2EYFA

Crystal structure of staphylococcal nuclease mutant t44v
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEVKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 37
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2eyfA00
1SNDA 5EKLA 5JOBA 5IGEA 4KV6A 5EGTA 2EYMA 2SOBA 5CV8A 4HMJA 5IGCA 4I65A 3D4DA 3SR1A 5J39A 4R8NA 1STGA 1EY0A 4K5VA 3HZXA 5J1ZA 4K5XA 1F2ZA 5IODA 2WACA 4KJNA 2F0GA 3OMGA 1NUCA 3TP6A 2OXPA 5CR3A 3QB3A 2PYKA 4IUNA 4DFAA 3H6MA 2SNMA 4PMCA 1EZ6A 1EY7A 4ZQ3A 4PNYA 1SYDA 2EXZA 4DU9A 2F0OA 1SNQA 4KJOA 5DAUA 5KGUA 1A3VA 1EZ8A 2F3VA 3P75A 5JAVA 2EY6A 1SYGA 1II3A 5CV9A 3OSOA 2O4XA 4KY7A 3MHBA 5DEHA 5KRUA 4HMIA 2EY2A 1KAAA 2F0SA 3NQTA 5CV6A 3SXHA 2PW5A 3E5SA 4KHVA 2EYHA 3OWFA 3V2TA 4E6IA 2F0PA 1SNOA 2OEOA 3D4WA 1F2MA 1SYBA 5HURA 4ZUJA 2F0QA 2EYJA 2F0WA 4ID6A 5F2DA 1ENAA 2EYOA 2RBMA 4DGZA 2PZUA 2PZTA 4DF7A 1JOOA 4NKLA 1EY8A 1TR5A 2EYPA 5M9OA 3P1HA 1KDBA 1U9RA 3C1EA 4K5WA 3T13A 3MVVA 5CV4A 4NDXA 2ENBA 1EY6A 3VA5A 4EQPA 5IGDA 3NXWA 3SK8A 1STYA 2F0FA 5E3FA 5IOCA 3MZ5A 3DMUA 1EY5A 3R3OA 3D6CA 3SK4A 3MEHA 4F7XA 1A2TA 1AEXA 3SK6A 2KHSA 3RUZA 5E1FA 5C3WA 5KYLA 3TP5A 5CV5A 1EQVA 2PQEA 1JOQA 3NP8A 5C3XA 5CC4A 1EY4A 1TT2A 4EVOA 5I6YA 4NMZA 4F8MA 3LX0A 4YIJA 3TP8A 2F3WA 1KDAA 3QOJA 4H7BA 4KY5A 4N9TA 3T16A 5C4HA 4MIUA 1SNMA 4S3SA 3TP7A 4EQOA 3NHHA 2M00A 4LAAA 5HGTA 5ISRA 1STAA 4K6DA 2F0VA 5C5LA 1STBA 1SNCA 5C5MA 2F0KA 2F0IA 3BDLA 2F0EA 4EQNA 5KYIA 4IZ8A 5IIFA 4TRDA 5IGBA 1A3TA 3BDCA 4G57A 4IALA 5C4ZA 4K14A 4ODGA 3OMCA 4N9PA 1KABA 4K8IA 2SNSA 4K2LA 4KTAA 1JORA 2PW7A 1SYFA 3ITPA 4K8JA 3D8GA 5K5PA 1STNA 4QB4A 2F0JA 4B9XA 1A2UA 2EYFA 5I9OA 1STHA 4RKBA 2F0LA 1SYCA 2EYLA 1EY9A 5KIXA 3DHQA 5I6WA 1F2YA 3TMEA 4QF4A 1NSNS 5EKKA 2EY5A 3C1FA 2KQ3A 4KD4A 3SK5A 2OF1A 2RKSA 3ERQA 3NUCA 5J22A 2PZWA 4B9WA 3NK9A 3U9OA 4RKLA 5CGKA 4KD3A 5I9PA 2F0MA 3SHLA 4J6HA 4HTHA 2RDFA 5CV7A 5IGGA 1A3UA 3PMFA 2F0NA 3S9WA 2NUCA 4QMGA 2F0DA 2HQEA 4WORA 3EROA 4ZUIA 3HEJA 3QOLA 4ME5A 3EJIA 1SNPA 5KEEA 2F0HA 1KDCA 3EVQA 1EYDA 3MXPA 4K2KA 5NUCA 4NP5A 1EYAA 5C6AA 5IGFA 1RKNA 1EYCA 1JOKA 2QDBA 1IHZA 1SYEA 2F0TA 2F0UA 2EY1A 4PMBA 2LKVA 4KY6A 4WRDA 1TQOA 4OL7A 4J1MA 1ENCA
chains in the Genus database with same CATH superfamily
1H95A 5JOBA 1XMOL 1AE3A 3R2IA 4U673 4KHZA 1BF4A 1H9SA 3HKSA 1Q8KA 2WP8J 2UUAQ 1E2VA 1I5FA 1NTGA 2OXPA 2FJ2A 4DR6L 1EY7A 3UI2A 1AZPA 5T1GA 1IL8A 2J7ZA 1W6JA 1DXMA 4QUFA 2F3VA 3CCUA 3I4MG 3I72A 3NQTA 5CV6A 2F03A 2MO0A 3S1QH 2I5MX 2EYHA 2IPKD 1IBMQ 1RTOA 1BQQT 4K0KL 5C4XG 4C3HG 3IRBA 5TSSA 4YCWA 2F0QA 1TWAB 1K8OA 1DM0B 5FLMG 1JMCA 2OTLA 1HR0L 4NKLA 2HD3A 1SSOA 1EQQA 4DV0L 1C4QA 2CCZA 2VL6A 1DD2A 4OHJA 4UP8A 2XNAC 1TWCH 1DCZA 4B3MQ 2OCEA 1DOKA 4JBJA 2EJMA 3D6CA 1FVIA 3KF8B 3SK6A 2A68D 4R4IA 3S1MH 1BCPB 1TWFB 2L9HA 3E9HA 3CCEA 1B44D 5M5WB 1N8RC 4B3TL 1ZEQX 2YTVA 1HNWL 1R9TH 2E5LQ 3JAMc 2Q8TA 5M5XB 4UP7A 1P8LA 2RHSB 1XNQQ 1CSQA 4G57A 4KK7A 3DEPA 3OMCA 4DR1Q 4DR4L 1I4HA 4NPSA 1FNWA 1YVCA 4LF4Q 1IYVA 1TWCB 4RFBA 1S5BD 2D0OA 5EKKA 3RD4A 3DEOA 4JI3Q 4KD4A 4JI2L 4X65Q 4A3DH 3KYHC 3K80C 2NVQH 1LUZA 3KLSX 4BBRH 4A3GH 1Y1WG 3S15B 4BS9A 2RDFA 1X55A 1EOTA 2CVRA 2F0NA 5FO8B 1BR9A 2E2IB 4M1UB 2Z6KC 4LMQD 1IYJB 4FF1A 1EWHA 1IL2A 3CCMA 1R9TB 2C5CA 1A8VA 1BUVT 1IHZA 1QWYA 2F0TA 2N8NA 4PMBA 3T1YQ 2FXQA 5AFWA 1TQOA 4O1NA 2EZVA 4IFDI 4MNOA 4CKEA 4GNXA 1KIXA 3MTSA 4C1NK 2L15A 4LWCA 4K5XA 4HAEA 2EJFC 3I4NH 1IW7C 4JPBW 1PFBA 3EA6A 1V1PB 4ZQ3A 4DV4L 4DUYQ 1X56A 1SYDA 3KDFA 1PXUA 4DAPA 4BBRB 3PO2B 4HIMA 4IUVA 1II3A 3E9IA 4KY7A 2JA6H 2Z8LA 3FVQA 4KMUC 2LXJA 2PW5A 3I73A 1T9HA 1SNOA 3MC0B 4H02A 4XXEA 5JJZA 2UU9L 2B63H 4J15A 4APVA 2IY5B 5LMNQ 1FJGL 2XWBB 1EY8A 1TR5A 5LL6X 1U4LA 3P1HA 1KDBA 1TWHB 2VQEQ 1SE8A 4IUQA 2JYOA 4AQYQ 1D2BA 3TZUA 4DAYB 1ZYRC 2K4KA 4A3IG 3HOUG 4MTKA 4HJ7A 5GADC 2N78A 1HRJA 3TP5A 3I4NB 1E3PA 1GKHA 1HUNA 2IW3A 3HG9A 3A74A 2L55A 3L3OC 3URYA 4JI6L 1HJPA 1DZ1A 3NHHA 1N34Q 3RZDH 4LFCL 3I7FA 4K6DA 3I4MH 2C35B 5C4XH 1K8AC 4C3HH 1IKMA 2CHBD 2RF4A 4CDDC 2KEEA 2BE5D 1D5XC 5FLMH 1GD7A 4HCSA 4IO9A 1KRTA 4FXDA 3T4AC 5K5PA 1A2UA 1JWMD 5ELCA 4QF4A 2RDHA 5DNFA 1FL0A 5EBCA 5BR8Q 1NY4A 4RGMA 1QUQA 3G6JB 4HTHA 1VF7A 3KLWA 1VQ9A 3W5OA 4YWLA 2JE6I 2NN6I 4WJ4A 3M3YH 1KDCA 3RZDB 1RKNA 5KNBA 1QNKA 3EN2A 4FF2A 2EY1A 1W2BA 1HH2P 4DA2A 3FP9A 1BBWA 3CCRA 1YJ9A 1PH4A 3VYRA 2KJXA 1I4GA 2VNUD 1OXSC 1O7ZA 3GO5A 3K5OA 2UXDL 3L2PA 1PFNA 2R7DA 4K5VA 1L0WA 4C1NI 4PZ6A 1PDQA 2QEJC 3G6EA 2NN6G 4PZ7A 1LTLA 4V0BA 2EXZA 4ZCKA 3E6ZX 2F0OA 1Y1WH 1SXTA 1EZ8A 1S4ZA 3S2HH 5DEHA 1OXTA 4B3RL 2FMCA 4DV3Q 2EY2A 1DGSA 3W1BA 3T51B 5IT9E 3M3YB 3I91A 3NBHA 2ZM6Q 1EIGA 2K5WA 2LY7A 1YNND 1ICFB 1ESRA 1FGBD 4IPHA 5M3MB 3JAML 2IX3A 2AQ1B 1WD0A 3TS0A 3FRPB 4JYAL 1HTPA 1D6EC 1CM9A 1HFGA 1ML0D 2R61A 1CQFA 2JN4A 2OWOA 1G6PA 5C3WA 4QQBX 4IQZA 2SEBD 2PQEA 4JI8L 1STEA 2WKDA 1E7ZA 1RL2A 4DKAC 4LF5Q 5LL6S 1PYBA 5LMNW 1VQ4A 3T16A 5HGQA 2QCPX 1I6VC 2O5IC 4DR2L 1SNCA 3OIQA 3CD6A 1JB3A 1OTCA 4EQNA 5IIFA 3TZDA 4AYBB 1M8AA 2Z6KA 2TSSA 4LF9Q 4DV6L 4CJ2C 1B7YB 2KCCA 4K2LA 4PMWA 1LM0A 2CW0D 4AYBE 4LF8L 4WJ3M 1BO0A 4A3IH 3HOUH 3OOCA 2A6HC 1D7QA 5KNCA 3HS0C 4JV5L 3NK9A 4GZYC 3NSWA 4K6LA 2DUDA 2HIVA 1VMCA 4Y7NH 1JJ2A 3J7AF 5EPJA 4WORA 1B4OA 4U68A 2A69C 4G7HC 3V96A 1G91A 3PIO3 1MD2D 2DJGC 1F2LA 3CMAA 4LF4L 4QIWB 4UHVA 5C4JB 1EYCA 3F2BA 3ERSX 3I3CA 4JI3L 1PZJD 5EQ0A 5GQOA 3H0GG 4XQQA 1IBKQ 5FO9B 1D1KA 2D62A 2K03A 5BN4A 3S1RB 5ELNA 1MKHA 1EEID 2F0GA 2K6AA 1XMOQ 1VQ8A 2YU9B 1VQPA 2H5XA 3K59A 2BDNA 3GP7A 4A93G 4GKKL 4DR6Q 1PTOH 1VDZA 1SJED 3GTGH 3V2TA 3D31A 4BA1I 4YHHL 5HURA 4DK0A 1S5CD 2RBMA 4DF7A 4K0KQ 1U9RA 5FJ8G 3CCQA 1C7YA 4IPGA 2AQ3B 3J81i 2DNCA 4CDFC 4ZK9B 1HR0Q 5H1SE 5E3FA 2ICEC 4DV0Q 3UDFA 4OX9L 2GVAA 3RUZA 4LNQA 2NWGA 2KECA 2I5HA 3A8KE 3DUZA 3CMEA 4RMFA 2NN6H 3LWEA 3NBIA 1R4PB 4YIJA 2J4XA 1HCZA 3K5MA 1KHIA 4JI1Q 3PUWA 4MIUA 5D3IB 1PTOB 4DN4M 3A8JE 3F8TA 3NWTA 4B3TQ 3BS1A 1HNWQ 5IGBA 1A3TA 1PFSA 4HSPA 4IALA 4C2MB 4A3JB 1E24A 4KTAA 4GS3A 4L6TB 3I90A 4HJ8A 1O78A 1Y1VG 4RKBA 4JC0A 2L11A 2PNHA 1F2YA 1ASZA 4DR4Q 3GD7A 3PV0A 4X6AH 4B9WA 4DAVA 2B2VC 2RSOA 1LTSD 2LXKA 1ILPA 4JI2Q 5CORA 3EROA 2Q8IB 4R4CA 2NZOA 5FK9C 2VW9A 1CZWA 2O5JC 1JOKA 2WB1G 3CCLA 1V1QA 1GUOA 5BR8L 4A3KB 1ENCA 1VS0A 3Q24A 4OIJA 4CBVA 2BCOA 3S16B 1K83B 1CKMA 3KF8A 4HMJA 1M90C 5ELDA 4GKJL 1TS4A 5IODA 3A5UA 1V1OA 1L1OC 3MXGA 1W3SA 1V43A 5C44B 1YJNA 2JSOA 4R1JA 1DJRD 2XSCA 4ZYSA 2IL8A 2KEDA 3K8AA 3AFPA 1GUSA 3OSOA 4HN7A 4DV4Q 3MHBA 1ET9A 4RWSC 3E5SA 4CJ0B 3VR5A 4BXXG 3MFGA 2SDFA 3MA2B 2VB2X 1MGSA 4ZUJA 3AYHB 4XT3B 3RZOH 4RGTA 1JORA 1OO9B 3S1NB 2PZTA 4A3BG 3FKIB 3H0GH 3HKZE 2BA0A 3PGZA 2UU9Q 3CC7A 1D5ZC 3SK8A 1FJGQ 3RN2A 2TMPA 4BWGB 3HOXG 1M4VA 3OPOA 2ZM6L 4A3MG 4RCOA 3STBD 2QKIC 3R93A 1PTOF 4RAUC 1WOCA 4IUUA 2B2YC 1ENFA 4L5QA 1E1TA 1I50H 4A93H 1QG7A 3FPUB 5AJ3L 1CFMA 1STAA 4TKOB 2K01A 2F4VL 3BDLA 1VQNA 1QB5D 3Q8DA 4JI6Q 3SDZA 1FGUA 5CMDA 2L12A 4LFCQ 3RZOB 5T1IA 2LS01 4N9PA 3D3RA 2AKWB 1H9JA 1UNSA 3H0GB 3KBXA 1FD7D 1MBYA 4ZLTF 1TIID 1QZGA 1V1PA 1X3EA 5FJ8H 1LT4D 2YYZA 1HZBA 3CP0A 4OGQC 4FVMA 5BN5A 3C1FA 1L0YB 1YNJD 2B39A 3U9OA 5JJKA 1NAPA 2KHIA 4BBSG 4KI0A 1UE6A 1I50B 3KLSA 1Y69U 2FMMA 3EJIA 2F0HA 3MXPA 2MUYA 4K2KA 3W1GA 5EPLA 4LFAL 3Q23A 3BVZA 2JA7B 2JA9A 3E0EA 3CRLC 1YHQA 4GLAC 1O7LA 1BXTA 1Y8NB 5IGCA 2UUBL 1CI3M 3HP3A 1BOSA 3HZXA 2NVXB 5J1ZA 1Y1VH 1S5ED 3GTOB 4HEDA 4OWXB 3BU2A 3K5LA 2UXDQ 4L5RC 1Z6HA 5ELBA 1B3QA 3J80E 1SEBD 3ULJA 2R92G 2V4DA 5G3LD 3K7UC 3VR3A 3P75A 5CV9A 2EJGC 3WDNA 4Q5VA 2EQSA 2F0SA 4OO1G 1CZGA 1K0SA 4ULLA 2F0PA 5C0XJ 4IUPA 3PCOB 1IZ6A 2A5HA 4B3RQ 1LACA 2EYJA 1GHKA 4ID6A 2ZXOA 3QR8A 4DGZA 2YTYA 4BY1G 5C0XG 1BDOA 3PF5A 3I2ZA 1PTOC 1YZ6A 1HNXL 1Q3LA 3U9SA 2Y0SG 1B50A 1SRUA 1Q12A 5DM73 1Y1VB 1B2TA 5EBDA 3HOZG 3H3VI 2A74C 2QILA 4JYAQ 2K5HA 4NMZA 5I6YA 4DK3C 3TP8A 1RODA 1WI5A 4JI8Q 1C8CA 1I6HB 3CHBD 2R93G 2VUMB 3CXCA 3VDYA 2B2VA 3TN2A 3ULLA 4BXXH 2L0CA 2AWOA 3M4YA 5FLXE 1NJIC 1U4RA 5EAYA 4DR2Q 4A3BH 3FMCA 1G6ZA 3D8GA 2F0JA 4JI1L 2EYLA 4DV6Q 4B08A 3S2DH 5I2YA 2AWNA 3KJOA 3HOXH 2PO4A 2XTIA 2RKSA 2XRSD 1TKWB 4LF8Q 1KC8C 4A3MH 5CGKA 4KD3A 3GTMH 1LV9A 2L1BA 1HQRD 2F0DA 2E8GA 3S1QB 4ZUIA 4JV5Q 3NQIA 2KENA 4CKBA 1QZHA 3TDQA 3IFTA 1PRTD 1MI2A 2PNRC 1XPRA 2OT2A 2CH4W 2Z9HA 1B9MA 2EYMA 3K81C 1SMXA 4A3BB 4R8NA 1XTCD 1ZKOA 1UE7A 3IFDA 3P7JA 1VQMA 1B8AA 1LTID 3S1MB 3F1ZA 2BH2A 3E0JA 1HXYD 2KCNA 3ER0A 1RIPA 1R4QB 3GQBA 4R9WA 4JBMA 4EQ5A 5KNDA 3C2PA 3RNUA 4ILWA 3SE0A 3SVMA 3ND8A 5JJIA 3BZDB 4BBSH 1B70B 2EXDA 1KAAA 1UEAB 1VQHA 4GKKQ 