4C3IG

Structure of 14-subunit rna polymerase i at 3.0 a resolution, crystal form c2-100
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
309
structure length
259
Chain Sequence
NENRETARFIKKHKKQVTNPIDEKNGTSNCIVRVPIALYVSLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGVVLGYEGLKILDADPLDTSEKLIKITPDTPFGFTWCHVNLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKNNIPVDWTFVHNDVELGHWVDSNGEPIDGKLRFTVRNVHTTGRVVSVDGTLISYNSSRSQAESLPIVSNKKIVFDDEVSIENKESHKELDLPEVKEDNGSEIVYEENTSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA190
publication title Crystal Structure of the 14-Subunit RNA Polymerase I
pubmed doi rcsb
total genus 37
structure length 259
sequence length 309
ec nomenclature
pdb deposition date 2013-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
G PF17875 RPA43_OB RPA43 OB domain in RNA Pol I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1060 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4c3iG02
4C3HG 4C3JG 4C3IG
chains in the Genus database with same CATH superfamily
1JR0D 4ZUJA 3K80C 1F2ZA 1PTOF 3PIPA 4V0BA 4X62L 3S1NH 2NUCA 2PW5A 3S9WA 1B70B 1Q90A 1QCBD 2UXCQ 2CQOA 1XMOQ 4KJOA 2K5QA 1G91A 3RN2A 3FKIH 1B44D 1WJJA 3JAMi 2ZTDA 2VQFL 2UXCL 1AZPA 3R2IA 2AQ1B 4IUNA 5E1FA 4DAPA 3A0JA 4DNTB 1K0SA 3DLLA 2AKWB 1KDCA 4UPAA 4N9TA 1KAAA 3M3YB 4AYBB 5FO8B 2NZOA 3URYA 4DXGA 2FHTA 3E5SA 1DJRD 3C1FA 2Q8TA 5JPNC 2R93B 4BY7H 2F3IA 1VQIA 4JI5Q 4M1UB 4C3JB 2D9UA 2YU9H 4EX5A 3R3OA 3BVZA 4LF9Q 1V9PA 1LTBD 3HKZE 3I4NH 4JI5L 1HTLD 4BBSB 3NBHA 2EYMA 2FMMA 4QIWE 2QKIC 4JVZA 5BR8L 1SJHD 2C35B 4EQ5A 3H94A 5KIXA 1EYGA 3MXNB 2JA5H 2EIFA 4C1NI 1TQOA 3HG9A 1PV4A 1N34Q 4OWXB 4WJ3M 3FEWX 5JEAH 2KCMA 3FDTA 3G48A 4NXML 3RZOB 1NMGA 3S17B 1TWGH 3K7AB 4B3TQ 3TZDA 1G6PA 4FNFA 1CUKA 3L0OA 1QOHA 1GUTA 1BR9A 4C2MH 1TWHB 3CMEA 2KCCA 1ICFB 4B9WA 1STYA 1KD1C 2J7ZA 1SNMA 1IL8A 1F2MA 5GQOA 2HDMA 4JI3Q 1I50B 2XNAC 1R4PB 1O78A 1KLUD 1PH6A 3KF8A 1OXVA 5M3FB 2PO4A 2Z4IA 4I7ZC 3GTPH 4KY5A 2L0CA 5ELOA 1BCPC 4RGNA 2LMCB 3M85A 2K5WA 4ZK9B 2EJMA 4NMZA 4Y52H 2A68D 4LFAQ 3H3VH 1ZYRC 4LK1C 5HGQA 5IGEA 4YWKA 3CAMA 1EEFD 5EKKA 3SGIA 4X64L 2X6GA 1E1OA 4HJ8A 1L1OC 1MGSA 1YHQA 4DR3Q 1S5DD 3MA2B 4WRDA 1CA5A 1K28A 2IY5B 3QOLA 2AQ2B 4DNRB 3TMEA 4IJLA 3EQLC 5BN4A 4FYDA 3GTQH 1G2TA 2XWBB 3IKJA 4JBWA 1NE3A 4K0KL 4XYQA 4ME3A 1SROA 2A6HD 1FNUA 4R4CA 4GKJL 3ERSX 1VQ6A 2CWPA 4DFAA 3HOVG 3IFTA 2Z1CA 4IUQA 1CKOA 2D0PA 4RCOA 3PO3H 4UP8A 1PTOH 4TRDA 1SNPA 3TQYA 3SHLA 4DV0Q 5HY6A 4DV7Q 3FRPB 3WOFA 5M5WB 2RF4A 4GNXB 3QG1A 2P5ZX 3HS0C 5FJ8H 4KN4C 4A3DB 1V1PA 1SMXA 3D8GA 4DV7L 4KY7A 1SRUA 3D31A 3TP8A 2IHFA 2JEAI 4HR7B 1PTOD 1SNCA 2I46A 5C3XA 2CCZA 1O7IA 4A3GB 1KXLA 4PMWA 5JVH3 2AQ3B 3A8KE 4K6LA 2UUCQ 1WTQA 1PYBA 1PH5A 3C3LA 1FVIA 4JK1C 4Q5VA 4PV1C 4AH6A 1MHWC 4RMFA 4ULLA 3AEVA 3VR5A 2UUCL 2MGSA 3QIAA 3J7AF 4IO9A 1S5BD 5DM73 1XWEA 3S1QH 1KDBA 3MXGA 1A63A 2KEDA 4BY1G 3U58A 2KECA 4B3SQ 4FXDA 2BA1A 2XVSA 3J7A5 1FL0A 3EBEA 1K9MC 4JG2A 3MHBA 4DV1L 2YTVA 4M8AA 1WYDA 4L6TB 3P20A 5IP7G 1SSOA 1EQRA 3CRKC 5JJIA 1YIJA 1SEBD 3STBC 3HOUB 3MWYW 2L5TA 4C3IB 4HSVA 2F0GA 4XT3B 3KLWA 4ABNA 1OXXK 4G7HC 2QEJC 2SNMA 2ZJQA 1HA6A 1U4MA 1VQJA 1VDZA 1B1ZA 2E76C 2EY2A 4HTHA 1AE3A 1TWCB 4JI2L 3K5LA 1RL2A 1A3VA 5E7NA 4I65A 4A93G 1TY2A 3CU7A 2YU9B 3J81c 1Y1WH 4JI1L 5EKLA 1HJPA 1R9TB 1L1OA 2LKVA 4OGQC 2JXMB 1Q12A 1ASZA 3NP8A 2UUAQ 3H0GG 4WFN3 3HOYB 1M4VA 3GTMB 5M3MB 2UUBQ 1HHVA 2Z6KC 2PZUA 3N6RA 3BS1A 3CCLA 1H9SB 2WAQB 1B53A 2OT2A 1JICA 3PIOA 1PH1A 4QUFA 1ILQA 4NKLA 1IBKL 2UUBL 1KABA 4N8FA 1B2TA 4X65L 3OSOA 1UE6A 1E0BA 3OW7A 4IOCA 2CWAA 1KL9A 2Z4HA 3WOEA 5J22A 1WCMB 3DWPA 4IURA 3HOWH 4OIKA 5K5PA 1QVCA 2MNAA 3HOZH 2KCNA 3L7ZC 1U9RA 1OTCA 3FPPA 4JI6Q 3BYYB 1STAA 2XRQD 1D5MC 3MVVA 1RODA 2RDHA 3KK7A 5KEEA 5C4XH 2DUDA 2EDGA 1FJGL 1PH2A 1LTLA 1SDFA 2WKCA 1E3PA 1A62A 1LT5D 2IX1A 3BDOA 2JA7G 1BCPD 3P75A 4IOAA 5FLXE 4A3JG 5C3EB 2B2VC 5IWAQ 1KTKA 3D6WA 5IP9G 1WD0A 5EPJA 1QVGA 1DXMA 3KYHC 2E5LQ 2A69C 1E7ZA 1JC7A 4L63B 2O5IC 2I5HA 4K5VA 4L5QA 4Y7NH 3NSWA 4B9XA 4YHHQ 4PZ8A 2K5HA 3NELA 3F2UA 1X32A 4DK0A 2E5LL 4B3RL 3M7NA 2R6GA 4KI0A 4FDBA 3X3MA 3ULLA 3TZUA 5GAHC 3A7LA 3EROA 4FF2A 2N8NA 4IUVA 2O2LD 2DN8A 2Z0SA 3W2DA 3K5MA 1XNQQ 2K32A 3CW2C 2FFKB 1MJCA 2VY3A 2JSOA 2I5MX 1WTOA 1WTVA 4HMIA 1JOKA 4JI8L 2BDNA 1K3BC 2QW7A 1FR3A 5C0XJ 1I4HA 5CBAE 1YHBA 2EY6A 2EOTA 2JA8G 2NN6G 2F0WA 3KFUA 5C4HA 3ULPA 2C5CA 5T1GA 3VDYA 1HNWL 4JI0L 2I07B 1EIFA 2EE1A 2RSOA 1DZ1A 4EGVA 2HUGA 3MXNA 3GTGB 4DV5Q 3CCQA 1B9NA 4HAEA 5AFWA 3B6YA 4A3EH 2JA6G 4A3BB 2R92B 5M5XB 2K05A 5CMDA 1PFMA 5ELBA 1HZCA 3MXPA 1GUWA 4HJAA 4LUOA 5ELCA 3D4WA 1N8RC 1A0IA 1VF5C 4ZCKA 3T1HL 1PZJD 2ID0A 1L0YB 3HEJA 1I94Q 2PW7A 3SK6A 1J8IA 2R93H 1K8AC 1VQ7A 5K36G 3STBD 2DNCA 3TBIB 3SEBA 4C3JH 2EXZA 1K3RA 2KHJA 1K8OA 3M4PA 2QDLA 1RF2D 4X3UA 1SYEA 3PIO3 1QILA 3L2PA 5BN5A 5ELDA 1C9OA 4BBSH 3J80c 1BOSA 1N32L 3MC0B 2QILA 4ZLTF 4K8IA 4DR4L 2B2VA 2R3ZA 4UHVA 5C44B 4IPGA 3FP9A 4NB3A 4WJWA 1K8GA 1SYBA 1V1QA 3RZOH 4UY8C 3K7AH 4GKKQ 4LFCL 4KD4A 3F2DA 2VW9A 1YEZA 1CHPD 1ET6A 3S14B 3HKSA 4LAAA 2ZT9C 1VQDA 1TWHH 1VQ4A 1LUZA 1STHA 2ZXPA 2Q8IB 1S3OA 3GDEA 2N49A 2VNUD 3T53B 1EY7A 2B8GA 4R4TA 1I50H 3BZKA 4YCWA 4KHVA 1CM9A 1IBMQ 4GN3B 1D5ZC 3BZCA 3D6CA 3UDFA 4GS3A 5M3FH 3CHBD 2RQXA 5C4ZA 4GNXA 1GUSA 2V4DA 2A74C 3HOXB 1K83B 4DR6Q 1IW7C 4TSSA 2GVAA 2F3VA 3PCOB 2ZJPA 3TSSA 4F8MA 4LUZA 4DR6L 3K6OA 1EQVA 2KENA 4OHJA 4WORA 1GUGA 4DPGA 2HQEA 1S5ED 4DV6Q 5EQ0A 5GAEC 1F77A 1EY6A 3IRBA 2B2TC 2SOBA 1CA6A 1HCZA 1Z6HA 3GTKB 1D1KA 3LNNA 2VUMG 2R7ZG 1HZAA 2K33A 2H1EA 1QVFA 4LF7L 1MBYA 5IYBG 2L12A 5EBCA 2K28A 1EEID 4PMBA 4N8X1 1ESFA 3M7GA 2WIIB 4PZ7A 2Y0SG 4HCEA 2EYLA 2PZTA 3S2HB 1C48A 2CH4A 5KRUA 3I4MB 1PRTB 1FNVA 2XGTA 2F0VA 2B63B 4A3DH 1HZ9A 2UXBL 3PGZA 3S15B 1JWUD 1H9RA 1XPRA 4OO1I 3HKZB 1MSGA 4PQXA 5IYDH 4K2LA 2MP1A 5C5MA 3ONAB 5C4JB 1TS2A 4QIWB 1U4PA 1N36L 3OW2A 4MHEA 4C3HG 2IHEA 1XXGA 2JJQA 3QOJA 1S4ZA 4J6HA 2N88A 3KDFA 1XJVA 1PXUA 1YJWA 1EY0A 3VYUA 5F2DA 5IYCG 3ULJA 3KJOA 4A3FG 4ZAIA 3VR4A 2F0SA 4XQJA 1KLGD 3I72A 1XNRL 2VQFQ 2CW0D 5CV6A 1AEXA 5FLXL 2CQAA 2JP1A 4A3EB 1CFMA 1H9SA 3TREA 1GVPA 1IKMA 2IL8A 2NVXH 1G8ZD 3HOUH 5IGFA 1DONA 1VF7A 4C3IH 1C8CA 4KMUC 1W6JA 1LT4D 4OIJA 1QWYA 2WFWA 2NWGA 5IE8A 5AJ3Q 1EWCA 4CBVA 3RLNA 3U9SA 1SYGA 5EKIA 2R61A 1TS5A 3W1BA 5AJ3L 5DM63 3HFZB 3C46A 1TWCH 4CJ2C 4QY7A 4XT1B 2AMCB 4KKUA 3NPPA 3PO2G 1EY4A 1OXSC 2M9VA 5E3FA 2HCCA 1VQMA 1D1IA 5BR8Q 4A3KG 2RCFA 3E3XA 5G3LF 4DV4L 5HURA 1R9TH 1MSHA 4CDEC 2KHIA 3CC7A 1Y1VB 2A1AA 4DR2Q 3JAME 2B2TA 3HOYH 5JJKA 1ENCA 4NXMQ 4EQNA 3GTMH 5M3MH 1U4RA 1NBWA 4K5XA 3F2CA 1PFNA 3K59A 2A8VA 4R9WA 1X3QA 4DR2L 4H44C 1T5XD 4LWCA 4Z9CB 2OQ0A 4UAIA 2PQEA 1WTHA 3T13A 3HGBA 3PF4A 1LYLA 3BG3A 1KRSA 4P2CB 2DY7A 2B3GA 3RUZA 4RHRA 4DK3C 2KCTA 1WCMH 1YBYA 3NBIA 2JN4A 2KBNA 3NUCA 3NE5B 3W1GA 1Y14B 2XTIA 1EOVA 2B2WC 2IPKD 4RAUC 5GADC 3F2BA 2F1MA 3NXWA 2Y0SE 2FMCA 2IT1A 3TP5A 1ICWA 2BE5C 5I6YA 2XIWA 3I73A 4ILWA 1SXTA 1EYAA 4QB4A 4JW0A 3I56A 1E22A 1CHQD 1EZ8A 1GUOA 1AP0A 4JPBW 5C3EH 1ASYA 4HJ7A 4DR1Q 4IFDI 4X64Q 5DNFA 4Q0FA 4K14A 3UDXA 4OELB 1AE2A 4A3MG 4CDFC 2WKDA 3VYRA 4DR1L 1GOZA 1B8AA 1U5KA 2A6EC 5FKAC 3VYTA 3ND8A 5J3BA 3Q8DA 4RGOS 3T16A 4K0KQ 2PZWA 5H1SE 4A3IG 1KQSA 4GKJQ 4OEMB 1FYCA 2WINB 5I9PA 2ZM6Q 3D0FA 2ES2A 1JJCB 5IGCA 1EQQA 2DY8A 4MN3A 1Q8IA 2WB1G 2H5XA 2E74C 2HT1A 3L9AX 1PFSA 1F2YA 1A2UA 1EIYB 2NVQB 4BS9A 1SE3A 2F0IA 2ZM6L 1ONLA 1CKNB 4YCVA 4LMQD 1BUVT 4DUYL 2YTXA 1SAPA 1SMYD 4JYAL 1A3TA 5I4DA 1D5XC 2CFMA 4BBRG 3RD4A 3CCUA 3GTOB 1K0RA 4HJ5A 3IAYA 1KC8C 5CBEE 5IT9E 1PRTC 1S5FD 3J7YW 1BF4A 1E2WA 1B3QA 4FP5D 4QCLA 3UE1A 1G2SA 5C5LA 4CGYB 1LTAD 4KHZA 1F9RA 3FKIG 5M9OA 3FHWA 5I2YA 1QJOA 4LFBL 4NDXA 1PH4A 5M5YB 1LM0A 1TS3A 1JJ2A 1NJIC 1KRTA 4O1NA 2D5DA 4XYOA 2NB0A 5CR3A 1NR2A 5JEAJ 2Q2IA 1VQFA 1PRTF 3GTGH 3ND9A 4QUCA 2PI2A 2JYOA 4NXNL 4PG3A 2M00A 4JI7Q 2NVTB 3JC66 4A3BH 2K01A 2R92H 5M5XH 2C9OA 1I6HB 1TXYA 4ALPA 4WJ4A 4BY7G 2ZJRA 4L5TA 2IX3A 3EVQA 