1KDCA

Stabilization of a strained protein loop conformation through protein engineering
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYNPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Stabilization of a strained protein loop conformation through protein engineering.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase (phosphoric diester)
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1kdcA00
4H7BA 1JOOA 1TT2A 2O4XA 2F0SA 3DHQA 3U9OA 1EY0A 4F7XA 1EQVA 3C1EA 4K6DA 3EJIA 3PMFA 4DU9A 3OMGA 1STHA 2F0TA 5C3XA 5IIFA 5EGTA 4KTAA 3SR1A 5KIXA 3NK9A 4HTHA 2PZUA 1TQOA 1SYDA 2F0NA 5KYIA 3TMEA 3OMCA 3TP5A 5J22A 2F0DA 5DAUA 1SNCA 1RKNA 3QOJA 2F0WA 2EYPA 3HZXA 3C1FA 1U9RA 4KY6A 5C6AA 5CV9A 3SK6A 1F2YA 1KDAA 3DMUA 5CV4A 4KY7A 4E6IA 1EYCA 5C4ZA 2NUCA 4HMJA 3E5SA 1EY7A 1STNA 2PZTA 4ODGA 1A2UA 4ZUIA 5C3WA 3P75A 4OL7A 3NP8A 3R3OA 5EKLA 5CV5A 3VA5A 3MZ5A 5CV6A 3ITPA 5IGGA 2F0IA 1ENCA 1STBA 1AEXA 1EY5A 2EYHA 2LKVA 4I65A 4IALA 2SNMA 4K2LA 4QMGA 4S3SA 3T16A 3NHHA 5IGBA 3TP6A 3MHBA 2PZWA 3SK8A 4IUNA 4ID6A 4DF7A 3RUZA 2F0UA 5J1ZA 3ERQA 5NUCA 3BDLA 5E3FA 2F0EA 3OSOA 2WACA 3MXPA 4KHVA 4PMCA 3SK4A 4KY5A 3SK5A 2F0JA 1STYA 5CC4A 4B9XA 5I6WA 4HMIA 2RBMA 4K5XA 3P1HA 3QB3A 4WORA 1SYGA 4KD3A 2F0KA 4KD4A 5HGTA 4WRDA 4KJNA 2PYKA 3HEJA 4R8NA 2F0QA 2SNSA 4PNYA 1SYFA 2EYJA 4NP5A 5HURA 5I9OA 1JOQA 5C5MA 1JORA 2F0OA 2F0GA 2ENBA 4QB4A 4TRDA 2EYOA 2F3VA 1F2ZA 3TP7A 5M9OA 1JOKA 2F0PA 2OXPA 4LAAA 5E1FA 2SOBA 3D4DA 5IGFA 4EQPA 1EY8A 2OF1A 1KABA 5KGUA 1SYEA 1EZ6A 3D6CA 3MEHA 4K2KA 1TR5A 4ZUJA 3SHLA 4NKLA 1NUCA 2RDFA 3OWFA 5KRUA 1EY9A 4QF4A 1ENAA 5IGCA 2EY6A 4EVOA 5ISRA 1F2MA 1A3UA 2QDBA 2EY1A 4N9PA 1EYAA 2RKSA 2F0HA 2HQEA 5IODA 1II3A 4NMZA 3NXWA 2EYFA 1SNMA 1STGA 5JOBA 5KYLA 5I6YA 5C4HA 2EYMA 2F0FA 5JAVA 3MVVA 2PQEA 1SYBA 2F0MA 4K5VA 4K8IA 4ME5A 4N9TA 4RKBA 5DEHA 4K5WA 3SXHA 1KDBA 4KV6A 3T13A 4F8MA 3QOLA 4KJOA 4J6HA 2F0LA 2PW5A 3BDCA 4K14A 3EVQA 4G57A 4DGZA 2EXZA 4EQNA 5IGEA 1A3VA 5I9PA 1SYCA 4B9WA 2EY2A 4MIUA 2PW7A 5J39A 1STAA 5CV8A 1KDCA 5IOCA 1EY4A 2KHSA 3NUCA 3H6MA 3S9WA 1SNQA 5CV7A 4IZ8A 1SNOA 5K5PA 2EY5A 4YIJA 2EYLA 3D4WA 1IHZA 1A3TA 3NQTA 5EKKA 3TP8A 1SNDA 1EYDA 1EZ8A 3V2TA 5CGKA 1SNPA 5IGDA 1KAAA 4ZQ3A 5KEEA 2OEOA 4RKLA 4PMBA 1NSNS 4K8JA 1EY6A 3D8GA 5CR3A 2F3WA 2F0VA 5F2DA 3LX0A 4DFAA 1A2TA 4NDXA 2M00A 5C5LA 3EROA 4EQOA 4J1MA 2KQ3A
chains in the Genus database with same CATH superfamily
1XMOQ 1W6JA 1PHJA 3DHQA 4LFCQ 3I8ZA 3E9IA 3CCSA 4DK1A 2HHHQ 3F2DA 3HOYG 5IIFA 1U5KA 1SFOH 4U68A 1QUQA 1PH3A 3HG9A 1IZ6A 4YHHQ 3HOUG 4AQYQ 1HPCA 4DR6Q 1B50A 4Y7NH 5C4ZA 4B3ML 4OIJA 3GTOB 5K36H 2B2YA 3TSSA 2ZM6L 4RGOS 1PFMA 4JG2A 2IX1A 4RHSA 3ERSX 3CXCA 1BO0A 2SNMA 1PH8A 2ZJQA 5C3EB 2E75C 5ELBA 5IT9L 3PUVA 3F2UA 4A3MG 4KHVA 1WTQA 2Q8RE 1PTOH 2ZJPA 1LTID 2IX0A 1C7YA 1PVOA 4ZYSA 1B4OA 2VB2X 2BDOA 2NWGA 5GADC 3ICEA 2B8GA 1CI3M 1WCMH 4JW0A 2X6GA 3OWEB 4A3GH 1LTSD 1RCVD 5CBEE 3K5NA 2ASBA 3MXNA 3J81L 2CVRA 2KCMA 4PMWA 1GUSA 1SJHD 1AP0A 5FJ8H 1SYEA 3MEHA 3ZYYX 3RN2A 3CU7A 3LWEA 5IT9c 1N8RC 4K0KQ 2IPKD 1I4HA 3CCVA 1I6VC 2Q8IB 1KD1C 2B63H 2AWNA 3PGZA 2N49A 4C1NI 2EYMA 4V190 1WI5A 2IHEA 4K5VA 1CZWA 4KV6A 3QOLA 2VUMH 3GQBA 1VQLA 4IUTA 1GOZA 5ELEA 1ILQA 3TZDA 1IBMQ 5C44B 2WFWA 4LF8L 1D7QA 4GKKL 3T1HQ 3J81c 2EY5A 1N9WA 2HCCA 4FF2A 3KLWA 4BY7G 4A3CH 2OQ0A 4PMBA 4J15A 1NSNS 3AB9A 4CBVA 3K57A 1BNZA 4PNYA 3I91A 4H7BA 4JI6Q 1Q3LA 4FVMA 4JI3L 3PMFA 1A62A 1GO3E 4DNRB 5EQ0A 4XQJA 1WTRA 1GKHA 1TQOA 1GUOA 3FHWA 4HSVA 4DR7Q 3R8BA 4GNXB 3TRZA 1VQDA 3TQYA 2NN6G 1PMRA 1HZCA 3F2CA 2Z1CA 4BY1B 3KJPA 2I46A 4LF4L 1GVPA 1I6HH 5C6AA 5BN4A 1VDZA 3STBD 1DGSA 3HP3A 3M4QA 1IL2A 3S2HH 1VQFA 1Z47A 4WJWA 1SE2A 3NP8A 1B3AA 2V1CC 3MZ5A 4JV5L 4O1NA 4EX5A 2ES2A 2VQFQ 1XJVA 5M3FH 4KN4C 2KHJA 1VQOA 4HIDA 1HH2P 3SK8A 4IUNA 3S24A 4GN3B 3RUZA 5E3FA 3M4OB 3RLNA 4PZ8A 2F0JA 3VA7A 1EIYB 1YHBA 3KLSA 1O78A 4B3SQ 4FNFA 1FGUA 2H1EA 1QOHA 1U4MA 4GN5A 4XDXA 5JPMC 1B8AA 3STBC 2C9OA 5C5MA 4DPGA 4DV1L 1H9JA 1TKWB 1LABA 2F4VQ 3I4MG 3GV6A 5ELCA 1VQ7A 2JA7G 5IGFA 5C4JH 1KABA 4Q5VA 3PUYA 4YCUA 5IGCA 1RODA 1W2BA 1F2MA 3HOUB 4LWCA 2QEJC 4ZKCB 3PV0A 1SNMA 1WOCA 1CA6A 3E3XA 4JI4L 1RD9D 1WTVA 2NN6I 2UUBQ 2JA6H 2K52A 4G4KA 1QB5D 4JBKA 2PW5A 2LSSA 1K0RA 2Z9HA 1L1OA 2LFNA 2Y0SB 4OHJA 1XTCD 3HOVG 1BVSA 1Q8KA 2KHSA 3J80E 2QKIC 1TWGB 5K5PA 2E2HH 2UXDL 5EKKA 3NBHA 1ICFB 1LTRD 1IYJB 4R4QA 2OEOA 1E0BA 1FVIA 2QA4A 3AMUA 3MEFA 4GLAC 2LXJA 2M00A 2MO0A 3AFQA 1I50B 2KQ3A 3ULPA 3I90A 1RF2D 4X62Q 4C3HG 3HS0C 2J0TD 2JSOA 4JC0A 3EQLC 3FVQA 3OMGA 4C3JH 1KXLA 2LXKA 4HIKA 2B2WA 3NK9A 3MXUA 2B29A 4OONA 3OMCA 1ZXTA 2UUAL 1K83H 5J3BA 1Y1WG 1K73C 3VYTA 1EL0A 1KDAA 5BR8L 2PZTA 3SE0A 1ML0D 2XRQD 3K5OA 5M3MB 1VQGA 3KOJA 3U4VA 1SE3A 2Y0SE 4DXFA 5IYDG 4LW1A 3TP6A 3Q23A 3CPWA 3I70A 1YJWA 1V8QA 2XRSD 4UP7A 2YTVA 2RSOA 4GS3A 4XQQA 4OO1G 4KY5A 4P73A 1J9OA 2WB1B 3E9HA 3CRLC 2CH4W 5CYUA 3P1HA 1X65A 1Q1EA 2K33A 1BCPD 1IW7D 4KD3A 1IBKL 1VQ5A 4KKUA 1N34L 3I4NB 4YWKA 5T1GA 3CMAA 1JORA 1CQFA 2ZJRA 1ET9A 1CTMA 1HUNA 1TS2A 3MTSA 3E0EA 4P74A 3D4DA 3GO5A 1VMPA 1HXYD 5IWAQ 5KNCA 2ZXOA 4IFDG 3HOWG 1BBXC 3OWFA 1B9MA 2EJGC 4LF7Q 3L2PA 5IP7H 4JI7Q 2MPMA 4EVOA 2EY1A 2RKSA 5IODA 3J81i 3H0GB 4KI0A 4RG1A 1PA6A 3BVGA 3T1YQ 4A3FH 3T51B 2Z0SA 3NWSA 1JR0D 3DM1A 4Y52H 2R7ZG 1D5XC 3BU2A 4C3IH 5FO7B 1F77A 1Z6HA 2GVBA 4K14A 4QUCA 5E4XA 4LF6L 3J7AV 3S1QB 2MHVA 2Z8LA 2K6AA 4FXGC 2WB1E 1OXXK 4RA8A 2HDMA 4RCOA 4N8FA 2DGYA 2ZTEA 1PZKD 3BVMA 5JEAH 4H44C 3HKZG 3T4AC 3LX0A 1A2TA 3I4OA 2XN9C 1F9PA 1EQRA 4XIGS 4DNIA 2O4XA 3KF8B 4OO1I 5G3LF 4R4TA 2UU9L 3G7LA 1TWHB 3IFDA 2PZUA 3DEPA 3Q6SA 3CCMA 3S17B 4ZRZA 2EE1A 1XMQL 4L5SA 3U50C 3GTLB 3PIP3 4GOPA 2E2JH 3A5UA 4QL5A 1Q1BA 3I3CA 4X6AH 3TN2A 4A3BH 3T56B 3D4RA 1B53A 4A3IH 2F0IA 4GKKQ 1AEXA 4IFDI 5EPKA 2VB3X 2IW3A 2R92H 1XPRA 3PCOB 4O2DA 1PTOC 2JN4A 1K9MC 5M5YH 3S1NB 1KNAA 1IYVA 3J81j 1KTKA 3DUZA 3LNNA 5CC4A 4JI3Q 2B8FA 1QZGA 1ZEQX 4K5XA 3CHBD 3MWYW 3A7AB 3ER0A 3FKIH 4R8NA 1YITA 1CUKA 1E2VA 3UDGA 2F0OA 3NENA 2NVTB 2A8VA 4C3HB 1CK1A 5JVH3 2IL8A 4LF4Q 1K28A 2F0PA 5EBCA 3HFZB 4BA2I 4GN4B 3OIPA 3L7ZC 4YY3L 2Q8TA 1AZPA 2K75A 4JK1C 4DR2L 4F87A 4L5RC 4GLXA 3PO3H 1H9SB 1AE3A 2BH2A 3S2DH 1WTPA 5JOBA 4MHEA 1U4LA 1H95A 5JAVA 1ET6A 1W6KA 2VW9A 2H5XA 1B9NA 4HJ9A 2GA4B 3BDCA 4N8X1 1SYCA 4UAIA 2EY2A 4JI0L 2PI2A 3NTKA 1MKHA 2PCFB 3TP8A 2QILA 1BKBA 2XNAC 4GKJL 4UHVA 2WP8J 2B2YC 4K8JA 1H9MA 2NVQH 4OX9L 2BE5D 1EIGA 3J7A5 4L5TA 4HJ8A 1JOOA 1Q12A 2DN8A 3U9OA 1EY0A 2A68D 2JYOA 5C3EG 4DU9A 1T5XD 2ZT9C 3ONAB 4R4IA 4M8AA 1FNUA 1ONLA 3NWTA 1R4QB 2EPBA 3URYA 5KYIA 2R7DA 5DAUA 2Z4IA 1BR9A 3QOJA 1YVCA 5FLXE 1HHVA 4FDBA 5EJWA 4QY7A 1F2YA 3DMUA 1WD1A 4WFN3 2SEBD 1IBLQ 4J8QA 5IP9G 1C0AA 1K8OA 1XPOA 2A6HC 5FK9C 4P75A 2AUJD 2MGSA 2NVXB 2R7ZB 1HCZA 1PFBA 1V43A 2A68C 1PYWD 1WYDA 5A2QE 2NYZD 2KUMA 2UUCL 5D3DA 4JYAL 1JB7A 2RBMA 3J80L 3AEVA 4TSSA 1T9HA 3HOZH 4KJNA 3H94A 2SNSA 4DV3Q 2N3SA 1I94Q 2VY3A 4CKCA 1B3QA 5C44G 2Z4HA 1K8AC 2K01A 4HAEA 1KL9A 5C0XG 3KYHC 1T5EA 4RAUC 2JA8H 3VR4A 3L0OA 5LHY1 4ZUJA 4B3TL 2ALYB 1CSPA 4X66Q 5FLMG 2EY6A 2DJGC 3WOEA 1EYAA 2F3IA 2CQAA 4JI1Q 1BF4A 4B3RL 2R93H 1TWCB 3G6EA 4IPDA 1TVXA 3W2DA 1N32L 3NQIA 1D2BA 3GTQB 3AFPA 3J80c 1DXMA 3U58A 4DA2A 3D0FA 1A3VA 1HA5A 2HCIA 4JBJA 4KHPL 1KDCA 4BY1G 1PFSA 4DAYB 3J7ZC 1UE1A 3H3VI 1GXDC 3VR6A 4BS9A 2K7VA 1KAAA 1UUPA 4RKLA 4B08A 3DXJC 3BDOA 4NDXA 2UXBL 3HOYH 3S1RH 5M5WB 3CCLA 2F52A 3FRPB 4KN7C 4UDUC 3S16B 1LTAD 3A55A 1QWYA 2DJFC 4OWXB 1YNNC 2JE6I 1ESRA 3PO2B 1HNWL 3G4SA 1WTWA 1NY4A 1PRTC 1YJNA 3IAYA 2CCZA 1FJGL 2K5WA 4BWGB 4HCSA 2B3GA 3OTOQ 3Q24A 3BZDB 4X3UA 1EY7A 4RHRA 3QIAA 1J5EL 4LF6Q 2FJ2A 3AYHB 3EFXD 3IFTA 1X3QA 4A93B 1SXTA 3ND8A 3K7AB 1O80A 2I0QA 2EYHA 1SDFA 3GTGB 4LF5Q 2EXDA 4CDFC 3PQIA 3MXGA 1LM0A 5ELOA 4A3MH 4APVA 1KQSA 2KOLA 1EQQA 2WACA 3SK4A 1X3PA 3K0YA 3CCRA 1BBUA 2GVAA 1I4GA 2UU9Q 4KD4A 3CCJA 3HOXB 1E1TA 1B44D 3GD7A 2HQLA 3S15H 1HZ9A 1F9RA 3QJYA 1LTTD 1L1OC 1NNXA 2Y0SG 1LACA 1HNXL 2OT2A 1LV9A 4BBSB 3V05A 5FO8B 2HIVA 1UEBA 4CKEA 1JWMD 1PYBA 4DUYL 2DUDA 1XTDA 1NR2A 1WD0A 2JA5B 3VYSA 2E2DC 2K32A 2RHSB 1A6XA 4YWMA 3CP0A 4NMZA 2EYFA 3JAME 4KLKA 2HT1A 3RNUA 1W3SA 5AJ3L 1CA5A 4F8MA 4XYOA 4MTNA 2RQXA 1GD7A 4H13C 2B2WC 3EVQA 4G57A 4AIMA 2EXZA 1EEFD 1EFWA 2K04A 5J39A 4BY7H 4NPSA 2D0PA 1E2ZA 1D1KA 2PQAB 3H6MA 2ICEC 3RD4A 3J7YW 3M3YH 2KJXA 4DAMA 4DK6C 1SLJA 1EZ8A 2A73B 1TWFH 3P7JA 1HTPA 4YWLA 1B70B 5M3MG 2N78A 2N8NA 4HIOA 4ME3A 5E7NA 1UEAB 1RJTA 1HFNA 2TMPA 1JE5A 4O42A 1PH1A 5LMNL 1KRTA 4M1UB 1N36L 2YU9H 3GTPH 1E1OA 