1NTGA

Crystal structure of the emap ii-like cytokine released from human tyrosyl-trna synthetase
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
171
structure length
171
Chain Sequence
PEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNISLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Tyrosyl-tRNA synthetase
publication title Crystal Structure of an EMAP-II-like Cytokine Released from a human tRNA Synthetase
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 171
sequence length 171
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.1: Tyrosine--tRNA ligase.
pdb deposition date 2003-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ntgA00
4IPDA 3TS0A 1N33Q 1OTCA 5IYCH 3AFPA 1PHJA 1HR0L 4A3DH 5JJKA 1X56A 3TS2A 4A93H 1I94L 4APVA 4HJAA 4DNIA 2B29A 1N9WA 4DV7L 4DR2L 1KAWA 2GN5A 1LM0A 1UE6A 4DK3C 2E5LL 2MO0A 2PQAA 1FJGQ 3GTGH 3GTOH 1IBKQ 4AQYQ 3GTPH 2BA0A 4A3DG 1BKBA 4B3RQ 4O0AA 3OW2A 3M4OH 4A93G 4P71A 1R9TH 3NENA 3KF6A 2WB1E 3RR5A 4GOPB 1VQNA 1SLJA 3FKIG 3K0XA 4YHHQ 3CPWA 3A5ZB 4DV0Q 4JI4L 1C9OA 3CD6A 2ZJPA 1X3EA 4HIMA 4DR5Q 4A3IG 4TVAB 3S17H 3PCOB 2BA1A 4LF5Q 4JBJA 4DR7Q 4LF9L 5EAYA 1E3PA 3STBC 3TEHB 1L1OA 5IWAQ 4LF8Q 4GS3A 5J3BA 3GTMH 3ICEA 4MTNA 3A0JA 4X66L 2I0QA 2EQSA 4A3CH 4LFBL 1S3OA 5LMUQ 4BBRH 5IP9G 2JA5H 4HJ5A 1KRSA 1PA6A 1YHBA 5IY0A 1XTDA 1TWCH 4R4TA 3I56A 4P73A 3M7NA 4DPGA 1VQKA 3RN5A 2XGTA 1A0IA 1T9HA 3DM3A 1PH7A 1SE8A 2UUBQ 3K80C 4NXNQ 2ALYB 1EOVA 2F4VQ 2WB1G 2NVXH 4QL5A 5M3MG 4JI6Q 4GLVB 5BR8L 3CCLA 2UXDQ 3D31A 1HNWQ 2VUMG 1N34Q 2N3SA 2KHJA 3OTOQ 1SFOH 4IPCA 4LF4Q 1GO3E 4R4CA 3GTJH 4IOAA 4JI1L 3S1RH 3KYHC 1LTLA 1J5EQ 2UU9L 4QIWE 4GN4B 2F3IA 3I4MG 1K83H 1NBWA 3HOXH 5M5WH 1I94Q 4H02A 5LMNW 3J81c 3RLFA 4DV4L 3I4NH 1Y1VH 4LUOA 5AJ3Q 4B3SL 4BA2I 2Q2HA 4POGA 3J81j 3G71A 4DV2L 1Q86C 1HNZL 1VCIA 3RNUA 4WJ3M 2JA8G 2GVAA 3HOXG 1VQ7A 1ASZA 1N36L 1IBLL 2UXCQ 1TWAH 1E22A 1QVCA 3EBEA 5C0XI 1PH2A 1Y1VG 2YV5A 4IJLA 2R93G 1WYDA 5C0XG 4UY8C 2R92H 1EQRA 3S1MH 2UUCQ 2OQ0A 1XJVA 2E2JH 2ASBA 3CAMA 2CWPA 4YCVA 4DKAC 5C4JH 4JI8L 5M5YH 3CXCA 4R1JA 3HKZE 2R7DA 3AEVA 2AWNA 2VQFL 1HH2P 3JAMi 2F52A 2K4KA 2LSSA 4DR1Q 3RN2A 1ASYA 3PO3H 2Q2UA 2OCEA 1VQDA 1Q1BA 4X66Q 1OXUA 4J15A 2R6GA 4A3KH 1SMXA 3BZCA 2AWOA 2R92G 4LFBQ 2B3GA 1VQGA 4GKJL 1FJGL 3KLWA 2MO1A 4PMWA 3U58A 1IBKL 1C7YA 1UE7A 1WOCA 4JBWA 4KLKA 2K5VA 2B63G 5GAEC 2RF4A 4C3IH 2NZHA 3HOYH 5C44H 4DAYB 2JEBI 2NVTH 1X3FA 1CKOA 2IX0A 4OONA 1NMFA 4HIOA 1Y1WH 2ZM6Q 1UWVA 2N8NA 2LXJA 3NBHB 5IP7G 4KHZA 2ES2A 3CCSA 1G51A 5IWAL 4R4IA 1EYGA 3S2HH 1A63A 5C44G 3HOWG 4EX5A 4JI1Q 3HKZG 4HIKA 4IO9A 1VQ6A 2JE6I 3PF4A 2YYZA 1BVSA 2Z6KC 3M9BA 2OQKA 4A3EH 2IX1A 1NTGA 3H3VH 4DR6L 2EIFA 1H95A 5LMUL 1V9PA 1HR0W 1PH4A 3S1QH 1CSPA 5FLXc 1HZAA 2OTLA 3GO5A 3H15A 2DGYA 1XNRL 3IRBA 4LW1A 4DV2Q 1B8AA 4NXNL 1HNZQ 4LF6Q 3H3VI 4A3LG 1YIJA 1I6HH 4P72A 1Z47A 2F4VL 1B7YB 3MEFA 2HT1A 3I4OA 4JI6L 4AH6A 1E24A 3ULJA 2IHEA 1N34L 1VQOA 3TREA 1W3SA 2RHQB 3E9HA 3ULLA 5IT9c 3CCMA 2N49A 4LF4L 3CC4A 1G6PA 1NMGA 4A3BG 1J5EL 4QQBX 4JI8Q 1PH3A 1KC8C 4POFA 2VQFQ 1O7IA 1KD1C 1Y14B 4BY7G 2WP8J 3M85A 1GM5A 3PF5A 4HJ8A 1XPUA 3M3YH 5ELOA 2MQHA 2A1AA 5AJ3L 3FKIH 1JT8A 4KHPQ 5C3EH 2K52A 1K3RA 1SR3A 3RLOA 4A3IH 4YY3L 5GADC 3S14H 3J80c 3G4SA 3I2ZA 4DUYQ 2D62A 3CCRA 1Q81C 3JC66 1TWHH 2JEAI 3KF8B 2UXCL 1CKNB 4LFAQ 2QA4A 4A3MH 3L0OA 2UXBL 5C3EG 1YEZA 3KJPA 1FL0A 2AKWB 2UUCL 2ZTDA 4JC0A 3T1HQ 5IP9H 2FXQA 3HOZG 1J6QA 1IBML 4DR1L 1OXVA 2YTXA 2E8GA 3M4QA 1IL2A 1A8VA 1HZBA 4X65Q 4A3MG 1AE2A 2K14A 4JI5L 4YWMA 2K75A 4NPSA 4JI3L 1JJGA 1MJCA 2JQOA 3S24A 1YBYA 2VL6A 4DR6Q 5M3MH 4BXXG 3PSIA 3CPFA 1HJPA 1JJCB 1M1KC 2GVBA 3HFZB 3D0FA 3OYYA 1PH5A 2VUMH 3K7UC 2RHSB 1E7ZA 5E7NA 1XNQQ 1GD7A 2KCTA 4JG2A 4AYBE 5HGQA 4JYAQ 1KIXA 1XNRQ 4JI7L 3TQYA 3H0GG 2PMZE 4MNOA 1EQQA 2ZM6L 3I4MH 2QGQA 3HKSA 4GKKQ 3G6EA 5JEAG 1XMQL 1TWGH 3L7ZC 3UE1A 1K0RA 1PH6A 4IPHA 5JJIA 5JJLA 3UE0A 4IPGA 3F2DA 2CCZA 3K81C 3HOUG 1L2FA 2JA8H 4LUVA 3PGZA 2PNHA 1PV4A 1CKNA 2D0OA 4LWCA 3F2CA 5IYDG 2R93H 2Z0SA 4OXPA 2IT1A 3BJUA 4LF6L 4YY3Q 3F2BA 4GNXC 4JOIC 4AYBG 3EIVA 3HOVG 1RL2A 1HNXQ 2VY3A 2UXBQ 3CCVA 3KDFA 2NZOA 2K5HA 1IZ6A 4DV3Q 4JV5Q 3PUXA 1X3GA 2ID0A 3KJOA 1YVCA 3S2DH 1IBMQ 1K9MC 4L5RC 1FGUA 4GN3B 1SN8A 2NVQH 2B63H 1TXYA 2L15A 1MIUA 4TQUS 1XPRA 2HHHL 4EQ5A 3UDXA 4JI5Q 2JA6G 4JI3Q 4IFDJ 4LF7Q 4LFCQ 4KHPL 4UPAA 1X54A 4BY1G 3PUYA 5IP7H 4DUYL 1WCMG 2Z6KA 4JBKA 1VQEA 1YNXA 1PH1A 4JI2Q 5K36G 3E0EA 1I5FA 4LFAL 1X65A 1Z9FA 4JI7Q 3HOWH 4P75A 4B3MQ 2JJQA 3J81i 2H5XA 1VQBA 1WFQA 3AQQA 4PG3A 1KL9A 1Q46A 2PI2E 3T1HL 1XMQQ 3E9IA 2VNUD 2JA7G 1XNQL 4R4OA 5DLQE 1EIFA 3NELA 2UUAQ 4JI0L 4DR4Q 4X65L 1UE5A 1K8GA 4A3GG 5IYBG 3U4ZA 4IOCA 2VZAA 4A3LH 4JCVE 4C3HH 3MXNB 5IE8A 2OWOA 3VDYA 1PVOA 2YTVA 3RZDH 1WI5A 2BH8A 1YHQA 4L5TA 1U0LA 4JYAL 3PV0A 4DUZL 1PH9A 1QZGA 2R7ZG 5GAGC 4A3BH 5GQOA 4QY7A 1M90C 1E1TA 1SROA 1EUJA 1QUQB 2A19A 4HIDA 4AIMA 3ERSX 1OXTA 1S72A 1SRUA 1VQ5A 1JE5A 4BY7H 4GKKL 4DV6L 4GLXA 5M3FG 4QJFA 3PUZA 4K0KL 2WFWA 5C4XG 2VW9A 4YWLA 1KHIA 4A75A 1S40A 1X55A 3UDFA 4PZ6A 3T1YQ 1N32Q 1AH9A 4A3FG 1KQSA 2DUDA 1MJEA 4IFDG 4GNXB 1YITA 2HIXA 3L2PA 2HHHQ 1V43A 1C0AA 1Q8KA 5GROA 1NJIC 3K7AH 2ZJRA 4DK6C 4IJHA 3K8AA 4OWXB 3HOZH 3CMEA 3F1ZA 2XTIA 2V1CC 4UP7A 5FJ8H 1VQHA 5JEAJ 4BA1I 2E2IH 2ZTEA 3SGIA 4X64L 1VQJA 3STBD 1YJNA 1HNXL 1GKHA 4UP8A 1VQ9A 3A5UA 2HIVA 3PIPA 5LMNQ 3RLNA 1HZ9A 1BBWA 4DV3L 4JV5L 4BXXH 3PO2H 1EWIA 1VQFA 5FJ8G 1NE3A 1VQCA 3J7ZC 1PH8A 4HJ9A 5FLMG 1PYSB 1VQAA 2EXDA 2Q2IA 4DV5Q 4JI0Q 4GN5A 1RIPA 1V1QA 4DR3Q 2JK8A 1EIYB 3I55A 3KDFB 4LF7L 3H0GH 2C35B 3ER0A 4LFCL 2YU9H 5IYCG 4BBSH 1QUQA 3PUVA 5ELNA 1YZ6A 2PI2A 3S15H 2VQEL 4L5SA 3PO2G 1L0WA 1OXSC 1VQIA 4B3TQ 3WWVA 1Q82C 2ZJQA 4JI2L 3BZKA 1YJWA 1G291 3CC7A 4DUZQ 2A8VA 3GTQH 1VQPA 1BBUA 4YCWA 3HOUH 4BBSG 1A62A 4B3ML 2KENA 1VQMA 2D0PA 4L5QA 4QGUA 2RCNA 4ME3A 1Q1EA 4P74A 5C0XJ 1JMCA 2MNAA 4DV6Q 4GNXA 4JOIA 4K0KQ 4NXMQ 2BH2A 4OO1I 3ULPA 1D8LA 3J80i 2UUAL 2CFMA 4YWKA 4DR4L 5IYDH 3B6YA 1LYLA 2KCMA 1VQ4A 3RZOH 3CQZH 3HOVH 2CWAA 3DLLA 2NN6I 3S1NH 1XMOL 1CSQA 4WJ4A 1VS0A 2K5NA 3A74A 4DV1Q 4HJ7A 1B70B 2NN6G 4DAMA 3JAMc 3GTKH 1X9NA 2Q2TA 1W2BA 4A3CG 1I50H 3U50C 2I5HA 3UDGA 3CCJA 4BBRG 2JA5G 2WAQE 3PIOA 1L1OC 4X6AH 1KRTA 4X64Q 1GVPA 1NY4A 2QEXA 3TRZA 2I5MX 5HY6A 2JA6H 2I5LX 4OX9L 1PYBA 1HR0Q 3J7A5 4BY1H 1QVGA 3T1YL 1N32L 1E1OA 1TWFH 4GLAC 1WCMH 4Y7NH 4GOPA 1WJJA 4DV7Q 4DR2Q 2OTJA 1HZCA 1K73C 5M5XH 4A76A 3W5OA 3AFQA 3EN2A 1X6OA 1QZHA 3FP9A 1QVFA 2E5LQ 3LGJA 1FVIA 3GTLH 2AHOB 1YI2A 2VQEQ 1LUZA 3CCQA 4FDBA 4NB3A 2HQLA 4X62L 1UEBA 2JA7H 4GKJQ 3I4NG 4O2DA 1MKHA 3KOJA 4JI4Q 1I3QH 4A3GH 2WAQG 5IYBH 1PFSA 5LMNL 3ZJYC 1N33L 3AYHB 2R7FA 3Q8DA 5H1SE 2KHIA 4XIGS 3KFUA 4GOPC 4LUZA 2AMCB 4ALPA 4LF9Q 4MZ9A 3FHWA 2CQOA 1VQ8A 4OO1G 3NEMA 4DV5L 3BU2A 4DR3L 1D7QA 2N78A 2R7ZH 1P8LA 4OWWB 1K8AC 1CUKA 4RMFA 3W1BA 4AQYL 4RG1A 4UP9A 1JJ2A 3UDIA 4B3RL 3M4PA 3PO3G 3PUWA 1Q12A 5M3FH 4B3TL 1XMOQ 2E2HH 1OXXK 1U5KA 5C4XH 3CCUA 2IHFA 2LXKA 4YHHL 4DV0L 4A3KG 4A4IA 1DGSA 1P16A 2PQAB 4C3JH 3CF5A 1AE3A 2Y0SE 5BR8Q 4A3FH 4DR5L 3I7FA 3CP0A 3G48A 3U4VA 4LF5L 4JBMA 3S16H 2MFIA 3KF6B 4R4QA 4DR7L 4LF8L 4NXML 4OX9Q 1VQLA 4C2MH 3HOYG 1N8RC 3CMAA 4YCUA 4Y52H 1UE1A 1YHAA 1Y1WG 5GAHC 2UU9Q 2JA9A 3F8TA 1KXLA 4A3JH 4IFDI 3GD7A 1XPOA 3CW2C 3CCEA 4DV4Q 4LNQA 1Q7YC 1EFWA 2ZTCA 1IXRA 3CC2A 4B3SQ 1L1OB 2CKZB 2VS1A 2UUBL 4DV1L 2ATWA 2YTYA 3GDEA 4A3JG 3W1GA 4A3EG 4PZ8A 1N36Q 2NVYH 1IYJB 4X62Q 1IBLQ 2UXDL 5FLMH 2IY5B 1HNWL 1CKMA 4XTCS 2KBNA 4OWTB 2K50A 3OTOL 4PZ7A 2Y0SG 4KI0A 1YJ9A 1JB7A
chains in the Genus database with same CATH superfamily
2D2CC 4IPDA 5JJKA 1XTCD 4A3DH 4CKCA 1HR0L 1JB3A 4YIJA 4TKOB 2K04A 1PTOH 4QUCA 2B29A 2GN5A 1EZ8A 1PRTF 2K1BA 1E2ZA 1AZPA 1D5MC 1E2WA 1UE6A 2E5LL 1EFID 4L8JA 1FJGQ 1CHQD 3FKIB 4AQYQ 1F77A 2MJ8A 4P71A 1S5ED 1Q90A 2ENBA 1G2TA 4DK1A 3GTPB 2XRSD 2PW5A 3M4OB 3CPWA 4DV0Q 4JI4L 3A5ZB 1PRTB 4IUNA 2ZJPA 1QWYA 1BCPF 1UUPA 4JBJA 4DR7Q 4LF9L 5EAYA 1F9RA 3STBC 5IWAQ 4XYOA 3BYTB 4MTNA 3A0JA 4X66L 4DU9A 1E0BA 3T16A 4N8X1 1S3OA 1PA6A 1KRSA 1BCPB 1TWCH 5M3MB 4R4TA 4C56C 3RN5A 4NXNQ 4OELB 2ALYB 1EOVA 2WB1G 1Z7TA 2F0NA 1SJED 1EYDA 4GLVB 2UXDQ 2QDBA 3I4MB 2NVXB 5EGTA 2KHJA 3OHXC 4IPCA 3GTJH 3S1RH 1EY0A 1LTLA 4QIWE 3VYSA 1PZID 3HOXH 5LMNW 4FXKC 3J81c 4DV4L 1Y1VH 5AJ3Q 4RGMA 4BA2I 3Q6SA 3J81j 3G71A 1HNZL 2D9UA 2X6GA 2JA8G 4FNFA 4N8FA 2EYHA 1N36L 3OWEB 4KN4C 1QVCA 1Y69U 2UXCQ 3CRLC 2YV5A 4IJLA 4RGTA 4UY8C 3I73A 1XJVA 2E2JH 1HQRD 2CWPA 3A8JE 3CAMA 4QIWB 4R1JA 2R7DA 2B2VC 3RN2A 4DXGA 3JAMi 1EY4A 2F52A 2K32A 5A2QL 2Q2UA 1VQDA 2X69A 5F2DA 4N9PA 2M00A 2SNSA 5CBAE 4J15A 2R92G 2EYMA 1IBKL 1KABA 1UE7A 1WOCA 1NUCA 5E4WC 3MVVA 2B63G 4ZAIA 3TZUA 1AP0A 4FXGC 1CKOA 4OONA 1NMFA 2K5WA 4QUFA 2ZM6Q 2DJFC 1QE6A 3NBHB 3J81L 2NVTB 5EKIA 4KHZA 1CM9A 3HS0C 2KUMA 2JYOA 2RA4A 2C5CA 3NE5B 1G51A 1CI3M 3QOLA 1A63A 3S2HH 5C44G 2E74C 4EX5A 2F03A 4IO9A 1BVSA 3NXWA 4KD4A 4A3EH 1I6VC 1CTMA 5LMUL 1HR0W 2EYPA 1CSPA 3E3XA 1HZAA 2OTLA 3GO5A 5KNCA 2DGYA 3IRBA 1ET9A 2A68D 2KJXA 1YIJA 3SXHA 4P72A 1Z47A 3DWAA 4A3BB 1N34L 1VQOA 1STAA 3AU7A 2N49A 4CJ0B 4LMQD 1EYAA 3CC4A 4HTHA 4LF4L 3MC0B 1PH3A 1ENCA 3HZXA 2VQFQ 3A7AB 4FF1A 4HJ8A 5ISRA 4CDCC 4OIJA 1W6JA 3BVZA 3CKIB 1LTAD 2H1EA 4ZYSA 3S14H 3G4SA 3Q24A 2D62A 3DEOA 4EGVA 1CKNB 3R2TA 1NAPA 2KHSA 2AKWB 2UUCL 3T1HQ 4XYQA 5IP9H 3NTIA 4K5WA 1IBML 2E8GA 