3SVMA

Human mpp8 - human dnmt3ak47me2 peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
EDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MPP8 mediates the interactions between DNA methyltransferase Dnmt3a and H3K9 methyltransferase GLP/G9a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords M-phase phosphoprotein 8
total genus 13
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3svmA00
2M2LA 1ML0D 4UAIA 2VXWA 2FINB 2B2VA 3DEOA 1U4LA 2L1BA 3N52A 4HEDA 4MN3A 4CJ0B 1CM9A 4U68A 3G7LA 2RA4A 2FHTA 1PDQA 1MGSA 4XDXA 2B2WC 4X3SA 1WTRA 2BDNA 3MTSA 1B4OA 1JE4A 1LV9A 2B2UA 2KEEA 2K03A 2KUMA 5CMDA 1WTOA 2NYZD 1J8IA 3TN2A 5EPKA 2B2WA 1VMPA 4R8IA 4HAEA 3HP3A 2MGSA 1XYIA 1SSOA 2L11A 1NR4A 1S4ZA 3DEPA 1WTPA 1U4MA 1NAPA 1PFBA 1HA6A 1HHVA 3FDTA 2FMMA 3P7JA 3UI2A 1B3AA 3D6WA 1BBXC 1GUWA 1RJTA 4X3TA 4XT3B 2D9UA 2JP1A 5EQ0A 3ONAB 1O80A 2MP1A 3LWEA 5T1GA 3SVMA 1F9SA 1WTVA 1C8CA 4X3KA 4ZKBB 1F9PA 4QUCA 2MPMA 3MWYW 2NZ1D 5E4WC 1ESRA 3GV3A 4DN4M 1WD1A 1IL8A 1A15A 4RAUC 2B2YA 4IUPA 5EPJA 2X6LA 5CBAE 1WTWA 1B50A 5E4XA 1X3PA 4X3UA 1U4RA 3I8ZA 1J9OA 1NCVA 2HDLA 5EKIA 1EL0A 1WTQA 4QUFA 4HCSA 4IUQA 3R93A 1HFGA 2RVLA 1WVLA 4IUVA 2CVRA 2SDFA 4IUTA 2MJ8A 1G91A 2EOTA 4RA8A 1BNZA 1X32A 1IKLA 2K05A 1QG7A 2HCIA 1WTXA 2HDMA 1DONA 1HUMA 4MHEA 3GV6A 4ZK9B 1HRJA 4NW2A 1M8AA 5D14A 2N88A 5T1IA 2KVMA 5EJWA 5EPLA 3I91A 1U4PA 1RTNA 1G2TA 1RODA 4IURA 4IUUA 4CJ1B 2L4NA 1SAPA 2HCCA 1E0BA 2K04A 1MSHA 1X3QA 3QO2A 1BO0A 2HUGA 1O7ZA 1NR2A 1EQTA 1DOLA 1QE6A 2K28A 4O42A 5CBEE 2RSNA 3KUPA 5JJZA 1RTOA 4R9WA 2XIWA 3IFDA 1QNKA 1ICWA 3DM1A 1AZPA 1ILQA 5COYA 1EIGA 1VMCA 2JYOA 2FJ2A 2DY7A 4ZKCB 1DZ1A 1CA6A 1Q3LA 1WD0A 1IKMA 1B2TA 1B53A 3H91A 1TVXA 4XT1B 1MSGA 1F9RA 4ZLTF 2Q8TA 2N55A 5AFWA 1XX8A 2IL8A 3Q6SA 1G2SA 1F2LA 1ILPA 1DOKA 3FPUB 1MI2A 2K01A 3KBXA 1EOTA 4LMQD 1HFNA 1KNEA 2EE1A 2K1BA 1DOMA 3I90A 2B2UC 1JICA 2NWGA 5DNFA 2X6GA 2FFKB 2B2YC 3F2UA 1O7YA 4OIJA 4CJ2C 1RHPA 1KNAA 1PLFA 2J7ZA 4ZAIA 1SDFA 2EPBA 2X69A 2L12A 1CA5A 1EIHA 1PFNA 2B2VC 1PFMA 2Q8RE 4HSVA 1AZQA 1AP0A 2KECA 2H1EA 1ZXTA 1F9QA 1G6ZA 2RSOA 3TZDA 2B2TC 5D65A 2L9HA 3I3CA 4OIKA 4RWSC 2KEDA 2R3ZA 1HUNA 5CORA 2DY8A 3IL8A 2B2TA 1BF4A 2KOLA
chains in the Genus database with same CATH superfamily
1RKNA 1SE2A 5GQOA 1PZKD 2E2HB 2Q8IB 1X56A 4HIDA 1VQ5A 4RG1A 5FLXL 3AFPA 2NYZD 3U58A 2H5XA 2ES2A 2HIXA 2R61A 2F1MA 3E9HA 3TZUA 1JR0D 1S5CD 1GUWA 2ICEC 1O80A 5C0XH 4KMUC 5M3MB 2A6EC 3CD6A 4RGMA 4WJ3M 4RAUC 5FJ8G 2Z1CA 1HQRD 3E0EA 1AE3A 3HOXH 4A4IA 5E3FA 4NPSA 3SGIA 4I7AA 3M4OB 4DV3Q 4LF6L 4A3KH 1GD7A 3RMHA 2WKCA 1BNZA 2OTJA 3QB3A 1IKLA 2KENA 5H1SE 2HCIA 3BVZA 1C0AA 4B3TL 1MJEA 1N36Q 3GV6A 1LTTD 3SEBA 4DXFA 2VL6A 1RTNA 1SAPA 2MO1A 1TQOA 1EIYB 1HZBA 2SNMA 3GTQB 3KF8A 5K5PA 3HOWH 4BY7H 2VB2X 1RF2D 2F0UA 3QG1A 1LTAD 2C5CA 4QIWB 4AYBB 1F2ZA 5JAVA 2NUCA 5IIFA 4XT1B 2WFWA 1NMGA 3T1YL 1K9MC 4N8X1 1HZ9A 1OXVA 3A7AB 3Q6SA 3HRZC 1VQLA 4IOAA 1IYJB 2F0VA 4B3MQ 3CHBD 1SYBA 1DOMA 2FFKB 1IW7D 3K5OA 1EIHA 2L12A 1LM0A 2Q8RE 3MFYA 4N8FA 3U50C 3UDFA 5C44B 1G6ZA 1D8LA 2NBFA 3KLRA 2NVYB 2K5DA 2VXWA 2FINB 2F0EA 1CHQD 1SNOA 4G7ZC 2E2IH 1MIUA 4HCEA 1MGSA 3OMCA 2UXBQ 3A0JA 2G9DA 1UNSA 3FHWA 4V0BA 4RFBA 3QIAA 4RGTA 3S14B 2VB3X 2R92H 1K8AC 2CH4W 4GNXB 2JA7H 1SE3A 3T1HL 4JBKA 4X3KA 2UUCQ 3CC4A 2VNUD 1F9PA 2C9OA 1SROA 3K5MA 2JE6I 4DN4M 4LFBQ 4K5VA 5FO9B 1IHZA 4RKLA 1X65A 5ELNA 3T16A 3ZJYC 1YNJC 1NNXA 5CC4A 3L3OC 2QEXA 4DAMA 3HOWG 4BY7G 1YITA 1QILA 3VR6A 4HIMA 1M90C 4JI4L 5IY0A 3H15A 2UUBL 3HKZB 2D0OA 5EAYA 4R4TA 1RDPD 1BCPC 3DHQA 1GXDC 3NBIA 1QG7A 2CQOA 4DGZA 4PMWA 4A3DB 2VQFQ 3J80E 4PMBA 4BBRH 4C3HB 5IGBA 1RODA 1SFOB 3VYTA 3VDYA 4KN4C 5D3DA 4IZ8A 2K28A 3SK4A 3K7AH 3PUWA 4Q0FA 4FF1A 1O7LA 2F0JA 1XTCD 2EQSA 2DY7A 5FO8B 5M9OA 1KAAA 5GAGC 4GNXC 4ZLTF 4FNFA 4BY1B 5AFWA 4JI1L 5JOBA 3CP0A 2Q2TA 1EWIA 3H3VI 2AWNA 2VY3A 1VF7A 1E22A 3FMCA 3T1HQ 2NWGA 3HOYH 4L5TA 2X6GA 3F2UA 3JC66 4GLXA 3PIOA 3IRBA 4CBVA 1M1KC 1CA5A 4GLVB 4JVZA 3DUZA 1UEBA 3WOFA 2WV6D 5BN3A 1E7ZA 2BDOA 1FNVA 1KAWA 2KEDA 4YCUA 2DN8A 1V8QA 2KOLA 5M3FH 3GTJB 3M4PA 3NQTA 5C4XH 3JAMi 1V1QA 2F0GA 2WIIB 2A73B 1LT3D 3NE5B 4DF7A 1LT6D 1HXYD 2FHTA 5FKAC 3CCEA 1NTGA 4A3EG 1AE2A 1K83B 3HOWB 4BY7B 3KBGA 3OWFA 1BOSA 1GOZA 1TWHH 5DLQE 4DV1Q 3I4MB 1RIPA 1SSOA 4C1NI 3Q8DA 4RCOA 1Y8NB 4CKCA 4IN3A 5DM63 3GO5A 3OSOA 4LF8Q 4DV2Q 1MBYA 1TWGH 4EVOA 4C3IG 2F0TA 4Y7NB 4IO9A 3PO2G 3FRPB 5G3LD 3T1YQ 4X6AH 2XRSD 1A3VA 3CU7A 2VZAA 1VQ7A 4IUVA 4UHVA 1N36L 3S2HB 3CCQA 2EY2A 2MJ8A 4KN7C 2F4IA 4RA8A 1GKHA 1WYDA 4DK3C 5F2DA 4P71A 3D31A 3M7GA 2BE5C 2WB1B 1Q7YC 4BY1G 3ITPA 2K5HA 4LNQA 3NXWA 3BZDB 4JPBW 2TSSA 1S40A 1TY0A 3I7FA 3K7UC 2L4NA 3I4NG 1M4VA 2YTYA 5C3EH 2OCEA 4DR5Q 3S14H 3A5ZB 1YZ6A 2OT2A 5CBEE 3GTPB 2RSNA 4BXXH 2SNSA 2NVQB 4WJ4A 3SK8A 4OO1H 5IYBG 1DZ1A 3H6MA 2K32A 3D4RA 5ELCA 5JEAG 1SN8A 4A3JG 1K3RA 2CFMA 1EY4A 5CV6A 4CKEA 2D0PA 4A3JH 3V96A 1IYVA 1Y1VB 2ZM6Q 4KKTA 1DOKA 2EYMA 4PZ6A 3W1BA 4LMQD 2EE1A 2K1BA 5DNFA 1Y14B 3KF6A 3MHBA 1O7YA 2YV5A 2Z9HA 4GS3A 3PV0A 1SDFA 4K6LA 4A3MG 1R9TH 2K4KA 3U4VA 2VUMB 1MHWC 4ZRZA 1I50B 1ONLA 3CW2C 5IWAQ 3HOUH 2L0CA 3OHXC 2EXZA 3E9IA 4DXGA 4C3JB 2BA1A 3A7LA 4PG3A 4DFAA 2ZTEA 3K57A 3KF6B 3K0XA 5DAUA 1JE4A 3T4AC 3M9BA 2ZT9C 2GVAA 3DEPA 3CCLA 5AJ3Q 3P7JA 4IJHA 4LF4L 1ASYA 1HZAA 4N9PA 4G4KA 3T56B 1SJHD 3ND9A 5EBCA 4C3HG 3RD4A 1EOVA 1EEID 4A93B 1YHAA 5IP9H 4A3GB 1PVOA 1PH3A 2K5NA 4EQOA 4X3UA 2RHSB 1T5XD 3K80C 5JVG3 5LMUQ 4QQBX 3TQYA 4XQQA 5GAHC 5M5XB 1K3BC 4M8AA 2QF7A 2HT1A 3J7YW 3IAYA 2A69C 1FL0A 2BA0A 4JOIA 4Y52H 2E5LQ 2E2DC 4NXML 4BA1I 3RR5A 1HUMA 4MHEA 5I9OA 1EZ6A 1HRJA 1M8AA 3HOXB 2KVMA 5M3MG 4IALA 1VQKA 2Y0SG 1L2FA 4LJZC 4A3KG 1H9SA 4DUZL 4DV5L 1GUGA 1GUSA 3A8IE 2IX1A 2E2IB 2KHIA 1JORA 1Q1BA 1Q8IA 5JJZA 2C35B 1TWHB 1GHJA 4RMFA 5CR3A 3RZOH 1NBWA 2MUYA 2KCTA 4ZKCB 2NVQH 2A8VA 1BKBA 4KKUA 1IKMA 1YNNC 4DV6Q 3H91A 2PI2E 1XNQQ 1LABA 4JC0A 5HGQA 2CHBD 3ERQA 1BQQT 3VYUA 5FLMH 1TS2A 1X3FA 5ELBA 4OWWB 3PO3G 2BOSA 5KIXA 1G8ZD 1RD9D 1ET6A 1B1ZA 2B2YC 4KJNA 1EFWA 5E7NA 2AMCB 3H94A 1SNQA 5IODA 4B08A 4NKLA 2RSOA 5C0XI 3T51B 3I3CA 3MXGA 4DK6C 3OMGA 4KY6A 4CHTB 3ERSX 4UAIA 4C3IB 4CJ0B 2HHHL 2I5HA 4ME5A 1UE6A 3HEJA 2XRQD 5C5MA 1I6HB 4KY7A 4BBRB 3TN2A 4C56C 1PTOD 2PCFB 1NAPA 3S1MH 2J4XA 2NVYH 4IFDI 1SNMA 2D9UA 1Q8KA 4FF4A 4K8JA 2F0PA 4X64L 4KHZA 2YYZA 3F2CA 1E24A 4P74A 1JB3A 1S5DD 1IL8A 1EQRA 2PO4A 3GTPH 1B50A 1GO3E 5KNCA 4HJAA 1HQMC 3UDIA 5L37A 4A3FB 4R4IA 5M5WH 2LKVA 3J7AF 3H0GG 4QMGA 1PV4A 3D4DA 4M1UB 3MFGA 1PTOB 2Z6KC 1QOHA 4TKOB 5ELFA 1J5EQ 4BWGB 1HJPA 1TY2A 5I2XA 2UXCQ 4GKKQ 4X65L 3HOZH 4DR1L 1GUTA 1Q82C 4R1JA 4JOIC 1UEAB 2PI2A 2O5JC 4JI7Q 5T1IA 1TT2A 2IPKD 4DV3L 1YIJA 4WRDA 4C3JH 1VQ8A 2CQAA 2K04A 3K7AB 3HKZE 4JI2L 1DOLA 1I50H 4OEMB 3VYSA 4GKJL 1PH5A 3IFDA 2UU9Q 4JCVE 4YCWA 1ILQA 1V43A 3BJUA 1FYCA 3HKZG 4A3CG 2JYOA 1QZHA 3S16B 1V1PB 4UY8C 4A3IH 1PYBA 1D1KA 5HY6A 4A76A 4KLKA 2QW7A 1LTRD 2PPBC 3KYHC 3FPUB 1MI2A 4RCNA 2R7ZH 2JA6H 5J22A 4LF8L 1SE8A 3PSIA 1AN8A 1UAPA 4G7HC 3OPOA 1STYA 2JEAI 5EGTA 3HOVG 3CCJA 3GP7A 5IP7G 5M3FB 1OXUA 3A56A 2K75A 3U9OA 3R2TA 3K81C 1HNZL 3GTOH 3GTLH 3R2IA 4LFBL 1BR9A 1BUVT 1XXGA 1CKNB 4U68A 1JWSD 2EYOA 3G7LA 1KHIA 1ASZA 1YBYA 2AUKA 1SMXA 2BDNA 4PNYA 2K14A 3CCRA 2B2WA 2OQKA 5FJ8H 1CT1D 1PH4A 1PFBA 2D2CC 3H3VC 5C4JH 4G7OC 4X3TA 1KDAA 3J7AV 1CSQA 2ZXOA 5IGGA 1Z6HA 2LXKA 1F9SA 1WTVA 3NQIA 4HJ9A 4BA2I 3S9WA 4C2MB 1D5ZC 2B63G 2NZ1D 4R4OA 1CZWA 1NY4A 3AB9A 3K6OA 2JA7G 1X3PA 5EKIA 1TWFB 4L8JA 2RVLA 5I6WA 1VQAA 2WKDA 4FF3A 4GLAC 1A2TA 1WFQA 1G91A 2EYFA 2EY5A 1PH7A 3OIQA 1GHKA 1CQVA 4C3IH 4L63B 1Y8PB 1VQ9A 2PNRC 4HMJA 2LFNA 4FDBA 1HTPA 1CKNA 5C3EB 5EPLA 1K8MA 1CHPD 1MD2D 1U4PA 4A93G 1WCMB 4DR2L 3PO2B 3WOEA 4ZUIA 4PMCA 4F7XA 5LMNQ 2ATWA 1FD7D 2E2HH 1EQTA 1KRTA 3Q22A 4KK7A 1EWCA 3QWNA 4JI6L 1Q1EA 2QDLA 4QJFA 2UUBQ 1VCIA 1NSNS 5COYA 1FJGQ 5BR8Q 1A0IA 1H95A 2F0HA 3HZXA 5LMUL 1DXMA 1XNRQ 3S1RB 4P73A 2F0WA 3PQIA 1KQSA 5J39A 3HOYG 4K5XA 4BXXG 4JK1C 1I3QB 1SYFA 3I90A 1JICA 1LLRD 1YHBA 4CJ2C 3A55A 1PZJD 5KNBA 2EPBA 3S2DB 4JI5Q 4HTHA 4DR4L 4CKBA 3QR8A 1CFMA 4MNOA 3IL8A 4A3EH 3KFUA 2E8GA 2IWHA 3CF5A 1HNXQ 3N52A 1QWYA 1IBML 3VA7A 1YJWA 4JBMA 1B4OA 2LMCB 2TMPA 5C4XB 1F2YA 1CI3M 2KCMA 2MGSA 1XYIA 3HOZB 1X54A 1N9WA 3S24A 4KJOA 1HA6A 2NB0A 2A68C 3RZDH 4JYAQ 1STNA 1B3AA 3I55A 2PQAB 5FK9C 1C8CA 3CCSA 5I4DA 2HD3A 4LUOA 4DAPA 5A2QL 3A8KE 3NWSA 3MWYW 2WACA 4YHHL 1N33Q 3PUZA 2YU9B 5KNDA 2GVBA 3SE0A 1WTWA 5ELDA 3UE0A 2A6HD 4DR4Q 1EY8A 2NZOA 2F3VA 