3RZOH 2NN6H 1XNRQ 1L0YB 1GHKA 1XXGA 1VMCA 5IYBG 1O7IA 2WB1G 5LL6S 3KK7A 1U9RA 3SK6A 1RHPA 5CV4A 4BBRB 1NR4A 3I4NG 4LUVA 1LTGD 2E5LQ 1FNVA 1STNA 2OCEA 3CF5A 4I7AA 1LT6D 5IGGA 3ITPA 1WCMG 5C4XB 4XQNA 4A3DB 2HUGA 1H9SA 3M4YA 4GKJQ 3ERQA 1PLFA 1Y1VB 4P71A 2VS1A 4P2CB 3EIVA 2B2UA 5FJ8G 3H0GG 4B9XA 1UWVA 1GJXA 4C56C 3M7NA 3AU7A 4NXML 4X65Q 1I4QA 3Q0AA 4QIWB 1M8AA 4NXNL 1M1KC 5ELFA 2A1AA 2IT1A 3O13A 4RCNA 4FYDA 4DV0L 5HURA 1JOQA 2QF7A 2L12A 4IUUA 3I4MH 1RDPD 2JA7H 1HR0Q 1X54A 1VQMA 1F2ZA 4OEMB 2VQEL 1H9KA 2OXPA 3J80i 1MJEA 2OF1A 4IOAA 5C0XJ 3SHLA 2L9HA 2L55A 3GTKB 1CM9A 1JJ2A 2JP1A 1CQVA 3OW2A 2F0HA 4IUQA 1R9TB 2BDNA 1A0IA 3A74A 4ME5A 1Q46A 3GTMB 1D8LA 1DCZA 1JMCA 1DONA 3HOVH 3E6ZX 2WIIB 5KRUA 4KHZA 1X3EA 4A3EB 1DOMA 4JCVE 4DR3L 3CQZH 4L6TB 5IOCA 4A75A 4QJFA 4DR4L 4GOPC 1Y8NB 4OIKA 3NQTA 2WV6D 3V2TA 1EYDA 4QIWE 2V4DA 1SN8A 2IJ0A 1CSQA 1EY6A 5CR3A 4JOIC 1EWHA 1D5MC 2ID0A 3HZXA 5C5LA 4EQOA 5A2QL 2EJMA 3PUZA 5AFWA 2FMMA 1E3PA 1LT4D 4K6LA 4V0BA 4DR1Q 3EJIA 4IUPA 4KTAA 4DV4Q 5FLXc 2IX3A 1Y1WH 5GAGC 3RZDH 4U673 5LMUQ 1CFMA 1O7YA 1RKNA 3MC0B 5JPNC 3W1GA 3C1FA 1C9OA 1S72A 3CCQA 4X64L 3G48A 1BCPB 2J4XA 1EYCA 2KCNA 4HMJA 3E5SA 2PMZE 5C3WA 4DV2Q 5IYDH 1LLRD 3S1MB 2LKVA 2OWOA 3B6YA 5IGBA 1ILPA 1WVLA 1XNQQ 2NVYH 1DOLA 2CWPA 4IOCA 2UXCQ 2XWJB 2CFMA 3G71A 4OO1H 1RIPA 3M4PA 2F0UA 4ULLA 4DUZQ 1YJ9A 5NUCA 4WJ3M 4ZKBB 4NB3A 3C2PA 3SVMA 1VQPA 3W1BA 5GQOA 2RHQB 3KDFB 2MUYA 2A6EC 2E2IH 4HN7A 3M85A 3NBIA 1AH9A 4DAYA 2F0QA 4Y7NB 3IRBA 2KHIA 3F2BA 3S14H 2E76C 3RLFA 1WTXA 2SOBA 4IFDH 1QILA 3HOWH 4UY8C 1AFPA 1E7ZA 1HTLD 1G6PA 1S3OA 1HR0W 4PV1C 4BA1I 4JBMA 2R7ZH 5I6YA 1SYBA 1X55A 2F0MA 2ZXRA 1PZID 3T13A 1KDBA 2A69C 4OXPA 4J6HA 2JEBI 2K1BA 2KVMA 1WCMB 2BCOA 1ENFA 4PQXA 1LYLA 2AQ1B 4A3GB 3FDTA 4TQUS 4DAPA 3CCEA 4B3MQ 2K5VA 2ZM6Q 2XTIA 4QGUA 4HJ5A 1LT5D 4LFBL 2XVSA 2F3WA 1S40A 3UE1A 1EQTA 2Z6KA 2K05A 3D3RA 1Y8PB 2B63B 1UE6A 1I3QH 1TS3A 1Z7TA 2F0TA 2SDFA 1MD2D 4A3JH 4RWSC 4DUYQ 5KIXA 3DM3A 1X3FA 4IJHA 1NTGA 2VUMB 1AN8A 1Q86C 1SNCA 2F0WA 1IYUA 2EYPA 4C2MH 5M5XH 4CJ0B 5I4DA 3GTQH 3ULLA 1QUQB 1JWSD 1JJCB 1G2SA 4FP5D 1QNKA 3RMHA 4DR5L 2M2LA 3DLLA 4UP9A 1MIUA 4LFAL 4JI5L 1N33L 5JJKA 1PTOD 1VQJA 4IALA 3BYYB 1BCPF 1B1ZA 4DV5L 4KKSA 1XMOL 1OXVA 4LFCL 3JAML 2HHHL 5H1SE 3BDLA 4CDDC 2AQ2B 3S16H 4LK1C 4RGNA 4MTKA 4YHHL 1ZKOA 2L5TA 2F0KA 3BVZA 4DR6L 3PIPA 2PQAA 1I6HB 3A5ZB 4LF8Q 2F0GA 3S2HB 2ENBA 1S5BD 1D1IA 1OO9B 2KECA 4CGYB 2EZVA 2HD3A 1TWAH 2HDLA 3GTJH 5D65A 4JBWA 5M3FB 1L2FA 4UP8A 1VQKA 4QF4A 3JAMc 3ULJA 1HQRD 1EFID 2QDBA 2ZTCA 1ZYRC 2HQEA 1II3A 1SJED 1SBBB 3NXWA 3A54A 2F0FA 5ELNA 4N9TA 3PF4A 3CMEA 4Z9CB 2Z6BA 1UAPA 3PO2G 1J8IA 3PIO3 1NBWA 1R4PB 2BOSA 2Q2UA 1F9QA 2X6LA 5E4WC 5IYCH 3GTOH 2XGTA 2D0OA 1LO5D 1IHZA 1SNDA 3M9BA 1SNPA 2L15A 3U9SA 4JV5Q 3EN2A 5C4JB 1DJRD 4A93G 5C3EH 2QEXA 4E6IA 4K0KL 3I2ZA 4BXXG 4GNXA 1LTBD 4F7XA 1LUZA 3C1EA 3A56A 1XWEA 3OIQA 4DN4M 4R4CA 2ZXPA 1F2LA 1NAPA 3LGJA 3L3OC 2H4OA 3D6WA 2JA6B 3UDFA 5EKIA 3SGIA 2B2VA 1UE7A 4L5QA 1IBML 1PXUA 2L0CA 2RVLA 3T1HL 2BH8A 3L9AX 2A6HD 4I7ZC 3HOXG 2KEEA 4DV1Q 2D5DA 3H3VH 1V1OA 3K59A 5DM63 2E2HB 1U4RA 4O0AA 5BN5A 2KCTA 4QUFA 4BBSG 4A3KG 2VNUD 2FFKB 3M7GA 2MJ8A 4JI6L 3QWNA 3I4LA 2AWOA 2F4IA 4C3JB 2JA5G 1FD7D 4JI4Q 3SK5A 4DR7L 5I6WA 3H09A 3NE5B 3IKJA 4QQBX 4IUVA 1K83B 5C44H 4JI2L 1A63A 1SYFA 1HJPA 1EWCA 2O5JC 1RL2A 4TRDA 4POFA 3C46A 2UXDQ 1Q81C 3TP7A 3QR8A 5FLMH 2VQFL 1X3GA 1I4PA 4JPBW 4XT1B 1QG7A 2I5MX 1V1QA 2I07B 1JICA 4RKBA 1I4XA 5DEHA 4HSPA 4B3SL 1GUGA 3RN5A 2L1BA 4BY1H 2LMCB 1L0XB 2UUAQ 1QNUA 5CBAE 3IL8A 3MA2B 3OPOA 3QG1A 5EBDA 5BR8Q 2F4VL 3D4WA 1FGBD 3F1ZA 3KBXA 4MZ9A 4BBRG 1L1OB 5LL6X 1PDQA 2C5CA 4OWWB 1HUMA 3EROA 1YNND 2EOTA 5C4XG 2F0SA 1PRTD 1BXTA 4A3DG 2OTJA 1QVFA 1XX8A 1YBYA 4IJLA 2I5LX 3KDFA 4G7ZC 3M4OH 2BA0A 3U4ZA 2NTTA 2UUBL 1PH7A 3N6RA 4A3FB 3R2TA 1V9PA 1EEID 1Y1VG 4GLVB 4MN3A 3ND9A 4C3IB 1DYQA 2B2UC 1IBKQ 2EVBA 1N34Q 1NMFA 2B2TA 2DY7A 1KC8C 1CHPD 2NUCA 4G7OC 1SAPA 3P75A 2NTSA 2MO1A 3R3OA 4YCWA 1CT1D 1DOKA 2QDLA 2WAQB 4X62L 1G91A 4ID6A 2DY8A 3HOUH 1CZGA 1PH6A 2A5HA 4A3LG 4DV7L 3N52A 4HJ7A 1WTOA 5COYA 1LTLA 1J6QA 3TDQA 3J7AF 1SYGA 5TSSA 2JEAI 1SSOA 4WRDA 4WJ4A 3JAMi 2E2JB 5C0XI 2RF4A 3I72A 5DM73 2EYJA 4NP5A 5I9OA 4A3EG 1SMXA 2DNCA 1JC7A 3A0JA 1QVCA 1TWGH 3W5OA 3BJUA 1OXSC 4A3BB 2O2LD 1VQHA 2BA1A 2LY7A 4A3IB 2E8GA 4DR5Q 1I50H 1O7LA 2RDFA 2R92B 4RGTA 5A35A 1JWUD 2K03A 4OWTB 2EDGA 5M5YB 4DV5Q 2NBFA 1QZHA 3K6OA 4ZCKA 2WAQE 5JEAJ 4KJOA 1XMQQ 1MSHA 5I9PA 3FKIB 4A3KB 1YZ6A 1HFGA 1SNQA 2R3ZA 1U4PA 4CHTB 3MFYA 4AYBB 5M3MH 2E74C 1GM5A 3KF8A 1BQQT 5IWAL 3HRZC 3D8GA 1KLGD 1V1PB 3SXHA 3UE0A 4LF7L 1YEZA 1Q8IA 4JI7L 1TT2A 3Q22A 3PO3B 4FXDA 3HGBA 2CKZB 1KAWA 3CW2C 1STHA 4YCVA 5IYBH 3S2DB 2RCNA 3T1YL 3K58A 3TS0A 1QCBD 3CC7A 2FHTA 4GZYC 1H9RA 1SYDA 2F0NA 3A8KE 5I2XA 1FYCA 1RTOA 4XXEA 3KLRA 1X6OA 4AH6A 1DZ1A 3I4NH 3R93A 4ILWA 4PZ6A 4KY7A 1YNJD 1JE4A 2CW0D 2L11A 3F8TA 1K8GA 4GOPB 5ELDA 5K36G 1OXUA 2CHBD 1JB3A 2VXWA 4YY3Q 2NVQB 1PFNA 2GN5A 5JJZA 3MHBA 2PZWA 4AYBE 3R2IA 4DR2Q 1SE8A 3K5LA 5J1ZA 1G6ZA 3NTHA 3H0GH 2ATWA 3OSOA 1VQ6A 4PMCA 3ZJYC 1G2TA 4R9WA 2I5HA 4C1NK 4HMIA 3KFUA 1K8MA 1TY2A 4JI8L 1AZQA 3S1QH 2WKDA 4EQ5A 4JI0Q 1LT3D 4HCEA 3DEOA 4X3SA 3CC4A 4TKOB 1YNJC 2F3VA 1EUJA 3KUPA 2CW0C 4A3GG 1JOKA 2NZOA 3WOFA 2WINB 4FF1A 2YV5A 3D6CA 4OX9Q 1HQMC 1TR5A 4FF4A 3NEMA 1STEA 1MSGA 2KENA 3H91A 3K81C 3UDXA 2YTYA 2MP1A 3DWAA 2PNRC 2Z6KC 2MQHA 3DWQA 2B63G 1TWHH 1KLUD 3S17H 4K5WA 2IWHA 5D14A 1GUNA 3KLSX 3GTLH 1FR3A 3HOZB 3UI2A 4A76A 4XYQA 1YI2A 1M90C 2VUMG 4LNQA 1B2TA 3NUCA 3NELA 4ALPA 2EYLA 5KEEA 4R1JA 3MAQA 4JI2Q 4RFBA 5F2DA 2JA8B 4A3CG 3VR5A 1C4QA 1SEBD 3RLOA 1HNZL 1MBYA 5FLXL 4FO2A 2PMZB 3NSWA 3S1NH 4ZAIA 2R93B 3E0JA 4DV6L 2UUCQ 4JYAQ 2R61A 2RDGA 3NTIA 4ZK9B 4KY6A 5CV9A 3H3VC 5FKAC 2NVTH 3V96A 1MJCA 4C3HH 5CMDA 2RSNA 4CJ2C 2OQKA 5CV5A 1TS4A 4JOIA 4EQNA 4QMGA 1VF7A 3TS2A 1PH9A 4B3TQ 3S1RB 3HOYB 1SMYD 1Y14B 1Y8OB 1Z9FA 4HIMA 2K4KA 4DF7A 2R7FA 5M3FG 1K0SA 3SEBA 2A6ED 2PI2E 1Q7YC 3OYYA 2F03A 1IXRA 4B3RQ 1VQAA 2VL6A 1N32Q 1A8VA 3KF6B 3X3MA 1NJIC 2NB0A 1GUWA 4MNOA 3PUXA 2Q2TA 4KHPQ 1E24A 3BS1A 1PH2A 4QB4A 4IO9A 1IBLL 1PH5A 5E1FA 1HZBA 4EQPA 1EY8A 4Q0FA 1ICWA 1L0WA 1EZ6A 1P8LA 3DWPA 4K2KA 5GROA 2UXBQ 1SFOB 1NUCA 4A3MB 1SMYC 1ENAA 1WFQA 4X3TA 2G9HD 2A69D 3GDEA 2KEDA 1KHIA 4KKTA 1STGA 4GNXC 1CKMA 2PQEA 3P20A 4G7HC 4K8IA 1HNWQ 1X32A 1DD2A 4DV7Q 4DAVA 1TY0A 2JA6G 4DV3L 1U0LA 1FJGQ 2PW7A 1EYGA 3NPPA 1I94L 1QJOA 2B2VC 4DK0A 3S15B 3VYUA 2EIFA 2WKCA 2JJQA 4IZ8A 1SNOA 3I7FA 1J5EQ 1VCIA 4ZQ3A 2MNAA 5JJIA 4PZ7A 5KNBA 1XPUA 1NE3A 4H0LC 1HA6A 4X66L 2YYZA 2NVXH 1PTOB 4K6DA 2K28A 4JI1L 5C3XA 2RCFA 4XTCS 2RA4A 1JQYD 5IY0A 4LJZC 4EGVA 4HTHA 4C3JG 4F88A 2KCCA 3I55A 3EA6A 1I5FA 3A8JE 4NW2A 3TREA 1ESFA 3CC2A 1S5FD 4BY7B 1WJJA 1QE6A 3GP7A 1EOVA 2EJFC 3M3YB 3RR5A 5JJLA 4ODGA 1A2UA 3PUWA 4TVAB 1C8CA 5G3LD 1HNXQ 2PNHA 4OL7A 1OTCA 1TWFB 4R8IA 1SR3A 1VQIA 5DLQE 3QO2A 1ENCA 4K2LA 4KMUC 1PYSB 1E2WA 3T16A 3NHHA 2FMCA 1YHAA 2Q2HA 5BN3A 2OTLA 1CKNB 1YHQA 3RZOB 2YTXA 2YU9B 3GTPB 3MXPA 2RDHA 1VS0A 1M4VA 1TWCH 4R4OA 4ABNA 4LF9L 4CDCC 4OGQC 4FF3A 3OOCA 1K3BC 5AJ3Q 4DK3C 1EU4A 3CRKC 1E22A 1X9NA 1TU2B 1O7ZA 1EIHA 3OHXC 1CHQD 2AKWB 3BZCA 3D31A 3OTOL 1ASYA 1G291 1XYIA 5FOBB 1BCPC 1IW7C 1BUVT 3CKIB 1NCVA 5M9OA 1A15A 3LWUA 1V1PA 4LF5L 1ZYRD 5D3IB 5M5WH 4NKLA 3FPUB 1TS5A 3WWVA 4CDEC 1ASZA 1D6EC 2D2CC 1KIXA 3PSIA 2LS01 5LMNQ 1N36Q 1D5ZC 5IP7G 4L63B 1BOSA 5IT9E 2JXMB 4AQYL 4IPHA 3PO2H 1AE2A 2QW7A 1JJGA 5I2YA 1OXTA 4DNTB 4CJ1B 3OW7A 2MFIA 4A3FG 3A8IE 5IGEA 2B39A 4MIUA 4A3JG 4C3IG 3I4MB 3FPPA 4JI8Q 2JA7B 5CV7A 4XT3B 1S5CD 2B2TC 2EQSA 3MXNB 1Q82C 2K5HA 4A93H 3FMCA 3K7AH 4HR7B 2IY5B 4BXXH 3AQQA 1AW7A 2F0VA 3J81E 4KK7A 3GTGH 1FL0A 1Q90A 2TSSA 5JEAG 3FP9A 4X3KA 3I56A 2A19A 2WAQG 1X56A 2NZ1D 2P5ZX 3UDIA 5EGTA 3SR1A 4H02A 1S5DD 4LUZA 3VR3A 1PTOF 5KNDA 3HOVB 3A7LA 5J22A 2F0DA 4NXMQ 1DM0B 4RGMA 1IKLA 2A74C 3K80C 3HOXH 4NXNQ 3PIOA 3CQZB 5EAYA 2N55A 2ZTDA 4DV0Q 2JQOA 2K5NA 2PO4A 4IPCA 4BBSH 3BZKA 1BBWA 4A3KH 2VQEQ 5CV6A 5IE8A 3TEHB 5HGQA 4A3BG 4A3IG 3SDZA 2C35B 1MGSA 5GAHC 1KRSA 2JA5H 1Y69U 1VQBA 2M9VA 1GUTA 4UPAA 2R92G 2F0EA 2ICIA 1XNRL 1HNZQ 3TBIB 3X3NA 1SROA 1VQEA 4IPGA 1Y1WB 3RZDB 1EWIA 3QB3A 5IP9H 4FXKC 4DV6Q 4DR3Q 2CH4A 3G6JB 2E5LL 4DR4Q 3FKIG 2D9UA 1YNXA 5HY6A 1HZAA 1JT8A 2XSCA 4LAAA 4AYBG 3K7UC 1VQCA 1PZJD 3CAMA 5KGUA 3WDNA 2JK8A 3I73A 1EU3A 5IYCG 1VQ8A 2NVYB 2Q2IA 2J7ZA 1EY9A 3FEWX 4HJAA 2CQOA 5ISRA 1A3UA 4LUOA 4N9PA 4P72A 2N88A 1PRTB 2DNEA 5KYLA 5C4HA 3PO3G 4OELB 5EKLA 4DXGA 3KJOA 2XWBB 4X65L 2E2IB 5GAEC 2F0LA 1VQ9A 4CKBA 1SE4A 5C0XH 1B7YB 2F1MA 2L4NA 2G9DA 2QCPX 5LMNW 2PPBC 2FXQA 1EY4A 4X64Q 4BBRH 1K3RA 3K0XA 1HR0L 1MHWC 4YIJA 2K50A 5CGKA 3S14B 2IHFA 3HOWB 2VZAA 5C4XH 4DFAA 3EBEA 2FINB 4A3DH 1PH4A 1G51A 1EQVA 4IURA 1VQNA 2BE5C 2CWAA 4IQZA 1Y1VH 2G5DA 5L37A 3TZUA 1S4ZA 5JVG3 3KF6A 2AMCB 4DKAC 2K5DA 3TMEA 3TP5A 3PF5A 3T53B 2X69A 3CD6A 1JCKB 1I4RA 1F9SA 1GHJA 2AQ3B 3K8AA 4ZUIA 2JA9A 3MFGA 1IKMA 3Q8DA 3HKZB 1IL8A 3VA5A 1PV4A 1G8ZD 3NBHB 1STBA 4JVZA 4I65A 1EY5A 3W3AA 4QCLA 4S3SA 3CCUA 4A3LH 5EPLA 1NMGA 5DNFA 4DR1L 3GTKH 1UNSA 1I3QB 1R9TH 1P16A 3BG3A 4A3JB 1TXYA 5CORA 4DV4L 4PG3A 1EOTA 1STYA 4IFDJ 2KBNA 3GTMH 3BYTB 1C48A 4LMQD 1EIFA 5LMUL 3C3LA 2K5QA 4RMFA 4WORA 5HGTA 4A3EH 3KBGA 4C2MB 1QVGA 3GV3A 2PYKA 3HEJA 5M5XB 1VF5C 1WTHA 5FO9B 3HOZG 1BDOA 4DV2L 1S5ED 2EYOA 3HKSA 4A4IA 1KNEA 1VQ4A 4LFBQ 2D62A 1YIJA 3VDYA 1XNQL 2UXCL 3JC66 4POGA 1SRUA 2JA8G 1HRJA 3HKZE 4DUZL 4HEDA 4IN3A 1MI2A 4L8JA 3VYRA 3MVVA 2AUKA 2K14A 4DGZA 1UE5A 1FNWA 5T1IA 2R93G 2O5IC 4LF9Q 4B9WA 4ZLTF 4RH6A 1PRTF 1STAA 1CKOA 2AHOB 5CV8A 3VR2A 2KA7A 3S9WA 1TIID 3K5MA 2R6GA 2XIWA 1A3TA 2HIXA 5IGDA 1RTNA 3S1MH 1TWAB 4LFAQ 4JI5Q 1N33Q 3GTJB 5EPJA 2QGQA 3CPFA 1CKNA 3H15A 2NZHA 4J1MA