1PZKD 5C3WA 2FJ2A 1HZBA 1TVXA 2ZXPA 4X65Q 3U9OA 3S17B 2AQ2B 4M1UB 3S24A 2VL6A 4DR6Q 4BXXG 3PSIA 3T51B 3CPFA 1UEAB 2GVBA 1TT2A 5IGEA 5IGCA 2RHSB 1E7ZA 1JQYD 4JYAQ 2NTTA 1KIXA 1XNRQ 4K2LA 1KAAA 2PMZE 1EEID 2KCCA 2NBFA 2QGQA 2PPBC 1ZXTA 3G6EA 2F0GA 4HEDA 3UE1A 2HQEA 2EZVA 1PH6A 2F0JA 2Q8RE 4IPGA 3NQTA 1HTLD 2Q8TA 4F87A 1EY5A 1EYCA 3KF8A 2D0OA 4LWCA 2IWHA 4E6IA 1II3A 1GUGA 2R93H 3HOVB 2PMZB 1X3QA 1KDAA 4GNXC 1WTQA 3A8IE 1CA6A 2NB0A 5AFWA 2SEBD 2WIIB 4ABNA 2F0OA 1STHA 1B9NA 4H44C 2KEEA 5BN3A 2JA6B 1YVCA 2NVQH 2L15A 4BY1B 3C1FA 1K8OA 4IFDJ 3IFDA 4KHPL 1CT1D 4CDDC 1DYQA 4K6LA 1YNXA 1PH1A 3P7JA 3HOWH 1V1PB 4B3MQ 2H5XA 1WFQA 3AQQA 4PG3A 1KL9A 4R4OA 1ZKOA 5DLQE 1EIFA 1LT4D 2FINB 2LKVA 3FPPA 1K8GA 4A3GG 2QDLA 4IOCA 4A3LH 2VZAA 5FO8B 4C3HH 2Z6BA 5JPNC 1D2BA 2K03A 1WI5A 4DGZA 5KRUA 4L5TA 1U0LA 3BS1A 3PV0A 1PH9A 2R7ZG 1HRJA 4QY7A 1SROA 1AN8A 2A19A 4XT3B 4GLXA 4WFN3 4BY7B 1S40A 3TZDA 4OGQC 2SOBA 1AH9A 4A3FG 2DUDA 4IFDG 3NWSA 3M4YA 1Y8NB 3P20A 1NJIC 3PIP3 3K7AH 1H9MA 4DAPA 3X3MA 2EJGC 2IL8A 4ILWA 2XTIA 4UP7A 3CMEA 2HCCA 1L0XB 1YJNA 4FF2A 5LMNQ 5D3DA 2LMCB 4DV3L 4JV5L 1HUMA 2L0CA 3J7ZC 1WVLA 1M4VA 3SK5A 1RIPA 5D3IB 3RMHA 4DR3Q 3PO2B 3H0GH 4BBSH 3P1HA 2HCIA 1VQIA 3GTOB 1A3VA 1DOLA 4JI2L 3CC7A 3GTQH 4DUZQ 1K28A 1R9TB 1QOHA 1CQVA 1A62A 1XWEA 2PZWA 4QGUA 2RCNA 4ME3A 1Q1EA 1SXTA 2MNAA 4GNXA 1KNAA 4R8NA 4HMIA 3J80i 5IYDH 3CHBD 4YWKA 2JXMB 3B6YA 1TY0A 5CV6A 3PIO3 3FRPB 2RKSA 2LS01 3DLLA 1SYCA 3RZOB 3S1NH 4BBRB 4JPBW 3CQZB 4IALA 2F0WA 1H9SA 3TBIB 1I50H 3U50C 3CRKC 2L12A 1L1OC 4X6AH 4X64Q 1SNPA 2K01A 1DONA 2I5MX 3QWNA 1DOKA 1JICA 1HR0Q 1XX8A 1SFOB 1QVGA 3T1YL 1TWFH 1LT5D 1WCMH 4HN7A 4GOPA 1HZCA 1K83B 2TMPA 1K73C 5M5XH 4A76A 1X6OA 2K05A 1QZHA 3FP9A 3E6ZX 3MXUA 1WTWA 2E5LQ 3LGJA 4XQNA 1PDQA 3QOJA 4IURA 1YI2A 2VQEQ 1LUZA 1BCPD 4NB3A 2HQLA 4X62L 1UEBA 1CHPD 1H9JA 5KNDA 4JI4Q 3CU7A 1N33L 4R8IA 2DJGC 2EY5A 2AMCB 2H4OA 3W3AA 4ALPA 4LF9Q 4PV1C 3FHWA 1H9RA 4BS9A 3NEMA 4DV5L 5M5YB 5I9PA 1PRTC 3BU2A 3OOCA 3PO3B 1D6EC 3ONAB 3W1BA 4UP9A 1JJ2A 3UDIA 4LJZC 2A6EC 1Q12A 4B3TL 4KY6A 2C9OA 1BF4A 5C4XH 1DD2A 3CCUA 3URYA 2LXKA 2Z8LA 2KCNA 2E2HB 4C3IB 1P16A 2PQAB 3CF5A 2KQ3A 1QILA 1Y1WB 3NUCA 3CP0A 3G48A 4LF5L 5E3FA 4P2CB 3S16H 2MFIA 1RF2D 4LF8L 4C2MH 3CMAA 5CR3A 4RHSA 3QG1A 2JA9A 3VYUA 1STGA 2F3WA 4C3JG 5IIFA 5KEEA 3HEJA 4DV4Q 3MHBA 2F4IA 2CKZB 2VS1A 1R4PB 2HUGA 1K3BC 1BO0A 1T5XD 2A5HA 4A3JG 1SE2A 4A3EG 3A55A 4PZ8A 1N36Q 2NVYH 1STNA 1PLFA 1I6HB 2IY5B 1M8AA 1HNWL 4XTCS 1B1ZA 2CHBD 3OTOL 1ZYRD 4Q5VA 3PMFA 1DM0B 2PCFB 1I94L 4HJAA 2Z4HA 2J4XA 2FMMA 5DM73 2BE5C 2A69D 4K5VA 3M3YB 3GTGH 1IBKQ 3GTPH 1BKBA 1MD2D 3M4OH 4A93G 1BUVT 3NENA 5JPMC 3KF6A 2WB1E 3FVQA 4X3SA 4GOPB 1VQNA 1SLJA 4YHHQ 4JVZA 5NUCA 4HIMA 1SYEA 3PCOB 2QCPX 1Q8IA 1L1OA 5J3BA 2I0QA 3IKJA 4ZKCB 5LMUQ 1A2TA 5IP9G 1YHBA 2WB1B 2JA5B 1RCVD 2UUBQ 3NTHA 2RSOA 1A0IA 1HA6A 1SE8A 2LFNA 4XQQA 4NP5A 2GA4B 2NVXH 1AZQA 3T13A 3K57A 3H3VC 1GHKA 1N34Q 2N3SA 2XN9C 1ENAA 4OHJA 4LF4Q 1GXDC 1TWGB 4JI1L 2UU9L 2RDHA 2F3IA 3WOEA 2B2WC 3C2PA 1EU3A 1O7YA 3A54A 4H02A 5L37A 3I4NH 2SNMA 1I4QA 2Q2HA 2EYJA 5BN5A 3EBEA 5C0XI 4ULLA 4OO1H 1PXUA 2R93G 1WYDA 3PQIA 2UUCQ 2OQ0A 4YCVA 1G2SA 4DKAC 4K5XA 4JI8L 1BR9A 2R92B 4OO1I 2AWNA 1HH2P 1U9RA 2K4KA 4C1NI 1ASYA 2XIWA 4J8QA 2OCEA 5HGTA 2B63B 2R6GA 4A3KH 1SMXA 2AWOA 4LFBQ 5EPJA 1STBA 1LTRD 3KLWA 3U58A 3LWEA 1B50A 1ZEQX 5CV5A 2AUJD 5CC4A 2RF4A 5GAEC 2NZHA 2NVTH 2F0QA 2KECA 2IX0A 5C44B 2LXJA 1NR2A 2B2YC 3WOFA 3HOWG 1VQ6A 2JE6I 1JWUD 2KEDA 3J81E 4UAIA 1NTGA 4ZUIA 3H3VH 3G6JB 3VA5A 1PH4A 1BBXC 3S1QH 5KYLA 2KOLA 1BXTA 3H15A 4I7AA 5ELEA 1B8AA 4DV2Q 3H3VI 4A3LG 4OL7A 2F4VL 1B7YB 2HT1A 1IW7C 4JI6L 3ULJA 2IHEA 5LL6X 3E9HA 3ULLA 3C1EA 1G6PA 3D6WA 1G8ZD 1O7LA 1S5FD 3QO2A 4KJOA 4KY5A 4RA8A 1KC8C 1J5EL 4POFA 4QQBX 1O7IA 1A6XA 4KMUC 5ELOA 4HAEA 2MQHA 2WKCA 4CBVA 3FDTA 4KHPQ 2K52A 5JVH3 3C46A 3NBHA 4ZK9B 4A3IH 5GADC 3I2ZA 3JC66 3NSWA 1EZ6A 2UXBL 5C3EG 1YEZA 2NYZD 4XQJA 2JN4A 1HXYD 1KLGD 2ZTDA 3V96A 2PZUA 4DR1L 3DMUA 3K5MA 1A8VA 4A3MG 2K14A 4YWMA 4JI3L 1JJGA 1MGSA 5CV7A 1QNUA 4L63B 4K14A 1HJPA 1JJCB 2XSCA 3EA6A 3HFZB 1M1KC 3D0FA 3UI2A 2B2WA 5JEAH 1PH5A 2YU9B 2B39A 3S15B 4ZRZA 4JI7L 2VUMB 3H0GG 1O7ZA 3HKSA 4O42A 3D4DA 1XMQL 2ICIA 3L7ZC 1K0RA 2RVLA 4HR7B 4IPHA 4H0LC 3UE0A 3OW7A 2CCZA 3F2DA 3K81C 1L2FA 1SYDA 4G7OC 2JP1A 3OMGA 1CKNA 5I4DA 3F2CA 4QF4A 5IYDG 4V190 1S5BD 4R9WA 3BJUA 1GUNA 4BWGB 4LF6L 4YY3Q 3F2BA 5EBDA 1VF5C 4AYBG 3EIVA 3GTKB 2F0DA 5CV4A 4QCLA 1BDOA 1PMRA 2K5HA 1IZ6A 4DV3Q 2WV6D 3PUXA 4JV5Q 2ID0A 4RGNA 2DY8A 2RCFA 1T5EA 1F9QA 4L5RC 3LX0A 4GN3B 4NMZA 4DF7A 3MTSA 1MIUA 4TQUS 1XPRA 2B2YA 3S2DB 1CQFA 4EQ5A 3UDXA 5K36H 1YNJD 4JI5Q 5DM63 1B2TA 1LT6D 3K59A 5IP7H 4DUYL 1WCMG 1D5XC 1GUWA 4JBKA 4JI2Q 3VR2A 3E0EA 4LFAL 4KV6A 2KA7A 3J81i 3EJIA 1SNCA 5C4HA 4FYDA 3MXPA 2PI2E 4EVOA 2VNUD 3E9IA 1EU4A 5IGGA 3U4ZA 4QMGA 3H09A 2R7ZB 3MXNB 1EY9A 2OWOA 2BH8A 1YHQA 3BDLA 4LK1C 2M2LA 3RZDB 5GAGC 5GQOA 1E1TA 2F0UA 4HIDA 4RCNA 4AIMA 1OXTA 1V1OA 5CYUA 4BY7H 1JE5A 3AB9A 3F2UA 4L6TB 1CZWA 4K0KL 1V8QA 4A3FB 5C4XG 4A75A 4RHRA 3T1YQ 3U9SA 2Z1CA 4IUQA 1MJEA 2HHHQ 1C0AA 1V43A 5GROA 1V1PA 4DK6C 4IJHA 3K8AA 5IGBA 3F1ZA 2V1CC 2WINB 4JW0A 1TU2B 1VQHA 2KVMA 5FJ8H 1UAPA 2MUYA 4BA1I 2E2IH 3HOZB 3MAQA 1WD0A 3IAYA 2A68C 1GUTA 3A7LA 3A5UA 1WTXA 3FPUB 3R3OA 1I4XA 4S3SA 3H91A 1FNUA 4WORA 3PO2H 4JK1C 3A56A 4HJ9A 1XNQQ 1PYSB 1VQAA 1EIGA 2Q2IA 4DV5Q 4JI0Q 4GN5A 1JR0D 1EIYB 2PQEA 2C35B 3ER0A 4LFCL 3PUVA 4L5SA 4UHVA 4B3TQ 1ONLA 1CA5A 1G291 4F8MA 4YCWA 2L1BA 3HOUH 2MGSA 2KENA 1VQMA 3HGBA 4P74A 5C0XJ 1C4QA 1F2MA 1EQVA 2F0FA 4DV6Q 1TS5A 1K8MA 1G91A 3ULPA 4DR4L 2QILA 2KCMA 3RZOH 4X3TA 1ICWA 2IX3A 3CQZH 1DCZA 2NN6I 1FNWA 1XMOL 4CHTB 4HJ7A 1TWCB 2Q2TA 2ICEC 3DHQA 5I9OA 3CCJA 3WDNA 1KRTA 3NQIA 1GVPA 1HUNA 2QEXA 5C4ZA 5HY6A 1PYBA 2CH4A 1PFNA 1U4MA 4PNYA 2I07B 1E1OA 4GLAC 3GTJB 3HG9A 1SE3A 5ELBA 3W5OA 1FYCA 3AFQA 3EN2A 5BN4A 1FVIA 3OMCA 4PMCA 3GTLB 3L9AX 4CDEC 2NTSA 2JA7H 3I4NG 4O2DA 1B53A 3KOJA 1I3QH 1TS4A 5IYBH 1PFSA 1IYVA 5H1SE 2R7FA 5JJZA 4ODGA 4GOPC 2L55A 4LUZA 2E2JB 4K6DA 1VQ8A 4OO1G 1OO9B 1I4RA 1K8AC 3RUZA 1GUSA 4AQYL 5M3FH 2E2HH 5EKKA 3LWUA 4DV0L 4A3KG 2A74C 4A4IA 1STYA 2WKDA 1SAPA 1XXGA 2AQ3B 3GQBA 5CV9A 3P75A 2R3ZA 1SBBB 3BDCA 4C3JB 4JBMA 1LTBD 4DR7L 2A6HD 4OX9Q 5KIXA 1N8RC 4Y52H 1UE1A 1MI2A 1YHAA 1KXLA 2UU9Q 1WD1A 4MHEA 2EDGA 4B9XA 1XPOA 2Z9HA 3CW2C 3S9WA 4ID6A 4DFAA 4A3JB 1EFWA 4A3EB 4DV1L 5FOBB 1VMPA 1F2YA 2UXDL 4KKSA 4DXFA 1GOZA 2EYFA 2KBNA 5C3XA 4KI0A 2B2TA 5JEAJ 1OTCA 2NUCA 3AFPA 4N9TA 4CKBA 1PHJA 1X56A 2CW0D 5C5LA 4APVA 1TQOA 1N9WA 4DR2L 4A93B 2VXWA 1FNVA 1X32A 3TP7A 1L0YB 5ELCA 2O2LD 2MO0A 2PQAA 4A3DG 2EJFC 3KBGA 4B3RQ 4O0AA 3I4LA 1IKLA 1NCVA 1U4PA 2F0EA 3RR5A 3S14B 1HFNA 4RKLA 4X3UA 2BOSA 4OIKA 2B2UA 4X3KA 1X3EA 4A3IG 4DR5Q 2RQXA 3SK4A 4TVAB 3MZ5A 4Q0FA 1SNOA 3TEHB 5LHY1 1TIID 2QEJC 3VR4A 3GTMB 1IKMA 2EQSA 4A3CH 2JA5H 5FLXE 3KLSA 2I46A 1JC7A 1AFPA 3D3RA 5T1GA 3I56A 4DPGA 1PH7A 3DM3A 1NSNS 3K80C 5G3LD 4G7HC 2F4VQ 2F0PA 4QL5A 4JI6Q 5IT9E 1U4RA 1GO3E 4R4CA 1J5EQ 3T53B 1UNSA 2X6LA 4GN4B 1NBWA 5M5WH 3RLFA 5FO7B 1ESRA 4B3SL 4KKUA 5IOCA 4POGA 3TDQA 1Q86C 1KTKA 5EQ0A 2R93B 2GVAA 3HOXG 1HCZA 3KBXA 1VQ7A 5D14A 1TWAH 1E22A 4CDFC 1Y1VG 1JOOA 3SHLA 2R92H 1EQRA 2NZ1D 3S1MH 2ASBA 1RHPA 5T1IA 1I4GA 3AEVA 2VQFL 4DR1Q 2LSSA 5C4JB 4MN3A 2P5ZX 1Q1BA 2G9HD 4X66Q 2NVQB 2EY6A 3BZCA 4O1NA 1EY6A 1VQGA 4G4KA 4GKJL 2RDGA 2MO1A 2BCOA 1C7YA 1F9SA 2K5VA 4Z9CB 2SDFA 3BZDB 3HOYH 5C44H 4DAYB 1X3FA 4HIOA 2MPMA 2WACA 5FKAC 2N8NA 1BCPC 5IP7G 3TMEA 1TR5A 4R4IA 4IN3A 4HIKA 3HKZG 3PF4A 4FXDA 2Z6KC 2OQKA 2IX1A 3I91A 4DR6L 1H95A 1K0SA 1LTGD 3N6RA 5FLXc 1XNRL 4LW1A 1HNZQ 4LF6Q 2EJMA 2F0SA 3MEFA 3I4OA 2AQ1B 1E24A 1D1IA 5I6YA 3TREA 1W3SA 2RHQB 5CV8A 5IT9c 3CCMA 1A15A 2E2DC 4BY7G 1Y14B 3MEHA 1SNMA 3FKIH 1K3RA 2F0TA 5C3EB 4DUYQ 1Q81C 5ELDA 4LFAQ 2QA4A 3L0OA 1TWHB 2HD3A 3I72A 2F0LA 4A3MB 4JC0A 1HHVA 1J6QA 5FLXL 1YNND 4KY7A 1OXVA 2YTXA 1CZGA 2XRQD 4XXEA 3MWYW 1ZYRC 2K33A 3MXGA 1IL2A 1Z6HA 2BDNA 2ZXOA 1MJCA 2JQOA 3DWQA 3EFXD 5M3MH 4H13C 3EQLC 3H0GB 2HDLA 3IL8A 5IT9L 3K7UC 2VUMH 4AYBE 4JG2A 2A69C 5HGQA 5KYIA 5IGDA 3RD4A 3TQYA 4MNOA 2RBMA 4FP5D 3I4MH 3I90A 5HURA 1RDPD 5JJLA 3HOUG 2IPKD 3PGZA 4LUVA 4HMJA 2PNHA 2JA8B 4AYBB 1PTOD 3OPOA 5C0XH 2Z0SA 3KLSX 4OXPA 2IT1A 3ITPA 4NDXA 2OF1A 3T4AC 1RL2A 1ML0D 2F0MA 3J7AV 1SMYD 3KDFA 3SVMA 1D1KA 4C1NK 3VYTA 3DUZA 3KJOA 4KHVA 3S2DH 4RGOS 1IBMQ 1SN8A 3A8KE 3K5OA 2EY2A 1SYGA 5JOBA 1TWFB 4J6HA 2EE1A 2B8FA 4LFCQ 4UPAA 1X54A 3PUYA 1LV9A 5I2YA 2OXPA 2Z6KA 1PYWD 4HSPA 2CH4W 1VQEA 1BOSA 3TSSA 1X65A 1A3TA 1I4HA 1VQBA 3BVGA 4KKTA 1Q46A 3SK6A 2JA7G 4K2KA 2ZT9C 4DR4Q 3NELA 1UE5A 5I2XA 5IYBG 3MA2B 4IUTA 2OT2A 1PVOA 2YTVA 1IL8A 3RZDH 3JAME 1HQMC 1STEA 1ICFB 2F3VA 4DUZL 1QZGA 5C4XB 4A3BH 1M90C 1QUQB 4C3HG 1VQ5A 1SRUA 4GKKL 1RTNA 5M3FG 2VW9A 4YWLA 4OEMB 1X55A 3S16B 4RFBA 5G3LF 4ZLTF 4C2MB 1HPCA 1YITA 3L2PA 3E0JA 1TKWB 1JORA 2ZJRA 3SR1A 3HOZH 3VYRA 4I7ZC 1EOTA 2IJ0A 4X64L 3E5SA 3STBD 1HNXL 3IFTA 4UP8A 3KUPA 3GP7A 1HZ9A 2CQAA 1BBWA 1JE4A 3MXNA 1JOKA 1NE3A 3S17H 3KDFB 4LF7L 2R61A 5ELNA 1YZ6A 2PI2A 1B3AA 3GV3A 2VQEL 5EBCA 1L0WA 1OXSC 2K28A 3WWVA 2ZJQA 3GTGB 1SDFA 4LAAA 1YJWA 4BBSG 4L5QA 1B9MA 4FVMA 2HDMA 2EYLA 1ILPA 3Q23A 2BH2A 4NW2A 1D8LA 2UUAL 3Q22A 1VQ4A 3J7AF 3HOVH 1R4QB 4WRDA 2A73B 1VS0A 2K5NA 3A74A 4DV1Q 1WTOA 1B70B 2EXZA 3JAMc 3BG3A 5M9OA 