G G;  1Q81 C;  4R4O A;  3W1B A;  5IP9 G;  4YHH L;  1VQE A;  2JK8 A;  4R4Q A;  4KHZ A;  2E2J H;  1Y1W G;  2Z6K A;  2RCN A;  3I4N H;  1YBY A;  3K80 C;  4IFD I;  2DUD A;  2OQK A;  4MNO A;  1HH2 P;  1SRO A;  2D0O A;  4YY3 Q;  1XNQ Q;  4P75 A;  1YI2 A;  3EIV A;  1HZA A;  2R7F A;  3HOU H;  1VQP A;  3RR5 A;  3TRZ A;  2UUC Q;  3TQY A;  2K75 A;  3JAM i;  2JA7 G;  4JI1 Q;  3CXC A;  3HOX H;  3S17 H;  3ER0 A;  4LW1 A;  4JI7 L;  5AJ3 L;  3I7F A;  2I5L X;  4A75 A;  4JV5 L;  2JQO A;  3S24 A;  3H15 A;  4OO1 G;  3L0O A;  5E7N A;  1SLJ A;  4HID A;  3CME A;  1K3R A;  3RLF A;  3J80 i;  2BH2 A;  3GTM H;  3HOU G;  1X54 A;  1GKH A;  3ULP A;  3A74 A;  3HKZ G;  4DV0 Q;  2Y0S E;  4NXM Q;  5IWA L;  4OO1 I;  4A3J H;  2IHF A;  1E1T A;  3HOX G;  4YCU A;  4KI0 A;  4LF5 L;  4GKK L;  3FP9 A;  1HNX Q;  4LF9 L;  2Z0S A;  1K8A C;  4A3I H;  3PF5 A;  1J5E L;  4L5Q A;  3PIO A;  3S1N H;  1E7Z A;  4POF A;  4WJ3 M;  4DUY L;  1PYS B;  4DUZ L;  1Q12 A;  3J81 c;  4B3M Q;  3CC2 A;  4QY7 A;  1XMQ Q;  1KRS A;  3STB D;  1H95 A;  4GNX C;  5JEA J;  3KOJ A;  1PA6 A;  3CW2 C;  4BXX G;  2VQE L;  1NE3 A;  1BVS A;  4DNI A;  5C4J H;  1GD7 A;  1FL0 A;  1G51 A;  2GN5 A;  1VQ5 A;  4DV3 L;  1VQG A;  4DR1 Q;  5EAY A;  1A62 A;  3E0E A;  2VQF L;  3VDY A;  4DAM A;  4A3I G;  2LXJ A;  1AH9 A;  4DV2 L;  1WYD A;  4POG A;  2K5N A;  1VQA A;  3CCM A;  1N32 L;  4DV1 Q;  3S1Q H;  1YHQ A;  3AEV A;  3T1H Q;  3M4P A;  3PUZ A;  4OWT B;  1M1K C;  3ICE A;  3BZC A;  2NVT H;  4EQ5 A;  4LUZ A;  3PGZ A;  4DV7 L;  3CCE A;  4X62 L;  3HOV H;  1IBL Q;  1BBU A;  1Z47 A;  4YCV A;  1K0R A;  5LMU L;  3ULJ A;  4JI6 Q;  2Z6K C;  2ZTD A;  3CMA A;  1NMF A;  3OTO L;  1FJG Q;  4A3B H;  1WCM H;  2C35 B;  4YCW A;  3CC7 A;  4B3R L;  1C0A A;  4GLV B;  3WWV A;  3NEL A;  3AFP A;  2HIV A;  3GO5 A;  1L0W A;  4AYB G;  3GTQ H;  5GAD C;  3ZJY C;  4IFD J;  2JE6 I;  1EOV A;  3K0X A;  1JT8 A;  1SE8 A;  3KF6 A;  2UXD L;  4JBM A;  4NB3 A;  5ELO A;  1RL2 A;  2KEN A;  2PNH A;  3RN5 A;  1IBM L;  2NN6 G;  1L1O C;  5JEA G;  5C0X G;  4A3B G;  1WCM G;  2A19 A;  4L5S A;  2Q2U A;  3D0F A;  4LF7 L;  4JYA L;  3RLN A;  4Y7N H;  3CPW A;  2R6G A;  2MQH A;  4LFB L;  2RF4 A;  2ATW A;  4DR5 L;  4IJL A;  4TQU S;  5LMN Q;  2B63 G;  3L2P A;  2ZJR A;  2VUM H;  2HIX A;  1EUJ A;  1I3Q H;  1YIJ A;  4DR7 Q;  4DR2 Q;  1VQ6 A;  2UU9 Q;  1BBW A;  4PZ8 A;  5FLX c;  5C0X I;  3PUY A;  1S72 A;  2BA1 A;  1SN8 A;  4LF4 L;  1OXT A;  3CP0 A;  4C2M H;  4X64 L;  1UE6 A;  4GOP A;  3PSI A;  1W2B A;  1OXV A;  3J7A 