2EYFA

Crystal structure of staphylococcal nuclease mutant t44v
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEVKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2eyfA00
4K5WA 1KDBA 4RKBA 2SNSA 5EKLA 3SK4A 3T13A 4B9WA 4KV6A 4B9XA 3NUCA 5F2DA 4ME5A 3E5SA 4G57A 4EQOA 5J39A 1A3UA 4I65A 2RKSA 2F0EA 4KTAA 4PNYA 4F7XA 4ZUIA 4WORA 5C4HA 5C4ZA 1SYBA 5CV6A 1EY4A 1TR5A 5CGKA 1JORA 5CV7A 5HGTA 5ISRA 2O4XA 4EQNA 1KAAA 4K5XA 1SNPA 5KEEA 5IIFA 1EZ8A 1SNMA 1STAA 4YIJA 2SOBA 1SYFA 4K8JA 5KYIA 3OSOA 4PMCA 4EQPA 1KDAA 4S3SA 1JOKA 1SYCA 1F2ZA 2F0SA 4DF7A 1STGA 3SXHA 4KY6A 5K5PA 2RDFA 1STNA 1KDCA 1EYCA 2EYOA 4DU9A 1STBA 2F0OA 3MZ5A 2QDBA 5IGCA 5C6AA 3PMFA 1JOOA 1EYAA 2RBMA 3C1FA 1II3A 3HEJA 2EYPA 4NMZA 1F2YA 2KQ3A 2F0IA 1NSNS 3D8GA 4TRDA 2F0DA 3D4DA 5KGUA 3TP7A 1SNCA 4K14A 2SNMA 5IGBA 1AEXA 5J22A 1ENAA 4QF4A 5CV4A 3C1EA 5DEHA 4DGZA 4E6IA 1EY0A 1KABA 3LX0A 2OXPA 5C5LA 4IUNA 2F0KA 1EQVA 2EYHA 1SYGA 2M00A 3NQTA 4NKLA 5CV8A 1EY8A 5EGTA 2PZUA 4QB4A 5IOCA 2EY5A 2EYFA 2F3WA 2F0GA 4K6DA 4RKLA 1SYDA 3QOJA 1EZ6A 4ZQ3A 5I6YA 3V2TA 4KHVA 4EVOA 4IALA 4ZUJA 2F0WA 1NUCA 3SR1A 5C3WA 4ODGA 3MXPA 2F0FA 3EJIA 4HTHA 1EY5A 2PW7A 3U9OA 1ENCA 3OMCA 1A2TA 2F0MA 3DHQA 3EROA 3TP6A 3ERQA 3MVVA 2EY2A 4OL7A 2ENBA 3TMEA 4PMBA 4HMIA 5CR3A 5DAUA 3HZXA 4IZ8A 2EY1A 5I9PA 2EXZA 3H6MA 4NP5A 1EY9A 2F0VA 3D4WA 3MEHA 1JOQA 3SK5A 5EKKA 4DFAA 5I9OA 5KIXA 1IHZA 3SK6A 1EYDA 5I6WA 5CV9A 4K5VA 2PYKA 2PZWA 5CV5A 5NUCA 1TT2A 4KD4A 3P75A 3R3OA 3OMGA 2F0PA 1SNDA 3ITPA 5KYLA 1U9RA 3EVQA 5IODA 3P1HA 3NP8A 2PQEA 3BDCA 5C5MA 2EY6A 4F8MA 1A2UA 5JAVA 2PZTA 5JOBA 3MHBA 1STHA 2F0JA 2EYLA 2NUCA 4J1MA 3D6CA 4WRDA 4KJNA 5C3XA 1EY6A 1A3VA 2F0LA 4KJOA 3S9WA 5E3FA 5HURA 3QOLA 5IGFA 5M9OA 2F0QA 3NXWA 2F0HA 2F3VA 3T16A 3QB3A 5E1FA 3DMUA 1SNQA 4K2KA 2KHSA 2OF1A 4NDXA 2F0UA 1STYA 4KY7A 1SYEA 2F0TA 4R8NA 5IGGA 2HQEA 5KRUA 3SK8A 2EYJA 4HMJA 3TP5A 5IGEA 4J6HA 4LAAA 2LKVA 2PW5A 3RUZA 2OEOA 3BDLA 4K2LA 3OWFA 4MIUA 4N9TA 2EYMA 4N9PA 1RKNA 1SNOA 2F0NA 1EY7A 5CC4A 3NK9A 1A3TA 2WACA 3SHLA 4KY5A 4KD3A 5IGDA 4QMGA 3TP8A 4H7BA 4K8IA 1F2MA 4ID6A 3VA5A 1TQOA 5J1ZA 3NHHA
chains in the Genus database with same CATH superfamily
1TS4A 3J81i 2JA5H 3BZDB 3CXCA 4FDBA 4DV7L 1CA5A 5BN5A 3PF5A 3NTKA 3LGJA 4KTAA 1KXLA 3K80C 4L5QA 3CD6A 3CMEA 4EQNA 5CYUA 4DUZL 2UUBL 3CRKC 3G7LA 5EPKA 4DNRB 3HGBA 4DUYQ 4B3TL 4XYQA 3NELA 3HOUB 3PO2B 2B2UA 2J4XA 4KY6A 4GOPA 4GNXA 2H1EA 5IYCH 1OXXK 3GTLB 2EVBA 2IT1A 1YZ6A 2HIXA 2Z1CA 3TP7A 2DGYA 1A6XA 3M4QA 5EAYA 2ZJQA 5BR8Q 3VR6A 3AFPA 3HOVB 1EU4A 2KJXA 2F0KA 5IYBH 3NQTA 1TWFB 2QKIC 3CCVA 1HTLD 2K5WA 1GUWA 4HEDA 1BR9A 1Y1VB 4H02A 2PW7A 1G51A 3STBD 1HNXQ 4YWKA 1PTOH 1A2TA 3TP6A 1K8MA 3I4NB 1SE4A 2RSOA 3PUZA 2F0VA 1CSQA 2ID0A 2PI2E 3J80c 4Z9CB 5I6WA 1HCZA 3EN2A 2RQXA 4ZCKA 1UE5A 5JEAG 2GVBA 4DV5Q 2ZXOA 1K73C 1BCPD 4A3EH 5JAVA 4LF8L 1PH2A 1KC8C 2NTTA 2BE5D 3M7GA 2D62A 1PTOD 2WB1G 4YY3L 2GA4B 4I7AA 5A2QL 3HOWG 1CUKA 4J6HA 4YCUA 1RL2A 2QGQA 1HXYD 4NXNL 4N9PA 2E2IB 3JAML 3BDOA 3AYHB 2IX0A 4BA1I 4PQXA 2R61A 1E0BA 3RLOA 4KN4C 4RKBA 1KDBA 4A3EG 2L1BA 1SBBB 1OXVA 5J39A 5C4ZA 2F0EA 3GTJH 4Q5VA 2MP1A 3X3MA 3RZDH 1J8IA 2EIFA 1JCKB 3AB9A 2B63H 3Q0AA 1EZ8A 3OSOA 4PMCA 2WFWA 4EGVA 4EQPA 1KDAA 2JK8A 1ICFB 4ZK9B 4FXGC 3NE5B 2ICEC 2K32A 1WTVA 5IGCA 1JT8A 4DR4Q 2PNRC 2F0IA 1NSNS 1D2BA 3KK7A 4B08A 1PH6A 1E24A 2A1AA 3VYSA 3A0JA 3ZJYC 1PRTF 2R7DA 1MSHA 2R93B 3F2BA 4PZ6A 2YTXA 5C5LA 2B63G 1V8QA 4NKLA 2UXCQ 5EGTA 1WTRA 5LMUL 4F87A 3GTKH 1U0LA 1CKNB 5KNCA 2KECA 4CKEA 2F0FA 1VQ8A 3S1NB 3VYTA 1GD7A 1KRTA 3BVGA 3M4OH 1GOZA 1AP0A 4DUYL 1N32Q 4BY7B 4ALPA 5IYDG 5FLMG 1TWCB 2ZXRA 2K6AA 1TY0A 1VDZA 1W2BA 5DAUA 3CF5A 3DUZA 2R92B 5M3MH 1FGUA 1NMGA 1PRTC 5AFWA 1VQNA 3BZKA 1WD0A 2DY7A 3JC66 1N8RC 4X65Q 5EPLA 3R3OA 1B3QA 1PYWD 1BF4A 4QQBX 3BU2A 5BR8L 2M2LA 4A3MH 2L9HA 4DV6Q 3GTPB 4OO1H 1I4QA 2F0JA 5EJWA 4X3SA 4C2MB 5DNFA 4IFDG 4JI0Q 3OW7A 1JJ2A 2F0HA 2PPBC 1BCPF 3I4MB 2K14A 2OF1A 4KY7A 2F0TA 1SE2A 2E2DC 4JI4Q 4LAAA 1S5ED 1XXGA 4YHHL 1I4RA 4DV3Q 1QVGA 5JJIA 1PTOF 1EY7A 5DM73 1VQBA 4L6TB 2MHVA 1BQQT 4G4KA 2G5DA 1X9NA 1A3UA 2WINB 2A5HA 2C35B 2KUMA 1SYBA 1LTAD 5ISRA 1BCPC 5GAGC 5IT9L 1NJIC 1QB5D 2F03A 4A3DG 3FDTA 3PIO3 1JOKA 3D6WA 5GROA 2BE5C 2UUCQ 2A19A 4CGYB 2DNEA 4UP7A 2RDHA 1E2ZA 1PV4A 2K50A 2L55A 3PMFA 1VQHA 1II3A 3KBXA 2ZJPA 1KAWA 3J80i 4X62L 3PUVA 1B70B 2N78A 2R3ZA 2MGSA 3HFZB 4UY8C 1G6PA 3UE1A 1AEXA 4BXXH 4X3KA 2UXBQ 4KLKA 3K7AH 1XTDA 2CWPA 1VQOA 1CT1D 1LABA 1GKHA 5HY6A 5IOCA 2QW7A 5LHY1 1H9SB 3RN2A 2JA6H 2G9HD 4ODGA 4A3JB 3MXPA 1LUZA 4A3CG 2IL8A 3W3AA 1AZPA 5M5YB 1H9KA 3KOJA 1EOVA 1WYDA 2HCIA 4OIKA 4HCEA 1VQFA 4FO2A 3A7LA 3SK5A 5D65A 1LYLA 2NN6I 4DV1Q 2ZT9C 1H9JA 4P75A 2NVQH 1Y8PB 2Z0SA 3P75A 4IPHA 3CCRA 1N34Q 3NP8A 4XIGS 1TWAH 3CCEA 1CFMA 4RMFA 1PFSA 1A2UA 4A3IG 4JI3L 5C3EH 4ZLTF 3NBHB 1XNQL 1X3GA 5LMNW 2UXCL 3M4YA 5C3XA 1EY6A 2F0LA 2WB1B 2MO1A 4JK1C 3DWQA 3T16A 3QB3A 3S2HH 1BXTA 3DM1A 5FLXc 5M3FB 3HOWB 2B39A 2L0CA 1LTGD 2NZHA 4IOCA 1N32L 5A35A 2LKVA 3GV3A 4DNIA 2N3SA 3BDLA 4C3IG 3OWFA 4MIUA 5C4XG 2KENA 1EIGA 4POGA 2Q2UA 2WACA 4KY5A 3Q8DA 4DK3C 2KCCA 3L3OC 4H7BA 1J6QA 2HT1A 2EE1A 4WJWA 1NY4A 1LTRD 1O78A 2FFKB 5F2DA 4X65L 5C3EG 2NVXH 3CQZB 5CBEE 2RKSA 4F7XA 1ZXTA 4WORA 5C4HA 3T1YQ 2Q2TA 3GTOB 2RA4A 2OTLA 3OYYA 2RHSB 3H09A 2E5LL 3I4LA 3GV6A 1SNMA 3J7ZC 4A93H 3H0GH 5FO9B 3IFDA 2Y0SG 4K8JA 1SMXA 2G9DA 1L0WA 2A69C 4GN5A 4LWCA 5D3DA 3F2DA 2XWJB 1IBML 1K3BC 4X6AH 4DV3L 4GZYC 2LXJA 2ICIA 1OXSC 2OQKA 1G2SA 1Y8NB 4NXMQ 3VA7A 5L37A 1SJHD 1XPOA 5GAHC 1QWYA 2OXPA 2CW0C 2C9OA 1QZHA 1BBXC 3GTGB 4K0KQ 2E75C 2PZUA 1XJVA 4K6DA 4RH6A 5JPNC 2FMCA 4KKTA 4R4IA 2Z4HA 1B8AA 2F0WA 3G6EA 1F9SA 4HTHA 4DAMA 1XMQL 3EROA 1RHPA 3F2UA 1UE7A 3MVVA 3L9AX 2UUCL 4IUTA 1W6KA 5CR3A 3GTMH 1C4QA 2MUYA 1YNJD 2EQSA 3J81L 5FO8B 1JWUD 5IY0A 3SDZA 3ND9A 3I7FA 1ESRA 5BN4A 2OQ0A 3QIAA 3C2PA 1XWEA 2K5VA 3EVQA 1QE6A 3KUPA 4UDUC 1UWVA 2UXBL 1HZAA 4RG1A 1I3QH 2EY6A 4F8MA 3MHBA 3S2DB 1S5CD 2O5IC 2OCEA 4IJLA 3I4NH 4DV4L 1Q7YC 1HPCA 4GKJQ 2K7VA 5FK9C 4QY7A 3TP5A 2JA7H 4H13C 4ZAIA 1YI2A 1SNOA 2PQAA 1TWHH 1PXUA 2C5CA 3SHLA 5IGDA 1KRSA 1EYGA 4OL7A 2B3GA 3PGZA 1PMRA 1DYQA 4BY1G 4B9WA 3Q24A 1DCZA 5FO7B 4TQUS 3CC4A 1ENFA 4C1NK 4X64Q 1JC7A 4Y7NH 1YJNA 4B3TQ 1JMCA 1K83H 1QNUA 4RFBA 4CJ0B 4A3GG 1PH7A 2O4XA 1Y14B 1LTSD 3BZCA 4QUFA 4A3DB 3TBIB 1AFPA 3CCSA 4V190 3GD7A 2K03A 5M5XH 1F9QA 5IP9H 4HAEA 1ESFA 1P16A 2IHFA 1G2TA 1PYSB 1NCVA 2F0OA 3TS2A 3HEJA 5C0XJ 4CHTB 1B44D 2JJQA 4KMUC 1QILA 3UDGA 2E2HB 5D3IB 1EU3A 1C8CA 4XQNA 2KA7A 1L0YB 3OOCA 3S1MB 2E2JH 4J15A 3F8TA 3VYUA 1PH4A 5I6YA 1EZ6A 4IPCA 3ULJA 2XWBB 2LMCB 5C3WA 5ELDA 3FKIG 2AUKA 5I2YA 3F2CA 3E3XA 2L15A 2NN6G 2R7ZG 1EY5A 3CCJA 4JOIC 4H44C 1VQJA 1WCMG 1SN8A 3M4PA 3CCMA 2WAQG 1RD9D 3H6MA 4DAYA 2B29A 4KKSA 4NXML 4A3LH 1I50H 4RGNA 4A3IB 2Y0SE 3T4AC 1DONA 1N36L 1NE3A 3CPFA 3QWNA 4BBSH 4L5TA 4K0KL 3R93A 1TU2B 1Y1WH 5COYA 5M9OA 4HIMA 3NXWA 1SNQA 1VQLA 1IYUA 3T1HQ 1KTKA 4C3IB 1C7YA 2ATWA 5C4XB 1Z9FA 4K2LA 2GN5A 4JG2A 4A3LG 3OW2A 4RA8A 4KD3A 1T5EA 4ZUIA 3PIOA 2IY5B 4K5WA 1ML0D 5ELEA 5ELFA 2XNAC 3NTHA 1ET6A 1EQQA 2K75A 5ELBA 4EQOA 3PO3H 1NTGA 1K8AC 5CV6A 1EY4A 4JBMA 1JORA 3FRPB 4JOIA 3OWEB 2LFNA 3S17B 1LTTD 3HKSA 1ZKOA 3X3NA 4LF6Q 3Q6SA 2F0SA 2AQ1B 3OTOL 4GKJL 1STNA 3NPPA 4RHSA 1WTXA 4RGTA 1SFOB 4DU9A 2F4IA 4A3BH 3J81E 1L1OC 3DLLA 2ZXPA 1SNCA 4UP9A 1UAPA 2EJGC 5LMUQ 1HR0L 1VQMA 4AH6A 2SEBD 1MSGA 3C1EA 3VR2A 1G6ZA 3NWSA 2M00A 1Q46A 3IKJA 3ND8A 4X64L 4OO1I 1EY8A 4P71A 2IHEA 4GOPB 2TSSA 4GNXB 1EIYB 3IL8A 1S5BD 4OWTB 1EQRA 2AWOA 1IBKL 1PRTD 2JP1A 1IKLA 4A3BG 4HSPA 2JA5G 4O1NA 2QEJC 3TMEA 2I46A 3HRZC 5G3LF 3OIPA 5BN3A 4LUOA 1M90C 5NUCA 1IKMA 1TT2A 2AHOB 1I6VC 2YU9H 2BDNA 1ASZA 1UUPA 1VS0A 4AQYL 4A3JH 2VXWA 4ME3A 4JI7L 4HIKA 3S1RB 2EPBA 1MKHA 4KJNA 4P73A 5IYCG 1LTLA 2F4VQ 3ER0A 5I2XA 2H5XA 3MFGA 4YHHQ 1AH9A 2KHSA 1L1OA 4FNFA 1VCIA 3J80L 3SK8A 1BDOA 1HFNA 2LXKA 3E9HA 4N9TA 1TXYA 2HUGA 1Q8IA 5IYBG 3PF4A 2D9UA 2IX1A 1QVCA 1LTID 2FXQA 3RR5A 4BY1B 5C4JH 3K6OA 3T53B 2K05A 1H95A 1ZYRC 3D3RA 3DXJC 3HS0C 3MA2B 4A3GB 2VB3X 3CW2C 5GQOA 3ONAB 2OWOA 5CGKA 3A8IE 2FINB 4K5XA 2WAQE 1VQ6A 1HRJA 4YIJA 4OEMB 1TIID 5K5PA 4X62Q 1STGA 5EQ0A 1C9OA 3T1HL 5AJ3L 1UE1A 3S16H 4LFBL 1ZEQX 2EYOA 3MZ5A 4IURA 1RTNA 2KQ3A 3D8GA 3LNNA 3D4DA 1U4MA 1E7ZA 5FKAC 4QCLA 2MJ8A 2WV6D 1K0RA 4LF4Q 1GJXA 5IGBA 1EFWA 4DR7L 3C46A 5JEAJ 1YNNC 2VL6A 2J0TD 1EIFA 5KRUA 2F3WA 3FKIB 3HOZH 3A74A 4EVOA 4C3HH 3CCLA 4A3KH 3HOYH 3K59A 2R7ZB 4HSVA 4P72A 4IUPA 3K5MA 4KHPL 