chains in the Genus database with same CATH topology
1W6JA 3DHQA 3I8ZA 4DK1A 5IIFA 4U68A 3HG9A 1HPCA 1B50A 5C4ZA 4OIJA 3GTOB 5K36H 2B2YA 3TSSA 4RGOS 1PFMA 2IX1A 4RHSA 1BO0A 2SNMA 5C3EB 2E75C 5ELBA 5IT9L 3PUVA 3F2UA 4KHVA 1WTQA 2Q8RE 1PTOH 1LTID 2IX0A 4ZYSA 1B4OA 2VB2X 2BDOA 2NWGA 2B8GA 1CI3M 2X6GA 3OWEB 1LTSD 1RCVD 5CBEE 3K5NA 3MXNA 3J81L 2CVRA 4PMWA 1GUSA 1SJHD 1AP0A 1SYEA 3MEHA 3ZYYX 3CU7A 3LWEA 2IPKD 1I4HA 1I6VC 2Q8IB 2AWNA 4C1NI 2EYMA 4V190 4K5VA 1CZWA 4KV6A 3QOLA 3GQBA 4IUTA 1GOZA 5ELEA 1ILQA 3TZDA 5C44B 2EY5A 2HCCA 4FF2A 4PMBA 1NSNS 3AB9A 4CBVA 3K57A 1BNZA 4PNYA 3I91A 4H7BA 1Q3LA 4FVMA 3PMFA 4DNRB 5EQ0A 4XQJA 1WTRA 1TQOA 1GUOA 4HSVA 3R8BA 2NN6G 1PMRA 4BY1B 2Z1CA 2I46A 5C6AA 5BN4A 1VDZA 3HP3A 1Z47A 4WJWA 1SE2A 3NP8A 1B3AA 3MZ5A 4O1NA 4KN4C 3SK8A 4IUNA 3RUZA 5E3FA 3M4OB 2F0JA 3VA7A 3KLSA 1O78A 4FNFA 2H1EA 1QOHA 1U4MA 4XDXA 5JPMC 2C9OA 5C5MA 1H9JA 1TKWB 1LABA 3GV6A 5ELCA 5IGFA 1KABA 4Q5VA 3PUYA 5IGCA 1RODA 1F2MA 3HOUB 4ZKCB 2QEJC 3PV0A 1SNMA 1CA6A 1RD9D 1WTVA 2NN6I 4G4KA 1QB5D 2PW5A 2LFNA 2Y0SB 4OHJA 1XTCD 2KHSA 3J80E 2QKIC 1TWGB 5K5PA 5EKKA 3NBHA 1LTRD 2OEOA 1E0BA 3AMUA 2M00A 1I50B 2KQ3A 3I90A 1RF2D 4C3HG 3HS0C 2J0TD 2JSOA 3EQLC 3FVQA 3OMGA 2B2WA 3NK9A 3MXUA 3OMCA 1ZXTA 3VYTA 1EL0A 1KDAA 2PZTA 3SE0A 1ML0D 2XRQD 3K5OA 5M3MB 1SE3A 4DXFA 3TP6A 3Q23A 3I70A 1V8QA 2XRSD 2RSOA 4XQQA 4OO1G 4KY5A 1J9OA 2WB1B 3CRLC 5CYUA 3P1HA 1Q1EA 2K33A 1BCPD 1IW7D 4KD3A 4KKUA 3I4NB 5T1GA 1JORA 1CQFA 1ET9A 1CTMA 1HUNA 1TS2A 3MTSA 3D4DA 3GO5A 1VMPA 1HXYD 5KNCA 2ZXOA 4IFDG 1BBXC 3OWFA 1B9MA 2EJGC 2MPMA 4EVOA 2EY1A 2RKSA 5IODA 3H0GB 4KI0A 3BVGA 3T51B 3NWSA 1JR0D 3DM1A 1D5XC 5FO7B 1F77A 5E4XA 1Z6HA 4K14A 4QUCA 3J7AV 3S1QB 2MHVA 2Z8LA 2K6AA 4FXGC 1OXXK 4RA8A 2HDMA 4RCOA 1PZKD 3BVMA 5JEAH 4H44C 3T4AC 3LX0A 1A2TA 2XN9C 1F9PA 4XIGS 2O4XA 4OO1I 5G3LF 3G7LA 1TWHB 3IFDA 2PZUA 3DEPA 3Q6SA 3S17B 4ZRZA 2EE1A 3GTLB 3PIP3 1Q1BA 3I3CA 3TN2A 3T56B 3D4RA 1B53A 2F0IA 1AEXA 4IFDI 5EPKA 2VB3X 2IW3A 1PTOC 3S1NB 1KNAA 1IYVA 1KTKA 3DUZA 3LNNA 5CC4A 2B8FA 1ZEQX 4K5XA 3CHBD 3MWYW 3A7AB 4R8NA 1E2VA 2F0OA 2NVTB 4C3HB 1CK1A 5JVH3 2IL8A 2F0PA 5EBCA 4BA2I 3OIPA 3L7ZC 2Q8TA 1AZPA 4JK1C 4F87A 1H9SB 1WTPA 5JOBA 4MHEA 1U4LA 5JAVA 1ET6A 1W6KA 1B9NA 2GA4B 3BDCA 1SYCA 4UAIA 2EY2A 3NTKA 2PCFB 3TP8A 2QILA 2XNAC 2WP8J 2B2YC 4K8JA 1H9MA 2BE5D 1EIGA 1JOOA 1Q12A 2DN8A 3U9OA 1EY0A 2A68D 2JYOA 4DU9A 1T5XD 2ZT9C 3ONAB 4M8AA 1FNUA 1ONLA 3NWTA 1R4QB 2EPBA 3URYA 5KYIA 5DAUA 2Z4IA 1BR9A 3QOJA 5FLXE 1HHVA 5EJWA 1F2YA 3DMUA 1WD1A 4WFN3 2SEBD 4J8QA 1K8OA 2A6HC 5FK9C 2AUJD 2MGSA 2NVXB 2R7ZB 1HCZA 1PFBA 1V43A 2A68C 1PYWD 5A2QE 2NYZD 2KUMA 5D3DA 2RBMA 3J80L 4TSSA 4KJNA 3H94A 2SNSA 4CKCA 2Z4HA 2K01A 4HAEA 5C0XG 1T5EA 4RAUC 3VR4A 5LHY1 4ZUJA 2EY6A 3WOEA 1EYAA 2CQAA 1BF4A 1TWCB 1TVXA 3W2DA 3NQIA 1D2BA 3GTQB 1DXMA 4DA2A 1A3VA 1HA5A 2HCIA 1KDCA 1GXDC 3VR6A 4BS9A 2K7VA 1KAAA 1UUPA 4RKLA 4B08A 3DXJC 3BDOA 4NDXA 5M5WB 3FRPB 4KN7C 4UDUC 3S16B 1LTAD 3A55A 1QWYA 1YNNC 2JE6I 1ESRA 3PO2B 1WTWA 1PRTC 3IAYA 2K5WA 4BWGB 4HCSA 3Q24A 3BZDB 4X3UA 1EY7A 4RHRA 3QIAA 2FJ2A 3EFXD 3IFTA 1X3QA 4A93B 1SXTA 3ND8A 3K7AB 1O80A 2EYHA 1SDFA 3GTGB 3MXGA 2KOLA 2WACA 3SK4A 1X3PA 3K0YA 1I4GA 4KD4A 3HOXB 1B44D 3GD7A 1F9RA 3QJYA 1LTTD 1LACA 2OT2A 1LV9A 4BBSB 3V05A 5FO8B 4CKEA 1JWMD 1WD0A 1NR2A 2JA5B 3VYSA 2E2DC 2K32A 1A6XA 4NMZA 2EYFA 3JAME 1CA5A 4F8MA 4XYOA 2RQXA 4H13C 2B2WC 3EVQA 4G57A 2EXZA 1EEFD 2K04A 5J39A 1E2ZA 1D1KA 3H6MA 3RD4A 2ICEC 3J7YW 2KJXA 1EZ8A 2A73B 3P7JA 1HTPA 1UEAB 1RJTA 1HFNA 2TMPA 4O42A 4M1UB 2NN6H 1L0YB 1GHKA 1XXGA 1VMCA 5LL6S 3KK7A 1U9RA 3SK6A 1RHPA 5CV4A 4BBRB 1NR4A 1LTGD 1FNVA 1STNA 1LT6D 5IGGA 3ITPA 5C4XB 4XQNA 4A3DB 2HUGA 1H9SA 3M4YA 3ERQA 1PLFA 1Y1VB 4P2CB 2B2UA 4B9XA 1GJXA 4C56C 3M7NA 3AU7A 1I4QA 3Q0AA 4QIWB 1M8AA 5ELFA 2IT1A 3O13A 4RCNA 4FYDA 5HURA 1JOQA 2QF7A 2L12A 4IUUA 1RDPD 1F2ZA 1H9KA 2OXPA 2OF1A 5C0XJ 3SHLA 2L9HA 2L55A 3GTKB 1CM9A 2JP1A 1CQVA 2F0HA 4IUQA 1R9TB 2BDNA 4ME5A 3GTMB 1DCZA 1DONA 3E6ZX 2WIIB 5KRUA 4KHZA 4A3EB 1DOMA 4L6TB 5IOCA 1Y8NB 4OIKA 3NQTA 2WV6D 3V2TA 1EYDA 2V4DA 2IJ0A 1EY6A 5CR3A 1EWHA 1D5MC 2ID0A 3HZXA 5C5LA 4EQOA 5A2QL 2EJMA 3PUZA 5AFWA 2FMMA 1LT4D 4K6LA 4V0BA 3EJIA 4IUPA 4KTAA 2IX3A 4U673 1CFMA 1O7YA 1RKNA 3MC0B 5JPNC 3C1FA 1BCPB 2J4XA 1EYCA 2KCNA 4HMJA 3E5SA 5C3WA 1LLRD 3S1MB 2LKVA 5IGBA 1ILPA 1WVLA 1DOLA 2XWJB 4OO1H 2F0UA 4ULLA 5NUCA 4ZKBB 3C2PA 3SVMA 2MUYA 2A6EC 4HN7A 3M85A 3NBIA 4DAYA 2F0QA 4Y7NB 2E76C 3RLFA 1WTXA 2SOBA 4IFDH 1QILA 1AFPA 1HTLD 4PV1C 4BA1I 5I6YA 1SYBA 2F0MA 2ZXRA 1PZID 3T13A 1KDBA 2A69C 4J6HA 2JEBI 2K1BA 2KVMA 1WCMB 2BCOA 1ENFA 4PQXA 2AQ1B 4A3GB 3FDTA 4TQUS 4DAPA 1LT5D 2XVSA 2F3WA 1EQTA 2K05A 3D3RA 1Y8PB 2B63B 1TS3A 1Z7TA 2F0TA 2SDFA 1MD2D 4RWSC 5KIXA 2VUMB 1AN8A 1SNCA 2F0WA 1IYUA 2EYPA 4CJ0B 5I4DA 1JWSD 1G2SA 4FP5D 1QNKA 3RMHA 2M2LA 1PTOD 4IALA 3BYYB 1BCPF 1B1ZA 4KKSA 1OXVA 3JAML 3BDLA 2AQ2B 4LK1C 4RGNA 1ZKOA 2L5TA 2F0KA 3BVZA 1I6HB 3S2HB 2F0GA 2ENBA 1S5BD 1D1IA 1OO9B 2KECA 4CGYB 2EZVA 2HDLA 5D65A 4JBWA 5M3FB 4QF4A 1HQRD 1EFID 2QDBA 1ZYRC 2HQEA 1II3A 1SJED 1SBBB 3NXWA 3A54A 2F0FA 4N9TA 4Z9CB 1UAPA 1J8IA 3PIO3 1R4PB 2BOSA 1F9QA 2X6LA 5E4WC 1LO5D 1IHZA 1SNDA 1SNPA 3U9SA 5C4JB 1DJRD 4E6IA 1LTBD 4F7XA 3OIQA 3C1EA 3A56A 1XWEA 4DN4M 2ZXPA 1F2LA 1NAPA 3L3OC 2H4OA 3D6WA 2JA6B 5EKIA 2B2VA 1PXUA 2L0CA 2RVLA 2A6HD 3L9AX 4I7ZC 2KEEA 2D5DA 1V1OA 3K59A 5DM63 2E2HB 1U4RA 5BN5A 4QUFA 2VNUD 2FFKB 3M7GA 2MJ8A 3QWNA 3I4LA 2AWOA 2F4IA 4C3JB 1FD7D 3SK5A 5I6WA 3H09A 3NE5B 3IKJA 4IUVA 1K83B 1SYFA 1EWCA 2O5JC 4TRDA 3C46A 3TP7A 1I4PA 4XT1B 1QG7A 2I07B 1JICA 4RKBA 1I4XA 5DEHA 4HSPA 1GUGA 2L1BA 2LMCB 1L0XB 1QNUA 5CBAE 3IL8A 3MA2B 3OPOA 3QG1A 5EBDA 3D4WA 1FGBD 3KBXA 5LL6X 1PDQA 2C5CA 1HUMA 3EROA 1YNND 2EOTA 2F0SA 1PRTD 1BXTA 1XX8A 4G7ZC 2BA0A 2NTTA 3N6RA 4A3FB 3R2TA 1EEID 4MN3A 3ND9A 4C3IB 1DYQA 2B2UC 2EVBA 2B2TA 2DY7A 1CHPD 2NUCA 4G7OC 1SAPA 3P75A 2NTSA 3R3OA 1CT1D 1DOKA 2WAQB 1G91A 4ID6A 2DY8A 1CZGA 2A5HA 3N52A 1WTOA 5COYA 3TDQA 3J7AF 5TSSA 1SYGA 2JEAI 1SSOA 4WRDA 2E2JB 5C0XI 3I72A 5DM73 2EYJA 4NP5A 5I9OA 2DNCA 1JC7A 1OXSC 4A3BB 2O2LD 2BA1A 2LY7A 4A3IB 2R92B 1O7LA 2RDFA 4RGTA 5A35A 1JWUD 2K03A 2EDGA 5M5YB 2NBFA 3K6OA 5JEAJ 4KJOA 1MSHA 5I9PA 3FKIB 4A3KB 1HFGA 1SNQA 2R3ZA 1U4PA 4CHTB 3MFYA 4AYBB 2E74C 3KF8A 1BQQT 3HRZC 3D8GA 1KLGD 1V1PB 3SXHA 1Q8IA 1TT2A 3Q22A 3PO3B 4FXDA 3HGBA 1STHA 3S2DB 3K58A 1QCBD 2FHTA 4GZYC 1H9RA 1SYDA 2F0NA 3A8KE 5I2XA 1FYCA 1RTOA 4XXEA 3KLRA 1DZ1A 3R93A 4ILWA 4KY7A 1YNJD 1JE4A 2CW0D 2L11A 5ELDA 5K36G 1OXUA 2CHBD 1JB3A 2VXWA 2NVQB 1PFNA 5JJZA 3MHBA 2PZWA 3R2IA 3K5LA 5J1ZA 1G6ZA 3NTHA 3OSOA 4PMCA 1G2TA 4R9WA 4C1NK 4HMIA 1K8MA 1TY2A 1AZQA 2WKDA 1LT3D 4HCEA 3DEOA 4X3SA 4TKOB 1YNJC 2F3VA 3KUPA 2CW0C 1JOKA 3WOFA 2WINB 4FF1A 3D6CA 1HQMC 1TR5A 4FF4A 1STEA 1MSGA 3H91A 2MP1A 3DWAA 2PNRC 3DWQA 1KLUD 4K5WA 2IWHA 5D14A 1GUNA 3KLSX 1FR3A 3HOZB 3UI2A 4XYQA 1B2TA 3NUCA 2EYLA 5KEEA 3MAQA 4RFBA 5F2DA 2JA8B 3VR5A 1C4QA 1SEBD 1MBYA 5FLXL 4FO2A 2PMZB 3NSWA 4ZAIA 2R93B 3E0JA 2R61A 2RDGA 3NTIA 4ZK9B 4KY6A 5CV9A 3H3VC 5FKAC 3V96A 5CMDA 2RSNA 4CJ2C 5CV5A 1TS4A 4EQNA 4QMGA 1VF7A 3HOYB 3S1RB 1SMYD 1Y8OB 4DF7A 3SEBA 2A6ED 2F03A 3X3MA 2NB0A 1GUWA 3PUXA 3BS1A 4QB4A 5E1FA 4EQPA 1EY8A 4Q0FA 1ICWA 1EZ6A 3DWPA 4K2KA 1SFOB 1NUCA 