1KDCA

Stabilization of a strained protein loop conformation through protein engineering
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYNPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Stabilization of a strained protein loop conformation through protein engineering.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase (phosphoric diester)
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1kdcA00
5E3FA 3EROA 3MZ5A 1EQVA 2RKSA 4KTAA 5NUCA 5CV8A 1KDAA 1EY0A 2NUCA 1EYDA 3ERQA 4HTHA 4ME5A 1KDBA 3LX0A 5DAUA 5IGCA 5KIXA 3NHHA 3C1FA 3H6MA 4KY6A 2SNSA 5KYIA 4IZ8A 3OSOA 4KD3A 5CV7A 2SNMA 2PW5A 5KGUA 2ENBA 3D4DA 1JOKA 3NUCA 4K6DA 5C4HA 4RKLA 1TR5A 2F0IA 3QB3A 4J1MA 3TP8A 2F0TA 3U9OA 3SK5A 4J6HA 4F7XA 5KYLA 2OF1A 1F2MA 5C3WA 4MIUA 5JAVA 3NP8A 5C4ZA 1TT2A 4B9WA 3QOLA 4WRDA 3SK6A 1SYGA 2F0MA 1SYEA 5CV4A 2QDBA 5F2DA 5HGTA 2F0LA 4DF7A 2PW7A 1EYAA 2O4XA 3BDLA 3P1HA 2F0OA 1A3TA 1KABA 3EJIA 1JOQA 5JOBA 3T16A 1F2ZA 5KEEA 4EQNA 1SNDA 3NK9A 3RUZA 3T13A 1TQOA 5K5PA 4K5XA 1ENAA 2RBMA 3OWFA 4WORA 1A2TA 5M9OA 5IGBA 1SNQA 3OMCA 4HMJA 4PMBA 5CGKA 5IIFA 1EZ8A 4R8NA 1SNMA 2HQEA 4G57A 1STHA 1STBA 4E6IA 2PZUA 3ITPA 4KD4A 3SR1A 4DGZA 4RKBA 4KV6A 5I6YA 2PZWA 3R3OA 2EYOA 4PNYA 2KHSA 2F0NA 3MHBA 1IHZA 4QMGA 3BDCA 1STGA 3E5SA 5IGDA 4K5VA 3QOJA 1SYFA 2M00A 3NXWA 3SHLA 5DEHA 2EYJA 4IUNA 3SK4A 3OMGA 2WACA 2OXPA 4KY5A 2EXZA 2F0GA 1STAA 1EZ6A 1STYA 2LKVA 3HEJA 4ZUIA 2F3VA 4QB4A 1SNOA 1A2UA 2F0DA 3NQTA 1U9RA 3V2TA 5CV6A 4PMCA 3S9WA 4ZQ3A 5J39A 2EYPA 4NP5A 1EY5A 2F3WA 4S3SA 3SXHA 2F0WA 5IGEA 3SK8A 2EYMA 1JORA 3P75A 1NSNS 2F0PA 2EYFA 1AEXA 2F0KA 5EGTA 4DU9A 4I65A 4KY7A 4K5WA 4QF4A 4ID6A 3TP5A 5J1ZA 5C6AA 1SYDA 5EKLA 1EY9A 4K8JA 5HURA 3EVQA 4K2KA 4ZUJA 5CR3A 5I9OA 5E1FA 2PYKA 2SOBA 4TRDA 3D6CA 2EYHA 3C1EA 2PZTA 4LAAA 1EYCA 5C5MA 5EKKA 2PQEA 5CV9A 4IALA 5CC4A 5KRUA 4ODGA 5IGFA 2KQ3A 3DHQA 2F0VA 1A3UA 4K14A 4KJOA 5C3XA 1STNA 3MVVA 5ISRA 4K2LA 1A3VA 3D4WA 4EQOA 5IOCA 1RKNA 1KDCA 4EVOA 1SNCA 3D8GA 4KJNA 3HZXA 2F0JA 3DMUA 1II3A 5I6WA 2EY5A 2F0FA 2EYLA 5I9PA 3MXPA 5CV5A 2F0UA 2F0SA 4HMIA 4NKLA 3PMFA 4EQPA 2RDFA 5IODA 1SYBA 4N9PA 2EY6A 1ENCA 1EY4A 2EY1A 5C5LA 4B9XA 4KHVA 1NUCA 3VA5A 3TMEA 1JOOA 2F0HA 4OL7A 2F0QA 5J22A 4F8MA 1EY6A 5IGGA 2F0EA 4N9TA 2OEOA 4NMZA 3TP6A 1EY7A 1SYCA 4YIJA 1F2YA 1EY8A 2EY2A 3MEHA 1SNPA 3TP7A 4H7BA 4NDXA 1KAAA 4K8IA 4DFAA
chains in the Genus database with same CATH superfamily
2EZVA 1OXVA 2VXWA 1XMQL 3VDYA 3MA2B 3ULPA 1XPUA 4HTHA 3BVMA 2ICEC 2JA8G 5IGCA 2L55A 3NHHA 3H6MA 2I5HA 4DAPA 3RD4A 1CZGA 1FL0A 1CHQD 4IZ8A 1V1OA 2D5DA 2E2HB 1NTGA 4RA8A 2K5QA 2K75A 1XNQL 2EQSA 4X3SA 5ELFA 1BBXC 4F7XA 1HR0Q 3U9OA 1C4QA 3DWAA 4X66L 5C3EB 5C4ZA 3UI2A 1N33L 2F0MA 1XPOA 1EQTA 4JYAQ 3KF8B 1F9PA 1DZ1A 1LACA 3HOYG 1D5XC 3VYUA 3S1QH 3I4MH 1GHJA 1TQOA 2CHBD 4JPBW 1Y8OB 2XWBB 2RA4A 4DR7Q 4PMBA 1ILQA 2R93G 4R8NA 3QWNA 1STBA 1RCVD 2KUMA 5D3DA 5BN4A 2UU9Q 2LS01 3I7FA 3EQLC 4HJ8A 3JAMi 4KKSA 2L9HA 5JEAG 2CKZB 2AUJD 1I3QB 2FMMA 1A15A 3HOXB 5JJIA 1HPCA 1STYA 1Y1WB 1CKNA 4DAYA 1LTGD 5CV6A 5IP7H 4A76A 3MXNB 1DJRD 4N8FA 1KAWA 1G51A 1GJXA 1I4RA 2K01A 3ULJA 2XRSD 1RD9D 3TSSA 4DV0Q 4LW1A 1C7YA 1GM5A 4JBKA 1K83H 2PPBC 4BXXG 2CQAA 2CWPA 3BZDB 1BBUA 1K8GA 1Z9FA 1W2BA 1LT6D 3NWTA 4JI8L 2ZJQA 4K14A 5C3XA 5ISRA 3F2CA 2NZOA 5LMUL 2BDNA 4CHTB 1WTXA 3I4NB 4A93B 2ZJPA 2QA4A 1SROA 1IYVA 3U4VA 1K28A 3H15A 1K8MA 3AFPA 1OTCA 2Q2IA 2ZTEA 1TXYA 1SYBA 3T4AC 1E3PA 1RJTA 4OO1G 1WOCA 3KK7A 1O7IA 2ZTCA 3NPPA 4YIJA 1RTOA 1S40A 4IJLA 4B3ML 2OTLA 1PLFA 1YNND 3TDQA 1R9TH 1WCMH 2VQEL 3OIPA 1XYIA 1KDBA 2NN6H 1QJOA 3CW2C 1E2WA 1DM0B 4HEDA 1VQ6A 3OSOA 2OQ0A 3T53B 3HKZG 2PW5A 1GO3E 5LMNL 1RIPA 2D0OA 1K0SA 1UAPA 5JAVA 3S1NH 5C4XH 3PV0A 1PH7A 2JA6G 2ZXOA 3H91A 3PO3B 2YTXA 2ZXRA 1G2TA 3BDLA 4IQZA 1XXGA 3T16A 1SEBD 4EQNA 2ZM6L 3H0GG 4ZK9B 1FNUA 1QVGA 4HMJA 1I6HH 5EPJA 3A8IE 1I94L 1PTOB 3HS0C 3NTKA 2RVLA 4KD4A 4CDCC 2WKCA 2KHSA 2XNAC 3D3RA 3M9BA 1BQQT 4IUUA 4IUNA 4DV1Q 2EXZA 2V4DA 1V1PA 2NZ1D 4YCUA 3CQZH 1EIYB 2ES2A 3FKIH 1GOZA 4CKEA 1Q1BA 1D6EC 3K5NA 4DV5Q 1U9RA 3V2TA 2A1AA 2YV5A 1B2TA 5FJ8G 2B39A 5LL6X 3HGBA 4B3SL 2XSCA 4YY3Q 3TP5A 4ZRZA 4R8IA 1EY9A 4K6LA 1EUJA 4K2KA 1MJEA 3BU2A 4R4TA 2B2VC 2QW7A 3RZOH 4C1NK 3Q0AA 2B63B 5M5XB 2KHJA 2KCNA 3D4WA 2H1EA 4CBVA 2F0JA 2R6GA 2EYLA 1XMQQ 5D65A 2YYZA 2F0SA 1GUGA 1IBLL 1JE4A 3KUPA 5EPKA 3I55A 2EIFA 2BCOA 5IP7G 1FGBD 1HFNA 1MKHA 3M85A 3TMEA 4F88A 3J7AV 1ICFB 2OEOA 4DGZA 4A3IH 1VQPA 1V1QA 3MEHA 4DR5L 2Z4IA 2KCTA 2E2JH 1DXMA 4X66Q 2KECA 5E3FA 5GAGC 3HOZH 4TVAB 2R7DA 5BN5A 1N33Q 5CV8A 3R8BA 5KIXA 4A3DH 4UAIA 5KYIA 1VQAA 1L0XB 5C0XJ 1BUVT 1HTPA 3STBC 3AU7A 2Z8LA 1CM9A 1N9WA 3L2PA 1F2MA 4A3FB 4ZCKA 1PFSA 3DWPA 3GTJB 5F2DA 1GD7A 1EYAA 5CORA 1I6VC 1V43A 4C3HB 4Z9CB 2K5DA 3FVQA 2J4XA 1MGSA 3CU7A 4FO2A 5JOBA 1EWCA 3RZDB 4KHPL 1HFGA 4YHHL 2WB1G 3OWFA 4WORA 5D14A 5M9OA 4KMUC 2E5LL 1CSPA 4C3IH 2R7ZG 2TMPA 3LWEA 2F0NA 2NN6G 3S1MH 2JEAI 4I7ZC 1PYSB 1U5KA 5DEHA 3KYHC 4LK1C 3HEJA 4IUVA 1KC8C 4LF5L 3VR3A 5C4XG 5D3IB 3HOVH 2JSOA 4DR4L 4JI8Q 2K52A 2KJXA 4GOPC 3AB9A 5IGEA 5LMUQ 2E2HH 2EYFA 4X65L 1HR0W 3JAMc 3NSWA 3HKZE 4V190 1PFMA 4GOPB 1IL8A 4RGMA 4MTNA 2EYHA 3DM3A 3NBIA 5C3EH 3M4YA 4P72A 3K0XA 1UUPA 1EWIA 1YNJD 3KOJA 1S5DD 2AKWB 2B8FA 3E9HA 3MVVA 5C0XH 2XVSA 3F2DA 1PH3A 5CYUA 1XTDA 1K9MC 5FLMH 2A8VA 4QCLA 1WYDA 3J81E 4B3MQ 4LF7L 1X9NA 3ZYYX 3FKIG 2K5WA 2VQEQ 3HOWG 2DY7A 3CCMA 3BJUA 2X6LA 3RN2A 2I0QA 3DM1A 4OELB 4JI1L 4GLXA 1JWUD 3P7JA 5LMNQ 1TU2B 4F8MA 2B2WA 4H7BA 1I3QH 3KLRA 4GKKL 4EQ5A 5NUCA 2J7ZA 2MJ8A 3HOXH 1D1KA 1Y1WH 2B3GA 4XT1B 1SE3A 4DUZL 1QZGA 4RCNA 2ENBA 2ZM6Q 1JOKA 3TN2A 4EX5A 3FEWX 3W3AA 4H44C 3CF5A 1KQSA 4MIUA 1DYQA 1X56A 4KKUA 4A3GB 1I94Q 5ELCA 4RHRA 1BKBA 3K0YA 3E6ZX 5EBDA 4EGVA 1EYGA 3J81j 2D0PA 3GQBA 3Q22A 3I4NH 2JXMB 1LTTD 1CKMA 4JI0L 4DR1L 1SNQA 2D9UA 1EZ8A 4JI6Q 1B9NA 4KV6A 4LF8L 4PNYA 3N52A 2CQOA 4A3DG 1YNNC 3BDCA 4O2DA 2VUMG 1SYFA 4B3SQ 3Q24A 1D7QA 3I2ZA 2WFWA 1BDOA 2R7FA 3K7AB 3R2IA 2A6HD 4H0LC 4ZYSA 1EOTA 4ZQ3A 4LF9L 1PH2A 4NP5A 1EY5A 2BOSA 2EJFC 1HCZA 1KRSA 1CTMA 1PH9A 3S1RB 4QF4A 3ULLA 5HURA 1ASZA 3K58A 3KFUA 1BCPF 2PYKA 4C3IG 2N49A 4KHZA 4BBRB 3IRBA 3KBGA 4MTKA 3PO3H 2PQEA 5CV9A 4B3TL 5AJ3L 4WJ4A 4DR5Q 5IYDG 2WV6D 2EY5A 3MXPA 1Y1VB 2WB1E 2F0UA 3ER0A 2LMCB 2NBFA 2PMZE 3RLFA 3HOVG 4N9PA 4UP9A 3AEVA 5LHY1 4KHVA 2B2YC 4LF6L 1S72A 2F0HA 3K80C 4JV5L 2G5DA 1EY6A 5CBEE 5FO8B 1EY7A 1SYCA 4DFAA 5G3LF 2N78A 1SRUA 1AW7A 4X6AH 2JQOA 4HIKA 3PO2G 1O7ZA 5E7NA 4BY1B 2WP8J 1HTLD 5E4WC 4KHPQ 4YHHQ 3NUCA 1V9PA 1YNXA 3EBEA 5FLMG 2E5LQ 1DOMA 1I4QA 1DOKA 1IXRA 2RDGA 5M3FB 1RDPD 3P1HA 2VB2X 4BBSB 2WAQE 2B63H 3UDXA 5M5XH 4FF2A 4DK0A 4P73A 4DR3L 4FF4A 5JPNC 3OHXC 4PZ6A 1HA6A 1EU3A 2FJ2A 1Q81C 1G8ZD 4IPHA 3OMCA 3T51B 2CCZA 3F2BA 4LF5Q 5IIFA 3IKJA 5M5YH 1YITA 4R1JA 1Y1WG 1VQ4A 4RHSA 3E3XA 3FP9A 1AZQA 4X65Q 3SHLA 1TWGB 1YHAA 1UEAB 2I5LX 3RLOA 5C44G 1HQMC 5JVH3 5C0XI 1BVSA 3S16B 2KENA 2F0WA 5TSSA 1JORA 2EYMA 3CRLC 1E1OA 3GTPB 1PYBA 5J1ZA 3KLSA 4LF7Q 4K8JA 3J7YW 1EEFD 4JVZA 3CD6A 3JAML 4XTCS 4A3FH 4RFBA 1JC7A 4ZKCB 3HP3A 4QIWB 2Y0SB 3GTJH 1JJ2A 1SFOB 2G9HD 4JI1Q 1HJPA 5M5WB 1TS2A 4C3HH 2YU9H 1A3VA 1OXSC 2VB3X 3K59A 4NXNL 3TS2A 3L0OA 4A3LH 3RZDH 1PDQA 1ESFA 1EFID 4ULLA 1PRTF 4GKKQ 4Y7NH 1RF2D 4HMIA 3OWEB 4AYBG 1ZXTA 1KD1C 3FMCA 5IODA 2KOLA 5FLXc 4P74A 4DUZQ 4DN4M 2A6ED 5EQ0A 1WTPA 3IL8A 5FO7B 1VQFA 1MIUA 5IYCH 1H9JA 3DUZA 3D6WA 1AE3A 1WTOA 1LABA 1J8IA 3S17B 2K5VA 4IOCA 3JAME 4IUPA 1MJCA 4IPGA 5CV7A 1SSOA 1IBML 2SNMA 1BXTA 3I72A 3OW2A 2F0IA 4JI0Q 4DR1Q 3I91A 1YNJC 3GTLB 1Q46A 2DNCA 4GZYC 1MHWC 4DV7L 1K0RA 2DJGC 1H9RA 4X3UA 4LF8Q 2C5CA 1PMRA 5KNDA 4DV3L 2A74C 3TEHB 4GNXA 1UEBA 4MN3A 5K5PA 2RBMA 2EVBA 1A2TA 3CCSA 1RODA 1SNMA 2H5XA 2NZHA 1M8AA 1OO9B 3SVMA 4XQJA 5EJWA 1QWYA 3SR1A 2HT1A 3CMAA 4LF9Q 3MHBA 5EPLA 1LTSD 1U4MA 5LMNW 4JBMA 1Y14B 4IN3A 1F2LA 4DR6Q 2NYZD 1TWHB 2GVBA 1H9SB 4KY5A 1W6JA 4FNFA 1TS5A 1SE4A 1A2UA 1CSQA 5ELDA 3L9AX 4PMCA 4B3TQ 5AJ3Q 2B2VA 4A3JG 3SK8A 2Q8TA 1VQOA 1Y8NB 2JA5G 1VS0A 1H95A 2ALYB 4GLVB 1YJ9A 1HQRD 2IL8A 4HCSA 1LO5D 4A3GH 1ZYRD 1LUZA 3GP7A 3TQYA 5CMDA 4LF6Q 3Q6SA 1X3GA 5EBCA 2JA9A 4JV5Q 4H13C 3VYTA 4CGYB 1RKNA 3D31A 4K0KL 1QZHA 1SLJA 2RCFA 3F8TA 5I6WA 2H4OA 1JWSD 5CV5A 1WVLA 2MGSA 3GTOB 1L1OC 1QOHA 4UP8A 2GA4B 2RF4A 3EA6A 3QO2A 1DOLA 1QB5D 1L1OB 2KEEA 2RSOA 4P2CB 4P75A 2PNHA 2A6HC 2F0EA 5KNBA 4NMZA 1EY8A 2E74C 2IHFA 4XYQA 4DV6L 4A3FG 2BA0A 3K7AH 1VQGA 2K14A 3E9IA 5ELEA 3T1YL 3RMHA 2IX3A 2WIIB 2D62A 1X32A 1QG7A 4JI5Q 1LLRD 2LY7A 1G291 4DR3Q 3G48A 