1V1OA 1WCMB 4Q0FA 2F0MA 4LF6L 1GUOA 2JEBI 3ERQA 1HZBA 1XMOQ 4FXKC 2JE6I 1HQMC 3H15A 2CFMA 3RZOH 3GTQH 3GO5A 2PZWA 4JI3Q 3S1QH 2O2LD 4NW2A 1IBLQ 1XNQQ 1WOCA 5FJ8H 4LFAQ 3P1HA 1YEZA 1R9TH 3HOZG 1JE5A 4MHEA 1FJGQ 4A3KG 3HOYG 1H9MA 5JOBA 1EOTA 3Q23A 2EYLA 2HD3A 5J3BA 2N55A 3HOXH 1YJWA 5FOBB 2I5HA 1TVXA 2A6HD 4JI8Q 3TS0A 1Q8KA 1EUJA 4XTCS 4XQQA 1C0AA 4NDXA 2JA8H 2OEOA 1NAPA 2NTSA 3NENA 2YTYA 2IJ0A 3J7A5 2DNCA 4JPBW 1V1PA 1ASYA 4M1UB 1CKNA 2UU9Q 5CV5A 2EOTA 1WD1A 2SNSA 4KV6A 2E5LQ 4DR6Q 2Q8IB 2VUMH 2X69A 3UDFA 1LO5D 1B9NA 2A69D 1HNWL 4DK0A 4A3FH 1WTOA 3AEVA 1UEBA 1I6HH 4R9WA 2RSNA 1PH8A 5M3MG 1STAA 1SYFA 2F4VL 1SR3A 1IBMQ 2CVRA 4DXFA 1QG7A 1TKWB 3U4ZA 4LNQA 2B8GA 1MBYA 1B1ZA 2K33A 2KEDA 4GKKQ 5C44H 4A3MG 1X6OA 1JOOA 2CW0D 1FD7D 4O42A 4OO1G 3S14B 2VUMG 2CWAA 4PZ7A 2NBFA 5KGUA 1S5FD 4K14A 2QA4A 3M3YB 1LT4D 2NVYH 3H94A 3TSSA 1IW7C 1VQ5A 3CKIB 4FF1A 1PH1A 1FNUA 2EYHA 3AFQA 3HP3A 3ICEA 3CCQA 2JSOA 1XMQQ 1FVIA 3CMAA 1PRTB 1AZQA 2M9VA 1G91A 3M7NA 1VQKA 4IFDJ 4JBWA 1VQIA 1YBYA 1PZKD 2JA5B 3U9OA 1XPRA 4DA2A 2BA0A 1WTWA 1JJCB 3I70A 2K5HA 1JICA 5JJKA 5KIXA 1IL2A 1EYDA 3MTSA 4K5VA 1Z47A 1SNDA 4LF4L 3I3CA 2PQEA 4DV4Q 4TKOB 1EIHA 1HH2P 1LTBD 1J9OA 1STHA 3FP9A 4KHZA 1H9RA 1XX8A 5A2QE 1FL0A 4R4CA 5E1FA 2BCOA 4BWGB 2EDGA 2DN8A 1W3SA 5GADC 3S15H 3JAME 4BBRH 5IGEA 4BXXG 3K57A 1UNSA 2PW5A 1BCPB 1XMOL 5CC4A 1DOLA 2XSCA 3BVMA 4YWMA 2VW9A 3VA5A 1Q82C 4S3SA 1VF7A 1EEFD 2JA6G 2QEXA 4C3JH 3N52A 4B3RQ 1PTOB 1IBLL 3K0XA 4FYDA 4H0LC 4HR7B 4I65A 4LFAL 3K0YA 2HIVA 1CZWA 1FJGL 2JYOA 1O7YA 5FLXL 1CHQD 3MXNA 4ULLA 1GUTA 2VB2X 2HHHL 3SVMA 2B2WC 4JI8L 2A6HC 1I5FA 3G48A 2AWNA 3I2ZA 4A3EB 2ZTDA 5CORA 4GS3A 1S3OA 1EQTA 3K5LA 3KDFA 1F77A 1LT5D 4X66L 5M5WH 3K5NA 3D4RA 4JBJA 2SNMA 4NB3A 2UU9L 1TWGH 5CV4A 5DEHA 3HKZG 4DR6L 2WKDA 1SYGA 2TMPA 4ZRZA 1SJED 5E4WC 4JV5Q 2P5ZX 2Q2HA 2MPMA 2AQ3B 4IALA 3SR1A 2NVTH 1MJEA 1F9PA 3BVZA 1ENCA 4HJ8A 1TY2A 4DV0L 1HA6A 4XT3B 2EY2A 1CKOA 3GTJB 1O7ZA 4GKKL 3HZXA 3RZDB 2PMZE 2LY7A 4LF7L 2WP8J 3MEHA 3ERSX 2B63B 4CDEC 3KLRA 2ZJRA 1DZ1A 1N36Q 2N8NA 4DFAA 4ILWA 4B3SQ 2PYKA 5IWAL 1WFQA 3HOUH 4A93G 3PO2H 3H0GG 2F0PA 1JJGA 4J8QA 3CC2A 2KCTA 4ZKCB 3EQLC 4C56C 3QO2A 2PZTA 3BJUA 2B2WA 3GTLH 3QG1A 3OPOA 3PQIA 4RHRA 4K2KA 2HQLA 1D5XC 3E6ZX 4OONA 4DK1A 3HOVH 1SYEA 2RHQB 2AKWB 1TWFH 4IUQA 1PH3A 1IYVA 1B3AA 1RKNA 3GTKB 4JW0A 4MZ9A 4A75A 1VQEA 1RCVD 4ID6A 1Y1VH 3PIP3 5J1ZA 2RCFA 5EKLA 4WJ3M 3M4OB 2GVAA 1LT3D 2OTJA 1CM9A 5C0XH 3GP7A 1ONLA 4PNYA 5IT9E 1HHVA 2F52A 4UPAA 4WJ4A 3OTOQ 5M3MB 4AYBE 3E9IA 3V96A 4WFN3 1CZGA 1Y69U 3PUXA 1GUNA 4ZYSA 2R7FA 1A63A 2MQHA 1G291 2PQAB 1PYBA 2PO4A 1V1QA 4FP5D 1D1IA 4A3MB 2DUDA 2KHIA 4M8AA 1CSPA 1HR0Q 2QDBA 2PNHA 1HZCA 1RJTA 4DR2Q 1DJRD 3I55A 1Z7TA 2FJ2A 2QCPX 3A7AB 3I4NG 1KABA 4B3RL 1K0SA 5JPMC 1IBKQ 4HIOA 3KF8A 2E2IH 1GHJA 1VMCA 2JA7G 1T9HA 1D6EC 1EWCA 2IWHA 1XNRQ 3MFYA 3EFXD 1BOSA 3OMCA 3PUYA 1M8AA 2K1BA 1JWMD 4GLAC 3KF6A 1CHPD 3MXGA 3RMHA 2L12A 2A8VA 4JBKA 1FYCA 3DWAA 1GM5A 1MIUA 1B7YB 4AQYQ 4R4QA 1WTQA 5I9OA 3SK6A 3WOFA 4JI7Q 3E0EA 3PUWA 1JB3A 4N8X1 3PCOB 3K8AA 1PHJA 2WKCA 5IP9G 4DN4M 5G3LD 1X3FA 1SAPA 1D5ZC 2BH8A 3V05A 2X6GA 4R4TA 4JV5L 2AQ2B 1AW7A 2ZTCA 3S9WA 1Z6HA 4KJOA 4LF5Q 5K36H 2Q8RE 5ELNA 2SDFA 4EQ5A 2K5NA 3I73A 3OIQA 3R8BA 2R93H 1CK1A 4DAYB 4R8NA 2H4OA 2HDLA 2Z9HA 3K7AB 1VQPA 4HMJA 1VQ4A 3URYA 2VQEQ 4JC0A 3VR5A 1VMPA 1ZYRD 3HKZE 2F0NA 4FXDA 5KNBA 3VYRA 1PLFA 2JA6B 3P7JA 3S1NH 1TQOA 2NZOA 4B3SL 4IPGA 3SE0A 3TDQA 3EBEA 4B9XA 3NUCA 4BY7H 1TWCH 4UAIA 1KHIA 4YCVA 1G8ZD 1MD2D 1BBUA 1FGBD 2B2VC 2R92H 1IYJB 2QILA 1SNPA 5AJ3Q 1LACA 4LFBQ 2R93G 1Q1BA 1MHWC 2NVQB 2SOBA 2F1MA 1NNXA 3G71A 1B9MA 1S5DD 1XTCD 1SYCA 1XPUA 2A73B 1SEBD 1TWAB 4IOAA 3EIVA 4DV2Q 3GTPH 1KNAA 1YVCA 2IW3A 4RCNA 4CJ1B 4DR7Q 5C3EB 3FPPA 4KKUA 1EYAA 4C2MH 4BBSG 1PA6A 1YNND 2F0DA 4BY7G 3SEBA 2O5JC 3HKZB 3S2HB 1Y1WG 3I4MH 5J22A 4DGZA 1B2TA 1BO0A 2Y0SB 1KLUD 2VZAA 3FMCA 2AUJD 4IUNA 4KN7C 3S24A 4CKCA 1CKMA 1R4QB 4CKBA 4KHPQ 2A6EC 2KHJA 5CV8A 1B53A 2EYFA 2F0GA 4RKLA 3ULPA 2N49A 2RF4A 3AQQA 3ULLA 4P74A 4N8FA 4YCWA 4PMWA 2K28A 3LWUA 2NVXB 1X56A 1E22A 1VQGA 2DJGC 2WIIB 3PO3G 1Q12A 3AMUA 3KBGA 5DLQE 5EKKA 4P2CB 4DR2L 1Q86C 4A93B 3H0GB 4IPDA 2B2VA 1A62A 1U5KA 4U673 2QDLA 2L4NA 3BDCA 1QUQA 2DJFC 4HN7A 1VQAA 3CP0A 3F1ZA 3A8KE 5I4DA 3A56A 1O7IA 2NUCA 4RCOA 1RDPD 3AU7A 3W5OA 5JVG3 2KOLA 3R2IA 3TN2A 2NYZD 3R2TA 2F0QA 1K3RA 2CH4A 4HJ9A 1STYA 3KJPA 1XNRL 1HA5A 1WI5A 2EYJA 4I7ZC 4LMQD 1KD1C 1JWSD 2RDGA 4CDDC 2UXDL 3KLSA 1YHAA 4MNOA 2K04A 4OXPA 4BS9A 4IJHA 1HNWQ 1K8GA 3N6RA 3BS1A 4GLXA 1TS2A 1GUGA 5M5YH 4DR3L 1VQ7A 3CU7A 1TR5A 3GTMB 1L1OB 3TQYA 3QR8A 1JE4A 4XDXA 1AE2A 5CBAE 3D31A 1Q1EA 5KYIA 3K5OA 3CC7A 5JEAH 4LF5L 2XRQD 2YV5A 1K28A 1STEA 4MTNA 1RF2D 2CCZA 1PZID 4JI6Q 1I3QB 1KDCA 2N88A 1IW7D 1STBA 4A3JG 1DOKA 4IUVA 2VQEL 4DF7A 3C1FA 4OELB 1I4HA 4K6LA 1PH9A 4R8IA 1GVPA 2XIWA 2EZVA 4FF3A 5TSSA 5M3FH 3HOWH 1I94Q 4ZKBB 2XGTA 3KJOA 1EY0A 3LX0A 1N9WA 3H3VI 4V0BA 2JA7B 5EBDA 1E1TA 1SYDA 1WTHA 3P20A 1XYIA 1RODA 3V2TA 1S40A 1TWHB 1LM0A 1O7LA 1R4PB 3DWPA 1HFGA 1X3PA 2HDMA 4LF9L 3CQZH 2BH2A 4Y7NB 2FHTA 3GTOH 4PMBA 4G7HC 4PV1C 1K83B 2VS1A 4DV2L 2EY1A 4NP5A 3BYYB 4AIMA 5M3FG 3T56B 1L2FA 1IHZA 2X6LA 5CV9A 4KD4A 5M5XB 3JAMc 2D2CC 5EBCA 4DNTB 1WVLA 5CMDA 3T51B 4UHVA 1CQVA 5ELOA 1TS3A 2CKZB 3D6CA 3L7ZC 4LW1A 2WAQB 1A3VA 5EKIA 3PIPA 2PI2A 1YHBA 4X3TA 1DD2A 3KYHC 4LUVA 2RCNA 4IQZA 2E2JB 1PFNA 1S72A 3GTGH 1X3QA 1J5EQ 1U4RA 2E8GA 3TZUA 1C48A 1EFID 3HG9A 5E4XA 4HIDA 1A3TA 1IXRA 5KNDA 3A5ZB 4C3HG 3E0JA 1RTOA 5FLMH 5IYDH 3U9SA 2D0PA 3RLFA 3M9BA 4ME5A 4LFCQ 2HHHQ 1E1OA 1F2LA 2BOSA 5EPJA 3VR3A 1WTPA 1EL0A 3K7UC 1KAAA 1EEID 4B3MQ 4YWLA 2BA1A 2FMMA 1V1PB 1I50B 2B2YC 4X66Q 2RDFA 1X65A 2KVMA 3WWVA 5T1GA 4CJ2C 3FVQA 5FJ8G 3EA6A 1V43A 4IFDH 4BBSB 3S2DH 5H1SE 1F2YA 3G4SA 1MGSA 4POFA 1A0IA 3HOXG 1Y1WB 2LS01 4DR5Q 1NBWA 4X3UA 3W1BA 1QVFA 2ALYB 3FPUB 4R1JA 1OXTA 1HTPA 4QGUA 1PVOA 2CQAA 4A4IA 3KLWA 1DGSA 2JA8G 2B8FA 3MEFA 4DV0Q 3RLNA 2RVLA 4LF7Q 1CI3M 4JYAQ 1SMYD 2ZM6Q 5JJLA 1BVSA 2I0QA 5IWAQ 5E7NA 3PO3B 1QCBD 4IO9A 4JI6L 1D8LA 1YITA 1L0XB 4A3FG 1HNXL 1GO3E 3STBC 1CA6A 4A3DH 3FHWA 3DEOA 1A15A 1X54A 4F88A 1YJ9A 1X3EA 3ITPA 1I94L 5C0XI 1E2VA 5C5MA 1SSOA 1JB7A 1VF5C 4JVZA 3MXUA 4A3BB 4J1MA 2B2YA 4DR1Q 5C44G 4DV5L 2E2HH 3J80E 3SGIA 4JI5Q 2F3VA 4AYBG 3DMUA 1Q81C 1V9PA 2NWGA 3S1MH 1SROA 2J7ZA 2F0UA 5IT9c 1SXTA 2HQEA 2KBNA 4TSSA 1HNZQ 2ASBA 2E76C 5LMNQ 1Q3LA 2DY8A 4QL5A 4A3CH 1PTOC 3NK9A 3H3VH 4CDFC 3T13A 3PV0A 3SK4A 4FF4A 1LV9A 3CHBD 3WDNA 4FVMA 5GAEC 4LK1C 1M4VA 4G7OC 5IE8A 5KEEA 1HUMA 3NQIA 2NZ1D 2WB1E 3NTIA 2YU9B 1F2ZA 2CH4W 4A3IH 4OWWB 3L2PA 1H9SA 3NSWA 4JI2Q 4L5RC 4MN3A 1J5EL 1PFBA 2RBMA 1AE3A 2EYPA 3GQBA 3W2DA 3GDEA 1KNEA 3CRLC 4JCVE 2Z6BA 3MXNB 4DKAC 3CCUA 1E2WA 1ENAA 3JAMi 4LJZC 2Q2IA 4DR4L 3K58A 4C3IH 1B50A 5C4XH 4L63B 1PZJD 4LFCL 4DPGA 4QB4A 4BBRG 4ZQ3A 2UUAQ 4OX9Q 1CTMA 3TREA 3A5UA 4B3ML 5C4JB 1E3PA 4HCSA 3J7YW 3Q22A 3KDFB 1UEAB 4L8JA 4HJ5A 3NBHA 1KLGD 4L5SA 4C3JG 3UE0A 1EWIA 1HZ9A 3NBIA 3QJYA 4KI0A 3BG3A 1EY9A 3FEWX 1VQCA 1NR2A 1BKBA 1HQRD 3S17H 4DXGA 3MAQA 1DM0B 3K81C 2K5DA 2Q8TA 4DR5L 3OMGA 3OHXC 3KLSX 5IODA 1UE6A 3S16B 1SFOH 1DXMA 4A76A 3UI2A 2R6GA 4GLVB 4RGMA 1KIXA 2V4DA 5IGFA 4O0AA 1F9RA 3DEPA 4DV6L 1IL8A 2CQOA 5IP7H 1A8VA 3M85A 4JYAL 4IN3A 4JI0L 2ZM6L 1NR4A 1SMYC 3L0OA 5ELCA 2EYMA 2MO0A 3IFTA 2BDOA 3HOZB 2KEEA 3RD4A 1AN8A 4C3HB 4A3KB 3HOYB 1MI2A 1FR3A 1F2MA 2D0OA 4JI4L 5HGQA 5LL6X 2V1CC 2MFIA 3LWEA 3ZYYX 3E5SA 1N33Q 3J7AF 1LT6D 2LSSA 5HGTA 3TZDA 4DAPA 2A68D 4QIWE 5IIFA 5JJZA 1ICWA 1B4OA 5IP7G 4DR1L 3RZOB 2YTVA 3GTQB 3S1QB 2MNAA 3VR4A 4JI5L 3D0FA 2IX3A 3HOUG 1R9TB 1KQSA 3PO2G 1GUSA 2F3IA 1Q90A 1EYCA 3S1RH 4TVAB 1I4XA 1HNZL 4XYOA 5C6AA 2VQFQ 3HOXB 2PMZB 3I72A 2EJFC 2ZTEA 3A55A 2Z6KC 1GXDC 2A6ED 3NEMA 5LMNL 3RNUA 3UDXA 3B6YA 3DM3A 3J81c 4QF4A 3I8ZA 5JVH3 4E6IA 2I5LX 4KK7A 2JA8B 3TRZA 4XXEA 4HJAA 3HOVG 2HCCA 1X32A 3UDIA 4OIJA 3QOJA 3TEHB 1HJPA 1QZGA 1SRUA 1NUCA 4QUCA 2JXMB 4BY1H 2XTIA 3IRBA 4C1NI 1PDQA 3MWYW 1M1KC 1RIPA 4QIWB 1Y1VG 4JI1Q 2VUMB 3A54A 2VNUD 4A3GH 2ENBA 1U4LA 2A74C 3O13A 4HMIA 4A3FB 1YHQA 5C0XG 3U58A 4IZ8A 5I9PA 4JI2L 1I6HB 2Z4IA 2L11A 3I90A 1OXUA 2XVSA 3KF8B 1BBWA 4DAVA 4BA2I 1BNZA 3H3VC 4PZ8A 4DV7Q 1K8OA 1Y8OB 1TS5A 1U9RA 5KYLA 1YNXA 1JR0D 2L5TA 4DV1L 2NB0A 1I4GA 1ILPA 5C44B 1I4PA 4DUZQ 2UUBQ 3U50C 4WRDA 2JA9A 3W1GA 1N34L 4AYBB 3RN5A 3KF6B 5D14A 2UUAL 5E3FA 4EX5A 5HURA 3QOLA 4OX9L 2JEAI 2UXDQ 2EJMA 2NVYB 3VDYA 4CBVA 4CDCC 5IGGA 2Z6KA 4ABNA 2VY3A 4RAUC 2YYZA 1YIJA 3RUZA 3MC0B 1PFMA 3J81j 3FKIH 4UP8A 4DR3Q 4LUZA 1EWHA 2NN6H 1PH5A 2R7ZH 1VQDA 3TP8A 3J7AV 2B2TC 4K8IA 3NHHA 2I07B 1WCMH 2I5MX 4XT1B 1SDFA 2JQOA 2K01A 1D7QA 1D5MC 1OO9B 2XN9C 4G57A 1SE3A 5FLXE 3A8JE 4HJ7A 1QJOA 1HR0W 5DM63 4MTKA 5CV7A 1ET9A 4Y52H 4APVA 1MJCA 3BYTB 3T1YL 1K9MC 3I4OA 5LL6S 4OHJA 3SXHA 3NWTA 3C3LA 1GHKA 1FNVA 1X55A 2JN4A 3U4VA 4OWXB 1VQ9A 1P8LA 1NMFA 4NMZA 4TRDA 3I56A 1BUVT 1U4PA 4QJFA 1W6JA 3CPWA 4U68A 5K36G 1HUNA 2QF7A 1QOHA 2E74C 2XRSD 2KCMA 3S15B 4BBRB 1EQVA 3IAYA 4LF8Q 1LLRD 1N33L 1OTCA 2EY5A 2D5DA 4LF9Q 4KHVA 4ZUJA 1IZ6A 2EXDA 2A68C 3EJIA 4YY3Q 2IPKD 3G6JB 4C3JB 1O80A 3DHQA 3CAMA 2OT2A 4NXNQ 2B2TA 4NPSA 1JQYD 1SLJA 2K5QA 2EXZA 2B2UC 3D4WA 1JOQA 2CHBD 4DK6C 2VQFL 4GOPC 4GNXC 5T1IA 1ILQA 2R92G 1KL9A 1T5XD 4O2DA 2K52A 3I91A 4PG3A 4GN4B 4IUUA 4RWSC 1YNJC 1DOMA 4G7ZC 2AMCB 2PCFB 2Z8LA 3S14H 3KFUA 5M5WB 3PSIA 1QNKA 2ES2A 3M3YH 4OGQC 1TWGB 1S4ZA 1D1KA 1WJJA 3H91A 4JI1L 3I4MG 4GN3B 4RGOS 3WOEA 4IFDI 1CQFA 4XQJA 1QUQB 2KCNA 4FF2A 1FNWA 2NVTB 2K4KA 4QMGA 4R4OA 1SE8A