1W2BA 4A3CG 4H7BA 3O13A 3MFGA 2JA5G 1VDZA 4HSVA 1EIHA 1NY4A 3NWTA 1JCKB 3TRZA 2CVRA 2JA6H 2I5LX 1W6KA 4BY1H 1HTPA 1N32L 1A3UA 1JOQA 1WJJA 4DR2Q 4F88A 4Y7NB 3I4NB 3GTLH 5LL6S 3CCQA 4FDBA 1MKHA 4G57A 4TRDA 4U68A 2WAQG 2DY7A 3AYHB 3DEPA 3HRZC 3Q8DA 4XIGS 4KD3A 4A3GB 2K7VA 5DEHA 4MZ9A 3W2DA 2CQOA 3JAML 2N78A 1P8LA 2O5IC 1CUKA 1EY8A 2EY1A 3R8BA 4A3KB 2O5JC 3PUWA 1YNJC 1U5KA 1AEXA 2DN8A 5EKLA 3BDOA 4YHHL 1GUOA 2VB3X 4C3JH 1AE3A 1SEBD 3R2IA 3U4VA 4R4QA 4NXML 3HOYG 4FF4A 1EWHA 3F8TA 3L3OC 3MFYA 4A3JH 3GD7A 4QB4A 3CCEA 1Q7YC 1LTID 1F2LA 3CC2A 4B3SQ 2XWJB 5I6WA 4V0BA 2UUBL 3K58A 3S1QB 3TP5A 2ATWA 2FMCA 2YTYA 3GDEA 3W1GA 3V05A 4X62Q 1IYJB 5FLMH 4G7ZC 1CKMA 3Q0AA 1H9KA 3OIQA 1PTOF 4OWTB 2K50A 1LLRD 2Y0SG 1MHWC 3H94A 3D6CA 1LO5D 2J0TD 3TS0A 1N33Q 1MBYA 5IYCH 3BYYB 4KK7A 3TS2A 4A93H 4A3DB 2TSSA 4DNIA 3D8GA 4DV7L 1KAWA 1PTOB 4CKEA 1LM0A 1TY2A 4DK3C 4GKJQ 3GTOH 3OIPA 2BA0A 3OW2A 2Z4IA 1QG7A 1R9TH 4A3IB 2PO4A 2B2TC 3EROA 4M8AA 3FKIG 3K0XA 3QR8A 1IHZA 1C9OA 3CD6A 1LT3D 3M7GA 4HCSA 2BA1A 4LF5Q 1PFMA 1E3PA 3SE0A 4LF8Q 3GTMH 4GS3A 3ICEA 2NN6H 2N55A 4LFBL 4BBRH 4HJ5A 5IY0A 5C6AA 1XTDA 2L5TA 4ZKBB 1EL0A 1U4LA 4P73A 4PMBA 3M7NA 1VQKA 1CFMA 2XGTA 1T9HA 2B2UC 1XYIA 1GJXA 1X3PA 3FEWX 5M3MG 1YJ9A 3SDZA 3QJYA 5BR8L 3CCLA 3D31A 2M9VA 5CGKA 1HNWQ 2VUMG 1B4OA 3OTOQ 1SFOH 1RKNA 4KTAA 2XVSA 1EY7A 4IOAA 2FFKB 3KYHC 3NP8A 3I4MG 1K83H 1I94Q 3S1RB 3SEBA 4IUUA 2B2VA 4LUOA 2QKIC 3HOXB 2OEOA 3J80E 1Y1VB 4DV2L 1VCIA 1WTHA 4IZ8A 1SNDA 4DK0A 3RNUA 4WJ3M 1ESFA 3I8ZA 1ASZA 1IBLL 1LTSD 1PH2A 1E2VA 1C8CA 5C0XG 3N52A 1TS3A 5C4JH 5M5YH 3LNNA 3CXCA 1PZJD 3HKZE 3PO3H 4WJWA 3TP8A 1OXUA 2B3GA 4MIUA 4NKLA 1FJGL 4PMWA 3T56B 2DNCA 4JBWA 4KLKA 1HA5A 4DN4M 4C3IH 5CMDA 2JEBI 2MHVA 5IODA 2N88A 1RTOA 1Y1WH 5DAUA 1UWVA 4KJNA 4XT1B 3HKZB 5EPLA 5IGFA 5JAVA 2ES2A 3CCSA 5IWAL 1EYGA 4FF3A 2RDFA 2F0IA 2FHTA 4JI1Q 2ZXRA 2YYZA 1GHJA 3S2HB 3M9BA 4MTKA 1SJHD 2EIFA 1V9PA 4DNRB 4ZQ3A 3K5NA 2DNEA 1J9OA 4NXNL 4F7XA 1I6HH 2PNRC 3DM1A 2MP1A 3VA7A 4AH6A 1SSOA 4RWSC 5DNFA 3SK8A 1D5ZC 3R93A 1EEFD 4RH6A 1NMGA 4A3BG 4JI8Q 1WTPA 3VR5A 1I4PA 1KD1C 2WP8J 3M85A 1GM5A 3PF5A 2F0VA 1XPUA 2A6HC 3M3YH 2A1AA 1QNKA 4DAYA 5AJ3L 1JT8A 1NNXA 5C3EH 1SR3A 3RLOA 4YY3L 3J80c 3CCRA 2L9HA 5FO9B 1TWHH 2JEAI 3KF8B 2UXCL 1ENFA 3K0YA 5J1ZA 4A3MH 4DAVA 2Q8IB 3KJPA 2E2IB 1FL0A 5ELFA 1F9PA 3HOZG 2FXQA 1S4ZA 1DJRD 4RAUC 3M4QA 3NPPA 1AE2A 4JI5L 3DXJC 2PYKA 2K75A 4NPSA 1FGBD 1YBYA 2CW0C 3ZYYX 4EQNA 3ND9A 3OYYA 5E7NA 1GD7A 2KCTA 3H6MA 4XDXA 3OWFA 1EQQA 2ZM6L 1DXMA 4GKKQ 3HOUB 2IW3A 5JEAG 3K5LA 1TWGH 4CJ2C 2QW7A 5JJIA 2E76C 2PW7A 3J80L 2JA8H 1KDBA 2F0KA 2XNAC 4CJ1B 1PV4A 1O80A 1LTTD 4DNTB 2JSOA 1SE4A 1TS2A 4JOIC 2K5QA 3HOVG 1HNXQ 2VY3A 4TSSA 2UXBQ 3CCVA 1PRTD 2NZOA 4UDUC 1X3GA 4FO2A 1Y8PB 2QF7A 1RD9D 4B9WA 1K9MC 1FGUA 2B63H 1TXYA 3NBIA 5D65A 2A6ED 2HHHL 1VF7A 1G6ZA 2JA6G 4JI3Q 3KLRA 1IYUA 4LF7Q 4ZUJA 5J22A 2F0HA 1JWSD 4BY1G 2B8GA 3AMUA 4U673 1B3QA 5K5PA 5K36G 1BNZA 3KK7A 1I5FA 4GZYC 1Z9FA 4JI7Q 2JA7B 4P75A 2JJQA 1I3QB 3HOWB 2EVBA 3NHHA 3T1HL 1XMQQ 1NR4A 2L4NA 1XNQL 2UUAQ 4JI0L 1FD7D 4X65L 1RODA 1Q3LA 1KNEA 4JCVE 3FMCA 4RCOA 5IE8A 3VDYA 4DA2A 4C3HB 4IUPA 1HFGA 3K6OA 4JYAL 5M3FB 1WTVA 1EUJA 4K8IA 3ERSX 2LY7A 1S72A 2VB2X 4DV6L 4QJFA 3PUZA 2WFWA 5E1FA 2G9DA 1KHIA 1FR3A 5EJWA 1A2UA 3UDFA 1JWMD 2BE5D 4PZ6A 1F2ZA 3X3NA 1BQQT 1N32Q 2RSNA 2EOTA 1EWCA 5CBEE 1KQSA 4GNXB 2HIXA 1Q8KA 4KN7C 4OWXB 3K7AB 3OSOA 3C3LA 2O4XA 2ZTEA 3SGIA 1VQJA 1GKHA 1VQ9A 3TP6A 2HIVA 3PIPA 3RLNA 1H9SB 1Y8OB 1LACA 4BXXH 1EWIA 1VQFA 5FJ8G 1PH8A 1VQCA 2K5DA 5FLMG 2EXDA 1V1QA 3I3CA 3D4RA 2JK8A 3I55A 3HP3A 2YU9H 5IYCG 4B08A 1QUQA 5E4XA 3I70A 3S15H 3PO2G 4BBSB 1Q82C 3EVQA 2J7ZA 4EQOA 3BZKA 2A8VA 1VQPA 1BBUA 1CK1A 4EQPA 1O78A 4B3ML 5EPKA 2D0PA 3GTQB 1JMCA 2NWGA 4JOIA 1MSGA 4K0KQ 4NXMQ 5KNBA 2CFMA 2F1MA 3DWPA 3VR3A 2L11A 4IQZA 1LYLA 1LABA 1YNNC 1SYBA 2CWAA 2EYOA 4HCEA 5KGUA 1CSQA 1PFBA 4WJ4A 4DAMA 2NN6G 3GTKH 5COYA 1X9NA 3S1NB 1KDCA 1S5DD 2BDOA 2I5HA 3UDGA 4BBRG 2WAQE 3PIOA 1SNQA 1I50B 5C5MA 4OX9L 4RKBA 1C48A 1SYFA 3J7A5 1DOMA 2AUKA 3BVMA 3G7LA 1ET6A 4Y7NH 4DV7Q 2OTJA 1WCMB 5M5WB 5FK9C 1QVFA 3GV6A 3D4WA 5M5XB 2AHOB 2EPBA 2WAQB 3TN2A 4CGYB 1DZ1A 4PQXA 1PTOC 1S5CD 4J1MA 2V4DA 1QJOA 3ERQA 3V2TA 4IUVA 1TWAB 4A3GH 5LMNL 3ZJYC 2K6AA 2KHIA 3KFUA 5CORA 3S1MB 5JVG3 1ILQA 2E75C 2D5DA 1J8IA 1EQTA 1SMYC 3QIAA 4DR3L 1D7QA 1VMCA 2R7ZH 4OWWB 4RMFA 1WTRA 1RJTA 3VR6A 4RG1A 4B3RL 3M4PA 3PO3G 1IW7D 5A2QE 1XMOQ 1OXXK 5J39A 2IHFA 1DGSA 4ME5A 3HOYB 3NK9A 2Y0SE 5BR8Q 4A3FH 4DR5L 2XWBB 3I7FA 4IFDH 3KF6B 4C3IG 3J7YW 1VQLA 4YCUA 1QB5D 1AW7A 1Y1WG 5GAHC 3NTKA 3ND8A 4IFDI 1KLUD 3QB3A 1QCBD 4LNQA 4I65A 2ZTCA 2G5DA 1IXRA 4K8JA 1B44D 1L1OB 4ZCKA 5TSSA 1MSHA 2Y0SB 1IBLQ 2PZTA 2NVYB 4PZ7A 5A35A 1JB7A
chains in the Genus database with same CATH topology
4IPDA 3TS0A 1N33Q 1OTCA 5IYCH 3AFPA 1PHJA 1HR0L 4A3DH 5JJKA 1X56A 3TS2A 4A93H 1I94L 4APVA 4HJAA 4DNIA 2B29A 1N9WA 4DV7L 4DR2L 1KAWA 2GN5A 1LM0A 1UE6A 4DK3C 2E5LL 2MO0A 2PQAA 1FJGQ 3GTGH 3GTOH 1IBKQ 4AQYQ 3GTPH 2BA0A 4A3DG 1BKBA 4B3RQ 4O0AA 3OW2A 3M4OH 4A93G 4P71A 1R9TH 3NENA 3KF6A 2WB1E 3RR5A 4GOPB 1VQNA 1SLJA 3FKIG 3K0XA 4YHHQ 3CPWA 3A5ZB 4DV0Q 4JI4L 1C9OA 3CD6A 2ZJPA 1X3EA 4HIMA 4DR5Q 4A3IG 4TVAB 3S17H 3PCOB 2BA1A 4LF5Q 4JBJA 4DR7Q 4LF9L 5EAYA 1E3PA 3STBC 3TEHB 1L1OA 5IWAQ 4LF8Q 4GS3A 5J3BA 3GTMH 3ICEA 4MTNA 3A0JA 4X66L 2I0QA 2EQSA 4A3CH 4LFBL 1S3OA 5LMUQ 4BBRH 5IP9G 2JA5H 4HJ5A 1KRSA 1PA6A 1YHBA 5IY0A 1XTDA 1TWCH 4R4TA 3I56A 4P73A 3M7NA 4DPGA 1VQKA 3RN5A 2XGTA 1A0IA 1T9HA 3DM3A 1PH7A 1SE8A 2UUBQ 3K80C 4NXNQ 2ALYB 1EOVA 2F4VQ 2WB1G 2NVXH 4QL5A 5M3MG 4JI6Q 4GLVB 5BR8L 3CCLA 2UXDQ 3D31A 1HNWQ 2VUMG 1N34Q 2N3SA 2KHJA 3OTOQ 1SFOH 4IPCA 4LF4Q 1GO3E 4R4CA 3GTJH 4IOAA 4JI1L 3S1RH 3KYHC 1LTLA 1J5EQ 2UU9L 4QIWE 4GN4B 2F3IA 3I4MG 1K83H 1NBWA 3HOXH 5M5WH 1I94Q 4H02A 5LMNW 3J81c 3RLFA 4DV4L 3I4NH 1Y1VH 4LUOA 5AJ3Q 4B3SL 4BA2I 2Q2HA 4POGA 3J81j 3G71A 4DV2L 1Q86C 1HNZL 1VCIA 3RNUA 4WJ3M 2JA8G 2GVAA 3HOXG 1VQ7A 1ASZA 1N36L 1IBLL 2UXCQ 1TWAH 1E22A 1QVCA 3EBEA 5C0XI 1PH2A 1Y1VG 2YV5A 4IJLA 2R93G 1WYDA 5C0XG 4UY8C 2R92H 1EQRA 3S1MH 2UUCQ 2OQ0A 1XJVA 2E2JH 2ASBA 3CAMA 2CWPA 4YCVA 4DKAC 5C4JH 4JI8L 5M5YH 3CXCA 4R1JA 3HKZE 2R7DA 3AEVA 2AWNA 2VQFL 1HH2P 3JAMi 2F52A 2K4KA 2LSSA 4DR1Q 3RN2A 1ASYA 3PO3H 2Q2UA 2OCEA 1VQDA 1Q1BA 4X66Q 1OXUA 4J15A 2R6GA 4A3KH 1SMXA 3BZCA 2AWOA 2R92G 4LFBQ 2B3GA 1VQGA 4GKJL 1FJGL 3KLWA 2MO1A 4PMWA 3U58A 1IBKL 1C7YA 1UE7A 1WOCA 4JBWA 4KLKA 2K5VA 2B63G 5GAEC 2RF4A 4C3IH 2NZHA 3HOYH 5C44H 4DAYB 2JEBI 2NVTH 1X3FA 1CKOA 2IX0A 4OONA 1NMFA 4HIOA 1Y1WH 2ZM6Q 1UWVA 2N8NA 2LXJA 3NBHB 5IP7G 4KHZA 2ES2A 3CCSA 1G51A 5IWAL 4R4IA 1EYGA 3S2HH 1A63A 5C44G 3HOWG 4EX5A 4JI1Q 3HKZG 4HIKA 4IO9A 1VQ6A 2JE6I 3PF4A 2YYZA 1BVSA 2Z6KC 3M9BA 2OQKA 4A3EH 2IX1A 1NTGA 3H3VH 4DR6L 2EIFA 1H95A 5LMUL 1V9PA 1HR0W 1PH4A 3S1QH 1CSPA 5FLXc 1HZAA 2OTLA 3GO5A 3H15A 2DGYA 1XNRL 3IRBA 4LW1A 4DV2Q 1B8AA 4NXNL 1HNZQ 4LF6Q 3H3VI 4A3LG 1YIJA 1I6HH 4P72A 1Z47A 2F4VL 1B7YB 3MEFA 2HT1A 3I4OA 4JI6L 4AH6A 1E24A 3ULJA 2IHEA 1N34L 1VQOA 3TREA 1W3SA 2RHQB 3E9HA 3ULLA 5IT9c 3CCMA 2N49A 4LF4L 3CC4A 1G6PA 1NMGA 4A3BG 1J5EL 4QQBX 4JI8Q 1PH3A 1KC8C 4POFA 2VQFQ 1O7IA 1KD1C 1Y14B 4BY7G 2WP8J 3M85A 1GM5A 3PF5A 4HJ8A 1XPUA 3M3YH 5ELOA 2MQHA 2A1AA 5AJ3L 3FKIH 1JT8A 4KHPQ 5C3EH 2K52A 1K3RA 1SR3A 3RLOA 4A3IH 4YY3L 5GADC 3S14H 3J80c 3G4SA 3I2ZA 4DUYQ 2D62A 3CCRA 1Q81C 3JC66 1TWHH 2JEAI 3KF8B 2UXCL 1CKNB 4LFAQ 2QA4A 4A3MH 3L0OA 2UXBL 5C3EG 1YEZA 3KJPA 1FL0A 2AKWB 2UUCL 2ZTDA 4JC0A 3T1HQ 5IP9H 2FXQA 3HOZG 1J6QA 1IBML 4DR1L 1OXVA 2YTXA 2E8GA 3M4QA 1IL2A 1A8VA 1HZBA 4X65Q 4A3MG 1AE2A 2K14A 4JI5L 4YWMA 2K75A 4NPSA 4JI3L 1JJGA 1MJCA 2JQOA 3S24A 1YBYA 2VL6A 4DR6Q 5M3MH 4BXXG 3PSIA 3CPFA 1HJPA 1JJCB 1M1KC 2GVBA 3HFZB 3D0FA 3OYYA 1PH5A 2VUMH 3K7UC 2RHSB 1E7ZA 5E7NA 1XNQQ 1GD7A 2KCTA 4JG2A 4AYBE 5HGQA 4JYAQ 1KIXA 1XNRQ 4JI7L 3TQYA 3H0GG 2PMZE 4MNOA 1EQQA 2ZM6L 3I4MH 2QGQA 3HKSA 4GKKQ 3G6EA 5JEAG 1XMQL 1TWGH 3L7ZC 3UE1A 1K0RA 1PH6A 4IPHA 5JJIA 5JJLA 3UE0A 4IPGA 3F2DA 2CCZA 3K81C 3HOUG 1L2FA 2JA8H 4LUVA 3PGZA 2PNHA 1PV4A 1CKNA 2D0OA 4LWCA 3F2CA 5IYDG 2R93H 2Z0SA 4OXPA 2IT1A 3BJUA 4LF6L 4YY3Q 3F2BA 4GNXC 4JOIC 4AYBG 3EIVA 3HOVG 1RL2A 1HNXQ 2VY3A 2UXBQ 3CCVA 3KDFA 2NZOA 2K5HA 1IZ6A 4DV3Q 4JV5Q 3PUXA 1X3GA 2ID0A 3KJOA 1YVCA 3S2DH 1IBMQ 1K9MC 4L5RC 1FGUA 4GN3B 1SN8A 2NVQH 2B63H 1TXYA 2L15A 1MIUA 4TQUS 1XPRA 2HHHL 4EQ5A 3UDXA 4JI5Q 2JA6G 4JI3Q 4IFDJ 4LF7Q 4LFCQ 4KHPL 4UPAA 1X54A 4BY1G 3PUYA 5IP7H 4DUYL 1WCMG 2Z6KA 4JBKA 1VQEA 1YNXA 1PH1A 4JI2Q 5K36G 3E0EA 1I5FA 4LFAL 1X65A 1Z9FA 4JI7Q 3HOWH 4P75A 4B3MQ 2JJQA 3J81i 2H5XA 1VQBA 1WFQA 3AQQA 4PG3A 1KL9A 1Q46A 2PI2E 3T1HL 1XMQQ 3E9IA 2VNUD 2JA7G 1XNQL 4R4OA 5DLQE 1EIFA 3NELA 2UUAQ 4JI0L 4DR4Q 4X65L 1UE5A 1K8GA 4A3GG 5IYBG 3U4ZA 4IOCA 2VZAA 4A3LH 4JCVE 4C3HH 3MXNB 5IE8A 2OWOA 3VDYA 1PVOA 2YTVA 3RZDH 1WI5A 2BH8A 1YHQA 4L5TA 1U0LA 4JYAL 3PV0A 4DUZL 1PH9A 1QZGA 2R7ZG 5GAGC 4A3BH 5GQOA 4QY7A 1M90C 1E1TA 1SROA 1EUJA 1QUQB 2A19A 4HIDA 4AIMA 3ERSX 1OXTA 1S72A 1SRUA 1VQ5A 1JE5A 4BY7H 4GKKL 4DV6L 4GLXA 5M3FG 4QJFA 3PUZA 4K0KL 2WFWA 5C4XG 2VW9A 4YWLA 1KHIA 4A75A 1S40A 1X55A 3UDFA 4PZ6A 3T1YQ 1N32Q 1AH9A 4A3FG 1KQSA 2DUDA 1MJEA 4IFDG 4GNXB 1YITA 2HIXA 3L2PA 2HHHQ 1V43A 1C0AA 1Q8KA 5GROA 1NJIC 3K7AH 2ZJRA 4DK6C 4IJHA 3K8AA 4OWXB 3HOZH 3CMEA 3F1ZA 2XTIA 2V1CC 4UP7A 5FJ8H 1VQHA 