4K6DA 3OIQA 2Z0SA 1TR5A 4J1MA 4HJAA 4F87A 2G9DA 3S1RH 4J6HA 4A3LG 4GKJL 1CT1D 1CK1A 1Q82C 3EFXD 4DKAC 1NE3A 1SYEA 3C3LA 4A3BB 1QUQB 4BBRH 3CCQA 4C2MH 1NNXA 3VYRA 2F0OA 1DGSA 1KABA 1D8LA 4FXGC 3RUZA 3FRPB 2EXDA 3NBHA 3CC2A 1I50B 5IYCG 2B2UA 5CGKA 1VQDA 4U68A 4DAMA 4OX9L 1DD2A 4PZ7A 4Y52H 4RKBA 4B3RL 4AYBE 4A3CH 2HDMA 3QJYA 2ZXPA 3PCOB 1STGA 5IGDA 2M00A 3EIVA 4HIDA 2EJMA 4OGQC 2R92G 5IWAL 1O7LA 3S9WA 1G6PA 1PTOC 4BY1H 3B6YA 1HNWL 3GTMB 4IJHA 1Q12A 4FDBA 3KJOA 4NXNQ 3VA7A 4ZAIA 2MP1A 4I65A 2K5NA 1SJHD 3PUYA 1SXTA 1WI5A 2JE6I 4FF1A 1U0LA 5JVG3 1WJJA 4LAAA 4YWLA 1H9MA 5KRUA 1E24A 1X6OA 2L1BA 2N8NA 5M3FH 1WTVA 1VMPA 3DHQA 3G71A 1QNUA 4KJOA 5A35A 4BBSH 2RSNA 2FHTA 3LGJA 1IYUA 1PZJD 5JJZA 1UE6A 3ERSX 3NELA 2F0FA 3A0JA 4NKLA 1LTID 4BY7H 4EQPA 1E22A 3I4MG 2GVAA 2QILA 4NW2A 1IBMQ 1UWVA 4CDDC 1T5EA 5FLXL 1AFPA 3UE1A 3TP6A 3RR5A 1YHBA 3AFQA 3NE5B 4KI0A 2ZJRA 4DV7Q 1CA6A 3CRKC 5IP9H 4DV3Q 3S16H 1JWMD 4TSSA 3PF4A 4ME3A 3CHBD 4FP5D 5C4HA 3KDFA 4RKLA 2NVQH 1OXUA 2WKDA 2UUAL 3GTPH 3M4QA 5C3WA 4CKCA 1TT2A 4UPAA 1NMGA 5C4JB 1XNQQ 2K7VA 3MTSA 2PW7A 3AMUA 1FGUA 3CCLA 1F2ZA 3TBIB 4ZKBB 3S2HB 2E2IB 5M5WH 2F03A 1DONA 4BA1I 2PCFB 2X6GA 1FVIA 1N8RC 1UE5A 1LTBD 1FR3A 2EOTA 2O2LD 4DK1A 4FF3A 4OONA 3RLNA 5FLXE 4Q0FA 3V05A 4G7OC 1XWEA 3WOEA 3J7A5 4XQQA 1I4HA 4K5VA 1CKNB 4DAYB 1PH4A 2XIWA 2PI2E 2WACA 4OEMB 1GUTA 3HOUB 3A5UA 2MO1A 4A3EB 5DLQE 1LV9A 2AQ1B 4GN5A 4LF4L 1ASYA 3S17H 2EYPA 2ID0A 3R93A 4BA2I 1EFWA 1FNVA 3LWUA 4IPDA 4MZ9A 4PV1C 2K6AA 1WCMG 4X64L 4QY7A 4ZUJA 4LNQA 1IW7D 2L11A 4RGTA 3GTLH 1Q86C 3S2DB 3I4OA 5KNCA 3EN2A 1YIJA 1SAPA 1K3BC 1A3UA 1VCIA 2F0VA 4A3CG 1A8VA 3J7AF 1SN8A 3DWQA 1TVXA 4M1UB 2K33A 2IW3A 2B2YA 4FXDA 4LFCL 2BE5D 1B53A 1BCPD 3E0JA 1VQLA 3T1YQ 4G7HC 2EY6A 3KLSX 2EY1A 4JOIA 1R4PB 2FXQA 4GN3B 1D5MC 2F0QA 3S15B 3NBHB 1VQMA 2JEBI 3DLLA 4HR7B 3HKZB 1KAAA 5GQOA 1TWHH 4KTAA 4DNTB 2JJQA 1PHJA 1E7ZA 1VF7A 2CH4A 4HSPA 3U9SA 4QL5A 2JA6B 5M3FG 2EE1A 1Q8KA 2N55A 3U58A 4BBSG 5KGUA 1Z47A 1GKHA 5G3LD 2ASBA 3QB3A 4WJWA 3RNUA 5GROA 4LFAL 1A63A 4OX9Q 1N34L 2DUDA 3M7GA 4B9WA 3AYHB 3H0GB 1SYGA 2QDBA 4BY7G 1ESRA 1X3PA 4B3RQ 4X3KA 2MHVA 2CH4W 3TREA 1F77A 1WD0A 2A68D 2B29A 5BN3A 2B2TA 4K5XA 1SJED 1EU4A 2Z6KA 4A3KB 3CCJA 2Q2HA 3K8AA 2QEJC 3W5OA 2HIXA 2QGQA 3GTOH 3GD7A 5IWAQ 2HCCA 1G91A 2NTSA 1V1PB 1HNWQ 1F9RA 5IP9G 2AWNA 1XNRL 2AMCB 3NQIA 3I3CA 1ET6A 3IAYA 2Z1CA 1GVPA 2XTIA 3OMGA 1PH1A 2XRQD 1EZ6A 4L63B 3DEPA 1SMYD 1I4PA 2IT1A 4XDXA 4A3IG 1N36L 1HZ9A 4S3SA 4A93H 2Y0SG 1U4LA 1IZ6A 1PZID 3HOZG 4G4KA 1A0IA 3S14B 1K8OA 5EKLA 1B4OA 3LNNA 1M90C 4HAEA 3EVQA 1D2BA 1AN8A 4R4OA 4DPGA 2HCIA 1YBYA 2SOBA 3DEOA 3A5ZB 2PZTA 1A6XA 5CC4A 4A3BH 1SR3A 1QVFA 4YCVA 1U4RA 3A8KE 1PA6A 3KDFB 1B1ZA 2QKIC 1KLGD 5M3MB 1TY2A 4DK3C 1I50H 4L5SA 2MQHA 4JCVE 1NAPA 3PGZA 3HG9A 1HNXL 3NENA 1JOOA 4QGUA 1CUKA 3M4PA 5ELOA 2IHEA 3S24A 1IBLQ 2UUAQ 3D0FA 1PRTD 4L5RC 3EROA 3MZ5A 4LUZA 1ML0D 1EY0A 3U50C 3ERQA 2UUCL 5EAYA 1WD1A 4QQBX 4L5TA 3K7UC 1BOSA 1UE7A 3GTMH 4NXML 2MFIA 4HSVA 5K36H 4HJ9A 1HXYD 5KYLA 1PTOH 2FFKB 1KHIA 2N3SA 2PO4A 2WB1B 1KNAA 2ICIA 2PMZB 5JEAJ 5HGTA 1VQ9A 1NY4A 1B44D 1J5EL 2R7ZB 1A3TA 4RMFA 2JA7B 5KEEA 3D4RA 4ILWA 3K5OA 1SNDA 3KF8A 5C3EG 2NVYB 1HHVA 2L12A 4HCEA 1XJVA 4R4CA 2Q2UA 1B9MA 4LF4Q 5C0XG 4IFDH 3WWVA 4CJ2C 5H1SE 3E5SA 4KK7A 3QOJA 3O13A 3CAMA 1VQNA 1TWCB 1RTNA 4LMQD 4X64Q 1WTRA 4JI4L 2KA7A 2A5HA 2AQ2B 4TQUS 4XT3B 4HIOA 1RL2A 2HUGA 1X55A 3PIPA 1CQFA 2F0DA 1OXTA 1LT4D 1PFBA 2VS1A 2DNEA 2WAQB 2UXCL 2F3WA 4HN7A 1G2SA 4FYDA 1B70B 3GTQB 3HOXG 3PSIA 1PXUA 4LFCQ 3IFTA 3MXNA 3NTIA 4DR4Q 5A2QL 4CKBA 2OWOA 2K50A 4TRDA 3MFYA 3C1EA 1GUNA 4UDUC 1E1TA 3FKIB 3RN5A 3HOWB 3A55A 3X3NA 2B8GA 1QVCA 4IOAA 1KDCA 3S2HH 2E2IH 1KXLA 3DMUA 1EIHA 1M1KC 2B2WC 1WTWA 3BVGA 1NMFA 5JEAH 2IPKD 1VQHA 4LUVA 1Q1EA 2KBNA 2O5IC 1ZEQX 4JG2A 3BZCA 3I4NG 1YZ6A 1IL2A 4A93G 2Z9HA 2MNAA 5IGGA 4AQYL 2DN8A 1AZPA 1SNPA 4LFAQ 4K8IA 1IBKL 3G6JB 2I07B 4DAVA 1WTHA 3HOUH 4A3EH 4RGOS 4ME5A 3C1FA 3UDFA 2L4NA 3TZDA 3PUWA 1IW7C 1X3EA 4DNRB 3D4DA 1WTQA 2NVTB 1XPRA 5T1IA 1TWFB 1L0WA 5DM73 5BR8L 1SMXA 3NP8A 3C2PA 3CC7A 1TS4A 1HNZL 3F2UA 4UP7A 5JPMC 4KN7C 2F0LA 4DF7A 3S2DH 1STEA 1B7YB 2BE5C 4X62L 3CCVA 1BCPC 2E75C 5FK9C 1CZWA 1XNRQ 4JI7L 3NK9A 4A3DB 1E2VA 3M4OB 2VUMB 1BCPB 4OO1H 3PO3G 4JI3L 2HQEA 5COYA 4E6IA 1L2FA 2N88A 3ITPA 4FVMA 3CP0A 1N36Q 4QMGA 2L5TA 4C3JB 1A62A 2MUYA 1NJIC 1LT5D 1HH2P 2UUBL 5DNFA 3STBD 1EOVA 3S15H 1LT3D 4QUCA 3V96A 1XTCD 3VR6A 4DR2L 3GO5A 3W1GA 2K32A 4YY3L 1UE1A 3NQTA 4C3IB 3OPOA 5J39A 2F4IA 2JA6H 1D5ZC 2Q2TA 1JJGA 3A8JE 1NSNS 2GN5A 4DU9A 1AEXA 4DV2L 2A73B 3S1MB 1I4XA 1L0YB 3H0GH 2E8GA 5LL6S 1KTKA 2FMCA 2V1CC 4IALA 2HHHL 1E2ZA 1PTOF 5ELNA 1HNXQ 1EIGA 3HOVB 1RHPA 1CHPD 3VR5A 4EQOA 1SNCA 4KLKA 4PQXA 4JBJA 1LTLA 4A3KH 2B63G 2UUCQ 3PMFA 2K1BA 2RDFA 1S5CD 1Z6HA 3PO2B 3VA5A 2IY5B 3BYTB 1SMYC 4XQNA 4NXMQ 3PIP3 3TP7A 4KN4C 1KL9A 5FJ8H 3CC4A 3N6RA 3NTHA 4LFBL 2RKSA 4L8JA 4L5QA 1CKOA 2LXJA 4N8X1 3MXGA 1EYDA 1E0BA 1MBYA 4ABNA 2F1MA 1S5ED 4HIMA 4DNIA 5DAUA 1J5EQ 4M8AA 5ELBA 2MO0A 3J81c 2QDLA 3M3YB 4KD3A 1GHKA 2QCPX 4A3MB 2PI2A 2BDOA 4YWMA 1CI3M 3S14H 4IFDI 1QCBD 3ZJYC 1GXDC 1TKWB 3SK6A 2RHQB 1PZKD 3ND8A 3PF5A 4G7ZC 4JK1C 3SDZA 3SGIA 4GN4B 3EJIA 2BA1A 3CCRA 1HA5A 3T13A 3VR4A 1JR0D 4APVA 4JI4Q 5M3MH 1JT8A 1BO0A 1QNKA 3NEMA 4P71A 5FOBB 3HOUG 4C3HG 2CVRA 2AUKA 2JN4A 1PRTC 2KHIA 2PZWA 2TSSA 5C44B 4A3EG 2UXCQ 1J9OA 4GS3A 4OXPA 5AFWA 2RCNA 1PRTB 2E76C 1JB7A 3CCEA 1R4QB 5JJKA 2L15A 2HD3A 4FXKC 3J80c 4R4IA 1FJGL 1FYCA 2ZTDA 3BZKA 1S3OA 1YI2A 1Y1VH 3BDOA 5C6AA 4OIKA 1BNZA 2HIVA 3PIOA 5E1FA 1HZCA 5DM63 4AYBB 4ODGA 4GOPA 1FNWA 4MHEA 1ENFA 3I56A 3K6OA 2R7ZH 4K2LA 1SE2A 4AQYQ 2JA7H 1F9QA 4H02A 3D8GA 4EVOA 4AH6A 1EQQA 3H3VI 1II3A 1IBKQ 2NVYH 3QR8A 4O1NA 1YEZA 1WFQA 5C5LA 1KRTA 5IT9c 1JQYD 3L7ZC 4B9XA 4POFA 4OL7A 4IUQA 1Q3LA 1AH9A 1ET9A 2F3IA 3H09A 1TWCH 4DV4L 5BR8Q 1VQBA 2PQAA 4PMWA 2UXBL 3G4SA 2KCMA 2Z4HA 3GDEA 1HNZQ 3SE0A 4X62Q 4KY6A 3SEBA 3T56B 1BF4A 2AWOA 3MXUA 5GADC 1QE6A 4JI7Q 4OO1I 1B3AA 1LTAD 3PUVA 3GTKB 3GTQH 4GNXC 1N32L 1TS3A 1ZKOA 2OF1A 4JI3Q 4IURA 3UE0A 1TIID 3MFGA 2JA8B 3OW7A 4A3KG 4GNXB 4RH6A 1TWAB 1K8AC 2O5JC 1TWGH 2DY8A 4JI6L 3HOWH 2UUBQ 5J3BA 4A3GG 1HZBA 4DR2Q 3T1HL 4JI2L 3I90A 4G57A 4LUOA 3QG1A 1Q8IA 3HOYB 3KLWA 2EDGA 3GTGB 5T1GA 2VY3A 2KEDA 2AQ3B 3BVZA 4A3JB 3NXWA 1HRJA 5L37A 4I7AA 4DV2Q 2NVXB 3SK4A 2NWGA 1JB3A 2R93B 1X54A 1GUSA 2JA5B 1HUMA 1STAA 4ZUIA 4WJ3M 2JP1A 1X65A 1SFOH 4QB4A 1SNOA 2OT2A 1PFNA 4RAUC 1C8CA 1ONLA 2UXDL 2HHHQ 1IKLA 3HRZC 2CW0D 5M5YB 3WOFA 2HDLA 2A6EC 2OCEA 1YVCA 4KY7A 1C48A 3UDGA 1SYDA 2NVTH 3M7NA 1PH8A 1TWFH 5I9OA 2SDFA 2F4VL 5M3MG 1MSHA 3H3VC 5C5MA 4QJFA 2ZT9C 4DXFA 5IGFA 2KQ3A 3A7AB 3BG3A 3OTOL 1YHQA 3M4OH 2VUMH 4LFBQ 1M4VA 4BBRG 3G7LA 2C9OA 4RCOA 3NWSA 3A56A 3TRZA 4K0KQ 1QILA 1O78A 1P8LA 4C3JH 1EQRA 1UNSA 2K28A 3P20A 1GUOA 1Y1VG 2EY2A 2IJ0A 2K04A 3R2TA 4L6TB 1T9HA 2YU9B 2XGTA 1EQVA 3A54A 3KF6A 3K5MA 2XN9C 2F52A 3I70A 4YCWA 2RQXA 4Y7NB 1EIFA 1DCZA 1MSGA 2Q8RE 3PIO3 3VYSA 4DV6Q 4O42A 3J81L 4JC0A 3TP8A 2JA7G 5FO9B 1BR9A 4Q5VA 2I46A 1ILPA 3CKIB 5IYDH 2B2UC 4J8QA 3AQQA 4BY1G 2QF7A 4RG1A 5CV4A 4GKJQ 1PVOA 3MEFA 1JOQA 3G6EA 3PQIA 3CPWA 3FPUB 2A69D 1STHA 1FJGQ 2KVMA 4UY8C 1ZYRC 5I6YA 4C1NI 5E4XA 5EKIA 1KNEA 2R92B 5GAHC 3PO2H 4A4IA 4DUYL 1EWHA 2PNRC 2WAQG 3FDTA 2EYJA 5JJLA 2BH8A 2F0GA 4XXEA 2EJGC 3DXJC 4MNOA 2XWJB 3MWYW 1XMOL 1TY0A 1NR2A 3J80L 4R9WA 1NCVA 2NN6I 2VL6A 2VQFL 1X3QA 1S4ZA 3M3YH 1ICWA 5EGTA 4R4QA 4A3MH 1VDZA 2PQAB 1Y8PB 1B50A 4ALPA 1GUWA 1VQKA 2M9VA 3D6CA 5HGQA 3I4LA 1EYCA 3K57A 5EKKA 2A19A 4DXGA 3KJPA 3HKSA 3S1QB 2QEXA 2K5HA 3I4MB 4QUFA 4OWTB 4KJNA 4DV4Q 1IKMA 2RDHA 1G6ZA 5I9PA 3OOCA 3ICEA 2UXBQ 3H94A 4IPCA 1CFMA 2K05A 3HFZB 5IYBH 3CCUA 1ENCA 1NUCA 3I73A 1PH6A 2NB0A 5C44H 4NB3A 5J22A 5IT9L 5I2YA 1S5BD 4N9TA 2I5MX 1VQ7A 5I4DA 1N32Q 2WINB 3E0EA 2IWHA 1KIXA 1HUNA 3J80E 4IFDJ 2DJFC 5CBAE 1CA5A 4HJ5A 1U4PA 2YTVA 4DK6C 2OQKA 3LX0A 2E2DC 2OTJA 1SBBB 3OYYA 4JW0A 4O0AA 4XYOA 3C46A 5IE8A 1VQ5A 4PZ8A 2D2CC 1K83B 2F0TA 1C0AA 3T1HQ 3J81i 1VQCA 4JI2Q 4WFN3 1O80A 5I2XA 3U4ZA 3KBXA 1CQVA 2SEBD 1B3QA 4IO9A 3FHWA 1Q7YC 3A7LA 2AHOB 3PUXA 1IYJB 4C3JG 3I8ZA 1VQJA 3Q23A 1HR0L 3W2DA 3PUZA 5GAEC 3MAQA 3A74A 5IT9E 2PZUA 4DR6L 5FKAC 1VQEA 2FINB 2UXDQ 1Q90A 4JYAL 3R3OA 4RWSC 2EYOA 4GLAC 4U673 4KKTA 2CFMA 3VR2A 4LJZC 3TS0A 1MI2A 4C2MB 1J6QA 3J7ZC 3TZUA 2C35B 3F1ZA 5IY0A 1NBWA 2LKVA 3Q8DA 1K3RA 2Q8IB 4DR7L 1R9TB 1VQIA 2RHSB 2F3VA 2F4VQ 1WCMB 1EEID 2K4KA 1YJNA 4PG3A 2UU9L 1H9SA 2EPBA 1JMCA 3W1BA 3OTOQ 3P75A 3J80i 2LFNA 4JBWA 4K5WA 4ID6A 4UHVA 1F9SA 2L0CA 3S1NB 3KF6B 3GTKH 5C4XB 2JA8H 4OIJA 1JJCB 1AP0A 2X69A 1TWAH 1AE2A 4JOIC 4IUTA 1MD2D 1HZAA 3CMEA 5IOCA 4XIGS 1FD7D 1LM0A 1LTRD 4DV0L 1I6HB 1T5XD 4J15A 3GV3A 2R3ZA 1O7YA 3WDNA 3ND9A 1JE5A 1EY4A 2HQLA 1PTOD 1NR4A 3HOYH 4CDEC 3GTGH 2DGYA 2IX0A 4A3JH 1F2YA 1W6KA 3CQZB 2CW0C 4NDXA 5C4JH 1L1OA 4YWKA 1SDFA 4JI5L 4A3MG 2NVXH 2R93H 2JA5H 4OWXB 3JC66 1KDAA 2NUCA 2IX1A 3GV6A 4CJ1B 3X3MA 1JICA 1XX8A 2NTTA 2P5ZX 2SNSA 4BY7B 1B8AA 3L3OC 4CDFC 1Z7TA 2CWAA 3SK5A 2B2TC 4X3TA 2Z6KC 3RZOB 3QOLA 4WRDA 4NPSA 1EL0A 2O4XA 5IYBG 1PV4A 3BYYB 4DUYQ 1V8QA 2J0TD 1YJWA 1N34Q 1VQ8A 1PH5A 4V0BA 4C56C 4HJ7A 3H3VH 1QUQA 1ENAA 1JCKB 4BXXH 2ATWA 1S5FD 2JYOA 1SE8A 4A3BG 2NVQB 5A2QE 4DA2A 1Y69U 1XMOQ 4OHJA 4QIWE 3K5LA 1W3SA 2Y0SE 2LXKA 3CXCA 2YTYA 1IHZA 1VF5C 2VQFQ 1H9KA 3ONAB 4A3IB 1OXXK 2E2JB 4ZLTF 2OXPA 3HOZB 2JK8A 2R61A 3UDIA 4BS9A 4A75A 1KLUD 4TKOB 2VZAA 1I4GA 4BWGB 3SXHA 1BBWA 2VW9A 2F0PA 2F0KA 2BH2A 3CPFA 4AIMA 3IFDA 3FPPA 4DV1L 2MPMA 5CR3A 4RGNA 4POGA 1PYWD 2K03A 1VMCA 4DV5L 3K81C 5K36G 1STNA 4LWCA 2VNUD 2A69C 5HY6A 1P16A 1LYLA 2Z6BA 3HZXA 3MC0B 2LSSA 1I5FA 1C9OA 2KCCA 3URYA 4B08A 1X3FA 1D1IA 3BS1A 2M2LA 2R92H 4CJ0B 5IGBA 1K73C 2A68C 3QIAA 4OWWB 4IFDG
