2HCCA

Solution structure of the human chemokine hcc-2, nmr, 30 structures
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
66
structure length
66
Chain Sequence
HFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN CHEMOKINE HCC-2
publication title Solution structure of the human CC chemokine 2: A monomeric representative of the CC chemokine subtype.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chemokine
total genus 6
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 1998-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2hccA00
1C8CA 5CBAE 1PFMA 2B2WC 1IKLA 2NYZD 4QUFA 4R9WA 2KEDA 3TN2A 1M8AA 2KECA 1WTQA 1B2TA 2FFKB 1X3PA 2Q8RE 1BO0A 1QNKA 2EE1A 4XT3B 2B2WA 1HA6A 1KNEA 2MGSA 1SSOA 1G91A 2J7ZA 2L11A 2EPBA 2X6LA 1VMCA 1X32A 3I90A 5CORA 1XYIA 1WTRA 2N88A 2X6GA 2KEEA 1F9SA 1HHVA 3D6WA 3R93A 1NR2A 1ZXTA 4IUTA 1WTPA 4HCSA 2RA4A 2RVLA 2HCIA 3ONAB 3Q6SA 3HP3A 1BBXC 2L9HA 1PFBA 1SAPA 1MI2A 5COYA 4CJ2C 1WVLA 1E0BA 4RAUC 3KBXA 1AP0A 2K28A 3FDTA 3UI2A 4RWSC 1O80A 1SDFA 1DONA 2K1BA 1PDQA 2EOTA 1O7YA 5E4WC 4XDXA 1PLFA 1MGSA 1WTVA 1WTXA 1IL8A 2L12A 5EPKA 4QUCA 1EIGA 3KUPA 4OIKA 4ZKBB 1BF4A 1MSHA 2B2YC 1RHPA 1VMPA 4ZK9B 4HEDA 4X3TA 3G7LA 1ICWA 2KUMA 3IFDA 3SVMA 1B3AA 2FINB 3H91A 1U4MA 1WD1A 1U4RA 1DZ1A 1U4LA 1O7ZA 2RSNA 2RSOA 1MSGA 3N52A 4NW2A 5D65A 1EIHA 2B2YA 2SDFA 1X3QA 2BDNA 3MWYW 1XX8A 5D14A 3DEOA 1HFNA 1RTNA 2FMMA 2MP1A 1AZPA 1DOMA 2K01A 2XIWA 2HDMA 3DM1A 5T1GA 1GUWA 4IURA 1B4OA 2R3ZA 1BNZA 1A15A 5CBEE 2B2UA 2DY8A 2L1BA 2NWGA 2K04A 2NZ1D 2CVRA 2B2TC 3FPUB 4OIJA 2KOLA 5JJZA 1ML0D 2JYOA 1CA5A 1EOTA 1IKMA 4HSVA 3TZDA 1G6ZA 5EQ0A 1B50A 1EL0A 1B53A 1CM9A 1TVXA 1NAPA 2HDLA 3DEPA 1F9PA 2DY7A 3QO2A 2M2LA 2B2TA 1S4ZA 1J9OA 5AFWA 1F2LA 4X3KA 3MTSA 4R8IA 2IL8A 3I3CA 4ZKCB 1U4PA 3LWEA 1WD0A 1G2SA 2FHTA 1J8IA 2L4NA 1ESRA 1EQTA 2B2UC 4ZAIA 1RODA 5E4XA 4CJ0B 5DNFA 2VXWA 1AZQA 2K03A 2KVMA 1RJTA 3P7JA 4IUPA 3I8ZA 2JP1A 4IUQA 4X3SA 4UAIA 1CA6A 2D9UA 2MJ8A 1ILQA 1WTOA 1NCVA 1NR4A 2K05A 1F9QA 1DOKA 3F2UA 3IL8A 4XT1B 4X3UA 4DN4M 2H1EA 2MPMA 2FJ2A 4HAEA 1QE6A 4U68A 1KNAA 5EKIA 1WTWA 1G2TA 1QG7A 1ILPA 5EJWA 5CMDA 4CJ1B 5T1IA 4IUVA 4MN3A 2B2VC 1DOLA 1JE4A 3I91A 1HFGA 5EPJA 1HRJA 4LMQD 2N55A 4ZLTF 5EPLA 4IUUA 1Q3LA 2HUGA 4O42A 1HUNA 1RTOA 2HCCA 1LV9A 2B2VA 1F9RA 2X69A 2Q8TA 4RA8A 1JICA 1HUMA 1PFNA 3GV3A 3GV6A 4MHEA
chains in the Genus database with same CATH superfamily
1SYFA 2IX0A 2E5LL 1SNPA 4OELB 4TQUS 3OIQA 2KECA 2Q8RE 3NENA 4A93B 1KHIA 5FLXc 2XGTA 4K2KA 3T56B 1WTHA 5ELNA 1VQ7A 1NBWA 4RKLA 3GTLH 2D62A 3VYSA 1X32A 4AYBE 3HG9A 2HT1A 2N88A 1SFOH 1BQQT 4K6DA 5CR3A 3C1EA 2VQFQ 4LW1A 4KY6A 4CDDC 5IOCA 3EBEA 2JA8B 5ELFA 1YHAA 4DNTB 4L8JA 2BH8A 4JBJA 1GVPA 2I5MX 1SNMA 1LTAD 1PDQA 3WOEA 1CZWA 4J6HA 5C44G 4KMUC 1GD7A 2NVQH 3KBGA 1YI2A 4A3BB 3KUPA 5BR8L 4OHJA 4DUYL 3M7GA 1FVIA 5JJIA 2F0HA 1PTOH 3VR3A 3SVMA 1K8OA 4A3DB 5IYBH 1MSGA 2YYZA 2E8GA 2JA5G 1TU2B 1RTNA 3RZOB 2EXDA 3C2PA 2F0NA 4OO1H 1EYAA 3CCQA 4JI5Q 4JBKA 1FNVA 4LF4Q 1Q12A 4CDEC 5JJZA 1PTOC 4MTKA 1X9NA 4LF8Q 2CWPA 2JYOA 4YCVA 3FEWX 4DV1L 1CM9A 1DD2A 5M5XH 3UE0A 1S4ZA 5AFWA 4BWGB 1Y1WH 3I73A 4ODGA 3SK4A 3VR2A 1OXUA 2L4NA 2Y0SG 1Z7TA 5E4XA 1AZQA 2OEOA 3KYHC 3SK5A 4OWWB 4UAIA 4ZYSA 2D9UA 2MJ8A 1VQDA 4IFDJ 1K8GA 4OONA 1FGBD 1D8LA 4HAEA 4DV0Q 3SHLA 5CGKA 3F2BA 4JI1L 2YU9B 2UXBL 5JEAH 2LS01 1HRJA 4DUZQ 2DGYA 4U673 1DYQA 1YJNA 2PNHA 1F2MA 2SOBA 1IZ6A 2E76C 1QZGA 2LSSA 1QB5D 1LV9A 3FKIB 1HUMA 2AWOA 1ONLA 4L5QA 5JVH3 3RLFA 5H1SE 1RIPA 2PO4A 2KEDA 4DR5Q 4IOCA 3RNUA 1EYCA 2B29A 2L0CA 4BBRG 4R4OA 2KA7A 2WINB 1NSNS 1PH7A 2MGSA 2F0SA 4JC0A 4HJAA 1PH3A 3T4AC 3KLRA 3BZCA 3OWEB 1DGSA 3GTKB 1Q82C 3K6OA 4IUTA 4JI3L 3I4MB 2RKSA 1BBXC 3Q6SA 2A1AA 3OMCA 1GOZA 5IP9H 3PIPA 5M3MG 5M3FB 4DPGA 2QEJC 3E0JA 4A75A 1BXTA 1BR9A 4QIWB 1TWAH 3T1HL 4BBSG 1WI5A 4RWSC 2N49A 1L0YB 3FP9A 1HNXL 1N34Q 4JW0A 4JCVE 3TP7A 1TT2A 5D3DA 1A3TA 3NWSA 5IE8A 1MSHA 3QOJA 4QF4A 2YTXA 2CH4A 1X6OA 4WORA 3CCLA 4OGQC 1GO3E 4NPSA 1VQ6A 4DR3L 5IY0A 3KF6B 2RDFA 3J7AF 5CV9A 5K36H 2P5ZX 3NUCA 1EFWA 4IPDA 4A93H 1CA5A 1KABA 5I2XA 4JBWA 2R92H 5GAEC 2BH2A 1RDPD 2KQ3A 1QCBD 2CHBD 3K7AB 3TREA 1OO9B 1VDZA 3I4OA 1E22A 2CH4W 2K52A 3CP0A 2Q2UA 1SJHD 2JA8H 1IBMQ 3SXHA 5IODA 4JI6L 4ME5A 1FJGL 2WKCA 1J8IA 5ELDA 1M1KC 3DWAA 3I4NB 4A3BH 2BDOA 1TWHB 1VQ4A 1O78A 1XTDA 1JOKA 1TS3A 1VQEA 1V1PB 4WJ3M 3BJUA 2JK8A 1J5EL 4A3DH 3HKSA 2D2CC 2VUMG 5JEAG 1Y8OB 3EROA 2L55A 3ITPA 1X3PA 3P75A 4DR4L 4NXNL 2L5TA 3L7ZC 5G3LD 1QWYA 5AJ3L 3SEBA 1G91A 2J4XA 3G48A 5C3XA 3J80L 1AN8A 2RVLA 5IP7G 3U4ZA 4DA2A 4YIJA 4K8JA 1PMRA 1X54A 1LTBD 2JA7G 1MD2D 1DONA 1DXMA 1G8ZD 3TSSA 1B70B 1SE3A 3ZJYC 1NJIC 1WTXA 1UE6A 1G291 1VF5C 1TXYA 2OQ0A 4KN4C 5LMUQ 4K0KQ 1B9NA 2YU9H 1B7YB 1JR0D 4I65A 3H15A 1FD7D 3AFPA 4YHHL 2AUKA 4BY1B 1A2UA 4CBVA 1EIHA 3FKIH 1V1QA 5FK9C 4EQ5A 3OPOA 5E7NA 1W2BA 1MJEA 4WFN3 5HURA 1HQMC 3KLWA 4IQZA 4NMZA 3Q23A 1LTGD 1D5XC 1EL0A 3SDZA 5K36G 3DEPA 4JI2L 1XNRL 5KRUA 3I55A 1J9OA 5I2YA 5GAHC 1AEXA 4PMBA 3DUZA 3GTKH 3CW2C 3BDOA 3EN2A 4UPAA 1X56A 2R92G 3VDYA 3CMAA 1UEBA 4IFDI 1ESRA 2B2UC 3BVZA 4RKBA 4A3MH 5M3FH 1UE7A 1U0LA 5IIFA 4RHSA 1E24A 3IAYA 2QDBA 4LFCL 4C2MB 2K05A 4C3HH 3AMUA 4POFA 5DAUA 4AIMA 3GTOH 1Y8PB 2OTJA 4QIWE 3W1BA 1UUPA 2GN5A 3I91A 4RCNA 3J81c 4S3SA 1RKNA 4QB4A 1EWHA 4LFBQ 3S2HB 1OXTA 2HIVA 4CDCC 1GUNA 1II3A 3BDLA 3FHWA 4BA1I 4Q0FA 1H95A 2F0GA 1HR0Q 1VQ5A 5LHY1 2WB1G 1LT5D 5EGTA 4YY3L 1SLJA 2DN8A 1HNXQ 4R4QA 3CPWA 1XNQQ 1WTQA 3MZ5A 4KHPL 1CI3M 1QNKA 4B3ML 3J7AV 4TVAB 1PXUA 3A8JE 1EYGA 4DR1Q 3S17H 4DV7L 3HOVB 1AE2A 3K7AH 5C4ZA 2KEEA 1F9SA 4RGMA 1ZXTA 5CV7A 2BE5C 1K28A 4KKUA 4B3RL 2HCIA 3M4OB 2HD3A 3OHXC 2VQEQ 1T5EA 3KF6A 5COYA 2A6HC 4KN7C 3A5UA 1BCPD 4FF1A 1VQPA 1JCKB 4UDUC 4A3KB 4KD4A 1KRSA 1JC7A 4A3CG 1A8VA 3F1ZA 3I4NH 2EYJA 3A7AB 2K5QA 3VYTA 1W3SA 2PMZE 4PNYA 1TKWB 3K5NA 1U4RA 3S1RB 3N52A 2EY1A 4DXGA 3NQTA 2L15A 4G7OC 1HNWQ 1M4VA 1Q8IA 2F4VQ 1UNSA 2R93B 1U5KA 4NKLA 3NELA 3NP8A 5NUCA 3JAMc 4F8MA 1OXSC 3I72A 3LWUA 4C3IB 4GLVB 4K8IA 2E2JB 4HIKA 1BBUA 4RGTA 1CKNB 3DWPA 4GZYC 4AQYQ 3CU7A 1V1PA 3HZXA 4GN3B 4M1UB 2F0FA 1PH1A 2F0DA 3CCUA 1KDBA 2VQFL 3M4YA 4A3IG 1VF7A 1L1OB 3TBIB 1IHZA 1STYA 3HOXB 3SK6A 2WFWA 2I5HA 4X3UA 2FJ2A 4A3MG 1ZEQX 2F3IA 1EIFA 3K0YA 5LMNQ 1RD9D 4O2DA 4MTNA 1VQHA 1NY4A 5C0XJ 5IT9E 3L3OC 4O42A 1RTOA 2FMCA 1X3EA 4JI0Q 3PCOB 3NBHB 4ZQ3A 1F9RA 1X55A 2ZM6Q 5JPMC 1E2ZA 4APVA 2HHHQ 4NB3A 3H3VI 3ERSX 2KBNA 4HJ8A 5LL6X 4JI5L 4LF4L 1Y69U 2PPBC 5JJLA 5M3MB 2CWAA 4LF8L 3J7YW 4FP5D 5A35A 3RD4A 3NHHA 5GAGC 4X64L 1LT4D 1KXLA 2K75A 1HH2P 1PTOF 1Q7YC 5C4JB 3HOUG 2K5VA 3PUVA 1MI2A 4CJ2C 4RAUC 3U50C 1ESFA 1QVCA 3D0FA 1D1IA 5IGDA 4B9WA 1SJED 3FDTA 5HGQA 5IYDH 1IW7D 2CW0D 2EJFC 4ZUJA 3KFUA 3PO2B 2R7DA 2R7ZB 1EIGA 2A73B 1YHQA 2B2YC 1RHPA 4DV0L 4HIDA 1VQ8A 2KUMA 1B3AA 1S40A 3S2HH 1U4LA 4DUZL 4NW2A 3C46A 1KAWA 2B2YA 2RHQB 4CKCA 1EOVA 2K01A 5T1GA 3A8IE 4LFCQ 1JORA 5IYCG 1SYCA 3RLNA 3R2TA 4DR5L 2IT1A 1PH9A 1LTLA 4KJNA 4RHRA 1D2BA 1X3GA 1XPOA 2XRQD 4A3GG 1X3FA 2JXMB 3HOVH 4O0AA 1BVSA 2VZAA 2GVBA 1STEA 4PZ7A 4L5SA 2DNCA 1VQAA 4IUNA 3PF5A 1B1ZA 4L5RC 3EJIA 4K2LA 2CKZB 4EVOA 5C3EG 3M4OH 1LLRD 2HQEA 5C4XB 5KEEA 1Z6HA 3EVQA 3MEHA 4A3KH 2B39A 4B3MQ 1NCVA 3F2UA 2OTLA 3S2DB 3K57A 2EY6A 1LTRD 2AQ1B 4DV7Q 4XIGS 1N34L 2VL6A 1H9KA 1L0XB 1BBWA 4A3EG 1KC8C 1PHJA 1J6QA 4P72A 3L2PA 1N32L 3S1RH 4R4IA 3HOZB 2MO1A 4DV2Q 2NN6I 4GN5A 4MHEA 4KD3A 4X66Q 2R93H 1KLUD 2SNMA 1XXGA 5J3BA 1JJGA 3A8KE 3A74A 1YIJA 1M8AA 1C7YA 1SEBD 2B8GA 5DEHA 3HRZC 4C3IH 4IOAA 3K58A 1JJ2A 3E6ZX 4B9XA 4A3FG 4DR6Q 1RL2A 3CQZB 2K5WA 1U9RA 1ZYRD 3CCEA 2AMCB 3CPFA 4GOPB 3HOWH 1PYBA 3HOYB 4OWXB 1N33Q 3RN2A 1EWCA 4GKKQ 4DK3C 1AP0A 2K28A 3HOXH 1IBML 1STHA 2MHVA 1K0SA 1E1OA 2D5DA 4ZKBB 1K9MC 1CKNA 1KL9A 4C3JG 3HKZG 3G7LA 3VA5A 2ZXPA 3ND9A 1L1OC 3G6JB 3AYHB 4ZRZA 4DR7Q 1KAAA 2K32A 3MWYW 2ES2A 2EY5A 4JK1C 3KDFB 1L1OA 1PFSA 1S72A 4FYDA 1LO5D 3WDNA 3E3XA 2K04A 2F0PA 1IYVA 3MEFA 3Q8DA 4HSVA 3KK7A 4NXMQ 2JA9A 1EY9A 3UDIA 2M2LA 5FO8B 4DK6C 2EQSA 1HTLD 4QMGA 1BCPB 1EZ6A 2V4DA 2E2DC 3ERQA 4KY5A 2QGQA 4XTCS 1XPUA 4BXXH 1SROA 3NBHA 4KV6A 1LTTD 1F77A 4ZAIA 2QKIC 2K03A 3S15B 2Z0SA 1RJTA 1VQGA 3P7JA 2ZXRA 4IFDH 1I4PA 4GN4B 1XPRA 2KHSA 4LUZA 1NR4A 4H02A 2H1EA 5C0XI 3CCMA 3A7LA 3PO2H 1Z47A 3HEJA 1WFQA 2R7ZH 3D4DA 4JOIA 3S9WA 1PZID 4X64Q 4DV6Q 2ASBA 3OTOQ 2ZJRA 5LMUL 4K0KL 2F0WA 5TSSA 1TS2A 2JA6H 1P8LA 3U4VA 2XSCA 2B63B 4RA8A 3QWNA 1CKOA 3A56A 4BY7H 2RQXA 4LJZC 1PFMA 3K8AA 3AEVA 1VQKA 3BYTB 3J80c 1MBYA 4UY8C 