4IUQA 1KDCA 3CCVA 5KRUA 1SMYC 1L1OB 3MEFA 1SYDA 4ALPA 2N78A 4HJ5A 1TWFH 4YY3L 4OWTB 1HNXL 1PTOC 3HG9A 3GTQH 1Y1WB 2XTIA 3KLWA 4X66L 4FVMA 1DONA 3BU2A 1VQHA 1STHA 3NBHB 4K5WA 1K0SA 2NZHA 1XNQL 2RF4A 4WJWA 1I94Q 5CV4A 2XVSA 3H0GH 4JI7L 3P20A 1Y69U 1D6EC 4RGNA 3PGZA 1IBKQ 4X66Q 4XXEA 3GTGH 4K6DA 3H0GB 1H9JA 2M9VA 1PRTC 1R4PB 1VQ4A 3A8JE 5CV8A 4DUYL 1CA6A 1Q3LA 3RLOA 2V1CC 1TVXA 4J15A 1PXUA 1XJVA 2QILA 2I5MX 2Y0SB 3A54A 1XMOL 3D6CA 3GDEA 2K01A 3BG3A 4I65A 2D62A 1KNEA 4B9XA 4E6IA 1KNAA 4PZ8A 2R6GA 4JG2A 5M5WB 1I4GA 4L6TB 1OXSC 2N49A 3TSSA 1EYGA 1QCBD 1HUNA 4HMIA 4YWMA 3AQQA 1SBBB 3LWUA 2A6HC 2B63B 4DK1A 5IT9c 3K58A 1XPRA 1CM9A 1WI5A 4L5QA 1EY0A 3MTSA 1N8RC 2CW0D 2NVXB 3HOVH 3DWQA 4YWKA 5IP7H 1H9RA 2K7VA 2EYPA 2PMZE 2F0DA 1HHVA 3FEWX 1XNRL 1Z7TA 1BCPF 1PMRA 3W2DA 3J81i 3S1QB 3HOVB 2L15A 1KLGD 4DR6L 3CCUA 2CH4A 1STGA 2ZTCA 2UXDQ 1HCZA 3S1QH 3MXNA 4KD4A 5E4WC 1KLUD 1JC7A 5LMNL 5FOBB 1WOCA 1NCVA 2HDLA 2L5TA 4RHRA 1HTLD 3TEHB 3PIPA 1N34Q 4RH6A 1TWAH 3ICEA 3NSWA 5HURA 2SDFA 2SOBA 4KTAA 1IXRA 1SXTA 2LS01 4UP7A 3LGJA 1TWCB 1OO9B 1KABA 3QOJA 2YTXA 3OW7A 3NELA 3U9SA 4A3FH 2N88A 2G9HD 1EY7A 1XPOA 1UE7A 3PIP3 1G2TA 1EIFA 4IUUA 2RKSA 1E0BA 1D5MC 3A74A 3RZDB 3DWAA 2CKZB 1E2WA 2A69D 1V1PA 2UXDL 3CQZH 3J7A5 1QNKA 1EEFD 3GTGB 5C0XJ 4LF4Q 3S15H 3K0YA 3EA6A 1PRTF 2FJ2A 4IJLA 3QJYA 2KCNA 3CAMA 4C3JG 1PH6A 2HQLA 3BZCA 3OTOQ 2XWBB 3L7ZC 2Q8TA 3NEMA 2Z6KA 2ID0A 4TSSA 2UUAL 5JVH3 4FF2A 2JSOA 1NJIC 1SJED 4CDCC 3LNNA 2JEBI 5IGCA 4JI2Q 4YY3Q 4K0KQ 3I70A 4ZAIA 2EJGC 4ID6A 5IWAL 2N3SA 3EIVA 1BXTA 5D65A 4OIKA 1BDOA 3J80i 2B2TA 1QNUA 3ONAB 4X65Q 3JAML 3TBIB 3T13A 4HEDA 3BDCA 2JA8B 4XIGS 3MVVA 5ELEA 4A75A 1JQYD 4O1NA 1VMPA 3MXPA 2F0KA 2ICIA 2L11A 1Q46A 1I4PA 3GTOB 1BBUA 1YI2A 4HN7A 2WP8J 4ODGA 3D4WA 4H13C 3KK7A 2XN9C 4JBWA 2X6LA 4EQ5A 2JA9A 2RDHA 3I4LA 1K28A 1WTQA 3M7NA 3R93A 3BZKA 5IYDG 2KJXA 3G6JB 4XQNA 1Z47A 5J1ZA 2OTLA 3RUZA 1S5ED 2IHEA 4K0KL 3T53B 2DJGC 2F03A 2RCFA 4LK1C 4A3JB 3CCMA 5JJLA 2K52A 1DM0B 1E1OA 1VQCA 4DR5L 1Q90A 4R4CA 2Y0SE 1EUJA 2NVXH 1VQMA 2Z6BA 1LO5D 1IYUA 1FJGL 4MTKA 4DU9A 4B3TQ 2JQOA 1QE6A 4GKKL 4KHPL 3GD7A 2ZXRA 2IW3A 1J5EL 2MNAA 1LACA 4OX9Q 1L0WA 1JMCA 1ICFB 2VQEL 1JB7A 1OTCA 1A63A 4LF6Q 5LMNW 1D7QA 1UUPA 3TP5A 1WCMH 2EXDA 2Z8LA 1HH2P 3CRKC 3N6RA 1II3A 3FKIH 1F2LA 2Z4HA 4YHHQ 2IJ0A 1N33L 1ILPA 4J6HA 1EOTA 2P5ZX 2F0MA 1SE4A 1TS3A 4LFAQ 1N32L 2MO0A 3C2PA 1S5BD 4DV5Q 3C1FA 3GTKH 1ET9A 1RL2A 4HSPA 1ZXTA 2F4VQ 4DNRB 5M5YB 4H44C 2L9HA 3TREA 4DA2A 2KHJA 3ULJA 4LF5Q 2R7FA 4OONA 1ML0D 1YHQA 3CMAA 1VS0A 4XDXA 1A3UA 3SHLA 2WB1E 1IW7C 5EPKA 5ELOA 4B3RL 1BCPD 1GVPA 1D5XC 1XPUA 3K8AA 4IOCA 5K36G 3I4OA 4G57A 1JOOA 3Q23A 2PNHA 4B3SQ 5I9PA 1WJJA 2RCNA 5CBAE 3GTJH 2R7DA 2NN6I 1HFGA 4A3CH 4ILWA 3SK5A 4L5SA 4KV6A 4DPGA 4HIKA 1MJCA 3RLFA 3J80c 1PYWD 3F8TA 1X32A 5LL6S 1X3EA 4AYBG 1B9NA 2EIFA 2PYKA 2ZTDA 1G51A 2F0QA 2F52A 3NPPA 3VR2A 3RZOB 2JA6B 2Q2IA 2OXPA 3ULLA 5KYIA 1U9RA 1K73C 1X3QA 1SYCA 1O7ZA 2J0TD 2O4XA 2DNCA 1W6JA 5LHY1 1SYEA 3SXHA 1VQOA 3S17B 4IPCA 1FGUA 1NE3A 1E3PA 1QVCA 4FYDA 2NTTA 3P75A 3WWVA 1KRSA 1T5EA 4C1NK 3G4SA 1JT8A 4OWXB 2IL8A 3HOXG 4LFCL 1J6QA 4JI0L 2JA8G 4R8NA 4FXDA 4EGVA 3KBXA 5IP9G 4GKJQ 3TS0A 3J7ZC 2B2UC 3M3YB 3FKIB 1I5FA 3F2BA 4BBSG 2J7ZA 3VR4A 5JJIA 4AIMA 1KIXA 1AZQA 3KLSX 1VQ6A 1EQQA 3UE1A 2B63H 3GTMH 1XWEA 1TWAB 4ABNA 2EZVA 2WINB 2KQ3A 4HR7B 4H02A 2JN4A 3CKIB 1VQFA 5E1FA 3LX0A 1A2UA 2R92B 1CSPA 1HR0L 2NVTB 1ESFA 2QDBA 1IBLL 1HNWL 2A6ED 4CDDC 2JA7B 4LF9Q 4J8QA 3NK9A 3EROA 4QGUA 4L5RC 1QVFA 2B2WC 2AQ3B 2KEEA 2KUMA 3AMUA 1X9NA 2ASBA 5IYCG 1G6PA 1T9HA 4KD3A 3CPFA 1X55A 1U4MA 4DV1L 4H0LC 3X3NA 4NDXA 3D6WA 1SEBD 1SNCA 2JJQA 4UDUC 1KL9A 1VQNA 2QKIC 4XYQA 4LFAL 2Q2HA 2F3WA 2VUMH 1JE5A 3BS1A 3S15B 1GUNA 1ESRA 2E75C 1TXYA 1B2TA 2B2YA 1LTBD 4ME3A 4A3IG 1NMFA 3MC0B 1VF5C 1J9OA 1SNDA 2I0QA 3P1HA 1WVLA 1TS4A 3DWPA 1S72A 4K14A 4IUTA 3BVGA 2R7ZG 4FO2A 5C4ZA 3KLSA 4A3LG 2CW0C 2UXCL 3OYYA 5C4HA 4JI3Q 1QVGA 2R93B 4DR7L 3C1EA 5ISRA 2FMCA 4JI8L 2K50A 1FNUA 3B6YA 5GAEC 1D2BA 5C3XA 4DR7Q 1PZID 4DNTB 2OQ0A 2VW9A 1BO0A 1C7YA 3RLNA 5BN4A 1KD1C 4A3GH 2JA5G 2RBMA 3TP7A 4LFCQ 4YCVA 3PF4A 3UDXA 2EYHA 1UE1A 1G291 1B53A 2KBNA 4OL7A 2G5DA 1XX8A 2HQEA 5KEEA 1K0RA 1VQGA 4P75A 2B29A 3KF8B 4A3KB 2NN6H 3CMEA 5TSSA 3FVQA 4DV4L 2EJMA 2K5WA 1PRTD 1YNND 1O7IA 4JYAL 4Q5VA 1PFMA 2KA7A 3NENA 5IOCA 2B8FA 3BYTB 3TZDA 1L0YB 5CORA 4KKSA 1VQEA 1U4LA 1FNWA 1V9PA 5EKKA 2RDGA 4IPHA 4MIUA 4C2MH 3J81E 2MQHA 5A35A 1PH8A 2NVTH 5AJ3L 1HR0W 1WTPA 3ER0A 1AH9A 3H09A 1CKOA 1L1OA 2FMMA 1Y1WG 2LSSA 1RJTA 4GN5A 3EQLC 4RGOS 2R93G 2MP1A 4H7BA 4QL5A 2B39A 1A6XA 2JA8H 2F3IA 2BCOA 3NP8A 2EYLA 2XNAC 4JI1Q 1ENFA 3W1GA 2PQAA 1U4RA 5C5LA 3S1MB 2E76C 2VQFL 2PW5A 1BCPB 1I6HH 4X62L 1C48A 1AEXA 2E74C 4ULLA 2K6AA 4S3SA 3PCOB 2HDMA 3S2DH 4QCLA 1STAA 1I3QH 5D14A 3GQBA 1TS5A 2F4VL 4PV1C 1UWVA 4IURA 1C4QA 2VQEQ 4A3FG 3DXJC 4BBSB 4FXGC 3HFZB 4B3ML 4V190 4ZUJA 1PFSA 1LUZA 5KYLA 1TR5A 1EIGA 4OGQC 3JAMc 2O2LD 2NTSA 1N34L 3EN2A 4FXKC 5I6YA 1FVIA 1MSGA 3PO2H 1F9RA 5EKLA 4IFDJ 4A3BH 1QZGA 1JJGA 4DR1Q 3L2PA 4B3SL 3E6ZX 3VR3A 4O0AA 1EFID 1ZYRD 3PF5A 3I4MG 2YU9H 1EWHA 3MZ5A 2OWOA 4LF5L 2X69A 3V05A 3X3MA 1LT4D 3K5NA 5IT9E 2R93H 4YIJA 4DR3L 3NTIA 4LF7Q 1O78A 4BY1H 4JI8Q 2IHFA 4RWSC 1W2BA 1YJ9A 2PZUA 1GJXA 1I6VC 4K2LA 3DMUA 4JV5Q 4IQZA 1L1OC 1QUQB 3KDFB 3STBD 4DV2L 4A3IB 4CDFC 3HOYB 3G71A 2RA4A 1OXXK 5M5XH 1LTGD 1WTRA 2O5IC 1TWGB 1LV9A 5CMDA 1WTOA 4POGA 3I2ZA 1B44D 3O13A 1B7YB 4TRDA 1NR4A 3NUCA 4NMZA 1PTOF 2A5HA 3FPPA 2CCZA 3S17H 4XT3B 3HS0C 5M3FG 3RN2A 1JOQA 4DV4Q 1GM5A 5EQ0A 3SVMA 4PQXA 5C44H 3G6EA 2MPMA 1PYSB 3J81L 2MHVA 1WD1A 4HJ8A 1FGBD 2AHOB 3MAQA 1I4XA 2Z0SA 4J1MA 2CWAA 2DJFC 5IGEA 3E5SA 4QUFA 5C4JB 2L55A 4DV0L 4MTNA 3IFTA 1HA5A 1JCKB 2CVRA 2LY7A 1F2MA 4GNXA 3M3YH 1RCVD 3BDOA 1CTMA 1TU2B 4OELB 3Q0AA 3V2TA 1EQVA 3VA5A 2E2JB 2IX0A 1PH2A 4LAAA 3C46A 1HZCA 2A1AA 4LUZA 5FLMG 4EQNA 2BH2A 1R4QB 2AQ1B 4CJ1B 4U673 1ENCA 1DD2A 5EBDA 4AQYL 3QO2A 1ZYRC 4QIWE 4AYBE 4OHJA 4A3MB 4R9WA 3S1NH 2KHSA 5D3IB 1PH1A 2VUMG 4KY5A 2QCPX 3STBC 4GZYC 1P8LA 4PZ7A 1VMCA 3ND8A 1EZ8A 2I07B 4QF4A 4CGYB 3OTOL 1B8AA 3CRLC 1EYAA 4UP8A 3I4NH 2JA6G 4A3DH 2M00A 1CK1A 1B70B 2E5LL 4APVA 4F87A 1VQBA 4X64Q 3J81c 1RHPA 2ENBA 4DR2Q 1NUCA 3L0OA 2AQ2B 4LUVA 1H9KA 1DGSA 3I72A 1AFPA 4DR3Q 3CC7A 4LF7L 4NB3A 4I7ZC 3F2DA 4DAYB 1QUQA 3KDFA 1DYQA 3PUXA 4EX5A 1E2VA 4A3GG 2I5LX 1ENAA 1TWCH 2B2VA 3TRZA 3F1ZA 1VQDA 2PZTA 5C6AA 5BN5A 1HNWQ 4QB4A 1PDQA 3J80L 2A19A 1EYCA 1J8IA 4R8IA 5IYBH 3GTMB 3DM3A 5JPNC 1STBA 2EY1A 3HOUB 3R8BA 1SMYD 3TP8A 1YNXA 2DGYA 2ZJPA 5LL6X 2EYJA 1Q12A 5BR8L 3PIO3 3TP6A 2UXBL 2SEBD 2K5QA 2UUCL 3LWEA 4A3BG 1LT5D 1S5FD 2WAQG 3AU7A 1X6OA 5IYCH 5JPMC 3GV3A 5IGFA 4JW0A 2GA4B 4DK0A 3RNUA 5K36H 2Q2UA 5E4XA 5KGUA 1I4HA 2QGQA 3K59A 3C3LA 2YTVA 4DUZQ 1EY5A 1L0XB 5JEAJ 4DNIA 1R9TB 1PHJA 1IL2A 4MZ9A 4NXNQ 4IPGA 2F0SA 1SNPA 2EY6A 4K8IA 1JJ2A 1WTXA 4C3HH 4X62Q 4KI0A 4NXNL 1QB5D 2MFIA 1SFOH 4NW2A 1CUKA 1FR3A 5C3WA 1A3TA 2D5DA 4A3LH 1TKWB 3EFXD 4A93H 1N32Q 2HUGA 2RHQB 3MXUA 1NR2A 1CKMA 4UPAA 4UP9A 2F0NA 3GTLB 3M4QA 1XMOQ 2DNEA 1EU3A 4JI4Q 5NUCA 2QA4A 2IY5B 1LYLA 5FO7B 5HGTA 3CC2A 1ZKOA 2JK8A 4IPDA 2ZJRA 3PUVA 2JA5H 2GN5A 4WORA 4RKBA 1BBWA 3KOJA 4KHPQ 3I4NB 3NTHA 4XQJA 2VS1A 1TIID 1W6KA 5JEAH 4DV7Q 1PFNA 4DV0Q 1F9QA 4DAYA 3BVMA 4K2KA 2DY8A 2FXQA 1JOKA 2IX3A 1K83H 5C0XG 2PW7A 4HIOA 2V4DA 1JJCB 3DEOA 2ZXPA 3OWEB 5GADC 4A3MH 1H9MA 1U5KA 1Y1VG 4LW1A 4NP5A 4P72A 1QJOA 2B2UA 4X3SA 2ZM6L 3S1NB 1S3OA 3D3RA 5G3LF 1HNZQ 1IZ6A 1Y1VH 4N9TA 2LXJA 2XWJB 2E2JH 3AYHB 5IYDH 3FDTA 3AEVA 2PMZB 1E2ZA 3HGBA 4XYOA 2F0FA 3HKSA 5J3BA 1I4QA 4OX9L 5GROA 2KCCA 3NBHA 4LF9L 1IBMQ 4Z9CB 3EBEA 1BVSA 4ZCKA 4ZKBB 1HR0Q 4QUCA 4CDEC 4F88A 1KXLA 3VR5A 1PRTB 2RDFA 4IUPA 4QY7A 2XSCA 3G48A 3I8ZA 3S2HH 1EL0A 1E1TA 1U0LA 4DUYQ 1VQJA 4BBRG 2XGTA 4GOPB 4DAVA 3SK6A 3MEHA 1IBLQ 4WFN3 2K05A 3PUYA 1VDZA 3EVQA 3EJIA 3SR1A 1JWMD 1OXTA 1IBKL 2B8GA 2UUAQ 4AQYQ 2A74C 3Q24A 4OO1I 3E0JA 5EJWA 3I91A 4JI5L 4DV6L 4BBSH 4HJ7A 4GOPC 3PMFA 2HCCA 1X3GA 1SLJA 3FKIG 2AKWB 3GTKB 1A8VA 2F0IA 3IKJA 1PA6A 4EQPA 1W3SA 3KUPA 3A5UA 1V1OA 5JJKA 1RTOA 1YNJD 1DJRD 2EDGA 4KHVA 3M4OH 5CV5A 3NTKA 1ICWA 1XTDA 3DM1A 5C44G 4JI0Q 1SR3A 1YEZA 2IT1A 5M3MH 3VYRA 3W3AA 2EVBA 3TS2A 3JAME 3RN5A 3OOCA 5M5YH 3I56A 4OO1G 1B9MA 2BE5D 2OF1A 1LTSD 1SRUA 1LTLA 4P2CB 2Z4IA 5CYUA 1KDBA 5IT9L 3CQZB 5DM73 3FP9A 1PTOH 2HHHQ 1XMQQ 3K5LA 3HOUG 3CXCA 3HOZG 2QEJC 1D1IA 1PLFA 4POFA 4HSVA 3NHHA 2H1EA 1VQIA 2AWOA 4A3BB 1DCZA 1Q81C 1PH9A 1JWUD 2R3ZA 3MA2B 3UDGA 1BF4A 2K33A 1EU4A 3W5OA 4DV7L 1YVCA 2M2LA 1GUOA 5DEHA 3WDNA 4MN3A 2L1BA 4ZQ3A 1CZGA 4GN4B 5IE8A 4DR6Q 4JV5L 3PO3B 2K03A 1Z9FA 3D0FA 2JXMB 4HAEA 2RQXA 1C9OA 3HP3A 4IUNA 3S16H 1S4ZA 2R7ZB 3M4YA 2DUDA 4DKAC 3PO3H 5FLXc 3TMEA 3UI2A 3L9AX 1BBXC 2ALYB 3I4MH 3URYA 2WB1G 2PQEA 4A3DG 2JP1A 4B9WA 3KJOA 5T1GA 4R4QA 2H4OA 5CV9A 5C3EG 1VQPA 4AH6A 3SDZA 4O2DA 4OXPA 4F8MA 1Y1WH 5FLXE 1UE5A 2N8NA 1WCMG 3ULPA 1Y8OB 1A15A 5CGKA 5EPJA 3TDQA 3CPWA 1A62A 3ZYYX 2JA5B 4HCSA 3NWTA 2HIVA 1K8OA 3H3VH 3E3XA 5I2YA 1F77A 1KTKA 2EOTA 4JI6Q 4NXMQ 2ZJQA 1I4RA 3J81j 1CQFA 2NN6G 2CWPA 4FP5D 1Q86C 4ZK9B 2AUJD 1KC8C 2A68D 3D8GA 1B3QA 3BYYB 2WAQB 3MXNB 1YJNA 2EJFC 1EYDA 4BS9A 3BDLA 1MSHA 3U4ZA 4LWCA 4TQUS 4ZYSA 4GOPA 2UU9L 1XMQL 4O42A 2OEOA 2XIWA 2PZWA 1AZPA 2WAQE 3QOLA 5IGDA 2BH8A 3DLLA 3OW2A 1WD0A 4Y7NH 5A2QE 2R92G 1SYGA 1STEA 3R3OA 4XTCS 2N55A 1AW7A 1G2SA 4A3EB 2K5VA 5C4XG 4YWLA 1LTID 4GN3B 3M85A 1K8GA 1HPCA 1HFNA 1WTHA 4JBJA 1P16A 1ZEQX 4OIJA 3I73A 3KJPA 1EY6A 1H9SB 2I46A 2B2VC 1EY9A 2B3GA 2F0LA 4RHSA 5CV7A 3S1RH 2KECA 1I94L 1AP0A 4IFDG 2B2TC 1MKHA 3AFQA 4B3RQ 3OIPA 4IFDH 4TVAB 4JI3L 2F0OA
