1NTGA

Crystal structure of the emap ii-like cytokine released from human tyrosyl-trna synthetase
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
171
structure length
171
Chain Sequence
PEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNISLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of an EMAP-II-like Cytokine Released from a human tRNA Synthetase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Tyrosyl-tRNA synthetase
total genus 34
structure length 171
sequence length 171
chains with identical sequence B, C, D
ec nomenclature ec 6.1.1.1: Tyrosine--tRNA ligase.
pdb deposition date 2003-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ntgA00
2KENA 4JBJA 3PF4A 2FXQA 2B29A 3LGJA 2Z0SA 3K80C 1VQ9A 2R92G 4DV6L 1HNXQ 3ICEA 5JJLA 3AQQA 1I3QH 5J3BA 1HNZQ 3GTLH 4A3JH 4HIMA 4NXNL 1X6OA 4QJFA 2YTYA 4DR2Q 3UDXA 4DUYL 5HGQA 4YWLA 3HOVG 3F2DA 3A74A 1VQOA 1IBKQ 2R92H 2KCMA 3KDFB 4BA2I 1TWAH 5H1SE 1K0RA 2YV5A 3F2CA 1FGUA 3HKZG 3K7AH 4DK6C 1IBML 1Y1WH 3HKSA 2MNAA 1K8AC 4X64Q 5M3FH 1WYDA 4UY8C 5FJ8H 1KXLA 5C4XG 2RHQB 2GN5A 4JI2Q 4Y7NH 1G6PA 1OTCA 4KHZA 3H0GG 4DV4Q 2Q2UA 3BU2A 3ULPA 1S40A 5IY0A 4A3MG 1HNWQ 4DV7Q 4LFBQ 4BBRG 5M3FG 4DR2L 2YTXA 2IX0A 4JI7Q 4B3TL 3KJOA 3UDIA 3ULJA 3T1HQ 2ZTDA 1XNRQ 3PUYA 4AQYQ 2JA8G 4OO1I 4JI5L 4HJ9A 1GO3E 4B3SQ 4HJ7A 4DV3Q 2UU9Q 1UE5A 3BZKA 3TEHB 4P75A 5C0XI 3K8AA 5C0XJ 4QQBX 4BA1I 4OXPA 2NN6G 4A3DG 1TWGH 3KJPA 4IPGA 4BY7H 4X6AH 3NEMA 4X62L 5LMUL 1GD7A 4IFDJ 1JT8A 1FVIA 2NVYH 2WAQG 1U5KA 4A3IH 5IYDH 1UWVA 1K3RA 1J5EL 4NXMQ 4LF6L 4Y52H 4APVA 4A3GH 1VCIA 2NVXH 4A3DH 2GVBA 2K50A 5M3MG 1XNQQ 1XJVA 4A3FH 1NTGA 2ES2A 3OTOL 4O2DA 1EWIA 3I7FA 3A0JA 3TQYA 4OWXB 1VQAA 1KHIA 4R4QA 3CCLA 4LF5Q 3PUWA 2E2JH 1PH4A 1VQKA 4OX9L 3GTOH 3GTJH 4JOIA 2AWNA 4K0KQ 3A5UA 4RMFA 3H3VH 1P8LA 1Q12A 2AHOB 1LTLA 4JI6L 4JI4L 3PGZA 2JA7H 3GDEA 2WP8J 1HZCA 1U0LA 1VQGA 1V9PA 3PSIA 3S1RH 3I4NH 2BH8A 4X66Q 4AH6A 2NVQH 4LF7Q 4DR6L 4GN3B 2UUAL 4B3ML 1XPUA 2VZAA 1VQHA 5IYBG 3PV0A 1YJNA 3RLFA 3G6EA 3DLLA 2LXKA 2Y0SG 2PMZE 1G291 3IRBA 2VS1A 1NY4A 2PI2E 4UP7A 1YIJA 3G48A 2B63H 1UE6A 3L7ZC 2VUMH 4AYBE 2JE6I 2LXJA 2PQAB 4A3KH 3J81i 2IY5B 4LF9L 4X66L 1YBYA 2K52A 3WWVA 4DUZQ 1E22A 3TS2A 4BBSG 1C0AA 3U4ZA 4A3EG 4A3MH 2ALYB 3AEVA 2UUAQ 3AFPA 2F4VL 1QUQB 4GS3A 2VQFQ 2K5NA 1N36L 1IBMQ 2QA4A 1NJIC 3MXNB 1IYJB 2UUBQ 4EQ5A 1FJGL 4A3CG 3UDGA 4HJ8A 1PH8A 5GAEC 1YHAA 4JC0A 3CF5A 4O0AA 1X3FA 1G51A 3TREA 1Q86C 3GD7A 1HH2P 3STBD 4GKKQ 4R1JA 4AIMA 5C3EG 1ASYA 4WJ3M 4OX9Q 3PO2H 2ZTCA 1P16A 3ERSX 5BR8Q 4WJ4A 4LF4L 2NZHA 3L2PA 2MQHA 5FJ8G 3U50C 3CCRA 2YTVA 2C35B 1XMQL 2ZM6Q 2Z6KC 4R4CA 4X65L 4GKKL 1VQMA 5GADC 1MJCA 4A4IA 3I4MH 1A8VA 2MO0A 3J80i 4YCVA 2IHEA 2D0OA 2E8GA 4BXXG 1Q82C 1AH9A 3HOWH 5LMUQ 2UUBL 1VQLA 1FJGQ 3HOXH 2R7ZH 4LFCQ 3S24A 2CFMA 3S1MH 1DGSA 3RR5A 1N34L 1VQ8A 1YZ6A 1OXSC 3I4MG 2ID0A 4P71A 1XMQQ 1HR0L 3HOUH 1GKHA 2ASBA 3VDYA 2R7FA 2E5LQ 2K5VA 4DUZL 3CQZH 2IT1A 4DR3Q 4R4IA 2R93G 4IPHA 4BY1G 4YY3Q 4PMWA 4DV1L 4GOPC 4DV7L 5K36G 1KAWA 2N8NA 3J7ZC 4A3IG 4RG1A 1IL2A 4LNQA 3E9HA 2UXDQ 1Q7YC 2OQKA 4JI7L 1JJGA 4NXNQ 2Q2IA 4JI2L 4A3GG 3W5OA 1NMGA 1XTDA 2N49A 3F1ZA 3J81j 1JB7A 5DLQE 5IP9G 5AJ3Q 2BA0A 2OTJA 5JJKA 2QEXA 2QGQA 1NE3A 4JYAL 2IHFA 3HOYG 2VY3A 4YWKA 2B3GA 2VUMG 2KHJA 1B70B 2XTIA 3CXCA 2UUCQ 3NELA 1V43A 5IP9H 1SMXA 4GN4B 4DAMA 2UXDL 3CCSA 3K0XA 1X54A 3HOYH 3PO3G 3ZJYC 5JJIA 4A93G 3S1QH 1VQIA 1E1OA 3M85A 2JA6H 4JI3L 1Y1WG 4HJ5A 3UDFA 5HY6A 4JYAQ 3EBEA 3I56A 1OXUA 5M5WH 1HR0Q 5FLMG 3Q8DA 4OONA 4YHHL 2KHIA 5C44G 4A93H 1YVCA 4P73A 1XMOL 3E9IA 3M9BA 4JI1Q 1YHBA 4HIOA 3T1YQ 4JI6Q 2ZJRA 2PNHA 4UP8A 2CCZA 1VQNA 2B63G 4DK3C 4L5SA 4DR4Q 4A3BG 4HJAA 1KRSA 2AWOA 2K5HA 4IPDA 5IP7G 4GLXA 2ATWA 4BBSH 4C2MH 1E7ZA 2VQEQ 3W1GA 1B7YB 3CCJA 4A3EH 4DPGA 1I94Q 2YU9H 4GKJL 4OO1G 2BH2A 4MZ9A 4DR4L 3HOZG 5ELNA 4LF8Q 1JMCA 2V1CC 5IWAL 4A3CH 1N32Q 5IT9c 5IE8A 1S3OA 1SLJA 1WJJA 3EIVA 3CCVA 4DV2Q 1A62A 2YYZA 4GN5A 1WFQA 5IYCH 3K81C 1TXYA 1KRTA 1BKBA 2JA8H 4P74A 1VQ7A 2JA5G 4B3RL 1TWFH 2HHHQ 3S2HH 2F4VQ 1PFSA 4IOAA 3RN5A 4AQYL 5IYCG 4JI8L 1EQRA 3S16H 1UEBA 2N78A 2UUCL 4PZ7A 1Q8KA 5ELOA 2R6GA 4YY3L 4C3IH 4DV1Q 3HOXG 1SRUA 2PQAA 3CPWA 3U58A 2IX1A 1SE8A 5LMNQ 2OQ0A 1EQQA 1C9OA 2JA7G 2JEAI 3CCUA 3L0OA 1Q81C 3OYYA 3CPFA 3RNUA 3EN2A 3KDFA 5AJ3L 3KF8B 2Q2TA 3FKIG 1HZBA 4DAYB 1J6QA 1L0WA 1KD1C 1S72A 1X65A 1HR0W 2CWAA 4YCUA 3JC66 1YEZA 4GNXA 1PH3A 4XIGS 2CKZB 4DR5L 1JE5A 3CCQA 1PHJA 3NBHB 1PYBA 1VQ4A 2E2HH 3S2DH 2K75A 3KF6B 4IJLA 5GQOA 3PCOB 4LFAQ 1N32L 1A0IA 2CWPA 4K0KL 4L5QA 5M3MH 3CMEA 4DV0Q 4J15A 1XPRA 2K4KA 4IPCA 3J7A5 5IYBH 4DV5Q 1YNXA 3PUVA 3M7NA 4R4OA 5C44H 2VNUD 2ZJPA 2I0QA 4GNXB 4HIDA 1PYSB 4GKJQ 4DR3L 1Y1VG 1BVSA 1LYLA 2AKWB 3BZCA 4NB3A 1YHQA 1Q46A 3OW2A 1YJWA 2UXBL 1VQEA 1N9WA 1E1TA 1Q1BA 