3SVMA

Human mpp8 - human dnmt3ak47me2 peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
EDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M-phase phosphoprotein 8
publication title MPP8 mediates the interactions between DNA methyltransferase Dnmt3a and H3K9 methyltransferase GLP/G9a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 13
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3svmA00
1DOKA 4LMQD 2B2YA 2B2WA 2HDLA 4MHEA 4O42A 2CVRA 2JP1A 2FHTA 4UAIA 1WTOA 1HFNA 4R9WA 4RWSC 5E4WC 1B4OA 1S4ZA 1BF4A 4HCSA 1ML0D 1HFGA 1NCVA 5CBEE 1RHPA 2K04A 1MSHA 2B2VA 4DN4M 1G6ZA 1BNZA 5EPKA 3D6WA 1ICWA 2FFKB 1WTVA 1JICA 1B3AA 2B2YC 1PFNA 3DEOA 4RAUC 4X3KA 2KEEA 5T1IA 1AZQA 2J7ZA 1G2TA 3IL8A 5EQ0A 4MN3A 1KNAA 1F9RA 5EKIA 4ZAIA 3SVMA 2DY8A 2B2TC 2RSOA 1X3QA 3HP3A 4ZKBB 4RA8A 2MPMA 3TZDA 3I90A 1SSOA 3DM1A 2R3ZA 1WTPA 1NAPA 5D65A 3UI2A 1C8CA 1G2SA 4CJ1B 1DOMA 4IUTA 2K1BA 1HHVA 1WD0A 3KBXA 2X6GA 3I91A 1EIHA 2MGSA 5COYA 3FDTA 5T1GA 2K01A 3R93A 4R8IA 3F2UA 1SDFA 1VMCA 4IUUA 2DY7A 1QNKA 2XIWA 1ESRA 1EIGA 2RVLA 4NW2A 2X69A 2N55A 2N88A 4OIJA 3ONAB 1G91A 2HUGA 1U4MA 1KNEA 3GV3A 3IFDA 1PFBA 2L12A 3LWEA 2B2WC 4X3TA 1IKLA 4X3SA 4XT3B 1WTXA 1B50A 1XX8A 2L4NA 1F9SA 1PLFA 1X3PA 2B2UA 2BDNA 2MP1A 1RTOA 2Q8RE 4QUFA 2K28A 5E4XA 1BBXC 1DZ1A 4IUQA 1MGSA 2L1BA 1O80A 2EOTA 2VXWA 2FMMA 1WVLA 1HUNA 2EE1A 2B2VC 1WTQA 1RODA 1QE6A 3I3CA 2D9UA 1HUMA 3H91A 5EJWA 1WTWA 2KOLA 2K05A 1F9PA 1HA6A 2NYZD 1J8IA 1WD1A 1WTRA 2M2LA 1J9OA 2K03A 2B2UC 2H1EA 2KECA 2NZ1D 3TN2A 3N52A 1RTNA 1XYIA 4CJ2C 4X3UA 3I8ZA 1MI2A 1O7ZA 1EQTA 1B53A 1A15A 1U4PA 2KUMA 5DNFA 2NWGA 3G7LA 4ZLTF 1RJTA 1HRJA 4IURA 5AFWA 5D14A 1SAPA 1ILQA 5EPJA 1JE4A 4XDXA 1QG7A 4IUVA 2IL8A 5CBAE 1U4LA 1CM9A 1F2LA 2SDFA 4HAEA 1CA5A 2B2TA 5CMDA 1Q3LA 2HDMA 3FPUB 4HSVA 1AP0A 1B2TA 1EL0A 1M8AA 1NR2A 1DOLA 4HEDA 1O7YA 5EPLA 1LV9A 1IL8A 4QUCA 1NR4A 1AZPA 1GUWA 1PFMA 2L9HA 2KVMA 4ZKCB 1EOTA 1ILPA 2RA4A 3DEPA 1DONA 1VMPA 2RSNA 4IUPA 1CA6A 1TVXA 2EPBA 3MWYW 4U68A 1U4RA 3Q6SA 3MTSA 1E0BA 5JJZA 1X32A 2FJ2A 2Q8TA 4CJ0B 4ZK9B 2HCCA 1BO0A 2L11A 2FINB 3KUPA 2HCIA 4XT1B 4OIKA 1ZXTA 1MSGA 2MJ8A 1PDQA 2JYOA 2KEDA 3P7JA 3QO2A 5CORA 1IKMA 3GV6A 2X6LA 1F9QA
chains in the Genus database with same CATH superfamily
1PRTD 2F52A 1TWAH 2C5CA 4GN5A 3U4ZA 1Y1VH 4JI8Q 5E7NA 2O5IC 5E4WC 4C1NI 1XPUA 4DV0Q 1J6QA 1JB3A 3HRZC 1E2WA 4UDUC 1C48A 1EY9A 1UEBA 1B70B 2VQFQ 3TBIB 4RG1A 3GO5A 1R4QB 1CK1A 2Q8IB 4H13C 4RGMA 2NB0A 1H9SA 1KQSA 1C8CA 3T1YQ 2ZTDA 1UNSA 4GNXC 2L55A 1K73C 4P74A 4RHRA 4JI0L 4JI7L 3S2HB 4DGZA 4A3JG 4L6TB 4WJ3M 1YJ9A 4YWLA 3T13A 3O13A 3CF5A 2E5LL 2ZJPA 1BR9A 3K57A 1QB5D 3MAQA 1QZGA 3RN5A 3I70A 5FOBB 1VQMA 2QDLA 4DXFA 2JA6B 4B3RL 1W2BA 2L4NA 3VYRA 4A4IA 4L5QA 1J5EQ 2K28A 3H3VH 2JA6G 1EY6A 1K3BC 4DK1A 3RZDB 1R9TH 1KDCA 3TREA 1QZHA 2WKCA 4C3JH 1WTRA 3KK7A 1YNXA 5IOCA 3EIVA 5DM73 3PO2B 2KECA 4IOAA 3F2BA 5J1ZA 4A3DG 1CZGA 3TQYA 4C1NK 5A35A 2F0QA 2VB2X 4KD4A 3PO2G 3I4NB 1HZ9A 4DUYL 4O2DA 2EYHA 5EPJA 3BVZA 5C0XJ 1QILA 1EY0A 1U5KA 3PUVA 1SFOB 3GP7A 3RNUA 3RUZA 1FJGQ 3I4NG 2JK8A 1II3A 4RHSA 3NXWA 4IFDJ 1NE3A 2ALYB 1GHJA 1F2YA 1KAWA 4XYQA 2BE5D 1BKBA 1LYLA 3MTSA 1EUJA 2AWNA 3A5UA 3PO3H 3CC4A 4ILWA 1A3UA 2JA7B 1B3QA 4KD3A 1FL0A 5M3MH 2FHTA 3KLWA 3OWEB 1A8VA 4GOPC 3E5SA 2R92G 3GTLH 4DU9A 4HCSA 1K83B 1PYSB 3V96A 2K04A 1PH2A 1SR3A 5T1IA 1BCPB 3DEOA 1XJVA 2I5LX 2ICIA 5EKIA 1EWIA 5JEAJ 4RA8A 2SNMA 1EY4A 4JOIA 3NWSA 4XXEA 5C0XG 2KCMA 4CGYB 5EBDA 2Z0SA 5I4DA 1WD0A 4BA1I 1YJNA 2L5TA 1KABA 3I4MB 1VQBA 3C1EA 4A93G 4IFDG 1N8RC 2F3IA 2ASBA 3OPOA 1SXTA 2HD3A 1I4XA 1LM0A 4HMIA 3I4MG 1YITA 4CDFC 2Z6KA 1KDBA 1SLJA 1U4MA 1YZ6A 2WAQB 1PH6A 1HTPA 1A6XA 2CCZA 4EQ5A 2IWHA 2N49A 5CV4A 1H9JA 2R7ZB 2PQAA 1HXYD 2WAQG 4DAMA 2CQAA 3FKIH 1V43A 1WTQA 4IJLA 2R7ZG 4GOPB 2C9OA 3A7AB 5EJWA 3S1NH 1SE3A 1JE5A 1WD1A 4KY7A 1E2VA 4BY1G 2K03A 1HQRD 3TN2A 1PH4A 2JA8B 4YHHL 4X3UA 1MI2A 2EDGA 2RDGA 4DR4L 1AH9A 2YU9B 5JEAG 4DNRB 4LFBL 2AWOA 1IBKL 2NUCA 5CV9A 1DM0B 3V2TA 1IW7D 1WTHA 4LF9L 1LT6D 1BQQT 5FO7B 3D3RA 2MFIA 4B9WA 2PNRC 4A3GG 1HTLD 1LTBD 2QA4A 4KKSA 1AP0A 1IBMQ 4DV6Q 4HSVA 2BE5C 2OEOA 4DNIA 3LX0A 4DNTB 3EN2A 5M9OA 2EY5A 1IHZA 4J1MA 3ZYYX 3I2ZA 1E1OA 1IL8A 1LV9A 5FLMG 3HOVB 1T9HA 4NDXA 3MEHA 1CSPA 2LFNA 3FPPA 3JC66 3VYTA 1STHA 2L11A 3NEMA 4FF1A 4OHJA 3D0FA 1MSGA 2JYOA 3QO2A 2GA4B 4KMUC 3GV6A 1NMGA 5EGTA 1KTKA 3S1QB 2B29A 3OIQA 1A62A 2F4IA 3K5LA 1WTOA 4K5WA 1IL2A 3QR8A 3ULLA 4DR2L 1X3EA 1FR3A 4PMCA 4DR6Q 3D6CA 1K0SA 3CRKC 2B2VA 5HGQA 1BNZA 1N36L 3OTOQ 1PTOD 5DEHA 3J7AF 1XPOA 4X6AH 2OXPA 3QG1A 2DY8A 1TWGH 2B2TC 1X3QA 4B3TQ 1Y14B 4FVMA 4PMWA 4NXNL 2R3ZA 1E1TA 5D65A 3CD6A 5IYCG 4AQYQ 1SE8A 3CKIB 4LFCQ 2I5MX 1STAA 5IYBH 1SMYC 2D5DA 3GTOB 2RCFA 4N8FA 3G4SA 4FXDA 1SJED 3HOUG 1W3SA 3HOXH 1I4QA 2XVSA 4DAPA 3JAMc 1LABA 1Y1WH 1WJJA 1PVOA 1XX8A 4N8X1 2PPBC 3PUZA 1XNRL 5C6AA 3S1MB 4FF4A 1YBYA 4ZCKA 2PYKA 2R7DA 1IW7C 4IO9A 2F3WA 3N52A 2OQKA 3VR6A 1Q8IA 4YY3L 2R93B 2JSOA 3HOYH 2K5NA 1JOKA 1R4PB 5LL6S 1I4GA 4IURA 4UPAA 5AFWA 3W1BA 4A3KB 5GADC 1FD7D 1N34Q 2AKWB 3V05A 2VQEL 5AJ3Q 2UUBQ 5K5PA 1VQFA 3S2DB 1ONLA 3JAML 4JK1C 4GKKL 1ILPA 2AQ2B 1LTRD 1TWAB 2UXBL 3BDLA 1Q12A 1KAAA 3U4VA 1Q46A 3K7AH 3SK6A 3W5OA 2HCCA 4JG2A 4OWXB 2VW9A 4JV5L 1ZXTA 1SNQA 4Z9CB 2D0OA 4K2LA 4ODGA 4DAYB 4DKAC 2B2WA 3X3MA 5IP7G 1ASZA 1PTOC 4QL5A 4DF7A 3OYYA 3HOWB 1RIPA 1SNOA 5EAYA 1YNJD 3BDCA 3K5OA 3SXHA 1XMOL 1PV4A 2Y0SB 1NCVA 2KJXA 3G6JB 2HHHQ 4A3DH 1I50H 2E74C 1JCKB 1FNUA 1SEBD 1FNWA 1YHAA 3P20A 5EBCA 2Y0SG 3A8IE 4HJ9A 4IUNA 3I90A 3VR5A 3T53B 3LNNA 3VA7A 2UUCQ 4K0KQ 2F0WA 2LKVA 3SK4A 5COYA 1VS0A 4R8IA 2K01A 3S24A 2XIWA 2OTLA 2EY2A 3GD7A 5L37A 4A3FH 3NE5B 3DWPA 2UXDQ 3J7YW 4ZRZA 4M8AA 3K0XA 1NBWA 4AYBG 1IXRA 4BBSH 3U9SA 1V9PA 4C3JB 1GUSA 3OHXC 4NMZA 5E4XA 3KF6A 4EQNA 2NTSA 2FMMA 1PFSA 1WVLA 2E2JH 2Z4IA 1O7LA 5IGFA 2EQSA 3ND9A 1CKOA 1SYCA 3M4OH 1VQIA 4BWGB 2EXDA 3I7FA 2H1EA 1HR0Q 4M1UB 5DLQE 3WOFA 1XNQQ 3GTJH 1LTAD 4K14A 2XWBB 1K8AC 3CC7A 3DWQA 1BXTA 4DV2Q 4JBWA 1U4PA 1S5DD 1RCVD 1N32L 1LACA 4ALPA 3MFGA 3ERSX 4WRDA 3KDFA 1TWCB 2A73B 4Y52H 5CBAE 3S1RB 4DV1L 2YTYA 1Q90A 3HKZG 3CCQA 5LMUQ 3MC0B 2XRSD 3M4PA 4HJAA 3PO3B 5M3FH 4K5XA 2RSNA 2K6AA 3MWYW 4OL7A 2FINB 5BN4A 2JEBI 3J7AV 2MJ8A 4HMJA 3HG9A 4A3IG 4GN4B 1KL9A 4LFAL 1TWHH 2F0IA 1TIID 2O2LD 1JWUD 4LF7Q 2K5DA 2E2HH 2V4DA 3K7UC 1SJHD 2F1MA 3E6ZX 1D6EC 1JORA 1LTLA 1A3TA 3RLOA 3EBEA 5CBEE 4JI2L 4LUVA 4ABNA 5C4ZA 1WTVA 2A6ED 1VQNA 4JI3Q 5IGCA 4X3KA 4DV7L 4OX9Q 4CKBA 5JEAH 4DV4L 5C4XG 4IALA 3D31A 2ZTCA 3VA5A 2D2CC 5J22A 1JJGA 4N9TA 4H02A 1PRTF 5IYDH 4EVOA 2EYOA 5C44H 1UE1A 2QGQA 3RD4A 3DHQA 1HNZQ 3URYA 2F0FA 4LF8L 3A74A 1H9MA 2KQ3A 1PA6A 4JC0A 3ONAB 4DK0A 2E2IH 4OO1H 3FKIB 5FKAC 1KNEA 4KKUA 2DNCA 4DV3L 4TKOB 1PZJD 3S1NB 5FJ8H 2IX0A 4DXGA 2RCNA 1B50A 1X3PA 2B2UA 4R4IA 4RKLA 4CKCA 1EU3A 4IUQA 1Q86C 3D8GA 1A0IA 2YYZA 2MHVA 4UY8C 4KY6A 5M5WH 1ICFB 3JAME 1ASYA 2QDBA 5I6YA 1EFID 1SYGA 3E3XA 2OF1A 3CRLC 4KKTA 4G7ZC 2QW7A 1VQKA 3BU2A 1PZKD 3I8ZA 4P72A 1PH1A 3NHHA 3VYSA 2EYFA 2MUYA 1HJPA 4F8MA 1O7ZA 3QOLA 1SYDA 1EQTA 5LL6X 1BVSA 1IYUA 3FVQA 2WINB 4AYBE 2NWGA 5JJIA 4OO1I 3FP9A 1HRJA 2F0NA 1PHJA 5IGDA 2O5JC 4MIUA 1CA5A 3C46A 1X9NA 1FVIA 3MEFA 3HZXA 4I7AA 3C2PA 3HOUH 5CR3A 2CWAA 1V1PB 1WCMH 2KCTA 4B3ML 5GAEC 1QUQA 2UU9Q 1CA6A 4IUPA 3CC2A 3EVQA 3L3OC 5C3XA 1EL0A 4YWKA 1I94Q 2KENA 1J5EL 5KRUA 2A69D 1QOHA 2WIIB 2DGYA 4IQZA 3GTGB 3TDQA 2A6EC 5KGUA 1I6HH 1FGUA 1VQHA 1BCPD 4BS9A 3A7LA 4H7BA 2NVXH 1IYVA 4JYAQ 4L63B 1A2TA 1HFGA 1V1QA 4KY5A 1X56A 3HKZE 1EEFD 2K50A 5CV7A 1EZ6A 1PH8A 5KEEA 4RAUC 1G8ZD 1EWCA 4HR7B 2B8FA 1GOZA 4K2KA 3HOXB 3DM1A 1IBLL 1NAPA 3NWTA 5KYLA 2N3SA 1TY2A 4FNFA 1VQJA 2EJGC 4A3CH 2JA5G 3I91A 4Y7NH 1FJGL 4QIWE 2A6HD 1XTCD 2NBFA 4IUUA 3CPFA 3A8KE 4KLKA 2Z4HA 4RCOA 3ER0A 3GTQB 3NBHB 3TZUA 1PZID 2Q2HA 1AE2A 3PQIA 4BBRB 2EXZA 1KXLA 4P73A 3S17B 1CQFA 3CCEA 4X65Q 3NQTA 3E0EA 3SR1A 1BOSA 4BY7H 1S5BD 1KC8C 1VQ8A 5IWAL 1P8LA 4C3IH 4BBRG 4A3EH 5IGGA 1CHQD 2E8GA 3H91A 1LTID 1MJEA 2EYMA 1UWVA 1W6KA 1VQPA 4FF2A 4JVZA 5HURA 3BYTB 3J81i 4PV1C 4HN7A 1I4RA 2NVTB 4KJNA 2KUMA 4JCVE 4EX5A 2UUAQ 3H15A 4NKLA 3I4LA 3SHLA 1QG7A 1X55A 1ENCA 4F7XA 1EY5A 5CV6A 5KNCA 1Q3LA 3D4RA 1C4QA 1PH9A 3FMCA 1TQOA 4HIKA 2RDHA 4X64Q 3F8TA 4K8JA 4GNXA 1H9SB 4TVAB 2L9HA 3GTPH 2A69C 3A55A 2A1AA 4A3BB 1DJRD 1JC7A 2PMZB 3TP6A 4RKBA 1BCPC 4OGQC 1QVCA 1JOOA 1STYA 1SNCA 1AEXA 3EJIA 1TS5A 4KJOA 4A3BG 1OXXK 1UE6A 1IKMA 1P16A 1CFMA 3CCSA 3IAYA 5K36G 1GJXA 1I50B 