1HNWL

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hnwL00
2Q2UA 4C3HH 1TWCH 3KOJA 3E9HA 4JI2L 3HOXH 4A3KG 2ZJPA 2JA8H 1X9NA 3PGZA 3JAMi 1Y1WG 3KJOA 4HIOA 2R92G 3H0GG 4UPAA 1M90C 2Q2TA 3UDIA 4DV6Q 2F4VQ 4B3RQ 3TS0A 3F2BA 2JEAI 4DR7L 1W3SA 2R92H 1VS0A 3TREA 1JJ2A 2K5VA 4X65L 2OWOA 2HHHL 1Q81C 2CKZB 3L7ZC 2R93H 5GROA 3JC66 4OX9L 1Y1VH 2JA6G 3MEFA 1P8LA 4OWXB 2IY5B 5C44G 5ELNA 1N34L 1XMQL 4IFDG 4L5RC 1XMOQ 2OQ0A 4UP7A 3H3VI 2JA6H 1KHIA 3TEHB 5LMNW 2LXJA 4DV4Q 1FVIA 3CW2C 4EQ5A 5LMUL 4LF6Q 4MNOA 4LFAQ 2IT1A 2FXQA 4IPGA 3CCMA 2I5HA 1W2BA 1HNXQ 1Y14B 3CCJA 4BY1H 4LF8L 2LXKA 2YYZA 1HZAA 1A62A 1I50H 1VQHA 4A3FH 3CC7A 2UUCL 1OXUA 1HR0W 4A3LG 4DR6Q 4DV5Q 3OTOL 3T1HQ 1H95A 3OYYA 3U4VA 1WOCA 3HOZH 1VQBA 2PMZE 3J7A5 4A3LH 4JBWA 3CAMA 5M3FG 4J15A 3U4ZA 4DK6C 3H15A 3F2DA 4IPDA 4DR3L 4DR5Q 5LMNQ 4C3JH 5H1SE 5IP7H 3J81j 2OCEA 2NN6G 5BR8L 1TWHH 1CSPA 3W5OA 5HGQA 3PCOB 3CCRA 5M5YH 4DV1L 3M4QA 4JI7Q 4Y52H 2ALYB 1B8AA 5IWAQ 3UDXA 4GLVB 5FLMG 2B3GA 1N36Q 1R9TH 2OTLA 4DR7Q 1WJJA 1TWAH 4A3CH 1TWFH 3PUVA 5IYDH 4GOPC 5FLMH 2K5HA 3BZKA 3RNUA 2LSSA 1X6OA 3NELA 5C3EG 4YWLA 1VQ6A 3RLFA 4JI0Q 4QGUA 4GNXC 1XMQQ 4AYBE 2VQEL 1SLJA 1IBLL 5C4XG 4AYBG 3AFQA 3I7FA 3HOWG 1E3PA 1Q12A 2F3IA 4WJ4A 1NY4A 1VQDA 4GLXA 3CCVA 1S40A 4GOPB 4BXXH 1PYBA 4HJ8A 1XJVA 1QVFA 4GNXB 1C9OA 4ME3A 4JYAL 4DUZL 1K73C 2A19A 1NBWA 2MQHA 2MNAA 1BBUA 1NJIC 4JI8Q 1WI5A 1E7ZA 2WAQE 3CCSA 2JA9A 4LF7L 5HY6A 4JC0A 4A3IG 4RMFA 3ULPA 4C2MH 3S14H 2E2HH 4LUOA 1DGSA 4DR3Q 3U50C 4A3EH 1VQKA 4R4QA 4YY3L 4JI6Q 1X55A 1KRSA 5IYCH 2NVYH 4GOPA 2N3SA 2I5LX 2I0QA 3G71A 3S2HH 1EQQA 4GNXA 3PO3G 2UXDL 1FL0A 4MZ9A 1KQSA 3UE0A 3K8AA 1PH6A 5JEAJ 1OXTA 5IYBG 1Q7YC 4DV6L 3F1ZA 5IT9c 2F4VL 4B3RL 1GD7A 2HIVA 4JOIC 4ALPA 3T1YL 2ZTCA 1PA6A 1E1TA 1WCMH 3Q8DA 5IYBH 2K50A 3HOUG 1WYDA 4A93G 4A76A 2Y0SE 2VQEQ 3M3YH 1UWVA 2WB1G 1IBLQ 3W1BA 3L0OA 2D0OA 4YWKA 3NENA 1UEBA 1G291 2VZAA 5E7NA 1XMOL 2ZTDA 1I5FA 4L5TA 2Z6KC 1NE3A 3B6YA 4GLAC 2JE6I 3GDEA 5GQOA 4A3GH 4IFDI 1QZGA 4JI5Q 3K81C 4LF6L 1GM5A 4P75A 4A75A 4QJFA 1HNXL 2Q2IA 4NB3A 1VQOA 4O0AA 3ULLA 2KBNA 1L1OC 3CCQA 1XNQQ 4DR6L 4PG3A 2JEBI 2B29A 1GKHA 4DV5L 2ASBA 1BBWA 2KCMA 1NMFA 2YTYA 3GD7A 2PI2A 4LUVA 1Q46A 3T1HL 1MJEA 3S24A 4QY7A 5JJKA 1SMXA 2JA8G 1J5EQ 1HJPA 4A3JH 2HQLA 4A3BH 3AEVA 5C0XJ 1OXSC 2ZTEA 4JOIA 4DKAC 3CF5A 4DR5L 5LMNL 3HOVH 1AE2A 2K14A 4P71A 3LGJA 1E1OA 2PQAB 2UXDQ 4JI1Q 1L0WA 2BA0A 4GS3A 1QVGA 2K5NA 4JI7L 3ER0A 1YZ6A 4B3ML 1U5KA 5IWAL 4Y7NH 2JA7H 2R93G 1EOVA 1N36L 2NN6I 3T1YQ 1HR0L 1Y1VG 3BU2A 1V1QA 2Z6KA 4O2DA 5JEAG 1PH4A 1KAWA 1BKBA 3FP9A 1LM0A 1C0AA 1A63A 1CKOA 4AIMA 2CCZA 4JI0L 1VQJA 3PF4A 3CP0A 5JJLA 5AJ3Q 4B3TQ 4JBMA 4LFCQ 1EWIA 3GTQH 3E9IA 4DV2Q 2PQAA 1L1OA 4BY1G 1VQCA 4DV3L 2CWAA 4L5QA 3L2PA 3UE1A 4A3FG 1JB7A 3RZDH 1EIFA 4A3MH 2BH2A 3A74A 3M4OH 2ID0A 3I2ZA 2YTVA 1VQ9A 2ATWA 1EFWA 4LUZA 3HOZG 4YHHQ 3I55A 4JI8L 1PFSA 1KRTA 4DPGA 2VW9A 3CCEA 3KLWA 1K3RA 3FKIH 4IOCA 1S72A 1XNRQ 5IP7G 3CMAA 1SFOH 1KXLA 2UU9L 4DR1Q 1YBYA 1MKHA 2E8GA 1YHQA 3I4NH 3EIVA 2HIXA 4UP8A 1GVPA 5GAHC 1OTCA 4H02A 4JI6L 4A3CG 4BBSH 2IX0A 2WFWA 2IX1A 1AH9A 3PO2H 4JG2A 1AE3A 5IYDG 4B3MQ 3J81c 1YITA 3TRZA 1G6PA 1HR0Q 4X62Q 1CUKA 5M3MH 1L2FA 2C35B 4JI4Q 1I94Q 1RIPA 1M1KC 1PH7A 4POGA 3NEMA 4IJLA 2VUMG 2UXBL 1YI2A 3F2CA 4GN4B 2QA4A 1Z9FA 4X64L 4HJ9A 1EQRA 4P72A 4BXXG 4GKJQ 4UP9A 2VUMH 4DV3Q 1FJGL 2EXDA 2V1CC 3MXNB 4HIKA 2ES2A 4OWTB 3PF5A 3KF6B 4TQUS 4EX5A 1VQEA 3DLLA 4JI5L 2YV5A 4XIGS 3RN5A 1VQGA 2ZJRA 3TQYA 1JT8A 1VQMA 4DK3C 2AKWB 2AMCB 3GTGH 2JJQA 1B7YB 2EQSA 1TWGH 4NPSA 4IOAA 1LTLA 5J3BA 5FJ8H 4IJHA 1XNQL 3TS2A 4A3EG 2MFIA 2KHIA 2WAQG 1ASYA 5IYCG 4AH6A 1TXYA 2UU9Q 1RL2A 2AWNA 3AQQA 1J5EL 3RLOA 4APVA 4HJ5A 4QIWE 4LF4Q 4NXMQ 3H3VH 4OO1I 1I3QH 3K7UC 3KF6A 3STBD 2A8VA 3CD6A 3GTMH 4A3BG 2OQKA 4JI1L 5GAEC 2VY3A 1WCMG 1QZHA 1SN8A 1Q8KA 4DUYQ 1Q1BA 1HNZL 2UUAQ 2MO1A 3W1GA 2VS1A 4GN5A 1YJWA 2ZM6Q 1HNWQ 2UXBQ 1GO3E 2N8NA 4DV0Q 4MTNA 3S16H 3S1MH 4X64Q 1N8RC 3ERSX 2Y0SG 2DGYA 1NTGA 2I5MX 3KF8B 4A3GG 2H5XA 4LFCL 4IPCA 3ZJYC 2GVAA 5AJ3L 4B3TL 1FJGQ 1K9MC 3S15H 1PV4A 4HJAA 4DV2L 1WFQA 2RCNA 4PMWA 2CFMA 1BVSA 1X65A 3EBEA 4DAYB 1N32Q 4K0KL 4X6AH 3E0EA 2CWPA 3NBHB 1PH8A 2YU9H 4C3IH 3PIOA 2Q2HA 2RF4A 3J81i 4R4CA 3CCLA 1PH5A 4YHHL 1A0IA 4A3JG 1SROA 2PNHA 4NXNL 1KC8C 1VQ7A 3S17H 4YCUA 4KHZA 3HOVG 2BA1A 1QVCA 3CMEA 3PUXA 1XNRL 5DLQE 3KJPA 1X54A 4KHPQ 1IBKL 4DR1L 1KL9A 4LF9L 3HKZE 2JA7G 4BA1I 2R7ZH 1PH1A 1L1OB 3WWVA 1N33Q 1CSQA 2E5LQ 1EUJA 1HNZQ 3S1NH 1D7QA 4X62L 1YVCA 3D31A 4JI4L 1I94L 5GAGC 4JI3Q 2HT1A 1CKNA 1FGUA 4HJ7A 3I4MH 4DAMA 1YJNA 4HIDA 2BH8A 3RZOH 1D8LA 1E24A 1Z47A 4AQYL 3K7AH 3ULJA 2UXCQ 3IRBA 3PSIA 2QGQA 2XGTA 1QUQB 4A3MG 4KLKA 4GKJL 1LUZA 2KCTA 4DV7L 3CCUA 1JMCA 1SRUA 1IZ6A 4XTCS 2GN5A 3VDYA 1IXRA 1PHJA 4LFBL 2K75A 3UDFA 3PUYA 4K0KQ 4A3KH 2JK8A 3S1RH 2KENA 4IPHA 1B70B 1E22A 4LW1A 2PI2E 3A0JA 1MJCA 3HFZB 1Y1WH 1PH2A 1XPOA 2NZHA 3H0GH 1K83H 3FKIG 4LWCA 3CPWA 3GO5A 4RG1A 4NXNQ 1MIUA 3G4SA 2Z0SA 4DR4Q 3I4NG 3PV0A 1QUQA 1V43A 1VQFA 1YHBA 4B3SQ 1YJ9A 3M7NA 4BBSG 4R4TA 1IBKQ 3PO2G 2AWOA 4LF9Q 4LF4L 1YHAA 4NXML 2B63G 1SE8A 5C44H 3GTOH 4QQBX 1PYSB 3CPFA 5M5WH 1I6HH 5M3MG 5ELOA 1IYJB 5C0XG 1PH3A 4UY8C 1KD1C 3EN2A 2B63H 3I4OA 3J7ZC 3HOYG 1HZ9A 2N78A 4P73A 2VQFQ 4L5SA 4GKKL 3K0XA 1J6QA 4OXPA 4LF5Q 4PZ7A 3CXCA 4DUYL 3FHWA 3HOYH 2UUAL 1P16A 5C4JH 3SGIA 1IL2A 1X3GA 1VQNA 3S2DH 4OWWB 2ZM6L 3D0FA 1U0LA 1HNWL 4AQYQ 2RHSB 3G48A 4DV0L 3J80i 1C7YA 2F52A 2CQOA 3M85A 4R4IA 1YEZA 4JI2Q 3A5UA 4DV7Q 4P74A 3K80C 1VQ4A 4LFBQ 5M3FH 1HZCA 1VQLA 2UUBL 2KHJA 4TVAB 2NZOA 4X66L 5FJ8G 1ASZA 1Q1EA 1X3EA 4YWMA 3I56A 2JA5G 5GADC 2NVXH 4JV5L 1N32L 4X65Q 2VNUD 3RLNA 1X3FA 2HHHQ 2DUDA 4POFA 1VQPA 5K36G 1EYGA 1VQAA 3STBC 4OX9Q 1HZBA 2D62A 2D0PA 5M5XH 2JA5H 1VCIA 4HIMA 2R7DA 4WJ3M 1SR3A 1N34Q 2L15A 2WP8J 3CC4A 1K0RA 3JAMc 2YTXA 5C3EH 4BA2I 1T9HA 3KDFB 4BBRG 4KHPL 2K4KA 4DNIA 3GTKH 1G51A 5IY0A 3PIPA 1K8AC 1IBML 2ZJQA 4BY7G 5LMUQ 5C4XH 3UDGA 1A8VA 4PZ6A 3HOWH 1UE6A 1UE7A 2NVQH 4BBRH 1NMGA 4LF8Q 1N33L 4BY7H 1O7IA 4DR2L 4GKKQ 2E5LL 2RHQB 2UUCQ 4PZ8A 3S1QH 1XTDA 5EAYA 3M4PA 1CKMA 3OTOQ 1OXXK 2OTJA 1KIXA 4JI3L 1K8GA 1UE5A 5IP9G 3A5ZB 5JJIA 4A4IA 1JJCB 3KDFA 4QL5A 3RN2A 2UXCL 5IP9H 4A3IH 4A3DG 5BR8Q 4R4OA 2UUBQ 1HH2P 4DV1Q 3CC2A 3ICEA 3U58A 3PUWA 4X66Q 1YNXA 4JV5Q 1JE5A 4JBKA 4A3DH 4YCVA 3AFPA 1Q86C 3M9BA 3GTLH 3KYHC 4GN3B 4JBJA 5FLXc 1LYLA 2R6GA 2MO0A 4KI0A 1YIJA 3PO3H 3J80c 1OXVA 1EIYB 4IFDJ 2WB1E 3DM3A 3AYHB 1PVOA 1CKNB 2JQOA 3BZCA 3F8TA 1V9PA 4LNQA 3BJUA 2IHFA 2NVTH 4DR4L 2R7ZG 1PH9A 4JCVE 3GTJH 4B3SL 5IE8A 1Q82C 3GTPH 1N9WA 3HOUH 4A93H 2QEXA 4OONA 1IBMQ 3CQZH 4IO9A 2IHEA 2R7FA 4DV4L 3HKSA 3HKZG 1UE1A 4DR2Q 4LFAL 3KFUA 3OW2A 1VQ8A 4DUZQ 4JYAQ 3I4MG 3RR5A 2AHOB 2GVBA 1S3OA 4R1JA 1VQIA 2VQFL 2E2JH 4LF5L 5C0XI 4YCWA 1X56A 2K52A 4LF7Q 2VL6A 4OO1G 1JJGA 3G6EA 2E2IH 1XPRA 2N49A 2XTIA 3HOXG 2A1AA 2EIFA 3PUZA 1VQ5A 4FDBA 1XPUA 4YY3Q
chains in the Genus database with same CATH superfamily
2WKDA 2GA4B 3E9HA 5DEHA 2ZJPA 2JA8H 1JICA 1Y1WG 2R92G 3L9AX 1WTHA 3UDIA 1LTRD 3BYTB 4B3RQ 2F3VA 2A6ED 3J81L 2MUYA 5CV6A 2R92H 2K5VA 4X65L 2PO4A 2QDBA 1G2TA 2R93H 2EVBA 3JC66 2JA6G 4K2LA 2BOSA 1N34L 1JWUD 4L5RC 3H3VI 1K0SA 2KVMA 2JA6H 3TEHB 5C4ZA 3CW2C 4LF6Q 2IT1A 3CCMA 3CCJA 4DNRB 4B9WA 1HZAA 3RUZA 1JOOA 3CC7A 1SNPA 4DF7A 2QW7A 2F0LA 2EY1A 3T1HQ 1WCMB 5CBAE 1BR9A 4ZUIA 3CAMA 3PIP3 2XWBB 3H15A 1AEXA 2EXZA 5LMNQ 3JAML 4V0BA 1TWHH 3W5OA 4CDCC 4DV1L 4GLVB 4A3CH 2B3GA 3K5NA 1H9SB 1TWAH 1KABA 3N6RA 3PUVA 1MD2D 2EOTA 4QF4A 2K5HA 1X6OA 5C3EG 3RLFA 2PZWA 4G7OC 1GUGA 4CJ1B 1X3QA 4FXGC 4ZYSA 1VMPA 1PDQA 1Q12A 2OF1A 2KJXA 3T53B 4XT3B 1FR3A 4HJ8A 3Q6SA 3EA6A 4HSVA 4GNXB 1C9OA 1SYEA 5EPJA 3S1NB 2DN8A 3KBGA 2JA9A 1SNQA 4JC0A 3WDNA 3U50C 4JI6Q 5FK9C 4GOPA 1AN8A 2B8FA 2XIWA 2I0QA 4CBVA 1D5MC 1EQQA 1STGA 3PO3G 1FL0A 1BCPC 3QWNA 3UE0A 1PH6A 3QJYA 1Q7YC 5IT9c 1GD7A 5IGBA 3H0GB 3MAQA 1EU3A 2L55A 4A93G 4A76A 4NW2A 1ZKOA 2KEEA 3R93A 3NENA 3VR5A 2ZTDA 4DXGA 1PTOC 1NE3A 2JE6I 4A3GH 1GM5A 4XXEA 3PQIA 2PW5A 4QJFA 2R61A 1MI2A 4O0AA 4LAAA 3CCQA 2JEBI 2ASBA 4K14A 3DUZA 4C3HG 2PI2A 5C4JB 5JJKA 3VYTA 4A3JH 3QG1A 3AEVA 5C0XJ 2A6EC 2KECA 2ZTEA 3L3OC 2K14A 4O42A 1LTGD 1E1OA 2PQAB 2K1BA 5HURA 4JI1Q 2EZVA 2BA0A 3C1EA 4GS3A 2K5NA 4JI7L 3ER0A 1U5KA 5IWAL 4Y7NH 1EOVA 4KJNA 3E5SA 1HR0L 3DEOA 1Y1VG 2NBFA 5D14A 3C1FA 5JEAG 1U4PA 1LM0A 1A63A 1PFNA 2L9HA 4LJZC 4AIMA 2CCZA 1NUCA 5JJLA 3K59A 4B3TQ 2RSNA 3E9IA 5LL6X 2EYJA 2K5WA 5I6YA 3GTKB 4L5QA 3MHBA 1L0YB 2BH2A 3RZDH 1EIFA 4RA8A 3M4OH 5EKIA 2F0JA 4BBRB 2NVQB 2YTVA 2ZXPA 1VQ9A 4PMCA 3HOZG 5AFWA 2IL8A 3I55A 2QKIC 3KLWA 3OSOA 2IWHA 1S72A 1XNRQ 4TRDA 1AZQA 4BBSH 1LV9A 1QCBD 1AH9A 3ZYYX 3J81c 1G6PA 1H9RA 2B2TC 5TSSA 1CUKA 1L2FA 3MWYW 1TU2B 1I94Q 4JI4Q 1PZJD 1PH7A 5E4WC 3F2CA 4R9WA 2QA4A 4IUTA 1EQRA 1NR4A 3IFTA 1L0XB 4GKJQ 4DV3Q 2EXDA 2V1CC 4EGVA 4HIKA 1O7ZA 2ES2A 2G9DA 3PF5A 3KF6B 1TS3A 4EX5A 2QCPX 4XIGS 1HCZA 2LKVA 2ZJRA 1JT8A 1G2SA 1VQMA 1ESFA 4DK3C 2AMCB 5IGEA 4ZUJA 1TWGH 4DNTB 3D6CA 3DHQA 4A3EG 1ASYA 5IIFA 1WD0A 2E2IB 5JPMC 1WTXA 1RL2A 2AWNA 3MXNA 3M7GA 4OO1I 1NSNS 2TSSA 3K7UC 1B3AA 4ZRZA 2MP1A 2KHSA 2A69D 1K28A 1VDZA 2EYHA 1QZHA 2Z4HA 2WINB 4DUYQ 2UUAQ 2MO1A 2R92B 5EBCA 1EZ8A 3H91A 1HNWQ 1A3TA 3MVVA 2R93B 3SK8A 4H13C 1LT3D 3KF8B 5G3LF 3GV6A 3NQTA 