1NTGA

Crystal structure of the emap ii-like cytokine released from human tyrosyl-trna synthetase
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
171
structure length
171
Chain Sequence
PEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNISLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosyl-tRNA synthetase
publication title Crystal Structure of an EMAP-II-like Cytokine Released from a human tRNA Synthetase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 34
structure length 171
sequence length 171
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.1: Tyrosine--tRNA ligase.
pdb deposition date 2003-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ntgA00
2RHSB 1VQKA 2RHQB 3PUVA 2K75A 2N78A 4IJHA 5M5WH 2C35B 2NVYH 1E7ZA 3CQZH 3RZDH 4ALPA 4R4OA 4IFDG 1X56A 4RMFA 2GVBA 2E8GA 4QL5A 3S17H 4GKJQ 1LUZA 5HY6A 4JG2A 1X3FA 2QA4A 4A3EH 3S1NH 4C2MH 3RLOA 1PH6A 1X55A 3T1HL 2JEAI 4PZ6A 1S72A 1MKHA 4JOIA 2UUBQ 4DV3L 3E0EA 2OTJA 2UXDL 3GTQH 2MO1A 1VQPA 4A3DG 3AQQA 2KCTA 3M9BA 4HIMA 5JJKA 1HJPA 1N34Q 3GD7A 1B8AA 1XNRL 4HJ8A 1WCMG 4EQ5A 2JA7G 1VQNA 5LMNW 5IYBH 1XMQL 2R7DA 3PO3H 1W2BA 1C0AA 1D7QA 1SLJA 1VQ8A 4A3MG 3IRBA 3H0GH 5BR8L 1ASZA 4AQYL 3A0JA 4YWMA 3PUXA 4LF9L 3S1QH 3PUWA 4DV2L 1HR0Q 3L7ZC 4JV5Q 4GKKQ 2JK8A 1V43A 2YTVA 1JB7A 4GLVB 1PFSA 3S24A 3DLLA 4LFBL 2MQHA 2OCEA 1E1TA 1Y14B 4IOAA 4AH6A 4LWCA 2B63H 3I7FA 4R1JA 4JI8L 3G4SA 3AEVA 3I4NG 5LMUQ 3T1HQ 2K14A 4EX5A 4DR2L 1EWIA 3ULPA 1WOCA 2HIXA 4X66L 1I94L 4LF6L 4YY3L 1IBKL 3PIPA 4PMWA 1VQ4A 3F2DA 3RN2A 3OTOL 4DR1L 1GVPA 1XMQQ 4A3GH 1CKNB 2K50A 3EIVA 3D31A 3VDYA 1EFWA 1PH3A 1VQFA 5FLMG 5M3MG 1Q8KA 4JYAL 1AE2A 1L1OB 2IX0A 3FKIH 3HFZB 4DUYQ 1Q7YC 2HT1A 1TWHH 2UXBQ 4LUOA 1W3SA 1WYDA 4DK3C 3HOVH 1JT8A 1M1KC 2BA0A 3KFUA 3RNUA 2CWPA 1EYGA 5IWAL 4JI0L 1OTCA 4JI3Q 2JA8G 4DV2Q 4LW1A 3LGJA 4LFAL 1HNZL 2LSSA 1KAWA 3NBHB 4LF7L 1C9OA 2NN6G 4L5RC 2ZJPA 3DM3A 4GLXA 2QGQA 4A76A 1KRTA 3UDFA 2AHOB 4HIKA 4A75A 2ASBA 5GROA 4JI8Q 1YI2A 1B7YB 1YHBA 3UDIA 4DR2Q 1IBLL 2A8VA 4DKAC 3F8TA 4QJFA 4X66Q 1PH8A 4JI4Q 1P8LA 4YY3Q 4A3EG 4GNXC 1YHAA 5C0XG 1TWCH 2VQFL 3CC7A 3J80c 4YCUA 4UY8C 1SN8A 3OTOQ 4DR1Q 5M5XH 3UE0A 1K9MC 3M3YH 3KLWA 2JEBI 4B3ML 3GTKH 2ZTEA 3M85A 3F1ZA 2VL6A 3HOUH 1D8LA 1HR0W 1PVOA 5IYBG 4GOPA 3CCMA 3GTJH 4HJ7A 3PO3G 1X54A 4DR4Q 3NELA 4IPGA 4TVAB 3CCJA 2ES2A 2JQOA 4JI0Q 2F4VL 4P73A 5JEAJ 1U0LA 4A3IH 1PH9A 5C44H 1HNZQ 3HOYH 3CAMA 1PHJA 3TS2A 4X65L 3H0GG 1M90C 3GDEA 4OXPA 2R7FA 4MNOA 1X6OA 1OXXK 4B3SL 4GN5A 4QY7A 4B3RL 2ID0A 4P74A 2N3SA 2A19A 2OQKA 3I2ZA 4XTCS 1RIPA 3M4PA 2PI2A 3RR5A 4A3CH 3ER0A 3L2PA 1IBML 4KHZA 2PMZE 1UWVA 3CCEA 2JA5H 2B63G 4IFDI 2CQOA 1FL0A 1PH4A 1I5FA 1UE1A 3GTMH 1LM0A 5M5YH 3KDFA 5H1SE 1A62A 1EQRA 1H95A 1GKHA 2VW9A 2VQEL 2DGYA 1YZ6A 1OXUA 2N8NA 4JI7L 3STBD 4DAMA 4DV5Q 1CSPA 3Q8DA 3WWVA 1XPRA 4A3GG 4YCVA 3J7A5 1QVFA 3KYHC 3CD6A 1X3GA 4MZ9A 1XPUA 1V1QA 4BY7H 4YWKA 4GLAC 4NXML 4L5TA 2F4VQ 3FKIG 4DR5Q 2Q2UA 4BBSH 1YBYA 1Q1EA 1R9TH 2A1AA 4NB3A 4B3TQ 4X65Q 3HOVG 3PO2H 1VQGA 4H02A 2MO0A 5FLXc 3FHWA 3CCLA 4TQUS 2ZTCA 1I50H 4NXNL 4B3SQ 3KJPA 4DV4L 2KHIA 1JMCA 4LF4Q 3GTOH 4WJ4A 2HHHL 4JI5L 1YHQA 4BY1H 2R93H 4L5QA 1B70B 4LUZA 4LF8Q 3J81c 1XJVA 2R92H 2AMCB 2VNUD 2JE6I 3UDXA 3CXCA 2UU9L 1I3QH 4IOCA 1SFOH 1N36L 3E9HA 2YU9H 3H3VH 3U50C 4HIOA 2IT1A 4JI2Q 4PZ8A 2GVAA 1SRUA 4YCWA 2E2HH 4DR6L 3HOXH 4K0KQ 1UE7A 1E3PA 4JI7Q 1IYJB 3CPFA 2YV5A 1YVCA 1TWAH 2JJQA 4BBRH 3H15A 1VQMA 2UUAQ 2K5HA 1MIUA 4C3IH 4OO1I 2Q2IA 3A5UA 4DAYB 2VS1A 2I5LX 3PUZA 4X64L 4NXMQ 3HOUG 4YHHL 3L0OA 4R4TA 1PH1A 2AWOA 4UPAA 5IYCH 4DV6L 2CCZA 1E22A 5IT9c 2PI2E 4QQBX 1NJIC 1PYSB 1TWGH 5GAHC 1C7YA 1CSQA 1KL9A 3KF6B 3ERSX 1E1OA 5C4XH 3KJOA 4YWLA 4QGUA 4A3IG 2Z0SA 4LUVA 5C44G 4DUZL 3HOYG 3CC4A 2YTXA 3U4VA 1NY4A 2N49A 3K7AH 4JI5Q 4JBKA 2UXDQ 4DV3Q 5EAYA 3E9IA 3KF6A 1L0WA 4AYBG 1XNQL 1GO3E 2RF4A 1YITA 1N33L 2NN6I 5C3EH 4FDBA 1XNRQ 1N36Q 3NENA 3GTGH 2WAQG 4A3CG 1EIFA 4RG1A 1KHIA 3K80C 4HJ9A 1NMGA 1Q46A 2JA9A 3TREA 1GD7A 1SR3A 2JA5G 3KF8B 1MJEA 4DR7L 2F3IA 3I56A 3BJUA 3J7ZC 4LF5L 5C0XI 5BR8Q 4GNXA 3G48A 4AQYQ 2YYZA 1HZBA 2E5LL 1CUKA 1NMFA 4YHHQ 4MTNA 1T9HA 1UE6A 4LF9Q 2BH2A 1Y1VH 3FP9A 1VQOA 1EOVA 2NZOA 4DR3L 2Y0SG 4BY7G 1J6QA 3M7NA 2PQAA 3ULJA 4LFBQ 3J80i 1PA6A 4BBSG 2IHEA 2XTIA 4LNQA 4GS3A 4KHPL 1N32L 1VS0A 3S14H 3PO2G 1WFQA 1UE5A 1A63A 1AH9A 5IYDH 2H5XA 1YNXA 1I94Q 3F2CA 4LF6Q 1XNQQ 3JC66 1IBKQ 2NVQH 1OXVA 1BBUA 4XIGS 3PF4A 2D0OA 2IY5B 1JJGA 4DV7L 4BY1G 4GN3B 3EN2A 3CCUA 3CF5A 2R93G 4OONA 4JBWA 4GOPB 2R92G 4AYBE 1HNWL 1X9NA 1J5EL 3M4OH 4A93H 1IXRA 4DR7Q 5FJ8H 4JYAQ 1P16A 1YIJA 1N8RC 1XMOL 5ELOA 1A0IA 3UE1A 4LF5Q 3K0XA 1O7IA 1YJNA 3HOXG 1K8GA 2E5LQ 4X62L 5IWAQ 4BBRG 2EIFA 4LFAQ 1U5KA 4JI6L 2F52A 4LF7Q 2D62A 2UXCL 1AE3A 4O2DA 2WB1G 4APVA 5IYCG 3G71A 3UDGA 1VQ9A 4KHPQ 2NVXH 1L1OC 4A4IA 2Y0SE 5GADC 4HJ5A 3S1RH 1KC8C 1PH5A 1HNXL 1IBLQ 3HOZH 3ZJYC 5K36G 3KDFB 1HZ9A 1Q12A 4DV1L 1VQ6A 1UEBA 3TQYA 4X6AH 4JI1L 5C4XG 3S16H 3TS0A 2VQFQ 1OXSC 4JC0A 2L15A 1J5EQ 4B3MQ 5JEAG 3MXNB 4UP9A 3ICEA 1QUQA 5C3EG 2OQ0A 1QZGA 3BZKA 1XMOQ 4OX9L 4DPGA 1WI5A 3I4MH 3JAMc 4DV0L 2ZM6L 2XGTA 3STBC 4BA2I 4JBJA 4BXXH 5IE8A 1IZ6A 3ULLA 1QVCA 3OW2A 2UUBL 2ATWA 1Q1BA 4IPCA 4P72A 4UP7A 2UXCQ 4A3JH 3HKSA 1TWFH 5M3FH 4B3RQ 2Q2HA 1N34L 1I6HH 1EUJA 1Y1VG 2I5HA 3PUYA 4A3FH 3W5OA 4A3LH 3CW2C 2VUMH 2OTLA 3PF5A 1EIYB 2R7ZH 1WJJA 4DV1Q 1OXTA 4KLKA 1HZCA 1IBMQ 2WB1E 3EBEA 4JI1Q 2ZJQA 1TXYA 1VQ5A 1SMXA 1VQCA 4OWWB 3GTLH 2BA1A 1EQQA 1K3RA 5IYDG 1QVGA 2Z6KC 4GN4B 1JJCB 1HZAA 3AFPA 3PV0A 2VQEQ 1KRSA 1X3EA 5ELNA 4DK6C 1HR0L 1Y1WH 3PSIA 2ALYB 5IP7H 1QZHA 4GKKL 4JV5L 1VQLA 2OWOA 4OX9Q 3BU2A 3TEHB 4J15A 2QEXA 4A3BH 1PYBA 2PNHA 1E24A 4A93G 2GN5A 2KBNA 4DV0Q 2JA6H 5FJ8G 2ZM6Q 1BVSA 1S3OA 2B3GA 2BH8A 1VCIA 4Y52H 5LMUL 2D0PA 2DUDA 3RLFA 2AKWB 1V9PA 3T1YL 3W1GA 4NXNQ 2E2JH 3GO5A 4DV4Q 3KOJA 1Z47A 3W1BA 1LYLA 3K81C 3CMAA 2K4KA 3CCSA 2HHHQ 3S15H 1PH2A 4JBMA 1NTGA 4NPSA 1YJ9A 4OWTB 3PGZA 5DLQE 2K5NA 5AJ3L 4DUYL 2UU9Q 3HOWH 2UXBL 3HOZG 2CKZB 2MNAA 4R4QA 4UP8A 2Q2TA 1CKOA 1LTLA 3RN5A 4JCVE 4C3HH 4JOIC 2LXKA 1CKMA 2YTYA 3M4QA 4JI3L 4GNXB 4DR6Q 2LXJA 2V1CC 3MEFA 2MFIA 2KHJA 3D0FA 1PV4A 1HH2P 4O0AA 4LFCL 3RZOH 4C3JH 3I4OA 1NE3A 1Q86C 4BA1I 1KIXA 3J81j 2CWAA 2PQAB 3K7UC 4IJLA 5GAGC 4X64Q 4AIMA 1SE8A 1Z9FA 4DV6Q 1G6PA 2ZJRA 4A3KH 1N9WA 3T1YQ 3I4MG 4R4CA 2K5VA 1MJCA 4JI4L 4P75A 1A8VA 3SGIA 3CPWA 1RL2A 3H3VI 3S1MH 3GTPH 4OO1G 4BXXG 2R6GA 3PCOB 2B29A 5HGQA 5IP9H 4R4IA 1VQEA 1KD1C 4DUZQ 5GQOA 1BBWA 1VQJA 2KCMA 4IPHA 4A3JG 2FXQA 3PIOA 4L5SA 5M3FG 1ASYA 1VQIA 4Y7NH 5AJ3Q 3A74A 1N33Q 4A3FG 4A3LG 1Q81C 1BKBA 5GAEC 5C0XJ 2IX1A 2VUMG 1CKNA 2NZHA 2EQSA 3HKZG 4PG3A 5LMNL 2K52A 2R7ZG 4HIDA 3TRZA 1DGSA 4DR4L 2UUCL 4IO9A 1Q82C 1K83H 3S2DH 2HIVA 1L1OA 1IL2A 2WP8J 5JJIA 2WAQE 3CP0A 5IY0A 2NVTH 2IHFA 1G291 4LFCQ 1FJGL 1S40A 4DNIA 2HQLA 4A3DH 3OYYA 1Y1WG 5IP7G 1XPOA 4A3BG 4OWXB 1WCMH 1KQSA 2JA7H 1VQHA 1FGUA 4DR3Q 2JA6G 3CCVA 4HJAA 1XTDA 1SROA 3I55A 2EXDA 4ME3A 1K8AC 3U4ZA 4QIWE 3RLNA 4A3MH 1N32Q 2AWNA 3K8AA 4POGA 3F2BA 2KENA 3B6YA 3CCQA 1QUQB 4DV5L 3CC2A 1JE5A 5JJLA 1K73C 3JAMi 1YEZA 3G6EA 5LMNQ 3AYHB 4DV7Q 3U58A 1PH7A 1G51A 2UUCQ 1HNWQ 4DR5L 3HOWG 5E7NA 3I4NH 3HKZE 5J3BA 4B3TL 1YJWA 1FJGQ 4PZ7A 1KXLA 1FVIA 2ZTDA 4GKJL 1VQ7A 4X62Q 1L2FA 4POFA 4LF4L 2Z6KA 3J81i 2I5MX 1NBWA 4JI6Q 3CMEA 4LF8L 1X65A 4IFDJ 4GOPC 2VY3A 3NEMA 1VQDA 4IPDA 2E2IH 3S2HH 2RCNA 5FLMH 5M3MH 3BZCA 3A5ZB 4P71A 4A3KG 2VZAA 1K0RA 1HNXQ 1JJ2A 4JI2L 4K0KL 2WFWA 2CFMA 3CCRA 2I0QA 4KI0A 3AFQA 5IP9G 2JA8H 1VQBA 2UUAL 5C4JH 1VQAA 1GM5A 4WJ3M
chains in the Genus database with same CATH superfamily
2RHSB 1TS2A 2K75A 3ND8A 2E2DC 2N78A 5IIFA 1GUGA 1IW7D 3DWPA 4I65A 4RMFA 2JA5B 1IW7C 1X3FA 3S1NH 4C2MH 1Y8NB 3T1HL 1MKHA 3I3CA 4DV3L 5CV4A 4J8QA 3GTQH 1E2WA 2KCTA 3M9BA 5JJKA 1N34Q 4HJ8A 5BN4A 3MA2B 1VQNA 2Y0SB 3VR3A 1WVLA 1CK1A 1W2BA 1C4QA 4HEDA 2KECA 2HCCA 3IRBA 2MGSA 2A69D 4LF9L 2NZ1D 3S1QH 3L7ZC 4JV5Q 4GKKQ 1A3VA 1GJXA 2ZXOA 3FEWX 2EY5A 2B2VC 1I3QB 4LWCA 2B63H 3I7FA 1TQOA 3G4SA 2K14A 4EX5A 3IL8A 3IFTA 3NBIA 4X66L 1I94L 4YY3L 4KD3A 2PO4A 4RCOA 1QB5D 4X3KA 1VQ4A 4K6DA 3OTOL 4C3IB 1U9RA 1BXTA 1XMQQ 1FR3A 3EIVA 1EFWA 3D3RA 3U9OA 3HFZB 2M00A 2UXBQ 1Q7YC 1TWHH 4I7ZC 4DK3C 1JT8A 3H09A 1M1KC 3KF8A 3KFUA 2CWPA 1PZKD 1OTCA 1SNOA 1O78A 3E6ZX 2ZJPA 3DM3A 2EYJA 2ASBA 4A75A 4K8IA 5GROA 3NP8A 4DR2Q 1IBLL 4DKAC 1SNPA 1II3A 3F8TA 1P8LA 1LO5D 1LTAD 4GNXC 1EY0A 3MAQA 2VQFL 3J80c 4UY8C 1SN8A 3M3YH 2J7ZA 1GUTA 4DXFA 2RBMA 3M85A 3VYUA 1Y1VB 1ENCA 1VDZA 3FDTA 3CCMA 4HJ7A 4DR4Q 3NELA 2P5ZX 4IPGA 3CCJA 3MWYW 2F1MA 2EE1A 3C1FA 1U0LA 1SNQA 5C44H 3TS2A 1PHJA 2BCOA 1V1PB 2R7FA 2EZVA 4B3RL 4QY7A 2L1BA 4P74A 2BDNA 3J80L 2A19A 3I2ZA 4XTCS 1MI2A 1PFNA 4R8NA 1YNNC 3M4PA 2WKCA 3ER0A 3H91A 4V0BA 1IL8A 2PMZE 4CDCC 4IFDI 2B63G 2B2TC 1FL0A 4OELB 1I5FA 3PMFA 1LM0A 2WV6D 3KDFA 3DXJC 1STAA 1GKHA 1OO9B 2VW9A 4KTAA 3TP6A 1YZ6A 2F0PA 4DV5Q 1CSPA 1FGBD 3Q8DA 3WWVA 1HUNA 2BDOA 1X3GA 4BY7H 4YWKA 4NXML 3PO2H 3S1RB 4X65Q 1TIID 4H02A 4TQUS 3HZXA 1I50H 1EQVA 3KJPA 1A3UA 3K5LA 4LF4Q 4HCSA 4K6LA 4BY1H 2VNUD 1K28A 3CXCA 3OMGA 4IUNA 3U50C 3MC0B 4PZ8A 1SRUA 1UE7A 4JI7Q 4RA8A 4BBRH 4LK1C 4DAYB 5CR3A 5CBEE 5M3FB 4F88A 2B39A 2AQ3B 5DAUA 4DV6L 4A3FB 4WJWA 3HKZB 1LTBD 4DF7A 5C4XH 2L0CA 5C44G 3GTLB 2N49A 4JI5Q 2UXDQ 3KF6A 1L0WA 4AYBG 1XNQL 3NPPA 5C3EH 1XNRQ 1N36Q 3NENA 2BE5C 