chains in the Genus database with same CATH topology
1TS4A 3BZDB 1CA5A 5BN5A 3NTKA 4KTAA 4EQNA 5CYUA 3CRKC 3G7LA 5EPKA 4DNRB 3HGBA 3HOUB 4XYQA 3PO2B 2B2UA 2J4XA 4KY6A 2H1EA 1OXXK 3GTLB 2EVBA 2IT1A 2Z1CA 3TP7A 1A6XA 3VR6A 3HOVB 1EU4A 2KJXA 2F0KA 3NQTA 1TWFB 2QKIC 1HTLD 2K5WA 1GUWA 4HEDA 1BR9A 1Y1VB 2PW7A 1PTOH 1A2TA 3TP6A 1K8MA 3I4NB 1SE4A 2RSOA 3PUZA 2F0VA 2ID0A 4Z9CB 5I6WA 1HCZA 2RQXA 5JEAG 2ZXOA 1BCPD 5JAVA 2NTTA 2BE5D 3M7GA 2D62A 1PTOD 2GA4B 5A2QL 4J6HA 1HXYD 4N9PA 2E2IB 3JAML 3BDOA 2IX0A 4BA1I 4PQXA 2R61A 1E0BA 4KN4C 4RKBA 1KDBA 2L1BA 1SBBB 1OXVA 5J39A 5C4ZA 2F0EA 4Q5VA 2MP1A 3X3MA 1J8IA 3AB9A 1JCKB 3Q0AA 1EZ8A 3OSOA 4PMCA 4EGVA 4EQPA 1KDAA 4ZK9B 4FXGC 3NE5B 2ICEC 2K32A 1WTVA 5IGCA 2PNRC 2F0IA 1NSNS 1D2BA 3KK7A 4B08A 3VYSA 1PRTF 1MSHA 2R93B 5C5LA 1V8QA 4NKLA 5EGTA 1WTRA 4F87A 5KNCA 2KECA 4CKEA 2F0FA 3S1NB 3VYTA 3BVGA 1GOZA 1AP0A 4BY7B 1TWCB 2ZXRA 2K6AA 1TY0A 1VDZA 5DAUA 3DUZA 2R92B 1PRTC 5AFWA 1WD0A 2DY7A 5EPLA 3R3OA 1PYWD 1BF4A 2M2LA 2L9HA 3GTPB 4OO1H 1I4QA 2F0JA 5EJWA 4X3SA 4C2MB 5DNFA 4IFDG 3OW7A 2F0HA 2PPBC 1BCPF 3I4MB 2OF1A 4KY7A 2F0TA 1SE2A 2E2DC 4LAAA 1S5ED 1XXGA 1I4RA 1PTOF 1EY7A 5DM73 4L6TB 2MHVA 1BQQT 4G4KA 1A3UA 2WINB 2A5HA 2KUMA 1SYBA 1LTAD 5ISRA 1BCPC 5IT9L 1QB5D 2F03A 3FDTA 3PIO3 1JOKA 3D6WA 2BE5C 4CGYB 2DNEA 2RDHA 1E2ZA 2L55A 3PMFA 1II3A 3KBXA 3PUVA 2R3ZA 2MGSA 1AEXA 4X3KA 1CT1D 1LABA 5IOCA 5LHY1 1H9SB 2G9HD 4ODGA 4A3JB 3MXPA 2IL8A 3W3AA 1AZPA 5M5YB 1H9KA 2HCIA 4OIKA 4HCEA 4FO2A 3A7LA 3SK5A 5D65A 2NN6I 2ZT9C 1H9JA 1Y8PB 3P75A 3NP8A 4XIGS 1CFMA 1A2UA 4ZLTF 3M4YA 5C3XA 1EY6A 2F0LA 2WB1B 4JK1C 3DWQA 3T16A 3QB3A 1BXTA 3DM1A 5M3FB 3HOWB 2B39A 2L0CA 1LTGD 5A35A 2LKVA 3GV3A 4C3IG 3BDLA 3OWFA 4MIUA 1EIGA 2WACA 4KY5A 2KCCA 3L3OC 4H7BA 2EE1A 4WJWA 1LTRD 1O78A 2FFKB 5F2DA 3CQZB 5CBEE 2RKSA 4F7XA 1ZXTA 4WORA 5C4HA 3GTOB 2RA4A 3H09A 3I4LA 3GV6A 1SNMA 5FO9B 4K8JA 3IFDA 2G9DA 2A69C 5D3DA 2XWJB 4GZYC 2ICIA 1OXSC 1G2SA 1Y8NB 3VA7A 1SJHD 1QWYA 2OXPA 2CW0C 2C9OA 1BBXC 3GTGB 2E75C 2PZUA 4K6DA 4RH6A 5JPNC 2FMCA 4KKTA 2Z4HA 2F0WA 1F9SA 4HTHA 3EROA 1RHPA 3F2UA 3MVVA 3L9AX 4IUTA 1W6KA 5CR3A 1C4QA 2MUYA 1YNJD 3J81L 5FO8B 1JWUD 3SDZA 3ND9A 1ESRA 5BN4A 3QIAA 3C2PA 1XWEA 3EVQA 1QE6A 3KUPA 4UDUC 2EY6A 4F8MA 3MHBA 3S2DB 1S5CD 2O5IC 1HPCA 2K7VA 5FK9C 3TP5A 4H13C 4ZAIA 1SNOA 2C5CA 1PXUA 3SHLA 5IGDA 4OL7A 1PMRA 1DYQA 4B9WA 3Q24A 1DCZA 5FO7B 4TQUS 1ENFA 4C1NK 1JC7A 1QNUA 4RFBA 4CJ0B 2O4XA 1LTSD 4QUFA 4A3DB 3TBIB 1AFPA 4V190 3GD7A 2K03A 1F9QA 4HAEA 1ESFA 1G2TA 1NCVA 2F0OA 3HEJA 5C0XJ 4CHTB 1B44D 4KMUC 1QILA 2E2HB 5D3IB 1EU3A 1C8CA 4XQNA 2KA7A 1L0YB 3OOCA 3S1MB 3VYUA 5I6YA 1EZ6A 2XWBB 2LMCB 5C3WA 5ELDA 2AUKA 5I2YA 2NN6G 1EY5A 4H44C 1RD9D 3H6MA 4DAYA 4KKSA 4RGNA 4A3IB 3T4AC 1DONA 3QWNA 3R93A 1TU2B 5COYA 5M9OA 3NXWA 1SNQA 1IYUA 1KTKA 4C3IB 5C4XB 4K2LA 4RA8A 4KD3A 1T5EA 4ZUIA 4K5WA 1ML0D 5ELEA 5ELFA 2XNAC 3NTHA 1ET6A 5ELBA 4EQOA 5CV6A 1EY4A 1JORA 3FRPB 3OWEB 2LFNA 3S17B 1LTTD 1ZKOA 3X3NA 3Q6SA 2F0SA 2AQ1B 1STNA 3NPPA 4RHSA 1WTXA 4RGTA 1SFOB 4DU9A 2F4IA 3J81E 2ZXPA 1SNCA 1UAPA 2EJGC 2SEBD 1MSGA 3C1EA 3VR2A 1G6ZA 3NWSA 2M00A 3IKJA 3ND8A 4OO1I 1EY8A 2TSSA 3IL8A 1S5BD 2AWOA 1PRTD 2JP1A 1IKLA 4HSPA 4O1NA 2QEJC 3TMEA 2I46A 3HRZC 5G3LF 3OIPA 5BN3A 5NUCA 1IKMA 1TT2A 1I6VC 2BDNA 1UUPA 2VXWA 3S1RB 2EPBA 4KJNA 5I2XA 3MFGA 2KHSA 4FNFA 1VCIA 3J80L 3SK8A 1BDOA 1HFNA 4N9TA 2HUGA 1Q8IA 2D9UA 2IX1A 1LTID 4BY1B 3K6OA 3T53B 2K05A 1ZYRC 3D3RA 3DXJC 3HS0C 3MA2B 4A3GB 2VB3X 3ONAB 5CGKA 3A8IE 2FINB 4K5XA 1HRJA 4YIJA 1TIID 5K5PA 1STGA 5EQ0A 1ZEQX 2EYOA 3MZ5A 4IURA 1RTNA 2KQ3A 3D8GA 3LNNA 3D4DA 1U4MA 5FKAC 4QCLA 2MJ8A 2WV6D 1GJXA 5IGBA 3C46A 5JEAJ 1YNNC 2J0TD 5KRUA 2F3WA 3FKIB 4EVOA 3K59A 2R7ZB 4HSVA 4IUPA 3K5MA 1V1OA 1WCMB 4Q0FA 2F0MA 1GUOA 2JEBI 3ERQA 4FXKC 2JE6I 1HQMC 3GO5A 2PZWA 2O2LD 4NW2A 3P1HA 4MHEA 1H9MA 5JOBA 1EOTA 3Q23A 2EYLA 2N55A 5FOBB 1TVXA 2A6HD 4XTCS 4XQQA 4NDXA 2OEOA 1NAPA 2NTSA 2IJ0A 2DNCA 1V1PA 4M1UB 5CV5A 2EOTA 1WD1A 2SNSA 4KV6A 2Q8IB 2X69A 1LO5D 1B9NA 2A69D 4DK0A 1WTOA 4R9WA 2RSNA 1STAA 1SYFA 2CVRA 4DXFA 1QG7A 1TKWB 2B8GA 1MBYA 1B1ZA 2K33A 2KEDA 2CW0D 1JOOA 1FD7D 4O42A 4OO1G 3S14B 5KGUA 2NBFA 1S5FD 4K14A 3M3YB 1LT4D 3H94A 3TSSA 1IW7C 3CKIB 4FF1A 1FNUA 2EYHA 3HP3A 2JSOA 1AZQA 1PRTB 1G91A 2M9VA 3M7NA 4IFDJ 4JBWA 1PZKD 2JA5B 3U9OA 4DA2A 2BA0A 1WTWA 3I70A 1JICA 5KIXA 1EYDA 3MTSA 4K5VA 1Z47A 1SNDA 3I3CA 2PQEA 4TKOB 1EIHA 1LTBD 1J9OA 1STHA 4KHZA 1H9RA 1XX8A 5A2QE 5E1FA 2BCOA 4BWGB 2EDGA 2DN8A 3JAME 5IGEA 3K57A 1UNSA 2PW5A 1BCPB 5CC4A 1DOLA 2XSCA 3BVMA 3VA5A 4S3SA 1VF7A 1EEFD 3N52A 1PTOB 4FYDA 4H0LC 4HR7B 4I65A 3K0YA 1CZWA 2JYOA 1O7YA 5FLXL 1CHQD 3MXNA 4ULLA 1GUTA 2VB2X 3SVMA 2B2WC 2A6HC 2AWNA 4A3EB 5CORA 1EQTA 3K5LA 1F77A 1LT5D 3K5NA 3D4RA 2SNMA 5CV4A 5DEHA 2WKDA 1SYGA 2TMPA 4ZRZA 1SJED 5E4WC 2MPMA 2AQ3B 4IALA 3SR1A 1F9PA 3BVZA 1ENCA 1TY2A 1HA6A 4XT3B 2EY2A 3GTJB 1O7ZA 3HZXA 3RZDB 2LY7A 2WP8J 3MEHA 2B63B 1DZ1A 3KLRA 4DFAA 4ILWA 2PYKA 2F0PA 4J8QA 4ZKCB 3EQLC 4C56C 3QO2A 2PZTA 2B2WA 3QG1A 3OPOA 4RHRA 4K2KA 1D5XC 3E6ZX 4DK1A 1SYEA 4IUQA 1IYVA 1B3AA 1RKNA 3GTKB 1RCVD 4ID6A 3PIP3 5J1ZA 5EKLA 3M4OB 1LT3D 1CM9A 5C0XH 3GP7A 1ONLA 4PNYA 5IT9E 1HHVA 5M3MB 3V96A 4WFN3 1CZGA 1Y69U 3PUXA 1GUNA 4ZYSA 1G291 2PO4A 4FP5D 1D1IA 4A3MB 4M8AA 2QDBA 1RJTA 1DJRD 1Z7TA 2FJ2A 2QCPX 3A7AB 1KABA 5JPMC 3KF8A 1GHJA 1VMCA 1D6EC 1EWCA 2IWHA 3MFYA 3EFXD 1BOSA 3OMCA 3PUYA 1M8AA 2K1BA 1JWMD 3MXGA 1CHPD 3RMHA 2L12A 1FYCA 3DWAA 1WTQA 5I9OA 3SK6A 3WOFA 3PUWA 1JB3A 2WKCA 4DN4M 5G3LD 1SAPA 1D5ZC 3V05A 2X6GA 2AQ2B 1AW7A 3S9WA 1Z6HA 4KJOA 5K36H 2Q8RE 2SDFA 3OIQA 3I73A 3R8BA 1CK1A 4R8NA 2H4OA 2HDLA 3K7AB 4HMJA 3URYA 3VR5A 1VMPA 1ZYRD 2F0NA 4FXDA 5KNBA 3VYRA 1PLFA 2JA6B 3P7JA 1TQOA 3SE0A 3TDQA 4B9XA 3NUCA 4UAIA 1G8ZD 1MD2D 1FGBD 2B2VC 2QILA 1SNPA 1LACA 1Q1BA 2NVQB 2SOBA 2F1MA 1B9MA 1S5DD 1XTCD 1SYCA 2A73B 1SEBD 1TWAB 1KNAA 2IW3A 4CJ1B 4RCNA 5C3EB 3FPPA 4KKUA 1EYAA 1YNND 2F0DA 3SEBA 2O5JC 3HKZB 3S2HB 5J22A 4DGZA 1B2TA 1BO0A 2Y0SB 1KLUD 4IUNA 3FMCA 2AUJD 4KN7C 4CKCA 1R4QB 4CKBA 2A6EC 5CV8A 1B53A 2EYFA 2F0GA 4RKLA 4PMWA 2K28A 3LWUA 2NVXB 2WIIB 1Q12A 3AMUA 3KBGA 5EKKA 4P2CB 4A93B 3H0GB 2B2VA 4U673 2L4NA 3BDCA 4HN7A 3A8KE 5I4DA 3A56A 2NUCA 4RCOA 1RDPD 3AU7A 5JVG3 3TN2A 2KOLA 3R2IA 2NYZD 3R2TA 2F0QA 1STYA 1HA5A 4I7ZC 2EYJA 4LMQD 1JWSD 2RDGA 3KLSA 2K04A 4BS9A 3N6RA 3BS1A 1TS2A 1GUGA 3CU7A 1TR5A 3GTMB 1JE4A 4XDXA 5CBAE 1Q1EA 3D31A 5KYIA 3K5OA 5JEAH 2XRQD 1STEA 1RF2D 1PZID 1I3QB 1KDCA 2N88A 1IW7D 1STBA 1DOKA 4IUVA 4DF7A 3C1FA 1I4HA 4K6LA 4R8IA 2XIWA 2EZVA 4FF3A 5TSSA 4ZKBB 1EY0A 3LX0A 4V0BA 2JA7B 5EBDA 1SYDA 1XYIA 3P20A 1RODA 3V2TA 1TWHB 1O7LA 1R4PB 3DWPA 1HFGA 1X3PA 2HDMA 4Y7NB 2FHTA 4PMBA 4G7HC 4PV1C 1K83B 2EY1A 4NP5A 3BYYB 3T56B 1IHZA 2X6LA 5CV9A 4KD4A 5M5XB 2D2CC 5EBCA 4DNTB 1WVLA 5CMDA 3T51B 1CQVA 1TS3A 3D6CA 3L7ZC 2WAQB 1A3VA 5EKIA 4X3TA 1DD2A 4IQZA 2E2JB 1PFNA 1X3QA 1U4RA 3TZUA 1C48A 1EFID 3HG9A 5E4XA 1A3TA 5KNDA 4C3HG 3E0JA 1RTOA 3U9SA 3RLFA 4ME5A 1F2LA 2BOSA 5EPJA 3VR3A 1WTPA 1EL0A 1KAAA 1EEID 2BA1A 2FMMA 1V1PB 1I50B 2B2YC 2RDFA 2KVMA 5T1GA 4CJ2C 3FVQA 3EA6A 1V43A 4IFDH 4BBSB 1F2YA 1MGSA 1Y1WB 2LS01 4X3UA 3FPUB 1OXTA 1HTPA 2CQAA 2B8FA 2RVLA 1CI3M 1SMYD 3PO3B 1QCBD 1L0XB 1CA6A 3DEOA 1A15A 4F88A 3ITPA 5C0XI 1E2VA 5C5MA 1SSOA 1VF5C 3MXUA 4A3BB 4J1MA 2B2YA 3J80E 2F3VA 3DMUA 2NWGA 2J7ZA 2F0UA 1SXTA 2HQEA 4TSSA 2E76C 1Q3LA 2DY8A 1PTOC 3NK9A 3T13A 3PV0A 3SK4A 4FF4A 1LV9A 3CHBD 