chains in the Genus database with same CATH topology
1RKNA 1SE2A 1PZKD 2E2HB 2Q8IB 5FLXL 2NYZD 2R61A 2F1MA 3TZUA 1JR0D 1S5CD 1GUWA 2ICEC 1O80A 5C0XH 4KMUC 5M3MB 2A6EC 4RGMA 4RAUC 2Z1CA 1HQRD 5E3FA 3M4OB 3RMHA 2WKCA 1BNZA 3QB3A 1IKLA 2HCIA 3BVZA 3GV6A 1LTTD 3SEBA 4DXFA 1RTNA 1SAPA 1TQOA 2SNMA 3GTQB 3KF8A 5K5PA 2VB2X 1RF2D 2F0UA 3QG1A 1LTAD 2C5CA 4QIWB 4AYBB 1F2ZA 5JAVA 2NUCA 5IIFA 4XT1B 1OXVA 3A7AB 3Q6SA 3HRZC 2F0VA 3CHBD 1SYBA 1DOMA 2FFKB 1IW7D 3K5OA 1EIHA 2L12A 2Q8RE 3MFYA 5C44B 1G6ZA 2NBFA 3KLRA 2NVYB 2K5DA 2VXWA 2FINB 2F0EA 1CHQD 1SNOA 4G7ZC 4HCEA 1MGSA 3OMCA 2G9DA 1UNSA 4V0BA 4RFBA 3QIAA 4RGTA 3S14B 2VB3X 1SE3A 4X3KA 2VNUD 1F9PA 2C9OA 3K5MA 2JE6I 4DN4M 4K5VA 5FO9B 1IHZA 4RKLA 3T16A 1YNJC 5CC4A 3L3OC 1QILA 3VR6A 3HKZB 1RDPD 1BCPC 3DHQA 1GXDC 3NBIA 1QG7A 4DGZA 4PMWA 4A3DB 3J80E 4PMBA 4C3HB 5IGBA 1RODA 1SFOB 3VYTA 4KN4C 5D3DA 4IZ8A 2K28A 3SK4A 3PUWA 4Q0FA 4FF1A 1O7LA 2F0JA 1XTCD 2DY7A 5FO8B 5M9OA 1KAAA 4ZLTF 4FNFA 4BY1B 5AFWA 5JOBA 2AWNA 1VF7A 3FMCA 2NWGA 2X6GA 3F2UA 4CBVA 1CA5A 3DUZA 3WOFA 2WV6D 5BN3A 2BDOA 1FNVA 2KEDA 2DN8A 1V8QA 2KOLA 3GTJB 3NQTA 2F0GA 4DF7A 2A73B 1LT3D 2WIIB 3NE5B 1LT6D 1HXYD 2FHTA 5FKAC 1K83B 3HOWB 4BY7B 3KBGA 3OWFA 1BOSA 1GOZA 3I4MB 1SSOA 4C1NI 4RCOA 1Y8NB 5DM63 4IN3A 4CKCA 3GO5A 3OSOA 1MBYA 4EVOA 4C3IG 2F0TA 4Y7NB 3FRPB 5G3LD 2XRSD 1A3VA 3CU7A 4IUVA 3S2HB 2EY2A 2MJ8A 4KN7C 2F4IA 4RA8A 5F2DA 3D31A 3M7GA 2BE5C 2WB1B 3ITPA 3NXWA 3BZDB 2TSSA 1TY0A 2L4NA 1M4VA 2OT2A 5CBEE 3GTPB 2RSNA 2NVQB 2SNSA 3SK8A 4OO1H 1DZ1A 3H6MA 2K32A 3D4RA 5ELCA 5JEAG 1EY4A 5CV6A 4CKEA 3V96A 1IYVA 1Y1VB 1DOKA 2EYMA 4KKTA 4LMQD 2EE1A 2K1BA 5DNFA 3MHBA 1O7YA 3PV0A 1SDFA 4K6LA 2VUMB 4ZRZA 1I50B 1ONLA 2L0CA 3OHXC 2EXZA 4DXGA 4C3JB 2BA1A 3A7LA 4DFAA 3K57A 5DAUA 1JE4A 3T4AC 2ZT9C 3DEPA 3P7JA 4N9PA 4G4KA 3T56B 1SJHD 3ND9A 5EBCA 4C3HG 3RD4A 1EEID 4A93B 4A3GB 4EQOA 4X3UA 1T5XD 5JVG3 4XQQA 5M5XB 4M8AA 2QF7A 3J7YW 3IAYA 2A69C 2BA0A 2E2DC 4BA1I 1HUMA 4MHEA 5I9OA 1EZ6A 1HRJA 1M8AA 3HOXB 2KVMA 4IALA 4LJZC 1H9SA 1GUGA 1GUSA 3A8IE 2IX1A 2E2IB 1JORA 1Q1BA 1Q8IA 5JJZA 1TWHB 1GHJA 5CR3A 2MUYA 4ZKCB 4KKUA 1IKMA 1YNNC 3H91A 1LABA 2CHBD 3ERQA 1BQQT 3VYUA 1TS2A 5ELBA 5KIXA 2BOSA 1G8ZD 1RD9D 1ET6A 1B1ZA 2B2YC 4KJNA 3H94A 1SNQA 5IODA 4B08A 4NKLA 2RSOA 5C0XI 3T51B 3I3CA 3MXGA 3OMGA 4CHTB 4KY6A 4UAIA 4C3IB 4CJ0B 4ME5A 3HEJA 2XRQD 5C5MA 1I6HB 4KY7A 4BBRB 3TN2A 4C56C 1PTOD 2PCFB 1NAPA 2J4XA 4IFDI 1SNMA 2D9UA 4FF4A 4K8JA 2F0PA 4KHZA 2YYZA 1JB3A 1S5DD 1IL8A 2PO4A 1B50A 5KNCA 1HQMC 4A3FB 2LKVA 3J7AF 4QMGA 3D4DA 4M1UB 3MFGA 1PTOB 5ELFA 1QOHA 4TKOB 4BWGB 1TY2A 5I2XA 1GUTA 1UEAB 2O5JC 5T1IA 1TT2A 2IPKD 4WRDA 2CQAA 2K04A 3K7AB 1DOLA 3VYSA 3IFDA 1ILQA 1V43A 1FYCA 2JYOA 3S16B 1V1PB 1D1KA 1LTRD 2PPBC 3FPUB 1MI2A 4RCNA 5J22A 1AN8A 1UAPA 4G7HC 3OPOA 1STYA 2JEAI 5EGTA 3GP7A 5M3FB 1OXUA 3A56A 3U9OA 3R2TA 3R2IA 1BR9A 1BUVT 1XXGA 4U68A 1JWSD 2EYOA 3G7LA 2AUKA 2BDNA 4PNYA 2B2WA 1CT1D 1PFBA 2D2CC 3H3VC 4G7OC 4X3TA 1KDAA 3J7AV 2ZXOA 5IGGA 1Z6HA 1F9SA 1WTVA 3NQIA 4BA2I 3S9WA 4C2MB 1D5ZC 2NZ1D 1CZWA 3AB9A 3K6OA 1X3PA 5EKIA 1TWFB 4L8JA 2RVLA 5I6WA 2WKDA 4FF3A 1A2TA 1G91A 2EYFA 2EY5A 3OIQA 1GHKA 1CQVA 4L63B 1Y8PB 2PNRC 4HMJA 2LFNA 1HTPA 5C3EB 5EPLA 1K8MA 1CHPD 1MD2D 1U4PA 1WCMB 3PO2B 3WOEA 4ZUIA 4PMCA 4F7XA 1FD7D 1EQTA 3Q22A 4KK7A 1EWCA 3QWNA 1Q1EA 1VCIA 1NSNS 5COYA 2F0HA 3HZXA 1DXMA 3S1RB 2F0WA 5J39A 4K5XA 4JK1C 1I3QB 1SYFA 3I90A 1JICA 1LLRD 4CJ2C 3A55A 1PZJD 5KNBA 2EPBA 3S2DB 4HTHA 4CKBA 1CFMA 3IL8A 2IWHA 3N52A 1QWYA 3VA7A 1B4OA 2LMCB 2TMPA 5C4XB 1F2YA 1CI3M 2MGSA 1XYIA 3HOZB 4KJOA 1HA6A 2NB0A 2A68C 1STNA 1B3AA 5FK9C 1C8CA 5I4DA 4DAPA 5A2QL 3A8KE 3NWSA 3MWYW 2WACA 3PUZA 2YU9B 5KNDA 3SE0A 1WTWA 5ELDA 2A6HD 1EY8A 2F3VA 4IUQA 1KDCA 5KRUA 1SMYC 1SYDA 1PTOC 3HG9A 1Y1WB 4FVMA 1DONA 1STHA 4K5WA 4WJWA 5CV4A 2XVSA 3P20A 1Y69U 1D6EC 4RGNA 4XXEA 4K6DA 3H0GB 1H9JA 2M9VA 1PRTC 1R4PB 3A8JE 5CV8A 1CA6A 1Q3LA 1TVXA 1PXUA 2QILA 2Y0SB 3A54A 3D6CA 2K01A 3BG3A 4I65A 2D62A 1KNEA 4B9XA 4E6IA 1KNAA 2R6GA 5M5WB 1I4GA 4L6TB 1OXSC 3TSSA 1QCBD 1HUNA 4HMIA 3LWUA 1SBBB 2A6HC 2B63B 4DK1A 3K58A 1CM9A 1EY0A 3MTSA 2CW0D 2NVXB 3DWQA 1H9RA 2K7VA 2EYPA 2F0DA 1HHVA 3FEWX 1Z7TA 1BCPF 1PMRA 3W2DA 3S1QB 3HOVB 1KLGD 1STGA 1HCZA 3MXNA 4KD4A 5E4WC 1KLUD 1JC7A 5FOBB 1NCVA 2HDLA 2L5TA 4RHRA 1HTLD 4RH6A 3NSWA 5HURA 2SDFA 2SOBA 4KTAA 1SXTA 2LS01 1TWCB 1OO9B 1KABA 3QOJA 3OW7A 3U9SA 2N88A 2G9HD 1EY7A 3PIP3 1G2TA 4IUUA 2RKSA 1E0BA 1D5MC 3RZDB 3DWAA 1E2WA 2A69D 1V1PA 1QNKA 1EEFD 3GTGB 5C0XJ 3K0YA 3EA6A 1PRTF 2FJ2A 3QJYA 2KCNA 4C3JG 2XWBB 3L7ZC 2Q8TA 2ID0A 4TSSA 5JVH3 4FF2A 2JSOA 1SJED 3LNNA 2JEBI 5IGCA 3I70A 4ZAIA 2EJGC 4ID6A 1BXTA 5D65A 4OIKA 1BDOA 2B2TA 1QNUA 3ONAB 3JAML 3TBIB 3T13A 4HEDA 3BDCA 2JA8B 4XIGS 3MVVA 5ELEA 1JQYD 4O1NA 1VMPA 3MXPA 2F0KA 2ICIA 2L11A 1I4PA 3GTOB 4HN7A 2WP8J 4ODGA 3D4WA 4H13C 3KK7A 2XN9C 4JBWA 2X6LA 2RDHA 3I4LA 1WTQA 3M7NA 3R93A 2KJXA 3G6JB 4XQNA 1Z47A 5J1ZA 3RUZA 1S5ED 3T53B 2F03A 4LK1C 4A3JB 1DM0B 1Q90A 1LO5D 1IYUA 4DU9A 1QE6A 3GD7A 2ZXRA 2IW3A 1LACA 1UUPA 3TP5A 2Z8LA 3CRKC 3N6RA 1II3A 1F2LA 2Z4HA 1ILPA 2IJ0A 4J6HA 1EOTA 2F0MA 1SE4A 1TS3A 3C2PA 1S5BD 3C1FA 1ET9A 4HSPA 1ZXTA 4DNRB 5M5YB 4H44C 2L9HA 4DA2A 1ML0D 4XDXA 1A3UA 3SHLA 1IW7C 5EPKA 1BCPD 1D5XC 5K36G 4G57A 1JOOA 3Q23A 5I9PA 5CBAE 2NN6I 1HFGA 4ILWA 3SK5A 4KV6A 3RLFA 1PYWD 1X32A 5LL6S 1B9NA 2PYKA 2F0QA 3VR2A 3NPPA 3RZOB 2JA6B 2OXPA 5KYIA 1U9RA 1X3QA 1SYCA 1O7ZA 2J0TD 2O4XA 2DNCA 1W6JA 5LHY1 1SYEA 3SXHA 3S17B 4FYDA 2NTTA 3P75A 1T5EA 4C1NK 2IL8A 4R8NA 4FXDA 4EGVA 3KBXA 2B2UC 3M3YB 3FKIB 2J7ZA 3VR4A 1AZQA 3KLSX 1XWEA 1TWAB 4ABNA 2EZVA 2WINB 2KQ3A 4HR7B 3CKIB 5E1FA 3LX0A 1A2UA 2R92B 2NVTB 1ESFA 2QDBA 2JA7B 2A6ED 4J8QA 3NK9A 3EROA 2B2WC 2AQ3B 2KEEA 3AMUA 2KUMA 4KD3A 1U4MA 4H0LC 3X3NA 4NDXA 3D6WA 1SEBD 1SNCA 4UDUC 2QKIC 4XYQA 2F3WA 3BS1A 3S15B 1GUNA 1ESRA 2E75C 1B2TA 2B2YA 1LTBD 3MC0B 1VF5C 1J9OA 1SNDA 3P1HA 1WVLA 1TS4A 3DWPA 4K14A 4IUTA 3BVGA 4FO2A 5C4ZA 3KLSA 2CW0C 5C4HA 2R93B 3C1EA 5ISRA 2FMCA 1FNUA 1D2BA 5C3XA 1PZID 4DNTB 1BO0A 5BN4A 2RBMA 3TP7A 2EYHA 1G291 1B53A 4OL7A 1XX8A 2HQEA 5KEEA 4A3KB 2NN6H 5TSSA 3FVQA 2EJMA 2K5WA 1PRTD 1YNND 4Q5VA 1PFMA 2KA7A 5IOCA 2B8FA 3BYTB 3TZDA 1L0YB 5CORA 4KKSA 1U4LA 1FNWA 5EKKA 2RDGA 4MIUA 3J81E 5A35A 1WTPA 3H09A 2FMMA 1RJTA 3EQLC 4RGOS 2MP1A 4H7BA 2B39A 1A6XA 2BCOA 3NP8A 2EYLA 2XNAC 1ENFA 1U4RA 5C5LA 3S1MB 2E76C 2PW5A 1BCPB 1C48A 1AEXA 2E74C 4ULLA 2K6AA 4S3SA 2HDMA 4QCLA 1STAA 5D14A 3GQBA 1TS5A 4PV1C 4IURA 1C4QA 3DXJC 4BBSB 4FXGC 4V190 4ZUJA 5KYLA 1TR5A 1EIGA 4OGQC 2O2LD 2NTSA 4FXKC 5I6YA 1MSGA 1F9RA 5EKLA 4IFDJ 3E6ZX 3VR3A 1EFID 1ZYRD 1EWHA 3MZ5A 2X69A 3V05A 3X3MA 1LT4D 3K5NA 5IT9E 4YIJA 3NTIA 1O78A 4RWSC 2PZUA 1GJXA 1I6VC 4K2LA 3DMUA 4IQZA 4A3IB 3HOYB 2RA4A 1OXXK 1LTGD 1WTRA 2O5IC 1TWGB 1LV9A 5CMDA 1WTOA 1B44D 3O13A 4TRDA 1NR4A 3NUCA 4NMZA 1PTOF 2A5HA 3FPPA 4XT3B 3HS0C 1JOQA 5EQ0A 3SVMA 4PQXA 2MPMA 3J81L 2MHVA 1WD1A 1FGBD 3MAQA 1I4XA 4J1MA 5IGEA 3E5SA 4QUFA 5C4JB 2L55A 3IFTA 1HA5A 1JCKB 2CVRA 2LY7A 1F2MA 1RCVD 3BDOA 1CTMA 1TU2B 3Q0AA 3V2TA 1EQVA 3VA5A 2E2JB 2IX0A 4LAAA 3C46A 4EQNA 1R4QB 2AQ1B 4CJ1B 4U673 1ENCA 1DD2A 5EBDA 3QO2A 1ZYRC 4OHJA 4A3MB 4R9WA 2KHSA 5D3IB 4KY5A 2QCPX 4GZYC 1VMCA 3ND8A 1EZ8A 2I07B 4QF4A 4CGYB 3CRLC 1EYAA 2M00A 1CK1A 4F87A 1RHPA 2ENBA 