1NTGA

Crystal structure of the emap ii-like cytokine released from human tyrosyl-trna synthetase
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
171
structure length
171
Chain Sequence
PEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNISLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosyl-tRNA synthetase
publication title Crystal Structure of an EMAP-II-like Cytokine Released from a human tRNA Synthetase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 34
structure length 171
sequence length 171
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.1: Tyrosine--tRNA ligase.
pdb deposition date 2003-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ntgA00
1X56A 1A62A 2BH8A 1HZBA 3GD7A 5ELNA 4A3IH 3HFZB 4JI2L 4HJ7A 3ULLA 5IP9H 2E2HH 1YVCA 2CKZB 3H15A 1IBML 2IHEA 1WOCA 1YHAA 4JBJA 3GO5A 4O2DA 3AFPA 1YBYA 3CXCA 4DV3L 3F8TA 4DV5L 5C44H 3ERSX 2A19A 2N8NA 3J81j 1S72A 4LF4L 4L5SA 1QVCA 1XJVA 4POGA 1WI5A 1OTCA 5LMNL 1N34L 1JE5A 2L15A 3CCSA 1X65A 2Q2TA 2ATWA 2EIFA 2MO0A 1X6OA 3J80c 3PUVA 1S3OA 4A3FG 4IFDG 4OWTB 1Q8KA 1Q81C 3W5OA 1A63A 4DR6L 4EQ5A 2Y0SG 4A3LH 2I5HA 2I5MX 1XPOA 1KAWA 4MNOA 1PH1A 4YCVA 3ICEA 3TQYA 3KOJA 2ID0A 5DLQE 1W3SA 2JEAI 4JI8L 4A3CH 4HJAA 3T1HL 1XMQL 4AQYL 1VQ6A 2E5LQ 4JBKA 2ZTDA 1UE1A 4B3TL 2YYZA 4UP9A 4J15A 4A3EG 1VQMA 3GTOH 1BBUA 4A3BH 1KHIA 4LW1A 4ME3A 1PH6A 1SLJA 2JEBI 4GN4B 3CMEA 4DV7L 1RIPA 1Z9FA 4P74A 4A3KG 1Q82C 1VQ7A 3KFUA 1IBKL 3M85A 3F1ZA 4X65Q 1CUKA 3PF5A 1EIFA 1HJPA 3RNUA 5IWAL 3DLLA 1O7IA 5C0XG 1CKNB 4IOCA 4LF4Q 1B7YB 1KL9A 1PH2A 2ZJQA 3HOWH 3J7A5 4YHHL 5FJ8H 2K5NA 2R92G 1LYLA 1N34Q 2QGQA 5C3EH 4BBRH 4LF7L 1WFQA 2AMCB 5JJLA 3CCVA 2PMZE 5ELOA 1NMGA 3UDXA 1HNXL 2CWPA 2UUAL 3M4OH 4KHPL 3PSIA 2KENA 4HJ9A 2NVTH 4JI4Q 2MO1A 4DR6Q 1OXUA 4IJLA 3NENA 4DV1L 2E2JH 2AWOA 1PH5A 3K80C 2R93H 3S16H 4JI5L 3EIVA 5EAYA 3S1RH 3PF4A 1KIXA 4JI8Q 1Y14B 5C4XG 1XMQQ 4HIMA 1W2BA 2ZTEA 2PQAA 2H5XA 3AQQA 4GN3B 4NB3A 1UE7A 1A8VA 5IYDH 4PZ7A 1C0AA 1K83H 5JJKA 1NJIC 1IXRA 3K7UC 4DV7Q 3H0GH 1CKNA 4DK3C 1WCMG 3HOXG 1IBKQ 3PV0A 3TEHB 1OXTA 1OXSC 3FKIH 4A3MH 2VUMH 4C3JH 2K4KA 1PHJA 1G51A 3ULJA 2R7FA 4A76A 3CC4A 1LM0A 4DAMA 2UUBL 3U58A 4LF5L 3TREA 1PYBA 3WWVA 2F52A 2PNHA 4KI0A 1KXLA 4KLKA 2R7ZG 3STBC 3RZOH 1UE6A 2OTLA 2Z6KA 3S14H 1UE5A 2AKWB 2VS1A 4OO1I 2YTYA 4LNQA 2RCNA 2I5LX 3E0EA 4GLAC 3I7FA 3S1NH 5GAHC 2K14A 4A75A 4X66Q 4RMFA 4YCWA 1KC8C 4B3SL 1XNQQ 2JA6H 4WJ4A 2AHOB 1FJGQ 3A5ZB 1M1KC 2YU9H 2ES2A 4X62L 4JI5Q 1EYGA 1YJNA 5C4JH 3CCLA 3GTMH 3PUWA 1N32Q 3PO2G 5LMNW 4BY1H 1EIYB 1SN8A 4DV2Q 1C9OA 2CFMA 4JYAL 3AYHB 4QY7A 3E9HA 2E8GA 5JEAJ 5IYBH 4GNXB 2NVQH 1U5KA 5IT9c 1V1QA 3M9BA 1BVSA 1HR0L 4OXPA 3PCOB 2MFIA 4LUZA 1Y1VG 4DR2Q 1YNXA 4GS3A 4C3IH 2YV5A 3RLNA 4HIOA 4UY8C 1GO3E 5H1SE 5AJ3Q 2I0QA 3S24A 3I4NG 1E7ZA 4TQUS 1X3EA 3CCRA 5M3FG 2IX1A 3HOUG 4MTNA 2PI2A 1IL2A 4DR7Q 3MEFA 1VQAA 2K5HA 3GTJH 1VQ8A 2XGTA 1E24A 1E3PA 3KF6B 3HOYG 3I4MG 4JBMA 4A3FH 2JA9A 1Q1EA 4DR5Q 2GVAA 3F2DA 2QA4A 3ULPA 2WP8J 3G48A 1J6QA 4X65L 2PI2E 4JI3L 3BU2A 4B3SQ 1BBWA 3BZKA 1K8AC 1N33L 5IP7G 4A93G 4GNXA 1TWFH 4X62Q 1PH9A 1PH8A 2OWOA 1HNWL 2LSSA 4BBSG 2F3IA 4AH6A 1V9PA 2HIXA 3BJUA 3H3VI 5GQOA 2HHHL 5J3BA 4LFBQ 4AIMA 2JJQA 4JYAQ 4IFDI 4A3EH 1L1OB 3CP0A 4IPDA 1HR0Q 3CQZH 3RR5A 4A3KH 3L2PA 1UEBA 4JI4L 2UU9L 1N9WA 5IE8A 3B6YA 1EFWA 2NZOA 3J7ZC 5IYCG 3JAMi 1YZ6A 4PG3A 4DKAC 4RG1A 5GADC 2Z0SA 3CAMA 3KF6A 4GNXC 1HZCA 4DAYB 4JI0L 4BY7G 1SR3A 2R92H 2DUDA 1UWVA 3L7ZC 3TS0A 1VQCA 4BXXG 1Q86C 4NXNL 4GKKL 2PQAB 1SROA 2V1CC 1Z47A 2RHQB 5C0XI 1TWAH 2Q2UA 4JI3Q 4A3DG 4LFAL 1E1TA 1VQ5A 4GOPB 3EN2A 1XMOL 1N33Q 5K36G 1X3FA 3HKZG 4UP7A 1MIUA 3K81C 3I2ZA 4QL5A 4DPGA 1L1OA 3J81c 1XPUA 1HNWQ 1OXXK 2D62A 4KHZA 4YWLA 4C3HH 5C4XH 4QIWE 2CQOA 3OTOL 2HHHQ 4IOAA 3UDFA 2HQLA 1EOVA 1X54A 4YWMA 1BKBA 3UDGA 2UXBL 1QZHA 1QVFA 2Y0SE 2IT1A 2R7DA 4PZ6A 1VQHA 4JBWA 4JG2A 4PZ8A 4R4CA 2UU9Q 1NMFA 1WCMH 3HOXH 3FHWA 4X66L 1JB7A 1XNQL 3A0JA 1FJGL 2B29A 3PUYA 4UPAA 2NZHA 4GKJL 4IO9A 2ZJRA 1IBLL 2B63G 2WAQG 3Q8DA 1VQKA 1EWIA 2JA7G 3FP9A 5M3MG 1E1OA 2ZJPA 3GTQH 4JI0Q 1N32L 5E7NA 2ZM6L 3G71A 4NPSA 1L1OC 4DV2L 3I4OA 4DNIA 3HOZG 2D0OA 3MXNB 4GOPA 2BH2A 2R7ZH 1I50H 2DGYA 4NXNQ 3EBEA 3PGZA 5BR8Q 4DR2L 3BZCA 4GKKQ 3S2DH 1VQJA 1ASZA 4QGUA 3HKZE 1A0IA 4LFAQ 5AJ3L 4BA2I 4LF9L 1XMOQ 1WYDA 2K50A 4EX5A 4DV0Q 4JI6L 1NE3A 3GTGH 4WJ3M 1JJ2A 5LMUQ 2OQKA 1HH2P 4DR7L 3PO2H 4R4OA 2KHIA 1P16A 3OTOQ 4H02A 4BA1I 4R4IA 3PO3G 3J80i 2UXDL 4JCVE 2F4VQ 1CKOA 1I3QH 1PFSA 2YTVA 2UXBQ 1IZ6A 4LF8Q 4DR5L 1G291 4GOPC 2KCMA 4L5QA 2E2IH 1KRSA 2QEXA 1B70B 2WAQE 2VY3A 4B3ML 1FL0A 1QZGA 4OWXB 2IX0A 1YI2A 2C35B 4OONA 4GKJQ 3ER0A 1VQIA 3F2CA 1IBLQ 3I4NH 3A74A 2R93G 2VQEL 3M4PA 5M3FH 3JAMc 4YY3L 3HOUH 2ZM6Q 2FXQA 4JOIA 3RLFA 1PH3A 1Q46A 4DR1Q 4LFBL 4LFCL 3OW2A 3PUXA 1I6HH 3UE0A 1MJCA 1X55A 5IYDG 3HOYH 3I4MH 2UXCL 2MNAA 1R9TH 1I5FA 2Z6KC 4HJ5A 5FLMG 1HZ9A 3S2HH 1QUQB 2AWNA 4K0KQ 1IYJB 3STBD 1PA6A 3K0XA 4LF9Q 4GLXA 2JA8G 4JI6Q 5IP7H 4A93H 1DGSA 4A3JG 1K73C 1I94L 4B3RQ 2A8VA 3G4SA 4BBSH 4P71A 3E9IA 3SGIA 2K75A 1K8GA 1P8LA 1E22A 1JJCB 4XIGS 4AYBG 1Y1WG 1CKMA 3RN5A 2UXDQ 1TWHH 3H3VH 2NVXH 5GAGC 3CD6A 5JEAG 2VZAA 1V43A 2WB1G 1AH9A 2GVBA 3S17H 1SE8A 4B3MQ 1VQNA 1TWCH 2JA6G 3CCEA 5IYCH 1M90C 3KLWA 4JI7L 1B8AA 2WFWA 1X9NA 1VCIA 2VW9A 1PVOA 1N36L 2ALYB 1VQFA 4L5TA 2VQEQ 4DR4L 2OTJA 4YY3Q 2MQHA 4C2MH 2JA5G 3U4ZA 1KQSA 3D31A 4LFCQ 1QUQA 4XTCS 5IYBG 4IFDJ 1Q1BA 1VS0A 4BXXH 4APVA 2UXCQ 4UP8A 4IPCA 1AE2A 3T1YQ 4O0AA 1VQOA 1PH7A 4A3DH 3HOVG 4A4IA 2HIVA 4R4QA 1JJGA 3NBHB 3GDEA 3CF5A 1NBWA 4A3GG 3GTKH 4AYBE 1I94Q 4DUYQ 4IPHA 1PV4A 1VQBA 4NXML 4PMWA 5M5WH 4TVAB 2JK8A 1HNZL 2WB1E 4ALPA 4DK6C 3CCMA 3HKSA 3K8AA 3CW2C 5BR8L 3KDFA 2IY5B 4A3IG 1JT8A 4X64Q 5IP9G 3GTLH 4GLVB 1C7YA 3W1BA 1HZAA 5C0XJ 4DV0L 1GD7A 1K0RA 2NVYH 2LXKA 1VQPA 4JI7Q 2B63H 1TWGH 3LGJA 4MZ9A 4Y7NH 4OX9Q 1N36Q 5C44G 3TRZA 5LMUL 5M3MH 2JA7H 4DR4Q 2R6GA 2EQSA 4JI1Q 3PIOA 1FVIA 1YJWA 3ZJYC 2Q2IA 3KJOA 1XNRQ 1RL2A 1MKHA 3HOZH 1SMXA 2Q2HA 2F4VL 3VDYA 1YHBA 2K5VA 4R4TA 4IPGA 4IJHA 4LF8L 2VNUD 3AFQA 2EXDA 2RHSB 4DV6L 1K9MC 5M5XH 1YITA 1T9HA 4JI2Q 2K52A 3M4QA 1IBMQ 4A3LG 1ASYA 4JV5L 1XTDA 2OQ0A 4DV3Q 3A5UA 4DV5Q 4P75A 3CMAA 1KD1C 1EUJA 2GN5A 3S1QH 3CPWA 4A3CG 1TXYA 3NELA 1VQGA 3I56A 4DR1L 4NXMQ 5LMNQ 4FDBA 4R1JA 1HNZQ 2UUCL 3PO3H 1HR0W 4A3BG 5M5YH 4DV4L 2BA1A 1VQEA 3DM3A 3KYHC 3G6EA 3UDIA 1X3GA 4K0KL 1VQ9A 4X6AH 1U0LA 2JE6I 3KF8B 1K3RA 1AE3A 2N3SA 3RN2A 4JC0A 2RF4A 2VQFL 1JMCA 3CC7A 2YTXA 4B3RL 3HOWG 4YWKA 2KHJA 5FJ8G 1YJ9A 3T1HQ 2KCTA 4AQYQ 5C3EG 1NTGA 4BBRG 1GM5A 1EQQA 4B3TQ 4L5RC 4Y52H 4POFA 1CSPA 4LF6L 3IRBA 1KRTA 3UE1A 1D8LA 1VQLA 3GTPH 3F2BA 4DV6Q 3NEMA 1Y1VH 2NN6I 4HIKA 1LUZA 1OXVA 3D0FA 5FLMH 3L0OA 3CC2A 1H95A 3M3YH 2BA0A 1CSQA 4DR3L 2NN6G 3CCQA 1EQRA 4DUZL 1VQ4A 3S1MH 2N78A 4JV5Q 1L2FA 2JA8H 4A3JH 5IY0A 1J5EL 5IWAQ 3RLOA 1MJEA 2XTIA 3S15H 2VL6A 1GKHA 1G6PA 4YHHQ 3OYYA 3I55A 1NY4A 1PH4A 1LTLA 1Y1WH 1S40A 2UUCQ 4LF7Q 1WJJA 4OWWB 4DV4Q 2OCEA 4GN5A 5FLXc 2UUAQ 1HNXQ 3H0GG 4KHPQ 3T1YL 5GROA 1D7QA 4OO1G 3FKIG 3U4VA 4A3MG 2VUMG 4DV1Q 2IHFA 3J81i 4LUVA 1GVPA 3TS2A 4LUOA 2VQFQ 4DUYL 3K7AH 1Q12A 4P72A 4QJFA 3CCJA 2JA5H 4JOIC 2ZTCA 1VQDA 5GAEC 1FGUA 2CCZA 2D0PA 1SRUA 5JJIA 1YIJA 2JQOA 1Q7YC 4LF6Q 5HGQA 1PYSB 1YEZA 4HJ8A 4X64L 3RZDH 4QQBX 3JC66 2B3GA 2A1AA 1YHQA 2LXJA 4DR3Q 4YCUA 1L0WA 3W1GA 3CCUA 4DUZQ 1XPRA 3HOVH 3KDFB 3U50C 4P73A 4OX9L 1SFOH 1J5EQ 3CPFA 2CWAA 2KBNA 1QVGA 4A3GH 4JI1L 3PUZA 4BY7H 3M7NA 4HIDA 4BY1G 1N8RC 5HY6A 3KJPA 1XNRL 2E5LL 2UUBQ 2ASBA 4LWCA 4LF5Q 3AEVA 2N49A 3PIPA 2HT1A
chains in the Genus database with same CATH superfamily
1E0BA 3JAME 2B2UA 3MA2B 3OHXC 4R9WA 2BH8A 1HZBA 5M9OA 4HJ7A 3H15A 4JBJA 1YHAA 1SMYD 2A19A 2A6HD 4HMIA 1S72A 4L5SA 1QVCA 1XJVA 4POGA 2RDFA 1OTCA 1N34L 2RQXA 1JE5A 2L15A 3D6CA 4M8AA 3CCSA 2Q2TA 2MO0A 2O4XA 3MFYA 5KGUA 4OWTB 5CV8A 2I5HA 2D9UA 2I5MX 2F0DA 3IL8A 1XPOA 1TS2A 4XXEA 4JI8L 1TY0A 4A3CH 1DYQA 2C9OA 1VQ6A 2E5LQ 4JBKA 4UP9A 4FF1A 4IUNA 1WD0A 1BBUA 1GHKA 1CZWA 2JEBI 3CMEA 4DV7L 1Q82C 1Z9FA 3D4WA 2EY5A 4X65Q 1EIFA 4J8QA 3DLLA 1J8IA 1PH2A 3J7A5 2R92G 2K5NA 1DCZA 2F0SA 1PTOB 2CWPA 2PNRC 1GUGA 2EJMA 3PSIA 2XVSA 3HOWB 1GUTA 2NN6H 2CVRA 4U68A 4DU9A 5C3EB 1PH5A 4KN4C 2R93H 4FF4A 5EAYA 3S1RH 4C3HG 1XMQQ 2XRQD 3ND8A 2H5XA 2E2JB 4KTAA 5LHY1 3QWNA 4PZ7A 1U4RA 1IXRA 1CZGA 3S16B 1PZID 4DK3C 1IBKQ 2PW7A 4JVZA 1OXTA 1STYA 3ITPA 3HS0C 1HQRD 4A3MH 3FRPB 2FINB 4C3JH 1Y8NB 2A68C 3R8BA 4CJ2C 1PHJA 1F9SA 1NAPA 2LKVA 3CC4A 1LM0A 2X6GA 5JOBA 4GZYC 1JQYD 4UAIA 4KI0A 2VUMB 4KLKA 3RZOH 2OTLA 2VS1A 4GLAC 1KC8C 2JA6H 4X66Q 3MXUA 4WJ4A 1M1KC 2ES2A 3R2IA 4JI5Q 1EYGA 3CCLA 1MSGA 1KLGD 4V0BA 4BY1H 3PO2G 2ZXPA 1SN8A 2E2IB 2CFMA 3VR5A 4QY7A 5KYLA 5KIXA 5IT9c 3M9BA 1HR0L 1JC7A 1YNJD 5M3FB 3GTMB 3SK4A 4GS3A 5FO7B 2B8GA 1SSOA 3RLNA 1K0SA 1GO3E 5H1SE 1G8ZD 3URYA 3I4NG 4TQUS 1H9MA 1R9TB 2NYZD 4HSVA 1VQ8A 2DJFC 2B39A 1CM9A 3I4MG 2JA9A 4IFDH 1EY5A 4X65L 1A2UA 3BU2A 4HSPA 5EJWA 3BZKA 2A73B 3R2TA 5NUCA 2VB3X 2K32A 4X62Q 1U4MA 3FMCA 4KJNA 3PIP3 2NVXB 4A3FB 2OXPA 1LTID 1JOKA 1BOSA 5GQOA 4AIMA 3BYYB 4IFDI 1L1OB 3CP0A 3TP7A 1CK1A 4OIKA 2B2UC 3RR5A 3L2PA 1UEBA 2KJXA 3AU7A 3B6YA 2NZ1D 4C2MB 2Q8TA 3J7ZC 1OO9B 2EVBA 4RG1A 3CAMA 5J1ZA 4GNXC 2G9DA 3HRZC 4M1UB 1TY2A 4CKCA 3GP7A 3DEOA 1U4LA 1UWVA 5CYUA 4ZUIA 1B1ZA 1VQCA 4BXXG 2NB0A 1VF7A 4NXNL 2DNCA 1HA5A 1Z47A 2Q2UA 