3SVMA

Human mpp8 - human dnmt3ak47me2 peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
EDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MPP8 mediates the interactions between DNA methyltransferase Dnmt3a and H3K9 methyltransferase GLP/G9a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords M-phase phosphoprotein 8
total genus 13
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3svmA00
1B3AA 1HA6A 2B2YC 1RHPA 1WD1A 1DOLA 1PFMA 3KBXA 4IURA 4R8IA 4UAIA 2L4NA 2K04A 1X3QA 4IUVA 1HHVA 4HSVA 1WTQA 2B2WA 2RA4A 1QG7A 1SDFA 3H91A 1CA5A 3I90A 2NWGA 1F2LA 1PDQA 1ICWA 2B2WC 4NW2A 1ML0D 1WTRA 2B2VC 5EPJA 3R93A 4IUPA 2HUGA 4HCSA 4LMQD 2K1BA 3QO2A 4MHEA 1WTVA 2HCIA 2B2UC 1BO0A 1G91A 2EOTA 1A15A 4QUCA 5EKIA 5JJZA 4X3SA 3IL8A 1SAPA 1U4MA 2FFKB 1HRJA 1EOTA 1G2TA 1F9RA 2D9UA 1TVXA 2HDLA 1HFNA 2N55A 1HUNA 1SSOA 4RWSC 4IUUA 2MJ8A 4ZKCB 4HAEA 4IUQA 4QUFA 5CMDA 2KOLA 1IKLA 1DOKA 1B50A 4XT1B 4ZK9B 1ESRA 5T1GA 1B2TA 2NYZD 2L1BA 1JE4A 5EQ0A 1IL8A 1MSGA 1F9QA 5DNFA 4CJ2C 5EPKA 1CA6A 1GUWA 1RTNA 2MGSA 1DOMA 1M8AA 5AFWA 1C8CA 2J7ZA 2NZ1D 4OIKA 4O42A 1QE6A 2KVMA 1AZQA 3DM1A 1CM9A 1U4RA 2MPMA 5EPLA 4X3TA 2HCCA 5T1IA 3D6WA 5D65A 4DN4M 1RODA 5CBAE 1KNAA 2BDNA 2Q8RE 3N52A 4RA8A 3MTSA 5E4XA 1WTWA 1HUMA 2B2TA 3SVMA 4OIJA 3F2UA 2B2UA 2X69A 3HP3A 1X3PA 1E0BA 2SDFA 3Q6SA 1WTOA 1PLFA 1U4LA 2L9HA 2X6GA 4ZKBB 2RSNA 3TZDA 3I8ZA 2MP1A 2IL8A 1JICA 2N88A 3FPUB 2K28A 2KUMA 2H1EA 3P7JA 1G2SA 3GV6A 1WVLA 2KEEA 3TN2A 1O7ZA 1U4PA 3DEPA 1AZPA 2L12A 1IKMA 3KUPA 4IUTA 1DONA 1QNKA 1VMPA 2FMMA 1RJTA 1LV9A 1DZ1A 1BF4A 2KEDA 1ILQA 4CJ0B 1EQTA 1F9PA 3GV3A 2JYOA 4ZAIA 1ILPA 1MI2A 2K01A 1Q3LA 1B53A 2M2LA 1AP0A 4XT3B 4CJ1B 1EL0A 2B2YA 1O7YA 1S4ZA 2EPBA 1NR2A 2EE1A 4X3UA 5COYA 4MN3A 1WTPA 5CBEE 5E4WC 2HDMA 1X32A 2RSOA 1PFBA 2K05A 1NCVA 3MWYW 3I91A 1BBXC 1MGSA 1MSHA 2K03A 4ZLTF 1RTOA 1XX8A 2R3ZA 3FDTA 4HEDA 2DY7A 2B2TC 4X3KA 5CORA 2XIWA 5EJWA 1KNEA 2RVLA 1EIGA 2B2VA 1EIHA 3LWEA 1O80A 4RAUC 1B4OA 2JP1A 1PFNA 2VXWA 1XYIA 3UI2A 4U68A 2FJ2A 5D14A 1HFGA 2DY8A 3IFDA 1F9SA 3DEOA 4XDXA 1WD0A 1BNZA 2KECA 2CVRA 2FHTA 3ONAB 2FINB 1NR4A 1VMCA 2Q8TA 1ZXTA 1WTXA 1J9OA 2L11A 1NAPA 3I3CA 1J8IA 3G7LA 1G6ZA 2X6LA 4R9WA
chains in the Genus database with same CATH superfamily
5FLXc 1HZAA 4LFAL 4UAIA 5C3XA 5KYLA 4JOIC 3FVQA 2RCFA 3I4MH 2F0LA 2NWGA 1SR3A 1FJGQ 1FYCA 3K7AB 4K5VA 2R61A 4B3ML 2KCTA 3UDXA 1J6QA 4A3FG 3J80E 2HUGA 2K1BA 4IPCA 4MHEA 1X54A 3A54A 1I3QH 5L37A 4C3IH 3PUVA 4QUCA 1JQYD 4LFCQ 1TWCB 4RHRA 2HDLA 5M3FG 1IW7D 3HOVB 4OO1G 3M4QA 5LMNW 4C1NI 1XNQQ 1B50A 2IHEA 4C3HB 4DR6Q 4C3JG 1TIID 1WFQA 3JC66 4BBRG 4ZQ3A 2LMCB 1E7ZA 3TREA 5C3EG 5E1FA 2ZM6L 1D6EC 5HGTA 4QY7A 2UXCL 1C8CA 3KK7A 3CXCA 4K0KL 1H9JA 4DK6C 1CI3M 2F0IA 3Q8DA 4XQNA 2JN4A 4R8NA 1ICFB 1CUKA 1HJPA 1CFMA 1SYFA 2QA4A 2SDFA 3OIQA 4JI0Q 4DV4Q 5M5XB 4KV6A 2RQXA 2EIFA 2N3SA 2PW7A 2UXBL 3ULLA 1IBLQ 4NXMQ 3H15A 1YI2A 3I73A 3G6EA 4HJAA 4LF4L 3PCOB 1L0WA 2I07B 5KGUA 4CJ0B 4H02A 1N34Q 1BVSA 4YWKA 1I50B 1HNXL 2Z4IA 3IAYA 3UE1A 2F3VA 5CBEE 4IFDH 3E3XA 3VA7A 4OO1I 1IBLL 1LM0A 2R92B 3BU2A 2AUKA 1EIGA 2UUCQ 1H9SA 4X65Q 1EY6A 2JP1A 2JK8A 2QILA 2FJ2A 5D14A 2DY8A 1WD0A 4PG3A 4XDXA 1SNOA 2FINB 1R4PB 1BUVT 3SEBA 4CDFC 2VY3A 1DCZA 3RN2A 1B3AA 5A35A 4R8IA 4A93B 4WRDA 2K04A 1TS5A 1J5EQ 5CC4A 5BN4A 3H6MA 1E3PA 1EY8A 1ICWA 2JA9A 2F4IA 5JPMC 3NEMA 2B2VC 2F0KA 4DV2Q 2R92H 5IIFA 4IPGA 2E8GA 4JYAL 5C44G 5JJZA 5ELOA 3U4ZA 2C35B 5IT9c 5LMNL 3X3NA 1OO9B 1V1QA 5C4JH 3ZJYC 3Q23A 3S17B 4F7XA 3F2DA 1BOSA 1V8QA 3VYSA 4ILWA 1HUNA 1XMQL 1GOZA 5FKAC 1GM5A 4CDCC 2NN6H 1STEA 5LL6S 2VUMB 1NE3A 1VQGA 3G71A 1D7QA 1I5FA 4JYAQ 4WJWA 2UU9L 1VQ6A 1WCMB 3I4NG 2PW5A 4Y7NB 2F0UA 5LHY1 1B44D 3M4YA 4JC0A 2BOSA 3DHQA 3S15H 4Z9CB 1VQ9A 1STGA 2IX3A 1Q8IA 4L5RC 3OOCA 5J1ZA 2EXZA 2CH4A 4A3KH 2CW0D 1KRTA 5CR3A 4KD4A 3FKIH 5M5WB 4UHVA 1O7IA 1HNXQ 1SE3A 2YU9B 2E2JH 3STBD 2B63H 3AB9A 3MVVA 4KD3A 4KKSA 5IP9G 4CKCA 3K57A 3C46A 5K36H 4GN3B 1GO3E 2F0DA 1Y8NB 4A3FB 3BVGA 4GOPA 1TWHB 1HR0Q 3QG1A 1XWEA 5JJKA 4DV0L 1IBMQ 1LT5D 2AQ1B 3NUCA 2RCNA 4HJ9A 1B53A 4PQXA 5C4HA 1AFPA 2WB1E 3CPFA 2EE1A 1IHZA 3R2IA 1UEBA 2KHJA 4L6TB 1X9NA 3K58A 2IX1A 2K50A 5IP7H 4N8X1 1Y1WH 3GTGH 5ELFA 2MNAA 1JWSD 2IWHA 2VQFL 3OHXC 2JA5H 1GD7A 4OWTB 2LKVA 2F0PA 3EBEA 2H4OA 4YCUA 2JSOA 2A8VA 4H44C 4B3SQ 2PQAB 3J81E 4OHJA 2O5IC 1N32L 2F0JA 4QIWB 4A3MG 3TP5A 3H91A 2NVYH 4JI8Q 4DR3L 2F0GA 3R93A 1JOKA 1EWIA 2HCIA 1YJ9A 3GTKH 2B29A 2G9HD 1TY2A 3ULPA 1FGUA 2N8NA 4L5QA 2K5QA 1L1OA 2RF4A 4KY7A 3PUYA 1TVXA 2WFWA 5JPNC 1Z7TA 3ULJA 4HJ5A 1CKNA 3A7AB 1FL0A 2KOLA 4UDUC 3I72A 3FP9A 1AE2A 2KCCA 3TP7A 1TWFH 5J39A 1Q86C 1M4VA 4BA1I 3R8BA 3LNNA 3SHLA 4CJ2C 1GUWA 3OW2A 1SFOB 3VR4A 2R6GA 4O42A 4P74A 4UPAA 1AZQA 4RKLA 1KLGD 3TRZA 4DUZL 2BDNA 1HZCA 2A5HA 1BDOA 3HOWH 3GTLH 3M3YB 4K5XA 3QB3A 4L63B 1X3PA 1WTOA 1XPOA 4RKBA 1RCVD 3V96A 3AQQA 2PNRC 2RSNA 2LY7A 3FPUB 1KAWA 4FXGC 4LF9Q 4JI3Q 2B8GA 4EQNA 5ELDA 5C5LA 3VR2A 2VQFQ 1RIPA 3CRLC 4ZAIA 1GUNA 1U5KA 4OELB 4LF7Q 1F2ZA 3MEHA 3E6ZX 4JV5Q 3J7AV 3P1HA 4MN3A 1VQ4A 1S40A 2RSOA 2F52A 4A4IA 3LX0A 3PGZA 4DAVA 1MKHA 3TSSA 3C1EA 1I94Q 5JEAH 4R1JA 3A8JE 2EYMA 2WAQE 4LF6L 2O5JC 4Y52H 1PH6A 2XWBB 2PPBC 2R93H 2OQKA 2PMZE 1XTDA 2BCOA 4EX5A 4ME3A 5KNDA 1I6HB 3S1QB 3F2BA 1FJGL 4C3HH 1EYAA 1HQRD 4LNQA 2E75C 5KEEA 2GN5A 1Y1WB 4X6AH 4JOIA 3TP6A 3N6RA 5JVG3 3CCEA 1KD1C 1M1KC 3S9WA 1BO0A 1H9SB 3OTOQ 3CHBD 5DEHA 5IYCH 3NQIA 2YTYA 2SNSA 2JA7H 4BY1G 2DGYA 3I2ZA 3JAME 1TS2A 4MZ9A 2VB3X 4GNXB 1B1ZA 2UUBL 1AN8A 5DM63 1JC7A 5T1GA 3IRBA 5M3FB 4IFDJ 1JE4A 4JI1Q 4XYQA 2KQ3A 4K0KQ 4DR5L 1G51A 3M9BA 3ZYYX 5HURA 4LWCA 3A55A 3TDQA 2Y0SE 4P71A 2F0FA 3D6WA 1PRTB 5C4ZA 1YNJD 4H0LC 3F2UA 2B2UA 4YCVA 1TWAB 4K5WA 4LF8L 2EYFA 1JWUD 5M3MB 3T1YL 1A0IA 2I5HA 1CKNB 1I4QA 1LYLA 1OTCA 2CQAA 1PH8A 3SGIA 1BKBA 3CF5A 3TN2A 2B8FA 1U4PA 4LF5L 3EROA 1ZEQX 1ILQA 2QW7A 2EYPA 1STNA 1U0LA 3HGBA 1AW7A 4C2MB 1JE5A 2D5DA 4LK1C 2OCEA 1CTMA 4DR3Q 3DLLA 2XVSA 2ZXOA 1FNUA 1PMRA 4PMBA 5KIXA 2F0NA 4GNXC 2EDGA 4OEMB 2UXDL 2ASBA 2ZTDA 4MNOA 4LFAQ 2GVBA 2EXDA 1YIJA 5IGBA 1XYIA 1GJXA 3VR3A 3J7ZC 4DK0A 4LFBQ 3DEOA 3DUZA 2CVRA 2FHTA 1STYA 1TWHH 4JCVE 1Y1VG 3O13A 4B9XA 5M5YH 4YWMA 1CZGA 3RLNA 3HOWG 4C3JB 4IURA 3KDFB 4KHZA 1STAA 3K7UC 2WB1G 4Q0FA 1D2BA 1Y1VH 1CK1A 2DJGC 5A2QE 3KFUA 4J6HA 4BS9A 1ZKOA 2R7ZB 3GDEA 1VQHA 4Y7NH 3PO2B 2CKZB 2K5VA 3KLSA 4J15A 1VQCA 3R3OA 4RGMA 3U4VA 1HNZL 1CQFA 2XTIA 4GKJL 1EY5A 1Q1BA 2HHHQ 4JW0A 2MJ8A 3HKSA 4EVOA 3A5ZB 1DOKA 1JOOA 1B2TA 3DWAA 1K83B 1QUQB 3J80i 1KQSA 3K8AA 3KF8A 4P73A 3SK4A 2WAQG 1GUSA 2C5CA 1HNWQ 3DMUA 4OIKA 3CD6A 2R7ZH 1PH3A 5D3IB 4DR1Q 1Z9FA 3J81L 1CHPD 2UXBQ 2JA6B 2Q8RE 4X62L 1AE3A 2K7VA 2QF7A 4HJ7A 1JOQA 1D5XC 2X69A 4N8FA 5JOBA 4BA2I 2JA6G 5C4XG 1UEAB 2OXPA 4AQYQ 4A3BB 3RMHA 2BE5C 3HOYG 2BA0A 4A3JG 1PH5A 1YHAA 4HIKA 2VL6A 2JE6I 2MUYA 1KLUD 3J7YW 1EWHA 1Y1WG 3W1BA 4JI2L 2QDBA 4RFBA 3K5OA 2A6HC 2JA5B 2KEDA 1SYBA 5IT9E 1F2MA 3GTJH 1NY4A 4IOAA 3MXGA 4DR6L 5D3DA 2BDOA 2WINB 2K05A 3DWQA 3QR8A 1QZHA 3I91A 5BN5A 1STBA 4PNYA 3E9IA 3PO2G 2A73B 4FF1A 3S2HB 2B2VA 1QB5D 1HTLD 1YITA 1NNXA 4AYBE 4U68A 3NXWA 1VQ5A 2QEJC 3H0GB 2LXJA 4N9TA 2L0CA 1ZXTA 4RMFA 2EY1A 1L0YB 2X6LA 1LABA 4A3KG 4UY8C 1WD1A 4A3BH 1Q12A 2EQSA 1CT1D 1IBKL 5LMNQ 4F88A 1Q1EA 1RL2A 2OQ0A 1TWAH 1HHVA 4A3KB 4APVA 3A5UA 3I90A 4DV6L 2OT2A 1K0RA 1JJGA 1CSPA 4A76A 3T1HQ 1HR0W 1WTRA 2JA8H 1W6KA 4DV7L 1PH9A 3PO3B 4O1NA 1D5ZC 3DXJC 4X3SA 3T56B 1WCMH 1CKOA 5C4XB 3S1MH 4KJNA 4HCEA 4LUOA 2A69C 3NP8A 4IOCA 4DUYQ 1XPRA 4A93G 4XT1B 5C44H 3HOVH 1Y14B 1F9QA 2JA8G 4QQBX 1T5XD 1K0SA 1F77A 2PZUA 3CC7A 1Q81C 3TBIB 1QVFA 2EY2A 4POGA 4IALA 3DWPA 4JI2Q 5EPLA 1SROA 3M7GA 5E4XA 4FYDA 3SVMA 3EFXD 4HIDA 1A3VA 3OTOL 2PCFB 4YY3Q 3MHBA 1STHA 3NHHA 4L5TA 1U4LA 5IWAL 4DR4L 5ISRA 4JI3L 3TMEA 1S72A 2FXQA 5CV9A 1H9KA 1LTSD 2KHSA 3HKZE 5G3LD 1WCMG 5J3BA 2KEEA 4NB3A 1O7ZA 4JI1L 4A3IG 1XNRL 1IKMA 1Z47A 3KOJA 1RJTA 4YWLA 1OXUA 4JI6L 4DV3Q 4A3EH 1XMQQ 3HOXB 1EOVA 5CV5A 2QCPX 4NXML 1SJHD 5J22A 5IGFA 1SMXA 2A6EC 2OTJA 5DAUA 1CQVA 1ZYRC 1XXGA 3CP0A 3A8KE 5IGEA 5C44B 3D3RA 2G9DA 1I94L 2KHIA 4X3KA 2JEAI 3OW7A 2F0MA 3CCUA 1Q82C 4RHSA 3RLFA 1IZ6A 1W2BA 3HOZB 1IYVA 3OWEB 4NPSA 3GTPH 4A3JH 1X6OA 3MC0B 3HOYH 2K33A 1VMCA 2Z6BA 2ZXPA 3KJPA 3BDLA 1SN8A 3NBHB 3EJIA 1VQOA 1A62A 3S14H 5EKLA 1EZ8A 2ZJQA 1JCKB 3D8GA 1YZ6A 4P75A 1X3FA 4DAYA 1MBYA 2EZVA 2IJ0A 3M3YH 3HZXA 3HOWB 3G6JB 4JPBW 4NW2A 4YHHQ 1A2UA 4WFN3 4IUPA 3NENA 4C3JH 1NTGA 1PYBA 1GKHA 1SYEA 3L9AX 5IP7G 3PMFA 