2HDLA

Solution structure of brak/cxcl14
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
77
structure length
77
Chain Sequence
SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small inducible cytokine B14
publication title Structural Determinants Involved in the Regulation of CXCL14/BRAK Expression by the 26 S Proteasome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 13
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2006-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2hdlA00
3I3CA 1QG7A 3GV6A 3LWEA 3P7JA 1WD0A 1U4LA 1WTPA 1HUMA 2KECA 1SSOA 5JJZA 1ZXTA 2K04A 1EIHA 4OIKA 2X69A 2R3ZA 1B50A 5EPLA 3FPUB 2VXWA 2N88A 1F2LA 2NZ1D 2Q8RE 4R9WA 1IKMA 1VMPA 2FJ2A 1DZ1A 1RJTA 5EKIA 4LMQD 5EPKA 5CORA 1XYIA 1F9PA 1HUNA 4XT1B 5CBAE 3KUPA 4X3TA 1PFNA 2SDFA 1WTWA 2XIWA 1J8IA 2B2VC 3G7LA 2KEEA 2X6LA 1HHVA 1HA6A 4IUVA 5EJWA 1F9SA 2K05A 1A15A 4IUPA 4NW2A 1JICA 5D65A 2EE1A 2B2WC 3TZDA 3D6WA 1DOKA 3GV3A 1WVLA 4U68A 1NAPA 1F9RA 1LV9A 2JYOA 5AFWA 4DN4M 4ZLTF 1X3PA 3QO2A 4X3UA 3UI2A 2L12A 2B2YC 2FINB 4IUUA 2MPMA 1WTOA 3MWYW 5DNFA 2MJ8A 4OIJA 2M2LA 2K1BA 1SDFA 2DY8A 4ZKBB 1PFMA 1WTXA 1PFBA 2B2UC 1IKLA 1B3AA 4X3KA 1RHPA 3Q6SA 1IL8A 2B2TC 2MP1A 1XX8A 2RSNA 1B2TA 1JE4A 1Q3LA 2EOTA 4CJ2C 5EPJA 1G2TA 2HCIA 1HFNA 1O7YA 1QNKA 4IURA 1WTRA 1BNZA 2X6GA 2L9HA 1CA5A 2CVRA 1PDQA 2JP1A 1WD1A 5E4WC 1GUWA 1U4PA 1G2SA 5CMDA 4UAIA 3DM1A 1ICWA 2NWGA 3IL8A 3SVMA 5CBEE 1RTNA 3DEPA 2K28A 1M8AA 4X3SA 3ONAB 2Q8TA 1ILQA 1F9QA 3KBXA 1ML0D 1EQTA 4MN3A 2H1EA 1CM9A 2EPBA 1AP0A 1G91A 4MHEA 4XDXA 5E4XA 2FHTA 1BO0A 2RSOA 2D9UA 2K03A 2BDNA 4HCSA 1ILPA 1RODA 1X32A 5T1GA 1EL0A 3H91A 3I90A 3FDTA 1WTVA 1WTQA 3N52A 1EOTA 2KVMA 3MTSA 2MGSA 4QUCA 1J9OA 1DOMA 4HEDA 2B2VA 1KNEA 5D14A 1RTOA 1G6ZA 3I91A 3I8ZA 1NCVA 3HP3A 5T1IA 4ZAIA 2NYZD 2B2WA 1SAPA 1U4MA 4O42A 1C8CA 1E0BA 1TVXA 2HUGA 2L4NA 3DEOA 1BF4A 3R93A 4IUQA 2DY7A 3F2UA 1NR2A 2FFKB 2N55A 1U4RA 1BBXC 3TN2A 1B53A 1ESRA 4RA8A 2B2YA 2HCCA 1MSHA 1O80A 4HAEA 2L1BA 1MI2A 2K01A 1HFGA 1HRJA 2RVLA 2HDLA 1MSGA 2B2UA 1X3QA 1MGSA 4QUFA 1AZPA 2FMMA 2J7ZA 3IFDA 4HSVA 1QE6A 4CJ0B 1PLFA 2KOLA 1EIGA 2B2TA 5COYA 1AZQA 1B4OA 1O7ZA 4XT3B 2KUMA 4RWSC 2IL8A 4RAUC 4CJ1B 1S4ZA 1DONA 4ZK9B 1CA6A 1NR4A 1DOLA 2L11A 4IUTA 2KEDA 1KNAA 2HDMA 5EQ0A 2RA4A 4ZKCB 4R8IA 1VMCA
chains in the Genus database with same CATH superfamily
4UP7A 3FKIB 5CV6A 4KV6A 4DV2Q 1YJNA 1GM5A 1GJXA 2N88A 4R9WA 3FVQA 4DV2L 2A6HC 3I70A 2P5ZX 1SYCA 1EY0A 4C3IB 4LFBQ 3PQIA 3G6EA 2EJGC 1KD1C 1JR0D 4IUVA 3HOUB 1F9SA 2EYPA 4IPHA 1IBLQ 1ASYA 2EE1A 1WVLA 4A3KH 3BZCA 4LFBL 1VQBA 2AKWB 4N9TA 1F77A 2LS01 1IBLL 3L9AX 4C56C 1BUVT 5K5PA 3M3YH 3DHQA 4LUZA 3CCVA 1Q46A 3J80E 5IT9L 2EQSA 3J81j 1X65A 4P71A 3QJYA 4BY1G 4LF9Q 2KBNA 5CYUA 1P8LA 2F0KA 2B2TC 2K5QA 4F88A 5IGEA 5JEAH 3HOUG 2A1AA 2K52A 1A3TA 1YNND 2WINB 5I2XA 3S1QH 1MBYA 1AH9A 1I4GA 2JSOA 1EYCA 4LUVA 4LF9L 4DGZA 3UDGA 2NWGA 3PUXA 4Y7NB 1HNXQ 1EFWA 1OXXK 1O7LA 3J81c 4DXGA 3KDFB 4A3JB 5C4JH 3KDFA 1G91A 2N49A 1HNXL 2FHTA 5J1ZA 5LMNQ 4DPGA 2MHVA 1AEXA 3FDTA 1L1OC 1Z47A 5LMNL 2PW7A 2EY6A 2AWNA 3I8ZA 1JWSD 4A3JG 5G3LD 3HS0C 4KJNA 1NE3A 1OXUA 5LMUQ 1S5BD 4JG2A 4RKBA 1UE1A 2K50A 3U9SA 3BYTB 1SEBD 5NUCA 2JA7H 1C48A 2Y0SB 3OSOA 4CGYB 3NTHA 4XTCS 3F2DA 1UAPA 2M00A 3HG9A 2B2TA 3GTGB 1A2TA 4L5RC 4JI8Q 5JAVA 2AWOA 1BBUA 4UDUC 1K8GA 2RA4A 4Q0FA 2XRSD 4JI8L 1X56A 2J0TD 4BBRH 1FNUA 4CBVA 2JEBI 4G7OC 3PO2G 5KNDA 3GQBA 1KDCA 1JMCA 2E2JH 2ZTCA 5KRUA 1QCBD 3CAMA 4JBKA 3S17B 2FJ2A 3UE0A 2PPBC 1L1OB 4OXPA 1B3QA 5F2DA 4F87A 5GADC 1L1OA 4IZ8A 1CTMA 1HA6A 2AQ1B 3PIPA 1H9RA 4K0KQ 5JPNC 3R3OA 3A7AB 2F3IA 2RQXA 5FO9B 5FO8B 5C3XA 5AFWA 1VQ9A 5M3MB 1IW7D 4K0KL 2B2YC 4A3MB 1X3FA 5E1FA 4PMWA 4DU9A 2F1MA 4LNQA 1TWFB 3BZKA 2Q2IA 1B2TA 3TS0A 5EPJA 1VQJA 2JN4A 1G51A 2X6GA 3J80i 4GNXA 1R9TH 1LTGD 1EY5A 4A3MG 4IFDJ 4YY3Q 4A3CG 4A3EG 1D7QA 4JI3Q 3DWQA 3OPOA 3KYHC 2EYHA 1WYDA 4KY5A 4JI6Q 4XDXA 4YY3L 4NXMQ 2YU9H 4RCNA 3AEVA 3EFXD 3JAME 2RDHA 4JI3L 1J5EL 2ZM6Q 4C2MH 4JI6L 5FO7B 4NXML 1LO5D 2FMCA 2EYOA 3L3OC 1J9OA 1QWYA 1TWCB 3IRBA 2JA5B 3MFGA 2ZM6L 1M4VA 1EY9A 4A3IB 1PH9A 2ASBA 4HJ9A 4NXNQ 2B63H 2BH8A 3VYSA 2A69D 2WFWA 1GUOA 3TN2A 2B2YA 2HCCA 4PMBA 1MSHA 1BCPC 4NXNL 4B3SQ 2DUDA 1HFGA 1STEA 3S14H 4FF3A 4C3HH 2N3SA 4DR5Q 5HGQA 3HOWB 4CJ0B 2JA5G 4A3IG 3DLLA 4B3SL 4CJ1B 3PMFA 3UDFA 4CKBA 4R8NA 4DR5L 2DGYA 1YNJD 2F03A 3WOEA 1E24A 3GV6A 3P7JA 3HOXB 2NVQB 3ND8A 4ABNA 1PTOF 3SE0A 2Z4HA 2R3ZA 4C3JB 5C4XH 1WI5A 1V43A 1VMPA 1VQIA 2I0QA 4A93G 1FGUA 4L5SA 1TWHH 4X64Q 5C3EG 2NVTB 4B08A 4HIOA 1SBBB 1O7IA 2F0GA 4A3GH 1TS3A 1JCKB 4OO1H 3I4OA 1JICA 5GAGC 4X64L 1SR3A 1VQKA 4G4KA 4C3JG 1LV9A 4X66Q 4H7BA 5CGKA 3M7NA 1Y14B 2NN6H 3CMEA 2DN8A 4JPBW 4HJ5A 1XNRQ 1A6XA 3J80L 1BCPB 2MNAA 2M2LA 2K1BA 4X66L 4ZKBB 4LF4Q 1XNRL 3Q24A 1I4HA 1Q3LA 1KC8C 3GTOH 4LF4L 3UDXA 2HT1A 3X3NA 1FD7D 1EY4A 3DM1A 2A5HA 1PV4A 2YV5A 2QEXA 1M8AA 1ILQA 3RZDB 4ME3A 1E1OA 4IFDH 2H1EA 3NE5B 3M4PA 5IGBA 4MHEA 3DUZA 3NUCA 3S15B 2VUMH 2ENBA 4O1NA 1BO0A 5DEHA 4DK1A 3A54A 3A7LA 4P2CB 4DAVA 1ILPA 2F0WA 1V9PA 1D6EC 1LTLA 1EWCA 3CRKC 1M90C 3CCLA 2JA9A 1TR5A 4PZ8A 4DUYQ 4NP5A 3NTKA 4BY7B 3I7FA 1Q8KA 3OWEB 2N78A 4BBSB 4DR3L 5LL6X 1A3UA 3S1NB 1GOZA 4L8JA 4P74A 5C6AA 4DUYL 2DY7A 2UXDQ 1WTHA 2N55A 3BJUA 2ZXRA 3DWPA 3E3XA 1D5MC 1VQPA 3H0GB 1N36Q 1HRJA 3HOZB 4ZRZA 1WCMB 2UXDL 4RCOA 4QUFA 2J7ZA 5IGFA 2QF7A 4BBSG 1JWMD 1N36L 1HTPA 5M3FH 3SEBA 2NTSA 4ODGA 4ZKCB 1XWEA 3AQQA 5I2YA 1W2BA 1R4QB 4APVA 3HOZG 4P73A 1WCMG 3LGJA 3QB3A 4K14A 2BH2A 1B9MA 1Q12A 2OEOA 3U4VA 4N9PA 1JWUD 1I50B 1PFNA 1IZ6A 2SDFA 4WORA 1PTOD 4FXDA 1SXTA 1EY6A 1IYUA 2EY2A 3BDLA 5C44B 2CFMA 1NMFA 4H44C 1VQ7A 2QA4A 1RL2A 3BVZA 2PZUA 3KLWA 4RGNA 4JI5Q 1EQVA 3QO2A 1S40A 1S3OA 1HCZA 1F2ZA 4A3DB 2R92B 3AYHB 1KL9A 4LAAA 2ZJRA 2XN9C 1SDFA 3BZDB 4WJ4A 1AE2A 4JI5L 1WTXA 1ZYRD 2R7FA 5IIFA 4U673 5M5WB 5C44G 1G2TA 2Z6KC 1E2ZA 1QB5D 4M1UB 3OIQA 1CA5A 3CPFA 1WD1A 1II3A 4K5VA 2DNCA 1ICWA 4A3DG 1ESFA 2R92G 4MZ9A 2XRQD 3AFQA 4X3SA 1ENCA 3KBXA 1BBWA 5I9OA 4GN4B 4QQBX 3KLRA 2VZAA 3H3VH 3VYUA 4IPDA 1L0WA 4A3BB 4QMGA 1SYBA 3S16B 1EL0A 2SOBA 5IT9E 1Y8NB 3TBIB 1CHQD 4A3FH 2MGSA 4IOAA 3K7AB 4LF8Q 4EX5A 2WACA 3GP7A 5IE8A 5A2QE 1SAPA 4O42A 3GTPH 4K5WA 1Y1VB 4LF8L 2E76C 3PO3H 1E22A 3S2HB 1KHIA 1VQHA 4PV1C 3NSWA 4DV4Q 3PIOA 1QZHA 2HDLA 1M1KC 2JK8A 1AZPA 3AMUA 4DV4L 2B8GA 1S5DD 2IL8A 2Z6KA 4NPSA 1A62A 2V4DA 4XYOA 3TEHB 3G6JB 1EY7A 3Q23A 3HGBA 4IPGA 2PW5A 2R7DA 2F0LA 2PZWA 2I5LX 2R93G 1D8LA 1JB3A 3I55A 1ZXTA 1PRTF 2WB1G 3PF5A 1HNZQ 1EIHA 1ET9A 1WFQA 1V8QA 3U4ZA 2WB1E 2EXZA 2K5NA 5C0XJ 1VF5C 4KK7A 1A0IA 1GD7A 5C4ZA 3ITPA 3FEWX 5FLXc 2EZVA 2F0DA 1TWGB 2I5HA 5HGTA 1TY0A 3TSSA 1RDPD 5M5XH 4NW2A 1IBMQ 1Q8IA 1N32Q 1J6QA 3HKZG 4QIWB 4XXEA 1MKHA 3S2DB 3AFPA 3VYRA 3HKZE 3A8KE 2JA6B 4DK0A 1IBML 3HOYG 1WTOA 1N32L 1BCPF 2PMZB 1FJGQ 1JOQA 4HJ8A 1Y8OB 5FKAC 3QG1A 3NQTA 1FJGL 1JQYD 2A74C 4QIWE 4KKUA 1D1KA 4MTKA 1DGSA 2WAQG 3EA6A 5CMDA 5I6WA 5KGUA 2JA6G 3RD4A 2ATWA 1PVOA 2WAQE 3MZ5A 1UE5A 1EQTA 3OMGA 3SXHA 3W2DA 3CC7A 4LF7Q 1KAAA 5M5YH 3GTJH 1EIFA 4HEDA 3TQYA 4LF7L 2EY1A 1DM0B 3KLSA 3HP3A 1STHA 4A3LH 1C8CA 3FMCA 4RHSA 3I4MG 3VYTA 3FKIH 1PTOH 4YWMA 4IJLA 5IYCH 1YBYA 1SJED 4YIJA 2PI2A 1U9RA 4Y52H 4TKOB 3VR5A 2M9VA 1AZQA 1B4OA 2IY5B 1BDOA 3A8JE 1SNDA 1CQVA 2F0HA 1Q81C 1U5KA 4C3IH 2HD3A 4KD3A 2VL6A 3NENA 1S72A 4DNRB 3A56A 2BE5D 1EU3A 4GN3B 4UPAA 4LW1A 2ZTDA 1HUMA 2QKIC 3D0FA 3PGZA 2G9HD 1Y1WG 2QDLA 3VR2A 3OWFA 5AJ3Q 3T1YQ 4KHVA 1EY8A 5I4DA 5C0XH 3OHXC 4IPCA 3NTIA 1FYCA 4DF7A 1HUNA 5CBAE 5AJ3L 3T1YL 3KUPA 1VQ6A 1JJCB 3RN2A 5LMNW 1PRTD 1ZYRC 4KY6A 3SHLA 1YJWA 1DOKA 3TS2A 3MXNB 4Y7NH 2F0OA 3S1MH 3MXNA 4IUUA 2FINB 2B29A 4B3TQ 3D4DA 2B8FA 1GKHA 2PNRC 2HQEA 5K36G 3K0YA 2F0EA 3E0EA 3QIAA 3M85A 1CHPD 1D5ZC 4UHVA 4ID6A 4B3TL 4DV7Q 2O5JC 1LABA 1UUPA 3D3RA 4IJHA 4BY1B 3EROA 1VF7A 1B9NA 4DV7L 3GO5A 3IL8A 2K28A 1YHQA 2K32A 3N6RA 2Z4IA 2EPBA 3HEJA 1C9OA 1VQ4A 1QUQB 2E2IB 1QZGA 1QUQA 1BKBA 2WKCA 3I90A 5IYBG 4N8FA 4JV5Q 3F1ZA 3GTGH 2AQ2B 5JJIA 5A2QL 5ELCA 2ALYB 1E0BA 4JV5L 2Z1CA 1X55A 3KJOA 3F2UA 3TRZA 1I3QH 1EYAA 4BS9A 5C3WA 3D31A 2L1BA 4HCEA 5BN5A 1D2BA 2K33A 3GTLB 1I6HH 4J1MA 5COYA 4JBWA 2KENA 5BN3A 1JB7A 3B6YA 2DJGC 1SJHD 3PIP3 4HJAA 1I94Q 1JORA 4FVMA 2UU9Q 5JVG3 1DOLA 3JAMc 3EVQA 1XMOQ 2CH4A 2KA7A 1NJIC 1WJJA 5EPKA 2ZXOA 1I94L 3S9WA 1OTCA 2KECA 1VCIA 4DKAC 5C4HA 4ULLA 3M9BA 1XMOL 1GHJA 5M3MH 3MXGA 1TWAH 2NTTA 5KEEA 2C35B 5LMUL 2EJFC 3PO2B 3BG3A 1TWFH 1HZCA 3E0JA 2XIWA 2B2VC 4DFAA 2LY7A 