3HEJA

Crystal structure of staphylococcal nuclease variant delta+phs t62r at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
135
structure length
135
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFRKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Domain swapping promoted by a single mutation that introduces an ionizable group into the hydrophobic core of a protein
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 135
sequence length 135
chains with identical sequence B, C, D
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2009-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3hejA00
3BDCA 1EY4A 4EQPA 4EQOA 2F0TA 5IODA 2EYLA 2EY6A 4G57A 1RKNA 5IGDA 1EYCA 5EKLA 5M9OA 4N9PA 3TP6A 2WACA 1ENAA 5IGGA 2F0MA 3HZXA 3MXPA 4MIUA 2PW5A 5CV5A 4YIJA 4DF7A 2LKVA 3D4DA 5KYLA 3DHQA 4TRDA 1STYA 1SYFA 1SNQA 1A2TA 2F0KA 1STAA 2EXZA 4K6DA 5CC4A 5KRUA 1SYBA 1A3TA 2F0SA 3TP7A 1TR5A 1SYGA 3VA5A 5KIXA 2PYKA 1EZ6A 1EY5A 5HURA 5IOCA 3DMUA 3NUCA 4KD3A 4KJOA 4H7BA 4KV6A 5IGCA 2O4XA 1TT2A 3HEJA 3NXWA 3P1HA 2F0EA 2F0IA 4PNYA 2F0JA 3LX0A 1SYEA 5CR3A 2M00A 3SXHA 2F0OA 2RKSA 4ODGA 2PZTA 2F0LA 4RKLA 3MEHA 1JOQA 2OEOA 3TP5A 4HMIA 5JAVA 1F2ZA 2EYPA 2NUCA 3MHBA 4KTAA 1IHZA 4F8MA 1EY0A 1KDCA 4WORA 2F3VA 2OXPA 3NK9A 1SNOA 2F0VA 3EVQA 1A2UA 3H6MA 5C3XA 1KABA 1TQOA 1SYCA 3E5SA 2EYJA 5I9PA 1SNCA 2RBMA 3ITPA 3D8GA 4EQNA 2F0QA 4KY6A 1SNMA 1NSNS 1EY8A 4QMGA 2EYMA 3OMCA 3MZ5A 3EROA 3SK5A 2F0UA 4N9TA 1KDBA 3QB3A 4S3SA 5CV7A 3T13A 4DU9A 5IGBA 3BDLA 3SK4A 1JOKA 4DGZA 3SK8A 5J22A 1ENCA 2F0NA 4RKBA 4DFAA 2PZWA 3U9OA 5IIFA 2KQ3A 1EY6A 1STNA 2EY2A 2F0DA 2F3WA 3NHHA 3P75A 4J1MA 2EYFA 3R3OA 3OMGA 3QOJA 5KYIA 4K8JA 4KJNA 3EJIA 5HGTA 1JOOA 4ZUIA 1STGA 4ZUJA 4KY7A 2QDBA 5C4HA 5I9OA 2EYOA 5IGFA 3S9WA 4K8IA 4NDXA 2OF1A 4J6HA 5IGEA 5C4ZA 3MVVA 1KAAA 4OL7A 1EZ8A 1EYAA 4KY5A 5I6YA 4EVOA 1JORA 4NP5A 1U9RA 3TMEA 3NQTA 4K5WA 1SNDA 1A3VA 4E6IA 4K2KA 2EYHA 1NUCA 4I65A 5K5PA 2F0FA 1SNPA 2HQEA 4HTHA 1F2YA 4K5XA 5KGUA 5CV9A 2PZUA 4IZ8A 2F0WA 4NKLA 3TP8A 3SK6A 5C5LA 1A3UA 5J1ZA 2F0GA 3QOLA 2SNMA 4IUNA 2F0HA 5E1FA 1SYDA 1F2MA 4ID6A 3OSOA 5EGTA 5NUCA 4QF4A 4K2LA 3PMFA 5KEEA 4PMCA 5EKKA 3RUZA 5E3FA 3SR1A 4ZQ3A 4WRDA 4B9WA 5J39A 4F7XA 1EYDA 4K5VA 1II3A 4KHVA 5F2DA 5DEHA 2F0PA 2EY1A 1EY7A 3V2TA 4IALA 2EY5A 1EY9A 4QB4A 1STBA 4KD4A 4LAAA 3OWFA 1KDAA 2ENBA 1STHA 3C1EA 3D6CA 1EQVA 4HMJA 5CV8A 5JOBA 5C3WA 5ISRA 2RDFA 5I6WA 3D4WA 5CV6A 5C5MA 2PW7A 3C1FA 4K14A 1AEXA 4PMBA 3SHLA 5CGKA 5DAUA 2SNSA 3NP8A 3ERQA 5C6AA 2SOBA 5CV4A 4ME5A 4R8NA 4NMZA 2PQEA 3T16A 2KHSA 4B9XA
chains in the Genus database with same CATH superfamily
2K5HA 5M9OA 4JBWA 3I2ZA 4B3SL 4JVZA 1B3QA 2XVSA 1SE3A 3H0GG 2XN9C 2UUAL 1SNQA 4JI6Q 5FKAC 5IYBH 2QF7A 1IKMA 1E1TA 1V43A 3E6ZX 3NSWA 5KIXA 4LJZC 5EKIA 1TXYA 1EY5A 4C3IH 2EZVA 4H7BA 3ER0A 3NWSA 1XMOQ 4TSSA 1HJPA 3GTQH 3I8ZA 4P72A 1SYEA 2XGTA 1NNXA 2EQSA 2NVYB 3MXNB 1SRUA 2BOSA 1BBUA 4RFBA 1MSHA 2G5DA 4DK3C 1KDCA 4X64Q 1WCMH 1SNOA 4JBKA 1RTNA 1LYLA 3OPOA 3S2HB 3H3VI 3Q6SA 1B2TA 1CKNB 4A76A 1QNUA 4KY6A 1XPRA 3NE5B 5CV7A 2MHVA 3HOXG 1V1OA 3I70A 1HFNA 1UUPA 1HUMA 1IW7D 1CQFA 3J7AF 4DV0L 4J1MA 1XPUA 1JWMD 5CYUA 2HCCA 2IX3A 4KJNA 5T1IA 1JOOA 1PZJD 1STGA 4KY7A 1H9SB 1H9KA 1GOZA 1UNSA 3DWQA 5M5XH 2QA4A 1DM0B 4A3GH 1YIJA 1SNDA 1A3VA 5IY0A 4G4KA 4M8AA 2F0FA 1E24A 2IW3A 4CHTB 4AIMA 1EIYB 2K03A 2B8GA 4NKLA 5IOCA 2J7ZA 2R7DA 4P75A 1UEAB 1X9NA 3H0GH 1AE3A 4XQJA 3PV0A 1XNQL 5C0XI 3T1HL 4F7XA 1X65A 1KXLA 4L63B 1K3RA 3MTSA 2IX0A 3I4LA 3QIAA 3EBEA 4KD4A 4CJ2C 3I4MB 3KBGA 4LF8L 3HOUG 4IFDI 4DXGA 3CAMA 5E7NA 3W2DA 2E2HH 3HP3A 3BDOA 3DWPA 2HDLA 3J81E 2B8FA 3CC2A 1HZBA 2BA1A 4IUPA 4IPDA 4DN4M 5AJ3L 4CJ1B 4AYBE 4NPSA 4PZ8A 2EYLA 5IGDA 1RKNA 4R9WA 1F9RA 4BXXG 4N9PA 5CMDA 4GLXA 5DNFA 2ZJQA 4IQZA 2OWOA 2LKVA 1HA5A 2IHEA 4TRDA 1YNJD 1SYGA 1EZ6A 1KRSA 2H1EA 5IT9c 1J8IA 3CC7A 1RD9D 4LFCQ 2Z6KC 4YWKA 4R1JA 1TY0A 3PIOA 4B3MQ 4DNTB 1IYJB 1TWAB 3D6WA 1QZGA 4F8MA 1X6OA 3CU7A 1E1OA 4L8JA 2E2IB 1PRTF 1CFMA 2YV5A 1EOTA 1Y1WG 1MI2A 4A3KH 5I9PA 1XMQQ 2IT1A 4LF4L 1JE4A 4PZ7A 3D8GA 1K8MA 3TZUA 1HUNA 2KCNA 1Y1VG 2VUMB 4JI3Q 2EY2A 2F0DA 2CKZB 2DGYA 5KYIA 2IHFA 4QIWB 5C3EG 3HOUH 1HZCA 2EYOA 3HS0C 4AH6A 3MVVA 1SEBD 1CSPA 2N55A 2L55A 3RN5A 1JORA 4UPAA 2LS01 3KYHC 4EX5A 4E6IA 4K2KA 3AMUA 1HQRD 3CXCA 1C9OA 4BXXH 1VDZA 3HOVB 3QG1A 3A8IE 2ZM6Q 4ID6A 4CJ0B 3AFQA 4PMCA 5GAGC 4QJFA 5D14A 2SDFA 1L0YB 4JI2L 4JYAL 3GTJH 1EY7A 1WVLA 2NVTB 1G6ZA 2Y0SB 4A3BB 5EBCA 5ISRA 2ZJRA 4DV2L 1VQCA 1HNWL 5I6WA 1K83B 1RIPA 3ULJA 4X3SA 3SVMA 2NTSA 3C1FA 4OX9Q 4DR2Q 2HDMA 2UXDL 3T16A 5EPKA 4QUFA 4EQPA 4YCWA 3L9AX 4LFBQ 3GTLH 2LY7A 3G7LA 5COYA 2E2JB 4KN4C 4WJWA 5LL6S 3A5ZB 3H91A 2WINB 1WTOA 1RL2A 3CW2C 1VQMA 1D1IA 1G2TA 3S1QH 2F0KA 4C3JH 3OOCA 1D2BA 4B3SQ 3ERSX 4ME3A 1BBXC 5C3EH 3S1NH 1BDOA 2UUAQ 3NXWA 1VQ6A 2KHJA 2ASBA 3G4SA 4RKLA 2MGSA 1EIHA 4HMIA 4XDXA 1I94L 1EY0A 3SGIA 3K5NA 4BWGB 4C1NK 1PH3A 3H6MA 1TQOA 1SYCA 4QUCA 1C7YA 3OMCA 3EROA 4XT3B 2R7ZG 1V9PA 1I50H 1ET9A 1LM0A 4XQNA 3DLLA 5CORA 1OO9B 2B2UC 1LV9A 4LF7L 4RGNA 1CSQA 2VXWA 2EYFA 4JK1C 4KKSA 1QZHA 1LT4D 1VQEA 3K0XA 4DAMA 4IUVA 3PUXA 4HEDA 1Y8OB 4IOAA 3CCSA 2UUCL 4C3HG 3GTKB 4DV0Q 1NE3A 4FO2A 2F03A 3GTOB 4DR6L 4K5WA 4O1NA 4FF2A 1N32L 4I65A 4LF5L 3E9HA 1PFBA 2LXJA 4JI8L 3J7AV 1LTBD 1S5DD 1S5BD 4KMUC 3TP8A 1UAPA 4LF6L 2A68C 3PIP3 1HR0W 4R4IA 4PG3A 3BZDB 4DV5L 2QDLA 2WIIB 2ZXRA 1WTQA 1EYDA 1ZEQX 2M2LA 4N8FA 2IPKD 2MO0A 1PTOD 1LABA 4LAAA 1IBKL 4DV6Q 3J81j 2Q8RE 2P5ZX 1XNQQ 4DK1A 3T1HQ 1K8OA 1TIID 3J80i 2GA4B 1I3QB 1AE2A 4GNXC 4DR1L 3GDEA 3IFTA 2KEDA 1IL8A 2VQFL 1KQSA 3S2DH 5FK9C 4LF8Q 1VQBA 5C4XH 3GV3A 1B9MA 3T56B 1EYCA 4AQYL 3TP6A 1M90C 2C9OA 2R7ZH 3U4VA 3K8AA 3UE1A 1K28A 1WI5A 5AJ3Q 2RCFA 1Q81C 1CKOA 5KYLA 3FDTA 1X56A 3A74A 2UUBL 1C0AA 1TKWB 1FGBD 2B29A 1RJTA 3DMUA 4A4IA 2K33A 1Q8KA 4DR7L 4C3HH 2JEBI 1FJGL 4U68A 2M00A 4AYBG 1KLUD 2D2CC 2FJ2A 5CBEE 2R61A 3BVGA 3MFYA 3VR2A 4HAEA 3W1GA 1IZ6A 4LFAL 4C2MB 3CHBD 4UHVA 1KABA 3A8KE 2L4NA 3GO5A 3MZ5A 1WTVA 2YYZA 3RZOB 2IJ0A 4DGZA 4LF4Q 1PA6A 4DFAA 4A3FH 3OWEB 3S16B 4FXDA 4I7AA 3KLSA 2ICEC 1PRTB 1R9TB 1ML0D 5FLXc 2D0PA 2B2VC 2WFWA 2K4KA 4UP7A 3A8JE 3S9WA 3TS0A 3TSSA 3TBIB 3AQQA 2KCTA 3HGBA 1PH8A 3ND8A 1BO0A 1JE5A 3VYUA 4ZYSA 2N8NA 4X3KA 2YU9H 2F1MA 1DJRD 2DUDA 1JWUD 3OTOL 4RGMA 3LGJA 5CV9A 4FF4A 2B2WC 3S1RH 4HJ8A 4A3IB 1PFMA 4Y7NB 2VZAA 2F0GA 3FEWX 3LNNA 1V1PA 1CT1D 3K6OA 1EWIA 1AP0A 2EJFC 5IP7G 1ET6A 1F9SA 4KHVA 1WD0A 5DEHA 2KENA 1RDPD 4RH6A 1QE6A 3OWFA 1STHA 2NBFA 1HHVA 1STEA 4JI2Q 4JYAQ 1Q1BA 2V1CC 5JJLA 3I4OA 4DV2Q 1BKBA 2UU9L 1BR9A 1HNWQ 2F0TA 1YHQA 2ES2A 2SEBD 2JA6H 1LO5D 1LTRD 1TS3A 2F0MA 2Z6BA 1R4QB 2PW5A 3T4AC 3K81C 4R4QA 1OTCA 2UXDQ 3D4DA 2DNEA 3KOJA 4ZCKA 3HOYG 2VY3A 1BCPF 4KKUA 3NBHA 2R6GA 1AN8A 4BY1H 1TS5A 2KBNA 3FRPB 3TP7A 2Q2UA 4FVMA 1EQRA 2CW0C 2E76C 3I56A 3M4QA 3S15H 4BS9A 5CR3A 4NXNL 5DLQE 3S17B 4L5RC 5M3MB 1PTOH 1IHZA 4NB3A 1EEID 5JEAJ 2E8GA 2I46A 2A69D 3V96A 1I94Q 3CC4A 1SE4A 5AFWA 4DUZL 2Z8LA 4S3SA 3T13A 4DR4L 1NY4A 2VB3X 1IBLL 5TSSA 2QILA 1VF5C 2K32A 4A93B 1SROA 1GUNA 3LWUA 5G3LD 3JAMi 5C44B 4HJ7A 3OYYA 5IP9G 1U4LA 5EJWA 2VL6A 5LHY1 1STNA 4JI1L 1E3PA 3I4NH 1Z9FA 2HCIA 5C4ZA 4LF7Q 1HH2P 5M3FH 4HSVA 2JA7B 2Q8IB 2M9VA 4GKJL 5ELBA 3HOWG 3K5OA 5K5PA 4XXEA 2JA5B 3KUPA 2UUCQ 5KGUA 1JJCB 4OONA 1IYUA 1A3UA 3I4MG 2SNMA 3ZYYX 4DR6Q 2R93B 1J6QA 3OSOA 3RZDB 1N32Q 3HOYH 4LF5Q 2QEJC 5EKKA 4JI8Q 2O5JC 4BBRG 5BN5A 3FKIB 5M5WB 3N6RA 4LF6Q 2C35B 1PHJA 4GLVB 2TSSA 1F9PA 2R92H 2JA8B 4DV5Q 3KF6A 2OTLA 1EL0A 1N36L 2MO1A 4BY7B 2D9UA 2I5HA 3VR6A 3KJPA 1IBKQ 2K04A 1E2WA 3K59A 4ME5A 4P73A 4NMZA 2FHTA 3CQZB 1SBBB 2JJQA 4DR1Q 4A75A 3KLWA 1VQ7A 1E22A 5GAHC 2VQFQ 4FDBA 4ZLTF 3HZXA 4MIUA 3GTMB 1OXTA 3A0JA 2N3SA 4DR3L 3PUWA 2D5DA 4BY1B 3QWNA 4AQYQ 1PH9A 2F0SA 3UI2A 2NVXH 1VF7A 4V190 2Z1CA 1C8CA 1QOHA 2H4OA 1JC7A 3FP9A 1HCZA 1TT2A 1UWVA 1EIGA 2HQLA 3PCOB 3I7FA 4B3RL 4R4OA 2CCZA 2RKSA 2JP1A 3TDQA 1XXGA 2VUMG 3HOWH 4I7ZC 3S1MB 2B63H 2JK8A 2F3VA 3CCMA 5JVG3 4DR7Q 1FJGQ 3DEPA 2GVAA 5I2XA 1D6EC 2L12A 1V1PB 2L1BA 3KLRA 1CK1A 2F0QA 5GQOA 1GUGA 2KECA 1I4QA 4LUOA 4MN3A 4LFAQ 2MQHA 2RSNA 4BBRH 5J22A 4RA8A 4GNXA 3QO2A 4IJLA 2YTYA 1L1OA 4LK1C 1EY6A 5IGCA 4HJ5A 2A6HD 5LMNQ 3NQIA 3HOVG 3LWEA 5JPNC 4NDXA 1QB5D 5M3FB 5GAEC 1GKHA 3F2UA 1N33L 4OL7A 4KY5A 4CBVA 3VDYA 3HOZB 4OWTB 1S5FD 1D1KA 1Q8IA 3NQTA 3IKJA 1B70B 1F2LA 3S14B 4FXKC 5HY6A 5JEAG 2GVBA 4IJHA 4A3BG 4JBJA 2CH4W 3NBHB 3OTOQ 4OGQC 1VQPA 4A3MG 4MNOA 3SR1A 3X3MA 4PV1C 4GOPC 1T5EA 1YITA 1MBYA 4L5SA 4IALA 5KNDA 2TMPA 3M4OB 1BXTA 