3SVMA

Human mpp8 - human dnmt3ak47me2 peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
60
Chain Sequence
EDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MPP8 mediates the interactions between DNA methyltransferase Dnmt3a and H3K9 methyltransferase GLP/G9a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords M-phase phosphoprotein 8
total genus 13
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3svmA00
1O80A 1NR2A 2L12A 1ICWA 1KNAA 4QUFA 3G7LA 2L11A 4O42A 1XYIA 1WTWA 1J8IA 5COYA 5EPLA 2Q8TA 3KUPA 1PFMA 4ZKBB 1WTPA 2B2YC 2RSOA 2EOTA 2N88A 5E4WC 1Q3LA 1RTNA 2IL8A 1WD1A 1BBXC 1EOTA 2KEEA 2L9HA 1HUMA 2RSNA 1LV9A 3I8ZA 4DN4M 1WTRA 5DNFA 4RAUC 2KOLA 2HUGA 1TVXA 4X3KA 2B2UA 1NCVA 5JJZA 2JP1A 1MSGA 1WVLA 4LMQD 1IKMA 1CA5A 5AFWA 3KBXA 3Q6SA 5CORA 1RHPA 3GV3A 5D14A 1G2TA 2H1EA 3LWEA 3D6WA 1NAPA 1WTQA 2B2YA 1GUWA 5T1IA 2NWGA 2X6GA 4IUUA 5EJWA 4CJ0B 1QG7A 1F9RA 1B3AA 2DY8A 5EPJA 1DONA 2RVLA 1KNEA 1CM9A 4IUQA 2HDMA 4OIKA 2DY7A 1EL0A 1HA6A 4OIJA 1XX8A 4MN3A 4IUTA 5CBAE 5E4XA 1B53A 2K28A 1ML0D 1F9SA 3I3CA 2L4NA 3MWYW 4R9WA 1S4ZA 1X3QA 1JICA 1RODA 2JYOA 2RA4A 2HCCA 2B2VA 1G2SA 1B4OA 2XIWA 4IUPA 1MSHA 1ILQA 3IFDA 1B2TA 4ZK9B 1DZ1A 4X3TA 2B2WC 1RJTA 2D9UA 2X6LA 4U68A 2MP1A 1X32A 3I90A 1U4RA 2R3ZA 1NR4A 1U4PA 1ILPA 1MGSA 1B50A 1F2LA 4UAIA 1X3PA 1WTOA 3DEPA 1PFBA 1AZQA 1IKLA 2HCIA 2K1BA 4X3SA 2KVMA 1O7ZA 1QNKA 3DEOA 3TN2A 3SVMA 1WTVA 1F9QA 2SDFA 2FFKB 3GV6A 1J9OA 1U4MA 1SAPA 4HCSA 3TZDA 2B2TA 3P7JA 5T1GA 2K05A 3HP3A 1G6ZA 1DOKA 3N52A 4XT3B 1E0BA 1U4LA 3H91A 1VMCA 4ZLTF 1EIGA 1O7YA 2L1BA 1MI2A 4NW2A 2KECA 2Q8RE 2VXWA 4HAEA 1PFNA 5EKIA 3UI2A 1HRJA 1PLFA 3FDTA 2EPBA 2NZ1D 1M8AA 1RTOA 3F2UA 1QE6A 4RA8A 5EQ0A 2CVRA 1IL8A 3IL8A 4HSVA 4R8IA 1BNZA 1VMPA 1WTXA 1A15A 3I91A 3ONAB 2FHTA 4MHEA 4X3UA 1C8CA 1PDQA 1SDFA 2B2VC 1WD0A 2K01A 1AZPA 5D65A 2B2WA 2NYZD 4QUCA 1EIHA 2KUMA 5CMDA 4CJ2C 1F9PA 2M2LA 2EE1A 2J7ZA 2K04A 2FMMA 2MPMA 4RWSC 1HUNA 4XT1B 2MJ8A 5CBEE 1DOMA 1HHVA 1BF4A 1DOLA 1ZXTA 2BDNA 2HDLA 3R93A 1CA6A 3FPUB 1SSOA 2KEDA 2FJ2A 3QO2A 4ZKCB 1HFNA 4IURA 3MTSA 2B2TC 2N55A 4XDXA 2FINB 2X69A 4ZAIA 1EQTA 1JE4A 2K03A 1BO0A 1HFGA 4HEDA 2B2UC 5EPKA 3DM1A 2MGSA 1ESRA 4IUVA 4CJ1B 1G91A 1AP0A
chains in the Genus database with same CATH superfamily
3CD6A 1KNAA 3SGIA 5L37A 4LF7L 1CSQA 4PMBA 3GTPB 1IL2A 3PSIA 1LTID 1HUMA 4DF7A 2F0LA 4EQPA 2F0UA 4A3LH 1IKMA 5CV7A 3ITPA 3OOCA 3NWTA 4OEMB 5CORA 1Y69U 1CQVA 2LKVA 1K3BC 2EY2A 3IFTA 1V1QA 1ENAA 1LTLA 2ZJRA 3S16B 1RIPA 4DNRB 1Y8NB 3RUZA 4IUQA 2UUBL 3BZDB 3FVQA 4PNYA 3JAML 4A3FB 4LF6L 3CCSA 2NN6G 3OIQA 2KCTA 4K5VA 1QUQA 3T1HQ 3HOUB 5JOBA 2G9HD 3NHHA 4LNQA 1GXDC 3LX0A 1KTKA 1GD7A 5CYUA 1SE8A 1K8AC 4JI5L 4KV6A 1CQFA 3V2TA 1MGSA 1TT2A 3DEPA 4B3MQ 2AWNA 4LF4L 3GV6A 1I94L 1NNXA 2HIXA 4CDEC 2OCEA 4DR1Q 1LM0A 4L5SA 4K2LA 5KGUA 2A6HC 1FNWA 1OXXK 3K5OA 4AIMA 1VQKA 2RCFA 1VQNA 1GUOA 1VQBA 4OXPA 5EQ0A 3MEHA 4QL5A 5EGTA 1BKBA 2F0DA 1KABA 1V1OA 3P1HA 1QOHA 1AZPA 1VQCA 3A55A 1DGSA 2F0QA 4BWGB 1ZYRD 1GO3E 1LT6D 4A3JH 1HUNA 3S2HH 1AFPA 4DK3C 2F3IA 4PMCA 3EBEA 3AQQA 1EFID 4KJOA 2B8FA 3S17B 4Q0FA 4YCUA 2B2TC 1I94Q 2UUAL 1A6XA 1EQTA 3P20A 3MHBA 3S14B 1PH3A 1LTRD 3NEMA 1G91A 1TWCB 3TZUA 2F3WA 1NR2A 5IP9H 3S2HB 3NTIA 2UUCL 1D1KA 3OWFA 2B63B 2SNMA 2N88A 4UDUC 1A3VA 2N49A 5C4XH 2PNHA 4IQZA 2B8GA 4LFCQ 5IGEA 4JI6Q 3GTJB 4A3IB 2VS1A 5AFWA 5IODA 5J22A 4FYDA 1D7QA 1RHPA 2K6AA 2WKDA 3I4NG 3LWEA 1GUWA 1E1TA 1K0RA 1Z9FA 3E0EA 2RVLA 5FK9C 4CDCC 1N33Q 4DV4Q 4G7OC 2Y0SB 3KF8A 3BZKA 4LF5L 5FKAC 3MWYW 1X3QA 2JYOA 4KHPQ 2XIWA 3T56B 2UUBQ 2E2JB 4IPCA 1VQLA 3HOXG 1GKHA 1S5FD 4S3SA 1VQGA 4B3SQ 3VR6A 3GTQH 2I5LX 1EZ6A 2I07B 3NE5B 1E1OA 3L0OA 3TP8A 2A68C 5FO8B 1SMXA 4HCEA 1QB5D 1WCMB 2IWHA 1IKLA 1PYWD 3J81E 3CKIB 3CQZB 3RD4A 4KHPL 2V1CC 1NY4A 4Y7NH 5FLMH 4HMIA 3PUVA 5J3BA 5I9OA 2R7ZG 1DOKA 1YHBA 2F3VA 1Y1VG 4YY3L 2D62A 3H0GH 2F0SA 3VDYA 3MA2B 1E2VA 1O7YA 1R4QB 1NSNS 1PYBA 1MI2A 2KENA 5BN5A 4IJHA 3I73A 3TRZA 3GD7A 3G6EA 2XGTA 2F0NA 3H3VC 1VF7A 3CCEA 2Q2IA 4PMWA 3BVMA 4BXXH 1GHKA 5M5XH 3Q22A 3LNNA 4FXKC 4GOPC 3PO2G 3PIP3 4IJLA 2R92G 3ULJA 4OWTB 1LUZA 2VNUD 5LMUQ 4HJ5A 1KXLA 3DUZA 1DOMA 4GNXB 4H7BA 4FO2A 2PNRC 3FPUB 2KEDA 3PUXA 2O4XA 4ZKCB 3KLSX 3MTSA 4I65A 2H5XA 1I5FA 2R6GA 3AU7A 2B2UC 2MGSA 4CJ1B 1PA6A 2A6EC 4JI1Q 4XQJA 5IYBG 4X66Q 5LMUL 1J8IA 3ND9A 2PMZB 1PFMA 1TS3A 3FMCA 5FJ8G 1PTOD 1RTNA 4A3FG 2VQEQ 1EIYB 2ID0A 2EYLA 5M3MB 2E2JH 2IJ0A 4DKAC 4J1MA 2KOLA 2JN4A 1QZHA 1STYA 1SYCA 3IRBA 2E2HB 3OMGA 4UY8C 3URYA 3QB3A 2ZTDA 5IE8A 1O78A 1L0YB 2EJGC 3FKIH 5EJWA 4ZYSA 1DONA 3HKSA 5A2QL 4N8X1 1M1KC 3KFUA 2DY7A 3A54A 3F2BA 3L3OC 1ESFA 1F9SA 3NQIA 1NBWA 1TWHB 4EQOA 2XNAC 1JICA 1RODA 1IBKQ 2RA4A 4DV2Q 3I55A 4NXMQ 1EU3A 1MSHA 3IFDA 1ET6A 1EEID 4ZK9B 4GLVB 2X6LA 2LXKA 4NPSA 1X32A 1Y1VH 4JI7Q 1DCZA 4F87A 1XNRL 4JCVE 3CCJA 3S2DH 2Q2UA 2JK8A 3GTKH 1VQJA 1WYDA 4NDXA 2JA6B 4X6AH 2O5JC 2M9VA 1I50B 1E24A 3SHLA 4DR2L 5KNCA 3J7YW 3D4WA 4DAPA 3D8GA 1YJNA 2LSSA 2EY1A 2F0IA 4JI3L 2EPBA 1D1IA 2YTVA 1IL8A 1FNVA 4HSVA 3U9OA 1T9HA 1RKNA 1K8OA 4IPHA 1I3QH 5FLXE 3F2CA 1FNUA 4WJ4A 2ZXOA 1IBLL 1I3QB 5K5PA 4POFA 3TP6A 2ATWA 4P71A 2FMMA 1VQMA 3DXJC 3D0FA 4JBJA 1EY0A 3HOXB 2QILA 1Y8PB 4JOIA 1QILA 2FJ2A 3U4ZA 3T1YL 3K59A 4RGNA 1G291 1VQ4A 3R93A 3VYRA 3M4OH 1B44D 3ZYYX 1MJCA 1Q8IA 3FP9A 3I56A 2CFMA 3MXNB 3H3VH 2L11A 2F03A 4GKJL 2QDBA 3CC2A 1M90C 3VA5A 2K33A 4A3GB 4A3EG 4HIKA 2EJFC 5BR8L 1UEBA 1G2TA 1LT3D 4KKSA 5I6WA 4IFDG 2B2YA 2C9OA 4A3MG 3K0XA 5GAHC 2F4VQ 5EPJA 1Q86C 3I4NB 4O2DA 3TDQA 3PCOB 4H0LC 2WB1B 4A3DH 2LFNA 4BBRH 1HXYD 5CGKA 1FYCA 1V1PB 5M3FH 3N6RA 1PH4A 5H1SE 1GM5A 4Z9CB 2AUJD 2EZVA 1DZ1A 4FF1A 4EQ5A 1XNQQ 3T51B 1RJTA 5GAGC 1TS5A 2VW9A 2VQEL 2AHOB 1W6KA 1NR4A 4TSSA 2K5DA 4DV0L 1LTAD 4UAIA 2E5LQ 1CUKA 5ELFA 3T13A 3UE1A 4DV2L 4F7XA 3Q23A 3EFXD 2SDFA 5KRUA 1PMRA 2OT2A 3CMAA 3V96A 1QNUA 5JEAJ 4N9PA 4GNXC 5FLXc 1E2ZA 2RBMA 3BVZA 3EVQA 2AQ3B 4ID6A 1H9SB 4JI1L 1HPCA 2NZ1D 2AKWB 5CV9A 5FLMG 3UE0A 1VMPA 4K0KL 1KRSA 4DK0A 3K7AB 1H9JA 4MNOA 3CC7A 4FNFA 4TRDA 3RMHA 2YYZA 4L5TA 2BE5C 4BXXG 2MJ8A 4B9XA 2UUCQ 4OX9L 1SSOA 3H0GB 4PV1C 4C1NK 5DLQE 3QO2A 2SOBA 3PO3G 2K32A 3A7LA 3GTMH 4XDXA 2PI2E 3BDLA 4KHVA 4DR4Q 3DM1A 5IYCH 3E6ZX 2WKCA 2R7ZH 1RDPD 1UWVA 5DM73 3W1GA 4A76A 2PYKA 1B70B 3NSWA 1VQ6A 5LHY1 5C0XH 4FVMA 1PRTF 1WD1A 5E4WC 1BBXC 4FP5D 3OYYA 3CXCA 4P72A 5C4HA 3E5SA 4YY3Q 3GO5A 3K58A 3HOYG 4J6HA 3K7AH 3MFYA 4DR5Q 1NUCA 2IX3A 1GUNA 4JVZA 5HURA 4ALPA 3RNUA 1D2BA 1Z7TA 5KYLA 1LLRD 4LWCA 5LL6S 4C3IG 2EYJA 3DWPA 5ISRA 1H9KA 4DPGA 1H9RA 5E4XA 3K81C 2EYPA 2R93B 4DFAA 1EYAA 1S4ZA 1V1PA 2PO4A 3HEJA 4JI6L 3PIPA 2VQFL 3KF6A 3OW7A 3C46A 3MXNA 4LF7Q 3G71A 5C4XG 2PZWA 1JJGA 2VUMB 5IP7G 3CCQA 1VQOA 1PFBA 1BOSA 1AZQA 3S1NB 2ZTEA 2F0WA 4EQNA 3SVMA 2NVQH 3S14H 1Q82C 3BYTB 1SAPA 3PUYA 4HSPA 1WJJA 5T1GA 1KL9A 3GP7A 1G6ZA 4LFCL 4RH6A 3T1YQ 4RCNA 1K8MA 2D5DA 4DV1Q 4UP7A 4C3JH 2L1BA 5JPMC 4A3CH 2OEOA 5C5LA 2AQ2B 4N8FA 1M8AA 4DAYB 3RLOA 2M00A 4HTHA 1TWGH 1Z6HA 4A3GH 5I6YA 3ULPA 3I4MB 1TS4A 3A8JE 2JEAI 1EIHA 5KEEA 2EE1A 3J7AF 3PUZA 4R8NA 3NENA 3D6CA 2CH4W 4XT1B 3HOZG 1DJRD 1EWCA 3QJYA 1ICFB 1VCIA 1VQEA 2Z6KA 2Z0SA 2IX1A 3NTKA 1GVPA 2NN6H 4BY7B 1HTPA 2A74C 2WAQE 1II3A 1ENCA 1AP0A 2LXJA 3R2IA 4LF9Q 2PI2A 2QEXA 3B6YA 1VQ5A 1JB7A 2EYMA 4HIOA 1L0WA 4DR2Q 4MTKA 3CCLA 4JI8Q 5IYBH 1TWGB 3HOUH 3R8BA 1CA5A 2AWOA 3Q6SA 4OONA 2JA8H 1SNPA 2F0KA 1VQ8A 2OQKA 4CKCA 4C3JB 2DY8A 4IOCA 1IW7C 4A3MB 2CH4A 1CTMA 4PZ7A 5FO7B 2K52A 1QUQB 2K50A 1X56A 3TEHB 4XQNA 2NVQB 1U0LA 3K80C 4YCWA 3K7UC 3KF8B 4FDBA 1S3OA 2D9UA 4K2KA 4U68A 2MP1A 2E5LL 5C6AA 4NXNQ 3KJOA 4R1JA 1K0SA 1SMYC 1BCPB 2ZXPA 4K8IA 3TQYA 1PH5A 1O7ZA 2QDLA 3GDEA 3H6MA 4R4QA 4A3CG 1OXVA 2NVXB 1X65A 4KY7A 3P7JA 3VR4A 3PF4A 3GTGH 3F2DA 1Y1WH 4GOPA 4OO1H 3J7AV 4F8MA 4TVAB 4UP8A 4J15A 1DXMA 1MD2D 5EKIA 1A3TA 4P75A 3F2UA 4KMUC 2XRSD 5BN3A 1FD7D 4RHRA 4A3JG 1EYCA 3I91A 1K9MC 1S72A 2RDGA 1EIFA 2KBNA 1PDQA 4ODGA 5J1ZA 1WD0A 3HOWB 4JYAL 5JEAH 4ZRZA 3S24A 1X55A 1HZAA 1M4VA 2J4XA 1QWYA 3U50C 1FGUA 3WWVA 4ILWA 2I0QA 2F0VA 1SRUA 2QF7A 1XMQQ 4Q5VA 3M85A 3JAMi 4CKEA 2K75A 4DK6C 4ZAIA 1F2YA 4HEDA 3WDNA 1A62A 2N8NA 2JA9A 1N8RC 1H9SA 3BDOA 3HS0C 2L12A 4ZCKA 4HMJA 4QUFA 1N36Q 4A93B 3IKJA 4LFBL 2IW3A 4R4TA 3A7AB 3AYHB 5TSSA 1YEZA 5G3LD 1QVCA 2L9HA 3VR3A 2MUYA 4A4IA 3FKIG 1W6JA 5JJZA 2VZAA 3GTLB 3UDGA 1IYUA 1L1OC 2PZTA 1OXUA 1TWFH 5M5XB 3T4AC 4B3TQ 1NE3A 2C35B 4IPDA 2NWGA 3I4MG 2RF4A 3PF5A 1GHJA 3CRLC 2KHJA 4AH6A 5DEHA 1OO9B 5M5YH 1EQQA 