3SEBA 2N55A 2H5XA 2RQXA 4IPCA 5AJ3L 2GVAA 1FJGQ 2DNEA 1Q90A 3U9OA 4DV2L 1WFQA 2JA6B 1X65A 5IT9E 3KK7A 1TS5A 2YU9H 1B2TA 3CCLA 2SOBA 1PH5A 4YHHL 1SROA 4NXNL 1STHA 1ICFB 4ZKBB 4YCUA 4KHZA 1SDFA 2K32A 1DZ1A 4KHPQ 4KY5A 2FHTA 1FNUA 4BA1I 1EIGA 4DAYA 2O5JC 3SVMA 3ERQA 1SNMA 2PYKA 1EUJA 2ENBA 1ML0D 1PTOF 1SMYD 4K5VA 1A3VA 1TWAB 4X62L 3EQLC 3HZXA 3D31A 2HT1A 3I4MH 1CKNA 1FGUA 4F88A 1E24A 1Z47A 3AU7A 5CBEE 1HQMC 3K7AH 3IRBA 1GXDC 4A3MG 5D3IB 2K03A 5IGFA 4LFBL 1PHJA 1S5DD 3V05A 4K0KQ 4A3KH 2JK8A 4IPHA 2J0TD 3A0JA 3MFGA 1PH2A 2LMCB 1HA6A 3T13A 3G4SA 3FVQA 1I6VC 2B2YA 4KK7A 5CV4A 3NPPA 1IBKQ 1EIHA 4LF4L 1XWEA 1BF4A 5C44H 3GTOH 5M5WH 4IFDH 1FD7D 1B44D 5M3MG 5ELOA 1IYJB 1PH3A 3NE5B 4RCOA 3I4OA 3IAYA 2D9UA 2H1EA 4IN3A 1J6QA 4LF5Q 2Q8TA 1PFMA 5BN5A 1RD9D 3D0FA 5FOBB 3G48A 4HCSA 1JE4A 2F0MA 5CV9A 2PZUA 2CQOA 3SK6A 3M85A 1KDCA 2EY5A 4CJ0B 5CC4A 4A93B 5IGGA 5M3FH 1HZCA 1VQLA 3J81E 2KHJA 1II3A 5CMDA 5FJ8G 4JV5L 1X3EA 2NN6H 2JA5G 5GADC 4X65Q 3OPOA 1V1PB 4POFA 5I2YA 1R4PB 1SYGA 2D62A 1PYWD 1JCKB 1VCIA 2EYFA 2JA5H 1N34Q 1CM9A 2A69C 3CC4A 4IURA 4A3JB 3TDQA 1T9HA 3KDFB 2K4KA 4DNIA 1G51A 1IBML 1TT2A 3BDOA 4PZ6A 3HOWH 1SJHD 1O7IA 4CDDC 4ABNA 4PZ8A 3NTKA 4KMUC 5F2DA 5KNBA 4Y7NB 3M4PA 2F03A 2DJFC 1QILA 2OTJA 1MSGA 3EFXD 5IGDA 5IODA 1K8GA 3FDTA 2B8GA 2ICIA 1Y1VB 2HD3A 2JYOA 4A3DG 4R4OA 4IUNA 5JOBA 1K8OA 4DV1Q 3ICEA 1DOLA 3PUWA 4X66Q 3RZDB 4JBKA 4A3DH 3AFPA 3M4OB 3GTLH 4XYQA 4CKEA 4KI0A 1YIJA 2WACA 3J80c 1G6ZA 2BE5D 3AYHB 2A73B 5NUCA 3BJUA 2M9VA 5CYUA 2R7ZG 4B3SL 1SMYC 2QEXA 4HMJA 4RHSA 3CQZH 4QUFA 1KLUD 2IHEA 4DFAA 4BBSB 3HKSA 3HKZG 2N88A 3LWEA 2O2LD 4LFAL 5M5YB 3OW2A 2NB0A 4EQPA 4R1JA 2VQFL 5C0XI 1T5EA 4YCWA 1KAAA 2B39A 1EYCA 3LX0A 3G6EA 1XPRA 2N49A 3Q23A 2EIFA 4I65A 3KLSX 4FF2A 1ENAA 1VQ5A 5BN4A 3S2DH 2G5DA 1D5ZC 1STEA 2K05A 3PGZA 4KD3A 2IJ0A 2CH4W 1S4ZA 2PQEA 5I9OA 3JAMi 4HIOA 5FO9B 3H0GG 2F0EA 5CR3A 3SXHA 3H3VC 4DR7L 3K0YA 4G4KA 3TREA 5JPNC 2OWOA 2HHHL 1Q81C 5DM63 4DA2A 3L7ZC 1TWGB 4Q5VA 3VR6A 4OX9L 4ULLA 1XMQL 2RBMA 2OQ0A 1FNVA 4IZ8A 4UP7A 3RMHA 2HCIA 1KHIA 2LXJA 4DV4Q 1HHVA 3HP3A 1PRTD 1A62A 1VQHA 4KV6A 4A3LG 1U9RA 4N9PA 2EDGA 1I4XA 1VQBA 4A3LH 4Z9CB 1CT1D 1C8CA 2RDHA 4DR3L 4IPDA 3A54A 2J7ZA 1F9SA 3I91A 1QOHA 3TP8A 5IP7H 4UAIA 2I46A 5HGQA 3F2UA 4NMZA 3CCRA 2KEDA 3CHBD 4JI7Q 1B8AA 5IWAQ 1NCVA 1TR5A 2OTLA 2YU9B 3QIAA 2A5HA 4GOPC 3RNUA 3FRPB 2LSSA 3NELA 3MA2B 3C46A 1S5ED 1Y8OB 1EY6A 4AYBE 2VQEL 1IBLL 3AB9A 4AYBG 3I7FA 3IKJA 1E3PA 3DWPA 3VA7A 4OIJA 4WJ4A 1VQDA 1S40A 4BXXH 2XN9C 1KLGD 4ME3A 2A19A 3DMUA 4EQNA 4S3SA 1Z7TA 1WI5A 2WV6D 5FLXL 2WAQE 1F77A 5BN3A 4LF7L 5C5MA 4A3IG 3ULPA 2F3WA 3P1HA 1BBXC 5JVH3 1A15A 3K7AB 2A68D 1X55A 5G3LD 5IYCH 3V2TA 1STBA 1ILPA 3S2HH 2BE5C 4MZ9A 4A3MB 5D65A 1OXTA 4A3KB 1ZYRD 4DV6L 3F1ZA 2F4VL 1SYFA 2ZTCA 1E1TA 3FMCA 3Q8DA 4KTAA 2K50A 4KY6A 3HOUG 2Y0SE 3M3YH 1DYQA 4L63B 2WB1G 2O5IC 1U4RA 3NBIA 1BNZA 1BCPB 3NSWA 4NKLA 2K6AA 5E7NA 3TP5A 2NWGA 1R4QB 1I5FA 3B6YA 3GTOB 5GQOA 3K6OA 5M5WB 1QZGA 1UNSA 1F2ZA 3SDZA 3VYSA 1QNUA 3PMFA 3J80E 1PTOD 4DR6L 4TSSA 4DV5L 4A3BG 1KXLA 2KCMA 2YTYA 2L4NA 3GD7A 3KF8A 2JA8G 1SEBD 4A3BH 1KNAA 4JOIA 4DKAC 4DR5L 3HOVH 1I4RA 1AE2A 3CRLC 3LGJA 2UXDQ 1LT6D 3W3AA 1L0WA 5EJWA 1QVGA 2AQ2B 1YZ6A 2R93G 1N36L 3T1YQ 4L6TB 3MFYA 1ONLA 1DOMA 1V1QA 2RVLA 2L5TA 3FP9A 3N52A 2JA5B 3VYUA 4JI0L 3PF4A 1VQJA 1PRTC 5AJ3Q 1HPCA 4ZQ3A 4DV2Q 3X3MA 2F4IA 4IUPA 3G6JB 4FYDA 3I2ZA 1V8QA 5EPKA 1EFWA 3C2PA 4YHHQ 4EVOA 4NDXA 4F8MA 1PFSA 1MHWC 4DPGA 4RKBA 5C3WA 1PZKD 2BDOA 4DAVA 1YBYA 5CORA 1MKHA 2E8GA 5FKAC 2B2UC 2RDGA 4UP8A 2F1MA 1GVPA 3NTIA 5GAHC 4A3CG 2XWJB 1PFBA 2EYPA 1C48A 4JG2A 1AE3A 4B3MQ 1YITA 3P20A 1D6EC 3TRZA 1GUSA 2B2VA 4A3DB 4X62Q 1B1ZA 3GTLB 1LTAD 4C56C 1EY5A 1WTQA 3DM1A 2VUMG 2UXBL 1UEAB 1EYDA 1VMCA 1RDPD 2NTTA 4P72A 4UP9A 2VUMH 3CQZB 2OT2A 1G91A 2R7ZB 4TQUS 3DLLA 1VQGA 1STNA 3RD4A 3TQYA 1CQVA 1Z6HA 2NUCA 2A68C 2JJQA 3HKZB 2X6GA 2XVSA 5HGTA 3Q0AA 4AH6A 1RF2D 1ENCA 2UU9Q 3P7JA 1ZYRC 5T1GA 5JJZA 3H3VH 4LF4Q 2VB3X 3S2DB 5KRUA 1I3QH 1FNWA 2VXWA 3PIO3 2OQKA 2F0IA 5GAEC 1EU4A 1F9QA 1SN8A 1BQQT 1V1PA 3NTHA 1HNZL 1Q1BA 1QNKA 5K5PA 1YJWA 4LMQD 3H94A 2N8NA 4RGTA 3S16H 1ILQA 3S1MH 4X64Q 3IFDA 2DGYA 4A3GG 4LFCL 3S15H 2RCNA 2M2LA 2HCCA 3OIPA 1A2UA 1IYUA 3E0EA 4C3IH 2HDLA 1MSHA 2Q2HA 1EY8A 4R4CA 4FVMA 4A3JG 2PNHA 2K04A 3I90A 1DM0B 2BA1A 3CMEA 2EYMA 3NXWA 4IUVA 2L12A 5DLQE 3KJPA 4RCNA 4HR7B 1A2TA 1LTSD 1PH1A 1L1OB 2CH4A 3WWVA 3NBHA 1DD2A 1CSQA 3BDLA 2B2YC 4PV1C 1YVCA 4OELB 1XX8A 3MTSA 2BH8A 4F7XA 2XRSD 2F0TA 4CDFC 4AQYL 4FF4A 3QB3A 3PSIA 1QUQB 4DV7L 3CCUA 1IZ6A 4XTCS 4UHVA 1EWCA 1IYVA 1JC7A 2FINB 3UDFA 3PUYA 4AYBB 1LTBD 2PI2E 3HFZB 1MJCA 3S1QB 2HDMA 1K83H 3CPWA 5LL6S 3GO5A 4ZCKA 4XQJA 1EY9A 1CZWA 1IW7D 3AMUA 3BVGA 3PV0A 4B3SQ 4CGYB 3M7NA 4BBSG 1DCZA 4LF9Q 4U68A 2Z8LA 3NK9A 1HQRD 2WAQB 4A3IB 1RHPA 4NXML 1PYSB 2SDFA 3Q24A 1PRTF 4UY8C 1KD1C 3S2HB 2CW0D 4UDUC 3A8KE 2VQFQ 4GKKL 3K0XA 1TIID 2K28A 2EYLA 2E76C 3FHWA 3CXCA 1P16A 2XRQD 1X3GA 4FXDA 1U4LA 4DV0L 1RTOA 1C7YA 4FNFA 2F52A 3M3YB 1AW7A 3A5UA 3HOUB 5ELCA 3K57A 1VQ4A 2K5QA 2WB1B 2Y0SB 1D1IA 2NZOA 1JWMD 3I56A 4OEMB 2VB2X 3RLNA 1X3FA 1M8AA 2B2UA 2HHHQ 2DUDA 2F0UA 3W2DA 1VQAA 1IHZA 1EYGA 4OX9Q 1F2MA 3BVMA 5M5XH 2X69A 1DJRD 1NNXA 1ENFA 3DEPA 5EBDA 1JWSD 2L15A 1CA5A 4WJ3M 3JAMc 2YTXA 3SE0A 4MIUA 4A3BB 1RODA 5IY0A 4DK0A 4KKSA 2WKCA 5C4XH 3UDGA 2JA8B 3EROA 1UE6A 1NMGA 2E5LL 1XTDA 1CKMA 2AUJD 4RHRA 1QE6A 1EEFD 1GUNA 4JI3L 2QILA 1KIXA 4DGZA 1EQVA 1O80A 4QL5A 4N9TA 3TN2A 4KKUA 1CZGA 4K6DA 2UUBQ 1O7YA 3GV3A 1JE5A 3M9BA 3SHLA 1CTMA 3D4DA 1OXVA 3T4AC 3I73A 1EIYB 3DM3A 1PVOA 2JQOA 2J4XA 1V9PA 5EGTA 1PMRA 3ITPA 4OHJA 5E4XA 3SK5A 1TWHB 4DR2Q 1Y69U 1VQ8A 3I4MG 2AHOB 5EQ0A 1S3OA 2SNSA 2K52A 4LF7Q 2VL6A 4OO1G 3TP7A 3HOXG 5ELDA 4FDBA 1XPUA 4OO1H 2Q2UA 1TWCH 3KOJA 2X6LA 3HOXH 4A3KG 2JXMB 2VUMB 1X9NA 2EY6A 3KJOA 4UPAA 1IW7C 2Q2TA 4JW0A 4DV6Q 2F4VQ 3TS0A 5C3XA 2NTSA 1W3SA 1VS0A 1JJ2A 1I4QA 5GROA 1CK1A 3MEFA 4OWXB 5C44G 2CW0C 1EWHA 4IFDG 5IOCA 4ZAIA 5ISRA 2O4XA 5LMNW 1DONA 5LMUL 1VF5C 4MNOA 4IPGA 2EY2A 2IPKD 4BY1H 2L1BA 2LXKA 1I50H 2UUCL 4A3FH 1OXUA 4DR6Q 4DV5Q 3OTOL 1HA5A 1T5XD 1PTOH 3OYYA 3CRKC 1NR2A 1WOCA 3U4VA 2QDLA 1H9KA 1JQYD 5M3FG 3S1MB 4J15A 3U4ZA 4DK6C 1XTCD 4DR5Q 4C3JH 3VR2A 5H1SE 3S15B 2OCEA 2NN6G 1IL8A 3PCOB 3M4QA 4A3GB 2ALYB 4GZYC 2NZ1D 5FLMG 1N36Q 4JK1C 4RFBA 5D3DA 1TWFH 2EJGC 3R3OA 4C3IB 1DXMA 2F0GA 5IYDH 5J1ZA 5FLMH 3MXGA 1VQ6A 4YWLA 4JI0Q 1SLJA 4XQNA 1LABA 3HOWG 3AFQA 1PZID 1LT4D 1NY4A 1F2LA 4B9XA 4GOPB 1PYBA 1H9SA 2SEBD 1QVFA 2AQ1B 3J7AV 3VA5A 1EY4A 4JYAL 4DUZL 1NBWA 2BDNA 2MQHA 1NJIC 3MZ5A 1E7ZA 3CCSA 1SE3A 4HEDA 5HY6A 5CV7A 3S14H 1GUTA 2E2HH 3JAME 3T16A 3TZDA 1VQKA 4R4QA 4YY3L 1KRSA 4BWGB 2N3SA 2I5LX 3VYRA 3G71A 4GNXA 4K2KA 1KQSA 5JEAJ 5IYBG 1JR0D 2E2DC 2B2WA 4FP5D 4JOIC 4R8IA 1PA6A 1WCMH 5IYBH 2EE1A 4ZLTF 3L0OA 2D0OA 4YWKA 1E2ZA 1KDBA 2VZAA 4KKTA 4DXFA 3MEHA 1XMOL 1B50A 3GDEA 1ICWA 3K81C 2NYZD 1HNXL 2Q2IA 1PXUA 5KIXA 3I72A 2KBNA 1GKHA 1NMFA 4LUVA 3S24A 4QY7A 1SMXA 2HQLA 1OXSC 3CF5A 5EKLA 2AQ3B 1S5FD 3Q22A 1HFNA 2DNCA 2G9HD 2JA7H 4KY7A 4G7HC 4H7BA 2Z6BA 2Z6KA 1PH4A 3P75A 5A2QL 1C0AA 5M5XB 1CKOA 3O13A 3CP0A 5KEEA 4LFCQ 2B2VC 1EWIA 3EVQA 3GTQH 1BO0A 2PQAA 1L1OA 2OXPA 1VQCA 4DV3L 3EJIA 3R2TA 3UE1A 1JB7A 5C4XB 2IX3A 2ID0A 4R8NA 5CV8A 2ATWA 4LUZA 2PCFB 4JI8L 1KRTA 1H9MA 2VW9A 3CCEA 3FKIH 5IP7G 1SFOH 2R3ZA 3I4NH 3KBXA 4M1UB 2HIXA 2WFWA 5I4DA 1SAPA 3PO2H 2QF7A 1ET6A 1I4GA 3NQIA 4RKLA 3K5MA 1HR0Q 5FO7B 1GHKA 5C0XH 1Q8IA 2C35B 3A8JE 1RIPA 1GHJA 2D2CC 3NEMA 4IJLA 4GN4B 1XYIA 1Z9FA 4BXXG 1FJGL 4H44C 1QB5D 3MXNB 3NP8A 1VQEA 4JI5L 5KNDA 1WTRA 5KYLA 2FFKB 3NHHA 2RA4A 3GTGH 5IT9L 1B7YB 4NPSA 4IOAA 1LTLA 5J3BA 1XNQL 2MFIA 3KLRA 3I4MB 2KHIA 2WAQG 1EYAA 5IYCG 4NP5A 4X3TA 1J5EL 3AQQA 1E2WA 4APVA 1CFMA 4QIWE 4NXMQ 2MHVA 3HRZC 3KF6A 3HOXB 2A8VA 3CD6A 3GTMH 3ND9A 4OGQC 3BS1A 1ZXTA 2JN4A 3QO2A 2VS1A 4WRDA 5E3FA 1V1OA 4GN5A 5ELEA 1GO3E 4RWSC 4DV0Q 2KUMA 4MTNA 1N8RC 3ERSX 2Y0SG 2LY7A 2L0CA 2Q8IB 1A6XA 1PV4A 4HJAA 5C44B 1BVSA 4DAYB 3OW7A 4K0KL 4HCEA 2CWPA 4BY1B 4O1NA 3PIOA 4ILWA 1UAPA 1I50B 3TMEA 4A3FB 3BDCA 1A0IA 4K5XA 3OMGA 2MPMA 1PTOB 1VQ7A 3S17H 2WIIB 3HOVG 2QEJC 4J6HA 3PUXA 1EY0A 3DWQA 1IBKL 4DR1L 3CKIB 2CVRA 4X3SA 2EYOA 4C3JB 4RGOS 5M3FB 2RSOA 3VR4A 4HAEA 3NUCA 2E5LQ 4QUCA 2EPBA 5DAUA 1D7QA 3K5LA 2K33A 1TWFB 2LS01 4RAUC 4JI3Q 2FMCA 3RZOH 4HJ7A 4DAMA 1YJNA 1EQTA 2DJGC 3TP6A 4HIDA 1D8LA 3SR1A 1HTPA 1D5XC 3K5OA 2XGTA 5JVG3 2Z9HA 4KLKA 1LUZA 1JMCA 1SRUA 4PMBA 2ZXRA 1IXRA 2K75A 3HOWB 3S1RH 1B70B 1E22A 4LW1A 1Y1WH 2KQ3A 4M8AA 1HXYD 4XYOA 3K58A 4NXNQ 2XSCA 2Z0SA 3C3LA 1LO5D 4K8JA 3S14B 1VQFA 3MXPA 2E2HB 1YJ9A 4R4TA 2AWOA 2B63G 4JVZA 1SE8A 4QQBX 1I6HH 3M4YA 5L37A 1Q3LA 2DY7A 1RCVD 2FJ2A 2AUKA 3EN2A 3H6MA 3J7ZC 2B63H 2F0OA 3HOYG 1HZ9A 2N78A 4OXPA 1ZEQX 1VF7A 3HOYH 3SGIA 4P2CB 4ZK9B 2ZM6L 3D4WA 2RHSB 1AZPA 3J80i 1S5CD 3TBIB 4CJ2C 1YEZA 4LFBQ 2XNAC 4KN4C 4XDXA 1WTPA 1AFPA 4TVAB 1JOKA 4X66L 4I7ZC 1EOTA 1ASZA 1N32L 1QG7A 2NVXH 4IUUA 2VNUD 1HZBA 2D0PA 4HIMA 1WD1A 3FPUB 2R7DA 1SR3A 3V96A 4IALA 1K0RA 4QMGA 5C3EH 4FO2A 5KGUA 4BY7G 1K8AC 5LMUQ 3I3CA 3MC0B 1UE7A 1N33L 4BY7H 2RHQB 2UUCQ 1MGSA 2JA7B 2K01A 1E2VA 3OTOQ 3OHXC 1OXXK 2F0HA 4B08A 1UE5A 5IP9G 3A5ZB 3E6ZX 2ICEC 4A4IA 1W6JA 3KDFA 4I7AA 3VR3A 2UXCL 1YNJD 1K8MA 