2PI2E 3CRLC 3NBIA 1L0XB 5M5YB 2I5MX 4DPGA 4DV4L 4PMBA 3PUVA 1VQFA 2SNSA 1PVOA 1Q3LA 1B3AA 2CW0D 4JCVE 2DNCA 3BU2A 2EY6A 4G57A 3CMEA 4IOCA 4A3JB 4BBSB 2CWAA 3MFGA 3OW2A 3AU7A 5CV5A 4YIJA 3C46A 1WYDA 3PO2G 2UU9Q 2N78A 1WTWA 2B2VA 1K73C 3F1ZA 1PH7A 3CCVA 3CCLA 4CKEA 2K5WA 1SLJA 3BJUA 2QKIC 5I2YA 4IPHA 2F0JA 4NW2A 3WOEA 3IL8A 1EIFA 2B2WA 1Q12A 2PCFB 2WKCA 4FYDA 1KL9A 1KTKA 1PH6A 1BCPB 1TS2A 4QQBX 3EIVA 3TS2A 1LLRD 3E3XA 1A2UA 4O0AA 3HOXH 2ZJPA 1PTOC 4NXNQ 3HFZB 1CZGA 2CHBD 4IO9A 1WD1A 2A8VA 3F2BA 4DUYL 1VQAA 4DU9A 4C3IB 1V1QA 1ZXTA 4A3MH 4TQUS 2K7VA 3HKZB 3GTQB 1IXRA 2GN5A 3JAML 1A6XA 1FD7D 2F3WA 4DUZQ 4DR4Q 3QOJA 3KF6B 1IBLQ 1WJJA 1ICFB 2VNUD 2EPBA 5JJKA 1WCMB 2NZOA 2EJMA 2JEAI 4JI1Q 3PIPA 3NENA 4ALPA 4J8QA 2KJXA 1VQ4A 1U4MA 3ULPA 2I0QA 2I07B 2KVMA 2NZ1D 2HQEA 3EQLC 1IBML 2K52A 3ULLA 1EWHA 4IZ8A 3PGZA 5EPLA 2A6EC 1IKLA 5C0XJ 4GKJQ 3PO2H 4JOIA 3QR8A 4YWLA 3MXUA 2K14A 3U58A 3V05A 3BZKA 4WRDA 4B9WA 5J39A 1JMCA 2C5CA 4X65L 2BDOA 1L0WA 1DOMA 2JYOA 4IFDJ 4DAYA 2PQAA 2DY8A 5M5XB 3PF5A 3P20A 3C1EA 4A3GB 1X3GA 4OELB 2HT1A 1SAPA 3GTGH 1K0RA 2NB0A 4JBMA 4YHHL 2WV6D 4OEMB 4X6AH 2OQKA 1HQMC 4PZ6A 2ZXOA 2PQEA 4B9XA 3H0GB 1VMPA 2Z9HA 1N36Q 4YCVA 3L0OA 5EKLA 1ENAA 4H13C 3KFUA 4OWWB 4CDEC 4FF3A 2UXBL 2CWPA 4GNXB 1DONA 4G7HC 1L1OB 1HTPA 1STAA 5IYDG 1PYSB 2A5HA 4HIMA 4JG2A 4ABNA 1K0SA 2E2HB 1D7QA 3AFPA 3URYA 4DR3Q 1RODA 5ELOA 4KHPL 2O4XA 1I4PA 1HR0L 2NN6G 1PZID 2AHOB 5GADC 1RHPA 1AW7A 2PZTA 4KK7A 1M8AA 2OEOA 1Y1WH 3MHBA 3WWVA 1T5XD 4OIKA 1ZKOA 3H15A 1Y1VH 2CVRA 4B3RQ 1XJVA 1SR3A 2K28A 1FNVA 2RBMA 2G9HD 1X3FA 4GLAC 2F0UA 1LT5D 3SK4A 3VYRA 1HPCA 4CDDC 2WP8J 4JI5L 4FXGC 1D5ZC 2E2DC 2OTJA 4O42A 3SDZA 4KN7C 1S4ZA 3R2TA 2X6LA 1PH5A 4A3IG 3KF8A 1LT6D 2KOLA 4HN7A 2HIVA 4FF1A 4DA2A 4A3KB 3R2IA 2YTVA 1N9WA 2A1AA 4N8X1 1DYQA 1SNPA 1N33Q 1TWFH 4UY8C 2PZUA 1ASYA 1A63A 4MHEA 1GJXA 3KK7A 1S5ED 3W3AA 2HHHL 3M4YA 5A2QL 4JI0L 3PMFA 2BCOA 3A56A 2PMZB 2XWBB 1UE1A 3HOUB 4WFN3 1II3A 5F2DA 1SFOH 4IN3A 5D3IB 5K36G 1SE2A 4QB4A 2A69C 2B2YC 2DJFC 2NN6H 1KDAA 3DEOA 1CHPD 3TQYA 3IRBA 1PFSA 3K58A 5LL6X 1J5EL 2IY5B 1KHIA 4DR5L 1E0BA 2NVQH 3M3YH 1X3EA 3E9IA 3K7UC 2EJGC 2AWNA 4DAPA 1EY4A 1CM9A 3J81i 1K8GA 4DV4Q 1AZPA 1LTID 3TN2A 1X54A 3H09A 1BNZA 3SEBA 3GTJB 1YZ6A 5LMUL 1CA6A 3DHQA 3I3CA 5C4JH 5M3MG 1KLGD 5CC4A 3E0EA 2B2TC 4LUVA 4A3EG 5DM63 3NUCA 5ELDA 1GHKA 1G291 2B39A 2L9HA 4DXFA 1Y1WB 1H95A 3GTLB 1EU3A 3TREA 3UDIA 3PF4A 2J0TD 3NWTA 3RR5A 1H9JA 2F0VA 5ELCA 5C3XA 1PTOF 2JSOA 2K6AA 4HCEA 4GOPA 2ZXPA 3S1QB 5IWAL 4C3JB 3D31A 5FJ8G 4K0KL 4QIWE 4DV3L 2LSSA 5C3EB 1YJNA 3PO3G 3S1NB 2JA7G 1KIXA 2ID0A 5BN4A 2F0NA 1H9RA 4DAYB 1VQLA 2PQAB 1EU4A 2A6ED 4DUYQ 5K36H 2KQ3A 4X3TA 1KC8C 2JA5G 5FO7B 1EFID 2UXCL 1GD7A 1U0LA 4Y52H 3MA2B 2OF1A 4DNIA 4A3DG 4HR7B 1FGUA 1EZ8A 1GM5A 2XTIA 4YY3L 4HJAA 3D4RA 5L37A 1KRTA 1VQ8A 4UDUC 1TWFB 1I50B 1RF2D 2CH4A 4ZAIA 1N34L 1SXTA 3EN2A 4KKTA 2KA7A 1BOSA 2Y0SE 2F0HA 1S72A 1F2MA 5J3BA 4MTNA 5NUCA 4K2LA 3Q24A 1JR0D 1IBMQ 1J9OA 4ZKBB 5H1SE 4DV1L 2V4DA 3NTKA 4H02A 1LTSD 2CFMA 4A3EH 1F77A 2F0PA 3M4PA 3V2TA 3CPWA 1Z47A 1NTGA 3F2DA 1I6HH 1HXYD 3K7AH 4HSPA 3FMCA 4X65Q 2PW7A 3PUZA 5CGKA 1U4RA 2FMCA 2RDHA 4A3GG 1VQ9A 2LFNA 5C6AA 1TVXA 1I5FA 1DOLA 4P71A 1WFQA 3WOFA 3BVMA 2A6HC 1QG7A 4DK0A 5FJ8H 4YHHQ 2Z6KA 1BF4A 3ND9A 1TWGH 3PO3H 3NTHA 4EQ5A 4ULLA 2CQAA 3DUZA 3H94A 1TR5A 1G2SA 4LF9L 1Y8PB 4X3UA 2UXBQ 4G7OC 3KF8B 3P1HA 4C56C 2B3GA 2RQXA 2F0IA 1TWCH 4PNYA 3GQBA 4A3DH 3S2DB 1SSOA 3Q22A 4X62L 4QCLA 5C4XB 3CCJA 1JOQA 5FO8B 4OO1G 4KHPQ 2R7ZB 1HR0Q 1YVCA 5D3DA 3NK9A 5DM73 1PH4A 2KCMA 1GHJA 1W6JA 4RAUC 1ZYRC 1GUTA 1X32A 1DGSA 1AZQA 1BUVT 3JC66 2ZTCA 5A2QE 3CPFA 1JOKA 3BVZA 4B08A 1EOVA 3CCEA 4C3HB 5IYCG 4BA1I 3Q8DA 1KNEA 2BH8A 2FXQA 3NPPA 4JI5Q 4IURA 2O5IC 3CCUA 1ILPA 2KUMA 3NTIA 2EYHA 5JPMC 3MAQA 3G48A 2MPMA 5IP7H 5LMNW 1LT3D 3CKIB 3QOLA 4A3FB 1SYDA 3L3OC 2AUKA 1MSGA 2A19A 2OT2A 2RSOA 4HCSA 3BG3A 3KDFA 4IUTA 2QEXA 1Q1EA 4UP8A 3J7ZC 2HHHQ 4JI0Q 1VQOA 1STBA 4HMJA 4MZ9A 1EQVA 4BBSG 4H44C 2YU9B 2DY7A 3D4WA 2BE5D 1BQQT 4OO1H 3S1RB 5ELFA 4X66L 5G3LF 4CGYB 2SOBA 4LMQD 4GOPB 1K8AC 2XRQD 4IPGA 4QGUA 2IX1A 1LTLA 2AMCB 1JICA 2NVYH 3J81L 5IODA 1J5EQ 4DR5Q 1K3BC 3U4ZA 1YEZA 1XX8A 3OIQA 2HUGA 3MXPA 4DK6C 1VQ5A 4ILWA 3S2HH 3K5LA 4AYBB 3OHXC 5EAYA 3J80L 5HURA 1TWHH 5LMUQ 4KJOA 1Y69U 3T53B 2K75A 1S3OA 5IYBG 1AFPA 1XWEA 4C1NI 4HIOA 1TS4A 2BA0A 2F0OA 1FNUA 2F0LA 4C3IG 1JQYD 1F2ZA 2JA6B 1NMFA 2Z4HA 2B2UA 4WORA 3DM1A 2OXPA 1HA6A 4OXPA 2QCPX 1SMYD 2EYJA 5IP9H 1JB7A 1WTXA 1Q90A 4XTCS 4U673 1RCVD 1KDBA 1WCMG 3NELA 3BDLA 5EPJA 4M1UB 2L0CA 3D0FA 1ENCA 5IWAQ 3S15B 3QJYA 3W5OA 2UUBQ 4K0KQ 3P75A 4DV3Q 3UDGA 1SN8A 1PTOB 4XQQA 3EJIA 1NR4A 1MJEA 2OQ0A 3U50C 3OW7A 1OXVA 1KAAA 1N8RC 2NN6I 3I4MH 2UXCQ 2RA4A 3AYHB 2B2TA 2JN4A 4YY3Q 4P2CB 1XNRL 2HD3A 2VQEL 5EGTA 1SJED 3TEHB 2YTXA 4DNRB 4J15A 1GUOA 1N34Q 2E5LL 3I4NB 2Q2HA 3KLSX 3AEVA 1MIUA 4OIJA 4K5VA 1KD1C 2A74C 2EXDA 2EY5A 2AQ2B 1B1ZA 4DV1Q 1O7IA 5CBAE 1I4XA 2NWGA 1Z6HA 1HZ9A 3VA7A 5CV6A 3EFXD 4K14A 1UE5A 1G8ZD 1C4QA 4UP9A 2WB1B 2K01A 2Y0SG 4H0LC 1CA5A 3HOYB 2F52A 3RN2A 1TWAH 3S24A 2WACA 1JJGA 4K6LA 1YHAA 3HRZC 2E2IH 2R92B 2F3IA 4RGOS 1ZYRD 4JV5L 1TWHB 2PYKA 3UDXA 1PXUA 3N52A 3RD4A 3CP0A 2VUMH 1RTOA 3T51B 3K0YA 3EA6A 3FVQA 2PNHA 1P8LA 2JQOA 3SE0A 3VYTA 1D5MC 4LF9Q 1FNWA 3J7YW 2LXKA 3J7A5 4DV7L 2EYPA 3FPPA 3BYTB 2MJ8A 4RWSC 4L5QA 3EVQA 2RVLA 1VQDA 4X62Q 1G51A 3E5SA 5IT9L 3ITPA 2N49A 3BYYB 4FP5D 3SK5A 2NVXB 3I55A 1GVPA 4N9TA 5FLMG 5IGBA 3KDFB 4IUQA 3A5UA 4RKBA 4A3KG 4JI7L 3HOVH 1YJ9A 1GO3E 4LWCA 3A7LA 4DAVA 4R4TA 2HIXA 3Q0AA 2PPBC 2BDNA 1KAWA 4DV6L 3X3NA 3R3OA 1G6PA 5HGTA 3HOWB 2XIWA 4YWMA 2B63B 4JW0A 1MGSA 2EVBA 1YNNC 1OXUA 5A35A 2NVTH 5JEAH 4A3BH 2K50A 3MC0B 2FMMA 2PO4A 4WJ4A 1K83H 1A0IA 4BBRB 3F8TA 4XIGS 2F0WA 4DKAC 3SK6A 1LTTD 1VQKA 5J1ZA 2KEEA 3K80C 2EOTA 3T1YL 1D5XC 1E2ZA 4PMWA 2E75C 1S40A 3RUZA 1LTAD 4NXML 1DZ1A 2JE6I 1NCVA 2PNRC 2WAQB 2E2JH 2XRSD 3D3RA 2EY1A 1PRTD 3J80E 1VQJA 1CUKA 1EQTA 1BVSA 2MUYA 2AUJD 1UE6A 2RDFA 3U9SA 5C5MA 3MXGA 4RG1A 4R8NA 1TY2A 1EEFD 3C2PA 1QVCA 2JA9A 1DCZA 4X66Q 3Q23A 1Y14B 5FLMH 4DF7A 1ILQA 2WKDA 3E0JA 1XTDA 1B53A 1SYFA 1TU2B 1PYBA 5E4XA 1E7ZA 3DWAA 3P7JA 3G71A 5HGQA 3RLFA 3HEJA 1X55A 4GKKL 4C3JG 1YI2A 2K5QA 1O7ZA 2AWOA 3VR4A 1WTRA 4HIDA 3JAMc 1XTCD 5JAVA 4B3TL 2KCCA 5E4WC 2A73B 4HJ9A 2L5TA 4Z9CB 1VCIA 3GTKH 4BA2I 3RLNA 3GTOH 3MEFA 4TKOB 2JXMB 4GN4B 1FVIA 2MP1A 1XPOA 5D65A 2N88A 4R4CA 4JI4L 1CKMA 2PZWA 1A8VA 1AH9A 4FNFA 1B44D 1ENFA 3OMGA 2XNAC 2F4VL 1F9QA 1PDQA 2WB1E 1EUJA 3HOXB 4IPCA 5I6YA 1M1KC 3I90A 4APVA 1CTMA 4JC0A 3ZJYC 4A3MB 1NMGA 1JWSD 1F2YA 1I3QH 1U5KA 3G6JB 4K5XA 4OO1I 1B4OA 5C5LA 4IUNA 5E1FA 3CMAA 4QF4A 1DOKA 2X6GA 4WJ3M 2CQOA 1LUZA 1XNRQ 5BR8L 2VQEQ 1PV4A 5ELNA 2QW7A 1BCPC 2OCEA 2L11A 2E5LQ 3HG9A 3A55A 1FR3A 4F87A 1AEXA 5DAUA 1HNXL 4XYOA 3KBXA 3PO2B 4LUZA 2ZTDA 2EDGA 3BDCA 4EQOA 5EQ0A 5FO9B 2MNAA 2I5LX 1EYGA 4GN5A 3BZCA 1YNXA 3KJOA 5IYDH 1Y8NB 5IT9E 3L2PA 1X3PA 2G9DA 4C2MH 2R3ZA 1XYIA 3DXJC 5C4XG 1GUSA 1V8QA 4K6DA 1ONLA 3GTGB 1B8AA 1VQNA 3RZOH 3TRZA 3UDFA 3PUYA 1PH1A 2RCNA 2F0EA 1E2VA 3WDNA 1I4RA 2L15A 1IYVA 4JV5Q 3S16H 1PZKD 3R93A 2K05A 1Q82C 1B7YB 3TP5A 1SDFA 2NUCA 1R9TH 4KTAA 1O7YA 2DJGC 3HKZE 3R8BA 1A15A 2FINB 2MFIA 1D8LA 3I73A 1YNND 2PI2A 2XWJB 3PIO3 4DV7Q 3MWYW 5C0XG 1SNMA 1NSNS 1YBYA 2EYMA 3JAME 1HNZL 2WAQE 5I4DA 2BE5C 1DD2A 1SJHD 3VR3A 4CKBA 4A3IH 2NYZD 4Y7NH 4POFA 4POGA 2X69A 4GS3A 3AB9A 1M4VA 1MKHA 4IFDG 3CCQA 1QJOA 4V0BA 5C4HA 2LMCB 5IGFA 4JI7Q 3CD6A 4A93G 4GZYC 5C44G 1Y1VB 4A3FG 3GD7A 3H3VH 3DM3A 2O2LD 5BN3A 1I6VC 4A3LG 1ICWA 1L1OC 2VB2X 3CF5A 4JPBW 2DN8A 3PSIA 5FLXL 4EGVA 1EFWA 1H9MA 1WOCA 2D0OA 3A54A 4A3CG 1JCKB 5EBDA 5E3FA 1A62A 2E74C 3STBC 1QWYA 4IUUA 3T1YQ 2K5NA 1EY9A 1SMYC 3FHWA 1WTHA 2Q8TA 2R93G 5CV8A 1WTPA 1NJIC 5C3WA 1DXMA 1EWCA 4NXMQ 1R4PB 3FKIG 5I9OA 3O13A 1OXXK 1QUQA 4OHJA 3GV6A 1U4PA 3ERQA 3NP8A 1QVGA 1O7LA 2JA8G 2IWHA 3S17H 4JI6L 1I4HA 4RHRA 5C0XH 4TVAB 3TZDA 5M3MH 1UEBA 2K5VA 4BY7G 1SFOB 3B6YA 2K1BA 4KLKA 5KNCA 1XMOL 4RMFA 2JA6G 4IFDH 4ZRZA 3VA5A 2NVQB 4KD3A 3M3YB 2F4IA 1QVFA 2BH2A 3A7AB 5LMNL 5IE8A 1PMRA 3HKSA 4A93H 1P16A 4X64L 5C44H 4BY1G 1PFNA 1YHBA 3SXHA 2EE1A 3W1BA 1OXSC 4ODGA 3MEHA 1W3SA 1HZAA 3ICEA 2RHQB 1Q46A 2ZTEA 4A3LH 1C48A 1ASZA 4GKKQ 1JB3A 3K5MA 2H5XA 5JVH3 2JA7H 5C4JB 1VS0A 2Q2IA 1HRJA 2IL8A 5GROA 4B3TQ 4A3CH 1W2BA 1VQHA 3QB3A 2JA5H 1LACA 3U9OA 2J4XA 5IIFA 1B9NA 3NHHA 4CDCC 2R93H 3RZDH 5FOBB 5JJIA 4K8JA 1CZWA 2RDGA 4L5TA 4ZUIA 4ZUJA 4JI4Q 1UE7A 3FKIH 4K8IA 5IGEA 4J6HA 5M5WH 2FFKB 4CKCA 1FYCA 