4OWTB 1QVFA 4LF5L 1X65A 3J81j 4UAIA 3HKSA 3CMAA 3QWNA 3KLSX 3H0GH 5KNBA 3H3VI 1RHPA 2F3VA 4DN4M 2K14A 3MFYA 4C2MB 3GDEA 2B3GA 4OONA 3VR4A 2ID0A 2VL6A 2UXCL 4BXXG 2A6HC 4QQBX 3TEHB 1HZCA 3AFQA 2AUJD 2MPMA 4LUZA 2NN6H 3UI2A 4A3FB 2NVQH 1DOMA 3ITPA 4HJ7A 1GO3E 4RGNA 1EIHA 2JEAI 3PGZA 3A8JE 3R93A 5ELBA 2JA7G 4KN4C 2VUMH 4JOIC 4LF6L 1PTOF 2B63H 3PF4A 1XMQL 4YCUA 5KNDA 3NP8A 3M4OB 4PG3A 2TSSA 3CHBD 2EY6A 3CQZH 1MGSA 5C4HA 4JI7Q 1SYEA 3GTJB 4JI0Q 4POGA 1N33L 2GVAA 5ELFA 5BN3A 2NN6I 1F9PA 3MVVA 1VQ4A 4DR6L 4BA2I 3RZOH 1CTMA 5I9PA 3IFTA 1STNA 4JPBW 4P71A 1XTDA 2I5HA 3S15B 4X66Q 4KHPQ 2H5XA 3HOZH 4B3RQ 1CQVA 1SMYD 2VB3X 4B3TL 1ET9A 2CH4W 3T16A 2EJMA 3BJUA 4AQYL 4LFCL 2DJFC 2E75C 1MD2D 2J4XA 1VQCA 3STBD 4CHTB 4GLXA 1LTGD 2R61A 2XSCA 2MQHA 4JI1Q 1TWHB 1TS3A 4Q5VA 4YCVA 1DONA 3OOCA 2JJQA 1VQ7A 1A3VA 3RR5A 1CKNA 3ULPA 4JBJA 3BVGA 2WB1B 4DUYQ 1VQ9A 2JA8G 4C3HH 5I6WA 3D4DA 3IL8A 1EYAA 4LMQD 2B2YA 4XTCS 4APVA 2R6GA 2PQEA 1GKHA 3MXUA 4R9WA 3WOEA 1EU4A 1F2MA 1E24A 1IYJB 1YHBA 2D62A 2PQAB 2JQOA 2WV6D 1V8QA 4A3MH 1D2BA 1K3RA 1DXMA 4RH6A 2V1CC 1OXSC 1EQVA 2C35B 3A54A 3C3LA 3KLSA 1STEA 2MO0A 3HOVG 1BUVT 5JVH3 1LT4D 2ICEC 2E2IB 4IPGA 2K1BA 5C3EB 4XYOA 3W1GA 1N34L 2UUBL 3CU7A 5T1GA 4IPCA 1QNUA 1VMCA 1LO5D 3KYHC 3E9HA 2LSSA 2B8GA 2G9HD 1VQLA 1EIGA 5C3EG 1KDAA 3PF5A 3TMEA 1ENFA 2A5HA 3GV3A 5CGKA 5M5WB 1PFBA 1OXUA 1X6OA 3KF8A 4WJWA 1S5CD 4XT3B 4DR1Q 1PH5A 2RBMA 4XQQA 4QY7A 1LTSD 1SE4A 2EE1A 4R4TA 3BYYB 3PIP3 2EY1A 2NTTA 3S16H 1HA6A 2NYZD 1GVPA 3GTMB 3S14B 1F2ZA 4X62Q 4ZUIA 1BDOA 1EQRA 4WFN3 1HZAA 2HHHL 2LXJA 4A3LH 1E2ZA 2EYPA 2FXQA 4IZ8A 3STBC 2Q2TA 2ZTEA 1MKHA 2K33A 4IPHA 1WCMB 1WFQA 2NZHA 1EY7A 3OIPA 4K0KL 4QJFA 1SYBA 1F2LA 4IN3A 4J15A 2JA5H 2B2TA 3FPUB 4FF3A 2F4VL 1M8AA 4KK7A 5IODA 2Z1CA 4KHZA 3UDIA 1GUWA 1PFMA 4YHHQ 1UAPA 3CCMA 1I4HA 1I6HB 5NUCA 4LFBQ 3DXJC 3CMEA 2AMCB 1E0BA 4ZK9B 2ZXPA 4LF9Q 1SNMA 1N9WA 1I6VC 1EYDA 1YVCA 3SDZA 2R93G 1FGBD 4O42A 5IP9G 2WAQE 4LF4Q 1PMRA 4A3JH 5IT9L 1I4PA 3K5NA 1HR0L 3VR3A 2N8NA 4HCEA 1MHWC 4A3KG 4J6HA 5BN5A 2FFKB 5IE8A 3S2HH 2LMCB 2EZVA 2F0TA 1AZQA 3U50C 2J7ZA 4Y7NB 4DUZL 2HIXA 4DV2L 3H3VC 1KNAA 1F9RA 1Y1VB 3SVMA 3CPWA 1HNXL 2A68D 2VNUD 1PH3A 1BBWA 5G3LD 3K58A 1ENAA 3HGBA 1OO9B 2N78A 4R4CA 4IUTA 4DR3L 4L8JA 2K5QA 2JA6H 2X6GA 3NQIA 4DR2Q 4HSPA 1Q8KA 4UP9A 2ATWA 4NW2A 3OW7A 3MXGA 1IZ6A 1N36Q 3RZDH 4C3IB 2HUGA 5LMNL 4TQUS 3HOWG 2EIFA 4LWCA 4OWWB 2CW0D 2D0PA 4LW1A 4DR5L 4R4QA 1VQEA 2TMPA 4NXNQ 3PO2H 4QUFA 2A74C 1RKNA 5CV8A 2OCEA 4RGTA 5JAVA 3BZCA 3I4NH 2K5HA 5EKLA 4K5VA 2OWOA 1HZBA 2VZAA 4CJ2C 1B44D 4L5RC 2ZM6L 1R9TB 4BXXH 4FXKC 1CZWA 4DR7Q 4YCWA 4KV6A 5EKKA 1Y69U 1S72A 1FYCA 1RJTA 4HIDA 5GAGC 1SAPA 1XNRQ 1I3QH 4XDXA 3GTPB 4IUVA 3HFZB 2BA1A 4HAEA 1K0RA 2HDMA 2HQEA 4IPDA 4C3JG 3A0JA 1W6JA 2ZXRA 4R4OA 3M85A 2R92H 2JA7H 1D5ZC 1YNND 1C9OA 3PUYA 1GUGA 1TU2B 4B3SQ 3DEPA 1EYCA 3CCJA 1VMPA 1VQGA 3U58A 2FJ2A 3MHBA 4XT1B 4POFA 2BH8A 4DV5L 3VR2A 5C0XH 2CKZB 3SE0A 3M9BA 4JI4Q 1S4ZA 3NENA 1HNWL 3A56A 4A93H 2A68C 4IFDH 4EQPA 1YI2A 1K8OA 1KLGD 2K5WA 5HGTA 4GKKQ 3K6OA 3KF6B 2UXBQ 3CAMA 2F0HA 3I4MH 1TWFH 2PO4A 3FEWX 3H09A 3T51B 5M3MB 1D5XC 3PO3G 3AEVA 3GTLB 3D4WA 1JR0D 4LK1C 1L1OA 3GTKH 5JOBA 1GUTA 2B63B 1C0AA 1BCPF 1HHVA 1YHQA 3OWFA 2R7ZH 3FHWA 3IRBA 2CW0C 1XMOQ 5C0XI 2NZOA 2MNAA 3CQZB 3IKJA 4BY1H 3KDFB 1MBYA 2IX1A 2SEBD 1TY0A 1L2FA 2RHSB 3K5MA 4IFDI 4LAAA 1B1ZA 2K52A 3MXNA 2BDNA 1BBXC 1DGSA 2YU9H 3T1HQ 4A3GH 4KHVA 4RGOS 1WTWA 2K05A 5C5MA 1J8IA 4JYAL 4EGVA 4JI6L 2B2UC 3N6RA 5HY6A 5C3WA 5FLMH 4K6DA 2QF7A 4NB3A 1PYWD 2F0MA 1JQYD 1JOQA 1Y8NB 2Y0SE 5IT9E 3L0OA 1YNNC 1JE4A 3FKIG 2IL8A 1M4VA 4RFBA 5CMDA 1UUPA 1GD7A 2PW5A 4JI8L 4CDEC 5LMNW 1NR2A 4G7HC 5ELNA 1DOLA 4QB4A 4DV0L 4C3HB 1NR4A 3RN2A 3J7ZC 4TSSA 3DWAA 5GQOA 2F0JA 3KOJA 4U68A 2VQFL 3I4OA 1N32Q 4N9PA 2RQXA 2EJFC 1Y8PB 1B9MA 3FRPB 3T1YL 5IYCH 2GN5A 4A3MB 2XWJB 4DV1Q 3RLFA 5C4JH 1SN8A 1O7IA 4RWSC 1XPRA 4B9XA 1K8GA 4V0BA 3Q8DA 1ML0D 3ZJYC 1G6ZA 4K6LA 4UHVA 1WOCA 5CYUA 2FMCA 3KBGA 4MN3A 4ZAIA 4NXMQ 3AU7A 2YTVA 5DAUA 2BDOA 4NPSA 1DD2A 2LS01 1LLRD 2MGSA 4G57A 3PIPA 5E1FA 2K5VA 5GROA 1UEAB 1TWGB 4PZ6A 4JI2Q 2KHIA 3S1MH 3QB3A 4DPGA 3RMHA 3M7GA 1EEID 4DV4Q 3W2DA 1WTXA 2PI2E 3J81c 2JXMB 2F0LA 1RTOA 1AW7A 4GKJQ 2VXWA 4FYDA 1QUQB 2QCPX 1YJWA 5IYBG 5IP9H 2Z8LA 3K81C 4GZYC 4WJ4A 1Y1WB 2IPKD 3K80C 2L0CA 3HOXG 3OMGA 2PNHA 3J80i 2L15A 3QJYA 1STGA 3KLRA 3J80L 4OXPA 4YIJA 4A3KH 1RTNA 1S5FD 2M00A 2F0VA 4DK6C 3CW2C 2OT2A 4DV3Q 3KJOA 1LT3D 3U9OA 4GS3A 1WYDA 4MZ9A 4NP5A 2KCNA 3G7LA 2CH4A 1ET6A 1TR5A 3T56B 4TRDA 4E6IA 4QCLA 3AYHB 2F0GA 4EQOA 3K59A 5CV5A 3KJPA 2SDFA 3SK5A 5IP7H 3KFUA 5BR8Q 2JE6I 3M4QA 5FLXL 1RL2A 1M1KC 3PSIA 3HOYB 2H4OA 1AN8A 5TSSA 2KVMA 3W3AA 1OXVA 1D1KA 4FP5D 3UDFA 1SNPA 3HOWH 1NSNS 1D5MC 3J81L 5JJZA 3CCRA 1X32A 4A3JB 3HOYG 1JWSD 1BO0A 3KUPA 5M5XH 1Z7TA 3X3NA 4IJHA 2CFMA 4MTNA 1VQOA 4JI5Q 2IY5B 3I55A 4MHEA 2CVRA 3PUWA 4KI0A 1SE2A 3K7AB 5C5LA 4ZYSA 3CCLA 3UE0A 4FXGC 2KHSA 1QVGA 4B3MQ 1MSHA 2B39A 4XIGS 1GXDC 3SK8A 1KLUD 3SEBA 1X3GA 4X66L 4KHPL 4Q0FA 1Q81C 4LJZC 4ZKBB 2G9DA 2ES2A 3L9AX 2NVYH 4PZ7A 4PMBA 4JBKA 1S5ED 1VQAA 1CT1D 5E3FA 5J3BA 1Q1BA 2F0DA 1UE7A 1PYBA 4A3DB 1U9RA 2I0QA 3LGJA 1E3PA 4AH6A 4JI1L 2N88A 1TXYA 2DUDA 1PTOH 3L2PA 1NY4A 2L12A 3M3YH 1QWYA 4O1NA 1B8AA 1X3FA 1PLFA 3L7ZC 4ZUJA 5F2DA 4QGUA 1IBLQ 5ELOA 3M4YA 4GNXB 5FO8B 1VF7A 1QCBD 4HIOA 1PH7A 1ESFA 1HUMA 5ELDA 2VS1A 3BG3A 1IBML 2XN9C 4DV6L 4BBSB 2Q2UA 2WFWA 1TWCH 4A3FG 2HQLA 4J8QA 1RD9D 2EVBA 1OXTA 4GN3B 1PRTC 2WKDA 1I3QB 4KTAA 3LWUA 3S1RH 1TKWB 1RF2D 3OMCA 1H9RA 1Z6HA 4BBSG 3P75A 2E2JB 1VQDA 2EYJA 3PV0A 5D3DA 2LXKA 1A15A 3TP7A 5A2QL 2R92B 3BZKA 5H1SE 3AMUA 4A3IH 1OTCA 1ILQA 5IWAQ 1G6PA 4G7OC 1L0XB 5IGEA 2Z6KC 1G51A 4HEDA 2E5LQ 1SRUA 2RKSA 1KIXA 4ZKCB 3OTOL 2KA7A 1VQ6A 4GOPA 2ZJQA 5C4XH 4DR1L 3NTHA 4A93B 1L0WA 2AQ1B 3F2CA 5M3FB 1YIJA 4S3SA 2HDLA 4HTHA 1TWFB 2OQ0A 4QMGA 3A5ZB 1BF4A 5ISRA 3MA2B 4K8IA 1MJCA 4X62L 5M3FG 1MIUA 1Q1EA 1SNDA 1PRTB 3GTKB 3RLNA 1JWMD 1B3AA 1SROA 2B2YC 3NPPA 4PQXA 1G2TA 2E2HB 2QKIC 4CBVA 1D1IA 2RSOA 3HP3A 3TZDA 4ME5A 1SSOA 3F1ZA 3ND8A 3VYUA 4BY1B 4CJ1B 1CSQA 3C1FA 4LF5Q 3EA6A 3J80E 1CHPD 1EYGA 4LUOA 2I07B 3FDTA 2WB1G 4HJ8A 1U0LA 3F2UA 1QNKA 1CUKA 1H95A 2N55A 2XNAC 5M5YH 2UXCQ 5C44B 1VF5C 4A3GB 2RDFA 4F87A 4R8NA 5G3LF 1F9SA 1DZ1A 4U673 5IYDG 5FLXE 2M9VA 4R1JA 4I7ZC 3CP0A 5C44G 1AE3A 2B2VC 4UP7A 2G5DA 2I46A 2D9UA 4L5TA 2PMZE 1TS2A 3DLLA 4LF4L 1CKNB 3TP5A 5AJ3L 1EIYB 2K4KA 3CCVA 3J81E 1A63A 1XYIA 1ZEQX 4LF6Q 3PIO3 4OO1G 1XMQQ 1G291 1D8LA 5FJ8G 1FNVA 2PZWA 3VDYA 5JJLA 3ICEA 5D3IB 4CDCC 2MO1A 2ZJRA 2RF4A 3I72A 1D7QA 1BBUA 1N33Q 1O7YA 1EY8A 5EPLA 5IT9c 2SNSA 2AQ3B 3GTGH 2WACA 3PCOB 3F2DA 5C4JB 2Q8TA 4CJ0B 1EOVA 2YTXA 3Q24A 2K75A 4JW0A 1A2UA 3P7JA 1CI3M 3G6EA 3HOUB 2F03A 4HJ5A 2X6LA 3OSOA 2UUCL 2JP1A 1JT8A 3E9IA 3KF8B 3WDNA 2F0SA 1WCMG 2AHOB 5EPKA 3D6WA 1LTTD 3UDXA 2UXDL 2F0PA 2KEEA 4DR4Q 2BA0A 1Z9FA 4DR7L 1IBKQ 1DCZA 3GTQH 2NVXB 4XQNA 1C7YA 4C56C 1G2SA 2F0UA 3TS2A 3BZDB 1ZKOA 5JJKA 4BBRH 3S17H 3E0JA 1WI5A 3T4AC 3HS0C 4DAYA 4B3SL 5A2QE 1XNQL 2ENBA 1K9MC 4DFAA 2KBNA 2B2WC 3LWEA 1IKLA 1O78A 2Q2IA 5LHY1 2Q8RE 3CCUA 2L1BA 2EOTA 4A3CG 1QE6A 2NVTH 1Y1VG 4JI4L 5I9OA 3S9WA 3JAMi 3WWVA 5LMUL 2WB1E 1Q7YC 3QOJA 2JA9A 4DK3C 1UE5A 4BY7B 4RMFA 4A3EB 1TT2A 2PZTA 4ID6A 5I2XA 1H9KA 2HIVA 3NTKA 1KHIA 3ULJA 4ZLTF 1GM5A 4BY7G 3DMUA 4H0LC 3TP8A 5JPMC 4C3IG 2IX3A 4A3EG 4A3BH 5K36H 2XGTA 4LF7L 1QJOA 3UE1A 3OW2A 4LNQA 5M5XB 1B7YB 2A19A 2JN4A 3NK9A 4JI3L 1SFOH 1U4RA 4OX9L 4UP8A 1AFPA 1SYFA 1PDQA 2KEDA 5CORA 4C2MH 4P75A 4PZ8A 1SMXA 3QIAA 4FDBA 2BCOA 2QEJC 2E76C 3T1HL 1NJIC 2F4VQ 3CXCA 1HNZL 1V1OA 4AYBB 3EQLC 2XRQD 2QILA 1KD1C 3G48A 2NVYB 1JJ2A 1HA5A 5GAHC 5J39A 1HPCA 1ICWA 1JICA 1PFNA 1E22A 4YY3Q 1JMCA 4XQJA 2PI2A 5FO9B 5EQ0A 3AFPA 2F0EA 2J0TD 1K83H 1CKMA 3H0GB 5DM63 1VQ5A 1PTOB 2CQOA 2CHBD 1Z47A 2F0OA 2ZT9C 3M3YB 3I73A 2VQEQ 3Q0AA 3H0GG 1SDFA 2DY7A 2RVLA 2O4XA 2X69A 4MTKA 3G71A 5ELCA 4WORA 1L1OC 2NVQB 2RHQB 3IFDA 4DUZQ 4X3SA 2XTIA 1HNXQ 2BH2A 2DN8A 2IHEA 4JV5Q 2NN6G 3HKZB 1S40A 4G4KA 2GVBA 1LT5D 4QF4A 1L0YB 2VUMB 1I5FA 1YEZA 4MNOA 3S15H 2DNEA 4DR3Q 2IHFA 1HUNA 5M3MG 1RODA 1NNXA 2Z9HA 3R2TA 1EIFA 2AUKA 4CKEA 1EQQA 2VUMG 2BOSA 1KRTA 2NZ1D 1T5XD 4A3IB 2B63G 3Q23A 2ZXOA 3NSWA 2UU9L 5LMNQ 3BVMA 4QIWB 1NTGA 5I2YA 1X54A 4KN7C 4DR5Q 4NXML 4P2CB 1YNJC 4ME3A 4RCNA 1I94L 3NTIA 1ZYRD 2JA8H 3RZOB 3B6YA 1HR0W 1KRSA 1U4LA 3TS0A 3P1HA 1B9NA 2KHJA 3PUXA 1B2TA 1HCZA 3HOZB 5C4XB 4GLAC 3M7NA 1VDZA 4QUCA 1GUOA 4DA2A 1AZPA 1L1OB 1JJCB 5FK9C 3NELA 1Y8OB 2RA4A 3BDOA 3HOZG 2ZM6Q 3Q6SA 4GLVB 1NUCA 4OIKA 3MZ5A 3K8AA 4HIMA 4B08A 3NBIA 3H94A 3BS1A 5ELEA 4JBMA 3HOVH 4GKJL 1DOKA 3HEJA 3MXPA 1EZ8A 3J7A5 1HQMC 2SOBA 1STBA 1HFNA 2LY7A 4FO2A 1B4OA 4YWMA 3MXNB 1EFWA 5C3EH 2E2DC 1E7ZA 1EWHA 1XWEA 3S1QH 2KCCA 4AIMA 3TSSA 4PNYA 3I56A 1RDPD 3H6MA 4C3HG 5IIFA 4X65L 1V1PA 1WTPA 2WP8J 4DV5Q 3AB9A 3DUZA 3AQQA 1SBBB 1GUNA 5M5YB 3KBXA 1VCIA 1PXUA 5BR8L 1HNWQ 3NUCA 1DYQA 2PCFB 1ESRA 1JB7A 4CDDC 4V190 1XXGA 1HH2P 3SGIA 4OIJA 4A3MG 1G91A 2Z6BA 3J80c 2IJ0A 2PW7A 1F77A 3PIOA 2K7VA 3GQBA 4X3TA 2DJGC 3S14H 3GTMH 3GTOH 5IY0A 2MP1A 2R7FA 3R3OA 4ZQ3A 4JI5L 2UUAL 5CC4A 2OTJA 4LFAQ 1O80A 4A75A 3R2IA 3I3CA 1K28A 2K32A 4H44C 1Q82C 3K0YA 2QEXA 3DM3A 2KOLA 2CWPA 2IW3A 1S3OA 4ULLA 2M2LA 1J9OA 4X64L 5FLXc 1TS4A 4L5SA 3EFXD 1ZYRC 3PMFA 4DAVA 5IGBA 1K8MA 2P5ZX 4DV7Q 3Q22A 5DNFA 1B53A 5JVG3 3S16B 2A8VA 5JPNC 5KIXA 3NBHA 1NMFA 4A76A 5D14A 2IT1A 3EROA 1CM9A 4I65A 4IOCA 3TRZA 2R93H 4O0AA 5KYIA 4OEMB 4OELB 3R8BA 4F88A 1T5EA 2PZUA 4LF8Q 1GHKA 4JI6Q 1LUZA 4A3LG 2EYLA 1M90C 1EOTA 3ERQA 2YV5A 1TVXA 2EPBA 1Y1WG 3UDGA 2JA5B 2HT1A 2HCIA 3S2DH 2VY3A 2F0KA 1F9QA