4DV1Q 4JI7L 5LMUL 4JOIC 4DV2L 2YYZA 3FPUB 1NCVA 2PCFB 2LS01 3I4NG 4A3LH 1ZEQX 2MQHA 3E0JA 1W3SA 4ZUIA 2OWOA 3HOVB 2NVXB 1TWAB 3S2DB 1VMCA 3OYYA 5FLXc 2VZAA 2B2WA 3E6ZX 1WD1A 2AWOA 2EJFC 2ZTEA 2JA5G 2TMPA 3VA5A 3RMHA 1TU2B 2KJXA 5JEAG 5G3LD 1VQOA 1H95A 4JI2Q 4FXKC 4EQPA 1HNXQ 2AHOB 2RBMA 2ASBA 3SK4A 5E4XA 1OXTA 4ID6A 2DGYA 5JPMC 2Q2UA 1STEA 1WI5A 1ENFA 2PMZE 1HNXL 1LACA 4JI1Q 4O2DA 1KAWA 5C44H 5EBDA 1HR0W 2VB2X 5LL6X 4RGTA 3KBGA 3PV0A 2IX0A 3KF6B 3QO2A 3MEFA 4OO1H 1SNOA 3S14H 3RZDB 3IFDA 1GM5A 4X6AH 1Q1BA 2O4XA 1BKBA 4JV5Q 3FMCA 1WFQA 5CV7A 2K04A 1RTOA 2K14A 2I0QA 1TR5A 3W5OA 1IBKQ 2RVLA 5TSSA 3A56A 1J5EL 4BY1B 4X65Q 1BO0A 4JV5L 4UDUC 4DXFA 1EY9A 5KNBA 3OWFA 2ENBA 1CSPA 1LT6D 2NTTA 2NTSA 1RTNA 1I3QB 3M4YA 1L0XB 2WB1E 4FXGC 2F0NA 3RLFA 1JB3A 2G5DA 3HOXH 1LLRD 1K83H 3G6JB 3CQZB 2LSSA 1FJGQ 3BYTB 4KJNA 2RCNA 2BDOA 1Y8OB 2H4OA 4K2KA 4BWGB 5IGDA 5I2XA 4ZYSA 2BE5D 3TS0A 1WTWA 1X65A 2RDGA 5C6AA 1GJXA 3KJPA 3PO3G 1MJEA 3CC2A 4HJ9A 2XSCA 4DK1A 4A93B 2DJFC 4UP9A 1F9SA 4H0LC 3WWVA 4X66L 3GTKH 1EZ6A 1ZYRD 3UDGA 4HIDA 1VQGA 3K5NA 3J81i 5FJ8G 3MXUA 3H15A 5LMNL 3MFYA 4JOIA 1GD7A 4B3RQ 3H0GB 1J9OA 4J15A 2A6ED 4KKTA 1PH9A 1JE4A 4G7OC 4B3ML 2EVBA 4LF4Q 2JA9A 2RA4A 3JAML 1EU3A 1DGSA 1L2FA 1F9PA 1V43A 4IPDA 2JE6I 1IZ6A 4DR5L 3S2HH 3BZDB 2L4NA 2F03A 1JT8A 1K73C 3ITPA 4DAMA 3GTJB 3I4MH 1E2VA 2QF7A 4R8NA 5I6WA 4LF4L 1DOMA 3CPWA 1VQAA 4KKSA 4CJ1B 2ZXOA 2B63H 1C7YA 4KD3A 3D4DA 1YJNA 1VMPA 1G6ZA 5D65A 3S15H 1HA5A 1NR4A 5HGTA 3DHQA 5CGKA 4HCSA 4H13C 4FF1A 2BCOA 2Q2HA 2E2IB 4RKLA 4JI8Q 3PUVA 3GV3A 1XPOA 2K5NA 3GO5A 4JBMA 1PRTD 4XDXA 5DLQE 4EQOA 5C4JH 3TS2A 4A76A 2L1BA 1RHPA 4L5RC 4DF7A 3OMCA 1QNKA 3MZ5A 4A75A 3J81E 1FNWA 1HNWQ 4L8JA 2WAQE 1AN8A 4JI0Q 1LTSD 1GUNA 1PYSB 4IUTA 1SR3A 4XQQA 3BU2A 2JA7B 4DR7L 2ZXRA 5FLMH 2A19A 5JJLA 4A3JB 4CKEA 1M8AA 1CZGA 2IW3A 3K81C 1PLFA 1O80A 5LMNW 1GO3E 2F52A 2Z6KA 1D2BA 3G7LA 3P1HA 4IFDH 1IYJB 3T1HQ 1EIHA 1QG7A 3S1RB 4CJ0B 5J39A 1TVXA 3GTLB 2BH8A 3EIVA 4BXXH 4A3CG 1T9HA 1Y1WG 1NSNS 1DYQA 1QUQB 4UP7A 4X3KA 3LX0A 1YNNC 4HEDA 3EJIA 3S16H 1YNJC 3M4OB 3AYHB 5C0XG 4O42A 3DWQA 2EJGC 4FO2A 1N32Q 3T1YL 1PH8A 4GLAC 3U4ZA 3OPOA 1TWFB 5IT9L 4DR4Q 4U68A 2BA0A 4C3HH 2PNRC 3IL8A 2LFNA 4RFBA 1Y1VH 2F0DA 1R4QB 2KHSA 1PA6A 4OX9L 2E8GA 4LNQA 2RDFA 1IXRA 2J0TD 2B2UC 3VR6A 1CTMA 3H6MA 1XPUA 2JA8B 2A73B 1ML0D 4LFCQ 3HOWG 1QNUA 3HOZG 1RKNA 1IBLQ 1YVCA 4KHPQ 2KQ3A 2JQOA 2LXKA 3OIPA 4YY3L 3CF5A 4O0AA 2JA6B 3NTKA 5C4XG 1IBLL 1SYFA 1Y69U 4KHPL 1JORA 1X3PA 1FD7D 5CC4A 1CKNA 4IUUA 1E2ZA 2EYHA 2ALYB 3CMAA 3E9IA 1EUJA 1JB7A 3RR5A 4N9PA 1KHIA 1SE2A 1GXDC 3P7JA 2UXDQ 3K58A 2KUMA 4PZ6A 4G7ZC 3I8ZA 3DUZA 4KY6A 3SVMA 1BQQT 1HFNA 3KUPA 3EA6A 2PNHA 4XXEA 3VA7A 1HPCA 1UEBA 2UXDL 1A3UA 4F88A 1STGA 1UEAB 1STNA 2FJ2A 2EQSA 4POFA 3CCJA 2F0QA 1M90C 4OWWB 2NVYB 4JBKA 2WP8J 3A8IE 1QZHA 3Q23A 3MEHA 4BA1I 4RCNA 1DOLA 4FVMA 5COYA 2B29A 3J80i 1HNZL 2F4VL 1NMFA 4LF5L 2MJ8A 1PH3A 4LF7Q 5CV9A 1LTTD 1VCIA 1YJ9A 1VQ8A 2BOSA 3DXJC 3I4OA 2NVQH 1GHKA 4G4KA 2SDFA 5LHY1 3NWTA 3L3OC 4RG1A 2VB3X 4R1JA 2A69D 1PDQA 2D0OA 1A2TA 2CHBD 2HCIA 2SEBD 2MPMA 1A8VA 2QCPX 4K6DA 3GTOH 1IYVA 2F0UA 3TP7A 3TP6A 1FGUA 2NN6I 4J8QA 2UXBQ 4JBJA 3TDQA 1EY8A 3A8JE 4GLVB 2A6HC 3JAMc 1I6VC 2D62A 5D14A 5DAUA 4MTNA 5M5YH 5IODA 3PUWA 3J80E 1N36Q 1SYDA 1RJTA 1KIXA 4S3SA 1S72A 1TS4A 1EQTA 3VYSA 1QE6A 4AYBG 1JQYD 3I55A 1EFWA 2JEBI 2B2UA 3PMFA 1LTID 4MIUA 2NVTH 2RSNA 1CQFA 1I6HH 3A55A 2F0OA 2R93G 3KLSX 3KF6A 1N9WA 4JI4L 3BJUA 2F0EA 5L37A 1XNRQ 1RCVD 3MFGA 4C3JG 3R93A 5BN3A 4AQYQ 4FF3A 3K5OA 1Z7TA 3AQQA 5A35A 2F0MA 2R7DA 1X3GA 4XTCS 5CV8A 2L9HA 2ICEC 3U9OA 1UUPA 2HIXA 2AUKA 2HIVA 1EFID 3A54A 4AQYL 4GZYC 2R7ZB 2VUMB 4BBSG 1OO9B 1EIGA 3HOVH 1TWAH 2YV5A 2F0TA 3S2DH 5CV5A 4RA8A 4BA2I 4BBRH 4ZRZA 1F2LA 3NHHA 2Y0SB 5KNDA 3Q24A 5JAVA 1IL2A 1JJGA 1VQBA 1T5EA 4HIMA 3OWEB 3KLRA 1WTXA 1CT1D 1Q8KA 1IKLA 1MD2D 1YNND 2RHSB 3RLOA 4MTKA 3S16B 2OF1A 1NAPA 1IHZA 1I5FA 2O5JC 3K57A 1YNJD 3D3RA 4DV4Q 1XMOL 5CORA 1O7YA 1KNEA 4G57A 4QF4A 3TN2A 5GAGC 2K03A 3CPFA 3CXCA 3K0YA 4XIGS 1C4QA 4C3HB 3RZDH 5M3FG 3D4RA 2E2JB 1ET9A 5IT9c 5ISRA 3J81L 5EPLA 5E4WC 4CKCA 5KYLA 4KK7A 1LV9A 4BY1H 4A3FB 1B4OA 1SYCA 1MKHA 3U50C 1ZKOA 4LUVA 4F7XA 3CCVA 3I91A 2CH4W 3U4VA 5IP7H 1D6EC 4LF9L 2CVRA 1I3QH 2Q8RE 4PNYA 3DWAA 4IPCA 3PSIA 2WV6D 2X6LA 1PZKD 3CQZH 1HQRD 2E2HH 3CKIB 4DAYB 1WTRA 1MI2A 2LY7A 3I7FA 4DGZA 2MO1A 1EWIA 2DJGC 1N34L 1JE5A 4DAVA 4B3TL 3AFPA 4A93H 1K8MA 2OCEA 1CZWA 1HFGA 2K50A 3PO2B 1IW7D 2SNSA 3NK9A 3CCRA 4A3KB 1M1KC 1EYCA 4H7BA 5FK9C 3W3AA 2HQLA 1HTPA 3I4LA 4JI3L 4A3DG 3I2ZA 1VQ5A 4IPHA 2R7FA 3H0GH 4AYBE 3MAQA 4HIKA 1SJED 3M9BA 2EY1A 1Y8PB 2EZVA 5IYDG 4A3GG 1LTGD 2KVMA 5EGTA 1XTCD 3TEHB 1DOKA 3GTJH 5D3IB 4DUYQ 1W6KA 1I4XA 1X55A 2OXPA 2Z8LA 2K75A 2MHVA 5FO9B 4JYAQ 1RDPD 2IJ0A 1Q1EA 3OMGA 5KNCA 3ZYYX 2QA4A 4ME5A 4KLKA 1O7ZA 2RHQB 1UE5A 4LFAL 1EYDA 2EYJA 2MO0A 1L0WA 1QUQA 1S40A 2E2IH 3LWEA 4K5WA 2MUYA 1HUNA 4RWSC 1BCPF 2L55A 4XQNA 4LFBQ 2OQKA 3CP0A 4DR3L 2PMZB 5CV4A 2Q2TA 4DA2A 4RHSA 3F8TA 1RD9D 3RN5A 1SNDA 2QGQA 1PVOA 2VL6A 3HOUG 1HR0Q 4GLXA 1B50A 3A74A 4FF4A 1BXTA 3PIP3 4DV3Q 2EYFA 4RH6A 4C3IG 5A2QE 4L5SA 1EY5A 4NXNQ 2JA7H 3S1MB 3CC4A 2N55A 2RKSA 2EXDA 4A3JH 1X9NA 4ZKCB 1HR0L 2EPBA 2NZHA 1VQ9A 1XMQQ 4DV3L 1P8LA 5IP9H 4NP5A 2UU9Q 1N33Q 3Q6SA 5LL6S 4OWTB 3HRZC 1SE4A 4R4IA 4CDDC 5LMUQ 4R4OA 4A3MB 4DV2Q 4DV0L 2KEEA 3EN2A 1XMQL 2Z6BA 4IQZA 4QL5A 1JCKB 4IZ8A 2UU9L 5GROA 1TIID 4C56C 1S5CD 1N33L 3O13A 3S1RH 4RGMA 4CHTB 4A3IB 3Q0AA 1QZGA 4A4IA 1Q7YC 3GTLH 2KOLA 5JVG3 4TQUS 1Q81C 3I3CA 1LT3D 1SFOB 2XN9C 1GKHA 2WB1B 5I9OA 3BVMA 3MTSA 3WDNA 5JJZA 1XYIA 2E75C 1SN8A 3CD6A 1ILPA 4DK6C 5EPKA 1BNZA 3M4OH 3HOYG 2KA7A 1Q82C 2AUJD 5M3MG 2K5VA 4BBRB 1B7YB 2K7VA 1X3FA 2TSSA 3HP3A 3C1EA 1UE7A 2WAQG 3S1NB 1TWFH 1B3AA 4GOPB 3SE0A 5EAYA 3TRZA 1YNXA 3C2PA 2K5DA 3FKIB 4B3SL 2BH2A 2L11A 1HH2P 2JA8H 2NN6H 3GP7A 2N78A 1HUMA 1WCMG 1H9KA 1EWHA 2ZTCA 1I4PA 4P72A 3J80L 4IALA 4MZ9A 1PHJA 4CKBA 4V190 1OXUA 4H02A 2JA6H 2OTJA 3NQIA 3RNUA 1J5EQ 1XX8A 1J6QA 1AW7A 4F87A 2OTLA 4OL7A 2HDLA 4BY7B 3QR8A 3PF5A 1Z9FA 5KGUA 3K7UC 5C3EG 4A3CH 3LGJA 2PQAB 3GQBA 3KDFB 2M2LA 3T51B 3I4NB 1X54A 3AB9A 3H09A 1BBXC 4MNOA 1O7LA 2D2CC 1VQCA 1Q46A 3VR2A 3DM3A 5K36H 2YTYA 4DNIA 2F3WA 5C0XH 1UAPA 3BDCA 1YHAA 3NQTA 1HQMC 1TKWB 4QGUA 2JA5B 1W2BA 2UUAL 4DKAC 2XWJB 1DCZA 3E0EA 2E2HB 3PUXA 4CDCC 1PYWD 2NVYH 4QQBX 3AMUA 1TWGB 2I5LX 1X6OA 1C0AA 1UE1A 1STBA 4DUZQ 1JOOA 4P75A 4X66Q 1SE8A 3QJYA 3DEPA 4C2MB 4B08A 5ELEA 1KNAA 1BBWA 3CCSA 2QDBA 1VQNA 3KOJA 1X56A 4DUZL 1UWVA 2F0HA 1V1OA 4QMGA 5LMNQ 1KDAA 3LWUA 3ERQA 2ATWA 2F0PA 4HSPA 1SBBB 2HD3A 2QEXA 2N3SA 4B3MQ 1LTRD 2NYZD 4DR5Q 4APVA 4JI6L 3GTPB 3R2TA 3FVQA 3UI2A 3G6EA 4JCVE 1QB5D 4HIOA 1PZID 2VS1A 4X3TA 3KLSA 4P74A 3NBHB 4OONA 3PQIA 4LF6Q 2VXWA 1BBUA 1CK1A 1G51A 3SXHA 4A3BG 2B39A 5T1IA 5IWAL 1AZQA 2R92G 3J7AV 4LF6L 1HRJA 1P16A 2JK8A 4ZQ3A 5KYIA 3GTQB 4DN4M 4YHHL 1RIPA 1EL0A 1JWSD 1Q86C 4A3LG 4KN7C 1VQLA 5IOCA 4EVOA 5C3WA 4OXPA 4DR7Q 5DEHA 1D7QA 3OOCA 4YCUA 3QWNA 2LXJA 4LJZC 3ER0A 4IN3A 3SR1A 3G4SA 3PO3B 3A5UA 1SNQA 1PTOB 1CKMA 3ZJYC 3OTOQ 3CCMA 3H91A 4GNXC 2PYKA 3KF8B 3SDZA 3V96A 3A7AB 1XNQL 2PPBC 2R7ZH 2VUMH 1B9MA 1XTDA 3OTOL 4LW1A 3EFXD 3DM1A 4GN5A 4YIJA 5IYBH 1VS0A 3GV6A 5FO7B 1JOQA 4YWLA 1CSQA 5CYUA 4I7AA 5C44G 2FINB 1Z47A 1FGBD 2AWNA 1DD2A 1X3EA 3S24A 2CW0C 2MFIA 4RKBA 1H9MA 5FOBB 4OO1G 1IYUA 1I4RA 1TT2A 4DAYA 4J1MA 2V1CC 3I90A 1AFPA 3T1YQ 2NZ1D 5JOBA 4DV5L 3S1QB 1Q3LA 4GOPC 2F4IA 4P71A 3SK5A 3J7ZC 4OX9Q 3M3YH 1A15A 2K1BA 2B2YC 5D3DA 1I4QA 1NY4A 2E2JH 3H3VI 3PUZA 2VQEQ 3G71A 1NUCA 5IYCH 1I94L 1NNXA 4HMJA 3HOXG 3ICEA 1ENAA 4YY3Q 4A3FH 1GHJA 3DEOA 5A2QL 2VQEL 2Z9HA 3NEMA 3HZXA 1ZXTA 1EU4A 1V1PB 3GD7A 3V05A 5IGBA 4POGA 1PFBA 4LF8Q 2K4KA 3NTHA 1SLJA 1TY0A 2IWHA 1PH7A 2CKZB 5IIFA 2GN5A 4LF8L 2FXQA 3PUYA 4DU9A 2K6AA 4E6IA 4C1NK 2B8FA 2XRSD 1E1TA 1VQEA 3K8AA 3S17H 1Y1WB 3VR3A 1VQKA 1YZ6A 3NWSA 4X3SA 4IJHA 1AH9A 4YWMA 1Y8NB 1A6XA 4GKKL 3V2TA 2ICIA 2X69A 4KV6A 3PO2H 2A5HA 1F9QA 5NUCA 1U0LA 1YI2A 1BDOA 4TKOB 1YITA 3I4MG 4A3KH 1U4LA 1HNZQ 2F4VQ 4PMCA 1WVLA 2B63G 1HXYD 4R8IA 3NTIA 4LF5Q 3OHXC 4IFDJ 3I70A 2L15A 3AFQA 3BDLA 3HKZG 3T56B 1IBML 3M4QA 4HN7A 4R4QA 2G9DA 1LO5D 1JWMD 3QB3A 3HOWB 2F0KA 1HZBA 2A68C 3HOZB 1BCPB 4IUPA 1EOTA 3Q22A 2EYPA 2K52A 5C4XB 2J4XA 1CI3M 3X3NA 1UNSA 2WACA 1L1OB 3H3VC 4ODGA 5FLMG 3BVGA 2OEOA 5IGGA 3KBXA 5ELNA 1D8LA 3K0XA 1H9JA 4DV6L 4JC0A 4A3EG 2NBFA 2PI2E 3E9HA 3N52A 5J1ZA 5IY0A 2F0FA 2HHHQ 1DM0B 3NENA 2E2DC 1SMYC 4GOPA 4NPSA 4IFDG 2DNEA 3DMUA 1VQHA 1BVSA 4Y7NB 3S1MH 4QJFA 2F0LA 3J81j 1LABA 4TVAB 2HHHL 4GN4B 2B2YA 3AU7A 4BXXG 4AIMA 3R8BA 4U673 1ESRA 4JI4Q 4NW2A 1VQPA 3T4AC 1NTGA 2EY5A 5M5WH 3UDIA 1I4GA 4A3MH 3A5ZB 1CQVA 1G291 3CCEA 1JMCA 1PTOC 2EYOA 2G9HD 2GA4B 4P73A 1MIUA 3F1ZA 4A3IH 1WOCA 4ZKBB 4A3GH 5ELFA 2GVBA 1WTPA 2F0JA 3SK8A 5C0XI 1SFOH 1V8QA 3CRLC 1PMRA 1E24A 3UE0A 4K8JA 3OIQA 1II3A 1Y1VG 4X62Q 2PQAA 4KTAA 5EJWA