3JC66 4A3FG 2B2YA 3LNNA 4IOAA 3Q22A 4YY3L 2I0QA 1VQ6A 1EIYB 2I46A 2K28A 4YHHQ 3I56A 1M1KC 3MVVA 2WKCA 2ENBA 2XRQD 3GTQH 4PG3A 4A3DB 5IOCA 2K32A 4JCVE 4MHEA 2NVQB 2KCTA 1NMFA 3HFZB 2XIWA 4I7ZC 3MEHA 1SROA 1O7YA 4A3GB 4C3JG 1S40A 2BDOA 1EQVA 1PH9A 1Z7TA 5C3XA 3KJPA 1L0XB 3F2UA 4BA2I 4OX9Q 2R92H 1TY0A 3A56A 2NYZD 4N9TA 3CC2A 1SNMA 4PZ8A 4P75A 1CK1A 1ET6A 3FHWA 1Q46A 2CQAA 3M4QA 3PUYA 4OO1H 4OWTB 1WYDA 4JG2A 2F0EA 1UEBA 1B53A 1LTRD 5EPKA 3ULPA 1D8LA 1KNAA 1PH6A 2UXCL 4BY1H 5CBAE 1V9PA 5C0XH 4GOPB 1RTNA 4O2DA 1PH7A 3I4LA 4A3CG 1XTDA 3TMEA 4QUCA 1CT1D 3J81E 3GTQB 3V05A 1E0BA 3HOZH 2NVYH 1EQRA 1EIHA 3SEBA 2VXWA 2JA6B 2RQXA 1HNZL 2ID0A 2NUCA 2FINB 1DOLA 2R93H 1SNPA 3K58A 5FOBB 2B63B 3A8IE 4DNRB 3M4PA 2KOLA 2ZJQA 3R2TA 1OXVA 3VR2A 1EU4A 3BG3A 4M8AA 2Z4IA 4KY6A 2E74C 2JA8G 3OYYA 1SNDA 1G2TA 4L63B 3J80i 1IW7D 2NTSA 4RGOS 3H3VH 4KN7C 1FR3A 3CPWA 3D4RA 3OMGA 4DNTB 3D0FA 1GUNA 5FO7B 4RG1A 4GKJQ 1QILA 2Z6BA 1XPOA 5JVH3 2OTJA 3VYTA 1GJXA 5KGUA 3HOZB 1A3VA 1U4MA 4MZ9A 2DN8A 2IHFA 4CJ1B 1SDFA 5A2QE 3I4MB 3AQQA 4G7ZC 4HJ9A 4IJHA 5C4XB 4C3HB 1QCBD 3PUZA 1J6QA 3AFQA 1WTHA 3GDEA 2EYOA 2PZUA 5M3FG 1ESFA 1ZYRD 3C1EA 4IPDA 1TS5A 3PIPA 5BN3A 1G2SA 2KCMA 3S14H 2HUGA 2ATWA 5GAHC 1AEXA 1WCMG 5E1FA 4ZKBB 2L5TA 2R6GA 2GN5A 5IT9c 5CBEE 1I4XA 2DGYA 4B3SL 4TSSA 4P71A 2IHEA 1L1OB 2F1MA 3MFYA 3IAYA 1N33L 2K75A 4NW2A 1PH8A 2KBNA 1X32A 5FKAC 3BVGA 1PFMA 4A3FH 4TRDA 1ICWA 5AJ3Q 3PIP3 2AUKA 1SR3A 2RCFA 4OXPA 2HHHL 5GAGC 4RA8A 2F4VQ 3RLOA 1QVFA 4F88A 1IKLA 1LABA 3ITPA 1LTBD 1O7IA 3PO3G 4A3EG 1CHQD 1S3OA 1SYCA 4DUZL 3QJYA 2NB0A 3RLFA 4ALPA 4FF4A 5I6WA 2AUJD 4LK1C 2KQ3A 3SK5A 3HOYG 1Y1WB 3FDTA 4C3JH 2JQOA 1BBXC 2F52A 3OWEB 3VA7A 1PH3A 2MFIA 3S2HB 3U4VA 2N88A 2HQEA 3MWYW 3J7AV 4DR7L 3QIAA 1J9OA 2YV5A 2OQKA 1B9NA 1UAPA 5E7NA 1HHVA 2H4OA 1VQ7A 1RHPA 4BY7G 4LF7L 3A7AB 4A3FB 3A55A 1E2ZA 4JW0A 4LFAQ 3JAMi 1Y14B 2WAQG 4DR5L 2DNEA 1IYUA 2M9VA 4A3CH 5A35A 1SMYC 2SNMA 5IWAL 1JB7A 2UUBQ 4FXGC 4PNYA 2K33A 3C46A 1RD9D 4DR3L 2E2JH 5JJLA 3GTJH 3OW2A 2VB3X 1MIUA 2O4XA 4IUTA 3DXJC 3GTLH 4DK6C 5LMUL 3OWFA 1HQMC 1BCPD 1K8MA 2IWHA 1CHPD 1JT8A 4QIWE 4MN3A 1KLUD 4V190 1KQSA 3HOWG 4G4KA 4HCEA 1GUTA 5J3BA 2JA8H 2I07B 3T13A 1KL9A 4FXKC 4X66L 3NE5B 4A3IB 3C3LA 3HOUB 1D1IA 3MZ5A 5KYLA 1WTWA 4JBWA 1KXLA 2Z0SA 1HNXQ 2K7VA 1PZID 4Y7NB 2K5NA 1TU2B 1GUWA 3LX0A 1Q81C 1SE2A 4OELB 3DWAA 4TVAB 1HTLD 2X6GA 5C4HA 1XMQL 4GOPC 1JQYD 3W2DA 2K05A 3GTJB 4CDEC 1WTOA 2YTXA 2R7ZG 3GTLB 3TSSA 3TQYA 2MP1A 3N6RA 2IX0A 1HFNA 5M3FH 1SFOH 1QOHA 2G9DA 2QDLA 5D14A 5I9OA 3K0XA 4JI7L 1YITA 5KIXA 2QEXA 2HDMA 4N8X1 2ZT9C 5IYBG 1U4PA 2G5DA 3BZCA 1WCMH 3T1HL 2JXMB 4RH6A 2G9HD 5IGGA 1EWIA 3GTGB 2VY3A 2HDLA 1WD1A 2NBFA 1V8QA 4DV5L 2UUCL 5JEAJ 2LFNA 3CC4A 1EYAA 4KLKA 1Z47A 4CKCA 1I4PA 2F0UA 4WRDA 1WTPA 2CH4A 5JEAG 4FYDA 4J1MA 4AH6A 2EPBA 1OXUA 3NPPA 1HPCA 5CV8A 1PH1A 5M3FB 1SFOB 3DLLA 1MJEA 4LUZA 1XYIA 3M4OH 4LUVA 1XX8A 4A3EH 1G291 4JOIC 1WTRA 3PO3H 3K7AH 4KJNA 1VMPA 5CR3A 4IUNA 1EFWA 3DM3A 3HOYH 1JWSD 1Q82C 1I4QA 1VQBA 2K5DA 4KJOA 1WTXA 1B1ZA 1XPUA 4OWWB 5JAVA 1VQKA 1QJOA 5KRUA 1PLFA 3GTPH 3I55A 3H3VC 3L9AX 4JVZA 5IT9L 3STBC 1TS3A 2PMZB 1U5KA 1X9NA 3CCSA 1ENAA 4BY7H 1JOOA 4ZRZA 4JI5L 2PMZE 3RN5A 2VZAA 1EY6A 3VA5A 5IGDA 4YY3Q 4HIKA 1LT5D 1GHJA 3WWVA 4DXFA 4X62L 2HCIA 2KA7A 2N3SA 1X65A 3OW7A 5ELOA 2HQLA 3HOYB 3U50C 4HJ5A 2D0PA 2CQOA 2HCCA 2EOTA 1QE6A 3H94A 3CQZH 4A3LG 1EU3A 3KLRA 4N8FA 1YNJC 2NVTH 3GTPB 2NZHA 2Q2HA 2F0KA 5KYIA 4YCVA 5DM63 1CKNB 1VQDA 4WJWA 2XGTA 4P73A 4DV7L 4K14A 3PF4A 2AHOB 3HOWH 4DV2L 5LHY1 1SYFA 2ALYB 4FO2A 1WFQA 2F0LA 3DHQA 3TRZA 3MXUA 3TBIB 2UXCQ 2ES2A 1EIFA 3CAMA 2O2LD 4KHPL 1PZKD 1MHWC 4DV1L 4F87A 2ZTCA 1PRTF 1A3UA 1HA5A 2MPMA 3CU7A 3S9WA 1HR0W 4A76A 4OEMB 1AE2A 2ZXPA 4H0LC 4X3KA 4NXMQ 3CQZB 5KEEA 5NUCA 1EYDA 5E4XA 3QWNA 1HNZQ 3ICEA 2R7ZH 1SYEA 3K5NA 4X64L 3L0OA 3KUPA 4GNXC 3SXHA 2A6EC 2C9OA 2BH8A 1X3QA 3OHXC 4Z9CB 4WFN3 1B3AA 4UPAA 4A75A 5J39A 1STGA 3M9BA 1ILQA 1X3GA 2E76C 3BVMA 4XYOA 3EBEA 1LO5D 1NUCA 1E22A 1YIJA 3H6MA 4KKUA 5IP7G 5IYBH 3RR5A 1GUGA 4A93B 2RVLA 2MNAA 2PPBC 3PO2G 1TS2A 4LW1A 2K5VA 4OONA 1JJCB 4OO1I 3MXNB 1TVXA 2R7ZB 3M85A 1K8GA 4TQUS 4GOPA 5JEAH 1WVLA 4XQJA 2ASBA 4LFBL 4HJAA 3UE0A 1WJJA 3J80c 5C0XI 4ZKCB 1O80A 4QCLA 3ONAB 1EY5A 3R3OA 1FYCA 2KHSA 1A0IA 3HRZC 4GN5A 4LF6L 5CC4A 1EY4A 2KUMA 5IP9H 5D3DA 2A68C 2Z1CA 1VQ5A 1H9MA 2D2CC 1KDAA 4H7BA 5CYUA 1E1OA 2MQHA 4EQOA 4S3SA 3I8ZA 1HZ9A 4LAAA 1H9RA 3CF5A 4B3SQ 2EVBA 4IZ8A 4RHRA 1N33Q 1VQFA 5C4ZA 1YEZA 1NR4A 1TWAH 4K8IA 2VQFL 5I2XA 2PW7A 2EYFA 5IYCG 2ZTEA 4UAIA 4XT1B 2HHHQ 1LT3D 2CFMA 3NENA 3K0YA 2CKZB 1EOVA 1UE5A 1YHAA 2HT1A 2PQAB 4DUZQ 5ELFA 3O13A 4JOIA 4QMGA 1SJHD 2E2DC 1NCVA 1TWFH 5HY6A 5FLXc 1VQIA 4A3LH 1QNUA 2IT1A 3M7GA 4EGVA 5M5WH 4NP5A 2BOSA 2WB1B 3NTHA 3KF6B 1UWVA 1YHBA 4DR7Q 1SAPA 1EL0A 1A63A 5COYA 3DWPA 4GN3B 4QJFA 5M5XH 1PYSB 1X3PA 4OL7A 5IGEA 5EKLA 2WB1E 3H09A 2SOBA 4LF7Q 2Q2TA 1TXYA 3B6YA 4IJLA 3OTOQ 2UXBL 4DFAA 2PYKA 2RDGA 4Y52H 4JI4L 2B2TC 4PMCA 4DR5Q 5ELEA 1L1OA 1T5EA 1KAWA 1KLGD 4X3TA 3BDOA 1SNQA 3TREA 2VS1A 5IWAQ 1WTQA 3S15H 1EWCA 4R8IA 3S24A 3NELA 1I3QH 4HMIA 1JJGA 2E2IH 1GOZA 2OEOA 4DR3Q 4IOCA 1EQTA 3J7A5 5K36G 4RGNA 5LMUQ 1EYGA 4HIOA 3PSIA 1PTOD 1EEFD 1Q8IA 3NWSA 2EYPA 1N32L 1YJWA 4UDUC 1NR2A 3JAME 2CWPA 3S2DB 1K73C 5M3MG 3HOXB 1IBLL 1AH9A 5EJWA 1GM5A 4A3MB 4X66Q 1N9WA 1JOQA 3GTMB 4POFA 5IP7H 3W3AA 1TT2A 1J5EL 4H13C 4O0AA 1KD1C 4P72A 3PO2H 3EFXD 1A62A 1C0AA 4DNIA 1I3QB 2K52A 3AMUA 3EQLC 5JPNC 1Q7YC 1XMQQ 2NTTA 2XN9C 3RLNA 4QGUA 3OIPA 4AYBG 5M5YH 3K6OA 5JVG3 4ABNA 1EFID 1PA6A 2BE5C 3GTKH 1STHA 2P5ZX 1TWHH 4POGA 1NSNS 3KBGA 2Q8RE 2OF1A 4JI7Q 1MJCA 1T5XD 3FEWX 5I4DA 1GO3E 1AZQA 4BBSB 3PMFA 3A0JA 4IFDJ 2JP1A 1CQVA 4P2CB 5E4WC 3T1HQ 3CCVA 3EVQA 1X3FA 2JEBI 4DV5Q 2UUCQ 1VQLA 4IFDG 2IX1A 3J81c 4DK1A 2IJ0A 1GVPA 2K1BA 3X3MA 5M5YB 4DPGA 1CA5A 3CKIB 4I65A 3D4DA 2KVMA 2Q2IA 1SE3A 1JE4A 1EY0A 5IYCH 1F2ZA 1XWEA 4YWKA 3GTKB 4NXML 3D6WA 1C48A 1VQAA 1LTTD 2ICIA 1Z9FA 1DONA 1EZ6A 2R92B 1BCPF 4DU9A 3J80L 4I7AA 1BKBA 3J7ZC 5IYDG 2ZJPA 1K3BC 4FDBA 4IPCA 1VCIA 2ZJRA 1XNRL 4HR7B 1NBWA 4KHVA 3HOVG 2F3IA 4XQNA 1W6KA 3VR4A 3VR6A 4NXNL 3DM1A 4ZAIA 4UY8C 4BY1B 3Q0AA 3BZKA 2A1AA 1YNNC 4K5WA 4P74A 2N49A 4KKTA 3I70A 2RHQB 4PQXA 4EQPA 2Y0SB 3AEVA 3A7LA 1N36L 4JI5Q 1H9SB 2NVYB 5CV5A 4HIDA 2Y0SE 2DJFC 4X62Q 2R93B 4GN4B 1SBBB 4CGYB 5DLQE 5ISRA 1ASYA 1MSHA 1HUMA 2R3ZA 2D5DA 3PUVA 2PI2A 1EUJA 5K36H 4KN4C 4X3SA 3S17H 4ODGA 2AMCB 2MO1A 5EKIA 5FLXL 1YI2A 3VYSA 1KABA 3T53B 4A3JG 3UDXA 1STNA 3GV3A 4DV7Q 4FP5D 3AB9A 5M3MH 4DV2Q 2CWAA 3CW2C 2CW0C 2B29A 4YWMA 3ERQA 3QG1A 1I94L 1J8IA 2K50A 4RKLA 1WTVA 2MGSA 3U4ZA 1UUPA 5CV7A 4JI0L 2HIXA 4ME3A 4KHPQ 3HEJA 3K57A 2B2TA 4DV1Q 2BA1A 3NEMA 1TWGH 4CDCC 4AIMA 3UDGA 1LTGD 2QW7A 2UUAL 1E2WA 4RCNA 3BJUA 3S17B 1F9RA 4A3KG 5EGTA 1H9KA 1X54A 3LWUA 1BCPC 3S14B 4X64Q 1NMGA 4IURA 3KK7A 3QB3A 2JA5G 2B2WC 3T56B 1PMRA 3FPPA 5C44G 2I5LX 5DAUA 1IBML 5IY0A 2EY6A 4PV1C 1SYGA 2D9UA 1CKNA 1K0RA 2ZXRA 1FNVA 2N55A 3D4WA 3NTIA 3OTOL 1F2MA 4X3UA 4XIGS 3HKZG 1XXGA 1TWGB 5C4JH 5F2DA 4B3ML 4IFDH 2RSNA 2GVBA 3QO2A 2QF7A 3F2DA 1PH5A 4L8JA 4A4IA 2WINB 1I4RA 3FKIG 5CV4A 3PIOA 1K9MC 3P20A 3NXWA 2PCFB 1QVGA 2QGQA 3DMUA 4C3JB 3SK4A 4GNXB 3KOJA 4LFBQ 3S1RH 2J0TD 1G8ZD 1F77A 1KNEA 2E5LL 2YU9H 2F3WA 3QOJA 4KY5A 3U58A 4R4QA 5IYDH 1LYLA 2H1EA 4LF6Q 3KDFB 1XNQL 2XVSA 4C3IG 5HGTA 4J8QA 1LLRD 1CSPA 4Q0FA 5C5LA 3HOVH 4DR1L 2V1CC 3CRKC 1DOMA 2B8GA 4G7OC 1IXRA 2AQ2B 2SNSA 1CKOA 3KFUA 3WOEA 4X65L 4QB4A 3CPFA 4CHTB 1PHJA 3RMHA 1EY9A 1Y8PB 1Q1BA 5C3EG 1CUKA 1K28A 2VQFQ 4C56C 1JE5A 3J81L 1FNUA 3NUCA 5J22A 4EX5A 2DY7A 3NTKA 2E2JB 2F0MA 2X69A 3SHLA 1VQGA 3MAQA 3J81j 4LJZC 3MXNA 3SGIA 4ME5A 3T1YL 1CTMA 2DY8A 3J7YW 5C6AA 3G48A 3HOVB 3L7ZC 2A19A 3ND9A 4GLXA 2JA8B 1RCVD 1PVOA 5IE8A 4QL5A 2LKVA 2A6HD 1SLJA 2JA7G 4KV6A 4C2MH 4FNFA 4A3JH 1VF5C 2FFKB 3SR1A 2M2LA 1YBYA 1SMYD 4DUYL 1HZAA 1F9PA 3IL8A 1MSGA 2WACA 3TP6A 2JJQA 2A69D 2X6LA 1Q90A 1A15A 2B2UC 3M7NA 2UXBQ 1PRTB 3AU7A 5A2QL 4JI4Q 1AFPA 4L5TA 1QUQB 2K04A 4E6IA 5LMNL 3H15A 1RDPD 2VQEL 1YNXA 1K3RA 1JICA 2EE1A 4O42A 4AQYL 2L4NA 2F0WA 1JC7A 4L5SA 5G3LF 2Q2UA 1KRSA 1JWUD 5M9OA 2B3GA 1A6XA 2PI2E 4A3KH 1VQEA 1JCKB 1VQOA 3ZYYX 1STYA 2PQAA 1K83H 2F0FA 5IP9G 1WCMB 3S16H 1N32Q 3G4SA 1S5FD 1JR0D 2JA5H 3NP8A 1IBLQ 5C44H 1N34L 4F8MA 2ZTDA 4QY7A 3KF6A 3GV6A 3TP7A 3Q6SA 2EIFA 3IKJA 2VUMG 1J5EQ 2F0VA 2E75C 4MTNA 3CCJA 1STBA 1SN8A 4HSVA 4XTCS 3H91A 3BDCA 2MJ8A 1GXDC 3NBHB 1DYQA 3PO3B 3M4OB 4A3EB 2E2HH 1BBUA 3S1NH 1TY2A 3K7AB 4K8JA 4B9XA 3FKIH 1SE4A 3A54A 1NNXA 4RHSA 2WFWA 1XJVA 3MEFA 2A8VA 3F2CA 1OXXK 3E3XA 5GROA 1VQCA 2LMCB 2PZWA 2Z4HA 1NE3A 2JA5B 2WIIB 3PUXA 4J6HA 1BVSA 1P16A 3VYUA 2F4IA 2JK8A 3QOLA 4YCUA 4XYQA 2B2WA 4C3IH 1CA6A 2GA4B 4BY7B 1C9OA 3TS2A 4JK1C 2WAQB 4JBKA 2EDGA 4F7XA 3HKZB 3LGJA 3TEHB 4R4OA 1Y8OB 2E2HB 3BYTB 2WAQE 3HGBA 2R7FA 1LT6D 3G7LA 5C3EH 1X6OA 1UE1A 4DAMA 1S5DD 4H44C 4KKSA 4DV3L 1F9QA 1AP0A 2A73B 2NVTB 2NZ1D 4UP9A 4C3IB 1XNRQ 3HOWB 1D5MC 1SYBA 2RCNA 1AN8A 2LSSA 3N52A 1HZCA 4IN3A 2JA7H 4GLVB 4NXNQ 3X3NA 4NDXA 1G51A 5JPMC 1HA6A 4LF5L 4A3DG 1U0LA 1A2TA 5D65A 2NVXH 4BBRG 5C3EB 4A3GG 3G71A 1ONLA 4OIKA 3GTOH 3R8BA 1QVCA 4EVOA 1N36Q 1BNZA 2OQ0A 5GAEC 2M00A 4LF9L 1S72A 5C5MA 2F0IA 3PQIA 5L37A 2XWJB 1PV4A 4FF3A 3ZJYC 3DWQA 2K5QA 3A5ZB 2MHVA 3I4OA 4DAYA 2RA4A 3I4NG 3UDIA 1RF2D 2FHTA 4DXGA 1AW7A 2EY5A 3EIVA 1VQJA 1Q86C 4R4TA 5I9PA 2B8FA 1PH2A 3BYYB 3UE1A 2QA4A 2WV6D 2JA6G 1F9SA 1Q1EA 1I94Q 2KHJA 1L2FA 2B2UA 4JI0Q 1PYWD 3WOFA 1IBKL 1I6HH 5IGFA 2VUMH 2A6ED 4XDXA 2B63G 2QDBA 4NB3A 1RJTA 2JEAI 1ZXTA 2K14A 1LTAD 4LUOA 1KTKA 1PRTC