4JI3Q 4CDFC 2L9HA 1VQ5A 1QWYA 1N33Q 2LMCB 1MIUA 3K81C 3K5NA 4FXDA 3I2ZA 4QL5A 1L1OA 4CGYB 2D62A 5C4XH 3E6ZX 3TBIB 3OTOL 2HHHQ 3M7GA 3OW7A 1JWMD 1O7LA 2IT1A 3MWYW 1VQHA 4JBWA 4R4CA 3NHHA 1SYCA 1PFNA 3FHWA 3I4LA 4N9PA 4X66L 3AMUA 2E75C 4NP5A 4IO9A 1IBLL 2WAQG 4F87A 1AEXA 4JI0Q 2MPMA 5M5XB 5FO8B 1WCMB 4FF2A 4KD3A 2BH2A 5BR8Q 3N52A 4QGUA 3MFGA 4S3SA 3EA6A 2M00A 2N88A 3OMGA 4BA2I 2K50A 3LX0A 5ELCA 1H9RA 2R7ZB 4WJ3M 5M5YB 1JJ2A 5LMUQ 5C3WA 2KHIA 4X3UA 3Q6SA 4R4IA 1EEFD 4KKTA 1ENAA 2EY1A 2A69D 4XYQA 1ENFA 2E2IH 3K5MA 1JICA 2IX0A 4GKJQ 3ER0A 1VQIA 5G3LD 4DXGA 2XIWA 3F2CA 2R93G 5M3FH 3JAMc 3U9OA 2F0IA 1Q46A 4DR1Q 3M3YB 3DWAA 3MXPA 5EQ0A 1MJCA 3KF8A 2BDNA 1R9TH 4G57A 3GV3A 4HJ5A 1QUQB 2AWNA 4K0KQ 3H6MA 3E5SA 3STBD 1EZ6A 1AN8A 4LF9Q 4GLXA 2JA8G 3EQLC 2DJGC 1I94L 3OMCA 4DK0A 3G4SA 2WB1B 1TR5A 5IGEA 1CKMA 3E0JA 1JCKB 1I6VC 2E2DC 2NVXH 1LTRD 5GAGC 3H3VH 3I8ZA 1SMYC 4XDXA 4BBSB 2A6HC 1D5ZC 1ZYRD 2JA6G 1TWCH 5CV4A 5JVG3 5IYCH 4FXKC 4JI7L 5CORA 3KUPA 2ALYB 1VQFA 2VQEQ 4C2MH 3Q24A 4LFCQ 1QUQA 4H44C 1Y69U 1WTOA 2A74C 1Q1BA 3C46A 3DXJC 2F0NA 2NBFA 2K1BA 3BVZA 4TKOB 4BY7B 2EYOA 4BWGB 4O0AA 1IHZA 4A3DH 1EIHA 3HOVG 4A4IA 3A8IE 3NBHB 4A3GG 1VQBA 2SEBD 4PMWA 4QF4A 3SE0A 5FO9B 2WB1E 4DK6C 1C48A 3HKSA 3K8AA 3CW2C 5BR8L 1ILPA 1BCPF 4X64Q 4FF3A 3GTLH 2N55A 1C7YA 5E4XA 1GD7A 4G7OC 4MZ9A 4OX9Q 1N36Q 5C44G 5LMUL 2WV6D 5M3MH 2EQSA 4JI1Q 3BVGA 1Q3LA 5IGDA 3RUZA 1RL2A 3HOZH 4R4TA 1V8QA 1TWGB 4N8X1 1Q8IA 1SJED 2F0OA 1WD1A 2RHSB 2PPBC 3NBHA 4RKLA 5M5XH 1GOZA 2F0FA 3H3VC 4JI2Q 4RFBA 1ASYA 3MZ5A 4J1MA 3GTOB 1LO5D 2NTTA 4KY7A 3A5UA 1K8MA 1KD1C 1EUJA 3S1QH 3NELA 4DR1L 1VQGA 4NXMQ 3P7JA 5LMNQ 4FDBA 1DXMA 1EZ8A 3NTKA 5CV7A 3PO3H 5M5YH 4DV4L 2BA1A 3DM3A 1X3GA 4K0KL 1U0LA 3EVQA 2JE6I 1AE3A 5C4HA 3OIQA 3OPOA 5IOCA 3VA7A 2VQFL 2YTXA 2J0TD 4WJWA 3M4OB 3HOWG 4YWKA 5C3EG 1GM5A 4B3TQ 3D4RA 3DMUA 1D8LA 3F2BA 4HIKA 5FLMH 1PFBA 2RDHA 1HFNA 3M3YH 2F3VA 5CC4A 1VQ4A 4LJZC 5LL6S 1B2TA 4A3JH 1S5FD 2XTIA 3S15H 2SDFA 1KDAA 1FR3A 1LTLA 5A2QE 1UUPA 4LF7Q 2UUAQ 1HNXQ 1W6JA 1NSNS 5GROA 4OO1G 2VUMG 4DV1Q 4DXFA 3QOLA 3TS2A 1BR9A 2ZTCA 4IUVA 3NSWA 1YIJA 4LF6Q 2YU9B 1RKNA 2DY8A 1YEZA 4HJ8A 4X64L 1GUNA 1G2SA 2EY6A 4DUZQ 4RGNA 1JE4A 3TMEA 1ET6A 4OX9L 1J5EQ 4JI1L 4BY7H 2L4NA 3IKJA 3SHLA 3KJPA 2ASBA 4DN4M 4C3IB 2HT1A 1X56A 1NCVA 1BQQT 2KCCA 5ELNA 1RJTA 1HPCA 3HFZB 4JI2L 3SXHA 5IP9H 1DOKA 3VYTA 4K14A 4LF4L 4XQNA 2MHVA 5LMNL 5CBEE 1X65A 4DF7A 4A3FG 1SEBD 1S3OA 3PUVA 1Q81C 4WORA 3W5OA 4DR6L 1PZJD 4EQ5A 1FNVA 2HDMA 2NWGA 1ICFB 1KAWA 4YCVA 1X32A 3TQYA 1H9KA 5DLQE 1W3SA 5A2QL 3CQZB 4A3KB 1E2WA 4DK1A 4DA2A 4B3TL 1UE1A 4Z9CB 3FEWX 1VQMA 3GTOH 4A3BH 1KHIA 4LW1A 2PCFB 4F7XA 4GN4B 1II3A 1AZQA 3KFUA 1VQ7A 3A55A 3F1ZA 4TSSA 1CUKA 3ZYYX 1HJPA 4MHEA 3S9WA 1PRTF 5C0XG 1CKNB 4IUPA 1QB5D 1B7YB 1KL9A 4WFN3 1LYLA 1N34Q 2QGQA 4F88A 1TWAB 4LF7L 2AMCB 1WTQA 3CCVA 5ELOA 3UDXA 2UUAL 1HNXL 3M4OH 1TS4A 4HJ9A 4JI4Q 2MO1A 5IODA 1RD9D 2P5ZX 4DV1L 1X3QA 2AWOA 4EQNA 5EKLA 1QNKA 3PF4A 4JI8Q 1Y14B 5F2DA 3AQQA 2Z1CA 4GN3B 3HOXB 2A69C 1SNMA 5IYDH 1NJIC 5KNCA 4DV7Q 3S1RB 1CKNA 1WCMG 1X3PA 1YNNC 1DJRD 4NKLA 2GA4B 4G7ZC 1I50B 4RGTA 2R7FA 2KUMA 3TZDA 1F2LA 4C3JB 2R7ZG 2ZXOA 2F0GA 3STBC 4EVOA 1UE6A 4LNQA 2EYLA 2HD3A 3E0EA 5JPMC 2O2LD 4B3SL 4O42A 1FJGQ 3UI2A 1EU4A 2YU9H 3RMHA 2PO4A 1TS5A 1HTLD 5C4JH 3C2PA 2PQEA 4CHTB 1WTWA 1EIYB 3A8JE 3AYHB 5JEAJ 5IYBH 2E8GA 4GNXB 3VR3A 2F0EA 2F0PA 3PCOB 4LUZA 5C4ZA 5CGKA 3HOUB 4BY1B 4C3IH 4HIOA 1F2ZA 4ABNA 4R8IA 1GUWA 3S24A 2JN4A 2IX1A 1SE3A 2PI2A 2AUJD 1STBA 3TP6A 2IL8A 1FNUA 2V4DA 4X3KA 4XT1B 1SNCA 3A54A 2L55A 1WTXA 1LT6D 3F2DA 5CV5A 3G48A 1DZ1A 1FD7D 2PI2E 2JSOA 4FYDA 1EYAA 1K8AC 5IP7G 4LK1C 4GNXA 1TWFH 2QKIC 2OWOA 2CH4W 4BBSG 2KHSA 1V9PA 5D3DA 5J3BA 1RHPA 2JJQA 3TP5A 4A3EH 1EY8A 1HQMC 4IPDA 1HR0Q 3CQZH 4A3KH 1UEAB 4JI4L 2UU9L 3W3AA 1N9WA 5IE8A 1KDCA 2SOBA 1YZ6A 4G7HC 1ILQA 2Z0SA 4HR7B 4ID6A 2C5CA 4DAYB 4BY7G 1B3AA 3QO2A 1EL0A 1SR3A 4L63B 4DAVA 1EY0A 1BXTA 2QDBA 1LTAD 1SNQA 3HKZB 3MC0B 4C1NI 3GTKB 2V1CC 2RHQB 4B08A 1TWAH 4IUTA 5K36G 1E1TA 3EN2A 3HEJA 2O5IC 1X3FA 4UP7A 4DPGA 1XPUA 5E3FA 4N8FA 4Q5VA 3G6JB 3OWEB 2MGSA 4OL7A 1D5XC 2HQLA 3NP8A 1NUCA 2F3WA 4QCLA 1W6KA 2UXBL 4PZ6A 5C4XB 3HOXH 4DAYA 3GV6A 5JVH3 1FJGL 2B29A 2RSNA 3PUYA 2B63G 1LABA 2ZJRA 5DAUA 1EWIA 2EYPA 3FP9A 1E1OA 2MUYA 3JAML 3GTQH 5E7NA 2ZM6L 2WKCA 3BDOA 3I4OA 2D0OA 1SYEA 1I50H 4NXNQ 3PGZA 3S2DH 1VQJA 1B9NA 3HKZE 1M4VA 2K5WA 1B53A 1CHPD 1NE3A 3X3NA 1A6XA 2OQKA 1HH2P 2XWJB 3C1FA 3OTOQ 1P16A 3IFTA 1Z6HA 3OWFA 5D14A 1CKOA 4GOPC 2KCMA 4ME5A 4B3ML 1FL0A 1QZGA 4OWXB 4OONA 1CQFA 1IBLQ 3M4PA 1GUOA 5ELEA 5ELDA 4CJ0B 3HOUH 1Y1VB 2FXQA 1UNSA 2F0VA 3PUXA 4ZKBB 2F0WA 3HOYH 5IYDG 3NQIA 1KLUD 1BCPD 4K2KA 1HZ9A 4EGVA 1IYJB 4LAAA 1PA6A 4ZQ3A 1BBXC 2CH4A 1Y1WB 4A93H 1K73C 2R61A 3E9IA 1CA5A 3SEBA 3A8KE 1JJCB 4XIGS 4AYBG 3D4DA 1TVXA 3CRLC 3I70A 2B2TA 3R3OA 4X3TA 4IQZA 1XTCD 3CCEA 3KLWA 2WFWA 1PVOA 2VW9A 4HCEA 4DR4L 2LY7A 2JA5G 2J4XA 3U4ZA 3D31A 1TWCB 3L3OC 5IYBG 2K5DA 1VS0A 1QNUA 1SFOB 4OEMB 5C3XA 3T1YQ 4MTKA 1PH7A 2CW0C 3P1HA 2HIVA 5E1FA 5A35A 1NBWA 5DEHA 3GTKH 4RHRA 5I9PA 1I94Q 4DUYQ 3MTSA 3K6OA 1H9SB 4A3DB 3KDFA 4PMCA 2IY5B 3OIPA 2K6AA 2F0MA 2XRSD 3W1BA 1HZAA 4JI7Q 2LXKA 1EU3A 2NVYH 4KKUA 2JA7H 1AW7A 3ZJYC 3GTLB 3KJOA 4ZUJA 2IJ0A 1YHBA 4IPGA 2VNUD 4DV6L 5M3MB 1PTOF 2K33A 3M4QA 1IBMQ 3HOZB 1H9SA 4DV3Q 2KEDA 3BYTB 4P75A 3CMAA 4A3CG 1DOMA 3CPWA 3CKIB 2BCOA 1MI2A 2EDGA 3DEPA 1VQEA 2FFKB 3K57A 3S1QB 1WTHA 1VQ9A 5EBDA 2BE5D 3KF8B 4U673 3RN2A 3PO3B 4BBRB 4XQQA 1BNZA 1H9JA 2KHJA 3T1HQ 1JWSD 4AQYQ 4RHSA 4V190 3J81E 1U9RA 4FXGC 1Y1VH 3KBXA 3DUZA 2FMCA 2NN6G 1GXDC 3CCQA 4R8NA 4DGZA 5IWAQ 1K83B 2VL6A 1G6PA 4UHVA 2H4OA 4ZYSA 1A15A 2Q8RE 3LWUA 3OYYA 4YHHQ 1Y1WH 3FKIB 4RCNA 4XQJA 4OWWB 4DV4Q 2OCEA 4A3JB 5JEAH 3S15B 4DAPA 1STNA 3T1YL 3PMFA 3DM1A 3A7LA 3HG9A 4A3MG 3U4VA 4G4KA 4C3JG 1STAA 2VQFQ 4DUYL 4FO2A 4P72A 3CCJA 1VQDA 3G7LA 1F9QA 2D0PA 5KRUA 2WACA 1PYSB 2QILA 2LXJA 1XWEA 1FNWA 1XPRA 4IALA 1PRTD 1SFOH 3MEHA 1HUNA 1I4XA 4ZLTF 3M7NA 4HIDA 4BY1G 5HY6A 2UUBQ 4LF5Q 3PIPA 5EBCA 2E74C 3FDTA 1A62A 3MXGA 2B2TC 3I73A 3GQBA 4OIJA 4A3IH 3ONAB 2E2HH 1YVCA 4H7BA 1IBML 2IHEA 2M2LA 3GO5A 5D65A 4O2DA 1T5XD 3AFPA 4DV3L 3WOEA 3F8TA 1DONA 3J81L 3DWQA 2PMZB 1EY6A 2ATWA 5I2XA 2K05A 1X6OA 3VA5A 4IFDG 2XSCA 4IUQA 2IX3A 1A63A 3CRKC 3SR1A 4A3LH 4MNOA 1PH1A 1KABA 1DM0B 5IIFA 2ID0A 2B2WC 1A3VA 4HMJA 3T1HL 2X69A 4AQYL 5CR3A 4J15A 4H13C 4ME3A 1PH6A 1E2ZA 2HUGA 3MHBA 2R92B 1G91A 1TQOA 3PF5A 4JK1C 1O7ZA 4A3BB 1CI3M 1EWCA 1EYCA 5IWAL 4LF4Q 3A56A 3LNNA 2XWBB 2IPKD 4YHHL 5FJ8H 3K58A 5I4DA 3QB3A 4CJ1B 4BBRH 1WFQA 3BDCA 2PMZE 1NMGA 1A3UA 3E3XA 3SDZA 4BS9A 2EE1A 2KENA 5KNBA 3VR6A 4DR6Q 1OXUA 3NENA 4ILWA 2K04A 3K80C 3EIVA 5DM73 4O1NA 1KIXA 5C4XG 4HIMA 1SYDA 2ZTEA 1W2BA 2PQAA 1HTPA 1A8VA 4RWSC 1C0AA 2EJFC 1K83H 1EY4A 3K7UC 3T16A 1BO0A 3H0GH 1O78A 3PV0A 1FGBD 3FKIH 5J39A 1ZEQX 2HDLA 5EPKA 1G51A 4DAMA 1YNJC 2UUBL 4LF5L 3TREA 1PYBA 3WWVA 2PNHA 1D1KA 1KXLA 3J7YW 2PZWA 2AKWB 3NTIA 3S1NH 1IYUA 5GAHC 2K14A 3PO2B 4RMFA 4I7ZC 1S5DD 3A5ZB 4C56C 1I3QB 1YJNA 4PQXA 3PUWA 1N32Q 4DV2Q 4JYAL 5K5PA 2NVQH 1U5KA 4DR2Q 1Y1VG 5C4JB 3FPPA 1F9PA 1EY7A 1FYCA 1C8CA 1JB3A 1I6HB 3CCRA 4KD4A 5M3FG 3I4MB 4MTNA 2F03A 1IL2A 4DR7Q 1O80A 2K5HA 3GTJH 2EY2A 1CA6A 1STGA 1E24A 3T13A 3KF6B 2PZTA 1Q1EA 2GVAA 2QA4A 2WP8J 1J6QA 1ONLA 3I90A 3VR4A 4B3SQ 1BBWA 3BG3A 5FLXE 1Y8OB 2FMMA 4IUUA 4QIWB 1TWHB 1S5BD 1PH8A 1HNWL 2LSSA 2B2YA 2F3IA 2TSSA 4ZAIA 3BJUA 3S17B 1J9OA 2Y0SB 2TMPA 1QJOA 4QB4A 1TWFB 4LMQD 3NXWA 5FK9C 1I4PA 1EFWA 2NZOA 1E2VA 5T1IA 5IYCG 3JAMi 4A3EB 4DKAC 5GADC 4K5VA 4KY6A 3KF6A 1A2TA 3IFDA 5J22A 1PYWD 1K28A 2R92H 1AFPA 2DUDA 3BS1A 3L7ZC 2KA7A 5KYIA 3TP8A 1Q86C 2PZUA 4GKKL 4JW0A 4A3DG 5M5WB 4LFAL 3MAQA 4GOPB 1XMOL 2L5TA 1S5CD 4K5XA 3ND9A 2SNMA 1LTBD 3J81c 4FNFA 2K28A 5KEEA 1OXXK 3BVMA 4KHZA 4YWLA 4C3HH 4QIWE 2CQOA 4IOAA 1D6EC 3UDFA 1EOVA 1LV9A 4JPBW 1X54A 2RVLA 4YWMA 2WAQB 2Y0SE 2F0KA 1SE4A 2UU9Q 3C1EA 2L1BA 1CTMA 1KAAA 4UPAA 1B44D 3J80E 1VQKA 3K5OA 1GUSA 5M3MG 2ZT9C 1N32L 3G71A 3P75A 4NPSA 2AQ1B 4DV2L 4DNIA 3HOZG 4GOPA 2DGYA 4QMGA 3EBEA 4DR2L 5FLXL 3BZCA 3GTQB 1ASZA 1KNAA 4KK7A 5D3IB 2QW7A 4XT3B 4RGMA 4DV0Q 4EX5A 4JI6L 3F2UA 4DR7L 3S2DB 3PO2H 1D1IA 1BUVT 3KK7A 4H02A 2J7ZA 3PO3G 2HCIA 2UXDL 2F0TA 1I3QH 2YTVA 2UXBQ 1G291 4IZ8A 4L5QA 1KRSA 2QEXA 2WAQE 1I4RA 2F0QA 3I91A 2AQ3B 3I4NH 3C3LA 2FJ2A 3GTPB 4YY3L 2ZM6Q 2DN8A 3RLFA 1PH3A 1LT5D 3OW2A 2K03A 5KNDA 1I6HH 1ZYRC 3UE0A 3I4MH 4ULLA 2UXCL 1PRTC 2F4IA 5FLMG 5IGBA 3OSOA 1IKMA 3K0XA 1VMCA 2G5DA 1EFID 3HGBA 5HURA 4A3JG 3HOYB 2A8VA 2K01A 3SGIA 2K75A 2Z8LA 1K8GA 1E22A 1G2TA 5E4WC 1SDFA 5COYA 3RN5A 5I9OA 1IW7D 1TWHH 4A93B 1I4HA 3CD6A 3NWTA 4FP5D 2H1EA 1HUMA 1PTOD 2VZAA 2WB1G 3J80L 1T5EA 2GVBA 2RBMA 3S17H 4B3MQ 4PNYA 1RCVD 2PW5A 3AB9A 3H94A 3IAYA 2LS01 1CFMA 4XTCS 1DOLA 4F8MA 1S5ED 4BXXH 4APVA 1QCBD 1SNDA 4UP8A 5IGCA 4IPCA 4A3GB 1A3TA 1AE2A 2D5DA 1VQOA 2QEJC 5CBAE 2KQ3A 4R4QA 3K5LA 3GDEA 3CF5A 3T51B 1JJGA 5CV6A 4IPHA 2B2YC 5M5WH 4TVAB 4ZK9B 2JK8A 1WTPA 1HNZL 4YIJA 1D2BA 4J6HA 2R3ZA 3BZDB 5C44B 3J7AV 1JT8A 5IP9G 4GLVB 4NW2A 5IGGA 5C0XJ 4DV0L 1K0RA 4ZRZA 1VQPA 3LGJA 5DNFA 3P20A 4DR4Q 2R6GA 1QG7A 3V05A 3PIOA 1FVIA 1XNRQ 1MKHA 5C5LA 1SMXA 2KVMA 2Q2HA 3SK5A 2NVYB 1L0YB 1SE2A 3AFQA 2EXDA 2JA7B 4KKSA 1K9MC 1EIGA 1YITA 1T9HA 5BN3A 3NPPA 1WVLA 4X3SA 2K52A 1GHJA 2NUCA 4JV5L 