2ZJQA 3CQZH 1JWMD 2MO0A 2PPBC 1L1OB 1EY6A 3G6JB 1HR0W 2JA5B 1XMQL 4OX9Q 2NVTH 4X3TA 4BY7G 4AQYL 4OGQC 2IHFA 3G48A 4DV7L 3CC4A 3H0GG 4A3EB 1X3PA 3PO2B 4KLKA 1VQDA 2K1BA 4YHHQ 4HCSA 2F0EA 2K5WA 1U4MA 2EJMA 2ZM6Q 1JOKA 2YTYA 3CW2C 2JEBI 1GUGA 1STHA 2WAQG 3I4NH 3DMUA 4NB3A 2UXDQ 2Z1CA 1B9NA 2E2DC 1HRJA 4JI5Q 4LF9L 3Q0AA 1CHPD 1HCZA 3QG1A 4A3IH 1VQ7A 4X64Q 2FHTA 1C8CA 1YITA 2A69C 1KQSA 3GTOH 1SNMA 3PIO3 3L7ZC 1Z47A 5CMDA 4QQBX 4DR6Q 4RWSC 2A68D 2FMCA 3KYHC 4C56C 1A0IA 3PQIA 4CGYB 5I2XA 3MZ5A 4JK1C 4YIJA 2DJGC 3NELA 4IUVA 4WRDA 4K6LA 3VYUA 3RZOH 2O5IC 5CV8A 4DR6L 4XIGS 4A3EH 4JI4Q 3CP0A 1D8LA 4L63B 1HNWL 2B2YC 2EOTA 1PZKD 2C5CA 1FJGL 4DR3L 1HA5A 1LTGD 3TP5A 1NMGA 1CI3M 4R4IA 4C3IB 3PUWA 5JVG3 3CMEA 4X64L 1SNOA 1LTBD 4PG3A 5A35A 1WVLA 3I4LA 2DUDA 1LTTD 3NXWA 5G3LF 1N33L 3D4RA 1XPOA 2H1EA 1BCPC 2KQ3A 3AMUA 3BU2A 4DV7Q 3VA7A 1JE5A 1A63A 1PTOB 3HOYB 1SMYD 2TSSA 1KNEA 3TREA 4RMFA 1YNJC 1S5ED 2WINB 5BR8Q 1PHJA 4MN3A 4B3TL 4IUTA 3OHXC 5CBAE 1F2ZA 3H3VI 3AB9A 4K14A 1HH2P 2AQ1B 1TIID 1OTCA 1CKMA 5E1FA 3NTHA 1GOZA 1GUTA 3CF5A 1Q90A 2ZTCA 3OPOA 2J0TD 2PMZE 4A93H 5JVH3 2G5DA 3SK5A 4HR7B 1CZGA 2OTLA 4CKBA 1L1OA 3QWNA 1SE4A 4LF5Q 1J6QA 4P2CB 2KJXA 3H91A 4HN7A 4ZLTF 1TXYA 1WTHA 3NWSA 4KD4A 3HFZB 4FXGC 2RDHA 1Y1WG 3HOWH 1PH6A 1PH8A 3ONAB 3E0JA 1P8LA 2JA7H 4KY5A 1E22A 1T5XD 5C0XJ 3DWQA 3RLFA 3STBC 2HIVA 1TQOA 3SXHA 1MHWC 2BH8A 4CJ2C 1E3PA 1CKOA 1PXUA 1KDBA 1YJWA 3A8IE 2L55A 3KF6B 2ZM6L 3GTGB 1D6EC 2XRQD 2DNCA 2K03A 1SXTA 2Y0SG 3EQLC 1G51A 4A3LG 3A56A 1TWAH 2CWPA 5I9PA 3OMCA 3SR1A 3C1FA 4C1NI 3G4SA 1EOVA 1KIXA 4RKBA 4DAMA 5I2YA 3J81i 2RSOA 4ZQ3A 4C3HB 4IFDJ 4JYAQ 4GLXA 3M4QA 2RSNA 4L6TB 3TSSA 5DNFA 5IGCA 2BOSA 5IY0A 2LS01 1JJCB 1WCMG 5C44H 3SEBA 3KBXA 5M3FB 2R92B 4LUVA 1I6VC 4BBRG 4IO9A 4DA2A 2XVSA 4BBSH 1CFMA 4RGOS 3OTOL 4A3DB 3F8TA 2QGQA 4RG1A 3SK8A 1YIJA 1HQRD 3TS0A 3NBHA 3ND8A 5ELBA 4AYBE 3D31A 1HZ9A 4QMGA 1STEA 1WFQA 4R9WA 2PW5A 3K57A 2B2VA 1RF2D 1MIUA 1G2SA 1HNXQ 2XTIA 1TR5A 3OSOA 5EKKA 2I46A 5JEAG 2B29A 3ZJYC 1WTOA 1A3UA 5C3XA 4A3KH 1S5BD 2PQEA 2D0PA 2FFKB 2KCMA 5KIXA 3HP3A 5IGDA 5C3EB 3HOVB 3N52A 1SJHD 2A6HD 2CKZB 4DK1A 2MO1A 2I5HA 1IYJB 3HOWG 1SNDA 2QW7A 3FPPA 1CKNB 2VB3X 4G4KA 2JE6I 3WOFA 4LW1A 4WFN3 4OWXB 3GTJH 3KLWA 1Y14B 4DAYA 1SDFA 2NUCA 1KDAA 1ONLA 2NTTA 1I4GA 3HG9A 1ASZA 3S15B 4GN3B 3JC66 2GN5A 2SEBD 1SJED 4K8JA 2OTJA 5IP9G 1S5CD 2P5ZX 3PMFA 2BH2A 4XTCS 1QJOA 5C0XG 1KHIA 4FF2A 2N55A 2AUKA 2K14A 1T5EA 4JI2Q 2EYOA 2R7FA 4G57A 3R3OA 1X3GA 3RN2A 4KI0A 3CCRA 4A3JB 1JOOA 1G8ZD 2Q8TA 1SE2A 5FLXL 1Y1VB 3J80c 5IP7H 1XTCD 4DN4M 3U58A 1JWUD 2CW0C 2F0JA 2WAQB 2ZJPA 3BG3A 5A2QE 2JA6G 5FOBB 3E9HA 2B3GA 4OO1G 4KTAA 4XQQA 3JAMc 4IUUA 2XN9C 1VDZA 1CZWA 4YWMA 1JCKB 1EWIA 1I4RA 3FKIB 4V190 3AFPA 2Z8LA 2IHEA 2B63G 3PV0A 5IYDG 4V0BA 1XX8A 1B7YB 3OTOQ 1PZID 2EXZA 3UDXA 2K28A 1S5DD 4DNTB 4YHHL 3MXUA 4R4OA 1EYGA 1JORA 2E2HH 4JI0Q 2A1AA 3PO2H 1BBWA 5M3MH 4HIMA 5ELNA 5I4DA 3K5LA 1X3FA 2F4IA 4A3BH 3E9IA 5FO9B 5GAEC 1HJPA 1KC8C 1QCBD 1QNKA 5M5WB 3W3AA 4JI0L 1F9QA 5M5YB 3QR8A 2ES2A 4LF8Q 2Z4IA 1ASYA 3GTMB 2K5HA 4EX5A 1Q1BA 2UXBL 4YWLA 1E0BA 3HRZC 3NBIA 2VXWA 3DHQA 3BVGA 3KOJA 3S16H 4A3DG 1PLFA 5FJ8H 2HD3A 1LT4D 2R92H 3J80E 4POGA 1UEAB 1WTXA 2CWAA 2DN8A 1EY5A 3I7FA 3M4PA 3TMEA 2VL6A 1WI5A 2B2VC 4LFAQ 4B08A 1RD9D 1I4QA 1WOCA 4RFBA 3MVVA 1K73C 1UUPA 3I72A 1AE2A 3BYYB 5NUCA 1HHVA 3MEFA 1DOLA 1TWAB 4ZUJA 4DR4L 4KD3A 1D5ZC 1Q7YC 3S1MB 3KK7A 4KK7A 2GVAA 4JBMA 2X69A 4Y7NB 3IAYA 2IX0A 5M5WH 1VQAA 3HOUG 1WCMH 5C44G 3J80L 3VYTA 2JSOA 5LMNQ 4O42A 5C3EG 3MAQA 4A3BB 4L5RC 5EPLA 2PQAB 5M3MG 1WTPA 1EY4A 1B1ZA 5ELOA 4NXNL 1STGA 2WP8J 4PZ8A 1WTRA 1LV9A 3I8ZA 3I70A 5HGTA 1K8GA 1BXTA 4X3KA 2K4KA 1YI2A 2B2UA 1J5EL 2OXPA 1IYVA 3MXGA 3A74A 4ULLA 5IYDH 5JJIA 1QVFA 1NAPA 1WTQA 5M3FG 1C9OA 4KY6A 1VQPA 5ELCA 3HOZH 2EIFA 1Y1WB 1CM9A 4X66L 5JJLA 1V43A 1HA6A 3KLSA 1A8VA 1QZGA 1JWSD 1LABA 2NVXH 3FRPB 1PRTB 1LACA 4IPGA 1RL2A 2HCCA 1O7LA 2IY5B 1YZ6A 1EYDA 4IUPA 4JI8L 4C2MB 2JA7G 2AMCB 4BA1I 2B63H 1W3SA 1F2LA 1YBYA 4ABNA 3D4DA 4YWKA 3TZDA 1U9RA 1BCPD 4P73A 1IBMQ 3S17H 4XT3B 1U4LA 1VMCA 1OXSC 3NPPA 1JT8A 1AE3A 1A2TA 1LYLA 3I2ZA 3SE0A 4DXGA 3EROA 2YU9H 4FF3A 4FXDA 1QE6A 1HNXL 2EY5A 4CHTB 1I6HB 2CQAA 4JOIC 2EYFA 1IBKL 3KJPA 2IT1A 2EQSA 2NVYH 3K8AA 1SEBD 2NZOA 3HKZB 1CT1D 2E8GA 3OIPA 1XPUA 4E6IA 5JPNC 3RZOB 4BA2I 5EAYA 2YTXA 5IT9c 5C5MA 2GA4B 3M3YB 2CW0D 1EY7A 1HFNA 3BS1A 4HJAA 3QIAA 4IURA 1I50H 5C3EH 4KN4C 1J5EQ 4OO1I 5IWAQ 3A5ZB 1BO0A 3K6OA 2HHHL 4A3KB 3GTKB 1H95A 1N32L 2R93G 2JXMB 2HT1A 1SNQA 1XYIA 4JI3Q 1FGBD 2EXDA 2IL8A 5BN4A 1UAPA 1BCPF 1EOTA 1TY2A 2OWOA 2NBFA 4QIWE 3I4MH 2WB1E 1NCVA 2K5VA 1JQYD 2V4DA 3KBGA 4A3FH 1K83H 2D2CC 3J81L 2NB0A 4DR3Q 4KJNA 2ICIA 2QCPX 5T1IA 1UE6A 1SROA 1R9TB 3HOZB 1B3QA 3J7ZC 3AEVA 1QG7A 1B3AA 4B9WA 1PH1A 4DAVA 5IGGA 1XXGA 5C4JB 4H44C 4NXML 1STAA 3UDFA 1UE7A 1NTGA 1ML0D 4L8JA 4RCOA 4MIUA 3J81c 2ZXRA 1B2TA 2VUMH 4H13C 4LUOA 1TY0A 5J39A 1ILPA 1JC7A 2NVTB 1G6PA 4RKLA 3BJUA 3A0JA 4UPAA 2MNAA 3TN2A 4KN7C 3J81j 2HQEA 4BBSG 2B2TA 3M7NA 1XMOL 4WJWA 5KYIA 5E7NA 1PH7A 1SYGA 4NW2A 3UI2A 3AFQA 3KDFB 4A3GG 4DUYL 3RZDH 1X9NA 1VS0A 2KCNA 2R7DA 4IFDI 2UU9L 1TWFB 4R8IA 1YNNC 1A15A 1BQQT 2XWJB 3CRKC 2RKSA 3GTLH 3VR2A 4LFAL 1EZ8A 1BDOA 2CQOA 1TU2B 3BDCA 4TQUS 3RR5A 3M7GA 2HQLA 1PTOF 2QKIC 2NYZD 5CC4A 1ZEQX 3S1QB 1ENFA 3E3XA 4LJZC 2NZHA 2ALYB 2WV6D 4UP9A 1B9MA 5ELDA 5JJKA 4JPBW 4JG2A 2SNSA 1IBML 3T1HL 2E76C 5M9OA 4RGMA 1HNWQ 1HZBA 4DUYQ 2N78A 4K5XA 4DV0Q 3KUPA 2VY3A 3GTQB 3ULLA 4CDDC 5F2DA 2HHHQ 3RN5A 1C4QA 3HKZE 4LF8L 1EY9A 5GROA 3D6WA 5IT9L 2DNEA 4NKLA 2Z4HA 2R61A 1PTOH 3HOYH 1IW7D 1N36L 2ENBA 1PH9A 4OIKA 3F1ZA 4AYBG 3NBHB 1IZ6A 1GJXA 4HJ8A 3I3CA 2L4NA 4KHZA 1FR3A 3V05A 3W5OA 4DR7L 5IYCG 4KKTA 3JAME 1X54A 4C3IH 5C4XB 1X3EA 1JR0D 2JJQA 4NP5A 5EKLA 4EVOA 4P74A 1U4RA 2B39A 2R3ZA 4B3SL 3EIVA 2RHSB 2O2LD 4B3RQ 1B50A 1SYFA 1R4PB 2K5QA 1IXRA 1SFOB 1SR3A 5C0XI 2MHVA 2HCIA 1SLJA 4DR7Q 4JBKA 3KLRA 2I5MX 1UE5A 1QVGA 1P16A 4DV5Q 3K5MA 2L0CA 4A3MH 5JAVA 5KNDA 4O1NA 5C4JH 2F0PA 4N9TA 4LK1C 4B3RL 2Q2TA 3L2PA 2Q8RE 2XSCA 1R9TH 1PFNA 1XJVA 2E2IH 1N32Q 3KDFA 3S9WA 5C3WA 4X65L 1EQVA 3S15H 1AW7A 3M4YA 4C3JG 2EY6A 2A5HA 2F0TA 2Z6BA 4JI2L 5EBCA 2JA5G 4C3HG 3C1EA 4GKJQ 1JJ2A 1F77A 1YNXA 2Y0SE 2K5NA 3LGJA 4IFDH 1SYDA 2DJFC 1PV4A 2JQOA 1FVIA 3T53B 5ELEA 2BDNA 4U673 4Y52H 3J7A5 1XMOQ 3M4OB 1I4PA 4M1UB 4O0AA 2F0HA 1D5MC 2EDGA 4G7ZC 3HOVH 4JV5Q 4DV5L 2CHBD 3M3YH 4UHVA 2VUMG 4CBVA 3C3LA 4B3ML 1Q8KA 3H94A 1KDCA 1YHAA 3H09A 3GQBA 5AJ3Q 1WTWA 2JA8G 4ZKBB 1TS2A 2Z6KC 4BY1G 3SK4A 1Q3LA 1KLGD 4GLAC 2JA5H 1I4XA 2NVYB 5CV6A 3U4VA 4QB4A 5GQOA 2PW7A 4LMQD 3J80i 1Q12A 1PRTD 4X65Q 3X3NA 5D14A 3S1RB 1FJGQ 2L15A 3W2DA 3D3RA 2YU9B 1X6OA 5E3FA 3FHWA 4CJ0B 2RCNA 1F9RA 2UXCQ 3K0YA 1L0XB 4AQYQ 3HOVG 3CPWA 1LO5D 3NK9A 3PGZA 4BBSB 1GUSA 3I4OA 5C44B 2JA6H 4X62Q 1N9WA 2WACA 2LMCB 4A3BG 2GVBA 4I7AA 3S1NH 4APVA 1U5KA 2OQ0A 1ILQA 1SFOH 5C4ZA 3CCVA 1DM0B 4PQXA 3CHBD 4C3HH 2MQHA 1DD2A 1KAAA 3Q8DA 3MC0B 1VQHA 5IGFA 1FL0A 1C7YA 1W2BA 4QGUA 1BR9A 4QY7A 2RHQB 3EN2A 1EQRA 1WTVA 1TWHH 4G7HC 1J9OA 2WIIB 4DGZA 2K05A 3EA6A 4J8QA 4BS9A 5LMNW 3SDZA 1HTLD 2A6ED 5DM63 1A2UA 2F0OA 3OWEB 3WOEA 5IGBA 4YCVA 2UXCL 1SE3A 1JMCA 1PTOC 4LFBQ 1HNZQ 2NTSA 3C2PA 1UNSA 4K6DA 2Q8IB 2KA7A 1RCVD 4X62L 2YV5A 2JA7B 4X3UA 4MHEA 4OELB 1C0AA 4IOAA 4I7ZC 1SYEA 3K5NA 4K0KQ 1MKHA 2KCCA 3OW2A 1XNRQ 1KAWA 2J7ZA 2K04A 4DV3Q 1BF4A 1ZXTA 2HDLA 1XWEA 1PH2A 5GADC 1V9PA 3QOLA 2G9DA 1PRTC 4H02A 4JV5L 4IALA 5IIFA 3S1MH 3R2TA 3VR5A 1ZYRC 2UU9Q 4R4CA 1O80A 4DV3L 1ICWA 3DWAA 1VQIA 1BVSA 3MXPA 4JI7L 4CDFC 1LT5D 5COYA 5AJ3L 4AYBB 5K36G 1ET9A 4A93G 1BUVT 2KEEA 4XYQA 4RAUC 2MFIA 2E74C 2HUGA 3TBIB 1IBLQ 3A8KE 3NP8A 1L2FA 1IHZA 1VQFA 4DV6L 1MJEA 4GNXA 2KHIA 2QA4A 1CSPA 1ZKOA 4DNIA 1JOQA 2KHSA 3U9SA 1XTDA 2UXDL 4QCLA 5KNBA 3PO3H 2HDMA 1AH9A 1D5XC 1EU4A 3NUCA 3S1RH 4DUZQ 2JA8B 3ERQA 4XXEA 2A73B 1Q81C 1K28A 2B2WC 4QIWB 3HKZG 2LY7A 3I90A 5LMNL 1XNQL 4QJFA 5DAUA 1HR0Q 2PZUA 1EFWA 2WFWA 1N34Q 4DV1L 2VQFQ 4X3SA 3DEOA 1XPRA 4ZUIA 4GS3A 5EBDA 4BBRB 5HGQA 2H4OA 1YNND 1NJIC 2CCZA 4KKUA 4LF4Q 5LL6X 4BY7H 5HY6A 3RLNA 4A3IG 3LWUA 1Q1EA 2ZT9C 2L5TA 1VF5C 3Q24A 1NMFA 4A3KG 3MFGA 3UDIA 3L9AX 2F4VL 5IOCA 4GZYC 2VB2X 2KECA 4HAEA 1PFSA 3NQTA 4OL7A 3P75A 3FDTA 1KRTA 4BY1H 4JI4L 4HJ9A 1K83B 4RA8A 2CVRA 2E75C 3IL8A 1BNZA 4RHSA 3GTOB 5IWAL 2BA0A 3W1BA 1OXTA 1C48A 3BZCA 4K5WA 1F2MA 3STBD 1VQ9A 4GKKQ 2EYHA 4M8AA 5CV5A 3ERSX 1PVOA 5D65A 1CKNA 2ICEC 1HNZL 4IZ8A 2KUMA 2DGYA 2IPKD 1F9PA 2M2LA 4BY1B 1SYBA 2E2IB 2MPMA 4LUZA 2XWBB 2RDFA 1E7ZA 1EY8A 1TWCH 2UXBQ 1UE1A 1Q46A 1CHQD 3HZXA 5D3DA 1HQMC 2F52A 1H9MA 4GKKL 2FINB 2N3SA 4ME3A 4JC0A 1JE4A 5EPKA 1I4HA 1HFGA 1LTSD 2PCFB 4DV4L 3HOXH 1YHQA 2PQAA 3G7LA 2F0MA 4IUNA 1S40A 2F0GA 2QEJC 1STBA 3CU7A 2ASBA 4L5QA 4TKOB 1YJ9A 4GN4B 2EVBA 3ER0A 3X3MA 1TVXA 3SK6A 2JP1A 1MSGA 4PZ6A 4OWWB 4WJ3M 3H15A 4ME5A 2R93H 4NMZA 1I6HH 3GV3A 2F1MA 1E2WA 5K36H 3PO3B 4JBWA 1HZCA 2X6GA 1HR0L 1STNA 2OF1A 3CAMA 4DR1L 3EJIA 1V8QA 3FEWX 1EL0A 4OIJA 2A19A 1PZJD 2BCOA 3DLLA 4DV6Q 1YNJD 2K7VA 1B53A 1SNCA 1K3RA 2BA1A 5CV4A 3PIOA 4JW0A 4IN3A 1B4OA 3S2DB 3M9BA 5CR3A 2RQXA 2TMPA 1YVCA 2BE5D 1KLUD 1CK1A 2D0OA 1DYQA 1U4PA 4DU9A 4C2MH 4F88A 1EWHA 2KVMA 2Z9HA 4DR5L 2R7ZB 1MBYA 5IT9E 4LF6Q 2Q2HA 4RGTA 1AN8A 4LAAA 1Y8OB 3T16A 4WORA 1BBUA 3HGBA 3VYSA 1EIGA 4XYOA 2BDOA 2FXQA 1TKWB 1PYSB 2WB1G 1RTOA 4MTNA 4GOPB 3S1QH 3O13A 1KD1C 2A8VA 4DXFA 4OHJA 1EEFD 5D3IB 4GN5A 4HIDA 2K01A 2A69D 2B2WA 4QUCA 1SN8A 1N34L 3GTPH 1O7IA 3RZDB 3QOJA 3A5UA 5CBEE 1AEXA 4MZ9A 1CA6A 3CPFA 2NN6I 4FF4A 3CCMA 1JB3A 4EGVA 3TS2A 4HJ7A 1B8AA 4QF4A 3CCUA 2UUAQ 3ICEA 2F0FA 3TP7A 4A75A 4DUZL 1ESRA 1EUJA 3DM3A 1SBBB