3M7GA 1HFGA 1BCPD 2JA8H 2PMZE 3MXNA 4NP5A 3GTPH 3TMEA 2F4VQ 3I4NG 3BS1A 3I91A 4HIKA 3C3LA 1BBWA 4BY7H 1X3QA 5M3FG 1L2FA 1IW7C 3RLOA 3PQIA 2ATWA 3HOZG 1CKNA 3CQZH 2EIFA 1NBWA 1JJ2A 4ZQ3A 1CQVA 5ELEA 5JJZA 1S5CD 2WB1G 3GTMH 4MTKA 1K9MC 2KHIA 4GN3B 3D6CA 5JOBA 2VW9A 1VQGA 4LNQA 5BR8Q 4JOIC 3SHLA 4L6TB 1EQQA 1H9SA 2R92G 5CV4A 2ICIA 3FPUB 3VR5A 1LTGD 1HNXQ 4LW1A 3RMHA 4A3EB 1QILA 4ZK9B 5IGGA 4Q5VA 3S1MH 3K57A 3RNUA 4RHSA 1SMXA 2D62A 1I6HB 1NAPA 1STYA 3K7AB 4RCOA 1A2TA 4LFCL 2EXZA 5KRUA 1SYBA 1A3TA 4KHZA 4A3JG 4O2DA 2XSCA 4B3ML 4UAIA 2K5DA 2ALYB 1HTLD 1ESRA 4KV6A 3CCRA 2A68D 1MJCA 1JT8A 3LX0A 1YJWA 1GUWA 5T1GA 4KI0A 4QY7A 1GXDC 1XMQL 4RGTA 1Q7YC 1T9HA 1TWGB 4RCNA 1O78A 3CRKC 1PRTC 4G7ZC 3PO3B 1G91A 4ZKCB 4PQXA 1PH2A 2RHSB 1ESFA 4XYQA 3HOZH 1YNJC 1SNCA 5IYCH 4EQNA 1I4GA 4QMGA 1EY8A 1MHWC 1PLFA 4JI3L 5FLXE 3F2CA 2B63G 3S14H 3UE0A 3G6EA 3SK8A 1KNAA 2VS1A 1TWCB 4A3DB 1W6KA 2AQ1B 1Z7TA 3IFDA 1HNZQ 2NZHA 3M9BA 2Z4IA 4P74A 2R7FA 1QUQB 1VQIA 2QDBA 3GP7A 4OWXB 5KNBA 3OIPA 3STBD 3HKZG 3ONAB 1CHQD 4Q0FA 1SE8A 1VMCA 1EYAA 3L7ZC 3M4OH 3I72A 3GTPB 4EVOA 2AQ3B 1FL0A 4QL5A 2ZM6L 1U9RA 1MD2D 4CDFC 3M85A 5M5YH 3H3VC 2WAQG 1NUCA 1O80A 3M7NA 1QCBD 4HTHA 4XT1B 2B2YA 2RF4A 2QGQA 1PYWD 1B50A 1IL2A 2Z0SA 4YCUA 1QNKA 5KEEA 4BBSH 4A3JH 1NR2A 3NEMA 3J81c 4OX9L 2AKWB 4DR2L 2ZT9C 2ENBA 4R8IA 1Q86C 4LFBL 2Q2TA 4F88A 2NTTA 1CI3M 3IAYA 3J80c 3VYSA 2KHSA
chains in the Genus database with same CATH topology
5M9OA 4JBWA 2XVSA 1SE3A 2XN9C 1SNQA 5FKAC 2QF7A 1IKMA 1V43A 3E6ZX 3NSWA 5KIXA 4LJZC 5EKIA 1EY5A 2EZVA 4H7BA 3NWSA 4TSSA 3I8ZA 1SYEA 2NVYB 2BOSA 4RFBA 1MSHA 1KDCA 1SNOA 1RTNA 3OPOA 3S2HB 3Q6SA 1B2TA 1QNUA 4KY6A 3NE5B 5CV7A 2MHVA 1V1OA 3I70A 1HFNA 1UUPA 1HUMA 1IW7D 1CQFA 3J7AF 4J1MA 1JWMD 5CYUA 2HCCA 2IX3A 4KJNA 5T1IA 1JOOA 1PZJD 1STGA 4KY7A 1H9SB 1H9KA 1GOZA 1UNSA 3DWQA 1DM0B 1SNDA 1A3VA 4G4KA 4M8AA 2F0FA 2IW3A 4CHTB 2K03A 2B8GA 4NKLA 5IOCA 2J7ZA 1UEAB 4XQJA 3PV0A 5C0XI 4F7XA 4L63B 3MTSA 2IX0A 3I4LA 3QIAA 4KD4A 4CJ2C 3I4MB 3KBGA 4IFDI 4DXGA 3W2DA 3HP3A 3BDOA 3DWPA 2HDLA 3J81E 2B8FA 2BA1A 4IUPA 4DN4M 4CJ1B 2EYLA 5IGDA 1RKNA 4R9WA 1F9RA 4N9PA 5CMDA 5DNFA 4IQZA 2LKVA 1HA5A 4TRDA 1YNJD 1SYGA 1EZ6A 2H1EA 1J8IA 1RD9D 1TY0A 4DNTB 3D6WA 1TWAB 4F8MA 3CU7A 4L8JA 2E2IB 1PRTF 1CFMA 1EOTA 1MI2A 5I9PA 2IT1A 1JE4A 3D8GA 1K8MA 3TZUA 1HUNA 2KCNA 2VUMB 2EY2A 2F0DA 5KYIA 4QIWB 2EYOA 3HS0C 3MVVA 1SEBD 2N55A 2L55A 1JORA 2LS01 4E6IA 4K2KA 3AMUA 1HQRD 1VDZA 3HOVB 3QG1A 3A8IE 4ID6A 4CJ0B 4PMCA 5D14A 2SDFA 1L0YB 1EY7A 1WVLA 2NVTB 1G6ZA 2Y0SB 4A3BB 5EBCA 5ISRA 5I6WA 1K83B 4X3SA 3SVMA 2NTSA 3C1FA 2HDMA 3T16A 5EPKA 4QUFA 4EQPA 3L9AX 2LY7A 3G7LA 5COYA 2E2JB 4KN4C 4WJWA 5LL6S 3H91A 2WINB 1WTOA 1D1IA 1G2TA 2F0KA 3OOCA 1D2BA 1BBXC 1BDOA 3NXWA 4RKLA 2MGSA 1EIHA 4HMIA 4XDXA 1EY0A 3K5NA 4BWGB 4C1NK 3H6MA 1TQOA 1SYCA 4QUCA 3OMCA 3EROA 4XT3B 1ET9A 4XQNA 5CORA 1OO9B 2B2UC 1LV9A 4RGNA 2VXWA 2EYFA 4JK1C 4KKSA 1LT4D 4IUVA 3PUXA 4HEDA 1Y8OB 4C3HG 3GTKB 4FO2A 2F03A 3GTOB 4K5WA 4O1NA 4FF2A 4I65A 1PFBA 3J7AV 1LTBD 1S5DD 1S5BD 4KMUC 3TP8A 1UAPA 2A68C 3PIP3 3BZDB 2WIIB 2ZXRA 1WTQA 1EYDA 1ZEQX 2M2LA 2IPKD 1PTOD 1LABA 4LAAA 2Q8RE 4DK1A 1K8OA 1TIID 2GA4B 1I3QB 3IFTA 2KEDA 1IL8A 5FK9C 3GV3A 1B9MA 3T56B 1EYCA 3TP6A 2C9OA 5KYLA 3FDTA 1TKWB 1FGBD 1RJTA 3DMUA 2K33A 2JEBI 4U68A 2M00A 1KLUD 2D2CC 2FJ2A 5CBEE 2R61A 3BVGA 3MFYA 3VR2A 4HAEA 4C2MB 3CHBD 1KABA 3A8KE 2L4NA 3GO5A 3MZ5A 1WTVA 2YYZA 3RZOB 2IJ0A 4DGZA 4DFAA 3S16B 3OWEB 4FXDA 3KLSA 2ICEC 1PRTB 1R9TB 1ML0D 2B2VC 3A8JE 3S9WA 3TSSA 3TBIB 3HGBA 3ND8A 1BO0A 3VYUA 4ZYSA 4X3KA 2F1MA 1DJRD 1JWUD 4RGMA 5CV9A 4FF4A 2B2WC 4A3IB 1PFMA 4Y7NB 2F0GA 3FEWX 3LNNA 1V1PA 1CT1D 3K6OA 1AP0A 2EJFC 1ET6A 1F9SA 4KHVA 1WD0A 5DEHA 1RDPD 4RH6A 1QE6A 3OWFA 1STHA 2NBFA 1HHVA 1STEA 1Q1BA 1BR9A 2F0TA 2SEBD 1LO5D 1LTRD 1TS3A 2F0MA 1R4QB 2PW5A 3T4AC 3D4DA 2DNEA 1BCPF 4KKUA 3NBHA 2R6GA 1AN8A 1TS5A 3TP7A 3FRPB 4FVMA 2CW0C 2E76C 4BS9A 5CR3A 3S17B 5M3MB 1PTOH 1IHZA 1EEID 5JEAJ 2I46A 2A69D 3V96A 1SE4A 5AFWA 2Z8LA 4S3SA 3T13A 2VB3X 5TSSA 2QILA 1VF5C 2K32A 4A93B 1GUNA 3LWUA 5G3LD 5C44B 1U4LA 5EJWA 5LHY1 1STNA 2HCIA 5C4ZA 4HSVA 2JA7B 2Q8IB 2M9VA 5ELBA 3K5OA 5K5PA 4XXEA 2JA5B 3KUPA 5KGUA 1IYUA 1A3UA 2SNMA 3ZYYX 2R93B 3OSOA 3RZDB 2QEJC 5EKKA 2O5JC 5BN5A 3FKIB 5M5WB 3N6RA 2TSSA 1F9PA 2JA8B 1EL0A 4BY7B 2D9UA 3VR6A 2K04A 1E2WA 3K59A 4ME5A 4NMZA 2FHTA 3CQZB 1SBBB 4ZLTF 3HZXA 4MIUA 3GTMB 1OXTA 3PUWA 2D5DA 4BY1B 3QWNA 2F0SA 3UI2A 1VF7A 4V190 2Z1CA 1C8CA 1QOHA 2H4OA 1JC7A 1HCZA 1TT2A 1EIGA 2RKSA 2JP1A 3TDQA 1XXGA 4I7ZC 3S1MB 2F3VA 5JVG3 3DEPA 5I2XA 1D6EC 2L12A 1V1PB 2L1BA 3KLRA 1CK1A 2F0QA 1GUGA 2KECA 1I4QA 4MN3A 2RSNA 5J22A 4RA8A 3QO2A 4LK1C 1EY6A 5IGCA 2A6HD 3NQIA 3LWEA 5JPNC 4NDXA 1QB5D 5M3FB 3F2UA 4OL7A 4KY5A 4CBVA 3HOZB 1S5FD 1D1KA 1Q8IA 3NQTA 3IKJA 1F2LA 3S14B 4FXKC 5JEAG 4OGQC 3SR1A 3X3MA 4PV1C 1T5EA 1MBYA 4IALA 5KNDA 2TMPA 3M4OB 1BXTA 3CRLC 3NBIA 1L0XB 5M5YB 4PMBA 3PUVA 2SNSA 1Q3LA 1B3AA 2CW0D 2DNCA 2EY6A 4G57A 4A3JB 4BBSB 3MFGA 3AU7A 5CV5A 4YIJA 3C46A 1WTWA 2B2VA 4CKEA 2K5WA 2QKIC 5I2YA 2F0JA 4NW2A 3WOEA 3IL8A 2B2WA 2PCFB 1Q12A 2WKCA 4FYDA 1KTKA 1BCPB 1TS2A 1LLRD 1A2UA 1PTOC 1CZGA 2CHBD 1WD1A 4DU9A 4C3IB 1ZXTA 4TQUS 2K7VA 3HKZB 3GTQB 3JAML 1A6XA 1FD7D 2F3WA 3QOJA 2VNUD 2EPBA 1WCMB 2EJMA 2JEAI 4J8QA 2KJXA 1U4MA 2I07B 2KVMA 2NZ1D 2HQEA 3EQLC 1EWHA 4IZ8A 5EPLA 2A6EC 1IKLA 5C0XJ 3MXUA 3V05A 4WRDA 4B9WA 5J39A 2C5CA 2BDOA 1DOMA 2JYOA 4IFDJ 4DAYA 2DY8A 5M5XB 3P20A 3C1EA 4A3GB 1SAPA 2NB0A 2WV6D 1HQMC 2ZXOA 2PQEA 4B9XA 3H0GB 1VMPA 5EKLA 1ENAA 4H13C 4FF3A 1DONA 4G7HC 1HTPA 1STAA 2A5HA 4ABNA 2E2HB 3URYA 1RODA 2O4XA 1I4PA 2NN6G 1PZID 1RHPA 1AW7A 2PZTA 4KK7A 1M8AA 2OEOA 3MHBA 1T5XD 4OIKA 1ZKOA 2CVRA 2K28A 1FNVA 2RBMA 2G9HD 2F0UA 1LT5D 3SK4A 3VYRA 1HPCA 2WP8J 4FXGC 1D5ZC 2E2DC 4O42A 3SDZA 4KN7C 1S4ZA 3R2TA 2X6LA 3KF8A 1LT6D 2KOLA 4HN7A 4FF1A 4DA2A 4A3KB 3R2IA 1SNPA 1DYQA 2PZUA 4MHEA 1GJXA 3KK7A 1S5ED 3W3AA 3M4YA 5A2QL 3PMFA 2BCOA 3A56A 2PMZB 2XWBB 3HOUB 4WFN3 1II3A 5F2DA 4IN3A 5D3IB 5K36G 1SE2A 4QB4A 2A69C 2B2YC 2NN6H 1KDAA 3DEOA 1CHPD 3K58A 5LL6X 1E0BA 2EJGC 2AWNA 4DAPA 1EY4A 1CM9A 1AZPA 1LTID 3TN2A 3H09A 1BNZA 3SEBA 3GTJB 1CA6A 3DHQA 3I3CA 1KLGD 5CC4A 2B2TC 5DM63 3NUCA 5ELDA 1GHKA 1G291 2B39A 2L9HA 4DXFA 1Y1WB 3GTLB 1EU3A 2J0TD 3NWTA 1H9JA 2F0VA 5ELCA 5C3XA 1PTOF 2JSOA 2K6AA 4HCEA 2ZXPA 3S1QB 4C3JB 3D31A 5C3EB 3S1NB 2ID0A 5BN4A 2F0NA 1H9RA 1EU4A 2A6ED 5K36H 2KQ3A 4X3TA 5FO7B 1EFID 3MA2B 2OF1A 4HR7B 1EZ8A 3D4RA 4UDUC 1TWFB 1I50B 1RF2D 4ZAIA 1SXTA 4KKTA 2KA7A 1BOSA 2F0HA 1F2MA 5NUCA 4K2LA 3Q24A 1JR0D 1J9OA 4ZKBB 2V4DA 3NTKA 1LTSD 1F77A 2F0PA 3V2TA 1Z47A 1HXYD 4HSPA 3FMCA 2PW7A 3PUZA 5CGKA 1U4RA 2FMCA 2RDHA 2LFNA 5C6AA 1TVXA 1DOLA 3WOFA 3BVMA 2A6HC 1QG7A 4DK0A 1BF4A 3ND9A 3NTHA 4ULLA 2CQAA 3DUZA 3H94A 1TR5A 1G2SA 1Y8PB 4X3UA 4G7OC 3P1HA 4C56C 2RQXA 2F0IA 3S2DB 4PNYA 3GQBA 1SSOA 3Q22A 4QCLA 5C4XB 1JOQA 5FO8B 4OO1G 2R7ZB 5D3DA 3NK9A 5DM73 1GHJA 4RAUC 1W6JA 1ZYRC 1GUTA 1X32A 1AZQA 1BUVT 5A2QE 1JOKA 3BVZA 4B08A 4C3HB 4BA1I 1KNEA 3NPPA 4IURA 2O5IC 1ILPA 2KUMA 3NTIA 2EYHA 5JPMC 3MAQA 2MPMA 1LT3D 3CKIB 3QOLA 4A3FB 1SYDA 3L3OC 2AUKA 1MSGA 2OT2A 2RSOA 4HCSA 3BG3A 4IUTA 1Q1EA 1STBA 4HMJA 1EQVA 4H44C 2YU9B 2DY7A 3D4WA 2BE5D 1BQQT 4OO1H 3S1RB 5ELFA 5G3LF 4CGYB 2SOBA 4LMQD 2XRQD 2IX1A 1JICA 3J81L 5IODA 1XX8A 3OIQA 2HUGA 3MXPA 4ILWA 3K5LA 4AYBB 3OHXC 3J80L 5HURA 4KJOA 1Y69U 3T53B 1AFPA 1XWEA 4C1NI 1TS4A 2BA0A 2F0OA 1FNUA 2F0LA 4C3IG 1JQYD 1F2ZA 2JA6B 2Z4HA 2B2UA 4WORA 3DM1A 2OXPA 1HA6A 2QCPX 1SMYD 2EYJA 1WTXA 1Q90A 4XTCS 4U673 1RCVD 1KDBA 3BDLA 5EPJA 4M1UB 2L0CA 1ENCA 3S15B 3QJYA 3P75A 1PTOB 4XQQA 3EJIA 1NR4A 3OW7A 1OXVA 1KAAA 2NN6I 2RA4A 2B2TA 4P2CB 5EGTA 1SJED 4DNRB 1GUOA 3I4NB 3KLSX 4OIJA 4K5VA 2A74C 2EY5A 2AQ2B 1B1ZA 5CBAE 1I4XA 2NWGA 1Z6HA 3VA7A 5CV6A 3EFXD 4K14A 1G8ZD 1C4QA 2WB1B 2K01A 4H0LC 1CA5A 3HOYB 2WACA 4K6LA 3HRZC 2R92B 4RGOS 1ZYRD 1TWHB 2PYKA 1PXUA 3N52A 3RD4A 1RTOA 3T51B 3K0YA 3EA6A 3FVQA 3SE0A 3VYTA 1D5MC 1FNWA 3J7YW 2EYPA 3FPPA 3BYTB 2MJ8A 4RWSC 3EVQA 2RVLA 3E5SA 5IT9L 3ITPA 3BYYB 4FP5D 3SK5A 2NVXB 4N9TA 5IGBA 4IUQA 4RKBA 3A7LA 4DAVA 2PPBC 3Q0AA 2BDNA 3X3NA 3R3OA 5HGTA 3HOWB 2XIWA 2B63B 1MGSA 2EVBA 5A35A 1OXUA 1YNNC 5JEAH 3MC0B 2FMMA 2PO4A 4BBRB 4XIGS 2F0WA 3SK6A 1LTTD 5J1ZA 2KEEA 2EOTA 1D5XC 1E2ZA 4PMWA 2E75C 3RUZA 1LTAD 1DZ1A 2JE6I 1NCVA 2PNRC 2WAQB 2XRSD 3D3RA 2EY1A 1PRTD 3J80E 1EQTA 2MUYA 2AUJD 2RDFA 3U9SA 5C5MA 3MXGA 4R8NA 1TY2A 1EEFD 3C2PA 1DCZA 3Q23A 4DF7A 1ILQA 2WKDA 3E0JA 1B53A 1SYFA 1TU2B 5E4XA 3DWAA 3P7JA 3RLFA 3HEJA 