1HHVA 1G6PA 2D0OA 2QW7A 5D65A 3GTMH 3NEMA 4J15A 4U68A 2Q2UA 1SMXA 3X3MA 4ZLTF 1NMGA 3M3YB 1CQFA 4P72A 2MPMA 1X54A 5IY0A 3LWUA 2AHOB 1TT2A 2IHEA 2C9OA 4A3KG 3CD6A 3S1QB 4HIKA 1E7ZA 2F0VA 5ELDA 2A68C 2EOTA 3NQIA 4RKLA 1GUTA 1Y69U 3RLNA 3ZJYC 2ICEC 3MXUA 1Z7TA 4JW0A 1VQMA 5IGGA 4RMFA 5C4JB 3ONAB 5JEAG 4H0LC 1JJGA 4CDCC 2Q2HA 5GAHC 4L6TB 5IOCA 4KHPQ 5E4XA 1PZKD 4A3EB 4DK6C 2K03A 2LXJA 4HCSA 5T1GA 4GZYC 2GN5A 2JE6I 3H94A 1YI2A 3HOWH 4KHPL 4JI1Q 4PNYA 1TIID 2B2VA 1OXTA 1KNEA 5FJ8H 1LT5D 3ZYYX 3PCOB 2N8NA 5CV4A 3MEFA 2BOSA 4OHJA 1UE6A 1TY2A 4YCVA 3A5UA 2JEAI 4JI1L 1BOSA 1A63A 2NZOA 3RLOA 2YTXA 4FP5D 3HOXH 3HOVH 2NVQH 1EU4A 3E9HA 2YYZA 4HAEA 2BE5C 1LM0A 4QB4A 2KQ3A 1HA5A 2I07B 3EIVA 1STYA 4PMCA 4EVOA 3J81E 4TRDA 4OO1I 1CKNB 2VW9A 1DONA 2JA7G 2NVTH 2RHSB 1K8AC 2KEDA 1FNVA 5EQ0A 1LTTD 4BBRB 5JJLA 1IHZA 1K83B 3PSIA 1EQRA 1SYGA 2E2JB 2D2CC 3FHWA 3FPUB 1F2LA 1PZID 3BDCA 2MFIA 4B3MQ 2EXDA 4GN5A 5EKIA 5CORA 1F9PA 1EYGA 4F8MA 4X3TA 4BBRG 4GS3A 3C46A 4B3ML 4A93B 1SNCA 4IFDI 3IKJA 3GV3A 5C3EB 1EWIA 3IAYA 2JYOA 3CU7A 3KF8B 3RZDH 4KD4A 2K5VA 3KF8A 1DYQA 3O13A 1TS2A 2IX3A 1PFMA 3S15H 2EYMA 2A6ED 2RSNA 1R9TB 3WWVA 3CCUA 1K0SA 5FK9C 4X65Q 1MD2D 2IW3A 2OQ0A 1G2SA 4UAIA 3CRLC 4K8JA 5CBEE 4BY7H 1YNNC 2Z8LA 4X65L 2DJFC 4LF6Q 3SK6A 2E2HB 1CSQA 2AUKA 1MHWC 4QCLA 2KHJA 1HQMC 2ICIA 4XQJA 1SYDA 2AUJD 5CV8A 2VQEQ 3J7A5 1VQ5A 3H0GH 4QJFA 4DR1Q 1SE4A 4BXXH 3EBEA 4LF6L 2SEBD 3H91A 4GKKQ 4GLXA 2KVMA 4KJOA 1DOMA 2XWJB 3CQZB 3FP9A 4DR1L 4GKKL 3CHBD 4R1JA 2K4KA 3TDQA 4QF4A 1R4PB 1LLRD 3G48A 3V2TA 3V96A 4ZUIA 5EKLA 4UY8C 5FLMH 4OONA 3EJIA 1SROA 4ILWA 4FNFA 3VR4A 1ZKOA 5H1SE 2H5XA 3MEHA 5IGCA 2B63G 2LKVA 4HSVA 3S1RH 1SE8A 3L7ZC 3NPPA 3DM3A 4L5QA 1I50H 5EAYA 3TP6A 1PH1A 3ND9A 4IUNA 1BR9A 1O78A 4I7AA 1RIPA 3J81i 1K8OA 4C3HG 2IPKD 2WP8J 4JBJA 3NXWA 4JC0A 5IT9c 1WTPA 4EGVA 3OW7A 1SSOA 1PA6A 3T51B 4N8X1 3Q0AA 1FL0A 5EPLA 2D0PA 1H9MA 1TWHB 1DZ1A 3E9IA 3K57A 2E5LQ 4UP9A 4L63B 1VQDA 4DNIA 2JA8H 1LUZA 5M5WH 2B39A 2X6LA 2E5LL 5E3FA 3UE1A 2F0JA 5C4XG 2Z0SA 3M4YA 1D5XC 1PH7A 4K5XA 3UI2A 1E3PA 3W1BA 2F0NA 3FRPB 3STBD 1KLGD 4A3GG 3TMEA 5EBDA 1BQQT 4OO1G 3NBHB 2DNEA 1PFBA 4GKJQ 3BYYB 4X3KA 3CCRA 1SYEA 2XGTA 3NBHA 1TKWB 1IW7C 3DXJC 3GTOB 4A3BH 1JE4A 3CCSA 2NN6G 1K9MC 1LTRD 3MC0B 4EQPA 4GKJL 2Q8IB 1LTBD 3TREA 3TZUA 1LTID 1DXMA 1Z9FA 2EDGA 2OXPA 1K28A 1FGBD 4MN3A 1Y1VH 1CM9A 4KN7C 1AE3A 3UDIA 3S2HH 3PIO3 3PUWA 2SNSA 3D8GA 1K0RA 3TP7A 1B7YB 4CKEA 3RZOH 1LT3D 4IFDG 1WTQA 2H4OA 1G6ZA 2NBFA 4X62Q 2VUMG 1NCVA 1U0LA 4DK3C 3LX0A 1U4MA 3DEOA 4HTHA 4FO2A 3F2CA 4DAPA 2PYKA 3AB9A 4X62L 1I4RA 2K14A 3P75A 3QOLA 4B9WA 1CZGA 1MI2A 3J81L 3EQLC 3QR8A 1PH4A 1ENFA 4XYQA 2A69C 1VQAA 3IFDA 3OW2A 1QE6A 1VQ8A 4CDFC 3MAQA 4OWWB 4AH6A 2RF4A 5IYDH 3SK5A 4WJWA 2EYJA 2XVSA 4R8IA 1V1OA 1QJOA 5IP9H 1C0AA 3KJPA 1WD0A 2UXCQ 2OTLA 1EZ6A 4NB3A 1N9WA 2K04A 4JI0Q 3NELA 5M3FG 1YZ6A 1YNJC 4KI0A 4Z9CB 2UXCL 3K0XA 3ULLA 1Q1BA 1STAA 2I46A 1RJTA 2R7ZH 2R93B 2ES2A 2WB1B 4JI0L 2KCCA 3GTKB 1WTWA 1YHBA 1SLJA 2KEEA 2ZT9C 2K05A 4IUPA 2E2DC 3P1HA 3TZDA 3W1GA 2JQOA 1F2YA 1I5FA 2KHSA 2XTIA 1ENAA 3K8AA 1X6OA 5LL6S 2UUAQ 2A8VA 2EIFA 3HKZB 4MIUA 1VQGA 3HFZB 2RCFA 3IFTA 1Y8PB 2NVXB 1IL8A 3HOYB 1HNZL 4CJ2C 2D62A 4YCWA 3I4NH 3K81C 3K6OA 1BVSA 3BS1A 3QOJA 3SVMA 2CW0D 2QDBA 4M8AA 4UP8A 4DAYB 1LT6D 3K7UC 1W3SA 1MJEA 4JYAQ 1NNXA 2WAQB 1STGA 3BVGA 4DAYA 5IP7H 3T16A 4DXFA 1FVIA 2F0PA 4TQUS 4A3FB 4JYAL 1GUSA 3Q8DA 1E2WA 1X32A 1EOTA 1GUNA 5JOBA 3I91A 5GROA 3GTPB 2XSCA 1NY4A 1BF4A 2MUYA 2QEJC 4J8QA 1T5XD 4PG3A 2VY3A 4A3FG 1U4RA 3EN2A 2CWPA 4K2KA 4TVAB 1XPOA 2EYFA 5M9OA 1SN8A 3S24A 3Q22A 1Q86C 3DMUA 4HN7A 4EQNA 1Q82C 4JI4Q 4R4OA 2F3VA 1X3QA 3I4MB 1KXLA 2WIIB 1ICFB 3GTQB 2KOLA 3PO3G 3RUZA 3U58A 2GA4B 3CCMA 2NZHA 4QY7A 2F4VQ 3K5NA 5DM63 4G7ZC 3J80c 2RKSA 1YIJA 1EQQA 2JJQA 2OF1A 1U4LA 2F4VL 1XNQQ 2GVAA 4HMJA 2MO1A 3RMHA 5HY6A 1EUJA 4OIKA 4DR7Q 1B50A 1VS0A 5IGDA 1HZAA 2L55A 5A35A 3NWSA 2Q8RE 2R6GA 4MNOA 1XNQL 4LMQD 1Y1WB 4DR7L 5BN4A 1PMRA 2EJMA 5L37A 5JJKA 4K2LA 1J8IA 3ERQA 1H9KA 2BA0A 3BU2A 1A15A 3NP8A 1JJ2A 1K3BC 4BY1H 1HNWQ 3HOUH 1NAPA 2QGQA 4IQZA 4DN4M 2NVYB 1KDBA 4XQNA 1PTOC 1VQLA 3D4RA 2CQOA 3K5MA 1PH5A 3MWYW 4FXKC 1MJCA 1HNWL 5G3LF 3V05A 4H02A 3WDNA 2B2UC 4Q5VA 2GVBA 3HZXA 1RHPA 2IJ0A 3K59A 4YCUA 1QVFA 2KCNA 5KYIA 3VR6A 3OOCA 5BR8Q 1QNKA 2RBMA 2I5MX 4KHZA 2LFNA 1OO9B 1RCVD 4WJ3M 2L0CA 1SNQA 5BR8L 3I2ZA 1HTLD 1PYBA 2E8GA 3TP8A 2F52A 1RF2D 4A3JH 1S5FD 3F2BA 4OX9Q 2RSOA 1BXTA 3PUYA 5M5YB 4FF4A 1NUCA 3M4OB 3GTJB 1RODA 3GTLH 2D5DA 5I6YA 3C1FA 4PQXA 1RKNA 4OX9L 2UXBQ 1TXYA 4LK1C 1RTOA 2ZJPA 1P16A 2BCOA 2F0QA 3R2IA 1BCPD 4LF5Q 3H09A 4GLAC 2HUGA 2L4NA 4C1NK 1PTOB 2UXBL 3L2PA 2RDGA 3CC2A 4J6HA 3SK4A 4LF5L 2JXMB 3A74A 1GXDC 1SRUA 1MSGA 2B2UA 2PO4A 4A3LG 4RH6A 2FMMA 5EKKA 2EYLA 2A73B 4KTAA 1B8AA 2PCFB 2KHIA 2BDOA 2NB0A 2KUMA 3PO2H 1C7YA 2KCTA 3FKIG 4IUTA 5IYCG 3G4SA 4DV0Q 3PUZA 3I3CA 4RFBA 2QCPX 1A2UA 5JJZA 2IT1A 1IXRA 4DV0L 4C3IG 2VXWA 4TSSA 4POFA 4GLVB 1Z6HA 1X3EA 1KTKA 1NSNS 4C1NI 4XT1B 1PH3A 3S17H 1SYFA 2A19A 3CCQA 4DR2Q 3K80C 1ET6A 3HRZC 1SFOB 4E6IA 5EJWA 1SNMA 1TQOA 3VA5A 1E2VA 3K58A 3S1MB 4DR2L 3R2TA 5C0XG 3G71A 4P75A 4FDBA 2L15A 1PH2A 2UU9L 4CDEC 2VB2X 4FF1A 2CW0C 2DY8A 4A3MH 4ZCKA 2V1CC 5JVH3 4DNTB 4V190 4A3CH 1YNXA 2YTYA 4A3EH 1JE5A 2L9HA 3WOFA 1U4PA 4A3KB 1B1ZA 1CZWA 4I65A 5KNBA 5CV7A 1CFMA 3DEPA 2PQAB 3RLFA 2CHBD 4RG1A 5D3IB 3ERSX 2PQAA 3NK9A 2F0IA 1EYDA 2IWHA 1STNA 2BDNA 4K8IA 2NUCA 4YHHQ 2Z9HA 4GNXC 1GUGA 1STBA 2G5DA 5D14A 1EWHA 5CV9A 2C5CA 4YHHL 2WKDA 2PNHA 1TWCH 2Y0SG 1X9NA 1K73C 3SGIA 1TS5A 2JA5H 2Y0SE 4NMZA 4A3IH 2FXQA 1I3QB 1K83H 4IUQA 2FFKB 4R4TA 4DR4Q 3BVMA 3HKSA 1I6HB 2RVLA 2RDFA 1MGSA 3VR3A 2HHHQ 2UUCQ 4DR4L 1EIGA 5CC4A 2KCMA 4OELB 1VQCA 1A3VA 1XTCD 2UUCL 2HHHL 4LJZC 2ID0A 1H9JA 4A93H 1VMCA 3NWTA 3E6ZX 5C3EH 4CDDC 2JA7B 4OWTB 2HQLA 1TWAB 1PH8A 4O2DA 4GOPC 4JCVE 1YEZA 1N33Q 5CV5A 5ISRA 4OGQC 5ELBA 4C3JH 1PFSA 5JPMC 1XYIA 1I6VC 4GNXB 3I4LA 3M7GA 4AIMA 3GTMB 1N33L 2IX0A 3U9OA 5M3MG 1CKNA 4LUOA 1JOKA 2F0UA 4R4QA 2NN6I 1B70B 5ELNA 2UUBQ 3MHBA 1F9RA 2RHQB 1HZBA 4I7ZC 1J5EQ 1PRTC 1QNUA 2O4XA 2G9DA 5DNFA 2SNMA 4OIJA 1FR3A 2UUBL 4CHTB 2E2HH 1LYLA 2HIXA 2K5WA 3MVVA 2MP1A 2RCNA 1NBWA 1V1PB 1WOCA 3J7AF 1O7YA 4IURA 2OTJA 1SE3A 1V1PA 2CVRA 4R4IA 1LTSD 1GUWA 2LMCB 3CQZH 1PZJD 2OT2A 5FLXL 1F9QA 4EQ5A 2PZTA 3GD7A 1KABA 3KFUA 4GOPB 1HPCA 1KDAA 4K6LA 1EEFD 4GOPA 2HIVA 4LFCQ 3CP0A 1LTAD 1IYVA 3TP5A 4KY7A 4HIMA 2B3GA 4LFCL 1G8ZD 3NBIA 4YWKA 3E5SA 4ZAIA 2NYZD 3ICEA 1XJVA 3HOVB 1N34Q 4BBSH 1PRTB 1AFPA 3CXCA 3HOWG 4S3SA 1BBXC 3S1NH 2YU9B 1K3RA 2CH4W 5FJ8G 3NHHA 1N34L 1SMYD 3OMCA 4RGOS 4C2MB 3H6MA 3W5OA 4JI2Q 4H13C 3HOZH 5GQOA 1O7ZA 1WCMH 4RWSC 1EEID 3HOXG 3HOVG 1CA6A 5KNCA 2VQEL 1IBKQ 2L11A 3URYA 1Q7YC 4JI2L 1V1QA 2B63B 4A75A 1XTDA 1QG7A 3SR1A 1EZ8A 1KRSA 3LNNA 4LWCA 4XQQA 1IBKL 4OL7A 2X69A 4FF2A 4KKSA 3S14B 1HH2P 4C3HB 4LFAQ 3CW2C 1VQEA 4LFAL 1N8RC 4CKCA 2F0SA 3ER0A 5C44H 1CKMA 1T9HA 3PF4A 2IHFA 4FXGC 2L5TA 5C4XB 1SNPA 4OEMB 4QGUA 4YWLA 1IYJB 4A3DH 2R92H 4FYDA 3I56A 3KF6B 4PZ6A 4EQOA 4BWGB 3KF6A 1XX8A 2KJXA 5ELFA 4DR3Q 4A3GB 5DM73 1CT1D 5DAUA 1PDQA 2JP1A 3JAMi 4JI7Q 4NDXA 3RR5A 1KLUD 2CWAA 2MO0A 2Q8TA 4AYBB 1UWVA 4JI7L 1ML0D 3M4QA 3H3VI 4MTNA 3DWAA 1QVCA 1CUKA 5C5MA 1XMQQ 1DD2A 3T13A 1AN8A 2WV6D 1F2MA 1KQSA 3KK7A 4BY7G 1DCZA 4HSPA 3D4WA 5J39A 3MTSA 1KAWA 1XMQL 3L0OA 3JC66 3S16H 1XPRA 4AYBG 3FPPA 4F7XA 1L0YB 3K7AH 2CQAA 4AYBE 3CMAA 4HMIA 2F3WA 3H0GG 4BXXG 3AU7A 1I4PA 1YVCA 4DR6Q 2VUMB 2OWOA 1D1IA 1UEAB 4KMUC 2K01A 3VDYA 2BA1A 2AQ3B 3S1RB 2PQEA 3T53B 4DR6L 1YJ9A 2E74C 1TS4A 2R93H 5KIXA 2O5IC 4ZK9B 3GTKH 4KKTA 5FLMG 3K5LA 3A8IE 5EGTA 1PHJA 3U50C 1VQNA 2QILA 1S5ED 4ME5A 4IO9A 2ZJQA 1CI3M 2ZTEA 1IKMA 1GHKA 1S5CD 2F0MA 4ZQ3A 2JA8B 1MIUA 1YHAA 1VDZA 1HQRD 4DA2A 5M3FB 2NVXH 3HOYH 3SK8A 1B44D 2CCZA 3OYYA 2IX1A 1UE7A 4WFN3 1PH6A 1HXYD 1H9SB 5J22A 1TWGH 4DV6Q 1H9SA 1XXGA 4RGTA 3RNUA 3S2DH 2F0FA 2A6HD 3JAML 2JA8G 2J4XA 2MJ8A 3H3VC 4DV6L 2JA6H 3I73A 4DV3Q 1IKLA 2AMCB 3VA7A 1ASZA 1SNOA 3K5OA 3KOJA 3PV0A 1GO3E 1EIYB 1RD9D 1QOHA 1WTRA 1BNZA 1T5EA 2K6AA 4DV3L 4AQYQ 3CPWA 5E4WC 3QWNA 4XIGS 1KIXA 2A6EC 1UNSA 1QVGA 1VQFA 2VNUD 3CCEA 1KRTA 4A3BG 4AQYL 1AP0A 1HZ9A 4DUZQ 3CCJA 1IL2A 1H95A 1JOOA 1ZEQX 4DV5Q 3RZOB 3J7YW 2D9UA 5HURA 4IOCA 4NKLA 4DUZL 2K5DA 2UUAL 3J7ZC 4DV5L 2K75A 1WTVA 5GAEC 3I4MH 4QUCA 4RHRA 3GTQH 1Y1VG 3T1HQ 1SMYC 1SE2A 3KBGA 1EFID 5I9PA 1CSPA 1L0XB 1TVXA 3W3AA 4ZUJA 3T1HL 1JT8A 3R93A 1NR2A 4HR7B 4JVZA 1B53A 1ESRA 4RA8A 4BA2I 4IALA 1C4QA 1VQOA 5FOBB 1AW7A 1PYSB 5E7NA 1YITA 4A76A 4POGA 4R4CA 3J7AV 3CF5A 1HFNA 1PLFA 3C3LA 1UEBA 1Y1WH 4O0AA 1S4ZA 4QL5A 1NR4A 5LHY1 5DLQE 1CKOA 2TSSA 4X6AH 3PO3B 4OWXB 1PXUA 2E75C 1PYWD 2CKZB 3LWEA 4RGMA 3BDOA 1HJPA 2OQKA 3MXPA 2NVYH 5C0XI 1G291 3CKIB 1I4QA 5IYDG 2R7ZB 2F4IA 2NZ1D 3I72A 4JOIC 5IP9G 3ULPA 2MQHA 5EBCA 3OTOQ 4G57A 5D3DA 1GVPA 1JC7A 4BA1I 1L2FA 3G7LA 5K36H 4JI4L 1HR0W 1QILA 3F8TA 3OTOL 4HJ7A 2B2WC 3D6WA 2LSSA 3T56B 1A8VA 2LXKA 2R7ZG 2PMZE 2Z6BA 1X3PA 4X3UA 1EOVA 2L12A 2A68D 2XWBB 2K7VA 4HIDA 4DV1Q 3D6CA 1K8MA 1FNWA 5JEAJ 1B3AA 2OCEA 3A55A 3Q6SA 2TMPA 4DAMA 4PZ7A 1OXSC 2R61A 3I4NB 4DV1L 3M4OH 1XPUA 3STBC 2HCIA 5C5LA 1I4XA 5M5XB 3H15A 3GDEA 1LACA 3RN5A 1ONLA 4KLKA 2Q2TA 1Q1EA 5ELOA 4IN3A 1RTNA 5IWAQ 2XNAC 5ELEA 4WRDA 5IYBH 3ULJA 2EY5A 1X3GA 1DJRD 3I4NG 1TU2B 5CR3A 5IWAL 4V0BA 2E2IH 4JOIA 5J3BA 4G7HC 2VQFQ 4ALPA 1Q90A 5IODA 3N52A 3CC4A 2K5HA 5IP7G 1W6JA 2YTVA 4KN4C 1OXVA 3P20A 5T1IA 2VQFL 3MFYA 2B2WA 2O2LD 2ZXPA 3C2PA 2PI2E 4A4IA 4B3RQ 4JK1C 5FLXE 3KLSX 1O80A 2EVBA 2VB3X 3MA2B 5TSSA 3A5ZB 1NTGA 1W6KA 3PUVA 4K6DA 4B3RL 3C1EA 1CK1A 3R8BA 1HR0Q 5KYLA 4XT3B 4B9XA 1E1TA 2VS1A 4RAUC 3OIPA 4ZYSA 1SFOH 1LT4D 2F0TA 3T4AC 1KNAA 2HDMA 1HR0L 3A0JA 4L5TA 3SDZA 4JBMA