4A3MB 1SMYC 1ENAA 4X3TA 2G9HD 2A69D 2KEDA 4KKTA 1STGA 2PQEA 3P20A 4G7HC 4K8IA 1X32A 1DD2A 4DAVA 1TY0A 2PW7A 3NPPA 1QJOA 2B2VC 4DK0A 3S15B 3VYUA 2WKCA 4IZ8A 1SNOA 1VCIA 4ZQ3A 5KNBA 4H0LC 1HA6A 2YYZA 1PTOB 4K6DA 2K28A 5C3XA 4XTCS 2RA4A 1JQYD 4EGVA 4LJZC 4HTHA 4C3JG 4F88A 2KCCA 3EA6A 3A8JE 4NW2A 1ESFA 1S5FD 4BY7B 1QE6A 3GP7A 3M3YB 2EJFC 4ODGA 1A2UA 3PUWA 1C8CA 5G3LD 4OL7A 1TWFB 4R8IA 3QO2A 1ENCA 4K2LA 4KMUC 1E2WA 3T16A 3NHHA 2FMCA 5BN3A 3RZOB 2YU9B 3GTPB 3MXPA 2RDHA 4ABNA 1M4VA 4OGQC 4FF3A 3OOCA 1EU4A 3CRKC 1TU2B 1O7ZA 1EIHA 3OHXC 1CHQD 3D31A 1G291 1XYIA 5FOBB 1BCPC 1IW7C 1BUVT 3CKIB 1NCVA 5M9OA 1A15A 3LWUA 1V1PA 1ZYRD 5D3IB 4NKLA 3FPUB 1TS5A 1D6EC 2D2CC 2LS01 1D5ZC 4L63B 1BOSA 5IT9E 2JXMB 5I2YA 1OXTA 4DNTB 4CJ1B 3OW7A 3A8IE 5IGEA 2B39A 4MIUA 4C3IG 3I4MB 3FPPA 2JA7B 5CV7A 4XT3B 1S5CD 2B2TC 4HR7B 1AW7A 2F0VA 3J81E 4KK7A 1Q90A 2TSSA 5JEAG 4X3KA 2NZ1D 5EGTA 3SR1A 1S5DD 3VR3A 1PTOF 5KNDA 3HOVB 3A7LA 5J22A 2F0DA 1DM0B 4RGMA 1IKLA 2A74C 3CQZB 2N55A 2PO4A 5CV6A 3SDZA 1MGSA 1Y69U 2M9VA 1GUTA 2F0EA 2ICIA 3TBIB 3X3NA 1Y1WB 3RZDB 3QB3A 4FXKC 3G6JB 2D9UA 2XSCA 4LAAA 1PZJD 5KGUA 3WDNA 3I73A 1EU3A 2NVYB 2J7ZA 1EY9A 3FEWX 5ISRA 1A3UA 4N9PA 2N88A 1PRTB 2DNEA 5KYLA 5C4HA 5EKLA 4DXGA 2XWBB 2E2IB 2F0LA 4CKBA 1SE4A 5C0XH 2F1MA 2L4NA 2G9DA 2QCPX 2PPBC 1EY4A 4YIJA 5CGKA 3S14B 3HOWB 4DFAA 2FINB 4IURA 1EQVA 2BE5C 4IQZA 3TZUA 1S4ZA 5JVG3 2K5DA 3TMEA 3TP5A 3T53B 2X69A 1JCKB 1I4RA 1F9SA 1GHJA 2AQ3B 4ZUIA 3MFGA 1IKMA 3HKZB 1IL8A 3VA5A 1G8ZD 1STBA 4I65A 1EY5A 3W3AA 4QCLA 4S3SA 5EPLA 5DNFA 1UNSA 1I3QB 3BG3A 4A3JB 5CORA 1EOTA 1STYA 4IFDJ 3BYTB 1C48A 4LMQD 3C3LA 2K5QA 4WORA 5HGTA 3KBGA 4C2MB 3GV3A 2PYKA 3HEJA 5M5XB 1VF5C 5FO9B 1BDOA 1S5ED 2EYOA 1KNEA 2D62A 1HRJA 4HEDA 4IN3A 1MI2A 4L8JA 3VYRA 3MVVA 2AUKA 4DGZA 1FNWA 5T1IA 2O5IC 4ZLTF 4B9WA 4RH6A 1PRTF 1STAA 5CV8A 3VR2A 2KA7A 3S9WA 1TIID 3K5MA 2R6GA 2XIWA 1A3TA 5IGDA 1RTNA 1TWAB 3GTJB 5EPJA 3FMCA 4J1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H7B A;  1JOO A;  1TT2 A;  2O4X A;  2F0S A;  3DHQ A;  3U9O A;  1EY0 A;  4F7X A;  1EQV A;  3C1E A;  4K6D A;  3EJI A;  3PMF A;  4DU9 A;  3OMG A;  1STH A;  2F0T A;  5C3X A;  5IIF A;  5EGT A;  4KTA A;  3SR1 A;  5KIX A;  3NK9 A;  4HTH A;  2PZU A;  1TQO A;  1SYD A;  2F0N A;  5KYI A;  3TME A;  3OMC A;  3TP5 A;  5J22 A;  2F0D A;  5DAU A;  1SNC A;  1RKN A;  3QOJ A;  2F0W A;  2EYP A;  3HZX A;  3C1F A;  1U9R A;  4KY6 A;  5C6A A;  5CV9 A;  3SK6 A;  1F2Y A;  1KDA A;  3DMU A;  5CV4 A;  4KY7 A;  4E6I A;  1EYC A;  5C4Z A;  2NUC A;  4HMJ A;  3E5S A;  1EY7 A;  1STN A;  2PZT A;  4ODG A;  1A2U A;  4ZUI A;  5C3W A;  3P75 A;  4OL7 A;  3NP8 A;  3R3O A;  5EKL A;  5CV5 A;  3VA5 A;  3MZ5 A;  5CV6 A;  3ITP A;  5IGG A;  2F0I A;  1ENC A;  1STB A;  1AEX A;  1EY5 A;  2EYH A;  2LKV A;  4I65 A;  4IAL A;  2SNM A;  4K2L A;  4QMG A;  4S3S A;  3T16 A;  3NHH A;  5IGB A;  3TP6 A;  3MHB A;  2PZW A;  3SK8 A;  4IUN A;  4ID6 A;  4DF7 A;  3RUZ A;  2F0U A;  5J1Z A;  3ERQ A;  5NUC A;  3BDL A;  5E3F A;  2F0E A;  3OSO A;  2WAC A;  3MXP A;  4KHV A;  4PMC A;  3SK4 A;  4KY5 A;  3SK5 A;  2F0J A;  1STY A;  5CC4 A;  4B9X A;  5I6W A;  4HMI A;  2RBM A;  4K5X A;  3P1H A;  3QB3 A;  4WOR A;  1SYG A;  4KD3 A;  2F0K A;  4KD4 A;  5HGT A;  4WRD A;  4KJN A;  2PYK A;  3HEJ A;  4R8N A;  2F0Q A;  2SNS A;  4PNY A;  1SYF A;  2EYJ A;  4NP5 A;  5HUR A;  5I9O A;  1JOQ A;  5C5M A;  1JOR A;  2F0O A;  2F0G A;  2ENB A;  4QB4 A;  4TRD A;  2EYO A;  2F3V A;  1F2Z A;  3TP7 A;  5M9O A;  1JOK A;  2F0P A;  2OXP A;  4LAA A;  5E1F A;  2SOB A;  3D4D A;  5IGF A;  4EQP A;  1EY8 A;  2OF1 A;  1KAB A;  5KGU A;  1SYE A;  1EZ6 A;  3D6C A;  3MEH A;  4K2K A;  1TR5 A;  4ZUJ A;  3SHL A;  4NKL A;  1NUC A;  2RDF A;  3OWF A;  5KRU A;  1EY9 A;  4QF4 A;  1ENA A;  5IGC A;  2EY6 A;  4EVO A;  5ISR A;  1F2M A;  1A3U A;  2QDB A;  2EY1 A;  4N9P A;  1EYA A;  2RKS A;  2F0H A;  2HQE A;  5IOD A;  1II3 A;  4NMZ A;  3NXW A;  2EYF A;  1SNM A;  1STG A;  5JOB A;  5KYL A;  5I6Y A;  5C4H A;  2EYM A;  2F0F A;  5JAV A;  3MVV A;  2PQE A;  1SYB A;  2F0M A;  4K5V A;  4K8I A;  4ME5 A;  4N9T A;  4RKB A;  5DEH A;  4K5W A;  3SXH A;  1KDB A;  4KV6 A;  3T13 A;  4F8M A;  3QOL A;  4KJO A;  4J6H A;  2F0L A;  2PW5 A;  3BDC A;  4K14 A;  3EVQ A;  4G57 A;  4DGZ A;  2EXZ A;  4EQN A;  5IGE A;  1A3V A;  5I9P A;  1SYC A;  4B9W A;  2EY2 A;  4MIU A;  2PW7 A;  5J39 A;  1STA A;  5CV8 A;  1KDC A;  5IOC A;  1EY4 A;  2KHS A;  3NUC A;  3H6M A;  3S9W A;  1SNQ A;  5CV7 A;  4IZ8 A;  1SNO A;  5K5P A;  2EY5 A;  4YIJ A;  2EYL A;  3D4W A;  1IHZ A;  1A3T A;  3NQT A;  5EKK A;  3TP8 A;  1SND A;  1EYD A;  1EZ8 A;  3V2T A;  5CGK A;  1SNP A;  5IGD A;  1KAA A;  4ZQ3 A;  5KEE A;  2OEO A;  4RKL A;  4PMB A;  1NSN S;  4K8J A;  1EY6 A;  3D8G A;  5CR3 A;  2F3W A;  2F0V A;  5F2D A;  3LX0 A;  4DFA A;  1A2T A;  4NDX A;  2M00 A;  5C5L A;  3ERO A;  4EQO A;  4J1M A;  2KQ3 A; 
#chains in the Genus database with same CATH topology
 1XMO Q;  1W6J A;  1PHJ A;  3DHQ A;  4LFC Q;  3I8Z A;  3E9I A;  3CCS A;  4DK1 A;  2HHH Q;  3F2D A;  3HOY G;  5IIF A;  1U5K A;  1SFO H;  4U68 A;  1QUQ A;  1PH3 A;  3HG9 A;  1IZ6 A;  4YHH Q;  3HOU G;  4AQY Q;  1HPC A;  4DR6 Q;  1B50 A;  4Y7N H;  5C4Z A;  4B3M L;  4OIJ A;  3GTO B;  5K36 H;  2B2Y A;  3TSS A;  2ZM6 L;  4RGO S;  1PFM A;  4JG2 A;  2IX1 A;  4RHS A;  3ERS X;  3CXC A;  1BO0 A;  2SNM A;  1PH8 A;  2ZJQ A;  5C3E B;  2E75 C;  5ELB A;  5IT9 L;  3PUV A;  3F2U A;  4A3M G;  4KHV A;  1WTQ A;  2Q8R E;  1PTO H;  2ZJP A;  1LTI D;  2IX0 A;  1C7Y A;  1PVO A;  4ZYS A;  1B4O A;  2VB2 X;  2BDO A;  2NWG A;  5GAD C;  3ICE A;  2B8G A;  1CI3 M;  1WCM H;  4JW0 A;  2X6G A;  3OWE B;  4A3G H;  1LTS D;  1RCV D;  5CBE E;  3K5N A;  2ASB A;  3MXN A;  3J81 L;  2CVR A;  2KCM A;  4PMW A;  1GUS A;  1SJH D;  1AP0 A;  5FJ8 H;  1SYE A;  3MEH A;  3ZYY X;  3RN2 A;  3CU7 A;  3LWE A;  5IT9 c;  1N8R C;  4K0K Q;  2IPK D;  1I4H A;  3CCV A;  1I6V C;  2Q8I B;  1KD1 C;  2B63 H;  2AWN A;  3PGZ A;  2N49 A;  4C1N I;  2EYM A;  4V19 0;  1WI5 A;  2IHE A;  4K5V A;  1CZW A;  4KV6 A;  3QOL A;  2VUM H;  3GQB A;  1VQL A;  4IUT A;  1GOZ A;  5ELE A;  1ILQ A;  3TZD A;  1IBM Q;  5C44 B;  2WFW A;  4LF8 L;  1D7Q A;  4GKK L;  3T1H Q;  3J81 c;  2EY5 A;  1N9W A;  2HCC A;  4FF2 A;  3KLW A;  4BY7 G;  4A3C H;  2OQ0 A;  4PMB A;  4J15 A;  1NSN S;  3AB9 A;  4CBV A;  3K57 A;  1BNZ A;  4PNY A;  3I91 A;  4H7B A;  4JI6 Q;  1Q3L A;  4FVM A;  4JI3 L;  3PMF A;  1A62 A;  1GO3 E;  4DNR B;  5EQ0 A;  4XQJ A;  1WTR A;  1GKH A;  1TQO A;  1GUO A;  3FHW A;  4HSV A;  4DR7 Q;  3R8B A;  4GNX B;  3TRZ A;  1VQD A;  3TQY A;  2NN6 G;  1PMR A;  1HZC A;  3F2C A;  2Z1C A;  4BY1 B;  3KJP A;  2I46 A;  4LF4 L;  1GVP A;  1I6H H;  5C6A A;  5BN4 A;  1VDZ A;  3STB D;  1DGS A;  3HP3 A;  3M4Q A;  1IL2 A;  3S2H H;  1VQF A;  1Z47 A;  4WJW A;  1SE2 A;  3NP8 A;  1B3A A;  2V1C C;  3MZ5 A;  4JV5 L;  4O1N A;  4EX5 A;  2ES2 A;  2VQF Q;  1XJV A;  5M3F H;  4KN4 C;  2KHJ A;  1VQO A;  4HID A;  1HH2 P;  3SK8 A;  4IUN A;  3S24 A;  4GN3 B;  3RUZ A;  5E3F A;  3M4O B;  3RLN A;  4PZ8 A;  2F0J A;  3VA7 A;  1EIY B;  1YHB A;  3KLS A;  1O78 A;  4B3S Q;  4FNF A;  1FGU A;  2H1E A;  1QOH A;  1U4M A;  4GN5 A;  4XDX A;  5JPM C;  1B8A A;  3STB C;  2C9O A;  5C5M A;  4DPG A;  4DV1 L;  1H9J A;  1TKW B;  1LAB A;  2F4V Q;  3I4M G;  3GV6 A;  5ELC A;  1VQ7 A;  2JA7 G;  5IGF A;  5C4J H;  1KAB A;  4Q5V A;  3PUY A;  4YCU A;  5IGC A;  1ROD A;  1W2B A;  1F2M A;  3HOU B;  4LWC A;  2QEJ C;  4ZKC B;  3PV0 A;  1SNM A;  1WOC A;  1CA6 A;  3E3X A;  4JI4 L;  1RD9 D;  1WTV A;  2NN6 I;  2UUB Q;  2JA6 H;  2K52 A;  4G4K A;  1QB5 D;  4JBK A;  2PW5 A;  2LSS A;  1K0R A;  2Z9H A;  1L1O A;  2LFN A;  2Y0S B;  4OHJ A;  1XTC D;  3HOV G;  1BVS A;  1Q8K A;  2KHS A;  3J80 E;  2QKI C;  1TWG B;  5K5P A;  2E2H H;  2UXD L;  5EKK A;  3NBH A;  1ICF B;  1LTR D;  1IYJ B;  4R4Q A;  2OEO A;  1E0B A;  1FVI A;  2QA4 A;  3AMU A;  3MEF A;  4GLA C;  2LXJ A;  2M00 A;  2MO0 A;  3AFQ A;  1I50 B;  2KQ3 A;  3ULP A;  3I90 A;  1RF2 D;  4X62 Q;  4C3H G;  3HS0 C;  2J0T D;  2JSO A;  4JC0 A;  3EQL C;  3FVQ A;  3OMG A;  4C3J H;  1KXL A;  2LXK A;  4HIK A;  2B2W A;  3NK9 A;  3MXU A;  2B29 A;  4OON A;  3OMC A;  1ZXT A;  2UUA L;  1K83 H;  5J3B A;  1Y1W G;  1K73 C;  3VYT A;  1EL0 A;  1KDA A;  5BR8 L;  2PZT A;  3SE0 A;  1ML0 D;  2XRQ D;  3K5O A;  5M3M B;  1VQG A;  3KOJ A;  3U4V A;  1SE3 A;  2Y0S E;  4DXF A;  5IYD G;  4LW1 A;  3TP6 A;  3Q23 A;  3CPW A;  3I70 A;  1YJW A;  1V8Q A;  2XRS D;  4UP7 