4C3JG 2K5QA 1O7ZA 2AWOA 3VR4A 1WTRA 1XTCD 5JAVA 2KCCA 5E4WC 2A73B 2L5TA 4Z9CB 1VCIA 4BA2I 4TKOB 2JXMB 2MP1A 5D65A 2N88A 2PZWA 4FNFA 1B44D 1ENFA 3OMGA 2XNAC 1F9QA 1PDQA 3HOXB 5I6YA 3I90A 1CTMA 4A3MB 1JWSD 1F2YA 3G6JB 4K5XA 4OO1I 1B4OA 5C5LA 4IUNA 5E1FA 4QF4A 1DOKA 2X6GA 1BCPC 2L11A 3HG9A 3A55A 1FR3A 4F87A 1AEXA 5DAUA 4XYOA 3KBXA 3PO2B 2EDGA 3BDCA 4EQOA 5EQ0A 5FO9B 1Y8NB 5IT9E 1X3PA 2G9DA 1XYIA 2R3ZA 3DXJC 1GUSA 1V8QA 4K6DA 1ONLA 3GTGB 3PUYA 2F0EA 1E2VA 3WDNA 1I4RA 1IYVA 1PZKD 3R93A 2K05A 3TP5A 1SDFA 2NUCA 4KTAA 1O7YA 3R8BA 1A15A 2FINB 3I73A 1YNND 2XWJB 3PIO3 3MWYW 5C0XG 1SNMA 1NSNS 2EYMA 3JAME 5I4DA 2BE5C 1DD2A 1SJHD 3VR3A 4CKBA 2NYZD 2X69A 3AB9A 1M4VA 4IFDG 1QJOA 4V0BA 5C4HA 2LMCB 5IGFA 4GZYC 1Y1VB 3GD7A 2O2LD 5BN3A 1I6VC 1ICWA 2VB2X 2DN8A 5FLXL 4EGVA 1H9MA 3A54A 1JCKB 5EBDA 5E3FA 2E74C 1QWYA 4IUUA 1EY9A 1SMYC 2Q8TA 5CV8A 1WTPA 5C3WA 1DXMA 1EWCA 1R4PB 5I9OA 3O13A 1OXXK 4OHJA 3GV6A 1U4PA 3ERQA 3NP8A 1O7LA 2IWHA 1I4HA 4RHRA 5C0XH 3TZDA 1SFOB 2K1BA 5KNCA 4IFDH 4ZRZA 3VA5A 2NVQB 4KD3A 3M3YB 2F4IA 3A7AB 1PMRA 1PFNA 3SXHA 2EE1A 1OXSC 4ODGA 3MEHA 1C48A 1JB3A 3K5MA 5JVH3 5C4JB 1HRJA 2IL8A 3QB3A 1LACA 3U9OA 2J4XA 5IIFA 1B9NA 3NHHA 5FOBB 4K8JA 1CZWA 2RDGA 4ZUIA 4ZUJA 4K8IA 5IGEA 4J6HA 2FFKB 4CKCA 1FYCA 3M7GA 1HFGA 1BCPD 3MXNA 4NP5A 3TMEA 3BS1A 3I91A 3C3LA 1X3QA 1IW7C 4ZQ3A 1CQVA 5ELEA 5JJZA 1S5CD 3D6CA 5JOBA 3SHLA 4L6TB 1H9SA 5CV4A 2ICIA 3FPUB 3VR5A 1LTGD 3RMHA 4A3EB 1QILA 4ZK9B 5IGGA 4Q5VA 3K57A 4RHSA 2D62A 1I6HB 1NAPA 1STYA 3K7AB 4RCOA 1A2TA 2EXZA 5KRUA 1SYBA 1A3TA 4KHZA 2XSCA 4UAIA 2K5DA 1HTLD 1ESRA 4KV6A 2A68D 3LX0A 1GUWA 5T1GA 4KI0A 1GXDC 4RGTA 1TWGB 4RCNA 1O78A 3CRKC 1PRTC 4G7ZC 3PO3B 1G91A 4ZKCB 4PQXA 1ESFA 4XYQA 1YNJC 1SNCA 4EQNA 1I4GA 4QMGA 1EY8A 1PLFA 5FLXE 3SK8A 1KNAA 1TWCB 4A3DB 1W6KA 2AQ1B 1Z7TA 3IFDA 2Z4IA 3GP7A 2QDBA 5KNBA 3OIPA 3ONAB 1CHQD 4Q0FA 1VMCA 1EYAA 3L7ZC 3I72A 3GTPB 4EVOA 2AQ3B 1U9RA 1MD2D 3M85A 3H3VC 1NUCA 1O80A 3M7NA 1QCBD 4HTHA 4XT1B 2B2YA 1PYWD 1B50A 1QNKA 5KEEA 1NR2A 2ZT9C 2ENBA 4R8IA 4F88A 2NTTA 1CI3M 3IAYA 3VYSA 2KHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BDC A;  1EY4 A;  4EQP A;  4EQO A;  2F0T A;  5IOD A;  2EYL A;  2EY6 A;  4G57 A;  1RKN A;  5IGD A;  1EYC A;  5EKL A;  5M9O A;  4N9P A;  3TP6 A;  2WAC A;  1ENA A;  5IGG A;  2F0M A;  3HZX A;  3MXP A;  4MIU A;  2PW5 A;  5CV5 A;  4YIJ A;  4DF7 A;  2LKV A;  3D4D A;  5KYL A;  3DHQ A;  4TRD A;  1STY A;  1SYF A;  1SNQ A;  1A2T A;  2F0K A;  1STA A;  2EXZ A;  4K6D A;  5CC4 A;  5KRU A;  1SYB A;  1A3T A;  2F0S A;  3TP7 A;  1TR5 A;  1SYG A;  3VA5 A;  5KIX A;  2PYK A;  1EZ6 A;  1EY5 A;  5HUR A;  5IOC A;  3DMU A;  3NUC A;  4KD3 A;  4KJO A;  4H7B A;  4KV6 A;  5IGC A;  2O4X A;  1TT2 A;  3HEJ A;  3NXW A;  3P1H A;  2F0E A;  2F0I A;  4PNY A;  2F0J A;  3LX0 A;  1SYE A;  5CR3 A;  2M00 A;  3SXH A;  2F0O A;  2RKS A;  4ODG A;  2PZT A;  2F0L A;  4RKL A;  3MEH A;  1JOQ A;  2OEO A;  3TP5 A;  4HMI A;  5JAV A;  1F2Z A;  2EYP A;  2NUC A;  3MHB A;  4KTA A;  1IHZ A;  4F8M A;  1EY0 A;  1KDC A;  4WOR A;  2F3V A;  2OXP A;  3NK9 A;  1SNO A;  2F0V A;  3EVQ A;  1A2U A;  3H6M A;  5C3X A;  1KAB A;  1TQO A;  1SYC A;  3E5S A;  2EYJ A;  5I9P A;  1SNC A;  2RBM A;  3ITP A;  3D8G A;  4EQN A;  2F0Q A;  4KY6 A;  1SNM A;  1NSN S;  1EY8 A;  4QMG A;  2EYM A;  3OMC A;  3MZ5 A;  3ERO A;  3SK5 A;  2F0U A;  4N9T A;  1KDB A;  3QB3 A;  4S3S A;  5CV7 A;  3T13 A;  4DU9 A;  5IGB A;  3BDL A;  3SK4 A;  1JOK A;  4DGZ A;  3SK8 A;  5J22 A;  1ENC A;  2F0N A;  4RKB A;  4DFA A;  2PZW A;  3U9O A;  5IIF A;  2KQ3 A;  1EY6 A;  1STN A;  2EY2 A;  2F0D A;  2F3W A;  3NHH A;  3P75 A;  4J1M A;  2EYF A;  3R3O A;  3OMG A;  3QOJ A;  5KYI A;  4K8J A;  4KJN A;  3EJI A;  5HGT A;  1JOO A;  4ZUI A;  1STG A;  4ZUJ A;  4KY7 A;  2QDB A;  5C4H A;  5I9O A;  2EYO A;  5IGF A;  3S9W A;  4K8I A;  4NDX A;  2OF1 A;  4J6H A;  5IGE A;  5C4Z A;  3MVV A;  1KAA A;  4OL7 A;  1EZ8 A;  1EYA A;  4KY5 A;  5I6Y A;  4EVO A;  1JOR A;  4NP5 A;  1U9R A;  3TME A;  3NQT A;  4K5W A;  1SND A;  1A3V A;  4E6I A;  4K2K A;  2EYH A;  1NUC A;  4I65 A;  5K5P A;  2F0F A;  1SNP A;  2HQE A;  4HTH A;  1F2Y A;  4K5X A;  5KGU A;  5CV9 A;  2PZU A;  4IZ8 A;  2F0W A;  4NKL A;  3TP8 A;  3SK6 A;  5C5L A;  1A3U A;  5J1Z A;  2F0G A;  3QOL A;  2SNM A;  4IUN A;  2F0H A;  5E1F A;  1SYD A;  1F2M A;  4ID6 A;  3OSO A;  5EGT A;  5NUC A;  4QF4 A;  4K2L A;  3PMF A;  5KEE A;  4PMC A;  5EKK A;  3RUZ A;  5E3F A;  3SR1 A;  4ZQ3 A;  4WRD A;  4B9W A;  5J39 A;  4F7X A;  1EYD A;  4K5V A;  1II3 A;  4KHV A;  5F2D A;  5DEH A;  2F0P A;  2EY1 A;  1EY7 A;  3V2T A;  4IAL A;  2EY5 A;  1EY9 A;  4QB4 A;  1STB A;  4KD4 A;  4LAA A;  3OWF A;  1KDA A;  2ENB A;  1STH A;  3C1E A;  3D6C A;  1EQV A;  4HMJ A;  5CV8 A;  5JOB A;  5C3W A;  5ISR A;  2RDF A;  5I6W A;  3D4W A;  5CV6 A;  5C5M A;  2PW7 A;  3C1F A;  4K14 A;  1AEX A;  4PMB A;  3SHL A;  5CGK A;  5DAU A;  2SNS A;  3NP8 A;  3ERQ A;  5C6A A;  2SOB A;  5CV4 A;  4ME5 A;  4R8N A;  4NMZ A;  2PQE A;  3T16 A;  2KHS A;  4B9X A; 
#chains in the Genus database with same CATH topology
 2K5H A;  5M9O A;  4JBW A;  3I2Z A;  4B3S L;  4JVZ A;  1B3Q A;  2XVS A;  1SE3 A;  3H0G G;  2XN9 C;  2UUA L;  1SNQ A;  4JI6 Q;  5FKA C;  5IYB H;  2QF7 A;  1IKM A;  1E1T A;  1V43 A;  3E6Z X;  3NSW A;  5KIX A;  4LJZ C;  5EKI A;  1TXY A;  1EY5 A;  4C3I H;  2EZV A;  4H7B A;  3ER0 A;  3NWS A;  1XMO Q;  4TSS A;  1HJP A;  3GTQ H;  3I8Z A;  4P72 A;  1SYE A;  2XGT A;  1NNX A;  2EQS A;  2NVY B;  3MXN B;  1SRU A;  2BOS A;  1BBU A;  4RFB A;  1MSH A;  2G5D A;  4DK3 C;  1KDC A;  4X64 Q;  1WCM H;  1SNO A;  4JBK A;  1RTN A;  1LYL A;  3OPO A;  3S2H B;  3H3V I;  3Q6S A;  1B2T A;  1CKN B;  4A76 A;  1QNU A;  4KY6 A;  1XPR A;  3NE5 B;  5CV7 A;  2MHV A;  3HOX G;  1V1O A;  3I70 A;  1HFN A;  1UUP A;  1HUM A;  1IW7 D;  1CQF A;  3J7A F;  4DV0 L;  4J1M A;  1XPU A;  1JWM D;  5CYU A;  2HCC A;  2IX3 A;  4KJN A;  5T1I A;  1JOO A;  1PZJ D;  1STG A;  4KY7 A;  1H9S B;  1H9K A;  1GOZ A;  1UNS A;  3DWQ A;  5M5X H;  2QA4 A;  1DM0 B;  4A3G H;  1YIJ A;  1SND A;  1A3V A;  5IY0 A;  4G4K A;  4M8A A;  2F0F A;  1E24 A;  2IW3 A;  4CHT B;  4AIM A;  1EIY B;  2K03 A;  2B8G A;  4NKL A;  5IOC A;  2J7Z A;  2R7D A;  4P75 A;  1UEA B;  1X9N A;  3H0G H;  1AE3 A;  4XQJ A;  3PV0 A;  1XNQ L;  5C0X I;  3T1H L;  4F7X A;  1X65 A;  1KXL A;  4L63 B;  1K3R A;  3MTS A;  2IX0 A;  3I4L A;  3QIA A;  3EBE A;  4KD4 A;  4CJ2 C;  3I4M B;  3KBG A;  4LF8 L;  3HOU G;  4IFD I;  4DXG A;  3CAM A;  5E7N A;  3W2D A;  2E2H H;  3HP3 A;  3BDO A;  3DWP A;  2HDL A;  3J81 E;  2B8F A;  3CC2 A;  1HZB A;  2BA1 A;  4IUP A;  4IPD A;  4DN4 M;  5AJ3 L;  4CJ1 B;  4AYB E;  4NPS A;  4PZ8 A;  2EYL A;  5IGD A;  1RKN A;  4R9W A;  1F9R A;  4BXX G;  4N9P A;  5CMD A;  4GLX A;  5DNF A;  2ZJQ A;  4IQZ A;  2OWO A;  2LKV A;  1HA5 A;  2IHE A;  4TRD A;  1YNJ D;  1SYG A;  1EZ6 A;  1KRS A;  2H1E A;  5IT9 c;  1J8I A;  3CC7 A;  1RD9 D;  4LFC Q;  2Z6K C;  4YWK A;  4R1J A;  1TY0 A;  3PIO A;  4B3M Q;  4DNT B;  1IYJ B;  1TWA B;  3D6W A;  1QZG A;  4F8M A;  1X6O A;  3CU7 A;  1E1O A;  4L8J A;  2E2I B;  1PRT F;  1CFM A;  2YV5 A;  1EOT A;  1Y1W G;  1MI2 A;  4A3K H;  5I9P A;  1XMQ Q;  2IT1 A;  4LF4 L;  1JE4 A;  4PZ7 A;  3D8G A;  1K8M A;  3TZU A;  1HUN A;  2KCN A;  1Y1V G;  2VUM B;  4JI3 Q;  2EY2 A;  2F0D A;  2CKZ B;  2DGY A;  5KYI A;  2IHF A;  4QIW B;  5C3E G;  3HOU H;  1HZC A;  2EYO A;  3HS0 C;  4AH6 A;  3MVV A;  1SEB D;  1CSP A;  2N55 A;  2L55 A;  3RN5 A;  1JOR A;  4UPA A;  2LS0 1;  3KYH C;  4EX5 A;  4E6I A;  4K2K A;  3AMU A;  1HQR D;  3CXC A;  1C9O A;  4BXX H;  1VDZ A;  3HOV B;  3QG1 A;  3A8I E;  2ZM6 Q;  4ID6 A;  4CJ0 B;  3AFQ A;  4PMC A;  5GAG C;  4QJF A;  5D14 A;  2SDF A;  1L0Y B;  4JI2 L;  4JYA L;  3GTJ H;  1EY7 A;  1WVL A;  2NVT B;  1G6Z A;  2Y0S B;  4A3B B;  5EBC A;  5ISR A;  2ZJR A;  4DV2 L;  1VQC A;  1HNW L;  5I6W A;  1K83 B;  1RIP A;  3ULJ A;  4X3S A;  3SVM A;  2NTS A;  3C1F A;  4OX9 Q;  4DR2 Q;  2HDM A;  2UXD L;  3T16 A;  5EPK A;  4QUF A;  4EQP A;  4YCW A;  3L9A X;  4LFB Q;  3GTL H;  2LY7 A;  3G7L A;  5COY A;  2E2J B;  4KN4 C;  4WJW A;  5LL6 S;  3A5Z B;  3H91 A;  2WIN B;  1WTO A;  1RL2 A;  3CW2 C;  1VQM A;  1D1I A;  1G2T A;  3S1Q H;  2F0K A;  4C3J H;  3OOC A;  1D2B A;  4B3S Q;  3ERS X;  4ME3 A;  1BBX C;  5C3E H;  3S1N H;  1BDO A;  2UUA Q;  3NXW A;  1VQ6 A;  2KHJ A;  2ASB A;  3G4S A;  4RKL A;  2MGS A;  1EIH A;  4HMI A;  4XDX A;  1I94 L;  1EY0 A;  3SGI A;  3K5N A;  4BWG B;  4C1N K;  1PH3 A;  3H6M A;  1TQO A;  1SYC