1MD2D 2F4VQ 2VW9A 3D4RA 5IGCA 3WOEA 3FHWA 4ZK9B 2UUAL 2B3GA 3KLSX 5EQ0A 1A8VA 4C56C 3HG9A 1YNJC 1RF2D 3JAML 1CA6A 1PVOA 1G6PA 1I4GA 5AFWA 3PUXA 1VDZA 4X66L 2L55A 1KNAA 2ZTEA 5HGQA 4EQ5A 4OXPA 1VQDA 1NUCA 2VB2X 2PO4A 3RZOH 1I6HH 5DM73 3VR6A 1BXTA 1QVCA 1PH1A 4LUVA 3PUZA 5ELNA 2BA1A 2RDHA 4BBSB 2IL8A 1PHJA 1IW7C 3Q24A 3C2PA 1EU4A 4XQQA 1SLJA 2A68D 4POFA 3J80c 2D62A 1EIFA 3HRZC 3RR5A 2E5LQ 5CV4A 1EYDA 2E2DC 4HR7B 3S16B 2XNAC 2K01A 2NN6I 3UDGA 1MHWC 1S4ZA 1HNWL 4MTKA 1WTPA 1GHKA 2HQEA 2PZWA 3CCJA 1PFBA 1NCVA 3NPPA 2CFMA 3SR1A 4L8JA 3MFYA 1V9PA 4HEDA 3KF6A 3HOZH 4NMZA 1UE1A 5I2XA 4LJZC 1EIHA 1S5DD 1ET9A 2QKIC 2N78A 1HFGA 1BCPC 5C4JB 1F9SA 4E6IA 3PUWA 3SE0A 2Q8TA 4JBMA 3A8IE 1N34L 2K5HA 3MFGA 2AHOB 4MIUA 1A2TA 3BYTB 3S1RB 2JQOA 4NXNL 3RN5A 2EYLA 1RD9D 5BR8Q 2Q2TA 1OXVA 2CWAA 4IPHA 3OIPA 4KLKA 5IYDG 1Q46A 3NTIA 4FVMA 4JI0L 4A3GG 1W6JA 4DGZA 4EGVA 2V1CC 4FF4A 3IL8A 4A3IB 1NSNS 3H3VH 2CHBD 5C5MA 1VF7A 1CSQA 4KK7A 1C48A 2N49A 3FMCA 5E7NA 1EQRA 2JEBI 5BR8L 1BCPB 1V1OA 3RZDB 2AKWB 3CCLA 2A69D 1Y69U 2Z9HA 3D6CA 4IPDA 4DV3L 5E3FA 3D31A 4CKEA 2O2LD 3IKJA 3PV0A 1N9WA 1LTTD 5DLQE 3T1HL 2P5ZX 1M8AA 4DV6Q 3BZCA 4UP8A 5I6YA 5I2YA 1HQMC 1Y8PB 4V190 3CMAA 2A1AA 2MHVA 3MTSA 2CH4W 4B08A 3GP7A 4X64Q 2QGQA 1LTAD 1UNSA 3Q6SA 4JV5L 1C7YA 1ESFA 1DJRD 2L9HA 2X6GA 2EJFC 1K28A 5C0XI 5M3MH 2PI2E 3U50C 3AU7A 3R2TA 2H1EA 2Z6KC 2OF1A 4R4TA 1JR0D 1J5EL 3ITPA 4IUTA 1VQNA 1EYCA 3PO3G 2RHSB 3E0JA 1XTCD 4IUNA 2NVTB 1K8MA 1HTPA 1I4RA 2IHFA 2ID0A 5EGTA 2PYKA 3CCVA 5M5YB 5M3FH 2K03A 2J0TD 4JK1C 4NKLA 4XQJA 4K2LA 3PIOA 1XNQL 4DV5Q 3M4OB 4R4QA 3STBC 1IXRA 5JVH3 2ZJPA 1QUQA 1C4QA 2UXCQ 3BG3A 4KHVA 4RGTA 1EEFD 3E0EA 3G7LA 3EQLC 3BYYB 1HZBA 1RKNA 2F0TA 4KY5A 4JI6Q 3VA5A 5KRUA 4FXKC 3G4SA 4QL5A 1TY0A 4JI5L 2NVTH 2Z4HA 4IUVA 4HIMA 1KDBA 4L5SA 1CA5A 2Q2UA 4I7ZC 4OWWB 3S1QH 4TVAB 3RNUA 4QMGA 4JBWA 3QO2A 3BVZA 3G48A 2V4DA 3K5MA 4K6LA 1EYGA 4LF4Q 5GAEC 3WDNA 3RZOB 1LTGD 4OGQC 2NBFA 1SSOA 5FLXE 3GTQH 1IBML 4IQZA 2JXMB 4HMIA 1VQ7A 4QIWE 2L1BA 4V0BA 4B3TL 1WOCA 1SJED 4O0AA 3OWFA 3X3MA 3HKZG 4A3MH 4LF5Q 4QJFA 5T1IA 1K8AC 3RZDH 1EEID 2Y0SG 2Z6KA 4ZUIA 1VQEA 3BVMA 2F0SA 3UDFA 1S5FD 5ELEA 4F87A 1LLRD 1VQIA 1YNXA 2ZXRA 3OMGA 2WIIB 1VQ8A 3M4PA 1FNWA 2K75A 2MP1A 3SK8A 1XNRQ 3M7NA 3W3AA 1FGBD 1SXTA 1TKWB 5G3LF 1WVLA 4DPGA 1K3RA 4PMWA 1QNKA 2A68C 3L2PA 2KJXA 1EQTA 1F9PA 3GV3A 4TRDA 2M2LA 1AH9A 4DAYB 1O7YA 2IT1A 2HQLA 4GLVB 3LWUA 1R9TH 1KL9A 2NZHA 4KHPQ 4JI7Q 2A19A 1K9MC 2IX0A 3KDFA 1EUJA 4ZLTF 1ASZA 3PF4A 2B2TC 2D0OA 4GOPB 5JAVA 1IBKQ 1Q8KA 2WKDA 1VQBA 4H7BA 2VXWA 4PV1C 4BBRB 4H13C 4DR2L 2VS1A 5CV6A 1KRSA 2RKSA 2XN9C 5FO8B 2O4XA 2B63G 2NTTA 2XGTA 2L5TA 3B6YA 4EQPA 3NE5B 3HEJA 2Z8LA 5C0XG 1SNCA 2GA4B 3RD4A 4CGYB 5M9OA 1PZID 3PQIA 1F2LA 3I4NB 3PF5A 3L0OA 4FNFA 3K5NA 3J81i 4GZYC 1WTVA 1O78A 4ME5A 1A15A 4M1UB 3K5LA 4A3IH 3S1NH 2KENA 4R4CA 1YJNA 1SYDA 1PZKD 1SNPA 5TSSA 3NELA 1PTOC 4IFDI 3MA2B 4RWSC 4OX9Q 1I4PA 2YV5A 1WJJA 1B9NA 1XMOL 3AFQA 3H94A 3V2TA 4DXFA 4JVZA 1R4QB 1PH7A 1TQOA 1WTHA 2CQOA 1VQKA 1LTLA 4CHTB 1QE6A 3V05A 3DM1A 1A63A 3VR5A 3KF8B 1NBWA 4I7AA 3T53B 4G7ZC 1JMCA 2I46A 5LMUQ 3HOVG 4DK3C 1CHQD 1X56A 4A3MB 3HP3A 2MO0A 3CCMA 2K32A 2RDGA 3S1MB 3I8ZA 4DV2L 2E2HH 4JI4L 2E2JB 1G8ZD 3PO3H 1G2SA 3EA6A 4KKUA 1IYUA 1GUTA 1PTOH 3HOUG 2JA8B 1YBYA 1Q90A 3DEPA 2OTLA 3KUPA 4IN3A 5C0XJ 2NVYB 2R92G 1BF4A 1UAPA 3SDZA 2XRQD 1EWCA 1MI2A 1Q3LA 1KXLA 1HH2P 2EJGC 4CJ1B 3S14B 2E2IB 2F1MA 2NVQB 2HIVA 5CYUA 3CAMA 2UU9Q 1L0XB 2R7FA 3ICEA 1BQQT 1XX8A 4S3SA 4X64L 3GTMH 4B3MQ 4JBJA 2E74C 1H9MA 4DR7Q 4RAUC 4ID6A 3EN2A 3UI2A 4XYOA 3S2HH 4O2DA 2KECA 1YNND 3SK5A 5IGDA 4LUZA 4YHHL 2WAQB 3VYTA 3RLOA 1WTXA 3I3CA 4A3DG 1NAPA 1I4HA 5EBDA 5IWAQ 2JA7B 1J8IA 3K6OA 1SNMA 2Y0SB 4C3IB 5EAYA 1LTRD 1A3TA 1V1PB 1VQFA 1K73C 4BY1H 1WTQA 3K7AH 2RA4A 1QG7A 4J8QA 1C9OA 1DM0B 1FD7D 1ML0D 1PYSB 5IYDH 2Z1CA 3CU7A 4DNIA 1B3QA 4U673 1YJWA 1IL2A 3KYHC 5EKIA 1E22A 1TT2A 1U4MA 3KBGA 1V1PA 3QWNA 3FRPB 4OO1H 4B3RQ 4GLXA 1KIXA 2A74C 1HFNA 4FXDA 2YYZA 1QCBD 5CMDA 4DV1Q 2JA6H 2Z0SA 4C3IG 4BXXG 2NYZD 3BZDB 3CKIB 4XIGS 5DNFA 1D1IA 5EPKA 4BY7B 1RTNA 4IJLA 4DUYL 3KF6B 5FLXL 3I4MG 1DYQA 3HOYB 4A3LG 2MPMA 1K8GA 3C1FA 2RDFA 5C3EH 4BBRH 4GN5A 4OONA 5C3EB 2J4XA 3SK6A 4OIJA 2F0EA 1QWYA 3MXUA 3T13A 3AFPA 2KCMA 3CQZB 3J80L 4RCNA 4BY7H 1VF5C 3TZDA 3GTKB 2LFNA 3QOJA 1FR3A 2K4KA 1MJEA 4RH6A 4YY3L 1L1OB 4AYBG 4DR4Q 1LTID 1O7LA 2FMMA 1JB3A 5CGKA 1YNNC 1ASYA 1U9RA 2QDLA 1HR0L 4PZ8A 3A74A 3KLRA 3EVQA 3CCQA 1HPCA 4MTNA 2LSSA 5COYA 1XJVA 1AEXA 5E4WC 1B9MA 4K8IA 3F1ZA 3CMEA 2VNUD 3MWYW 1BBXC 3PIP3 1MGSA 2KCNA 1N8RC 5ELCA 1XPUA 2AMCB 4LAAA 3LWEA 1O80A 3J81c 1LTBD 3S1RH 4K6DA 5EBCA 3P20A 2SOBA 2K14A 4AH6A 3TP8A 2M00A 3W2DA 2ZTCA 3BZKA 4G57A 4AYBB 2IW3A 1EY9A 2F03A 1PYWD 3U9OA 2OEOA 4R4OA 1SYCA 3M85A 1HA6A 2B2YC 2B39A 1DOLA 1T9HA 3EIVA 3KBXA 1UWVA 5JEAJ 5I6WA 3GTJB 4UP9A 4RCOA 3WWVA 3NBHA 5LL6X 1X55A 2DN8A 4B3SL 4P72A 1N32Q 2K52A 4KHPL 4LFCL 3UDIA 2SEBD 3NK9A 4KTAA 2D2CC 2CW0C 2B2UC 3TQYA 4LF7L 4FO2A 1EOTA 3FKIB 5M5WH 2WV6D 1VQAA 3HOXG 2EYJA 1VQMA 3NTHA 1WI5A 1PTOB 1KDAA 5CV7A 1EFWA 1IL8A 3NWTA 5NUCA 1LUZA 2D0PA 1TS3A 4BBSH 3BDOA 4PMCA 3F8TA 1Q7YC 1DOMA 2J7ZA 2NZOA 2IY5B 2KVMA 1ZYRD 4C1NK 4X3TA 2PI2A 5D65A 4K14A 2UUCL 1WTWA 3MXPA 1KAAA 3T4AC 4NDXA 4GNXA 4HJ8A 5AJ3L 3K59A 4ODGA 3MEFA 4KN7C 2WACA 3GO5A 5BN3A 2JA7G 4A3DB 1GHJA 2KBNA 3BJUA 1YHQA 2L12A 1VMPA 1W3SA 3URYA 2F0WA 4WJ3M 5IP9H 2NVXB 3W1GA 2F3WA 3OMCA 5IYBG 2UUAQ 4JI7L 1NR2A 3J7A5 3S15B 3FKIG 1A6XA 3C3LA 4C3HG 1KHIA 1X32A 2BH2A 2NVQH 4GKJQ 4KY6A 5GAHC 3VYRA 2R93G 2XIWA 2RVLA 4TQUS 2QEXA 3DM3A 3OPOA 3CCSA 1K8OA 1PFNA 3S2DB 1SE4A 4EQOA 4WJ4A 2ES2A 1X3EA 1BNZA 3VYUA 5JEAG 4BY7G 3ER0A 3ERSX 1PH4A 2C9OA 4JG2A 4R9WA 2E2HB 1SYGA 3TEHB 1EQVA 1S5ED 3VDYA 1PRTF 3H0GG 1MJCA 2B2WA 2XRSD 4K8JA 3MXNB 4ULLA 4X65L 1SMYC 2A6ED 3D4DA 4FF2A 1PTOD 3GQBA 5EPJA 5IY0A 4HN7A 4BXXH 1GUGA 2EOTA 2YTVA 1SAPA 1PXUA 4PZ6A 4QCLA 1G2TA 2G5DA 3CPWA 1QZGA 1TXYA 3J81j 1E24A 4HAEA 4QUFA 4ZKCB 4RGOS 2UXDQ 4RG1A 2ZJRA 1X3GA 4A75A 4CBVA 4KN4C 1YVCA 5EKKA 2I0QA 3GTOH 1ENCA 2UUBQ 1KABA 2HT1A 4A3GB 1CM9A 2DNEA 1BBUA 4DN4M 4FF3A 3AYHB 4IJHA 1L2FA 5JJLA 5JJIA 1RDPD 1PFSA 4IFDG 4BY1B 3I55A 1TWCH 4A3DH 3OSOA 1PLFA 4R4IA 1MIUA 1PV4A 2LS01 3S24A 2F0HA 1BCPD 3JAMi 1CKMA 1PZJD 1JWMD 5M5XH 1EU3A 1VCIA 1QILA 1A3UA 4DKAC 3T1YQ 4PZ7A 4LF8Q 4IZ8A 1JJ2A 3KJOA 1PRTD 4BBSG 1TWGH 1DZ1A 2Q2HA 3S2DH 3S16H 4CKBA 2Q8IB 4KI0A 1ILPA 2JYOA 3HOUB 2H5XA 5IT9L 5C4XH 3W5OA 4AIMA 4KJOA 2XWJB 2HDMA 4Q5VA 1SRUA 2AQ3B 1MSHA 1SNDA 1RTOA 2R3ZA 2E2IH 5CORA 2NTSA 2R7ZG 5EJWA 1T5EA 1ONLA 3PSIA 2ZT9C 2WB1B 2CWPA 2R7DA 1B8AA 1OXXK 1Z6HA 3HFZB 1HXYD 4ZYSA 1G6ZA 2F0OA 2NB0A 2PQEA 1RHPA 4P2CB 1SEBD 4LW1A 3NSWA 2VUMG 1X3QA 4HTHA 4HSVA 4DUZQ 1N36L 1SDFA 3U58A 3TZUA 1SE8A 5KYIA 1E2ZA 4A3FH 2PNHA 3GTOB 1G91A 1E2WA 4HMJA 5AJ3Q 1HRJA 3D4WA 2AWOA 1EY7A 3GD7A 3QJYA 1SMYD 2XSCA 2YU9H 4DV0Q 5K36G 2KA7A 4DV1L 3KLWA 1E1OA 2N55A 4K2KA 4FP5D 4UP7A 3T16A 1HCZA 4IUQA 5IGGA 1IKLA 3CCRA 1ESRA 1LT3D 1S5CD 4DR2Q 5A2QL 1SFOH 2MFIA 3TS0A 2K6AA 2ICIA 3S1NB 2PZTA 4X66Q 2EYHA 1G291 4KKTA 4N9PA 3I70A 1PA6A 2R93B 1X65A 3CRKC 2MGSA 4JI4Q 2NZ1D 2VQEL 4M8AA 4OL7A 5KNCA 1TU2B 2HCCA 5C0XH 4ALPA 4B3TQ 3I4NH 3GTPB 4G7OC 2VUMH 2NUCA 1PTOF 1HUMA 2IPKD 1YEZA 4DR1L 4YIJA 1LACA 2Q2IA 1C0AA 2NN6G 3S17H 1V43A 1N33Q 4GKKQ 4QF4A 3A7LA 4X62Q 2N88A 1B7YB 2KUMA 1PH2A 1K83H 4A3LH 3FPPA 4QGUA 5IE8A 1LV9A 5GAGC 1JORA 1TR5A 3NWSA 1AP0A 3U9SA 3ND8A 1ENFA 3T51B 4A3CH 2SNMA 3WOFA 5FLMH 2TSSA 4DXGA 5K5PA 4ZUJA 4XTCS 2TMPA 2DNCA 3Q0AA 1UE7A 3RUZA 2F3IA 3F2CA 4GLAC 5FO7B 1B4OA 1IYJB 2EYOA 3GTGB 3IFDA 4ZCKA 1JB7A 5LMUL 1NR4A 4DU9A 1JJCB 1H9RA 1HZ9A 3QIAA 1GUOA 3K81C 1PFMA 2HIXA 2ENBA 1JT8A 2L4NA 4DAMA 2ZM6Q 3BS1A 4DFAA 5IYCG 1VQJA 1PDQA 4YCWA 1HA5A 1F2YA 1ET6A 1LT6D 1M90C 3I7FA 3FEWX 3P75A 1I6VC 3ND9A 4GN4B 1S5BD 2PMZB 3H3VI 4C2MH 4DV7Q 1F9RA 3A56A 3E9HA 3K0YA 2CCZA 2DUDA 4KMUC 1EY0A 1UE6A 4GOPC 1NJIC 3GTMB 5FO9B 4DR7L 4JI5Q 2A6HD 1N33L 4A3EG 4GKKL 1CZWA 1MSGA 5C6AA 4DAPA 3MXNA 2ALYB 1XMOQ 4I65A 5ELBA 3HOUH 4TSSA 1DONA 1U4RA 5IOCA 3H0GH 5CBAE 1RODA 2AUJD 2AQ2B 3NTKA 4DV5L 2NVXH 4DA2A 1KDCA 1SE2A 1D8LA 3QOLA 3K0XA 1GXDC 1ENAA 3HKZB 2MQHA 2YTXA 5FOBB 1JICA 2ATWA 1I3QB 2K28A 2VZAA 3TS2A 3P7JA 5IODA 4NP5A 4DR5Q 3AEVA 3J7AF 3I56A 4ABNA 4NXNQ 1QNUA 1OXTA 3CW2C 1AZPA 3AMUA 4B9WA 1QOHA 3M4OH 4QB4A 4DK1A 4OX9L 4RGNA 4HSPA 2F4VL 2DJFC 2MO1A 4DF7A 1EL0A 4A93H 2B2YA 2JJQA 3L7ZC 4G4KA 4X3UA 1YHBA 3MZ5A 1FNVA 4JBKA 2EY5A 1P8LA 3CC4A 2B63B 2DY7A 3H3VC 1EZ6A 5I4DA 3JAMc 3PIPA 2RHQB 1LT4D 2HHHL 2LXKA 1NMFA 4TKOB 1BR9A 1EFID 2BE5D 3D0FA 3UE0A 2OWOA 1VQPA 5M3MG 3L3OC 3ONAB 1II3A 1QJOA 2WKCA 4CDEC 1EQQA 3BDCA 2EVBA 2I5LX 5GQOA 4B3RL 4A3JB 4FDBA 4A3BG 1GVPA 1EY4A 3LGJA 4HIOA 4LF6Q 4DNTB 1KTKA 1TWGB 2B2WC 2EY6A 5IYBH 5FJ8G 1HNZQ 4LFBL 4HCSA 4LMQD 4JI8L 1BCPF 1E2VA 4J1MA 1BBWA 3HS0C 1L1OC 1DXMA 1DGSA 2AWNA 2FFKB 2K5DA 1QVGA 3PIO3 3NBIA 3I4LA 3PO2H 3SXHA 4BWGB 3HOXH 2D9UA 4A3EB 5KNBA 1FVIA 3K80C 4ZRZA 4IUUA 1Y1VB 1SBBB 2RBMA 4DNRB 4IO9A 2PQAA 1H95A 1I4XA 3I4OA 1LO5D 1D1KA 2K5NA 5FK9C 5CV8A 2L15A 4A3GH 1N36Q 4GS3A 5GROA 2JA5G 2GVAA 5I9OA 2F0QA 2E76C 2M9VA 4WORA 1UE5A 4AQYL 3GTLB 4XXEA 4OWXB 3N52A 4RA8A 4CDDC 1VS0A 5FLMG 2B2TA 4A3CG 1B70B 1E0BA 2F0VA 4ZKBB 1PRTC 1P16A 5GADC 1TWFB 1D5MC 3GV6A 3CQZH 1I50H 3H09A 3CC2A 4LF9L 1WYDA 3HOZG 3I4MB 1KC8C 2FMCA 3Q22A 3E5SA 2WP8J 5FJ8H 4G7HC 2VQEQ 3A0JA 4XT3B 2I5MX 1NMGA 2EPBA 1TS4A 3ERQA 2E5LL 1E1TA 2K5WA 1S3OA 1OXSC 4DV4L 2EJMA 1DD2A 1SNQA 1R9TB 3NQTA 1UUPA 3FDTA 3IFTA 5I9PA 4F8MA 5F2DA 1KNEA 3GTQB 5C3WA 5HY6A 2ICEC 1K3BC 3OYYA 1EIYB 5H1SE 2BH8A 1VQLA 3MAQA 1J9OA 2HD3A 2L11A 1Y8OB