1LTGD 1B50A 3FPUB 2OQ0A 4DV5Q 2GN5A 1TXYA 1MSHA 3TN2A 3I56A 1ZKOA 1EQVA 5T1GA 4R1JA 4RAUC 2Z4IA 5CMDA 2UUCL 4A3BG 4CKEA 4KN7C 1GJXA 2N3SA 3H91A 3T56B 1M8AA 2RF4A 1JMCA 3VYUA 5ISRA 3CC7A 1VF5C 1YJ9A 2NVTB 1NTGA 4Y52H 4POFA 1CSPA 3IRBA 3GTPH 3HOVB 4RH6A 4DV6Q 1ESRA 2NN6I 3SVMA 1LUZA 1OXVA 3D0FA 4C1NK 3L0OA 2BA0A 1PDQA 4DR3L 1EQTA 1PFMA 1EQRA 3S1MH 2N78A 2JA8H 4RCOA 5IY0A 1MJEA 1MHWC 3I55A 3QJYA 1PH4A 2A6ED 1S40A 1PZKD 1WJJA 2G9HD 4NMZA 5FLXc 1F2YA 1QILA 4KHPQ 5JJZA 1TT2A 2QCPX 3EFXD 3J81i 4LUVA 1GVPA 3S14B 3K7AH 1Q12A 2F0HA 1KTKA 4QJFA 1EY9A 1TS3A 1ML0D 2Z9HA 4KJOA 2IWHA 1FGUA 1SRUA 5JJIA 1CQVA 2JQOA 1Q7YC 1NR4A 5EPLA 4QQBX 1JORA 2OF1A 3NK9A 1YHQA 4CDEC 1L0WA 3W1GA 3CCUA 3HOVH 3KDFB 3U50C 4P73A 4A3GH 2EZVA 2KBNA 3H09A 1PXUA 1QVGA 3TDQA 5EKIA 1XNRL 2E5LL 2L11A 2QF7A 3L9AX 1S4ZA 4ZCKA 3GD7A 1SBBB 3I3CA 1KDBA 3ULLA 1STHA 3OOCA 2CKZB 4C3IG 5I6YA 1WOCA 2BOSA 2KOLA 2B2WA 1YBYA 3CXCA 4DV5L 5C44H 3ERSX 2N8NA 4CKBA 2M9VA 3J81j 1KNEA 4CBVA 1RF2D 4A3IB 1WI5A 2E2HB 2EIFA 1EEID 1ENCA 3J80c 1L0XB 2F0JA 1Q8KA 1F2MA 2Y0SG 3ICEA 1V1PB 3KOJA 4RGOS 2AQ2B 2EXZA 2JEAI 1XX8A 4HJAA 1PLFA 1XMQL 2RDGA 4KHVA 4RKBA 4CDDC 2ZTDA 1SXTA 2YYZA 4A3EG 1I4GA 1BCPB 3M4YA 1SLJA 5EPJA 4A3KG 1RIPA 4P74A 3PQIA 1IBKL 3M85A 4DNRB 3BDLA 4IURA 3RNUA 1PTOH 1O7IA 4IOCA 2ZXRA 1R4PB 4HAEA 2ZJQA 3HOWH 5C3EH 5JJLA 4DFAA 3Q22A 4HCSA 4ODGA 1V1PA 4KHPL 1RTNA 4I7AA 1QE6A 4PV1C 1CHQD 3RD4A 2NVTH 4RA8A 4IJLA 2E2JH 1AP0A 3QIAA 5ELBA 2RKSA 3S16H 4JI5L 5JAVA 1MBYA 1HXYD 5HGTA 1F77A 4NB3A 1UE7A 5JJKA 1HRJA 1XXGA 2OEOA 4PMBA 3HOXG 4OO1H 3TEHB 1OXSC 1RODA 2VUMH 1ZXTA 2K4KA 3ULJA 4A76A 1JWUD 3DHQA 1SYBA 3H0GB 2WIIB 2EYFA 1JOQA 3U58A 2Z4HA 2F52A 3N6RA 2KCNA 1RTOA 5DM63 4K5WA 3S14H 2Z6KA 4OO1I 1UE5A 3GTGB 2YTYA 2RCNA 2I5LX 3I7FA 4A75A 3SK6A 4YCWA 3SK8A 1XNQQ 3T53B 2AHOB 1JR0D 4X62L 1IW7C 3MVVA 3GTMH 5LMNW 1YNND 3S1NB 1PTOC 1C9OA 5JPNC 3E9HA 1V1QA 2ICEC 1BVSA 4OXPA 2MFIA 3V96A 4MN3A 4OGQC 1YNXA 3A7AB 4EQPA 2WINB 2EJGC 4OHJA 2YV5A 4UY8C 1IYVA 2AUKA 5AJ3Q 2I0QA 2NVQB 1E7ZA 1X3EA 3QOJA 3HOUG 3S2HB 3V2TA 3MEFA 1VQAA 1VDZA 4K8IA 1SAPA 2XGTA 2K5QA 1E3PA 2CQAA 3K0YA 3HOYG 2RSOA 4P2CB 4JBMA 4A3FH 4DR5Q 3ULPA 5ELFA 4ZKCB 1Z7TA 3HZXA 2D2CC 4JI3L 1LACA 4QUCA 2B2VA 3GTJB 1STEA 2IW3A 1N33L 4A93G 4QUFA 4EQOA 1PH9A 1HFGA 4AH6A 2HIXA 2L0CA 3H3VI 2HHHL 4LFBQ 4JYAQ 1TIID 2OT2A 2SNSA 4DNTB 1LLRD 1SNPA 4MIUA 2RCFA 1TU2B 5IGFA 4PG3A 1QOHA 4K8JA 3NTHA 5C0XH 1ET9A 2LFNA 1HZCA 4JI0L 2F1MA 2KEEA 5TSSA 1XYIA 4XYOA 1F9RA 3TS0A 4TRDA 2MP1A 2PQAB 2EYHA 1SROA 5C0XI 1LT3D 4H0LC 3HKZG 3WDNA 3TZUA 2A5HA 1HNWQ 1NR2A 1BDOA 1R4QB 3J7AF 3VYRA 1ESFA 1SYFA 4B9WA 3UDGA 1BKBA 2B63B 1QZHA 1QVFA 4Y7NB 2R7DA 4PZ8A 4JG2A 4Q0FA 1NMFA 1WCMH 4K2LA 4C3HB 1JB7A 1Q90A 1XNQL 1Y8PB 3A0JA 3VYSA 1PRTB 2NZHA 4GKJL 3D6WA 3Q8DA 2WKDA 5AFWA 2JA7G 2ZJPA 1L1OC 1K8OA 2EPBA 2EYJA 3MXNB 2R7ZH 3KLRA 3DWPA 4GKKQ 1WTRA 4WRDA 1A0IA 4LFAQ 5AJ3L 4LF9L 1XMOQ 1WYDA 2Q8IB 1B4OA 4B9XA 3GTGH 2A6EC 2DNEA 5FKAC 1BCPC 4IN3A 4R4OA 4CDCC 2B8FA 4BA1I 5EKKA 3J80i 1B9MA 4JCVE 3NBIA 2F4VQ 3ERQA 1PFSA 1IZ6A 4LF8Q 4DR5L 1B70B 2VY3A 2MJ8A 3U9SA 1YI2A 2C35B 3A74A 4KV6A 3MXNA 1DD2A 2ENBA 3D8GA 2VQEL 4JOIA 4LFBL 3KLSX 4LFCL 2A68D 1EYDA 1IL8A 2ICIA 1X55A 3I4NB 4KMUC 2MNAA 1I5FA 2Z6KC 3S2HH 2F0LA 1C4QA 3KBGA 4AYBB 1WTVA 2EYMA 5IP7H 1DGSA 4JI6Q 2KECA 3VR2A 4B3RQ 5L37A 4BBSH 4P71A 1P8LA 1SNOA 1Y1WG 2UXDQ 5JEAG 4HTHA 1V43A 1AH9A 2DY7A 3TSSA 4E6IA 1SE8A 2F0UA 1VQNA 2JA5B 1M90C 2HQEA 1B8AA 1X9NA 1VCIA 1N36L 1HHVA 4L5TA 2OTJA 2I46A 4YY3Q 1SJHD 2MQHA 3RZDB 1KQSA 3D3RA 3I72A 4IFDJ 3HP3A 2UXCQ 5BN5A 3EROA 4L6TB 5K36H 5IT9E 4OELB 2B2VC 5G3LF 2FHTA 2BDOA 4AYBE 1PV4A 1MD2D 4NXML 2XNAC 5BN4A 4ALPA 2JP1A 3CCMA 2QDLA 3NUCA 1UAPA 3Q0AA 4A3IG 1BF4A 2I07B 1U4PA 2JYOA 4HEDA 3T4AC 5LL6X 1SYGA 2B63H 1TWGH 3TRZA 4Y7NH 3R93A 1LTSD 2CW0D 1D5MC 1YJWA 2Q2IA 4FVMA 2RA4A 2F4VL 2BE5C 3VDYA 2K5VA 1HA6A 3NE5B 4IJHA 4LF8L 1TKWB 1MGSA 1EWHA 2Z6BA 2L12A 2X6LA 5C5MA 4A3LG 3PIO3 1PMRA 1XTDA 2O5JC 4HN7A 4UDUC 1HNZQ 3X3MA 1HR0W 4NDXA 1IKLA 3KYHC 1RDPD 3G6EA 3UDIA 4X6AH 1AZPA 1K3RA 4L8JA 3QG1A 3FVQA 1B3QA 2E76C 3LWEA 4JC0A 4B3RL 1LTTD 1K3BC 5FJ8G 2KCTA 3W2DA 3KLSA 4BBRG 4L5RC 2CHBD 1EQQA 4LF6L 1KRTA 3UE1A 1VQLA 5IT9L 2R93B 1I4QA 3NEMA 3CC2A 1H95A 1EOTA 1CSQA 1V1OA 4DUZL 4K6DA 4JV5Q 1L2FA 1G6ZA 3NQTA 1J5EL 3RLOA 1GKHA 1LT4D 5C6AA 5I2YA 3NWSA 2HCCA 2VXWA 1NY4A 1NNXA 3S1MB 3CU7A 2UUCQ 4A3MB 2JA8B 4KY5A 4I65A 4GN5A 3H0GG 2XN9C 1D7QA 3FKIG 5EGTA 2IHFA 4N9TA 4LUOA 3K59A 3RZOB 3QR8A 2PYKA 1VMPA 1JOOA 4JOIC 2JA5H 2VB2X 5GAEC 1HCZA 2JA6B 5I6WA 2CCZA 3CHBD 5HGQA 3O13A 3WOFA 3K7AB 3RZDH 3JC66 2B3GA 3Q23A 2A1AA 4DR3Q 2EOTA 4YCUA 2K7VA 2NTSA 3CPFA 2CWAA 4K6LA 3PUZA 1CT1D 5FOBB 1ICWA 1N8RC 3AEVA 4LWCA 5CV9A 3EJIA 2N49A 2JXMB 1O7YA
chains in the Genus database with same CATH topology
1X56A 1A62A 2BH8A 1HZBA 3GD7A 5ELNA 4A3IH 3HFZB 4JI2L 4HJ7A 3ULLA 5IP9H 2E2HH 1YVCA 2CKZB 3H15A 1IBML 2IHEA 1WOCA 1YHAA 4JBJA 3GO5A 4O2DA 3AFPA 1YBYA 3CXCA 4DV3L 3F8TA 4DV5L 5C44H 3ERSX 2A19A 2N8NA 3J81j 1S72A 4LF4L 4L5SA 1QVCA 1XJVA 4POGA 1WI5A 1OTCA 5LMNL 1N34L 1JE5A 2L15A 3CCSA 1X65A 2Q2TA 2ATWA 2EIFA 2MO0A 1X6OA 3J80c 3PUVA 1S3OA 4A3FG 4IFDG 4OWTB 1Q8KA 1Q81C 3W5OA 1A63A 4DR6L 4EQ5A 2Y0SG 4A3LH 2I5HA 2I5MX 1XPOA 1KAWA 4MNOA 1PH1A 4YCVA 3ICEA 3TQYA 3KOJA 2ID0A 5DLQE 1W3SA 2JEAI 4JI8L 4A3CH 4HJAA 3T1HL 1XMQL 4AQYL 1VQ6A 2E5LQ 4JBKA 2ZTDA 1UE1A 4B3TL 2YYZA 4UP9A 4J15A 4A3EG 1VQMA 3GTOH 1BBUA 4A3BH 1KHIA 4LW1A 4ME3A 1PH6A 1SLJA 2JEBI 4GN4B 3CMEA 4DV7L 1RIPA 1Z9FA 4P74A 4A3KG 1Q82C 1VQ7A 3KFUA 1IBKL 3M85A 3F1ZA 4X65Q 1CUKA 3PF5A 1EIFA 1HJPA 3RNUA 5IWAL 3DLLA 1O7IA 5C0XG 1CKNB 4IOCA 4LF4Q 1B7YB 1KL9A 1PH2A 2ZJQA 3HOWH 3J7A5 4YHHL 5FJ8H 2K5NA 2R92G 1LYLA 1N34Q 2QGQA 5C3EH 4BBRH 4LF7L 1WFQA 2AMCB 5JJLA 3CCVA 2PMZE 5ELOA 1NMGA 3UDXA 1HNXL 2CWPA 2UUAL 3M4OH 4KHPL 3PSIA 2KENA 4HJ9A 2NVTH 4JI4Q 2MO1A 4DR6Q 1OXUA 4IJLA 3NENA 4DV1L 2E2JH 2AWOA 1PH5A 3K80C 2R93H 3S16H 4JI5L 3EIVA 5EAYA 3S1RH 3PF4A 1KIXA 4JI8Q 1Y14B 5C4XG 1XMQQ 4HIMA 1W2BA 2ZTEA 2PQAA 2H5XA 3AQQA 4GN3B 4NB3A 1UE7A 1A8VA 5IYDH 4PZ7A 1C0AA 1K83H 5JJKA 1NJIC 1IXRA 3K7UC 4DV7Q 3H0GH 1CKNA 4DK3C 1WCMG 3HOXG 1IBKQ 3PV0A 3TEHB 1OXTA 1OXSC 3FKIH 4A3MH 2VUMH 4C3JH 2K4KA 1PHJA 1G51A 3ULJA 2R7FA 4A76A 3CC4A 1LM0A 4DAMA 2UUBL 3U58A 4LF5L 3TREA 1PYBA 3WWVA 2F52A 2PNHA 4KI0A 1KXLA 4KLKA 2R7ZG 3STBC 3RZOH 1UE6A 2OTLA 2Z6KA 3S14H 1UE5A 2AKWB 2VS1A 4OO1I 2YTYA 4LNQA 2RCNA 2I5LX 3E0EA 4GLAC 3I7FA 3S1NH 5GAHC 2K14A 4A75A 4X66Q 4RMFA 4YCWA 1KC8C 4B3SL 1XNQQ 2JA6H 4WJ4A 2AHOB 1FJGQ 3A5ZB 1M1KC 2YU9H 2ES2A 4X62L 4JI5Q 1EYGA 1YJNA 5C4JH 3CCLA 3GTMH 3PUWA 1N32Q 3PO2G 5LMNW 4BY1H 1EIYB 1SN8A 4DV2Q 1C9OA 2CFMA 4JYAL 3AYHB 4QY7A 3E9HA 2E8GA 5JEAJ 5IYBH 4GNXB 2NVQH 1U5KA 5IT9c 1V1QA 3M9BA 1BVSA 1HR0L 4OXPA 3PCOB 2MFIA 4LUZA 1Y1VG 4DR2Q 1YNXA 4GS3A 4C3IH 2YV5A 3RLNA 4HIOA 4UY8C 1GO3E 5H1SE 5AJ3Q 2I0QA 3S24A 3I4NG 1E7ZA 4TQUS 1X3EA 3CCRA 5M3FG 2IX1A 3HOUG 4MTNA 2PI2A 1IL2A 4DR7Q 3MEFA 1VQAA 2K5HA 3GTJH 1VQ8A 2XGTA 1E24A 1E3PA 3KF6B 3HOYG 3I4MG 4JBMA 4A3FH 2JA9A 1Q1EA 4DR5Q 2GVAA 3F2DA 2QA4A 3ULPA 2WP8J 3G48A 1J6QA 4X65L 2PI2E 4JI3L 3BU2A 4B3SQ 1BBWA 3BZKA 1K8AC 1N33L 5IP7G 4A93G 4GNXA 1TWFH 4X62Q 1PH9A 1PH8A 2OWOA 1HNWL 2LSSA 4BBSG 2F3IA 4AH6A 1V9PA 2HIXA 3BJUA 3H3VI 5GQOA 2HHHL 5J3BA 4LFBQ 4AIMA 2JJQA 4JYAQ 4IFDI 4A3EH 1L1OB 3CP0A 4IPDA 1HR0Q 3CQZH 3RR5A 4A3KH 3L2PA 1UEBA 4JI4L 2UU9L 1N9WA 5IE8A 3B6YA 1EFWA 2NZOA 3J7ZC 5IYCG 3JAMi 1YZ6A 4PG3A 4DKAC 4RG1A 5GADC 2Z0SA 3CAMA 3KF6A 4GNXC 1HZCA 4DAYB 4JI0L 4BY7G 1SR3A 2R92H 2DUDA 1UWVA 3L7ZC 3TS0A 1VQCA 4BXXG 1Q86C 4NXNL 4GKKL 2PQAB 1SROA 2V1CC 1Z47A 2RHQB 5C0XI 1TWAH 2Q2UA 4JI3Q 4A3DG 4LFAL 1E1TA 1VQ5A 4GOPB 3EN2A 1XMOL 1N33Q 5K36G 1X3FA 3HKZG 4UP7A 1MIUA 3K81C 3I2ZA 4QL5A 4DPGA 1L1OA 3J81c 1XPUA 1HNWQ 1OXXK 2D62A 4KHZA 4YWLA 4C3HH 5C4XH 4QIWE 2CQOA 3OTOL 2HHHQ 4IOAA 3UDFA 2HQLA 1EOVA 1X54A 4YWMA 1BKBA 3UDGA 2UXBL 1QZHA 1QVFA 2Y0SE 2IT1A 2R7DA 4PZ6A 1VQHA 4JBWA 4JG2A 4PZ8A 4R4CA 2UU9Q 1NMFA 1WCMH 3HOXH 3FHWA 4X66L 1JB7A 1XNQL 3A0JA 1FJGL 2B29A 3PUYA 4UPAA 2NZHA 4GKJL 4IO9A 2ZJRA 1IBLL 2B63G 2WAQG 3Q8DA 1VQKA 1EWIA 2JA7G 3FP9A 5M3MG 1E1OA 2ZJPA 3GTQH 4JI0Q 1N32L 5E7NA 2ZM6L 3G71A 4NPSA 1L1OC 4DV2L 3I4OA 4DNIA 3HOZG 2D0OA 3MXNB 4GOPA 2BH2A 2R7ZH 1I50H 2DGYA 4NXNQ 3EBEA 3PGZA 5BR8Q 4DR2L 3BZCA 4GKKQ 3S2DH 1VQJA 1ASZA 4QGUA 3HKZE 1A0IA 4LFAQ 5AJ3L 4BA2I 4LF9L 1XMOQ 1WYDA 2K50A 4EX5A 4DV0Q 4JI6L 1NE3A 3GTGH 4WJ3M 1JJ2A 5LMUQ 2OQKA 1HH2P 4DR7L 3PO2H 4R4OA 2KHIA 1P16A 3OTOQ 4H02A 4BA1I 4R4IA 3PO3G 3J80i 2UXDL 4JCVE 2F4VQ 1CKOA 1I3QH 1PFSA 2YTVA 2UXBQ 1IZ6A 4LF8Q 4DR5L 1G291 4GOPC 2KCMA 4L5QA 2E2IH 1KRSA 2QEXA 1B70B 2WAQE 2VY3A 4B3ML 1FL0A 1QZGA 4OWXB 2IX0A 1YI2A 2C35B 4OONA 4GKJQ 3ER0A 1VQIA 3F2CA 1IBLQ 3I4NH 3A74A 2R93G 2VQEL 3M4PA 5M3FH 3JAMc 4YY3L 3HOUH 2ZM6Q 2FXQA 4JOIA 3RLFA 1PH3A 1Q46A 4DR1Q 4LFBL 4LFCL 3OW2A 3PUXA 1I6HH 3UE0A 1MJCA 1X55A 5IYDG 3HOYH 3I4MH 2UXCL 2MNAA 1R9TH 1I5FA 2Z6KC 4HJ5A 5FLMG 1HZ9A 3S2HH 1QUQB 2AWNA 4K0KQ 1IYJB 3STBD 1PA6A 3K0XA 4LF9Q 4GLXA 2JA8G 4JI6Q 5IP7H 4A93H 1DGSA 4A3JG 1K73C 1I94L 4B3RQ 2A8VA 3G4SA 4BBSH 4P71A 3E9IA 3SGIA 2K75A 1K8GA 1P8LA 1E22A 1JJCB 4XIGS 4AYBG 1Y1WG 1CKMA 3RN5A 2UXDQ 1TWHH 3H3VH 2NVXH 5GAGC 3CD6A 5JEAG 2VZAA 1V43A 2WB1G 1AH9A 2GVBA 3S17H 1SE8A 4B3MQ 1VQNA 1TWCH 2JA6G 3CCEA 5IYCH 1M90C 3KLWA 4JI7L 1B8AA 