A;  4QUC A;  1C7Y A;  3OMC A;  3ERO A;  4XT3 B;  2R7Z G;  1V9P A;  1I50 H;  1ET9 A;  1LM0 A;  4XQN A;  3DLL A;  5COR A;  1OO9 B;  2B2U C;  1LV9 A;  4LF7 L;  4RGN A;  1CSQ A;  2VXW A;  2EYF A;  4JK1 C;  4KKS A;  1QZH A;  1LT4 D;  1VQE A;  3K0X A;  4DAM A;  4IUV A;  3PUX A;  4HED A;  1Y8O B;  4IOA A;  3CCS A;  2UUC L;  4C3H G;  3GTK B;  4DV0 Q;  1NE3 A;  4FO2 A;  2F03 A;  3GTO B;  4DR6 L;  4K5W A;  4O1N A;  4FF2 A;  1N32 L;  4I65 A;  4LF5 L;  3E9H A;  1PFB A;  2LXJ A;  4JI8 L;  3J7A V;  1LTB D;  1S5D D;  1S5B D;  4KMU C;  3TP8 A;  1UAP A;  4LF6 L;  2A68 C;  3PIP 3;  1HR0 W;  4R4I A;  4PG3 A;  3BZD B;  4DV5 L;  2QDL A;  2WII B;  2ZXR A;  1WTQ A;  1EYD A;  1ZEQ X;  2M2L A;  4N8F A;  2IPK D;  2MO0 A;  1PTO D;  1LAB A;  4LAA A;  1IBK L;  4DV6 Q;  3J81 j;  2Q8R E;  2P5Z X;  1XNQ Q;  4DK1 A;  3T1H Q;  1K8O A;  1TII D;  3J80 i;  2GA4 B;  1I3Q B;  1AE2 A;  4GNX C;  4DR1 L;  3GDE A;  3IFT A;  2KED A;  1IL8 A;  2VQF L;  1KQS A;  3S2D H;  5FK9 C;  4LF8 Q;  1VQB A;  5C4X H;  3GV3 A;  1B9M A;  3T56 B;  1EYC A;  4AQY L;  3TP6 A;  1M90 C;  2C9O A;  2R7Z H;  3U4V A;  3K8A A;  3UE1 A;  1K28 A;  1WI5 A;  5AJ3 Q;  2RCF A;  1Q81 C;  1CKO A;  5KYL A;  3FDT A;  1X56 A;  3A74 A;  2UUB L;  1C0A A;  1TKW B;  1FGB D;  2B29 A;  1RJT A;  3DMU A;  4A4I A;  2K33 A;  1Q8K A;  4DR7 L;  4C3H H;  2JEB I;  1FJG L;  4U68 A;  2M00 A;  4AYB G;  1KLU D;  2D2C C;  2FJ2 A;  5CBE E;  2R61 A;  3BVG A;  3MFY A;  3VR2 A;  4HAE A;  3W1G A;  1IZ6 A;  4LFA L;  4C2M B;  3CHB D;  4UHV A;  1KAB A;  3A8K E;  2L4N A;  3GO5 A;  3MZ5 A;  1WTV A;  2YYZ A;  3RZO B;  2IJ0 A;  4DGZ A;  4LF4 Q;  1PA6 A;  4DFA A;  4A3F H;  3OWE B;  3S16 B;  4FXD A;  4I7A A;  3KLS A;  2ICE C;  1PRT B;  1R9T B;  1ML0 D;  5FLX c;  2D0P A;  2B2V C;  2WFW A;  2K4K A;  4UP7 A;  3A8J E;  3S9W A;  3TS0 A;  3TSS A;  3TBI B;  3AQQ A;  2KCT A;  3HGB A;  1PH8 A;  3ND8 A;  1BO0 A;  1JE5 A;  3VYU A;  4ZYS A;  2N8N A;  4X3K A;  2YU9 H;  2F1M A;  1DJR D;  2DUD A;  1JWU D;  3OTO L;  4RGM A;  3LGJ A;  5CV9 A;  4FF4 A;  2B2W C;  3S1R H;  4HJ8 A;  4A3I B;  1PFM A;  4Y7N B;  2VZA A;  2F0G A;  3FEW X;  3LNN A;  1V1P A;  1CT1 D;  3K6O A;  1EWI A;  1AP0 A;  2EJF C;  5IP7 G;  1ET6 A;  1F9S A;  4KHV A;  1WD0 A;  5DEH A;  2KEN A;  1RDP D;  4RH6 A;  1QE6 A;  3OWF A;  1STH A;  2NBF A;  1HHV A;  1STE A;  4JI2 Q;  4JYA Q;  1Q1B A;  2V1C C;  5JJL A;  3I4O A;  4DV2 Q;  1BKB A;  2UU9 L;  1BR9 A;  1HNW Q;  2F0T A;  1YHQ A;  2ES2 A;  2SEB D;  2JA6 H;  1LO5 D;  1LTR D;  1TS3 A;  2F0M A;  2Z6B A;  1R4Q B;  2PW5 A;  3T4A C;  3K81 C;  4R4Q A;  1OTC A;  2UXD Q;  3D4D A;  2DNE A;  3KOJ A;  4ZCK A;  3HOY G;  2VY3 A;  1BCP F;  4KKU A;  3NBH A;  2R6G A;  1AN8 A;  4BY1 H;  1TS5 A;  2KBN A;  3FRP B;  3TP7 A;  2Q2U A;  4FVM A;  1EQR A;  2CW0 C;  2E76 C;  3I56 A;  3M4Q A;  3S15 H;  4BS9 A;  5CR3 A;  4NXN L;  5DLQ E;  3S17 B;  4L5R C;  5M3M B;  1PTO H;  1IHZ A;  4NB3 A;  1EEI D;  5JEA J;  2E8G A;  2I46 A;  2A69 D;  3V96 A;  1I94 Q;  3CC4 A;  1SE4 A;  5AFW A;  4DUZ L;  2Z8L A;  4S3S A;  3T13 A;  4DR4 L;  1NY4 A;  2VB3 X;  1IBL L;  5TSS A;  2QIL A;  1VF5 C;  2K32 A;  4A93 B;  1SRO A;  1GUN A;  3LWU A;  5G3L D;  3JAM i;  5C44 B;  4HJ7 A;  3OYY A;  5IP9 G;  1U4L A;  5EJW A;  2VL6 A;  5LHY 1;  1STN A;  4JI1 L;  1E3P A;  3I4N H;  1Z9F A;  2HCI A;  5C4Z A;  4LF7 Q;  1HH2 P;  5M3F H;  4HSV A;  2JA7 B;  2Q8I B;  2M9V A;  4GKJ L;  5ELB A;  3HOW G;  3K5O A;  5K5P A;  4XXE A;  2JA5 B;  3KUP A;  2UUC Q;  5KGU A;  1JJC B;  4OON A;  1IYU A;  1A3U A;  3I4M G;  2SNM A;  3ZYY X;  4DR6 Q;  2R93 B;  1J6Q A;  3OSO A;  3RZD B;  1N32 Q;  3HOY H;  4LF5 Q;  2QEJ C;  5EKK A;  4JI8 Q;  2O5J C;  4BBR G;  5BN5 A;  3FKI B;  5M5W B;  3N6R A;  4LF6 Q;  2C35 B;  1PHJ A;  4GLV B;  2TSS A;  1F9P A;  2R92 H;  2JA8 B;  4DV5 Q;  3KF6 A;  2OTL A;  1EL0 A;  1N36 L;  2MO1 A;  4BY7 B;  2D9U A;  2I5H A;  3VR6 A;  3KJP A;  1IBK Q;  2K04 A;  1E2W A;  3K59 A;  4ME5 A;  4P73 A;  4NMZ A;  2FHT A;  3CQZ B;  1SBB B;  2JJQ A;  4DR1 Q;  4A75 A;  3KLW A;  1VQ7 A;  1E22 A;  5GAH C;  2VQF Q;  4FDB A;  4ZLT F;  3HZX A;  4MIU A;  3GTM B;  1OXT A;  3A0J A;  2N3S A;  4DR3 L;  3PUW A;  2D5D A;  4BY1 B;  3QWN A;  4AQY Q;  1PH9 A;  2F0S A;  3UI2 A;  2NVX H;  1VF7 A;  4V19 0;  2Z1C A;  1C8C A;  1QOH A;  2H4O A;  1JC7 A;  3FP9 A;  1HCZ A;  1TT2 A;  1UWV A;  1EIG A;  2HQL A;  3PCO B;  3I7F A;  4B3R L;  4R4O A;  2CCZ A;  2RKS A;  2JP1 A;  3TDQ A;  1XXG A;  2VUM G;  3HOW H;  4I7Z C;  3S1M B;  2B63 H;  2JK8 A;  2F3V A;  3CCM A;  5JVG 3;  4DR7 Q;  1FJG Q;  3DEP A;  2GVA A;  5I2X A;  1D6E C;  2L12 A;  1V1P B;  2L1B A;  3KLR A;  1CK1 A;  2F0Q A;  5GQO A;  1GUG A;  2KEC A;  1I4Q A;  4LUO A;  4MN3 A;  4LFA Q;  2MQH A;  2RSN A;  4BBR H;  5J22 A;  4RA8 A;  4GNX A;  3QO2 A;  4IJL A;  2YTY A;  1L1O A;  4LK1 C;  1EY6 A;  5IGC A;  4HJ5 A;  2A6H D;  5LMN Q;  3NQI A;  3HOV G;  3LWE A;  5JPN C;  4NDX A;  1QB5 D;  5M3F B;  5GAE C;  1GKH A;  3F2U A;  1N33 L;  4OL7 A;  4KY5 A;  4CBV A;  3VDY A;  3HOZ B;  4OWT B;  1S5F D;  1D1K A;  1Q8I A;  3NQT A;  3IKJ A;  1B70 B;  1F2L A;  3S14 B;  4FXK C;  5HY6 A;  5JEA G;  2GVB A;  4IJH A;  4A3B G;  4JBJ A;  2CH4 W;  3NBH B;  3OTO Q;  4OGQ C;  1VQP A;  4A3M G;  4MNO A;  3SR1 A;  3X3M A;  4PV1 C;  4GOP C;  1T5E A;  1YIT A;  1MBY A;  4L5S A;  4IAL A;  5KND A;  2TMP A;  3M4O B;  1BXT A;  2PI2 E;  3CRL C;  3NBI A;  1L0X B;  5M5Y B;  2I5M X;  4DPG A;  4DV4 L;  4PMB A;  3PUV A;  1VQF A;  2SNS A;  1PVO A;  1Q3L A;  1B3A A;  2CW0 D;  4JCV E;  2DNC A;  3BU2 A;  2EY6 A;  4G57 A;  3CME A;  4IOC A;  4A3J B;  4BBS B;  2CWA A;  3MFG A;  3OW2 A;  3AU7 A;  5CV5 A;  4YIJ A;  3C46 A;  1WYD A;  3PO2 G;  2UU9 Q;  2N78 A;  1WTW A;  2B2V A;  1K73 C;  3F1Z A;  1PH7 A;  3CCV A;  3CCL A;  4CKE A;  2K5W A;  1SLJ A;  3BJU A;  2QKI C;  5I2Y A;  4IPH A;  2F0J A;  4NW2 A;  3WOE A;  3IL8 A;  1EIF A;  2B2W A;  1Q12 A;  2PCF B;  2WKC A;  4FYD A;  1KL9 A;  1KTK A;  1PH6 A;  1BCP B;  1TS2 A;  4QQB X;  3EIV A;  3TS2 A;  1LLR D;  3E3X A;  1A2U A;  4O0A A;  3HOX H;  2ZJP A;  1PTO C;  4NXN Q;  3HFZ B;  1CZG A;  2CHB D;  4IO9 A;  1WD1 A;  2A8V A;  3F2B A;  4DUY L;  1VQA A;  4DU9 A;  4C3I B;  1V1Q A;  1ZXT A;  4A3M H;  4TQU S;  2K7V A;  3HKZ B;  3GTQ B;  1IXR A;  2GN5 A;  3JAM L;  1A6X A;  1FD7 D;  2F3W A;  4DUZ Q;  4DR4 Q;  3QOJ A;  3KF6 B;  1IBL Q;  1WJJ A;  1ICF B;  2VNU D;  2EPB A;  5JJK A;  1WCM B;  2NZO A;  2EJM A;  2JEA I;  4JI1 Q;  3PIP A;  3NEN A;  4ALP A;  4J8Q A;  2KJX A;  1VQ4 A;  1U4M A;  3ULP A;  2I0Q A;  2I07 B;  2KVM A;  2NZ1 D;  2HQE A;  3EQL C;  1IBM L;  2K52 A;  3ULL A;  1EWH A;  4IZ8 A;  3PGZ A;  5EPL A;  2A6E C;  1IKL A;  5C0X J;  4GKJ Q;  3PO2 H;  4JOI A;  3QR8 A;  4YWL A;  3MXU A;  2K14 A;  3U58 A;  3V05 A;  3BZK A;  4WRD A;  4B9W A;  5J39 A;  1JMC A;  2C5C A;  4X65 L;  2BDO A;  1L0W A;  1DOM A;  2JYO A;  4IFD J;  4DAY A;  2PQA A;  2DY8 A;  5M5X B;  3PF5 A;  3P20 A;  3C1E A;  4A3G B;  1X3G A;  4OEL B;  2HT1 A;  1SAP A;  3GTG H;  1K0R A;  2NB0 A;  4JBM A;  4YHH L;  2WV6 D;  4OEM B;  4X6A H;  2OQK A;  1HQM C;  4PZ6 A;  2ZXO A;  2PQE A;  4B9X A;  3H0G B;  1VMP A;  2Z9H A;  1N36 Q;  4YCV A;  3L0O A;  5EKL A;  1ENA A;  4H13 C;  3KFU A;  4OWW B;  4CDE C;  4FF3 A;  2UXB L;  2CWP A;  4GNX B;  1DON A;  4G7H C;  1L1O B;  1HTP A;  1STA A;  5IYD G;  1PYS B;  2A5H A;  4HIM A;  4JG2 A;  4ABN A;  1K0S A;  2E2H B;  1D7Q A;  3AFP A;  3URY A;  4DR3 Q;  1ROD A;  5ELO A;  4KHP L;  2O4X A;  1I4P A;  1HR0 L;  2NN6 G;  1PZI D;  2AHO B;  5GAD C;  1RHP A;  1AW7 A;  2PZT A;  4KK7 A;  1M8A A;  2OEO A;  1Y1W H;  3MHB A;  3WWV A;  1T5X D;  4OIK A;  1ZKO A;  3H15 A;  1Y1V H;  2CVR A;  4B3R Q;  1XJV A;  1SR3 A;  2K28 A;  1FNV A;  2RBM A;  2G9H D;  1X3F A;  4GLA C;  2F0U A;  1LT5 D;  3SK4 A;  3VYR A;  1HPC A;  4CDD C;  2WP8 J;  4JI5 L;  4FXG C;  1D5Z C;  2E2D C;  2OTJ A;  4O42 A;  3SDZ A;  4KN7 C;  1S4Z A;  3R2T A;  2X6L A;  1PH5 A;  4A3I G;  3KF8 A;  1LT6 D;  2KOL A;  4HN7 A;  2HIV A;  4FF1 A;  4DA2 A;  4A3K B;  3R2I A;  2YTV A;  1N9W A;  2A1A A;  4N8X 1;  1DYQ A;  1SNP A;  1N33 Q;  1TWF H;  4UY8 C;  2PZU A;  1ASY A;  1A63 A;  4MHE A;  1GJX A;  3KK7 A;  1S5E D;  3W3A A;  2HHH L;  3M4Y A;  5A2Q L;  4JI0 L;  3PMF A;  2BCO A;  3A56 A;  2PMZ B;  2XWB B;  1UE1 A;  3HOU B;  4WFN 3;  1II3 A;  5F2D A;  1SFO H;  4IN3 A;  5D3I B;  5K36 G;  1SE2 A;  4QB4 A;  2A69 C;  2B2Y C;  2DJF C;  2NN6 H;  1KDA A;  3DEO A;  1CHP D;  3TQY A;  3IRB A;  1PFS A;  3K58 A;  5LL6 X;  1J5E