chains in the Genus database with same CATH topology
1JR0D 4ZUJA 1F2ZA 1PTOF 4V0BA 2NUCA 2PW5A 3S9WA 1Q90A 1QCBD 4KJOA 2K5QA 1G91A 1B44D 1AZPA 3R2IA 2AQ1B 4IUNA 5E1FA 4DAPA 4DNTB 1KDCA 4N9TA 1KAAA 3M3YB 4AYBB 5FO8B 3URYA 4DXGA 2FHTA 3E5SA 1DJRD 3C1FA 2Q8TA 5JPNC 2R93B 4M1UB 4C3JB 2D9UA 3R3OA 3BVZA 1LTBD 1HTLD 4BBSB 3NBHA 2EYMA 2FMMA 2QKIC 1SJHD 3H94A 5KIXA 4C1NI 1TQOA 3HG9A 3FEWX 5JEAH 3FDTA 3RZOB 3S17B 3K7AB 3TZDA 4FNFA 1QOHA 1GUTA 1BR9A 1TWHB 2KCCA 4B9WA 1STYA 2J7ZA 1SNMA 1IL8A 1F2MA 2HDMA 1I50B 2XNAC 1R4PB 1O78A 1KLUD 3KF8A 1OXVA 5M3FB 2PO4A 2Z4IA 4I7ZC 4KY5A 2L0CA 1BCPC 4RGNA 2LMCB 3M85A 2K5WA 4ZK9B 2EJMA 4NMZA 2A68D 1ZYRC 4LK1C 5IGEA 1EEFD 5EKKA 2X6GA 1MGSA 1S5DD 3MA2B 4WRDA 1CA5A 3QOLA 2AQ2B 4DNRB 3TMEA 5BN4A 3EQLC 4FYDA 1G2TA 2XWBB 3IKJA 4JBWA 4XYQA 2A6HD 1FNUA 4DFAA 3IFTA 2Z1CA 4IUQA 4RCOA 1PTOH 4TRDA 1SNPA 3SHLA 3FRPB 3WOFA 5M5WB 3QG1A 3HS0C 4KN4C 4A3DB 1V1PA 3D8GA 4KY7A 3D31A 3TP8A 2JEAI 4HR7B 1PTOD 1SNCA 2I46A 5C3XA 4A3GB 4PMWA 5JVH3 2AQ3B 3A8KE 4K6LA 1WTQA 3C3LA 4JK1C 4Q5VA 4PV1C 4ULLA 3VR5A 2MGSA 3QIAA 3J7AF 1S5BD 5DM73 1XWEA 1KDBA 3MXGA 2KEDA 2KECA 4FXDA 2BA1A 2XVSA 3MHBA 4M8AA 4L6TB 3P20A 1SSOA 3CRKC 1SEBD 3HOUB 3MWYW 2L5TA 4C3IB 4HSVA 2F0GA 4XT3B 4ABNA 1OXXK 4G7HC 2QEJC 2SNMA 1HA6A 1U4MA 1VDZA 1B1ZA 2E76C 2EY2A 4HTHA 1TWCB 3K5LA 1A3VA 4I65A 1TY2A 3CU7A 2YU9B 5EKLA 1R9TB 2LKVA 4OGQC 2JXMB 1Q12A 3NP8A 4WFN3 3HOYB 1M4VA 3GTMB 5M3MB 1HHVA 2PZUA 3N6RA 3BS1A 1H9SB 2WAQB 1B53A 2OT2A 1JICA 4QUFA 1ILQA 4NKLA 1KABA 1B2TA 3OSOA 1E0BA 3OW7A 2Z4HA 3WOEA 5J22A 1WCMB 3DWPA 4IURA 4OIKA 5K5PA 2KCNA 3L7ZC 1U9RA 3FPPA 3BYYB 1STAA 2XRQD 1D5MC 3MVVA 1RODA 2RDHA 3KK7A 5KEEA 2EDGA 1SDFA 2WKCA 1LT5D 2IX1A 3BDOA 1BCPD 3P75A 5FLXE 5C3EB 2B2VC 1KTKA 3D6WA 1WD0A 5EPJA 1DXMA 2A69C 1JC7A 4L63B 2O5IC 4K5VA 3NSWA 4B9XA 3F2UA 1X32A 4DK0A 3M7NA 2R6GA 4KI0A 3X3MA 3TZUA 3A7LA 3EROA 4FF2A 4IUVA 2O2LD 2DN8A 3W2DA 3K5MA 2K32A 2FFKB 2JSOA 1WTOA 1WTVA 4HMIA 1JOKA 2BDNA 1FR3A 5C0XJ 1I4HA 5CBAE 2EY6A 2EOTA 2NN6G 2F0WA 5C4HA 2C5CA 5T1GA 2I07B 2EE1A 2RSOA 1DZ1A 4EGVA 2HUGA 3MXNA 3GTGB 1B9NA 4HAEA 5AFWA 4A3BB 2R92B 5M5XB 2K05A 5CMDA 1PFMA 5ELBA 3MXPA 1GUWA 5ELCA 3D4WA 1VF5C 1PZJD 2ID0A 1L0YB 3HEJA 2PW7A 3SK6A 1J8IA 5K36G 2DNCA 3TBIB 3SEBA 2EXZA 1K8OA 1RF2D 4X3UA 1SYEA 3PIO3 1QILA 5BN5A 5ELDA 1BOSA 3MC0B 2QILA 4ZLTF 4K8IA 2B2VA 2R3ZA 5C44B 4WJWA 1SYBA 4KD4A 1CHPD 1ET6A 3S14B 4LAAA 2ZT9C 1STHA 2ZXPA 2Q8IB 2VNUD 3T53B 1EY7A 2B8GA 4KHVA 1CM9A 1D5ZC 3D6CA 3CHBD 2RQXA 5C4ZA 1GUSA 2V4DA 2A74C 3HOXB 1K83B 1IW7C 4TSSA 2F3VA 3TSSA 4F8MA 3K6OA 1EQVA 4OHJA 4WORA 1GUGA 2HQEA 1S5ED 5EQ0A 1F77A 1EY6A 2B2TC 2SOBA 1CA6A 1HCZA 1Z6HA 3GTKB 1D1KA 3LNNA 2K33A 2H1EA 1MBYA 2L12A 5EBCA 2K28A 1EEID 4PMBA 1ESFA 3M7GA 2WIIB 4HCEA 2EYLA 2PZTA 3S2HB 1C48A 5KRUA 3I4MB 1PRTB 1FNVA 2F0VA 2B63B 3S15B 1JWUD 1H9RA 4OO1I 3HKZB 1MSGA 4PQXA 4K2LA 2MP1A 5C5MA 3ONAB 5C4JB 1TS2A 4QIWB 1U4PA 4MHEA 4C3HG 1XXGA 3QOJA 1S4ZA 4J6HA 2N88A 1PXUA 1EY0A 3VYUA 5F2DA 4ZAIA 3VR4A 2F0SA 4XQJA 1KLGD 3I72A 2CW0D 5CV6A 1AEXA 5FLXL 2CQAA 2JP1A 4A3EB 1CFMA 1H9SA 1IKMA 2IL8A 1G8ZD 5IGFA 1DONA 1VF7A 1C8CA 4KMUC 1W6JA 1LT4D 4OIJA 1QWYA 2NWGA 1EWCA 4CBVA 3U9SA 1SYGA 5EKIA 2R61A 1TS5A 5DM63 3C46A 4CJ2C 4XT1B 4KKUA 3NPPA 1EY4A 1OXSC 2M9VA 5E3FA 2HCCA 1D1IA 5G3LF 5HURA 1MSHA 1Y1VB 3JAME 2B2TA 1ENCA 4EQNA 1U4RA 4K5XA 1PFNA 3K59A 4R9WA 1X3QA 4H44C 1T5XD 4Z9CB 4UAIA 2PQEA 3T13A 3HGBA 3BG3A 4P2CB 2DY7A 3RUZA 4RHRA 3NBIA 3NUCA 3NE5B 2B2WC 2IPKD 4RAUC 2F1MA 3NXWA 2FMCA 2IT1A 3TP5A 1ICWA 2BE5C 5I6YA 2XIWA 3I73A 4ILWA 1SXTA 1EYAA 4QB4A 1CHQD 1EZ8A 1GUOA 1AP0A 4IFDI 5DNFA 4Q0FA 4K14A 2WKDA 3VYRA 1GOZA 2A6EC 5FKAC 3VYTA 3ND8A 3T16A 4RGOS 2PZWA 1FYCA 2WINB 5I9PA 5IGCA 2DY8A 4MN3A 1Q8IA 2E74C 3L9AX 1F2YA 1A2UA 2NVQB 4BS9A 1SE3A 2F0IA 1ONLA 4LMQD 1BUVT 1SAPA 1SMYD 1A3TA 5I4DA 1D5XC 3GTOB 3RD4A 3IAYA 5CBEE 5IT9E 1PRTC 1S5FD 3J7YW 1BF4A 1E2WA 4FP5D 4QCLA 1G2SA 5C5LA 4CGYB 1LTAD 4KHZA 1F9RA 5M9OA 5I2YA 1QJOA 4NDXA 5M5YB 1TS3A 4O1NA 2D5DA 4XYOA 2NB0A 5CR3A 1NR2A 5JEAJ 1PRTF 3ND9A 4QUCA 2JYOA 2M00A 2NVTB 2K01A 2C9OA 1I6HB 2IX3A 3EVQA 2YYZA 3FPUB 1NCVA 2PCFB 2LS01 1ZEQX 3E0JA 4ZUIA 3HOVB 2NVXB 1TWAB 3S2DB 1VMCA 2B2WA 3E6ZX 1WD1A 2AWOA 2EJFC 2TMPA 3VA5A 3RMHA 1TU2B 2KJXA 5JEAG 5G3LD 4EQPA 4FXKC 2RBMA 3SK4A 5E4XA 1OXTA 4ID6A 5JPMC 1STEA 1ENFA 1LACA 5EBDA 2VB2X 5LL6X 4RGTA 3KBGA 3PV0A 2IX0A 3QO2A 4OO1H 1SNOA 3RZDB 3IFDA 1Q1BA 2O4XA 3FMCA 5CV7A 2K04A 1RTOA 1TR5A 2RVLA 5TSSA 3A56A 4BY1B 1BO0A 4UDUC 4DXFA 1EY9A 5KNBA 3OWFA 2ENBA 1LT6D 2NTTA 2NTSA 1RTNA 1I3QB 3M4YA 1L0XB 4FXGC 2F0NA 3RLFA 1JB3A 1LLRD 3G6JB 3CQZB 3BYTB 4KJNA 2BDOA 1Y8OB 2H4OA 4K2KA 4BWGB 5IGDA 5I2XA 4ZYSA 2BE5D 1WTWA 2RDGA 5C6AA 1GJXA 2XSCA 4DK1A 4A93B 1F9SA 4H0LC 1EZ6A 1ZYRD 3K5NA 3MXUA 3MFYA 3H0GB 1J9OA 4KKTA 2A6ED 1JE4A 4G7OC 2EVBA 2RA4A 3JAML 1EU3A 1F9PA 1V43A 2JE6I 3BZDB 2L4NA 2F03A 3ITPA 3GTJB 1E2VA 2QF7A 4R8NA 5I6WA 1DOMA 4KKSA 4CJ1B 2ZXOA 4KD3A 3D4DA 1VMPA 1G6ZA 5D65A 1HA5A 1NR4A 5HGTA 3DHQA 5CGKA 4HCSA 4H13C 4FF1A 2BCOA 2E2IB 4RKLA 3PUVA 3GV3A 3GO5A 1PRTD 4XDXA 4EQOA 2L1BA 1RHPA 4DF7A 3OMCA 1QNKA 3MZ5A 3J81E 1FNWA 4L8JA 1AN8A 1LTSD 1GUNA 4IUTA 4XQQA 2JA7B 2ZXRA 4A3JB 4CKEA 1M8AA 1CZGA 2IW3A 1PLFA 1O80A 1D2BA 3G7LA 3P1HA 4IFDH 1EIHA 1QG7A 3S1RB 4CJ0B 5J39A 1TVXA 3GTLB 1NSNS 1DYQA 4X3KA 3LX0A 1YNNC 4HEDA 3EJIA 1YNJC 3M4OB 5C0XG 4O42A 3DWQA 2EJGC 4FO2A 3OPOA 1TWFB 5IT9L 4U68A 2BA0A 2PNRC 3IL8A 2LFNA 4RFBA 2F0DA 1R4QB 2KHSA 2RDFA 2J0TD 2B2UC 3VR6A 1CTMA 3H6MA 2JA8B 2A73B 1ML0D 1QNUA 1RKNA 2KQ3A 3OIPA 2JA6B 3NTKA 1SYFA 1Y69U 1JORA 1X3PA 1FD7D 5CC4A 4IUUA 1E2ZA 2EYHA 4N9PA 1SE2A 1GXDC 3P7JA 3K58A 2KUMA 4G7ZC 3I8ZA 3DUZA 4KY6A 3SVMA 1BQQT 1HFNA 3KUPA 3EA6A 4XXEA 3VA7A 1HPCA 1A3UA 4F88A 1STGA 1UEAB 1STNA 2FJ2A 2F0QA 2NVYB 2WP8J 3A8IE 3Q23A 3MEHA 4BA1I 4RCNA 1DOLA 4FVMA 5COYA 2MJ8A 5CV9A 1LTTD 1VCIA 2BOSA 3DXJC 1GHKA 4G4KA 2SDFA 5LHY1 3NWTA 3L3OC 2VB3X 2A69D 1PDQA 2HCIA 1A2TA 2CHBD 2SEBD 2MPMA 4K6DA 2QCPX 1IYVA 2F0UA 3TP7A 3TP6A 2NN6I 4J8QA 3TDQA 1EY8A 3A8JE 2A6HC 1I6VC 2D62A 5D14A 5DAUA 5IODA 3PUWA 3J80E 1SYDA 1RJTA 4S3SA 1TS4A 1EQTA 3VYSA 1QE6A 1JQYD 2JEBI 2B2UA 3PMFA 1LTID 4MIUA 2RSNA 1CQFA 3A55A 2F0OA 3KLSX 2F0EA 1RCVD 3MFGA 4C3JG 3R93A 5BN3A 4FF3A 3K5OA 1Z7TA 5A35A 2F0MA 4XTCS 5CV8A 2L9HA 2ICEC 3U9OA 1UUPA 2AUKA 1EFID 3A54A 4GZYC 2R7ZB 2VUMB 1EIGA 1OO9B 2F0TA 5CV5A 4RA8A 4BA2I 4ZRZA 1F2LA 3NHHA 2Y0SB 5KNDA 3Q24A 5JAVA 1T5EA 3OWEB 3KLRA 1WTXA 1CT1D 1IKLA 1MD2D 1YNND 3S16B 2OF1A 1NAPA 1IHZA 2O5JC 3K57A 1YNJD 3D3RA 5CORA 1O7YA 1KNEA 4G57A 4QF4A 3TN2A 2K03A 3K0YA 4XIGS 1C4QA 4C3HB 3D4RA 2E2JB 1ET9A 5ISRA 3J81L 5EPLA 5E4WC 4CKCA 5KYLA 4KK7A 1LV9A 4A3FB 1B4OA 1SYCA 1ZKOA 4F7XA 3I91A 1D6EC 2CVRA 2Q8RE 4PNYA 3DWAA 2WV6D 2X6LA 1PZKD 1HQRD 3CKIB 1WTRA 1MI2A 2LY7A 4DGZA 4DAVA 1K8MA 1CZWA 1HFGA 3PO2B 1IW7D 2SNSA 3NK9A 4A3KB 1EYCA 4H7BA 5FK9C 3W3AA 1HTPA 3I4LA 3MAQA 1SJED 2EY1A 1Y8PB 2EZVA 1LTGD 2KVMA 5EGTA 1XTCD 1DOKA 5D3IB 1W6KA 1I4XA 2OXPA 2Z8LA 2MHVA 5FO9B 1RDPD 2IJ0A 1Q1EA 3OMGA 5KNCA 3ZYYX 4ME5A 