1KDCA

Stabilization of a strained protein loop conformation through protein engineering
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYNPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Stabilization of a strained protein loop conformation through protein engineering.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase (phosphoric diester)
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1kdcA00
3OMCA 1F2ZA 1TT2A 1EY9A 1F2MA 1KAAA 5CV5A 4IALA 2F0SA 3P75A 4DF7A 4K2KA 5C5MA 5E1FA 2F0OA 5F2DA 5C3WA 2F0MA 5IOCA 4K8IA 1SYGA 2F0UA 1STHA 2OEOA 3ERQA 3NHHA 5E3FA 3SK5A 3D4WA 5CV4A 4G57A 1EY0A 4ODGA 2EYHA 1AEXA 3MVVA 3TP8A 4YIJA 4B9XA 5KRUA 4F8MA 4RKLA 3EVQA 5CV9A 4HTHA 3E5SA 3OSOA 4K8JA 2RDFA 5I6WA 3T16A 2RBMA 2PW7A 3TP6A 2EY2A 4QMGA 5C3XA 1EY8A 3NK9A 5CGKA 5IGDA 2EYOA 3D4DA 4WORA 1EZ6A 5CC4A 5KIXA 1TQOA 3EROA 3MZ5A 4K5WA 3BDCA 2HQEA 2PQEA 5I6YA 4QB4A 4H7BA 5KYLA 1A3UA 2EYJA 2EXZA 2F0EA 4KJOA 2O4XA 5CV8A 4KD3A 5JOBA 5ISRA 2F0DA 1NSNS 1SNMA 3QB3A 5CV6A 1II3A 2EY1A 3SK4A 4EVOA 3S9WA 3SXHA 2F0HA 1SNQA 5K5PA 2PYKA 2PZUA 1RKNA 2RKSA 2EYPA 4KV6A 4N9TA 4OL7A 5C6AA 5IODA 3BDLA 3OMGA 3VA5A 5KGUA 2EYLA 3P1HA 1KDBA 4F7XA 2PW5A 1SYFA 2PZTA 4I65A 3DHQA 4KY7A 1EY7A 4N9PA 4J1MA 2ENBA 5EGTA 4DGZA 4DU9A 2F3WA 1EZ8A 5EKLA 3SR1A 1EQVA 1SNPA 4HMIA 4NP5A 4ID6A 3NXWA 2PZWA 1SYDA 2F0QA 4ZUIA 3MEHA 3SHLA 3T13A 4EQNA 4K5XA 2EY5A 3DMUA 2F0VA 2F3VA 2NUCA 3C1EA 3H6MA 3TMEA 3V2TA 5J22A 1A2UA 4PMBA 3TP7A 5IGBA 1EY5A 1STBA 2F0FA 2F0KA 2KQ3A 2KHSA 5IGCA 5JAVA 3D6CA 3NQTA 1EY4A 3PMFA 1KDCA 1STYA 4MIUA 5HGTA 1KABA 2EYMA 4NMZA 2EY6A 5J1ZA 3SK6A 5I9PA 1SNOA 4S3SA 4DFAA 1A3TA 5IGGA 4IUNA 1F2YA 3NUCA 4R8NA 4ZQ3A 5J39A 1ENAA 3QOJA 4HMJA 1SNCA 5NUCA 1EY6A 4PNYA 5IGFA 5DAUA 4K14A 3R3OA 3U9OA 3HZXA 4QF4A 5C4HA 1JOKA 3SK8A 3MXPA 2LKVA 2OXPA 4KTAA 1EYAA 2M00A 2F0IA 1A3VA 2F0GA 3HEJA 1JOOA 1STNA 3OWFA 4NDXA 1EYDA 4KY5A 1STAA 4EQPA 1SYEA 4LAAA 5KYIA 1IHZA 3ITPA 4B9WA 2SNMA 2EYFA 2F0WA 1KDAA 2SNSA 4K6DA 4KD4A 4WRDA 4ZUJA 2F0LA 1JORA 2WACA 3TP5A 4PMCA 3LX0A 5M9OA 1ENCA 5CR3A 1U9RA 2F0PA 1STGA 3D8GA 4J6HA 5EKKA 1EYCA 1TR5A 3EJIA 1A2TA 4KJNA 4K5VA 1JOQA 5I9OA 4NKLA 4EQOA 3NP8A 4E6IA 4ME5A 3RUZA 5HURA 2SOBA 1SYCA 2F0NA 4RKBA 5DEHA 3MHBA 5C4ZA 5KEEA 5IGEA 4KY6A 1SNDA 5IIFA 5C5LA 2QDBA 3QOLA 2F0TA 1NUCA 3C1FA 4KHVA 5CV7A 4IZ8A 2F0JA 4TRDA 2OF1A 1SYBA 4K2LA
chains in the Genus database with same CATH superfamily
1BBUA 3OMCA 5BN3A 1CI3M 1AN8A 1EQRA 1BCPD 4PQXA 3NEMA 4WFN3 4GKJQ 2VUMG 4X6AH 1CFMA 3I90A 5M3FB 4LF7L 5JEAH 4MTKA 3D4WA 2N88A 1UE1A 5C4JH 3V05A 3KF6A 2X69A 3LWEA 1VQ9A 1EY8A 4C1NK 3GTOH 3NTIA 2GVBA 3KLSX 1CKNA 3I4OA 4A3EB 1GD7A 2A19A 5CV8A 3I4MB 3I70A 5ISRA 3Q22A 1PH7A 4A93B 1HA5A 2D9UA 3NBIA 2XTIA 2PYKA 4OL7A 3PO3B 2XIWA 4ME3A 3RD4A 2NN6I 3IAYA 1SYFA 2G5DA 4BBSG 2MP1A 1YNXA 2N55A 1NNXA 3DWAA 1QUQA 4JK1C 3S17B 1WTOA 1S72A 1QCBD 1WCMH 4IFDG 1T9HA 3C1EA 3V2TA 2CHBD 1PZID 1A2UA 2UUAQ 1CT1D 1LTRD 4LFAL 1IKLA 2Y0SE 1KDCA 2KJXA 3RLNA 3CHBD 2IHFA 3OWEB 4X3UA 1WD1A 2DJGC 3OTOQ 2P5ZX 4YY3L 3J81c 2EJFC 3HOZB 1EIGA 1I4QA 4ZKCB 4KTAA 2EOTA 1IW7C 1IBMQ 4NDXA 1FJGQ 3S2HH 4ILWA 3KF6B 1ILQA 1A62A 1LTGD 3K57A 4C3HB 2E2HB 3F2BA 2EPBA 4GN3B 3AMUA 4LF5Q 4ZUJA 1G8ZD 1CKNB 1XPUA 3BDOA 1X3QA 1HTPA 1Y1VH 1U9RA 3GTLB 2KEEA 5EAYA 1I4HA 3QWNA 1W2BA 1O78A 1V1QA 2QKIC 3MHBA 2C5CA 1CQVA 3A8IE 1HTLD 1SFOB 2ICIA 2I46A 3S15H 1ZXTA 1F2MA 1KAAA 4XDXA 1JQYD 1HFNA 3J80c 4GKKL 3T4AC 4B3RQ 1W6KA 4UY8C 3HOYG 4AYBG 4GOPA 2ZJPA 2F4VQ 2F0MA 5IOCA 2AKWB 1MSGA 3OIPA 3I4NG 4EX5A 1IXRA 5CV4A 3JAME 4BXXH 5FLXE 4EQ5A 3OSOA 4A3GB 1B3QA 3HOXG 4ZRZA 3TDQA 1D2BA 3E9IA 2NZHA 3S1RH 1Q81C 4KJOA 5M5WH 2QCPX 4KHZA 4BBRH 1LTSD 2K6AA 2RKSA 5G3LF 5IODA 3FPUB 5DM63 3NWTA 2I0QA 3X3NA 2YTVA 5D65A 3CXCA 4I65A 4R4CA 3C46A 4DR1L 1RL2A 2ENBA 4LF7Q 3K8AA 5HGQA 1GUTA 3KK7A 4ZUIA 4JW0A 5KNDA 5ELCA 3H6MA 1KC8C 2RHQB 2F0KA 5FK9C 4NXNL 5JEAJ 4HN7A 3IFDA 2XN9C 2QA4A 2RVLA 3K59A 1SNOA 3L3OC 1E2WA 4A75A 2GVAA 4DV0Q 2R7ZG 4DR4L 4R1JA 1HPCA 4WJ4A 5C3EG 4GS3A 4L5QA 4PNYA 2VQFL 3TZUA 4CKEA 4RG1A 3H3VH 1RTNA 1GUNA 1Y8PB 4A3FG 4HJ5A 3PF5A 3NE5B 1B44D 3BYYB 1Q1EA 1VQ8A 3P7JA 3D3RA 4ALPA 3HOWB 5IP7H 4LF6L 1ENCA 1STGA 3SGIA 1PLFA 2ALYB 3E0JA 4LFAQ 1R9TB 3SVMA 3M4YA 4KJNA 1KD1C 4K5VA 4XQQA 4JYAL 3EBEA 1AFPA 4IPDA 2EDGA 2EVBA 2SOBA 4RKBA 4IOCA 4YY3Q 5IIFA 5C5LA 3GTQB 4FYDA 1EIHA 2Q2IA 2VUMB 2JA8H 5CV5A 4O0AA 4DR2L 2Q2TA 3L2PA 2LSSA 4DR3L 2AWOA 4A3JG 4DK6C 5M3MH 2K5HA 2KEDA 1SYGA 2K5DA 1X9NA 1QVCA 5IYBG 3VR3A 4YIJA 4J15A 1EL0A 3M3YB 3E5SA 1LO5D 3T16A 1WJJA 1T5XD 5C3XA 3MXUA 1JWMD 1R4PB 3H94A 3FMCA 4CJ1B 1KRTA 4MTNA 5M5XB 1SXTA 2ZTCA 2A69C 1Y1WH 1EFWA 3CCLA 2OTJA 3BVGA 2EYJA 2F0EA 3LGJA 2V4DA 1NSNS 3L7ZC 1F9RA 5CV6A 5C44G 2ASBA 4ULLA 4BBSB 5FLMG 1ILPA 3BDLA 4GKKQ 5KGUA 2EYLA 2BA1A 2VZAA 3J7ZC 1EYGA 4DPGA 4KI0A 5CMDA 2A5HA 1SNPA 4PZ6A 1NR2A 3CQZB 4JV5L 1HZBA 3KBXA 1HQMC 2F3VA 5J22A 4HR7B 3TMEA 2B29A 3A8KE 4DV6L 1OXVA 1IYJB 2R61A 1A15A 5BN4A 3NQTA 3HKSA 3HOUH 1A8VA 1G51A 3SK6A 4PG3A 5M5YB 1A3TA 2CH4W 4IOAA 3RZDH 1ET6A 1Q82C 5CORA 1B2TA 2IPKD 2OXPA 3AFQA 3FKIG 1MIUA 4DFAA 2F3IA 3T51B 4DR1Q 4CHTB 4LAAA 1XJVA 1PTOB 1D5MC 2TSSA 3JAMc 3PF4A 1X3EA 4XYOA 3W2DA 2ID0A 1CKOA 1GUGA 4DXFA 5FLXc 1KQSA 3WOFA 2WACA 4XQNA 4JI7Q 1BO0A 1GHKA 1D8LA 3CCMA 4ZKBB 3M9BA 4C3JB 2LY7A 1I5FA 4JI0L 1GKHA 3E9HA 2B2UC 4NPSA 2WAQG 2DGYA 1SSOA 4H0LC 1FGBD 3PUVA 4A3BH 3K7AH 4KY6A 4FXGC 2VQFQ 2F0TA 1AP0A 5T1IA 1BQQT 2CQOA 2B63G 1D1IA 2KCMA 5ELOA 1PH1A 5EPKA 4AYBB 3HOYB 4BY1G 2R92H 4RH6A 1PYSB 5FKAC 3I4NB 2R7DA 5JVG3 4HCEA 1I6HH 2N8NA 5E3FA 1E2VA 2OEOA 4LF6Q 1QWYA 4CDFC 4Y7NH 4JI8L 4I7ZC 3HOXB 3U4VA 2ATWA 1Q3LA 2MGSA 3K5LA 2Q8RE 1V8QA 1N34Q 2EY2A 5JPMC 2A68C 2L4NA 5CC4A 2QILA 2ZXRA 4ZCKA 4K5WA 1WOCA 5I6YA 2KVMA 2UXDL 1KL9A 2EXZA 3BJUA 1HNZL 2F0DA 2LFNA 4LF4L 4L8JA 2EY1A 1WTHA 5IE8A 1AZPA 3K81C 4DR2Q 4F7XA 1KDBA 2D2CC 4O2DA 1EY7A 3SEBA 1QE6A 1EQVA 1O7ZA 5DNFA 1SYDA 3TN2A 2O5IC 4BY7H 2GA4B 2OTLA 2H1EA 1CA6A 1IW7D 1EEFD 4DAVA 2R7ZB 3I3CA 3DWPA 1DZ1A 5C3EB 1H9SA 4A3KH 4DAYB 5J1ZA 1YI2A 1FD7D 5I9PA 1I94L 1FGUA 4A3DG 4IUNA 4XXEA 3U58A 1RD9D 1XNRL 1RHPA 1W6JA 1ICFB 2F52A 3NTKA 1L0WA 2ZXPA 2CQAA 4A3FB 1O80A 1OXUA 2ZTDA 1EUJA 3SK8A 3HG9A 1YITA 4ZYSA 1JOOA 1PH6A 1IBLL 3BZDB 1EIYB 4IUVA 2R93H 2CCZA 1X6OA 2ZJRA 2CVRA 3BU2A 1VQOA 4JV5Q 3PO2B 4K6DA 4DR7Q 2WV6D 4C2MB 4DV6Q 1WTXA 4Y52H 1X3PA 2I5MX 1DXMA 2KBNA 3CMAA 5K36H 1S5CD 2K7VA 4HEDA 5LMNL 1SEBD 3BZKA 3RUZA 3J81i 2E2IH 1O7IA 2E74C 1CHQD 2JA6H 1VQCA 4KHVA 2CFMA 2RCFA 3GTJH 4A3JB 1MSHA 5JEAG 3FEWX 5EJWA 5GQOA 1Q46A 4X3TA 4ABNA 4CKCA 3PUYA 3KF8A 1H9SB 2D0OA 2VNUD 4OWXB 3SK5A 3A5ZB 4FDBA 2D5DA 1HRJA 1QB5D 4JI0Q 3CRLC 4FXKC 1YEZA 1ENFA 3QO2A 4WORA 5EKIA 2B2UA 4C3IB 4GNXC 2HQEA 5C44B 3CAMA 1MKHA 4KD3A 3J80i 4BA1I 4FXDA 1ML0D 3EA6A 1BXTA 3DUZA 3WOEA 1L0XB 2F0HA 2BDNA 5K5PA 2VW9A 5E7NA 2QF7A 2HQLA 3CCEA 1WCMG 3H15A 3CCQA 1B50A 1D7QA 1VQDA 3G7LA 4JI8Q 5C4XH 1KLUD 3K5OA 4J8QA 2NUCA 1LT5D 3TP7A 5IGCA 3KJOA 2KHSA 3L9AX 1SJHD 3A56A 1LUZA 1NJIC 1SMXA 1VMPA 2BH2A 2EY6A 2PNRC 3C3LA 5TSSA 4A3IH 3KF8B 4TSSA 4LF4Q 1EY6A 3N52A 3FKIB 3CF5A 3Q6SA 3HZXA 1D1KA 1JOKA 3J81j 4PZ7A 5FO8B 3VYTA 1VF5C 1Y1VG 1IKMA 2UUBL 1GM5A 2ZXOA 5D14A 1SRUA 1XNQL 3DWQA 1L1OB 4PMCA 2M2LA 2NVQH 2MUYA 4KN7C 2WAQB 2MFIA 3G71A 1AE3A 3H0GH 5ELFA 1I94Q 3WWVA 4FO2A 4EQOA 2Z9HA 5LMNW 1LABA 2YU9B 2JN4A 4JBJA 3PUWA 1XNRQ 2B63B 1PYBA 3A55A 2JA9A 1GUWA 1K0SA 3TSSA 5IYDH 1UUPA 1HZAA 1TWFB 2XWJB 5C0XI 4IALA 2IL8A 4JG2A 4BXXG 2A69D 1ASZA 1G2SA 4K8IA 3CC7A 4FF1A 4JBKA 1EY0A 1AEXA 1TVXA 1DM0B 2HUGA 3FVQA 3I4MH 4JI4L 3I2ZA 4K8JA 5H1SE 3FP9A 2CW0C 3LWUA 1GJXA 3J7AF 4PV1C 1RF2D 3NK9A 2JA5G 3PO3H 1YHQA 1TIID 1UEBA 4BBRG 3HKZG 4H7BA 2IT1A 4QB4A 5KYLA 3F2CA 2UXBQ 2O5JC 4LF8Q 2NN6G 1QJOA 4L6TB 1MI2A 3GD7A 4JPBW 1SROA 2BOSA 2UU9L 4RGNA 2B2VC 3PGZA 1V1OA 2B39A 2FJ2A 5I2XA 3I73A 4X66L 3CMEA 1UEAB 3MFGA 4A3LG 2E75C 1SE3A 2ZM6L 4RFBA 4DK0A 4QQBX 5IGBA 1A63A 4A3DB 1NMGA 1TY0A 3AFPA 3S1QH 1Z7TA 4R4IA 5AJ3L 1YJ9A 1K8AC 3E3XA 4GNXA 1H9KA 4X62L 1SNCA 3R2TA 3J7A5 2A73B 3ND8A 1TWHB 2PI2A 3GTPB 1XWEA 5IP7G 3OIQA 1X32A 2PPBC 4CDDC 5LL6X 4HIMA 1VMCA 2A8VA 3BS1A 4IPGA 3S1MB 1FL0A 1VQLA 1IBKL 4C1NI 5GAEC 2HT1A 2LXJA 5KNBA 1Y8NB 1KXLA 3EIVA 1X3FA 3EFXD 4JBMA 1UE5A 1ONLA 4GLVB 2OQ0A 3NBHB 3A7AB 2N49A 4G7HC 3ZYYX 5IP9H 2WINB 2YV5A 2JA8G 3H3VI 1HJPA 1SYBA 2L15A 3JAMi 1KLGD 2NWGA 1M4VA 2A68D 2FINB 4DNRB 5C0XH 5L37A 5C4JB 2ES2A 3A5UA 1BUVT 4GLXA 2UUBQ 2K05A 1PTOC 1XNQQ 3GTOB 3R2IA 2PNHA 1ZEQX 2RDHA 4UDUC 4GNXB 1BOSA 2DY8A 