2HDLA

Solution structure of brak/cxcl14
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
77
structure length
77
Chain Sequence
SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords Small inducible cytokine B14
publication title Structural Determinants Involved in the Regulation of CXCL14/BRAK Expression by the 26 S Proteasome.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2006-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2hdlA00
1MSHA 1NCVA 1ZXTA 2XIWA 2RVLA 1JICA 1RHPA 2KEEA 2RSNA 4MHEA 3KBXA 4HSVA 1ILPA 1WTPA 1HFNA 1EOTA 2FFKB 4ZKBB 4IUUA 3F2UA 1WTRA 1HUNA 1B4OA 1G2SA 1AZQA 4UAIA 5EJWA 1PFBA 4IUVA 1VMPA 1NR4A 2B2UA 2NWGA 1PFNA 4RAUC 3FPUB 5CORA 2K28A 1QG7A 5CMDA 1ILQA 4R8IA 2KEDA 3MWYW 2N55A 1AP0A 2FJ2A 1EIGA 2X6GA 4HCSA 3TN2A 4IUPA 2B2YA 2H1EA 2B2TA 1XYIA 2L4NA 4R9WA 3I3CA 1HUMA 2HCIA 4X3UA 3GV3A 1G91A 4CJ0B 1SSOA 1X3PA 2K1BA 2FINB 1ML0D 2K01A 3GV6A 4ZK9B 2EPBA 4CJ1B 1G6ZA 1QE6A 4HAEA 2DY7A 4QUCA 5EQ0A 1TVXA 1SDFA 3H91A 1E0BA 2M2LA 1J8IA 3P7JA 1VMCA 4XDXA 4CJ2C 1EIHA 1F9PA 1RTNA 4IURA 1ESRA 1JE4A 2MP1A 2R3ZA 1KNEA 1U4MA 1EL0A 1Q3LA 1RJTA 1U4RA 3IL8A 1CA6A 1LV9A 2B2VC 1KNAA 5D65A 1BNZA 1B53A 2K05A 2MPMA 2EOTA 2K03A 1U4LA 2EE1A 1PDQA 2KECA 1WVLA 1X32A 1BBXC 1QNKA 3R93A 2IL8A 1X3QA 1IKMA 3D6WA 1DZ1A 1IL8A 1O80A 1U4PA 1SAPA 5EPLA 3I90A 2Q8TA 4RA8A 1WTOA 1B2TA 1B50A 1DONA 1GUWA 2J7ZA 3G7LA 4IUQA 2B2WC 4OIKA 5CBEE 1J9OA 2RA4A 1EQTA 1XX8A 3MTSA 4X3TA 3TZDA 1DOLA 3DEPA 2N88A 1WTVA 5CBAE 1NR2A 2NZ1D 5E4WC 1IKLA 3SVMA 1ICWA 1G2TA 3I8ZA 4NW2A 3UI2A 1HFGA 4XT1B 4XT3B 5E4XA 1F9SA 1B3AA 2RSOA 5T1GA 1WD0A 2VXWA 5AFWA 1F9QA 1RODA 2Q8RE 2X69A 1WTWA 2NYZD 2L12A 2L1BA 2HDMA 1CM9A 4OIJA 3ONAB 4U68A 3IFDA 1PLFA 3DEOA 2D9UA 4RWSC 1HA6A 4QUFA 2FMMA 1HRJA 1MSGA 1NAPA 2B2UC 1BO0A 2FHTA 2K04A 2KUMA 4X3SA 2BDNA 2B2VA 5COYA 5EPJA 1WTQA 1MGSA 1DOKA 4LMQD 1O7YA 3I91A 4MN3A 1MI2A 2HUGA 3LWEA 4ZAIA 1F9RA 2CVRA 4IUTA 2B2YC 5EPKA 4ZLTF 1C8CA 3KUPA 2JYOA 2JP1A 2B2TC 2HDLA 1DOMA 1A15A 2KVMA 2MGSA 5D14A 1AZPA 2MJ8A 1M8AA 2B2WA 3FDTA 5JJZA 3Q6SA 2HCCA 1RTOA 1BF4A 1WTXA 4HEDA 3HP3A 5DNFA 2L11A 2L9HA 1F2LA 1PFMA 2KOLA 1S4ZA 2SDFA 2DY8A 1O7ZA 3QO2A 3DM1A 5EKIA 3N52A 4X3KA 5T1IA 1WD1A 4ZKCB 1HHVA 4O42A 4DN4M 1CA5A 2X6LA
chains in the Genus database with same CATH superfamily
1RHPA 2RSNA 4MHEA 1C7YA 4FP5D 1FVIA 4KN4C 4EQOA 5FLMG 1PFBA 2VY3A 1EYCA 1K8GA 1QZGA 4ABNA 3V2TA 1ILQA 4EQ5A 2KEDA 4N8FA 2Z0SA 4QMGA 1PZJD 4C3HG 2B2YA 3BJUA 1EEID 5FK9C 4GOPB 1Z9FA 2D2CC 5AJ3L 5IIFA 4K14A 1XNQL 4J8QA 3GTKH 1NUCA 4IFDJ 1TS2A 2JA5B 5LL6S 5CYUA 4A3DB 2RQXA 3PO3B 1JOQA 1IYUA 3CU7A 4AYBB 2SNSA 4HJ7A 2NTTA 1O78A 4BS9A 3M7NA 3ND8A 2WAQB 3BZKA 3C2PA 1B2TA 3QWNA 5CV8A 3KYHC 4QJFA 1PTOB 3G7LA 5CBEE 3HKZE 4BBRG 4JOIC 2ZT9C 2UXBQ 2F4IA 4OO1G 2DUDA 3KBGA 2OTJA 2DJGC 4N8X1 5EBDA 4DV6Q 5C4JH 3HRZC 2F0HA 3VDYA 2E2IH 3S2HB 1G6PA 1WTHA 1AEXA 3MEHA 2PO4A 1TIID 2AQ1B 1TT2A 1NSNS 4KI0A 4ULLA 2IHEA 2JEBI 3QJYA 4UP7A 1BO0A 1HTPA 4CBVA 1HXYD 4ZYSA 1KIXA 1KDBA 2F3IA 1SFOH 1DGSA 3HOWB 3GTKB 1EEFD 4ZLTF 4ALPA 3W5OA 1C8CA 4AIMA 1HH2P 4EVOA 3CC7A 2WFWA 4IFDG 1A0IA 1S5FD 1H9KA 1X65A 1MJCA 3L0OA 1SE3A 4S3SA 1IBKL 1PZID 1WTXA 3BVMA 3CMEA 1X3FA 2HD3A 3SE0A 1Z7TA 1K8OA 3VYUA 2ZJRA 1WD1A 4A3JH 4C3JB 3ND9A 2JA6G 1NCVA 2XNAC 1GO3E 2JA6H 4HSVA 1A8VA 3H09A 2NZOA 4EQNA 4KY7A 4G7HC 4XIGS 4ZKBB 3G71A 1SRUA 3I56A 2B2UA 1N34Q 5H1SE 1CI3M 4RAUC 5NUCA 2K5NA 1TWFB 3CRKC 4M8AA 4MNOA 1NTGA 2FXQA 1PA6A 2BE5D 3G4SA 4DV0L 5JEAH 4NB3A 4YWLA 3TS2A 5C0XJ 1XXGA 4UPAA 2QEXA 1JC7A 4POFA 3R2TA 1PH7A 2KCMA 1A3TA 4XDXA 4DR1Q 1U9RA 1HR0Q 1N33Q 1VQFA 1ESRA 2MP1A 4JI2L 3ITPA 2AQ3B 4PZ8A 5GQOA 2K52A 1IL2A 2B2VC 2BE5C 2KCCA 2RDFA 1B53A 1HNXL 2K05A 1D5XC 2IT1A 1X32A 1BBUA 2QDBA 1KD1C 2UUAL 1STBA 4A3JB 4B3MQ 1F2MA 2LMCB 5C6AA 3VR6A 4A3IH 1PRTF 2Z8LA 1KAAA 1RIPA 4K2KA 1ESFA 4EX5A 5CBAE 4PG3A 3V05A 4QGUA 4DA2A 5E4WC 1UUPA 2PI2E 1HZAA 4XT1B 4JCVE 2VUMB 4K5VA 4LF4Q 4B3SQ 4FF4A 2E75C 1XMOL 2E8GA 2HDMA 1JB7A 1PLFA 3DEOA 1JMCA 4JW0A 4BWGB 4ZUIA 2Q2IA 4B3TL 1D8LA 2UXCQ 1X55A 2BDNA 5CGKA 1XJVA 4K0KQ 2KBNA 2KA7A 4DXFA 2EDGA 3DWAA 3U58A 4F88A 1HTLD 3GTOH 4RKBA 4IUTA 2L5TA 4K6LA 5CV5A 3GQBA 1A15A 3KDFB 1C4QA 2XWJB 3BG3A 1S3OA 4C2MB 1SE2A 3CCMA 4TRDA 1FJGQ 1XWEA 3E0JA 4AQYL 2O5IC 2ICIA 1I4QA 2E74C 2K5QA 4JOIA 1OXVA 1STEA 1KDAA 4YY3Q 2R93H 3H0GH 3HOXG 1ZXTA 3NWTA 1Q8IA 3I4NG 3EIVA 2K7VA 3K81C 2Z4IA 1RL2A 3I4NH 1LM0A 1RDPD 3GTMH 4KLKA 2FFKB 1M1KC 3F2UA 1VQ7A 3PUYA 2WINB 2A6HC 4DV3Q 2ID0A 1BR9A 1OO9B 3RMHA 1D6EC 3AU7A 1AP0A 2MO1A 1QUQA 4DR4L 5JPMC 3OW2A 4FF1A 3GV3A 1UEBA 4ZK9B 2K14A 3GTOB 4JPBW 4KKUA 2QA4A 1GUSA 2OWOA 1VQHA 2C5CA 5KNDA 2ASBA 1STGA 1VMCA 5CR3A 4MZ9A 1TWHB 3U50C 1RJTA 1HPCA 4AH6A 3KF6A 3DWQA 1OXUA 3ICEA 3I7FA 3VR2A 5LMUQ 4PV1C 4EQPA 1PTOF 1LYLA 3M85A 4KHPQ 2R93B 4FXDA 1SAPA 3TRZA 1DM0B 3H0GB 3SK5A 4DR5Q 1EUJA 1Q81C 1XX8A 3MTSA 2C35B 1DOLA 4JVZA 3GTMB 3SVMA 4H02A 1B9NA 1HFGA 5KYIA 3M4OH 1D5MC 3I73A 5M5WB 3IRBA 1VQOA 1EY6A 4OO1I 1O7IA 4J15A 1F2ZA 2CKZB 2D9UA 2NBFA 3MXNB 1OXSC 1MSGA 4DNTB 4DV4Q 2NVTB 1X54A 1CZWA 2B2VA 1BOSA 1EY8A 4WJ4A 4LF5Q 3QOLA 1UNSA 4LMQD 2PMZB 1UE1A 3LWEA 4NDXA 2F0VA 5IYBG 2YTVA 3PO2B 1VQ5A 5D3DA 3VR4A 1XPRA 1GUGA 4PQXA 3P75A 4FO2A 4IFDI 3D8GA 5DLQE 2B29A 2K5VA 4A3MH 5T1IA 2F0WA 1E24A 3J7AF 5M9OA 4JI0L 1MHWC 1YEZA 4WORA 1N36Q 1SMYD 2F52A 2Q2HA 3TDQA 1H9SB 1EQRA 1Y8PB 3H3VI 2A74C 4BY7H 1ILPA 5IP7G 1XPUA 4A3BB 1WTPA 1HFNA 2OCEA 1HNZL 5IT9E 2N49A 1LTBD 2PQEA 1SNDA 2H4OA 2JQOA 4GN5A 2WACA 1S5BD 4L5QA 3TQYA 4DV1L 3TZUA 1SMYC 3E3XA 4HJ9A 3D4DA 2EY5A 4JC0A 3U9OA 2Y0SG 2CW0D 1BVSA 1ZKOA 2VS1A 4LK1C 3I4OA 3Q23A 5I9OA 3I3CA 4HTHA 2VNUD 1IBMQ 1X3PA 2K1BA 3S1RH 3DM3A 1TKWB 3CPFA 2AWNA 1QB5D 3CF5A 4G7ZC 2YV5A 1L2FA 3EVQA 1LACA 3H91A 3A74A 1I4PA 1JORA 1YI2A 2VB3X 2TSSA 2NVXB 2CW0C 4LFAL 1QWYA 4ID6A 2RKSA 3MEFA 2VQEQ 2KECA 3OOCA 5LHY1 4A3MB 1U4PA 3I90A 2ZM6L 4DK0A 3G6EA 1EQTA 3KOJA 1FNUA 1SJHD 3T13A 3W2DA 5BR8Q 4BY7B 4L5TA 3CQZH 2IY5B 1VQCA 2K6AA 3A5ZB 1G291 2E2DC 1KQSA 4DUZQ 1XTDA 4XT3B 3S16B 2DGYA 2Q8RE 2RHQB 2KQ3A 3QIAA 3J7YW 2I0QA 3IFDA 4IPGA 4ZCKA 4A3FG 3HKZB 5HURA 2FHTA 4PZ6A 1L0XB 4HJ5A 2MNAA 1I50B 2XSCA 1IYJB 5C3EG 1BCPB 4A3GG 3KJPA 1XNRL 3S9WA 2R7FA 3V96A 5FLXE 1WYDA 2B3GA 2MUYA 3F1ZA 1K0RA 1DOMA 4K6DA 2UUBQ 2KVMA 1PYBA 5C3WA 1B1ZA 2QDLA 1CT1D 3Q6SA 2HCCA 5JJZA 2EY6A 2MHVA 5GAGC 1PFMA 1SNOA 4JI7L 1AH9A 3E9HA 3TEHB 3RLNA 3K58A 2EY2A 3URYA 1LT4D 1Y1VH 1GUNA 1Z6HA 1E22A 2PQAB 1UEAB 2ZJPA 3CQZB 2HHHL 1VQMA 4PZ7A 5KNBA 4UAIA 3K5MA 4CGYB 2K32A 5HY6A 1QG7A 2E5LL 2N78A 2L15A 2H1EA 3CCVA 2KHIA 3RZDB 4LUOA 3KLWA 5JVH3 1PV4A 4RCNA 1SSOA 2R92B 3AQQA 2PI2A 4QUCA 3DWPA 3HOVG 3CP0A 2CWPA 1RTNA 1XMQL 2EZVA 4OWTB 5ELBA 1K3RA 1KNEA 4WFN3 1U4RA 3TP7A 1SE4A 2ZXOA 5IOCA 2EOTA 2EE1A 4DPGA 2GN5A 3A8JE 3R3OA 1HZBA 4B3RQ 3I2ZA 3NTHA 4JI5Q 1GUWA 2RF4A 2F4VL 4RH6A 3TZDA 4MTNA 5ELCA 2I5LX 4DR3Q 1I6VC 4C1NK 1CZGA 5M3FB 2L12A 3TREA 1A63A 3J80c 2F0PA 5D3IB 4RWSC 4QUFA 1MD2D 3I70A 2F3WA 1WTQA 3NHHA 1I94L 1MGSA 3NBHA 4NP5A 3I55A 4FXGC 2I5MX 1VQGA 5M3MG 2LKVA 3J81i 3KF8A 3U4VA 5IYCG 4JI6L 1YJ9A 3N6RA 1LT5D 1QNUA 2UU9Q 4LFCQ 3H3VC 2TMPA 3J81L 3OIPA 4IALA 3I4MH 1ZYRC 3OTOQ 4YWKA 2KOLA 3NTIA 1EOVA 3EN2A 1I3QH 4OWWB 2LXJA 4RFBA 3EROA 2X6LA 3LWUA 1K28A 1SNMA 1M4VA 4DUYQ 5FJ8G 3PIO3 4WJWA 2F03A 1NBWA 2XN9C 2N3SA 1EOTA 1HZ9A 4A3CG 1G2SA 2F0DA 4A3CH 3D4WA 2DNCA 3PIOA 2K5DA 1A2UA 2QCPX 4DNRB 4OL7A 1Q8KA 3M4PA 2F0JA 1TU2B 2SNMA 2VB2X 2MFIA 1SNQA 3T4AC 3AEVA 2JA5G 1NMFA 2IPKD 4HCEA 5DM73 5A2QL 2XTIA 4A3DG 2EPBA 1EIFA 2SOBA 1VQPA 3NSWA 3J81c 3KLSX 4YHHQ 4R4QA 1TR5A 1F9PA 1CUKA 1VQEA 4PNYA 4P72A 5CC4A 5FLMH 3I4MB 5JVG3 3PF4A 1CKNA 2K03A 4YIJA 1EU4A 1OXTA 2RCNA 3BVZA 1KL9A 1L1OC 2QGQA 1HJPA 4NXML 1I3QB 3PSIA 1O80A 4C3HH 1B50A 4TSSA 4RGNA 3FHWA 1CKOA 2B2WC 2R7ZG 2R7ZH 2A69D 3A0JA 3K7UC 3NBIA 1VQKA 1FL0A 1EY7A 3CCRA 4R4OA 5IWAQ 4WRDA 2VXWA 2JK8A 1V1QA 1WTWA 1EY0A 4U68A 1GVPA 3FKIB 1N34L 1DD2A 1RD9D 2A69C 2EJMA 4K8JA 3EA6A 1BCPF 1KC8C 3S15H 4FF3A 4JYAQ 1F2YA 2Y0SE 2C9OA 3DUZA 4ZUJA 2HIXA 1IYVA 4MN3A 1E2ZA 1IBLL 2YU9H 4BBRH 2XGTA 3K6OA 3J81j 4PMCA 4DV5Q 1VQAA 1I4HA 1HZCA 1WCMG 4OO1H 2CH4A 3HFZB 1Y14B 3RZOH 5JAVA 4L6TB 1QZHA 3CW2C 3IFTA 4RHSA 1HR0L 2GVAA 2ALYB 2BDOA 3HP3A 4CDCC 5GROA 4ZKCB 1X3EA 3VR5A 1YHAA 4Q0FA 4C3HB 3ZYYX 2OQ0A 3OYYA 2M9VA 3NEMA 2EJFC 3D3RA 1JWSD 2CH4W 1HUNA 1LTTD 4CDDC 1R9TH 1ASZA 1EQQA 4O0AA 3FPUB 1JJ2A 4IFDH 4KHZA 5CMDA 5JEAJ 4BY1G 3GTQH 2MO0A 2ZJQA 4XTCS 1EY9A 4BY1H 2BOSA 2X6GA 4QY7A 