1O7ZA 1EYDA 2EYJA 3LWEA 4K5WA 2MUYA 1HUNA 4RWSC 1BCPF 2L55A 4XQNA 2PMZB 5CV4A 4DA2A 4RHSA 1RD9D 1SNDA 1B50A 4FF4A 1BXTA 3PIP3 2EYFA 4RH6A 4C3IG 5A2QE 1EY5A 3S1MB 2N55A 2RKSA 4ZKCB 2EPBA 4NP5A 3Q6SA 5LL6S 3HRZC 1SE4A 4A3MB 2KEEA 4IQZA 1JCKB 4IZ8A 1TIID 4C56C 1S5CD 3O13A 4RGMA 4CHTB 4A3IB 3Q0AA 2KOLA 5JVG3 4TQUS 3I3CA 1LT3D 1SFOB 2XN9C 2WB1B 5I9OA 3BVMA 3MTSA 3WDNA 5JJZA 1XYIA 2E75C 1ILPA 5EPKA 1BNZA 2KA7A 2AUJD 4BBRB 2K7VA 2TSSA 3HP3A 3C1EA 3S1NB 1B3AA 3SE0A 3C2PA 2K5DA 3FKIB 2L11A 2NN6H 3GP7A 1HUMA 1H9KA 1EWHA 1I4PA 3J80L 4IALA 4CKBA 4V190 1OXUA 3NQIA 1XX8A 1AW7A 4F87A 4OL7A 2HDLA 4BY7B 5KGUA 3GQBA 2M2LA 3T51B 3I4NB 3AB9A 3H09A 1BBXC 1O7LA 2D2CC 3VR2A 5K36H 2F3WA 5C0XH 1UAPA 3BDCA 3NQTA 1HQMC 1TKWB 2JA5B 2XWJB 1DCZA 2E2HB 3PUXA 1PYWD 3AMUA 1TWGB 1STBA 1JOOA 3QJYA 4C2MB 3DEPA 4B08A 5ELEA 1KNAA 2QDBA 2F0HA 1V1OA 4QMGA 1KDAA 3LWUA 3ERQA 2F0PA 4HSPA 1SBBB 1LTRD 2NYZD 3GTPB 3R2TA 3FVQA 3UI2A 1QB5D 1PZID 4X3TA 3KLSA 2VXWA 1CK1A 3SXHA 2B39A 5T1IA 1AZQA 3J7AV 1HRJA 4ZQ3A 5KYIA 3GTQB 4DN4M 1EL0A 1JWSD 4KN7C 5IOCA 4EVOA 5C3WA 5DEHA 3OOCA 3QWNA 4LJZC 4IN3A 3SR1A 3PO3B 1SNQA 1PTOB 3H91A 2PYKA 3SDZA 3V96A 3A7AB 2PPBC 1B9MA 3EFXD 3DM1A 4YIJA 3GV6A 5FO7B 1JOQA 5CYUA 2FINB 1Z47A 1FGBD 2AWNA 1DD2A 2CW0C 4RKBA 1H9MA 5FOBB 4OO1G 1IYUA 1I4RA 1TT2A 4DAYA 4J1MA 3I90A 1AFPA 2NZ1D 5JOBA 3S1QB 1Q3LA 2F4IA 3SK5A 1A15A 2K1BA 2B2YC 5D3DA 1I4QA 3PUZA 1NUCA 4HMJA 1ENAA 1GHJA 3DEOA 5A2QL 3HZXA 1ZXTA 1EU4A 1V1PB 3GD7A 3V05A 5IGBA 1PFBA 3NTHA 1TY0A 2IWHA 5IIFA 3PUYA 4DU9A 2K6AA 4E6IA 4C1NK 2B8FA 2XRSD 1Y1WB 3VR3A 3NWSA 4X3SA 1Y8NB 1A6XA 3V2TA 2ICIA 2X69A 4KV6A 2A5HA 1F9QA 5NUCA 1BDOA 4TKOB 1U4LA 4PMCA 1WVLA 1HXYD 4R8IA 3NTIA 3OHXC 4IFDJ 3I70A 3BDLA 3T56B 4HN7A 2G9DA 1LO5D 1JWMD 3QB3A 3HOWB 2F0KA 2A68C 3HOZB 1BCPB 4IUPA 1EOTA 3Q22A 2EYPA 5C4XB 2J4XA 1CI3M 3X3NA 1UNSA 2WACA 3H3VC 4ODGA 3BVGA 2OEOA 5IGGA 3KBXA 1H9JA 2NBFA 3N52A 5J1ZA 2F0FA 1DM0B 2E2DC 1SMYC 4IFDG 2DNEA 3DMUA 4Y7NB 2F0LA 1LABA 2B2YA 3AU7A 3R8BA 4U673 1ESRA 4NW2A 3T4AC 2EY5A 1I4GA 1CQVA 1G291 1PTOC 2EYOA 2G9HD 2GA4B 4ZKBB 5ELFA 1WTPA 2F0JA 3SK8A 5C0XI 1V8QA 3CRLC 1PMRA 4K8JA 3OIQA 1II3A 4KTAA 5EJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3H G;  4C3J G;  4C3I G; 
#chains in the Genus database with same CATH topology
 1JR0 D;  4ZUJ A;  3K80 C;  1F2Z A;  1PTO F;  3PIP A;  4V0B A;  4X62 L;  3S1N H;  2NUC A;  2PW5 A;  3S9W A;  1B70 B;  1Q90 A;  1QCB D;  2UXC Q;  2CQO A;  1XMO Q;  4KJO A;  2K5Q A;  1G91 A;  3RN2 A;  3FKI H;  1B44 D;  1WJJ A;  3JAM i;  2ZTD A;  2VQF L;  2UXC L;  1AZP A;  3R2I A;  2AQ1 B;  4IUN A;  5E1F A;  4DAP A;  3A0J A;  4DNT B;  1K0S A;  3DLL A;  2AKW B;  1KDC A;  4UPA A;  4N9T A;  1KAA A;  3M3Y B;  4AYB B;  5FO8 B;  2NZO A;  3URY A;  4DXG A;  2FHT A;  3E5S A;  1DJR D;  3C1F A;  2Q8T A;  5JPN C;  2R93 B;  4BY7 H;  2F3I A;  1VQI A;  4JI5 Q;  4M1U B;  4C3J B;  2D9U A;  2YU9 H;  4EX5 A;  3R3O A;  3BVZ A;  4LF9 Q;  1V9P A;  1LTB D;  3HKZ E;  3I4N H;  4JI5 L;  1HTL D;  4BBS B;  3NBH A;  2EYM A;  2FMM A;  4QIW E;  2QKI C;  4JVZ A;  5BR8 L;  1SJH D;  2C35 B;  4EQ5 A;  3H94 A;  5KIX A;  1EYG A;  3MXN B;  2JA5 H;  2EIF A;  4C1N I;  1TQO A;  3HG9 A;  1PV4 A;  1N34 Q;  4OWX B;  4WJ3 M;  3FEW X;  5JEA H;  2KCM A;  3FDT A;  3G48 A;  4NXM L;  3RZO B;  1NMG A;  3S17 B;  1TWG H;  3K7A B;  4B3T Q;  3TZD A;  1G6P A;  4FNF A;  1CUK A;  3L0O A;  1QOH A;  1GUT A;  1BR9 A;  4C2M H;  1TWH B;  3CME A;  2KCC A;  1ICF B;  4B9W A;  1STY A;  1KD1 C;  2J7Z A;  1SNM A;  1IL8 A;  1F2M A;  5GQO A;  2HDM A;  4JI3 Q;  1I50 B;  2XNA C;  1R4P B;  1O78 A;  1KLU D;  1PH6 A;  3KF8 A;  1OXV A;  5M3F B;  2PO4 A;  2Z4I A;  4I7Z C;  3GTP H;  4KY5 A;  2L0C A;  5ELO A;  1BCP C;  4RGN A;  2LMC B;  3M85 A;  2K5W A;  4ZK9 B;  2EJM A;  4NMZ A;  4Y52 H;  2A68 D;  4LFA Q;  3H3V H;  1ZYR C;  4LK1 C;  5HGQ A;  5IGE A;  4YWK A;  3CAM A;  1EEF D;  5EKK A;  3SGI A;  4X64 L;  2X6G A;  1E1O A;  4HJ8 A;  1L1O C;  1MGS A;  1YHQ A;  4DR3 Q;  1S5D D;  3MA2 B;  4WRD A;  1CA5 A;  1K28 A;  2IY5 B;  3QOL A;  2AQ2 B;  4DNR B;  3TME A;  4IJL A;  3EQL C;  5BN4 A;  4FYD A;  3GTQ H;  1G2T A;  2XWB B;  3IKJ A;  4JBW A;  1NE3 A;  4K0K L;  4XYQ A;  4ME3 A;  1SRO A;  2A6H D;  1FNU A;  4R4C A;  4GKJ L;  3ERS X;  1VQ6 A;  2CWP A;  4DFA A;  3HOV G;  3IFT A;  2Z1C A;  4IUQ A;  1CKO A;  2D0P A;  4RCO A;  3PO3 H;  4UP8 A;  1PTO H;  4TRD A;  1SNP A;  3TQY A;  3SHL A;  4DV0 Q;  5HY6 A;  4DV7 Q;  3FRP B;  3WOF A;  5M5W B;  2RF4 A;  4GNX B;  3QG1 A;  2P5Z X;  3HS0 C;  5FJ8 H;  4KN4 C;  4A3D B;  1V1P A;  1SMX A;  3D8G A;  4DV7 L;  4KY7 A;  1SRU A;  3D31 A;  3TP8 A;  2IHF A;  2JEA I;  4HR7 B;  1PTO D;  1SNC A;  2I46 A;  5C3X A;  2CCZ A;  1O7I A;  4A3G B;  1KXL A;  4PMW A;  5JVH 3;  2AQ3 B;  3A8K E;  4K6L A;  2UUC Q;  1WTQ A;  1PYB A;  1PH5 A;  3C3L A;  1FVI A;  4JK1 C;  4Q5V A;  4PV1 C;  4AH6 A;  1MHW C;  4RMF A;  4ULL A;  3AEV A;  3VR5 A;  2UUC L;  2MGS A;  3QIA A;  3J7A F;  4IO9 A;  1S5B D;  5DM7 3;  1XWE A;  3S1Q H;  1KDB A;  3MXG A;  1A63 A;  2KED A;  4BY1 G;  3U58 A;  2KEC A;  4B3S Q;  4FXD A;  2BA1 A;  2XVS A;  3J7A 5;  1FL0 A;  3EBE A;  1K9M C;  4JG2 A;  3MHB A;  4DV1 L;  2YTV A;  4M8A A;  1WYD A;  4L6T B;  3P20 A;  5IP7 G;  1SSO A;  1EQR A;  3CRK C;  5JJI A;  1YIJ A;  1SEB D;  3STB C;  3HOU B;  3MWY W;  2L5T A;  4C3I B;  4HSV A;  2F0G A;  4XT3 B;  3KLW A;  4ABN A;  1OXX K;  4G7H C;  2QEJ C;  2SNM A;  2ZJQ A;  1HA6 A;  1U4M A;  1VQJ A;  1VDZ A;  1B1Z A;  2E76 C;  2EY2 A;  4HTH A;  1AE3 A;  1TWC B;  4JI2 L;  3K5L A;  1RL2 A;  1A3V A;  5E7N A;  4I65 A;  4A93 G;  1TY2 A;  3CU7 A;  2YU9 B;  3J81 c;  1Y1W H;  4JI1 L;  5EKL A;  1HJP A;  1R9T B;  1L1O A;  2LKV A;  4OGQ C;  2JXM B;  1Q12 A;  1ASZ A;  3NP8 A;  2UUA Q;  3H0G G;  4WFN 3;  3HOY B;  1M4V A;  3GTM B;  5M3M B;  2UUB Q;  1HHV A;  2Z6K C;  2PZU A;  3N6R A;  3BS1 A;  3CCL A;  1H9S B;  2WAQ B;  1B53 A;  2OT2 A;  1JIC A;  3PIO A;  1PH1 A;  4QUF A;  1ILQ A;  4NKL A;  1IBK L;  2UUB L;  1KAB A;  4N8F A;  1B2T A;  4X65 L;  3OSO A;  1UE6 A;  1E0B A;  3OW7 A;  4IOC A;  2CWA A;  1KL9 A;  2Z4H A;  3WOE A;  5J22 A;  1WCM B;  3DWP A;  4IUR A;  3HOW H;  4OIK A;  5K5P A;  1QVC A;  2MNA A;  3HOZ H;  2KCN A;  3L7Z C;  1U9R A;  1OTC A;  3FPP A;  4JI6 Q;  3BYY B;  1STA A;  2XRQ D;  1D5M C;  3MVV A;  1ROD A;  2RDH A;  3KK7 A;  5KEE A;  5C4X H;  2DUD A;  2EDG A;  1FJG L;  1PH2 A;  1LTL A;  1SDF A;  2WKC A;  1E3P A;  1A62 A;  1LT5 D;  2IX1 A;  3BDO A;  2JA7 G;  1BCP D;  3P75 A;  4IOA A;  5FLX E;  4A3J G;  5C3E B;  2B2V C;  5IWA Q;  1KTK A;  3D6W A;  5IP9 G;  1WD0 A;  5EPJ A;  1QVG A;  1DXM A;  3KYH C;  2E5L Q;  2A69 C;  1E7Z A;  1JC7 A;  4L63 B;  2O5I C;  2I5H A;  4K5V A;  4L5Q A;  4Y7N H;  3NSW A;  4B9X A;  4YHH Q;  4PZ8 A;  2K5H A;  3NEL A;  3F2U A;  1X32 A;  4DK0 A;  2E5L L;  4B3R L;  3M7N A;  2R6G A;  4KI0 A;  4FDB A;  3X3M A;  3ULL A;  3TZU A;  5GAH C;  3A7L A;  3ERO A;  4FF2 A;  2N8N A;  4IUV A;  2O2L D;  2DN8 A;  2Z0S A;  3W2D A;  3K5M A;  1XNQ Q;  2K32 A;  3CW2 C;  2FFK B;  1MJC A;  2VY3 A;  2JSO A;  2I5M X;  1WTO A;  1WTV A;  4HMI A;  1JOK A;  4JI8 L;  2BDN A;  1K3B C;  2QW7 A;  1FR3 A;  5C0X J;  1I4H A;  5CBA E;  1YHB A;  2EY6 A;  2EOT A;  2JA8 G;  2NN6 G;  2F0W A;  3KFU A;  5C4H A;  3ULP A;  2C5C A;  5T1G A;  3VDY A;  1HNW L;  4JI0 L;  2I07 B;  1EIF A;  2EE1 A;  2RSO A;  1DZ1 A;  4EGV A;  2HUG A;  3MXN A;  3GTG B;  4DV5 Q;  3CCQ A;  1B9N A;  4HAE A;  5AFW A;  3B6Y A;  4A3E H;  2JA6 G;  4A3B B;  2R92 B;  5M5X B;  2K05 A;  5CMD A;  1PFM A;  5ELB A;  1HZC A;  3MXP A;  1GUW A;  4HJA A;  4LUO A;  5ELC A;  3D4W A;  1N8R C;  1A0I A;  1VF5 C;  4ZCK A;  3T1H L;  1PZJ D;  2ID0 A;  1L0Y B;  3HEJ A;  1I94 Q;  2PW7 A;  3SK6 A;  1J8I A;  2R93 H;  1K8A C;  1VQ7 A;  5K36 G;  3STB D;  2DNC A;  3TBI B;  3SEB A;  4C3J H;  2EXZ A;  1K3R A;  2KHJ A;  1K8O A;  3M4P A;  2QDL A;  1RF2 D;  4X3U A;  1SYE A;  3PIO 3;  1QIL A;  3L2P A;  