chains in the Genus database with same CATH topology
2EZVA 1OXVA 2VXWA 3MA2B 4HTHA 3BVMA 2ICEC 5IGCA 2L55A 3NHHA 3H6MA 4DAPA 3RD4A 1CZGA 1CHQD 4IZ8A 1V1OA 2D5DA 2E2HB 4RA8A 2K5QA 4X3SA 5ELFA 1BBXC 4F7XA 3U9OA 1C4QA 3DWAA 5C3EB 5C4ZA 3UI2A 2F0MA 1EQTA 1F9PA 1DZ1A 1LACA 1D5XC 3VYUA 1GHJA 1TQOA 2CHBD 1Y8OB 2XWBB 2RA4A 4PMBA 1ILQA 4R8NA 3QWNA 1STBA 1RCVD 2KUMA 5D3DA 5BN4A 2LS01 3EQLC 4KKSA 2L9HA 5JEAG 2AUJD 1I3QB 2FMMA 1A15A 3HOXB 1HPCA 1STYA 1Y1WB 4DAYA 1LTGD 5CV6A 1DJRD 1GJXA 1I4RA 2K01A 2XRSD 1RD9D 3TSSA 2PPBC 2CQAA 3BZDB 1LT6D 3NWTA 4K14A 5C3XA 5ISRA 2BDNA 4CHTB 1WTXA 3I4NB 4A93B 1IYVA 1K8MA 1SYBA 3T4AC 1RJTA 4OO1G 3KK7A 3NPPA 4YIJA 1RTOA 1PLFA 1YNND 3TDQA 3OIPA 1XYIA 1KDBA 2NN6H 1QJOA 1E2WA 1DM0B 4HEDA 3OSOA 3T53B 2PW5A 1UAPA 5JAVA 3PV0A 2ZXOA 3H91A 3PO3B 1G2TA 2ZXRA 3BDLA 4IQZA 1XXGA 3T16A 1SEBD 4EQNA 4ZK9B 1FNUA 4HMJA 5EPJA 3A8IE 1PTOB 3HS0C 3NTKA 2RVLA 4KD4A 2WKCA 2KHSA 2XNAC 3D3RA 1BQQT 4IUUA 4IUNA 2EXZA 2V4DA 1V1PA 2NZ1D 1GOZA 4CKEA 1Q1BA 1D6EC 3K5NA 1U9RA 3V2TA 1B2TA 2B39A 5LL6X 3HGBA 2XSCA 3TP5A 4ZRZA 4R8IA 1EY9A 4K6LA 4K2KA 2B2VC 4C1NK 3Q0AA 2B63B 5M5XB 2KCNA 3D4WA 2H1EA 4CBVA 2F0JA 2R6GA 2EYLA 5D65A 2YYZA 2F0SA 1GUGA 1JE4A 3KUPA 5EPKA 2BCOA 1FGBD 1HFNA 3M85A 3TMEA 4F88A 3J7AV 2OEOA 4DGZA 3MEHA 2Z4IA 1DXMA 2KECA 5E3FA 5BN5A 5CV8A 3R8BA 5KIXA 4UAIA 5KYIA 1L0XB 5C0XJ 1BUVT 1HTPA 3AU7A 2Z8LA 1CM9A 1F2MA 4A3FB 3DWPA 3GTJB 5F2DA 1EYAA 5CORA 1I6VC 1V43A 4C3HB 4Z9CB 2K5DA 2J4XA 3FVQA 1MGSA 3CU7A 4FO2A 5JOBA 1EWCA 3RZDB 1HFGA 3OWFA 4WORA 5D14A 5M9OA 4KMUC 2TMPA 3LWEA 2F0NA 2NN6G 2JEAI 4I7ZC 5DEHA 4LK1C 3HEJA 4IUVA 3VR3A 5D3IB 2JSOA 2KJXA 3AB9A 5IGEA 2EYFA 3NSWA 4V190 1PFMA 1IL8A 4RGMA 2EYHA 3NBIA 3M4YA 1UUPA 1YNJD 1S5DD 2B8FA 3MVVA 5C0XH 2XVSA 5CYUA 4QCLA 3J81E 3ZYYX 2K5WA 2DY7A 2X6LA 3DM1A 1JWUD 3P7JA 1TU2B 4F8MA 2B2WA 4H7BA 3KLRA 5NUCA 2J7ZA 2MJ8A 1D1KA 4XT1B 1SE3A 4RCNA 2ENBA 1JOKA 3TN2A 3FEWX 3W3AA 4H44C 4MIUA 1DYQA 4KKUA 4A3GB 5ELCA 4RHRA 3K0YA 3E6ZX 5EBDA 4EGVA 3GQBA 3Q22A 2JXMB 1LTTD 1SNQA 2D9UA 1EZ8A 1B9NA 4KV6A 4PNYA 3N52A 1YNNC 3BDCA 1SYFA 3Q24A 1BDOA 3K7AB 3R2IA 2A6HD 4H0LC 4ZYSA 1EOTA 4ZQ3A 4NP5A 1EY5A 2BOSA 2EJFC 1HCZA 1CTMA 3S1RB 4QF4A 5HURA 3K58A 1BCPF 2PYKA 4C3IG 4KHZA 4BBRB 3KBGA 2PQEA 5CV9A 2WV6D 2EY5A 1Y1VB 3MXPA 2F0UA 2LMCB 2NBFA 3RLFA 4N9PA 5LHY1 4KHVA 2B2YC 2F0HA 5FO8B 1EY6A 5CBEE 1EY7A 1SYCA 4DFAA 5G3LF 1AW7A 1O7ZA 4BY1B 2WP8J 1HTLD 5E4WC 3NUCA 1DOMA 1I4QA 1DOKA 2RDGA 5M3FB 1RDPD 3P1HA 2VB2X 4BBSB 4FF2A 4DK0A 4FF4A 5JPNC 3OHXC 1HA6A 1EU3A 2FJ2A 1G8ZD 3OMCA 3T51B 5IIFA 3IKJA 4RHSA 1AZQA 3SHLA 1TWGB 1UEAB 1HQMC 5JVH3 5C0XI 3S16B 2F0WA 5TSSA 1JORA 2EYMA 3CRLC 3GTPB 5J1ZA 3KLSA 4K8JA 3J7YW 1EEFD 3JAML 4XTCS 4RFBA 1JC7A 4ZKCB 3HP3A 4QIWB 2Y0SB 1SFOB 2G9HD 5M5WB 1TS2A 1A3VA 1OXSC 2VB3X 3K59A 1PDQA 1ESFA 1EFID 4ULLA 1PRTF 1RF2D 4HMIA 3OWEB 1ZXTA 3FMCA 5IODA 2KOLA 4DN4M 2A6ED 5EQ0A 1WTPA 3IL8A 5FO7B 1H9JA 3DUZA 3D6WA 1WTOA 1LABA 1J8IA 3S17B 3JAME 4IUPA 5CV7A 1SSOA 2SNMA 1BXTA 3I72A 2F0IA 3I91A 1YNJC 3GTLB 2DNCA 4GZYC 1H9RA 4X3UA 2C5CA 1PMRA 5KNDA 2A74C 4MN3A 5K5PA 2RBMA 2EVBA 1A2TA 1RODA 1SNMA 1M8AA 1OO9B 3SVMA 4XQJA 5EJWA 1QWYA 3SR1A 3MHBA 5EPLA 1LTSD 1U4MA 4IN3A 1F2LA 2NYZD 1TWHB 1H9SB 4KY5A 1W6JA 4FNFA 1TS5A 1SE4A 1A2UA 5ELDA 3L9AX 4PMCA 2B2VA 3SK8A 2Q8TA 1Y8NB 1HQRD 2IL8A 4HCSA 1LO5D 1ZYRD 3GP7A 5CMDA 3Q6SA 5EBCA 4H13C 3VYTA 4CGYB 1RKNA 3D31A 5I6WA 2H4OA 1JWSD 5CV5A 1WVLA 2MGSA 3GTOB 1QOHA 2GA4B 3EA6A 3QO2A 1DOLA 1QB5D 2KEEA 2RSOA 4P2CB 2A6HC 2F0EA 5KNBA 4NMZA 1EY8A 2E74C 4XYQA 2BA0A 5ELEA 3RMHA 2IX3A 2WIIB 2D62A 1X32A 1QG7A 1LLRD 2LY7A 1G291 4K6DA 3OIQA 1TR5A 4J1MA 4F87A 2G9DA 4J6HA 1CT1D 1CK1A 3EFXD 1SYEA 3C3LA 4A3BB 3VYRA 2F0OA 1KABA 4FXGC 3RUZA 3FRPB 3NBHA 1I50B 2B2UA 5CGKA 4U68A 1DD2A 4RKBA 2HDMA 3QJYA 2ZXPA 1STGA 5IGDA 2M00A 2EJMA 4OGQC 1O7LA 3S9WA 1PTOC 3GTMB 1Q12A 3VA7A 4ZAIA 2MP1A 4I65A 1SJHD 3PUYA 1SXTA 2JE6I 4FF1A 5JVG3 4LAAA 1H9MA 5KRUA 2L1BA 1WTVA 1VMPA 3DHQA 1QNUA 4KJOA 5A35A 2RSNA 2FHTA 1IYUA 1PZJD 5JJZA 2F0FA 4NKLA 1LTID 4EQPA 2QILA 4NW2A 1T5EA 5FLXL 1AFPA 3TP6A 3NE5B 4KI0A 1CA6A 3CRKC 1JWMD 4TSSA 3CHBD 4FP5D 5C4HA 4RKLA 1OXUA 2WKDA 5C3WA 4CKCA 1TT2A 5C4JB 2K7VA 3MTSA 2PW7A 3AMUA 1F2ZA 3TBIB 4ZKBB 3S2HB 2E2IB 2F03A 1DONA 4BA1I 2PCFB 2X6GA 1LTBD 1FR3A 2EOTA 2O2LD 4DK1A 4FF3A 5FLXE 4Q0FA 3V05A 4G7OC 1XWEA 3WOEA 4XQQA 1I4HA 4K5VA 2XIWA 2WACA 1GUTA 3HOUB 4A3EB 1LV9A 2AQ1B 2EYPA 2ID0A 3R93A 4BA2I 1FNVA 3LWUA 4PV1C 2K6AA 4ZUJA 1IW7D 2L11A 4RGTA 3S2DB 5KNCA 1SAPA 1VCIA 1A3UA 2F0VA 3J7AF 3DWQA 1TVXA 4M1UB 2K33A 2IW3A 2B2YA 4FXDA 2BE5D 1B53A 1BCPD 3E0JA 4G7HC 2EY6A 3KLSX 2EY1A 1R4PB 1D5MC 2F0QA 3S15B 2JEBI 4HR7B 3HKZB 1KAAA 4KTAA 4DNTB 1VF7A 4HSPA 3U9SA 2JA6B 2EE1A 2N55A 5KGUA 1Z47A 5G3LD 3QB3A 4WJWA 3M7GA 4B9WA 3H0GB 1SYGA 2QDBA 1ESRA 1X3PA 4X3KA 2MHVA 1F77A 1WD0A 2A68D 5BN3A 2B2TA 4K5XA 1SJED 1EU4A 4A3KB 2QEJC 3GD7A 2HCCA 1G91A 2NTSA 1V1PB 1F9RA 2AWNA 3NQIA 3I3CA 1ET6A 3IAYA 2Z1CA 3OMGA 2XRQD 1EZ6A 4L63B 3DEPA 1SMYD 1I4PA 2IT1A 4XDXA 4S3SA 1U4LA 1PZID 4G4KA 3S14B 1K8OA 5EKLA 1B4OA 3LNNA 4HAEA 3EVQA 1D2BA 1AN8A 2HCIA 3DEOA 2SOBA 2PZTA 1A6XA 5CC4A 1U4RA 3A8KE 1B1ZA 2QKIC 1KLGD 5M3MB 1TY2A 1NAPA 3HG9A 1JOOA 1PRTD 3EROA 3MZ5A 1ML0D 1EY0A 3ERQA 1WD1A 1BOSA 4HSVA 5K36H 1HXYD 5KYLA 1PTOH 2FFKB 2PO4A 2WB1B 1KNAA 2ICIA 2PMZB 5JEAJ 5HGTA 1B44D 2R7ZB 1A3TA 2JA7B 5KEEA 3D4RA 4ILWA 3K5OA 1SNDA 3KF8A 2NVYB 1HHVA 2L12A 4HCEA 1B9MA 5C0XG 4IFDH 4CJ2C 3E5SA 4KK7A 3QOJA 3O13A 1TWCB 1RTNA 4LMQD 1WTRA 2KA7A 2A5HA 2AQ2B 4TQUS 4XT3B 2HUGA 1CQFA 2F0DA 1OXTA 1LT4D 1PFBA 2DNEA 2WAQB 2F3WA 4HN7A 1G2SA 4FYDA 3GTQB 1PXUA 3IFTA 3MXNA 3NTIA 5A2QL 4CKBA 4TRDA 3MFYA 3C1EA 1GUNA 4UDUC 3FKIB 3HOWB 3A55A 3X3NA 2B8GA 1KDCA 3DMUA 1EIHA 2B2WC 1WTWA 3BVGA 5JEAH 2IPKD 1Q1EA 2O5IC 1ZEQX 5IGGA 2DN8A 1AZPA 1SNPA 4K8IA 3G6JB 2I07B 4DAVA 4RGOS 4ME5A 3C1FA 2L4NA 3TZDA 3PUWA 1IW7C 4DNRB 3D4DA 1WTQA 2NVTB 5T1IA 1TWFB 5DM73 3NP8A 3C2PA 1TS4A 3F2UA 5JPMC 4KN7C 2F0LA 4DF7A 1STEA 2BE5C 1BCPC 2E75C 5FK9C 1CZWA 3NK9A 4A3DB 1E2VA 3M4OB 2VUMB 1BCPB 4OO1H 2HQEA 5COYA 4E6IA 2N88A 3ITPA 4FVMA 4QMGA 2L5TA 4C3JB 2MUYA 1LT5D 5DNFA 1LT3D 4QUCA 3V96A 1XTCD 3VR6A 3GO5A 2K32A 3NQTA 4C3IB 3OPOA 5J39A 2F4IA 1D5ZC 3A8JE 1NSNS 4DU9A 1AEXA 2A73B 3S1MB 1I4XA 1L0YB 5LL6S 1KTKA 2FMCA 4IALA 1E2ZA 1PTOF 1EIGA 3HOVB 1RHPA 1CHPD 3VR5A 4EQOA 1SNCA 4PQXA 3PMFA 2K1BA 2RDFA 1S5CD 1Z6HA 3PO2B 3VA5A 3BYTB 1SMYC 4XQNA 3PIP3 3TP7A 4KN4C 3N6RA 3NTHA 2RKSA 4L8JA 3MXGA 1EYDA 1E0BA 1MBYA 4ABNA 2F1MA 1S5ED 5DAUA 4M8AA 5ELBA 1GHKA 3M3YB 4KD3A 2QCPX 4A3MB 2BDOA 1CI3M 4IFDI 1QCBD 1GXDC 1TKWB 3SK6A 1PZKD 3ND8A 4G7ZC 4JK1C 3SDZA 3EJIA 2BA1A 1HA5A 3T13A 3VR4A 1JR0D 1BO0A 1QNKA 5FOBB 4C3HG 2CVRA 2AUKA 1PRTC 2PZWA 2TSSA 5C44B 1J9OA 5AFWA 1PRTB 2E76C 1R4QB 4FXKC 1FYCA 3BDOA 5C6AA 4OIKA 1BNZA 5E1FA 5DM63 4AYBB 4ODGA 1FNWA 4MHEA 1ENFA 3K6OA 4K2LA 1SE2A 1F9QA 4EVOA 3D8GA 1II3A 4O1NA 5C5LA 1JQYD 3L7ZC 4B9XA 4OL7A 4IUQA 1Q3LA 1ET9A 3H09A 4PMWA 2Z4HA 3SE0A 4KY6A 3SEBA 3T56B 1BF4A 2AWOA 3MXUA 4OO1I 1QE6A 1B3AA 1LTAD 3PUVA 3GTKB 1TS3A 1ZKOA 2OF1A 4IURA 1TIID 3MFGA 2JA8B 3OW7A 4RH6A 1TWAB 2O5JC 2DY8A 3I90A 4G57A 3QG1A 1Q8IA 3HOYB 2EDGA 3GTGB 5T1GA 2KEDA 2AQ3B 3BVZA 4A3JB 3NXWA 1HRJA 2NVXB 3SK4A 2NWGA 1JB3A 2R93B 1GUSA 2JA5B 1HUMA 1STAA 