L;  2IY5 B;  1KHI A;  4DR5 L;  1E0B A;  2NVQ H;  3M3Y H;  1X3E A;  3E9I A;  3K7U C;  2EJG C;  2AWN A;  4DAP A;  1EY4 A;  1CM9 A;  3J81 i;  1K8G A;  4DV4 Q;  1AZP A;  1LTI D;  3TN2 A;  1X54 A;  3H09 A;  1BNZ A;  3SEB A;  3GTJ B;  1YZ6 A;  5LMU L;  1CA6 A;  3DHQ A;  3I3C A;  5C4J H;  5M3M G;  1KLG D;  5CC4 A;  3E0E A;  2B2T C;  4LUV A;  4A3E G;  5DM6 3;  3NUC A;  5ELD A;  1GHK A;  1G29 1;  2B39 A;  2L9H A;  4DXF A;  1Y1W B;  1H95 A;  3GTL B;  1EU3 A;  3TRE A;  3UDI A;  3PF4 A;  2J0T D;  3NWT A;  3RR5 A;  1H9J A;  2F0V A;  5ELC A;  5C3X A;  1PTO F;  2JSO A;  2K6A A;  4HCE A;  4GOP A;  2ZXP A;  3S1Q B;  5IWA L;  4C3J B;  3D31 A;  5FJ8 G;  4K0K L;  4QIW E;  4DV3 L;  2LSS A;  5C3E B;  1YJN A;  3PO3 G;  3S1N B;  2JA7 G;  1KIX A;  2ID0 A;  5BN4 A;  2F0N A;  1H9R A;  4DAY B;  1VQL A;  2PQA B;  1EU4 A;  2A6E D;  4DUY Q;  5K36 H;  2KQ3 A;  4X3T A;  1KC8 C;  2JA5 G;  5FO7 B;  1EFI D;  2UXC L;  1GD7 A;  1U0L A;  4Y52 H;  3MA2 B;  2OF1 A;  4DNI A;  4A3D G;  4HR7 B;  1FGU A;  1EZ8 A;  1GM5 A;  2XTI A;  4YY3 L;  4HJA A;  3D4R A;  5L37 A;  1KRT A;  1VQ8 A;  4UDU C;  1TWF B;  1I50 B;  1RF2 D;  2CH4 A;  4ZAI A;  1N34 L;  1SXT A;  3EN2 A;  4KKT A;  2KA7 A;  1BOS A;  2Y0S E;  2F0H A;  1S72 A;  1F2M A;  5J3B A;  4MTN A;  5NUC A;  4K2L A;  3Q24 A;  1JR0 D;  1IBM Q;  1J9O A;  4ZKB B;  5H1S E;  4DV1 L;  2V4D A;  3NTK A;  4H02 A;  1LTS D;  2CFM A;  4A3E H;  1F77 A;  2F0P A;  3M4P A;  3V2T A;  3CPW A;  1Z47 A;  1NTG A;  3F2D A;  1I6H H;  1HXY D;  3K7A H;  4HSP A;  3FMC A;  4X65 Q;  2PW7 A;  3PUZ A;  5CGK A;  1U4R A;  2FMC A;  2RDH A;  4A3G G;  1VQ9 A;  2LFN A;  5C6A A;  1TVX A;  1I5F A;  1DOL A;  4P71 A;  1WFQ A;  3WOF A;  3BVM A;  2A6H C;  1QG7 A;  4DK0 A;  5FJ8 H;  4YHH Q;  2Z6K A;  1BF4 A;  3ND9 A;  1TWG H;  3PO3 H;  3NTH A;  4EQ5 A;  4ULL A;  2CQA A;  3DUZ A;  3H94 A;  1TR5 A;  1G2S A;  4LF9 L;  1Y8P B;  4X3U A;  2UXB Q;  4G7O C;  3KF8 B;  3P1H A;  4C56 C;  2B3G A;  2RQX A;  2F0I A;  1TWC H;  4PNY A;  3GQB A;  4A3D H;  3S2D B;  1SSO A;  3Q22 A;  4X62 L;  4QCL A;  5C4X B;  3CCJ A;  1JOQ A;  5FO8 B;  4OO1 G;  4KHP Q;  2R7Z B;  1HR0 Q;  1YVC A;  5D3D A;  3NK9 A;  5DM7 3;  1PH4 A;  2KCM A;  1GHJ A;  1W6J A;  4RAU C;  1ZYR C;  1GUT A;  1X32 A;  1DGS A;  1AZQ A;  1BUV T;  3JC6 6;  2ZTC A;  5A2Q E;  3CPF A;  1JOK A;  3BVZ A;  4B08 A;  1EOV A;  3CCE A;  4C3H B;  5IYC G;  4BA1 I;  3Q8D A;  1KNE A;  2BH8 A;  2FXQ A;  3NPP A;  4JI5 Q;  4IUR A;  2O5I C;  3CCU A;  1ILP A;  2KUM A;  3NTI A;  2EYH A;  5JPM C;  3MAQ A;  3G48 A;  2MPM A;  5IP7 H;  5LMN W;  1LT3 D;  3CKI B;  3QOL A;  4A3F B;  1SYD A;  3L3O C;  2AUK A;  1MSG A;  2A19 A;  2OT2 A;  2RSO A;  4HCS A;  3BG3 A;  3KDF A;  4IUT A;  2QEX A;  1Q1E A;  4UP8 A;  3J7Z C;  2HHH Q;  4JI0 Q;  1VQO A;  1STB A;  4HMJ A;  4MZ9 A;  1EQV A;  4BBS G;  4H44 C;  2YU9 B;  2DY7 A;  3D4W A;  2BE5 D;  1BQQ T;  4OO1 H;  3S1R B;  5ELF A;  4X66 L;  5G3L F;  4CGY B;  2SOB A;  4LMQ D;  4GOP B;  1K8A C;  2XRQ D;  4IPG A;  4QGU A;  2IX1 A;  1LTL A;  2AMC B;  1JIC A;  2NVY H;  3J81 L;  5IOD A;  1J5E Q;  4DR5 Q;  1K3B C;  3U4Z A;  1YEZ A;  1XX8 A;  3OIQ A;  2HUG A;  3MXP A;  4DK6 C;  1VQ5 A;  4ILW A;  3S2H H;  3K5L A;  4AYB B;  3OHX C;  5EAY A;  3J80 L;  5HUR A;  1TWH H;  5LMU Q;  4KJO A;  1Y69 U;  3T53 B;  2K75 A;  1S3O A;  5IYB G;  1AFP A;  1XWE A;  4C1N I;  4HIO A;  1TS4 A;  2BA0 A;  2F0O A;  1FNU A;  2F0L A;  4C3I G;  1JQY D;  1F2Z A;  2JA6 B;  1NMF A;  2Z4H A;  2B2U A;  4WOR A;  3DM1 A;  2OXP A;  1HA6 A;  4OXP A;  2QCP X;  1SMY D;  2EYJ A;  5IP9 H;  1JB7 A;  1WTX A;  1Q90 A;  4XTC S;  4U67 3;  1RCV D;  1KDB A;  1WCM G;  3NEL A;  3BDL A;  5EPJ A;  4M1U B;  2L0C A;  3D0F A;  1ENC A;  5IWA Q;  3S15 B;  3QJY A;  3W5O A;  2UUB Q;  4K0K Q;  3P75 A;  4DV3 Q;  3UDG A;  1SN8 A;  1PTO B;  4XQQ A;  3EJI A;  1NR4 A;  1MJE A;  2OQ0 A;  3U50 C;  3OW7 A;  1OXV A;  1KAA A;  1N8R C;  2NN6 I;  3I4M H;  2UXC Q;  2RA4 A;  3AYH B;  2B2T A;  2JN4 A;  4YY3 Q;  4P2C B;  1XNR L;  2HD3 A;  2VQE L;  5EGT A;  1SJE D;  3TEH B;  2YTX A;  4DNR B;  4J15 A;  1GUO A;  1N34 Q;  2E5L L;  3I4N B;  2Q2H A;  3KLS X;  3AEV A;  1MIU A;  4OIJ A;  4K5V A;  1KD1 C;  2A74 C;  2EXD A;  2EY5 A;  2AQ2 B;  1B1Z A;  4DV1 Q;  1O7I A;  5CBA E;  1I4X A;  2NWG A;  1Z6H A;  1HZ9 A;  3VA7 A;  5CV6 A;  3EFX D;  4K14 A;  1UE5 A;  1G8Z D;  1C4Q A;  4UP9 A;  2WB1 B;  2K01 A;  2Y0S G;  4H0L C;  1CA5 A;  3HOY B;  2F52 A;  3RN2 A;  1TWA H;  3S24 A;  2WAC A;  1JJG A;  4K6L A;  1YHA A;  3HRZ C;  2E2I H;  2R92 B;  2F3I A;  4RGO S;  1ZYR D;  4JV5 L;  1TWH B;  2PYK A;  3UDX A;  1PXU A;  3N52 A;  3RD4 A;  3CP0 A;  2VUM H;  1RTO A;  3T51 B;  3K0Y A;  3EA6 A;  3FVQ A;  2PNH A;  1P8L A;  2JQO A;  3SE0 A;  3VYT A;  1D5M C;  4LF9 Q;  1FNW A;  3J7Y W;  2LXK A;  3J7A 5;  4DV7 L;  2EYP A;  3FPP A;  3BYT B;  2MJ8 A;  4RWS C;  4L5Q A;  3EVQ A;  2RVL A;  1VQD A;  4X62 Q;  1G51 A;  3E5S A;  5IT9 L;  3ITP A;  2N49 A;  3BYY B;  4FP5 D;  3SK5 A;  2NVX B;  3I55 A;  1GVP A;  4N9T A;  5FLM G;  5IGB A;  3KDF B;  4IUQ A;  3A5U A;  4RKB A;  4A3K G;  4JI7 L;  3HOV H;  1YJ9 A;  1GO3 E;  4LWC A;  3A7L A;  4DAV A;  4R4T A;  2HIX A;  3Q0A A;  2PPB C;  2BDN A;  1KAW A;  4DV6 L;  3X3N A;  3R3O A;  1G6P A;  5HGT A;  3HOW B;  2XIW A;  4YWM A;  2B63 B;  4JW0 A;  1MGS A;  2EVB A;  1YNN C;  1OXU A;  5A35 A;  2NVT H;  5JEA H;  4A3B H;  2K50 A;  3MC0 B;  2FMM A;  2PO4 A;  4WJ4 A;  1K83 H;  1A0I A;  4BBR B;  3F8T A;  4XIG S;  2F0W A;  4DKA C;  3SK6 A;  1LTT D;  1VQK A;  5J1Z A;  2KEE A;  3K80 C;  2EOT A;  3T1Y L;  1D5X C;  1E2Z A;  4PMW A;  2E75 C;  1S40 A;  3RUZ A;  1LTA D;  4NXM L;  1DZ1 A;  2JE6 I;  1NCV A;  2PNR C;  2WAQ B;  2E2J H;  2XRS D;  3D3R A;  2EY1 A;  1PRT D;  3J80 E;  1VQJ A;  1CUK A;  1EQT A;  1BVS A;  2MUY A;  2AUJ D;  1UE6 A;  2RDF A;  3U9S A;  5C5M A;  3MXG A;  4RG1 A;  4R8N A;  1TY2 A;  1EEF D;  3C2P A;  1QVC A;  2JA9 A;  1DCZ A;  4X66 Q;  3Q23 A;  1Y14 B;  5FLM H;  4DF7 A;  1ILQ A;  2WKD A;  3E0J A;  1XTD A;  1B53 A;  1SYF A;  1TU2 B;  1PYB A;  5E4X A;  1E7Z A;  3DWA A;  3P7J A;  3G71 A;  5HGQ A;  3RLF A;  3HEJ A;  1X55 A;  4GKK L;  4C3J G;  1YI2 A;  2K5Q A;  1O7Z A;  2AWO A;  3VR4 A;  1WTR A;  4HID A;  3JAM c;  1XTC D;  5JAV A;  4B3T L;  2KCC A;  5E4W C;  2A73 B;  4HJ9 A;  2L5T A;  4Z9C B;  1VCI A;  3GTK H;  4BA2 I;  3RLN A;  3GTO H;  3MEF A;  4TKO B;  2JXM B;  4GN4 B;  1FVI A;  2MP1 A;  1XPO A;  5D65 A;  2N88 A;  4R4C A;  4JI4 L;  1CKM A;  2PZW A;  1A8V A;  1AH9 A;  4FNF A;  1B44 D;  1ENF A;  3OMG A;  2XNA C;  2F4V L;  1F9Q A;  1PDQ A;  2WB1 E;  1EUJ A;  3HOX B;  4IPC A;  5I6Y A;  1M1K C;  3I90 A;  4APV A;  1CTM A;  4JC0 A;  3ZJY C;  4A3M B;  1NMG A;  1JWS D;  1F2Y A;  1I3Q H;  1U5K A;  3G6J B;  4K5X A;  4OO1 I;  1B4O A;  5C5L A;  4IUN A;  5E1F A;  3CMA A;  4QF4 A;  1DOK A;  2X6G A;  4WJ3 M;  2CQO A;  1LUZ A;  1XNR Q;  5BR8 L;  2VQE Q;  1PV4 A;  5ELN A;  2QW7 A;  1BCP C;  2OCE A;  2L11 A;  2E5L Q;  3HG9 A;  3A55 A;  1FR3 A;  4F87 A;  1AEX A;  5DAU A;  1HNX L;  4XYO A;  3KBX A;  3PO2 B;  4LUZ A;  2ZTD A;  2EDG A;  3BDC A;  4EQO A;  5EQ0 A;  5FO9 B;  2MNA A;  2I5L X;  1EYG A;  4GN5 A;  3BZC A;  1YNX A;  3KJO A;  5IYD H;  1Y8N B;  5IT9 E;  3L2P A;  1X3P A;  2G9D A;  4C2M H;  2R3Z A;  1XYI A;  3DXJ C;  5C4X G;  1GUS A;  1V8Q A;  4K6D A;  1ONL A;  3GTG B;  1B8A A;  1VQN A;  3RZO H;  3TRZ A;  3UDF A;  3PUY A;  1PH1 A;  2RCN A;  2F0E A;  1E2V A;  3WDN A;  1I4R A;  2L15 A;  1IYV A;  4JV5 Q;  3S16 H;  1PZK D;  3R93 A;  2K05 A;  1Q82 C;  1B7Y B;  3TP5 A;  1SDF A;  2NUC A;  1R9T H;  4KTA A;  1O7Y A;  2DJG C;  3HKZ E;  3R8B A;  1A15 A;  2FIN B;  2MFI A;  1D8L A;  3I73 A;  1YNN D;  2PI2 A;  2XWJ B;  3PIO 3;  4DV7 Q;  3MWY W;  5C0X G;  1SNM A;  1NSN S;  1YBY A;  2EYM A;  3JAM E;  1HNZ L;  2WAQ E;  5I4D A;  2BE5 C;  1DD2 A;  1SJH D;  3VR3 A;  4CKB A;  4A3I H;  2NYZ D;  4Y7N H;  4POF A;  4POG A;  2X69 A;  4GS3 A;  3AB9 A;  1M4V A;  1MKH A;  4IFD G;  3CCQ A;  1QJO A;  4V0B A;  5C4H A;  2LMC B;  5IGF A;  4JI7 Q;  3CD6 A;  4A93 G;  4GZY C;  5C44 G;  1Y1V B;  4A3F G;  3GD7 A;  3H3V H;  3DM3 A;  2O2L D;  5BN3 A;  1I6V C;  4A3L G;  1ICW A;  1L1O C;  2VB2 X;  3CF5 A;  4JPB W;  2DN8 A;  3PSI A;  5FLX L;  4EGV A;  1EFW A;  1H9M A;  1WOC A;  2D0O A;  3A54 A;  4A3C G;  1JCK B;  5EBD A;  5E3F A;  1A62 A;  2E74 C;  3STB C;  1QWY A;  4IUU A;  3T1Y Q;  2K5N A;  1EY9 A;  1SMY C;  3FHW A;  1WTH A;  2Q8T A;  2R93 G;  5CV8 A;  1WTP A;  1NJI C;  5C3W A;  1DXM