5BN5 A;  5ELD A;  1C9O A;  4BBS H;  3J80 c;  1BOS A;  1N32 L;  3MC0 B;  2QIL A;  4ZLT F;  4K8I A;  4DR4 L;  2B2V A;  2R3Z A;  4UHV A;  5C44 B;  4IPG A;  3FP9 A;  4NB3 A;  4WJW A;  1K8G A;  1SYB A;  1V1Q A;  3RZO H;  4UY8 C;  3K7A H;  4GKK Q;  4LFC L;  4KD4 A;  3F2D A;  2VW9 A;  1YEZ A;  1CHP D;  1ET6 A;  3S14 B;  3HKS A;  4LAA A;  2ZT9 C;  1VQD A;  1TWH H;  1VQ4 A;  1LUZ A;  1STH A;  2ZXP A;  2Q8I B;  1S3O A;  3GDE A;  2N49 A;  2VNU D;  3T53 B;  1EY7 A;  2B8G A;  4R4T A;  1I50 H;  3BZK A;  4YCW A;  4KHV A;  1CM9 A;  1IBM Q;  4GN3 B;  1D5Z C;  3BZC A;  3D6C A;  3UDF A;  4GS3 A;  5M3F H;  3CHB D;  2RQX A;  5C4Z A;  4GNX A;  1GUS A;  2V4D A;  2A74 C;  3HOX B;  1K83 B;  4DR6 Q;  1IW7 C;  4TSS A;  2GVA A;  2F3V A;  3PCO B;  2ZJP A;  3TSS A;  4F8M A;  4LUZ A;  4DR6 L;  3K6O A;  1EQV A;  2KEN A;  4OHJ A;  4WOR A;  1GUG A;  4DPG A;  2HQE A;  1S5E D;  4DV6 Q;  5EQ0 A;  5GAE C;  1F77 A;  1EY6 A;  3IRB A;  2B2T C;  2SOB A;  1CA6 A;  1HCZ A;  1Z6H A;  3GTK B;  1D1K A;  3LNN A;  2VUM G;  2R7Z G;  1HZA A;  2K33 A;  2H1E A;  1QVF A;  4LF7 L;  1MBY A;  5IYB G;  2L12 A;  5EBC A;  2K28 A;  1EEI D;  4PMB A;  4N8X 1;  1ESF A;  3M7G A;  2WII B;  4PZ7 A;  2Y0S G;  4HCE A;  2EYL A;  2PZT A;  3S2H B;  1C48 A;  2CH4 A;  5KRU A;  3I4M B;  1PRT B;  1FNV A;  2XGT A;  2F0V A;  2B63 B;  4A3D H;  1HZ9 A;  2UXB L;  3PGZ A;  3S15 B;  1JWU D;  1H9R A;  1XPR A;  4OO1 I;  3HKZ B;  1MSG A;  4PQX A;  5IYD H;  4K2L A;  2MP1 A;  5C5M A;  3ONA B;  5C4J B;  1TS2 A;  4QIW B;  1U4P A;  1N36 L;  3OW2 A;  4MHE A;  4C3H G;  2IHE A;  1XXG A;  2JJQ A;  3QOJ A;  1S4Z A;  4J6H A;  2N88 A;  3KDF A;  1XJV A;  1PXU A;  1YJW A;  1EY0 A;  3VYU A;  5F2D A;  5IYC G;  3ULJ A;  3KJO A;  4A3F G;  4ZAI A;  3VR4 A;  2F0S A;  4XQJ A;  1KLG D;  3I72 A;  1XNR L;  2VQF Q;  2CW0 D;  5CV6 A;  1AEX A;  5FLX L;  2CQA A;  2JP1 A;  4A3E B;  1CFM A;  1H9S A;  3TRE A;  1GVP A;  1IKM A;  2IL8 A;  2NVX H;  1G8Z D;  3HOU H;  5IGF A;  1DON A;  1VF7 A;  4C3I H;  1C8C A;  4KMU C;  1W6J A;  1LT4 D;  4OIJ A;  1QWY A;  2WFW A;  2NWG A;  5IE8 A;  5AJ3 Q;  1EWC A;  4CBV A;  3RLN A;  3U9S A;  1SYG A;  5EKI A;  2R61 A;  1TS5 A;  3W1B A;  5AJ3 L;  5DM6 3;  3HFZ B;  3C46 A;  1TWC H;  4CJ2 C;  4QY7 A;  4XT1 B;  2AMC B;  4KKU A;  3NPP A;  3PO2 G;  1EY4 A;  1OXS C;  2M9V A;  5E3F A;  2HCC A;  1VQM A;  1D1I A;  5BR8 Q;  4A3K G;  2RCF A;  3E3X A;  5G3L F;  4DV4 L;  5HUR A;  1R9T H;  1MSH A;  4CDE C;  2KHI A;  3CC7 A;  1Y1V B;  2A1A A;  4DR2 Q;  3JAM E;  2B2T A;  3HOY H;  5JJK A;  1ENC A;  4NXM Q;  4EQN A;  3GTM H;  5M3M H;  1U4R A;  1NBW A;  4K5X A;  3F2C A;  1PFN A;  3K59 A;  2A8V A;  4R9W A;  1X3Q A;  4DR2 L;  4H44 C;  1T5X D;  4LWC A;  4Z9C B;  2OQ0 A;  4UAI A;  2PQE A;  1WTH A;  3T13 A;  3HGB A;  3PF4 A;  1LYL A;  3BG3 A;  1KRS A;  4P2C B;  2DY7 A;  2B3G A;  3RUZ A;  4RHR A;  4DK3 C;  2KCT A;  1WCM H;  1YBY A;  3NBI A;  2JN4 A;  2KBN A;  3NUC A;  3NE5 B;  3W1G A;  1Y14 B;  2XTI A;  1EOV A;  2B2W C;  2IPK D;  4RAU C;  5GAD C;  3F2B A;  2F1M A;  3NXW A;  2Y0S E;  2FMC A;  2IT1 A;  3TP5 A;  1ICW A;  2BE5 C;  5I6Y A;  2XIW A;  3I73 A;  4ILW A;  1SXT A;  1EYA A;  4QB4 A;  4JW0 A;  3I56 A;  1E22 A;  1CHQ D;  1EZ8 A;  1GUO A;  1AP0 A;  4JPB W;  5C3E H;  1ASY A;  4HJ7 A;  4DR1 Q;  4IFD I;  4X64 Q;  5DNF A;  4Q0F A;  4K14 A;  3UDX A;  4OEL B;  1AE2 A;  4A3M G;  4CDF C;  2WKD A;  3VYR A;  4DR1 L;  1GOZ A;  1B8A A;  1U5K A;  2A6E C;  5FKA C;  3VYT A;  3ND8 A;  5J3B A;  3Q8D A;  4RGO S;  3T16 A;  4K0K Q;  2PZW A;  5H1S E;  4A3I G;  1KQS A;  4GKJ Q;  4OEM B;  1FYC A;  2WIN B;  5I9P A;  2ZM6 Q;  3D0F A;  2ES2 A;  1JJC B;  5IGC A;  1EQQ A;  2DY8 A;  4MN3 A;  1Q8I A;  2WB1 G;  2H5X A;  2E74 C;  2HT1 A;  3L9A X;  1PFS A;  1F2Y A;  1A2U A;  1EIY B;  2NVQ B;  4BS9 A;  1SE3 A;  2F0I A;  2ZM6 L;  1ONL A;  1CKN B;  4YCV A;  4LMQ D;  1BUV T;  4DUY L;  2YTX A;  1SAP A;  1SMY D;  4JYA L;  1A3T A;  5I4D A;  1D5X C;  2CFM A;  4BBR G;  3RD4 A;  3CCU A;  3GTO B;  1K0R A;  4HJ5 A;  3IAY A;  1KC8 C;  5CBE E;  5IT9 E;  1PRT C;  1S5F D;  3J7Y W;  1BF4 A;  1E2W A;  1B3Q A;  4FP5 D;  4QCL A;  3UE1 A;  1G2S A;  5C5L A;  4CGY B;  1LTA D;  4KHZ A;  1F9R A;  3FKI G;  5M9O A;  3FHW A;  5I2Y A;  1QJO A;  4LFB L;  4NDX A;  1PH4 A;  5M5Y B;  1LM0 A;  1TS3 A;  1JJ2 A;  1NJI C;  1KRT A;  4O1N A;  2D5D A;  4XYO A;  2NB0 A;  5CR3 A;  1NR2 A;  5JEA J;  2Q2I A;  1VQF A;  1PRT F;  3GTG H;  3ND9 A;  4QUC A;  2PI2 A;  2JYO A;  4NXN L;  4PG3 A;  2M00 A;  4JI7 Q;  2NVT B;  3JC6 6;  4A3B H;  2K01 A;  2R92 H;  5M5X H;  2C9O A;  1I6H B;  1TXY A;  4ALP A;  4WJ4 A;  4BY7 G;  2ZJR A;  4L5T A;  2IX3 A;  3EVQ A;  4DV1 Q;  4JI7 L;  5LMU L;  4JOI C;  4DV2 L;  2YYZ A;  3FPU B;  1NCV A;  2PCF B;  2LS0 1;  3I4N G;  4A3L H;  1ZEQ X;  2MQH A;  3E0J A;  1W3S A;  4ZUI A;  2OWO A;  3HOV B;  2NVX B;  1TWA B;  3S2D B;  1VMC A;  3OYY A;  5FLX c;  2VZA A;  2B2W A;  3E6Z X;  1WD1 A;  2AWO A;  2EJF C;  2ZTE A;  2JA5 G;  2TMP A;  3VA5 A;  3RMH A;  1TU2 B;  2KJX A;  5JEA G;  5G3L D;  1VQO A;  1H95 A;  4JI2 Q;  4FXK C;  4EQP A;  1HNX Q;  2AHO B;  2RBM A;  2ASB A;  3SK4 A;  5E4X A;  1OXT A;  4ID6 A;  2DGY A;  5JPM C;  2Q2U A;  1STE A;  1WI5 A;  1ENF A;  2PMZ E;  1HNX L;  1LAC A;  4JI1 Q;  4O2D A;  1KAW A;  5C44 H;  5EBD A;  1HR0 W;  2VB2 X;  5LL6 X;  4RGT A;  3KBG A;  3PV0 A;  2IX0 A;  3KF6 B;  3QO2 A;  3MEF A;  4OO1 H;  1SNO A;  3S14 H;  3RZD B;  3IFD A;  1GM5 A;  4X6A H;  1Q1B A;  2O4X A;  1BKB A;  4JV5 Q;  3FMC A;  1WFQ A;  5CV7 A;  2K04 A;  1RTO A;  2K14 A;  2I0Q A;  1TR5 A;  3W5O A;  1IBK Q;  2RVL A;  5TSS A;  3A56 A;  1J5E L;  4BY1 B;  4X65 Q;  1BO0 A;  4JV5 L;  4UDU C;  4DXF A;  1EY9 A;  5KNB A;  3OWF A;  2ENB A;  1CSP A;  1LT6 D;  2NTT A;  2NTS A;  1RTN A;  1I3Q B;  3M4Y A;  1L0X B;  2WB1 E;  4FXG C;  2F0N A;  3RLF A;  1JB3 A;  2G5D A;  3HOX H;  1LLR D;  1K83 H;  3G6J B;  3CQZ B;  2LSS A;  1FJG Q;  3BYT B;  4KJN A;  2RCN A;  2BDO A;  1Y8O B;  2H4O A;  4K2K A;  4BWG B;  5IGD A;  5I2X A;  4ZYS A;  2BE5 D;  3TS0 A;  1WTW A;  1X65 A;  2RDG A;  5C6A A;  1GJX A;  3KJP A;  3PO3 G;  1MJE A;  3CC2 A;  4HJ9 A;  2XSC A;  4DK1 A;  4A93 B;  2DJF C;  4UP9 A;  1F9S A;  4H0L C;  3WWV A;  4X66 L;  3GTK H;  1EZ6 A;  1ZYR D;  3UDG A;  4HID A;  1VQG A;  3K5N A;  3J81 i;  5FJ8 G;  3MXU A;  3H15 A;  5LMN L;  3MFY A;  4JOI A;  1GD7 A;  4B3R Q;  3H0G B;  1J9O A;  4J15 A;  2A6E D;  4KKT A;  1PH9 A;  1JE4 A;  4G7O C;  4B3M L;  2EVB A;  4LF4 Q;  2JA9 A;  2RA4 A;  3JAM L;  1EU3 A;  1DGS A;  1L2F A;  1F9P A;  1V43 A;  4IPD A;  2JE6 I;  1IZ6 A;  4DR5 L;  3S2H H;  3BZD B;  2L4N A;  2F03 A;  1JT8 A;  1K73 C;  3ITP A;  4DAM A;  3GTJ B;  3I4M H;  1E2V A;  2QF7 A;  4R8N A;  5I6W A;  4LF4 L;  1DOM A;  3CPW A;  1VQA A;  4KKS A;  4CJ1 B;  2ZXO A;  2B63 H;  1C7Y A;  4KD3 A;  3D4D A;  1YJN A;  1VMP A;  1G6Z A;  5D65 A;  3S15 H;  1HA5 A;  1NR4 A;  5HGT A;  3DHQ A;  5CGK A;  4HCS A;  4H13 C;  4FF1 A;  2BCO A;  2Q2H A;  2E2I B;  4RKL A;  4JI8 Q;  3PUV A;  3GV3 A;  1XPO A;  2K5N A;  3GO5 A;  4JBM A;  1PRT D;  4XDX A;  5DLQ E;  4EQO A;  5C4J H;  3TS2 A;  4A76 A;  2L1B A;  1RHP A;  4L5R C;  4DF7 A;  3OMC A;  1QNK A;  3MZ5 A;  4A75 A;  3J81 E;  1FNW A;  1HNW Q;  4L8J A;  2WAQ E;  1AN8 A;  4JI0 Q;  1LTS D;  1GUN A;  1PYS B;  4IUT A;  1SR3 A;  4XQQ A;  3BU2 A;  2JA7 B;  4DR7 L;  2ZXR A;  5FLM H;  2A19 A;  5JJL A;  4A3J B;  4CKE A;  1M8A A;  1CZG A;  2IW3 A;  3K81 C;  1PLF A;  1O80 A;  5LMN W;  1GO3 E;  2F52 A;  2Z6K A;  1D2B A;  3G7L A;  3P1H A;  4IFD H;  1IYJ B;  3T1H Q;  1EIH A;  1QG7 A;  3S1R B;  4CJ0 B;  5J39 A;  1TVX A;  3GTL B;  2BH8 A;  3EIV A;  4BXX H;  4A3C G;  1T9H A;  1Y1W G;  1NSN S;  1DYQ A;  1QUQ B;  4UP7 A;  4X3K A;  3LX0 A;  1YNN C;  4HED A;  3EJI A;  3S16 H;  1YNJ C;  3M4O B;  3AYH B;  5C0X G;  4O42 A;  3DWQ A;  2EJG C;  4FO2 A;  1N32 Q;  3T1Y L;  1PH8 A;  4GLA C;  3U4Z A;  3OPO A;  1TWF B;  5IT9 L;  4DR4 Q;  4U68 