chains in the Genus database with same CATH topology
4UAIA 5C3XA 5KYLA 3FVQA 2F0LA 2NWGA 1FYCA 3K7AB 4K5VA 2R61A 3J80E 2HUGA 2K1BA 4MHEA 3A54A 3PUVA 4QUCA 1JQYD 1TWCB 4RHRA 2HDLA 3HOVB 1IW7D 4OO1G 4C1NI 1B50A 4C3HB 4C3JG 1TIID 4ZQ3A 2LMCB 5E1FA 1D6EC 5HGTA 1C8CA 3KK7A 1H9JA 1CI3M 2F0IA 4XQNA 4R8NA 1CFMA 1SYFA 2SDFA 3OIQA 5M5XB 4KV6A 2RQXA 2PW7A 3I73A 2I07B 5KGUA 4CJ0B 1I50B 2Z4IA 3IAYA 2F3VA 5CBEE 4IFDH 3VA7A 4OO1I 2R92B 2AUKA 1EIGA 1H9SA 1EY6A 2JP1A 2QILA 2FJ2A 5D14A 2DY8A 1WD0A 4XDXA 1SNOA 2FINB 1R4PB 1BUVT 3SEBA 1DCZA 1B3AA 5A35A 4R8IA 4A93B 4WRDA 2K04A 1TS5A 5CC4A 5BN4A 3H6MA 1EY8A 1ICWA 2F4IA 5JPMC 2B2VC 2F0KA 5IIFA 5JJZA 3X3NA 1OO9B 3Q23A 3S17B 4F7XA 1BOSA 1V8QA 3VYSA 4ILWA 1HUNA 1GOZA 5FKAC 2NN6H 1STEA 5LL6S 2VUMB 4WJWA 1WCMB 2PW5A 4Y7NB 2F0UA 5LHY1 1B44D 3M4YA 2BOSA 3DHQA 4Z9CB 1STGA 2IX3A 1Q8IA 3OOCA 5J1ZA 2EXZA 2CW0D 5CR3A 4KD4A 5M5WB 1SE3A 2YU9B 3AB9A 3MVVA 4KD3A 4KKSA 4CKCA 3K57A 3C46A 5K36H 2F0DA 1Y8NB 4A3FB 3BVGA 1TWHB 3QG1A 1XWEA 1LT5D 2AQ1B 3NUCA 1B53A 4PQXA 5C4HA 1AFPA 2EE1A 1IHZA 3R2IA 4L6TB 2IX1A 3K58A 5ELFA 1JWSD 2IWHA 3OHXC 2LKVA 2F0PA 2H4OA 2JSOA 4H44C 3J81E 4OHJA 2O5IC 2F0JA 4QIWB 3TP5A 3H91A 2F0GA 3R93A 1JOKA 2HCIA 2G9HD 1TY2A 2K5QA 4KY7A 3PUYA 1TVXA 5JPNC 1Z7TA 3A7AB 2KOLA 4UDUC 3I72A 2KCCA 3TP7A 5J39A 1M4VA 4BA1I 3R8BA 3LNNA 3SHLA 4CJ2C 1GUWA 1SFOB 3VR4A 2R6GA 4O42A 1AZQA 4RKLA 1KLGD 2BDNA 2A5HA 1BDOA 3M3YB 4K5XA 3QB3A 4L63B 1X3PA 1WTOA 4RKBA 1RCVD 3V96A 2PNRC 2RSNA 2LY7A 3FPUB 4FXGC 2B8GA 4EQNA 5ELDA 5C5LA 3VR2A 3CRLC 4ZAIA 1GUNA 1F2ZA 3MEHA 3E6ZX 3J7AV 3P1HA 4MN3A 2RSOA 3LX0A 4DAVA 3TSSA 3C1EA 5JEAH 3A8JE 2EYMA 2O5JC 2XWBB 2PPBC 2BCOA 5KNDA 1I6HB 3S1QB 1EYAA 1HQRD 2E75C 5KEEA 1Y1WB 3TP6A 3N6RA 5JVG3 3S9WA 1BO0A 1H9SB 3CHBD 5DEHA 3NQIA 2SNSA 3JAME 1TS2A 2VB3X 1B1ZA 1AN8A 5DM63 1JC7A 5T1GA 5M3FB 4IFDJ 1JE4A 4XYQA 2KQ3A 3ZYYX 5HURA 3A55A 3TDQA 2F0FA 3D6WA 1PRTB 5C4ZA 1YNJD 4H0LC 3F2UA 2B2UA 1TWAB 4K5WA 2EYFA 1JWUD 5M3MB 1I4QA 2CQAA 3TN2A 2B8FA 1U4PA 3EROA 1ZEQX 1ILQA 2EYPA 1STNA 3HGBA 1AW7A 4C2MB 2D5DA 4LK1C 1CTMA 2XVSA 2ZXOA 1FNUA 1PMRA 4PMBA 5KIXA 2F0NA 2EDGA 5IGBA 1XYIA 1GJXA 3VR3A 4DK0A 3DEOA 3DUZA 2CVRA 2FHTA 1STYA 4B9XA 3O13A 1CZGA 4C3JB 4IURA 4KHZA 1STAA 4Q0FA 1D2BA 1CK1A 5A2QE 4J6HA 4BS9A 1ZKOA 2R7ZB 3PO2B 3KLSA 3R3OA 4RGMA 1CQFA 1EY5A 1Q1BA 2MJ8A 4EVOA 1DOKA 1JOOA 1B2TA 3DWAA 1K83B 3KF8A 3SK4A 1GUSA 2C5CA 3DMUA 4OIKA 5D3IB 3J81L 1CHPD 2JA6B 2Q8RE 2K7VA 2QF7A 1JOQA 1D5XC 2X69A 5JOBA 4BA2I 1UEAB 2OXPA 4A3BB 3RMHA 2BE5C 2BA0A 2JE6I 2MUYA 1KLUD 3J7YW 1EWHA 2QDBA 4RFBA 3K5OA 2A6HC 2JA5B 2KEDA 1SYBA 5IT9E 1F2MA 3MXGA 5D3DA 2BDOA 2WINB 2K05A 3DWQA 3I91A 5BN5A 1STBA 4PNYA 2A73B 4FF1A 3S2HB 2B2VA 1QB5D 1HTLD 4U68A 3NXWA 2QEJC 3H0GB 4N9TA 2L0CA 1ZXTA 2EY1A 1L0YB 2X6LA 1LABA 1WD1A 1Q12A 1CT1D 4F88A 1Q1EA 1HHVA 4A3KB 3I90A 2OT2A 1WTRA 1W6KA 3PO3B 4O1NA 1D5ZC 3DXJC 4X3SA 3T56B 5C4XB 4KJNA 4HCEA 2A69C 3NP8A 4XT1B 1F9QA 1T5XD 1F77A 2PZUA 3TBIB 2EY2A 4IALA 3DWPA 5EPLA 3M7GA 5E4XA 4FYDA 3SVMA 3EFXD 1A3VA 2PCFB 3MHBA 1STHA 3NHHA 1U4LA 5ISRA 3TMEA 5CV9A 1H9KA 1LTSD 2KHSA 5G3LD 2KEEA 1O7ZA 1IKMA 1Z47A 1RJTA 1OXUA 3HOXB 5CV5A 2QCPX 1SJHD 5J22A 5IGFA 2A6EC 5DAUA 1CQVA 1ZYRC 1XXGA 3A8KE 5IGEA 5C44B 3D3RA 2G9DA 4X3KA 2JEAI 3OW7A 2F0MA 4RHSA 3RLFA 3HOZB 1IYVA 3OWEB 3MC0B 2K33A 1VMCA 2ZXPA 3BDLA 3EJIA 5EKLA 1EZ8A 1JCKB 3D8GA 4DAYA 1MBYA 2EZVA 2IJ0A 3HZXA 3HOWB 3G6JB 4NW2A 1A2UA 4WFN3 4IUPA 1SYEA 3L9AX 3PMFA 1MD2D 3D4RA 5IGCA 3WOEA 4ZK9B 3KLSX 5EQ0A 4C56C 3HG9A 1YNJC 1RF2D 3JAML 1CA6A 1I4GA 5AFWA 3PUXA 1VDZA 2L55A 1KNAA 1NUCA 2VB2X 2PO4A 5DM73 3VR6A 1BXTA 3PUZA 2BA1A 2RDHA 4BBSB 2IL8A 1IW7C 3Q24A 3C2PA 1EU4A 4XQQA 2A68D 2D62A 3HRZC 5CV4A 1EYDA 2E2DC 4HR7B 3S16B 2XNAC 2K01A 2NN6I 1S4ZA 1WTPA 1GHKA 2HQEA 2PZWA 1PFBA 1NCVA 3NPPA 3SR1A 4L8JA 3MFYA 4HEDA 4NMZA 5I2XA 4LJZC 1EIHA 1S5DD 1ET9A 2QKIC 1HFGA 1BCPC 5C4JB 1F9SA 4E6IA 3PUWA 3SE0A 2Q8TA 3A8IE 3MFGA 4MIUA 1A2TA 3BYTB 3S1RB 2EYLA 1RD9D 1OXVA 3OIPA 3NTIA 4FVMA 1W6JA 4DGZA 4EGVA 4FF4A 3IL8A 4A3IB 1NSNS 2CHBD 5C5MA 1VF7A 4KK7A 1C48A 3FMCA 2JEBI 1BCPB 1V1OA 3RZDB 2A69D 1Y69U 3D6CA 5E3FA 3D31A 4CKEA 2O2LD 3IKJA 3PV0A 1LTTD 1M8AA 5I6YA 5I2YA 1HQMC 1Y8PB 4V190 2MHVA 3MTSA 4B08A 3GP7A 1LTAD 1UNSA 3Q6SA 1ESFA 1DJRD 2L9HA 2X6GA 2EJFC 5C0XI 3AU7A 3R2TA 2H1EA 2OF1A 1JR0D 3ITPA 4IUTA 1EYCA 3E0JA 1XTCD 4IUNA 2NVTB 1K8MA 1HTPA 1I4RA 2ID0A 5EGTA 2PYKA 5M5YB 2K03A 2J0TD 4JK1C 4NKLA 4XQJA 4K2LA 3M4OB 5JVH3 1C4QA 3BG3A 4KHVA 4RGTA 1EEFD 3G7LA 3EQLC 3BYYB 1RKNA 2F0TA 4KY5A 3VA5A 5KRUA 4FXKC 1TY0A 2Z4HA 4IUVA 1KDBA 1CA5A 4I7ZC 4QMGA 4JBWA 3QO2A 3BVZA 2V4DA 3K5MA 4K6LA 3WDNA 3RZOB 1LTGD 4OGQC 2NBFA 1SSOA 5FLXE 4IQZA 2JXMB 4HMIA 4V0BA 2L1BA 1SJED 3OWFA 3X3MA 5T1IA 1EEID 4ZUIA 3BVMA 2F0SA 1S5FD 5ELEA 4F87A 1LLRD 2ZXRA 3OMGA 2WIIB 1FNWA 2MP1A 3SK8A 3M7NA 3W3AA 1FGBD 1SXTA 1TKWB 5G3LF 1WVLA 4PMWA 1QNKA 2A68C 2KJXA 1EQTA 1F9PA 3GV3A 4TRDA 2M2LA 1O7YA 2IT1A 3LWUA 2IX0A 4ZLTF 2B2TC 5JAVA 2WKDA 4H7BA 2VXWA 4PV1C 4BBRB 4H13C 5CV6A 2RKSA 2XN9C 5FO8B 2O4XA 2NTTA 2L5TA 4EQPA 3NE5B 3HEJA 2Z8LA 5C0XG 1SNCA 2GA4B 3RD4A 4CGYB 5M9OA 1PZID 1F2LA 3I4NB 4FNFA 3K5NA 4GZYC 1WTVA 1O78A 4ME5A 1A15A 4M1UB 3K5LA 1SYDA 1PZKD 1SNPA 5TSSA 1PTOC 4IFDI 3MA2B 4RWSC 1I4PA 1B9NA 3H94A 3V2TA 4DXFA 1R4QB 1TQOA 4CHTB 1QE6A 3V05A 3DM1A 3VR5A 4G7ZC 3T53B 2I46A 1CHQD 4A3MB 3HP3A 2K32A 2RDGA 3S1MB 3I8ZA 2E2JB 1G8ZD 1G2SA 3EA6A 4KKUA 1IYUA 1GUTA 1PTOH 2JA8B 1Q90A 3DEPA 3KUPA 4IN3A 5C0XJ 2NVYB 1BF4A 1UAPA 3SDZA 2XRQD 1EWCA 1MI2A 1Q3LA 2EJGC 4CJ1B 3S14B 2E2IB 2F1MA 2NVQB 5CYUA 1L0XB 1BQQT 1XX8A 4S3SA 2E74C 1H9MA 4RAUC 4ID6A 3UI2A 4XYOA 2KECA 1YNND 3SK5A 5IGDA 2WAQB 3VYTA 1WTXA 3I3CA 2JA7B 1NAPA 1I4HA 5EBDA 1J8IA 3K6OA 1SNMA 2Y0SB 4C3IB 1LTRD 1A3TA 1V1PB 1WTQA 2RA4A 1QG7A 4J8QA 1DM0B 1FD7D 1ML0D 2Z1CA 3CU7A 4U673 5EKIA 1TT2A 3KBGA 1U4MA 1V1PA 3QWNA 3FRPB 4OO1H 2A74C 1HFNA 4FXDA 2YYZA 1QCBD 5CMDA 4C3IG 2NYZD 3BZDB 3CKIB 4XIGS 5DNFA 1D1IA 5EPKA 4BY7B 1RTNA 5FLXL 1DYQA 3HOYB 2MPMA 3C1FA 2RDFA 5C3EB 2J4XA 3SK6A 4OIJA 2F0EA 1QWYA 3MXUA 3T13A 3CQZB 3J80L 4RCNA 1VF5C 3TZDA 3GTKB 2LFNA 3QOJA 1FR3A 4RH6A 1LTID 1O7LA 2FMMA 1JB3A 5CGKA 1YNNC 1U9RA 3KLRA 3EVQA 1HPCA 5COYA 1AEXA 5E4WC 1B9MA 4K8IA 2VNUD 3MWYW 1BBXC 3PIP3 1MGSA 2KCNA 5ELCA 4LAAA 3LWEA 1O80A 1LTBD 5EBCA 4K6DA 2SOBA 3P20A 3TP8A 2M00A 3W2DA 4AYBB 4G57A 2F03A 2IW3A 1EY9A 1PYWD 3U9OA 2OEOA 1SYCA 3M85A 1HA6A 2B2YC 2B39A 1DOLA 3KBXA 5JEAJ 5I6WA 3GTJB 4RCOA 3NBHA 5LL6X 2DN8A 2SEBD 3NK9A 4KTAA 2D2CC 2CW0C 2B2UC 4FO2A 1EOTA 3FKIB 2WV6D 2EYJA 3NTHA 1PTOB 1KDAA 5CV7A 1IL8A 3NWTA 5NUCA 1TS3A 3BDOA 4PMCA 1DOMA 2J7ZA 2KVMA 1ZYRD 4C1NK 4X3TA 5D65A 4K14A 1WTWA 3MXPA 1KAAA 3T4AC 4NDXA 3K59A 4ODGA 4KN7C 2WACA 3GO5A 5BN3A 4A3DB 1GHJA 2L12A 1VMPA 3URYA 2F0WA 2NVXB 2F3WA 3OMCA 1NR2A 3S15B 1A6XA 3C3LA 4C3HG 1X32A 4KY6A 3VYRA 2XIWA 2RVLA 4TQUS 3OPOA 1K8OA 1PFNA 3S2DB 1SE4A 4EQOA 1BNZA 3VYUA 5JEAG 2C9OA 4R9WA 2E2HB 1SYGA 1EQVA 1S5ED 1PRTF 2B2WA 2XRSD 4K8JA 4ULLA 1SMYC 2A6ED 3D4DA 4FF2A 1PTOD 3GQBA 5EPJA 4HN7A 1GUGA 2EOTA 1SAPA 1PXUA 4QCLA 1G2TA 4ZKCB 4HAEA 4QUFA 4RGOS 4CBVA 4KN4C 5EKKA 1ENCA 1KABA 4A3GB 1CM9A 2DNEA 4DN4M 4FF3A 1RDPD 4IFDG 4BY1B 3OSOA 1PLFA 2LS01 2F0HA 1BCPD 1PZJD 1JWMD 1EU3A 1VCIA 1QILA 1A3UA 4IZ8A 1PRTD 1DZ1A 4CKBA 2Q8IB 4KI0A 1ILPA 