chains in the Genus database with same CATH topology
1PRTD 2C5CA 2O5IC 5E4WC 4C1NI 1JB3A 3HRZC 1E2WA 4UDUC 1C48A 1EY9A 3TBIB 3GO5A 1R4QB 1CK1A 2Q8IB 4H13C 4RGMA 2NB0A 1H9SA 1C8CA 1UNSA 2L55A 4RHRA 3S2HB 4DGZA 4L6TB 3T13A 3O13A 1BR9A 3K57A 1QB5D 3MAQA 3I70A 5FOBB 4DXFA 2JA6B 2L4NA 3VYRA 2K28A 1EY6A 4DK1A 3RZDB 1KDCA 2WKCA 1WTRA 3KK7A 5IOCA 5DM73 3PO2B 2KECA 5J1ZA 1CZGA 4C1NK 5A35A 2F0QA 2VB2X 4KD4A 3I4NB 2EYHA 5EPJA 3BVZA 5C0XJ 1QILA 1EY0A 3PUVA 1SFOB 3GP7A 3RUZA 1II3A 4RHSA 3NXWA 4IFDJ 1GHJA 1F2YA 4XYQA 2BE5D 3MTSA 2AWNA 4ILWA 1A3UA 2JA7B 4KD3A 2FHTA 3OWEB 3E5SA 4DU9A 4HCSA 1K83B 3V96A 2K04A 5T1IA 1BCPB 3DEOA 2ICIA 5EKIA 5JEAJ 4RA8A 2SNMA 1EY4A 4XXEA 3NWSA 5C0XG 4CGYB 5EBDA 5I4DA 1WD0A 4BA1I 3I4MB 2L5TA 1KABA 3C1EA 4IFDG 3OPOA 1SXTA 1I4XA 4HMIA 1KDBA 1U4MA 2WAQB 1HTPA 1A6XA 2IWHA 5CV4A 1H9JA 2R7ZB 1HXYD 2CQAA 1V43A 1WTQA 2C9OA 3A7AB 5EJWA 1SE3A 1WD1A 4KY7A 1E2VA 2K03A 1HQRD 3TN2A 2JA8B 4X3UA 1MI2A 2EDGA 2RDGA 2YU9B 5JEAG 4DNRB 2AWOA 2NUCA 5CV9A 1DM0B 3V2TA 1IW7D 1LT6D 1BQQT 5FO7B 3D3RA 4B9WA 2PNRC 1HTLD 1LTBD 4KKSA 1AP0A 4HSVA 2BE5C 2OEOA 3LX0A 4DNTB 5M9OA 2EY5A 1IHZA 4J1MA 3ZYYX 1LV9A 1IL8A 3HOVB 4NDXA 3MEHA 2LFNA 3FPPA 3VYTA 1STHA 2L11A 4FF1A 4OHJA 1MSGA 2JYOA 3QO2A 2GA4B 4KMUC 3GV6A 5EGTA 1KTKA 3S1QB 3OIQA 2F4IA 3K5LA 1WTOA 4K5WA 1FR3A 4PMCA 3D6CA 3CRKC 2B2VA 1BNZA 1PTOD 5DEHA 3J7AF 2OXPA 3QG1A 2DY8A 2B2TC 1X3QA 4FVMA 4PMWA 2R3ZA 5D65A 3CKIB 1STAA 1SMYC 2D5DA 3GTOB 4FXDA 1SJED 1I4QA 2XVSA 4DAPA 1LABA 1XX8A 2PPBC 3PUZA 5C6AA 3S1MB 4FF4A 2PYKA 1IW7C 2F3WA 3N52A 3VR6A 1Q8IA 2R93B 2JSOA 1JOKA 1R4PB 5LL6S 1I4GA 4IURA 5AFWA 4A3KB 1FD7D 3V05A 5K5PA 3S2DB 1ONLA 3JAML 4JK1C 1ILPA 2AQ2B 1LTRD 1TWAB 3BDLA 1Q12A 1KAAA 3SK6A 2HCCA 1ZXTA 1SNQA 4Z9CB 4K2LA 4ODGA 2B2WA 3X3MA 1PTOC 4DF7A 3HOWB 1SNOA 3SXHA 1YNJD 3BDCA 3K5OA 2Y0SB 1NCVA 2KJXA 3G6JB 2E74C 1JCKB 1FNUA 1SEBD 1FNWA 3P20A 5EBCA 3A8IE 4IUNA 3I90A 3VR5A 3T53B 3LNNA 3VA7A 2F0WA 2LKVA 3SK4A 5COYA 4R8IA 2K01A 2XIWA 2EY2A 3GD7A 3NE5B 3DWPA 3J7YW 4ZRZA 4M8AA 3U9SA 4C3JB 1GUSA 3OHXC 4NMZA 5E4XA 4EQNA 2NTSA 2FMMA 1WVLA 2Z4IA 1O7LA 5IGFA 3ND9A 1SYCA 4BWGB 2H1EA 4M1UB 3WOFA 1LTAD 4K14A 2XWBB 3DWQA 1BXTA 4JBWA 1U4PA 1S5DD 1RCVD 1LACA 3MFGA 4WRDA 1TWCB 2A73B 5CBAE 3S1RB 1Q90A 3MC0B 2XRSD 3PO3B 4K5XA 2RSNA 2K6AA 3MWYW 4OL7A 2FINB 5BN4A 2JEBI 3J7AV 2MJ8A 4HMJA 3HG9A 2F0IA 1TIID 2O2LD 1JWUD 2K5DA 2V4DA 1SJHD 2F1MA 3E6ZX 1D6EC 1JORA 1A3TA 5CBEE 4ABNA 5C4ZA 1WTVA 2A6ED 5IGCA 4X3KA 4CKBA 5JEAH 4IALA 3D31A 3VA5A 2D2CC 5J22A 4N9TA 1PRTF 4EVOA 2EYOA 3RD4A 3DHQA 3URYA 2F0FA 1H9MA 2KQ3A 3ONAB 4DK0A 4OO1H 3FKIB 5FKAC 1KNEA 4KKUA 2DNCA 4TKOB 1PZJD 3S1NB 2IX0A 4DXGA 1B50A 1X3PA 2B2UA 4RKLA 4CKCA 1EU3A 4IUQA 3D8GA 2YYZA 2MHVA 4KY6A 3JAME 2QDBA 5I6YA 1EFID 1SYGA 2OF1A 3CRLC 4KKTA 4G7ZC 1PZKD 3I8ZA 3NHHA 3VYSA 2EYFA 2MUYA 4F8MA 1O7ZA 3QOLA 1SYDA 1EQTA 5LL6X 1IYUA 3FVQA 2WINB 2NWGA 4OO1I 1HRJA 2F0NA 5IGDA 2O5JC 4MIUA 1CA5A 3C46A 3HZXA 3C2PA 5CR3A 1V1PB 1CA6A 4IUPA 3EVQA 3L3OC 5C3XA 1EL0A 5KRUA 2A69D 1QOHA 2WIIB 4IQZA 3GTGB 3TDQA 2A6EC 5KGUA 1BCPD 4BS9A 3A7LA 4H7BA 1IYVA 4L63B 1A2TA 1HFGA 4KY5A 1EEFD 5CV7A 1EZ6A 5KEEA 4RAUC 1G8ZD 1EWCA 4HR7B 2B8FA 1GOZA 4K2KA 3HOXB 3DM1A 1NAPA 3NWTA 5KYLA 1TY2A 4FNFA 2EJGC 3I91A 2A6HD 1XTCD 2NBFA 4IUUA 3A8KE 2Z4HA 4RCOA 3GTQB 3TZUA 1PZID 4BBRB 2EXZA 3S17B 1CQFA 3NQTA 3SR1A 1BOSA 1S5BD 5IGGA 1CHQD 3H91A 1LTID 2EYMA 1W6KA 4FF2A 5HURA 3BYTB 4PV1C 4HN7A 1I4RA 2NVTB 4KJNA 2KUMA 4NKLA 3I4LA 3SHLA 1QG7A 1ENCA 4F7XA 1EY5A 5CV6A 5KNCA 1Q3LA 3D4RA 1C4QA 3FMCA 1TQOA 2RDHA 4K8JA 1H9SB 2L9HA 2A69C 3A55A 4A3BB 1DJRD 1JC7A 2PMZB 3TP6A 4RKBA 1BCPC 4OGQC 1JOOA 1STYA 1SNCA 1AEXA 3EJIA 1TS5A 4KJOA 1IKMA 1OXXK 1CFMA 3IAYA 5K36G 1GJXA 1I50B 4UAIA 3QWNA 3KLSX 5KNBA 1RHPA 2F3VA 4DN4M 3MFYA 4C2MB 3VR4A 2ID0A 2A6HC 2AUJD 2MPMA 2NN6H 3UI2A 4A3FB 1DOMA 3ITPA 4RGNA 1EIHA 2JEAI 3A8JE 3R93A 5ELBA 4KN4C 1PTOF 5KNDA 3NP8A 3M4OB 2TSSA 3CHBD 2EY6A 1MGSA 5C4HA 1SYEA 3GTJB 5BN3A 5ELFA 2NN6I 1F9PA 3MVVA 4BA2I 1CTMA 5I9PA 3IFTA 1STNA 3S15B 1CQVA 1SMYD 2VB3X 1ET9A 3T16A 2EJMA 2E75C 1MD2D 2J4XA 4CHTB 1LTGD 2R61A 2XSCA 1TWHB 1TS3A 4Q5VA 1DONA 3OOCA 1A3VA 3BVGA 2WB1B 5I6WA 3D4DA 3IL8A 1EYAA 4LMQD 2B2YA 4XTCS 2R6GA 2PQEA 3MXUA 4R9WA 3WOEA 1EU4A 1F2MA 2D62A 2WV6D 1V8QA 1D2BA 1DXMA 4RH6A 1OXSC 1EQVA 3A54A 3C3LA 3KLSA 1STEA 1BUVT 5JVH3 1LT4D 2ICEC 2E2IB 5C3EB 2K1BA 4XYOA 3CU7A 5T1GA 1QNUA 1VMCA 1LO5D 2B8GA 2G9HD 1EIGA 1KDAA 3TMEA 1ENFA 2A5HA 3GV3A 5CGKA 5M5WB 1PFBA 1OXUA 3KF8A 4WJWA 1S5CD 4XT3B 2RBMA 4XQQA 1LTSD 1SE4A 2EE1A 3BYYB 3PIP3 2EY1A 2NTTA 1HA6A 2NYZD 3S14B 3GTMB 1F2ZA 4ZUIA 1BDOA 4WFN3 1E2ZA 2EYPA 4IZ8A 2K33A 1WCMB 1EY7A 3OIPA 1SYBA 1F2LA 4IN3A 2B2TA 3FPUB 4FF3A 1M8AA 4KK7A 5IODA 2Z1CA 4KHZA 1GUWA 1PFMA 1UAPA 1I4HA 1I6HB 5NUCA 3DXJC 1E0BA 4ZK9B 2ZXPA 1SNMA 1I6VC 1EYDA 3SDZA 1FGBD 4O42A 1PMRA 5IT9L 1I4PA 3K5NA 3VR3A 4HCEA 4J6HA 5BN5A 2FFKB 2LMCB 2EZVA 2F0TA 1AZQA 3H3VC 2J7ZA 4Y7NB 1KNAA 1F9RA 1Y1VB 3SVMA 2A68D 2VNUD 5G3LD 3K58A 1ENAA 3HGBA 1OO9B 4IUTA 4L8JA 2K5QA 2X6GA 3NQIA 4HSPA 4NW2A 3OW7A 3MXGA 4C3IB 2HUGA 4TQUS 2CW0D 2TMPA 4QUFA 2A74C 1RKNA 5CV8A 4RGTA 5JAVA 5EKLA 4K5VA 4CJ2C 1B44D 1R9TB 4FXKC 1CZWA 4KV6A 5EKKA 1Y69U 1FYCA 1RJTA 1SAPA 4XDXA 3GTPB 4IUVA 2BA1A 4HAEA 2HDMA 2HQEA 4C3JG 1W6JA 2ZXRA 3M85A 1D5ZC 1YNND 3PUYA 1GUGA 1TU2B 3DEPA 1EYCA 1VMPA 2FJ2A 3MHBA 4XT1B 3VR2A 5C0XH 3SE0A 1S4ZA 3A56A 2A68C 4IFDH 4EQPA 1K8OA 1KLGD 2K5WA 5HGTA 3K6OA 2F0HA 2PO4A 3FEWX 3H09A 3T51B 5M3MB 1D5XC 3GTLB 3D4WA 1JR0D 4LK1C 5JOBA 1GUTA 2B63B 1HHVA 1BCPF 3OWFA 2CW0C 5C0XI 3CQZB 3IKJA 1MBYA 2IX1A 2SEBD 1TY0A 4IFDI 3K5MA 4LAAA 1B1ZA 3MXNA 2BDNA 1BBXC 4KHVA 4RGOS 1WTWA 2K05A 5C5MA 1J8IA 4EGVA 2B2UC 3N6RA 5C3WA 4K6DA 2QF7A 1PYWD 2F0MA 1JQYD 1JOQA 1Y8NB 5IT9E 1YNNC 1JE4A 2IL8A 1M4VA 4RFBA 5CMDA 1UUPA 2PW5A 4G7HC 1NR2A 1DOLA 4QB4A 4C3HB 1NR4A 4TSSA 3DWAA 2F0JA 4U68A 4N9PA 2RQXA 2EJFC 1Y8PB 1B9MA 3FRPB 4A3MB 2XWJB 3RLFA 4RWSC 4B9XA 4V0BA 1ML0D 1G6ZA 4K6LA 5CYUA 2FMCA 3KBGA 4MN3A 4ZAIA 3AU7A 5DAUA 2BDOA 1DD2A 2LS01 1LLRD 2MGSA 4G57A 5E1FA 1UEAB 1TWGB 3QB3A 3RMHA 3M7GA 1EEID 3W2DA 1WTXA 2JXMB 2F0LA 1RTOA 1AW7A 2VXWA 4FYDA 2QCPX 2Z8LA 4GZYC 1Y1WB 2IPKD 2L0CA 3OMGA 3QJYA 1STGA 3KLRA 3J80L 4YIJA 1RTNA 1S5FD 2M00A 2F0VA 2OT2A 1LT3D 3U9OA 4NP5A 2KCNA 3G7LA 1ET6A 1TR5A 3T56B 4TRDA 4E6IA 4QCLA 2F0GA 4EQOA 3K59A 5CV5A 2SDFA 3SK5A 2JE6I 5FLXL 3HOYB 2H4OA 1AN8A 5TSSA 2KVMA 3W3AA 1OXVA 1D1KA 4FP5D 1SNPA 1NSNS 1D5MC 3J81L 5JJZA 1X32A 4A3JB 1JWSD 1BO0A 3KUPA 1Z7TA 3X3NA 4MHEA 2CVRA 3PUWA 4KI0A 1SE2A 3K7AB 5C5LA 4ZYSA 4FXGC 2KHSA 1MSHA 2B39A 4XIGS 1GXDC 3SK8A 1KLUD 3SEBA 4Q0FA 4LJZC 4ZKBB 2G9DA 3L9AX 4PMBA 1S5ED 5E3FA 1CT1D 1Q1BA 2F0DA 4A3DB 1U9RA 2N88A 1PTOH 2L12A 1QWYA 4O1NA 4ZUJA 1PLFA 3L7ZC 5F2DA 3M4YA 5FO8B 1VF7A 1QCBD 1ESFA 1HUMA 5ELDA 3BG3A 2XN9C 4BBSB 4J8QA 1RD9D 2EVBA 1OXTA 2WKDA 1PRTC 4KTAA 1I3QB 3LWUA 1TKWB 1RF2D 3OMCA 1H9RA 1Z6HA 3P75A 2E2JB 2EYJA 3PV0A 5D3DA 1A15A 3TP7A 5A2QL 2R92B 3AMUA 1ILQA 4G7OC 1L0XB 5IGEA 4HEDA 2RKSA 4ZKCB 2KA7A 3NTHA 4A93B 2AQ1B 5M3FB 4S3SA 2HDLA 4HTHA 1TWFB 4QMGA 1BF4A 5ISRA 3MA2B 4K8IA 1SNDA 1Q1EA 1PRTB 3GTKB 1JWMD 1B3AA 2B2YC 3NPPA 4PQXA 1G2TA 2E2HB 2QKIC 4CBVA 1D1IA 2RSOA 3HP3A 3TZDA 4ME5A 1SSOA 3ND8A 3VYUA 4BY1B 4CJ1B 3C1FA 3EA6A 3J80E 1CHPD 2I07B 