2HCCA

Solution structure of the human chemokine hcc-2, nmr, 30 structures
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
66
structure length
66
Chain Sequence
HFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the human CC chemokine 2: A monomeric representative of the CC chemokine subtype.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chemokine
molecule keywords HUMAN CHEMOKINE HCC-2
total genus 6
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 1998-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2hccA00
4RAUC 1X3QA 1X3PA 5D65A 1JE4A 1KNEA 4NW2A 1WTVA 5CMDA 3HP3A 1X32A 4X3SA 3FPUB 4CJ2C 1WVLA 1F9PA 3F2UA 2FINB 1BF4A 5EKIA 4ZLTF 1AP0A 2N55A 2MPMA 1AZQA 4OIJA 4RWSC 5AFWA 3KUPA 1BNZA 4R8IA 1G2TA 2MJ8A 2NZ1D 2B2UC 5EPJA 1WTRA 1DOMA 2B2VC 5CBAE 2D9UA 2FMMA 1ILPA 5T1GA 1O7YA 4DN4M 1NR2A 1NCVA 2FHTA 2L12A 1IKMA 2BDNA 1G6ZA 1B4OA 1IKLA 4HCSA 5EQ0A 4QUFA 2B2YC 2EE1A 4R9WA 1PFBA 4MHEA 1B3AA 2K04A 4QUCA 1WTOA 1MSGA 1WD0A 1WTQA 2J7ZA 5COYA 4IUVA 3I90A 4OIKA 1EIGA 2KUMA 3TN2A 2X69A 5CORA 1B53A 2K05A 1RODA 2FJ2A 2K28A 4IUPA 1HHVA 1RTNA 1WTXA 1M8AA 2H1EA 3P7JA 1TVXA 1BBXC 2NWGA 1ZXTA 4IURA 1U4PA 5E4WC 1F9SA 2M2LA 2CVRA 2XIWA 1HRJA 1U4RA 1HFNA 2K03A 1JICA 2KOLA 2X6LA 2RA4A 2RSNA 4HSVA 5DNFA 1DOKA 1HUMA 2K01A 4HAEA 4O42A 4X3TA 4XT3B 2L9HA 5T1IA 3IFDA 4ZK9B 1AZPA 1CA5A 1HA6A 1LV9A 1G91A 2RVLA 1IL8A 3QO2A 3GV3A 1MI2A 2B2TA 1HFGA 2B2WA 2FFKB 1CM9A 2KEDA 3MTSA 1SAPA 3DM1A 4XDXA 5EJWA 4U68A 4UAIA 5D14A 1C8CA 2B2TC 1EIHA 1F2LA 1F9RA 3MWYW 2HCIA 2HDLA 2R3ZA 1GUWA 3ONAB 4IUUA 3LWEA 4CJ0B 1WD1A 2HDMA 2EOTA 2IL8A 1EQTA 2L1BA 4IUTA 2JYOA 2K1BA 2VXWA 1PDQA 4MN3A 2RSOA 1DZ1A 1SDFA 1RHPA 2B2WC 3DEPA 3GV6A 3N52A 1EOTA 1ICWA 2KVMA 5E4XA 1ML0D 3UI2A 1RJTA 1WTWA 1EL0A 1HUNA 3DEOA 1A15A 1J9OA 4LMQD 3R93A 1NR4A 2HCCA 3I8ZA 4IUQA 1O7ZA 1E0BA 1ESRA 2DY7A 3Q6SA 1KNAA 1B2TA 1DONA 3H91A 3FDTA 1VMPA 2HUGA 1QG7A 1PFMA 4X3UA 2Q8TA 4ZKBB 5JJZA 3IL8A 1BO0A 3SVMA 3I3CA 1U4MA 5EPLA 2MP1A 5EPKA 2B2VA 2KECA 2SDFA 4X3KA 3KBXA 2KEEA 3G7LA 1XYIA 1J8IA 5CBEE 1Q3LA 2N88A 4ZAIA 2NYZD 4CJ1B 1PFNA 2L4NA 4ZKCB 1SSOA 1S4ZA 3I91A 2EPBA 3D6WA 1NAPA 4XT1B 1O80A 2MGSA 1XX8A 2L11A 2X6GA 1DOLA 1RTOA 2DY8A 2B2YA 2JP1A 4HEDA 1MGSA 2B2UA 1WTPA 1G2SA 3TZDA 1CA6A 1QNKA 1MSHA 1PLFA 2Q8RE 1B50A 1F9QA 1VMCA 1ILQA 1U4LA 1QE6A 4RA8A
chains in the Genus database with same CATH superfamily
2F52A 1WFQA 1X3PA 4C3JH 4PG3A 1JE4A 4IPCA 1Q46A 4N9PA 4XQJA 1B44D 2JQOA 2JA5B 3IFTA 4IFDJ 4QL5A 4V190 3CCJA 1JWUD 1ENAA 4RWSC 4A3KH 5I2YA 1VQDA 1DOMA 1QVFA 2B2VC 1XNRQ 1LUZA 3VR2A 1VQKA 1D2BA 5I6WA 3A7LA 2F0VA 3N6RA 1LTID 1IKLA 1JR0D 3DXJC 4C3JG 1A8VA 2V4DA 3S17B 1QILA 4PQXA 5IY0A 1YNXA 1UE6A 5JEAG 1KQSA 5CORA 2EYPA 3TP7A 1KC8C 3K57A 2JEBI 1LACA 1BCPC 1M8AA 4NXNL 4YWKA 4A3LH 3HGBA 5GROA 3HOUB 3PUZA 4IN3A 1BUVT 2RHSB 1OXVA 4GLXA 2RA4A 1I4GA 4K2LA 1LT5D 3JC66 2EZVA 4WJ3M 2L9HA 1CQVA 3M3YB 2VUMB 4H13C 2NBFA 2EJFC 3HEJA 1E7ZA 1MHWC 5IT9c 1QCBD 5IGCA 2F4VL 4FXGC 1FD7D 3CPFA 1MIUA 1C8CA 2K5DA 1L1OC 5C4JB 3S1RB 1F77A 4AIMA 3K7AH 5J1ZA 3U4ZA 4B08A 5HURA 2PI2E 1C4QA 4YCUA 3G6EA 2LKVA 3MXNA 3D8GA 1NJIC 4HIMA 2B8GA 1SDFA 4OEMB 1VQ4A 2TMPA 1DD2A 2KVMA 1EFID 4JI6Q 1KD1C 3FKIG 2LY7A 2R93G 4GKJQ 2CCZA 4P2CB 3JAME 1Y1WH 1DONA 4HJ8A 1PH7A 4CKBA 2AMCB 2MUYA 2M00A 4OX9L 2F0UA 2RDHA 4RH6A 4LFBQ 2NVYB 3HOYG 4UHVA 1UNSA 2ICIA 5IT9L 5LMUL 4DF7A 3MA2B 1MGSA 1D5XC 3A56A 4UP8A 2JA7H 5M5WB 3GTLB 2PPBC 4A93H 2V1CC 4F7XA 4LNQA 4JI2Q 4LK1C 4C1NI 1S5BD 4KMUC 3F8TA 3E0JA 1X32A 4FF1A 1EWCA 2OQKA 3L7ZC 4KY6A 4XYOA 1IW7C 3KDFB 1GHKA 4RGNA 1CTMA 1PH9A 3OSOA 2NVYH 1EZ8A 3PF4A 4M1UB 4JC0A 4DNTB 4GOPA 3WOEA 3I55A 4XQQA 2I5MX 1EY6A 3K81C 1B3AA 3S1NB 4GKKL 3S2DH 4B3ML 1EIGA 2KUMA 2A73B 4OWXB 3PIP3 3J7ZC 1GHJA 1SLJA 4K8JA 4L5TA 2EIFA 4IURA 2SNMA 2G9HD 2QA4A 5ELDA 2KHJA 1PH5A 2KBNA 4R4QA 3EIVA 1HFNA 1JICA 1LYLA 4N9TA 3I4NH 4IQZA 4XT3B 1M90C 3G71A 1EEID 3CCSA 1N36Q 2WV6D 4POFA 3IRBA 2F0QA 1RKNA 3BDOA 3CMAA 3PO3H 2B2TC 1HQRD 1F2LA 3MWYW 4DR2L 3ERSX 1PTOH 2F3VA 2E75C 5CV9A 5M3FB 1IBLL 2F0IA 1PZID 4JI8Q 3HOZH 2VXWA 4DFAA 1Q90A 4HR7B 3SR1A 1XJVA 4BY7G 2WAQB 1TWGH 4A3BB 4A3JG 5C5MA 4DR6Q 1ESRA 1Q12A 3HOVB 2QGQA 1PFMA 4JOIA 5EPLA 5IGGA 1XPUA 4R4OA 1R9TB 5FK9C 5C4HA 3M7NA 1ZYRD 4OONA 5BN3A 1JB3A 4ULLA 3V96A 5JEAJ 1FNWA 1XX8A 1OXTA 2X6GA 4DR7L 1DOLA 2K32A 1JE5A 2B2UA 4BY1G 2K14A 1JOQA 5BN5A 2BA1A 1B50A 1QVGA 1ILQA 1VMCA 1E24A 1AH9A 2B8FA 3RLNA 4JVZA 2BE5C 2OEOA 3HG9A 1SBBB 5JVH3 4A3IG 1VQHA 1W6KA 2ZT9C 5LMNL 4FF4A 2KA7A 1I4HA 1F9PA 1ET9A 1BF4A 4APVA 3CC7A 3M4OH 2AUKA 2N55A 2P5ZX 3OHXC 2LFNA 2MPMA 4KKUA 2BDOA 2R61A 2B2UC 1Q7YC 4BBSB 3W1GA 4P72A 4JCVE 4LF8Q 4RHSA 1G6ZA 5TSSA 4DAVA 4WRDA 4A3IH 2R92B 4I65A 4CDDC 2UUCL 1B3QA 3J7AV 3KF6A 2AWNA 4LFAL 5FJ8H 3CU7A 5FOBB 4A3FG 1I3QB 5C4ZA 3NBHA 2N49A 1XWEA 4A3GH 2IT1A 2DGYA 2B63G 1SMYC 3E0EA 2JA9A 4A3IB 2LSSA 3T53B 2GN5A 5IYBH 2RSNA 2RDGA 4JI0L 4G4KA 5C3EB 1HUMA 1TKWB 4GNXB 4MTNA 1L1OB 2F0DA 4ID6A 1CI3M 1JWSD 4EGVA 5K36G 1FYCA 3MXPA 4OO1H 1Y1VH 4UAIA 2ZXOA 1F2ZA 3H94A 2A74C 2HDLA 4G7HC 5IGBA 1A0IA 3LWEA 4CJ0B 2VQEQ 2CWAA 1HR0W 2NN6I 2XSCA 1VQIA 4BXXH 1KXLA 4P71A 3NSWA 5I6YA 2K4KA 1K3BC 3GV6A 2D5DA 5CV6A 4TRDA 5E4XA 1TY0A 4GN3B 3K5LA 1SE3A 4DXGA 1DXMA 1SNQA 1KNAA 1X3GA 3FP9A 2E2JH 1VMPA 1JJ2A 3IL8A 1BO0A 3FMCA 1P16A 4LUVA 1U4MA 3VYUA 2VY3A 1C48A 4UP9A 1JJGA 4LWCA 3AQQA 3K5MA 1V8QA 4C3HH 1UWVA 3J80E 2XVSA 4PNYA 3HOVH 4DV6L 3RZDB 3D4RA 1N34Q 3TP6A 3Q24A 1D5MC 1IBMQ 5KYLA 3E5SA 2KQ3A 3NHHA 4C2MB 5C6AA 4X66Q 1VCIA 2F0OA 1YIJA 4J8QA 4MNOA 4DK1A 2WB1G 4Y7NB 2EYMA 1VS0A 1J6QA 2QEXA 2HIVA 4KI0A 1ASYA 5LMNW 3QWNA 3VYTA 4R8IA 1T5EA 3S17H 1S72A 1FVIA 3U58A 4Z9CB 3KYHC 4YWLA 3AYHB 2WIIB 3AMUA 2FHTA 4JK1C 1TWCB 4HJAA 5FLXc 2F0PA 2EE1A 3SE0A 3HOWB 1XNRL 1KLGD 3I56A 2Z6BA 1B53A 1FNUA 3NK9A 2JE6I 1C9OA 1KRSA 2CQAA 3WDNA 3CRLC 4NPSA 2B63H 1B9NA 4UP7A 1V1PB 4IOCA 2DNEA 2CH4W 3HOZB 1VQ7A 1U9RA 1H9MA 1UAPA 2JA8B 1H95A 1JWMD 5EBCA 4DR2Q 1KABA 3HOZG 3PF5A 5EJWA 4NXML 4EQOA 1JORA 3PO3B 3KF8A 4IUUA 4KK7A 4JBWA 2F0GA 2HDMA 3RZOH 1GJXA 3EN2A 3EQLC 3PO3G 1GUSA 4AQYQ 4DR5Q 1V43A 1FNVA 4IJLA 2DJFC 3K58A 3FRPB 1EOTA 2PCFB 4IUNA 3KLSX 4DV5L 1CKMA 1KRTA 1E2WA 3DHQA 3UE1A 2TSSA 3GTQH 2K5QA 4KHZA 4K6LA 3Q22A 2PQAB 4H44C 2QCPX 1JOOA 4KHVA 2WFWA 1KDBA 4ZCKA 1N36L 3I72A 3I4LA 2L11A 3MXGA 4DV4Q 1RTOA 2DNCA 1G2SA 1EQQA 2H4OA 2VZAA 1CSQA 2IX1A 3TREA 3FPPA 3TQYA 5C0XI 1I6VC 3NQIA 4RA8A 1JC7A 4LF7L 5KNCA 1X3QA 1SE2A 1PZJD 1Q8IA 2BCOA 3TEHB 3K7AB 3TZUA 2F0NA 4DPGA 4X62L 4KHPL 5EBDA 4IFDG 1S5DD 3F2CA 1EY9A 1WOCA 1EY8A 1FJGQ 4Y52H 3W3AA 1G2TA 1WTRA 4CBVA 1PHJA 3RLFA 4A3KG 1A3UA 1TWGB 1SJHD 2A19A 1D1IA 5IGFA 2BDNA 5C0XJ 4HCSA 1FJGL 2BH8A 3GTPB 2YYZA 3BS1A 1Z6HA 1CQFA 2K04A 3AU7A 4J1MA 4KHPQ 3TN2A 1UEBA 2X69A 4A75A 2K05A 3CC4A 4JI2L 2UUBQ 4GNXC 2KJXA 1ZXTA 1ICFB 5E4WC 1YZ6A 4JBKA 5K36H 2OQ0A 3SEBA 3RN2A 1A62A 4DR5L 3GTJB 3BVMA 3M85A 2I5HA 3MEFA 3BDCA 4YCVA 5C5LA 5IYBG 4HSPA 4GN4B 5IP7G 3S9WA 5IYCH 4H0LC 5IYDG 2E74C 2A8VA 3HKSA 1L0YB 4OXPA 2IY5B 1I4XA 5HGTA 3CKIB 3GP7A 2F0FA 1H9SB 2IPKD 4DK3C 2EDGA 3J81i 1NNXA 4DV5Q 2RSOA 2ZM6Q 4X6AH 5EKLA 1EL0A 1X54A 3T1HQ 3PMFA 1D8LA 3DEOA 1HPCA 3R93A 4BBRB 1E22A 5M3MG 2F1MA 4ZUJA 4IALA 5M5YH 3NTKA 1OTCA 3T1YQ 3KBXA 4NXMQ 4KKSA 3KBGA 1I6HH 1Q3LA 4HIKA 2F4VQ 1ET6A 4KLKA 3NUCA 1SSOA 3RR5A 1NAPA 1JOKA 4A3FB 1PA6A 2N3SA 3I4NB 1FGUA 2G5DA 1WTPA 4IPDA 4EVOA 2NTTA 3HOYH 3R2IA 1ESFA 1K0SA 3PUVA 3ICEA 3HOWG 4JYAQ 5L37A 1SR3A 2IWHA 4DK0A 2HQLA 3WWVA 1VQOA 1WTVA 4OGQC 2A1AA 1LTAD 3KLSA 3KJOA 4K5WA 4CJ2C 1EWIA 2H5XA 1VF5C 3QOLA 4HMJA 4MZ9A 1X6OA 2MJ8A 1SRUA 3MXUA 3S15H 5EPJA 2R7ZH 3EVQA 1YEZA 4FP5D 1YNJC 3K80C 3NTHA 1SJED 3VR4A 2RCNA 4A3JH 2OTLA 2F0HA 3J81j 2O5IC 3GTOH 2L5TA 2EJGC 5GAGC 2BE5D 4C56C 2A68C 3G6JB 1AW7A 1HCZA 2B2YC 3VYSA 4ABNA 4MHEA 1STBA 1BXTA 1EU3A 3FEWX 5COYA 3OW2A 1R4PB 2F0WA 3B6YA 2OTJA 3DWQA 3SK8A 1JB7A 4X66L 1I6HB 4DNRB 5CGKA 4K5XA 1IYJB 5M3FG 2Y0SB 5ELNA 3DM3A 1XNQL 4DAMA 2A6HD 4DV3L 3TRZA 1EY5A 4JI7L 2PW5A 3P75A 4KD3A 2PMZE 1QVCA 4BY7B 4JI3L 1TY2A 3J81E 2A5HA 4LJZC 1EYDA 4K14A 2UU9Q 4XYQA 4LFCQ 1L0WA 5GADC 3MXNB 1WCMH 3PQIA 3BYTB 2UUAL 1G51A 2IL8A 4IUTA 2Z9HA 3HKZG 2CQOA 4CDCC 2ASBA 4JG2A 3AB9A 5DM73 1YNJD 2D2CC 1A15A 4A3MG 2WB1E 3CPWA 3I8ZA 4O2DA 1UE5A 1L0XB 3A54A 5C3WA 4K0KQ 5DM63 1XMQQ 2R92H 4LFAQ 2XWBB 3GTGB 1O78A 2C9OA 4EQ5A 2UUAQ 3D3RA 2B63B 3A74A 2NZOA 4ZRZA 5IP9H 2E5LL 3HZXA 2VQFQ 3QG1A 2ZJQA 2UU9L 1L1OA 1STNA 1QNKA 2RHQB 4XQNA 1J5EQ 2Q8RE 4JI4L 3L2PA 