2JYOA 3HOUB 5IT9L 4KJOA 2XWJB 2HDMA 4Q5VA 2AQ3B 1MSHA 1SNDA 1RTOA 2R3ZA 5CORA 2NTSA 5EJWA 1T5EA 1ONLA 2ZT9C 2WB1B 1Z6HA 1OXXK 1HXYD 4ZYSA 1G6ZA 2F0OA 2NB0A 2PQEA 1RHPA 4P2CB 1SEBD 3NSWA 1X3QA 4HTHA 4HSVA 1SDFA 3TZUA 5KYIA 1E2ZA 3GTOB 1G91A 1E2WA 4HMJA 1HRJA 3D4WA 2AWOA 1EY7A 3GD7A 3QJYA 1SMYD 2XSCA 5K36G 2KA7A 2N55A 4K2KA 4FP5D 3T16A 1HCZA 4IUQA 5IGGA 1IKLA 1ESRA 1LT3D 1S5CD 5A2QL 2K6AA 2ICIA 3S1NB 2PZTA 2EYHA 1G291 4KKTA 4N9PA 3I70A 2R93B 3CRKC 2MGSA 2NZ1D 4M8AA 4OL7A 5KNCA 1TU2B 2HCCA 5C0XH 3GTPB 4G7OC 2NUCA 1PTOF 1HUMA 2IPKD 4YIJA 1LACA 2NN6G 1V43A 4QF4A 3A7LA 2N88A 2KUMA 3FPPA 1LV9A 1JORA 1TR5A 3NWSA 1AP0A 3U9SA 3ND8A 1ENFA 3T51B 2SNMA 3WOFA 2TSSA 4DXGA 5K5PA 4ZUJA 4XTCS 2TMPA 2DNCA 3Q0AA 3RUZA 5FO7B 1B4OA 2EYOA 3GTGB 3IFDA 1NR4A 4DU9A 1H9RA 3QIAA 1GUOA 1PFMA 2ENBA 2L4NA 3BS1A 4DFAA 1PDQA 1HA5A 1F2YA 1ET6A 1LT6D 3FEWX 3P75A 1I6VC 3ND9A 1S5BD 2PMZB 1F9RA 3A56A 3K0YA 4KMUC 1EY0A 3GTMB 5FO9B 2A6HD 1CZWA 1MSGA 5C6AA 4DAPA 3MXNA 4I65A 5ELBA 4TSSA 1DONA 1U4RA 5IOCA 5CBAE 1RODA 2AUJD 2AQ2B 3NTKA 4DA2A 1KDCA 1SE2A 3QOLA 1GXDC 1ENAA 3HKZB 5FOBB 1JICA 1I3QB 2K28A 3P7JA 5IODA 4NP5A 3J7AF 4ABNA 1QNUA 1OXTA 3AMUA 1AZPA 4B9WA 1QOHA 4QB4A 4DK1A 4RGNA 4HSPA 4DF7A 1EL0A 2B2YA 3L7ZC 4G4KA 4X3UA 3MZ5A 1FNVA 2EY5A 2B63B 2DY7A 3H3VC 1EZ6A 5I4DA 1LT4D 4TKOB 1BR9A 1EFID 2BE5D 3L3OC 3ONAB 1II3A 1QJOA 2WKCA 3BDCA 2EVBA 4A3JB 1EY4A 4DNTB 1KTKA 1TWGB 2B2WC 2EY6A 4HCSA 4LMQD 1BCPF 1E2VA 4J1MA 3HS0C 1DXMA 2AWNA 2FFKB 2K5DA 3PIO3 3NBIA 3I4LA 3SXHA 4BWGB 2D9UA 4A3EB 5KNBA 4ZRZA 4IUUA 1Y1VB 1SBBB 2RBMA 4DNRB 1I4XA 1LO5D 1D1KA 5FK9C 5CV8A 5I9OA 2F0QA 2E76C 2M9VA 4WORA 3GTLB 4XXEA 3N52A 4RA8A 2B2TA 1E0BA 2F0VA 4ZKBB 1PRTC 1TWFB 1D5MC 3GV6A 3H09A 3I4MB 2FMCA 3Q22A 3E5SA 2WP8J 4G7HC 4XT3B 2EPBA 1TS4A 3ERQA 2K5WA 1OXSC 2EJMA 1DD2A 1SNQA 1R9TB 3NQTA 1UUPA 3FDTA 3IFTA 5I9PA 4F8MA 5F2DA 1KNEA 3GTQB 5C3WA 2ICEC 3MAQA 1J9OA 2L11A 1Y8OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B3A A;  1HA6 A;  2B2Y C;  1RHP A;  1WD1 A;  1DOL A;  1PFM A;  3KBX A;  4IUR A;  4R8I A;  4UAI A;  2L4N A;  2K04 A;  1X3Q A;  4IUV A;  1HHV A;  4HSV A;  1WTQ A;  2B2W A;  2RA4 A;  1QG7 A;  1SDF A;  3H91 A;  1CA5 A;  3I90 A;  2NWG A;  1F2L A;  1PDQ A;  1ICW A;  2B2W C;  4NW2 A;  1ML0 D;  1WTR A;  2B2V C;  5EPJ A;  3R93 A;  4IUP A;  2HUG A;  4HCS A;  4LMQ D;  2K1B A;  3QO2 A;  4MHE A;  1WTV A;  2HCI A;  2B2U C;  1BO0 A;  1G91 A;  2EOT A;  1A15 A;  4QUC A;  5EKI A;  5JJZ A;  4X3S A;  3IL8 A;  1SAP A;  1U4M A;  2FFK B;  1HRJ A;  1EOT A;  1G2T A;  1F9R A;  2D9U A;  1TVX A;  2HDL A;  1HFN A;  2N55 A;  1HUN A;  1SSO A;  4RWS C;  4IUU A;  2MJ8 A;  4ZKC B;  4HAE A;  4IUQ A;  4QUF A;  5CMD A;  2KOL A;  1IKL A;  1DOK A;  1B50 A;  4XT1 B;  4ZK9 B;  1ESR A;  5T1G A;  1B2T A;  2NYZ D;  2L1B A;  1JE4 A;  5EQ0 A;  1IL8 A;  1MSG A;  1F9Q A;  5DNF A;  4CJ2 C;  5EPK A;  1CA6 A;  1GUW A;  1RTN A;  2MGS A;  1DOM A;  1M8A A;  5AFW A;  1C8C A;  2J7Z A;  2NZ1 D;  4OIK A;  4O42 A;  1QE6 A;  2KVM A;  1AZQ A;  3DM1 A;  1CM9 A;  1U4R A;  2MPM A;  5EPL A;  4X3T A;  2HCC A;  5T1I A;  3D6W A;  5D65 A;  4DN4 M;  1ROD A;  5CBA E;  1KNA A;  2BDN A;  2Q8R E;  3N52 A;  4RA8 A;  3MTS A;  5E4X A;  1WTW A;  1HUM A;  2B2T A;  3SVM A;  4OIJ A;  3F2U A;  2B2U A;  2X69 A;  3HP3 A;  1X3P A;  1E0B A;  2SDF A;  3Q6S A;  1WTO A;  1PLF A;  1U4L A;  2L9H A;  2X6G A;  4ZKB B;  2RSN A;  3TZD A;  3I8Z A;  2MP1 A;  2IL8 A;  1JIC A;  2N88 A;  3FPU B;  2K28 A;  2KUM A;  2H1E A;  3P7J A;  1G2S A;  3GV6 A;  1WVL A;  2KEE A;  3TN2 A;  1O7Z A;  1U4P A;  3DEP A;  1AZP A;  2L12 A;  1IKM A;  3KUP A;  4IUT A;  1DON A;  1QNK A;  1VMP A;  2FMM A;  1RJT A;  1LV9 A;  1DZ1 A;  1BF4 A;  2KED A;  1ILQ A;  4CJ0 B;  1EQT A;  1F9P A;  3GV3 A;  2JYO A;  4ZAI A;  1ILP A;  1MI2 A;  2K01 A;  1Q3L A;  1B53 A;  2M2L A;  1AP0 A;  4XT3 B;  4CJ1 B;  1EL0 A;  2B2Y A;  1O7Y A;  1S4Z A;  2EPB A;  1NR2 A;  2EE1 A;  4X3U A;  5COY A;  4MN3 A;  1WTP A;  5CBE E;  5E4W C;  2HDM A;  1X32 A;  2RSO A;  1PFB A;  2K05 A;  1NCV A;  3MWY W;  3I91 A;  1BBX C;  1MGS A;  1MSH A;  2K03 A;  4ZLT F;  1RTO A;  1XX8 A;  2R3Z A;  3FDT A;  4HED A;  2DY7 A;  2B2T C;  4X3K A;  5COR A;  2XIW A;  5EJW A;  1KNE A;  2RVL A;  1EIG A;  2B2V A;  1EIH A;  3LWE A;  1O80 A;  4RAU C;  1B4O A;  2JP1 A;  1PFN A;  2VXW A;  1XYI A;  3UI2 A;  4U68 A;  2FJ2 A;  5D14 A;  1HFG A;  2DY8 A;  3IFD A;  1F9S A;  3DEO A;  4XDX A;  1WD0 A;  1BNZ A;  2KEC A;  2CVR A;  2FHT A;  3ONA B;  2FIN B;  1NR4 A;  1VMC A;  2Q8T A;  1ZXT A;  1WTX A;  1J9O A;  2L11 A;  1NAP A;  3I3C A;  1J8I A;  3G7L A;  1G6Z A;  2X6L A;  4R9W A; 
#chains in the Genus database with same CATH topology
 5FLX c;  1HZA A;  4LFA L;  4UAI A;  5C3X A;  5KYL A;  4JOI C;  3FVQ A;  2RCF A;  3I4M H;  2F0L A;  2NWG A;  1SR3 A;  1FJG Q;  1FYC A;  3K7A B;  4K5V A;  2R61 A;  4B3M L;  2KCT A;  3UDX A;  1J6Q A;  4A3F G;  3J80 E;  2HUG A;  2K1B A;  4IPC A;  4MHE A;  1X54 A;  3A54 A;  1I3Q H;  5L37 A;  4C3I H;  3PUV A;  4QUC A;  1JQY D;  4LFC Q;  1TWC B;  4RHR A;  2HDL A;  5M3F G;  1IW7 D;  3HOV B;  4OO1 G;  3M4Q A;  5LMN W;  4C1N I;  1XNQ Q;  1B50 A;  2IHE A;  4C3H B;  4DR6 Q;  4C3J G;  1TII D;  1WFQ A;  3JC6 6;  4BBR G;  4ZQ3 A;  2LMC B;  1E7Z A;  3TRE A;  5C3E G;  5E1F A;  2ZM6 L;  1D6E C;  5HGT A;  4QY7 A;  2UXC L;  1C8C A;  3KK7 A;  3CXC A;  4K0K L;  1H9J A;  4DK6 C;  1CI3 M;  2F0I A;  3Q8D A;  4XQN A;  2JN4 A;  4R8N A;  1ICF B;  1CUK A;  1HJP A;  1CFM A;  1SYF A;  2QA4 A;  2SDF A;  3OIQ A;  4JI0 Q;  4DV4 Q;  5M5X B;  4KV6 A;  2RQX A;  2EIF A;  2N3S A;  2PW7 A;  2UXB L;  3ULL A;  1IBL Q;  4NXM Q;  3H15 A;  1YI2 A;  3I73 A;  3G6E A;  4HJA A;  4LF4 L;  3PCO B;  1L0W A;  2I07 B;  5KGU A;  4CJ0 B;  4H02 A;  1N34 Q;  1BVS A;  4YWK A;  1I50 B;  1HNX L;  2Z4I A;  3IAY A;  3UE1 A;  2F3V A;  5CBE E;  4IFD H;  3E3X A;  3VA7 A;  4OO1 I;  1IBL L;  1LM0 A;  2R92 B;  3BU2 A;  2AUK A;  1EIG A;  2UUC Q;  1H9S A;  4X65 Q;  1EY6 A;  2JP1 A;  2JK8 A;  2QIL A;  2FJ2 A;  5D14 A;  2DY8 A;  1WD0 A;  4PG3 A;  4XDX A;  1SNO A;  2FIN B;  1R4P B;  1BUV T;  3SEB A;  4CDF C;  2VY3 A;  1DCZ A;  3RN2 A;  1B3A A;  5A35 A;  4R8I A;  4A93 B;  4WRD A;  2K04 A;  1TS5 A;  1J5E Q;  5CC4 A;  5BN4 A;  3H6M A;  1E3P A;  1EY8 A;  1ICW A;  2JA9 A;  2F4I A;  5JPM C;  3NEM A;  2B2V C;  2F0K A;  4DV2 Q;  2R92 H;  5IIF A;  4IPG A;  2E8G A;  4JYA L;  5C44 G;  5JJZ A;  5ELO A;  3U4Z A;  2C35 B;  5IT9 c;  5LMN L;  3X3N A;  1OO9 B;  1V1Q A;  5C4J H;  3ZJY C;  3Q23 A;  3S17 B;  4F7X A;  3F2D A;  1BOS A;  1V8Q A;  3VYS A;  4ILW A;  1HUN A;  1XMQ L;  1GOZ A;  5FKA C;  1GM5 A;  4CDC C;  2NN6 H;  1STE A;  5LL6 S;  2VUM B;  1NE3 A;  1VQG A;  3G71 A;  1D7Q A;  1I5F A;  4JYA Q;  4WJW A;  2UU9 L;  1VQ6 A;  1WCM B;  3I4N G;  2PW5 A;  4Y7N B;  2F0U A;  5LHY 1;  1B44 D;  3M4Y A;  4JC0 A;  2BOS A;  3DHQ A;  3S15 H;  4Z9C B;  1VQ9 A;  1STG A;  2IX3 A;  1Q8I A;  4L5R C;  3OOC A;  5J1Z A;  2EXZ A;  2CH4 A;  4A3K H;  2CW0 D;  1KRT A;  5CR3 A;  4KD4 A;  3FKI H;  5M5W B;  4UHV A;  1O7I A;  1HNX Q;  1SE3 A;  2YU9 B;  2E2J H;  3STB D;  2B63 H;  3AB9 A;  3MVV A;  4KD3 A;  4KKS A;  5IP9 G;  4CKC A;  3K57 A;  3C46 A;  5K36 H;  4GN3 B;  1GO3 E;  2F0D A;  1Y8N B;  4A3F B;  3BVG A;  4GOP A;  1TWH B;  1HR0 Q;  3QG1 A;  1XWE A;  5JJK A;  4DV0 L;  1IBM Q;  1LT5 D;  2AQ1 B;  3NUC A;  2RCN A;  4HJ9 A;  1B53 A;  4PQX A;  5C4H A;  1AFP A;  2WB1 E;  3CPF A;  2EE1 A;  1IHZ A;  3R2I A;  1UEB A;  2KHJ A;  4L6T B;  1X9N A;  3K58 A;  2IX1 A;  2K50 A;  5IP7 H;  4N8X 1;  1Y1W H;  3GTG H;  5ELF A;  2MNA A;  1JWS D;  2IWH A;  2VQF L;  3OHX C;  2JA5 H;  1GD7 A;  4OWT B;  2LKV A;  2F0P A;  3EBE A;  2H4O A;  4YCU A;  2JSO A;  2A8V A;  4H44 C;  4B3S Q;  2PQA B;  3J81 E;  4OHJ A;  2O5I C;  1N32 L;  2F0J A;  4QIW B;  4A3M G;  3TP5 A;  3H91 A;  2NVY H;  4JI8 Q;  4DR3 L;  2F0G A;  3R93 A;  1JOK A;  1EWI A;  2HCI A;  1YJ9 A;  3GTK H;  2B29 A;  2G9H D;  1TY2 A;  3ULP A;  1FGU A;  2N8N A;  4L5Q A;  2K5Q A;  1L1O A;  2RF4 A;  4KY7 A;  3PUY A;  1TVX A;  2WFW A;  5JPN C;  1Z7T A;  3ULJ A;  4HJ5 A;  1CKN A;  3A7A B;  1FL0 A;  2KOL A;  4UDU C;  3I72 A;  3FP9 A;  1AE2 A;  2KCC A;  3TP7 A;  1TWF H;  5J39 A;  1Q86 C;  1M4V A;  4BA1 I;  3R8B A;  3LNN A;  3SHL A;  4CJ2 C;  1GUW A;  3OW2 A;  1SFO B;  3VR4 A;  2R6G A;  4O42 A;  4P74 A;  4UPA A;  1AZQ A;  4RKL A;  1KLG D;  3TRZ A;  4DUZ L;  2BDN A;  1HZC A;  2A5H A;  