1HNWL

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hnwL00
3L0OA 3AYHB 4DUZL 3JAMi 1A8VA 1OTCA 2RCNA 2IHFA 3TS2A 3A5ZB 5GQOA 1GD7A 1YJNA 4BA2I 3TEHB 4APVA 2Z6KC 4X62Q 2WAQG 3K8AA 2NN6G 3KOJA 3HOWH 1W3SA 2GVAA 2R93H 4R4TA 4KLKA 1PV4A 3A5UA 1V1QA 4DUYL 2VUMH 1PH4A 1TWHH 1HNZQ 4A3LG 1M90C 2BH2A 1Q81C 2JK8A 5ELOA 3HOYG 4DR4Q 3SGIA 1GVPA 3EN2A 3JC66 5HGQA 3M85A 3Q8DA 1PYSB 1PHJA 1BKBA 5JJLA 2NVQH 1SE8A 4A3JG 1VQ5A 2LSSA 2QEXA 3UDGA 2AKWB 2EIFA 4IFDG 3CCVA 4PG3A 1EIYB 4LF9L 2AMCB 4BBSH 1IBKQ 3S1QH 2JA9A 1E3PA 1OXTA 1XPUA 2HT1A 1TWAH 1I3QH 4C3HH 3RN5A 4LFCQ 2UUCQ 2F4VL 1FVIA 1QZGA 1Q8KA 4DKAC 4JI8Q 1Q12A 2KBNA 3GTPH 4MZ9A 1I94L 4GN3B 4BA1I 1JJGA 2JA7G 2YTYA 3OYYA 4NXNQ 2ZTDA 2CWAA 4JI1Q 4LF6Q 2YYZA 4IPGA 3UDXA 3W1BA 4C2MH 4JI8L 3ER0A 1K8GA 3S1MH 4JBJA 4DV0Q 1X55A 4JV5L 1Y14B 2ATWA 3NBHB 1IXRA 4A75A 2R7ZG 4A3CH 4AH6A 3HKZE 4JI1L 4NB3A 1N33Q 4DK3C 3HKSA 1UE5A 1YHQA 4JOIA 1N9WA 1VQ4A 5FJ8G 1NMGA 2IX0A 3FKIG 1VQJA 2YTXA 1YITA 3H3VI 3S1NH 2VL6A 3L2PA 1EQQA 3S2HH 1N33L 4JI5L 3K7UC 4LFBL 3CCEA 4QY7A 4FDBA 4R1JA 4DR6L 4A3MG 1Y1VH 4IPDA 4JCVE 3STBC 3DLLA 1KIXA 2KCMA 2KHJA 1YJWA 1KC8C 1B7YB 1GO3E 2D0PA 5C3EH 3OTOQ 4NXML 2B63H 4AQYQ 1NTGA 4BY1G 3RZOH 4JYAQ 1SROA 5AJ3Q 3ULPA 2E2IH 1G51A 3IRBA 1WYDA 1SMXA 1HZ9A 4DR2Q 3S24A 1XNRL 4JYAL 4LUVA 5LMUQ 1Q46A 4BBRH 4RG1A 5AJ3L 3A74A 1KQSA 2RHQB 4MTNA 1C9OA 2ZJRA 3OW2A 4DR2L 5IYDH 1PH5A 1PH6A 3UDFA 1LUZA 5ELNA 1E7ZA 4YY3Q 5LMUL 2UUAQ 4J15A 2YV5A 3AEVA 5C4XH 1VQ8A 4A3DH 4IFDI 1G291 3GO5A 4IOCA 2PQAB 4R4CA 1LM0A 5E7NA 4BY7G 1IL2A 3PGZA 1SR3A 2BA0A 4YY3L 1IBLL 2UUAL 2ASBA 2R92H 4YCUA 3CW2C 5GAHC 3H3VH 1GM5A 4OXPA 2YTVA 3ERSX 3RN2A 4JI4L 1M1KC 4OX9Q 3I2ZA 5IP9G 5FLMG 4HJ5A 1D8LA 2NVTH 3BJUA 5M5WH 5LMNL 2H5XA 3UE1A 3S14H 1WCMH 4LWCA 2C35B 4A3EH 3PSIA 1AH9A 1L1OC 4OX9L 4Y7NH 1CKNA 2MQHA 1E1TA 1CSPA 1SRUA 1UEBA 1EOVA 4JI7L 4POGA 1QVFA 2LXKA 1Z9FA 1YBYA 1N8RC 1HJPA 1OXUA 4YHHL 2ID0A 3HOYH 4POFA 1HR0L 1VQEA 4ALPA 4LFAQ 3PIOA 4A3KH 1LTLA 4IO9A 1N36L 1PH2A 4OO1G 4JBWA 1HH2P 4GLAC 5C44G 1Y1WH 3HOVH 2WB1E 5J3BA 1VQAA 3VDYA 1Q1EA 4OONA 1IZ6A 1HNXQ 2MO0A 1FL0A 1L1OB 5DLQE 4JI3L 5M3MG 2E5LQ 2GVBA 2WP8J 1MIUA 1YI2A 1XPOA 1C7YA 2VNUD 4A93H 1B8AA 1X9NA 3EBEA 3FP9A 2Q2TA 1VQNA 1X6OA 3J7ZC 1XJVA 2JA8G 4DV6L 2VZAA 5C4JH 2E5LL 4LUZA 1IYJB 2JA7H 2E2JH 4DUYQ 1I5FA 4AIMA 4A3BG 3HOZH 1PYBA 4GOPC 3DM3A 2AHOB 3RLNA 2JEAI 3HOXH 2HHHL 1VQHA 2PI2E 2AWNA 2AWOA 3G48A 4QL5A 2FXQA 4JC0A 4QIWE 3CCLA 3PO3G 3MEFA 2ES2A 4DV5L 2UXCL 3CCSA 1H95A 3GDEA 5FJ8H 4HJ7A 1X3GA 3F2BA 3M7NA 2ZJPA 3F8TA 4K0KL 2ZJQA 4LF9Q 3CAMA 3PO2H 3K7AH 4X66Q 2UXDQ 1TWCH 3HFZB 2VW9A 2CWPA 4UP7A 3J80c 1PH9A 5LMNW 2JA5G 4PZ8A 1W2BA 2F4VQ 5IYCH 4DV2Q 3CCMA 4BXXH 2K5HA 4A3FG 1A62A 2VQFL 4X65L 4X66L 3TRZA 2UXDL 1JT8A 4R4QA 1FJGQ 1I94Q 1YJ9A 1KD1C 4B3MQ 1PH1A 1T9HA 1TWFH 3I4MG 4DV2L 3GTJH 4GKJQ 1L0WA 3PF4A 5BR8Q 1FJGL 2N8NA 4TVAB 4JV5Q 5C0XI 1NJIC 4HJ8A 5GAEC 4B3ML 3TS0A 4GN5A 2OTLA 3KLWA 1HR0W 1SLJA 4GKJL 2Y0SG 5IY0A 5BR8L 3I56A 1P16A 1HZAA 3PUVA 1O7IA 4LUOA 3I4OA 2E8GA 2ZTCA 3CMAA 3TQYA 4JI5Q 2JJQA 3U58A 2K4KA 1WI5A 1BBUA 4YWKA 4LFBQ 3U50C 2K5VA 3GD7A 1K9MC 1V43A 2PQAA 4JBMA 3GTMH 4DR6Q 4DR3Q 3KJPA 2CCZA 4EX5A 3KF8B 4TQUS 3NEMA 1NMFA 3LGJA 3AQQA 1B70B 4DK6C 4NXMQ 2B3GA 1EIFA 2JEBI 4IJHA 4DR3L 4A3GH 2HIXA 4GKKQ 3I7FA 4LF8L 3KDFB 3GTOH 3PUWA 2K50A 3CCUA 1XNRQ 2GN5A 1VQFA 2NN6I 3HOWG 2KHIA 2OQKA 1QUQB 2WAQE 4WJ4A 2D62A 4GKKL 1X65A 4DV7Q 2OTJA 3UE0A 5IYBG 5FLXc 1WOCA 1E24A 4HIMA 4PMWA 4X6AH 3F1ZA 4A3IH 5JJIA 3ZJYC 5JJKA 3J80i 4DV7L 1VQ7A 4HIKA 1VCIA 3CC7A 1JJCB 5C44H 1IBLQ 4LNQA 1NY4A 2MNAA 4IPCA 4L5SA 1KXLA 4JI4Q 4XTCS 1KRTA 3K81C 1S3OA 4R4OA 4BBSG 3PCOB 2NVXH 3KYHC 3L7ZC 5LMNQ 2JA6H 2EXDA 4L5QA 1XTDA 1L1OA 3K0XA 3PUYA 1JE5A 3RZDH 1J6QA 2IX1A 5HY6A 1CKOA 4JI7Q 2ALYB 4MNOA 5EAYA 2A19A 1HZCA 5JEAJ 3S1RH 4C3IH 1EWIA 4YHHQ 4ME3A 1YHBA 4PZ7A 4JI2Q 2L15A 2NVYH 5GADC 1HR0Q 3PV0A 4A3CG 4GS3A 4DAYB 2V1CC 3KJOA 1N36Q 1YIJA 3PO3H 2UXBL 2NZHA 4A3LH 1FGUA 2K52A 1KRSA 2Q2UA 3CF5A 4JI2L 4GNXC 3TREA 1UE7A 5GAGC 2XGTA 1TWGH 4JI3Q 2IT1A 5C0XJ 4KHPL 2R7DA 1P8LA 4O0AA 1AE3A 1U0LA 1Y1VG 2MFIA 4A3JH 1S40A 3S2DH 4B3RQ 3U4VA 1VQOA 3PIPA 1PH8A 4DV6Q 2A8VA 5C3EG 4YCVA 4DV4Q 1KHIA 2PMZE 2B63G 2YU9H 4B3RL 4LF7L 1QVCA 4LF5Q 3K80C 2I5LX 3NENA 4P74A 3I4MH 2KENA 3D31A 2Z6KA 1K83H 1Q86C 4DV4L 2XTIA 3S15H 3EIVA 5H1SE 2CKZB 2HHHQ 1U5KA 2I5MX 2OQ0A 4P71A 5IP7G 4GNXB 3PF5A 1JMCA 1VQKA 4GLXA 2OCEA 4DV5Q 2Q2IA 1KAWA 3CXCA 1VQPA 1GKHA 4P73A 3U4ZA 3BU2A 2WFWA 2UXCQ 2R7ZH 3ICEA 1X56A 4B3TQ 3KF6B 1ASYA 1K73C 2PI2A 2CQOA 4K0KQ 3CD6A 4LF4Q 3E9IA 1QVGA 2R92G 1VQCA 3FKIH 3ULJA 4B3TL 2BA1A 1VQ6A 3A0JA 1E1OA 3E9HA 5M3FG 4LF4L 2VQFQ 4X65Q 3CCJA 2DUDA 1YEZA 4A3EG 1XPRA 4A3MH 4LF5L 4X64L 4B3SL 3RR5A 1XMQL 1VQIA 4JG2A 3J81j 2VQEQ 4IFDJ 1K8AC 3S17H 3B6YA 4GOPB 4BY1H 3H0GG 3KDFA 1PH3A 2N78A 3W1GA 1YZ6A 5IYBH 2VQEL 1I6HH 4X62L 1SN8A 1YHAA 1KL9A 1QUQA 1RL2A 4O2DA 5M5XH 3F2CA 1PH7A 1N34Q 1MJEA 3PUZA 1A0IA 4NPSA 1E22A 1WJJA 4A3KG 3HOUG 1QZHA 4OO1I 4QGUA 1HNZL 2E2HH 1EYGA 1VS0A 2HQLA 3G4SA 4HJ9A 1Y1WG 3HOUH 3HOVG 4DR4L 2I5HA 4OWTB 3STBD 3WWVA 1N34L 3CPFA 4JBKA 4HJAA 2IY5B 2ZM6Q 1UE6A 1UE1A 5M5YH 3CPWA 4BY7H 4DAMA 4PZ6A 1PVOA 3BZCA 2K75A 1OXXK 1K3RA 2PNHA 3CP0A 1X3EA 4UP9A 4A93G 1D7QA 2IHEA 2ZM6L 3CC4A 2R7FA 4HIOA 1C0AA 4LF8Q 5FLMH 5IP9H 3I4NG 1VQDA 2K5NA 4H02A 4DR1Q 4L5RC 1IBKL 2N3SA 3GTGH 4AYBG 1EUJA 4R4IA 4QQBX 1OXSC 1CUKA 4LFCL 3J7A5 2UUCL 3CMEA 5IE8A 3HOZG 4DR1L 1X3FA 2JE6I 2DGYA 1HZBA 2NZOA 4YWMA 1S72A 1Q1BA 3HOXG 2R93G 4KHZA 1LYLA 4NXNL 2VUMG 1YNXA 2VS1A 3J81c 3GTQH 1K0RA 4LF6L 4DV1Q 4DV0L 3GTKH 4EQ5A 3CCQA 1BVSA 1Q82C 4LW1A 2UUBQ 2I0QA 2WB1G 3PO2G 3D0FA 4DV1L 1HNWQ 3GTLH 3AFQA 1I50H 4JOIC 4IPHA 1XMOQ 1SFOH 1N32Q 5IYCG 2D0OA 4YWLA 1JB7A 1PFSA 5GROA 2UUBL 4OWWB 1TXYA 4BXXG 5M3MH 1HNWL 2RHSB 4IJLA 1BBWA 4GLVB 1WFQA 2Q2HA 3G6EA 2CFMA 3T1YQ 1XMOL 1Z47A 1PA6A 4DR7Q 2VY3A 2F3IA 2JA8H 1N32L 4UY8C 1EQRA 2K14A 1X54A 3OTOL 2QA4A 2B29A 4AQYL 4OWXB 3NELA 4L5TA 3T1YL 1V9PA 5IP7H 4DV3Q 3M3YH 4DR7L 2UXBQ 2KCTA 4A3BH 1VQGA 1NBWA 2A1AA 4GNXA 1G6PA 3RNUA 1VQMA 3JAMc 2Y0SE 3MXNB 4DV3L 1R9TH 1XNQQ 4IOAA 3CC2A 1J5EQ 1VQBA 4KHPQ 3KF6A 2LXJA 3M4QA 1UWVA 3G71A 4A76A 3T1HQ 1JJ2A 2EQSA 1XNQL 1AE2A 1IBMQ 3BZKA 5M3FH 1DGSA 1J5EL 2F52A 4XIGS 4HIDA 1VQ9A 3FHWA 2R6GA 2JQOA 4P75A 5JEAG 1OXVA 2UU9Q 4LF7Q 4A3GG 2Z0SA 5IT9c 4AYBE 3T1HL 1YVCA 2JA5H 3J81i 1IBML 1ASZA 4A3FH 1CSQA 3RLFA 4KI0A 1EFWA 3KFUA 5K36G 3CCRA 2UU9L 1A63A 3H0GH 4UP8A 3S16H 4DNIA 4Y52H 2HIVA 4DR5Q 4RMFA 4GOPA 3M4PA 4JI0Q 2ZTEA 4YCWA 3M4OH 1CKMA 4BBRG 4GN4B 1MKHA 3RLOA 4A3IG 3PUXA 5C0XG 2N49A 4QJFA 4DR5L 1NE3A 4UPAA 5IYDG 4JI0L 1MJCA 2RF4A 4P72A 3UDIA 5C4XG 3HKZG 3E0EA 4LFAL 3AFPA 4A3DG 4JI6Q 5IWAQ 3I55A 3F2DA 3W5OA 2JA6G 2BH8A 4WJ3M 4X64Q 4DUZQ 1RIPA 5IWAL 3H15A 1HNXL 4B3SQ 2QGQA 4JI6L 2MO1A 1Q7YC 3M9BA 4A4IA 4C3JH 1L2FA 4DPGA 1XMQQ 2OWOA 3I4NH 3CQZH 3ULLA 1VQLA 1WCMG 1CKNB
chains in the Genus database with same CATH superfamily
3OWFA 3QWNA 1A8VA 3TS2A 1YJNA 1GD7A 2A74C 4DAPA 3KOJA 4CKBA 5LL6X 3A5UA 4DUYL 4IQZA 3M7GA 4A3LG 3BVMA 2BH2A 2JK8A 3BDCA 5ELOA 4CJ0B 2F0MA 3DWQA 5HGQA 1EIGA 1PYSB 1PHJA 2DJGC 4B9WA 2LSSA 2QEXA 3CCVA 1EIYB 4LF9L 2AMCB 4BBSH 1STEA 1E3PA 2HT1A 5CC4A 4I65A 2V4DA 1Q8KA 1B44D 4DKAC 4JW0A 1EFID 2KBNA 1QWYA 1DXMA 2B8FA 1JJGA 3OYYA 1A3VA 1QCBD 3C1EA 4IPGA 3W1BA 3S1MH 4X3SA 3S1MB 1X55A 4QIWB 2ATWA 1IXRA 2KCCA 1CZGA 4AH6A 1BXTA 1W6KA 3HKZE 4JI1L 3HKSA 2WIIB 5I6YA 1NMGA 2HDMA 2YTXA 1EYDA 2B2UA 3S2HH 1B50A 4JI5L 3K7UC 3MTSA 2B2YA 3CCEA 4QY7A 4A3MG 4A3GB 2KHJA 4FF2A 1EEFD 1B7YB 1GO3E 2D0PA 3OTOQ 2B63H 3IKJA 5AJ3Q 2A68C 1G2TA 4K6DA 1WD0A 2PCFB 3I91A 4LUVA 4ZLTF 1KQSA 3A74A 4MTNA 3OW2A 4DR2L 1E7ZA 2UUAQ 1CK1A 5C4XH 1VQ8A 3ND8A 4A3DH 4A3DB 5C4XB 3GO5A 4IOCA 1LM0A 1HHVA 2PZWA 1B3QA 2BA0A 2NVXB 2ASBA 3NTKA 4YCUA 2JA6B 2R92H 3R3OA 4OXPA 2YTVA 3ERSX 1CQFA 4OX9Q 2C5CA 4FF1A 1NSNS 3BJUA 4C1NI 5LMNL 3S14H 4A3EH 1RKNA 1LTTD 5EJWA 1QOHA 4HSPA 3S1RB 2MQHA 4L8JA 4J6HA 1SRUA 4JI7L 4POGA 4O42A 2OEOA 1PZID 2GA4B 1IW7C 1OXUA 1ENCA 2OXPA 5ELCA 4KY5A 1VQEA 4RFBA 1IYVA 1O7LA 2EYHA 4GLAC 5K5PA 5C44G 3L3OC 2F0GA 4K8JA 4I7AA 1C8CA 1KTKA 1IZ6A 4IFDH 4RH6A 5M3MG 2HCIA 1MIUA 2A73B 1YI2A 4K5XA 4RCOA 5FO8B 3O13A 4C1NK 1XJVA 2KHSA 2E5LL 4LUZA 2BCOA 2BE5D 5C3WA 4DUYQ 1I5FA 3HOZH 3HOZB 2RA4A 1F77A 2JEAI 2ENBA 3G48A 4KN7C 2AWOA 3T53B 4DA2A 4JC0A 4QIWE 4QCLA 4NKLA 2PZTA 1O7ZA 3GDEA 1X3GA 2BDNA 2ZJQA 4LF9Q 3T16A 3PO2H 3PO2B 1WD1A 2E76C 2VW9A 3OPOA 3QIAA 4XQQA 1PMRA 2BDOA 2F0OA 2PMZB 3J81E 4BXXH 1A62A 4X65L 1QJOA 1PH1A 1T9HA 3FPUB 3DM1A 3OW7A 1I4XA 3QJYA 3D8GA 1DCZA 5IGBA 3PF4A 4TVAB 2PW5A 5GAEC 1IL8A 1QNUA 1JWMD 5DM63 3KLSX 2MGSA 5BR8L 4WRDA 1Y69U 3HOUB 1RJTA 2PZUA 3OSOA 2E8GA 4HMJA 2F1MA 4JI5Q 1WI5A 3CRLC 3GD7A 2PQAA 4LJZC 3DWAA 1B70B 2B3GA 1EIFA 2JEBI 3UI2A 1RODA 3JAME 3I7FA 4LF8L 3CCUA 1VQFA 2NN6I 3VYTA 4IUTA 3HOWG 1QE6A 1TS5A 1QUQB 3X3NA 1GUTA 4WJ4A 1JOQA 2OTJA 5FLXc 1QB5D 1WOCA 1E24A 4PMWA 2FHTA 4A3IH 1K28A 4A3IB 5C0XH 1U4LA 3J80i 4ME5A 4HIKA 1BQQT 2FINB 1KXLA 3KBGA 2B2UC 1KRTA 3K81C 3PCOB 2FJ2A 3L7ZC 5LMNQ 2B2YC 4M1UB 2JN4A 4C3HG 1L1OA 3K59A 1JE5A 3NPPA 1EY8A 3RZDH 3RZDB 1TY0A 2IX1A 2NZ1D 4JI7Q 2ALYB 4N9PA 2WACA 2A19A 1HZCA 2LFNA 3TP5A 2SNSA 2A6HD 2RSOA 4K5VA 4PQXA 5D65A 4JI2Q 2L15A 2NVYH 4A3CG 