3FDTA 3F2UA 1QNKA 2N55A 2XNAC 5C44B 1VF5C 4A3GB 2RDFA 4F87A 4R8NA 5G3LF 1F9SA 1DZ1A 4U673 5FLXE 2M9VA 4I7ZC 2B2VC 2I46A 2D9UA 1TS2A 3TP5A 3J81E 1XYIA 1ZEQX 4OO1G 3PIO3 1G291 1FNVA 2PZWA 5D3IB 3I72A 1O7YA 1EY8A 5EPLA 2SNSA 2AQ3B 2WACA 5C4JB 2Q8TA 4CJ0B 3Q24A 1A2UA 3P7JA 1CI3M 3HOUB 2F03A 2X6LA 3OSOA 2JP1A 3WDNA 2F0SA 5EPKA 3D6WA 1LTTD 2F0PA 2KEEA 2BA0A 1DCZA 2NVXB 4XQNA 4C56C 1G2SA 2F0UA 3BZDB 1ZKOA 3E0JA 3T4AC 3HS0C 4DAYA 5A2QE 2ENBA 4DFAA 3LWEA 2B2WC 1IKLA 1O78A 5LHY1 2Q8RE 2L1BA 2EOTA 1QE6A 5I9OA 3S9WA 3QOJA 4BY7B 4A3EB 1TT2A 2PZTA 4ID6A 5I2XA 1H9KA 3NTKA 4ZLTF 3DMUA 4H0LC 3TP8A 5JPMC 4C3IG 2IX3A 5K36H 1QJOA 5M5XB 3NK9A 1U4RA 1AFPA 1SYFA 1PDQA 2KEDA 5CORA 3QIAA 2BCOA 2QEJC 2E76C 1V1OA 4AYBB 3EQLC 2XRQD 2QILA 2NVYB 1HA5A 5J39A 1HPCA 1ICWA 1JICA 1PFNA 4XQJA 5FO9B 5EQ0A 2F0EA 2J0TD 3H0GB 5DM63 1PTOB 2CHBD 1Z47A 2F0OA 2ZT9C 3M3YB 3I73A 3Q0AA 1SDFA 2DY7A 2RVLA 2O4XA 2X69A 5ELCA 4WORA 2NVQB 3IFDA 4X3SA 2DN8A 2NN6G 3HKZB 4G4KA 1LT5D 4QF4A 1L0YB 2VUMB 1HUNA 2DNEA 1RODA 3R2TA 2AUKA 4CKEA 2BOSA 2NZ1D 1T5XD 4A3IB 3Q23A 2ZXOA 3NSWA 3BVMA 4QIWB 5I2YA 4KN7C 4P2CB 1YNJC 4RCNA 3NTIA 1ZYRD 3RZOB 1U4LA 3P1HA 1B9NA 3PUXA 1B2TA 1HCZA 3HOZB 5C4XB 3M7NA 1VDZA 4QUCA 1GUOA 4DA2A 1AZPA 5FK9C 1Y8OB 2RA4A 3BDOA 3Q6SA 1NUCA 4OIKA 3MZ5A 4B08A 3NBIA 3H94A 3BS1A 5ELEA 1DOKA 3HEJA 3MXPA 1EZ8A 1HQMC 2SOBA 1STBA 1HFNA 2LY7A 4FO2A 1B4OA 2E2DC 1EWHA 1XWEA 2KCCA 3TSSA 4PNYA 5IIFA 4C3HG 1RDPD 3H6MA 1V1PA 1WTPA 2WP8J 3AB9A 3DUZA 1SBBB 1GUNA 5M5YB 3KBXA 1VCIA 1PXUA 3NUCA 1DYQA 2PCFB 1ESRA 4V190 1XXGA 4OIJA 1G91A 2IJ0A 2PW7A 1F77A 2K7VA 3GQBA 4X3TA 2MP1A 3R3OA 4ZQ3A 5CC4A 1O80A 3R2IA 3I3CA 2K32A 4H44C 3K0YA 2KOLA 2IW3A 4ULLA 2M2LA 1J9OA 1TS4A 3EFXD 1ZYRC 3PMFA 4DAVA 5IGBA 1K8MA 3Q22A 5DNFA 1B53A 5JVG3 3S16B 5JPNC 5KIXA 3NBHA 5D14A 2IT1A 3EROA 1CM9A 4I65A 5KYIA 3R8BA 4F88A 1T5EA 2PZUA 1GHKA 2EYLA 1EOTA 3ERQA 1TVXA 2EPBA 2JA5B 2HCIA 2F0KA 1F9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOK A;  4LMQ D;  2B2Y A;  2B2W A;  2HDL A;  4MHE A;  4O42 A;  2CVR A;  2JP1 A;  2FHT A;  4UAI A;  1WTO A;  1HFN A;  4R9W A;  4RWS C;  5E4W C;  1B4O A;  1S4Z A;  1BF4 A;  4HCS A;  1ML0 D;  1HFG A;  1NCV A;  5CBE E;  1RHP A;  2K04 A;  1MSH A;  2B2V A;  4DN4 M;  1G6Z A;  1BNZ A;  5EPK A;  3D6W A;  1ICW A;  2FFK B;  1WTV A;  1JIC A;  1B3A A;  2B2Y C;  1PFN A;  3DEO A;  4RAU C;  4X3K A;  2KEE A;  5T1I A;  1AZQ A;  2J7Z A;  1G2T A;  3IL8 A;  5EQ0 A;  4MN3 A;  1KNA A;  1F9R A;  5EKI A;  4ZAI A;  3SVM A;  2DY8 A;  2B2T C;  2RSO A;  1X3Q A;  3HP3 A;  4ZKB B;  4RA8 A;  2MPM A;  3TZD A;  3I90 A;  1SSO A;  3DM1 A;  2R3Z A;  1WTP A;  1NAP A;  5D65 A;  3UI2 A;  1C8C A;  1G2S A;  4CJ1 B;  1DOM A;  4IUT A;  2K1B A;  1HHV A;  1WD0 A;  3KBX A;  2X6G A;  3I91 A;  1EIH A;  2MGS A;  5COY A;  3FDT A;  5T1G A;  2K01 A;  3R93 A;  4R8I A;  3F2U A;  1SDF A;  1VMC A;  4IUU A;  2DY7 A;  1QNK A;  2XIW A;  1ESR A;  1EIG A;  2RVL A;  4NW2 A;  2X69 A;  2N55 A;  2N88 A;  4OIJ A;  3ONA B;  1G91 A;  2HUG A;  1U4M A;  1KNE A;  3GV3 A;  3IFD A;  1PFB A;  2L12 A;  3LWE A;  2B2W C;  4X3T A;  1IKL A;  4X3S A;  4XT3 B;  1WTX A;  1B50 A;  1XX8 A;  2L4N A;  1F9S A;  1PLF A;  1X3P A;  2B2U A;  2BDN A;  2MP1 A;  1RTO A;  2Q8R E;  4QUF A;  2K28 A;  5E4X A;  1BBX C;  1DZ1 A;  4IUQ A;  1MGS A;  2L1B A;  1O80 A;  2EOT A;  2VXW A;  2FMM A;  1WVL A;  1HUN A;  2EE1 A;  2B2V C;  1WTQ A;  1ROD A;  1QE6 A;  3I3C A;  2D9U A;  1HUM A;  3H91 A;  5EJW A;  1WTW A;  2KOL A;  2K05 A;  1F9P A;  1HA6 A;  2NYZ D;  1J8I A;  1WD1 A;  1WTR A;  2M2L A;  1J9O A;  2K03 A;  2B2U C;  2H1E A;  2KEC A;  2NZ1 D;  3TN2 A;  3N52 A;  1RTN A;  1XYI A;  4CJ2 C;  4X3U A;  3I8Z A;  1MI2 A;  1O7Z A;  1EQT A;  1B53 A;  1A15 A;  1U4P A;  2KUM A;  5DNF A;  2NWG A;  3G7L A;  4ZLT F;  1RJT A;  1HRJ A;  4IUR A;  5AFW A;  5D14 A;  1SAP A;  1ILQ A;  5EPJ A;  1JE4 A;  4XDX A;  1QG7 A;  4IUV A;  2IL8 A;  5CBA E;  1U4L A;  1CM9 A;  1F2L A;  2SDF A;  4HAE A;  1CA5 A;  2B2T A;  5CMD A;  1Q3L A;  2HDM A;  3FPU B;  4HSV A;  1AP0 A;  1B2T A;  1EL0 A;  1M8A A;  1NR2 A;  1DOL A;  4HED A;  1O7Y A;  5EPL A;  1LV9 A;  1IL8 A;  4QUC A;  1NR4 A;  1AZP A;  1GUW A;  1PFM A;  2L9H A;  2KVM A;  4ZKC B;  1EOT A;  1ILP A;  2RA4 A;  3DEP A;  1DON A;  1VMP A;  2RSN A;  4IUP A;  1CA6 A;  1TVX A;  2EPB A;  3MWY W;  4U68 A;  1U4R A;  3Q6S A;  3MTS A;  1E0B A;  5JJZ A;  1X32 A;  2FJ2 A;  2Q8T A;  4CJ0 B;  4ZK9 B;  2HCC A;  1BO0 A;  2L11 A;  2FIN B;  3KUP A;  2HCI A;  4XT1 B;  4OIK A;  1ZXT A;  1MSG A;  2MJ8 A;  1PDQ A;  2JYO A;  2KED A;  3P7J A;  3QO2 A;  5COR A;  1IKM A;  3GV6 A;  2X6L A;  1F9Q A; 
#chains in the Genus database with same CATH topology
 1PRT D;  2F52 A;  1TWA H;  2C5C A;  4GN5 A;  3U4Z A;  1Y1V H;  4JI8 Q;  5E7N A;  2O5I C;  5E4W C;  4C1N I;  1XPU A;  4DV0 Q;  1J6Q A;  1JB3 A;  3HRZ C;  1E2W A;  4UDU C;  1C48 A;  1EY9 A;  1UEB A;  1B70 B;  2VQF Q;  3TBI B;  4RG1 A;  3GO5 A;  1R4Q B;  1CK1 A;  2Q8I B;  4H13 C;  4RGM A;  2NB0 A;  1H9S A;  1KQS A;  1C8C A;  3T1Y Q;  2ZTD A;  1UNS A;  4GNX C;  2L55 A;  1K73 C;  4P74 A;  4RHR A;  4JI0 L;  4JI7 L;  3S2H B;  4DGZ A;  4A3J G;  4L6T B;  4WJ3 M;  1YJ9 A;  4YWL A;  3T13 A;  3O13 A;  3CF5 A;  2E5L L;  2ZJP A;  1BR9 A;  3K57 A;  1QB5 D;  3MAQ A;  1QZG A;  3RN5 A;  3I70 A;  5FOB B;  1VQM A;  2QDL A;  4DXF A;  2JA6 B;  4B3R L;  1W2B A;  2L4N A;  3VYR A;  4A4I A;  4L5Q A;  1J5E Q;  2K28 A;  3H3V H;  2JA6 G;  1EY6 A;  1K3B C;  4DK1 A;  3RZD B;  1R9T H;  1KDC A;  3TRE A;  1QZH A;  2WKC A;  4C3J H;  1WTR A;  3KK7 A;  1YNX A;  5IOC A;  3EIV A;  5DM7 3;  3PO2 B;  2KEC A;  4IOA A;  3F2B A;  5J1Z A;  4A3D G;  1CZG A;  3TQY A;  4C1N K;  5A35 A;  2F0Q A;  2VB2 X;  4KD4 A;  3PO2 G;  3I4N B;  1HZ9 A;  4DUY L;  4O2D A;  2EYH A;  5EPJ A;  3BVZ A;  5C0X J;  1QIL A;  1EY0 A;  1U5K A;  3PUV A;  1SFO B;  3GP7 A;  3RNU A;  3RUZ A;  1FJG Q;  3I4N G;  2JK8 A;  1II3 A;  4RHS A;  3NXW A;  4IFD J;  1NE3 A;  2ALY B;  1GHJ A;  1F2Y A;  1KAW A;  4XYQ A;  2BE5 D;  1BKB A;  1LYL A;  3MTS A;  1EUJ A;  2AWN A;  3A5U A;  3PO3 H;  3CC4 A;  4ILW A;  1A3U A;  2JA7 B;  1B3Q A;  4KD3 A;  1FL0 A;  5M3M H;  2FHT A;  3KLW A;  3OWE B;  1A8V A;  4GOP C;  3E5S A;  2R92 G;  3GTL H;  4DU9 A;  4HCS A;  1K83 B;  1PYS B;  3V96 A;  2K04 A;  1PH2 A;  1SR3 A;  5T1I A;  1BCP B;  3DEO A;  1XJV A;  2I5L X;  2ICI A;  5EKI A;  1EWI A;  5JEA J;  4RA8 A;  2SNM A;  1EY4 A;  4JOI A;  3NWS A;  4XXE A;  5C0X G;  2KCM A;  4CGY B;  5EBD A;  2Z0S A;  5I4D A;  1WD0 A;  4BA1 I;  1YJN A;  2L5T A;  1KAB A;  3I4M B;  1VQB A;  3C1E A;  4A93 G;  4IFD G;  1N8R C;  2F3I A;  2ASB A;  3OPO A;  1SXT A;  2HD3 A;  1I4X A;  1LM0 A;  4HMI A;  3I4M G;  1YIT A;  4CDF C;  2Z6K A;  1KDB A;  1SLJ A;  1U4M A;  1YZ6 A;  2WAQ B;  1PH6 A;  1HTP A;  1A6X A;  2CCZ A;  4EQ5 A;  2IWH A;  2N49 A;  5CV4 A;  1H9J A;  2R7Z B;  2PQA A;  1HXY D;  2WAQ G;  4DAM A;  2CQA A;  3FKI H;  1V43 A;  1WTQ A;  4IJL A;  2R7Z G;  4GOP B;  2C9O A;  3A7A B;  5EJW A;  3S1N H;  1SE3 A;  1JE5 A;  1WD1 A;  4KY7 A;  1E2V A;  4BY1 G;  2K03 A;  1HQR D;  3TN2 A;  1PH4 A;  2JA8 B;  4YHH L;  4X3U A;  1MI2 A;  2EDG A;  2RDG A;  4DR4 L;  1AH9 A;  2YU9 B;  5JEA G;  4DNR B;  4LFB L;  2AWO A;  1IBK L;  2NUC A;  5CV9 A;  1DM0 B;  3V2T A;  1IW7 D;  1WTH A;  4LF9 L;  1LT6 D;  1BQQ T;  5FO7 B;  3D3R A;  2MFI A;  4B9W A;  2PNR C;  4A3G G;  1HTL D;  1LTB D;  2QA4 A;  4KKS A;  1AP0 A;  1IBM Q;  4DV6 Q;  4HSV A;  2BE5 C;  2OEO A;  4DNI A;  3LX0 A;  4DNT B;  3EN2 A;  5M9O A;  2EY5 A;  1IHZ A;  4J1M A;  3ZYY X;  3I2Z A;  1E1O A;  1IL8 A;  1LV9 A;  5FLM G;  3HOV B;  1T9H A;  4NDX A;  3MEH A;  1CSP A;  2LFN A;  3FPP A;  3JC6 6;  3VYT A;  1STH A;  2L11 A;  3NEM A;  4FF1 A;  4OHJ A;  3D0F A;  1MSG A;  2JYO A;  3QO2 A;  2GA4 B;  4KMU C;  3GV6 A;  1NMG A;  5EGT A;  1KTK A;  3S1Q B;  2B29 A;  3OIQ A;  1A62 A;  2F4I A;  3K5L A;  1WTO A;  4K5W A;  1IL2 A;  3QR8 A;  3ULL A;  4DR2 L;  1X3E A;  1FR3 A;  4PMC A;  4DR6 Q;  3D6C A;  1K0S A;  3CRK C;  2B2V A;  5HGQ A;  1BNZ A;  1N36 L;  3OTO Q;  1PTO D;  5DEH A;  3J7A F;  1XPO A;  4X6A H;  2OXP A;  3QG1 A;  2DY8 A;  1TWG H;  2B2T C;  1X3Q A;  4B3T Q;  1Y14 B;  4FVM A;  4PMW A;  4NXN L;  2R3Z A;  1E1T A;  5D65 A;  3CD6 A;  5IYC G;  4AQY Q;  1SE8 A;  3CKI B;  4LFC Q;  2I5M X;  1STA A;  5IYB H;  1SMY C;  2D5D A;  3GTO B;  2RCF A;  4N8F A;  3G4S A;  4FXD A;  1SJE D;  3HOU G;  1W3S A;  3HOX