1BDO A;  3HOW H;  3GTL H;  3M3Y B;  4K5X A;  3QB3 A;  4L63 B;  1X3P A;  1WTO A;  1XPO A;  4RKB A;  1RCV D;  3V96 A;  3AQQ A;  2PNR C;  2RSN A;  2LY7 A;  3FPU B;  1KAW A;  4FXG C;  4LF9 Q;  4JI3 Q;  2B8G A;  4EQN A;  5ELD A;  5C5L A;  3VR2 A;  2VQF Q;  1RIP A;  3CRL C;  4ZAI A;  1GUN A;  1U5K A;  4OEL B;  4LF7 Q;  1F2Z A;  3MEH A;  3E6Z X;  4JV5 Q;  3J7A V;  3P1H A;  4MN3 A;  1VQ4 A;  1S40 A;  2RSO A;  2F52 A;  4A4I A;  3LX0 A;  3PGZ A;  4DAV A;  1MKH A;  3TSS A;  3C1E A;  1I94 Q;  5JEA H;  4R1J A;  3A8J E;  2EYM A;  2WAQ E;  4LF6 L;  2O5J C;  4Y52 H;  1PH6 A;  2XWB B;  2PPB C;  2R93 H;  2OQK A;  2PMZ E;  1XTD A;  2BCO A;  4EX5 A;  4ME3 A;  5KND A;  1I6H B;  3S1Q B;  3F2B A;  1FJG L;  4C3H H;  1EYA A;  1HQR D;  4LNQ A;  2E75 C;  5KEE A;  2GN5 A;  1Y1W B;  4X6A H;  4JOI A;  3TP6 A;  3N6R A;  5JVG 3;  3CCE A;  1KD1 C;  1M1K C;  3S9W A;  1BO0 A;  1H9S B;  3OTO Q;  3CHB D;  5DEH A;  5IYC H;  3NQI A;  2YTY A;  2SNS A;  2JA7 H;  4BY1 G;  2DGY A;  3I2Z A;  3JAM E;  1TS2 A;  4MZ9 A;  2VB3 X;  4GNX B;  1B1Z A;  2UUB L;  1AN8 A;  5DM6 3;  1JC7 A;  5T1G A;  3IRB A;  5M3F B;  4IFD J;  1JE4 A;  4JI1 Q;  4XYQ A;  2KQ3 A;  4K0K Q;  4DR5 L;  1G51 A;  3M9B A;  3ZYY X;  5HUR A;  4LWC A;  3A55 A;  3TDQ A;  2Y0S E;  4P71 A;  2F0F A;  3D6W A;  1PRT B;  5C4Z A;  1YNJ D;  4H0L C;  3F2U A;  2B2U A;  4YCV A;  1TWA B;  4K5W A;  4LF8 L;  2EYF A;  1JWU D;  5M3M B;  3T1Y L;  1A0I A;  2I5H A;  1CKN B;  1I4Q A;  1LYL A;  1OTC A;  2CQA A;  1PH8 A;  3SGI A;  1BKB A;  3CF5 A;  3TN2 A;  2B8F A;  1U4P A;  4LF5 L;  3ERO A;  1ZEQ X;  1ILQ A;  2QW7 A;  2EYP A;  1STN A;  1U0L A;  3HGB A;  1AW7 A;  4C2M B;  1JE5 A;  2D5D A;  4LK1 C;  2OCE A;  1CTM A;  4DR3 Q;  3DLL A;  2XVS A;  2ZXO A;  1FNU A;  1PMR A;  4PMB A;  5KIX A;  2F0N A;  4GNX C;  2EDG A;  4OEM B;  2UXD L;  2ASB A;  2ZTD A;  4MNO A;  4LFA Q;  2GVB A;  2EXD A;  1YIJ A;  5IGB A;  1XYI A;  1GJX A;  3VR3 A;  3J7Z C;  4DK0 A;  4LFB Q;  3DEO A;  3DUZ A;  2CVR A;  2FHT A;  1STY A;  1TWH H;  4JCV E;  1Y1V G;  3O13 A;  4B9X A;  5M5Y H;  4YWM A;  1CZG A;  3RLN A;  3HOW G;  4C3J B;  4IUR A;  3KDF B;  4KHZ A;  1STA A;  3K7U C;  2WB1 G;  4Q0F A;  1D2B A;  1Y1V H;  1CK1 A;  2DJG C;  5A2Q E;  3KFU A;  4J6H A;  4BS9 A;  1ZKO A;  2R7Z B;  3GDE A;  1VQH A;  4Y7N H;  3PO2 B;  2CKZ B;  2K5V A;  3KLS A;  4J15 A;  1VQC A;  3R3O A;  4RGM A;  3U4V A;  1HNZ L;  1CQF A;  2XTI A;  4GKJ L;  1EY5 A;  1Q1B A;  2HHH Q;  4JW0 A;  2MJ8 A;  3HKS A;  4EVO A;  3A5Z B;  1DOK A;  1JOO A;  1B2T A;  3DWA A;  1K83 B;  1QUQ B;  3J80 i;  1KQS A;  3K8A A;  3KF8 A;  4P73 A;  3SK4 A;  2WAQ G;  1GUS A;  2C5C A;  1HNW Q;  3DMU A;  4OIK A;  3CD6 A;  2R7Z H;  1PH3 A;  5D3I B;  4DR1 Q;  1Z9F A;  3J81 L;  1CHP D;  2UXB Q;  2JA6 B;  2Q8R E;  4X62 L;  1AE3 A;  2K7V A;  2QF7 A;  4HJ7 A;  1JOQ A;  1D5X C;  2X69 A;  4N8F A;  5JOB A;  4BA2 I;  2JA6 G;  5C4X G;  1UEA B;  2OXP A;  4AQY Q;  4A3B B;  3RMH A;  2BE5 C;  3HOY G;  2BA0 A;  4A3J G;  1PH5 A;  1YHA A;  4HIK A;  2VL6 A;  2JE6 I;  2MUY A;  1KLU D;  3J7Y W;  1EWH A;  1Y1W G;  3W1B A;  4JI2 L;  2QDB A;  4RFB A;  3K5O A;  2A6H C;  2JA5 B;  2KED A;  1SYB A;  5IT9 E;  1F2M A;  3GTJ H;  1NY4 A;  4IOA A;  3MXG A;  4DR6 L;  5D3D A;  2BDO A;  2WIN B;  2K05 A;  3DWQ A;  3QR8 A;  1QZH A;  3I91 A;  5BN5 A;  1STB A;  4PNY A;  3E9I A;  3PO2 G;  2A73 B;  4FF1 A;  3S2H B;  2B2V A;  1QB5 D;  1HTL D;  1YIT A;  1NNX A;  4AYB E;  4U68 A;  3NXW A;  1VQ5 A;  2QEJ C;  3H0G B;  2LXJ A;  4N9T A;  2L0C A;  1ZXT A;  4RMF A;  2EY1 A;  1L0Y B;  2X6L A;  1LAB A;  4A3K G;  4UY8 C;  1WD1 A;  4A3B H;  1Q12 A;  2EQS A;  1CT1 D;  1IBK L;  5LMN Q;  4F88 A;  1Q1E A;  1RL2 A;  2OQ0 A;  1TWA H;  1HHV A;  4A3K B;  4APV A;  3A5U A;  3I90 A;  4DV6 L;  2OT2 A;  1K0R A;  1JJG A;  1CSP A;  4A76 A;  3T1H Q;  1HR0 W;  1WTR A;  2JA8 H;  1W6K A;  4DV7 L;  1PH9 A;  3PO3 B;  4O1N A;  1D5Z C;  3DXJ C;  4X3S A;  3T56 B;  1WCM H;  1CKO A;  5C4X B;  3S1M H;  4KJN A;  4HCE A;  4LUO A;  2A69 C;  3NP8 A;  4IOC A;  4DUY Q;  1XPR A;  4A93 G;  4XT1 B;  5C44 H;  3HOV H;  1Y14 B;  1F9Q A;  2JA8 G;  4QQB X;  1T5X D;  1K0S A;  1F77 A;  2PZU A;  3CC7 A;  1Q81 C;  3TBI B;  1QVF A;  2EY2 A;  4POG A;  4IAL A;  3DWP A;  4JI2 Q;  5EPL A;  1SRO A;  3M7G A;  5E4X A;  4FYD A;  3SVM A;  3EFX D;  4HID A;  1A3V A;  3OTO L;  2PCF B;  4YY3 Q;  3MHB A;  1STH A;  3NHH A;  4L5T A;  1U4L A;  5IWA L;  4DR4 L;  5ISR A;  4JI3 L;  3TME A;  1S72 A;  2FXQ A;  5CV9 A;  1H9K A;  1LTS D;  2KHS A;  3HKZ E;  5G3L D;  1WCM G;  5J3B A;  2KEE A;  4NB3 A;  1O7Z A;  4JI1 L;  4A3I G;  1XNR L;  1IKM A;  1Z47 A;  3KOJ A;  1RJT A;  4YWL A;  1OXU A;  4JI6 L;  4DV3 Q;  4A3E H;  1XMQ Q;  3HOX B;  1EOV A;  5CV5 A;  2QCP X;  4NXM L;  1SJH D;  5J22 A;  5IGF A;  1SMX A;  2A6E C;  2OTJ A;  5DAU A;  1CQV A;  1ZYR C;  1XXG A;  3CP0 A;  3A8K E;  5IGE A;  5C44 B;  3D3R A;  2G9D A;  1I94 L;  2KHI A;  4X3K A;  2JEA I;  3OW7 A;  2F0M A;  3CCU A;  1Q82 C;  4RHS A;  3RLF A;  1IZ6 A;  1W2B A;  3HOZ B;  1IYV A;  3OWE B;  4NPS A;  3GTP H;  4A3J H;  1X6O A;  3MC0 B;  3HOY H;  2K33 A;  1VMC A;  2Z6B A;  2ZXP A;  3KJP A;  3BDL A;  1SN8 A;  3NBH B;  3EJI A;  1VQO A;  1A62 A;  3S14 H;  5EKL A;  1EZ8 A;  2ZJQ A;  1JCK B;  3D8G A;  1YZ6 A;  4P75 A;  1X3F A;  4DAY A;  1MBY A;  2EZV A;  2IJ0 A;  3M3Y H;  3HZX A;  3HOW B;  3G6J B;  4JPB W;  4NW2 A;  4YHH Q;  1A2U A;  4WFN 3;  4IUP A;  3NEN A;  4C3J H;  1NTG A;  1PYB A;  1GKH A;  1SYE A;  3L9A X;  5IP7 G;  3PMF A;  1MD2 D;  2F4V Q;  2VW9 A;  3D4R A;  5IGC A;  3WOE A;  3FHW A;  4ZK9 B;  2UUA L;  2B3G A;  3KLS X;  5EQ0 A;  1A8V A;  4C56 C;  3HG9 A;  1YNJ C;  1RF2 D;  3JAM L;  1CA6 A;  1PVO A;  1G6P A;  1I4G A;  5AFW A;  3PUX A;  1VDZ A;  4X66 L;  2L55 A;  1KNA A;  2ZTE A;  5HGQ A;  4EQ5 A;  4OXP A;  1VQD A;  1NUC A;  2VB2 X;  2PO4 A;  3RZO H;  1I6H H;  5DM7 3;  3VR6 A;  1BXT A;  1QVC A;  1PH1 A;  4LUV A;  3PUZ A;  5ELN A;  2BA1 A;  2RDH A;  4BBS B;  2IL8 A;  1PHJ A;  1IW7 C;  3Q24 A;  3C2P A;  1EU4 A;  4XQQ A;  1SLJ A;  2A68 D;  4POF A;  3J80 c;  2D62 A;  1EIF A;  3HRZ C;  3RR5 A;  2E5L Q;  5CV4 A;  1EYD A;  2E2D C;  4HR7 B;  3S16 B;  2XNA C;  2K01 A;  2NN6 I;  3UDG A;  1MHW C;  1S4Z A;  1HNW L;  4MTK A;  1WTP A;  1GHK A;  2HQE A;  2PZW A;  3CCJ A;  1PFB A;  1NCV A;  3NPP A;  2CFM A;  3SR1 A;  4L8J A;  3MFY A;  1V9P A;  4HED A;  3KF6 A;  3HOZ H;  4NMZ A;  1UE1 A;  5I2X A;  4LJZ C;  1EIH A;  1S5D D;  1ET9 A;  2QKI C;  2N78 A;  1HFG A;  1BCP C;  5C4J B;  1F9S A;  4E6I A;  3PUW A;  3SE0 A;  2Q8T A;  4JBM A;  3A8I E;  1N34 L;  2K5H A;  3MFG A;  2AHO B;  4MIU A;  1A2T A;  3BYT B;  3S1R B;  2JQO A;  4NXN L;  3RN5 A;  2EYL A;  1RD9 D;  5BR8 Q;  2Q2T A;  1OXV A;  2CWA A;  4IPH A;  3OIP A;  4KLK A;  5IYD G;  1Q46 A;  3NTI A;  4FVM A;  4JI0 L;  4A3G G;  1W6J A;  4DGZ A;  4EGV A;  2V1C C;  4FF4 A;  3IL8 A;  4A3I B;  1NSN S;  3H3V H;  2CHB D;  5C5M A;  1VF7 A;  1CSQ A;  4KK7 A;  1C48 A;  2N49 A;  3FMC A;  5E7N A;  1EQR A;  2JEB I;  5BR8 L;  1BCP B;  1V1O A;  3RZD B;  2AKW B;  3CCL A;  2A69 D;  1Y69 U;  2Z9H A;  3D6C A;  4IPD A;  4DV3 L;  5E3F A;  3D31 A;  4CKE A;  2O2L D;  3IKJ A;  3PV0 A;  1N9W A;  1LTT D;  5DLQ E;  3T1H L;  2P5Z X;  1M8A A;  4DV6 Q;  3BZC A;  4UP8 A;  5I6Y A;  5I2Y A;  1HQM C;  1Y8P B;  4V19 0;  3CMA A;  2A1A A;  2MHV A;  3MTS A;  2CH4 W;  4B08 A;  3GP7 A;  4X64 Q;  2QGQ A;  1LTA D;  1UNS A;  3Q6S A;  4JV5 L;  1C7Y A;  1ESF A;  1DJR D;  2L9H A;  2X6G A;  2EJF C;  1K28 A;  5C0X I;  5M3M H;  2PI2 E;  3U50 C;  3AU7 A;  3R2T A;  2H1E A;  2Z6K C;  2OF1 A;  4R4T A;  1JR0 D;  1J5E L;  3ITP A;  4IUT A;  1VQN A;  1EYC A;  3PO3 G;  2RHS B;  3E0J A;  1XTC D;  4IUN A;  2NVT B;  1K8M A;  1HTP A;  1I4R A;  2IHF A;  2ID0 A;  5EGT A;  2PYK A;  3CCV A;  5M5Y B;  5M3F H;  2K03 A;  2J0T D;  4JK1 C;  4NKL A;  4XQJ A;  4K2L A;  3PIO A;  1XNQ L;  4DV5 Q;  3M4O B;  4R4Q A;  3STB C;  1IXR A;  5JVH 3;  2ZJP A;  1QUQ A;  1C4Q A;  2UXC Q;  3BG3 A;  4KHV A;  4RGT A;  1EEF D;  3E0E A;  3G7L A;  3EQL C;  3BYY B;  1HZB A;  1RKN A;  2F0T A;  4KY5 A;  4JI6 Q;  3VA5 A;  5KRU A;  4FXK C;  3G4S A;  4QL5 A;  1TY0 A;  4JI5 L;  2NVT H;  2Z4H A;  4IUV A;  4HIM A;  1KDB A;  4L5S A;  1CA5 A;  2Q2U A;  4I7Z C;  4OWW B;  3S1Q H;  4TVA B;  3RNU A;  4QMG A;  4JBW A;  3QO2 A;  3BVZ A;  3G48 A;  2V4D A;  3K5M A;  4K6L A;  1EYG A;  4LF4 Q;  5GAE C;  3WDN A;  3RZO B;  1LTG D;  