3PV0A 3KJOA 3I70A 4A3LH 1FGUA 2PNRC 5G3LD 4U68A 4QF4A 1YNJD 3TN2A 1P8LA 1S40A 3S2DH 4B3RQ 3U9SA 2JA5B 4FXGC 1J8IA 2A8VA 5C3EG 4NDXA 4YCVA 2PMZE 2A5HA 5CV9A 4LF7L 4DU9A 3K80C 5COYA 2I5LX 4P74A 1B3AA 2Z6KA 4WFN3 2TMPA 1Q86C 3H91A 2ZXPA 3EIVA 5H1SE 4LF5L 1U5KA 2I5MX 3I4LA 3R93A 3OIQA 3PF5A 1VQKA 1GHKA 4GLXA 2OCEA 5JOBA 1KAWA 3T56B 3U4ZA 3VR3A 2WFWA 3ICEA 5KNBA 4HCSA 4ZUIA 1J9OA 1TR5A 1Y8NB 1QVGA 1LT4D 4B3TL 1SYDA 4ODGA 2PPBC 4LF4L 4X65Q 1F9PA 1XPRA 4A3MH 1V1OA 4X64L 4UDUC 4B3SL 3RR5A 1XMQL 1DONA 4MHEA 1YNND 1BF4A 1PH3A 2N78A 5I2YA 1D5MC 1A2UA 1SN8A 2AUKA 4HN7A 1KNEA 1E22A 4A3KG 2F0KA 1TU2B 1LTRD 1B4OA 1EYGA 1VS0A 3G4SA 3BG3A 3J7AF 3MXGA 1UE1A 2F3WA 3CPWA 1ZYRC 4KJNA 2WV6D 3BZCA 2IHEA 2R3ZA 4HIOA 4LF8Q 1ET9A 3NSWA 3I4NG 2IL8A 1IBKL 2N3SA 1STHA 5D3IB 1CUKA 4LFCL 1R4PB 3SVMA 3J7A5 2ZXOA 4YWMA 1HZBA 5IOCA 1EU4A 5CV6A 4NXNL 1K0RA 1PZJD 3S1NB 1BUVT 2I0QA 3D0FA 3GTLH 1Y8PB 1I50H 3AFQA 5KGUA 1I50B 3GTLB 2HCCA 1PFMA 1EQVA 2L1BA 1N32Q 2D0OA 2UUBL 5M3MH 2Q2HA 1XMOL 2CFMA 2Z4IA 2F3IA 1AZQA 1X54A 1C4QA 2B29A 4AQYL 3J7YW 3NELA 1NBWA 1SEBD 4GNXA 2F03A 3RNUA 2L5TA 3EVQA 4RCNA 2KA7A 1R9TH 2I07B 2F0EA 4KMUC 3CC2A 5A35A 1J5EQ 1VQBA 3KF6A 2LXJA 3G71A 1UWVA 4RHSA 2RCFA 3T1HQ 1AE2A 1IBMQ 1VQ9A 1DGSA 4HIDA 5M5WB 2JQOA 3D3RA 1OXVA 4LF7Q 4A3GG 5C6AA 2F3VA 4AYBE 3J81i 2XSCA 1PTOC 3RLFA 3KFUA 2IWHA 3MFGA 1GOZA 4HSVA 3S16H 3S16B 2EYLA 4Y52H 2F0QA 3CHBD 3IL8A 4KKSA 4QUFA 3M4OH 1F9QA 4YCWA 3M4OB 1CKMA 1D6EC 5ELEA 5FO7B 5IGEA 3PUXA 4P2CB 5I9OA 4UPAA 4JI0L 4RHRA 4ZK9B 3HOVB 5C4XG 4LFAL 4E6IA 4A3DG 3NWTA 4FO2A 5IWAQ 1EZ6A 2EY1A 2ZXRA 3GP7A 5FKAC 2JA6G 3IFTA 3EA6A 4A93B 1GUWA 4X64Q 4B3SQ 5EKIA 1XMQQ 5BN5A 2RDFA 3CQZH 3ULLA 3CQZB 1F9RA 1TY2A 5C4ZA 3AYHB 4DUZL 3JAMi 2E2JB 1MGSA 3MEHA 1LTGD 2Z6KC 3H94A 3HOWH 2Z9HA 2GVAA 3HOXB 2R93H 2R93B 4MTKA 1PV4A 1PH4A 1TWHH 1TWHB 1Z6HA 1Q81C 2HD3A 1GVPA 1RCVD 1PRTD 1CT1D 4FP5D 5JJLA 1SE8A 5G3LF 3UDGA 2SDFA 4IFDG 5ELBA 3BVGA 1IBKQ 3S1QH 1B9MA 1D5ZC 2N55A 1OXTA 1TWAH 4C3HH 1TWAB 4C3HB 4LFCQ 2JYOA 2F4VL 1FVIA 1Q12A 3GTPH 4BA1I 2YTYA 4NXNQ 2CHBD 2YYZA 4C2MH 4C2MB 4JBJA 2QCPX 2L4NA 4A3CH 4MN3A 4A75A 1A3UA 1EQTA 1TT2A 1N33Q 1ENAA 1UE5A 3KUPA 4H44C 4JOIA 3MXNA 1VQ4A 2EJMA 2KOLA 3L2PA 1EQQA 4M8AA 1DYQA 1TS3A 3NTIA 2XNAC 1M8AA 4FDBA 4R9WA 4IPDA 4EQOA 2SNMA 3STBC 2VXWA 5C3EH 5C3EB 3N6RA 2EE1A 4F88A 4AQYQ 4JYAQ 2EYMA 1WYDA 1HTPA 5HURA 3G7LA 4BBRH 4RG1A 1HCZA 4BBRB 5AJ3L 3P7JA 1SXTA 2RHQB 2IX3A 4XT1B 1U4PA 2ZJRA 1RDPD 2DJFC 1PH6A 4FF3A 1LUZA 4YY3Q 3HOUG 3OMCA 5IGDA 3DEPA 3HKZB 1G291 1ZXTA 4IFDI 4G7OC 2PQAB 4BY7G 4XQJA 3Q23A 1IBLL 2UUAL 1DOKA 5GAHC 5FLMG 2MHVA 4I7ZC 2NVTH 2NVTB 1MHWC 1SDFA 3MHBA 1WCMH 1XTCD 2C35B 1WCMB 4BS9A 4OX9L 1CKNA 1FNWA 3VA7A 4DNRB 1BO0A 1EOVA 1QVFA 1LTID 2LXKA 5E4XA 1YBYA 3T13A 1DJRD 1N8RC 3SXHA 1HJPA 3FDTA 4YHHL 1HFGA 5KIXA 1HR0L 5FOBB 4ALPA 4LFAQ 4A3KH 4Q0FA 1ZKOA 1PH2A 4OO1G 4QB4A 1D1KA 1Q1EA 1S4ZA 4OONA 4EGVA 2B39A 3I73A 2MO0A 1FL0A 1L1OB 1U9RA 1PTOH 1ICWA 1K0SA 2VNUD 3EBEA 1X6OA 4DV6L 3PQIA 3C2PA 1K83B 5C4JH 5C4JB 1V1PA 1CTMA 1F2MA 1LABA 3S15B 1ML0D 4X3KA 4AIMA 5KYLA 1JWUD 5A2QL 3DM3A 2AHOB 4EVOA 3AU7A 1KDAA 1SMYC 3H6MA 1HUNA 1U4RA 2HHHL 2PI2E 2R7ZB 4OHJA 4V190 4DV5L 2SOBA 1BR9A 2O2LD 3FKIB 4OEMB 3F2BA 1SYBA 3E3XA 1RF2D 3SK6A 1FNVA 3K7AH 3K7AB 4X66Q 2UXDQ 1TWCH 1TWCB 2CWPA 4UP7A 3J80c 5LMNW 2JA5G 5EKKA 5NUCA 2F4VQ 4DV2Q 3L9AX 3CCMA 1F2ZA 5J22A 1KD1C 4WORA 3HP3A 1I6HB 1HFNA 4CBVA 5C0XI 2EYOA 2L55A 4GN5A 1B1ZA 2OTLA 2RQXA 4KTAA 1JB3A 4OELB 1HZAA 1O7IA 4LUOA 3I4OA 5T1IA 3U58A 2B2TA 2K4KA 4R8NA 4YWKA 1FR3A 4JBMA 4DR3Q 2CW0D 1EIHA 4DK1A 4KV6A 1NAPA 3AQQA 4MIUA 4DK6C 3GTGB 4A3GH 4GKKQ 1WTOA 3GTOH 3GTOB 2K50A 3K57A 3VYSA 2OQKA 2D62A 3UE0A 4DAVA 5JJIA 2DY7A 1E2VA 1JJCB 1IBLQ 3K5LA 1ONLA 4LNQA 1AFPA 1NY4A 1PRTF 1SFOB 4XTCS 1WTVA 4NW2A 2NVXH 2JA6H 1NUCA 2EXDA 4L5QA 1XTDA 4KN4C 1KLUD 1J6QA 2M2LA 3H09A 1T5XD 1CKOA 2EZVA 3S1RH 4YHHQ 4ME3A 1YHBA 3DMUA 1HR0Q 4GS3A 2K32A 5CV4A 2L11A 2V1CC 4BWGB 2UXBL 3PO3H 3PO3B 2NZHA 2K52A 4KKTA 4JI2L 1O80A 3IAYA 3T51B 2IT1A 5C0XJ 4KHPL 5CV8A 2MFIA 2BOSA 1HPCA 1LT3D 1PH8A 3PIP3 2QW7A 4DV6Q 2C9OA 3K58A 4DV4Q 1KHIA 1EEID 4ILWA 1V8QA 4B3RL 3TP6A 1WTRA 2JXMB 2XRSD 2CKZB 2HHHQ 1ENFA 4GNXB 3TZUA 4DV5Q 4CDDC 2Y0SB 4P73A 3KF6B 1ASYA 5DM73 1T5EA 5CV7A 2PI2A 1K73C 2CQOA 1HA5A 2MP1A 2EVBA 3E9IA 1VQCA 3K6OA 2VB3X 3FRPB 1NR4A 3NE5B 3E9HA 3CCJA 1YEZA 5DEHA 4G7HC 1W6JA 1VQIA 2IPKD 2J0TD 1CHQD 2QF7A 3KDFA 2Q8TA 3E5SA 1YZ6A 2EY2A 5JPNC 4X62L 4O2DA 1KL9A 3MA2B 1RL2A 1SNOA 1MJEA 1I6VC 3Q24A 1WJJA 1KAAA 3QR8A 4CDCC 1ESRA 2F0NA 4QGUA 2BE5C 3SE0A 3HOVG 4HJ9A 3HOUH 2F0DA 4OWTB 2EPBA 1NCVA 1UE6A 1SNCA 4BY7H 4BY7B 3MZ5A 3A7AB 1SBBB 3CP0A 1OXXK 3BYTB 1D7QA 4A93G 1F2LA 3KBXA 4PV1C 1I3QB 3CC4A 3OWEB 2R7FA 5FLMH 2NTTA 2KECA 4H02A 4DR1Q 1DZ1A 3KK7A 4V0BA 1JE4A 2CVRA 3ND9A 1SYEA 3CMEA 4CKCA 1X3FA 2JE6I 1S72A 3HOXG 2R93G 2CH4A 2KJXA 3VR2A 1YNXA 3J81c 4LF6L 1MI2A 3VYRA 3N52A 2D5DA 1D5XC 3CU7A 4DAYA 5L37A 3NWSA 1O78A 4DV0L 1PDQA 2MJ8A 4OO1H 4LW1A 1STGA 1MD2D 1HA6A 2B2TC 1CM9A 1HNWQ 1G8ZD 1STNA 1Y1VB 4DK0A 4OWWB 1PFSA 1TXYA 3D6CA 4RGMA 4IJLA 1I4PA 3RZOB 2ICIA 1WFQA 4CKEA 3H3VC 1B53A 1Z47A 2VY3A 1N32L 3OMGA 1EQRA 2K14A 3MVVA 5C4HA 5IP7H 2UXBQ 1VQGA 3VA5A 3AB9A 1RD9D 1GUSA 1H9SA 2KVMA 2WINB 2Y0SE 3MXNB 3JAMc 1SE2A 3BDLA 4TSSA 2NUCA 4XT3B 1WTPA 4UAIA 4KHPQ 4GZYC 1X3QA 1JJ2A 1EWCA 3R8BA 1J5EL 5HGTA 4XIGS 1HTLD 5JEAG 1PZKD 1CHPD 2UU9Q 3BVZA 3T1HL 2JA5H 1YVCA 3E0JA 1SNQA 1IBML 4Y7NB 1CSQA 5K36G 4KI0A 4ZRZA 3CCRA 3HGBA 4DNIA 4GOPA 3URYA 4BBRG 5EBCA 1EWHA 2R61A 1UAPA 2N49A 5TSSA 2FMMA 4QUCA 1SJED 3A8KE 4RA8A 5J39A 3HKZG 3E0EA 4TRDA 2A6HC 3ITPA 4JI6Q 2TSSA 1QILA 3I55A 1BNZA 3AMUA 3W5OA 1HUMA 1CA5A 2BH8A 4WJ3M 1RIPA 5IWAL 3M9BA 2IW3A 4DPGA 2OWOA 2MPMA 4HAEA 1YNJC 1VQLA 1WCMG 1CKNB 3RUZA 1X9NA 4AYBB 1EL0A 5GQOA 4BA2I 2K33A 1QNKA 4X62Q 5D14A 1W3SA 2A69D 1LT6D 4R4TA 1Y8OB 2VUMH 1V1QA 2VUMB 1EYAA 1II3A 2EYFA 4EQPA 2H1EA 5EPJA 3FVQA 3Q8DA 1BCPD 4HR7B 2WB1B 1BKBA 2NVQH 2NVQB 1VQ5A 2EIFA 4H7BA 4PG3A 1JCKB 3SK4A 5CGKA 3SR1A 1BDOA 4HMIA 1XPUA 4ZKBB 5FK9C 1V1PB 5IT9L 1QZGA 4JI8Q 1STYA 2KCNA 1I94L 1Z7TA 2L12A 4GN3B 3C1FA 4F8MA 4LF6Q 3UDXA 3ER0A 4DV0Q 1SAPA 4JV5L 1Y14B 5EBDA 2R7ZG 1U4MA 1YNNC 4DK3C 4X3UA 5EQ0A 1GUGA 1BBXC 3GTMB 2IX0A 3FKIG 1VQJA 1YITA 3S1NH 5BN4A 2VL6A 3MXPA 1N33L 5IODA 1NNXA 1IKLA 1VF7A 3G6JB 4OIKA 4LFBL 2XN9C 4R1JA 4DR6L 1ESFA 3VR4A 3OHXC 3WDNA 2KCMA 1YJWA 1KC8C 3R2IA 4J1MA 2HUGA 3F2UA 1NTGA 4BY1G 1G51A 3IRBA 1HZ9A 4KY7A 3S24A 1XNRL 3J7AV 1EYCA 4JYAL 5LMUQ 1Q46A 2K1BA 2K01A 2LMCB 1C9OA 3UDFA 4J15A 2CH4W 2NBFA 4R4CA 1IL2A 3NQTA 3PGZA 4PMCA 1SR3A 5LHY1 4YY3L 3CW2C 1B2TA 3H3VH 1GM5A 3GV6A 3RN2A 4JI4L 1PLFA 1D8LA 3V2TA 5M5WH 1D1IA 3UE1A 4LWCA 1H9RA 1L1OC 1ZEQX 3FMCA 2B2WA 5CBAE 1Z9FA 2QDLA 3TMEA 3W3AA 1K8MA 4DF7A 2ID0A 3HOYH 1LLRD 3HOYB 1B9NA 1XYIA 1TIID 3PIOA 1LTLA 4IO9A 1N36L 1EY4A 4JBWA 1UUPA 1HH2P 1JQYD 3HOVH 2XWJB 2WB1E 3VDYA 1VQAA 3PMFA 4A3JB 4Q5VA 4JI3L 4CJ2C 2GVBA 1XPOA 4A93H 1B8AA 2Q2TA 3J7ZC 2M9VA 2EYJA 3SDZA 3ZYYX 4ZUJA 2JA7H 2E2JH 2JA7B 4R8IA 1PYBA 4KY6A 4GOPC 3P20A 3RLNA 4ZKCB 1O7YA 3HOXH 2AWNA 3NK9A 3EQLC 2FXQA 3CCLA 4J8QA 3PO3G 3DEOA 3MEFA 2FMCA 3NBHA 4KD3A 1H95A 5FJ8H 3HS0C 1L0YB 2ZJPA 5AFWA 3VYUA 1W2BA 2DN8A 3QB3A 5C5MA 1GXDC 4A3FG 4X66L 4X3TA 2UXDL 1FJGQ 4Z9CB 1YJ9A 1I94Q 3S17B 2DNCA 1PXUA 3IFDA 4B3MQ 1TWFH 5C3XA 1TWFB 2P5ZX 4DV2L 5DNFA 4GKJQ 1L0WA 2F0LA 5M5XB 4HTHA 4JV5Q 3NUCA 1OO9B 3TS0A 1DM0B 3KLWA 1HR0W 1JICA 3D4WA 2Y0SG 4UHVA 5IY0A 2VB2X 1P16A 2Q8IB 4C56C 3PUVA 3LNNA 2ZTCA 2WKCA 4L63B 1BBUA 4LFBQ 3U50C 1CA6A 2K5VA 1K9MC 1V43A 4DR6Q 3M4YA 3NEMA 3LGJA 1PRTC 5JEAH 4DR3L 2HIXA 3LWUA 5KNDA 1KABA 1TKWB 3KDFB 2XRQD 1XNRQ 2GN5A 5K36H 4O1NA 5CYUA 2A6ED 1TS2A 2KQ3A 2WAQE 4GKKL 3GTQB 4DV7Q 1PYWD 4ID6A 5IIFA 4HIMA 4F7XA 2DY8A 4B08A 4LAAA 4X6AH 1JOKA 3ZJYC 5E1FA 5IT9E 1VQ7A 3CC7A 4G4KA 3NQIA 1BCPF 4JI4Q 3DHQA 4RGTA 4JVZA 2HQEA 3HG9A 2SEBD 3PUYA 4DXFA 1HXYD 5I2XA 5HY6A 5IGGA 5J1ZA 1GUOA 2K7VA 4MNOA 4DGZA 5EAYA 1JC7A 3GV3A 4C3IH 1EWIA 4C3IB 3DWPA 3DUZA 3OIPA 4RGOS 4A3BB 3DXJC 4PZ7A 1VMCA 4NP5A 4RGNA 4DAYB 1N36Q 1YIJA 1RTNA 2N88A 2Q2UA 4GNXC 3PIO3 2O5JC 1UE7A 1TWGH 4JI3Q 1TWGB 1IHZA 2R7DA 1AE3A 1EY6A 1Y1VG 2KEDA 3U4VA 3TDQA 3PIPA 4CGYB 1TQOA 1QVCA 5KRUA 3I4MH 2KENA 3D31A 3I4MB 1K83H 4DV4L 2XTIA 3S15H 2B2WC 4P71A 1JMCA 5IP7G 3J81L 1H9SB 4HCEA 5FLXL 2Q2IA 1XXGA 3CXCA 1GKHA 3BU2A 3V96A 2R7ZH 4JPBW 1A6XA 3TP8A 3EROA 5CBEE 1JR0D 1PTOF 3FKIH 3ULJA 2BA1A 4ZQ3A 1VQ6A 1E1OA 1GHJA 1AZPA 3HZXA 1TVXA 1LTSD 1RHPA 3KF8A 4IUUA 4JG2A 2VQEQ 5KEEA 4CHTB 4IFDJ 1K8AC 3NHHA 4GOPB 4BY1H 4BY1B 3W1GA 2OF1A 5ELDA 5IYBH 1I6HH 2G9HD 1PH7A 2QDBA 1N34Q 3PUZA 1A0IA 3JAML 1CQVA 1QZHA 4OO1I 1HNZL 2E2HH 2E2HB 5EPKA 4LK1C 1Y1WG 4DR4L 4DFAA 4IALA 4N9TA 3WWVA 1I4QA 5BN3A 4HJAA 2ZM6Q 4DAMA 4PZ6A 4BBSB 2F0UA 1K3RA 2PNHA 4HEDA 2F4IA 4UP9A 2A68D 3BYYB 2F0HA 5EPLA 1VQDA 4L5RC 3OOCA 1Q8IA 4K8IA 4R4IA 4AYBG 3GTGH 4QQBX 1G91A 4KK7A 3QG1A 2UUCL 2F0SA 2MUYA 4KD4A 5IE8A 3K5MA 4DR1L 2DGYA 2NZOA 1Q1BA 5EKLA 4KHZA 1LYLA 3EJIA 2B8GA 2VUMG 2EOTA 2VS1A 3CKIB 1EY5A 1SYGA 5IGFA 4DV1Q 3MXUA 3D4DA 4EQ5A 3TP7A 1WTWA 1BVSA 4RWSC 3S2HB 3K5OA 2WB1G 4JOIC 1PRTB 4ZYSA 3FPPA 2FFKB 4IUNA 1SFOH 5KNCA 2J7ZA 2O4XA 3T4AC 5IYCG 1JB7A 3RMHA 1HNWL 2RHSB 1AEXA 1BBWA 4GLVB 2B63B 3QOJA 