3WDNA 4FVMA 4LK1C 1M4VA 4G7OC 5KEEA 1HUMA 3NQIA 2NZ1D 3NTIA 2YU9B 1F2ZA 1H9SA 3NSWA 4MN3A 1PFBA 2RBMA 2EYPA 3GQBA 3W2DA 1KNEA 3CRLC 1E2WA 1ENAA 4LJZC 3K58A 1B50A 4L63B 1PZJD 4QB4A 4ZQ3A 1CTMA 5C4JB 4HCSA 3J7YW 3Q22A 1UEAB 4L8JA 3NBHA 1KLGD 4C3JG 3NBIA 3QJYA 4KI0A 3BG3A 1EY9A 3FEWX 1NR2A 1HQRD 4DXGA 3MAQA 1DM0B 2K5DA 2Q8TA 3OMGA 3OHXC 3KLSX 5IODA 3S16B 1DXMA 3UI2A 2R6GA 4RGMA 2V4DA 5IGFA 1F9RA 3DEPA 1IL8A 3M85A 4IN3A 1NR4A 1SMYC 5ELCA 2EYMA 3IFTA 2BDOA 3HOZB 2KEEA 3RD4A 1AN8A 4C3HB 4A3KB 3HOYB 1MI2A 1FR3A 1F2MA 5LL6X 3LWEA 3ZYYX 3E5SA 3J7AF 1LT6D 5HGTA 3TZDA 4DAPA 2A68D 5IIFA 5JJZA 1ICWA 1B4OA 3RZOB 3GTQB 3S1QB 3VR4A 2IX3A 1R9TB 1GUSA 1Q90A 1EYCA 1I4XA 4XYOA 5C6AA 3HOXB 2PMZB 3I72A 2EJFC 3A55A 1GXDC 2A6ED 4QF4A 3I8ZA 5JVH3 4E6IA 2JA8B 4KK7A 4XXEA 2HCCA 1X32A 4OIJA 3QOJA 1NUCA 4QUCA 2JXMB 4C1NI 1PDQA 3MWYW 4QIWB 2VUMB 3A54A 2VNUD 2ENBA 1U4LA 2A74C 3O13A 4HMIA 4A3FB 5C0XG 4IZ8A 5I9PA 1I6HB 2Z4IA 2L11A 3I90A 1OXUA 2XVSA 4DAVA 4BA2I 1BNZA 3H3VC 1K8OA 1Y8OB 1TS5A 1U9RA 5KYLA 1JR0D 2L5TA 2NB0A 1I4GA 1ILPA 5C44B 1I4PA 4WRDA 4AYBB 5D14A 5E3FA 2JEAI 5HURA 3QOLA 2EJMA 2NVYB 4CBVA 5IGGA 4ABNA 4RAUC 2YYZA 3RUZA 3MC0B 1PFMA 1EWHA 2NN6H 3TP8A 3J7AV 2B2TC 4K8IA 3NHHA 2I07B 4XT1B 1SDFA 2K01A 1D5MC 1OO9B 2XN9C 4G57A 1SE3A 5FLXE 3A8JE 1QJOA 5DM63 5CV7A 1ET9A 3BYTB 5LL6S 4OHJA 3SXHA 3NWTA 3C3LA 1GHKA 1FNVA 4NMZA 4TRDA 1BUVT 1U4PA 1W6JA 4U68A 5K36G 1HUNA 2QF7A 1QOHA 2E74C 2XRSD 3S15B 4BBRB 1EQVA 3IAYA 1LLRD 2EY5A 2D5DA 4KHVA 4ZUJA 2A68C 3EJIA 2IPKD 3G6JB 4C3JB 1O80A 3DHQA 2OT2A 2B2TA 1JQYD 2K5QA 2EXZA 2B2UC 3D4WA 1JOQA 2CHBD 5T1IA 1ILQA 1T5XD 3I91A 4IUUA 4RWSC 1YNJC 1DOMA 4G7ZC 2PCFB 2Z8LA 5M5WB 1QNKA 4OGQC 1TWGB 1S4ZA 1D1KA 3H91A 4RGOS 3WOEA 4IFDI 1CQFA 4XQJA 2KCNA 4FF2A 1FNWA 2NVTB 4QMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K5W A;  1KDB A;  4RKB A;  2SNS A;  5EKL A;  3SK4 A;  3T13 A;  4B9W A;  4KV6 A;  4B9X A;  3NUC A;  5F2D A;  4ME5 A;  3E5S A;  4G57 A;  4EQO A;  5J39 A;  1A3U A;  4I65 A;  2RKS A;  2F0E A;  4KTA A;  4PNY A;  4F7X A;  4ZUI A;  4WOR A;  5C4H A;  5C4Z A;  1SYB A;  5CV6 A;  1EY4 A;  1TR5 A;  5CGK A;  1JOR A;  5CV7 A;  5HGT A;  5ISR A;  2O4X A;  4EQN A;  1KAA A;  4K5X A;  1SNP A;  5KEE A;  5IIF A;  1EZ8 A;  1SNM A;  1STA A;  4YIJ A;  2SOB A;  1SYF A;  4K8J A;  5KYI A;  3OSO A;  4PMC A;  4EQP A;  1KDA A;  4S3S A;  1JOK A;  1SYC A;  1F2Z A;  2F0S A;  4DF7 A;  1STG A;  3SXH A;  4KY6 A;  5K5P A;  2RDF A;  1STN A;  1KDC A;  1EYC A;  2EYO A;  4DU9 A;  1STB A;  2F0O A;  3MZ5 A;  2QDB A;  5IGC A;  5C6A A;  3PMF A;  1JOO A;  1EYA A;  2RBM A;  3C1F A;  1II3 A;  3HEJ A;  2EYP A;  4NMZ A;  1F2Y A;  2KQ3 A;  2F0I A;  1NSN S;  3D8G A;  4TRD A;  2F0D A;  3D4D A;  5KGU A;  3TP7 A;  1SNC A;  4K14 A;  2SNM A;  5IGB A;  1AEX A;  5J22 A;  1ENA A;  4QF4 A;  5CV4 A;  3C1E A;  5DEH A;  4DGZ A;  4E6I A;  1EY0 A;  1KAB A;  3LX0 A;  2OXP A;  5C5L A;  4IUN A;  2F0K A;  1EQV A;  2EYH A;  1SYG A;  2M00 A;  3NQT A;  4NKL A;  5CV8 A;  1EY8 A;  5EGT A;  2PZU A;  4QB4 A;  5IOC A;  2EY5 A;  2EYF A;  2F3W A;  2F0G A;  4K6D A;  4RKL A;  1SYD A;  3QOJ A;  1EZ6 A;  4ZQ3 A;  5I6Y A;  3V2T A;  4KHV A;  4EVO A;  4IAL A;  4ZUJ A;  2F0W A;  1NUC A;  3SR1 A;  5C3W A;  4ODG A;  3MXP A;  2F0F A;  3EJI A;  4HTH A;  1EY5 A;  2PW7 A;  3U9O A;  1ENC A;  3OMC A;  1A2T A;  2F0M A;  3DHQ A;  3ERO A;  3TP6 A;  3ERQ A;  3MVV A;  2EY2 A;  4OL7 A;  2ENB A;  3TME A;  4PMB A;  4HMI A;  5CR3 A;  5DAU A;  3HZX A;  4IZ8 A;  2EY1 A;  5I9P A;  2EXZ A;  3H6M A;  4NP5 A;  1EY9 A;  2F0V A;  3D4W A;  3MEH A;  1JOQ A;  3SK5 A;  5EKK A;  4DFA A;  5I9O A;  5KIX A;  1IHZ A;  3SK6 A;  1EYD A;  5I6W A;  5CV9 A;  4K5V A;  2PYK A;  2PZW A;  5CV5 A;  5NUC A;  1TT2 A;  4KD4 A;  3P75 A;  3R3O A;  3OMG A;  2F0P A;  1SND A;  3ITP A;  5KYL A;  1U9R A;  3EVQ A;  5IOD A;  3P1H A;  3NP8 A;  2PQE A;  3BDC A;  5C5M A;  2EY6 A;  4F8M A;  1A2U A;  5JAV A;  2PZT A;  5JOB A;  3MHB A;  1STH A;  2F0J A;  2EYL A;  2NUC A;  4J1M A;  3D6C A;  4WRD A;  4KJN A;  5C3X A;  1EY6 A;  1A3V A;  2F0L A;  4KJO A;  3S9W A;  5E3F A;  5HUR A;  3QOL A;  5IGF A;  5M9O A;  2F0Q A;  3NXW A;  2F0H A;  2F3V A;  3T16 A;  3QB3 A;  5E1F A;  3DMU A;  1SNQ A;  4K2K A;  2KHS A;  2OF1 A;  4NDX A;  2F0U A;  1STY A;  4KY7 A;  1SYE A;  2F0T A;  4R8N A;  5IGG A;  2HQE A;  5KRU A;  3SK8 A;  2EYJ A;  4HMJ A;  3TP5 A;  5IGE A;  4J6H A;  4LAA A;  2LKV A;  2PW5 A;  3RUZ A;  2OEO A;  3BDL A;  4K2L A;  3OWF A;  4MIU A;  4N9T A;  2EYM A;  4N9P A;  1RKN A;  1SNO A;  2F0N A;  1EY7 A;  5CC4 A;  3NK9 A;  1A3T A;  2WAC A;  3SHL A;  4KY5 A;  4KD3 A;  5IGD A;  4QMG A;  3TP8 A;  4H7B A;  4K8I A;  1F2M A;  4ID6 A;  3VA5 A;  1TQO A;  5J1Z A;  3NHH A; 
#chains in the Genus database with same CATH topology
 1TS4 A;  3J81 i;  2JA5 H;  3BZD B;  3CXC A;  4FDB A;  4DV7 L;  1CA5 A;  5BN5 A;  3PF5 A;  3NTK A;  3LGJ A;  4KTA A;  1KXL A;  3K80 C;  4L5Q A;  3CD6 A;  3CME A;  4EQN A;  5CYU A;  4DUZ L;  2UUB L;  3CRK C;  3G7L A;  5EPK A;  4DNR B;  3HGB A;  4DUY Q;  4B3T L;  4XYQ A;  3NEL A;  3HOU B;  3PO2 B;  2B2U A;  2J4X A;  4KY6 A;  4GOP A;  4GNX A;  2H1E A;  5IYC H;  1OXX K;  3GTL B;  2EVB A;  2IT1 A;  1YZ6 A;  2HIX A;  2Z1C A;  3TP7 A;  2DGY A;  1A6X A;  3M4Q A;  5EAY A;  2ZJQ A;  5BR8 Q;  3VR6 A;  3AFP A;  3HOV B;  1EU4 A;  2KJX A;  2F0K A;  5IYB H;  3NQT A;  1TWF B;  2QKI C;  3CCV A;  1HTL D;  2K5W A;  1GUW A;  4HED A;  1BR9 A;  1Y1V B;  4H02 A;  2PW7 A;  1G51 A;  3STB D;  1HNX Q;  4YWK A;  1PTO H;  1A2T A;  3TP6 A;  1K8M A;  3I4N B;  1SE4 A;  2RSO A;  3PUZ A;  2F0V A;  1CSQ A;  2ID0 A;  2PI2 E;  3J80 c;  4Z9C B;  5I6W A;  1HCZ A;  3EN2 A;  2RQX A;  4ZCK A;  1UE5 A;  5JEA G;  2GVB A;  4DV5 Q;  2ZXO A;  1K73 C;  1BCP D;  4A3E H;  5JAV A;  4LF8 L;  1PH2 A;  1KC8 C;  2NTT A;  2BE5 D;  3M7G A;  2D62 A;  1PTO D;  2WB1 G;  4YY3 L;  2GA4 B;  4I7A A;  5A2Q L;  3HOW G;  1CUK A;  4J6H A;  4YCU A;  1RL2 A;  2QGQ A;  1HXY D;  4NXN L;  4N9P A;  2E2I B;  3JAM L;  3BDO A;  3AYH B;  2IX0 A;  4BA1 I;  4PQX A;  2R61 A;  1E0B A;  3RLO A;  4KN4 C;  4RKB A;  1KDB A;  4A3E G;  2L1B A;  1SBB B;  1OXV A;  5J39 A;  5C4Z A;  2F0E A;  3GTJ H;  4Q5V A;  2MP1 A;  3X3M A;  3RZD H;  1J8I A;  2EIF A;  1JCK B;  3AB9 A;  2B63 H;  3Q0A A;  1EZ8 A;  3OSO A;  4PMC A;  2WFW A;  4EGV A;  4EQP A;  1KDA A;  2JK8 A;  1ICF B;  4ZK9 B;  4FXG C;  3NE5 B;  2ICE C;  2K32 A;  1WTV A;  5IGC A;  1JT8 A;  4DR4 Q;  2PNR C;  2F0I A;  1NSN S;  1D2B A;  3KK7 A;  4B08 A;  1PH6 A;  1E24 A;  2A1A A;  3VYS A;  3A0J A;  3ZJY C;  1PRT F;  2R7D A;  1MSH A;  2R93 B;  3F2B A;  4PZ6 A;  2YTX A;  5C5L A;  2B63 G;  1V8Q A;  4NKL A;  2UXC Q;  5EGT A;  1WTR A;  5LMU L;  4F87 A;  3GTK H;  1U0L A;  1CKN B;  5KNC A;  2KEC A;  4CKE A;  2F0F A;  1VQ8 A;  3S1N B;  3VYT A;  1GD7 A;  1KRT A;  3BVG A;  3M4O H;  1GOZ A;  1AP0 A;  4DUY L;  1N32 Q;  4BY7 B;  4ALP A;  5IYD G;  5FLM G;  1TWC B;  2ZXR A;  2K6A A;  1TY0 A;  1VDZ A;  1W2B A;  5DAU A;  3CF5 A;  3DUZ A;  2R92 B;  5M3M H;  1FGU A;  1NMG A;  1PRT C;  5AFW A;  1VQN A;  3BZK A;  1WD0 A;  2DY7 A;  3JC6 6;  1N8R C;  4X65 Q;  5EPL A;  3R3O A;  1B3Q A;  1PYW D;  1BF4 A;  4QQB X;  3BU2 A;  5BR8 L;  2M2L A;  4A3M H;  2L9H A;  4DV6 Q;  3GTP B;  4OO1 H;  1I4Q A;  2F0J A;  5EJW A;  4X3S A;  4C2M B;  5DNF A;  4IFD G;  4JI0 Q;  3OW7 A;  1JJ2 A;  2F0H A;  2PPB C;  1BCP F;  3I4M B;  2K14 A;  2OF1 A;  4KY7 A;  2F0T A;  1SE2 A;  2E2D C;  4JI4 Q;  4LAA A;  1S5E D;  1XXG A;  4YHH L;  1I4R A;  4DV3 Q;  1QVG A;  5JJI A;  1PTO F;  1EY7 A;  5DM7 3;  1VQB A;  4L6T B;  2MHV A;  1BQQ T;  4G4K A;  2G5D A;  1X9N A;  1A3U A;  2WIN B;  2A5H A;  2C35 B;  2KUM A;  1SYB A;  1LTA D;  5ISR A;  1BCP C;  5GAG C;  5IT9 L;  1NJI C;  1QB5 D;  2F03 A;  4A3D G;  3FDT A;  3PIO 3;  1JOK A;  3D6W A;  5GRO A;  2BE5 C;  2UUC Q;  2A19 A;  4CGY B;  2DNE A;  4UP7 A;  2RDH A;  1E2Z A;  1PV4 A;  2K50 A;  2L55 A;  3PMF A;  1VQH A;  1II3 A;  3KBX A;  2ZJP A;  1KAW A;  3J80 i;  4X62 L;  3PUV A;  1B70 B;  2N78 A;  2R3Z A;  2MGS A;  3HFZ B;  4UY8 C;  1G6P A;  3UE1 A;  1AEX A;  4BXX H;  4X3K A;  2UXB Q;  4KLK A;  3K7A H;  1XTD A;  2CWP A;  1VQO A;  1CT1 D;  1LAB A;  1GKH A;  5HY6 A;  5IOC A;  2QW7 A;  5LHY 1;  1H9S B;  3RN2 A;  2JA6 H;  2G9H D;  4ODG A;  4A3J B;  3MXP A;  1LUZ A;  4A3C G;  2IL8 A;  3W3A A;  1AZP A;  5M5Y B;  1H9K A;  3KOJ A;  1EOV A;  1WYD A;  2HCI A;  4OIK A;  4HCE A;  1VQF A;  4FO2 