1NUCA 2AQ2B 1H9KA 3I72A 1AFPA 4I7ZC 1DYQA 3PUXA 1E2VA 1ENAA 2B2VA 5C6AA 2PZTA 5BN5A 4QB4A 1PDQA 3J80L 1EYCA 1J8IA 4R8IA 3GTMB 5JPNC 1STBA 2EY1A 3HOUB 3R8BA 1SMYD 3TP8A 5LL6X 2EYJA 1Q12A 3PIO3 3TP6A 2SEBD 2K5QA 3LWEA 1LT5D 1S5FD 3AU7A 5JPMC 3GV3A 5IGFA 2GA4B 4DK0A 5K36H 5E4XA 5KGUA 1I4HA 3K59A 3C3LA 1EY5A 1L0XB 5JEAJ 1R9TB 2F0SA 1SNPA 2EY6A 4K8IA 1WTXA 4KI0A 1QB5D 4NW2A 1FR3A 5C3WA 1A3TA 2D5DA 1TKWB 3EFXD 2HUGA 3MXUA 1NR2A 2F0NA 3GTLB 2DNEA 1EU3A 5NUCA 5FO7B 5HGTA 1ZKOA 3PUVA 4WORA 4RKBA 3I4NB 3NTHA 4XQJA 1TIID 1W6KA 5JEAH 1PFNA 1F9QA 4DAYA 3BVMA 4K2KA 2DY8A 1JOKA 2IX3A 5C0XG 2PW7A 2V4DA 3DEOA 2ZXPA 3OWEB 1H9MA 4X3SA 4NP5A 1QJOA 2B2UA 3S1NB 3D3RA 5G3LF 4N9TA 2XWJB 3FDTA 2PMZB 1E2ZA 3HGBA 4XYOA 2F0FA 1I4QA 2KCCA 3NBHA 4Z9CB 4ZKBB 4QUCA 4F88A 3VR5A 1PRTB 2RDFA 4IUPA 2XSCA 3I8ZA 1EL0A 4DAVA 3SK6A 3MEHA 4WFN3 2K05A 3PUYA 1VDZA 3EVQA 3EJIA 3SR1A 1JWMD 1OXTA 2B8GA 2A74C 3Q24A 4OO1I 3E0JA 5EJWA 3I91A 3PMFA 2HCCA 3GTKB 2F0IA 3IKJA 4EQPA 3KUPA 1V1OA 1RTOA 1YNJD 1DJRD 2EDGA 4KHVA 5CV5A 3NTKA 1ICWA 3DM1A 2IT1A 3VYRA 3W3AA 2EVBA 3JAME 3OOCA 4OO1G 1B9MA 2BE5D 2OF1A 1LTSD 4P2CB 2Z4IA 5CYUA 1KDBA 5IT9L 5DM73 3CQZB 1PTOH 3K5LA 2QEJC 1D1IA 1PLFA 4HSVA 3NHHA 2H1EA 2AWOA 4A3BB 1DCZA 1JWUD 2R3ZA 3MA2B 1BF4A 2K33A 1EU4A 2M2LA 1GUOA 5DEHA 3WDNA 4MN3A 2L1BA 4ZQ3A 1CZGA 3PO3B 2K03A 2JXMB 4HAEA 2RQXA 3HP3A 4IUNA 1S4ZA 2R7ZB 3M4YA 3TMEA 3UI2A 3L9AX 1BBXC 3URYA 2PQEA 2JP1A 4B9WA 5T1GA 2H4OA 5CV9A 3SDZA 4F8MA 5FLXE 1Y8OB 1A15A 5CGKA 5EPJA 3TDQA 3ZYYX 2JA5B 4HCSA 3NWTA 1K8OA 5I2YA 1F77A 1KTKA 2EOTA 1I4RA 1CQFA 2NN6G 4FP5D 4ZK9B 2AUJD 2A68D 3D8GA 3BYYB 2WAQB 2EJFC 1EYDA 4BS9A 3BDLA 1MSHA 4TQUS 4ZYSA 4O42A 2OEOA 2XIWA 2PZWA 1AZPA 3QOLA 5IGDA 1WD0A 5A2QE 1SYGA 1STEA 3R3OA 4XTCS 2N55A 1AW7A 1G2SA 4A3EB 3M85A 1LTID 1HFNA 1HPCA 1ZEQX 4OIJA 3I73A 1EY6A 1H9SB 2I46A 2B2VC 1EY9A 2F0LA 4RHSA 5CV7A 1AP0A 2KECA 4IFDG 2B2TC 3OIPA 4IFDH 2F0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M2L A;  1ML0 D;  4UAI A;  2VXW A;  2FIN B;  2B2V A;  3DEO A;  1U4L A;  2L1B A;  3N52 A;  4HED A;  4MN3 A;  4CJ0 B;  1CM9 A;  4U68 A;  3G7L A;  2RA4 A;  2FHT A;  1PDQ A;  1MGS A;  4XDX A;  2B2W C;  4X3S A;  1WTR A;  2BDN A;  3MTS A;  1B4O A;  1JE4 A;  1LV9 A;  2B2U A;  2KEE A;  2K03 A;  2KUM A;  5CMD A;  1WTO A;  2NYZ D;  1J8I A;  3TN2 A;  5EPK A;  2B2W A;  1VMP A;  4R8I A;  4HAE A;  3HP3 A;  2MGS A;  1XYI A;  1SSO A;  2L11 A;  1NR4 A;  1S4Z A;  3DEP A;  1WTP A;  1U4M A;  1NAP A;  1PFB A;  1HA6 A;  1HHV A;  3FDT A;  2FMM A;  3P7J A;  3UI2 A;  1B3A A;  3D6W A;  1BBX C;  1GUW A;  1RJT A;  4X3T A;  4XT3 B;  2D9U A;  2JP1 A;  5EQ0 A;  3ONA B;  1O80 A;  2MP1 A;  3LWE A;  5T1G A;  3SVM A;  1F9S A;  1WTV A;  1C8C A;  4X3K A;  4ZKB B;  1F9P A;  4QUC A;  2MPM A;  3MWY W;  2NZ1 D;  5E4W C;  1ESR A;  3GV3 A;  4DN4 M;  1WD1 A;  1IL8 A;  1A15 A;  4RAU C;  2B2Y A;  4IUP A;  5EPJ A;  2X6L A;  5CBA E;  1WTW A;  1B50 A;  5E4X A;  1X3P A;  4X3U A;  1U4R A;  3I8Z A;  1J9O A;  1NCV A;  2HDL A;  5EKI A;  1EL0 A;  1WTQ A;  4QUF A;  4HCS A;  4IUQ A;  3R93 A;  1HFG A;  2RVL A;  1WVL A;  4IUV A;  2CVR A;  2SDF A;  4IUT A;  2MJ8 A;  1G91 A;  2EOT A;  4RA8 A;  1BNZ A;  1X32 A;  1IKL A;  2K05 A;  1QG7 A;  2HCI A;  1WTX A;  2HDM A;  1DON A;  1HUM A;  4MHE A;  3GV6 A;  4ZK9 B;  1HRJ A;  4NW2 A;  1M8A A;  5D14 A;  2N88 A;  5T1I A;  2KVM A;  5EJW A;  5EPL A;  3I91 A;  1U4P A;  1RTN A;  1G2T A;  1ROD A;  4IUR A;  4IUU A;  4CJ1 B;  2L4N A;  1SAP A;  2HCC A;  1E0B A;  2K04 A;  1MSH A;  1X3Q A;  3QO2 A;  1BO0 A;  2HUG A;  1O7Z A;  1NR2 A;  1EQT A;  1DOL A;  1QE6 A;  2K28 A;  4O42 A;  5CBE E;  2RSN A;  3KUP A;  5JJZ A;  1RTO A;  4R9W A;  2XIW A;  3IFD A;  1QNK A;  1ICW A;  3DM1 A;  1AZP A;  1ILQ A;  5COY A;  1EIG A;  1VMC A;  2JYO A;  2FJ2 A;  2DY7 A;  4ZKC B;  1DZ1 A;  1CA6 A;  1Q3L A;  1WD0 A;  1IKM A;  1B2T A;  1B53 A;  3H91 A;  1TVX A;  4XT1 B;  1MSG A;  1F9R A;  4ZLT F;  2Q8T A;  2N55 A;  5AFW A;  1XX8 A;  2IL8 A;  3Q6S A;  1G2S A;  1F2L A;  1ILP A;  1DOK A;  3FPU B;  1MI2 A;  2K01 A;  3KBX A;  1EOT A;  4LMQ D;  1HFN A;  1KNE A;  2EE1 A;  2K1B A;  1DOM A;  3I90 A;  2B2U C;  1JIC A;  2NWG A;  5DNF A;  2X6G A;  2FFK B;  2B2Y C;  3F2U A;  1O7Y A;  4OIJ A;  4CJ2 C;  1RHP A;  1KNA A;  1PLF A;  2J7Z A;  4ZAI A;  1SDF A;  2EPB A;  2X69 A;  2L12 A;  1CA5 A;  1EIH A;  1PFN A;  2B2V C;  1PFM A;  2Q8R E;  4HSV A;  1AZQ A;  1AP0 A;  2KEC A;  2H1E A;  1ZXT A;  1F9Q A;  1G6Z A;  2RSO A;  3TZD A;  2B2T C;  5D65 A;  2L9H A;  3I3C A;  4OIK A;  4RWS C;  2KED A;  2R3Z A;  1HUN A;  5COR A;  2DY8 A;  3IL8 A;  2B2T A;  1BF4 A;  2KOL A; 
#chains in the Genus database with same CATH topology
 1RKN A;  1SE2 A;  5GQO A;  1PZK D;  2E2H B;  2Q8I B;  1X56 A;  4HID A;  1VQ5 A;  4RG1 A;  5FLX L;  3AFP A;  2NYZ D;  3U58 A;  2H5X A;  2ES2 A;  2HIX A;  2R61 A;  2F1M A;  3E9H A;  3TZU A;  1JR0 D;  1S5C D;  1GUW A;  2ICE C;  1O80 A;  5C0X H;  4KMU C;  5M3M B;  2A6E C;  3CD6 A;  4RGM A;  4WJ3 M;  4RAU C;  5FJ8 G;  2Z1C A;  1HQR D;  3E0E A;  1AE3 A;  3HOX H;  4A4I A;  5E3F A;  4NPS A;  3SGI A;  4I7A A;  3M4O B;  4DV3 Q;  4LF6 L;  4A3K H;  1GD7 A;  3RMH A;  2WKC A;  1BNZ A;  2OTJ A;  3QB3 A;  1IKL A;  2KEN A;  5H1S E;  2HCI A;  3BVZ A;  1C0A A;  4B3T L;  1MJE A;  1N36 Q;  3GV6 A;  1LTT D;  3SEB A;  4DXF A;  2VL6 A;  1RTN A;  1SAP A;  2MO1 A;  1TQO A;  1EIY B;  1HZB A;  2SNM A;  3GTQ B;  3KF8 A;  5K5P A;  3HOW H;  4BY7 H;  2VB2 X;  1RF2 D;  2F0U A;  3QG1 A;  1LTA D;  2C5C A;  4QIW B;  4AYB B;  1F2Z A;  5JAV A;  2NUC A;  5IIF A;  4XT1 B;  2WFW A;  1NMG A;  3T1Y L;  1K9M C;  4N8X 1;  1HZ9 A;  1OXV A;  3A7A B;  3Q6S A;  3HRZ C;  1VQL A;  4IOA A;  1IYJ B;  2F0V A;  4B3M Q;  3CHB D;  1SYB A;  1DOM A;  2FFK B;  1IW7 D;  3K5O A;  1EIH A;  2L12 A;  1LM0 A;  2Q8R E;  3MFY A;  4N8F A;  3U50 C;  3UDF A;  5C44 B;  1G6Z A;  1D8L A;  2NBF A;  3KLR A;  2NVY B;  2K5D A;  2VXW A;  2FIN B;  2F0E A;  1CHQ D;  1SNO A;  4G7Z C;  2E2I H;  1MIU A;  4HCE A;  1MGS A;  3OMC A;  2UXB Q;  3A0J A;  2G9D A;  1UNS A;  3FHW A;  4V0B A;  4RFB A;  3QIA A;  4RGT A;  3S14 B;  2VB3 X;  2R92 H;  1K8A C;  2CH4 W;  4GNX B;  2JA7 H;  1SE3 A;  3T1H L;  4JBK A;  4X3K A;  2UUC Q;  3CC4 A;  2VNU D;  1F9P A;  2C9O A;  1SRO A;  3K5M A;  2JE6 I;  4DN4 M;  4LFB Q;  4K5V A;  5FO9 B;  1IHZ A;  4RKL A;  1X65 A;  5ELN A;  3T16 A;  3ZJY C;  1YNJ C;  1NNX A;  5CC4 A;  3L3O C;  2QEX A;  4DAM A;  3HOW G;  4BY7 G;  1YIT A;  1QIL A;  3VR6 A;  4HIM A;  1M90 C;  4JI4 L;  5IY0 A;  3H15 A;  2UUB L;  3HKZ B;  2D0O A;  5EAY A;  4R4T A;  1RDP D;  1BCP C;  3DHQ A;  1GXD C;  3NBI A;  1QG7 A;  2CQO A;  4DGZ A;  4PMW A;  4A3D B;  2VQF Q;  3J80 E;  4PMB A;  4BBR H;  4C3H B;  5IGB A;  1ROD A;  1SFO B;  3VYT A;  3VDY A;  4KN4 C;  5D3D A;  4IZ8 A;  2K28 A;  3SK4 A;  3K7A H;  3PUW A;  4Q0F A;  4FF1 A;  1O7L A;  2F0J A;  1XTC D;  2EQS A;  2DY7 A;  5FO8 B;  5M9O A;  1KAA A;  5GAG C;  4GNX C;  4ZLT F;  4FNF A;  4BY1 B;  5AFW A;  4JI1 L;  5JOB A;  3CP0 A;  2Q2T A;  1EWI A;  3H3V I;  2AWN A;  2VY3 A;  1VF7 A;  1E22 A;  3FMC A;  3T1H Q;  2NWG A;  3HOY H;  4L5T A;  2X6G A;  3F2U A;  3JC6 6;  4GLX A;  3PIO A;  3IRB A;  4CBV A;  1M1K C;  1CA5 A;  4GLV B;  4JVZ A;  3DUZ A;  1UEB A;  3WOF A;  2WV6 D;  5BN3 A;  1E7Z A;  2BDO A;  1FNV A;  1KAW A;  2KED A;  4YCU A;  2DN8 A;  1V8Q A;  2KOL A;  5M3F H;  3GTJ B;  3M4P A;  3NQT A;  5C4X H;  3JAM i;  1V1Q A;  2F0G A;  2WII B;  2A73 B;  1LT3 D;  3NE5 B;  4DF7 A;  1LT6 D;  1HXY D;  2FHT A;  5FKA C;  3CCE A;  1NTG A;  4A3E G;  1AE2 A;  1K83 B;  3HOW B;  4BY7 B;  3KBG A;  3OWF A;  1BOS A;  1GOZ A;  1TWH H;  5DLQ E;  4DV1 Q;  3I4M B;  1RIP A;  1SSO A;  4C1N I;  3Q8D A;  4RCO A;  1Y8N B;  4CKC A;  4IN3 A;  5DM6 3;  3GO5 A;  3OSO A;  4LF8 Q;  4DV2 Q;  1MBY A;  1TWG H;  4EVO A;  4C3I G;  2F0T A;  4Y7N B;  4IO9 A;  3PO2 G;  3FRP B;  5G3L D;  3T1Y Q;  4X6A H;  2XRS D;  1A3V A;  3CU7 A;  2VZA A;  1VQ7 A;  4IUV A;  4UHV A;  1N36 L;  3S2H B;  3CCQ A;  2EY2 A;  2MJ8 A;  4KN7 C;  2F4I A;  4RA8 A;  1GKH A;  1WYD A;  4DK3 C;  5F2D A;  4P71 A;  3D31 A;  3M7G A;  2BE5 C;  2WB1 B;  1Q7Y C;  4BY1 G;  3ITP A;  2K5H A;  4LNQ A;  3NXW A;  3BZD B;  4JPB W;  2TSS A;  1S40 A;  1TY0 A;  3I7F A;  3K7U C;  2L4N A;  3I4N G;  1M4V A;  2YTY A;  5C3E H;  2OCE A;  4DR5 Q;  3S14 H;  3A5Z B;  1YZ6 A;  2OT2 A;  5CBE E;  3GTP B;  2RSN A;  4BXX H;  2SNS A;  2NVQ B;  4WJ4 A;  