1FYCA 3T1YQ 5T1GA 1IW7D 2NTSA 4ZCKA 4DR7Q 1GJXA 2CW0C 2QA4A 4OL7A 1SYCA 4L5TA 3V05A 3LX0A 5D3DA 4DV3Q 4G7ZC 3M3YH 3M3YB 2A1AA 1G6PA 3NP8A 1VQMA 5CR3A 1RTOA 2K5QA 3K5NA 3BZDB 1XNQQ 1WVLA 4IOAA 2R92B 3M4QA 4IN3A 2H4OA 2EQSA 5M3FH 5M3FB 3FHWA 2R6GA 4P75A 3S14B 3Q0AA 4A3EB 4K2KA 2Z0SA 1A3TA 2K6AA 2M00A 4FXKC 1ASZA 4A3FH 4A3FB 3C46A 2UU9L 3H0GH 3SEBA 1K8OA 3H0GB 1E2WA 2HIVA 4DR5Q 3KLSA 4RMFA 1G6ZA 3M4PA 2ZTEA 1JOOA 1Q90A 1TS4A 2K04A 4GN4B 3RLOA 1SSOA 5E3FA 1NE3A 1ET6A 5ISRA 1Q3LA 2RF4A 4P72A 4CJ1B 3AFPA 4YIJA 5KYIA 1STAA 3A56A 4XYQA 1HNXL 3H15A 4JI6L 2QGQA 1Q7YC 4A4IA 1L2FA 2G9DA 1EY0A 3L0OA 1OTCA 2RCNA 2IHFA 2QEJC 3A5ZB 3TEHB 4APVA 2WAQG 3K8AA 2NN6G 4LMQD 2F0PA 4KLKA 4RKLA 2LY7A 1HNZQ 1NR2A 1M90C 4DR4Q 3HOYG 2QKIC 2JSOA 3EN2A 3SGIA 3JC66 3C3LA 4ABNA 1VDZA 1EY7A 3RD4A 3M85A 1LTBD 1IYUA 2E2DC 4A3JG 5JAVA 3A8JE 4IUVA 2AKWB 1S5FD 5FLXE 5A2QE 1JWSD 2JA9A 2RSNA 5IGCA 1I3QH 3RN5A 2E74C 2UUCQ 2PQEA 1A15A 3E6ZX 1AP0A 4MZ9A 2JA7G 2ZTDA 2CWAA 2F0IA 4JI1Q 1K8GA 4JI8L 2KEEA 3NBHB 4IURA 3WOFA 3ERQA 4NB3A 4JK1C 1QG7A 1YHQA 1N9WA 5FJ8G 3H3VI 1Y1VH 1H9KA 2K5WA 1F9SA 3NXWA 5F2DA 4JCVE 3DLLA 1KIXA 1F2YA 4RKBA 4XQNA 4NXML 3RZOH 1CI3M 1SROA 3VR6A 3ULPA 2E2IH 2E2IB 1S5DD 1SMXA 4DR2Q 2D9UA 4CDFC 2F0TA 4N8X1 2RDHA 5IYDH 1PH5A 3Q22A 5ELNA 5LMUL 4DNTB 2YV5A 3AEVA 5E7NA 1S5ED 2XIWA 1GUNA 2CQAA 4DXGA 2EYPA 1I4GA 1M1KC 3I2ZA 5CV5A 5IP9G 4HJ5A 4N8FA 5ELFA 2H5XA 4L6TB 5CMDA 3PSIA 3I8ZA 1AH9A 1MBYA 3A54A 4Y7NH 1E1TA 1CSPA 1UEBA 2AQ3B 3GQBA 2NVYB 1JORA 1R4QB 4POFA 2O5IC 1DD2A 3U9OA 3S9WA 2AQ1B 1Y1WH 1Y1WB 5J3BA 3S2DB 1HNXQ 2Z8LA 5JJZA 1SNMA 3A7LA 5DLQE 3CRKC 5LL6S 2E5LQ 2WP8J 1C7YA 2PYKA 3FP9A 1VQNA 2JA8G 1LACA 2VZAA 3SK8A 1IYJB 1A2TA 1PFNA 3FEWX 2K5DA 4C3IG 4A3BG 2L9HA 1I4RA 3BDOA 2X6LA 1KDCA 4H13C 2EY6A 1X3PA 1VQHA 1ZYRD 4QL5A 3MWYW 2ES2A 1VF5C 2UXCL 3CCSA 4HJ7A 2DNEA 3M7NA 3D6WA 2EJFC 3F8TA 4K0KL 1AW7A 3CAMA 2NWGA 4U673 1HQMC 2B2VA 1I4HA 3P1HA 3HFZB 4A3MB 1PH9A 4PZ8A 5IYCH 2K5HA 3TRZA 2VQFL 1JT8A 5M9OA 4RAUC 4R4QA 3I4MG 2Q8RE 4PNYA 3GTJH 3GTJB 1XX8A 5BR8Q 3MFYA 1FJGL 2HDLA 2N8NA 1NJIC 4B3ML 4HJ8A 1SLJA 4GKJL 3I56A 2ZT9C 3MAQA 5C5LA 2RBMA 3A55A 1SYFA 2A69C 3CMAA 3TQYA 2JJQA 4FNFA 3GTMH 3I3CA 3KJPA 2CCZA 1LT5D 4EX5A 4C3JG 3KF8B 4TQUS 1NMFA 5DAUA 3NBIA 4NXMQ 3QO2A 1BCPC 4IJHA 4FXDA 2F0FA 3BS1A 1LV9A 2RVLA 3PUWA 1ILPA 1CZWA 2KHIA 1X65A 5IYBG 3I90A 2EDGA 2Z1CA 2KUMA 3F1ZA 1C48A 5JJKA 4OIJA 4DV7L 1VCIA 4KJOA 1VMPA 4ZAIA 1MSHA 5C44H 3X3MA 5C44B 4KKUA 2MNAA 4CDEC 4IPCA 4L5SA 1PTOD 5I4DA 2K05A 1WTQA 1EU3A 4R4OA 1S3OA 4BBSG 3KYHC 5M3MB 5JPMC 2PO4A 2Z6BA 3K0XA 3J80L 1KNAA 4IZ8A 4S3SA 4B9XA 4WJWA 5JVG3 5CORA 5JEAJ 1M4VA 3TBIB 2NN6H 2WAQB 1D2BA 5GADC 1G2SA 1MSGA 1R9TB 1K3BC 3EFXD 1KRSA 1S5BD 3CF5A 1LTAD 3TREA 5GAGC 2XGTA 3HEJA 2OT2A 1WTXA 4O0AA 1U0LA 4A3JH 3HRZC 2G5DA 1VQOA 3P75A 2AQ2B 4XYOA 3NTHA 2LS01 2B63G 5JVH3 4OGQC 4XXEA 2YU9H 2Z4HA 2YU9B 4LF5Q 3NENA 1L0XB 5E4WC 4K5WA 1DOLA 2OQ0A 1UNSA 2J4XA 2PW7A 2F0WA 3A8IE 4K6LA 2UXCQ 1VQPA 1FNUA 1X56A 4B3TQ 4QMGA 3I72A 4ULLA 4K0KQ 1FD7D 3CD6A 4LF4Q 4KHVA 3SK5A 2R92G 4K2LA 2D2CC 3A0JA 5M3FG 2VQFQ 1SE3A 2DUDA 1H9MA 1DOMA 4A3EG 2LKVA 3J81j 4XDXA 2F0VA 3S17H 3B6YA 3HOWB 2WKDA 3H0GG 1HQRD 1SNDA 2VQEL 2QILA 1YHAA 5M5XH 3F2CA 1QUQA 4NPSA 1KLGD 4NMZA 1BOSA 4FVMA 2HQLA 5EGTA 2I5HA 3STBD 1N34L 3CPFA 4JBKA 2IY5B 5M5YH 5M5YB 1PVOA 2K75A 1S5CD 3S1QB 2AUJD 2B2VC 1X3EA 2ZM6L 1E2ZA 3LWEA 1C0AA 5IP9H 2NB0A 2K5NA 1EY9A 1SJHD 1ILQA 1CFMA 1EUJA 3GTPB 4TKOB 1OXSC 3HOZG 1SNPA 4IUPA 1X32A 2XWBB 3GTQH 2NYZD 2L0CA 3R2TA 3GTKH 3GTKB 3CCQA 4G57A 1Q82C 2UUBQ 4PMBA 2X6GA 3PO2G 1AN8A 4DV1L 3WOEA 4IPHA 1XMOQ 1BCPB 4FYDA 1XWEA 4BXXG 4YWLA 5GROA 1E0BA 4H0LC 4FF4A 3G6EA 2IJ0A 1PA6A 5I9PA 1SE4A 2JA8H 4UY8C 2JA8B 1HRJA 3OTOL 3K0YA 3ONAB 2I46A 4OWXB 3T1YL 3W2DA 1V9PA 4DR7L 1IKMA 1UEAB 5FO9B 2KCTA 4A3BH 4EQNA 1WTHA 1STBA 3VR5A 3SHLA 4DV3L 2A6EC 3TSSA 1H9JA 3MC0B 2K28A 1ICFB 4A76A 1EOTA 2F0JA 1KDBA 1XNQL 3BZKA 2F52A 2RDGA 2EXZA 2ICEC 5I6WA 5IT9c 4F87A 3D4RA 1EZ8A 1SMYD 1LO5D 1EFWA 3Q6SA 2EJGC 3TZDA 1A63A 4UP8A 2XVSA 4JI0Q 3QOLA 2EY5A 4IUQA 1PFBA 1MKHA 4A3IG 4DN4M 5C0XG 4QJFA 4DR5L 4A3KB 3J80E 5IYDG 2X69A 3KLRA 1MJCA 3UDIA 1FGBD 2K03A 2JP1A 2E75C 3F2DA 1PTOB 2RKSA 4DUZQ 2MO1A 4C3JH 3I4NH 4K14A 4C3JB 3I4NB
chains in the Genus database with same CATH topology
3L0OA 3AYHB 4DUZL 3JAMi 1A8VA 1OTCA 2RCNA 2IHFA 3TS2A 3A5ZB 5GQOA 1GD7A 1YJNA 4BA2I 3TEHB 4APVA 2Z6KC 4X62Q 2WAQG 3K8AA 2NN6G 3KOJA 3HOWH 1W3SA 2GVAA 2R93H 4R4TA 4KLKA 1PV4A 3A5UA 1V1QA 4DUYL 2VUMH 1PH4A 1TWHH 1HNZQ 4A3LG 1M90C 2BH2A 1Q81C 2JK8A 5ELOA 3HOYG 4DR4Q 3SGIA 1GVPA 3EN2A 3JC66 5HGQA 3M85A 3Q8DA 1PYSB 1PHJA 1BKBA 5JJLA 2NVQH 1SE8A 4A3JG 1VQ5A 2LSSA 2QEXA 3UDGA 2AKWB 2EIFA 4IFDG 3CCVA 4PG3A 1EIYB 4LF9L 2AMCB 4BBSH 1IBKQ 3S1QH 2JA9A 1E3PA 1OXTA 1XPUA 2HT1A 1TWAH 1I3QH 4C3HH 3RN5A 4LFCQ 2UUCQ 2F4VL 1FVIA 1QZGA 1Q8KA 4DKAC 4JI8Q 1Q12A 2KBNA 3GTPH 4MZ9A 1I94L 4GN3B 4BA1I 1JJGA 2JA7G 2YTYA 3OYYA 4NXNQ 2ZTDA 2CWAA 4JI1Q 4LF6Q 2YYZA 4IPGA 3UDXA 3W1BA 4C2MH 4JI8L 3ER0A 1K8GA 3S1MH 4JBJA 4DV0Q 1X55A 4JV5L 1Y14B 2ATWA 3NBHB 1IXRA 4A75A 2R7ZG 4A3CH 4AH6A 3HKZE 4JI1L 4NB3A 1N33Q 4DK3C 3HKSA 1UE5A 1YHQA 4JOIA 1N9WA 1VQ4A 5FJ8G 1NMGA 2IX0A 3FKIG 1VQJA 2YTXA 1YITA 3H3VI 3S1NH 2VL6A 3L2PA 1EQQA 3S2HH 1N33L 4JI5L 3K7UC 4LFBL 3CCEA 4QY7A 4FDBA 4R1JA 4DR6L 4A3MG 1Y1VH 4IPDA 4JCVE 3STBC 3DLLA 1KIXA 2KCMA 2KHJA 1YJWA 1KC8C 1B7YB 1GO3E 2D0PA 5C3EH 3OTOQ 4NXML 2B63H 4AQYQ 1NTGA 4BY1G 3RZOH 4JYAQ 1SROA 5AJ3Q 3ULPA 2E2IH 1G51A 3IRBA 1WYDA 1SMXA 1HZ9A 4DR2Q 3S24A 1XNRL 4JYAL 4LUVA 5LMUQ 1Q46A 4BBRH 4RG1A 5AJ3L 3A74A 1KQSA 2RHQB 4MTNA 1C9OA 2ZJRA 3OW2A 4DR2L 5IYDH 1PH5A 1PH6A 3UDFA 1LUZA 5ELNA 1E7ZA 4YY3Q 5LMUL 2UUAQ 4J15A 2YV5A 3AEVA 5C4XH 1VQ8A 4A3DH 4IFDI 1G291 3GO5A 4IOCA 2PQAB 4R4CA 1LM0A 5E7NA 4BY7G 1IL2A 3PGZA 1SR3A 2BA0A 4YY3L 1IBLL 2UUAL 2ASBA 2R92H 4YCUA 3CW2C 5GAHC 3H3VH 1GM5A 4OXPA 2YTVA 3ERSX 3RN2A 4JI4L 1M1KC 4OX9Q 3I2ZA 5IP9G 5FLMG 4HJ5A 1D8LA 2NVTH 3BJUA 5M5WH 5LMNL 2H5XA 3UE1A 3S14H 1WCMH 4LWCA 2C35B 4A3EH 3PSIA 1AH9A 1L1OC 4OX9L 4Y7NH 1CKNA 2MQHA 1E1TA 1CSPA 1SRUA 1UEBA 1EOVA 4JI7L 4POGA 1QVFA 2LXKA 1Z9FA 1YBYA 1N8RC 1HJPA 1OXUA 4YHHL 2ID0A 3HOYH 4POFA 1HR0L 1VQEA 4ALPA 4LFAQ 3PIOA 4A3KH 1LTLA 4IO9A 1N36L 1PH2A 4OO1G 4JBWA 1HH2P 4GLAC 5C44G 1Y1WH 3HOVH 2WB1E 5J3BA 1VQAA 3VDYA 1Q1EA 4OONA 1IZ6A 1HNXQ 2MO0A 1FL0A 1L1OB 5DLQE 4JI3L 5M3MG 2E5LQ 2GVBA 2WP8J 1MIUA 1YI2A 1XPOA 1C7YA 2VNUD 4A93H 1B8AA 1X9NA 3EBEA 3FP9A 2Q2TA 1VQNA 1X6OA 3J7ZC 1XJVA 2JA8G 4DV6L 2VZAA 5C4JH 2E5LL 4LUZA 1IYJB 2JA7H 2E2JH 4DUYQ 1I5FA 4AIMA 4A3BG 3HOZH 1PYBA 4GOPC 3DM3A 2AHOB 3RLNA 2JEAI 3HOXH 2HHHL 1VQHA 2PI2E 2AWNA 2AWOA 3G48A 4QL5A 2FXQA 4JC0A 4QIWE 3CCLA 3PO3G 3MEFA 2ES2A 4DV5L 2UXCL 3CCSA 1H95A 3GDEA 5FJ8H 4HJ7A 1X3GA 3F2BA 3M7NA 2ZJPA 3F8TA 4K0KL 2ZJQA 4LF9Q 3CAMA 3PO2H 3K7AH 4X66Q 2UXDQ 1TWCH 3HFZB 2VW9A 2CWPA 4UP7A 3J80c 1PH9A 5LMNW 2JA5G 4PZ8A 1W2BA 2F4VQ 5IYCH 4DV2Q 3CCMA 4BXXH 2K5HA 4A3FG 1A62A 2VQFL 4X65L 4X66L 3TRZA 2UXDL 1JT8A 4R4QA 1FJGQ 1I94Q 1YJ9A 1KD1C 4B3MQ 1PH1A 1T9HA 1TWFH 3I4MG 4DV2L 3GTJH 4GKJQ 1L0WA 3PF4A 5BR8Q 1FJGL 2N8NA 4TVAB 4JV5Q 5C0XI 1NJIC 4HJ8A 5GAEC 4B3ML 3TS0A 4GN5A 2OTLA 3KLWA 1HR0W 1SLJA 4GKJL 2Y0SG 5IY0A 5BR8L 3I56A 1P16A 1HZAA 3PUVA 1O7IA 4LUOA 3I4OA 2E8GA 2ZTCA 3CMAA 3TQYA 4JI5Q 2JJQA 3U58A 2K4KA 1WI5A 1BBUA 4YWKA 4LFBQ 3U50C 2K5VA 3GD7A 1K9MC 1V43A 2PQAA 4JBMA 3GTMH 4DR6Q 4DR3Q 3KJPA 2CCZA 4EX5A 3KF8B 4TQUS 3NEMA 1NMFA 3LGJA 3AQQA 1B70B 4DK6C 4NXMQ 2B3GA 1EIFA 2JEBI 4IJHA 4DR3L 4A3GH 2HIXA 4GKKQ 3I7FA 4LF8L 3KDFB 3GTOH 3PUWA 2K50A 3CCUA 1XNRQ 2GN5A 1VQFA 2NN6I 3HOWG 2KHIA 2OQKA 1QUQB 2WAQE 4WJ4A 2D62A 4GKKL 1X65A 4DV7Q 2OTJA 3UE0A 5IYBG 5FLXc 1WOCA 1E24A 4HIMA 4PMWA 4X6AH 3F1ZA 4A3IH 5JJIA 3ZJYC 5JJKA 3J80i 4DV7L 1VQ7A 4HIKA 1VCIA 3CC7A 1JJCB 5C44H 1IBLQ 4LNQA 1NY4A 2MNAA 4IPCA 4L5SA 1KXLA 4JI4Q 4XTCS 1KRTA 3K81C 1S3OA 4R4OA 4BBSG 3PCOB 2NVXH 3KYHC 3L7ZC 5LMNQ 2JA6H 2EXDA 4L5QA 1XTDA 1L1OA 3K0XA 3PUYA 1JE5A 3RZDH 1J6QA 2IX1A 5HY6A 1CKOA 4JI7Q 2ALYB 4MNOA 5EAYA 2A19A 1HZCA 5JEAJ 3S1RH 4C3IH 1EWIA 4YHHQ 4ME3A 1YHBA 4PZ7A 4JI2Q 2L15A 2NVYH 5GADC 1HR0Q 3PV0A 4A3CG 4GS3A 4DAYB 2V1CC 3KJOA 1N36Q 1YIJA 3PO3H 2UXBL 2NZHA 4A3LH 1FGUA 2K52A 1KRSA 2Q2UA 3CF5A 4JI2L 4GNXC 3TREA 1UE7A 5GAGC 2XGTA 1TWGH 4JI3Q 2IT1A 5C0XJ 4KHPL 2R7DA 1P8LA 4O0AA 1AE3A 1U0LA 1Y1VG 2MFIA 4A3JH 1S40A 3S2DH 4B3RQ 3U4VA 1VQOA 3PIPA 1PH8A 4DV6Q 2A8VA 5C3EG 4YCVA 4DV4Q 1KHIA 2PMZE 2B63G 2YU9H 4B3RL 4LF7L 1QVCA 4LF5Q 3K80C 2I5LX 3NENA 4P74A 3I4MH 2KENA 3D31A 2Z6KA 1K83H 1Q86C 4DV4L 2XTIA 3S15H 3EIVA 5H1SE 2CKZB 2HHHQ 1U5KA 2I5MX 2OQ0A 4P71A 5IP7G 4GNXB 3PF5A 1JMCA 1VQKA 4GLXA 2OCEA 4DV5Q 2Q2IA 1KAWA 3CXCA 1VQPA 1GKHA 4P73A 3U4ZA 3BU2A 2WFWA 2UXCQ 2R7ZH 3ICEA 1X56A 4B3TQ 3KF6B 1ASYA 1K73C 2PI2A 2CQOA 4K0KQ 3CD6A 4LF4Q 3E9IA 1QVGA 2R92G 1VQCA 3FKIH 3ULJA 4B3TL 2BA1A 1VQ6A 3A0JA 1E1OA 3E9HA 5M3FG 4LF4L 2VQFQ 4X65Q 3CCJA 2DUDA 1YEZA 4A3EG 1XPRA 4A3MH 4LF5L 4X64L 4B3SL 3RR5A 1XMQL 1VQIA 4JG2A 3J81j 2VQEQ 4IFDJ 1K8AC 3S17H 3B6YA 4GOPB 4BY1H 3H0GG 3KDFA 1PH3A 2N78A 3W1GA 1YZ6A 5IYBH 2VQEL 1I6HH 4X62L 1SN8A 1YHAA 1KL9A 1QUQA 1RL2A 4O2DA 5M5XH 3F2CA 1PH7A 1N34Q 1MJEA 3PUZA 1A0IA 4NPSA 1E22A 1WJJA 4A3KG 3HOUG 1QZHA 4OO1I 4QGUA 1HNZL 2E2HH 1EYGA 