5IP9H 3BVZA 1EFID 3GTQB 1XXGA 4C3IG 3CC2A 1SSOA 5COYA 4JV5Q 4YCVA 3I4LA 2EJFC 3HEJA 4JBJA 5FLXc 1LYLA 3PO3H 2MO0A 5EKKA 1SJED 1TS2A 1NAPA 1SXTA 3J7AF 3BZCA 4DR4L 2NVTH 2IHFA 2F0NA 3FKIB 1PH9A 3GTJH 3GTPH 5IE8A 1Q82C 4A93H 1N9WA 1SFOB 4OONA 1IBMQ 2KOLA 1D2BA 1SE2A 3I4NB 2R7FA 4DV4L 3KFUA 3PO2B 1SNCA 4DUZQ 4JYAQ 1HRJA 2E2JH 1VQIA 4CKCA 1X56A 1STYA 5J22A 3J7YW 2A1AA 3PUZA 3NWSA 1CA6A 3MXUA 4YY3Q 2Q8RE 4C3HH 4JI2L 1ESRA 2C5CA 1B4OA 1Y8NB 4FF3A 1IKMA 1M90C 2MJ8A 3F2BA 1TY0A 2JEAI 3X3NA 3QOLA 3GTGB 2CKZB 5A35A 5IGCA 1SE4A 1Y1VH 1P8LA 2IY5B 5ELNA 5JEAH 2F0PA 1XMOQ 4HSPA 3WOFA 1FVIA 3OWFA 1HUNA 4EQ5A 4BS9A 4LFAQ 2FXQA 1FGBD 1HFGA 3GTMB 2I5HA 1W2BA 1HNXQ 1Y14B 4G57A 4LF8L 3A56A 2YYZA 4QIWB 1HR0W 1H95A 3D6WA 3OWEB 3TSSA 3HOZH 2PMZE 3J7A5 4JBWA 1DOKA 1B3QA 1IKLA 3F2DA 2Z1CA 5DNFA 3OOCA 3J81j 4RGMA 5BR8L 1CSPA 2ZXOA 1W6KA 5M5YH 4Y52H 3UDXA 1SYBA 1R9TH 4DR7Q 1WJJA 4K6LA 5A2QE 2TMPA 3URYA 2PPBC 2F0SA 2IW3A 4DAPA 3R8BA 3BZKA 1KNEA 4QGUA 4GNXC 2F0WA 3GQBA 1XMQQ 3S17B 3HGBA 5C4XG 2B2WC 2FMMA 2BCOA 2CQAA 2F3IA 3HOVB 4MTKA 4GLXA 4DU9A 3CCVA 1XJVA 2A6HD 1K73C 1BUVT 1F9RA 1JORA 2MNAA 4PNYA 1YNJC 1BBUA 4YIJA 1I4HA 4JI8Q 1WTWA 2I07B 2F0QA 3H09A 4JPBW 3J80L 3RZOB 4RMFA 4C2MH 1CHQD 4LUOA 3A8IE 1DGSA 4DR3Q 4KN7C 4A3EH 4RH6A 3E3XA 2NVYH 2F0VA 1AP0A 5I9PA 1LLRD 2UXDL 3K8AA 3S1RB 4B3RL 2HIVA 5C5LA 4ALPA 3T1YL 1Y1WB 2Z4IA 1WYDA 2K5DA 2VQEQ 1UWVA 1IBLQ 3W1BA 1LACA 1UEBA 1G291 4CKBA 1A3UA 4L5TA 1GOZA 4EQOA 2Z6KC 4GLAC 4IFDI 4JI5Q 1I6HB 2PZTA 4LF6L 2KCNA 4P75A 4A75A 5FLXE 2B63B 1O7LA 2L11A 4NB3A 1VQOA 4WFN3 1MBYA 5CGKA 1B9MA 3ULLA 1L1OC 1XNQQ 1BCPF 4PG3A 1J8IA 2B29A 3HOYB 1BBWA 3T1HL 1MJEA 1LTTD 1Q46A 1J5EQ 1HJPA 5EPLA 4MHEA 1CHPD 5DM73 2E75C 1Y8PB 5LMNL 4N8FA 4P71A 1RJTA 2LFNA 4B3ML 2NN6I 1YNND 4MN3A 3SK4A 1UUPA 3BU2A 2NVXB 4O2DA 1KAWA 2JSOA 1BKBA 4HN7A 1TY2A 4JBMA 3ND8A 4K8IA 5C3EB 4BY1G 1I3QB 2CWAA 1QWYA 3L2PA 4A3FG 4A3MH 2C9OA 3A74A 4TKOB 1GUOA 1BXTA 4XT1B 1E0BA 4BY7B 1O78A 3LWUA 2CHBD 3KUPA 4N8X1 1SYCA 2P5ZX 1SNDA 1K3RA 4L8JA 3UI2A 4C3JG 3R2IA 4X3KA 5T1IA 1C4QA 3D4RA 4IOCA 3CMAA 3S16B 2UU9L 4DR1Q 1YHQA 3EIVA 1U4MA 4JI6L 1OTCA 4H02A 2IX0A 2IX1A 5IYDG 1KTKA 3QOJA 5M3MH 1FYCA 3PO3B 1CI3M 1M1KC 5E1FA 4POGA 1YI2A 3U9SA 1GUWA 4X64L 4HJ9A 2NVTB 5JAVA 2A6HC 3HS0C 3ONAB 3GTJB 3GTPB 5C6AA 4OIKA 4OWTB 1JB3A 1STAA 2YV5A 3RN5A 1SBBB 2M00A 2OEOA 2AKWB 4U673 2E2JB 2EQSA 1RTNA 5FJ8H 4IJHA 3TS2A 3I8ZA 2KCCA 4QB4A 1BOSA 2B2TA 2SNMA 1TXYA 1F2YA 3RLOA 4HJ5A 4C3HB 3BZDB 3NWTA 3STBD 1K3BC 5M9OA 1JOQA 1D1KA 4JI1L 1EZ6A 1HUMA 2VY3A 1WCMG 1Q8KA 4XQQA 4J1MA 3W1GA 1LTID 1K83B 4K5WA 2ZM6Q 2UXBQ 2V4DA 3HG9A 1RKNA 1NTGA 2I5MX 4RGNA 4B3TL 3QR8A 3ZJYC 4IQZA 4FXKC 1K9MC 3GP7A 5FO8B 3T51B 3FEWX 1EEID 4PMWA 2CFMA 1X32A 3EBEA 4WORA 1N32Q 4X6AH 3NBHB 1PH8A 5KNCA 2RF4A 1S5BD 3J81i 2K7VA 2HUGA 2F0KA 1KC8C 1X3PA 1B9NA 2ZT9C 3HOZB 1QVCA 4F87A 2PW7A 1XNRL 1X54A 1QJOA 1YNNC 1KL9A 2D5DA 4LF9L 3HKZE 2JA7G 2R7ZH 1B53A 2MGSA 2PMZB 1N33Q 1I4PA 1HNZQ 1TVXA 3S1NH 1GJXA 1R9TB 1EY7A 4DK1A 3OIQA 4OL7A 3OMCA 4JI4L 1I94L 5GAGC 3D8GA 3A55A 3ULJA 2UXCQ 2QGQA 4G7ZC 4GKJL 2KCTA 3KLSA 3VDYA 2GN5A 1TS4A 2KENA 4ME5A 4KD4A 4WJWA 1XPOA 2NZHA 1PRTB 3H0GH 4LWCA 2HQEA 3FKIG 4C1NI 4RG1A 1MIUA 1WTVA 4DR4Q 3I4NG 1QUQA 1V43A 4C2MB 1YHBA 3BYYB 3PO2G 4A3EB 1YHAA 4C1NK 2NVYB 3CPFA 1BDOA 5C4HA 5C0XG 3WOEA 1LT5D 2H4OA 3DWAA 4V190 4X3UA 4P73A 4L5SA 3LNNA 1J9OA 3D3RA 2EJMA 2KA7A 4PZ7A 4DUYL 4QCLA 2UUAL 5KYIA 5C4JH 1SYDA 1SNOA 2E74C 1IL2A 1VQNA 4OWWB 1HNWL 1U0LA 4H0LC 4AQYQ 4R4IA 4JI2Q 4DV7Q 4P74A 1EL0A 1WTOA 3K80C 1HTLD 1ET9A 2UUBL 4HTHA 1H9JA 1Q1EA 4YWMA 3BG3A 4CHTB 2RDFA 1VQPA 5K36G 5J39A 2F0DA 3STBC 2WP8J 5K36H 1OO9B 3IL8A 4BA2I 4BBRG 4KHPL 3A7LA 3GTKH 1TWCB 3PIPA 2ZJQA 3TZUA 1A8VA 3FPPA 2NVQH 4BBRH 3A7AB 4LF8Q 4DR2L 5ELFA 4GKKQ 5I6WA 3S1QH 5EAYA 1PLFA 2PNRC 2DY8A 1TKWB 5JJIA 1JJCB 4ZKCB 3RN2A 4Q0FA 4A3IH 1WVLA 5BR8Q 2A74C 1HH2P 3U58A 4FF1A 4ODGA 1YNXA 1CQFA 1Q86C 3KYHC 4GN3B 2R6GA 4IUQA 3DXJC 4ID6A 4IFDJ 2JP1A 2WB1E 1BCPD 1G8ZD 1CKNB 3F8TA 4LNQA 5CV5A 4JCVE 3HOUH 3E0JA 4HMIA 4J8QA 4LK1C 1F9PA 4E6IA 4IO9A 4PQXA 4DN4M 1UE1A 1TQOA 3CU7A 5I2XA 2RCFA 2RKSA 3RR5A 2GVBA 5ELBA 4CDEC 4LF5L 4KHVA 3T56B 5M3MB 3I70A 1KDAA 1M4VA 3S9WA 1JJGA 5LHY1 3G7LA 2E2IH 2XTIA 2F0FA 4KJOA
chains in the Genus database with same CATH topology
2Q2UA 4C3HH 1TWCH 3KOJA 3E9HA 4JI2L 3HOXH 4A3KG 2ZJPA 2JA8H 1X9NA 3PGZA 3JAMi 1Y1WG 3KJOA 4HIOA 2R92G 3H0GG 4UPAA 1M90C 2Q2TA 3UDIA 4DV6Q 2F4VQ 4B3RQ 3TS0A 3F2BA 2JEAI 4DR7L 1W3SA 2R92H 1VS0A 3TREA 1JJ2A 2K5VA 4X65L 2OWOA 2HHHL 1Q81C 2CKZB 3L7ZC 2R93H 5GROA 3JC66 4OX9L 1Y1VH 2JA6G 3MEFA 1P8LA 4OWXB 2IY5B 5C44G 5ELNA 1N34L 1XMQL 4IFDG 4L5RC 1XMOQ 2OQ0A 4UP7A 3H3VI 2JA6H 1KHIA 3TEHB 5LMNW 2LXJA 4DV4Q 1FVIA 3CW2C 4EQ5A 5LMUL 4LF6Q 4MNOA 4LFAQ 2IT1A 2FXQA 4IPGA 3CCMA 2I5HA 1W2BA 1HNXQ 1Y14B 3CCJA 4BY1H 4LF8L 2LXKA 2YYZA 1HZAA 1A62A 1I50H 1VQHA 4A3FH 3CC7A 2UUCL 1OXUA 1HR0W 4A3LG 4DR6Q 4DV5Q 3OTOL 3T1HQ 1H95A 3OYYA 3U4VA 1WOCA 3HOZH 1VQBA 2PMZE 3J7A5 4A3LH 4JBWA 3CAMA 5M3FG 4J15A 3U4ZA 4DK6C 3H15A 3F2DA 4IPDA 4DR3L 4DR5Q 5LMNQ 4C3JH 5H1SE 5IP7H 3J81j 2OCEA 2NN6G 5BR8L 1TWHH 1CSPA 3W5OA 5HGQA 3PCOB 3CCRA 5M5YH 4DV1L 3M4QA 4JI7Q 4Y52H 2ALYB 1B8AA 5IWAQ 3UDXA 4GLVB 5FLMG 2B3GA 1N36Q 1R9TH 2OTLA 4DR7Q 1WJJA 1TWAH 4A3CH 1TWFH 3PUVA 5IYDH 4GOPC 5FLMH 2K5HA 3BZKA 3RNUA 2LSSA 1X6OA 3NELA 5C3EG 4YWLA 1VQ6A 3RLFA 4JI0Q 4QGUA 4GNXC 1XMQQ 4AYBE 2VQEL 1SLJA 1IBLL 5C4XG 4AYBG 3AFQA 3I7FA 3HOWG 1E3PA 1Q12A 2F3IA 4WJ4A 1NY4A 1VQDA 4GLXA 3CCVA 1S40A 4GOPB 4BXXH 1PYBA 4HJ8A 1XJVA 1QVFA 4GNXB 1C9OA 4ME3A 4JYAL 4DUZL 1K73C 2A19A 1NBWA 2MQHA 2MNAA 1BBUA 1NJIC 4JI8Q 1WI5A 1E7ZA 2WAQE 3CCSA 2JA9A 4LF7L 5HY6A 4JC0A 4A3IG 4RMFA 3ULPA 4C2MH 3S14H 2E2HH 4LUOA 1DGSA 4DR3Q 3U50C 4A3EH 1VQKA 4R4QA 4YY3L 4JI6Q 1X55A 1KRSA 5IYCH 2NVYH 4GOPA 2N3SA 2I5LX 2I0QA 3G71A 3S2HH 1EQQA 4GNXA 3PO3G 2UXDL 1FL0A 4MZ9A 1KQSA 3UE0A 3K8AA 1PH6A 5JEAJ 1OXTA 5IYBG 1Q7YC 4DV6L 3F1ZA 5IT9c 2F4VL 4B3RL 1GD7A 2HIVA 4JOIC 4ALPA 3T1YL 2ZTCA 1PA6A 1E1TA 1WCMH 3Q8DA 5IYBH 2K50A 3HOUG 1WYDA 4A93G 4A76A 2Y0SE 2VQEQ 3M3YH 1UWVA 2WB1G 1IBLQ 3W1BA 3L0OA 2D0OA 4YWKA 3NENA 1UEBA 1G291 2VZAA 5E7NA 1XMOL 2ZTDA 1I5FA 4L5TA 2Z6KC 1NE3A 3B6YA 4GLAC 2JE6I 3GDEA 5GQOA 4A3GH 4IFDI 1QZGA 4JI5Q 3K81C 4LF6L 1GM5A 4P75A 4A75A 4QJFA 1HNXL 2Q2IA 4NB3A 1VQOA 4O0AA 3ULLA 2KBNA 1L1OC 3CCQA 1XNQQ 4DR6L 4PG3A 2JEBI 2B29A 1GKHA 4DV5L 2ASBA 1BBWA 2KCMA 1NMFA 2YTYA 3GD7A 2PI2A 4LUVA 1Q46A 3T1HL 1MJEA 3S24A 4QY7A 5JJKA 1SMXA 2JA8G 1J5EQ 1HJPA 4A3JH 2HQLA 4A3BH 3AEVA 5C0XJ 1OXSC 2ZTEA 4JOIA 4DKAC 3CF5A 4DR5L 5LMNL 3HOVH 1AE2A 2K14A 4P71A 3LGJA 1E1OA 2PQAB 2UXDQ 4JI1Q 1L0WA 2BA0A 4GS3A 1QVGA 2K5NA 4JI7L 3ER0A 1YZ6A 4B3ML 1U5KA 5IWAL 4Y7NH 2JA7H 2R93G 1EOVA 1N36L 2NN6I 3T1YQ 1HR0L 1Y1VG 3BU2A 1V1QA 2Z6KA 4O2DA 5JEAG 1PH4A 1KAWA 1BKBA 3FP9A 1LM0A 1C0AA 1A63A 1CKOA 4AIMA 2CCZA 4JI0L 1VQJA 3PF4A 3CP0A 5JJLA 5AJ3Q 4B3TQ 4JBMA 4LFCQ 1EWIA 3GTQH 3E9IA 4DV2Q 2PQAA 1L1OA 4BY1G 1VQCA 4DV3L 2CWAA 4L5QA 3L2PA 3UE1A 4A3FG 1JB7A 3RZDH 1EIFA 4A3MH 2BH2A 3A74A 3M4OH 2ID0A 3I2ZA 2YTVA 1VQ9A 2ATWA 1EFWA 4LUZA 3HOZG 4YHHQ 3I55A 4JI8L 1PFSA 1KRTA 4DPGA 2VW9A 3CCEA 3KLWA 1K3RA 3FKIH 4IOCA 1S72A 1XNRQ 5IP7G 3CMAA 1SFOH 1KXLA 2UU9L 4DR1Q 1YBYA 1MKHA 2E8GA 1YHQA 3I4NH 3EIVA 2HIXA 4UP8A 1GVPA 5GAHC 1OTCA 4H02A 4JI6L 4A3CG 4BBSH 2IX0A 2WFWA 2IX1A 1AH9A 3PO2H 4JG2A 1AE3A 5IYDG 4B3MQ 3J81c 1YITA 3TRZA 1G6PA 1HR0Q 4X62Q 1CUKA 5M3MH 1L2FA 2C35B 4JI4Q 1I94Q 1RIPA 1M1KC 1PH7A 4POGA 3NEMA 4IJLA 2VUMG 2UXBL 1YI2A 3F2CA 4GN4B 2QA4A 1Z9FA 4X64L 4HJ9A 1EQRA 4P72A 4BXXG 4GKJQ 4UP9A 2VUMH 4DV3Q 1FJGL 2EXDA 2V1CC 3MXNB 4HIKA 2ES2A 4OWTB 3PF5A 3KF6B 4TQUS 4EX5A 1VQEA 3DLLA 4JI5L 2YV5A 4XIGS 3RN5A 1VQGA 2ZJRA 3TQYA 1JT8A 1VQMA 4DK3C 2AKWB 2AMCB 3GTGH 2JJQA 1B7YB 2EQSA 1TWGH 4NPSA 4IOAA 1LTLA 5J3BA 5FJ8H 4IJHA 1XNQL 3TS2A 4A3EG 2MFIA 2KHIA 2WAQG 1ASYA 5IYCG 4AH6A 1TXYA 2UU9Q 1RL2A 2AWNA 3AQQA 1J5EL 3RLOA 4APVA 4HJ5A 4QIWE 4LF4Q 4NXMQ 3H3VH 4OO1I 1I3QH 3K7UC 3KF6A 3STBD 2A8VA 3CD6A 3GTMH 4A3BG 2OQKA 4JI1L 5GAEC 2VY3A 1WCMG 1QZHA 1SN8A 1Q8KA 4DUYQ 1Q1BA 1HNZL 2UUAQ 2MO1A 3W1GA 2VS1A 4GN5A 1YJWA 2ZM6Q 1HNWQ 2UXBQ 1GO3E 2N8NA 4DV0Q 4MTNA 3S16H 3S1MH 4X64Q 1N8RC 3ERSX 2Y0SG 2DGYA 1NTGA 2I5MX 3KF8B 4A3GG 2H5XA 4LFCL 4IPCA 3ZJYC 2GVAA 5AJ3L 4B3TL 1FJGQ 1K9MC 3S15H 1PV4A 4HJAA 4DV2L 1WFQA 2RCNA 4PMWA 2CFMA 1BVSA 1X65A 3EBEA 4DAYB 1N32Q 4K0KL 4X6AH 3E0EA 2CWPA 3NBHB 1PH8A 2YU9H 4C3IH 3PIOA 2Q2HA 2RF4A 3J81i 4R4CA 3CCLA 1PH5A 4YHHL 1A0IA 4A3JG 1SROA 2PNHA 4NXNL 1KC8C 1VQ7A 3S17H 4YCUA 4KHZA 3HOVG 2BA1A 1QVCA 3CMEA 3PUXA 1XNRL 5DLQE 3KJPA 1X54A 4KHPQ 1IBKL 4DR1L 1KL9A 4LF9L 3HKZE 2JA7G 4BA1I 2R7ZH 1PH1A 1L1OB 3WWVA 1N33Q 1CSQA 2E5LQ 1EUJA 1HNZQ 3S1NH 1D7QA 4X62L 1YVCA 3D31A 4JI4L 1I94L 5GAGC 4JI3Q 2HT1A 1CKNA 1FGUA 4HJ7A 3I4MH 4DAMA 1YJNA 4HIDA 2BH8A 3RZOH 1D8LA 1E24A 1Z47A 4AQYL 3K7AH 3ULJA 2UXCQ 3IRBA 3PSIA 2QGQA 2XGTA 1QUQB 4A3MG 4KLKA 4GKJL 1LUZA 2KCTA 4DV7L 3CCUA 1JMCA 1SRUA 1IZ6A 4XTCS 2GN5A 3VDYA 1IXRA 1PHJA 4LFBL 2K75A 3UDFA 3PUYA 4K0KQ 4A3KH 2JK8A 3S1RH 2KENA 4IPHA 1B70B 1E22A 4LW1A 2PI2E 3A0JA 1MJCA 3HFZB 1Y1WH 1PH2A 1XPOA 2NZHA 3H0GH 1K83H 3FKIG 4LWCA 3CPWA 3GO5A 4RG1A 4NXNQ 1MIUA 3G4SA 2Z0SA 4DR4Q 3I4NG 3PV0A 1QUQA 1V43A 1VQFA 1YHBA 4B3SQ 