3TRZA 1OXXK 1PH9A 1QZGA 4YCWA 3HOVH 3H0GH 1QVFA 4LF6Q 4JOIC 1J5EQ 4IJHA 2Q2HA 4KHPQ 4A3JG 3S17H 1I50H 3KF6A 3AYHB 2WB1G 2A8VA 4IFDG 3ULLA 1AE2A 2UXCQ 1VQFA 2PI2A 1RL2A 1SN8A 5GAHC 2ZTEA 5GAGC 1FL0A 2D0PA 4JV5L 1WI5A 2F3IA 2HT1A 1MIUA 2A1AA 1E24A 1T9HA 2I5MX 4DR1Q 3RN2A 2E5LL 2UU9L 1EYGA 4PG3A 2JEBI 4PZ6A 2LSSA 3T1HL 1VQ6A 1D7QA 3GTKH 4FDBA 1N34Q 1H95A 1C7YA 3BJUA 1JJ2A 4IFDI 5IYDG 5E7NA 1HNWL 1WCMG 3GO5A 5C4XH 4QL5A 2OTLA 1IZ6A 4UP9A 5IP7H 5GROA 1L2FA 1BBWA 3UE0A 1K83H 3HOUG 1VS0A 3PO2G 2BA1A 3GTQH 3U4VA 1OXTA 4DNIA 3J81c 4KLKA 4LUZA 4X65Q 4GOPB 4JBMA 3RLNA 1VQDA 2K14A 2NN6I 2VL6A 3E0EA 1WCMH 4L5TA 3AFQA 2N3SA 5JEAG 1WOCA 3HFZB 4LF4Q 1KIXA 3M3YH 4DV5L 1K8GA 4MTNA 4TQUS 1SROA 2L15A 3B6YA 3M4PA 1BBUA 1CUKA 3FKIH 1L1OB 1EIYB 4LF5L 2KBNA 3HOWG 1UE1A 4BY7G 4UPAA 1ASZA 1X55A 3D0FA 4A3FG 1N8RC 2E2IH 4L5RC 4TVAB 3TS0A 4BY1H 3FP9A 1TWCH 3MEFA 3GTPH 2OCEA 3S14H 4MNOA 4QGUA 4HIKA 1SR3A 3I4NG 4LW1A 5FLXc 3UE1A 1YJ9A 4A75A 2RF4A 1VQJA 3G71A 2RHSB 5C4JH 2A19A 3K7UC 4KHPL 1O7IA 3H15A 1JJCB 3KYHC 3SGIA 1PV4A 4LF9Q 2OWOA 2F52A 4JBWA 4LUOA 2AMCB 4IO9A 1D8LA 1X3EA 1PH5A 4GNXC 4JBKA 1Z47A 4DV2L 1KC8C 2EQSA 2R7ZG 2WAQE 2ZJQA 5IWAQ 1GVPA 1M1KC 3PF5A 3JAMi 2ZM6L 4DKAC 2VW9A 3CCEA 2MFIA 2NZOA 2KCTA 5EAYA 3W1BA 2XGTA 5BR8L 4KI0A 3CMAA 4QIWE 3KFUA 1I94L 3I4OA 1HZAA 4C3JH 2HQLA 3CW2C 5FLMH 4LF7L 3RZOH 1QVGA 4DR6Q 1NBWA 3OTOQ 3CP0A 1EUJA 2HIXA 1XNQL 4PZ8A 4DV4L 1NMFA 4LWCA 2I5HA 1Q1EA 1CKOA 4JI4Q 1EOVA 2WFWA 3CC4A 4EX5A 4A3BH 4POFA 1K73C 1IXRA 4A3KG 4DR7Q 1I6HH 2VQFL 1N36Q 3HKZE 3S1NH 4LF8L 2I5LX 4B3SL 2Z6KA 1AE3A 4OWTB 4JI5Q 1MKHA 4DR1L 1B8AA 1VQCA 5M5YH 4B3TQ 4JI3Q 1XNRL 4DV0L 3FHWA 4JV5Q 1IBKL 1QUQA 2WB1E 4JI0L 4LFAL 1QZHA 3KOJA 3ER0A 3A5ZB 3CC2A 4C3HH 3CD6A 4JG2A 1PA6A 4BBRH 4JI1L 3PIOA 4NXML 3J80c 1K9MC 3HOZH 2MO1A 1KL9A 4X64L 3CAMA 1L1OA 2HHHL 1R9TH 3I55A 1SFOH 1V1QA 2H5XA 3M4QA 4XTCS 4NPSA 2EIFA 2Y0SE 1N33Q 1VQBA 2GVAA 3PUZA 5C3EH 1VQ5A 4A76A 4DV3L 1YI2A 3RLOA 2JJQA 2CQOA 2RCNA 1LUZA 4DUYQ 1PH2A 1TWHH 1VQPA 4BXXH 1CKNB 4YWMA 5LMNL 3RZDH 4P72A 3PIPA 3I2ZA 1W3SA 1Z9FA 5M5XH 1W2BA 4IOCA 1HNZL 1KQSA 4GLAC 1HJPA 4B3MQ 1PH6A 4QY7A 4DR5Q 2DUDA 2JA9A 2JA5H 1N33L 1X3GA 3KLWA 1YITA 3JAMc 2JK8A 1QVCA 2UXCL 2R7DA 1CSQA 4GOPA 3CCMA 2JQOA 4DR7L 1UE7A 3S15H 1RIPA 1XMOQ 3M4OH 1IBLL 1MJEA 1GM5A 4A3LH 1E3PA 4JCVE 1XPOA 3F8TA 3G4SA 1EFWA 2UXBQ 3PO3H 5C0XG 1PH1A 4AYBG 4ME3A 4JI0Q 4GLVB 3CC7A 2JA6G 1CKMA 2D62A 4JI8Q 1HZ9A 1Y1VH 1X9NA 1PVOA 3GTMH 1A63A 2EXDA 1Y14B 1I5FA 4POGA 4DV6Q 1HNXL 4A3LG 3NENA 3H3VI 4R4TA 2VQEL 2R93H 3GTGH 4LUVA 1M90C 3STBC 1IBLQ 4B3RQ 4LFCL 4LFBL 1X56A 5LMNW 2DGYA 3PUXA 4YHHQ 2HIVA 5JEAJ 1CKNA 1EIFA 2NVTH 1OXVA 3D31A 4OWWB 3DM3A 1PH7A 4X62Q 3T1YL 1CSPA 1L1OC 1LM0A 3F2BA 4ALPA 4H02A
chains in the Genus database with same CATH superfamily
2KENA 2NTSA 4JBJA 1RD9D 5EKLA 3LGJA 2Z0SA 3K80C 3P75A 3PF4A 1HNXQ 3M3YB 1EWHA 3AQQA 5J3BA 1HNZQ 2L9HA 5KEEA 4HIMA 3TP7A 2FFKB 3NTKA 3T56B 2YTYA 4DUYL 1JICA 4IUQA 1EIGA 3D6WA 4DK1A 5HURA 2CW0C 1IBML 1Y1WH 3D3RA 4K8IA 4X64Q 1WYDA 2EZVA 1H9MA 1KXLA 1SMYC 1HHVA 4Y7NH 4A3EB 4KHZA 3BU2A 3ULPA 4N9PA 1HNWQ 5M3FG 4DR2L 4IFDH 3GTLB 1UAPA 3UDIA 1DZ1A 3PUYA 3MA2B 4HJ9A 2SDFA 4HJ7A 2O5IC 3TEHB 3E0JA 1RF2D 3HZXA 1ENAA 2V4DA 1WTOA 5C0XH 1FVIA 1HUMA 2WAQG 1PZJD 4A3IH 1K3RA 2FHTA 1IKLA 4APVA 4A3GH 1VCIA 2B2VA 4A3FH 1KTKA 1HQRD 3MVVA 2E2DC 2F0QA 1PRTD 1VMCA 4R4QA 4B9WA 2E2JH 4OX9L 3FVQA 3PQIA 2F0UA 3A5UA 4RMFA 4G57A 2WB1B 4JI6L 5E4XA 1RCVD 4LJZC 2WP8J 3S1RH 3PSIA 2NTTA 1EFID 3CKIB 2BH8A 4G4KA 4CKCA 3CQZB 4IUUA 2VZAA 2G5DA 5IYBG 4LMQD 3U9OA 2CW0D 2LXKA 2PMZE 2Y0SG 2VS1A 3J7AV 1NY4A 4OIKA 4BY1B 4UP7A 2EE1A 2IPKD 3G48A 2B63H 3EJIA 4XYOA 3L7ZC 1WTQA 4AYBE 2JE6I 2PQAB 1S5ED 3J81i 3U4ZA 4A3MH 3AEVA 1J8IA 3KLSX 2F4VL 1QUQB 4FNFA 1RKNA 2RVLA 3OIPA 3NWSA 2RQXA 1WTPA 2OEOA 3OIQA 2DY8A 1FD7D 1Q86C 2A69C 5C3EG 1ASYA 4WJ3M 4OX9Q 3PO2H 1P16A 1MSGA 4WJ4A 3V2TA 3L2PA 5FJ8G 2C35B 3UI2A 4R4CA 4GKKL 2N88A 1K28A 1A8VA 3FPPA 2MO0A 5LMUQ 3PIO3 2R7ZH 2EY5A 1ZEQX 3A8IE 1HR0L 3HOUH 2E5LQ 2K5VA 1X3PA 2XWJB 2R3ZA 1Q8IA 3CQZH 1TIID 4Z9CB 4DR3Q 1TR5A 4R4IA 4IPHA 3TBIB 4YY3Q 4DV1L 4DV7L 2JA6B 1T5EA 3J7ZC 3J7AF 1DD2A 3I90A 2OQKA 5M5XB 3W5OA 1NMGA 3F1ZA 5C5LA 1GUTA 2BDNA 3SR1A 2O2LD 5AJ3Q 2BA0A 2OTJA 3GV6A 5JJKA 2QEXA 5KNDA 2QGQA 4JYAL 3HOYG 1A15A 1I4GA 3NSWA 3HRZC 4MTKA 5IP9H 4HMIA 1ICFB 1SMXA 2F0DA 4GN4B 2C5CA 4KN4C 4RFBA 3PO3G 3ZJYC 5LL6S 3Q23A 2A68D 2HQEA 3M85A 3S1QH 5JOBA 1K3BC 2E2IB 3DM1A 3T16A 5KNBA 2XRQD 3S1NB 1YVCA 1YHBA 2CH4A 3EROA 4PNYA 4DK3C 1STHA 1Y1VB 4DR4Q 4A3BG 3QIAA 4HJAA 1CA5A 2K5HA 2AWOA 4IPDA 5IP7G 4GLXA 4BBSH 4A3EH 1B7YB 1I94Q 2YU9H 4MZ9A 1I50B 4KY5A 3S9WA 2D5DA 1TY2A 2FMCA 1NUCA 1A62A 3DXJC 1B9NA 1SYCA 3OWEB 1FNWA 2IJ0A 1BKBA 4P74A 4B3RL 2JA5G 1TWFH 1EL0A 2I46A 4H13C 