A;  2BA0 A;  4C3H H;  2PNR C;  3IL8 A;  2LFN A;  4RFB A;  1Y1V H;  2F0D A;  1R4Q B;  2KHS A;  1PA6 A;  4OX9 L;  2E8G A;  4LNQ A;  2RDF A;  1IXR A;  2J0T D;  2B2U C;  3VR6 A;  1CTM A;  3H6M A;  1XPU A;  2JA8 B;  2A73 B;  1ML0 D;  4LFC Q;  3HOW G;  1QNU A;  3HOZ G;  1RKN A;  1IBL Q;  1YVC A;  4KHP Q;  2KQ3 A;  2JQO A;  2LXK A;  3OIP A;  4YY3 L;  3CF5 A;  4O0A A;  2JA6 B;  3NTK A;  5C4X G;  1IBL L;  1SYF A;  1Y69 U;  4KHP L;  1JOR A;  1X3P A;  1FD7 D;  5CC4 A;  1CKN A;  4IUU A;  1E2Z A;  2EYH A;  2ALY B;  3CMA A;  3E9I A;  1EUJ A;  1JB7 A;  3RR5 A;  4N9P A;  1KHI A;  1SE2 A;  1GXD C;  3P7J A;  2UXD Q;  3K58 A;  2KUM A;  4PZ6 A;  4G7Z C;  3I8Z A;  3DUZ A;  4KY6 A;  3SVM A;  1BQQ T;  1HFN A;  3KUP A;  3EA6 A;  2PNH A;  4XXE A;  3VA7 A;  1HPC A;  1UEB A;  2UXD L;  1A3U A;  4F88 A;  1STG A;  1UEA B;  1STN A;  2FJ2 A;  2EQS A;  4POF A;  3CCJ A;  2F0Q A;  1M90 C;  4OWW B;  2NVY B;  4JBK A;  2WP8 J;  3A8I E;  1QZH A;  3Q23 A;  3MEH A;  4BA1 I;  4RCN A;  1DOL A;  4FVM A;  5COY A;  2B29 A;  3J80 i;  1HNZ L;  2F4V L;  1NMF A;  4LF5 L;  2MJ8 A;  1PH3 A;  4LF7 Q;  5CV9 A;  1LTT D;  1VCI A;  1YJ9 A;  1VQ8 A;  2BOS A;  3DXJ C;  3I4O A;  2NVQ H;  1GHK A;  4G4K A;  2SDF A;  5LHY 1;  3NWT A;  3L3O C;  4RG1 A;  2VB3 X;  4R1J A;  2A69 D;  1PDQ A;  2D0O A;  1A2T A;  2CHB D;  2HCI A;  2SEB D;  2MPM A;  1A8V A;  2QCP X;  4K6D A;  3GTO H;  1IYV A;  2F0U A;  3TP7 A;  3TP6 A;  1FGU A;  2NN6 I;  4J8Q A;  2UXB Q;  4JBJ A;  3TDQ A;  1EY8 A;  3A8J E;  4GLV B;  2A6H C;  3JAM c;  1I6V C;  2D62 A;  5D14 A;  5DAU A;  4MTN A;  5M5Y H;  5IOD A;  3PUW A;  3J80 E;  1N36 Q;  1SYD A;  1RJT A;  1KIX A;  4S3S A;  1S72 A;  1TS4 A;  1EQT A;  3VYS A;  1QE6 A;  4AYB G;  1JQY D;  3I55 A;  1EFW A;  2JEB I;  2B2U A;  3PMF A;  1LTI D;  4MIU A;  2NVT H;  2RSN A;  1CQF A;  1I6H H;  3A55 A;  2F0O A;  2R93 G;  3KLS X;  3KF6 A;  1N9W A;  4JI4 L;  3BJU A;  2F0E A;  5L37 A;  1XNR Q;  1RCV D;  3MFG A;  4C3J G;  3R93 A;  5BN3 A;  4AQY Q;  4FF3 A;  3K5O A;  1Z7T A;  3AQQ A;  5A35 A;  2F0M A;  2R7D A;  1X3G A;  4XTC S;  5CV8 A;  2L9H A;  2ICE C;  3U9O A;  1UUP A;  2HIX A;  2AUK A;  2HIV A;  1EFI D;  3A54 A;  4AQY L;  4GZY C;  2R7Z B;  2VUM B;  4BBS G;  1OO9 B;  1EIG A;  3HOV H;  1TWA H;  2YV5 A;  2F0T A;  3S2D H;  5CV5 A;  4RA8 A;  4BA2 I;  4BBR H;  4ZRZ A;  1F2L A;  3NHH A;  2Y0S B;  5KND A;  3Q24 A;  5JAV A;  1IL2 A;  1JJG A;  1VQB A;  1T5E A;  4HIM A;  3OWE B;  3KLR A;  1WTX A;  1CT1 D;  1Q8K A;  1IKL A;  1MD2 D;  1YNN D;  2RHS B;  3RLO A;  4MTK A;  3S16 B;  2OF1 A;  1NAP A;  1IHZ A;  1I5F A;  2O5J C;  3K57 A;  1YNJ D;  3D3R A;  4DV4 Q;  1XMO L;  5COR A;  1O7Y A;  1KNE A;  4G57 A;  4QF4 A;  3TN2 A;  5GAG C;  2K03 A;  3CPF A;  3CXC A;  3K0Y A;  4XIG S;  1C4Q A;  4C3H B;  3RZD H;  5M3F G;  3D4R A;  2E2J B;  1ET9 A;  5IT9 c;  5ISR A;  3J81 L;  5EPL A;  5E4W C;  4CKC A;  5KYL A;  4KK7 A;  1LV9 A;  4BY1 H;  4A3F B;  1B4O A;  1SYC A;  1MKH A;  3U50 C;  1ZKO A;  4LUV A;  4F7X A;  3CCV A;  3I91 A;  2CH4 W;  3U4V A;  5IP7 H;  1D6E C;  4LF9 L;  2CVR A;  1I3Q H;  2Q8R E;  4PNY A;  3DWA A;  4IPC A;  3PSI A;  2WV6 D;  2X6L A;  1PZK D;  3CQZ H;  1HQR D;  2E2H H;  3CKI B;  4DAY B;  1WTR A;  1MI2 A;  2LY7 A;  3I7F A;  4DGZ A;  2MO1 A;  1EWI A;  2DJG C;  1N34 L;  1JE5 A;  4DAV A;  4B3T L;  3AFP A;  4A93 H;  1K8M A;  2OCE A;  1CZW A;  1HFG A;  2K50 A;  3PO2 B;  1IW7 D;  2SNS A;  3NK9 A;  3CCR A;  4A3K B;  1M1K C;  1EYC A;  4H7B A;  5FK9 C;  3W3A A;  2HQL A;  1HTP A;  3I4L A;  4JI3 L;  4A3D G;  3I2Z A;  1VQ5 A;  4IPH A;  2R7F A;  3H0G H;  4AYB E;  3MAQ A;  4HIK A;  1SJE D;  3M9B A;  2EY1 A;  1Y8P B;  2EZV A;  5IYD G;  4A3G G;  1LTG D;  2KVM A;  5EGT A;  1XTC D;  3TEH B;  1DOK A;  3GTJ H;  5D3I B;  4DUY Q;  1W6K A;  1I4X A;  1X55 A;  2OXP A;  2Z8L A;  2K75 A;  2MHV A;  5FO9 B;  4JYA Q;  1RDP D;  2IJ0 A;  1Q1E A;  3OMG A;  5KNC A;  3ZYY X;  2QA4 A;  4ME5 A;  4KLK A;  1O7Z A;  2RHQ B;  1UE5 A;  4LFA L;  1EYD A;  2EYJ A;  2MO0 A;  1L0W A;  1QUQ A;  1S40 A;  2E2I H;  3LWE A;  4K5W A;  2MUY A;  1HUN A;  4RWS C;  1BCP F;  2L55 A;  4XQN A;  4LFB Q;  2OQK A;  3CP0 A;  4DR3 L;  2PMZ B;  5CV4 A;  2Q2T A;  4DA2 A;  4RHS A;  3F8T A;  1RD9 D;  3RN5 A;  1SND A;  2QGQ A;  1PVO A;  2VL6 A;  3HOU G;  1HR0 Q;  4GLX A;  1B50 A;  3A74 A;  4FF4 A;  1BXT A;  3PIP 3;  4DV3 Q;  2EYF A;  4RH6 A;  4C3I G;  5A2Q E;  4L5S A;  1EY5 A;  4NXN Q;  2JA7 H;  3S1M B;  3CC4 A;  2N55 A;  2RKS A;  2EXD A;  4A3J H;  1X9N A;  4ZKC B;  1HR0 L;  2EPB A;  2NZH A;  1VQ9 A;  1XMQ Q;  4DV3 L;  1P8L A;  5IP9 H;  4NP5 A;  2UU9 Q;  1N33 Q;  3Q6S A;  5LL6 S;  4OWT B;  3HRZ C;  1SE4 A;  4R4I A;  4CDD C;  5LMU Q;  4R4O A;  4A3M B;  4DV2 Q;  4DV0 L;  2KEE A;  3EN2 A;  1XMQ L;  2Z6B A;  4IQZ A;  4QL5 A;  1JCK B;  4IZ8 A;  2UU9 L;  5GRO A;  1TII D;  4C56 C;  1S5C D;  1N33 L;  3O13 A;  3S1R H;  4RGM A;  4CHT B;  4A3I B;  3Q0A A;  1QZG A;  4A4I A;  1Q7Y C;  3GTL H;  2KOL A;  5JVG 3;  4TQU S;  1Q81 C;  3I3C A;  1LT3 D;  1SFO B;  2XN9 C;  1GKH A;  2WB1 B;  5I9O A;  3BVM A;  3MTS A;  3WDN A;  5JJZ A;  1XYI A;  2E75 C;  1SN8 A;  3CD6 A;  1ILP A;  4DK6 C;  5EPK A;  1BNZ A;  3M4O H;  3HOY G;  2KA7 A;  1Q82 C;  2AUJ D;  5M3M G;  2K5V A;  4BBR B;  1B7Y B;  2K7V A;  1X3F A;  2TSS A;  3HP3 A;  3C1E A;  1UE7 A;  2WAQ G;  3S1N B;  1TWF H;  1B3A A;  4GOP B;  3SE0 A;  5EAY A;  3TRZ A;  1YNX A;  3C2P A;  2K5D A;  3FKI B;  4B3S L;  2BH2 A;  2L11 A;  1HH2 P;  2JA8 H;  2NN6 H;  3GP7 A;  2N78 A;  1HUM A;  1WCM G;  1H9K A;  1EWH A;  2ZTC A;  1I4P A;  4P72 A;  3J80 L;  4IAL A;  4MZ9 A;  1PHJ A;  4CKB A;  4V19 0;  1OXU A;  4H02 A;  2JA6 H;  2OTJ A;  3NQI A;  3RNU A;  1J5E Q;  1XX8 A;  1J6Q A;  1AW7 A;  4F87 A;  2OTL A;  4OL7 A;  2HDL A;  4BY7 B;  3QR8 A;  3PF5 A;  1Z9F A;  5KGU A;  3K7U C;  5C3E G;  4A3C H;  3LGJ A;  2PQA B;  3GQB A;  3KDF B;  2M2L A;  3T51 B;  3I4N B;  1X54 A;  3AB9 A;  3H09 A;  1BBX C;  4MNO A;  1O7L A;  2D2C C;  1VQC A;  1Q46 A;  3VR2 A;  3DM3 A;  5K36 H;  2YTY A;  4DNI A;  2F3W A;  5C0X H;  1UAP A;  3BDC A;  1YHA A;  3NQT A;  1HQM C;  1TKW B;  4QGU A;  2JA5 B;  1W2B A;  2UUA L;  4DKA C;  2XWJ B;  1DCZ A;  3E0E A;  2E2H B;  3PUX A;  4CDC C;  1PYW D;  2NVY H;  4QQB X;  3AMU A;  1TWG B;  2I5L X;  1X6O A;  1C0A A;  1UE1 A;  1STB A;  4DUZ Q;  1JOO A;  4P75 A;  4X66 Q;  1SE8 A;  3QJY A;  3DEP A;  4C2M B;  4B08 A;  5ELE A;  1KNA A;  1BBW A;  3CCS A;  2QDB A;  1VQN A;  3KOJ A;  1X56 A;  4DUZ L;  1UWV A;  2F0H A;  1V1O A;  4QMG A;  5LMN Q;  1KDA A;  3LWU A;  3ERQ A;  2ATW A;  2F0P A;  4HSP A;  1SBB B;  2HD3 A;  2QEX A;  2N3S A;  4B3M Q;  1LTR D;  2NYZ D;  4DR5 Q;  4APV A;  4JI6 L;  3GTP B;  3R2T A;  3FVQ A;  3UI2 A;  3G6E A;  4JCV E;  1QB5 D;  4HIO A;  1PZI D;  2VS1 A;  4X3T A;  3KLS A;  4P74 A;  3NBH B;  4OON A;  3PQI A;  4LF6 Q;  2VXW A;  1BBU A;  1CK1 A;  1G51 A;  3SXH A;  4A3B G;  2B39 A;  5T1I A;  5IWA L;  1AZQ A;  2R92 G;  3J7A V;  4LF6 L;  1HRJ A;  1P16 A;  2JK8 A;  4ZQ3 A;  5KYI A;  3GTQ B;  4DN4 M;  4YHH L;  1RIP A;  1EL0 A;  1JWS D;  1Q86 C;  4A3L G;  4KN7 C;  1VQL A;  5IOC A;  4EVO A;  5C3W A;  4OXP A;  4DR7 Q;  5DEH A;  1D7Q A;  3OOC A;  4YCU A;  3QWN A;  2LXJ A;  4LJZ C;  3ER0 A;  4IN3 A;  3SR1 A;  3G4S A;  3PO3 B;  3A5U A;  1SNQ A;  1PTO B;  1CKM A;  3ZJY C;  3OTO Q;  3CCM A;  3H91 A;  4GNX C;  2PYK A;  3KF8 B;  3SDZ A;  3V96 A;  3A7A B;  1XNQ L;  2PPB C;  2R7Z H;  2VUM H;  1B9M A;  1XTD A;  3OTO L;  4LW1 A;  3EFX D;  3DM1 A;  4GN5 A;  4YIJ A;  5IYB H;  1VS0 A;  3GV6 A;  5FO7 B;  1JOQ A;  4YWL A;  1CSQ A;  5CYU A;  4I7A A;  5C44 G;  2FIN B;  1Z47 A;  1FGB D;  2AWN A;  1DD2 A;  1X3E A;  3S24 A;  2CW0 C;  2MFI A;  4RKB A;  1H9M A;  5FOB B;  4OO1 G;  1IYU A;  1I4R A;  1TT2 A;  4DAY A;  4J1M A;  2V1C C;  3I90 A;  1AFP A;  3T1Y Q;  2NZ1 D;  5JOB A;  4DV5 L;  3S1Q B;  1Q3L A;  4GOP C;  2F4I A;  4P71 A;  3SK5 A;  3J7Z C;  4OX9 Q;  3M3Y H;  1A15 A;  2K1B A;  