4IUPA 3O13A 4XYOA 4DGZA 3Q24A 4R9WA 3H3VH 4M1UB 4A3LG 1V1PA 3MZ5A 4A3LH 2UXCL 4C3IG 1BDOA 5EQ0A 2YU9B 4BBRB 5K36G 4YCVA 5DEHA 1CSPA 2IW3A 4J1MA 1KNAA 5C4JB 1HNWL 2NN6G 4DAMA 4JBMA 2E2IB 3H94A 3RN2A 1PXUA 4A93G 4A93H 1IKMA 1IL8A 4LF6Q 4X65L 3R2IA 1EQVA 3TSSA 4YY3L 3M4QA 1CHQD 1B9MA 2WP8J 4EGVA 1WTVA 1SFOB 2NZ1D 2A73B 3C1EA 1ET6A 5E4XA 1R9TB 4BBSG 2EYJA 3GTGH 4BBSH 2M00A 1QVFA 3SK8A 1L0WA 5EGTA 1CM9A 1BQQT 3HOUG 3M3YH 2A19A 1N9WA 4DAYB 4DV3L 3EFXD 1PH4A 2F0FA 2FMMA 4QF4A 3PUXA 1S5DD 1FGBD 4O2DA 2K04A 1GKHA 3CAMA 1KDCA 2E2HH 2JA6B 2WB1B 4KHVA 4OHJA 1NY4A 1L1OA 3KUPA 5ELOA 1HCZA 2JP1A 5ELFA 1K83H 2B2WA 1LTSD 2E2JH 4XQJA 3CD6A 4GNXC 1SYFA 3G48A 1Y8NB 3QO2A 1S4ZA 1Y1WG 3CHBD 2RCFA 3DM1A 1GM5A 4JI4Q 3OSOA 1Y1WH 4LUVA 2CWAA 4HN7A 1PHJA 1HHVA 1MSHA 4O1NA 2XIWA 5HGQA 2WKDA 3ULJA 4A3KG 1SMXA 3A56A 4UP8A 4FXKC 4DR5L 1YITA 5ELDA 5C0XG 5EJWA 4IUVA 2PZWA 1NR4A 3QG1A 1G51A 2K28A 1B7YB 1VQDA 3MFGA 1JOKA 3M3YB 1YJNA 4Y7NH 4IQZA 5I9PA 5J39A 1UE7A 1IXRA 3BVGA 2KHJA 1SN8A 2K5WA 2NTSA 3GV6A 4A3IB 3HOXH 2E2HB 4C56C 2ZTDA 3TP5A 3CXCA 2M2LA 3OWEB 2WV6D 1EIHA 3RD4A 4TKOB 4CDEC 3GTLH 1F77A 1C0AA 1U4MA 2CCZA 5J1ZA 4OGQC 1D5ZC 4DV0Q 3L9AX 1BBXC 1FD7D 2XRSD 4HIKA 2Z4HA 1DONA 2BH8A 3VR3A 2PZTA 4XQNA 1VQLA 1TY0A 5KIXA 2J4XA 4JI2Q 3M7GA 1Z47A 4QIWB 3MHBA 1N36L 1HNXQ 2N8NA 4K8IA 5I6WA 4HJAA 3RUZA 1KRSA 4DK6C 1C48A 3TMEA 1WD0A 4X64L 3CCUA 2UUAQ 1WOCA 3RLOA 1FYCA 1I4RA 1UE6A 4DU9A 2JEAI 2NVQH 4KJNA 3NUCA 2UXDL 4FVMA 1NAPA 4CKBA 4ODGA 5EPJA 3CCSA 3K80C 1LTID 4DR2Q 4DV7Q 3SGIA 1PZKD 3HOXB 3PO2G 3HOYG 3I4NB 1GHKA 5EPKA 1IBML 3HOYH 1WI5A 4F8MA 3NQTA 4HIDA 3GTLB 1J5EQ 5C4XG 3BU2A 3OW7A 4JBJA 1B70B 3W3AA 3S1QH 3CMAA 2DJFC 1QUQB 2JA7G 4IOCA 4DR6Q 5CV6A 1LTLA 3OMGA 4JV5L 1S72A 4AQYQ 4GKJL 1VCIA 2F3VA 1B4OA 3JC66 2F0UA 5BR8L 1G8ZD 5IYBH 3S1MH 4LF8L 4JI8L 3KF6B 2D0PA 2N55A 4UHVA 3LNNA 2UUCL 5FO7B 1QJOA 3M4YA 3C3LA 1LT6D 2V1CC 2EYLA 3BYYB 1CSQA 2ZXRA 1P16A 1PRTD 4GNXA 1QE6A 2HQLA 5I4DA 3P20A 1E0BA 3T1YQ 3A8KE 3HKSA 3L7ZC 1ET9A 4ILWA 5IP7H 1JE4A 4DR7L 1EL0A 2I5HA 2EYPA 5EBCA 3M4OB 2F0QA 2J0TD 4XYQA 2MPMA 4DR4Q 3S14H 2F0NA 4FF2A 1PRTC 1AE2A 1QNKA 4NPSA 3R93A 2NN6I 1XPOA 1X3QA 1T5EA 3SHLA 5E3FA 3ULLA 4OIKA 5C4HA 1C9OA 4GKKQ 4LFBL 1R4QB 1IHZA 1IKLA 2JA9A 1I6HH 4LUZA 4QCLA 4DFAA 1NE3A 2LY7A 3D0FA 5LMNL 2RSOA 1EU3A 5T1GA 5AFWA 1I4XA 3WOEA 1EZ8A 2X69A 2JA8G 2KHSA 3EQLC 1UAPA 1PH2A 2JA8H 3ONAB 2A1AA 1ONLA 2R61A 1JR0D 5KGUA 4JI3Q 4QL5A 4B9WA 5FO9B 1TWAH 2BA0A 4IN3A 3WOFA 5BN4A 1EYAA 3VYRA 3R8BA 2CVRA 2B2TC 1AW7A 3U4ZA 1QOHA 4KY5A 1M8AA 3A8IE 2YTYA 2EY1A 3GDEA 2IWHA 4IZ8A 2AWOA 1YHQA 2I46A 4LF7L 5IT9L 4DN4M 4HR7B 4IPHA 5TSSA 4A3FH 2G5DA 1SXTA 2ATWA 2NVYH 4KK7A 1D1KA 4YCWA 3S1RB 3NPPA 1KABA 5C3EH 4JI5L 4RG1A 3HOZG 4GOPC 2H5XA 3AFPA 1TY2A 1II3A 2AMCB 3HOZH 4A3GH 4MIUA 1X9NA 1GHJA 3SXHA 3S2DH 3GTJH 5KYLA 1VMPA 4QQBX 1JOOA 5C0XI 3Q0AA 3BDCA 2ZTCA 1KHIA 1LO5D 1PTOD 1YBYA 3STBD 5IGBA 1STAA 1V43A 4LNQA 2R92G 2JSOA 2HCIA 4X66L 1HNZQ 4CJ0B 4JK1C 3S17H 5ELEA 2HT1A 4CJ1B 2XVSA 1K3BC 4FYDA 2B63G 1PFSA 2IHFA 3E6ZX 3HG9A 3A5UA 3JAME 4OONA 2QW7A 5C3XA 4A3EG 1PTOC 2VQFL 3STBC 4OX9L 4I7AA 4RGTA 5IT9c 1PDQA 2A68D 3OTOL 3J80i 3Q22A 3AYHB 3NE5B 1WTOA 4A3FB 2RBMA 3T53B 3J80L 5C44G 3T1HL 3E5SA 1HQMC 1SYEA 1VF5C 2O4XA 1VQ8A 3HEJA 5M3FG 2JE6I 3HOVH 4KN7C 3S2DB 2A68C 1A3VA 3TP8A 3BDOA 5FO8B 3UE1A 4LJZC 3RNUA 2L0CA 2L1BA 1M90C 3UE0A 2ZM6Q 2BH2A 4JI1L 3F8TA 1HRJA 4BXXG 2O2LD 2EYOA 2P5ZX 2EXDA 1CFMA 5COYA 2R6GA 4C1NI 1Y1VB 1YVCA 1QILA 2LSSA 3A54A 1MI2A 4LF9L 3C46A 4L8JA 1H9RA 2OTLA 1T5XD 3BDLA 3S1NH 5KEEA 2MGSA 4X62Q 2RHSB 1RTOA 1BF4A 2L9HA 1V8QA 5EKIA 4K5WA 1EZ6A 5I2YA 1XNRQ 5BN3A 1TXYA 4H0LC 3AFQA 2RVLA 1JICA 2KEEA 2CHBD 3KBXA 1L0YB 1X3GA 4DV2Q 3K7AH 2VL6A 4P2CB 1GUOA 1WTRA 2ZTEA 3HOVB 5M3MH 1SROA 5GAEC 1MJEA 5IYCH 4DKAC 1JE5A 2PNRC 1JJCB 1ASYA 5FLXc 5IWAL 4GN4B 1TQOA 2OQKA 1B8AA 3CRLC 2Z6KC 2NUCA 2Q8IB 2O5JC 2F0OA 1IW7D 2B2TA 2L4NA 1JQYD 2HHHQ 5C5LA 2B8GA 4DAPA 1JWMD 3CKIB 3BZDB 4F7XA 1V1OA 5IGFA 3M9BA 5FJ8H 3W1BA 1TVXA 3WDNA 2E5LQ 1EYDA 2PMZE 4CJ2C 5BN5A 3MXPA 4IURA 2EYMA 1BXTA 4R1JA 1DJRD 3IL8A 1IW7C 2UXBL 4I7ZC 2DNEA 3P1HA 4FDBA 4DV6L 2QEJC 4GOPA 3D6WA 1WFQA 5EPLA 4RA8A 3OIQA 3X3MA 1VDZA 3K8AA 2JA5H 3NBHB 4MTKA 5ISRA 3PO3G 3K7AB 4A3DH 4RHRA 1SBBB 1G2TA 1VQ4A 4AYBG 4A4IA 1A2TA 1LABA 1GJXA 5M3MB 1B3AA 1Q86C 1N32Q 4Z9CB 1XTCD 2NYZD 4ZQ3A 3TP6A 2WAQG 3AMUA 1D1IA 3PIP3 2F4VQ 1PH5A 2AUJD 4GLAC 5KRUA 1PH8A 1JCKB 3BZCA 4HSPA 5JJIA 1PTOH 3FVQA 1KXLA 5KNCA 4N9PA 3X3NA 3NELA 3CPWA 2B39A 3PIPA 3AB9A 1N8RC 1F9RA 2XWBB 2NB0A 3T51B 2JN4A 3E9IA 5IGDA 4IUNA 1YNND 1A6XA 4L5SA 2CQOA 1LTAD 3S2HH 4NXNQ 3FMCA 4K5XA 1U0LA 4KD4A 1MIUA 1I94Q 4KV6A 3W1GA 2GA4B 3OPOA 1S5ED 4DK1A 4F87A 2YTXA 3PUZA 5E1FA 1YNNC 3HOWG 4JI6Q 1ENFA 1SE8A 3HOWH 1RKNA 2HIVA 1VS0A 5LL6X 4LF6L 2G9HD 1RF2D 3LGJA 1AZQA 1V9PA 1ICFB 2SEBD 5LMNW 1MKHA 1WCMH 3VA7A 1CKNB 3B6YA 4DR1L 1N33L 5CV9A 4C3JG 3I4LA 4GLVB 4L5RC 3E0EA 4C3JH 2WKCA 5GADC 5IGCA 1TWCH 4X3UA 3RR5A 1NJIC 1JB3A 2R7ZB 2AUKA 4B3ML 1NNXA 3NP8A 1LLRD 4OWXB 1TWFH 2GVBA 2ENBA 3D6CA 2EJGC 4KKTA 4CKEA 4LF4L 4B3SL 4Y52H 1YNJD 2AQ2B 5JPNC 4DF7A 1SYDA 2J7ZA 1E7ZA 4JI4L 3S15B 4HIOA 3DEPA 5FKAC 5ELNA 1NR2A 3FRPB 4ZRZA 4C3IH 3MXGA 1ICWA 2Z6KA 4K0KL 3NXWA 4X6AH 3K0XA 4TVAB 1Y8OB 1FNVA 3IKJA 3RLFA 4NXMQ 1YNJC 1RODA 1Q1EA 5K36H 3RZOB 1WCMB 1BKBA 4DAYA 2V4DA 4OIJA 4OEMB 2NN6H 4KY6A 4A3JG 5AJ3Q 1K9MC 5JJLA 1LUZA 3CCJA 1XNQQ 1FJGL 2YYZA 3F2BA 1YJWA 2WB1G 1TWCB 4KMUC 5DAUA 4CHTB 2F0TA 3J7ZC 5J3BA 3I72A 3L3OC 4P73A 4JG2A 4R4TA 1W2BA 3QOJA 2VUMG 2JYOA 1PH9A 2VUMH 3K59A 1T9HA 1AZPA 2ES2A 4DAVA 2D5DA 4PMWA 3GTQB 5I6YA 1F2LA 1STYA 2F0SA 4BY1B 2DY8A 1CTMA 1EY5A 3HOUH 3N52A 4XQQA 5JEAG 4R8NA 1IBLQ 4O42A 5C5MA 3FPPA 4ME3A 4UY8C 1KRTA 5GAHC 1V1PB 4R4IA 3HZXA 4C3IB 2D0OA 2CFMA 3KDFA 1KLUD 3DMUA 2B8FA 4C2MH 5J22A 1PFNA 3GD7A 1E3PA 1EWHA 3K5LA 1FNWA 3SEBA 3DHQA 3DXJC 2FJ2A 2EYHA 3PMFA 2LS01 4A93B 4A3IG 1X56A 3U9SA 5LMUL 3QB3A 2K01A 2WIIB 4KHPL 5A35A 4A3KH 4DR2L 4DV7L 1IBKQ 3J7A5 5C0XH 1LV9A 3UDIA 5K5PA 3GTGB 2MQHA 4FNFA 4BBSB 2F0GA 1U4LA 1VQJA 2OT2A 1J5EL 1Q7YC 2A8VA 1OXXK 3KLRA 3HOUB 3K57A 1VQBA 1BCPD 3OWFA 2Q8TA 4I65A 2OXPA 1S40A 5IP9G 4DV4L 1Q1BA 1HNWQ 5IP9H 4GS3A 1OTCA 4DR6L 1TWHH 1L1OB 4LF5L 2OEOA 1K83B 4X65Q 1BCPC 1SEBD 4B9XA 2E2JB 1YNXA 4H7BA 2F0LA 3FEWX 2R93G 4K2LA 2A6HD 3H0GG 3NWSA 4DXGA 1HA6A 1Y1WB 1GXDC 4L63B 1TS3A 1AN8A 3HGBA 5IODA 2IX1A 1Q12A 2PPBC 1X6OA 1DOKA 1O7YA 1UE5A 4IPCA 2BCOA 2HUGA 1K8AC 4ZAIA 4A3KB 2LFNA 4UDUC 5M5WH 3ULPA 1IZ6A 5D14A 1J6QA 2QILA 4CKCA 3T1YL 4GN3B 4IJHA 3J7AV 1ZEQX 4HIMA 3MXNA 4Y7NB 2NVTH 4RGMA 1CA5A 4A76A 5CV4A 1H95A 3MXUA 2FMCA 3NK9A 1XMOQ 3MVVA 2G9DA 4IUUA 3PO2H 2Z6BA 4GKKL 2NWGA 1E2WA 1E1TA 4B3TQ 5C4XH 1FGUA 4AYBE 3MWYW 4RCOA 2IJ0A 4HCSA 3UDGA 1BBWA 3OHXC 5I2XA 5IYDG 1PMRA 1K73C 4YCUA 2KCTA 5IYDH 4HMJA 5M5YH 2WAQE 2VQEL 2PW7A 3GO5A 1H9SA 1G91A 1EYGA 4A3BG 4JI3L 2JA7H 4A3BH 1A3UA 3F2CA 4KKSA 3P7JA 4RGOS 4HMIA 2D62A 2RDHA 4JBKA 1Q3LA 2L55A 3LX0A 1BNZA 2BA1A 1S5CD 2K50A 4DK3C 2IX0A 4DUZL 2VZAA 4IJLA 1PH1A 3VA5A 4WJ3M 2K33A 4RKLA 1TS5A 2NVQB 2IL8A 2PNHA 1LTGD 3TS0A 1PYSB 1SR3A 4G4KA 1DZ1A 1SNPA 4B08A 1SYGA 3PUWA 3K5OA 5IE8A 1J9OA 1PH3A 2RA4A 4G7OC 4V190 2QKIC 2PZUA 5G3LF 2N88A 4KTAA 4BA2I 1QVGA 2NVXH 3MAQA 3UI2A 3HOYB 4POGA 3BYTB 2AKWB 4A3MG 2R7DA 5C4XB 1BUVT 1B3QA 1HR0W 2UUBL 4LW1A 2JJQA 3S1QB 1D7QA 1DCZA 3G6JB 3KFUA 5M5YB 3SR1A 4BY7G 2KUMA 1ENAA 2LXKA 5C4ZA 2Z9HA 1RCVD 4KJOA 2JA7B 4N9TA 3T16A 1W6KA 4X64Q 3PQIA 3WWVA 1I5FA 3S16H 4E6IA 2EXZA 1WJJA 1AFPA 2UXDQ 1Y69U 3S1MB 4HEDA 1A62A 2L11A 3KJOA 3VYTA 3HKZG 4X3KA 2XRQD 1ENCA 4UP9A 1I50H 1VF7A 1EWCA 2E76C 2CQAA 5HGTA 4H13C 3SK6A 3CC2A 4GNXB 2QF7A 1MBYA 1NMGA 4H44C 4LWCA 3KLSA 3D4RA 1PH6A 1EIYB 2PYKA 4QB4A 1QCBD 1KTKA 4P74A 1LTRD 3NQIA 5CORA 3ERSX 4NKLA 3PGZA 1SJED 2F0MA 1VQ6A 1EIGA 3TN2A 2HQEA 3S14B 4R4CA 5JJKA 4JV5Q 1HUMA 2Z1CA 2Y0SB 1KLGD 4GKJQ 2Q2TA 3K0YA 3GTPH 2PQAA 4B3RL 4HAEA 4IO9A 2DY7A 4OXPA 1HQRD 2WB1E 4IPDA 1GD7A 4JI8Q 4U673 4LF8Q 1HA5A 3DLLA 1Q90A 3J80E 1I6HB 2F0KA 1CQFA 2R3ZA 2UUCQ 1CA6A 3ER0A 5D65A 5EAYA 4DR3L 1Q46A 4JI0Q 2JA8B 2F0IA 4X62L 1R4PB 3RZDH 2PW5A 4V0BA 3CCLA 1TWAB 4IUQA 1D2BA 3H6MA 4J6HA 2R92H 4DR7Q 1CKMA 3A7AB 3A55A 1EY4A 1DYQA 1O7LA 3C1FA 3PV0A 1JJGA 1VQNA 4DV1Q 2EQSA 2B63H 2PCFB 1F9SA 1AE3A 4DV2L 4A3EH 5M5XH 3FP9A 2UU9L 3EJIA 4LFCL 1EWIA 1CHPD 5F2DA 1CQVA 3Q8DA 4LFBQ 1JT8A 3PCOB 1Y1VG 3CC4A 4X3SA 1JWUD 1B44D 3MA2B 1YZ6A 5LMNQ 1GUTA 2NVYB 3GTPB 1TS4A 5E7NA 3A7LA 4LFAQ 5C44H 4ME5A 2B2YC 5C3EB 3MFYA 2K5HA 2HDLA 4DUYL 4A3GB 3CCQA 3HOZB 3QR8A 3SK4A 4P71A 3GTJB 1STHA 3ERQA 5M3FH 4CDFC 3UDFA 5FOBB 2K75A 3UDXA 5DNFA 2SDFA 1QVCA 4R8IA 1O7ZA 1K0SA 1E2VA 3J81E 3EBEA 5FLXL 1DXMA 4TQUS 4BXXH 4OELB 5G3LD 1K8MA 1TWGH 4KD3A 3S17B 1KAWA 1CK1A 4QIWE 1SNCA 4JBWA 5CV7A 2OF1A 2B63B 3CCEA 1PVOA 1YHBA 4A3EB 1VQ9A 1U5KA 5M5XB 4APVA 4YHHL 4LF7Q 4P75A 1N32L 3NTKA 3JAMi 1P8LA 5IY0A 4GLXA 2I07B 1XYIA 3KK7A 3HS0C 1W6JA 5DM63 3JAML 2A6ED 2FINB 4XXEA 3L2PA 1ML0D 1G6ZA 1Q82C 5C44B 1SDFA 1J8IA 1W3SA 4A75A 3RN5A 2AHOB 5A2QE 3BS1A 2DN8A 2EYFA 1I4GA 4X66Q 4JI7Q 2A6EC 1WVLA 2F1MA 5L37A 1VQIA 1ZYRD 4NMZA 4NXNL 1GOZA 4YWMA 3IAYA 3VYSA 4IOAA 4BA1I 1SLJA 4PMBA 2VQFQ 4X3TA 4Q5VA 1TWGB 2JXMB 1YIJA 2RDGA 2EIFA 4OX9Q 1UWVA 1STNA 3D31A 1LT3D 1PRTB 3I8ZA 4NW2A 3S24A 4JYAL 2EVBA 3I4MG 2IX3A 3K5NA 2ZXPA 2Q2UA 4RMFA 3S1NB 1F9QA 4DV5L 3OMCA 3ZJYC 3MC0B 3T56B 3JAMc 2VW9A 3T1HQ 1E1OA 4DNIA 2NZHA 1H9MA 3NENA 1SYCA 2B2UC 3TBIB 5IGGA 5EKLA 1XMQQ 4GZYC 2KCNA 3I91A 4LAAA 3F2DA 2F0EA 1FR3A 2KJXA 3PO3H 1EFID 2ICEC 3KF8B 5EKKA 3PF5A 1EFWA 4JI1Q 2K4KA 5IGEA 2MJ8A 3FKIG 3H15A 3GP7A 3FDTA 1H9JA 3FKIH 1SYBA 3PUVA 2A5HA 4G57A 3SDZA 4HJ8A 4LF9Q 2KENA 1PYWD 5JOBA