3SK8 A;  4OO1 H;  5IYB G;  1DZ1 A;  3H6M A;  2K32 A;  3D4R A;  5ELC A;  5JEA G;  1SN8 A;  4A3J G;  1K3R A;  2CFM A;  1EY4 A;  5CV6 A;  4CKE A;  2D0P A;  4A3J H;  3V96 A;  1IYV A;  1Y1V B;  2ZM6 Q;  4KKT A;  1DOK A;  2EYM A;  4PZ6 A;  3W1B A;  4LMQ D;  2EE1 A;  2K1B A;  5DNF A;  1Y14 B;  3KF6 A;  3MHB A;  1O7Y A;  2YV5 A;  2Z9H A;  4GS3 A;  3PV0 A;  1SDF A;  4K6L A;  4A3M G;  1R9T H;  2K4K A;  3U4V A;  2VUM B;  1MHW C;  4ZRZ A;  1I50 B;  1ONL A;  3CW2 C;  5IWA Q;  3HOU H;  2L0C A;  3OHX C;  2EXZ A;  3E9I A;  4DXG A;  4C3J B;  2BA1 A;  3A7L A;  4PG3 A;  4DFA A;  2ZTE A;  3K57 A;  3KF6 B;  3K0X A;  5DAU A;  1JE4 A;  3T4A C;  3M9B A;  2ZT9 C;  2GVA A;  3DEP A;  3CCL A;  5AJ3 Q;  3P7J A;  4IJH A;  4LF4 L;  1ASY A;  1HZA A;  4N9P A;  4G4K A;  3T56 B;  1SJH D;  3ND9 A;  5EBC A;  4C3H G;  3RD4 A;  1EOV A;  1EEI D;  4A93 B;  1YHA A;  5IP9 H;  4A3G B;  1PVO A;  1PH3 A;  2K5N A;  4EQO A;  4X3U A;  2RHS B;  1T5X D;  3K80 C;  5JVG 3;  5LMU Q;  4QQB X;  3TQY A;  4XQQ A;  5GAH C;  5M5X B;  1K3B C;  4M8A A;  2QF7 A;  2HT1 A;  3J7Y W;  3IAY A;  2A69 C;  1FL0 A;  2BA0 A;  4JOI A;  4Y52 H;  2E5L Q;  2E2D C;  4NXM L;  4BA1 I;  3RR5 A;  1HUM A;  4MHE A;  5I9O A;  1EZ6 A;  1HRJ A;  1M8A A;  3HOX B;  2KVM A;  5M3M G;  4IAL A;  1VQK A;  2Y0S G;  1L2F A;  4LJZ C;  4A3K G;  1H9S A;  4DUZ L;  4DV5 L;  1GUG A;  1GUS A;  3A8I E;  2IX1 A;  2E2I B;  2KHI A;  1JOR A;  1Q1B A;  1Q8I A;  5JJZ A;  2C35 B;  1TWH B;  1GHJ A;  4RMF A;  5CR3 A;  3RZO H;  1NBW A;  2MUY A;  2KCT A;  4ZKC B;  2NVQ H;  2A8V A;  1BKB A;  4KKU A;  1IKM A;  1YNN C;  4DV6 Q;  3H91 A;  2PI2 E;  1XNQ Q;  1LAB A;  4JC0 A;  5HGQ A;  2CHB D;  3ERQ A;  1BQQ T;  3VYU A;  5FLM H;  1TS2 A;  1X3F A;  5ELB A;  4OWW B;  3PO3 G;  2BOS A;  5KIX A;  1G8Z D;  1RD9 D;  1ET6 A;  1B1Z A;  2B2Y C;  4KJN A;  1EFW A;  5E7N A;  2AMC B;  3H94 A;  1SNQ A;  5IOD A;  4B08 A;  4NKL A;  2RSO A;  5C0X I;  3T51 B;  3I3C A;  3MXG A;  4DK6 C;  3OMG A;  4KY6 A;  4CHT B;  3ERS X;  4UAI A;  4C3I B;  4CJ0 B;  2HHH L;  2I5H A;  4ME5 A;  1UE6 A;  3HEJ A;  2XRQ D;  5C5M A;  1I6H B;  4KY7 A;  4BBR B;  3TN2 A;  4C56 C;  1PTO D;  2PCF B;  1NAP A;  3S1M H;  2J4X A;  2NVY H;  4IFD I;  1SNM A;  2D9U A;  1Q8K A;  4FF4 A;  4K8J A;  2F0P A;  4X64 L;  4KHZ A;  2YYZ A;  3F2C A;  1E24 A;  4P74 A;  1JB3 A;  1S5D D;  1IL8 A;  1EQR A;  2PO4 A;  3GTP H;  1B50 A;  1GO3 E;  5KNC A;  4HJA A;  1HQM C;  3UDI A;  5L37 A;  4A3F B;  4R4I A;  5M5W H;  2LKV A;  3J7A F;  3H0G G;  4QMG A;  1PV4 A;  3D4D A;  4M1U B;  3MFG A;  1PTO B;  2Z6K C;  1QOH A;  4TKO B;  5ELF A;  1J5E Q;  4BWG B;  1HJP A;  1TY2 A;  5I2X A;  2UXC Q;  4GKK Q;  4X65 L;  3HOZ H;  4DR1 L;  1GUT A;  1Q82 C;  4R1J A;  4JOI C;  1UEA B;  2PI2 A;  2O5J C;  4JI7 Q;  5T1I A;  1TT2 A;  2IPK D;  4DV3 L;  1YIJ A;  4WRD A;  4C3J H;  1VQ8 A;  2CQA A;  2K04 A;  3K7A B;  3HKZ E;  4JI2 L;  1DOL A;  1I50 H;  4OEM B;  3VYS A;  4GKJ L;  1PH5 A;  3IFD A;  2UU9 Q;  4JCV E;  4YCW A;  1ILQ A;  1V43 A;  3BJU A;  1FYC A;  3HKZ G;  4A3C G;  2JYO A;  1QZH A;  3S16 B;  1V1P B;  4UY8 C;  4A3I H;  1PYB A;  1D1K A;  5HY6 A;  4A76 A;  4KLK A;  2QW7 A;  1LTR D;  2PPB C;  3KYH C;  3FPU B;  1MI2 A;  4RCN A;  2R7Z H;  2JA6 H;  5J22 A;  4LF8 L;  1SE8 A;  3PSI A;  1AN8 A;  1UAP A;  4G7H C;  3OPO A;  1STY A;  2JEA I;  5EGT A;  3HOV G;  3CCJ A;  3GP7 A;  5IP7 G;  5M3F B;  1OXU A;  3A56 A;  2K75 A;  3U9O A;  3R2T A;  3K81 C;  1HNZ L;  3GTO H;  3GTL H;  3R2I A;  4LFB L;  1BR9 A;  1BUV T;  1XXG A;  1CKN B;  4U68 A;  1JWS D;  2EYO A;  3G7L A;  1KHI A;  1ASZ A;  1YBY A;  2AUK A;  1SMX A;  2BDN A;  4PNY A;  2K14 A;  3CCR A;  2B2W A;  2OQK A;  5FJ8 H;  1CT1 D;  1PH4 A;  1PFB A;  2D2C C;  3H3V C;  5C4J H;  4G7O C;  4X3T A;  1KDA A;  3J7A V;  1CSQ A;  2ZXO A;  5IGG A;  1Z6H A;  2LXK A;  1F9S A;  1WTV A;  3NQI A;  4HJ9 A;  4BA2 I;  3S9W A;  4C2M B;  1D5Z C;  2B63 G;  2NZ1 D;  4R4O A;  1CZW A;  1NY4 A;  3AB9 A;  3K6O A;  2JA7 G;  1X3P A;  5EKI A;  1TWF B;  4L8J A;  2RVL A;  5I6W A;  1VQA A;  2WKD A;  4FF3 A;  4GLA C;  1A2T A;  1WFQ A;  1G91 A;  2EYF A;  2EY5 A;  1PH7 A;  3OIQ A;  1GHK A;  1CQV A;  4C3I H;  4L63 B;  1Y8P B;  1VQ9 A;  2PNR C;  4HMJ A;  2LFN A;  4FDB A;  1HTP A;  1CKN A;  5C3E B;  5EPL A;  1K8M A;  1CHP D;  1MD2 D;  1U4P A;  4A93 G;  1WCM B;  4DR2 L;  3PO2 B;  3WOE A;  4ZUI A;  4PMC A;  4F7X A;  5LMN Q;  2ATW A;  1FD7 D;  2E2H H;  1EQT A;  1KRT A;  3Q22 A;  4KK7 A;  1EWC A;  3QWN A;  4JI6 L;  1Q1E A;  2QDL A;  4QJF A;  2UUB Q;  1VCI A;  1NSN S;  5COY A;  1FJG Q;  5BR8 Q;  1A0I A;  1H95 A;  2F0H A;  3HZX A;  5LMU L;  1DXM A;  1XNR Q;  3S1R B;  4P73 A;  2F0W A;  3PQI A;  1KQS A;  5J39 A;  3HOY G;  4K5X A;  4BXX G;  4JK1 C;  1I3Q B;  1SYF A;  3I90 A;  1JIC A;  1LLR D;  1YHB A;  4CJ2 C;  3A55 A;  1PZJ D;  5KNB A;  2EPB A;  3S2D B;  4JI5 Q;  4HTH A;  4DR4 L;  4CKB A;  3QR8 A;  1CFM A;  4MNO A;  3IL8 A;  4A3E H;  3KFU A;  2E8G A;  2IWH A;  3CF5 A;  1HNX Q;  3N52 A;  1QWY A;  1IBM L;  3VA7 A;  1YJW A;  4JBM A;  1B4O A;  2LMC B;  2TMP A;  5C4X B;  1F2Y A;  1CI3 M;  2KCM A;  2MGS A;  1XYI A;  3HOZ B;  1X54 A;  1N9W A;  3S24 A;  4KJO A;  1HA6 A;  2NB0 A;  2A68 C;  3RZD H;  4JYA Q;  1STN A;  1B3A A;  3I55 A;  2PQA B;  5FK9 C;  1C8C A;  3CCS A;  5I4D A;  2HD3 A;  4LUO A;  4DAP A;  5A2Q L;  3A8K E;  3NWS A;  3MWY W;  2WAC A;  4YHH L;  1N33 Q;  3PUZ A;  2YU9 B;  5KND A;  2GVB A;  3SE0 A;  1WTW A;  5ELD A;  3UE0 A;  2A6H D;  4DR4 Q;  1EY8 A;  2NZO A;  2F3V A;  4IUQ A;  1KDC A;  3CCV A;  5KRU A;  1SMY C;  1L1O B;  3MEF A;  1SYD A;  4ALP A;  2N78 A;  4HJ5 A;  1TWF H;  4YY3 L;  4OWT B;  1HNX L;  1PTO C;  3HG9 A;  3GTQ H;  1Y1W B;  2XTI A;  3KLW A;  4X66 L;  4FVM A;  1DON A;  3BU2 A;  1VQH A;  1STH A;  3NBH B;  4K5W A;  1K0S A;  2NZH A;  1XNQ L;  2RF4 A;  4WJW A;  1I94 Q;  5CV4 A;  2XVS A;  3H0G H;  4JI7 L;  3P20 A;  1Y69 U;  1D6E C;  4RGN A;  3PGZ A;  1IBK Q;  4X66 Q;  4XXE A;  3GTG H;  4K6D A;  3H0G B;  1H9J A;  2M9V A;  1PRT C;  1R4P B;  1VQ4 A;  3A8J E;  5CV8 A;  4DUY L;  1CA6 A;  1Q3L A;  3RLO A;  2V1C C;  1TVX A;  4J15 A;  1PXU A;  1XJV A;  2QIL A;  2I5M X;  2Y0S B;  3A54 A;  1XMO L;  3D6C A;  3GDE A;  2K01 A;  3BG3 A;  4I65 A;  2D62 A;  1KNE A;  4B9X A;  4E6I A;  1KNA A;  4PZ8 A;  2R6G A;  4JG2 A;  5M5W B;  1I4G A;  4L6T B;  1OXS C;  2N49 A;  3TSS A;  1EYG A;  1QCB D;  1HUN A;  4HMI A;  4YWM A;  3AQQ A;  1SBB B;  3LWU A;  2A6H C;  2B63 B;  4DK1 A;  5IT9 c;  3K58 A;  1XPR A;  1CM9 A;  1WI5 A;  4L5Q A;  1EY0 A;  3MTS A;  1N8R C;  2CW0 D;  2NVX B;  3HOV H;  3DWQ A;  4YWK A;  5IP7 H;  1H9R A;  2K7V A;  2EYP A;  2PMZ E;  2F0D A;  1HHV A;  3FEW X;  1XNR L;  1Z7T A;  1BCP F;  1PMR A;  3W2D A;  3J81 i;  3S1Q B;  3HOV B;  2L15 A;  1KLG D;  4DR6 L;  3CCU A;  2CH4 A;  1STG A;  2ZTC A;  2UXD Q;  1HCZ A;  3S1Q H;  3MXN A;  4KD4 A;  5E4W C;  1KLU D;  1JC7 A;  5LMN L;  5FOB B;  1WOC A;  1NCV A;  2HDL A;  2L5T A;  4RHR A;  1HTL D;  3TEH B;  3PIP A;  1N34 Q;  4RH6 A;  1TWA H;  3ICE A;  3NSW A;  5HUR A;  2SDF A;  2SOB A;  4KTA A;  1IXR A;  1SXT A;  2LS0 1;  4UP7 A;  3LGJ A;  1TWC B;  1OO9 B;  1KAB A;  3QOJ A;  2YTX A;  3OW7 A;  3NEL A;  3U9S A;  4A3F H;  2N88 A;  2G9H D;  1EY7 A;  1XPO A;  1UE7 A;  3PIP 3;  1G2T A;  1EIF A;  4IUU A;  2RKS A;  1E0B A;  1D5M C;  3A74 A;  3RZD B;  3DWA A;  2CKZ B;  1E2W A;  2A69 D;  1V1P A;  2UXD L;  3CQZ H;  3J7A 5;  1QNK A;  1EEF D;  3GTG B;  5C0X J;  4LF4 Q;  3S15 H;  3K0Y A;  3EA6 A;  1PRT F;  2FJ2 A;  4IJL A;  3QJY A;  2KCN A;  3CAM A;  4C3J G;  1PH6 A;  2HQL A;  3BZC A;  3OTO Q;  2XWB B;  3L7Z C;  2Q8T A;  3NEM A;  2Z6K A;  2ID0 A;  4TSS A;  2UUA L;  5JVH 3;  4FF2 A;  2JSO A;  1NJI C;  1SJE D;  4CDC C;  3LNN A;  2JEB I;  5IGC A;  4JI2 Q;  4YY3 Q;  4K0K Q;  3I70 A;  4ZAI A;  2EJG C;  4ID6 A;  5IWA L;  2N3S A;  3EIV A;  1BXT A;  5D65 A;  4OIK A;  1BDO A;  3J80 i;  2B2T A;  1QNU A;  3ONA B;  4X65 Q;  3JAM L;  3TBI B;  3T13 A;  4HED A;  3BDC A;  2JA8 B;  4XIG S;  3MVV A;  5ELE A;  4A75 A;  1JQY D;  4O1N A;  1VMP A;  3MXP A;  2F0K A;  2ICI A;  2L11 A;  1Q46 A;  1I4P A;  3GTO B;  1BBU A;  1YI2 A;  4HN7 A;  2WP8 J;  4ODG A;  3D4W A;  4H13 C;  3KK7 A;  2XN9 C;  4JBW A;  2X6L A;  4EQ5 A;  2JA9 A;  2RDH A;  3I4L A;  1K28 A;  1WTQ A;  3M7N A;  3R93 A;  3BZK A;  5IYD G;  2KJX A;  3G6J B;  4XQN A;  1Z47 A;  5J1Z A;  2OTL A;  3RUZ A;  1S5E D;  2IHE A;  4K0K L;  3T53 B;  