A;  1EWC A;  4NXM Q;  1R4P B;  3FKI G;  5I9O A;  3O13 A;  1OXX K;  1QUQ A;  4OHJ A;  3GV6 A;  1U4P A;  3ERQ A;  3NP8 A;  1QVG A;  1O7L A;  2JA8 G;  2IWH A;  3S17 H;  4JI6 L;  1I4H A;  4RHR A;  5C0X H;  4TVA B;  3TZD A;  5M3M H;  1UEB A;  2K5V A;  4BY7 G;  1SFO B;  3B6Y A;  2K1B A;  4KLK A;  5KNC A;  1XMO L;  4RMF A;  2JA6 G;  4IFD H;  4ZRZ A;  3VA5 A;  2NVQ B;  4KD3 A;  3M3Y B;  2F4I A;  1QVF A;  2BH2 A;  3A7A B;  5LMN L;  5IE8 A;  1PMR A;  3HKS A;  4A93 H;  1P16 A;  4X64 L;  5C44 H;  4BY1 G;  1PFN A;  1YHB A;  3SXH A;  2EE1 A;  3W1B A;  1OXS C;  4ODG A;  3MEH A;  1W3S A;  1HZA A;  3ICE A;  2RHQ B;  1Q46 A;  2ZTE A;  4A3L H;  1C48 A;  1ASZ A;  4GKK Q;  1JB3 A;  3K5M A;  2H5X A;  5JVH 3;  2JA7 H;  5C4J B;  1VS0 A;  2Q2I A;  1HRJ A;  2IL8 A;  5GRO A;  4B3T Q;  4A3C H;  1W2B A;  1VQH A;  3QB3 A;  2JA5 H;  1LAC A;  3U9O A;  2J4X A;  5IIF A;  1B9N A;  3NHH A;  4CDC C;  2R93 H;  3RZD H;  5FOB B;  5JJI A;  4K8J A;  1CZW A;  2RDG A;  4L5T A;  4ZUI A;  4ZUJ A;  4JI4 Q;  1UE7 A;  3FKI H;  4K8I A;  5IGE A;  4J6H A;  5M5W H;  2FFK B;  4CKC A;  1FYC A;  3M7G A;  1HFG A;  1BCP D;  2JA8 H;  2PMZ E;  3MXN A;  4NP5 A;  3GTP H;  3TME A;  2F4V Q;  3I4N G;  3BS1 A;  3I91 A;  4HIK A;  3C3L A;  1BBW A;  4BY7 H;  1X3Q A;  5M3F G;  1L2F A;  1IW7 C;  3RLO A;  3PQI A;  2ATW A;  3HOZ G;  1CKN A;  3CQZ H;  2EIF A;  1NBW A;  1JJ2 A;  4ZQ3 A;  1CQV A;  5ELE A;  5JJZ A;  1S5C D;  2WB1 G;  3GTM H;  4MTK A;  1K9M C;  2KHI A;  4GN3 B;  3D6C A;  5JOB A;  2VW9 A;  1VQG A;  4LNQ A;  5BR8 Q;  4JOI C;  3SHL A;  4L6T B;  1EQQ A;  1H9S A;  2R92 G;  5CV4 A;  2ICI A;  3FPU B;  3VR5 A;  1LTG D;  1HNX Q;  4LW1 A;  3RMH A;  4A3E B;  1QIL A;  4ZK9 B;  5IGG A;  4Q5V A;  3S1M H;  3K57 A;  3RNU A;  4RHS A;  1SMX A;  2D62 A;  1I6H B;  1NAP A;  1STY A;  3K7A B;  4RCO A;  1A2T A;  4LFC L;  2EXZ A;  5KRU A;  1SYB A;  1A3T A;  4KHZ A;  4A3J G;  4O2D A;  2XSC A;  4B3M L;  4UAI A;  2K5D A;  2ALY B;  1HTL D;  1ESR A;  4KV6 A;  3CCR A;  2A68 D;  1MJC A;  1JT8 A;  3LX0 A;  1YJW A;  1GUW A;  5T1G A;  4KI0 A;  4QY7 A;  1GXD C;  1XMQ L;  4RGT A;  1Q7Y C;  1T9H A;  1TWG B;  4RCN A;  1O78 A;  3CRK C;  1PRT C;  4G7Z C;  3PO3 B;  1G91 A;  4ZKC B;  4PQX A;  1PH2 A;  2RHS B;  1ESF A;  4XYQ A;  3HOZ H;  1YNJ C;  1SNC A;  5IYC H;  4EQN A;  1I4G A;  4QMG A;  1EY8 A;  1MHW C;  1PLF A;  4JI3 L;  5FLX E;  3F2C A;  2B63 G;  3S14 H;  3UE0 A;  3G6E A;  3SK8 A;  1KNA A;  2VS1 A;  1TWC B;  4A3D B;  1W6K A;  2AQ1 B;  1Z7T A;  3IFD A;  1HNZ Q;  2NZH A;  3M9B A;  2Z4I A;  4P74 A;  2R7F A;  1QUQ B;  1VQI A;  2QDB A;  3GP7 A;  4OWX B;  5KNB A;  3OIP A;  3STB D;  3HKZ G;  3ONA B;  1CHQ D;  4Q0F A;  1SE8 A;  1VMC A;  1EYA A;  3L7Z C;  3M4O H;  3I72 A;  3GTP B;  4EVO A;  2AQ3 B;  1FL0 A;  4QL5 A;  2ZM6 L;  1U9R A;  1MD2 D;  4CDF C;  3M85 A;  5M5Y H;  3H3V C;  2WAQ G;  1NUC A;  1O80 A;  3M7N A;  1QCB D;  4HTH A;  4XT1 B;  2B2Y A;  2RF4 A;  2QGQ A;  1PYW D;  1B50 A;  1IL2 A;  2Z0S A;  4YCU A;  1QNK A;  5KEE A;  4BBS H;  4A3J H;  1NR2 A;  3NEM A;  3J81 c;  4OX9 L;  2AKW B;  4DR2 L;  2ZT9 C;  2ENB A;  4R8I A;  1Q86 C;  4LFB L;  2Q2T A;  4F88 A;  2NTT A;  1CI3 M;  3IAY A;  3J80 c;  3VYS A;  2KHS A; 
#chains in the Genus database with same CATH homology
 5M9O A;  4JBW A;  2XVS A;  1SE3 A;  2XN9 C;  1SNQ A;  5FKA C;  2QF7 A;  1IKM A;  1V43 A;  3E6Z X;  3NSW A;  5KIX A;  4LJZ C;  5EKI A;  1EY5 A;  2EZV A;  4H7B A;  3NWS A;  4TSS A;  3I8Z A;  1SYE A;  2NVY B;  2BOS A;  4RFB A;  1MSH A;  1KDC A;  1SNO A;  1RTN A;  3OPO A;  3S2H B;  3Q6S A;  1B2T A;  1QNU A;  4KY6 A;  3NE5 B;  5CV7 A;  2MHV A;  1V1O A;  3I70 A;  1HFN A;  1UUP A;  1HUM A;  1IW7 D;  1CQF A;  3J7A F;  4J1M A;  1JWM D;  5CYU A;  2HCC A;  2IX3 A;  4KJN A;  5T1I A;  1JOO A;  1PZJ D;  1STG A;  4KY7 A;  1H9S B;  1H9K A;  1GOZ A;  1UNS A;  3DWQ A;  1DM0 B;  1SND A;  1A3V A;  4G4K A;  4M8A A;  2F0F A;  2IW3 A;  4CHT B;  2K03 A;  2B8G A;  4NKL A;  5IOC A;  2J7Z A;  1UEA B;  4XQJ A;  3PV0 A;  5C0X I;  4F7X A;  4L63 B;  3MTS A;  2IX0 A;  3I4L A;  3QIA A;  4KD4 A;  4CJ2 C;  3I4M B;  3KBG A;  4IFD I;  4DXG A;  3W2D A;  3HP3 A;  3BDO A;  3DWP A;  2HDL A;  3J81 E;  2B8F A;  2BA1 A;  4IUP A;  4DN4 M;  4CJ1 B;  2EYL A;  5IGD A;  1RKN A;  4R9W A;  1F9R A;  4N9P A;  5CMD A;  5DNF A;  4IQZ A;  2LKV A;  1HA5 A;  4TRD A;  1YNJ D;  1SYG A;  1EZ6 A;  2H1E A;  1J8I A;  1RD9 D;  1TY0 A;  4DNT B;  3D6W A;  1TWA B;  4F8M A;  3CU7 A;  4L8J A;  2E2I B;  1PRT F;  1CFM A;  1EOT A;  1MI2 A;  5I9P A;  2IT1 A;  1JE4 A;  3D8G A;  1K8M A;  3TZU A;  1HUN A;  2KCN A;  2VUM B;  2EY2 A;  2F0D A;  5KYI A;  4QIW B;  2EYO A;  3HS0 C;  3MVV A;  1SEB D;  2N55 A;  2L55 A;  1JOR A;  2LS0 1;  4E6I A;  4K2K A;  3AMU A;  1HQR D;  1VDZ A;  3HOV B;  3QG1 A;  3A8I E;  4ID6 A;  4CJ0 B;  4PMC A;  5D14 A;  2SDF A;  1L0Y B;  1EY7 A;  1WVL A;  2NVT B;  1G6Z A;  2Y0S B;  4A3B B;  5EBC A;  5ISR A;  5I6W A;  1K83 B;  4X3S A;  3SVM A;  2NTS A;  3C1F A;  2HDM A;  3T16 A;  5EPK A;  4QUF A;  4EQP A;  3L9A X;  2LY7 A;  3G7L A;  5COY A;  2E2J B;  4KN4 C;  4WJW A;  5LL6 S;  3H91 A;  2WIN B;  1WTO A;  1D1I A;  1G2T A;  2F0K A;  3OOC A;  1D2B A;  1BBX C;  1BDO A;  3NXW A;  4RKL A;  2MGS A;  1EIH A;  4HMI A;  4XDX A;  1EY0 A;  3K5N A;  4BWG B;  4C1N K;  3H6M A;  1TQO A;  1SYC A;  4QUC A;  3OMC A;  3ERO A;  4XT3 B;  1ET9 A;  4XQN A;  5COR A;  1OO9 B;  2B2U C;  1LV9 A;  4RGN A;  2VXW A;  2EYF A;  4JK1 C;  4KKS A;  1LT4 D;  4IUV A;  3PUX A;  4HED A;  1Y8O B;  4C3H G;  3GTK B;  4FO2 A;  2F03 A;  3GTO B;  4K5W A;  4O1N A;  4FF2 A;  4I65 A;  1PFB A;  3J7A V;  1LTB D;  1S5D D;  1S5B D;  4KMU C;  3TP8 A;  1UAP A;  2A68 C;  3PIP 3;  3BZD B;  2WII B;  2ZXR A;  1WTQ A;  1EYD A;  1ZEQ X;  2M2L A;  2IPK D;  1PTO D;  1LAB A;  4LAA A;  2Q8R E;  4DK1 A;  1K8O A;  1TII D;  2GA4 B;  1I3Q B;  3IFT A;  2KED A;  1IL8 A;  5FK9 C;  3GV3 A;  1B9M A;  3T56 B;  1EYC A;  3TP6 A;  2C9O A;  5KYL A;  3FDT A;  1TKW B;  1FGB D;  1RJT A;  3DMU A;  2K33 A;  2JEB I;  4U68 A;  2M00 A;  1KLU D;  2D2C C;  2FJ2 A;  5CBE E;  2R61 A;  3BVG A;  3MFY A;  3VR2 A;  4HAE A;  4C2M B;  3CHB D;  1KAB A;  3A8K E;  2L4N A;  3GO5 A;  3MZ5 A;  1WTV A;  2YYZ A;  3RZO B;  2IJ0 A;  4DGZ A;  4DFA A;  3S16 B;  3OWE B;  4FXD A;  3KLS A;  2ICE C;  1PRT B;  1R9T B;  1ML0 D;  2B2V C;  3A8J E;  3S9W A;  3TSS A;  3TBI B;  3HGB A;  3ND8 A;  1BO0 A;  3VYU A;  4ZYS A;  4X3K A;  2F1M A;  1DJR D;  1JWU D;  4RGM A;  5CV9 A;  4FF4 A;  2B2W C;  4A3I B;  1PFM A;  4Y7N B;  2F0G A;  3FEW X;  3LNN A;  1V1P A;  1CT1 D;  3K6O A;  1AP0 A;  2EJF C;  1ET6 A;  1F9S A;  4KHV A;  1WD0 A;  5DEH A;  1RDP D;  4RH6 A;  1QE6 A;  3OWF A;  1STH A;  2NBF A;  1HHV A;  1STE A;  1Q1B A;  1BR9 A;  2F0T A;  2SEB D;  1LO5 D;  1LTR D;  1TS3 A;  2F0M A;  1R4Q B;  2PW5 A;  3T4A C;  3D4D A;  2DNE A;  1BCP F;  4KKU A;  3NBH A;  2R6G A;  1AN8 A;  1TS5 A;  3TP7 A;  3FRP B;  4FVM A;  2CW0 C;  2E76 C;  4BS9 A;  5CR3 A;  3S17 B;  5M3M B;  1PTO H;  1IHZ A;  1EEI D;  5JEA J;  2I46 A;  2A69 D;  3V96 A;  1SE4 A;  5AFW A;  2Z8L A;  4S3S A;  3T13 A;  2VB3 X;  5TSS A;  2QIL A;  1VF5 C;  2K32 A;  4A93 B;  1GUN A;  3LWU A;  5G3L D;  5C44 B;  1U4L A;  5EJW A;  5LHY 1;  1STN A;  2HCI A;  5C4Z A;  4HSV A;  2JA7 B;  2Q8I B;  2M9V A;  5ELB A;  3K5O A;  5K5P A;  4XXE A;  2JA5 B;  3KUP A;  5KGU A;  1IYU A;  1A3U A;  2SNM A;  3ZYY X;  2R93 B;  3OSO A;  3RZD B;  2QEJ C;  5EKK A;  2O5J C;  5BN5 A;  3FKI B;  5M5W B;  3N6R A;  2TSS A;  1F9P A;  2JA8 B;  1EL0 A;  4BY7 B;  2D9U A;  3VR6 A;  2K04 A;  1E2W A;  3K59 A;  4ME5 A;  4NMZ A;  2FHT A;  3CQZ B;  1SBB B;  4ZLT F;  3HZX A;  4MIU A;  3GTM B;  1OXT A;  3PUW A;  2D5D A;  4BY1 B;  3QWN A;  2F0S A;  3UI2 A;  1VF7 A;  4V19 0;  2Z1C A;  1C8C A;  1QOH A;  2H4O A;  1JC7 A;  1HCZ A;  1TT2 A;  1EIG A;  2RKS A;  2JP1 A;  3TDQ A;  1XXG A;  4I7Z C;  3S1M B;  2F3V A;  5JVG 3;  3DEP A;  5I2X A;  1D6E C;  2L12 A;  1V1P B;  2L1B A;  3KLR A;  1CK1 A;  2F0Q A;  1GUG A;  2KEC A;  1I4Q A;  4MN3 A;  2RSN A;  5J22 A;  4RA8 A;  3QO2 A;  4LK1 C;  1EY6 A;  5IGC A;  2A6H D;  3NQI A;  3LWE A;  5JPN C;  4NDX A;  1QB5 D;  5M3F B;  3F2U A;  4OL7 A;  4KY5 A;  4CBV A;  3HOZ B;  1S5F D;  1D1K A;  1Q8I A;  3NQT A;  3IKJ A;  1F2L A;  3S14 B;  4FXK C;  5JEA G;  4OGQ C;  3SR1 A;  3X3M A;  4PV1 C;  1T5E A;  1MBY A;  4IAL A;  5KND A;  2TMP A;  3M4O B;  1BXT A;  3CRL C;  3NBI A;  1L0X B;  5M5Y B;  4PMB A;  3PUV A;  2SNS A;  1Q3L A;  1B3A A;  2CW0 D;  2DNC