5JEAJ 4BA1I 2E2IH 2ZTEA 3SGIA 4X64L 1VQJA 3STBD 1YJNA 1HNXL 1GKHA 4UP8A 1VQ9A 3A5UA 2HIVA 3PIPA 5LMNQ 3RLNA 1HZ9A 1BBWA 4DV3L 4JV5L 4BXXH 3PO2H 1EWIA 1VQFA 5FJ8G 1NE3A 1VQCA 3J7ZC 1PH8A 4HJ9A 5FLMG 1PYSB 1VQAA 2EXDA 2Q2IA 4DV5Q 4JI0Q 4GN5A 1RIPA 1V1QA 4DR3Q 2JK8A 1EIYB 3I55A 3KDFB 4LF7L 3H0GH 2C35B 3ER0A 4LFCL 2YU9H 5IYCG 4BBSH 1QUQA 3PUVA 5ELNA 1YZ6A 2PI2A 3S15H 2VQEL 4L5SA 3PO2G 1L0WA 1OXSC 1VQIA 4B3TQ 3WWVA 1Q82C 2ZJQA 4JI2L 3BZKA 1YJWA 1G291 3CC7A 4DUZQ 2A8VA 3GTQH 1VQPA 1BBUA 4YCWA 3HOUH 4BBSG 1A62A 4B3ML 2KENA 1VQMA 2D0PA 4L5QA 4QGUA 2RCNA 4ME3A 1Q1EA 4P74A 5C0XJ 1JMCA 2MNAA 4DV6Q 4GNXA 4JOIA 4K0KQ 4NXMQ 2BH2A 4OO1I 3ULPA 1D8LA 3J80i 2UUAL 2CFMA 4YWKA 4DR4L 5IYDH 3B6YA 1LYLA 2KCMA 1VQ4A 3RZOH 3CQZH 3HOVH 2CWAA 3DLLA 2NN6I 3S1NH 1XMOL 1CSQA 4WJ4A 1VS0A 2K5NA 3A74A 4DV1Q 4HJ7A 1B70B 2NN6G 4DAMA 3JAMc 3GTKH 1X9NA 2Q2TA 1W2BA 4A3CG 1I50H 3U50C 2I5HA 3UDGA 3CCJA 4BBRG 2JA5G 2WAQE 3PIOA 1L1OC 4X6AH 1KRTA 4X64Q 1GVPA 1NY4A 2QEXA 3TRZA 2I5MX 5HY6A 2JA6H 2I5LX 4OX9L 1PYBA 1HR0Q 3J7A5 4BY1H 1QVGA 3T1YL 1N32L 1E1OA 1TWFH 4GLAC 1WCMH 4Y7NH 4GOPA 1WJJA 4DV7Q 4DR2Q 2OTJA 1HZCA 1K73C 5M5XH 4A76A 3W5OA 3AFQA 3EN2A 1X6OA 1QZHA 3FP9A 1QVFA 2E5LQ 3LGJA 1FVIA 3GTLH 2AHOB 1YI2A 2VQEQ 1LUZA 3CCQA 4FDBA 4NB3A 2HQLA 4X62L 1UEBA 2JA7H 4GKJQ 3I4NG 4O2DA 1MKHA 3KOJA 4JI4Q 1I3QH 4A3GH 2WAQG 5IYBH 1PFSA 5LMNL 3ZJYC 1N33L 3AYHB 2R7FA 3Q8DA 5H1SE 2KHIA 4XIGS 3KFUA 4GOPC 4LUZA 2AMCB 4ALPA 4LF9Q 4MZ9A 3FHWA 2CQOA 1VQ8A 4OO1G 3NEMA 4DV5L 3BU2A 4DR3L 1D7QA 2N78A 2R7ZH 1P8LA 4OWWB 1K8AC 1CUKA 4RMFA 3W1BA 4AQYL 4RG1A 4UP9A 1JJ2A 3UDIA 4B3RL 3M4PA 3PO3G 3PUWA 1Q12A 5M3FH 4B3TL 1XMOQ 2E2HH 1OXXK 1U5KA 5C4XH 3CCUA 2IHFA 2LXKA 4YHHL 4DV0L 4A3KG 4A4IA 1DGSA 1P16A 2PQAB 4C3JH 3CF5A 1AE3A 2Y0SE 5BR8Q 4A3FH 4DR5L 3I7FA 3CP0A 3G48A 3U4VA 4LF5L 4JBMA 3S16H 2MFIA 3KF6B 4R4QA 4DR7L 4LF8L 4NXML 4OX9Q 1VQLA 4C2MH 3HOYG 1N8RC 3CMAA 4YCUA 4Y52H 1UE1A 1YHAA 1Y1WG 5GAHC 2UU9Q 2JA9A 3F8TA 1KXLA 4A3JH 4IFDI 3GD7A 1XPOA 3CW2C 3CCEA 4DV4Q 4LNQA 1Q7YC 1EFWA 2ZTCA 1IXRA 3CC2A 4B3SQ 1L1OB 2CKZB 2VS1A 2UUBL 4DV1L 2ATWA 2YTYA 3GDEA 4A3JG 3W1GA 4A3EG 4PZ8A 1N36Q 2NVYH 1IYJB 4X62Q 1IBLQ 2UXDL 5FLMH 2IY5B 1HNWL 1CKMA 4XTCS 2KBNA 4OWTB 2K50A 3OTOL 4PZ7A 2Y0SG 4KI0A 1YJ9A 1JB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IPD A;  3TS0 A;  1N33 Q;  1OTC A;  5IYC H;  3AFP A;  1PHJ A;  1HR0 L;  4A3D H;  5JJK A;  1X56 A;  3TS2 A;  4A93 H;  1I94 L;  4APV A;  4HJA A;  4DNI A;  2B29 A;  1N9W A;  4DV7 L;  4DR2 L;  1KAW A;  2GN5 A;  1LM0 A;  1UE6 A;  4DK3 C;  2E5L L;  2MO0 A;  2PQA A;  1FJG Q;  3GTG H;  3GTO H;  1IBK Q;  4AQY Q;  3GTP H;  2BA0 A;  4A3D G;  1BKB A;  4B3R Q;  4O0A A;  3OW2 A;  3M4O H;  4A93 G;  4P71 A;  1R9T H;  3NEN A;  3KF6 A;  2WB1 E;  3RR5 A;  4GOP B;  1VQN A;  1SLJ A;  3FKI G;  3K0X A;  4YHH Q;  3CPW A;  3A5Z B;  4DV0 Q;  4JI4 L;  1C9O A;  3CD6 A;  2ZJP A;  1X3E A;  4HIM A;  4DR5 Q;  4A3I G;  4TVA B;  3S17 H;  3PCO B;  2BA1 A;  4LF5 Q;  4JBJ A;  4DR7 Q;  4LF9 L;  5EAY A;  1E3P A;  3STB C;  3TEH B;  1L1O A;  5IWA Q;  4LF8 Q;  4GS3 A;  5J3B A;  3GTM H;  3ICE A;  4MTN A;  3A0J A;  4X66 L;  2I0Q A;  2EQS A;  4A3C H;  4LFB L;  1S3O A;  5LMU Q;  4BBR H;  5IP9 G;  2JA5 H;  4HJ5 A;  1KRS A;  1PA6 A;  1YHB A;  5IY0 A;  1XTD A;  1TWC H;  4R4T A;  3I56 A;  4P73 A;  3M7N A;  4DPG A;  1VQK A;  3RN5 A;  2XGT A;  1A0I A;  1T9H A;  3DM3 A;  1PH7 A;  1SE8 A;  2UUB Q;  3K80 C;  4NXN Q;  2ALY B;  1EOV A;  2F4V Q;  2WB1 G;  2NVX H;  4QL5 A;  5M3M G;  4JI6 Q;  4GLV B;  5BR8 L;  3CCL A;  2UXD Q;  3D31 A;  1HNW Q;  2VUM G;  1N34 Q;  2N3S A;  2KHJ A;  3OTO Q;  1SFO H;  4IPC A;  4LF4 Q;  1GO3 E;  4R4C A;  3GTJ H;  4IOA A;  4JI1 L;  3S1R H;  3KYH C;  1LTL A;  1J5E Q;  2UU9 L;  4QIW E;  4GN4 B;  2F3I A;  3I4M G;  1K83 H;  1NBW A;  3HOX H;  5M5W H;  1I94 Q;  4H02 A;  5LMN W;  3J81 c;  3RLF A;  4DV4 L;  3I4N H;  1Y1V H;  4LUO A;  5AJ3 Q;  4B3S L;  4BA2 I;  2Q2H A;  4POG A;  3J81 j;  3G71 A;  4DV2 L;  1Q86 C;  1HNZ L;  1VCI A;  3RNU A;  4WJ3 M;  2JA8 G;  2GVA A;  3HOX G;  1VQ7 A;  1ASZ A;  1N36 L;  1IBL L;  2UXC Q;  1TWA H;  1E22 A;  1QVC A;  3EBE A;  5C0X I;  1PH2 A;  1Y1V G;  2YV5 A;  4IJL A;  2R93 G;  1WYD A;  5C0X G;  4UY8 C;  2R92 H;  1EQR A;  3S1M H;  2UUC Q;  2OQ0 A;  1XJV A;  2E2J H;  2ASB A;  3CAM A;  2CWP A;  4YCV A;  4DKA C;  5C4J H;  4JI8 L;  5M5Y H;  3CXC A;  4R1J A;  3HKZ E;  2R7D A;  3AEV A;  2AWN A;  2VQF L;  1HH2 P;  3JAM i;  2F52 A;  2K4K A;  2LSS A;  4DR1 Q;  3RN2 A;  1ASY A;  3PO3 H;  2Q2U A;  2OCE A;  1VQD A;  1Q1B A;  4X66 Q;  1OXU A;  4J15 A;  2R6G A;  4A3K H;  1SMX A;  3BZC A;  2AWO A;  2R92 G;  4LFB Q;  2B3G A;  1VQG A;  4GKJ L;  1FJG L;  3KLW A;  2MO1 A;  4PMW A;  3U58 A;  1IBK L;  1C7Y A;  1UE7 A;  1WOC A;  4JBW A;  4KLK A;  2K5V A;  2B63 G;  5GAE C;  2RF4 A;  4C3I H;  2NZH A;  3HOY H;  5C44 H;  4DAY B;  2JEB I;  2NVT H;  1X3F A;  1CKO A;  2IX0 A;  4OON A;  1NMF A;  4HIO A;  1Y1W H;  2ZM6 Q;  1UWV A;  2N8N A;  2LXJ A;  3NBH B;  5IP7 G;  4KHZ A;  2ES2 A;  3CCS A;  1G51 A;  5IWA L;  4R4I A;  1EYG A;  3S2H H;  1A63 A;  5C44 G;  3HOW G;  4EX5 A;  4JI1 Q;  3HKZ G;  4HIK A;  4IO9 A;  1VQ6 A;  2JE6 I;  3PF4 A;  2YYZ A;  1BVS A;  2Z6K C;  3M9B A;  2OQK A;  4A3E H;  2IX1 A;  1NTG A;  3H3V H;  4DR6 L;  2EIF A;  1H95 A;  5LMU L;  1V9P A;  1HR0 W;  1PH4 A;  3S1Q H;  1CSP A;  5FLX c;  1HZA A;  2OTL A;  3GO5 A;  3H15 A;  2DGY A;  1XNR L;  3IRB A;  4LW1 A;  4DV2 Q;  1B8A A;  4NXN L;  1HNZ Q;  4LF6 Q;  3H3V I;  4A3L G;  1YIJ A;  1I6H H;  4P72 A;  1Z47 A;  2F4V L;  1B7Y B;  3MEF A;  2HT1 A;  3I4O A;  4JI6 L;  4AH6 A;  1E24 A;  3ULJ A;  2IHE A;  1N34 L;  1VQO A;  3TRE A;  1W3S A;  2RHQ B;  3E9H A;  3ULL A;  5IT9 c;  3CCM A;  2N49 A;  4LF4 L;  3CC4 A;  1G6P A;  1NMG A;  4A3B G;  1J5E L;  4QQB X;  4JI8 Q;  1PH3 A;  1KC8 C;  4POF A;  2VQF Q;  1O7I A;  1KD1 C;  1Y14 B;  4BY7 G;  2WP8 J;  3M85 A;  1GM5 A;  3PF5 A;  4HJ8 A;  1XPU A;  3M3Y H;  5ELO A;  2MQH A;  2A1A A;  5AJ3 L;  3FKI H;  1JT8 A;  4KHP Q;  5C3E H;  2K52 A;  1K3R A;  1SR3 A;  3RLO A;  4A3I H;  4YY3 L;  5GAD C;  3S14 H;  3J80 c;  3G4S A;  3I2Z A;  4DUY Q;  2D62 A;  3CCR A;  1Q81 C;  3JC6 6;  1TWH H;  2JEA I;  3KF8 B;  2UXC L;  1CKN B;  4LFA Q;  2QA4 A;  4A3M H;  3L0O A;  2UXB L;  5C3E G;  1YEZ A;  3KJP A;  1FL0 A;  2AKW B;  2UUC L;  2ZTD A;  4JC0 A;  3T1H Q;  5IP9 H;  2FXQ A;  3HOZ G;  1J6Q A;  1IBM L;  4DR1 L;  1OXV A;  2YTX A;  2E8G A;  3M4Q A;  1IL2 A;  1A8V A;  1HZB A;  4X65 Q;  4A3M G;  1AE2 A;  2K14 A;  4JI5 L;  4YWM A;  2K75 A;  4NPS A;  4JI3 L;  1JJG A;  1MJC A;  2JQO A;  3S24 A;  1YBY A;  2VL6 A;  4DR6 Q;  5M3M H;  4BXX G;  3PSI A;  3CPF A;  1HJP A;  1JJC B;  1M1K C;  2GVB A;  3HFZ B;  3D0F A;  3OYY A;  1PH5 A;  2VUM H;  3K7U C;  2RHS B;  1E7Z A;  5E7N A;  1XNQ Q;  1GD7 A;  2KCT A;  4JG2 A;  4AYB E;  5HGQ A;  4JYA Q;  1KIX A;  1XNR Q;  4JI7 L;  3TQY A;  3H0G G;  2PMZ E;  4MNO A;  1EQQ A;  2ZM6 L;  3I4M H;  2QGQ A;  3HKS A;  4GKK Q;  3G6E A;  5JEA G;  1XMQ L;  1TWG H;  3L7Z C;  3UE1 A;  1K0R A;  1PH6 A;  4IPH A;  5JJI A;  5JJL A;  3UE0 A;  4IPG A;  3F2D A;  2CCZ A;  3K81 C;  3HOU G;  1L2F A;  2JA8 H;  4LUV A;  3PGZ A;  2PNH A;  1PV4 A;  1CKN A;  2D0O A;  4LWC A;  3F2C A;  5IYD G;  2R93 H;  2Z0S A;  4OXP A;  2IT1 A;  3BJU A;  4LF6 L;  4YY3 Q;  3F2B A;  4GNX C;  4JOI C;  4AYB G;  3EIV A;  3HOV G;  1RL2 A;  1HNX Q;  2VY3 A;  2UXB Q;  3CCV A;  3KDF A;  2NZO A;  2K5H A;  1IZ6 A;  4DV3 Q;  4JV5 Q;  3PUX A;  1X3G A;  2ID0 A;  3KJO A;  1YVC A;  3S2D H;  1IBM Q;  1K9M C;  4L5R C;  1FGU A;  4GN3 B;  1SN8 A;  2NVQ H;  2B63 H;  1TXY A;  2L15 A;  1MIU A;  4TQU S;  1XPR A;  2HHH L;  4EQ5 A;  3UDX A;  4JI5 Q;  2JA6 G;  4JI3 Q;  4IFD J;  4LF7 Q;  4LFC Q;  4KHP L;  4UPA A;  1X54 A;  4BY1 G;  3PUY A;  5IP7 H;  4DUY L;  1WCM G;  2Z6K A;  4JBK A;  1VQE A;  1YNX A;  1PH1 A;  4JI2 Q;  5K36 G;  3E0E A;  1I5F A;  4LFA L;  1X65 A;  1Z9F A;  4JI7 Q;  3HOW H;  4P75 A;  4B3M Q;  2JJQ A;  3J81 i;  2H5X A;  1VQB A;  1WFQ A;  3AQQ A;  4PG3 A;  1KL9 A;  1Q46 A;  2PI2 E;  3T1H L;  1XMQ Q;  3E9I A;  2VNU D;  2JA7 G;  1XNQ L;  4R4O A;  5DLQ E;  1EIF A;  3NEL A;  2UUA Q;  4JI0 L;  4DR4 Q;  4X65 L;  1UE5 A;  1K8G A;  4A3G G;  5IYB G;  3U4Z A;  4IOC A;  2VZA A;  4A3L H;  4JCV E;  4C3H H;  3MXN B;  5IE8 A;  2OWO A;  3VDY A;  1PVO A;  2YTV A;  3RZD H;  1WI5 A;  2BH8 A;  1YHQ A;  4L5T A;  1U0L A;  4JYA L;  3PV0 A;  4DUZ L;  1PH9 A;  1QZG A;  2R7Z G;  5GAG C;  4A3B H;  5GQO A;  4QY7 A;  1M90 C;  1E1T A;  1SRO A;  1EUJ A;  1QUQ B;  2A19 A;  4HID A;  4AIM A;  3ERS X;  1OXT A;  1S72 A;  1SRU A;  1VQ5 A;  1JE5 A;  4BY7 H;  4GKK L;  4DV6 L;  4GLX A;  5M3F G;  4QJF A;  3PUZ A;  4K0K L;  2WFW A;  5C4X G;  2VW9 A;  4YWL A;  1KHI A;  4A75 A;  1S40 A;  1X55 A;  3UDF A;  4PZ6 A;  3T1Y Q;  1N32 Q;  1AH9 A;  4A3F G;  1KQS A;  2DUD A;  1MJE A;  4IFD G;  4GNX B;  1YIT A;  2HIX A;  3L2P A;  2HHH Q;  1V43 A;  1C0A A;  1Q8K A;  5GRO A;  1NJI C;  3K7A H;  2ZJR A;  4DK6 C;  4IJH A;  3K8A A;  4OWX B;  3HOZ H;  3CME A;  3F1Z A;  2XTI A;  2V1C C;  4UP7 A;  5FJ8 H;  1VQH A;  5JEA J;  4BA1 I;  2E2I H;  2ZTE A;  3SGI A;  4X64 L;  1VQJ A;  3STB D;  1YJN A;  1HNX L;  1GKH A;  4UP8 A;  1VQ9 A;  3A5U A;  2HIV A;  3PIP A;  5LMN Q;  3RLN A;  1HZ9 A;  1BBW A;  