2DJG C;  2F03 A;  2RCF A;  4LK1 C;  4A3J B;  3CCM A;  5JJL A;  2K52 A;  1DM0 B;  1E1O A;  1VQC A;  4DR5 L;  1Q90 A;  4R4C A;  2Y0S E;  1EUJ A;  2NVX H;  1VQM A;  2Z6B A;  1LO5 D;  1IYU A;  1FJG L;  4MTK A;  4DU9 A;  4B3T Q;  2JQO A;  1QE6 A;  4GKK L;  4KHP L;  3GD7 A;  2ZXR A;  2IW3 A;  1J5E L;  2MNA A;  1LAC A;  4OX9 Q;  1L0W A;  1JMC A;  1ICF B;  2VQE L;  1JB7 A;  1OTC A;  1A63 A;  4LF6 Q;  5LMN W;  1D7Q A;  1UUP A;  3TP5 A;  1WCM H;  2EXD A;  2Z8L A;  1HH2 P;  3CRK C;  3N6R A;  1II3 A;  3FKI H;  1F2L A;  2Z4H A;  4YHH Q;  2IJ0 A;  1N33 L;  1ILP A;  4J6H A;  1EOT A;  2P5Z X;  2F0M A;  1SE4 A;  1TS3 A;  4LFA Q;  1N32 L;  2MO0 A;  3C2P A;  1S5B D;  4DV5 Q;  3C1F A;  3GTK H;  1ET9 A;  1RL2 A;  4HSP A;  1ZXT A;  2F4V Q;  4DNR B;  5M5Y B;  4H44 C;  2L9H A;  3TRE A;  4DA2 A;  2KHJ A;  3ULJ A;  4LF5 Q;  2R7F A;  4OON A;  1ML0 D;  1YHQ A;  3CMA A;  1VS0 A;  4XDX A;  1A3U A;  3SHL A;  2WB1 E;  1IW7 C;  5EPK A;  5ELO A;  4B3R L;  1BCP D;  1GVP A;  1D5X C;  1XPU A;  3K8A A;  4IOC A;  5K36 G;  3I4O A;  4G57 A;  1JOO A;  3Q23 A;  2PNH A;  4B3S Q;  5I9P A;  1WJJ A;  2RCN A;  5CBA E;  3GTJ H;  2R7D A;  2NN6 I;  1HFG A;  4A3C H;  4ILW A;  3SK5 A;  4L5S A;  4KV6 A;  4DPG A;  4HIK A;  1MJC A;  3RLF A;  3J80 c;  1PYW D;  3F8T A;  1X32 A;  5LL6 S;  1X3E A;  4AYB G;  1B9N A;  2EIF A;  2PYK A;  2ZTD A;  1G51 A;  2F0Q A;  2F52 A;  3NPP A;  3VR2 A;  3RZO B;  2JA6 B;  2Q2I A;  2OXP A;  3ULL A;  5KYI A;  1U9R A;  1K73 C;  1X3Q A;  1SYC A;  1O7Z A;  2J0T D;  2O4X A;  2DNC A;  1W6J A;  5LHY 1;  1SYE A;  3SXH A;  1VQO A;  3S17 B;  4IPC A;  1FGU A;  1NE3 A;  1E3P A;  1QVC A;  4FYD A;  2NTT A;  3P75 A;  3WWV A;  1KRS A;  1T5E A;  4C1N K;  3G4S A;  1JT8 A;  4OWX B;  2IL8 A;  3HOX G;  4LFC L;  1J6Q A;  4JI0 L;  2JA8 G;  4R8N A;  4FXD A;  4EGV A;  3KBX A;  5IP9 G;  4GKJ Q;  3TS0 A;  3J7Z C;  2B2U C;  3M3Y B;  3FKI B;  1I5F A;  3F2B A;  4BBS G;  2J7Z A;  3VR4 A;  5JJI A;  4AIM A;  1KIX A;  1AZQ A;  3KLS X;  1VQ6 A;  1EQQ A;  3UE1 A;  2B63 H;  3GTM H;  1XWE A;  1TWA B;  4ABN A;  2EZV A;  2WIN B;  2KQ3 A;  4HR7 B;  4H02 A;  2JN4 A;  3CKI B;  1VQF A;  5E1F A;  3LX0 A;  1A2U A;  2R92 B;  1CSP A;  1HR0 L;  2NVT B;  1ESF A;  2QDB A;  1IBL L;  1HNW L;  2A6E D;  4CDD C;  2JA7 B;  4LF9 Q;  4J8Q A;  3NK9 A;  3ERO A;  4QGU A;  4L5R C;  1QVF A;  2B2W C;  2AQ3 B;  2KEE A;  2KUM A;  3AMU A;  1X9N A;  2ASB A;  5IYC G;  1G6P A;  1T9H A;  4KD3 A;  3CPF A;  1X55 A;  1U4M A;  4DV1 L;  4H0L C;  3X3N A;  4NDX A;  3D6W A;  1SEB D;  1SNC A;  2JJQ A;  4UDU C;  1KL9 A;  1VQN A;  2QKI C;  4XYQ A;  4LFA L;  2Q2H A;  2F3W A;  2VUM H;  1JE5 A;  3BS1 A;  3S15 B;  1GUN A;  1ESR A;  2E75 C;  1TXY A;  1B2T A;  2B2Y A;  1LTB D;  4ME3 A;  4A3I G;  1NMF A;  3MC0 B;  1VF5 C;  1J9O A;  1SND A;  2I0Q A;  3P1H A;  1WVL A;  1TS4 A;  3DWP A;  1S72 A;  4K14 A;  4IUT A;  3BVG A;  2R7Z G;  4FO2 A;  5C4Z A;  3KLS A;  4A3L G;  2CW0 C;  2UXC L;  3OYY A;  5C4H A;  4JI3 Q;  1QVG A;  2R93 B;  4DR7 L;  3C1E A;  5ISR A;  2FMC A;  4JI8 L;  2K50 A;  1FNU A;  3B6Y A;  5GAE C;  1D2B A;  5C3X A;  4DR7 Q;  1PZI D;  4DNT B;  2OQ0 A;  2VW9 A;  1BO0 A;  1C7Y A;  3RLN A;  5BN4 A;  1KD1 C;  4A3G H;  2JA5 G;  2RBM A;  3TP7 A;  4LFC Q;  4YCV A;  3PF4 A;  3UDX A;  2EYH A;  1UE1 A;  1G29 1;  1B53 A;  2KBN A;  4OL7 A;  2G5D A;  1XX8 A;  2HQE A;  5KEE A;  1K0R A;  1VQG A;  4P75 A;  2B29 A;  3KF8 B;  4A3K B;  2NN6 H;  3CME A;  5TSS A;  3FVQ A;  4DV4 L;  2EJM A;  2K5W A;  1PRT D;  1YNN D;  1O7I A;  4JYA L;  4Q5V A;  1PFM A;  2KA7 A;  3NEN A;  5IOC A;  2B8F A;  3BYT B;  3TZD A;  1L0Y B;  5COR A;  4KKS A;  1VQE A;  1U4L A;  1FNW A;  1V9P A;  5EKK A;  2RDG A;  4IPH A;  4MIU A;  4C2M H;  3J81 E;  2MQH A;  5A35 A;  1PH8 A;  2NVT H;  5AJ3 L;  1HR0 W;  1WTP A;  3ER0 A;  1AH9 A;  3H09 A;  1CKO A;  1L1O A;  2FMM A;  1Y1W G;  2LSS A;  1RJT A;  4GN5 A;  3EQL C;  4RGO S;  2R93 G;  2MP1 A;  4H7B A;  4QL5 A;  2B39 A;  1A6X A;  2JA8 H;  2F3I A;  2BCO A;  3NP8 A;  2EYL A;  2XNA C;  4JI1 Q;  1ENF A;  3W1G A;  2PQA A;  1U4R A;  5C5L A;  3S1M B;  2E76 C;  2VQF L;  2PW5 A;  1BCP B;  1I6H H;  4X62 L;  1C48 A;  1AEX A;  2E74 C;  4ULL A;  2K6A A;  4S3S A;  3PCO B;  2HDM A;  3S2D H;  4QCL A;  1STA A;  1I3Q H;  5D14 A;  3GQB A;  1TS5 A;  2F4V L;  4PV1 C;  1UWV A;  4IUR A;  1C4Q A;  2VQE Q;  4A3F G;  3DXJ C;  4BBS B;  4FXG C;  3HFZ B;  4B3M L;  4V19 0;  4ZUJ A;  1PFS A;  1LUZ A;  5KYL A;  1TR5 A;  1EIG A;  4OGQ C;  3JAM c;  2O2L D;  2NTS A;  1N34 L;  3EN2 A;  4FXK C;  5I6Y A;  1FVI A;  1MSG A;  3PO2 H;  1F9R A;  5EKL A;  4IFD J;  4A3B H;  1QZG A;  1JJG A;  4DR1 Q;  3L2P A;  4B3S L;  3E6Z X;  3VR3 A;  4O0A A;  1EFI D;  1ZYR D;  3PF5 A;  3I4M G;  2YU9 H;  1EWH A;  3MZ5 A;  2OWO A;  4LF5 L;  2X69 A;  3V05 A;  3X3M A;  1LT4 D;  3K5N A;  5IT9 E;  2R93 H;  4YIJ A;  4DR3 L;  3NTI A;  4LF7 Q;  1O78 A;  4BY1 H;  4JI8 Q;  2IHF A;  4RWS C;  1W2B A;  1YJ9 A;  2PZU A;  1GJX A;  1I6V C;  4K2L A;  3DMU A;  4JV5 Q;  4IQZ A;  1L1O C;  1QUQ B;  3KDF B;  3STB D;  4DV2 L;  4A3I B;  4CDF C;  3HOY B;  3G71 A;  2RA4 A;  1OXX K;  5M5X H;  1LTG D;  1WTR A;  2O5I C;  1TWG B;  1LV9 A;  5CMD A;  1WTO A;  4POG A;  3I2Z A;  1B44 D;  3O13 A;  1B7Y B;  4TRD A;  1NR4 A;  3NUC A;  4NMZ A;  1PTO F;  2A5H A;  3FPP A;  2CCZ A;  3S17 H;  4XT3 B;  3HS0 C;  5M3F G;  3RN2 A;  1JOQ A;  4DV4 Q;  1GM5 A;  5EQ0 A;  3SVM A;  4PQX A;  5C44 H;  3G6E A;  2MPM A;  1PYS B;  3J81 L;  2MHV A;  1WD1 A;  4HJ8 A;  1FGB D;  2AHO B;  3MAQ A;  1I4X A;  2Z0S A;  4J1M A;  2CWA A;  2DJF C;  5IGE A;  3E5S A;  4QUF A;  5C4J B;  2L55 A;  4DV0 L;  4MTN A;  3IFT A;  1HA5 A;  1JCK B;  2CVR A;  2LY7 A;  1F2M A;  4GNX A;  3M3Y H;  1RCV D;  3BDO A;  1CTM A;  1TU2 B;  4OEL B;  3Q0A A;  3V2T A;  1EQV A;  3VA5 A;  2E2J B;  2IX0 A;  1PH2 A;  4LAA A;  3C46 A;  1HZC A;  2A1A A;  4LUZ A;  5FLM G;  4EQN A;  2BH2 A;  1R4Q B;  2AQ1 B;  4CJ1 B;  4U67 3;  1ENC A;  1DD2 A;  5EBD A;  4AQY L;  3QO2 A;  1ZYR C;  4QIW E;  4AYB E;  4OHJ A;  4A3M B;  4R9W A;  3S1N H;  2KHS A;  5D3I B;  1PH1 A;  2VUM G;  4KY5 A;  2QCP X;  3STB C;  4GZY C;  1P8L A;  4PZ7 A;  1VMC A;  3ND8 A;  1EZ8 A;  2I07 B;  4QF4 A;  4CGY B;  3OTO L;  1B8A A;  3CRL C;  1EYA A;  4UP8 A;  3I4N H;  2JA6 G;  4A3D H;  2M00 A;  1CK1 A;  1B70 B;  2E5L L;  4APV A;  4F87 A;  1VQB A;  4X64 Q;  3J81 c;  1RHP A;  2ENB A;  4DR2 Q;  1NUC A;  3L0O A;  2AQ2 B;  4LUV A;  1H9K A;  1DGS A;  3I72 A;  1AFP A;  4DR3 Q;  3CC7 A;  4LF7 L;  4NB3 A;  4I7Z C;  3F2D A;  4DAY B;  1QUQ A;  3KDF A;  1DYQ A;  3PUX A;  4EX5 A;  1E2V A;  4A3G G;  2I5L X;  1ENA A;  1TWC H;  2B2V A;  3TRZ A;  3F1Z A;  1VQD A;  2PZT A;  5C6A A;  5BN5 A;  1HNW Q;  4QB4 A;  1PDQ A;  3J80 L;  2A19 A;  1EYC A;  1J8I A;  4R8I A;  5IYB H;  3GTM B;  3DM3 A;  5JPN C;  1STB A;  2EY1 A;  3HOU B;  3R8B A;  1SMY D;  3TP8 A;  1YNX A;  2DGY A;  2ZJP A;  5LL6 X;  2EYJ A;  1Q12 A;  5BR8 L;  3PIO 3;  3TP6 A;  2UXB L;  2SEB D;  2K5Q A;  2UUC L;  3LWE A;  4A3B G;  1LT5 D;  1S5F D;  2WAQ G;  3AU7 A;  1X6O A;  5IYC H;  5JPM C;  3GV3 A;  5IGF A;  4JW0 A;  2GA4 B;  4DK0 A;  3RNU A;  5K36 H;  2Q2U A;  5E4X A;  5KGU A;  1I4H A;  2QGQ A;  3K59 A;  3C3L A;  2YTV A;  4DUZ Q;  1EY5 A;  1L0X B;  5JEA J;  4DNI A;  1R9T B;  1PHJ A;  1IL2 A;  4MZ9 A;  4NXN Q;  4IPG A;  2F0S A;  1SNP A;  2EY6 A;  4K8I A;  1JJ2 A;  1WTX A;  4C3H H;  4X62 Q;  4KI0 A;  4NXN L;  1QB5 D;  2MFI A;  1SFO H;  4NW2 A;  1CUK A;  1FR3 A;  5C3W A;  1A3T A;  2D5D A;  4A3L H;  1TKW B;  3EFX D;  4A93 H;  1N32 Q;  2HUG A;  2RHQ B;  3MXU A;  1NR2 A;  1CKM A;  4UPA A;  4UP9 A;  2F0N A;  3GTL B;  3M4Q A;  1XMO Q;  2DNE A;  1EU3 A;  4JI4 Q;  5NUC A;  2QA4 A;  2IY5 B;  1LYL A;  5FO7 B;  5HGT A;  3CC2 A;  1ZKO A;  2JK8 A;  4IPD A;  2ZJR A;  3PUV A;  2JA5 H;  2GN5 A;  4WOR A;  4RKB A;  1BBW A;  3KOJ A;  4KHP Q;  3I4N B;  3NTH A;  4XQJ A;  2VS1 A;  1TII D;  1W6K A;  5JEA H;  4DV7 Q;  1PFN A;  4DV0 Q;  1F9Q A;  4DAY A;  3BVM A;  4K2K A;  2DY8 A;  2FXQ A;  1JOK A;  2IX3 A;  1K83 H;  5C0X G;  2PW7 A;  4HIO A;  2V4D A;  1JJC B;  3DEO A;  2ZXP A;  3OWE B;  5GAD C;  4A3M H;  1H9M A;  1U5K A;  1Y1V G;  4LW1 A;  4NP5 A;  4P72 A;  1QJO A;  2B2U A;  4X3S A;  2ZM6 L;  3S1N B;  1S3O A;  3D3R A;  5G3L F;  1HNZ Q;  1IZ6 A;  1Y1V H;  4N9T A;  2LXJ A;  2XWJ B;  2E2J H;  3AYH B;  5IYD H;  3FDT A;  3AEV A;  2PMZ B;  1E2Z A;  3HGB A;  4XYO A;  2F0F A;  3HKS