chains in the Genus database with same CATH topology
3FKIB 5CV6A 4KV6A 1GJXA 2N88A 4R9WA 3FVQA 2A6HC 3I70A 1SYCA 1EY0A 4C3IB 2EJGC 1JR0D 4IUVA 3HOUB 1F9SA 2EYPA 2EE1A 1WVLA 4N9TA 1F77A 2LS01 3L9AX 4C56C 5K5PA 1BUVT 3DHQA 3J80E 5IT9L 3QJYA 5CYUA 2F0KA 2K5QA 2B2TC 4F88A 5IGEA 5JEAH 1A3TA 1YNND 2WINB 5I2XA 1MBYA 1I4GA 2JSOA 1EYCA 4DGZA 2NWGA 3PUXA 4Y7NB 1OXXK 1O7LA 4DXGA 4A3JB 1G91A 2FHTA 5J1ZA 2MHVA 1AEXA 3FDTA 1Z47A 2PW7A 2EY6A 2AWNA 3I8ZA 1JWSD 5G3LD 3HS0C 4KJNA 1OXUA 1S5BD 4RKBA 3U9SA 3BYTB 1SEBD 5NUCA 1C48A 2Y0SB 3OSOA 4CGYB 3NTHA 4XTCS 1UAPA 2M00A 3HG9A 2B2TA 3GTGB 1A2TA 5JAVA 2AWOA 4UDUC 2RA4A 4Q0FA 2XRSD 2J0TD 1FNUA 4CBVA 2JEBI 4G7OC 5KNDA 3GQBA 1KDCA 5KRUA 1QCBD 3S17B 2FJ2A 2PPBC 5F2DA 4F87A 4IZ8A 1CTMA 1HA6A 2AQ1B 1H9RA 5JPNC 3R3OA 3A7AB 2RQXA 5FO9B 5FO8B 5C3XA 5AFWA 5M3MB 1IW7D 2B2YC 4A3MB 5E1FA 4PMWA 4DU9A 2F1MA 1TWFB 1B2TA 5EPJA 2X6GA 1LTGD 1EY5A 4IFDJ 3DWQA 3OPOA 2EYHA 4KY5A 4XDXA 4RCNA 3EFXD 3JAME 2RDHA 5FO7B 1LO5D 2FMCA 2EYOA 3L3OC 1J9OA 1QWYA 1TWCB 2JA5B 3MFGA 1M4VA 1EY9A 4A3IB 3VYSA 2A69D 1GUOA 3TN2A 2B2YA 2HCCA 4PMBA 1MSHA 1BCPC 1HFGA 1STEA 4FF3A 3HOWB 4CJ0B 4CJ1B 3PMFA 4CKBA 4R8NA 1YNJD 2F03A 3WOEA 3GV6A 3P7JA 3HOXB 2NVQB 3ND8A 4ABNA 1PTOF 3SE0A 2Z4HA 2R3ZA 4C3JB 1V43A 1VMPA 2NVTB 4B08A 1SBBB 2F0GA 1TS3A 1JCKB 4OO1H 1JICA 4G4KA 4C3JG 1LV9A 4H7BA 5CGKA 3M7NA 2NN6H 1A6XA 2DN8A 3J80L 1BCPB 2M2LA 2K1BA 4ZKBB 3Q24A 1I4HA 1Q3LA 3X3NA 1FD7D 1EY4A 3DM1A 2A5HA 1M8AA 1ILQA 3RZDB 4IFDH 2H1EA 3NE5B 5IGBA 4MHEA 3DUZA 3NUCA 3S15B 2ENBA 4O1NA 1BO0A 5DEHA 4DK1A 3A54A 3A7LA 4P2CB 4DAVA 1ILPA 2F0WA 1D6EC 1EWCA 3CRKC 1TR5A 4NP5A 3NTKA 4BY7B 3OWEB 4BBSB 5LL6X 1A3UA 3S1NB 1GOZA 4L8JA 5C6AA 2DY7A 2N55A 2ZXRA 3DWPA 1D5MC 3H0GB 1HRJA 3HOZB 4ZRZA 1WCMB 4QUFA 4RCOA 2J7ZA 5IGFA 2QF7A 1JWMD 1HTPA 3SEBA 2NTSA 4ODGA 4ZKCB 1XWEA 5I2YA 1R4QB 3QB3A 4K14A 1B9MA 1Q12A 2OEOA 4N9PA 1JWUD 1I50B 1PFNA 4WORA 2SDFA 1PTOD 4FXDA 1SXTA 1EY6A 1IYUA 2EY2A 3BDLA 5C44B 4H44C 3BVZA 2PZUA 4RGNA 1EQVA 3QO2A 1HCZA 1F2ZA 4A3DB 2R92B 4LAAA 2XN9C 1SDFA 3BZDB 1WTXA 1ZYRD 5IIFA 4U673 5M5WB 1G2TA 1E2ZA 1QB5D 4M1UB 3OIQA 1CA5A 1WD1A 1II3A 4K5VA 2DNCA 1ICWA 1ESFA 2XRQD 4X3SA 1ENCA 3KBXA 5I9OA 3KLRA 3VYUA 4A3BB 4QMGA 1SYBA 3S16B 1EL0A 2SOBA 5IT9E 1Y8NB 3TBIB 1CHQD 2MGSA 3K7AB 2WACA 3GP7A 5A2QE 1SAPA 4O42A 4K5WA 1Y1VB 2E76C 3S2HB 4PV1C 3NSWA 2HDLA 1AZPA 3AMUA 2B8GA 1S5DD 2IL8A 2V4DA 4XYOA 3G6JB 1EY7A 3Q23A 3HGBA 2PW5A 2F0LA 2PZWA 1JB3A 1ZXTA 1PRTF 1EIHA 1ET9A 1V8QA 2EXZA 5C0XJ 1VF5C 4KK7A 5C4ZA 3ITPA 3FEWX 2EZVA 2F0DA 1TWGB 5HGTA 1TY0A 3TSSA 1RDPD 4NW2A 1Q8IA 4QIWB 4XXEA 3S2DB 3VYRA 3A8KE 2JA6B 4DK0A 1WTOA 1BCPF 2PMZB 1JOQA 1Y8OB 5FKAC 3QG1A 3NQTA 1JQYD 2A74C 4KKUA 1D1KA 5I6WA 3EA6A 5CMDA 5KGUA 3RD4A 3MZ5A 1EQTA 3OMGA 3SXHA 3W2DA 1KAAA 4HEDA 2EY1A 1DM0B 3KLSA 3HP3A 1STHA 1C8CA 3FMCA 4RHSA 3VYTA 1PTOH 1SJED 4YIJA 1U9RA 4TKOB 3VR5A 2M9VA 1AZQA 1B4OA 1BDOA 3A8JE 1SNDA 1CQVA 2F0HA 4KD3A 4DNRB 3A56A 2BE5D 1EU3A 1HUMA 2QKIC 2G9HD 3VR2A 3OWFA 4KHVA 1EY8A 5I4DA 5C0XH 3OHXC 3NTIA 1FYCA 4DF7A 1HUNA 5CBAE 3KUPA 1PRTD 1ZYRC 4KY6A 3SHLA 1DOKA 2F0OA 3MXNA 4IUUA 2FINB 3D4DA 2B8FA 5K36G 2PNRC 2HQEA 3K0YA 2F0EA 3QIAA 3M85A 1CHPD 1D5ZC 4ID6A 2O5JC 1LABA 1UUPA 3D3RA 4BY1B 3EROA 1VF7A 1B9NA 3GO5A 3IL8A 2K28A 2K32A 3N6RA 2Z4IA 2EPBA 3HEJA 2E2IB 2WKCA 3I90A 2AQ2B 5A2QL 5ELCA 1E0BA 2Z1CA 3F2UA 1EYAA 4BS9A 5C3WA 3D31A 2L1BA 4HCEA 5BN5A 1D2BA 2K33A 3GTLB 4J1MA 5COYA 4JBWA 5BN3A 1SJHD 3PIP3 1JORA 4FVMA 5JVG3 1DOLA 3EVQA 2KA7A 5EPKA 2ZXOA 3S9WA 2KECA 1VCIA 5C4HA 4ULLA 1GHJA 3MXGA 2NTTA 5KEEA 2EJFC 3PO2B 3BG3A 3E0JA 2XIWA 2B2VC 4DFAA 2LY7A 1HHVA 5D65A 4U68A 3X3MA 4ZLTF 3M3YB 1CQFA 2MPMA 3LWUA 1TT2A 2C9OA 3S1QB 2F0VA 5ELDA 2A68C 2EOTA 3NQIA 4RKLA 1GUTA 1Y69U 2ICEC 3MXUA 1Z7TA 5IGGA 5C4JB 3ONAB 5JEAG 4H0LC 4L6TB 5IOCA 5E4XA 1PZKD 4A3EB 2K03A 4HCSA 5T1GA 4GZYC 2JE6I 3H94A 4PNYA 1TIID 2B2VA 1OXTA 1KNEA 1LT5D 3ZYYX 5CV4A 2BOSA 4OHJA 1TY2A 2JEAI 1BOSA 4FP5D 1EU4A 2YYZA 4HAEA 2BE5C 4QB4A 2KQ3A 1HA5A 2I07B 1STYA 4PMCA 4EVOA 3J81E 4TRDA 4OO1I 1DONA 2KEDA 1FNVA 5EQ0A 1LTTD 4BBRB 1IHZA 1K83B 1SYGA 2E2JB 2D2CC 3FPUB 1F2LA 1PZID 3BDCA 5EKIA 5CORA 1F9PA 4F8MA 4X3TA 3C46A 4A93B 1SNCA 4IFDI 3IKJA 3GV3A 5C3EB 3IAYA 2JYOA 3CU7A 4KD4A 3KF8A 1DYQA 3O13A 1TS2A 2IX3A 1PFMA 2EYMA 2A6ED 2RSNA 1R9TB 5FK9C 1MD2D 2IW3A 1G2SA 4UAIA 3CRLC 4K8JA 5CBEE 1YNNC 2Z8LA 3SK6A 2E2HB 2AUKA 4QCLA 1HQMC 2ICIA 4XQJA 1SYDA 2AUJD 5CV8A 1SE4A 2SEBD 3H91A 2KVMA 4KJOA 1DOMA 2XWJB 3CQZB 3CHBD 3TDQA 4QF4A 1R4PB 1LLRD 3V2TA 3V96A 4ZUIA 5EKLA 3EJIA 4ILWA 4FNFA 3VR4A 1ZKOA 3MEHA 5IGCA 2LKVA 4HSVA 3L7ZC 3NPPA 3TP6A 3ND9A 4IUNA 1BR9A 1O78A 1K8OA 4C3HG 2IPKD 2WP8J 3NXWA 1WTPA 4EGVA 3OW7A 1SSOA 3T51B 3Q0AA 5EPLA 1H9MA 1TWHB 1DZ1A 3K57A 4L63B 2B39A 2X6LA 5E3FA 2F0JA 3M4YA 1D5XC 4K5XA 3UI2A 2F0NA 3FRPB 1KLGD 3TMEA 5EBDA 1BQQT 4OO1G 2DNEA 1PFBA 3BYYB 4X3KA 1SYEA 3NBHA 1TKWB 1IW7C 3DXJC 3GTOB 1JE4A 2NN6G 1LTRD 3MC0B 4EQPA 2Q8IB 1LTBD 3TZUA 1LTID 1DXMA 2EDGA 2OXPA 1FGBD 4MN3A 1CM9A 4KN7C 3PIO3 3PUWA 2SNSA 3D8GA 3TP7A 4CKEA 1LT3D 4IFDG 1WTQA 2H4OA 1G6ZA 2NBFA 1NCVA 3LX0A 1U4MA 3DEOA 4HTHA 4FO2A 4DAPA 2PYKA 3AB9A 1I4RA 3P75A 3QOLA 4B9WA 1CZGA 1MI2A 3J81L 3EQLC 1ENFA 4XYQA 2A69C 3IFDA 1QE6A 3MAQA 3SK5A 4WJWA 2EYJA 2XVSA 4R8IA 1V1OA 1QJOA 1WD0A 1EZ6A 2K04A 1YNJC 4KI0A 4Z9CB 1Q1BA 1STAA 2I46A 1RJTA 2R93B 2WB1B 2KCCA 3GTKB 1WTWA 2KEEA 2ZT9C 2K05A 4IUPA 2E2DC 3P1HA 3TZDA 1F2YA 2KHSA 1ENAA 5LL6S 3HKZB 4MIUA 3IFTA 1Y8PB 2NVXB 1IL8A 3HOYB 4CJ2C 2D62A 3K6OA 3BS1A 3QOJA 3SVMA 2CW0D 2QDBA 4M8AA 1LT6D 2WAQB 1STGA 3BVGA 4DAYA 3T16A 4DXFA 2F0PA 4TQUS 4A3FB 1GUSA 1E2WA 1X32A 1EOTA 1GUNA 5JOBA 3I91A 3GTPB 2XSCA 1BF4A 2MUYA 2QEJC 4J8QA 1T5XD 1U4RA 4K2KA 2EYFA 5M9OA 3Q22A 3DMUA 4HN7A 4EQNA 2F3VA 1X3QA 3I4MB 2WIIB 3GTQB 2KOLA 3RUZA 2GA4B 3K5NA 5DM63 4G7ZC 2RKSA 2OF1A 1U4LA 4HMJA 3RMHA 4OIKA 1B50A 5IGDA 2L55A 5A35A 3NWSA 2Q8RE 2R6GA 4LMQD 1Y1WB 5BN4A 1PMRA 2EJMA 4K2LA 1J8IA 3ERQA 1H9KA 2BA0A 3NP8A 1A15A 1NAPA 4IQZA 4DN4M 2NVYB 1KDBA 4XQNA 1PTOC 3D4RA 3K5MA 3MWYW 4FXKC 5G3LF 3V05A 3WDNA 2B2UC 4Q5VA 3HZXA 1RHPA 2IJ0A 3K59A 2KCNA 5KYIA 3VR6A 3OOCA 1QNKA 2RBMA 4KHZA 2LFNA 1OO9B 1RCVD 2L0CA 1SNQA 1HTLD 3TP8A 1RF2D 1S5FD 2RSOA 1BXTA 3PUYA 5M5YB 4FF4A 1NUCA 3M4OB 3GTJB 1RODA 2D5DA 5I6YA 3C1FA 4PQXA 1RKNA 4LK1C 1RTOA 2BCOA 2F0QA 3R2IA 1BCPD 3H09A 4C1NK 2HUGA 2L4NA 1PTOB 2RDGA 4J6HA 3SK4A 2JXMB 1GXDC 1MSGA 2B2UA 2PO4A 4RH6A 2FMMA 5EKKA 2EYLA 2A73B 4KTAA 2PCFB 2BDOA 2NB0A 2KUMA 4IUTA 3PUZA 3I3CA 4RFBA 2QCPX 1A2UA 5JJZA 2IT1A 4C3IG 2VXWA 4TSSA 1Z6HA 1KTKA 1NSNS 4C1NI 4XT1B 1SYFA 1SFOB 1ET6A 3HRZC 4E6IA 5EJWA 1SNMA 1TQOA 3VA5A 1E2VA 3K58A 3S1MB 3R2TA 5C0XG 2VB2X 4FF1A 2CW0C 2DY8A 5JVH3 4DNTB 4V190 2L9HA 3WOFA 1U4PA 4A3KB 1B1ZA 1CZWA 4I65A 5KNBA 5CV7A 1CFMA 3DEPA 3RLFA 2CHBD 5D3IB 3NK9A 2F0IA 1EYDA 2IWHA 1STNA 2BDNA 4K8IA 2NUCA 1GUGA 1STBA 5D14A 1EWHA 5CV9A 2C5CA 2WKDA 1TS5A 4NMZA 1I3QB 4IUQA 2FFKB 3BVMA 1I6HB 2RVLA 2RDFA 1MGSA 3VR3A 1EIGA 5CC4A 1A3VA 1XTCD 4LJZC 2ID0A 1H9JA 1VMCA 3NWTA 3E6ZX 2JA7B 1TWAB 5CV5A 5ISRA 4OGQC 5ELBA 5JPMC 1XYIA 1I6VC 3I4LA 3M7GA 3GTMB 2IX0A 3U9OA 1JOKA 2F0UA 2NN6I 3MHBA 1F9RA 4I7ZC 1PRTC 1QNUA 2O4XA 2G9DA 5DNFA 2SNMA 4OIJA 1FR3A 4CHTB 2K5WA 