4OGQ C;  2NBF A;  1SSO A;  5FLX E;  3GTQ H;  1IBM L;  4IQZ A;  2JXM B;  4HMI A;  1VQ7 A;  4QIW E;  2L1B A;  4V0B A;  4B3T L;  1WOC A;  1SJE D;  4O0A A;  3OWF A;  3X3M A;  3HKZ G;  4A3M H;  4LF5 Q;  4QJF A;  5T1I A;  1K8A C;  3RZD H;  1EEI D;  2Y0S G;  2Z6K A;  4ZUI A;  1VQE A;  3BVM A;  2F0S A;  3UDF A;  1S5F D;  5ELE A;  4F87 A;  1LLR D;  1VQI A;  1YNX A;  2ZXR A;  3OMG A;  2WII B;  1VQ8 A;  3M4P A;  1FNW A;  2K75 A;  2MP1 A;  3SK8 A;  1XNR Q;  3M7N A;  3W3A A;  1FGB D;  1SXT A;  1TKW B;  5G3L F;  1WVL A;  4DPG A;  1K3R A;  4PMW A;  1QNK A;  2A68 C;  3L2P A;  2KJX A;  1EQT A;  1F9P A;  3GV3 A;  4TRD A;  2M2L A;  1AH9 A;  4DAY B;  1O7Y A;  2IT1 A;  2HQL A;  4GLV B;  3LWU A;  1R9T H;  1KL9 A;  2NZH A;  4KHP Q;  4JI7 Q;  2A19 A;  1K9M C;  2IX0 A;  3KDF A;  1EUJ A;  4ZLT F;  1ASZ A;  3PF4 A;  2B2T C;  2D0O A;  4GOP B;  5JAV A;  1IBK Q;  1Q8K A;  2WKD A;  1VQB A;  4H7B A;  2VXW A;  4PV1 C;  4BBR B;  4H13 C;  4DR2 L;  2VS1 A;  5CV6 A;  1KRS A;  2RKS A;  2XN9 C;  5FO8 B;  2O4X A;  2B63 G;  2NTT A;  2XGT A;  2L5T A;  3B6Y A;  4EQP A;  3NE5 B;  3HEJ A;  2Z8L A;  5C0X G;  1SNC A;  2GA4 B;  3RD4 A;  4CGY B;  5M9O A;  1PZI D;  3PQI A;  1F2L A;  3I4N B;  3PF5 A;  3L0O A;  4FNF A;  3K5N A;  3J81 i;  4GZY C;  1WTV A;  1O78 A;  4ME5 A;  1A15 A;  4M1U B;  3K5L A;  4A3I H;  3S1N H;  2KEN A;  4R4C A;  1YJN A;  1SYD A;  1PZK D;  1SNP A;  5TSS A;  3NEL A;  1PTO C;  4IFD I;  3MA2 B;  4RWS C;  4OX9 Q;  1I4P A;  2YV5 A;  1WJJ A;  1B9N A;  1XMO L;  3AFQ A;  3H94 A;  3V2T A;  4DXF A;  4JVZ A;  1R4Q B;  1PH7 A;  1TQO A;  1WTH A;  2CQO A;  1VQK A;  1LTL A;  4CHT B;  1QE6 A;  3V05 A;  3DM1 A;  1A63 A;  3VR5 A;  3KF8 B;  1NBW A;  4I7A A;  3T53 B;  4G7Z C;  1JMC A;  2I46 A;  5LMU Q;  3HOV G;  4DK3 C;  1CHQ D;  1X56 A;  4A3M B;  3HP3 A;  2MO0 A;  3CCM A;  2K32 A;  2RDG A;  3S1M B;  3I8Z A;  4DV2 L;  2E2H H;  4JI4 L;  2E2J B;  1G8Z D;  3PO3 H;  1G2S A;  3EA6 A;  4KKU A;  1IYU A;  1GUT A;  1PTO H;  3HOU G;  2JA8 B;  1YBY A;  1Q90 A;  3DEP A;  2OTL A;  3KUP A;  4IN3 A;  5C0X J;  2NVY B;  2R92 G;  1BF4 A;  1UAP A;  3SDZ A;  2XRQ D;  1EWC A;  1MI2 A;  1Q3L A;  1KXL A;  1HH2 P;  2EJG C;  4CJ1 B;  3S14 B;  2E2I B;  2F1M A;  2NVQ B;  2HIV A;  5CYU A;  3CAM A;  2UU9 Q;  1L0X B;  2R7F A;  3ICE A;  1BQQ T;  1XX8 A;  4S3S A;  4X64 L;  3GTM H;  4B3M Q;  4JBJ A;  2E74 C;  1H9M A;  4DR7 Q;  4RAU C;  4ID6 A;  3EN2 A;  3UI2 A;  4XYO A;  3S2H H;  4O2D A;  2KEC A;  1YNN D;  3SK5 A;  5IGD A;  4LUZ A;  4YHH L;  2WAQ B;  3VYT A;  3RLO A;  1WTX A;  3I3C A;  4A3D G;  1NAP A;  1I4H A;  5EBD A;  5IWA Q;  2JA7 B;  1J8I A;  3K6O A;  1SNM A;  2Y0S B;  4C3I B;  5EAY A;  1LTR D;  1A3T A;  1V1P B;  1VQF A;  1K73 C;  4BY1 H;  1WTQ A;  3K7A H;  2RA4 A;  1QG7 A;  4J8Q A;  1C9O A;  1DM0 B;  1FD7 D;  1ML0 D;  1PYS B;  5IYD H;  2Z1C A;  3CU7 A;  4DNI A;  1B3Q A;  4U67 3;  1YJW A;  1IL2 A;  3KYH C;  5EKI A;  1E22 A;  1TT2 A;  1U4M A;  3KBG A;  1V1P A;  3QWN A;  3FRP B;  4OO1 H;  4B3R Q;  4GLX A;  1KIX A;  2A74 C;  1HFN A;  4FXD A;  2YYZ A;  1QCB D;  5CMD A;  4DV1 Q;  2JA6 H;  2Z0S A;  4C3I G;  4BXX G;  2NYZ D;  3BZD B;  3CKI B;  4XIG S;  5DNF A;  1D1I A;  5EPK A;  4BY7 B;  1RTN A;  4IJL A;  4DUY L;  3KF6 B;  5FLX L;  3I4M G;  1DYQ A;  3HOY B;  4A3L G;  2MPM A;  1K8G A;  3C1F A;  2RDF A;  5C3E H;  4BBR H;  4GN5 A;  4OON A;  5C3E B;  2J4X A;  3SK6 A;  4OIJ A;  2F0E A;  1QWY A;  3MXU A;  3T13 A;  3AFP A;  2KCM A;  3CQZ B;  3J80 L;  4RCN A;  4BY7 H;  1VF5 C;  3TZD A;  3GTK B;  2LFN A;  3QOJ A;  1FR3 A;  2K4K A;  1MJE A;  4RH6 A;  4YY3 L;  1L1O B;  4AYB G;  4DR4 Q;  1LTI D;  1O7L A;  2FMM A;  1JB3 A;  5CGK A;  1YNN C;  1ASY A;  1U9R A;  2QDL A;  1HR0 L;  4PZ8 A;  3A74 A;  3KLR A;  3EVQ A;  3CCQ A;  1HPC A;  4MTN A;  2LSS A;  5COY A;  1XJV A;  1AEX A;  5E4W C;  1B9M A;  4K8I A;  3F1Z A;  3CME A;  2VNU D;  3MWY W;  1BBX C;  3PIP 3;  1MGS A;  2KCN A;  1N8R C;  5ELC A;  1XPU A;  2AMC B;  4LAA A;  3LWE A;  1O80 A;  3J81 c;  1LTB D;  3S1R H;  4K6D A;  5EBC A;  3P20 A;  2SOB A;  2K14 A;  4AH6 A;  3TP8 A;  2M00 A;  3W2D A;  2ZTC A;  3BZK A;  4G57 A;  4AYB B;  2IW3 A;  1EY9 A;  2F03 A;  1PYW D;  3U9O A;  2OEO A;  4R4O A;  1SYC A;  3M85 A;  1HA6 A;  2B2Y C;  2B39 A;  1DOL A;  1T9H A;  3EIV A;  3KBX A;  1UWV A;  5JEA J;  5I6W A;  3GTJ B;  4UP9 A;  4RCO A;  3WWV A;  3NBH A;  5LL6 X;  1X55 A;  2DN8 A;  4B3S L;  4P72 A;  1N32 Q;  2K52 A;  4KHP L;  4LFC L;  3UDI A;  2SEB D;  3NK9 A;  4KTA A;  2D2C C;  2CW0 C;  2B2U C;  3TQY A;  4LF7 L;  4FO2 A;  1EOT A;  3FKI B;  5M5W H;  2WV6 D;  1VQA A;  3HOX G;  2EYJ A;  1VQM A;  3NTH A;  1WI5 A;  1PTO B;  1KDA A;  5CV7 A;  1EFW A;  1IL8 A;  3NWT A;  5NUC A;  1LUZ A;  2D0P A;  1TS3 A;  4BBS H;  3BDO A;  4PMC A;  3F8T A;  1Q7Y C;  1DOM A;  2J7Z A;  2NZO A;  2IY5 B;  2KVM A;  1ZYR D;  4C1N K;  4X3T A;  2PI2 A;  5D65 A;  4K14 A;  2UUC L;  1WTW A;  3MXP A;  1KAA A;  3T4A C;  4NDX A;  4GNX A;  4HJ8 A;  5AJ3 L;  3K59 A;  4ODG A;  3MEF A;  4KN7 C;  2WAC A;  3GO5 A;  5BN3 A;  2JA7 G;  4A3D B;  1GHJ A;  2KBN A;  3BJU A;  1YHQ A;  2L12 A;  1VMP A;  1W3S A;  3URY A;  2F0W A;  4WJ3 M;  5IP9 H;  2NVX B;  3W1G A;  2F3W A;  3OMC A;  5IYB G;  2UUA Q;  4JI7 L;  1NR2 A;  3J7A 5;  3S15 B;  3FKI G;  1A6X A;  3C3L A;  4C3H G;  1KHI A;  1X32 A;  2BH2 A;  2NVQ H;  4GKJ Q;  4KY6 A;  5GAH C;  3VYR A;  2R93 G;  2XIW A;  2RVL A;  4TQU S;  2QEX A;  3DM3 A;  3OPO A;  3CCS A;  1K8O A;  1PFN A;  3S2D B;  1SE4 A;  4EQO A;  4WJ4 A;  2ES2 A;  1X3E A;  1BNZ A;  3VYU A;  5JEA G;  4BY7 G;  3ER0 A;  3ERS X;  1PH4 A;  2C9O A;  4JG2 A;  4R9W A;  2E2H B;  1SYG A;  3TEH B;  1EQV A;  1S5E D;  3VDY A;  1PRT F;  3H0G G;  1MJC A;  2B2W A;  2XRS D;  4K8J A;  3MXN B;  4ULL A;  4X65 L;  1SMY C;  2A6E D;  3D4D A;  4FF2 A;  1PTO D;  3GQB A;  5EPJ A;  5IY0 A;  4HN7 A;  4BXX H;  1GUG A;  2EOT A;  2YTV A;  1SAP A;  1PXU A;  4PZ6 A;  4QCL A;  1G2T A;  2G5D A;  3CPW A;  1QZG A;  1TXY A;  3J81 j;  1E24 A;  4HAE A;  4QUF A;  4ZKC B;  4RGO S;  2UXD Q;  4RG1 A;  2ZJR A;  1X3G A;  4A75 A;  4CBV A;  4KN4 C;  1YVC A;  5EKK A;  2I0Q A;  3GTO H;  1ENC A;  2UUB Q;  1KAB A;  2HT1 A;  4A3G B;  1CM9 A;  2DNE A;  1BBU A;  4DN4 M;  4FF3 A;  3AYH B;  4IJH A;  1L2F A;  5JJL A;  5JJI A;  1RDP D;  1PFS A;  4IFD G;  4BY1 B;  3I55 A;  1TWC H;  4A3D H;  3OSO A;  1PLF A;  4R4I A;  1MIU A;  1PV4 A;  2LS0 1;  3S24 A;  2F0H A;  1BCP D;  3JAM i;  1CKM A;  1PZJ D;  1JWM D;  5M5X H;  1EU3 A;  1VCI A;  1QIL A;  1A3U A;  4DKA C;  3T1Y Q;  4PZ7 A;  4LF8 Q;  4IZ8 A;  1JJ2 A;  3KJO A;  1PRT D;  4BBS G;  1TWG H;  1DZ1 A;  2Q2H A;  3S2D H;  3S16 H;  4CKB A;  2Q8I B;  4KI0 A;  1ILP A;  2JYO A;  3HOU B;  2H5X A;  5IT9 L;  5C4X H;  3W5O A;  4AIM A;  4KJO A;  2XWJ B;  2HDM A;  4Q5V A;  1SRU A;  2AQ3 B;  1MSH A;  1SND A;  1RTO A;  2R3Z A;  2E2I H;  5COR A;  2NTS A;  2R7Z G;  5EJW A;  1T5E A;  1ONL A;  3PSI A;  2ZT9 C;  2WB1 B;  2CWP A;  2R7D A;  1B8A A;  1OXX K;  1Z6H A;  3HFZ B;  1HXY D;  4ZYS A;  1G6Z A;  2F0O A;  2NB0 A;  2PQE A;  1RHP A;  4P2C B;  1SEB D;  4LW1 A;  3NSW A;  2VUM G;  1X3Q A;  4HTH A;  4HSV A;  4DUZ Q;  1N36 L;  1SDF A;  3U58 A;  3TZU A;  1SE8 A;  5KYI A;  1E2Z A;  4A3F H;  2PNH A;  3GTO B;  1G91 A;  1E2W A;  4HMJ A;  5AJ3 Q;  1HRJ A;  3D4W A;  2AWO A;  1EY7 A;  3GD7 A;  3QJY A;  1SMY D;  2XSC A;  2YU9 H;  4DV0 Q;  5K36 G;  2KA7 A;  4DV1 L;  3KLW A;  1E1O A;  2N55 A;  4K2K A;  4FP5 D;  4UP7 A;  3T16 A;  1HCZ A;  4IUQ A;  5IGG A;  1IKL A;  3CCR A;  1ESR A;  1LT3 D;  1S5C D;  4DR2 Q;  5A2Q L;  1SFO H;  2MFI A;  3TS0 A;  2K6A A;  2ICI A;  3S1N B;  2PZT A;  4X66 Q;  2EYH A;  1G29 1;  4KKT A;  4N9P A;  3I70 A;  1PA6 A;  2R93 B;  1X65 A;  3CRK C;  2MGS A;  4JI4 Q;  2NZ1 D;  2VQE L;  4M8A A;  4OL7 A;  5KNC A;  1TU2 B;  2HCC A;  5C0X H;  4ALP A;  4B3T Q;  3I4N H;  3GTP B;  4G7O C;  2VUM H;  2NUC A;  1PTO F;  1HUM A;  2IPK D;  1YEZ A;  4DR1 L;  4YIJ A;  1LAC A;  2Q2I A;  1C0A A;  2NN6 G;  3S17 H;  1V43 A;  1N33 Q;  4GKK Q;  4QF4 A;  3A7L A;  4X62 Q;  2N88 A;  1B7Y B;  2KUM A;  1PH2 A;  1K83 H;  4A3L H;  3FPP A;  4QGU A;  5IE8 A;  1LV9 A;  5GAG C;  1JOR A;  1TR5 A;  3NWS A;  1AP0 A;  3U9S A;  3ND8 A;  1ENF A;  3T51 B;  4A3C H;  2SNM A;  3WOF A;  5FLM H;  2TSS A;  4DXG A;  5K5P A;  4ZUJ A;  4XTC S;  2TMP A;  2DNC A;  3Q0A A;  1UE7 A;  3RUZ A;  2F3I A;  3F2C A;  4GLA C;  5FO7 B;  1B4O A;  1IYJ B;  2EYO A;  