chains in the Genus database with same CATH topology
5JOBA 3R2IA 4U673 4KHZA 1BF4A 1H9SA 2WP8J 1E2VA 2OXPA 2FJ2A 1EY7A 3UI2A 1AZPA 5T1GA 1IL8A 2J7ZA 1W6JA 1DXMA 4QUFA 2F3VA 3I72A 3NQTA 5CV6A 2F03A 2EYHA 2IPKD 1RTOA 1BQQT 4C3HG 5TSSA 2F0QA 1TWAB 1K8OA 1DM0B 4NKLA 1SSOA 1DD2A 1C4QA 4OHJA 2XNAC 1DCZA 1DOKA 2EJMA 3D6CA 3SK6A 2A68D 1BCPB 1TWFB 2L9HA 1B44D 5M5WB 1ZEQX 2Q8TA 5M5XB 4G57A 4KK7A 3DEPA 3OMCA 1I4HA 1FNWA 1IYVA 1TWCB 4RFBA 1S5BD 5EKKA 3RD4A 3DEOA 4KD4A 3KLSX 3S15B 4BS9A 2RDFA 2CVRA 1EOTA 2F0NA 5FO8B 1BR9A 2E2IB 4M1UB 4LMQD 4FF1A 1EWHA 1R9TB 2C5CA 1BUVT 1IHZA 1QWYA 2F0TA 4PMBA 5AFWA 1TQOA 4O1NA 2EZVA 4IFDI 4CKEA 3MTSA 4C1NK 4K5XA 4HAEA 2EJFC 1IW7C 1PFBA 3EA6A 1V1PB 4ZQ3A 1SYDA 1PXUA 4DAPA 4BBRB 3PO2B 4IUVA 1II3A 4KY7A 2Z8LA 3FVQA 4KMUC 2PW5A 3I73A 1SNOA 3MC0B 4XXEA 5JJZA 2XWBB 1EY8A 1TR5A 5LL6X 1U4LA 3P1HA 1KDBA 1TWHB 4IUQA 2JYOA 1D2BA 3TZUA 1ZYRC 1HRJA 3TP5A 3I4NB 1HUNA 2IW3A 3HG9A 2L55A 3L3OC 3URYA 1DZ1A 3NHHA 4K6DA 1IKMA 2CHBD 2KEEA 2BE5D 1D5XC 4HCSA 4FXDA 3T4AC 5K5PA 1A2UA 1JWMD 5ELCA 4QF4A 2RDHA 5DNFA 5EBCA 4RGMA 3G6JB 4HTHA 1VF7A 2JE6I 2NN6I 1KDCA 3RZDB 1RKNA 5KNBA 1QNKA 4FF2A 2EY1A 4DA2A 3VYRA 2KJXA 1I4GA 2VNUD 1OXSC 1O7ZA 3GO5A 3K5OA 1PFNA 4K5VA 4C1NI 1PDQA 2QEJC 2NN6G 4V0BA 2EXZA 3E6ZX 2F0OA 1SXTA 1EZ8A 1S4ZA 5DEHA 1OXTA 2FMCA 2EY2A 3T51B 5IT9E 3M3YB 3I91A 3NBHA 1EIGA 2K5WA 2LY7A 1YNND 1ESRA 1FGBD 5M3MB 3JAML 2IX3A 2AQ1B 1WD0A 3FRPB 1HTPA 1D6EC 1CM9A 1HFGA 1ML0D 2R61A 1CQFA 5C3WA 4IQZA 2SEBD 2PQEA 1STEA 2WKDA 5LL6S 3T16A 2QCPX 1I6VC 2O5IC 1SNCA 3OIQA 1JB3A 4EQNA 5IIFA 3TZDA 4AYBB 1M8AA 2TSSA 4CJ2C 2KCCA 4K2LA 4PMWA 2CW0D 1BO0A 3OOCA 2A6HC 5KNCA 3HS0C 3NK9A 4GZYC 3NSWA 4K6LA 1VMCA 3J7AF 5EPJA 4WORA 1B4OA 4U68A 2A69C 4G7HC 3V96A 1G91A 3PIO3 1MD2D 1F2LA 4QIWB 5C4JB 1EYCA 3I3CA 1PZJD 5EQ0A 4XQQA 5FO9B 1D1KA 2D62A 2K03A 5BN4A 3S1RB 1EEID 2F0GA 2K6AA 2YU9B 3K59A 2BDNA 3GP7A 1PTOH 1VDZA 1SJED 3V2TA 3D31A 4BA1I 5HURA 4DK0A 1S5CD 2RBMA 4DF7A 1U9RA 2AQ3B 2DNCA 4ZK9B 5E3FA 2ICEC 3RUZA 2NWGA 2KECA 3DUZA 3A8KE 2NN6H 3LWEA 3NBIA 1R4PB 4YIJA 2J4XA 1HCZA 3K5MA 3PUWA 4MIUA 5D3IB 1PTOB 4DN4M 3A8JE 3NWTA 3BS1A 5IGBA 1A3TA 4HSPA 4IALA 4C2MB 4A3JB 4KTAA 4L6TB 3I90A 1O78A 4RKBA 2L11A 1F2YA 3GD7A 3PV0A 4B9WA 4DAVA 2B2VC 2RSOA 1LTSD 1ILPA 5CORA 3EROA 2Q8IB 5FK9C 1CZWA 2O5JC 1JOKA 1GUOA 4A3KB 1ENCA 3Q24A 4OIJA 4CBVA 2BCOA 3S16B 1K83B 3KF8A 4HMJA 5ELDA 1TS4A 5IODA 1V1OA 3MXGA 1V43A 5C44B 2JSOA 1DJRD 2XSCA 4ZYSA 2IL8A 2KEDA 1GUSA 3OSOA 4HN7A 3MHBA 1ET9A 4RWSC 3E5SA 4CJ0B 3VR5A 3MFGA 2SDFA 3MA2B 2VB2X 1MGSA 4ZUJA 4XT3B 4RGTA 1JORA 1OO9B 3S1NB 2PZTA 3FKIB 2BA0A 1D5ZC 3SK8A 2TMPA 4BWGB 1M4VA 3OPOA 4RCOA 2QKIC 3R93A 1PTOF 4RAUC 4IUUA 2B2YC 1ENFA 1QG7A 3FPUB 1CFMA 1STAA 4TKOB 2K01A 3BDLA 1QB5D 3SDZA 5CMDA 2L12A 3RZOB 5T1IA 2LS01 4N9PA 3D3RA 1H9JA 1UNSA 3H0GB 3KBXA 1FD7D 1MBYA 4ZLTF 1TIID 1V1PA 1LT4D 2YYZA 4OGQC 4FVMA 5BN5A 3C1FA 1L0YB 1YNJD 2B39A 3U9OA 1NAPA 4KI0A 1I50B 3KLSA 1Y69U 2FMMA 3EJIA 2F0HA 3MXPA 2MUYA 4K2KA 5EPLA 3Q23A 3BVZA 2JA7B 3CRLC 1O7LA 1BXTA 1Y8NB 5IGCA 1CI3M 3HP3A 1BOSA 3HZXA 2NVXB 5J1ZA 1S5ED 3GTOB 4HEDA 3K5LA 1Z6HA 5ELBA 3J80E 1SEBD 2V4DA 5G3LD 3VR3A 3P75A 5CV9A 2EJGC 3WDNA 4Q5VA 2F0SA 4OO1G 1CZGA 4ULLA 2F0PA 5C0XJ 4IUPA 2A5HA 1LACA 2EYJA 1GHKA 4ID6A 2ZXOA 4DGZA 5C0XG 1BDOA 1PTOC 1Q3LA 3U9SA 1B50A 1Q12A 5DM73 1Y1VB 1B2TA 5EBDA 2A74C 2QILA 5I6YA 4NMZA 3TP8A 1RODA 1C8CA 1I6HB 3CHBD 2VUMB 2B2VA 3TN2A 2L0CA 2AWOA 3M4YA 5FLXE 1U4RA 3FMCA 1G6ZA 3D8GA 2F0JA 2EYLA 4B08A 5I2YA 2AWNA 2PO4A 2RKSA 2XRSD 1TKWB 5CGKA 4KD3A 1LV9A 2L1BA 1HQRD 2F0DA 3S1QB 4ZUIA 3NQIA 4CKBA 3TDQA 3IFTA 1PRTD 1MI2A 2PNRC 2OT2A 1B9MA 2EYMA 4A3BB 4R8NA 1XTCD 1ZKOA 3IFDA 3P7JA 1LTID 3S1MB 3E0JA 1HXYD 2KCNA 1R4QB 3GQBA 4R9WA 5KNDA 3C2PA 4ILWA 3SE0A 3SVMA 3ND8A 3BZDB 1KAAA 1UEAB 2B2YA 3LNNA 3Q22A 2I46A 2K28A 3MVVA 2WKCA 2ENBA 2XRQD 4A3DB 2NVQB 5IOCA 4MHEA 2K32A 2XIWA 4I7ZC 3MEHA 1O7YA 4A3GB 4C3JG 2BDOA 1EQVA 1Z7TA 5C3XA 1L0XB 3F2UA 4BA2I 1TY0A 3A56A 2NYZD 4N9TA 1SNMA 1CK1A 1ET6A 2CQAA 3PUYA 4OO1H 2F0EA 1B53A 1LTRD 5EPKA 1KNAA 5CBAE 5C0XH 1RTNA 3I4LA 3TMEA 4QUCA 1CT1D 3J81E 3GTQB 3V05A 1E0BA 1EIHA 3SEBA 2VXWA 2JA6B 2RQXA 2ID0A 2NUCA 2FINB 1DOLA 1SNPA 3K58A 5FOBB 2B63B 3A8IE 4DNRB 2KOLA 3R2TA 1OXVA 3VR2A 1EU4A 3BG3A 4M8AA 2Z4IA 4KY6A 2E74C 1SNDA 1G2TA 4L63B 1IW7D 2NTSA 4RGOS 4KN7C 1FR3A 3D4RA 3OMGA 4DNTB 1GUNA 5FO7B 1QILA 5JVH3 3VYTA 1GJXA 5KGUA 3HOZB 1A3VA 1U4MA 4CJ1B 2DN8A 5A2QE 1SDFA 3I4MB 4G7ZC 5C4XB 4C3HB 1QCBD 3PUZA 2EYOA 2PZUA 1ESFA 1ZYRD 3C1EA 1TS5A 5BN3A 1G2SA 2HUGA 1AEXA 5E1FA 4ZKBB 2L5TA 2R6GA 5CBEE 1I4XA 4TSSA 2F1MA 3MFYA 3IAYA 4NW2A 1X32A 5FKAC 3BVGA 1PFMA 4TRDA 1ICWA 3PIP3 2AUKA 4RA8A 4F88A 1IKLA 1LABA 3ITPA 1LTBD 1CHQD 1SYCA 3QJYA 2NB0A 3RLFA 4FF4A 5I6WA 2AUJD 4LK1C 2KQ3A 3SK5A 1Y1WB 3FDTA 1BBXC 3OWEB 3VA7A 3S2HB 2N88A 2HQEA 3MWYW 3J7AV 3QIAA 1J9OA 1B9NA 1UAPA 1HHVA 2H4OA 1RHPA 3A7AB 4A3FB 3A55A 1E2ZA 2DNEA 1IYUA 2M9VA 5A35A 1SMYC 2SNMA 4FXGC 4PNYA 2K33A 3C46A 1RD9D 2VB3X 2O4XA 4IUTA 3DXJC 3OWFA 1HQMC 1BCPD 1K8MA 2IWHA 1CHPD 4MN3A 1KLUD 4V190 4G4KA 4HCEA 1GUTA 2I07B 3T13A 4FXKC 3NE5B 4A3IB 3C3LA 3HOUB 1D1IA 3MZ5A 5KYLA 1WTWA 4JBWA 2K7VA 1PZID 4Y7NB 1TU2B 1GUWA 3LX0A 1SE2A 3DWAA 1HTLD 2X6GA 5C4HA 1JQYD 3W2DA 2K05A 3GTJB 1WTOA 3GTLB 3TSSA 2MP1A 3N6RA 2IX0A 1HFNA 1QOHA 2G9DA 5D14A 5I9OA 5KIXA 2HDMA 2ZT9C 1U4PA 2JXMB 4RH6A 2G9HD 5IGGA 3GTGB 2HDLA 1WD1A 2NBFA 1V8QA 5JEAJ 2LFNA 1EYAA 1Z47A 4CKCA 1I4PA 2F0UA 4WRDA 1WTPA 5JEAG 4FYDA 4J1MA 2EPBA 1OXUA 3NPPA 1HPCA 5CV8A 5M3FB 1SFOB 1XYIA 1WTRA 1XX8A 1G291 4KJNA 1VMPA 5CR3A 4IUNA 1JWSD 1I4QA 2K5DA 4KJOA 1WTXA 1B1ZA 5JAVA 1QJOA 5KRUA 1PLFA 3H3VC 3L9AX 5IT9L 1TS3A 2PMZB 1ENAA 1JOOA 4ZRZA 1EY6A 3VA5A 5IGDA 1LT5D 1GHJA 4DXFA 2HCIA 2KA7A 3OW7A 3HOYB 2HCCA 2EOTA 1QE6A 3H94A 1EU3A 3KLRA 1YNJC 3GTPB 2F0KA 5KYIA 5DM63 4WJWA 4K14A 5LHY1 1SYFA 4FO2A 2F0LA 3DHQA 3MXUA 3TBIB 2O2LD 1PZKD 4F87A 1PRTF 1A3UA 1HA5A 2MPMA 3CU7A 3S9WA 2ZXPA 4H0LC 4X3KA 3CQZB 5KEEA 5NUCA 1EYDA 5E4XA 3QWNA 1SYEA 3K5NA 3KUPA 3SXHA 2A6EC 2C9OA 1X3QA 3OHXC 4Z9CB 4WFN3 1B3AA 5J39A 1STGA 1ILQA 4XYOA 2E76C 3BVMA 1LO5D 1NUCA 3H6MA 4KKUA 1GUGA 4A93B 2RVLA 2PPBC 1TS2A 4OO1I 1TVXA 2R7ZB 3M85A 4TQUS 5JEAH 1WVLA 4XQJA 5C0XI 4ZKCB 1O80A 4QCLA 3ONAB 1EY5A 3R3OA 1FYCA 2KHSA 3HRZC 5CC4A 1EY4A 2KUMA 5D3DA 2A68C 2Z1CA 1H9MA 2D2CC 1KDAA 4H7BA 5CYUA 4EQOA 4S3SA 3I8ZA 4LAAA 1H9RA 2EVBA 4IZ8A 4RHRA 5C4ZA 1NR4A 4K8IA 5I2XA 2PW7A 2EYFA 4UAIA 4XT1B 1LT3D 3K0YA 5ELFA 3O13A 4QMGA 1SJHD 2E2DC 1NCVA 1QNUA 2IT1A 3M7GA 4EGVA 4NP5A 2BOSA 2WB1B 3NTHA 1SAPA 1EL0A 5COYA 3DWPA 1X3PA 4OL7A 5IGEA 5EKLA 3H09A 2SOBA 4DFAA 2PYKA 2RDGA 2B2TC 4PMCA 5ELEA 1T5EA 1KLGD 4X3TA 3BDOA 1SNQA 1WTQA 1EWCA 4R8IA 4HMIA 1GOZA 2OEOA 1EQTA 5K36G 4RGNA 1PTOD 1EEFD 1Q8IA 3NWSA 2EYPA 4UDUC 1NR2A 3JAME 3S2DB 3HOXB 5EJWA 4A3MB 1JOQA 3GTMB 3W3AA 1TT2A 4H13C 3EFXD 1I3QB 3AMUA 3EQLC 5JPNC 2NTTA 2XN9C 3OIPA 3K6OA 5JVG3 4ABNA 1EFID 2BE5C 1STHA 1NSNS 3KBGA 2Q8RE 2OF1A 1T5XD 3FEWX 5I4DA 1AZQA 4BBSB 3PMFA 4IFDJ 2JP1A 1CQVA 4P2CB 5E4WC 3EVQA 2JEBI 4IFDG 2IX1A 4DK1A 2IJ0A 2K1BA 3X3MA 5M5YB 1CA5A 3CKIB 4I65A 3D4DA 2KVMA 1SE3A 1JE4A 1EY0A 1F2ZA 1XWEA 3GTKB 3D6WA 1C48A 1LTTD 2ICIA 1DONA 1EZ6A 2R92B 1BCPF 4DU9A 3J80L 1VCIA 4HR7B 4KHVA 4XQNA 1W6KA 3VR4A 3VR6A 3DM1A 4ZAIA 4BY1B 3Q0AA 1YNNC 4K5WA 4KKTA 3I70A 4PQXA 4EQPA 2Y0SB 3A7LA 1H9SB 2NVYB 5CV5A 2R93B 1SBBB 4CGYB 