1EUJA 2EXZA 4K8IA 1H9JA 5DLQE 3PIPA 1C0AA 3QJYA 3NENA 1GXDC 4DK6C 3A8JE 4NMZA 4FXKC 4L63B 1WVLA 2AUJD 2EQSA 1QWYA 1JCKB 4OL7A 4BBSG 4ZLTF 4DV0L 1AP0A 4XTCS 4V0BA 2UUCQ 1MBYA 4RHRA 4GOPB 3GDEA 3PUYA 2XWJB 1SNCA 1PVOA 2JJQA 1O7YA 3H0GH 1SNDA 2L55A 1SEBD 3S1RH 4YY3Q 5ELFA 1PFBA 3Q0AA 3J80c 2K5WA 1EQRA 4A93G 5I4DA 5IGDA 4F87A 5FKAC 1VQEA 1HQMC 2I46A 1EFWA 4A3DG 1LTLA 2E2HB 3W2DA 4C3HB 5IP7H 4LF5L 5M5XH 2A6HC 1ONLA 4ODGA 1IXRA 2NVXB 5C4XB 1HHVA 4IFDH 3Q8DA 4HN7A 4TQUS 3RNUA 4ZK9B 4JYAL 3OTOL 1IL8A 3R3OA 3HOVG 2UXBQ 2KEDA 4HMIA 4DUZQ 2VUMG 4A3JB 3GTOB 3OMCA 3BVGA 3BZCA 2I5LX 2NTSA 3HOUG 2GA4B 5KEEA 1HJPA 1EQTA 4DR6L 3T1YL 2B2WC 3DEPA 2PZTA 1FR3A 4KV6A 4XIGS 4CGYB 1QJOA 4JI8L 1X3EA 5F2DA 4DR3Q 2PYKA 1PH4A 2JA7B 3DMUA 1ASZA 5HGQA 1YBYA 1IHZA 3HOXB 2EJMA 3I91A 3Q23A 4X64Q 2YU9B 2PI2A 4DV0Q 1BCPD 1IYVA 1SMYD 3M7GA 3H3VC 4CDFC 2LXJA 2B39A 1F9QA 1W3SA 2C35B 3NELA 2WAQE 5CYUA 3KF8B 1JMCA 3H09A 4HTHA 3S2HH 3PO2G 1BCPB 2AQ2B 1LO5D 2VQFL 3EROA 5EKIA 4RMFA 4RCNA 4GKKQ 3D31A 1Y8OB 2WKDA 2QILA 4L5RC 4WJ4A 3C3LA 2RBMA 1Q1BA 4N8FA 1IYUA 3CCVA 1HR0L 5KIXA 3D6CA 4IPGA 2EY5A 4DN4M 4FDBA 3KF6B 2JEAI 3PO2B 1B4OA 3K0YA 4X65L 2D62A 4DAPA 1NMFA 1GUTA 1R9TH 4B3TQ 4DXFA 3OOCA 3I90A 2KCCA 4ILWA 3HKZE 2I07B 3HRZC 4R8NA 4KJOA 4HCEA 4LUOA 3NWTA 1C7YA 3S14H 1P8LA 4J6HA 1GVPA 3M4YA 3HOXG 2F0TA 5IWAQ 4DAYB 4LF9Q 3HOYB 2JA6B 3SDZA 3GTMH 3NE5B 1AN8A 2QKIC 1NE3A 2JA7G 4C1NK 3V05A 4B3SL 4LFCL 4U68A 1HNWL 4JI0Q 1LT3D 3PIOA 2ZJPA 1CFMA 1YVCA 2HCIA 4A3BH 4LFBL 5GAEC 2ID0A 2AQ3B 1UE1A 1X9NA 1EYGA 1DZ1A 2K5NA 4PZ8A 3RN5A 3A7AB 1QOHA 3CW2C 2EY6A 2JXMB 3A55A 2NZHA 2E2JB 1NY4A 1O7ZA 4YHHQ 1A2TA 2Q8TA 1HNZL 4FYDA 4DUYQ 2R7ZB 5C4XG 3S2DB 1GUGA 4X3KA 3S16B 4C3IG 2ZXRA 1XYIA 1K8OA 1HZBA 1QB5D 4H7BA 3JAMi 2NYZD 2CH4A 5CR3A 4K2KA 1EU4A 1NUCA 3DWPA 4PZ6A 2MGSA 3M4PA 1HTLD 3GTJH 5C4JH 2E2IB 2YV5A 3PV0A 5BN4A 3S15B 3PCOB 5M9OA 1Y1VG 3OPOA 1CHPD 4GS3A 3TMEA 3STBC 4C3JB 2VUMH 4A3LG 4DKAC 3VR3A 4JV5Q 4C3HG 4RG1A 2PZWA 1QNUA 1Q82C 1QUQA 4UY8C 2F0KA 2Y0SE 1WTHA 1SMXA 3V2TA 3T51B 5JEAH 1AZQA 1TS2A 3KUPA 4AYBB 5IYDH 1UE7A 3CCUA 2VNUD 1Z47A 1K0RA 2FMMA 5I2XA 3PUWA 4I7ZC 2L12A 4RKLA 1FL0A 4A3FH 2E2HH 3MFGA 4QUFA 4GOPC 2KENA 1STAA 1EYCA 1VQBA 1BQQT 1B8AA 4CKEA 2ZM6L 1KDCA 5JOBA 1T5XD 4F8MA 5E3FA 4JI1L 1VQNA 3J80i 1TVXA 4A76A 1YHQA 2MO0A 1U4RA 4EQNA 3MZ5A 5CC4A 5DNFA 2K01A 5GAHC 2OF1A 3IFDA 1STGA 2F0LA 5NUCA 5FLXL 4UPAA 3MAQA 2ZTCA 4HJ9A 3MTSA 2FFKB 2K5HA 4KJNA 1RF2D 4A3MB 4RGMA 5D14A 1GUWA 1ENFA 3BZKA 3NEMA 1K28A 3F1ZA 1A3TA 3HKZB 3SK6A 5IWAL 1XXGA 1ML0D 2L15A 2OWOA 1XTCD 3L0OA 3CAMA 4MIUA 3H3VI 4A3CG 2O4XA 1X65A 5IIFA 1LABA 1SE8A 3UDIA 5KRUA 2F0MA 4R1JA 3CCRA 1HNXL 3W1BA 1I50H 4A3CH 2KEEA 4BA1I 1G291 1OXUA 1X55A 4FF3A 1KAWA 1S4ZA 3SGIA 4AYBG 4B3SQ 1ZKOA 3HOXH 3KJPA 4KY7A 2J0TD 1HNWQ 2VB2X 5ELBA 1Q86C 5HY6A 1U0LA 4DA2A 1SYCA 4O1NA 3EBEA 3NP8A 5IOCA 5BR8Q 2E8GA 5C3EH 3OW7A 1TS5A 2E76C 1PYSB 2K6AA 1YNND 3UDGA 2RCFA 2Y0SG 2YTXA 3ZYYX 1RD9D 3STBD 5H1SE 4X3SA 2K75A 4JPBW 1PFSA 4DV4L 3AFPA 3KLRA 1LT4D 4P75A 5C0XH 4OIJA 4DV7Q 2ALYB 2OCEA 4PMWA 4QIWB 4AH6A 3K59A 4LUZA 4B3TL 4DV1Q 1NR2A 2JN4A 4JI5L 4XXEA 3OIQA 1K83H 1EZ6A 4PMCA 5EQ0A 1DGSA 1TQOA 3BDLA 2WACA 1N32L 1YJNA 3MHBA 3IKJA 5CV8A 4PV1C 2SNSA 4FO2A 3F2DA 3OWEB 1F2YA 4JBMA 4YIJA 3CD6A 5G3LD 2IW3A 1VQ5A 2OXPA 4QIWE 4LF6L 2Z4IA 4FF2A 4IOAA 3I4MH 5FLMH 3NBHB 5J3BA 4J15A 3EFXD 4A3EG 1PXUA 2QDBA 2RDFA 1W2BA 2HT1A 4O42A 1DYQA 2Q2TA 5M3MB 1WTQA 1CM9A 1B1ZA 3J7AF 5JJLA 1GO3E 4DR7Q 2Q2UA 1EEFD 3J7YW 3O13A 1E3PA 4NXNQ 3GTQB 3M4OB 4HIDA 2L1BA 1TWHB 3NPPA 3ULJA 3C2PA 2F0EA 4A3GG 3I70A 4BBRG 1G8ZD 4LMQD 3EA6A 3K6OA 1LTGD 4R4IA 5IE8A 4X3UA 4ZUIA 2Z6KA 1EYAA 4BA2I 1TWHH 3U50C 5E1FA 1J8IA 2XNAC 1LTTD 3QB3A 2NB0A 3S1QB 1V1OA 5J22A 3LGJA 1II3A 1PH2A 3P20A 4ZKCB 4O0AA 1E1TA 3D6WA 3URYA 1V1QA 3A0JA 3OTOQ 4IPHA 4GNXA 1CKNB 3UDXA 3I4MG 2UXDL 4HEDA 2NVTH 3CQZB 1T9HA 1EIYB 3I2ZA 1NSNS 5KNDA 5KNBA 3CCQA 5M5WH 3X3MA 3GTLH 3OYYA 1F2MA 3M3YH 1K8MA 3C1EA 1N34L 3LX0A 1DM0B 2N78A 1KLUD 3H15A 5DEHA 1SXTA 3CP0A 4A3KB 1D5ZC 3ULLA 2VW9A 2NUCA 1RIPA 5C44H 2A6EC 2RF4A 5AFWA 1CUKA 5DAUA 4G7OC 3BYYB 3CXCA 5C44G 4QF4A 1ILPA 1PYBA 2RKSA 4LW1A 3FKIH 3SHLA 1TXYA 3PIO3 3CCMA 1HNZQ 4BBSH 2IJ0A 2A68D 1XPOA 3MEHA 5C44B 2R7FA 1MSGA 4RGTA 3BJUA 1VDZA 4RGOS 2Q8IB 1RCVD 2XN9C 3TDQA 4IUPA 1I3QH 3RUZA 4L5QA 4BY7H 1WTXA 3CRKC 5FJ8G 4ZYSA 1D1KA 1E1OA 1PMRA 2CVRA 1N8RC 1SYBA 1A63A 1RL2A 2JA5H 3K8AA 4P73A 4B3RL 5FO8B 4LF4Q 1DOKA 2UXCL 5T1IA 3KLWA 3RZDH 1V1PA 4IO9A 2FXQA 2CFMA 2EYLA 4YWMA 2RVLA 1MI2A 2B2TA 4XDXA 4B9XA 1HRJA 3HOUH 2PW7A 5M5XB 4K0KL 3MFYA 1PTOB 4A3DB 4CHTB 2K1BA 1JQYD 4MN3A 1BKBA 5IT9E 1HUNA 5LHY1 1NR4A 3D4WA 4B9WA 1TWAH 1TWFB 3H3VH 1U5KA 1CZWA 3QR8A 1GKHA 1DCZA 3H91A 2NN6H 5KGUA 3SVMA 1BDOA 4A3DH 3OIPA 2LS01 4OELB 2A69C 3I3CA 5M5YB 2VS1A 3S1QH 1HR0Q 3OMGA 3EJIA 4G57A 1HZAA 2KCMA 3S14B 4OO1I 4ZQ3A 2YU9H 3VA7A 1A3VA 2L4NA 1FGBD 2EPBA 5CV5A 1O80A 1AE3A 2ENBA 2K5VA 4A4IA 1EY7A 1KAAA 3TZDA 2JA8G 4NP5A 2Z8LA 1QZGA 1Y8NB 4JI7Q 5C3XA 1S3OA 4DU9A 3S2HB 3E9HA 1I4PA 3T16A 1XNQQ 1SFOH 4OWWB 3TS2A 4KN4C 5CMDA 2MNAA 1S5FD 4GZYC 3F2UA 4BY1H 4X64L 1LTRD 4QCLA 3HS0C 2NZ1D 2WKCA 1B70B 5AJ3Q 2N8NA 5FO9B 2D9UA 4WJWA 5C0XG 5LL6S 2DJGC 2XGTA 2YTVA 4DR3L 1NCVA 3F2BA 5GQOA 4BY1B 2EY1A 1GUNA 2PQAA 2R6GA 2QW7A 3VR6A 2I0QA 3SXHA 1D7QA 2J7ZA 4IUVA 3S1MH 4G7ZC 5LMNQ 2Z1CA 2J4XA 2KCNA 3VYRA 3J81c 4A3EH 4DR1L 3T1HL 1Z7TA 2HHHQ 3DUZA 1SYFA 4YCWA 4JW0A 2M9VA 1EY0A 2HQEA 4HAEA 3BG3A 2Z6KC 3GV3A 5IYCG 1BOSA 4MTKA 1BR9A 1Q81C 2EVBA 3C46A 1EIHA 1SYEA 2MHVA 2FMCA 1PZKD 4OHJA 4QJFA 4LF5Q 2MO1A 5JJIA 4Q0FA 4C2MH 5IP9G 5A2QL 1ICWA 1H9SA 1ENCA 4B3MQ 3KK7A 2ZXPA 4LF6Q 1HZ9A 1OXSC 4IZ8A 2XRSD 4IUQA 1AE2A 4YY3L 1PRTF 2IX3A 3T4AC 3ITPA 5FLMG 2VL6A 3GTPH 2MP1A 2B2VA 5C3EG 4NKLA 2D0PA 1AFPA 2C5CA 1LM0A 1HH2P 4CJ1B 3RD4A 4DV7L 1PFNA 1SE4A 1BVSA 3CCLA 1KTKA 4DV1L 5K5PA 3A8IE 2CWPA 4M8AA 5I9PA 3G4SA 2NVTB 1PLFA 3E6ZX 1GOZA 4ME5A 2R92G 1RDPD 1UEAB 3T56B 1NTGA 1YHBA 1PV4A 3X3NA 2QF7A 2CKZB 4NW2A 2OT2A 3HP3A 4Y7NH 1TWFH 3CF5A 3I4NG 5BR8L 2UUBL 3LNNA 1Y69U 3NQTA 2EYHA 4JI5Q 2XRQD 2AWOA 3PUXA 5CBAE 3KDFA 1TU2B 2IHEA 3NBIA 1Z9FA 2QDLA 4L6TB 4X65Q 1Q8KA 1PRTB 1E2VA 3RZOB 3S1MB 4JI6L 5KYIA 1VQ8A 4R4CA 1SNPA 3TSSA 2R93H 2FJ2A 1A6XA 1CK1A 3R2TA 4LF7Q 1RTNA 1ZYRC 1PYWD 2NWGA 1SNOA 1F9SA 2XIWA 4X62Q 2YTYA 1KHIA 1XPRA 2CHBD 3L3OC 4HSVA 1O7IA 1SYDA 4JI3Q 1CA5A 2R93B 4PMBA 1G91A 4KY5A 4KN7C 5I9OA 4HJ7A 3CHBD 1CSPA 3OWFA 4QMGA 4TVAB 1TR5A 2XTIA 1VQAA 2EYOA 1I4RA 4BS9A 4FVMA 1GUOA 4C3IB 2R7ZG 2B29A 2RQXA 1RHPA 2L0CA 3ER0A 5EGTA 3K5NA 4TKOB 1G6PA 3I73A 1WYDA 4A3BG 4AQYL 1E0BA 3Q6SA 4R4TA 5M3FH 3FDTA 2MQHA 1QG7A 5ELEA 1PRTC 1A2UA 1PRTD 3G48A 2VB3X 2SDFA 2O5JC 1N9WA 1KDAA 5A35A 4F88A 2WP8J 3A5UA 4ZAIA 3S16H 5D3DA 1PTOF 4RKBA 2DY8A 1Y8PB 1I94Q 4QQBX 1N33Q 1VQ6A 4CDEC 1SROA 1NBWA 1YNNC 2HHHL 3BVZA 5C4XH 1QE6A 2LMCB 1GM5A 4ALPA 2JA6G 4RAUC 3VA5A 1UUPA 1KNEA 1GD7A 1KIXA 1N33L 1VQCA 1I94L 1IW7D 4DV2L 1LTBD 1I4QA 1H9RA 4UDUC 1JT8A 3ERQA 1X56A 2A6ED 2NN6G 3FVQA 5ELCA 4L8JA 1B7YB 1H9KA 4KTAA 5T1GA 1V9PA 2AHOB 1VQ9A 5AJ3L 2AKWB 4YHHL 4ME3A 4IJHA 4DNIA 5CV7A 2SOBA 4DUYL 1IL2A 4OIKA 1PTOC 3VR5A 1CKNA 4JV5L 1I5FA 2K28A 3U4VA 1PH3A 3JAMc 1TS4A 2H1EA 3P7JA 4RFBA 1U4PA 1PH8A 5FLXE 4JOIC 5JPNC 1BBUA 1WJJA 2KOLA 2EXDA 4AYBE 3E3XA 1HA6A 1AZPA 2JA8H 1XTDA 3D0FA 4A3GB 2GVBA 3SK4A 1HFGA 2B2WA 3RLOA 2ATWA 3FKIB 4DV6Q 1F9RA 1EWHA 2HIXA 5JVG3 1TWCH 1X3FA 4JBJA 4LF9L 1K83B 5JPMC 1S5CD 4TSSA 4RCOA 2EOTA 1TIID 3K7UC 1DJRD 5CV4A 4B3RQ 5ISRA 1PDQA 1AEXA 3RMHA 1IKMA 3LWUA 3UI2A 2PO4A 3S24A 3TP5A 1TS3A 2HD3A 2KHIA 4KKTA 5JAVA 2DY7A 4H02A 4EQPA 3CC2A 1B2TA 4DGZA 4U673 2HUGA 3NXWA 5JJZA 2MFIA 3DLLA 1HA5A 4NB3A 4GN5A 3G7LA 3VDYA 1I50B 1QZHA 5CBEE 2N88A 2VQEL 1Y1WB 3PGZA 1W6JA 3CQZH 2K7VA 3PSIA 1VF7A 1MJCA 1HZCA 5EKKA 3GTMB 4I7AA 1IZ6A 2WB1B 1U4LA 3U9OA 2PNHA 4DV3Q 2ZTEA 4LF4L 2UXCQ 2SEBD 2PZUA 5D65A 1EIFA 3WOFA 1XMOL 3DWAA 4DR4L 4FXDA 3FPUB 2K50A 4L5SA 2FINB 5J39A 3J7A5 2ES2A 2IHFA 4OO1G 4A93B 4BWGB 1SNMA 1MJEA 4QGUA 1PH6A 2IX0A 2AQ1B 2UXDQ 2EY2A 3M9BA 4LF8L 3GTKH 1WD0A 3I7FA 4QUCA 1WTOA 1JJCB 2JK8A 1EOVA 1IBKQ 2NVQB 2F03A 2LXKA 2QEJC 1PH1A 3I4MB 2JA5G 3IAYA 2BH2A 3C1FA 3W5OA 2M2LA 1BCPF 1STEA 1VQLA 4EX5A 4GLAC 3HFZB 3K5OA 1K73C 4X3TA 4DUZL 2ZJRA 2F0JA 5JJKA 1LV9A 2EYFA 4WFN3 2O2LD 2A69D 1EQVA 3QO2A 5D3IB 2Q2IA 2D0OA 3ND9A 3TS0A 5E7NA 2PQEA 5M3MH 1EY4A 1PTOD 1VQMA 2UXBL 2R3ZA 4A3MH 3H6MA 3H0GG 5G3LF 1LT6D 2CW0D 1SYGA 2BOSA 4DR1Q 1CKOA 2DN8A 4IFDI 