4DFAA 1NTGA 3J81i 3H94A 4IPGA 1VS0A 1OXVA 4FXKC 1K83B 4GLXA 3LGJA 1I4RA 2D0PA 1WTRA 1S3OA 1BKBA 1EU3A 2X6GA 3D6WA 1NR2A 1YZ6A 3SGIA 3ONAB 3NWTA 4HMIA 1HNZQ 4QQBX 1WJJA 3NBIA 4YCWA 4PV1C 2PYKA 5C4XH 5BN5A 1UE1A 2AQ3B 1QNUA 2RDGA 2E75C 5KGUA 3E9HA 1MGSA 1CUKA 3S2DH 4G4KA 2C35B 5KNCA 4JV5Q 4H7BA 2M9VA 3IFDA 4AYBG 3PUWA 3PO3H 4IO9A 4LFBL 1SRUA 1L0WA 3CRLC 3HOZH 3CHBD 5FOBB 3X3NA 3PGZA 1A3VA 4CKBA 1LM0A 3NTIA 2O2LD 1HR0L 1E3PA 5CBEE 3S1QB 1PVOA 1GUGA 1XNQL 5CC4A 1EOTA 1YITA 1PH5A 5F2DA 1C0AA 3X3MA 2ZT9C 1TVXA 2WAQE 3E9IA 2F0OA 3TP8A 3CQZH 4DR1L 4I7ZC 2PI2E 1N32Q 3MTSA 5JEAJ 3J81E 2XRSD 3R3OA 1VQJA 3G71A 2IX3A 1OXXK 4J15A 4RCOA 3HOYH 1JOQA 1I6VC 3FRPB 2VQEL 1H9MA 2VS1A 2ZTCA 4TSSA 1YNJD 4BXXG 3PUYA 1CA6A 5IYBG 2PI2A 2NBFA 2G9DA 1KNAA 4LF6Q 5EJWA 4GOPC 1B9MA 1EEID 4OO1G 1LUZA 4LFAQ 5CYUA 2N55A 2LXKA 3AFQA 3D4WA 1JQYD 3V2TA 3KJPA 2UUCQ 4GOPA 3CKIB 1A2TA 2IW3A 1HUNA 1JJCB 2HCCA 3OOCA 2NVYB 1K3RA 1XYIA 5FO9B 3FVQA 4DKAC 1TS4A 2B2WC 1HNWL 5IT9L 2F4VL 2YV5A 1Y1WG 3NXWA 2E2IB 1BO0A 2KCNA 4QCLA 3H3VH 4BY7G 3TDQA 1Q1BA 2B2WA 4G7ZC 4JI4Q 5KYIA 3TP5A 2K14A 1SSOA 1EY5A 2EPBA 1VMCA 2FXQA 3D8GA 3H0GB 4E6IA 4B08A 3R93A 1VQFA 4AQYL 2F0LA 4HCSA 2R7FA 3I7FA 3NTHA 3H3VC 1PRTF 1PZKD 2F03A 3S15H 3KDFA 3RZOH 1I50B 4CKEA 1E7ZA 1O80A 4GNXB 1O7YA 4XDXA 2XVSA 4BS9A 1BCPC 3BS1A 3NK9A 4HTHA 1SNOA 5LL6S 5LMNL 4UP8A 4ZK9B 2BOSA 4JBMA 4WJ4A 1T9HA 2KHIA 1DZ1A 4QGUA 2BA0A 3NSWA 2A5HA 2B63H 1EYDA 1C9OA 1I6HB 4POGA 4JI0L 2FMMA 2H5XA 2KJXA 1AZPA 3M7NA 3TS2A 4PZ6A 2ZM6L 4C1NI 3PO3G 1BNZA 4JPBW 4N9PA 2K7VA 3BG3A 2HHHL 2AQ2B 2JSOA 1Y1VB 1ENFA 5IP9G 2LXJA 3CD6A 4ZCKA 1B53A 2PW5A 1NAPA 2HDLA 2SEBD 4KHZA 1IYUA 1K83H 3U9OA 1YHBA 1RODA 3CF5A 5DLQE 1RCVD 4IUQA 4RGNA 3KF8B 4XXEA 1I4XA 2MPMA 1DM0B 2EYMA 1EIYB 1K73C 2Z8LA 4CJ1B 4IPHA 4UP7A 1SNDA 2A68D 5E1FA 1JWSD 4A3LH 1DOLA 2SNSA 5KYLA 1HFGA 5EPJA 4A3JB 2EYLA 4LMQD 5EPLA 1TIID 2MNAA 2UUAQ 4A93G 1CT1D 1K8AC 4P73A 3L9AX 1IXRA 3I4MH 1WCMB 2XWBB 1R9TB 2CCZA 3A54A 2NN6H 2NVXB 4DGZA 1ENAA 3MA2B 3S1NB 1TR5A 1B2TA 3MXUA 4XQQA 2KCMA 4P75A 2EE1A 3DXJC 2JA8G 5K5PA 2K33A 4A4IA 1JWMD 2A19A 3JC66 1EWIA 3ER0A 4DAPA 3M4PA 1FNUA 3VR6A 2PQEA 1Z9FA 4A3BG 4IPCA 1E2WA 1VCIA 1WVLA 1HPCA 1MHWC 2AUJD 3TS0A 3UI2A 3V05A 1E2VA 2JE6I 4A3DG 4DV4L 1AE3A 2QA4A 1BF4A 1EQQA 1IW7C 2CW0C 3MXGA 4UHVA 3SE0A 4X3TA 1GHKA 1YJWA 3S14B 2FINB 4X6AH 1GM5A 5I4DA 4P2CB 3AQQA 5C44B 3K0XA 5D14A 2PZWA 1VQOA 3P20A 4DAYB 1WYDA 1KIXA 2HDMA 4DV2L 1XMOQ 1H9RA 1KTKA 2WACA 4X66L 4FF4A 1LACA 4HIOA 4OIJA 3DLLA 2O5IC 3PSIA 3MC0B 2AHOB 3OMGA 2F4IA 2JA5B 1VQCA 5M5YB 1TWHH 4M8AA 1STBA 4DR6L 2EY2A 4DV5Q 3ULPA 4N9TA 2N8NA 2FHTA 3PMFA 2G9HD 1JB7A 1EQTA 1SNCA 1A3UA 3IRBA 2KVMA 2YTYA 1FYCA 4EQPA 3PIOA 1YBYA 1N33L 4GKKL 4B3TQ 5ELEA 3IL8A 5I6WA 1XWEA 1UWVA 3FKIG 1I4HA 2Y0SB 2ATWA 1BDOA 3D3RA 3PIP3 3ULJA 3FPPA 3I70A 3PV0A 3TRZA 1CHPD 2A6ED 4HIMA 4DAVA 4IN3A 1S5DD 1Y8NB 4ZKCB 4X62Q 4GNXC 1WD0A 3CC2A 5C3WA 1KQSA 1SYEA 4DR7L 1I6HH 1R4PB 1IKLA 2NZHA 1SBBB 1LT3D 2NB0A 1EY0A 4HSPA 5FLMH 4GNXA 3I4MG 1YJ9A 1Y1VH 2F0MA 5M3FG 1PH4A 1EY7A 2N3SA 5FLXE 1ASZA 3ZYYX 4NXML 2BA1A 2JQOA 3P1HA 2ZJPA 2JEAI 1EEFD 1F2YA 1HA5A 4C3HG 1HHVA 3BVGA 4BBRB 1UE5A 1GUSA 1AW7A 4BY1H 3E0EA 1PH2A 2OF1A 1ZYRC 2VNUD 2F0TA 1Q90A 5EKLA 5I9PA 2MUYA 1SYDA 3BZDB 4CDFC 4HN7A 3SK8A 4XQJA 4QJFA 4ABNA 5ELCA 2UXCQ 1AFPA 2L12A 1I4GA 1TWGB 3GTLB 1BUVT 3T16A 4A3JH 1EY8A 4BBSB 5KIXA 4H0LC 3GO5A 4DV6L 3OW2A 1WD1A 4LF5L 2RSNA 3OTOL 1K3BC 5D65A 3BVMA 2H4OA 2SDFA 1S5CD 1R9TH 1QUQB 1DOMA 1HTPA 2OXPA 3T53B 1GUWA 1JT8A 3KF8A 4IZ8A 3VYRA 3Q22A 3NTKA 3S1NH 2NZ1D 5FJ8H 4C2MH 1GKHA 2KOLA 5EBCA 4DR2Q 4JI8L 3S16B 2Z6KC 4R1JA 1PTOB 3OWFA 3GTGB 4Q5VA 3B6YA 2I0QA 4OXPA 4KKTA 2Z6KA 5E3FA 2A74C 3I4NG 5KNBA 1SE4A 1EFID 4HJ7A 4IUPA 1HNZL 4KY7A 2VY3A 5G3LF 1MKHA 2DJFC 4XQNA 2F0KA 4OWTB 2UXDL 3W3AA 5DM73 5EKIA 2F3WA 2IY5B 1EY4A 5FKAC 4FXGC 4P74A 3PF4A 1D7QA 5JVG3 1UAPA 2GVAA 4ZUIA 3CC7A 5JOBA 4JV5L 4EX5A 3GTMB 5C44H 1H9JA 2LKVA 2OCEA 3U58A 5JJKA 1HQRD 3QG1A 4DV4Q 2G5DA 4A76A 3V96A 5ISRA 4DV3Q 1CQVA 3M4QA 4N8X1 2V1CC 2LY7A 1JMCA 2VUMB 5JAVA 1KNEA 2JA5H 3G4SA 4DF7A 3CCSA 1VQ9A 1YEZA 4DNRB 2K5HA 4LF9Q 5C6AA 2UU9Q 1S5ED 1XMQL 3TZUA 1GJXA 1V1OA 3HP3A 5DM63 1PFBA 5GROA 1SAPA 5CV5A 1ICFB 4DAYA 5CV8A 1E0BA 2QILA 4BA2I 3PUXA 1PYSB 1PRTD 5E4WC 4K5VA 1PLFA 1IL8A 1D6EC 4F87A 3J7ZC 3ICEA 4OX9Q 2E2JH 1DCZA 1XTCD 2RCFA 4LF6L 1SMYD 2PZTA 1KD1C 4JYAQ 2ZJQA 3A5ZB 5D3IB 2JA7B 3GD7A 4LFAL 2Y0SE 1YNND 3T1YQ 2UUCL 1TQOA 1TWAB 4K14A 3IFTA 2A69D 1A15A 3C3LA 1ENCA 1V9PA 3M3YB 1VQBA 4HMJA 1UEAB 4JI4L 1HXYD 3I2ZA 5IYDG 2A8VA 2LFNA 3QIAA 4BBRH 3UDGA 2JN4A 4H44C 3RMHA 2JP1A 2MFIA 5EKKA 2IHFA 1JE5A 2MO0A 1F9QA 1C8CA 1CQFA 5IGCA 2R92B 1G2TA 1D5MC 1WTWA 1SN8A 2WKDA 1YNJC 5IT9c 1TWGH 4MN3A 5M3MH 3BYYB 3WOFA 1K0RA 4KK7A 2K6AA 3DWQA 4MNOA 4BBSH 1TY0A 4X65Q 5A2QE 1BCPF 3CRKC 4UP9A 5C4JH 2TSSA 4I7AA 1NE3A 3HS0C 3MAQA 2O5JC 4GLAC 2EDGA 3HOVG 4QUFA 4LWCA 1JWUD 4R9WA 4JOIC 2IX1A 2Z6BA 2C9OA 4IALA 3TQYA 1S5BD 3S16H 2WB1B 3PIO3 2E74C 2QW7A 4LF5Q 4A3KG 3GTGH 3L0OA 3TEHB 5IGEA 3OW7A 3UDFA 2F0UA 1QOHA 1QUQA 1EZ8A 5HY6A 2I5LX 3N6RA 2EOTA 4JI8Q 1FGUA 3W5OA 5EPKA 5ELBA 2R93G 5ELOA 3H09A 1FR3A 1H9SB 4LUVA 5FO7B 3GTQB 4HEDA 1HZ9A 3W1GA 5IWAQ 1HZCA 2WIIB 3M85A 4C3IG 2UUAL 3GTMH 1HCZA 4GKJQ 4LF7Q 3QJYA 1X3QA 3J7A5 3GQBA 2UUBQ 2XIWA 3D6CA 2R3ZA 4HCEA 2UXDQ 2J0TD 2NWGA 2L1BA 3HOWG 4JI7Q 3TZDA 2PCFB 2VUMH 2PQAB 1N36Q 1K8MA 4R4TA 3HOXG 1I94Q 3OYYA 4KI0A 4J8QA 3RZDB 3E5SA 4V0BA 3STBD 3CC4A 4DXFA 3CXCA 2D0OA 3GP7A 1U4PA 3LWEA 1KRTA 1G2SA 4O1NA 4CJ0B 1Q1EA 5DNFA 2VXWA 4YWMA 2Z9HA 4Y7NB 5GQOA 1PYWD 1IBLQ 4R8NA 1Y14B 1C4QA 4ULLA 3CCRA 5IP7H 3LNNA 2B2VC 1Q86C 4A3IB 3A55A 2NVTB 1ZKOA 4G57A 4PQXA 2EYPA 2HUGA 1XMQQ 2JA7H 5JPNC 2A68C 4TRDA 2I07B 2DNEA 2B2VA 1CSQA 3D31A 3JAMi 4A3MB 1JICA 1STGA 5CBAE 3GTPB 2F0JA 3BU2A 4ILWA 5EBDA 4DAMA 4C3HB 2C5CA 1XMOL 3VA7A 4B3SL 1DJRD 4L63B 3GTOB 2Z4HA 2Q2IA 3A0JA 1N9WA 3EIVA 4FDBA 4NDXA 4XT3B 4IFDG 1HA6A 3M3YH 2MQHA 2L11A 2CQAA 2Q2HA 5CORA 2ICEC 3PO2G 2RA4A 1LT6D 5FLXL 4DV5L 2R7ZG 3RUZA 3BDCA 4C56C 1LYLA 3LX0A 3H6MA 3ND8A 4DNIA 1MIUA 2YTVA 3S1MB 1EQVA 2JA6G 1F2ZA 2K1BA 3HOUB 4LUOA 4B3TL 3S17B 2KENA 2QDLA 1PH8A 2ZXOA 3NPPA 4V190 3M9BA 2BCOA 1U4MA 1TWFB 2F1MA 2Z1CA 4WRDA 3HGBA 2E5LQ 3VR5A 1AH9A 1T5XD 1XX8A 1ET9A 3DEOA 4ID6A 1PTOD 3UE1A 4X62L 3GTJB 4IURA 4ALPA 3F2CA 3KOJA 2PMZB 3G6EA 1NMFA 1QVFA 3FMCA 3JAME 1CFMA 4PMWA 1ASYA 1B50A 1G6ZA 2R6GA 5C4XG 1C48A 1F2LA 5IGBA 4RG1A 1VQIA 2EJMA 1PRTB 1GXDC 2WB1E 4KHVA 4A3GB 4Y52H 4G7HC 4J1MA 2IWHA 3PQIA 1N8RC 2F52A 4FF2A 1E1TA 4XT1B 2VB3X 5BR8Q 3HOZG 4DUYQ 3QR8A 3T51B 3NQIA 5CMDA 4PZ8A 5C3EB 1EQRA 2UXCL 3K7UC 3F8TA 2WAQG 3GTQH 1O7LA 1G6PA 4RMFA 2K50A 3PUZA 4A3CH 2F0EA 3W2DA 3C1FA 1HJPA 2A6EC 2ICIA 4A3EB 4FNFA 2CFMA 4OL7A 4DV1Q 1TY2A 3EQLC 3HOYG 1H9SA 4DR2L 4RFBA 1HZBA 4KLKA 3VR4A 4AH6A 2RHSB 3DM3A 3I90A 2F0VA 3RZDH 2XN9C 4JG2A 5GADC 3CCVA 3UDXA 1KLGD 5I9OA 4PMCA 3KBXA 4A3FB 2EYOA 4Y7NH 4YWLA 3MXNB 3O13A 1SDFA 1I3QB 1A63A 3MHBA 3S1QH 1STAA 1XJVA 2I46A 2RDHA 2R61A 3EA6A 4JI1Q 1WTVA 4FF3A 2EZVA 4DK1A 3DHQA 2UXBQ 2PQAA 2EYFA 1A62A 1TS5A 1VMPA 4A3IH 2NVTH 1BOSA 2XNAC 4C1NK 3OSOA 1FL0A 1TWCB 3I56A 4RGOS 1O7ZA 2WV6D 4KTAA 2B3GA 4OO1I 3CAMA 4C3JB 3GTPH 1A6XA 2F0QA 3HKZB 4NP5A 3VYUA 1SYBA 2B2UA 2OQKA 5M5WB 1SR3A 1JB3A 4KKSA 2DY8A 3FPUB 1ML0D 2ID0A 4DV3L 4EQNA 1JOOA 3AU7A 3F2DA 1Q46A 4LAAA 5J1ZA 4JI3Q 1WOCA 2Q2TA 4LK1C 4R8IA 1GUOA 3R2IA 1IBKL 4LF9L 4K6LA 1VQNA 2EVBA 2UU9L 4IJHA 2NVYH 3T1HQ 4F88A 4B3SQ 1PZJD 2QCPX 2LMCB 3S1MH 1DOKA 2EXZA 4DN4M 1GHJA 2B63G 2E2IH 3HOUH 4ME3A 3DMUA 3OIPA 3QOLA 1B8AA 4IUVA 5T1IA 2QEXA 1JE4A 4OX9L 2QF7A 4ZLTF 2NUCA 4IUUA 1Q3LA 4DR3Q 4JYAL 3H0GH 2RCNA 1TWFH 5C5LA 2X69A 2Q8TA 1A0IA 3MVVA 1EU4A 2XTIA 4FO2A 2OWOA 3T1YL 2NZOA 5A2QL 1V8QA 3TN2A 3GTJH 2N78A 1I50H 2FFKB 1G51A 2K4KA 2RBMA 4XYQA 2DUDA 4KJOA 5C0XH 1SXTA 3D4RA 4YCUA 2X6LA 1X65A 2NTTA 5J22A 3Q0AA 5CV6A 5IYCH 1PV4A 2E2HB 4A3LG 4FXDA 2XWJB 1LTSD 4A3GH 1D5ZC 4JI6Q 4L6TB 3MFGA 1FJGQ 1RF2D 2IJ0A 1B3QA 4IJLA 3TMEA 4HR7B 2TMPA 2JEBI 1D1KA 4OIKA 5C3EH 2NN6G 1STNA 1PRTC 1PA6A 1ICWA 1J5EQ 3H91A 3U9SA 2DJGC 1V43A 1CZGA 5IGFA 1W6KA 5C4HA 2NTSA 3HOWB 1SMYC 3J80i 4X65L 2BDNA 2MP1A 1Q8KA 1YNNC 1B4OA 1GUTA 4DU9A 4A3EH 1IL2A 1SE8A 2IHEA 4AYBB 3RN5A 4DR4Q 4NXNQ 1SE2A 2CQOA 1MJCA 5IGGA 5I6YA 1QZHA 2HIXA 5AJ3Q 1IKMA 2EJGC 1O7IA 2M00A 3BZKA 2A69C 5EQ0A 3IKJA 1HR0W 5L37A 4L5TA 1CK1A 3KLSX 4HJ5A 3S24A 2DY7A 1M90C 1SFOB 4X3KA 2IL8A 1IYJB 4PG3A 3I3CA 3RLOA 5M9OA 2F3VA 3KLSA 