5ISRA 1MSHA 1HUMA 2R3ZA 2D5DA 3PUVA 5K36H 4KN4C 4X3SA 4ODGA 5FLXL 5EKIA 3VYSA 1KABA 3T53B 1STNA 3GV3A 4FP5D 3AB9A 2CW0C 3ERQA 3QG1A 1J8IA 4RKLA 1WTVA 2MGSA 1UUPA 5CV7A 3HEJA 3K57A 2B2TA 2BA1A 1LTGD 1E2WA 4RCNA 3S17B 1F9RA 5EGTA 1H9KA 3LWUA 1BCPC 3S14B 4IURA 3KK7A 3QB3A 2B2WC 3T56B 1PMRA 3FPPA 5DAUA 2EY6A 4PV1C 1SYGA 2D9UA 2ZXRA 1FNVA 2N55A 3D4WA 3NTIA 1F2MA 4X3UA 4XIGS 1XXGA 1TWGB 5F2DA 4IFDH 2RSNA 3QO2A 2QF7A 4L8JA 2WINB 1I4RA 5CV4A 3P20A 3NXWA 2PCFB 3DMUA 4C3JB 3SK4A 2J0TD 1G8ZD 1F77A 1KNEA 2F3WA 3QOJA 4KY5A 2H1EA 2XVSA 4C3IG 5HGTA 4J8QA 1LLRD 4Q0FA 5C5LA 3CRKC 1DOMA 2B8GA 4G7OC 2AQ2B 2SNSA 3WOEA 4QB4A 4CHTB 3RMHA 1EY9A 1Y8PB 1Q1BA 4C56C 3J81L 1FNUA 3NUCA 5J22A 2DY7A 3NTKA 2E2JB 2F0MA 2X69A 3SHLA 3MAQA 4LJZC 3MXNA 4ME5A 1CTMA 2DY8A 3J7YW 5C6AA 3HOVB 3L7ZC 3ND9A 2JA8B 1RCVD 2LKVA 2A6HD 4KV6A 4FNFA 1VF5C 2FFKB 3SR1A 2M2LA 1SMYD 1F9PA 3IL8A 1MSGA 2WACA 3TP6A 2A69D 2X6LA 1Q90A 1A15A 2B2UC 3M7NA 1PRTB 3AU7A 5A2QL 1AFPA 2K04A 4E6IA 1RDPD 2EE1A 4O42A 1JICA 2L4NA 2F0WA 1JC7A 5G3LF 1JWUD 5M9OA 1A6XA 1JCKB 3ZYYX 1STYA 2F0FA 1WCMB 1S5FD 1JR0D 3NP8A 4F8MA 3GV6A 3TP7A 3Q6SA 3IKJA 2F0VA 2E75C 1STBA 4HSVA 4XTCS 3H91A 3BDCA 2MJ8A 1GXDC 1DYQA 3PO3B 3M4OB 4A3EB 1TY2A 3K7AB 4K8JA 4B9XA 1SE4A 3A54A 4RHSA 1OXXK 2LMCB 2PZWA 2Z4HA 2JA5B 2WIIB 3PUXA 4J6HA 3VYUA 2F4IA 3QOLA 4XYQA 2B2WA 1CA6A 2GA4B 4BY7B 4JK1C 2WAQB 2EDGA 4F7XA 3HKZB 1Y8OB 2E2HB 3BYTB 3HGBA 1LT6D 3G7LA 1S5DD 4H44C 4KKSA 1F9QA 1AP0A 2A73B 2NVTB 2NZ1D 4C3IB 3HOWB 1D5MC 1SYBA 1AN8A 3N52A 4IN3A 3X3NA 4NDXA 5JPMC 1HA6A 1A2TA 5D65A 5C3EB 1ONLA 4OIKA 3R8BA 4EVOA 1BNZA 2M00A 5C5MA 2F0IA 2XWJB 4FF3A 3DWQA 2K5QA 2MHVA 4DAYA 2RA4A 1RF2D 2FHTA 4DXGA 1AW7A 2EY5A 5I9PA 2B8FA 3BYYB 2WV6D 1F9SA 1Q1EA 2B2UA 1PYWD 3WOFA 5IGFA 2A6ED 4XDXA 2QDBA 1RJTA 2JEAI 1ZXTA 1LTAD 1KTKA 1PRTC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SND A;  5EKL A;  5JOB A;  5IGE A;  4KV6 A;  5EGT A;  2EYM A;  2SOB A;  5CV8 A;  4HMJ A;  5IGC A;  4I65 A;  3D4D A;  3SR1 A;  5J39 A;  4R8N A;  1STG A;  1EY0 A;  4K5V A;  3HZX A;  5J1Z A;  4K5X A;  1F2Z A;  5IOD A;  2WAC A;  4KJN A;  2F0G A;  3OMG A;  1NUC A;  3TP6 A;  2OXP A;  5CR3 A;  3QB3 A;  2PYK A;  4IUN A;  4DFA A;  3H6M A;  2SNM A;  4PMC A;  1EZ6 A;  1EY7 A;  4ZQ3 A;  4PNY A;  1SYD A;  2EXZ A;  4DU9 A;  2F0O A;  1SNQ A;  4KJO A;  5DAU A;  5KGU A;  1A3V A;  1EZ8 A;  2F3V A;  3P75 A;  5JAV A;  2EY6 A;  1SYG A;  1II3 A;  5CV9 A;  3OSO A;  2O4X A;  4KY7 A;  3MHB A;  5DEH A;  5KRU A;  4HMI A;  2EY2 A;  1KAA A;  2F0S A;  3NQT A;  5CV6 A;  3SXH A;  2PW5 A;  3E5S A;  4KHV A;  2EYH A;  3OWF A;  3V2T A;  4E6I A;  2F0P A;  1SNO A;  2OEO A;  3D4W A;  1F2M A;  1SYB A;  5HUR A;  4ZUJ A;  2F0Q A;  2EYJ A;  2F0W A;  4ID6 A;  5F2D A;  1ENA A;  2EYO A;  2RBM A;  4DGZ A;  2PZU A;  2PZT A;  4DF7 A;  1JOO A;  4NKL A;  1EY8 A;  1TR5 A;  2EYP A;  5M9O A;  3P1H A;  1KDB A;  1U9R A;  3C1E A;  4K5W A;  3T13 A;  3MVV A;  5CV4 A;  4NDX A;  2ENB A;  1EY6 A;  3VA5 A;  4EQP A;  5IGD A;  3NXW A;  3SK8 A;  1STY A;  2F0F A;  5E3F A;  5IOC A;  3MZ5 A;  3DMU A;  1EY5 A;  3R3O A;  3D6C A;  3SK4 A;  3MEH A;  4F7X A;  1A2T A;  1AEX A;  3SK6 A;  2KHS A;  3RUZ A;  5E1F A;  5C3W A;  5KYL A;  3TP5 A;  5CV5 A;  1EQV A;  2PQE A;  1JOQ A;  3NP8 A;  5C3X A;  5CC4 A;  1EY4 A;  1TT2 A;  4EVO A;  5I6Y A;  4NMZ A;  4F8M A;  3LX0 A;  4YIJ A;  3TP8 A;  2F3W A;  1KDA A;  3QOJ A;  4H7B A;  4KY5 A;  4N9T A;  3T16 A;  5C4H A;  4MIU A;  1SNM A;  4S3S A;  3TP7 A;  4EQO A;  3NHH A;  2M00 A;  4LAA A;  5HGT A;  5ISR A;  1STA A;  4K6D A;  2F0V A;  5C5L A;  1STB A;  1SNC A;  5C5M A;  2F0K A;  2F0I A;  3BDL A;  2F0E A;  4EQN A;  5KYI A;  4IZ8 A;  5IIF A;  4TRD A;  5IGB A;  1A3T A;  3BDC A;  4G57 A;  4IAL A;  5C4Z A;  4K14 A;  4ODG A;  3OMC A;  4N9P A;  1KAB A;  4K8I A;  2SNS A;  4K2L A;  4KTA A;  1JOR A;  2PW7 A;  1SYF A;  3ITP A;  4K8J A;  3D8G A;  5K5P A;  1STN A;  4QB4 A;  2F0J A;  4B9X A;  1A2U A;  2EYF A;  5I9O A;  1STH A;  4RKB A;  2F0L A;  1SYC A;  2EYL A;  1EY9 A;  5KIX A;  3DHQ A;  5I6W A;  1F2Y A;  3TME A;  4QF4 A;  1NSN S;  5EKK A;  2EY5 A;  3C1F A;  2KQ3 A;  4KD4 A;  3SK5 A;  2OF1 A;  2RKS A;  3ERQ A;  3NUC A;  5J22 A;  2PZW A;  4B9W A;  3NK9 A;  3U9O A;  4RKL A;  5CGK A;  4KD3 A;  5I9P A;  2F0M A;  3SHL A;  4J6H A;  4HTH A;  2RDF A;  5CV7 A;  5IGG A;  1A3U A;  3PMF A;  2F0N A;  3S9W A;  2NUC A;  4QMG A;  2F0D A;  2HQE A;  4WOR A;  3ERO A;  4ZUI A;  3HEJ A;  3QOL A;  4ME5 A;  3EJI A;  1SNP A;  5KEE A;  2F0H A;  1KDC A;  3EVQ A;  1EYD A;  3MXP A;  4K2K A;  5NUC A;  4NP5 A;  1EYA A;  5C6A A;  5IGF A;  1RKN A;  1EYC A;  1JOK A;  2QDB A;  1IHZ A;  1SYE A;  2F0T A;  2F0U A;  2EY1 A;  4PMB A;  2LKV A;  4KY6 A;  4WRD A;  1TQO A;  4OL7 A;  4J1M A;  1ENC A; 
#chains in the Genus database with same CATH topology
 1H95 A;  5JOB A;  1XMO L;  1AE3 A;  3R2I A;  4U67 3;  4KHZ A;  1BF4 A;  1H9S A;  3HKS A;  1Q8K A;  2WP8 J;  2UUA Q;  1E2V A;  1I5F A;  1NTG A;  2OXP A;  2FJ2 A;  4DR6 L;  1EY7 A;  3UI2 A;  1AZP A;  5T1G A;  1IL8 A;  2J7Z A;  1W6J A;  1DXM A;  4QUF A;  2F3V A;  3CCU A;  3I4M G;  3I72 A;  3NQT A;  5CV6 A;  2F03 A;  2MO0 A;  3S1Q H;  2I5M X;  2EYH A;  2IPK D;  1IBM Q;  1RTO A;  1BQQ T;  4K0K L;  5C4X G;  4C3H G;  3IRB A;  5TSS A;  4YCW A;  2F0Q A;  1TWA B;  1K8O A;  1DM0 B;  5FLM G;  1JMC A;  2OTL A;  1HR0 L;  4NKL A;  2HD3 A;  1SSO A;  1EQQ A;  4DV0 L;  1C4Q A;  2CCZ A;  2VL6 A;  1DD2 A;  4OHJ A;  4UP8 A;  2XNA C;  1TWC H;  1DCZ A;  4B3M Q;  2OCE A;  1DOK A;  4JBJ A;  2EJM A;  3D6C A;  1FVI A;  3KF8 B;  3SK6 A;  2A68 D;  4R4I A;  3S1M H;  1BCP B;  1TWF B;  2L9H A;  3E9H A;  3CCE A;  1B44 D;  5M5W B;  1N8R C;  4B3T L;  1ZEQ X;  2YTV A;  1HNW L;  1R9T H;  2E5L Q;  3JAM c;  2Q8T A;  5M5X B;  4UP7 A;  1P8L A;  2RHS B;  1XNQ Q;  1CSQ A;  4G57 A;  4KK7 A;  3DEP A;  3OMC A;  4DR1 Q;  4DR4 L;  1I4H A;  4NPS A;  1FNW A;  1YVC A;  4LF4 Q;  1IYV A;  1TWC B;  4RFB A;  1S5B D;  2D0O A;  5EKK A;  3RD4 A;  3DEO A;  4JI3 Q;  4KD4 A;  4JI2 L;  4X65 Q;  4A3D H;  3KYH C;  3K80 C;  2NVQ H;  1LUZ A;  3KLS X;  4BBR H;  4A3G H;  1Y1W G;  3S15 B;  4BS9 A;  2RDF A;  1X55 A;  1EOT A;  2CVR A;  2F0N A;  5FO8 B;  1BR9 A;  2E2I B;  4M1U B;  2Z6K C;  4LMQ D;  1IYJ B;  4FF1 A;  1EWH A;  1IL2 A;  3CCM A;  1R9T B;  2C5C A;  1A8V A;  1BUV T;  1IHZ A;  1QWY A;  2F0T A;  2N8N A;  4PMB A;  3T1Y Q;  2FXQ A;  5AFW A;  1TQO A;  4O1N A;  2EZV A;  4IFD I;  4MNO A;  4CKE A;  4GNX A;  1KIX A;  3MTS A;  4C1N K;  2L15 A;  4LWC A;  4K5X A;  4HAE A;  2EJF C;  3I4N H;  1IW7 C;  4JPB W;  1PFB A;  3EA6 A;  1V1P B;  4ZQ3 A;  4DV4 L;  4DUY Q;  1X56 A;  1SYD A;  3KDF A;  1PXU A;  4DAP A;  4BBR B;  3PO2 B;  4HIM A;  4IUV A;  1II3 A;  3E9I A;  4KY7 A;  2JA6 H;  2Z8L A;  3FVQ A;  4KMU C;  2LXJ A;  2PW5 A;  3I73 A;  1T9H A;  1SNO A;  3MC0 B;  4H02 A;  4XXE A;  5JJZ A;  2UU9 L;  2B63 H;  4J15 A;  4APV A;  2IY5 B;  5LMN Q;  1FJG L;  2XWB B;  1EY8 A;  1TR5 A;  5LL6 X;  1U4L A;  3P1H A;  1KDB A;  1TWH B;  2VQE Q;  1SE8 A;  4IUQ A;  2JYO A;  4AQY Q;  1D2B A;  3TZU A;  4DAY B;  1ZYR C;  2K4K A;  4A3I G;  3HOU G;  4MTK A;  4HJ7 A;  5GAD C;  2N78 A;  1HRJ A;  3TP5 A;  3I4N B;  1E3P A;  1GKH A;  1HUN A;  2IW3 A;  3HG9 A;  3A74 A;  2L55 A;  3L3O C;  3URY A;  4JI6 L;  1HJP A;  1DZ1 A;  3NHH A;  1N34 Q;  3RZD H;  4LFC L;  3I7F A;  4K6D A;  3I4M H;  2C35 B;  5C4X H;  1K8A C;  4C3H H;  1IKM A;  2CHB D;  2RF4 A;  4CDD C;  2KEE A;  2BE5 D;  1D5X C;  5FLM H;  1GD7 A;  4HCS A;  4IO9 A;  1KRT A;  4FXD A;  3T4A C;  5K5P A;  1A2U A;  1JWM D;  5ELC A;  4QF4 A;  2RDH A;  5DNF A;  1FL0 A;  5EBC A;  5BR8 Q;  1NY4 A;  4RGM A;  1QUQ A;  3G6J B;  4HTH A;  1VF7 A;  3KLW A;  1VQ9 A;  3W5O A;  4YWL A;  2JE6 I;  2NN6 I;  4WJ4 A;  3M3Y H;  1KDC A;  3RZD B;  1RKN A;  5KNB A;  1QNK A;  3EN2 A;  4FF2 A;  2EY1 A;  1W2B A;  1HH2 P;  4DA2 A;  3FP9 A;  1BBW A;  3CCR A;  1YJ9 A;  1PH4 A;  3VYR A;  2KJX A;  1I4G A;  2VNU D;  1OXS C;  1O7Z A;  3GO5 A;  3K5O A;  2UXD L;  3L2P A;  1PFN A;  2R7D A;  4K5V A;  1L0W A;  4C1N I;  4PZ6 A;  1PDQ A;  2QEJ C;  3G6E A;  2NN6 G;  4PZ7 A;  1LTL A;  4V0B A;  2EXZ A;  4ZCK A;  3E6Z X;  2F0O A;  1Y1W H;  1SXT A;  1EZ8 A;  1S4Z A;  3S2H H;  5DEH A;  1OXT A;  4B3R L;  2FMC A;  4DV3 Q;  2EY2 A;  1DGS A;  3W1B A;  3T51 B;  5IT9 E;  3M3Y B;  3I91 A;  3NBH A;  2ZM6 Q;  1EIG A;  2K5W A;  2LY7 A;  1YNN D;  1ICF B;  1ESR A;  1FGB D;  4IPH A;  5M3M B;  3JAM L;  2IX3 