1NMGA 1ML0D 1Q46A 2JA9A 1GD7A 2JA6B 1G2TA 4DR7L 1Y69U 3I56A 2L11A 3BJUA 5BR8Q 3G48A 1HZBA 1O7ZA 3OPOA 2BH2A 1R4PB 1XYIA 4BY7G 3S15B 1PA6A 2IHEA 1S5BD 1I4XA 4HTHA 3PO2G 2CH4A 3A56A 3CKIB 1AH9A 5IYDH 3QJYA 2CH4W 3JC66 4HN7A 3PF4A 2MP1A 3D6WA 4DV7L 4BY1G 1ESRA 3EN2A 4GOPB 4AYBE 1X9NA 3M4OH 4A93H 3PO3B 2F0WA 2ZXRA 2QKIC 4JYAQ 1XMOL 1A0IA 3H3VC 4LF5Q 4R8IA 3VYSA 1O7IA 1YJNA 3GTPB 3S1MB 5DNFA 3P20A 4BBRG 1LABA 1PTOD 4LFAQ 5CV8A 3RD4A 5IGFA 4LF7Q 3KLSA 2JYOA 4KHPQ 2NVXH 5J22A 1L1OC 3BDLA 4L63B 4X3TA 4DV1L 5C4XG 4JI1L 1F9RA 4F8MA 1OXSC 2F0GA 2Q8IB 4JC0A 1DYQA 2L15A 3PIP3 1QUQA 5C3EG 1PLFA 3BZKA 2E76C 5HURA 1SJHD 3I4MH 1FNVA 2K04A 4DV0L 1EWHA 2ZM6L 3DHQA 4JBJA 3MHBA 1EY8A 4K5XA 4G7ZC 4CBVA 4B9WA 1E0BA 2L5TA 4UP7A 4G7OC 2SEBD 4KV6A 1N34L 3BDOA 1H9RA 3PUYA 1OXTA 1HTLD 2K5QA 3T4AC 3EBEA 1IBMQ 2ZJQA 3DWAA 3C46A 5C4ZA 4NW2A 1SMXA 5ISRA 5KRUA 4OWWB 1K3RA 5IYDG 1G91A 2Z6KC 2XWBB 4GN4B 3AFPA 3ERQA 1KRSA 1X3EA 1KTKA 4JV5L 2ALYB 3O13A 5G3LF 4GKKL 1VQLA 1HCZA 3BU2A 3TEHB 4J15A 4A3BH 3K5OA 3EROA 4A93G 5IODA 4UHVA 3KUPA 2B3GA 2BH8A 4Y52H 3BS1A 2DUDA 3RLFA 2D2CC 1IKMA 4NXNQ 4DV4Q 4FXDA 5EKLA 3HS0C 5IGDA 3CCSA 2HHHQ 4DXGA 4JBMA 2UXBL 1STGA 2PMZB 2CKZB 1Q3LA 1STHA 2O2LD 2F0OA 4JCVE 1H9SB 3S1NB 4MTKA 4C2MB 3GTOB 1CHQD 1TKWB 1PV4A 1WTVA 2R92B 4C3JH 1NE3A 3GTQB 4BA1I 2V4DA 4RKBA 2EYPA 1PZID 2PQAB 4IJLA 1B4OA 4G4KA 2LY7A 3I4MG 2EOTA 5IT9E 5I2XA 3IKJA 4B9XA 2B29A 5JJZA 2PZWA 1DD2A 2FXQA 4BS9A 4Y7NH 3S1QB 4EGVA 1N33Q 1BKBA 3SHLA 5GAEC 2EQSA 4QMGA 1DGSA 3J7YW 4DR4L 1BCPF 5LHY1 3S2DH 3BZDB 3H6MA 2B63B 1L0YB 2NVTH 2IHFA 2ICIA 2LFNA 4LFCQ 4O1NA 1GUNA 2K03A 4WORA 5AFWA 4A3BG 3GV6A 2JA7H 3WDNA 4DR3Q 3CCVA 2PW7A 4HJAA 1K8OA 4F7XA 4ME3A 3U4ZA 3RLNA 4A3MH 1TWHB 2R3ZA 2A68C 2K28A 2AWNA 2C5CA 4POGA 3HGBA 3F2BA 3R3OA 1RD9D 3CCQA 4DV5L 2IJ0A 2WACA 3G6EA 4DN4M 3SK8A 1S5ED 2F0EA 4FYDA 1LV9A 2K7VA 1HFGA 2RVLA 1KXLA 4GKJL 1EU4A 2PYKA 2OF1A 1XWEA 2DNCA 4ZYSA 4CDFC 2QDLA 4LF4L 1I4HA 3M3YB 3J81i 4C3JG 1V1PA 1LTTD 3SK5A 2E2IH 4IPDA 3S2HH 1B9NA 5FLMH 5ELDA 2X6GA 3D4WA 3HRZC 3TBIB 1KAAA 4HSVA 4RKLA 3CCRA 4KI0A 2JA8H 1VQBA 5C44B 1VQAA 2Z1CA 1KNAA 2K5DA 2VB2X 2NN6H 2RSNA 1RDPD 4LJZC 4HCEA 4AYBB 2NVYH 4R4OA 2GVBA 3KBXA 1H9MA 2RQXA 2QA4A 1GUOA 1PH6A 3ND9A 1SE2A 1X55A 1S72A 2UXDL 1TY0A 1VQPA 3AQQA 4HIMA 1SE4A 1XNRL 5EBCA 2JA7G 5LMNW 1BF4A 5IYBH 4BY7B 3QR8A 2EDGA 3DMUA 1C0AA 1D7QA 1SLJA 4A3MG 3PO2B 5JPNC 4JK1C 1I4QA 5BR8L 2F3VA 1I50B 4YWMA 3GQBA 3K0YA 3PUXA 1STBA 1BO0A 4DNTB 3A54A 1SMYD 1HR0Q 4J6HA 1V43A 1PRTB 2YTVA 1JB7A 4BY1B 1PFSA 4DAYA 2OCEA 3D8GA 1Y14B 2AQ1B 4KN7C 4JI8L 1LT6D 5IGBA 1EEID 2EJGC 4QUFA 1PMRA 3VA5A 4BBRB 4PMWA 3PIPA 2H4OA 2JSOA 3H94A 3F2DA 1I4RA 2F0JA 2K50A 1WTPA 5FLMG 4JYAL 3U9SA 4DUYQ 2B2YC 1W3SA 1B53A 1PXUA 2BA0A 2Q8RE 1EYGA 5C4XB 1WTQA 2JA8G 4DV2Q 4RHSA 3LGJA 3OW7A 4LFAL 3MXGA 1SJED 2F0UA 2LSSA 3VYRA 3P1HA 4LF7L 1C9OA 2NN6G 1QNUA 4A76A 1ONLA 1UNSA 1YI2A 1CA6A 5C3EB 1BCPB 4U68A 1FNUA 1UUPA 2JP1A 3OOCA 3C1EA 1PH8A 4KD4A 5COYA 3CC7A 2B8FA 1JOOA 4DR1Q 4ZQ3A 3UE0A 4EQNA 4DK1A 3GTKH 1K8MA 1CI3M 3QIAA 4UAIA 3F1ZA 1M8AA 3LWUA 4XYOA 1PVOA 1ICWA 5I4DA 5IYBG 5HGTA 5I2YA 1F2YA 4GOPA 4G7HC 2ES2A 4JI0Q 5CMDA 4P73A 5JEAJ 1HNZQ 2PPBC 2PZUA 2A73B 1OXXK 4GN5A 2ID0A 2N3SA 3OWFA 2CW0C 1RIPA 1ENAA 3A8IE 5D65A 3RR5A 2PI2A 4RWSC 1IBML 4A93B 3M4OB 4KHZA 1EU3A 2B8GA 3RUZA 1KDBA 1QOHA 2DGYA 4L6TB 3STBD 1B44D 4ODGA 4YCVA 1QVFA 3KYHC 4MZ9A 1XPUA 4GLAC 2F4VQ 4L5TA 2Q2UA 1MBYA 2NVXB 1YBYA 4NB3A 5FLXc 3FHWA 1F77A 2XRSD 4NXNL 4B3SQ 1U4LA 2DJGC 3MXUA 4DV4L 1SNMA 3W3AA 1JMCA 3GTOH 4WJ4A 2HHHL 2R93H 4L5QA 1B70B 1HRJA 2R92H 3J81c 5CC4A 1F2LA 1LT4D 3EA6A 4FP5D 3KLSX 5FOBB 5J39A 3DWQA 3E9HA 3H3VH 1CA5A 4DK0A 3I4MB 2E2HH 4K0KQ 1DOLA 3HOXH 2OXPA 3CPFA 1VQMA 1YVCA 1TWAH 1NNXA 2JJQA 2PQEA 2UUAQ 4OO1I 1C8CA 1WD0A 3A5UA 4CKBA 1KNEA 3PUZA 2F0DA 4KKUA 3L0OA 4R4TA 1PH1A 2AWOA 4UPAA 1ZYRD 1E22A 5IT9c 2HDMA 2PI2E 4QQBX 1NJIC 1TWGH 2A69C 2DN8A 5GAHC 3ERSX 2Z0SA 4LUVA 3CC4A 4JBKA 3VA7A 1D5MC 1JC7A 2F03A 1GO3E 2RF4A 1YITA 4CGYB 1N33L 3GTGH 2WAQG 4A3BB 4HJ9A 4RG1A 3K80C 5E1FA 1GHJA 2EJFC 1SR3A 1SDFA 4XYQA 3NXWA 2J4XA 5IT9L 4V190 1SYBA 5L37A 3J7ZC 4HR7B 5C0XI 4AQYQ 1H9SA 4YHHQ 3KLRA 4ZKCB 5M9OA 2FINB 1VQOA 2NZOA 3NK9A 4DR3L 2JN4A 4ZUJA 4B08A 4K2LA 4LFBQ 2PQAA 3ULJA 4LNQA 3S14H 1WD1A 1T5XD 1A63A 3KK7A 2H5XA 3QG1A 1YNXA 4LF6Q 1IBKQ 5D3DA 2L9HA 2D0OA 1JJGA 1EFID 2OEOA 4GN3B 3CCUA 2R93G 4C3JB 4JBWA 2R92G 4K14A 2K5WA 4K5WA 1F9PA 1DXMA 2HQEA 1G8ZD 3AU7A 1YIJA 2CQAA 4ID6A 5CV5A 4XT1B 5ELOA 1BBXC 2Z4HA 2Z9HA 3K0XA 3HOXG 1K8GA 2E5LQ 5IWAQ 2EIFA 1B3QA 4KY6A 1A2UA 1U5KA 4OHJA 2UXCL 2KJXA 1AE3A 3R2TA 3VR6A 1O80A 4O2DA 4Y7NB 3UDGA 4A4IA 5GADC 3QB3A 4OGQC 4KJNA 1WTOA 3S2DB 4X6AH 1WTXA 2WINB 1TS3A 3TS0A 2NVTB 2CHBD 5FO9B 2AQ2B 1J5EQ 3HEJA 1EY5A 5JOBA 2MUYA 2IPKD 1QZGA 1EIGA 2TSSA 4OX9L 4FF2A 2NB0A 2JA7B 1WI5A 3Q6SA 1LACA 1LT3D 4KK7A 2XGTA 4JPBW 4BXXH 4A3MB 1IZ6A 1QVCA 3SK6A 1Q1BA 1CQFA 3TMEA 2NWGA 4N9TA 4A3LH 3CW2C 3PF5A 2R7ZH 1U4MA 1HZCA 1JWMD 1VQCA 1EQQA 4NKLA 5JAVA 1HZAA 1LTID 2M2LA 2VQEQ 3RMHA 5ELNA 4DK6C 1HR0L 1Y1WH 5IP7H 3I72A 3I4LA 2OWOA 4IN3A 2NBFA 3ZYYX 1E24A 2GN5A 2KBNA 3CU7A 4IQZA 2N55A 2E2IB 3S2HB 2SNMA 5C6AA 5IGGA 2D0PA 5M5YB 3VR2A 2AKWB 3T1YL 1EYDA 1HQMC 1J9OA 4K8JA 5I6WA 2E2JH 1Y8OB 2JA8B 2D9UA 1LYLA 4N8X1 3K81C 5C5MA 2K4KA 3GV3A 4PV1C 2Q8TA 1PH2A 2RDHA 4NPSA 2NVYB 2K5NA 5AJ3L 4DUYL 2UU9Q 3HOWH 2QEJC 2Q2TA 1LTLA 1TS4A 4C3HH 1CKMA 4GNXB 4DR6Q 5T1GA 2V1CC 2MFIA 2F0LA 4FVMA 1KIXA 2A6ED 3QWNA 3X3NA 4X64Q 1QG7A 2YU9B 1Z9FA 1G6PA 2EJMA 3HG9A 3MVVA 4P75A 4OO1G 4BXXG 2R6GA 3PCOB 3TP5A 3Q24A 5IP9H 1VQEA 1STNA 4ABNA 4DUZQ 5GQOA 1BBWA 3G7LA 4IUTA 2B2WA 3BYYB 4KN4C 5D14A 4A3LG 5C0XJ 5LMNL 2NZHA 3C3LA 2R7ZG 4IFDH 3TRZA 2K52A 3WOEA 1K83H 1PFBA 4PMCA 3I90A 3CP0A 5IY0A 1S40A 2PW5A 3NWTA 1F2MA 1Y1WG 5IP7G 1L0XB 1GUWA 5DM63 1FGUA 4LAAA 4PMBA 4XT3B 1SROA 1PTOC 2EXDA 5CV7A 1K8AC 1N32Q 5EGTA 1JR0D 4RHRA 1NSNS 1A2TA 3K8AA 3TZDA 1EYCA 5JJLA 3CC2A 1K73C 4IUUA 5C5LA 3JAMi 3AYHB 3U58A 1PH7A 5C3WA 2UUCQ 1HNWQ 3J7AF 1QCBD 3HOWG 5E7NA 1FJGQ 4N9PA 4C3HG 1SAPA 1RJTA 3A7AB 1A3TA 1ET6A 1L2FA 1VF5C 4POFA 5ELCA 3I91A 1NBWA 4IFDJ 3GTKB 2VY3A 4KKTA 5TSSA 4L8JA 3VR5A 3MZ5A 2NUCA 2G5DA 4K0KL 2F0FA 3W2DA 3AFQA 5IP9G 4JW0A 2UUAL 1GM5A 1XX8A 1ILPA 4WJ3M 3EQLC 1TT2A 1HFNA 2RHQB 3PUVA 1AN8A 5M5WH 2C35B 3RZDH 2LMCB 4ALPA 2L55A 1SEBD 4IFDG 2WAQB 1X56A 1EYAA 3IFDA 2NTTA 5HY6A 4JG2A 3BDCA 4A3EH 2AUKA 3T13A 3RLOA 2EYMA 1EY6A 2JEAI 4ZLTF 2UUBQ 4JOIA 2OTJA 2MO1A 2PZTA 5I9OA 5FLXE 4H13C 3LNNA 1B8AA 1CM9A 3GP7A 5KNCA 1XMQL 2R7DA 4BWGB 4C1NK 1E2VA 2I46A 1PRTF 3J81E 4X3UA 2GA4B 4H7BA 3H0GH 4AQYL 1RTNA 3BYTB 3NE5B 2R93B 5CORA 1Q90A 2ICEC 3DLLA 4LFBL 1E1TA 4AH6A 3AEVA 1QJOA 5LMUQ 3T1HQ 2NTSA 4DR2L 1EOTA 1EWIA 3ULPA 1WOCA 2HIXA 2E2HB 4LF6L 2KCCA 1IBKL 3HOXB 5EJWA 1TWAB 1RKNA 3RN2A 2E75C 3VDYA 2L4NA 5G3LD 3UI2A 3WOFA 1Q8KA 2KEEA 3FKIH 1L1OB 5ELBA 4EQOA 1Q8IA 4JVZA 1TWGB 5IWAL 3VYTA 4LW1A 1CZWA 4FNFA 1KAWA 3NBHB 3MFGA 3FRPB 2QGQA 2A6HD 4GLXA 1KRTA 4IURA 3VR4A 4RGTA 2FHTA 1YHBA 3UDIA 3GTGB 2A6HC 4ZCKA 4X66Q 4YY3Q 4A3EG 3E5SA 3OTOQ 3RZOB 5M5XH 1K9MC 3KLWA 5IGCA 3V96A 2ZTEA 2H1EA 5CGKA 3HOUH 1D8LA 1WTWA 1HR0W 2LKVA 3FPPA 1SNCA 1X54A 1S5FD 2IX3A 1G2SA 3S14B 4A3IH 3HOYH 3AMUA 3G6JB 3CAMA 4X65L 2F3WA 3H0GG 1M90C 3GDEA 2FMMA 4OXPA 4QF4A 4MNOA 2KHSA 4HMIA 2KQ3A 1ICFB 3L2PA 4DAPA 4O42A 1UWVA 3SDZA 2HCIA 1J8IA 2CQOA 3SE0A 1PH4A 1UE1A 3GTMH 5M5YH 5I6YA 1BCPD 1H95A 4KJOA 2F0MA 1YNJD 2VQEL 4E6IA 1OXUA 4JI7L 1XPRA 1WCMB 3PIO3 5FO7B 3J7A5 3CD6A 1V1QA 1ZEQX 3FKIG 4IUPA 4BBSH 3LX0A 1Q1EA 1R9TH 2A1AA 1VQGA 2MO0A 2F0HA 4FXKC 1KDCA 4CJ0B 1CQVA 2K33A 2KHIA 1BR9A 2MPMA 3BG3A 2RKSA 1MGSA 2HDLA 4JI5L 3KBGA 5EKKA 4LUZA 4DU9A 2JE6I 3UDXA 2UU9L 2F0SA 5T1IA 5KGUA 1SFOH 1N36L 2YU9H 4HIOA 4JI2Q 2B2VA 2GVAA 1HUMA 4YCWA 4DR6L 4MN3A 1IYJB 3H15A 5IOCA 1D2BA 3CRLC 1MIUA 3L3OC 2Q2IA 5D3IB 4TKOB 2VS1A 2I5LX 3D6CA 4X64L 3K5NA 5M3MB 4NXMQ 3HOUG 2CCZA 1SE3A 1AP0A 2QDBA 2R7ZB 2KA7A 1KL9A 1SMYC 3KF6B 1E1OA 3S9WA 4TSSA 4QGUA 4A3IG 3HOYG 4DUZL 3U4VA 1NY4A 3K5MA 2QILA 4OIJA 5EAYA 3E9IA 3CQZB 5CV6A 4K2KA 5JEAH 1EY7A 4ZAIA 1Y1WB 2QCPX 3TREA 4C56C 1JB3A 2F0NA 1MJEA 1AEXA 4ZK9B 4CKEA 2G9DA 1JORA 4LF5L 2DY7A 3ITPA 4MHEA 4GNXA 2YYZA 4H44C 1A6XA 1NMFA 2E2JB 4MTNA 2K05A 2IW3A 4XQNA 1R4QB 1B1ZA 4NP5A 3M7NA 4X3SA 3J80i 1ILQA 4BBSG 2XTIA 3HOWB 4KHPL 1N32L 4Q0FA 4XDXA 1VS0A 2K32A 1WFQA 1SYDA 4C3HB 3F2CA 1XNQQ 2NVQH 1BBUA 1Z7TA 1JOKA 5CV9A 3CF5A 4OONA 1HPCA 1HNWL 2FFKB 4DR7Q 2G9HD 3A8KE 1JE4A 2K01A 1N8RC 2OT2A 3NUCA 2A5HA 1C48A 2B2TA 1FNWA 4MIUA 3I70A 1TY2A 2B2UA 2WB1G 1BNZA 3G71A 1D5XC 1VQ9A 1EZ6A 3HOZH 4HJ5A 3Q0AA 1JQYD 3ZJYC 1HZ9A 1Q12A 1K83B 3EFXD 3TQYA 3S16H 4P2CB 5EBDA 4RGMA 2C9OA 4B3MQ 3PQIA 1EZ8A 3MXNB 5JEAG 1IKLA 2OQ0A 3FPUB 3HP3A 1XMOQ 4N8FA 4DPGA 4CJ2C 5BN5A 1M4VA 2DNEA 3STBC 2EXZA 4BA2I 1EEFD 3URYA 2MJ8A 5IE8A 1AZPA 1NUCA 5E4WC 3ULLA 1W6KA 2UUBL 2O5JC 1PDQA 2ATWA 4IPCA 3OMCA 4P72A 4A3JH 3HKSA 1TWFH 5C3XA 1I6HH 4XQQA 1EUJA 3NTIA 1QILA 3W5OA 2VUMH 2QW7A 4DV1Q 5E3FA 4KLKA 2WB1E 4JI1Q 4HAEA 2Z4IA 1QVGA 1JJCB 1V8QA 3OWEB 1MD2D 5FLXL 1EQTA 1PYBA 5C4HA 2PNHA 4DV0Q 2ZM6Q 2L12A 1PTOH 1VMCA 1VCIA 5LMUL 2MHVA 5BN3A 2KVMA 1V9PA 3W1GA 3J81L 3J7AV 4CDEC 1ZYRC 3GO5A 4KY7A 1HA5A 3F2UA 5ELFA 3SVMA 3W1BA 3OSOA 4QCLA 1NTGA 1YJ9A 4OWTB 5M5WB 3RZDB 3HOZG 2MNAA 4UP8A 1CKOA 2LS01 2RA4A 1ESFA 4QB4A 2YTYA 3M4QA 