1SMXA 3K5LA 1WCMH 4K5WA 3T13A 4A3FH 2NVXH 4DK0A 1CSPA 2ZTDA 5C5MA 1I3QH 4MZ9A 4U68A 2NVQB 4CHTB 3CMEA 1KDCA 3R8BA 2WP8J 2PW7A 2VB2X 5BN4A 4YHHQ 1SYGA 5EAYA 1TWCH 2PZUA 1KDAA 1OTCA 5IWAL 5J39A 3GV6A 1NUCA 2RF4A 4GKJL 4LF7L 2NYZD 3Q24A 2IPKD 4C3JH 3MXNA 4YWKA 3H0GG 4LNQA 2UUBL 3TP6A 5M5WH 3J81L 1FNWA 3J80E 1LABA 4GS3A 4JI2Q 1XNRQ 1EUJA 4H13C 3HKZE 3K5OA 4JI7L 2BE5D 2J7ZA 5M5XB 3GDEA 4WJWA 4RH6A 1Y1WB 2JA6B 1N36L 1I94L 2A6HD 2GA4B 4QL5A 3S14H 2OT2A 4R4CA 4EGVA 1WTPA 4BY7B 2KCCA 2L9HA 5C0XG 1VQMA 1B44D 1S5FD 2ZTEA 3AB9A 3J81j 1QJOA 2VW9A 1EY6A 2ALYB 1NNXA 2HQLA 2AWNA 1HZAA 1CTMA 4OEMB 3CCJA 2K5NA 1IBLL 2K5DA 4QUCA 4MIUA 1LTID 2Z4IA 5FLMG 5M5YH 4N8FA 1IBKQ 1I4QA 2RSOA 2EYHA 1Y1VG 5CV4A 5LMNW 3KJOA 4YY3Q 3K81C 1W6JA 1HFNA 1P16A 1R4QB 3SR1A 3DM1A 3ULLA 1YNXA 1QVGA 3RR5A 1NMGA 4KHPQ 2KHJA 3K80C 2AKWB 2KCTA 3K59A 3MFYA 2CVRA 2B2TC 2JJQA 4TKOB 4BY1G 2ENBA 3WWVA 1Q81C 1F9PA 4CGYB 3QO2A 3K5MA 2B2TA 3NEMA 4F7XA 3PO3B 4B3RQ 4HJ9A 3I4LA 3JAML 4Z9CB 3URYA 4P71A 2E2HH 3STBC 2F0IA 1CKMA 3QB3A 2WAQB 3I8ZA 4A3JG 3MXPA 1QILA 4X3SA 4K5XA 3NE5B 4EQOA 1ILQA 1WTOA 4FVMA 2B8FA 2PNRC 1VQLA 1QE6A 3HFZB 1WCMG 1QG7A 1ILPA 1I5FA 4JVZA 1YVCA 4XYOA 3EFXD 4QY7A 2O4XA 5BN3A 5HGTA 2Q8IB 5FJ8G 1PH6A 1CHQD 1L2FA 1SNQA 5KNDA 1ET6A 1PFNA 3GV3A 2EIFA
chains in the Genus database with same CATH topology
1SYFA 2IX0A 1SNPA 4TQUS 3OIQA 2KECA 2Q8RE 4A93B 4K2KA 3T56B 4RKLA 2D62A 3VYSA 1X32A 3HG9A 2N88A 1BQQT 4K6DA 5CR3A 3C1EA 4KY6A 5IOCA 2JA8B 5ELFA 4DNTB 4L8JA 1SNMA 1LTAD 1PDQA 3WOEA 1CZWA 4J6HA 4KMUC 3KBGA 4A3BB 3KUPA 4OHJA 3M7GA 2F0HA 1PTOH 3VR3A 3SVMA 1K8OA 4A3DB 1MSGA 2YYZA 1TU2B 1RTNA 3RZOB 3C2PA 2F0NA 4OO1H 1EYAA 1FNVA 1Q12A 5JJZA 1PTOC 2JYOA 3FEWX 1CM9A 1DD2A 1S4ZA 5AFWA 4BWGB 3I73A 4ODGA 3SK4A 3VR2A 1OXUA 2L4NA 1Z7TA 5E4XA 1AZQA 2OEOA 3SK5A 4UAIA 4ZYSA 2D9UA 2MJ8A 4IFDJ 1FGBD 4HAEA 3SHLA 5CGKA 2YU9B 5JEAH 2LS01 1HRJA 4U673 1DYQA 1F2MA 2SOBA 2E76C 1QB5D 1LV9A 3FKIB 1HUMA 2AWOA 1ONLA 5JVH3 3RLFA 2PO4A 2KEDA 1EYCA 2L0CA 2KA7A 2WINB 1NSNS 2MGSA 2F0SA 3T4AC 3KLRA 3OWEB 3GTKB 3K6OA 4IUTA 3I4MB 2RKSA 1BBXC 3Q6SA 3OMCA 1GOZA 5M3FB 2QEJC 3E0JA 1BXTA 1BR9A 4QIWB 4RWSC 1L0YB 3TP7A 1TT2A 5D3DA 1A3TA 3NWSA 1MSHA 3QOJA 4QF4A 4WORA 4OGQC 2RDFA 3J7AF 5CV9A 5K36H 3NUCA 1CA5A 1KABA 5I2XA 4JBWA 1RDPD 2KQ3A 1QCBD 2CHBD 3K7AB 1OO9B 1VDZA 1SJHD 3SXHA 5IODA 4ME5A 2WKCA 1J8IA 5ELDA 3DWAA 3I4NB 2BDOA 1TWHB 1O78A 1JOKA 1TS3A 1V1PB 2D2CC 5JEAG 1Y8OB 3EROA 2L55A 3ITPA 1X3PA 3P75A 2L5TA 3L7ZC 5G3LD 1QWYA 3SEBA 1G91A 2J4XA 5C3XA 3J80L 1AN8A 2RVLA 4DA2A 4YIJA 4K8JA 1PMRA 1LTBD 1MD2D 1DONA 1DXMA 1G8ZD 3TSSA 1SE3A 1WTXA 1G291 1VF5C 4KN4C 1B9NA 1JR0D 4I65A 1FD7D 4BY1B 2AUKA 1A2UA 4CBVA 1EIHA 5FK9C 3OPOA 4WFN3 5HURA 1HQMC 4IQZA 4NMZA 3Q23A 1LTGD 1D5XC 1EL0A 3SDZA 5K36G 3DEPA 5KRUA 1J9OA 5I2YA 1AEXA 4PMBA 3DUZA 3BDOA 4IFDI 1ESRA 2B2UC 3BVZA 4RKBA 5IIFA 4RHSA 3IAYA 2QDBA 4C2MB 2K05A 3AMUA 5DAUA 1Y8PB 1UUPA 3I91A 4RCNA 4S3SA 1RKNA 4QB4A 1EWHA 3S2HB 1OXTA 1GUNA 1II3A 3BDLA 4BA1I 4Q0FA 2F0GA 5LHY1 1LT5D 5EGTA 2DN8A 1WTQA 3MZ5A 1CI3M 1QNKA 3J7AV 1PXUA 3A8JE 3HOVB 5C4ZA 2KEEA 1F9SA 4RGMA 1ZXTA 5CV7A 2BE5C 4KKUA 2HCIA 3M4OB 3OHXC 1T5EA 5COYA 2A6HC 4KN7C 1BCPD 4FF1A 1JCKB 4UDUC 4A3KB 4KD4A 1JC7A 2EYJA 3A7AB 2K5QA 3VYTA 4PNYA 1TKWB 3K5NA 1U4RA 3S1RB 3N52A 2EY1A 4DXGA 3NQTA 4G7OC 1M4VA 1Q8IA 1UNSA 2R93B 4NKLA 3NP8A 5NUCA 4F8MA 1OXSC 3I72A 3LWUA 4C3IB 4K8IA 2E2JB 4RGTA 3DWPA 4GZYC 3CU7A 1V1PA 3HZXA 4M1UB 2F0FA 2F0DA 1KDBA 3M4YA 1VF7A 3TBIB 1IHZA 1STYA 3HOXB 3SK6A 4X3UA 2FJ2A 1ZEQX 3K0YA 1RD9D 5C0XJ 5IT9E 3L3OC 4O42A 1RTOA 2FMCA 4ZQ3A 1F9RA 5JPMC 1E2ZA 5LL6X 1Y69U 2PPBC 5M3MB 3J7YW 4FP5D 5A35A 3RD4A 3NHHA 1LT4D 1PTOF 5C4JB 3PUVA 1MI2A 4CJ2C 4RAUC 1ESFA 1D1IA 5IGDA 4B9WA 1SJED 3FDTA 1IW7D 2CW0D 2EJFC 4ZUJA 3PO2B 2R7ZB 1EIGA 2A73B 2B2YC 1RHPA 2KUMA 1B3AA 1U4LA 4NW2A 3C46A 2B2YA 4CKCA 2K01A 5T1GA 3A8IE 1JORA 1SYCA 3R2TA 2IT1A 4KJNA 4RHRA 1D2BA 2XRQD 2JXMB 1STEA 2DNCA 4IUNA 1B1ZA 3EJIA 4K2LA 4EVOA 1LLRD 2HQEA 5C4XB 5KEEA 1Z6HA 3EVQA 3MEHA 2B39A 1NCVA 3F2UA 3S2DB 3K57A 2EY6A 1LTRD 2AQ1B 4XIGS 1H9KA 1L0XB 3HOZB 2NN6I 4MHEA 4KD3A 1KLUD 2SNMA 1XXGA 3A8KE 1M8AA 1SEBD 2B8GA 5DEHA 3HRZC 3K58A 3E6ZX 4B9XA 3CQZB 2K5WA 1U9RA 1ZYRD 3HOYB 1EWCA 1AP0A 2K28A 1STHA 2MHVA 2D5DA 4ZKBB 4C3JG 3G7LA 3VA5A 2ZXPA 3ND9A 3G6JB 4ZRZA 1KAAA 2K32A 3MWYW 2EY5A 4JK1C 4FYDA 1LO5D 3WDNA 2K04A 2F0PA 1IYVA 4HSVA 3KK7A 1EY9A 2M2LA 5FO8B 1HTLD 4QMGA 1BCPB 1EZ6A 2V4DA 2E2DC 3ERQA 4KY5A 4XTCS 3NBHA 4KV6A 1LTTD 1F77A 4ZAIA 2QKIC 2K03A 3S15B 1RJTA 3P7JA 4IFDH 2ZXRA 1I4PA 2KHSA 1NR4A 2H1EA 5C0XI 3A7LA 1Z47A 3HEJA 3D4DA 3S9WA 1PZID 2F0WA 5TSSA 1TS2A 2XSCA 2B63B 4RA8A 3QWNA 3A56A 2RQXA 4LJZC 1PFMA 3BYTB 1MBYA 4DFAA 3H94A 1OXVA 4FXKC 1K83B 1I4RA 1WTRA 1EU3A 2X6GA 3D6WA 1NR2A 3ONAB 3NWTA 4HMIA 3NBIA 4PV1C 2PYKA 5BN5A 2AQ3B 1QNUA 2RDGA 2E75C 5KGUA 1MGSA 4G4KA 5KNCA 4H7BA 2M9VA 3IFDA 3PUWA 3CRLC 3CHBD 5FOBB 3X3NA 1A3VA 4CKBA 3NTIA 2O2LD 5CBEE 3S1QB 1GUGA 5CC4A 1EOTA 5F2DA 3X3MA 2ZT9C 1TVXA 2F0OA 3TP8A 4I7ZC 3MTSA 5JEAJ 3J81E 2XRSD 3R3OA 2IX3A 1OXXK 4RCOA 1JOQA 1I6VC 3FRPB 1H9MA 4TSSA 1YNJD 3PUYA 1CA6A 2NBFA 2G9DA 1KNAA 5EJWA 1B9MA 1EEID 4OO1G 5CYUA 2N55A 3D4WA 1JQYD 3V2TA 1HUNA 3CKIB 1A2TA 2IW3A 2HCCA 3OOCA 2NVYB 1XYIA 5FO9B 3FVQA 1TS4A 2B2WC 5IT9L 3NXWA 2E2IB 1BO0A 2KCNA 4QCLA 3TDQA 1Q1BA 2B2WA 4G7ZC 5KYIA 3TP5A 1SSOA 1EY5A 2EPBA 1VMCA 3D8GA 3H0GB 4E6IA 4B08A 3R93A 2F0LA 4HCSA 3NTHA 3H3VC 1PRTF 1PZKD 2F03A 1I50B 4CKEA 1O80A 1O7YA 4XDXA 2XVSA 4BS9A 1BCPC 3BS1A 3NK9A 4HTHA 1SNOA 5LL6S 4ZK9B 2BOSA 1DZ1A 2BA0A 3NSWA 2A5HA 1EYDA 1I6HB 2FMMA 2KJXA 1AZPA 3M7NA 4C1NI 1BNZA 4N9PA 2K7VA 3BG3A 2AQ2B 2JSOA 1Y1VB 1ENFA 1B53A 2PW5A 1NAPA 2HDLA 2SEBD 4KHZA 1IYUA 3U9OA 1RODA 1RCVD 4IUQA 4RGNA 4XXEA 1I4XA 2MPMA 1DM0B 2EYMA 2Z8LA 4CJ1B 5E1FA 1SNDA 2A68D 1JWSD 1DOLA 2SNSA 5KYLA 1HFGA 5EPJA 4A3JB 2EYLA 4LMQD 5EPLA 1TIID 1CT1D 3L9AX 1WCMB 2XWBB 1R9TB 3A54A 2NN6H 2NVXB 4DGZA 1ENAA 3MA2B 3S1NB 1TR5A 1B2TA 3MXUA 4XQQA 2EE1A 3DXJC 5K5PA 2K33A 1JWMD 4DAPA 1FNUA 3VR6A 2PQEA 1E2WA 1VCIA 1WVLA 1HPCA 2AUJD 3UI2A 3V05A 1E2VA 2JE6I 1BF4A 1IW7C 2CW0C 3MXGA 3SE0A 4X3TA 1GHKA 3S14B 2FINB 5I4DA 4P2CB 5C44B 5D14A 2PZWA 3P20A 2HDMA 1H9RA 1KTKA 2WACA 4FF4A 1LACA 4OIJA 2O5IC 3MC0B 3OMGA 2F4IA 2JA5B 5M5YB 4M8AA 1STBA 2EY2A 4N9TA 2FHTA 3PMFA 2G9HD 1EQTA 1SNCA 1A3UA 2KVMA 1FYCA 4EQPA 5ELEA 3IL8A 5I6WA 1XWEA 1I4HA 2Y0SB 1BDOA 3D3RA 3PIP3 3FPPA 3I70A 3PV0A 1CHPD 2A6ED 4DAVA 4IN3A 1S5DD 1Y8NB 4ZKCB 1WD0A 5C3WA 1SYEA 1R4PB 1IKLA 1SBBB 1LT3D 2NB0A 1EY0A 4HSPA 2F0MA 1EY7A 5FLXE 3ZYYX 2BA1A 3P1HA 2JEAI 1EEFD 1F2YA 1HA5A 4C3HG 1HHVA 3BVGA 4BBRB 1GUSA 1AW7A 2OF1A 1ZYRC 2VNUD 2F0TA 1Q90A 5EKLA 5I9PA 2MUYA 1SYDA 3BZDB 4HN7A 3SK8A 4XQJA 4ABNA 5ELCA 1AFPA 2L12A 1I4GA 1TWGB 3GTLB 1BUVT 3T16A 1EY8A 4BBSB 5KIXA 4H0LC 3GO5A 1WD1A 2RSNA 5D65A 3BVMA 2H4OA 2SDFA 1S5CD 1DOMA 1HTPA 2OXPA 3T53B 1GUWA 3KF8A 4IZ8A 3VYRA 3Q22A 3NTKA 2NZ1D 2KOLA 5EBCA 3S16B 1PTOB 3OWFA 3GTGB 4Q5VA 4KKTA 5E3FA 2A74C 5KNBA 1SE4A 1EFID 4IUPA 4KY7A 5G3LF 4XQNA 2F0KA 3W3AA 5DM73 5EKIA 2F3WA 1EY4A 5FKAC 4FXGC 5JVG3 1UAPA 4ZUIA 5JOBA 3GTMB 1H9JA 2LKVA 1HQRD 3QG1A 3V96A 5ISRA 1CQVA 2LY7A 2VUMB 5JAVA 1KNEA 4DF7A 4DNRB 5C6AA 1S5ED 3TZUA 1GJXA 1V1OA 3HP3A 5DM63 1PFBA 1SAPA 5CV5A 4DAYA 5CV8A 1E0BA 2QILA 4BA2I 3PUXA 1PRTD 5E4WC 4K5VA 1PLFA 1IL8A 1D6EC 4F87A 1DCZA 1XTCD 1SMYD 2PZTA 5D3IB 2JA7B 3GD7A 1YNND 1TQOA 1TWAB 4K14A 3IFTA 2A69D 1A15A 3C3LA 1ENCA 3M3YB 4HMJA 1UEAB 1HXYD 2LFNA 3QIAA 4H44C 3RMHA 2JP1A 5EKKA 1F9QA 1C8CA 1CQFA 5IGCA 2R92B 1G2TA 1D5MC 1WTWA 2WKDA 1YNJC 4MN3A 3BYYB 3WOFA 4KK7A 2K6AA 3DWQA 1TY0A 5A2QE 1BCPF 3CRKC 2TSSA 3HS0C 3MAQA 2O5JC 2EDGA 4QUFA 1JWUD 4R9WA 2IX1A 2C9OA 4IALA 1S5BD 2WB1B 3PIO3 2E74C 5IGEA 3OW7A 2F0UA 1QOHA 1EZ8A 3N6RA 2EOTA 5EPKA 5ELBA 3H09A 1FR3A 1H9SB 5FO7B 3GTQB 4HEDA 2WIIB 3M85A 4C3IG 1HCZA 3QJYA 1X3QA 3GQBA 2XIWA 3D6CA 2R3ZA 4HCEA 2J0TD 2NWGA 2L1BA 3TZDA 2PCFB 1K8MA 4KI0A 4J8QA 3RZDB 3E5SA 4V0BA 4DXFA 3GP7A 1U4PA 3LWEA 1G2SA 4O1NA 4CJ0B 1Q1EA 5DNFA 2VXWA 4Y7NB 1PYWD 4R8NA 4ULLA 1C4QA 3LNNA 2B2VC 4A3IB 3A55A 2NVTB 1ZKOA 4G57A 4PQXA 2EYPA 2HUGA 5JPNC 2A68C 4TRDA 2I07B 2DNEA 2B2VA 3D31A 4A3MB 1JICA 1STGA 5CBAE 3GTPB 2F0JA 4ILWA 5EBDA 4C3HB 2C5CA 3VA7A 1DJRD 4L63B 3GTOB 2Z4HA 4XT3B 4NDXA 4IFDG 1HA6A 2L11A 2CQAA 5CORA 2ICEC 2RA4A 1LT6D 5FLXL 3RUZA 3BDCA 4C56C 3LX0A 3H6MA 3ND8A 3S1MB 1EQVA 1F2ZA 2K1BA 3HOUB 3S17B 2ZXOA 3NPPA 4V190 2BCOA 1U4MA 1TWFB 2F1MA 2Z1CA 4WRDA 3HGBA 3VR5A 