2WFWA 1X9NA 1VCIA 2VW9A 1PVOA 1N36L 2ALYB 1VQFA 4L5TA 2VQEQ 4DR4L 2OTJA 4YY3Q 2MQHA 4C2MH 2JA5G 3U4ZA 1KQSA 3D31A 4LFCQ 1QUQA 4XTCS 5IYBG 4IFDJ 1Q1BA 1VS0A 4BXXH 4APVA 2UXCQ 4UP8A 4IPCA 1AE2A 3T1YQ 4O0AA 1VQOA 1PH7A 4A3DH 3HOVG 4A4IA 2HIVA 4R4QA 1JJGA 3NBHB 3GDEA 3CF5A 1NBWA 4A3GG 3GTKH 4AYBE 1I94Q 4DUYQ 4IPHA 1PV4A 1VQBA 4NXML 4PMWA 5M5WH 4TVAB 2JK8A 1HNZL 2WB1E 4ALPA 4DK6C 3CCMA 3HKSA 3K8AA 3CW2C 5BR8L 3KDFA 2IY5B 4A3IG 1JT8A 4X64Q 5IP9G 3GTLH 4GLVB 1C7YA 3W1BA 1HZAA 5C0XJ 4DV0L 1GD7A 1K0RA 2NVYH 2LXKA 1VQPA 4JI7Q 2B63H 1TWGH 3LGJA 4MZ9A 4Y7NH 4OX9Q 1N36Q 5C44G 3TRZA 5LMUL 5M3MH 2JA7H 4DR4Q 2R6GA 2EQSA 4JI1Q 3PIOA 1FVIA 1YJWA 3ZJYC 2Q2IA 3KJOA 1XNRQ 1RL2A 1MKHA 3HOZH 1SMXA 2Q2HA 2F4VL 3VDYA 1YHBA 2K5VA 4R4TA 4IPGA 4IJHA 4LF8L 2VNUD 3AFQA 2EXDA 2RHSB 4DV6L 1K9MC 5M5XH 1YITA 1T9HA 4JI2Q 2K52A 3M4QA 1IBMQ 4A3LG 1ASYA 4JV5L 1XTDA 2OQ0A 4DV3Q 3A5UA 4DV5Q 4P75A 3CMAA 1KD1C 1EUJA 2GN5A 3S1QH 3CPWA 4A3CG 1TXYA 3NELA 1VQGA 3I56A 4DR1L 4NXMQ 5LMNQ 4FDBA 4R1JA 1HNZQ 2UUCL 3PO3H 1HR0W 4A3BG 5M5YH 4DV4L 2BA1A 1VQEA 3DM3A 3KYHC 3G6EA 3UDIA 1X3GA 4K0KL 1VQ9A 4X6AH 1U0LA 2JE6I 3KF8B 1K3RA 1AE3A 2N3SA 3RN2A 4JC0A 2RF4A 2VQFL 1JMCA 3CC7A 2YTXA 4B3RL 3HOWG 4YWKA 2KHJA 5FJ8G 1YJ9A 3T1HQ 2KCTA 4AQYQ 5C3EG 1NTGA 4BBRG 1GM5A 1EQQA 4B3TQ 4L5RC 4Y52H 4POFA 1CSPA 4LF6L 3IRBA 1KRTA 3UE1A 1D8LA 1VQLA 3GTPH 3F2BA 4DV6Q 3NEMA 1Y1VH 2NN6I 4HIKA 1LUZA 1OXVA 3D0FA 5FLMH 3L0OA 3CC2A 1H95A 3M3YH 2BA0A 1CSQA 4DR3L 2NN6G 3CCQA 1EQRA 4DUZL 1VQ4A 3S1MH 2N78A 4JV5Q 1L2FA 2JA8H 4A3JH 5IY0A 1J5EL 5IWAQ 3RLOA 1MJEA 2XTIA 3S15H 2VL6A 1GKHA 1G6PA 4YHHQ 3OYYA 3I55A 1NY4A 1PH4A 1LTLA 1Y1WH 1S40A 2UUCQ 4LF7Q 1WJJA 4OWWB 4DV4Q 2OCEA 4GN5A 5FLXc 2UUAQ 1HNXQ 3H0GG 4KHPQ 3T1YL 5GROA 1D7QA 4OO1G 3FKIG 3U4VA 4A3MG 2VUMG 4DV1Q 2IHFA 3J81i 4LUVA 1GVPA 3TS2A 4LUOA 2VQFQ 4DUYL 3K7AH 1Q12A 4P72A 4QJFA 3CCJA 2JA5H 4JOIC 2ZTCA 1VQDA 5GAEC 1FGUA 2CCZA 2D0PA 1SRUA 5JJIA 1YIJA 2JQOA 1Q7YC 4LF6Q 5HGQA 1PYSB 1YEZA 4HJ8A 4X64L 3RZDH 4QQBX 3JC66 2B3GA 2A1AA 1YHQA 2LXJA 4DR3Q 4YCUA 1L0WA 3W1GA 3CCUA 4DUZQ 1XPRA 3HOVH 3KDFB 3U50C 4P73A 4OX9L 1SFOH 1J5EQ 3CPFA 2CWAA 2KBNA 1QVGA 4A3GH 4JI1L 3PUZA 4BY7H 3M7NA 4HIDA 4BY1G 1N8RC 5HY6A 3KJPA 1XNRL 2E5LL 2UUBQ 2ASBA 4LWCA 4LF5Q 3AEVA 2N49A 3PIPA 2HT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X56 A;  1A62 A;  2BH8 A;  1HZB A;  3GD7 A;  5ELN A;  4A3I H;  3HFZ B;  4JI2 L;  4HJ7 A;  3ULL A;  5IP9 H;  2E2H H;  1YVC A;  2CKZ B;  3H15 A;  1IBM L;  2IHE A;  1WOC A;  1YHA A;  4JBJ A;  3GO5 A;  4O2D A;  3AFP A;  1YBY A;  3CXC A;  4DV3 L;  3F8T A;  4DV5 L;  5C44 H;  3ERS X;  2A19 A;  2N8N A;  3J81 j;  1S72 A;  4LF4 L;  4L5S A;  1QVC A;  1XJV A;  4POG A;  1WI5 A;  1OTC A;  5LMN L;  1N34 L;  1JE5 A;  2L15 A;  3CCS A;  1X65 A;  2Q2T A;  2ATW A;  2EIF A;  2MO0 A;  1X6O A;  3J80 c;  3PUV A;  1S3O A;  4A3F G;  4IFD G;  4OWT B;  1Q8K A;  1Q81 C;  3W5O A;  1A63 A;  4DR6 L;  4EQ5 A;  2Y0S G;  4A3L H;  2I5H A;  2I5M X;  1XPO A;  1KAW A;  4MNO A;  1PH1 A;  4YCV A;  3ICE A;  3TQY A;  3KOJ A;  2ID0 A;  5DLQ E;  1W3S A;  2JEA I;  4JI8 L;  4A3C H;  4HJA A;  3T1H L;  1XMQ L;  4AQY L;  1VQ6 A;  2E5L Q;  4JBK A;  2ZTD A;  1UE1 A;  4B3T L;  2YYZ A;  4UP9 A;  4J15 A;  4A3E G;  1VQM A;  3GTO H;  1BBU A;  4A3B H;  1KHI A;  4LW1 A;  4ME3 A;  1PH6 A;  1SLJ A;  2JEB I;  4GN4 B;  3CME A;  4DV7 L;  1RIP A;  1Z9F A;  4P74 A;  4A3K G;  1Q82 C;  1VQ7 A;  3KFU A;  1IBK L;  3M85 A;  3F1Z A;  4X65 Q;  1CUK A;  3PF5 A;  1EIF A;  1HJP A;  3RNU A;  5IWA L;  3DLL A;  1O7I A;  5C0X G;  1CKN B;  4IOC A;  4LF4 Q;  1B7Y B;  1KL9 A;  1PH2 A;  2ZJQ A;  3HOW H;  3J7A 5;  4YHH L;  5FJ8 H;  2K5N A;  2R92 G;  1LYL A;  1N34 Q;  2QGQ A;  5C3E H;  4BBR H;  4LF7 L;  1WFQ A;  2AMC B;  5JJL A;  3CCV A;  2PMZ E;  5ELO A;  1NMG A;  3UDX A;  1HNX L;  2CWP A;  2UUA L;  3M4O H;  4KHP L;  3PSI A;  2KEN A;  4HJ9 A;  2NVT H;  4JI4 Q;  2MO1 A;  4DR6 Q;  1OXU A;  4IJL A;  3NEN A;  4DV1 L;  2E2J H;  2AWO A;  1PH5 A;  3K80 C;  2R93 H;  3S16 H;  4JI5 L;  3EIV A;  5EAY A;  3S1R H;  3PF4 A;  1KIX A;  4JI8 Q;  1Y14 B;  5C4X G;  1XMQ Q;  4HIM A;  1W2B A;  2ZTE A;  2PQA A;  2H5X A;  3AQQ A;  4GN3 B;  4NB3 A;  1UE7 A;  1A8V A;  5IYD H;  4PZ7 A;  1C0A A;  1K83 H;  5JJK A;  1NJI C;  1IXR A;  3K7U C;  4DV7 Q;  3H0G H;  1CKN A;  4DK3 C;  1WCM G;  3HOX G;  1IBK Q;  3PV0 A;  3TEH B;  1OXT A;  1OXS C;  3FKI H;  4A3M H;  2VUM H;  4C3J H;  2K4K A;  1PHJ A;  1G51 A;  3ULJ A;  2R7F A;  4A76 A;  3CC4 A;  1LM0 A;  4DAM A;  2UUB L;  3U58 A;  4LF5 L;  3TRE A;  1PYB A;  3WWV A;  2F52 A;  2PNH A;  4KI0 A;  1KXL A;  4KLK A;  2R7Z G;  3STB C;  3RZO H;  1UE6 A;  2OTL A;  2Z6K A;  3S14 H;  1UE5 A;  2AKW B;  2VS1 A;  4OO1 I;  2YTY A;  4LNQ A;  2RCN A;  2I5L X;  3E0E A;  4GLA C;  3I7F A;  3S1N H;  5GAH C;  2K14 A;  4A75 A;  4X66 Q;  4RMF A;  4YCW A;  1KC8 C;  4B3S L;  1XNQ Q;  2JA6 H;  4WJ4 A;  2AHO B;  1FJG Q;  3A5Z B;  1M1K C;  2YU9 H;  2ES2 A;  4X62 L;  4JI5 Q;  1EYG A;  1YJN A;  5C4J H;  3CCL A;  3GTM H;  3PUW A;  1N32 Q;  3PO2 G;  5LMN W;  4BY1 H;  1EIY B;  1SN8 A;  4DV2 Q;  1C9O A;  2CFM A;  4JYA L;  3AYH B;  4QY7 A;  3E9H A;  2E8G A;  5JEA J;  5IYB H;  4GNX B;  2NVQ H;  1U5K A;  5IT9 c;  1V1Q A;  3M9B A;  1BVS A;  1HR0 L;  4OXP A;  3PCO B;  2MFI A;  4LUZ A;  1Y1V G;  4DR2 Q;  1YNX A;  4GS3 A;  4C3I H;  2YV5 A;  3RLN A;  4HIO A;  4UY8 C;  1GO3 E;  5H1S E;  5AJ3 Q;  2I0Q A;  3S24 A;  3I4N G;  1E7Z A;  4TQU S;  1X3E A;  3CCR A;  5M3F G;  2IX1 A;  3HOU G;  4MTN A;  2PI2 A;  1IL2 A;  4DR7 Q;  3MEF A;  1VQA A;  2K5H A;  3GTJ H;  1VQ8 A;  2XGT A;  1E24 A;  1E3P A;  3KF6 B;  3HOY G;  3I4M G;  4JBM A;  4A3F H;  2JA9 A;  1Q1E A;  4DR5 Q;  2GVA A;  3F2D A;  2QA4 A;  3ULP A;  2WP8 J;  3G48 A;  1J6Q A;  4X65 L;  2PI2 E;  4JI3 L;  3BU2 A;  4B3S Q;  1BBW A;  3BZK A;  1K8A C;  1N33 L;  5IP7 G;  4A93 G;  4GNX A;  1TWF H;  4X62 Q;  1PH9 A;  1PH8 A;  2OWO A;  1HNW L;  2LSS A;  4BBS G;  2F3I A;  4AH6 A;  1V9P A;  2HIX A;  3BJU A;  3H3V I;  5GQO A;  2HHH L;  5J3B A;  4LFB Q;  4AIM A;  2JJQ A;  4JYA Q;  4IFD I;  4A3E H;  1L1O B;  3CP0 A;  4IPD A;  1HR0 Q;  3CQZ H;  3RR5 A;  4A3K H;  3L2P A;  1UEB A;  4JI4 L;  2UU9 L;  1N9W A;  5IE8 A;  3B6Y A;  1EFW A;  2NZO A;  3J7Z C;  5IYC G;  3JAM i;  1YZ6 A;  4PG3 A;  4DKA C;  4RG1 A;  5GAD C;  2Z0S A;  3CAM A;  3KF6 A;  4GNX C;  1HZC A;  4DAY B;  4JI0 L;  4BY7 G;  1SR3 A;  2R92 H;  2DUD A;  1UWV A;  3L7Z C;  3TS0 A;  1VQC A;  4BXX G;  1Q86 C;  4NXN L;  4GKK L;  2PQA B;  1SRO A;  2V1C C;  1Z47 A;  2RHQ B;  5C0X I;  1TWA H;  2Q2U A;  4JI3 Q;  4A3D G;  4LFA L;  1E1T A;  1VQ5 A;  4GOP B;  3EN2 A;  1XMO L;  1N33 Q;  5K36 G;  1X3F A;  3HKZ G;  4UP7 A;  1MIU A;  3K81 C;  3I2Z A;  4QL5 A;  4DPG A;  1L1O A;  3J81 c;  1XPU A;  1HNW Q;  1OXX K;  2D62 A;  4KHZ A;  4YWL A;  4C3H H;  5C4X H;  4QIW E;  2CQO A;  3OTO L;  2HHH Q;  4IOA A;  3UDF A;  2HQL A;  1EOV A;  1X54 A;  4YWM A;  1BKB A;  3UDG A;  2UXB L;  1QZH A;  1QVF A;  2Y0S E;  2IT1 A;  2R7D A;  4PZ6 A;  1VQH A;  4JBW A;  4JG2 A;  4PZ8 A;  4R4C A;  2UU9 Q;  1NMF A;  1WCM H;  3HOX H;  3FHW A;  4X66 L;  1JB7 A;  1XNQ L;  3A0J A;  1FJG L;  2B29 A;  3PUY A;  4UPA A;  2NZH A;  4GKJ L;  4IO9 A;  2ZJR A;  1IBL L;  2B63 G;  2WAQ G;  3Q8D A;  1VQK A;  1EWI A;  2JA7 G;  3FP9 A;  5M3M G;  1E1O A;  2ZJP A;  3GTQ H;  4JI0 Q;  1N32 L;  5E7N A;  2ZM6 L;  3G71 A;  4NPS A;  1L1O C;  4DV2 L;  3I4O A;  4DNI A;  3HOZ G;  2D0O A;  3MXN B;  4GOP A;  2BH2 A;  2R7Z H;  1I50 H;  2DGY A;  4NXN Q;  3EBE A;  3PGZ A;  5BR8 Q;  4DR2 L;  3BZC A;  4GKK Q;  3S2D H;  1VQJ A;  1ASZ A;  4QGU A;  3HKZ E;  1A0I A;  4LFA Q;  5AJ3 L;  4BA2 I;  4LF9 L;  1XMO Q;  1WYD A;  2K50 A;  4EX5 A;  4DV0 Q;  4JI6 L;  1NE3 A;  3GTG H;  4WJ3 M;  1JJ2 A;  5LMU Q;  2OQK A;  1HH2 P;  4DR7 L;  3PO2 H;  4R4O A;  2KHI A;  1P16 A;  3OTO Q;  4H02 A;  4BA1 I;  4R4I A;  3PO3 G;  3J80 i;  2UXD L;  4JCV E;  2F4V Q;  1CKO A;  1I3Q H;  1PFS A;  2YTV A;  2UXB Q;  1IZ6 A;  4LF8 Q;  4DR5 L;  1G29 1;  4GOP C;  2KCM A;  4L5Q A;  2E2I H;  1KRS A;  2QEX A;  1B70 B;  2WAQ E;  2VY3 A;  4B3M L;  1FL0 A;  1QZG A;  4OWX B;  2IX0 A;  1YI2 A;  2C35 B;  4OON A;  4GKJ Q;  3ER0 A;  1VQI A;  3F2C A;  1IBL Q;  3I4N H;  3A74 A;  2R93 G;  2VQE L;  3M4P A;  5M3F H;  3JAM c;  4YY3 L;  3HOU H;  2ZM6 Q;  2FXQ A;  4JOI A;  3RLF A;  1PH3 A;  1Q46 A;  4DR1 Q;  4LFB L;  4LFC L;  3OW2 A;  3PUX A;  1I6H H;  3UE0 A;  1MJC A;  1X55 A;  5IYD G;  3HOY H;  3I4M H;  2UXC L;  2MNA A;  1R9T H;  1I5F A;  2Z6K C;  4HJ5 A;  5FLM G;  1HZ9 A;  3S2H H;  1QUQ B;  2AWN A;  4K0K Q;  1IYJ B;  3STB D;  1PA6 A;  3K0X A;  4LF9 Q;  4GLX A;  2JA8 G;  4JI6 Q;  5IP7 H;  4A93 H;  1DGS A;  4A3J G;  1K73 C;  1I94 L;  4B3R Q;  2A8V A;  3G4S A;  4BBS H;  4P71 A;  3E9I A;  3SGI A;  2K75 A;  1K8G A;  1P8L A;  1E22 A;  1JJC B;  4XIG S;  4AYB G;  1Y1W G;  1CKM A;  3RN5 A;  2UXD Q;  1TWH H;  3H3V H;  2NVX H;  5GAG C;  3CD6 A;  5JEA G;  2VZA A;  1V43 A;  2WB1 G;  1AH9 A;  2GVB A;  3S17 H;  1SE8 A;  4B3M Q;  1VQN A;  1TWC H;  2JA6 G;  3CCE A;  5IYC H;  1M90 C;  3KLW A;  4JI7 L;  1B8A A;  2WFW A;  1X9N A;  1VCI A;  2VW9 A;  1PVO A;  1N36 L;  2ALY B;  1VQF A;  4L5T A;  2VQE Q;  4DR4 L;  2OTJ A;  4YY3 Q;  2MQH A;  4C2M H;  2JA5 G;  3U4Z A;  1KQS A;  3D31 A;  4LFC Q;  1QUQ A;  