5C4ZA 3RN5A 5IYCG 1TY0A 2F0KA 4JI8L 1MHWC 3JAML 2H1EA 4BS9A 1HA5A 1UEBA 1JR0D 4CHTB 2DJFC 4N9TA 2R6GA 1BR9A 4ZQ3A 1V1PA 2KCNA 1SJED 2PQAA 2IX1A 1LLRD 3J7YW 1SNQA 1H9SA 3OWFA 4N8X1 3KDFA 5AJ3L 2Q2TA 3KLSA 3DHQA 1KD1C 1S5CD 1HR0W 1EWCA 1DOLA 1PH3A 1MD2D 5DNFA 3X3NA 4XIGS 4DR5L 1JE5A 3BYTB 4IJLA 1HPCA 5ELCA 2XRSD 4K0KL 2PYKA 4DV0Q 3CMEA 5D3IB 4J15A 4UDUC 5C4JB 3J7A5 2JN4A 1O7LA 4N8FA 1HTPA 5TSSA 5C44H 1OO9B 1CFMA 3IFDA 4UHVA 2AKWB 1YJWA 2IWHA 1Q1BA 2KCCA 1CQVA 2RDHA 4FP5D 5C44B 1ZYRC 1J5EQ 2QILA 3A56A 3T51B 2BE5D 1L0YB 2IX3A 1O7YA 1WTXA 3S17H 3AYHB 4IFDG 2UXCQ 1RL2A 2EPBA 1FL0A 2D0PA 4JV5L 3AMUA 2F3IA 2A1AA 4DR1Q 1T9HA 2UU9L 2E5LL 4PZ6A 4ZUJA 1C7YA 3BJUA 1JJ2A 1PTOH 4IFDI 5E7NA 4ID6A 5G3LD 5C4XH 2OTLA 1B44D 4HN7A 1EY5A 2ZXOA 1K83H 4UAIA 3PO2G 3GTQH 4KLKA 3RLNA 1VQDA 2K14A 2QDBA 2VL6A 3WWVA 1O7ZA 2XIWA 1WOCA 4LF4Q 2E75C 2EYMA 1LTID 1AZQA 1Q3LA 3B6YA 1CUKA 2JA8B 1L1OB 4ILWA 1Z6HA 1UE1A 1ASZA 1X55A 3D0FA 5D14A 4BY1H 2ZXRA 3FP9A 3GTPH 1IYUA 2EXZA 3UE1A 1EY4A 2RHSB 4KTAA 2A19A 3L3OC 1JJCB 3BYYB 2O4XA 1SYFA 4LF9Q 4JBWA 2RCFA 1KNEA 1X3EA 5CR3A 4C3IG 3J80L 1BDOA 2EQSA 2NVTB 5L37A 4PV1C 3R8BA 2FINB 1PFNA 3LWUA 4RHSA 2ZM6L 3TN2A 4ZK9B 4FF1A 1XTCD 4KY7A 2KEDA 3W1BA 4QIWE 1ML0D 3KFUA 4IZ8A 1I94L 1FGBD 4JK1C 1XXGA 4LF7L 3CW2C 4DR6Q 1QVGA 4OEMB 2HIXA 1XNQL 2ZT9C 4PZ8A 2VB3X 4JI4Q 2WFWA 1K73C 1TKWB 4A3KG 4KK7A 4DR7Q 2VQFL 1I6HH 1JOQA 3S1NH 2VB2X 5IGDA 4B3SL 4OO1H 4CKBA 1MKHA 1TS2A 3SE0A 4DR1L 1B8AA 1VQCA 1XNRL 4DV0L 3FHWA 1R4PB 1QUQA 1SYGA 2A68C 1AFPA 1QZHA 1KNAA 3A5ZB 1BQQT 3IAYA 3I91A 2X69A 1ESFA 4S3SA 3J80c 3CAMA 2YU9B 1L1OA 1R9TH 1SFOH 1V1QA 1TU2B 1SXTA 3NQTA 3M4QA 4XTCS 4NPSA 3MAQA 1GHKA 1VQ5A 3VA5A 4DUYQ 1LUZA 4BXXH 1MBYA 1VQPA 1DYQA 3I2ZA 2A74C 2H4OA 4IOCA 5JAVA 3MXNA 3BG3A 4NKLA 1F9RA 2JA5H 2VUMB 4KMUC 4QMGA 1GUNA 2F1MA 1QVCA 2UXCL 2R7DA 1I3QB 2JQOA 1CHQD 4DR7L 4ZCKA 1RIPA 2L11A 3KUPA 4OHJA 5NUCA 4JCVE 1XPOA 1EY7A 3PO3H 4AYBG 3K5NA 4FF3A 3S1RB 2IL8A 2D62A 4WFN3 1X9NA 1Y1VH 2R93B 2EXDA 1Y14B 4POGA 4DV6Q 3NENA 5JJZA 2R93H 3OPOA 1M90C 3STBC 4LFCL 1X56A 5LMNW 1RTOA 2LS01 4YHHQ 2HIVA 1BBXC 1CKNA 1EIFA 3D31A 1PH7A 1EY0A 2EYFA 3QOJA 3F2BA 1I4RA 4H02A 4V190 2QKIC 2B29A 2R92G 5A35A 4JPBW 4A3JH 1LTBD 1X6OA 4ZKBB 3A55A 1WD1A 3C2PA 1II3A 4OIJA 1PYWD 2K01A 1K0RA 1TWHB 2YV5A 3HGBA 3AB9A 2MNAA 1K8AC 5JVG3 1ENFA 5IGGA 4QB4A 1G6PA 1OTCA 2DNCA 4BBSB 1S40A 5IY0A 1BCPF 2M9VA 4BBRG 4ABNA 2IX0A 4JI7Q 2JYOA 5JEAH 1XNRQ 2ZTDA 2JA8G 1NR4A 3GTJB 1GO3E 2B2YC 5ELEA 4ZKCB 5C0XI 1DONA 5C0XJ 1SEBD 4OXPA 5CBEE 2NN6G 3HG9A 1LT5D 2AQ1B 3QWNA 3KJPA 4IPGA 4A3DG 3NEMA 3WOEA 5KYIA 2KA7A 5IYDH 1J5EL 4LF6L 2EYHA 3PIP3 4RAUC 2GVBA 1XJVA 4KJOA 2ES2A 2A69D 3OTOL 4O2DA 1D6EC 4OWXB 2TMPA 2HCCA 3P7JA 1HA6A 3GTOH 1VQKA 4JOIA 2AWNA 2CQAA 4K0KQ 1ET6A 1P8LA 3SDZA 1CM9A 4JI4L 3AU7A 3PGZA 1HFGA 3GDEA 2EJMA 3S14B 2NVQH 4BWGB 2D9UA 4A3DB 2F0VA 1AP0A 1LTRD 3PV0A 1EY6A 3RLFA 1SYBA 3G6EA 1C48A 2EY6A 1H9RA 2PCFB 2PI2E 2Z8LA 4IALA 1K83B 4A3KH 2B8GA 4NMZA 1YBYA 1GUSA 5EJWA 5I9OA 3AFPA 1FNUA 2VQFQ 2QA4A 1NJIC 2RSNA 1IYJB 2UUBQ 3NP8A 3P1HA 4A3CG 1H9JA 3ND9A 3CF5A 4JC0A 1X3FA 1G51A 1T5XD 3G7LA 3TREA 3V05A 1HH2P 1R9TB 4AIMA 1X32A 1G6ZA 3ERSX 1XMQL 3J81L 3CCRA 1LO5D 2YTVA 2F3WA 2XN9C 3S1MB 4MN3A 2Z6KC 2EOTA 1VQMA 5AFWA 5GADC 2JA5B 4P2CB 4BXXG 1Q82C 4KN7C 3F2UA 1FJGQ 1VQLA 4L6TB 1FR3A 2CFMA 3BVGA 1LTTD 3S1MH 1VQ8A 2HUGA 1RDPD 1F9SA 2Q8RE 4P71A 1XMQQ 1GKHA 1LT3D 2ASBA 3VDYA 1F2ZA 4BY7B 4HCEA 5CORA 4PMWA 4F8MA 1KAWA 3S1QB 1JC7A 1STYA 4WJWA 3OW7A 1JB7A 3BVZA 3TP5A 1KLGD 2B2WA 1HCZA 4Y7NB 5CMDA 2IHFA 4YWKA 1B70B 2XTIA 2LMCB 3NELA 1RODA 3D4DA 5LL6X 1O80A 2PZUA 2UXDL 4PQXA 3I8ZA 3CCSA 1DM0B 3HOYH 1ILPA 4DA2A 3QOLA 1E1OA 4H44C 1TWCB 2R61A 4JI3L 4CGYB 5A2QL 3VYUA 1BCPB 2K6AA 4JYAQ 2LKVA 3N6RA 3EBEA 3R2TA 3I56A 4A3JB 4RCOA 4C3JG 4OONA 1I6VC 2KHIA 1JB3A 1XMOL 4JI6Q 5D3DA 4HIOA 5M9OA 2PNHA 2CVRA 1KRSA 2ATWA 3J80E 1E7ZA 3N52A 3W1GA 2VQEQ 3CCJA 3MHBA 1D5ZC 1EOTA 3HOZG 5ELNA 4LF8Q 4OELB 4ZRZA 4EVOA 2RDFA 1ONLA 5IT9c 5IE8A 1S3OA 1SLJA 3EIVA 2TSSA 2EYLA 4RHRA 1WFQA 2DJGC 3K6OA 4KY6A 1U4LA 3K81C 2QDLA 1KRTA 2F0PA 1EIHA 2JA8H 3S2HH 3NBHA 1VF5C 3QR8A 4M8AA 5J1ZA 3OMCA 1QNUA 3P20A 4K2LA 2UUCL 4PZ7A 5ELOA 3U58A 3HOXG 1SRUA 3CPWA 3W3AA 4MIUA 2OQ0A 1A2TA 1EQQA 2JA7G 2JEAI 3OYYA 4CDEC 3KF8B 2F0EA 1JE4A 3FKIG 4DAYB 4HSVA 1L0WA 1S72A 2CWAA 1S5BD 4YCUA 3JC66 1Q90A 3GTMB 1RJTA 2NYZD 3CCQA 1PHJA 3NBHB 1PYBA 1VQ4A 2E2HH 1PRTC 1SMYD 1N32L 2CWPA 3GV3A 1PTOB 5I9PA 1XPRA 4IPCA 3PUVA 1STNA 4GNXB 4GKJQ 1LYLA 3BZCA 3OW2A 1VQEA 1N9WA 1OXXK 3HOUB 1QZGA 3HOVH 1XYIA 3H3VC 1E2ZA 4LF6Q 4IJHA 2Q2HA 4KHPQ 1WCMB 1PFMA 1XX8A 1I50H 1BF4A 2WB1G 4RKLA 1AE2A 3CRKC 1CT1D 1F2MA 1SN8A 2ZTEA 3S2DB 1SJHD 1VMPA 1WI5A 1D1KA 3C1EA 1STEA 4WRDA 1E24A 3RN2A 3I3CA 4K5XA 1SFOB 4PG3A 3T1HL 