1T5XD 1XX8A 1ET9A 3DEOA 4ID6A 1PTOD 3GTJB 4IURA 2PMZB 3FMCA 3JAME 1CFMA 4PMWA 1B50A 1G6ZA 2R6GA 1C48A 1F2LA 5IGBA 2EJMA 1PRTB 1GXDC 4KHVA 4A3GB 4G7HC 4J1MA 2IWHA 4FF2A 4XT1B 2VB3X 3T51B 5C3EB 3NQIA 5CMDA 1O7LA 3PUZA 2F0EA 3W2DA 3C1FA 2A6EC 2ICIA 4A3EB 4FNFA 4OL7A 1TY2A 3EQLC 1H9SA 4RFBA 3VR4A 3I90A 2F0VA 2XN9C 1KLGD 5I9OA 4PMCA 3KBXA 4A3FB 2EYOA 3O13A 1SDFA 1I3QB 3MHBA 1STAA 2I46A 2RDHA 2R61A 3EA6A 1WTVA 4FF3A 2EZVA 4DK1A 3DHQA 2EYFA 1TS5A 1VMPA 1BOSA 2XNAC 4C1NK 3OSOA 1TWCB 4RGOS 1O7ZA 2WV6D 4KTAA 4OO1I 4C3JB 1A6XA 2F0QA 3HKZB 4NP5A 3VYUA 1SYBA 2B2UA 5M5WB 1JB3A 4KKSA 2DY8A 3FPUB 1ML0D 2ID0A 4EQNA 1JOOA 3AU7A 4LAAA 5J1ZA 4LK1C 4R8IA 1GUOA 3R2IA 4K6LA 2EVBA 4F88A 1PZJD 2QCPX 2LMCB 1DOKA 2EXZA 4DN4M 1GHJA 3DMUA 3OIPA 3QOLA 5T1IA 4IUVA 1JE4A 2QF7A 4ZLTF 2NUCA 4IUUA 1Q3LA 5C5LA 2X69A 2Q8TA 3MVVA 1EU4A 4FO2A 5A2QL 1V8QA 3TN2A 2FFKB 2RBMA 4XYQA 4KJOA 5C0XH 1SXTA 3D4RA 2X6LA 2NTTA 5J22A 3Q0AA 5CV6A 2E2HB 4FXDA 2XWJB 1LTSD 1D5ZC 4L6TB 3MFGA 1RF2D 2IJ0A 3TMEA 4HR7B 2TMPA 2JEBI 1D1KA 4OIKA 2NN6G 1STNA 1PRTC 1ICWA 3H91A 3U9SA 1V43A 1CZGA 5IGFA 1W6KA 5C4HA 2NTSA 3HOWB 1SMYC 2BDNA 2MP1A 1YNNC 1B4OA 1GUTA 4DU9A 4AYBB 1SE2A 5IGGA 5I6YA 1IKMA 2EJGC 2M00A 2A69C 5EQ0A 3IKJA 1CK1A 3KLSX 2DY7A 1SFOB 4X3KA 2IL8A 3I3CA 5M9OA 2F3VA 3KLSA 3K5LA 4K5WA 3T13A 4DK0A 5C5MA 4U68A 2NVQB 4CHTB 1KDCA 3R8BA 2WP8J 2PW7A 2VB2X 5BN4A 1SYGA 2PZUA 1KDAA 5J39A 3GV6A 1NUCA 2NYZD 3Q24A 2IPKD 3MXNA 3TP6A 3J81L 1FNWA 3J80E 1LABA 4H13C 3K5OA 2BE5D 2J7ZA 5M5XB 4WJWA 4RH6A 1Y1WB 2JA6B 2A6HD 2GA4B 2OT2A 4EGVA 1WTPA 4BY7B 2KCCA 2L9HA 5C0XG 1B44D 1S5FD 3AB9A 1QJOA 1EY6A 2AWNA 1CTMA 2K5DA 4QUCA 4MIUA 1LTID 2Z4IA 1I4QA 2RSOA 2EYHA 5CV4A 1W6JA 1HFNA 1R4QB 3SR1A 3DM1A 3K59A 3MFYA 2CVRA 2B2TC 4TKOB 2ENBA 1F9PA 4CGYB 3QO2A 3K5MA 2B2TA 4F7XA 3PO3B 3I4LA 3JAML 4Z9CB 3URYA 2F0IA 3QB3A 2WAQB 3I8ZA 3MXPA 1QILA 4X3SA 4K5XA 3NE5B 4EQOA 1ILQA 1WTOA 4FVMA 2B8FA 2PNRC 1QE6A 1QG7A 1ILPA 4XYOA 3EFXD 5HGTA 2O4XA 5BN3A 2Q8IB 1CHQD 1SNQA 5KNDA 1ET6A 1PFNA 3GV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C8C A;  5CBA E;  1PFM A;  2B2W C;  1IKL A;  2NYZ D;  4QUF A;  4R9W A;  2KED A;  3TN2 A;  1M8A A;  2KEC A;  1WTQ A;  1B2T A;  2FFK B;  1X3P A;  2Q8R E;  1BO0 A;  1QNK A;  2EE1 A;  4XT3 B;  2B2W A;  1HA6 A;  1KNE A;  2MGS A;  1SSO A;  1G91 A;  2J7Z A;  2L11 A;  2EPB A;  2X6L A;  1VMC A;  1X32 A;  3I90 A;  5COR A;  1XYI A;  1WTR A;  2N88 A;  2X6G A;  2KEE A;  1F9S A;  1HHV A;  3D6W A;  3R93 A;  1NR2 A;  1ZXT A;  4IUT A;  1WTP A;  4HCS A;  2RA4 A;  2RVL A;  2HCI A;  3ONA B;  3Q6S A;  3HP3 A;  1BBX C;  2L9H A;  1PFB A;  1SAP A;  1MI2 A;  5COY A;  4CJ2 C;  1WVL A;  1E0B A;  4RAU C;  3KBX A;  1AP0 A;  2K28 A;  3FDT A;  3UI2 A;  4RWS C;  1O80 A;  1SDF A;  1DON A;  2K1B A;  1PDQ A;  2EOT A;  1O7Y A;  5E4W C;  4XDX A;  1PLF A;  1MGS A;  1WTV A;  1WTX A;  1IL8 A;  2L12 A;  5EPK A;  4QUC A;  1EIG A;  3KUP A;  4OIK A;  4ZKB B;  1BF4 A;  1MSH A;  2B2Y C;  1RHP A;  1VMP A;  4ZK9 B;  4HED A;  4X3T A;  3G7L A;  1ICW A;  2KUM A;  3IFD A;  3SVM A;  1B3A A;  2FIN B;  3H91 A;  1U4M A;  1WD1 A;  1U4R A;  1DZ1 A;  1U4L A;  1O7Z A;  2RSN A;  2RSO A;  1MSG A;  3N52 A;  4NW2 A;  5D65 A;  1EIH A;  2B2Y A;  2SDF A;  1X3Q A;  2BDN A;  3MWY W;  1XX8 A;  5D14 A;  3DEO A;  1HFN A;  1RTN A;  2FMM A;  2MP1 A;  1AZP A;  1DOM A;  2K01 A;  2XIW A;  2HDM A;  3DM1 A;  5T1G A;  1GUW A;  4IUR A;  1B4O A;  2R3Z A;  1BNZ A;  1A15 A;  5CBE E;  2B2U A;  2DY8 A;  2L1B A;  2NWG A;  2K04 A;  2NZ1 D;  2CVR A;  2B2T C;  3FPU B;  4OIJ A;  2KOL A;  5JJZ A;  1ML0 D;  2JYO A;  1CA5 A;  1EOT A;  1IKM A;  4HSV A;  3TZD A;  1G6Z A;  5EQ0 A;  1B50 A;  1EL0 A;  1B53 A;  1CM9 A;  1TVX A;  1NAP A;  2HDL A;  3DEP A;  1F9P A;  2DY7 A;  3QO2 A;  2M2L A;  2B2T A;  1S4Z A;  1J9O A;  5AFW A;  1F2L A;  4X3K A;  3MTS A;  4R8I A;  2IL8 A;  3I3C A;  4ZKC B;  1U4P A;  3LWE A;  1WD0 A;  1G2S A;  2FHT A;  1J8I A;  2L4N A;  1ESR A;  1EQT A;  2B2U C;  4ZAI A;  1ROD A;  5E4X A;  4CJ0 B;  5DNF A;  2VXW A;  1AZQ A;  2K03 A;  2KVM A;  1RJT A;  3P7J A;  4IUP A;  3I8Z A;  2JP1 A;  4IUQ A;  4X3S A;  4UAI A;  1CA6 A;  2D9U A;  2MJ8 A;  1ILQ A;  1WTO A;  1NCV A;  1NR4 A;  2K05 A;  1F9Q A;  1DOK A;  3F2U A;  3IL8 A;  4XT1 B;  4X3U A;  4DN4 M;  2H1E A;  2MPM A;  2FJ2 A;  4HAE A;  1QE6 A;  4U68 A;  1KNA A;  5EKI A;  1WTW A;  1G2T A;  1QG7 A;  1ILP A;  5EJW A;  5CMD A;  4CJ1 B;  5T1I A;  4IUV A;  4MN3 A;  2B2V C;  1DOL A;  1JE4 A;  3I91 A;  1HFG A;  5EPJ A;  1HRJ A;  4LMQ D;  2N55 A;  4ZLT F;  5EPL A;  4IUU A;  1Q3L A;  2HUG A;  4O42 A;  1HUN A;  1RTO A;  2HCC A;  1LV9 A;  2B2V A;  1F9R A;  2X69 A;  2Q8T A;  4RA8 A;  1JIC A;  1HUM A;  1PFN A;  3GV3 A;  3GV6 A;  4MHE A; 
#chains in the Genus database with same CATH topology
 1SYF A;  2IX0 A;  2E5L L;  1SNP A;  4OEL B;  4TQU S;  3OIQ A;  2KEC A;  2Q8R E;  3NEN A;  4A93 B;  1KHI A;  5FLX c;  2XGT A;  4K2K A;  3T56 B;  1WTH A;  5ELN A;  1VQ7 A;  1NBW A;  4RKL A;  3GTL H;  2D62 A;  3VYS A;  1X32 A;  4AYB E;  3HG9 A;  2HT1 A;  2N88 A;  1SFO H;  1BQQ T;  4K6D A;  5CR3 A;  3C1E A;  2VQF Q;  4LW1 A;  4KY6 A;  4CDD C;  5IOC A;  3EBE A;  2JA8 B;  5ELF A;  1YHA A;  4DNT B;  4L8J A;  2BH8 A;  4JBJ A;  1GVP A;  2I5M X;  1SNM A;  1LTA D;  1PDQ A;  3WOE A;  1CZW A;  4J6H A;  5C44 G;  4KMU C;  1GD7 A;  2NVQ H;  3KBG A;  1YI2 A;  4A3B B;  3KUP A;  5BR8 L;  4OHJ A;  4DUY L;  3M7G A;  1FVI A;  5JJI A;  2F0H A;  1PTO H;  3VR3 A;  3SVM A;  1K8O A;  4A3D B;  5IYB H;  1MSG A;  2YYZ A;  2E8G A;  2JA5 G;  1TU2 B;  1RTN A;  3RZO B;  2EXD A;  3C2P A;  2F0N A;  4OO1 H;  1EYA A;  3CCQ A;  4JI5 Q;  4JBK A;  1FNV A;  4LF4 Q;  1Q12 A;  4CDE C;  5JJZ A;  1PTO C;  4MTK A;  1X9N A;  4LF8 Q;  2CWP A;  2JYO A;  4YCV A;  3FEW X;  4DV1 L;  1CM9 A;  1DD2 A;  5M5X H;  3UE0 A;  1S4Z A;  5AFW A;  4BWG B;  1Y1W H;  3I73 A;  4ODG A;  3SK4 A;  3VR2 A;  1OXU A;  2L4N A;  2Y0S G;  1Z7T A;  5E4X A;  1AZQ A;  2OEO A;  3KYH C;  3SK5 A;  4OWW B;  4UAI A;  4ZYS A;  2D9U A;  2MJ8 A;  1VQD A;  4IFD J;  1K8G A;  4OON A;  1FGB D;  1D8L A;  4HAE A;  4DV0 Q;  3SHL A;  5CGK A;  3F2B A;  4JI1 L;  2YU9 B;  2UXB L;  5JEA H;  2LS0 1;  1HRJ A;  4DUZ Q;  2DGY A;  4U67 3;  1DYQ A;  1YJN A;  2PNH A;  1F2M A;  2SOB A;  1IZ6 A;  2E76 C;  1QZG A;  2LSS A;  1QB5 D;  1LV9 A;  3FKI B;  1HUM A;  2AWO A;  1ONL A;  4L5Q A;  5JVH 3;  3RLF A;  5H1S E;  1RIP A;  2PO4 A;  2KED A;  4DR5 Q;  4IOC A;  3RNU A;  1EYC A;  2B29 A;  2L0C A;  4BBR G;  4R4O A;  2KA7 A;  2WIN B;  1NSN S;  1PH7 A;  2MGS A;  2F0S A;  4JC0 A;  4HJA A;  1PH3 A;  3T4A C;  3KLR A;  3BZC A;  3OWE B;  1DGS A;  3GTK B;  1Q82 C;  3K6O A;  4IUT A;  4JI3 L;  3I4M B;  2RKS A;  1BBX C;  3Q6S A;  2A1A A;  3OMC A;  1GOZ A;  5IP9 H;  3PIP A;  5M3M G;  5M3F B;  4DPG A;  2QEJ C;  3E0J A;  4A75 A;  1BXT A;  1BR9 A;  4QIW B;  1TWA H;  3T1H L;  4BBS G;  1WI5 A;  4RWS C;  2N49 A;  1L0Y B;  3FP9 A;  1HNX L;  1N34 Q;  4JW0 A;  4JCV E;  3TP7 A;  1TT2 A;  5D3D A;  1A3T A;  3NWS A;  5IE8 A;  1MSH A;  3QOJ A;  4QF4 A;  2YTX A;  2CH4 A;  1X6O A;  4WOR A;  3CCL A;  4OGQ C;  1GO3 E;  4NPS A;  1VQ6 A;  4DR3 L;  5IY0 A;  3KF6 B;  2RDF A;  3J7A F;  5CV9 A;  5K36 H;  2P5Z X;  3NUC A;  1EFW A;  4IPD A;  4A93 H;  1CA5 A;  1KAB A;  5I2X A;  4JBW A;  2R92 H;  5GAE C;  2BH2 A;  1RDP D;  2KQ3 A;  1QCB D;  2CHB D;  3K7A B;  3TRE A;  1OO9 B;  1VDZ A;  3I4O A;  1E22 A;  2CH4 W;  2K52 A;  3CP0 A;  2Q2U A;  1SJH D;  2JA8 H;  1IBM Q;  3SXH A;  5IOD A;  4JI6 L;  4ME5 A;  1FJG L;  2WKC A;  1J8I A;  5ELD A;  1M1K C;  3DWA A;  3I4N B;  4A3B H;  2BDO A;  1TWH B;  1VQ4 A;  1O78 A;  1XTD A;  1JOK A;  1TS3 A;  1VQE A;  1V1P B;  4WJ3 M;  3BJU A;  2JK8 A;  1J5E L;  4A3D H;  3HKS A;  2D2C C;  2VUM G;  5JEA G;  1Y8O B;  3ERO A;  2L55 A;  3ITP A;  1X3P A;  3P75 A;  4DR4 L;  4NXN L;  2L5T A;  3L7Z C;  5G3L D;  1QWY A;  5AJ3 L;  3SEB A;  1G91 A;  2J4X A;  3G48 A;  5C3X A;  3J80 L;  1AN8 A;  2RVL A;  5IP7 G;  3U4Z A;  4DA2 A;  4YIJ A;  4K8J A;  1PMR A;  1X54 A;  1LTB D;  2JA7 G;  1MD2 D;  1DON A;  1DXM A;  1G8Z D;  3TSS A;  1B70 B;  1SE3 A;  3ZJY C;  1NJI C;  1WTX A;  1UE6 A;  1G29 1;  1VF5 C;  1TXY A;  2OQ0 A;  4KN4 C;  5LMU Q;  4K0K Q;  1B9N A;  2YU9 H;  1B7Y B;  1JR0 D;  4I65 A;  3H15 A;  1FD7 D;  3AFP A;  4YHH L;  2AUK A;  4BY1 B;  1A2U A;  4CBV A;  1EIH A;  3FKI H;  1V1Q A;  5FK9 C;  4EQ5 A;  3OPO A;  5E7N A;  1W2B A;  1MJE A;  4WFN 3;  5HUR A;  1HQM