H;  1I4Q A;  2XVS A;  4DAP A;  3JAM c;  1LAB A;  1Y1W H;  1WJJ A;  1PVO A;  1XX8 A;  4N8X 1;  2PPB C;  3PUZ A;  1XNR L;  5C6A A;  3S1M B;  4FF4 A;  1YBY A;  4ZCK A;  2PYK A;  2R7D A;  1IW7 C;  4IO9 A;  2F3W A;  3N52 A;  2OQK A;  3VR6 A;  1Q8I A;  4YY3 L;  2R93 B;  2JSO A;  3HOY H;  2K5N A;  1JOK A;  1R4P B;  5LL6 S;  1I4G A;  4IUR A;  4UPA A;  5AFW A;  3W1B A;  4A3K B;  5GAD C;  1FD7 D;  1N34 Q;  2AKW B;  3V05 A;  2VQE L;  5AJ3 Q;  2UUB Q;  5K5P A;  1VQF A;  3S2D B;  1ONL A;  3JAM L;  4JK1 C;  4GKK L;  1ILP A;  2AQ2 B;  1LTR D;  1TWA B;  2UXB L;  3BDL A;  1Q12 A;  1KAA A;  3U4V A;  1Q46 A;  3K7A H;  3SK6 A;  3W5O A;  2HCC A;  4JG2 A;  4OWX B;  2VW9 A;  4JV5 L;  1ZXT A;  1SNQ A;  4Z9C B;  2D0O A;  4K2L A;  4ODG A;  4DAY B;  4DKA C;  2B2W A;  3X3M A;  5IP7 G;  1ASZ A;  1PTO C;  4QL5 A;  4DF7 A;  3OYY A;  3HOW B;  1RIP A;  1SNO A;  5EAY A;  1YNJ D;  3BDC A;  3K5O A;  3SXH A;  1XMO L;  1PV4 A;  2Y0S B;  1NCV A;  2KJX A;  3G6J B;  2HHH Q;  4A3D H;  1I50 H;  2E74 C;  1JCK B;  1FNU A;  1SEB D;  1FNW A;  1YHA A;  3P20 A;  5EBC A;  2Y0S G;  3A8I E;  4HJ9 A;  4IUN A;  3I90 A;  3VR5 A;  3T53 B;  3LNN A;  3VA7 A;  2UUC Q;  4K0K Q;  2F0W A;  2LKV A;  3SK4 A;  5COY A;  1VS0 A;  4R8I A;  2K01 A;  3S24 A;  2XIW A;  2OTL A;  2EY2 A;  3GD7 A;  5L37 A;  4A3F H;  3NE5 B;  3DWP A;  2UXD Q;  3J7Y W;  4ZRZ A;  4M8A A;  3K0X A;  1NBW A;  4AYB G;  1IXR A;  4BBS H;  3U9S A;  1V9P A;  4C3J B;  1GUS A;  3OHX C;  4NMZ A;  5E4X A;  3KF6 A;  4EQN A;  2NTS A;  2FMM A;  1PFS A;  1WVL A;  2E2J H;  2Z4I A;  1O7L A;  5IGF A;  2EQS A;  3ND9 A;  1CKO A;  1SYC A;  3M4O H;  1VQI A;  4BWG B;  2EXD A;  3I7F A;  2H1E A;  1HR0 Q;  4M1U B;  5DLQ E;  3WOF A;  1XNQ Q;  3GTJ H;  1LTA D;  4K14 A;  2XWB B;  1K8A C;  3CC7 A;  3DWQ A;  1BXT A;  4DV2 Q;  4JBW A;  1U4P A;  1S5D D;  1RCV D;  1N32 L;  1LAC A;  4ALP A;  3MFG A;  3ERS X;  4WRD A;  3KDF A;  1TWC B;  2A73 B;  4Y52 H;  5CBA E;  3S1R B;  4DV1 L;  2YTY A;  1Q90 A;  3HKZ G;  3CCQ A;  5LMU Q;  3MC0 B;  2XRS D;  3M4P A;  4HJA A;  3PO3 B;  5M3F H;  4K5X A;  2RSN A;  2K6A A;  3MWY W;  4OL7 A;  2FIN B;  5BN4 A;  2JEB I;  3J7A V;  2MJ8 A;  4HMJ A;  3HG9 A;  4A3I G;  4GN4 B;  1KL9 A;  4LFA L;  1TWH H;  2F0I A;  1TII D;  2O2L D;  1JWU D;  4LF7 Q;  2K5D A;  2E2H H;  2V4D A;  3K7U C;  1SJH D;  2F1M A;  3E6Z X;  1D6E C;  1JOR A;  1LTL A;  1A3T A;  3RLO A;  3EBE A;  5CBE E;  4JI2 L;  4LUV A;  4ABN A;  5C4Z A;  1WTV A;  2A6E D;  1VQN A;  4JI3 Q;  5IGC A;  4X3K A;  4DV7 L;  4OX9 Q;  4CKB A;  5JEA H;  4DV4 L;  5C4X G;  4IAL A;  3D31 A;  2ZTC A;  3VA5 A;  2D2C C;  5J22 A;  1JJG A;  4N9T A;  4H02 A;  1PRT F;  5IYD H;  4EVO A;  2EYO A;  5C44 H;  1UE1 A;  2QGQ A;  3RD4 A;  3DHQ A;  1HNZ Q;  3URY A;  2F0F A;  4LF8 L;  3A74 A;  1H9M A;  2KQ3 A;  1PA6 A;  4JC0 A;  3ONA B;  4DK0 A;  2E2I H;  4OO1 H;  3FKI B;  5FKA C;  1KNE A;  4KKU A;  2DNC A;  4DV3 L;  4TKO B;  1PZJ D;  3S1N B;  5FJ8 H;  2IX0 A;  4DXG A;  2RCN A;  1B50 A;  1X3P A;  2B2U A;  4R4I A;  4RKL A;  4CKC A;  1EU3 A;  4IUQ A;  1Q86 C;  3D8G A;  1A0I A;  2YYZ A;  2MHV A;  4UY8 C;  4KY6 A;  5M5W H;  1ICF B;  3JAM E;  1ASY A;  2QDB A;  5I6Y A;  1EFI D;  1SYG A;  3E3X A;  2OF1 A;  3CRL C;  4KKT A;  4G7Z C;  2QW7 A;  1VQK A;  3BU2 A;  1PZK D;  3I8Z A;  4P72 A;  1PH1 A;  3NHH A;  3VYS A;  2EYF A;  2MUY A;  1HJP A;  4F8M A;  1O7Z A;  3QOL A;  1SYD A;  1EQT A;  5LL6 X;  1BVS A;  1IYU A;  3FVQ A;  2WIN B;  4AYB E;  2NWG A;  5JJI A;  4OO1 I;  3FP9 A;  1HRJ A;  2F0N A;  1PHJ A;  5IGD A;  2O5J C;  4MIU A;  1CA5 A;  3C46 A;  1X9N A;  1FVI A;  3MEF A;  3HZX A;  4I7A A;  3C2P A;  3HOU H;  5CR3 A;  2CWA A;  1V1P B;  1WCM H;  2KCT A;  4B3M L;  5GAE C;  1QUQ A;  2UU9 Q;  1CA6 A;  4IUP A;  3CC2 A;  3EVQ A;  3L3O C;  5C3X A;  1EL0 A;  4YWK A;  1I94 Q;  2KEN A;  1J5E L;  5KRU A;  2A69 D;  1QOH A;  2WII B;  2DGY A;  4IQZ A;  3GTG B;  3TDQ A;  2A6E C;  5KGU A;  1I6H H;  1FGU A;  1VQH A;  1BCP D;  4BS9 A;  3A7L A;  4H7B A;  2NVX H;  1IYV A;  4JYA Q;  4L63 B;  1A2T A;  1HFG A;  1V1Q A;  4KY5 A;  1X56 A;  3HKZ E;  1EEF D;  2K50 A;  5CV7 A;  1EZ6 A;  1PH8 A;  5KEE A;  4RAU C;  1G8Z D;  1EWC A;  4HR7 B;  2B8F A;  1GOZ A;  4K2K A;  3HOX B;  3DM1 A;  1IBL L;  1NAP A;  3NWT A;  5KYL A;  2N3S A;  1TY2 A;  4FNF A;  1VQJ A;  2EJG C;  4A3C H;  2JA5 G;  3I91 A;  4Y7N H;  1FJG L;  4QIW E;  2A6H D;  1XTC D;  2NBF A;  4IUU A;  3CPF A;  3A8K E;  4KLK A;  2Z4H A;  4RCO A;  3ER0 A;  3GTQ B;  3NBH B;  3TZU A;  1PZI D;  2Q2H A;  1AE2 A;  3PQI A;  4BBR B;  2EXZ A;  1KXL A;  4P73 A;  3S17 B;  1CQF A;  3CCE A;  4X65 Q;  3NQT A;  3E0E A;  3SR1 A;  1BOS A;  4BY7 H;  1S5B D;  1KC8 C;  1VQ8 A;  5IWA L;  1P8L A;  4C3I H;  4BBR G;  4A3E H;  5IGG A;  1CHQ D;  2E8G A;  3H91 A;  1LTI D;  1MJE A;  2EYM A;  1UWV A;  1W6K A;  1VQP A;  4FF2 A;  4JVZ A;  5HUR A;  3BYT B;  3J81 i;  4PV1 C;  4HN7 A;  1I4R A;  2NVT B;  4KJN A;  2KUM A;  4JCV E;  4EX5 A;  2UUA Q;  3H15 A;  4NKL A;  3I4L A;  3SHL A;  1QG7 A;  1X55 A;  1ENC A;  4F7X A;  1EY5 A;  5CV6 A;  5KNC A;  1Q3L A;  3D4R A;  1C4Q A;  1PH9 A;  3FMC A;  1TQO A;  4HIK A;  2RDH A;  4X64 Q;  3F8T A;  4K8J A;  4GNX A;  1H9S B;  4TVA B;  2L9H A;  3GTP H;  2A69 C;  3A55 A;  2A1A A;  4A3B B;  1DJR D;  1JC7 A;  2PMZ B;  3TP6 A;  4RKB A;  1BCP C;  4OGQ C;  1QVC A;  1JOO A;  1STY A;  1SNC A;  1AEX A;  3EJI A;  1TS5 A;  4KJO A;  4A3B G;  1OXX K;  1UE6 A;  1IKM A;  1P16 A;  1CFM A;  3CCS A;  3IAY A;  5K36 G;  1GJX A;  1I50 B;  4OWT B;  1QVF A;  4LF5 L;  1X65 A;  3J81 j;  4UAI A;  3HKS A;  3CMA A;  3QWN A;  3KLS X;  3H0G H;  5KNB A;  3H3V I;  1RHP A;  2F3V A;  4DN4 M;  2K14 A;  3MFY A;  4C2M B;  3GDE A;  2B3G A;  4OON A;  3VR4 A;  2ID0 A;  2VL6 A;  2UXC L;  4BXX G;  2A6H C;  4QQB X;  3TEH B;  1HZC A;  3AFQ A;  2AUJ D;  2MPM A;  4LUZ A;  2NN6 H;  3UI2 A;  4A3F B;  2NVQ H;  1DOM A;  3ITP A;  4HJ7 A;  1GO3 E;  4RGN A;  1EIH A;  2JEA I;  3PGZ A;  3A8J E;  3R93 A;  5ELB A;  2JA7 G;  4KN4 C;  2VUM H;  4JOI C;  4LF6 L;  1PTO F;  2B63 H;  3PF4 A;  1XMQ L;  4YCU A;  5KND A;  3NP8 A;  3M4O B;  4PG3 A;  2TSS A;  3CHB D;  2EY6 A;  3CQZ H;  1MGS A;  5C4H A;  4JI7 Q;  1SYE A;  3GTJ B;  4JI0 Q;  4POG A;  1N33 L;  2GVA A;  5ELF A;  5BN3 A;  2NN6 I;  1F9P A;  3MVV A;  1VQ4 A;  4DR6 L;  4BA2 I;  3RZO H;  1CTM A;  5I9P A;  3IFT A;  1STN A;  4JPB W;  4P71 A;  1XTD A;  2I5H A;  3S15 B;  4X66 Q;  4KHP Q;  2H5X A;  3HOZ H;  4B3R Q;  1CQV A;  1SMY D;  2VB3 X;  4B3T L;  1ET9 A;  2CH4 W;  3T16 A;  2EJM A;  3BJU A;  4AQY L;  4LFC L;  2DJF C;  2E75 C;  1MD2 D;  2J4X A;  1VQC A;  3STB D;  4CHT B;  4GLX A;  1LTG D;  2R61 A;  2XSC A;  2MQH A;  4JI1 Q;  1TWH B;  1TS3 A;  4Q5V A;  4YCV A;  1DON A;  3OOC A;  2JJQ A;  1VQ7 A;  1A3V A;  3RR5 A;  1CKN A;  3ULP A;  4JBJ A;  3BVG A;  2WB1 B;  4DUY Q;  1VQ9 A;  2JA8 G;  4C3H H;  5I6W A;  3D4D A;  3IL8 A;  1EYA A;  4LMQ D;  2B2Y A;  4XTC S;  4APV A;  2R6G A;  2PQE A;  1GKH A;  3MXU A;  4R9W A;  3WOE A;  1EU4 A;  1F2M A;  1E24 A;  1IYJ B;  1YHB A;  2D62 A;  2PQA B;  2JQO A;  2WV6 D;  1V8Q A;  4A3M H;  1D2B A;  1K3R A;  1DXM A;  4RH6 A;  2V1C C;  1OXS C;  1EQV A;  2C35 B;  3A54 A;  3C3L A;  3KLS A;  1STE A;  2MO0 A;  3HOV G;  1BUV T;  5JVH 3;  1LT4 D;  2ICE C;  2E2I B;  4IPG A;  2K1B A;  5C3E B;  4XYO A;  3W1G A;  1N34 L;  2UUB L;  3CU7 A;  5T1G A;  4IPC A;  1QNU A;  1VMC A;  1LO5 D;  3KYH C;  3E9H A;  2LSS A;  2B8G A;  2G9H D;  1VQL A;  1EIG A;  5C3E G;  1KDA A;  3PF5 A;  3TME A;  1ENF A;  2A5H A;  3GV3 A;  5CGK A;  5M5W B;  1PFB A;  1OXU A;  1X6O A;  3KF8 A;  4WJW A;  1S5C D;  4XT3 B;  4DR1 Q;  1PH5 A;  2RBM A;  4XQQ A;  4QY7 A;  1LTS D;  1SE4 A;  2EE1 A;  4R4T A;  3BYY B;  3PIP 3;  2EY1 A;  2NTT A;  3S16 H;  1HA6 A;  2NYZ D;  1GVP A;  3GTM B;  3S14 B;  1F2Z A;  4X62 Q;  4ZUI A;  1BDO A;  1EQR A;  4WFN 3;  1HZA A;  2HHH L;  2LXJ A;  4A3L H;  1E2Z A;  2EYP A;  2FXQ A;  4IZ8 A;  3STB C;  2Q2T A;  2ZTE A;  1MKH A;  2K33 A;  4IPH A;  1WCM B;  1WFQ A;  2NZH A;  1EY7 A;  3OIP A;  4K0K L;  4QJF A;  1SYB A;  1F2L A;  4IN3 A;  4J15 A;  2JA5 H;  2B2T A;  3FPU B;  4FF3 A;  2F4V L;  1M8A A;  4KK7 A;  5IOD A;  2Z1C A;  4KHZ A;  3UDI A;  1GUW A;  1PFM A;  4YHH Q;  1UAP A;  3CCM A;  1I4H A;  1I6H B;  5NUC A;  4LFB Q;  3DXJ C;  3CME A;  2AMC B;  1E0B A;  4ZK9 B;  2ZXP A;  4LF9 Q;  1SNM A;  1N9W A;  1I6V C;  1EYD A;  1YVC A;  3SDZ A;  2R93 G;  1FGB D;  4O42 