1YJ9A 3M7NA 4BBSG 4R4TA 1IBKQ 3PO2G 2AWOA 4LF9Q 4LF4L 1YHAA 4NXML 2B63G 1SE8A 5C44H 3GTOH 4QQBX 1PYSB 3CPFA 5M5WH 1I6HH 5M3MG 5ELOA 1IYJB 5C0XG 1PH3A 4UY8C 1KD1C 3EN2A 2B63H 3I4OA 3J7ZC 3HOYG 1HZ9A 2N78A 4P73A 2VQFQ 4L5SA 4GKKL 3K0XA 1J6QA 4OXPA 4LF5Q 4PZ7A 3CXCA 4DUYL 3FHWA 3HOYH 2UUAL 1P16A 5C4JH 3SGIA 1IL2A 1X3GA 1VQNA 3S2DH 4OWWB 2ZM6L 3D0FA 1U0LA 1HNWL 4AQYQ 2RHSB 3G48A 4DV0L 3J80i 1C7YA 2F52A 2CQOA 3M85A 4R4IA 1YEZA 4JI2Q 3A5UA 4DV7Q 4P74A 3K80C 1VQ4A 4LFBQ 5M3FH 1HZCA 1VQLA 2UUBL 2KHJA 4TVAB 2NZOA 4X66L 5FJ8G 1ASZA 1Q1EA 1X3EA 4YWMA 3I56A 2JA5G 5GADC 2NVXH 4JV5L 1N32L 4X65Q 2VNUD 3RLNA 1X3FA 2HHHQ 2DUDA 4POFA 1VQPA 5K36G 1EYGA 1VQAA 3STBC 4OX9Q 1HZBA 2D62A 2D0PA 5M5XH 2JA5H 1VCIA 4HIMA 2R7DA 4WJ3M 1SR3A 1N34Q 2L15A 2WP8J 3CC4A 1K0RA 3JAMc 2YTXA 5C3EH 4BA2I 1T9HA 3KDFB 4BBRG 4KHPL 2K4KA 4DNIA 3GTKH 1G51A 5IY0A 3PIPA 1K8AC 1IBML 2ZJQA 4BY7G 5LMUQ 5C4XH 3UDGA 1A8VA 4PZ6A 3HOWH 1UE6A 1UE7A 2NVQH 4BBRH 1NMGA 4LF8Q 1N33L 4BY7H 1O7IA 4DR2L 4GKKQ 2E5LL 2RHQB 2UUCQ 4PZ8A 3S1QH 1XTDA 5EAYA 3M4PA 1CKMA 3OTOQ 1OXXK 2OTJA 1KIXA 4JI3L 1K8GA 1UE5A 5IP9G 3A5ZB 5JJIA 4A4IA 1JJCB 3KDFA 4QL5A 3RN2A 2UXCL 5IP9H 4A3IH 4A3DG 5BR8Q 4R4OA 2UUBQ 1HH2P 4DV1Q 3CC2A 3ICEA 3U58A 3PUWA 4X66Q 1YNXA 4JV5Q 1JE5A 4JBKA 4A3DH 4YCVA 3AFPA 1Q86C 3M9BA 3GTLH 3KYHC 4GN3B 4JBJA 5FLXc 1LYLA 2R6GA 2MO0A 4KI0A 1YIJA 3PO3H 3J80c 1OXVA 1EIYB 4IFDJ 2WB1E 3DM3A 3AYHB 1PVOA 1CKNB 2JQOA 3BZCA 3F8TA 1V9PA 4LNQA 3BJUA 2IHFA 2NVTH 4DR4L 2R7ZG 1PH9A 4JCVE 3GTJH 4B3SL 5IE8A 1Q82C 3GTPH 1N9WA 3HOUH 4A93H 2QEXA 4OONA 1IBMQ 3CQZH 4IO9A 2IHEA 2R7FA 4DV4L 3HKSA 3HKZG 1UE1A 4DR2Q 4LFAL 3KFUA 3OW2A 1VQ8A 4DUZQ 4JYAQ 3I4MG 3RR5A 2AHOB 2GVBA 1S3OA 4R1JA 1VQIA 2VQFL 2E2JH 4LF5L 5C0XI 4YCWA 1X56A 2K52A 4LF7Q 2VL6A 4OO1G 1JJGA 3G6EA 2E2IH 1XPRA 2N49A 2XTIA 3HOXG 2A1AA 2EIFA 3PUZA 1VQ5A 4FDBA 1XPUA 4YY3Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2U A;  4C3H H;  1TWC H;  3KOJ A;  3E9H A;  4JI2 L;  3HOX H;  4A3K G;  2ZJP A;  2JA8 H;  1X9N A;  3PGZ A;  3JAM i;  1Y1W G;  3KJO A;  4HIO A;  2R92 G;  3H0G G;  4UPA A;  1M90 C;  2Q2T A;  3UDI A;  4DV6 Q;  2F4V Q;  4B3R Q;  3TS0 A;  3F2B A;  2JEA I;  4DR7 L;  1W3S A;  2R92 H;  1VS0 A;  3TRE A;  1JJ2 A;  2K5V A;  4X65 L;  2OWO A;  2HHH L;  1Q81 C;  2CKZ B;  3L7Z C;  2R93 H;  5GRO A;  3JC6 6;  4OX9 L;  1Y1V H;  2JA6 G;  3MEF A;  1P8L A;  4OWX B;  2IY5 B;  5C44 G;  5ELN A;  1N34 L;  1XMQ L;  4IFD G;  4L5R C;  1XMO Q;  2OQ0 A;  4UP7 A;  3H3V I;  2JA6 H;  1KHI A;  3TEH B;  5LMN W;  2LXJ A;  4DV4 Q;  1FVI A;  3CW2 C;  4EQ5 A;  5LMU L;  4LF6 Q;  4MNO A;  4LFA Q;  2IT1 A;  2FXQ A;  4IPG A;  3CCM A;  2I5H A;  1W2B A;  1HNX Q;  1Y14 B;  3CCJ A;  4BY1 H;  4LF8 L;  2LXK A;  2YYZ A;  1HZA A;  1A62 A;  1I50 H;  1VQH A;  4A3F H;  3CC7 A;  2UUC L;  1OXU A;  1HR0 W;  4A3L G;  4DR6 Q;  4DV5 Q;  3OTO L;  3T1H Q;  1H95 A;  3OYY A;  3U4V A;  1WOC A;  3HOZ H;  1VQB A;  2PMZ E;  3J7A 5;  4A3L H;  4JBW A;  3CAM A;  5M3F G;  4J15 A;  3U4Z A;  4DK6 C;  3H15 A;  3F2D A;  4IPD A;  4DR3 L;  4DR5 Q;  5LMN Q;  4C3J H;  5H1S E;  5IP7 H;  3J81 j;  2OCE A;  2NN6 G;  5BR8 L;  1TWH H;  1CSP A;  3W5O A;  5HGQ A;  3PCO B;  3CCR A;  5M5Y H;  4DV1 L;  3M4Q A;  4JI7 Q;  4Y52 H;  2ALY B;  1B8A A;  5IWA Q;  3UDX A;  4GLV B;  5FLM G;  2B3G A;  1N36 Q;  1R9T H;  2OTL A;  4DR7 Q;  1WJJ A;  1TWA H;  4A3C H;  1TWF H;  3PUV A;  5IYD H;  4GOP C;  5FLM H;  2K5H A;  3BZK A;  3RNU A;  2LSS A;  1X6O A;  3NEL A;  5C3E G;  4YWL A;  1VQ6 A;  3RLF A;  4JI0 Q;  4QGU A;  4GNX C;  1XMQ Q;  4AYB E;  2VQE L;  1SLJ A;  1IBL L;  5C4X G;  4AYB G;  3AFQ A;  3I7F A;  3HOW G;  1E3P A;  1Q12 A;  2F3I A;  4WJ4 A;  1NY4 A;  1VQD A;  4GLX A;  3CCV A;  1S40 A;  4GOP B;  4BXX H;  1PYB A;  4HJ8 A;  1XJV A;  1QVF A;  4GNX B;  1C9O A;  4ME3 A;  4JYA L;  4DUZ L;  1K73 C;  2A19 A;  1NBW A;  2MQH A;  2MNA A;  1BBU A;  1NJI C;  4JI8 Q;  1WI5 A;  1E7Z A;  2WAQ E;  3CCS A;  2JA9 A;  4LF7 L;  5HY6 A;  4JC0 A;  4A3I G;  4RMF A;  3ULP A;  4C2M H;  3S14 H;  2E2H H;  4LUO A;  1DGS A;  4DR3 Q;  3U50 C;  4A3E H;  1VQK A;  4R4Q A;  4YY3 L;  4JI6 Q;  1X55 A;  1KRS A;  5IYC H;  2NVY H;  4GOP A;  2N3S A;  2I5L X;  2I0Q A;  3G71 A;  3S2H H;  1EQQ A;  4GNX A;  3PO3 G;  2UXD L;  1FL0 A;  4MZ9 A;  1KQS A;  3UE0 A;  3K8A A;  1PH6 A;  5JEA J;  1OXT A;  5IYB G;  1Q7Y C;  4DV6 L;  3F1Z A;  5IT9 c;  2F4V L;  4B3R L;  1GD7 A;  2HIV A;  4JOI C;  4ALP A;  3T1Y L;  2ZTC A;  1PA6 A;  1E1T A;  1WCM H;  3Q8D A;  5IYB H;  2K50 A;  3HOU G;  1WYD A;  4A93 G;  4A76 A;  2Y0S E;  2VQE Q;  3M3Y H;  1UWV A;  2WB1 G;  1IBL Q;  3W1B A;  3L0O A;  2D0O A;  4YWK A;  3NEN A;  1UEB A;  1G29 1;  2VZA A;  5E7N A;  1XMO L;  2ZTD A;  1I5F A;  4L5T A;  2Z6K C;  1NE3 A;  3B6Y A;  4GLA C;  2JE6 I;  3GDE A;  5GQO A;  4A3G H;  4IFD I;  1QZG A;  4JI5 Q;  3K81 C;  4LF6 L;  1GM5 A;  4P75 A;  4A75 A;  4QJF A;  1HNX L;  2Q2I A;  4NB3 A;  1VQO A;  4O0A A;  3ULL A;  2KBN A;  1L1O C;  3CCQ A;  1XNQ Q;  4DR6 L;  4PG3 A;  2JEB I;  2B29 A;  1GKH A;  4DV5 L;  2ASB A;  1BBW A;  2KCM A;  1NMF A;  2YTY A;  3GD7 A;  2PI2 A;  4LUV A;  1Q46 A;  3T1H L;  1MJE A;  3S24 A;  4QY7 A;  5JJK A;  1SMX A;  2JA8 G;  1J5E Q;  1HJP A;  4A3J H;  2HQL A;  4A3B H;  3AEV A;  5C0X J;  1OXS C;  2ZTE A;  4JOI A;  4DKA C;  3CF5 A;  4DR5 L;  5LMN L;  3HOV H;  1AE2 A;  2K14 A;  4P71 A;  3LGJ A;  1E1O A;  2PQA B;  2UXD Q;  4JI1 Q;  1L0W A;  2BA0 A;  4GS3 A;  1QVG A;  2K5N A;  4JI7 L;  3ER0 A;  1YZ6 A;  4B3M L;  1U5K A;  5IWA L;  4Y7N H;  2JA7 H;  2R93 G;  1EOV A;  1N36 L;  2NN6 I;  3T1Y Q;  1HR0 L;  1Y1V G;  3BU2 A;  1V1Q A;  2Z6K A;  4O2D A;  5JEA G;  1PH4 A;  1KAW A;  1BKB A;  3FP9 A;  1LM0 A;  1C0A A;  1A63 A;  1CKO A;  4AIM A;  2CCZ A;  4JI0 L;  1VQJ A;  3PF4 A;  3CP0 A;  5JJL A;  5AJ3 Q;  4B3T Q;  4JBM A;  4LFC Q;  1EWI A;  3GTQ H;  3E9I A;  4DV2 Q;  2PQA A;  1L1O A;  4BY1 G;  1VQC A;  4DV3 L;  2CWA A;  4L5Q A;  3L2P A;  3UE1 A;  4A3F G;  1JB7 A;  3RZD H;  1EIF A;  4A3M H;  2BH2 A;  3A74 A;  3M4O H;  2ID0 A;  3I2Z A;  2YTV A;  1VQ9 A;  2ATW A;  1EFW A;  4LUZ A;  3HOZ G;  4YHH Q;  3I55 A;  4JI8 L;  1PFS A;  1KRT A;  4DPG A;  2VW9 A;  3CCE A;  3KLW A;  1K3R A;  3FKI H;  4IOC A;  1S72 A;  1XNR Q;  5IP7 G;  3CMA A;  1SFO H;  1KXL A;  2UU9 L;  4DR1 Q;  1YBY A;  1MKH A;  2E8G A;  1YHQ A;  3I4N H;  3EIV A;  2HIX A;  4UP8 A;  1GVP A;  5GAH C;  1OTC A;  4H02 A;  4JI6 L;  4A3C G;  4BBS H;  2IX0 A;  2WFW A;  2IX1 A;  1AH9 A;  3PO2 H;  4JG2 A;  1AE3 A;  5IYD G;  4B3M Q;  3J81 c;  1YIT A;  3TRZ A;  1G6P A;  1HR0 Q;  4X62 Q;  1CUK A;  5M3M H;  1L2F A;  2C35 B;  4JI4 Q;  1I94 Q;  1RIP A;  1M1K C;  1PH7 A;  4POG A;  3NEM A;  4IJL A;  2VUM G;  2UXB L;  1YI2 A;  3F2C A;  4GN4 B;  2QA4 A;  1Z9F A;  4X64 L;  4HJ9 A;  1EQR A;  4P72 A;  4BXX G;  4GKJ Q;  4UP9 A;  2VUM H;  4DV3 Q;  1FJG L;  2EXD A;  2V1C C;  3MXN B;  4HIK A;  2ES2 A;  4OWT B;  3PF5 A;  3KF6 B;  4TQU S;  4EX5 A;  1VQE A;  3DLL A;  4JI5 L;  2YV5 A;  4XIG S;  3RN5 A;  1VQG A;  2ZJR A;  3TQY A;  1JT8 A;  1VQM A;  4DK3 C;  2AKW B;  2AMC B;  3GTG H;  2JJQ A;  1B7Y B;  2EQS A;  1TWG H;  4NPS A;  4IOA A;  1LTL A;  5J3B A;  5FJ8 H;  4IJH A;  1XNQ L;  3TS2 A;  4A3E G;  2MFI A;  2KHI A;  2WAQ G;  1ASY A;  5IYC G;  4AH6 A;  1TXY A;  2UU9 Q;  1RL2 A;  2AWN A;  3AQQ A;  1J5E L;  3RLO A;  4APV A;  4HJ5 A;  4QIW E;  4LF4 Q;  4NXM Q;  3H3V H;  4OO1 I;  1I3Q H;  3K7U C;  3KF6 A;  3STB D;  2A8V A;  3CD6 A;  3GTM H;  4A3B G;  2OQK A;  4JI1 L;  5GAE C;  2VY3 A;  1WCM G;  1QZH A;  1SN8 A;  1Q8K A;  4DUY Q;  1Q1B A;  1HNZ L;  2UUA Q;  2MO1 A;  3W1G A;  2VS1 A;  4GN5 A;  1YJW A;  2ZM6 Q;  1HNW Q;  2UXB Q;  1GO3 E;  2N8N A;  4DV0 Q;  4MTN A;  3S16 H;  3S1M H;  4X64 Q;  1N8R C;  3ERS X;  2Y0S G;  2DGY A;  1NTG A;  2I5M X;  3KF8 B;  4A3G G;  2H5X A;  4LFC L;  4IPC A;  3ZJY C;  2GVA A;  5AJ3 L;  4B3T L;  1FJG Q;  1K9M C;  3S15 H;  1PV4 A;  4HJA A;  4DV2 L;  1WFQ A;  2RCN A;  4PMW A;  2CFM A;  1BVS A;  1X65 A;  3EBE A;  4DAY B;  1N32 Q;  4K0K L;  4X6A H;  3E0E A;  2CWP A;  3NBH B;  1PH8 A;  2YU9 H;  4C3I H;  3PIO A;  2Q2H A;  2RF4 A;  3J81 i;  4R4C A;  3CCL A;  1PH5 A;  4YHH L;  1A0I A;  4A3J G;  1SRO A;  2PNH A;  4NXN L;  1KC8 C;  1VQ7 A;  3S17 H;  4YCU A;  4KHZ A;  3HOV G;  2BA1 A;  1QVC A;  3CME A;  3PUX A;  1XNR L;  5DLQ E;  3KJP A;  1X54 A;  4KHP Q;  1IBK L;  4DR1 L;  1KL9 A;  4LF9 L;  3HKZ E;  2JA7 G;  4BA1 I;  2R7Z H;  1PH1 A;  1L1O B;  3WWV A;  1N33 Q;  1CSQ A;  2E5L Q;  1EUJ A;  1HNZ Q;  3S1N H;  1D7Q A;  4X62 L;  1YVC A;  3D31 A;  4JI4 L;  1I94 L;  5GAG C;  4JI3 Q;  2HT1 A;  1CKN A;  1FGU A;  4HJ7 A;  3I4M H;  4DAM A;  1YJN A;  4HID A;  2BH8 A;  3RZO H;  1D8L A;  1E24 A;  1Z47 A;  4AQY L;  3K7A H;  3ULJ A;  2UXC Q;  3IRB A;  3PSI A;  2QGQ A;  2XGT A;  1QUQ B;  4A3M G;  4KLK A;  4GKJ L;  1LUZ A;  2KCT A;  4DV7 L;  3CCU A;  1JMC A;  1SRU A;  1IZ6 A;  4XTC S;  2GN5 A;  3VDY A;  1IXR A;  1PHJ A;  4LFB L;  2K75 A;  3UDF A;  3PUY A;  4K0K Q;  4A3K H;  2JK8 A;  3S1R H;  2KEN A;  4IPH A;  1B70 B;  1E22 A;  4LW1 A;  2PI2 E;  3A0J A;  1MJC A;  3HFZ B;  1Y1W H;  1PH2 A;  1XPO A;  2NZH A;  3H0G H;  1K83 H;  3FKI G;  4LWC A;  3CPW A;  3GO5 A;  4RG1 A;  4NXN Q;  1MIU A;  3G4S