1D7QA 1VQ6A 1H95A 3A54A 4FDBA 3QG1A 5M3MB 5IYDG 1K8MA 4QL5A 1PDQA 2XVSA 1A6XA 1BBWA 4RKBA 3UE0A 2EY1A 2BA1A 2WINB 4JBMA 4LUZA 4GOPB 5M5YB 1SE4A 4L5TA 2BOSA 2BE5C 1KIXA 1QE6A 5FK9C 1CA6A 1EIYB 4LF5L 1JCKB 2B2WC 1D1IA 1MGSA 2E2IH 4L5RC 3TS0A 4ZLTF 3S14H 1ENCA 2HDLA 1SR3A 4LW1A 5FLXc 2F0HA 3G71A 2DY7A 3NQIA 5C4JH 4KHPL 1O7IA 4DAPA 3H15A 1EQTA 2DNEA 3NK9A 4K2KA 1CZWA 3VR2A 5J22A 3GTKB 2OWOA 1PH5A 4DV2L 3SVMA 1GVPA 4DKAC 3OOCA 2RDGA 2PQEA 4KJNA 5BR8L 1PRTF 3CMAA 1ZYRD 3I4OA 5FLMH 2F0MA 4C2MB 1NBWA 3OTOQ 5K36H 3CP0A 1U4PA 5EBDA 4DV4L 4LWCA 2I5HA 4RGOS 1CKOA 1B4OA 1BCPD 4EX5A 4EQNA 1IXRA 3E5SA 3ND8A 3DWPA 1AE3A 5EBCA 3VYTA 4DFAA 1S5DD 5M5YH 4JV5Q 1IBKL 4LFAL 1B53A 1AEXA 1AN8A 2SEBD 2L0CA 3ER0A 5JPMC 1EYAA 3CC2A 3BDLA 4XT3B 1JOOA 3CD6A 4JI1L 2F0FA 4NXML 2F0LA 2OF1A 3FRPB 3FPUB 2MO1A 1KL9A 4X64L 4CDFC 2BCOA 1DJRD 2K33A 1CZGA 2JP1A 4I65A 1LTAD 1PLFA 2CHBD 2EIFA 2Y0SE 1CHPD 4FF4A 2KOLA 5C3EH 3NPPA 2CQOA 2RCNA 5FLXE 3RZDH 2KQ3A 4HMJA 3PIPA 1A2UA 1Z9FA 5M5XH 1W2BA 3S2HB 2C9OA 1HJPA 1PH6A 2AUKA 2K5QA 4QY7A 2JA9A 4IUNA 1EU3A 2JK8A 4K14A 1CSQA 3RZDB 2MJ8A 2J4XA 4NW2A 3SHLA 5E3FA 2KUMA 3T4AC 5EPLA 1XMOQ 1SNOA 4G7OC 1MJEA 3NWTA 1GM5A 5IGEA 4A3LH 1E3PA 2I07B 1UUPA 1C8CA 2E2HB 1TQOA 4GLVB 4JI8Q 3X3MA 1A63A 3GTMH 3V96A 1EY9A 4IURA 3VR4A 3H3VI 4ZUIA 3C46A 2B2UA 4B3RQ 1TVXA 4O1NA 4A3KB 5JEAJ 3VYSA 3DM3A 5ELBA 3T1YL 4QIWB 5KIXA 4ALPA 4GOPA 4UY8C 3S16B 2F0JA 2K03A 3ICEA 3CHBD 5BN5A 5IGCA 4XT1B 4DV6L 3GTLH 1AW7A 3HS0C 3QO2A 3HOXB 4NXNL 3HOVB 1TWFB 4QJFA 4DR2Q 4FXGC 4TRDA 5HGQA 4LAAA 3F2DA 3HOVG 1VQOA 4X3KA 2R92H 3HEJA 3KDFB 1TWAH 5H1SE 3F2CA 3HKZG 3VR3A 5FJ8H 3DEOA 3H0GG 2ICEC 2F0TA 3DUZA 3ITPA 3R93A 2L5TA 4DV7Q 4LFBQ 2F0OA 2YTXA 3T1HQ 4OO1I 4JI5L 4O42A 4B3SQ 2EYOA 2UU9Q 1UE5A 3BZKA 2F0NA 4XYQA 1TWGH 4BY7H 1GD7A 4IFDJ 2NVYH 1U5KA 3I70A 4ZAIA 1UWVA 4G7ZC 4C3JB 2KJXA 3NUCA 2NVXH 2NN6H 4A3DH 3OHXC 1XNQQ 1D2BA 4DU9A 3I7FA 3TQYA 1I4XA 3CCLA 3PUWA 1PH4A 4QCLA 2NWGA 1ZXTA 3H3VH 1QCBD 1Q12A 2AHOB 1ICWA 1BXTA 1U0LA 1VQGA 1V9PA 1XWEA 5G3LF 2XWBB 2IW3A 2A6ED 4LF7Q 4DR6L 4QUFA 5BN4A 2UUAL 3A8KE 1XPUA 4A3GB 1YJNA 4HCSA 3WDNA 4MHEA 3BVMA 4A3IB 2ICIA 3IRBA 2F0IA 3SK6A 1SYEA 3NXWA 3Q22A 1EEFD 1UE6A 2VUMH 4LF9L 1C0AA 1GJXA 4BBSG 3MXPA 3GP7A 2HD3A 4A3EG 2ALYB 5ISRA 2UUAQ 4GS3A 5CV8A 1CTMA 2K5NA 1IBMQ 1WD0A 3BDCA 3MXNB 2PW5A 2XSCA 3UDGA 3A8JE 1QILA 5GAEC 2JA7B 4O0AA 3STBD 4GKKQ 2ZTCA 5BR8Q 3NHHA 4LF4L 2MQHA 2LY7A 3U50C 2ZM6Q 4X65L 3U9SA 4C3IB 1MJCA 4A4IA 3I4MH 3M4YA 3J80i 2XNAC 2IHEA 1AH9A 4C3HG 3HOWH 2L4NA 1B9MA 4LFCQ 1NR2A 1RTNA 4QUCA 3MC0B 1LT4D 1EQVA 1I4QA 5C6AA 2K5DA 4CBVA 3JAME 2ID0A 1GUOA 5JVH3 2R7FA 4DUZL 2IT1A 3TP8A 3HOWB 4BY1G 4FF2A 1TS5A 4GOPC 5K36G 2N8NA 5EKKA 4A3IG 3T13A 4AYBB 5FOBB 1STAA 4B08A 1Q7YC 5EPKA 1HXYD 2K5WA 1IL8A 2Q2IA 4A3GG 2N49A 5LHY1 1SSOA 3GQBA 3J81j 4RCNA 2MP1A 5KGUA 3I4LA 3PO2B 2EY2A 1O78A 2A6HD 5KYLA 1YNJD 4J8QA 2N55A 1B50A 1NE3A 2Z4HA 2MUYA 2VY3A 2EJGC 3URYA 1YNND 2UUCQ 4DAMA 1JQYD 3K0XA 2O5JC 5JJIA 4A93G 2JA6H 1Y1WG 3D6CA 4RGNA 5M5WH 3MZ5A 1W6KA 1NAPA 1F9QA 4E6IA 2ZXPA 5CBAE 3Q8DA 2SOBA 4YHHL 5EGTA 1S5FD 2WAQB 4FXDA 4P73A 4JI1Q 4NXMQ 1V8QA 2A73B 4UP8A 3C3LA 1LT6D 3K5OA 1VQNA 2B63G 4U68A 3BZDB 4LK1C 3KBXA 4GKJL 4DPGA 5T1GA 3RUZA 4OO1G 2GA4B 2Q8TA 4DR4L 4BBRB 1SE2A 2V1CC 5EPJA 1N32Q 4NDXA 3H0GB 4HEDA 1HRJA 2NVYB 2F3VA 4FXKC 4DV2Q 2YYZA 4GN5A 3VR6A 2K28A 5ELDA 1VQ7A 1H9SB 1PTOF 1C4QA 2F4VQ 4F88A 1PFSA 4IUTA 1LTGD 1I6HB 1GOZA 4AQYL 1EQRA 2Z1CA 4B9XA 4C3IH 4YY3L 4DV1Q 4CJ0B 1SE8A 5T1IA 1C9OA 1EYDA 3LWEA 3L0OA 5FO8B 3CCUA 4CDCC 1Q81C 3EFXD 3RNUA 3EN2A 1HZBA 1J6QA 1X65A 3MXGA 1U4MA 1YEZA 1W6JA 2CKZB 3K5MA 3KBGA 4DNRB 4FYDA 3KF6B 5GQOA 2EVBA 2A6HC 3PCOB 1LV9A 4A3FB 1A0IA 3DWQA 5CV5A 4L5QA 5M3MH 2K4KA 5IYBH 4DV5Q 3M7NA 4R4OA 1TS3A 2I0QA 1A3UA 1PYSB 1TS4A 4DR3L 3LNNA 1Y1VG 1G2TA 4NB3A 5I6WA 1Q46A 4CDDC 3A7LA 1PFBA 5CC4A 3SK5A 3TRZA 4YCWA 5CV6A 1B3AA 3H0GH 3QJYA 4FVMA 2NBFA 1MSHA 4A3JG 3KF6A 1VQFA 4IUPA 1JWUD 4DAYA 5FLXL 3KF8A 4K8JA 1TWGB 3PO3B 1QWYA 2I5MX 3RZOB 1EYGA 2LSSA 1N34Q 1HNWL 1WCMG 2F03A 1IZ6A 3CRLC 4UP9A 1H9KA 2X6LA 3K58A 5IP7H 5E1FA 5K5PA 3HOUG 2JXMB 1VS0A 1OXTA 2QCPX 5JEAG 3E0EA 3AFQA 3M3YH 3FEWX 4DV5L 4U673 4MTNA 4TQUS 1SROA 2L15A 3M4PA 3FKIH 3HOWG 2NB0A 5CYUA 3R2IA 3ERQA 4TVAB 2WKDA 3MEFA 2OCEA 3NBIA 1PZID 4IQZA 4HIKA 2D2CC 1KDCA 1YJ9A 4A75A 1VQJA 1E0BA 1EEID 4R8IA 1LACA 3SGIA 1BNZA 3HKZB 2AMCB 2K05A 4IO9A 1JWSD 3CU7A 4GNXC 1WTWA 4JBKA 2AUJD 1KC8C 2ZJQA 4HAEA 3MTSA 4X3SA 5CV4A 3SK8A 3NTIA 1PXUA 3JAMi 3FDTA 3CCEA 2XGTA 2LFNA 4R9WA 4JVZA 5A2QE 1HZAA 4TKOB 2HQLA 5I4DA 3RZOH 2R7ZB 2R92B 2Q8IB 3GTPB 1NMFA 3FMCA 1SYDA 1CI3M 1Q1EA 4CJ1B 1KLUD 4A3BH 1N36Q 4K5VA 3H91A 3OMGA 2I5LX 2WV6D 4PMCA 2Z6KA 4L8JA 4OWTB 1WTVA 3E6ZX 4B3TQ 1EU4A 4IN3A 1SE3A 4C3HH 4BBRH 3PIOA 4KV6A 2E2JB 