chains in the Genus database with same CATH topology
1RHPA 2RSNA 4MHEA 4FP5D 4KN4C 4EQOA 1PFBA 1EYCA 4ABNA 3V2TA 1ILQA 2KEDA 4QMGA 1PZJD 4C3HG 2B2YA 1EEID 5FK9C 2D2CC 5IIFA 4K14A 4J8QA 1NUCA 4IFDJ 1TS2A 2JA5B 5LL6S 5CYUA 4A3DB 2RQXA 3PO3B 1JOQA 1IYUA 3CU7A 4AYBB 2SNSA 2NTTA 1O78A 4BS9A 3M7NA 3ND8A 2WAQB 3C2PA 1B2TA 3QWNA 5CV8A 1PTOB 3G7LA 5CBEE 2ZT9C 2F4IA 4OO1G 3KBGA 5EBDA 3HRZC 2F0HA 3S2HB 1AEXA 3MEHA 2PO4A 1TIID 2AQ1B 1TT2A 1NSNS 4KI0A 4ULLA 2JEBI 3QJYA 1BO0A 1HTPA 4CBVA 1HXYD 4ZYSA 1KDBA 3HOWB 3GTKB 1EEFD 4ZLTF 1C8CA 4EVOA 4IFDG 1S5FD 1H9KA 1SE3A 4S3SA 1PZID 1WTXA 3BVMA 3SE0A 1Z7TA 1K8OA 3VYUA 1WD1A 4C3JB 3ND9A 1NCVA 2XNAC 4HSVA 3H09A 4EQNA 4KY7A 4G7HC 4XIGS 4ZKBB 2B2UA 1CI3M 4RAUC 5NUCA 1TWFB 3CRKC 4M8AA 2BE5D 5JEAH 5C0XJ 1XXGA 1JC7A 3R2TA 1A3TA 4XDXA 1U9RA 1ESRA 2MP1A 3ITPA 2AQ3B 2B2VC 2BE5C 2KCCA 2RDFA 1B53A 2K05A 1D5XC 2IT1A 1X32A 2QDBA 1STBA 4A3JB 1F2MA 2LMCB 5C6AA 3VR6A 1PRTF 2Z8LA 1KAAA 4K2KA 1ESFA 5CBAE 3V05A 4DA2A 5E4WC 1UUPA 4XT1B 2VUMB 4K5VA 4FF4A 2E75C 2HDMA 1PLFA 3DEOA 4BWGB 4ZUIA 2BDNA 5CGKA 2KA7A 4DXFA 2EDGA 3DWAA 4F88A 1HTLD 4RKBA 4IUTA 2L5TA 4K6LA 5CV5A 1A15A 1C4QA 2XWJB 3BG3A 3GQBA 4C2MB 1SE2A 4TRDA 1XWEA 3E0JA 2O5IC 2ICIA 1I4QA 2E74C 2K5QA 1OXVA 1STEA 1KDAA 1ZXTA 3NWTA 1Q8IA 2K7VA 2Z4IA 1RDPD 2FFKB 3F2UA 3PUYA 2WINB 2A6HC 2ID0A 1BR9A 1OO9B 3RMHA 1D6EC 3AU7A 1AP0A 5JPMC 4FF1A 3GV3A 4ZK9B 3GTOB 4KKUA 1GUSA 5KNDA 2C5CA 1STGA 1VMCA 5CR3A 1TWHB 1RJTA 1HPCA 3DWQA 1OXUA 3VR2A 4PV1C 4EQPA 1PTOF 3M85A 2R93B 4FXDA 1SAPA 1DM0B 3H0GB 3SK5A 1XX8A 3MTSA 1DOLA 3GTMB 3SVMA 1B9NA 1HFGA 5KYIA 1D5MC 3I73A 5M5WB 1EY6A 4OO1I 1F2ZA 2D9UA 2NBFA 1OXSC 1MSGA 4DNTB 2NVTB 1CZWA 2B2VA 1BOSA 1EY8A 3QOLA 1UNSA 4LMQD 2PMZB 3LWEA 4NDXA 2F0VA 3PO2B 5D3DA 3VR4A 1GUGA 4PQXA 3P75A 4FO2A 4IFDI 3D8GA 5T1IA 2F0WA 3J7AF 5M9OA 4WORA 1SMYD 3TDQA 1H9SB 1Y8PB 2A74C 1ILPA 4A3BB 1WTPA 1HFNA 5IT9E 1LTBD 2PQEA 1SNDA 2H4OA 2WACA 1S5BD 3TZUA 1SMYC 3D4DA 2EY5A 3U9OA 2CW0D 1ZKOA 4LK1C 3Q23A 5I9OA 3I3CA 4HTHA 2VNUD 1X3PA 2K1BA 1TKWB 2AWNA 1QB5D 4G7ZC 3EVQA 1LACA 3H91A 1I4PA 1JORA 2VB3X 2TSSA 2NVXB 2CW0C 1QWYA 4ID6A 2RKSA 2KECA 3OOCA 5LHY1 4A3MB 1U4PA 3I90A 4DK0A 1EQTA 1FNUA 3T13A 3W2DA 1SJHD 4BY7B 2K6AA 1G291 2E2DC 4XT3B 3S16B 2Q8RE 2KQ3A 3QIAA 3J7YW 3IFDA 3HKZB 5HURA 2FHTA 1L0XB 1I50B 2XSCA 1BCPB 3S9WA 3V96A 5FLXE 2MUYA 4K6DA 1DOMA 2KVMA 5C3WA 1B1ZA 5JJZA 1CT1D 3Q6SA 2HCCA 2EY6A 2MHVA 1PFMA 1SNOA 3K58A 2EY2A 3URYA 1LT4D 1GUNA 1Z6HA 1UEAB 3CQZB 5KNBA 4UAIA 3K5MA 4CGYB 2K32A 1QG7A 2H1EA 3RZDB 5JVH3 4RCNA 1SSOA 2R92B 4QUCA 3DWPA 1RTNA 2EZVA 5ELBA 1KNEA 4WFN3 1U4RA 3TP7A 1SE4A 2ZXOA 5IOCA 2EOTA 2EE1A 3A8JE 3R3OA 3NTHA 1GUWA 4RH6A 3TZDA 5ELCA 1I6VC 4C1NK 1CZGA 5M3FB 2L12A 2F0PA 5D3IB 4RWSC 4QUFA 1MD2D 3I70A 2F3WA 1WTQA 3NHHA 1MGSA 3NBHA 4NP5A 4FXGC 2LKVA 3KF8A 3N6RA 1LT5D 1QNUA 3H3VC 2TMPA 3J81L 3OIPA 4IALA 1ZYRC 2KOLA 3NTIA 4RFBA 3EROA 2X6LA 3LWUA 1SNMA 1M4VA 3PIO3 4WJWA 2F03A 2XN9C 1EOTA 1G2SA 2F0DA 3D4WA 2DNCA 2K5DA 1A2UA 2QCPX 4DNRB 4OL7A 2F0JA 1TU2B 2SNMA 2VB2X 3T4AC 1SNQA 2IPKD 4HCEA 5DM73 5A2QL 2EPBA 2SOBA 3NSWA 3KLSX 1TR5A 1F9PA 4PNYA 5CC4A 3I4MB 5JVG3 2K03A 4YIJA 1EU4A 1OXTA 3BVZA 1I3QB 1O80A 1B50A 4TSSA 4RGNA 2B2WC 2A69D 3NBIA 1EY7A 4WRDA 2VXWA 1WTWA 1EY0A 4U68A 3FKIB 1DD2A 1RD9D 2A69C 2EJMA 4K8JA 3EA6A 1BCPF 4FF3A 1F2YA 4ZUJA 2C9OA 3DUZA 1IYVA 4MN3A 1E2ZA 3K6OA 4PMCA 1I4HA 4OO1H 5JAVA 4L6TB 4RHSA 3IFTA 2BDOA 3HP3A 4ZKCB 3VR5A 4Q0FA 4C3HB 3ZYYX 2M9VA 2EJFC 3D3RA 1JWSD 1HUNA 1LTTD 3FPUB 4IFDH 4KHZA 5CMDA 5JEAJ 4XTCS 1EY9A 2BOSA 2X6GA 4IUPA 3O13A 4XYOA 4DGZA 3Q24A 4R9WA 4M1UB 1V1PA 3MZ5A 4C3IG 1BDOA 5EQ0A 2YU9B 4BBRB 5K36G 5DEHA 2IW3A 4J1MA 1KNAA 5C4JB 2NN6G 2E2IB 3H94A 1PXUA 1IKMA 1IL8A 3R2IA 1EQVA 3TSSA 1CHQD 1B9MA 2WP8J 4EGVA 1WTVA 1SFOB 2NZ1D 2A73B 3C1EA 1ET6A 5E4XA 1R9TB 2EYJA 2M00A 3SK8A 5EGTA 1CM9A 1BQQT 3EFXD 2F0FA 2FMMA 4QF4A 3PUXA 1S5DD 1FGBD 2K04A 1KDCA 2JA6B 2WB1B 4KHVA 4OHJA 3KUPA 1HCZA 2JP1A 5ELFA 2B2WA 1LTSD 4XQJA 1SYFA 1Y8NB 3QO2A 1S4ZA 3CHBD 3DM1A 3OSOA 4HN7A 1HHVA 1MSHA 4O1NA 2XIWA 2WKDA 3A56A 4FXKC 5ELDA 5C0XG 5EJWA 4IUVA 2PZWA 1NR4A 3QG1A 2K28A 3MFGA 1JOKA 3M3YB 4IQZA 5I9PA 5J39A 3BVGA 2K5WA 2NTSA 3GV6A 4A3IB 2E2HB 4C56C 3TP5A 2M2LA 3OWEB 2WV6D 1EIHA 3RD4A 4TKOB 1F77A 1U4MA 5J1ZA 4OGQC 1D5ZC 3L9AX 1BBXC 1FD7D 2XRSD 2Z4HA 1DONA 3VR3A 2PZTA 4XQNA 1TY0A 5KIXA 2J4XA 3M7GA 1Z47A 4QIWB 3MHBA 4K8IA 5I6WA 3RUZA 1C48A 3TMEA 1WD0A 1FYCA 1I4RA 4DU9A 2JEAI 4KJNA 3NUCA 4FVMA 1NAPA 4CKBA 4ODGA 5EPJA 1LTID 1PZKD 3HOXB 3I4NB 1GHKA 5EPKA 4F8MA 3NQTA 3GTLB 3OW7A 3W3AA 5CV6A 3OMGA 1VCIA 2F3VA 1B4OA 2F0UA 1G8ZD 2N55A 3LNNA 5FO7B 1QJOA 3M4YA 3C3LA 1LT6D 2EYLA 3BYYB 2ZXRA 1PRTD 1QE6A 5I4DA 3P20A 1E0BA 3A8KE 3L7ZC 4ILWA 1ET9A 1JE4A 1EL0A 2EYPA 5EBCA 3M4OB 2F0QA 2J0TD 4XYQA 2MPMA 2F0NA 4FF2A 1PRTC 1QNKA 3R93A 2NN6I 1X3QA 1T5EA 3SHLA 5E3FA 4OIKA 5C4HA 1R4QB 1IHZA 1IKLA 4QCLA 4DFAA 2LY7A 2RSOA 1EU3A 5T1GA 5AFWA 1I4XA 3WOEA 1EZ8A 2X69A 2KHSA 3EQLC 1UAPA 3ONAB 1ONLA 2R61A 1JR0D 5KGUA 4B9WA 5FO9B 2BA0A 4IN3A 3WOFA 5BN4A 1EYAA 3VYRA 3R8BA 2CVRA 2B2TC 1AW7A 1QOHA 4KY5A 1M8AA 3A8IE 2EY1A 2IWHA 4IZ8A 2AWOA 2I46A 5IT9L 4DN4M 4HR7B 5TSSA 1SXTA 4KK7A 1D1KA 3S1RB 3NPPA 1KABA 1TY2A 1II3A 4MIUA 1GHJA 3SXHA 5KYLA 1VMPA 1JOOA 5C0XI 3Q0AA 3BDCA 1LO5D 1PTOD 5IGBA 1STAA 1V43A 2JSOA 2HCIA 4CJ0B 4JK1C 5ELEA 4CJ1B 2XVSA 4FYDA 3E6ZX 3HG9A 3JAME 5C3XA 1PTOC 4RGTA 1PDQA 2A68D 3Q22A 3NE5B 1WTOA 4A3FB 2RBMA 3T53B 3J80L 3E5SA 1HQMC 1SYEA 1VF5C 2O4XA 3HEJA 2JE6I 4KN7C 3S2DB 2A68C 1A3VA 3TP8A 3BDOA 5FO8B 4LJZC 2L0CA 2L1BA 1HRJA 2O2LD 2EYOA 1CFMA 5COYA 2R6GA 4C1NI 1Y1VB 1QILA 3A54A 1MI2A 3C46A 4L8JA 1H9RA 1T5XD 3BDLA 5KEEA 2MGSA 1RTOA 1BF4A 2L9HA 1V8QA 5EKIA 4K5WA 1EZ6A 5I2YA 5BN3A 4H0LC 2RVLA 1JICA 2KEEA 2CHBD 3KBXA 1L0YB 4P2CB 1GUOA 1WTRA 3HOVB 2PNRC 1TQOA 3CRLC 2NUCA 2Q8IB 2O5JC 2F0OA 1IW7D 2B2TA 2L4NA 1JQYD 5C5LA 2B8GA 4DAPA 1JWMD 3CKIB 3BZDB 4F7XA 1V1OA 5IGFA 1TVXA 3WDNA 5BN5A 1EYDA 4CJ2C 3MXPA 4IURA 2EYMA 1BXTA 1DJRD 3IL8A 1IW7C 4I7ZC 2DNEA 3P1HA 2QEJC 3D6WA 5EPLA 4RA8A 3OIQA 3X3MA 1VDZA 5ISRA 3K7AB 4RHRA 1SBBB 1G2TA 1A2TA 1LABA 1GJXA 5M3MB 1B3AA 4Z9CB 1XTCD 2NYZD 4ZQ3A 3TP6A 3AMUA 1D1IA 3PIP3 2AUJD 5KRUA 1JCKB 4HSPA 1PTOH 3FVQA 5KNCA 4N9PA 3X3NA 2B39A 3AB9A 1F9RA 2XWBB 2NB0A 3T51B 5IGDA 4IUNA 1YNND 1A6XA 1LTAD 3FMCA 4K5XA 4KD4A 4KV6A 2GA4B 3OPOA 1S5ED 4DK1A 4F87A 3PUZA 5E1FA 1YNNC 1ENFA 1RKNA 5LL6X 2G9HD 1RF2D 1AZQA 2SEBD 3VA7A 5CV9A 4C3JG 3I4LA 2WKCA 5IGCA 4X3UA 1JB3A 2R7ZB 2AUKA 3NP8A 1LLRD 3D6CA 2ENBA 2EJGC 4KKTA 4CKEA 1YNJD 2AQ2B 5JPNC 4DF7A 1SYDA 2J7ZA 3S15B 3DEPA 5FKAC 1NR2A 3FRPB 4ZRZA 3MXGA 1ICWA 3NXWA 1Y8OB 1FNVA 3IKJA 3RLFA 1YNJC 1RODA 1Q1EA 5K36H 3RZOB 1WCMB 4DAYA 2V4DA 4OIJA 2NN6H 4KY6A 2YYZA 1TWCB 4KMUC 5DAUA 4CHTB 2F0TA 3I72A 3L3OC 3QOJA 2JYOA 3K59A 1AZPA 4DAVA 2D5DA 4PMWA 3GTQB 5I6YA 1F2LA 1STYA 2F0SA 4BY1B 2DY8A 1CTMA 1EY5A 3N52A 4XQQA 5JEAG 4R8NA 4O42A 5C5MA 3FPPA 1V1PB 3HZXA 4C3IB 1KLUD 3DMUA 2B8FA 5J22A 1PFNA 3GD7A 1EWHA 3K5LA 1FNWA 3SEBA 3DHQA 3DXJC 2FJ2A 2EYHA 3PMFA 2LS01 4A93B 3U9SA 3QB3A 2K01A 2WIIB 5A35A 5C0XH 1LV9A 5K5PA 3GTGB 4FNFA 4BBSB 2F0GA 1U4LA 2OT2A 1OXXK 3KLRA 3HOUB 3K57A 1BCPD 3OWFA 2Q8TA 4I65A 2OXPA 1Q1BA 2OEOA 1K83B 1BCPC 1SEBD 4B9XA 2E2JB 4H7BA 2F0LA 3FEWX 