1VS0A 2HQLA 3G4SA 4HJ9A 1Y1WG 3HOUH 3HOVG 4DR4L 2I5HA 4OWTB 3STBD 3WWVA 1N34L 3CPFA 4JBKA 4HJAA 2IY5B 2ZM6Q 1UE6A 1UE1A 5M5YH 3CPWA 4BY7H 4DAMA 4PZ6A 1PVOA 3BZCA 2K75A 1OXXK 1K3RA 2PNHA 3CP0A 1X3EA 4UP9A 4A93G 1D7QA 2IHEA 2ZM6L 3CC4A 2R7FA 4HIOA 1C0AA 4LF8Q 5FLMH 5IP9H 3I4NG 1VQDA 2K5NA 4H02A 4DR1Q 4L5RC 1IBKL 2N3SA 3GTGH 4AYBG 1EUJA 4R4IA 4QQBX 1OXSC 1CUKA 4LFCL 3J7A5 2UUCL 3CMEA 5IE8A 3HOZG 4DR1L 1X3FA 2JE6I 2DGYA 1HZBA 2NZOA 4YWMA 1S72A 1Q1BA 3HOXG 2R93G 4KHZA 1LYLA 4NXNL 2VUMG 1YNXA 2VS1A 3J81c 3GTQH 1K0RA 4LF6L 4DV1Q 4DV0L 3GTKH 4EQ5A 3CCQA 1BVSA 1Q82C 4LW1A 2UUBQ 2I0QA 2WB1G 3PO2G 3D0FA 4DV1L 1HNWQ 3GTLH 3AFQA 1I50H 4JOIC 4IPHA 1XMOQ 1SFOH 1N32Q 5IYCG 2D0OA 4YWLA 1JB7A 1PFSA 5GROA 2UUBL 4OWWB 1TXYA 4BXXG 5M3MH 1HNWL 2RHSB 4IJLA 1BBWA 4GLVB 1WFQA 2Q2HA 3G6EA 2CFMA 3T1YQ 1XMOL 1Z47A 1PA6A 4DR7Q 2VY3A 2F3IA 2JA8H 1N32L 4UY8C 1EQRA 2K14A 1X54A 3OTOL 2QA4A 2B29A 4AQYL 4OWXB 3NELA 4L5TA 3T1YL 1V9PA 5IP7H 4DV3Q 3M3YH 4DR7L 2UXBQ 2KCTA 4A3BH 1VQGA 1NBWA 2A1AA 4GNXA 1G6PA 3RNUA 1VQMA 3JAMc 2Y0SE 3MXNB 4DV3L 1R9TH 1XNQQ 4IOAA 3CC2A 1J5EQ 1VQBA 4KHPQ 3KF6A 2LXJA 3M4QA 1UWVA 3G71A 4A76A 3T1HQ 1JJ2A 2EQSA 1XNQL 1AE2A 1IBMQ 3BZKA 5M3FH 1DGSA 1J5EL 2F52A 4XIGS 4HIDA 1VQ9A 3FHWA 2R6GA 2JQOA 4P75A 5JEAG 1OXVA 2UU9Q 4LF7Q 4A3GG 2Z0SA 5IT9c 4AYBE 3T1HL 1YVCA 2JA5H 3J81i 1IBML 1ASZA 4A3FH 1CSQA 3RLFA 4KI0A 1EFWA 3KFUA 5K36G 3CCRA 2UU9L 1A63A 3H0GH 4UP8A 3S16H 4DNIA 4Y52H 2HIVA 4DR5Q 4RMFA 4GOPA 3M4PA 4JI0Q 2ZTEA 4YCWA 3M4OH 1CKMA 4BBRG 4GN4B 1MKHA 3RLOA 4A3IG 3PUXA 5C0XG 2N49A 4QJFA 4DR5L 1NE3A 4UPAA 5IYDG 4JI0L 1MJCA 2RF4A 4P72A 3UDIA 5C4XG 3HKZG 3E0EA 4LFAL 3AFPA 4A3DG 4JI6Q 5IWAQ 3I55A 3F2DA 3W5OA 2JA6G 2BH8A 4WJ3M 4X64Q 4DUZQ 1RIPA 5IWAL 3H15A 1HNXL 4B3SQ 2QGQA 4JI6L 2MO1A 1Q7YC 3M9BA 4A4IA 4C3JH 1L2FA 4DPGA 1XMQQ 2OWOA 3I4NH 3CQZH 3ULLA 1VQLA 1WCMG 1CKNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L0O A;  3AYH B;  4DUZ L;  3JAM i;  1A8V A;  1OTC A;  2RCN A;  2IHF A;  3TS2 A;  3A5Z B;  5GQO A;  1GD7 A;  1YJN A;  4BA2 I;  3TEH B;  4APV A;  2Z6K C;  4X62 Q;  2WAQ G;  3K8A A;  2NN6 G;  3KOJ A;  3HOW H;  1W3S A;  2GVA A;  2R93 H;  4R4T A;  4KLK A;  1PV4 A;  3A5U A;  1V1Q A;  4DUY L;  2VUM H;  1PH4 A;  1TWH H;  1HNZ Q;  4A3L G;  1M90 C;  2BH2 A;  1Q81 C;  2JK8 A;  5ELO A;  3HOY G;  4DR4 Q;  3SGI A;  1GVP A;  3EN2 A;  3JC6 6;  5HGQ A;  3M85 A;  3Q8D A;  1PYS B;  1PHJ A;  1BKB A;  5JJL A;  2NVQ H;  1SE8 A;  4A3J G;  1VQ5 A;  2LSS A;  2QEX A;  3UDG A;  2AKW B;  2EIF A;  4IFD G;  3CCV A;  4PG3 A;  1EIY B;  4LF9 L;  2AMC B;  4BBS H;  1IBK Q;  3S1Q H;  2JA9 A;  1E3P A;  1OXT A;  1XPU A;  2HT1 A;  1TWA H;  1I3Q H;  4C3H H;  3RN5 A;  4LFC Q;  2UUC Q;  2F4V L;  1FVI A;  1QZG A;  1Q8K A;  4DKA C;  4JI8 Q;  1Q12 A;  2KBN A;  3GTP H;  4MZ9 A;  1I94 L;  4GN3 B;  4BA1 I;  1JJG A;  2JA7 G;  2YTY A;  3OYY A;  4NXN Q;  2ZTD A;  2CWA A;  4JI1 Q;  4LF6 Q;  2YYZ A;  4IPG A;  3UDX A;  3W1B A;  4C2M H;  4JI8 L;  3ER0 A;  1K8G A;  3S1M H;  4JBJ A;  4DV0 Q;  1X55 A;  4JV5 L;  1Y14 B;  2ATW A;  3NBH B;  1IXR A;  4A75 A;  2R7Z G;  4A3C H;  4AH6 A;  3HKZ E;  4JI1 L;  4NB3 A;  1N33 Q;  4DK3 C;  3HKS A;  1UE5 A;  1YHQ A;  4JOI A;  1N9W A;  1VQ4 A;  5FJ8 G;  1NMG A;  2IX0 A;  3FKI G;  1VQJ A;  2YTX A;  1YIT A;  3H3V I;  3S1N H;  2VL6 A;  3L2P A;  1EQQ A;  3S2H H;  1N33 L;  4JI5 L;  3K7U C;  4LFB L;  3CCE A;  4QY7 A;  4FDB A;  4R1J A;  4DR6 L;  4A3M G;  1Y1V H;  4IPD A;  4JCV E;  3STB C;  3DLL A;  1KIX A;  2KCM A;  2KHJ A;  1YJW A;  1KC8 C;  1B7Y B;  1GO3 E;  2D0P A;  5C3E H;  3OTO Q;  4NXM L;  2B63 H;  4AQY Q;  1NTG A;  4BY1 G;  3RZO H;  4JYA Q;  1SRO A;  5AJ3 Q;  3ULP A;  2E2I H;  1G51 A;  3IRB A;  1WYD A;  1SMX A;  1HZ9 A;  4DR2 Q;  3S24 A;  1XNR L;  4JYA L;  4LUV A;  5LMU Q;  1Q46 A;  4BBR H;  4RG1 A;  5AJ3 L;  3A74 A;  1KQS A;  2RHQ B;  4MTN A;  1C9O A;  2ZJR A;  3OW2 A;  4DR2 L;  5IYD H;  1PH5 A;  1PH6 A;  3UDF A;  1LUZ A;  5ELN A;  1E7Z A;  4YY3 Q;  5LMU L;  2UUA Q;  4J15 A;  2YV5 A;  3AEV A;  5C4X H;  1VQ8 A;  4A3D H;  4IFD I;  1G29 1;  3GO5 A;  4IOC A;  2PQA B;  4R4C A;  1LM0 A;  5E7N A;  4BY7 G;  1IL2 A;  3PGZ A;  1SR3 A;  2BA0 A;  4YY3 L;  1IBL L;  2UUA L;  2ASB A;  2R92 H;  4YCU A;  3CW2 C;  5GAH C;  3H3V H;  1GM5 A;  4OXP A;  2YTV A;  3ERS X;  3RN2 A;  4JI4 L;  1M1K C;  4OX9 Q;  3I2Z A;  5IP9 G;  5FLM G;  4HJ5 A;  1D8L A;  2NVT H;  3BJU A;  5M5W H;  5LMN L;  2H5X A;  3UE1 A;  3S14 H;  1WCM H;  4LWC A;  2C35 B;  4A3E H;  3PSI A;  1AH9 A;  1L1O C;  4OX9 L;  4Y7N H;  1CKN A;  2MQH A;  1E1T A;  1CSP A;  1SRU A;  1UEB A;  1EOV A;  4JI7 L;  4POG A;  1QVF A;  2LXK A;  1Z9F A;  1YBY A;  1N8R C;  1HJP A;  1OXU A;  4YHH L;  2ID0 A;  3HOY H;  4POF A;  1HR0 L;  1VQE A;  4ALP A;  4LFA Q;  3PIO A;  4A3K H;  1LTL A;  4IO9 A;  1N36 L;  1PH2 A;  4OO1 G;  4JBW A;  1HH2 P;  4GLA C;  5C44 G;  1Y1W H;  3HOV H;  2WB1 E;  5J3B A;  1VQA A;  3VDY A;  1Q1E A;  4OON A;  1IZ6 A;  1HNX Q;  2MO0 A;  1FL0 A;  1L1O B;  5DLQ E;  4JI3 L;  5M3M G;  2E5L Q;  2GVB A;  2WP8 J;  1MIU A;  1YI2 A;  1XPO A;  1C7Y A;  2VNU D;  4A93 H;  1B8A A;  1X9N A;  3EBE A;  3FP9 A;  2Q2T A;  1VQN A;  1X6O A;  3J7Z C;  1XJV A;  2JA8 G;  4DV6 L;  2VZA A;  5C4J H;  2E5L L;  4LUZ A;  1IYJ B;  2JA7 H;  2E2J H;  4DUY Q;  1I5F A;  4AIM A;  4A3B G;  3HOZ H;  1PYB A;  4GOP C;  3DM3 A;  2AHO B;  3RLN A;  2JEA I;  3HOX H;  2HHH L;  1VQH A;  2PI2 E;  2AWN A;  2AWO A;  3G48 A;  4QL5 A;  2FXQ A;  4JC0 A;  4QIW E;  3CCL A;  3PO3 G;  3MEF A;  2ES2 A;  4DV5 L;  2UXC L;  3CCS A;  1H95 A;  3GDE A;  5FJ8 H;  4HJ7 A;  1X3G A;  3F2B A;  3M7N A;  2ZJP A;  3F8T A;  4K0K L;  2ZJQ A;  4LF9 Q;  3CAM A;  3PO2 H;  3K7A H;  4X66 Q;  2UXD Q;  1TWC H;  3HFZ B;  2VW9 A;  2CWP A;  4UP7 A;  3J80 c;  1PH9 A;  5LMN W;  2JA5 G;  4PZ8 A;  1W2B A;  2F4V Q;  5IYC H;  4DV2 Q;  3CCM A;  4BXX H;  2K5H A;  4A3F G;  1A62 A;  2VQF L;  4X65 L;  4X66 L;  3TRZ A;  2UXD L;  1JT8 A;  4R4Q A;  1FJG Q;  1I94 Q;  1YJ9 A;  1KD1 C;  4B3M Q;  1PH1 A;  1T9H A;  1TWF H;  3I4M G;  4DV2 L;  3GTJ H;  4GKJ Q;  1L0W A;  3PF4 A;  5BR8 Q;  1FJG L;  2N8N A;  4TVA B;  4JV5 Q;  5C0X I;  1NJI C;  4HJ8 A;  5GAE C;  4B3M L;  3TS0 A;  4GN5 A;  2OTL A;  3KLW A;  1HR0 W;  1SLJ A;  4GKJ L;  2Y0S G;  5IY0 A;  5BR8 L;  3I56 A;  1P16 A;  1HZA A;  3PUV A;  1O7I A;  4LUO A;  3I4O A;  2E8G A;  2ZTC A;  3CMA A;  3TQY A;  4JI5 Q;  2JJQ A;  3U58 A;  2K4K A;  1WI5 A;  1BBU A;  4YWK A;  4LFB Q;  3U50 C;  2K5V A;  3GD7 A;  1K9M C;  1V43 A;  2PQA A;  4JBM A;  3GTM H;  4DR6 Q;  4DR3 Q;  3KJP A;  2CCZ A;  4EX5 A;  3KF8 B;  4TQU S;  3NEM A;  1NMF A;  3LGJ A;  3AQQ A;  1B70 B;  4DK6 C;  4NXM Q;  2B3G A;  1EIF A;  2JEB I;  4IJH A;  4DR3 L;  4A3G H;  2HIX A;  4GKK Q;  3I7F A;  4LF8 L;  3KDF B;  3GTO H;  3PUW A;  2K50 A;  3CCU A;  1XNR Q;  2GN5 A;  1VQF A;  2NN6 I;  3HOW G;  2KHI A;  2OQK A;  1QUQ B;  2WAQ E;  4WJ4 A;  2D62 A;  4GKK L;  1X65 A;  4DV7 Q;  2OTJ A;  3UE0 A;  5IYB G;  5FLX c;  1WOC A;  1E24 A;  4HIM A;  4PMW A;  4X6A H;  3F1Z A;  4A3I H;  5JJI A;  3ZJY C;  5JJK A;  3J80 i;  4DV7 L;  1VQ7 A;  4HIK A;  1VCI A;  3CC7 A;  1JJC B;  5C44 H;  1IBL Q;  4LNQ A;  1NY4 A;  2MNA A;  4IPC A;  4L5S A;  1KXL A;  4JI4 Q;  4XTC S;  1KRT A;  3K81 C;  1S3O A;  4R4O A;  4BBS G;  3PCO B;  2NVX H;  3KYH C;  3L7Z C;  5LMN Q;  2JA6 H;  2EXD A;  4L5Q A;  1XTD A;  1L1O A;  3K0X A;  3PUY A;  1JE5 A;  3RZD H;  1J6Q A;  2IX1 A;  5HY6 A;  1CKO A;  4JI7 Q;  2ALY B;  4MNO A;  5EAY A;  2A19 A;  1HZC A;  5JEA J;  3S1R H;  4C3I H;  1EWI A;  4YHH Q;  4ME3 A;  1YHB A;  4PZ7 A;  4JI2 Q;  2L15 A;  2NVY H;  5GAD C;  1HR0 Q;  3PV0 A;  4A3C G;  4GS3 A;  4DAY B;  2V1C C;  3KJO A;  1N36 Q;  1YIJ A;  3PO3 H;  2UXB L;  2NZH A;  4A3L H;  1FGU A;  2K52 A;  1KRS A;  2Q2U A;  3CF5 A;  4JI2 L;  4GNX C;  3TRE A;  1UE7 A;  5GAG C;  2XGT A;  1TWG H;  4JI3 Q;  2IT1 A;  5C0X J;  4KHP L;  2R7D A;  1P8L A;  4O0A A;  1AE3 A;  1U0L A;  1Y1V G;  2MFI A;  4A3J H;  1S40 A;  3S2D H;  4B3R Q;  3U4V A;  1VQO A;  3PIP A;  1PH8 A;  4DV6 Q;  2A8V A;  5C3E G;  4YCV A;  4DV4 Q;  1KHI A;  2PMZ E;  2B63 G;  2YU9 H;  4B3R L;  4LF7 L;  1QVC A;  4LF5 Q;  3K80 C;  2I5L X;  3NEN A;  4P74 A;  3I4M H;  2KEN A;  3D31 A;  2Z6K A;  1K83 H;  1Q86 C;  4DV4 L;  2XTI A;  3S15 H;  3EIV A;  5H1S E;  2CKZ B;  2HHH Q;  1U5K A;  2I5M X;  2OQ0 A;  4P71 A;  5IP7 G;  4GNX B;  3PF5 A;  1JMC A;  1VQK A;  4GLX A;  2OCE A;  4DV5 Q;  2Q2I A;  1KAW A;  3CXC A;  1VQP A;  1GKH A;  4P73 A;  3U4Z A;  3BU2 A;  2WFW A;  2UXC Q;  2R7Z H;  3ICE A;  1X56 A;  4B3T Q;  3KF6 B;  1ASY A;  1K73 C;  2PI2 A;  2CQO A;  4K0K Q;  3CD6 A;  4LF4 Q;  3E9I A;  1QVG A;  2R92 G;  1VQC A;  3FKI H;  3ULJ A;  4B3T L;  2BA1 A;  1VQ6 A;  3A0J A;  1E1O A;  3E9H A;  5M3F G;  4LF4 L;  2VQF Q;  4X65 Q;  3CCJ A;  2DUD A;  1YEZ A;  4A3E G;  1XPR A;  4A3M H;  4LF5 L;  4X64 L;  4B3S L;  3RR5 A;  1XMQ L;  1VQI A;  4JG2 A;  3J81 j;  2VQE Q;  4IFD J;  1K8A C;  3S17 H;  3B6Y A;  4GOP B;  4BY1 H;  3H0G G;  3KDF A;  1PH3 A;  2N78 A;  3W1G A;  1YZ6 A;  5IYB H;  2VQE L;  1I6H H;  4X62 L;  1SN8 A;  1YHA A;  1KL9 A;  1QUQ A;  1RL2 A;  4O2D A;  5M5X H;  3F2C A;  1PH7 A;  1N34 Q;  1MJE A;  3PUZ A;  1A0I A;  4NPS A;  1E22 