3J81L 1K3RA 4NDXA 4P74A 3K0XA 1WTWA 2EYJA 3UDFA 4BBRH 5ELOA 4POGA 2HCCA 3AFQA 3TBIB 1CT1D 1MKHA 3SK5A 1ZEQX 3ND8A 1OO9B 4K6DA 3NTIA 4CKCA 1VQPA 3JAML 2KECA 1B9MA 1STHA 4QB4A 2Z4HA 4A3EB 3NWSA 4DAYA 1M1KC 2K52A 1IBLQ 1S40A 4XT1B 1YI2A 2E2IH 1YHAA 4PZ7A 2JP1A 1VQFA 2WINB 3HOWH 4HJ5A 3M4QA 1MSHA 4WORA 4FNFA 1NMGA 2ZTDA 3FHWA 1M4VA 1SFOB 3QIAA 2KHSA 4DR4Q 1J5EL 4JI4Q 3KOJA 1IBML 4HIOA 1XMOQ 3GQBA 5IGEA 3GO5A 1KL9A 3KFUA 1Y14B 4S3SA 1WCMB 1IBKL 2Z0SA 4C3IH 2E5LQ 5EAYA 2F4IA 1QUQB 4BXXG 1VQJA 1Y1VB 1WCMG 1YJ9A 5FO7B 1N32Q 2KCTA 1STYA 3S1NH 4Q5VA 1LTSD 1MD2D 4R9WA 1SN8A 2NVXH 1HXYD 1R4QB 2DUDA 2NVQH 1E2ZA 1XMQL 4LAAA 1Y1WG 2WAQG 4OX9Q 2BA0A 3I4OA 2GVAA 1RODA 1HTPA 4N8X1 4KD4A 1LLRD 4GKJL 1BBXC 4GLVB 2JA6H 3BU2A 2PMZB 2K03A 2X6LA 2K33A 3GD7A 5LL6X 1K8GA 3E9IA 1BNZA 3ULPA 1OXXK 2B3GA 2E2DC 5LMUQ 1K9MC 4K5VA 1D6EC 1K8AC 1SAPA 3DM1A 3A8KE 3TP8A 2G9DA 3D4DA 1WI5A 1YITA 2F3IA 4OWTB 3ONAB 1HNXQ 1WD1A 2CW0C 3GTKB 1YJWA 1CHQD 2JYOA 1Q1EA 3CMEA 1O7LA 3H0GB 3N52A 2ICEC 3L9AX 2F3WA 1RJTA 2R7DA 4QY7A 3ZJYC 3UE0A 1J9OA 1L2FA 1TT2A 4JI1Q 3MVVA 1TWAB 4ZKBB 3BZDB 3GTGH 2F0SA 5EPKA 3A5ZB 3CCEA 2PNRC 2JSOA 3T13A 3P1HA 5IODA 1VQGA 5A2QE 3PO2H 4DV2Q 1BBWA 1S5ED 2B2YA 3U9SA 3J80L 3AEVA 1CA6A 3MC0B 4E6IA 3QOJA 2Q2HA 1CZGA 3R8BA
chains in the Genus database with same CATH topology
1X3PA 1JE4A 4N9PA 4XQJA 1B44D 2JA5B 3IFTA 4IFDJ 4V190 1JWUD 1ENAA 4RWSC 5I2YA 1DOMA 2B2VC 3VR2A 1D2BA 5I6WA 3A7LA 2F0VA 3N6RA 1LTID 1IKLA 1JR0D 3DXJC 4C3JG 2V4DA 3S17B 1QILA 4PQXA 5JEAG 5CORA 2EYPA 3TP7A 3K57A 2JEBI 1LACA 1BCPC 1M8AA 3HGBA 3HOUB 3PUZA 4IN3A 1BUVT 1OXVA 2RA4A 1I4GA 4K2LA 1LT5D 2EZVA 2L9HA 1CQVA 3M3YB 2VUMB 4H13C 2NBFA 2EJFC 3HEJA 1QCBD 5IGCA 4FXGC 1FD7D 1C8CA 2K5DA 5C4JB 3S1RB 1F77A 5J1ZA 4B08A 5HURA 1C4QA 2LKVA 3MXNA 3D8GA 2B8GA 1SDFA 2TMPA 1DD2A 2KVMA 1EFID 2LY7A 4P2CB 3JAME 1DONA 4CKBA 2MUYA 2M00A 2F0UA 2RDHA 4RH6A 2NVYB 1UNSA 2ICIA 5IT9L 4DF7A 3MA2B 1MGSA 1D5XC 3A56A 5M5WB 3GTLB 2PPBC 4F7XA 4LK1C 4C1NI 1S5BD 4KMUC 3E0JA 1X32A 4FF1A 1EWCA 3L7ZC 4KY6A 4XYOA 1IW7C 1GHKA 4RGNA 1CTMA 3OSOA 1EZ8A 4M1UB 4DNTB 3WOEA 4XQQA 1EY6A 1B3AA 3S1NB 1EIGA 2KUMA 2A73B 3PIP3 1GHJA 4K8JA 4IURA 2SNMA 2G9HD 5ELDA 1HFNA 1JICA 4N9TA 4IQZA 4XT3B 1EEID 2WV6D 2F0QA 1RKNA 3BDOA 2B2TC 1HQRD 1F2LA 3MWYW 1PTOH 2F3VA 2E75C 5CV9A 5M3FB 2F0IA 1PZID 2VXWA 4DFAA 1Q90A 4HR7B 3SR1A 2WAQB 4A3BB 5C5MA 1ESRA 1Q12A 3HOVB 1PFMA 5EPLA 5IGGA 1R9TB 5FK9C 5C4HA 3M7NA 1ZYRD 5BN3A 1JB3A 4ULLA 3V96A 5JEAJ 1FNWA 1XX8A 1OXTA 2X6GA 1DOLA 2K32A 2B2UA 1JOQA 5BN5A 2BA1A 1B50A 1ILQA 1VMCA 2B8FA 2BE5C 2OEOA 3HG9A 5JVH3 1SBBB 1W6KA 2ZT9C 4FF4A 2KA7A 1I4HA 1F9PA 1BF4A 1ET9A 2AUKA 2N55A 3OHXC 2LFNA 2MPMA 4KKUA 2BDOA 2R61A 2B2UC 4BBSB 4RHSA 1G6ZA 5TSSA 4DAVA 4WRDA 2R92B 4I65A 3J7AV 2AWNA 3CU7A 5FOBB 1I3QB 5C4ZA 3NBHA 1XWEA 2IT1A 1SMYC 4A3IB 3T53B 2RSNA 2RDGA 4G4KA 5C3EB 1HUMA 1TKWB 2F0DA 4ID6A 4EGVA 1CI3M 1JWSD 5K36G 1FYCA 3MXPA 4OO1H 4UAIA 2ZXOA 1F2ZA 3H94A 2A74C 2HDLA 4G7HC 5IGBA 3LWEA 4CJ0B 2NN6I 2XSCA 3NSWA 5I6YA 3GV6A 2D5DA 5CV6A 4TRDA 5E4XA 1TY0A 3K5LA 1SE3A 4DXGA 1DXMA 1SNQA 1KNAA 1VMPA 3IL8A 1BO0A 3FMCA 3VYUA 1U4MA 1C48A 3K5MA 1V8QA 3J80E 2XVSA 4PNYA 3RZDB 3D4RA 3TP6A 3Q24A 1D5MC 5KYLA 3E5SA 2KQ3A 3NHHA 4C2MB 5C6AA 1VCIA 2F0OA 4J8QA 4DK1A 4Y7NB 2EYMA 4KI0A 3QWNA 3VYTA 4R8IA 1T5EA 4Z9CB 2WIIB 3AMUA 2FHTA 4JK1C 1TWCB 2F0PA 2EE1A 3SE0A 3HOWB 1KLGD 1B53A 1FNUA 3NK9A 2JE6I 2CQAA 3WDNA 3CRLC 1B9NA 1V1PB 2DNEA 3HOZB 1U9RA 1H9MA 1UAPA 2JA8B 1JWMD 5EBCA 1KABA 5EJWA 4EQOA 1JORA 3PO3B 3KF8A 4IUUA 4KK7A 4JBWA 2F0GA 2HDMA 1GJXA 3EQLC 1GUSA 1V43A 1FNVA 3K58A 3FRPB 1EOTA 2PCFB 4IUNA 3KLSX 1E2WA 3DHQA 2TSSA 2K5QA 4KHZA 4K6LA 3Q22A 4H44C 2QCPX 1JOOA 4KHVA 1KDBA 3I72A 3I4LA 2L11A 3MXGA 1RTOA 2DNCA 1G2SA 2H4OA 2IX1A 3FPPA 5C0XI 1I6VC 3NQIA 4RA8A 1JC7A 5KNCA 1X3QA 1SE2A 1PZJD 1Q8IA 2BCOA 3K7AB 3TZUA 2F0NA 5EBDA 4IFDG 1S5DD 1EY9A 1EY8A 3W3AA 1G2TA 1WTRA 4CBVA 3RLFA 1A3UA 1TWGB 1SJHD 1D1IA 5IGFA 2BDNA 5C0XJ 4HCSA 3GTPB 2YYZA 3BS1A 1Z6HA 1CQFA 2K04A 3AU7A 4J1MA 3TN2A 2X69A 2K05A 2KJXA 1ZXTA 5E4WC 5K36H 3SEBA 3GTJB 3BVMA 3M85A 3BDCA 5C5LA 4HSPA 3S9WA 4H0LC 2E74C 1L0YB 1I4XA 5HGTA 3CKIB 3GP7A 2F0FA 1H9SB 2IPKD 2EDGA 2RSOA 5EKLA 1EL0A 3PMFA 3DEOA 1HPCA 3R93A 4BBRB 2F1MA 4ZUJA 4IALA 3NTKA 3KBXA 4KKSA 3KBGA 1Q3LA 1ET6A 3NUCA 1SSOA 1NAPA 1JOKA 4A3FB 3I4NB 1WTPA 4EVOA 2NTTA 3R2IA 1ESFA 3PUVA 2IWHA 4DK0A 1WTVA 4OGQC 1LTAD 3KLSA 4K5WA 4CJ2C 1VF5C 3QOLA 4HMJA 2MJ8A 3MXUA 5EPJA 3EVQA 4FP5D 1YNJC 3NTHA 1SJED 3VR4A 2O5IC 2F0HA 2L5TA 2EJGC 2BE5D 4C56C 2A68C 3G6JB 1AW7A 1HCZA 2B2YC 3VYSA 4ABNA 4MHEA 1STBA 1BXTA 1EU3A 3FEWX 5COYA 1R4PB 2F0WA 3DWQA 3SK8A 1I6HB 4DNRB 5CGKA 4K5XA 2Y0SB 2A6HD 1EY5A 2PW5A 3P75A 4KD3A 4BY7B 1TY2A 3J81E 2A5HA 4LJZC 1EYDA 4K14A 4XYQA 3BYTB 2IL8A 4IUTA 3AB9A 5DM73 1YNJD 2D2CC 1A15A 3I8ZA 1L0XB 3A54A 5C3WA 5DM63 2XWBB 3GTGB 1O78A 2C9OA 3D3RA 2B63B 4ZRZA 3HZXA 3QG1A 1STNA 1QNKA 4XQNA 2Q8RE 2EXZA 4K8IA 1H9JA 3QJYA 1GXDC 3A8JE 4NMZA 4FXKC 4L63B 1WVLA 2AUJD 1QWYA 1JCKB 4OL7A 4ZLTF 1AP0A 4XTCS 4V0BA 1MBYA 4RHRA 3PUYA 2XWJB 1SNCA 1O7YA 1SNDA 2L55A 1SEBD 5ELFA 1PFBA 3Q0AA 2K5WA 5I4DA 5IGDA 4F87A 5FKAC 1HQMC 2I46A 2E2HB 3W2DA 4C3HB 2A6HC 1ONLA 4ODGA 2NVXB 5C4XB 1HHVA 4IFDH 4TQUS 4HN7A 4ZK9B 1IL8A 3R3OA 2KEDA 4HMIA 4A3JB 3GTOB 3OMCA 3BVGA 2NTSA 2GA4B 5KEEA 1EQTA 2B2WC 3DEPA 2PZTA 1FR3A 4KV6A 4XIGS 4CGYB 1QJOA 5F2DA 2PYKA 2JA7B 3DMUA 1IHZA 3HOXB 2EJMA 3I91A 3Q23A 2YU9B 1BCPD 1IYVA 1SMYD 3M7GA 3H3VC 2B39A 1F9QA 5CYUA 3H09A 4HTHA 1BCPB 2AQ2B 1LO5D 3EROA 5EKIA 4RCNA 3D31A 1Y8OB 2WKDA 2QILA 3C3LA 2RBMA 1Q1BA 1IYUA 5KIXA 3D6CA 2EY5A 4DN4M 2JEAI 3PO2B 1B4OA 3K0YA 2D62A 4DAPA 1GUTA 4DXFA 3OOCA 3I90A 2KCCA 4ILWA 2I07B 3HRZC 4R8NA 4KJOA 4HCEA 3NWTA 4J6HA 3M4YA 2F0TA 3HOYB 2JA6B 3SDZA 3NE5B 1AN8A 2QKIC 4C1NK 3V05A 4U68A 1LT3D 1CFMA 2HCIA 2ID0A 2AQ3B 1DZ1A 3A7AB 1QOHA 2EY6A 2JXMB 3A55A 2E2JB 1O7ZA 1A2TA 2Q8TA 4FYDA 2R7ZB 3S2DB 1GUGA 4X3KA 3S16B 4C3IG 2ZXRA 1XYIA 1K8OA 1QB5D 4H7BA 2NYZD 5CR3A 4K2KA 1EU4A 1NUCA 3DWPA 2MGSA 1HTLD 2E2IB 3PV0A 5BN4A 3S15B 5M9OA 3OPOA 3TMEA 1CHPD 4C3JB 3VR3A 4C3HG 2PZWA 1QNUA 2F0KA 3V2TA 3T51B 5JEAH 1AZQA 1TS2A 3KUPA 4AYBB 2VNUD 1Z47A 2FMMA 5I2XA 3PUWA 4I7ZC 2L12A 4RKLA 3MFGA 4QUFA 1STAA 1EYCA 1BQQT 4CKEA 1KDCA 5JOBA 1T5XD 4F8MA 5E3FA 1TVXA 1U4RA 4EQNA 3MZ5A 5CC4A 5DNFA 2K01A 2OF1A 3IFDA 1STGA 2F0LA 5NUCA 5FLXL 3MAQA 3MTSA 2FFKB 4KJNA 1RF2D 4A3MB 4RGMA 5D14A 1GUWA 1ENFA 1A3TA 3HKZB 3SK6A 1XXGA 1ML0D 1XTCD 4MIUA 2O4XA 5IIFA 1LABA 5KRUA 2F0MA 2KEEA 4BA1I 1G291 1OXUA 4FF3A 1S4ZA 1ZKOA 4KY7A 2J0TD 2VB2X 5ELBA 4DA2A 1SYCA 4O1NA 3NP8A 5IOCA 3OW7A 1TS5A 2E76C 2K6AA 1YNND 3ZYYX 1RD9D 4X3SA 3KLRA 1LT4D 5C0XH 4OIJA 4PMWA 4QIWB 3K59A 1NR2A 4XXEA 3OIQA 1EZ6A 4PMCA 5EQ0A 1TQOA 3BDLA 2WACA 3MHBA 3IKJA 5CV8A 4PV1C 2SNSA 4FO2A 3OWEB 1F2YA 4YIJA 5G3LD 2IW3A 2OXPA 2Z4IA 4FF2A 3EFXD 1PXUA 2QDBA 2RDFA 4O42A 1DYQA 5M3MB 1WTQA 1CM9A 1B1ZA 3J7AF 1EEFD 3J7YW 3O13A 3GTQB 3M4OB 2L1BA 1TWHB 3NPPA 3C2PA 2F0EA 3I70A 1G8ZD 4LMQD 3EA6A 3K6OA 1LTGD 4X3UA 4ZUIA 1EYAA 4BA2I 5E1FA 1J8IA 2XNAC 1LTTD 3QB3A 2NB0A 3S1QB 1V1OA 5J22A 1II3A 3P20A 4ZKCB 3URYA 3D6WA 4HEDA 3CQZB 1NSNS 5KNDA 5KNBA 3X3MA 1F2MA 1K8MA 3C1EA 3LX0A 1DM0B 1KLUD 5DEHA 1SXTA 4A3KB 1D5ZC 2NUCA 2A6EC 5AFWA 5DAUA 4G7OC 3BYYB 4QF4A 1ILPA 2RKSA 3SHLA 3PIO3 2IJ0A 2A68D 3MEHA 5C44B 1MSGA 4RGTA 4RGOS 1VDZA 2Q8IB 1RCVD 2XN9C 3TDQA 4IUPA 3RUZA 1WTXA 3CRKC 4ZYSA 1D1KA 1PMRA 2CVRA 1SYBA 5FO8B 1DOKA 5T1IA 1V1PA 2EYLA 2RVLA 1MI2A 2B2TA 4XDXA 4B9XA 1HRJA 2PW7A 5M5XB 3MFYA 1PTOB 4A3DB 4CHTB 2K1BA 1JQYD 4MN3A 5IT9E 1HUNA 5LHY1 1NR4A 3D4WA 4B9WA 1TWFB 1CZWA 3H91A 1DCZA 3SVMA 2NN6H 5KGUA 1BDOA 3OIPA 2LS01 2A69C 3I3CA 5M5YB 3OMGA 3EJIA 4G57A 3S14B 4OO1I 4ZQ3A 3VA7A 1A3VA 2L4NA 1FGBD 2EPBA 5CV5A 1O80A 2ENBA 1EY7A 1KAAA 3TZDA 4NP5A 2Z8LA 1Y8NB 5C3XA 4DU9A 3S2HB 1I4PA 3T16A 4KN4C 5CMDA 1S5FD 4GZYC 3F2UA 1LTRD 4QCLA 3HS0C 2NZ1D 2WKCA 5FO9B 2D9UA 4WJWA 5C0XG 5LL6S 1NCVA 4BY1B 2EY1A 1GUNA 2R6GA 3VR6A 3SXHA 2J7ZA 4IUVA 4G7ZC 2Z1CA 2J4XA 2KCNA 3VYRA 1Z7TA 3DUZA 1SYFA 2M9VA 1EY0A 2HQEA 4HAEA 3BG3A 3GV3A 1BOSA 1BR9A 2EVBA 3C46A 1EIHA 1SYEA 2MHVA 2FMCA 1PZKD 4OHJA 4Q0FA 5A2QL 1ICWA 1H9SA 1ENCA 2ZXPA 3KK7A 1OXSC 4IZ8A 2XRSD 4IUQA 1PRTF 2IX3A 3T4AC 3ITPA 2MP1A 2B2VA 4NKLA 1AFPA 2C5CA 4CJ1B 3RD4A 1PFNA 1SE4A 1KTKA 5K5PA 3A8IE 4M8AA 5I9PA 2NVTB 1PLFA 3E6ZX 1GOZA 4ME5A 1RDPD 1UEAB 3T56B 3X3NA 2QF7A 4NW2A 2OT2A 3HP3A 3LNNA 1Y69U 3NQTA 2EYHA 2XRQD 2AWOA 3PUXA 5CBAE 1TU2B 3NBIA 4L6TB 