chains in the Genus database with same CATH topology
1KNAA 4PMBA 3GTPB 1LTID 1HUMA 4DF7A 2F0LA 4EQPA 2F0UA 1IKMA 5CV7A 3ITPA 3OOCA 3NWTA 5CORA 1Y69U 1CQVA 2LKVA 2EY2A 3IFTA 1ENAA 3S16B 4DNRB 1Y8NB 3RUZA 4IUQA 3BZDB 3FVQA 4PNYA 3JAML 4A3FB 2NN6G 3OIQA 4K5VA 3HOUB 5JOBA 2G9HD 3NHHA 1GXDC 3LX0A 1KTKA 5CYUA 4KV6A 1CQFA 3V2TA 1MGSA 1TT2A 3DEPA 2AWNA 3GV6A 4K2LA 5KGUA 2A6HC 1FNWA 1OXXK 3K5OA 1GUOA 5EQ0A 3MEHA 5EGTA 2F0DA 1KABA 1V1OA 3P1HA 1QOHA 1AZPA 3A55A 2F0QA 4BWGB 1ZYRD 1LT6D 1HUNA 1AFPA 4PMCA 1EFID 4KJOA 2B8FA 3S17B 4Q0FA 2B2TC 1A6XA 1EQTA 3P20A 3MHBA 3S14B 1LTRD 1G91A 1TWCB 3TZUA 2F3WA 1NR2A 3S2HB 3NTIA 1D1KA 3OWFA 2B63B 2SNMA 2N88A 4UDUC 1A3VA 4IQZA 2B8GA 5IGEA 3GTJB 4A3IB 5AFWA 5IODA 5J22A 4FYDA 1RHPA 2K6AA 2WKDA 3LWEA 1GUWA 5FK9C 2RVLA 4G7OC 2Y0SB 3KF8A 5FKAC 3MWYW 1X3QA 2JYOA 2XIWA 3T56B 2E2JB 1S5FD 4S3SA 3VR6A 1EZ6A 2I07B 3NE5B 3TP8A 2A68C 5FO8B 1QB5D 1WCMB 4HCEA 2IWHA 1IKLA 1PYWD 3J81E 3CKIB 3CQZB 3RD4A 4HMIA 3PUVA 5I9OA 1DOKA 2F3VA 2D62A 2F0SA 3MA2B 1E2VA 1O7YA 1R4QB 1NSNS 1MI2A 5BN5A 3I73A 3GD7A 3H3VC 2F0NA 1VF7A 4PMWA 3BVMA 1GHKA 3Q22A 3LNNA 4FXKC 3PIP3 2VNUD 3DUZA 1DOMA 4H7BA 4FO2A 2PNRC 3FPUB 2KEDA 3PUXA 2O4XA 4ZKCB 3KLSX 3MTSA 4I65A 2R6GA 3AU7A 2B2UC 2MGSA 4CJ1B 2A6EC 4XQJA 1J8IA 3ND9A 2PMZB 1PFMA 1TS3A 3FMCA 1PTOD 1RTNA 2ID0A 2EYLA 5M3MB 2IJ0A 4J1MA 2KOLA 1STYA 1SYCA 2E2HB 3OMGA 3URYA 3QB3A 1O78A 1L0YB 2EJGC 5EJWA 4ZYSA 1DONA 5A2QL 2DY7A 3A54A 3L3OC 1ESFA 1F9SA 3NQIA 1TWHB 4EQOA 2XNAC 1JICA 1RODA 2RA4A 1EU3A 1MSHA 3IFDA 1ET6A 1EEID 4ZK9B 2X6LA 1X32A 1DCZA 4F87A 4NDXA 2JA6B 2O5JC 2M9VA 1I50B 3SHLA 5KNCA 3J7YW 3D4WA 4DAPA 3D8GA 2EY1A 2F0IA 2EPBA 1D1IA 1IL8A 1FNVA 4HSVA 3U9OA 1K8OA 1RKNA 5FLXE 1FNUA 2ZXOA 1I3QB 5K5PA 3TP6A 2FMMA 3DXJC 3HOXB 1EY0A 2QILA 1Y8PB 1QILA 2FJ2A 3K59A 4RGNA 1G291 3R93A 3VYRA 1B44D 3ZYYX 1Q8IA 2L11A 2F03A 2QDBA 3VA5A 2K33A 4A3GB 2EJFC 1G2TA 1LT3D 4KKSA 5I6WA 4IFDG 2B2YA 2C9OA 5EPJA 3I4NB 3TDQA 4H0LC 2WB1B 2LFNA 1HXYD 5CGKA 1FYCA 1V1PB 3N6RA 4Z9CB 2AUJD 2EZVA 1DZ1A 4FF1A 3T51B 1RJTA 1TS5A 1W6KA 1NR4A 4TSSA 2K5DA 1LTAD 4UAIA 5ELFA 3T13A 4F7XA 3Q23A 3EFXD 2SDFA 5KRUA 1PMRA 2OT2A 3V96A 1QNUA 5JEAJ 4N9PA 1E2ZA 2RBMA 3BVZA 3EVQA 2AQ3B 4ID6A 1H9SB 1HPCA 2NZ1D 5CV9A 1VMPA 4DK0A 3K7AB 1H9JA 4FNFA 4TRDA 3RMHA 2YYZA 2BE5C 2MJ8A 4B9XA 1SSOA 3H0GB 4PV1C 4C1NK 3QO2A 2SOBA 2K32A 3A7LA 4XDXA 3BDLA 4KHVA 3DM1A 3E6ZX 2WKCA 1RDPD 5DM73 2PYKA 3NSWA 5LHY1 5C0XH 4FVMA 1PRTF 1WD1A 5E4WC 1BBXC 4FP5D 5C4HA 3E5SA 3GO5A 3K58A 4J6HA 3MFYA 1NUCA 2IX3A 1GUNA 5HURA 1D2BA 1Z7TA 5KYLA 1LLRD 5LL6S 4C3IG 2EYJA 3DWPA 5ISRA 1H9KA 1H9RA 5E4XA 2EYPA 2R93B 4DFAA 1EYAA 1S4ZA 1V1PA 2PO4A 3HEJA 3OW7A 3C46A 3MXNA 2PZWA 2VUMB 1PFBA 1BOSA 1AZQA 3S1NB 2F0WA 4EQNA 3SVMA 3BYTB 1SAPA 3PUYA 4HSPA 5T1GA 3GP7A 1G6ZA 4RH6A 4RCNA 1K8MA 2D5DA 2L1BA 5JPMC 2OEOA 5C5LA 2AQ2B 1M8AA 2M00A 4HTHA 1Z6HA 5I6YA 3I4MB 1TS4A 3A8JE 2JEAI 1EIHA 5KEEA 2EE1A 3J7AF 3PUZA 4R8NA 3D6CA 4XT1B 1DJRD 1EWCA 3QJYA 1VCIA 2IX1A 3NTKA 2NN6H 4BY7B 1HTPA 2A74C 1II3A 1ENCA 1AP0A 3R2IA 2EYMA 1TWGB 3R8BA 1CA5A 2AWOA 3Q6SA 1SNPA 2F0KA 4CKCA 4C3JB 2DY8A 1IW7C 4A3MB 1CTMA 5FO7B 4XQNA 2NVQB 2D9UA 4K2KA 4U68A 2MP1A 5C6AA 1SMYC 1BCPB 2ZXPA 4K8IA 1O7ZA 2NVXB 3H6MA 1OXVA 4KY7A 3P7JA 3VR4A 4OO1H 3J7AV 4F8MA 1DXMA 1MD2D 5EKIA 1A3TA 3F2UA 4KMUC 2XRSD 5BN3A 1FD7D 4RHRA 1EYCA 3I91A 2RDGA 1PDQA 4ODGA 5J1ZA 1WD0A 3HOWB 5JEAH 4ZRZA 1M4VA 2J4XA 1QWYA 4ILWA 2F0VA 2QF7A 4Q5VA 3M85A 4CKEA 4ZAIA 1F2YA 4HEDA 3WDNA 1H9SA 3BDOA 3HS0C 2L12A 4HMJA 4QUFA 4A93B 3IKJA 2IW3A 3A7AB 5TSSA 5G3LD 2L9HA 3VR3A 2MUYA 1W6JA 5JJZA 3GTLB 1IYUA 2PZTA 1OXUA 5M5XB 3T4AC 2NWGA 1GHJA 3CRLC 5DEHA 1OO9B 1JWMD 2PPBC 1EY6A 3G6JB 2JA5B 4X3TA 4OGQC 4A3EB 1X3PA 3PO2B 2K1BA 4HCSA 2F0EA 2K5WA 1U4MA 2EJMA 1JOKA 2JEBI 1GUGA 1STHA 3DMUA 2Z1CA 1B9NA 2E2DC 1HRJA 3Q0AA 1CHPD 1HCZA 3QG1A 2FHTA 1C8CA 2A69C 1SNMA 3PIO3 3L7ZC 1Z47A 5CMDA 4RWSC 2A68D 2FMCA 4C56C 4CGYB 5I2XA 3MZ5A 4JK1C 4YIJA 4IUVA 4WRDA 4K6LA 3VYUA 2O5IC 5CV8A 4XIGS 4L63B 2B2YC 2EOTA 1PZKD 2C5CA 1HA5A 1LTGD 3TP5A 5JVG3 1CI3M 4C3IB 3PUWA 1SNOA 1LTBD 5A35A 1WVLA 3I4LA 1LTTD 3NXWA 5G3LF 3D4RA 2H1EA 1BCPC 2KQ3A 3AMUA 3VA7A 3HOYB 1PTOB 1SMYD 2TSSA 1KNEA 1YNJC 1S5ED 2WINB 4MN3A 4IUTA 3OHXC 5CBAE 1F2ZA 3AB9A 4K14A 2AQ1B 1TIID 5E1FA 3NTHA 1GOZA 1GUTA 1Q90A 3OPOA 2J0TD 5JVH3 3SK5A 4HR7B 1CZGA 4CKBA 3QWNA 1SE4A 4P2CB 2KJXA 3H91A 4HN7A 4ZLTF 3NWSA 4KD4A 4FXGC 2RDHA 3ONAB 3E0JA 4KY5A 1T5XD 5C0XJ 3DWQA 3RLFA 1TQOA 3SXHA 4CJ2C 1PXUA 1KDBA 3A8IE 2L55A 3GTGB 1D6EC 2XRQD 2DNCA 2K03A 1SXTA 3EQLC 3A56A 5I9PA 3OMCA 3SR1A 3C1FA 4C1NI 4RKBA 5I2YA 2RSOA 4ZQ3A 4C3HB 4IFDJ 2RSNA 4L6TB 3TSSA 5DNFA 5IGCA 2BOSA 2LS01 3SEBA 3KBXA 5M3FB 2R92B 1I6VC 4DA2A 2XVSA 4A3DB 1CFMA 4RGOS 3SK8A 1HQRD 3NBHA 3ND8A 5ELBA 3D31A 4QMGA 1STEA 4R9WA 2PW5A 3K57A 2B2VA 1RF2D 1G2SA 1TR5A 3OSOA 5EKKA 2I46A 5JEAG 1WTOA 1A3UA 5C3XA 1S5BD 2PQEA 2FFKB 5KIXA 3HP3A 5IGDA 5C3EB 3HOVB 3N52A 1SJHD 2A6HD 4DK1A 1SNDA 3FPPA 2VB3X 4G4KA 2JE6I 3WOFA 4WFN3 4DAYA 1SDFA 2NUCA 1KDAA 1ONLA 2NTTA 1I4GA 3HG9A 3S15B 2SEBD 1SJED 4K8JA 1S5CD 3PMFA 4XTCS 1QJOA 5C0XG 4FF2A 2N55A 2AUKA 1T5EA 2EYOA 4G57A 3R3OA 4KI0A 4A3JB 1JOOA 1G8ZD 2Q8TA 1SE2A 5FLXL 1Y1VB 1XTCD 4DN4M 1JWUD 2CW0C 2F0JA 2WAQB 3BG3A 5A2QE 5FOBB 4OO1G 4KTAA 4XQQA 4IUUA 2XN9C 1VDZA 1CZWA 1JCKB 1I4RA 3FKIB 4V190 2Z8LA 3PV0A 4V0BA 1XX8A 1PZID 2EXZA 2K28A 1S5DD 4DNTB 3MXUA 1JORA 5I4DA 3K5LA 2F4IA 5FO9B 1QCBD 1QNKA 5M5WB 3W3AA 1F9QA 5M5YB 2Z4IA 3GTMB 1Q1BA 1E0BA 3HRZC 3NBIA 2VXWA 3DHQA 3BVGA 1PLFA 1LT4D 3J80E 1UEAB 1WTXA 2DN8A 1EY5A 3TMEA 2B2VC 4B08A 1RD9D 1I4QA 4RFBA 3MVVA 1UUPA 3I72A 3BYYB 5NUCA 1HHVA 1DOLA 1TWAB 4ZUJA 4KD3A 1D5ZC 3S1MB 3KK7A 4KK7A 2X69A 4Y7NB 3IAYA 2IX0A 3J80L 3VYTA 2JSOA 4O42A 3MAQA 4A3BB 5EPLA 1WTPA 1EY4A 1B1ZA 1STGA 2WP8J 1WTRA 1LV9A 3I8ZA 3I70A 5HGTA 1BXTA 4X3KA 2B2UA 2OXPA 1IYVA 3MXGA 4ULLA 1NAPA 1WTQA 4KY6A 5ELCA 1Y1WB 1CM9A 1V43A 1HA6A 3KLSA 1JWSD 1LABA 3FRPB 1PRTB 1LACA 2HCCA 1O7LA 1EYDA 4IUPA 4C2MB 4BA1I 1F2LA 4ABNA 3D4DA 3TZDA 1U9RA 1BCPD 4XT3B 1U4LA 1VMCA 1OXSC 3NPPA 1A2TA 3SE0A 4DXGA 3EROA 4FF3A 4FXDA 1QE6A 2EY5A 4CHTB 1I6HB 2CQAA 2EYFA 2IT1A 1SEBD 3HKZB 1CT1D 3OIPA 4E6IA 5JPNC 3RZOB 4BA2I 5C5MA 2GA4B 3M3YB 2CW0D 1EY7A 1HFNA 3BS1A 3QIAA 4IURA 4KN4C 4OO1I 1BO0A 3K6OA 4A3KB 3GTKB 2JXMB 1SNQA 1XYIA 1FGBD 2IL8A 5BN4A 1UAPA 1BCPF 1EOTA 1TY2A 2NBFA 1NCVA 1JQYD 2V4DA 3KBGA 2D2CC 3J81L 2NB0A 4KJNA 2ICIA 2QCPX 5T1IA 1R9TB 3HOZB 1QG7A 1B3AA 4B9WA 4DAVA 5IGGA 1XXGA 5C4JB 4H44C 1STAA 1ML0D 4L8JA 4RCOA 4MIUA 2ZXRA 1B2TA 4H13C 1TY0A 5J39A 1ILPA 1JC7A 2NVTB 4RKLA 3TN2A 4KN7C 2HQEA 2B2TA 3M7NA 4WJWA 5KYIA 1SYGA 4NW2A 3UI2A 2KCNA 4IFDI 1TWFB 4R8IA 1YNNC 1A15A 1BQQT 2XWJB 3CRKC 2RKSA 3VR2A 1EZ8A 1BDOA 3BDCA 1TU2B 4TQUS 3M7GA 1PTOF 2QKIC 2NYZD 5CC4A 1ZEQX 3S1QB 1ENFA 4LJZC 2WV6D 1B9MA 5ELDA 2SNSA 2E76C 5M9OA 4RGMA 4K5XA 3KUPA 3GTQB 5F2DA 1C4QA 1EY9A 3D6WA 5IT9L 2DNEA 4NKLA 2Z4HA 2R61A 1PTOH 1IW7D 2ENBA 4OIKA 1GJXA 3I3CA 2L4NA 4KHZA 1FR3A 3V05A 4KKTA 3JAME 5C4XB 1JR0D 4NP5A 5EKLA 4EVOA 1U4RA 2B39A 2R3ZA 2O2LD 1B50A 1SYFA 1R4PB 2K5QA 1SFOB 5C0XI 2MHVA 2HCIA 3KLRA 3K5MA 2L0CA 5JAVA 5KNDA 4O1NA 2F0PA 4N9TA 4LK1C 2Q8RE 2XSCA 1PFNA 3S9WA 5C3WA 1EQVA 1AW7A 3M4YA 4C3JG 2EY6A 2A5HA 2F0TA 5EBCA 4C3HG 3C1EA 1F77A 4IFDH 1SYDA 