A;  5IP9 G;  2WAQ E;  4LF4 Q;  1PMR A;  4A3J H;  5IT9 L;  1I4P A;  3K5N A;  1HR0 L;  3VR3 A;  2N8N A;  4HCE A;  1MHW C;  4A3K G;  4J6H A;  5BN5 A;  2FFK B;  5IE8 A;  3S2H H;  2LMC B;  2EZV A;  2F0T A;  1AZQ A;  3U50 C;  2J7Z A;  4Y7N B;  4DUZ L;  2HIX A;  4DV2 L;  3H3V C;  1KNA A;  1F9R A;  1Y1V B;  3SVM A;  3CPW A;  1HNX L;  2A68 D;  2VNU D;  1PH3 A;  1BBW A;  5G3L D;  3K58 A;  1ENA A;  3HGB A;  1OO9 B;  2N78 A;  4R4C A;  4IUT A;  4DR3 L;  4L8J A;  2K5Q A;  2JA6 H;  2X6G A;  3NQI A;  4DR2 Q;  4HSP A;  1Q8K A;  4UP9 A;  2ATW A;  4NW2 A;  3OW7 A;  3MXG A;  1IZ6 A;  1N36 Q;  3RZD H;  4C3I B;  2HUG A;  5LMN L;  4TQU S;  3HOW G;  2EIF A;  4LWC A;  4OWW B;  2CW0 D;  2D0P A;  4LW1 A;  4DR5 L;  4R4Q A;  1VQE A;  2TMP A;  4NXN Q;  3PO2 H;  4QUF A;  2A74 C;  1RKN A;  5CV8 A;  2OCE A;  4RGT A;  5JAV A;  3BZC A;  3I4N H;  2K5H A;  5EKL A;  4K5V A;  2OWO A;  1HZB A;  2VZA A;  4CJ2 C;  1B44 D;  4L5R C;  2ZM6 L;  1R9T B;  4BXX H;  4FXK C;  1CZW A;  4DR7 Q;  4YCW A;  4KV6 A;  5EKK A;  1Y69 U;  1S72 A;  1FYC A;  1RJT A;  4HID A;  5GAG C;  1SAP A;  1XNR Q;  1I3Q H;  4XDX A;  3GTP B;  4IUV A;  3HFZ B;  2BA1 A;  4HAE A;  1K0R A;  2HDM A;  2HQE A;  4IPD A;  4C3J G;  3A0J A;  1W6J A;  2ZXR A;  4R4O A;  3M85 A;  2R92 H;  2JA7 H;  1D5Z C;  1YNN D;  1C9O A;  3PUY A;  1GUG A;  1TU2 B;  4B3S Q;  3DEP A;  1EYC A;  3CCJ A;  1VMP A;  1VQG A;  3U58 A;  2FJ2 A;  3MHB A;  4XT1 B;  4POF A;  2BH8 A;  4DV5 L;  3VR2 A;  5C0X H;  2CKZ B;  3SE0 A;  3M9B A;  4JI4 Q;  1S4Z A;  3NEN A;  1HNW L;  3A56 A;  4A93 H;  2A68 C;  4IFD H;  4EQP A;  1YI2 A;  1K8O A;  1KLG D;  2K5W A;  5HGT A;  4GKK Q;  3K6O A;  3KF6 B;  2UXB Q;  3CAM A;  2F0H A;  3I4M H;  1TWF H;  2PO4 A;  3FEW X;  3H09 A;  3T51 B;  5M3M B;  1D5X C;  3PO3 G;  3AEV A;  3GTL B;  3D4W A;  1JR0 D;  4LK1 C;  1L1O A;  3GTK H;  5JOB A;  1GUT A;  2B63 B;  1C0A A;  1BCP F;  1HHV A;  1YHQ A;  3OWF A;  2R7Z H;  3FHW A;  3IRB A;  2CW0 C;  1XMO Q;  5C0X I;  2NZO A;  2MNA A;  3CQZ B;  3IKJ A;  4BY1 H;  3KDF B;  1MBY A;  2IX1 A;  2SEB D;  1TY0 A;  1L2F A;  2RHS B;  3K5M A;  4IFD I;  4LAA A;  1B1Z A;  2K52 A;  3MXN A;  2BDN A;  1BBX C;  1DGS A;  2YU9 H;  3T1H Q;  4A3G H;  4KHV A;  4RGO S;  1WTW A;  2K05 A;  5C5M A;  1J8I A;  4JYA L;  4EGV A;  4JI6 L;  2B2U C;  3N6R A;  5HY6 A;  5C3W A;  5FLM H;  4K6D A;  2QF7 A;  4NB3 A;  1PYW D;  2F0M A;  1JQY D;  1JOQ A;  1Y8N B;  2Y0S E;  5IT9 E;  3L0O A;  1YNN C;  1JE4 A;  3FKI G;  2IL8 A;  1M4V A;  4RFB A;  5CMD A;  1UUP A;  1GD7 A;  2PW5 A;  4JI8 L;  4CDE C;  5LMN W;  1NR2 A;  4G7H C;  5ELN A;  1DOL A;  4QB4 A;  4DV0 L;  4C3H B;  1NR4 A;  3RN2 A;  3J7Z C;  4TSS A;  3DWA A;  5GQO A;  2F0J A;  3KOJ A;  4U68 A;  2VQF L;  3I4O A;  1N32 Q;  4N9P A;  2RQX A;  2EJF C;  1Y8P B;  1B9M A;  3FRP B;  3T1Y L;  5IYC H;  2GN5 A;  4A3M B;  2XWJ B;  4DV1 Q;  3RLF A;  5C4J H;  1SN8 A;  1O7I A;  4RWS C;  1XPR A;  4B9X A;  1K8G A;  4V0B A;  3Q8D A;  1ML0 D;  3ZJY C;  1G6Z A;  4K6L A;  4UHV A;  1WOC A;  5CYU A;  2FMC A;  3KBG A;  4MN3 A;  4ZAI A;  4NXM Q;  3AU7 A;  2YTV A;  5DAU A;  2BDO A;  4NPS A;  1DD2 A;  2LS0 1;  1LLR D;  2MGS A;  4G57 A;  3PIP A;  5E1F A;  2K5V A;  5GRO A;  1UEA B;  1TWG B;  4PZ6 A;  4JI2 Q;  2KHI A;  3S1M H;  3QB3 A;  4DPG A;  3RMH A;  3M7G A;  1EEI D;  4DV4 Q;  3W2D A;  1WTX A;  2PI2 E;  3J81 c;  2JXM B;  2F0L A;  1RTO A;  1AW7 A;  4GKJ Q;  2VXW A;  4FYD A;  1QUQ B;  2QCP X;  1YJW A;  5IYB G;  5IP9 H;  2Z8L A;  3K81 C;  4GZY C;  4WJ4 A;  1Y1W B;  2IPK D;  3K80 C;  2L0C A;  3HOX G;  3OMG A;  2PNH A;  3J80 i;  2L15 A;  3QJY A;  1STG A;  3KLR A;  3J80 L;  4OXP A;  4YIJ A;  4A3K H;  1RTN A;  1S5F D;  2M00 A;  2F0V A;  4DK6 C;  3CW2 C;  2OT2 A;  4DV3 Q;  3KJO A;  1LT3 D;  3U9O A;  4GS3 A;  1WYD A;  4MZ9 A;  4NP5 A;  2KCN A;  3G7L A;  2CH4 A;  1ET6 A;  1TR5 A;  3T56 B;  4TRD A;  4E6I A;  4QCL A;  3AYH B;  2F0G A;  4EQO A;  3K59 A;  5CV5 A;  3KJP A;  2SDF A;  3SK5 A;  5IP7 H;  3KFU A;  5BR8 Q;  2JE6 I;  3M4Q A;  5FLX L;  1RL2 A;  1M1K C;  3PSI A;  3HOY B;  2H4O A;  1AN8 A;  5TSS A;  2KVM A;  3W3A A;  1OXV A;  1D1K A;  4FP5 D;  3UDF A;  1SNP A;  3HOW H;  1NSN S;  1D5M C;  3J81 L;  5JJZ A;  3CCR A;  1X32 A;  4A3J B;  3HOY G;  1JWS D;  1BO0 A;  3KUP A;  5M5X H;  1Z7T A;  3X3N A;  4IJH A;  2CFM A;  4MTN A;  1VQO A;  4JI5 Q;  2IY5 B;  3I55 A;  4MHE A;  2CVR A;  3PUW A;  4KI0 A;  1SE2 A;  3K7A B;  5C5L A;  4ZYS A;  3CCL A;  3UE0 A;  4FXG C;  2KHS A;  1QVG A;  4B3M Q;  1MSH A;  2B39 A;  4XIG S;  1GXD C;  3SK8 A;  1KLU D;  3SEB A;  1X3G A;  4X66 L;  4KHP L;  4Q0F A;  1Q81 C;  4LJZ C;  4ZKB B;  2G9D A;  2ES2 A;  3L9A X;  2NVY H;  4PZ7 A;  4PMB A;  4JBK A;  1S5E D;  1VQA A;  1CT1 D;  5E3F A;  5J3B A;  1Q1B A;  2F0D A;  1UE7 A;  1PYB A;  4A3D B;  1U9R A;  2I0Q A;  3LGJ A;  1E3P A;  4AH6 A;  4JI1 L;  2N88 A;  1TXY A;  2DUD A;  1PTO H;  3L2P A;  1NY4 A;  2L12 A;  3M3Y H;  1QWY A;  4O1N A;  1B8A A;  1X3F A;  1PLF A;  3L7Z C;  4ZUJ A;  5F2D A;  4QGU A;  1IBL Q;  5ELO A;  3M4Y A;  4GNX B;  5FO8 B;  1VF7 A;  1QCB D;  4HIO A;  1PH7 A;  1ESF A;  1HUM A;  5ELD A;  2VS1 A;  3BG3 A;  1IBM L;  2XN9 C;  4DV6 L;  4BBS B;  2Q2U A;  2WFW A;  1TWC H;  4A3F G;  2HQL A;  4J8Q A;  1RD9 D;  2EVB A;  1OXT A;  4GN3 B;  1PRT C;  2WKD A;  1I3Q B;  4KTA A;  3LWU A;  3S1R H;  1TKW B;  1RF2 D;  3OMC A;  1H9R A;  1Z6H A;  4BBS G;  3P75 A;  2E2J B;  1VQD A;  2EYJ A;  3PV0 A;  5D3D A;  2LXK A;  1A15 A;  3TP7 A;  5A2Q L;  2R92 B;  3BZK A;  5H1S E;  3AMU A;  4A3I H;  1OTC A;  1ILQ A;  5IWA Q;  1G6P A;  4G7O C;  1L0X B;  5IGE A;  2Z6K C;  1G51 A;  4HED A;  2E5L Q;  1SRU A;  2RKS A;  1KIX A;  4ZKC B;  3OTO L;  2KA7 A;  1VQ6 A;  4GOP A;  2ZJQ A;  5C4X H;  4DR1 L;  3NTH A;  4A93 B;  1L0W A;  2AQ1 B;  3F2C A;  5M3F B;  1YIJ A;  4S3S A;  2HDL A;  4HTH A;  1TWF B;  2OQ0 A;  4QMG A;  3A5Z B;  1BF4 A;  5ISR A;  3MA2 B;  4K8I A;  1MJC A;  4X62 L;  5M3F G;  1MIU A;  1Q1E A;  1SND A;  1PRT B;  3GTK B;  3RLN A;  1JWM D;  1B3A A;  1SRO A;  2B2Y C;  3NPP A;  4PQX A;  1G2T A;  2E2H B;  2QKI C;  4CBV A;  1D1I A;  2RSO A;  3HP3 A;  3TZD A;  4ME5 A;  1SSO A;  3F1Z A;  3ND8 A;  3VYU A;  4BY1 B;  4CJ1 B;  1CSQ A;  3C1F A;  4LF5 Q;  3EA6 A;  3J80 E;  1CHP D;  1EYG A;  4LUO A;  2I07 B;  3FDT A;  2WB1 G;  4HJ8 A;  1U0L A;  3F2U A;  1QNK A;  1CUK A;  1H95 A;  2N55 A;  2XNA C;  5M5Y H;  2UXC Q;  5C44 B;  1VF5 C;  4A3G B;  2RDF A;  4F87 A;  4R8N A;  5G3L F;  1F9S A;  1DZ1 A;  4U67 3;  5IYD G;  5FLX E;  2M9V A;  4R1J A;  4I7Z C;  3CP0 A;  5C44 G;  1AE3 A;  2B2V C;  4UP7 A;  2G5D A;  2I46 A;  2D9U A;  4L5T A;  2PMZ E;  1TS2 A;  3DLL A;  4LF4 L;  1CKN B;  3TP5 A;  5AJ3 L;  1EIY B;  2K4K A;  3CCV A;  3J81 E;  1A63 A;  1XYI A;  1ZEQ X;  4LF6 Q;  3PIO 3;  4OO1 G;  1XMQ Q;  1G29 1;  1D8L A;  5FJ8 G;  1FNV A;  2PZW A;  3VDY A;  5JJL A;  3ICE A;  5D3I B;  4CDC C;  2MO1 A;  2ZJR A;  2RF4 A;  3I72 A;  1D7Q A;  1BBU A;  1N33 Q;  1O7Y A;  1EY8 A;  5EPL A;  5IT9 c;  2SNS A;  2AQ3 B;  3GTG H;  2WAC A;  3PCO B;  3F2D A;  5C4J B;  2Q8T A;  4CJ0 B;  1EOV A;  2YTX A;  3Q24 A;  2K75 A;  4JW0 A;  1A2U A;  3P7J A;  1CI3 M;  3G6E A;  3HOU B;  2F03 A;  4HJ5 A;  2X6L A;  3OSO A;  2UUC L;  2JP1 A;  1JT8 A;  3E9I A;  3KF8 B;  3WDN A;  2F0S A;  1WCM G;  2AHO B;  5EPK A;  3D6W A;  1LTT D;  3UDX A;  2UXD L;  2F0P A;  2KEE A;  4DR4 Q;  2BA0 A;  1Z9F A;  4DR7 L;  1IBK Q;  1DCZ A;  3GTQ H;  2NVX B;  4XQN A;  1C7Y A;  4C56 C;  1G2S A;  2F0U A;  3TS2 A;  3BZD B;  1ZKO A;  5JJK A;  4BBR H;  3S17 H;  3E0J A;  1WI5 A;  3T4A C;  3HS0 C;  4DAY A;  4B3S L;  5A2Q E;  1XNQ L;  2ENB A;  1K9M C;  4DFA A;  2KBN A;  2B2W C;  3LWE A;  1IKL A;  1O78 A;  2Q2I A;  5LHY 1;  2Q8R E;  3CCU A;  2L1B A;  2EOT A;  4A3C G;  1QE6 A;  2NVT H;  1Y1V G;  4JI4 L;  5I9O A;  3S9W A;  3JAM i;  3WWV A;  5LMU L;  2WB1 E;  1Q7Y C;  3QOJ A;  2JA9 A;  4DK3 C;  1UE5 A;  4BY7 B;  4RMF A;  4A3E B;  1TT2 A;  2PZT A;  4ID6 A;  5I2X A;  1H9K A;  2HIV A;  3NTK A;  1KHI A;  3ULJ A;  4ZLT F;  1GM5 A;  4BY7 G;  3DMU A;  4H0L C;  3TP8 A;  5JPM C;  4C3I G;  2IX3 A;  4A3E G;  4A3B H;  5K36 H;  2XGT A;  4LF7 L;  1QJO A;  3UE1 A;  3OW2 A;  4LNQ A;  5M5X B;  1B7Y B;  2A19 A;  2JN4 A;  3NK9 A;  4JI3 L;  1SFO H;  1U4R A;  4OX9 L;  4UP8 A;  1AFP A;  1SYF A;  1PDQ A;  2KED A;  5COR A;  4C2M H;  4P75 A;  4PZ8 A;  1SMX A;  3QIA A;  4FDB A;  2BCO A;  2QEJ C;  2E76 C;  3T1H L;  1NJI C;  2F4V