1KABA 3I72A 2H5XA 2B39A 4QF4A 1N33Q 1VQBA 3PUZA 3Q0AA 1QJOA 3RLOA 5DEHA 1Y1WB 1PH2A 4A93B 5E4WC 1STGA 4RA8A 4P72A 1BUVT 3WOFA 1HNZL 1NCVA 5I2XA 1G2SA 1KQSA 4GLAC 4B3MQ 3Q24A 4DR5Q 4C1NI 1N33L 1X3GA 3KLWA 4TSSA 1YITA 3HOYB 1F9PA 1GHJA 3CCMA 1UE7A 3S15H 1IBLL 3K5LA 4F87A 1QG7A 5EQ0A 2UXBQ 5C0XG 4ME3A 1M4VA 2JA6G 3CC7A 4X3UA 1HZ9A 1I5FA 1HNXL 4A3LG 4R4TA 2VQEL 5COYA 4LUVA 1IBLQ 4LFBL 2DGYA 3PUXA 4Q0FA 4X3TA 2F4IA 5IODA 1OXVA 4X62Q 1CSPA 1L1OC 1GXDC 1K0SA 1SBBB 2FXQA 1VQ9A 4KKUA 5JJLA 2EYPA 1I3QH 4CKEA 2L12A 4ZYSA 5HGTA 3Q6SA 4OL7A 3UDXA 5C3EB 1LTSD 4YWLA 3A74A 1IBKQ 2KCMA 1X3QA 4XQNA 4BA2I 1FGUA 1SAPA 3ZYYX 3K7AH 4DK6C 1AZPA 4C56C 3HKSA 1UNSA 3SK4A 5M3FH 1IW7C 5C4XG 2RHQB 2GN5A 4HSPA 2J0TD 4JI2Q 3TP6A 1PMRA 4DV4Q 2Q2UA 4A3MG 4RGMA 5KRUA 3HOZB 3L9AX 4B3TL 3KJOA 3ULJA 3OSOA 4AQYQ 2Y0SB 5DM63 3MWYW 4DV3Q 4P75A 4QQBX 3K8AA 1LABA 4BA1I 4ODGA 4X6AH 4X62L 5LMUL 2K1BA 1SDFA 1JT8A 2M00A 1EZ6A 1Y8OB 4Y52H 1Z7TA 1BCPC 2K50A 5M3MG 3RMHA 1ZKOA 1NTGA 2Z4IA 3C1FA 3IFTA 1G91A 1S4ZA 1EWIA 3A0JA 2B2TC 3D8GA 1VQAA 1KHIA 4LF5Q 5IGBA 4DK0A 3GTJH 1LTLA 2KECA 2B2TA 4H7BA 2JA7H 5FKAC 1HZCA 2OXPA 2WACA 4EQPA 3I4NH 1EZ8A 4X66Q 4AH6A 2M2LA 4R8NA 4GN3B 4DF7A 4B3ML 1VQHA 1FYCA 1HTLD 4FO2A 1TWAB 3DLLA 1G291 4KHVA 1ILQA 1IYVA 1I4HA 2RSOA 1YIJA 2LXJA 1NSNS 2VXWA 2IY5B 3TS2A 4XQQA 4X66L 2K52A 4DUZQ 3I4MB 1E22A 2P5ZX 4KKTA 1JWMD 1N36L 3QB3A 1B2TA 2QF7A 2B2YA 4C3HB 2K32A 4EQ5A 1FJGL 4NP5A 4I7AA 4HJ8A 1PH8A 1DOKA 1YHAA 2A5HA 1YNJC 1F77A 3GD7A 4CJ2C 4R1JA 3VR5A 1QOHA 5I6YA 4IUVA 1I4PA 1GUWA 2NZHA 2K7VA 5KNCA 1HQMC 4YCVA 2D0OA 2E8GA 3KK7A 1ESRA 2UUBL 2PW7A 3HOXH 4WORA 2NVXB 3S24A 1DGSA 1G8ZD 3RR5A 1N34L 3E3XA 3S15B 1YZ6A 1OXSC 3I4MG 1BO0A 1Y8NB 2G9DA 5IT9E 2R93G 1M8AA 2EDGA 3K57A 5C5MA 4RG1A 1IL2A 4LNQA 3E9HA 2UXDQ 4F7XA 4JI7L 1JJGA 4NXNQ 1K8OA 4DGZA 4JI2L 2OT2A 1XTDA 1SNPA 5DLQE 2RA4A 3H94A 2K04A 3M7GA 1R4QB 5IP9G 5IIFA 1D5XC 1QB5D 2E76C 2B3GA 3SXHA 2VUMG 2KHJA 3CXCA 1U4RA 1E2WA 1V43A 3MFYA 2QEJC 1QNKA 1L0XB 4C1NK 1X54A 2PO4A 1VQIA 1J9OA 2EJFC 4HJ5A 3UDFA 5HY6A 1OXUA 1HR0Q 1B3QA 5FLMG 3SEBA 5C44G 4DXGA 5CV7A 4A93H 4EGVA 1E2VA 2B2VC 3E9IA 3M9BA 3T1YQ 1TT2A 2F0SA 3O13A 2ZJRA 2CCZA 2AQ3B 2RKSA 4L5SA 2MHVA 2QW7A 4C2MH 1GUGA 1MI2A 2BH2A 2FMMA 5FO7B 4L63B 3EA6A 1JMCA 4JW0A 1DCZA 4A3MB 5IWAL 4A3CH 3DMUA 1PRTB 1WJJA 3A7AB 4G7HC 3DEPA 3CCVA 4RGTA 5IYCH 1TXYA 2PNRC 5BN3A 3FKIB 3DWAA 2HHHQ 3D4RA 5DM73 2G9HD 5IT9L 4DN4M 4IOAA 3T53B 2B2UC 2BDOA 3TSSA 1IHZA 4J6HA 3S16H 2NVQB 2DN8A 2N78A 2NUCA 1Q8KA 3J81E 4ME5A 5LMNQ 3MXUA 3CPFA 1ET9A 1YNNC 1Y69U 3D4WA 4GNXA 3I73A 5J39A 3I4NB 3S2DH 2K75A 4LFAQ 4XXEA 2NZ1D 1YNXA 3K7AB 5F2DA 2VNUD 2ZJPA 4KKSA 4HIDA 2Z9HA 3NTHA 4A3BB 1SNDA 1BVSA 1VDZA 1Y8PB 5M5WB 1YHQA 2B63B 2UXBL 2KEEA 1E1TA 1PH9A 5CGKA 1QVFA 3TZDA 4JOIC 1D5MC 1KDAA 2A8VA 3ULLA 3ONAB 1JORA 2PI2A 5GAHC 5GAGC 3W2DA 1B1ZA 1MIUA 1NNXA 2HT1A 1U9RA 4KD3A 5IOCA 3EVQA 1FNVA 2JEBI 1IW7D 2MGSA 3GTKH 4M1UB 4K6DA 4RWSC 2F0WA 3GO5A 5EKIA 5C4HA 5FO9B 2FJ2A 4KD4A 4H0LC 5GROA 3BDOA 1L2FA 3MFGA 1VF7A 1KAAA 3H6MA 2WKCA 3U4VA 2L55A 3G6JB 4DNIA 4X65Q 2KVMA 3J81c 3LX0A 3G4SA 3M4OH 2NN6I 3S17B 1WCMH 3IKJA 2N3SA 5I2YA 3HFZB 3VYRA 1K8GA 1BBUA 4PMBA 5D65A 1HFNA 2X6GA 2KBNA 3KLRA 4V0BA 4BY7G 4UPAA 2SNMA 3M4OB 4A3FG 1N8RC 1TWCH 4MNOA 2CH4W 4QGUA 3TMEA 1F2YA 3I4NG 3GTGB 2RF4A 4XDXA 5C4XB 4OGQC 3K7UC 3KYHC 2AQ2B 2F0GA 4RH6A 1V1OA 1PV4A 2A6EC 2F52A 4LUOA 1D8LA 2Z6BA 1Z47A 2R7ZG 2SNSA 2WAQE 1SNMA 1DOMA 1PTOD 5IWAQ 1M1KC 3PF5A 3K59A 3NE5B 2VW9A 2MFIA 4HTHA 2NZOA 1A3TA 2KCTA 5EAYA 4KI0A 3MEHA 1WVLA 4C3JH 3TZUA 2PZWA 3PMFA 4DAVA 5C3WA 1EUJA 1BOSA 2PMZB 4I7ZC 2HCIA 3HP3A 3R3OA 1EOVA 3CC4A 4POFA 3HKZE 4LF8L 1UEAB 4K5WA 4JI5Q 5ELFA 4JI3Q 4JI0L 2WB1E 2JSOA 2KHSA 3KOJA 1RHPA 2EYJA 5IGFA 2WIIB 4JG2A 1PA6A 1STBA 3HOZH 1K9MC 4DXFA 1CQFA 1WTRA 2HHHL 3GTOB 1PTOC 4HR7B 3I55A 1PZKD 4J1MA 3BS1A 2GVAA 3RD4A 4A76A 4DV3L 5DAUA 1YI2A 2JJQA 1DXMA 4DNTB 4EQOA 1TWHH 1CKNB 2HDMA 4YWMA 5LMNL 1W3SA 3EQLC 2PPBC 3GTQB 3K0YA 1CK1A 4GZYC 2DUDA 3VA7A 3JAMc 1KDBA 4Q5VA 1SNCA 2E74C 1EY8A 5C3XA 1HUNA 1V1PB 1JOKA 5CV9A 2PZTA 1EYCA 3H09A 4K6LA 1F2LA 1WTHA 3F8TA 1EFWA 2ENBA 3TDQA 1PH1A 4JI0Q 4ULLA 1CKMA 2B8FA 5JPNC 1PVOA 2L1BA 5M3FB 3IL8A 3GTGH 2MPMA 4XQJA 1A3VA 2NVTH 1IKMA 2J7ZA 4OWWB 4YIJA 1LM0A 2RBMA
chains in the Genus database with same CATH topology