1VF7A 4A3EB 2O5IC 2LXJA 4PNYA 5CYUA 3MEFA 2KHJA 4LFCL 3RZOH 3I4OA 1F9QA 5JVH3 4J1MA 2CWAA 2DJFC 2EY6A 3K7UC 4DA2A 5GAGC 4AIMA 2EY2A 5I9PA 1H9KA 1SE8A 1ZXTA 2ZJRA 4A3KH 2K5VA 2A74C 2EYOA 1TU2B 3D4RA 4RFBA 2EY1A 1KD1C 2EYLA 1VQJA 2KCMA 2HUGA 2XIWA 4RH6A 2K6AA 3H0GB 4IPHA 4A3JG 3PIOA 1Y8PB 3E3XA 1VQIA 3A74A 4LMQD 1Q81C 2VUMG 1CT1D 4PG3A 1KDAA 4I7AA 4HIDA 4IO9A 1DZ1A 1RHPA 1L1OA 2WAQE 3K7AB 1G291 3QO2A 4DNIA 4A3DH 1XPOA 2NYZD 3NBHA 4OWXB 1WCMH 1VQHA 1D1IA 2X69A 1A15A 2XRQD 1KLUD 1O7LA 1XTDA 3BVGA 2ZT9C 3FKIB 4QIWE 3NQIA 3BVMA 2IWHA 2KENA 3B6YA 4RCNA 3NSWA 1DONA 4TRDA 5J1ZA 3CHBD 1G51A 4NMZA 2Z8LA 1MSHA 4OL7A 3I4NH 3NTKA 5J3BA 2Z6BA 1YJWA 1YNND 1FVIA 2ZTDA 4EQPA 1JWUD 2KOLA 1VQ7A 4X62Q 4OO1H 2Z6KA 5M5XB 2I5MX 4JI6Q 3CMEA 1RTOA 4ZRZA 1D6EC 4GOPC 2HD3A 5EQ0A 1CHPD 2RCNA 2VXWA 3HOUB 1ENFA 2F0QA 5M3MH 1GHKA 5EPKA 3A5ZB 4A3KG 2D5DA 1CFMA 1HNXQ 4JI2L 1STYA 3L9AX 2CFMA 4OEMB 2I0QA 2B2UC 4A3IB 5C4JH 3HOYB 3NTHA 3TN2A 1HHVA 4S3SA 3MFYA 1PYWD 1VQKA 4IJHA 1E7ZA 3CQZH 4WFN3 5EKIA 1BUVT 3MXPA 2E8GA 2EVBA 4QL5A 5FK9C 3S17H 3K58A 4GKJQ 1LUZA 4KMUC 3JAME 3GTMB 5C0XH 4PZ6A 4OIKA 1K0SA 3E0EA 4A3DG 5LL6S 1HJPA 3GD7A 4GZYC 1WCMG 4EQ5A 2RCFA 3PO3H 5KNBA 1VQ8A 1EY9A 4BBSB 1R9TB 2TMPA 2RSOA 1X3QA 3EVQA 1ASZA 3A0JA 4Z9CB 2SDFA 3V05A 3PUWA 5F2DA 4DV2L 1DJRD 2JK8A 5KEEA 5LL6X 4GLVB 3S24A 4FF4A 2MQHA 1UAPA 4IOAA 3I4NG 4R1JA 1SFOB 3IAYA 3OHXC 1DM0B 1NAPA 1PTOF 4G57A 2A6EC 3OIQA 2BE5D 1RCVD 4XXEA 2RDFA 4DFAA 2RDGA 3V2TA 1CZGA 4A3GH 4DR1L 1GVPA 1CKNB 1CTMA 3D31A 3AB9A 1PH3A 1VQFA 5M3MG 1VMPA 2WB1B 1AE2A 2IX0A 2HT1A 1X3PA 3M4YA 4LUOA 1WYDA 3HOVH 3RNUA 1FD7D 3P7JA 4JI0L 4JI3Q 3N52A 1HNZL 2DY8A 1K3BC 3T51B 4L5RC 5DEHA 1S5DD 5IGEA 3UDFA 4HIKA 2AHOB 4JI8Q 1B7YB 4C1NI 2A8VA 1EIHA 1B3AA 4QJFA 4JI4Q 2XNAC 3ONAB 1YHAA 1GUSA 5FO8B 5C0XG 1TWCH 4YCUA 4HSPA 1WTRA 1HXYD 2JEBI 1I4PA 4B3ML 4DGZA 4ZUIA 4CKCA 2VL6A 3TZUA 4DNRB 3R8BA 3GTJH 2KUMA 3PO3G 1S4ZA 3NHHA 4TVAB 2JQOA 3T16A 2F4VL 2F4IA 1PH9A 3D4DA 1NR2A 4IUVA 1X6OA 1AFPA 4B3SL 2NVQB 1KABA 2CVRA 2OQKA 1BQQT 1UEAB 2SOBA 4FXGC 4A3CH 5NUCA 5A2QE 1NCVA 3CCEA 2JA5H 1G6ZA 1LTRD 1I6VC 5H1SE 1A62A 1EQRA 2X6LA 4RGNA 2FJ2A 3FVQA 2N8NA 2KCNA 4DAMA 4A3GG 1STEA 1W6JA 1F2ZA 1MHWC 3MXNA 4WRDA 1LTSD 4RAUC 1MSGA 4DR5Q 3M7GA 5FKAC 4R9WA 3HOZB 4B3TQ 3HOVG 3DEOA 3CCLA 3TSSA 2ZTCA 3S16B 5KIXA 5EPJA 4M8AA 3A8JE 1YHQA 4LF8Q 1XJVA 3DEPA 2AMCB 3K57A 5A35A 1I3QH 4IOCA 3MTSA 4QIWB 2IT1A 4DAVA 1SNDA 4FO2A 1LTGD 1E3PA 1X32A 2YV5A 2VB3X 1ET9A 3Q23A 2K5HA 3TP7A 3CRKC 4C3IH 1KLGD 3DUZA 4A3JB 1QNKA 1TWFB 1I6HB 4YHHL 1WTHA 4CHTB 5IYCH 1E2ZA 2VUMB 3FMCA 1QE6A 1PYSB 4UDUC 5K36H 2AUJD 1CSQA 1C7YA 3KJOA 2B2YA 4YWLA 2YTXA 4IALA 1IYVA 3K7AH 2F0TA 4DV3Q 2PNRC 3DM1A 2PCFB 2NN6I 2WIIB 4FDBA 4Q5VA 4A3CG 1EIFA 1KHIA 3NQTA 4ZKBB 2ENBA 2JA5G 3KF8B 1PTOB 3E0JA 1BOSA 4HMJA 3SK4A 5K5PA 1AW7A 1SXTA 5KYLA 2F3IA 3R2IA 1JWSD 2E5LL 1CUKA 1T9HA 1UE6A 4LF9Q 1Y1VH 3FP9A 1EOVA 1PZJD 2I07B 2Y0SG 1RODA 1I4GA 1J6QA 1H9JA 2F0KA 3QOLA 2XWJB 4GS3A 1SBBB 1UE5A 2R61A 1I94Q 3SEBA 5KYIA 1PRTD 1QWYA 1OXVA 4XIGS 2J0TD 2IY5B 1TS5A 2E74C 1PRTC 1EL0A 1J5EL 1IXRA 5FJ8H 1P16A 5E4XA 4A3KB 3UE1A 3X3MA 4X62L 3R93A 1RF2D 2B2WC 1EY4A 4C3IG 4JI6L 2F52A 3P75A 1IHZA 2A68D 2D62A 4APVA 5IYCG 1HTPA 2Y0SE 1KC8C 1PH5A 3S1RH 1IBLQ 1HNXL 4FF1A 4QUCA 5K36G 2F0VA 1XTCD 3KDFB 1VQ6A 4F87A 3BVZA 1UEBA 2K1BA 3TP8A 2BOSA 3OIPA 2VQFQ 1NR4A 3J80E 4A3DB 1JICA 2F0IA 4UP9A 3ICEA 2XVSA 1BCPC 1LT5D 1Z6HA 1YNJC 3JAMc 1IYUA 3TDQA 3MEHA 3OW2A 2UXCQ 1SYCA 3Q22A 1FYCA 5M3FH 4B3RQ 2Q2HA 1D1KA 1Y1VG 2I5HA 4A3FH 5KNDA 2OTLA 1EIYB 1WJJA 5DM73 2IL8A 5EPLA 1TXYA 4K5VA 3T56B 1VQ5A 3K6OA 4KY5A 3I4NB 1DOKA 3GTLH 2BA1A 1ZKOA 2FMCA 3JAML 1B2TA 3PV0A 3PSIA 1LLRD 1QZHA 4OX9Q 2QF7A 2QEXA 2JA6H 5FJ8G 1BVSA 1S3OA 4RGOS 2ZXPA 5CBAE 4PQXA 2JXMB 1AZQA 1GOZA 1DOMA 1GXDC 5C4JB 3KOJA 1Z47A 1SYEA 3CMAA 3S15H 1B50A 2M9VA 3PGZA 5DLQE 5ELEA 2XN9C 1SYGA 1BDOA 4R4QA 1V1OA 4YIJA 3S17B 3RN5A 4JOIC 2LXKA 4JI3L 4KKSA 3EJIA 1HA6A 3NWSA 3D0FA 1HH2P 4ME5A 2XSCA 4O0AA 1Q86C 1SYFA 3J81j 1B9MA 3I73A 3LWEA 4KHVA 1SSOA 4DV6Q 1N9WA 3T1YQ 4R4CA 4U673 1MJCA 4JI4L 1A8VA 2O4XA 3SGIA 1RL2A 3CPWA 3H3VI 3A55A 4CDDC 3GTPH 3S1MH 5HGQA 4R4IA 1D5ZC 2EPBA 3SR1A 1U4RA 4L5SA 1PFMA 5M3FG 1ASYA 1JOQA 5AJ3Q 3C2PA 1EWCA 4A3FG 2N88A 4XQJA 2IX1A 1CKNA 3HKZG 1T5EA 2UUCL 1Q82C 2HIVA 4IUQA 1TVXA 1IL2A 2WP8J 5JJIA 5JVG3 1FJGL 1TR5A 2HQLA 4ILWA 1F9SA 1U4PA 2EYHA 3OYYA 5JPMC 4H0LC 4NDXA 4A3GB 1JCKB 1KQSA 2JA6G 3N6RA 3I55A 1O7YA 2SNSA 3QOJA 4FF3A 3HOVB 3T53B 1QUQB 4M1UB 1JE5A 1YEZA 5LMNQ 4DV7Q 2KEDA 4ULLA 5A2QL 4DR5L 3HKZE 4EVOA 4B3TL 2CW0D 2WKDA 4PZ7A 1S5CD 3I8ZA 4IZ8A 1TWCB 2EYFA 3K59A 4LF8L 1X65A 3NEMA 1VQDA 1HQRD 3BZCA 4P71A 2VZAA 1DCZA 1K0RA 3GTJB 1JJ2A 2WFWA 1XXGA 4CJ1B 3SXHA 3A7LA
chains in the Genus database with same CATH topology
2RHSB 1VQKA 2RHQB 3PUVA 2K75A 2N78A 4IJHA 5M5WH 2C35B 2NVYH 1E7ZA 3CQZH 3RZDH 4ALPA 4R4OA 4IFDG 1X56A 4RMFA 2GVBA 2E8GA 4QL5A 3S17H 4GKJQ 1LUZA 5HY6A 4JG2A 1X3FA 2QA4A 4A3EH 3S1NH 4C2MH 3RLOA 1PH6A 1X55A 3T1HL 2JEAI 4PZ6A 1S72A 1MKHA 4JOIA 2UUBQ 4DV3L 3E0EA 2OTJA 2UXDL 3GTQH 2MO1A 1VQPA 4A3DG 3AQQA 2KCTA 3M9BA 4HIMA 5JJKA 1HJPA 1N34Q 3GD7A 1B8AA 1XNRL 4HJ8A 1WCMG 4EQ5A 2JA7G 1VQNA 5LMNW 5IYBH 1XMQL 2R7DA 3PO3H 1W2BA 1C0AA 1D7QA 1SLJA 1VQ8A 4A3MG 3IRBA 3H0GH 5BR8L 1ASZA 4AQYL 3A0JA 4YWMA 3PUXA 4LF9L 3S1QH 3PUWA 4DV2L 1HR0Q 3L7ZC 4JV5Q 4GKKQ 2JK8A 1V43A 2YTVA 1JB7A 4GLVB 1PFSA 3S24A 3DLLA 4LFBL 2MQHA 2OCEA 1E1TA 1Y14B 4IOAA 4AH6A 4LWCA 2B63H 3I7FA 4R1JA 4JI8L 3G4SA 3AEVA 3I4NG 5LMUQ 3T1HQ 2K14A 4EX5A 4DR2L 1EWIA 3ULPA 1WOCA 2HIXA 4X66L 1I94L 4LF6L 4YY3L 1IBKL 3PIPA 4PMWA 1VQ4A 3F2DA 3RN2A 3OTOL 4DR1L 1GVPA 1XMQQ 4A3GH 1CKNB 2K50A 3EIVA 3D31A 3VDYA 1EFWA 1PH3A 1VQFA 5FLMG 5M3MG 1Q8KA 4JYAL 1AE2A 1L1OB 2IX0A 3FKIH 3HFZB 4DUYQ 1Q7YC 2HT1A 1TWHH 2UXBQ 4LUOA 1W3SA 1WYDA 4DK3C 3HOVH 1JT8A 1M1KC 2BA0A 3KFUA 3RNUA 2CWPA 1EYGA 5IWAL 4JI0L 1OTCA 4JI3Q 2JA8G 4DV2Q 4LW1A 3LGJA 4LFAL 1HNZL 2LSSA 1KAWA 3NBHB 4LF7L 1C9OA 2NN6G 4L5RC 2ZJPA 3DM3A 4GLXA 2QGQA 4A76A 1KRTA 3UDFA 2AHOB 4HIKA 4A75A 2ASBA 5GROA 4JI8Q 1YI2A 1B7YB 1YHBA 3UDIA 4DR2Q 1IBLL 2A8VA 4DKAC 3F8TA 4QJFA 4X66Q 1PH8A 4JI4Q 1P8LA 4YY3Q 4A3EG 4GNXC 1YHAA 5C0XG 1TWCH 2VQFL 3CC7A 3J80c 4YCUA 4UY8C 1SN8A 3OTOQ 4DR1Q 5M5XH 3UE0A 1K9MC 3M3YH 3KLWA 2JEBI 4B3ML 3GTKH 2ZTEA 3M85A 3F1ZA 2VL6A 3HOUH 1D8LA 1HR0W 1PVOA 5IYBG 4GOPA 3CCMA 3GTJH 4HJ7A 3PO3G 1X54A 4DR4Q 3NELA 4IPGA 4TVAB 3CCJA 2ES2A 2JQOA 4JI0Q 2F4VL 4P73A 5JEAJ 1U0LA 4A3IH 1PH9A 5C44H 1HNZQ 3HOYH 3CAMA 1PHJA 3TS2A 4X65L 3H0GG 1M90C 3GDEA 4OXPA 2R7FA 4MNOA 1X6OA 1OXXK 4B3SL 4GN5A 4QY7A 4B3RL 2ID0A 4P74A 2N3SA 2A19A 2OQKA 3I2ZA 4XTCS 1RIPA 3M4PA 2PI2A 3RR5A 4A3CH 3ER0A 3L2PA 1IBML 4KHZA 2PMZE 1UWVA 3CCEA 2JA5H 2B63G 4IFDI 2CQOA 1FL0A 1PH4A 1I5FA 1UE1A 3GTMH 1LM0A 5M5YH 3KDFA 5H1SE 1A62A 1EQRA 1H95A 1GKHA 2VW9A 2VQEL 2DGYA 1YZ6A 1OXUA 2N8NA 4JI7L 3STBD 4DAMA 4DV5Q 1CSPA 3Q8DA 3WWVA 1XPRA 4A3GG 4YCVA 3J7A5 1QVFA 3KYHC 3CD6A 1X3GA 4MZ9A 1XPUA 1V1QA 4BY7H 4YWKA 4GLAC 4NXML 4L5TA 2F4VQ 3FKIG 4DR5Q 2Q2UA 4BBSH 1YBYA 1Q1EA 1R9TH 2A1AA 4NB3A 4B3TQ 4X65Q 3HOVG 3PO2H 1VQGA 4H02A 2MO0A 5FLXc 3FHWA 3CCLA 4TQUS 2ZTCA 1I50H 4NXNL 4B3SQ 3KJPA 4DV4L 2KHIA 1JMCA 4LF4Q 3GTOH 4WJ4A 2HHHL 4JI5L 1YHQA 4BY1H 2R93H 4L5QA 1B70B 4LUZA 4LF8Q 3J81c 1XJVA 2R92H 2AMCB 2VNUD 2JE6I 3UDXA 3CXCA 2UU9L 1I3QH 4IOCA 1SFOH 1N36L 3E9HA 2YU9H 3H3VH 3U50C 4HIOA 2IT1A 4JI2Q 4PZ8A 2GVAA 1SRUA 4YCWA 2E2HH 4DR6L 3HOXH 4K0KQ 1UE7A 1E3PA 4JI7Q 1IYJB 3CPFA 2YV5A 1YVCA 1TWAH 2JJQA 4BBRH 3H15A 1VQMA 2UUAQ 2K5HA 1MIUA 4C3IH 4OO1I 2Q2IA 3A5UA 4DAYB 2VS1A 2I5LX 3PUZA 4X64L 4NXMQ 3HOUG 4YHHL 3L0OA 4R4TA 1PH1A 2AWOA 4UPAA 5IYCH 4DV6L 2CCZA 1E22A 5IT9c 2PI2E 4QQBX 1NJIC 1PYSB 1TWGH 5GAHC 1C7YA 1CSQA 1KL9A 3KF6B 3ERSX 1E1OA 5C4XH 3KJOA 4YWLA 4QGUA 4A3IG 2Z0SA 4LUVA 5C44G 4DUZL 3HOYG 3CC4A 2YTXA 3U4VA 1NY4A 2N49A 3K7AH 4JI5Q 4JBKA 2UXDQ 4DV3Q 5EAYA 3E9IA 3KF6A 1L0WA 4AYBG 1XNQL 1GO3E 2RF4A 1YITA 1N33L 2NN6I 5C3EH 4FDBA 1XNRQ 1N36Q 3NENA 3GTGH 2WAQG 4A3CG 1EIFA 4RG1A 1KHIA 3K80C 4HJ9A 1NMGA 1Q46A 2JA9A 3TREA 1GD7A 1SR3A 2JA5G 3KF8B 1MJEA 4DR7L 2F3IA 3I56A 3BJUA 3J7ZC 4LF5L 5C0XI 5BR8Q 4GNXA 3G48A 4AQYQ 2YYZA 1HZBA 2E5LL 1CUKA 1NMFA 4YHHQ 4MTNA 1T9HA 1UE6A 4LF9Q 2BH2A 1Y1VH 3FP9A 1VQOA 1EOVA 2NZOA 4DR3L 2Y0SG 4BY7G 1J6QA 3M7NA 2PQAA 3ULJA 4LFBQ 3J80i 1PA6A 4BBSG 2IHEA 2XTIA 4LNQA 4GS3A 4KHPL 1N32L 1VS0A 3S14H 3PO2G 1WFQA 1UE5A 1A63A 1AH9A 5IYDH 2H5XA 1YNXA 1I94Q 3F2CA 4LF6Q 1XNQQ 3JC66 1IBKQ 2NVQH 1OXVA 1BBUA 4XIGS 3PF4A 2D0OA 2IY5B 1JJGA 4DV7L 4BY1G 4GN3B 3EN2A 3CCUA 3CF5A 2R93G 4OONA 4JBWA 4GOPB 2R92G 4AYBE 1HNWL 1X9NA 1J5EL 3M4OH 4A93H 1IXRA 4DR7Q 5FJ8H 4JYAQ 1P16A 1YIJA 1N8RC 1XMOL 5ELOA 1A0IA 3UE1A 4LF5Q 3K0XA 1O7IA 1YJNA 3HOXG 1K8GA 2E5LQ 4X62L 5IWAQ 4BBRG 2EIFA 4LFAQ 1U5KA 4JI6L 2F52A 4LF7Q 2D62A 2UXCL 1AE3A 4O2DA 2WB1G 4APVA 5IYCG 3G71A 3UDGA 1VQ9A 4KHPQ 2NVXH 1L1OC 4A4IA 2Y0SE 5GADC 4HJ5A 3S1RH 1KC8C 1PH5A 1HNXL 1IBLQ 3HOZH 3ZJYC 5K36G 3KDFB 1HZ9A 1Q12A 4DV1L 1VQ6A 1UEBA 3TQYA 4X6AH 4JI1L 5C4XG 3S16H 3TS0A 2VQFQ 1OXSC 4JC0A 2L15A 1J5EQ 4B3MQ 5JEAG 3MXNB 4UP9A 3ICEA 1QUQA 5C3EG 2OQ0A 1QZGA 3BZKA 1XMOQ 4OX9L 4DPGA 1WI5A 3I4MH 3JAMc 4DV0L 2ZM6L 2XGTA 3STBC 4BA2I 4JBJA 4BXXH 5IE8A 1IZ6A 3ULLA 1QVCA 3OW2A 2UUBL 2ATWA 1Q1BA 4IPCA 4P72A 4UP7A 2UXCQ 4A3JH 3HKSA 1TWFH 5M3FH 4B3RQ 2Q2HA 