1PRTB 1E2VA 3RZOB 3S1MB 5KYIA 1SNPA 3TSSA 2FJ2A 1A6XA 1CK1A 3R2TA 1RTNA 1ZYRC 1PYWD 2NWGA 1SNOA 1F9SA 2XIWA 2CHBD 3L3OC 4HSVA 1SYDA 1CA5A 2R93B 4PMBA 1G91A 4KY5A 4KN7C 5I9OA 3CHBD 3OWFA 4QMGA 1TR5A 2EYOA 1I4RA 4BS9A 4FVMA 1GUOA 4C3IB 2RQXA 1RHPA 2L0CA 5EGTA 3K5NA 4TKOB 3I73A 1E0BA 3Q6SA 3FDTA 1QG7A 5ELEA 1PRTC 1A2UA 1PRTD 2VB3X 2SDFA 2O5JC 1KDAA 5A35A 4F88A 2WP8J 4ZAIA 5D3DA 1PTOF 4RKBA 2DY8A 1Y8PB 1YNNC 3BVZA 1QE6A 2LMCB 4RAUC 3VA5A 1UUPA 1KNEA 1IW7D 1LTBD 1I4QA 1H9RA 4UDUC 3ERQA 2A6ED 2NN6G 3FVQA 5ELCA 4L8JA 1H9KA 4KTAA 5T1GA 5CV7A 2SOBA 4OIKA 1PTOC 3VR5A 2K28A 1TS4A 2H1EA 3P7JA 4RFBA 1U4PA 5FLXE 5JPNC 2KOLA 1HA6A 1AZPA 4A3GB 3SK4A 1HFGA 2B2WA 3FKIB 1F9RA 1EWHA 5JVG3 1K83B 5JPMC 1S5CD 4TSSA 4RCOA 2EOTA 1TIID 1DJRD 5CV4A 5ISRA 1PDQA 1AEXA 3RMHA 1IKMA 3LWUA 3UI2A 2PO4A 3TP5A 1TS3A 4KKTA 5JAVA 2DY7A 4EQPA 1B2TA 4DGZA 4U673 2HUGA 3NXWA 5JJZA 1HA5A 3G7LA 1I50B 5CBEE 2N88A 1Y1WB 1W6JA 2K7VA 1VF7A 5EKKA 3GTMB 2WB1B 1U4LA 3U9OA 2SEBD 2PZUA 5D65A 3WOFA 3DWAA 4FXDA 3FPUB 2FINB 5J39A 4OO1G 4A93B 4BWGB 1SNMA 2IX0A 2AQ1B 2EY2A 1WD0A 4QUCA 1WTOA 2NVQB 2F03A 2QEJC 3I4MB 3IAYA 3C1FA 2M2LA 1BCPF 1STEA 3K5OA 4X3TA 2F0JA 1LV9A 2EYFA 4WFN3 2O2LD 2A69D 1EQVA 3QO2A 5D3IB 3ND9A 2PQEA 1EY4A 1PTOD 2R3ZA 3H6MA 5G3LF 1LT6D 2CW0D 1SYGA 2BOSA 2DN8A 4IFDI 3J81L 4NDXA 1WTWA 2EYJA 2HCCA 3TBIB 1CT1D 3SK5A 1ZEQX 3ND8A 1OO9B 4K6DA 3NTIA 4CKCA 3JAML 2KECA 1B9MA 1STHA 4QB4A 2Z4HA 4A3EB 3NWSA 4DAYA 4XT1B 2JP1A 2WINB 1MSHA 4WORA 4FNFA 1M4VA 1SFOB 3QIAA 2KHSA 3GQBA 5IGEA 3GO5A 4S3SA 1WCMB 2F4IA 1Y1VB 5FO7B 1STYA 4Q5VA 1LTSD 1MD2D 4R9WA 1HXYD 1R4QB 1E2ZA 4LAAA 2BA0A 1RODA 1HTPA 4KD4A 1LLRD 1BBXC 2PMZB 2K03A 2X6LA 2K33A 3GD7A 5LL6X 1BNZA 1OXXK 2E2DC 4K5VA 1D6EC 1SAPA 3TP8A 3A8KE 3DM1A 2G9DA 3D4DA 3ONAB 1WD1A 2CW0C 3GTKB 1CHQD 2JYOA 1Q1EA 1O7LA 3H0GB 3N52A 2ICEC 3L9AX 2F3WA 1RJTA 1J9OA 1TT2A 3MVVA 1TWAB 4ZKBB 3BZDB 2F0SA 5EPKA 2PNRC 2JSOA 3T13A 3P1HA 5IODA 5A2QE 1S5ED 2B2YA 3U9SA 3J80L 1CA6A 3MC0B 4E6IA 3QOJA 1CZGA 3R8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RAU C;  1X3Q A;  1X3P A;  5D65 A;  1JE4 A;  1KNE A;  4NW2 A;  1WTV A;  5CMD A;  3HP3 A;  1X32 A;  4X3S A;  3FPU B;  4CJ2 C;  1WVL A;  1F9P A;  3F2U A;  2FIN B;  1BF4 A;  5EKI A;  4ZLT F;  1AP0 A;  2N55 A;  2MPM A;  1AZQ A;  4OIJ A;  4RWS C;  5AFW A;  3KUP A;  1BNZ A;  4R8I A;  1G2T A;  2MJ8 A;  2NZ1 D;  2B2U C;  5EPJ A;  1WTR A;  1DOM A;  2B2V C;  5CBA E;  2D9U A;  2FMM A;  1ILP A;  5T1G A;  1O7Y A;  4DN4 M;  1NR2 A;  1NCV A;  2FHT A;  2L12 A;  1IKM A;  2BDN A;  1G6Z A;  1B4O A;  1IKL A;  4HCS A;  5EQ0 A;  4QUF A;  2B2Y C;  2EE1 A;  4R9W A;  1PFB A;  4MHE A;  1B3A A;  2K04 A;  4QUC A;  1WTO A;  1MSG A;  1WD0 A;  1WTQ A;  2J7Z A;  5COY A;  4IUV A;  3I90 A;  4OIK A;  1EIG A;  2KUM A;  3TN2 A;  2X69 A;  5COR A;  1B53 A;  2K05 A;  1ROD A;  2FJ2 A;  2K28 A;  4IUP A;  1HHV A;  1RTN A;  1WTX A;  1M8A A;  2H1E A;  3P7J A;  1TVX A;  1BBX C;  2NWG A;  1ZXT A;  4IUR A;  1U4P A;  5E4W C;  1F9S A;  2M2L A;  2CVR A;  2XIW A;  1HRJ A;  1U4R A;  1HFN A;  2K03 A;  1JIC A;  2KOL A;  2X6L A;  2RA4 A;  2RSN A;  4HSV A;  5DNF A;  1DOK A;  1HUM A;  2K01 A;  4HAE A;  4O42 A;  4X3T A;  4XT3 B;  2L9H A;  5T1I A;  3IFD A;  4ZK9 B;  1AZP A;  1CA5 A;  1HA6 A;  1LV9 A;  1G91 A;  2RVL A;  1IL8 A;  3QO2 A;  3GV3 A;  1MI2 A;  2B2T A;  1HFG A;  2B2W A;  2FFK B;  1CM9 A;  2KED A;  3MTS A;  1SAP A;  3DM1 A;  4XDX A;  5EJW A;  4U68 A;  4UAI A;  5D14 A;  1C8C A;  2B2T C;  1EIH A;  1F2L A;  1F9R A;  3MWY W;  2HCI A;  2HDL A;  2R3Z A;  1GUW A;  3ONA B;  4IUU A;  3LWE A;  4CJ0 B;  1WD1 A;  2HDM A;  2EOT A;  2IL8 A;  1EQT A;  2L1B A;  4IUT A;  2JYO A;  2K1B A;  2VXW A;  1PDQ A;  4MN3 A;  2RSO A;  1DZ1 A;  1SDF A;  1RHP A;  2B2W C;  3DEP A;  3GV6 A;  3N52 A;  1EOT A;  1ICW A;  2KVM A;  5E4X A;  1ML0 D;  3UI2 A;  1RJT A;  1WTW A;  1EL0 A;  1HUN A;  3DEO A;  1A15 A;  1J9O A;  4LMQ D;  3R93 A;  1NR4 A;  2HCC A;  3I8Z A;  4IUQ A;  1O7Z A;  1E0B A;  1ESR A;  2DY7 A;  3Q6S A;  1KNA A;  1B2T A;  1DON A;  3H91 A;  3FDT A;  1VMP A;  2HUG A;  1QG7 A;  1PFM A;  4X3U A;  2Q8T A;  4ZKB B;  5JJZ A;  3IL8 A;  1BO0 A;  3SVM A;  3I3C A;  1U4M A;  5EPL A;  2MP1 A;  5EPK A;  2B2V A;  2KEC A;  2SDF A;  4X3K A;  3KBX A;  2KEE A;  3G7L A;  1XYI A;  1J8I A;  5CBE E;  1Q3L A;  2N88 A;  4ZAI A;  2NYZ D;  4CJ1 B;  1PFN A;  2L4N A;  4ZKC B;  1SSO A;  1S4Z A;  3I91 A;  2EPB A;  3D6W A;  1NAP A;  4XT1 B;  1O80 A;  2MGS A;  1XX8 A;  2L11 A;  2X6G A;  1DOL A;  1RTO A;  2DY8 A;  2B2Y A;  2JP1 A;  4HED A;  1MGS A;  2B2U A;  1WTP A;  1G2S A;  3TZD A;  1CA6 A;  1QNK A;  1MSH A;  1PLF A;  2Q8R E;  1B50 A;  1F9Q A;  1VMC A;  1ILQ A;  1U4L A;  1QE6 A;  4RA8 A; 
#chains in the Genus database with same CATH topology
 2F52 A;  1WFQ A;  1X3P A;  4C3J H;  4PG3 A;  1JE4 A;  4IPC A;  1Q46 A;  4N9P A;  4XQJ A;  1B44 D;  2JQO A;  2JA5 B;  3IFT A;  4IFD J;  4QL5 A;  4V19 0;  3CCJ A;  1JWU D;  1ENA A;  4RWS C;  4A3K H;  5I2Y A;  1VQD A;  1DOM A;  1QVF A;  2B2V C;  1XNR Q;  1LUZ A;  3VR2 A;  1VQK A;  1D2B A;  5I6W A;  3A7L A;  2F0V A;  3N6R A;  1LTI D;  1IKL A;  1JR0 D;  3DXJ C;  4C3J G;  1A8V A;  2V4D A;  3S17 B;  1QIL A;  4PQX A;  5IY0 A;  1YNX A;  1UE6 A;  5JEA G;  1KQS A;  5COR A;  2EYP A;  3TP7 A;  1KC8 C;  3K57 A;  2JEB I;  1LAC A;  1BCP C;  1M8A A;  4NXN L;  4YWK A;  4A3L H;  3HGB A;  5GRO A;  3HOU B;  3PUZ A;  4IN3 A;  1BUV T;  2RHS B;  1OXV A;  4GLX A;  2RA4 A;  1I4G A;  4K2L A;  1LT5 D;  3JC6 6;  2EZV A;  4WJ3 M;  2L9H A;  1CQV A;  3M3Y B;  2VUM B;  4H13 C;  2NBF A;  2EJF C;  3HEJ A;  1E7Z A;  1MHW C;  5IT9 c;  1QCB D;  5IGC A;  2F4V L;  4FXG C;  1FD7 D;  3CPF A;  1MIU A;  1C8C A;  2K5D A;  1L1O C;  5C4J B;  3S1R B;  1F77 A;  4AIM A;  3K7A H;  5J1Z A;  3U4Z A;  4B08 A;  5HUR A;  2PI2 E;  1C4Q A;  4YCU A;  3G6E A;  2LKV A;  3MXN A;  3D8G A;  1NJI C;  4HIM A;  2B8G A;  1SDF A;  4OEM B;  1VQ4 A;  2TMP A;  1DD2 A;  2KVM A;  1EFI D;  4JI6 Q;  1KD1 C;  3FKI G;  2LY7 A;  2R93 G;  4GKJ Q;  2CCZ A;  4P2C B;  3JAM E;  1Y1W H;  1DON A;  4HJ8 A;  1PH7 A;  4CKB A;  2AMC B;  2MUY A;  2M00 A;  4OX9 L;  2F0U A;  2RDH A;  4RH6 A;  4LFB Q;  2NVY B;  3HOY G;  4UHV A;  1UNS A;  2ICI A;  5IT9 L;  5LMU L;  4DF7 A;  3MA2 B;  1MGS A;  1D5X C;  3A56 A;  4UP8 A;  2JA7 H;  5M5W B;  3GTL B;  2PPB C;  4A93 H;  2V1C C;  4F7X A;  4LNQ A;  4JI2 Q;  4LK1 C;  4C1N I;  1S5B D;  4KMU C;  3F8T A;  3E0J A;  1X32 A;  4FF1 A;  1EWC A;  2OQK A;  3L7Z C;  4KY6 A;  4XYO A;  1IW7 C;  3KDF B;  1GHK A;  4RGN A;  1CTM A;  1PH9 A;  3OSO A;  2NVY H;  1EZ8 A;  3PF4 A;  4M1U B;  4JC0 A;  4DNT B;  4GOP A;  3WOE A;  3I55 A;  4XQQ A;  2I5M X;  1EY6 A;  3K81 C;  1B3A A;  3S1N B;  4GKK L;  3S2D H;  4B3M L;  1EIG A;  2KUM A;  2A73 B;  4OWX B;  3PIP 3;  3J7Z C;  1GHJ A;  1SLJ A;  4K8J A;  4L5T A;  2EIF A;  4IUR A;  2SNM A;  2G9H D;  2QA4 A;  5ELD A;  2KHJ A;  1PH5 A;  2KBN A;  4R4Q A;  3EIV A;  1HFN A;  1JIC A;  1LYL A;  4N9T A;  3I4N H;  4IQZ A;  4XT3 B;  1M90 C;  3G71 A;  1EEI D;  3CCS A;  1N36 Q;  2WV6 D;  4POF A;  3IRB A;  2F0Q A;  1RKN A;  3BDO A;  3CMA A;  3PO3 H;  2B2T C;  1HQR D;  1F2L A;  3MWY W;  4DR2 L;  3ERS X;  1PTO H;  2F3V A;  2E75 C;  5CV9 A;  5M3F B;  1IBL L;  2F0I A;  1PZI D;  4JI8 Q;  3HOZ H;  2VXW A;  4DFA A;  1Q90 A;  4HR7 B;  3SR1 A;  1XJV A;  4BY7 G;  2WAQ B;  1TWG H;  4A3B B;  4A3J G;  5C5M A;  4DR6 Q;  1ESR A;  1Q12 A;  3HOV B;  2QGQ A;  1PFM A;  4JOI A;  5EPL A;  5IGG A;  1XPU A;  4R4O A;  1R9T B;  5FK9 C;  5C4H A;  3M7N A;  1ZYR D;  4OON A;  5BN3 A;  1JB3 A;  4ULL A;  3V96 A;  5JEA J;  1FNW A;  1XX8 A;  1OXT A;  2X6G A;  4DR7 L;  1DOL A;  2K32 A;  1JE5 A;  2B2U A;  4BY1 G;  2K14 A;  1JOQ A;  5BN5 A;  2BA1 A;  1B50 A;  1QVG A;  1ILQ A;  1VMC A;  1E24 A;  1AH9 A;  2B8F A;  3RLN A;  4JVZ A;  2BE5 C;  2OEO A;  3HG9 A;  1SBB B;  5JVH 3;  4A3I G;  1VQH A;  1W6K A;  2ZT9 C;  5LMN L;  4FF4 A;  2KA7 A;  1I4H A;  1F9P A;  1ET9 A;  1BF4 A;  4APV A;  3CC7 A;  3M4O H;  2AUK A;  2N55 A;  2P5Z X;  3OHX C;  2LFN A;  2MPM A;  4KKU A;  2BDO A;  2R61 A;  2B2U C;  1Q7Y C;  4BBS B;  3W1G A;  4P72 A;  4JCV E;  4LF8 Q;  4RHS A;  1G6Z A;  5TSS A;  4DAV A;  4WRD A;  4A3I H;  2R92 B;  4I65 A;  4CDD C;  2UUC L;  1B3Q A;  3J7A V;  3KF6 A;  2AWN A;  4LFA L;  5FJ8 H;  3CU7 A;  5FOB B;  4A3F G;  1I3Q B;  5C4Z A;  3NBH A;  2N49 A;  1XWE A;  4A3G H;  2IT1 A;  2DGY A;  2B63 G;  1SMY C;  3E0E A;  2JA9 