3MVVA 2MP1A 1V1PB 3J7AF 1O7YA 4IURA 1SE3A 1V1PA 2CVRA 1LTSD 1GUWA 2LMCB 1PZJD 2OT2A 5FLXL 1F9QA 2PZTA 3GD7A 1KABA 1HPCA 1KDAA 4K6LA 1EEFD 1IYVA 1LTAD 3TP5A 4KY7A 1G8ZD 3NBIA 3E5SA 4ZAIA 2NYZD 3HOVB 1PRTB 1AFPA 4S3SA 1BBXC 2YU9B 3NHHA 1SMYD 3OMCA 4RGOS 4C2MB 3H6MA 4H13C 1O7ZA 4RWSC 1EEID 1CA6A 5KNCA 2L11A 3URYA 2B63B 1QG7A 3SR1A 1EZ8A 3LNNA 4XQQA 4OL7A 2X69A 4FF2A 4KKSA 3S14B 4C3HB 4CKCA 2F0SA 4FXGC 2L5TA 5C4XB 1SNPA 4FYDA 4EQOA 4BWGB 1XX8A 2KJXA 5ELFA 4A3GB 5DM73 1CT1D 5DAUA 1PDQA 2JP1A 4NDXA 1KLUD 2Q8TA 4AYBB 1ML0D 3DWAA 5C5MA 1DD2A 3T13A 1AN8A 2WV6D 1F2MA 3KK7A 1DCZA 4HSPA 3D4WA 5J39A 3MTSA 3FPPA 4F7XA 1L0YB 2CQAA 4HMIA 2F3WA 3AU7A 1I4PA 2VUMB 1D1IA 1UEAB 4KMUC 2K01A 2BA1A 2AQ3B 3S1RB 2PQEA 3T53B 2E74C 1TS4A 5KIXA 2O5IC 4ZK9B 4KKTA 3K5LA 3A8IE 5EGTA 2QILA 1S5ED 4ME5A 1CI3M 1IKMA 1GHKA 1S5CD 2F0MA 4ZQ3A 2JA8B 1VDZA 1HQRD 4DA2A 5M3FB 3SK8A 1B44D 2IX1A 4WFN3 1HXYD 1H9SB 5J22A 1H9SA 1XXGA 4RGTA 2F0FA 2A6HD 3JAML 2J4XA 2MJ8A 3H3VC 3I73A 1IKLA 3VA7A 1SNOA 3K5OA 3PV0A 1RD9D 1QOHA 1WTRA 1BNZA 1T5EA 2K6AA 5E4WC 3QWNA 4XIGS 2A6EC 1UNSA 2VNUD 1AP0A 1JOOA 1ZEQX 3RZOB 3J7YW 2D9UA 5HURA 4NKLA 2K5DA 1WTVA 4QUCA 4RHRA 1SMYC 1SE2A 3KBGA 1EFID 5I9PA 1L0XB 3W3AA 1TVXA 4ZUJA 3R93A 1NR2A 4HR7B 1B53A 1ESRA 4RA8A 4BA2I 4IALA 1C4QA 5FOBB 1AW7A 3J7AV 1HFNA 1PLFA 3C3LA 1S4ZA 1NR4A 5LHY1 2TSSA 3PO3B 4RGMA 1PXUA 2E75C 1PYWD 3LWEA 3BDOA 3MXPA 5C0XI 1G291 3CKIB 1I4QA 2R7ZB 2F4IA 2NZ1D 3I72A 5EBCA 4G57A 5D3DA 1JC7A 4BA1I 3G7LA 5K36H 1QILA 2B2WC 3D6WA 3T56B 1X3PA 4X3UA 2L12A 2A68D 2XWBB 2K7VA 3D6CA 1K8MA 1FNWA 5JEAJ 1B3AA 3A55A 3Q6SA 2TMPA 1OXSC 2R61A 3I4NB 2HCIA 5C5LA 1I4XA 5M5XB 1LACA 1ONLA 1Q1EA 4IN3A 1RTNA 2XNAC 5ELEA 4WRDA 2EY5A 1DJRD 1TU2B 5CR3A 4V0BA 4G7HC 1Q90A 5IODA 3N52A 1W6JA 4KN4C 1OXVA 3P20A 5T1IA 3MFYA 2B2WA 2O2LD 2ZXPA 3C2PA 4JK1C 5FLXE 3KLSX 1O80A 2EVBA 2VB3X 3MA2B 5TSSA 1W6KA 3PUVA 4K6DA 3C1EA 1CK1A 3R8BA 5KYLA 4XT3B 4B9XA 4RAUC 3OIPA 4ZYSA 1LT4D 2F0TA 3T4AC 1KNAA 2HDMA 3SDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3C A;  1QG7 A;  3GV6 A;  3LWE A;  3P7J A;  1WD0 A;  1U4L A;  1WTP A;  1HUM A;  2KEC A;  1SSO A;  5JJZ A;  1ZXT A;  2K04 A;  1EIH A;  4OIK A;  2X69 A;  2R3Z A;  1B50 A;  5EPL A;  3FPU B;  2VXW A;  2N88 A;  1F2L A;  2NZ1 D;  2Q8R E;  4R9W A;  1IKM A;  1VMP A;  2FJ2 A;  1DZ1 A;  1RJT A;  5EKI A;  4LMQ D;  5EPK A;  5COR A;  1XYI A;  1F9P A;  1HUN A;  4XT1 B;  5CBA E;  3KUP A;  4X3T A;  1PFN A;  2SDF A;  1WTW A;  2XIW A;  1J8I A;  2B2V C;  3G7L A;  2KEE A;  2X6L A;  1HHV A;  1HA6 A;  4IUV A;  5EJW A;  1F9S A;  2K05 A;  1A15 A;  4IUP A;  4NW2 A;  1JIC A;  5D65 A;  2EE1 A;  2B2W C;  3TZD A;  3D6W A;  1DOK A;  3GV3 A;  1WVL A;  4U68 A;  1NAP A;  1F9R A;  1LV9 A;  2JYO A;  5AFW A;  4DN4 M;  4ZLT F;  1X3P A;  3QO2 A;  4X3U A;  3UI2 A;  2L12 A;  2B2Y C;  2FIN B;  4IUU A;  2MPM A;  1WTO A;  3MWY W;  5DNF A;  2MJ8 A;  4OIJ A;  2M2L A;  2K1B A;  1SDF A;  2DY8 A;  4ZKB B;  1PFM A;  1WTX A;  1PFB A;  2B2U C;  1IKL A;  1B3A A;  4X3K A;  1RHP A;  3Q6S A;  1IL8 A;  2B2T C;  2MP1 A;  1XX8 A;  2RSN A;  1B2T A;  1JE4 A;  1Q3L A;  2EOT A;  4CJ2 C;  5EPJ A;  1G2T A;  2HCI A;  1HFN A;  1O7Y A;  1QNK A;  4IUR A;  1WTR A;  1BNZ A;  2X6G A;  2L9H A;  1CA5 A;  2CVR A;  1PDQ A;  2JP1 A;  1WD1 A;  5E4W C;  1GUW A;  1U4P A;  1G2S A;  5CMD A;  4UAI A;  3DM1 A;  1ICW A;  2NWG A;  3IL8 A;  3SVM A;  5CBE E;  1RTN A;  3DEP A;  2K28 A;  1M8A A;  4X3S A;  3ONA B;  2Q8T A;  1ILQ A;  1F9Q A;  3KBX A;  1ML0 D;  1EQT A;  4MN3 A;  2H1E A;  1CM9 A;  2EPB A;  1AP0 A;  1G91 A;  4MHE A;  4XDX A;  5E4X A;  2FHT A;  1BO0 A;  2RSO A;  2D9U A;  2K03 A;  2BDN A;  4HCS A;  1ILP A;  1ROD A;  1X32 A;  5T1G A;  1EL0 A;  3H91 A;  3I90 A;  3FDT A;  1WTV A;  1WTQ A;  3N52 A;  1EOT A;  2KVM A;  3MTS A;  2MGS A;  4QUC A;  1J9O A;  1DOM A;  4HED A;  2B2V A;  1KNE A;  5D14 A;  1RTO A;  1G6Z A;  3I91 A;  3I8Z A;  1NCV A;  3HP3 A;  5T1I A;  4ZAI A;  2NYZ D;  2B2W A;  1SAP A;  1U4M A;  4O42 A;  1C8C A;  1E0B A;  1TVX A;  2HUG A;  2L4N A;  3DEO A;  1BF4 A;  3R93 A;  4IUQ A;  2DY7 A;  3F2U A;  1NR2 A;  2FFK B;  2N55 A;  1U4R A;  1BBX C;  3TN2 A;  1B53 A;  1ESR A;  4RA8 A;  2B2Y A;  2HCC A;  1MSH A;  1O80 A;  4HAE A;  2L1B A;  1MI2 A;  2K01 A;  1HFG A;  1HRJ A;  2RVL A;  2HDL A;  1MSG A;  2B2U A;  1X3Q A;  1MGS A;  4QUF A;  1AZP A;  2FMM A;  2J7Z A;  3IFD A;  4HSV A;  1QE6 A;  4CJ0 B;  1PLF A;  2KOL A;  1EIG A;  2B2T A;  5COY A;  1AZQ A;  1B4O A;  1O7Z A;  4XT3 B;  2KUM A;  4RWS C;  2IL8 A;  4RAU C;  4CJ1 B;  1S4Z A;  1DON A;  4ZK9 B;  1CA6 A;  1NR4 A;  1DOL A;  2L11 A;  4IUT A;  2KED A;  1KNA A;  2HDM A;  5EQ0 A;  2RA4 A;  4ZKC B;  4R8I A;  1VMC A; 
#chains in the Genus database with same CATH topology
 4UP7 A;  3FKI B;  5CV6 A;  4KV6 A;  4DV2 Q;  1YJN A;  1GM5 A;  1GJX A;  2N88 A;  4R9W A;  3FVQ A;  4DV2 L;  2A6H C;  3I70 A;  2P5Z X;  1SYC A;  1EY0 A;  4C3I B;  4LFB Q;  3PQI A;  3G6E A;  2EJG C;  1KD1 C;  1JR0 D;  4IUV A;  3HOU B;  1F9S A;  2EYP A;  4IPH A;  1IBL Q;  1ASY A;  2EE1 A;  1WVL A;  4A3K H;  3BZC A;  4LFB L;  1VQB A;  2AKW B;  4N9T A;  1F77 A;  2LS0 1;  1IBL L;  3L9A X;  4C56 C;  1BUV T;  5K5P A;  3M3Y H;  3DHQ A;  4LUZ A;  3CCV A;  1Q46 A;  3J80 E;  5IT9 L;  2EQS A;  3J81 j;  1X65 A;  4P71 A;  3QJY A;  4BY1 G;  4LF9 Q;  2KBN A;  5CYU A;  1P8L A;  2F0K A;  2B2T C;  2K5Q A;  4F88 A;  5IGE A;  5JEA H;  3HOU G;  2A1A A;  2K52 A;  1A3T A;  1YNN D;  2WIN B;  5I2X A;  3S1Q H;  1MBY A;  1AH9 A;  1I4G A;  2JSO A;  1EYC A;  4LUV A;  4LF9 L;  4DGZ A;  3UDG A;  2NWG A;  3PUX A;  4Y7N B;  1HNX Q;  1EFW A;  1OXX K;  1O7L A;  3J81 c;  4DXG A;  3KDF B;  4A3J B;  5C4J H;  3KDF A;  1G91 A;  2N49 A;  1HNX L;  2FHT A;  5J1Z A;  5LMN Q;  4DPG A;  2MHV A;  1AEX A;  3FDT A;  1L1O C;  1Z47 A;  5LMN L;  2PW7 A;  2EY6 A;  2AWN A;  3I8Z A;  1JWS D;  4A3J G;  5G3L D;  3HS0 C;  4KJN A;  1NE3 A;  1OXU A;  5LMU Q;  1S5B D;  4JG2 A;  4RKB A;  1UE1 A;  2K50 A;  3U9S A;  3BYT B;  1SEB D;  5NUC A;  2JA7 H;  1C48 A;  2Y0S B;  3OSO A;  4CGY B;  3NTH A;  4XTC S;  3F2D A;  1UAP A;  2M00 A;  3HG9 A;  2B2T A;  3GTG B;  1A2T A;  4L5R C;  4JI8 Q;  5JAV A;  2AWO A;  1BBU A;  4UDU C;  1K8G A;  2RA4 A;  4Q0F A;  2XRS D;  4JI8 L;  1X56 A;  2J0T D;  4BBR H;  1FNU A;  4CBV A;  2JEB I;  4G7O C;  3PO2 G;  5KND A;  3GQB A;  1KDC A;  1JMC A;  2E2J H;  2ZTC A;  5KRU A;  1QCB D;  3CAM A;  4JBK A;  3S17 B;  2FJ2 A;  3UE0 A;  2PPB C;  1L1O B;  4OXP A;  1B3Q A;  5F2D A;  4F87 A;  5GAD C;  1L1O A;  4IZ8 A;  1CTM A;  1HA6 A;  2AQ1 B;  3PIP A;  1H9R A;  4K0K Q;  5JPN C;  3R3O A;  3A7A B;  2F3I A;  2RQX A;  5FO9 B;  5FO8 B;  5C3X A;  5AFW A;  1VQ9 A;  5M3M B;  1IW7 D;  4K0K L;  2B2Y C;  4A3M B;  1X3F A;  5E1F A;  4PMW A;  4DU9 A;  2F1M A;  4LNQ A;  1TWF B;  3BZK A;  2Q2I A;  1B2T A;  3TS0 A;  5EPJ A;  1VQJ A;  2JN4 A;  1G51 A;  2X6G A;  3J80 i;  4GNX A;  1R9T H;  1LTG D;  1EY5 A;  4A3M G;  4IFD J;  4YY3 Q;  4A3C G;  4A3E G;  1D7Q A;  4JI3 Q;  3DWQ A;  3OPO A;  3KYH C;  2EYH A;  1WYD A;  4KY5 A;  4JI6 Q;  4XDX A;  4YY3 L;  4NXM Q;  2YU9 H;  4RCN A;  3AEV A;  3EFX D;  3JAM E;  2RDH A;  4JI3 L;  1J5E L;  2ZM6 Q;  4C2M H;  4JI6 L;  5FO7 B;  4NXM L;  1LO5 D;  2FMC A;  2EYO A;  3L3O C;  1J9O A;  1QWY A;  1TWC B;  3IRB A;  2JA5 B;  3MFG A;  2ZM6 L;  1M4V A;  1EY9 A;  4A3I B;  1PH9 A;  2ASB A;  4HJ9 A;  4NXN Q;  2B63 H;  2BH8 A;  3VYS A;  2A69 D;  2WFW A;  1GUO A;  3TN2 A;  2B2Y A;  2HCC A;  4PMB A;  1MSH A;  1BCP C;  4NXN L;  4B3S Q;  2DUD A;  1HFG A;  1STE A;  3S14 H;  4FF3 A;  4C3H H;  2N3S A;  4DR5 Q;  5HGQ A;  3HOW B;  4CJ0 B;  2JA5 G;  4A3I G;  3DLL A;  4B3S L;  4CJ1 B;  3PMF A;  3UDF A;  4CKB A;  4R8N A;  4DR5 L;  2DGY A;  1YNJ D;  2F03 A;  3WOE A;  1E24 A;  3GV6 A;  3P7J A;  3HOX B;  2NVQ B;  3ND8 A;  4ABN A;  1PTO F;  3SE0 A;  2Z4H A;  2R3Z A;  4C3J B;  5C4X H;  1WI5 A;  1V43 A;  1VMP A;  1VQI A;  2I0Q A;  4A93 G;  1FGU A;  4L5S A;  1TWH H;  4X64 Q;  5C3E G;  2NVT B;  4B08 A;  4HIO A;  1SBB B;  1O7I A;  2F0G A;  4A3G H;  1TS3 A;  1JCK B;  4OO1 H;  3I4O A;  1JIC A;  5GAG C;  4X64 L;  1SR3 A;  1VQK A;  4G4K A;  4C3J G;  1LV9 A;  4X66 Q;  4H7B A;  5CGK A;  3M7N A;  1Y14 B;  2NN6 H;  3CME A;  2DN8 A;  4JPB W;  4HJ5 A;  1XNR Q;  1A6X A;  3J80 L;  1BCP B;  2MNA A;  2M2L A;  2K1B A;  4X66 L;  4ZKB B;  4LF4 Q;  1XNR L;  3Q24 A;  1I4H A;  1Q3L A;  1KC8 C;  3GTO H;  4LF4 L;  3UDX A;  2HT1 A;  3X3N