A;  5J3B A;  1I4Q A;  4OX9 L;  5GRO A;  2KCC A;  3NBH A;  4LF9 L;  1IBM Q;  4Z9C B;  3EBE A;  1BVS A;  4ZCK A;  4ZKB B;  1HR0 Q;  4QUC A;  4CDE C;  4F88 A;  1KXL A;  3VR5 A;  1PRT B;  2RDF A;  4IUP A;  4QY7 A;  2XSC A;  3G48 A;  3I8Z A;  3S2H H;  1EL0 A;  1E1T A;  1U0L A;  4DUY Q;  1VQJ A;  4BBR G;  2XGT A;  4GOP B;  4DAV A;  3SK6 A;  3MEH A;  1IBL Q;  4WFN 3;  2K05 A;  3PUY A;  1VDZ A;  3EVQ A;  3EJI A;  3SR1 A;  1JWM D;  1OXT A;  1IBK L;  2B8G A;  2UUA Q;  4AQY Q;  2A74 C;  3Q24 A;  4OO1 I;  3E0J A;  5EJW A;  3I91 A;  4JI5 L;  4DV6 L;  4BBS H;  4HJ7 A;  4GOP C;  3PMF A;  2HCC A;  1X3G A;  1SLJ A;  3FKI G;  2AKW B;  3GTK B;  1A8V A;  2F0I A;  3IKJ A;  1PA6 A;  4EQP A;  1W3S A;  3KUP A;  3A5U A;  1V1O A;  5JJK A;  1RTO A;  1YNJ D;  1DJR D;  2EDG A;  4KHV A;  3M4O H;  5CV5 A;  3NTK A;  1ICW A;  1XTD A;  3DM1 A;  5C44 G;  4JI0 Q;  1SR3 A;  1YEZ A;  2IT1 A;  5M3M H;  3VYR A;  3W3A A;  2EVB A;  3TS2 A;  3JAM E;  3RN5 A;  3OOC A;  5M5Y H;  3I56 A;  4OO1 G;  1B9M A;  2BE5 D;  2OF1 A;  1LTS D;  1SRU A;  1LTL A;  4P2C B;  2Z4I A;  5CYU A;  1KDB A;  5IT9 L;  3CQZ B;  5DM7 3;  3FP9 A;  1PTO H;  2HHH Q;  1XMQ Q;  3K5L A;  3HOU G;  3CXC A;  3HOZ G;  2QEJ C;  1D1I A;  1PLF A;  4POF A;  4HSV A;  3NHH A;  2H1E A;  1VQI A;  2AWO A;  4A3B B;  1DCZ A;  1Q81 C;  1PH9 A;  1JWU D;  2R3Z A;  3MA2 B;  3UDG A;  1BF4 A;  2K33 A;  1EU4 A;  3W5O A;  4DV7 L;  1YVC A;  2M2L A;  1GUO A;  5DEH A;  3WDN A;  4MN3 A;  2L1B A;  4ZQ3 A;  1CZG A;  4GN4 B;  5IE8 A;  4DR6 Q;  4JV5 L;  3PO3 B;  2K03 A;  1Z9F A;  3D0F A;  2JXM B;  4HAE A;  2RQX A;  1C9O A;  3HP3 A;  4IUN A;  3S16 H;  1S4Z A;  2R7Z B;  3M4Y A;  2DUD A;  4DKA C;  3PO3 H;  5FLX c;  3TME A;  3UI2 A;  3L9A X;  1BBX C;  2ALY B;  3I4M H;  3URY A;  2WB1 G;  2PQE A;  4A3D G;  2JP1 A;  4B9W A;  3KJO A;  5T1G A;  4R4Q A;  2H4O A;  5CV9 A;  5C3E G;  1VQP A;  4AH6 A;  3SDZ A;  4O2D A;  4OXP A;  4F8M A;  1Y1W H;  5FLX E;  1UE5 A;  2N8N A;  1WCM G;  3ULP A;  1Y8O B;  1A15 A;  5CGK A;  5EPJ A;  3TDQ A;  3CPW A;  1A62 A;  3ZYY X;  2JA5 B;  4HCS A;  3NWT A;  2HIV A;  1K8O A;  3H3V H;  3E3X A;  5I2Y A;  1F77 A;  1KTK A;  2EOT A;  4JI6 Q;  4NXM Q;  2ZJQ A;  1I4R A;  3J81 j;  1CQF A;  2NN6 G;  2CWP A;  4FP5 D;  1Q86 C;  4ZK9 B;  2AUJ D;  1KC8 C;  2A68 D;  3D8G A;  1B3Q A;  3BYY B;  2WAQ B;  3MXN B;  1YJN A;  2EJF C;  1EYD A;  4BS9 A;  3BDL A;  1MSH A;  3U4Z A;  4LWC A;  4TQU S;  4ZYS A;  4GOP A;  2UU9 L;  1XMQ L;  4O42 A;  2OEO A;  2XIW A;  2PZW A;  1AZP A;  2WAQ E;  3QOL A;  5IGD A;  2BH8 A;  3DLL A;  3OW2 A;  1WD0 A;  4Y7N H;  5A2Q E;  2R92 G;  1SYG A;  1STE A;  3R3O A;  4XTC S;  2N55 A;  1AW7 A;  1G2S A;  4A3E B;  2K5V A;  5C4X G;  4YWL A;  1LTI D;  4GN3 B;  3M85 A;  1K8G A;  1HPC A;  1HFN A;  1WTH A;  4JBJ A;  1P16 A;  1ZEQ X;  4OIJ A;  3I73 A;  3KJP A;  1EY6 A;  1H9S B;  2I46 A;  2B2V C;  1EY9 A;  2B3G A;  2F0L A;  4RHS A;  5CV7 A;  3S1R H;  2KEC A;  1I94 L;  1AP0 A;  4IFD G;  2B2T C;  1MKH A;  3AFQ A;  4B3R Q;  3OIP A;  4IFD H;  4TVA B;  4JI3 L;  2F0O A; 
#chains in the Genus database with same CATH homology
 1RKN A;  1SE2 A;  1PZK D;  2E2H B;  2Q8I B;  5FLX L;  2NYZ D;  2R61 A;  2F1M A;  3TZU A;  1JR0 D;  1S5C D;  1GUW A;  2ICE C;  1O80 A;  5C0X H;  4KMU C;  5M3M B;  2A6E C;  4RGM A;  4RAU C;  2Z1C A;  1HQR D;  5E3F A;  3M4O B;  3RMH A;  2WKC A;  1BNZ A;  3QB3 A;  1IKL A;  2HCI A;  3BVZ A;  3GV6 A;  1LTT D;  3SEB A;  4DXF A;  1RTN A;  1SAP A;  1TQO A;  2SNM A;  3GTQ B;  3KF8 A;  5K5P A;  2VB2 X;  1RF2 D;  2F0U A;  3QG1 A;  1LTA D;  2C5C A;  4QIW B;  4AYB B;  1F2Z A;  5JAV A;  2NUC A;  5IIF A;  4XT1 B;  1OXV A;  3A7A B;  3Q6S A;  3HRZ C;  2F0V A;  3CHB D;  1SYB A;  1DOM A;  2FFK B;  1IW7 D;  3K5O A;  1EIH A;  2L12 A;  2Q8R E;  3MFY A;  5C44 B;  1G6Z A;  2NBF A;  3KLR A;  2NVY B;  2K5D A;  2VXW A;  2FIN B;  2F0E A;  1CHQ D;  1SNO A;  4G7Z C;  4HCE A;  1MGS A;  3OMC A;  2G9D A;  1UNS A;  4V0B A;  4RFB A;  3QIA A;  4RGT A;  3S14 B;  2VB3 X;  1SE3 A;  4X3K A;  2VNU D;  1F9P A;  2C9O A;  3K5M A;  2JE6 I;  4DN4 M;  4K5V A;  5FO9 B;  1IHZ A;  4RKL A;  3T16 A;  1YNJ C;  5CC4 A;  3L3O C;  1QIL A;  3VR6 A;  3HKZ B;  1RDP D;  1BCP C;  3DHQ A;  1GXD C;  3NBI A;  1QG7 A;  4DGZ A;  4PMW A;  4A3D B;  3J80 E;  4PMB A;  4C3H B;  5IGB A;  1ROD A;  1SFO B;  3VYT A;  4KN4 C;  5D3D A;  4IZ8 A;  2K28 A;  3SK4 A;  3PUW A;  4Q0F A;  4FF1 A;  1O7L A;  2F0J A;  1XTC D;  2DY7 A;  5FO8 B;  5M9O A;  1KAA A;  4ZLT F;  4FNF A;  4BY1 B;  5AFW A;  5JOB A;  2AWN A;  1VF7 A;  3FMC A;  2NWG A;  2X6G A;  3F2U A;  4CBV A;  1CA5 A;  3DUZ A;  3WOF A;  2WV6 D;  5BN3 A;  2BDO A;  1FNV A;  2KED A;  2DN8 A;  1V8Q A;  2KOL A;  3GTJ B;  3NQT A;  2F0G A;  4DF7 A;  2A73 B;  1LT3 D;  2WII B;  3NE5 B;  1LT6 D;  1HXY D;  2FHT A;  5FKA C;  1K83 B;  3HOW B;  4BY7 B;  3KBG A;  3OWF A;  1BOS A;  1GOZ A;  3I4M B;  1SSO A;  4C1N I;  4RCO A;  1Y8N B;  5DM6 3;  4IN3 A;  4CKC A;  3GO5 A;  3OSO A;  1MBY A;  4EVO A;  4C3I G;  2F0T A;  4Y7N B;  3FRP B;  5G3L D;  2XRS D;  1A3V A;  3CU7 A;  4IUV A;  3S2H B;  2EY2 A;  2MJ8 A;  4KN7 C;  2F4I A;  4RA8 A;  5F2D A;  3D31 A;  3M7G A;  2BE5 C;  2WB1 B;  3ITP A;  3NXW A;  3BZD B;  2TSS A;  1TY0 A;  2L4N A;  1M4V A;  2OT2 A;  5CBE E;  3GTP B;  2RSN A;  2NVQ B;  2SNS A;  3SK8 A;  4OO1 H;  1DZ1 A;  3H6M A;  2K32 A;  3D4R A;  5ELC A;  5JEA G;  1EY4 A;  5CV6 A;  4CKE A;  3V96 A;  1IYV A;  1Y1V B;  1DOK A;  2EYM A;  4KKT A;  4LMQ D;  2EE1 A;  2K1B A;  5DNF A;  3MHB A;  1O7Y A;  3PV0 A;  1SDF A;  4K6L A;  2VUM B;  4ZRZ A;  1I50 B;  1ONL A;  2L0C A;  3OHX C;  2EXZ A;  4DXG A;  4C3J B;  2BA1 A;  3A7L A;  4DFA A;  3K57 A;  5DAU A;  1JE4 A;  3T4A C;  2ZT9 C;  3DEP A;  3P7J A;  4N9P A;  4G4K A;  3T56 B;  1SJH D;  3ND9 A;  5EBC A;  4C3H G;  3RD4 A;  1EEI D;  4A93 B;  4A3G B;  4EQO A;  4X3U A;  1T5X D;  5JVG 3;  4XQQ A;  5M5X B;  4M8A A;  2QF7 A;  3J7Y W;  3IAY A;  2A69 C;  2BA0 A;  2E2D C;  4BA1 I;  1HUM A;  4MHE A;  5I9O A;  1EZ6 A;  1HRJ A;  1M8A A;  3HOX B;  2KVM A;  4IAL A;  4LJZ C;  1H9S A;  1GUG A;  1GUS A;  3A8I E;  2IX1 A;  2E2I B;  1JOR A;  1Q1B A;  1Q8I A;  5JJZ A;  1TWH B;  1GHJ A;  5CR3 A;  2MUY A;  4ZKC B;  4KKU A;  1IKM A;  1YNN C;  3H91 A;  1LAB A;  2CHB D;  3ERQ A;  1BQQ T;  3VYU A;  1TS2 A;  5ELB A;  5KIX A;  2BOS A;  1G8Z D;  1RD9 D;  1ET6 A;  1B1Z A;  2B2Y C;  4KJN A;  3H94 A;  1SNQ A;  5IOD A;  4B08 A;  4NKL A;  2RSO A;  5C0X I;  3T51 B;  3I3C A;  3MXG A;  3OMG A;  4CHT B;  4KY6 A;  4UAI A;  4C3I B;  4CJ0 B;  4ME5 A;  3HEJ A;  2XRQ D;  5C5M A;  1I6H B;  4KY7 A;  4BBR B;  3TN2 A;  4C56 C;  1PTO D;  2PCF B;  1NAP A;  2J4X A;  4IFD I;  1SNM A;  2D9U A;  4FF4 A;  4K8J A;  2F0P A;  4KHZ A;  2YYZ A;  1JB3 A;  1S5D D;  1IL8 A;  2PO4 A;  1B50 A;  5KNC A;  1HQM C;  4A3F B;  2LKV A;  3J7A F;  4QMG A;  3D4D A;  4M1U B;  3MFG A;  1PTO B;  5ELF A;  1QOH A;  4TKO B;  4BWG B;  1TY2 A;  5I2X A;  1GUT A;  1UEA B;  2O5J C;  5T1I A;  1TT2 A;  2IPK D;  4WRD A;  2CQA A;  2K04 A;  3K7A B;  1DOL A;  3VYS A;  3IFD A;  1ILQ A;  1V43 A;  1FYC A;  2JYO A;  3S16 B;  1V1P B;  1D1K A;  1LTR D;  2PPB C;  3FPU B;  1MI2 A;  4RCN A;  5J22 A;  1AN8 A;  1UAP A;  4G7H C;  3OPO A;  1STY A;  2JEA I;  5EGT A;  3GP7 A;  5M3F B;  1OXU A;  3A56 A;  3U9O A;  3R2T A;  3R2I A;  1BR9 A;  1BUV T;  1XXG A;  4U68 A;  1JWS D;  2EYO A;  3G7L A;  2AUK A;  2BDN A;  4PNY A;  2B2W A;  1CT1 D;  1PFB A;  2D2C C;  3H3V C;  4G7O C;  4X3T A;  1KDA A;  3J7A V;  2ZXO A;  5IGG A;  1Z6H A;  1F9S A;  1WTV A;  3NQI A;  4BA2 I;  3S9W A;  4C2M B;  1D5Z C;  2NZ1 D;  1CZW A;  3AB9 A;  3K6O A;  1X3P A;  5EKI A;  1TWF B;  4L8J A;  2RVL A;  5I6W A;  2WKD A;  4FF3 A;  1A2T A;  1G91 A;  2EYF A;  2EY5 A;  3OIQ A;  1GHK A;  1CQV A;  4L63 B;  1Y8P B;  2PNR C;  4HMJ A;  2LFN A;  1HTP A;  5C3E B;  5EPL A;  1K8M A;  1CHP D;  1MD2 D;  1U4P A;  1WCM B;  3PO2 B;  3WOE A;  4ZUI A;  4PMC A;  4F7X A;  1FD7 D;  1EQT A;  3Q22 A;  4KK7 A;  1EWC A;  3QWN A;  1Q1E A;  1VCI A;  1NSN S;  5COY A;  2F0H A;  3HZX A;  1DXM A;  3S1R B;  2F0W A;  5J39 A;  4K5X A;  4JK1 C;  1I3Q B;  1SYF A;  3I90 A;  1JIC A;  1LLR D;  4CJ2 C;  3A55 A;  1PZJ D;  5KNB A;  2EPB A;  3S2D B;  4HTH A;  4CKB A;  1CFM A;  3IL8 A;  2IWH A;  3N52 A;  1QWY A;  3VA7 A;  1B4O A;  2LMC B;  2TMP A;  5C4X B;  1F2Y A;  1CI3 M;  2MGS A;  1XYI A;  3HOZ B;  4KJO A;  1HA6 A;  2NB0 A;  2A68 C;  1STN A;  1B3A