1N34L 1I6HH 1EUJA 1Y1VG 2I5HA 3PUYA 4A3FH 3W5OA 4A3LH 3CW2C 2VUMH 2OTLA 3PF5A 1EIYB 2R7ZH 1WJJA 4DV1Q 1OXTA 4KLKA 1HZCA 1IBMQ 2WB1E 3EBEA 4JI1Q 2ZJQA 1TXYA 1VQ5A 1SMXA 1VQCA 4OWWB 3GTLH 2BA1A 1EQQA 1K3RA 5IYDG 1QVGA 2Z6KC 4GN4B 1JJCB 1HZAA 3AFPA 3PV0A 2VQEQ 1KRSA 1X3EA 5ELNA 4DK6C 1HR0L 1Y1WH 3PSIA 2ALYB 5IP7H 1QZHA 4GKKL 4JV5L 1VQLA 2OWOA 4OX9Q 3BU2A 3TEHB 4J15A 2QEXA 4A3BH 1PYBA 2PNHA 1E24A 4A93G 2GN5A 2KBNA 4DV0Q 2JA6H 5FJ8G 2ZM6Q 1BVSA 1S3OA 2B3GA 2BH8A 1VCIA 4Y52H 5LMUL 2D0PA 2DUDA 3RLFA 2AKWB 1V9PA 3T1YL 3W1GA 4NXNQ 2E2JH 3GO5A 4DV4Q 3KOJA 1Z47A 3W1BA 1LYLA 3K81C 3CMAA 2K4KA 3CCSA 2HHHQ 3S15H 1PH2A 4JBMA 1NTGA 4NPSA 1YJ9A 4OWTB 3PGZA 5DLQE 2K5NA 5AJ3L 4DUYL 2UU9Q 3HOWH 2UXBL 3HOZG 2CKZB 2MNAA 4R4QA 4UP8A 2Q2TA 1CKOA 1LTLA 3RN5A 4JCVE 4C3HH 4JOIC 2LXKA 1CKMA 2YTYA 3M4QA 4JI3L 4GNXB 4DR6Q 2LXJA 2V1CC 3MEFA 2MFIA 2KHJA 3D0FA 1PV4A 1HH2P 4O0AA 4LFCL 3RZOH 4C3JH 3I4OA 1NE3A 1Q86C 4BA1I 1KIXA 3J81j 2CWAA 2PQAB 3K7UC 4IJLA 5GAGC 4X64Q 4AIMA 1SE8A 1Z9FA 4DV6Q 1G6PA 2ZJRA 4A3KH 1N9WA 3T1YQ 3I4MG 4R4CA 2K5VA 1MJCA 4JI4L 4P75A 1A8VA 3SGIA 3CPWA 1RL2A 3H3VI 3S1MH 3GTPH 4OO1G 4BXXG 2R6GA 3PCOB 2B29A 5HGQA 5IP9H 4R4IA 1VQEA 1KD1C 4DUZQ 5GQOA 1BBWA 1VQJA 2KCMA 4IPHA 4A3JG 2FXQA 3PIOA 4L5SA 5M3FG 1ASYA 1VQIA 4Y7NH 5AJ3Q 3A74A 1N33Q 4A3FG 4A3LG 1Q81C 1BKBA 5GAEC 5C0XJ 2IX1A 2VUMG 1CKNA 2NZHA 2EQSA 3HKZG 4PG3A 5LMNL 2K52A 2R7ZG 4HIDA 3TRZA 1DGSA 4DR4L 2UUCL 4IO9A 1Q82C 1K83H 3S2DH 2HIVA 1L1OA 1IL2A 2WP8J 5JJIA 2WAQE 3CP0A 5IY0A 2NVTH 2IHFA 1G291 4LFCQ 1FJGL 1S40A 4DNIA 2HQLA 4A3DH 3OYYA 1Y1WG 5IP7G 1XPOA 4A3BG 4OWXB 1WCMH 1KQSA 2JA7H 1VQHA 1FGUA 4DR3Q 2JA6G 3CCVA 4HJAA 1XTDA 1SROA 3I55A 2EXDA 4ME3A 1K8AC 3U4ZA 4QIWE 3RLNA 4A3MH 1N32Q 2AWNA 3K8AA 4POGA 3F2BA 2KENA 3B6YA 3CCQA 1QUQB 4DV5L 3CC2A 1JE5A 5JJLA 1K73C 3JAMi 1YEZA 3G6EA 5LMNQ 3AYHB 4DV7Q 3U58A 1PH7A 1G51A 2UUCQ 1HNWQ 4DR5L 3HOWG 5E7NA 3I4NH 3HKZE 5J3BA 4B3TL 1YJWA 1FJGQ 4PZ7A 1KXLA 1FVIA 2ZTDA 4GKJL 1VQ7A 4X62Q 1L2FA 4POFA 4LF4L 2Z6KA 3J81i 2I5MX 1NBWA 4JI6Q 3CMEA 4LF8L 1X65A 4IFDJ 4GOPC 2VY3A 3NEMA 1VQDA 4IPDA 2E2IH 3S2HH 2RCNA 5FLMH 5M3MH 3BZCA 3A5ZB 4P71A 4A3KG 2VZAA 1K0RA 1HNXQ 1JJ2A 4JI2L 4K0KL 2WFWA 2CFMA 3CCRA 2I0QA 4KI0A 3AFQA 5IP9G 2JA8H 1VQBA 2UUAL 5C4JH 1VQAA 1GM5A 4WJ3M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHS B;  1VQK A;  2RHQ B;  3PUV A;  2K75 A;  2N78 A;  4IJH A;  5M5W H;  2C35 B;  2NVY H;  1E7Z A;  3CQZ H;  3RZD H;  4ALP A;  4R4O A;  4IFD G;  1X56 A;  4RMF A;  2GVB A;  2E8G A;  4QL5 A;  3S17 H;  4GKJ Q;  1LUZ A;  5HY6 A;  4JG2 A;  1X3F A;  2QA4 A;  4A3E H;  3S1N H;  4C2M H;  3RLO A;  1PH6 A;  1X55 A;  3T1H L;  2JEA I;  4PZ6 A;  1S72 A;  1MKH A;  4JOI A;  2UUB Q;  4DV3 L;  3E0E A;  2OTJ A;  2UXD L;  3GTQ H;  2MO1 A;  1VQP A;  4A3D G;  3AQQ A;  2KCT A;  3M9B A;  4HIM A;  5JJK A;  1HJP A;  1N34 Q;  3GD7 A;  1B8A A;  1XNR L;  4HJ8 A;  1WCM G;  4EQ5 A;  2JA7 G;  1VQN A;  5LMN W;  5IYB H;  1XMQ L;  2R7D A;  3PO3 H;  1W2B A;  1C0A A;  1D7Q A;  1SLJ A;  1VQ8 A;  4A3M G;  3IRB A;  3H0G H;  5BR8 L;  1ASZ A;  4AQY L;  3A0J A;  4YWM A;  3PUX A;  4LF9 L;  3S1Q H;  3PUW A;  4DV2 L;  1HR0 Q;  3L7Z C;  4JV5 Q;  4GKK Q;  2JK8 A;  1V43 A;  2YTV A;  1JB7 A;  4GLV B;  1PFS A;  3S24 A;  3DLL A;  4LFB L;  2MQH A;  2OCE A;  1E1T A;  1Y14 B;  4IOA A;  4AH6 A;  4LWC A;  2B63 H;  3I7F A;  4R1J A;  4JI8 L;  3G4S A;  3AEV A;  3I4N G;  5LMU Q;  3T1H Q;  2K14 A;  4EX5 A;  4DR2 L;  1EWI A;  3ULP A;  1WOC A;  2HIX A;  4X66 L;  1I94 L;  4LF6 L;  4YY3 L;  1IBK L;  3PIP A;  4PMW A;  1VQ4 A;  3F2D A;  3RN2 A;  3OTO L;  4DR1 L;  1GVP A;  1XMQ Q;  4A3G H;  1CKN B;  2K50 A;  3EIV A;  3D31 A;  3VDY A;  1EFW A;  1PH3 A;  1VQF A;  5FLM G;  5M3M G;  1Q8K A;  4JYA L;  1AE2 A;  1L1O B;  2IX0 A;  3FKI H;  3HFZ B;  4DUY Q;  1Q7Y C;  2HT1 A;  1TWH H;  2UXB Q;  4LUO A;  1W3S A;  1WYD A;  4DK3 C;  3HOV H;  1JT8 A;  1M1K C;  2BA0 A;  3KFU A;  3RNU A;  2CWP A;  1EYG A;  5IWA L;  4JI0 L;  1OTC A;  4JI3 Q;  2JA8 G;  4DV2 Q;  4LW1 A;  3LGJ A;  4LFA L;  1HNZ L;  2LSS A;  1KAW A;  3NBH B;  4LF7 L;  1C9O A;  2NN6 G;  4L5R C;  2ZJP A;  3DM3 A;  4GLX A;  2QGQ A;  4A76 A;  1KRT A;  3UDF A;  2AHO B;  4HIK A;  4A75 A;  2ASB A;  5GRO A;  4JI8 Q;  1YI2 A;  1B7Y B;  1YHB A;  3UDI A;  4DR2 Q;  1IBL L;  2A8V A;  4DKA C;  3F8T A;  4QJF A;  4X66 Q;  1PH8 A;  4JI4 Q;  1P8L A;  4YY3 Q;  4A3E G;  4GNX C;  1YHA A;  5C0X G;  1TWC H;  2VQF L;  3CC7 A;  3J80 c;  4YCU A;  4UY8 C;  1SN8 A;  3OTO Q;  4DR1 Q;  5M5X H;  3UE0 A;  1K9M C;  3M3Y H;  3KLW A;  2JEB I;  4B3M L;  3GTK H;  2ZTE A;  3M85 A;  3F1Z A;  2VL6 A;  3HOU H;  1D8L A;  1HR0 W;  1PVO A;  5IYB G;  4GOP A;  3CCM A;  3GTJ H;  4HJ7 A;  3PO3 G;  1X54 A;  4DR4 Q;  3NEL A;  4IPG A;  4TVA B;  3CCJ A;  2ES2 A;  2JQO A;  4JI0 Q;  2F4V L;  4P73 A;  5JEA J;  1U0L A;  4A3I H;  1PH9 A;  5C44 H;  1HNZ Q;  3HOY H;  3CAM A;  1PHJ A;  3TS2 A;  4X65 L;  3H0G G;  1M90 C;  3GDE A;  4OXP A;  2R7F A;  4MNO A;  1X6O A;  1OXX K;  4B3S L;  4GN5 A;  4QY7 A;  4B3R L;  2ID0 A;  4P74 A;  2N3S A;  2A19 A;  2OQK A;  3I2Z A;  4XTC S;  1RIP A;  3M4P A;  2PI2 A;  3RR5 A;  4A3C H;  3ER0 A;  3L2P A;  1IBM L;  4KHZ A;  2PMZ E;  1UWV A;  3CCE A;  2JA5 H;  2B63 G;  4IFD I;  2CQO A;  1FL0 A;  1PH4 A;  1I5F A;  1UE1 A;  3GTM H;  1LM0 A;  5M5Y H;  3KDF A;  5H1S E;  1A62 A;  1EQR A;  1H95 A;  1GKH A;  2VW9 A;  2VQE L;  2DGY A;  1YZ6 A;  1OXU A;  2N8N A;  4JI7 L;  3STB D;  4DAM A;  4DV5 Q;  1CSP A;  3Q8D A;  3WWV A;  1XPR A;  4A3G G;  4YCV A;  3J7A 5;  1QVF A;  3KYH C;  3CD6 A;  1X3G A;  4MZ9 A;  1XPU A;  1V1Q A;  4BY7 H;  4YWK A;  4GLA C;  4NXM L;  4L5T A;  2F4V Q;  3FKI G;  4DR5 Q;  2Q2U A;  4BBS H;  1YBY A;  1Q1E A;  1R9T H;  2A1A A;  4NB3 A;  4B3T Q;  4X65 Q;  3HOV G;  3PO2 H;  1VQG A;  4H02 A;  2MO0 A;  5FLX c;  3FHW A;  3CCL A;  4TQU S;  2ZTC A;  1I50 H;  4NXN L;  4B3S Q;  3KJP A;  4DV4 L;  2KHI A;  1JMC A;  4LF4 Q;  3GTO H;  4WJ4 A;  2HHH L;  4JI5 L;  1YHQ A;  4BY1 H;  2R93 H;  4L5Q A;  1B70 B;  4LUZ A;  4LF8 Q;  3J81 c;  1XJV A;  2R92 H;  2AMC B;  2VNU D;  2JE6 I;  3UDX A;  3CXC A;  2UU9 L;  1I3Q H;  4IOC A;  1SFO H;  1N36 L;  3E9H A;  2YU9 H;  3H3V H;  3U50 C;  4HIO A;  2IT1 A;  4JI2 Q;  4PZ8 A;  2GVA A;  1SRU A;  4YCW A;  2E2H H;  4DR6 L;  3HOX H;  4K0K Q;  1UE7 A;  1E3P A;  4JI7 Q;  1IYJ B;  3CPF A;  2YV5 A;  1YVC A;  1TWA H;  2JJQ A;  4BBR H;  3H15 A;  1VQM A;  2UUA Q;  2K5H A;  1MIU A;  4C3I H;  4OO1 I;  2Q2I A;  3A5U A;  4DAY B;  2VS1 A;  2I5L X;  3PUZ A;  4X64 L;  4NXM Q;  3HOU G;  4YHH L;  3L0O A;  4R4T A;  1PH1 A;  2AWO A;  4UPA A;  5IYC H;  4DV6 L;  2CCZ A;  1E22 A;  5IT9 c;  2PI2 E;  4QQB X;  1NJI C;  1PYS B;  1TWG H;  5GAH C;  1C7Y A;  1CSQ A;  1KL9 A;  3KF6 B;  3ERS X;  1E1O A;  5C4X H;  3KJO A;  4YWL A;  4QGU A;  4A3I G;  2Z0S A;  4LUV A;  5C44 G;  4DUZ L;  3HOY G;  3CC4 A;  2YTX A;  3U4V A;  1NY4 A;  2N49 A;  3K7A H;  4JI5 Q;  4JBK A;  2UXD Q;  4DV3 Q;  5EAY A;  3E9I A;  3KF6 A;  1L0W A;  4AYB G;  1XNQ L;  1GO3 E;  2RF4 A;  1YIT A;  1N33 L;  2NN6 I;  5C3E H;  4FDB A;  1XNR Q;  1N36 Q;  3NEN A;  3GTG H;  2WAQ G;  4A3C G;  1EIF A;  4RG1 A;  1KHI A;  3K80 C;  4HJ9 A;  1NMG A;  1Q46 A;  2JA9 A;  3TRE A;  1GD7 A;  1SR3 A;  2JA5 G;  3KF8 B;  1MJE A;  4DR7 L;  2F3I A;  3I56 A;  3BJU A;  3J7Z C;  4LF5 L;  5C0X I;  5BR8 Q;  4GNX A;  3G48 A;  4AQY Q;  2YYZ A;  1HZB A;  2E5L L;  1CUK A;  1NMF A;  4YHH Q;  4MTN A;  1T9H A;  1UE6 A;  4LF9 Q;  2BH2 A;  1Y1V H;  3FP9 A;  1VQO A;  1EOV A;  2NZO A;  4DR3 L;  2Y0S G;  4BY7 G;  1J6Q A;  3M7N A;  2PQA A;  3ULJ A;  4LFB Q;  3J80 i;  1PA6 A;  4BBS G;  2IHE A;  2XTI A;  4LNQ A;  4GS3 A;  4KHP L;  1N32 L;  1VS0 A;  3S14 H;  3PO2 G;  1WFQ A;  1UE5 A;  1A63 A;  1AH9 A;  5IYD H;  2H5X A;  1YNX A;  1I94 Q;  3F2C A;  4LF6 Q;  1XNQ Q;  3JC6 6;  1IBK Q;  2NVQ H;  1OXV A;  1BBU A;  4XIG S;  3PF4 A;  2D0O A;  2IY5 B;  1JJG A;  4DV7 L;  4BY1 G;  4GN3 B;  3EN2 A;  3CCU A;  3CF5 A;  2R93 G;  4OON A;  4JBW A;  4GOP B;  2R92 G;  4AYB E;  1HNW L;  1X9N A;  1J5E L;  3M4O H;  4A93 H;  1IXR A;  4DR7 Q;  5FJ8 H;  4JYA Q;  1P16 A;  1YIJ A;  1N8R C;  1XMO L;  5ELO A;  1A0I A;  3UE1 A;  4LF5 Q;  3K0X A;  1O7I A;  1YJN A;  3HOX G;  1K8G A;  2E5L Q;  4X62 L;  5IWA Q;  4BBR G;  2EIF A;  4LFA Q;  1U5K A;  4JI6 L;  2F52 A;  4LF7 Q;  2D62 A;  2UXC L;  1AE3 A;  4O2D A;  2WB1 G;  4APV A;  5IYC G;  3G71 A;  3UDG A;  1VQ9 A;  4KHP Q;  2NVX H;  1L1O C;  4A4I A;  2Y0S E;  5GAD C;  4HJ5 A;  3S1R H;  1KC8 C;  1PH5 A;  1HNX L;  1IBL Q;  3HOZ H;  3ZJY C;  5K36 G;  3KDF B;  1HZ9 A;  1Q12 A;  4DV1 L;  1VQ6 A;  1UEB A;  3TQY A;  4X6A H;  4JI1 L;  5C4X G;  3S16 H;  3TS0 A;  2VQF Q;  1OXS C;  4JC0 A;  2L15 A;  1J5E Q;  4B3M Q;  5JEA G;  3MXN B;  4UP9 A;  3ICE A;  1QUQ A;  5C3E G;  2OQ0 A;  1QZG A;  3BZK A;  1XMO Q;  4OX9 L;  4DPG A;  1WI5 A;  3I4M H;  3JAM c;  4DV0 L;  2ZM6 L;  2XGT A;  3STB C;  4BA2 I;  4JBJ A;  4BXX H;  5IE8 A;  1IZ6 A;  3ULL A;  1QVC A;  3OW2 A;  2UUB L;  2ATW A;  1Q1B A;  4IPC A;  4P72 A;  4UP7 A;  2UXC Q;  4A3J H;  3HKS A;  1TWF H;  5M3F H;  4B3R Q;  2Q2H A;  1N34 L;  1I6H H;  1EUJ A;  1Y1V G;  2I5H A;  3PUY A;  4A3F H;  3W5O A;  4A3L H;  3CW2 C;  2VUM H;  2OTL A;  3PF5 A;  1EIY B;  2R7Z H;  1WJJ A;  4DV1 Q;  1OXT A;  4KLK A;  1HZC A;  1IBM Q;  