A;  1FD7 D;  1EY4 A;  3DM1 A;  2A5H A;  1PV4 A;  2YV5 A;  2QEX A;  1M8A A;  1ILQ A;  3RZD B;  4ME3 A;  1E1O A;  4IFD H;  2H1E A;  3NE5 B;  3M4P A;  5IGB A;  4MHE A;  3DUZ A;  3NUC A;  3S15 B;  2VUM H;  2ENB A;  4O1N A;  1BO0 A;  5DEH A;  4DK1 A;  3A54 A;  3A7L A;  4P2C B;  4DAV A;  1ILP A;  2F0W A;  1V9P A;  1D6E C;  1LTL A;  1EWC A;  3CRK C;  1M90 C;  3CCL A;  2JA9 A;  1TR5 A;  4PZ8 A;  4DUY Q;  4NP5 A;  3NTK A;  4BY7 B;  3I7F A;  1Q8K A;  3OWE B;  2N78 A;  4BBS B;  4DR3 L;  5LL6 X;  1A3U A;  3S1N B;  1GOZ A;  4L8J A;  4P74 A;  5C6A A;  4DUY L;  2DY7 A;  2UXD Q;  1WTH A;  2N55 A;  3BJU A;  2ZXR A;  3DWP A;  3E3X A;  1D5M C;  1VQP A;  3H0G B;  1N36 Q;  1HRJ A;  3HOZ B;  4ZRZ A;  1WCM B;  2UXD L;  4RCO A;  4QUF A;  2J7Z A;  5IGF A;  2QF7 A;  4BBS G;  1JWM D;  1N36 L;  1HTP A;  5M3F H;  3SEB A;  2NTS A;  4ODG A;  4ZKC B;  1XWE A;  3AQQ A;  5I2Y A;  1W2B A;  1R4Q B;  4APV A;  3HOZ G;  4P73 A;  1WCM G;  3LGJ A;  3QB3 A;  4K14 A;  2BH2 A;  1B9M A;  1Q12 A;  2OEO A;  3U4V A;  4N9P A;  1JWU D;  1I50 B;  1PFN A;  1IZ6 A;  2SDF A;  4WOR A;  1PTO D;  4FXD A;  1SXT A;  1EY6 A;  1IYU A;  2EY2 A;  3BDL A;  5C44 B;  2CFM A;  1NMF A;  4H44 C;  1VQ7 A;  2QA4 A;  1RL2 A;  3BVZ A;  2PZU A;  3KLW A;  4RGN A;  4JI5 Q;  1EQV A;  3QO2 A;  1S40 A;  1S3O A;  1HCZ A;  1F2Z A;  4A3D B;  2R92 B;  3AYH B;  1KL9 A;  4LAA A;  2ZJR A;  2XN9 C;  1SDF A;  3BZD B;  4WJ4 A;  1AE2 A;  4JI5 L;  1WTX A;  1ZYR D;  2R7F A;  5IIF A;  4U67 3;  5M5W B;  5C44 G;  1G2T A;  2Z6K C;  1E2Z A;  1QB5 D;  4M1U B;  3OIQ A;  1CA5 A;  3CPF A;  1WD1 A;  1II3 A;  4K5V A;  2DNC A;  1ICW A;  4A3D G;  1ESF A;  2R92 G;  4MZ9 A;  2XRQ D;  3AFQ A;  4X3S A;  1ENC A;  3KBX A;  1BBW A;  5I9O A;  4GN4 B;  4QQB X;  3KLR A;  2VZA A;  3H3V H;  3VYU A;  4IPD A;  1L0W A;  4A3B B;  4QMG A;  1SYB A;  3S16 B;  1EL0 A;  2SOB A;  5IT9 E;  1Y8N B;  3TBI B;  1CHQ D;  4A3F H;  2MGS A;  4IOA A;  3K7A B;  4LF8 Q;  4EX5 A;  2WAC A;  3GP7 A;  5IE8 A;  5A2Q E;  1SAP A;  4O42 A;  3GTP H;  4K5W A;  1Y1V B;  4LF8 L;  2E76 C;  3PO3 H;  1E22 A;  3S2H B;  1KHI A;  1VQH A;  4PV1 C;  3NSW A;  4DV4 Q;  3PIO A;  1QZH A;  2HDL A;  1M1K C;  2JK8 A;  1AZP A;  3AMU A;  4DV4 L;  2B8G A;  1S5D D;  2IL8 A;  2Z6K A;  4NPS A;  1A62 A;  2V4D A;  4XYO A;  3TEH B;  3G6J B;  1EY7 A;  3Q23 A;  3HGB A;  4IPG A;  2PW5 A;  2R7D A;  2F0L A;  2PZW A;  2I5L X;  2R93 G;  1D8L A;  1JB3 A;  3I55 A;  1ZXT A;  1PRT F;  2WB1 G;  3PF5 A;  1HNZ Q;  1EIH A;  1ET9 A;  1WFQ A;  1V8Q A;  3U4Z A;  2WB1 E;  2EXZ A;  2K5N A;  5C0X J;  1VF5 C;  4KK7 A;  1A0I A;  1GD7 A;  5C4Z A;  3ITP A;  3FEW X;  5FLX c;  2EZV A;  2F0D A;  1TWG B;  2I5H A;  5HGT A;  1TY0 A;  3TSS A;  1RDP D;  5M5X H;  4NW2 A;  1IBM Q;  1Q8I A;  1N32 Q;  1J6Q A;  3HKZ G;  4QIW B;  4XXE A;  1MKH A;  3S2D B;  3AFP A;  3VYR A;  3HKZ E;  3A8K E;  2JA6 B;  4DK0 A;  1IBM L;  3HOY G;  1WTO A;  1N32 L;  1BCP F;  2PMZ B;  1FJG Q;  1JOQ A;  4HJ8 A;  1Y8O B;  5FKA C;  3QG1 A;  3NQT A;  1FJG L;  1JQY D;  2A74 C;  4QIW E;  4KKU A;  1D1K A;  4MTK A;  1DGS A;  2WAQ G;  3EA6 A;  5CMD A;  5I6W A;  5KGU A;  2JA6 G;  3RD4 A;  2ATW A;  1PVO A;  2WAQ E;  3MZ5 A;  1UE5 A;  1EQT A;  3OMG A;  3SXH A;  3W2D A;  3CC7 A;  4LF7 Q;  1KAA A;  5M5Y H;  3GTJ H;  1EIF A;  4HED A;  3TQY A;  4LF7 L;  2EY1 A;  1DM0 B;  3KLS A;  3HP3 A;  1STH A;  4A3L H;  1C8C A;  3FMC A;  4RHS A;  3I4M G;  3VYT A;  3FKI H;  1PTO H;  4YWM A;  4IJL A;  5IYC H;  1YBY A;  1SJE D;  4YIJ A;  2PI2 A;  1U9R A;  4Y52 H;  4TKO B;  3VR5 A;  2M9V A;  1AZQ A;  1B4O A;  2IY5 B;  1BDO A;  3A8J E;  1SND A;  1CQV A;  2F0H A;  1Q81 C;  1U5K A;  4C3I H;  2HD3 A;  4KD3 A;  2VL6 A;  3NEN A;  1S72 A;  4DNR B;  3A56 A;  2BE5 D;  1EU3 A;  4GN3 B;  4UPA A;  4LW1 A;  2ZTD A;  1HUM A;  2QKI C;  3D0F A;  3PGZ A;  2G9H D;  1Y1W G;  2QDL A;  3VR2 A;  3OWF A;  5AJ3 Q;  3T1Y Q;  4KHV A;  1EY8 A;  5I4D A;  5C0X H;  3OHX C;  4IPC A;  3NTI A;  1FYC A;  4DF7 A;  1HUN A;  5CBA E;  5AJ3 L;  3T1Y L;  3KUP A;  1VQ6 A;  1JJC B;  3RN2 A;  5LMN W;  1PRT D;  1ZYR C;  4KY6 A;  3SHL A;  1YJW A;  1DOK A;  3TS2 A;  3MXN B;  4Y7N H;  2F0O A;  3S1M H;  3MXN A;  4IUU A;  2FIN B;  2B29 A;  4B3T Q;  3D4D A;  2B8F A;  1GKH A;  2PNR C;  2HQE A;  5K36 G;  3K0Y A;  2F0E A;  3E0E A;  3QIA A;  3M85 A;  1CHP D;  1D5Z C;  4UHV A;  4ID6 A;  4B3T L;  4DV7 Q;  2O5J C;  1LAB A;  1UUP A;  3D3R A;  4IJH A;  4BY1 B;  3ERO A;  1VF7 A;  1B9N A;  4DV7 L;  3GO5 A;  3IL8 A;  2K28 A;  1YHQ A;  2K32 A;  3N6R A;  2Z4I A;  2EPB A;  3HEJ A;  1C9O A;  1VQ4 A;  1QUQ B;  2E2I B;  1QZG A;  1QUQ A;  1BKB A;  2WKC A;  3I90 A;  5IYB G;  4N8F A;  4JV5 Q;  3F1Z A;  3GTG H;  2AQ2 B;  5JJI A;  5A2Q L;  5ELC A;  2ALY B;  1E0B A;  4JV5 L;  2Z1C A;  1X55 A;  3KJO A;  3F2U A;  3TRZ A;  1I3Q H;  1EYA A;  4BS9 A;  5C3W A;  3D31 A;  2L1B A;  4HCE A;  5BN5 A;  1D2B A;  2K33 A;  3GTL B;  1I6H H;  4J1M A;  5COY A;  4JBW A;  2KEN A;  5BN3 A;  1JB7 A;  3B6Y A;  2DJG C;  1SJH D;  3PIP 3;  4HJA A;  1I94 Q;  1JOR A;  4FVM A;  2UU9 Q;  5JVG 3;  1DOL A;  3JAM c;  3EVQ A;  1XMO Q;  2CH4 A;  2KA7 A;  1NJI C;  1WJJ A;  5EPK A;  2ZXO A;  1I94 L;  3S9W A;  1OTC A;  2KEC A;  1VCI A;  4DKA C;  5C4H A;  4ULL A;  3M9B A;  1XMO L;  1GHJ A;  5M3M H;  3MXG A;  1TWA H;  2NTT A;  5KEE A;  2C35 B;  5LMU L;  2EJF C;  3PO2 B;  3BG3 A;  1TWF H;  1HZC A;  3E0J A;  2XIW A;  2B2V C;  4DFA A;  2LY7 A;  1HHV A;  1G6P A;  2D0O A;  2QW7 A;  5D65 A;  3GTM H;  3NEM A;  4J15 A;  4U68 A;  2Q2U A;  1SMX A;  3X3M A;  4ZLT F;  1NMG A;  3M3Y B;  1CQF A;  4P72 A;  2MPM A;  1X54 A;  5IY0 A;  3LWU A;  2AHO B;  1TT2 A;  2IHE A;  2C9O A;  4A3K G;  3CD6 A;  3S1Q B;  4HIK A;  1E7Z A;  2F0V A;  5ELD A;  2A68 C;  2EOT A;  3NQI A;  4RKL A;  1GUT A;  1Y69 U;  3RLN A;  3ZJY C;  2ICE C;  3MXU A;  1Z7T A;  4JW0 A;  1VQM A;  5IGG A;  4RMF A;  5C4J B;  3ONA B;  5JEA G;  4H0L C;  1JJG A;  4CDC C;  2Q2H A;  5GAH C;  4L6T B;  5IOC A;  4KHP Q;  5E4X A;  1PZK D;  4A3E B;  4DK6 C;  2K03 A;  2LXJ A;  4HCS A;  5T1G A;  4GZY C;  2GN5 A;  2JE6 I;  3H94 A;  1YI2 A;  3HOW H;  4KHP L;  4JI1 Q;  4PNY A;  1TII D;  2B2V A;  1OXT A;  1KNE A;  5FJ8 H;  1LT5 D;  3ZYY X;  3PCO B;  2N8N A;  5CV4 A;  3MEF A;  2BOS A;  4OHJ A;  1UE6 A;  1TY2 A;  4YCV A;  3A5U A;  2JEA I;  4JI1 L;  1BOS A;  1A63 A;  2NZO A;  3RLO A;  2YTX A;  4FP5 D;  3HOX H;  3HOV H;  2NVQ H;  1EU4 A;  3E9H A;  2YYZ A;  4HAE A;  2BE5 C;  1LM0 A;  4QB4 A;  2KQ3 A;  1HA5 A;  2I07 B;  3EIV A;  1STY A;  4PMC A;  4EVO A;  3J81 E;  4TRD A;  4OO1 I;  1CKN B;  2VW9 A;  1DON A;  2JA7 G;  2NVT H;  2RHS B;  1K8A C;  2KED A;  1FNV A;  5EQ0 A;  1LTT D;  4BBR B;  5JJL A;  1IHZ A;  1K83 B;  3PSI A;  1EQR A;  1SYG A;  2E2J B;  2D2C C;  3FHW A;  3FPU B;  1F2L A;  1PZI D;  3BDC A;  2MFI A;  4B3M Q;  2EXD A;  4GN5 A;  5EKI A;  5COR A;  1F9P A;  1EYG A;  4F8M A;  4X3T A;  4BBR G;  4GS3 A;  3C46 A;  4B3M L;  4A93 B;  1SNC A;  4IFD I;  3IKJ A;  3GV3 A;  5C3E B;  1EWI A;  3IAY A;  2JYO A;  3CU7 A;  3KF8 B;  3RZD H;  4KD4 A;  2K5V A;  3KF8 A;  1DYQ A;  3O13 A;  1TS2 A;  2IX3 A;  1PFM A;  3S15 H;  2EYM A;  2A6E D;  2RSN A;  1R9T B;  3WWV A;  3CCU A;  1K0S A;  5FK9 C;  4X65 Q;  1MD2 D;  2IW3 A;  2OQ0 A;  1G2S A;  4UAI A;  3CRL C;  4K8J A;  5CBE E;  4BY7 H;  1YNN C;  2Z8L A;  4X65 L;  2DJF C;  4LF6 Q;  3SK6 A;  2E2H B;  1CSQ A;  2AUK A;  1MHW C;  4QCL A;  2KHJ A;  1HQM C;  2ICI A;  4XQJ A;  1SYD A;  2AUJ D;  5CV8 A;  2VQE Q;  3J7A 5;  1VQ5 A;  3H0G H;  4QJF A;  4DR1 Q;  1SE4 A;  4BXX H;  3EBE A;  4LF6 L;  2SEB D;  3H91 A;  4GKK Q;  4GLX A;  2KVM A;  4KJO A;  1DOM A;  2XWJ B;  3CQZ B;  3FP9 A;  4DR1 L;  4GKK L;  3CHB D;  4R1J A;  2K4K A;  3TDQ A;  4QF4 A;  1R4P B;  1LLR D;  3G48 A;  3V2T A;  3V96 A;  4ZUI A;  5EKL A;  4UY8 C;  5FLM H;  4OON A;  3EJI A;  1SRO A;  4ILW A;  4FNF A;  3VR4 A;  1ZKO A;  5H1S E;  2H5X A;  3MEH A;  5IGC A;  2B63 G;  2LKV A;  4HSV A;  3S1R H;  1SE8 A;  3L7Z C;  3NPP A;  3DM3 A;  4L5Q A;  1I50 H;  5EAY A;  3TP6 A;  1PH1 A;  3ND9 A;  4IUN A;  1BR9 A;  1O78 A;  4I7A A;  1RIP A;  3J81 i;  1K8O A;  4C3H G;  2IPK D;  2WP8 J;  4JBJ A;  3NXW A;  4JC0 A;  5IT9 c;  1WTP A;  4EGV A;  3OW7 A;  1SSO A;  1PA6 A;  3T51 B;  4N8X 1;  3Q0A A;  1FL0 A;  5EPL A;  2D0P A;  1H9M A;  1TWH B;  1DZ1 A;  3E9I A;  3K57 A;  2E5L Q;  4UP9 A;  4L63 B;  1VQD A;  4DNI A;  2JA8 H;  1LUZ A;  5M5W H;  2B39 A;  2X6L A;  2E5L L;  5E3F