4ZUIA 2JP1A 4QB4A 1SNOA 2OT2A 1PFNA 4RAUC 1C8CA 1ONLA 1IKLA 3HRZC 2CW0D 5M5YB 3WOFA 2HDLA 2A6EC 4KY7A 1C48A 1SYDA 3M7NA 5I9OA 2SDFA 1MSHA 3H3VC 5C5MA 2ZT9C 4DXFA 5IGFA 2KQ3A 3A7AB 3BG3A 1M4VA 3G7LA 2C9OA 4RCOA 3NWSA 3A56A 1QILA 1O78A 3P20A 1UNSA 2K28A 1GUOA 2EY2A 2IJ0A 2K04A 3R2TA 4L6TB 2YU9B 1EQVA 3A54A 3K5MA 2XN9C 3I70A 2RQXA 4Y7NB 1DCZA 1MSGA 2Q8RE 3PIO3 3VYSA 4O42A 3J81L 3TP8A 5FO9B 1BR9A 4Q5VA 2I46A 1ILPA 3CKIB 2B2UC 4J8QA 2QF7A 5CV4A 1JOQA 3FPUB 2A69D 1STHA 2KVMA 1ZYRC 5I6YA 4C1NI 5E4XA 5EKIA 1KNEA 2R92B 1EWHA 2PNRC 3FDTA 2EYJA 2F0GA 4XXEA 2EJGC 3DXJC 2XWJB 3MWYW 1TY0A 1NR2A 3J80L 4R9WA 1NCVA 2NN6I 1X3QA 1S4ZA 1ICWA 5EGTA 1VDZA 1Y8PB 1B50A 1GUWA 2M9VA 3D6CA 3I4LA 1EYCA 3K57A 5EKKA 4DXGA 3S1QB 3I4MB 4QUFA 4KJNA 1IKMA 2RDHA 1G6ZA 5I9PA 3OOCA 3H94A 1CFMA 2K05A 1ENCA 1NUCA 3I73A 2NB0A 5J22A 5IT9L 5I2YA 1S5BD 4N9TA 5I4DA 2WINB 2IWHA 1HUNA 3J80E 4IFDJ 5CBAE 1CA5A 1U4PA 3LX0A 2E2DC 1SBBB 4XYOA 3C46A 2D2CC 1K83B 2F0TA 4WFN3 1O80A 5I2XA 3KBXA 1CQVA 2SEBD 3A7LA 3PUXA 4C3JG 3I8ZA 3Q23A 3W2DA 3PUZA 3MAQA 5IT9E 2PZUA 5FKAC 2FINB 1Q90A 3R3OA 4RWSC 2EYOA 4U673 4KKTA 3VR2A 4LJZC 1MI2A 4C2MB 3TZUA 2LKVA 2Q8IB 1R9TB 2F3VA 1WCMB 1EEID 1H9SA 2EPBA 3P75A 2LFNA 4JBWA 4K5WA 4ID6A 1F9SA 2L0CA 3S1NB 5C4XB 4OIJA 1AP0A 2X69A 4IUTA 1MD2D 5IOCA 4XIGS 1FD7D 1LTRD 1I6HB 1T5XD 3GV3A 2R3ZA 1O7YA 3WDNA 3ND9A 1EY4A 1PTOD 1NR4A 2IX0A 1F2YA 1W6KA 3CQZB 2CW0C 4NDXA 1SDFA 1KDAA 2NUCA 2IX1A 3GV6A 4CJ1B 3X3MA 1JICA 1XX8A 2NTTA 2SNSA 4BY7B 3L3OC 1Z7TA 3SK5A 2B2TC 4X3TA 3RZOB 3QOLA 4WRDA 1EL0A 2O4XA 3BYYB 1V8QA 2J0TD 4V0BA 4C56C 1ENAA 1JCKB 1S5FD 2JYOA 2NVQB 5A2QE 4DA2A 1Y69U 4OHJA 3K5LA 1IHZA 1VF5C 1H9KA 3ONAB 4A3IB 1OXXK 2E2JB 4ZLTF 2OXPA 3HOZB 2R61A 4BS9A 1KLUD 4TKOB 1I4GA 4BWGB 3SXHA 2F0PA 2F0KA 3IFDA 3FPPA 2MPMA 5CR3A 4RGNA 1PYWD 2K03A 1VMCA 5K36G 1STNA 2VNUD 2A69C 3HZXA 3MC0B 2KCCA 3URYA 4B08A 1D1IA 3BS1A 2M2LA 4CJ0B 5IGBA 2A68C 3QIAA 4IFDG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E3F A;  3ERO A;  3MZ5 A;  1EQV A;  2RKS A;  4KTA A;  5NUC A;  5CV8 A;  1KDA A;  1EY0 A;  2NUC A;  1EYD A;  3ERQ A;  4HTH A;  4ME5 A;  1KDB A;  3LX0 A;  5DAU A;  5IGC A;  5KIX A;  3NHH A;  3C1F A;  3H6M A;  4KY6 A;  2SNS A;  5KYI A;  4IZ8 A;  3OSO A;  4KD3 A;  5CV7 A;  2SNM A;  2PW5 A;  5KGU A;  2ENB A;  3D4D A;  1JOK A;  3NUC A;  4K6D A;  5C4H A;  4RKL A;  1TR5 A;  2F0I A;  3QB3 A;  4J1M A;  3TP8 A;  2F0T A;  3U9O A;  3SK5 A;  4J6H A;  4F7X A;  5KYL A;  2OF1 A;  1F2M A;  5C3W A;  4MIU A;  5JAV A;  3NP8 A;  5C4Z A;  1TT2 A;  4B9W A;  3QOL A;  4WRD A;  3SK6 A;  1SYG A;  2F0M A;  1SYE A;  5CV4 A;  2QDB A;  5F2D A;  5HGT A;  2F0L A;  4DF7 A;  2PW7 A;  1EYA A;  2O4X A;  3BDL A;  3P1H A;  2F0O A;  1A3T A;  1KAB A;  3EJI A;  1JOQ A;  5JOB A;  3T16 A;  1F2Z A;  5KEE A;  4EQN A;  1SND A;  3NK9 A;  3RUZ A;  3T13 A;  1TQO A;  5K5P A;  4K5X A;  1ENA A;  2RBM A;  3OWF A;  4WOR A;  1A2T A;  5M9O A;  5IGB A;  1SNQ A;  3OMC A;  4HMJ A;  4PMB A;  5CGK A;  5IIF A;  1EZ8 A;  4R8N A;  1SNM A;  2HQE A;  4G57 A;  1STH A;  1STB A;  4E6I A;  2PZU A;  3ITP A;  4KD4 A;  3SR1 A;  4DGZ A;  4RKB A;  4KV6 A;  5I6Y A;  2PZW A;  3R3O A;  2EYO A;  4PNY A;  2KHS A;  2F0N A;  3MHB A;  1IHZ A;  4QMG A;  3BDC A;  1STG A;  3E5S A;  5IGD A;  4K5V A;  3QOJ A;  1SYF A;  2M00 A;  3NXW A;  3SHL A;  5DEH A;  2EYJ A;  4IUN A;  3SK4 A;  3OMG A;  2WAC A;  2OXP A;  4KY5 A;  2EXZ A;  2F0G A;  1STA A;  1EZ6 A;  1STY A;  2LKV A;  3HEJ A;  4ZUI A;  2F3V A;  4QB4 A;  1SNO A;  1A2U A;  2F0D A;  3NQT A;  1U9R A;  3V2T A;  5CV6 A;  4PMC A;  3S9W A;  4ZQ3 A;  5J39 A;  2EYP A;  4NP5 A;  1EY5 A;  2F3W A;  4S3S A;  3SXH A;  2F0W A;  5IGE A;  3SK8 A;  2EYM A;  1JOR A;  3P75 A;  1NSN S;  2F0P A;  2EYF A;  1AEX A;  2F0K A;  5EGT A;  4DU9 A;  4I65 A;  4KY7 A;  4K5W A;  4QF4 A;  4ID6 A;  3TP5 A;  5J1Z A;  5C6A A;  1SYD A;  5EKL A;  1EY9 A;  4K8J A;  5HUR A;  3EVQ A;  4K2K A;  4ZUJ A;  5CR3 A;  5I9O A;  5E1F A;  2PYK A;  2SOB A;  4TRD A;  3D6C A;  2EYH A;  3C1E A;  2PZT A;  4LAA A;  1EYC A;  5C5M A;  5EKK A;  2PQE A;  5CV9 A;  4IAL A;  5CC4 A;  5KRU A;  4ODG A;  5IGF A;  2KQ3 A;  3DHQ A;  2F0V A;  1A3U A;  4K14 A;  4KJO A;  5C3X A;  1STN A;  3MVV A;  5ISR A;  4K2L A;  1A3V A;  3D4W A;  4EQO A;  5IOC A;  1RKN A;  1KDC A;  4EVO A;  1SNC A;  3D8G A;  4KJN A;  3HZX A;  2F0J A;  3DMU A;  1II3 A;  5I6W A;  2EY5 A;  2F0F A;  2EYL A;  5I9P A;  3MXP A;  5CV5 A;  2F0U A;  2F0S A;  4HMI A;  4NKL A;  3PMF A;  4EQP A;  2RDF A;  5IOD A;  1SYB A;  4N9P A;  2EY6 A;  1ENC A;  1EY4 A;  2EY1 A;  5C5L A;  4B9X A;  4KHV A;  1NUC A;  3VA5 A;  3TME A;  1JOO A;  2F0H A;  4OL7 A;  2F0Q A;  5J22 A;  4F8M A;  1EY6 A;  5IGG A;  2F0E A;  4N9T A;  2OEO A;  4NMZ A;  3TP6 A;  1EY7 A;  1SYC A;  4YIJ A;  1F2Y A;  1EY8 A;  2EY2 A;  3MEH A;  1SNP A;  3TP7 A;  4H7B A;  4NDX A;  1KAA A;  4K8I A;  4DFA A; 
#chains in the Genus database with same CATH topology
 2EZV A;  1OXV A;  2VXW A;  1XMQ L;  3VDY A;  3MA2 B;  3ULP A;  1XPU A;  4HTH A;  3BVM A;  2ICE C;  2JA8 G;  5IGC A;  2L55 A;  3NHH A;  3H6M A;  2I5H A;  4DAP A;  3RD4 A;  1CZG A;  1FL0 A;  1CHQ D;  4IZ8 A;  1V1O A;  2D5D A;  2E2H B;  1NTG A;  4RA8 A;  2K5Q A;  2K75 A;  1XNQ L;  2EQS A;  4X3S A;  5ELF A;  1BBX C;  4F7X A;  1HR0 Q;  3U9O A;  1C4Q A;  3DWA A;  4X66 L;  5C3E B;  5C4Z A;  3UI2 A;  1N33 L;  2F0M A;  1XPO A;  1EQT A;  4JYA Q;  3KF8 B;  1F9P A;  1DZ1 A;  1LAC A;  3HOY G;  1D5X C;  3VYU A;  3S1Q H;  3I4M H;  1GHJ A;  1TQO A;  2CHB D;  4JPB W;  1Y8O B;  2XWB B;  2RA4 A;  4DR7 Q;  4PMB A;  1ILQ A;  2R93 G;  4R8N A;  3QWN A;  1STB A;  1RCV D;  2KUM A;  5D3D A;  5BN4 A;  2UU9 Q;  2LS0 1;  3I7F A;  3EQL C;  4HJ8 A;  3JAM i;  4KKS A;  2L9H A;  5JEA G;  2CKZ B;  2AUJ D;  1I3Q B;  2FMM A;  1A15 A;  3HOX B;  5JJI A;  1HPC A;  1STY A;  1Y1W B;  1CKN A;  4DAY A;  1LTG D;  5CV6 A;  5IP7 H;  4A76 A;  3MXN B;  1DJR D;  4N8F A;  1KAW A;  1G51 A;  1GJX A;  1I4R A;  2K01 A;  3ULJ A;  2XRS D;  1RD9 D;  3TSS A;  4DV0 Q;  4LW1 A;  1C7Y A;  1GM5 A;  4JBK A;  1K83 H;  2PPB C;  4BXX G;  2CQA A;  2CWP A;  3BZD B;  1BBU A;  1K8G A;  1Z9F A;  1W2B A;  1LT6 D;  3NWT A;  4JI8 L;  2ZJQ A;  4K14 A;  5C3X A;  5ISR A;  3F2C A;  2NZO A;  5LMU L;  2BDN A;  4CHT B;  1WTX A;  3I4N B;  4A93 B;  2ZJP A;  2QA4 A;  1SRO A;  1IYV A;  3U4V A;  1K28 A;  3H15 A;  1K8M A;  3AFP A;  1OTC A;  2Q2I A;  2ZTE A;  1TXY A;  1SYB A;  3T4A C;  1E3P A;  1RJT A;  4OO1 G;  1WOC A;  3KK7 A;  1O7I A;  2ZTC A;  3NPP A;  4YIJ A;  1RTO A;  1S40 A;  4IJL A;  4B3M L;  2OTL A;  1PLF A;  1YNN D;  3TDQ A;  1R9T H;  1WCM H;  2VQE L;  3OIP A;  1XYI A;  1KDB A;  2NN6 H;  1QJO A;  3CW2 C;  1E2W A;  1DM0 B;  4HED A;  1VQ6 A;  3OSO A;  2OQ0 A;  3T53 B;  3HKZ G;  2PW5 A;  1GO3 E;  5LMN L;  1RIP A;  2D0O A;  1K0S A;  1UAP A;  5JAV A;  3S1N H;  5C4X H;  3PV0 A;  1PH7 A;  2JA6 G;  2ZXO A;  3H91 A;  3PO3 B;  2YTX A;  2ZXR A;  1G2T A;  3BDL A;  4IQZ A;  1XXG A;  3T16 A;  1SEB D;  4EQN A;  2ZM6 L;  3H0G G;  4ZK9 B;  1FNU A;  1QVG A;  4HMJ A;  1I6H H;  5EPJ A;  3A8I E;  1I94 L;  1PTO B;  3HS0 C;  3NTK A;  2RVL A;  4KD4 A;  4CDC C;  2WKC A;  2KHS A;  2XNA C;  3D3R A;  3M9B A;  1BQQ T;  4IUU A;  4IUN A;  4DV1 Q;  2EXZ A;  2V4D A;  1V1P A;  2NZ1 D;  4YCU A;  3CQZ H;  1EIY B;  2ES2 A;  3FKI H;  1GOZ A;  4CKE A;  1Q1B A;  1D6E C;  3K5N A;  4DV5 Q;  1U9R A;  3V2T A;  2A1A A;  2YV5 A;  1B2T A;  5FJ8 G;  2B39 A;  5LL6 X;  3HGB A;  4B3S L;  2XSC A;  4YY3 Q;  3TP5 A;  4ZRZ A;  4R8I A;  1EY9 A;  4K6L A;  1EUJ A;  4K2K A;  1MJE A;  3BU2 A;  4R4T A;  2B2V C;  2QW7 A;  3RZO H;  4C1N K;  3Q0A A;  2B63 B;  5M5X B;  2KHJ A;  2KCN A;  3D4W A;  2H1E A;  4CBV A;  2F0J A;  2R6G A;  2EYL A;  1XMQ Q;  5D65 A;  2YYZ A;  2F0S A;  1GUG A;  1IBL L;  1JE4 A;  3KUP A;  5EPK A;  3I55 A;  2EIF A;  2BCO A;  5IP7 G;  1FGB D;  1HFN A;  1MKH A;  3M85 A;  3TME A;  4F88 A;  3J7A V;  1ICF B;  2OEO A;  4DGZ A;  4A3I H;  1VQP A;  1V1Q A;  3MEH A;  4DR5 L;  2Z4I A;  2KCT A;  2E2J H;  1DXM A;  4X66 Q;  2KEC A;  5E3F A;  5GAG C;  3HOZ H;  4TVA B;  2R7D A;  5BN5 A;  1N33 Q;  5CV8 A;  3R8B A;  5KIX A;  4A3D H;  4UAI A;  5KYI A;  1VQA A;  1L0X B;  5C0X J;  1BUV T;  1HTP A;  3STB C;  3AU7 A;  2Z8L A;  1CM9 A;  1N9W A;  3L2P A;  1F2M A;  4A3F B;  4ZCK A;  1PFS A;  3DWP A;  3GTJ B;  5F2D A;  1GD7 A;  1EYA A;  5COR A;  1I6V C;  1V43 A;  4C3H B;  4Z9C B;  2K5D A;  3FVQ A;  2J4X A;  1MGS A;  3CU7 A;  4FO2 A;  5JOB A;  1EWC