4JCVE 2EZVA 2OT2A 1XMOL 1VQPA 4RCOA 1Y1WG 1CK1A 5BR8Q 2EYOA 1EZ6A 1PHJA 4IN3A 5JOBA 1TWGB 4V190 3QB3A 2I5LX 1JE4A 4BA2I 1Q8KA 3KLWA 4EVOA 5ELDA 3A0JA 5EPLA 1WCMB 3ULPA 1NMFA 1RTOA 1J8IA 4YCVA 1E3PA 1AE2A 2SEBD 3P1HA 4DV1L 5T1GA 3RLOA 4P73A 2R7FA 4UHVA 1YVCA 4JI1L 4XTCS 3BZCA 2AUJD 2KUMA 1HFGA 4GN4B 3HOUG 3M4QA 1JCKB 4APVA 1EY5A 1E0BA 2KQ3A 4HJ9A 2Z6KC 3DM1A 4BWGB 4NMZA 4A4IA 4L5SA 3S2HB 5IGGA 1JR0D 1TKWB 3K0XA 5GAGC 4FNFA 5NUCA 1WTWA 3HOVH 1B53A 1HR0W 5GROA 1JWSD 1Y14B 1Y1VB 4U673 1MD2D 1F9PA 3CCSA 1R9TH 4EGVA 4FF4A 2B2VA 1AH9A 4L63B 2YTYA 4KKSA 4X66Q 3AYHB 2SNSA 2WIIB 1VQ4A 1OTCA 1JJGA 2ZM6Q 1J5EL 1K8GA 1B70B 1X54A 1RODA 4A3BG 1TR5A 5GADC 3S15B 2HCIA 2XGTA 3QIAA 2VY3A 1QVFA 5I9OA 4M1UB 2NVTH 4K6LA 1CHPD 2XRSD 1PFMA 1PRTF 1U4LA 1V43A 3G48A 1IYUA 1SNDA 2OCEA 1EQTA 1PTOF 3C1FA 2R92G 3D4RA 1P16A 4TQUS 2EIFA 4A76A 2DNEA 3A54A 3M3YH 4GZYC 2XVSA 1PVOA 2F0SA 4BS9A 1S5DD 1XMQL 4Q0FA 1WYDA 1IBKQ 2WB1G 3BVMA 4LUOA 1SJED 4ODGA 1PH4A 3ULLA 5A35A 2B2YA 4HTHA 2JA5B 3CP0A 2PMZB 3CPWA 2EQSA 2GN5A 4BBRB 3TP6A 3HKZB 4LFBL 4H13C 3GTGB 1YHAA 3G4SA 3VYSA 1I50B 2NYZD 3Q23A 3Q0AA 1IL8A 2PQEA 1R4QB 4AH6A 2MNAA 1HUNA 1VDZA 3FRPB 4YHHL 2EXDA 4DR5L 1UE6A 1M8AA 2B8GA 2DN8A 3M4OH 1EWIA 5C6AA 3UE0A 1Y8OB 2AUKA 2JK8A 3RLFA 1I4GA 4BY7G 1BBXC 4DGZA 1ET9A 3R93A 3HRZC 1LTAD 2NVXH 5C0XJ 4QJFA 2PZWA 2F0QA 1A6XA 3UE1A 4A3KG 4RGTA 3TRZA 1XMOQ 3I7FA 3IL8A 3T1YL 1STBA 5JAVA 4AQYL 2A6EC 4A3MH 4DV7L 1EY4A 3PMFA 4MIUA 1D6EC 1DOKA 4JI5L 3URYA 2BCOA 2FFKB 1BBWA 1VQEA 4MHEA 4HMJA 3U50C 5EBCA 2R93G 2A1AA 4C3JH 1FNVA 5ELBA 5KIXA 2HCCA 4G7OC 1A3VA 4DV1Q 1GUOA 5KYIA 4JVZA 3CC4A 2PI2E 4LK1C 1LTLA 5K36G 2F0LA 1JORA 1PDQA 5M9OA 5CR3A 2Y0SG 4IQZA 3EJIA 3CKIB 2K5QA 2MHVA 2JA6G 3DXJC 2JA8B 3KJPA 1XPOA 1CM9A 1SYCA 1SDFA 2Z6KA 3TREA 2DY7A 2K5VA 4KK7A 1PRTB 2VQEL 1QILA 5LL6S 2CW0D 3G6EA 3HOXH 3CC2A 5FO7B 3W1BA 1K73C 3VYUA 2B3GA 3P75A 1X56A 4DF7A 4DN4M 2F0OA 1HZCA 3SDZA 1GUSA 3MC0B 4NXNQ 1J5EQ 3RZOH 1STHA 5IT9L 1TU2B 4G57A 4O42A 3GV6A 1C8CA 1Y1WB 1JT8A 3PIOA 1L1OC 2VS1A 3MAQA 4LJZC 4DR4Q 3P20A 1IZ6A 4X64L 4OXPA 4CDCC 2AQ3B 1FNUA 3S16H 3EQLC 2B2WC 3BYTB 3OPOA 1N32L 1PFSA 1FVIA 1SE4A 2A74C 2CH4A 3HGBA 1YNNC 1LACA 1QZHA 4DAYA 2ZT9C 4KLKA 3PUZA 1YJWA 2E2DC 4OEMB 4XQJA 2G9HD 3RN5A 4DR6L 4FF2A 1GOZA 1UAPA 2K14A 5IYCG 1XMQQ 4YWLA 4J1MA 3HOUB 4JYAQ 2F4IA 2Z4HA 4CBVA 4Z9CB 5FLXL 1VQFA 3T13A 3M7NA 1ZKOA 3I56A 3RZDB 3OW2A 2JEBI 4FF3A 1MJCA 1PH5A 3Q24A 3RNUA 3AEVA 4LFBQ 4CKBA 1G6PA 4A3IG 1PV4A 1TS3A 2EYMA 3OW7A 2LMCB 3T53B 2JJQA 4YHHQ 1H9RA 4DR3Q 4DUZL 4JI6L 2AQ1B 3PO2H 2VB3X 1JJ2A 3R3OA 1DYQA 4H02A 2I5HA 5C4HA 3GTKH 3J7AV 2J7ZA 4N8FA 2PMZE 2M00A 3CCJA 3HKZE 1JJCB 2DJFC 3I72A 1SE2A 2EYFA 2AHOB 3AQQA 4A3BB 1PMRA 3K7AB 3H0GG 1YBYA 1ZYRC 3T1YQ 2QEXA 2ICEC 3ND9A 4GLAC 4IUUA 2RA4A 4DV7Q 1PRTD 3VA7A 4CJ0B 4JI5Q 4E6IA 2B2TC 4DUYL 3CU7A 1KRSA 1PTOD 2R92B 5IYDG 5IWAL 1E22A 3K6OA 2L11A 2XRQD 4IO9A 1BKBA 4IURA 1N36L 2OF1A 4Y7NB 2V1CC 2CWPA 3TEHB 4B3SL 5J3BA 1F2ZA 1YNJC 4OIKA 3ICEA 3W5OA 1V1PA 1TWAB 3DEOA 1PH3A 2WB1B 1DJRD 1SN8A 2B8FA 3I4MG 4C3IH 3PIO3 2F0UA 3ERQA 2E76C 4MZ9A 4B9XA 1C0AA 1RDPD 1C4QA 1KNAA 4POGA 1XX8A 2K04A 1LM0A 3B6YA 3SE0A 3IFTA 2JE6I 2BDOA 1H9MA 1W3SA 4LNQA 4MN3A 3K0YA 2Z0SA 3SK4A 2IX1A 3KOJA 2JA7H 4UP9A 1Z9FA 5EPJA 2EYPA 4BY7B 1GHJA 2MQHA 2BH8A 5JJLA 3F2UA 3S14B 4A3KB 3STBC 1KTKA 3MEHA 3F1ZA 5CYUA 1Z47A 4K5XA 4GKJL 5A2QL 2N3SA 1KAWA 2F0FA 4X65L 1L1OA 1N32Q 3ZJYC 1V1PB 1Z6HA 2B2WA 3E0EA 4DV2L 4WJ3M 1ENAA 3UDGA 3CRKC 4DNIA 5DAUA 3U9OA 2E2JH 4V0BA 4DR6Q 3AU7A 1K83H 2NVYB 4I7AA 1EYAA 2K5WA 4KY5A 1K28A 4EQPA 2LXKA 1JC7A 2E2IB 2KA7A 4KD4A 2Y0SB 3LX0A 4AYBE 1C7YA 4B3TL 1N8RC 2K33A 4DAPA 2JA6B 2F0PA 1WTQA 2UXDQ 2NTTA 3GTJB 1C9OA 5IP9G 1HNZQ 1BCPB 1QNKA 1NBWA 4HJAA 4OO1H 1TWFH 3KUPA 4DV4L 1GVPA 3DLLA 4HSPA 3W1GA 3WDNA 4NXML 5C4ZA 1RCVD 5KEEA 1TWCH 4JI6Q 4DUZQ 1OO9B 4OWWB 5C0XG 1J6QA 1VS0A 1H95A 2QW7A 4A3CH 4PMWA 1EY9A 1CQFA 3S1NB 1NE3A 3S2DH 3I8ZA 5F2DA 5FOBB 3K5NA 1I3QH 5FJ8H 1LT6D 1U4RA 3GTMB 3TP8A 4P72A 4UP7A 1PH8A 1DCZA 4R9WA 3LNNA 1A0IA 4LF5L 4P74A 4QMGA 5M3FH 1YJNA 5CGKA 1K3RA 5IGDA 4BY1B 2M9VA 5IWAQ 1TQOA 3F2DA 3BDCA 1SAPA 2B2TA 2KCCA 2YYZA 2AQ2B 3MXNB 2WP8J 1N36Q 3VDYA 1IBLQ 2O4XA 4B3SQ 1G2TA 5GAHC 1CZWA 2A6ED 1SNQA 1JWUD 1DD2A 1PZJD 3VA5A 1SLJA 3KBGA 1UNSA 4A3EH 1JICA 1SMYC 4IPHA 1NR4A 4A93H 1VQHA 4LUZA 5LMNQ 3K7UC 3PUXA 1EQQA 1B3AA 2HIXA 5EBDA 4A3IB 3KLSA 1F9QA 2F4VL 1S5ED 1WD0A 3JC66 4HJ7A 2H5XA 3GTPH 2RF4A 2XWBB 3HOVG 3S17H 3U9SA 2WB1E 4OHJA 2KECA 2PQAA 2JP1A 1HHVA 2KCTA 3NBHA 4JI2L 3C2PA 4Q5VA 4DK3C 2F0IA 1PZKD 3H0GB 1IYVA 3K5MA 4K0KL 4HIOA 4R4TA 4YWMA 3BVZA 3HOZH 4OX9L 2JXMB 4X65Q 3D8GA 2RHSB 1PFBA 1HZ9A 1G6ZA 2TMPA 1JOQA 1E2ZA 4C3HH 2E2HH 3A74A 2E5LL 1VQ7A 2KENA 4DV2Q 3H3VC 2Z4IA 1HR0L 3GTLH 4NW2A 4CJ2C 4DV0L 3DEPA 2B2YC 1XYIA 3G6JB 1SBBB 2G9DA 1SFOH 1YNND 2L5TA 2IHEA 2HIVA 5JJIA 1B1ZA 1QZGA 1UWVA 4B3TQ 1DONA 2EYHA 2PQAB 4RKLA 1TWGH 3VR6A 3J7YW 3TS2A 3MXGA 2RBMA 2Z8LA 4UAIA 4DV4Q 2E8GA 1LV9A 2Z6BA 4NXMQ 1ICWA 4JBWA 1HUMA 3EROA 4DV5L 1Q12A 1DOMA 4UP8A 5M3MG 1FR3A 1C48A 1Y69U 1RIPA 4A3GH 1PRTC 1SE8A 3A8JE 3RMHA 4KV6A 3BG3A 1D5XC 1TY2A 1IL2A 4XIGS 4JI3L 2PZTA 1KIXA 2K32A 2OWOA 3S1QB 4DAMA 2F3WA 1K8MA 1JE5A 4LWCA 2KCNA 4A3MG 4RGOS 5CBEE 3DMUA 2IX3A 4UPAA 3UDIA 4PMBA 2BA0A 5IT9E 1STEA 4IFDI 4KMUC 3J81L 1DGSA 1U0LA 1F2YA 4TVAB 2L0CA 1HA6A 1TXYA 2WAQE 1ZYRD 3GQBA 3NUCA 4ZQ3A 4C3JG 4HIDA 1WTRA 1AZQA 1X3GA 4OGQC 3CCVA 4QF4A 3HP3A 1GO3E 1K0RA 1QUQB 3VYRA 1STAA 2KOLA 4JI4Q 1M90C 1KDAA 1EFID 5E4XA 1EIFA 3L0OA 3GP7A 1E24A 2BE5C 1YNJD 2EJGC 1EYCA 2R6GA 3NP8A 4JOIA 3E6ZX 3HOWH 1Q90A 2EJMA 4G4KA 3N6RA 1CSQA 2UU9Q 4JI2Q 4IZ8A 2F0JA 2RSOA 3J80L 1BR9A 4OWTB 3K58A 2JA5H 2PO4A 1B9MA 4K0KQ 3GTGH 1VQAA 5C3WA 1QOHA 3GTQH 1I50H 4OX9Q 2NN6H 2H4OA 2K52A 3MVVA 2VUMH 2Q2HA 5AJ3Q 2K50A 4XT1B 3NSWA 1VQ6A 1I4XA 4U68A 5I6WA 2PW7A 3MWYW 2Q8IB 4X62Q 3T1HL 1WTVA 2E5LQ 4JI7L 4XT3B 4B08A 5JJZA 3D4DA 1K9MC 1HR0Q 3RR5A 3STBD 4P71A 5D3DA 1PYWD 3M7GA 4A3LH 1Q8IA 3GO5A 2K28A 4GOPB 2L1BA 2SDFA 2UXCL 3OMGA 5M5XH 3W3AA 3KDFA 2PW5A 1HNXL 3S1RB 1JB7A 5DLQE 1VQNA 5M5WB 5EKLA 3NXWA 4BBSH 3SHLA 4EQNA 1TS4A 2EY5A 1TS5A 4YWKA 4R4OA 1J9OA 3HOVB 1B4OA 1E7ZA 2A6HC 4RA8A 5HGTA 4IFDH 4DV5Q 3PO2G 4MNOA 2JSOA 3CQZH 1X55A 3R8BA 4OIJA 4ZLTF 2HDMA 3NELA 1N34L 1EWCA 2QDLA 3OYYA 3QG1A 3VR5A 5IGFA 1U4MA 3MA2B 1FYCA 4JI3Q 3HEJA 5M5YH 3T56B 1STNA 3KYHC 2N78A 2CKZB 3IRBA 2EE1A 2NVTB 4FP5D 3MEFA 5HY6A 4B3ML 4HAEA 3UDXA 1XTDA 1PTOH 4IUTA 5LHY1 5HURA 3KDFB 4RWSC 2D62A 1OXSC 5A2QE 1I6VC 5CV7A 2AMCB 5ELNA 4FVMA 1F9SA 4YCWA 4JI1Q 3IKJA 1CKMA 1HCZA 1V9PA 4C3IG 2HDLA 2DNCA 5IY0A 1CTMA 2VL6A 1VQJA 4QY7A 4AIMA 1D5ZC 5DM73 5KRUA 1WVLA 3HOYH 1QVGA 5IT9c 3I4NH 4OONA 3M4OB 4DR7L 4LFCL 1UE7A 4DKAC 3RN2A 1SMYD 5M3MB 2KHJA 1BCPC 4CDEC 1JMCA 2JA7G 3NPPA 4DK1A 2VXWA 3MFYA 2DUDA 1CSPA 1LT4D 2NVXB 3I91A 3TS0A 3SXHA 4N9TA 4IPCA 1N9WA 1WI5A 4QCLA 3PV0A 3FHWA 1YHBA 5LMUL 1LYLA 5I4DA 4QUFA 4A3MB 3CD6A 4DU9A 3NTHA 3I4LA 1FNWA 2WKCA 4R4QA 3ONAB 4QIWB 2FMMA 2O2LD 4NP5A 3SR1A 2ZJQA 4M8AA 1PFNA 3FPPA 5COYA 4RHRA 3CCRA 1DOLA 2AWNA 3T1HQ 4GN5A 1XPRA 3GV3A 1BVSA 2J0TD 1Q86C 1BDOA 4S3SA 3O13A 1T5EA 5ELEA 4R8NA 3M85A 3S24A 3X3MA 5C4XG 2R7ZH 1VQ5A 2UXCQ 3PIPA 3JAML 5C3EH 3MXPA 2J4XA 3CW2C 2X6GA 3PQIA 1HNXQ 3D0FA 1EYDA 3PCOB 1SYEA 1O7LA 1U5KA 2K75A 3ITPA 4B9WA 2Q8TA 1VQMA 3A7LA 4A3FH 3HS0C 3TP5A 3NENA 4TKOB 4X3KA 4OO1G 1CZGA 2Z1CA 1A2TA 3H09A 4RMFA 4DR5Q 2QEJC 4DA2A 2K5NA 2K01A 4DV3L 3KFUA 1TWAH 4C2MH 2RCNA 3TBIB 1MHWC 4A3CG 2K03A 2QDBA 4IFDJ 1NY4A 3RZOB 1MGSA 5BN5A 1XTCD 5JJKA 1TT2A 1CA5A 5G3LD 5FJ8G 3UDFA 5C5MA 1Q7YC 1N33L 3S16B 4CGYB 4AQYQ 3VR4A 1BCPF 1I4RA 3NHHA 3H91A 1OXXK 4LF9L 4B3MQ 1ESRA 1VQGA 4A3JH 5M3FG 3EVQA 2CWAA 5CV9A 4OO1I 4C56C 2JEAI 2C9OA 5IYBH 3K80C 1I6HB 4IUPA 1ESFA 5EQ0A 1CUKA 1LLRD 1EU3A 1S5BD 2NB0A 5D3IB 3S14H 1PH2A 2YTXA 2HHHL 4LW1A 3KLRA 1AW7A 4WJWA 2MJ8A 2FHTA 1K8OA 2UUCL 1SNMA 4KHPL 1II3A 4A3EG 2PZUA 1RKNA 4YCUA 2WFWA 1MBYA 4POFA 4A93G 1JB3A 5C44H 4KN4C 2RDGA 1O7YA 4KY7A 1RJTA 4L5RC 2L9HA 5FLMH 5AFWA 5EGTA 4JC0A 3PO3G 1EZ8A 2IX0A 3NWSA 3MTSA 1GXDC 4F87A 4L5TA 2IW3A 5JVH3 1S4ZA 4R8IA 4KKTA 1E1OA 2F0VA 4H44C 2D0PA 5I2YA 1HH2P 4LFCQ 4ZK9B 3GTKB 2VQEQ 1STYA 1S3OA 2NVYH 2Q2UA 1EOVA 4DXGA 3OHXC 1HNWL 3VR2A 1S5FD 3TQYA 1NTGA 4PZ8A 3QOJA 5J39A 2BE5D 3PIP3 4HJ8A 1M1KC 1XXGA 4K14A 4QUCA 3UI2A 3TZDA 2LKVA 2UXBL 1B9NA 2MO1A 5LMUQ 1L2FA 2F0GA 3OWFA 4HSVA 4LF8L 3HOZG 1IHZA 1WTPA 2VB2X 2SNMA 4X64Q 2RSNA 4WRDA 3FKIH 2PCFB 1H9JA 1BNZA 2OQKA 3CCUA 4C3HG 2LS01 5EKKA 3F8TA 1MJEA 1EWHA 4QGUA 3FDTA 3AB9A 3HFZB 2R93B 2C35B 1B7YB 4ME5A 3ULJA 1WFQA 3S1NH 2F0NA 5DEHA 2JYOA 2MO0A 2K4KA 4QIWE 1VQIA 2RQXA 3V96A 1E1TA 4TRDA 3U4ZA 1PA6A 3GTMH 1TS2A 3MXNA 2HD3A 2YU9H 4RGMA 3J81E 1I4PA 2B63H 3QJYA 4K2KA 3QR8A 5E1FA 2IJ0A 1SR3A 2FMCA 4BY1H 2MPMA 1L0YB 1EOTA 1BF4A 1KNEA 4F8MA 1LTID 2QGQA 3GDEA 4RHSA 2L12A 2RDFA 2NBFA 4X3SA 2UUAL 1OXTA 2JA7B 1NAPA 5IYCH 1Q1BA 3M4PA 3Q8DA 4DV3Q 4A3GG 3MZ5A 1KHIA 1EEID 4IJHA 3OTOL 2IY5B 1A3UA 3ERSX 4QL5A 3D6WA 1LT3D 3S9WA 2F03A 3PSIA 4HCSA 2A6HD 2K1BA 3OOCA 5JPNC 1N33Q 1IBML 2IWHA 1FJGL 3DHQA 4IJLA 4N9PA 4LMQD 2L55A 4LF9Q 3J80E 4HMIA 4ID6A 2JQOA 4RCNA 2NZOA 4DUYQ 1F77A 5CBAE 1B8AA 1F2LA 2FXQA 3D31A 1NCVA 3CPFA 3D6CA 5FO9B 2E2JB 2WKDA 2XSCA 4NB3A 1KABA 1K83B 4ZAIA 1LTBD 1LTTD 5KNCA 4XYQA 4LUVA 2HHHQ 5C4XB 3EN2A 2UUCQ 4KHPQ 5BR8L 2KHIA 1YZ6A 1G291 2NZ1D 1S40A 1PXUA 1X65A 1VQKA 4A3DH 1G91A 2ZTEA 1VQBA 1VCIA 4GOPC 3ER0A 2R3ZA 4O1NA 3I55A 2I07B 4P2CB 4B3RL 2F0WA 1QG7A 3NQIA 1ASYA 1PH9A 1TWCB 4JOIC 1U4PA 1TWHH 3DM3A 1VF7A 1K3BC 4F88A 4J6HA 4N8X1 2X6LA 2F1MA 3HOWG 4OELB 1HXYD 2NTSA 1YIJA 4NKLA 4P75A 3S1MH 2XNAC 1HNWQ 1P8LA 2NVQB 4RAUC 5IGEA 3S2DB 3QOLA 4IUQA 1NUCA 1I3QB 1EU4A 4G7ZC 4KKUA 4DNTB 5E4WC 1HQRD 1QNUA 4HIKA 4K2LA