3T53B 5ELEA 2BDNA 4U673 3M4OB 1I4PA 4M1UB 2F0HA 1D5MC 2EDGA 4G7ZC 2CHBD 4CBVA 3C3LA 3H94A 1KDCA 3H09A 1WTWA 3GQBA 4ZKBB 1TS2A 3SK4A 1Q3LA 1KLGD 1I4XA 2NVYB 5CV6A 4QB4A 2PW7A 4LMQD 1Q12A 1PRTD 3X3NA 5D14A 3S1RB 2YU9B 3W2DA 3D3RA 5E3FA 4CJ0B 1F9RA 3K0YA 1L0XB 1LO5D 3NK9A 4BBSB 1GUSA 5C44B 2WACA 2LMCB 1ILQA 5C4ZA 1DM0B 4PQXA 3CHBD 1DD2A 1KAAA 3MC0B 5IGFA 1BR9A 1WTVA 4G7HC 1J9OA 2WIIB 4DGZA 2K05A 3EA6A 4J8QA 4BS9A 3SDZA 1HTLD 2A6ED 5DM63 1A2UA 2F0OA 3OWEB 3WOEA 5IGBA 1SE3A 1PTOC 2NTSA 3C2PA 1UNSA 4K6DA 2Q8IB 2KA7A 1RCVD 2JA7B 4X3UA 4MHEA 4I7ZC 1SYEA 3K5NA 2KCCA 2J7ZA 2K04A 1BF4A 1ZXTA 2HDLA 1XWEA 3QOLA 2G9DA 1PRTC 4IALA 5IIFA 3R2TA 3VR5A 1ZYRC 1O80A 1ICWA 3DWAA 3MXPA 1LT5D 5COYA 4AYBB 5K36G 1ET9A 1BUVT 2KEEA 4XYQA 4RAUC 2E74C 2HUGA 3TBIB 3A8KE 3NP8A 1IHZA 1ZKOA 1JOQA 2KHSA 3U9SA 4QCLA 5KNBA 2HDMA 1D5XC 1EU4A 3NUCA 2JA8B 3ERQA 4XXEA 2A73B 2B2WC 4QIWB 2LY7A 3I90A 5DAUA 2PZUA 4X3SA 3DEOA 4ZUIA 5EBDA 4BBRB 2H4OA 1YNND 4KKUA 5LL6X 3LWUA 1Q1EA 2ZT9C 2L5TA 1VF5C 3Q24A 4GZYC 3MFGA 3L9AX 5IOCA 2VB2X 2KECA 4HAEA 3NQTA 4OL7A 3P75A 3FDTA 1K83B 4RA8A 2CVRA 2E75C 3IL8A 1BNZA 4RHSA 3GTOB 2BA0A 1OXTA 1C48A 4K5WA 1F2MA 2EYHA 4M8AA 5CV5A 5D65A 2ICEC 4IZ8A 2KUMA 2IPKD 1F9PA 2M2LA 4BY1B 1SYBA 2E2IB 2MPMA 2XWBB 2RDFA 1EY8A 1CHQD 3HZXA 5D3DA 1HQMC 1H9MA 2FINB 1JE4A 5EPKA 1I4HA 1HFGA 1LTSD 2PCFB 3G7LA 2F0MA 4IUNA 2F0GA 2QEJC 1STBA 3CU7A 4TKOB 2EVBA 3X3MA 1TVXA 3SK6A 2JP1A 1MSGA 4ME5A 4NMZA 3GV3A 2F1MA 1E2WA 5K36H 3PO3B 4JBWA 2X6GA 1STNA 2OF1A 3EJIA 1V8QA 3FEWX 1EL0A 4OIJA 1PZJD 2BCOA 1YNJD 2K7VA 1B53A 1SNCA 2BA1A 5CV4A 4IN3A 1B4OA 3S2DB 5CR3A 2RQXA 2TMPA 2BE5D 1KLUD 1CK1A 1DYQA 1U4PA 4DU9A 4F88A 1EWHA 2KVMA 2R7ZB 1MBYA 5IT9E 4RGTA 1AN8A 4LAAA 1Y8OB 3T16A 4WORA 3HGBA 3VYSA 1EIGA 4XYOA 2BDOA 1TKWB 1RTOA 3O13A 4DXFA 4OHJA 1EEFD 5D3IB 2K01A 2A69D 2B2WA 4QUCA 3RZDB 3QOJA 5CBEE 1AEXA 1CA6A 2NN6I 4FF4A 1JB3A 4EGVA 4QF4A 2F0FA 3TP7A 1ESRA 1SBBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O80 A;  1NR2 A;  2L12 A;  1ICW A;  1KNA A;  4QUF A;  3G7L A;  2L11 A;  4O42 A;  1XYI A;  1WTW A;  1J8I A;  5COY A;  5EPL A;  2Q8T A;  3KUP A;  1PFM A;  4ZKB B;  1WTP A;  2B2Y C;  2RSO A;  2EOT A;  2N88 A;  5E4W C;  1Q3L A;  1RTN A;  2IL8 A;  1WD1 A;  1BBX C;  1EOT A;  2KEE A;  2L9H A;  1HUM A;  2RSN A;  1LV9 A;  3I8Z A;  4DN4 M;  1WTR A;  5DNF A;  4RAU C;  2KOL A;  2HUG A;  1TVX A;  4X3K A;  2B2U A;  1NCV A;  5JJZ A;  2JP1 A;  1MSG A;  1WVL A;  4LMQ D;  1IKM A;  1CA5 A;  5AFW A;  3KBX A;  3Q6S A;  5COR A;  1RHP A;  3GV3 A;  5D14 A;  1G2T A;  2H1E A;  3LWE A;  3D6W A;  1NAP A;  1WTQ A;  2B2Y A;  1GUW A;  5T1I A;  2NWG A;  2X6G A;  4IUU A;  5EJW A;  4CJ0 B;  1QG7 A;  1F9R A;  1B3A A;  2DY8 A;  5EPJ A;  1DON A;  2RVL A;  1KNE A;  1CM9 A;  4IUQ A;  2HDM A;  4OIK A;  2DY7 A;  1EL0 A;  1HA6 A;  4OIJ A;  1XX8 A;  4MN3 A;  4IUT A;  5CBA E;  5E4X A;  1B53 A;  2K28 A;  1ML0 D;  1F9S A;  3I3C A;  2L4N A;  3MWY W;  4R9W A;  1S4Z A;  1X3Q A;  1JIC A;  1ROD A;  2JYO A;  2RA4 A;  2HCC A;  2B2V A;  1G2S A;  1B4O A;  2XIW A;  4IUP A;  1MSH A;  1ILQ A;  3IFD A;  1B2T A;  4ZK9 B;  1DZ1 A;  4X3T A;  2B2W C;  1RJT A;  2D9U A;  2X6L A;  4U68 A;  2MP1 A;  1X32 A;  3I90 A;  1U4R A;  2R3Z A;  1NR4 A;  1U4P A;  1ILP A;  1MGS A;  1B50 A;  1F2L A;  4UAI A;  1X3P A;  1WTO A;  3DEP A;  1PFB A;  1AZQ A;  1IKL A;  2HCI A;  2K1B A;  4X3S A;  2KVM A;  1O7Z A;  1QNK A;  3DEO A;  3TN2 A;  3SVM A;  1WTV A;  1F9Q A;  2SDF A;  2FFK B;  3GV6 A;  1J9O A;  1U4M A;  1SAP A;  4HCS A;  3TZD A;  2B2T A;  3P7J A;  5T1G A;  2K05 A;  3HP3 A;  1G6Z A;  1DOK A;  3N52 A;  4XT3 B;  1E0B A;  1U4L A;  3H91 A;  1VMC A;  4ZLT F;  1EIG A;  1O7Y A;  2L1B A;  1MI2 A;  4NW2 A;  2KEC A;  2Q8R E;  2VXW A;  4HAE A;  1PFN A;  5EKI A;  3UI2 A;  1HRJ A;  1PLF A;  3FDT A;  2EPB A;  2NZ1 D;  1M8A A;  1RTO A;  3F2U A;  1QE6 A;  4RA8 A;  5EQ0 A;  2CVR A;  1IL8 A;  3IL8 A;  4HSV A;  4R8I A;  1BNZ A;  1VMP A;  1WTX A;  1A15 A;  3I91 A;  3ONA B;  2FHT A;  4MHE A;  4X3U A;  1C8C A;  1PDQ A;  1SDF A;  2B2V C;  1WD0 A;  2K01 A;  1AZP A;  5D65 A;  2B2W A;  2NYZ D;  4QUC A;  1EIH A;  2KUM A;  5CMD A;  4CJ2 C;  1F9P A;  2M2L A;  2EE1 A;  2J7Z A;  2K04 A;  2FMM A;  2MPM A;  4RWS C;  1HUN A;  4XT1 B;  2MJ8 A;  5CBE E;  1DOM A;  1HHV A;  1BF4 A;  1DOL A;  1ZXT A;  2BDN A;  2HDL A;  3R93 A;  1CA6 A;  3FPU B;  1SSO A;  2KED A;  2FJ2 A;  3QO2 A;  4ZKC B;  1HFN A;  4IUR A;  3MTS A;  2B2T C;  2N55 A;  4XDX A;  2FIN B;  2X69 A;  4ZAI A;  1EQT A;  1JE4 A;  2K03 A;  1BO0 A;  1HFG A;  4HED A;  2B2U C;  5EPK A;  3DM1 A;  2MGS A;  1ESR A;  4IUV A;  4CJ1 B;  1G91 A;  1AP0 A; 
#chains in the Genus database with same CATH topology
 3CD6 A;  1KNA A;  3SGI A;  5L37 A;  4LF7 L;  1CSQ A;  4PMB A;  3GTP B;  1IL2 A;  3PSI A;  1LTI D;  1HUM A;  4DF7 A;  2F0L A;  4EQP A;  2F0U A;  4A3L H;  1IKM A;  5CV7 A;  3ITP A;  3OOC A;  3NWT A;  4OEM B;  5COR A;  1Y69 U;  1CQV A;  2LKV A;  1K3B C;  2EY2 A;  3IFT A;  1V1Q A;  1ENA A;  1LTL A;  2ZJR A;  3S16 B;  1RIP A;  4DNR B;  1Y8N B;  3RUZ A;  4IUQ A;  2UUB L;  3BZD B;  3FVQ A;  4PNY A;  3JAM L;  4A3F B;  4LF6 L;  3CCS A;  2NN6 G;  3OIQ A;  2KCT A;  4K5V A;  1QUQ A;  3T1H Q;  3HOU B;  5JOB A;  2G9H D;  3NHH A;  4LNQ A;  1GXD C;  3LX0 A;  1KTK A;  1GD7 A;  5CYU A;  1SE8 A;  1K8A C;  4JI5 L;  4KV6 A;  1CQF A;  3V2T A;  1MGS A;  1TT2 A;  3DEP A;  4B3M Q;  2AWN A;  4LF4 L;  3GV6 A;  1I94 L;  1NNX A;  2HIX A;  4CDE C;  2OCE A;  4DR1 Q;  1LM0 A;  4L5S A;  4K2L A;  5KGU A;  2A6H C;  1FNW A;  1OXX K;  3K5O A;  4AIM A;  1VQK A;  2RCF A;  1VQN A;  1GUO A;  1VQB A;  4OXP A;  5EQ0 A;  3MEH A;  4QL5 A;  5EGT A;  1BKB A;  2F0D A;  1KAB A;  1V1O A;  3P1H A;  1QOH A;  1AZP A;  1VQC A;  3A55 A;  1DGS A;  2F0Q A;  4BWG B;  1ZYR D;  1GO3 E;  1LT6 D;  4A3J H;  1HUN A;  3S2H H;  1AFP A;  4DK3 C;  2F3I A;  4PMC A;  3EBE A;  3AQQ A;  1EFI D;  4KJO A;  2B8F A;  3S17 B;  4Q0F A;  4YCU A;  2B2T C;  1I94 Q;  2UUA L;  1A6X A;  1EQT A;  3P20 A;  3MHB A;  3S14 B;  1PH3 A;  1LTR D;  3NEM A;  1G91 A;  1TWC B;  3TZU A;  2F3W A;  1NR2 A;  5IP9 H;  3S2H B;  3NTI A;  2UUC L;  1D1K A;  3OWF A;  2B63 B;  2SNM A;  2N88 A;  4UDU C;  1A3V A;  2N49 A;  5C4X H;  2PNH A;  4IQZ A;  2B8G A;  4LFC Q;  5IGE A;  4JI6 Q;  3GTJ B;  4A3I B;  2VS1 A;  5AFW A;  5IOD A;  5J22 A;  4FYD A;  1D7Q A;  1RHP A;  2K6A A;  2WKD A;  3I4N G;  3LWE A;  1GUW A;  1E1T A;  1K0R A;  1Z9F A;  3E0E A;  2RVL A;  5FK9 C;  4CDC C;  1N33 Q;  4DV4 Q;  4G7O C;  2Y0S B;  3KF8 A;  3BZK A;  4LF5 L;  5FKA C;  3MWY W;  1X3Q A;  2JYO A;  4KHP Q;  2XIW A;  3T56 B;  2UUB Q;  2E2J B;  4IPC A;  1VQL A;  3HOX G;  1GKH A;  1S5F D;  4S3S A;  1VQG A;  4B3S Q;  3VR6 A;  3GTQ H;  2I5L X;  1EZ6 A;  2I07 B;  3NE5 B;  1E1O A;  3L0O A;  3TP8 A;  2A68 C;  5FO8 B;  1SMX A;  4HCE A;  1QB5 D;  1WCM B;  2IWH A;  1IKL A;  1PYW D;  3J81 E;  3CKI B;  3CQZ B;  3RD4 A;  4KHP L;  2V1C C;  1NY4 A;  4Y7N H;  5FLM H;  4HMI A;  3PUV A;  5J3B A;  5I9O A;  2R7Z G;  1DOK A;  1YHB A;  2F3V A;  1Y1V G;  4YY3 L;  2D62 A;  3H0G H;  2F0S A;  3VDY A;  3MA2 B;  1E2V A;  1O7Y A;  1R4Q B;  1NSN S;  1PYB A;  1MI2 A;  2KEN A;  5BN5 A;  4IJH A;  3I73 A;  3TRZ A;  3GD7 A;  3G6E A;  2XGT A;  2F0N A;  3H3V C;  1VF7 A;  3CCE A;  2Q2I A;  4PMW A;  3BVM A;  4BXX H;  1GHK A;  5M5X H;  3Q22 A;  3LNN A;  4FXK C;  4GOP C;  3PO2 G;  3PIP 3;  4IJL A;  2R92 G;  3ULJ A;  4OWT B;  1LUZ A;  2VNU D;  5LMU Q;  4HJ5 A;  1KXL A;  3DUZ A;  1DOM A;  4GNX B;  4H7B A;  4FO2 A;  2PNR C;  3FPU B;  2KED A;  3PUX A;  2O4X A;  4ZKC B;  3KLS X;  3MTS A;  4I65 A;  2H5X A;  1I5F A;  2R6G A;  3AU7 A;  2B2U C;  2MGS A;  4CJ1 B;  1PA6 A;  2A6E C;  4JI1 Q;  4XQJ A;  5IYB G;  4X66 Q;  5LMU L;  1J8I A;  3ND9 A;  2PMZ B;  1PFM A;  1TS3 A;  3FMC A;  5FJ8 G;  1PTO D;  1RTN A;  4A3F G;  2VQE Q;  1EIY B;  2ID0 A;  2EYL A;  5M3M B;  2E2J H;  2IJ0 A;  4DKA C;  4J1M A;  2KOL A;  2JN4 A;  1QZH A;  1STY A;  1SYC A;  3IRB A;  2E2H B;  3OMG A;  4UY8 C;  3URY A;  3QB3 A;  2ZTD A;  5IE8 A;  1O78 A;  1L0Y B;  2EJG C;  3FKI H;  5EJW A;  4ZYS A;  1DON A;  3HKS A;  5A2Q L;  4N8X 1;  1M1K C;  3KFU A;  2DY7 A;  3A54 A;  3F2B A;  3L3O C;  1ESF A;  1F9S A;  3NQI A;  1NBW A;  1TWH B;  4EQO A;  2XNA C;  1JIC A;  1ROD A;  1IBK Q;  2RA4 A;  4DV2 Q;  3I55 A;  4NXM Q;  1EU3 A;  1MSH A;  3IFD A;  1ET6 A;  1EEI D;  4ZK9 B;  4GLV B;  2X6L A;  2LXK A;  4NPS A;  1X32 A;  