4K2LA 2A6HD 1HA6A 3NWSA 4DXGA 1Y1WB 1GXDC 4L63B 1TS3A 1AN8A 3HGBA 5IODA 2IX1A 1Q12A 2PPBC 1DOKA 1O7YA 2BCOA 2HUGA 4ZAIA 4A3KB 2LFNA 4UDUC 5D14A 2QILA 4CKCA 3J7AV 1ZEQX 3MXNA 4Y7NB 4RGMA 1CA5A 5CV4A 3MXUA 2FMCA 3NK9A 3MVVA 2G9DA 4IUUA 2NWGA 1E2WA 3MWYW 4RCOA 2IJ0A 4HCSA 3OHXC 5I2XA 1PMRA 4HMJA 2PW7A 3GO5A 1H9SA 1G91A 1A3UA 4KKSA 3P7JA 4RGOS 4HMIA 2D62A 2RDHA 1Q3LA 2L55A 3LX0A 1BNZA 2BA1A 1S5CD 2IX0A 3VA5A 2K33A 4RKLA 1TS5A 2NVQB 2IL8A 1LTGD 4G4KA 1DZ1A 1SNPA 4B08A 1SYGA 3PUWA 3K5OA 1J9OA 2RA4A 4G7OC 4V190 2QKIC 2PZUA 5G3LF 2N88A 4KTAA 4BA2I 3MAQA 3UI2A 3HOYB 3BYTB 5C4XB 1BUVT 3S1QB 1DCZA 3G6JB 5M5YB 3SR1A 2KUMA 1ENAA 5C4ZA 1RCVD 4KJOA 2JA7B 4N9TA 3T16A 1W6KA 4E6IA 2EXZA 1AFPA 1Y69U 3S1MB 4HEDA 2L11A 3VYTA 4X3KA 2XRQD 1ENCA 1VF7A 1EWCA 2E76C 2CQAA 5HGTA 4H13C 3SK6A 2QF7A 1MBYA 4H44C 3KLSA 3D4RA 2PYKA 4QB4A 1QCBD 1KTKA 1LTRD 3NQIA 5CORA 4NKLA 1SJED 2F0MA 1EIGA 3TN2A 2HQEA 3S14B 1HUMA 2Z1CA 2Y0SB 1KLGD 3K0YA 4HAEA 2DY7A 1HQRD 4U673 1HA5A 1Q90A 3J80E 1I6HB 2F0KA 1CQFA 2R3ZA 1CA6A 5D65A 2JA8B 2F0IA 1R4PB 2PW5A 4V0BA 1TWAB 4IUQA 1D2BA 3H6MA 4J6HA 3A7AB 3A55A 1EY4A 1DYQA 1O7LA 3C1FA 3PV0A 2PCFB 1F9SA 3EJIA 1CHPD 5F2DA 1CQVA 4X3SA 1JWUD 1B44D 3MA2B 1GUTA 2NVYB 3GTPB 1TS4A 3A7LA 4ME5A 2B2YC 5C3EB 3MFYA 2HDLA 4A3GB 3HOZB 3SK4A 3GTJB 1STHA 3ERQA 5FOBB 5DNFA 2SDFA 4R8IA 1O7ZA 1E2VA 3J81E 5FLXL 1DXMA 4TQUS 5G3LD 1K8MA 4KD3A 3S17B 1CK1A 1SNCA 4JBWA 5CV7A 2OF1A 2B63B 4A3EB 5M5XB 3NTKA 1XYIA 2I07B 3KK7A 3HS0C 1W6JA 5DM63 3JAML 2A6ED 2FINB 4XXEA 1ML0D 1G6ZA 5C44B 1SDFA 1J8IA 5A2QE 3BS1A 2DN8A 2EYFA 1I4GA 2A6EC 1WVLA 2F1MA 4NMZA 1ZYRD 1GOZA 3IAYA 3VYSA 4BA1I 4PMBA 4X3TA 4Q5VA 1TWGB 2JXMB 2RDGA 1STNA 3D31A 1LT3D 1PRTB 3I8ZA 4NW2A 2EVBA 2IX3A 3K5NA 2ZXPA 3S1NB 1F9QA 3OMCA 3MC0B 3T56B 1H9MA 1SYCA 2B2UC 3TBIB 5IGGA 5EKLA 4GZYC 2KCNA 3I91A 4LAAA 2F0EA 1FR3A 2KJXA 1EFID 2ICEC 5EKKA 5IGEA 2MJ8A 3GP7A 3FDTA 1H9JA 1SYBA 3PUVA 2A5HA 4G57A 3SDZA 1PYWD 5JOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MSH A;  1NCV A;  1ZXT A;  2XIW A;  2RVL A;  1JIC A;  1RHP A;  2KEE A;  2RSN A;  4MHE A;  3KBX A;  4HSV A;  1ILP A;  1WTP A;  1HFN A;  1EOT A;  2FFK B;  4ZKB B;  4IUU A;  3F2U A;  1WTR A;  1HUN A;  1B4O A;  1G2S A;  1AZQ A;  4UAI A;  5EJW A;  1PFB A;  4IUV A;  1VMP A;  1NR4 A;  2B2U A;  2NWG A;  1PFN A;  4RAU C;  3FPU B;  5COR A;  2K28 A;  1QG7 A;  5CMD A;  1ILQ A;  4R8I A;  2KED A;  3MWY W;  2N55 A;  1AP0 A;  2FJ2 A;  1EIG A;  2X6G A;  4HCS A;  3TN2 A;  4IUP A;  2B2Y A;  2H1E A;  2B2T A;  1XYI A;  2L4N A;  4R9W A;  3I3C A;  1HUM A;  2HCI A;  4X3U A;  3GV3 A;  1G91 A;  4CJ0 B;  1SSO A;  1X3P A;  2K1B A;  2FIN B;  1ML0 D;  2K01 A;  3GV6 A;  4ZK9 B;  2EPB A;  4CJ1 B;  1G6Z A;  1QE6 A;  4HAE A;  2DY7 A;  4QUC A;  5EQ0 A;  1TVX A;  1SDF A;  3H91 A;  1E0B A;  2M2L A;  1J8I A;  3P7J A;  1VMC A;  4XDX A;  4CJ2 C;  1EIH A;  1F9P A;  1RTN A;  4IUR A;  1ESR A;  1JE4 A;  2MP1 A;  2R3Z A;  1KNE A;  1U4M A;  1EL0 A;  1Q3L A;  1RJT A;  1U4R A;  3IL8 A;  1CA6 A;  1LV9 A;  2B2V C;  1KNA A;  5D65 A;  1BNZ A;  1B53 A;  2K05 A;  2MPM A;  2EOT A;  2K03 A;  1U4L A;  2EE1 A;  1PDQ A;  2KEC A;  1WVL A;  1X32 A;  1BBX C;  1QNK A;  3R93 A;  2IL8 A;  1X3Q A;  1IKM A;  3D6W A;  1DZ1 A;  1IL8 A;  1O80 A;  1U4P A;  1SAP A;  5EPL A;  3I90 A;  2Q8T A;  4RA8 A;  1WTO A;  1B2T A;  1B50 A;  1DON A;  1GUW A;  2J7Z A;  3G7L A;  4IUQ A;  2B2W C;  4OIK A;  5CBE E;  1J9O A;  2RA4 A;  1EQT A;  1XX8 A;  3MTS A;  4X3T A;  3TZD A;  1DOL A;  3DEP A;  2N88 A;  1WTV A;  5CBA E;  1NR2 A;  2NZ1 D;  5E4W C;  1IKL A;  3SVM A;  1ICW A;  1G2T A;  3I8Z A;  4NW2 A;  3UI2 A;  1HFG A;  4XT1 B;  4XT3 B;  5E4X A;  1F9S A;  1B3A A;  2RSO A;  5T1G A;  1WD0 A;  2VXW A;  5AFW A;  1F9Q A;  1ROD A;  2Q8R E;  2X69 A;  1WTW A;  2NYZ D;  2L12 A;  2L1B A;  2HDM A;  1CM9 A;  4OIJ A;  3ONA B;  4U68 A;  3IFD A;  1PLF A;  3DEO A;  2D9U A;  4RWS C;  1HA6 A;  4QUF A;  2FMM A;  1HRJ A;  1MSG A;  1NAP A;  2B2U C;  1BO0 A;  2FHT A;  2K04 A;  2KUM A;  4X3S A;  2BDN A;  2B2V A;  5COY A;  5EPJ A;  1WTQ A;  1MGS A;  1DOK A;  4LMQ D;  1O7Y A;  3I91 A;  4MN3 A;  1MI2 A;  2HUG A;  3LWE A;  4ZAI A;  1F9R A;  2CVR A;  4IUT A;  2B2Y C;  5EPK A;  4ZLT F;  1C8C A;  3KUP A;  2JYO A;  2JP1 A;  2B2T C;  2HDL A;  1DOM A;  1A15 A;  2KVM A;  2MGS A;  5D14 A;  1AZP A;  2MJ8 A;  1M8A A;  2B2W A;  3FDT A;  5JJZ A;  3Q6S A;  2HCC A;  1RTO A;  1BF4 A;  1WTX A;  4HED A;  3HP3 A;  5DNF A;  2L11 A;  2L9H A;  1F2L A;  1PFM A;  2KOL A;  1S4Z A;  2SDF A;  2DY8 A;  1O7Z A;  3QO2 A;  3DM1 A;  5EKI A;  3N52 A;  4X3K A;  5T1I A;  1WD1 A;  4ZKC B;  1HHV A;  4O42 A;  4DN4 M;  1CA5 A;  2X6L A; 
#chains in the Genus database with same CATH topology
 1RHP A;  2RSN A;  4MHE A;  1C7Y A;  4FP5 D;  1FVI A;  4KN4 C;  4EQO A;  5FLM G;  1PFB A;  2VY3 A;  1EYC A;  1K8G A;  1QZG A;  4ABN A;  3V2T A;  1ILQ A;  4EQ5 A;  2KED A;  4N8F A;  2Z0S A;  4QMG A;  1PZJ D;  4C3H G;  2B2Y A;  3BJU A;  1EEI D;  5FK9 C;  4GOP B;  1Z9F A;  2D2C C;  5AJ3 L;  5IIF A;  4K14 A;  1XNQ L;  4J8Q A;  3GTK H;  1NUC A;  4IFD J;  1TS2 A;  2JA5 B;  5LL6 S;  5CYU A;  4A3D B;  2RQX A;  3PO3 B;  1JOQ A;  1IYU A;  3CU7 A;  4AYB B;  2SNS A;  4HJ7 A;  2NTT A;  1O78 A;  4BS9 A;  3M7N A;  3ND8 A;  2WAQ B;  3BZK A;  3C2P A;  1B2T A;  3QWN A;  5CV8 A;  3KYH C;  4QJF A;  1PTO B;  3G7L A;  5CBE E;  3HKZ E;  4BBR G;  4JOI C;  2ZT9 C;  2UXB Q;  2F4I A;  4OO1 G;  2DUD A;  3KBG A;  2OTJ A;  2DJG C;  4N8X 1;  5EBD A;  4DV6 Q;  5C4J H;  3HRZ C;  2F0H A;  3VDY A;  2E2I H;  3S2H B;  1G6P A;  1WTH A;  1AEX A;  3MEH A;  2PO4 A;  1TII D;  2AQ1 B;  1TT2 A;  1NSN S;  4KI0 A;  4ULL A;  2IHE A;  2JEB I;  3QJY A;  4UP7 A;  1BO0 A;  1HTP A;  4CBV A;  1HXY D;  4ZYS A;  1KIX A;  1KDB A;  2F3I A;  1SFO H;  1DGS A;  3HOW B;  3GTK B;  1EEF D;  4ZLT F;  4ALP A;  3W5O A;  1C8C A;  4AIM A;  1HH2 P;  4EVO A;  3CC7 A;  2WFW A;  4IFD G;  1A0I A;  1S5F D;  1H9K A;  1X65 A;  1MJC A;  3L0O A;  1SE3 A;  4S3S A;  1IBK L;  1PZI D;  1WTX A;  3BVM A;  3CME A;  1X3F A;  2HD3 A;  3SE0 A;  1Z7T A;  1K8O A;  3VYU A;  2ZJR A;  1WD1 A;  4A3J H;  4C3J B;  3ND9 A;  2JA6 G;  1NCV A;  2XNA C;  1GO3 E;  2JA6 H;  4HSV A;  1A8V A;  3H09 A;  2NZO A;  4EQN A;  4KY7 A;  4G7H C;  4XIG S;  4ZKB B;  3G71 A;  1SRU A;  3I56 A;  2B2U A;  1N34 Q;  5H1S E;  1CI3 M;  4RAU C;  5NUC A;  2K5N A;  1TWF B;  3CRK C;  4M8A A;  4MNO A;  1NTG A;  2FXQ A;  1PA6 A;  2BE5 D;  3G4S A;  4DV0 L;  5JEA H;  4NB3 A;  4YWL A;  3TS2 A;  5C0X J;  1XXG A;  4UPA A;  2QEX A;  1JC7 A;  4POF A;  3R2T A;  1PH7 A;  2KCM A;  1A3T A;  4XDX A;  4DR1 Q;  1U9R A;  1HR0 Q;  1N33 Q;  1VQF A;  1ESR A;  2MP1 A;  4JI2 L;  3ITP A;  2AQ3 B;  4PZ8 A;  5GQO A;  2K52 A;  1IL2 A;  2B2V C;  2BE5 C;  2KCC A;  2RDF A;  1B53 A;  1HNX L;  2K05 A;  1D5X C;  2IT1 A;  1X32 A;  1BBU A;  2QDB A;  1KD1 C;  2UUA L;  1STB A;  4A3J B;  4B3M Q;  1F2M A;  2LMC B;  5C6A A;  3VR6 A;  4A3I H;  1PRT F;  2Z8L A;  1KAA A;  1RIP A;  4K2K A;  1ESF A;  4EX5 A;  5CBA E;  4PG3 A;  3V05 A;  4QGU A;  4DA2 A;  5E4W C;  1UUP A;  2PI2 E;  1HZA A;  4XT1 B;  4JCV E;  2VUM B;  4K5V A;  4LF4 Q;  4B3S Q;  4FF4 A;  2E75 C;  1XMO L;  2E8G A;  2HDM A;  1JB7 A;  1PLF A;  3DEO A;  1JMC A;  4JW0 A;  4BWG B;  4ZUI A;  2Q2I A;  4B3T L;  1D8L A;  2UXC Q;  1X55 A;  2BDN A;  5CGK A;  1XJV A;  4K0K Q;  2KBN A;  2KA7 A;  4DXF A;  2EDG A;  3DWA A;  3U58 A;  4F88 A;  1HTL D;  3GTO H;  4RKB A;  4IUT A;  2L5T A;  4K6L A;  5CV5 A;  3GQB A;  1A15 A;  3KDF B;  1C4Q A;  2XWJ B;  3BG3 A;  1S3O A;  4C2M B;  1SE2 A;  3CCM A;  4TRD A;  1FJG Q;  1XWE A;  3E0J A;  4AQY L;  2O5I C;  2ICI A;  1I4Q A;  2E74 C;  2K5Q A;  4JOI A;  1OXV A;  1STE A;  1KDA A;  4YY3 Q;  2R93 H;  3H0G H;  3HOX G;  1ZXT A;  3NWT A;  1Q8I A;  3I4N G;  3EIV A;  2K7V A;  3K81 C;  2Z4I A;  1RL2 A;  3I4N H;  1LM0 A;  1RDP D;  3GTM H;  4KLK A;  2FFK B;  1M1K C;  3F2U A;  1VQ7 A;  3PUY A;  2WIN B;  2A6H C;  4DV3 Q;  2ID0 A;  1BR9 A;  1OO9 B;  3RMH A;  1D6E C;  3AU7 A;  1AP0 A;  2MO1 A;  1QUQ A;  4DR4 L;  5JPM C;  3OW2 A;  4FF1 A;  3GV3 A;  1UEB A;  4ZK9 B;  2K14 A;  3GTO B;  4JPB W;  4KKU A;  2QA4 A;  1GUS A;  2OWO A;  1VQH A;  2C5C A;  5KND A;  2ASB A;  1STG A;  1VMC A;  5CR3 A;  4MZ9 A;  1TWH B;  3U50 C;  1RJT A;  1HPC A;  4AH6 A;  3KF6 A;  3DWQ A;  1OXU A;  3ICE A;  3I7F A;  3VR2 A;  5LMU Q;  4PV1 C;  4EQP A;  1PTO F;  1LYL A;  3M85 A;  4KHP Q;  2R93 B;  