A;  2YTV A;  2RSO A;  4GS3 A;  4XQQ A;  4OO1 G;  4KY5 A;  4P73 A;  1J9O A;  2WB1 B;  3E9H A;  3CRL C;  2CH4 W;  5CYU A;  3P1H A;  1X65 A;  1Q1E A;  2K33 A;  1BCP D;  1IW7 D;  4KD3 A;  1IBK L;  1VQ5 A;  4KKU A;  1N34 L;  3I4N B;  4YWK A;  5T1G A;  3CMA A;  1JOR A;  1CQF A;  2ZJR A;  1ET9 A;  1CTM A;  1HUN A;  1TS2 A;  3MTS A;  3E0E A;  4P74 A;  3D4D A;  3GO5 A;  1VMP A;  1HXY D;  5IWA Q;  5KNC A;  2ZXO A;  4IFD G;  3HOW G;  1BBX C;  3OWF A;  1B9M A;  2EJG C;  4LF7 Q;  3L2P A;  5IP7 H;  4JI7 Q;  2MPM A;  4EVO A;  2EY1 A;  2RKS A;  5IOD A;  3J81 i;  3H0G B;  4KI0 A;  4RG1 A;  1PA6 A;  3BVG A;  3T1Y Q;  4A3F H;  3T51 B;  2Z0S A;  3NWS A;  1JR0 D;  3DM1 A;  4Y52 H;  2R7Z G;  1D5X C;  3BU2 A;  4C3I H;  5FO7 B;  1F77 A;  1Z6H A;  2GVB A;  4K14 A;  4QUC A;  5E4X A;  4LF6 L;  3J7A V;  3S1Q B;  2MHV A;  2Z8L A;  2K6A A;  4FXG C;  2WB1 E;  1OXX K;  4RA8 A;  2HDM A;  4RCO A;  4N8F A;  2DGY A;  2ZTE A;  1PZK D;  3BVM A;  5JEA H;  4H44 C;  3HKZ G;  3T4A C;  3LX0 A;  1A2T A;  3I4O A;  2XN9 C;  1F9P A;  1EQR A;  4XIG S;  4DNI A;  2O4X A;  3KF8 B;  4OO1 I;  5G3L F;  4R4T A;  2UU9 L;  3G7L A;  1TWH B;  3IFD A;  2PZU A;  3DEP A;  3Q6S A;  3CCM A;  3S17 B;  4ZRZ A;  2EE1 A;  1XMQ L;  4L5S A;  3U50 C;  3GTL B;  3PIP 3;  4GOP A;  2E2J H;  3A5U A;  4QL5 A;  1Q1B A;  3I3C A;  4X6A H;  3TN2 A;  4A3B H;  3T56 B;  3D4R A;  1B53 A;  4A3I H;  2F0I A;  4GKK Q;  1AEX A;  4IFD I;  5EPK A;  2VB3 X;  2IW3 A;  2R92 H;  1XPR A;  3PCO B;  4O2D A;  1PTO C;  2JN4 A;  1K9M C;  5M5Y H;  3S1N B;  1KNA A;  1IYV A;  3J81 j;  1KTK A;  3DUZ A;  3LNN A;  5CC4 A;  4JI3 Q;  2B8F A;  1QZG A;  1ZEQ X;  4K5X A;  3CHB D;  3MWY W;  3A7A B;  3ER0 A;  3FKI H;  4R8N A;  1YIT A;  1CUK A;  1E2V A;  3UDG A;  2F0O A;  3NEN A;  2NVT B;  2A8V A;  4C3H B;  1CK1 A;  5JVH 3;  2IL8 A;  4LF4 Q;  1K28 A;  2F0P A;  5EBC A;  3HFZ B;  4BA2 I;  4GN4 B;  3OIP A;  3L7Z C;  4YY3 L;  2Q8T A;  1AZP A;  2K75 A;  4JK1 C;  4DR2 L;  4F87 A;  4L5R C;  4GLX A;  3PO3 H;  1H9S B;  1AE3 A;  2BH2 A;  3S2D H;  1WTP A;  5JOB A;  4MHE A;  1U4L A;  1H95 A;  5JAV A;  1ET6 A;  1W6K A;  2VW9 A;  2H5X A;  1B9N A;  4HJ9 A;  2GA4 B;  3BDC A;  4N8X 1;  1SYC A;  4UAI A;  2EY2 A;  4JI0 L;  2PI2 A;  3NTK A;  1MKH A;  2PCF B;  3TP8 A;  2QIL A;  1BKB A;  2XNA C;  4GKJ L;  4UHV A;  2WP8 J;  2B2Y C;  4K8J A;  1H9M A;  2NVQ H;  4OX9 L;  2BE5 D;  1EIG A;  3J7A 5;  4L5T A;  4HJ8 A;  1JOO A;  1Q12 A;  2DN8 A;  3U9O A;  1EY0 A;  2A68 D;  2JYO A;  5C3E G;  4DU9 A;  1T5X D;  2ZT9 C;  3ONA B;  4R4I A;  4M8A A;  1FNU A;  1ONL A;  3NWT A;  1R4Q B;  2EPB A;  3URY A;  5KYI A;  2R7D A;  5DAU A;  2Z4I A;  1BR9 A;  3QOJ A;  1YVC A;  5FLX E;  1HHV A;  4FDB A;  5EJW A;  4QY7 A;  1F2Y A;  3DMU A;  1WD1 A;  4WFN 3;  2SEB D;  1IBL Q;  4J8Q A;  5IP9 G;  1C0A A;  1K8O A;  1XPO A;  2A6H C;  5FK9 C;  4P75 A;  2AUJ D;  2MGS A;  2NVX B;  2R7Z B;  1HCZ A;  1PFB A;  1V43 A;  2A68 C;  1PYW D;  1WYD A;  5A2Q E;  2NYZ D;  2KUM A;  2UUC L;  5D3D A;  4JYA L;  1JB7 A;  2RBM A;  3J80 L;  3AEV A;  4TSS A;  1T9H A;  3HOZ H;  4KJN A;  3H94 A;  2SNS A;  4DV3 Q;  2N3S A;  1I94 Q;  2VY3 A;  4CKC A;  1B3Q A;  5C44 G;  2Z4H A;  1K8A C;  2K01 A;  4HAE A;  1KL9 A;  5C0X G;  3KYH C;  1T5E A;  4RAU C;  2JA8 H;  3VR4 A;  3L0O A;  5LHY 1;  4ZUJ A;  4B3T L;  2ALY B;  1CSP A;  4X66 Q;  5FLM G;  2EY6 A;  2DJG C;  3WOE A;  1EYA A;  2F3I A;  2CQA A;  4JI1 Q;  1BF4 A;  4B3R L;  2R93 H;  1TWC B;  3G6E A;  4IPD A;  1TVX A;  3W2D A;  1N32 L;  3NQI A;  1D2B A;  3GTQ B;  3AFP A;  3J80 c;  1DXM A;  3U58 A;  4DA2 A;  3D0F A;  1A3V A;  1HA5 A;  2HCI A;  4JBJ A;  4KHP L;  1KDC A;  4BY1 G;  1PFS A;  4DAY B;  3J7Z C;  1UE1 A;  3H3V I;  1GXD C;  3VR6 A;  4BS9 A;  2K7V A;  1KAA A;  1UUP A;  4RKL A;  4B08 A;  3DXJ C;  3BDO A;  4NDX A;  2UXB L;  3HOY H;  3S1R H;  5M5W B;  3CCL A;  2F52 A;  3FRP B;  4KN7 C;  4UDU C;  3S16 B;  1LTA D;  3A55 A;  1QWY A;  2DJF C;  4OWX B;  1YNN C;  2JE6 I;  1ESR A;  3PO2 B;  1HNW L;  3G4S A;  1WTW A;  1NY4 A;  1PRT C;  1YJN A;  3IAY A;  2CCZ A;  1FJG L;  2K5W A;  4BWG B;  4HCS A;  2B3G A;  3OTO Q;  3Q24 A;  3BZD B;  4X3U A;  1EY7 A;  4RHR A;  3QIA A;  1J5E L;  4LF6 Q;  2FJ2 A;  3AYH B;  3EFX D;  3IFT A;  1X3Q A;  4A93 B;  1SXT A;  3ND8 A;  3K7A B;  1O80 A;  2I0Q A;  2EYH A;  1SDF A;  3GTG B;  4LF5 Q;  2EXD A;  4CDF C;  3PQI A;  3MXG A;  1LM0 A;  5ELO A;  4A3M H;  4APV A;  1KQS A;  2KOL A;  1EQQ A;  2WAC A;  3SK4 A;  1X3P A;  3K0Y A;  3CCR A;  1BBU A;  2GVA A;  1I4G A;  2UU9 Q;  4KD4 A;  3CCJ A;  3HOX B;  1E1T A;  1B44 D;  3GD7 A;  2HQL A;  3S15 H;  1HZ9 A;  1F9R A;  3QJY A;  1LTT D;  1L1O C;  1NNX A;  2Y0S G;  1LAC A;  1HNX L;  2OT2 A;  1LV9 A;  4BBS B;  3V05 A;  5FO8 B;  2HIV A;  1UEB A;  4CKE A;  1JWM D;  1PYB A;  4DUY L;  2DUD A;  1XTD A;  1NR2 A;  1WD0 A;  2JA5 B;  3VYS A;  2E2D C;  2K32 A;  2RHS B;  1A6X A;  4YWM A;  3CP0 A;  4NMZ A;  2EYF A;  3JAM E;  4KLK A;  2HT1 A;  3RNU A;  1W3S A;  5AJ3 L;  1CA5 A;  4F8M A;  4XYO A;  4MTN A;  2RQX A;  1GD7 A;  4H13 C;  2B2W C;  3EVQ A;  4G57 A;  4AIM A;  2EXZ A;  1EEF D;  1EFW A;  2K04 A;  5J39 A;  4BY7 H;  4NPS A;  2D0P A;  1E2Z A;  1D1K A;  2PQA B;  3H6M A;  2ICE C;  3RD4 A;  3J7Y W;  3M3Y H;  2KJX A;  4DAM A;  4DK6 C;  1SLJ A;  1EZ8 A;  2A73 B;  1TWF H;  3P7J A;  1HTP A;  4YWL A;  1B70 B;  5M3M G;  2N78 A;  2N8N A;  4HIO A;  4ME3 A;  5E7N A;  1UEA B;  1RJT A;  1HFN A;  2TMP A;  1JE5 A;  4O42 A;  1PH1 A;  5LMN L;  1KRT A;  4M1U B;  1N36 L;  2YU9 H;  3GTP H;  1E1O A;  3RZO H;  2NN6 H;  1XNR Q;  1L0Y B;  1GHK A;  1XXG A;  1VMC A;  5IYB G;  1O7I A;  2WB1 G;  5LL6 S;  3KK7 A;  1U9R A;  3SK6 A;  1RHP A;  5CV4 A;  4BBR B;  1NR4 A;  3I4N G;  4LUV A;  1LTG D;  2E5L Q;  1FNV A;  1STN A;  2OCE A;  3CF5 A;  4I7A A;  1LT6 D;  5IGG A;  3ITP A;  1WCM G;  5C4X B;  4XQN A;  4A3D B;  2HUG A;  1H9S A;  3M4Y A;  4GKJ Q;  3ERQ A;  1PLF A;  1Y1V B;  4P71 A;  2VS1 A;  4P2C B;  3EIV A;  2B2U A;  5FJ8 G;  3H0G G;  4B9X A;  1UWV A;  1GJX A;  4C56 C;  3M7N A;  3AU7 A;  4NXM L;  4X65 Q;  1I4Q A;  3Q0A A;  4QIW B;  1M8A A;  4NXN L;  1M1K C;  5ELF A;  2A1A A;  2IT1 A;  3O13 A;  4RCN A;  4FYD A;  4DV0 L;  5HUR A;  1JOQ A;  2QF7 A;  2L12 A;  4IUU A;  3I4M H;  1RDP D;  2JA7 H;  1HR0 Q;  1X54 A;  1VQM A;  1F2Z A;  4OEM B;  2VQE L;  1H9K A;  2OXP A;  3J80 i;  1MJE A;  2OF1 A;  4IOA A;  5C0X J;  3SHL A;  2L9H A;  2L55 A;  3GTK B;  1CM9 A;  1JJ2 A;  2JP1 A;  1CQV A;  3OW2 A;  2F0H A;  4IUQ A;  1R9T B;  2BDN A;  1A0I A;  3A74 A;  4ME5 A;  1Q46 A;  3GTM B;  1D8L A;  1DCZ A;  1JMC A;  1DON A;  3HOV H;  3E6Z X;  2WII B;  5KRU A;  4KHZ A;  1X3E A;  4A3E B;  1DOM A;  4JCV E;  4DR3 L;  3CQZ H;  4L6T B;  5IOC A;  4A75 A;  4QJF A;  4DR4 L;  4GOP C;  1Y8N B;  4OIK A;  3NQT A;  2WV6 D;  3V2T A;  1EYD A;  4QIW E;  2V4D A;  1SN8 A;  2IJ0 A;  1CSQ A;  1EY6 A;  5CR3 A;  4JOI C;  1EWH A;  1D5M C;  2ID0 A;  3HZX A;  5C5L A;  4EQO A;  5A2Q L;  2EJM A;  3PUZ A;  5AFW A;  2FMM A;  1E3P A;  1LT4 D;  4K6L A;  4V0B A;  4DR1 Q;  3EJI A;  4IUP A;  4KTA A;  4DV4 Q;  5FLX c;  2IX3 A;  1Y1W H;  5GAG C;  3RZD H;  4U67 3;  5LMU Q;  1CFM A;  1O7Y A;  1RKN A;  3MC0 B;  5JPN C;  3W1G A;  3C1F A;  1C9O A;  1S72 A;  3CCQ A;  4X64 L;  3G48 A;  1BCP B;  2J4X A;  1EYC A;  2KCN A;  4HMJ A;  3E5S A;  2PMZ E;  5C3W A;  4DV2 Q;  5IYD H;  1LLR D;  3S1M B;  2LKV A;  2OWO A;  3B6Y A;  5IGB A;  1ILP A;  1WVL A;  1XNQ Q;  2NVY H;  1DOL A;  2CWP A;  4IOC A;  2UXC Q;  2XWJ B;  2CFM A;  3G71 A;  4OO1 H;  1RIP A;  3M4P A;  2F0U A;  4ULL A;  4DUZ Q;  1YJ9 A;  5NUC A;  4WJ3 M;  4ZKB B;  4NB3 A;  3C2P A;  3SVM A;  1VQP A;  3W1B A;  5GQO A;  2RHQ B;  3KDF B;  2MUY A;  2A6E C;  2E2I H;  4HN7 A;  3M85 A;  3NBI A;  1AH9 A;  4DAY A;  2F0Q A;  4Y7N B;  3IRB A;  2KHI A;  3F2B A;  3S14 H;  2E76 C;  3RLF A;  1WTX A;  2SOB A;  4IFD H;  1QIL A;  3HOW H;  4UY8 C;  1AFP A;  1E7Z A;  1HTL D;  1G6P A;  1S3O A;  1HR0 W;  4PV1 C;  4BA1 I;  4JBM A;  2R7Z H;  5I6Y A;  1SYB A;  1X55 A;  2F0M A;  2ZXR A;  1PZI D;  3T13 A;  1KDB A;  2A69 C;  4OXP A;  4J6H A;  2JEB I;  2K1B A;  2KVM A;  1WCM B;  2BCO A;  1ENF A;  4PQX A;  1LYL A;  2AQ1 B;  4A3G B;  3FDT A;  4TQU S;  4DAP A;  3CCE A;  4B3M Q;  2K5V A;  2ZM6 Q;  2XTI A;  4QGU A;  4HJ5 A;  1LT5 D;  4LFB L;  2XVS A;  2F3W A;  1S40 A;  3UE1 A;  1EQT A;  2Z6K A;  2K05 A;  3D3R A;  1Y8P B;  2B63 B;  1UE6 A;  1I3Q H;  1TS3 A;  1Z7T A;  2F0T A;  2SDF A;  1MD2 D;  4A3J H;  4RWS C;  