A;  3A7L A;  3SK5 A;  5D65 A;  1LYL A;  2NN6 I;  4DV1 Q;  2ZT9 C;  1H9J A;  4P75 A;  2NVQ H;  1Y8P B;  2Z0S A;  3P75 A;  4IPH A;  3CCR A;  1N34 Q;  3NP8 A;  4XIG S;  1TWA H;  3CCE A;  1CFM A;  4RMF A;  1PFS A;  1A2U A;  4A3I G;  4JI3 L;  5C3E H;  4ZLT F;  3NBH B;  1XNQ L;  1X3G A;  5LMN W;  2UXC L;  3M4Y A;  5C3X A;  1EY6 A;  2F0L A;  2WB1 B;  2MO1 A;  4JK1 C;  3DWQ A;  3T16 A;  3QB3 A;  3S2H H;  1BXT A;  3DM1 A;  5FLX c;  5M3F B;  3HOW B;  2B39 A;  2L0C A;  1LTG D;  2NZH A;  4IOC A;  1N32 L;  5A35 A;  2LKV A;  3GV3 A;  4DNI A;  2N3S A;  3BDL A;  4C3I G;  3OWF A;  4MIU A;  5C4X G;  2KEN A;  1EIG A;  4POG A;  2Q2U A;  2WAC A;  4KY5 A;  3Q8D A;  4DK3 C;  2KCC A;  3L3O C;  4H7B A;  1J6Q A;  2HT1 A;  2EE1 A;  4WJW A;  1NY4 A;  1LTR D;  1O78 A;  2FFK B;  5F2D A;  4X65 L;  5C3E G;  2NVX H;  3CQZ B;  5CBE E;  2RKS A;  4F7X A;  1ZXT A;  4WOR A;  5C4H A;  3T1Y Q;  2Q2T A;  3GTO B;  2RA4 A;  2OTL A;  3OYY A;  2RHS B;  3H09 A;  2E5L L;  3I4L A;  3GV6 A;  1SNM A;  3J7Z C;  4A93 H;  3H0G H;  5FO9 B;  3IFD A;  2Y0S G;  4K8J A;  1SMX A;  2G9D A;  1L0W A;  2A69 C;  4GN5 A;  4LWC A;  5D3D A;  3F2D A;  2XWJ B;  1IBM L;  1K3B C;  4X6A H;  4DV3 L;  4GZY C;  2LXJ A;  2ICI A;  1OXS C;  2OQK A;  1G2S A;  1Y8N B;  4NXM Q;  3VA7 A;  5L37 A;  1SJH D;  1XPO A;  5GAH C;  1QWY A;  2OXP A;  2CW0 C;  2C9O A;  1QZH A;  1BBX C;  3GTG B;  4K0K Q;  2E75 C;  2PZU A;  1XJV A;  4K6D A;  4RH6 A;  5JPN C;  2FMC A;  4KKT A;  4R4I A;  2Z4H A;  1B8A A;  2F0W A;  3G6E A;  1F9S A;  4HTH A;  4DAM A;  1XMQ L;  3ERO A;  1RHP A;  3F2U A;  1UE7 A;  3MVV A;  3L9A X;  2UUC L;  4IUT A;  1W6K A;  5CR3 A;  3GTM H;  1C4Q A;  2MUY A;  1YNJ D;  2EQS A;  3J81 L;  5FO8 B;  1JWU D;  5IY0 A;  3SDZ A;  3ND9 A;  3I7F A;  1ESR A;  5BN4 A;  2OQ0 A;  3QIA A;  3C2P A;  1XWE A;  2K5V A;  3EVQ A;  1QE6 A;  3KUP A;  4UDU C;  1UWV A;  2UXB L;  1HZA A;  4RG1 A;  1I3Q H;  2EY6 A;  4F8M A;  3MHB A;  3S2D B;  1S5C D;  2O5I C;  2OCE A;  4IJL A;  3I4N H;  4DV4 L;  1Q7Y C;  1HPC A;  4GKJ Q;  2K7V A;  5FK9 C;  4QY7 A;  3TP5 A;  2JA7 H;  4H13 C;  4ZAI A;  1YI2 A;  1SNO A;  2PQA A;  1TWH H;  1PXU A;  2C5C A;  3SHL A;  5IGD A;  1KRS A;  1EYG A;  4OL7 A;  2B3G A;  3PGZ A;  1PMR A;  1DYQ A;  4BY1 G;  4B9W A;  3Q24 A;  1DCZ A;  5FO7 B;  4TQU S;  3CC4 A;  1ENF A;  4C1N K;  4X64 Q;  1JC7 A;  4Y7N H;  1YJN A;  4B3T Q;  1JMC A;  1K83 H;  1QNU A;  4RFB A;  4CJ0 B;  4A3G G;  1PH7 A;  2O4X A;  1Y14 B;  1LTS D;  3BZC A;  4QUF A;  4A3D B;  3TBI B;  1AFP A;  3CCS A;  4V19 0;  3GD7 A;  2K03 A;  5M5X H;  1F9Q A;  5IP9 H;  4HAE A;  1ESF A;  1P16 A;  2IHF A;  1G2T A;  1PYS B;  1NCV A;  2F0O A;  3TS2 A;  3HEJ A;  5C0X J;  4CHT B;  1B44 D;  2JJQ A;  4KMU C;  1QIL A;  3UDG A;  2E2H B;  5D3I B;  1EU3 A;  1C8C A;  4XQN A;  2KA7 A;  1L0Y B;  3OOC A;  3S1M B;  2E2J H;  4J15 A;  3F8T A;  3VYU A;  1PH4 A;  5I6Y A;  1EZ6 A;  4IPC A;  3ULJ A;  2XWB B;  2LMC B;  5C3W A;  5ELD A;  3FKI G;  2AUK A;  5I2Y A;  3F2C A;  3E3X A;  2L15 A;  2NN6 G;  2R7Z G;  1EY5 A;  3CCJ A;  4JOI C;  4H44 C;  1VQJ A;  1WCM G;  1SN8 A;  3M4P A;  3CCM A;  2WAQ G;  1RD9 D;  3H6M A;  4DAY A;  2B29 A;  4KKS A;  4NXM L;  4A3L H;  1I50 H;  4RGN A;  4A3I B;  2Y0S E;  3T4A C;  1DON A;  1N36 L;  1NE3 A;  3CPF A;  3QWN A;  4BBS H;  4L5T A;  4K0K L;  3R93 A;  1TU2 B;  1Y1W H;  5COY A;  5M9O A;  4HIM A;  3NXW A;  1SNQ A;  1VQL A;  1IYU A;  3T1H Q;  1KTK A;  4C3I B;  1C7Y A;  2ATW A;  5C4X B;  1Z9F A;  4K2L A;  2GN5 A;  4JG2 A;  4A3L G;  3OW2 A;  4RA8 A;  4KD3 A;  1T5E A;  4ZUI A;  3PIO A;  2IY5 B;  4K5W A;  1ML0 D;  5ELE A;  5ELF A;  2XNA C;  3NTH A;  1ET6 A;  1EQQ A;  2K75 A;  5ELB A;  4EQO A;  3PO3 H;  1NTG A;  1K8A C;  5CV6 A;  1EY4 A;  4JBM A;  1JOR A;  3FRP B;  4JOI A;  3OWE B;  2LFN A;  3S17 B;  1LTT D;  3HKS A;  1ZKO A;  3X3N A;  4LF6 Q;  3Q6S A;  2F0S A;  2AQ1 B;  3OTO L;  4GKJ L;  1STN A;  3NPP A;  4RHS A;  1WTX A;  4RGT A;  1SFO B;  4DU9 A;  2F4I A;  4A3B H;  3J81 E;  1L1O C;  3DLL A;  2ZXP A;  1SNC A;  4UP9 A;  1UAP A;  2EJG C;  5LMU Q;  1HR0 L;  1VQM A;  4AH6 A;  2SEB D;  1MSG A;  3C1E A;  3VR2 A;  1G6Z A;  3NWS A;  2M00 A;  1Q46 A;  3IKJ A;  3ND8 A;  4X64 L;  4OO1 I;  1EY8 A;  4P71 A;  2IHE A;  4GOP B;  2TSS A;  4GNX B;  1EIY B;  3IL8 A;  1S5B D;  4OWT B;  1EQR A;  2AWO A;  1IBK L;  1PRT D;  2JP1 A;  1IKL A;  4A3B G;  4HSP A;  2JA5 G;  4O1N A;  2QEJ C;  3TME A;  2I46 A;  3HRZ C;  5G3L F;  3OIP A;  5BN3 A;  4LUO A;  1M90 C;  5NUC A;  1IKM A;  1TT2 A;  2AHO B;  1I6V C;  2YU9 H;  2BDN A;  1ASZ A;  1UUP A;  1VS0 A;  4AQY L;  4A3J H;  2VXW A;  4ME3 A;  4JI7 L;  4HIK A;  3S1R B;  2EPB A;  1MKH A;  4KJN A;  4P73 A;  5IYC G;  1LTL A;  2F4V Q;  3ER0 A;  5I2X A;  2H5X A;  3MFG A;  4YHH Q;  1AH9 A;  2KHS A;  1L1O A;  4FNF A;  1VCI A;  3J80 L;  3SK8 A;  1BDO A;  1HFN A;  2LXK A;  3E9H A;  4N9T A;  1TXY A;  2HUG A;  1Q8I A;  5IYB G;  3PF4 A;  2D9U A;  2IX1 A;  1QVC A;  1LTI D;  2FXQ A;  3RR5 A;  4BY1 B;  5C4J H;  3K6O A;  3T53 B;  2K05 A;  1H95 A;  1ZYR C;  3D3R A;  3DXJ C;  3HS0 C;  3MA2 B;  4A3G B;  2VB3 X;  3CW2 C;  5GQO A;  3ONA B;  2OWO A;  5CGK A;  3A8I E;  2FIN B;  4K5X A;  2WAQ E;  1VQ6 A;  1HRJ A;  4YIJ A;  4OEM B;  1TII D;  5K5P A;  4X62 Q;  1STG A;  5EQ0 A;  1C9O A;  3T1H L;  5AJ3 L;  1UE1 A;  3S16 H;  4LFB L;  1ZEQ X;  2EYO A;  3MZ5 A;  4IUR A;  1RTN A;  2KQ3 A;  3D8G A;  3LNN A;  3D4D A;  1U4M A;  1E7Z A;  5FKA C;  4QCL A;  2MJ8 A;  2WV6 D;  1K0R A;  4LF4 Q;  1GJX A;  5IGB A;  1EFW A;  4DR7 L;  3C46 A;  5JEA J;  1YNN C;  2VL6 A;  2J0T D;  1EIF A;  5KRU A;  2F3W A;  3FKI B;  3HOZ H;  3A74 A;  4EVO A;  4C3H H;  3CCL A;  4A3K H;  3HOY H;  3K59 A;  2R7Z B;  4HSV A;  4P72 A;  4IUP A;  3K5M A;  4KHP L;  1V1O A;  1WCM B;  4Q0F A;  2F0M A;  4LF6 L;  1GUO A;  2JEB I;  3ERQ A;  1HZB A;  1XMO Q;  4FXK C;  2JE6 I;  1HQM C;  3H15 A;  2CFM A;  3RZO H;  3GTQ H;  3GO5 A;  2PZW A;  4JI3 Q;  3S1Q H;  2O2L D;  4NW2 A;  1IBL Q;  1XNQ Q;  1WOC A;  5FJ8 H;  4LFA Q;  3P1H A;  1YEZ A;  1R9T H;  3HOZ G;  1JE5 A;  4MHE A;  1FJG Q;  4A3K G;  3HOY G;  1H9M A;  5JOB A;  1EOT A;  3Q23 A;  2EYL A;  2HD3 A;  5J3B A;  2N55 A;  3HOX H;  1YJW A;  5FOB B;  2I5H A;  1TVX A;  2A6H D;  4JI8 Q;  3TS0 A;  1Q8K A;  1EUJ A;  4XTC S;  4XQQ A;  1C0A A;  4NDX A;  2JA8 H;  2OEO A;  1NAP A;  2NTS A;  3NEN A;  2YTY A;  2IJ0 A;  3J7A 5;  2DNC A;  4JPB W;  1V1P A;  1ASY A;  4M1U B;  1CKN A;  2UU9 Q;  5CV5 A;  2EOT A;  1WD1 A;  2SNS A;  4KV6 A;  2E5L Q;  4DR6 Q;  2Q8I B;  2VUM H;  2X69 A;  3UDF A;  1LO5 D;  1B9N A;  2A69 D;  1HNW L;  4DK0 A;  4A3F H;  1WTO A;  3AEV A;  1UEB A;  1I6H H;  4R9W A;  2RSN A;  1PH8 A;  5M3M G;  1STA A;  1SYF A;  2F4V L;  1SR3 A;  1IBM Q;  2CVR A;  4DXF A;  1QG7 A;  1TKW B;  3U4Z A;  4LNQ A;  2B8G A;  1MBY A;  1B1Z A;  2K33 A;  2KED A;  4GKK Q;  5C44 H;  4A3M G;  1X6O A;  1JOO A;  2CW0 D;  1FD7 D;  4O42 A;  4OO1 G;  3S14 B;  2VUM G;  2CWA A;  4PZ7 A;  2NBF A;  5KGU A;  1S5F D;  4K14 A;  2QA4 A;  3M3Y B;  1LT4 D;  2NVY H;  3H94 A;  3TSS A;  1IW7 C;  1VQ5 A;  3CKI B;  4FF1 A;  1PH1 A;  1FNU A;  2EYH A;  3AFQ A;  3HP3 A;  3ICE A;  3CCQ A;  2JSO A;  1XMQ Q;  1FVI A;  3CMA A;  1PRT B;  1AZQ A;  2M9V A;  1G91 A;  3M7N A;  1VQK A;  4IFD J;  4JBW A;  1VQI A;  1YBY A;  1PZK D;  2JA5 B;  3U9O A;  1XPR A;  4DA2 A;  2BA0 A;  1WTW A;  1JJC B;  3I70 A;  2K5H A;  1JIC A;  5JJK A;  5KIX A;  1IL2 A;  1EYD A;  3MTS A;  4K5V A;  1Z47 A;  1SND A;  4LF4 L;  3I3C A;  2PQE A;  4DV4 Q;  4TKO B;  1EIH A;  1HH2 P;  1LTB D;  1J9O A;  1STH A;  3FP9 A;  4KHZ A;  1H9R A;  1XX8 A;  5A2Q E;  1FL0 A;  4R4C A;  5E1F A;  2BCO A;  4BWG B;  2EDG A;  2DN8 A;  1W3S A;  5GAD C;  3S15 H;  3JAM E;  4BBR H;  5IGE A;  4BXX G;  3K57 A;  1UNS A;  2PW5 A;  1BCP B;  1XMO L;  5CC4 A;  1DOL A;  2XSC A;  3BVM A;  4YWM A;  2VW9 A;  3VA5 A;  1Q82 C;  4S3S A;  1VF7 A;  1EEF D;  2JA6 G;  2QEX A;  4C3J H;  3N52 A;  4B3R Q;  1PTO B;  1IBL L;  3K0X A;  4FYD A;  4H0L C;  4HR7 B;  4I65 A;  4LFA L;  3K0Y A;  2HIV A;  1CZW A;  1FJG L;  2JYO A;  1O7Y A;  5FLX L;  1CHQ D;  3MXN A;  4ULL A;  1GUT A;  2VB2 X;  2HHH L;  3SVM A;  2B2W C;  4JI8 L;  2A6H C;  1I5F A;  3G48 A;  2AWN A;  3I2Z A;  4A3E B;  2ZTD A;  5COR A;  4GS3 A;  1S3O A;  1EQT A;  3K5L A;  3KDF A;  1F77 A;  1LT5 D;  4X66 L;  5M5W H;  3K5N A;  3D4R A;  4JBJ A;  2SNM A;  4NB3 A;  2UU9 L;  1TWG H;  5CV4 A;  5DEH A;  3HKZ G;  4DR6 L;  2WKD A;  1SYG