C;  3KLW A;  4IQZ A;  4NMZ A;  3Q23 A;  1LTG D;  1D5X C;  1EL0 A;  3SDZ A;  5K36 G;  3DEP A;  4JI2 L;  1XNR L;  5KRU A;  3I55 A;  1J9O A;  5I2Y A;  5GAH C;  1AEX A;  4PMB A;  3DUZ A;  3GTK H;  3CW2 C;  3BDO A;  3EN2 A;  4UPA A;  1X56 A;  2R92 G;  3VDY A;  3CMA A;  1UEB A;  4IFD I;  1ESR A;  2B2U C;  3BVZ A;  4RKB A;  4A3M H;  5M3F H;  1UE7 A;  1U0L A;  5IIF A;  4RHS A;  1E24 A;  3IAY A;  2QDB A;  4LFC L;  4C2M B;  2K05 A;  4C3H H;  3AMU A;  4POF A;  5DAU A;  4AIM A;  3GTO H;  1Y8P B;  2OTJ A;  4QIW E;  3W1B A;  1UUP A;  2GN5 A;  3I91 A;  4RCN A;  3J81 c;  4S3S A;  1RKN A;  4QB4 A;  1EWH A;  4LFB Q;  3S2H B;  1OXT A;  2HIV A;  4CDC C;  1GUN A;  1II3 A;  3BDL A;  3FHW A;  4BA1 I;  4Q0F A;  1H95 A;  2F0G A;  1HR0 Q;  1VQ5 A;  5LHY 1;  2WB1 G;  1LT5 D;  5EGT A;  4YY3 L;  1SLJ A;  2DN8 A;  1HNX Q;  4R4Q A;  3CPW A;  1XNQ Q;  1WTQ A;  3MZ5 A;  4KHP L;  1CI3 M;  1QNK A;  4B3M L;  3J7A V;  4TVA B;  1PXU A;  3A8J E;  1EYG A;  4DR1 Q;  3S17 H;  4DV7 L;  3HOV B;  1AE2 A;  3K7A H;  5C4Z A;  2KEE A;  1F9S A;  4RGM A;  1ZXT A;  5CV7 A;  2BE5 C;  1K28 A;  4KKU A;  4B3R L;  2HCI A;  3M4O B;  2HD3 A;  3OHX C;  2VQE Q;  1T5E A;  3KF6 A;  5COY A;  2A6H C;  4KN7 C;  3A5U A;  1BCP D;  4FF1 A;  1VQP A;  1JCK B;  4UDU C;  4A3K B;  4KD4 A;  1KRS A;  1JC7 A;  4A3C G;  1A8V A;  3F1Z A;  3I4N H;  2EYJ A;  3A7A B;  2K5Q A;  3VYT A;  1W3S A;  2PMZ E;  4PNY A;  1TKW B;  3K5N A;  1U4R A;  3S1R B;  3N52 A;  2EY1 A;  4DXG A;  3NQT A;  2L15 A;  4G7O C;  1HNW Q;  1M4V A;  1Q8I A;  2F4V Q;  1UNS A;  2R93 B;  1U5K A;  4NKL A;  3NEL A;  3NP8 A;  5NUC A;  3JAM c;  4F8M A;  1OXS C;  3I72 A;  3LWU A;  4C3I B;  4GLV B;  4K8I A;  2E2J B;  4HIK A;  1BBU A;  4RGT A;  1CKN B;  3DWP A;  4GZY C;  4AQY Q;  3CU7 A;  1V1P A;  3HZX A;  4GN3 B;  4M1U B;  2F0F A;  1PH1 A;  2F0D A;  3CCU A;  1KDB A;  2VQF L;  3M4Y A;  4A3I G;  1VF7 A;  1L1O B;  3TBI B;  1IHZ A;  1STY A;  3HOX B;  3SK6 A;  2WFW A;  2I5H A;  4X3U A;  2FJ2 A;  4A3M G;  1ZEQ X;  2F3I A;  1EIF A;  3K0Y A;  5LMN Q;  1RD9 D;  4O2D A;  4MTN A;  1VQH A;  1NY4 A;  5C0X J;  5IT9 E;  3L3O C;  4O42 A;  1RTO A;  2FMC A;  1X3E A;  4JI0 Q;  3PCO B;  3NBH B;  4ZQ3 A;  1F9R A;  1X55 A;  2ZM6 Q;  5JPM C;  1E2Z A;  4APV A;  2HHH Q;  4NB3 A;  3H3V I;  3ERS X;  2KBN A;  4HJ8 A;  5LL6 X;  4JI5 L;  4LF4 L;  1Y69 U;  2PPB C;  5JJL A;  5M3M B;  2CWA A;  4LF8 L;  3J7Y W;  4FP5 D;  5A35 A;  3RD4 A;  3NHH A;  5GAG C;  4X64 L;  1LT4 D;  1KXL A;  2K75 A;  1HH2 P;  1PTO F;  1Q7Y C;  5C4J B;  3HOU G;  2K5V A;  3PUV A;  1MI2 A;  4CJ2 C;  4RAU C;  3U50 C;  1ESF A;  1QVC A;  3D0F A;  1D1I A;  5IGD A;  4B9W A;  1SJE D;  3FDT A;  5HGQ A;  5IYD H;  1IW7 D;  2CW0 D;  2EJF C;  4ZUJ A;  3KFU A;  3PO2 B;  2R7D A;  2R7Z B;  1EIG A;  2A73 B;  1YHQ A;  2B2Y C;  1RHP A;  4DV0 L;  4HID A;  1VQ8 A;  2KUM A;  1B3A A;  1S40 A;  3S2H H;  1U4L A;  4DUZ L;  4NW2 A;  3C46 A;  1KAW A;  2B2Y A;  2RHQ B;  4CKC A;  1EOV A;  2K01 A;  5T1G A;  3A8I E;  4LFC Q;  1JOR A;  5IYC G;  1SYC A;  3RLN A;  3R2T A;  4DR5 L;  2IT1 A;  1PH9 A;  1LTL A;  4KJN A;  4RHR A;  1D2B A;  1X3G A;  1XPO A;  2XRQ D;  4A3G G;  1X3F A;  2JXM B;  3HOV H;  4O0A A;  1BVS A;  2VZA A;  2GVB A;  1STE A;  4PZ7 A;  4L5S A;  2DNC A;  1VQA A;  4IUN A;  3PF5 A;  1B1Z A;  4L5R C;  3EJI A;  4K2L A;  2CKZ B;  4EVO A;  5C3E G;  3M4O H;  1LLR D;  2HQE A;  5C4X B;  5KEE A;  1Z6H A;  3EVQ A;  3MEH A;  4A3K H;  2B39 A;  4B3M Q;  1NCV A;  3F2U A;  2OTL A;  3S2D B;  3K57 A;  2EY6 A;  1LTR D;  2AQ1 B;  4DV7 Q;  4XIG S;  1N34 L;  2VL6 A;  1H9K A;  1L0X B;  1BBW A;  4A3E G;  1KC8 C;  1PHJ A;  1J6Q A;  4P72 A;  3L2P A;  1N32 L;  3S1R H;  4R4I A;  3HOZ B;  2MO1 A;  4DV2 Q;  2NN6 I;  4GN5 A;  4MHE A;  4KD3 A;  4X66 Q;  2R93 H;  1KLU D;  2SNM A;  1XXG A;  5J3B A;  1JJG A;  3A8K E;  3A74 A;  1YIJ A;  1M8A A;  1C7Y A;  1SEB D;  2B8G A;  5DEH A;  3HRZ C;  4C3I H;  4IOA A;  3K58 A;  1JJ2 A;  3E6Z X;  4B9X A;  4A3F G;  4DR6 Q;  1RL2 A;  3CQZ B;  2K5W A;  1U9R A;  1ZYR D;  3CCE A;  2AMC B;  3CPF A;  4GOP B;  3HOW H;  1PYB A;  3HOY B;  4OWX B;  1N33 Q;  3RN2 A;  1EWC A;  4GKK Q;  4DK3 C;  1AP0 A;  2K28 A;  3HOX H;  1IBM L;  1STH A;  2MHV A;  1K0S A;  1E1O A;  2D5D A;  4ZKB B;  1K9M C;  1CKN A;  1KL9 A;  4C3J G;  3HKZ G;  3G7L A;  3VA5 A;  2ZXP A;  3ND9 A;  1L1O C;  3G6J B;  3AYH B;  4ZRZ A;  4DR7 Q;  1KAA A;  2K32 A;  3MWY W;  2ES2 A;  2EY5 A;  4JK1 C;  3KDF B;  1L1O A;  1PFS A;  1S72 A;  4FYD A;  1LO5 D;  3WDN A;  3E3X A;  2K04 A;  2F0P A;  1IYV A;  3MEF A;  3Q8D A;  4HSV A;  3KK7 A;  4NXM Q;  2JA9 A;  1EY9 A;  3UDI A;  2M2L A;  5FO8 B;  4DK6 C;  2EQS A;  1HTL D;  4QMG A;  1BCP B;  1EZ6 A;  2V4D A;  2E2D C;  3ERQ A;  4KY5 A;  2QGQ A;  4XTC S;  1XPU A;  4BXX H;  1SRO A;  3NBH A;  4KV6 A;  1LTT D;  1F77 A;  4ZAI A;  2QKI C;  2K03 A;  3S15 B;  2Z0S A;  1RJT A;  1VQG A;  3P7J A;  2ZXR A;  4IFD H;  1I4P A;  4GN4 B;  1XPR A;  2KHS A;  4LUZ A;  1NR4 A;  4H02 A;  2H1E A;  5C0X I;  3CCM A;  3A7L A;  3PO2 H;  1Z47 A;  3HEJ A;  1WFQ A;  2R7Z H;  3D4D A;  4JOI A;  3S9W A;  1PZI D;  4X64 Q;  4DV6 Q;  2ASB A;  3OTO Q;  2ZJR A;  5LMU L;  4K0K L;  2F0W A;  5TSS A;  1TS2 A;  2JA6 H;  1P8L A;  3U4V A;  2XSC A;  2B63 B;  4RA8 A;  3QWN A;  1CKO A;  3A56 A;  4BY7 H;  2RQX A;  4LJZ C;  1PFM A;  3K8A A;  3AEV A;  1VQK A;  3BYT B;  3J80 c;  1MBY A;  4UY8 C;  4DFA A;  1NTG A;  3J81 i;  3H94 A;  4IPG A;  1VS0 A;  1OXV A;  4FXK C;  1K83 B;  4GLX A;  3LGJ A;  1I4R A;  2D0P A;  1WTR A;  1S3O A;  1BKB A;  1EU3 A;  2X6G A;  3D6W A;  1NR2 A;  1YZ6 A;  3SGI A;  3ONA B;  3NWT A;  4HMI A;  1HNZ Q;  4QQB X;  1WJJ A;  3NBI A;  4YCW A;  4PV1 C;  2PYK A;  5C4X H;  5BN5 A;  1UE1 A;  2AQ3 B;  1QNU A;  2RDG A;  2E75 C;  5KGU A;  3E9H A;  1MGS A;  1CUK A;  3S2D H;  4G4K A;  2C35 B;  5KNC A;  4JV5 Q;  4H7B A;  2M9V A;  3IFD A;  4AYB G;  3PUW A;  3PO3 H;  4IO9 A;  4LFB L;  1SRU A;  1L0W A;  3CRL C;  3HOZ H;  3CHB D;  5FOB B;  3X3N A;  3PGZ A;  1A3V A;  4CKB A;  1LM0 A;  3NTI A;  2O2L D;  1HR0 L;  1E3P A;  5CBE E;  3S1Q B;  1PVO A;  1GUG A;  1XNQ L;  5CC4 A;  1EOT A;  1YIT A;  1PH5 A;  5F2D A;  1C0A A;  3X3M A;  2ZT9 C;  1TVX A;  2WAQ E;  3E9I A;  2F0O A;  3TP8 A;  3CQZ H;  4DR1 L;  4I7Z C;  2PI2 E;  1N32 Q;  3MTS A;  5JEA J;  3J81 E;  2XRS D;  3R3O A;  1VQJ A;  3G71 A;  2IX3 A;  1OXX K;  4J15 A;  4RCO A;  3HOY H;  1JOQ A;  1I6V C;  3FRP B;  2VQE L;  1H9M A;  2VS1 A;  2ZTC A;  4TSS A;  1YNJ D;  4BXX G;  3PUY A;  1CA6 A;  5IYB G;  2PI2 A;  2NBF A;  2G9D A;  1KNA A;  4LF6 Q;  5EJW A;  4GOP C;  1B9M A;  1EEI D;  4OO1 G;  1LUZ A;  4LFA Q;  5CYU A;  2N55 A;  2LXK A;  3AFQ A;  3D4W A;  1JQY D;  3V2T A;  3KJP A;  2UUC Q;  4GOP A;  3CKI B;  1A2T A;  2IW3 A;  1HUN A;  1JJC B;  2HCC A;  3OOC A;  2NVY B;  1K3R A;  1XYI A;  5FO9 B;  3FVQ A;  4DKA C;  1TS4 A;  2B2W C;  1HNW L;  5IT9 L;  2F4V L;  2YV5 A;  1Y1W G;  3NXW A;  2E2I B;  1BO0 A;  2KCN A;  4QCL A;  3H3V H;  4BY7 G;  3TDQ A;  1Q1B A;  2B2W A;  4G7Z C;  4JI4 Q;  5KYI A;  3TP5 A;  2K14 A;  1SSO A;  1EY5 A;  2EPB A;  1VMC A;  2FXQ A;  3D8G A;  3H0G B;  4E6I A;  4B08 A;  3R93 A;  1VQF A;  4AQY L;  2F0L A;  4HCS A;  2R7F A;  3I7F A;  3NTH A;  3H3V C;  1PRT F;  1PZK D;  2F03 A;  3S15 H;  3KDF A;  3RZO H;  1I50 B;  4CKE A;  1E7Z A;  1O80 A;  4GNX B;  1O7Y A;  4XDX A;  2XVS A;  4BS9 A;  1BCP C;  3BS1 A;  3NK9 A;  4HTH A;  1SNO A;  5LL6 S;  5LMN L;  4UP8 A;  4ZK9 B;  2BOS A;  4JBM A;  4WJ4 A;  1T9H A;  2KHI A;  1DZ1 A;  4QGU A;  2BA0 A;  3NSW A;  2A5H A;  2B63 H;  1EYD A;  1C9O A;  1I6H B;  4POG A;  4JI0 L;  2FMM A;  2H5X A;  2KJX A;  1AZP A;  3M7N A;  3TS2 A;  4PZ6 A;  2ZM6 L;  4C1N I;  3PO3 G;  1BNZ A;  4JPB W;  4N9P A;  2K7V A;  3BG3 A;  2HHH L;  2AQ2 B;  2JSO A;  1Y1V B;  1ENF A;  5IP9 G;  2LXJ A;  3CD6 A;  4ZCK A;  1B53 A;  2PW5 A;  1NAP A;  2HDL A;  2SEB D;  4KHZ A;  1IYU A;  1K83 H;  3U9O A;  1YHB A;  1ROD A;  3CF5 A;  5DLQ E;  1RCV D;  4IUQ A;  4RGN A;  3KF8 B;  4XXE A;  1I4X A;  2MPM A;  1DM0 B;  2EYM A;  1EIY B;  1K73 C;  2Z8L A;  4CJ1 B;  4IPH A;  4UP7 A;  1SND A;  2A68 D;  5E1F A;  1JWS D;  4A3L H;  1DOL A;  2SNS A;  5KYL A;  1HFG A;  5EPJ A;  4A3J B;  2EYL A;  4LMQ D;  5EPL A;  1TII D;  2MNA A;  2UUA Q;  4A93 G;  1CT1 D;  1K8A C;  4P73 A;  3L9A X;  1IXR A;  3I4M H;  1WCM B;  2XWB B;  1R9T B;  2CCZ A;  3A54 A;  2NN6 H;  2NVX B;  4DGZ A;  1ENA A;  3MA2 B;  3S1N B;  1TR5 A;  1B2T A;  3MXU