4DUY Q;  5KIX A;  3DM3 A;  1X3F A;  4IJH A;  1NTG A;  2VUM B;  1AN8 A;  1Q86 C;  1SNC A;  2F0W A;  1IYU A;  2EYP A;  4C2M H;  5M5X H;  4CJ0 B;  5I4D A;  3GTQ H;  3ULL A;  1QUQ B;  1JWS D;  1JJC B;  1G2S A;  4FP5 D;  1QNK A;  3RMH A;  4DR5 L;  2M2L A;  3DLL A;  4UP9 A;  1MIU A;  4LFA L;  4JI5 L;  1N33 L;  5JJK A;  1PTO D;  1VQJ A;  4IAL A;  3BYY B;  1BCP F;  1B1Z A;  4DV5 L;  4KKS A;  1XMO L;  1OXV A;  4LFC L;  3JAM L;  2HHH L;  5H1S E;  3BDL A;  4CDD C;  2AQ2 B;  3S16 H;  4LK1 C;  4RGN A;  4MTK A;  4YHH L;  1ZKO A;  2L5T A;  2F0K A;  3BVZ A;  4DR6 L;  3PIP A;  2PQA A;  1I6H B;  3A5Z B;  4LF8 Q;  2F0G A;  3S2H B;  2ENB A;  1S5B D;  1D1I A;  1OO9 B;  2KEC A;  4CGY B;  2EZV A;  2HD3 A;  1TWA H;  2HDL A;  3GTJ H;  5D65 A;  4JBW A;  5M3F B;  1L2F A;  4UP8 A;  1VQK A;  4QF4 A;  3JAM c;  3ULJ A;  1HQR D;  1EFI D;  2QDB A;  2ZTC A;  1ZYR C;  2HQE A;  1II3 A;  1SJE D;  1SBB B;  3NXW A;  3A54 A;  2F0F A;  5ELN A;  4N9T A;  3PF4 A;  3CME A;  4Z9C B;  2Z6B A;  1UAP A;  3PO2 G;  1J8I A;  3PIO 3;  1NBW A;  1R4P B;  2BOS A;  2Q2U A;  1F9Q A;  2X6L A;  5E4W C;  5IYC H;  3GTO H;  2XGT A;  2D0O A;  1LO5 D;  1IHZ A;  1SND A;  3M9B A;  1SNP A;  2L15 A;  3U9S A;  4JV5 Q;  3EN2 A;  5C4J B;  1DJR D;  4A93 G;  5C3E H;  2QEX A;  4E6I A;  4K0K L;  3I2Z A;  4BXX G;  4GNX A;  1LTB D;  4F7X A;  1LUZ A;  3C1E A;  3A56 A;  1XWE A;  3OIQ A;  4DN4 M;  4R4C A;  2ZXP A;  1F2L A;  1NAP A;  3LGJ A;  3L3O C;  2H4O A;  3D6W A;  2JA6 B;  3UDF A;  5EKI A;  3SGI A;  2B2V A;  1UE7 A;  4L5Q A;  1IBM L;  1PXU A;  2L0C A;  2RVL A;  3T1H L;  2BH8 A;  3L9A X;  2A6H D;  4I7Z C;  3HOX G;  2KEE A;  4DV1 Q;  2D5D A;  3H3V H;  1V1O A;  3K59 A;  5DM6 3;  2E2H B;  1U4R A;  4O0A A;  5BN5 A;  2KCT A;  4QUF A;  4BBS G;  4A3K G;  2VNU D;  2FFK B;  3M7G A;  2MJ8 A;  4JI6 L;  3QWN A;  3I4L A;  2AWO A;  2F4I A;  4C3J B;  2JA5 G;  1FD7 D;  4JI4 Q;  3SK5 A;  4DR7 L;  5I6W A;  3H09 A;  3NE5 B;  3IKJ A;  4QQB X;  4IUV A;  1K83 B;  5C44 H;  4JI2 L;  1A63 A;  1SYF A;  1HJP A;  1EWC A;  2O5J C;  1RL2 A;  4TRD A;  4POF A;  3C46 A;  2UXD Q;  1Q81 C;  3TP7 A;  3QR8 A;  5FLM H;  2VQF L;  1X3G A;  1I4P A;  4JPB W;  4XT1 B;  1QG7 A;  2I5M X;  1V1Q A;  2I07 B;  1JIC A;  4RKB A;  1I4X A;  5DEH A;  4HSP A;  4B3S L;  1GUG A;  3RN5 A;  2L1B A;  4BY1 H;  2LMC B;  1L0X B;  2UUA Q;  1QNU A;  5CBA E;  3IL8 A;  3MA2 B;  3OPO A;  3QG1 A;  5EBD A;  5BR8 Q;  2F4V L;  3D4W A;  1FGB D;  3F1Z A;  3KBX A;  4MZ9 A;  4BBR G;  1L1O B;  5LL6 X;  1PDQ A;  2C5C A;  4OWW B;  1HUM A;  3ERO A;  1YNN D;  2EOT A;  5C4X G;  2F0S A;  1PRT D;  1BXT A;  4A3D G;  2OTJ A;  1QVF A;  1XX8 A;  1YBY A;  4IJL A;  2I5L X;  3KDF A;  4G7Z C;  3M4O H;  2BA0 A;  3U4Z A;  2NTT A;  2UUB L;  1PH7 A;  3N6R A;  4A3F B;  3R2T A;  1V9P A;  1EEI D;  1Y1V G;  4GLV B;  4MN3 A;  3ND9 A;  4C3I B;  1DYQ A;  2B2U C;  1IBK Q;  2EVB A;  1N34 Q;  1NMF A;  2B2T A;  2DY7 A;  1KC8 C;  1CHP D;  2NUC A;  4G7O C;  1SAP A;  3P75 A;  2NTS A;  2MO1 A;  3R3O A;  4YCW A;  1CT1 D;  1DOK A;  2QDL A;  2WAQ B;  4X62 L;  1G91 A;  4ID6 A;  2DY8 A;  3HOU H;  1CZG A;  1PH6 A;  2A5H A;  4A3L G;  4DV7 L;  3N52 A;  4HJ7 A;  1WTO A;  5COY A;  1LTL A;  1J6Q A;  3TDQ A;  3J7A F;  1SYG A;  5TSS A;  2JEA I;  1SSO A;  4WRD A;  4WJ4 A;  3JAM i;  2E2J B;  5C0X I;  2RF4 A;  3I72 A;  5DM7 3;  2EYJ A;  4NP5 A;  5I9O A;  4A3E G;  1SMX A;  2DNC A;  1JC7 A;  3A0J A;  1QVC A;  1TWG H;  3W5O A;  3BJU A;  1OXS C;  4A3B B;  2O2L D;  1VQH A;  2BA1 A;  2LY7 A;  4A3I B;  2E8G A;  4DR5 Q;  1I50 H;  1O7L A;  2RDF A;  2R92 B;  4RGT A;  5A35 A;  1JWU D;  2K03 A;  4OWT B;  2EDG A;  5M5Y B;  4DV5 Q;  2NBF A;  1QZH A;  3K6O A;  4ZCK A;  2WAQ E;  5JEA J;  4KJO A;  1XMQ Q;  1MSH A;  5I9P A;  3FKI B;  4A3K B;  1YZ6 A;  1HFG A;  1SNQ A;  2R3Z A;  1U4P A;  4CHT B;  3MFY A;  4AYB B;  5M3M H;  2E74 C;  1GM5 A;  3KF8 A;  1BQQ T;  5IWA L;  3HRZ C;  3D8G A;  1KLG D;  1V1P B;  3SXH A;  3UE0 A;  4LF7 L;  1YEZ A;  1Q8I A;  4JI7 L;  1TT2 A;  3Q22 A;  3PO3 B;  4FXD A;  3HGB A;  2CKZ B;  1KAW A;  3CW2 C;  1STH A;  4YCV A;  5IYB H;  3S2D B;  2RCN A;  3T1Y L;  3K58 A;  3TS0 A;  1QCB D;  3CC7 A;  2FHT A;  4GZY C;  1H9R A;  1SYD A;  2F0N A;  3A8K E;  5I2X A;  1FYC A;  1RTO A;  4XXE A;  3KLR A;  1X6O A;  4AH6 A;  1DZ1 A;  3I4N H;  3R93 A;  4ILW A;  4PZ6 A;  4KY7 A;  1YNJ D;  1JE4 A;  2CW0 D;  2L11 A;  3F8T A;  1K8G A;  4GOP B;  5ELD A;  5K36 G;  1OXU A;  2CHB D;  1JB3 A;  2VXW A;  4YY3 Q;  2NVQ B;  1PFN A;  2GN5 A;  5JJZ A;  3MHB A;  2PZW A;  4AYB E;  3R2I A;  4DR2 Q;  1SE8 A;  3K5L A;  5J1Z A;  1G6Z A;  3NTH A;  3H0G H;  2ATW A;  3OSO A;  1VQ6 A;  4PMC A;  3ZJY C;  1G2T A;  4R9W A;  2I5H A;  4C1N K;  4HMI A;  3KFU A;  1K8M A;  1TY2 A;  4JI8 L;  1AZQ A;  3S1Q H;  2WKD A;  4EQ5 A;  4JI0 Q;  1LT3 D;  4HCE A;  3DEO A;  4X3S A;  3CC4 A;  4TKO B;  1YNJ C;  2F3V A;  1EUJ A;  3KUP A;  2CW0 C;  4A3G G;  1JOK A;  2NZO A;  3WOF A;  2WIN B;  4FF1 A;  2YV5 A;  3D6C A;  4OX9 Q;  1HQM C;  1TR5 A;  4FF4 A;  3NEM A;  1STE A;  1MSG A;  2KEN A;  3H91 A;  3K81 C;  3UDX A;  2YTY A;  2MP1 A;  3DWA A;  2PNR C;  2Z6K C;  2MQH A;  3DWQ A;  2B63 G;  1TWH H;  1KLU D;  3S17 H;  4K5W A;  2IWH A;  5D14 A;  1GUN A;  3KLS X;  3GTL H;  1FR3 A;  3HOZ B;  3UI2 A;  4A76 A;  4XYQ A;  1YI2 A;  1M90 C;  2VUM G;  4LNQ A;  1B2T A;  3NUC A;  3NEL A;  4ALP A;  2EYL A;  5KEE A;  4R1J A;  3MAQ A;  4JI2 Q;  4RFB A;  5F2D A;  2JA8 B;  4A3C G;  3VR5 A;  1C4Q A;  1SEB D;  3RLO A;  1HNZ L;  1MBY A;  5FLX L;  4FO2 A;  2PMZ B;  3NSW A;  3S1N H;  4ZAI A;  2R93 B;  3E0J A;  4DV6 L;  2UUC Q;  4JYA Q;  2R61 A;  2RDG A;  3NTI A;  4ZK9 B;  4KY6 A;  5CV9 A;  3H3V C;  5FKA C;  2NVT H;  3V96 A;  1MJC A;  4C3H H;  5CMD A;  2RSN A;  4CJ2 C;  2OQK A;  5CV5 A;  1TS4 A;  4JOI A;  4EQN A;  4QMG A;  1VF7 A;  3TS2 A;  1PH9 A;  4B3T Q;  3S1R B;  3HOY B;  1SMY D;  1Y14 B;  1Y8O B;  1Z9F A;  4HIM A;  2K4K A;  4DF7 A;  2R7F A;  5M3F G;  1K0S A;  3SEB A;  2A6E D;  2PI2 E;  1Q7Y C;  3OYY A;  2F03 A;  1IXR A;  4B3R Q;  1VQA A;  2VL6 A;  1N32 Q;  1A8V A;  3KF6 B;  3X3M A;  1NJI C;  2NB0 A;  1GUW A;  4MNO A;  3PUX A;  2Q2T A;  4KHP Q;  1E24 A;  3BS1 A;  1PH2 A;  4QB4 A;  4IO9 A;  1IBL L;  1PH5 A;  5E1F A;  1HZB A;  4EQP A;  1EY8 A;  4Q0F A;  1ICW A;  1L0W A;  1EZ6 A;  1P8L A;  3DWP A;  4K2K A;  5GRO A;  2UXB Q;  1SFO B;  1NUC A;  4A3M B;  1SMY C;  1ENA A;  1WFQ A;  4X3T A;  2G9H D;  2A69 D;  3GDE A;  2KED A;  1KHI A;  4KKT A;  1STG A;  4GNX C;  1CKM A;  2PQE A;  3P20 A;  4G7H C;  4K8I A;  1HNW Q;  1X32 A;  1DD2 A;  4DV7 Q;  4DAV A;  1TY0 A;  2JA6 G;  4DV3 L;  1U0L A;  1FJG Q;  2PW7 A;  1EYG A;  3NPP A;  1I94 L;  1QJO A;  2B2V C;  4DK0 A;  3S15 B;  3VYU A;  2EIF A;  2WKC A;  2JJQ A;  4IZ8 A;  1SNO A;  3I7F A;  1J5E Q;  1VCI A;  4ZQ3 A;  2MNA A;  5JJI A;  4PZ7 A;  5KNB A;  1XPU A;  1NE3 A;  4H0L C;  1HA6 A;  4X66 L;  2YYZ A;  2NVX H;  1PTO B;  4K6D A;  2K28 A;  4JI1 L;  5C3X A;  2RCF A;  4XTC S;  2RA4 A;  1JQY D;  5IY0 A;  4LJZ C;  4EGV A;  4HTH A;  4C3J G;  4F88 A;  2KCC A;  3I55 A;  3EA6 A;  1I5F A;  3A8J E;  4NW2 A;  3TRE A;  1ESF A;  3CC2 A;  1S5F D;  4BY7 B;  1WJJ A;  1QE6 A;  3GP7 A;  1EOV A;  2EJF C;  3M3Y B;  3RR5 A;  5JJL A;  4ODG A;  1A2U A;  3PUW A;  4TVA B;  1C8C A;  5G3L D;  1HNX Q;  2PNH A;  4OL7 A;  1OTC A;  1TWF B;  4R8I A;  1SR3 A;  1VQI A;  5DLQ E;  3QO2 A;  1ENC A;  4K2L A;  4KMU C;  1PYS B;  1E2W A;  3T16 A;  3NHH A;  2FMC A;  1YHA A;  2Q2H A;  5BN3 A;  2OTL A;  1CKN B;  1YHQ A;  3RZO B;  2YTX A;  2YU9 B;  3GTP B;  3MXP A;  2RDH A;  1VS0 A;  1M4V A;  1TWC H;  4R4O A;  4ABN A;  4LF9 L;  4CDC C;  4OGQ C;  4FF3 A;  3OOC A;  1K3B C;  5AJ3 Q;  4DK3 C;  1EU4 A;  3CRK C;  1E22 A;  1X9N A;  1TU2 B;  1O7Z A;  1EIH A;  3OHX C;  1CHQ D;  2AKW B;  3BZC A;  3D31 A;  3OTO L;  1ASY A;  1G29 1;  1XYI A;  5FOB B;  1BCP C;  1IW7 C;  1BUV T;  3CKI B;  1NCV A;  5M9O A;  1A15 A;  3LWU A;  1V1P A;  4LF5 L;  1ZYR D;  5D3I B;  5M5W H;  4NKL A;  3FPU B;  1TS5 A;  3WWV A;  4CDE C;  1ASZ A;  1D6E C;  2D2C C;  1KIX A;  3PSI A;  2LS0 1;  5LMN Q;  1N36 Q;  1D5Z C;  5IP7 G;  4L63 B;  1BOS A;  5IT9 E;  2JXM B;  4AQY L;  4IPH A;  3PO2 H;  1AE2 A;  2QW7 A;  1JJG A;  5I2Y A;  1OXT A;  4DNT B;  4CJ1 B;  3OW7 A;  2MFI A;  4A3F G;  3A8I E;  5IGE A;  2B39 A;  4MIU A;  4A3J G;  4C3I G;  3I4M B;  3FPP A;  4JI8 Q;  2JA7 B;  5CV7 A;  4XT3 B;  1S5C D;  2B2T C;  2EQS A;  3MXN B;  1Q82 C;  2K5H A;  4A93 H;  3FMC A;  