5;  4GKJ L;  4KHP Q;  1VQF A;  4QQB X;  1HNW Q;  3U4V A;  2MO0 A;  3OW2 A;  5GAH C;  4WJ4 A;  2PQA A;  2WAQ E;  2CWP A;  3D31 A;  5M5Y H;  3I2Z A;  4JI5 L;  2VUM G;  4LNQ A;  1OXS C;  3OYY A;  4LFA Q;  1VQ8 A;  4NXN Q;  1PH3 A;  4JI3 L;  2ID0 A;  2OCE A;  4YWM A;  4LF6 L;  2RHS B;  1XMO L;  4BBS H;  3HOZ H;  3W1G A;  3M9B A;  3A0J A;  2UXC L;  1N33 Q;  1FVI A;  2ZM6 Q;  3JAM c;  4QL5 A;  1JB7 A;  1PVO A;  1PFS A;  1I6H H;  1V9P A;  3KF6 B;  2ES2 A;  2NZH A;  1R9T H;  2K52 A;  2PI2 A;  3H3V I;  4DV4 Q;  1YIT A;  1HNZ L;  2Q2T A;  4OWW B;  3E9I A;  2NVQ H;  4AQY Q;  1LUZ A;  2B3G A;  5BR8 L;  1P8L A;  2WFW A;  4J15 A;  1PH1 A;  4BBS G;  3KJP A;  2LXK A;  3STB C;  3J80 c;  4LUV A;  3CCV A;  3HOZ G;  1V43 A;  2CWA A;  4JI2 Q;  4JOI A;  3F2B A;  1VCI A;  1KIX A;  1IBK Q;  2R93 H;  4GN3 B;  1KHI A;  2K5H A;  2OTJ A;  2IX1 A;  4DR4 Q;  3GDE A;  1OXU A;  1I94 L;  2RHQ B;  1YVC A;  1IL2 A;  2CCZ A;  1X56 A;  1YZ6 A;  2N49 A;  2OTL A;  1VQN A;  1HZ9 A;  3JC6 6;  1PH9 A;  2XTI A;  4YWL A;  4GNX B;  1HZB A;  2B29 A;  1WJJ A;  2Y0S G;  1YJ9 A;  2UUA Q;  1PH5 A;  4DR6 Q;  1UE1 A;  2PQA B;  1L1O A;  3I4N G;  2R93 G;  2HHH Q;  5IYD H;  1X9N A;  1A0I A;  1UWV A;  3KJO A;  1B70 B;  2EQS A;  1X3G A;  4A4I A;  1VQC A;  4X66 Q;  3CCR A;  1CKM A;  2F4V L;  4JI0 Q;  1VQ9 A;  2KHI A;  2N8N A;  4DR3 Q;  4DKA C;  4BA2 I;  3RNU A;  1VQJ A;  1N36 Q;  4JI8 L;  3AQQ A;  1X55 A;  5JJL A;  2E2I H;  1PYB A;  2NZO A;  5GAG C;  1GM5 A;  4K0K L;  2AKW B;  3UDF A;  5IYD G;  1CKO A;  3M3Y H;  3M4Q A;  4GOP C;  4C3H H;  4DPG A;  4B3T Q;  3TS2 A;  4B3S Q;  5IE8 A;  5C44 H;  3I56 A;  4A3F H;  1N9W A;  1XTD A;  2I5H A;  5C0X J;  2ZM6 L;  3CCS A;  4HJ7 A;  3CCL A;  4BY1 H;  4OX9 Q;  2R7Z H;  2ZJP A;  4JI4 Q;  1NTG A;  4A3J G;  1UEB A;  2Q2I A;  1QUQ A;  2E5L L;  1PH2 A;  2CKZ B;  1NJI C;  1E24 A;  1EQR A;  2CFM A;  3PO3 H;  1MIU A;  3UE1 A;  5ELN A;  1QVC A;  1KD1 C;  4IJH A;  2AWO A;  4QIW E;  4BBR H;  3T1Y Q;  1X65 A;  1KRT A;  1MJE A;  3U50 C;  1IXR A;  5C44 G;  1JJG A;  4A3F G;  4LF8 Q;  4BY1 G;  3CCU A;  4HJA A;  5C3E H;  3BZK A;  1QZG A;  2R7Z G;  3J7Z C;  4YY3 L;  1Y14 B;  3F1Z A;  1XNQ L;  3GTK H;  4PG3 A;  2KCT A;  3CCJ A;  4LFC Q;  1L1O B;  1A8V A;  1L2F A;  3UDX A;  4DV6 Q;  2UUC L;  1RIP A;  1VQB A;  3J81 j;  2MNA A;  2UUB Q;  3F8T A;  1X3F A;  4JI1 L;  3PO3 G;  3K8A A;  2VNU D;  1Q1B A;  4UY8 C;  3M4O H;  2EIF A;  4BBR G;  1XJV A;  3NBH B;  4IPH A;  4JOI C;  1V1Q A;  1JE5 A;  4O0A A;  5DLQ E;  