4XTC S;  5IYB G;  4IFD J;  1Q1B A;  1VS0 A;  4BXX H;  4APV A;  2UXC Q;  4UP8 A;  4IPC A;  1AE2 A;  3T1Y Q;  4O0A A;  1VQO A;  1PH7 A;  4A3D H;  3HOV G;  4A4I A;  2HIV A;  4R4Q A;  1JJG A;  3NBH B;  3GDE A;  3CF5 A;  1NBW A;  4A3G G;  3GTK H;  4AYB E;  1I94 Q;  4DUY Q;  4IPH A;  1PV4 A;  1VQB A;  4NXM L;  4PMW A;  5M5W H;  4TVA B;  2JK8 A;  1HNZ L;  2WB1 E;  4ALP A;  4DK6 C;  3CCM A;  3HKS A;  3K8A A;  3CW2 C;  5BR8 L;  3KDF A;  2IY5 B;  4A3I G;  1JT8 A;  4X64 Q;  5IP9 G;  3GTL H;  4GLV B;  1C7Y A;  3W1B A;  1HZA A;  5C0X J;  4DV0 L;  1GD7 A;  1K0R A;  2NVY H;  2LXK A;  1VQP A;  4JI7 Q;  2B63 H;  1TWG H;  3LGJ A;  4MZ9 A;  4Y7N H;  4OX9 Q;  1N36 Q;  5C44 G;  3TRZ A;  5LMU L;  5M3M H;  2JA7 H;  4DR4 Q;  2R6G A;  2EQS A;  4JI1 Q;  3PIO A;  1FVI A;  1YJW A;  3ZJY C;  2Q2I A;  3KJO A;  1XNR Q;  1RL2 A;  1MKH A;  3HOZ H;  1SMX A;  2Q2H A;  2F4V L;  3VDY A;  1YHB A;  2K5V A;  4R4T A;  4IPG A;  4IJH A;  4LF8 L;  2VNU D;  3AFQ A;  2EXD A;  2RHS B;  4DV6 L;  1K9M C;  5M5X H;  1YIT A;  1T9H A;  4JI2 Q;  2K52 A;  3M4Q A;  1IBM Q;  4A3L G;  1ASY A;  4JV5 L;  1XTD A;  2OQ0 A;  4DV3 Q;  3A5U A;  4DV5 Q;  4P75 A;  3CMA A;  1KD1 C;  1EUJ A;  2GN5 A;  3S1Q H;  3CPW A;  4A3C G;  1TXY A;  3NEL A;  1VQG A;  3I56 A;  4DR1 L;  4NXM Q;  5LMN Q;  4FDB A;  4R1J A;  1HNZ Q;  2UUC L;  3PO3 H;  1HR0 W;  4A3B G;  5M5Y H;  4DV4 L;  2BA1 A;  1VQE A;  3DM3 A;  3KYH C;  3G6E A;  3UDI A;  1X3G A;  4K0K L;  1VQ9 A;  4X6A H;  1U0L A;  2JE6 I;  3KF8 B;  1K3R A;  1AE3 A;  2N3S A;  3RN2 A;  4JC0 A;  2RF4 A;  2VQF L;  1JMC A;  3CC7 A;  2YTX A;  4B3R L;  3HOW G;  4YWK A;  2KHJ A;  5FJ8 G;  1YJ9 A;  3T1H Q;  2KCT A;  4AQY Q;  5C3E G;  1NTG A;  4BBR G;  1GM5 A;  1EQQ A;  4B3T Q;  4L5R C;  4Y52 H;  4POF A;  1CSP A;  4LF6 L;  3IRB A;  1KRT A;  3UE1 A;  1D8L A;  1VQL A;  3GTP H;  3F2B A;  4DV6 Q;  3NEM A;  1Y1V H;  2NN6 I;  4HIK A;  1LUZ A;  1OXV A;  3D0F A;  5FLM H;  3L0O A;  3CC2 A;  1H95 A;  3M3Y H;  2BA0 A;  1CSQ A;  4DR3 L;  2NN6 G;  3CCQ A;  1EQR A;  4DUZ L;  1VQ4 A;  3S1M H;  2N78 A;  4JV5 Q;  1L2F A;  2JA8 H;  4A3J H;  5IY0 A;  1J5E L;  5IWA Q;  3RLO A;  1MJE A;  2XTI A;  3S15 H;  2VL6 A;  1GKH A;  1G6P A;  4YHH Q;  3OYY A;  3I55 A;  1NY4 A;  1PH4 A;  1LTL A;  1Y1W H;  1S40 A;  2UUC Q;  4LF7 Q;  1WJJ A;  4OWW B;  4DV4 Q;  2OCE A;  4GN5 A;  5FLX c;  2UUA Q;  1HNX Q;  3H0G G;  4KHP Q;  3T1Y L;  5GRO A;  1D7Q A;  4OO1 G;  3FKI G;  3U4V A;  4A3M G;  2VUM G;  4DV1 Q;  2IHF A;  3J81 i;  4LUV A;  1GVP A;  3TS2 A;  4LUO A;  2VQF Q;  4DUY L;  3K7A H;  1Q12 A;  4P72 A;  4QJF A;  3CCJ A;  2JA5 H;  4JOI C;  2ZTC A;  1VQD A;  5GAE C;  1FGU A;  2CCZ A;  2D0P A;  1SRU A;  5JJI A;  1YIJ A;  2JQO A;  1Q7Y C;  4LF6 Q;  5HGQ A;  1PYS B;  1YEZ A;  4HJ8 A;  4X64 L;  3RZD H;  4QQB X;  3JC6 6;  2B3G A;  2A1A A;  1YHQ A;  2LXJ A;  4DR3 Q;  4YCU A;  1L0W A;  3W1G A;  3CCU A;  4DUZ Q;  1XPR A;  3HOV H;  3KDF B;  3U50 C;  4P73 A;  4OX9 L;  1SFO H;  1J5E Q;  3CPF A;  2CWA A;  2KBN A;  1QVG A;  4A3G H;  4JI1 L;  3PUZ A;  4BY7 H;  3M7N A;  4HID A;  4BY1 G;  1N8R C;  5HY6 A;  3KJP A;  1XNR L;  2E5L L;  2UUB Q;  2ASB A;  4LWC A;  4LF5 Q;  3AEV A;  2N49 A;  3PIP A;  2HT1 A; 
#chains in the Genus database with same CATH topology
 1E0B A;  3JAM E;  2B2U A;  3MA2 B;  3OHX C;  4R9W A;  2BH8 A;  1HZB A;  5M9O A;  4HJ7 A;  3H15 A;  4JBJ A;  1YHA A;  1SMY D;  2A19 A;  2A6H D;  4HMI A;  1S72 A;  4L5S A;  1QVC A;  1XJV A;  4POG A;  2RDF A;  1OTC A;  1N34 L;  2RQX A;  1JE5 A;  2L15 A;  3D6C A;  4M8A A;  3CCS A;  2Q2T A;  2MO0 A;  2O4X A;  3MFY A;  5KGU A;  4OWT B;  5CV8 A;  2I5H A;  2D9U A;  2I5M X;  2F0D A;  3IL8 A;  1XPO A;  1TS2 A;  4XXE A;  4JI8 L;  1TY0 A;  4A3C H;  1DYQ A;  2C9O A;  1VQ6 A;  2E5L Q;  4JBK A;  4UP9 A;  4FF1 A;  4IUN A;  1WD0 A;  1BBU A;  1GHK A;  1CZW A;  2JEB I;  3CME A;  4DV7 L;  1Q82 C;  1Z9F A;  3D4W A;  2EY5 A;  4X65 Q;  1EIF A;  4J8Q A;  3DLL A;  1J8I A;  1PH2 A;  3J7A 5;  2R92 G;  2K5N A;  1DCZ A;  2F0S A;  1PTO B;  2CWP A;  2PNR C;  1GUG A;  2EJM A;  3PSI A;  2XVS A;  3HOW B;  1GUT A;  2NN6 H;  2CVR A;  4U68 A;  4DU9 A;  5C3E B;  1PH5 A;  4KN4 C;  2R93 H;  4FF4 A;  5EAY A;  3S1R H;  4C3H G;  1XMQ Q;  2XRQ D;  3ND8 A;  2H5X A;  2E2J B;  4KTA A;  5LHY 1;  3QWN A;  4PZ7 A;  1U4R A;  1IXR A;  1CZG A;  3S16 B;  1PZI D;  4DK3 C;  1IBK Q;  2PW7 A;  4JVZ A;  1OXT A;  1STY A;  3ITP A;  3HS0 C;  1HQR D;  4A3M H;  3FRP B;  2FIN B;  4C3J H;  1Y8N B;  2A68 C;  3R8B A;  4CJ2 C;  1PHJ A;  1F9S A;  1NAP A;  2LKV A;  3CC4 A;  1LM0 A;  2X6G A;  5JOB A;  4GZY C;  1JQY D;  4UAI A;  4KI0 A;  2VUM B;  4KLK A;  3RZO H;  2OTL A;  2VS1 A;  4GLA C;  1KC8 C;  2JA6 H;  4X66 Q;  3MXU A;  4WJ4 A;  1M1K C;  2ES2 A;  3R2I A;  4JI5 Q;  1EYG A;  3CCL A;  1MSG A;  1KLG D;  4V0B A;  4BY1 H;  3PO2 G;  2ZXP A;  1SN8 A;  2E2I B;  2CFM A;  3VR5 A;  4QY7 A;  5KYL A;  5KIX A;  5IT9 c;  3M9B A;  1HR0 L;  1JC7 A;  1YNJ D;  5M3F B;  3GTM B;  3SK4 A;  4GS3 A;  5FO7 B;  2B8G A;  1SSO A;  3RLN A;  1K0S A;  1GO3 E;  5H1S E;  1G8Z D;  3URY A;  3I4N G;  4TQU S;  1H9M A;  1R9T B;  2NYZ D;  4HSV A;  1VQ8 A;  2DJF C;  2B39 A;  1CM9 A;  3I4M G;  2JA9 A;  4IFD H;  1EY5 A;  4X65 L;  1A2U A;  3BU2 A;  4HSP A;  5EJW A;  3BZK A;  2A73 B;  3R2T A;  5NUC A;  2VB3 X;  2K32 A;  4X62 Q;  1U4M A;  3FMC A;  4KJN A;  3PIP 3;  2NVX B;  4A3F B;  2OXP A;  1LTI D;  1JOK A;  1BOS A;  5GQO A;  4AIM A;  3BYY B;  4IFD I;  1L1O B;  3CP0 A;  3TP7 A;  1CK1 A;  4OIK A;  2B2U C;  3RR5 A;  3L2P A;  1UEB A;  2KJX A;  3AU7 A;  3B6Y A;  2NZ1 D;  4C2M B;  2Q8T A;  3J7Z C;  1OO9 B;  2EVB A;  4RG1 A;  3CAM A;  5J1Z A;  4GNX C;  2G9D A;  3HRZ C;  4M1U B;  1TY2 A;  4CKC A;  3GP7 A;  3DEO A;  1U4L A;  1UWV A;  5CYU A;  4ZUI A;  1B1Z A;  1VQC A;  4BXX G;  2NB0 A;  1VF7 A;  4NXN L;  2DNC A;  1HA5 A;  1Z47 A;  2Q2U A;  4JI3 Q;  4CDF C;  2L9H A;  1VQ5 A;  1QWY A;  1N33 Q;  2LMC B;  1MIU A;  3K81 C;  3K5N A;  4FXD A;  3I2Z A;  4QL5 A;  1L1O A;  4CGY B;  2D62 A;  5C4X H;  3E6Z X;  3TBI B;  3OTO L;  2HHH Q;  3M7G A;  3OW7 A;  1JWM D;  1O7L A;  2IT1 A;  3MWY W;  1VQH A;  4JBW A;  4R4C A;  3NHH A;  1SYC A;  1PFN A;  3FHW A;  3I4L A;  4N9P A;  4X66 L;  3AMU A;  2E75 C;  4NP5 A;  4IO9 A;  1IBL L;  2WAQ G;  4F87 A;  1AEX A;  4JI0 Q;  2MPM A;  5M5X B;  5FO8 B;  1WCM B;  4FF2 A;  4KD3 A;  2BH2 A;  5BR8 Q;  3N52 A;  4QGU A;  3MFG A;  4S3S A;  3EA6 A;  2M00 A;  2N88 A;  3OMG A;  4BA2 I;  2K50 A;  3LX0 A;  5ELC A;  1H9R A;  2R7Z B;  4WJ3 M;  5M5Y B;  1JJ2 A;  5LMU Q;  5C3W A;  2KHI A;  4X3U A;  3Q6S A;  4R4I A;  1EEF D;  4KKT A;  1ENA A;  2EY1 A;  2A69 D;  4XYQ A;  1ENF A;  2E2I H;  3K5M A;  1JIC A;  2IX0 A;  4GKJ Q;  3ER0 A;  1VQI A;  5G3L D;  4DXG A;  2XIW A;  3F2C A;  2R93 G;  5M3F H;  3JAM c;  3U9O A;  2F0I A;  1Q46 A;  4DR1 Q;  3M3Y B;  3DWA A;  3MXP A;  5EQ0 A;  1MJC A;  3KF8 A;  2BDN A;  1R9T H;  4G57 A;  3GV3 A;  4HJ5 A;  1QUQ B;  2AWN A;  4K0K Q;  3H6M A;  3E5S A;  3STB D;  1EZ6 A;  1AN8 A;  4LF9 Q;  4GLX A;  2JA8 G;  3EQL C;  2DJG C;  1I94 L;  3OMC A;  4DK0 A;  3G4S A;  2WB1 B;  1TR5 A;  5IGE A;  1CKM A;  3E0J A;  1JCK B;  1I6V C;  2E2D C;  2NVX H;  1LTR D;  5GAG C;  3H3V H;  3I8Z A;  1SMY C;  4XDX A;  4BBS B;  2A6H C;  1D5Z C;  1ZYR D;  2JA6 G;  1TWC H;  5CV4 A;  5JVG 3;  5IYC H;  4FXK C;  4JI7 L;  5COR A;  3KUP A;  2ALY B;  1VQF A;  2VQE Q;  4C2M H;  3Q24 A;  4LFC Q;  1QUQ A;  4H44 C;  1Y69 U;  1WTO A;  2A74 C;  1Q1B A;  3C46 A;  3DXJ C;  2F0N A;  2NBF A;  2K1B A;  3BVZ A;  4TKO B;  4BY7 B;  2EYO A;  4BWG B;  4O0A A;  1IHZ A;  4A3D H;  1EIH A;  3HOV G;  4A4I A;  3A8I E;  3NBH B;  4A3G G;  1VQB A;  2SEB D;  4PMW A;  4QF4 A;  3SE0 A;  5FO9 B;  2WB1 E;  4DK6 C;  1C48 A;  3HKS A;  3K8A A;  3CW2 C;  5BR8 L;  1ILP A;  1BCP F;  4X64 Q;  4FF3 A;  3GTL H;  2N55 A;  1C7Y A;  5E4X A;  1GD7 A;  4G7O C;  4MZ9 A;  4OX9 Q;  1N36 Q;  5C44 G;  5LMU L;  2WV6 D;  5M3M H;  2EQS A;  4JI1 Q;  3BVG A;  1Q3L A;  5IGD A;  3RUZ A;  1RL2 A;  3HOZ H;  4R4T A;  1V8Q A;  1TWG B;  4N8X 1;  1Q8I A;  1SJE D;  2F0O A;  1WD1 A;  2RHS B;  2PPB C;  3NBH A;  4RKL A;  5M5X H;  1GOZ A;  2F0F A;  3H3V C;  4JI2 Q;  4RFB A;  1ASY A;  3MZ5 A;  4J1M A;  3GTO B;  1LO5 D;  2NTT A;  4KY7 A;  3A5U A;  1K8M A;  1KD1 C;  1EUJ A;  3S1Q H;  3NEL A;  4DR1 L;  1VQG A;  4NXM Q;  3P7J A;  5LMN Q;  4FDB A;  1DXM A;  1EZ8 A;  3NTK A;  5CV7 A;  3PO3 H;  5M5Y H;  4DV4 L;  2BA1 A;  3DM3 A;  1X3G A;  4K0K L;  1U0L A;  3EVQ A;  2JE6 I;  1AE3 A;  5C4H A;  3OIQ A;  3OPO A;  5IOC A;  3VA7 A;  2VQF L;  2YTX A;  2J0T D;  4WJW A;  3M4O B;  3HOW G;  4YWK A;  5C3E G;  1GM5 A;  4B3T Q;  3D4R A;  3DMU A;  1D8L A;  3F2B A;  4HIK A;  5FLM H;  1PFB A;  2RDH A;  1HFN A;  3M3Y H;  2F3V A;  5CC4 A;  1VQ4 A;  4LJZ C;  5LL6 S;  1B2T A;  4A3J H;  1S5F D;  2XTI A;  3S15 H;  2SDF A;  1KDA A;  1FR3 A;  1LTL A;  5A2Q E;  1UUP A;  4LF7 Q;  2UUA Q;  1HNX Q;  1W6J A;  1NSN S;  5GRO A;  4OO1 G;  2VUM G;  4DV1 Q;  4DXF A;  3QOL A;  3TS2 A;  1BR9 A;  2ZTC A;  4IUV A;  3NSW A;  1YIJ A;  4LF6 Q;  2YU9 B;  1RKN A;  2DY8 A;  1YEZ A;  4HJ8 A;  4X64 L;  1GUN A;  1G2S A;  2EY6 A;  4DUZ Q;  4RGN A;  1JE4 A;  3TME A;  1ET6 A;  4OX9 L;  1J5E Q;  4JI1 L;  4BY7 H;  2L4N A;  3IKJ A;  3SHL A;  3KJP A;  2ASB A;  4DN4 M;  4C3I B;  2HT1 A;  