chains in the Genus database with same CATH topology
3OMCA 5BN3A 1CI3M 1AN8A 1BCPD 4PQXA 4WFN3 1CFMA 3I90A 5M3FB 5JEAH 3D4WA 2N88A 3V05A 2X69A 3LWEA 1EY8A 4C1NK 3NTIA 3KLSX 4A3EB 5CV8A 3I4MB 3I70A 5ISRA 3Q22A 4A93B 1HA5A 2D9UA 3NBIA 2PYKA 4OL7A 3PO3B 2XIWA 3RD4A 2NN6I 3IAYA 1SYFA 2MP1A 2N55A 3DWAA 4JK1C 3S17B 1WTOA 1QCBD 4IFDG 3C1EA 3V2TA 2CHBD 1PZID 1A2UA 1CT1D 1LTRD 1IKLA 1KDCA 2KJXA 3CHBD 3OWEB 4X3UA 1WD1A 2EJFC 3HOZB 1EIGA 1I4QA 4ZKCB 4KTAA 2EOTA 1IW7C 4NDXA 4ILWA 1ILQA 1LTGD 3K57A 4C3HB 2E2HB 2EPBA 3AMUA 4ZUJA 1G8ZD 3BDOA 1X3QA 1HTPA 1U9RA 3GTLB 2KEEA 1I4HA 3QWNA 1O78A 2QKIC 3MHBA 2C5CA 1CQVA 3A8IE 1HTLD 1SFOB 2ICIA 2I46A 1ZXTA 1F2MA 1KAAA 4XDXA 1JQYD 1HFNA 3T4AC 1W6KA 2F0MA 5IOCA 1MSGA 3OIPA 5CV4A 3JAME 5FLXE 3OSOA 4A3GB 4ZRZA 3TDQA 1D2BA 4KJOA 2QCPX 4KHZA 1LTSD 2K6AA 2RKSA 5G3LF 5IODA 3FPUB 5DM63 3NWTA 3X3NA 5D65A 4I65A 3C46A 2ENBA 1GUTA 3KK7A 4ZUIA 5KNDA 5ELCA 3H6MA 2F0KA 5FK9C 5JEAJ 4HN7A 3IFDA 2XN9C 2RVLA 3K59A 1SNOA 3L3OC 1E2WA 1HPCA 4PNYA 3TZUA 4CKEA 1RTNA 1GUNA 1Y8PB 3NE5B 1B44D 3BYYB 1Q1EA 3P7JA 3D3RA 3HOWB 1ENCA 1STGA 1PLFA 3E0JA 1R9TB 3SVMA 3M4YA 4KJNA 4K5VA 4XQQA 1AFPA 2EDGA 2EVBA 2SOBA 4RKBA 5IIFA 5C5LA 3GTQB 4FYDA 1EIHA 2VUMB 5CV5A 2AWOA 2KEDA 1SYGA 2K5DA 3VR3A 4YIJA 1EL0A 3M3YB 3E5SA 1LO5D 3T16A 1T5XD 5C3XA 3MXUA 1JWMD 1R4PB 3H94A 3FMCA 4CJ1B 5M5XB 1SXTA 2A69C 3BVGA 2EYJA 2F0EA 2V4DA 1NSNS 3L7ZC 1F9RA 5CV6A 4ULLA 4BBSB 1ILPA 3BDLA 5KGUA 2EYLA 2BA1A 4KI0A 5CMDA 2A5HA 1SNPA 1NR2A 3CQZB 3KBXA 1HQMC 2F3VA 5J22A 4HR7B 3TMEA 3A8KE 1OXVA 2R61A 1A15A 5BN4A 3NQTA 3SK6A 5M5YB 1A3TA 1ET6A 5CORA 1B2TA 2IPKD 2OXPA 4DFAA 3T51B 4CHTB 4LAAA 1PTOB 1D5MC 2TSSA 4XYOA 3W2DA 2ID0A 1GUGA 4DXFA 3WOFA 2WACA 4XQNA 1BO0A 1GHKA 4ZKBB 4C3JB 2LY7A 2B2UC 1SSOA 4H0LC 1FGBD 3PUVA 4KY6A 4FXGC 2F0TA 1AP0A 5T1IA 1BQQT 1D1IA 3HOYB 5EPKA 4AYBB 4RH6A 5FKAC 3I4NB 5JVG3 4HCEA 5E3FA 1E2VA 2OEOA 1QWYA 4I7ZC 3HOXB 1Q3LA 2MGSA 3K5LA 2Q8RE 1V8QA 2EY2A 5JPMC 2A68C 2L4NA 5CC4A 2QILA 2ZXRA 4K5WA 5I6YA 2KVMA 2EXZA 2F0DA 2LFNA 4L8JA 2EY1A 1AZPA 4F7XA 1KDBA 2D2CC 1EY7A 3SEBA 1QE6A 1EQVA 1O7ZA 5DNFA 1SYDA 3TN2A 2O5IC 2GA4B 2H1EA 1CA6A 1IW7D 1EEFD 4DAVA 2R7ZB 3I3CA 3DWPA 1DZ1A 5C3EB 1H9SA 5J1ZA 1FD7D 5I9PA 4IUNA 4XXEA 1RD9D 1RHPA 1W6JA 3NTKA 2ZXPA 2CQAA 4A3FB 1O80A 1OXUA 3SK8A 3HG9A 4ZYSA 1JOOA 3BZDB 4IUVA 2CVRA 3PO2B 4K6DA 2WV6D 4C2MB 1WTXA 1X3PA 1DXMA 5K36H 1S5CD 2K7VA 4HEDA 1SEBD 3RUZA 2E74C 1CHQD 4KHVA 4A3JB 1MSHA 5JEAG 3FEWX 5EJWA 4X3TA 4ABNA 4CKCA 3PUYA 3KF8A 1H9SB 2VNUD 3SK5A 2D5DA 1HRJA 1QB5D 3CRLC 4FXKC 1ENFA 3QO2A 4WORA 5EKIA 2B2UA 4C3IB 2HQEA 5C44B 4KD3A 4BA1I 4FXDA 1ML0D 3EA6A 1BXTA 3DUZA 3WOEA 1L0XB 2F0HA 2BDNA 5K5PA 2QF7A 1B50A 3G7LA 1KLUD 3K5OA 4J8QA 2NUCA 1LT5D 3TP7A 5IGCA 2KHSA 3L9AX 1SJHD 3A56A 1VMPA 2EY6A 2PNRC 3C3LA 5TSSA 4TSSA 1EY6A 3N52A 3FKIB 3Q6SA 3HZXA 1D1KA 1JOKA 5FO8B 3VYTA 1VF5C 1IKMA 2ZXOA 5D14A 3DWQA 4PMCA 2M2LA 2MUYA 4KN7C 2WAQB 5ELFA 4FO2A 4EQOA 2YU9B 1LABA 3PUWA 2B63B 3A55A 1GUWA 3TSSA 1UUPA 1TWFB 2XWJB 5C0XI 4IALA 2IL8A 2A69D 1G2SA 4K8IA 4FF1A 1EY0A 1AEXA 1TVXA 1DM0B 2HUGA 3FVQA 4K8JA 2CW0C 3LWUA 1GJXA 3J7AF 4PV1C 1RF2D 3NK9A 1TIID 4QB4A 4H7BA 2IT1A 5KYLA 2O5JC 2NN6G 1QJOA 4L6TB 1MI2A 3GD7A 2BOSA 4RGNA 2B2VC 1V1OA 2B39A 2FJ2A 5I2XA 3I73A 1UEAB 3MFGA 2E75C 1SE3A 4RFBA 4DK0A 5IGBA 4A3DB 1TY0A 1Z7TA 1H9KA 1SNCA 3R2TA 2A73B 3ND8A 1TWHB 3GTPB 1XWEA 3OIQA 1X32A 2PPBC 5LL6X 1VMCA 3BS1A 3S1MB 4C1NI 5KNBA 1Y8NB 3EFXD 1ONLA 3A7AB 4G7HC 3ZYYX 2WINB 1SYBA 1KLGD 2NWGA 1M4VA 2A68D 2FINB 4DNRB 5C0XH 5C4JB 1BUVT 2K05A 1PTOC 3GTOB 3R2IA 1ZEQX 2RDHA 4UDUC 1BOSA 2DY8A 2EZVA 2OT2A 4RCOA 1CK1A 2EYOA 1EZ6A 4IN3A 5JOBA 1TWGB 4V190 3QB3A 1JE4A 4BA2I 4EVOA 5ELDA 5EPLA 1WCMB 1RTOA 1J8IA 2SEBD 3P1HA 5T1GA 4XTCS 2AUJD 2KUMA 1HFGA 1JCKB 1EY5A 1E0BA 2KQ3A 3DM1A 4BWGB 4NMZA 3S2HB 5IGGA 1JR0D 1TKWB 4FNFA 5NUCA 1WTWA 1B53A 1JWSD 4U673 1Y1VB 1MD2D 1F9PA 4EGVA 4FF4A 2B2VA 4L63B 4KKSA 2SNSA 2WIIB 1RODA 1TR5A 3S15B 2HCIA 3QIAA 5I9OA 4M1UB 4K6LA 1CHPD 2XRSD 1PFMA 1PRTF 1U4LA 1V43A 1IYUA 1SNDA 1EQTA 1PTOF 3C1FA 3D4RA 4TQUS 2DNEA 3A54A 4GZYC 2XVSA 2F0SA 4BS9A 1S5DD 4Q0FA 3BVMA 4ODGA 1SJED 5A35A 2B2YA 4HTHA 2JA5B 2PMZB 4BBRB 3TP6A 3HKZB 4H13C 3GTGB 3VYSA 1I50B 2NYZD 3Q23A 3Q0AA 1IL8A 2PQEA 1R4QB 1HUNA 1VDZA 3FRPB 1M8AA 2B8GA 2DN8A 5C6AA 1Y8OB 2AUKA 3RLFA 1I4GA 1BBXC 4DGZA 1ET9A 3R93A 3HRZC 1LTAD 5C0XJ 2PZWA 2F0QA 1A6XA 4RGTA 3IL8A 1STBA 5JAVA 2A6EC 1EY4A 3PMFA 4MIUA 1D6EC 1DOKA 3URYA 2BCOA 2FFKB 4MHEA 4HMJA 5EBCA 1FNVA 5ELBA 5KIXA 2HCCA 4G7OC 1A3VA 1GUOA 5KYIA 4LK1C 5K36G 2F0LA 1JORA 1PDQA 5M9OA 5CR3A 4IQZA 3EJIA 3CKIB 2K5QA 2MHVA 3DXJC 2JA8B 1CM9A 1SYCA 1SDFA 2DY7A 4KK7A 1PRTB 1QILA 5LL6S 2CW0D 5FO7B 3VYUA 3P75A 4DF7A 4DN4M 2F0OA 3SDZA 1GUSA 3MC0B 1STHA 5IT9L 1TU2B 4G57A 4O42A 3GV6A 1C8CA 1Y1WB 3MAQA 4LJZC 3P20A 2AQ3B 1FNUA 3EQLC 2B2WC 3BYTB 3OPOA 1SE4A 2A74C 3HGBA 1YNNC 1LACA 4DAYA 2ZT9C 3PUZA 2E2DC 4XQJA 2G9HD 4FF2A 1GOZA 1UAPA 4J1MA 3HOUB 2F4IA 2Z4HA 4CBVA 4Z9CB 5FLXL 3M7NA 3T13A 1ZKOA 3RZDB 2JEBI 4FF3A 3Q24A 4CKBA 1TS3A 2EYMA 3OW7A 2LMCB 3T53B 1H9RA 2AQ1B 2VB3X 3R3OA 1DYQA 5C4HA 3J7AV 2J7ZA 2M00A 3I72A 1SE2A 2EYFA 4A3BB 1PMRA 3K7AB 1ZYRC 2ICEC 3ND9A 4IUUA 2RA4A 1PRTD 3VA7A 4CJ0B 4E6IA 2B2TC 2R92B 3CU7A 1PTOD 3K6OA 2L11A 2XRQD 4IURA 2OF1A 4Y7NB 1F2ZA 1YNJC 4OIKA 1V1PA 1TWAB 3DEOA 2WB1B 1DJRD 2B8FA 3PIO3 2F0UA 3ERQA 2E76C 4B9XA 1RDPD 1C4QA 1KNAA 1XX8A 2K04A 3SE0A 3IFTA 2JE6I 2BDOA 1H9MA 4MN3A 3K0YA 3SK4A 2IX1A 5EPJA 2EYPA 4BY7B 1GHJA 3F2UA 3S14B 4A3KB 1KTKA 3MEHA 5CYUA 1Z47A 4K5XA 5A2QL 2F0FA 1V1PB 1Z6HA 2B2WA 1ENAA 3CRKC 5DAUA 3U9OA 4V0BA 3AU7A 2NVYB 1EYAA 2K5WA 4KY5A 4EQPA 1JC7A 2E2IB 2KA7A 4KD4A 2Y0SB 3LX0A 2K33A 4DAPA 2JA6B 2F0PA 1WTQA 2NTTA 3GTJB 1BCPB 1QNKA 4OO1H 3KUPA 4HSPA 3WDNA 5C4ZA 1RCVD 5KEEA 1OO9B 5C0XG 4PMWA 1EY9A 1CQFA 3S1NB 3I8ZA 5F2DA 5FOBB 3K5NA 1LT6D 1U4RA 3GTMB 3TP8A 1DCZA 4R9WA 3LNNA 4QMGA 5CGKA 5IGDA 4BY1B 2M9VA 1TQOA 1SAPA 3BDCA 2B2TA 2KCCA 2YYZA 2AQ2B 2WP8J 2O4XA 1G2TA 1CZWA 2A6ED 1SNQA 1JWUD 1DD2A 1PZJD 3VA5A 3KBGA 1UNSA 1JICA 1SMYC 1NR4A 3PUXA 1B3AA 4A3IB 5EBDA 3KLSA 1F9QA 1S5ED 1WD0A 2XWBB 3U9SA 4OHJA 2KECA 2JP1A 1HHVA 3NBHA 3C2PA 4Q5VA 2F0IA 1PZKD 3H0GB 1IYVA 3K5MA 3BVZA 2JXMB 3D8GA 1PFBA 1G6ZA 2TMPA 1JOQA 1E2ZA 3H3VC 2Z4IA 4NW2A 4CJ2C 3DEPA 2B2YC 1XYIA 3G6JB 1SBBB 2G9DA 1YNND 2L5TA 1B1ZA 1DONA 2EYHA 4RKLA 3VR6A 3J7YW 3MXGA 2RBMA 2Z8LA 4UAIA 1LV9A 1ICWA 4JBWA 1HUMA 3EROA 1Q12A 1DOMA 1FR3A 1C48A 1Y69U 1PRTC 3A8JE 3RMHA 4KV6A 3BG3A 1D5XC 1TY2A 4XIGS 2PZTA 2K32A 3S1QB 2F3WA 1K8MA 2KCNA 4RGOS 5CBEE 3DMUA 2IX3A 4PMBA 2BA0A 5IT9E 1STEA 4IFDI 4KMUC 3J81L 1F2YA 2L0CA 1HA6A 1ZYRD 3GQBA 3NUCA 4ZQ3A 4C3JG 1WTRA 1AZQA 4OGQC 4QF4A 3HP3A 3VYRA 1STAA 2KOLA 1KDAA 1EFID 5E4XA 3GP7A 2BE5C 1YNJD 2EJGC 1EYCA 2R6GA 3NP8A 3E6ZX 1Q90A 2EJMA 4G4KA 3N6RA 4IZ8A 2F0JA 2RSOA 3J80L 1BR9A 3K58A 2PO4A 1B9MA 5C3WA 1QOHA 2NN6H 2H4OA 3MVVA 4XT1B 3NSWA 1I4XA 4U68A 5I6WA 2PW7A 3MWYW 2Q8IB 1WTVA 4XT3B 4B08A 5JJZA 3D4DA 5D3DA 1PYWD 3M7GA 1Q8IA 3GO5A 2K28A 2L1BA 2SDFA 3OMGA 3W3AA 2PW5A 3S1RB 5M5WB 5EKLA 3NXWA 3SHLA 4EQNA 1TS4A 2EY5A 1TS5A 1J9OA 3HOVB 1B4OA 2A6HC 4RA8A 5HGTA 4IFDH 2JSOA 3R8BA 4OIJA 4ZLTF 2HDMA 1EWCA 3QG1A 3VR5A 5IGFA 1U4MA 3MA2B 1FYCA 3HEJA 3T56B 1STNA 2EE1A 2NVTB 4FP5D 4HAEA 1PTOH 