A;  2Z0S A;  4DR4 Q;  3I4N G;  3PV0 A;  1QUQ A;  1V43 A;  1VQF A;  1YHB A;  4B3S Q;  1YJ9 A;  3M7N A;  4BBS G;  4R4T A;  1IBK Q;  3PO2 G;  2AWO A;  4LF9 Q;  4LF4 L;  1YHA A;  4NXM L;  2B63 G;  1SE8 A;  5C44 H;  3GTO H;  4QQB X;  1PYS B;  3CPF A;  5M5W H;  1I6H H;  5M3M G;  5ELO A;  1IYJ B;  5C0X G;  1PH3 A;  4UY8 C;  1KD1 C;  3EN2 A;  2B63 H;  3I4O A;  3J7Z C;  3HOY G;  1HZ9 A;  2N78 A;  4P73 A;  2VQF Q;  4L5S A;  4GKK L;  3K0X A;  1J6Q A;  4OXP A;  4LF5 Q;  4PZ7 A;  3CXC A;  4DUY L;  3FHW A;  3HOY H;  2UUA L;  1P16 A;  5C4J H;  3SGI A;  1IL2 A;  1X3G A;  1VQN A;  3S2D H;  4OWW B;  2ZM6 L;  3D0F A;  1U0L A;  1HNW L;  4AQY Q;  2RHS B;  3G48 A;  4DV0 L;  3J80 i;  1C7Y A;  2F52 A;  2CQO A;  3M85 A;  4R4I A;  1YEZ A;  4JI2 Q;  3A5U A;  4DV7 Q;  4P74 A;  3K80 C;  1VQ4 A;  4LFB Q;  5M3F H;  1HZC A;  1VQL A;  2UUB L;  2KHJ A;  4TVA B;  2NZO A;  4X66 L;  5FJ8 G;  1ASZ A;  1Q1E A;  1X3E A;  4YWM A;  3I56 A;  2JA5 G;  5GAD C;  2NVX H;  4JV5 L;  1N32 L;  4X65 Q;  2VNU D;  3RLN A;  1X3F A;  2HHH Q;  2DUD A;  4POF A;  1VQP A;  5K36 G;  1EYG A;  1VQA A;  3STB C;  4OX9 Q;  1HZB A;  2D62 A;  2D0P A;  5M5X H;  2JA5 H;  1VCI A;  4HIM A;  2R7D A;  4WJ3 M;  1SR3 A;  1N34 Q;  2L15 A;  2WP8 J;  3CC4 A;  1K0R A;  3JAM c;  2YTX A;  5C3E H;  4BA2 I;  1T9H A;  3KDF B;  4BBR G;  4KHP L;  2K4K A;  4DNI A;  3GTK H;  1G51 A;  5IY0 A;  3PIP A;  1K8A C;  1IBM L;  2ZJQ A;  4BY7 G;  5LMU Q;  5C4X H;  3UDG A;  1A8V A;  4PZ6 A;  3HOW H;  1UE6 A;  1UE7 A;  2NVQ H;  4BBR H;  1NMG A;  4LF8 Q;  1N33 L;  4BY7 H;  1O7I A;  4DR2 L;  4GKK Q;  2E5L L;  2RHQ B;  2UUC Q;  4PZ8 A;  3S1Q H;  1XTD A;  5EAY A;  3M4P A;  1CKM A;  3OTO Q;  1OXX K;  2OTJ A;  1KIX A;  4JI3 L;  1K8G A;  1UE5 A;  5IP9 G;  3A5Z B;  5JJI A;  4A4I A;  1JJC B;  3KDF A;  4QL5 A;  3RN2 A;  2UXC L;  5IP9 H;  4A3I H;  4A3D G;  5BR8 Q;  4R4O A;  2UUB Q;  1HH2 P;  4DV1 Q;  3CC2 A;  3ICE A;  3U58 A;  3PUW A;  4X66 Q;  1YNX A;  4JV5 Q;  1JE5 A;  4JBK A;  4A3D H;  4YCV A;  3AFP A;  1Q86 C;  3M9B A;  3GTL H;  3KYH C;  4GN3 B;  4JBJ A;  5FLX c;  1LYL A;  2R6G A;  2MO0 A;  4KI0 A;  1YIJ A;  3PO3 H;  3J80 c;  1OXV A;  1EIY B;  4IFD J;  2WB1 E;  3DM3 A;  3AYH B;  1PVO A;  1CKN B;  2JQO A;  3BZC A;  3F8T A;  1V9P A;  4LNQ A;  3BJU A;  2IHF A;  2NVT H;  4DR4 L;  2R7Z G;  1PH9 A;  4JCV E;  3GTJ H;  4B3S L;  5IE8 A;  1Q82 C;  3GTP H;  1N9W A;  3HOU H;  4A93 H;  2QEX A;  4OON A;  1IBM Q;  3CQZ H;  4IO9 A;  2IHE A;  2R7F A;  4DV4 L;  3HKS A;  3HKZ G;  1UE1 A;  4DR2 Q;  4LFA L;  3KFU A;  3OW2 A;  1VQ8 A;  4DUZ Q;  4JYA Q;  3I4M G;  3RR5 A;  2AHO B;  2GVB A;  1S3O A;  4R1J A;  1VQI A;  2VQF L;  2E2J H;  4LF5 L;  5C0X I;  4YCW A;  1X56 A;  2K52 A;  4LF7 Q;  2VL6 A;  4OO1 G;  1JJG A;  3G6E A;  2E2I H;  1XPR A;  2N49 A;  2XTI A;  3HOX G;  2A1A A;  2EIF A;  3PUZ A;  1VQ5 A;  4FDB A;  1XPU A;  4YY3 Q; 
#chains in the Genus database with same CATH topology
 2WKD A;  2GA4 B;  3E9H A;  5DEH A;  2ZJP A;  2JA8 H;  1JIC A;  1Y1W G;  2R92 G;  3L9A X;  1WTH A;  3UDI A;  1LTR D;  3BYT B;  4B3R Q;  2F3V A;  2A6E D;  3J81 L;  2MUY A;  5CV6 A;  2R92 H;  2K5V A;  4X65 L;  2PO4 A;  2QDB A;  1G2T A;  2R93 H;  2EVB A;  3JC6 6;  2JA6 G;  4K2L A;  2BOS A;  1N34 L;  1JWU D;  4L5R C;  3H3V I;  1K0S A;  2KVM A;  2JA6 H;  3TEH B;  5C4Z A;  3CW2 C;  4LF6 Q;  2IT1 A;  3CCM A;  3CCJ A;  4DNR B;  4B9W A;  1HZA A;  3RUZ A;  1JOO A;  3CC7 A;  1SNP A;  4DF7 A;  2QW7 A;  2F0L A;  2EY1 A;  3T1H Q;  1WCM B;  5CBA E;  1BR9 A;  4ZUI A;  3CAM A;  3PIP 3;  2XWB B;  3H15 A;  1AEX A;  2EXZ A;  5LMN Q;  3JAM L;  4V0B A;  1TWH H;  3W5O A;  4CDC C;  4DV1 L;  4GLV B;  4A3C H;  2B3G A;  3K5N A;  1H9S B;  1TWA H;  1KAB A;  3N6R A;  3PUV A;  1MD2 D;  2EOT A;  4QF4 A;  2K5H A;  1X6O A;  5C3E G;  3RLF A;  2PZW A;  4G7O C;  1GUG A;  4CJ1 B;  1X3Q A;  4FXG C;  4ZYS A;  1VMP A;  1PDQ A;  1Q12 A;  2OF1 A;  2KJX A;  3T53 B;  4XT3 B;  1FR3 A;  4HJ8 A;  3Q6S A;  3EA6 A;  4HSV A;  4GNX B;  1C9O A;  1SYE A;  5EPJ A;  3S1N B;  2DN8 A;  3KBG A;  2JA9 A;  1SNQ A;  4JC0 A;  3WDN A;  3U50 C;  4JI6 Q;  5FK9 C;  4GOP A;  1AN8 A;  2B8F A;  2XIW A;  2I0Q A;  4CBV A;  1D5M C;  1EQQ A;  1STG A;  3PO3 G;  1FL0 A;  1BCP C;  3QWN A;  3UE0 A;  1PH6 A;  3QJY A;  1Q7Y C;  5IT9 c;  1GD7 A;  5IGB A;  3H0G B;  3MAQ A;  1EU3 A;  2L55 A;  4A93 G;  4A76 A;  4NW2 A;  1ZKO A;  2KEE A;  3R93 A;  3NEN A;  3VR5 A;  2ZTD A;  4DXG A;  1PTO C;  1NE3 A;  2JE6 I;  4A3G H;  1GM5 A;  4XXE A;  3PQI A;  2PW5 A;  4QJF A;  2R61 A;  1MI2 A;  4O0A A;  4LAA A;  3CCQ A;  2JEB I;  2ASB A;  4K14 A;  3DUZ A;  4C3H G;  2PI2 A;  5C4J B;  5JJK A;  3VYT A;  4A3J H;  3QG1 A;  3AEV A;  5C0X J;  2A6E C;  2KEC A;  2ZTE A;  3L3O C;  2K14 A;  4O42 A;  1LTG D;  1E1O A;  2PQA B;  2K1B A;  5HUR A;  4JI1 Q;  2EZV A;  2BA0 A;  3C1E A;  4GS3 A;  2K5N A;  4JI7 L;  3ER0 A;  1U5K A;  5IWA L;  4Y7N H;  1EOV A;  4KJN A;  3E5S A;  1HR0 L;  3DEO A;  1Y1V G;  2NBF A;  5D14 A;  3C1F A;  5JEA G;  1U4P A;  1LM0 A;  1A63 A;  1PFN A;  2L9H A;  4LJZ C;  4AIM A;  2CCZ A;  1NUC A;  5JJL A;  3K59 A;  4B3T Q;  2RSN A;  3E9I A;  5LL6 X;  2EYJ A;  2K5W A;  5I6Y A;  3GTK B;  4L5Q A;  3MHB A;  1L0Y B;  2BH2 A;  3RZD H;  1EIF A;  4RA8 A;  3M4O H;  5EKI A;  2F0J A;  4BBR B;  2NVQ B;  2YTV A;  2ZXP A;  1VQ9 A;  4PMC A;  3HOZ G;  5AFW A;  2IL8 A;  3I55 A;  2QKI C;  3KLW A;  3OSO A;  2IWH A;  1S72 A;  1XNR Q;  4TRD A;  1AZQ A;  4BBS H;  1LV9 A;  1QCB D;  1AH9 A;  3ZYY X;  3J81 c;  1G6P A;  1H9R A;  2B2T C;  5TSS A;  1CUK A;  1L2F A;  3MWY W;  1TU2 B;  1I94 Q;  4JI4 Q;  1PZJ D;  1PH7 A;  5E4W C;  3F2C A;  4R9W A;  2QA4 A;  4IUT A;  1EQR A;  1NR4 A;  3IFT A;  1L0X B;  4GKJ Q;  4DV3 Q;  2EXD A;  2V1C C;  4EGV A;  4HIK A;  1O7Z A;  2ES2 A;  2G9D A;  3PF5 A;  3KF6 B;  1TS3 A;  4EX5 A;  2QCP X;  4XIG S;  1HCZ A;  2LKV A;  2ZJR A;  1JT8 A;  1G2S A;  1VQM A;  1ESF A;  4DK3 C;  2AMC B;  5IGE A;  4ZUJ A;  1TWG H;  4DNT B;  3D6C A;  3DHQ A;  4A3E G;  1ASY A;  5IIF A;  1WD0 A;  2E2I B;  5JPM C;  1WTX A;  1RL2 A;  2AWN A;  3MXN A;  3M7G A;  4OO1 I;  1NSN S;  2TSS A;  3K7U C;  1B3A A;  4ZRZ A;  2MP1 A;  2KHS A;  2A69 D;  1K28 A;  1VDZ A;  2EYH A;  1QZH A;  2Z4H A;  2WIN B;  4DUY Q;  2UUA Q;  2MO1 A;  2R92 B;  5EBC A;  1EZ8 A;  3H91 A;  1HNW Q;  1A3T A;  3MVV A;  2R93 B;  3SK8 A;  4H13 C;  1LT3 D;  3KF8 B;  5G3L F;  3GV6 A;  3NQT A;  3SEB A;  2N55 A;  2H5X A;  2RQX A;  4IPC A;  5AJ3 L;  2GVA A;  1FJG Q;  2DNE A;  1Q90 A;  3U9O A;  4DV2 L;  1WFQ A;  2JA6 B;  1X65 A;  5IT9 E;  3KK7 A;  1TS5 A;  2YU9 H;  1B2T A;  3CCL A;  2SOB A;  1PH5 A;  4YHH L;  1SRO A;  4NXN L;  1STH A;  1ICF B;  4ZKB B;  4YCU A;  4KHZ A;  1SDF A;  2K32 A;  1DZ1 A;  4KHP Q;  4KY5 A;  2FHT A;  1FNU A;  4BA1 I;  1EIG A;  4DAY A;  2O5J C;  3SVM A;  3ERQ A;  1SNM A;  2PYK A;  1EUJ A;  2ENB A;  1ML0 D;  1PTO F;  1SMY D;  4K5V A;  1A3V A;  1TWA B;  4X62 L;  3EQL C;  3HZX A;  3D31 A;  2HT1 A;  3I4M H;  1CKN A;  1FGU A;  4F88 A;  1E24 A;  1Z47 A;  3AU7 A;  5CBE E;  1HQM C;  3K7A H;  3IRB A;  1GXD C;  4A3M G;  5D3I B;  2K03 A;  5IGF A;  4LFB L;  1PHJ A;  1S5D D;  3V05 A;  4K0K Q;  4A3K H;  2JK8 A;  4IPH A;  2J0T D;  3A0J A;  3MFG A;  1PH2 A;  2LMC B;  1HA6 A;  3T13 A;  3G4S A;  3FVQ A;  1I6V C;  2B2Y A;  4KK7 A;  5CV4 A;  3NPP A;  1IBK Q;  1EIH A;  4LF4 L;  1XWE A;  1BF4 A;  5C44 H;  3GTO H;  5M5W H;  4IFD H;  1FD7 D;  1B44 D;  5M3M G;  5ELO A;  1IYJ B;  1PH3 A;  3NE5 B;  4RCO A;  3I4O A;  3IAY A;  2D9U A;  2H1E A;  4IN3 A;  1J6Q A;  4LF5 Q;  2Q8T A;  1PFM A;  5BN5 A;  1RD9 D;  3D0F A;  5FOB B;  3G48 A;  4HCS A;  1JE4 A;  2F0M A;  5CV9 A;  2PZU A;  2CQO A;  3SK6 A;  3M85 A;  1KDC A;  2EY5 A;  4CJ0 B;  5CC4 A;  4A93 B;  5IGG A;  5M3F H;  1HZC A;  1VQL A;  3J81 E;  2KHJ A;  1II3 A;  5CMD A;  5FJ8 G;  4JV5 L;  1X3E A;  2NN6 H;  2JA5 G;  5GAD C;  4X65 Q;  3OPO A;  1V1P B;  4POF A;  5I2Y A;  1R4P B;  1SYG A;  2D62 A;  1PYW D;  1JCK B;  1VCI A;  2EYF A;  2JA5 H;  1N34 Q;  1CM9 A;  2A69 C;  3CC4 A;  4IUR A;  4A3J B;  3TDQ A;  1T9H A;  3KDF B;  2K4K A;  4DNI A;  1G51 A;  1IBM L;  1TT2 A;  3BDO A;  4PZ6 A;  3HOW H;  1SJH D;  1O7I A;  4CDD C;  4ABN A;  4PZ8 A;  3NTK A;  4KMU C;  5F2D A;  5KNB A;  4Y7N B;  3M4P A;  2F03 A;  2DJF C;  1QIL A;  2OTJ A;  1MSG A;  3EFX D;  5IGD A;  5IOD A;  1K8G A;  3FDT A;  2B8G A;  2ICI A;  1Y1V B;  2HD3 A;  2JYO A;  4A3D G;  4R4O A;  4IUN A;  5JOB A;  1K8O A;  4DV1 Q;  3ICE A;  1DOL A;  3PUW A;  4X66 Q;  3RZD B;  4JBK A;  4A3D H;  3AFP A;  3M4O B;  3GTL H;  4XYQ A;  4CKE A;  4KI0 A;  1YIJ A;  2WAC A;  3J80 c;  1G6Z A;  2BE5 D;  3AYH B;  2A73 B;  5NUC A;  3BJU A;  2M9V A;  5CYU A;  2R7Z G;  4B3S L;  1SMY C;  2QEX A;  4HMJ A;  4RHS A;  3CQZ H;  4QUF A;  1KLU D;  2IHE A;  4DFA A;  4BBS B;  3HKS A;  3HKZ G;  2N88 A;  3LWE A;  2O2L D;  4LFA L;  5M5Y B;  3OW2 A;  2NB0 A;  4EQP A;  4R1J A;  2VQF L;  5C0X I;  1T5E A;  4YCW A;  1KAA A;  2B39 A;  1EYC A;  3LX0 A;  3G6E A;  1XPR A;  2N49 A;  3Q23 A;  2EIF A;  4I65 A;  3KLS X;  4FF2 A;  1ENA A;  1VQ5 A;  5BN4 A;  3S2D H;  2G5D A;  1D5Z C;  1STE A;  2K05 A;  3PGZ A;  4KD3 A;  2IJ0 A;  2CH4 W;  1S4Z A;  2PQE A;  5I9O A;  3JAM i;  4HIO A;  5FO9 B;  3H0G G;  