4FXD A;  1SAP A;  3TRZ A;  1DM0 B;  3H0G B;  3SK5 A;  4DR5 Q;  1EUJ A;  1Q81 C;  1XX8 A;  3MTS A;  2C35 B;  1DOL A;  4JVZ A;  3GTM B;  3SVM A;  4H02 A;  1B9N A;  1HFG A;  5KYI A;  3M4O H;  1D5M C;  3I73 A;  5M5W B;  3IRB A;  1VQO A;  1EY6 A;  4OO1 I;  1O7I A;  4J15 A;  1F2Z A;  2CKZ B;  2D9U A;  2NBF A;  3MXN B;  1OXS C;  1MSG A;  4DNT B;  4DV4 Q;  2NVT B;  1X54 A;  1CZW A;  2B2V A;  1BOS A;  1EY8 A;  4WJ4 A;  4LF5 Q;  3QOL A;  1UNS A;  4LMQ D;  2PMZ B;  1UE1 A;  3LWE A;  4NDX A;  2F0V A;  5IYB G;  2YTV A;  3PO2 B;  1VQ5 A;  5D3D A;  3VR4 A;  1XPR A;  1GUG A;  4PQX A;  3P75 A;  4FO2 A;  4IFD I;  3D8G A;  5DLQ E;  2B29 A;  2K5V A;  4A3M H;  5T1I A;  2F0W A;  1E24 A;  3J7A F;  5M9O A;  4JI0 L;  1MHW C;  1YEZ A;  4WOR A;  1N36 Q;  1SMY D;  2F52 A;  2Q2H A;  3TDQ A;  1H9S B;  1EQR A;  1Y8P B;  3H3V I;  2A74 C;  4BY7 H;  1ILP A;  5IP7 G;  1XPU A;  4A3B B;  1WTP A;  1HFN A;  2OCE A;  1HNZ L;  5IT9 E;  2N49 A;  1LTB D;  2PQE A;  1SND A;  2H4O A;  2JQO A;  4GN5 A;  2WAC A;  1S5B D;  4L5Q A;  3TQY A;  4DV1 L;  3TZU A;  1SMY C;  3E3X A;  4HJ9 A;  3D4D A;  2EY5 A;  4JC0 A;  3U9O A;  2Y0S G;  2CW0 D;  1BVS A;  1ZKO A;  2VS1 A;  4LK1 C;  3I4O A;  3Q23 A;  5I9O A;  3I3C A;  4HTH A;  2VNU D;  1IBM Q;  1X3P A;  2K1B A;  3S1R H;  3DM3 A;  1TKW B;  3CPF A;  2AWN A;  1QB5 D;  3CF5 A;  4G7Z C;  2YV5 A;  1L2F A;  3EVQ A;  1LAC A;  3H91 A;  3A74 A;  1I4P A;  1JOR A;  1YI2 A;  2VB3 X;  2TSS A;  2NVX B;  2CW0 C;  4LFA L;  1QWY A;  4ID6 A;  2RKS A;  3MEF A;  2VQE Q;  2KEC A;  3OOC A;  5LHY 1;  4A3M B;  1U4P A;  3I90 A;  2ZM6 L;  4DK0 A;  3G6E A;  1EQT A;  3KOJ A;  1FNU A;  1SJH D;  3T13 A;  3W2D A;  5BR8 Q;  4BY7 B;  4L5T A;  3CQZ H;  2IY5 B;  1VQC A;  2K6A A;  3A5Z B;  1G29 1;  2E2D C;  1KQS A;  4DUZ Q;  1XTD A;  4XT3 B;  3S16 B;  2DGY A;  2Q8R E;  2RHQ B;  2KQ3 A;  3QIA A;  3J7Y W;  2I0Q A;  3IFD A;  4IPG A;  4ZCK A;  4A3F G;  3HKZ B;  5HUR A;  2FHT A;  4PZ6 A;  1L0X B;  4HJ5 A;  2MNA A;  1I50 B;  2XSC A;  1IYJ B;  5C3E G;  1BCP B;  4A3G G;  3KJP A;  1XNR L;  3S9W A;  2R7F A;  3V96 A;  5FLX E;  1WYD A;  2B3G A;  2MUY A;  3F1Z A;  1K0R A;  1DOM A;  4K6D A;  2UUB Q;  2KVM A;  1PYB A;  5C3W A;  1B1Z A;  2QDL A;  1CT1 D;  3Q6S A;  2HCC A;  5JJZ A;  2EY6 A;  2MHV A;  5GAG C;  1PFM A;  1SNO A;  4JI7 L;  1AH9 A;  3E9H A;  3TEH B;  3RLN A;  3K58 A;  2EY2 A;  3URY A;  1LT4 D;  1Y1V H;  1GUN A;  1Z6H A;  1E22 A;  2PQA B;  1UEA B;  2ZJP A;  3CQZ B;  2HHH L;  1VQM A;  4PZ7 A;  5KNB A;  4UAI A;  3K5M A;  4CGY B;  2K32 A;  5HY6 A;  1QG7 A;  2E5L L;  2N78 A;  2L15 A;  2H1E A;  3CCV A;  2KHI A;  3RZD B;  4LUO A;  3KLW A;  5JVH 3;  1PV4 A;  4RCN A;  1SSO A;  2R92 B;  3AQQ A;  2PI2 A;  4QUC A;  3DWP A;  3HOV G;  3CP0 A;  2CWP A;  1RTN A;  1XMQ L;  2EZV A;  4OWT B;  5ELB A;  1K3R A;  1KNE A;  4WFN 3;  1U4R A;  3TP7 A;  1SE4 A;  2ZXO A;  5IOC A;  2EOT A;  2EE1 A;  4DPG A;  2GN5 A;  3A8J E;  3R3O A;  1HZB A;  4B3R Q;  3I2Z A;  3NTH A;  4JI5 Q;  1GUW A;  2RF4 A;  2F4V L;  4RH6 A;  3TZD A;  4MTN A;  5ELC A;  2I5L X;  4DR3 Q;  1I6V C;  4C1N K;  1CZG A;  5M3F B;  2L12 A;  3TRE A;  1A63 A;  3J80 c;  2F0P A;  5D3I B;  4RWS C;  4QUF A;  1MD2 D;  3I70 A;  2F3W A;  1WTQ A;  3NHH A;  1I94 L;  1MGS A;  3NBH A;  4NP5 A;  3I55 A;  4FXG C;  2I5M X;  1VQG A;  5M3M G;  2LKV A;  3J81 i;  3KF8 A;  3U4V A;  5IYC G;  4JI6 L;  1YJ9 A;  3N6R A;  1LT5 D;  1QNU A;  2UU9 Q;  4LFC Q;  3H3V C;  2TMP A;  3J81 L;  3OIP A;  4IAL A;  3I4M H;  1ZYR C;  3OTO Q;  4YWK A;  2KOL A;  3NTI A;  1EOV A;  3EN2 A;  1I3Q H;  4OWW B;  2LXJ A;  4RFB A;  3ERO A;  2X6L A;  3LWU A;  1K28 A;  1SNM A;  1M4V A;  4DUY Q;  5FJ8 G;  3PIO 3;  4WJW A;  2F03 A;  1NBW A;  2XN9 C;  2N3S A;  1EOT A;  1HZ9 A;  4A3C G;  1G2S A;  2F0D A;  4A3C H;  3D4W A;  2DNC A;  3PIO A;  2K5D A;  1A2U A;  2QCP X;  4DNR B;  4OL7 A;  1Q8K A;  3M4P A;  2F0J A;  1TU2 B;  2SNM A;  2VB2 X;  2MFI A;  1SNQ A;  3T4A C;  3AEV A;  2JA5 G;  1NMF A;  2IPK D;  4HCE A;  5DM7 3;  5A2Q L;  2XTI A;  4A3D G;  2EPB A;  1EIF A;  2SOB A;  1VQP A;  3NSW A;  3J81 c;  3KLS X;  4YHH Q;  4R4Q A;  1TR5 A;  1F9P A;  1CUK A;  1VQE A;  4PNY A;  4P72 A;  5CC4 A;  5FLM H;  3I4M B;  5JVG 3;  3PF4 A;  1CKN A;  2K03 A;  4YIJ A;  1EU4 A;  1OXT A;  2RCN A;  3BVZ A;  1KL9 A;  1L1O C;  2QGQ A;  1HJP A;  4NXM L;  1I3Q B;  3PSI A;  1O80 A;  4C3H H;  1B50 A;  4TSS A;  4RGN A;  3FHW A;  1CKO A;  2B2W C;  2R7Z G;  2R7Z H;  2A69 D;  3A0J A;  3K7U C;  3NBI A;  1VQK A;  1FL0 A;  1EY7 A;  3CCR A;  4R4O A;  5IWA Q;  4WRD A;  2VXW A;  2JK8 A;  1V1Q A;  1WTW A;  1EY0 A;  4U68 A;  1GVP A;  3FKI B;  1N34 L;  1DD2 A;  1RD9 D;  2A69 C;  2EJM A;  4K8J A;  3EA6 A;  1BCP F;  1KC8 C;  3S15 H;  4FF3 A;  4JYA Q;  1F2Y A;  2Y0S E;  2C9O A;  3DUZ A;  4ZUJ A;  2HIX A;  1IYV A;  4MN3 A;  1E2Z A;  1IBL L;  2YU9 H;  4BBR H;  2XGT A;  3K6O A;  3J81 j;  4PMC A;  4DV5 Q;  1VQA A;  1I4H A;  1HZC A;  1WCM G;  4OO1 H;  2CH4 A;  3HFZ B;  1Y14 B;  3RZO H;  5JAV A;  4L6T B;  1QZH A;  3CW2 C;  3IFT A;  4RHS A;  1HR0 L;  2GVA A;  2ALY B;  2BDO A;  3HP3 A;  4CDC C;  5GRO A;  4ZKC B;  1X3E A;  3VR5 A;  1YHA A;  4Q0F A;  4C3H B;  3ZYY X;  2OQ0 A;  3OYY A;  2M9V A;  3NEM A;  2EJF C;  3D3R A;  1JWS D;  2CH4 W;  1HUN A;  1LTT D;  4CDD C;  1R9T H;  1ASZ A;  1EQQ A;  4O0A A;  3FPU B;  1JJ2 A;  4IFD H;  4KHZ A;  5CMD A;  5JEA J;  4BY1 G;  3GTQ H;  2MO0 A;  2ZJQ A;  4XTC S;  1EY9 A;  4BY1 H;  2BOS A;  2X6G A;  4QY7 A;  4IUP A;  3O13 A;  4XYO A;  4DGZ A;  3Q24 A;  4R9W A;  3H3V H;  4M1U B;  4A3L G;  1V1P A;  3MZ5 A;  4A3L H;  2UXC L;  4C3I G;  1BDO A;  5EQ0 A;  2YU9 B;  4BBR B;  5K36 G;  4YCV A;  5DEH A;  1CSP A;  2IW3 A;  4J1M A;  1KNA A;  5C4J B;  1HNW L;  2NN6 G;  4DAM A;  4JBM A;  2E2I B;  3H94 A;  3RN2 A;  1PXU A;  4A93 G;  4A93 H;  1IKM A;  1IL8 A;  4LF6 Q;  4X65 L;  3R2I A;  1EQV A;  3TSS A;  4YY3 L;  3M4Q A;  1CHQ D;  1B9M A;  2WP8 J;  4EGV A;  1WTV A;  1SFO B;  2NZ1 D;  2A73 B;  3C1E A;  1ET6 A;  5E4X A;  1R9T B;  4BBS G;  2EYJ A;  3GTG H;  4BBS H;  2M00 A;  1QVF A;  3SK8 A;  1L0W A;  5EGT A;  1CM9 A;  1BQQ T;  3HOU G;  3M3Y H;  2A19 A;  1N9W A;  4DAY B;  4DV3 L;  3EFX D;  1PH4 A;  2F0F A;  2FMM A;  4QF4 A;  3PUX A;  1S5D D;  1FGB D;  4O2D A;  2K04 A;  1GKH A;  3CAM A;  1KDC A;  2E2H H;  2JA6 B;  2WB1 B;  4KHV A;  4OHJ A;  1NY4 A;  1L1O A;  3KUP A;  5ELO A;  1HCZ A;  2JP1 A;  5ELF A;  1K83 H;  2B2W A;  1LTS D;  2E2J H;  4XQJ A;  3CD6 A;  4GNX C;  1SYF A;  3G48 A;  1Y8N B;  3QO2 A;  1S4Z A;  1Y1W G;  3CHB D;  2RCF A;  3DM1 A;  1GM5 A;  4JI4 Q;  3OSO A;  1Y1W H;  4LUV A;  2CWA A;  4HN7 A;  1PHJ A;  1HHV A;  1MSH A;  4O1N A;  2XIW A;  5HGQ A;  2WKD A;  3ULJ A;  4A3K G;  1SMX A;  3A56 A;  4UP8 A;  4FXK C;  4DR5 L;  1YIT A;  5ELD A;  5C0X G;  5EJW A;  4IUV A;  2PZW A;  1NR4 A;  3QG1 A;  1G51 A;  2K28 A;  1B7Y B;  1VQD A;  3MFG A;  1JOK A;  3M3Y B;  1YJN A;  4Y7N H;  4IQZ A;  5I9P A;  5J39 A;  1UE7 A;  1IXR A;  3BVG A;  2KHJ A;  1SN8 A;  2K5W A;  2NTS A;  3GV6 A;  4A3I B;  3HOX H;  2E2H B;  4C56 C;  2ZTD A;  3TP5 A;  3CXC A;  2M2L A;  3OWE B;  2WV6 D;  1EIH A;  3RD4 A;  4TKO B;  4CDE C;  3GTL H;  1F77 A;  1C0A A;  1U4M A;  2CCZ A;  5J1Z A;  4OGQ C;  1D5Z C;  4DV0 Q;  3L9A X;  1BBX C;  1FD7 D;  2XRS D;  4HIK A;  2Z4H A;  1DON A;  2BH8 A;  3VR3 A;  2PZT A;  4XQN A;  1VQL A;  1TY0 A;  5KIX A;  2J4X A;  4JI2 Q;  3M7G A;  1Z47 A;  4QIW B;  3MHB A;  1N36 L;  1HNX Q;  2N8N A;  4K8I A;  5I6W A;  4HJA A;  3RUZ A;  1KRS A;  4DK6 C;  1C48 A;  3TME A;  1WD0 A;  4X64 L;  3CCU A;  2UUA Q;  1WOC A;  3RLO A;  1FYC A;  1I4R A;  1UE6 A;  4DU9 A;  2JEA I;  2NVQ H;  4KJN A;  3NUC A;  2UXD L;  4FVM A;  1NAP A;  4CKB A;  4ODG A;  5EPJ A;  3CCS A;  3K80 C;  1LTI D;  4DR2 Q;  4DV7 Q;  3SGI A;  1PZK D;  3HOX B;  3PO2 G;  3HOY G;  3I4N B;  1GHK A;  5EPK A;  1IBM L;  3HOY H;  1WI5 A;  4F8M A;  3NQT A;  4HID A;  3GTL B;  1J5E Q;  5C4X G;  3BU2 A;  3OW7 A;  4JBJ A;  1B70 B;  3W3A A;  3S1Q H;  3CMA A;  2DJF C;  1QUQ B;  2JA7 G;  4IOC A;  4DR6 Q;  5CV6 A;  1LTL A;  3OMG A;  4JV5 L;  1S72 A;  4AQY Q;  4GKJ L;  1VCI A;  2F3V A;  1B4O A;  3JC6 6;  2F0U A;  5BR8 L;  1G8Z D;  5IYB H;  3S1M H;  4LF8 L;  4JI8 L;  3KF6 B;  2D0P A;  2N55 A;  4UHV A;  3LNN A;  2UUC L;  5FO7 B;  1QJO A;  3M4Y A;  3C3L A;  1LT6 D;  2V1C C;  2EYL A;  3BYY B;  1CSQ A;  2ZXR A;  1P16 A;  1PRT D;  4GNX A;  1QE6 A;  2HQL A;  5I4D A;  3P20 A;  