4IUTA 5LHY1 5HURA 4RWSC 2D62A 1OXSC 5A2QE 1I6VC 5CV7A 4FVMA 1F9SA 3IKJA 1HCZA 4C3IG 2HDLA 2DNCA 1CTMA 5KRUA 1D5ZC 5DM73 1WVLA 3M4OB 1SMYD 5M3MB 1BCPC 3NPPA 4DK1A 2VXWA 3MFYA 1LT4D 2NVXB 3I91A 3SXHA 4N9TA 4QCLA 3PV0A 5I4DA 4QUFA 4A3MB 4DU9A 3NTHA 3I4LA 1FNWA 2WKCA 3ONAB 4QIWB 2FMMA 2O2LD 4NP5A 3SR1A 4M8AA 1PFNA 3FPPA 5COYA 4RHRA 1DOLA 2AWNA 3GV3A 2J0TD 1BDOA 4S3SA 3O13A 1T5EA 5ELEA 4R8NA 3M85A 3X3MA 3JAML 3MXPA 2J4XA 2X6GA 1EYDA 1SYEA 1O7LA 3ITPA 4B9WA 2Q8TA 3A7LA 3HS0C 3TP5A 4TKOB 4X3KA 4OO1G 1CZGA 2Z1CA 1A2TA 3H09A 2QEJC 4DA2A 2K01A 3TBIB 2K03A 2QDBA 4IFDJ 3RZOB 1MGSA 5BN5A 1XTCD 1TT2A 1CA5A 5G3LD 5C5MA 3S16B 4CGYB 3VR4A 1BCPF 1I4RA 3NHHA 3H91A 1OXXK 1ESRA 3EVQA 5CV9A 4OO1I 4C56C 2JEAI 2C9OA 1I6HB 4IUPA 1ESFA 5EQ0A 1LLRD 1EU3A 1S5BD 2NB0A 5D3IB 3KLRA 1AW7A 4WJWA 2MJ8A 2FHTA 1K8OA 1SNMA 1II3A 2PZUA 1RKNA 1MBYA 1JB3A 4KN4C 2RDGA 1O7YA 4KY7A 1RJTA 2L9HA 5AFWA 5EGTA 1EZ8A 2IX0A 3NWSA 3MTSA 1GXDC 4F87A 2IW3A 5JVH3 1S4ZA 4R8IA 4KKTA 2F0VA 4H44C 5I2YA 4ZK9B 3GTKB 1STYA 4DXGA 3OHXC 3VR2A 1S5FD 5J39A 3QOJA 2BE5D 3PIP3 1XXGA 4K14A 4QUCA 3UI2A 3TZDA 2LKVA 1B9NA 2F0GA 3OWFA 4HSVA 1IHZA 1WTPA 2VB2X 2SNMA 2RSNA 4WRDA 2PCFB 1H9JA 1BNZA 4C3HG 2LS01 5EKKA 1EWHA 3FDTA 3AB9A 2R93B 4ME5A 2F0NA 5DEHA 2JYOA 2RQXA 3V96A 4TRDA 1TS2A 3MXNA 4RGMA 3J81E 1I4PA 3QJYA 4K2KA 5E1FA 2IJ0A 2FMCA 2MPMA 1L0YB 1EOTA 1BF4A 1KNEA 4F8MA 1LTID 4RHSA 2L12A 2RDFA 2NBFA 4X3SA 1OXTA 2JA7B 1NAPA 1Q1BA 3MZ5A 1EEID 1A3UA 3D6WA 1LT3D 3S9WA 2F03A 4HCSA 2A6HD 2K1BA 3OOCA 5JPNC 2IWHA 3DHQA 4N9PA 4LMQD 2L55A 3J80E 4HMIA 4ID6A 4RCNA 1F77A 5CBAE 1F2LA 3D31A 1NCVA 3D6CA 5FO9B 2E2JB 2WKDA 2XSCA 1KABA 1K83B 4ZAIA 1LTBD 1LTTD 5KNCA 4XYQA 5C4XB 1G291 2NZ1D 1PXUA 1G91A 1VCIA 2R3ZA 4O1NA 2I07B 4P2CB 2F0WA 1QG7A 3NQIA 1TWCB 1U4PA 1VF7A 4F88A 4J6HA 2X6LA 2F1MA 1HXYD 2NTSA 4NKLA 2XNAC 2NVQB 4RAUC 5IGEA 3S2DB 3QOLA 4IUQA 1NUCA 1I3QB 1EU4A 4G7ZC 4KKUA 4DNTB 5E4WC 1HQRD 1QNUA 4K2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OMC A;  1F2Z A;  1TT2 A;  1EY9 A;  1F2M A;  1KAA A;  5CV5 A;  4IAL A;  2F0S A;  3P75 A;  4DF7 A;  4K2K A;  5C5M A;  5E1F A;  2F0O A;  5F2D A;  5C3W A;  2F0M A;  5IOC A;  4K8I A;  1SYG A;  2F0U A;  1STH A;  2OEO A;  3ERQ A;  3NHH A;  5E3F A;  3SK5 A;  3D4W A;  5CV4 A;  4G57 A;  1EY0 A;  4ODG A;  2EYH A;  1AEX A;  3MVV A;  3TP8 A;  4YIJ A;  4B9X A;  5KRU A;  4F8M A;  4RKL A;  3EVQ A;  5CV9 A;  4HTH A;  3E5S A;  3OSO A;  4K8J A;  2RDF A;  5I6W A;  3T16 A;  2RBM A;  2PW7 A;  3TP6 A;  2EY2 A;  4QMG A;  5C3X A;  1EY8 A;  3NK9 A;  5CGK A;  5IGD A;  2EYO A;  3D4D A;  4WOR A;  1EZ6 A;  5CC4 A;  5KIX A;  1TQO A;  3ERO A;  3MZ5 A;  4K5W A;  3BDC A;  2HQE A;  2PQE A;  5I6Y A;  4QB4 A;  4H7B A;  5KYL A;  1A3U A;  2EYJ A;  2EXZ A;  2F0E A;  4KJO A;  2O4X A;  5CV8 A;  4KD3 A;  5JOB A;  5ISR A;  2F0D A;  1NSN S;  1SNM A;  3QB3 A;  5CV6 A;  1II3 A;  2EY1 A;  3SK4 A;  4EVO A;  3S9W A;  3SXH A;  2F0H A;  1SNQ A;  5K5P A;  2PYK A;  2PZU A;  1RKN A;  2RKS A;  2EYP A;  4KV6 A;  4N9T A;  4OL7 A;  5C6A A;  5IOD A;  3BDL A;  3OMG A;  3VA5 A;  5KGU A;  2EYL A;  3P1H A;  1KDB A;  4F7X A;  2PW5 A;  1SYF A;  2PZT A;  4I65 A;  3DHQ A;  4KY7 A;  1EY7 A;  4N9P A;  4J1M A;  2ENB A;  5EGT A;  4DGZ A;  4DU9 A;  2F3W A;  1EZ8 A;  5EKL A;  3SR1 A;  1EQV A;  1SNP A;  4HMI A;  4NP5 A;  4ID6 A;  3NXW A;  2PZW A;  1SYD A;  2F0Q A;  4ZUI A;  3MEH A;  3SHL A;  3T13 A;  4EQN A;  4K5X A;  2EY5 A;  3DMU A;  2F0V A;  2F3V A;  2NUC A;  3C1E A;  3H6M A;  3TME A;  3V2T A;  5J22 A;  1A2U A;  4PMB A;  3TP7 A;  5IGB A;  1EY5 A;  1STB A;  2F0F A;  2F0K A;  2KQ3 A;  2KHS A;  5IGC A;  5JAV A;  3D6C A;  3NQT A;  1EY4 A;  3PMF A;  1KDC A;  1STY A;  4MIU A;  5HGT A;  1KAB A;  2EYM A;  4NMZ A;  2EY6 A;  5J1Z A;  3SK6 A;  5I9P A;  1SNO A;  4S3S A;  4DFA A;  1A3T A;  5IGG A;  4IUN A;  1F2Y A;  3NUC A;  4R8N A;  4ZQ3 A;  5J39 A;  1ENA A;  3QOJ A;  4HMJ A;  1SNC A;  5NUC A;  1EY6 A;  4PNY A;  5IGF A;  5DAU A;  4K14 A;  3R3O A;  3U9O A;  3HZX A;  4QF4 A;  5C4H A;  1JOK A;  3SK8 A;  3MXP A;  2LKV A;  2OXP A;  4KTA A;  1EYA A;  2M00 A;  2F0I A;  1A3V A;  2F0G A;  3HEJ A;  1JOO A;  1STN A;  3OWF A;  4NDX A;  1EYD A;  4KY5 A;  1STA A;  4EQP A;  1SYE A;  4LAA A;  5KYI A;  1IHZ A;  3ITP A;  4B9W A;  2SNM A;  2EYF A;  2F0W A;  1KDA A;  2SNS A;  4K6D A;  4KD4 A;  4WRD A;  4ZUJ A;  2F0L A;  1JOR A;  2WAC A;  3TP5 A;  4PMC A;  3LX0 A;  5M9O A;  1ENC A;  5CR3 A;  1U9R A;  2F0P A;  1STG A;  3D8G A;  4J6H A;  5EKK A;  1EYC A;  1TR5 A;  3EJI A;  1A2T A;  4KJN A;  4K5V A;  1JOQ A;  5I9O A;  4NKL A;  4EQO A;  3NP8 A;  4E6I A;  4ME5 A;  3RUZ A;  5HUR A;  2SOB A;  1SYC A;  2F0N A;  4RKB A;  5DEH A;  3MHB A;  5C4Z A;  5KEE A;  5IGE A;  4KY6 A;  1SND A;  5IIF A;  5C5L A;  2QDB A;  3QOL A;  2F0T A;  1NUC A;  3C1F A;  4KHV A;  5CV7 A;  4IZ8 A;  2F0J A;  4TRD A;  2OF1 A;  1SYB A;  4K2L A; 
#chains in the Genus database with same CATH topology
 1BBU A;  3OMC A;  5BN3 A;  1CI3 M;  1AN8 A;  1EQR A;  1BCP D;  4PQX A;  3NEM A;  4WFN 3;  4GKJ Q;  2VUM G;  4X6A H;  1CFM A;  3I90 A;  5M3F B;  4LF7 L;  5JEA H;  4MTK A;  3D4W A;  2N88 A;  1UE1 A;  5C4J H;  3V05 A;  3KF6 A;  2X69 A;  3LWE A;  1VQ9 A;  1EY8 A;  4C1N K;  3GTO H;  3NTI A;  2GVB A;  3KLS X;  1CKN A;  3I4O A;  4A3E B;  1GD7 A;  2A19 A;  5CV8 A;  3I4M B;  3I70 A;  5ISR A;  3Q22 A;  1PH7 A;  4A93 B;  1HA5 A;  2D9U A;  3NBI A;  2XTI A;  2PYK A;  4OL7 A;  3PO3 B;  2XIW A;  4ME3 A;  3RD4 A;  2NN6 I;  3IAY A;  1SYF A;  2G5D A;  4BBS G;  2MP1 A;  1YNX A;  2N55 A;  1NNX A;  3DWA A;  1QUQ A;  4JK1 C;  3S17 B;  1WTO A;  1S72 A;  1QCB D;  1WCM H;  4IFD G;  1T9H A;  3C1E A;  3V2T A;  2CHB D;  1PZI D;  1A2U A;  2UUA Q;  1CT1 D;  1LTR D;  4LFA L;  1IKL A;  2Y0S E;  1KDC A;  2KJX A;  3RLN A;  3CHB D;  2IHF A;  3OWE B;  4X3U A;  1WD1 A;  2DJG C;  3OTO Q;  2P5Z X;  4YY3 L;  3J81 c;  2EJF C;  3HOZ B;  1EIG A;  1I4Q A;  4ZKC B;  4KTA A;  2EOT A;  1IW7 C;  1IBM Q;  4NDX A;  1FJG Q;  3S2H H;  4ILW A;  3KF6 B;  1ILQ A;  1A62 A;  1LTG D;  3K57 A;  4C3H B;  2E2H B;  3F2B A;  2EPB A;  4GN3 B;  3AMU A;  4LF5 Q;  4ZUJ A;  1G8Z D;  1CKN B;  1XPU A;  3BDO A;  1X3Q A;  1HTP A;  1Y1V H;  1U9R A;  3GTL B;  2KEE A;  5EAY A;  1I4H A;  3QWN A;  1W2B A;  1O78 A;  1V1Q A;  2QKI C;  3MHB A;  2C5C A;  1CQV A;  3A8I E;  1HTL D;  1SFO B;  2ICI A;  2I46 A;  3S15 H;  1ZXT A;  1F2M A;  1KAA A;  4XDX A;  1JQY D;  1HFN A;  3J80 c;  4GKK L;  3T4A C;  4B3R Q;  1W6K A;  4UY8 C;  3HOY G;  4AYB G;  4GOP A;  2ZJP A;  2F4V Q;  2F0M A;  5IOC A;  2AKW B;  1MSG A;  3OIP A;  3I4N G;  4EX5 A;  1IXR A;  5CV4 A;  3JAM E;  4BXX H;  5FLX E;  4EQ5 A;  3OSO A;  4A3G B;  1B3Q A;  3HOX G;  4ZRZ A;  3TDQ A;  1D2B A;  3E9I A;  2NZH A;  3S1R H;  1Q81 C;  4KJO A;  5M5W H;  2QCP X;  4KHZ A;  4BBR H;  1LTS D;  2K6A A;  2RKS A;  5G3L F;  5IOD A;  3FPU B;  5DM6 3;  3NWT A;  2I0Q A;  3X3N A;  2YTV A;  5D65 A;  3CXC A;  4I65 A;  4R4C A;  3C46 A;  4DR1 L;  1RL2 A;  2ENB A;  4LF7 Q;  3K8A A;  5HGQ A;  1GUT A;  3KK7 A;  4ZUI A;  4JW0 A;  5KND A;  5ELC A;  3H6M A;  1KC8 C;  2RHQ B;  2F0K A;  5FK9 C;  4NXN L;  5JEA J;  4HN7 A;  3IFD A;  2XN9 C;  2QA4 A;  2RVL A;  3K59 A;  1SNO A;  3L3O C;  1E2W A;  4A75 A;  2GVA A;  4DV0 Q;  2R7Z G;  4DR4 L;  4R1J A;  1HPC A;  4WJ4 A;  5C3E G;  4GS3 A;  4L5Q A;  4PNY A;  2VQF L;  3TZU A;  4CKE A;  4RG1 A;  3H3V H;  1RTN A;  1GUN A;  1Y8P B;  4A3F G;  4HJ5 A;  3PF5 A;  3NE5 B;  1B44 D;  3BYY B;  1Q1E A;  1VQ8 A;  3P7J A;  3D3R A;  4ALP A;  3HOW B;  5IP7 H;  4LF6 L;  1ENC A;  1STG A;  3SGI A;  1PLF A;  2ALY B;  3E0J A;  4LFA Q;  1R9T B;  3SVM A;  3M4Y A;  4KJN A;  1KD1 C;  4K5V A;  4XQQ A;  4JYA L;  3EBE A;  1AFP A;  4IPD A;  2EDG A;  2EVB A;  2SOB A;  4RKB A;  4IOC A;  4YY3 Q;  5IIF A;  5C5L A;  3GTQ B;  4FYD A;  1EIH A;  2Q2I A;  2VUM B;  2JA8 H;  5CV5 A;  4O0A A;  4DR2 L;  2Q2T A;  3L2P A;  2LSS A;  4DR3 L;  2AWO A;  4A3J G;  4DK6 C;  5M3M H;  2K5H A;  2KED A;  1SYG A;  2K5D A;  1X9N A;  1QVC A;  5IYB G;  3VR3 A;  4YIJ A;  4J15 A;  1EL0 A;  3M3Y B;  3E5S A;  1LO5 D;  3T16 A;  1WJJ A;  1T5X D;  5C3X A;  3MXU A;  1JWM D;  1R4P B;  3H94 A;  3FMC A;  4CJ1 B;  1KRT A;  4MTN A;  5M5X B;  1SXT A;  2ZTC A;  2A69 C;  1Y1W H;  1EFW A;  3CCL A;  2OTJ A;  3BVG A;  2EYJ A;  2F0E A;  3LGJ A;  2V4D A;  1NSN S;  3L7Z C;  1F9R A;  5CV6 A;  5C44 G;  2ASB A;  4ULL A;  4BBS B;  5FLM G;  1ILP A;  3BDL A;  4GKK Q;  5KGU A;  2EYL A;  2BA1 A;  2VZA A;  3J7Z