A;  3RZD B;  4KHP L;  1HFG A;  4YHH L;  2WB1 G;  3OWF A;  4WOR A;  5D14 A;  5M9O A;  4KMU C;  2E5L L;  1CSP A;  4C3I H;  2R7Z G;  2TMP A;  3LWE A;  2F0N A;  2NN6 G;  3S1M H;  2JEA I;  4I7Z C;  1PYS B;  1U5K A;  5DEH A;  3KYH C;  4LK1 C;  3HEJ A;  4IUV A;  1KC8 C;  4LF5 L;  3VR3 A;  5C4X G;  5D3I B;  3HOV H;  2JSO A;  4DR4 L;  4JI8 Q;  2K52 A;  2KJX A;  4GOP C;  3AB9 A;  5IGE A;  5LMU Q;  2E2H H;  2EYF A;  4X65 L;  1HR0 W;  3JAM c;  3NSW A;  3HKZ E;  4V19 0;  1PFM A;  4GOP B;  1IL8 A;  4RGM A;  4MTN A;  2EYH A;  3DM3 A;  3NBI A;  5C3E H;  3M4Y A;  4P72 A;  3K0X A;  1UUP A;  1EWI A;  1YNJ D;  3KOJ A;  1S5D D;  2AKW B;  2B8F A;  3E9H A;  3MVV A;  5C0X H;  2XVS A;  3F2D A;  1PH3 A;  5CYU A;  1XTD A;  1K9M C;  5FLM H;  2A8V A;  4QCL A;  1WYD A;  3J81 E;  4B3M Q;  4LF7 L;  1X9N A;  3ZYY X;  3FKI G;  2K5W A;  2VQE Q;  3HOW G;  2DY7 A;  3CCM A;  3BJU A;  2X6L A;  3RN2 A;  2I0Q A;  3DM1 A;  4OEL B;  4JI1 L;  4GLX A;  1JWU D;  3P7J A;  5LMN Q;  1TU2 B;  4F8M A;  2B2W A;  4H7B A;  1I3Q H;  3KLR A;  4GKK L;  4EQ5 A;  5NUC A;  2J7Z A;  2MJ8 A;  3HOX H;  1D1K A;  1Y1W H;  2B3G A;  4XT1 B;  1SE3 A;  4DUZ L;  1QZG A;  4RCN A;  2ENB A;  2ZM6 Q;  1JOK A;  3TN2 A;  4EX5 A;  3FEW X;  3W3A A;  4H44 C;  3CF5 A;  1KQS A;  4MIU A;  1DYQ A;  1X56 A;  4KKU A;  4A3G B;  1I94 Q;  5ELC A;  4RHR A;  1BKB A;  3K0Y A;  3E6Z X;  5EBD A;  4EGV A;  1EYG A;  3J81 j;  2D0P A;  3GQB A;  3Q22 A;  3I4N H;  2JXM B;  1LTT D;  1CKM A;  4JI0 L;  4DR1 L;  1SNQ A;  2D9U A;  1EZ8 A;  4JI6 Q;  1B9N A;  4KV6 A;  4LF8 L;  4PNY A;  3N52 A;  2CQO A;  4A3D G;  1YNN C;  3BDC A;  4O2D A;  2VUM G;  1SYF A;  4B3S Q;  3Q24 A;  1D7Q A;  3I2Z A;  2WFW A;  1BDO A;  2R7F A;  3K7A B;  3R2I A;  2A6H D;  4H0L C;  4ZYS A;  1EOT A;  4ZQ3 A;  4LF9 L;  1PH2 A;  4NP5 A;  1EY5 A;  2BOS A;  2EJF C;  1HCZ A;  1KRS A;  1CTM A;  1PH9 A;  3S1R B;  4QF4 A;  3ULL A;  5HUR A;  1ASZ A;  3K58 A;  3KFU A;  1BCP F;  2PYK A;  4C3I G;  2N49 A;  4KHZ A;  4BBR B;  3IRB A;  3KBG A;  4MTK A;  3PO3 H;  2PQE A;  5CV9 A;  4B3T L;  5AJ3 L;  4WJ4 A;  4DR5 Q;  5IYD G;  2WV6 D;  2EY5 A;  3MXP A;  1Y1V B;  2WB1 E;  2F0U A;  3ER0 A;  2LMC B;  2NBF A;  2PMZ E;  3RLF A;  3HOV G;  4N9P A;  4UP9 A;  3AEV A;  5LHY 1;  4KHV A;  2B2Y C;  4LF6 L;  1S72 A;  2F0H A;  3K80 C;  4JV5 L;  2G5D A;  1EY6 A;  5CBE E;  5FO8 B;  1EY7 A;  1SYC A;  4DFA A;  5G3L F;  2N78 A;  1SRU A;  1AW7 A;  4X6A H;  2JQO A;  4HIK A;  3PO2 G;  1O7Z A;  5E7N A;  4BY1 B;  2WP8 J;  1HTL D;  5E4W C;  4KHP Q;  4YHH Q;  3NUC A;  1V9P A;  1YNX A;  3EBE A;  5FLM G;  2E5L Q;  1DOM A;  1I4Q A;  1DOK A;  1IXR A;  2RDG A;  5M3F B;  1RDP D;  3P1H A;  2VB2 X;  4BBS B;  2WAQ E;  2B63 H;  3UDX A;  5M5X H;  4FF2 A;  4DK0 A;  4P73 A;  4DR3 L;  4FF4 A;  5JPN C;  3OHX C;  4PZ6 A;  1HA6 A;  1EU3 A;  2FJ2 A;  1Q81 C;  1G8Z D;  4IPH A;  3OMC A;  3T51 B;  2CCZ A;  3F2B A;  4LF5 Q;  5IIF A;  3IKJ A;  5M5Y H;  1YIT A;  4R1J A;  1Y1W G;  1VQ4 A;  4RHS A;  3E3X A;  3FP9 A;  1AZQ A;  4X65 Q;  3SHL A;  1TWG B;  1YHA A;  1UEA B;  2I5L X;  3RLO A;  5C44 G;  1HQM C;  5JVH 3;  5C0X I;  1BVS A;  3S16 B;  2KEN A;  2F0W A;  5TSS A;  1JOR A;  2EYM A;  3CRL C;  1E1O A;  3GTP B;  1PYB A;  5J1Z A;  3KLS A;  4LF7 Q;  4K8J A;  3J7Y W;  1EEF D;  4JVZ A;  3CD6 A;  3JAM L;  4XTC S;  4A3F H;  4RFB A;  1JC7 A;  4ZKC B;  3HP3 A;  4QIW B;  2Y0S B;  3GTJ H;  1JJ2 A;  1SFO B;  2G9H D;  4JI1 Q;  1HJP A;  5M5W B;  1TS2 A;  4C3H H;  2YU9 H;  1A3V A;  1OXS C;  2VB3 X;  3K59 A;  4NXN L;  3TS2 A;  3L0O A;  4A3L H;  3RZD H;  1PDQ A;  1ESF A;  1EFI D;  4ULL A;  1PRT F;  4GKK Q;  4Y7N H;  1RF2 D;  4HMI A;  3OWE B;  4AYB G;  1ZXT A;  1KD1 C;  3FMC A;  5IOD A;  2KOL A;  5FLX c;  4P74 A;  4DUZ Q;  4DN4 M;  2A6E D;  5EQ0 A;  1WTP A;  3IL8 A;  5FO7 B;  1VQF A;  1MIU A;  5IYC H;  1H9J A;  3DUZ A;  3D6W A;  1AE3 A;  1WTO A;  1LAB A;  1J8I A;  3S17 B;  2K5V A;  4IOC A;  3JAM E;  4IUP A;  1MJC A;  4IPG A;  5CV7 A;  1SSO A;  1IBM L;  2SNM A;  1BXT A;  3I72 A;  3OW2 A;  2F0I A;  4JI0 Q;  4DR1 Q;  3I91 A;  1YNJ C;  3GTL B;  1Q46 A;  2DNC A;  4GZY C;  1MHW C;  4DV7 L;  1K0R A;  2DJG C;  1H9R A;  4X3U A;  4LF8 Q;  2C5C A;  1PMR A;  5KND A;  4DV3 L;  2A74 C;  3TEH B;  4GNX A;  1UEB A;  4MN3 A;  5K5P A;  2RBM A;  2EVB A;  1A2T A;  3CCS A;  1ROD A;  1SNM A;  2H5X A;  2NZH A;  1M8A A;  1OO9 B;  3SVM A;  4XQJ A;  5EJW A;  1QWY A;  3SR1 A;  2HT1 A;  3CMA A;  4LF9 Q;  3MHB A;  5EPL A;  1LTS D;  1U4M A;  5LMN W;  4JBM A;  1Y14 B;  4IN3 A;  1F2L A;  4DR6 Q;  2NYZ D;  1TWH B;  2GVB A;  1H9S B;  4KY5 A;  1W6J A;  4FNF A;  1TS5 A;  1SE4 A;  1A2U A;  1CSQ A;  5ELD A;  3L9A X;  4PMC A;  4B3T Q;  5AJ3 Q;  2B2V A;  4A3J G;  3SK8 A;  2Q8T A;  1VQO A;  1Y8N B;  2JA5 G;  1VS0 A;  1H95 A;  2ALY B;  4GLV B;  1YJ9 A;  1HQR D;  2IL8 A;  4HCS A;  1LO5 D;  4A3G H;  1ZYR D;  1LUZ A;  3GP7 A;  3TQY A;  5CMD A;  4LF6 Q;  3Q6S A;  1X3G A;  5EBC A;  2JA9 A;  4JV5 Q;  4H13 C;  3VYT A;  4CGY B;  1RKN A;  3D31 A;  4K0K L;  1QZH A;  1SLJ A;  2RCF A;  3F8T A;  5I6W A;  2H4O A;  1JWS D;  5CV5 A;  1WVL A;  2MGS A;  3GTO B;  1L1O C;  1QOH A;  4UP8 A;  2GA4 B;  2RF4 A;  3EA6 A;  3QO2 A;  1DOL A;  1QB5 D;  1L1O B;  2KEE A;  2RSO A;  4P2C B;  4P75 A;  2PNH A;  2A6H C;  2F0E A;  5KNB A;  4NMZ A;  1EY8 A;  2E74 C;  2IHF A;  4XYQ A;  4DV6 L;  4A3F G;  2BA0 A;  3K7A H;  1VQG A;  2K14 A;  3E9I A;  5ELE A;  3T1Y L;  3RMH A;  2IX3 A;  2WII B;  2D62 A;  1X32 A;  1QG7 A;  4JI5 Q;  1LLR D;  2LY7 A;  1G29 1;  4DR3 Q;  3G48 A;  4K6D A;  3OIQ A;  2Z0S A;  1TR5 A;  4J1M A;  4HJA A;  4F87 A;  2G9D A;  3S1R H;  4J6H A;  4A3L G;  4GKJ L;  1CT1 D;  1CK1 A;  1Q82 C;  3EFX D;  4DKA C;  1NE3 A;  1SYE A;  3C3L A;  4A3B B;  1QUQ B;  4BBR H;  3CCQ A;  4C2M H;  1NNX A;  3VYR A;  2F0O A;  1DGS A;  1KAB A;  1D8L A;  4FXG C;  3RUZ A;  3FRP B;  2EXD A;  3NBH A;  3CC2 A;  1I50 B;  5IYC G;  2B2U A;  5CGK A;  1VQD A;  4U68 A;  4DAM A;  4OX9 L;  1DD2 A;  4PZ7 A;  4Y52 H;  4RKB A;  4B3R L;  4AYB E;  4A3C H;  2HDM A;  3QJY A;  2ZXP A;  3PCO B;  1STG A;  5IGD A;  2M00 A;  3EIV A;  4HID A;  2EJM A;  4OGQ C;  2R92 G;  5IWA L;  1O7L A;  3S9W A;  1G6P A;  1PTO C;  4BY1 H;  3B6Y A;  1HNW L;  3GTM B;  4IJH A;  1Q12 A;  4FDB A;  3KJO A;  4NXN Q;  3VA7 A;  4ZAI A;  2MP1 A;  4I65 A;  2K5N A;  1SJH D;  3PUY A;  1SXT A;  1WI5 A;  2JE6 I;  4FF1 A;  1U0L A;  5JVG 3;  1WJJ A;  4LAA A;  4YWL A;  1H9M A;  5KRU A;  1E24 A;  1X6O A;  2L1B A;  2N8N A;  5M3F H;  1WTV A;  1VMP A;  3DHQ A;  3G71 A;  1QNU A;  4KJO A;  5A35 A;  4BBS H;  2RSN A;  2FHT A;  3LGJ A;  1IYU A;  1PZJ D;  5JJZ A;  1UE6 A;  3ERS X;  3NEL A;  2F0F A;  3A0J A;  4NKL A;  1LTI D;  4BY7 H;  4EQP A;  1E22 A;  3I4M G;  2GVA A;  2QIL A;  4NW2 A;  1IBM Q;  1UWV A;  4CDD C;  1T5E A;  5FLX L;  1AFP A;  3UE1 A;  3TP6 A;  3RR5 A;  1YHB A;  3AFQ A;  3NE5 B;  4KI0 A;  2ZJR A;  4DV7 Q;  1CA6 A;  3CRK C;  5IP9 H;  4DV3 Q;  3S16 H;  1JWM D;  4TSS A;  3PF4 A;  4ME3 A;  3CHB D;  4FP5 D;  5C4H A;  3KDF A;  4RKL A;  2NVQ H;  1OXU A;  2WKD A;  2UUA L;  3GTP H;  3M4Q A;  5C3W A;  4CKC A;  1TT2 A;  4UPA A;  1NMG A;  5C4J B;  1XNQ Q;  2K7V A;  3MTS A;  2PW7 A;  3AMU A;  1FGU A;  3CCL A;  1F2Z A;  3TBI B;  4ZKB B;  3S2H B;  2E2I B;  5M5W H;  2F03 A;  1DON A;  4BA1 I;  2PCF B;  2X6G A;  1FVI A;  1N8R C;  1UE5 A;  1LTB D;  1FR3 A;  2EOT A;  2O2L D;  4DK1 A;  4FF3 A;  4OON A;  3RLN A;  5FLX E;  4Q0F A;  3V05 A;  4G7O C;  1XWE A;  3WOE A;  3J7A 5;  4XQQ A;  1I4H A;  4K5V A;  1CKN B;  4DAY B;  1PH4 A;  2XIW A;  2PI2 E;  2WAC A;  4OEM B;  1GUT A;  3HOU B;  3A5U A;  2MO1 A;  4A3E B;  5DLQ E;  1LV9 A;  2AQ1 B;  4GN5 A;  4LF4 L;  1ASY A;  3S17 H;  2EYP A;  2ID0 A;  3R93 A;  4BA2 I;  1EFW A;  1FNV A;  3LWU A;  4IPD A;  4MZ9 A;  4PV1 C;  2K6A A;  1WCM G;  4X64 L;  4QY7 A;  4ZUJ A;  4LNQ A;  1IW7 D;  2L11 A;  4RGT A;  3GTL H;  1Q86 C;  3S2D B;  3I4O A;  5KNC A;  3EN2 A;  1YIJ A;  1SAP A;  1K3B C;  1A3U A;  1VCI A;  2F0V A;  4A3C G;  1A8V A;  3J7A F;  1SN8 A;  3DWQ A;  1TVX A;  4M1U B;  2K33 A;  2IW3 A;  2B2Y A;  4FXD A;  4LFC L;  2BE5 D;  1B53 A;  1BCP D;  3E0J A;  1VQL A;  3T1Y Q;  4G7H C;  2EY6 A;  3KLS X;  2EY1 A;  4JOI A;  1R4P B;  2FXQ A;  4GN3 B;  1D5M C;  2F0Q A;  3S15 B;  3NBH B;  1VQM A;  2JEB I;  3DLL A;  4HR7 B;  3HKZ B;  1KAA A;  5GQO A;  1TWH H;  4KTA A;  4DNT B;  2JJQ A;  1PHJ A;  1E7Z A;  1VF7 A;  2CH4 A;  4HSP A;  3U9S A;  4QL5 A;  2JA6 B;  5M3F G;  2EE1 A;  1Q8K A;  