1X56 A;  1NCV A;  1BQQ T;  2KCC A;  5ELN A;  1RJT A;  1HPC A;  3HFZ B;  4JI2 L;  3SXH A;  5IP9 H;  1DOK A;  3VYT A;  4K14 A;  4LF4 L;  4XQN A;  2MHV A;  5LMN L;  5CBE E;  1X65 A;  4DF7 A;  4A3F G;  1SEB D;  1S3O A;  3PUV A;  1Q81 C;  4WOR A;  3W5O A;  4DR6 L;  1PZJ D;  4EQ5 A;  1FNV A;  2HDM A;  2NWG A;  1ICF B;  1KAW A;  4YCV A;  1X32 A;  3TQY A;  1H9K A;  5DLQ E;  1W3S A;  5A2Q L;  3CQZ B;  4A3K B;  1E2W A;  4DK1 A;  4DA2 A;  4B3T L;  1UE1 A;  4Z9C B;  3FEW X;  1VQM A;  3GTO H;  4A3B H;  1KHI A;  4LW1 A;  2PCF B;  4F7X A;  4GN4 B;  1II3 A;  1AZQ A;  3KFU A;  1VQ7 A;  3A55 A;  3F1Z A;  4TSS A;  1CUK A;  3ZYY X;  1HJP A;  4MHE A;  3S9W A;  1PRT F;  5C0X G;  1CKN B;  4IUP A;  1QB5 D;  1B7Y B;  1KL9 A;  4WFN 3;  1LYL A;  1N34 Q;  2QGQ A;  4F88 A;  1TWA B;  4LF7 L;  2AMC B;  1WTQ A;  3CCV A;  5ELO A;  3UDX A;  2UUA L;  1HNX L;  3M4O H;  1TS4 A;  4HJ9 A;  4JI4 Q;  2MO1 A;  5IOD A;  1RD9 D;  2P5Z X;  4DV1 L;  1X3Q A;  2AWO A;  4EQN A;  5EKL A;  1QNK A;  3PF4 A;  4JI8 Q;  1Y14 B;  5F2D A;  3AQQ A;  2Z1C A;  4GN3 B;  3HOX B;  2A69 C;  1SNM A;  5IYD H;  1NJI C;  5KNC A;  4DV7 Q;  3S1R B;  1CKN A;  1WCM G;  1X3P A;  1YNN C;  1DJR D;  4NKL A;  2GA4 B;  4G7Z C;  1I50 B;  4RGT A;  2R7F A;  2KUM A;  3TZD A;  1F2L A;  4C3J B;  2R7Z G;  2ZXO A;  2F0G A;  3STB C;  4EVO A;  1UE6 A;  4LNQ A;  2EYL A;  2HD3 A;  3E0E A;  5JPM C;  2O2L D;  4B3S L;  4O42 A;  1FJG Q;  3UI2 A;  1EU4 A;  2YU9 H;  3RMH A;  2PO4 A;  1TS5 A;  1HTL D;  5C4J H;  3C2P A;  2PQE A;  4CHT B;  1WTW A;  1EIY B;  3A8J E;  3AYH B;  5JEA J;  5IYB H;  2E8G A;  4GNX B;  3VR3 A;  2F0E A;  2F0P A;  3PCO B;  4LUZ A;  5C4Z A;  5CGK A;  3HOU B;  4BY1 B;  4C3I H;  4HIO A;  1F2Z A;  4ABN A;  4R8I A;  1GUW A;  3S24 A;  2JN4 A;  2IX1 A;  1SE3 A;  2PI2 A;  2AUJ D;  1STB A;  3TP6 A;  2IL8 A;  1FNU A;  2V4D A;  4X3K A;  4XT1 B;  1SNC A;  3A54 A;  2L55 A;  1WTX A;  1LT6 D;  3F2D A;  5CV5 A;  3G48 A;  1DZ1 A;  1FD7 D;  2PI2 E;  2JSO A;  4FYD A;  1EYA A;  1K8A C;  5IP7 G;  4LK1 C;  4GNX A;  1TWF H;  2QKI C;  2OWO A;  2CH4 W;  4BBS G;  2KHS A;  1V9P A;  5D3D A;  5J3B A;  1RHP A;  2JJQ A;  3TP5 A;  4A3E H;  1EY8 A;  1HQM C;  4IPD A;  1HR0 Q;  3CQZ H;  4A3K H;  1UEA B;  4JI4 L;  2UU9 L;  3W3A A;  1N9W A;  5IE8 A;  1KDC A;  2SOB A;  1YZ6 A;  4G7H C;  1ILQ A;  2Z0S A;  4HR7 B;  4ID6 A;  2C5C A;  4DAY B;  4BY7 G;  1B3A A;  3QO2 A;  1EL0 A;  1SR3 A;  4L63 B;  4DAV A;  1EY0 A;  1BXT A;  2QDB A;  1LTA D;  1SNQ A;  3HKZ B;  3MC0 B;  4C1N I;  3GTK B;  2V1C C;  2RHQ B;  4B08 A;  1TWA H;  4IUT A;  5K36 G;  1E1T A;  3EN2 A;  3HEJ A;  2O5I C;  1X3F A;  4UP7 A;  4DPG A;  1XPU A;  5E3F A;  4N8F A;  4Q5V A;  3G6J B;  3OWE B;  2MGS A;  4OL7 A;  1D5X C;  2HQL A;  3NP8 A;  1NUC A;  2F3W A;  4QCL A;  1W6K A;  2UXB L;  4PZ6 A;  5C4X B;  3HOX H;  4DAY A;  3GV6 A;  5JVH 3;  1FJG L;  2B29 A;  2RSN A;  3PUY A;  2B63 G;  1LAB A;  2ZJR A;  5DAU A;  1EWI A;  2EYP A;  3FP9 A;  1E1O A;  2MUY A;  3JAM L;  3GTQ H;  5E7N A;  2ZM6 L;  2WKC A;  3BDO A;  3I4O A;  2D0O A;  1SYE A;  1I50 H;  4NXN Q;  3PGZ A;  3S2D H;  1VQJ A;  1B9N A;  3HKZ E;  1M4V A;  2K5W A;  1B53 A;  1CHP D;  1NE3 A;  3X3N A;  1A6X A;  2OQK A;  1HH2 P;  2XWJ B;  3C1F A;  3OTO Q;  1P16 A;  3IFT A;  1Z6H A;  3OWF A;  5D14 A;  1CKO A;  4GOP C;  2KCM A;  4ME5 A;  4B3M L;  1FL0 A;  1QZG A;  4OWX B;  4OON A;  1CQF A;  1IBL Q;  3M4P A;  1GUO A;  5ELE A;  5ELD A;  4CJ0 B;  3HOU H;  1Y1V B;  2FXQ A;  1UNS A;  2F0V A;  3PUX A;  4ZKB B;  2F0W A;  3HOY H;  5IYD G;  3NQI A;  1KLU D;  1BCP D;  4K2K A;  1HZ9 A;  4EGV A;  1IYJ B;  4LAA A;  1PA6 A;  4ZQ3 A;  1BBX C;  2CH4 A;  1Y1W B;  4A93 H;  1K73 C;  2R61 A;  3E9I A;  1CA5 A;  3SEB A;  3A8K E;  1JJC B;  4XIG S;  4AYB G;  3D4D A;  1TVX A;  3CRL C;  3I70 A;  2B2T A;  3R3O A;  4X3T A;  4IQZ A;  1XTC D;  3CCE A;  3KLW A;  2WFW A;  1PVO A;  2VW9 A;  4HCE A;  4DR4 L;  2LY7 A;  2JA5 G;  2J4X A;  3U4Z A;  3D31 A;  1TWC B;  3L3O C;  5IYB G;  2K5D A;  1VS0 A;  1QNU A;  1SFO B;  4OEM B;  5C3X A;  3T1Y Q;  4MTK A;  1PH7 A;  2CW0 C;  3P1H A;  2HIV A;  5E1F A;  5A35 A;  1NBW A;  5DEH A;  3GTK H;  4RHR A;  5I9P A;  1I94 Q;  4DUY Q;  3MTS A;  3K6O A;  1H9S B;  4A3D B;  3KDF A;  4PMC A;  2IY5 B;  3OIP A;  2K6A A;  2F0M A;  2XRS D;  3W1B A;  1HZA A;  4JI7 Q;  2LXK A;  1EU3 A;  2NVY H;  4KKU A;  2JA7 H;  1AW7 A;  3ZJY C;  3GTL B;  3KJO A;  4ZUJ A;  2IJ0 A;  1YHB A;  4IPG A;  2VNU D;  4DV6 L;  5M3M B;  1PTO F;  2K33 A;  3M4Q A;  1IBM Q;  3HOZ B;  1H9S A;  4DV3 Q;  2KED A;  3BYT B;  4P75 A;  3CMA A;  4A3C G;  1DOM A;  3CPW A;  3CKI B;  2BCO A;  1MI2 A;  2EDG A;  3DEP A;  1VQE A;  2FFK B;  3K57 A;  3S1Q B;  1WTH A;  1VQ9 A;  5EBD A;  2BE5 D;  3KF8 B;  4U67 3;  3RN2 A;  3PO3 B;  4BBR B;  4XQQ A;  1BNZ A;  1H9J A;  2KHJ A;  3T1H Q;  1JWS D;  4AQY Q;  4RHS A;  4V19 0;  3J81 E;  1U9R A;  4FXG C;  1Y1V H;  3KBX A;  3DUZ A;  2FMC A;  2NN6 G;  1GXD C;  3CCQ A;  4R8N A;  4DGZ A;  5IWA Q;  1K83 B;  2VL6 A;  1G6P A;  4UHV A;  2H4O A;  4ZYS A;  1A15 A;  2Q8R E;  3LWU A;  3OYY A;  4YHH Q;  1Y1W H;  3FKI B;  4RCN A;  4XQJ A;  4OWW B;  4DV4 Q;  2OCE A;  4A3J B;  5JEA H;  3S15 B;  4DAP A;  1STN A;  3T1Y L;  3PMF A;  3DM1 A;  3A7L A;  3HG9 A;  4A3M G;  3U4V A;  4G4K A;  4C3J G;  1STA A;  2VQF Q;  4DUY L;  4FO2 A;  4P72 A;  3CCJ A;  1VQD A;  3G7L A;  1F9Q A;  2D0P A;  5KRU A;  2WAC A;  1PYS B;  2QIL A;  2LXJ A;  1XWE A;  1FNW A;  1XPR A;  4IAL A;  1PRT D;  1SFO H;  3MEH A;  1HUN A;  1I4X A;  4ZLT F;  3M7N A;  4HID A;  4BY1 G;  5HY6 A;  2UUB Q;  4LF5 Q;  3PIP A;  5EBC A;  2E74 C;  3FDT A;  1A62 A;  3MXG A;  2B2T C;  3I73 A;  3GQB A;  4OIJ A;  4A3I H;  3ONA B;  2E2H H;  1YVC A;  4H7B A;  1IBM L;  2IHE A;  2M2L A;  3GO5 A;  5D65 A;  4O2D A;  1T5X D;  3AFP A;  4DV3 L;  3WOE A;  3F8T A;  1DON A;  3J81 L;  3DWQ A;  2PMZ B;  1EY6 A;  2ATW A;  5I2X A;  2K05 A;  1X6O A;  3VA5 A;  4IFD G;  2XSC A;  4IUQ A;  2IX3 A;  1A63 A;  3CRK C;  3SR1 A;  4A3L H;  4MNO A;  1PH1 A;  1KAB A;  1DM0 B;  5IIF A;  2ID0 A;  2B2W C;  1A3V A;  4HMJ A;  3T1H L;  2X69 A;  4AQY L;  5CR3 A;  4J15 A;  4H13 C;  4ME3 A;  1PH6 A;  1E2Z A;  2HUG A;  3MHB A;  2R92 B;  1G91 A;  1TQO A;  3PF5 A;  4JK1 C;  1O7Z A;  4A3B B;  1CI3 M;  1EWC A;  1EYC A;  5IWA L;  4LF4 Q;  3A56 A;  3LNN A;  2XWB B;  2IPK D;  4YHH L;  5FJ8 H;  3K58 A;  5I4D A;  3QB3 A;  4CJ1 B;  4BBR H;  1WFQ A;  3BDC A;  2PMZ E;  1NMG A;  1A3U A;  3E3X A;  3SDZ A;  4BS9 A;  2EE1 A;  2KEN A;  5KNB A;  3VR6 A;  4DR6 Q;  1OXU A;  3NEN A;  4ILW A;  2K04 A;  3K80 C;  3EIV A;  5DM7 3;  4O1N A;  1KIX A;  5C4X G;  4HIM A;  1SYD A;  2ZTE A;  1W2B A;  2PQA A;  1HTP A;  1A8V A;  4RWS C;  1C0A A;  2EJF C;  1K83 H;  1EY4 A;  3K7U C;  3T16 A;  1BO0 A;  3H0G H;  1O78 A;  3PV0 A;  1FGB D;  3FKI H;  5J39 A;  1ZEQ X;  2HDL A;  5EPK A;  1G51 A;  4DAM A;  1YNJ C;  2UUB L;  4LF5 L;  3TRE A;  1PYB A;  3WWV A;  2PNH A;  1D1K A;  1KXL A;  3J7Y W;  2PZW A;  2AKW B;  3NTI A;  3S1N H;  1IYU A;  5GAH C;  2K14 A;  3PO2 B;  4RMF A;  4I7Z C;  1S5D D;  3A5Z B;  4C56 C;  1I3Q B;  1YJN A;  4PQX A;  3PUW A;  1N32 Q;  4DV2 Q;  4JYA L;  5K5P A;  2NVQ H;  1U5K A;  4DR2 Q;  1Y1V G;  5C4J B;  3FPP A;  1F9P A;  1EY7 A;  1FYC A;  1C8C A;  1JB3 A;  1I6H B;  3CCR A;  4KD4 A;  5M3F G;  3I4M B;  4MTN A;  2F03 A;  1IL2 A;  4DR7 Q;  1O80 A;  2K5H A;  3GTJ H;  2EY2 A;  1CA6 A;  1STG A;  1E24 A;  3T13 A;  3KF6 B;  2PZT A;  1Q1E A;  2GVA A;  2QA4 A;  2WP8 J;  1J6Q A;  1ONL A;  3I90 A;  3VR4 A;  4B3S Q;  1BBW A;  3BG3 A;  5FLX E;  1Y8O B;  2FMM A;  4IUU A;  4QIW B;  1TWH B;  1S5B D;  1PH8 A;  1HNW L;  2LSS A;  2B2Y A;  2F3I A;  2TSS A;  4ZAI A;  3BJU A;  3S17 B;  1J9O A;  2Y0S B;  2TMP A;  1QJO A;  4QB4 A;  1TWF B;  4LMQ D;  3NXW A;  5FK9 C;  1I4P A;  1EFW A;  2NZO A;  1E2V A;  5T1I A;  5IYC G;  3JAM i;  4A3E B;  4DKA C;  5GAD C;  4K5V A;  4KY6 A;  3KF6 A;  1A2T A;  3IFD A;  5J22 A;  1PYW D;  1K28 A;  2R92 H;  1AFP A;  2DUD A;  3BS1 A;  3L7Z C;  2KA7 A;  5KYI A;  3TP8 A;  1Q86 C;  2PZU A;  4GKK L;  4JW0 A;  4A3D G;  5M5W B;  4LFA L;  3MAQ A;  4GOP B;  1XMO L;  2L5T A;  1S5C D;  4K5X A;  3ND9 A;  2SNM A;  1LTB D;  3J81 c;  4FNF A;  2K28 A;  5KEE A;  1OXX K;  3BVM A;  4KHZ A;  4YWL A;  4C3H H;  4QIW E;  2CQO A;  4IOA A;  1D6E C;  3UDF A;  1EOV A;  1LV9 A;  4JPB W;  1X54 A;  2RVL A;  4YWM A;  2WAQ B;  2Y0S E;  2F0K A;  1SE4 A;  2UU9 Q;  3C1E A;  2L1B A;  1CTM A;  1KAA A;  4UPA A;  1B44 D;  3J80 E;  1VQK A;  3K5O A;  1GUS A;  5M3M G;  2ZT9 C;  1N32 L;  3G71 A;  3P75 A;  4NPS A;  2AQ1 B;  4DV2 L;  4DNI A;  3HOZ G;  4GOP A;  2DGY A;  4QMG A;  3EBE A;  4DR2 L;  5FLX L;  3BZC A;  3GTQ B;  1ASZ A;  1KNA A;  4KK7 A;  5D3I B;  2QW7 A;  4XT3 B;  4RGM A;  4DV0 Q;  4EX5 A;  4JI6 L;  3F2U A;  4DR7 L;  3S2D B;  3PO2 H;  1D1I A;  1BUV T;  3KK7 A;  4H02 A;  2J7Z A;  3PO3 G;  2HCI A;  2UXD L;  2F0T A;  1I3Q H;  2YTV A;  2UXB Q;  1G29 1;  4IZ8 A;  4L5Q A;  1KRS A;  2QEX A;  2WAQ E;  1I4R A;  2F0Q A;  3I91 A;  2AQ3 B;  3I4N H;  3C3L A;  2FJ2 A;  3GTP B;  4YY3 L;  2ZM6 Q;  2DN8 A;  3RLF A;  1PH3 A;  1LT5 D;  3OW2 A;  2K03 A;  5KND A;  1I6H H;  1ZYR C;  3UE0 A;  3I4M H;  4ULL A;  2UXC L;  1PRT C;  2F4I A;  5FLM G;  5IGB A;  3OSO A;  1IKM A;  3K0X A;  1VMC A;  2G5D A;  1EFI D;  3HGB A;  