4DV3 L;  4JV5 L;  4BXX H;  3PO2 H;  1EWI A;  1VQF A;  5FJ8 G;  1NE3 A;  1VQC A;  3J7Z C;  1PH8 A;  4HJ9 A;  5FLM G;  1PYS B;  1VQA A;  2EXD A;  2Q2I A;  4DV5 Q;  4JI0 Q;  4GN5 A;  1RIP A;  1V1Q A;  4DR3 Q;  2JK8 A;  1EIY B;  3I55 A;  3KDF B;  4LF7 L;  3H0G H;  2C35 B;  3ER0 A;  4LFC L;  2YU9 H;  5IYC G;  4BBS H;  1QUQ A;  3PUV A;  5ELN A;  1YZ6 A;  2PI2 A;  3S15 H;  2VQE L;  4L5S A;  3PO2 G;  1L0W A;  1OXS C;  1VQI A;  4B3T Q;  3WWV A;  1Q82 C;  2ZJQ A;  4JI2 L;  3BZK A;  1YJW A;  1G29 1;  3CC7 A;  4DUZ Q;  2A8V A;  3GTQ H;  1VQP A;  1BBU A;  4YCW A;  3HOU H;  4BBS G;  1A62 A;  4B3M L;  2KEN A;  1VQM A;  2D0P A;  4L5Q A;  4QGU A;  2RCN A;  4ME3 A;  1Q1E A;  4P74 A;  5C0X J;  1JMC A;  2MNA A;  4DV6 Q;  4GNX A;  4JOI A;  4K0K Q;  4NXM Q;  2BH2 A;  4OO1 I;  3ULP A;  1D8L A;  3J80 i;  2UUA L;  2CFM A;  4YWK A;  4DR4 L;  5IYD H;  3B6Y A;  1LYL A;  2KCM A;  1VQ4 A;  3RZO H;  3CQZ H;  3HOV H;  2CWA A;  3DLL A;  2NN6 I;  3S1N H;  1XMO L;  1CSQ A;  4WJ4 A;  1VS0 A;  2K5N A;  3A74 A;  4DV1 Q;  4HJ7 A;  1B70 B;  2NN6 G;  4DAM A;  3JAM c;  3GTK H;  1X9N A;  2Q2T A;  1W2B A;  4A3C G;  1I50 H;  3U50 C;  2I5H A;  3UDG A;  3CCJ A;  4BBR G;  2JA5 G;  2WAQ E;  3PIO A;  1L1O C;  4X6A H;  1KRT A;  4X64 Q;  1GVP A;  1NY4 A;  2QEX A;  3TRZ A;  2I5M X;  5HY6 A;  2JA6 H;  2I5L X;  4OX9 L;  1PYB A;  1HR0 Q;  3J7A 5;  4BY1 H;  1QVG A;  3T1Y L;  1N32 L;  1E1O A;  1TWF H;  4GLA C;  1WCM H;  4Y7N H;  4GOP A;  1WJJ A;  4DV7 Q;  4DR2 Q;  2OTJ A;  1HZC A;  1K73 C;  5M5X H;  4A76 A;  3W5O A;  3AFQ A;  3EN2 A;  1X6O A;  1QZH A;  3FP9 A;  1QVF A;  2E5L Q;  3LGJ A;  1FVI A;  3GTL H;  2AHO B;  1YI2 A;  2VQE Q;  1LUZ A;  3CCQ A;  4FDB A;  4NB3 A;  2HQL A;  4X62 L;  1UEB A;  2JA7 H;  4GKJ Q;  3I4N G;  4O2D A;  1MKH A;  3KOJ A;  4JI4 Q;  1I3Q H;  4A3G H;  2WAQ G;  5IYB H;  1PFS A;  5LMN L;  3ZJY C;  1N33 L;  3AYH B;  2R7F A;  3Q8D A;  5H1S E;  2KHI A;  4XIG S;  3KFU A;  4GOP C;  4LUZ A;  2AMC B;  4ALP A;  4LF9 Q;  4MZ9 A;  3FHW A;  2CQO A;  1VQ8 A;  4OO1 G;  3NEM A;  4DV5 L;  3BU2 A;  4DR3 L;  1D7Q A;  2N78 A;  2R7Z H;  1P8L A;  4OWW B;  1K8A C;  1CUK A;  4RMF A;  3W1B A;  4AQY L;  4RG1 A;  4UP9 A;  1JJ2 A;  3UDI A;  4B3R L;  3M4P A;  3PO3 G;  3PUW A;  1Q12 A;  5M3F H;  4B3T L;  1XMO Q;  2E2H H;  1OXX K;  1U5K A;  5C4X H;  3CCU A;  2IHF A;  2LXK A;  4YHH L;  4DV0 L;  4A3K G;  4A4I A;  1DGS A;  1P16 A;  2PQA B;  4C3J H;  3CF5 A;  1AE3 A;  2Y0S E;  5BR8 Q;  4A3F H;  4DR5 L;  3I7F A;  3CP0 A;  3G48 A;  3U4V A;  4LF5 L;  4JBM A;  3S16 H;  2MFI A;  3KF6 B;  4R4Q A;  4DR7 L;  4LF8 L;  4NXM L;  4OX9 Q;  1VQL A;  4C2M H;  3HOY G;  1N8R C;  3CMA A;  4YCU A;  4Y52 H;  1UE1 A;  1YHA A;  1Y1W G;  5GAH C;  2UU9 Q;  2JA9 A;  3F8T A;  1KXL A;  4A3J H;  4IFD I;  3GD7 A;  1XPO A;  3CW2 C;  3CCE A;  4DV4 Q;  4LNQ A;  1Q7Y C;  1EFW A;  2ZTC A;  1IXR A;  3CC2 A;  4B3S Q;  1L1O B;  2CKZ B;  2VS1 A;  2UUB L;  4DV1 L;  2ATW A;  2YTY A;  3GDE A;  4A3J G;  3W1G A;  4A3E G;  4PZ8 A;  1N36 Q;  2NVY H;  1IYJ B;  4X62 Q;  1IBL Q;  2UXD L;  5FLM H;  2IY5 B;  1HNW L;  1CKM A;  4XTC S;  2KBN A;  4OWT B;  2K50 A;  3OTO L;  4PZ7 A;  2Y0S G;  4KI0 A;  1YJ9 A;  1JB7 A; 
#chains in the Genus database with same CATH topology
 2D2C C;  4IPD A;  5JJK A;  1XTC D;  4A3D H;  4CKC A;  1HR0 L;  1JB3 A;  4YIJ A;  4TKO B;  2K04 A;  1PTO H;  4QUC A;  2B29 A;  2GN5 A;  1EZ8 A;  1PRT F;  2K1B A;  1E2Z A;  1AZP A;  1D5M C;  1E2W A;  1UE6 A;  2E5L L;  1EFI D;  4L8J A;  1FJG Q;  1CHQ D;  3FKI B;  4AQY Q;  1F77 A;  2MJ8 A;  4P71 A;  1S5E D;  1Q90 A;  2ENB A;  1G2T A;  4DK1 A;  3GTP B;  2XRS D;  2PW5 A;  3M4O B;  3CPW A;  4DV0 Q;  4JI4 L;  3A5Z B;  1PRT B;  4IUN A;  2ZJP A;  1QWY A;  1BCP F;  1UUP A;  4JBJ A;  4DR7 Q;  4LF9 L;  5EAY A;  1F9R A;  3STB C;  5IWA Q;  4XYO A;  3BYT B;  4MTN A;  3A0J A;  4X66 L;  4DU9 A;  1E0B A;  3T16 A;  4N8X 1;  1S3O A;  1PA6 A;  1KRS A;  1BCP B;  1TWC H;  5M3M B;  4R4T A;  4C56 C;  3RN5 A;  4NXN Q;  4OEL B;  2ALY B;  1EOV A;  2WB1 G;  1Z7T A;  2F0N A;  1SJE D;  1EYD A;  4GLV B;  2UXD Q;  2QDB A;  3I4M B;  2NVX B;  5EGT A;  2KHJ A;  3OHX C;  4IPC A;  3GTJ H;  3S1R H;  1EY0 A;  1LTL A;  4QIW E;  3VYS A;  1PZI D;  3HOX H;  5LMN W;  4FXK C;  3J81 c;  4DV4 L;  1Y1V H;  5AJ3 Q;  4RGM A;  4BA2 I;  3Q6S A;  3J81 j;  3G71 A;  1HNZ L;  2D9U A;  2X6G A;  2JA8 G;  4FNF A;  4N8F A;  2EYH A;  1N36 L;  3OWE B;  4KN4 C;  1QVC A;  1Y69 U;  2UXC Q;  3CRL C;  2YV5 A;  4IJL A;  4RGT A;  4UY8 C;  3I73 A;  1XJV A;  2E2J H;  1HQR D;  2CWP A;  3A8J E;  3CAM A;  4QIW B;  4R1J A;  2R7D A;  2B2V C;  3RN2 A;  4DXG A;  3JAM i;  1EY4 A;  2F52 A;  2K32 A;  5A2Q L;  2Q2U A;  1VQD A;  2X69 A;  5F2D A;  4N9P A;  2M00 A;  2SNS A;  5CBA E;  4J15 A;  2R92 G;  2EYM A;  1IBK L;  1KAB A;  1UE7 A;  1WOC A;  1NUC A;  5E4W C;  3MVV A;  2B63 G;  4ZAI A;  3TZU A;  1AP0 A;  4FXG C;  1CKO A;  4OON A;  1NMF A;  2K5W A;  4QUF A;  2ZM6 Q;  2DJF C;  1QE6 A;  3NBH B;  3J81 L;  2NVT B;  5EKI A;  4KHZ A;  1CM9 A;  3HS0 C;  2KUM A;  2JYO A;  2RA4 A;  2C5C A;  3NE5 B;  1G51 A;  1CI3 M;  3QOL A;  1A63 A;  3S2H H;  5C44 G;  2E74 C;  4EX5 A;  2F03 A;  4IO9 A;  1BVS A;  3NXW A;  4KD4 A;  4A3E H;  1I6V C;  1CTM A;  5LMU L;  1HR0 W;  2EYP A;  1CSP A;  3E3X A;  1HZA A;  2OTL A;  3GO5 A;  5KNC A;  2DGY A;  3IRB A;  1ET9 A;  2A68 D;  2KJX A;  1YIJ A;  3SXH A;  4P72 A;  1Z47 A;  3DWA A;  4A3B B;  1N34 L;  1VQO A;  1STA A;  3AU7 A;  2N49 A;  4CJ0 B;  4LMQ D;  1EYA A;  3CC4 A;  4HTH A;  4LF4 L;  3MC0 B;  1PH3 A;  1ENC A;  3HZX A;  2VQF Q;  3A7A B;  4FF1 A;  4HJ8 A;  5ISR A;  4CDC C;  4OIJ A;  1W6J A;  3BVZ A;  3CKI B;  1LTA D;  2H1E A;  4ZYS A;  3S14 H;  3G4S A;  3Q24 A;  2D62 A;  3DEO A;  4EGV A;  1CKN B;  3R2T A;  1NAP A;  2KHS A;  2AKW B;  2UUC L;  3T1H Q;  4XYQ A;  5IP9 H;  3NTI A;  4K5W A;  1IBM L;  2E8G A;  1PZK D;  5C3W A;  2FJ2 A;  1HZB A;  1TVX A;  2ZXP A;  4X65 Q;  3U9O A;  3S17 B;  2AQ2 B;  4M1U B;  3S24 A;  2VL6 A;  4DR6 Q;  4BXX G;  3PSI A;  3T51 B;  3CPF A;  1UEA B;  2GVB A;  1TT2 A;  5IGE A;  5IGC A;  2RHS B;  1E7Z A;  1JQY D;  4JYA Q;  2NTT A;  1KIX A;  1XNR Q;  4K2L A;  1KAA A;  2PMZ E;  1EEI D;  2KCC A;  2NBF A;  2QGQ A;  2PPB C;  1ZXT A;  3G6E A;  2F0G A;  4HED A;  3UE1 A;  2HQE A;  2EZV A;  1PH6 A;  2F0J A;  2Q8R E;  4IPG A;  3NQT A;  1HTL D;  2Q8T A;  4F87 A;  1EY5 A;  1EYC A;  3KF8 A;  2D0O A;  4LWC A;  2IWH A;  4E6I A;  1II3 A;  1GUG A;  2R93 H;  3HOV B;  2PMZ B;  1X3Q A;  1KDA A;  4GNX C;  1WTQ A;  3A8I E;  1CA6 A;  2NB0 A;  5AFW A;  2SEB D;  2WII B;  4ABN A;  2F0O A;  1STH A;  1B9N A;  4H44 C;  2KEE A;  5BN3 A;  2JA6 B;  1YVC A;  2NVQ H;  2L15 A;  4BY1 B;  3C1F A;  1K8O A;  4IFD J;  3IFD A;  4KHP L;  1CT1 D;  4CDD C;  1DYQ A;  4K6L A;  1YNX A;  1PH1 A;  3P7J A;  3HOW H;  1V1P B;  4B3M Q;  2H5X A;  1WFQ A;  3AQQ A;  4PG3 A;  1KL9 A;  4R4O A;  1ZKO A;  5DLQ E;  1EIF A;  1LT4 D;  2FIN B;  2LKV A;  3FPP A;  1K8G A;  4A3G G;  2QDL A;  4IOC A;  4A3L H;  2VZA A;  5FO8 B;  4C3H H;  2Z6B A;  5JPN C;  1D2B A;  2K03 A;  1WI5 A;  4DGZ A;  5KRU A;  4L5T A;  1U0L A;  3BS1 A;  3PV0 A;  1PH9 A;  2R7Z G;  1HRJ A;  4QY7 A;  1SRO A;  1AN8 A;  2A19 A;  4XT3 B;  4GLX A;  4WFN 3;  4BY7 B;  1S40 A;  3TZD A;  4OGQ C;  2SOB A;  1AH9 A;  4A3F G;  2DUD A;  4IFD G;  3NWS A;  3M4Y A;  1Y8N B;  3P20 A;  1NJI C;  3PIP 3;  3K7A H;  1H9M A;  4DAP A;  3X3M A;  2EJG C;  2IL8 A;  4ILW A;  2XTI A;  4UP7 A;  3CME A;  2HCC A;  1L0X B;  1YJN A;  4FF2 A;  5LMN Q;  5D3D A;  2LMC B;  4DV3 L;  4JV5 L;  1HUM A;  2L0C A;  3J7Z C;  1WVL A;  1M4V A;  3SK5 A;  1RIP A;  5D3I B;  3RMH A;  4DR3 Q;  3PO2 B;  3H0G H;  4BBS H;  3P1H A;  2HCI A;  1VQI A;  3GTO B;  1A3V A;  1DOL A;  4JI2 L;  3CC7 A;  3GTQ H;  4DUZ Q;  1K28 A;  1R9T B;  1QOH A;  1CQV A;  1A62 A;  1XWE A;  2PZW A;  4QGU A;  2RCN A;  4ME3 A;  1Q1E A;  1SXT A;  2MNA A;  4GNX A;  1KNA A;  4R8N A;  4HMI A;  3J80 i;  5IYD H;  3CHB D;  4YWK A;  2JXM B;  3B6Y A;  1TY0 A;  5CV6 A;  3PIO 3;  3FRP B;  2RKS A;  2LS0 1;  3DLL A;  1SYC A;  3RZO B;  3S1N H;  4BBR B;  4JPB W;  3CQZ B;  4IAL A;  2F0W A;  1H9S A;  3TBI B;  1I50 H;  3U50 C;  3CRK C;  2L12 A;  1L1O C;  4X6A H;  4X64 Q;  1SNP A;  2K01 A;  1DON A;  2I5M X;  3QWN A;  1DOK A;  1JIC A;  1HR0 Q;  1XX8 A;  1SFO B;  1QVG A;  3T1Y L;  1TWF H;  1LT5 D;  1WCM H;  4HN7 A;  4GOP A;  1HZC A;  1K83 B;  2TMP A;  1K73 C;  5M5X H;  4A76 A;  1X6O A;  2K05 A;  1QZH A;  3FP9 A;  3E6Z X;  3MXU A;  1WTW A;  2E5L Q;  3LGJ A;  4XQN A;  1PDQ A;  3QOJ A;  4IUR A;  1YI2 A;  2VQE Q;  1LUZ A;  1BCP D;  4NB3 A;  2HQL A;  4X62 L;  1UEB A;  1CHP D;  1H9J A;  5KND A;  4JI4 Q;  3CU7 A;  1N33 L;  4R8I A;  2DJG C;  2EY5 A;  2AMC B;  2H4O A;  3W3A A;  4ALP A;  4LF9 Q;  4PV1 C;  3FHW A;  1H9R A;  4BS9 A;  3NEM A;  4DV5 L;  5M5Y B;  5I9P A;  1PRT C;  3BU2 A;  3OOC A;  3PO3 B;  1D6E C;  3ONA B;  3W1B A;  4UP9 A;  1JJ2 A;  3UDI A;  4LJZ C;  2A6E C;  1Q12 A;  4B3T L;  4KY6 A;  2C9O A;  1BF4 A;  5C4X H;  1DD2 A;  3CCU A;  3URY A;  2LXK A;  2Z8L A;  2KCN A;  2E2H B;  4C3I B;  1P16 A;  2PQA B;  3CF5 A;  2KQ3 A;  1QIL A;  1Y1W B;  3NUC A;  3CP0 A;  3G48 A;  4LF5 L;  5E3F A;  4P2C B;  3S16 H;  2MFI A;  1RF2 D;  4LF8 L;  4C2M H;  3CMA A;  5CR3 A;  4RHS A;  3QG1 A;  2JA9 A;  3VYU