2WB1 E;  3EBE A;  4JI1 Q;  2ZJQ A;  1TXY A;  1VQ5 A;  1SMX A;  1VQC A;  4OWW B;  3GTL H;  2BA1 A;  1EQQ A;  1K3R A;  5IYD G;  1QVG A;  2Z6K C;  4GN4 B;  1JJC B;  1HZA A;  3AFP A;  3PV0 A;  2VQE Q;  1KRS A;  1X3E A;  5ELN A;  4DK6 C;  1HR0 L;  1Y1W H;  3PSI A;  2ALY B;  5IP7 H;  1QZH A;  4GKK L;  4JV5 L;  1VQL A;  2OWO A;  4OX9 Q;  3BU2 A;  3TEH B;  4J15 A;  2QEX A;  4A3B H;  1PYB A;  2PNH A;  1E24 A;  4A93 G;  2GN5 A;  2KBN A;  4DV0 Q;  2JA6 H;  5FJ8 G;  2ZM6 Q;  1BVS A;  1S3O A;  2B3G A;  2BH8 A;  1VCI A;  4Y52 H;  5LMU L;  2D0P A;  2DUD A;  3RLF A;  2AKW B;  1V9P A;  3T1Y L;  3W1G A;  4NXN Q;  2E2J H;  3GO5 A;  4DV4 Q;  3KOJ A;  1Z47 A;  3W1B A;  1LYL A;  3K81 C;  3CMA A;  2K4K A;  3CCS A;  2HHH Q;  3S15 H;  1PH2 A;  4JBM A;  1NTG A;  4NPS A;  1YJ9 A;  4OWT B;  3PGZ A;  5DLQ E;  2K5N A;  5AJ3 L;  4DUY L;  2UU9 Q;  3HOW H;  2UXB L;  3HOZ G;  2CKZ B;  2MNA A;  4R4Q A;  4UP8 A;  2Q2T A;  1CKO A;  1LTL A;  3RN5 A;  4JCV E;  4C3H H;  4JOI C;  2LXK A;  1CKM A;  2YTY A;  3M4Q A;  4JI3 L;  4GNX B;  4DR6 Q;  2LXJ A;  2V1C C;  3MEF A;  2MFI A;  2KHJ A;  3D0F A;  1PV4 A;  1HH2 P;  4O0A A;  4LFC L;  3RZO H;  4C3J H;  3I4O A;  1NE3 A;  1Q86 C;  4BA1 I;  1KIX A;  3J81 j;  2CWA A;  2PQA B;  3K7U C;  4IJL A;  5GAG C;  4X64 Q;  4AIM A;  1SE8 A;  1Z9F A;  4DV6 Q;  1G6P A;  2ZJR A;  4A3K H;  1N9W A;  3T1Y Q;  3I4M G;  4R4C A;  2K5V A;  1MJC A;  4JI4 L;  4P75 A;  1A8V A;  3SGI A;  3CPW A;  1RL2 A;  3H3V I;  3S1M H;  3GTP H;  4OO1 G;  4BXX G;  2R6G A;  3PCO B;  2B29 A;  5HGQ A;  5IP9 H;  4R4I A;  1VQE A;  1KD1 C;  4DUZ Q;  5GQO A;  1BBW A;  1VQJ A;  2KCM A;  4IPH A;  4A3J G;  2FXQ A;  3PIO A;  4L5S A;  5M3F G;  1ASY A;  1VQI A;  4Y7N H;  5AJ3 Q;  3A74 A;  1N33 Q;  4A3F G;  4A3L G;  1Q81 C;  1BKB A;  5GAE C;  5C0X J;  2IX1 A;  2VUM G;  1CKN A;  2NZH A;  2EQS A;  3HKZ G;  4PG3 A;  5LMN L;  2K52 A;  2R7Z G;  4HID A;  3TRZ A;  1DGS A;  4DR4 L;  2UUC L;  4IO9 A;  1Q82 C;  1K83 H;  3S2D H;  2HIV A;  1L1O A;  1IL2 A;  2WP8 J;  5JJI A;  2WAQ E;  3CP0 A;  5IY0 A;  2NVT H;  2IHF A;  1G29 1;  4LFC Q;  1FJG L;  1S40 A;  4DNI A;  2HQL A;  4A3D H;  3OYY A;  1Y1W G;  5IP7 G;  1XPO A;  4A3B G;  4OWX B;  1WCM H;  1KQS A;  2JA7 H;  1VQH A;  1FGU A;  4DR3 Q;  2JA6 G;  3CCV A;  4HJA A;  1XTD A;  1SRO A;  3I55 A;  2EXD A;  4ME3 A;  1K8A C;  3U4Z A;  4QIW E;  3RLN A;  4A3M H;  1N32 Q;  2AWN A;  3K8A A;  4POG A;  3F2B A;  2KEN A;  3B6Y A;  3CCQ A;  1QUQ B;  4DV5 L;  3CC2 A;  1JE5 A;  5JJL A;  1K73 C;  3JAM i;  1YEZ A;  3G6E A;  5LMN Q;  3AYH B;  4DV7 Q;  3U58 A;  1PH7 A;  1G51 A;  2UUC Q;  1HNW Q;  4DR5 L;  3HOW G;  5E7N A;  3I4N H;  3HKZ E;  5J3B A;  4B3T L;  1YJW A;  1FJG Q;  4PZ7 A;  1KXL A;  1FVI A;  2ZTD A;  4GKJ L;  1VQ7 A;  4X62 Q;  1L2F A;  4POF A;  4LF4 L;  2Z6K A;  3J81 i;  2I5M X;  1NBW A;  4JI6 Q;  3CME A;  4LF8 L;  1X65 A;  4IFD J;  4GOP C;  2VY3 A;  3NEM A;  1VQD A;  4IPD A;  2E2I H;  3S2H H;  2RCN A;  5FLM H;  5M3M H;  3BZC A;  3A5Z B;  4P71 A;  4A3K G;  2VZA A;  1K0R A;  1HNX Q;  1JJ2 A;  4JI2 L;  4K0K L;  2WFW A;  2CFM A;  3CCR A;  2I0Q A;  4KI0 A;  3AFQ A;  5IP9 G;  2JA8 H;  1VQB A;  2UUA L;  5C4J H;  1VQA A;  1GM5 A;  4WJ3 M; 
#chains in the Genus database with same CATH topology
 2RHS B;  1TS2 A;  2K75 A;  3ND8 A;  2E2D C;  2N78 A;  5IIF A;  1GUG A;  1IW7 D;  3DWP A;  4I65 A;  4RMF A;  2JA5 B;  1IW7 C;  1X3F A;  3S1N H;  4C2M H;  1Y8N B;  3T1H L;  1MKH A;  3I3C A;  4DV3 L;  5CV4 A;  4J8Q A;  3GTQ H;  1E2W A;  2KCT A;  3M9B A;  5JJK A;  1N34 Q;  4HJ8 A;  5BN4 A;  3MA2 B;  1VQN A;  2Y0S B;  3VR3 A;  1WVL A;  1CK1 A;  1W2B A;  1C4Q A;  4HED A;  2KEC A;  2HCC A;  3IRB A;  2MGS A;  2A69 D;  4LF9 L;  2NZ1 D;  3S1Q H;  3L7Z C;  4JV5 Q;  4GKK Q;  1A3V A;  1GJX A;  2ZXO A;  3FEW X;  2EY5 A;  2B2V C;  1I3Q B;  4LWC A;  2B63 H;  3I7F A;  1TQO A;  3G4S A;  2K14 A;  4EX5 A;  3IL8 A;  3IFT A;  3NBI A;  4X66 L;  1I94 L;  4YY3 L;  4KD3 A;  2PO4 A;  4RCO A;  1QB5 D;  4X3K A;  1VQ4 A;  4K6D A;  3OTO L;  4C3I B;  1U9R A;  1BXT A;  1XMQ Q;  1FR3 A;  3EIV A;  1EFW A;  3D3R A;  3U9O A;  3HFZ B;  2M00 A;  2UXB Q;  1Q7Y C;  1TWH H;  4I7Z C;  4DK3 C;  1JT8 A;  3H09 A;  1M1K C;  3KF8 A;  3KFU A;  2CWP A;  1PZK D;  1OTC A;  1SNO A;  1O78 A;  3E6Z X;  2ZJP A;  3DM3 A;  2EYJ A;  2ASB A;  4A75 A;  4K8I A;  5GRO A;  3NP8 A;  4DR2 Q;  1IBL L;  4DKA C;  1SNP A;  1II3 A;  3F8T A;  1P8L A;  1LO5 D;  1LTA D;  4GNX C;  1EY0 A;  3MAQ A;  2VQF L;  3J80 c;  4UY8 C;  1SN8 A;  3M3Y H;  2J7Z A;  1GUT A;  4DXF A;  2RBM A;  3M85 A;  3VYU A;  1Y1V B;  1ENC A;  1VDZ A;  3FDT A;  3CCM A;  4HJ7 A;  4DR4 Q;  3NEL A;  2P5Z X;  4IPG A;  3CCJ A;  3MWY W;  2F1M A;  2EE1 A;  3C1F A;  1U0L A;  1SNQ A;  5C44 H;  3TS2 A;  1PHJ A;  2BCO A;  1V1P B;  2R7F A;  2EZV A;  4B3R L;  4QY7 A;  2L1B A;  4P74 A;  2BDN A;  3J80 L;  2A19 A;  3I2Z A;  4XTC S;  1MI2 A;  1PFN A;  4R8N A;  1YNN C;  3M4P A;  2WKC A;  3ER0 A;  3H91 A;  4V0B A;  1IL8 A;  2PMZ E;  4CDC C;  4IFD I;  2B63 G;  2B2T C;  1FL0 A;  4OEL B;  1I5F A;  3PMF A;  1LM0 A;  2WV6 D;  3KDF A;  3DXJ C;  1STA A;  1GKH A;  1OO9 B;  2VW9 A;  4KTA A;  3TP6 A;  1YZ6 A;  2F0P A;  4DV5 Q;  1CSP A;  1FGB D;  3Q8D A;  3WWV A;  1HUN A;  2BDO A;  1X3G A;  4BY7 H;  4YWK A;  4NXM L;  3PO2 H;  3S1R B;  4X65 Q;  1TII D;  4H02 A;  4TQU S;  3HZX A;  1I50 H;  1EQV A;  3KJP A;  1A3U A;  3K5L A;  4LF4 Q;  4HCS A;  4K6L A;  4BY1 H;  2VNU D;  1K28 A;  3CXC A;  3OMG A;  4IUN A;  3U50 C;  3MC0 B;  4PZ8 A;  1SRU A;  1UE7 A;  4JI7 Q;  4RA8 A;  4BBR H;  4LK1 C;  4DAY B;  5CR3 A;  5CBE E;  5M3F B;  4F88 A;  2B39 A;  2AQ3 B;  5DAU A;  4DV6 L;  4A3F B;  4WJW A;  3HKZ B;  1LTB D;  4DF7 A;  5C4X H;  2L0C A;  5C44 G;  3GTL B;  2N49 A;  4JI5 Q;  2UXD Q;  3KF6 A;  1L0W A;  4AYB G;  1XNQ L;  3NPP A;  5C3E H;  1XNR Q;  1N36 Q;  3NEN A;  2BE5 C;  1NMG A;  1ML0 D;  1Q46 A;  2JA9 A;  1GD7 A;  2JA6 B;  1G2T A;  4DR7 L;  1Y69 U;  3I56 A;  2L11 A;  3BJU A;  5BR8 Q;  3G48 A;  1HZB A;  1O7Z A;  3OPO A;  2BH2 A;  1R4P B;  1XYI A;  4BY7 G;  3S15 B;  1PA6 A;  2IHE A;  1S5B D;  1I4X A;  4HTH A;  3PO2 G;  2CH4 A;  3A56 A;  3CKI B;  1AH9 A;  5IYD H;  3QJY A;  2CH4 W;  3JC6 6;  4HN7 A;  3PF4 A;  2MP1 A;  3D6W A;  4DV7 L;  4BY1 G;  1ESR A;  3EN2 A;  4GOP B;  4AYB E;  1X9N A;  3M4O H;  4A93 H;  3PO3 B;  2F0W A;  2ZXR A;  2QKI C;  4JYA Q;  1XMO L;  1A0I A;  3H3V C;  4LF5 Q;  4R8I A;  3VYS A;  1O7I A;  1YJN A;  3GTP B;  3S1M B;  5DNF A;  3P20 A;  4BBR G;  1LAB A;  1PTO D;  4LFA Q;  5CV8 A;  3RD4 A;  5IGF A;  4LF7 Q;  3KLS A;  2JYO A;  4KHP Q;  2NVX H;  5J22 A;  1L1O C;  3BDL A;  4L63 B;  4X3T A;  4DV1 L;  5C4X G;  4JI1 L;  1F9R A;  4F8M A;  1OXS C;  2F0G A;  2Q8I B;  4JC0 A;  1DYQ A;  2L15 A;  3PIP 3;  1QUQ A;  5C3E G;  1PLF A;  3BZK A;  2E76 C;  5HUR A;  1SJH D;  3I4M H;  1FNV A;  2K04 A;  4DV0 L;  1EWH A;  2ZM6 L;  3DHQ A;  4JBJ A;  3MHB A;  1EY8 A;  4K5X A;  4G7Z C;  4CBV A;  4B9W A;  1E0B A;  2L5T A;  4UP7 A;  4G7O C;  2SEB D;  4KV6 A;  1N34 L;  3BDO A;  1H9R A;  3PUY A;  1OXT A;  1HTL D;  2K5Q A;  3T4A C;  3EBE A;  1IBM Q;  2ZJQ A;  3DWA A;  3C46 A;  5C4Z A;  4NW2 A;  1SMX A;  5ISR A;  5KRU A;  4OWW B;  1K3R A;  5IYD G;  1G91 A;  2Z6K C;  2XWB B;  4GN4 B;  3AFP A;  3ERQ A;  1KRS A;  1X3E A;  1KTK A;  4JV5 L;  2ALY B;  3O13 A;  5G3L F;  4GKK L;  1VQL A;  1HCZ A;  3BU2 A;  3TEH B;  4J15 A;  4A3B H;  3K5O A;  3ERO A;  4A93 G;  5IOD A;  4UHV A;  3KUP A;  2B3G A;  2BH8 A;  4Y52 H;  3BS1 A;  2DUD A;  3RLF A;  2D2C C;  1IKM A;  4NXN Q;  4DV4 Q;  4FXD A;  5EKL A;  3HS0 C;  5IGD A;  3CCS A;  2HHH Q;  4DXG A;  4JBM A;  2UXB L;  1STG A;  2PMZ B;  2CKZ B;  1Q3L A;  1STH A;  2O2L D;  2F0O A;  4JCV E;  1H9S B;  3S1N B;  4MTK A;  4C2M B;  3GTO B;  1CHQ D;  1TKW B;  1PV4 A;  1WTV A;  2R92 B;  4C3J H;  1NE3 A;  3GTQ B;  4BA1 I;  2V4D A;  4RKB A;  2EYP A;  1PZI D;  2PQA B;  4IJL A;  1B4O A;  4G4K A;  2LY7 A;  3I4M G;  2EOT A;  5IT9 E;  5I2X A;  3IKJ A;  4B9X A;  2B29 A;  5JJZ A;  2PZW A;  1DD2 A;  2FXQ A;  4BS9 A;  4Y7N H;  3S1Q B;  4EGV A;  1N33 Q;  1BKB A;  3SHL A;  5GAE C;  2EQS A;  4QMG A;  1DGS A;  3J7Y W;  4DR4 L;  1BCP F;  5LHY 1;  3S2D H;  3BZD B;  3H6M A;  2B63 B;  1L0Y B;  2NVT H;  2IHF A;  2ICI A;  2LFN A;  4LFC Q;  4O1N A;  1GUN A;  2K03 A;  4WOR A;  5AFW A;  4A3B G;  3GV6 A;  2JA7 H;  3WDN A;  4DR3 Q;  3CCV A;  2PW7 A;  4HJA A;  1K8O A;  4F7X A;  4ME3 A;  3U4Z A;  3RLN A;  4A3M H;  1TWH B;  2R3Z A;  2A68 C;  2K28 A;  2AWN A;  2C5C A;  4POG A;  3HGB A;  3F2B A;  3R3O A;  1RD9 D;  3CCQ A;  4DV5 L;  2IJ0 A;  2WAC A;  3G6E A;  4DN4 M;  3SK8 A;  1S5E D;  2F0E A;  4FYD A;  1LV9 A;  2K7V A;  1HFG A;  2RVL A;  1KXL A;  4GKJ L;  1EU4 A;  2PYK A;  2OF1 A;  1XWE A;  2DNC A;  4ZYS A;  4CDF C;  2QDL A;  4LF4 L;  1I4H A;  3M3Y B;  3J81 i;  4C3J G;  1V1P A;  1LTT D;  3SK5 A;  2E2I H;  4IPD A;  3S2H H;  1B9N A;  5FLM H;  5ELD A;  2X6G A;  3D4W A;  3HRZ C;  3TBI B;  1KAA A;  4HSV A;  4RKL A;  3CCR A;  4KI0 A;  2JA8 H;  1VQB A;  5C44 B;  1VQA A;  2Z1C A;  1KNA A;  2K5D A;  2VB2 X;  2NN6 H;  2RSN A;  1RDP D;  4LJZ C;  4HCE A;  4AYB B;  2NVY H;  4R4O A;  2GVB A;  3KBX A;  1H9M A;  2RQX A;  2QA4 A;  1GUO A;  1PH6 A;  3ND9 A;  1SE2 A;  1X55 A;  1S72 A;  2UXD L;  1TY0 A;  1VQP A;  3AQQ A;  4HIM A;  