A;  4A3I B;  2LSS A;  3T53 B;  2GN5 A;  5IYB H;  2RSN A;  2RDG A;  4JI0 L;  4G4K A;  5C3E B;  1HUM A;  1TKW B;  4GNX B;  4MTN A;  1L1O B;  2F0D A;  4ID6 A;  1CI3 M;  1JWS D;  4EGV A;  5K36 G;  1FYC A;  3MXP A;  4OO1 H;  1Y1V H;  4UAI A;  2ZXO A;  1F2Z A;  3H94 A;  2A74 C;  2HDL A;  4G7H C;  5IGB A;  1A0I A;  3LWE A;  4CJ0 B;  2VQE Q;  2CWA A;  1HR0 W;  2NN6 I;  2XSC A;  1VQI A;  4BXX H;  1KXL A;  4P71 A;  3NSW A;  5I6Y A;  2K4K A;  1K3B C;  3GV6 A;  2D5D A;  5CV6 A;  4TRD A;  5E4X A;  1TY0 A;  4GN3 B;  3K5L A;  1SE3 A;  4DXG A;  1DXM A;  1SNQ A;  1KNA A;  1X3G A;  3FP9 A;  2E2J H;  1VMP A;  1JJ2 A;  3IL8 A;  1BO0 A;  3FMC A;  1P16 A;  4LUV A;  1U4M A;  3VYU A;  2VY3 A;  1C48 A;  4UP9 A;  1JJG A;  4LWC A;  3AQQ A;  3K5M A;  1V8Q A;  4C3H H;  1UWV A;  3J80 E;  2XVS A;  4PNY A;  3HOV H;  4DV6 L;  3RZD B;  3D4R A;  1N34 Q;  3TP6 A;  3Q24 A;  1D5M C;  1IBM Q;  5KYL A;  3E5S A;  2KQ3 A;  3NHH A;  4C2M B;  5C6A A;  4X66 Q;  1VCI A;  2F0O A;  1YIJ A;  4J8Q A;  4MNO A;  4DK1 A;  2WB1 G;  4Y7N B;  2EYM A;  1VS0 A;  1J6Q A;  2QEX A;  2HIV A;  4KI0 A;  1ASY A;  5LMN W;  3QWN A;  3VYT A;  4R8I A;  1T5E A;  3S17 H;  1S72 A;  1FVI A;  3U58 A;  4Z9C B;  3KYH C;  4YWL A;  3AYH B;  2WII B;  3AMU A;  2FHT A;  4JK1 C;  1TWC B;  4HJA A;  5FLX c;  2F0P A;  2EE1 A;  3SE0 A;  3HOW B;  1XNR L;  1KLG D;  3I56 A;  2Z6B A;  1B53 A;  1FNU A;  3NK9 A;  2JE6 I;  1C9O A;  1KRS A;  2CQA A;  3WDN A;  3CRL C;  4NPS A;  2B63 H;  1B9N A;  4UP7 A;  1V1P B;  4IOC A;  2DNE A;  2CH4 W;  3HOZ B;  1VQ7 A;  1U9R A;  1H9M A;  1UAP A;  2JA8 B;  1H95 A;  1JWM D;  5EBC A;  4DR2 Q;  1KAB A;  3HOZ G;  3PF5 A;  5EJW A;  4NXM L;  4EQO A;  1JOR A;  3PO3 B;  3KF8 A;  4IUU A;  4KK7 A;  4JBW A;  2F0G A;  2HDM A;  3RZO H;  1GJX A;  3EN2 A;  3EQL C;  3PO3 G;  1GUS A;  4AQY Q;  4DR5 Q;  1V43 A;  1FNV A;  4IJL A;  2DJF C;  3K58 A;  3FRP B;  1EOT A;  2PCF B;  4IUN A;  3KLS X;  4DV5 L;  1CKM A;  1KRT A;  1E2W A;  3DHQ A;  3UE1 A;  2TSS A;  3GTQ H;  2K5Q A;  4KHZ A;  4K6L A;  3Q22 A;  2PQA B;  4H44 C;  2QCP X;  1JOO A;  4KHV A;  2WFW A;  1KDB A;  4ZCK A;  1N36 L;  3I72 A;  3I4L A;  2L11 A;  3MXG A;  4DV4 Q;  1RTO A;  2DNC A;  1G2S A;  1EQQ A;  2H4O A;  2VZA A;  1CSQ A;  2IX1 A;  3TRE A;  3FPP A;  3TQY A;  5C0X I;  1I6V C;  3NQI A;  4RA8 A;  1JC7 A;  4LF7 L;  5KNC A;  1X3Q A;  1SE2 A;  1PZJ D;  1Q8I A;  2BCO A;  3TEH B;  3K7A B;  3TZU A;  2F0N A;  4DPG A;  4X62 L;  4KHP L;  5EBD A;  4IFD G;  1S5D D;  3F2C A;  1EY9 A;  1WOC A;  1EY8 A;  1FJG Q;  4Y52 H;  3W3A A;  1G2T A;  1WTR A;  4CBV A;  1PHJ A;  3RLF A;  4A3K G;  1A3U A;  1TWG B;  1SJH D;  2A19 A;  1D1I A;  5IGF A;  2BDN A;  5C0X J;  4HCS A;  1FJG L;  2BH8 A;  3GTP B;  2YYZ A;  3BS1 A;  1Z6H A;  1CQF A;  2K04 A;  3AU7 A;  4J1M A;  4KHP Q;  3TN2 A;  1UEB A;  2X69 A;  4A75 A;  2K05 A;  3CC4 A;  4JI2 L;  2UUB Q;  4GNX C;  2KJX A;  1ZXT A;  1ICF B;  5E4W C;  1YZ6 A;  4JBK A;  5K36 H;  2OQ0 A;  3SEB A;  3RN2 A;  1A62 A;  4DR5 L;  3GTJ B;  3BVM A;  3M85 A;  2I5H A;  3MEF A;  3BDC A;  4YCV A;  5C5L A;  5IYB G;  4HSP A;  4GN4 B;  5IP7 G;  3S9W A;  5IYC H;  4H0L C;  5IYD G;  2E74 C;  2A8V A;  3HKS A;  1L0Y B;  4OXP A;  2IY5 B;  1I4X A;  5HGT A;  3CKI B;  3GP7 A;  2F0F A;  1H9S B;  2IPK D;  4DK3 C;  2EDG A;  3J81 i;  1NNX A;  4DV5 Q;  2RSO A;  2ZM6 Q;  4X6A H;  5EKL A;  1EL0 A;  1X54 A;  3T1H Q;  3PMF A;  1D8L A;  3DEO A;  1HPC A;  3R93 A;  4BBR B;  1E22 A;  5M3M G;  2F1M A;  4ZUJ A;  4IAL A;  5M5Y H;  3NTK A;  1OTC A;  3T1Y Q;  3KBX A;  4NXM Q;  4KKS A;  3KBG A;  1I6H H;  1Q3L A;  4HIK A;  2F4V Q;  1ET6 A;  4KLK A;  3NUC A;  1SSO A;  3RR5 A;  1NAP A;  1JOK A;  4A3F B;  1PA6 A;  2N3S A;  3I4N B;  1FGU A;  2G5D A;  1WTP A;  4IPD A;  4EVO A;  2NTT A;  3HOY H;  3R2I A;  1ESF A;  1K0S A;  3PUV A;  3ICE A;  3HOW G;  4JYA Q;  5L37 A;  1SR3 A;  2IWH A;  4DK0 A;  2HQL A;  3WWV A;  1VQO A;  1WTV A;  4OGQ C;  2A1A A;  1LTA D;  3KLS A;  3KJO A;  4K5W A;  4CJ2 C;  1EWI A;  2H5X A;  1VF5 C;  3QOL A;  4HMJ A;  4MZ9 A;  1X6O A;  2MJ8 A;  1SRU A;  3MXU A;  3S15 H;  5EPJ A;  2R7Z H;  3EVQ A;  1YEZ A;  4FP5 D;  1YNJ C;  3K80 C;  3NTH A;  1SJE D;  3VR4 A;  2RCN A;  4A3J H;  2OTL A;  2F0H A;  3J81 j;  2O5I C;  3GTO H;  2L5T A;  2EJG C;  5GAG C;  2BE5 D;  4C56 C;  2A68 C;  3G6J B;  1AW7 A;  1HCZ A;  2B2Y C;  3VYS A;  4ABN A;  4MHE A;  1STB A;  1BXT A;  1EU3 A;  3FEW X;  5COY A;  3OW2 A;  1R4P B;  2F0W A;  3B6Y A;  2OTJ A;  3DWQ A;  3SK8 A;  1JB7 A;  4X66 L;  1I6H B;  4DNR B;  5CGK A;  4K5X A;  1IYJ B;  5M3F G;  2Y0S B;  5ELN A;  3DM3 A;  1XNQ L;  4DAM A;  2A6H D;  4DV3 L;  3TRZ A;  1EY5 A;  4JI7 L;  2PW5 A;  3P75 A;  4KD3 A;  2PMZ E;  1QVC A;  4BY7 B;  4JI3 L;  1TY2 A;  3J81 E;  2A5H A;  4LJZ C;  1EYD A;  4K14 A;  2UU9 Q;  4XYQ A;  4LFC Q;  1L0W A;  5GAD C;  3MXN B;  1WCM H;  3PQI A;  3BYT B;  2UUA L;  1G51 A;  2IL8 A;  4IUT A;  2Z9H A;  3HKZ G;  2CQO A;  4CDC C;  2ASB A;  4JG2 A;  3AB9 A;  5DM7 3;  1YNJ D;  2D2C C;  1A15 A;  4A3M G;  2WB1 E;  3CPW A;  3I8Z A;  4O2D A;  1UE5 A;  1L0X B;  3A54 A;  5C3W A;  4K0K Q;  5DM6 3;  1XMQ Q;  2R92 H;  4LFA Q;  2XWB B;  3GTG B;  1O78 A;  2C9O A;  4EQ5 A;  2UUA Q;  3D3R A;  2B63 B;  3A74 A;  2NZO A;  4ZRZ A;  5IP9 H;  2E5L L;  3HZX A;  2VQF Q;  3QG1 A;  2ZJQ A;  2UU9 L;  1L1O A;  1STN A;  1QNK A;  2RHQ B;  4XQN A;  1J5E Q;  2Q8R E;  4JI4 L;  3L2P A;  1EUJ A;  2EXZ A;  4K8I A;  1H9J A;  5DLQ E;  3PIP A;  1C0A A;  3QJY A;  3NEN A;  1GXD C;  4DK6 C;  3A8J E;  4NMZ A;  4FXK C;  4L63 B;  1WVL A;  2AUJ D;  2EQS A;  1QWY A;  1JCK B;  4OL7 A;  4BBS G;  4ZLT F;  4DV0 L;  1AP0 A;  4XTC S;  4V0B A;  2UUC Q;  1MBY A;  4RHR A;  4GOP B;  3GDE A;  3PUY A;  2XWJ B;  1SNC A;  1PVO A;  2JJQ A;  1O7Y A;  3H0G H;  1SND A;  2L55 A;  1SEB D;  3S1R H;  4YY3 Q;  5ELF A;  1PFB A;  3Q0A A;  3J80 c;  2K5W A;  1EQR A;  4A93 G;  5I4D A;  5IGD A;  4F87 A;  5FKA C;  1VQE A;  1HQM C;  2I46 A;  1EFW A;  4A3D G;  1LTL A;  2E2H B;  3W2D A;  4C3H B;  5IP7 H;  4LF5 L;  5M5X H;  2A6H C;  1ONL A;  4ODG A;  1IXR A;  2NVX B;  5C4X B;  1HHV A;  4IFD H;  3Q8D A;  4HN7 A;  4TQU S;  3RNU A;  4ZK9 B;  4JYA L;  3OTO L;  1IL8 A;  3R3O A;  3HOV G;  2UXB Q;  2KED A;  4HMI A;  4DUZ Q;  2VUM G;  4A3J B;  3GTO B;  3OMC A;  3BVG A;  3BZC A;  2I5L X;  2NTS A;  3HOU G;  2GA4 B;  5KEE A;  1HJP A;  1EQT A;  4DR6 L;  3T1Y L;  2B2W C;  3DEP A;  2PZT A;  1FR3 A;  4KV6 A;  4XIG S;  4CGY B;  1QJO A;  4JI8 L;  1X3E A;  5F2D A;  4DR3 Q;  2PYK A;  1PH4 A;  2JA7 B;  3DMU A;  1ASZ A;  5HGQ A;  1YBY A;  1IHZ A;  3HOX B;  2EJM A;  3I91 A;  3Q23 A;  4X64 Q;  2YU9 B;  2PI2 A;  4DV0 Q;  1BCP D;  1IYV A;  1SMY D;  3M7G A;  3H3V C;  4CDF C;  2LXJ A;  2B39 A;  1F9Q A;  1W3S A;  2C35 B;  3NEL A;  2WAQ E;  5CYU A;  3KF8 B;  1JMC A;  3H09 A;  4HTH A;  3S2H H;  3PO2 G;  1BCP B;  2AQ2 B;  1LO5 D;  2VQF L;  3ERO A;  5EKI A;  4RMF A;  4RCN A;  4GKK Q;  3D31 A;  1Y8O B;  2WKD A;  2QIL A;  4L5R C;  4WJ4 A;  3C3L A;  2RBM A;  1Q1B A;  4N8F A;  1IYU A;  3CCV A;  1HR0 L;  5KIX A;  3D6C A;  4IPG A;  2EY5 A;  4DN4 M;  4FDB A;  3KF6 B;  2JEA I;  3PO2 B;  1B4O A;  3K0Y A;  4X65 L;  2D62 A;  4DAP A;  1NMF A;  1GUT A;  1R9T H;  4B3T Q;  4DXF A;  3OOC A;  3I90 A;  2KCC A;  4ILW A;  3HKZ E;  2I07 B;  3HRZ C;  4R8N A;  4KJO A;  4HCE A;  4LUO A;  3NWT A;  1C7Y A;  3S14 H;  1P8L A;  4J6H A;  1GVP A;  3M4Y A;  3HOX G;  2F0T A;  5IWA Q;  4DAY B;  4LF9 Q;  3HOY B;  2JA6 B;  3SDZ A;  3GTM H;  3NE5 B;  1AN8 A;  2QKI C;  1NE3 A;  2JA7 G;  4C1N K;  3V05 A;  4B3S L;  4LFC L;  4U68 A;  1HNW L;  4JI0 Q;  1LT3 D;  3PIO A;  2ZJP A;  1CFM A;  1YVC A;  2HCI A;  4A3B H;  4LFB L;  5GAE C;  2ID0 A;  2AQ3 B;  1UE1 A;  1X9N A;  1EYG A;  1DZ1 A;  2K5N A;  4PZ8 A;  3RN5 A;  3A7A B;  1QOH A;  3CW2 C;  2EY6 A;  2JXM B;  3A55 A;  2NZH A;  2E2J B;  1NY4 A;  1O7Z A;  4YHH Q;  1A2T A;  2Q8T A;  1HNZ L;  4FYD A;  4DUY Q;  2R7Z B;  5C4X G;  3S2D B;  1GUG A;  4X3K A;  3S16 B;  4C3I G;  2ZXR A;  1XYI A;  1K8O A;  1HZB A;  1QB5 D;  4H7B A;  3JAM i;  2NYZ D;  2CH4 A;  5CR3 A;  4K2K A;  1EU4 A;  1NUC A;  3DWP A;  4PZ6 A;  2MGS A;  3M4P A;  1HTL D;  3GTJ H;  5C4J H;  2E2I B;  2YV5 A;  3PV0 A;  5BN4 A;  3S15 B;  3PCO B;  5M9O A;  1Y1V G;  3OPO A;  1CHP D;  4GS3 A;  3TME A;  3STB C;  4C3J B;  2VUM H;  4A3L G;  4DKA C;  3VR3 A;  4JV5 Q;  4C3H G;  4RG1 A;  2PZW A;  1QNU A;  1Q82 C;  1QUQ A;  4UY8 C;  2F0K A;  2Y0S E;  1WTH