C;  1EYG A;  4DPG A;  4KI0 A;  5CMD A;  2A5H A;  1SNP A;  4PZ6 A;  1NR2 A;  3CQZ B;  4JV5 L;  1HZB A;  3KBX A;  1HQM C;  2F3V A;  5J22 A;  4HR7 B;  3TME A;  2B29 A;  3A8K E;  4DV6 L;  1OXV A;  1IYJ B;  2R61 A;  1A15 A;  5BN4 A;  3NQT A;  3HKS A;  3HOU H;  1A8V A;  1G51 A;  3SK6 A;  4PG3 A;  5M5Y B;  1A3T A;  2CH4 W;  4IOA A;  3RZD H;  1ET6 A;  1Q82 C;  5COR A;  1B2T A;  2IPK D;  2OXP A;  3AFQ A;  3FKI G;  1MIU A;  4DFA A;  2F3I A;  3T51 B;  4DR1 Q;  4CHT B;  4LAA A;  1XJV A;  1PTO B;  1D5M C;  2TSS A;  3JAM c;  3PF4 A;  1X3E A;  4XYO A;  3W2D A;  2ID0 A;  1CKO A;  1GUG A;  4DXF A;  5FLX c;  1KQS A;  3WOF A;  2WAC A;  4XQN A;  4JI7 Q;  1BO0 A;  1GHK A;  1D8L A;  3CCM A;  4ZKB B;  3M9B A;  4C3J B;  2LY7 A;  1I5F A;  4JI0 L;  1GKH A;  3E9H A;  2B2U C;  4NPS A;  2WAQ G;  2DGY A;  1SSO A;  4H0L C;  1FGB D;  3PUV A;  4A3B H;  3K7A H;  4KY6 A;  4FXG C;  2VQF Q;  2F0T A;  1AP0 A;  5T1I A;  1BQQ T;  2CQO A;  2B63 G;  1D1I A;  2KCM A;  5ELO A;  1PH1 A;  5EPK A;  4AYB B;  3HOY B;  4BY1 G;  2R92 H;  4RH6 A;  1PYS B;  5FKA C;  3I4N B;  2R7D A;  5JVG 3;  4HCE A;  1I6H H;  2N8N A;  5E3F A;  1E2V A;  2OEO A;  4LF6 Q;  1QWY A;  4CDF C;  4Y7N H;  4JI8 L;  4I7Z C;  3HOX B;  3U4V A;  2ATW A;  1Q3L A;  2MGS A;  3K5L A;  2Q8R E;  1V8Q A;  1N34 Q;  2EY2 A;  5JPM C;  2A68 C;  2L4N A;  5CC4 A;  2QIL A;  2ZXR A;  4ZCK A;  4K5W A;  1WOC A;  5I6Y A;  2KVM A;  2UXD L;  1KL9 A;  2EXZ A;  3BJU A;  1HNZ L;  2F0D A;  2LFN A;  4LF4 L;  4L8J A;  2EY1 A;  1WTH A;  5IE8 A;  1AZP A;  3K81 C;  4DR2 Q;  4F7X A;  1KDB A;  2D2C C;  4O2D A;  1EY7 A;  3SEB A;  1QE6 A;  1EQV A;  1O7Z A;  5DNF A;  1SYD A;  3TN2 A;  2O5I C;  4BY7 H;  2GA4 B;  2OTL A;  2H1E A;  1CA6 A;  1IW7 D;  1EEF D;  4DAV A;  2R7Z B;  3I3C A;  3DWP A;  1DZ1 A;  5C3E B;  1H9S A;  4A3K H;  4DAY B;  5J1Z A;  1YI2 A;  1FD7 D;  5I9P A;  1I94 L;  1FGU A;  4A3D G;  4IUN A;  4XXE A;  3U58 A;  1RD9 D;  1XNR L;  1RHP A;  1W6J A;  1ICF B;  2F52 A;  3NTK A;  1L0W A;  2ZXP A;  2CQA A;  4A3F B;  1O80 A;  1OXU A;  2ZTD A;  1EUJ A;  3SK8 A;  3HG9 A;  1YIT A;  4ZYS A;  1JOO A;  1PH6 A;  1IBL L;  3BZD B;  1EIY B;  4IUV A;  2R93 H;  2CCZ A;  1X6O A;  2ZJR A;  2CVR A;  3BU2 A;  1VQO A;  4JV5 Q;  3PO2 B;  4K6D A;  4DR7 Q;  2WV6 D;  4C2M B;  4DV6 Q;  1WTX A;  4Y52 H;  1X3P A;  2I5M X;  1DXM A;  2KBN A;  3CMA A;  5K36 H;  1S5C D;  2K7V A;  4HED A;  5LMN L;  1SEB D;  3BZK A;  3RUZ A;  3J81 i;  2E2I H;  1O7I A;  2E74 C;  1CHQ D;  2JA6 H;  1VQC A;  4KHV A;  2CFM A;  2RCF A;  3GTJ H;  4A3J B;  1MSH A;  5JEA G;  3FEW X;  5EJW A;  5GQO A;  1Q46 A;  4X3T A;  4ABN A;  4CKC A;  3PUY A;  3KF8 A;  1H9S B;  2D0O A;  2VNU D;  4OWX B;  3SK5 A;  3A5Z B;  4FDB A;  2D5D A;  1HRJ A;  1QB5 D;  4JI0 Q;  3CRL C;  4FXK C;  1YEZ A;  1ENF A;  3QO2 A;  4WOR A;  5EKI A;  2B2U A;  4C3I B;  4GNX C;  2HQE A;  5C44 B;  3CAM A;  1MKH A;  4KD3 A;  3J80 i;  4BA1 I;  4FXD A;  1ML0 D;  3EA6 A;  1BXT A;  3DUZ A;  3WOE A;  1L0X B;  2F0H A;  2BDN A;  5K5P A;  2VW9 A;  5E7N A;  2QF7 A;  2HQL A;  3CCE A;  1WCM G;  3H15 A;  3CCQ A;  1B50 A;  1D7Q A;  1VQD A;  3G7L A;  4JI8 Q;  5C4X H;  1KLU D;  3K5O A;  4J8Q A;  2NUC A;  1LT5 D;  3TP7 A;  5IGC A;  3KJO A;  2KHS A;  3L9A X;  1SJH D;  3A56 A;  1LUZ A;  1NJI C;  1SMX A;  1VMP A;  2BH2 A;  2EY6 A;  2PNR C;  3C3L A;  5TSS A;  4A3I H;  3KF8 B;  4TSS A;  4LF4 Q;  1EY6 A;  3N52 A;  3FKI B;  3CF5 A;  3Q6S A;  3HZX A;  1D1K A;  1JOK A;  3J81 j;  4PZ7 A;  5FO8 B;  3VYT A;  1VF5 C;  1Y1V G;  1IKM A;  2UUB L;  1GM5 A;  2ZXO A;  5D14 A;  1SRU A;  1XNQ L;  3DWQ A;  1L1O B;  4PMC A;  2M2L A;  2NVQ H;  2MUY A;  4KN7 C;  2WAQ B;  2MFI A;  3G71 A;  1AE3 A;  3H0G H;  5ELF A;  1I94 Q;  3WWV A;  4FO2 A;  4EQO A;  2Z9H A;  5LMN W;  1LAB A;  2YU9 B;  2JN4 A;  4JBJ A;  3PUW A;  1XNR Q;  2B63 B;  1PYB A;  3A55 A;  2JA9 A;  1GUW A;  1K0S A;  3TSS A;  5IYD H;  1UUP A;  1HZA A;  1TWF B;  2XWJ B;  5C0X I;  4IAL A;  2IL8 A;  4JG2 A;  4BXX G;  2A69 D;  1ASZ A;  1G2S A;  4K8I A;  3CC7 A;  4FF1 A;  4JBK A;  1EY0 A;  1AEX A;  1TVX A;  1DM0 B;  2HUG A;  3FVQ A;  3I4M H;  4JI4 L;  3I2Z A;  4K8J A;  5H1S E;  3FP9 A;  2CW0 C;  3LWU A;  1GJX A;  3J7A F;  4PV1 C;  1RF2 D;  3NK9 A;  2JA5 G;  3PO3 H;  1YHQ A;  1TII D;  1UEB A;  4BBR G;  3HKZ G;  4H7B A;  2IT1 A;  4QB4 A;  5KYL A;  3F2C A;  2UXB Q;  2O5J C;  4LF8 Q;  2NN6 G;  1QJO A;  4L6T B;  1MI2 A;  3GD7 A;  4JPB W;  1SRO A;  2BOS A;  2UU9 L;  4RGN A;  2B2V C;  3PGZ A;  1V1O A;  2B39 A;  2FJ2 A;  5I2X A;  3I73 A;  4X66 L;  3CME A;  1UEA B;  3MFG A;  4A3L G;  2E75 C;  1SE3 A;  2ZM6 L;  4RFB A;  4DK0 A;  4QQB X;  5IGB A;  1A63 A;  4A3D B;  1NMG A;  1TY0 A;  3AFP A;  3S1Q H;  1Z7T A;  4R4I A;  5AJ3 L;  1YJ9 A;  1K8A C;  3E3X A;  4GNX A;  1H9K A;  4X62 L;  1SNC A;  3R2T A;  3J7A 5;  2A73 B;  3ND8 A;  1TWH B;  2PI2 A;  3GTP B;  1XWE A;  5IP7 G;  3OIQ A;  1X32 A;  2PPB C;  4CDD C;  5LL6 X;  4HIM A;  1VMC A;  2A8V A;  3BS1 A;  4IPG A;  3S1M B;  1FL0 A;  1VQL A;  1IBK L;  4C1N I;  5GAE C;  2HT1 A;  2LXJ A;  5KNB A;  1Y8N B;  1KXL A;  3EIV A;  1X3F A;  3EFX D;  4JBM A;  1UE5 A;  1ONL A;  4GLV B;  2OQ0 A;  3NBH B;  3A7A B;  2N49 A;  4G7H C;  3ZYY X;  5IP9 H;  2WIN B;  2YV5 A;  2JA8 G;  3H3V I;  1HJP A;  1SYB A;  2L15 A;  3JAM i;  1KLG D;  2NWG A;  1M4V A;  2A68 D;  2FIN B;  4DNR B;  5C0X H;  5L37 A;  5C4J B;  2ES2 A;  3A5U A;  1BUV T;  4GLX A;  2UUB Q;  2K05 A;  1PTO C;  1XNQ Q;  3GTO B;  3R2I A;  2PNH A;  1ZEQ X;  2RDH A;  4UDU C;  4GNX B;  1BOS A;  2DY8 A;  4JCV E;  2EZV A;  2OT2 A;  1XMO L;  1VQP A;  4RCO A;  1Y1W G;  1CK1 A;  5BR8 Q;  2EYO A;  1EZ6 A;  1PHJ A;  4IN3 A;  5JOB A;  1TWG B;  4V19 0;  3QB3 A;  2I5L X;  1JE4 A;  4BA2 I;  1Q8K A;  3KLW A;  4EVO A;  5ELD A;  3A0J A;  5EPL A;  1WCM B;  3ULP A;  1NMF A;  1RTO A;  1J8I A;  4YCV A;  1E3P A;  1AE2 A;  2SEB D;  3P1H A;  4DV1 L;  5T1G A;  3RLO A;  4P73 A;  2R7F A;  4UHV A;  1YVC A;  4JI1 L;  4XTC S;  3BZC A;  2AUJ D;  2KUM A;  1HFG A;  4GN4 B;  3HOU G;  3M4Q A;  1JCK B;  4APV A;  1EY5 A;  1E0B A;  2KQ3 A;  4HJ9 A;  2Z6K C;  3DM1 A;  4BWG B;  4NMZ A;  4A4I A;  4L5S A;  3S2H B;  5IGG A;  1JR0 D;  1TKW B;  3K0X A;  5GAG C;  4FNF A;  5NUC A;  1WTW A;  3HOV H;  1B53 A;  1HR0 W;  5GRO A;  1JWS D;  1Y14 B;  1Y1V B;  4U67 3;  1MD2 D;  1F9P A;  3CCS A;  1R9T H;  4EGV A;  4FF4 A;  2B2V A;  1AH9 A;  4L63 B;  2YTY A;  4KKS A;  4X66 Q;  3AYH B;  2SNS A;  2WII B;  1VQ4 A;  1OTC A;  1JJG A;  2ZM6 Q;  1J5E L;  1K8G A;  1B70 B;  1X54 A;  1ROD A;  4A3B G;  1TR5 A;  5GAD C;  3S15 B;  2HCI A;  2XGT A;  3QIA A;  2VY3 A;  1QVF A;  5I9O A;  4M1U B;  2NVT H;  4K6L A;  1CHP D;  2XRS D;  1PFM A;  1PRT F;  1U4L A;  1V43 A;  3G48 A;  1IYU A;  1SND A;  2OCE A;  1EQT A;  1PTO F;  3C1F A;  2R92 G;  3D4R A;  1P16 A;  4TQU S;  2EIF A;  4A76 A;  2DNE A;  3A54 A;  3M3Y H;  4GZY C;  2XVS A;  1PVO A;  2F0S A;  4BS9 A;  1S5D D;  1XMQ L;  4Q0F A;  1WYD A;  1IBK Q;  2WB1 G;  3BVM A;  4LUO A;  1SJE D;  4ODG A;  1PH4 A;  3ULL A;  5A35 A;  2B2Y A;  4HTH A;  2JA5 B;  3CP0 A;  2PMZ B;  3CPW A;  2EQS A;  2GN5 A;  4BBR B;  3TP6 A;  3HKZ B;  4LFB L;  4H13 C;  3GTG B;  1YHA A;  3G4S A;  3VYS A;  1I50 B;  2NYZ D;  3Q23 A;  3Q0A A;  1IL8 A;  2PQE A;  1R4Q B;  4AH6 A;  2MNA A;  1HUN A;  1VDZ A;  3FRP B;  4YHH L;  2EXD A;  4DR5 L;  1UE6 A;  1M8A A;  2B8G A;  2DN8 A;  3M4O H;  1EWI A;  5C6A A;  3UE0 A;  1Y8O B;  2AUK A;  2JK8 A;  3RLF A;  1I4G A;  4BY7 G;  1BBX C;  4DGZ A;  1ET9 A;  3R93 A;  3HRZ C;  1LTA D;  2NVX H;  5C0X J;  4QJF A;  2PZW A;  2F0Q A;  1A6X A;  3UE1 A;  4A3K G;  4RGT A;  3TRZ A;  1XMO Q;  3I7F A;  3IL8 A;  3T1Y L;  1STB A;  5JAV A;  4AQY L;  2A6E C;  4A3M H;  4DV7 L;  1EY4 A;  3PMF A;  4MIU A;  1D6E C;  1DOK A;  4JI5 L;  3URY A;  2BCO A;  2FFK B;  1BBW A;  1VQE A;  4MHE A;  4HMJ A;  3U50 C;  5EBC A;  2R93 G;  2A1A A;  4C3J H;  1FNV A;  5ELB A;  5KIX A;  2HCC A;  4G7O C;  1A3V A;  4DV1 Q;  1GUO A;  5KYI A;  4JVZ A;  3CC4 A;  2PI2 E;  4LK1 C;  1LTL A;  5K36 G;  2F0L A;  1JOR A;  1PDQ A;  5M9O A;  5CR3 A;  2Y0S G;  4IQZ A;  3EJI A;  3CKI B;  2K5Q A;  2MHV A;  2JA6 G;  3DXJ C;  2JA8 B;  3KJP A;  1XPO A;  1CM9 A;  1SYC A;  1SDF A;  2Z6K A;  3TRE A;  2DY7 A;  2K5V A;  4KK7 A;  1PRT B;  2VQE L;  1QIL A;  5LL6 S;  2CW0 D;  3G6E A;  3HOX H;  3CC2 A;  5FO7 B;  3W1B A;  1K73 C;  3VYU A;  2B3G A;  3P75 A;  1X56 A;  4DF7 A;  4DN4 M;  2F0O A;  1HZC A;  3SDZ A;  1GUS A;  3MC0 B;  4NXN Q;  1J5E Q;  