1SE4 A;  1XNR L;  5EBC A;  2JA7 G;  5LMN W;  1BF4 A;  5IYB H;  4BY7 B;  3QR8 A;  2EDG A;  3DMU A;  1C0A A;  1D7Q A;  1SLJ A;  4A3M G;  3PO2 B;  5JPN C;  4JK1 C;  1I4Q A;  5BR8 L;  2F3V A;  1I50 B;  4YWM A;  3GQB A;  3K0Y A;  3PUX A;  1STB A;  1BO0 A;  4DNT B;  3A54 A;  1SMY D;  1HR0 Q;  4J6H A;  1V43 A;  1PRT B;  2YTV A;  1JB7 A;  4BY1 B;  1PFS A;  4DAY A;  2OCE A;  3D8G A;  1Y14 B;  2AQ1 B;  4KN7 C;  4JI8 L;  1LT6 D;  5IGB A;  1EEI D;  2EJG C;  4QUF A;  1PMR A;  3VA5 A;  4BBR B;  4PMW A;  3PIP A;  2H4O A;  2JSO A;  3H94 A;  3F2D A;  1I4R A;  2F0J A;  2K50 A;  1WTP A;  5FLM G;  4JYA L;  3U9S A;  4DUY Q;  2B2Y C;  1W3S A;  1B53 A;  1PXU A;  2BA0 A;  2Q8R E;  1EYG A;  5C4X B;  1WTQ A;  2JA8 G;  4DV2 Q;  4RHS A;  3LGJ A;  3OW7 A;  4LFA L;  3MXG A;  1SJE D;  2F0U A;  2LSS A;  3VYR A;  3P1H A;  4LF7 L;  1C9O A;  2NN6 G;  1QNU A;  4A76 A;  1ONL A;  1UNS A;  1YI2 A;  1CA6 A;  5C3E B;  1BCP B;  4U68 A;  1FNU A;  1UUP A;  2JP1 A;  3OOC A;  3C1E A;  1PH8 A;  4KD4 A;  5COY A;  3CC7 A;  2B8F A;  1JOO A;  4DR1 Q;  4ZQ3 A;  3UE0 A;  4EQN A;  4DK1 A;  3GTK H;  1K8M A;  1CI3 M;  3QIA A;  4UAI A;  3F1Z A;  1M8A A;  3LWU A;  4XYO A;  1PVO A;  1ICW A;  5I4D A;  5IYB G;  5HGT A;  5I2Y A;  1F2Y A;  4GOP A;  4G7H C;  2ES2 A;  4JI0 Q;  5CMD A;  4P73 A;  5JEA J;  1HNZ Q;  2PPB C;  2PZU A;  2A73 B;  1OXX K;  4GN5 A;  2ID0 A;  2N3S A;  3OWF A;  2CW0 C;  1RIP A;  1ENA A;  3A8I E;  5D65 A;  3RR5 A;  2PI2 A;  4RWS C;  1IBM L;  4A93 B;  3M4O B;  4KHZ A;  1EU3 A;  2B8G A;  3RUZ A;  1KDB A;  1QOH A;  2DGY A;  4L6T B;  3STB D;  1B44 D;  4ODG A;  4YCV A;  1QVF A;  3KYH C;  4MZ9 A;  1XPU A;  4GLA C;  2F4V Q;  4L5T A;  2Q2U A;  1MBY A;  2NVX B;  1YBY A;  4NB3 A;  5FLX c;  3FHW A;  1F77 A;  2XRS D;  4NXN L;  4B3S Q;  1U4L A;  2DJG C;  3MXU A;  4DV4 L;  1SNM A;  3W3A A;  1JMC A;  3GTO H;  4WJ4 A;  2HHH L;  2R93 H;  4L5Q A;  1B70 B;  1HRJ A;  2R92 H;  3J81 c;  5CC4 A;  1F2L A;  1LT4 D;  3EA6 A;  4FP5 D;  3KLS X;  5FOB B;  5J39 A;  3DWQ A;  3E9H A;  3H3V H;  1CA5 A;  4DK0 A;  3I4M B;  2E2H H;  4K0K Q;  1DOL A;  3HOX H;  2OXP A;  3CPF A;  1VQM A;  1YVC A;  1TWA H;  1NNX A;  2JJQ A;  2PQE A;  2UUA Q;  4OO1 I;  1C8C A;  1WD0 A;  3A5U A;  4CKB A;  1KNE A;  3PUZ A;  2F0D A;  4KKU A;  3L0O A;  4R4T A;  1PH1 A;  2AWO A;  4UPA A;  1ZYR D;  1E22 A;  5IT9 c;  2HDM A;  2PI2 E;  4QQB X;  1NJI C;  1TWG H;  2A69 C;  2DN8 A;  5GAH C;  3ERS X;  2Z0S A;  4LUV A;  3CC4 A;  4JBK A;  3VA7 A;  1D5M C;  1JC7 A;  2F03 A;  1GO3 E;  2RF4 A;  1YIT A;  4CGY B;  1N33 L;  3GTG H;  2WAQ G;  4A3B B;  4HJ9 A;  4RG1 A;  3K80 C;  5E1F A;  1GHJ A;  2EJF C;  1SR3 A;  1SDF A;  4XYQ A;  3NXW A;  2J4X A;  5IT9 L;  4V19 0;  1SYB A;  5L37 A;  3J7Z C;  4HR7 B;  5C0X I;  4AQY Q;  1H9S A;  4YHH Q;  3KLR A;  4ZKC B;  5M9O A;  2FIN B;  1VQO A;  2NZO A;  3NK9 A;  4DR3 L;  2JN4 A;  4ZUJ A;  4B08 A;  4K2L A;  4LFB Q;  2PQA A;  3ULJ A;  4LNQ A;  3S14 H;  1WD1 A;  1T5X D;  1A63 A;  3KK7 A;  2H5X A;  3QG1 A;  1YNX A;  4LF6 Q;  1IBK Q;  5D3D A;  2L9H A;  2D0O A;  1JJG A;  1EFI D;  2OEO A;  4GN3 B;  3CCU A;  2R93 G;  4C3J B;  4JBW A;  2R92 G;  4K14 A;  2K5W A;  4K5W A;  1F9P A;  1DXM A;  2HQE A;  1G8Z D;  3AU7 A;  1YIJ A;  2CQA A;  4ID6 A;  5CV5 A;  4XT1 B;  5ELO A;  1BBX C;  2Z4H A;  2Z9H A;  3K0X A;  3HOX G;  1K8G A;  2E5L Q;  5IWA Q;  2EIF A;  1B3Q A;  4KY6 A;  1A2U A;  1U5K A;  4OHJ A;  2UXC L;  2KJX A;  1AE3 A;  3R2T A;  3VR6 A;  1O80 A;  4O2D A;  4Y7N B;  3UDG A;  4A4I A;  5GAD C;  3QB3 A;  4OGQ C;  4KJN A;  1WTO A;  3S2D B;  4X6A H;  1WTX A;  2WIN B;  1TS3 A;  3TS0 A;  2NVT B;  2CHB D;  5FO9 B;  2AQ2 B;  1J5E Q;  3HEJ A;  1EY5 A;  5JOB A;  2MUY A;  2IPK D;  1QZG A;  1EIG A;  2TSS A;  4OX9 L;  4FF2 A;  2NB0 A;  2JA7 B;  1WI5 A;  3Q6S A;  1LAC A;  1LT3 D;  4KK7 A;  2XGT A;  4JPB W;  4BXX H;  4A3M B;  1IZ6 A;  1QVC A;  3SK6 A;  1Q1B A;  1CQF A;  3TME A;  2NWG A;  4N9T A;  4A3L H;  3CW2 C;  3PF5 A;  2R7Z H;  1U4M A;  1HZC A;  1JWM D;  1VQC A;  1EQQ A;  4NKL A;  5JAV A;  1HZA A;  1LTI D;  2M2L A;  2VQE Q;  3RMH A;  5ELN A;  4DK6 C;  1HR0 L;  1Y1W H;  5IP7 H;  3I72 A;  3I4L A;  2OWO A;  4IN3 A;  2NBF A;  3ZYY X;  1E24 A;  2GN5 A;  2KBN A;  3CU7 A;  4IQZ A;  2N55 A;  2E2I B;  3S2H B;  2SNM A;  5C6A A;  5IGG A;  2D0P A;  5M5Y B;  3VR2 A;  2AKW B;  3T1Y L;  1EYD A;  1HQM C;  1J9O A;  4K8J A;  5I6W A;  2E2J H;  1Y8O B;  2JA8 B;  2D9U A;  1LYL A;  4N8X 1;  3K81 C;  5C5M A;  2K4K A;  3GV3 A;  4PV1 C;  2Q8T A;  1PH2 A;  2RDH A;  4NPS A;  2NVY B;  2K5N A;  5AJ3 L;  4DUY L;  2UU9 Q;  3HOW H;  2QEJ C;  2Q2T A;  1LTL A;  1TS4 A;  4C3H H;  1CKM A;  4GNX B;  4DR6 Q;  5T1G A;  2V1C C;  2MFI A;  2F0L A;  4FVM A;  1KIX A;  2A6E D;  3QWN A;  3X3N A;  4X64 Q;  1QG7 A;  2YU9 B;  1Z9F A;  1G6P A;  2EJM A;  3HG9 A;  3MVV A;  4P75 A;  4OO1 G;  4BXX G;  2R6G A;  3PCO B;  3TP5 A;  3Q24 A;  5IP9 H;  1VQE A;  1STN A;  4ABN A;  4DUZ Q;  5GQO A;  1BBW A;  3G7L A;  4IUT A;  2B2W A;  3BYY B;  4KN4 C;  5D14 A;  4A3L G;  5C0X J;  5LMN L;  2NZH A;  3C3L A;  2R7Z G;  4IFD H;  3TRZ A;  2K52 A;  3WOE A;  1K83 H;  1PFB A;  4PMC A;  3I90 A;  3CP0 A;  5IY0 A;  1S40 A;  2PW5 A;  3NWT A;  1F2M A;  1Y1W G;  5IP7 G;  1L0X B;  1GUW A;  5DM6 3;  1FGU A;  4LAA A;  4PMB A;  4XT3 B;  1SRO A;  1PTO C;  2EXD A;  5CV7 A;  1K8A C;  1N32 Q;  5EGT A;  1JR0 D;  4RHR A;  1NSN S;  1A2T A;  3K8A A;  3TZD A;  1EYC A;  5JJL A;  3CC2 A;  1K73 C;  4IUU A;  5C5L A;  3JAM i;  3AYH B;  3U58 A;  1PH7 A;  5C3W A;  2UUC Q;  1HNW Q;  3J7A F;  1QCB D;  3HOW G;  5E7N A;  1FJG Q;  4N9P A;  4C3H G;  1SAP A;  1RJT A;  3A7A B;  1A3T A;  1ET6 A;  1L2F A;  1VF5 C;  4POF A;  5ELC A;  3I91 A;  1NBW A;  4IFD J;  3GTK B;  2VY3 A;  4KKT A;  5TSS A;  4L8J A;  3VR5 A;  3MZ5 A;  2NUC A;  2G5D A;  4K0K L;  2F0F A;  3W2D A;  3AFQ A;  5IP9 G;  4JW0 A;  2UUA L;  1GM5 A;  1XX8 A;  1ILP A;  4WJ3 M;  3EQL C;  1TT2 A;  1HFN A;  2RHQ B;  3PUV A;  1AN8 A;  5M5W H;  2C35 B;  3RZD H;  2LMC B;  4ALP A;  2L55 A;  1SEB D;  4IFD G;  2WAQ B;  1X56 A;  1EYA A;  3IFD A;  2NTT A;  5HY6 A;  4JG2 A;  3BDC A;  4A3E H;  2AUK A;  3T13 A;  3RLO A;  2EYM A;  1EY6 A;  2JEA I;  4ZLT F;  2UUB Q;  4JOI A;  2OTJ A;  2MO1 A;  2PZT A;  5I9O A;  5FLX E;  4H13 C;  3LNN A;  1B8A A;  1CM9 A;  3GP7 A;  5KNC A;  1XMQ L;  2R7D A;  4BWG B;  4C1N K;  1E2V A;  2I46 A;  1PRT F;  3J81 E;  4X3U A;  2GA4 B;  4H7B A;  3H0G H;  4AQY L;  1RTN A;  3BYT B;  3NE5 B;  2R93 B;  5COR A;  1Q90 A;  2ICE C;  3DLL A;  4LFB L;  1E1T A;  4AH6 A;  3AEV A;  1QJO A;  5LMU Q;  3T1H Q;  2NTS A;  4DR2 L;  1EOT A;  1EWI A;  3ULP A;  1WOC A;  2HIX A;  2E2H B;  4LF6 L;  2KCC A;  1IBK L;  3HOX B;  5EJW A;  1TWA B;  1RKN A;  3RN2 A;  2E75 C;  3VDY A;  2L4N A;  5G3L D;  3UI2 A;  3WOF A;  1Q8K A;  2KEE A;  3FKI H;  1L1O B;  5ELB A;  4EQO A;  1Q8I A;  4JVZ A;  1TWG B;  5IWA L;  3VYT A;  4LW1 A;  1CZW A;  4FNF A;  1KAW A;  3NBH B;  3MFG A;  3FRP B;  2QGQ A;  2A6H D;  4GLX A;  1KRT A;  4IUR A;  3VR4 A;  4RGT A;  2FHT A;  1YHB A;  3UDI A;  3GTG B;  2A6H C;  4ZCK A;  4X66 Q;  4YY3 Q;  4A3E G;  3E5S A;  3OTO Q;  3RZO B;  5M5X H;  1K9M C;  3KLW A;  5IGC A;  3V96 A;  2ZTE A;  2H1E A;  5CGK A;  3HOU H;  1D8L A;  1WTW A;  1HR0 W;  2LKV A;  3FPP A;  1SNC A;  1X54 A;  1S5F D;  2IX3 A;  1G2S A;  3S14 B;  4A3I H;  3HOY H;  3AMU A;  3G6J B;  3CAM A;  4X65 L;  2F3W A;  3H0G G;  1M90 C;  3GDE A;  2FMM A;  4OXP A;  4QF4 A;  4MNO A;  2KHS A;  4HMI A;  2KQ3 A;  1ICF B;  3L2P A;  4DAP A;  4O42 A;  1UWV A;  3SDZ A;  2HCI A;  1J8I A;  2CQO A;  3SE0 A;  1PH4 A;  1UE1 A;  3GTM H;  5M5Y H;  5I6Y A;  1BCP D;  1H95 A;  4KJO A;  2F0M A;  1YNJ D;  2VQE L;  4E6I A;  1OXU A;  4JI7 L;  1XPR A;  1WCM B;  3PIO 3;  5FO7 B;  3J7A 5;  3CD6 A;  1V1Q A;  1ZEQ X;  3FKI G;  4IUP A;  4BBS H;  3LX0 A;  1Q1E A;  1R9T H;  2A1A A;  1VQG A;  2MO0 A;  2F0H A;  4FXK C;  1KDC A;  4CJ0 B;  1CQV A;  2K33 A;  2KHI A;  1BR9 A;  2MPM A;  3BG3 A;  2RKS A;  1MGS A;  2HDL A;  4JI5 L;  3KBG A;  5EKK A;  4LUZ A;  4DU9 A;  2JE6 I;  3UDX A;  2UU9 L;  2F0S A;  5T1I A;  5KGU A;  1SFO H;  1N36 L;  2YU9 H;  4HIO A;  4JI2 Q;  2B2V A;  2GVA A;  1HUM A;  4YCW A;  4DR6 L;  4MN3 A;  1IYJ B;  3H15 A;  5IOC A;  1D2B A;  3CRL C;  1MIU A;  3L3O C;  2Q2I A;  5D3I B;  4TKO B;  2VS1 A;  2I5L X;  3D6C A;  4X64 L;  3K5N A;  5M3M B;  4NXM Q;  3HOU G;  2CCZ A;  1SE3 A;  1AP0 A;  2QDB A;  2R7Z B;  2KA7 A;  1KL9 A;  1SMY C;  3KF6 B;  1E1O A;  3S9W A;  4TSS A;  4QGU A;  4A3I G;  3HOY G;  4DUZ L;  3U4V A;  1NY4 A;  3K5M A;  2QIL A;  4OIJ A;  5EAY A;  3E9I A;  3CQZ B;  5CV6 A;  4K2K A;  5JEA H;  1EY7 A;  4ZAI A;  1Y1W B;  2QCP X;  3TRE A;  4C56 C;  1JB3 A;  2F0N A;  1MJE A;  1AEX A;  4ZK9 B;  4CKE A;  2G9D A;  1JOR A;  4LF5 L;  2DY7 A;  3ITP A;  4MHE A;  4GNX A;  2YYZ A;  4H44 C;  1A6X A;  1NMF A;  2E2J B;  4MTN A;  2K05 A;  2IW3 A;  4XQN A;  1R4Q B;  1B1Z A;  4NP5 A;  3M7N A;  4X3S A;  3J80 i;  1ILQ A;  4BBS G;  2XTI A;  3HOW B;  4KHP L;  1N32 L;  4Q0F A;  4XDX A;  1VS0 A;  2K32 A;  1WFQ A;  1SYD A;  4C3H B;  3F2C A;  1XNQ Q;  2NVQ H;  1BBU A;  1Z7T A;  1JOK A;  5CV9 A;  3CF5 A;  4OON A;  1HPC A;  1HNW L;  2FFK B;  4DR7 Q;  2G9H D;  3A8K E;  1JE4 A;  2K01 A;  1N8R C;  2OT2 A;  3NUC A;  2A5H A;  1C48 A;  2B2T A;  1FNW A;  4MIU