A;  3UE1 A;  2F0J A;  5C4X G;  2Z0S A;  3M4Y A;  1D5X C;  1PH7 A;  4K5X A;  3UI2 A;  1E3P A;  3W1B A;  2F0N A;  3FRP B;  3STB D;  1KLG D;  4A3G G;  3TME A;  5EBD A;  1BQQ T;  4OO1 G;  3NBH B;  2DNE A;  1PFB A;  4GKJ Q;  3BYY B;  4X3K A;  3CCR A;  1SYE A;  2XGT A;  3NBH A;  1TKW B;  1IW7 C;  3DXJ C;  3GTO B;  4A3B H;  1JE4 A;  3CCS A;  2NN6 G;  1K9M C;  1LTR D;  3MC0 B;  4EQP A;  4GKJ L;  2Q8I B;  1LTB D;  3TRE A;  3TZU A;  1LTI D;  1DXM A;  1Z9F A;  2EDG A;  2OXP A;  1K28 A;  1FGB D;  4MN3 A;  1Y1V H;  1CM9 A;  4KN7 C;  1AE3 A;  3UDI A;  3S2H H;  3PIO 3;  3PUW A;  2SNS A;  3D8G A;  1K0R A;  3TP7 A;  1B7Y B;  4CKE A;  3RZO H;  1LT3 D;  4IFD G;  1WTQ A;  2H4O A;  1G6Z A;  2NBF A;  4X62 Q;  2VUM G;  1NCV A;  1U0L A;  4DK3 C;  3LX0 A;  1U4M A;  3DEO A;  4HTH A;  4FO2 A;  3F2C A;  4DAP A;  2PYK A;  3AB9 A;  4X62 L;  1I4R A;  2K14 A;  3P75 A;  3QOL A;  4B9W A;  1CZG A;  1MI2 A;  3J81 L;  3EQL C;  3QR8 A;  1PH4 A;  1ENF A;  4XYQ A;  2A69 C;  1VQA A;  3IFD A;  3OW2 A;  1QE6 A;  1VQ8 A;  4CDF C;  3MAQ A;  4OWW B;  4AH6 A;  2RF4 A;  5IYD H;  3SK5 A;  4WJW A;  2EYJ A;  2XVS A;  4R8I A;  1V1O A;  1QJO A;  5IP9 H;  1C0A A;  3KJP A;  1WD0 A;  2UXC Q;  2OTL A;  1EZ6 A;  4NB3 A;  1N9W A;  2K04 A;  4JI0 Q;  3NEL A;  5M3F G;  1YZ6 A;  1YNJ C;  4KI0 A;  4Z9C B;  2UXC L;  3K0X A;  3ULL A;  1Q1B A;  1STA A;  2I46 A;  1RJT A;  2R7Z H;  2R93 B;  2ES2 A;  2WB1 B;  4JI0 L;  2KCC A;  3GTK B;  1WTW A;  1YHB A;  1SLJ A;  2KEE A;  2ZT9 C;  2K05 A;  4IUP A;  2E2D C;  3P1H A;  3TZD A;  3W1G A;  2JQO A;  1F2Y A;  1I5F A;  2KHS A;  2XTI A;  1ENA A;  3K8A A;  1X6O A;  5LL6 S;  2UUA Q;  2A8V A;  2EIF A;  3HKZ B;  4MIU A;  1VQG A;  3HFZ B;  2RCF A;  3IFT A;  1Y8P B;  2NVX B;  1IL8 A;  3HOY B;  1HNZ L;  4CJ2 C;  2D62 A;  4YCW A;  3I4N H;  3K81 C;  3K6O A;  1BVS A;  3BS1 A;  3QOJ A;  3SVM A;  2CW0 D;  2QDB A;  4M8A A;  4UP8 A;  4DAY B;  1LT6 D;  3K7U C;  1W3S A;  1MJE A;  4JYA Q;  1NNX A;  2WAQ B;  1STG A;  3BVG A;  4DAY A;  5IP7 H;  3T16 A;  4DXF A;  1FVI A;  2F0P A;  4TQU S;  4A3F B;  4JYA L;  1GUS A;  3Q8D A;  1E2W A;  1X32 A;  1EOT A;  1GUN A;  5JOB A;  3I91 A;  5GRO A;  3GTP B;  2XSC A;  1NY4 A;  1BF4 A;  2MUY A;  2QEJ C;  4J8Q A;  1T5X D;  4PG3 A;  2VY3 A;  4A3F G;  1U4R A;  3EN2 A;  2CWP A;  4K2K A;  4TVA B;  1XPO A;  2EYF A;  5M9O A;  1SN8 A;  3S24 A;  3Q22 A;  1Q86 C;  3DMU A;  4HN7 A;  4EQN A;  1Q82 C;  4JI4 Q;  4R4O A;  2F3V A;  1X3Q A;  3I4M B;  1KXL A;  2WII B;  1ICF B;  3GTQ B;  2KOL A;  3PO3 G;  3RUZ A;  3U58 A;  2GA4 B;  3CCM A;  2NZH A;  4QY7 A;  2F4V Q;  3K5N A;  5DM6 3;  4G7Z C;  3J80 c;  2RKS A;  1YIJ A;  1EQQ A;  2JJQ A;  2OF1 A;  1U4L A;  2F4V L;  1XNQ Q;  2GVA A;  4HMJ A;  2MO1 A;  3RMH A;  5HY6 A;  1EUJ A;  4OIK A;  4DR7 Q;  1B50 A;  1VS0 A;  5IGD A;  1HZA A;  2L55 A;  5A35 A;  3NWS A;  2Q8R E;  2R6G A;  4MNO A;  1XNQ L;  4LMQ D;  1Y1W B;  4DR7 L;  5BN4 A;  1PMR A;  2EJM A;  5L37 A;  5JJK A;  4K2L A;  1J8I A;  3ERQ A;  1H9K A;  2BA0 A;  3BU2 A;  1A15 A;  3NP8 A;  1JJ2 A;  1K3B C;  4BY1 H;  1HNW Q;  3HOU H;  1NAP A;  2QGQ A;  4IQZ A;  4DN4 M;  2NVY B;  1KDB A;  4XQN A;  1PTO C;  1VQL A;  3D4R A;  2CQO A;  3K5M A;  1PH5 A;  3MWY W;  4FXK C;  1MJC A;  1HNW L;  5G3L F;  3V05 A;  4H02 A;  3WDN A;  2B2U C;  4Q5V A;  2GVB A;  3HZX A;  1RHP A;  2IJ0 A;  3K59 A;  4YCU A;  1QVF A;  2KCN A;  5KYI A;  3VR6 A;  3OOC A;  5BR8 Q;  1QNK A;  2RBM A;  2I5M X;  4KHZ A;  2LFN A;  1OO9 B;  1RCV D;  4WJ3 M;  2L0C A;  1SNQ A;  5BR8 L;  3I2Z A;  1HTL D;  1PYB A;  2E8G A;  3TP8 A;  2F52 A;  1RF2 D;  4A3J H;  1S5F D;  3F2B A;  4OX9 Q;  2RSO A;  1BXT A;  3PUY A;  5M5Y B;  4FF4 A;  1NUC A;  3M4O B;  3GTJ B;  1ROD A;  3GTL H;  2D5D A;  5I6Y A;  3C1F A;  4PQX A;  1RKN A;  4OX9 L;  2UXB Q;  1TXY A;  4LK1 C;  1RTO A;  2ZJP A;  1P16 A;  2BCO A;  2F0Q A;  3R2I A;  1BCP D;  4LF5 Q;  3H09 A;  4GLA C;  2HUG A;  2L4N A;  4C1N K;  1PTO B;  2UXB L;  3L2P A;  2RDG A;  3CC2 A;  4J6H A;  3SK4 A;  4LF5 L;  2JXM B;  3A74 A;  1GXD C;  1SRU A;  1MSG A;  2B2U A;  2PO4 A;  4A3L G;  4RH6 A;  2FMM A;  5EKK A;  2EYL A;  2A73 B;  4KTA A;  1B8A A;  2PCF B;  2KHI A;  2BDO A;  2NB0 A;  2KUM A;  3PO2 H;  1C7Y A;  2KCT A;  3FKI G;  4IUT A;  5IYC G;  3G4S A;  4DV0 Q;  3PUZ A;  3I3C A;  4RFB A;  2QCP X;  1A2U A;  5JJZ A;  2IT1 A;  1IXR A;  4DV0 L;  4C3I G;  2VXW A;  4TSS A;  4POF A;  4GLV B;  1Z6H A;  1X3E A;  1KTK A;  1NSN S;  4C1N I;  4XT1 B;  1PH3 A;  3S17 H;  1SYF A;  2A19 A;  3CCQ A;  4DR2 Q;  3K80 C;  1ET6 A;  3HRZ C;  1SFO B;  4E6I A;  5EJW A;  1SNM A;  1TQO A;  3VA5 A;  1E2V A;  3K58 A;  3S1M B;  4DR2 L;  3R2T A;  5C0X G;  3G71 A;  4P75 A;  4FDB A;  2L15 A;  1PH2 A;  2UU9 L;  4CDE C;  2VB2 X;  4FF1 A;  2CW0 C;  2DY8 A;  4A3M H;  4ZCK A;  2V1C C;  5JVH 3;  4DNT B;  4V19 0;  4A3C H;  1YNX A;  2YTY A;  4A3E H;  1JE5 A;  2L9H A;  3WOF A;  1U4P A;  4A3K B;  1B1Z A;  1CZW A;  4I65 A;  5KNB A;  5CV7 A;  1CFM A;  3DEP A;  2PQA B;  3RLF A;  2CHB D;  4RG1 A;  5D3I B;  3ERS X;  2PQA A;  3NK9 A;  2F0I A;  1EYD A;  2IWH A;  1STN A;  2BDN A;  4K8I A;  2NUC A;  4YHH Q;  2Z9H A;  4GNX C;  1GUG A;  1STB A;  2G5D A;  5D14 A;  1EWH A;  5CV9 A;  2C5C A;  4YHH L;  2WKD A;  2PNH A;  1TWC H;  2Y0S G;  1X9N A;  1K73 C;  3SGI A;  1TS5 A;  2JA5 H;  2Y0S E;  4NMZ A;  4A3I H;  2FXQ A;  1I3Q B;  1K83 H;  4IUQ A;  2FFK B;  4R4T A;  4DR4 Q;  3BVM A;  3HKS A;  1I6H B;  2RVL A;  2RDF A;  1MGS A;  3VR3 A;  2HHH Q;  2UUC Q;  4DR4 L;  1EIG A;  5CC4 A;  2KCM A;  4OEL B;  1VQC A;  1A3V A;  1XTC D;  2UUC L;  2HHH L;  4LJZ C;  2ID0 A;  1H9J A;  4A93 H;  1VMC A;  3NWT A;  3E6Z X;  5C3E H;  4CDD C;  2JA7 B;  4OWT B;  2HQL A;  1TWA B;  1PH8 A;  4O2D A;  4GOP C;  4JCV E;  1YEZ A;  1N33 Q;  5CV5 A;  5ISR A;  4OGQ C;  5ELB A;  4C3J H;  1PFS A;  5JPM C;  1XYI A;  1I6V C;  4GNX B;  3I4L A;  3M7G A;  4AIM A;  3GTM B;  1N33 L;  2IX0 A;  3U9O A;  5M3M G;  1CKN A;  4LUO A;  1JOK A;  2F0U A;  4R4Q A;  2NN6 I;  1B70 B;  5ELN A;  2UUB Q;  3MHB A;  1F9R A;  2RHQ B;  1HZB A;  4I7Z C;  1J5E Q;  1PRT C;  1QNU A;  2O4X A;  2G9D A;  5DNF A;  2SNM A;  4OIJ A;  1FR3 A;  2UUB L;  4CHT B;  2E2H H;  1LYL A;  2HIX A;  2K5W A;  3MVV A;  2MP1 A;  2RCN A;  1NBW A;  1V1P B;  1WOC A;  3J7A F;  1O7Y A;  4IUR A;  2OTJ A;  1SE3 A;  1V1P A;  2CVR A;  4R4I A;  1LTS D;  1GUW A;  2LMC B;  3CQZ H;  1PZJ D;  2OT2 A;  5FLX L;  1F9Q A;  4EQ5 A;  2PZT A;  3GD7 A;  1KAB A;  3KFU A;  4GOP B;  1HPC A;  1KDA A;  4K6L A;  1EEF D;  4GOP A;  2HIV A;  4LFC Q;  3CP0 A;  1LTA D;  1IYV A;  3TP5 A;  4KY7 A;  4HIM A;  2B3G A;  4LFC L;  1G8Z D;  3NBI A;  4YWK A;  3E5S A;  4ZAI A;  2NYZ D;  3ICE A;  1XJV A;  3HOV B;  1N34 Q;  4BBS H;  1PRT B;  1AFP A;  3CXC A;  3HOW G;  4S3S A;  1BBX C;  3S1N H;  2YU9 B;  1K3R A;  2CH4 W;  5FJ8 G;  3NHH A;  1N34 L;  1SMY D;  3OMC A;  4RGO S;  4C2M B;  3H6M A;  3W5O A;  4JI2 Q;  4H13 C;  3HOZ H;  5GQO A;  1O7Z A;  1WCM H;  4RWS C;  1EEI D;  3HOX G;  3HOV G;  1CA6 A;  5KNC A;  2VQE L;  1IBK Q;  2L11 A;  3URY A;  1Q7Y C;  4JI2 L;  1V1Q A;  2B63 B;  4A75 A;  1XTD A;  1QG7 A;  3SR1 A;  1EZ8 A;  1KRS A;  3LNN A;  4LWC A;  4XQQ A;  1IBK L;  4OL7 A;  2X69 A;  4FF2 A;  4KKS A;  3S14 B;  1HH2 P;  4C3H B;  4LFA Q;  3CW2 C;  1VQE A;  4LFA L;  1N8R C;  4CKC A;  2F0S A;  3ER0 A;  5C44 H;  1CKM A;  1T9H A;  3PF4 A;  2IHF A;  4FXG C;  2L5T A;  5C4X B;  1SNP A;  4OEM B;  4QGU A;  4YWL A;  1IYJ B;  4A3D H;  2R92 H;  4FYD A;  3I56 A;  3KF6 B;  4PZ6 A;  4EQO A;  4BWG B;  3KF6 A;  1XX8 A;  2KJX A;  5ELF A;  4DR3 Q;  4A3G B;  5DM7 3;  1CT1 D;  5DAU A;  1PDQ A;  2JP1 A;  3JAM i;  4JI7 Q;  4NDX A;  3RR5 A;  1KLU D;  2CWA A;  2MO0 A;  2Q8T A;  4AYB B;  1UWV A;  4JI7 L;  1ML0 D;  3M4Q A;  3H3V I;  4MTN A;  3DWA A;  1QVC A;  1CUK A;  5C5M A;  1XMQ Q;  1DD2 A;  3T13 A;  1AN8 A;  2WV6 D;  1F2M A;  1KQS A;  3KK7 A;  4BY7 G;  1DCZ A;  4HSP A;  3D4W A;  5J39 A;  3MTS A;  1KAW A;  1XMQ L;  3L0O A;  3JC6 6;  3S16 H;  1XPR A;  4AYB G;  3FPP A;  4F7X A;  1L0Y B;  3K7A H;  2CQA A;  4AYB E;  3CMA A;  4HMI A;  2F3W A;  3H0G G;  4BXX G;  3AU7 A;  1I4P A;  1YVC A;  4DR6 Q;  2VUM B;  2OWO A;  1D1I A;  1UEA B;  4KMU C;  2K01 A;  3VDY A;  2BA1 A;  2AQ3 B;  3S1R B;  2PQE A;  3T53 B;  4DR6 L;  1YJ9 A;  2E74 C;  1TS4 A;  2R93 H;  5KIX A;  2O5I C;  4ZK9 B;  3GTK H;  4KKT A;  5FLM G;  3K5L A;  3A8I E;  5EGT A;  1PHJ A;  3U50 C;  1VQN A;  2QIL A;  1S5E D;  