A;  4XQQ A;  2KCM A;  4P75 A;  2EE1 A;  3DXJ C;  2JA8 G;  5K5P A;  2K33 A;  4A4I A;  1JWM D;  2A19 A;  3JC6 6;  1EWI A;  3ER0 A;  4DAP A;  3M4P A;  1FNU A;  3VR6 A;  2PQE A;  1Z9F A;  4A3B G;  4IPC A;  1E2W A;  1VCI A;  1WVL A;  1HPC A;  1MHW C;  2AUJ D;  3TS0 A;  3UI2 A;  3V05 A;  1E2V A;  2JE6 I;  4A3D G;  4DV4 L;  1AE3 A;  2QA4 A;  1BF4 A;  1EQQ A;  1IW7 C;  2CW0 C;  3MXG A;  4UHV A;  3SE0 A;  4X3T A;  1GHK A;  1YJW A;  3S14 B;  2FIN B;  4X6A H;  1GM5 A;  5I4D A;  4P2C B;  3AQQ A;  5C44 B;  3K0X A;  5D14 A;  2PZW A;  1VQO A;  3P20 A;  4DAY B;  1WYD A;  1KIX A;  2HDM A;  4DV2 L;  1XMO Q;  1H9R A;  1KTK A;  2WAC A;  4X66 L;  4FF4 A;  1LAC A;  4HIO A;  4OIJ A;  3DLL A;  2O5I C;  3PSI A;  3MC0 B;  2AHO B;  3OMG A;  2F4I A;  2JA5 B;  1VQC A;  5M5Y B;  1TWH H;  4M8A A;  1STB A;  4DR6 L;  2EY2 A;  4DV5 Q;  3ULP A;  4N9T A;  2N8N A;  2FHT A;  3PMF A;  2G9H D;  1JB7 A;  1EQT A;  1SNC A;  1A3U A;  3IRB A;  2KVM A;  2YTY A;  1FYC A;  4EQP A;  3PIO A;  1YBY A;  1N33 L;  4GKK L;  4B3T Q;  5ELE A;  3IL8 A;  5I6W A;  1XWE A;  1UWV A;  3FKI G;  1I4H A;  2Y0S B;  2ATW A;  1BDO A;  3D3R A;  3PIP 3;  3ULJ A;  3FPP A;  3I70 A;  3PV0 A;  3TRZ A;  1CHP D;  2A6E D;  4HIM A;  4DAV A;  4IN3 A;  1S5D D;  1Y8N B;  4ZKC B;  4X62 Q;  4GNX C;  1WD0 A;  3CC2 A;  5C3W A;  1KQS A;  1SYE A;  4DR7 L;  1I6H H;  1R4P B;  1IKL A;  2NZH A;  1SBB B;  1LT3 D;  2NB0 A;  1EY0 A;  4HSP A;  5FLM H;  4GNX A;  3I4M G;  1YJ9 A;  1Y1V H;  2F0M A;  5M3F G;  1PH4 A;  1EY7 A;  2N3S A;  5FLX E;  1ASZ A;  3ZYY X;  4NXM L;  2BA1 A;  2JQO A;  3P1H A;  2ZJP A;  2JEA I;  1EEF D;  1F2Y A;  1HA5 A;  4C3H G;  1HHV A;  3BVG A;  4BBR B;  1UE5 A;  1GUS A;  1AW7 A;  4BY1 H;  3E0E A;  1PH2 A;  2OF1 A;  1ZYR C;  2VNU D;  2F0T A;  1Q90 A;  5EKL A;  5I9P A;  2MUY A;  1SYD A;  3BZD B;  4CDF C;  4HN7 A;  3SK8 A;  4XQJ A;  4QJF A;  4ABN A;  5ELC A;  2UXC Q;  1AFP A;  2L12 A;  1I4G A;  1TWG B;  3GTL B;  1BUV T;  3T16 A;  4A3J H;  1EY8 A;  4BBS B;  5KIX A;  4H0L C;  3GO5 A;  4DV6 L;  3OW2 A;  1WD1 A;  4LF5 L;  2RSN A;  3OTO L;  1K3B C;  5D65 A;  3BVM A;  2H4O A;  2SDF A;  1S5C D;  1R9T H;  1QUQ B;  1DOM A;  1HTP A;  2OXP A;  3T53 B;  1GUW A;  1JT8 A;  3KF8 A;  4IZ8 A;  3VYR A;  3Q22 A;  3NTK A;  3S1N H;  2NZ1 D;  5FJ8 H;  4C2M H;  1GKH A;  2KOL A;  5EBC A;  4DR2 Q;  4JI8 L;  3S16 B;  2Z6K C;  4R1J A;  1PTO B;  3OWF A;  3GTG B;  4Q5V A;  3B6Y A;  2I0Q A;  4OXP A;  4KKT A;  2Z6K A;  5E3F A;  2A74 C;  3I4N G;  5KNB A;  1SE4 A;  1EFI D;  4HJ7 A;  4IUP A;  1HNZ L;  4KY7 A;  2VY3 A;  5G3L F;  1MKH A;  2DJF C;  4XQN A;  2F0K A;  4OWT B;  2UXD L;  3W3A A;  5DM7 3;  5EKI A;  2F3W A;  2IY5 B;  1EY4 A;  5FKA C;  4FXG C;  4P74 A;  3PF4 A;  1D7Q A;  5JVG 3;  1UAP A;  2GVA A;  4ZUI A;  3CC7 A;  5JOB A;  4JV5 L;  4EX5 A;  3GTM B;  5C44 H;  1H9J A;  2LKV A;  2OCE A;  3U58 A;  5JJK A;  1HQR D;  3QG1 A;  4DV4 Q;  2G5D A;  4A76 A;  3V96 A;  5ISR A;  4DV3 Q;  1CQV A;  3M4Q A;  4N8X 1;  2V1C C;  2LY7 A;  1JMC A;  2VUM B;  5JAV A;  1KNE A;  2JA5 H;  3G4S A;  4DF7 A;  3CCS A;  1VQ9 A;  1YEZ A;  4DNR B;  2K5H A;  4LF9 Q;  5C6A A;  2UU9 Q;  1S5E D;  1XMQ L;  3TZU A;  1GJX A;  1V1O A;  3HP3 A;  5DM6 3;  1PFB A;  5GRO A;  1SAP A;  5CV5 A;  1ICF B;  4DAY A;  5CV8 A;  1E0B A;  2QIL A;  4BA2 I;  3PUX A;  1PYS B;  1PRT D;  5E4W C;  4K5V A;  1PLF A;  1IL8 A;  1D6E C;  4F87 A;  3J7Z C;  3ICE A;  4OX9 Q;  2E2J H;  1DCZ A;  1XTC D;  2RCF A;  4LF6 L;  1SMY D;  2PZT A;  1KD1 C;  4JYA Q;  2ZJQ A;  3A5Z B;  5D3I B;  2JA7 B;  3GD7 A;  4LFA L;  2Y0S E;  1YNN D;  3T1Y Q;  2UUC L;  1TQO A;  1TWA B;  4K14 A;  3IFT A;  2A69 D;  1A15 A;  3C3L A;  1ENC A;  1V9P A;  3M3Y B;  1VQB A;  4HMJ A;  1UEA B;  4JI4 L;  1HXY D;  3I2Z A;  5IYD G;  2A8V A;  2LFN A;  3QIA A;  4BBR H;  3UDG A;  2JN4 A;  4H44 C;  3RMH A;  2JP1 A;  2MFI A;  5EKK A;  2IHF A;  1JE5 A;  2MO0 A;  1F9Q A;  1C8C A;  1CQF A;  5IGC A;  2R92 B;  1G2T A;  1D5M C;  1WTW A;  1SN8 A;  2WKD A;  1YNJ C;  5IT9 c;  1TWG H;  4MN3 A;  5M3M H;  3BYY B;  3WOF A;  1K0R A;  4KK7 A;  2K6A A;  3DWQ A;  4MNO A;  4BBS H;  1TY0 A;  4X65 Q;  5A2Q E;  1BCP F;  3CRK C;  4UP9 A;  5C4J H;  2TSS A;  4I7A A;  1NE3 A;  3HS0 C;  3MAQ A;  2O5J C;  4GLA C;  2EDG A;  3HOV G;  4QUF A;  4LWC A;  1JWU D;  4R9W A;  4JOI C;  2IX1 A;  2Z6B A;  2C9O A;  4IAL A;  3TQY A;  1S5B D;  3S16 H;  2WB1 B;  3PIO 3;  2E74 C;  2QW7 A;  4LF5 Q;  4A3K G;  3GTG H;  3L0O A;  3TEH B;  5IGE A;  3OW7 A;  3UDF A;  2F0U A;  1QOH A;  1QUQ A;  1EZ8 A;  5HY6 A;  2I5L X;  3N6R A;  2EOT A;  4JI8 Q;  1FGU A;  3W5O A;  5EPK A;  5ELB A;  2R93 G;  5ELO A;  3H09 A;  1FR3 A;  1H9S B;  4LUV A;  5FO7 B;  3GTQ B;  4HED A;  1HZ9 A;  3W1G A;  5IWA Q;  1HZC A;  2WII B;  3M85 A;  4C3I G;  2UUA L;  3GTM H;  1HCZ A;  4GKJ Q;  4LF7 Q;  3QJY A;  1X3Q A;  3J7A 5;  3GQB A;  2UUB Q;  2XIW A;  3D6C A;  2R3Z A;  4HCE A;  2UXD Q;  2J0T D;  2NWG A;  2L1B A;  3HOW G;  4JI7 Q;  3TZD A;  2PCF B;  2VUM H;  2PQA B;  1N36 Q;  1K8M A;  4R4T A;  3HOX G;  1I94 Q;  3OYY A;  4KI0 A;  4J8Q A;  3RZD B;  3E5S A;  4V0B A;  3STB D;  3CC4 A;  4DXF A;  3CXC A;  2D0O A;  3GP7 A;  1U4P A;  3LWE A;  1KRT A;  1G2S A;  4O1N A;  4CJ0 B;  1Q1E A;  5DNF A;  2VXW A;  4YWM A;  2Z9H A;  4Y7N B;  5GQO A;  1PYW D;  1IBL Q;  4R8N A;  1Y14 B;  1C4Q A;  4ULL A;  3CCR A;  5IP7 H;  3LNN A;  2B2V C;  1Q86 C;  4A3I B;  3A55 A;  2NVT B;  1ZKO A;  4G57 A;  4PQX A;  2EYP A;  2HUG A;  1XMQ Q;  2JA7 H;  5JPN C;  2A68 C;  4TRD A;  2I07 B;  2DNE A;  2B2V A;  1CSQ A;  3D31 A;  3JAM i;  4A3M B;  1JIC A;  1STG A;  5CBA E;  3GTP B;  2F0J A;  3BU2 A;  4ILW A;  5EBD A;  4DAM A;  4C3H B;  2C5C A;  1XMO L;  3VA7 A;  4B3S L;  1DJR D;  4L63 B;  3GTO B;  2Z4H A;  2Q2I A;  3A0J A;  1N9W A;  3EIV A;  4FDB A;  4NDX A;  4XT3 B;  4IFD G;  1HA6 A;  3M3Y H;  2MQH A;  2L11 A;  2CQA A;  2Q2H A;  5COR A;  2ICE C;  3PO2 G;  2RA4 A;  1LT6 D;  5FLX L;  4DV5 L;  2R7Z G;  3RUZ A;  3BDC A;  4C56 C;  1LYL A;  3LX0 A;  3H6M A;  3ND8 A;  4DNI A;  1MIU A;  2YTV A;  3S1M B;  1EQV A;  2JA6 G;  1F2Z A;  2K1B A;  3HOU B;  4LUO A;  4B3T L;  3S17 B;  2KEN A;  2QDL A;  1PH8 A;  2ZXO A;  3NPP A;  4V19 0;  3M9B A;  2BCO A;  1U4M A;  1TWF B;  2F1M A;  2Z1C A;  4WRD A;  3HGB A;  2E5L Q;  3VR5 A;  1AH9 A;  1T5X D;  1XX8 A;  1ET9 A;  3DEO A;  4ID6 A;  1PTO D;  3UE1 A;  4X62 L;  3GTJ B;  4IUR A;  4ALP A;  3F2C A;  3KOJ A;  2PMZ B;  3G6E A;  1NMF A;  1QVF A;  3FMC A;  3JAM E;  1CFM A;  4PMW A;  1ASY A;  1B50 A;  1G6Z A;  2R6G A;  5C4X G;  1C48 A;  1F2L A;  5IGB A;  4RG1 A;  1VQI A;  2EJM A;  1PRT B;  1GXD C;  2WB1 E;  4KHV A;  4A3G B;  4Y52 H;  4G7H C;  4J1M A;  2IWH A;  3PQI A;  1N8R C;  2F52 A;  4FF2 A;  1E1T A;  4XT1 B;  2VB3 X;  5BR8 Q;  3HOZ G;  4DUY Q;  3QR8 A;  3T51 B;  3NQI A;  5CMD A;  4PZ8 A;  5C3E B;  1EQR A;  2UXC L;  3K7U C;  3F8T A;  2WAQ G;  3GTQ H;  1O7L A;  1G6P A;  4RMF A;  2K50 A;  3PUZ A;  4A3C H;  2F0E A;  3W2D A;  3C1F A;  1HJP A;  2A6E C;  2ICI A;  4A3E B;  4FNF A;  2CFM A;  4OL7 A;  4DV1 Q;  1TY2 A;  3EQL C;  3HOY G;  1H9S A;  4DR2 L;  4RFB A;  1HZB A;  4KLK A;  3VR4 A;  4AH6 A;  2RHS B;  3DM3 A;  3I90 A;  2F0V A;  3RZD H;  2XN9 C;  4JG2 A;  5GAD C;  3CCV A;  3UDX A;  1KLG D;  5I9O A;  4PMC A;  3KBX A;  4A3F B;  2EYO A;  4Y7N H;  4YWL A;  3MXN B;  3O13 A;  1SDF A;  1I3Q B;  1A63 A;  3MHB A;  3S1Q H;  1STA A;  1XJV A;  2I46 A;  2RDH A;  2R61 A;  3EA6 A;  4JI1 Q;  1WTV A;  4FF3 A;  2EZV A;  4DK1 A;  3DHQ A;  2UXB Q;  2PQA A;  2EYF A;  1A62 A;  1TS5 A;  1VMP A;  4A3I H;  2NVT H;  1BOS A;  2XNA C;  4C1N K;  3OSO A;  1FL0 A;  1TWC B;  3I56 A;  4RGO S;  1O7Z A;  2WV6 D;  4KTA A;  2B3G A;  4OO1 I;  3CAM A;  4C3J B;  3GTP H;  1A6X A;  2F0Q A;  3HKZ B;  4NP5 A;  3VYU A;  1SYB A;  2B2U A;  2OQK A;  5M5W B;  1SR3 A;  1JB3 A;  4KKS A;  2DY8 A;  3FPU B;  1ML0 D;  2ID0 A;  4DV3 L;  4EQN A;  1JOO A;  3AU7 A;  3F2D A;  1Q46 A;  4LAA A;  5J1Z A;  4JI3 Q;  1WOC A;  2Q2T A;  4LK1 C;  4R8I A;  1GUO A;  3R2I A;  1IBK L;  4LF9 L;  4K6L A;  1VQN A;  2EVB A;  2UU9 L;  4IJH A;  2NVY H;  3T1H Q;  4F88 A;  4B3S Q;  1PZJ D;  2QCP X;  2LMC B;  3S1M H;  1DOK A;  2EXZ A;  4DN4 M;  1GHJ A;  2B63 G;  2E2I H;  3HOU H;  4ME3 A;  3DMU A;  3OIP A;  3QOL A;  1B8A A;  4IUV A;  5T1I A;  2QEX A;  1JE4 A;  4OX9 L;  2QF7 A;  4ZLT F;  2NUC A;  4IUU A;  1Q3L A;  4DR3 Q;  4JYA L;  3H0G H;  2RCN A;  1TWF H;  5C5L A;  2X69 A;  2Q8T A;  1A0I