2QA4 A;  1NBW A;  1QZH A;  4BY7 H;  3K81 C;  4NPS A;  1TWA H;  4A3C H;  4XTC S;  2A1A A;  3KYH C;  5C3E G;  2OQ0 A;  4P73 A;  5LMN W;  3FHW A;  4DV5 Q;  2IY5 B;  4DV0 L;  4X66 L;  1BKB A;  4DK6 C;  4NXM L;  3J81 i;  2QEX A;  1E3P A;  1Q1E A;  3A5Z B;  4OXP A;  2D62 A;  1HR0 Q;  3HOV G;  3SGI A;  2V1C C;  1HZC A;  4FDB A;  1PV4 A;  1HNX L;  5GQO A;  1K8G A;  4XIG S;  1AE2 A;  4C3I H;  1XNR Q;  4A93 H;  1LTL A;  3PIP A;  4BY7 G;  4JBJ A;  3CPF A;  4A3C G;  3L7Z C;  5FJ8 H;  4B3M L;  3UE0 A;  1QVG A;  2I0Q A;  1UE7 A;  1XMQ L;  2JA6 H;  2D0P A;  1D7Q A;  2ZTC A;  2UXB Q;  4JBK A;  3NEN A;  4IOC A;  2EXD A;  3H3V H;  2N3S A;  1E22 A;  3BU2 A;  4YHH Q;  2WB1 E;  1XPU A;  2AMC B;  2GVA A;  4EX5 A;  4DK3 C;  4DR1 L;  1T9H A;  2F3I A;  3CF5 A;  1CUK A;  3PO2 H;  4A93 G;  2F52 A;  3KDF A;  2FXQ A;  5FJ8 G;  1TWG H;  1CKN A;  1Y1V H;  4KLK A;  4R4C A;  4AYB E;  4DV1 L;  1PH4 A;  5J3B A;  2JA6 G;  3RZO H;  3T1H L;  4A3E H;  3G48 A;  3PUW A;  2VY3 A;  1KAW A;  4JI7 Q;  5AJ3 Q;  2R7D A;  1NMG A;  2K5V A;  5GRO A;  4GLX A;  2MO1 A;  3E9H A;  4O2D A;  4PMW A;  2A8V A;  4JV5 Q;  1W3S A;  3UDI A;  4HJ5 A;  3A5U A;  1Q82 C;  1Q46 A;  3EN2 A;  1IBL L;  1WFQ A;  1ASY A;  3PO2 G;  5K36 G;  4MTN A;  4LWC A;  4JI6 L;  1Y1V G;  1FJG L;  1VQ4 A;  1XPO A;  2AWN A;  1KL9 A;  1TWC H;  3I4O A;  5IT9 c;  3CD6 A;  5IWA Q;  1UE5 A;  4A3E G;  4LF5 Q;  1S40 A;  1EYG A;  4LF9 Q;  4H02 A;  1J5E Q;  3S1R H;  1IZ6 A;  4GS3 A;  4HIM A;  2ZTE A;  1HR0 L;  3CC4 A;  4DUY Q;  1E1O A;  4DUZ Q;  5IYB H;  1QVF A;  4HIO A;  1FGU A;  3CQZ H;  1OXX K;  5C4X H;  2DGY A;  1N8R C;  2NVX H;  3I4M H;  4C3J H;  1X3E A;  2VQE Q;  4GOP B;  3F2C A;  1PH6 A;  4APV A;  5LMN L;  4DV3 Q;  2YU9 H;  4LUO A;  4DR7 L;  4HJ9 A;  1LYL A;  4DR2 L;  2YV5 A;  2H5X A;  1CKN B;  5HY6 A;  4DV2 Q;  1VQL A;  2HQL A;  1EIF A;  2UU9 L;  3S1M H;  2MFI A;  4R4I A;  1M90 C;  5IYB G;  1KC8 C;  3S2D H;  3Q8D A;  3HOW H;  1N32 Q;  4UPA A;  1NY4 A;  2AHO B;  4KHP L;  4BA1 I;  1HNW L;  5C4X G;  2YTV A;  3I4M G;  1B7Y B;  2JA5 H;  5M3F H;  1YJW A;  1EFW A;  1TWF H;  2E8G A;  4ME3 A;  1U5K A;  4DV7 Q;  4X62 Q;  4LFA L;  4NXN L;  1IYJ B;  2JA8 H;  2BH8 A;  1G29 1;  4UP7 A;  4DAY B;  3M7N A;  1EWI A;  1J6Q A;  4OWX B;  1K83 H;  1DGS A;  2JA9 A;  2VZA A;  2K14 A;  3DM3 A;  2VW9 A;  5LMU Q;  5HGQ A;  5M5X H;  1TXY A;  3OTO Q;  4B3R Q;  4X65 Q;  2JEA I;  3HOW G;  5M3M H;  3TEH B;  3RZD H;  1N33 L;  2ASB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...