A;  3I70 A;  1TY2 A;  2B2U A;  2WB1 G;  1BNZ A;  3G71 A;  1D5X C;  1VQ9 A;  1EZ6 A;  3HOZ H;  4HJ5 A;  3Q0A A;  1JQY D;  3ZJY C;  1HZ9 A;  1Q12 A;  1K83 B;  3EFX D;  3TQY A;  3S16 H;  4P2C B;  5EBD A;  4RGM A;  2C9O A;  4B3M Q;  3PQI A;  1EZ8 A;  3MXN B;  5JEA G;  1IKL A;  2OQ0 A;  3FPU B;  3HP3 A;  1XMO Q;  4N8F A;  4DPG A;  4CJ2 C;  5BN5 A;  1M4V A;  2DNE A;  3STB C;  2EXZ A;  4BA2 I;  1EEF D;  3URY A;  2MJ8 A;  5IE8 A;  1AZP A;  1NUC A;  5E4W C;  3ULL A;  1W6K A;  2UUB L;  2O5J C;  1PDQ A;  2ATW A;  4IPC A;  3OMC A;  4P72 A;  4A3J H;  3HKS A;  1TWF H;  5C3X A;  1I6H H;  4XQQ A;  1EUJ A;  3NTI A;  1QIL A;  3W5O A;  2VUM H;  2QW7 A;  4DV1 Q;  5E3F A;  4KLK A;  2WB1 E;  4JI1 Q;  4HAE A;  2Z4I A;  1QVG A;  1JJC B;  1V8Q A;  3OWE B;  1MD2 D;  5FLX L;  1EQT A;  1PYB A;  5C4H A;  2PNH A;  4DV0 Q;  2ZM6 Q;  2L12 A;  1PTO H;  1VMC A;  1VCI A;  5LMU L;  2MHV A;  5BN3 A;  2KVM A;  1V9P A;  3W1G A;  3J81 L;  3J7A V;  4CDE C;  1ZYR C;  3GO5 A;  4KY7 A;  1HA5 A;  3F2U A;  5ELF A;  3SVM A;  3W1B A;  3OSO A;  4QCL A;  1NTG A;  1YJ9 A;  4OWT B;  5M5W B;  3RZD B;  3HOZ G;  2MNA A;  4UP8 A;  1CKO A;  2LS0 1;  2RA4 A;  1ESF A;  4QB4 A;  2YTY A;  3M4Q A;  1VF7 A;  4A3E B;  2O5I C;  2LXJ A;  4PNY A;  5CYU A;  3MEF A;  2KHJ A;  4LFC L;  3RZO H;  3I4O A;  1F9Q A;  5JVH 3;  4J1M A;  2CWA A;  2DJF C;  2EY6 A;  3K7U C;  4DA2 A;  5GAG C;  4AIM A;  2EY2 A;  5I9P A;  1H9K A;  1SE8 A;  1ZXT A;  2ZJR A;  4A3K H;  2K5V A;  2A74 C;  2EYO A;  1TU2 B;  3D4R A;  4RFB A;  2EY1 A;  1KD1 C;  2EYL A;  1VQJ A;  2KCM A;  2HUG A;  2XIW A;  4RH6 A;  2K6A A;  3H0G B;  4IPH A;  4A3J G;  3PIO A;  1Y8P B;  3E3X A;  1VQI A;  3A74 A;  4LMQ D;  1Q81 C;  2VUM G;  1CT1 D;  4PG3 A;  1KDA A;  4I7A A;  4HID A;  4IO9 A;  1DZ1 A;  1RHP A;  1L1O A;  2WAQ E;  3K7A B;  1G29 1;  3QO2 A;  4DNI A;  4A3D H;  1XPO A;  2NYZ D;  3NBH A;  4OWX B;  1WCM H;  1VQH A;  1D1I A;  2X69 A;  1A15 A;  2XRQ D;  1KLU D;  1O7L A;  1XTD A;  3BVG A;  2ZT9 C;  3FKI B;  4QIW E;  3NQI A;  3BVM A;  2IWH A;  2KEN A;  3B6Y A;  4RCN A;  3NSW A;  1DON A;  4TRD A;  5J1Z A;  3CHB D;  1G51 A;  4NMZ A;  2Z8L A;  1MSH A;  4OL7 A;  3I4N H;  3NTK A;  5J3B A;  2Z6B A;  1YJW A;  1YNN D;  1FVI A;  2ZTD A;  4EQP A;  1JWU D;  2KOL A;  1VQ7 A;  4X62 Q;  4OO1 H;  2Z6K A;  5M5X B;  2I5M X;  4JI6 Q;  3CME A;  1RTO A;  4ZRZ A;  1D6E C;  4GOP C;  2HD3 A;  5EQ0 A;  1CHP D;  2RCN A;  2VXW A;  3HOU B;  1ENF A;  2F0Q A;  5M3M H;  1GHK A;  5EPK A;  3A5Z B;  4A3K G;  2D5D A;  1CFM A;  1HNX Q;  4JI2 L;  1STY A;  3L9A X;  2CFM A;  4OEM B;  2I0Q A;  2B2U C;  4A3I B;  5C4J H;  3HOY B;  3NTH A;  3TN2 A;  1HHV A;  4S3S A;  3MFY A;  1PYW D;  1VQK A;  4IJH A;  1E7Z A;  3CQZ H;  4WFN 3;  5EKI A;  1BUV T;  3MXP A;  2E8G A;  2EVB A;  4QL5 A;  5FK9 C;  3S17 H;  3K58 A;  4GKJ Q;  1LUZ A;  4KMU C;  3JAM E;  3GTM B;  5C0X H;  4PZ6 A;  4OIK A;  1K0S A;  3E0E A;  4A3D G;  5LL6 S;  1HJP A;  3GD7 A;  4GZY C;  1WCM G;  4EQ5 A;  2RCF A;  3PO3 H;  5KNB A;  1VQ8 A;  1EY9 A;  4BBS B;  1R9T B;  2TMP A;  2RSO A;  1X3Q A;  3EVQ A;  1ASZ A;  3A0J A;  4Z9C B;  2SDF A;  3V05 A;  3PUW A;  5F2D A;  4DV2 L;  1DJR D;  2JK8 A;  5KEE A;  5LL6 X;  4GLV B;  3S24 A;  4FF4 A;  2MQH A;  1UAP A;  4IOA A;  3I4N G;  4R1J A;  1SFO B;  3IAY A;  3OHX C;  1DM0 B;  1NAP A;  1PTO F;  4G57 A;  2A6E C;  3OIQ A;  2BE5 D;  1RCV D;  4XXE A;  2RDF A;  4DFA A;  2RDG A;  3V2T A;  1CZG A;  4A3G H;  4DR1 L;  1GVP A;  1CKN B;  1CTM A;  3D31 A;  3AB9 A;  1PH3 A;  1VQF A;  5M3M G;  1VMP A;  2WB1 B;  1AE2 A;  2IX0 A;  2HT1 A;  1X3P A;  3M4Y A;  4LUO A;  1WYD A;  3HOV H;  3RNU A;  1FD7 D;  3P7J A;  4JI0 L;  4JI3 Q;  3N52 A;  1HNZ L;  2DY8 A;  1K3B C;  3T51 B;  4L5R C;  5DEH A;  1S5D D;  5IGE A;  3UDF A;  4HIK A;  2AHO B;  4JI8 Q;  1B7Y B;  4C1N I;  2A8V A;  1EIH A;  1B3A A;  4QJF A;  4JI4 Q;  2XNA C;  3ONA B;  1YHA A;  1GUS A;  5FO8 B;  5C0X G;  1TWC H;  4YCU A;  4HSP A;  1WTR A;  1HXY D;  2JEB I;  1I4P A;  4B3M L;  4DGZ A;  4ZUI A;  4CKC A;  2VL6 A;  3TZU A;  4DNR B;  3R8B A;  3GTJ H;  2KUM A;  3PO3 G;  1S4Z A;  3NHH A;  4TVA B;  2JQO A;  3T16 A;  2F4V L;  2F4I A;  1PH9 A;  3D4D A;  1NR2 A;  4IUV A;  1X6O A;  1AFP A;  4B3S L;  2NVQ B;  1KAB A;  2CVR A;  2OQK A;  1BQQ T;  1UEA B;  2SOB A;  4FXG C;  4A3C H;  5NUC A;  5A2Q E;  1NCV A;  3CCE A;  2JA5 H;  1G6Z A;  1LTR D;  1I6V C;  5H1S E;  1A62 A;  1EQR A;  2X6L A;  4RGN A;  2FJ2 A;  3FVQ A;  2N8N A;  2KCN A;  4DAM A;  4A3G G;  1STE A;  1W6J A;  1F2Z A;  1MHW C;  3MXN A;  4WRD A;  1LTS D;  4RAU C;  1MSG A;  4DR5 Q;  3M7G A;  5FKA C;  4R9W A;  3HOZ B;  4B3T Q;  3HOV G;  3DEO A;  3CCL A;  3TSS A;  2ZTC A;  3S16 B;  5KIX A;  5EPJ A;  4M8A A;  3A8J E;  1YHQ A;  4LF8 Q;  1XJV A;  3DEP A;  2AMC B;  3K57 A;  5A35 A;  1I3Q H;  4IOC A;  3MTS A;  4QIW B;  2IT1 A;  4DAV A;  1SND A;  4FO2 A;  1LTG D;  1E3P A;  1X32 A;  2YV5 A;  2VB3 X;  1ET9 A;  3Q23 A;  2K5H A;  3TP7 A;  3CRK C;  4C3I H;  1KLG D;  3DUZ A;  4A3J B;  1QNK A;  1TWF B;  1I6H B;  4YHH L;  1WTH A;  4CHT B;  5IYC H;  1E2Z A;  2VUM B;  3FMC A;  1QE6 A;  1PYS B;  4UDU C;  5K36 H;  2AUJ D;  1CSQ A;  1C7Y A;  3KJO A;  2B2Y A;  4YWL A;  2YTX A;  4IAL A;  1IYV A;  3K7A H;  2F0T A;  4DV3 Q;  2PNR C;  3DM1 A;  2PCF B;  2NN6 I;  2WII B;  4FDB A;  4Q5V A;  4A3C G;  1EIF A;  1KHI A;  3NQT A;  4ZKB B;  2ENB A;  2JA5 G;  3KF8 B;  1PTO B;  3E0J A;  1BOS A;  4HMJ A;  3SK4 A;  5K5P A;  1AW7 A;  1SXT A;  5KYL A;  2F3I A;  3R2I A;  1JWS D;  2E5L L;  1CUK A;  1T9H A;  1UE6 A;  4LF9 Q;  1Y1V H;  3FP9 A;  1EOV A;  1PZJ D;  2I07 B;  2Y0S G;  1ROD A;  1I4G A;  1J6Q A;  1H9J A;  2F0K A;  3QOL A;  2XWJ B;  4GS3 A;  1SBB B;  1UE5 A;  2R61 A;  1I94 Q;  3SEB A;  5KYI A;  1PRT D;  1QWY A;  1OXV A;  4XIG S;  2J0T D;  2IY5 B;  1TS5 A;  2E74 C;  1PRT C;  1EL0 A;  1J5E L;  1IXR A;  5FJ8 H;  1P16 A;  5E4X A;  4A3K B;  3UE1 A;  3X3M A;  4X62 L;  3R93 A;  1RF2 D;  2B2W C;  1EY4 A;  4C3I G;  4JI6 L;  2F52 A;  3P75 A;  1IHZ A;  2A68 D;  2D62 A;  4APV A;  5IYC G;  1HTP A;  2Y0S E;  1KC8 C;  1PH5 A;  3S1R H;  1IBL Q;  1HNX L;  4FF1 A;  4QUC A;  5K36 G;  2F0V A;  1XTC D;  3KDF B;  1VQ6 A;  4F87 A;  3BVZ A;  1UEB A;  2K1B A;  3TP8 A;  2BOS A;  3OIP A;  2VQF Q;  1NR4 A;  3J80 E;  4A3D B;  1JIC A;  2F0I A;  4UP9 A;  3ICE A;  2XVS A;  1BCP C;  1LT5 D;  1Z6H A;  1YNJ C;  3JAM c;  1IYU A;  3TDQ A;  3MEH A;  3OW2 A;  2UXC Q;  1SYC A;  3Q22 A;  1FYC A;  5M3F H;  4B3R Q;  2Q2H A;  1D1K A;  1Y1V G;  2I5H A;  4A3F H;  5KND A;  2OTL A;  1EIY B;  1WJJ A;  5DM7 3;  2IL8 A;  5EPL A;  1TXY A;  4K5V A;  3T56 B;  1VQ5 A;  3K6O A;  4KY5 A;  3I4N B;  1DOK A;  3GTL H;  2BA1 A;  1ZKO A;  2FMC A;  3JAM L;  1B2T A;  3PV0 A;  3PSI A;  1LLR D;  1QZH A;  4OX9 Q;  2QF7 A;  2QEX A;  2JA6 H;  5FJ8 G;  1BVS A;  1S3O A;  4RGO S;  2ZXP A;  5CBA E;  4PQX A;  2JXM B;  1AZQ A;  1GOZ A;  1DOM A;  1GXD C;  5C4J B;  3KOJ A;  1Z47 A;  1SYE A;  3CMA A;  3S15 H;  1B50 A;  2M9V A;  3PGZ A;  5DLQ E;  5ELE A;  2XN9 C;  1SYG A;  1BDO A;  4R4Q A;  1V1O A;  4YIJ A;  3S17 B;  3RN5 A;  4JOI C;  2LXK A;  4JI3 L;  4KKS A;  3EJI A;  1HA6 A;  3NWS A;  3D0F A;  1HH2 P;  4ME5 A;  2XSC A;  4O0A A;  1Q86 C;  1SYF A;  3J81 j;  1B9M A;  3I73 A;  3LWE A;  4KHV A;  1SSO A;  4DV6 Q;  1N9W A;  3T1Y Q;  4R4C A;  4U67 3;  1MJC A;  4JI4 L;  1A8V A;  2O4X A;  3SGI A;  1RL2 A;  3CPW A;  3H3V I;  3A55 A;  4CDD C;  3GTP H;  3S1M H;  5HGQ A;  4R4I A;  1D5Z C;  2EPB A;  3SR1 A;  1U4R A;  4L5S A;  1PFM A;  5M3F G;  1ASY A;  1JOQ A;  5AJ3 Q;  3C2P A;  1EWC A;  4A3F G;  2N88 A;  4XQJ A;  2IX1 A;  1CKN A;  3HKZ G;  1T5E A;  2UUC L;  1Q82 C;  2HIV A;  4IUQ A;  1TVX A;  1IL2 A;  2WP8 J;  5JJI A;  5JVG 3;  1FJG L;  1TR5 A;  2HQL A;  4ILW A;  1F9S A;  1U4P A;  2EYH A;  3OYY A;  5JPM C;  4H0L C;  4NDX A;  4A3G B;  1JCK B;  1KQS A;  2JA6 G;  3N6R A;  3I55 A;  1O7Y A;  2SNS A;  3QOJ A;  4FF3 A;  3HOV B;  3T53 B;  1QUQ B;  4M1U B;  1JE5 A;  1YEZ A;  5LMN Q;  4DV7 Q;  2KED A;  4ULL A;  5A2Q L;  4DR5 L;  3HKZ E;  4EVO A;  4B3T L;  2CW0 D;  2WKD A;  4PZ7 A;  1S5C D;  3I8Z A;  4IZ8 A;  1TWC B;  2EYF A;  3K59 A;  4LF8 L;  1X65 A;  3NEM A;  1VQD A;  1HQR D;  3BZC A;  4P71 A;  2VZA A;  1DCZ A;  1K0R A;  3GTJ B;  1JJ2 A;  2WFW A;  1XXG A;  4CJ1 B;  3SXH A;  3A7L A; 
#chains in the Genus database with same CATH homology