A;  2TMP A;  4ZRZ A;  1SJE D;  5E4W C;  4JV5 Q;  2P5Z X;  2Q2H A;  2MPM A;  2AQ3 B;  4IAL A;  3SR1 A;  2NVT H;  1MJE A;  1F9P A;  3BVZ A;  1ENC A;  4HJ8 A;  1TY2 A;  4DV0 L;  1HA6 A;  4XT3 B;  2EY2 A;  1CKO A;  3GTJ B;  1O7Z A;  4GKK L;  3HZX A;  3RZD B;  2PMZ E;  2LY7 A;  4LF7 L;  2WP8 J;  3MEH A;  3ERS X;  2B63 B;  4CDE C;  3KLR A;  2ZJR A;  1DZ1 A;  1N36 Q;  2N8N A;  4DFA A;  4ILW A;  4B3S Q;  2PYK A;  5IWA L;  1WFQ A;  3HOU H;  4A93 G;  3PO2 H;  3H0G G;  2F0P A;  1JJG A;  4J8Q A;  3CC2 A;  2KCT A;  4ZKC B;  3EQL C;  4C56 C;  3QO2 A;  2PZT A;  3BJU A;  2B2W A;  3GTL H;  3QG1 A;  3OPO A;  3PQI A;  4RHR A;  4K2K A;  2HQL A;  1D5X C;  3E6Z X;  4OON A;  4DK1 A;  3HOV H;  1SYE A;  2RHQ B;  2AKW B;  1TWF H;  4IUQ A;  1PH3 A;  1IYV A;  1B3A A;  1RKN A;  3GTK B;  4JW0 A;  4MZ9 A;  4A75 A;  1VQE A;  1RCV D;  4ID6 A;  1Y1V H;  3PIP 3;  5J1Z A;  2RCF A;  5EKL A;  4WJ3 M;  3M4O B;  2GVA A;  1LT3 D;  2OTJ A;  1CM9 A;  5C0X H;  3GP7 A;  1ONL A;  4PNY A;  5IT9 E;  1HHV A;  2F52 A;  4UPA A;  4WJ4 A;  3OTO Q;  5M3M B;  4AYB E;  3E9I A;  3V96 A;  4WFN 3;  1CZG A;  1Y69 U;  3PUX A;  1GUN A;  4ZYS A;  2R7F A;  1A63 A;  2MQH A;  1G29 1;  2PQA B;  1PYB A;  2PO4 A;  1V1Q A;  4FP5 D;  1D1I A;  4A3M B;  2DUD A;  2KHI A;  4M8A A;  1CSP A;  1HR0 Q;  2QDB A;  2PNH A;  1HZC A;  1RJT A;  4DR2 Q;  1DJR D;  3I55 A;  1Z7T A;  2FJ2 A;  2QCP X;  3A7A B;  3I4N G;  1KAB A;  4B3R L;  1K0S A;  5JPM C;  1IBK Q;  4HIO A;  3KF8 A;  2E2I H;  1GHJ A;  1VMC A;  2JA7 G;  1T9H A;  1D6E C;  1EWC A;  2IWH A;  1XNR Q;  3MFY A;  3EFX D;  1BOS A;  3OMC A;  3PUY A;  1M8A A;  2K1B A;  1JWM D;  4GLA C;  3KF6 A;  1CHP D;  3MXG A;  3RMH A;  2L12 A;  2A8V A;  4JBK A;  1FYC A;  3DWA A;  1GM5 A;  1MIU A;  1B7Y B;  4AQY Q;  4R4Q A;  1WTQ A;  5I9O A;  3SK6 A;  3WOF A;  4JI7 Q;  3E0E A;  3PUW A;  1JB3 A;  4N8X 1;  3PCO B;  3K8A A;  1PHJ A;  2WKC A;  5IP9 G;  4DN4 M;  5G3L D;  1X3F A;  1SAP A;  1D5Z C;  2BH8 A;  3V05 A;  2X6G A;  4R4T A;  4JV5 L;  2AQ2 B;  1AW7 A;  2ZTC A;  3S9W A;  1Z6H A;  4KJO A;  4LF5 Q;  5K36 H;  2Q8R E;  5ELN A;  2SDF A;  4EQ5 A;  2K5N A;  3I73 A;  3OIQ A;  3R8B A;  2R93 H;  1CK1 A;  4DAY B;  4R8N A;  2H4O A;  2HDL A;  2Z9H A;  3K7A B;  1VQP A;  4HMJ A;  1VQ4 A;  3URY A;  2VQE Q;  4JC0 A;  3VR5 A;  1VMP A;  1ZYR D;  3HKZ E;  2F0N A;  4FXD A;  5KNB A;  3VYR A;  1PLF A;  2JA6 B;  3P7J A;  3S1N H;  1TQO A;  2NZO A;  4B3S L;  4IPG A;  3SE0 A;  3TDQ A;  3EBE A;  4B9X A;  3NUC A;  4BY7 H;  1TWC H;  4UAI A;  1KHI A;  4YCV A;  1G8Z D;  1MD2 D;  1BBU A;  1FGB D;  2B2V C;  2R92 H;  1IYJ B;  2QIL A;  1SNP A;  5AJ3 Q;  1LAC A;  4LFB Q;  2R93 G;  1Q1B A;  1MHW C;  2NVQ B;  2SOB A;  2F1M A;  1NNX A;  3G71 A;  1B9M A;  1S5D D;  1XTC D;  1SYC A;  1XPU A;  2A73 B;  1SEB D;  1TWA B;  4IOA A;  3EIV A;  4DV2 Q;  3GTP H;  1KNA A;  1YVC A;  2IW3 A;  4RCN A;  4CJ1 B;  4DR7 Q;  5C3E B;  3FPP A;  4KKU A;  1EYA A;  4C2M H;  4BBS G;  1PA6 A;  1YNN D;  2F0D A;  4BY7 G;  3SEB A;  2O5J C;  3HKZ B;  3S2H B;  1Y1W G;  3I4M H;  5J22 A;  4DGZ A;  1B2T A;  1BO0 A;  2Y0S B;  1KLU D;  2VZA A;  3FMC A;  2AUJ D;  4IUN A;  4KN7 C;  3S24 A;  4CKC A;  1CKM A;  1R4Q B;  4CKB A;  4KHP Q;  2A6E C;  2KHJ A;  5CV8 A;  1B53 A;  2EYF A;  2F0G A;  4RKL A;  3ULP A;  2N49 A;  2RF4 A;  3AQQ A;  3ULL A;  4P74 A;  4N8F A;  4YCW A;  4PMW A;  2K28 A;  3LWU A;  2NVX B;  1X56 A;  1E22 A;  1VQG A;  2DJG C;  2WII B;  3PO3 G;  1Q12 A;  3AMU A;  3KBG A;  5DLQ E;  5EKK A;  4P2C B;  4DR2 L;  1Q86 C;  4A93 B;  3H0G B;  4IPD A;  2B2V A;  1A62 A;  1U5K A;  4U67 3;  2QDL A;  2L4N A;  3BDC A;  1QUQ A;  2DJF C;  4HN7 A;  1VQA A;  3CP0 A;  3F1Z A;  3A8K E;  5I4D A;  3A56 A;  1O7I A;  2NUC A;  4RCO A;  1RDP D;  3AU7 A;  3W5O A;  5JVG 3;  2KOL A;  3R2I A;  3TN2 A;  2NYZ D;  3R2T A;  2F0Q A;  1K3R A;  2CH4 A;  4HJ9 A;  1STY A;  3KJP A;  1XNR L;  1HA5 A;  1WI5 A;  2EYJ A;  4I7Z C;  4LMQ D;  1KD1 C;  1JWS D;  2RDG A;  4CDD C;  2UXD L;  3KLS A;  1YHA A;  4MNO A;  2K04 A;  4OXP A;  4BS9 A;  4IJH A;  1HNW Q;  1K8G A;  3N6R A;  3BS1 A;  4GLX A;  1TS2 A;  1GUG A;  5M5Y H;  4DR3 L;  1VQ7 A;  3CU7 A;  1TR5 A;  3GTM B;  1L1O B;  3TQY A;  3QR8 A;  1JE4 A;  4XDX A;  1AE2 A;  5CBA E;  3D31 A;  1Q1E A;  5KYI A;  3K5O A;  3CC7 A;  5JEA H;  4LF5 L;  2XRQ D;  2YV5 A;  1K28 A;  1STE A;  4MTN A;  1RF2 D;  2CCZ A;  1PZI D;  4JI6 Q;  1I3Q B;  1KDC A;  2N88 A;  1IW7 D;  1STB A;  4A3J G;  1DOK A;  4IUV A;  2VQE L;  4DF7 A;  3C1F A;  4OEL B;  1I4H A;  4K6L A;  1PH9 A;  4R8I A;  1GVP A;  2XIW A;  2EZV A;  4FF3 A;  5TSS A;  5M3F H;  3HOW H;  1I94 Q;  4ZKB B;  2XGT A;  3KJO A;  1EY0 A;  3LX0 A;  1N9W A;  3H3V I;  4V0B A;  2JA7 B;  5EBD A;  1E1T A;  1SYD A;  1WTH A;  3P20 A;  1XYI A;  1ROD A;  3V2T A;  1S40 A;  1TWH B;  1LM0 A;  1O7L A;  1R4P B;  3DWP A;  1HFG A;  1X3P A;  2HDM A;  4LF9 L;  3CQZ H;  2BH2 A;  4Y7N B;  2FHT A;  3GTO H;  4PMB A;  4G7H C;  4PV1 C;  1K83 B;  2VS1 A;  4DV2 L;  2EY1 A;  4NP5 A;  3BYY B;  4AIM A;  5M3F G;  3T56 B;  1L2F A;  1IHZ A;  2X6L A;  5CV9 A;  4KD4 A;  5M5X B;  3JAM c;  2D2C C;  5EBC A;  4DNT B;  1WVL A;  5CMD A;  3T51 B;  4UHV A;  1CQV A;  5ELO A;  1TS3 A;  2CKZ B;  3D6C A;  3L7Z C;  4LW1 A;  2WAQ B;  1A3V A;  5EKI A;  3PIP A;  2PI2 A;  1YHB A;  4X3T A;  1DD2 A;  3KYH C;  4LUV A;  2RCN A;  4IQZ A;  2E2J B;  1PFN A;  1S72 A;  3GTG H;  1X3Q A;  1J5E Q;  1U4R A;  2E8G A;  3TZU A;  1C48 A;  1EFI D;  3HG9 A;  5E4X A;  4HID A;  1A3T A;  1IXR A;  5KND A;  3A5Z B;  4C3H G;  3E0J A;  1RTO A;  5FLM H;  5IYD H;  3U9S A;  2D0P A;  3RLF A;  3M9B A;  4ME5 A;  4LFC Q;  2HHH Q;  1E1O A;  1F2L A;  2BOS A;  5EPJ A;  3VR3 A;  1WTP A;  1EL0 A;  3K7U C;  1KAA A;  1EEI D;  4B3M Q;  4YWL A;  2BA1 A;  2FMM A;  1V1P B;  1I50 B;  2B2Y C;  4X66 Q;  2RDF A;  1X65 A;  2KVM A;  3WWV A;  5T1G A;  4CJ2 C;  3FVQ A;  5FJ8 G;  3EA6 A;  1V43 A;  4IFD H;  4BBS B;  3S2D H;  5H1S E;  1F2Y A;  3G4S A;  1MGS A;  4POF A;  1A0I A;  3HOX G;  1Y1W B;  2LS0 1;  4DR5 Q;  1NBW A;  4X3U A;  3W1B A;  1QVF A;  2ALY B;  3FPU B;  4R1J A;  1OXT A;  1HTP A;  4QGU A;  1PVO A;  2CQA A;  4A4I A;  3KLW A;  1DGS A;  2JA8 G;  2B8F A;  3MEF A;  4DV0 Q;  3RLN A;  2RVL A;  4LF7 Q;  1CI3 M;  4JYA Q;  1SMY D;  2ZM6 Q;  5JJL A;  1BVS A;  2I0Q A;  5IWA Q;  5E7N A;  3PO3 B;  1QCB D;  4IO9 A;  4JI6 L;  1D8L A;  1YIT A;  1L0X B;  4A3F G;  1HNX L;  1GO3 E;  3STB C;  1CA6 A;  4A3D H;  3FHW A;  3DEO A;  1A15 A;  1X54 A;  4F88 A;  1YJ9 A;  1X3E A;  3ITP A;  1I94 L;  5C0X I;  1E2V A;  5C5M A;  1SSO A;  1JB7 A;  1VF5 C;  4JVZ A;  3MXU A;  4A3B B;  4J1M A;  2B2Y A;  4DR1 Q;  5C44 G;  4DV5 L;  2E2H H;  3J80 E;  3SGI A;  4JI5 Q;  2F3V A;  4AYB G;  3DMU A;  1Q81 C;  1V9P A;  2NWG A;  3S1M H;  1SRO A;  2J7Z A;  2F0U A;  5IT9 c;  1SXT A;  2HQE A;  2KBN A;  4TSS A;  1HNZ Q;  2ASB A;  2E76 C;  5LMN Q;  1Q3L A;  2DY8 A;  4QL5 A;  4A3C H;  1PTO C;  3NK9 A;  3H3V H;  4CDF C;  3T13 A;  3PV0 A;  3SK4 A;  4FF4 A;  1LV9 A;  3CHB D;  3WDN A;  4FVM A;  5GAE C;  4LK1 C;  1M4V A;  4G7O C;  5IE8 A;  5KEE A;  1HUM A;  3NQI A;  2NZ1 D;  2WB1 E;  3NTI A;  2YU9 B;  1F2Z A;  2CH4 W;  4A3I H;  4OWW B;  3L2P A;  1H9S A;  3NSW A;  4JI2 Q;  4L5R C;  4MN3 A;  1J5E L;  1PFB A;  2RBM A;  1AE3 A;  2EYP A;  3GQB A;  3W2D A;  3GDE A;  1KNE A;  3CRL C;  4JCV E;  2Z6B A;  3MXN B;  4DKA C;  3CCU A;  1E2W A;  1ENA A;  3JAM i;  4LJZ C;  2Q2I A;  4DR4 L;  3K58 A;  4C3I H;  1B50 A;  5C4X H;  4L63 B;  1PZJ D;  4LFC L;  4DPG A;  4QB4 A;  4BBR G;  4ZQ3 A;  2UUA Q;  4OX9 Q;  1CTM A;  3TRE A;  3A5U A;  4B3M L;  5C4J B;  1E3P A;  4HCS A;  3J7Y W;  3Q22 A;  3KDF B;  1UEA B;  4L8J A;  4HJ5 A;  3NBH A;  1KLG D;  4L5S A;  4C3J G;  3UE0 A;  1EWI A;  1HZ9 A;  3NBI A;  3QJY A;  4KI0 A;  3BG3 A;  1EY9 A;  3FEW X;  1VQC A;  1NR2 A;  1BKB A;  1HQR D;  3S17 H;  4DXG A;  3MAQ A;  1DM0 B;  3K81 C;  2K5D A;  2Q8T A;  4DR5 L;  3OMG A;  3OHX C;  3KLS X;  5IOD A;  1UE6 A;  3S16 B;  1SFO H;  1DXM A;  4A76 A;  3UI2 A;  2R6G A;  4GLV B;  4RGM A;  1KIX A;  2V4D A;  5IGF A;  4O0A A;  1F9R A;  3DEP A;  4DV6 L;  1IL8 A;  2CQO A;  5IP7 H;  1A8V A;  3M85 A;  4JYA L;  4IN3 A;  4JI0 L;  2ZM6 L;  1NR4 A;  1SMY C;  3L0O A;  5ELC A;  2EYM A;  2MO0 A;  3IFT A;  2BDO A;  3HOZ B;  2KEE A;  3RD4 A;  1AN8 A;  4C3H B;  4A3K B;  3HOY B;  1MI2 A;  1FR3 A;  1F2M A;  2D0O A;  4JI4 L;  5HGQ A;  5LL6 X;  2V1C C;  2MFI A;  3LWE A;  3ZYY X;  3E5S A;  1N33 