A;  1STG A;  2F3W A;  4C3J G;  5IIF A;  5KEE A;  3HEJ A;  4DV4 Q;  3MHB A;  2F4I A;  2CKZ B;  2VS1 A;  1R4P B;  2HUG A;  1K3B C;  1BO0 A;  1T5X D;  2A5H A;  4A3J G;  1SE2 A;  4A3E G;  3A55 A;  4PZ8 A;  1N36 Q;  2NVY H;  1STN A;  1PLF A;  1I6H B;  2IY5 B;  1M8A A;  1HNW L;  4XTC S;  1B1Z A;  2CHB D;  3OTO L;  1ZYR D;  4Q5V A;  3PMF A;  1DM0 B;  2PCF B;  1I94 L;  4HJA A;  2Z4H A;  2J4X A;  2FMM A;  5DM7 3;  2BE5 C;  2A69 D;  4K5V A;  3M3Y B;  3GTG H;  1IBK Q;  3GTP H;  1BKB A;  1MD2 D;  3M4O H;  4A93 G;  1BUV T;  3NEN A;  5JPM C;  3KF6 A;  2WB1 E;  3FVQ A;  4X3S A;  4GOP B;  1VQN A;  1SLJ A;  4YHH Q;  4JVZ A;  5NUC A;  4HIM A;  1SYE A;  3PCO B;  2QCP X;  1Q8I A;  1L1O A;  5J3B A;  2I0Q A;  3IKJ A;  4ZKC B;  5LMU Q;  1A2T A;  5IP9 G;  1YHB A;  2WB1 B;  2JA5 B;  1RCV D;  2UUB Q;  3NTH A;  2RSO A;  1A0I A;  1HA6 A;  1SE8 A;  2LFN A;  4XQQ A;  4NP5 A;  2GA4 B;  2NVX H;  1AZQ A;  3T13 A;  3K57 A;  3H3V C;  1GHK A;  1N34 Q;  2N3S A;  2XN9 C;  1ENA A;  4OHJ A;  4LF4 Q;  1GXD C;  1TWG B;  4JI1 L;  2UU9 L;  2RDH A;  2F3I A;  3WOE A;  2B2W C;  3C2P A;  1EU3 A;  1O7Y A;  3A54 A;  4H02 A;  5L37 A;  3I4N H;  2SNM A;  1I4Q A;  2Q2H A;  2EYJ A;  5BN5 A;  3EBE A;  5C0X I;  4ULL A;  4OO1 H;  1PXU A;  2R93 G;  1WYD A;  3PQI A;  2UUC Q;  2OQ0 A;  4YCV A;  1G2S A;  4DKA C;  4K5X A;  4JI8 L;  1BR9 A;  2R92 B;  4OO1 I;  2AWN A;  1HH2 P;  1U9R A;  2K4K A;  4C1N I;  1ASY A;  2XIW A;  4J8Q A;  2OCE A;  5HGT A;  2B63 B;  2R6G A;  4A3K H;  1SMX A;  2AWO A;  4LFB Q;  5EPJ A;  1STB A;  1LTR D;  3KLW A;  3U58 A;  3LWE A;  1B50 A;  1ZEQ X;  5CV5 A;  2AUJ D;  5CC4 A;  2RF4 A;  5GAE C;  2NZH A;  2NVT H;  2F0Q A;  2KEC A;  2IX0 A;  5C44 B;  2LXJ A;  1NR2 A;  2B2Y C;  3WOF A;  3HOW G;  1VQ6 A;  2JE6 I;  1JWU D;  2KED A;  3J81 E;  4UAI A;  1NTG A;  4ZUI A;  3H3V H;  3G6J B;  3VA5 A;  1PH4 A;  1BBX C;  3S1Q H;  5KYL A;  2KOL A;  1BXT A;  3H15 A;  4I7A A;  5ELE A;  1B8A A;  4DV2 Q;  3H3V I;  4A3L G;  4OL7 A;  2F4V L;  1B7Y B;  2HT1 A;  1IW7 C;  4JI6 L;  3ULJ A;  2IHE A;  5LL6 X;  3E9H A;  3ULL A;  3C1E A;  1G6P A;  3D6W A;  1G8Z D;  1O7L A;  1S5F D;  3QO2 A;  4KJO A;  4KY5 A;  4RA8 A;  1KC8 C;  1J5E L;  4POF A;  4QQB X;  1O7I A;  1A6X A;  4KMU C;  5ELO A;  4HAE A;  2MQH A;  2WKC A;  4CBV A;  3FDT A;  4KHP Q;  2K52 A;  5JVH 3;  3C46 A;  3NBH A;  4ZK9 B;  4A3I H;  5GAD C;  3I2Z A;  3JC6 6;  3NSW A;  1EZ6 A;  2UXB L;  5C3E G;  1YEZ A;  2NYZ D;  4XQJ A;  2JN4 A;  1HXY D;  1KLG D;  2ZTD A;  3V96 A;  2PZU A;  4DR1 L;  3DMU A;  3K5M A;  1A8V A;  4A3M G;  2K14 A;  4YWM A;  4JI3 L;  1JJG A;  1MGS A;  5CV7 A;  1QNU A;  4L63 B;  4K14 A;  1HJP A;  1JJC B;  2XSC A;  3EA6 A;  3HFZ B;  1M1K C;  3D0F A;  3UI2 A;  2B2W A;  5JEA H;  1PH5 A;  2YU9 B;  2B39 A;  3S15 B;  4ZRZ A;  4JI7 L;  2VUM B;  3H0G G;  1O7Z A;  3HKS A;  4O42 A;  3D4D A;  1XMQ L;  2ICI A;  3L7Z C;  1K0R A;  2RVL A;  4HR7 B;  4IPH A;  4H0L C;  3UE0 A;  3OW7 A;  2CCZ A;  3F2D A;  3K81 C;  1L2F A;  1SYD A;  4G7O C;  2JP1 A;  3OMG A;  1CKN A;  5I4D A;  3F2C A;  4QF4 A;  5IYD G;  4V19 0;  1S5B D;  4R9W A;  3BJU A;  1GUN A;  4BWG B;  4LF6 L;  4YY3 Q;  3F2B A;  5EBD A;  1VF5 C;  4AYB G;  3EIV A;  3GTK B;  2F0D A;  5CV4 A;  4QCL A;  1BDO A;  1PMR A;  2K5H A;  1IZ6 A;  4DV3 Q;  2WV6 D;  3PUX A;  4JV5 Q;  2ID0 A;  4RGN A;  2DY8 A;  2RCF A;  1T5E A;  1F9Q A;  4L5R C;  3LX0 A;  4GN3 B;  4NMZ A;  4DF7 A;  3MTS A;  1MIU A;  4TQU S;  1XPR A;  2B2Y A;  3S2D B;  1CQF A;  4EQ5 A;  3UDX A;  5K36 H;  1YNJ D;  4JI5 Q;  5DM6 3;  1B2T A;  1LT6 D;  3K59 A;  5IP7 H;  4DUY L;  1WCM G;  1D5X C;  1GUW A;  4JBK A;  4JI2 Q;  3VR2 A;  3E0E A;  4LFA L;  4KV6 A;  2KA7 A;  3J81 i;  3EJI A;  1SNC A;  5C4H A;  4FYD A;  3MXP A;  2PI2 E;  4EVO A;  2VNU D;  3E9I A;  1EU4 A;  5IGG A;  3U4Z A;  4QMG A;  3H09 A;  2R7Z B;  3MXN B;  1EY9 A;  2OWO A;  2BH8 A;  1YHQ A;  3BDL A;  4LK1 C;  2M2L A;  3RZD B;  5GAG C;  5GQO A;  1E1T A;  2F0U A;  4HID A;  4RCN A;  4AIM A;  1OXT A;  1V1O A;  5CYU A;  4BY7 H;  1JE5 A;  3AB9 A;  3F2U A;  4L6T B;  1CZW A;  4K0K L;  1V8Q A;  4A3F B;  5C4X G;  4A75 A;  4RHR A;  3T1Y Q;  3U9S A;  2Z1C A;  4IUQ A;  1MJE A;  2HHH Q;  1C0A A;  1V43 A;  5GRO A;  1V1P A;  4DK6 C;  4IJH A;  3K8A A;  5IGB A;  3F1Z A;  2V1C C;  2WIN B;  4JW0 A;  1TU2 B;  1VQH A;  2KVM A;  5FJ8 H;  1UAP A;  2MUY A;  4BA1 I;  2E2I H;  3HOZ B;  3MAQ A;  1WD0 A;  3IAY A;  2A68 C;  1GUT A;  3A7L A;  3A5U A;  1WTX A;  3FPU B;  3R3O A;  1I4X A;  4S3S A;  3H91 A;  1FNU A;  4WOR A;  3PO2 H;  4JK1 C;  3A56 A;  4HJ9 A;  1XNQ Q;  1PYS B;  1VQA A;  1EIG A;  2Q2I A;  4DV5 Q;  4JI0 Q;  4GN5 A;  1JR0 D;  1EIY B;  2PQE A;  2C35 B;  3ER0 A;  4LFC L;  3PUV A;  4L5S A;  4UHV A;  4B3T Q;  1ONL A;  1CA5 A;  1G29 1;  4F8M A;  4YCW A;  2L1B A;  3HOU H;  2MGS A;  2KEN A;  1VQM A;  3HGB A;  4P74 A;  5C0X J;  1C4Q A;  1F2M A;  1EQV A;  2F0F A;  4DV6 Q;  1TS5 A;  1K8M A;  1G91 A;  3ULP A;  4DR4 L;  2QIL A;  2KCM A;  3RZO H;  4X3T A;  1ICW A;  2IX3 A;  3CQZ H;  1DCZ A;  2NN6 I;  1FNW A;  1XMO L;  4CHT B;  4HJ7 A;  1TWC B;  2Q2T A;  2ICE C;  3DHQ A;  5I9O A;  3CCJ A;  3WDN A;  1KRT A;  3NQI A;  1GVP A;  1HUN A;  2QEX A;  5C4Z A;  5HY6 A;  1PYB A;  2CH4 A;  1PFN A;  1U4M A;  4PNY A;  2I07 B;  1E1O A;  4GLA C;  3GTJ B;  3HG9 A;  1SE3 A;  5ELB A;  3W5O A;  1FYC A;  3AFQ A;  3EN2 A;  5BN4 A;  1FVI A;  3OMC A;  4PMC A;  3GTL B;  3L9A X;  4CDE C;  2NTS A;  2JA7 H;  3I4N G;  4O2D A;  1B53 A;  3KOJ A;  1I3Q H;  1TS4 A;  5IYB H;  1PFS A;  1IYV A;  5H1S E;  2R7F A;  5JJZ A;  4ODG A;  4GOP C;  2L55 A;  4LUZ A;  2E2J B;  4K6D A;  1VQ8 A;  4OO1 G;  1OO9 B;  1I4R A;  1K8A C;  3RUZ A;  1GUS A;  4AQY L;  5M3F H;  2E2H H;  5EKK A;  3LWU A;  4DV0 L;  4A3K G;  2A74 C;  4A4I A;  1STY A;  2WKD A;  1SAP A;  1XXG A;  2AQ3 B;  3GQB A;  5CV9 A;  3P75 A;  2R3Z A;  1SBB B;  3BDC A;  4C3J B;  4JBM A;  1LTB D;  4DR7 L;  2A6H D;  4OX9 Q;  5KIX A;  1N8R C;  4Y52 H;  1UE1 A;  1MI2 A;  1YHA A;  1KXL A;  2UU9 Q;  1WD1 A;  4MHE A;  2EDG A;  4B9X A;  1XPO A;  2Z9H A;  3CW2 C;  3S9W A;  4ID6 A;  4DFA A;  4A3J B;  1EFW A;  4A3E B;  4DV1 L;  5FOB B;  1VMP A;  1F2Y A;  2UXD L;  4KKS A;  4DXF A;  1GOZ A;  2EYF A;  2KBN A;  5C3X A;  4KI0 A;  2B2T A;  5JEA J;  1OTC A;  2NUC A;  3AFP A;  4N9T A;  4CKB A;  1PHJ A;  1X56 A;  2CW0 D;  5C5L A;  4APV A;  1TQO A;  1N9W A;  4DR2 L;  4A93 B;  2VXW A;  1FNV A;  1X32 A;  3TP7 A;  1L0Y B;  5ELC A;  2O2L D;  2MO0 A;  2PQA A;  4A3D G;  2EJF C;  3KBG A;  4B3R Q;  4O0A A;  3I4L A;  1IKL A;  1NCV A;  1U4P A;  2F0E A;  3RR5 A;  3S14 B;  1HFN A;  4RKL A;  4X3U A;  2BOS A;  4OIK A;  2B2U A;  4X3K A;  1X3E A;  4A3I G;  4DR5 Q;  2RQX A;  3SK4 A;  4TVA B;  3MZ5 A;  4Q0F A;  1SNO A;  3TEH B;  5LHY 1;  1TII D;  2QEJ C;  3VR4 A;  3GTM B;  1IKM A;  2EQS A;  4A3C H;  2JA5 H;  5FLX E;  3KLS A;  2I46 A;  1JC7 A;  1AFP A;  3D3R A;  5T1G A;  3I56 A;  4DPG A;  1PH7 A;  3DM3 A;  1NSN S;  3K80 C;  5G3L D;  4G7H C;  2F4V Q;  2F0P A;  4QL5 A;  4JI6 Q;  5IT9 E;  1U4R A;  1GO3 E;  4R4C A;  1J5E Q;  3T53 B;  1UNS A;  2X6L A;  4GN4 B;  1NBW A;  5M5W H;  3RLF A;  5FO7 B;  1ESR A;  4B3S L;  4KKU A;  5IOC A;  4POG A;  3TDQ A;  1Q86 C;  1KTK A;  5EQ0 A;  2R93 B;  2GVA A;  3HOX G;  1HCZ A;  3KBX A;  1VQ7 A;  5D14 A;  1TWA H;  1E22 A;  4CDF C;  1Y1V G;  1JOO A;  3SHL A;  2R92 H;  1EQR A;  2NZ1 D;  3S1M H;  2ASB A;  1RHP A;  5T1I A;  1I4G A;  3AEV A;  2VQF L;  4DR1 Q;  2LSS A;  5C4J B;  4MN3 A;  2P5Z X;  1Q1B A;  2G9H D;  4X66 Q;  2NVQ B;  2EY6 A;  3BZC A;  4O1N A;  1EY6 A;  1VQG A;  4G4K A;  4GKJ L;  2RDG A;  2MO1 A;  2BCO A;  1C7Y A;  1F9S A;  2K5V A;  4Z9C B;  2SDF A;  3BZD B;  3HOY H;  5C44 H;  4DAY B;  1X3F A;  4HIO A;  2MPM A;  2WAC A;  5FKA C;  2N8N A;  1BCP C;  5IP7 G;  3TME A;  1TR5 A;  4R4I A;  4IN3 A;  4HIK A;  3HKZ G;  3PF4 A;  4FXD A;  2Z6K C;  2OQK A;  2IX1 A;  3I91 A;  4DR6 L;  1H95 A;  1K0S A;  1LTG D;  3N6R A;  5FLX c;  1XNR L;  4LW1 A;  1HNZ Q;  4LF6 Q;  2EJM A;  2F0S A;  3MEF A;  3I4O A;  2AQ1 B;  1E24 A;  1D1I A;  5I6Y A;  3TRE A;  1W3S A;  2RHQ B;  5CV8 A;  5IT9 c;  3CCM A;  1A15 A;  2E2D C;  4BY7 G;  1Y14 B;  3MEH A;  1SNM A;  3FKI H;  1K3R A;  2F0T A;  5C3E B;  4DUY Q;  1Q81 C;  5ELD A;  4LFA Q;  2QA4 A;  3L0O A;  1TWH B;  2HD3 A;  3I72 A;  2F0L A;  4A3M B;  4JC0 A;  1HHV A;  1J6Q A;  5FLX L;  1YNN D;  4KY7 A;  1OXV A;  2YTX A;  1CZG A;  2XRQ D;  4XXE A;  3MWY W;  1ZYR C;  2K33 A;  3MXG A;  1IL2 A;  1Z6H A;  2BDN A;  2ZXO A;  1MJC A;  2JQO A;  3DWQ A;  3EFX D;  5M3M H;  4H13 C;  3EQL C;  3H0G B;  2HDL A;  3IL8 A;  5IT9 L;  3K7U C;  2VUM H;  4AYB E;  4JG2 A;  2A69 C;  5HGQ A;  5KYI A;  5IGD A;  3RD4 A;  3TQY A;  4MNO A;  2RBM A;  4FP5 D;  3I4M H;  3I90 A;  5HUR A;  1RDP D;  5JJL A;  3HOU G;  2IPK D;  3PGZ A;  4LUV A;  4HMJ A;  2PNH A;  2JA8 B;  4AYB B;  1PTO D;  3OPO A;  5C0X H;  2Z0S A;  3KLS X;  4OXP A;  2IT1 A;  3ITP A;  4NDX A;  2OF1 A;  3T4A C;  1RL2 A;  1ML0 D;  2F0M A;  3J7A V;  1SMY D;  3KDF A;  3SVM A;  1D1K A;  4C1N K;  3VYT A;  3DUZ A;  3KJO A;  4KHV A;  3S2D H;  4RGO S;  1IBM Q;  1SN8 A;  3A8K E;  3K5O A;  2EY2 A;  1SYG A;  5JOB A;  1TWF B;  4J6H A;  2EE1 A;  2B8F A;  4LFC Q;  4UPA A;  1X54 A;  3PUY A;  1LV9 A;  5I2Y A;  2OXP A;  2Z6K A;  1PYW D;  4HSP A;  2CH4 