A;  3MVV A;  1EU4 A;  2XTI A;  4FO2 A;  2OWO A;  3T1Y L;  2NZO A;  5A2Q L;  1V8Q A;  3TN2 A;  3GTJ H;  2N78 A;  1I50 H;  2FFK B;  1G51 A;  2K4K A;  2RBM A;  4XYQ A;  2DUD A;  4KJO A;  5C0X H;  1SXT A;  3D4R A;  4YCU A;  2X6L A;  1X65 A;  2NTT A;  5J22 A;  3Q0A A;  5CV6 A;  5IYC H;  1PV4 A;  2E2H B;  4A3L G;  4FXD A;  2XWJ B;  1LTS D;  4A3G H;  1D5Z C;  4JI6 Q;  4L6T B;  3MFG A;  1FJG Q;  1RF2 D;  2IJ0 A;  1B3Q A;  4IJL A;  3TME A;  4HR7 B;  2TMP A;  2JEB I;  1D1K A;  4OIK A;  5C3E H;  2NN6 G;  1STN A;  1PRT C;  1PA6 A;  1ICW A;  1J5E Q;  3H91 A;  3U9S A;  2DJG C;  1V43 A;  1CZG A;  5IGF A;  1W6K A;  5C4H A;  2NTS A;  3HOW B;  1SMY C;  3J80 i;  4X65 L;  2BDN A;  2MP1 A;  1Q8K A;  1YNN C;  1B4O A;  1GUT A;  4DU9 A;  4A3E H;  1IL2 A;  1SE8 A;  2IHE A;  4AYB B;  3RN5 A;  4DR4 Q;  4NXN Q;  1SE2 A;  2CQO A;  1MJC A;  5IGG A;  5I6Y A;  1QZH A;  2HIX A;  5AJ3 Q;  1IKM A;  2EJG C;  1O7I A;  2M00 A;  3BZK A;  2A69 C;  5EQ0 A;  3IKJ A;  1HR0 W;  5L37 A;  4L5T A;  1CK1 A;  3KLS X;  4HJ5 A;  3S24 A;  2DY7 A;  1M90 C;  1SFO B;  4X3K A;  2IL8 A;  1IYJ B;  4PG3 A;  3I3C A;  3RLO A;  5M9O A;  2F3V A;  3KLS A;  1SMX A;  3K5L A;  1WCM H;  4K5W A;  3T13 A;  4A3F H;  2NVX H;  4DK0 A;  1CSP A;  2ZTD A;  5C5M A;  1I3Q H;  4MZ9 A;  4U68 A;  2NVQ B;  4CHT B;  3CME A;  1KDC A;  3R8B A;  2WP8 J;  2PW7 A;  2VB2 X;  5BN4 A;  4YHH Q;  1SYG A;  5EAY A;  1TWC H;  2PZU A;  1KDA A;  1OTC A;  5IWA L;  5J39 A;  3GV6 A;  1NUC A;  2RF4 A;  4GKJ L;  4LF7 L;  2NYZ D;  3Q24 A;  2IPK D;  4C3J H;  3MXN A;  4YWK A;  3H0G G;  4LNQ A;  2UUB L;  3TP6 A;  5M5W H;  3J81 L;  1FNW A;  3J80 E;  1LAB A;  4GS3 A;  4JI2 Q;  1XNR Q;  1EUJ A;  4H13 C;  3HKZ E;  3K5O A;  4JI7 L;  2BE5 D;  2J7Z A;  5M5X B;  3GDE A;  4WJW A;  4RH6 A;  1Y1W B;  2JA6 B;  1N36 L;  1I94 L;  2A6H D;  2GA4 B;  4QL5 A;  3S14 H;  2OT2 A;  4R4C A;  4EGV A;  1WTP A;  4BY7 B;  2KCC A;  2L9H A;  5C0X G;  1VQM A;  1B44 D;  1S5F D;  2ZTE A;  3AB9 A;  3J81 j;  1QJO A;  2VW9 A;  1EY6 A;  2ALY B;  1NNX A;  2HQL A;  2AWN A;  1HZA A;  1CTM A;  4OEM B;  3CCJ A;  2K5N A;  1IBL L;  2K5D A;  4QUC A;  4MIU A;  1LTI D;  2Z4I A;  5FLM G;  5M5Y H;  4N8F A;  1IBK Q;  1I4Q A;  2RSO A;  2EYH A;  1Y1V G;  5CV4 A;  5LMN W;  3KJO A;  4YY3 Q;  3K81 C;  1W6J A;  1HFN A;  1P16 A;  1R4Q B;  3SR1 A;  3DM1 A;  3ULL A;  1YNX A;  1QVG A;  3RR5 A;  1NMG A;  4KHP Q;  2KHJ A;  3K80 C;  2AKW B;  2KCT A;  3K59 A;  3MFY A;  2CVR A;  2B2T C;  2JJQ A;  4TKO B;  4BY1 G;  2ENB A;  3WWV A;  1Q81 C;  1F9P A;  4CGY B;  3QO2 A;  3K5M A;  2B2T A;  3NEM A;  4F7X A;  3PO3 B;  4B3R Q;  4HJ9 A;  3I4L A;  3JAM L;  4Z9C B;  3URY A;  4P71 A;  2E2H H;  3STB C;  2F0I A;  1CKM A;  3QB3 A;  2WAQ B;  3I8Z A;  4A3J G;  3MXP A;  1QIL A;  4X3S A;  4K5X A;  3NE5 B;  4EQO A;  1ILQ A;  1WTO A;  4FVM A;  2B8F A;  2PNR C;  1VQL A;  1QE6 A;  3HFZ B;  1WCM G;  1QG7 A;  1ILP A;  1I5F A;  4JVZ A;  1YVC A;  4XYO A;  3EFX D;  4QY7 A;  2O4X A;  5BN3 A;  5HGT A;  2Q8I B;  5FJ8 G;  1PH6 A;  1CHQ D;  1L2F A;  1SNQ A;  5KND A;  1ET6 A;  1PFN A;  3GV3 A;  2EIF A; 
#chains in the Genus database with same CATH homology
 1SYF A;  2IX0 A;  1SNP A;  4TQU S;  3OIQ A;  2KEC A;  2Q8R E;  4A93 B;  4K2K A;  3T56 B;  4RKL A;  2D62 A;  3VYS A;  1X32 A;  3HG9 A;  2N88 A;  1BQQ T;  4K6D A;  5CR3 A;  3C1E A;  4KY6 A;  5IOC A;  2JA8 B;  5ELF A;  4DNT B;  4L8J A;  1SNM A;  1LTA D;  1PDQ A;  3WOE A;  1CZW A;  4J6H A;  4KMU C;  3KBG A;  4A3B B;  3KUP A;  4OHJ A;  3M7G A;  2F0H A;  1PTO H;  3VR3 A;  3SVM A;  1K8O A;  4A3D B;  1MSG A;  2YYZ A;  1TU2 B;  1RTN A;  3RZO B;  3C2P A;  2F0N A;  4OO1 H;  1EYA A;  1FNV A;  1Q12 A;  5JJZ A;  1PTO C;  2JYO A;  3FEW X;  1CM9 A;  1DD2 A;  1S4Z A;  5AFW A;  4BWG B;  3I73 A;  4ODG A;  3SK4 A;  3VR2 A;  1OXU A;  2L4N A;  1Z7T A;  5E4X A;  1AZQ A;  2OEO A;  3SK5 A;  4UAI A;  4ZYS A;  2D9U A;  2MJ8 A;  4IFD J;  1FGB D;  4HAE A;  3SHL A;  5CGK A;  2YU9 B;  5JEA H;  2LS0 1;  1HRJ A;  4U67 3;  1DYQ A;  1F2M A;  2SOB A;  2E76 C;  1QB5 D;  1LV9 A;  3FKI B;  1HUM A;  2AWO A;  1ONL A;  5JVH 3;  3RLF A;  2PO4 A;  2KED A;  1EYC A;  2L0C A;  2KA7 A;  2WIN B;  1NSN S;  2MGS A;  2F0S A;  3T4A C;  3KLR A;  3OWE B;  3GTK B;  3K6O A;  4IUT A;  3I4M B;  2RKS A;  1BBX C;  3Q6S A;  3OMC A;  1GOZ A;  5M3F B;  2QEJ C;  3E0J A;  1BXT A;  1BR9 A;  4QIW B;  4RWS C;  1L0Y B;  3TP7 A;  1TT2 A;  5D3D A;  1A3T A;  3NWS A;  1MSH A;  3QOJ A;  4QF4 A;  4WOR A;  4OGQ C;  2RDF A;  3J7A F;  5CV9 A;  5K36 H;  3NUC A;  1CA5 A;  1KAB A;  5I2X A;  4JBW A;  1RDP D;  2KQ3 A;  1QCB D;  2CHB D;  3K7A B;  1OO9 B;  1VDZ A;  1SJH D;  3SXH A;  5IOD A;  4ME5 A;  2WKC A;  1J8I A;  5ELD A;  3DWA A;  3I4N B;  2BDO A;  1TWH B;  1O78 A;  1JOK A;  1TS3 A;  1V1P B;  2D2C C;  5JEA G;  1Y8O B;  3ERO A;  2L55 A;  3ITP A;  1X3P A;  3P75 A;  2L5T A;  3L7Z C;  5G3L D;  1QWY A;  3SEB A;  1G91 A;  2J4X A;  5C3X A;  3J80 L;  1AN8 A;  2RVL A;  4DA2 A;  4YIJ A;  4K8J A;  1PMR A;  1LTB D;  1MD2 D;  1DON A;  1DXM A;  1G8Z D;  3TSS A;  1SE3 A;  1WTX A;  1G29 1;  1VF5 C;  4KN4 C;  1B9N A;  1JR0 D;  4I65 A;  1FD7 D;  4BY1 B;  2AUK A;  1A2U A;  4CBV A;  1EIH A;  5FK9 C;  3OPO A;  4WFN 3;  5HUR A;  1HQM C;  4IQZ A;  4NMZ A;  3Q23 A;  1LTG D;  1D5X C;  1EL0 A;  3SDZ A;  5K36 G;  3DEP A;  5KRU A;  1J9O A;  5I2Y A;  1AEX A;  4PMB A;  3DUZ A;  3BDO A;  4IFD I;  1ESR A;  2B2U C;  3BVZ A;  4RKB A;  5IIF A;  4RHS A;  3IAY A;  2QDB A;  4C2M B;  2K05 A;  3AMU A;  5DAU A;  1Y8P B;  1UUP A;  3I91 A;  4RCN A;  4S3S A;  1RKN A;  4QB4 A;  1EWH A;  3S2H B;  1OXT A;  1GUN A;  1II3 A;  3BDL A;  4BA1 I;  4Q0F A;  2F0G A;  5LHY 1;  1LT5 D;  5EGT A;  2DN8 A;  1WTQ A;  3MZ5 A;  1CI3 M;  1QNK A;  3J7A V;  1PXU A;  3A8J E;  3HOV B;  5C4Z A;  2KEE A;  1F9S A;  4RGM A;  1ZXT A;  5CV7 A;  2BE5 C;  4KKU A;  2HCI A;  3M4O B;  3OHX C;  1T5E A;  5COY A;  2A6H C;  4KN7 C;  1BCP D;  4FF1 A;  1JCK B;  4UDU C;  4A3K B;  4KD4 A;  1JC7 A;  2EYJ A;  3A7A B;  2K5Q A;  3VYT A;  4PNY A;  1TKW B;  3K5N A;  1U4R A;  3S1R B;  3N52 A;  2EY1 A;  4DXG A;  3NQT A;  4G7O C;  1M4V A;  1Q8I A;  1UNS A;  2R93 B;  4NKL A;  3NP8 A;  5NUC A;  4F8M A;  1OXS C;  3I72 A;  3LWU A;  4C3I B;  4K8I A;  2E2J B;  4RGT A;  3DWP A;  4GZY C;  3CU7 A;  1V1P A;  3HZX A;  4M1U B;  2F0F A;  2F0D A;  1KDB A;  3M4Y A;  1VF7 A;  3TBI B;  1IHZ A;  1STY A;  3HOX B;  3SK6 A;  4X3U A;  2FJ2 A;  1ZEQ X;  3K0Y A;  1RD9 D;  5C0X J;  5IT9 E;  3L3O C;  4O42 A;  1RTO A;  2FMC A;  4ZQ3 A;  1F9R A;  5JPM C;  1E2Z A;  5LL6 X;  1Y69 U;  2PPB C;  5M3M B;  3J7Y W;  4FP5 D;  5A35 A;  3RD4 A;  3NHH A;  1LT4 D;  1PTO F;  5C4J B;  3PUV A;  1MI2 A;  4CJ2 C;  4RAU C;  1ESF A;  1D1I A;  5IGD A;  4B9W A;  1SJE D;  3FDT A;  1IW7 D;  2CW0 D;  2EJF C;  4ZUJ A;  3PO2 B;  2R7Z B;  1EIG A;  2A73 B;  2B2Y C;  1RHP A;  2KUM A;  1B3A A;  1U4L A;  4NW2 A;  3C46 A;  2B2Y A;  4CKC A;  2K01 A;  5T1G A;  3A8I E;  1JOR A;  1SYC A;  3R2T A;  2IT1 A;  4KJN A;  4RHR A;  1D2B A;  2XRQ D;  2JXM B;  1STE A;  2DNC A;  4IUN A;  1B1Z A;  3EJI A;  4K2L A;  4EVO A;  1LLR D;  2HQE A;  5C4X B;  5KEE A;  1Z6H A;  3EVQ A;  3MEH A;  2B39 A;  1NCV A;  3F2U A;  3S2D B;  3K57 A;  2EY6 A;  1LTR D;  2AQ1 B;  4XIG S;  1H9K A;  1L0X B;  3HOZ B;  2NN6 I;  4MHE A;  4KD3 A;  1KLU D;  2SNM A;  1XXG A;  3A8K E;  1M8A A;  1SEB D;  2B8G A;  5DEH A;  3HRZ C;  3K58 A;  3E6Z X;  4B9X A;  3CQZ B;  2K5W A;  1U9R A;  1ZYR D;  3HOY B;  1EWC A;  1AP0 A;  2K28 A;  1STH A;  2MHV A;  2D5D A;  4ZKB B;  4C3J G;  3G7L A;  3VA5 A;  2ZXP A;  3ND9 A;  3G6J B;  4ZRZ A;  1KAA A;  2K32 A;  3MWY W;  2EY5 A;  4JK1 C;  4FYD A;  1LO5 D;  3WDN A;  2K04 A;  2F0P A;  1IYV A;  4HSV A;  3KK7 A;  1EY9 A;  2M2L A;  5FO8 B;  1HTL D;  4QMG A;  1BCP B;  1EZ6 A;  2V4D A;  2E2D C;  3ERQ A;  4KY5 A;  4XTC S;  3NBH A;  4KV6 A;  1LTT D;  1F77 A;  4ZAI A;  2QKI C;  2K03 A;  3S15 B;  1RJT A;  3P7J A;  4IFD H;  2ZXR A;  1I4P A;  2KHS A;  1NR4 A;  2H1E A;  5C0X I;  3A7L A;  1Z47 A;  3HEJ A;  3D4D A;  3S9W A;  1PZI D;  2F0W A;  5TSS A;  1TS2 A;  2XSC A;  2B63 B;  4RA8 A;  3QWN A;  3A56 A;  2RQX A;  4LJZ C;  1PFM A;  3BYT B;  1MBY A;  4DFA A;  3H94 A;  1OXV A;  4FXK C;  1K83 B;  1I4R A;  1WTR A;  1EU3 A;  2X6G A;  3D6W A;  1NR2 A;  3ONA B;  3NWT A;  4HMI A;  3NBI A;  4PV1 C;  2PYK A;  5BN5 A;  2AQ3 B;  1QNU A;  2RDG A;  2E75 C;  5KGU A;  1MGS A;  4G4K A;  5KNC A;  4H7B A;  2M9V A;  3IFD