3GTG B;  3IFD A;  4ZCK A;  1JB7 A;  5LMU L;  1NR4 A;  4DU9 A;  1JJC B;  1H9R A;  1HZ9 A;  3QIA A;  1GUO A;  3K81 C;  1PFM A;  2HIX A;  2ENB A;  1JT8 A;  2L4N A;  4DAM A;  2ZM6 Q;  3BS1 A;  4DFA A;  5IYC G;  1VQJ A;  1PDQ A;  4YCW A;  1HA5 A;  1F2Y A;  1ET6 A;  1LT6 D;  1M90 C;  3I7F A;  3FEW X;  3P75 A;  1I6V C;  3ND9 A;  4GN4 B;  1S5B D;  2PMZ B;  3H3V I;  4C2M H;  4DV7 Q;  1F9R A;  3A56 A;  3E9H A;  3K0Y A;  2CCZ A;  2DUD A;  4KMU C;  1EY0 A;  1UE6 A;  4GOP C;  1NJI C;  3GTM B;  5FO9 B;  4DR7 L;  4JI5 Q;  2A6H D;  1N33 L;  4A3E G;  4GKK L;  1CZW A;  1MSG A;  5C6A A;  4DAP A;  3MXN A;  2ALY B;  1XMO Q;  4I65 A;  5ELB A;  3HOU H;  4TSS A;  1DON A;  1U4R A;  5IOC A;  3H0G H;  5CBA E;  1ROD A;  2AUJ D;  2AQ2 B;  3NTK A;  4DV5 L;  2NVX H;  4DA2 A;  1KDC A;  1SE2 A;  1D8L A;  3QOL A;  3K0X A;  1GXD C;  1ENA A;  3HKZ B;  2MQH A;  2YTX A;  5FOB B;  1JIC A;  2ATW A;  1I3Q B;  2K28 A;  2VZA A;  3TS2 A;  3P7J A;  5IOD A;  4NP5 A;  4DR5 Q;  3AEV A;  3J7A F;  3I56 A;  4ABN A;  4NXN Q;  1QNU A;  1OXT A;  3CW2 C;  1AZP A;  3AMU A;  4B9W A;  1QOH A;  3M4O H;  4QB4 A;  4DK1 A;  4OX9 L;  4RGN A;  4HSP A;  2F4V L;  2DJF C;  2MO1 A;  4DF7 A;  1EL0 A;  4A93 H;  2B2Y A;  2JJQ A;  3L7Z C;  4G4K A;  4X3U A;  1YHB A;  3MZ5 A;  1FNV A;  4JBK A;  2EY5 A;  1P8L A;  3CC4 A;  2B63 B;  2DY7 A;  3H3V C;  1EZ6 A;  5I4D A;  3JAM c;  3PIP A;  2RHQ B;  1LT4 D;  2HHH L;  2LXK A;  1NMF A;  4TKO B;  1BR9 A;  1EFI D;  2BE5 D;  3D0F A;  3UE0 A;  2OWO A;  1VQP A;  5M3M G;  3L3O C;  3ONA B;  1II3 A;  1QJO A;  2WKC A;  4CDE C;  1EQQ A;  3BDC A;  2EVB A;  2I5L X;  5GQO A;  4B3R L;  4A3J B;  4FDB A;  4A3B G;  1GVP A;  1EY4 A;  3LGJ A;  4HIO A;  4LF6 Q;  4DNT B;  1KTK A;  1TWG B;  2B2W C;  2EY6 A;  5IYB H;  5FJ8 G;  1HNZ Q;  4LFB L;  4HCS A;  4LMQ D;  4JI8 L;  1BCP F;  1E2V A;  4J1M A;  1BBW A;  3HS0 C;  1L1O C;  1DXM A;  1DGS A;  2AWN A;  2FFK B;  2K5D A;  1QVG A;  3PIO 3;  3NBI A;  3I4L A;  3PO2 H;  3SXH A;  4BWG B;  3HOX H;  2D9U A;  4A3E B;  5KNB A;  1FVI A;  3K80 C;  4ZRZ A;  4IUU A;  1Y1V B;  1SBB B;  2RBM A;  4DNR B;  4IO9 A;  2PQA A;  1H95 A;  1I4X A;  3I4O A;  1LO5 D;  1D1K A;  2K5N A;  5FK9 C;  5CV8 A;  2L15 A;  4A3G H;  1N36 Q;  4GS3 A;  5GRO A;  2JA5 G;  2GVA A;  5I9O A;  2F0Q A;  2E76 C;  2M9V A;  4WOR A;  1UE5 A;  4AQY L;  3GTL B;  4XXE A;  4OWX B;  3N52 A;  4RA8 A;  4CDD C;  1VS0 A;  5FLM G;  2B2T A;  4A3C G;  1B70 B;  1E0B A;  2F0V A;  4ZKB B;  1PRT C;  1P16 A;  5GAD C;  1TWF B;  1D5M C;  3GV6 A;  3CQZ H;  1I50 H;  3H09 A;  3CC2 A;  4LF9 L;  1WYD A;  3HOZ G;  3I4M B;  1KC8 C;  2FMC A;  3Q22 A;  3E5S A;  2WP8 J;  5FJ8 H;  4G7H C;  2VQE Q;  3A0J A;  4XT3 B;  2I5M X;  1NMG A;  2EPB A;  1TS4 A;  3ERQ A;  2E5L L;  1E1T A;  2K5W A;  1S3O A;  1OXS C;  4DV4 L;  2EJM A;  1DD2 A;  1SNQ A;  1R9T B;  3NQT A;  1UUP A;  3FDT A;  3IFT A;  5I9P A;  4F8M A;  5F2D A;  1KNE A;  3GTQ B;  5C3W A;  5HY6 A;  2ICE C;  1K3B C;  3OYY A;  1EIY B;  5H1S E;  2BH8 A;  1VQL A;  3MAQ A;  1J9O A;  2HD3 A;  2L11 A;  1Y8O B; 
#chains in the Genus database with same CATH homology
 4UAI A;  5C3X A;  5KYL A;  3FVQ A;  2F0L A;  2NWG A;  1FYC A;  3K7A B;  4K5V A;  2R61 A;  3J80 E;  2HUG A;  2K1B A;  4MHE A;  3A54 A;  3PUV A;  4QUC A;  1JQY D;  1TWC B;  4RHR A;  2HDL A;  3HOV B;  1IW7 D;  4OO1 G;  4C1N I;  1B50 A;  4C3H B;  4C3J G;  1TII D;  4ZQ3 A;  2LMC B;  5E1F A;  1D6E C;  5HGT A;  1C8C A;  3KK7 A;  1H9J A;  1CI3 M;  2F0I A;  4XQN A;  4R8N A;  1CFM A;  1SYF A;  2SDF A;  3OIQ A;  5M5X B;  4KV6 A;  2RQX A;  2PW7 A;  3I73 A;  2I07 B;  5KGU A;  4CJ0 B;  1I50 B;  2Z4I A;  3IAY A;  2F3V A;  5CBE E;  4IFD H;  3VA7 A;  4OO1 I;  2R92 B;  2AUK A;  1EIG A;  1H9S A;  1EY6 A;  2JP1 A;  2QIL A;  2FJ2 A;  5D14 A;  2DY8 A;  1WD0 A;  4XDX A;  1SNO A;  2FIN B;  1R4P B;  1BUV T;  3SEB A;  1DCZ A;  1B3A A;  5A35 A;  4R8I A;  4A93 B;  4WRD A;  2K04 A;  1TS5 A;  5CC4 A;  5BN4 A;  3H6M A;  1EY8 A;  1ICW A;  2F4I A;  5JPM C;  2B2V C;  2F0K A;  5IIF A;  5JJZ A;  3X3N A;  1OO9 B;  3Q23 A;  3S17 B;  4F7X A;  1BOS A;  1V8Q A;  3VYS A;  4ILW A;  1HUN A;  1GOZ A;  5FKA C;  2NN6 H;  1STE A;  5LL6 S;  2VUM B;  4WJW A;  1WCM B;  2PW5 A;  4Y7N B;  2F0U A;  5LHY 1;  1B44 D;  3M4Y A;  2BOS A;  3DHQ A;  4Z9C B;  1STG A;  2IX3 A;  1Q8I A;  3OOC A;  5J1Z A;  2EXZ A;  2CW0 D;  5CR3 A;  4KD4 A;  5M5W B;  1SE3 A;  2YU9 B;  3AB9 A;  3MVV A;  4KD3 A;  4KKS A;  4CKC A;  3K57 A;  3C46 A;  5K36 H;  2F0D A;  1Y8N B;  4A3F B;  3BVG A;  1TWH B;  3QG1 A;  1XWE A;  1LT5 D;  2AQ1 B;  3NUC A;  1B53 A;  4PQX A;  5C4H A;  1AFP A;  2EE1 A;  1IHZ A;  3R2I A;  4L6T B;  2IX1 A;  3K58 A;  5ELF A;  1JWS D;  2IWH A;  3OHX C;  2LKV A;  2F0P A;  2H4O A;  2JSO A;  4H44 C;  3J81 E;  4OHJ A;  2O5I C;  2F0J A;  4QIW B;  3TP5 A;  3H91 A;  2F0G A;  3R93 A;  1JOK A;  2HCI A;  2G9H D;  1TY2 A;  2K5Q A;  4KY7 A;  3PUY A;  1TVX A;  5JPN C;  1Z7T A;  3A7A B;  2KOL A;  4UDU C;  3I72 A;  2KCC A;  3TP7 A;  5J39 A;  1M4V A;  4BA1 I;  3R8B A;  3LNN A;  3SHL A;  4CJ2 C;  1GUW A;  1SFO B;  3VR4 A;  2R6G A;  4O42 A;  1AZQ A;  4RKL A;  1KLG D;  2BDN A;  2A5H A;  1BDO A;  3M3Y B;  4K5X A;  3QB3 A;  4L63 B;  1X3P A;  1WTO A;  4RKB A;  1RCV D;  3V96 A;  2PNR C;  2RSN A;  2LY7 A;  3FPU B;  4FXG C;  2B8G A;  4EQN A;  5ELD A;  5C5L A;  3VR2 A;  3CRL C;  4ZAI A;  1GUN A;  1F2Z A;  3MEH A;  3E6Z X;  3J7A V;  3P1H A;  4MN3 A;  2RSO A;  3LX0 A;  4DAV A;  3TSS A;  3C1E A;  5JEA H;  3A8J E;  2EYM A;  2O5J C;  2XWB B;  2PPB C;  2BCO A;  5KND A;  1I6H B;  3S1Q B;  1EYA A;  1HQR D;  2E75 C;  5KEE A;  1Y1W B;  3TP6 A;  3N6R A;  5JVG 3;  3S9W A;  1BO0 A;  1H9S B;  3CHB D;  5DEH A;  3NQI A;  2SNS A;  3JAM E;  1TS2 A;  2VB3 X;  1B1Z A;  1AN8 A;  5DM6 3;  1JC7 A;  5T1G A;  5M3F B;  4IFD J;  1JE4 A;  4XYQ A;  2KQ3 A;  3ZYY X;  5HUR A;  3A55 A;  3TDQ A;  2F0F A;  3D6W A;  1PRT B;  5C4Z A;  1YNJ D;  4H0L C;  3F2U A;  2B2U A;  1TWA B;  4K5W A;  2EYF A;  1JWU D;  5M3M B;  1I4Q A;  2CQA A;  3TN2 A;  2B8F A;  1U4P A;  3ERO A;  1ZEQ X;  1ILQ A;  2EYP A;  1STN A;  3HGB A;  1AW7 A;  4C2M B;  2D5D A;  4LK1 C;  1CTM A;  2XVS A;  2ZXO A;  1FNU A;  1PMR A;  4PMB A;  5KIX A;  2F0N A;  2EDG A;  5IGB A;  1XYI A;  1GJX A;  3VR3 A;  4DK0 A;  3DEO A;  3DUZ A;  2CVR A;  2FHT A;  1STY A;  4B9X A;  3O13 A;  1CZG A;  4C3J B;  4IUR A;  4KHZ A;  1STA A;  4Q0F A;  1D2B A;  1CK1 A;  5A2Q E;  4J6H A;  4BS9 A;  1ZKO A;  2R7Z B;  3PO2 B;  3KLS A;  3R3O A;  4RGM A;  1CQF A;  1EY5 A;  1Q1B A;  2MJ8 A;  4EVO A;  1DOK A;  1JOO A;  1B2T A;  3DWA A;  1K83 B;  3KF8 A;  3SK4 A;  1GUS A;  2C5C A;  3DMU A;  4OIK A;  5D3I B;  3J81 L;  1CHP D;  2JA6 B;  2Q8R E;  2K7V A;  2QF7 A;  1JOQ A;  1D5X C;  2X69 A;  5JOB A;  4BA2 I;  1UEA B;  2OXP A;  4A3B B;  3RMH A;  2BE5 C;  2BA0 A;  2JE6 I;  2MUY A;  1KLU D;  3J7Y W;  1EWH A;  2QDB A;  4RFB A;  3K5O A;  2A6H C;  2JA5 B;  2KED A;  1SYB A;  5IT9 E;  1F2M A;  3MXG A;  5D3D A;  2BDO A;  2WIN B;  2K05 A;  3DWQ A;  3I91 A;  5BN5 A;  1STB A;  4PNY A;  2A73 B;  4FF1 A;  3S2H B;  2B2V A;  1QB5 D;  1HTL D;  4U68 A;  3NXW A;  2QEJ C;  3H0G B;  4N9T A;  2L0C A;  1ZXT A;  2EY1 A;  1L0Y B;  2X6L A;  1LAB A;  1WD1 A;  1Q12 A;  1CT1 D;  4F88 A;  1Q1E A;  1HHV A;  4A3K B;  3I90 A;  2OT2 A;  1WTR A;  1W6K A;  3PO3 B;  4O1N A;  1D5Z C;  3DXJ C;  4X3S A;  3T56 B;  5C4X B;  4KJN A;  4HCE A;  2A69 C;  3NP8 A;  4XT1 B;  1F9Q A;  1T5X D;  1F77 A;  2PZU A;  3TBI B;  2EY2 A;  4IAL A;  3DWP A;  5EPL A;  3M7G A;  5E4X A;  4FYD A;  3SVM A;  3EFX D;  1A3V A;  2PCF B;  3MHB A;  1STH A;  3NHH A;  1U4L A;  5ISR A;  3TME A;  5CV9 A;  1H9K A;  1LTS D;  2KHS A;  5G3L D;  2KEE A;  1O7Z A;  1IKM A;  1Z47 A;  1RJT A;  1OXU A;  3HOX B;  5CV5 A;  2QCP X;  1SJH D;  5J22 A;  5IGF A;  2A6E C;  5DAU A;  1CQV A;  1ZYR C;  1XXG A;  3A8K E;  5IGE A;  5C44 B;  3D3R A;  2G9D A;  4X3K A;  2JEA I;  3OW7 A;  2F0M A;  4RHS A;  3RLF A;  3HOZ B;  1IYV A;  3OWE B;  3MC0 B;  2K33 A;  1VMC A;  2ZXP A;  3BDL A;  3EJI A;  5EKL A;  1EZ8 A;  1JCK B;  3D8G A;  4DAY A;  1MBY A;  2EZV A;  2IJ0 A;  3HZX A;  3HOW B;  3G6J B;  4NW2 A;  1A2U A;  4WFN 3;  4IUP A;  1SYE A;  3L9A X;  3PMF A;  1MD2 D;  3D4R A;  5IGC A;  3WOE A;  4ZK9 B;  3KLS X;  5EQ0 A;  4C56 C;  3HG9 A;  1YNJ C;  1RF2 D;  3JAM L;  1CA6 A;  1I4G A;  5AFW A;  3PUX A;  1VDZ A;  2L55 A;  1KNA A;  1NUC A;  2VB2 X;  2PO4 A;  5DM7 3;  3VR6 