W;  1VQE A;  1BOS A;  3TSS A;  1X65 A;  1A3T A;  1I4H A;  1VQB A;  3BVG A;  4KKT A;  1Q46 A;  3SK6 A;  2JA7 G;  4K2K A;  2ZT9 C;  4DR4 Q;  3NEL A;  1UE5 A;  5I2X A;  5IYB G;  3MA2 B;  4IUT A;  2OT2 A;  1PVO A;  2YTV A;  1IL8 A;  3RZD H;  3JAM E;  1HQM C;  1STE A;  1ICF B;  2F3V A;  4DUZ L;  1QZG A;  5C4X B;  4A3B H;  1M90 C;  1QUQ B;  4C3H G;  1VQ5 A;  1SRU A;  4GKK L;  1RTN A;  5M3F G;  2VW9 A;  4YWL A;  4OEM B;  1X55 A;  3S16 B;  4RFB A;  5G3L F;  4ZLT F;  4C2M B;  1HPC A;  1YIT A;  3L2P A;  3E0J A;  1TKW B;  1JOR A;  2ZJR A;  3SR1 A;  3HOZ H;  3VYR A;  4I7Z C;  1EOT A;  2IJ0 A;  4X64 L;  3E5S A;  3STB D;  1HNX L;  3IFT A;  4UP8 A;  3KUP A;  3GP7 A;  1HZ9 A;  2CQA A;  1BBW A;  1JE4 A;  3MXN A;  1JOK A;  1NE3 A;  3S17 H;  3KDF B;  4LF7 L;  2R61 A;  5ELN A;  1YZ6 A;  2PI2 A;  1B3A A;  3GV3 A;  2VQE L;  5EBC A;  1L0W A;  1OXS C;  2K28 A;  3WWV A;  2ZJQ A;  3GTG B;  1SDF A;  4LAA A;  1YJW A;  4BBS G;  4L5Q A;  1B9M A;  4FVM A;  2HDM A;  2EYL A;  1ILP A;  3Q23 A;  2BH2 A;  4NW2 A;  1D8L A;  2UUA L;  3Q22 A;  1VQ4 A;  3J7A F;  3HOV H;  1R4Q B;  4WRD A;  2A73 B;  1VS0 A;  2K5N A;  3A74 A;  4DV1 Q;  1WTO A;  1B70 B;  2EXZ A;  3JAM c;  3BG3 A;  5M9O A;  1W2B A;  4A3C G;  4H7B A;  3O13 A;  3MFG A;  2JA5 G;  1VDZ A;  4HSV A;  1EIH A;  1NY4 A;  3NWT A;  1JCK B;  3TRZ A;  2CVR A;  2JA6 H;  2I5L X;  1W6K A;  4BY1 H;  1HTP A;  1N32 L;  1A3U A;  1JOQ A;  1WJJ A;  4DR2 Q;  4F88 A;  4Y7N B;  3I4N B;  3GTL H;  5LL6 S;  3CCQ A;  4FDB A;  1MKH A;  4G57 A;  4TRD A;  4U68 A;  2WAQ G;  2DY7 A;  3AYH B;  3DEP A;  3HRZ C;  3Q8D A;  4XIG S;  4KD3 A;  4A3G B;  2K7V A;  5DEH A;  4MZ9 A;  3W2D A;  2CQO A;  3JAM L;  2N78 A;  1P8L A;  2O5I C;  1CUK A;  1EY8 A;  2EY1 A;  3R8B A;  4A3K B;  2O5J C;  3PUW A;  1YNJ C;  1U5K A;  1AEX A;  2DN8 A;  5EKL A;  3BDO A;  4YHH L;  1GUO A;  2VB3 X;  4C3J H;  1AE3 A;  1SEB D;  3R2I A;  3U4V A;  4R4Q A;  4NXM L;  3HOY G;  4FF4 A;  1EWH A;  3F8T A;  3L3O C;  3MFY A;  4A3J H;  3GD7 A;  4QB4 A;  3CCE A;  1Q7Y C;  1LTI D;  1F2L A;  3CC2 A;  4B3S Q;  2XWJ B;  5I6W A;  4V0B A;  2UUB L;  3K58 A;  3S1Q B;  3TP5 A;  2ATW A;  2FMC A;  2YTY A;  3GDE A;  3W1G A;  3V05 A;  4X62 Q;  1IYJ B;  5FLM H;  4G7Z C;  1CKM A;  3Q0A A;  1H9K A;  3OIQ A;  1PTO F;  4OWT B;  2K50 A;  1LLR D;  2Y0S G;  1MHW C;  3H94 A;  3D6C A;  1LO5 D;  2J0T D;  3TS0 A;  1N33 Q;  1MBY A;  5IYC H;  3BYY B;  4KK7 A;  3TS2 A;  4A93 H;  4A3D B;  2TSS A;  4DNI A;  3D8G A;  4DV7 L;  1KAW A;  1PTO B;  4CKE A;  1LM0 A;  1TY2 A;  4DK3 C;  4GKJ Q;  3GTO H;  3OIP A;  2BA0 A;  3OW2 A;  2Z4I A;  1QG7 A;  1R9T H;  4A3I B;  2PO4 A;  2B2T C;  3ERO A;  4M8A A;  3FKI G;  3K0X A;  3QR8 A;  1IHZ A;  1C9O A;  3CD6 A;  1LT3 D;  3M7G A;  4HCS A;  2BA1 A;  4LF5 Q;  1PFM A;  1E3P A;  3SE0 A;  4LF8 Q;  3GTM H;  4GS3 A;  3ICE A;  2NN6 H;  2N55 A;  4LFB L;  4BBR H;  4HJ5 A;  5IY0 A;  5C6A A;  1XTD A;  2L5T A;  4ZKB B;  1EL0 A;  1U4L A;  4P73 A;  4PMB A;  3M7N A;  1VQK A;  1CFM A;  2XGT A;  1T9H A;  2B2U C;  1XYI A;  1GJX A;  1X3P A;  3FEW X;  5M3M G;  1YJ9 A;  3SDZ A;  3QJY A;  5BR8 L;  3CCL A;  3D31 A;  2M9V A;  5CGK A;  1HNW Q;  2VUM G;  1B4O A;  3OTO Q;  1SFO H;  1RKN A;  4KTA A;  2XVS A;  1EY7 A;  4IOA A;  2FFK B;  3KYH C;  3NP8 A;  3I4M G;  1K83 H;  1I94 Q;  3S1R B;  3SEB A;  4IUU A;  2B2V A;  4LUO A;  2QKI C;  3HOX B;  2OEO A;  3J80 E;  1Y1V B;  4DV2 L;  1VCI A;  1WTH A;  4IZ8 A;  1SND A;  4DK0 A;  3RNU A;  4WJ3 M;  1ESF A;  3I8Z A;  1ASZ A;  1IBL L;  1LTS D;  1PH2 A;  1E2V A;  1C8C A;  5C0X G;  3N52 A;  1TS3 A;  5C4J H;  5M5Y H;  3LNN A;  3CXC A;  1PZJ D;  3HKZ E;  3PO3 H;  4WJW A;  3TP8 A;  1OXU A;  2B3G A;  4MIU A;  4NKL A;  1FJG L;  4PMW A;  3T56 B;  2DNC A;  4JBW A;  4KLK A;  1HA5 A;  4DN4 M;  4C3I H;  5CMD A;  2JEB I;  2MHV A;  5IOD A;  2N88 A;  1RTO A;  1Y1W H;  5DAU A;  1UWV A;  4KJN A;  4XT1 B;  3HKZ B;  5EPL A;  5IGF A;  5JAV A;  2ES2 A;  3CCS A;  5IWA L;  1EYG A;  4FF3 A;  2RDF A;  2F0I A;  2FHT A;  4JI1 Q;  2ZXR A;  2YYZ A;  1GHJ A;  3S2H B;  3M9B A;  4MTK A;  1SJH D;  2EIF A;  1V9P A;  4DNR B;  4ZQ3 A;  3K5N A;  2DNE A;  1J9O A;  4NXN L;  4F7X A;  1I6H H;  2PNR C;  3DM1 A;  2MP1 A;  3VA7 A;  4AH6 A;  1SSO A;  4RWS C;  5DNF A;  3SK8 A;  1D5Z C;  3R93 A;  1EEF D;  4RH6 A;  1NMG A;  4A3B G;  4JI8 Q;  1WTP A;  3VR5 A;  1I4P A;  1KD1 C;  2WP8 J;  3M85 A;  1GM5 A;  3PF5 A;  2F0V A;  1XPU A;  2A6H C;  3M3Y H;  2A1A A;  1QNK A;  4DAY A;  5AJ3 L;  1JT8 A;  1NNX A;  5C3E H;  1SR3 A;  3RLO A;  4YY3 L;  3J80 c;  3CCR A;  2L9H A;  5FO9 B;  1TWH H;  2JEA I;  3KF8 B;  2UXC L;  1ENF A;  3K0Y A;  5J1Z A;  4A3M H;  4DAV A;  2Q8I B;  3KJP A;  2E2I B;  1FL0 A;  5ELF A;  1F9P A;  3HOZ G;  2FXQ A;  1S4Z A;  1DJR D;  4RAU C;  3M4Q A;  3NPP A;  1AE2 A;  4JI5 L;  3DXJ C;  2PYK A;  2K75 A;  4NPS A;  1FGB D;  1YBY A;  2CW0 C;  3ZYY X;  4EQN A;  3ND9 A;  3OYY A;  5E7N A;  1GD7 A;  2KCT A;  3H6M A;  4XDX A;  3OWF A;  1EQQ A;  2ZM6 L;  1DXM A;  4GKK Q;  3HOU B;  2IW3 A;  5JEA G;  3K5L A;  1TWG H;  4CJ2 C;  2QW7 A;  5JJI A;  2E76 C;  2PW7 A;  3J80 L;  2JA8 H;  1KDB A;  2F0K A;  2XNA C;  4CJ1 B;  1PV4 A;  1O80 A;  1LTT D;  4DNT B;  2JSO A;  1SE4 A;  1TS2 A;  4JOI C;  2K5Q A;  3HOV G;  1HNX Q;  2VY3 A;  4TSS A;  2UXB Q;  3CCV A;  1PRT D;  2NZO A;  4UDU C;  1X3G A;  4FO2 A;  1Y8P B;  2QF7 A;  1RD9 D;  4B9W A;  1K9M C;  1FGU A;  2B63 H;  1TXY A;  3NBI A;  5D65 A;  2A6E D;  2HHH L;  1VF7 A;  1G6Z A;  2JA6 G;  4JI3 Q;  3KLR A;  1IYU A;  4LF7 Q;  4ZUJ A;  5J22 A;  2F0H A;  1JWS D;  4BY1 G;  2B8G A;  3AMU A;  4U67 3;  1B3Q A;  5K5P A;  5K36 G;  1BNZ A;  3KK7 A;  1I5F A;  4GZY C;  1Z9F A;  4JI7 Q;  2JA7 B;  4P75 A;  2JJQ A;  1I3Q B;  3HOW B;  2EVB A;  3NHH A;  3T1H L;  1XMQ Q;  1NR4 A;  2L4N A;  1XNQ L;  2UUA Q;  4JI0 L;  1FD7 D;  4X65 L;  1ROD A;  1Q3L A;  1KNE A;  4JCV E;  3FMC A;  4RCO A;  5IE8 A;  3VDY A;  4DA2 A;  4C3H B;  4IUP A;  1HFG A;  3K6O A;  4JYA L;  5M3F B;  1WTV A;  1EUJ A;  4K8I A;  3ERS X;  2LY7 A;  1S72 A;  2VB2 X;  4DV6 L;  4QJF A;  3PUZ A;  2WFW A;  5E1F A;  2G9D A;  1KHI A;  1FR3 A;  5EJW A;  1A2U A;  3UDF A;  1JWM D;  2BE5 D;  4PZ6 A;  1F2Z A;  3X3N A;  1BQQ T;  1N32 Q;  2RSN A;  2EOT A;  1EWC A;  5CBE E;  1KQS A;  4GNX B;  2HIX A;  1Q8K A;  4KN7 C;  4OWX B;  3K7A B;  3OSO A;  3C3L A;  2O4X A;  2ZTE A;  3SGI A;  1VQJ A;  1GKH A;  1VQ9 A;  3TP6 A;  2HIV A;  3PIP A;  3RLN A;  1H9S B;  1Y8O B;  1LAC A;  4BXX H;  1EWI A;  1VQF A;  5FJ8 G;  1PH8 A;  1VQC A;  2K5D A;  5FLM G;  2EXD A;  1V1Q A;  3I3C A;  3D4R A;  2JK8 A;  3I55 A;  3HP3 A;  2YU9 H;  5IYC G;  4B08 A;  1QUQ A;  5E4X A;  3I70 A;  3S15 H;  3PO2 G;  4BBS B;  1Q82 C;  3EVQ A;  2J7Z A;  4EQO A;  3BZK A;  2A8V A;  1VQP A;  1BBU A;  1CK1 A;  4EQP A;  1O78 A;  4B3M L;  5EPK A;  2D0P A;  3GTQ B;  1JMC A;  2NWG A;  4JOI A;  1MSG A;  4K0K Q;  4NXM Q;  5KNB A;  2CFM A;  2F1M A;  3DWP A;  3VR3 A;  2L11 A;  4IQZ A;  1LYL A;  1LAB A;  1YNN C;  1SYB A;  2CWA A;  2EYO A;  4HCE A;  5KGU A;  1CSQ A;  1PFB A;  4WJ4 A;  4DAM A;  2NN6 G;  3GTK H;  5COY A;  1X9N A;  3S1N B;  1KDC A;  1S5D D;  2BDO A;  2I5H A;  3UDG A;  4BBR G;  2WAQ E;  3PIO A;  1SNQ A;  1I50 B;  5C5M A;  4OX9 L;  4RKB A;  1C48 A;  1SYF A;  3J7A 5;  1DOM A;  2AUK A;  3BVM A;  3G7L A;  1ET6 A;  4Y7N H;  4DV7 Q;  2OTJ A;  1WCM B;  5M5W B;  5FK9 C;  1QVF A;  3GV6 A;  3D4W A;  5M5X B;  2AHO B;  2EPB A;  2WAQ B;  3TN2 A;  4CGY B;  1DZ1 A;  4PQX A;  1PTO C;  1S5C D;  4J1M A;  2V4D A;  1QJO A;  3ERQ A;  3V2T A;  4IUV A;  1TWA B;  4A3G H;  5LMN L;  3ZJY C;  2K6A A;  2KHI A;  3KFU A;  5COR A;  3S1M B;  5JVG 3;  1ILQ A;  2E75 C;  2D5D A;  1J8I A;  1EQT A;  1SMY C;  3QIA A;  4DR3 L;  1D7Q A;  1VMC A;  2R7Z H;  4OWW B;  4RMF A;  1WTR A;  1RJT A;  3VR6 A;  4RG1 A;  4B3R L;  3M4P A;  3PO3 G;  1IW7 D;  5A2Q E;  1XMO Q;  1OXX K;  5J39 A;  2IHF A;  1DGS A;  4ME5 A;  3HOY B;  3NK9 A;  2Y0S E;  5BR8 Q;  4A3F H;  4DR5 L;  2XWB B;  3I7F A;  4IFD H;  3KF6 B;  4C3I G;  3J7Y W;  1VQL A;  4YCU A;  1QB5 D;  1AW7 A;  1Y1W G;  5GAH C;  3NTK A;  3ND8 A;  4IFD I;  1KLU D;  3QB3 A;  1QCB D;  4LNQ A;  4I65 A;  2ZTC A;  2G5D A;  1IXR A;  4K8J A;  1B44 D;  1L1O B;  4ZCK A;  5TSS A;  1MSH A;  2Y0S B;  1IBL Q;  2PZT A;  2NVY B;  4PZ7 A;  5A35 A;  1JB7 A; 
#chains in the Genus database with same CATH homology