Q;  3CXC A;  1HNZ L;  1V1O A;  4AYB B;  3EQL C;  2XRQ D;  2QIL A;  1KD1 C;  3G48 A;  2NVY B;  1JJ2 A;  1HA5 A;  5GAH C;  5J39 A;  1HPC A;  1ICW A;  1JIC A;  1PFN A;  1E22 A;  4YY3 Q;  1JMC A;  4XQJ A;  2PI2 A;  5FO9 B;  5EQ0 A;  3AFP A;  2F0E A;  2J0T D;  1K83 H;  1CKM A;  3H0G B;  5DM6 3;  1VQ5 A;  1PTO B;  2CQO A;  2CHB D;  1Z47 A;  2F0O A;  2ZT9 C;  3M3Y B;  3I73 A;  2VQE Q;  3Q0A A;  3H0G G;  1SDF A;  2DY7 A;  2RVL A;  2O4X A;  2X69 A;  4MTK A;  3G71 A;  5ELC A;  4WOR A;  1L1O C;  2NVQ B;  2RHQ B;  3IFD A;  4DUZ Q;  4X3S A;  2XTI A;  1HNX Q;  2BH2 A;  2DN8 A;  2IHE A;  4JV5 Q;  2NN6 G;  3HKZ B;  1S40 A;  4G4K A;  2GVB A;  1LT5 D;  4QF4 A;  1L0Y B;  2VUM B;  1I5F A;  1YEZ A;  4MNO A;  3S15 H;  2DNE A;  4DR3 Q;  2IHF A;  1HUN A;  5M3M G;  1ROD A;  1NNX A;  2Z9H A;  3R2T A;  1EIF A;  2AUK A;  4CKE A;  1EQQ A;  2VUM G;  2BOS A;  1KRT A;  2NZ1 D;  1T5X D;  4A3I B;  2B63 G;  3Q23 A;  2ZXO A;  3NSW A;  2UU9 L;  5LMN Q;  3BVM A;  4QIW B;  1NTG A;  5I2Y A;  1X54 A;  4KN7 C;  4DR5 Q;  4NXM L;  4P2C B;  1YNJ C;  4ME3 A;  4RCN A;  1I94 L;  3NTI A;  1ZYR D;  2JA8 H;  3RZO B;  3B6Y A;  1HR0 W;  1KRS A;  1U4L A;  3TS0 A;  3P1H A;  1B9N A;  2KHJ A;  3PUX A;  1B2T A;  1HCZ A;  3HOZ B;  5C4X B;  4GLA C;  3M7N A;  1VDZ A;  4QUC A;  1GUO A;  4DA2 A;  1AZP A;  1L1O B;  1JJC B;  5FK9 C;  3NEL A;  1Y8O B;  2RA4 A;  3BDO A;  3HOZ G;  2ZM6 Q;  3Q6S A;  4GLV B;  1NUC A;  4OIK A;  3MZ5 A;  3K8A A;  4HIM A;  4B08 A;  3NBI A;  3H94 A;  3BS1 A;  5ELE A;  4JBM A;  3HOV H;  4GKJ L;  1DOK A;  3HEJ A;  3MXP A;  1EZ8 A;  3J7A 5;  1HQM C;  2SOB A;  1STB A;  1HFN A;  2LY7 A;  4FO2 A;  1B4O A;  4YWM A;  3MXN B;  1EFW A;  5C3E H;  2E2D C;  1E7Z A;  1EWH A;  1XWE A;  3S1Q H;  2KCC A;  4AIM A;  3TSS A;  4PNY A;  3I56 A;  1RDP D;  3H6M A;  4C3H G;  5IIF A;  4X65 L;  1V1P A;  1WTP A;  2WP8 J;  4DV5 Q;  3AB9 A;  3DUZ A;  3AQQ A;  1SBB B;  1GUN A;  5M5Y B;  3KBX A;  1VCI A;  1PXU A;  5BR8 L;  1HNW Q;  3NUC A;  1DYQ A;  2PCF B;  1ESR A;  1JB7 A;  4CDD C;  4V19 0;  1XXG A;  1HH2 P;  3SGI A;  4OIJ A;  4A3M G;  1G91 A;  2Z6B A;  3J80 c;  2IJ0 A;  2PW7 A;  1F77 A;  3PIO A;  2K7V A;  3GQB A;  4X3T A;  2DJG C;  3S14 H;  3GTM H;  3GTO H;  5IY0 A;  2MP1 A;  2R7F A;  3R3O A;  4ZQ3 A;  4JI5 L;  2UUA L;  5CC4 A;  2OTJ A;  4LFA Q;  1O80 A;  4A75 A;  3R2I A;  3I3C A;  1K28 A;  2K32 A;  4H44 C;  1Q82 C;  3K0Y A;  2QEX A;  3DM3 A;  2KOL A;  2CWP A;  2IW3 A;  1S3O A;  4ULL A;  2M2L A;  1J9O A;  4X64 L;  5FLX c;  1TS4 A;  4L5S A;  3EFX D;  1ZYR C;  3PMF A;  4DAV A;  5IGB A;  1K8M A;  2P5Z X;  4DV7 Q;  3Q22 A;  5DNF A;  1B53 A;  5JVG 3;  3S16 B;  2A8V A;  5JPN C;  5KIX A;  3NBH A;  1NMF A;  4A76 A;  5D14 A;  2IT1 A;  3ERO A;  1CM9 A;  4I65 A;  4IOC A;  3TRZ A;  2R93 H;  4O0A A;  5KYI A;  4OEM B;  4OEL B;  3R8B A;  4F88 A;  1T5E A;  2PZU A;  4LF8 Q;  1GHK A;  4JI6 Q;  1LUZ A;  4A3L G;  2EYL A;  1M90 C;  1EOT A;  3ERQ A;  2YV5 A;  1TVX A;  2EPB A;  1Y1W G;  3UDG A;  2JA5 B;  2HT1 A;  2HCI A;  3S2D H;  2VY3 A;  2F0K A;  1F9Q A; 
#chains in the Genus database with same CATH homology
 1PRT D;  2C5C A;  2O5I C;  5E4W C;  4C1N I;  1JB3 A;  3HRZ C;  1E2W A;  4UDU C;  1C48 A;  1EY9 A;  3TBI B;  3GO5 A;  1R4Q B;  1CK1 A;  2Q8I B;  4H13 C;  4RGM A;  2NB0 A;  1H9S A;  1C8C A;  1UNS A;  2L55 A;  4RHR A;  3S2H B;  4DGZ A;  4L6T B;  3T13 A;  3O13 A;  1BR9 A;  3K57 A;  1QB5 D;  3MAQ A;  3I70 A;  5FOB B;  4DXF A;  2JA6 B;  2L4N A;  3VYR A;  2K28 A;  1EY6 A;  4DK1 A;  3RZD B;  1KDC A;  2WKC A;  1WTR A;  3KK7 A;  5IOC A;  5DM7 3;  3PO2 B;  2KEC A;  5J1Z A;  1CZG A;  4C1N K;  5A35 A;  2F0Q A;  2VB2 X;  4KD4 A;  3I4N B;  2EYH A;  5EPJ A;  3BVZ A;  5C0X J;  1QIL A;  1EY0 A;  3PUV A;  1SFO B;  3GP7 A;  3RUZ A;  1II3 A;  4RHS A;  3NXW A;  4IFD J;  1GHJ A;  1F2Y A;  4XYQ A;  2BE5 D;  3MTS A;  2AWN A;  4ILW A;  1A3U A;  2JA7 B;  4KD3 A;  2FHT A;  3OWE B;  3E5S A;  4DU9 A;  4HCS A;  1K83 B;  3V96 A;  2K04 A;  5T1I A;  1BCP B;  3DEO A;  2ICI A;  5EKI A;  5JEA J;  4RA8 A;  2SNM A;  1EY4 A;  4XXE A;  3NWS A;  5C0X G;  4CGY B;  5EBD A;  5I4D A;  1WD0 A;  4BA1 I;  3I4M B;  2L5T A;  1KAB A;  3C1E A;  4IFD G;  3OPO A;  1SXT A;  1I4X A;  4HMI A;  1KDB A;  1U4M A;  2WAQ B;  1HTP A;  1A6X A;  2IWH A;  5CV4 A;  1H9J A;  2R7Z B;  1HXY D;  2CQA A;  1V43 A;  1WTQ A;  2C9O A;  3A7A B;  5EJW A;  1SE3 A;  1WD1 A;  4KY7 A;  1E2V A;  2K03 A;  1HQR D;  3TN2 A;  2JA8 B;  4X3U A;  1MI2 A;  2EDG A;  2RDG A;  2YU9 B;  5JEA G;  4DNR B;  2AWO A;  2NUC A;  5CV9 A;  1DM0 B;  3V2T A;  1IW7 D;  1LT6 D;  1BQQ T;  5FO7 B;  3D3R A;  4B9W A;  2PNR C;  1HTL D;  1LTB D;  4KKS A;  1AP0 A;  4HSV A;  2BE5 C;  2OEO A;  3LX0 A;  4DNT B;  5M9O A;  2EY5 A;  1IHZ A;  4J1M A;  3ZYY X;  1LV9 A;  1IL8 A;  3HOV B;  4NDX A;  3MEH A;  2LFN A;  3FPP A;  3VYT A;  1STH A;  2L11 A;  4FF1 A;  4OHJ A;  1MSG A;  2JYO A;  3QO2 A;  2GA4 B;  4KMU C;  3GV6 A;  5EGT A;  1KTK A;  3S1Q B;  3OIQ A;  2F4I A;  3K5L A;  1WTO A;  4K5W A;  1FR3 A;  4PMC A;  3D6C A;  3CRK C;  2B2V A;  1BNZ A;  1PTO D;  5DEH A;  3J7A F;  2OXP A;  3QG1 A;  2DY8 A;  2B2T C;  1X3Q A;  4FVM A;  4PMW A;  2R3Z A;  5D65 A;  3CKI B;  1STA A;  1SMY C;  2D5D A;  3GTO B;  4FXD A;  1SJE D;  1I4Q A;  2XVS A;  4DAP A;  1LAB A;  1XX8 A;  2PPB C;  3PUZ A;  5C6A A;  3S1M B;  4FF4 A;  2PYK A;  1IW7 C;  2F3W A;  3N52 A;  3VR6 A;  1Q8I A;  2R93 B;  2JSO A;  1JOK A;  1R4P B;  5LL6 S;  1I4G A;  4IUR A;  5AFW A;  4A3K B;  1FD7 D;  3V05 A;  5K5P A;  3S2D B;  1ONL A;  3JAM L;  4JK1 C;  1ILP A;  2AQ2 B;  1LTR D;  1TWA B;  3BDL A;  1Q12 A;  1KAA A;  3SK6 A;  2HCC A;  1ZXT A;  1SNQ A;  4Z9C B;  4K2L A;  4ODG A;  2B2W A;  3X3M A;  1PTO C;  4DF7 A;  3HOW B;  1SNO A;  3SXH A;  1YNJ D;  3BDC A;  3K5O A;  2Y0S B;  1NCV A;  2KJX A;  3G6J B;  2E74 C;  1JCK B;  1FNU A;  1SEB D;  1FNW A;  3P20 A;  5EBC A;  3A8I E;  4IUN A;  3I90 A;  3VR5 A;  3T53 B;  3LNN A;  3VA7 A;  2F0W A;  2LKV A;  3SK4 A;  5COY A;  4R8I A;  2K01 A;  2XIW A;  2EY2 A;  3GD7 A;  3NE5 B;  3DWP A;  3J7Y W;  4ZRZ A;  4M8A A;  3U9S A;  4C3J B;  1GUS A;  3OHX C;  4NMZ A;  5E4X A;  4EQN A;  2NTS A;  2FMM A;  1WVL A;  2Z4I A;  1O7L A;  5IGF A;  3ND9 A;  1SYC A;  4BWG B;  2H1E A;  4M1U B;  3WOF A;  1LTA D;  4K14 A;  2XWB B;  3DWQ A;  1BXT A;  4JBW A;  1U4P A;  1S5D D;  1RCV D;  1LAC A;  3MFG A;  4WRD A;  1TWC B;  2A73 B;  5CBA E;  3S1R B;  1Q90 A;  3MC0 B;  2XRS D;  3PO3 B;  4K5X A;  2RSN A;  2K6A A;  3MWY W;  4OL7 A;  2FIN B;  5BN4 A;  2JEB I;  3J7A V;  2MJ8 A;  4HMJ A;  3HG9 A;  2F0I A;  1TII D;  2O2L D;  1JWU D;  2K5D A;  2V4D A;  1SJH D;  2F1M A;  3E6Z X;  1D6E C;  1JOR A;  1A3T A;  5CBE E;  4ABN A;  5C4Z A;  1WTV A;  2A6E D;  5IGC A;  4X3K A;  4CKB A;  5JEA H;  4IAL A;  3D31 A;  3VA5 A;  2D2C C;  5J22 A;  4N9T A;  1PRT F;  4EVO A;  2EYO A;  3RD4 A;  3DHQ A;  3URY A;  2F0F A;  1H9M A;  2KQ3 A;  3ONA B;  4DK0 A;  4OO1 H;  3FKI B;  5FKA C;  1KNE A;  4KKU A;  2DNC A;  4TKO B;  1PZJ D;  3S1N B;  2IX0 A;  4DXG A;  1B50 A;  1X3P A;  2B2U A;  4RKL A;  4CKC A;  1EU3 A;  4IUQ A;  3D8G A;  2YYZ A;  2MHV A;  4KY6 A;  3JAM E;  2QDB A;  5I6Y A;  1EFI D;  1SYG A;  2OF1 A;  3CRL C;  4KKT A;  4G7Z C;  1PZK D;  3I8Z A;  3NHH A;  3VYS A;  2EYF A;  2MUY A;  4F8M A;  1O7Z A;  3QOL A;  1SYD A;  1EQT A;  5LL6 X;  1IYU A;  3FVQ A;  2WIN B;  2NWG A;  4OO1 I;  1HRJ A;  2F0N A;  5IGD A;  2O5J C;  4MIU A;  1CA5 A;  3C46 A;  3HZX A;  3C2P A;  5CR3 A;  1V1P B;  1CA6 A;  4IUP A;  3EVQ A;  3L3O C;  5C3X A;  1EL0 A;  5KRU A;  2A69 D;  1QOH A;  2WII B;  4IQZ A;  3GTG B;  3TDQ A;  2A6E C;  5KGU A;  1BCP D;  4BS9 A;  3A7L A;  4H7B A;  1IYV A;  4L63 B;  1A2T A;  1HFG A;  4KY5 A;  1EEF D;  5CV7 A;  1EZ6 A;  5KEE A;  4RAU C;  1G8Z D;  1EWC A;  4HR7 B;  2B8F A;  1GOZ A;  4K2K A;  3HOX B;  3DM1 A;  1NAP A;  3NWT A;  5KYL A;  1TY2 A;  4FNF A;  2EJG C;  3I91 A;  2A6H D;  1XTC D;  2NBF A;  4IUU A;  3A8K E;  2Z4H A;  4RCO A;  3GTQ B;  3TZU A;  1PZI D;  4BBR B;  2EXZ A;  3S17 B;  1CQF A;  3NQT A;  3SR1 A;  1BOS A;  1S5B D;  5IGG A;  1CHQ D;  3H91 A;  1LTI D;  2EYM A;  1W6K A;  4FF2 A;  5HUR A;  3BYT B;  4PV1 C;  4HN7 A;  1I4R A;  2NVT B;  4KJN A;  2KUM A;  4NKL A;  3I4L A;  3SHL A;  1QG7 A;  1ENC A;  4F7X A;  1EY5 A;  5CV6 A;  5KNC A;  1Q3L A;  3D4R A;  1C4Q A;  3FMC A;  1TQO A;  2RDH A;  4K8J A;  1H9S B;  2L9H A;  2A69 C;  3A55 A;  4A3B B;  1DJR D;  1JC7 