3RZO H;  1STH A;  5IT9 L;  1TU2 B;  4G57 A;  4O42 A;  3GV6 A;  1C8C A;  1Y1W B;  1JT8 A;  3PIO A;  1L1O C;  2VS1 A;  3MAQ A;  4LJZ C;  4DR4 Q;  3P20 A;  1IZ6 A;  4X64 L;  4OXP A;  4CDC C;  2AQ3 B;  1FNU A;  3S16 H;  3EQL C;  2B2W C;  3BYT B;  3OPO A;  1N32 L;  1PFS A;  1FVI A;  1SE4 A;  2A74 C;  2CH4 A;  3HGB A;  1YNN C;  1LAC A;  1QZH A;  4DAY A;  2ZT9 C;  4KLK A;  3PUZ A;  1YJW A;  2E2D C;  4OEM B;  4XQJ A;  2G9H D;  3RN5 A;  4DR6 L;  4FF2 A;  1GOZ A;  1UAP A;  2K14 A;  5IYC G;  1XMQ Q;  4YWL A;  4J1M A;  3HOU B;  4JYA Q;  2F4I A;  2Z4H A;  4CBV A;  4Z9C B;  5FLX L;  1VQF A;  3T13 A;  3M7N A;  1ZKO A;  3I56 A;  3RZD B;  3OW2 A;  2JEB I;  4FF3 A;  1MJC A;  1PH5 A;  3Q24 A;  3RNU A;  3AEV A;  4LFB Q;  4CKB A;  1G6P A;  4A3I G;  1PV4 A;  1TS3 A;  2EYM A;  3OW7 A;  2LMC B;  3T53 B;  2JJQ A;  4YHH Q;  1H9R A;  4DR3 Q;  4DUZ L;  4JI6 L;  2AQ1 B;  3PO2 H;  2VB3 X;  1JJ2 A;  3R3O A;  1DYQ A;  4H02 A;  2I5H A;  5C4H A;  3GTK H;  3J7A V;  2J7Z A;  4N8F A;  2PMZ E;  2M00 A;  3CCJ A;  3HKZ E;  1JJC B;  2DJF C;  3I72 A;  1SE2 A;  2EYF A;  2AHO B;  3AQQ A;  4A3B B;  1PMR A;  3K7A B;  3H0G G;  1YBY A;  1ZYR C;  3T1Y Q;  2QEX A;  2ICE C;  3ND9 A;  4GLA C;  4IUU A;  2RA4 A;  4DV7 Q;  1PRT D;  3VA7 A;  4CJ0 B;  4JI5 Q;  4E6I A;  2B2T C;  4DUY L;  3CU7 A;  1KRS A;  1PTO D;  2R92 B;  5IYD G;  5IWA L;  1E22 A;  3K6O A;  2L11 A;  2XRQ D;  4IO9 A;  1BKB A;  4IUR A;  1N36 L;  2OF1 A;  4Y7N B;  2V1C C;  2CWP A;  3TEH B;  4B3S L;  5J3B A;  1F2Z A;  1YNJ C;  4OIK A;  3ICE A;  3W5O A;  1V1P A;  1TWA B;  3DEO A;  1PH3 A;  2WB1 B;  1DJR D;  1SN8 A;  2B8F A;  3I4M G;  4C3I H;  3PIO 3;  2F0U A;  3ERQ A;  2E76 C;  4MZ9 A;  4B9X A;  1C0A A;  1RDP D;  1C4Q A;  1KNA A;  4POG A;  1XX8 A;  2K04 A;  1LM0 A;  3B6Y A;  3SE0 A;  3IFT A;  2JE6 I;  2BDO A;  1H9M A;  1W3S A;  4LNQ A;  4MN3 A;  3K0Y A;  2Z0S A;  3SK4 A;  2IX1 A;  3KOJ A;  2JA7 H;  4UP9 A;  1Z9F A;  5EPJ A;  2EYP A;  4BY7 B;  1GHJ A;  2MQH A;  2BH8 A;  5JJL A;  3F2U A;  3S14 B;  4A3K B;  3STB C;  1KTK A;  3MEH A;  3F1Z A;  5CYU A;  1Z47 A;  4K5X A;  4GKJ L;  5A2Q L;  2N3S A;  1KAW A;  2F0F A;  4X65 L;  1L1O A;  1N32 Q;  3ZJY C;  1V1P B;  1Z6H A;  2B2W A;  3E0E A;  4DV2 L;  4WJ3 M;  1ENA A;  3UDG A;  3CRK C;  4DNI A;  5DAU A;  3U9O A;  2E2J H;  4V0B A;  4DR6 Q;  3AU7 A;  1K83 H;  2NVY B;  4I7A A;  1EYA A;  2K5W A;  4KY5 A;  1K28 A;  4EQP A;  2LXK A;  1JC7 A;  2E2I B;  2KA7 A;  4KD4 A;  2Y0S B;  3LX0 A;  4AYB E;  1C7Y A;  4B3T L;  1N8R C;  2K33 A;  4DAP A;  2JA6 B;  2F0P A;  1WTQ A;  2UXD Q;  2NTT A;  3GTJ B;  1C9O A;  5IP9 G;  1HNZ Q;  1BCP B;  1QNK A;  1NBW A;  4HJA A;  4OO1 H;  1TWF H;  3KUP A;  4DV4 L;  1GVP A;  3DLL A;  4HSP A;  3W1G A;  3WDN A;  4NXM L;  5C4Z A;  1RCV D;  5KEE A;  1TWC H;  4JI6 Q;  4DUZ Q;  1OO9 B;  4OWW B;  5C0X G;  1J6Q A;  1VS0 A;  1H95 A;  2QW7 A;  4A3C H;  4PMW A;  1EY9 A;  1CQF A;  3S1N B;  1NE3 A;  3S2D H;  3I8Z A;  5F2D A;  5FOB B;  3K5N A;  1I3Q H;  5FJ8 H;  1LT6 D;  1U4R A;  3GTM B;  3TP8 A;  4P72 A;  4UP7 A;  1PH8 A;  1DCZ A;  4R9W A;  3LNN A;  1A0I A;  4LF5 L;  4P74 A;  4QMG A;  5M3F H;  1YJN A;  5CGK A;  1K3R A;  5IGD A;  4BY1 B;  2M9V A;  5IWA Q;  1TQO A;  3F2D A;  3BDC A;  1SAP A;  2B2T A;  2KCC A;  2YYZ A;  2AQ2 B;  3MXN B;  2WP8 J;  1N36 Q;  3VDY A;  1IBL Q;  2O4X A;  4B3S Q;  1G2T A;  5GAH C;  1CZW A;  2A6E D;  1SNQ A;  1JWU D;  1DD2 A;  1PZJ D;  3VA5 A;  1SLJ A;  3KBG A;  1UNS A;  4A3E H;  1JIC A;  1SMY C;  4IPH A;  1NR4 A;  4A93 H;  1VQH A;  4LUZ A;  5LMN Q;  3K7U C;  3PUX A;  1EQQ A;  1B3A A;  2HIX A;  5EBD A;  4A3I B;  3KLS A;  1F9Q A;  2F4V L;  1S5E D;  1WD0 A;  3JC6 6;  4HJ7 A;  2H5X A;  3GTP H;  2RF4 A;  2XWB B;  3HOV G;  3S17 H;  3U9S A;  2WB1 E;  4OHJ A;  2KEC A;  2PQA A;  2JP1 A;  1HHV A;  2KCT A;  3NBH A;  4JI2 L;  3C2P A;  4Q5V A;  4DK3 C;  2F0I A;  1PZK D;  3H0G B;  1IYV A;  3K5M A;  4K0K L;  4HIO A;  4R4T A;  4YWM A;  3BVZ A;  3HOZ H;  4OX9 L;  2JXM B;  4X65 Q;  3D8G A;  2RHS B;  1PFB A;  1HZ9 A;  1G6Z A;  2TMP A;  1JOQ A;  1E2Z A;  4C3H H;  2E2H H;  3A74 A;  2E5L L;  1VQ7 A;  2KEN A;  4DV2 Q;  3H3V C;  2Z4I A;  1HR0 L;  3GTL H;  4NW2 A;  4CJ2 C;  4DV0 L;  3DEP A;  2B2Y C;  1XYI A;  3G6J B;  1SBB B;  2G9D A;  1SFO H;  1YNN D;  2L5T A;  2IHE A;  2HIV A;  5JJI A;  1B1Z A;  1QZG A;  1UWV A;  4B3T Q;  1DON A;  2EYH A;  2PQA B;  4RKL A;  1TWG H;  3VR6 A;  3J7Y W;  3TS2 A;  3MXG A;  2RBM A;  2Z8L A;  4UAI A;  4DV4 Q;  2E8G A;  1LV9 A;  2Z6B A;  4NXM Q;  1ICW A;  4JBW A;  1HUM A;  3ERO A;  4DV5 L;  1Q12 A;  1DOM A;  4UP8 A;  5M3M G;  1FR3 A;  1C48 A;  1Y69 U;  1RIP A;  4A3G H;  1PRT C;  1SE8 A;  3A8J E;  3RMH A;  4KV6 A;  3BG3 A;  1D5X C;  1TY2 A;  1IL2 A;  4XIG S;  4JI3 L;  2PZT A;  1KIX A;  2K32 A;  2OWO A;  3S1Q B;  4DAM A;  2F3W A;  1K8M A;  1JE5 A;  4LWC A;  2KCN A;  4A3M G;  4RGO S;  5CBE E;  3DMU A;  2IX3 A;  4UPA A;  3UDI A;  4PMB A;  2BA0 A;  5IT9 E;  1STE A;  4IFD I;  4KMU C;  3J81 L;  1DGS A;  1U0L A;  1F2Y A;  4TVA B;  2L0C A;  1HA6 A;  1TXY A;  2WAQ E;  1ZYR D;  3GQB A;  3NUC A;  4ZQ3 A;  4C3J G;  4HID A;  1WTR A;  1AZQ A;  1X3G A;  4OGQ C;  3CCV A;  4QF4 A;  3HP3 A;  1GO3 E;  1K0R A;  1QUQ B;  3VYR A;  1STA A;  2KOL A;  4JI4 Q;  1M90 C;  1KDA A;  1EFI D;  5E4X A;  1EIF A;  3L0O A;  3GP7 A;  1E24 A;  2BE5 C;  1YNJ D;  2EJG C;  1EYC A;  2R6G A;  3NP8 A;  4JOI A;  3E6Z X;  3HOW H;  1Q90 A;  2EJM A;  4G4K A;  3N6R A;  1CSQ A;  2UU9 Q;  4JI2 Q;  4IZ8 A;  2F0J A;  2RSO A;  3J80 L;  1BR9 A;  4OWT B;  3K58 A;  2JA5 H;  2PO4 A;  1B9M A;  4K0K Q;  3GTG H;  1VQA A;  5C3W A;  1QOH A;  3GTQ H;  1I50 H;  4OX9 Q;  2NN6 H;  2H4O A;  2K52 A;  3MVV A;  2VUM H;  2Q2H A;  5AJ3 Q;  2K50 A;  4XT1 B;  3NSW A;  1VQ6 A;  1I4X A;  4U68 A;  5I6W A;  2PW7 A;  3MWY W;  2Q8I B;  4X62 Q;  3T1H L;  1WTV A;  2E5L Q;  4JI7 L;  4XT3 B;  4B08 A;  5JJZ A;  3D4D A;  1K9M C;  1HR0 Q;  3RR5 A;  3STB D;  4P71 A;  5D3D A;  1PYW D;  3M7G A;  4A3L H;  1Q8I A;  3GO5 A;  2K28 A;  4GOP B;  2L1B A;  2SDF A;  2UXC L;  3OMG A;  5M5X H;  3W3A A;  3KDF A;  2PW5 A;  1HNX L;  3S1R B;  1JB7 A;  5DLQ E;  1VQN A;  5M5W B;  5EKL A;  3NXW A;  4BBS H;  3SHL A;  4EQN A;  1TS4 A;  2EY5 A;  1TS5 A;  4YWK A;  4R4O A;  1J9O A;  3HOV B;  1B4O A;  1E7Z A;  2A6H C;  4RA8 A;  5HGT A;  4IFD H;  4DV5 Q;  3PO2 G;  4MNO A;  2JSO A;  3CQZ H;  1X55 A;  3R8B A;  4OIJ A;  4ZLT F;  2HDM A;  3NEL A;  1N34 L;  1EWC A;  2QDL A;  3OYY A;  3QG1 A;  3VR5 A;  5IGF A;  1U4M A;  3MA2 B;  1FYC A;  4JI3 Q;  3HEJ A;  5M5Y H;  3T56 B;  1STN A;  3KYH C;  2N78 A;  2CKZ B;  3IRB A;  2EE1 A;  2NVT B;  4FP5 D;  3MEF A;  5HY6 A;  4B3M L;  4HAE A;  3UDX A;  1XTD A;  1PTO H;  4IUT A;  5LHY 1;  5HUR A;  3KDF B;  4RWS C;  2D62 A;  1OXS C;  5A2Q E;  1I6V C;  5CV7 A;  2AMC B;  5ELN A;  4FVM A;  1F9S A;  4YCW A;  4JI1 Q;  3IKJ A;  1CKM A;  1HCZ A;  1V9P A;  4C3I G;  2HDL A;  2DNC A;  5IY0 A;  1CTM A;  2VL6 A;  1VQJ A;  4QY7 A;  4AIM A;  1D5Z C;  5DM7 3;  5KRU A;  1WVL A;  3HOY H;  1QVG A;  5IT9 c;  3I4N H;  4OON A;  3M4O B;  4DR7 L;  4LFC L;  1UE7 A;  4DKA C;  3RN2 A;  1SMY D;  5M3M B;  2KHJ A;  1BCP C;  4CDE C;  1JMC A;  2JA7 G;  3NPP A;  4DK1 A;  2VXW A;  3MFY A;  2DUD A;  1CSP A;  1LT4 D;  2NVX B;  3I91 A;  3TS0 A;  3SXH A;  4N9T A;  4IPC A;  1N9W A;  1WI5 A;  4QCL A;  3PV0 A;  3FHW A;  1YHB A;  5LMU L;  1LYL A;  5I4D A;  4QUF A;  4A3M B;  3CD6 A;  4DU9 A;  3NTH A;  3I4L A;  1FNW A;  2WKC A;  4R4Q A;  3ONA B;  4QIW B;  2FMM A;  2O2L D;  4NP5 A;  3SR1 A;  2ZJQ A;  4M8A A;  1PFN A;  3FPP A;  5COY A;  4RHR A;  3CCR A;  1DOL A;  2AWN A;  3T1H Q;  4GN5 A;  1XPR A;  3GV3 A;  1BVS A;  2J0T D;  1Q86 C;  1BDO A;  4S3S A;  3O13 A;  1T5E A;  5ELE A;  4R8N A;  3M85 A;  3S24 A;  3X3M A;  5C4X G;  2R7Z H;  1VQ5 A;  2UXC Q;  3PIP A;  3JAM L;  5C3E H;  3MXP A;  2J4X A;  3CW2 C;  2X6G A;  3PQI A;  1HNX Q;  3D0F A;  1EYD A;  3PCO B;  1SYE A;  1O7L A;  1U5K A;  2K75 A;  3ITP A;  4B9W A;  2Q8T A;  1VQM A;  3A7L A;  4A3F H;  3HS0 C;  3TP5 A;  3NEN A;  4TKO B;  4X3K A;  4OO1 G;  1CZG A;  2Z1C A;  1A2T A;  3H09 A;  4RMF A;  4DR5 Q;  2QEJ C;  4DA2 A;  2K5N A;  2K01 A;  4DV3 L;  3KFU A;  1TWA H;  4C2M H;  2RCN A;  3TBI B;  1MHW C;  4A3C G;  2K03 A;  2QDB A;  4IFD J;  1NY4 A;  3RZO B;  1MGS A;  5BN5 A;  1XTC D;  5JJK A;  1TT2 A;  1CA5 A;  5G3L D;  5FJ8 G;  3UDF A;  5C5M A;  1Q7Y C;  1N33 L;  3S16 B;  4CGY B;  4AQY Q;  3VR4 A;  1BCP F;  1I4R A;  3NHH A;  