4ME5 A;  4IO9 A;  2ZJQ A;  1CI3 M;  2ZTE A;  1IKM A;  1GHK A;  1S5C D;  2F0M A;  4ZQ3 A;  2JA8 B;  1MIU A;  1YHA A;  1VDZ A;  1HQR D;  4DA2 A;  5M3F B;  2NVX H;  3HOY H;  3SK8 A;  1B44 D;  2CCZ A;  3OYY A;  2IX1 A;  1UE7 A;  4WFN 3;  1PH6 A;  1HXY D;  1H9S B;  5J22 A;  1TWG H;  4DV6 Q;  1H9S A;  1XXG A;  4RGT A;  3RNU A;  3S2D H;  2F0F A;  2A6H D;  3JAM L;  2JA8 G;  2J4X A;  2MJ8 A;  3H3V C;  4DV6 L;  2JA6 H;  3I73 A;  4DV3 Q;  1IKL A;  2AMC B;  3VA7 A;  1ASZ A;  1SNO A;  3K5O A;  3KOJ A;  3PV0 A;  1GO3 E;  1EIY B;  1RD9 D;  1QOH A;  1WTR A;  1BNZ A;  1T5E A;  2K6A A;  4DV3 L;  4AQY Q;  3CPW A;  5E4W C;  3QWN A;  4XIG S;  1KIX A;  2A6E C;  1UNS A;  1QVG A;  1VQF A;  2VNU D;  3CCE A;  1KRT A;  4A3B G;  4AQY L;  1AP0 A;  1HZ9 A;  4DUZ Q;  3CCJ A;  1IL2 A;  1H95 A;  1JOO A;  1ZEQ X;  4DV5 Q;  3RZO B;  3J7Y W;  2D9U A;  5HUR A;  4IOC A;  4NKL A;  4DUZ L;  2K5D A;  2UUA L;  3J7Z C;  4DV5 L;  2K75 A;  1WTV A;  5GAE C;  3I4M H;  4QUC A;  4RHR A;  3GTQ H;  1Y1V G;  3T1H Q;  1SMY C;  1SE2 A;  3KBG A;  1EFI D;  5I9P A;  1CSP A;  1L0X B;  1TVX A;  3W3A A;  4ZUJ A;  3T1H L;  1JT8 A;  3R93 A;  1NR2 A;  4HR7 B;  4JVZ A;  1B53 A;  1ESR A;  4RA8 A;  4BA2 I;  4IAL A;  1C4Q A;  1VQO A;  5FOB B;  1AW7 A;  1PYS B;  5E7N A;  1YIT A;  4A76 A;  4POG A;  4R4C A;  3J7A V;  3CF5 A;  1HFN A;  1PLF A;  3C3L A;  1UEB A;  1Y1W H;  4O0A A;  1S4Z A;  4QL5 A;  1NR4 A;  5LHY 1;  5DLQ E;  1CKO A;  2TSS A;  4X6A H;  3PO3 B;  4OWX B;  1PXU A;  2E75 C;  1PYW D;  2CKZ B;  3LWE A;  4RGM A;  3BDO A;  1HJP A;  2OQK A;  3MXP A;  2NVY H;  5C0X I;  1G29 1;  3CKI B;  1I4Q A;  5IYD G;  2R7Z B;  2F4I A;  2NZ1 D;  3I72 A;  4JOI C;  5IP9 G;  3ULP A;  2MQH A;  5EBC A;  3OTO Q;  4G57 A;  5D3D A;  1GVP A;  1JC7 A;  4BA1 I;  1L2F A;  3G7L A;  5K36 H;  4JI4 L;  1HR0 W;  1QIL A;  3F8T A;  3OTO L;  4HJ7 A;  2B2W C;  3D6W A;  2LSS A;  3T56 B;  1A8V A;  2LXK A;  2R7Z G;  2PMZ E;  2Z6B A;  1X3P A;  4X3U A;  1EOV A;  2L12 A;  2A68 D;  2XWB B;  2K7V A;  4HID A;  4DV1 Q;  3D6C A;  1K8M A;  1FNW A;  5JEA J;  1B3A A;  2OCE A;  3A55 A;  3Q6S A;  2TMP A;  4DAM A;  4PZ7 A;  1OXS C;  2R61 A;  3I4N B;  4DV1 L;  3M4O H;  1XPU A;  3STB C;  2HCI A;  5C5L A;  1I4X A;  5M5X B;  3H15 A;  3GDE A;  1LAC A;  3RN5 A;  1ONL A;  4KLK A;  2Q2T A;  1Q1E A;  5ELO A;  4IN3 A;  1RTN A;  5IWA Q;  2XNA C;  5ELE A;  4WRD A;  5IYB H;  3ULJ A;  2EY5 A;  1X3G A;  1DJR D;  3I4N G;  1TU2 B;  5CR3 A;  5IWA L;  4V0B A;  2E2I H;  4JOI A;  5J3B A;  4G7H C;  2VQF Q;  4ALP A;  1Q90 A;  5IOD A;  3N52 A;  3CC4 A;  2K5H A;  5IP7 G;  1W6J A;  2YTV A;  4KN4 C;  1OXV A;  3P20 A;  5T1I A;  2VQF L;  3MFY A;  2B2W A;  2O2L D;  2ZXP A;  3C2P A;  2PI2 E;  4A4I A;  4B3R Q;  4JK1 C;  5FLX E;  3KLS X;  1O80 A;  2EVB A;  2VB3 X;  3MA2 B;  5TSS A;  3A5Z B;  1NTG A;  1W6K A;  3PUV A;  4K6D A;  4B3R L;  3C1E A;  1CK1 A;  3R8B A;  1HR0 Q;  5KYL A;  4XT3 B;  4B9X A;  1E1T A;  2VS1 A;  4RAU C;  3OIP A;  4ZYS A;  1SFO H;  1LT4 D;  2F0T A;  3T4A C;  1KNA A;  2HDM A;  1HR0 L;  3A0J A;  4L5T A;  3SDZ A;  4JBM A; 
#chains in the Genus database with same CATH homology
 3FKI B;  5CV6 A;  4KV6 A;  1GJX A;  2N88 A;  4R9W A;  3FVQ A;  2A6H C;  3I70 A;  1SYC A;  1EY0 A;  4C3I B;  2EJG C;  1JR0 D;  4IUV A;  3HOU B;  1F9S A;  2EYP A;  2EE1 A;  1WVL A;  4N9T A;  1F77 A;  2LS0 1;  3L9A X;  4C56 C;  5K5P A;  1BUV T;  3DHQ A;  3J80 E;  5IT9 L;  3QJY A;  5CYU A;  2F0K A;  2K5Q A;  2B2T C;  4F88 A;  5IGE A;  5JEA H;  1A3T A;  1YNN D;  2WIN B;  5I2X A;  1MBY A;  1I4G A;  2JSO A;  1EYC A;  4DGZ A;  2NWG A;  3PUX A;  4Y7N B;  1OXX K;  1O7L A;  4DXG A;  4A3J B;  1G91 A;  2FHT A;  5J1Z A;  2MHV A;  1AEX A;  3FDT A;  1Z47 A;  2PW7 A;  2EY6 A;  2AWN A;  3I8Z A;  1JWS D;  5G3L D;  3HS0 C;  4KJN A;  1OXU A;  1S5B D;  4RKB A;  3U9S A;  3BYT B;  1SEB D;  5NUC A;  1C48 A;  2Y0S B;  3OSO A;  4CGY B;  3NTH A;  4XTC S;  1UAP A;  2M00 A;  3HG9 A;  2B2T A;  3GTG B;  1A2T A;  5JAV A;  2AWO A;  4UDU C;  2RA4 A;  4Q0F A;  2XRS D;  2J0T D;  1FNU A;  4CBV A;  2JEB I;  4G7O C;  5KND A;  3GQB A;  1KDC A;  5KRU A;  1QCB D;  3S17 B;  2FJ2 A;  2PPB C;  5F2D A;  4F87 A;  4IZ8 A;  1CTM A;  1HA6 A;  2AQ1 B;  1H9R A;  5JPN C;  3R3O A;  3A7A B;  2RQX A;  5FO9 B;  5FO8 B;  5C3X A;  5AFW A;  5M3M B;  1IW7 D;  2B2Y C;  4A3M B;  5E1F A;  4PMW A;  4DU9 A;  2F1M A;  1TWF B;  1B2T A;  5EPJ A;  2X6G A;  1LTG D;  1EY5 A;  4IFD J;  3DWQ A;  3OPO A;  2EYH A;  4KY5 A;  4XDX A;  4RCN A;  3EFX D;  3JAM E;  2RDH A;  5FO7 B;  1LO5 D;  2FMC A;  2EYO A;  3L3O C;  1J9O A;  1QWY A;  1TWC B;  2JA5 B;  3MFG A;  1M4V A;  1EY9 A;  4A3I B;  3VYS A;  2A69 D;  1GUO A;  3TN2 A;  2B2Y A;  2HCC A;  4PMB A;  1MSH A;  1BCP C;  1HFG A;  1STE A;  4FF3 A;  3HOW B;  4CJ0 B;  4CJ1 B;  3PMF A;  4CKB A;  4R8N A;  1YNJ D;  2F03 A;  3WOE A;  3GV6 A;  3P7J A;  3HOX B;  2NVQ B;  3ND8 A;  4ABN A;  1PTO F;  3SE0 A;  2Z4H A;  2R3Z A;  4C3J B;  1V43 A;  1VMP A;  2NVT B;  4B08 A;  1SBB B;  2F0G A;  1TS3 A;  1JCK B;  4OO1 H;  1JIC A;  4G4K A;  4C3J G;  1LV9 A;  4H7B A;  5CGK A;  3M7N A;  2NN6 H;  1A6X A;  2DN8 A;  3J80 L;  1BCP B;  2M2L A;  2K1B A;  4ZKB B;  3Q24 A;  1I4H A;  1Q3L A;  3X3N A;  1FD7 D;  1EY4 A;  3DM1 A;  2A5H A;  1M8A A;  1ILQ A;  3RZD B;  4IFD H;  2H1E A;  3NE5 B;  5IGB A;  4MHE A;  3DUZ A;  3NUC A;  3S15 B;  2ENB A;  4O1N A;  1BO0 A;  5DEH A;  4DK1 A;  3A54 A;  3A7L A;  4P2C B;  4DAV A;  1ILP A;  2F0W A;  1D6E C;  1EWC A;  3CRK C;  1TR5 A;  4NP5 A;  3NTK A;  4BY7 B;  3OWE B;  4BBS B;  5LL6 X;  1A3U A;  3S1N B;  1GOZ A;  4L8J A;  5C6A A;  2DY7 A;  2N55 A;  2ZXR A;  3DWP A;  1D5M C;  3H0G B;  1HRJ A;  3HOZ B;  4ZRZ A;  1WCM B;  4QUF A;  4RCO A;  2J7Z A;  5IGF A;  2QF7 A;  1JWM D;  1HTP A;  3SEB A;  2NTS A;  4ODG A;  4ZKC B;  1XWE A;  5I2Y A;  1R4Q B;  3QB3 A;  4K14 A;  1B9M A;  1Q12 A;  2OEO A;  4N9P A;  1JWU D;  1I50 B;  1PFN A;  4WOR A;  2SDF A;  1PTO D;  4FXD A;  1SXT A;  1EY6 A;  1IYU A;  2EY2 A;  3BDL A;  5C44 B;  4H44 C;  3BVZ A;  2PZU A;  4RGN A;  1EQV A;  3QO2 A;  1HCZ A;  1F2Z A;  4A3D B;  2R92 B;  4LAA A;  2XN9 C;  1SDF A;  3BZD B;  1WTX A;  1ZYR D;  5IIF A;  4U67 3;  5M5W B;  1G2T A;  1E2Z A;  1QB5 D;  4M1U B;  3OIQ A;  1CA5 A;  1WD1 A;  1II3 A;  4K5V A;  2DNC A;  1ICW A;  1ESF A;  2XRQ D;  4X3S A;  1ENC A;  3KBX A;  5I9O A;  3KLR A;  3VYU A;  4A3B B;  4QMG A;  1SYB A;  3S16 B;  1EL0 A;  2SOB A;  5IT9 E;  1Y8N B;  3TBI B;  1CHQ D;  2MGS A;  3K7A B;  2WAC A;  3GP7 A;  5A2Q E;  1SAP A;  4O42 A;  4K5W A;  1Y1V B;  2E76 C;  3S2H B;  4PV1 C;  3NSW A;  2HDL A;  1AZP A;  3AMU A;  2B8G A;  1S5D D;  2IL8 A;  2V4D A;  4XYO A;  3G6J B;  1EY7 A;  3Q23 A;  3HGB A;  2PW5 A;  2F0L A;  2PZW A;  1JB3 A;  1ZXT A;  1PRT F;  1EIH A;  1ET9 A;  1V8Q A;  2EXZ A;  5C0X J;  1VF5 C;  4KK7 A;  5C4Z A;  3ITP A;  3FEW X;  2EZV A;  2F0D A;  1TWG B;  5HGT A;  1TY0 A;  3TSS A;  1RDP D;  4NW2 A;  1Q8I A;  4QIW B;  4XXE A;  3S2D B;  3VYR A;  3A8K E;  2JA6 B;  4DK0 A;  1WTO A;  1BCP F;  2PMZ B;  1JOQ A;  1Y8O B;  5FKA C;  3QG1 A;  3NQT A;  1JQY D;  2A74 C;  4KKU A;  1D1K A;  5I6W A;  3EA6 A;  5CMD A;  5KGU A;  3RD4 A;  3MZ5 A;  1EQT A;  3OMG A;  3SXH A;  3W2D A;  1KAA A;  4HED A;  2EY1 A;  1DM0 B;  3KLS A;  3HP3 A;  1STH A;  1C8C A;  3FMC A;  4RHS A;  3VYT A;  1PTO H;  1SJE D;  4YIJ A;  1U9R A;  4TKO B;  3VR5 A;  2M9V A;  1AZQ A;  1B4O A;  1BDO A;  3A8J E;  1SND A;  1CQV A;  2F0H A;  4KD3 A;  4DNR B;  3A56 A;  2BE5 D;  1EU3 A;  1HUM A;  2QKI C;  2G9H D;  3VR2 A;  3OWF A;  4KHV A;  1EY8 A;  5I4D A;  5C0X H;  3OHX C;  3NTI A;  1FYC A;  4DF7 A;  1HUN A;  5CBA E;  3KUP A;  1PRT D;  1ZYR C;  4KY6 A;  3SHL A;  1DOK A;  2F0O A;  3MXN A;  4IUU A;  2FIN B;  3D4D A;  2B8F A;  5K36 G;  2PNR C;  2HQE A;  3K0Y A;  2F0E A;  3QIA A;  3M85 A;  1CHP D;  1D5Z C;  4ID6 A;  2O5J C;  1LAB A;  1UUP A;  3D3R A;  4BY1 B;  3ERO A;  1VF7 A;  1B9N A;  3GO5 A;  3IL8 A;  2K28 A;  2K32 A;  3N6R A;  2Z4I A;  2EPB A;  3HEJ A;  2E2I B;  2WKC A;  3I90 A;  2AQ2 B;  5A2Q L;  5ELC A;  1E0B A;  2Z1C A;  3F2U A;  1EYA A;  4BS9 A;  5C3W A;  3D31 A;  2L1B A;  4HCE A;  5BN5 A;  1D2B A;  2K33 A;  3GTL B;  4J1M A;  5COY A;  4JBW A;  5BN3 A;  1SJH D;  3PIP 3;  1JOR A;  4FVM A;  5JVG 3;  1DOL A;  3EVQ A;  2KA7 A;  5EPK A;  2ZXO A;  3S9W A;  2KEC A;  1VCI A;  5C4H A;  4ULL A;  1GHJ A;  3MXG A;  2NTT A;  5KEE A;  2EJF C;  3PO2 B;  3BG3 A;  3E0J A;  