3K7A H;  4HR7 B;  2IY5 B;  4BXX H;  3AQQ A;  1AW7 A;  2F0V A;  3J81 E;  4KK7 A;  3GTG H;  1FL0 A;  1Q90 A;  2TSS A;  5JEA G;  3FP9 A;  4X3K A;  3I56 A;  2A19 A;  2WAQ G;  1X56 A;  2NZ1 D;  2P5Z X;  3UDI A;  5EGT A;  3SR1 A;  4H02 A;  1S5D D;  4LUZ A;  3VR3 A;  1PTO F;  5KND A;  3HOV B;  3A7L A;  5J22 A;  2F0D A;  4NXM Q;  1DM0 B;  4RGM A;  1IKL A;  2A74 C;  3K80 C;  3HOX H;  4NXN Q;  3PIO A;  3CQZ B;  5EAY A;  2N55 A;  2ZTD A;  4DV0 Q;  2JQO A;  2K5N A;  2PO4 A;  4IPC A;  4BBS H;  3BZK A;  1BBW A;  4A3K H;  2VQE Q;  5CV6 A;  5IE8 A;  3TEH B;  5HGQ A;  4A3B G;  4A3I G;  3SDZ A;  2C35 B;  1MGS A;  5GAH C;  1KRS A;  2JA5 H;  1Y69 U;  1VQB A;  2M9V A;  1GUT A;  4UPA A;  2R92 G;  2F0E A;  2ICI A;  1XNR L;  1HNZ Q;  3TBI B;  3X3N A;  1SRO A;  1VQE A;  4IPG A;  1Y1W B;  3RZD B;  1EWI A;  3QB3 A;  5IP9 H;  4FXK C;  4DV6 Q;  4DR3 Q;  2CH4 A;  3G6J B;  2E5L L;  4DR4 Q;  3FKI G;  2D9U A;  1YNX A;  5HY6 A;  1HZA A;  1JT8 A;  2XSC A;  4LAA A;  4AYB G;  3K7U C;  1VQC A;  1PZJ D;  3CAM A;  5KGU A;  3WDN A;  2JK8 A;  3I73 A;  1EU3 A;  5IYC G;  1VQ8 A;  2NVY B;  2Q2I A;  2J7Z A;  1EY9 A;  3FEW X;  4HJA A;  2CQO A;  5ISR A;  1A3U A;  4LUO A;  4N9P A;  4P72 A;  2N88 A;  1PRT B;  2DNE A;  5KYL A;  5C4H A;  3PO3 G;  4OEL B;  5EKL A;  4DXG A;  3KJO A;  2XWB B;  4X65 L;  2E2I B;  5GAE C;  2F0L A;  1VQ9 A;  4CKB A;  1SE4 A;  5C0X H;  1B7Y B;  2F1M A;  2L4N A;  2G9D A;  2QCP X;  5LMN W;  2PPB C;  2FXQ A;  1EY4 A;  4X64 Q;  4BBR H;  1K3R A;  3K0X A;  1HR0 L;  1MHW C;  4YIJ A;  2K50 A;  5CGK A;  3S14 B;  2IHF A;  3HOW B;  2VZA A;  5C4X H;  4DFA A;  3EBE A;  2FIN B;  4A3D H;  1PH4 A;  1G51 A;  1EQV A;  4IUR A;  1VQN A;  2BE5 C;  2CWA A;  4IQZ A;  1Y1V H;  2G5D A;  5L37 A;  3TZU A;  1S4Z A;  5JVG 3;  3KF6 A;  2AMC B;  4DKA C;  2K5D A;  3TME A;  3TP5 A;  3PF5 A;  3T53 B;  2X69 A;  3CD6 A;  1JCK B;  1I4R A;  1F9S A;  1GHJ A;  2AQ3 B;  3K8A A;  4ZUI A;  2JA9 A;  3MFG A;  1IKM A;  3Q8D A;  3HKZ B;  1IL8 A;  3VA5 A;  1PV4 A;  1G8Z D;  3NBH B;  1STB A;  4JVZ A;  4I65 A;  1EY5 A;  3W3A A;  4QCL A;  4S3S A;  3CCU A;  4A3L H;  5EPL A;  1NMG A;  5DNF A;  4DR1 L;  3GTK H;  1UNS A;  1I3Q B;  1R9T H;  1P16 A;  3BG3 A;  4A3J B;  1TXY A;  5COR A;  4DV4 L;  4PG3 A;  1EOT A;  1STY A;  4IFD J;  2KBN A;  3GTM H;  3BYT B;  1C48 A;  4LMQ D;  1EIF A;  5LMU L;  3C3L A;  2K5Q A;  4RMF A;  4WOR A;  5HGT A;  4A3E H;  3KBG A;  4C2M B;  1QVG A;  3GV3 A;  2PYK A;  3HEJ A;  5M5X B;  1VF5 C;  1WTH A;  5FO9 B;  3HOZ G;  1BDO A;  4DV2 L;  1S5E D;  2EYO A;  3HKS A;  4A4I A;  1KNE A;  1VQ4 A;  4LFB Q;  2D62 A;  1YIJ A;  3VDY A;  1XNQ L;  2UXC L;  3JC6 6;  4POG A;  1SRU A;  2JA8 G;  1HRJ A;  3HKZ E;  4DUZ L;  4HED A;  4IN3 A;  1MI2 A;  4L8J A;  3VYR A;  3MVV A;  2AUK A;  2K14 A;  4DGZ A;  1UE5 A;  1FNW A;  5T1I A;  2R93 G;  2O5I C;  4LF9 Q;  4B9W A;  4ZLT F;  4RH6 A;  1PRT F;  1STA A;  1CKO A;  2AHO B;  5CV8 A;  3VR2 A;  2KA7 A;  3S9W A;  1TII D;  3K5M A;  2R6G A;  2XIW A;  1A3T A;  2HIX A;  5IGD A;  1RTN A;  3S1M H;  1TWA B;  4LFA Q;  4JI5 Q;  1N33 Q;  3GTJ B;  5EPJ A;  2QGQ A;  3CPF A;  1CKN A;  3H15 A;  2NZH A;  4J1M A; 
#chains in the Genus database with same CATH homology
 1W6J A;  3DHQ A;  3I8Z A;  4DK1 A;  5IIF A;  4U68 A;  3HG9 A;  1HPC A;  1B50 A;  5C4Z A;  4OIJ A;  3GTO B;  5K36 H;  2B2Y A;  3TSS A;  4RGO S;  1PFM A;  2IX1 A;  4RHS A;  1BO0 A;  2SNM A;  5C3E B;  2E75 C;  5ELB A;  5IT9 L;  3PUV A;  3F2U A;  4KHV A;  1WTQ A;  2Q8R E;  1PTO H;  1LTI D;  2IX0 A;  4ZYS A;  1B4O A;  2VB2 X;  2BDO A;  2NWG A;  2B8G A;  1CI3 M;  2X6G A;  3OWE B;  1LTS D;  1RCV D;  5CBE E;  3K5N A;  3MXN A;  3J81 L;  2CVR A;  4PMW A;  1GUS A;  1SJH D;  1AP0 A;  1SYE A;  3MEH A;  3ZYY X;  3CU7 A;  3LWE A;  2IPK D;  1I4H A;  1I6V C;  2Q8I B;  2AWN A;  4C1N I;  2EYM A;  4V19 0;  4K5V A;  1CZW A;  4KV6 A;  3QOL A;  3GQB A;  4IUT A;  1GOZ A;  5ELE A;  1ILQ A;  3TZD A;  5C44 B;  2EY5 A;  2HCC A;  4FF2 A;  4PMB A;  1NSN S;  3AB9 A;  4CBV A;  3K57 A;  1BNZ A;  4PNY A;  3I91 A;  4H7B A;  1Q3L A;  4FVM A;  3PMF A;  4DNR B;  5EQ0 A;  4XQJ A;  1WTR A;  1TQO A;  1GUO A;  4HSV A;  3R8B A;  2NN6 G;  1PMR A;  4BY1 B;  2Z1C A;  2I46 A;  5C6A A;  5BN4 A;  1VDZ A;  3HP3 A;  1Z47 A;  4WJW A;  1SE2 A;  3NP8 A;  1B3A A;  3MZ5 A;  4O1N A;  4KN4 C;  3SK8 A;  4IUN A;  3RUZ A;  5E3F A;  3M4O B;  2F0J A;  3VA7 A;  3KLS A;  1O78 A;  4FNF A;  2H1E A;  1QOH A;  1U4M A;  4XDX A;  5JPM C;  2C9O A;  5C5M A;  1H9J A;  1TKW B;  1LAB A;  3GV6 A;  5ELC A;  5IGF A;  1KAB A;  4Q5V A;  3PUY A;  5IGC A;  1ROD A;  1F2M A;  3HOU B;  4ZKC B;  2QEJ C;  3PV0 A;  1SNM A;  1CA6 A;  1RD9 D;  1WTV A;  2NN6 I;  4G4K A;  1QB5 D;  2PW5 A;  2LFN A;  2Y0S B;  4OHJ A;  1XTC D;  2KHS A;  3J80 E;  2QKI C;  1TWG B;  5K5P A;  5EKK A;  3NBH A;  1LTR D;  2OEO A;  1E0B A;  3AMU A;  2M00 A;  1I50 B;  2KQ3 A;  3I90 A;  1RF2 D;  4C3H G;  3HS0 C;  2J0T D;  2JSO A;  3EQL C;  3FVQ A;  3OMG A;  2B2W A;  3NK9 A;  3MXU A;  3OMC A;  1ZXT A;  3VYT A;  1EL0 A;  1KDA A;  2PZT A;  3SE0 A;  1ML0 D;  2XRQ D;  3K5O A;  5M3M B;  1SE3 A;  4DXF A;  3TP6 A;  3Q23 A;  3I70 A;  1V8Q A;  2XRS D;  2RSO A;  4XQQ A;  4OO1 G;  4KY5 A;  1J9O A;  2WB1 B;  3CRL C;  5CYU A;  3P1H A;  1Q1E A;  2K33 A;  1BCP D;  1IW7 D;  4KD3 A;  4KKU A;  3I4N B;  5T1G A;  1JOR A;  1CQF A;  1ET9 A;  1CTM A;  1HUN A;  1TS2 A;  3MTS A;  3D4D A;  3GO5 A;  1VMP A;  1HXY D;  5KNC A;  2ZXO A;  4IFD G;  1BBX C;  3OWF A;  1B9M A;  2EJG C;  2MPM A;  4EVO A;  2EY1 A;  2RKS A;  5IOD A;  3H0G B;  4KI0 A;  3BVG A;  3T51 B;  3NWS A;  1JR0 D;  3DM1 A;  1D5X C;  5FO7 B;  1F77 A;  5E4X A;  1Z6H A;  4K14 A;  4QUC A;  3J7A V;  3S1Q B;  2MHV A;  2Z8L A;  2K6A A;  4FXG C;  1OXX K;  4RA8 A;  2HDM A;  4RCO A;  1PZK D;  3BVM A;  5JEA H;  4H44 C;  3T4A C;  3LX0 A;  1A2T A;  2XN9 C;  1F9P A;  4XIG S;  2O4X A;  4OO1 I;  5G3L F;  3G7L A;  1TWH B;  3IFD A;  2PZU A;  3DEP A;  3Q6S A;  3S17 B;  4ZRZ A;  2EE1 A;  3GTL B;  3PIP 3;  1Q1B A;  3I3C A;  3TN2 A;  3T56 B;  3D4R A;  1B53 A;  2F0I A;  1AEX A;  4IFD I;  5EPK A;  2VB3 X;  2IW3 A;  1PTO C;  3S1N B;  1KNA A;  1IYV A;  1KTK A;  3DUZ A;  3LNN A;  5CC4 A;  2B8F A;  1ZEQ X;  4K5X A;  3CHB D;  3MWY W;  3A7A B;  4R8N A;  1E2V A;  2F0O A;  2NVT B;  4C3H B;  1CK1 A;  5JVH 3;  2IL8 A;  2F0P A;  5EBC A;  4BA2 I;  3OIP A;  3L7Z C;  2Q8T A;  1AZP A;  4JK1 C;  4F87 A;  1H9S B;  1WTP A;  5JOB A;  4MHE A;  1U4L A;  5JAV A;  1ET6 A;  1W6K A;  1B9N A;  2GA4 B;  3BDC A;  1SYC A;  4UAI A;  2EY2 A;  3NTK A;  2PCF B;  3TP8 A;  2QIL A;  2XNA C;  2WP8 J;  2B2Y C;  4K8J A;  1H9M A;  2BE5 D;  1EIG A;  1JOO A;  1Q12 A;  2DN8 A;  3U9O A;  1EY0 A;  2A68 D;  2JYO A;  4DU9 A;  1T5X D;  2ZT9 C;  3ONA B;  4M8A A;  1FNU A;  1ONL A;  3NWT A;  1R4Q B;  2EPB A;  3URY A;  5KYI A;  5DAU A;  2Z4I A;  1BR9 A;  3QOJ A;  5FLX E;  1HHV A;  5EJW A;  1F2Y A;  3DMU A;  1WD1 A;  4WFN 3;  2SEB D;  4J8Q A;  1K8O A;  2A6H C;  5FK9 C;  2AUJ D;  2MGS A;  2NVX B;  2R7Z B;  1HCZ A;  1PFB A;  1V43 A;  2A68 C;  1PYW D;  5A2Q E;  2NYZ D;  2KUM A;  5D3D A;  2RBM A;  3J80 L;  4TSS A;  4KJN A;  3H94 A;  2SNS A;  4CKC A;  2Z4H A;  2K01 A;  4HAE A;  5C0X G;  1T5E A;  4RAU C;  3VR4 A;  5LHY 1;  4ZUJ A;  2EY6 A;  3WOE A;  1EYA A;  2CQA A;  1BF4 A;  1TWC B;  1TVX A;  3W2D A;  3NQI A;  1D2B A;  3GTQ B;  1DXM A;  4DA2 A;  1A3V A;  1HA5 A;  2HCI A;  1KDC A;  1GXD C;  3VR6 A;  4BS9 A;  2K7V A;  1KAA A;  1UUP A;  4RKL A;  4B08 A;  3DXJ C;  3BDO A;  4NDX A;  5M5W B;  3FRP B;  4KN7 C;  4UDU C;  3S16 B;  1LTA D;  3A55 A;  1QWY A;  1YNN C;  2JE6 I;  1ESR A;  3PO2 B;  1WTW A;  1PRT C;  3IAY A;  2K5W A;  4BWG B;  4HCS A;  3Q24 A;  3BZD B;  4X3U A;  1EY7 A;  4RHR A;  3QIA A;  2FJ2 A;  3EFX D;  3IFT A;  1X3Q A;  4A93 B;  1SXT A;  3ND8 A;  3K7A B;  1O80 A;  2EYH A;  1SDF A;  3GTG B;  3MXG A;  2KOL A;  2WAC A;  3SK4 A;  1X3P A;  3K0Y A;  1I4G A;  4KD4 A;  3HOX B;  1B44 D;  3GD7 A;  1F9R A;  3QJY A;  1LTT D;  1LAC A;  2OT2 A;  1LV9 A;  4BBS B;  3V05 A;  5FO8 B;  4CKE A;  1JWM D;  1WD0 A;  1NR2 A;  2JA5 B;  3VYS A;  2E2D C;  2K32 A;  1A6X A;  4NMZ A;  2EYF A;  3JAM E;  1CA5 A;  4F8M A;  4XYO A;  2RQX A;  4H13 C;  2B2W C;  3EVQ A;  4G57 A;  2EXZ A;  1EEF D;  2K04 A;  5J39 A;  1E2Z A;  1D1K A;  3H6M A;  3RD4 A;  2ICE C;  3J7Y W;  2KJX A;  1EZ8 A;  2A73 B;  3P7J A;  1HTP A;  1UEA B;  1RJT A;  1HFN A;  2TMP A;  4O42 A;  4M1U B;  2NN6 H;  1L0Y B;  1GHK A;  1XXG A;  