A;  2EY6 A;  4G57 A;  4A3J B;  4BBS B;  3MFG A;  3AU7 A;  5CV5 A;  4YIJ A;  3C46 A;  1WTW A;  2B2V A;  4CKE A;  2K5W A;  2QKI C;  5I2Y A;  2F0J A;  4NW2 A;  3WOE A;  3IL8 A;  2B2W A;  2PCF B;  1Q12 A;  2WKC A;  4FYD A;  1KTK A;  1BCP B;  1TS2 A;  1LLR D;  1A2U A;  1PTO C;  1CZG A;  2CHB D;  1WD1 A;  4DU9 A;  4C3I B;  1ZXT A;  4TQU S;  2K7V A;  3HKZ B;  3GTQ B;  3JAM L;  1A6X A;  1FD7 D;  2F3W A;  3QOJ A;  2VNU D;  2EPB A;  1WCM B;  2EJM A;  2JEA I;  4J8Q A;  2KJX A;  1U4M A;  2I07 B;  2KVM A;  2NZ1 D;  2HQE A;  3EQL C;  1EWH A;  4IZ8 A;  5EPL A;  2A6E C;  1IKL A;  5C0X J;  3MXU A;  3V05 A;  4WRD A;  4B9W A;  5J39 A;  2C5C A;  2BDO A;  1DOM A;  2JYO A;  4IFD J;  4DAY A;  2DY8 A;  5M5X B;  3P20 A;  3C1E A;  4A3G B;  1SAP A;  2NB0 A;  2WV6 D;  1HQM C;  2ZXO A;  2PQE A;  4B9X A;  3H0G B;  1VMP A;  5EKL A;  1ENA A;  4H13 C;  4FF3 A;  1DON A;  4G7H C;  1HTP A;  1STA A;  2A5H A;  4ABN A;  2E2H B;  3URY A;  1ROD A;  2O4X A;  1I4P A;  2NN6 G;  1PZI D;  1RHP A;  1AW7 A;  2PZT A;  4KK7 A;  1M8A A;  2OEO A;  3MHB A;  1T5X D;  4OIK A;  1ZKO A;  2CVR A;  2K28 A;  1FNV A;  2RBM A;  2G9H D;  2F0U A;  1LT5 D;  3SK4 A;  3VYR A;  1HPC A;  2WP8 J;  4FXG C;  1D5Z C;  2E2D C;  4O42 A;  3SDZ A;  4KN7 C;  1S4Z A;  3R2T A;  2X6L A;  3KF8 A;  1LT6 D;  2KOL A;  4HN7 A;  4FF1 A;  4DA2 A;  4A3K B;  3R2I A;  1SNP A;  1DYQ A;  2PZU A;  4MHE A;  1GJX A;  3KK7 A;  1S5E D;  3W3A A;  3M4Y A;  5A2Q L;  3PMF A;  2BCO A;  3A56 A;  2PMZ B;  2XWB B;  3HOU B;  4WFN 3;  1II3 A;  5F2D A;  4IN3 A;  5D3I B;  5K36 G;  1SE2 A;  4QB4 A;  2A69 C;  2B2Y C;  2NN6 H;  1KDA A;  3DEO A;  1CHP D;  3K58 A;  5LL6 X;  1E0B A;  2EJG C;  2AWN A;  4DAP A;  1EY4 A;  1CM9 A;  1AZP A;  1LTI D;  3TN2 A;  3H09 A;  1BNZ A;  3SEB A;  3GTJ B;  1CA6 A;  3DHQ A;  3I3C A;  1KLG D;  5CC4 A;  2B2T C;  5DM6 3;  3NUC A;  5ELD A;  1GHK A;  1G29 1;  2B39 A;  2L9H A;  4DXF A;  1Y1W B;  3GTL B;  1EU3 A;  2J0T D;  3NWT A;  1H9J A;  2F0V A;  5ELC A;  5C3X A;  1PTO F;  2JSO A;  2K6A A;  4HCE A;  2ZXP A;  3S1Q B;  4C3J B;  3D31 A;  5C3E B;  3S1N B;  2ID0 A;  5BN4 A;  2F0N A;  1H9R A;  1EU4 A;  2A6E D;  5K36 H;  2KQ3 A;  4X3T A;  5FO7 B;  1EFI D;  3MA2 B;  2OF1 A;  4HR7 B;  1EZ8 A;  3D4R A;  4UDU C;  1TWF B;  1I50 B;  1RF2 D;  4ZAI A;  1SXT A;  4KKT A;  2KA7 A;  1BOS A;  2F0H A;  1F2M A;  5NUC A;  4K2L A;  3Q24 A;  1JR0 D;  1J9O A;  4ZKB B;  2V4D A;  3NTK A;  1LTS D;  1F77 A;  2F0P A;  3V2T A;  1Z47 A;  1HXY D;  4HSP A;  3FMC A;  2PW7 A;  3PUZ A;  5CGK A;  1U4R A;  2FMC A;  2RDH A;  2LFN A;  5C6A A;  1TVX A;  1DOL A;  3WOF A;  3BVM A;  2A6H C;  1QG7 A;  4DK0 A;  1BF4 A;  3ND9 A;  3NTH A;  4ULL A;  2CQA A;  3DUZ A;  3H94 A;  1TR5 A;  1G2S A;  1Y8P B;  4X3U A;  4G7O C;  3P1H A;  4C56 C;  2RQX A;  2F0I A;  3S2D B;  4PNY A;  3GQB A;  1SSO A;  3Q22 A;  4QCL A;  5C4X B;  1JOQ A;  5FO8 B;  4OO1 G;  2R7Z B;  5D3D A;  3NK9 A;  5DM7 3;  1GHJ A;  4RAU C;  1W6J A;  1ZYR C;  1GUT A;  1X32 A;  1AZQ A;  1BUV T;  5A2Q E;  1JOK A;  3BVZ A;  4B08 A;  4C3H B;  4BA1 I;  1KNE A;  3NPP A;  4IUR A;  2O5I C;  1ILP A;  2KUM A;  3NTI A;  2EYH A;  5JPM C;  3MAQ A;  2MPM A;  1LT3 D;  3CKI B;  3QOL A;  4A3F B;  1SYD A;  3L3O C;  2AUK A;  1MSG A;  2OT2 A;  2RSO A;  4HCS A;  3BG3 A;  4IUT A;  1Q1E A;  1STB A;  4HMJ A;  1EQV A;  4H44 C;  2YU9 B;  2DY7 A;  3D4W A;  2BE5 D;  1BQQ T;  4OO1 H;  3S1R B;  5ELF A;  5G3L F;  4CGY B;  2SOB A;  4LMQ D;  2XRQ D;  2IX1 A;  1JIC A;  3J81 L;  5IOD A;  1XX8 A;  3OIQ A;  2HUG A;  3MXP A;  4ILW A;  3K5L A;  4AYB B;  3OHX C;  3J80 L;  5HUR A;  4KJO A;  1Y69 U;  3T53 B;  1AFP A;  1XWE A;  4C1N I;  1TS4 A;  2BA0 A;  2F0O A;  1FNU A;  2F0L A;  4C3I G;  1JQY D;  1F2Z A;  2JA6 B;  2Z4H A;  2B2U A;  4WOR A;  3DM1 A;  2OXP A;  1HA6 A;  2QCP X;  1SMY D;  2EYJ A;  1WTX A;  1Q90 A;  4XTC S;  4U67 3;  1RCV D;  1KDB A;  3BDL A;  5EPJ A;  4M1U B;  2L0C A;  1ENC A;  3S15 B;  3QJY A;  3P75 A;  1PTO B;  4XQQ A;  3EJI A;  1NR4 A;  3OW7 A;  1OXV A;  1KAA A;  2NN6 I;  2RA4 A;  2B2T A;  4P2C B;  5EGT A;  1SJE D;  4DNR B;  1GUO A;  3I4N B;  3KLS X;  4OIJ A;  4K5V A;  2A74 C;  2EY5 A;  2AQ2 B;  1B1Z A;  5CBA E;  1I4X A;  2NWG A;  1Z6H A;  3VA7 A;  5CV6 A;  3EFX D;  4K14 A;  1G8Z D;  1C4Q A;  2WB1 B;  2K01 A;  4H0L C;  1CA5 A;  3HOY B;  2WAC A;  4K6L A;  3HRZ C;  2R92 B;  4RGO S;  1ZYR D;  1TWH B;  2PYK A;  1PXU A;  3N52 A;  3RD4 A;  1RTO A;  3T51 B;  3K0Y A;  3EA6 A;  3FVQ A;  3SE0 A;  3VYT A;  1D5M C;  1FNW A;  3J7Y W;  2EYP A;  3FPP A;  3BYT B;  2MJ8 A;  4RWS C;  3EVQ A;  2RVL A;  3E5S A;  5IT9 L;  3ITP A;  3BYY B;  4FP5 D;  3SK5 A;  2NVX B;  4N9T A;  5IGB A;  4IUQ A;  4RKB A;  3A7L A;  4DAV A;  2PPB C;  3Q0A A;  2BDN A;  3X3N A;  3R3O A;  5HGT A;  3HOW B;  2XIW A;  2B63 B;  1MGS A;  2EVB A;  5A35 A;  1OXU A;  1YNN C;  5JEA H;  3MC0 B;  2FMM A;  2PO4 A;  4BBR B;  4XIG S;  2F0W A;  3SK6 A;  1LTT D;  5J1Z A;  2KEE A;  2EOT A;  1D5X C;  1E2Z A;  4PMW A;  2E75 C;  3RUZ A;  1LTA D;  1DZ1 A;  2JE6 I;  1NCV A;  2PNR C;  2WAQ B;  2XRS D;  3D3R A;  2EY1 A;  1PRT D;  3J80 E;  1EQT A;  2MUY A;  2AUJ D;  2RDF A;  3U9S A;  5C5M A;  3MXG A;  4R8N A;  1TY2 A;  1EEF D;  3C2P A;  1DCZ A;  3Q23 A;  4DF7 A;  1ILQ A;  2WKD A;  3E0J A;  1B53 A;  1SYF A;  1TU2 B;  5E4X A;  3DWA A;  3P7J A;  3RLF A;  3HEJ A;  4C3J G;  2K5Q A;  1O7Z A;  2AWO A;  3VR4 A;  1WTR A;  1XTC D;  5JAV A;  2KCC A;  5E4W C;  2A73 B;  2L5T A;  4Z9C B;  1VCI A;  4BA2 I;  4TKO B;  2JXM B;  2MP1 A;  5D65 A;  2N88 A;  2PZW A;  4FNF A;  1B44 D;  1ENF A;  3OMG A;  2XNA C;  1F9Q A;  1PDQ A;  3HOX B;  5I6Y A;  3I90 A;  1CTM A;  4A3M B;  1JWS D;  1F2Y A;  3G6J B;  4K5X A;  4OO1 I;  1B4O A;  5C5L A;  4IUN A;  5E1F A;  4QF4 A;  1DOK A;  2X6G A;  1BCP C;  2L11 A;  3HG9 A;  3A55 A;  1FR3 A;  4F87 A;  1AEX A;  5DAU A;  4XYO A;  3KBX A;  3PO2 B;  2EDG A;  3BDC A;  4EQO A;  5EQ0 A;  5FO9 B;  1Y8N B;  5IT9 E;  1X3P A;  2G9D A;  1XYI A;  2R3Z A;  3DXJ C;  1GUS A;  1V8Q A;  4K6D A;  1ONL A;  3GTG B;  3PUY A;  2F0E A;  1E2V A;  3WDN A;  1I4R A;  1IYV A;  1PZK D;  3R93 A;  2K05 A;  3TP5 A;  1SDF A;  2NUC A;  4KTA A;  1O7Y A;  3R8B A;  1A15 A;  2FIN B;  3I73 A;  1YNN D;  2XWJ B;  3PIO 3;  3MWY W;  5C0X G;  1SNM A;  1NSN S;  2EYM A;  3JAM E;  5I4D A;  2BE5 C;  1DD2 A;  1SJH D;  3VR3 A;  4CKB A;  2NYZ D;  2X69 A;  3AB9 A;  1M4V A;  4IFD G;  1QJO A;  4V0B A;  5C4H A;  2LMC B;  5IGF A;  4GZY C;  1Y1V B;  3GD7 A;  2O2L D;  5BN3 A;  1I6V C;  1ICW A;  2VB2 X;  2DN8 A;  5FLX L;  4EGV A;  1H9M A;  3A54 A;  1JCK B;  5EBD A;  5E3F A;  2E74 C;  1QWY A;  4IUU A;  1EY9 A;  1SMY C;  2Q8T A;  5CV8 A;  1WTP A;  5C3W A;  1DXM A;  1EWC A;  1R4P B;  5I9O A;  3O13 A;  1OXX K;  4OHJ A;  3GV6 A;  1U4P A;  3ERQ A;  3NP8 A;  1O7L A;  2IWH A;  1I4H A;  4RHR A;  5C0X H;  3TZD A;  1SFO B;  2K1B A;  5KNC A;  4IFD H;  4ZRZ A;  3VA5 A;  2NVQ B;  4KD3 A;  3M3Y B;  2F4I A;  3A7A B;  1PMR A;  1PFN A;  3SXH A;  2EE1 A;  1OXS C;  4ODG A;  3MEH A;  1C48 A;  1JB3 A;  3K5M A;  5JVH 3;  5C4J B;  1HRJ A;  2IL8 A;  3QB3 A;  1LAC A;  3U9O A;  2J4X A;  5IIF A;  1B9N A;  3NHH A;  5FOB B;  4K8J A;  1CZW A;  2RDG A;  4ZUI A;  4ZUJ A;  4K8I A;  5IGE A;  4J6H A;  2FFK B;  4CKC A;  1FYC A;  3M7G A;  1HFG A;  1BCP D;  3MXN A;  4NP5 A;  3TME A;  3BS1 A;  3I91 A;  3C3L A;  1X3Q A;  1IW7 C;  4ZQ3 A;  1CQV A;  5ELE A;  5JJZ A;  1S5C D;  3D6C A;  5JOB A;  3SHL A;  4L6T B;  1H9S A;  5CV4 A;  2ICI A;  3FPU B;  3VR5 A;  1LTG D;  3RMH A;  4A3E B;  1QIL A;  4ZK9 B;  5IGG A;  4Q5V A;  3K57 A;  4RHS A;  2D62 A;  1I6H B;  1NAP A;  1STY A;  3K7A B;  4RCO A;  1A2T A;  2EXZ A;  5KRU A;  1SYB A;  1A3T A;  4KHZ A;  2XSC A;  4UAI A;  2K5D A;  1HTL D;  1ESR A;  4KV6 A;  2A68 D;  3LX0 A;  1GUW A;  5T1G A;  4KI0 A;  1GXD C;  4RGT A;  1TWG B;  4RCN A;  1O78 A;  3CRK C;  1PRT C;  4G7Z C;  3PO3 B;  1G91 A;  4ZKC B;  4PQX A;  1ESF A;  4XYQ A;  1YNJ C;  1SNC A;  4EQN A;  1I4G A;  4QMG A;  1EY8 A;  1PLF A;  5FLX E;  3SK8 A;  1KNA A;  1TWC B;  4A3D B;  1W6K A;  2AQ1 B;  1Z7T A;  3IFD A;  2Z4I A;  3GP7 A;  2QDB A;  5KNB A;  3OIP A;  3ONA B;  1CHQ D;  4Q0F A;  1VMC A;  1EYA A;  3L7Z C;  3I72 A;  3GTP B;  4EVO A;  2AQ3 B;  1U9R A;  1MD2 D;  3M85 A;  3H3V C;  1NUC A;  1O80 A;  3M7N A;  1QCB D;  4HTH A;  4XT1 B;  2B2Y A;  1PYW D;  1B50 A;  1QNK A;  5KEE A;  1NR2 A;  2ZT9 C;  2ENB A;  4R8I A;  4F88 A;  2NTT A;  1CI3 M;  3IAY A;  3VYS A;  2KHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...