2N55 A;  3U58 A;  4BBS G;  5KGU A;  1Z47 A;  1GKH A;  5G3L D;  2ASB A;  3QB3 A;  4WJW A;  3RNU A;  5GRO A;  4LFA L;  1A63 A;  4OX9 Q;  1N34 L;  2DUD A;  3M7G A;  4B9W A;  3AYH B;  3H0G B;  1SYG A;  2QDB A;  4BY7 G;  1ESR A;  1X3P A;  4B3R Q;  4X3K A;  2MHV A;  2CH4 W;  3TRE A;  1F77 A;  1WD0 A;  2A68 D;  2B29 A;  5BN3 A;  2B2T A;  4K5X A;  1SJE D;  1EU4 A;  2Z6K A;  4A3K B;  3CCJ A;  2Q2H A;  3K8A A;  2QEJ C;  3W5O A;  2HIX A;  2QGQ A;  3GTO H;  3GD7 A;  5IWA Q;  2HCC A;  1G91 A;  2NTS A;  1V1P B;  1HNW Q;  1F9R A;  5IP9 G;  2AWN A;  1XNR L;  2AMC B;  3NQI A;  3I3C A;  1ET6 A;  3IAY A;  2Z1C A;  1GVP A;  2XTI A;  3OMG A;  1PH1 A;  2XRQ D;  1EZ6 A;  4L63 B;  3DEP A;  1SMY D;  1I4P A;  2IT1 A;  4XDX A;  4A3I G;  1N36 L;  1HZ9 A;  4S3S A;  4A93 H;  2Y0S G;  1U4L A;  1IZ6 A;  1PZI D;  3HOZ G;  4G4K A;  1A0I A;  3S14 B;  1K8O A;  5EKL A;  1B4O A;  3LNN A;  1M90 C;  4HAE A;  3EVQ A;  1D2B A;  1AN8 A;  4R4O A;  4DPG A;  2HCI A;  1YBY A;  2SOB A;  3DEO A;  3A5Z B;  2PZT A;  1A6X A;  5CC4 A;  4A3B H;  1SR3 A;  1QVF A;  4YCV A;  1U4R A;  3A8K E;  1PA6 A;  3KDF B;  1B1Z A;  2QKI C;  1KLG D;  5M3M B;  1TY2 A;  4DK3 C;  1I50 H;  4L5S A;  2MQH A;  4JCV E;  1NAP A;  3PGZ A;  3HG9 A;  1HNX L;  3NEN A;  1JOO A;  4QGU A;  1CUK A;  3M4P A;  5ELO A;  2IHE A;  3S24 A;  1IBL Q;  2UUA Q;  3D0F A;  1PRT D;  4L5R C;  3ERO A;  3MZ5 A;  4LUZ A;  1ML0 D;  1EY0 A;  3U50 C;  3ERQ A;  2UUC L;  5EAY A;  1WD1 A;  4QQB X;  4L5T A;  3K7U C;  1BOS A;  1UE7 A;  3GTM H;  4NXM L;  2MFI A;  4HSV A;  5K36 H;  4HJ9 A;  1HXY D;  5KYL A;  1PTO H;  2FFK B;  1KHI A;  2N3S A;  2PO4 A;  2WB1 B;  1KNA A;  2ICI A;  2PMZ B;  5JEA J;  5HGT A;  1VQ9 A;  1NY4 A;  1B44 D;  1J5E L;  2R7Z B;  1A3T A;  4RMF A;  2JA7 B;  5KEE A;  3D4R A;  4ILW A;  3K5O A;  1SND A;  3KF8 A;  5C3E G;  2NVY B;  1HHV A;  2L12 A;  4HCE A;  1XJV A;  4R4C A;  2Q2U A;  1B9M A;  4LF4 Q;  5C0X G;  4IFD H;  3WWV A;  4CJ2 C;  5H1S E;  3E5S A;  4KK7 A;  3QOJ A;  3O13 A;  3CAM A;  1VQN A;  1TWC B;  1RTN A;  4LMQ D;  4X64 Q;  1WTR A;  4JI4 L;  2KA7 A;  2A5H A;  2AQ2 B;  4TQU S;  4XT3 B;  4HIO A;  1RL2 A;  2HUG A;  1X55 A;  3PIP A;  1CQF A;  2F0D A;  1OXT A;  1LT4 D;  1PFB A;  2VS1 A;  2DNE A;  2WAQ B;  2UXC L;  2F3W A;  4HN7 A;  1G2S A;  4FYD A;  1B70 B;  3GTQ B;  3HOX G;  3PSI A;  1PXU A;  4LFC Q;  3IFT A;  3MXN A;  3NTI A;  4DR4 Q;  5A2Q L;  4CKB A;  2OWO A;  2K50 A;  4TRD A;  3MFY A;  3C1E A;  1GUN A;  4UDU C;  1E1T A;  3FKI B;  3RN5 A;  3HOW B;  3A55 A;  3X3N A;  2B8G A;  1QVC A;  4IOA A;  1KDC A;  3S2H H;  2E2I H;  1KXL A;  3DMU A;  1EIH A;  1M1K C;  2B2W C;  1WTW A;  3BVG A;  1NMF A;  5JEA H;  2IPK D;  1VQH A;  4LUV A;  1Q1E A;  2KBN A;  2O5I C;  1ZEQ X;  4JG2 A;  3BZC A;  3I4N G;  1YZ6 A;  1IL2 A;  4A93 G;  2Z9H A;  2MNA A;  5IGG A;  4AQY L;  2DN8 A;  1AZP A;  1SNP A;  4LFA Q;  4K8I A;  1IBK L;  3G6J B;  2I07 B;  4DAV A;  1WTH A;  3HOU H;  4A3E H;  4RGO S;  4ME5 A;  3C1F A;  3UDF A;  2L4N A;  3TZD A;  3PUW A;  1IW7 C;  1X3E A;  4DNR B;  3D4D A;  1WTQ A;  2NVT B;  1XPR A;  5T1I A;  1TWF B;  1L0W A;  5DM7 3;  5BR8 L;  1SMX A;  3NP8 A;  3C2P A;  3CC7 A;  1TS4 A;  1HNZ L;  3F2U A;  4UP7 A;  5JPM C;  4KN7 C;  2F0L A;  4DF7 A;  3S2D H;  1STE A;  1B7Y B;  2BE5 C;  4X62 L;  3CCV A;  1BCP C;  2E75 C;  5FK9 C;  1CZW A;  1XNR Q;  4JI7 L;  3NK9 A;  4A3D B;  1E2V A;  3M4O B;  2VUM B;  1BCP B;  4OO1 H;  3PO3 G;  4JI3 L;  2HQE A;  5COY A;  4E6I A;  1L2F A;  2N88 A;  3ITP A;  4FVM A;  3CP0 A;  1N36 Q;  4QMG A;  2L5T A;  4C3J B;  1A62 A;  2MUY A;  1NJI C;  1LT5 D;  1HH2 P;  2UUB L;  5DNF A;  3STB D;  1EOV A;  3S15 H;  1LT3 D;  4QUC A;  3V96 A;  1XTC D;  3VR6 A;  4DR2 L;  3GO5 A;  3W1G A;  2K32 A;  4YY3 L;  1UE1 A;  3NQT A;  4C3I B;  3OPO A;  5J39 A;  2F4I A;  2JA6 H;  1D5Z C;  2Q2T A;  1JJG A;  3A8J E;  1NSN S;  2GN5 A;  4DU9 A;  1AEX A;  4DV2 L;  2A73 B;  3S1M B;  1I4X A;  1L0Y B;  3H0G H;  2E8G A;  5LL6 S;  1KTK A;  2FMC A;  2V1C C;  4IAL A;  2HHH L;  1E2Z A;  1PTO F;  5ELN A;  1HNX Q;  1EIG A;  3HOV B;  1RHP A;  1CHP D;  3VR5 A;  4EQO A;  1SNC A;  4KLK A;  4PQX A;  4JBJ A;  1LTL A;  4A3K H;  2B63 G;  2UUC Q;  3PMF A;  2K1B A;  2RDF A;  1S5C D;  1Z6H A;  3PO2 B;  3VA5 A;  2IY5 B;  3BYT B;  1SMY C;  4XQN A;  4NXM Q;  3PIP 3;  3TP7 A;  4KN4 C;  1KL9 A;  5FJ8 H;  3CC4 A;  3N6R A;  3NTH A;  4LFB L;  2RKS A;  4L8J A;  4L5Q A;  1CKO A;  2LXJ A;  4N8X 1;  3MXG A;  1EYD A;  1E0B A;  1MBY A;  4ABN A;  2F1M A;  1S5E D;  4HIM A;  4DNI A;  5DAU A;  1J5E Q;  4M8A A;  5ELB A;  2MO0 A;  3J81 c;  2QDL A;  3M3Y B;  4KD3 A;  1GHK A;  2QCP X;  4A3M B;  2PI2 A;  2BDO A;  4YWM A;  1CI3 M;  3S14 H;  4IFD I;  1QCB D;  3ZJY C;  1GXD C;  1TKW B;  3SK6 A;  2RHQ B;  1PZK D;  3ND8 A;  3PF5 A;  4G7Z C;  4JK1 C;  3SDZ A;  3SGI A;  4GN4 B;  3EJI A;  2BA1 A;  3CCR A;  1HA5 A;  3T13 A;  3VR4 A;  1JR0 D;  4APV A;  4JI4 Q;  5M3M H;  1JT8 A;  1BO0 A;  1QNK A;  3NEM A;  4P71 A;  5FOB B;  3HOU G;  4C3H G;  2CVR A;  2AUK A;  2JN4 A;  1PRT C;  2KHI A;  2PZW A;  2TSS A;  5C44 B;  4A3E G;  2UXC Q;  1J9O A;  4GS3 A;  4OXP A;  5AFW A;  2RCN A;  1PRT B;  2E76 C;  1JB7 A;  3CCE A;  1R4Q B;  5JJK A;  2L15 A;  2HD3 A;  4FXK C;  3J80 c;  4R4I A;  1FJG L;  1FYC A;  2ZTD A;  3BZK A;  1S3O A;  1YI2 A;  1Y1V H;  3BDO A;  5C6A A;  4OIK A;  1BNZ A;  2HIV A;  3PIO A;  5E1F A;  1HZC A;  5DM6 3;  4AYB B;  4ODG A;  4GOP A;  1FNW A;  4MHE A;  1ENF A;  3I56 A;  3K6O A;  2R7Z H;  4K2L A;  1SE2 A;  4AQY Q;  2JA7 H;  1F9Q A;  4H02 A;  3D8G A;  4EVO A;  4AH6 A;  1EQQ A;  3H3V I;  1II3 A;  1IBK Q;  2NVY H;  3QR8 A;  4O1N A;  1YEZ A;  1WFQ A;  5C5L A;  1KRT A;  5IT9 c;  1JQY D;  3L7Z C;  4B9X A;  4POF A;  4OL7 A;  4IUQ A;  1Q3L A;  1AH9 A;  1ET9 A;  2F3I A;  3H09 A;  1TWC H;  4DV4 L;  5BR8 Q;  1VQB A;  2PQA A;  4PMW A;  2UXB L;  3G4S A;  2KCM A;  2Z4H A;  3GDE A;  1HNZ Q;  3SE0 A;  4X62 Q;  4KY6 A;  3SEB A;  3T56 B;  1BF4 A;  2AWO A;  3MXU A;  5GAD C;  1QE6 A;  4JI7 Q;  4OO1 I;  1B3A A;  1LTA D;  3PUV A;  3GTK B;  3GTQ H;  4GNX C;  1N32 L;  1TS3 A;  1ZKO A;  2OF1 A;  4JI3 Q;  4IUR A;  3UE0 A;  1TII D;  3MFG A;  2JA8 B;  3OW7 A;  4A3K G;  4GNX B;  4RH6 A;  1TWA B;  1K8A C;  2O5J C;  1TWG H;  2DY8 A;  4JI6 L;  3HOW H;  2UUB Q;  5J3B A;  4A3G G;  1HZB A;  4DR2 Q;  3T1H L;  4JI2 L;  3I90 A;  4G57 A;  4LUO A;  3QG1 A;  1Q8I A;  3HOY B;  3KLW A;  2EDG A;  3GTG B;  5T1G A;  2VY3 A;  2KED A;  2AQ3 B;  3BVZ A;  4A3J B;  3NXW A;  1HRJ A;  5L37 A;  4I7A A;  4DV2 Q;  2NVX B;  3SK4 A;  2NWG A;  1JB3 A;  2R93 B;  1X54 A;  1GUS A;  2JA5 B;  1HUM A;  1STA A;  4ZUI A;  4WJ3 M;  2JP1 A;  1X65 A;  1SFO H;  4QB4 A;  1SNO A;  2OT2 A;  1PFN A;  4RAU C;  1C8C A;  1ONL A;  2UXD L;  2HHH Q;  1IKL A;  3HRZ C;  2CW0 D;  5M5Y B;  3WOF A;  2HDL A;  2A6E C;  2OCE A;  1YVC A;  4KY7 A;  1C48 A;  3UDG A;  1SYD A;  2NVT H;  3M7N A;  1PH8 A;  1TWF H;  5I9O A;  2SDF A;  2F4V L;  5M3M G;  1MSH A;  3H3V C;  5C5M A;  4QJF A;  2ZT9 C;  4DXF A;  5IGF A;  2KQ3 A;  3A7A B;  3BG3 A;  3OTO L;  1YHQ A;  3M4O H;  2VUM H;  4LFB Q;  1M4V A;  4BBR G;  3G7L A;  2C9O A;  4RCO A;  3NWS A;  3A56 A;  3TRZ A;  4K0K Q;  1QIL A;  1O78 A;  1P8L A;  4C3J H;  1EQR A;  1UNS A;  2K28 A;  3P20 A;  1GUO A;  1Y1V G;  2EY2 A;  2IJ0 A;  2K04 A;  3R2T A;  4L6T B;  1T9H A;  2YU9 B;  2XGT A;  1EQV A;  3A54 A;  3KF6 A;  3K5M A;  2XN9 C;  2F52 A;  3I70 A;  4YCW A;  2RQX A;  4Y7N B;  1EIF A;  1DCZ A;  1MSG A;  2Q8R E;  3PIO 3;  3VYS A;  4DV6 Q;  4O42 A;  3J81 L;  4JC0 A;  3TP8 A;  2JA7 G;  5FO9 B;  1BR9 A;  4Q5V A;  2I46 A;  1ILP A;  3CKI B;  5IYD H;  2B2U C;  4J8Q A;  3AQQ A;  4BY1 G;  2QF7 A;  4RG1 A;  5CV4 A;  4GKJ Q;  1PVO A;  3MEF A;  1JOQ A;  3G6E A;  3PQI A;  3CPW A;  3FPU B;  2A69 D;  1STH A;  1FJG Q;  2KVM A;  4UY8 C;  1ZYR C;  5I6Y A;  4C1N I;  5E4X A;  5EKI A;  1KNE A;  2R92 B;  5GAH C;  3PO2 H;  4A4I A;  4DUY L;  1EWH A;  2PNR C;  2WAQ G;  3FDT A;  2EYJ A;  5JJL A;  2BH8 A;  2F0G A;  4XXE A;  2EJG C;  3DXJ C;  4MNO A;  2XWJ B;  3MWY W;  1XMO L;  1TY0 A;  1NR2 A;  3J80 L;  4R9W A;  1NCV A;  2NN6 I;  2VL6 A;  2VQF L;  1X3Q A;  1S4Z A;  3M3Y H;  1ICW A;  5EGT A;  4R4Q A;  4A3M H;  1VDZ A;  2PQA B;  1Y8P B;  1B50 A;  4ALP A;  1GUW A;  1VQK A;  2M9V A;  3D6C A;  5HGQ A;  3I4L A;  1EYC A;  3K57 A;  5EKK A;  2A19 A;  4DXG A;  3KJP A;  3HKS A;  3S1Q B;  2QEX A;  2K5H A;  3I4M B;  4QUF A;  4OWT B;  4KJN A;  4DV4 Q;  1IKM A;  2RDH A;  1G6Z A;  5I9P