A;  2AQ1 B;  1WD0 A;  3TS0 A;  3FRP B;  4JYA L;  1HTP A;  1D6E C;  1CM9 A;  1HFG A;  1ML0 D;  2R61 A;  1CQF A;  2JN4 A;  2OWO A;  1G6P A;  5C3W A;  4QQB X;  4IQZ A;  2SEB D;  2PQE A;  4JI8 L;  1STE A;  2WKD A;  1E7Z A;  1RL2 A;  4DKA C;  4LF5 Q;  5LL6 S;  1PYB A;  5LMN W;  1VQ4 A;  3T16 A;  5HGQ A;  2QCP X;  1I6V C;  2O5I C;  4DR2 L;  1SNC A;  3OIQ A;  3CD6 A;  1JB3 A;  1OTC A;  4EQN A;  5IIF A;  3TZD A;  4AYB B;  1M8A A;  2Z6K A;  2TSS A;  4LF9 Q;  4DV6 L;  4CJ2 C;  1B7Y B;  2KCC A;  4K2L A;  4PMW A;  1LM0 A;  2CW0 D;  4AYB E;  4LF8 L;  4WJ3 M;  1BO0 A;  4A3I H;  3HOU H;  3OOC A;  2A6H C;  1D7Q A;  5KNC A;  3HS0 C;  4JV5 L;  3NK9 A;  4GZY C;  3NSW A;  4K6L A;  2DUD A;  2HIV A;  1VMC A;  4Y7N H;  1JJ2 A;  3J7A F;  5EPJ A;  4WOR A;  1B4O A;  4U68 A;  2A69 C;  4G7H C;  3V96 A;  1G91 A;  3PIO 3;  1MD2 D;  2DJG C;  1F2L A;  3CMA A;  4LF4 L;  4QIW B;  4UHV A;  5C4J B;  1EYC A;  3F2B A;  3ERS X;  3I3C A;  4JI3 L;  1PZJ D;  5EQ0 A;  5GQO A;  3H0G G;  4XQQ A;  1IBK Q;  5FO9 B;  1D1K A;  2D62 A;  2K03 A;  5BN4 A;  3S1R B;  5ELN A;  1MKH A;  1EEI D;  2F0G A;  2K6A A;  1XMO Q;  1VQ8 A;  2YU9 B;  1VQP A;  2H5X A;  3K59 A;  2BDN A;  3GP7 A;  4A93 G;  4GKK L;  4DR6 Q;  1PTO H;  1VDZ A;  1SJE D;  3GTG H;  3V2T A;  3D31 A;  4BA1 I;  4YHH L;  5HUR A;  4DK0 A;  1S5C D;  2RBM A;  4DF7 A;  4K0K Q;  1U9R A;  5FJ8 G;  3CCQ A;  1C7Y A;  4IPG A;  2AQ3 B;  3J81 i;  2DNC A;  4CDF C;  4ZK9 B;  1HR0 Q;  5H1S E;  5E3F A;  2ICE C;  4DV0 Q;  3UDF A;  4OX9 L;  2GVA A;  3RUZ A;  4LNQ A;  2NWG A;  2KEC A;  2I5H A;  3A8K E;  3DUZ A;  3CME A;  4RMF A;  2NN6 H;  3LWE A;  3NBI A;  1R4P B;  4YIJ A;  2J4X A;  1HCZ A;  3K5M A;  1KHI A;  4JI1 Q;  3PUW A;  4MIU A;  5D3I B;  1PTO B;  4DN4 M;  3A8J E;  3F8T A;  3NWT A;  4B3T Q;  3BS1 A;  1HNW Q;  5IGB A;  1A3T A;  1PFS A;  4HSP A;  4IAL A;  4C2M B;  4A3J B;  1E24 A;  4KTA A;  4GS3 A;  4L6T B;  3I90 A;  4HJ8 A;  1O78 A;  1Y1V G;  4RKB A;  4JC0 A;  2L11 A;  2PNH A;  1F2Y A;  1ASZ A;  4DR4 Q;  3GD7 A;  3PV0 A;  4X6A H;  4B9W A;  4DAV A;  2B2V C;  2RSO A;  1LTS D;  2LXK A;  1ILP A;  4JI2 Q;  5COR A;  3ERO A;  2Q8I B;  4R4C A;  2NZO A;  5FK9 C;  2VW9 A;  1CZW A;  2O5J C;  1JOK A;  2WB1 G;  3CCL A;  1V1Q A;  1GUO A;  5BR8 L;  4A3K B;  1ENC A;  1VS0 A;  3Q24 A;  4OIJ A;  4CBV A;  2BCO A;  3S16 B;  1K83 B;  1CKM A;  3KF8 A;  4HMJ A;  1M90 C;  5ELD A;  4GKJ L;  1TS4 A;  5IOD A;  3A5U A;  1V1O A;  1L1O C;  3MXG A;  1W3S A;  1V43 A;  5C44 B;  1YJN A;  2JSO A;  4R1J A;  1DJR D;  2XSC A;  4ZYS A;  2IL8 A;  2KED A;  3K8A A;  3AFP A;  1GUS A;  3OSO A;  4HN7 A;  4DV4 Q;  3MHB A;  1ET9 A;  4RWS C;  3E5S A;  4CJ0 B;  3VR5 A;  4BXX G;  3MFG A;  2SDF A;  3MA2 B;  2VB2 X;  1MGS A;  4ZUJ A;  3AYH B;  4XT3 B;  3RZO H;  4RGT A;  1JOR A;  1OO9 B;  3S1N B;  2PZT A;  4A3B G;  3FKI B;  3H0G H;  3HKZ E;  2BA0 A;  3PGZ A;  2UU9 Q;  3CC7 A;  1D5Z C;  3SK8 A;  1FJG Q;  3RN2 A;  2TMP A;  4BWG B;  3HOX G;  1M4V A;  3OPO A;  2ZM6 L;  4A3M G;  4RCO A;  3STB D;  2QKI C;  3R93 A;  1PTO F;  4RAU C;  1WOC A;  4IUU A;  2B2Y C;  1ENF A;  4L5Q A;  1E1T A;  1I50 H;  4A93 H;  1QG7 A;  3FPU B;  5AJ3 L;  1CFM A;  1STA A;  4TKO B;  2K01 A;  2F4V L;  3BDL A;  1VQN A;  1QB5 D;  3Q8D A;  4JI6 Q;  3SDZ A;  1FGU A;  5CMD A;  2L12 A;  4LFC Q;  3RZO B;  5T1I A;  2LS0 1;  4N9P A;  3D3R A;  2AKW B;  1H9J A;  1UNS A;  3H0G B;  3KBX A;  1FD7 D;  1MBY A;  4ZLT F;  1TII D;  1QZG A;  1V1P A;  1X3E A;  5FJ8 H;  1LT4 D;  2YYZ A;  1HZB A;  3CP0 A;  4OGQ C;  4FVM A;  5BN5 A;  3C1F A;  1L0Y B;  1YNJ D;  2B39 A;  3U9O A;  5JJK A;  1NAP A;  2KHI A;  4BBS G;  4KI0 A;  1UE6 A;  1I50 B;  3KLS A;  1Y69 U;  2FMM A;  3EJI A;  2F0H A;  3MXP A;  2MUY A;  4K2K A;  3W1G A;  5EPL A;  4LFA L;  3Q23 A;  3BVZ A;  2JA7 B;  2JA9 A;  3E0E A;  3CRL C;  1YHQ A;  4GLA C;  1O7L A;  1BXT A;  1Y8N B;  5IGC A;  2UUB L;  1CI3 M;  3HP3 A;  1BOS A;  3HZX A;  2NVX B;  5J1Z A;  1Y1V H;  1S5E D;  3GTO B;  4HED A;  4OWX B;  3BU2 A;  3K5L A;  2UXD Q;  4L5R C;  1Z6H A;  5ELB A;  1B3Q A;  3J80 E;  1SEB D;  3ULJ A;  2R92 G;  2V4D A;  5G3L D;  3K7U C;  3VR3 A;  3P75 A;  5CV9 A;  2EJG C;  3WDN A;  4Q5V A;  2EQS A;  2F0S A;  4OO1 G;  1CZG A;  1K0S A;  4ULL A;  2F0P A;  5C0X J;  4IUP A;  3PCO B;  1IZ6 A;  2A5H A;  4B3R Q;  1LAC A;  2EYJ A;  1GHK A;  4ID6 A;  2ZXO A;  3QR8 A;  4DGZ A;  2YTY A;  4BY1 G;  5C0X G;  1BDO A;  3PF5 A;  3I2Z A;  1PTO C;  1YZ6 A;  1HNX L;  1Q3L A;  3U9S A;  2Y0S G;  1B50 A;  1SRU A;  1Q12 A;  5DM7 3;  1Y1V B;  1B2T A;  5EBD A;  3HOZ G;  3H3V I;  2A74 C;  2QIL A;  4JYA Q;  2K5H A;  4NMZ A;  5I6Y A;  4DK3 C;  3TP8 A;  1ROD A;  1WI5 A;  4JI8 Q;  1C8C A;  1I6H B;  3CHB D;  2R93 G;  2VUM B;  3CXC A;  3VDY A;  2B2V A;  3TN2 A;  3ULL A;  4BXX H;  2L0C A;  2AWO A;  3M4Y A;  5FLX E;  1NJI C;  1U4R A;  5EAY A;  4DR2 Q;  4A3B H;  3FMC A;  1G6Z A;  3D8G A;  2F0J A;  4JI1 L;  2EYL A;  4DV6 Q;  4B08 A;  3S2D H;  5I2Y A;  2AWN A;  3KJO A;  3HOX H;  2PO4 A;  2XTI A;  2RKS A;  2XRS D;  1TKW B;  4LF8 Q;  1KC8 C;  4A3M H;  5CGK A;  4KD3 A;  3GTM H;  1LV9 A;  2L1B A;  1HQR D;  2F0D A;  2E8G A;  3S1Q B;  4ZUI A;  4JV5 Q;  3NQI A;  2KEN A;  4CKB A;  1QZH A;  3TDQ A;  3IFT A;  1PRT D;  1MI2 A;  2PNR C;  1XPR A;  2OT2 A;  2CH4 W;  2Z9H A;  1B9M A;  2EYM A;  3K81 C;  1SMX A;  4A3B B;  4R8N A;  1XTC D;  1ZKO A;  1UE7 A;  3IFD A;  3P7J A;  1VQM A;  1B8A A;  1LTI D;  3S1M B;  3F1Z A;  2BH2 A;  3E0J A;  1HXY D;  2KCN A;  3ER0 A;  1RIP A;  1R4Q B;  3GQB A;  4R9W A;  4JBM A;  4EQ5 A;  5KND A;  3C2P A;  3RNU A;  4ILW A;  3SE0 A;  3SVM A;  3ND8 A;  5JJI A;  3BZD B;  4BBS H;  1B70 B;  2EXD A;  1KAA A;  1UEA B;  1VQH A;  4GKK Q;  3JC6 6;  4A3F G;  2B2Y A;  3LNN A;  4IOA A;  3Q22 A;  4YY3 L;  2I0Q A;  1VQ6 A;  1EIY B;  2I46 A;  2K28 A;  4YHH Q;  3I56 A;  1M1K C;  3MVV A;  2WKC A;  2ENB A;  2XRQ D;  3GTQ H;  4PG3 A;  4A3D B;  5IOC A;  2K32 A;  4JCV E;  4MHE A;  2NVQ B;  2KCT A;  1NMF A;  3HFZ B;  2XIW A;  4I7Z C;  3MEH A;  1SRO A;  1O7Y A;  4A3G B;  4C3J G;  1S40 A;  2BDO A;  1EQV A;  1PH9 A;  1Z7T A;  5C3X A;  3KJP A;  1L0X B;  3F2U A;  4BA2 I;  4OX9 Q;  2R92 H;  1TY0 A;  3A56 A;  2NYZ D;  4N9T A;  3CC2 A;  1SNM A;  4PZ8 A;  4P75 A;  1CK1 A;  1ET6 A;  3FHW A;  1Q46 A;  2CQA A;  3M4Q A;  3PUY A;  4OO1 H;  4OWT B;  1WYD A;  4JG2 A;  2F0E A;  1UEB A;  1B53 A;  1LTR D;  5EPK A;  3ULP A;  1D8L A;  1KNA A;  1PH6 A;  2UXC L;  4BY1 H;  5CBA E;  1V9P A;  5C0X H;  4GOP B;  1RTN A;  4O2D A;  1PH7 A;  3I4L A;  4A3C G;  1XTD A;  3TME A;  4QUC A;  1CT1 D;  3J81 E;  3GTQ B;  3V05 A;  1E0B A;  3HOZ H;  2NVY H;  1EQR A;  1EIH A;  3SEB A;  2VXW A;  2JA6 B;  2RQX A;  1HNZ L;  2ID0 A;  2NUC A;  2FIN B;  1DOL A;  2R93 H;  1SNP A;  3K58 A;  5FOB B;  2B63 B;  3A8I E;  4DNR B;  3M4P A;  2KOL A;  2ZJQ A;  3R2T A;  1OXV A;  3VR2 A;  1EU4 A;  3BG3 A;  4M8A A;  2Z4I A;  4KY6 A;  2E74 C;  2JA8 G;  3OYY A;  1SND A;  1G2T A;  4L63 B;  3J80 i;  1IW7 D;  2NTS A;  4RGO S;  3H3V H;  4KN7 C;  1FR3 A;  3CPW A;  3D4R A;  3OMG A;  4DNT B;  3D0F A;  1GUN A;  5FO7 B;  4RG1 A;  4GKJ Q;  1QIL A;  2Z6B A;  1XPO A;  5JVH 3;  2OTJ A;  3VYT A;  1GJX A;  5KGU A;  3HOZ B;  1A3V A;  1U4M A;  4MZ9 A;  2DN8 A;  2IHF A;  4CJ1 B;  1SDF A;  5A2Q E;  3I4M B;  3AQQ A;  4G7Z C;  4HJ9 A;  4IJH A;  5C4X B;  4C3H B;  1QCB D;  3PUZ A;  1J6Q A;  3AFQ A;  1WTH A;  3GDE A;  2EYO A;  2PZU A;  5M3F G;  1ESF A;  1ZYR D;  3C1E A;  4IPD A;  1TS5 A;  3PIP A;  5BN3 A;  1G2S A;  2KCM A;  3S14 H;  2HUG A;  2ATW A;  5GAH C;  1AEX A;  1WCM G;  5E1F A;  4ZKB B;  2L5T A;  2R6G A;  2GN5 A;  5IT9 c;  5CBE E;  1I4X A;  2DGY A;  4B3S L;  4TSS A;  4P71 A;  2IHE A;  1L1O B;  2F1M A;  3MFY A;  3IAY A;  1N33 L;  2K75 A;  4NW2 A;  1PH8 A;  2KBN A;  1X32 A;  5FKA C;  3BVG A;  1PFM A;  4A3F H;  4TRD A;  1ICW A;  5AJ3 Q;  3PIP 3;  2AUK A;  1SR3 A;  2RCF A;  4OXP A;  2HHH L;  5GAG C;  4RA8 A;  2F4V Q;  3RLO A;  1QVF A;  4F88 A;  1IKL A;  1LAB A;  3ITP A;  1LTB D;  1O7I A;  3PO3 G;  4A3E G;  1CHQ D;  1S3O A;  1SYC A;  4DUZ L;  3QJY A;  2NB0 A;  3RLF A;  4ALP A;  4FF4 A;  5I6W A;  2AUJ D;  4LK1 C;  2KQ3 A;  3SK5 A;  3HOY G;  1Y1W B;  3FDT A;  4C3J H;  2JQO A;  1BBX C;  2F52 A;  3OWE B;  3VA7 A;  1PH3 A;  2MFI A;  3S2H B;  3U4V A;  2N88 A;  2HQE A;  3MWY W;  3J7A V;  4DR7 L;  3QIA A;  1J9O A;  2YV5 A;  2OQK A;  1B9N A;  1UAP A;  5E7N A;  1HHV A;  2H4O A;  1VQ7 A;  1RHP A;  4BY7 G;  4LF7 L;  3A7A