A;  1SMX A;  3V2T A;  3T51 B;  5JEA H;  1AZQ A;  1TS2 A;  3KUP A;  4AYB B;  5IYD H;  1UE7 A;  3CCU A;  2VNU D;  1Z47 A;  1K0R A;  2FMM A;  5I2X A;  3PUW A;  4I7Z C;  2L12 A;  4RKL A;  1FL0 A;  4A3F H;  2E2H H;  3MFG A;  4QUF A;  4GOP C;  2KEN A;  1STA A;  1EYC A;  1VQB A;  1BQQ T;  1B8A A;  4CKE A;  2ZM6 L;  1KDC A;  5JOB A;  1T5X D;  4F8M A;  5E3F A;  4JI1 L;  1VQN A;  3J80 i;  1TVX A;  4A76 A;  1YHQ A;  2MO0 A;  1U4R A;  4EQN A;  3MZ5 A;  5CC4 A;  5DNF A;  2K01 A;  5GAH C;  2OF1 A;  3IFD A;  1STG A;  2F0L A;  5NUC A;  5FLX L;  4UPA A;  3MAQ A;  2ZTC A;  4HJ9 A;  3MTS A;  2FFK B;  2K5H A;  4KJN A;  1RF2 D;  4A3M B;  4RGM A;  5D14 A;  1GUW A;  1ENF A;  3BZK A;  3NEM A;  1K28 A;  3F1Z A;  1A3T A;  3HKZ B;  3SK6 A;  5IWA L;  1XXG A;  1ML0 D;  2L15 A;  2OWO A;  1XTC D;  3L0O A;  3CAM A;  4MIU A;  3H3V I;  4A3C G;  2O4X A;  1X65 A;  5IIF A;  1LAB A;  1SE8 A;  3UDI A;  5KRU A;  2F0M A;  4R1J A;  3CCR A;  1HNX L;  3W1B A;  1I50 H;  4A3C H;  2KEE A;  4BA1 I;  1G29 1;  1OXU A;  1X55 A;  4FF3 A;  1KAW A;  1S4Z A;  3SGI A;  4AYB G;  4B3S Q;  1ZKO A;  3HOX H;  3KJP A;  4KY7 A;  2J0T D;  1HNW Q;  2VB2 X;  5ELB A;  1Q86 C;  5HY6 A;  1U0L A;  4DA2 A;  1SYC A;  4O1N A;  3EBE A;  3NP8 A;  5IOC A;  5BR8 Q;  2E8G A;  5C3E H;  3OW7 A;  1TS5 A;  2E76 C;  1PYS B;  2K6A A;  1YNN D;  3UDG A;  2RCF A;  2Y0S G;  2YTX A;  3ZYY X;  1RD9 D;  3STB D;  5H1S E;  4X3S A;  2K75 A;  4JPB W;  1PFS A;  4DV4 L;  3AFP A;  3KLR A;  1LT4 D;  4P75 A;  5C0X H;  4OIJ A;  4DV7 Q;  2ALY B;  2OCE A;  4PMW A;  4QIW B;  4AH6 A;  3K59 A;  4LUZ A;  4B3T L;  4DV1 Q;  1NR2 A;  2JN4 A;  4JI5 L;  4XXE A;  3OIQ A;  1K83 H;  1EZ6 A;  4PMC A;  5EQ0 A;  1DGS A;  1TQO A;  3BDL A;  2WAC A;  1N32 L;  1YJN A;  3MHB A;  3IKJ A;  5CV8 A;  4PV1 C;  2SNS A;  4FO2 A;  3F2D A;  3OWE B;  1F2Y A;  4JBM A;  4YIJ A;  3CD6 A;  5G3L D;  2IW3 A;  1VQ5 A;  2OXP A;  4QIW E;  4LF6 L;  2Z4I A;  4FF2 A;  4IOA A;  3I4M H;  5FLM H;  3NBH B;  5J3B A;  4J15 A;  3EFX D;  4A3E G;  1PXU A;  2QDB A;  2RDF A;  1W2B A;  2HT1 A;  4O42 A;  1DYQ A;  2Q2T A;  5M3M B;  1WTQ A;  1CM9 A;  1B1Z A;  3J7A F;  5JJL A;  1GO3 E;  4DR7 Q;  2Q2U A;  1EEF D;  3J7Y W;  3O13 A;  1E3P A;  4NXN Q;  3GTQ B;  3M4O B;  4HID A;  2L1B A;  1TWH B;  3NPP A;  3ULJ A;  3C2P A;  2F0E A;  4A3G G;  3I70 A;  4BBR G;  1G8Z D;  4LMQ D;  3EA6 A;  3K6O A;  1LTG D;  4R4I A;  5IE8 A;  4X3U A;  4ZUI A;  2Z6K A;  1EYA A;  4BA2 I;  1TWH H;  3U50 C;  5E1F A;  1J8I A;  2XNA C;  1LTT D;  3QB3 A;  2NB0 A;  3S1Q B;  1V1O A;  5J22 A;  3LGJ A;  1II3 A;  1PH2 A;  3P20 A;  4ZKC B;  4O0A A;  1E1T A;  3D6W A;  3URY A;  1V1Q A;  3A0J A;  3OTO Q;  4IPH A;  4GNX A;  1CKN B;  3UDX A;  3I4M G;  2UXD L;  4HED A;  2NVT H;  3CQZ B;  1T9H A;  1EIY B;  3I2Z A;  1NSN S;  5KND A;  5KNB A;  3CCQ A;  5M5W H;  3X3M A;  3GTL H;  3OYY A;  1F2M A;  3M3Y H;  1K8M A;  3C1E A;  1N34 L;  3LX0 A;  1DM0 B;  2N78 A;  1KLU D;  3H15 A;  5DEH A;  1SXT A;  3CP0 A;  4A3K B;  1D5Z C;  3ULL A;  2VW9 A;  2NUC A;  1RIP A;  5C44 H;  2A6E C;  2RF4 A;  5AFW A;  1CUK A;  5DAU A;  4G7O C;  3BYY B;  3CXC A;  5C44 G;  4QF4 A;  1ILP A;  1PYB A;  2RKS A;  4LW1 A;  3FKI H;  3SHL A;  1TXY A;  3PIO 3;  3CCM A;  1HNZ Q;  4BBS H;  2IJ0 A;  2A68 D;  1XPO A;  3MEH A;  5C44 B;  2R7F A;  1MSG A;  4RGT A;  3BJU A;  1VDZ A;  4RGO S;  2Q8I B;  1RCV D;  2XN9 C;  3TDQ A;  4IUP A;  1I3Q H;  3RUZ A;  4L5Q A;  4BY7 H;  1WTX A;  3CRK C;  5FJ8 G;  4ZYS A;  1D1K A;  1E1O A;  1PMR A;  2CVR A;  1N8R C;  1SYB A;  1A63 A;  1RL2 A;  2JA5 H;  3K8A A;  4P73 A;  4B3R L;  5FO8 B;  4LF4 Q;  1DOK A;  2UXC L;  5T1I A;  3KLW A;  3RZD H;  1V1P A;  4IO9 A;  2FXQ A;  2CFM A;  2EYL A;  4YWM A;  2RVL A;  1MI2 A;  2B2T A;  4XDX A;  4B9X A;  1HRJ A;  3HOU H;  2PW7 A;  5M5X B;  4K0K L;  3MFY A;  1PTO B;  4A3D B;  4CHT B;  2K1B A;  1JQY D;  4MN3 A;  1BKB A;  5IT9 E;  1HUN A;  5LHY 1;  1NR4 A;  3D4W A;  4B9W A;  1TWA H;  1TWF B;  3H3V H;  1U5K A;  1CZW A;  3QR8 A;  1GKH A;  1DCZ A;  3H91 A;  2NN6 H;  5KGU A;  3SVM A;  1BDO A;  4A3D H;  3OIP A;  2LS0 1;  4OEL B;  2A69 C;  3I3C A;  5M5Y B;  2VS1 A;  3S1Q H;  1HR0 Q;  3OMG A;  3EJI A;  4G57 A;  1HZA A;  2KCM A;  3S14 B;  4OO1 I;  4ZQ3 A;  2YU9 H;  3VA7 A;  1A3V A;  2L4N A;  1FGB D;  2EPB A;  5CV5 A;  1O80 A;  1AE3 A;  2ENB A;  2K5V A;  4A4I A;  1EY7 A;  1KAA A;  3TZD A;  2JA8 G;  4NP5 A;  2Z8L A;  1QZG A;  1Y8N B;  4JI7 Q;  5C3X A;  1S3O A;  4DU9 A;  3S2H B;  3E9H A;  1I4P A;  3T16 A;  1XNQ Q;  1SFO H;  4OWW B;  3TS2 A;  4KN4 C;  5CMD A;  2MNA A;  1S5F D;  4GZY C;  3F2U A;  4BY1 H;  4X64 L;  1LTR D;  4QCL A;  3HS0 C;  2NZ1 D;  2WKC A;  1B70 B;  5AJ3 Q;  2N8N A;  5FO9 B;  2D9U A;  4WJW A;  5C0X G;  5LL6 S;  2DJG C;  2XGT A;  2YTV A;  4DR3 L;  1NCV A;  3F2B A;  5GQO A;  4BY1 B;  2EY1 A;  1GUN A;  2PQA A;  2R6G A;  2QW7 A;  3VR6 A;  2I0Q A;  3SXH A;  1D7Q A;  2J7Z A;  4IUV A;  3S1M H;  4G7Z C;  5LMN Q;  2Z1C A;  2J4X A;  2KCN A;  3VYR A;  3J81 c;  4A3E H;  4DR1 L;  3T1H L;  1Z7T A;  2HHH Q;  3DUZ A;  1SYF A;  4YCW A;  4JW0 A;  2M9V A;  1EY0 A;  2HQE A;  4HAE A;  3BG3 A;  2Z6K C;  3GV3 A;  5IYC G;  1BOS A;  4MTK A;  1BR9 A;  1Q81 C;  2EVB A;  3C46 A;  1EIH A;  1SYE A;  2MHV A;  2FMC A;  1PZK D;  4OHJ A;  4QJF A;  4LF5 Q;  2MO1 A;  5JJI A;  4Q0F A;  4C2M H;  5IP9 G;  5A2Q L;  1ICW A;  1H9S A;  1ENC A;  4B3M Q;  3KK7 A;  2ZXP A;  4LF6 Q;  1HZ9 A;  1OXS C;  4IZ8 A;  2XRS D;  4IUQ A;  1AE2 A;  4YY3 L;  1PRT F;  2IX3 A;  3T4A C;  3ITP A;  5FLM G;  2VL6 A;  3GTP H;  2MP1 A;  2B2V A;  5C3E G;  4NKL A;  2D0P A;  1AFP A;  2C5C A;  1LM0 A;  1HH2 P;  4CJ1 B;  3RD4 A;  4DV7 L;  1PFN A;  1SE4 A;  1BVS A;  3CCL A;  1KTK A;  4DV1 L;  5K5P A;  3A8I E;  2CWP A;  4M8A A;  5I9P A;  3G4S A;  2NVT B;  1PLF A;  3E6Z X;  1GOZ A;  4ME5 A;  2R92 G;  1RDP D;  1UEA B;  3T56 B;  1NTG A;  1YHB A;  1PV4 A;  3X3N A;  2QF7 A;  2CKZ B;  4NW2 A;  2OT2 A;  3HP3 A;  4Y7N H;  1TWF H;  3CF5 A;  3I4N G;  5BR8 L;  2UUB L;  3LNN A;  1Y69 U;  3NQT A;  2EYH A;  4JI5 Q;  2XRQ D;  2AWO A;  3PUX A;  5CBA E;  3KDF A;  1TU2 B;  2IHE A;  3NBI A;  1Z9F A;  2QDL A;  4L6T B;  4X65 Q;  1Q8K A;  1PRT B;  1E2V A;  3RZO B;  3S1M B;  4JI6 L;  5KYI A;  1VQ8 A;  4R4C A;  1SNP A;  3TSS A;  2R93 H;  2FJ2 A;  1A6X A;  1CK1 A;  3R2T A;  4LF7 Q;  1RTN A;  1ZYR C;  1PYW D;  2NWG A;  1SNO A;  1F9S A;  2XIW A;  4X62 Q;  2YTY A;  1KHI A;  1XPR A;  2CHB D;  3L3O C;  4HSV A;  1O7I A;  1SYD A;  4JI3 Q;  1CA5 A;  2R93 B;  4PMB A;  1G91 A;  4KY5 A;  4KN7 C;  5I9O A;  4HJ7 A;  3CHB D;  1CSP A;  3OWF A;  4QMG A;  4TVA B;  1TR5 A;  2XTI A;  1VQA A;  2EYO A;  1I4R A;  4BS9 A;  4FVM A;  1GUO A;  4C3I B;  2R7Z G;  2B29 A;  2RQX A;  1RHP A;  2L0C A;  3ER0 A;  5EGT A;  3K5N A;  4TKO B;  1G6P A;  3I73 A;  1WYD A;  4A3B G;  4AQY L;  1E0B A;  3Q6S A;  4R4T A;  5M3F H;  3FDT A;  2MQH A;  1QG7 A;  5ELE A;  1PRT C;  1A2U A;  1PRT D;  3G48 A;  2VB3 X;  2SDF A;  2O5J C;  1N9W A;  1KDA A;  5A35 A;  4F88 A;  2WP8 J;  3A5U A;  4ZAI A;  3S16 H;  5D3D A;  1PTO F;  4RKB A;  2DY8 A;  1Y8P B;  1I94 Q;  4QQB X;  1N33 Q;  1VQ6 A;  4CDE C;  1SRO A;  1NBW A;  1YNN C;  2HHH L;  3BVZ A;  5C4X H;  1QE6 A;  2LMC B;  1GM5 A;  4ALP A;  2JA6 G;  4RAU C;  3VA5 A;  1UUP A;  1KNE A;  1GD7 A;  1KIX A;  1N33 L;  1VQC A;  1I94 L;  1IW7 D;  4DV2 L;  1LTB D;  1I4Q A;  1H9R A;  4UDU C;  1JT8 A;  3ERQ A;  1X56 A;  2A6E D;  2NN6 G;  3FVQ A;  5ELC A;  4L8J A;  1B7Y B;  1H9K A;  4KTA A;  5T1G A;  1V9P A;  2AHO B;  1VQ9 A;  5AJ3 L;  2AKW B;  4YHH L;  4ME3 A;  4IJH A;  4DNI A;  5CV7 A;  2SOB A;  4DUY L;  1IL2 A;  4OIK A;  1PTO C;  3VR5 A;  1CKN A;  4JV5 L;  1I5F A;  2K28 A;  3U4V A;  1PH3 A;  3JAM c;  1TS4 A;  2H1E A;  3P7J A;  4RFB A;  1U4P A;  1PH8 A;  5FLX E;  4JOI C;  5JPN C;  1BBU A;  1WJJ A;  2KOL A;  2EXD A;  4AYB E;  3E3X A;  1HA6 A;  1AZP A;  2JA8 H;  1XTD A;  3D0F A;  4A3G B;  2GVB A;  3SK4 A;  1HFG A;  2B2W A;  3RLO A;  2ATW A;  3FKI B;  4DV6 Q;  1F9R A;  1EWH A;  2HIX A;  5JVG 3;  1TWC H;  1X3F A;  4JBJ A;  4LF9 L;  1K83 B;  5JPM C;  1S5C D;  4TSS A;  4RCO A;  2EOT A;  1TII D;  3K7U C;  1DJR D;  5CV4 A;  4B3R Q;  5ISR A;  1PDQ A;  1AEX A;  3RMH A;  1IKM A;  3LWU A;  3UI2 A;  2PO4 A;  3S24 A;  3TP5 A;  1TS3 A;  2HD3 A;  2KHI A;  4KKT A;  5JAV A;  2DY7 A;  4H02 A;  4EQP A;  3CC2 A;  1B2T A;  4DGZ A;  4U67 3;  2HUG A;  3NXW A;  5JJZ A;  2MFI A;  3DLL A;  1HA5 A;  4NB3 A;  