A;  3OOC A;  3ICE A;  2UXB Q;  3H94 A;  4IPC A;  1CFM A;  2K05 A;  3HFZ B;  5IYB H;  3CCU A;  1ENC A;  1NUC A;  3I73 A;  1PH6 A;  2NB0 A;  5C44 H;  4NB3 A;  5J22 A;  5IT9 L;  5I2Y A;  1S5B D;  4N9T A;  2I5M X;  1VQ7 A;  5I4D A;  1N32 Q;  2WIN B;  3E0E A;  2IWH A;  1KIX A;  1HUN A;  3J80 E;  4IFD J;  2DJF C;  5CBA E;  1CA5 A;  4HJ5 A;  1U4P A;  2YTV A;  4DK6 C;  2OQK A;  3LX0 A;  2E2D C;  2OTJ A;  1SBB B;  3OYY A;  4JW0 A;  4O0A A;  4XYO A;  3C46 A;  5IE8 A;  1VQ5 A;  4PZ8 A;  2D2C C;  1K83 B;  2F0T A;  1C0A A;  3T1H Q;  3J81 i;  1VQC A;  4JI2 Q;  4WFN 3;  1O80 A;  5I2X A;  3U4Z A;  3KBX A;  1CQV A;  2SEB D;  1B3Q A;  4IO9 A;  3FHW A;  1Q7Y C;  3A7L A;  2AHO B;  3PUX A;  1IYJ B;  4C3J G;  3I8Z A;  1VQJ A;  3Q23 A;  1HR0 L;  3W2D A;  3PUZ A;  5GAE C;  3MAQ A;  3A74 A;  5IT9 E;  2PZU A;  4DR6 L;  5FKA C;  1VQE A;  2FIN B;  2UXD Q;  1Q90 A;  4JYA L;  3R3O A;  4RWS C;  2EYO A;  4GLA C;  4U67 3;  4KKT A;  2CFM A;  3VR2 A;  4LJZ C;  3TS0 A;  1MI2 A;  4C2M B;  1J6Q A;  3J7Z C;  3TZU A;  2C35 B;  3F1Z A;  5IY0 A;  1NBW A;  2LKV A;  3Q8D A;  1K3R A;  2Q8I B;  4DR7 L;  1R9T B;  1VQI A;  2RHS B;  2F3V A;  2F4V Q;  1WCM B;  1EEI D;  2K4K A;  1YJN A;  4PG3 A;  2UU9 L;  1H9S A;  2EPB A;  1JMC A;  3W1B A;  3OTO Q;  3P75 A;  3J80 i;  2LFN A;  4JBW A;  4K5W A;  4ID6 A;  4UHV A;  1F9S A;  2L0C A;  3S1N B;  3KF6 B;  3GTK H;  5C4X B;  2JA8 H;  4OIJ A;  1JJC B;  1AP0 A;  2X69 A;  1TWA H;  1AE2 A;  4JOI C;  4IUT A;  1MD2 D;  1HZA A;  3CME A;  5IOC A;  4XIG S;  1FD7 D;  1LM0 A;  1LTR D;  4DV0 L;  1I6H B;  1T5X D;  4J15 A;  3GV3 A;  2R3Z A;  1O7Y A;  3WDN A;  3ND9 A;  1JE5 A;  1EY4 A;  2HQL A;  1PTO D;  1NR4 A;  3HOY H;  4CDE C;  3GTG H;  2DGY A;  2IX0 A;  4A3J H;  1F2Y A;  1W6K A;  3CQZ B;  2CW0 C;  4NDX A;  5C4J H;  1L1O A;  4YWK A;  1SDF A;  4JI5 L;  4A3M G;  2NVX H;  2R93 H;  2JA5 H;  4OWX B;  3JC6 6;  1KDA A;  2NUC A;  2IX1 A;  3GV6 A;  4CJ1 B;  3X3M A;  1JIC A;  1XX8 A;  2NTT A;  2P5Z X;  2SNS A;  4BY7 B;  1B8A A;  3L3O C;  4CDF C;  1Z7T A;  2CWA A;  3SK5 A;  2B2T C;  4X3T A;  2Z6K C;  3RZO B;  3QOL A;  4WRD A;  4NPS A;  1EL0 A;  2O4X A;  5IYB G;  1PV4 A;  3BYY B;  4DUY Q;  1V8Q A;  2J0T D;  1YJW A;  1N34 Q;  1VQ8 A;  1PH5 A;  4V0B A;  4C56 C;  4HJ7 A;  3H3V H;  1QUQ A;  1ENA A;  1JCK B;  4BXX H;  2ATW A;  1S5F D;  2JYO A;  1SE8 A;  4A3B G;  2NVQ B;  5A2Q E;  4DA2 A;  1Y69 U;  1XMO Q;  4OHJ A;  4QIW E;  3K5L A;  1W3S A;  2Y0S E;  2LXK A;  3CXC A;  2YTY A;  1IHZ A;  1VF5 C;  2VQF Q;  1H9K A;  3ONA B;  4A3I B;  1OXX K;  2E2J B;  4ZLT F;  2OXP A;  3HOZ B;  2JK8 A;  2R61 A;  3UDI A;  4BS9 A;  4A75 A;  1KLU D;  4TKO B;  2VZA A;  1I4G A;  4BWG B;  3SXH A;  1BBW A;  2VW9 A;  2F0P A;  2F0K A;  2BH2 A;  3CPF A;  4AIM A;  3IFD A;  3FPP A;  4DV1 L;  2MPM A;  5CR3 A;  4RGN A;  4POG A;  1PYW D;  2K03 A;  1VMC A;  4DV5 L;  3K81 C;  5K36 G;  1STN A;  4LWC A;  2VNU D;  2A69 C;  5HY6 A;  1P16 A;  1LYL A;  2Z6B A;  3HZX A;  3MC0 B;  2LSS A;  1I5F A;  1C9O A;  2KCC A;  3URY A;  4B08 A;  1X3F A;  1D1I A;  3BS1 A;  2M2L A;  2R92 H;  4CJ0 B;  5IGB A;  1K73 C;  2A68 C;  3QIA A;  4OWW B;  4IFD G; 
#chains in the Genus database with same CATH homology
 2EZV A;  1OXV A;  2VXW A;  3MA2 B;  4HTH A;  3BVM A;  2ICE C;  5IGC A;  2L55 A;  3NHH A;  3H6M A;  4DAP A;  3RD4 A;  1CZG A;  1CHQ D;  4IZ8 A;  1V1O A;  2D5D A;  2E2H B;  4RA8 A;  2K5Q A;  4X3S A;  5ELF A;  1BBX C;  4F7X A;  3U9O A;  1C4Q A;  3DWA A;  5C3E B;  5C4Z A;  3UI2 A;  2F0M A;  1EQT A;  1F9P A;  1DZ1 A;  1LAC A;  1D5X C;  3VYU A;  1GHJ A;  1TQO A;  2CHB D;  1Y8O B;  2XWB B;  2RA4 A;  4PMB A;  1ILQ A;  4R8N A;  3QWN A;  1STB A;  1RCV D;  2KUM A;  5D3D A;  5BN4 A;  2LS0 1;  3EQL C;  4KKS A;  2L9H A;  5JEA G;  2AUJ D;  1I3Q B;  2FMM A;  1A15 A;  3HOX B;  1HPC A;  1STY A;  1Y1W B;  4DAY A;  1LTG D;  5CV6 A;  1DJR D;  1GJX A;  1I4R A;  2K01 A;  2XRS D;  1RD9 D;  3TSS A;  2PPB C;  2CQA A;  3BZD B;  1LT6 D;  3NWT A;  4K14 A;  5C3X A;  5ISR A;  2BDN A;  4CHT B;  1WTX A;  3I4N B;  4A93 B;  1IYV A;  1K8M A;  1SYB A;  3T4A C;  1RJT A;  4OO1 G;  3KK7 A;  3NPP A;  4YIJ A;  1RTO A;  1PLF A;  1YNN D;  3TDQ A;  3OIP A;  1XYI A;  1KDB A;  2NN6 H;  1QJO A;  1E2W A;  1DM0 B;  4HED A;  3OSO A;  3T53 B;  2PW5 A;  1UAP A;  5JAV A;  3PV0 A;  2ZXO A;  3H91 A;  3PO3 B;  1G2T A;  2ZXR A;  3BDL A;  4IQZ A;  1XXG A;  3T16 A;  1SEB D;  4EQN A;  4ZK9 B;  1FNU A;  4HMJ A;  5EPJ A;  3A8I E;  1PTO B;  3HS0 C;  3NTK A;  2RVL A;  4KD4 A;  2WKC A;  2KHS A;  2XNA C;  3D3R A;  1BQQ T;  4IUU A;  4IUN A;  2EXZ A;  2V4D A;  1V1P A;  2NZ1 D;  1GOZ A;  4CKE A;  1Q1B A;  1D6E C;  3K5N A;  1U9R A;  3V2T A;  1B2T A;  2B39 A;  5LL6 X;  3HGB A;  2XSC A;  3TP5 A;  4ZRZ A;  4R8I A;  1EY9 A;  4K6L A;  4K2K A;  2B2V C;  4C1N K;  3Q0A A;  2B63 B;  5M5X B;  2KCN A;  3D4W A;  2H1E A;  4CBV A;  2F0J A;  2R6G A;  2EYL A;  5D65 A;  2YYZ A;  2F0S A;  1GUG A;  1JE4 A;  3KUP A;  5EPK A;  2BCO A;  1FGB D;  1HFN A;  3M85 A;  3TME A;  4F88 A;  3J7A V;  2OEO A;  4DGZ A;  3MEH A;  2Z4I A;  1DXM A;  2KEC A;  5E3F A;  5BN5 A;  5CV8 A;  3R8B A;  5KIX A;  4UAI A;  5KYI A;  1L0X B;  5C0X J;  1BUV T;  1HTP A;  3AU7 A;  2Z8L A;  1CM9 A;  1F2M A;  4A3F B;  3DWP A;  3GTJ B;  5F2D A;  1EYA A;  5COR A;  1I6V C;  1V43 A;  4C3H B;  4Z9C B;  2K5D A;  2J4X A;  3FVQ A;  1MGS A;  3CU7 A;  4FO2 A;  5JOB A;  1EWC A;  3RZD B;  1HFG A;  3OWF A;  4WOR A;  5D14 A;  5M9O A;  4KMU C;  2TMP A;  3LWE A;  2F0N A;  2NN6 G;  2JEA I;  4I7Z C;  5DEH A;  4LK1 C;  3HEJ A;  4IUV A;  3VR3 A;  5D3I B;  2JSO A;  2KJX A;  3AB9 A;  5IGE A;  2EYF A;  3NSW A;  4V19 0;  1PFM A;  1IL8 A;  4RGM A;  2EYH A;  3NBI A;  3M4Y A;  1UUP A;  1YNJ D;  1S5D D;  2B8F A;  3MVV A;  5C0X H;  2XVS A;  5CYU A;  4QCL A;  3J81 E;  3ZYY X;  2K5W A;  2DY7 A;  2X6L A;  3DM1 A;  1JWU D;  3P7J A;  1TU2 B;  4F8M A;  2B2W A;  4H7B A;  3KLR A;  5NUC A;  2J7Z A;  2MJ8 A;  1D1K A;  4XT1 B;  1SE3 A;  4RCN A;  2ENB A;  1JOK A;  3TN2 A;  3FEW X;  3W3A A;  4H44 C;  4MIU A;  1DYQ A;  4KKU A;  4A3G B;  5ELC A;  4RHR A;  3K0Y A;  3E6Z X;  5EBD A;  4EGV A;  3GQB A;  3Q22 A;  2JXM B;  1LTT D;  1SNQ A;  2D9U A;  1EZ8 A;  1B9N A;  4KV6 A;  4PNY A;  3N52 A;  1YNN C;  3BDC A;  1SYF A;  3Q24 A;  1BDO A;  3K7A B;  3R2I A;  2A6H D;  4H0L C;  4ZYS A;  1EOT A;  4ZQ3 A;  4NP5 A;  1EY5 A;  2BOS A;  2EJF C;  1HCZ A;  1CTM A;  3S1R B;  4QF4 A;  5HUR A;  3K58 A;  1BCP F;  2PYK A;  4C3I G;  4KHZ A;  4BBR B;  3KBG A;  2PQE A;  5CV9 A;  2WV6 D;  2EY5 A;  1Y1V B;  3MXP A;  2F0U A;  2LMC B;  2NBF A;  3RLF A;  4N9P A;  5LHY 1;  4KHV A;  2B2Y C;  2F0H A;  5FO8 B;  1EY6 A;  5CBE E;  1EY7 A;  1SYC A;  4DFA A;  5G3L F;  1AW7 A;  1O7Z A;  4BY1 B;  2WP8 J;  1HTL D;  5E4W C;  3NUC A;  1DOM A;  1I4Q A;  1DOK A;  2RDG A;  5M3F B;  1RDP D;  3P1H A;  2VB2 X;  4BBS B;  4FF2 A;  4DK0 A;  4FF4 A;  5JPN C;  3OHX C;  1HA6 A;  1EU3 A;  2FJ2 A;  1G8Z D;  3OMC A;  3T51 B;  5IIF A;  3IKJ A;  4RHS A;  1AZQ A;  3SHL A;  1TWG B;  1UEA B;  1HQM C;  5JVH 3;  5C0X I;  3S16 B;  2F0W A;  5TSS A;  1JOR A;  2EYM A;  3CRL C;  3GTP B;  5J1Z A;  3KLS A;  4K8J A;  3J7Y W;  1EEF D;  3JAM L;  4XTC S;  4RFB A;  1JC7 A;  4ZKC B;  3HP3 A;  4QIW B;  2Y0S B;  1SFO B;  2G9H D;  5M5W B;  1TS2 A;  1A3V A;  1OXS C;  2VB3 X;  3K59 A;  1PDQ A;  1ESF A;  1EFI D;  4ULL A;  1PRT F;  1RF2 D;  4HMI A;  3OWE B;  1ZXT A;  3FMC A;  5IOD A;  2KOL A;  4DN4 M;  2A6E D;  5EQ0 A;  1WTP A;  3IL8 A;  5FO7 B;  1H9J A;  3DUZ A;  3D6W A;  1WTO A;  1LAB A;  1J8I A;  3S17 B;  3JAM E;  4IUP A;  5CV7 A;  1SSO A;  2SNM A;  1BXT A;  3I72 A;  2F0I A;  3I91 A;  1YNJ C;  3GTL B;  2DNC A;  4GZY C;  1H9R A;  4X3U A;  2C5C A;  1PMR A;  5KND A;  2A74 C;  4MN3 A;  5K5P A;  2RBM A;  2EVB A;  1A2T A;  1ROD A;  1SNM A;  1M8A A;  1OO9 B;  3SVM A;  4XQJ A;  5EJW A;  1QWY A;  3SR1 A;  3MHB A;  5EPL A;  1LTS D;  1U4M A;  4IN3 A;  1F2L A;  2NYZ D;  1TWH B;  1H9S B;  4KY5 A;  1W6J A;  4FNF A;  1TS5 A;  1SE4 A;  1A2U A;  5ELD A;  3L9A X;  4PMC A;  2B2V A;  3SK8 A;  2Q8T A;  1Y8N B;  1HQR D;  2IL8 A;  4HCS A;  1LO5 D;  1ZYR D;  3GP7 A;  5CMD A;  3Q6S A;  5EBC A;  4H13 C;  3VYT A;  4CGY B;  1RKN A;  3D31 A;  5I6W A;  2H4O A;  1JWS D;  5CV5 A;  1WVL A;  2MGS A;  3GTO B;  1QOH A;  2GA4 B;  3EA6 A;  3QO2 A;  1DOL A;  1QB5 D;  2KEE A;  2RSO A;  4P2C B;  2A6H C;  2F0E A;  5KNB A;  4NMZ A;  1EY8 A;  2E74 C;  4XYQ A;  2BA0 A;  5ELE A;  3RMH A;  2IX3 A;  2WII