1Y1V H;  4JI7 Q;  1DCZ A;  4F87 A;  1XNR L;  4JCV E;  3CCJ A;  3S2D H;  2Q2U A;  2JK8 A;  3GTK H;  1VQJ A;  1WYD A;  4NDX A;  2JA6 B;  4X6A H;  2O5J C;  2M9V A;  1I50 B;  1E24 A;  3SHL A;  4DR2 L;  5KNC A;  3J7Y W;  3D4W A;  4DAP A;  3D8G A;  1YJN A;  2LSS A;  2EY1 A;  2F0I A;  4JI3 L;  2EPB A;  1D1I A;  2YTV A;  1IL8 A;  1FNV A;  4HSV A;  3U9O A;  1T9H A;  1RKN A;  1K8O A;  4IPH A;  1I3Q H;  5FLX E;  3F2C A;  1FNU A;  4WJ4 A;  2ZXO A;  1IBL L;  1I3Q B;  5K5P A;  4POF A;  3TP6 A;  2ATW A;  4P71 A;  2FMM A;  1VQM A;  3DXJ C;  3D0F A;  4JBJ A;  1EY0 A;  3HOX B;  2QIL A;  1Y8P B;  4JOI A;  1QIL A;  2FJ2 A;  3U4Z A;  3T1Y L;  3K59 A;  4RGN A;  1G29 1;  1VQ4 A;  3R93 A;  3VYR A;  3M4O H;  1B44 D;  3ZYY X;  1MJC A;  1Q8I A;  3FP9 A;  3I56 A;  2CFM A;  3MXN B;  3H3V H;  2L11 A;  2F03 A;  4GKJ L;  2QDB A;  3CC2 A;  1M90 C;  3VA5 A;  2K33 A;  4A3G B;  4A3E G;  4HIK A;  2EJF C;  5BR8 L;  1UEB A;  1G2T A;  1LT3 D;  4KKS A;  5I6W A;  4IFD G;  2B2Y A;  2C9O A;  4A3M G;  3K0X A;  5GAH C;  2F4V Q;  5EPJ A;  1Q86 C;  3I4N B;  4O2D A;  3TDQ A;  3PCO B;  4H0L C;  2WB1 B;  4A3D H;  2LFN A;  4BBR H;  1HXY D;  5CGK A;  1FYC A;  1V1P B;  5M3F H;  3N6R A;  1PH4 A;  5H1S E;  1GM5 A;  4Z9C B;  2AUJ D;  2EZV A;  1DZ1 A;  4FF1 A;  4EQ5 A;  1XNQ Q;  3T51 B;  1RJT A;  5GAG C;  1TS5 A;  2VW9 A;  2VQE L;  2AHO B;  1W6K A;  1NR4 A;  4TSS A;  2K5D A;  4DV0 L;  1LTA D;  4UAI A;  2E5L Q;  1CUK A;  5ELF A;  3T13 A;  3UE1 A;  4DV2 L;  4F7X A;  3Q23 A;  3EFX D;  2SDF A;  5KRU A;  1PMR A;  2OT2 A;  3CMA A;  3V96 A;  1QNU A;  5JEA J;  4N9P A;  4GNX C;  5FLX c;  1E2Z A;  2RBM A;  3BVZ A;  3EVQ A;  2AQ3 B;  4ID6 A;  1H9S B;  4JI1 L;  1HPC A;  2NZ1 D;  2AKW B;  5CV9 A;  5FLM G;  3UE0 A;  1VMP A;  4K0K L;  1KRS A;  4DK0 A;  3K7A B;  1H9J A;  4MNO A;  3CC7 A;  4FNF A;  4TRD A;  3RMH A;  2YYZ A;  4L5T A;  2BE5 C;  4BXX G;  2MJ8 A;  4B9X A;  2UUC Q;  4OX9 L;  1SSO A;  3H0G B;  4PV1 C;  4C1N K;  5DLQ E;  3QO2 A;  2SOB A;  3PO3 G;  2K32 A;  3A7L A;  3GTM H;  4XDX A;  2PI2 E;  3BDL A;  4KHV A;  4DR4 Q;  3DM1 A;  5IYC H;  3E6Z X;  2WKC A;  2R7Z H;  1RDP D;  1UWV A;  5DM7 3;  3W1G A;  4A76 A;  2PYK A;  1B70 B;  3NSW A;  1VQ6 A;  5LHY 1;  5C0X H;  4FVM A;  1PRT F;  1WD1 A;  5E4W C;  1BBX C;  4FP5 D;  3OYY A;  3CXC A;  4P72 A;  5C4H A;  3E5S A;  4YY3 Q;  3GO5 A;  3K58 A;  3HOY G;  4J6H A;  3K7A H;  3MFY A;  4DR5 Q;  1NUC A;  2IX3 A;  1GUN A;  4JVZ A;  5HUR A;  4ALP A;  3RNU A;  1D2B A;  1Z7T A;  5KYL A;  1LLR D;  4LWC A;  5LL6 S;  4C3I G;  2EYJ A;  3DWP A;  5ISR A;  1H9K A;  4DPG A;  1H9R A;  5E4X A;  3K81 C;  2EYP A;  2R93 B;  4DFA A;  1EYA A;  1S4Z A;  1V1P A;  2PO4 A;  3HEJ A;  4JI6 L;  3PIP A;  2VQF L;  3KF6 A;  3OW7 A;  3C46 A;  3MXN A;  4LF7 Q;  3G71 A;  5C4X G;  2PZW A;  1JJG A;  2VUM B;  5IP7 G;  3CCQ A;  1VQO A;  1PFB A;  1BOS A;  1AZQ A;  3S1N B;  2ZTE A;  2F0W A;  4EQN A;  3SVM A;  2NVQ H;  3S14 H;  1Q82 C;  3BYT B;  1SAP A;  3PUY A;  4HSP A;  1WJJ A;  5T1G A;  1KL9 A;  3GP7 A;  1G6Z A;  4LFC L;  4RH6 A;  3T1Y Q;  4RCN A;  1K8M A;  2D5D A;  4DV1 Q;  4UP7 A;  4C3J H;  2L1B A;  5JPM C;  4A3C H;  2OEO A;  5C5L A;  2AQ2 B;  4N8F A;  1M8A A;  4DAY B;  3RLO A;  2M00 A;  4HTH A;  1TWG H;  1Z6H A;  4A3G H;  5I6Y A;  3ULP A;  3I4M B;  1TS4 A;  3A8J E;  2JEA I;  1EIH A;  5KEE A;  2EE1 A;  3J7A F;  3PUZ A;  4R8N A;  3NEN A;  3D6C A;  2CH4 W;  4XT1 B;  3HOZ G;  1DJR D;  1EWC A;  3QJY A;  1ICF B;  1VCI A;  1VQE A;  2Z6K A;  2Z0S A;  2IX1 A;  3NTK A;  1GVP A;  2NN6 H;  4BY7 B;  1HTP A;  2A74 C;  2WAQ E;  1II3 A;  1ENC A;  1AP0 A;  2LXJ A;  3R2I A;  4LF9 Q;  2PI2 A;  2QEX A;  3B6Y A;  1VQ5 A;  1JB7 A;  2EYM A;  4HIO A;  1L0W A;  4DR2 Q;  4MTK A;  3CCL A;  4JI8 Q;  5IYB H;  1TWG B;  3HOU H;  3R8B A;  1CA5 A;  2AWO A;  3Q6S A;  4OON A;  2JA8 H;  1SNP A;  2F0K A;  1VQ8 A;  2OQK A;  4CKC A;  4C3J B;  2DY8 A;  4IOC A;  1IW7 C;  4A3M B;  2CH4 A;  1CTM A;  4PZ7 A;  5FO7 B;  2K52 A;  1QUQ B;  2K50 A;  1X56 A;  3TEH B;  4XQN A;  2NVQ B;  1U0L A;  3K80 C;  4YCW A;  3K7U C;  3KF8 B;  4FDB A;  1S3O A;  2D9U A;  4K2K A;  4U68 A;  2MP1 A;  2E5L L;  5C6A A;  4NXN Q;  3KJO A;  4R1J A;  1K0S A;  1SMY C;  1BCP B;  2ZXP A;  4K8I A;  3TQY A;  1PH5 A;  1O7Z A;  2QDL A;  3GDE A;  3H6M A;  4R4Q A;  4A3C G;  1OXV A;  2NVX B;  1X65 A;  4KY7 A;  3P7J A;  3VR4 A;  3PF4 A;  3GTG H;  3F2D A;  1Y1W H;  4GOP A;  4OO1 H;  3J7A V;  4F8M A;  4TVA B;  4UP8 A;  4J15 A;  1DXM A;  1MD2 D;  5EKI A;  1A3T A;  4P75 A;  3F2U A;  4KMU C;  2XRS D;  5BN3 A;  1FD7 D;  4RHR A;  4A3J G;  1EYC A;  3I91 A;  1K9M C;  1S72 A;  2RDG A;  1EIF A;  2KBN A;  1PDQ A;  4ODG A;  5J1Z A;  1WD0 A;  3HOW B;  4JYA L;  5JEA H;  4ZRZ A;  3S24 A;  1X55 A;  1HZA A;  1M4V A;  2J4X A;  1QWY A;  3U50 C;  1FGU A;  3WWV A;  4ILW A;  2I0Q A;  2F0V A;  1SRU A;  2QF7 A;  1XMQ Q;  4Q5V A;  3M85 A;  3JAM i;  4CKE A;  2K75 A;  4DK6 C;  4ZAI A;  1F2Y A;  4HED A;  3WDN A;  1A62 A;  2N8N A;  2JA9 A;  1N8R C;  1H9S A;  3BDO A;  3HS0 C;  2L12 A;  4ZCK A;  4HMJ A;  4QUF A;  1N36 Q;  4A93 B;  3IKJ A;  4LFB L;  2IW3 A;  4R4T A;  3A7A B;  3AYH B;  5TSS A;  1YEZ A;  5G3L D;  1QVC A;  2L9H A;  3VR3 A;  2MUY A;  4A4I A;  3FKI G;  1W6J A;  5JJZ A;  2VZA A;  3GTL B;  3UDG A;  1IYU A;  1L1O C;  2PZT A;  1OXU A;  1TWF H;  5M5X B;  3T4A C;  4B3T Q;  1NE3 A;  2C35 B;  4IPD A;  2NWG A;  3I4M G;  2RF4 A;  3PF5 A;  1GHJ A;  3CRL C;  2KHJ A;  4AH6 A;  5DEH A;  1OO9 B;  5M5Y H;  1EQQ A;  2ZJQ A;  3CQZ H;  1JWM D;  2MO0 A;  2PPB C;  1L1O B;  1EY6 A;  3G6J B;  1HR0 W;  2JA5 B;  1XMQ L;  4OX9 Q;  2NVT H;  4X3T A;  4BY7 G;  4AQY L;  4OGQ C;  2IHF A;  3G48 A;  4DV7 L;  3CC4 A;  3H0G G;  4A3E B;  1X3P A;  3PO2 B;  4KLK A;  1VQD A;  2K1B A;  4YHH Q;  4HCS A;  2F0E A;  2K5W A;  1U4M A;  2EJM A;  2ZM6 Q;  1JOK A;  2YTY A;  3CW2 C;  2JEB I;  1GUG A;  1STH A;  2WAQ G;  3I4N H;  3DMU A;  4NB3 A;  2UXD Q;  2Z1C A;  1B9N A;  2E2D C;  1HRJ A;  4JI5 Q;  4LF9 L;  3Q0A A;  1CHP D;  1HCZ A;  3QG1 A;  4A3I H;  1VQ7 A;  4X64 Q;  2FHT A;  1C8C A;  1YIT A;  2A69 C;  1KQS A;  3GTO H;  1SNM A;  3PIO 3;  3L7Z C;  1Z47 A;  5CMD A;  4QQB X;  4DR6 Q;  4RWS C;  2A68 D;  2FMC A;  3KYH C;  4C56 C;  1A0I A;  3PQI A;  4CGY B;  5I2X A;  3MZ5 A;  4JK1 C;  4YIJ A;  2DJG C;  3NEL A;  4IUV A;  4WRD A;  4K6L A;  3VYU A;  3RZO H;  2O5I C;  5CV8 A;  4DR6 L;  4XIG S;  4A3E H;  4JI4 Q;  3CP0 A;  1D8L A;  4L63 B;  1HNW L;  2B2Y C;  2EOT A;  1PZK D;  2C5C A;  1FJG L;  4DR3 L;  1HA5 A;  1LTG D;  3TP5 A;  1NMG A;  1CI3 M;  4R4I A;  4C3I B;  3PUW A;  5JVG 3;  3CME A;  4X64 L;  1SNO A;  1LTB D;  4PG3 A;  5A35 A;  1WVL A;  3I4L A;  2DUD A;  1LTT D;  3NXW A;  5G3L F;  1N33 L;  3D4R A;  1XPO A;  2H1E A;  1BCP C;  2KQ3 A;  3AMU A;  3BU2 A;  4DV7 Q;  3VA7 A;  1JE5 A;  1A63 A;  1PTO B;  3HOY B;  1SMY D;  2TSS A;  1KNE A;  3TRE A;  4RMF A;  1YNJ C;  1S5E D;  2WIN B;  5BR8 Q;  1PHJ A;  4MN3 A;  4B3T L;  4IUT A;  3OHX C;  5CBA E;  1F2Z A;  3H3V I;  3AB9 A;  4K14 A;  1HH2 P;  2AQ1 B;  1TII D;  1OTC A;  1CKM A;  5E1F A;  3NTH A;  1GOZ A;  1GUT A;  3CF5 A;  1Q90 A;  2ZTC A;  3OPO A;  2J0T D;  2PMZ E;  4A93 H;  5JVH 3;  2G5D A;  3SK5 A;  4HR7 B;  1CZG A;  2OTL A;  4CKB A;  1L1O A;  3QWN A;  1SE4 A;  4LF5 Q;  1J6Q A;  4P2C B;  2KJX A;  3H91 A;  4HN7 A;  4ZLT F;  1TXY A;  1WTH A;  3NWS A;  4KD4 A;  3HFZ B;  4FXG C;  2RDH A;  1Y1W G;  3HOW H;  1PH6 A;  1PH8 A;  3ONA B;  3E0J A;  1P8L A;  2JA7 H;  4KY5 A;  1E22 A;  1T5X D;  5C0X J;  3DWQ A;  3RLF A;  3STB C;  2HIV A;  1TQO A;  3SXH A;  1MHW C;  2BH8 A;  4CJ2 C;  1E3P A;  1CKO A;  1PXU A;  1KDB A;  1YJW A;  3A8I E;  2L55 A;  3KF6 B;  2ZM6 L;  3GTG B;  1D6E C;  2XRQ D;  2DNC A;  2K03 A;  1SXT A;  2Y0S G;  3EQL C;  1G51 A;  4A3L G;  3A56 A;  1TWA H;  2CWP A;  5I9P A;  3OMC A;  3SR1 A;  3C1F A;  4C1N I;  3G4S A;  1EOV A;  1KIX A;  4RKB A;  4DAM A;  5I2Y A;  3J81 i;  2RSO A;  4ZQ3 A;  4C3H B;  4IFD J;  4JYA Q;  4GLX A;  3M4Q A;  2RSN A;  4L6T B;  3TSS A;  5DNF A;  5IGC A;  2BOS A;  5IY0 A;  2LS0 1;  1JJC B;  1WCM G;  5C44 H;  3SEB A;  3KBX A;  5M3F B;  2R92 B;  4LUV A;  1I6V C;  4BBR G;  4IO9 A;  4DA2 A;  2XVS A;  4BBS H;  1CFM A;  4RGO S;  3OTO L;  4A3D B;  3F8T A;  2QGQ A;  4RG1 A;  3SK8 A;  1YIJ A;  1HQR D;  3TS0 A;  3NBH A;  3ND8 A;  5ELB A;  4AYB E;  3D31 A;  1HZ9 A;  4QMG A;  1STE A;  1WFQ A;  4R9W A;  2PW5 A;  3K57 A;  2B2V A;  1RF2 D;  