2F0E A;  5CR3 A;  3SXH A;  3H3V C;  4DR7 L;  3K0Y A;  4G4K A;  3TRE A;  5JPN C;  2OWO A;  2HHH L;  1Q81 C;  5DM6 3;  4DA2 A;  3L7Z C;  1TWG B;  4Q5V A;  3VR6 A;  4OX9 L;  4ULL A;  1XMQ L;  2RBM A;  2OQ0 A;  1FNV A;  4IZ8 A;  4UP7 A;  3RMH A;  2HCI A;  1KHI A;  2LXJ A;  4DV4 Q;  1HHV A;  3HP3 A;  1PRT D;  1A62 A;  1VQH A;  4KV6 A;  4A3L G;  1U9R A;  4N9P A;  2EDG A;  1I4X A;  1VQB A;  4A3L H;  4Z9C B;  1CT1 D;  1C8C A;  2RDH A;  4DR3 L;  4IPD A;  3A54 A;  2J7Z A;  1F9S A;  3I91 A;  1QOH A;  3TP8 A;  5IP7 H;  4UAI A;  2I46 A;  5HGQ A;  3F2U A;  4NMZ A;  3CCR A;  2KED A;  3CHB D;  4JI7 Q;  1B8A A;  5IWA Q;  1NCV A;  1TR5 A;  2OTL A;  2YU9 B;  3QIA A;  2A5H A;  4GOP C;  3RNU A;  3FRP B;  2LSS A;  3NEL A;  3MA2 B;  3C46 A;  1S5E D;  1Y8O B;  1EY6 A;  4AYB E;  2VQE L;  1IBL L;  3AB9 A;  4AYB G;  3I7F A;  3IKJ A;  1E3P A;  3DWP A;  3VA7 A;  4OIJ A;  4WJ4 A;  1VQD A;  1S40 A;  4BXX H;  2XN9 C;  1KLG D;  4ME3 A;  2A19 A;  3DMU A;  4EQN A;  4S3S A;  1Z7T A;  1WI5 A;  2WV6 D;  5FLX L;  2WAQ E;  1F77 A;  5BN3 A;  4LF7 L;  5C5M A;  4A3I G;  3ULP A;  2F3W A;  3P1H A;  1BBX C;  5JVH 3;  1A15 A;  3K7A B;  2A68 D;  1X55 A;  5G3L D;  5IYC H;  3V2T A;  1STB A;  1ILP A;  3S2H H;  2BE5 C;  4MZ9 A;  4A3M B;  5D65 A;  1OXT A;  4A3K B;  1ZYR D;  4DV6 L;  3F1Z A;  2F4V L;  1SYF A;  2ZTC A;  1E1T A;  3FMC A;  3Q8D A;  4KTA A;  2K50 A;  4KY6 A;  3HOU G;  2Y0S E;  3M3Y H;  1DYQ A;  4L63 B;  2WB1 G;  2O5I C;  1U4R A;  3NBI A;  1BNZ A;  1BCP B;  3NSW A;  4NKL A;  2K6A A;  5E7N A;  3TP5 A;  2NWG A;  1R4Q B;  1I5F A;  3B6Y A;  3GTO B;  5GQO A;  3K6O A;  5M5W B;  1QZG A;  1UNS A;  1F2Z A;  3SDZ A;  3VYS A;  1QNU A;  3PMF A;  3J80 E;  1PTO D;  4DR6 L;  4TSS A;  4DV5 L;  4A3B G;  1KXL A;  2KCM A;  2YTY A;  2L4N A;  3GD7 A;  3KF8 A;  2JA8 G;  1SEB D;  4A3B H;  1KNA A;  4JOI A;  4DKA C;  4DR5 L;  3HOV H;  1I4R A;  1AE2 A;  3CRL C;  3LGJ A;  2UXD Q;  1LT6 D;  3W3A A;  1L0W A;  5EJW A;  1QVG A;  2AQ2 B;  1YZ6 A;  2R93 G;  1N36 L;  3T1Y Q;  4L6T B;  3MFY A;  1ONL A;  1DOM A;  1V1Q A;  2RVL A;  2L5T A;  3FP9 A;  3N52 A;  2JA5 B;  3VYU A;  4JI0 L;  3PF4 A;  1VQJ A;  1PRT C;  5AJ3 Q;  1HPC A;  4ZQ3 A;  4DV2 Q;  3X3M A;  2F4I A;  4IUP A;  3G6J B;  4FYD A;  3I2Z A;  1V8Q A;  5EPK A;  1EFW A;  3C2P A;  4YHH Q;  4EVO A;  4NDX A;  4F8M A;  1PFS A;  1MHW C;  4DPG A;  4RKB A;  5C3W A;  1PZK D;  2BDO A;  4DAV A;  1YBY A;  5COR A;  1MKH A;  2E8G A;  5FKA C;  2B2U C;  2RDG A;  4UP8 A;  2F1M A;  1GVP A;  3NTI A;  5GAH C;  4A3C G;  2XWJ B;  1PFB A;  2EYP A;  1C48 A;  4JG2 A;  1AE3 A;  4B3M Q;  1YIT A;  3P20 A;  1D6E C;  3TRZ A;  1GUS A;  2B2V A;  4A3D B;  4X62 Q;  1B1Z A;  3GTL B;  1LTA D;  4C56 C;  1EY5 A;  1WTQ A;  3DM1 A;  2VUM G;  2UXB L;  1UEA B;  1EYD A;  1VMC A;  1RDP D;  2NTT A;  4P72 A;  4UP9 A;  2VUM H;  3CQZ B;  2OT2 A;  1G91 A;  2R7Z B;  4TQU S;  3DLL A;  1VQG A;  1STN A;  3RD4 A;  3TQY A;  1CQV A;  1Z6H A;  2NUC A;  2A68 C;  2JJQ A;  3HKZ B;  2X6G A;  2XVS A;  5HGT A;  3Q0A A;  4AH6 A;  1RF2 D;  1ENC A;  2UU9 Q;  3P7J A;  1ZYR C;  5T1G A;  5JJZ A;  3H3V H;  4LF4 Q;  2VB3 X;  3S2D B;  5KRU A;  1I3Q H;  1FNW A;  2VXW A;  3PIO 3;  2OQK A;  2F0I A;  5GAE C;  1EU4 A;  1F9Q A;  1SN8 A;  1BQQ T;  1V1P A;  3NTH A;  1HNZ L;  1Q1B A;  1QNK A;  5K5P A;  1YJW A;  4LMQ D;  3H94 A;  2N8N A;  4RGT A;  3S16 H;  1ILQ A;  3S1M H;  4X64 Q;  3IFD A;  2DGY A;  4A3G G;  4LFC L;  3S15 H;  2RCN A;  2M2L A;  2HCC A;  3OIP A;  1A2U A;  1IYU A;  3E0E A;  4C3I H;  2HDL A;  1MSH A;  2Q2H A;  1EY8 A;  4R4C A;  4FVM A;  4A3J G;  2PNH A;  2K04 A;  3I90 A;  1DM0 B;  2BA1 A;  3CME A;  2EYM A;  3NXW A;  4IUV A;  2L12 A;  5DLQ E;  3KJP A;  4RCN A;  4HR7 B;  1A2T A;  1LTS D;  1PH1 A;  1L1O B;  2CH4 A;  3WWV A;  3NBH A;  1DD2 A;  1CSQ A;  3BDL A;  2B2Y C;  4PV1 C;  1YVC A;  4OEL B;  1XX8 A;  3MTS A;  2BH8 A;  4F7X A;  2XRS D;  2F0T A;  4CDF C;  4AQY L;  4FF4 A;  3QB3 A;  3PSI A;  1QUQ B;  4DV7 L;  3CCU A;  1IZ6 A;  4XTC S;  4UHV A;  1EWC A;  1IYV A;  1JC7 A;  2FIN B;  3UDF A;  3PUY A;  4AYB B;  1LTB D;  2PI2 E;  3HFZ B;  1MJC A;  3S1Q B;  2HDM A;  1K83 H;  3CPW A;  5LL6 S;  3GO5 A;  4ZCK A;  4XQJ A;  1EY9 A;  1CZW A;  1IW7 D;  3AMU A;  3BVG A;  3PV0 A;  4B3S Q;  4CGY B;  3M7N A;  4BBS G;  1DCZ A;  4LF9 Q;  4U68 A;  2Z8L A;  3NK9 A;  1HQR D;  2WAQ B;  4A3I B;  1RHP A;  4NXM L;  1PYS B;  2SDF A;  3Q24 A;  1PRT F;  4UY8 C;  1KD1 C;  3S2H B;  2CW0 D;  4UDU C;  3A8K E;  2VQF Q;  4GKK L;  3K0X A;  1TII D;  2K28 A;  2EYL A;  2E76 C;  3FHW A;  3CXC A;  1P16 A;  2XRQ D;  1X3G A;  4FXD A;  1U4L A;  4DV0 L;  1RTO A;  1C7Y A;  4FNF A;  2F52 A;  3M3Y B;  1AW7 A;  3A5U A;  3HOU B;  5ELC A;  3K57 A;  1VQ4 A;  2K5Q A;  2WB1 B;  2Y0S B;  1D1I A;  2NZO A;  1JWM D;  3I56 A;  4OEM B;  2VB2 X;  3RLN A;  1X3F A;  1M8A A;  2B2U A;  2HHH Q;  2DUD A;  2F0U A;  3W2D A;  1VQA A;  1IHZ A;  1EYG A;  4OX9 Q;  1F2M A;  3BVM A;  5M5X H;  2X69 A;  1DJR D;  1NNX A;  1ENF A;  3DEP A;  5EBD A;  1JWS D;  2L15 A;  1CA5 A;  4WJ3 M;  3JAM c;  2YTX A;  3SE0 A;  4MIU A;  4A3B B;  1ROD A;  5IY0 A;  4DK0 A;  4KKS A;  2WKC A;  5C4X H;  3UDG A;  2JA8 B;  3ERO A;  1UE6 A;  1NMG A;  2E5L L;  1XTD A;  1CKM A;  2AUJ D;  4RHR A;  1QE6 A;  1EEF D;  1GUN A;  4JI3 L;  2QIL A;  1KIX A;  4DGZ A;  1EQV A;  1O80 A;  4QL5 A;  4N9T A;  3TN2 A;  4KKU A;  1CZG A;  4K6D A;  2UUB Q;  1O7Y A;  3GV3 A;  1JE5 A;  3M9B A;  3SHL A;  1CTM A;  3D4D A;  1OXV A;  3T4A C;  3I73 A;  1EIY B;  3DM3 A;  1PVO A;  2JQO A;  2J4X A;  1V9P A;  5EGT A;  1PMR A;  3ITP A;  4OHJ A;  5E4X A;  3SK5 A;  1TWH B;  4DR2 Q;  1Y69 U;  1VQ8 A;  3I4M G;  2AHO B;  5EQ0 A;  1S3O A;  2SNS A;  2K52 A;  4LF7 Q;  2VL6 A;  4OO1 G;  3TP7 A;  3HOX G;  5ELD A;  4FDB A;  1XPU A;  4OO1 H;  2Q2U A;  1TWC H;  3KOJ A;  2X6L A;  3HOX H;  4A3K G;  2JXM B;  2VUM B;  1X9N A;  2EY6 A;  3KJO A;  4UPA A;  1IW7 C;  2Q2T A;  4JW0 A;  4DV6 Q;  2F4V Q;  3TS0 A;  5C3X A;  2NTS A;  1W3S A;  1VS0 A;  1JJ2 A;  1I4Q A;  5GRO A;  1CK1 A;  3MEF A;  4OWX B;  5C44 G;  2CW0 C;  1EWH A;  4IFD G;  5IOC A;  4ZAI A;  5ISR A;  2O4X A;  5LMN W;  1DON A;  5LMU L;  1VF5 C;  4MNO A;  4IPG A;  2EY2 A;  2IPK D;  4BY1 H;  2L1B A;  2LXK A;  1I50 H;  2UUC L;  4A3F H;  1OXU A;  4DR6 Q;  4DV5 Q;  3OTO L;  1HA5 A;  1T5X D;  1PTO H;  3OYY A;  3CRK C;  1NR2 A;  1WOC A;  3U4V A;  2QDL A;  1H9K A;  1JQY D;  5M3F G;  3S1M B;  4J15 A;  3U4Z A;  4DK6 C;  1XTC D;  4DR5 Q;  4C3J H;  3VR2 A;  5H1S E;  3S15 B;  2OCE A;  2NN6 G;  1IL8 A;  3PCO B;  3M4Q A;  4A3G B;  2ALY B;  4GZY C;  2NZ1 D;  5FLM G;  1N36 Q;  4JK1 C;  4RFB A;  5D3D A;  1TWF H;  2EJG C;  3R3O A;  4C3I B;  1DXM A;  2F0G A;  5IYD H;  5J1Z A;  5FLM H;  3MXG A;  1VQ6 A;  4YWL A;  4JI0 Q;  1SLJ A;  4XQN A;  1LAB A;  3HOW G;  3AFQ A;  1PZI D;  1LT4 D;  1NY4 A;  1F2L A;  4B9X A;  4GOP B;  1PYB A;  1H9S A;  2SEB D;  1QVF A;  2AQ1 B;  3J7A V;  3VA5 A;  1EY4 A;  4JYA L;  4DUZ L;  1NBW A;  2BDN A;  2MQH A;  1NJI C;  3MZ5 A;  1E7Z A;  3CCS A;  1SE3 A;  4HED A;  5HY6 A;  5CV7 A;  3S14 H;  1GUT A;  2E2H H;  3JAM E;  3T16 A;  3TZD A;  1VQK A;  4R4Q A;  4YY3 L;  1KRS A;  4BWG B;  2N3S A;  2I5L X;  3VYR A;  3G71 A;  4GNX A;  4K2K A;  1KQS A;  5JEA J;  5IYB G;  1JR0 D;  2E2D C;  2B2W A;  4FP5 D;  4JOI C;  4R8I A;  1PA6 A;  1WCM H;  5IYB H;  2EE1 A;  4ZLT F;  3L0O A;  2D0O A;  4YWK A;  1E2Z A;  1KDB A;  2VZA A;  4KKT A;  4DXF A;  3MEH A;  1XMO L;  1B50 A;  3GDE A;  1ICW A;  3K81 C;  2NYZ D;  1HNX L;  2Q2I A;  1PXU A;  5KIX A;  3I72 A;  2KBN A;  1GKH A;  1NMF A;  4LUV A;  3S24 A;  4QY7 A;  1SMX A;  2HQL A;  1OXS C;  3CF5 A;  5EKL A;  2AQ3 B;  1S5F D;  3Q22 A;  1HFN A;  2DNC A;  2G9H D;  2JA7 H;  4KY7 A;  4G7H C;  4H7B A;  2Z6B A;  2Z6K A;  1PH4 A;  3P75 A;  5A2Q L;  1C0A A;  5M5X B;  1CKO A;  3O13 A;  3CP0 A;  5KEE A;  4LFC Q;  2B2V C;  1EWI A;  3EVQ A;  3GTQ H;  1BO0 A;  2PQA A;  1L1O A;  2OXP A;  1VQC A;  4DV3 L;  3EJI A;  3R2T A;  3UE1 A;  1JB7 A;  5C4X B;  2IX3 A;  2ID0 A;  4R8N A;  5CV8 A;  2ATW A;  4LUZ A;  2PCF B;  4JI8 L;  1KRT A;  1H9M A;  2VW9 A;  3CCE A;  3FKI H;  5IP7 G;  1SFO H;  2R3Z A;  3I4N H;  3KBX A;  4M1U B;  2HIX A;  2WFW A;  5I4D A;  1SAP A;  3PO2 H;  2QF7 A;  1ET6 A;  1I4G A;  3NQI A;  4RKL A;  3K5M A;  1HR0 Q;  5FO7 B;  1GHK A;  5C0X H;  1Q8I A;  2C35 B;  3A8J E;  1RIP A;  1GHJ A;  2D2C C;  3NEM A;  4IJL A;  4GN4 B;  1XYI A;  1Z9F A;  4BXX G;  1FJG L;  4H44 C;  1QB5 D;  3MXN B;  3NP8 A;  1VQE A;  4JI5 L;  5KND A;  1WTR A;  5KYL A;  2FFK B;  3NHH A;  2RA4 A;  3GTG H;  5IT9 L;  1B7Y B;  4NPS A;  4IOA A;  1LTL A;  5J3B A;  1XNQ L;  2MFI A;  3KLR A;  3I4M B;  2KHI A;  2WAQ G;  1EYA A;  5IYC G;  4NP5 A;  4X3T A;  1J5E L;  3AQQ A;  1E2W A;  4APV A;  1CFM A;  4QIW E;  4NXM Q;  2MHV A;  3HRZ C;  3KF6 A;  3HOX B;  2A8V A;  3CD6 A;  3GTM H;  3ND9 A;  4OGQ C;  3BS1 A;  1ZXT A;  2JN4 A;  3QO2 A;  2VS1 A;  4WRD A;  5E3F A;  1V1O A;  4GN5 A;  5ELE A;  1GO3 E;  4RWS C;  4DV0 Q;  2KUM A;  4MTN A;  1N8R C;  3ERS X;  2Y0S G;  2LY7 A;  2L0C A;  2Q8I B;  1A6X A;  1PV4 A;  4HJA A;  5C44 B;  1BVS A;  4DAY B;  3OW7 A;  4K0K L;  4HCE A;  2CWP A;  4BY1 B;  4O1N A;  3PIO A;  4ILW A;  1UAP A;  1I50 B;  3TME