 2RHS B;  1VQK A;  2RHQ B;  3PUV A;  2K75 A;  2N78 A;  4IJH A;  5M5W H;  2C35 B;  2NVY H;  1E7Z A;  3CQZ H;  3RZD H;  4ALP A;  4R4O A;  4IFD G;  1X56 A;  4RMF A;  2GVB A;  2E8G A;  4QL5 A;  3S17 H;  4GKJ Q;  1LUZ A;  5HY6 A;  4JG2 A;  1X3F A;  2QA4 A;  4A3E H;  3S1N H;  4C2M H;  3RLO A;  1PH6 A;  1X55 A;  3T1H L;  2JEA I;  4PZ6 A;  1S72 A;  1MKH A;  4JOI A;  2UUB Q;  4DV3 L;  3E0E A;  2OTJ A;  2UXD L;  3GTQ H;  2MO1 A;  1VQP A;  4A3D G;  3AQQ A;  2KCT A;  3M9B A;  4HIM A;  5JJK A;  1HJP A;  1N34 Q;  3GD7 A;  1B8A A;  1XNR L;  4HJ8 A;  1WCM G;  4EQ5 A;  2JA7 G;  1VQN A;  5LMN W;  5IYB H;  1XMQ L;  2R7D A;  3PO3 H;  1W2B A;  1C0A A;  1D7Q A;  1SLJ A;  1VQ8 A;  4A3M G;  3IRB A;  3H0G H;  5BR8 L;  1ASZ A;  4AQY L;  3A0J A;  4YWM A;  3PUX A;  4LF9 L;  3S1Q H;  3PUW A;  4DV2 L;  1HR0 Q;  3L7Z C;  4JV5 Q;  4GKK Q;  2JK8 A;  1V43 A;  2YTV A;  1JB7 A;  4GLV B;  1PFS A;  3S24 A;  3DLL A;  4LFB L;  2MQH A;  2OCE A;  1E1T A;  1Y14 B;  4IOA A;  4AH6 A;  4LWC A;  2B63 H;  3I7F A;  4R1J A;  4JI8 L;  3G4S A;  3AEV A;  3I4N G;  5LMU Q;  3T1H Q;  2K14 A;  4EX5 A;  4DR2 L;  1EWI A;  3ULP A;  1WOC A;  2HIX A;  4X66 L;  1I94 L;  4LF6 L;  4YY3 L;  1IBK L;  3PIP A;  4PMW A;  1VQ4 A;  3F2D A;  3RN2 A;  3OTO L;  4DR1 L;  1GVP A;  1XMQ Q;  4A3G H;  1CKN B;  2K50 A;  3EIV A;  3D31 A;  3VDY A;  1EFW A;  1PH3 A;  1VQF A;  5FLM G;  5M3M G;  1Q8K A;  4JYA L;  1AE2 A;  1L1O B;  2IX0 A;  3FKI H;  3HFZ B;  4DUY Q;  1Q7Y C;  2HT1 A;  1TWH H;  2UXB Q;  4LUO A;  1W3S A;  1WYD A;  4DK3 C;  3HOV H;  1JT8 A;  1M1K C;  2BA0 A;  3KFU A;  3RNU A;  2CWP A;  1EYG A;  5IWA L;  4JI0 L;  1OTC A;  4JI3 Q;  2JA8 G;  4DV2 Q;  4LW1 A;  3LGJ A;  4LFA L;  1HNZ L;  2LSS A;  1KAW A;  3NBH B;  4LF7 L;  1C9O A;  2NN6 G;  4L5R C;  2ZJP A;  3DM3 A;  4GLX A;  2QGQ A;  4A76 A;  1KRT A;  3UDF A;  2AHO B;  4HIK A;  4A75 A;  2ASB A;  5GRO A;  4JI8 Q;  1YI2 A;  1B7Y B;  1YHB A;  3UDI A;  4DR2 Q;  1IBL L;  2A8V A;  4DKA C;  3F8T A;  4QJF A;  4X66 Q;  1PH8 A;  4JI4 Q;  1P8L A;  4YY3 Q;  4A3E G;  4GNX C;  1YHA A;  5C0X G;  1TWC H;  2VQF L;  3CC7 A;  3J80 c;  4YCU A;  4UY8 C;  1SN8 A;  3OTO Q;  4DR1 Q;  5M5X H;  3UE0 A;  1K9M C;  3M3Y H;  3KLW A;  2JEB I;  4B3M L;  3GTK H;  2ZTE A;  3M85 A;  3F1Z A;  2VL6 A;  3HOU H;  1D8L A;  1HR0 W;  1PVO A;  5IYB G;  4GOP A;  3CCM A;  3GTJ H;  4HJ7 A;  3PO3 G;  1X54 A;  4DR4 Q;  3NEL A;  4IPG A;  4TVA B;  3CCJ A;  2ES2 A;  2JQO A;  4JI0 Q;  2F4V L;  4P73 A;  5JEA J;  1U0L A;  4A3I H;  1PH9 A;  5C44 H;  1HNZ Q;  3HOY H;  3CAM A;  1PHJ A;  3TS2 A;  4X65 L;  3H0G G;  1M90 C;  3GDE A;  4OXP A;  2R7F A;  4MNO A;  1X6O A;  1OXX K;  4B3S L;  4GN5 A;  4QY7 A;  4B3R L;  2ID0 A;  4P74 A;  2N3S A;  2A19 A;  2OQK A;  3I2Z A;  4XTC S;  1RIP A;  3M4P A;  2PI2 A;  3RR5 A;  4A3C H;  3ER0 A;  3L2P A;  1IBM L;  4KHZ A;  2PMZ E;  1UWV A;  3CCE A;  2JA5 H;  2B63 G;  4IFD I;  2CQO A;  1FL0 A;  1PH4 A;  1I5F A;  1UE1 A;  3GTM H;  1LM0 A;  5M5Y H;  3KDF A;  5H1S E;  1A62 A;  1EQR A;  1H95 A;  1GKH A;  2VW9 A;  2VQE L;  2DGY A;  1YZ6 A;  1OXU A;  2N8N A;  4JI7 L;  3STB D;  4DAM A;  4DV5 Q;  1CSP A;  3Q8D A;  3WWV A;  1XPR A;  4A3G G;  4YCV A;  3J7A 5;  1QVF A;  3KYH C;  3CD6 A;  1X3G A;  4MZ9 A;  1XPU A;  1V1Q A;  4BY7 H;  4YWK A;  4GLA C;  4NXM L;  4L5T A;  2F4V Q;  3FKI G;  4DR5 Q;  2Q2U A;  4BBS H;  1YBY A;  1Q1E A;  1R9T H;  2A1A A;  4NB3 A;  4B3T Q;  4X65 Q;  3HOV G;  3PO2 H;  1VQG A;  4H02 A;  2MO0 A;  5FLX c;  3FHW A;  3CCL A;  4TQU S;  2ZTC A;  1I50 H;  4NXN L;  4B3S Q;  3KJP A;  4DV4 L;  2KHI A;  1JMC A;  4LF4 Q;  3GTO H;  4WJ4 A;  2HHH L;  4JI5 L;  1YHQ A;  4BY1 H;  2R93 H;  4L5Q A;  1B70 B;  4LUZ A;  4LF8 Q;  3J81 c;  1XJV A;  2R92 H;  2AMC B;  2VNU D;  2JE6 I;  3UDX A;  3CXC A;  2UU9 L;  1I3Q H;  4IOC A;  1SFO H;  1N36 L;  3E9H A;  2YU9 H;  3H3V H;  3U50 C;  4HIO A;  2IT1 A;  4JI2 Q;  4PZ8 A;  2GVA A;  1SRU A;  4YCW A;  2E2H H;  4DR6 L;  3HOX H;  4K0K Q;  1UE7 A;  1E3P A;  4JI7 Q;  1IYJ B;  3CPF A;  2YV5 A;  1YVC A;  1TWA H;  2JJQ A;  4BBR H;  3H15 A;  1VQM A;  2UUA Q;  2K5H A;  1MIU A;  4C3I H;  4OO1 I;  2Q2I A;  3A5U A;  4DAY B;  2VS1 A;  2I5L X;  3PUZ A;  4X64 L;  4NXM Q;  3HOU G;  4YHH L;  3L0O A;  4R4T A;  1PH1 A;  2AWO A;  4UPA A;  5IYC H;  4DV6 L;  2CCZ A;  1E22 A;  5IT9 c;  2PI2 E;  4QQB X;  1NJI C;  1PYS B;  1TWG H;  5GAH C;  1C7Y A;  1CSQ A;  1KL9 A;  3KF6 B;  3ERS X;  1E1O A;  5C4X H;  3KJO A;  4YWL A;  4QGU A;  4A3I G;  2Z0S A;  4LUV A;  5C44 G;  4DUZ L;  3HOY G;  3CC4 A;  2YTX A;  3U4V A;  1NY4 A;  2N49 A;  3K7A H;  4JI5 Q;  4JBK A;  2UXD Q;  4DV3 Q;  5EAY A;  3E9I A;  3KF6 A;  1L0W A;  4AYB G;  1XNQ L;  1GO3 E;  2RF4 A;  1YIT A;  1N33 L;  2NN6 I;  5C3E H;  4FDB A;  1XNR Q;  1N36 Q;  3NEN A;  3GTG H;  2WAQ G;  4A3C G;  1EIF A;  4RG1 A;  1KHI A;  3K80 C;  4HJ9 A;  1NMG A;  1Q46 A;  2JA9 A;  3TRE A;  1GD7 A;  1SR3 A;  2JA5 G;  3KF8 B;  1MJE A;  4DR7 L;  2F3I A;  3I56 A;  3BJU A;  3J7Z C;  4LF5 L;  5C0X I;  5BR8 Q;  4GNX A;  3G48 A;  4AQY Q;  2YYZ A;  1HZB A;  2E5L L;  1CUK A;  1NMF A;  4YHH Q;  4MTN A;  1T9H A;  1UE6 A;  4LF9 Q;  2BH2 A;  1Y1V H;  3FP9 A;  1VQO A;  1EOV A;  2NZO A;  4DR3 L;  2Y0S G;  4BY7 G;  1J6Q A;  3M7N A;  2PQA A;  3ULJ A;  4LFB Q;  3J80 i;  1PA6 A;  4BBS G;  2IHE A;  2XTI A;  4LNQ A;  4GS3 A;  4KHP L;  1N32 L;  1VS0 A;  3S14 H;  3PO2 G;  1WFQ A;  1UE5 A;  1A63 A;  1AH9 A;  5IYD H;  2H5X A;  1YNX A;  1I94 Q;  3F2C A;  4LF6 Q;  1XNQ Q;  3JC6 6;  1IBK Q;  2NVQ H;  1OXV A;  1BBU A;  4XIG S;  3PF4 A;  2D0O A;  2IY5 B;  1JJG A;  4DV7 L;  4BY1 G;  4GN3 B;  3EN2 A;  3CCU A;  3CF5 A;  2R93 G;  4OON A;  4JBW A;  4GOP B;  2R92 G;  4AYB E;  1HNW L;  1X9N A;  1J5E L;  3M4O H;  4A93 H;  1IXR A;  4DR7 Q;  5FJ8 H;  4JYA Q;  1P16 A;  1YIJ A;  1N8R C;  1XMO L;  5ELO A;  1A0I A;  3UE1 A;  4LF5 Q;  3K0X A;  1O7I A;  1YJN A;  3HOX G;  1K8G A;  2E5L Q;  4X62 L;  5IWA Q;  4BBR G;  2EIF A;  4LFA Q;  1U5K A;  4JI6 L;  2F52 A;  4LF7 Q;  2D62 A;  2UXC L;  1AE3 A;  4O2D A;  2WB1 G;  4APV A;  5IYC G;  3G71 A;  3UDG A;  1VQ9 A;  4KHP Q;  2NVX H;  1L1O C;  4A4I A;  2Y0S E;  5GAD C;  4HJ5 A;  3S1R H;  1KC8 C;  1PH5 A;  1HNX L;  1IBL Q;  3HOZ H;  3ZJY C;  5K36 G;  3KDF B;  1HZ9 A;  1Q12 A;  4DV1 L;  1VQ6 A;  1UEB A;  3TQY A;  4X6A H;  4JI1 L;  5C4X G;  3S16 H;  3TS0 A;  2VQF Q;  1OXS C;  4JC0 A;  2L15 A;  1J5E Q;  4B3M Q;  5JEA G;  3MXN B;  4UP9 A;  3ICE A;  1QUQ A;  5C3E G;  2OQ0 A;  1QZG A;  3BZK A;  1XMO Q;  4OX9 L;  4DPG A;  1WI5 A;  3I4M H;  3JAM c;  4DV0 L;  2ZM6 L;  2XGT A;  3STB C;  4BA2 I;  4JBJ A;  4BXX H;  5IE8 A;  1IZ6 A;  3ULL A;  1QVC A;  3OW2 A;  2UUB L;  2ATW A;  1Q1B A;  4IPC A;  4P72 A;  4UP7 A;  2UXC Q;  4A3J H;  3HKS A;  1TWF H;  5M3F H;  4B3R Q;  2Q2H A;  1N34 L;  1I6H H;  1EUJ A;  1Y1V G;  2I5H A;  3PUY A;  4A3F H;  3W5O A;  4A3L H;  3CW2 C;  2VUM H;  2OTL A;  3PF5 A;  1EIY B;  2R7Z H;  1WJJ A;  4DV1 Q;  1OXT A;  4KLK A;  1HZC A;  1IBM Q;  2WB1 E;  3EBE A;  4JI1 Q;  2ZJQ A;  1TXY A;  1VQ5 A;  1SMX A;  1VQC A;  4OWW B;  3GTL H;  2BA1 A;  1EQQ A;  1K3R A;  5IYD G;  1QVG A;  2Z6K C;  4GN4 B;  1JJC B;  1HZA A;  3AFP A;  3PV0 A;  2VQE Q;  1KRS A;  1X3E A;  5ELN A;  4DK6 C;  1HR0 L;  1Y1W H;  3PSI A;  2ALY B;  5IP7 H;  1QZH A;  4GKK L;  4JV5 L;  1VQL A;  2OWO A;  4OX9 Q;  3BU2 A;  3TEH B;  4J15 A;  2QEX A;  4A3B H;  1PYB A;  2PNH A;  1E24 A;  4A93 G;  2GN5 A;  2KBN A;  4DV0 Q;  2JA6 H;  5FJ8 G;  2ZM6 Q;  1BVS A;  1S3O A;  2B3G A;  2BH8 A;  1VCI A;  4Y52 H;  5LMU L;  2D0P A;  2DUD A;  3RLF A;  2AKW B;  1V9P A;  3T1Y L;  3W1G A;  4NXN Q;  2E2J H;  3GO5 A;  4DV4 Q;  3KOJ A;  1Z47 A;  3W1B A;  1LYL A;  3K81 C;  3CMA A;  2K4K A;  3CCS A;  2HHH Q;  3S15 H;  1PH2 A;  4JBM A;  1NTG A;  4NPS A;  1YJ9 A;  4OWT B;  3PGZ A;  5DLQ E;  2K5N A;  5AJ3 L;  4DUY L;  2UU9 Q;  3HOW H;  2UXB L;  3HOZ G;  2CKZ B;  2MNA A;  4R4Q A;  4UP8 A;  2Q2T A;  1CKO A;  1LTL A;  3RN5 A;  4JCV E;  4C3H H;  4JOI C;  2LXK A;  1CKM A;  2YTY A;  3M4Q A;  4JI3 L;  4GNX B;  4DR6 Q;  2LXJ A;  2V1C C;  3MEF A;  2MFI A;  2KHJ A;  3D0F A;  1PV4 A;  1HH2 P;  4O0A A;  4LFC L;  3RZO H;  4C3J H;  3I4O A;  1NE3 A;  1Q86 C;  4BA1 I;  1KIX A;  3J81 j;  2CWA A;  2PQA B;  3K7U C;  4IJL A;  5GAG C;  4X64 Q;  4AIM A;  1SE8 A;  1Z9F A;  4DV6 Q;  1G6P A;  2ZJR A;  4A3K H;  1N9W A;  3T1Y Q;  3I4M G;  4R4C A;  2K5V A;  1MJC A;  4JI4 L;  4P75 A;  1A8V A;  3SGI A;  3CPW A;  1RL2 A;  3H3V I;  3S1M H;  3GTP H;  4OO1 G;  4BXX G;  2R6G A;  3PCO B;  2B29 A;  5HGQ A;  5IP9 H;  4R4I A;  1VQE A;  1KD1 C;  4DUZ Q;  5GQO A;  1BBW A;  1VQJ A;  2KCM A;  4IPH A;  4A3J G;  2FXQ A;  3PIO A;  4L5S A;  5M3F G;  1ASY A;  1VQI A;  4Y7N H;  5AJ3 Q;  3A74 A;  1N33 Q;  4A3F G;  4A3L G;  1Q81 C;  1BKB A;  5GAE C;  5C0X J;  2IX1 A;  2VUM G;  1CKN A;  2NZH A;  2EQS A;  3HKZ G;  4PG3 A;  5LMN L;  2K52 A;  2R7Z G;  4HID A;  3TRZ A;  1DGS A;  4DR4 L;  2UUC L;  4IO9 A;  1Q82 C;  1K83 H;  3S2D H;  2HIV A;  1L1O A;  1IL2 A;  2WP8 J;  5JJI A;  2WAQ E;  3CP0 A;  5IY0 A;  2NVT H;  2IHF A;  1G29 1;  4LFC Q;  1FJG L;  1S40 A;  4DNI A;  2HQL A;  4A3D H;  3OYY A;  1Y1W G;  5IP7 G;  1XPO A;  4A3B G;  4OWX B;  1WCM H;  1KQS A;  2JA7 H;  1VQH A;  1FGU A;  4DR3 Q;  2JA6 G;  3CCV A;  4HJA A;  1XTD A;  1SRO A;  3I55 A;  2EXD A;  4ME3 A;  1K8A C;  3U4Z A;  4QIW E;  3RLN A;  4A3M H;  1N32 Q;  2AWN A;  3K8A A;  4POG A;  3F2B A;  2KEN A;  3B6Y A;  3CCQ A;  1QUQ B;  4DV5 L;  3CC2 A;  1JE5 A;  5JJL A;  1K73 C;  3JAM i;  1YEZ A;  3G6E A;  5LMN Q;  3AYH B;  4DV7 Q;  3U58 A;  1PH7 A;  1G51 A;  2UUC Q;  1HNW Q;  4DR5 L;  3HOW G;  5E7N A;  3I4N H;  3HKZ E;  5J3B A;  4B3T L;  1YJW A;  1FJG Q;  4PZ7 A;  1KXL A;  1FVI A;  2ZTD A;  4GKJ L;  1VQ7 A;  4X62 Q;  1L2F A;  4POF A;  4LF4 L;  2Z6K A;  3J81 i;  2I5M X;  1NBW A;  4JI6 Q;  3CME A;  4LF8 L;  1X65 A;  4IFD J;  4GOP C;  2VY3 A;  3NEM A;  1VQD A;  4IPD A;  2E2I H;  3S2H H;  2RCN A;  5FLM H;  5M3M H;  3BZC A;  3A5Z B;  4P71 A;  4A3K G;  2VZA A;  1K0R A;  1HNX Q;  1JJ2 A;  4JI2 L;  4K0K L;  2WFW A;  2CFM A;  3CCR A;  2I0Q A;  4KI0 A;  3AFQ A;  5IP9 G;  2JA8 H;  1VQB A;  2UUA L;  5C4J H;  1VQA A;  1GM5 A;  4WJ3 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...