B;  4A3F B;  3A55 A;  1E2Z A;  4JW0 A;  4LFA Q;  3JAM i;  1Y14 B;  2WAQ G;  4DR5 L;  2DNE A;  1IYU A;  2M9V A;  4A3C H;  5A35 A;  1SMY C;  2SNM A;  5IWA L;  1JB7 A;  2UUB Q;  4FXG C;  4PNY A;  2K33 A;  3C46 A;  1RD9 D;  4DR3 L;  2E2J H;  5JJL A;  3GTJ H;  3OW2 A;  2VB3 X;  1MIU A;  2O4X A;  4IUT A;  3DXJ C;  3GTL H;  4DK6 C;  5LMU L;  3OWF A;  1HQM C;  1BCP D;  1K8M A;  2IWH A;  1CHP D;  1JT8 A;  4QIW E;  4MN3 A;  1KLU D;  4V19 0;  1KQS A;  3HOW G;  4G4K A;  4HCE A;  1GUT A;  5J3B A;  2JA8 H;  2I07 B;  3T13 A;  1KL9 A;  4FXK C;  4X66 L;  3NE5 B;  4A3I B;  3C3L A;  3HOU B;  1D1I A;  3MZ5 A;  5KYL A;  1WTW A;  4JBW A;  1KXL A;  2Z0S A;  1HNX Q;  2K7V A;  1PZI D;  4Y7N B;  2K5N A;  1TU2 B;  1GUW A;  3LX0 A;  1Q81 C;  1SE2 A;  4OEL B;  3DWA A;  4TVA B;  1HTL D;  2X6G A;  5C4H A;  1XMQ L;  4GOP C;  1JQY D;  3W2D A;  2K05 A;  3GTJ B;  4CDE C;  1WTO A;  2YTX A;  2R7Z G;  3GTL B;  3TSS A;  3TQY A;  2MP1 A;  3N6R A;  2IX0 A;  1HFN A;  5M3F H;  1SFO H;  1QOH A;  2G9D A;  2QDL A;  5D14 A;  5I9O A;  3K0X A;  4JI7 L;  1YIT A;  5KIX A;  2QEX A;  2HDM A;  4N8X 1;  2ZT9 C;  5IYB G;  1U4P A;  2G5D A;  3BZC A;  1WCM H;  3T1H L;  2JXM B;  4RH6 A;  2G9H D;  5IGG A;  1EWI A;  3GTG B;  2VY3 A;  2HDL A;  1WD1 A;  2NBF A;  1V8Q A;  4DV5 L;  2UUC L;  5JEA J;  2LFN A;  3CC4 A;  1EYA A;  4KLK A;  1Z47 A;  4CKC A;  1I4P A;  2F0U A;  4WRD A;  1WTP A;  2CH4 A;  5JEA G;  4FYD A;  4J1M A;  4AH6 A;  2EPB A;  1OXU A;  3NPP A;  1HPC A;  5CV8 A;  1PH1 A;  5M3F B;  1SFO B;  3DLL A;  1MJE A;  4LUZ A;  1XYI A;  3M4O H;  4LUV A;  1XX8 A;  4A3E H;  1G29 1;  4JOI C;  1WTR A;  3PO3 H;  3K7A H;  4KJN A;  1VMP A;  5CR3 A;  4IUN A;  1EFW A;  3DM3 A;  3HOY H;  1JWS D;  1Q82 C;  1I4Q A;  1VQB A;  2K5D A;  4KJO A;  1WTX A;  1B1Z A;  1XPU A;  4OWW B;  5JAV A;  1VQK A;  1QJO A;  5KRU A;  1PLF A;  3GTP H;  3I55 A;  3H3V C;  3L9A X;  4JVZ A;  5IT9 L;  3STB C;  1TS3 A;  2PMZ B;  1U5K A;  1X9N A;  3CCS A;  1ENA A;  4BY7 H;  1JOO A;  4ZRZ A;  4JI5 L;  2PMZ E;  3RN5 A;  2VZA A;  1EY6 A;  3VA5 A;  5IGD A;  4YY3 Q;  4HIK A;  1LT5 D;  1GHJ A;  3WWV A;  4DXF A;  4X62 L;  2HCI A;  2KA7 A;  2N3S A;  1X65 A;  3OW7 A;  5ELO A;  2HQL A;  3HOY B;  3U50 C;  4HJ5 A;  2D0P A;  2CQO A;  2HCC A;  2EOT A;  1QE6 A;  3H94 A;  3CQZ H;  4A3L G;  1EU3 A;  3KLR A;  4N8F A;  1YNJ C;  2NVT H;  3GTP B;  2NZH A;  2Q2H A;  2F0K A;  5KYI A;  4YCV A;  5DM6 3;  1CKN B;  1VQD A;  4WJW A;  2XGT A;  4P73 A;  4DV7 L;  4K14 A;  3PF4 A;  2AHO B;  3HOW H;  4DV2 L;  5LHY 1;  1SYF A;  2ALY B;  4FO2 A;  1WFQ A;  2F0L A;  3DHQ A;  3TRZ A;  3MXU A;  3TBI B;  2UXC Q;  2ES2 A;  1EIF A;  3CAM A;  2O2L D;  4KHP L;  1PZK D;  1MHW C;  4DV1 L;  4F87 A;  2ZTC A;  1PRT F;  1A3U A;  1HA5 A;  2MPM A;  3CU7 A;  3S9W A;  1HR0 W;  4A76 A;  4OEM B;  1AE2 A;  2ZXP A;  4H0L C;  4X3K A;  4NXM Q;  3CQZ B;  5KEE A;  5NUC A;  1EYD A;  5E4X A;  3QWN A;  1HNZ Q;  3ICE A;  2R7Z H;  1SYE A;  3K5N A;  4X64 L;  3L0O A;  3KUP A;  4GNX C;  3SXH A;  2A6E C;  2C9O A;  2BH8 A;  1X3Q A;  3OHX C;  4Z9C B;  4WFN 3;  1B3A A;  4UPA A;  4A75 A;  5J39 A;  1STG A;  3M9B A;  1ILQ A;  1X3G A;  2E76 C;  3BVM A;  4XYO A;  3EBE A;  1LO5 D;  1NUC A;  1E22 A;  1YIJ A;  3H6M A;  4KKU A;  5IP7 G;  5IYB H;  3RR5 A;  1GUG A;  4A93 B;  2RVL A;  2MNA A;  2PPB C;  3PO2 G;  1TS2 A;  4LW1 A;  2K5V A;  4OON A;  1JJC B;  4OO1 I;  3MXN B;  1TVX A;  2R7Z B;  3M85 A;  1K8G A;  4TQU S;  4GOP A;  5JEA H;  1WVL A;  4XQJ A;  2ASB A;  4LFB L;  4HJA A;  3UE0 A;  1WJJ A;  3J80 c;  5C0X I;  4ZKC B;  1O80 A;  4QCL A;  3ONA B;  1EY5 A;  3R3O A;  1FYC A;  2KHS A;  1A0I A;  3HRZ C;  4GN5 A;  4LF6 L;  5CC4 A;  1EY4 A;  2KUM A;  5IP9 H;  5D3D A;  2A68 C;  2Z1C A;  1VQ5 A;  1H9M A;  2D2C C;  1KDA A;  4H7B A;  5CYU A;  1E1O A;  2MQH A;  4EQO A;  4S3S A;  3I8Z A;  1HZ9 A;  4LAA A;  1H9R A;  3CF5 A;  4B3S Q;  2EVB A;  4IZ8 A;  4RHR A;  1N33 Q;  1VQF A;  5C4Z A;  1YEZ A;  1NR4 A;  1TWA H;  4K8I A;  2VQF L;  5I2X A;  2PW7 A;  2EYF A;  5IYC G;  2ZTE A;  4UAI A;  4XT1 B;  2HHH Q;  1LT3 D;  2CFM A;  3NEN A;  3K0Y A;  2CKZ B;  1EOV A;  1UE5 A;  1YHA A;  2HT1 A;  2PQA B;  4DUZ Q;  5ELF A;  3O13 A;  4JOI A;  4QMG A;  1SJH D;  2E2D C;  1NCV A;  1TWF H;  5HY6 A;  5FLX c;  1VQI A;  4A3L H;  1QNU A;  2IT1 A;  3M7G A;  4EGV A;  5M5W H;  4NP5 A;  2BOS A;  2WB1 B;  3NTH A;  3KF6 B;  1UWV A;  1YHB A;  4DR7 Q;  1SAP A;  1EL0 A;  1A63 A;  5COY A;  3DWP A;  4GN3 B;  4QJF A;  5M5X H;  1PYS B;  1X3P A;  4OL7 A;  5IGE A;  5EKL A;  2WB1 E;  3H09 A;  2SOB A;  4LF7 Q;  2Q2T A;  1TXY A;  3B6Y A;  4IJL A;  3OTO Q;  2UXB L;  4DFA A;  2PYK A;  2RDG A;  4Y52 H;  4JI4 L;  2B2T C;  4PMC A;  4DR5 Q;  5ELE A;  1L1O A;  1T5E A;  1KAW A;  1KLG D;  4X3T A;  3BDO A;  1SNQ A;  3TRE A;  2VS1 A;  5IWA Q;  1WTQ A;  3S15 H;  1EWC A;  4R8I A;  3S24 A;  3NEL A;  1I3Q H;  4HMI A;  1JJG A;  2E2I H;  1GOZ A;  2OEO A;  4DR3 Q;  4IOC A;  1EQT A;  3J7A 5;  5K36 G;  4RGN A;  5LMU Q;  1EYG A;  4HIO A;  3PSI A;  1PTO D;  1EEF D;  1Q8I A;  3NWS A;  2EYP A;  1N32 L;  1YJW A;  4UDU C;  1NR2 A;  3JAM E;  2CWP A;  3S2D B;  1K73 C;  5M3M G;  3HOX B;  1IBL L;  1AH9 A;  5EJW A;  1GM5 A;  4A3M B;  4X66 Q;  1N9W A;  1JOQ A;  3GTM B;  4POF A;  5IP7 H;  3W3A A;  1TT2 A;  1J5E L;  4H13 C;  4O0A A;  1KD1 C;  4P72 A;  3PO2 H;  3EFX D;  1A62 A;  1C0A A;  4DNI A;  1I3Q B;  2K52 A;  3AMU A;  3EQL C;  5JPN C;  1Q7Y C;  1XMQ Q;  2NTT A;  2XN9 C;  3RLN A;  4QGU A;  3OIP A;  4AYB G;  5M5Y H;  3K6O A;  5JVG 3;  4ABN A;  1EFI D;  1PA6 A;  2BE5 C;  3GTK H;  1STH A;  2P5Z X;  1TWH H;  4POG A;  1NSN S;  3KBG A;  2Q8R E;  2OF1 A;  4JI7 Q;  1MJC A;  1T5X D;  3FEW X;  5I4D A;  1GO3 E;  1AZQ A;  4BBS B;  3PMF A;  3A0J A;  4IFD J;  2JP1 A;  1CQV A;  4P2C B;  5E4W C;  3T1H Q;  3CCV A;  3EVQ A;  1X3F A;  2JEB I;  4DV5 Q;  2UUC Q;  1VQL A;  4IFD G;  2IX1 A;  3J81 c;  4DK1 A;  2IJ0 A;  1GVP A;  2K1B A;  3X3M A;  5M5Y B;  4DPG A;  1CA5 A;  3CKI B;  4I65 A;  3D4D A;  2KVM A;  2Q2I A;  1SE3 A;  1JE4 A;  1EY0 A;  5IYC H;  1F2Z A;  1XWE A;  4YWK A;  3GTK B;  4NXM L;  3D6W A;  1C48 A;  1VQA A;  1LTT D;  2ICI A;  1Z9F A;  1DON A;  1EZ6 A;  2R92 B;  1BCP F;  4DU9 A;  3J80 L;  4I7A A;  1BKB A;  3J7Z C;  5IYD G;  2ZJP A;  1K3B C;  4FDB A;  4IPC A;  1VCI A;  2ZJR A;  1XNR L;  4HR7 B;  1NBW A;  4KHV A;  3HOV G;  2F3I A;  4XQN A;  1W6K A;  3VR4 A;  3VR6 A;  4NXN L;  3DM1 A;  4ZAI A;  4UY8 C;  4BY1 B;  3Q0A A;  3BZK A;  2A1A A;  1YNN C;  4K5W A;  4P74 A;  2N49 A;  4KKT A;  3I70 A;  2RHQ B;  4PQX A;  4EQP A;  2Y0S B;  3AEV A;  3A7L A;  1N36 L;  4JI5 Q;  1H9S B;  2NVY B;  5CV5 A;  4HID A;  2Y0S E;  2DJF C;  4X62 Q;  2R93 B;  4GN4 B;  1SBB B;  4CGY B;  5DLQ E;  5ISR A;  1ASY A;  1MSH A;  1HUM A;  2R3Z A;  2D5D A;  3PUV A;  2PI2 A;  1EUJ A;  5K36 H;  4KN4 C;  4X3S A;  3S17 H;  4ODG A;  2AMC B;  2MO1 A;  5EKI A;  5FLX L;  1YI2 A;  3VYS A;  1KAB A;  3T53 B;  4A3J G;  3UDX A;  1STN A;  3GV3 A;  4DV7 Q;  4FP5 D;  3AB9 A;  5M3M H;  4DV2 Q;  2CWA A;  3CW2 C;  2CW0 C;  2B29 A;  4YWM A;  3ERQ A;  3QG1 A;  1I94 L;  1J8I A;  2K50 A;  4RKL A;  1WTV A;  2MGS A;  3U4Z A;  1UUP A;  5CV7 A;  4JI0 L;  2HIX A;  4ME3 A;  4KHP Q;  3HEJ A;  3K57 A;  2B2T A;  4DV1 Q;  2BA1 A;  3NEM A;  1TWG H;  4CDC C;  4AIM A;  3UDG A;  1LTG D;  2QW7 A;  2UUA L;  1E2W A;  4RCN A;  3BJU A;  3S17 B;  1F9R A;  4A3K G;  5EGT A;  1H9K A;  1X54 A;  3LWU A;  1BCP C;  3S14 B;  4X64 Q;  1NMG A;  4IUR A;  3KK7 A;  3QB3 A;  2JA5 G;  2B2W C;  3T56 B;  1PMR A;  3FPP A;  5C44 G;  2I5L X;  5DAU A;  1IBM L;  5IY0 A;  2EY6 A;  4PV1 C;  1SYG A;  2D9U A;  1CKN A;  1K0R A;  2ZXR A;  1FNV A;  2N55 A;  3D4W A;  3NTI A;  3OTO L;  1F2M A;  4X3U A;  4XIG S;  3HKZ G;  1XXG A;  1TWG B;  5C4J H;  5F2D A;  4B3M L;  4IFD H;  2RSN A;  2GVB A;  3QO2 A;  2QF7 A;  3F2D A;  1PH5 A;  4L8J A;  4A4I A;  2WIN B;  1I4R A;  3FKI G;  5CV4 A;  3PIO A;  1K9M C;  3P20 A;  3NXW A;  2PCF B;  1QVG A;  2QGQ A;  3DMU A;  4C3J B;  3SK4 A;  4GNX B;  3KOJ A;  4LFB Q;  3S1R H;  2J0T D;  1G8Z D;  1F77 A;  1KNE A;  2E5L L;  2YU9 H;  2F3W A;  3QOJ A;  4KY5 A;  3U58 A;  4R4Q A;  5IYD H;  1LYL A;  2H1E A;  4LF6 Q;  3KDF B;  1XNQ L;  2XVS A;  4C3I G;  5HGT A;  4J8Q A;  1LLR D;  1CSP A;  4Q0F A;  5C5L A;  3HOV H;  4DR1 L;  2V1C C;  3CRK C;  1DOM A;  2B8G A;  4G7O C;  1IXR A;  2AQ2 B;  2SNS A;  1CKO A;  3KFU A;  3WOE A;  4X65 L;  4QB4 A;  3CPF A;  4CHT B;  1PHJ A;  3RMH