1E0B A;  3T1Y Q;  3A8K E;  3HKS A;  3L7Z C;  1ET9 A;  4ILW A;  5IP7 H;  1JE4 A;  4DR7 L;  1EL0 A;  2I5H A;  2EYP A;  5EBC A;  3M4O B;  2F0Q A;  2J0T D;  4XYQ A;  2MPM A;  4DR4 Q;  3S14 H;  2F0N A;  4FF2 A;  1PRT C;  1AE2 A;  1QNK A;  4NPS A;  3R93 A;  2NN6 I;  1XPO A;  1X3Q A;  1T5E A;  3SHL A;  5E3F A;  3ULL A;  4OIK A;  5C4H A;  1C9O A;  4GKK Q;  4LFB L;  1R4Q B;  1IHZ A;  1IKL A;  2JA9 A;  1I6H H;  4LUZ A;  4QCL A;  4DFA A;  1NE3 A;  2LY7 A;  3D0F A;  5LMN L;  2RSO A;  1EU3 A;  5T1G A;  5AFW A;  1I4X A;  3WOE A;  1EZ8 A;  2X69 A;  2JA8 G;  2KHS A;  3EQL C;  1UAP A;  1PH2 A;  2JA8 H;  3ONA B;  2A1A A;  1ONL A;  2R61 A;  1JR0 D;  5KGU A;  4JI3 Q;  4QL5 A;  4B9W A;  5FO9 B;  1TWA H;  2BA0 A;  4IN3 A;  3WOF A;  5BN4 A;  1EYA A;  3VYR A;  3R8B A;  2CVR A;  2B2T C;  1AW7 A;  3U4Z A;  1QOH A;  4KY5 A;  1M8A A;  3A8I E;  2YTY A;  2EY1 A;  3GDE A;  2IWH A;  4IZ8 A;  2AWO A;  1YHQ A;  2I46 A;  4LF7 L;  5IT9 L;  4DN4 M;  4HR7 B;  4IPH A;  5TSS A;  4A3F H;  2G5D A;  1SXT A;  2ATW A;  2NVY H;  4KK7 A;  1D1K A;  4YCW A;  3S1R B;  3NPP A;  1KAB A;  5C3E H;  4JI5 L;  4RG1 A;  3HOZ G;  4GOP C;  2H5X A;  3AFP A;  1TY2 A;  1II3 A;  2AMC B;  3HOZ H;  4A3G H;  4MIU A;  1X9N A;  1GHJ A;  3SXH A;  3S2D H;  3GTJ H;  5KYL A;  1VMP A;  4QQB X;  1JOO A;  5C0X I;  3Q0A A;  3BDC A;  2ZTC A;  1KHI A;  1LO5 D;  1PTO D;  1YBY A;  3STB D;  5IGB A;  1STA A;  1V43 A;  4LNQ A;  2R92 G;  2JSO A;  2HCI A;  4X66 L;  1HNZ Q;  4CJ0 B;  4JK1 C;  3S17 H;  5ELE A;  2HT1 A;  4CJ1 B;  2XVS A;  1K3B C;  4FYD A;  2B63 G;  1PFS A;  2IHF A;  3E6Z X;  3HG9 A;  3A5U A;  3JAM E;  4OON A;  2QW7 A;  5C3X A;  4A3E G;  1PTO C;  2VQF L;  3STB C;  4OX9 L;  4I7A A;  4RGT A;  5IT9 c;  1PDQ A;  2A68 D;  3OTO L;  3J80 i;  3Q22 A;  3AYH B;  3NE5 B;  1WTO A;  4A3F B;  2RBM A;  3T53 B;  3J80 L;  5C44 G;  3T1H L;  3E5S A;  1HQM C;  1SYE A;  1VF5 C;  2O4X A;  1VQ8 A;  3HEJ A;  5M3F G;  2JE6 I;  3HOV H;  4KN7 C;  3S2D B;  2A68 C;  1A3V A;  3TP8 A;  3BDO A;  5FO8 B;  3UE1 A;  4LJZ C;  3RNU A;  2L0C A;  2L1B A;  1M90 C;  3UE0 A;  2ZM6 Q;  2BH2 A;  4JI1 L;  3F8T A;  1HRJ A;  4BXX G;  2O2L D;  2EYO A;  2P5Z X;  2EXD A;  1CFM A;  5COY A;  2R6G A;  4C1N I;  1Y1V B;  1YVC A;  1QIL A;  2LSS A;  3A54 A;  1MI2 A;  4LF9 L;  3C46 A;  4L8J A;  1H9R A;  2OTL A;  1T5X D;  3BDL A;  3S1N H;  5KEE A;  2MGS A;  4X62 Q;  2RHS B;  1RTO A;  1BF4 A;  2L9H A;  1V8Q A;  5EKI A;  4K5W A;  1EZ6 A;  5I2Y A;  1XNR Q;  5BN3 A;  1TXY A;  4H0L C;  3AFQ A;  2RVL A;  1JIC A;  2KEE A;  2CHB D;  3KBX A;  1L0Y B;  1X3G A;  4DV2 Q;  3K7A H;  2VL6 A;  4P2C B;  1GUO A;  1WTR A;  2ZTE A;  3HOV B;  5M3M H;  1SRO A;  5GAE C;  1MJE A;  5IYC H;  4DKA C;  1JE5 A;  2PNR C;  1JJC B;  1ASY A;  5FLX c;  5IWA L;  4GN4 B;  1TQO A;  2OQK A;  1B8A A;  3CRL C;  2Z6K C;  2NUC A;  2Q8I B;  2O5J C;  2F0O A;  1IW7 D;  2B2T A;  2L4N A;  1JQY D;  2HHH Q;  5C5L A;  2B8G A;  4DAP A;  1JWM D;  3CKI B;  3BZD B;  4F7X A;  1V1O A;  5IGF A;  3M9B A;  5FJ8 H;  3W1B A;  1TVX A;  3WDN A;  2E5L Q;  1EYD A;  2PMZ E;  4CJ2 C;  5BN5 A;  3MXP A;  4IUR A;  2EYM A;  1BXT A;  4R1J A;  1DJR D;  3IL8 A;  1IW7 C;  2UXB L;  4I7Z C;  2DNE A;  3P1H A;  4FDB A;  4DV6 L;  2QEJ C;  4GOP A;  3D6W A;  1WFQ A;  5EPL A;  4RA8 A;  3OIQ A;  3X3M A;  1VDZ A;  3K8A A;  2JA5 H;  3NBH B;  4MTK A;  5ISR A;  3PO3 G;  3K7A B;  4A3D H;  4RHR A;  1SBB B;  1G2T A;  1VQ4 A;  4AYB G;  4A4I A;  1A2T A;  1LAB A;  1GJX A;  5M3M B;  1B3A A;  1Q86 C;  1N32 Q;  4Z9C B;  1XTC D;  2NYZ D;  4ZQ3 A;  3TP6 A;  2WAQ G;  3AMU A;  1D1I A;  3PIP 3;  2F4V Q;  1PH5 A;  2AUJ D;  4GLA C;  5KRU A;  1PH8 A;  1JCK B;  3BZC A;  4HSP A;  5JJI A;  1PTO H;  3FVQ A;  1KXL A;  5KNC A;  4N9P A;  3X3N A;  3NEL A;  3CPW A;  2B39 A;  3PIP A;  3AB9 A;  1N8R C;  1F9R A;  2XWB B;  2NB0 A;  3T51 B;  2JN4 A;  3E9I A;  5IGD A;  4IUN A;  1YNN D;  1A6X A;  4L5S A;  2CQO A;  1LTA D;  3S2H H;  4NXN Q;  3FMC A;  4K5X A;  1U0L A;  4KD4 A;  1MIU A;  1I94 Q;  4KV6 A;  3W1G A;  2GA4 B;  3OPO A;  1S5E D;  4DK1 A;  4F87 A;  2YTX A;  3PUZ A;  5E1F A;  1YNN C;  3HOW G;  4JI6 Q;  1ENF A;  1SE8 A;  3HOW H;  1RKN A;  2HIV A;  1VS0 A;  5LL6 X;  4LF6 L;  2G9H D;  1RF2 D;  3LGJ A;  1AZQ A;  1V9P A;  1ICF B;  2SEB D;  5LMN W;  1MKH A;  1WCM H;  3VA7 A;  1CKN B;  3B6Y A;  4DR1 L;  1N33 L;  5CV9 A;  4C3J G;  3I4L A;  4GLV B;  4L5R C;  3E0E A;  4C3J H;  2WKC A;  5GAD C;  5IGC A;  1TWC H;  4X3U A;  3RR5 A;  1NJI C;  1JB3 A;  2R7Z B;  2AUK A;  4B3M L;  1NNX A;  3NP8 A;  1LLR D;  4OWX B;  1TWF H;  2GVB A;  2ENB A;  3D6C A;  2EJG C;  4KKT A;  4CKE A;  4LF4 L;  4B3S L;  4Y52 H;  1YNJ D;  2AQ2 B;  5JPN C;  4DF7 A;  1SYD A;  2J7Z A;  1E7Z A;  4JI4 L;  3S15 B;  4HIO A;  3DEP A;  5FKA C;  5ELN A;  1NR2 A;  3FRP B;  4ZRZ A;  4C3I H;  3MXG A;  1ICW A;  2Z6K A;  4K0K L;  3NXW A;  4X6A H;  3K0X A;  4TVA B;  1Y8O B;  1FNV A;  3IKJ A;  3RLF A;  4NXM Q;  1YNJ C;  1ROD A;  1Q1E A;  5K36 H;  3RZO B;  1WCM B;  1BKB A;  4DAY A;  2V4D A;  4OIJ A;  4OEM B;  2NN6 H;  4KY6 A;  4A3J G;  5AJ3 Q;  1K9M C;  5JJL A;  1LUZ A;  3CCJ A;  1XNQ Q;  1FJG L;  2YYZ A;  3F2B A;  1YJW A;  2WB1 G;  1TWC B;  4KMU C;  5DAU A;  4CHT B;  2F0T A;  3J7Z C;  5J3B A;  3I72 A;  3L3O C;  4P73 A;  4JG2 A;  4R4T A;  1W2B A;  3QOJ A;  2VUM G;  2JYO A;  1PH9 A;  2VUM H;  3K59 A;  1T9H A;  1AZP A;  2ES2 A;  4DAV A;  2D5D A;  4PMW A;  3GTQ B;  5I6Y A;  1F2L A;  1STY A;  2F0S A;  4BY1 B;  2DY8 A;  1CTM A;  1EY5 A;  3HOU H;  3N52 A;  4XQQ A;  5JEA G;  4R8N A;  1IBL Q;  4O42 A;  5C5M A;  3FPP A;  4ME3 A;  4UY8 C;  1KRT A;  5GAH C;  1V1P B;  4R4I A;  3HZX A;  4C3I B;  2D0O A;  2CFM A;  3KDF A;  1KLU D;  3DMU A;  2B8F A;  4C2M H;  5J22 A;  1PFN A;  3GD7 A;  1E3P A;  1EWH A;  3K5L A;  1FNW A;  3SEB A;  3DHQ A;  3DXJ C;  2FJ2 A;  2EYH A;  3PMF A;  2LS0 1;  4A93 B;  4A3I G;  1X56 A;  3U9S A;  5LMU L;  3QB3 A;  2K01 A;  2WII B;  4KHP L;  5A35 A;  4A3K H;  4DR2 L;  4DV7 L;  1IBK Q;  3J7A 5;  5C0X H;  1LV9 A;  3UDI A;  5K5P A;  3GTG B;  2MQH A;  4FNF A;  4BBS B;  2F0G A;  1U4L A;  1VQJ A;  2OT2 A;  1J5E L;  1Q7Y C;  2A8V A;  1OXX K;  3KLR A;  3HOU B;  3K57 A;  1VQB A;  1BCP D;  3OWF A;  2Q8T A;  4I65 A;  2OXP A;  1S40 A;  5IP9 G;  4DV4 L;  1Q1B A;  1HNW Q;  5IP9 H;  4GS3 A;  1OTC A;  4DR6 L;  1TWH H;  1L1O B;  4LF5 L;  2OEO A;  1K83 B;  4X65 Q;  1BCP C;  1SEB D;  4B9X A;  2E2J B;  1YNX A;  4H7B A;  2F0L A;  3FEW X;  2R93 G;  4K2L A;  2A6H D;  3H0G G;  3NWS A;  4DXG A;  1HA6 A;  1Y1W B;  1GXD C;  4L63 B;  1TS3 A;  1AN8 A;  3HGB A;  5IOD A;  2IX1 A;  1Q12 A;  2PPB C;  1X6O A;  1DOK A;  1O7Y A;  1UE5 A;  4IPC A;  2BCO A;  2HUG A;  1K8A C;  4ZAI A;  4A3K B;  2LFN A;  4UDU C;  5M5W H;  3ULP A;  1IZ6 A;  5D14 A;  1J6Q A;  2QIL A;  4CKC A;  3T1Y L;  4GN3 B;  4IJH A;  3J7A V;  1ZEQ X;  4HIM A;  3MXN A;  4Y7N B;  2NVT H;  4RGM A;  1CA5 A;  4A76 A;  5CV4 A;  1H95 A;  3MXU A;  2FMC A;  3NK9 A;  1XMO Q;  3MVV A;  2G9D A;  4IUU A;  3PO2 H;  2Z6B A;  4GKK L;  2NWG A;  1E2W A;  1E1T A;  4B3T Q;  5C4X H;  1FGU A;  4AYB E;  3MWY W;  4RCO A;  2IJ0 A;  4HCS A;  3UDG A;  1BBW A;  3OHX C;  5I2X A;  5IYD G;  1PMR A;  1K73 C;  4YCU A;  2KCT A;  5IYD H;  4HMJ A;  5M5Y H;  2WAQ E;  2VQE L;  2PW7 A;  3GO5 A;  1H9S A;  1G91 A;  1EYG A;  4A3B G;  4JI3 L;  2JA7 H;  4A3B H;  1A3U A;  3F2C A;  4KKS A;  3P7J A;  4RGO S;  4HMI A;  2D62 A;  2RDH A;  4JBK A;  1Q3L A;  2L55 A;  3LX0 A;  1BNZ A;  2BA1 A;  1S5C D;  2K50 A;  4DK3 C;  2IX0 A;  4DUZ L;  2VZA A;  4IJL A;  1PH1 A;  3VA5 A;  4WJ3 M;  2K33 A;  4RKL A;  1TS5 A;  2NVQ B;  2IL8 A;  2PNH A;  1LTG D;  3TS0 A;  1PYS B;  1SR3 A;  4G4K A;  1DZ1 A;  1SNP A;  4B08 A;  1SYG A;  3PUW A;  3K5O A;  5IE8 A;  1J9O A;  1PH3 A;  2RA4 A;  4G7O C;  4V19 0;  2QKI C;  2PZU A;  5G3L F;  2N88 A;  4KTA A;  4BA2 I;  1QVG A;  2NVX H;  3MAQ A;  3UI2 A;  3HOY B;  4POG A;  3BYT B;  2AKW B;  4A3M G;  2R7D A;  5C4X B;  1BUV T;  1B3Q A;  1HR0 W;  2UUB L;  4LW1 A;  2JJQ A;  3S1Q B;  1D7Q A;  1DCZ A;  3G6J B;  3KFU A;  5M5Y B;  3SR1 A;  4BY7 G;  2KUM A;  1ENA A;  2LXK A;  5C4Z A;  2Z9H A;  1RCV D;  4KJO A;  2JA7 B;  4N9T A;  3T16 A;  1W6K A;  4X64 Q;  3PQI A;  3WWV A;  1I5F A;  3S16 H;  4E6I A;  2EXZ A;  1WJJ A;  1AFP A;  2UXD Q;  1Y69 U;  3S1M B;  4HED A;  1A62 A;  2L11 A;  3KJO A;  3VYT A;  3HKZ G;  4X3K A;  2XRQ D;  1ENC A;  4UP9 A;  1I50 H;  1VF7 A;  1EWC A;  2E76 C;  2CQA