2XIW A;  2B2V C;  4DFA A;  2LY7 A;  1HHV A;  5D65 A;  4U68 A;  3X3M A;  4ZLT F;  3M3Y B;  1CQF A;  2MPM A;  3LWU A;  1TT2 A;  2C9O A;  3S1Q B;  2F0V A;  5ELD A;  2A68 C;  2EOT A;  3NQI A;  4RKL A;  1GUT A;  1Y69 U;  2ICE C;  3MXU A;  1Z7T A;  5IGG A;  5C4J B;  3ONA B;  5JEA G;  4H0L C;  4L6T B;  5IOC A;  5E4X A;  1PZK D;  4A3E B;  2K03 A;  4HCS A;  5T1G A;  4GZY C;  2JE6 I;  3H94 A;  4PNY A;  1TII D;  2B2V A;  1OXT A;  1KNE A;  1LT5 D;  3ZYY X;  5CV4 A;  2BOS A;  4OHJ A;  1TY2 A;  2JEA I;  1BOS A;  4FP5 D;  1EU4 A;  2YYZ A;  4HAE A;  2BE5 C;  4QB4 A;  2KQ3 A;  1HA5 A;  2I07 B;  1STY A;  4PMC A;  4EVO A;  3J81 E;  4TRD A;  4OO1 I;  1DON A;  2KED A;  1FNV A;  5EQ0 A;  1LTT D;  4BBR B;  1IHZ A;  1K83 B;  1SYG A;  2E2J B;  2D2C C;  3FPU B;  1F2L A;  1PZI D;  3BDC A;  5EKI A;  5COR A;  1F9P A;  4F8M A;  4X3T A;  3C46 A;  4A93 B;  1SNC A;  4IFD I;  3IKJ A;  3GV3 A;  5C3E B;  3IAY A;  2JYO A;  3CU7 A;  4KD4 A;  3KF8 A;  1DYQ A;  3O13 A;  1TS2 A;  2IX3 A;  1PFM A;  2EYM A;  2A6E D;  2RSN A;  1R9T B;  5FK9 C;  1MD2 D;  2IW3 A;  1G2S A;  4UAI A;  3CRL C;  4K8J A;  5CBE E;  1YNN C;  2Z8L A;  3SK6 A;  2E2H B;  2AUK A;  4QCL A;  1HQM C;  2ICI A;  4XQJ A;  1SYD A;  2AUJ D;  5CV8 A;  1SE4 A;  2SEB D;  3H91 A;  2KVM A;  4KJO A;  1DOM A;  2XWJ B;  3CQZ B;  3CHB D;  3TDQ A;  4QF4 A;  1R4P B;  1LLR D;  3V2T A;  3V96 A;  4ZUI A;  5EKL A;  3EJI A;  4ILW A;  4FNF A;  3VR4 A;  1ZKO A;  3MEH A;  5IGC A;  2LKV A;  4HSV A;  3L7Z C;  3NPP A;  3TP6 A;  3ND9 A;  4IUN A;  1BR9 A;  1O78 A;  1K8O A;  4C3H G;  2IPK D;  2WP8 J;  3NXW A;  1WTP A;  4EGV A;  3OW7 A;  1SSO A;  3T51 B;  3Q0A A;  5EPL A;  1H9M A;  1TWH B;  1DZ1 A;  3K57 A;  4L63 B;  2B39 A;  2X6L A;  5E3F A;  2F0J A;  3M4Y A;  1D5X C;  4K5X A;  3UI2 A;  2F0N A;  3FRP B;  1KLG D;  3TME A;  5EBD A;  1BQQ T;  4OO1 G;  2DNE A;  1PFB A;  3BYY B;  4X3K A;  1SYE A;  3NBH A;  1TKW B;  1IW7 C;  3DXJ C;  3GTO B;  1JE4 A;  2NN6 G;  1LTR D;  3MC0 B;  4EQP A;  2Q8I B;  1LTB D;  3TZU A;  1LTI D;  1DXM A;  2EDG A;  2OXP A;  1FGB D;  4MN3 A;  1CM9 A;  4KN7 C;  3PIO 3;  3PUW A;  2SNS A;  3D8G A;  3TP7 A;  4CKE A;  1LT3 D;  4IFD G;  1WTQ A;  2H4O A;  1G6Z A;  2NBF A;  1NCV A;  3LX0 A;  1U4M A;  3DEO A;  4HTH A;  4FO2 A;  4DAP A;  2PYK A;  3AB9 A;  1I4R A;  3P75 A;  3QOL A;  4B9W A;  1CZG A;  1MI2 A;  3J81 L;  3EQL C;  1ENF A;  4XYQ A;  2A69 C;  3IFD A;  1QE6 A;  3MAQ A;  3SK5 A;  4WJW A;  2EYJ A;  2XVS A;  4R8I A;  1V1O A;  1QJO A;  1WD0 A;  1EZ6 A;  2K04 A;  1YNJ C;  4KI0 A;  4Z9C B;  1Q1B A;  1STA A;  2I46 A;  1RJT A;  2R93 B;  2WB1 B;  2KCC A;  3GTK B;  1WTW A;  2KEE A;  2ZT9 C;  2K05 A;  4IUP A;  2E2D C;  3P1H A;  3TZD A;  1F2Y A;  2KHS A;  1ENA A;  5LL6 S;  3HKZ B;  4MIU A;  3IFT A;  1Y8P B;  2NVX B;  1IL8 A;  3HOY B;  4CJ2 C;  2D62 A;  3K6O A;  3BS1 A;  3QOJ A;  3SVM A;  2CW0 D;  2QDB A;  4M8A A;  1LT6 D;  2WAQ B;  1STG A;  3BVG A;  4DAY A;  3T16 A;  4DXF A;  2F0P A;  4TQU S;  4A3F B;  1GUS A;  1E2W A;  1X32 A;  1EOT A;  1GUN A;  5JOB A;  3I91 A;  3GTP B;  2XSC A;  1BF4 A;  2MUY A;  2QEJ C;  4J8Q A;  1T5X D;  1U4R A;  4K2K A;  2EYF A;  5M9O A;  3Q22 A;  3DMU A;  4HN7 A;  4EQN A;  2F3V A;  1X3Q A;  3I4M B;  2WII B;  3GTQ B;  2KOL A;  3RUZ A;  2GA4 B;  3K5N A;  5DM6 3;  4G7Z C;  2RKS A;  2OF1 A;  1U4L A;  4HMJ A;  3RMH A;  4OIK A;  1B50 A;  5IGD A;  2L55 A;  5A35 A;  3NWS A;  2Q8R E;  2R6G A;  4LMQ D;  1Y1W B;  5BN4 A;  1PMR A;  2EJM A;  4K2L A;  1J8I A;  3ERQ A;  1H9K A;  2BA0 A;  3NP8 A;  1A15 A;  1NAP A;  4IQZ A;  4DN4 M;  2NVY B;  1KDB A;  4XQN A;  1PTO C;  3D4R A;  3K5M A;  3MWY W;  4FXK C;  5G3L F;  3V05 A;  3WDN A;  2B2U C;  4Q5V A;  3HZX A;  1RHP A;  2IJ0 A;  3K59 A;  2KCN A;  5KYI A;  3VR6 A;  3OOC A;  1QNK A;  2RBM A;  4KHZ A;  2LFN A;  1OO9 B;  1RCV D;  2L0C A;  1SNQ A;  1HTL D;  3TP8 A;  1RF2 D;  1S5F D;  2RSO A;  1BXT A;  3PUY A;  5M5Y B;  4FF4 A;  1NUC A;  3M4O B;  3GTJ B;  1ROD A;  2D5D A;  5I6Y A;  3C1F A;  4PQX A;  1RKN A;  4LK1 C;  1RTO A;  2BCO A;  2F0Q A;  3R2I A;  1BCP D;  3H09 A;  4C1N K;  2HUG A;  2L4N A;  1PTO B;  2RDG A;  4J6H A;  3SK4 A;  2JXM B;  1GXD C;  1MSG A;  2B2U A;  2PO4 A;  4RH6 A;  2FMM A;  5EKK A;  2EYL A;  2A73 B;  4KTA A;  2PCF B;  2BDO A;  2NB0 A;  2KUM A;  4IUT A;  3PUZ A;  3I3C A;  4RFB A;  2QCP X;  1A2U A;  5JJZ A;  2IT1 A;  4C3I G;  2VXW A;  4TSS A;  1Z6H A;  1KTK A;  1NSN S;  4C1N I;  4XT1 B;  1SYF A;  1SFO B;  1ET6 A;  3HRZ C;  4E6I A;  5EJW A;  1SNM A;  1TQO A;  3VA5 A;  1E2V A;  3K58 A;  3S1M B;  3R2T A;  5C0X G;  2VB2 X;  4FF1 A;  2CW0 C;  2DY8 A;  5JVH 3;  4DNT B;  4V19 0;  2L9H A;  3WOF A;  1U4P A;  4A3K B;  1B1Z A;  1CZW A;  4I65 A;  5KNB A;  5CV7 A;  1CFM A;  3DEP A;  3RLF A;  2CHB D;  5D3I B;  3NK9 A;  2F0I A;  1EYD A;  2IWH A;  1STN A;  2BDN A;  4K8I A;  2NUC A;  1GUG A;  1STB A;  5D14 A;  1EWH A;  5CV9 A;  2C5C A;  2WKD A;  1TS5 A;  4NMZ A;  1I3Q B;  4IUQ A;  2FFK B;  3BVM A;  1I6H B;  2RVL A;  2RDF A;  1MGS A;  3VR3 A;  1EIG A;  5CC4 A;  1A3V A;  1XTC D;  4LJZ C;  2ID0 A;  1H9J A;  1VMC A;  3NWT A;  3E6Z X;  2JA7 B;  1TWA B;  5CV5 A;  5ISR A;  4OGQ C;  5ELB A;  5JPM C;  1XYI A;  1I6V C;  3I4L A;  3M7G A;  3GTM B;  2IX0 A;  3U9O A;  1JOK A;  2F0U A;  2NN6 I;  3MHB A;  1F9R A;  4I7Z C;  1PRT C;  1QNU A;  2O4X A;  2G9D A;  5DNF A;  2SNM A;  4OIJ A;  1FR3 A;  4CHT B;  2K5W A;  3MVV A;  2MP1 A;  1V1P B;  3J7A F;  1O7Y A;  4IUR A;  1SE3 A;  1V1P A;  2CVR A;  1LTS D;  1GUW A;  2LMC B;  1PZJ D;  2OT2 A;  5FLX L;  1F9Q A;  2PZT A;  3GD7 A;  1KAB A;  1HPC A;  1KDA A;  4K6L A;  1EEF D;  1IYV A;  1LTA D;  3TP5 A;  4KY7 A;  1G8Z D;  3NBI A;  3E5S A;  4ZAI A;  2NYZ D;  3HOV B;  1PRT B;  1AFP A;  4S3S A;  1BBX C;  2YU9 B;  3NHH A;  1SMY D;  3OMC A;  4RGO S;  4C2M B;  3H6M A;  4H13 C;  1O7Z A;  4RWS C;  1EEI D;  1CA6 A;  5KNC A;  2L11 A;  3URY A;  2B63 B;  1QG7 A;  3SR1 A;  1EZ8 A;  3LNN A;  4XQQ A;  4OL7 A;  2X69 A;  4FF2 A;  4KKS A;  3S14 B;  4C3H B;  4CKC A;  2F0S A;  4FXG C;  2L5T A;  5C4X B;  1SNP A;  4FYD A;  4EQO A;  4BWG B;  1XX8 A;  2KJX A;  5ELF A;  4A3G B;  5DM7 3;  1CT1 D;  5DAU A;  1PDQ A;  2JP1 A;  4NDX A;  1KLU D;  2Q8T A;  4AYB B;  1ML0 D;  3DWA A;  5C5M A;  1DD2 A;  3T13 A;  1AN8 A;  2WV6 D;  1F2M A;  3KK7 A;  1DCZ A;  4HSP A;  3D4W A;  5J39 A;  3MTS A;  3FPP A;  4F7X A;  1L0Y B;  2CQA A;  4HMI A;  2F3W A;  3AU7 A;  1I4P A;  2VUM B;  1D1I A;  1UEA B;  4KMU C;  2K01 A;  2BA1 A;  2AQ3 B;  3S1R B;  2PQE A;  3T53 B;  2E74 C;  1TS4 A;  5KIX A;  2O5I C;  4ZK9 B;  4KKT A;  3K5L A;  3A8I E;  5EGT A;  2QIL A;  1S5E D;  4ME5 A;  1CI3 M;  1IKM A;  1GHK A;  1S5C D;  2F0M A;  4ZQ3 A;  2JA8 B;  1VDZ A;  1HQR D;  4DA2 A;  5M3F B;  3SK8 A;  1B44 D;  2IX1 A;  4WFN 3;  1HXY D;  1H9S B;  5J22 A;  1H9S A;  1XXG A;  4RGT A;  2F0F A;  2A6H D;  3JAM L;  2J4X A;  2MJ8 A;  3H3V C;  3I73 A;  1IKL A;  3VA7 A;  1SNO A;  3K5O A;  3PV0 A;  1RD9 D;  1QOH A;  1WTR A;  1BNZ A;  1T5E A;  2K6A A;  5E4W C;  3QWN A;  4XIG S;  2A6E C;  1UNS A;  2VNU D;  1AP0 A;  1JOO A;  1ZEQ X;  3RZO B;  3J7Y W;  2D9U A;  5HUR A;  4NKL A;  2K5D A;  1WTV A;  4QUC A;  4RHR A;  1SMY C;  1SE2 A;  3KBG A;  1EFI D;  5I9P A;  1L0X B;  3W3A A;  1TVX A;  4ZUJ A;  3R93 A;  1NR2 A;  4HR7 B;  1B53 A;  1ESR A;  4RA8 A;  4BA2 I;  4IAL A;  1C4Q A;  5FOB B;  1AW7 A;  3J7A V;  1HFN A;  1PLF A;  3C3L A;  1S4Z A;  1NR4 A;  5LHY 1;  2TSS A;  3PO3 B;  4RGM A;  1PXU A;  2E75 C;  1PYW D;  3LWE A;  3BDO A;  3MXP A;  5C0X I;  1G29 1;  3CKI B;  1I4Q A;  2R7Z B;  2F4I A;  2NZ1 D;  3I72 A;  5EBC A;  4G57 A;  5D3D A;  1JC7 A;  4BA1 I;  3G7L A;  5K36 H;  1QIL A;  2B2W C;  3D6W A;  3T56 B;  1X3P A;  4X3U A;  2L12 A;  2A68 D;  2XWB B;  2K7V A;  3D6C A;  1K8M A;  1FNW A;  5JEA J;  1B3A A;  3A55 A;  3Q6S A;  2TMP A;  1OXS C;  2R61 A;  3I4N B;  2HCI A;  5C5L A;  1I4X A;  5M5X B;  1LAC A;  1ONL A;  1Q1E A;  4IN3 A;  1RTN A;  2XNA C;  5ELE A;  4WRD A;  2EY5 A;  1DJR D;  1TU2 B;  5CR3 A;  4V0B A;  4G7H C;  1Q90 A;  5IOD A;  3N52 A;  1W6J A;  4KN4 C;  1OXV A;  3P20 A;  5T1I A;  3MFY A;  2B2W A;  2O2L D;  2ZXP A;  3C2P A;  4JK1 C;  5FLX E;  3KLS X;  1O80 A;  2EVB A;  2VB3 X;  3MA2 B;  5TSS A;  1W6K A;  3PUV A;  4K6D A;  3C1E A;  1CK1 A;  3R8B A;  5KYL A;  4XT3 B;  4B9X A;  4RAU C;  3OIP A;  4ZYS A;  1LT4 D;  2F0T A;  3T4A C;  1KNA A;  2HDM A;  3SDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...