A;  4A3F B;  3BDC A;  1A0I A;  4K5X A;  3OMG A;  2MPM A;  1PTO B;  1VQ7 A;  3S17 H;  2WII B;  3HOV G;  2QEJ C;  4J6H A;  3PUX A;  1EY0 A;  3DWQ A;  1IBK L;  4DR1 L;  3CKI B;  2CVR A;  4X3S A;  2EYO A;  4C3J B;  4RGO S;  5M3F B;  2RSO A;  3VR4 A;  4HAE A;  3NUC A;  2E5L Q;  4QUC A;  2EPB A;  5DAU A;  1D7Q A;  3K5L A;  2K33 A;  1TWF B;  2LS0 1;  4RAU C;  4JI3 Q;  2FMC A;  3RZO H;  4HJ7 A;  4DAM A;  1YJN A;  1EQT A;  2DJG C;  3TP6 A;  4HID A;  1D8L A;  3SR1 A;  1HTP A;  1D5X C;  3K5O A;  2XGT A;  5JVG 3;  2Z9H A;  4KLK A;  1LUZ A;  1JMC A;  1SRU A;  4PMB A;  2ZXR A;  1IXR A;  2K75 A;  3HOW B;  3S1R H;  1B70 B;  1E22 A;  4LW1 A;  1Y1W H;  2KQ3 A;  4M8A A;  1HXY D;  4XYO A;  3K58 A;  4NXN Q;  2XSC A;  2Z0S A;  3C3L A;  1LO5 D;  4K8J A;  3S14 B;  1VQF A;  3MXP A;  2E2H B;  1YJ9 A;  4R4T A;  2AWO A;  2B63 G;  4JVZ A;  1SE8 A;  4QQB X;  1I6H H;  3M4Y A;  5L37 A;  1Q3L A;  2DY7 A;  1RCV D;  2FJ2 A;  2AUK A;  3EN2 A;  3H6M A;  3J7Z C;  2B63 H;  2F0O A;  3HOY G;  1HZ9 A;  2N78 A;  4OXP A;  1ZEQ X;  1VF7 A;  3HOY H;  3SGI A;  4P2C B;  4ZK9 B;  2ZM6 L;  3D4W A;  2RHS B;  1AZP A;  3J80 i;  1S5C D;  3TBI B;  4CJ2 C;  1YEZ A;  4LFB Q;  2XNA C;  4KN4 C;  4XDX A;  1WTP A;  1AFP A;  4TVA B;  1JOK A;  4X66 L;  4I7Z C;  1EOT A;  1ASZ A;  1N32 L;  1QG7 A;  2NVX H;  4IUU A;  2VNU D;  1HZB A;  2D0P A;  4HIM A;  1WD1 A;  3FPU B;  2R7D A;  1SR3 A;  3V96 A;  4IAL A;  1K0R A;  4QMG A;  5C3E H;  4FO2 A;  5KGU A;  4BY7 G;  1K8A C;  5LMU Q;  3I3C A;  3MC0 B;  1UE7 A;  1N33 L;  4BY7 H;  2RHQ B;  2UUC Q;  1MGS A;  2JA7 B;  2K01 A;  1E2V A;  3OTO Q;  3OHX C;  1OXX K;  2F0H A;  4B08 A;  1UE5 A;  5IP9 G;  3A5Z B;  3E6Z X;  2ICE C;  4A4I A;  1W6J A;  3KDF A;  4I7A A;  3VR3 A;  2UXC L;  1YNJ D;  1K8M A;  5IP9 H;  3BVZ A;  1EFI D;  3GTQ B;  1XXG A;  4C3I G;  3CC2 A;  1SSO A;  5COY A;  4JV5 Q;  4YCV A;  3I4L A;  2EJF C;  3HEJ A;  4JBJ A;  5FLX c;  1LYL A;  3PO3 H;  2MO0 A;  5EKK A;  1SJE D;  1TS2 A;  1NAP A;  1SXT A;  3J7A F;  3BZC A;  4DR4 L;  2NVT H;  2IHF A;  2F0N A;  3FKI B;  1PH9 A;  3GTJ H;  3GTP H;  5IE8 A;  1Q82 C;  4A93 H;  1N9W A;  1SFO B;  4OON A;  1IBM Q;  2KOL A;  1D2B A;  1SE2 A;  3I4N B;  2R7F A;  4DV4 L;  3KFU A;  3PO2 B;  1SNC A;  4DUZ Q;  4JYA Q;  1HRJ A;  2E2J H;  1VQI A;  4CKC A;  1X56 A;  1STY A;  5J22 A;  3J7Y W;  2A1A A;  3PUZ A;  3NWS A;  1CA6 A;  3MXU A;  4YY3 Q;  2Q8R E;  4C3H H;  4JI2 L;  1ESR A;  2C5C A;  1B4O A;  1Y8N B;  4FF3 A;  1IKM A;  1M90 C;  2MJ8 A;  3F2B A;  1TY0 A;  2JEA I;  3X3N A;  3QOL A;  3GTG B;  2CKZ B;  5A35 A;  5IGC A;  1SE4 A;  1Y1V H;  1P8L A;  2IY5 B;  5ELN A;  5JEA H;  2F0P A;  1XMO Q;  4HSP A;  3WOF A;  1FVI A;  3OWF A;  1HUN A;  4EQ5 A;  4BS9 A;  4LFA Q;  2FXQ A;  1FGB D;  1HFG A;  3GTM B;  2I5H A;  1W2B A;  1HNX Q;  1Y14 B;  4G57 A;  4LF8 L;  3A56 A;  2YYZ A;  4QIW B;  1HR0 W;  1H95 A;  3D6W A;  3OWE B;  3TSS A;  3HOZ H;  2PMZ E;  3J7A 5;  4JBW A;  1DOK A;  1B3Q A;  1IKL A;  3F2D A;  2Z1C A;  5DNF A;  3OOC A;  3J81 j;  4RGM A;  5BR8 L;  1CSP A;  2ZXO A;  1W6K A;  5M5Y H;  4Y52 H;  3UDX A;  1SYB A;  1R9T H;  4DR7 Q;  1WJJ A;  4K6L A;  5A2Q E;  2TMP A;  3URY A;  2PPB C;  2F0S A;  2IW3 A;  4DAP A;  3R8B A;  3BZK A;  1KNE A;  4QGU A;  4GNX C;  2F0W A;  3GQB A;  1XMQ Q;  3S17 B;  3HGB A;  5C4X G;  2B2W C;  2FMM A;  2BCO A;  2CQA A;  2F3I A;  3HOV B;  4MTK A;  4GLX A;  4DU9 A;  3CCV A;  1XJV A;  2A6H D;  1K73 C;  1BUV T;  1F9R A;  1JOR A;  2MNA A;  4PNY A;  1YNJ C;  1BBU A;  4YIJ A;  1I4H A;  4JI8 Q;  1WTW A;  2I07 B;  2F0Q A;  3H09 A;  4JPB W;  3J80 L;  3RZO B;  4RMF A;  4C2M H;  1CHQ D;  4LUO A;  3A8I E;  1DGS A;  4DR3 Q;  4KN7 C;  4A3E H;  4RH6 A;  3E3X A;  2NVY H;  2F0V A;  1AP0 A;  5I9P A;  1LLR D;  2UXD L;  3K8A A;  3S1R B;  4B3R L;  2HIV A;  5C5L A;  4ALP A;  3T1Y L;  1Y1W B;  2Z4I A;  1WYD A;  2K5D A;  2VQE Q;  1UWV A;  1IBL Q;  3W1B A;  1LAC A;  1UEB A;  1G29 1;  4CKB A;  1A3U A;  4L5T A;  1GOZ A;  4EQO A;  2Z6K C;  4GLA C;  4IFD I;  4JI5 Q;  1I6H B;  2PZT A;  4LF6 L;  2KCN A;  4P75 A;  4A75 A;  5FLX E;  2B63 B;  1O7L A;  2L11 A;  4NB3 A;  1VQO A;  4WFN 3;  1MBY A;  5CGK A;  1B9M A;  3ULL A;  1L1O C;  1XNQ Q;  1BCP F;  4PG3 A;  1J8I A;  2B29 A;  3HOY B;  1BBW A;  3T1H L;  1MJE A;  1LTT D;  1Q46 A;  1J5E Q;  1HJP A;  5EPL A;  4MHE A;  1CHP D;  5DM7 3;  2E75 C;  1Y8P B;  5LMN L;  4N8F A;  4P71 A;  1RJT A;  2LFN A;  4B3M L;  2NN6 I;  1YNN D;  4MN3 A;  3SK4 A;  1UUP A;  3BU2 A;  2NVX B;  4O2D A;  1KAW A;  2JSO A;  1BKB A;  4HN7 A;  1TY2 A;  4JBM A;  3ND8 A;  4K8I A;  5C3E B;  4BY1 G;  1I3Q B;  2CWA A;  1QWY A;  3L2P A;  4A3F G;  4A3M H;  2C9O A;  3A74 A;  4TKO B;  1GUO A;  1BXT A;  4XT1 B;  1E0B A;  4BY7 B;  1O78 A;  3LWU A;  2CHB D;  3KUP A;  4N8X 1;  1SYC A;  2P5Z X;  1SND A;  1K3R A;  4L8J A;  3UI2 A;  4C3J G;  3R2I A;  4X3K A;  5T1I A;  1C4Q A;  3D4R A;  4IOC A;  3CMA A;  3S16 B;  2UU9 L;  4DR1 Q;  1YHQ A;  3EIV A;  1U4M A;  4JI6 L;  1OTC A;  4H02 A;  2IX0 A;  2IX1 A;  5IYD G;  1KTK A;  3QOJ A;  5M3M H;  1FYC A;  3PO3 B;  1CI3 M;  1M1K C;  5E1F A;  4POG A;  1YI2 A;  3U9S A;  1GUW A;  4X64 L;  4HJ9 A;  2NVT B;  5JAV A;  2A6H C;  3HS0 C;  3ONA B;  3GTJ B;  3GTP B;  5C6A A;  4OIK A;  4OWT B;  1JB3 A;  1STA A;  2YV5 A;  3RN5 A;  1SBB B;  2M00 A;  2OEO A;  2AKW B;  4U67 3;  2E2J B;  2EQS A;  1RTN A;  5FJ8 H;  4IJH A;  3TS2 A;  3I8Z A;  2KCC A;  4QB4 A;  1BOS A;  2B2T A;  2SNM A;  1TXY A;  1F2Y A;  3RLO A;  4HJ5 A;  4C3H B;  3BZD B;  3NWT A;  3STB D;  1K3B C;  5M9O A;  1JOQ A;  1D1K A;  4JI1 L;  1EZ6 A;  1HUM A;  2VY3 A;  1WCM G;  1Q8K A;  4XQQ A;  4J1M A;  3W1G A;  1LTI D;  1K83 B;  4K5W A;  2ZM6 Q;  2UXB Q;  2V4D A;  3HG9 A;  1RKN A;  1NTG A;  2I5M X;  4RGN A;  4B3T L;  3QR8 A;  3ZJY C;  4IQZ A;  4FXK C;  1K9M C;  3GP7 A;  5FO8 B;  3T51 B;  3FEW X;  1EEI D;  4PMW A;  2CFM A;  1X32 A;  3EBE A;  4WOR A;  1N32 Q;  4X6A H;  3NBH B;  1PH8 A;  5KNC A;  2RF4 A;  1S5B D;  3J81 i;  2K7V A;  2HUG A;  2F0K A;  1KC8 C;  1X3P A;  1B9N A;  2ZT9 C;  3HOZ B;  1QVC A;  4F87 A;  2PW7 A;  1XNR L;  1X54 A;  1QJO A;  1YNN C;  1KL9 A;  2D5D A;  4LF9 L;  3HKZ E;  2JA7 G;  2R7Z H;  1B53 A;  2MGS A;  2PMZ B;  1N33 Q;  1I4P A;  1HNZ Q;  1TVX A;  3S1N H;  1GJX A;  1R9T B;  1EY7 A;  4DK1 A;  3OIQ A;  4OL7 A;  3OMC A;  4JI4 L;  1I94 L;  5GAG C;  3D8G A;  3A55 A;  3ULJ A;  2UXC Q;  2QGQ A;  4G7Z C;  4GKJ L;  2KCT A;  3KLS A;  3VDY A;  2GN5 A;  1TS4 A;  2KEN A;  4ME5 A;  4KD4 A;  4WJW A;  1XPO A;  2NZH A;  1PRT B;  3H0G H;  4LWC A;  2HQE A;  3FKI G;  4C1N I;  4RG1 A;  1MIU A;  1WTV A;  4DR4 Q;  3I4N G;  1QUQ A;  1V43 A;  4C2M B;  1YHB A;  3BYY B;  3PO2 G;  4A3E B;  1YHA A;  4C1N K;  2NVY B;  3CPF A;  1BDO A;  5C4H A;  5C0X G;  3WOE A;  1LT5 D;  2H4O A;  3DWA A;  4V19 0;  4X3U A;  4P73 A;  4L5S A;  3LNN A;  1J9O A;  3D3R A;  2EJM A;  2KA7 A;  4PZ7 A;  4DUY L;  4QCL A;  2UUA L;  5KYI A;  5C4J H;  1SYD A;  1SNO A;  2E74 C;  1IL2 A;  1VQN A;  4OWW B;  1HNW L;  1U0L A;  4H0L C;  4AQY Q;  4R4I A;  4JI2 Q;  4DV7 Q;  4P74 A;  1EL0 A;  1WTO A;  3K80 C;  1HTL D;  1ET9 A;  2UUB L;  4HTH A;  1H9J A;  1Q1E A;  4YWM A;  3BG3 A;  4CHT B;  2RDF A;  1VQP A;  5K36 G;  5J39 A;  2F0D A;  3STB C;  2WP8 J;  5K36 H;  1OO9 B;  3IL8 A;  4BA2 I;  4BBR G;  4KHP L;  3A7L A;  3GTK H;  1TWC B;  3PIP A;  2ZJQ A;  3TZU A;  1A8V A;  3FPP A;  2NVQ H;  4BBR H;  3A7A B;  4LF8 Q;  4DR2 L;  5ELF A;  4GKK Q;  5I6W A;  3S1Q H;  5EAY A;  1PLF A;  2PNR C;  2DY8 A;  1TKW B;  5JJI A;  1JJC B;  4ZKC B;  3RN2 A;  4Q0F A;  4A3I H;  1WVL A;  5BR8 Q;  2A74 C;  1HH2 P;  3U58 A;  4FF1 A;  4ODG A;  1YNX A;  1CQF A;  1Q86 C;  3KYH C;  4GN3 B;  2R6G A;  4IUQ A;  3DXJ C;  4ID6 A;  4IFD J;  2JP1 A;  2WB1 E;  1BCP D;  1G8Z D;  1CKN B;  3F8T A;  4LNQ A;  5CV5 A;  4JCV E;  3HOU H;  3E0J A;  4HMI A;  4J8Q A;  4LK1 C;  1F9P A;  4E6I A;  4IO9 A;  4PQX A;  4DN4 M;  1UE1 A;  1TQO A;  3CU7 A;  5I2X A;  2RCF A;  2RKS A;  3RR5 A;  2GVB A;  5ELB A;  4CDE C;  4LF5 L;  4KHV A;  3T56 B;  5M3M B;  3I70 A;  1KDA A;  1M4V A;  3S9W A;  1JJG A;  5LHY 1;  3G7L A;  2E2I H;  2XTI A;  2F0F A;  4KJO A; 
#chains in the Genus database with same CATH homology