A;  5FK9 C;  1C8C A;  5I4D A;  4DAP A;  5A2Q L;  3A8K E;  3NWS A;  3MWY W;  2WAC A;  3PUZ A;  2YU9 B;  5KND A;  3SE0 A;  1WTW A;  5ELD A;  2A6H D;  1EY8 A;  2F3V A;  4IUQ A;  1KDC A;  5KRU A;  1SMY C;  1SYD A;  1PTO C;  3HG9 A;  1Y1W B;  4FVM A;  1DON A;  1STH A;  4K5W A;  4WJW A;  5CV4 A;  2XVS A;  3P20 A;  1Y69 U;  1D6E C;  4RGN A;  4XXE A;  4K6D A;  3H0G B;  1H9J A;  2M9V A;  1PRT C;  1R4P B;  3A8J E;  5CV8 A;  1CA6 A;  1Q3L A;  1TVX A;  1PXU A;  2QIL A;  2Y0S B;  3A54 A;  3D6C A;  2K01 A;  3BG3 A;  4I65 A;  2D62 A;  1KNE A;  4B9X A;  4E6I A;  1KNA A;  2R6G A;  5M5W B;  1I4G A;  4L6T B;  1OXS C;  3TSS A;  1QCB D;  1HUN A;  4HMI A;  3LWU A;  1SBB B;  2A6H C;  2B63 B;  4DK1 A;  3K58 A;  1CM9 A;  1EY0 A;  3MTS A;  2CW0 D;  2NVX B;  3DWQ A;  1H9R A;  2K7V A;  2EYP A;  2F0D A;  1HHV A;  3FEW X;  1Z7T A;  1BCP F;  1PMR A;  3W2D A;  3S1Q B;  3HOV B;  1KLG D;  1STG A;  1HCZ A;  3MXN A;  4KD4 A;  5E4W C;  1KLU D;  1JC7 A;  5FOB B;  1NCV A;  2HDL A;  2L5T A;  4RHR A;  1HTL D;  4RH6 A;  3NSW A;  5HUR A;  2SDF A;  2SOB A;  4KTA A;  1SXT A;  2LS0 1;  1TWC B;  1OO9 B;  1KAB A;  3QOJ A;  3OW7 A;  3U9S A;  2N88 A;  2G9H D;  1EY7 A;  3PIP 3;  1G2T A;  4IUU A;  2RKS A;  1E0B A;  1D5M C;  3RZD B;  3DWA A;  1E2W A;  2A69 D;  1V1P A;  1QNK A;  1EEF D;  3GTG B;  5C0X J;  3K0Y A;  3EA6 A;  1PRT F;  2FJ2 A;  3QJY A;  2KCN A;  4C3J G;  2XWB B;  3L7Z C;  2Q8T A;  2ID0 A;  4TSS A;  5JVH 3;  4FF2 A;  2JSO A;  1SJE D;  3LNN A;  2JEB I;  5IGC A;  3I70 A;  4ZAI A;  2EJG C;  4ID6 A;  1BXT A;  5D65 A;  4OIK A;  1BDO A;  2B2T A;  1QNU A;  3ONA B;  3JAM L;  3TBI B;  3T13 A;  4HED A;  3BDC A;  2JA8 B;  4XIG S;  3MVV A;  5ELE A;  1JQY D;  4O1N A;  1VMP A;  3MXP A;  2F0K A;  2ICI A;  2L11 A;  1I4P A;  3GTO B;  4HN7 A;  2WP8 J;  4ODG A;  3D4W A;  4H13 C;  3KK7 A;  2XN9 C;  4JBW A;  2X6L A;  2RDH A;  3I4L A;  1WTQ A;  3M7N A;  3R93 A;  2KJX A;  3G6J B;  4XQN A;  1Z47 A;  5J1Z A;  3RUZ A;  1S5E D;  3T53 B;  2F03 A;  4LK1 C;  4A3J B;  1DM0 B;  1Q90 A;  1LO5 D;  1IYU A;  4DU9 A;  1QE6 A;  3GD7 A;  2ZXR A;  2IW3 A;  1LAC A;  1UUP A;  3TP5 A;  2Z8L A;  3CRK C;  3N6R A;  1II3 A;  1F2L A;  2Z4H A;  1ILP A;  2IJ0 A;  4J6H A;  1EOT A;  2F0M A;  1SE4 A;  1TS3 A;  3C2P A;  1S5B D;  3C1F A;  1ET9 A;  4HSP A;  1ZXT A;  4DNR B;  5M5Y B;  4H44 C;  2L9H A;  4DA2 A;  1ML0 D;  4XDX A;  1A3U A;  3SHL A;  1IW7 C;  5EPK A;  1BCP D;  1D5X C;  5K36 G;  4G57 A;  1JOO A;  3Q23 A;  5I9P A;  5CBA E;  2NN6 I;  1HFG A;  4ILW A;  3SK5 A;  4KV6 A;  3RLF A;  1PYW D;  1X32 A;  5LL6 S;  1B9N A;  2PYK A;  2F0Q A;  3VR2 A;  3NPP A;  3RZO B;  2JA6 B;  2OXP A;  5KYI A;  1U9R A;  1X3Q A;  1SYC A;  1O7Z A;  2J0T D;  2O4X A;  2DNC A;  1W6J A;  5LHY 1;  1SYE A;  3SXH A;  3S17 B;  4FYD A;  2NTT A;  3P75 A;  1T5E A;  4C1N K;  2IL8 A;  4R8N A;  4FXD A;  4EGV A;  3KBX A;  2B2U C;  3M3Y B;  3FKI B;  2J7Z A;  3VR4 A;  1AZQ A;  3KLS X;  1XWE A;  1TWA B;  4ABN A;  2EZV A;  2WIN B;  2KQ3 A;  4HR7 B;  3CKI B;  5E1F A;  3LX0 A;  1A2U A;  2R92 B;  2NVT B;  1ESF A;  2QDB A;  2JA7 B;  2A6E D;  4J8Q A;  3NK9 A;  3ERO A;  2B2W C;  2AQ3 B;  2KEE A;  3AMU A;  2KUM A;  4KD3 A;  1U4M A;  4H0L C;  3X3N A;  4NDX A;  3D6W A;  1SEB D;  1SNC A;  4UDU C;  2QKI C;  4XYQ A;  2F3W A;  3BS1 A;  3S15 B;  1GUN A;  1ESR A;  2E75 C;  1B2T A;  2B2Y A;  1LTB D;  3MC0 B;  1VF5 C;  1J9O A;  1SND A;  3P1H A;  1WVL A;  1TS4 A;  3DWP A;  4K14 A;  4IUT A;  3BVG A;  4FO2 A;  5C4Z A;  3KLS A;  2CW0 C;  5C4H A;  2R93 B;  3C1E A;  5ISR A;  2FMC A;  1FNU A;  1D2B A;  5C3X A;  1PZI D;  4DNT B;  1BO0 A;  5BN4 A;  2RBM A;  3TP7 A;  2EYH A;  1G29 1;  1B53 A;  4OL7 A;  1XX8 A;  2HQE A;  5KEE A;  4A3K B;  2NN6 H;  5TSS A;  3FVQ A;  2EJM A;  2K5W A;  1PRT D;  1YNN D;  4Q5V A;  1PFM A;  2KA7 A;  5IOC A;  2B8F A;  3BYT B;  3TZD A;  1L0Y B;  5COR A;  4KKS A;  1U4L A;  1FNW A;  5EKK A;  2RDG A;  4MIU A;  3J81 E;  5A35 A;  1WTP A;  3H09 A;  2FMM A;  1RJT A;  3EQL C;  4RGO S;  2MP1 A;  4H7B A;  2B39 A;  1A6X A;  2BCO A;  3NP8 A;  2EYL A;  2XNA C;  1ENF A;  1U4R A;  5C5L A;  3S1M B;  2E76 C;  2PW5 A;  1BCP B;  1C48 A;  1AEX A;  2E74 C;  4ULL A;  2K6A A;  4S3S A;  2HDM A;  4QCL A;  1STA A;  5D14 A;  3GQB A;  1TS5 A;  4PV1 C;  4IUR A;  1C4Q A;  3DXJ C;  4BBS B;  4FXG C;  4V19 0;  4ZUJ A;  5KYL A;  1TR5 A;  1EIG A;  4OGQ C;  2O2L D;  2NTS A;  4FXK C;  5I6Y A;  1MSG A;  1F9R A;  5EKL A;  4IFD J;  3E6Z X;  3VR3 A;  1EFI D;  1ZYR D;  1EWH A;  3MZ5 A;  2X69 A;  3V05 A;  3X3M A;  1LT4 D;  3K5N A;  5IT9 E;  4YIJ A;  3NTI A;  1O78 A;  4RWS C;  2PZU A;  1GJX A;  1I6V C;  4K2L A;  3DMU A;  4IQZ A;  4A3I B;  3HOY B;  2RA4 A;  1OXX K;  1LTG D;  1WTR A;  2O5I C;  1TWG B;  1LV9 A;  5CMD A;  1WTO A;  1B44 D;  3O13 A;  4TRD A;  1NR4 A;  3NUC A;  4NMZ A;  1PTO F;  2A5H A;  3FPP A;  4XT3 B;  3HS0 C;  1JOQ A;  5EQ0 A;  3SVM A;  4PQX A;  2MPM A;  3J81 L;  2MHV A;  1WD1 A;  1FGB D;  3MAQ A;  1I4X A;  4J1M A;  5IGE A;  3E5S A;  4QUF A;  5C4J B;  2L55 A;  3IFT A;  1HA5 A;  1JCK B;  2CVR A;  2LY7 A;  1F2M A;  1RCV D;  3BDO A;  1CTM A;  1TU2 B;  3Q0A A;  3V2T A;  1EQV A;  3VA5 A;  2E2J B;  2IX0 A;  4LAA A;  3C46 A;  4EQN A;  1R4Q B;  2AQ1 B;  4CJ1 B;  4U67 3;  1ENC A;  1DD2 A;  5EBD A;  3QO2 A;  1ZYR C;  4OHJ A;  4A3M B;  4R9W A;  2KHS A;  5D3I B;  4KY5 A;  2QCP X;  4GZY C;  1VMC A;  3ND8 A;  1EZ8 A;  2I07 B;  4QF4 A;  4CGY B;  3CRL C;  1EYA A;  2M00 A;  1CK1 A;  4F87 A;  1RHP A;  2ENB A;  1NUC A;  2AQ2 B;  1H9K A;  3I72 A;  1AFP A;  4I7Z C;  1DYQ A;  3PUX A;  1E2V A;  1ENA A;  2B2V A;  5C6A A;  2PZT A;  5BN5 A;  4QB4 A;  1PDQ A;  3J80 L;  1EYC A;  1J8I A;  4R8I A;  3GTM B;  5JPN C;  1STB A;  2EY1 A;  3HOU B;  3R8B A;  1SMY D;  3TP8 A;  5LL6 X;  2EYJ A;  1Q12 A;  3PIO 3;  3TP6 A;  2SEB D;  2K5Q A;  3LWE A;  1LT5 D;  1S5F D;  3AU7 A;  5JPM C;  3GV3 A;  5IGF A;  2GA4 B;  4DK0 A;  5K36 H;  5E4X A;  5KGU A;  1I4H A;  3K59 A;  3C3L A;  1EY5 A;  1L0X B;  5JEA J;  1R9T B;  2F0S A;  1SNP A;  2EY6 A;  4K8I A;  1WTX A;  4KI0 A;  1QB5 D;  4NW2 A;  1FR3 A;  5C3W A;  1A3T A;  2D5D A;  1TKW B;  3EFX D;  2HUG A;  3MXU A;  1NR2 A;  2F0N A;  3GTL B;  2DNE A;  1EU3 A;  5NUC A;  5FO7 B;  5HGT A;  1ZKO A;  3PUV A;  4WOR A;  4RKB A;  3I4N B;  3NTH A;  4XQJ A;  1TII D;  1W6K A;  5JEA H;  1PFN A;  1F9Q A;  4DAY A;  3BVM A;  4K2K A;  2DY8 A;  1JOK A;  2IX3 A;  5C0X G;  2PW7 A;  2V4D A;  3DEO A;  2ZXP A;  3OWE B;  1H9M A;  4X3S A;  4NP5 A;  1QJO A;  2B2U A;  3S1N B;  3D3R A;  5G3L F;  4N9T A;  2XWJ B;  3FDT A;  2PMZ B;  1E2Z A;  3HGB A;  4XYO A;  2F0F A;  1I4Q A;  2KCC A;  3NBH A;  4Z9C B;  4ZKB B;  4QUC A;  4F88 A;  3VR5 A;  1PRT B;  2RDF A;  4IUP A;  2XSC A;  3I8Z A;  1EL0 A;  4DAV A;  3SK6 A;  3MEH A;  4WFN 3;  2K05 A;  3PUY A;  1VDZ A;  3EVQ A;  3EJI A;  3SR1 A;  1JWM D;  1OXT A;  2B8G A;  2A74 C;  3Q24 A;  4OO1 I;  3E0J A;  5EJW A;  3I91 A;  3PMF A;  2HCC A;  3GTK B;  2F0I A;  3IKJ A;  4EQP A;  3KUP A;  1V1O A;  1RTO A;  1YNJ D;  1DJR D;  2EDG A;  4KHV A;  5CV5 A;  3NTK A;  1ICW A;  3DM1 A;  2IT1 A;  3VYR A;  3W3A A;  2EVB A;  3JAM E;  3OOC A;  4OO1 G;  1B9M A;  2BE5 D;  2OF1 A;  1LTS D;  4P2C B;  2Z4I A;  5CYU A;  1KDB A;  5IT9 L;  5DM7 3;  3CQZ B;  1PTO H;  3K5L A;  2QEJ C;  1D1I A;  1PLF A;  4HSV A;  3NHH A;  2H1E A;  2AWO A;  4A3B B;  1DCZ A;  1JWU D;  2R3Z A;  3MA2 B;  1BF4 A;  2K33 A;  1EU4 A;  2M2L A;  1GUO A;  5DEH A;  3WDN A;  4MN3 A;  2L1B A;  4ZQ3 A;  1CZG A;  3PO3 B;  2K03 A;  2JXM B;  4HAE A;  2RQX A;  3HP3 A;  4IUN A;  1S4Z A;  2R7Z B;  3M4Y A;  3TME A;  3UI2 A;  3L9A X;  1BBX C;  3URY A;  2PQE A;  2JP1 A;  4B9W A;  5T1G A;  2H4O A;  5CV9 A;  3SDZ A;  4F8M A;  5FLX E;  1Y8O B;  1A15 A;  5CGK A;  5EPJ A;  3TDQ A;  3ZYY X;  2JA5 B;  4HCS A;  3NWT A;  1K8O A;  5I2Y A;  1F77 A;  1KTK A;  2EOT A;  1I4R A;  1CQF A;  2NN6 G;  4FP5 D;  4ZK9 B;  2AUJ D;  2A68 D;  3D8G A;  3BYY B;  2WAQ B;  2EJF C;  1EYD A;  4BS9 A;  3BDL A;  1MSH A;  4TQU S;  4ZYS A;  4O42 A;  2OEO A;  2XIW A;  2PZW A;  1AZP A;  3QOL A;  5IGD A;  1WD0 A;  5A2Q E;  1SYG A;  1STE A;  3R3O A;  4XTC S;  2N55 A;  1AW7 A;  1G2S A;  4A3E B;  3M85 A;  1LTI D;  1HFN A;  1HPC A;  1ZEQ X;  4OIJ A;  3I73 A;  1EY6 A;  1H9S B;  2I46 A;  2B2V C;  1EY9 A;  2F0L A;  4RHS A;  5CV7 A;  1AP0 A;  2KEC A;  4IFD G;  2B2T C;  3OIP A;  4IFD H;  2F0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...