3H91 A;  1OXX K;  4LF9 L;  4B3M Q;  1ESR A;  1VQG A;  4A3J H;  5M3F G;  3EVQ A;  2CWA A;  5CV9 A;  4OO1 I;  4C56 C;  2JEA I;  2C9O A;  5IYB H;  3K80 C;  1I6H B;  4IUP A;  1ESF A;  5EQ0 A;  1CUK A;  1LLR D;  1EU3 A;  1S5B D;  2NB0 A;  5D3I B;  3S14 H;  1PH2 A;  2YTX A;  2HHH L;  4LW1 A;  3KLR A;  1AW7 A;  4WJW A;  2MJ8 A;  2FHT A;  1K8O A;  2UUC L;  1SNM A;  4KHP L;  1II3 A;  4A3E G;  2PZU A;  1RKN A;  4YCU A;  2WFW A;  1MBY A;  4POF A;  4A93 G;  1JB3 A;  5C44 H;  4KN4 C;  2RDG A;  1O7Y A;  4KY7 A;  1RJT A;  4L5R C;  2L9H A;  5FLM H;  5AFW A;  5EGT A;  4JC0 A;  3PO3 G;  1EZ8 A;  2IX0 A;  3NWS A;  3MTS A;  1GXD C;  4F87 A;  4L5T A;  2IW3 A;  5JVH 3;  1S4Z A;  4R8I A;  4KKT A;  1E1O A;  2F0V A;  4H44 C;  2D0P A;  5I2Y A;  1HH2 P;  4LFC Q;  4ZK9 B;  3GTK B;  2VQE Q;  1STY A;  1S3O A;  2NVY H;  2Q2U A;  1EOV A;  4DXG A;  3OHX C;  1HNW L;  3VR2 A;  1S5F D;  3TQY A;  1NTG A;  4PZ8 A;  3QOJ A;  5J39 A;  2BE5 D;  3PIP 3;  4HJ8 A;  1M1K C;  1XXG A;  4K14 A;  4QUC A;  3UI2 A;  3TZD A;  2LKV A;  2UXB L;  1B9N A;  2MO1 A;  5LMU Q;  1L2F A;  2F0G A;  3OWF A;  4HSV A;  4LF8 L;  3HOZ G;  1IHZ A;  1WTP A;  2VB2 X;  2SNM A;  4X64 Q;  2RSN A;  4WRD A;  3FKI H;  2PCF B;  1H9J A;  1BNZ A;  2OQK A;  3CCU A;  4C3H G;  2LS0 1;  5EKK A;  3F8T A;  1MJE A;  1EWH A;  4QGU A;  3FDT A;  3AB9 A;  3HFZ B;  2R93 B;  2C35 B;  1B7Y B;  4ME5 A;  3ULJ A;  1WFQ A;  3S1N H;  2F0N A;  5DEH A;  2JYO A;  2MO0 A;  2K4K A;  4QIW E;  1VQI A;  2RQX A;  3V96 A;  1E1T A;  4TRD A;  3U4Z A;  1PA6 A;  3GTM H;  1TS2 A;  3MXN A;  2HD3 A;  2YU9 H;  4RGM A;  3J81 E;  1I4P A;  2B63 H;  3QJY A;  4K2K A;  3QR8 A;  5E1F A;  2IJ0 A;  1SR3 A;  2FMC A;  4BY1 H;  2MPM A;  1L0Y B;  1EOT A;  1BF4 A;  1KNE A;  4F8M A;  1LTI D;  2QGQ A;  3GDE A;  4RHS A;  2L12 A;  2RDF A;  2NBF A;  4X3S A;  2UUA L;  1OXT A;  2JA7 B;  1NAP A;  5IYC H;  1Q1B A;  3M4P A;  3Q8D A;  4DV3 Q;  4A3G G;  3MZ5 A;  1KHI A;  1EEI D;  4IJH A;  3OTO L;  2IY5 B;  1A3U A;  3ERS X;  4QL5 A;  3D6W A;  1LT3 D;  3S9W A;  2F03 A;  3PSI A;  4HCS A;  2A6H D;  2K1B A;  3OOC A;  5JPN C;  1N33 Q;  1IBM L;  2IWH A;  1FJG L;  3DHQ A;  4IJL A;  4N9P A;  4LMQ D;  2L55 A;  4LF9 Q;  3J80 E;  4HMI A;  4ID6 A;  2JQO A;  4RCN A;  2NZO A;  4DUY Q;  1F77 A;  5CBA E;  1B8A A;  1F2L A;  2FXQ A;  3D31 A;  1NCV A;  3CPF A;  3D6C A;  5FO9 B;  2E2J B;  2WKD A;  2XSC A;  4NB3 A;  1KAB A;  1K83 B;  4ZAI A;  1LTB D;  1LTT D;  5KNC A;  4XYQ A;  4LUV A;  2HHH Q;  5C4X B;  3EN2 A;  2UUC Q;  4KHP Q;  5BR8 L;  2KHI A;  1YZ6 A;  1G29 1;  2NZ1 D;  1S40 A;  1PXU A;  1X65 A;  1VQK A;  4A3D H;  1G91 A;  2ZTE A;  1VQB A;  1VCI A;  4GOP C;  3ER0 A;  2R3Z A;  4O1N A;  3I55 A;  2I07 B;  4P2C B;  4B3R L;  2F0W A;  1QG7 A;  3NQI A;  1ASY A;  1PH9 A;  1TWC B;  4JOI C;  1U4P A;  1TWH H;  3DM3 A;  1VF7 A;  1K3B C;  4F88 A;  4J6H A;  4N8X 1;  2X6L A;  2F1M A;  3HOW G;  4OEL B;  1HXY D;  2NTS A;  1YIJ A;  4NKL A;  4P75 A;  3S1M H;  2XNA C;  1HNW Q;  1P8L A;  2NVQ B;  4RAU C;  5IGE A;  3S2D B;  3QOL A;  4IUQ A;  1NUC A;  1I3Q B;  1EU4 A;  4G7Z C;  4KKU A;  4DNT B;  5E4W C;  1HQR D;  1QNU A;  4HIK A;  4K2L A; 
#chains in the Genus database with same CATH homology
 3OMC A;  5BN3 A;  1CI3 M;  1AN8 A;  1BCP D;  4PQX A;  4WFN 3;  1CFM A;  3I90 A;  5M3F B;  5JEA H;  3D4W A;  2N88 A;  3V05 A;  2X69 A;  3LWE A;  1EY8 A;  4C1N K;  3NTI A;  3KLS X;  4A3E B;  5CV8 A;  3I4M B;  3I70 A;  5ISR A;  3Q22 A;  4A93 B;  1HA5 A;  2D9U A;  3NBI A;  2PYK A;  4OL7 A;  3PO3 B;  2XIW A;  3RD4 A;  2NN6 I;  3IAY A;  1SYF A;  2MP1 A;  2N55 A;  3DWA A;  4JK1 C;  3S17 B;  1WTO A;  1QCB D;  4IFD G;  3C1E A;  3V2T A;  2CHB D;  1PZI D;  1A2U A;  1CT1 D;  1LTR D;  1IKL A;  1KDC A;  2KJX A;  3CHB D;  3OWE B;  4X3U A;  1WD1 A;  2EJF C;  3HOZ B;  1EIG A;  1I4Q A;  4ZKC B;  4KTA A;  2EOT A;  1IW7 C;  4NDX A;  4ILW A;  1ILQ A;  1LTG D;  3K57 A;  4C3H B;  2E2H B;  2EPB A;  3AMU A;  4ZUJ A;  1G8Z D;  3BDO A;  1X3Q A;  1HTP A;  1U9R A;  3GTL B;  2KEE A;  1I4H A;  3QWN A;  1O78 A;  2QKI C;  3MHB A;  2C5C A;  1CQV A;  3A8I E;  1HTL D;  1SFO B;  2ICI A;  2I46 A;  1ZXT A;  1F2M A;  1KAA A;  4XDX A;  1JQY D;  1HFN A;  3T4A C;  1W6K A;  2F0M A;  5IOC A;  1MSG A;  3OIP A;  5CV4 A;  3JAM E;  5FLX E;  3OSO A;  4A3G B;  4ZRZ A;  3TDQ A;  1D2B A;  4KJO A;  2QCP X;  4KHZ A;  1LTS D;  2K6A A;  2RKS A;  5G3L F;  5IOD A;  3FPU B;  5DM6 3;  3NWT A;  3X3N A;  5D65 A;  4I65 A;  3C46 A;  2ENB A;  1GUT A;  3KK7 A;  4ZUI A;  5KND A;  5ELC A;  3H6M A;  2F0K A;  5FK9 C;  5JEA J;  4HN7 A;  3IFD A;  2XN9 C;  2RVL A;  3K59 A;  1SNO A;  3L3O C;  1E2W A;  1HPC A;  4PNY A;  3TZU A;  4CKE A;  1RTN A;  1GUN A;  1Y8P B;  3NE5 B;  1B44 D;  3BYY B;  1Q1E A;  3P7J A;  3D3R A;  3HOW B;  1ENC A;  1STG A;  1PLF A;  3E0J A;  1R9T B;  3SVM A;  3M4Y A;  4KJN A;  4K5V A;  4XQQ A;  1AFP A;  2EDG A;  2EVB A;  2SOB A;  4RKB A;  5IIF A;  5C5L A;  3GTQ B;  4FYD A;  1EIH A;  2VUM B;  5CV5 A;  2AWO A;  2KED A;  1SYG A;  2K5D A;  3VR3 A;  4YIJ A;  1EL0 A;  3M3Y B;  3E5S A;  1LO5 D;  3T16 A;  1T5X D;  5C3X A;  3MXU A;  1JWM D;  1R4P B;  3H94 A;  3FMC A;  4CJ1 B;  5M5X B;  1SXT A;  2A69 C;  3BVG A;  2EYJ A;  2F0E A;  2V4D A;  1NSN S;  3L7Z C;  1F9R A;  5CV6 A;  4ULL A;  4BBS B;  1ILP A;  3BDL A;  5KGU A;  2EYL A;  2BA1 A;  4KI0 A;  5CMD A;  2A5H A;  1SNP A;  1NR2 A;  3CQZ B;  3KBX A;  1HQM C;  2F3V A;  5J22 A;  4HR7 B;  3TME A;  3A8K E;  1OXV A;  2R61 A;  1A15 A;  5BN4 A;  3NQT A;  3SK6 A;  5M5Y B;  1A3T A;  1ET6 A;  5COR A;  1B2T A;  2IPK D;  2OXP A;  4DFA A;  3T51 B;  4CHT B;  4LAA A;  1PTO B;  1D5M C;  2TSS A;  4XYO A;  3W2D A;  2ID0 A;  1GUG A;  4DXF A;  3WOF A;  2WAC A;  4XQN A;  1BO0 A;  1GHK A;  4ZKB B;  4C3J B;  2LY7 A;  2B2U C;  1SSO A;  4H0L C;  1FGB D;  3PUV A;  4KY6 A;  4FXG C;  2F0T A;  1AP0 A;  5T1I A;  1BQQ T;  1D1I A;  3HOY B;  5EPK A;  4AYB B;  4RH6 A;  5FKA C;  3I4N B;  5JVG 3;  4HCE A;  5E3F A;  1E2V A;  2OEO A;  1QWY A;  4I7Z C;  3HOX B;  1Q3L A;  2MGS A;  3K5L A;  2Q8R E;  1V8Q A;  2EY2 A;  5JPM C;  2A68 C;  2L4N A;  5CC4 A;  2QIL A;  2ZXR A;  4K5W A;  5I6Y A;  2KVM A;  2EXZ A;  2F0D A;  2LFN A;  4L8J A;  2EY1 A;  1AZP A;  4F7X A;  1KDB A;  2D2C C;  1EY7 A;  3SEB A;  1QE6 A;  1EQV A;  1O7Z A;  5DNF A;  1SYD A;  3TN2 A;  2O5I C;  2GA4 B;  2H1E A;  1CA6 A;  1IW7 D;  1EEF D;  4DAV A;  2R7Z B;  3I3C A;  3DWP A;  1DZ1 A;  5C3E B;  1H9S A;  5J1Z A;  1FD7 D;  5I9P A;  4IUN A;  4XXE A;  1RD9 D;  1RHP A;  1W6J A;  3NTK A;  2ZXP A;  2CQA A;  4A3F B;  1O80 A;  1OXU A;  3SK8 A;  3HG9 A;  4ZYS A;  1JOO A;  3BZD B;  4IUV A;  2CVR A;  3PO2 B;  4K6D A;  2WV6 D;  4C2M B;  1WTX A;  1X3P A;  1DXM A;  5K36 H;  1S5C D;  2K7V A;  4HED A;  1SEB D;  3RUZ A;  2E74 C;  1CHQ D;  4KHV A;  4A3J B;  1MSH A;  5JEA G;  3FEW X;  5EJW A;  4X3T A;  4ABN A;  4CKC A;  3PUY A;  3KF8 A;  1H9S B;  2VNU D;  3SK5 A;  2D5D A;  1HRJ A;  1QB5 D;  3CRL C;  4FXK C;  1ENF A;  3QO2 A;  4WOR A;  5EKI A;  2B2U A;  4C3I B;  2HQE A;  5C44 B;  4KD3 A;  4BA1 I;  4FXD A;  1ML0 D;  3EA6 A;  1BXT A;  3DUZ A;  3WOE A;  1L0X B;  2F0H A;  2BDN A;  5K5P A;  2QF7 A;  1B50 A;  3G7L A;  1KLU D;  3K5O A;  4J8Q A;  2NUC A;  1LT5 D;  3TP7 A;  5IGC A;  2KHS A;  3L9A X;  1SJH D;  3A56 A;  1VMP A;  2EY6 A;  2PNR C;  3C3L A;  5TSS A;  4TSS A;  1EY6 A;  3N52 A;  3FKI B;  3Q6S A;  3HZX A;  1D1K A;  1JOK A;  5FO8 B;  3VYT A;  1VF5 C;  1IKM A;  2ZXO A;  5D14 A;  3DWQ A;  4PMC A;  2M2L A;  2MUY A;  4KN7 C;  2WAQ B;  5ELF A;  4FO2 A;  4EQO A;  2YU9 B;  1LAB A;  3PUW A;  2B63 B;  3A55 A;  1GUW A;  3TSS A;  1UUP A;  1TWF B;  2XWJ B;  5C0X I;  4IAL A;  2IL8 A;  2A69 D;  1G2S A;  4K8I A;  4FF1 A;  1EY0 A;  1AEX A;  1TVX A;  1DM0 B;  2HUG A;  3FVQ A;  4K8J A;  2CW0 C;  3LWU A;  1GJX A;  3J7A F;  4PV1 C;  1RF2 D;  3NK9 A;  1TII D;  4QB4 A;  4H7B A;  2IT1 A;  5KYL A;  2O5J C;  2NN6 G;  1QJO A;  4L6T B;  1MI2 A;  3GD7 A;  2BOS A;  4RGN A;  2B2V C;  1V1O A;  2B39 A;  2FJ2 A;  5I2X A;  3I73 A;  1UEA B;  3MFG A;  2E75 C;  1SE3 A;  4RFB A;  4DK0 A;  5IGB A;  4A3D B;  1TY0 A;  1Z7T A;  1H9K A;  1SNC A;  3R2T A;  2A73 B;  3ND8 A;  1TWH B;  3GTP B;  1XWE A;  3OIQ A;  1X32 A;  2PPB C;  5LL6 X;  1VMC A;  3BS1 A;  3S1M B;  4C1N I;  5KNB A;  1Y8N B;  3EFX D;  1ONL A;  3A7A B;  4G7H C;  3ZYY X;  2WIN B;  1SYB A;  1KLG D;  2NWG A;  1M4V A;  2A68 D;  2FIN B;  4DNR B;  5C0X H;  5C4J B;  1BUV T;  2K05 A;  1PTO C;  3GTO B;  3R2I A;  