1MIU A;  1G2S A;  1HNX Q;  2XTI A;  1TR5 A;  3OSO A;  5EKK A;  2I46 A;  5JEA G;  2B29 A;  3ZJY C;  1WTO A;  1A3U A;  5C3X A;  4A3K H;  1S5B D;  2PQE A;  2D0P A;  2FFK B;  2KCM A;  5KIX A;  3HP3 A;  5IGD A;  5C3E B;  3HOV B;  3N52 A;  1SJH D;  2A6H D;  2CKZ B;  4DK1 A;  2MO1 A;  2I5H A;  1IYJ B;  3HOW G;  1SND A;  2QW7 A;  3FPP A;  1CKN B;  2VB3 X;  4G4K A;  2JE6 I;  3WOF A;  4LW1 A;  4WFN 3;  4OWX B;  3GTJ H;  3KLW A;  1Y14 B;  4DAY A;  1SDF A;  2NUC A;  1KDA A;  1ONL A;  2NTT A;  1I4G A;  3HG9 A;  1ASZ A;  3S15 B;  4GN3 B;  3JC6 6;  2GN5 A;  2SEB D;  1SJE D;  4K8J A;  2OTJ A;  5IP9 G;  1S5C D;  2P5Z X;  3PMF A;  2BH2 A;  4XTC S;  1QJO A;  5C0X G;  1KHI A;  4FF2 A;  2N55 A;  2AUK A;  2K14 A;  1T5E A;  4JI2 Q;  2EYO A;  2R7F A;  4G57 A;  3R3O A;  1X3G A;  3RN2 A;  4KI0 A;  3CCR A;  4A3J B;  1JOO A;  1G8Z D;  2Q8T A;  1SE2 A;  5FLX L;  1Y1V B;  3J80 c;  5IP7 H;  1XTC D;  4DN4 M;  3U58 A;  1JWU D;  2CW0 C;  2F0J A;  2WAQ B;  2ZJP A;  3BG3 A;  5A2Q E;  2JA6 G;  5FOB B;  3E9H A;  2B3G A;  4OO1 G;  4KTA A;  4XQQ A;  3JAM c;  4IUU A;  2XN9 C;  1VDZ A;  1CZW A;  4YWM A;  1JCK B;  1EWI A;  1I4R A;  3FKI B;  4V19 0;  3AFP A;  2Z8L A;  2IHE A;  2B63 G;  3PV0 A;  5IYD G;  4V0B A;  1XX8 A;  1B7Y B;  3OTO Q;  1PZI D;  2EXZ A;  3UDX A;  2K28 A;  1S5D D;  4DNT B;  4YHH L;  3MXU A;  4R4O A;  1EYG A;  1JOR A;  2E2H H;  4JI0 Q;  2A1A A;  3PO2 H;  1BBW A;  5M3M H;  4HIM A;  5ELN A;  5I4D A;  3K5L A;  1X3F A;  2F4I A;  4A3B H;  3E9I A;  5FO9 B;  5GAE C;  1HJP A;  1KC8 C;  1QCB D;  1QNK A;  5M5W B;  3W3A A;  4JI0 L;  1F9Q A;  5M5Y B;  3QR8 A;  2ES2 A;  4LF8 Q;  2Z4I A;  1ASY A;  3GTM B;  2K5H A;  4EX5 A;  1Q1B A;  2UXB L;  4YWL A;  1E0B A;  3HRZ C;  3NBI A;  2VXW A;  3DHQ A;  3BVG A;  3KOJ A;  3S16 H;  4A3D G;  1PLF A;  5FJ8 H;  2HD3 A;  1LT4 D;  2R92 H;  3J80 E;  4POG A;  1UEA B;  1WTX A;  2CWA A;  2DN8 A;  1EY5 A;  3I7F A;  3M4P A;  3TME A;  2VL6 A;  1WI5 A;  2B2V C;  4LFA Q;  4B08 A;  1RD9 D;  1I4Q A;  1WOC A;  4RFB A;  3MVV A;  1K73 C;  1UUP A;  3I72 A;  1AE2 A;  3BYY B;  5NUC A;  1HHV A;  3MEF A;  1DOL A;  1TWA B;  4ZUJ A;  4DR4 L;  4KD3 A;  1D5Z C;  1Q7Y C;  3S1M B;  3KK7 A;  4KK7 A;  2GVA A;  4JBM A;  2X69 A;  4Y7N B;  3IAY A;  2IX0 A;  5M5W H;  1VQA A;  3HOU G;  1WCM H;  5C44 G;  3J80 L;  3VYT A;  2JSO A;  5LMN Q;  4O42 A;  5C3E G;  3MAQ A;  4A3B B;  4L5R C;  5EPL A;  2PQA B;  5M3M G;  1WTP A;  1EY4 A;  1B1Z A;  5ELO A;  4NXN L;  1STG A;  2WP8 J;  4PZ8 A;  1WTR A;  1LV9 A;  3I8Z A;  3I70 A;  5HGT A;  1K8G A;  1BXT A;  4X3K A;  2K4K A;  1YI2 A;  2B2U A;  1J5E L;  2OXP A;  1IYV A;  3MXG A;  3A74 A;  4ULL A;  5IYD H;  5JJI A;  1QVF A;  1NAP A;  1WTQ A;  5M3F G;  1C9O A;  4KY6 A;  1VQP A;  5ELC A;  3HOZ H;  2EIF A;  1Y1W B;  1CM9 A;  4X66 L;  5JJL A;  1V43 A;  1HA6 A;  3KLS A;  1A8V A;  1QZG A;  1JWS D;  1LAB A;  2NVX H;  3FRP B;  1PRT B;  1LAC A;  4IPG A;  1RL2 A;  2HCC A;  1O7L A;  2IY5 B;  1YZ6 A;  1EYD A;  4IUP A;  4JI8 L;  4C2M B;  2JA7 G;  2AMC B;  4BA1 I;  2B63 H;  1W3S A;  1F2L A;  1YBY A;  4ABN A;  3D4D A;  4YWK A;  3TZD A;  1U9R A;  1BCP D;  4P73 A;  1IBM Q;  3S17 H;  4XT3 B;  1U4L A;  1VMC A;  1OXS C;  3NPP A;  1JT8 A;  1AE3 A;  1A2T A;  1LYL A;  3I2Z A;  3SE0 A;  4DXG A;  3ERO A;  2YU9 H;  4FF3 A;  4FXD A;  1QE6 A;  1HNX L;  2EY5 A;  4CHT B;  1I6H B;  2CQA A;  4JOI C;  2EYF A;  1IBK L;  3KJP A;  2IT1 A;  2EQS A;  2NVY H;  3K8A A;  1SEB D;  2NZO A;  3HKZ B;  1CT1 D;  2E8G A;  3OIP A;  1XPU A;  4E6I A;  5JPN C;  3RZO B;  4BA2 I;  5EAY A;  2YTX A;  5IT9 c;  5C5M A;  2GA4 B;  3M3Y B;  2CW0 D;  1EY7 A;  1HFN A;  3BS1 A;  4HJA A;  3QIA A;  4IUR A;  1I50 H;  5C3E H;  4KN4 C;  1J5E Q;  4OO1 I;  5IWA Q;  3A5Z B;  1BO0 A;  3K6O A;  2HHH L;  4A3K B;  3GTK B;  1H95 A;  1N32 L;  2R93 G;  2JXM B;  2HT1 A;  1SNQ A;  1XYI A;  4JI3 Q;  1FGB D;  2EXD A;  2IL8 A;  5BN4 A;  1UAP A;  1BCP F;  1EOT A;  1TY2 A;  2OWO A;  2NBF A;  4QIW E;  3I4M H;  2WB1 E;  1NCV A;  2K5V A;  1JQY D;  2V4D A;  3KBG A;  4A3F H;  1K83 H;  2D2C C;  3J81 L;  2NB0 A;  4DR3 Q;  4KJN A;  2ICI A;  2QCP X;  5T1I A;  1UE6 A;  1SRO A;  1R9T B;  3HOZ B;  1B3Q A;  3J7Z C;  3AEV A;  1QG7 A;  1B3A A;  4B9W A;  1PH1 A;  4DAV A;  5IGG A;  1XXG A;  5C4J B;  4H44 C;  4NXM L;  1STA A;  3UDF A;  1UE7 A;  1NTG A;  1ML0 D;  4L8J A;  4RCO A;  4MIU A;  3J81 c;  2ZXR A;  1B2T A;  2VUM H;  4H13 C;  4LUO A;  1TY0 A;  5J39 A;  1ILP A;  1JC7 A;  2NVT B;  1G6P A;  4RKL A;  3BJU A;  3A0J A;  4UPA A;  2MNA A;  3TN2 A;  4KN7 C;  3J81 j;  2HQE A;  4BBS G;  2B2T A;  3M7N A;  1XMO L;  4WJW A;  5KYI A;  5E7N A;  1PH7 A;  1SYG A;  4NW2 A;  3UI2 A;  3AFQ A;  3KDF B;  4A3G G;  4DUY L;  3RZD H;  1X9N A;  1VS0 A;  2KCN A;  2R7D A;  4IFD I;  2UU9 L;  1TWF B;  4R8I A;  1YNN C;  1A15 A;  1BQQ T;  2XWJ B;  3CRK C;  2RKS A;  3GTL H;  3VR2 A;  4LFA L;  1EZ8 A;  1BDO A;  2CQO A;  1TU2 B;  3BDC A;  4TQU S;  3RR5 A;  3M7G A;  2HQL A;  1PTO F;  2QKI C;  2NYZ D;  5CC4 A;  1ZEQ X;  3S1Q B;  1ENF A;  3E3X A;  4LJZ C;  2NZH A;  2ALY B;  2WV6 D;  4UP9 A;  1B9M A;  5ELD A;  5JJK A;  4JPB W;  4JG2 A;  2SNS A;  1IBM L;  3T1H L;  2E76 C;  5M9O A;  4RGM A;  1HNW Q;  1HZB A;  4DUY Q;  2N78 A;  4K5X A;  4DV0 Q;  3KUP A;  2VY3 A;  3GTQ B;  3ULL A;  4CDD C;  5F2D A;  2HHH Q;  3RN5 A;  1C4Q A;  3HKZ E;  4LF8 L;  1EY9 A;  5GRO A;  3D6W A;  5IT9 L;  2DNE A;  4NKL A;  2Z4H A;  2R61 A;  1PTO H;  3HOY H;  1IW7 D;  1N36 L;  2ENB A;  1PH9 A;  4OIK A;  3F1Z A;  4AYB G;  3NBH B;  1IZ6 A;  1GJX A;  4HJ8 A;  3I3C A;  2L4N A;  4KHZ A;  1FR3 A;  3V05 A;  3W5O A;  4DR7 L;  5IYC G;  4KKT A;  3JAM E;  1X54 A;  4C3I H;  5C4X B;  1X3E A;  1JR0 D;  2JJQ A;  4NP5 A;  5EKL A;  4EVO A;  4P74 A;  1U4R A;  2B39 A;  2R3Z A;  4B3S L;  3EIV A;  2RHS B;  2O2L D;  4B3R Q;  1B50 A;  1SYF A;  1R4P B;  2K5Q A;  1IXR A;  1SFO B;  1SR3 A;  5C0X I;  2MHV A;  2HCI A;  1SLJ A;  4DR7 Q;  4JBK A;  3KLR A;  2I5M X;  1UE5 A;  1QVG A;  1P16 A;  4DV5 Q;  3K5M A;  2L0C A;  4A3M H;  5JAV A;  5KND A;  4O1N A;  5C4J H;  2F0P A;  4N9T A;  4LK1 C;  4B3R L;  2Q2T A;  3L2P A;  2Q8R E;  2XSC A;  1R9T H;  1PFN A;  1XJV A;  2E2I H;  1N32 Q;  3KDF A;  3S9W A;  5C3W A;  4X65 L;  1EQV A;  3S15 H;  1AW7 A;  3M4Y A;  4C3J G;  2EY6 A;  2A5H A;  2F0T A;  2Z6B A;  4JI2 L;  5EBC A;  2JA5 G;  4C3H G;  3C1E A;  4GKJ Q;  1JJ2 A;  1F77 A;  1YNX A;  2Y0S E;  2K5N A;  3LGJ A;  4IFD H;  1SYD A;  2DJF C;  1PV4 A;  2JQO A;  1FVI A;  3T53 B;  5ELE A;  2BDN A;  4U67 3;  4Y52 H;  3J7A 5;  1XMO Q;  3M4O B;  1I4P A;  4M1U B;  4O0A A;  2F0H A;  1D5M C;  2EDG A;  4G7Z C;  3HOV H;  4JV5 Q;  4DV5 L;  2CHB D;  3M3Y H;  4UHV A;  2VUM G;  4CBV A;  3C3L A;  4B3M L;  1Q8K A;  3H94 A;  1KDC A;  1YHA A;  3H09 A;  3GQB A;  5AJ3 Q;  1WTW A;  2JA8 G;  4ZKB B;  1TS2 A;  2Z6K C;  4BY1 G;  3SK4 A;  1Q3L A;  1KLG D;  4GLA C;  2JA5 H;  1I4X A;  2NVY B;  5CV6 A;  3U4V A;  4QB4 A;  5GQO A;  2PW7 A;  4LMQ D;  3J80 i;  1Q12 A;  1PRT D;  4X65 Q;  3X3N A;  5D14 A;  3S1R B;  1FJG Q;  2L15 A;  3W2D A;  3D3R A;  2YU9 B;  1X6O A;  5E3F A;  3FHW A;  4CJ0 B;  2RCN A;  1F9R A;  2UXC Q;  3K0Y A;  1L0X B;  4AQY Q;  3HOV G;  3CPW A;  1LO5 D;  3NK9 A;  3PGZ A;  4BBS B;  1GUS A;  3I4O A;  5C44 B;  2JA6 H;  4X62 Q;  1N9W A;  2WAC A;  2LMC B;  4A3B G;  2GVB A;  4I7A A;  3S1N H;  4APV A;  1U5K A;  2OQ0 A;  1ILQ A;  1SFO H;  5C4Z A;  3CCV A;  1DM0 B;  4PQX A;  3CHB D;  4C3H H;  2MQH A;  1DD2 A;  1KAA A;  3Q8D A;  3MC0 B;  1VQH A;  5IGF A;  1FL0 A;  1C7Y A;  1W2B A;  4QGU A;  1BR9 A;  4QY7 A;  2RHQ B;  3EN2 A;  1EQR A;  1WTV A;  1TWH H;  4G7H C;  1J9O A;  2WII B;  4DGZ A;  2K05 A;  3EA6 A;  4J8Q A;  4BS9 A;  5LMN W;  3SDZ A;  1HTL D;  2A6E D;  5DM6 3;  1A2U A;  2F0O A;  3OWE B;  3WOE A;  5IGB A;  4YCV A;  2UXC L;  1SE3 A;  1JMC A;  1PTO C;  4LFB Q;  1HNZ Q;  2NTS A;  3C2P A;  1UNS A;  4K6D A;  2Q8I B;  2KA7 A;  1RCV D;  4X62 L;  2YV5 A;  2JA7 B;  4X3U A;  4MHE A;  4OEL B;  1C0A A;  4IOA A;  4I7Z C;  1SYE A;  3K5N A;  4K0K Q;  1MKH A;  2KCC A;  3OW2 A;  1XNR Q;  1KAW A;  2J7Z A;  2K04 A;  4DV3 Q;  1BF4 A;  1ZXT A;  2HDL A;  1XWE A;  1PH2 A;  5GAD C;  1V9P A;  3QOL A;  2G9D A;  1PRT C;  4H02 A;  4JV5 L;  4IAL A;  5IIF A;  3S1M H;  3R2T A;  3VR5 A;  1ZYR C;  2UU9 Q;  4R4C A;  1O80 A;  4DV3 L;  1ICW A;  3DWA A;  1VQI A;  1BVS A;  3MXP A;  4JI7 L;  4CDF C;  1LT5 D;  5COY A;  5AJ3 L;  4AYB B;  5K36 G;  1ET9 