Q;  3J7A F;  1LT6 D;  2LSS A;  5HGT A;  3TZD A;  4DAP A;  2A68 D;  4QIW E;  5IIF A;  5JJZ A;  1ICW A;  1B4O A;  5IP7 G;  4DR1 L;  3RZO B;  2YTV A;  3GTQ B;  3S1Q B;  2MNA A;  3VR4 A;  4JI5 L;  3D0F A;  2IX3 A;  3HOU G;  1R9T B;  1KQS A;  3PO2 G;  1GUS A;  2F3I A;  1Q90 A;  1EYC A;  3S1R H;  4TVA B;  1I4X A;  1HNZ L;  4XYO A;  5C6A A;  2VQF Q;  3HOX B;  2PMZ B;  3I72 A;  2EJF C;  2ZTE A;  3A55 A;  2Z6K C;  1GXD C;  2A6E D;  3NEM A;  5LMN L;  3RNU A;  3UDX A;  3B6Y A;  3DM3 A;  3J81 c;  4QF4 A;  3I8Z A;  5JVH 3;  4E6I A;  2I5L X;  4KK7 A;  2JA8 B;  3TRZ A;  4XXE A;  4HJA A;  3HOV G;  2HCC A;  1X32 A;  3UDI A;  4OIJ A;  3QOJ A;  3TEH B;  1HJP A;  1QZG A;  1SRU A;  1NUC A;  4QUC A;  2JXM B;  4BY1 H;  2XTI A;  3IRB A;  4C1N I;  1PDQ A;  3MWY W;  1M1K C;  1RIP A;  4QIW B;  1Y1V G;  4JI1 Q;  2VUM B;  3A54 A;  2VNU D;  4A3G H;  2ENB A;  1U4L A;  2A74 C;  3O13 A;  4HMI A;  4A3F B;  1YHQ A;  5C0X G;  3U58 A;  4IZ8 A;  5I9P A;  4JI2 L;  1I6H B;  2Z4I A;  2L11 A;  3I90 A;  1OXU A;  2XVS A;  3KF8 B;  1BBW A;  4DAV A;  4BA2 I;  1BNZ A;  3H3V C;  4PZ8 A;  4DV7 Q;  1K8O A;  1Y8O B;  1TS5 A;  1U9R A;  5KYL A;  1YNX A;  1JR0 D;  2L5T A;  4DV1 L;  2NB0 A;  1I4G A;  1ILP A;  5C44 B;  1I4P A;  4DUZ Q;  2UUB Q;  3U50 C;  4WRD A;  2JA9 A;  3W1G A;  1N34 L;  4AYB B;  3RN5 A;  3KF6 B;  5D14 A;  2UUA L;  5E3F A;  4EX5 A;  5HUR A;  3QOL A;  4OX9 L;  2JEA I;  2UXD Q;  2EJM A;  2NVY B;  3VDY A;  4CBV A;  4CDC C;  5IGG A;  2Z6K A;  4ABN A;  2VY3 A;  4RAU C;  2YYZ A;  1YIJ A;  3RUZ A;  3MC0 B;  1PFM A;  3J81 j;  3FKI H;  4UP8 A;  4DR3 Q;  4LUZ A;  1EWH A;  2NN6 H;  1PH5 A;  2R7Z H;  1VQD A;  3TP8 A;  3J7A V;  2B2T C;  4K8I A;  3NHH A;  2I07 B;  1WCM H;  2I5M X;  4XT1 B;  1SDF A;  2JQO A;  2K01 A;  1D7Q A;  1D5M C;  1OO9 B;  2XN9 C;  4G57 A;  1SE3 A;  5FLX E;  3A8J E;  4HJ7 A;  1QJO A;  1HR0 W;  5DM6 3;  4MTK A;  5CV7 A;  1ET9 A;  4Y52 H;  4APV A;  1MJC A;  3BYT B;  3T1Y L;  1K9M C;  3I4O A;  5LL6 S;  4OHJ A;  3SXH A;  3NWT A;  3C3L A;  1GHK A;  1FNV A;  1X55 A;  2JN4 A;  3U4V A;  4OWX B;  1VQ9 A;  1P8L A;  1NMF A;  4NMZ A;  4TRD A;  3I56 A;  1BUV T;  1U4P A;  4QJF A;  1W6J A;  3CPW A;  4U68 A;  5K36 G;  1HUN A;  2QF7 A;  1QOH A;  2E74 C;  2XRS D;  2KCM A;  3S15 B;  4BBR B;  1EQV A;  3IAY A;  4LF8 Q;  1LLR D;  1N33 L;  1OTC A;  2EY5 A;  2D5D A;  4LF9 Q;  4KHV A;  4ZUJ A;  1IZ6 A;  2EXD A;  2A68 C;  3EJI A;  4YY3 Q;  2IPK D;  3G6J B;  4C3J B;  1O80 A;  3DHQ A;  3CAM A;  2OT2 A;  4NXN Q;  2B2T A;  4NPS A;  1JQY D;  1SLJ A;  2K5Q A;  2EXZ A;  2B2U C;  3D4W A;  1JOQ A;  2CHB D;  4DK6 C;  2VQF L;  4GOP C;  4GNX C;  5T1I A;  1ILQ A;  2R92 G;  1KL9 A;  1T5X D;  4O2D A;  2K52 A;  3I91 A;  4PG3 A;  4GN4 B;  4IUU A;  4RWS C;  1YNJ C;  1DOM A;  4G7Z C;  2AMC B;  2PCF B;  2Z8L A;  3S14 H;  3KFU A;  5M5W B;  3PSI A;  1QNK A;  2ES2 A;  3M3Y H;  4OGQ C;  1TWG B;  1S4Z A;  1D1K A;  1WJJ A;  3H91 A;  4JI1 L;  3I4M G;  4GN3 B;  4RGO S;  3WOE A;  4IFD I;  1CQF A;  4XQJ A;  1QUQ B;  2KCN A;  4FF2 A;  1FNW A;  2NVT B;  2K4K A;  4QMG A;  4R4O A;  1SE8 A; 
#chains in the Genus database with same CATH homology
 1TS4 A;  3BZD B;  1CA5 A;  5BN5 A;  3NTK A;  4KTA A;  4EQN A;  5CYU A;  3CRK C;  3G7L A;  5EPK A;  4DNR B;  3HGB A;  3HOU B;  4XYQ A;  3PO2 B;  2B2U A;  2J4X A;  4KY6 A;  2H1E A;  1OXX K;  3GTL B;  2EVB A;  2IT1 A;  2Z1C A;  3TP7 A;  1A6X A;  3VR6 A;  3HOV B;  1EU4 A;  2KJX A;  2F0K A;  3NQT A;  1TWF B;  2QKI C;  1HTL D;  2K5W A;  1GUW A;  4HED A;  1BR9 A;  1Y1V B;  2PW7 A;  1PTO H;  1A2T A;  3TP6 A;  1K8M A;  3I4N B;  1SE4 A;  2RSO A;  3PUZ A;  2F0V A;  2ID0 A;  4Z9C B;  5I6W A;  1HCZ A;  2RQX A;  5JEA G;  2ZXO A;  1BCP D;  5JAV A;  2NTT A;  2BE5 D;  3M7G A;  2D62 A;  1PTO D;  2GA4 B;  5A2Q L;  4J6H A;  1HXY D;  4N9P A;  2E2I B;  3JAM L;  3BDO A;  2IX0 A;  4BA1 I;  4PQX A;  2R61 A;  1E0B A;  4KN4 C;  4RKB A;  1KDB A;  2L1B A;  1SBB B;  1OXV A;  5J39 A;  5C4Z A;  2F0E A;  4Q5V A;  2MP1 A;  3X3M A;  1J8I A;  3AB9 A;  1JCK B;  3Q0A A;  1EZ8 A;  3OSO A;  4PMC A;  4EGV A;  4EQP A;  1KDA A;  4ZK9 B;  4FXG C;  3NE5 B;  2ICE C;  2K32 A;  1WTV A;  5IGC A;  2PNR C;  2F0I A;  1NSN S;  1D2B A;  3KK7 A;  4B08 A;  3VYS A;  1PRT F;  1MSH A;  2R93 B;  5C5L A;  1V8Q A;  4NKL A;  5EGT A;  1WTR A;  4F87 A;  5KNC A;  2KEC A;  4CKE A;  2F0F A;  3S1N B;  3VYT A;  3BVG A;  1GOZ A;  1AP0 A;  4BY7 B;  1TWC B;  2ZXR A;  2K6A A;  1TY0 A;  1VDZ A;  5DAU A;  3DUZ A;  2R92 B;  1PRT C;  5AFW A;  1WD0 A;  2DY7 A;  5EPL A;  3R3O A;  1PYW D;  1BF4 A;  2M2L A;  2L9H A;  3GTP B;  4OO1 H;  1I4Q A;  2F0J A;  5EJW A;  4X3S A;  4C2M B;  5DNF A;  4IFD G;  3OW7 A;  2F0H A;  2PPB C;  1BCP F;  3I4M B;  2OF1 A;  4KY7 A;  2F0T A;  1SE2 A;  2E2D C;  4LAA A;  1S5E D;  1XXG A;  1I4R A;  1PTO F;  1EY7 A;  5DM7 3;  4L6T B;  2MHV A;  1BQQ T;  4G4K A;  1A3U A;  2WIN B;  2A5H A;  2KUM A;  1SYB A;  1LTA D;  5ISR A;  1BCP C;  5IT9 L;  1QB5 D;  2F03 A;  3FDT A;  3PIO 3;  1JOK A;  3D6W A;  2BE5 C;  4CGY B;  2DNE A;  2RDH A;  1E2Z A;  2L55 A;  3PMF A;  1II3 A;  3KBX A;  3PUV A;  2R3Z A;  2MGS A;  1AEX A;  4X3K A;  1CT1 D;  1LAB A;  5IOC A;  5LHY 1;  1H9S B;  2G9H D;  4ODG A;  4A3J B;  3MXP A;  2IL8 A;  3W3A A;  1AZP A;  5M5Y B;  1H9K A;  2HCI A;  4OIK A;  4HCE A;  4FO2 A;  3A7L A;  3SK5 A;  5D65 A;  2NN6 I;  2ZT9 C;  1H9J A;  1Y8P B;  3P75 A;  3NP8 A;  4XIG S;  1CFM A;  1A2U A;  4ZLT F;  3M4Y A;  5C3X A;  1EY6 A;  2F0L A;  2WB1 B;  4JK1 C;  3DWQ A;  3T16 A;  3QB3 A;  1BXT A;  3DM1 A;  5M3F B;  3HOW B;  2B39 A;  2L0C A;  1LTG D;  5A35 A;  2LKV A;  3GV3 A;  4C3I G;  3BDL A;  3OWF A;  4MIU A;  1EIG A;  2WAC A;  4KY5 A;  2KCC A;  3L3O C;  4H7B A;  2EE1 A;  4WJW A;  1LTR D;  1O78 A;  2FFK B;  5F2D A;  3CQZ B;  5CBE E;  2RKS A;  4F7X A;  1ZXT A;  4WOR A;  5C4H A;  3GTO B;  2RA4 A;  3H09 A;  3I4L A;  3GV6 A;  1SNM A;  5FO9 B;  4K8J A;  3IFD A;  2G9D A;  2A69 C;  5D3D A;  2XWJ B;  4GZY C;  2ICI A;  1OXS C;  1G2S A;  1Y8N B;  3VA7 A;  1SJH D;  1QWY A;  2OXP A;  2CW0 C;  2C9O A;  1BBX C;  3GTG B;  2E75 C;  2PZU A;  4K6D A;  4RH6 A;  5JPN C;  2FMC A;  4KKT A;  2Z4H A;  2F0W A;  1F9S A;  4HTH A;  3ERO A;  1RHP A;  3F2U A;  3MVV A;  3L9A X;  4IUT A;  1W6K A;  5CR3 A;  1C4Q A;  2MUY A;  1YNJ D;  3J81 L;  5FO8 B;  1JWU D;  3SDZ A;  3ND9 A;  1ESR A;  5BN4 A;  3QIA A;  3C2P A;  1XWE A;  3EVQ A;  1QE6 A;  3KUP A;  4UDU C;  2EY6 A;  4F8M A;  3MHB A;  3S2D B;  1S5C D;  2O5I C;  1HPC A;  2K7V A;  5FK9 C;  3TP5 A;  4H13 C;  4ZAI A;  1SNO A;  2C5C A;  1PXU A;  3SHL A;  5IGD A;  4OL7 A;  1PMR A;  1DYQ A;  4B9W A;  3Q24 A;  1DCZ A;  5FO7 B;  4TQU S;  1ENF A;  4C1N K;  1JC7 A;  1QNU A;  4RFB A;  4CJ0 B;  2O4X A;  1LTS D;  4QUF A;  4A3D B;  3TBI B;  1AFP A;  4V19 0;  3GD7 A;  2K03 A;  1F9Q A;  4HAE A;  1ESF A;  1G2T A;  1NCV A;  2F0O A;  3HEJ A;  5C0X J;  4CHT B;  1B44 D;  4KMU C;  1QIL A;  2E2H B;  5D3I B;  1EU3 A;  1C8C A;  4XQN A;  2KA7 A;  1L0Y B;  3OOC A;  3S1M B;  3VYU A;  5I6Y A;  1EZ6 A;  2XWB B;  2LMC B;  5C3W A;  5ELD A;  2AUK A;  5I2Y A;  2NN6 G;  1EY5 A;  4H44 C;  1RD9 D;  3H6M A;  4DAY A;  4KKS A;  4RGN A;  4A3I B;  3T4A C;  1DON A;  3QWN A;  3R93 A;  1TU2 B;  5COY A;  5M9O A;  3NXW A;  1SNQ A;  1IYU A;  1KTK A;  4C3I B;  5C4X B;  4K2L A;  4RA8 A;  4KD3 A;  1T5E A;  4ZUI A;  4K5W A;  1ML0 D;  5ELE A;  5ELF A;  2XNA C;  3NTH A;  1ET6 A;  5ELB A;  4EQO A;  5CV6 A;  1EY4 A;  1JOR A;  3FRP B;  3OWE B;  2LFN A;  3S17 B;  1LTT D;  1ZKO A;  3X3N A;  3Q6S A;  2F0S A;  2AQ1 B;  1STN A;  3NPP A;  4RHS A;  1WTX A;  4RGT A;  1SFO B;  4DU9 A;  2F4I A;  3J81 E;  2ZXP A;  1SNC A;  1UAP A;  2EJG C;  2SEB D;  1MSG A;  3C1E A;  3VR2 A;  1G6Z A;  3NWS A;  2M00 A;  3IKJ A;  3ND8 A;  4OO1 I;  1EY8 A;  2TSS A;  3IL8 A;  1S5B D;  2AWO A;  1PRT D;  2JP1 A;  1IKL A;  4HSP A;  4O1N A;  2QEJ C;  3TME A;  2I46 A;  3HRZ C;  5G3L F;  3OIP A;  5BN3 A;  5NUC A;  1IKM A;  1TT2 A;  1I6V C;  2BDN A;  1UUP A;  2VXW A;  3S1R B;  2EPB A;  4KJN A;  5I2X A;  3MFG A;  2KHS A;  4FNF A;  1VCI A;  3J80 L;  3SK8 A;  1BDO A;  1HFN A;  4N9T A;  2HUG A;  1Q8I A;  2D9U A;  2IX1 A;  1LTI D;  4BY1 B;  3K6O A;  3T53 B;  2K05 A;  1ZYR C;  3D3R A;  3DXJ C;  3HS0 C;  3MA2 B;  4A3G B;  2VB3 X;  3ONA B;  5CGK A;  3A8I E;  2FIN B;  4K5X A;  1HRJ A;  4YIJ A;  1TII D;  5K5P A;  1STG A;  5EQ0 A;  1ZEQ X;  2EYO A;  3MZ5 A;  4IUR A;  1RTN A;  2KQ3 A;  3D8G A;  3LNN