A;  3PUW A;  3CRL C;  3CHB D;  5FOB B;  3X3N A;  1A3V A;  4CKB A;  3NTI A;  2O2L D;  5CBE E;  3S1Q B;  1GUG A;  5CC4 A;  1EOT A;  5F2D A;  3X3M A;  2ZT9 C;  1TVX A;  2F0O A;  3TP8 A;  4I7Z C;  3MTS A;  5JEA J;  3J81 E;  2XRS D;  3R3O A;  2IX3 A;  1OXX K;  4RCO A;  1JOQ A;  1I6V C;  3FRP B;  1H9M A;  4TSS A;  1YNJ D;  3PUY A;  1CA6 A;  2NBF A;  2G9D A;  1KNA A;  5EJW A;  1B9M A;  1EEI D;  4OO1 G;  5CYU A;  2N55 A;  3D4W A;  1JQY D;  3V2T A;  1HUN A;  3CKI B;  1A2T A;  2IW3 A;  2HCC A;  3OOC A;  2NVY B;  1XYI A;  5FO9 B;  3FVQ A;  1TS4 A;  2B2W C;  5IT9 L;  3NXW A;  2E2I B;  1BO0 A;  2KCN A;  4QCL A;  3TDQ A;  1Q1B A;  2B2W A;  4G7Z C;  5KYI A;  3TP5 A;  1SSO A;  1EY5 A;  2EPB A;  1VMC A;  3D8G A;  3H0G B;  4E6I A;  4B08 A;  3R93 A;  2F0L A;  4HCS A;  3NTH A;  3H3V C;  1PRT F;  1PZK D;  2F03 A;  1I50 B;  4CKE A;  1O80 A;  1O7Y A;  4XDX A;  2XVS A;  4BS9 A;  1BCP C;  3BS1 A;  3NK9 A;  4HTH A;  1SNO A;  5LL6 S;  4ZK9 B;  2BOS A;  1DZ1 A;  2BA0 A;  3NSW A;  2A5H A;  1EYD A;  1I6H B;  2FMM A;  2KJX A;  1AZP A;  3M7N A;  4C1N I;  1BNZ A;  4N9P A;  2K7V A;  3BG3 A;  2AQ2 B;  2JSO A;  1Y1V B;  1ENF A;  1B53 A;  2PW5 A;  1NAP A;  2HDL A;  2SEB D;  4KHZ A;  1IYU A;  3U9O A;  1ROD A;  1RCV D;  4IUQ A;  4RGN A;  4XXE A;  1I4X A;  2MPM A;  1DM0 B;  2EYM A;  2Z8L A;  4CJ1 B;  5E1F A;  1SND A;  2A68 D;  1JWS D;  1DOL A;  2SNS A;  5KYL A;  1HFG A;  5EPJ A;  4A3J B;  2EYL A;  4LMQ D;  5EPL A;  1TII D;  1CT1 D;  3L9A X;  1WCM B;  2XWB B;  1R9T B;  3A54 A;  2NN6 H;  2NVX B;  4DGZ A;  1ENA A;  3MA2 B;  3S1N B;  1TR5 A;  1B2T A;  3MXU A;  4XQQ A;  2EE1 A;  3DXJ C;  5K5P A;  2K33 A;  1JWM D;  4DAP A;  1FNU A;  3VR6 A;  2PQE A;  1E2W A;  1VCI A;  1WVL A;  1HPC A;  2AUJ D;  3UI2 A;  3V05 A;  1E2V A;  2JE6 I;  1BF4 A;  1IW7 C;  2CW0 C;  3MXG A;  3SE0 A;  4X3T A;  1GHK A;  3S14 B;  2FIN B;  5I4D A;  4P2C B;  5C44 B;  5D14 A;  2PZW A;  3P20 A;  2HDM A;  1H9R A;  1KTK A;  2WAC A;  4FF4 A;  1LAC A;  4OIJ A;  2O5I C;  3MC0 B;  3OMG A;  2F4I A;  2JA5 B;  5M5Y B;  4M8A A;  1STB A;  2EY2 A;  4N9T A;  2FHT A;  3PMF A;  2G9H D;  1EQT A;  1SNC A;  1A3U A;  2KVM A;  1FYC A;  4EQP A;  5ELE A;  3IL8 A;  5I6W A;  1XWE A;  1I4H A;  2Y0S B;  1BDO A;  3D3R A;  3PIP 3;  3FPP A;  3I70 A;  3PV0 A;  1CHP D;  2A6E D;  4DAV A;  4IN3 A;  1S5D D;  1Y8N B;  4ZKC B;  1WD0 A;  5C3W A;  1SYE A;  1R4P B;  1IKL A;  1SBB B;  1LT3 D;  2NB0 A;  1EY0 A;  4HSP A;  2F0M A;  1EY7 A;  5FLX E;  3ZYY X;  2BA1 A;  3P1H A;  2JEA I;  1EEF D;  1F2Y A;  1HA5 A;  4C3H G;  1HHV A;  3BVG A;  4BBR B;  1GUS A;  1AW7 A;  2OF1 A;  1ZYR C;  2VNU D;  2F0T A;  1Q90 A;  5EKL A;  5I9P A;  2MUY A;  1SYD A;  3BZD B;  4HN7 A;  3SK8 A;  4XQJ A;  4ABN A;  5ELC A;  1AFP A;  2L12 A;  1I4G A;  1TWG B;  3GTL B;  1BUV T;  3T16 A;  1EY8 A;  4BBS B;  5KIX A;  4H0L C;  3GO5 A;  1WD1 A;  2RSN A;  5D65 A;  3BVM A;  2H4O A;  2SDF A;  1S5C D;  1DOM A;  1HTP A;  2OXP A;  3T53 B;  1GUW A;  3KF8 A;  4IZ8 A;  3VYR A;  3Q22 A;  3NTK A;  2NZ1 D;  2KOL A;  5EBC A;  3S16 B;  1PTO B;  3OWF A;  3GTG B;  4Q5V A;  4KKT A;  5E3F A;  2A74 C;  5KNB A;  1SE4 A;  1EFI D;  4IUP A;  4KY7 A;  5G3L F;  4XQN A;  2F0K A;  3W3A A;  5DM7 3;  5EKI A;  2F3W A;  1EY4 A;  5FKA C;  4FXG C;  5JVG 3;  1UAP A;  4ZUI A;  5JOB A;  3GTM B;  1H9J A;  2LKV A;  1HQR D;  3QG1 A;  3V96 A;  5ISR A;  1CQV A;  2LY7 A;  2VUM B;  5JAV A;  1KNE A;  4DF7 A;  4DNR B;  5C6A A;  1S5E D;  3TZU A;  1GJX A;  1V1O A;  3HP3 A;  5DM6 3;  1PFB A;  1SAP A;  5CV5 A;  4DAY A;  5CV8 A;  1E0B A;  2QIL A;  4BA2 I;  3PUX A;  1PRT D;  5E4W C;  4K5V A;  1PLF A;  1IL8 A;  1D6E C;  4F87 A;  1DCZ A;  1XTC D;  1SMY D;  2PZT A;  5D3I B;  2JA7 B;  3GD7 A;  1YNN D;  1TQO A;  1TWA B;  4K14 A;  3IFT A;  2A69 D;  1A15 A;  3C3L A;  1ENC A;  3M3Y B;  4HMJ A;  1UEA B;  1HXY D;  2LFN A;  3QIA A;  4H44 C;  3RMH A;  2JP1 A;  5EKK A;  1F9Q A;  1C8C A;  1CQF A;  5IGC A;  2R92 B;  1G2T A;  1D5M C;  1WTW A;  2WKD A;  1YNJ C;  4MN3 A;  3BYY B;  3WOF A;  4KK7 A;  2K6A A;  3DWQ A;  1TY0 A;  5A2Q E;  1BCP F;  3CRK C;  2TSS A;  3HS0 C;  3MAQ A;  2O5J C;  2EDG A;  4QUF A;  1JWU D;  4R9W A;  2IX1 A;  2C9O A;  4IAL A;  1S5B D;  2WB1 B;  3PIO 3;  2E74 C;  5IGE A;  3OW7 A;  2F0U A;  1QOH A;  1EZ8 A;  3N6R A;  2EOT A;  5EPK A;  5ELB A;  3H09 A;  1FR3 A;  1H9S B;  5FO7 B;  3GTQ B;  4HED A;  2WII B;  3M85 A;  4C3I G;  1HCZ A;  3QJY A;  1X3Q A;  3GQB A;  2XIW A;  3D6C A;  2R3Z A;  4HCE A;  2J0T D;  2NWG A;  2L1B A;  3TZD A;  2PCF B;  1K8M A;  4KI0 A;  4J8Q A;  3RZD B;  3E5S A;  4V0B A;  4DXF A;  3GP7 A;  1U4P A;  3LWE A;  1G2S A;  4O1N A;  4CJ0 B;  1Q1E A;  5DNF A;  2VXW A;  4Y7N B;  1PYW D;  4R8N A;  4ULL A;  1C4Q A;  3LNN A;  2B2V C;  4A3I B;  3A55 A;  2NVT B;  1ZKO A;  4G57 A;  4PQX A;  2EYP A;  2HUG A;  5JPN C;  2A68 C;  4TRD A;  2I07 B;  2DNE A;  2B2V A;  3D31 A;  4A3M B;  1JIC A;  1STG A;  5CBA E;  3GTP B;  2F0J A;  4ILW A;  5EBD A;  4C3H B;  2C5C A;  3VA7 A;  1DJR D;  4L63 B;  3GTO B;  2Z4H A;  4XT3 B;  4NDX A;  4IFD G;  1HA6 A;  2L11 A;  2CQA A;  5COR A;  2ICE C;  2RA4 A;  1LT6 D;  5FLX L;  3RUZ A;  3BDC A;  4C56 C;  3LX0 A;  3H6M A;  3ND8 A;  3S1M B;  1EQV A;  1F2Z A;  2K1B A;  3HOU B;  3S17 B;  2ZXO A;  3NPP A;  4V19 0;  2BCO A;  1U4M A;  1TWF B;  2F1M A;  2Z1C A;  4WRD A;  3HGB A;  3VR5 A;  1T5X D;  1XX8 A;  1ET9 A;  3DEO A;  4ID6 A;  1PTO D;  3GTJ B;  4IUR A;  2PMZ B;  3FMC A;  3JAM E;  1CFM A;  4PMW A;  1B50 A;  1G6Z A;  2R6G A;  1C48 A;  1F2L A;  5IGB A;  2EJM A;  1PRT B;  1GXD C;  4KHV A;  4A3G B;  4G7H C;  4J1M A;  2IWH A;  4FF2 A;  4XT1 B;  2VB3 X;  3T51 B;  5C3E B;  3NQI A;  5CMD A;  1O7L A;  3PUZ A;  2F0E A;  3W2D A;  3C1F A;  2A6E C;  2ICI A;  4A3E B;  4FNF A;  4OL7 A;  1TY2 A;  3EQL C;  1H9S A;  4RFB A;  3VR4 A;  3I90 A;  2F0V A;  2XN9 C;  1KLG D;  5I9O A;  4PMC A;  3KBX A;  4A3F B;  2EYO A;  3O13 A;  1SDF A;  1I3Q B;  3MHB A;  1STA A;  2I46 A;  2RDH A;  2R61 A;  3EA6 A;  1WTV A;  4FF3 A;  2EZV A;  4DK1 A;  3DHQ A;  2EYF A;  1TS5 A;  1VMP A;  1BOS A;  2XNA C;  4C1N K;  3OSO A;  1TWC B;  4RGO S;  1O7Z A;  2WV6 D;  4KTA A;  4OO1 I;  4C3J B;  1A6X A;  2F0Q A;  3HKZ B;  4NP5 A;  3VYU A;  1SYB A;  2B2U A;  5M5W B;  1JB3 A;  4KKS A;  2DY8 A;  3FPU B;  1ML0 D;  2ID0 A;  4EQN A;  1JOO A;  3AU7 A;  4LAA A;  5J1Z A;  4LK1 C;  4R8I A;  1GUO A;  3R2I A;  4K6L A;  2EVB A;  4F88 A;  1PZJ D;  2QCP X;  2LMC B;  1DOK A;  2EXZ A;  4DN4 M;  1GHJ A;  3DMU A;  3OIP A;  3QOL A;  5T1I A;  4IUV A;  1JE4 A;  2QF7 A;  4ZLT F;  2NUC A;  4IUU A;  1Q3L A;  5C5L A;  2X69 A;  2Q8T A;  3MVV A;  1EU4 A;  4FO2 A;  5A2Q L;  1V8Q A;  3TN2 A;  2FFK B;  2RBM A;  4XYQ A;  4KJO A;  5C0X H;  1SXT A;  3D4R A;  2X6L A;  2NTT A;  5J22 A;  3Q0A A;  5CV6 A;  2E2H B;  4FXD A;  2XWJ B;  1LTS D;  1D5Z C;  4L6T B;  3MFG A;  1RF2 D;  2IJ0 A;  3TME A;  4HR7 B;  2TMP A;  2JEB I;  1D1K A;  4OIK A;  2NN6 G;  1STN A;  1PRT C;  1ICW A;  3H91 A;  3U9S A;  1V43 A;  1CZG A;  5IGF A;  1W6K A;  5C4H A;  2NTS A;  3HOW B;  1SMY C;  2BDN A;  2MP1 A;  1YNN C;  1B4O A;  1GUT A;  4DU9 A;  4AYB B;  1SE2 A;  5IGG A;  5I6Y A;  1IKM A;  2EJG C;  2M00 A;  2A69 C;  5EQ0 A;  3IKJ A;  1CK1 A;  3KLS X;  2DY7 A;  1SFO B;  4X3K A;  2IL8 A;  3I3C A;  5M9O A;  2F3V A;  3KLS A;  3K5L A;  4K5W A;  3T13 A;  4DK0 A;  5C5M A;  4U68 A;  2NVQ B;  4CHT B;  1KDC A;  3R8B A;  2WP8 J;  2PW7 A;  2VB2 X;  5BN4 A;  1SYG A;  2PZU A;  1KDA A;  5J39 A;  3GV6 A;  1NUC A;  2NYZ D;  3Q24 A;  2IPK D;  3MXN A;  3TP6 A;  3J81 L;  1FNW A;  3J80 E;  1LAB A;  4H13 C;  3K5O A;  2BE5 D;  2J7Z A;  5M5X B;  4WJW A;  4RH6 A;  1Y1W B;  2JA6 B;  2A6H D;  2GA4 B;  2OT2 A;  4EGV A;  1WTP A;  4BY7 B;  2KCC A;  2L9H A;  5C0X G;  1B44 D;  1S5F D;  3AB9 A;  1QJO A;  1EY6 A;  2AWN A;  1CTM A;  2K5D A;  4QUC A;  4MIU A;  1LTI D;  2Z4I A;  1I4Q A;  2RSO A;  2EYH A;  5CV4 A;  1W6J A;  1HFN A;  1R4Q B;  3SR1 A;  3DM1 A;  3K59 A;  3MFY A;  2CVR A;  2B2T C;  4TKO B;  2ENB A;  1F9P A;  4CGY B;  3QO2 A;  3K5M A;  2B2T A;  4F7X A;  3PO3 B;  3I4L A;  3JAM L;  4Z9C B;  3URY A;  2F0I A;  3QB3 A;  2WAQ B;  3I8Z A;  3MXP A;  1QIL A;  4X3S A;  4K5X A;  3NE5 B;  4EQO A;  1ILQ A;  1WTO A;  4FVM A;  2B8F A;  2PNR C;  1QE6 A;  1QG7 A;  1ILP A;  4XYO A;  3EFX D;  5HGT A;  2O4X A;  5BN3 A;  2Q8I B;  1CHQ D;  1SNQ A;  5KND A;  1ET6 A;  1PFN A;  3GV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...