A;  1WJJ A;  4A3K G;  3HOU G;  1QZH A;  4OO1 I;  4QGU A;  1HNZ L;  2E2H H;  1EYG A;  1VS0 A;  2HQL A;  3G4S A;  4HJ9 A;  1Y1W G;  3HOU H;  3HOV G;  4DR4 L;  2I5H A;  4OWT B;  3STB D;  3WWV A;  1N34 L;  3CPF A;  4JBK A;  4HJA A;  2IY5 B;  2ZM6 Q;  1UE6 A;  1UE1 A;  5M5Y H;  3CPW A;  4BY7 H;  4DAM A;  4PZ6 A;  1PVO A;  3BZC A;  2K75 A;  1OXX K;  1K3R A;  2PNH A;  3CP0 A;  1X3E A;  4UP9 A;  4A93 G;  1D7Q A;  2IHE A;  2ZM6 L;  3CC4 A;  2R7F A;  4HIO A;  1C0A A;  4LF8 Q;  5FLM H;  5IP9 H;  3I4N G;  1VQD A;  2K5N A;  4H02 A;  4DR1 Q;  4L5R C;  1IBK L;  2N3S A;  3GTG H;  4AYB G;  1EUJ A;  4R4I A;  4QQB X;  1OXS C;  1CUK A;  4LFC L;  3J7A 5;  2UUC L;  3CME A;  5IE8 A;  3HOZ G;  4DR1 L;  1X3F A;  2JE6 I;  2DGY A;  1HZB A;  2NZO A;  4YWM A;  1S72 A;  1Q1B A;  3HOX G;  2R93 G;  4KHZ A;  1LYL A;  4NXN L;  2VUM G;  1YNX A;  2VS1 A;  3J81 c;  3GTQ H;  1K0R A;  4LF6 L;  4DV1 Q;  4DV0 L;  3GTK H;  4EQ5 A;  3CCQ A;  1BVS A;  1Q82 C;  4LW1 A;  2UUB Q;  2I0Q A;  2WB1 G;  3PO2 G;  3D0F A;  4DV1 L;  1HNW Q;  3GTL H;  3AFQ A;  1I50 H;  4JOI C;  4IPH A;  1XMO Q;  1SFO H;  1N32 Q;  5IYC G;  2D0O A;  4YWL A;  1JB7 A;  1PFS A;  5GRO A;  2UUB L;  4OWW B;  1TXY A;  4BXX G;  5M3M H;  1HNW L;  2RHS B;  4IJL A;  1BBW A;  4GLV B;  1WFQ A;  2Q2H A;  3G6E A;  2CFM A;  3T1Y Q;  1XMO L;  1Z47 A;  1PA6 A;  4DR7 Q;  2VY3 A;  2F3I A;  2JA8 H;  1N32 L;  4UY8 C;  1EQR A;  2K14 A;  1X54 A;  3OTO L;  2QA4 A;  2B29 A;  4AQY L;  4OWX B;  3NEL A;  4L5T A;  3T1Y L;  1V9P A;  5IP7 H;  4DV3 Q;  3M3Y H;  4DR7 L;  2UXB Q;  2KCT A;  4A3B H;  1VQG A;  1NBW A;  2A1A A;  4GNX A;  1G6P A;  3RNU A;  1VQM A;  3JAM c;  2Y0S E;  3MXN B;  4DV3 L;  1R9T H;  1XNQ Q;  4IOA A;  3CC2 A;  1J5E Q;  1VQB A;  4KHP Q;  3KF6 A;  2LXJ A;  3M4Q A;  1UWV A;  3G71 A;  4A76 A;  3T1H Q;  1JJ2 A;  2EQS A;  1XNQ L;  1AE2 A;  1IBM Q;  3BZK A;  5M3F H;  1DGS A;  1J5E L;  2F52 A;  4XIG S;  4HID A;  1VQ9 A;  3FHW A;  2R6G A;  2JQO A;  4P75 A;  5JEA G;  1OXV A;  2UU9 Q;  4LF7 Q;  4A3G G;  2Z0S A;  5IT9 c;  4AYB E;  3T1H L;  1YVC A;  2JA5 H;  3J81 i;  1IBM L;  1ASZ A;  4A3F H;  1CSQ A;  3RLF A;  4KI0 A;  1EFW A;  3KFU A;  5K36 G;  3CCR A;  2UU9 L;  1A63 A;  3H0G H;  4UP8 A;  3S16 H;  4DNI A;  4Y52 H;  2HIV A;  4DR5 Q;  4RMF A;  4GOP A;  3M4P A;  4JI0 Q;  2ZTE A;  4YCW A;  3M4O H;  1CKM A;  4BBR G;  4GN4 B;  1MKH A;  3RLO A;  4A3I G;  3PUX A;  5C0X G;  2N49 A;  4QJF A;  4DR5 L;  1NE3 A;  4UPA A;  5IYD G;  4JI0 L;  1MJC A;  2RF4 A;  4P72 A;  3UDI A;  5C4X G;  3HKZ G;  3E0E A;  4LFA L;  3AFP A;  4A3D G;  4JI6 Q;  5IWA Q;  3I55 A;  3F2D A;  3W5O A;  2JA6 G;  2BH8 A;  4WJ3 M;  4X64 Q;  4DUZ Q;  1RIP A;  5IWA L;  3H15 A;  1HNX L;  4B3S Q;  2QGQ A;  4JI6 L;  2MO1 A;  1Q7Y C;  3M9B A;  4A4I A;  4C3J H;  1L2F A;  4DPG A;  1XMQ Q;  2OWO A;  3I4N H;  3CQZ H;  3ULL A;  1VQL A;  1WCM G;  1CKN B; 
#chains in the Genus database with same CATH topology
 3OWF A;  3QWN A;  1A8V A;  3TS2 A;  1YJN A;  1GD7 A;  2A74 C;  4DAP A;  3KOJ A;  4CKB A;  5LL6 X;  3A5U A;  4DUY L;  4IQZ A;  3M7G A;  4A3L G;  3BVM A;  2BH2 A;  2JK8 A;  3BDC A;  5ELO A;  4CJ0 B;  2F0M A;  3DWQ A;  5HGQ A;  1EIG A;  1PYS B;  1PHJ A;  2DJG C;  4B9W A;  2LSS A;  2QEX A;  3CCV A;  1EIY B;  4LF9 L;  2AMC B;  4BBS H;  1STE A;  1E3P A;  2HT1 A;  5CC4 A;  4I65 A;  2V4D A;  1Q8K A;  1B44 D;  4DKA C;  4JW0 A;  1EFI D;  2KBN A;  1QWY A;  1DXM A;  2B8F A;  1JJG A;  3OYY A;  1A3V A;  1QCB D;  3C1E A;  4IPG A;  3W1B A;  3S1M H;  4X3S A;  3S1M B;  1X55 A;  4QIW B;  2ATW A;  1IXR A;  2KCC A;  1CZG A;  4AH6 A;  1BXT A;  1W6K A;  3HKZ E;  4JI1 L;  3HKS A;  2WII B;  5I6Y A;  1NMG A;  2HDM A;  2YTX A;  1EYD A;  2B2U A;  3S2H H;  1B50 A;  4JI5 L;  3K7U C;  3MTS A;  2B2Y A;  3CCE A;  4QY7 A;  4A3M G;  4A3G B;  2KHJ A;  4FF2 A;  1EEF D;  1B7Y B;  1GO3 E;  2D0P A;  3OTO Q;  2B63 H;  3IKJ A;  5AJ3 Q;  2A68 C;  1G2T A;  4K6D A;  1WD0 A;  2PCF B;  3I91 A;  4LUV A;  4ZLT F;  1KQS A;  3A74 A;  4MTN A;  3OW2 A;  4DR2 L;  1E7Z A;  2UUA Q;  1CK1 A;  5C4X H;  1VQ8 A;  3ND8 A;  4A3D H;  4A3D B;  5C4X B;  3GO5 A;  4IOC A;  1LM0 A;  1HHV A;  2PZW A;  1B3Q A;  2BA0 A;  2NVX B;  2ASB A;  3NTK A;  4YCU A;  2JA6 B;  2R92 H;  3R3O A;  4OXP A;  2YTV A;  3ERS X;  1CQF A;  4OX9 Q;  2C5C A;  4FF1 A;  1NSN S;  3BJU A;  4C1N I;  5LMN L;  3S14 H;  4A3E H;  1RKN A;  1LTT D;  5EJW A;  1QOH A;  4HSP A;  3S1R B;  2MQH A;  4L8J A;  4J6H A;  1SRU A;  4JI7 L;  4POG A;  4O42 A;  2OEO A;  1PZI D;  2GA4 B;  1IW7 C;  1OXU A;  1ENC A;  2OXP A;  5ELC A;  4KY5 A;  1VQE A;  4RFB A;  1IYV A;  1O7L A;  2EYH A;  4GLA C;  5K5P A;  5C44 G;  3L3O C;  2F0G A;  4K8J A;  4I7A A;  1C8C A;  1KTK A;  1IZ6 A;  4IFD H;  4RH6 A;  5M3M G;  2HCI A;  1MIU A;  2A73 B;  1YI2 A;  4K5X A;  4RCO A;  5FO8 B;  3O13 A;  4C1N K;  1XJV A;  2KHS A;  2E5L L;  4LUZ A;  2BCO A;  2BE5 D;  5C3W A;  4DUY Q;  1I5F A;  3HOZ H;  3HOZ B;  2RA4 A;  1F77 A;  2JEA I;  2ENB A;  3G48 A;  4KN7 C;  2AWO A;  3T53 B;  4DA2 A;  4JC0 A;  4QIW E;  4QCL A;  4NKL A;  2PZT A;  1O7Z A;  3GDE A;  1X3G A;  2BDN A;  2ZJQ A;  4LF9 Q;  3T16 A;  3PO2 H;  3PO2 B;  1WD1 A;  2E76 C;  2VW9 A;  3OPO A;  3QIA A;  4XQQ A;  1PMR A;  2BDO A;  2F0O A;  2PMZ B;  3J81 E;  4BXX H;  1A62 A;  4X65 L;  1QJO A;  1PH1 A;  1T9H A;  3FPU B;  3DM1 A;  3OW7 A;  1I4X A;  3QJY A;  3D8G A;  1DCZ A;  5IGB A;  3PF4 A;  4TVA B;  2PW5 A;  5GAE C;  1IL8 A;  1QNU A;  1JWM D;  5DM6 3;  3KLS X;  2MGS A;  5BR8 L;  4WRD A;  1Y69 U;  3HOU B;  1RJT A;  2PZU A;  3OSO A;  2E8G A;  4HMJ A;  2F1M A;  4JI5 Q;  1WI5 A;  3CRL C;  3GD7 A;  2PQA A;  4LJZ C;  3DWA A;  1B70 B;  2B3G A;  1EIF A;  2JEB I;  3UI2 A;  1ROD A;  3JAM E;  3I7F A;  4LF8 L;  3CCU A;  1VQF A;  2NN6 I;  3VYT A;  4IUT A;  3HOW G;  1QE6 A;  1TS5 A;  1QUQ B;  3X3N A;  1GUT A;  4WJ4 A;  1JOQ A;  2OTJ A;  5FLX c;  1QB5 D;  1WOC A;  1E24 A;  4PMW A;  2FHT A;  4A3I H;  1K28 A;  4A3I B;  5C0X H;  1U4L A;  3J80 i;  4ME5 A;  4HIK A;  1BQQ T;  2FIN B;  1KXL A;  3KBG A;  2B2U C;  1KRT A;  3K81 C;  3PCO B;  2FJ2 A;  3L7Z C;  5LMN Q;  2B2Y C;  4M1U B;  2JN4 A;  4C3H G;  1L1O A;  3K59 A;  1JE5 A;  3NPP A;  1EY8 A;  3RZD H;  3RZD B;  1TY0 A;  2IX1 A;  2NZ1 D;  4JI7 Q;  2ALY B;  4N9P A;  2WAC A;  2A19 A;  1HZC A;  2LFN A;  3TP5 A;  2SNS A;  2A6H D;  2RSO A;  4K5V A;  4PQX A;  5D65 A;  4JI2 Q;  2L15 A;  2NVY H;  4A3C G;  3PV0 A;  3KJO A;  3I70 A;  4A3L H;  1FGU A;  2PNR C;  5G3L D;  4U68 A;  4QF4 A;  1YNJ D;  3TN2 A;  1P8L A;  1S40 A;  3S2D H;  4B3R Q;  3U9S A;  2JA5 B;  4FXG C;  1J8I A;  2A8V A;  5C3E G;  4NDX A;  4YCV A;  2PMZ E;  2A5H A;  5CV9 A;  4LF7 L;  4DU9 A;  3K80 C;  5COY A;  2I5L X;  4P74 A;  1B3A A;  2Z6K A;  4WFN 3;  2TMP A;  1Q86 C;  3H91 A;  2ZXP A;  3EIV A;  5H1S E;  4LF5 L;  1U5K A;  2I5M X;  3I4L A;  3R93 A;  3OIQ A;  3PF5 A;  1VQK A;  1GHK A;  4GLX A;  2OCE A;  5JOB A;  1KAW A;  3T56 B;  3U4Z A;  3VR3 A;  2WFW A;  3ICE A;  5KNB A;  4HCS A;  4ZUI A;  1J9O A;  1TR5 A;  1Y8N B;  1QVG A;  1LT4 D;  4B3T L;  1SYD A;  4ODG A;  2PPB C;  4LF4 L;  4X65 Q;  1F9P A;  1XPR A;  4A3M H;  1V1O A;  4X64 L;  4UDU C;  4B3S L;  3RR5 A;  1XMQ L;  1DON A;  4MHE A;  1YNN D;  1BF4 A;  1PH3 A;  2N78 A;  5I2Y A;  1D5M C;  1A2U A;  1SN8 A;  2AUK A;  4HN7 A;  1KNE A;  1E22 A;  4A3K G;  2F0K A;  1TU2 B;  1LTR D;  1B4O A;  1EYG A;  1VS0 A;  3G4S A;  3BG3 A;  3J7A F;  3MXG A;  1UE1 A;  2F3W A;  3CPW A;  1ZYR C;  4KJN A;  2WV6 D;  3BZC A;  2IHE A;  2R3Z A;  4HIO A;  4LF8 Q;  1ET9 A;  3NSW A;  3I4N G;  2IL8 A;  1IBK L;  2N3S A;  1STH A;  5D3I B;  1CUK A;  4LFC L;  1R4P B;  3SVM A;  3J7A 5;  2ZXO A;  4YWM A;  1HZB A;  5IOC A;  1EU4 A;  5CV6 A;  4NXN L;  1K0R A;  1PZJ D;  3S1N B;  1BUV T;  2I0Q A;  3D0F A;  3GTL H;  1Y8P B;  1I50 H;  3AFQ A;  5KGU A;  1I50 B;  3GTL B;  2HCC A;  1PFM A;  1EQV A;  2L1B A;  1N32 Q;  2D0O A;  2UUB L;  5M3M H;  2Q2H A;  1XMO L;  2CFM A;  2Z4I A;  2F3I A;  1AZQ A;  1X54 A;  1C4Q A;  2B29 A;  4AQY L;  3J7Y W;  3NEL A;  1NBW A;  1SEB D;  4GNX A;  2F03 A;  3RNU A;  2L5T A;  3EVQ A;  4RCN A;  2KA7 A;  1R9T H;  2I07 B;  2F0E A;  4KMU C;  3CC2 A;  5A35 A;  1J5E Q;  1VQB A;  3KF6 A;  2LXJ A;  3G71 A;  1UWV A;  4RHS A;  2RCF A;  3T1H Q;  1AE2 A;  1IBM Q;  1VQ9 A;  1DGS A;  4HID A;  5M5W B;  2JQO A;  3D3R A;  1OXV A;  4LF7 Q;  4A3G G;  5C6A A;  2F3V A;  4AYB E;  3J81 i;  2XSC A;  1PTO C;  3RLF A;  3KFU A;  2IWH A;  3MFG A;  1GOZ A;  4HSV A;  3S16 H;  3S16 B;  2EYL A;  4Y52 H;  2F0Q A;  3CHB D;  3IL8 A;  4KKS A;  4QUF A;  3M4O H;  1F9Q A;  4YCW A;  3M4O B;  1CKM A;  1D6E C;  5ELE A;  5FO7 B;  5IGE A;  3PUX A;  4P2C B;  5I9O A;  4UPA A;  4JI0 L;  4RHR A;  4ZK9 B;  3HOV B;  5C4X G;  4LFA L;  4E6I A;  4A3D G;  3NWT A;  4FO2 A;  5IWA Q;  1EZ6 A;  2EY1 A;  2ZXR A;  3GP7 A;  5FKA C;  2JA6 G;  3IFT A;  3EA6 A;  4A93 B;  1GUW A;  4X64 Q;  4B3S Q;  5EKI A;  1XMQ Q;  5BN5 A;  2RDF A;  3CQZ H;  3ULL A;  3CQZ B;  1F9R A;  1TY2 A;  5C4Z A;  3AYH B;  4DUZ L;  3JAM i;  2E2J B;  1MGS A;  3MEH A;  1LTG D;  2Z6K C;  3H94 A;  3HOW H;  2Z9H A;  2GVA A;  3HOX B;  2R93 H;  2R93 B;  4MTK A;  1PV4 A;  1PH4 A;  1TWH H;  1TWH B;  1Z6H A;  1Q81 C;  2HD3 A;  1GVP A;  1RCV D;  1PRT D;  