A;  2PMZ B;  3TP6 A;  4RKB A;  1BCP C;  4OGQ C;  1JOO A;  1STY A;  1SNC A;  1AEX A;  3EJI A;  1TS5 A;  4KJO A;  1IKM A;  1OXX K;  1CFM A;  3IAY A;  5K36 G;  1GJX A;  1I50 B;  4UAI A;  3QWN A;  3KLS X;  5KNB A;  1RHP A;  2F3V A;  4DN4 M;  3MFY A;  4C2M B;  3VR4 A;  2ID0 A;  2A6H C;  2AUJ D;  2MPM A;  2NN6 H;  3UI2 A;  4A3F B;  1DOM A;  3ITP A;  4RGN A;  1EIH A;  2JEA I;  3A8J E;  3R93 A;  5ELB A;  4KN4 C;  1PTO F;  5KND A;  3NP8 A;  3M4O B;  2TSS A;  3CHB D;  2EY6 A;  1MGS A;  5C4H A;  1SYE A;  3GTJ B;  5BN3 A;  5ELF A;  2NN6 I;  1F9P A;  3MVV A;  4BA2 I;  1CTM A;  5I9P A;  3IFT A;  1STN A;  3S15 B;  1CQV A;  1SMY D;  2VB3 X;  1ET9 A;  3T16 A;  2EJM A;  2E75 C;  1MD2 D;  2J4X A;  4CHT B;  1LTG D;  2R61 A;  2XSC A;  1TWH B;  1TS3 A;  4Q5V A;  1DON A;  3OOC A;  1A3V A;  3BVG A;  2WB1 B;  5I6W A;  3D4D A;  3IL8 A;  1EYA A;  4LMQ D;  2B2Y A;  4XTC S;  2R6G A;  2PQE A;  3MXU A;  4R9W A;  3WOE A;  1EU4 A;  1F2M A;  2D62 A;  2WV6 D;  1V8Q A;  1D2B A;  1DXM A;  4RH6 A;  1OXS C;  1EQV A;  3A54 A;  3C3L A;  3KLS A;  1STE A;  1BUV T;  5JVH 3;  1LT4 D;  2ICE C;  2E2I B;  5C3E B;  2K1B A;  4XYO A;  3CU7 A;  5T1G A;  1QNU A;  1VMC A;  1LO5 D;  2B8G A;  2G9H D;  1EIG A;  1KDA A;  3TME A;  1ENF A;  2A5H A;  3GV3 A;  5CGK A;  5M5W B;  1PFB A;  1OXU A;  3KF8 A;  4WJW A;  1S5C D;  4XT3 B;  2RBM A;  4XQQ A;  1LTS D;  1SE4 A;  2EE1 A;  3BYY B;  3PIP 3;  2EY1 A;  2NTT A;  1HA6 A;  2NYZ D;  3S14 B;  3GTM B;  1F2Z A;  4ZUI A;  1BDO A;  4WFN 3;  1E2Z A;  2EYP A;  4IZ8 A;  2K33 A;  1WCM B;  1EY7 A;  3OIP A;  1SYB A;  1F2L A;  4IN3 A;  2B2T A;  3FPU B;  4FF3 A;  1M8A A;  4KK7 A;  5IOD A;  2Z1C A;  4KHZ A;  1GUW A;  1PFM A;  1UAP A;  1I4H A;  1I6H B;  5NUC A;  3DXJ C;  1E0B A;  4ZK9 B;  2ZXP A;  1SNM A;  1I6V C;  1EYD A;  3SDZ A;  1FGB D;  4O42 A;  1PMR A;  5IT9 L;  1I4P A;  3K5N A;  3VR3 A;  4HCE A;  4J6H A;  5BN5 A;  2FFK B;  2LMC B;  2EZV A;  2F0T A;  1AZQ A;  3H3V C;  2J7Z A;  4Y7N B;  1KNA A;  1F9R A;  1Y1V B;  3SVM A;  2A68 D;  2VNU D;  5G3L D;  3K58 A;  1ENA A;  3HGB A;  1OO9 B;  4IUT A;  4L8J A;  2K5Q A;  2X6G A;  3NQI A;  4HSP A;  4NW2 A;  3OW7 A;  3MXG A;  4C3I B;  2HUG A;  4TQU S;  2CW0 D;  2TMP A;  4QUF A;  2A74 C;  1RKN A;  5CV8 A;  4RGT A;  5JAV A;  5EKL A;  4K5V A;  4CJ2 C;  1B44 D;  1R9T B;  4FXK C;  1CZW A;  4KV6 A;  5EKK A;  1Y69 U;  1FYC A;  1RJT A;  1SAP A;  4XDX A;  3GTP B;  4IUV A;  2BA1 A;  4HAE A;  2HDM A;  2HQE A;  4C3J G;  1W6J A;  2ZXR A;  3M85 A;  1D5Z C;  1YNN D;  3PUY A;  1GUG A;  1TU2 B;  3DEP A;  1EYC A;  1VMP A;  2FJ2 A;  3MHB A;  4XT1 B;  3VR2 A;  5C0X H;  3SE0 A;  1S4Z A;  3A56 A;  2A68 C;  4IFD H;  4EQP A;  1K8O A;  1KLG D;  2K5W A;  5HGT A;  3K6O A;  2F0H A;  2PO4 A;  3FEW X;  3H09 A;  3T51 B;  5M3M B;  1D5X C;  3GTL B;  3D4W A;  1JR0 D;  4LK1 C;  5JOB A;  1GUT A;  2B63 B;  1HHV A;  1BCP F;  3OWF A;  2CW0 C;  5C0X I;  3CQZ B;  3IKJ A;  1MBY A;  2IX1 A;  2SEB D;  1TY0 A;  4IFD I;  3K5M A;  4LAA A;  1B1Z A;  3MXN A;  2BDN A;  1BBX C;  4KHV A;  4RGO S;  1WTW A;  2K05 A;  5C5M A;  1J8I A;  4EGV A;  2B2U C;  3N6R A;  5C3W A;  4K6D A;  2QF7 A;  1PYW D;  2F0M A;  1JQY D;  1JOQ A;  1Y8N B;  5IT9 E;  1YNN C;  1JE4 A;  2IL8 A;  1M4V A;  4RFB A;  5CMD A;  1UUP A;  2PW5 A;  4G7H C;  1NR2 A;  1DOL A;  4QB4 A;  4C3H B;  1NR4 A;  4TSS A;  3DWA A;  2F0J A;  4U68 A;  4N9P A;  2RQX A;  2EJF C;  1Y8P B;  1B9M A;  3FRP B;  4A3M B;  2XWJ B;  3RLF A;  4RWS C;  4B9X A;  4V0B A;  1ML0 D;  1G6Z A;  4K6L A;  5CYU A;  2FMC A;  3KBG A;  4MN3 A;  4ZAI A;  3AU7 A;  5DAU A;  2BDO A;  1DD2 A;  2LS0 1;  1LLR D;  2MGS A;  4G57 A;  5E1F A;  1UEA B;  1TWG B;  3QB3 A;  3RMH A;  3M7G A;  1EEI D;  3W2D A;  1WTX A;  2JXM B;  2F0L A;  1RTO A;  1AW7 A;  2VXW A;  4FYD A;  2QCP X;  2Z8L A;  4GZY C;  1Y1W B;  2IPK D;  2L0C A;  3OMG A;  3QJY A;  1STG A;  3KLR A;  3J80 L;  4YIJ A;  1RTN A;  1S5F D;  2M00 A;  2F0V A;  2OT2 A;  1LT3 D;  3U9O A;  4NP5 A;  2KCN A;  3G7L A;  1ET6 A;  1TR5 A;  3T56 B;  4TRD A;  4E6I A;  4QCL A;  2F0G A;  4EQO A;  3K59 A;  5CV5 A;  2SDF A;  3SK5 A;  2JE6 I;  5FLX L;  3HOY B;  2H4O A;  1AN8 A;  5TSS A;  2KVM A;  3W3A A;  1OXV A;  1D1K A;  4FP5 D;  1SNP A;  1NSN S;  1D5M C;  3J81 L;  5JJZ A;  1X32 A;  4A3J B;  1JWS D;  1BO0 A;  3KUP A;  1Z7T A;  3X3N A;  4MHE A;  2CVR A;  3PUW A;  4KI0 A;  1SE2 A;  3K7A B;  5C5L A;  4ZYS A;  4FXG C;  2KHS A;  1MSH A;  2B39 A;  4XIG S;  1GXD C;  3SK8 A;  1KLU D;  3SEB A;  4Q0F A;  4LJZ C;  4ZKB B;  2G9D A;  3L9A X;  4PMB A;  1S5E D;  5E3F A;  1CT1 D;  1Q1B A;  2F0D A;  4A3D B;  1U9R A;  2N88 A;  1PTO H;  2L12 A;  1QWY A;  4O1N A;  4ZUJ A;  1PLF A;  3L7Z C;  5F2D A;  3M4Y A;  5FO8 B;  1VF7 A;  1QCB D;  1ESF A;  1HUM A;  5ELD A;  3BG3 A;  2XN9 C;  4BBS B;  4J8Q A;  1RD9 D;  2EVB A;  1OXT A;  2WKD A;  1PRT C;  4KTA A;  1I3Q B;  3LWU A;  1TKW B;  1RF2 D;  3OMC A;  1H9R A;  1Z6H A;  3P75 A;  2E2J B;  2EYJ A;  3PV0 A;  5D3D A;  1A15 A;  3TP7 A;  5A2Q L;  2R92 B;  3AMU A;  1ILQ A;  4G7O C;  1L0X B;  5IGE A;  4HED A;  2RKS A;  4ZKC B;  2KA7 A;  3NTH A;  4A93 B;  2AQ1 B;  5M3F B;  4S3S A;  2HDL A;  4HTH A;  1TWF B;  4QMG A;  1BF4 A;  5ISR A;  3MA2 B;  4K8I A;  1SND A;  1Q1E A;  1PRT B;  3GTK B;  1JWM D;  1B3A A;  2B2Y C;  3NPP A;  4PQX A;  1G2T A;  2E2H B;  2QKI C;  4CBV A;  1D1I A;  2RSO A;  3HP3 A;  3TZD A;  4ME5 A;  1SSO A;  3ND8 A;  3VYU A;  4BY1 B;  4CJ1 B;  3C1F A;  3EA6 A;  3J80 E;  1CHP D;  2I07 B;  3FDT A;  3F2U A;  1QNK A;  2N55 A;  2XNA C;  5C44 B;  1VF5 C;  4A3G B;  2RDF A;  4F87 A;  4R8N A;  5G3L F;  1F9S A;  1DZ1 A;  4U67 3;  5FLX E;  2M9V A;  4I7Z C;  2B2V C;  2I46 A;  2D9U A;  1TS2 A;  3TP5 A;  3J81 E;  1XYI A;  1ZEQ X;  4OO1 G;  3PIO 3;  1G29 1;  1FNV A;  2PZW A;  5D3I B;  3I72 A;  1O7Y A;  1EY8 A;  5EPL A;  2SNS A;  2AQ3 B;  2WAC A;  5C4J B;  2Q8T A;  4CJ0 B;  3Q24 A;  1A2U A;  3P7J A;  1CI3 M;  3HOU B;  2F03 A;  2X6L A;  3OSO A;  2JP1 A;  3WDN A;  2F0S A;  5EPK A;  3D6W A;  1LTT D;  2F0P A;  2KEE A;  2BA0 A;  1DCZ A;  2NVX B;  4XQN A;  4C56 C;  1G2S A;  2F0U A;  3BZD B;  1ZKO A;  3E0J A;  3T4A C;  3HS0 C;  4DAY A;  5A2Q E;  2ENB A;  4DFA A;  3LWE A;  2B2W C;  1IKL A;  1O78 A;  5LHY 1;  2Q8R E;  2L1B A;  2EOT A;  1QE6 A;  5I9O A;  3S9W A;  3QOJ A;  4BY7 B;  4A3E B;  1TT2 A;  2PZT A;  4ID6 A;  5I2X A;  1H9K A;  3NTK A;  4ZLT F;  3DMU A;  4H0L C;  3TP8 A;  5JPM C;  4C3I G;  2IX3 A;  5K36 H;  1QJO A;  5M5X B;  3NK9 A;  1U4R A;  1AFP A;  1SYF A;  1PDQ A;  2KED A;  5COR A;  3QIA A;  2BCO A;  2QEJ C;  2E76 C;  1V1O A;  4AYB B;  3EQL C;  2XRQ D;  2QIL A;  2NVY B;  1HA5 A;  5J39 A;  1HPC A;  1ICW A;  1JIC A;  1PFN A;  4XQJ A;  5FO9 B;  5EQ0 A;  2F0E A;  2J0T D;  3H0G B;  5DM6 3;  1PTO B;  2CHB D;  1Z47 A;  2F0O A;  2ZT9 C;  3M3Y B;  3I73 A;  3Q0A A;  1SDF A;  2DY7 A;  2RVL A;  2O4X A;  2X69 A;  5ELC A;  4WOR A;  2NVQ B;  3IFD A;  4X3S A;  2DN8 A;  2NN6 G;  3HKZ B;  4G4K A;  1LT5 D;  4QF4 A;  1L0Y B;  2VUM B;  1HUN A;  2DNE A;  1ROD A;  3R2T A;  2AUK A;  4CKE A;  2BOS A;  2NZ1 D;  1T5X D;  4A3I B;  3Q23 A;  2ZXO A;  3NSW A;  3BVM A;  4QIW B;  5I2Y A;  4KN7 C;  4P2C B;  1YNJ C;  4RCN A;  3NTI A;  1ZYR D;  3RZO B;  1U4L A;  3P1H A;  1B9N A;  3PUX A;  1B2T A;  1HCZ A;  3HOZ B;  5C4X B;  3M7N A;  1VDZ A;  4QUC A;  1GUO A;  4DA2 A;  1AZP A;  5FK9 C;  1Y8O B;  2RA4 A;  3BDO A;  3Q6S A;  1NUC A;  4OIK A;  3MZ5 A;  4B08 A;  3NBI A;  3H94 A;  3BS1 A;  5ELE A;  1DOK A;  3HEJ A;  3MXP A;  1EZ8 A;  1HQM C;  2SOB A;  1STB A;  1HFN A;  2LY7 A;  4FO2 A;  1B4O A;  2E2D C;  1EWH A;  1XWE A;  2KCC A;  3TSS A;  4PNY A;  5IIF A;  4C3H G;  1RDP D;  3H6M A;  1V1P A;  1WTP A;  2WP8 J;  3AB9 A;  3DUZ A;  1SBB B;  1GUN A;  5M5Y B;  3KBX A;  1VCI A;  1PXU A;  3NUC A;  1DYQ A;  2PCF B;  1ESR A;  4V19 0;  1XXG A;  4OIJ A;  1G91 A;  2IJ0 A;  2PW7 A;  1F77 A;  2K7V A;  3GQB A;  4X3T A;  2MP1 A;  3R3O A;  4ZQ3 A;  5CC4 A;  1O80 A;  3R2I A;  3I3C A;  2K32 A;  4H44 C;  3K0Y A;  2KOL A;  2IW3 A;  4ULL A;  2M2L A;  1J9O A;  1TS4 A;  3EFX D;  1ZYR C;  3PMF A;  4DAV A;  5IGB A;  1K8M A;  3Q22 A;  5DNF A;  1B53 A;  5JVG 3;  3S16 B;  5JPN C;  5KIX A;  3NBH A;  5D14 A;  2IT1 A;  3ERO A;  1CM9 A;  4I65 A;  5KYI A;  3R8B A;  4F88 A;  1T5E A;  2PZU A;  1GHK A;  2EYL A;  1EOT A;  3ERQ A;  1TVX A;  2EPB A;  2JA5 B;  2HCI A;  2F0K A;  1F9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...