A;  1BXT A;  3PUZ A;  2BA1 A;  2RDH A;  4BBS B;  2IL8 A;  1IW7 C;  3Q24 A;  3C2P A;  1EU4 A;  4XQQ A;  2A68 D;  2D62 A;  3HRZ C;  5CV4 A;  1EYD A;  2E2D C;  4HR7 B;  3S16 B;  2XNA C;  2K01 A;  2NN6 I;  1S4Z A;  1WTP A;  1GHK A;  2HQE A;  2PZW A;  1PFB A;  1NCV A;  3NPP A;  3SR1 A;  4L8J A;  3MFY A;  4HED A;  4NMZ A;  5I2X A;  4LJZ C;  1EIH A;  1S5D D;  1ET9 A;  2QKI C;  1HFG A;  1BCP C;  5C4J B;  1F9S A;  4E6I A;  3PUW A;  3SE0 A;  2Q8T A;  3A8I E;  3MFG A;  4MIU A;  1A2T A;  3BYT B;  3S1R B;  2EYL A;  1RD9 D;  1OXV A;  3OIP A;  3NTI A;  4FVM A;  1W6J A;  4DGZ A;  4EGV A;  4FF4 A;  3IL8 A;  4A3I B;  1NSN S;  2CHB D;  5C5M A;  1VF7 A;  4KK7 A;  1C48 A;  3FMC A;  2JEB I;  1BCP B;  1V1O A;  3RZD B;  2A69 D;  1Y69 U;  3D6C A;  5E3F A;  3D31 A;  4CKE A;  2O2L D;  3IKJ A;  3PV0 A;  1LTT D;  1M8A A;  5I6Y A;  5I2Y A;  1HQM C;  1Y8P B;  4V19 0;  2MHV A;  3MTS A;  4B08 A;  3GP7 A;  1LTA D;  1UNS A;  3Q6S A;  1ESF A;  1DJR D;  2L9H A;  2X6G A;  2EJF C;  5C0X I;  3AU7 A;  3R2T A;  2H1E A;  2OF1 A;  1JR0 D;  3ITP A;  4IUT A;  1EYC A;  3E0J A;  1XTC D;  4IUN A;  2NVT B;  1K8M A;  1HTP A;  1I4R A;  2ID0 A;  5EGT A;  2PYK A;  5M5Y B;  2K03 A;  2J0T D;  4JK1 C;  4NKL A;  4XQJ A;  4K2L A;  3M4O B;  5JVH 3;  1C4Q A;  3BG3 A;  4KHV A;  4RGT A;  1EEF D;  3G7L A;  3EQL C;  3BYY B;  1RKN A;  2F0T A;  4KY5 A;  3VA5 A;  5KRU A;  4FXK C;  1TY0 A;  2Z4H A;  4IUV A;  1KDB A;  1CA5 A;  4I7Z C;  4QMG A;  4JBW A;  3QO2 A;  3BVZ A;  2V4D A;  3K5M A;  4K6L A;  3WDN A;  3RZO B;  1LTG D;  4OGQ C;  2NBF A;  1SSO A;  5FLX E;  4IQZ A;  2JXM B;  4HMI A;  4V0B A;  2L1B A;  1SJE D;  3OWF A;  3X3M A;  5T1I A;  1EEI D;  4ZUI A;  3BVM A;  2F0S A;  1S5F D;  5ELE A;  4F87 A;  1LLR D;  2ZXR A;  3OMG A;  2WII B;  1FNW A;  2MP1 A;  3SK8 A;  3M7N A;  3W3A A;  1FGB D;  1SXT A;  1TKW B;  5G3L F;  1WVL A;  4PMW A;  1QNK A;  2A68 C;  2KJX A;  1EQT A;  1F9P A;  3GV3 A;  4TRD A;  2M2L A;  1O7Y A;  2IT1 A;  3LWU A;  2IX0 A;  4ZLT F;  2B2T C;  5JAV A;  2WKD A;  4H7B A;  2VXW A;  4PV1 C;  4BBR B;  4H13 C;  5CV6 A;  2RKS A;  2XN9 C;  5FO8 B;  2O4X A;  2NTT A;  2L5T A;  4EQP A;  3NE5 B;  3HEJ A;  2Z8L A;  5C0X G;  1SNC A;  2GA4 B;  3RD4 A;  4CGY B;  5M9O A;  1PZI D;  1F2L A;  3I4N B;  4FNF A;  3K5N A;  4GZY C;  1WTV A;  1O78 A;  4ME5 A;  1A15 A;  4M1U B;  3K5L A;  1SYD A;  1PZK D;  1SNP A;  5TSS A;  1PTO C;  4IFD I;  3MA2 B;  4RWS C;  1I4P A;  1B9N A;  3H94 A;  3V2T A;  4DXF A;  1R4Q B;  1TQO A;  4CHT B;  1QE6 A;  3V05 A;  3DM1 A;  3VR5 A;  4G7Z C;  3T53 B;  2I46 A;  1CHQ D;  4A3M B;  3HP3 A;  2K32 A;  2RDG A;  3S1M B;  3I8Z A;  2E2J B;  1G8Z D;  1G2S A;  3EA6 A;  4KKU A;  1IYU A;  1GUT A;  1PTO H;  2JA8 B;  1Q90 A;  3DEP A;  3KUP A;  4IN3 A;  5C0X J;  2NVY B;  1BF4 A;  1UAP A;  3SDZ A;  2XRQ D;  1EWC A;  1MI2 A;  1Q3L A;  2EJG C;  4CJ1 B;  3S14 B;  2E2I B;  2F1M A;  2NVQ B;  5CYU A;  1L0X B;  1BQQ T;  1XX8 A;  4S3S A;  2E74 C;  1H9M A;  4RAU C;  4ID6 A;  3UI2 A;  4XYO A;  2KEC A;  1YNN D;  3SK5 A;  5IGD A;  2WAQ B;  3VYT A;  1WTX A;  3I3C A;  2JA7 B;  1NAP A;  1I4H A;  5EBD A;  1J8I A;  3K6O A;  1SNM A;  2Y0S B;  4C3I B;  1LTR D;  1A3T A;  1V1P B;  1WTQ A;  2RA4 A;  1QG7 A;  4J8Q A;  1DM0 B;  1FD7 D;  1ML0 D;  2Z1C A;  3CU7 A;  4U67 3;  5EKI A;  1TT2 A;  3KBG A;  1U4M A;  1V1P A;  3QWN A;  3FRP B;  4OO1 H;  2A74 C;  1HFN A;  4FXD A;  2YYZ A;  1QCB D;  5CMD A;  4C3I G;  2NYZ D;  3BZD B;  3CKI B;  4XIG S;  5DNF A;  1D1I A;  5EPK A;  4BY7 B;  1RTN A;  5FLX L;  1DYQ A;  3HOY B;  2MPM A;  3C1F A;  2RDF A;  5C3E B;  2J4X A;  3SK6 A;  4OIJ A;  2F0E A;  1QWY A;  3MXU A;  3T13 A;  3CQZ B;  3J80 L;  4RCN A;  1VF5 C;  3TZD A;  3GTK B;  2LFN A;  3QOJ A;  1FR3 A;  4RH6 A;  1LTI D;  1O7L A;  2FMM A;  1JB3 A;  5CGK A;  1YNN C;  1U9R A;  3KLR A;  3EVQ A;  1HPC A;  5COY A;  1AEX A;  5E4W C;  1B9M A;  4K8I A;  2VNU D;  3MWY W;  1BBX C;  3PIP 3;  1MGS A;  2KCN A;  5ELC A;  4LAA A;  3LWE A;  1O80 A;  1LTB D;  5EBC A;  4K6D A;  2SOB A;  3P20 A;  3TP8 A;  2M00 A;  3W2D A;  4AYB B;  4G57 A;  2F03 A;  2IW3 A;  1EY9 A;  1PYW D;  3U9O A;  2OEO A;  1SYC A;  3M85 A;  1HA6 A;  2B2Y C;  2B39 A;  1DOL A;  3KBX A;  5JEA J;  5I6W A;  3GTJ B;  4RCO A;  3NBH A;  5LL6 X;  2DN8 A;  2SEB D;  3NK9 A;  4KTA A;  2D2C C;  2CW0 C;  2B2U C;  4FO2 A;  1EOT A;  3FKI B;  2WV6 D;  2EYJ A;  3NTH A;  1PTO B;  1KDA A;  5CV7 A;  1IL8 A;  3NWT A;  5NUC A;  1TS3 A;  3BDO A;  4PMC A;  1DOM A;  2J7Z A;  2KVM A;  1ZYR D;  4C1N K;  4X3T A;  5D65 A;  4K14 A;  1WTW A;  3MXP A;  1KAA A;  3T4A C;  4NDX A;  3K59 A;  4ODG A;  4KN7 C;  2WAC A;  3GO5 A;  5BN3 A;  4A3D B;  1GHJ A;  2L12 A;  1VMP A;  3URY A;  2F0W A;  2NVX B;  2F3W A;  3OMC A;  1NR2 A;  3S15 B;  1A6X A;  3C3L A;  4C3H G;  1X32 A;  4KY6 A;  3VYR A;  2XIW A;  2RVL A;  4TQU S;  3OPO A;  1K8O A;  1PFN A;  3S2D B;  1SE4 A;  4EQO A;  1BNZ A;  3VYU A;  5JEA G;  2C9O A;  4R9W A;  2E2H B;  1SYG A;  1EQV A;  1S5E D;  1PRT F;  2B2W A;  2XRS D;  4K8J A;  4ULL A;  1SMY C;  2A6E D;  3D4D A;  4FF2 A;  1PTO D;  3GQB A;  5EPJ A;  4HN7 A;  1GUG A;  2EOT A;  1SAP A;  1PXU A;  4QCL A;  1G2T A;  4ZKC B;  4HAE A;  4QUF A;  4RGO S;  4CBV A;  4KN4 C;  5EKK A;  1ENC A;  1KAB A;  4A3G B;  1CM9 A;  2DNE A;  4DN4 M;  4FF3 A;  1RDP D;  4IFD G;  4BY1 B;  3OSO A;  1PLF A;  2LS0 1;  2F0H A;  1BCP D;  1PZJ D;  1JWM D;  1EU3 A;  1VCI A;  1QIL A;  1A3U A;  4IZ8 A;  1PRT D;  1DZ1 A;  4CKB A;  2Q8I B;  4KI0 A;  1ILP A;  2JYO A;  3HOU B;  5IT9 L;  4KJO A;  2XWJ B;  2HDM A;  4Q5V A;  2AQ3 B;  1MSH A;  1SND A;  1RTO A;  2R3Z A;  5COR A;  2NTS A;  5EJW A;  1T5E A;  1ONL A;  2ZT9 C;  2WB1 B;  1Z6H A;  1OXX K;  1HXY D;  4ZYS A;  1G6Z A;  2F0O A;  2NB0 A;  2PQE A;  1RHP A;  4P2C B;  1SEB D;  3NSW A;  1X3Q A;  4HTH A;  4HSV A;  1SDF A;  3TZU A;  5KYI A;  1E2Z A;  3GTO B;  1G91 A;  1E2W A;  4HMJ A;  1HRJ A;  3D4W A;  2AWO A;  1EY7 A;  3GD7 A;  3QJY A;  1SMY D;  2XSC A;  5K36 G;  2KA7 A;  2N55 A;  4K2K A;  4FP5 D;  3T16 A;  1HCZ A;  4IUQ A;  5IGG A;  1IKL A;  1ESR A;  1LT3 D;  1S5C D;  5A2Q L;  2K6A A;  2ICI A;  3S1N B;  2PZT A;  2EYH A;  1G29 1;  4KKT A;  4N9P A;  3I70 A;  2R93 B;  3CRK C;  2MGS A;  2NZ1 D;  4M8A A;  4OL7 A;  5KNC A;  1TU2 B;  2HCC A;  5C0X H;  3GTP B;  4G7O C;  2NUC A;  1PTO F;  1HUM A;  2IPK D;  4YIJ A;  1LAC A;  2NN6 G;  1V43 A;  4QF4 A;  3A7L A;  2N88 A;  2KUM A;  3FPP A;  1LV9 A;  1JOR A;  1TR5 A;  3NWS A;  1AP0 A;  3U9S A;  3ND8 A;  1ENF A;  3T51 B;  2SNM A;  3WOF A;  2TSS A;  4DXG A;  5K5P A;  4ZUJ A;  4XTC S;  2TMP A;  2DNC A;  3Q0A A;  3RUZ A;  5FO7 B;  1B4O A;  2EYO A;  3GTG B;  3IFD A;  1NR4 A;  4DU9 A;  1H9R A;  3QIA A;  1GUO A;  1PFM A;  2ENB A;  2L4N A;  3BS1 A;  4DFA A;  1PDQ A;  1HA5 A;  1F2Y A;  1ET6 A;  1LT6 D;  3FEW X;  3P75 A;  1I6V C;  3ND9 A;  1S5B D;  2PMZ B;  1F9R A;  3A56 A;  3K0Y A;  4KMU C;  1EY0 A;  3GTM B;  5FO9 B;  2A6H D;  1CZW A;  1MSG A;  5C6A A;  4DAP A;  3MXN A;  4I65 A;  5ELB A;  4TSS A;  1DON A;  1U4R A;  5IOC A;  5CBA E;  1ROD A;  2AUJ D;  2AQ2 B;  3NTK A;  4DA2 A;  1KDC A;  1SE2 A;  3QOL A;  1GXD C;  1ENA A;  3HKZ B;  5FOB B;  1JIC A;  1I3Q B;  2K28 A;  3P7J A;  5IOD A;  4NP5 A;  3J7A F;  4ABN A;  1QNU A;  1OXT A;  3AMU A;  1AZP A;  4B9W A;  1QOH A;  4QB4 A;  4DK1 A;  4RGN A;  4HSP A;  4DF7 A;  1EL0 A;  2B2Y A;  3L7Z C;  4G4K A;  4X3U A;  3MZ5 A;  1FNV A;  2EY5 A;  2B63 B;  2DY7 A;  3H3V C;  1EZ6 A;  5I4D A;  1LT4 D;  4TKO B;  1BR9 A;  1EFI D;  2BE5 D;  3L3O C;  3ONA B;  1II3 A;  1QJO A;  2WKC A;  3BDC A;  2EVB A;  4A3J B;  1EY4 A;  4DNT B;  1KTK A;  1TWG B;  2B2W C;  2EY6 A;  4HCS A;  4LMQ D;  1BCP F;  1E2V A;  4J1M A;  3HS0 C;  1DXM A;  2AWN A;  2FFK B;  2K5D A;  3PIO 3;  3NBI A;  3I4L A;  3SXH A;  4BWG B;  2D9U A;  4A3E B;  5KNB A;  4ZRZ A;  4IUU A;  1Y1V B;  1SBB B;  2RBM A;  4DNR B;  1I4X A;  1LO5 D;  1D1K A;  5FK9 C;  5CV8 A;  5I9O A;  2F0Q A;  2E76 C;  2M9V A;  4WOR A;  3GTL B;  4XXE A;  3N52 A;  4RA8 A;  2B2T A;  1E0B A;  2F0V A;  4ZKB B;  1PRT C;  1TWF B;  1D5M C;  3GV6 A;  3H09 A;  3I4M B;  2FMC A;  3Q22 A;  3E5S A;  2WP8 J;  4G7H C;  4XT3 B;  2EPB A;  1TS4 A;  3ERQ A;  2K5W A;  1OXS C;  2EJM A;  1DD2 A;  1SNQ A;  1R9T B;  3NQT A;  1UUP A;  3FDT A;  3IFT A;  5I9P A;  4F8M A;  5F2D A;  1KNE A;  3GTQ B;  5C3W A;  2ICE C;  3MAQ A;  1J9O A;  2L11 A;  1Y8O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...