1CT1 D;  4FP5 D;  5JJL A;  1SE8 A;  5G3L F;  3UDG A;  2SDF A;  4IFD G;  5ELB A;  3BVG A;  1IBK Q;  3S1Q H;  1B9M A;  1D5Z C;  2N55 A;  1OXT A;  1TWA H;  4C3H H;  1TWA B;  4C3H B;  4LFC Q;  2JYO A;  2F4V L;  1FVI A;  1Q12 A;  3GTP H;  4BA1 I;  2YTY A;  4NXN Q;  2CHB D;  2YYZ A;  4C2M H;  4C2M B;  4JBJ A;  2QCP X;  2L4N A;  4A3C H;  4MN3 A;  4A75 A;  1A3U A;  1EQT A;  1TT2 A;  1N33 Q;  1ENA A;  1UE5 A;  3KUP A;  4H44 C;  4JOI A;  3MXN A;  1VQ4 A;  2EJM A;  2KOL A;  3L2P A;  1EQQ A;  4M8A A;  1DYQ A;  1TS3 A;  3NTI A;  2XNA C;  1M8A A;  4FDB A;  4R9W A;  4IPD A;  4EQO A;  2SNM A;  3STB C;  2VXW A;  5C3E H;  5C3E B;  3N6R A;  2EE1 A;  4F88 A;  4AQY Q;  4JYA Q;  2EYM A;  1WYD A;  1HTP A;  5HUR A;  3G7L A;  4BBR H;  4RG1 A;  1HCZ A;  4BBR B;  5AJ3 L;  3P7J A;  1SXT A;  2RHQ B;  2IX3 A;  4XT1 B;  1U4P A;  2ZJR A;  1RDP D;  2DJF C;  1PH6 A;  4FF3 A;  1LUZ A;  4YY3 Q;  3HOU G;  3OMC A;  5IGD A;  3DEP A;  3HKZ B;  1G29 1;  1ZXT A;  4IFD I;  4G7O C;  2PQA B;  4BY7 G;  4XQJ A;  3Q23 A;  1IBL L;  2UUA L;  1DOK A;  5GAH C;  5FLM G;  2MHV A;  4I7Z C;  2NVT H;  2NVT B;  1MHW C;  1SDF A;  3MHB A;  1WCM H;  1XTC D;  2C35 B;  1WCM B;  4BS9 A;  4OX9 L;  1CKN A;  1FNW A;  3VA7 A;  4DNR B;  1BO0 A;  1EOV A;  1QVF A;  1LTI D;  2LXK A;  5E4X A;  1YBY A;  3T13 A;  1DJR D;  1N8R C;  3SXH A;  1HJP A;  3FDT A;  4YHH L;  1HFG A;  5KIX A;  1HR0 L;  5FOB B;  4ALP A;  4LFA Q;  4A3K H;  4Q0F A;  1ZKO A;  1PH2 A;  4OO1 G;  4QB4 A;  1D1K A;  1Q1E A;  1S4Z A;  4OON A;  4EGV A;  2B39 A;  3I73 A;  2MO0 A;  1FL0 A;  1L1O B;  1U9R A;  1PTO H;  1ICW A;  1K0S A;  2VNU D;  3EBE A;  1X6O A;  4DV6 L;  3PQI A;  3C2P A;  1K83 B;  5C4J H;  5C4J B;  1V1P A;  1CTM A;  1F2M A;  1LAB A;  3S15 B;  1ML0 D;  4X3K A;  4AIM A;  5KYL A;  1JWU D;  5A2Q L;  3DM3 A;  2AHO B;  4EVO A;  3AU7 A;  1KDA A;  1SMY C;  3H6M A;  1HUN A;  1U4R A;  2HHH L;  2PI2 E;  2R7Z B;  4OHJ A;  4V19 0;  4DV5 L;  2SOB A;  1BR9 A;  2O2L D;  3FKI B;  4OEM B;  3F2B A;  1SYB A;  3E3X A;  1RF2 D;  3SK6 A;  1FNV A;  3K7A H;  3K7A B;  4X66 Q;  2UXD Q;  1TWC H;  1TWC B;  2CWP A;  4UP7 A;  3J80 c;  5LMN W;  2JA5 G;  5EKK A;  5NUC A;  2F4V Q;  4DV2 Q;  3L9A X;  3CCM A;  1F2Z A;  5J22 A;  1KD1 C;  4WOR A;  3HP3 A;  1I6H B;  1HFN A;  4CBV A;  5C0X I;  2EYO A;  2L55 A;  4GN5 A;  1B1Z A;  2OTL A;  2RQX A;  4KTA A;  1JB3 A;  4OEL B;  1HZA A;  1O7I A;  4LUO A;  3I4O A;  5T1I A;  3U58 A;  2B2T A;  2K4K A;  4R8N A;  4YWK A;  1FR3 A;  4JBM A;  4DR3 Q;  2CW0 D;  1EIH A;  4DK1 A;  4KV6 A;  1NAP A;  3AQQ A;  4MIU A;  4DK6 C;  3GTG B;  4A3G H;  4GKK Q;  1WTO A;  3GTO H;  3GTO B;  2K50 A;  3K57 A;  3VYS A;  2OQK A;  2D62 A;  3UE0 A;  4DAV A;  5JJI A;  2DY7 A;  1E2V A;  1JJC B;  1IBL Q;  3K5L A;  1ONL A;  4LNQ A;  1AFP A;  1NY4 A;  1PRT F;  1SFO B;  4XTC S;  1WTV A;  4NW2 A;  2NVX H;  2JA6 H;  1NUC A;  2EXD A;  4L5Q A;  1XTD A;  4KN4 C;  1KLU D;  1J6Q A;  2M2L A;  3H09 A;  1T5X D;  1CKO A;  2EZV A;  3S1R H;  4YHH Q;  4ME3 A;  1YHB A;  3DMU A;  1HR0 Q;  4GS3 A;  2K32 A;  5CV4 A;  2L11 A;  2V1C C;  4BWG B;  2UXB L;  3PO3 H;  3PO3 B;  2NZH A;  2K52 A;  4KKT A;  4JI2 L;  1O80 A;  3IAY A;  3T51 B;  2IT1 A;  5C0X J;  4KHP L;  5CV8 A;  2MFI A;  2BOS A;  1HPC A;  1LT3 D;  1PH8 A;  3PIP 3;  2QW7 A;  4DV6 Q;  2C9O A;  3K58 A;  4DV4 Q;  1KHI A;  1EEI D;  4ILW A;  1V8Q A;  4B3R L;  3TP6 A;  1WTR A;  2JXM B;  2XRS D;  2CKZ B;  2HHH Q;  1ENF A;  4GNX B;  3TZU A;  4DV5 Q;  4CDD C;  2Y0S B;  4P73 A;  3KF6 B;  1ASY A;  5DM7 3;  1T5E A;  5CV7 A;  2PI2 A;  1K73 C;  2CQO A;  1HA5 A;  2MP1 A;  2EVB A;  3E9I A;  1VQC A;  3K6O A;  2VB3 X;  3FRP B;  1NR4 A;  3NE5 B;  3E9H A;  3CCJ A;  1YEZ A;  5DEH A;  4G7H C;  1W6J A;  1VQI A;  2IPK D;  2J0T D;  1CHQ D;  2QF7 A;  3KDF A;  2Q8T A;  3E5S A;  1YZ6 A;  2EY2 A;  5JPN C;  4X62 L;  4O2D A;  1KL9 A;  3MA2 B;  1RL2 A;  1SNO A;  1MJE A;  1I6V C;  3Q24 A;  1WJJ A;  1KAA A;  3QR8 A;  4CDC C;  1ESR A;  2F0N A;  4QGU A;  2BE5 C;  3SE0 A;  3HOV G;  4HJ9 A;  3HOU H;  2F0D A;  4OWT B;  2EPB A;  1NCV A;  1UE6 A;  1SNC A;  4BY7 H;  4BY7 B;  3MZ5 A;  3A7A B;  1SBB B;  3CP0 A;  1OXX K;  3BYT B;  1D7Q A;  4A93 G;  1F2L A;  3KBX A;  4PV1 C;  1I3Q B;  3CC4 A;  3OWE B;  2R7F A;  5FLM H;  2NTT A;  2KEC A;  4H02 A;  4DR1 Q;  1DZ1 A;  3KK7 A;  4V0B A;  1JE4 A;  2CVR A;  3ND9 A;  1SYE A;  3CME A;  4CKC A;  1X3F A;  2JE6 I;  1S72 A;  3HOX G;  2R93 G;  2CH4 A;  2KJX A;  3VR2 A;  1YNX A;  3J81 c;  4LF6 L;  1MI2 A;  3VYR A;  3N52 A;  2D5D A;  1D5X C;  3CU7 A;  4DAY A;  5L37 A;  3NWS A;  1O78 A;  4DV0 L;  1PDQ A;  2MJ8 A;  4OO1 H;  4LW1 A;  1STG A;  1MD2 D;  1HA6 A;  2B2T C;  1CM9 A;  1HNW Q;  1G8Z D;  1STN A;  1Y1V B;  4DK0 A;  4OWW B;  1PFS A;  1TXY A;  3D6C A;  4RGM A;  4IJL A;  1I4P A;  3RZO B;  2ICI A;  1WFQ A;  4CKE A;  3H3V C;  1B53 A;  1Z47 A;  2VY3 A;  1N32 L;  3OMG A;  1EQR A;  2K14 A;  3MVV A;  5C4H A;  5IP7 H;  2UXB Q;  1VQG A;  3VA5 A;  3AB9 A;  1RD9 D;  1GUS A;  1H9S A;  2KVM A;  2WIN B;  2Y0S E;  3MXN B;  3JAM c;  1SE2 A;  3BDL A;  4TSS A;  2NUC A;  4XT3 B;  1WTP A;  4UAI A;  4KHP Q;  4GZY C;  1X3Q A;  1JJ2 A;  1EWC A;  3R8B A;  1J5E L;  5HGT A;  4XIG S;  1HTL D;  5JEA G;  1PZK D;  1CHP D;  2UU9 Q;  3BVZ A;  3T1H L;  2JA5 H;  1YVC A;  3E0J A;  1SNQ A;  1IBM L;  4Y7N B;  1CSQ A;  5K36 G;  4KI0 A;  4ZRZ A;  3CCR A;  3HGB A;  4DNI A;  4GOP A;  3URY A;  4BBR G;  5EBC A;  1EWH A;  2R61 A;  1UAP A;  2N49 A;  5TSS A;  2FMM A;  4QUC A;  1SJE D;  3A8K E;  4RA8 A;  5J39 A;  3HKZ G;  3E0E A;  4TRD A;  2A6H C;  3ITP A;  4JI6 Q;  2TSS A;  1QIL A;  3I55 A;  1BNZ A;  3AMU A;  3W5O A;  1HUM A;  1CA5 A;  2BH8 A;  4WJ3 M;  1RIP A;  5IWA L;  3M9B A;  2IW3 A;  4DPG A;  2OWO A;  2MPM A;  4HAE A;  1YNJ C;  1VQL A;  1WCM G;  1CKN B;  3RUZ A;  1X9N A;  4AYB B;  1EL0 A;  5GQO A;  4BA2 I;  2K33 A;  1QNK A;  4X62 Q;  5D14 A;  1W3S A;  2A69 D;  1LT6 D;  4R4T A;  1Y8O B;  2VUM H;  1V1Q A;  2VUM B;  1EYA A;  1II3 A;  2EYF A;  4EQP A;  2H1E A;  5EPJ A;  3FVQ A;  3Q8D A;  1BCP D;  4HR7 B;  2WB1 B;  1BKB A;  2NVQ H;  2NVQ B;  1VQ5 A;  2EIF A;  4H7B A;  4PG3 A;  1JCK B;  3SK4 A;  5CGK A;  3SR1 A;  1BDO A;  4HMI A;  1XPU A;  4ZKB B;  5FK9 C;  1V1P B;  5IT9 L;  1QZG A;  4JI8 Q;  1STY A;  2KCN A;  1I94 L;  1Z7T A;  2L12 A;  4GN3 B;  3C1F A;  4F8M A;  4LF6 Q;  3UDX A;  3ER0 A;  4DV0 Q;  1SAP A;  4JV5 L;  1Y14 B;  5EBD A;  2R7Z G;  1U4M A;  1YNN C;  4DK3 C;  4X3U A;  5EQ0 A;  1GUG A;  1BBX C;  3GTM B;  2IX0 A;  3FKI G;  1VQJ A;  1YIT A;  3S1N H;  5BN4 A;  2VL6 A;  3MXP A;  1N33 L;  5IOD A;  1NNX A;  1IKL A;  1VF7 A;  3G6J B;  4OIK A;  4LFB L;  2XN9 C;  4R1J A;  4DR6 L;  1ESF A;  3VR4 A;  3OHX C;  3WDN A;  2KCM A;  1YJW A;  1KC8 C;  3R2I A;  4J1M A;  2HUG A;  3F2U A;  1NTG A;  4BY1 G;  1G51 A;  3IRB A;  1HZ9 A;  4KY7 A;  3S24 A;  1XNR L;  3J7A V;  1EYC A;  4JYA L;  5LMU Q;  1Q46 A;  2K1B A;  2K01 A;  2LMC B;  1C9O A;  3UDF A;  4J15 A;  2CH4 W;  2NBF A;  4R4C A;  1IL2 A;  3NQT A;  3PGZ A;  4PMC A;  1SR3 A;  5LHY 1;  4YY3 L;  3CW2 C;  1B2T A;  3H3V H;  1GM5 A;  3GV6 A;  3RN2 A;  4JI4 L;  1PLF A;  1D8L A;  3V2T A;  5M5W H;  1D1I A;  3UE1 A;  4LWC A;  1H9R A;  1L1O C;  1ZEQ X;  3FMC A;  2B2W A;  5CBA E;  1Z9F A;  2QDL A;  3TME A;  3W3A A;  1K8M A;  4DF7 A;  2ID0 A;  3HOY H;  1LLR D;  3HOY B;  1B9N A;  1XYI A;  1TII D;  3PIO A;  1LTL A;  4IO9 A;  1N36 L;  1EY4 A;  4JBW A;  1UUP A;  1HH2 P;  1JQY D;  3HOV H;  2XWJ B;  2WB1 E;  3VDY A;  1VQA A;  3PMF A;  4A3J B;  4Q5V A;  4JI3 L;  4CJ2 C;  2GVB A;  1XPO A;  4A93 H;  1B8A A;  2Q2T A;  3J7Z C;  2M9V A;  2EYJ A;  3SDZ A;  3ZYY X;  4ZUJ A;  2JA7 H;  2E2J H;  2JA7 B;  4R8I A;  1PYB A;  4KY6 A;  4GOP C;  3P20 A;  3RLN A;  4ZKC B;  1O7Y A;  3HOX H;  2AWN A;  3NK9 A;  3EQL C;  2FXQ A;  3CCL A;  4J8Q A;  3PO3 G;  3DEO A;  3MEF A;  2FMC A;  3NBH A;  4KD3 A;  1H95 A;  5FJ8 H;  3HS0 C;  1L0Y B;  2ZJP A;  5AFW A;  3VYU A;  1W2B A;  2DN8 A;  3QB3 A;  5C5M A;  1GXD C;  4A3F G;  4X66 L;  4X3T A;  2UXD L;  1FJG Q;  4Z9C B;  1YJ9 A;  1I94 Q;  3S17 B;  2DNC A;  1PXU A;  3IFD A;  4B3M Q;  1TWF H;  5C3X A;  1TWF B;  2P5Z X;  4DV2 L;  5DNF A;  4GKJ Q;  1L0W A;  2F0L A;  5M5X B;  4HTH A;  4JV5 Q;  3NUC A;  1OO9 B;  3TS0 A;  1DM0 B;  3KLW A;  1HR0 W;  1JIC A;  3D4W A;  2Y0S G;  4UHV A;  5IY0 A;  2VB2 X;  1P16 A;  2Q8I B;  4C56 C;  3PUV A;  3LNN A;  2ZTC A;  2WKC A;  4L63 B;  1BBU A;  4LFB Q;  3U50 C;  1CA6 A;  2K5V A;  1K9M C;  1V43 A;  4DR6 Q;  3M4Y A;  3NEM A;  3LGJ A;  1PRT C;  5JEA H;  4DR3 L;  2HIX A;  3LWU A;  5KND A;  1KAB A;  1TKW B;  3KDF B;  2XRQ D;  1XNR Q;  2GN5 A;  5K36 H;  4O1N A;  5CYU A;  2A6E D;  1TS2 A;  2KQ3 A;  2WAQ E;  4GKK L;  3GTQ B;  4DV7 Q;  1PYW D;  4ID6 A;  5IIF A;  4HIM A;  4F7X A;  2DY8 A;  4B08 A;  4LAA A;  4X6A H;  1JOK A;  3ZJY C;  5E1F A;  5IT9 E;  1VQ7 A;  3CC7 A;  4G4K A;  3NQI A;  1BCP F;  4JI4 Q;  3DHQ A;  4RGT A;  4JVZ A;  2HQE A;  3HG9 A;  2SEB D;  3PUY A;  4DXF A;  1HXY D;  5I2X A;  5HY6 A;  5IGG A;  5J1Z A;  1GUO A;  2K7V A;  4MNO A;  4DGZ A;  5EAY A;  1JC7 A;  3GV3 A;  4C3I H;  1EWI A;  4C3I B;  3DWP A;  3DUZ A;  3OIP A;  4RGO S;  4A3B B;  3DXJ C;  4PZ7 A;  1VMC A;  4NP5 A;  4RGN A;  4DAY