4GN5 A;  3G7L A;  3VDY A;  1I50 B;  1QZH A;  5CBE E;  2N88 A;  2VQE L;  1Y1W B;  3PGZ A;  1W6J A;  3CQZ H;  2K7V A;  3PSI A;  1VF7 A;  1MJC A;  1HZC A;  5EKK A;  3GTM B;  4I7A A;  1IZ6 A;  2WB1 B;  1U4L A;  3U9O A;  2PNH A;  4DV3 Q;  2ZTE A;  4LF4 L;  2UXC Q;  2SEB D;  2PZU A;  5D65 A;  1EIF A;  3WOF A;  1XMO L;  3DWA A;  4DR4 L;  4FXD A;  3FPU B;  2K50 A;  4L5S A;  2FIN B;  5J39 A;  3J7A 5;  2ES2 A;  2IHF A;  4OO1 G;  4A93 B;  4BWG B;  1SNM A;  1MJE A;  4QGU A;  1PH6 A;  2IX0 A;  2AQ1 B;  2UXD Q;  2EY2 A;  3M9B A;  4LF8 L;  3GTK H;  1WD0 A;  3I7F A;  4QUC A;  1WTO A;  1JJC B;  2JK8 A;  1EOV A;  1IBK Q;  2NVQ B;  2F03 A;  2LXK A;  2QEJ C;  1PH1 A;  3I4M B;  2JA5 G;  3IAY A;  2BH2 A;  3C1F A;  3W5O A;  2M2L A;  1BCP F;  1STE A;  1VQL A;  4EX5 A;  4GLA C;  3HFZ B;  3K5O A;  1K73 C;  4X3T A;  4DUZ L;  2ZJR A;  2F0J A;  5JJK A;  1LV9 A;  2EYF A;  4WFN 3;  2O2L D;  2A69 D;  1EQV A;  3QO2 A;  5D3I B;  2Q2I A;  2D0O A;  3ND9 A;  3TS0 A;  5E7N A;  2PQE A;  5M3M H;  1EY4 A;  1PTO D;  1VQM A;  2UXB L;  2R3Z A;  4A3M H;  3H6M A;  3H0G G;  5G3L F;  1LT6 D;  2CW0 D;  1SYG A;  2BOS A;  4DR1 Q;  1CKO A;  2DN8 A;  4IFD I;  3J81 L;  1K3R A;  4NDX A;  4P74 A;  3K0X A;  1WTW A;  2EYJ A;  3UDF A;  4BBR H;  5ELO A;  4POG A;  2HCC A;  3AFQ A;  3TBI B;  1CT1 D;  1MKH A;  3SK5 A;  1ZEQ X;  3ND8 A;  1OO9 B;  4K6D A;  3NTI A;  4CKC A;  1VQP A;  3JAM L;  2KEC A;  1B9M A;  1STH A;  4QB4 A;  2Z4H A;  4A3E B;  3NWS A;  4DAY A;  1M1K C;  2K52 A;  1IBL Q;  1S40 A;  4XT1 B;  1YI2 A;  2E2I H;  1YHA A;  4PZ7 A;  2JP1 A;  1VQF A;  2WIN B;  3HOW H;  4HJ5 A;  3M4Q A;  1MSH A;  4WOR A;  4FNF A;  1NMG A;  2ZTD A;  3FHW A;  1M4V A;  1SFO B;  3QIA A;  2KHS A;  4DR4 Q;  1J5E L;  4JI4 Q;  3KOJ A;  1IBM L;  4HIO A;  1XMO Q;  3GQB A;  5IGE A;  3GO5 A;  1KL9 A;  3KFU A;  1Y14 B;  4S3S A;  1WCM B;  1IBK L;  2Z0S A;  4C3I H;  2E5L Q;  5EAY A;  2F4I A;  1QUQ B;  4BXX G;  1VQJ A;  1Y1V B;  1WCM G;  1YJ9 A;  5FO7 B;  1N32 Q;  2KCT A;  1STY A;  3S1N H;  4Q5V A;  1LTS D;  1MD2 D;  4R9W A;  1SN8 A;  2NVX H;  1HXY D;  1R4Q B;  2DUD A;  2NVQ H;  1E2Z A;  1XMQ L;  4LAA A;  1Y1W G;  2WAQ G;  4OX9 Q;  2BA0 A;  3I4O A;  2GVA A;  1ROD A;  1HTP A;  4N8X 1;  4KD4 A;  1LLR D;  4GKJ L;  1BBX C;  4GLV B;  2JA6 H;  3BU2 A;  2PMZ B;  2K03 A;  2X6L A;  2K33 A;  3GD7 A;  5LL6 X;  1K8G A;  3E9I A;  1BNZ A;  3ULP A;  1OXX K;  2B3G A;  2E2D C;  5LMU Q;  1K9M C;  4K5V A;  1D6E C;  1K8A C;  1SAP A;  3DM1 A;  3A8K E;  3TP8 A;  2G9D A;  3D4D A;  1WI5 A;  1YIT A;  2F3I A;  4OWT B;  3ONA B;  1HNX Q;  1WD1 A;  2CW0 C;  3GTK B;  1YJW A;  1CHQ D;  2JYO A;  1Q1E A;  3CME A;  1O7L A;  3H0G B;  3N52 A;  2ICE C;  3L9A X;  2F3W A;  1RJT A;  2R7D A;  4QY7 A;  3ZJY C;  3UE0 A;  1J9O A;  1L2F A;  1TT2 A;  4JI1 Q;  3MVV A;  1TWA B;  4ZKB B;  3BZD B;  3GTG H;  2F0S A;  5EPK A;  3A5Z B;  3CCE A;  2PNR C;  2JSO A;  3T13 A;  3P1H A;  5IOD A;  1VQG A;  5A2Q E;  3PO2 H;  4DV2 Q;  1BBW A;  1S5E D;  2B2Y A;  3U9S A;  3J80 L;  3AEV A;  1CA6 A;  3MC0 B;  4E6I A;  3QOJ A;  2Q2H A;  1CZG A;  3R8B A; 
#chains in the Genus database with same CATH homology
 1X3P A;  1JE4 A;  4N9P A;  4XQJ A;  1B44 D;  2JA5 B;  3IFT A;  4IFD J;  4V19 0;  1JWU D;  1ENA A;  4RWS C;  5I2Y A;  1DOM A;  2B2V C;  3VR2 A;  1D2B A;  5I6W A;  3A7L A;  2F0V A;  3N6R A;  1LTI D;  1IKL A;  1JR0 D;  3DXJ C;  4C3J G;  2V4D A;  3S17 B;  1QIL A;  4PQX A;  5JEA G;  5COR A;  2EYP A;  3TP7 A;  3K57 A;  2JEB I;  1LAC A;  1BCP C;  1M8A A;  3HGB A;  3HOU B;  3PUZ A;  4IN3 A;  1BUV T;  1OXV A;  2RA4 A;  1I4G A;  4K2L A;  1LT5 D;  2EZV A;  2L9H A;  1CQV A;  3M3Y B;  2VUM B;  4H13 C;  2NBF A;  2EJF C;  3HEJ A;  1QCB D;  5IGC A;  4FXG C;  1FD7 D;  1C8C A;  2K5D A;  5C4J B;  3S1R B;  1F77 A;  5J1Z A;  4B08 A;  5HUR A;  1C4Q A;  2LKV A;  3MXN A;  3D8G A;  2B8G A;  1SDF A;  2TMP A;  1DD2 A;  2KVM A;  1EFI D;  2LY7 A;  4P2C B;  3JAM E;  1DON A;  4CKB A;  2MUY A;  2M00 A;  2F0U A;  2RDH A;  4RH6 A;  2NVY B;  1UNS A;  2ICI A;  5IT9 L;  4DF7 A;  3MA2 B;  1MGS A;  1D5X C;  3A56 A;  5M5W B;  3GTL B;  2PPB C;  4F7X A;  4LK1 C;  4C1N I;  1S5B D;  4KMU C;  3E0J A;  1X32 A;  4FF1 A;  1EWC A;  3L7Z C;  4KY6 A;  4XYO A;  1IW7 C;  1GHK A;  4RGN A;  1CTM A;  3OSO A;  1EZ8 A;  4M1U B;  4DNT B;  3WOE A;  4XQQ A;  1EY6 A;  1B3A A;  3S1N B;  1EIG A;  2KUM A;  2A73 B;  3PIP 3;  1GHJ A;  4K8J A;  4IUR A;  2SNM A;  2G9H D;  5ELD A;  1HFN A;  1JIC A;  4N9T A;  4IQZ A;  4XT3 B;  1EEI D;  2WV6 D;  2F0Q A;  1RKN A;  3BDO A;  2B2T C;  1HQR D;  1F2L A;  3MWY W;  1PTO H;  2F3V A;  2E75 C;  5CV9 A;  5M3F B;  2F0I A;  1PZI D;  2VXW A;  4DFA A;  1Q90 A;  4HR7 B;  3SR1 A;  2WAQ B;  4A3B B;  5C5M A;  1ESR A;  1Q12 A;  3HOV B;  1PFM A;  5EPL A;  5IGG A;  1R9T B;  5FK9 C;  5C4H A;  3M7N A;  1ZYR D;  5BN3 A;  1JB3 A;  4ULL A;  3V96 A;  5JEA J;  1FNW A;  1XX8 A;  1OXT A;  2X6G A;  1DOL A;  2K32 A;  2B2U A;  1JOQ A;  5BN5 A;  2BA1 A;  1B50 A;  1ILQ A;  1VMC A;  2B8F A;  2BE5 C;  2OEO A;  3HG9 A;  5JVH 3;  1SBB B;  1W6K A;  2ZT9 C;  4FF4 A;  2KA7 A;  1I4H A;  1F9P A;  1BF4 A;  1ET9 A;  2AUK A;  2N55 A;  3OHX C;  2LFN A;  2MPM A;  4KKU A;  2BDO A;  2R61 A;  2B2U C;  4BBS B;  4RHS A;  1G6Z A;  5TSS A;  4DAV A;  4WRD A;  2R92 B;  4I65 A;  3J7A V;  2AWN A;  3CU7 A;  5FOB B;  1I3Q B;  5C4Z A;  3NBH A;  1XWE A;  2IT1 A;  1SMY C;  4A3I B;  3T53 B;  2RSN A;  2RDG A;  4G4K A;  5C3E B;  1HUM A;  1TKW B;  2F0D A;  4ID6 A;  4EGV A;  1CI3 M;  1JWS D;  5K36 G;  1FYC A;  3MXP A;  4OO1 H;  4UAI A;  2ZXO A;  1F2Z A;  3H94 A;  2A74 C;  2HDL A;  4G7H C;  5IGB A;  3LWE A;  4CJ0 B;  2NN6 I;  2XSC A;  3NSW A;  5I6Y A;  3GV6 A;  2D5D A;  5CV6 A;  4TRD A;  5E4X A;  1TY0 A;  3K5L A;  1SE3 A;  4DXG A;  1DXM A;  1SNQ A;  1KNA A;  1VMP A;  3IL8 A;  1BO0 A;  3FMC A;  3VYU A;  1U4M A;  1C48 A;  3K5M A;  1V8Q A;  3J80 E;  2XVS A;  4PNY A;  3RZD B;  3D4R A;  3TP6 A;  3Q24 A;  1D5M C;  5KYL A;  3E5S A;  2KQ3 A;  3NHH A;  4C2M B;  5C6A A;  1VCI A;  2F0O A;  4J8Q A;  4DK1 A;  4Y7N B;  2EYM A;  4KI0 A;  3QWN A;  3VYT A;  4R8I A;  1T5E A;  4Z9C B;  2WII B;  3AMU A;  2FHT A;  4JK1 C;  1TWC B;  2F0P A;  2EE1 A;  3SE0 A;  3HOW B;  1KLG D;  1B53 A;  1FNU A;  3NK9 A;  2JE6 I;  2CQA A;  3WDN A;  3CRL C;  1B9N A;  1V1P B;  2DNE A;  3HOZ B;  1U9R A;  1H9M A;  1UAP A;  2JA8 B;  1JWM D;  5EBC A;  1KAB A;  5EJW A;  4EQO A;  1JOR A;  3PO3 B;  3KF8 A;  4IUU A;  4KK7 A;  4JBW A;  2F0G A;  2HDM A;  1GJX A;  3EQL C;  1GUS A;  1V43 A;  1FNV A;  3K58 A;  3FRP B;  1EOT A;  2PCF B;  4IUN A;  3KLS X;  1E2W A;  3DHQ A;  2TSS A;  2K5Q A;  4KHZ A;  4K6L A;  3Q22 A;  4H44 C;  2QCP X;  1JOO A;  4KHV A;  1KDB A;  3I72 A;  3I4L A;  2L11 A;  3MXG A;  1RTO A;  2DNC A;  1G2S A;  2H4O A;  2IX1 A;  3FPP A;  5C0X I;  1I6V C;  3NQI A;  4RA8 A;  1JC7 A;  5KNC A;  1X3Q A;  1SE2 A;  1PZJ D;  1Q8I A;  2BCO A;  3K7A B;  3TZU A;  2F0N A;  5EBD A;  4IFD G;  1S5D D;  1EY9 A;  1EY8 A;  3W3A A;  1G2T A;  1WTR A;  4CBV A;  3RLF A;  1A3U A;  1TWG B;  1SJH D;  1D1I A;  5IGF A;  2BDN A;  5C0X J;  4HCS A;  3GTP B;  2YYZ A;  3BS1 A;  1Z6H A;  1CQF A;  2K04 A;  3AU7 A;  4J1M A;  3TN2 A;  2X69 A;  2K05 A;  2KJX A;  1ZXT A;  5E4W C;  5K36 H;  3SEB A;  3GTJ B;  3BVM A;  3M85 A;  3BDC A;  5C5L A;  4HSP A;  3S9W A;  4H0L C;  2E74 C;  1L0Y B;  1I4X A;  5HGT A;  3CKI B;  3GP7 A;  2F0F A;  1H9S B;  2IPK D;  2EDG A;  2RSO A;  5EKL A;  1EL0 A;  3PMF A;  3DEO A;  1HPC A;  3R93 A;  4BBR B;  2F1M A;  4ZUJ A;  4IAL A;  3NTK A;  3KBX A;  4KKS A;  3KBG A;  1Q3L A;  1ET6 A;  3NUC A;  1SSO A;  1NAP A;  1JOK A;  4A3F B;  3I4N B;  1WTP A;  4EVO A;  2NTT A;  3R2I A;  1ESF A;  3PUV A;  2IWH A;  4DK0 A;  1WTV A;  4OGQ C;  1LTA D;  3KLS A;  4K5W A;  4CJ2 C;  1VF5 C;  3QOL A;  4HMJ A;  2MJ8 A;  3MXU A;  5EPJ A;  3EVQ A;  4FP5 D;  1YNJ C;  3NTH A;  1SJE D;  3VR4 A;  2O5I C;  2F0H A;  2L5T A;  2EJG C;  2BE5 D;  4C56 C;  2A68 C;  3G6J B;  1AW7 A;  1HCZ A;  2B2Y C;  3VYS A;  4ABN A;  4MHE A;  1STB A;  1BXT A;  1EU3 A;  3FEW X;  5COY A;  1R4P B;  2F0W A;  3DWQ A;  3SK8 A;  1I6H B;  4DNR B;  5CGK A;  4K5X A;  2Y0S B;  2A6H D;  1EY5 A;  2PW5 A;  3P75 A;  4KD3 A;  4BY7 B;  1TY2 A;  3J81 E;  2A5H A;  4LJZ C;  1EYD A;  4K14 A;  4XYQ A;  3BYT B;  2IL8 A;  4IUT A;  3AB9 A;  5DM7 3;  1YNJ D;  2D2C C;  1A15 A;  3I8Z A;  1L0X B;  3A54 A;  5C3W A;  5DM6 3;  2XWB B;  3GTG B;  1O78 A;  2C9O A;  3D3R A;  