2B2Y C;  5D3D A;  1I4Q A;  1NY4 A;  2E2J H;  3H3V I;  3PUZ A;  2VQE Q;  3G71 A;  1NUC A;  5IYC H;  1I94 L;  1NNX A;  4HMJ A;  3HOX G;  3ICE A;  1ENA A;  4YY3 Q;  4A3F H;  1GHJ A;  3DEO A;  5A2Q L;  2VQE L;  2Z9H A;  3NEM A;  3HZX A;  1ZXT A;  1EU4 A;  1V1P B;  3GD7 A;  3V05 A;  5IGB A;  4POG A;  1PFB A;  4LF8 Q;  2K4K A;  3NTH A;  1SLJ A;  1TY0 A;  2IWH A;  1PH7 A;  2CKZ B;  5IIF A;  2GN5 A;  4LF8 L;  2FXQ A;  3PUY A;  4DU9 A;  2K6A A;  4E6I A;  4C1N K;  2B8F A;  2XRS D;  1E1T A;  1VQE A;  3K8A A;  3S17 H;  1Y1W B;  3VR3 A;  1VQK A;  1YZ6 A;  3NWS A;  4X3S A;  4IJH A;  1AH9 A;  4YWM A;  1Y8N B;  1A6X A;  4GKK L;  3V2T A;  2ICI A;  2X69 A;  4KV6 A;  3PO2 H;  2A5H A;  1F9Q A;  5NUC A;  1U0L A;  1YI2 A;  1BDO A;  4TKO B;  1YIT A;  3I4M G;  4A3K H;  1U4L A;  1HNZ Q;  2F4V Q;  4PMC A;  1WVL A;  2B63 G;  1HXY D;  4R8I A;  3NTI A;  4LF5 Q;  3OHX C;  4IFD J;  3I70 A;  2L15 A;  3AFQ A;  3BDL A;  3HKZ G;  3T56 B;  1IBM L;  3M4Q A;  4HN7 A;  4R4Q A;  2G9D A;  1LO5 D;  1JWM D;  3QB3 A;  3HOW B;  2F0K A;  1HZB A;  2A68 C;  3HOZ B;  1BCP B;  4IUP A;  1EOT A;  3Q22 A;  2EYP A;  2K52 A;  5C4X B;  2J4X A;  1CI3 M;  3X3N A;  1UNS A;  2WAC A;  1L1O B;  3H3V C;  4ODG A;  5FLM G;  3BVG A;  2OEO A;  5IGG A;  3KBX A;  5ELN A;  1D8L A;  3K0X A;  1H9J A;  4DV6 L;  4JC0 A;  4A3E G;  2NBF A;  2PI2 E;  3E9H A;  3N52 A;  5J1Z A;  5IY0 A;  2F0F A;  2HHH Q;  1DM0 B;  3NEN A;  2E2D C;  1SMY C;  4GOP A;  4NPS A;  4IFD G;  2DNE A;  3DMU A;  1VQH A;  1BVS A;  4Y7N B;  3S1M H;  4QJF A;  2F0L A;  3J81 j;  1LAB A;  4TVA B;  2HHH L;  4GN4 B;  2B2Y A;  3AU7 A;  4BXX G;  4AIM A;  3R8B A;  4U67 3;  1ESR A;  4JI4 Q;  4NW2 A;  1VQP A;  3T4A C;  1NTG A;  2EY5 A;  5M5W H;  3UDI A;  1I4G A;  4A3M H;  3A5Z B;  1CQV A;  1G29 1;  3CCE A;  1JMC A;  1PTO C;  2EYO A;  2G9H D;  2GA4 B;  4P73 A;  1MIU A;  3F1Z A;  4A3I H;  1WOC A;  4ZKB B;  4A3G H;  5ELF A;  2GVB A;  1WTP A;  2F0J A;  3SK8 A;  5C0X I;  1SFO H;  1V8Q A;  3CRL C;  1PMR A;  1E24 A;  3UE0 A;  4K8J A;  3OIQ A;  1II3 A;  1Y1V G;  4X62 Q;  2PQA A;  4KTA A;  5EJW A; 
#chains in the Genus database with same CATH homology
 1JR0 D;  4ZUJ A;  1F2Z A;  1PTO F;  4V0B A;  2NUC A;  2PW5 A;  3S9W A;  1Q90 A;  1QCB D;  4KJO A;  2K5Q A;  1G91 A;  1B44 D;  1AZP A;  3R2I A;  2AQ1 B;  4IUN A;  5E1F A;  4DAP A;  4DNT B;  1KDC A;  4N9T A;  1KAA A;  3M3Y B;  4AYB B;  5FO8 B;  3URY A;  4DXG A;  2FHT A;  3E5S A;  1DJR D;  3C1F A;  2Q8T A;  5JPN C;  2R93 B;  4M1U B;  4C3J B;  2D9U A;  3R3O A;  3BVZ A;  1LTB D;  1HTL D;  4BBS B;  3NBH A;  2EYM A;  2FMM A;  2QKI C;  1SJH D;  3H94 A;  5KIX A;  4C1N I;  1TQO A;  3HG9 A;  3FEW X;  5JEA H;  3FDT A;  3RZO B;  3S17 B;  3K7A B;  3TZD A;  4FNF A;  1QOH A;  1GUT A;  1BR9 A;  1TWH B;  2KCC A;  4B9W A;  1STY A;  2J7Z A;  1SNM A;  1IL8 A;  1F2M A;  2HDM A;  1I50 B;  2XNA C;  1R4P B;  1O78 A;  1KLU D;  3KF8 A;  1OXV A;  5M3F B;  2PO4 A;  2Z4I A;  4I7Z C;  4KY5 A;  2L0C A;  1BCP C;  4RGN A;  2LMC B;  3M85 A;  2K5W A;  4ZK9 B;  2EJM A;  4NMZ A;  2A68 D;  1ZYR C;  4LK1 C;  5IGE A;  1EEF D;  5EKK A;  2X6G A;  1MGS A;  1S5D D;  3MA2 B;  4WRD A;  1CA5 A;  3QOL A;  2AQ2 B;  4DNR B;  3TME A;  5BN4 A;  3EQL C;  4FYD A;  1G2T A;  2XWB B;  3IKJ A;  4JBW A;  4XYQ A;  2A6H D;  1FNU A;  4DFA A;  3IFT A;  2Z1C A;  4IUQ A;  4RCO A;  1PTO H;  4TRD A;  1SNP A;  3SHL A;  3FRP B;  3WOF A;  5M5W B;  3QG1 A;  3HS0 C;  4KN4 C;  4A3D B;  1V1P A;  3D8G A;  4KY7 A;  3D31 A;  3TP8 A;  2JEA I;  4HR7 B;  1PTO D;  1SNC A;  2I46 A;  5C3X A;  4A3G B;  4PMW A;  5JVH 3;  2AQ3 B;  3A8K E;  4K6L A;  1WTQ A;  3C3L A;  4JK1 C;  4Q5V A;  4PV1 C;  4ULL A;  3VR5 A;  2MGS A;  3QIA A;  3J7A F;  1S5B D;  5DM7 3;  1XWE A;  1KDB A;  3MXG A;  2KED A;  2KEC A;  4FXD A;  2BA1 A;  2XVS A;  3MHB A;  4M8A A;  4L6T B;  3P20 A;  1SSO A;  3CRK C;  1SEB D;  3HOU B;  3MWY W;  2L5T A;  4C3I B;  4HSV A;  2F0G A;  4XT3 B;  4ABN A;  1OXX K;  4G7H C;  2QEJ C;  2SNM A;  1HA6 A;  1U4M A;  1VDZ A;  1B1Z A;  2E76 C;  2EY2 A;  4HTH A;  1TWC B;  3K5L A;  1A3V A;  4I65 A;  1TY2 A;  3CU7 A;  2YU9 B;  5EKL A;  1R9T B;  2LKV A;  4OGQ C;  2JXM B;  1Q12 A;  3NP8 A;  4WFN 3;  3HOY B;  1M4V A;  3GTM B;  5M3M B;  1HHV A;  2PZU A;  3N6R A;  3BS1 A;  1H9S B;  2WAQ B;  1B53 A;  2OT2 A;  1JIC A;  4QUF A;  1ILQ A;  4NKL A;  1KAB A;  1B2T A;  3OSO A;  1E0B A;  3OW7 A;  2Z4H A;  3WOE A;  5J22 A;  1WCM B;  3DWP A;  4IUR A;  4OIK A;  5K5P A;  2KCN A;  3L7Z C;  1U9R A;  3FPP A;  3BYY B;  1STA A;  2XRQ D;  1D5M C;  3MVV A;  1ROD A;  2RDH A;  3KK7 A;  5KEE A;  2EDG A;  1SDF A;  2WKC A;  1LT5 D;  2IX1 A;  3BDO A;  1BCP D;  3P75 A;  5FLX E;  5C3E B;  2B2V C;  1KTK A;  3D6W A;  1WD0 A;  5EPJ A;  1DXM A;  2A69 C;  1JC7 A;  4L63 B;  2O5I C;  4K5V A;  3NSW A;  4B9X A;  3F2U A;  1X32 A;  4DK0 A;  3M7N A;  2R6G A;  4KI0 A;  3X3M A;  3TZU A;  3A7L A;  3ERO A;  4FF2 A;  4IUV A;  2O2L D;  2DN8 A;  3W2D A;  3K5M A;  2K32 A;  2FFK B;  2JSO A;  1WTO A;  1WTV A;  4HMI A;  1JOK A;  2BDN A;  1FR3 A;  5C0X J;  1I4H A;  5CBA E;  2EY6 A;  2EOT A;  2NN6 G;  2F0W A;  5C4H A;  2C5C A;  5T1G A;  2I07 B;  2EE1 A;  2RSO A;  1DZ1 A;  4EGV A;  2HUG A;  3MXN A;  3GTG B;  1B9N A;  4HAE A;  5AFW A;  4A3B B;  2R92 B;  5M5X B;  2K05 A;  5CMD A;  1PFM A;  5ELB A;  3MXP A;  1GUW A;  5ELC A;  3D4W A;  1VF5 C;  1PZJ D;  2ID0 A;  1L0Y B;  3HEJ A;  2PW7 A;  3SK6 A;  1J8I A;  5K36 G;  2DNC A;  3TBI B;  3SEB A;  2EXZ A;  1K8O A;  1RF2 D;  4X3U A;  1SYE A;  3PIO 3;  1QIL A;  5BN5 A;  5ELD A;  1BOS A;  3MC0 B;  2QIL A;  4ZLT F;  4K8I A;  2B2V A;  2R3Z A;  5C44 B;  4WJW A;  1SYB A;  4KD4 A;  1CHP D;  1ET6 A;  3S14 B;  4LAA A;  2ZT9 C;  1STH A;  2ZXP A;  2Q8I B;  2VNU D;  3T53 B;  1EY7 A;  2B8G A;  4KHV A;  1CM9 A;  1D5Z C;  3D6C A;  3CHB D;  2RQX A;  5C4Z A;  1GUS A;  2V4D A;  2A74 C;  3HOX B;  1K83 B;  1IW7 C;  4TSS A;  2F3V A;  3TSS A;  4F8M A;  3K6O A;  1EQV A;  4OHJ A;  4WOR A;  1GUG A;  2HQE A;  1S5E D;  5EQ0 A;  1F77 A;  1EY6 A;  2B2T C;  2SOB A;  1CA6 A;  1HCZ A;  1Z6H A;  3GTK B;  1D1K A;  3LNN A;  2K33 A;  2H1E A;  1MBY A;  2L12 A;  5EBC A;  2K28 A;  1EEI D;  4PMB A;  1ESF A;  3M7G A;  2WII B;  4HCE A;  2EYL A;  2PZT A;  3S2H B;  1C48 A;  5KRU A;  3I4M B;  1PRT B;  1FNV A;  2F0V A;  2B63 B;  3S15 B;  1JWU D;  1H9R A;  4OO1 I;  3HKZ B;  1MSG A;  4PQX A;  4K2L A;  2MP1 A;  5C5M A;  3ONA B;  5C4J B;  1TS2 A;  4QIW B;  1U4P A;  4MHE A;  4C3H G;  1XXG A;  3QOJ A;  1S4Z A;  4J6H A;  2N88 A;  1PXU A;  1EY0 A;  3VYU A;  5F2D A;  4ZAI A;  3VR4 A;  2F0S A;  4XQJ A;  1KLG D;  3I72 A;  2CW0 D;  5CV6 A;  1AEX A;  5FLX L;  2CQA A;  2JP1 A;  4A3E B;  1CFM A;  1H9S A;  1IKM A;  2IL8 A;  1G8Z D;  5IGF A;  1DON A;  1VF7 A;  1C8C A;  4KMU C;  1W6J A;  1LT4 D;  4OIJ A;  1QWY A;  2NWG A;  1EWC A;  4CBV A;  3U9S A;  1SYG A;  5EKI A;  2R61 A;  1TS5 A;  5DM6 3;  3C46 A;  4CJ2 C;  4XT1 B;  4KKU A;  3NPP A;  1EY4 A;  1OXS C;  2M9V A;  5E3F A;  2HCC A;  1D1I A;  5G3L F;  5HUR A;  1MSH A;  1Y1V B;  3JAM E;  2B2T A;  1ENC A;  4EQN A;  1U4R A;  4K5X A;  1PFN A;  3K59 A;  4R9W A;  1X3Q A;  4H44 C;  1T5X D;  4Z9C B;  4UAI A;  2PQE A;  3T13 A;  3HGB A;  3BG3 A;  4P2C B;  2DY7 A;  3RUZ A;  4RHR A;  3NBI A;  3NUC A;  3NE5 B;  2B2W C;  2IPK D;  4RAU C;  2F1M A;  3NXW A;  2FMC A;  2IT1 A;  3TP5 A;  1ICW A;  2BE5 C;  5I6Y A;  2XIW A;  3I73 A;  4ILW A;  1SXT A;  1EYA A;  4QB4 A;  1CHQ D;  1EZ8 A;  1GUO A;  1AP0 A;  4IFD I;  5DNF A;  4Q0F A;  4K14 A;  2WKD A;  3VYR A;  1GOZ A;  2A6E C;  5FKA C;  3VYT A;  3ND8 A;  3T16 A;  4RGO S;  2PZW A;  1FYC A;  2WIN B;  5I9P A;  5IGC A;  2DY8 A;  4MN3 A;  1Q8I A;  2E74 C;  3L9A X;  1F2Y A;  1A2U A;  2NVQ B;  4BS9 A;  1SE3 A;  2F0I A;  1ONL A;  4LMQ D;  1BUV T;  1SAP A;  1SMY D;  1A3T A;  5I4D A;  1D5X C;  3GTO B;  3RD4 A;  3IAY A;  5CBE E;  5IT9 E;  1PRT C;  1S5F D;  3J7Y W;  1BF4 A;  1E2W A;  4FP5 D;  4QCL A;  1G2S A;  