1ZEQ X;  2RDH A;  4UDU C;  1BOS A;  2DY8 A;  2EZV A;  2OT2 A;  4RCO A;  1CK1 A;  2EYO A;  1EZ6 A;  4IN3 A;  5JOB A;  1TWG B;  4V19 0;  3QB3 A;  1JE4 A;  4BA2 I;  4EVO A;  5ELD A;  5EPL A;  1WCM B;  1RTO A;  1J8I A;  2SEB D;  3P1H A;  5T1G A;  4XTC S;  2AUJ D;  2KUM A;  1HFG A;  1JCK B;  1EY5 A;  1E0B A;  2KQ3 A;  3DM1 A;  4BWG B;  4NMZ A;  3S2H B;  5IGG A;  1JR0 D;  1TKW B;  4FNF A;  5NUC A;  1WTW A;  1B53 A;  1JWS D;  4U67 3;  1Y1V B;  1MD2 D;  1F9P A;  4EGV A;  4FF4 A;  2B2V A;  4L63 B;  4KKS A;  2SNS A;  2WII B;  1ROD A;  1TR5 A;  3S15 B;  2HCI A;  3QIA A;  5I9O A;  4M1U B;  4K6L A;  1CHP D;  2XRS D;  1PFM A;  1PRT F;  1U4L A;  1V43 A;  1IYU A;  1SND A;  1EQT A;  1PTO F;  3C1F A;  3D4R A;  4TQU S;  2DNE A;  3A54 A;  4GZY C;  2XVS A;  2F0S A;  4BS9 A;  1S5D D;  4Q0F A;  3BVM A;  4ODG A;  1SJE D;  5A35 A;  2B2Y A;  4HTH A;  2JA5 B;  2PMZ B;  4BBR B;  3TP6 A;  3HKZ B;  4H13 C;  3GTG B;  3VYS A;  1I50 B;  2NYZ D;  3Q23 A;  3Q0A A;  1IL8 A;  2PQE A;  1R4Q B;  1HUN A;  1VDZ A;  3FRP B;  1M8A A;  2B8G A;  2DN8 A;  5C6A A;  1Y8O B;  2AUK A;  3RLF A;  1I4G A;  1BBX C;  4DGZ A;  1ET9 A;  3R93 A;  3HRZ C;  1LTA D;  5C0X J;  2PZW A;  2F0Q A;  1A6X A;  4RGT A;  3IL8 A;  1STB A;  5JAV A;  2A6E C;  1EY4 A;  3PMF A;  4MIU A;  1D6E C;  1DOK A;  3URY A;  2BCO A;  2FFK B;  4MHE A;  4HMJ A;  5EBC A;  1FNV A;  5ELB A;  5KIX A;  2HCC A;  4G7O C;  1A3V A;  1GUO A;  5KYI A;  4LK1 C;  5K36 G;  2F0L A;  1JOR A;  1PDQ A;  5M9O A;  5CR3 A;  4IQZ A;  3EJI A;  3CKI B;  2K5Q A;  2MHV A;  3DXJ C;  2JA8 B;  1CM9 A;  1SYC A;  1SDF A;  2DY7 A;  4KK7 A;  1PRT B;  1QIL A;  5LL6 S;  2CW0 D;  5FO7 B;  3VYU A;  3P75 A;  4DF7 A;  4DN4 M;  2F0O A;  3SDZ A;  1GUS A;  3MC0 B;  1STH A;  5IT9 L;  1TU2 B;  4G57 A;  4O42 A;  3GV6 A;  1C8C A;  1Y1W B;  3MAQ A;  4LJZ C;  3P20 A;  2AQ3 B;  1FNU A;  3EQL C;  2B2W C;  3BYT B;  3OPO A;  1SE4 A;  2A74 C;  3HGB A;  1YNN C;  1LAC A;  4DAY A;  2ZT9 C;  3PUZ A;  2E2D C;  4XQJ A;  2G9H D;  4FF2 A;  1GOZ A;  1UAP A;  4J1M A;  3HOU B;  2F4I A;  2Z4H A;  4CBV A;  4Z9C B;  5FLX L;  3M7N A;  3T13 A;  1ZKO A;  3RZD B;  2JEB I;  4FF3 A;  3Q24 A;  4CKB A;  1TS3 A;  2EYM A;  3OW7 A;  2LMC B;  3T53 B;  1H9R A;  2AQ1 B;  2VB3 X;  3R3O A;  1DYQ A;  5C4H A;  3J7A V;  2J7Z A;  2M00 A;  3I72 A;  1SE2 A;  2EYF A;  4A3B B;  1PMR A;  3K7A B;  1ZYR C;  2ICE C;  3ND9 A;  4IUU A;  2RA4 A;  1PRT D;  3VA7 A;  4CJ0 B;  4E6I A;  2B2T C;  2R92 B;  3CU7 A;  1PTO D;  3K6O A;  2L11 A;  2XRQ D;  4IUR A;  2OF1 A;  4Y7N B;  1F2Z A;  1YNJ C;  4OIK A;  1V1P A;  1TWA B;  3DEO A;  2WB1 B;  1DJR D;  2B8F A;  3PIO 3;  2F0U A;  3ERQ A;  2E76 C;  4B9X A;  1RDP D;  1C4Q A;  1KNA A;  1XX8 A;  2K04 A;  3SE0 A;  3IFT A;  2JE6 I;  2BDO A;  1H9M A;  4MN3 A;  3K0Y A;  3SK4 A;  2IX1 A;  5EPJ A;  2EYP A;  4BY7 B;  1GHJ A;  3F2U A;  3S14 B;  4A3K B;  1KTK A;  3MEH A;  5CYU A;  1Z47 A;  4K5X A;  5A2Q L;  2F0F A;  1V1P B;  1Z6H A;  2B2W A;  1ENA A;  3CRK C;  5DAU A;  3U9O A;  4V0B A;  3AU7 A;  2NVY B;  1EYA A;  2K5W A;  4KY5 A;  4EQP A;  1JC7 A;  2E2I B;  2KA7 A;  4KD4 A;  2Y0S B;  3LX0 A;  2K33 A;  4DAP A;  2JA6 B;  2F0P A;  1WTQ A;  2NTT A;  3GTJ B;  1BCP B;  1QNK A;  4OO1 H;  3KUP A;  4HSP A;  3WDN A;  5C4Z A;  1RCV D;  5KEE A;  1OO9 B;  5C0X G;  4PMW A;  1EY9 A;  1CQF A;  3S1N B;  3I8Z A;  5F2D A;  5FOB B;  3K5N A;  1LT6 D;  1U4R A;  3GTM B;  3TP8 A;  1DCZ A;  4R9W A;  3LNN A;  4QMG A;  5CGK A;  5IGD A;  4BY1 B;  2M9V A;  1TQO A;  1SAP A;  3BDC A;  2B2T A;  2KCC A;  2YYZ A;  2AQ2 B;  2WP8 J;  2O4X A;  1G2T A;  1CZW A;  2A6E D;  1SNQ A;  1JWU D;  1DD2 A;  1PZJ D;  3VA5 A;  3KBG A;  1UNS A;  1JIC A;  1SMY C;  1NR4 A;  3PUX A;  1B3A A;  4A3I B;  5EBD A;  3KLS A;  1F9Q A;  1S5E D;  1WD0 A;  2XWB B;  3U9S A;  4OHJ A;  2KEC A;  2JP1 A;  1HHV A;  3NBH A;  3C2P A;  4Q5V A;  2F0I A;  1PZK D;  3H0G B;  1IYV A;  3K5M A;  3BVZ A;  2JXM B;  3D8G A;  1PFB A;  1G6Z A;  2TMP A;  1JOQ A;  1E2Z A;  3H3V C;  2Z4I A;  4NW2 A;  4CJ2 C;  3DEP A;  2B2Y C;  1XYI A;  3G6J B;  1SBB B;  2G9D A;  1YNN D;  2L5T A;  1B1Z A;  1DON A;  2EYH A;  4RKL A;  3VR6 A;  3J7Y W;  3MXG A;  2RBM A;  2Z8L A;  4UAI A;  1LV9 A;  1ICW A;  4JBW A;  1HUM A;  3ERO A;  1Q12 A;  1DOM A;  1FR3 A;  1C48 A;  1Y69 U;  1PRT C;  3A8J E;  3RMH A;  4KV6 A;  3BG3 A;  1D5X C;  1TY2 A;  4XIG S;  2PZT A;  2K32 A;  3S1Q B;  2F3W A;  1K8M A;  2KCN A;  4RGO S;  5CBE E;  3DMU A;  2IX3 A;  4PMB A;  2BA0 A;  5IT9 E;  1STE A;  4IFD I;  4KMU C;  3J81 L;  1F2Y A;  2L0C A;  1HA6 A;  1ZYR D;  3GQB A;  3NUC A;  4ZQ3 A;  4C3J G;  1WTR A;  1AZQ A;  4OGQ C;  4QF4 A;  3HP3 A;  3VYR A;  1STA A;  2KOL A;  1KDA A;  1EFI D;  5E4X A;  3GP7 A;  2BE5 C;  1YNJ D;  2EJG C;  1EYC A;  2R6G A;  3NP8 A;  3E6Z X;  1Q90 A;  2EJM A;  4G4K A;  3N6R A;  4IZ8 A;  2F0J A;  2RSO A;  3J80 L;  1BR9 A;  3K58 A;  2PO4 A;  1B9M A;  5C3W A;  1QOH A;  2NN6 H;  2H4O A;  3MVV A;  4XT1 B;  3NSW A;  1I4X A;  4U68 A;  5I6W A;  2PW7 A;  3MWY W;  2Q8I B;  1WTV A;  4XT3 B;  4B08 A;  5JJZ A;  3D4D A;  5D3D A;  1PYW D;  3M7G A;  1Q8I A;  3GO5 A;  2K28 A;  2L1B A;  2SDF A;  3OMG A;  3W3A A;  2PW5 A;  3S1R B;  5M5W B;  5EKL A;  3NXW A;  3SHL A;  4EQN A;  1TS4 A;  2EY5 A;  1TS5 A;  1J9O A;  3HOV B;  1B4O A;  2A6H C;  4RA8 A;  5HGT A;  4IFD H;  2JSO A;  3R8B A;  4OIJ A;  4ZLT F;  2HDM A;  1EWC A;  3QG1 A;  3VR5 A;  5IGF A;  1U4M A;  3MA2 B;  1FYC A;  3HEJ A;  3T56 B;  1STN A;  2EE1 A;  2NVT B;  4FP5 D;  4HAE A;  1PTO H;  4IUT A;  5LHY 1;  5HUR A;  4RWS C;  2D62 A;  1OXS C;  5A2Q E;  1I6V C;  5CV7 A;  4FVM A;  1F9S A;  3IKJ A;  1HCZ A;  4C3I G;  2HDL A;  2DNC A;  1CTM A;  5KRU A;  1D5Z C;  5DM7 3;  1WVL A;  3M4O B;  1SMY D;  5M3M B;  1BCP C;  3NPP A;  4DK1 A;  2VXW A;  3MFY A;  1LT4 D;  2NVX B;  3I91 A;  3SXH A;  4N9T A;  4QCL A;  3PV0 A;  5I4D A;  4QUF A;  4A3M B;  4DU9 A;  3NTH A;  3I4L A;  1FNW A;  2WKC A;  3ONA B;  4QIW B;  2FMM A;  2O2L D;  4NP5 A;  3SR1 A;  4M8A A;  1PFN A;  3FPP A;  5COY A;  4RHR A;  1DOL A;  2AWN A;  3GV3 A;  2J0T D;  1BDO A;  4S3S A;  3O13 A;  1T5E A;  5ELE A;  4R8N A;  3M85 A;  3X3M A;  3JAM L;  3MXP A;  2J4X A;  2X6G A;  1EYD A;  1SYE A;  1O7L A;  3ITP A;  4B9W A;  2Q8T A;  3A7L A;  3HS0 C;  3TP5 A;  4TKO B;  4X3K A;  4OO1 G;  1CZG A;  2Z1C A;  1A2T A;  3H09 A;  2QEJ C;  4DA2 A;  2K01 A;  3TBI B;  2K03 A;  2QDB A;  4IFD J;  3RZO B;  1MGS A;  5BN5 A;  1XTC D;  1TT2 A;  1CA5 A;  5G3L D;  5C5M A;  3S16 B;  4CGY B;  3VR4 A;  1BCP F;  1I4R A;  3NHH A;  3H91 A;  1OXX K;  1ESR A;  3EVQ A;  5CV9 A;  4OO1 I;  4C56 C;  2JEA I;  2C9O A;  1I6H B;  4IUP A;  1ESF A;  5EQ0 A;  1LLR D;  1EU3 A;  1S5B D;  2NB0 A;  5D3I B;  3KLR A;  1AW7 A;  4WJW A;  2MJ8 A;  2FHT A;  1K8O A;  1SNM A;  1II3 A;  2PZU A;  1RKN A;  1MBY A;  1JB3 A;  4KN4 C;  2RDG A;  1O7Y A;  4KY7 A;  1RJT A;  2L9H A;  5AFW A;  5EGT A;  1EZ8 A;  2IX0 A;  3NWS A;  3MTS A;  1GXD C;  4F87 A;  2IW3 A;  5JVH 3;  1S4Z A;  4R8I A;  4KKT A;  2F0V A;  4H44 C;  5I2Y A;  4ZK9 B;  3GTK B;  1STY A;  4DXG A;  3OHX C;  3VR2 A;  1S5F D;  5J39 A;  3QOJ A;  2BE5 D;  3PIP 3;  1XXG A;  4K14 A;  4QUC A;  3UI2 A;  3TZD A;  2LKV A;  1B9N A;  2F0G A;  3OWF A;  4HSV A;  1IHZ A;  1WTP A;  2VB2 X;  2SNM A;  2RSN A;  4WRD A;  2PCF B;  1H9J A;  1BNZ A;  4C3H G;  2LS0 1;  5EKK A;  1EWH A;  3FDT A;  3AB9 A;  2R93 B;  4ME5 A;  2F0N A;  5DEH A;  2JYO A;  2RQX A;  3V96 A;  4TRD A;  1TS2 A;  3MXN A;  4RGM A;  3J81 E;  1I4P A;  3QJY A;  4K2K A;  5E1F A;  2IJ0 A;  2FMC A;  2MPM A;  1L0Y B;  1EOT A;  1BF4 A;  1KNE A;  4F8M A;  1LTI D;  4RHS A;  2L12 A;  2RDF A;  2NBF A;  4X3S A;  1OXT A;  2JA7 B;  1NAP A;  1Q1B A;  3MZ5 A;  1EEI D;  1A3U A;  3D6W A;  1LT3 D;  3S9W A;  2F03 A;  4HCS A;  2A6H D;  2K1B A;  3OOC A;  5JPN C;  2IWH A;  3DHQ A;  4N9P A;  4LMQ D;  2L55 A;  3J80 E;  4HMI A;  4ID6 A;  4RCN A;  1F77 A;  5CBA E;  1F2L A;  3D31 A;  1NCV A;  3D6C A;  5FO9 B;  2E2J B;  2WKD A;  2XSC A;  1KAB A;  1K83 B;  4ZAI A;  1LTB D;  1LTT D;  5KNC A;  4XYQ A;  5C4X B;  1G29 1;  2NZ1 D;  1PXU A;  1G91 A;  1VCI A;  2R3Z A;  4O1N A;  2I07 B;  4P2C B;  2F0W A;  1QG7 A;  3NQI A;  1TWC B;  1U4P A;  1VF7 A;  4F88 A;  4J6H A;  2X6L A;  2F1M A;  1HXY D;  2NTS A;  4NKL A;  2XNA C;  2NVQ B;  4RAU C;  5IGE A;  3S2D B;  3QOL A;  4IUQ A;  1NUC A;  1I3Q B;  1EU4 A;  4G7Z C;  4KKU A;  4DNT B;  5E4W C;  1HQR D;  1QNU A;  4K2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...