A;  1EY9 A;  1Y8P B;  1Q1B A;  5C3E G;  1CUK A;  1K28 A;  2VQF Q;  4C56 C;  1JE5 A;  3J81 L;  1FNU A;  3NUC A;  5J22 A;  4EX5 A;  2DY7 A;  3NTK A;  2E2J B;  2F0M A;  2X69 A;  3SHL A;  1VQG A;  3MAQ A;  3J81 j;  4LJZ C;  3MXN A;  3SGI A;  4ME5 A;  3T1Y L;  1CTM A;  2DY8 A;  3J7Y W;  5C6A A;  3G48 A;  3HOV B;  3L7Z C;  2A19 A;  3ND9 A;  4GLX A;  2JA8 B;  1RCV D;  1PVO A;  5IE8 A;  4QL5 A;  2LKV A;  2A6H D;  1SLJ A;  2JA7 G;  4KV6 A;  4C2M H;  4FNF A;  4A3J H;  1VF5 C;  2FFK B;  3SR1 A;  2M2L A;  1YBY A;  1SMY D;  4DUY L;  1HZA A;  1F9P A;  3IL8 A;  1MSG A;  2WAC A;  3TP6 A;  2JJQ A;  2A69 D;  2X6L A;  1Q90 A;  1A15 A;  2B2U C;  3M7N A;  2UXB Q;  1PRT B;  3AU7 A;  5A2Q L;  4JI4 Q;  1AFP A;  4L5T A;  1QUQ B;  2K04 A;  4E6I A;  5LMN L;  3H15 A;  1RDP D;  2VQE L;  1YNX A;  1K3R A;  1JIC A;  2EE1 A;  4O42 A;  4AQY L;  2L4N A;  2F0W A;  1JC7 A;  4L5S A;  5G3L F;  2Q2U A;  1KRS A;  1JWU D;  5M9O A;  2B3G A;  1A6X A;  2PI2 E;  4A3K H;  1VQE A;  1JCK B;  1VQO A;  3ZYY X;  1STY A;  2PQA A;  1K83 H;  2F0F A;  5IP9 G;  1WCM B;  3S16 H;  1N32 Q;  3G4S A;  1S5F D;  1JR0 D;  2JA5 H;  3NP8 A;  1IBL Q;  5C44 H;  1N34 L;  4F8M A;  2ZTD A;  4QY7 A;  3KF6 A;  3GV6 A;  3TP7 A;  3Q6S A;  2EIF A;  3IKJ A;  2VUM G;  1J5E Q;  2F0V A;  2E75 C;  4MTN A;  3CCJ A;  1STB A;  1SN8 A;  4HSV A;  4XTC S;  3H91 A;  3BDC A;  2MJ8 A;  1GXD C;  3NBH B;  1DYQ A;  3PO3 B;  3M4O B;  4A3E B;  2E2H H;  1BBU A;  3S1N H;  1TY2 A;  3K7A B;  4K8J A;  4B9X A;  3FKI H;  1SE4 A;  3A54 A;  1NNX A;  4RHS A;  2WFW A;  1XJV A;  3MEF A;  2A8V A;  3F2C A;  1OXX K;  3E3X A;  5GRO A;  1VQC A;  2LMC B;  2PZW A;  2Z4H A;  1NE3 A;  2JA5 B;  2WII B;  3PUX A;  4J6H A;  1BVS A;  1P16 A;  3VYU A;  2F4I A;  2JK8 A;  3QOL A;  4YCU A;  4XYQ A;  2B2W A;  4C3I H;  1CA6 A;  2GA4 B;  4BY7 B;  1C9O A;  3TS2 A;  4JK1 C;  2WAQ B;  4JBK A;  2EDG A;  4F7X A;  3HKZ B;  3LGJ A;  3TEH B;  4R4O A;  1Y8O B;  2E2H B;  3BYT B;  2WAQ E;  3HGB A;  2R7F A;  1LT6 D;  3G7L A;  5C3E H;  1X6O A;  1UE1 A;  4DAM A;  1S5D D;  4H44 C;  4KKS A;  4DV3 L;  1F9Q A;  1AP0 A;  2A73 B;  2NVT B;  2NZ1 D;  4UP9 A;  4C3I B;  1XNR Q;  3HOW B;  1D5M C;  1SYB A;  2RCN A;  1AN8 A;  2LSS A;  3N52 A;  1HZC A;  4IN3 A;  2JA7 H;  4GLV B;  4NXN Q;  3X3N A;  4NDX A;  1G51 A;  5JPM C;  1HA6 A;  4LF5 L;  4A3D G;  1U0L A;  1A2T A;  5D65 A;  2NVX H;  4BBR G;  5C3E B;  4A3G G;  3G71 A;  1ONL A;  4OIK A;  3GTO H;  3R8B A;  1QVC A;  4EVO A;  1N36 Q;  1BNZ A;  2OQ0 A;  5GAE C;  2M00 A;  4LF9 L;  1S72 A;  5C5M A;  2F0I A;  3PQI A;  5L37 A;  2XWJ B;  1PV4 A;  4FF3 A;  3ZJY C;  3DWQ A;  2K5Q A;  3A5Z B;  2MHV A;  3I4O A;  4DAY A;  2RA4 A;  3I4N G;  3UDI A;  1RF2 D;  2FHT A;  4DXG A;  1AW7 A;  2EY5 A;  3EIV A;  1VQJ A;  1Q86 C;  4R4T A;  5I9P A;  2B8F A;  1PH2 A;  3BYY B;  3UE1 A;  2QA4 A;  2WV6 D;  2JA6 G;  1F9S A;  1Q1E A;  1I94 Q;  2KHJ A;  1L2F A;  2B2U A;  4JI0 Q;  1PYW D;  3WOF A;  1IBK L;  1I6H H;  5IGF A;  2VUM H;  2A6E D;  4XDX A;  2B63 G;  2QDB A;  4NB3 A;  1RJT A;  2JEA I;  1ZXT A;  2K14 A;  1LTA D;  4LUO A;  1KTK A;  1PRT C; 
#chains in the Genus database with same CATH homology
 5JOB A;  3R2I A;  4U67 3;  4KHZ A;  1BF4 A;  1H9S A;  2WP8 J;  1E2V A;  2OXP A;  2FJ2 A;  1EY7 A;  3UI2 A;  1AZP A;  5T1G A;  1IL8 A;  2J7Z A;  1W6J A;  1DXM A;  4QUF A;  2F3V A;  3I72 A;  3NQT A;  5CV6 A;  2F03 A;  2EYH A;  2IPK D;  1RTO A;  1BQQ T;  4C3H G;  5TSS A;  2F0Q A;  1TWA B;  1K8O A;  1DM0 B;  4NKL A;  1SSO A;  1DD2 A;  1C4Q A;  4OHJ A;  2XNA C;  1DCZ A;  1DOK A;  2EJM A;  3D6C A;  3SK6 A;  2A68 D;  1BCP B;  1TWF B;  2L9H A;  1B44 D;  5M5W B;  1ZEQ X;  2Q8T A;  5M5X B;  4G57 A;  4KK7 A;  3DEP A;  3OMC A;  1I4H A;  1FNW A;  1IYV A;  1TWC B;  4RFB A;  1S5B D;  5EKK A;  3RD4 A;  3DEO A;  4KD4 A;  3KLS X;  3S15 B;  4BS9 A;  2RDF A;  2CVR A;  1EOT A;  2F0N A;  5FO8 B;  1BR9 A;  2E2I B;  4M1U B;  4LMQ D;  4FF1 A;  1EWH A;  1R9T B;  2C5C A;  1BUV T;  1IHZ A;  1QWY A;  2F0T A;  4PMB A;  5AFW A;  1TQO A;  4O1N A;  2EZV A;  4IFD I;  4CKE A;  3MTS A;  4C1N K;  4K5X A;  4HAE A;  2EJF C;  1IW7 C;  1PFB A;  3EA6 A;  1V1P B;  4ZQ3 A;  1SYD A;  1PXU A;  4DAP A;  4BBR B;  3PO2 B;  4IUV A;  1II3 A;  4KY7 A;  2Z8L A;  3FVQ A;  4KMU C;  2PW5 A;  3I73 A;  1SNO A;  3MC0 B;  4XXE A;  5JJZ A;  2XWB B;  1EY8 A;  1TR5 A;  5LL6 X;  1U4L A;  3P1H A;  1KDB A;  1TWH B;  4IUQ A;  2JYO A;  1D2B A;  3TZU A;  1ZYR C;  1HRJ A;  3TP5 A;  3I4N B;  1HUN A;  2IW3 A;  3HG9 A;  2L55 A;  3L3O C;  3URY A;  1DZ1 A;  3NHH A;  4K6D A;  1IKM A;  2CHB D;  2KEE A;  2BE5 D;  1D5X C;  4HCS A;  4FXD A;  3T4A C;  5K5P A;  1A2U A;  1JWM D;  5ELC A;  4QF4 A;  2RDH A;  5DNF A;  5EBC A;  4RGM A;  3G6J B;  4HTH A;  1VF7 A;  2JE6 I;  2NN6 I;  1KDC A;  3RZD B;  1RKN A;  5KNB A;  1QNK A;  4FF2 A;  2EY1 A;  4DA2 A;  3VYR A;  2KJX A;  1I4G A;  2VNU D;  1OXS C;  1O7Z A;  3GO5 A;  3K5O A;  1PFN A;  4K5V A;  4C1N I;  1PDQ A;  2QEJ C;  2NN6 G;  4V0B A;  2EXZ A;  3E6Z X;  2F0O A;  1SXT A;  1EZ8 A;  1S4Z A;  5DEH A;  1OXT A;  2FMC A;  2EY2 A;  3T51 B;  5IT9 E;  3M3Y B;  3I91 A;  3NBH A;  1EIG A;  2K5W A;  2LY7 A;  1YNN D;  1ESR A;  1FGB D;  5M3M B;  3JAM L;  2IX3 A;  2AQ1 B;  1WD0 A;  3FRP B;  1HTP A;  1D6E C;  1CM9 A;  1HFG A;  1ML0 D;  2R61 A;  1CQF A;  5C3W A;  4IQZ A;  2SEB D;  2PQE A;  1STE A;  2WKD A;  5LL6 S;  3T16 A;  2QCP X;  1I6V C;  2O5I C;  1SNC A;  3OIQ A;  1JB3 A;  4EQN A;  5IIF A;  3TZD A;  4AYB B;  1M8A A;  2TSS A;  4CJ2 C;  2KCC A;  4K2L A;  4PMW A;  2CW0 D;  1BO0 A;  3OOC A;  2A6H C;  5KNC A;  3HS0 C;  3NK9 A;  4GZY C;  3NSW A;  4K6L A;  1VMC A;  3J7A F;  5EPJ A;  4WOR A;  1B4O A;  4U68 A;  2A69 C;  4G7H C;  3V96 A;  1G91 A;  3PIO 3;  1MD2 D;  1F2L A;  4QIW B;  5C4J B;  1EYC A;  3I3C A;  1PZJ D;  5EQ0 A;  4XQQ A;  5FO9 B;  1D1K A;  2D62 A;  2K03 A;  5BN4 A;  3S1R B;  1EEI D;  2F0G A;  2K6A A;  2YU9 B;  3K59 A;  2BDN A;  3GP7 A;  1PTO H;  1VDZ A;  1SJE D;  3V2T A;  3D31 A;  4BA1 I;  5HUR A;  4DK0 A;  1S5C D;  2RBM A;  4DF7 A;  1U9R A;  2AQ3 B;  2DNC A;  4ZK9 B;  5E3F A;  2ICE C;  3RUZ A;  2NWG A;  2KEC A;  3DUZ A;  3A8K E;  2NN6 H;  3LWE A;  3NBI A;  1R4P B;  4YIJ A;  2J4X A;  1HCZ A;  3K5M A;  3PUW A;  4MIU A;  5D3I B;  1PTO B;  4DN4 M;  3A8J E;  3NWT A;  3BS1 A;  5IGB A;  1A3T A;  4HSP A;  4IAL A;  4C2M B;  4A3J B;  4KTA A;  4L6T B;  3I90 A;  1O78 A;  4RKB A;  2L11 A;  1F2Y A;  3GD7 A;  3PV0 A;  4B9W A;  4DAV A;  2B2V C;  2RSO A;  1LTS D;  1ILP A;  5COR A;  3ERO A;  2Q8I B;  5FK9 C;  1CZW A;  2O5J C;  1JOK A;  1GUO A;  4A3K B;  1ENC A;  3Q24 A;  4OIJ A;  4CBV A;  2BCO A;  3S16 B;  1K83 B;  3KF8 A;  4HMJ A;  5ELD A;  1TS4 A;  5IOD A;  1V1O A;  3MXG A;  1V43 A;  5C44 B;  2JSO A;  1DJR D;  2XSC A;  4ZYS A;  2IL8 A;  2KED A;  1GUS A;  3OSO A;  4HN7 A;  3MHB A;  1ET9 A;  4RWS C;  3E5S A;  4CJ0 B;  3VR5 A;  3MFG A;  2SDF A;  3MA2 B;  2VB2 X;  1MGS A;  4ZUJ A;  4XT3 B;  4RGT A;  1JOR A;  1OO9 B;  3S1N B;  2PZT A;  3FKI B;  2BA0 A;  1D5Z C;  3SK8 A;  2TMP A;  4BWG B;  1M4V A;  3OPO A;  4RCO A;  2QKI C;  3R93 A;  1PTO F;  4RAU C;  4IUU A;  2B2Y C;  1ENF A;  1QG7 A;  3FPU B;  1CFM A;  1STA A;  4TKO B;  2K01 A;  3BDL A;  1QB5 D;  3SDZ A;  5CMD A;  2L12 A;  3RZO B;  5T1I A;  2LS0 1;  4N9P A;  3D3R A;  1H9J A;  1UNS A;  3H0G B;  3KBX A;  1FD7 D;  1MBY A;  4ZLT F;  1TII D;  1V1P A;  1LT4 D;  2YYZ A;  4OGQ C;  4FVM A;  5BN5 A;  3C1F A;  1L0Y B;  1YNJ D;  2B39 A;  3U9O A;  1NAP A;  4KI0 A;  1I50 B;  3KLS A;  1Y69 U;  2FMM A;  3EJI A;  2F0H A;  3MXP A;  2MUY A;  4K2K A;  5EPL A;  3Q23 A;  3BVZ A;  2JA7 B;  3CRL C;  1O7L A;  1BXT A;  1Y8N B;  5IGC A;  1CI3 M;  3HP3 A;  1BOS A;  3HZX A;  2NVX B;  5J1Z A;  1S5E D;  3GTO B;  4HED A;  3K5L A;  1Z6H A;  5ELB A;  3J80 E;  1SEB D;  2V4D A;  5G3L D;  3VR3 A;  3P75 A;  5CV9 A;  2EJG C;  3WDN A;  4Q5V A;  2F0S A;  4OO1 G;  1CZG A;  4ULL A;  2F0P A;  5C0X J;  4IUP A;  2A5H A;  1LAC A;  2EYJ A;  1GHK A;  4ID6 A;  2ZXO A;  4DGZ A;  5C0X G;  1BDO A;  1PTO C;  1Q3L A;  3U9S A;  1B50 A;  1Q12 A;  5DM7 3;  1Y1V B;  1B2T A;  5EBD A;  2A74 C;  2QIL A;  5I6Y A;  4NMZ A;  3TP8 A;  1ROD A;  1C8C A;  1I6H B;  3CHB D;  2VUM B;  2B2V A;  3TN2 A;  2L0C A;  2AWO A;  3M4Y A;  5FLX E;  1U4R A;  3FMC A;  1G6Z A;  3D8G A;  2F0J A;  2EYL A;  4B08 A;  5I2Y A;  2AWN A;  2PO4 A;  2RKS A;  2XRS D;  1TKW B;  5CGK A;  4KD3 A;  1LV9 A;  2L1B A;  1HQR D;  2F0D A;  3S1Q B;  