B;  1N36 Q;  1YIJ A;  1RTN A;  2N88 A;  2Q2U A;  4GNX C;  3PIO 3;  2O5J C;  1UE7 A;  1TWG H;  4JI3 Q;  1TWG B;  1IHZ A;  2R7D A;  1AE3 A;  1EY6 A;  1Y1V G;  2KED A;  3U4V A;  3TDQ A;  3PIP A;  4CGY B;  1TQO A;  1QVC A;  5KRU A;  3I4M H;  2KEN A;  3D31 A;  3I4M B;  1K83 H;  4DV4 L;  2XTI A;  3S15 H;  2B2W C;  4P71 A;  1JMC A;  5IP7 G;  3J81 L;  1H9S B;  4HCE A;  5FLX L;  2Q2I A;  1XXG A;  3CXC A;  1GKH A;  3BU2 A;  3V96 A;  2R7Z H;  4JPB W;  1A6X A;  3TP8 A;  3ERO A;  5CBE E;  1JR0 D;  1PTO F;  3FKI H;  3ULJ A;  2BA1 A;  4ZQ3 A;  1VQ6 A;  1E1O A;  1GHJ A;  1AZP A;  3HZX A;  1TVX A;  1LTS D;  1RHP A;  3KF8 A;  4IUU A;  4JG2 A;  2VQE Q;  5KEE A;  4CHT B;  4IFD J;  1K8A C;  3NHH A;  4GOP B;  4BY1 H;  4BY1 B;  3W1G A;  2OF1 A;  5ELD A;  5IYB H;  1I6H H;  2G9H D;  1PH7 A;  2QDB A;  1N34 Q;  3PUZ A;  1A0I A;  3JAM L;  1CQV A;  1QZH A;  4OO1 I;  1HNZ L;  2E2H H;  2E2H B;  5EPK A;  4LK1 C;  1Y1W G;  4DR4 L;  4DFA A;  4IAL A;  4N9T A;  3WWV A;  1I4Q A;  5BN3 A;  4HJA A;  2ZM6 Q;  4DAM A;  4PZ6 A;  4BBS B;  2F0U A;  1K3R A;  2PNH A;  4HED A;  2F4I A;  4UP9 A;  2A68 D;  3BYY B;  2F0H A;  5EPL A;  1VQD A;  4L5R C;  3OOC A;  1Q8I A;  4K8I A;  4R4I A;  4AYB G;  3GTG H;  4QQB X;  1G91 A;  4KK7 A;  3QG1 A;  2UUC L;  2F0S A;  2MUY A;  4KD4 A;  5IE8 A;  3K5M A;  4DR1 L;  2DGY A;  2NZO A;  1Q1B A;  5EKL A;  4KHZ A;  1LYL A;  3EJI A;  2B8G A;  2VUM G;  2EOT A;  2VS1 A;  3CKI B;  1EY5 A;  1SYG A;  5IGF A;  4DV1 Q;  3MXU A;  3D4D A;  4EQ5 A;  3TP7 A;  1WTW A;  1BVS A;  4RWS C;  3S2H B;  3K5O A;  2WB1 G;  4JOI C;  1PRT B;  4ZYS A;  3FPP A;  2FFK B;  4IUN A;  1SFO H;  5KNC A;  2J7Z A;  2O4X A;  3T4A C;  5IYC G;  1JB7 A;  3RMH A;  1HNW L;  2RHS B;  1AEX A;  1BBW A;  4GLV B;  2B63 B;  3QOJ A;  1FYC A;  3T1Y Q;  5T1G A;  1IW7 D;  2NTS A;  4ZCK A;  4DR7 Q;  1GJX A;  2CW0 C;  2QA4 A;  4OL7 A;  1SYC A;  4L5T A;  3V05 A;  3LX0 A;  5D3D A;  4DV3 Q;  4G7Z C;  3M3Y H;  3M3Y B;  2A1A A;  1G6P A;  3NP8 A;  1VQM A;  5CR3 A;  1RTO A;  2K5Q A;  3K5N A;  3BZD B;  1XNQ Q;  1WVL A;  4IOA A;  2R92 B;  3M4Q A;  4IN3 A;  2H4O A;  2EQS A;  5M3F H;  5M3F B;  3FHW A;  2R6G A;  4P75 A;  3S14 B;  3Q0A A;  4A3E B;  4K2K A;  2Z0S A;  1A3T A;  2K6A A;  2M00 A;  4FXK C;  1ASZ A;  4A3F H;  4A3F B;  3C46 A;  2UU9 L;  3H0G H;  3SEB A;  1K8O A;  3H0G B;  1E2W A;  2HIV A;  4DR5 Q;  3KLS A;  4RMF A;  1G6Z A;  3M4P A;  2ZTE A;  1JOO A;  1Q90 A;  1TS4 A;  2K04 A;  4GN4 B;  3RLO A;  1SSO A;  5E3F A;  1NE3 A;  1ET6 A;  5ISR A;  1Q3L A;  2RF4 A;  4P72 A;  4CJ1 B;  3AFP A;  4YIJ A;  5KYI A;  1STA A;  3A56 A;  4XYQ A;  1HNX L;  3H15 A;  4JI6 L;  2QGQ A;  1Q7Y C;  4A4I A;  1L2F A;  2G9D A;  1EY0 A;  3L0O A;  1OTC A;  2RCN A;  2IHF A;  2QEJ C;  3A5Z B;  3TEH B;  4APV A;  2WAQ G;  3K8A A;  2NN6 G;  4LMQ D;  2F0P A;  4KLK A;  4RKL A;  2LY7 A;  1HNZ Q;  1NR2 A;  1M90 C;  4DR4 Q;  3HOY G;  2QKI C;  2JSO A;  3EN2 A;  3SGI A;  3JC6 6;  3C3L A;  4ABN A;  1VDZ A;  1EY7 A;  3RD4 A;  3M85 A;  1LTB D;  1IYU A;  2E2D C;  4A3J G;  5JAV A;  3A8J E;  4IUV A;  2AKW B;  1S5F D;  5FLX E;  5A2Q E;  1JWS D;  2JA9 A;  2RSN A;  5IGC A;  1I3Q H;  3RN5 A;  2E74 C;  2UUC Q;  2PQE A;  1A15 A;  3E6Z X;  1AP0 A;  4MZ9 A;  2JA7 G;  2ZTD A;  2CWA A;  2F0I A;  4JI1 Q;  1K8G A;  4JI8 L;  2KEE A;  3NBH B;  4IUR A;  3WOF A;  3ERQ A;  4NB3 A;  4JK1 C;  1QG7 A;  1YHQ A;  1N9W A;  5FJ8 G;  3H3V I;  1Y1V H;  1H9K A;  2K5W A;  1F9S A;  3NXW A;  5F2D A;  4JCV E;  3DLL A;  1KIX A;  1F2Y A;  4RKB A;  4XQN A;  4NXM L;  3RZO H;  1CI3 M;  1SRO A;  3VR6 A;  3ULP A;  2E2I H;  2E2I B;  1S5D D;  1SMX A;  4DR2 Q;  2D9U A;  4CDF C;  2F0T A;  4N8X 1;  2RDH A;  5IYD H;  1PH5 A;  3Q22 A;  5ELN A;  5LMU L;  4DNT B;  2YV5 A;  3AEV A;  5E7N A;  1S5E D;  2XIW A;  1GUN A;  2CQA A;  4DXG A;  2EYP A;  1I4G A;  1M1K C;  3I2Z A;  5CV5 A;  5IP9 G;  4HJ5 A;  4N8F A;  5ELF A;  2H5X A;  4L6T B;  5CMD A;  3PSI A;  3I8Z A;  1AH9 A;  1MBY A;  3A54 A;  4Y7N H;  1E1T A;  1CSP A;  1UEB A;  2AQ3 B;  3GQB A;  2NVY B;  1JOR A;  1R4Q B;  4POF A;  2O5I C;  1DD2 A;  3U9O A;  3S9W A;  2AQ1 B;  1Y1W H;  1Y1W B;  5J3B A;  3S2D B;  1HNX Q;  2Z8L A;  5JJZ A;  1SNM A;  3A7L A;  5DLQ E;  3CRK C;  5LL6 S;  2E5L Q;  2WP8 J;  1C7Y A;  2PYK A;  3FP9 A;  1VQN A;  2JA8 G;  1LAC A;  2VZA A;  3SK8 A;  1IYJ B;  1A2T A;  1PFN A;  3FEW X;  2K5D A;  4C3I G;  4A3B G;  2L9H A;  1I4R A;  3BDO A;  2X6L A;  1KDC A;  4H13 C;  2EY6 A;  1X3P A;  1VQH A;  1ZYR D;  4QL5 A;  3MWY W;  2ES2 A;  1VF5 C;  2UXC L;  3CCS A;  4HJ7 A;  2DNE A;  3M7N A;  3D6W A;  2EJF C;  3F8T A;  4K0K L;  1AW7 A;  3CAM A;  2NWG A;  4U67 3;  1HQM C;  2B2V A;  1I4H A;  3P1H A;  3HFZ B;  4A3M B;  1PH9 A;  4PZ8 A;  5IYC H;  2K5H A;  3TRZ A;  2VQF L;  1JT8 A;  5M9O A;  4RAU C;  4R4Q A;  3I4M G;  2Q8R E;  4PNY A;  3GTJ H;  3GTJ B;  1XX8 A;  5BR8 Q;  3MFY A;  1FJG L;  2HDL A;  2N8N A;  1NJI C;  4B3M L;  4HJ8 A;  1SLJ A;  4GKJ L;  3I56 A;  2ZT9 C;  3MAQ A;  5C5L A;  2RBM A;  3A55 A;  1SYF A;  2A69 C;  3CMA A;  3TQY A;  2JJQ A;  4FNF A;  3GTM H;  3I3C A;  3KJP A;  2CCZ A;  1LT5 D;  4EX5 A;  4C3J G;  3KF8 B;  4TQU S;  1NMF A;  5DAU A;  3NBI A;  4NXM Q;  3QO2 A;  1BCP C;  4IJH A;  4FXD A;  2F0F A;  3BS1 A;  1LV9 A;  2RVL A;  3PUW A;  1ILP A;  1CZW A;  2KHI A;  1X65 A;  5IYB G;  3I90 A;  2EDG A;  2Z1C A;  2KUM A;  3F1Z A;  1C48 A;  5JJK A;  4OIJ A;  4DV7 L;  1VCI A;  4KJO A;  1VMP A;  4ZAI A;  1MSH A;  5C44 H;  3X3M A;  5C44 B;  4KKU A;  2MNA A;  4CDE C;  4IPC A;  4L5S A;  1PTO D;  5I4D A;  2K05 A;  1WTQ A;  1EU3 A;  4R4O A;  1S3O A;  4BBS G;  3KYH C;  5M3M B;  5JPM C;  2PO4 A;  2Z6B A;  3K0X A;  3J80 L;  1KNA A;  4IZ8 A;  4S3S A;  4B9X A;  4WJW A;  5JVG 3;  5COR A;  5JEA J;  1M4V A;  3TBI B;  2NN6 H;  2WAQ B;  1D2B A;  5GAD C;  1G2S A;  1MSG A;  1R9T B;  1K3B C;  3EFX D;  1KRS A;  1S5B D;  3CF5 A;  1LTA D;  3TRE A;  5GAG C;  2XGT A;  3HEJ A;  2OT2 A;  1WTX A;  4O0A A;  1U0L A;  4A3J H;  3HRZ C;  2G5D A;  1VQO A;  3P75 A;  2AQ2 B;  4XYO A;  3NTH A;  2LS0 1;  2B63 G;  5JVH 3;  4OGQ C;  4XXE A;  2YU9 H;  2Z4H A;  2YU9 B;  4LF5 Q;  3NEN A;  1L0X B;  5E4W C;  4K5W A;  1DOL A;  2OQ0 A;  1UNS A;  2J4X A;  2PW7 A;  2F0W A;  3A8I E;  4K6L A;  2UXC Q;  1VQP A;  1FNU A;  1X56 A;  4B3T Q;  4QMG A;  3I72 A;  4ULL A;  4K0K Q;  1FD7 D;  3CD6 A;  4LF4 Q;  4KHV A;  3SK5 A;  2R92 G;  4K2L A;  2D2C C;  3A0J A;  5M3F G;  2VQF Q;  1SE3 A;  2DUD A;  1H9M A;  1DOM A;  4A3E G;  2LKV A;  3J81 j;  4XDX A;  2F0V A;  3S17 H;  3B6Y A;  3HOW B;  2WKD A;  3H0G G;  1HQR D;  1SND A;  2VQE L;  2QIL A;  1YHA A;  5M5X H;  3F2C A;  1QUQ A;  4NPS A;  1KLG D;  4NMZ A;  1BOS A;  4FVM A;  2HQL A;  5EGT A;  2I5H A;  3STB D;  1N34 L;  3CPF A;  4JBK A;  2IY5 B;  5M5Y H;  5M5Y B;  1PVO A;  2K75 A;  1S5C D;  3S1Q B;  2AUJ D;  2B2V C;  1X3E A;  2ZM6 L;  1E2Z A;  3LWE A;  1C0A A;  5IP9 H;  2NB0 A;  2K5N A;  1EY9 A;  1SJH D;  1ILQ A;  1CFM A;  1EUJ A;  3GTP B;  4TKO B;  1OXS C;  3HOZ G;  1SNP A;  4IUP A;  1X32 A;  2XWB B;  3GTQ H;  2NYZ D;  2L0C A;  3R2T A;  3GTK H;  3GTK B;  3CCQ A;  4G57 A;  1Q82 C;  2UUB Q;  4PMB A;  2X6G A;  3PO2 G;  1AN8 A;  4DV1 L;  3WOE A;  4IPH A;  1XMO Q;  1BCP B;  4FYD A;  1XWE A;  4BXX G;  4YWL A;  5GRO A;  1E0B A;  4H0L C;  4FF4 A;  3G6E A;  2IJ0 A;  1PA6 A;  5I9P A;  1SE4 A;  2JA8 H;  4UY8 C;  2JA8 B;  1HRJ A;  3OTO L;  3K0Y A;  3ONA B;  2I46 A;  4OWX B;  3T1Y L;  3W2D A;  1V9P A;  4DR7 L;  1IKM A;  1UEA B;  5FO9 B;  2KCT A;  4A3B H;  4EQN A;  1WTH A;  1STB A;  3VR5 A;  3SHL A;  4DV3 L;  2A6E C;  3TSS A;  1H9J A;  3MC0 B;  2K28 A;  1ICF B;  4A76 A;  1EOT A;  2F0J A;  1KDB A;  1XNQ L;  3BZK A;  2F52 A;  2RDG A;  2EXZ A;  2ICE C;  5I6W A;  5IT9 c;  4F87 A;  3D4R A;  1EZ8 A;  1SMY D;  1LO5 D;  1EFW A;  3Q6S A;  2EJG C;  3TZD A;  1A63 A;  4UP8 A;  2XVS A;  4JI0 Q;  3QOL A;  2EY5 A;  4IUQ A;  1PFB A;  1MKH A;  4A3I G;  4DN4 M;  5C0X G;  4QJF A;  4DR5 L;  4A3K B;  3J80 E;  5IYD G;  2X69 A;  3KLR A;  1MJC A;  3UDI A;  1FGB D;  2K03 A;  2JP1 A;  2E75 C;  3F2D A;  1PTO B;  2RKS A;  4DUZ Q;  2MO1 A;  4C3J H;  3I4N H;  4K14 A;  4C3J B;  3I4N B; 
#chains in the Genus database with same CATH homology