 4IPD A;  3TS0 A;  1N33 Q;  1OTC A;  5IYC H;  3AFP A;  1PHJ A;  1HR0 L;  4A3D H;  5JJK A;  1X56 A;  3TS2 A;  4A93 H;  1I94 L;  4APV A;  4HJA A;  4DNI A;  2B29 A;  1N9W A;  4DV7 L;  4DR2 L;  1KAW A;  2GN5 A;  1LM0 A;  1UE6 A;  4DK3 C;  2E5L L;  2MO0 A;  2PQA A;  1FJG Q;  3GTG H;  3GTO H;  1IBK Q;  4AQY Q;  3GTP H;  2BA0 A;  4A3D G;  1BKB A;  4B3R Q;  4O0A A;  3OW2 A;  3M4O H;  4A93 G;  4P71 A;  1R9T H;  3NEN A;  3KF6 A;  2WB1 E;  3RR5 A;  4GOP B;  1VQN A;  1SLJ A;  3FKI G;  3K0X A;  4YHH Q;  3CPW A;  3A5Z B;  4DV0 Q;  4JI4 L;  1C9O A;  3CD6 A;  2ZJP A;  1X3E A;  4HIM A;  4DR5 Q;  4A3I G;  4TVA B;  3S17 H;  3PCO B;  2BA1 A;  4LF5 Q;  4JBJ A;  4DR7 Q;  4LF9 L;  5EAY A;  1E3P A;  3STB C;  3TEH B;  1L1O A;  5IWA Q;  4LF8 Q;  4GS3 A;  5J3B A;  3GTM H;  3ICE A;  4MTN A;  3A0J A;  4X66 L;  2I0Q A;  2EQS A;  4A3C H;  4LFB L;  1S3O A;  5LMU Q;  4BBR H;  5IP9 G;  2JA5 H;  4HJ5 A;  1KRS A;  1PA6 A;  1YHB A;  5IY0 A;  1XTD A;  1TWC H;  4R4T A;  3I56 A;  4P73 A;  3M7N A;  4DPG A;  1VQK A;  3RN5 A;  2XGT A;  1A0I A;  1T9H A;  3DM3 A;  1PH7 A;  1SE8 A;  2UUB Q;  3K80 C;  4NXN Q;  2ALY B;  1EOV A;  2F4V Q;  2WB1 G;  2NVX H;  4QL5 A;  5M3M G;  4JI6 Q;  4GLV B;  5BR8 L;  3CCL A;  2UXD Q;  3D31 A;  1HNW Q;  2VUM G;  1N34 Q;  2N3S A;  2KHJ A;  3OTO Q;  1SFO H;  4IPC A;  4LF4 Q;  1GO3 E;  4R4C A;  3GTJ H;  4IOA A;  4JI1 L;  3S1R H;  3KYH C;  1LTL A;  1J5E Q;  2UU9 L;  4QIW E;  4GN4 B;  2F3I A;  3I4M G;  1K83 H;  1NBW A;  3HOX H;  5M5W H;  1I94 Q;  4H02 A;  5LMN W;  3J81 c;  3RLF A;  4DV4 L;  3I4N H;  1Y1V H;  4LUO A;  5AJ3 Q;  4B3S L;  4BA2 I;  2Q2H A;  4POG A;  3J81 j;  3G71 A;  4DV2 L;  1Q86 C;  1HNZ L;  1VCI A;  3RNU A;  4WJ3 M;  2JA8 G;  2GVA A;  3HOX G;  1VQ7 A;  1ASZ A;  1N36 L;  1IBL L;  2UXC Q;  1TWA H;  1E22 A;  1QVC A;  3EBE A;  5C0X I;  1PH2 A;  1Y1V G;  2YV5 A;  4IJL A;  2R93 G;  1WYD A;  5C0X G;  4UY8 C;  2R92 H;  1EQR A;  3S1M H;  2UUC Q;  2OQ0 A;  1XJV A;  2E2J H;  2ASB A;  3CAM A;  2CWP A;  4YCV A;  4DKA C;  5C4J H;  4JI8 L;  5M5Y H;  3CXC A;  4R1J A;  3HKZ E;  2R7D A;  3AEV A;  2AWN A;  2VQF L;  1HH2 P;  3JAM i;  2F52 A;  2K4K A;  2LSS A;  4DR1 Q;  3RN2 A;  1ASY A;  3PO3 H;  2Q2U A;  2OCE A;  1VQD A;  1Q1B A;  4X66 Q;  1OXU A;  4J15 A;  2R6G A;  4A3K H;  1SMX A;  3BZC A;  2AWO A;  2R92 G;  4LFB Q;  2B3G A;  1VQG A;  4GKJ L;  1FJG L;  3KLW A;  2MO1 A;  4PMW A;  3U58 A;  1IBK L;  1C7Y A;  1UE7 A;  1WOC A;  4JBW A;  4KLK A;  2K5V A;  2B63 G;  5GAE C;  2RF4 A;  4C3I H;  2NZH A;  3HOY H;  5C44 H;  4DAY B;  2JEB I;  2NVT H;  1X3F A;  1CKO A;  2IX0 A;  4OON A;  1NMF A;  4HIO A;  1Y1W H;  2ZM6 Q;  1UWV A;  2N8N A;  2LXJ A;  3NBH B;  5IP7 G;  4KHZ A;  2ES2 A;  3CCS A;  1G51 A;  5IWA L;  4R4I A;  1EYG A;  3S2H H;  1A63 A;  5C44 G;  3HOW G;  4EX5 A;  4JI1 Q;  3HKZ G;  4HIK A;  4IO9 A;  1VQ6 A;  2JE6 I;  3PF4 A;  2YYZ A;  1BVS A;  2Z6K C;  3M9B A;  2OQK A;  4A3E H;  2IX1 A;  1NTG A;  3H3V H;  4DR6 L;  2EIF A;  1H95 A;  5LMU L;  1V9P A;  1HR0 W;  1PH4 A;  3S1Q H;  1CSP A;  5FLX c;  1HZA A;  2OTL A;  3GO5 A;  3H15 A;  2DGY A;  1XNR L;  3IRB A;  4LW1 A;  4DV2 Q;  1B8A A;  4NXN L;  1HNZ Q;  4LF6 Q;  3H3V I;  4A3L G;  1YIJ A;  1I6H H;  4P72 A;  1Z47 A;  2F4V L;  1B7Y B;  3MEF A;  2HT1 A;  3I4O A;  4JI6 L;  4AH6 A;  1E24 A;  3ULJ A;  2IHE A;  1N34 L;  1VQO A;  3TRE A;  1W3S A;  2RHQ B;  3E9H A;  3ULL A;  5IT9 c;  3CCM A;  2N49 A;  4LF4 L;  3CC4 A;  1G6P A;  1NMG A;  4A3B G;  1J5E L;  4QQB X;  4JI8 Q;  1PH3 A;  1KC8 C;  4POF A;  2VQF Q;  1O7I A;  1KD1 C;  1Y14 B;  4BY7 G;  2WP8 J;  3M85 A;  1GM5 A;  3PF5 A;  4HJ8 A;  1XPU A;  3M3Y H;  5ELO A;  2MQH A;  2A1A A;  5AJ3 L;  3FKI H;  1JT8 A;  4KHP Q;  5C3E H;  2K52 A;  1K3R A;  1SR3 A;  3RLO A;  4A3I H;  4YY3 L;  5GAD C;  3S14 H;  3J80 c;  3G4S A;  3I2Z A;  4DUY Q;  2D62 A;  3CCR A;  1Q81 C;  3JC6 6;  1TWH H;  2JEA I;  3KF8 B;  2UXC L;  1CKN B;  4LFA Q;  2QA4 A;  4A3M H;  3L0O A;  2UXB L;  5C3E G;  1YEZ A;  3KJP A;  1FL0 A;  2AKW B;  2UUC L;  2ZTD A;  4JC0 A;  3T1H Q;  5IP9 H;  2FXQ A;  3HOZ G;  1J6Q A;  1IBM L;  4DR1 L;  1OXV A;  2YTX A;  2E8G A;  3M4Q A;  1IL2 A;  1A8V A;  1HZB A;  4X65 Q;  4A3M G;  1AE2 A;  2K14 A;  4JI5 L;  4YWM A;  2K75 A;  4NPS A;  4JI3 L;  1JJG A;  1MJC A;  2JQO A;  3S24 A;  1YBY A;  2VL6 A;  4DR6 Q;  5M3M H;  4BXX G;  3PSI A;  3CPF A;  1HJP A;  1JJC B;  1M1K C;  2GVB A;  3HFZ B;  3D0F A;  3OYY A;  1PH5 A;  2VUM H;  3K7U C;  2RHS B;  1E7Z A;  5E7N A;  1XNQ Q;  1GD7 A;  2KCT A;  4JG2 A;  4AYB E;  5HGQ A;  4JYA Q;  1KIX A;  1XNR Q;  4JI7 L;  3TQY A;  3H0G G;  2PMZ E;  4MNO A;  1EQQ A;  2ZM6 L;  3I4M H;  2QGQ A;  3HKS A;  4GKK Q;  3G6E A;  5JEA G;  1XMQ L;  1TWG H;  3L7Z C;  3UE1 A;  1K0R A;  1PH6 A;  4IPH A;  5JJI A;  5JJL A;  3UE0 A;  4IPG A;  3F2D A;  2CCZ A;  3K81 C;  3HOU G;  1L2F A;  2JA8 H;  4LUV A;  3PGZ A;  2PNH A;  1PV4 A;  1CKN A;  2D0O A;  4LWC A;  3F2C A;  5IYD G;  2R93 H;  2Z0S A;  4OXP A;  2IT1 A;  3BJU A;  4LF6 L;  4YY3 Q;  3F2B A;  4GNX C;  4JOI C;  4AYB G;  3EIV A;  3HOV G;  1RL2 A;  1HNX Q;  2VY3 A;  2UXB Q;  3CCV A;  3KDF A;  2NZO A;  2K5H A;  1IZ6 A;  4DV3 Q;  4JV5 Q;  3PUX A;  1X3G A;  2ID0 A;  3KJO A;  1YVC A;  3S2D H;  1IBM Q;  1K9M C;  4L5R C;  1FGU A;  4GN3 B;  1SN8 A;  2NVQ H;  2B63 H;  1TXY A;  2L15 A;  1MIU A;  4TQU S;  1XPR A;  2HHH L;  4EQ5 A;  3UDX A;  4JI5 Q;  2JA6 G;  4JI3 Q;  4IFD J;  4LF7 Q;  4LFC Q;  4KHP L;  4UPA A;  1X54 A;  4BY1 G;  3PUY A;  5IP7 H;  4DUY L;  1WCM G;  2Z6K A;  4JBK A;  1VQE A;  1YNX A;  1PH1 A;  4JI2 Q;  5K36 G;  3E0E A;  1I5F A;  4LFA L;  1X65 A;  1Z9F A;  4JI7 Q;  3HOW H;  4P75 A;  4B3M Q;  2JJQ A;  3J81 i;  2H5X A;  1VQB A;  1WFQ A;  3AQQ A;  4PG3 A;  1KL9 A;  1Q46 A;  2PI2 E;  3T1H L;  1XMQ Q;  3E9I A;  2VNU D;  2JA7 G;  1XNQ L;  4R4O A;  5DLQ E;  1EIF A;  3NEL A;  2UUA Q;  4JI0 L;  4DR4 Q;  4X65 L;  1UE5 A;  1K8G A;  4A3G G;  5IYB G;  3U4Z A;  4IOC A;  2VZA A;  4A3L H;  4JCV E;  4C3H H;  3MXN B;  5IE8 A;  2OWO A;  3VDY A;  1PVO A;  2YTV A;  3RZD H;  1WI5 A;  2BH8 A;  1YHQ A;  4L5T A;  1U0L A;  4JYA L;  3PV0 A;  4DUZ L;  1PH9 A;  1QZG A;  2R7Z G;  5GAG C;  4A3B H;  5GQO A;  4QY7 A;  1M90 C;  1E1T A;  1SRO A;  1EUJ A;  1QUQ B;  2A19 A;  4HID A;  4AIM A;  3ERS X;  1OXT A;  1S72 A;  1SRU A;  1VQ5 A;  1JE5 A;  4BY7 H;  4GKK L;  4DV6 L;  4GLX A;  5M3F G;  4QJF A;  3PUZ A;  4K0K L;  2WFW A;  5C4X G;  2VW9 A;  4YWL A;  1KHI A;  4A75 A;  1S40 A;  1X55 A;  3UDF A;  4PZ6 A;  3T1Y Q;  1N32 Q;  1AH9 A;  4A3F G;  1KQS A;  2DUD A;  1MJE A;  4IFD G;  4GNX B;  1YIT A;  2HIX A;  3L2P A;  2HHH Q;  1V43 A;  1C0A A;  1Q8K A;  5GRO A;  1NJI C;  3K7A H;  2ZJR A;  4DK6 C;  4IJH A;  3K8A A;  4OWX B;  3HOZ H;  3CME A;  3F1Z A;  2XTI A;  2V1C C;  4UP7 A;  5FJ8 H;  1VQH A;  5JEA J;  4BA1 I;  2E2I H;  2ZTE A;  3SGI A;  4X64 L;  1VQJ A;  3STB D;  1YJN A;  1HNX L;  1GKH A;  4UP8 A;  1VQ9 A;  3A5U A;  2HIV A;  3PIP A;  5LMN Q;  3RLN A;  1HZ9 A;  1BBW A;  4DV3 L;  4JV5 L;  4BXX H;  3PO2 H;  1EWI A;  1VQF A;  5FJ8 G;  1NE3 A;  1VQC A;  3J7Z C;  1PH8 A;  4HJ9 A;  5FLM G;  1PYS B;  1VQA A;  2EXD A;  2Q2I A;  4DV5 Q;  4JI0 Q;  4GN5 A;  1RIP A;  1V1Q A;  4DR3 Q;  2JK8 A;  1EIY B;  3I55 A;  3KDF B;  4LF7 L;  3H0G H;  2C35 B;  3ER0 A;  4LFC L;  2YU9 H;  5IYC G;  4BBS H;  1QUQ A;  3PUV A;  5ELN A;  1YZ6 A;  2PI2 A;  3S15 H;  2VQE L;  4L5S A;  3PO2 G;  1L0W A;  1OXS C;  1VQI A;  4B3T Q;  3WWV A;  1Q82 C;  2ZJQ A;  4JI2 L;  3BZK A;  1YJW A;  1G29 1;  3CC7 A;  4DUZ Q;  2A8V A;  3GTQ H;  1VQP A;  1BBU A;  4YCW A;  3HOU H;  4BBS G;  1A62 A;  4B3M L;  2KEN A;  1VQM A;  2D0P A;  4L5Q A;  4QGU A;  2RCN A;  4ME3 A;  1Q1E A;  4P74 A;  5C0X J;  1JMC A;  2MNA A;  4DV6 Q;  4GNX A;  4JOI A;  4K0K Q;  4NXM Q;  2BH2 A;  4OO1 I;  3ULP A;  1D8L A;  3J80 i;  2UUA L;  2CFM A;  4YWK A;  4DR4 L;  5IYD H;  3B6Y A;  1LYL A;  2KCM A;  1VQ4 A;  3RZO H;  3CQZ H;  3HOV H;  2CWA A;  3DLL A;  2NN6 I;  3S1N H;  1XMO L;  1CSQ A;  4WJ4 A;  1VS0 A;  2K5N A;  3A74 A;  4DV1 Q;  4HJ7 A;  1B70 B;  2NN6 G;  4DAM A;  3JAM c;  3GTK H;  1X9N A;  2Q2T A;  1W2B A;  4A3C G;  1I50 H;  3U50 C;  2I5H A;  3UDG A;  3CCJ A;  4BBR G;  2JA5 G;  2WAQ E;  3PIO A;  1L1O C;  4X6A H;  1KRT A;  4X64 Q;  1GVP A;  1NY4 A;  2QEX A;  3TRZ A;  2I5M X;  5HY6 A;  2JA6 H;  2I5L X;  4OX9 L;  1PYB A;  1HR0 Q;  3J7A 5;  4BY1 H;  1QVG A;  3T1Y L;  1N32 L;  1E1O A;  1TWF H;  4GLA C;  1WCM H;  4Y7N H;  4GOP A;  1WJJ A;  4DV7 Q;  4DR2 Q;  2OTJ A;  1HZC A;  1K73 C;  5M5X H;  4A76 A;  3W5O A;  3AFQ A;  3EN2 A;  1X6O A;  1QZH A;  3FP9 A;  1QVF A;  2E5L Q;  3LGJ A;  1FVI A;  3GTL H;  2AHO B;  1YI2 A;  2VQE Q;  1LUZ A;  3CCQ A;  4FDB A;  4NB3 A;  2HQL A;  4X62 L;  1UEB A;  2JA7 H;  4GKJ Q;  3I4N G;  4O2D A;  1MKH A;  3KOJ A;  4JI4 Q;  1I3Q H;  4A3G H;  2WAQ G;  5IYB H;  1PFS A;  5LMN L;  3ZJY C;  1N33 L;  3AYH B;  2R7F A;  3Q8D A;  5H1S E;  2KHI A;  4XIG S;  3KFU A;  4GOP C;  4LUZ A;  2AMC B;  4ALP A;  4LF9 Q;  4MZ9 A;  3FHW A;  2CQO A;  1VQ8 A;  4OO1 G;  3NEM A;  4DV5 L;  3BU2 A;  4DR3 L;  1D7Q A;  2N78 A;  2R7Z H;  1P8L A;  4OWW B;  1K8A C;  1CUK A;  4RMF A;  3W1B A;  4AQY L;  4RG1 A;  4UP9 A;  1JJ2 A;  3UDI A;  4B3R L;  3M4P A;  3PO3 G;  3PUW A;  1Q12 A;  5M3F H;  4B3T L;  1XMO Q;  2E2H H;  1OXX K;  1U5K A;  5C4X H;  3CCU A;  2IHF A;  2LXK A;  4YHH L;  4DV0 L;  4A3K G;  4A4I A;  1DGS A;  1P16 A;  2PQA B;  4C3J H;  3CF5 A;  1AE3 A;  2Y0S E;  5BR8 Q;  4A3F H;  4DR5 L;  3I7F A;  3CP0 A;  3G48 A;  3U4V A;  4LF5 L;  4JBM A;  3S16 H;  2MFI A;  3KF6 B;  4R4Q A;  4DR7 L;  4LF8 L;  4NXM L;  4OX9 Q;  1VQL A;  4C2M H;  3HOY G;  1N8R C;  3CMA A;  4YCU A;  4Y52 H;  1UE1 A;  1YHA A;  1Y1W G;  5GAH C;  2UU9 Q;  2JA9 A;  3F8T A;  1KXL A;  4A3J H;  4IFD I;  3GD7 A;  1XPO A;  3CW2 C;  3CCE A;  4DV4 Q;  4LNQ A;  1Q7Y C;  1EFW A;  2ZTC A;  1IXR A;  3CC2 A;  4B3S Q;  1L1O B;  2CKZ B;  2VS1 A;  2UUB L;  4DV1 L;  2ATW A;  2YTY A;  3GDE A;  4A3J G;  3W1G A;  4A3E G;  4PZ8 A;  1N36 Q;  2NVY H;  1IYJ B;  4X62 Q;  1IBL Q;  2UXD L;  5FLM H;  2IY5 B;  1HNW L;  1CKM A;  4XTC S;  2KBN A;  4OWT B;  2K50 A;  3OTO L;  4PZ7 A;  2Y0S G;  4KI0 A;  1YJ9 A;  1JB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...