A;  3D4D A;  1U4M A;  5FKA C;  4QCL A;  2MJ8 A;  2WV6 D;  1GJX A;  5IGB A;  3C46 A;  5JEA J;  1YNN C;  2J0T D;  5KRU A;  2F3W A;  3FKI B;  4EVO A;  3K59 A;  2R7Z B;  4HSV A;  4IUP A;  3K5M A;  1V1O A;  1WCM B;  4Q0F A;  2F0M A;  1GUO A;  2JEB I;  3ERQ A;  4FXK C;  2JE6 I;  1HQM C;  3GO5 A;  2PZW A;  2O2L D;  4NW2 A;  3P1H A;  4MHE A;  1H9M A;  5JOB A;  1EOT A;  3Q23 A;  2EYL A;  2N55 A;  5FOB B;  1TVX A;  2A6H D;  4XTC S;  4XQQ A;  4NDX A;  2OEO A;  1NAP A;  2NTS A;  2IJ0 A;  2DNC A;  1V1P A;  4M1U B;  5CV5 A;  2EOT A;  1WD1 A;  2SNS A;  4KV6 A;  2Q8I B;  2X69 A;  1LO5 D;  1B9N A;  2A69 D;  4DK0 A;  1WTO A;  4R9W A;  2RSN A;  1STA A;  1SYF A;  2CVR A;  4DXF A;  1QG7 A;  1TKW B;  2B8G A;  1MBY A;  1B1Z A;  2K33 A;  2KED A;  2CW0 D;  1JOO A;  1FD7 D;  4O42 A;  4OO1 G;  3S14 B;  5KGU A;  2NBF A;  1S5F D;  4K14 A;  3M3Y B;  1LT4 D;  3H94 A;  3TSS A;  1IW7 C;  3CKI B;  4FF1 A;  1FNU A;  2EYH A;  3HP3 A;  2JSO A;  1AZQ A;  1PRT B;  1G91 A;  2M9V A;  3M7N A;  4IFD J;  4JBW A;  1PZK D;  2JA5 B;  3U9O A;  4DA2 A;  2BA0 A;  1WTW A;  3I70 A;  1JIC A;  5KIX A;  1EYD A;  3MTS A;  4K5V A;  1Z47 A;  1SND A;  3I3C A;  2PQE A;  4TKO B;  1EIH A;  1LTB D;  1J9O A;  1STH A;  4KHZ A;  1H9R A;  1XX8 A;  5A2Q E;  5E1F A;  2BCO A;  4BWG B;  2EDG A;  2DN8 A;  3JAM E;  5IGE A;  3K57 A;  1UNS A;  2PW5 A;  1BCP B;  5CC4 A;  1DOL A;  2XSC A;  3BVM A;  3VA5 A;  4S3S A;  1VF7 A;  1EEF D;  3N52 A;  1PTO B;  4FYD A;  4H0L C;  4HR7 B;  4I65 A;  3K0Y A;  1CZW A;  2JYO A;  1O7Y A;  5FLX L;  1CHQ D;  3MXN A;  4ULL A;  1GUT A;  2VB2 X;  3SVM A;  2B2W C;  2A6H C;  2AWN A;  4A3E B;  5COR A;  1EQT A;  3K5L A;  1F77 A;  1LT5 D;  3K5N A;  3D4R A;  2SNM A;  5CV4 A;  5DEH A;  2WKD A;  1SYG A;  2TMP A;  4ZRZ A;  1SJE D;  5E4W C;  2MPM A;  2AQ3 B;  4IAL A;  3SR1 A;  1F9P A;  3BVZ A;  1ENC A;  1TY2 A;  1HA6 A;  4XT3 B;  2EY2 A;  3GTJ B;  1O7Z A;  3HZX A;  3RZD B;  2LY7 A;  2WP8 J;  3MEH A;  2B63 B;  1DZ1 A;  3KLR A;  4DFA A;  4ILW A;  2PYK A;  2F0P A;  4J8Q A;  4ZKC B;  3EQL C;  4C56 C;  3QO2 A;  2PZT A;  2B2W A;  3QG1 A;  3OPO A;  4RHR A;  4K2K A;  1D5X C;  3E6Z X;  4DK1 A;  1SYE A;  4IUQ A;  1IYV A;  1B3A A;  1RKN A;  3GTK B;  1RCV D;  4ID6 A;  3PIP 3;  5J1Z A;  5EKL A;  3M4O B;  1LT3 D;  1CM9 A;  5C0X H;  3GP7 A;  1ONL A;  4PNY A;  5IT9 E;  1HHV A;  5M3M B;  3V96 A;  4WFN 3;  1CZG A;  1Y69 U;  3PUX A;  1GUN A;  4ZYS A;  1G29 1;  2PO4 A;  4FP5 D;  1D1I A;  4A3M B;  4M8A A;  2QDB A;  1RJT A;  1DJR D;  1Z7T A;  2FJ2 A;  2QCP X;  3A7A B;  1KAB A;  5JPM C;  3KF8 A;  1GHJ A;  1VMC A;  1D6E C;  1EWC A;  2IWH A;  3MFY A;  3EFX D;  1BOS A;  3OMC A;  3PUY A;  1M8A A;  2K1B A;  1JWM D;  3MXG A;  1CHP D;  3RMH A;  2L12 A;  1FYC A;  3DWA A;  1WTQ A;  5I9O A;  3SK6 A;  3WOF A;  3PUW A;  1JB3 A;  2WKC A;  4DN4 M;  5G3L D;  1SAP A;  1D5Z C;  3V05 A;  2X6G A;  2AQ2 B;  1AW7 A;  3S9W A;  1Z6H A;  4KJO A;  5K36 H;  2Q8R E;  2SDF A;  3OIQ A;  3I73 A;  3R8B A;  1CK1 A;  4R8N A;  2H4O A;  2HDL A;  3K7A B;  4HMJ A;  3URY A;  3VR5 A;  1VMP A;  1ZYR D;  2F0N A;  4FXD A;  5KNB A;  3VYR A;  1PLF A;  2JA6 B;  3P7J A;  1TQO A;  3SE0 A;  3TDQ A;  4B9X A;  3NUC A;  4UAI A;  1G8Z D;  1MD2 D;  1FGB D;  2B2V C;  2QIL A;  1SNP A;  1LAC A;  1Q1B A;  2NVQ B;  2SOB A;  2F1M A;  1B9M A;  1S5D D;  1XTC D;  1SYC A;  2A73 B;  1SEB D;  1TWA B;  1KNA A;  2IW3 A;  4CJ1 B;  4RCN A;  5C3E B;  3FPP A;  4KKU A;  1EYA A;  1YNN D;  2F0D A;  3SEB A;  2O5J C;  3HKZ B;  3S2H B;  5J22 A;  4DGZ A;  1B2T A;  1BO0 A;  2Y0S B;  1KLU D;  4IUN A;  3FMC A;  2AUJ D;  4KN7 C;  4CKC A;  1R4Q B;  4CKB A;  2A6E C;  5CV8 A;  1B53 A;  2EYF A;  2F0G A;  4RKL A;  4PMW A;  2K28 A;  3LWU A;  2NVX B;  2WII B;  1Q12 A;  3AMU A;  3KBG A;  5EKK A;  4P2C B;  4A93 B;  3H0G B;  2B2V A;  4U67 3;  2L4N A;  3BDC A;  4HN7 A;  3A8K E;  5I4D A;  3A56 A;  2NUC A;  4RCO A;  1RDP D;  3AU7 A;  5JVG 3;  3TN2 A;  2KOL A;  3R2I A;  2NYZ D;  3R2T A;  2F0Q A;  1STY A;  1HA5 A;  4I7Z C;  2EYJ A;  4LMQ D;  1JWS D;  2RDG A;  3KLS A;  2K04 A;  4BS9 A;  3N6R A;  3BS1 A;  1TS2 A;  1GUG A;  3CU7 A;  1TR5 A;  3GTM B;  1JE4 A;  4XDX A;  5CBA E;  1Q1E A;  3D31 A;  5KYI A;  3K5O A;  5JEA H;  2XRQ D;  1STE A;  1RF2 D;  1PZI D;  1I3Q B;  1KDC A;  2N88 A;  1IW7 D;  1STB A;  1DOK A;  4IUV A;  4DF7 A;  3C1F A;  1I4H A;  4K6L A;  4R8I A;  2XIW A;  2EZV A;  4FF3 A;  5TSS A;  4ZKB B;  1EY0 A;  3LX0 A;  4V0B A;  2JA7 B;  5EBD A;  1SYD A;  1XYI A;  3P20 A;  1ROD A;  3V2T A;  1TWH B;  1O7L A;  1R4P B;  3DWP A;  1HFG A;  1X3P A;  2HDM A;  4Y7N B;  2FHT A;  4PMB A;  4G7H C;  4PV1 C;  1K83 B;  2EY1 A;  4NP5 A;  3BYY B;  3T56 B;  1IHZ A;  2X6L A;  5CV9 A;  4KD4 A;  5M5X B;  2D2C C;  5EBC A;  4DNT B;  1WVL A;  5CMD A;  3T51 B;  1CQV A;  1TS3 A;  3D6C A;  3L7Z C;  2WAQ B;  1A3V A;  5EKI A;  4X3T A;  1DD2 A;  4IQZ A;  2E2J B;  1PFN A;  1X3Q A;  1U4R A;  3TZU A;  1C48 A;  1EFI D;  3HG9 A;  5E4X A;  1A3T A;  5KND A;  4C3H G;  3E0J A;  1RTO A;  3U9S A;  3RLF A;  4ME5 A;  1F2L A;  2BOS A;  5EPJ A;  3VR3 A;  1WTP A;  1EL0 A;  1KAA A;  1EEI D;  2BA1 A;  2FMM A;  1V1P B;  1I50 B;  2B2Y C;  2RDF A;  2KVM A;  5T1G A;  4CJ2 C;  3FVQ A;  3EA6 A;  1V43 A;  4IFD H;  4BBS B;  1F2Y A;  1MGS A;  1Y1W B;  2LS0 1;  4X3U A;  3FPU B;  1OXT A;  1HTP A;  2CQA A;  2B8F A;  2RVL A;  1CI3 M;  1SMY D;  3PO3 B;  1QCB D;  1L0X B;  1CA6 A;  3DEO A;  1A15 A;  4F88 A;  3ITP A;  5C0X I;  1E2V A;  5C5M A;  1SSO A;  1VF5 C;  3MXU A;  4A3B B;  4J1M A;  2B2Y A;  3J80 E;  2F3V A;  3DMU A;  2NWG A;  2J7Z A;  2F0U A;  1SXT A;  2HQE A;  4TSS A;  2E76 C;  1Q3L A;  2DY8 A;  1PTO C;  3NK9 A;  3T13 A;  3PV0 A;  3SK4 A;  4FF4 A;  1LV9 A;  3CHB D;  3WDN A;  4FVM A;  4LK1 C;  1M4V A;  4G7O C;  5KEE A;  1HUM A;  3NQI A;  2NZ1 D;  3NTI A;  2YU9 B;  1F2Z A;  1H9S A;  3NSW A;  4MN3 A;  1PFB A;  2RBM A;  2EYP A;  3GQB A;  3W2D A;  1KNE A;  3CRL C;  1E2W A;  1ENA A;  4LJZ C;  3K58 A;  1B50 A;  4L63 B;  1PZJ D;  4QB4 A;  4ZQ3 A;  1CTM A;  5C4J B;  4HCS A;  3J7Y W;  3Q22 A;  1UEA B;  4L8J A;  3NBH A;  1KLG D;  4C3J G;  3NBI A;  3QJY A;  4KI0 A;  3BG3 A;  1EY9 A;  3FEW X;  1NR2 A;  1HQR D;  4DXG A;  3MAQ A;  1DM0 B;  2K5D A;  2Q8T A;  3OMG A;  3OHX C;  3KLS X;  5IOD A;  3S16 B;  1DXM A;  3UI2 A;  2R6G A;  4RGM A;  2V4D A;  5IGF A;  1F9R A;  3DEP A;  1IL8 A;  3M85 A;  4IN3 A;  1NR4 A;  1SMY C;  5ELC A;  2EYM A;  3IFT A;  2BDO A;  3HOZ B;  2KEE A;  3RD4 A;  1AN8 A;  4C3H B;  4A3K B;  3HOY B;  1MI2 A;  1FR3 A;  1F2M A;  5LL6 X;  3LWE A;  3ZYY X;  3E5S A;  3J7A F;  1LT6 D;  5HGT A;  3TZD A;  4DAP A;  2A68 D;  5IIF A;  5JJZ A;  1ICW A;  1B4O A;  3RZO B;  3GTQ B;  3S1Q B;  3VR4 A;  2IX3 A;  1R9T B;  1GUS A;  1Q90 A;  1EYC A;  1I4X A;  4XYO A;  5C6A A;  3HOX B;  2PMZ B;  3I72 A;  2EJF C;  3A55 A;  1GXD C;  2A6E D;  4QF4 A;  3I8Z A;  5JVH 3;  4E6I A;  2JA8 B;  4KK7 A;  4XXE A;  2HCC A;  1X32 A;  4OIJ A;  3QOJ A;  1NUC A;  4QUC A;  2JXM B;  4C1N I;  1PDQ A;  3MWY W;  4QIW B;  2VUM B;  3A54 A;  2VNU D;  2ENB A;  1U4L A;  2A74 C;  3O13 A;  4HMI A;  4A3F B;  5C0X G;  4IZ8 A;  5I9P A;  1I6H B;  2Z4I A;  2L11 A;  3I90 A;  1OXU A;  2XVS A;  4DAV A;  4BA2 I;  1BNZ A;  3H3V C;  1K8O A;  1Y8O B;  1TS5 A;  1U9R A;  5KYL A;  1JR0 D;  2L5T A;  2NB0 A;  1I4G A;  1ILP A;  5C44 B;  1I4P A;  4WRD A;  4AYB B;  5D14 A;  5E3F A;  2JEA I;  5HUR A;  3QOL A;  2EJM A;  2NVY B;  4CBV A;  5IGG A;  4ABN A;  4RAU C;  2YYZ A;  3RUZ A;  3MC0 B;  1PFM A;  1EWH A;  2NN6 H;  3TP8 A;  3J7A V;  2B2T C;  4K8I A;  3NHH A;  2I07 B;  4XT1 B;  1SDF A;  2K01 A;  1D5M C;  1OO9 B;  2XN9 C;  4G57 A;  1SE3 A;  5FLX E;  3A8J E;  1QJO A;  5DM6 3;  5CV7 A;  1ET9 A;  3BYT B;  5LL6 S;  4OHJ A;  3SXH A;  3NWT A;  3C3L A;  1GHK A;  1FNV A;  4NMZ A;  4TRD A;  1BUV T;  1U4P A;  1W6J A;  4U68 A;  5K36 G;  1HUN A;  2QF7 A;  1QOH A;  2E74 C;  2XRS D;  3S15 B;  4BBR B;  1EQV A;  3IAY A;  1LLR D;  2EY5 A;  2D5D A;  4KHV A;  4ZUJ A;  2A68 C;  3EJI A;  2IPK D;  3G6J B;  4C3J B;  1O80 A;  3DHQ A;  2OT2 A;  2B2T A;  1JQY D;  2K5Q A;  2EXZ A;  2B2U C;  3D4W A;  1JOQ A;  2CHB D;  5T1I A;  1ILQ A;  1T5X D;  3I91 A;  4IUU A;  4RWS C;  1YNJ C;  1DOM A;  4G7Z C;  2PCF B;  2Z8L A;  5M5W B;  1QNK A;  4OGQ C;  1TWG B;  1S4Z A;  1D1K A;  3H91 A;  4RGO S;  3WOE A;  4IFD I;  1CQF A;  4XQJ A;  2KCN A;  4FF2 A;  1FNW A;  2NVT B;  4QMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...