A;  4A93 G;  1BUV T;  2KEE A;  4XYQ A;  4RAU C;  2MFI A;  2E74 C;  2HUG A;  3TBI B;  1IBL Q;  3A8K E;  3NP8 A;  1L2F A;  1IHZ A;  1VQF A;  4DV6 L;  1MJE A;  4GNX A;  2KHI A;  2QA4 A;  1CSP A;  1ZKO A;  4DNI A;  1JOQ A;  2KHS A;  3U9S A;  1XTD A;  2UXD L;  4QCL A;  5KNB A;  3PO3 H;  2HDM A;  1AH9 A;  1D5X C;  1EU4 A;  3NUC A;  3S1R H;  4DUZ Q;  2JA8 B;  3ERQ A;  4XXE A;  2A73 B;  1Q81 C;  1K28 A;  2B2W C;  4QIW B;  3HKZ G;  2LY7 A;  3I90 A;  5LMN L;  1XNQ L;  4QJF A;  5DAU A;  1HR0 Q;  2PZU A;  1EFW A;  2WFW A;  1N34 Q;  4DV1 L;  2VQF Q;  4X3S A;  3DEO A;  1XPR A;  4ZUI A;  4GS3 A;  5EBD A;  4BBR B;  5HGQ A;  2H4O A;  1YNN D;  1NJI C;  2CCZ A;  4KKU A;  4LF4 Q;  5LL6 X;  4BY7 H;  5HY6 A;  3RLN A;  4A3I G;  3LWU A;  1Q1E A;  2ZT9 C;  2L5T A;  1VF5 C;  3Q24 A;  1NMF A;  4A3K G;  3MFG A;  3UDI A;  3L9A X;  2F4V L;  5IOC A;  4GZY C;  2VB2 X;  2KEC A;  4HAE A;  1PFS A;  3NQT A;  4OL7 A;  3P75 A;  3FDT A;  1KRT A;  4BY1 H;  4JI4 L;  4HJ9 A;  1K83 B;  4RA8 A;  2CVR A;  2E75 C;  3IL8 A;  1BNZ A;  4RHS A;  3GTO B;  5IWA L;  2BA0 A;  3W1B A;  1OXT A;  1C48 A;  3BZC A;  4K5W A;  1F2M A;  3STB D;  1VQ9 A;  4GKK Q;  2EYH A;  4M8A A;  5CV5 A;  3ERS X;  1PVO A;  5D65 A;  1CKN A;  2ICE C;  1HNZ L;  4IZ8 A;  2KUM A;  2DGY A;  2IPK D;  1F9P A;  2M2L A;  4BY1 B;  1SYB A;  2E2I B;  2MPM A;  4LUZ A;  2XWB B;  2RDF A;  1E7Z A;  1EY8 A;  1TWC H;  2UXB Q;  1UE1 A;  1Q46 A;  1CHQ D;  3HZX A;  5D3D A;  1HQM C;  2F52 A;  1H9M A;  4GKK L;  2FIN B;  2N3S A;  4ME3 A;  4JC0 A;  1JE4 A;  5EPK A;  1I4H A;  1HFG A;  1LTS D;  2PCF B;  4DV4 L;  3HOX H;  1YHQ A;  2PQA A;  3G7L A;  2F0M A;  4IUN A;  1S40 A;  2F0G A;  2QEJ C;  1STB A;  3CU7 A;  2ASB A;  4L5Q A;  4TKO B;  1YJ9 A;  4GN4 B;  2EVB A;  3ER0 A;  3X3M A;  1TVX A;  3SK6 A;  2JP1 A;  1MSG A;  4PZ6 A;  4OWW B;  4WJ3 M;  3H15 A;  4ME5 A;  2R93 H;  4NMZ A;  1I6H H;  3GV3 A;  2F1M A;  1E2W A;  5K36 H;  3PO3 B;  4JBW A;  1HZC A;  2X6G A;  1HR0 L;  1STN A;  2OF1 A;  3CAM A;  4DR1 L;  3EJI A;  1V8Q A;  3FEW X;  1EL0 A;  4OIJ A;  2A19 A;  1PZJ D;  2BCO A;  3DLL A;  4DV6 Q;  1YNJ D;  2K7V A;  1B53 A;  1SNC A;  1K3R A;  2BA1 A;  5CV4 A;  3PIO A;  4JW0 A;  4IN3 A;  1B4O A;  3S2D B;  3M9B A;  5CR3 A;  2RQX A;  2TMP A;  1YVC A;  2BE5 D;  1KLU D;  1CK1 A;  2D0O A;  1DYQ A;  1U4P A;  4DU9 A;  4C2M H;  4F88 A;  1EWH A;  2KVM A;  2Z9H A;  4DR5 L;  2R7Z B;  1MBY A;  5IT9 E;  4LF6 Q;  2Q2H A;  4RGT A;  1AN8 A;  4LAA A;  1Y8O B;  3T16 A;  4WOR A;  1BBU A;  3HGB A;  3VYS A;  1EIG A;  4XYO A;  2BDO A;  2FXQ A;  1TKW B;  1PYS B;  2WB1 G;  1RTO A;  4MTN A;  4GOP B;  3S1Q H;  3O13 A;  1KD1 C;  2A8V A;  4DXF A;  4OHJ A;  1EEF D;  5D3I B;  4GN5 A;  4HID A;  2K01 A;  2A69 D;  2B2W A;  4QUC A;  1SN8 A;  1N34 L;  3GTP H;  1O7I A;  3RZD B;  3QOJ A;  3A5U A;  5CBE E;  1AEX A;  4MZ9 A;  1CA6 A;  3CPF A;  2NN6 I;  4FF4 A;  3CCM A;  1JB3 A;  4EGV A;  3TS2 A;  4HJ7 A;  1B8A A;  4QF4 A;  3CCU A;  2UUA Q;  3ICE A;  2F0F A;  3TP7 A;  4A75 A;  4DUZ L;  1ESR A;  1EUJ A;  3DM3 A;  1SBB B; 
#chains in the Genus database with same CATH homology
 1KNA A;  4PMB A;  3GTP B;  1LTI D;  1HUM A;  4DF7 A;  2F0L A;  4EQP A;  2F0U A;  1IKM A;  5CV7 A;  3ITP A;  3OOC A;  3NWT A;  5COR A;  1Y69 U;  1CQV A;  2LKV A;  2EY2 A;  3IFT A;  1ENA A;  3S16 B;  4DNR B;  1Y8N B;  3RUZ A;  4IUQ A;  3BZD B;  3FVQ A;  4PNY A;  3JAM L;  4A3F B;  2NN6 G;  3OIQ A;  4K5V A;  3HOU B;  5JOB A;  2G9H D;  3NHH A;  1GXD C;  3LX0 A;  1KTK A;  5CYU A;  4KV6 A;  1CQF A;  3V2T A;  1MGS A;  1TT2 A;  3DEP A;  2AWN A;  3GV6 A;  4K2L A;  5KGU A;  2A6H C;  1FNW A;  1OXX K;  3K5O A;  1GUO A;  5EQ0 A;  3MEH A;  5EGT A;  2F0D A;  1KAB A;  1V1O A;  3P1H A;  1QOH A;  1AZP A;  3A55 A;  2F0Q A;  4BWG B;  1ZYR D;  1LT6 D;  1HUN A;  1AFP A;  4PMC A;  1EFI D;  4KJO A;  2B8F A;  3S17 B;  4Q0F A;  2B2T C;  1A6X A;  1EQT A;  3P20 A;  3MHB A;  3S14 B;  1LTR D;  1G91 A;  1TWC B;  3TZU A;  2F3W A;  1NR2 A;  3S2H B;  3NTI A;  1D1K A;  3OWF A;  2B63 B;  2SNM A;  2N88 A;  4UDU C;  1A3V A;  4IQZ A;  2B8G A;  5IGE A;  3GTJ B;  4A3I B;  5AFW A;  5IOD A;  5J22 A;  4FYD A;  1RHP A;  2K6A A;  2WKD A;  3LWE A;  1GUW A;  5FK9 C;  2RVL A;  4G7O C;  2Y0S B;  3KF8 A;  5FKA C;  3MWY W;  1X3Q A;  2JYO A;  2XIW A;  3T56 B;  2E2J B;  1S5F D;  4S3S A;  3VR6 A;  1EZ6 A;  2I07 B;  3NE5 B;  3TP8 A;  2A68 C;  5FO8 B;  1QB5 D;  1WCM B;  4HCE A;  2IWH A;  1IKL A;  1PYW D;  3J81 E;  3CKI B;  3CQZ B;  3RD4 A;  4HMI A;  3PUV A;  5I9O A;  1DOK A;  2F3V A;  2D62 A;  2F0S A;  3MA2 B;  1E2V A;  1O7Y A;  1R4Q B;  1NSN S;  1MI2 A;  5BN5 A;  3I73 A;  3GD7 A;  3H3V C;  2F0N A;  1VF7 A;  4PMW A;  3BVM A;  1GHK A;  3Q22 A;  3LNN A;  4FXK C;  3PIP 3;  2VNU D;  3DUZ A;  1DOM A;  4H7B A;  4FO2 A;  2PNR C;  3FPU B;  2KED A;  3PUX A;  2O4X A;  4ZKC B;  3KLS X;  3MTS A;  4I65 A;  2R6G A;  3AU7 A;  2B2U C;  2MGS A;  4CJ1 B;  2A6E C;  4XQJ A;  1J8I A;  3ND9 A;  2PMZ B;  1PFM A;  1TS3 A;  3FMC A;  1PTO D;  1RTN A;  2ID0 A;  2EYL A;  5M3M B;  2IJ0 A;  4J1M A;  2KOL A;  1STY A;  1SYC A;  2E2H B;  3OMG A;  3URY A;  3QB3 A;  1O78 A;  1L0Y B;  2EJG C;  5EJW A;  4ZYS A;  1DON A;  5A2Q L;  2DY7 A;  3A54 A;  3L3O C;  1ESF A;  1F9S A;  3NQI A;  1TWH B;  4EQO A;  2XNA C;  1JIC A;  1ROD A;  2RA4 A;  1EU3 A;  1MSH A;  3IFD A;  1ET6 A;  1EEI D;  4ZK9 B;  2X6L A;  1X32 A;  1DCZ A;  4F87 A;  4NDX A;  2JA6 B;  2O5J C;  2M9V A;  1I50 B;  3SHL A;  5KNC A;  3J7Y W;  3D4W A;  4DAP A;  3D8G A;  2EY1 A;  2F0I A;  2EPB A;  1D1I A;  1IL8 A;  1FNV A;  4HSV A;  3U9O A;  1K8O A;  1RKN A;  5FLX E;  1FNU A;  2ZXO A;  1I3Q B;  5K5P A;  3TP6 A;  2FMM A;  3DXJ C;  3HOX B;  1EY0 A;  2QIL A;  1Y8P B;  1QIL A;  2FJ2 A;  3K59 A;  4RGN A;  1G29 1;  3R93 A;  3VYR A;  1B44 D;  3ZYY X;  1Q8I A;  2L11 A;  2F03 A;  2QDB A;  3VA5 A;  2K33 A;  4A3G B;  2EJF C;  1G2T A;  1LT3 D;  4KKS A;  5I6W A;  4IFD G;  2B2Y A;  2C9O A;  5EPJ A;  3I4N B;  3TDQ A;  4H0L C;  2WB1 B;  2LFN A;  1HXY D;  5CGK A;  1FYC A;  1V1P B;  3N6R A;  4Z9C B;  2AUJ D;  2EZV A;  1DZ1 A;  4FF1 A;  3T51 B;  1RJT A;  1TS5 A;  1W6K A;  1NR4 A;  4TSS A;  2K5D A;  1LTA D;  4UAI A;  5ELF A;  3T13 A;  4F7X A;  3Q23 A;  3EFX D;  2SDF A;  5KRU A;  1PMR A;  2OT2 A;  3V96 A;  1QNU A;  5JEA J;  4N9P A;  1E2Z A;  2RBM A;  3BVZ A;  3EVQ A;  2AQ3 B;  4ID6 A;  1H9S B;  1HPC A;  2NZ1 D;  5CV9 A;  1VMP A;  4DK0 A;  3K7A B;  1H9J A;  4FNF A;  4TRD A;  3RMH A;  2YYZ A;  2BE5 C;  2MJ8 A;  4B9X A;  1SSO A;  3H0G B;  4PV1 C;  4C1N K;  3QO2 A;  2SOB A;  2K32 A;  3A7L A;  4XDX A;  3BDL A;  4KHV A;  3DM1 A;  3E6Z X;  2WKC A;  1RDP D;  5DM7 3;  2PYK A;  3NSW A;  5LHY 1;  5C0X H;  4FVM A;  1PRT F;  1WD1 A;  5E4W C;  1BBX C;  4FP5 D;  5C4H A;  3E5S A;  3GO5 A;  3K58 A;  4J6H A;  3MFY A;  1NUC A;  2IX3 A;  1GUN A;  5HUR A;  1D2B A;  1Z7T A;  5KYL A;  1LLR D;  5LL6 S;  4C3I G;  2EYJ A;  3DWP A;  5ISR A;  1H9K A;  1H9R A;  5E4X A;  2EYP A;  2R93 B;  4DFA A;  1EYA A;  1S4Z A;  1V1P A;  2PO4 A;  3HEJ A;  3OW7 A;  3C46 A;  3MXN A;  2PZW A;  2VUM B;  1PFB A;  1BOS A;  1AZQ A;  3S1N B;  2F0W A;  4EQN A;  3SVM A;  3BYT B;  1SAP A;  3PUY A;  4HSP A;  5T1G A;  3GP7 A;  1G6Z A;  4RH6 A;  4RCN A;  1K8M A;  2D5D A;  2L1B A;  5JPM C;  2OEO A;  5C5L A;  2AQ2 B;  1M8A A;  2M00 A;  4HTH A;  1Z6H A;  5I6Y A;  3I4M B;  1TS4 A;  3A8J E;  2JEA I;  1EIH A;  5KEE A;  2EE1 A;  3J7A F;  3PUZ A;  4R8N A;  3D6C A;  4XT1 B;  1DJR D;  1EWC A;  3QJY A;  1VCI A;  2IX1 A;  3NTK A;  2NN6 H;  4BY7 B;  1HTP A;  2A74 C;  1II3 A;  1ENC A;  1AP0 A;  3R2I A;  2EYM A;  1TWG B;  3R8B A;  1CA5 A;  2AWO A;  3Q6S A;  1SNP A;  2F0K A;  4CKC A;  4C3J B;  2DY8 A;  1IW7 C;  4A3M B;  1CTM A;  5FO7 B;  4XQN A;  2NVQ B;  2D9U A;  4K2K A;  4U68 A;  2MP1 A;  5C6A A;  1SMY C;  1BCP B;  2ZXP A;  4K8I A;  1O7Z A;  2NVX B;  3H6M A;  1OXV A;  4KY7 A;  3P7J A;  3VR4 A;  4OO1 H;  3J7A V;  4F8M A;  1DXM A;  1MD2 D;  5EKI A;  1A3T A;  3F2U A;  4KMU C;  2XRS D;  5BN3 A;  1FD7 D;  4RHR A;  1EYC A;  3I91 A;  2RDG A;  1PDQ A;  4ODG A;  5J1Z A;  1WD0 A;  3HOW B;  5JEA H;  4ZRZ A;  1M4V A;  2J4X A;  1QWY A;  4ILW A;  2F0V A;  2QF7 A;  4Q5V A;  3M85 A;  4CKE A;  4ZAI A;  1F2Y A;  4HED A;  3WDN A;  1H9S A;  3BDO A;  3HS0 C;  2L12 A;  4HMJ A;  4QUF A;  4A93 B;  3IKJ A;  2IW3 A;  3A7A B;  5TSS A;  5G3L D;  2L9H A;  3VR3 A;  2MUY A;  1W6J A;  5JJZ A;  3GTL B;  1IYU A;  2PZT