5HUR A;  4A3J G;  3HOY B;  2A8V A;  2K01 A;  3SGI A;  2K75 A;  2Z8L A;  1K8G A;  1E22 A;  1G2T A;  5E4W C;  1SDF A;  5COY A;  3RN5 A;  5I9O A;  1IW7 D;  1TWH H;  4A93 B;  1I4H A;  3CD6 A;  3NWT A;  4FP5 D;  2H1E A;  1HUM A;  1PTO D;  2VZA A;  2WB1 G;  3J80 L;  1T5E A;  2GVB A;  2RBM A;  3S17 H;  4B3M Q;  4PNY A;  1RCV D;  2PW5 A;  3AB9 A;  3H94 A;  3IAY A;  2LS0 1;  1CFM A;  4XTC S;  1DOL A;  4F8M A;  1S5E D;  4BXX H;  4APV A;  1QCB D;  1SND A;  4UP8 A;  5IGC A;  4IPC A;  4A3G B;  1A3T A;  1AE2 A;  2D5D A;  1VQO A;  2QEJ C;  5CBA E;  2KQ3 A;  4R4Q A;  3K5L A;  3GDE A;  3CF5 A;  3T51 B;  1JJG A;  5CV6 A;  4IPH A;  2B2Y C;  5M5W H;  4TVA B;  4ZK9 B;  2JK8 A;  1WTP A;  1HNZ L;  4YIJ A;  1D2B A;  4J6H A;  2R3Z A;  3BZD B;  5C44 B;  3J7A V;  1JT8 A;  5IP9 G;  4GLV B;  4NW2 A;  5IGG A;  5C0X J;  4DV0 L;  1K0R A;  4ZRZ A;  1VQP A;  3LGJ A;  5DNF A;  3P20 A;  4DR4 Q;  2R6G A;  1QG7 A;  3V05 A;  3PIO A;  1FVI A;  1XNR Q;  1MKH A;  5C5L A;  1SMX A;  2KVM A;  2Q2H A;  3SK5 A;  2NVY B;  1L0Y B;  1SE2 A;  3AFQ A;  2EXD A;  2JA7 B;  4KKS A;  1K9M C;  1EIG A;  1YIT A;  1T9H A;  5BN3 A;  3NPP A;  1WVL A;  4X3S A;  2K52 A;  1GHJ A;  2NUC A;  4JV5 L;  1LTG D;  1B50 A;  3FPU B;  2OQ0 A;  4DV5 Q;  2GN5 A;  1TXY A;  1MSH A;  3TN2 A;  3I56 A;  1ZKO A;  1EQV A;  5T1G A;  4R1J A;  4RAU C;  2Z4I A;  5CMD A;  2UUC L;  4A3B G;  4CKE A;  4KN7 C;  1GJX A;  2N3S A;  3H91 A;  3T56 B;  1M8A A;  2RF4 A;  1JMC A;  3VYU A;  5ISR A;  3CC7 A;  1VF5 C;  1YJ9 A;  2NVT B;  1NTG A;  4Y52 H;  4POF A;  1CSP A;  3IRB A;  3GTP H;  3HOV B;  4RH6 A;  4DV6 Q;  1ESR A;  2NN6 I;  3SVM A;  1LUZ A;  1OXV A;  3D0F A;  4C1N K;  3L0O A;  2BA0 A;  1PDQ A;  4DR3 L;  1EQT A;  1PFM A;  1EQR A;  3S1M H;  2N78 A;  2JA8 H;  4RCO A;  5IY0 A;  1MJE A;  1MHW C;  3I55 A;  3QJY A;  1PH4 A;  2A6E D;  1S40 A;  1PZK D;  1WJJ A;  2G9H D;  4NMZ A;  5FLX c;  1F2Y A;  1QIL A;  4KHP Q;  5JJZ A;  1TT2 A;  2QCP X;  3EFX D;  3J81 i;  4LUV A;  1GVP A;  3S14 B;  3K7A H;  1Q12 A;  2F0H A;  1KTK A;  4QJF A;  1EY9 A;  1TS3 A;  1ML0 D;  2Z9H A;  4KJO A;  2IWH A;  1FGU A;  1SRU A;  5JJI A;  1CQV A;  2JQO A;  1Q7Y C;  1NR4 A;  5EPL A;  4QQB X;  1JOR A;  2OF1 A;  3NK9 A;  1YHQ A;  4CDE C;  1L0W A;  3W1G A;  3CCU A;  3HOV H;  3KDF B;  3U50 C;  4P73 A;  4A3G H;  2EZV A;  2KBN A;  3H09 A;  1PXU A;  1QVG A;  3TDQ A;  5EKI A;  1XNR L;  2E5L L;  2L11 A;  2QF7 A;  3L9A X;  1S4Z A;  4ZCK A;  3GD7 A;  1SBB B;  3I3C A;  1KDB A;  3ULL A;  1STH A;  3OOC A;  2CKZ B;  4C3I G;  5I6Y A;  1WOC A;  2BOS A;  2KOL A;  2B2W A;  1YBY A;  3CXC A;  4DV5 L;  5C44 H;  3ERS X;  2N8N A;  4CKB A;  2M9V A;  3J81 j;  1KNE A;  4CBV A;  1RF2 D;  4A3I B;  1WI5 A;  2E2H B;  2EIF A;  1EEI D;  1ENC A;  3J80 c;  1L0X B;  2F0J A;  1Q8K A;  1F2M A;  2Y0S G;  3ICE A;  1V1P B;  3KOJ A;  4RGO S;  2AQ2 B;  2EXZ A;  2JEA I;  1XX8 A;  4HJA A;  1PLF A;  1XMQ L;  2RDG A;  4KHV A;  4RKB A;  4CDD C;  2ZTD A;  1SXT A;  2YYZ A;  4A3E G;  1I4G A;  1BCP B;  3M4Y A;  1SLJ A;  5EPJ A;  4A3K G;  1RIP A;  4P74 A;  3PQI A;  1IBK L;  3M85 A;  4DNR B;  3BDL A;  4IUR A;  3RNU A;  1PTO H;  1O7I A;  4IOC A;  2ZXR A;  1R4P B;  4HAE A;  2ZJQ A;  3HOW H;  5C3E H;  5JJL A;  4DFA A;  3Q22 A;  4HCS A;  4ODG A;  1V1P A;  4KHP L;  1RTN A;  4I7A A;  1QE6 A;  4PV1 C;  1CHQ D;  3RD4 A;  2NVT H;  4RA8 A;  4IJL A;  2E2J H;  1AP0 A;  3QIA A;  5ELB A;  2RKS A;  3S16 H;  4JI5 L;  5JAV A;  1MBY A;  1HXY D;  5HGT A;  1F77 A;  4NB3 A;  1UE7 A;  5JJK A;  1HRJ A;  1XXG A;  2OEO A;  4PMB A;  3HOX G;  4OO1 H;  3TEH B;  1OXS C;  1ROD A;  2VUM H;  1ZXT A;  2K4K A;  3ULJ A;  4A76 A;  1JWU D;  3DHQ A;  1SYB A;  3H0G B;  2WII B;  2EYF A;  1JOQ A;  3U58 A;  2Z4H A;  2F52 A;  3N6R A;  2KCN A;  1RTO A;  5DM6 3;  4K5W A;  3S14 H;  2Z6K A;  4OO1 I;  1UE5 A;  3GTG B;  2YTY A;  2RCN A;  2I5L X;  3I7F A;  4A75 A;  3SK6 A;  4YCW A;  3SK8 A;  1XNQ Q;  3T53 B;  2AHO B;  1JR0 D;  4X62 L;  1IW7 C;  3MVV A;  3GTM H;  5LMN W;  1YNN D;  3S1N B;  1PTO C;  1C9O A;  5JPN C;  3E9H A;  1V1Q A;  2ICE C;  1BVS A;  4OXP A;  2MFI A;  3V96 A;  4MN3 A;  4OGQ C;  1YNX A;  3A7A B;  4EQP A;  2WIN B;  2EJG C;  4OHJ A;  2YV5 A;  4UY8 C;  1IYV A;  2AUK A;  5AJ3 Q;  2I0Q A;  2NVQ B;  1E7Z A;  1X3E A;  3QOJ A;  3HOU G;  3S2H B;  3V2T A;  3MEF A;  1VQA A;  1VDZ A;  4K8I A;  1SAP A;  2XGT A;  2K5Q A;  1E3P A;  2CQA A;  3K0Y A;  3HOY G;  2RSO A;  4P2C B;  4JBM A;  4A3F H;  4DR5 Q;  3ULP A;  5ELF A;  4ZKC B;  1Z7T A;  3HZX A;  2D2C C;  4JI3 L;  1LAC A;  4QUC A;  2B2V A;  3GTJ B;  1STE A;  2IW3 A;  1N33 L;  4A93 G;  4QUF A;  4EQO A;  1PH9 A;  1HFG A;  4AH6 A;  2HIX A;  2L0C A;  3H3V I;  2HHH L;  4LFB Q;  4JYA Q;  1TII D;  2OT2 A;  2SNS A;  4DNT B;  1LLR D;  1SNP A;  4MIU A;  2RCF A;  1TU2 B;  5IGF A;  4PG3 A;  1QOH A;  4K8J A;  3NTH A;  5C0X H;  1ET9 A;  2LFN A;  1HZC A;  4JI0 L;  2F1M A;  2KEE A;  5TSS A;  1XYI A;  4XYO A;  1F9R A;  3TS0 A;  4TRD A;  2MP1 A;  2PQA B;  2EYH A;  1SRO A;  5C0X I;  1LT3 D;  4H0L C;  3HKZ G;  3WDN A;  3TZU A;  2A5H A;  1HNW Q;  1NR2 A;  1BDO A;  1R4Q B;  3J7A F;  3VYR A;  1ESF A;  1SYF A;  4B9W A;  3UDG A;  1BKB A;  2B63 B;  1QZH A;  1QVF A;  4Y7N B;  2R7D A;  4PZ8 A;  4JG2 A;  4Q0F A;  1NMF A;  1WCM H;  4K2L A;  4C3H B;  1JB7 A;  1Q90 A;  1XNQ L;  1Y8P B;  3A0J A;  3VYS A;  1PRT B;  2NZH A;  4GKJ L;  3D6W A;  3Q8D A;  2WKD A;  5AFW A;  2JA7 G;  2ZJP A;  1L1O C;  1K8O A;  2EPB A;  2EYJ A;  3MXN B;  2R7Z H;  3KLR A;  3DWP A;  4GKK Q;  1WTR A;  4WRD A;  1A0I A;  4LFA Q;  5AJ3 L;  4LF9 L;  1XMO Q;  1WYD A;  2Q8I B;  1B4O A;  4B9X A;  3GTG H;  2A6E C;  2DNE A;  5FKA C;  1BCP C;  4IN3 A;  4R4O A;  4CDC C;  2B8F A;  4BA1 I;  5EKK A;  3J80 i;  1B9M A;  4JCV E;  3NBI A;  2F4V Q;  3ERQ A;  1PFS A;  1IZ6 A;  4LF8 Q;  4DR5 L;  1B70 B;  2VY3 A;  2MJ8 A;  3U9S A;  1YI2 A;  2C35 B;  3A74 A;  4KV6 A;  3MXN A;  1DD2 A;  2ENB A;  3D8G A;  2VQE L;  4JOI A;  4LFB L;  3KLS X;  4LFC L;  2A68 D;  1EYD A;  1IL8 A;  2ICI A;  1X55 A;  3I4N B;  4KMU C;  2MNA A;  1I5F A;  2Z6K C;  3S2H H;  2F0L A;  1C4Q A;  3KBG A;  4AYB B;  1WTV A;  2EYM A;  5IP7 H;  1DGS A;  4JI6 Q;  2KEC A;  3VR2 A;  4B3R Q;  5L37 A;  4BBS H;  4P71 A;  1P8L A;  1SNO A;  1Y1W G;  2UXD Q;  5JEA G;  4HTH A;  1V43 A;  1AH9 A;  2DY7 A;  3TSS A;  4E6I A;  1SE8 A;  2F0U A;  1VQN A;  2JA5 B;  1M90 C;  2HQE A;  1B8A A;  1X9N A;  1VCI A;  1N36 L;  1HHV A;  4L5T A;  2OTJ A;  2I46 A;  4YY3 Q;  1SJH D;  2MQH A;  3RZD B;  1KQS A;  3D3R A;  3I72 A;  4IFD J;  3HP3 A;  2UXC Q;  5BN5 A;  3ERO A;  4L6T B;  5K36 H;  5IT9 E;  4OEL B;  2B2V C;  5G3L F;  2FHT A;  2BDO A;  4AYB E;  1PV4 A;  1MD2 D;  4NXM L;  2XNA C;  5BN4 A;  4ALP A;  2JP1 A;  3CCM A;  2QDL A;  3NUC A;  1UAP A;  3Q0A A;  4A3I G;  1BF4 A;  2I07 B;  1U4P A;  2JYO A;  4HED A;  3T4A C;  5LL6 X;  1SYG A;  2B63 H;  1TWG H;  3TRZ A;  4Y7N H;  3R93 A;  1LTS D;  2CW0 D;  1D5M C;  1YJW A;  2Q2I A;  4FVM A;  2RA4 A;  2F4V L;  2BE5 C;  3VDY A;  2K5V A;  1HA6 A;  3NE5 B;  4IJH A;  4LF8 L;  1TKW B;  1MGS A;  1EWH A;  2Z6B A;  2L12 A;  2X6L A;  5C5M A;  4A3L G;  3PIO 3;  1PMR A;  1XTD A;  2O5J C;  4HN7 A;  4UDU C;  1HNZ Q;  3X3M A;  1HR0 W;  4NDX A;  1IKL A;  3KYH C;  1RDP D;  3G6E A;  3UDI A;  4X6A H;  1AZP A;  1K3R A;  4L8J A;  3QG1 A;  3FVQ A;  1B3Q A;  2E76 C;  3LWE A;  4JC0 A;  4B3R L;  1LTT D;  1K3B C;  5FJ8 G;  2KCT A;  3W2D A;  3KLS A;  4BBR G;  4L5R C;  2CHB D;  1EQQ A;  4LF6 L;  1KRT A;  3UE1 A;  1VQL A;  5IT9 L;  2R93 B;  1I4Q A;  3NEM A;  3CC2 A;  1H95 A;  1EOT A;  1CSQ A;  1V1O A;  4DUZ L;  4K6D A;  4JV5 Q;  1L2F A;  1G6Z A;  3NQT A;  1J5E L;  3RLO A;  1GKH A;  1LT4 D;  5C6A A;  5I2Y A;  3NWS A;  2HCC A;  2VXW A;  1NY4 A;  1NNX A;  3S1M B;  3CU7 A;  2UUC Q;  4A3M B;  2JA8 B;  4KY5 A;  4I65 A;  4GN5 A;  3H0G G;  2XN9 C;  1D7Q A;  3FKI G;  5EGT A;  2IHF A;  4N9T A;  4LUO A;  3K59 A;  3RZO B;  3QR8 A;  2PYK A;  1VMP A;  1JOO A;  4JOI C;  2JA5 H;  2VB2 X;  5GAE C;  1HCZ A;  2JA6 B;  5I6W A;  2CCZ A;  3CHB D;  5HGQ A;  3O13 A;  3WOF A;  3K7A B;  3RZD H;  3JC6 6;  2B3G A;  3Q23 A;  2A1A A;  4DR3 Q;  2EOT A;  4YCU A;  2K7V A;  2NTS A;  3CPF A;  2CWA A;  4K6L A;  3PUZ A;  1CT1 D;  5FOB B;  1ICW A;  1N8R C;  3AEV A;  4LWC A;  5CV9 A;  3EJI A;  2N49 A;  2JXM B;  1O7Y A; 
#chains in the Genus database with same CATH homology