2KENA 4JBJA 3PF4A 2FXQA 2B29A 3LGJA 2Z0SA 3K80C 1VQ9A 2R92G 4DV6L 1HNXQ 3ICEA 5JJLA 3AQQA 1I3QH 5J3BA 1HNZQ 3GTLH 4A3JH 4HIMA 4NXNL 1X6OA 4QJFA 2YTYA 4DR2Q 3UDXA 4DUYL 5HGQA 4YWLA 3HOVG 3F2DA 3A74A 1VQOA 1IBKQ 2R92H 2KCMA 3KDFB 4BA2I 1TWAH 5H1SE 1K0RA 2YV5A 3F2CA 1FGUA 3HKZG 3K7AH 4DK6C 1IBML 1Y1WH 3HKSA 2MNAA 1K8AC 4X64Q 5M3FH 1WYDA 4UY8C 5FJ8H 1KXLA 5C4XG 2RHQB 2GN5A 4JI2Q 4Y7NH 1G6PA 1OTCA 4KHZA 3H0GG 4DV4Q 2Q2UA 3BU2A 3ULPA 1S40A 5IY0A 4A3MG 1HNWQ 4DV7Q 4LFBQ 4BBRG 5M3FG 4DR2L 2YTXA 2IX0A 4JI7Q 4B3TL 3KJOA 3UDIA 3ULJA 3T1HQ 2ZTDA 1XNRQ 3PUYA 4AQYQ 2JA8G 4OO1I 4JI5L 4HJ9A 1GO3E 4B3SQ 4HJ7A 4DV3Q 2UU9Q 1UE5A 3BZKA 3TEHB 4P75A 5C0XI 3K8AA 5C0XJ 4QQBX 4BA1I 4OXPA 2NN6G 4A3DG 1TWGH 3KJPA 4IPGA 4BY7H 4X6AH 3NEMA 4X62L 5LMUL 1GD7A 4IFDJ 1JT8A 1FVIA 2NVYH 2WAQG 1U5KA 4A3IH 5IYDH 1UWVA 1K3RA 1J5EL 4NXMQ 4LF6L 4Y52H 4APVA 4A3GH 1VCIA 2NVXH 4A3DH 2GVBA 2K50A 5M3MG 1XNQQ 1XJVA 4A3FH 1NTGA 2ES2A 3OTOL 4O2DA 1EWIA 3I7FA 3A0JA 3TQYA 4OWXB 1VQAA 1KHIA 4R4QA 3CCLA 4LF5Q 3PUWA 2E2JH 1PH4A 1VQKA 4OX9L 3GTOH 3GTJH 4JOIA 2AWNA 4K0KQ 3A5UA 4RMFA 3H3VH 1P8LA 1Q12A 2AHOB 1LTLA 4JI6L 4JI4L 3PGZA 2JA7H 3GDEA 2WP8J 1HZCA 1U0LA 1VQGA 1V9PA 3PSIA 3S1RH 3I4NH 2BH8A 4X66Q 4AH6A 2NVQH 4LF7Q 4DR6L 4GN3B 2UUAL 4B3ML 1XPUA 2VZAA 1VQHA 5IYBG 3PV0A 1YJNA 3RLFA 3G6EA 3DLLA 2LXKA 2Y0SG 2PMZE 1G291 3IRBA 2VS1A 1NY4A 2PI2E 4UP7A 1YIJA 3G48A 2B63H 1UE6A 3L7ZC 2VUMH 4AYBE 2JE6I 2LXJA 2PQAB 4A3KH 3J81i 2IY5B 4LF9L 4X66L 1YBYA 2K52A 3WWVA 4DUZQ 1E22A 3TS2A 4BBSG 1C0AA 3U4ZA 4A3EG 4A3MH 2ALYB 3AEVA 2UUAQ 3AFPA 2F4VL 1QUQB 4GS3A 2VQFQ 2K5NA 1N36L 1IBMQ 2QA4A 1NJIC 3MXNB 1IYJB 2UUBQ 4EQ5A 1FJGL 4A3CG 3UDGA 4HJ8A 1PH8A 5GAEC 1YHAA 4JC0A 3CF5A 4O0AA 1X3FA 1G51A 3TREA 1Q86C 3GD7A 1HH2P 3STBD 4GKKQ 4R1JA 4AIMA 5C3EG 1ASYA 4WJ3M 4OX9Q 3PO2H 2ZTCA 1P16A 3ERSX 5BR8Q 4WJ4A 4LF4L 2NZHA 3L2PA 2MQHA 5FJ8G 3U50C 3CCRA 2YTVA 2C35B 1XMQL 2ZM6Q 2Z6KC 4R4CA 4X65L 4GKKL 1VQMA 5GADC 1MJCA 4A4IA 3I4MH 1A8VA 2MO0A 3J80i 4YCVA 2IHEA 2D0OA 2E8GA 4BXXG 1Q82C 1AH9A 3HOWH 5LMUQ 2UUBL 1VQLA 1FJGQ 3HOXH 2R7ZH 4LFCQ 3S24A 2CFMA 3S1MH 1DGSA 3RR5A 1N34L 1VQ8A 1YZ6A 1OXSC 3I4MG 2ID0A 4P71A 1XMQQ 1HR0L 3HOUH 1GKHA 2ASBA 3VDYA 2R7FA 2E5LQ 2K5VA 4DUZL 3CQZH 2IT1A 4DR3Q 4R4IA 2R93G 4IPHA 4BY1G 4YY3Q 4PMWA 4DV1L 4GOPC 4DV7L 5K36G 1KAWA 2N8NA 3J7ZC 4A3IG 4RG1A 1IL2A 4LNQA 3E9HA 2UXDQ 1Q7YC 2OQKA 4JI7L 1JJGA 4NXNQ 2Q2IA 4JI2L 4A3GG 3W5OA 1NMGA 1XTDA 2N49A 3F1ZA 3J81j 1JB7A 5DLQE 5IP9G 5AJ3Q 2BA0A 2OTJA 5JJKA 2QEXA 2QGQA 1NE3A 4JYAL 2IHFA 3HOYG 2VY3A 4YWKA 2B3GA 2VUMG 2KHJA 1B70B 2XTIA 3CXCA 2UUCQ 3NELA 1V43A 5IP9H 1SMXA 4GN4B 4DAMA 2UXDL 3CCSA 3K0XA 1X54A 3HOYH 3PO3G 3ZJYC 5JJIA 4A93G 3S1QH 1VQIA 1E1OA 3M85A 2JA6H 4JI3L 1Y1WG 4HJ5A 3UDFA 5HY6A 4JYAQ 3EBEA 3I56A 1OXUA 5M5WH 1HR0Q 5FLMG 3Q8DA 4OONA 4YHHL 2KHIA 5C44G 4A93H 1YVCA 4P73A 1XMOL 3E9IA 3M9BA 4JI1Q 1YHBA 4HIOA 3T1YQ 4JI6Q 2ZJRA 2PNHA 4UP8A 2CCZA 1VQNA 2B63G 4DK3C 4L5SA 4DR4Q 4A3BG 4HJAA 1KRSA 2AWOA 2K5HA 4IPDA 5IP7G 4GLXA 2ATWA 4BBSH 4C2MH 1E7ZA 2VQEQ 3W1GA 1B7YB 3CCJA 4A3EH 4DPGA 1I94Q 2YU9H 4GKJL 4OO1G 2BH2A 4MZ9A 4DR4L 3HOZG 5ELNA 4LF8Q 1JMCA 2V1CC 5IWAL 4A3CH 1N32Q 5IT9c 5IE8A 1S3OA 1SLJA 1WJJA 3EIVA 3CCVA 4DV2Q 1A62A 2YYZA 4GN5A 1WFQA 5IYCH 3K81C 1TXYA 1KRTA 1BKBA 2JA8H 4P74A 1VQ7A 2JA5G 4B3RL 1TWFH 2HHHQ 3S2HH 2F4VQ 1PFSA 4IOAA 3RN5A 4AQYL 5IYCG 4JI8L 1EQRA 3S16H 1UEBA 2N78A 2UUCL 4PZ7A 1Q8KA 5ELOA 2R6GA 4YY3L 4C3IH 4DV1Q 3HOXG 1SRUA 2PQAA 3CPWA 3U58A 2IX1A 1SE8A 5LMNQ 2OQ0A 1EQQA 1C9OA 2JA7G 2JEAI 3CCUA 3L0OA 1Q81C 3OYYA 3CPFA 3RNUA 3EN2A 3KDFA 5AJ3L 3KF8B 2Q2TA 3FKIG 1HZBA 4DAYB 1J6QA 1L0WA 1KD1C 1S72A 1X65A 1HR0W 2CWAA 4YCUA 3JC66 1YEZA 4GNXA 1PH3A 4XIGS 2CKZB 4DR5L 1JE5A 3CCQA 1PHJA 3NBHB 1PYBA 1VQ4A 2E2HH 3S2DH 2K75A 3KF6B 4IJLA 5GQOA 3PCOB 4LFAQ 1N32L 1A0IA 2CWPA 4K0KL 4L5QA 5M3MH 3CMEA 4DV0Q 4J15A 1XPRA 2K4KA 4IPCA 3J7A5 5IYBH 4DV5Q 1YNXA 3PUVA 3M7NA 4R4OA 5C44H 2VNUD 2ZJPA 2I0QA 4GNXB 4HIDA 1PYSB 4GKJQ 4DR3L 1Y1VG 1BVSA 1LYLA 2AKWB 3BZCA 4NB3A 1YHQA 1Q46A 3OW2A 1YJWA 2UXBL 1VQEA 1N9WA 1E1TA 1Q1BA 3TRZA 1OXXK 1PH9A 1QZGA 4YCWA 3HOVH 3H0GH 1QVFA 4LF6Q 4JOIC 1J5EQ 4IJHA 2Q2HA 4KHPQ 4A3JG 3S17H 1I50H 3KF6A 3AYHB 2WB1G 2A8VA 4IFDG 3ULLA 1AE2A 2UXCQ 1VQFA 2PI2A 1RL2A 1SN8A 5GAHC 2ZTEA 5GAGC 1FL0A 2D0PA 4JV5L 1WI5A 2F3IA 2HT1A 1MIUA 2A1AA 1E24A 1T9HA 2I5MX 4DR1Q 3RN2A 2E5LL 2UU9L 1EYGA 4PG3A 2JEBI 4PZ6A 2LSSA 3T1HL 1VQ6A 1D7QA 3GTKH 4FDBA 1N34Q 1H95A 1C7YA 3BJUA 1JJ2A 4IFDI 5IYDG 5E7NA 1HNWL 1WCMG 3GO5A 5C4XH 4QL5A 2OTLA 1IZ6A 4UP9A 5IP7H 5GROA 1L2FA 1BBWA 3UE0A 1K83H 3HOUG 1VS0A 3PO2G 2BA1A 3GTQH 3U4VA 1OXTA 4DNIA 3J81c 4KLKA 4LUZA 4X65Q 4GOPB 4JBMA 3RLNA 1VQDA 2K14A 2NN6I 2VL6A 3E0EA 1WCMH 4L5TA 3AFQA 2N3SA 5JEAG 1WOCA 3HFZB 4LF4Q 1KIXA 3M3YH 4DV5L 1K8GA 4MTNA 4TQUS 1SROA 2L15A 3B6YA 3M4PA 1BBUA 1CUKA 3FKIH 1L1OB 1EIYB 4LF5L 2KBNA 3HOWG 1UE1A 4BY7G 4UPAA 1ASZA 1X55A 3D0FA 4A3FG 1N8RC 2E2IH 4L5RC 4TVAB 3TS0A 4BY1H 3FP9A 1TWCH 3MEFA 3GTPH 2OCEA 3S14H 4MNOA 4QGUA 4HIKA 1SR3A 3I4NG 4LW1A 5FLXc 3UE1A 1YJ9A 4A75A 2RF4A 1VQJA 3G71A 2RHSB 5C4JH 2A19A 3K7UC 4KHPL 1O7IA 3H15A 1JJCB 3KYHC 3SGIA 1PV4A 4LF9Q 2OWOA 2F52A 4JBWA 4LUOA 2AMCB 4IO9A 1D8LA 1X3EA 1PH5A 4GNXC 4JBKA 1Z47A 4DV2L 1KC8C 2EQSA 