5C5L A;  4CGY B;  1LTA D;  4KHZ A;  1F9R A;  5M9O A;  5I2Y A;  1QJO A;  4NDX A;  5M5Y B;  1TS3 A;  4O1N A;  2D5D A;  4XYO A;  2NB0 A;  5CR3 A;  1NR2 A;  5JEA J;  1PRT F;  3ND9 A;  4QUC A;  2JYO A;  2M00 A;  2NVT B;  2K01 A;  2C9O A;  1I6H B;  2IX3 A;  3EVQ A;  2YYZ A;  3FPU B;  1NCV A;  2PCF B;  2LS0 1;  1ZEQ X;  3E0J A;  4ZUI A;  3HOV B;  2NVX B;  1TWA B;  3S2D B;  1VMC A;  2B2W A;  3E6Z X;  1WD1 A;  2AWO A;  2EJF C;  2TMP A;  3VA5 A;  3RMH A;  1TU2 B;  2KJX A;  5JEA G;  5G3L D;  4EQP A;  4FXK C;  2RBM A;  3SK4 A;  5E4X A;  1OXT A;  4ID6 A;  5JPM C;  1STE A;  1ENF A;  1LAC A;  5EBD A;  2VB2 X;  5LL6 X;  4RGT A;  3KBG A;  3PV0 A;  2IX0 A;  3QO2 A;  4OO1 H;  1SNO A;  3RZD B;  3IFD A;  1Q1B A;  2O4X A;  3FMC A;  5CV7 A;  2K04 A;  1RTO A;  1TR5 A;  2RVL A;  5TSS A;  3A56 A;  4BY1 B;  1BO0 A;  4UDU C;  4DXF A;  1EY9 A;  5KNB A;  3OWF A;  2ENB A;  1LT6 D;  2NTT A;  2NTS A;  1RTN A;  1I3Q B;  3M4Y A;  1L0X B;  4FXG C;  2F0N A;  3RLF A;  1JB3 A;  1LLR D;  3G6J B;  3CQZ B;  3BYT B;  4KJN A;  2BDO A;  1Y8O B;  2H4O A;  4K2K A;  4BWG B;  5IGD A;  5I2X A;  4ZYS A;  2BE5 D;  1WTW A;  2RDG A;  5C6A A;  1GJX A;  2XSC A;  4DK1 A;  4A93 B;  1F9S A;  4H0L C;  1EZ6 A;  1ZYR D;  3K5N A;  3MXU A;  3MFY A;  3H0G B;  1J9O A;  4KKT A;  2A6E D;  1JE4 A;  4G7O C;  2EVB A;  2RA4 A;  3JAM L;  1EU3 A;  1F9P A;  1V43 A;  2JE6 I;  3BZD B;  2L4N A;  2F03 A;  3ITP A;  3GTJ B;  1E2V A;  2QF7 A;  4R8N A;  5I6W A;  1DOM A;  4KKS A;  4CJ1 B;  2ZXO A;  4KD3 A;  3D4D A;  1VMP A;  1G6Z A;  5D65 A;  1HA5 A;  1NR4 A;  5HGT A;  3DHQ A;  5CGK A;  4HCS A;  4H13 C;  4FF1 A;  2BCO A;  2E2I B;  4RKL A;  3PUV A;  3GV3 A;  3GO5 A;  1PRT D;  4XDX A;  4EQO A;  2L1B A;  1RHP A;  4DF7 A;  3OMC A;  1QNK A;  3MZ5 A;  3J81 E;  1FNW A;  4L8J A;  1AN8 A;  1LTS D;  1GUN A;  4IUT A;  4XQQ A;  2JA7 B;  2ZXR A;  4A3J B;  4CKE A;  1M8A A;  1CZG A;  2IW3 A;  1PLF A;  1O80 A;  1D2B A;  3G7L A;  3P1H A;  4IFD H;  1EIH A;  1QG7 A;  3S1R B;  4CJ0 B;  5J39 A;  1TVX A;  3GTL B;  1NSN S;  1DYQ A;  4X3K A;  3LX0 A;  1YNN C;  4HED A;  3EJI A;  1YNJ C;  3M4O B;  5C0X G;  4O42 A;  3DWQ A;  2EJG C;  4FO2 A;  3OPO A;  1TWF B;  5IT9 L;  4U68 A;  2BA0 A;  2PNR C;  3IL8 A;  2LFN A;  4RFB A;  2F0D A;  1R4Q B;  2KHS A;  2RDF A;  2J0T D;  2B2U C;  3VR6 A;  1CTM A;  3H6M A;  2JA8 B;  2A73 B;  1ML0 D;  1QNU A;  1RKN A;  2KQ3 A;  3OIP A;  2JA6 B;  3NTK A;  1SYF A;  1Y69 U;  1JOR A;  1X3P A;  1FD7 D;  5CC4 A;  4IUU A;  1E2Z A;  2EYH A;  4N9P A;  1SE2 A;  1GXD C;  3P7J A;  3K58 A;  2KUM A;  4G7Z C;  3I8Z A;  3DUZ A;  4KY6 A;  3SVM A;  1BQQ T;  1HFN A;  3KUP A;  3EA6 A;  4XXE A;  3VA7 A;  1HPC A;  1A3U A;  4F88 A;  1STG A;  1UEA B;  1STN A;  2FJ2 A;  2F0Q A;  2NVY B;  2WP8 J;  3A8I E;  3Q23 A;  3MEH A;  4BA1 I;  4RCN A;  1DOL A;  4FVM A;  5COY A;  2MJ8 A;  5CV9 A;  1LTT D;  1VCI A;  2BOS A;  3DXJ C;  1GHK A;  4G4K A;  2SDF A;  5LHY 1;  3NWT A;  3L3O C;  2VB3 X;  2A69 D;  1PDQ A;  2HCI A;  1A2T A;  2CHB D;  2SEB D;  2MPM A;  4K6D A;  2QCP X;  1IYV A;  2F0U A;  3TP7 A;  3TP6 A;  2NN6 I;  4J8Q A;  3TDQ A;  1EY8 A;  3A8J E;  2A6H C;  1I6V C;  2D62 A;  5D14 A;  5DAU A;  5IOD A;  3PUW A;  3J80 E;  1SYD A;  1RJT A;  4S3S A;  1TS4 A;  1EQT A;  3VYS A;  1QE6 A;  1JQY D;  2JEB I;  2B2U A;  3PMF A;  1LTI D;  4MIU A;  2RSN A;  1CQF A;  3A55 A;  2F0O A;  3KLS X;  2F0E A;  1RCV D;  3MFG A;  4C3J G;  3R93 A;  5BN3 A;  4FF3 A;  3K5O A;  1Z7T A;  5A35 A;  2F0M A;  4XTC S;  5CV8 A;  2L9H A;  2ICE C;  3U9O A;  1UUP A;  2AUK A;  1EFI D;  3A54 A;  4GZY C;  2R7Z B;  2VUM B;  1EIG A;  1OO9 B;  2F0T A;  5CV5 A;  4RA8 A;  4BA2 I;  4ZRZ A;  1F2L A;  3NHH A;  2Y0S B;  5KND A;  3Q24 A;  5JAV A;  1T5E A;  3OWE B;  3KLR A;  1WTX A;  1CT1 D;  1IKL A;  1MD2 D;  1YNN D;  3S16 B;  2OF1 A;  1NAP A;  1IHZ A;  2O5J C;  3K57 A;  1YNJ D;  3D3R A;  5COR A;  1O7Y A;  1KNE A;  4G57 A;  4QF4 A;  3TN2 A;  2K03 A;  3K0Y A;  4XIG S;  1C4Q A;  4C3H B;  3D4R A;  2E2J B;  1ET9 A;  5ISR A;  3J81 L;  5EPL A;  5E4W C;  4CKC A;  5KYL A;  4KK7 A;  1LV9 A;  4A3F B;  1B4O A;  1SYC A;  1ZKO A;  4F7X A;  3I91 A;  1D6E C;  2CVR A;  2Q8R E;  4PNY A;  3DWA A;  2WV6 D;  2X6L A;  1PZK D;  1HQR D;  3CKI B;  1WTR A;  1MI2 A;  2LY7 A;  4DGZ A;  4DAV A;  1K8M A;  1CZW A;  1HFG A;  3PO2 B;  1IW7 D;  2SNS A;  3NK9 A;  4A3K B;  1EYC A;  4H7B A;  5FK9 C;  3W3A A;  1HTP A;  3I4L A;  3MAQ A;  1SJE D;  2EY1 A;  1Y8P B;  2EZV A;  1LTG D;  2KVM A;  5EGT A;  1XTC D;  1DOK A;  5D3I B;  1W6K A;  1I4X A;  2OXP A;  2Z8L A;  2MHV A;  5FO9 B;  1RDP D;  2IJ0 A;  1Q1E A;  3OMG A;  5KNC A;  3ZYY X;  4ME5 A;  1O7Z A;  1EYD A;  2EYJ A;  3LWE A;  4K5W A;  2MUY A;  1HUN A;  4RWS C;  1BCP F;  2L55 A;  4XQN A;  2PMZ B;  5CV4 A;  4DA2 A;  4RHS A;  1RD9 D;  1SND A;  1B50 A;  4FF4 A;  1BXT A;  3PIP 3;  2EYF A;  4RH6 A;  4C3I G;  5A2Q E;  1EY5 A;  3S1M B;  2N55 A;  2RKS A;  4ZKC B;  2EPB A;  4NP5 A;  3Q6S A;  5LL6 S;  3HRZ C;  1SE4 A;  4A3M B;  2KEE A;  4IQZ A;  1JCK B;  4IZ8 A;  1TII D;  4C56 C;  1S5C D;  3O13 A;  4RGM A;  4CHT B;  4A3I B;  3Q0A A;  2KOL A;  5JVG 3;  4TQU S;  3I3C A;  1LT3 D;  1SFO B;  2XN9 C;  2WB1 B;  5I9O A;  3BVM A;  3MTS A;  3WDN A;  5JJZ A;  1XYI A;  2E75 C;  1ILP A;  5EPK A;  1BNZ A;  2KA7 A;  2AUJ D;  4BBR B;  2K7V A;  2TSS A;  3HP3 A;  3C1E A;  3S1N B;  1B3A A;  3SE0 A;  3C2P A;  2K5D A;  3FKI B;  2L11 A;  2NN6 H;  3GP7 A;  1HUM A;  1H9K A;  1EWH A;  1I4P A;  3J80 L;  4IAL A;  4CKB A;  4V19 0;  1OXU A;  3NQI A;  1XX8 A;  1AW7 A;  4F87 A;  4OL7 A;  2HDL A;  4BY7 B;  5KGU A;  3GQB A;  2M2L A;  3T51 B;  3I4N B;  3AB9 A;  3H09 A;  1BBX C;  1O7L A;  2D2C C;  3VR2 A;  5K36 H;  2F3W A;  5C0X H;  1UAP A;  3BDC A;  3NQT A;  1HQM C;  1TKW B;  2JA5 B;  2XWJ B;  1DCZ A;  2E2H B;  3PUX A;  1PYW D;  3AMU A;  1TWG B;  1STB A;  1JOO A;  3QJY A;  4C2M B;  3DEP A;  4B08 A;  5ELE A;  1KNA A;  2QDB A;  2F0H A;  1V1O A;  4QMG A;  1KDA A;  3LWU A;  3ERQ A;  2F0P A;  4HSP A;  1SBB B;  1LTR D;  2NYZ D;  3GTP B;  3R2T A;  3FVQ A;  3UI2 A;  1QB5 D;  1PZI D;  4X3T A;  3KLS A;  2VXW A;  1CK1 A;  3SXH A;  2B39 A;  5T1I A;  1AZQ A;  3J7A V;  1HRJ A;  4ZQ3 A;  5KYI A;  3GTQ B;  4DN4 M;  1EL0 A;  1JWS D;  4KN7 C;  5IOC A;  4EVO A;  5C3W A;  5DEH A;  3OOC A;  3QWN A;  4LJZ C;  4IN3 A;  3SR1 A;  3PO3 B;  1SNQ A;  1PTO B;  3H91 A;  2PYK A;  3SDZ A;  3V96 A;  3A7A B;  2PPB C;  1B9M A;  3EFX D;  3DM1 A;  4YIJ A;  3GV6 A;  5FO7 B;  1JOQ A;  5CYU A;  2FIN B;  1Z47 A;  1FGB D;  2AWN A;  1DD2 A;  2CW0 C;  4RKB A;  1H9M A;  5FOB B;  4OO1 G;  1IYU A;  1I4R A;  1TT2 A;  4DAY A;  4J1M A;  3I90 A;  1AFP A;  2NZ1 D;  5JOB A;  3S1Q B;  1Q3L A;  2F4I A;  3SK5 A;  1A15 A;  2K1B A;  2B2Y C;  5D3D A;  1I4Q A;  3PUZ A;  1NUC A;  4HMJ A;  1ENA A;  1GHJ A;  3DEO A;  5A2Q L;  3HZX A;  1ZXT A;  1EU4 A;  1V1P B;  3GD7 A;  3V05 A;  5IGB A;  1PFB A;  3NTH A;  1TY0 A;  2IWH A;  5IIF A;  3PUY A;  4DU9 A;  2K6A A;  4E6I A;  4C1N K;  2B8F A;  2XRS D;  1Y1W B;  3VR3 A;  3NWS A;  4X3S A;  1Y8N B;  1A6X A;  3V2T A;  2ICI A;  2X69 A;  4KV6 A;  2A5H A;  1F9Q A;  5NUC A;  1BDO A;  4TKO B;  1U4L A;  4PMC A;  1WVL A;  1HXY D;  4R8I A;  3NTI A;  3OHX C;  4IFD J;  3I70 A;  3BDL A;  3T56 B;  4HN7 A;  2G9D A;  1LO5 D;  1JWM D;  3QB3 A;  3HOW B;  2F0K A;  2A68 C;  3HOZ B;  1BCP B;  4IUP A;  1EOT A;  3Q22 A;  2EYP A;  5C4X B;  2J4X A;  1CI3 M;  3X3N A;  1UNS A;  2WAC A;  3H3V C;  4ODG A;  3BVG A;  2OEO A;  5IGG A;  3KBX A;  1H9J A;  2NBF A;  3N52 A;  5J1Z A;  2F0F A;  1DM0 B;  2E2D C;  1SMY C;  4IFD G;  2DNE A;  3DMU A;  4Y7N B;  2F0L A;  1LAB A;  2B2Y A;  3AU7 A;  3R8B A;  4U67 3;  1ESR A;  4NW2 A;  3T4A C;  2EY5 A;  1I4G A;  1CQV A;  1G29 1;  1PTO C;  2EYO A;  2G9H D;  2GA4 B;  4ZKB B;  5ELF A;  1WTP A;  2F0J A;  3SK8 A;  5C0X I;  1V8Q A;  3CRL C;  1PMR A;  4K8J A;  3OIQ A;  1II3 A;  4KTA A;  5EJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...