A;  5HGT A;  4H13 C;  3SK6 A;  3CC2 A;  4GNX B;  2QF7 A;  1MBY A;  1NMG A;  4H44 C;  4LWC A;  3KLS A;  3D4R A;  1PH6 A;  1EIY B;  2PYK A;  4QB4 A;  1QCB D;  1KTK A;  4P74 A;  1LTR D;  3NQI A;  5COR A;  3ERS X;  4NKL A;  3PGZ A;  1SJE D;  2F0M A;  1VQ6 A;  1EIG A;  3TN2 A;  2HQE A;  3S14 B;  4R4C A;  5JJK A;  4JV5 Q;  1HUM A;  2Z1C A;  2Y0S B;  1KLG D;  4GKJ Q;  2Q2T A;  3K0Y A;  3GTP H;  2PQA A;  4B3R L;  4HAE A;  4IO9 A;  2DY7 A;  4OXP A;  1HQR D;  2WB1 E;  4IPD A;  1GD7 A;  4JI8 Q;  4U67 3;  4LF8 Q;  1HA5 A;  3DLL A;  1Q90 A;  3J80 E;  1I6H B;  2F0K A;  1CQF A;  2R3Z A;  2UUC Q;  1CA6 A;  3ER0 A;  5D65 A;  5EAY A;  4DR3 L;  1Q46 A;  4JI0 Q;  2JA8 B;  2F0I A;  4X62 L;  1R4P B;  3RZD H;  2PW5 A;  4V0B A;  3CCL A;  1TWA B;  4IUQ A;  1D2B A;  3H6M A;  4J6H A;  2R92 H;  4DR7 Q;  1CKM A;  3A7A B;  3A55 A;  1EY4 A;  1DYQ A;  1O7L A;  3C1F A;  3PV0 A;  1JJG A;  1VQN A;  4DV1 Q;  2EQS A;  2B63 H;  2PCF B;  1F9S A;  1AE3 A;  4DV2 L;  4A3E H;  5M5X H;  3FP9 A;  2UU9 L;  3EJI A;  4LFC L;  1EWI A;  1CHP D;  5F2D A;  1CQV A;  3Q8D A;  4LFB Q;  1JT8 A;  3PCO B;  1Y1V G;  3CC4 A;  4X3S A;  1JWU D;  1B44 D;  3MA2 B;  1YZ6 A;  5LMN Q;  1GUT A;  2NVY B;  3GTP B;  1TS4 A;  5E7N A;  3A7L A;  4LFA Q;  5C44 H;  4ME5 A;  2B2Y C;  5C3E B;  3MFY A;  2K5H A;  2HDL A;  4DUY L;  4A3G B;  3CCQ A;  3HOZ B;  3QR8 A;  3SK4 A;  4P71 A;  3GTJ B;  1STH A;  3ERQ A;  5M3F H;  4CDF C;  3UDF A;  5FOB B;  2K75 A;  3UDX A;  5DNF A;  2SDF A;  1QVC A;  4R8I A;  1O7Z A;  1K0S A;  1E2V A;  3J81 E;  3EBE A;  5FLX L;  1DXM A;  4TQU S;  4BXX H;  4OEL B;  5G3L D;  1K8M A;  1TWG H;  4KD3 A;  3S17 B;  1KAW A;  1CK1 A;  4QIW E;  1SNC A;  4JBW A;  5CV7 A;  2OF1 A;  2B63 B;  3CCE A;  1PVO A;  1YHB A;  4A3E B;  1VQ9 A;  1U5K A;  5M5X B;  4APV A;  4YHH L;  4LF7 Q;  4P75 A;  1N32 L;  3NTK A;  3JAM i;  1P8L A;  5IY0 A;  4GLX A;  2I07 B;  1XYI A;  3KK7 A;  3HS0 C;  1W6J A;  5DM6 3;  3JAM L;  2A6E D;  2FIN B;  4XXE A;  3L2P A;  1ML0 D;  1G6Z A;  1Q82 C;  5C44 B;  1SDF A;  1J8I A;  1W3S A;  4A75 A;  3RN5 A;  2AHO B;  5A2Q E;  3BS1 A;  2DN8 A;  2EYF A;  1I4G A;  4X66 Q;  4JI7 Q;  2A6E C;  1WVL A;  2F1M A;  5L37 A;  1VQI A;  1ZYR D;  4NMZ A;  4NXN L;  1GOZ A;  4YWM A;  3IAY A;  3VYS A;  4IOA A;  4BA1 I;  1SLJ A;  4PMB A;  2VQF Q;  4X3T A;  4Q5V A;  1TWG B;  2JXM B;  1YIJ A;  2RDG A;  2EIF A;  4OX9 Q;  1UWV A;  1STN A;  3D31 A;  1LT3 D;  1PRT B;  3I8Z A;  4NW2 A;  3S24 A;  4JYA L;  2EVB A;  3I4M G;  2IX3 A;  3K5N A;  2ZXP A;  2Q2U A;  4RMF A;  3S1N B;  1F9Q A;  4DV5 L;  3OMC A;  3ZJY C;  3MC0 B;  3T56 B;  3JAM c;  2VW9 A;  3T1H Q;  1E1O A;  4DNI A;  2NZH A;  1H9M A;  3NEN A;  1SYC A;  2B2U C;  3TBI B;  5IGG A;  5EKL A;  1XMQ Q;  4GZY C;  2KCN A;  3I91 A;  4LAA A;  3F2D A;  2F0E A;  1FR3 A;  2KJX A;  3PO3 H;  1EFI D;  2ICE C;  3KF8 B;  5EKK A;  3PF5 A;  1EFW A;  4JI1 Q;  2K4K A;  5IGE A;  2MJ8 A;  3FKI G;  3H15 A;  3GP7 A;  3FDT A;  1H9J A;  3FKI H;  1SYB A;  3PUV A;  2A5H A;  4G57 A;  3SDZ A;  4HJ8 A;  4LF9 Q;  2KEN A;  1PYW D;  5JOB A; 
#chains in the Genus database with same CATH homology
 1RHP A;  2RSN A;  4MHE A;  4FP5 D;  4KN4 C;  4EQO A;  1PFB A;  1EYC A;  4ABN A;  3V2T A;  1ILQ A;  2KED A;  4QMG A;  1PZJ D;  4C3H G;  2B2Y A;  1EEI D;  5FK9 C;  2D2C C;  5IIF A;  4K14 A;  4J8Q A;  1NUC A;  4IFD J;  1TS2 A;  2JA5 B;  5LL6 S;  5CYU A;  4A3D B;  2RQX A;  3PO3 B;  1JOQ A;  1IYU A;  3CU7 A;  4AYB B;  2SNS A;  2NTT A;  1O78 A;  4BS9 A;  3M7N A;  3ND8 A;  2WAQ B;  3C2P A;  1B2T A;  3QWN A;  5CV8 A;  1PTO B;  3G7L A;  5CBE E;  2ZT9 C;  2F4I A;  4OO1 G;  3KBG A;  5EBD A;  3HRZ C;  2F0H A;  3S2H B;  1AEX A;  3MEH A;  2PO4 A;  1TII D;  2AQ1 B;  1TT2 A;  1NSN S;  4KI0 A;  4ULL A;  2JEB I;  3QJY A;  1BO0 A;  1HTP A;  4CBV A;  1HXY D;  4ZYS A;  1KDB A;  3HOW B;  3GTK B;  1EEF D;  4ZLT F;  1C8C A;  4EVO A;  4IFD G;  1S5F D;  1H9K A;  1SE3 A;  4S3S A;  1PZI D;  1WTX A;  3BVM A;  3SE0 A;  1Z7T A;  1K8O A;  3VYU A;  1WD1 A;  4C3J B;  3ND9 A;  1NCV A;  2XNA C;  4HSV A;  3H09 A;  4EQN A;  4KY7 A;  4G7H C;  4XIG S;  4ZKB B;  2B2U A;  1CI3 M;  4RAU C;  5NUC A;  1TWF B;  3CRK C;  4M8A A;  2BE5 D;  5JEA H;  5C0X J;  1XXG A;  1JC7 A;  3R2T A;  1A3T A;  4XDX A;  1U9R A;  1ESR A;  2MP1 A;  3ITP A;  2AQ3 B;  2B2V C;  2BE5 C;  2KCC A;  2RDF A;  1B53 A;  2K05 A;  1D5X C;  2IT1 A;  1X32 A;  2QDB A;  1STB A;  4A3J B;  1F2M A;  2LMC B;  5C6A A;  3VR6 A;  1PRT F;  2Z8L A;  1KAA A;  4K2K A;  1ESF A;  5CBA E;  3V05 A;  4DA2 A;  5E4W C;  1UUP A;  4XT1 B;  2VUM B;  4K5V A;  4FF4 A;  2E75 C;  2HDM A;  1PLF A;  3DEO A;  4BWG B;  4ZUI A;  2BDN A;  5CGK A;  2KA7 A;  4DXF A;  2EDG A;  3DWA A;  4F88 A;  1HTL D;  4RKB A;  4IUT A;  2L5T A;  4K6L A;  5CV5 A;  1A15 A;  1C4Q A;  2XWJ B;  3BG3 A;  3GQB A;  4C2M B;  1SE2 A;  4TRD A;  1XWE A;  3E0J A;  2O5I C;  2ICI A;  1I4Q A;  2E74 C;  2K5Q A;  1OXV A;  1STE A;  1KDA A;  1ZXT A;  3NWT A;  1Q8I A;  2K7V A;  2Z4I A;  1RDP D;  2FFK B;  3F2U A;  3PUY A;  2WIN B;  2A6H C;  2ID0 A;  1BR9 A;  1OO9 B;  3RMH A;  1D6E C;  3AU7 A;  1AP0 A;  5JPM C;  4FF1 A;  3GV3 A;  4ZK9 B;  3GTO B;  4KKU A;  1GUS A;  5KND A;  2C5C A;  1STG A;  1VMC A;  5CR3 A;  1TWH B;  1RJT A;  1HPC A;  3DWQ A;  1OXU A;  3VR2 A;  4PV1 C;  4EQP A;  1PTO F;  3M85 A;  2R93 B;  4FXD A;  1SAP A;  1DM0 B;  3H0G B;  3SK5 A;  1XX8 A;  3MTS A;  1DOL A;  3GTM B;  3SVM A;  1B9N A;  1HFG A;  5KYI A;  1D5M C;  3I73 A;  5M5W B;  1EY6 A;  4OO1 I;  1F2Z A;  2D9U A;  2NBF A;  1OXS C;  1MSG A;  4DNT B;  2NVT B;  1CZW A;  2B2V A;  1BOS A;  1EY8 A;  3QOL A;  1UNS A;  4LMQ D;  2PMZ B;  3LWE A;  4NDX A;  2F0V A;  3PO2 B;  5D3D A;  3VR4 A;  1GUG A;  4PQX A;  3P75 A;  4FO2 A;  4IFD I;  3D8G A;  5T1I A;  2F0W A;  3J7A F;  5M9O A;  4WOR A;  1SMY D;  3TDQ A;  1H9S B;  1Y8P B;  2A74 C;  1ILP A;  4A3B B;  1WTP A;  1HFN A;  5IT9 E;  1LTB D;  2PQE A;  1SND A;  2H4O A;  2WAC A;  1S5B D;  3TZU A;  1SMY C;  3D4D A;  2EY5 A;  3U9O A;  2CW0 D;  1ZKO A;  4LK1 C;  3Q23 A;  5I9O A;  3I3C A;  4HTH A;  2VNU D;  1X3P A;  2K1B A;  1TKW B;  2AWN A;  1QB5 D;  4G7Z C;  3EVQ A;  1LAC A;  3H91 A;  1I4P A;  1JOR A;  2VB3 X;  2TSS A;  2NVX B;  2CW0 C;  1QWY A;  4ID6 A;  2RKS A;  2KEC A;  3OOC A;  5LHY 1;  4A3M B;  1U4P A;  3I90 A;  4DK0 A;  1EQT A;  1FNU A;  3T13 A;  3W2D A;  1SJH D;  4BY7 B;  2K6A A;  1G29 1;  2E2D C;  4XT3 B;  3S16 B;  2Q8R E;  2KQ3 A;  3QIA A;  3J7Y W;  3IFD A;  3HKZ B;  5HUR A;  2FHT A;  1L0X B;  1I50 B;  2XSC A;  1BCP B;  3S9W A;  3V96 A;  5FLX E;  2MUY A;  4K6D A;  1DOM A;  2KVM A;  5C3W A;  1B1Z A;  5JJZ A;  1CT1 D;  3Q6S A;  2HCC A;  2EY6 A;  2MHV A;  1PFM A;  1SNO A;  3K58 A;  2EY2 A;  3URY A;  1LT4 D;  1GUN A;  1Z6H A;  1UEA B;  3CQZ B;  5KNB A;  4UAI A;  3K5M A;  4CGY B;  2K32 A;  1QG7 A;  2H1E A;  3RZD B;  5JVH 3;  4RCN A;  1SSO A;  2R92 B;  4QUC A;  3DWP A;  1RTN A;  2EZV A;  5ELB A;  1KNE A;  4WFN 3;  1U4R A;  3TP7 A;  1SE4 A;  2ZXO A;  5IOC A;  2EOT A;  2EE1 A;  3A8J E;  3R3O A;  3NTH A;  1GUW A;  4RH6 A;  3TZD A;  5ELC A;  1I6V C;  4C1N K;  1CZG A;  5M3F B;  2L12 A;  2F0P A;  5D3I B;  4RWS C;  4QUF A;  1MD2 D;  3I70 A;  2F3W A;  1WTQ A;  3NHH A;  1MGS A;  3NBH A;  4NP5 A;  4FXG C;  2LKV A;  3KF8 A;  3N6R A;  1LT5 D;  1QNU A;  3H3V C;  2TMP A;  3J81 L;  3OIP A;  4IAL A;  1ZYR C;  2KOL A;  3NTI A;  4RFB A;  3ERO A;  2X6L A;  3LWU A;  1SNM A;  1M4V A;  3PIO 3;  4WJW A;  2F03 A;  2XN9 C;  1EOT A;  1G2S A;  2F0D A;  3D4W A;  2DNC A;  2K5D A;  1A2U A;  2QCP X;  4DNR B;  4OL7 A;  2F0J A;  1TU2 B;  2SNM A;  2VB2 X;  3T4A C;  1SNQ A;  2IPK D;  4HCE A;  5DM7 3;  5A2Q L;  2EPB A;  2SOB A;  3NSW A;  3KLS X;  1TR5 A;  1F9P A;  4PNY A;  5CC4 A;  3I4M B;  5JVG 3;  2K03 A;  4YIJ A;  1EU4 A;  1OXT A;  3BVZ A;  1I3Q B;  1O80 A;  1B50 A;  4TSS A;  4RGN A;  2B2W C;  2A69 D;  3NBI A;  1EY7 A;  4WRD A;  2VXW A;  1WTW A;  1EY0 A;  4U68 A;  3FKI B;  1DD2 A;  1RD9 D;  2A69 C;  2EJM A;  4K8J A;  3EA6 A;  1BCP F;  4FF3 A;  1F2Y A;  4ZUJ A;  2C9O A;  3DUZ A;  1IYV A;  4MN3 A;  1E2Z A;  3K6O A;  4PMC A;  1I4H A;  4OO1 H;  5JAV A;  4L6T B;  4RHS A;  3IFT A;  2BDO A;  3HP3 A;  4ZKC B;  3VR5 A;  4Q0F A;  4C3H B;  3ZYY X;  2M9V A;  2EJF C;  3D3R A;  1JWS D;  1HUN A;  1LTT D;  3FPU B;  4IFD H;  4KHZ A;  5CMD A;  5JEA J;  4XTC S;  1EY9 A;  2BOS A;  2X6G A;  4IUP A;  3O13 A;  4XYO A;  4DGZ A;  3Q24 A;  4R9W A;  4M1U B;  