2R7ZG 2WAQE 2ZJQA 5IWAQ 1GVPA 1M1KC 3PF5A 3JAMi 2ZM6L 4DKAC 2VW9A 3CCEA 2MFIA 2NZOA 2KCTA 5EAYA 3W1BA 2XGTA 5BR8L 4KI0A 3CMAA 4QIWE 3KFUA 1I94L 3I4OA 1HZAA 4C3JH 2HQLA 3CW2C 5FLMH 4LF7L 3RZOH 1QVGA 4DR6Q 1NBWA 3OTOQ 3CP0A 1EUJA 2HIXA 1XNQL 4PZ8A 4DV4L 1NMFA 4LWCA 2I5HA 1Q1EA 1CKOA 4JI4Q 1EOVA 2WFWA 3CC4A 4EX5A 4A3BH 4POFA 1K73C 1IXRA 4A3KG 4DR7Q 1I6HH 2VQFL 1N36Q 3HKZE 3S1NH 4LF8L 2I5LX 4B3SL 2Z6KA 1AE3A 4OWTB 4JI5Q 1MKHA 4DR1L 1B8AA 1VQCA 5M5YH 4B3TQ 4JI3Q 1XNRL 4DV0L 3FHWA 4JV5Q 1IBKL 1QUQA 2WB1E 4JI0L 4LFAL 1QZHA 3KOJA 3ER0A 3A5ZB 3CC2A 4C3HH 3CD6A 4JG2A 1PA6A 4BBRH 4JI1L 3PIOA 4NXML 3J80c 1K9MC 3HOZH 2MO1A 1KL9A 4X64L 3CAMA 1L1OA 2HHHL 1R9TH 3I55A 1SFOH 1V1QA 2H5XA 3M4QA 4XTCS 4NPSA 2EIFA 2Y0SE 1N33Q 1VQBA 2GVAA 3PUZA 5C3EH 1VQ5A 4A76A 4DV3L 1YI2A 3RLOA 2JJQA 2CQOA 2RCNA 1LUZA 4DUYQ 1PH2A 1TWHH 1VQPA 4BXXH 1CKNB 4YWMA 5LMNL 3RZDH 4P72A 3PIPA 3I2ZA 1W3SA 1Z9FA 5M5XH 1W2BA 4IOCA 1HNZL 1KQSA 4GLAC 1HJPA 4B3MQ 1PH6A 4QY7A 4DR5Q 2DUDA 2JA9A 2JA5H 1N33L 1X3GA 3KLWA 1YITA 3JAMc 2JK8A 1QVCA 2UXCL 2R7DA 1CSQA 4GOPA 3CCMA 2JQOA 4DR7L 1UE7A 3S15H 1RIPA 1XMOQ 3M4OH 1IBLL 1MJEA 1GM5A 4A3LH 1E3PA 4JCVE 1XPOA 3F8TA 3G4SA 1EFWA 2UXBQ 3PO3H 5C0XG 1PH1A 4AYBG 4ME3A 4JI0Q 4GLVB 3CC7A 2JA6G 1CKMA 2D62A 4JI8Q 1HZ9A 1Y1VH 1X9NA 1PVOA 3GTMH 1A63A 2EXDA 1Y14B 1I5FA 4POGA 4DV6Q 1HNXL 4A3LG 3NENA 3H3VI 4R4TA 2VQEL 2R93H 3GTGH 4LUVA 1M90C 3STBC 1IBLQ 4B3RQ 4LFCL 4LFBL 1X56A 5LMNW 2DGYA 3PUXA 4YHHQ 2HIVA 5JEAJ 1CKNA 1EIFA 2NVTH 1OXVA 3D31A 4OWWB 3DM3A 1PH7A 4X62Q 3T1YL 1CSPA 1L1OC 1LM0A 3F2BA 4ALPA 4H02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KEN A;  4JBJ A;  3PF4 A;  2FXQ A;  2B29 A;  3LGJ A;  2Z0S A;  3K80 C;  1VQ9 A;  2R92 G;  4DV6 L;  1HNX Q;  3ICE A;  5JJL A;  3AQQ A;  1I3Q H;  5J3B A;  1HNZ Q;  3GTL H;  4A3J H;  4HIM A;  4NXN L;  1X6O A;  4QJF A;  2YTY A;  4DR2 Q;  3UDX A;  4DUY L;  5HGQ A;  4YWL A;  3HOV G;  3F2D A;  3A74 A;  1VQO A;  1IBK Q;  2R92 H;  2KCM A;  3KDF B;  4BA2 I;  1TWA H;  5H1S E;  1K0R A;  2YV5 A;  3F2C A;  1FGU A;  3HKZ G;  3K7A H;  4DK6 C;  1IBM L;  1Y1W H;  3HKS A;  2MNA A;  1K8A C;  4X64 Q;  5M3F H;  1WYD A;  4UY8 C;  5FJ8 H;  1KXL A;  5C4X G;  2RHQ B;  2GN5 A;  4JI2 Q;  4Y7N H;  1G6P A;  1OTC A;  4KHZ A;  3H0G G;  4DV4 Q;  2Q2U A;  3BU2 A;  3ULP A;  1S40 A;  5IY0 A;  4A3M G;  1HNW Q;  4DV7 Q;  4LFB Q;  4BBR G;  5M3F G;  4DR2 L;  2YTX A;  2IX0 A;  4JI7 Q;  4B3T L;  3KJO A;  3UDI A;  3ULJ A;  3T1H Q;  2ZTD A;  1XNR Q;  3PUY A;  4AQY Q;  2JA8 G;  4OO1 I;  4JI5 L;  4HJ9 A;  1GO3 E;  4B3S Q;  4HJ7 A;  4DV3 Q;  2UU9 Q;  1UE5 A;  3BZK A;  3TEH B;  4P75 A;  5C0X I;  3K8A A;  5C0X J;  4QQB X;  4BA1 I;  4OXP A;  2NN6 G;  4A3D G;  1TWG H;  3KJP A;  4IPG A;  4BY7 H;  4X6A H;  3NEM A;  4X62 L;  5LMU L;  1GD7 A;  4IFD J;  1JT8 A;  1FVI A;  2NVY H;  2WAQ G;  1U5K A;  4A3I H;  5IYD H;  1UWV A;  1K3R A;  1J5E L;  4NXM Q;  4LF6 L;  4Y52 H;  4APV A;  4A3G H;  1VCI A;  2NVX H;  4A3D H;  2GVB A;  2K50 A;  5M3M G;  1XNQ Q;  1XJV A;  4A3F H;  1NTG A;  2ES2 A;  3OTO L;  4O2D A;  1EWI A;  3I7F A;  3A0J A;  3TQY A;  4OWX B;  1VQA A;  1KHI A;  4R4Q A;  3CCL A;  4LF5 Q;  3PUW A;  2E2J H;  1PH4 A;  1VQK A;  4OX9 L;  3GTO H;  3GTJ H;  4JOI A;  2AWN A;  4K0K Q;  3A5U A;  4RMF A;  3H3V H;  1P8L A;  1Q12 A;  2AHO B;  1LTL A;  4JI6 L;  4JI4 L;  3PGZ A;  2JA7 H;  3GDE A;  2WP8 J;  1HZC A;  1U0L A;  1VQG A;  1V9P A;  3PSI A;  3S1R H;  3I4N H;  2BH8 A;  4X66 Q;  4AH6 A;  2NVQ H;  4LF7 Q;  4DR6 L;  4GN3 B;  2UUA L;  4B3M L;  1XPU A;  2VZA A;  1VQH A;  5IYB G;  3PV0 A;  1YJN A;  3RLF A;  3G6E A;  3DLL A;  2LXK A;  2Y0S G;  2PMZ E;  1G29 1;  3IRB A;  2VS1 A;  1NY4 A;  2PI2 E;  4UP7 A;  1YIJ A;  3G48 A;  2B63 H;  1UE6 A;  3L7Z C;  2VUM H;  4AYB E;  2JE6 I;  2LXJ A;  2PQA B;  4A3K H;  3J81 i;  2IY5 B;  4LF9 L;  4X66 L;  1YBY A;  2K52 A;  3WWV A;  4DUZ Q;  1E22 A;  3TS2 A;  4BBS G;  1C0A A;  3U4Z A;  4A3E G;  4A3M H;  2ALY B;  3AEV A;  2UUA Q;  3AFP A;  2F4V L;  1QUQ B;  4GS3 A;  2VQF Q;  2K5N A;  1N36 L;  1IBM Q;  2QA4 A;  1NJI C;  3MXN B;  1IYJ B;  2UUB Q;  4EQ5 A;  1FJG L;  4A3C G;  3UDG A;  4HJ8 A;  1PH8 A;  5GAE C;  1YHA A;  4JC0 A;  3CF5 A;  4O0A A;  1X3F A;  1G51 A;  3TRE A;  1Q86 C;  3GD7 A;  1HH2 P;  3STB D;  4GKK Q;  4R1J A;  4AIM A;  5C3E G;  1ASY A;  4WJ3 M;  4OX9 Q;  3PO2 H;  2ZTC A;  1P16 A;  3ERS X;  5BR8 Q;  4WJ4 A;  4LF4 L;  2NZH A;  3L2P A;  2MQH A;  5FJ8 G;  3U50 C;  3CCR A;  2YTV A;  2C35 B;  1XMQ L;  2ZM6 Q;  2Z6K C;  4R4C A;  4X65 L;  4GKK L;  1VQM A;  5GAD C;  1MJC A;  4A4I A;  3I4M H;  1A8V A;  2MO0 A;  3J80 i;  4YCV A;  2IHE A;  2D0O A;  2E8G A;  4BXX G;  1Q82 C;  1AH9 A;  3HOW H;  5LMU Q;  2UUB L;  1VQL A;  1FJG Q;  3HOX H;  2R7Z H;  4LFC Q;  3S24 A;  2CFM