4ZUI A;  3NQI A;  4CKB A;  3TDQ A;  3IFT A;  1PRT D;  1MI2 A;  2PNR C;  2OT2 A;  1B9M A;  2EYM A;  4A3B B;  4R8N A;  1XTC D;  1ZKO A;  3IFD A;  3P7J A;  1LTI D;  3S1M B;  3E0J A;  1HXY D;  2KCN A;  1R4Q B;  3GQB A;  4R9W A;  5KND A;  3C2P A;  4ILW A;  3SE0 A;  3SVM A;  3ND8 A;  3BZD B;  1KAA A;  1UEA B;  2B2Y A;  3LNN A;  3Q22 A;  2I46 A;  2K28 A;  3MVV A;  2WKC A;  2ENB A;  2XRQ D;  4A3D B;  2NVQ B;  5IOC A;  4MHE A;  2K32 A;  2XIW A;  4I7Z C;  3MEH A;  1O7Y A;  4A3G B;  4C3J G;  2BDO A;  1EQV A;  1Z7T A;  5C3X A;  1L0X B;  3F2U A;  4BA2 I;  1TY0 A;  3A56 A;  2NYZ D;  4N9T A;  1SNM A;  1CK1 A;  1ET6 A;  2CQA A;  3PUY A;  4OO1 H;  2F0E A;  1B53 A;  1LTR D;  5EPK A;  1KNA A;  5CBA E;  5C0X H;  1RTN A;  3I4L A;  3TME A;  4QUC A;  1CT1 D;  3J81 E;  3GTQ B;  3V05 A;  1E0B A;  1EIH A;  3SEB A;  2VXW A;  2JA6 B;  2RQX A;  2ID0 A;  2NUC A;  2FIN B;  1DOL A;  1SNP A;  3K58 A;  5FOB B;  2B63 B;  3A8I E;  4DNR B;  2KOL A;  3R2T A;  1OXV A;  3VR2 A;  1EU4 A;  3BG3 A;  4M8A A;  2Z4I A;  4KY6 A;  2E74 C;  1SND A;  1G2T A;  4L63 B;  1IW7 D;  2NTS A;  4RGO S;  4KN7 C;  1FR3 A;  3D4R A;  3OMG A;  4DNT B;  1GUN A;  5FO7 B;  1QIL A;  5JVH 3;  3VYT A;  1GJX A;  5KGU A;  3HOZ B;  1A3V A;  1U4M A;  4CJ1 B;  2DN8 A;  5A2Q E;  1SDF A;  3I4M B;  4G7Z C;  5C4X B;  4C3H B;  1QCB D;  3PUZ A;  2EYO A;  2PZU A;  1ESF A;  1ZYR D;  3C1E A;  1TS5 A;  5BN3 A;  1G2S A;  2HUG A;  1AEX A;  5E1F A;  4ZKB B;  2L5T A;  2R6G A;  5CBE E;  1I4X A;  4TSS A;  2F1M A;  3MFY A;  3IAY A;  4NW2 A;  1X32 A;  5FKA C;  3BVG A;  1PFM A;  4TRD A;  1ICW A;  3PIP 3;  2AUK A;  4RA8 A;  4F88 A;  1IKL A;  1LAB A;  3ITP A;  1LTB D;  1CHQ D;  1SYC A;  3QJY A;  2NB0 A;  3RLF A;  4FF4 A;  5I6W A;  2AUJ D;  4LK1 C;  2KQ3 A;  3SK5 A;  1Y1W B;  3FDT A;  1BBX C;  3OWE B;  3VA7 A;  3S2H B;  2N88 A;  2HQE A;  3MWY W;  3J7A V;  3QIA A;  1J9O A;  1B9N A;  1UAP A;  1HHV A;  2H4O A;  1RHP A;  3A7A B;  4A3F B;  3A55 A;  1E2Z A;  2DNE A;  1IYU A;  2M9V A;  5A35 A;  1SMY C;  2SNM A;  4FXG C;  4PNY A;  2K33 A;  3C46 A;  1RD9 D;  2VB3 X;  2O4X A;  4IUT A;  3DXJ C;  3OWF A;  1HQM C;  1BCP D;  1K8M A;  2IWH A;  1CHP D;  4MN3 A;  1KLU D;  4V19 0;  4G4K A;  4HCE A;  1GUT A;  2I07 B;  3T13 A;  4FXK C;  3NE5 B;  4A3I B;  3C3L A;  3HOU B;  1D1I A;  3MZ5 A;  5KYL A;  1WTW A;  4JBW A;  2K7V A;  1PZI D;  4Y7N B;  1TU2 B;  1GUW A;  3LX0 A;  1SE2 A;  3DWA A;  1HTL D;  2X6G A;  5C4H A;  1JQY D;  3W2D A;  2K05 A;  3GTJ B;  1WTO A;  3GTL B;  3TSS A;  2MP1 A;  3N6R A;  2IX0 A;  1HFN A;  1QOH A;  2G9D A;  5D14 A;  5I9O A;  5KIX A;  2HDM A;  2ZT9 C;  1U4P A;  2JXM B;  4RH6 A;  2G9H D;  5IGG A;  3GTG B;  2HDL A;  1WD1 A;  2NBF A;  1V8Q A;  5JEA J;  2LFN A;  1EYA A;  1Z47 A;  4CKC A;  1I4P A;  2F0U A;  4WRD A;  1WTP A;  5JEA G;  4FYD A;  4J1M A;  2EPB A;  1OXU A;  3NPP A;  1HPC A;  5CV8 A;  5M3F B;  1SFO B;  1XYI A;  1WTR A;  1XX8 A;  1G29 1;  4KJN A;  1VMP A;  5CR3 A;  4IUN A;  1JWS D;  1I4Q A;  2K5D A;  4KJO A;  1WTX A;  1B1Z A;  5JAV A;  1QJO A;  5KRU A;  1PLF A;  3H3V C;  3L9A X;  5IT9 L;  1TS3 A;  2PMZ B;  1ENA A;  1JOO A;  4ZRZ A;  1EY6 A;  3VA5 A;  5IGD A;  1LT5 D;  1GHJ A;  4DXF A;  2HCI A;  2KA7 A;  3OW7 A;  3HOY B;  2HCC A;  2EOT A;  1QE6 A;  3H94 A;  1EU3 A;  3KLR A;  1YNJ C;  3GTP B;  2F0K A;  5KYI A;  5DM6 3;  4WJW A;  4K14 A;  5LHY 1;  1SYF A;  4FO2 A;  2F0L A;  3DHQ A;  3MXU A;  3TBI B;  2O2L D;  1PZK D;  4F87 A;  1PRT F;  1A3U A;  1HA5 A;  2MPM A;  3CU7 A;  3S9W A;  2ZXP A;  4H0L C;  4X3K A;  3CQZ B;  5KEE A;  5NUC A;  1EYD A;  5E4X A;  3QWN A;  1SYE A;  3K5N A;  3KUP A;  3SXH A;  2A6E C;  2C9O A;  1X3Q A;  3OHX C;  4Z9C B;  4WFN 3;  1B3A A;  5J39 A;  1STG A;  1ILQ A;  4XYO A;  2E76 C;  3BVM A;  1LO5 D;  1NUC A;  3H6M A;  4KKU A;  1GUG A;  4A93 B;  2RVL A;  2PPB C;  1TS2 A;  4OO1 I;  1TVX A;  2R7Z B;  3M85 A;  4TQU S;  5JEA H;  1WVL A;  4XQJ A;  5C0X I;  4ZKC B;  1O80 A;  4QCL A;  3ONA B;  1EY5 A;  3R3O A;  1FYC A;  2KHS A;  3HRZ C;  5CC4 A;  1EY4 A;  2KUM A;  5D3D A;  2A68 C;  2Z1C A;  1H9M A;  2D2C C;  1KDA A;  4H7B A;  5CYU A;  4EQO A;  4S3S A;  3I8Z A;  4LAA A;  1H9R A;  2EVB A;  4IZ8 A;  4RHR A;  5C4Z A;  1NR4 A;  4K8I A;  5I2X A;  2PW7 A;  2EYF A;  4UAI A;  4XT1 B;  1LT3 D;  3K0Y A;  5ELF A;  3O13 A;  4QMG A;  1SJH D;  2E2D C;  1NCV A;  1QNU A;  2IT1 A;  3M7G A;  4EGV A;  4NP5 A;  2BOS A;  2WB1 B;  3NTH A;  1SAP A;  1EL0 A;  5COY A;  3DWP A;  1X3P A;  4OL7 A;  5IGE A;  5EKL A;  3H09 A;  2SOB A;  4DFA A;  2PYK A;  2RDG A;  2B2T C;  4PMC A;  5ELE A;  1T5E A;  1KLG D;  4X3T A;  3BDO A;  1SNQ A;  1WTQ A;  1EWC A;  4R8I A;  4HMI A;  1GOZ A;  2OEO A;  1EQT A;  5K36 G;  4RGN A;  1PTO D;  1EEF D;  1Q8I A;  3NWS A;  2EYP A;  4UDU C;  1NR2 A;  3JAM E;  3S2D B;  3HOX B;  5EJW A;  4A3M B;  1JOQ A;  3GTM B;  3W3A A;  1TT2 A;  4H13 C;  3EFX D;  1I3Q B;  3AMU A;  3EQL C;  5JPN C;  2NTT A;  2XN9 C;  3OIP A;  3K6O A;  5JVG 3;  4ABN A;  1EFI D;  2BE5 C;  1STH A;  1NSN S;  3KBG A;  2Q8R E;  2OF1 A;  1T5X D;  3FEW X;  5I4D A;  1AZQ A;  4BBS B;  3PMF A;  4IFD J;  2JP1 A;  1CQV A;  4P2C B;  5E4W C;  3EVQ A;  2JEB I;  4IFD G;  2IX1 A;  4DK1 A;  2IJ0 A;  2K1B A;  3X3M A;  5M5Y B;  1CA5 A;  3CKI B;  4I65 A;  3D4D A;  2KVM A;  1SE3 A;  1JE4 A;  1EY0 A;  1F2Z A;  1XWE A;  3GTK B;  3D6W A;  1C48 A;  1LTT D;  2ICI A;  1DON A;  1EZ6 A;  2R92 B;  1BCP F;  4DU9 A;  3J80 L;  1VCI A;  4HR7 B;  4KHV A;  4XQN A;  1W6K A;  3VR4 A;  3VR6 A;  3DM1 A;  4ZAI A;  4BY1 B;  3Q0A A;  1YNN C;  4K5W A;  4KKT A;  3I70 A;  4PQX A;  4EQP A;  2Y0S B;  3A7L A;  1H9S B;  2NVY B;  5CV5 A;  2R93 B;  1SBB B;  4CGY B;  5ISR A;  1MSH A;  1HUM A;  2R3Z A;  2D5D A;  3PUV A;  5K36 H;  4KN4 C;  4X3S A;  4ODG A;  5FLX L;  5EKI A;  3VYS A;  1KAB A;  3T53 B;  1STN A;  3GV3 A;  4FP5 D;  3AB9 A;  2CW0 C;  3ERQ A;  3QG1 A;  1J8I A;  4RKL A;  1WTV A;  2MGS A;  1UUP A;  5CV7 A;  3HEJ A;  3K57 A;  2B2T A;  2BA1 A;  1LTG D;  1E2W A;  4RCN A;  3S17 B;  1F9R A;  5EGT A;  1H9K A;  3LWU A;  1BCP C;  3S14 B;  4IUR A;  3KK7 A;  3QB3 A;  2B2W C;  3T56 B;  1PMR A;  3FPP A;  5DAU A;  2EY6 A;  4PV1 C;  1SYG A;  2D9U A;  2ZXR A;  1FNV A;  2N55 A;  3D4W A;  3NTI A;  1F2M A;  4X3U A;  4XIG S;  1XXG A;  1TWG B;  5F2D A;  4IFD H;  2RSN A;  3QO2 A;  2QF7 A;  4L8J A;  2WIN B;  1I4R A;  5CV4 A;  3P20 A;  3NXW A;  2PCF B;  3DMU A;  4C3J B;  3SK4 A;  2J0T D;  1G8Z D;  1F77 A;  1KNE A;  2F3W A;  3QOJ A;  4KY5 A;  2H1E A;  2XVS A;  4C3I G;  5HGT A;  4J8Q A;  1LLR D;  4Q0F A;  5C5L A;  3CRK C;  1DOM A;  2B8G A;  4G7O C;  2AQ2 B;  2SNS A;  3WOE A;  4QB4 A;  4CHT B;  3RMH A;  1EY9 A;  1Y8P B;  1Q1B A;  4C56 C;  3J81 L;  1FNU A;  3NUC A;  5J22 A;  2DY7 A;  3NTK A;  2E2J B;  2F0M A;  2X69 A;  3SHL A;  3MAQ A;  4LJZ C;  3MXN A;  4ME5 A;  1CTM A;  2DY8 A;  3J7Y W;  5C6A A;  3HOV B;  3L7Z C;  3ND9 A;  2JA8 B;  1RCV D;  2LKV A;  2A6H D;  4KV6 A;  4FNF A;  1VF5 C;  2FFK B;  3SR1 A;  2M2L A;  1SMY D;  1F9P A;  3IL8 A;  1MSG A;  2WAC A;  3TP6 A;  2A69 D;  2X6L A;  1Q90 A;  1A15 A;  2B2U C;  3M7N A;  1PRT B;  3AU7 A;  5A2Q L;  1AFP A;  2K04 A;  4E6I A;  1RDP D;  2EE1 A;  4O42 A;  1JIC A;  2L4N A;  2F0W A;  1JC7 A;  5G3L F;  1JWU D;  5M9O A;  1A6X A;  1JCK B;  3ZYY X;  1STY A;  2F0F A;  1WCM B;  1S5F D;  1JR0 D;  3NP8 A;  4F8M A;  3GV6 A;  3TP7 A;  3Q6S A;  3IKJ A;  2F0V A;  2E75 C;  1STB A;  4HSV A;  4XTC S;  3H91 A;  3BDC A;  2MJ8 A;  1GXD C;  1DYQ A;  3PO3 B;  3M4O B;  4A3E B;  1TY2 A;  3K7A B;  4K8J A;  4B9X A;  1SE4 A;  3A54 A;  4RHS A;  1OXX K;  2LMC B;  2PZW A;  2Z4H A;  2JA5 B;  2WII B;  3PUX A;  4J6H A;  3VYU A;  2F4I A;  3QOL A;  4XYQ A;  2B2W A;  1CA6 A;  2GA4 B;  4BY7 B;  4JK1 C;  2WAQ B;  2EDG A;  4F7X A;  3HKZ B;  1Y8O B;  2E2H B;  3BYT B;  3HGB A;  1LT6 D;  3G7L A;  1S5D D;  4H44 C;  4KKS A;  1F9Q A;  1AP0 A;  2A73 B;  2NVT B;  2NZ1 D;  4C3I B;  3HOW B;  1D5M C;  1SYB A;  1AN8 A;  3N52 A;  4IN3 A;  3X3N A;  4NDX A;  5JPM C;  1HA6 A;  1A2T A;  5D65 A;  5C3E B;  1ONL A;  4OIK A;  3R8B A;  4EVO A;  1BNZ A;  2M00 A;  5C5M A;  2F0I A;  2XWJ B;  4FF3 A;  3DWQ A;  2K5Q A;  2MHV A;  4DAY A;  2RA4 A;  1RF2 D;  2FHT A;  4DXG A;  1AW7 A;  2EY5 A;  5I9P A;  2B8F A;  3BYY B;  2WV6 D;  1F9S A;  1Q1E A;  2B2U A;  1PYW D;  3WOF A;  5IGF A;  2A6E D;  4XDX A;  2QDB A;  1RJT A;  2JEA I;  1ZXT A;  1LTA D;  1KTK A;  1PRT C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...