1VMC A;  5LL6 S;  3KK7 A;  1U9R A;  3SK6 A;  1RHP A;  5CV4 A;  4BBR B;  1NR4 A;  1LTG D;  1FNV A;  1STN A;  1LT6 D;  5IGG A;  3ITP A;  5C4X B;  4XQN A;  4A3D B;  2HUG A;  1H9S A;  3M4Y A;  3ERQ A;  1PLF A;  1Y1V B;  4P2C B;  2B2U A;  4B9X A;  1GJX A;  4C56 C;  3M7N A;  3AU7 A;  1I4Q A;  3Q0A A;  4QIW B;  1M8A A;  5ELF A;  2IT1 A;  3O13 A;  4RCN A;  4FYD A;  5HUR A;  1JOQ A;  2QF7 A;  2L12 A;  4IUU A;  1RDP D;  1F2Z A;  1H9K A;  2OXP A;  2OF1 A;  5C0X J;  3SHL A;  2L9H A;  2L55 A;  3GTK B;  1CM9 A;  2JP1 A;  1CQV A;  2F0H A;  4IUQ A;  1R9T B;  2BDN A;  4ME5 A;  3GTM B;  1DCZ A;  1DON A;  3E6Z X;  2WII B;  5KRU A;  4KHZ A;  4A3E B;  1DOM A;  4L6T B;  5IOC A;  1Y8N B;  4OIK A;  3NQT A;  2WV6 D;  3V2T A;  1EYD A;  2V4D A;  2IJ0 A;  1EY6 A;  5CR3 A;  1EWH A;  1D5M C;  2ID0 A;  3HZX A;  5C5L A;  4EQO A;  5A2Q L;  2EJM A;  3PUZ A;  5AFW A;  2FMM A;  1LT4 D;  4K6L A;  4V0B A;  3EJI A;  4IUP A;  4KTA A;  2IX3 A;  4U67 3;  1CFM A;  1O7Y A;  1RKN A;  3MC0 B;  5JPN C;  3C1F A;  1BCP B;  2J4X A;  1EYC A;  2KCN A;  4HMJ A;  3E5S A;  5C3W A;  1LLR D;  3S1M B;  2LKV A;  5IGB A;  1ILP A;  1WVL A;  1DOL A;  2XWJ B;  4OO1 H;  2F0U A;  4ULL A;  5NUC A;  4ZKB B;  3C2P A;  3SVM A;  2MUY A;  2A6E C;  4HN7 A;  3M85 A;  3NBI A;  4DAY A;  2F0Q A;  4Y7N B;  2E76 C;  3RLF A;  1WTX A;  2SOB A;  4IFD H;  1QIL A;  1AFP A;  1HTL D;  4PV1 C;  4BA1 I;  5I6Y A;  1SYB A;  2F0M A;  2ZXR A;  1PZI D;  3T13 A;  1KDB A;  2A69 C;  4J6H A;  2JEB I;  2K1B A;  2KVM A;  1WCM B;  2BCO A;  1ENF A;  4PQX A;  2AQ1 B;  4A3G B;  3FDT A;  4TQU S;  4DAP A;  1LT5 D;  2XVS A;  2F3W A;  1EQT A;  2K05 A;  3D3R A;  1Y8P B;  2B63 B;  1TS3 A;  1Z7T A;  2F0T A;  2SDF A;  1MD2 D;  4RWS C;  5KIX A;  2VUM B;  1AN8 A;  1SNC A;  2F0W A;  1IYU A;  2EYP A;  4CJ0 B;  5I4D A;  1JWS D;  1G2S A;  4FP5 D;  1QNK A;  3RMH A;  2M2L A;  1PTO D;  4IAL A;  3BYY B;  1BCP F;  1B1Z A;  4KKS A;  1OXV A;  3JAM L;  3BDL A;  2AQ2 B;  4LK1 C;  4RGN A;  1ZKO A;  2L5T A;  2F0K A;  3BVZ A;  1I6H B;  3S2H B;  2F0G A;  2ENB A;  1S5B D;  1D1I A;  1OO9 B;  2KEC A;  4CGY B;  2EZV A;  2HDL A;  5D65 A;  4JBW A;  5M3F B;  4QF4 A;  1HQR D;  1EFI D;  2QDB A;  1ZYR C;  2HQE A;  1II3 A;  1SJE D;  1SBB B;  3NXW A;  3A54 A;  2F0F A;  4N9T A;  4Z9C B;  1UAP A;  1J8I A;  3PIO 3;  1R4P B;  2BOS A;  1F9Q A;  2X6L A;  5E4W C;  1LO5 D;  1IHZ A;  1SND A;  1SNP A;  3U9S A;  5C4J B;  1DJR D;  4E6I A;  1LTB D;  4F7X A;  3OIQ A;  3C1E A;  3A56 A;  1XWE A;  4DN4 M;  2ZXP A;  1F2L A;  1NAP A;  3L3O C;  2H4O A;  3D6W A;  2JA6 B;  5EKI A;  2B2V A;  1PXU A;  2L0C A;  2RVL A;  2A6H D;  3L9A X;  4I7Z C;  2KEE A;  2D5D A;  1V1O A;  3K59 A;  5DM6 3;  2E2H B;  1U4R A;  5BN5 A;  4QUF A;  2VNU D;  2FFK B;  3M7G A;  2MJ8 A;  3QWN A;  3I4L A;  2AWO A;  2F4I A;  4C3J B;  1FD7 D;  3SK5 A;  5I6W A;  3H09 A;  3NE5 B;  3IKJ A;  4IUV A;  1K83 B;  1SYF A;  1EWC A;  2O5J C;  4TRD A;  3C46 A;  3TP7 A;  1I4P A;  4XT1 B;  1QG7 A;  2I07 B;  1JIC A;  4RKB A;  1I4X A;  5DEH A;  4HSP A;  1GUG A;  2L1B A;  2LMC B;  1L0X B;  1QNU A;  5CBA E;  3IL8 A;  3MA2 B;  3OPO A;  3QG1 A;  5EBD A;  3D4W A;  1FGB D;  3KBX A;  5LL6 X;  1PDQ A;  2C5C A;  1HUM A;  3ERO A;  1YNN D;  2EOT A;  2F0S A;  1PRT D;  1BXT A;  1XX8 A;  4G7Z C;  2BA0 A;  2NTT A;  3N6R A;  4A3F B;  3R2T A;  1EEI D;  4MN3 A;  3ND9 A;  4C3I B;  1DYQ A;  2B2U C;  2EVB A;  2B2T A;  2DY7 A;  1CHP D;  2NUC A;  4G7O C;  1SAP A;  3P75 A;  2NTS A;  3R3O A;  1CT1 D;  1DOK A;  2WAQ B;  1G91 A;  4ID6 A;  2DY8 A;  1CZG A;  2A5H A;  3N52 A;  1WTO A;  5COY A;  3TDQ A;  3J7A F;  5TSS A;  1SYG A;  2JEA I;  1SSO A;  4WRD A;  2E2J B;  5C0X I;  3I72 A;  5DM7 3;  2EYJ A;  4NP5 A;  5I9O A;  2DNC A;  1JC7 A;  1OXS C;  4A3B B;  2O2L D;  2BA1 A;  2LY7 A;  4A3I B;  2R92 B;  1O7L A;  2RDF A;  4RGT A;  5A35 A;  1JWU D;  2K03 A;  2EDG A;  5M5Y B;  2NBF A;  3K6O A;  5JEA J;  4KJO A;  1MSH A;  5I9P A;  3FKI B;  4A3K B;  1HFG A;  1SNQ A;  2R3Z A;  1U4P A;  4CHT B;  3MFY A;  4AYB B;  2E74 C;  3KF8 A;  1BQQ T;  3HRZ C;  3D8G A;  1KLG D;  1V1P B;  3SXH A;  1Q8I A;  1TT2 A;  3Q22 A;  3PO3 B;  4FXD A;  3HGB A;  1STH A;  3S2D B;  3K58 A;  1QCB D;  2FHT A;  4GZY C;  1H9R A;  1SYD A;  2F0N A;  3A8K E;  5I2X A;  1FYC A;  1RTO A;  4XXE A;  3KLR A;  1DZ1 A;  3R93 A;  4ILW A;  4KY7 A;  1YNJ D;  1JE4 A;  2CW0 D;  2L11 A;  5ELD A;  5K36 G;  1OXU A;  2CHB D;  1JB3 A;  2VXW A;  2NVQ B;  1PFN A;  5JJZ A;  3MHB A;  2PZW A;  3R2I A;  3K5L A;  5J1Z A;  1G6Z A;  3NTH A;  3OSO A;  4PMC A;  1G2T A;  4R9W A;  4C1N K;  4HMI A;  1K8M A;  1TY2 A;  1AZQ A;  2WKD A;  1LT3 D;  4HCE A;  3DEO A;  4X3S A;  4TKO B;  1YNJ C;  2F3V A;  3KUP A;  2CW0 C;  1JOK A;  3WOF A;  2WIN B;  4FF1 A;  3D6C A;  1HQM C;  1TR5 A;  4FF4 A;  1STE A;  1MSG A;  3H91 A;  2MP1 A;  3DWA A;  2PNR C;  3DWQ A;  1KLU D;  4K5W A;  2IWH A;  5D14 A;  1GUN A;  3KLS X;  1FR3 A;  3HOZ B;  3UI2 A;  4XYQ A;  1B2T A;  3NUC A;  2EYL A;  5KEE A;  3MAQ A;  4RFB A;  5F2D A;  2JA8 B;  3VR5 A;  1C4Q A;  1SEB D;  1MBY A;  5FLX L;  4FO2 A;  2PMZ B;  3NSW A;  4ZAI A;  2R93 B;  3E0J A;  2R61 A;  2RDG A;  3NTI A;  4ZK9 B;  4KY6 A;  5CV9 A;  3H3V C;  5FKA C;  3V96 A;  5CMD A;  2RSN A;  4CJ2 C;  5CV5 A;  1TS4 A;  4EQN A;  4QMG A;  1VF7 A;  3HOY B;  3S1R B;  1SMY D;  1Y8O B;  4DF7 A;  3SEB A;  2A6E D;  2F03 A;  3X3M A;  2NB0 A;  1GUW A;  3PUX A;  3BS1 A;  4QB4 A;  5E1F A;  4EQP A;  1EY8 A;  4Q0F A;  1ICW A;  1EZ6 A;  3DWP A;  4K2K A;  1SFO B;  1NUC A;  4A3M B;  1SMY C;  1ENA A;  4X3T A;  2G9H D;  2A69 D;  2KED A;  4KKT A;  1STG A;  2PQE A;  3P20 A;  4G7H C;  4K8I A;  1X32 A;  1DD2 A;  4DAV A;  1TY0 A;  2PW7 A;  3NPP A;  1QJO A;  2B2V C;  4DK0 A;  3S15 B;  3VYU A;  2WKC A;  4IZ8 A;  1SNO A;  1VCI A;  4ZQ3 A;  5KNB A;  4H0L C;  1HA6 A;  2YYZ A;  1PTO B;  4K6D A;  2K28 A;  5C3X A;  4XTC S;  2RA4 A;  1JQY D;  4EGV A;  4LJZ C;  4HTH A;  4C3J G;  4F88 A;  2KCC A;  3EA6 A;  3A8J E;  4NW2 A;  1ESF A;  1S5F D;  4BY7 B;  1QE6 A;  3GP7 A;  3M3Y B;  2EJF C;  4ODG A;  1A2U A;  3PUW A;  1C8C A;  5G3L D;  4OL7 A;  1TWF B;  4R8I A;  3QO2 A;  1ENC A;  4K2L A;  4KMU C;  1E2W A;  3T16 A;  3NHH A;  2FMC A;  5BN3 A;  3RZO B;  2YU9 B;  3GTP B;  3MXP A;  2RDH A;  4ABN A;  1M4V A;  4OGQ C;  4FF3 A;  3OOC A;  1EU4 A;  3CRK C;  1TU2 B;  1O7Z A;  1EIH A;  3OHX C;  1CHQ D;  3D31 A;  1G29 1;  1XYI A;  5FOB B;  1BCP C;  1IW7 C;  1BUV T;  3CKI B;  1NCV A;  5M9O A;  1A15 A;  3LWU A;  1V1P A;  1ZYR D;  5D3I B;  4NKL A;  3FPU B;  1TS5 A;  1D6E C;  2D2C C;  2LS0 1;  1D5Z C;  4L63 B;  1BOS A;  5IT9 E;  2JXM B;  5I2Y A;  1OXT A;  4DNT B;  4CJ1 B;  3OW7 A;  3A8I E;  5IGE A;  2B39 A;  4MIU A;  4C3I G;  3I4M B;  3FPP A;  2JA7 B;  5CV7 A;  4XT3 B;  1S5C D;  2B2T C;  4HR7 B;  1AW7 A;  2F0V A;  3J81 E;  4KK7 A;  1Q90 A;  2TSS A;  5JEA G;  4X3K A;  2NZ1 D;  5EGT A;  3SR1 A;  1S5D D;  3VR3 A;  1PTO F;  5KND A;  3HOV B;  3A7L A;  5J22 A;  2F0D A;  1DM0 B;  4RGM A;  1IKL A;  2A74 C;  3CQZ B;  2N55 A;  2PO4 A;  5CV6 A;  3SDZ A;  1MGS A;  1Y69 U;  2M9V A;  1GUT A;  2F0E A;  2ICI A;  3TBI B;  3X3N A;  1Y1W B;  3RZD B;  3QB3 A;  4FXK C;  3G6J B;  2D9U A;  2XSC A;  4LAA A;  1PZJ D;  5KGU A;  3WDN A;  3I73 A;  1EU3 A;  2NVY B;  2J7Z A;  1EY9 A;  3FEW X;  5ISR A;  1A3U A;  4N9P A;  2N88 A;  1PRT B;  2DNE A;  5KYL A;  5C4H A;  5EKL A;  4DXG A;  2XWB B;  2E2I B;  2F0L A;  4CKB A;  1SE4 A;  5C0X H;  2F1M A;  2L4N A;  2G9D A;  2QCP X;  2PPB C;  1EY4 A;  4YIJ A;  5CGK A;  3S14 B;  3HOW B;  4DFA A;  2FIN B;  4IUR A;  1EQV A;  2BE5 C;  4IQZ A;  3TZU A;  1S4Z A;  5JVG 3;  2K5D A;  3TME A;  3TP5 A;  3T53 B;  2X69 A;  1JCK B;  1I4R A;  1F9S A;  1GHJ A;  2AQ3 B;  4ZUI A;  3MFG A;  1IKM A;  3HKZ B;  1IL8 A;  3VA5 A;  1G8Z D;  1STB A;  4I65 A;  1EY5 A;  3W3A A;  4QCL A;  4S3S A;  5EPL A;  5DNF A;  1UNS A;  1I3Q B;  3BG3 A;  4A3J B;  5COR A;  1EOT A;  1STY A;  4IFD J;  3BYT B;  1C48 A;  4LMQ D;  3C3L A;  2K5Q A;  4WOR A;  5HGT A;  3KBG A;  4C2M B;  3GV3 A;  2PYK A;  3HEJ A;  5M5X B;  1VF5 C;  5FO9 B;  1BDO A;  1S5E D;  2EYO A;  1KNE A;  2D62 A;  1HRJ A;  4HED A;  4IN3 A;  1MI2 A;  4L8J A;  3VYR A;  3MVV A;  2AUK A;  4DGZ A;  1FNW A;  5T1I A;  2O5I C;  4ZLT F;  4B9W A;  4RH6 A;  1PRT F;  1STA A;  5CV8 A;  3VR2 A;  2KA7 A;  3S9W A;  1TII D;  3K5M A;  2R6G A;  2XIW A;  1A3T A;  5IGD A;  1RTN A;  1TWA B;  3GTJ B;  5EPJ A;  3FMC A;  4J1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...