2B63 B;  4ZRZ A;  3HZX A;  3QG1 A;  1STN A;  1QNK A;  4XQN A;  2Q8R E;  2EXZ A;  4K8I A;  1H9J A;  3QJY A;  1GXD C;  3A8J E;  4NMZ A;  4FXK C;  4L63 B;  1WVL A;  2AUJ D;  1QWY A;  1JCK B;  4OL7 A;  4ZLT F;  1AP0 A;  4XTC S;  4V0B A;  1MBY A;  4RHR A;  3PUY A;  2XWJ B;  1SNC A;  1O7Y A;  1SND A;  2L55 A;  1SEB D;  5ELF A;  1PFB A;  3Q0A A;  2K5W A;  5I4D A;  5IGD A;  4F87 A;  5FKA C;  1HQM C;  2I46 A;  2E2H B;  3W2D A;  4C3H B;  2A6H C;  1ONL A;  4ODG A;  2NVX B;  5C4X B;  1HHV A;  4IFD H;  4TQU S;  4HN7 A;  4ZK9 B;  1IL8 A;  3R3O A;  2KED A;  4HMI A;  4A3J B;  3GTO B;  3OMC A;  3BVG A;  2NTS A;  2GA4 B;  5KEE A;  1EQT A;  2B2W C;  3DEP A;  2PZT A;  1FR3 A;  4KV6 A;  4XIG S;  4CGY B;  1QJO A;  5F2D A;  2PYK A;  2JA7 B;  3DMU A;  1IHZ A;  3HOX B;  2EJM A;  3I91 A;  3Q23 A;  2YU9 B;  1BCP D;  1IYV A;  1SMY D;  3M7G A;  3H3V C;  2B39 A;  1F9Q A;  5CYU A;  3H09 A;  4HTH A;  1BCP B;  2AQ2 B;  1LO5 D;  3ERO A;  5EKI A;  4RCN A;  3D31 A;  1Y8O B;  2WKD A;  2QIL A;  3C3L A;  2RBM A;  1Q1B A;  1IYU A;  5KIX A;  3D6C A;  2EY5 A;  4DN4 M;  2JEA I;  3PO2 B;  1B4O A;  3K0Y A;  2D62 A;  4DAP A;  1GUT A;  4DXF A;  3OOC A;  3I90 A;  2KCC A;  4ILW A;  2I07 B;  3HRZ C;  4R8N A;  4KJO A;  4HCE A;  3NWT A;  4J6H A;  3M4Y A;  2F0T A;  3HOY B;  2JA6 B;  3SDZ A;  3NE5 B;  1AN8 A;  2QKI C;  4C1N K;  3V05 A;  4U68 A;  1LT3 D;  1CFM A;  2HCI A;  2ID0 A;  2AQ3 B;  1DZ1 A;  3A7A B;  1QOH A;  2EY6 A;  2JXM B;  3A55 A;  2E2J B;  1O7Z A;  1A2T A;  2Q8T A;  4FYD A;  2R7Z B;  3S2D B;  1GUG A;  4X3K A;  3S16 B;  4C3I G;  2ZXR A;  1XYI A;  1K8O A;  1QB5 D;  4H7B A;  2NYZ D;  5CR3 A;  4K2K A;  1EU4 A;  1NUC A;  3DWP A;  2MGS A;  1HTL D;  2E2I B;  3PV0 A;  5BN4 A;  3S15 B;  5M9O A;  3OPO A;  3TME A;  1CHP D;  4C3J B;  3VR3 A;  4C3H G;  2PZW A;  1QNU A;  2F0K A;  3V2T A;  3T51 B;  5JEA H;  1AZQ A;  1TS2 A;  3KUP A;  4AYB B;  2VNU D;  1Z47 A;  2FMM A;  5I2X A;  3PUW A;  4I7Z C;  2L12 A;  4RKL A;  3MFG A;  4QUF A;  1STA A;  1EYC A;  1BQQ T;  4CKE A;  1KDC A;  5JOB A;  1T5X D;  4F8M A;  5E3F A;  1TVX A;  1U4R A;  4EQN A;  3MZ5 A;  5CC4 A;  5DNF A;  2K01 A;  2OF1 A;  3IFD A;  1STG A;  2F0L A;  5NUC A;  5FLX L;  3MAQ A;  3MTS A;  2FFK B;  4KJN A;  1RF2 D;  4A3M B;  4RGM A;  5D14 A;  1GUW A;  1ENF A;  1A3T A;  3HKZ B;  3SK6 A;  1XXG A;  1ML0 D;  1XTC D;  4MIU A;  2O4X A;  5IIF A;  1LAB A;  5KRU A;  2F0M A;  2KEE A;  4BA1 I;  1G29 1;  1OXU A;  4FF3 A;  1S4Z A;  1ZKO A;  4KY7 A;  2J0T D;  2VB2 X;  5ELB A;  4DA2 A;  1SYC A;  4O1N A;  3NP8 A;  5IOC A;  3OW7 A;  1TS5 A;  2E76 C;  2K6A A;  1YNN D;  3ZYY X;  1RD9 D;  4X3S A;  3KLR A;  1LT4 D;  5C0X H;  4OIJ A;  4PMW A;  4QIW B;  3K59 A;  1NR2 A;  4XXE A;  3OIQ A;  1EZ6 A;  4PMC A;  5EQ0 A;  1TQO A;  3BDL A;  2WAC A;  3MHB A;  3IKJ A;  5CV8 A;  4PV1 C;  2SNS A;  4FO2 A;  3OWE B;  1F2Y A;  4YIJ A;  5G3L D;  2IW3 A;  2OXP A;  2Z4I A;  4FF2 A;  3EFX D;  1PXU A;  2QDB A;  2RDF A;  4O42 A;  1DYQ A;  5M3M B;  1WTQ A;  1CM9 A;  1B1Z A;  3J7A F;  1EEF D;  3J7Y W;  3O13 A;  3GTQ B;  3M4O B;  2L1B A;  1TWH B;  3NPP A;  3C2P A;  2F0E A;  3I70 A;  1G8Z D;  4LMQ D;  3EA6 A;  3K6O A;  1LTG D;  4X3U A;  4ZUI A;  1EYA A;  4BA2 I;  5E1F A;  1J8I A;  2XNA C;  1LTT D;  3QB3 A;  2NB0 A;  3S1Q B;  1V1O A;  5J22 A;  1II3 A;  3P20 A;  4ZKC B;  3URY A;  3D6W A;  4HED A;  3CQZ B;  1NSN S;  5KND A;  5KNB A;  3X3M A;  1F2M A;  1K8M A;  3C1E A;  3LX0 A;  1DM0 B;  1KLU D;  5DEH A;  1SXT A;  4A3K B;  1D5Z C;  2NUC A;  2A6E C;  5AFW A;  5DAU A;  4G7O C;  3BYY B;  4QF4 A;  1ILP A;  2RKS A;  3SHL A;  3PIO 3;  2IJ0 A;  2A68 D;  3MEH A;  5C44 B;  1MSG A;  4RGT A;  4RGO S;  1VDZ A;  2Q8I B;  1RCV D;  2XN9 C;  3TDQ A;  4IUP A;  3RUZ A;  1WTX A;  3CRK C;  4ZYS A;  1D1K A;  1PMR A;  2CVR A;  1SYB A;  5FO8 B;  1DOK A;  5T1I A;  1V1P A;  2EYL A;  2RVL A;  1MI2 A;  2B2T A;  4XDX A;  4B9X A;  1HRJ A;  2PW7 A;  5M5X B;  3MFY A;  1PTO B;  4A3D B;  4CHT B;  2K1B A;  1JQY D;  4MN3 A;  5IT9 E;  1HUN A;  5LHY 1;  1NR4 A;  3D4W A;  4B9W A;  1TWF B;  1CZW A;  3H91 A;  1DCZ A;  3SVM A;  2NN6 H;  5KGU A;  1BDO A;  3OIP A;  2LS0 1;  2A69 C;  3I3C A;  5M5Y B;  3OMG A;  3EJI A;  4G57 A;  3S14 B;  4OO1 I;  4ZQ3 A;  3VA7 A;  1A3V A;  2L4N A;  1FGB D;  2EPB A;  5CV5 A;  1O80 A;  2ENB A;  1EY7 A;  1KAA A;  3TZD A;  4NP5 A;  2Z8L A;  1Y8N B;  5C3X A;  4DU9 A;  3S2H B;  1I4P A;  3T16 A;  4KN4 C;  5CMD A;  1S5F D;  4GZY C;  3F2U A;  1LTR D;  4QCL A;  3HS0 C;  2NZ1 D;  2WKC A;  5FO9 B;  2D9U A;  4WJW A;  5C0X G;  5LL6 S;  1NCV A;  4BY1 B;  2EY1 A;  1GUN A;  2R6G A;  3VR6 A;  3SXH A;  2J7Z A;  4IUV A;  4G7Z C;  2Z1C A;  2J4X A;  2KCN A;  3VYR A;  1Z7T A;  3DUZ A;  1SYF A;  2M9V A;  1EY0 A;  2HQE A;  4HAE A;  3BG3 A;  3GV3 A;  1BOS A;  1BR9 A;  2EVB A;  3C46 A;  1EIH A;  1SYE A;  2MHV A;  2FMC A;  1PZK D;  4OHJ A;  4Q0F A;  5A2Q L;  1ICW A;  1H9S A;  1ENC A;  2ZXP A;  3KK7 A;  1OXS C;  4IZ8 A;  2XRS D;  4IUQ A;  1PRT F;  2IX3 A;  3T4A C;  3ITP A;  2MP1 A;  2B2V A;  4NKL A;  1AFP A;  2C5C A;  4CJ1 B;  3RD4 A;  1PFN A;  1SE4 A;  1KTK A;  5K5P A;  3A8I E;  4M8A A;  5I9P A;  2NVT B;  1PLF A;  3E6Z X;  1GOZ A;  4ME5 A;  1RDP D;  1UEA B;  3T56 B;  3X3N A;  2QF7 A;  4NW2 A;  2OT2 A;  3HP3 A;  3LNN A;  1Y69 U;  3NQT A;  2EYH A;  2XRQ D;  2AWO A;  3PUX A;  5CBA E;  1TU2 B;  3NBI A;  4L6T B;  1PRT B;  1E2V A;  3RZO B;  3S1M B;  5KYI A;  1SNP A;  3TSS A;  2FJ2 A;  1A6X A;  1CK1 A;  3R2T A;  1RTN A;  1ZYR C;  1PYW D;  2NWG A;  1SNO A;  1F9S A;  2XIW A;  2CHB D;  3L3O C;  4HSV A;  1SYD A;  1CA5 A;  2R93 B;  4PMB A;  1G91 A;  4KY5 A;  4KN7 C;  5I9O A;  3CHB D;  3OWF A;  4QMG A;  1TR5 A;  2EYO A;  1I4R A;  4BS9 A;  4FVM A;  1GUO A;  4C3I B;  2RQX A;  1RHP A;  2L0C A;  5EGT A;  3K5N A;  4TKO B;  3I73 A;  1E0B A;  3Q6S A;  3FDT A;  1QG7 A;  5ELE A;  1PRT C;  1A2U A;  1PRT D;  2VB3 X;  2SDF A;  2O5J C;  1KDA A;  5A35 A;  4F88 A;  2WP8 J;  4ZAI A;  5D3D A;  1PTO F;  4RKB A;  2DY8 A;  1Y8P B;  1YNN C;  3BVZ A;  1QE6 A;  2LMC B;  4RAU C;  3VA5 A;  1UUP A;  1KNE A;  1IW7 D;  1LTB D;  1I4Q A;  1H9R A;  4UDU C;  3ERQ A;  2A6E D;  2NN6 G;  3FVQ A;  5ELC A;  4L8J A;  1H9K A;  4KTA A;  5T1G A;  5CV7 A;  2SOB A;  4OIK A;  1PTO C;  3VR5 A;  2K28 A;  1TS4 A;  2H1E A;  3P7J A;  4RFB A;  1U4P A;  5FLX E;  5JPN C;  2KOL A;  1HA6 A;  1AZP A;  4A3G B;  3SK4 A;  1HFG A;  2B2W A;  3FKI B;  1F9R A;  1EWH A;  5JVG 3;  1K83 B;  5JPM C;  1S5C D;  4TSS A;  4RCO A;  2EOT A;  1TII D;  1DJR D;  5CV4 A;  5ISR A;  1PDQ A;  1AEX A;  3RMH A;  1IKM A;  3LWU A;  3UI2 A;  2PO4 A;  3TP5 A;  1TS3 A;  4KKT A;  5JAV A;  2DY7 A;  4EQP A;  1B2T A;  4DGZ A;  4U67 3;  2HUG A;  3NXW A;  5JJZ A;  1HA5 A;  3G7L A;  1I50 B;  5CBE E;  2N88 A;  1Y1W B;  1W6J A;  2K7V A;  1VF7 A;  5EKK A;  3GTM B;  2WB1 B;  1U4L A;  3U9O A;  2SEB D;  2PZU A;  5D65 A;  3WOF A;  3DWA A;  4FXD A;  3FPU B;  2FIN B;  5J39 A;  4OO1 G;  4A93 B;  4BWG B;  1SNM A;  2IX0 A;  2AQ1 B;  2EY2 A;  1WD0 A;  4QUC A;  1WTO A;  2NVQ B;  2F03 A;  2QEJ C;  3I4M B;  3IAY A;  3C1F A;  2M2L A;  1BCP F;  1STE A;  3K5O A;  4X3T A;  2F0J A;  1LV9 A;  2EYF A;  4WFN 3;  2O2L D;  2A69 D;  1EQV A;  3QO2 A;  5D3I B;  3ND9 A;  2PQE A;  1EY4 A;  1PTO D;  2R3Z A;  3H6M A;  5G3L F;  1LT6 D;  2CW0 D;  1SYG A;  2BOS A;  2DN8 A;  4IFD I;  3J81 L;  4NDX A;  1WTW A;  2EYJ A;  2HCC A;  3TBI B;  1CT1 D;  3SK5 A;  1ZEQ X;  3ND8 A;  1OO9 B;  4K6D A;  3NTI A;  4CKC A;  3JAM L;  2KEC A;  1B9M A;  1STH A;  4QB4 A;  2Z4H A;  4A3E B;  3NWS A;  4DAY A;  4XT1 B;  2JP1 A;  2WIN B;  1MSH A;  4WOR A;  4FNF A;  1M4V A;  1SFO B;  3QIA A;  2KHS A;  3GQB A;  5IGE A;  3GO5 A;  4S3S A;  1WCM B;  2F4I A;  1Y1V B;  5FO7 B;  1STY A;  4Q5V A;  1LTS D;  1MD2 D;  4R9W A;  1HXY D;  1R4Q B;  1E2Z A;  4LAA A;  2BA0 A;  1ROD A;  1HTP A;  4KD4 A;  1LLR D;  1BBX C;  2PMZ B;  2K03 A;  2X6L A;  2K33 A;  3GD7 A;  5LL6 X;  1BNZ A;  1OXX K;  2E2D C;  4K5V A;  1D6E C;  1SAP A;  3TP8 A;  3A8K E;  3DM1 A;  2G9D A;  3D4D A;  3ONA B;  1WD1 A;  2CW0 C;  3GTK B;  1CHQ D;  2JYO A;  1Q1E A;  1O7L A;  3H0G B;  3N52 A;  2ICE C;  3L9A X;  2F3W A;  1RJT A;  1J9O A;  1TT2 A;  3MVV A;  1TWA B;  4ZKB B;  3BZD B;  2F0S A;  5EPK A;  2PNR C;  2JSO A;  3T13 A;  3P1H A;  5IOD A;  5A2Q E;  1S5E D;  2B2Y A;  3U9S A;  3J80 L;  1CA6 A;  3MC0 B;  4E6I A;  3QOJ A;  1CZG A;  3R8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...