B;  2D62 A;  1X32 A;  1QG7 A;  1LLR D;  2LY7 A;  1G29 1;  4K6D A;  3OIQ A;  1TR5 A;  4J1M A;  4F87 A;  2G9D A;  4J6H A;  1CT1 D;  1CK1 A;  3EFX D;  1SYE A;  3C3L A;  4A3B B;  3VYR A;  2F0O A;  1KAB A;  4FXG C;  3RUZ A;  3FRP B;  3NBH A;  1I50 B;  2B2U A;  5CGK A;  4U68 A;  1DD2 A;  4RKB A;  2HDM A;  3QJY A;  2ZXP A;  1STG A;  5IGD A;  2M00 A;  2EJM A;  4OGQ C;  1O7L A;  3S9W A;  1PTO C;  3GTM B;  1Q12 A;  3VA7 A;  4ZAI A;  2MP1 A;  4I65 A;  1SJH D;  3PUY A;  1SXT A;  2JE6 I;  4FF1 A;  5JVG 3;  4LAA A;  1H9M A;  5KRU A;  2L1B A;  1WTV A;  1VMP A;  3DHQ A;  1QNU A;  4KJO A;  5A35 A;  2RSN A;  2FHT A;  1IYU A;  1PZJ D;  5JJZ A;  2F0F A;  4NKL A;  1LTI D;  4EQP A;  2QIL A;  4NW2 A;  1T5E A;  5FLX L;  1AFP A;  3TP6 A;  3NE5 B;  4KI0 A;  1CA6 A;  3CRK C;  1JWM D;  4TSS A;  3CHB D;  4FP5 D;  5C4H A;  4RKL A;  1OXU A;  2WKD A;  5C3W A;  4CKC A;  1TT2 A;  5C4J B;  2K7V A;  3MTS A;  2PW7 A;  3AMU A;  1F2Z A;  3TBI B;  4ZKB B;  3S2H B;  2E2I B;  2F03 A;  1DON A;  4BA1 I;  2PCF B;  2X6G A;  1LTB D;  1FR3 A;  2EOT A;  2O2L D;  4DK1 A;  4FF3 A;  5FLX E;  4Q0F A;  3V05 A;  4G7O C;  1XWE A;  3WOE A;  4XQQ A;  1I4H A;  4K5V A;  2XIW A;  2WAC A;  1GUT A;  3HOU B;  4A3E B;  1LV9 A;  2AQ1 B;  2EYP A;  2ID0 A;  3R93 A;  4BA2 I;  1FNV A;  3LWU A;  4PV1 C;  2K6A A;  4ZUJ A;  1IW7 D;  2L11 A;  4RGT A;  3S2D B;  5KNC A;  1SAP A;  1VCI A;  1A3U A;  2F0V A;  3J7A F;  3DWQ A;  1TVX A;  4M1U B;  2K33 A;  2IW3 A;  2B2Y A;  4FXD A;  2BE5 D;  1B53 A;  1BCP D;  3E0J A;  4G7H C;  2EY6 A;  3KLS X;  2EY1 A;  1R4P B;  1D5M C;  2F0Q A;  3S15 B;  2JEB I;  4HR7 B;  3HKZ B;  1KAA A;  4KTA A;  4DNT B;  1VF7 A;  4HSP A;  3U9S A;  2JA6 B;  2EE1 A;  2N55 A;  5KGU A;  1Z47 A;  5G3L D;  3QB3 A;  4WJW A;  3M7G A;  4B9W A;  3H0G B;  1SYG A;  2QDB A;  1ESR A;  1X3P A;  4X3K A;  2MHV A;  1F77 A;  1WD0 A;  2A68 D;  5BN3 A;  2B2T A;  4K5X A;  1SJE D;  1EU4 A;  4A3K B;  2QEJ C;  3GD7 A;  2HCC A;  1G91 A;  2NTS A;  1V1P B;  1F9R A;  2AWN A;  3NQI A;  3I3C A;  1ET6 A;  3IAY A;  2Z1C A;  3OMG A;  2XRQ D;  1EZ6 A;  4L63 B;  3DEP A;  1SMY D;  1I4P A;  2IT1 A;  4XDX A;  4S3S A;  1U4L A;  1PZI D;  4G4K A;  3S14 B;  1K8O A;  5EKL A;  1B4O A;  3LNN A;  4HAE A;  3EVQ A;  1D2B A;  1AN8 A;  2HCI A;  3DEO A;  2SOB A;  2PZT A;  1A6X A;  5CC4 A;  1U4R A;  3A8K E;  1B1Z A;  2QKI C;  1KLG D;  5M3M B;  1TY2 A;  1NAP A;  3HG9 A;  1JOO A;  1PRT D;  3ERO A;  3MZ5 A;  1ML0 D;  1EY0 A;  3ERQ A;  1WD1 A;  1BOS A;  4HSV A;  5K36 H;  1HXY D;  5KYL A;  1PTO H;  2FFK B;  2PO4 A;  2WB1 B;  1KNA A;  2ICI A;  2PMZ B;  5JEA J;  5HGT A;  1B44 D;  2R7Z B;  1A3T A;  2JA7 B;  5KEE A;  3D4R A;  4ILW A;  3K5O A;  1SND A;  3KF8 A;  2NVY B;  1HHV A;  2L12 A;  4HCE A;  1B9M A;  5C0X G;  4IFD H;  4CJ2 C;  3E5S A;  4KK7 A;  3QOJ A;  3O13 A;  1TWC B;  1RTN A;  4LMQ D;  1WTR A;  2KA7 A;  2A5H A;  2AQ2 B;  4TQU S;  4XT3 B;  2HUG A;  1CQF A;  2F0D A;  1OXT A;  1LT4 D;  1PFB A;  2DNE A;  2WAQ B;  2F3W A;  4HN7 A;  1G2S A;  4FYD A;  3GTQ B;  1PXU A;  3IFT A;  3MXN A;  3NTI A;  5A2Q L;  4CKB A;  4TRD A;  3MFY A;  3C1E A;  1GUN A;  4UDU C;  3FKI B;  3HOW B;  3A55 A;  3X3N A;  2B8G A;  1KDC A;  3DMU A;  1EIH A;  2B2W C;  1WTW A;  3BVG A;  5JEA H;  2IPK D;  1Q1E A;  2O5I C;  1ZEQ X;  5IGG A;  2DN8 A;  1AZP A;  1SNP A;  4K8I A;  3G6J B;  2I07 B;  4DAV A;  4RGO S;  4ME5 A;  3C1F A;  2L4N A;  3TZD A;  3PUW A;  1IW7 C;  4DNR B;  3D4D A;  1WTQ A;  2NVT B;  5T1I A;  1TWF B;  5DM7 3;  3NP8 A;  3C2P A;  1TS4 A;  3F2U A;  5JPM C;  4KN7 C;  2F0L A;  4DF7 A;  1STE A;  2BE5 C;  1BCP C;  2E75 C;  5FK9 C;  1CZW A;  3NK9 A;  4A3D B;  1E2V A;  3M4O B;  2VUM B;  1BCP B;  4OO1 H;  2HQE A;  5COY A;  4E6I A;  2N88 A;  3ITP A;  4FVM A;  4QMG A;  2L5T A;  4C3J B;  2MUY A;  1LT5 D;  5DNF A;  1LT3 D;  4QUC A;  3V96 A;  1XTC D;  3VR6 A;  3GO5 A;  2K32 A;  3NQT A;  4C3I B;  3OPO A;  5J39 A;  2F4I A;  1D5Z C;  3A8J E;  1NSN S;  4DU9 A;  1AEX A;  2A73 B;  3S1M B;  1I4X A;  1L0Y B;  5LL6 S;  1KTK A;  2FMC A;  4IAL A;  1E2Z A;  1PTO F;  1EIG A;  3HOV B;  1RHP A;  1CHP D;  3VR5 A;  4EQO A;  1SNC A;  4PQX A;  3PMF A;  2K1B A;  2RDF A;  1S5C D;  1Z6H A;  3PO2 B;  3VA5 A;  3BYT B;  1SMY C;  4XQN A;  3PIP 3;  3TP7 A;  4KN4 C;  3N6R A;  3NTH A;  2RKS A;  4L8J A;  3MXG A;  1EYD A;  1E0B A;  1MBY A;  4ABN A;  2F1M A;  1S5E D;  5DAU A;  4M8A A;  5ELB A;  1GHK A;  3M3Y B;  4KD3 A;  2QCP X;  4A3M B;  2BDO A;  1CI3 M;  4IFD I;  1QCB D;  1GXD C;  1TKW B;  3SK6 A;  1PZK D;  3ND8 A;  4G7Z C;  4JK1 C;  3SDZ A;  3EJI A;  2BA1 A;  1HA5 A;  3T13 A;  3VR4 A;  1JR0 D;  1BO0 A;  1QNK A;  5FOB B;  4C3H G;  2CVR A;  2AUK A;  1PRT C;  2PZW A;  2TSS A;  5C44 B;  1J9O A;  5AFW A;  1PRT B;  2E76 C;  1R4Q B;  4FXK C;  1FYC A;  3BDO A;  5C6A A;  4OIK A;  1BNZ A;  5E1F A;  5DM6 3;  4AYB B;  4ODG A;  1FNW A;  4MHE A;  1ENF A;  3K6O A;  4K2L A;  1SE2 A;  1F9Q A;  4EVO A;  3D8G A;  1II3 A;  4O1N A;  5C5L A;  1JQY D;  3L7Z C;  4B9X A;  4OL7 A;  4IUQ A;  1Q3L A;  1ET9 A;  3H09 A;  4PMW A;  2Z4H A;  3SE0 A;  4KY6 A;  3SEB A;  3T56 B;  1BF4 A;  2AWO A;  3MXU A;  4OO1 I;  1QE6 A;  1B3A A;  1LTA D;  3PUV A;  3GTK B;  1TS3 A;  1ZKO A;  2OF1 A;  4IUR A;  1TII D;  3MFG A;  2JA8 B;  3OW7 A;  4RH6 A;  1TWA B;  2O5J C;  2DY8 A;  3I90 A;  4G57 A;  3QG1 A;  1Q8I A;  3HOY B;  2EDG A;  3GTG B;  5T1G A;  2KED A;  2AQ3 B;  3BVZ A;  4A3J B;  3NXW A;  1HRJ A;  2NVX B;  3SK4 A;  2NWG A;  1JB3 A;  2R93 B;  1GUS A;  2JA5 B;  1HUM A;  1STA A;  4ZUI A;  2JP1 A;  4QB4 A;  1SNO A;  2OT2 A;  1PFN A;  4RAU C;  1C8C A;  1ONL A;  1IKL A;  3HRZ C;  2CW0 D;  5M5Y B;  3WOF A;  2HDL A;  2A6E C;  4KY7 A;  1C48 A;  1SYD A;  3M7N A;  5I9O A;  2SDF A;  1MSH A;  3H3V C;  5C5M A;  2ZT9 C;  4DXF A;  5IGF A;  2KQ3 A;  3A7A B;  3BG3 A;  1M4V A;  3G7L A;  2C9O A;  4RCO A;  3NWS A;  3A56 A;  1QIL A;  1O78 A;  3P20 A;  1UNS A;  2K28 A;  1GUO A;  2EY2 A;  2IJ0 A;  2K04 A;  3R2T A;  4L6T B;  2YU9 B;  1EQV A;  3A54 A;  3K5M A;  2XN9 C;  3I70 A;  2RQX A;  4Y7N B;  1DCZ A;  1MSG A;  2Q8R E;  3PIO 3;  3VYS A;  4O42 A;  3J81 L;  3TP8 A;  5FO9 B;  1BR9 A;  4Q5V A;  2I46 A;  1ILP A;  3CKI B;  2B2U C;  4J8Q A;  2QF7 A;  5CV4 A;  1JOQ A;  3FPU B;  2A69 D;  1STH A;  2KVM A;  1ZYR C;  5I6Y A;  4C1N I;  5E4X A;  5EKI A;  1KNE A;  2R92 B;  1EWH A;  2PNR C;  3FDT A;  2EYJ A;  2F0G A;  4XXE A;  2EJG C;  3DXJ C;  2XWJ B;  3MWY W;  1TY0 A;  1NR2 A;  3J80 L;  4R9W A;  1NCV A;  2NN6 I;  1X3Q A;  1S4Z A;  1ICW A;  5EGT A;  1VDZ A;  1Y8P B;  1B50 A;  1GUW A;  2M9V A;  3D6C A;  3I4L A;  1EYC A;  3K57 A;  5EKK A;  4DXG A;  3S1Q B;  3I4M B;  4QUF A;  4KJN A;  1IKM A;  2RDH A;  1G6Z A;  5I9P A;  3OOC A;  3H94 A;  1CFM A;  2K05 A;  1ENC A;  1NUC A;  3I73 A;  2NB0 A;  5J22 A;  5IT9 L;  5I2Y A;  1S5B D;  4N9T A;  5I4D A;  2WIN B;  2IWH A;  1HUN A;  3J80 E;  4IFD J;  5CBA E;  1CA5 A;  1U4P A;  3LX0 A;  2E2D C;  1SBB B;  4XYO A;  3C46 A;  2D2C C;  1K83 B;  2F0T A;  4WFN 3;  1O80 A;  5I2X A;  3KBX A;  1CQV A;  2SEB D;  3A7L A;  3PUX A;  4C3J G;  3I8Z A;  3Q23 A;  3W2D A;  3PUZ A;  3MAQ A;  5IT9 E;  2PZU A;  5FKA C;  2FIN B;  1Q90 A;  3R3O A;  4RWS C;  2EYO A;  4U67 3;  4KKT A;  3VR2 A;  4LJZ C;  1MI2 A;  4C2M B;  3TZU A;  2LKV A;  2Q8I B;  1R9T B;  2F3V A;  1WCM B;  1EEI D;  1H9S A;  2EPB A;  3P75 A;  2LFN A;  4JBW A;  4K5W A;  4ID6 A;  1F9S A;  2L0C A;  3S1N B;  5C4X B;  4OIJ A;  1AP0 A;  2X69 A;  4IUT A;  1MD2 D;  5IOC A;  4XIG S;  1FD7 D;  1LTR D;  1I6H B;  1T5X D;  3GV3 A;  2R3Z A;  1O7Y A;  3WDN A;  3ND9 A;  1EY4 A;  1PTO D;  1NR4 A;  2IX0 A;  1F2Y A;  1W6K A;  3CQZ B;  2CW0 C;  4NDX A;  1SDF A;  1KDA A;  2NUC A;  2IX1 A;  3GV6 A;  4CJ1 B;  3X3M A;  1JIC A;  1XX8 A;  2NTT A;  2SNS A;  4BY7 B;  3L3O C;  1Z7T A;  3SK5 A;  2B2T C;  4X3T A;  3RZO B;  3QOL A;  4WRD A;  1EL0 A;  2O4X A;  3BYY B;  1V8Q A;  2J0T D;  4V0B A;  4C56 C;  1ENA A;  1JCK B;  1S5F D;  2JYO A;  2NVQ B;  5A2Q E;  4DA2 A;  1Y69 U;  4OHJ A;  3K5L A;  1IHZ A;  1VF5 C;  1H9K A;  3ONA B;  4A3I B;  1OXX K;  2E2J B;  4ZLT F;  2OXP A;  3HOZ B;  2R61 A;  4BS9 A;  1KLU D;  4TKO B;  1I4G A;  4BWG B;  3SXH A;  2F0P A;  2F0K A;  3IFD A;  3FPP A;  2MPM A;  5CR3 A;  4RGN A;  1PYW D;  2K03 A;  1VMC A;  5K36 G;  1STN A;  2VNU D;  2A69 C;  3HZX A;  3MC0 B;  2KCC A;  3URY A;  4B08 A;  1D1I A;  3BS1 A;  2M2L A;  4CJ0 B;  5IGB A;  2A68 C;  3QIA A;  4IFD G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...