 3L0O A;  3AYH B;  4DUZ L;  3JAM i;  1A8V A;  1OTC A;  2RCN A;  2IHF A;  3TS2 A;  3A5Z B;  5GQO A;  1GD7 A;  1YJN A;  4BA2 I;  3TEH B;  4APV A;  2Z6K C;  4X62 Q;  2WAQ G;  3K8A A;  2NN6 G;  3KOJ A;  3HOW H;  1W3S A;  2GVA A;  2R93 H;  4R4T A;  4KLK A;  1PV4 A;  3A5U A;  1V1Q A;  4DUY L;  2VUM H;  1PH4 A;  1TWH H;  1HNZ Q;  4A3L G;  1M90 C;  2BH2 A;  1Q81 C;  2JK8 A;  5ELO A;  3HOY G;  4DR4 Q;  3SGI A;  1GVP A;  3EN2 A;  3JC6 6;  5HGQ A;  3M85 A;  3Q8D A;  1PYS B;  1PHJ A;  1BKB A;  5JJL A;  2NVQ H;  1SE8 A;  4A3J G;  1VQ5 A;  2LSS A;  2QEX A;  3UDG A;  2AKW B;  2EIF A;  4IFD G;  3CCV A;  4PG3 A;  1EIY B;  4LF9 L;  2AMC B;  4BBS H;  1IBK Q;  3S1Q H;  2JA9 A;  1E3P A;  1OXT A;  1XPU A;  2HT1 A;  1TWA H;  1I3Q H;  4C3H H;  3RN5 A;  4LFC Q;  2UUC Q;  2F4V L;  1FVI A;  1QZG A;  1Q8K A;  4DKA C;  4JI8 Q;  1Q12 A;  2KBN A;  3GTP H;  4MZ9 A;  1I94 L;  4GN3 B;  4BA1 I;  1JJG A;  2JA7 G;  2YTY A;  3OYY A;  4NXN Q;  2ZTD A;  2CWA A;  4JI1 Q;  4LF6 Q;  2YYZ A;  4IPG A;  3UDX A;  3W1B A;  4C2M H;  4JI8 L;  3ER0 A;  1K8G A;  3S1M H;  4JBJ A;  4DV0 Q;  1X55 A;  4JV5 L;  1Y14 B;  2ATW A;  3NBH B;  1IXR A;  4A75 A;  2R7Z G;  4A3C H;  4AH6 A;  3HKZ E;  4JI1 L;  4NB3 A;  1N33 Q;  4DK3 C;  3HKS A;  1UE5 A;  1YHQ A;  4JOI A;  1N9W A;  1VQ4 A;  5FJ8 G;  1NMG A;  2IX0 A;  3FKI G;  1VQJ A;  2YTX A;  1YIT A;  3H3V I;  3S1N H;  2VL6 A;  3L2P A;  1EQQ A;  3S2H H;  1N33 L;  4JI5 L;  3K7U C;  4LFB L;  3CCE A;  4QY7 A;  4FDB A;  4R1J A;  4DR6 L;  4A3M G;  1Y1V H;  4IPD A;  4JCV E;  3STB C;  3DLL A;  1KIX A;  2KCM A;  2KHJ A;  1YJW A;  1KC8 C;  1B7Y B;  1GO3 E;  2D0P A;  5C3E H;  3OTO Q;  4NXM L;  2B63 H;  4AQY Q;  1NTG A;  4BY1 G;  3RZO H;  4JYA Q;  1SRO A;  5AJ3 Q;  3ULP A;  2E2I H;  1G51 A;  3IRB A;  1WYD A;  1SMX A;  1HZ9 A;  4DR2 Q;  3S24 A;  1XNR L;  4JYA L;  4LUV A;  5LMU Q;  1Q46 A;  4BBR H;  4RG1 A;  5AJ3 L;  3A74 A;  1KQS A;  2RHQ B;  4MTN A;  1C9O A;  2ZJR A;  3OW2 A;  4DR2 L;  5IYD H;  1PH5 A;  1PH6 A;  3UDF A;  1LUZ A;  5ELN A;  1E7Z A;  4YY3 Q;  5LMU L;  2UUA Q;  4J15 A;  2YV5 A;  3AEV A;  5C4X H;  1VQ8 A;  4A3D H;  4IFD I;  1G29 1;  3GO5 A;  4IOC A;  2PQA B;  4R4C A;  1LM0 A;  5E7N A;  4BY7 G;  1IL2 A;  3PGZ A;  1SR3 A;  2BA0 A;  4YY3 L;  1IBL L;  2UUA L;  2ASB A;  2R92 H;  4YCU A;  3CW2 C;  5GAH C;  3H3V H;  1GM5 A;  4OXP A;  2YTV A;  3ERS X;  3RN2 A;  4JI4 L;  1M1K C;  4OX9 Q;  3I2Z A;  5IP9 G;  5FLM G;  4HJ5 A;  1D8L A;  2NVT H;  3BJU A;  5M5W H;  5LMN L;  2H5X A;  3UE1 A;  3S14 H;  1WCM H;  4LWC A;  2C35 B;  4A3E H;  3PSI A;  1AH9 A;  1L1O C;  4OX9 L;  4Y7N H;  1CKN A;  2MQH A;  1E1T A;  1CSP A;  1SRU A;  1UEB A;  1EOV A;  4JI7 L;  4POG A;  1QVF A;  2LXK A;  1Z9F A;  1YBY A;  1N8R C;  1HJP A;  1OXU A;  4YHH L;  2ID0 A;  3HOY H;  4POF A;  1HR0 L;  1VQE A;  4ALP A;  4LFA Q;  3PIO A;  4A3K H;  1LTL A;  4IO9 A;  1N36 L;  1PH2 A;  4OO1 G;  4JBW A;  1HH2 P;  4GLA C;  5C44 G;  1Y1W H;  3HOV H;  2WB1 E;  5J3B A;  1VQA A;  3VDY A;  1Q1E A;  4OON A;  1IZ6 A;  1HNX Q;  2MO0 A;  1FL0 A;  1L1O B;  5DLQ E;  4JI3 L;  5M3M G;  2E5L Q;  2GVB A;  2WP8 J;  1MIU A;  1YI2 A;  1XPO A;  1C7Y A;  2VNU D;  4A93 H;  1B8A A;  1X9N A;  3EBE A;  3FP9 A;  2Q2T A;  1VQN A;  1X6O A;  3J7Z C;  1XJV A;  2JA8 G;  4DV6 L;  2VZA A;  5C4J H;  2E5L L;  4LUZ A;  1IYJ B;  2JA7 H;  2E2J H;  4DUY Q;  1I5F A;  4AIM A;  4A3B G;  3HOZ H;  1PYB A;  4GOP C;  3DM3 A;  2AHO B;  3RLN A;  2JEA I;  3HOX H;  2HHH L;  1VQH A;  2PI2 E;  2AWN A;  2AWO A;  3G48 A;  4QL5 A;  2FXQ A;  4JC0 A;  4QIW E;  3CCL A;  3PO3 G;  3MEF A;  2ES2 A;  4DV5 L;  2UXC L;  3CCS A;  1H95 A;  3GDE A;  5FJ8 H;  4HJ7 A;  1X3G A;  3F2B A;  3M7N A;  2ZJP A;  3F8T A;  4K0K L;  2ZJQ A;  4LF9 Q;  3CAM A;  3PO2 H;  3K7A H;  4X66 Q;  2UXD Q;  1TWC H;  3HFZ B;  2VW9 A;  2CWP A;  4UP7 A;  3J80 c;  1PH9 A;  5LMN W;  2JA5 G;  4PZ8 A;  1W2B A;  2F4V Q;  5IYC H;  4DV2 Q;  3CCM A;  4BXX H;  2K5H A;  4A3F G;  1A62 A;  2VQF L;  4X65 L;  4X66 L;  3TRZ A;  2UXD L;  1JT8 A;  4R4Q A;  1FJG Q;  1I94 Q;  1YJ9 A;  1KD1 C;  4B3M Q;  1PH1 A;  1T9H A;  1TWF H;  3I4M G;  4DV2 L;  3GTJ H;  4GKJ Q;  1L0W A;  3PF4 A;  5BR8 Q;  1FJG L;  2N8N A;  4TVA B;  4JV5 Q;  5C0X I;  1NJI C;  4HJ8 A;  5GAE C;  4B3M L;  3TS0 A;  4GN5 A;  2OTL A;  3KLW A;  1HR0 W;  1SLJ A;  4GKJ L;  2Y0S G;  5IY0 A;  5BR8 L;  3I56 A;  1P16 A;  1HZA A;  3PUV A;  1O7I A;  4LUO A;  3I4O A;  2E8G A;  2ZTC A;  3CMA A;  3TQY A;  4JI5 Q;  2JJQ A;  3U58 A;  2K4K A;  1WI5 A;  1BBU A;  4YWK A;  4LFB Q;  3U50 C;  2K5V A;  3GD7 A;  1K9M C;  1V43 A;  2PQA A;  4JBM A;  3GTM H;  4DR6 Q;  4DR3 Q;  3KJP A;  2CCZ A;  4EX5 A;  3KF8 B;  4TQU S;  3NEM A;  1NMF A;  3LGJ A;  3AQQ A;  1B70 B;  4DK6 C;  4NXM Q;  2B3G A;  1EIF A;  2JEB I;  4IJH A;  4DR3 L;  4A3G H;  2HIX A;  4GKK Q;  3I7F A;  4LF8 L;  3KDF B;  3GTO H;  3PUW A;  2K50 A;  3CCU A;  1XNR Q;  2GN5 A;  1VQF A;  2NN6 I;  3HOW G;  2KHI A;  2OQK A;  1QUQ B;  2WAQ E;  4WJ4 A;  2D62 A;  4GKK L;  1X65 A;  4DV7 Q;  2OTJ A;  3UE0 A;  5IYB G;  5FLX c;  1WOC A;  1E24 A;  4HIM A;  4PMW A;  4X6A H;  3F1Z A;  4A3I H;  5JJI A;  3ZJY C;  5JJK A;  3J80 i;  4DV7 L;  1VQ7 A;  4HIK A;  1VCI A;  3CC7 A;  1JJC B;  5C44 H;  1IBL Q;  4LNQ A;  1NY4 A;  2MNA A;  4IPC A;  4L5S A;  1KXL A;  4JI4 Q;  4XTC S;  1KRT A;  3K81 C;  1S3O A;  4R4O A;  4BBS G;  3PCO B;  2NVX H;  3KYH C;  3L7Z C;  5LMN Q;  2JA6 H;  2EXD A;  4L5Q A;  1XTD A;  1L1O A;  3K0X A;  3PUY A;  1JE5 A;  3RZD H;  1J6Q A;  2IX1 A;  5HY6 A;  1CKO A;  4JI7 Q;  2ALY B;  4MNO A;  5EAY A;  2A19 A;  1HZC A;  5JEA J;  3S1R H;  4C3I H;  1EWI A;  4YHH Q;  4ME3 A;  1YHB A;  4PZ7 A;  4JI2 Q;  2L15 A;  2NVY H;  5GAD C;  1HR0 Q;  3PV0 A;  4A3C G;  4GS3 A;  4DAY B;  2V1C C;  3KJO A;  1N36 Q;  1YIJ A;  3PO3 H;  2UXB L;  2NZH A;  4A3L H;  1FGU A;  2K52 A;  1KRS A;  2Q2U A;  3CF5 A;  4JI2 L;  4GNX C;  3TRE A;  1UE7 A;  5GAG C;  2XGT A;  1TWG H;  4JI3 Q;  2IT1 A;  5C0X J;  4KHP L;  2R7D A;  1P8L A;  4O0A A;  1AE3 A;  1U0L A;  1Y1V G;  2MFI A;  4A3J H;  1S40 A;  3S2D H;  4B3R Q;  3U4V A;  1VQO A;  3PIP A;  1PH8 A;  4DV6 Q;  2A8V A;  5C3E G;  4YCV A;  4DV4 Q;  1KHI A;  2PMZ E;  2B63 G;  2YU9 H;  4B3R L;  4LF7 L;  1QVC A;  4LF5 Q;  3K80 C;  2I5L X;  3NEN A;  4P74 A;  3I4M H;  2KEN A;  3D31 A;  2Z6K A;  1K83 H;  1Q86 C;  4DV4 L;  2XTI A;  3S15 H;  3EIV A;  5H1S E;  2CKZ B;  2HHH Q;  1U5K A;  2I5M X;  2OQ0 A;  4P71 A;  5IP7 G;  4GNX B;  3PF5 A;  1JMC A;  1VQK A;  4GLX A;  2OCE A;  4DV5 Q;  2Q2I A;  1KAW A;  3CXC A;  1VQP A;  1GKH A;  4P73 A;  3U4Z A;  3BU2 A;  2WFW A;  2UXC Q;  2R7Z H;  3ICE A;  1X56 A;  4B3T Q;  3KF6 B;  1ASY A;  1K73 C;  2PI2 A;  2CQO A;  4K0K Q;  3CD6 A;  4LF4 Q;  3E9I A;  1QVG A;  2R92 G;  1VQC A;  3FKI H;  3ULJ A;  4B3T L;  2BA1 A;  1VQ6 A;  3A0J A;  1E1O A;  3E9H A;  5M3F G;  4LF4 L;  2VQF Q;  4X65 Q;  3CCJ A;  2DUD A;  1YEZ A;  4A3E G;  1XPR A;  4A3M H;  4LF5 L;  4X64 L;  4B3S L;  3RR5 A;  1XMQ L;  1VQI A;  4JG2 A;  3J81 j;  2VQE Q;  4IFD J;  1K8A C;  3S17 H;  3B6Y A;  4GOP B;  4BY1 H;  3H0G G;  3KDF A;  1PH3 A;  2N78 A;  3W1G A;  1YZ6 A;  5IYB H;  2VQE L;  1I6H H;  4X62 L;  1SN8 A;  1YHA A;  1KL9 A;  1QUQ A;  1RL2 A;  4O2D A;  5M5X H;  3F2C A;  1PH7 A;  1N34 Q;  1MJE A;  3PUZ A;  1A0I A;  4NPS A;  1E22 A;  1WJJ A;  4A3K G;  3HOU G;  1QZH A;  4OO1 I;  4QGU A;  1HNZ L;  2E2H H;  1EYG A;  1VS0 A;  2HQL A;  3G4S A;  4HJ9 A;  1Y1W G;  3HOU H;  3HOV G;  4DR4 L;  2I5H A;  4OWT B;  3STB D;  3WWV A;  1N34 L;  3CPF A;  4JBK A;  4HJA A;  2IY5 B;  2ZM6 Q;  1UE6 A;  1UE1 A;  5M5Y H;  3CPW A;  4BY7 H;  4DAM A;  4PZ6 A;  1PVO A;  3BZC A;  2K75 A;  1OXX K;  1K3R A;  2PNH A;  3CP0 A;  1X3E A;  4UP9 A;  4A93 G;  1D7Q A;  2IHE A;  2ZM6 L;  3CC4 A;  2R7F A;  4HIO A;  1C0A A;  4LF8 Q;  5FLM H;  5IP9 H;  3I4N G;  1VQD A;  2K5N A;  4H02 A;  4DR1 Q;  4L5R C;  1IBK L;  2N3S A;  3GTG H;  4AYB G;  1EUJ A;  4R4I A;  4QQB X;  1OXS C;  1CUK A;  4LFC L;  3J7A 5;  2UUC L;  3CME A;  5IE8 A;  3HOZ G;  4DR1 L;  1X3F A;  2JE6 I;  2DGY A;  1HZB A;  2NZO A;  4YWM A;  1S72 A;  1Q1B A;  3HOX G;  2R93 G;  4KHZ A;  1LYL A;  4NXN L;  2VUM G;  1YNX A;  2VS1 A;  3J81 c;  3GTQ H;  1K0R A;  4LF6 L;  4DV1 Q;  4DV0 L;  3GTK H;  4EQ5 A;  3CCQ A;  1BVS A;  1Q82 C;  4LW1 A;  2UUB Q;  2I0Q A;  2WB1 G;  3PO2 G;  3D0F A;  4DV1 L;  1HNW Q;  3GTL H;  3AFQ A;  1I50 H;  4JOI C;  4IPH A;  1XMO Q;  1SFO H;  1N32 Q;  5IYC G;  2D0O A;  4YWL A;  1JB7 A;  1PFS A;  5GRO A;  2UUB L;  4OWW B;  1TXY A;  4BXX G;  5M3M H;  1HNW L;  2RHS B;  4IJL A;  1BBW A;  4GLV B;  1WFQ A;  2Q2H A;  3G6E A;  2CFM A;  3T1Y Q;  1XMO L;  1Z47 A;  1PA6 A;  4DR7 Q;  2VY3 A;  2F3I A;  2JA8 H;  1N32 L;  4UY8 C;  1EQR A;  2K14 A;  1X54 A;  3OTO L;  2QA4 A;  2B29 A;  4AQY L;  4OWX B;  3NEL A;  4L5T A;  3T1Y L;  1V9P A;  5IP7 H;  4DV3 Q;  3M3Y H;  4DR7 L;  2UXB Q;  2KCT A;  4A3B H;  1VQG A;  1NBW A;  2A1A A;  4GNX A;  1G6P A;  3RNU A;  1VQM A;  3JAM c;  2Y0S E;  3MXN B;  4DV3 L;  1R9T H;  1XNQ Q;  4IOA A;  3CC2 A;  1J5E Q;  1VQB A;  4KHP Q;  3KF6 A;  2LXJ A;  3M4Q A;  1UWV A;  3G71 A;  4A76 A;  3T1H Q;  1JJ2 A;  2EQS A;  1XNQ L;  1AE2 A;  1IBM Q;  3BZK A;  5M3F H;  1DGS A;  1J5E L;  2F52 A;  4XIG S;  4HID A;  1VQ9 A;  3FHW A;  2R6G A;  2JQO A;  4P75 A;  5JEA G;  1OXV A;  2UU9 Q;  4LF7 Q;  4A3G G;  2Z0S A;  5IT9 c;  4AYB E;  3T1H L;  1YVC A;  2JA5 H;  3J81 i;  1IBM L;  1ASZ A;  4A3F H;  1CSQ A;  3RLF A;  4KI0 A;  1EFW A;  3KFU A;  5K36 G;  3CCR A;  2UU9 L;  1A63 A;  3H0G H;  4UP8 A;  3S16 H;  4DNI A;  4Y52 H;  2HIV A;  4DR5 Q;  4RMF A;  4GOP A;  3M4P A;  4JI0 Q;  2ZTE A;  4YCW A;  3M4O H;  1CKM A;  4BBR G;  4GN4 B;  1MKH A;  3RLO A;  4A3I G;  3PUX A;  5C0X G;  2N49 A;  4QJF A;  4DR5 L;  1NE3 A;  4UPA A;  5IYD G;  4JI0 L;  1MJC A;  2RF4 A;  4P72 A;  3UDI A;  5C4X G;  3HKZ G;  3E0E A;  4LFA L;  3AFP A;  4A3D G;  4JI6 Q;  5IWA Q;  3I55 A;  3F2D A;  3W5O A;  2JA6 G;  2BH8 A;  4WJ3 M;  4X64 Q;  4DUZ Q;  1RIP A;  5IWA L;  3H15 A;  1HNX L;  4B3S Q;  2QGQ A;  4JI6 L;  2MO1 A;  1Q7Y C;  3M9B A;  4A4I A;  4C3J H;  1L2F A;  4DPG A;  1XMQ Q;  2OWO A;  3I4N H;  3CQZ H;  3ULL A;  1VQL A;  1WCM G;  1CKN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...