 2Q2U A;  4C3H H;  1TWC H;  3KOJ A;  3E9H A;  4JI2 L;  3HOX H;  4A3K G;  2ZJP A;  2JA8 H;  1X9N A;  3PGZ A;  3JAM i;  1Y1W G;  3KJO A;  4HIO A;  2R92 G;  3H0G G;  4UPA A;  1M90 C;  2Q2T A;  3UDI A;  4DV6 Q;  2F4V Q;  4B3R Q;  3TS0 A;  3F2B A;  2JEA I;  4DR7 L;  1W3S A;  2R92 H;  1VS0 A;  3TRE A;  1JJ2 A;  2K5V A;  4X65 L;  2OWO A;  2HHH L;  1Q81 C;  2CKZ B;  3L7Z C;  2R93 H;  5GRO A;  3JC6 6;  4OX9 L;  1Y1V H;  2JA6 G;  3MEF A;  1P8L A;  4OWX B;  2IY5 B;  5C44 G;  5ELN A;  1N34 L;  1XMQ L;  4IFD G;  4L5R C;  1XMO Q;  2OQ0 A;  4UP7 A;  3H3V I;  2JA6 H;  1KHI A;  3TEH B;  5LMN W;  2LXJ A;  4DV4 Q;  1FVI A;  3CW2 C;  4EQ5 A;  5LMU L;  4LF6 Q;  4MNO A;  4LFA Q;  2IT1 A;  2FXQ A;  4IPG A;  3CCM A;  2I5H A;  1W2B A;  1HNX Q;  1Y14 B;  3CCJ A;  4BY1 H;  4LF8 L;  2LXK A;  2YYZ A;  1HZA A;  1A62 A;  1I50 H;  1VQH A;  4A3F H;  3CC7 A;  2UUC L;  1OXU A;  1HR0 W;  4A3L G;  4DR6 Q;  4DV5 Q;  3OTO L;  3T1H Q;  1H95 A;  3OYY A;  3U4V A;  1WOC A;  3HOZ H;  1VQB A;  2PMZ E;  3J7A 5;  4A3L H;  4JBW A;  3CAM A;  5M3F G;  4J15 A;  3U4Z A;  4DK6 C;  3H15 A;  3F2D A;  4IPD A;  4DR3 L;  4DR5 Q;  5LMN Q;  4C3J H;  5H1S E;  5IP7 H;  3J81 j;  2OCE A;  2NN6 G;  5BR8 L;  1TWH H;  1CSP A;  3W5O A;  5HGQ A;  3PCO B;  3CCR A;  5M5Y H;  4DV1 L;  3M4Q A;  4JI7 Q;  4Y52 H;  2ALY B;  1B8A A;  5IWA Q;  3UDX A;  4GLV B;  5FLM G;  2B3G A;  1N36 Q;  1R9T H;  2OTL A;  4DR7 Q;  1WJJ A;  1TWA H;  4A3C H;  1TWF H;  3PUV A;  5IYD H;  4GOP C;  5FLM H;  2K5H A;  3BZK A;  3RNU A;  2LSS A;  1X6O A;  3NEL A;  5C3E G;  4YWL A;  1VQ6 A;  3RLF A;  4JI0 Q;  4QGU A;  4GNX C;  1XMQ Q;  4AYB E;  2VQE L;  1SLJ A;  1IBL L;  5C4X G;  4AYB G;  3AFQ A;  3I7F A;  3HOW G;  1E3P A;  1Q12 A;  2F3I A;  4WJ4 A;  1NY4 A;  1VQD A;  4GLX A;  3CCV A;  1S40 A;  4GOP B;  4BXX H;  1PYB A;  4HJ8 A;  1XJV A;  1QVF A;  4GNX B;  1C9O A;  4ME3 A;  4JYA L;  4DUZ L;  1K73 C;  2A19 A;  1NBW A;  2MQH A;  2MNA A;  1BBU A;  1NJI C;  4JI8 Q;  1WI5 A;  1E7Z A;  2WAQ E;  3CCS A;  2JA9 A;  4LF7 L;  5HY6 A;  4JC0 A;  4A3I G;  4RMF A;  3ULP A;  4C2M H;  3S14 H;  2E2H H;  4LUO A;  1DGS A;  4DR3 Q;  3U50 C;  4A3E H;  1VQK A;  4R4Q A;  4YY3 L;  4JI6 Q;  1X55 A;  1KRS A;  5IYC H;  2NVY H;  4GOP A;  2N3S A;  2I5L X;  2I0Q A;  3G71 A;  3S2H H;  1EQQ A;  4GNX A;  3PO3 G;  2UXD L;  1FL0 A;  4MZ9 A;  1KQS A;  3UE0 A;  3K8A A;  1PH6 A;  5JEA J;  1OXT A;  5IYB G;  1Q7Y C;  4DV6 L;  3F1Z A;  5IT9 c;  2F4V L;  4B3R L;  1GD7 A;  2HIV A;  4JOI C;  4ALP A;  3T1Y L;  2ZTC A;  1PA6 A;  1E1T A;  1WCM H;  3Q8D A;  5IYB H;  2K50 A;  3HOU G;  1WYD A;  4A93 G;  4A76 A;  2Y0S E;  2VQE Q;  3M3Y H;  1UWV A;  2WB1 G;  1IBL Q;  3W1B A;  3L0O A;  2D0O A;  4YWK A;  3NEN A;  1UEB A;  1G29 1;  2VZA A;  5E7N A;  1XMO L;  2ZTD A;  1I5F A;  4L5T A;  2Z6K C;  1NE3 A;  3B6Y A;  4GLA C;  2JE6 I;  3GDE A;  5GQO A;  4A3G H;  4IFD I;  1QZG A;  4JI5 Q;  3K81 C;  4LF6 L;  1GM5 A;  4P75 A;  4A75 A;  4QJF A;  1HNX L;  2Q2I A;  4NB3 A;  1VQO A;  4O0A A;  3ULL A;  2KBN A;  1L1O C;  3CCQ A;  1XNQ Q;  4DR6 L;  4PG3 A;  2JEB I;  2B29 A;  1GKH A;  4DV5 L;  2ASB A;  1BBW A;  2KCM A;  1NMF A;  2YTY A;  3GD7 A;  2PI2 A;  4LUV A;  1Q46 A;  3T1H L;  1MJE A;  3S24 A;  4QY7 A;  5JJK A;  1SMX A;  2JA8 G;  1J5E Q;  1HJP A;  4A3J H;  2HQL A;  4A3B H;  3AEV A;  5C0X J;  1OXS C;  2ZTE A;  4JOI A;  4DKA C;  3CF5 A;  4DR5 L;  5LMN L;  3HOV H;  1AE2 A;  2K14 A;  4P71 A;  3LGJ A;  1E1O A;  2PQA B;  2UXD Q;  4JI1 Q;  1L0W A;  2BA0 A;  4GS3 A;  1QVG A;  2K5N A;  4JI7 L;  3ER0 A;  1YZ6 A;  4B3M L;  1U5K A;  5IWA L;  4Y7N H;  2JA7 H;  2R93 G;  1EOV A;  1N36 L;  2NN6 I;  3T1Y Q;  1HR0 L;  1Y1V G;  3BU2 A;  1V1Q A;  2Z6K A;  4O2D A;  5JEA G;  1PH4 A;  1KAW A;  1BKB A;  3FP9 A;  1LM0 A;  1C0A A;  1A63 A;  1CKO A;  4AIM A;  2CCZ A;  4JI0 L;  1VQJ A;  3PF4 A;  3CP0 A;  5JJL A;  5AJ3 Q;  4B3T Q;  4JBM A;  4LFC Q;  1EWI A;  3GTQ H;  3E9I A;  4DV2 Q;  2PQA A;  1L1O A;  4BY1 G;  1VQC A;  4DV3 L;  2CWA A;  4L5Q A;  3L2P A;  3UE1 A;  4A3F G;  1JB7 A;  3RZD H;  1EIF A;  4A3M H;  2BH2 A;  3A74 A;  3M4O H;  2ID0 A;  3I2Z A;  2YTV A;  1VQ9 A;  2ATW A;  1EFW A;  4LUZ A;  3HOZ G;  4YHH Q;  3I55 A;  4JI8 L;  1PFS A;  1KRT A;  4DPG A;  2VW9 A;  3CCE A;  3KLW A;  1K3R A;  3FKI H;  4IOC A;  1S72 A;  1XNR Q;  5IP7 G;  3CMA A;  1SFO H;  1KXL A;  2UU9 L;  4DR1 Q;  1YBY A;  1MKH A;  2E8G A;  1YHQ A;  3I4N H;  3EIV A;  2HIX A;  4UP8 A;  1GVP A;  5GAH C;  1OTC A;  4H02 A;  4JI6 L;  4A3C G;  4BBS H;  2IX0 A;  2WFW A;  2IX1 A;  1AH9 A;  3PO2 H;  4JG2 A;  1AE3 A;  5IYD G;  4B3M Q;  3J81 c;  1YIT A;  3TRZ A;  1G6P A;  1HR0 Q;  4X62 Q;  1CUK A;  5M3M H;  1L2F A;  2C35 B;  4JI4 Q;  1I94 Q;  1RIP A;  1M1K C;  1PH7 A;  4POG A;  3NEM A;  4IJL A;  2VUM G;  2UXB L;  1YI2 A;  3F2C A;  4GN4 B;  2QA4 A;  1Z9F A;  4X64 L;  4HJ9 A;  1EQR A;  4P72 A;  4BXX G;  4GKJ Q;  4UP9 A;  2VUM H;  4DV3 Q;  1FJG L;  2EXD A;  2V1C C;  3MXN B;  4HIK A;  2ES2 A;  4OWT B;  3PF5 A;  3KF6 B;  4TQU S;  4EX5 A;  1VQE A;  3DLL A;  4JI5 L;  2YV5 A;  4XIG S;  3RN5 A;  1VQG A;  2ZJR A;  3TQY A;  1JT8 A;  1VQM A;  4DK3 C;  2AKW B;  2AMC B;  3GTG H;  2JJQ A;  1B7Y B;  2EQS A;  1TWG H;  4NPS A;  4IOA A;  1LTL A;  5J3B A;  5FJ8 H;  4IJH A;  1XNQ L;  3TS2 A;  4A3E G;  2MFI A;  2KHI A;  2WAQ G;  1ASY A;  5IYC G;  4AH6 A;  1TXY A;  2UU9 Q;  1RL2 A;  2AWN A;  3AQQ A;  1J5E L;  3RLO A;  4APV A;  4HJ5 A;  4QIW E;  4LF4 Q;  4NXM Q;  3H3V H;  4OO1 I;  1I3Q H;  3K7U C;  3KF6 A;  3STB D;  2A8V A;  3CD6 A;  3GTM H;  4A3B G;  2OQK A;  4JI1 L;  5GAE C;  2VY3 A;  1WCM G;  1QZH A;  1SN8 A;  1Q8K A;  4DUY Q;  1Q1B A;  1HNZ L;  2UUA Q;  2MO1 A;  3W1G A;  2VS1 A;  4GN5 A;  1YJW A;  2ZM6 Q;  1HNW Q;  2UXB Q;  1GO3 E;  2N8N A;  4DV0 Q;  4MTN A;  3S16 H;  3S1M H;  4X64 Q;  1N8R C;  3ERS X;  2Y0S G;  2DGY A;  1NTG A;  2I5M X;  3KF8 B;  4A3G G;  2H5X A;  4LFC L;  4IPC A;  3ZJY C;  2GVA A;  5AJ3 L;  4B3T L;  1FJG Q;  1K9M C;  3S15 H;  1PV4 A;  4HJA A;  4DV2 L;  1WFQ A;  2RCN A;  4PMW A;  2CFM A;  1BVS A;  1X65 A;  3EBE A;  4DAY B;  1N32 Q;  4K0K L;  4X6A H;  3E0E A;  2CWP A;  3NBH B;  1PH8 A;  2YU9 H;  4C3I H;  3PIO A;  2Q2H A;  2RF4 A;  3J81 i;  4R4C A;  3CCL A;  1PH5 A;  4YHH L;  1A0I A;  4A3J G;  1SRO A;  2PNH A;  4NXN L;  1KC8 C;  1VQ7 A;  3S17 H;  4YCU A;  4KHZ A;  3HOV G;  2BA1 A;  1QVC A;  3CME A;  3PUX A;  1XNR L;  5DLQ E;  3KJP A;  1X54 A;  4KHP Q;  1IBK L;  4DR1 L;  1KL9 A;  4LF9 L;  3HKZ E;  2JA7 G;  4BA1 I;  2R7Z H;  1PH1 A;  1L1O B;  3WWV A;  1N33 Q;  1CSQ A;  2E5L Q;  1EUJ A;  1HNZ Q;  3S1N H;  1D7Q A;  4X62 L;  1YVC A;  3D31 A;  4JI4 L;  1I94 L;  5GAG C;  4JI3 Q;  2HT1 A;  1CKN A;  1FGU A;  4HJ7 A;  3I4M H;  4DAM A;  1YJN A;  4HID A;  2BH8 A;  3RZO H;  1D8L A;  1E24 A;  1Z47 A;  4AQY L;  3K7A H;  3ULJ A;  2UXC Q;  3IRB A;  3PSI A;  2QGQ A;  2XGT A;  1QUQ B;  4A3M G;  4KLK A;  4GKJ L;  1LUZ A;  2KCT A;  4DV7 L;  3CCU A;  1JMC A;  1SRU A;  1IZ6 A;  4XTC S;  2GN5 A;  3VDY A;  1IXR A;  1PHJ A;  4LFB L;  2K75 A;  3UDF A;  3PUY A;  4K0K Q;  4A3K H;  2JK8 A;  3S1R H;  2KEN A;  4IPH A;  1B70 B;  1E22 A;  4LW1 A;  2PI2 E;  3A0J A;  1MJC A;  3HFZ B;  1Y1W H;  1PH2 A;  1XPO A;  2NZH A;  3H0G H;  1K83 H;  3FKI G;  4LWC A;  3CPW A;  3GO5 A;  4RG1 A;  4NXN Q;  1MIU A;  3G4S A;  2Z0S A;  4DR4 Q;  3I4N G;  3PV0 A;  1QUQ A;  1V43 A;  1VQF A;  1YHB A;  4B3S Q;  1YJ9 A;  3M7N A;  4BBS G;  4R4T A;  1IBK Q;  3PO2 G;  2AWO A;  4LF9 Q;  4LF4 L;  1YHA A;  4NXM L;  2B63 G;  1SE8 A;  5C44 H;  3GTO H;  4QQB X;  1PYS B;  3CPF A;  5M5W H;  1I6H H;  5M3M G;  5ELO A;  1IYJ B;  5C0X G;  1PH3 A;  4UY8 C;  1KD1 C;  3EN2 A;  2B63 H;  3I4O A;  3J7Z C;  3HOY G;  1HZ9 A;  2N78 A;  4P73 A;  2VQF Q;  4L5S A;  4GKK L;  3K0X A;  1J6Q A;  4OXP A;  4LF5 Q;  4PZ7 A;  3CXC A;  4DUY L;  3FHW A;  3HOY H;  2UUA L;  1P16 A;  5C4J H;  3SGI A;  1IL2 A;  1X3G A;  1VQN A;  3S2D H;  4OWW B;  2ZM6 L;  3D0F A;  1U0L A;  1HNW L;  4AQY Q;  2RHS B;  3G48 A;  4DV0 L;  3J80 i;  1C7Y A;  2F52 A;  2CQO A;  3M85 A;  4R4I A;  1YEZ A;  4JI2 Q;  3A5U A;  4DV7 Q;  4P74 A;  3K80 C;  1VQ4 A;  4LFB Q;  5M3F H;  1HZC A;  1VQL A;  2UUB L;  2KHJ A;  4TVA B;  2NZO A;  4X66 L;  5FJ8 G;  1ASZ A;  1Q1E A;  1X3E A;  4YWM A;  3I56 A;  2JA5 G;  5GAD C;  2NVX H;  4JV5 L;  1N32 L;  4X65 Q;  2VNU D;  3RLN A;  1X3F A;  2HHH Q;  2DUD A;  4POF A;  1VQP A;  5K36 G;  1EYG A;  1VQA A;  3STB C;  4OX9 Q;  1HZB A;  2D62 A;  2D0P A;  5M5X H;  2JA5 H;  1VCI A;  4HIM A;  2R7D A;  4WJ3 M;  1SR3 A;  1N34 Q;  2L15 A;  2WP8 J;  3CC4 A;  1K0R A;  3JAM c;  2YTX A;  5C3E H;  4BA2 I;  1T9H A;  3KDF B;  4BBR G;  4KHP L;  2K4K A;  4DNI A;  3GTK H;  1G51 A;  5IY0 A;  3PIP A;  1K8A C;  1IBM L;  2ZJQ A;  4BY7 G;  5LMU Q;  5C4X H;  3UDG A;  1A8V A;  4PZ6 A;  3HOW H;  1UE6 A;  1UE7 A;  2NVQ H;  4BBR H;  1NMG A;  4LF8 Q;  1N33 L;  4BY7 H;  1O7I A;  4DR2 L;  4GKK Q;  2E5L L;  2RHQ B;  2UUC Q;  4PZ8 A;  3S1Q H;  1XTD A;  5EAY A;  3M4P A;  1CKM A;  3OTO Q;  1OXX K;  2OTJ A;  1KIX A;  4JI3 L;  1K8G A;  1UE5 A;  5IP9 G;  3A5Z B;  5JJI A;  4A4I A;  1JJC B;  3KDF A;  4QL5 A;  3RN2 A;  2UXC L;  5IP9 H;  4A3I H;  4A3D G;  5BR8 Q;  4R4O A;  2UUB Q;  1HH2 P;  4DV1 Q;  3CC2 A;  3ICE A;  3U58 A;  3PUW A;  4X66 Q;  1YNX A;  4JV5 Q;  1JE5 A;  4JBK A;  4A3D H;  4YCV A;  3AFP A;  1Q86 C;  3M9B A;  3GTL H;  3KYH C;  4GN3 B;  4JBJ A;  5FLX c;  1LYL A;  2R6G A;  2MO0 A;  4KI0 A;  1YIJ A;  3PO3 H;  3J80 c;  1OXV A;  1EIY B;  4IFD J;  2WB1 E;  3DM3 A;  3AYH B;  1PVO A;  1CKN B;  2JQO A;  3BZC A;  3F8T A;  1V9P A;  4LNQ A;  3BJU A;  2IHF A;  2NVT H;  4DR4 L;  2R7Z G;  1PH9 A;  4JCV E;  3GTJ H;  4B3S L;  5IE8 A;  1Q82 C;  3GTP H;  1N9W A;  3HOU H;  4A93 H;  2QEX A;  4OON A;  1IBM Q;  3CQZ H;  4IO9 A;  2IHE A;  2R7F A;  4DV4 L;  3HKS A;  3HKZ G;  1UE1 A;  4DR2 Q;  4LFA L;  3KFU A;  3OW2 A;  1VQ8 A;  4DUZ Q;  4JYA Q;  3I4M G;  3RR5 A;  2AHO B;  2GVB A;  1S3O A;  4R1J A;  1VQI A;  2VQF L;  2E2J H;  4LF5 L;  5C0X I;  4YCW A;  1X56 A;  2K52 A;  4LF7 Q;  2VL6 A;  4OO1 G;  1JJG A;  3G6E A;  2E2I H;  1XPR A;  2N49 A;  2XTI A;  3HOX G;  2A1A A;  2EIF A;  3PUZ A;  1VQ5 A;  4FDB A;  1XPU A;  4YY3 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...