1V1P A;  3MZ5 A;  4C3I G;  1BDO A;  5EQ0 A;  2YU9 B;  4BBR B;  5K36 G;  5DEH A;  2IW3 A;  4J1M A;  1KNA A;  5C4J B;  2NN6 G;  2E2I B;  3H94 A;  1PXU A;  1IKM A;  1IL8 A;  3R2I A;  1EQV A;  3TSS A;  1CHQ D;  1B9M A;  2WP8 J;  4EGV A;  1WTV A;  1SFO B;  2NZ1 D;  2A73 B;  3C1E A;  1ET6 A;  5E4X A;  1R9T B;  2EYJ A;  2M00 A;  3SK8 A;  5EGT A;  1CM9 A;  1BQQ T;  3EFX D;  2F0F A;  2FMM A;  4QF4 A;  3PUX A;  1S5D D;  1FGB D;  2K04 A;  1KDC A;  2JA6 B;  2WB1 B;  4KHV A;  4OHJ A;  3KUP A;  1HCZ A;  2JP1 A;  5ELF A;  2B2W A;  1LTS D;  4XQJ A;  1SYF A;  1Y8N B;  3QO2 A;  1S4Z A;  3CHB D;  3DM1 A;  3OSO A;  4HN7 A;  1HHV A;  1MSH A;  4O1N A;  2XIW A;  2WKD A;  3A56 A;  4FXK C;  5ELD A;  5C0X G;  5EJW A;  4IUV A;  2PZW A;  1NR4 A;  3QG1 A;  2K28 A;  3MFG A;  1JOK A;  3M3Y B;  4IQZ A;  5I9P A;  5J39 A;  3BVG A;  2K5W A;  2NTS A;  3GV6 A;  4A3I B;  2E2H B;  4C56 C;  3TP5 A;  2M2L A;  3OWE B;  2WV6 D;  1EIH A;  3RD4 A;  4TKO B;  1F77 A;  1U4M A;  5J1Z A;  4OGQ C;  1D5Z C;  3L9A X;  1BBX C;  1FD7 D;  2XRS D;  2Z4H A;  1DON A;  3VR3 A;  2PZT A;  4XQN A;  1TY0 A;  5KIX A;  2J4X A;  3M7G A;  1Z47 A;  4QIW B;  3MHB A;  4K8I A;  5I6W A;  3RUZ A;  1C48 A;  3TME A;  1WD0 A;  1FYC A;  1I4R A;  4DU9 A;  2JEA I;  4KJN A;  3NUC A;  4FVM A;  1NAP A;  4CKB A;  4ODG A;  5EPJ A;  1LTI D;  1PZK D;  3HOX B;  3I4N B;  1GHK A;  5EPK A;  4F8M A;  3NQT A;  3GTL B;  3OW7 A;  3W3A A;  5CV6 A;  3OMG A;  1VCI A;  2F3V A;  1B4O A;  2F0U A;  1G8Z D;  2N55 A;  3LNN A;  5FO7 B;  1QJO A;  3M4Y A;  3C3L A;  1LT6 D;  2EYL A;  3BYY B;  2ZXR A;  1PRT D;  1QE6 A;  5I4D A;  3P20 A;  1E0B A;  3A8K E;  3L7Z C;  4ILW A;  1ET9 A;  1JE4 A;  1EL0 A;  2EYP A;  5EBC A;  3M4O B;  2F0Q A;  2J0T D;  4XYQ A;  2MPM A;  2F0N A;  4FF2 A;  1PRT C;  1QNK A;  3R93 A;  2NN6 I;  1X3Q A;  1T5E A;  3SHL A;  5E3F A;  4OIK A;  5C4H A;  1R4Q B;  1IHZ A;  1IKL A;  4QCL A;  4DFA A;  2LY7 A;  2RSO A;  1EU3 A;  5T1G A;  5AFW A;  1I4X A;  3WOE A;  1EZ8 A;  2X69 A;  2KHS A;  3EQL C;  1UAP A;  3ONA B;  1ONL A;  2R61 A;  1JR0 D;  5KGU A;  4B9W A;  5FO9 B;  2BA0 A;  4IN3 A;  3WOF A;  5BN4 A;  1EYA A;  3VYR A;  3R8B A;  2CVR A;  2B2T C;  1AW7 A;  1QOH A;  4KY5 A;  1M8A A;  3A8I E;  2EY1 A;  2IWH A;  4IZ8 A;  2AWO A;  2I46 A;  5IT9 L;  4DN4 M;  4HR7 B;  5TSS A;  1SXT A;  4KK7 A;  1D1K A;  3S1R B;  3NPP A;  1KAB A;  1TY2 A;  1II3 A;  4MIU A;  1GHJ A;  3SXH A;  5KYL A;  1VMP A;  1JOO A;  5C0X I;  3Q0A A;  3BDC A;  1LO5 D;  1PTO D;  5IGB A;  1STA A;  1V43 A;  2JSO A;  2HCI A;  4CJ0 B;  4JK1 C;  5ELE A;  4CJ1 B;  2XVS A;  4FYD A;  3E6Z X;  3HG9 A;  3JAM E;  5C3X A;  1PTO C;  4RGT A;  1PDQ A;  2A68 D;  3Q22 A;  3NE5 B;  1WTO A;  4A3F B;  2RBM A;  3T53 B;  3J80 L;  3E5S A;  1HQM C;  1SYE A;  1VF5 C;  2O4X A;  3HEJ A;  2JE6 I;  4KN7 C;  3S2D B;  2A68 C;  1A3V A;  3TP8 A;  3BDO A;  5FO8 B;  4LJZ C;  2L0C A;  2L1B A;  1HRJ A;  2O2L D;  2EYO A;  1CFM A;  5COY A;  2R6G A;  4C1N I;  1Y1V B;  1QIL A;  3A54 A;  1MI2 A;  3C46 A;  4L8J A;  1H9R A;  1T5X D;  3BDL A;  5KEE A;  2MGS A;  1RTO A;  1BF4 A;  2L9H A;  1V8Q A;  5EKI A;  4K5W A;  1EZ6 A;  5I2Y A;  5BN3 A;  4H0L C;  2RVL A;  1JIC A;  2KEE A;  2CHB D;  3KBX A;  1L0Y B;  4P2C B;  1GUO A;  1WTR A;  3HOV B;  2PNR C;  1TQO A;  3CRL C;  2NUC A;  2Q8I B;  2O5J C;  2F0O A;  1IW7 D;  2B2T A;  2L4N A;  1JQY D;  5C5L A;  2B8G A;  4DAP A;  1JWM D;  3CKI B;  3BZD B;  4F7X A;  1V1O A;  5IGF A;  1TVX A;  3WDN A;  5BN5 A;  1EYD A;  4CJ2 C;  3MXP A;  4IUR A;  2EYM A;  1BXT A;  1DJR D;  3IL8 A;  1IW7 C;  4I7Z C;  2DNE A;  3P1H A;  2QEJ C;  3D6W A;  5EPL A;  4RA8 A;  3OIQ A;  3X3M A;  1VDZ A;  5ISR A;  3K7A B;  4RHR A;  1SBB B;  1G2T A;  1A2T A;  1LAB A;  1GJX A;  5M3M B;  1B3A A;  4Z9C B;  1XTC D;  2NYZ D;  4ZQ3 A;  3TP6 A;  3AMU A;  1D1I A;  3PIP 3;  2AUJ D;  5KRU A;  1JCK B;  4HSP A;  1PTO H;  3FVQ A;  5KNC A;  4N9P A;  3X3N A;  2B39 A;  3AB9 A;  1F9R A;  2XWB B;  2NB0 A;  3T51 B;  5IGD A;  4IUN A;  1YNN D;  1A6X A;  1LTA D;  3FMC A;  4K5X A;  4KD4 A;  4KV6 A;  2GA4 B;  3OPO A;  1S5E D;  4DK1 A;  4F87 A;  3PUZ A;  5E1F A;  1YNN C;  1ENF A;  1RKN A;  5LL6 X;  2G9H D;  1RF2 D;  1AZQ A;  2SEB D;  3VA7 A;  5CV9 A;  4C3J G;  3I4L A;  2WKC A;  5IGC A;  4X3U A;  1JB3 A;  2R7Z B;  2AUK A;  3NP8 A;  1LLR D;  3D6C A;  2ENB A;  2EJG C;  4KKT A;  4CKE A;  1YNJ D;  2AQ2 B;  5JPN C;  4DF7 A;  1SYD A;  2J7Z A;  3S15 B;  3DEP A;  5FKA C;  1NR2 A;  3FRP B;  4ZRZ A;  3MXG A;  1ICW A;  3NXW A;  1Y8O B;  1FNV A;  3IKJ A;  3RLF A;  1YNJ C;  1ROD A;  1Q1E A;  5K36 H;  3RZO B;  1WCM B;  4DAY A;  2V4D A;  4OIJ A;  2NN6 H;  4KY6 A;  2YYZ A;  1TWC B;  4KMU C;  5DAU A;  4CHT B;  2F0T A;  3I72 A;  3L3O C;  3QOJ A;  2JYO A;  3K59 A;  1AZP A;  4DAV A;  2D5D A;  4PMW A;  3GTQ B;  5I6Y A;  1F2L A;  1STY A;  2F0S A;  4BY1 B;  2DY8 A;  1CTM A;  1EY5 A;  3N52 A;  4XQQ A;  5JEA G;  4R8N A;  4O42 A;  5C5M A;  3FPP A;  1V1P B;  3HZX A;  4C3I B;  1KLU D;  3DMU A;  2B8F A;  5J22 A;  1PFN A;  3GD7 A;  1EWH A;  3K5L A;  1FNW A;  3SEB A;  3DHQ A;  3DXJ C;  2FJ2 A;  2EYH A;  3PMF A;  2LS0 1;  4A93 B;  3U9S A;  3QB3 A;  2K01 A;  2WII B;  5A35 A;  5C0X H;  1LV9 A;  5K5P A;  3GTG B;  4FNF A;  4BBS B;  2F0G A;  1U4L A;  2OT2 A;  1OXX K;  3KLR A;  3HOU B;  3K57 A;  1BCP D;  3OWF A;  2Q8T A;  4I65 A;  2OXP A;  1Q1B A;  2OEO A;  1K83 B;  1BCP C;  1SEB D;  4B9X A;  2E2J B;  4H7B A;  2F0L A;  3FEW X;  4K2L A;  2A6H D;  1HA6 A;  3NWS A;  4DXG A;  1Y1W B;  1GXD C;  4L63 B;  1TS3 A;  1AN8 A;  3HGB A;  5IOD A;  2IX1 A;  1Q12 A;  2PPB C;  1DOK A;  1O7Y A;  2BCO A;  2HUG A;  4ZAI A;  4A3K B;  2LFN A;  4UDU C;  5D14 A;  2QIL A;  4CKC A;  3J7A V;  1ZEQ X;  3MXN A;  4Y7N B;  4RGM A;  1CA5 A;  5CV4 A;  3MXU A;  2FMC A;  3NK9 A;  3MVV A;  2G9D A;  4IUU A;  2NWG A;  1E2W A;  3MWY W;  4RCO A;  2IJ0 A;  4HCS A;  3OHX C;  5I2X A;  1PMR A;  4HMJ A;  2PW7 A;  3GO5 A;  1H9S A;  1G91 A;  1A3U A;  4KKS A;  3P7J A;  4RGO S;  4HMI A;  2D62 A;  2RDH A;  1Q3L A;  2L55 A;  3LX0 A;  1BNZ A;  2BA1 A;  1S5C D;  2IX0 A;  3VA5 A;  2K33 A;  4RKL A;  1TS5 A;  2NVQ B;  2IL8 A;  1LTG D;  4G4K A;  1DZ1 A;  1SNP A;  4B08 A;  1SYG A;  3PUW A;  3K5O A;  1J9O A;  2RA4 A;  4G7O C;  4V19 0;  2QKI C;  2PZU A;  5G3L F;  2N88 A;  4KTA A;  4BA2 I;  3MAQ A;  3UI2 A;  3HOY B;  3BYT B;  5C4X B;  1BUV T;  3S1Q B;  1DCZ A;  3G6J B;  5M5Y B;  3SR1 A;  2KUM A;  1ENA A;  5C4Z A;  1RCV D;  4KJO A;  2JA7 B;  4N9T A;  3T16 A;  1W6K A;  4E6I A;  2EXZ A;  1AFP A;  1Y69 U;  3S1M B;  4HED A;  2L11 A;  3VYT A;  4X3K A;  2XRQ D;  1ENC A;  1VF7 A;  1EWC A;  2E76 C;  2CQA A;  5HGT A;  4H13 C;  3SK6 A;  2QF7 A;  1MBY A;  4H44 C;  3KLS A;  3D4R A;  2PYK A;  4QB4 A;  1QCB D;  1KTK A;  1LTR D;  3NQI A;  5COR A;  4NKL A;  1SJE D;  2F0M A;  1EIG A;  3TN2 A;  2HQE A;  3S14 B;  1HUM A;  2Z1C A;  2Y0S B;  1KLG D;  3K0Y A;  4HAE A;  2DY7 A;  1HQR D;  4U67 3;  1HA5 A;  1Q90 A;  3J80 E;  1I6H B;  2F0K A;  1CQF A;  2R3Z A;  1CA6 A;  5D65 A;  2JA8 B;  2F0I A;  1R4P B;  2PW5 A;  4V0B A;  1TWA B;  4IUQ A;  1D2B A;  3H6M A;  4J6H A;  3A7A B;  3A55 A;  1EY4 A;  1DYQ A;  1O7L A;  3C1F A;  3PV0 A;  2PCF B;  1F9S A;  3EJI A;  1CHP D;  5F2D A;  1CQV A;  4X3S A;  1JWU D;  1B44 D;  3MA2 B;  1GUT A;  2NVY B;  3GTP B;  1TS4 A;  3A7L A;  4ME5 A;  2B2Y C;  5C3E B;  3MFY A;  2HDL A;  4A3G B;  3HOZ B;  3SK4 A;  3GTJ B;  1STH A;  3ERQ A;  5FOB B;  5DNF A;  2SDF A;  4R8I A;  1O7Z A;  1E2V A;  3J81 E;  5FLX L;  1DXM A;  4TQU S;  5G3L D;  1K8M A;  4KD3 A;  3S17 B;  1CK1 A;  1SNC A;  4JBW A;  5CV7 A;  2OF1 A;  2B63 B;  4A3E B;  5M5X B;  3NTK A;  1XYI A;  2I07 B;  3KK7 A;  3HS0 C;  1W6J A;  5DM6 3;  3JAM L;  2A6E D;  2FIN B;  4XXE A;  1ML0 D;  1G6Z A;  5C44 B;  1SDF A;  1J8I A;  5A2Q E;  3BS1 A;  2DN8 A;  2EYF A;  1I4G A;  2A6E C;  1WVL A;  2F1M A;  4NMZ A;  1ZYR D;  1GOZ A;  3IAY A;  3VYS A;  4BA1 I;  4PMB A;  4X3T A;  4Q5V A;  1TWG B;  2JXM B;  2RDG A;  1STN A;  3D31 A;  1LT3 D;  1PRT B;  3I8Z A;  4NW2 A;  2EVB A;  2IX3 A;  3K5N A;  2ZXP A;  3S1N B;  1F9Q A;  3OMC A;  3MC0 B;  3T56 B;  1H9M A;  1SYC A;  2B2U C;  3TBI B;  5IGG A;  5EKL A;  4GZY C;  2KCN A;  3I91 A;  4LAA A;  2F0E A;  1FR3 A;  2KJX A;  1EFI D;  2ICE C;  5EKK A;  5IGE A;  2MJ8 A;  3GP7 A;  3FDT A;  1H9J A;  1SYB A;  3PUV A;  2A5H A;  4G57 A;  3SDZ A;  1PYW D;  5JOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...