 1X56 A;  1A62 A;  2BH8 A;  1HZB A;  3GD7 A;  5ELN A;  4A3I H;  3HFZ B;  4JI2 L;  4HJ7 A;  3ULL A;  5IP9 H;  2E2H H;  1YVC A;  2CKZ B;  3H15 A;  1IBM L;  2IHE A;  1WOC A;  1YHA A;  4JBJ A;  3GO5 A;  4O2D A;  3AFP A;  1YBY A;  3CXC A;  4DV3 L;  3F8T A;  4DV5 L;  5C44 H;  3ERS X;  2A19 A;  2N8N A;  3J81 j;  1S72 A;  4LF4 L;  4L5S A;  1QVC A;  1XJV A;  4POG A;  1WI5 A;  1OTC A;  5LMN L;  1N34 L;  1JE5 A;  2L15 A;  3CCS A;  1X65 A;  2Q2T A;  2ATW A;  2EIF A;  2MO0 A;  1X6O A;  3J80 c;  3PUV A;  1S3O A;  4A3F G;  4IFD G;  4OWT B;  1Q8K A;  1Q81 C;  3W5O A;  1A63 A;  4DR6 L;  4EQ5 A;  2Y0S G;  4A3L H;  2I5H A;  2I5M X;  1XPO A;  1KAW A;  4MNO A;  1PH1 A;  4YCV A;  3ICE A;  3TQY A;  3KOJ A;  2ID0 A;  5DLQ E;  1W3S A;  2JEA I;  4JI8 L;  4A3C H;  4HJA A;  3T1H L;  1XMQ L;  4AQY L;  1VQ6 A;  2E5L Q;  4JBK A;  2ZTD A;  1UE1 A;  4B3T L;  2YYZ A;  4UP9 A;  4J15 A;  4A3E G;  1VQM A;  3GTO H;  1BBU A;  4A3B H;  1KHI A;  4LW1 A;  4ME3 A;  1PH6 A;  1SLJ A;  2JEB I;  4GN4 B;  3CME A;  4DV7 L;  1RIP A;  1Z9F A;  4P74 A;  4A3K G;  1Q82 C;  1VQ7 A;  3KFU A;  1IBK L;  3M85 A;  3F1Z A;  4X65 Q;  1CUK A;  3PF5 A;  1EIF A;  1HJP A;  3RNU A;  5IWA L;  3DLL A;  1O7I A;  5C0X G;  1CKN B;  4IOC A;  4LF4 Q;  1B7Y B;  1KL9 A;  1PH2 A;  2ZJQ A;  3HOW H;  3J7A 5;  4YHH L;  5FJ8 H;  2K5N A;  2R92 G;  1LYL A;  1N34 Q;  2QGQ A;  5C3E H;  4BBR H;  4LF7 L;  1WFQ A;  2AMC B;  5JJL A;  3CCV A;  2PMZ E;  5ELO A;  1NMG A;  3UDX A;  1HNX L;  2CWP A;  2UUA L;  3M4O H;  4KHP L;  3PSI A;  2KEN A;  4HJ9 A;  2NVT H;  4JI4 Q;  2MO1 A;  4DR6 Q;  1OXU A;  4IJL A;  3NEN A;  4DV1 L;  2E2J H;  2AWO A;  1PH5 A;  3K80 C;  2R93 H;  3S16 H;  4JI5 L;  3EIV A;  5EAY A;  3S1R H;  3PF4 A;  1KIX A;  4JI8 Q;  1Y14 B;  5C4X G;  1XMQ Q;  4HIM A;  1W2B A;  2ZTE A;  2PQA A;  2H5X A;  3AQQ A;  4GN3 B;  4NB3 A;  1UE7 A;  1A8V A;  5IYD H;  4PZ7 A;  1C0A A;  1K83 H;  5JJK A;  1NJI C;  1IXR A;  3K7U C;  4DV7 Q;  3H0G H;  1CKN A;  4DK3 C;  1WCM G;  3HOX G;  1IBK Q;  3PV0 A;  3TEH B;  1OXT A;  1OXS C;  3FKI H;  4A3M H;  2VUM H;  4C3J H;  2K4K A;  1PHJ A;  1G51 A;  3ULJ A;  2R7F A;  4A76 A;  3CC4 A;  1LM0 A;  4DAM A;  2UUB L;  3U58 A;  4LF5 L;  3TRE A;  1PYB A;  3WWV A;  2F52 A;  2PNH A;  4KI0 A;  1KXL A;  4KLK A;  2R7Z G;  3STB C;  3RZO H;  1UE6 A;  2OTL A;  2Z6K A;  3S14 H;  1UE5 A;  2AKW B;  2VS1 A;  4OO1 I;  2YTY A;  4LNQ A;  2RCN A;  2I5L X;  3E0E A;  4GLA C;  3I7F A;  3S1N H;  5GAH C;  2K14 A;  4A75 A;  4X66 Q;  4RMF A;  4YCW A;  1KC8 C;  4B3S L;  1XNQ Q;  2JA6 H;  4WJ4 A;  2AHO B;  1FJG Q;  3A5Z B;  1M1K C;  2YU9 H;  2ES2 A;  4X62 L;  4JI5 Q;  1EYG A;  1YJN A;  5C4J H;  3CCL A;  3GTM H;  3PUW A;  1N32 Q;  3PO2 G;  5LMN W;  4BY1 H;  1EIY B;  1SN8 A;  4DV2 Q;  1C9O A;  2CFM A;  4JYA L;  3AYH B;  4QY7 A;  3E9H A;  2E8G A;  5JEA J;  5IYB H;  4GNX B;  2NVQ H;  1U5K A;  5IT9 c;  1V1Q A;  3M9B A;  1BVS A;  1HR0 L;  4OXP A;  3PCO B;  2MFI A;  4LUZ A;  1Y1V G;  4DR2 Q;  1YNX A;  4GS3 A;  4C3I H;  2YV5 A;  3RLN A;  4HIO A;  4UY8 C;  1GO3 E;  5H1S E;  5AJ3 Q;  2I0Q A;  3S24 A;  3I4N G;  1E7Z A;  4TQU S;  1X3E A;  3CCR A;  5M3F G;  2IX1 A;  3HOU G;  4MTN A;  2PI2 A;  1IL2 A;  4DR7 Q;  3MEF A;  1VQA A;  2K5H A;  3GTJ H;  1VQ8 A;  2XGT A;  1E24 A;  1E3P A;  3KF6 B;  3HOY G;  3I4M G;  4JBM A;  4A3F H;  2JA9 A;  1Q1E A;  4DR5 Q;  2GVA A;  3F2D A;  2QA4 A;  3ULP A;  2WP8 J;  3G48 A;  1J6Q A;  4X65 L;  2PI2 E;  4JI3 L;  3BU2 A;  4B3S Q;  1BBW A;  3BZK A;  1K8A C;  1N33 L;  5IP7 G;  4A93 G;  4GNX A;  1TWF H;  4X62 Q;  1PH9 A;  1PH8 A;  2OWO A;  1HNW L;  2LSS A;  4BBS G;  2F3I A;  4AH6 A;  1V9P A;  2HIX A;  3BJU A;  3H3V I;  5GQO A;  2HHH L;  5J3B A;  4LFB Q;  4AIM A;  2JJQ A;  4JYA Q;  4IFD I;  4A3E H;  1L1O B;  3CP0 A;  4IPD A;  1HR0 Q;  3CQZ H;  3RR5 A;  4A3K H;  3L2P A;  1UEB A;  4JI4 L;  2UU9 L;  1N9W A;  5IE8 A;  3B6Y A;  1EFW A;  2NZO A;  3J7Z C;  5IYC G;  3JAM i;  1YZ6 A;  4PG3 A;  4DKA C;  4RG1 A;  5GAD C;  2Z0S A;  3CAM A;  3KF6 A;  4GNX C;  1HZC A;  4DAY B;  4JI0 L;  4BY7 G;  1SR3 A;  2R92 H;  2DUD A;  1UWV A;  3L7Z C;  3TS0 A;  1VQC A;  4BXX G;  1Q86 C;  4NXN L;  4GKK L;  2PQA B;  1SRO A;  2V1C C;  1Z47 A;  2RHQ B;  5C0X I;  1TWA H;  2Q2U A;  4JI3 Q;  4A3D G;  4LFA L;  1E1T A;  1VQ5 A;  4GOP B;  3EN2 A;  1XMO L;  1N33 Q;  5K36 G;  1X3F A;  3HKZ G;  4UP7 A;  1MIU A;  3K81 C;  3I2Z A;  4QL5 A;  4DPG A;  1L1O A;  3J81 c;  1XPU A;  1HNW Q;  1OXX K;  2D62 A;  4KHZ A;  4YWL A;  4C3H H;  5C4X H;  4QIW E;  2CQO A;  3OTO L;  2HHH Q;  4IOA A;  3UDF A;  2HQL A;  1EOV A;  1X54 A;  4YWM A;  1BKB A;  3UDG A;  2UXB L;  1QZH A;  1QVF A;  2Y0S E;  2IT1 A;  2R7D A;  4PZ6 A;  1VQH A;  4JBW A;  4JG2 A;  4PZ8 A;  4R4C A;  2UU9 Q;  1NMF A;  1WCM H;  3HOX H;  3FHW A;  4X66 L;  1JB7 A;  1XNQ L;  3A0J A;  1FJG L;  2B29 A;  3PUY A;  4UPA A;  2NZH A;  4GKJ L;  4IO9 A;  2ZJR A;  1IBL L;  2B63 G;  2WAQ G;  3Q8D A;  1VQK A;  1EWI A;  2JA7 G;  3FP9 A;  5M3M G;  1E1O A;  2ZJP A;  3GTQ H;  4JI0 Q;  1N32 L;  5E7N A;  2ZM6 L;  3G71 A;  4NPS A;  1L1O C;  4DV2 L;  3I4O A;  4DNI A;  3HOZ G;  2D0O A;  3MXN B;  4GOP A;  2BH2 A;  2R7Z H;  1I50 H;  2DGY A;  4NXN Q;  3EBE A;  3PGZ A;  5BR8 Q;  4DR2 L;  3BZC A;  4GKK Q;  3S2D H;  1VQJ A;  1ASZ A;  4QGU A;  3HKZ E;  1A0I A;  4LFA Q;  5AJ3 L;  4BA2 I;  4LF9 L;  1XMO Q;  1WYD A;  2K50 A;  4EX5 A;  4DV0 Q;  4JI6 L;  1NE3 A;  3GTG H;  4WJ3 M;  1JJ2 A;  5LMU Q;  2OQK A;  1HH2 P;  4DR7 L;  3PO2 H;  4R4O A;  2KHI A;  1P16 A;  3OTO Q;  4H02 A;  4BA1 I;  4R4I A;  3PO3 G;  3J80 i;  2UXD L;  4JCV E;  2F4V Q;  1CKO A;  1I3Q H;  1PFS A;  2YTV A;  2UXB Q;  1IZ6 A;  4LF8 Q;  4DR5 L;  1G29 1;  4GOP C;  2KCM A;  4L5Q A;  2E2I H;  1KRS A;  2QEX A;  1B70 B;  2WAQ E;  2VY3 A;  4B3M L;  1FL0 A;  1QZG A;  4OWX B;  2IX0 A;  1YI2 A;  2C35 B;  4OON A;  4GKJ Q;  3ER0 A;  1VQI A;  3F2C A;  1IBL Q;  3I4N H;  3A74 A;  2R93 G;  2VQE L;  3M4P A;  5M3F H;  3JAM c;  4YY3 L;  3HOU H;  2ZM6 Q;  2FXQ A;  4JOI A;  3RLF A;  1PH3 A;  1Q46 A;  4DR1 Q;  4LFB L;  4LFC L;  3OW2 A;  3PUX A;  1I6H H;  3UE0 A;  1MJC A;  1X55 A;  5IYD G;  3HOY H;  3I4M H;  2UXC L;  2MNA A;  1R9T H;  1I5F A;  2Z6K C;  4HJ5 A;  5FLM G;  1HZ9 A;  3S2H H;  1QUQ B;  2AWN A;  4K0K Q;  1IYJ B;  3STB D;  1PA6 A;  3K0X A;  4LF9 Q;  4GLX A;  2JA8 G;  4JI6 Q;  5IP7 H;  4A93 H;  1DGS A;  4A3J G;  1K73 C;  1I94 L;  4B3R Q;  2A8V A;  3G4S A;  4BBS H;  4P71 A;  3E9I A;  3SGI A;  2K75 A;  1K8G A;  1P8L A;  1E22 A;  1JJC B;  4XIG S;  4AYB G;  1Y1W G;  1CKM A;  3RN5 A;  2UXD Q;  1TWH H;  3H3V H;  2NVX H;  5GAG C;  3CD6 A;  5JEA G;  2VZA A;  1V43 A;  2WB1 G;  1AH9 A;  2GVB A;  3S17 H;  1SE8 A;  4B3M Q;  1VQN A;  1TWC H;  2JA6 G;  3CCE A;  5IYC H;  1M90 C;  3KLW A;  4JI7 L;  1B8A A;  2WFW A;  1X9N A;  1VCI A;  2VW9 A;  1PVO A;  1N36 L;  2ALY B;  1VQF A;  4L5T A;  2VQE Q;  4DR4 L;  2OTJ A;  4YY3 Q;  2MQH A;  4C2M H;  2JA5 G;  3U4Z A;  1KQS A;  3D31 A;  4LFC Q;  1QUQ A;  4XTC S;  5IYB G;  4IFD J;  1Q1B A;  1VS0 A;  4BXX H;  4APV A;  2UXC Q;  4UP8 A;  4IPC A;  1AE2 A;  3T1Y Q;  4O0A A;  1VQO A;  1PH7 A;  4A3D H;  3HOV G;  4A4I A;  2HIV A;  4R4Q A;  1JJG A;  3NBH B;  3GDE A;  3CF5 A;  1NBW A;  4A3G G;  3GTK H;  4AYB E;  1I94 Q;  4DUY Q;  4IPH A;  1PV4 A;  1VQB A;  4NXM L;  4PMW A;  5M5W H;  4TVA B;  2JK8 A;  1HNZ L;  2WB1 E;  4ALP A;  4DK6 C;  3CCM A;  3HKS A;  3K8A A;  3CW2 C;  5BR8 L;  3KDF A;  2IY5 B;  4A3I G;  1JT8 A;  4X64 Q;  5IP9 G;  3GTL H;  4GLV B;  1C7Y A;  3W1B A;  1HZA A;  5C0X J;  4DV0 L;  1GD7 A;  1K0R A;  2NVY H;  2LXK A;  1VQP A;  4JI7 Q;  2B63 H;  1TWG H;  3LGJ A;  4MZ9 A;  4Y7N H;  4OX9 Q;  1N36 Q;  5C44 G;  3TRZ A;  5LMU L;  5M3M H;  2JA7 H;  4DR4 Q;  2R6G A;  2EQS A;  4JI1 Q;  3PIO A;  1FVI A;  1YJW A;  3ZJY C;  2Q2I A;  3KJO A;  1XNR Q;  1RL2 A;  1MKH A;  3HOZ H;  1SMX A;  2Q2H A;  2F4V L;  3VDY A;  1YHB A;  2K5V A;  4R4T A;  4IPG A;  4IJH A;  4LF8 L;  2VNU D;  3AFQ A;  2EXD A;  2RHS B;  4DV6 L;  1K9M C;  5M5X H;  1YIT A;  1T9H A;  4JI2 Q;  2K52 A;  3M4Q A;  1IBM Q;  4A3L G;  1ASY A;  4JV5 L;  1XTD A;  2OQ0 A;  4DV3 Q;  3A5U A;  4DV5 Q;  4P75 A;  3CMA A;  1KD1 C;  1EUJ A;  2GN5 A;  3S1Q H;  3CPW A;  4A3C G;  1TXY A;  3NEL A;  1VQG A;  3I56 A;  4DR1 L;  4NXM Q;  5LMN Q;  4FDB A;  4R1J A;  1HNZ Q;  2UUC L;  3PO3 H;  1HR0 W;  4A3B G;  5M5Y H;  4DV4 L;  2BA1 A;  1VQE A;  3DM3 A;  3KYH C;  3G6E A;  3UDI A;  1X3G A;  4K0K L;  1VQ9 A;  4X6A H;  1U0L A;  2JE6 I;  3KF8 B;  1K3R A;  1AE3 A;  2N3S A;  3RN2 A;  4JC0 A;  2RF4 A;  2VQF L;  1JMC A;  3CC7 A;  2YTX A;  4B3R L;  3HOW G;  4YWK A;  2KHJ A;  5FJ8 G;  1YJ9 A;  3T1H Q;  2KCT A;  4AQY Q;  5C3E G;  1NTG A;  4BBR G;  1GM5 A;  1EQQ A;  4B3T Q;  4L5R C;  4Y52 H;  4POF A;  1CSP A;  4LF6 L;  3IRB A;  1KRT A;  3UE1 A;  1D8L A;  1VQL A;  3GTP H;  3F2B A;  4DV6 Q;  3NEM A;  1Y1V H;  2NN6 I;  4HIK A;  1LUZ A;  1OXV A;  3D0F A;  5FLM H;  3L0O A;  3CC2 A;  1H95 A;  3M3Y H;  2BA0 A;  1CSQ A;  4DR3 L;  2NN6 G;  3CCQ A;  1EQR A;  4DUZ L;  1VQ4 A;  3S1M H;  2N78 A;  4JV5 Q;  1L2F A;  2JA8 H;  4A3J H;  5IY0 A;  1J5E L;  5IWA Q;  3RLO A;  1MJE A;  2XTI A;  3S15 H;  2VL6 A;  1GKH A;  1G6P A;  4YHH Q;  3OYY A;  3I55 A;  1NY4 A;  1PH4 A;  1LTL A;  1Y1W H;  1S40 A;  2UUC Q;  4LF7 Q;  1WJJ A;  4OWW B;  4DV4 Q;  2OCE A;  4GN5 A;  5FLX c;  2UUA Q;  1HNX Q;  3H0G G;  4KHP Q;  3T1Y L;  5GRO A;  1D7Q A;  4OO1 G;  3FKI G;  3U4V A;  4A3M G;  2VUM G;  4DV1 Q;  2IHF A;  3J81 i;  4LUV A;  1GVP A;  3TS2 A;  4LUO A;  2VQF Q;  4DUY L;  3K7A H;  1Q12 A;  4P72 A;  4QJF A;  3CCJ A;  2JA5 H;  4JOI C;  2ZTC A;  1VQD A;  5GAE C;  1FGU A;  2CCZ A;  2D0P A;  1SRU A;  5JJI A;  1YIJ A;  2JQO A;  1Q7Y C;  4LF6 Q;  5HGQ A;  1PYS B;  1YEZ A;  4HJ8 A;  4X64 L;  3RZD H;  4QQB X;  3JC6 6;  2B3G A;  2A1A A;  1YHQ A;  2LXJ A;  4DR3 Q;  4YCU A;  1L0W A;  3W1G A;  3CCU A;  4DUZ Q;  1XPR A;  3HOV H;  3KDF B;  3U50 C;  4P73 A;  4OX9 L;  1SFO H;  1J5E Q;  3CPF A;  2CWA A;  2KBN A;  1QVG A;  4A3G H;  4JI1 L;  3PUZ A;  4BY7 H;  3M7N A;  4HID A;  4BY1 G;  1N8R C;  5HY6 A;  3KJP A;  1XNR L;  2E5L L;  2UUB Q;  2ASB A;  4LWC A;  4LF5 Q;  3AEV A;  2N49 A;  3PIP A;  2HT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...