A;  1OXU A;  5M5X B;  3T4A C;  2NWG A;  1GHJ A;  3CRL C;  5DEH A;  1OO9 B;  1JWM D;  2PPB C;  1EY6 A;  3G6J B;  2JA5 B;  4X3T A;  4OGQ C;  4A3E B;  1X3P A;  3PO2 B;  2K1B A;  4HCS A;  2F0E A;  2K5W A;  1U4M A;  2EJM A;  1JOK A;  2JEB I;  1GUG A;  1STH A;  3DMU A;  2Z1C A;  1B9N A;  2E2D C;  1HRJ A;  3Q0A A;  1CHP D;  1HCZ A;  3QG1 A;  2FHT A;  1C8C A;  2A69 C;  1SNM A;  3PIO 3;  3L7Z C;  1Z47 A;  5CMD A;  4RWS C;  2A68 D;  2FMC A;  4C56 C;  4CGY B;  5I2X A;  3MZ5 A;  4JK1 C;  4YIJ A;  4IUV A;  4WRD A;  4K6L A;  3VYU A;  2O5I C;  5CV8 A;  4XIG S;  4L63 B;  2B2Y C;  2EOT A;  1PZK D;  2C5C A;  1HA5 A;  1LTG D;  3TP5 A;  5JVG 3;  1CI3 M;  4C3I B;  3PUW A;  1SNO A;  1LTB D;  5A35 A;  1WVL A;  3I4L A;  1LTT D;  3NXW A;  5G3L F;  3D4R A;  2H1E A;  1BCP C;  2KQ3 A;  3AMU A;  3VA7 A;  3HOY B;  1PTO B;  1SMY D;  2TSS A;  1KNE A;  1YNJ C;  1S5E D;  2WIN B;  4MN3 A;  4IUT A;  3OHX C;  5CBA E;  1F2Z A;  3AB9 A;  4K14 A;  2AQ1 B;  1TII D;  5E1F A;  3NTH A;  1GOZ A;  1GUT A;  1Q90 A;  3OPO A;  2J0T D;  5JVH 3;  3SK5 A;  4HR7 B;  1CZG A;  4CKB A;  3QWN A;  1SE4 A;  4P2C B;  2KJX A;  3H91 A;  4HN7 A;  4ZLT F;  3NWS A;  4KD4 A;  4FXG C;  2RDH A;  3ONA B;  3E0J A;  4KY5 A;  1T5X D;  5C0X J;  3DWQ A;  3RLF A;  1TQO A;  3SXH A;  4CJ2 C;  1PXU A;  1KDB A;  3A8I E;  2L55 A;  3GTG B;  1D6E C;  2XRQ D;  2DNC A;  2K03 A;  1SXT A;  3EQL C;  3A56 A;  5I9P A;  3OMC A;  3SR1 A;  3C1F A;  4C1N I;  4RKB A;  5I2Y A;  2RSO A;  4ZQ3 A;  4C3H B;  4IFD J;  2RSN A;  4L6T B;  3TSS A;  5DNF A;  5IGC A;  2BOS A;  2LS0 1;  3SEB A;  3KBX A;  5M3F B;  2R92 B;  1I6V C;  4DA2 A;  2XVS A;  4A3D B;  1CFM A;  4RGO S;  3SK8 A;  1HQR D;  3NBH A;  3ND8 A;  5ELB A;  3D31 A;  4QMG A;  1STE A;  4R9W A;  2PW5 A;  3K57 A;  2B2V A;  1RF2 D;  1G2S A;  1TR5 A;  3OSO A;  5EKK A;  2I46 A;  5JEA G;  1WTO A;  1A3U A;  5C3X A;  1S5B D;  2PQE A;  2FFK B;  5KIX A;  3HP3 A;  5IGD A;  5C3E B;  3HOV B;  3N52 A;  1SJH D;  2A6H D;  4DK1 A;  1SND A;  3FPP A;  2VB3 X;  4G4K A;  2JE6 I;  3WOF A;  4WFN 3;  4DAY A;  1SDF A;  2NUC A;  1KDA A;  1ONL A;  2NTT A;  1I4G A;  3HG9 A;  3S15 B;  2SEB D;  1SJE D;  4K8J A;  1S5C D;  3PMF A;  4XTC S;  1QJO A;  5C0X G;  4FF2 A;  2N55 A;  2AUK A;  1T5E A;  2EYO A;  4G57 A;  3R3O A;  4KI0 A;  4A3J B;  1JOO A;  1G8Z D;  2Q8T A;  1SE2 A;  5FLX L;  1Y1V B;  1XTC D;  4DN4 M;  1JWU D;  2CW0 C;  2F0J A;  2WAQ B;  3BG3 A;  5A2Q E;  5FOB B;  4OO1 G;  4KTA A;  4XQQ A;  4IUU A;  2XN9 C;  1VDZ A;  1CZW A;  1JCK B;  1I4R A;  3FKI B;  4V19 0;  2Z8L A;  3PV0 A;  4V0B A;  1XX8 A;  1PZI D;  2EXZ A;  2K28 A;  1S5D D;  4DNT B;  3MXU A;  1JOR A;  5I4D A;  3K5L A;  2F4I A;  5FO9 B;  1QCB D;  1QNK A;  5M5W B;  3W3A A;  1F9Q A;  5M5Y B;  2Z4I A;  3GTM B;  1Q1B A;  1E0B A;  3HRZ C;  3NBI A;  2VXW A;  3DHQ A;  3BVG A;  1PLF A;  1LT4 D;  3J80 E;  1UEA B;  1WTX A;  2DN8 A;  1EY5 A;  3TME A;  2B2V C;  4B08 A;  1RD9 D;  1I4Q A;  4RFB A;  3MVV A;  1UUP A;  3I72 A;  3BYY B;  5NUC A;  1HHV A;  1DOL A;  1TWA B;  4ZUJ A;  4KD3 A;  1D5Z C;  3S1M B;  3KK7 A;  4KK7 A;  2X69 A;  4Y7N B;  3IAY A;  2IX0 A;  3J80 L;  3VYT A;  2JSO A;  4O42 A;  3MAQ A;  4A3B B;  5EPL A;  1WTP A;  1EY4 A;  1B1Z A;  1STG A;  2WP8 J;  1WTR A;  1LV9 A;  3I8Z A;  3I70 A;  5HGT A;  1BXT A;  4X3K A;  2B2U A;  2OXP A;  1IYV A;  3MXG A;  4ULL A;  1NAP A;  1WTQ A;  4KY6 A;  5ELC A;  1Y1W B;  1CM9 A;  1V43 A;  1HA6 A;  3KLS A;  1JWS D;  1LAB A;  3FRP B;  1PRT B;  1LAC A;  2HCC A;  1O7L A;  1EYD A;  4IUP A;  4C2M B;  4BA1 I;  1F2L A;  4ABN A;  3D4D A;  3TZD A;  1U9R A;  1BCP D;  4XT3 B;  1U4L A;  1VMC A;  1OXS C;  3NPP A;  1A2T A;  3SE0 A;  4DXG A;  3ERO A;  4FF3 A;  4FXD A;  1QE6 A;  2EY5 A;  4CHT B;  1I6H B;  2CQA A;  2EYF A;  2IT1 A;  1SEB D;  3HKZ B;  1CT1 D;  3OIP A;  4E6I A;  5JPN C;  3RZO B;  4BA2 I;  5C5M A;  2GA4 B;  3M3Y B;  2CW0 D;  1EY7 A;  1HFN A;  3BS1 A;  3QIA A;  4IUR A;  4KN4 C;  4OO1 I;  1BO0 A;  3K6O A;  4A3K B;  3GTK B;  2JXM B;  1SNQ A;  1XYI A;  1FGB D;  2IL8 A;  5BN4 A;  1UAP A;  1BCP F;  1EOT A;  1TY2 A;  2NBF A;  1NCV A;  1JQY D;  2V4D A;  3KBG A;  2D2C C;  3J81 L;  2NB0 A;  4KJN A;  2ICI A;  2QCP X;  5T1I A;  1R9T B;  3HOZ B;  1QG7 A;  1B3A A;  4B9W A;  4DAV A;  5IGG A;  1XXG A;  5C4J B;  4H44 C;  1STA A;  1ML0 D;  4L8J A;  4RCO A;  4MIU A;  2ZXR A;  1B2T A;  4H13 C;  1TY0 A;  5J39 A;  1ILP A;  1JC7 A;  2NVT B;  4RKL A;  3TN2 A;  4KN7 C;  2HQE A;  2B2T A;  3M7N A;  4WJW A;  5KYI A;  1SYG A;  4NW2 A;  3UI2 A;  2KCN A;  4IFD I;  1TWF B;  4R8I A;  1YNN C;  1A15 A;  1BQQ T;  2XWJ B;  3CRK C;  2RKS A;  3VR2 A;  1EZ8 A;  1BDO A;  3BDC A;  1TU2 B;  4TQU S;  3M7G A;  1PTO F;  2QKI C;  2NYZ D;  5CC4 A;  1ZEQ X;  3S1Q B;  1ENF A;  4LJZ C;  2WV6 D;  1B9M A;  5ELD A;  2SNS A;  2E76 C;  5M9O A;  4RGM A;  4K5X A;  3KUP A;  3GTQ B;  5F2D A;  1C4Q A;  1EY9 A;  3D6W A;  5IT9 L;  2DNE A;  4NKL A;  2Z4H A;  2R61 A;  1PTO H;  1IW7 D;  2ENB A;  4OIK A;  1GJX A;  3I3C A;  2L4N A;  4KHZ A;  1FR3 A;  3V05 A;  4KKT A;  3JAM E;  5C4X B;  1JR0 D;  4NP5 A;  5EKL A;  4EVO A;  1U4R A;  2B39 A;  2R3Z A;  2O2L D;  1B50 A;  1SYF A;  1R4P B;  2K5Q A;  1SFO B;  5C0X I;  2MHV A;  2HCI A;  3KLR A;  3K5M A;  2L0C A;  5JAV A;  5KND A;  4O1N A;  2F0P A;  4N9T A;  4LK1 C;  2Q8R E;  2XSC A;  1PFN A;  3S9W A;  5C3W A;  1EQV A;  1AW7 A;  3M4Y A;  4C3J G;  2EY6 A;  2A5H A;  2F0T A;  5EBC A;  4C3H G;  3C1E A;  1F77 A;  4IFD H;  1SYD A;  3T53 B;  5ELE A;  2BDN A;  4U67 3;  3M4O B;  1I4P A;  4M1U B;  2F0H A;  1D5M C;  2EDG A;  4G7Z C;  2CHB D;  4CBV A;  3C3L A;  3H94 A;  1KDC A;  3H09 A;  1WTW A;  3GQB A;  4ZKB B;  1TS2 A;  3SK4 A;  1Q3L A;  1KLG D;  1I4X A;  2NVY B;  5CV6 A;  4QB4 A;  2PW7 A;  4LMQ D;  1Q12 A;  1PRT D;  3X3N A;  5D14 A;  3S1R B;  2YU9 B;  3W2D A;  3D3R A;  5E3F A;  4CJ0 B;  1F9R A;  3K0Y A;  1L0X B;  1LO5 D;  3NK9 A;  4BBS B;  1GUS A;  5C44 B;  2WAC A;  2LMC B;  1ILQ A;  5C4Z A;  1DM0 B;  4PQX A;  3CHB D;  1DD2 A;  1KAA A;  3MC0 B;  5IGF A;  1BR9 A;  1WTV A;  4G7H C;  1J9O A;  2WII B;  4DGZ A;  2K05 A;  3EA6 A;  4J8Q A;  4BS9 A;  3SDZ A;  1HTL D;  2A6E D;  5DM6 3;  1A2U A;  2F0O A;  3OWE B;  3WOE A;  5IGB A;  1SE3 A;  1PTO C;  2NTS A;  3C2P A;  1UNS A;  4K6D A;  2Q8I B;  2KA7 A;  1RCV D;  2JA7 B;  4X3U A;  4MHE A;  4I7Z C;  1SYE A;  3K5N A;  2KCC A;  2J7Z A;  2K04 A;  1BF4 A;  1ZXT A;  2HDL A;  1XWE A;  3QOL A;  2G9D A;  1PRT C;  4IAL A;  5IIF A;  3R2T A;  3VR5 A;  1ZYR C;  1O80 A;  1ICW A;  3DWA A;  3MXP A;  1LT5 D;  5COY A;  4AYB B;  5K36 G;  1ET9 A;  1BUV T;  2KEE A;  4XYQ A;  4RAU C;  2E74 C;  2HUG A;  3TBI B;  3A8K E;  3NP8 A;  1IHZ A;  1ZKO A;  1JOQ A;  2KHS A;  3U9S A;  4QCL A;  5KNB A;  2HDM A;  1D5X C;  1EU4 A;  3NUC A;  2JA8 B;  3ERQ A;  4XXE A;  2A73 B;  2B2W C;  4QIW B;  2LY7 A;  3I90 A;  5DAU A;  2PZU A;  4X3S A;  3DEO A;  4ZUI A;  5EBD A;  4BBR B;  2H4O A;  1YNN D;  4KKU A;  5LL6 X;  3LWU A;  1Q1E A;  2ZT9 C;  2L5T A;  1VF5 C;  3Q24 A;  4GZY C;  3MFG A;  3L9A X;  5IOC A;  2VB2 X;  2KEC A;  4HAE A;  3NQT A;  4OL7 A;  3P75 A;  3FDT A;  1K83 B;  4RA8 A;  2CVR A;  2E75 C;  3IL8 A;  1BNZ A;  4RHS A;  3GTO B;  2BA0 A;  1OXT A;  1C48 A;  4K5W A;  1F2M A;  2EYH A;  4M8A A;  5CV5 A;  5D65 A;  2ICE C;  4IZ8 A;  2KUM A;  2IPK D;  1F9P A;  2M2L A;  4BY1 B;  1SYB A;  2E2I B;  2MPM A;  2XWB B;  2RDF A;  1EY8 A;  1CHQ D;  3HZX A;  5D3D A;  1HQM C;  1H9M A;  2FIN B;  1JE4 A;  5EPK A;  1I4H A;  1HFG A;  1LTS D;  2PCF B;  3G7L A;  2F0M A;  4IUN A;  2F0G A;  2QEJ C;  1STB A;  3CU7 A;  4TKO B;  2EVB A;  3X3M A;  1TVX A;  3SK6 A;  2JP1 A;  1MSG A;  4ME5 A;  4NMZ A;  3GV3 A;  2F1M A;  1E2W A;  5K36 H;  3PO3 B;  4JBW A;  2X6G A;  1STN A;  2OF1 A;  3EJI A;  1V8Q A;  3FEW X;  1EL0 A;  4OIJ A;  1PZJ D;  2BCO A;  1YNJ D;  2K7V A;  1B53 A;  1SNC A;  2BA1 A;  5CV4 A;  4IN3 A;  1B4O A;  3S2D B;  5CR3 A;  2RQX A;  2TMP A;  2BE5 D;  1KLU D;  1CK1 A;  1DYQ A;  1U4P A;  4DU9 A;  4F88 A;  1EWH A;  2KVM A;  2R7Z B;  1MBY A;  5IT9 E;  4RGT A;  1AN8 A;  4LAA A;  1Y8O B;  3T16 A;  4WOR A;  3HGB A;  3VYS A;  1EIG A;  4XYO A;  2BDO A;  1TKW B;  1RTO A;  3O13 A;  4DXF A;  4OHJ A;  1EEF D;  5D3I B;  2K01 A;  2A69 D;  2B2W A;  4QUC A;  3RZD B;  3QOJ A;  5CBE E;  1AEX A;  1CA6 A;  2NN6 I;  4FF4 A;  1JB3 A;  4EGV A;  4QF4 A;  2F0F A;  3TP7 A;  1ESR A;  1SBB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...