A;  3S1M H;  1DGS A;  3RR5 A;  1N34 L;  1VQ8 A;  1YZ6 A;  1OXS C;  3I4M G;  2ID0 A;  4P71 A;  1XMQ Q;  1HR0 L;  3HOU H;  1GKH A;  2ASB A;  3VDY A;  2R7F A;  2E5L Q;  2K5V A;  4DUZ L;  3CQZ H;  2IT1 A;  4DR3 Q;  4R4I A;  2R93 G;  4IPH A;  4BY1 G;  4YY3 Q;  4PMW A;  4DV1 L;  4GOP C;  4DV7 L;  5K36 G;  1KAW A;  2N8N A;  3J7Z C;  4A3I G;  4RG1 A;  1IL2 A;  4LNQ A;  3E9H A;  2UXD Q;  1Q7Y C;  2OQK A;  4JI7 L;  1JJG A;  4NXN Q;  2Q2I A;  4JI2 L;  4A3G G;  3W5O A;  1NMG A;  1XTD A;  2N49 A;  3F1Z A;  3J81 j;  1JB7 A;  5DLQ E;  5IP9 G;  5AJ3 Q;  2BA0 A;  2OTJ A;  5JJK A;  2QEX A;  2QGQ A;  1NE3 A;  4JYA L;  2IHF A;  3HOY G;  2VY3 A;  4YWK A;  2B3G A;  2VUM G;  2KHJ A;  1B70 B;  2XTI A;  3CXC A;  2UUC Q;  3NEL A;  1V43 A;  5IP9 H;  1SMX A;  4GN4 B;  4DAM A;  2UXD L;  3CCS A;  3K0X A;  1X54 A;  3HOY H;  3PO3 G;  3ZJY C;  5JJI A;  4A93 G;  3S1Q H;  1VQI A;  1E1O A;  3M85 A;  2JA6 H;  4JI3 L;  1Y1W G;  4HJ5 A;  3UDF A;  5HY6 A;  4JYA Q;  3EBE A;  3I56 A;  1OXU A;  5M5W H;  1HR0 Q;  5FLM G;  3Q8D A;  4OON A;  4YHH L;  2KHI A;  5C44 G;  4A93 H;  1YVC A;  4P73 A;  1XMO L;  3E9I A;  3M9B A;  4JI1 Q;  1YHB A;  4HIO A;  3T1Y Q;  4JI6 Q;  2ZJR A;  2PNH A;  4UP8 A;  2CCZ A;  1VQN A;  2B63 G;  4DK3 C;  4L5S A;  4DR4 Q;  4A3B G;  4HJA A;  1KRS A;  2AWO A;  2K5H A;  4IPD A;  5IP7 G;  4GLX A;  2ATW A;  4BBS H;  4C2M H;  1E7Z A;  2VQE Q;  3W1G A;  1B7Y B;  3CCJ A;  4A3E H;  4DPG A;  1I94 Q;  2YU9 H;  4GKJ L;  4OO1 G;  2BH2 A;  4MZ9 A;  4DR4 L;  3HOZ G;  5ELN A;  4LF8 Q;  1JMC A;  2V1C C;  5IWA L;  4A3C H;  1N32 Q;  5IT9 c;  5IE8 A;  1S3O A;  1SLJ A;  1WJJ A;  3EIV A;  3CCV A;  4DV2 Q;  1A62 A;  2YYZ A;  4GN5 A;  1WFQ A;  5IYC H;  3K81 C;  1TXY A;  1KRT A;  1BKB A;  2JA8 H;  4P74 A;  1VQ7 A;  2JA5 G;  4B3R L;  1TWF H;  2HHH Q;  3S2H H;  2F4V Q;  1PFS A;  4IOA A;  3RN5 A;  4AQY L;  5IYC G;  4JI8 L;  1EQR A;  3S16 H;  1UEB A;  2N78 A;  2UUC L;  4PZ7 A;  1Q8K A;  5ELO A;  2R6G A;  4YY3 L;  4C3I H;  4DV1 Q;  3HOX G;  1SRU A;  2PQA A;  3CPW A;  3U58 A;  2IX1 A;  1SE8 A;  5LMN Q;  2OQ0 A;  1EQQ A;  1C9O A;  2JA7 G;  2JEA I;  3CCU A;  3L0O A;  1Q81 C;  3OYY A;  3CPF A;  3RNU A;  3EN2 A;  3KDF A;  5AJ3 L;  3KF8 B;  2Q2T A;  3FKI G;  1HZB A;  4DAY B;  1J6Q A;  1L0W A;  1KD1 C;  1S72 A;  1X65 A;  1HR0 W;  2CWA A;  4YCU A;  3JC6 6;  1YEZ A;  4GNX A;  1PH3 A;  4XIG S;  2CKZ B;  4DR5 L;  1JE5 A;  3CCQ A;  1PHJ A;  3NBH B;  1PYB A;  1VQ4 A;  2E2H H;  3S2D H;  2K75 A;  3KF6 B;  4IJL A;  5GQO A;  3PCO B;  4LFA Q;  1N32 L;  1A0I A;  2CWP A;  4K0K L;  4L5Q A;  5M3M H;  3CME A;  4DV0 Q;  4J15 A;  1XPR A;  2K4K A;  4IPC A;  3J7A 5;  5IYB H;  4DV5 Q;  1YNX A;  3PUV A;  3M7N A;  4R4O A;  5C44 H;  2VNU D;  2ZJP A;  2I0Q A;  4GNX B;  4HID A;  1PYS B;  4GKJ Q;  4DR3 L;  1Y1V G;  1BVS A;  1LYL A;  2AKW B;  3BZC A;  4NB3 A;  1YHQ A;  1Q46 A;  3OW2 A;  1YJW A;  2UXB L;  1VQE A;  1N9W A;  1E1T A;  1Q1B A;  3TRZ A;  1OXX K;  1PH9 A;  1QZG A;  4YCW A;  3HOV H;  3H0G H;  1QVF A;  4LF6 Q;  4JOI C;  1J5E Q;  4IJH A;  2Q2H A;  4KHP Q;  4A3J G;  3S17 H;  1I50 H;  3KF6 A;  3AYH B;  2WB1 G;  2A8V A;  4IFD G;  3ULL A;  1AE2 A;  2UXC Q;  1VQF A;  2PI2 A;  1RL2 A;  1SN8 A;  5GAH C;  2ZTE A;  5GAG C;  1FL0 A;  2D0P A;  4JV5 L;  1WI5 A;  2F3I A;  2HT1 A;  1MIU A;  2A1A A;  1E24 A;  1T9H A;  2I5M X;  4DR1 Q;  3RN2 A;  2E5L L;  2UU9 L;  1EYG A;  4PG3 A;  2JEB I;  4PZ6 A;  2LSS A;  3T1H L;  1VQ6 A;  1D7Q A;  3GTK H;  4FDB A;  1N34 Q;  1H95 A;  1C7Y A;  3BJU A;  1JJ2 A;  4IFD I;  5IYD G;  5E7N A;  1HNW L;  1WCM G;  3GO5 A;  5C4X H;  4QL5 A;  2OTL A;  1IZ6 A;  4UP9 A;  5IP7 H;  5GRO A;  1L2F A;  1BBW A;  3UE0 A;  1K83 H;  3HOU G;  1VS0 A;  3PO2 G;  2BA1 A;  3GTQ H;  3U4V A;  1OXT A;  4DNI A;  3J81 c;  4KLK A;  4LUZ A;  4X65 Q;  4GOP B;  4JBM A;  3RLN A;  1VQD A;  2K14 A;  2NN6 I;  2VL6 A;  3E0E A;  1WCM H;  4L5T A;  3AFQ A;  2N3S A;  5JEA G;  1WOC A;  3HFZ B;  4LF4 Q;  1KIX A;  3M3Y H;  4DV5 L;  1K8G A;  4MTN A;  4TQU S;  1SRO A;  2L15 A;  3B6Y A;  3M4P A;  1BBU A;  1CUK A;  3FKI H;  1L1O B;  1EIY B;  4LF5 L;  2KBN A;  3HOW G;  1UE1 A;  4BY7 G;  4UPA A;  1ASZ A;  1X55 A;  3D0F A;  4A3F G;  1N8R C;  2E2I H;  4L5R C;  4TVA B;  3TS0 A;  4BY1 H;  3FP9 A;  1TWC H;  3MEF A;  3GTP H;  2OCE A;  3S14 H;  4MNO A;  4QGU A;  4HIK A;  1SR3 A;  3I4N G;  4LW1 A;  5FLX c;  3UE1 A;  1YJ9 A;  4A75 A;  2RF4 A;  1VQJ A;  3G71 A;  2RHS B;  5C4J H;  2A19 A;  3K7U C;  4KHP L;  1O7I A;  3H15 A;  1JJC B;  3KYH C;  3SGI A;  1PV4 A;  4LF9 Q;  2OWO A;  2F52 A;  4JBW A;  4LUO A;  2AMC B;  4IO9 A;  1D8L A;  1X3E A;  1PH5 A;  4GNX C;  4JBK A;  1Z47 A;  4DV2 L;  1KC8 C;  2EQS A;  2R7Z G;  2WAQ E;  2ZJQ A;  5IWA Q;  1GVP A;  1M1K C;  3PF5 A;  3JAM i;  2ZM6 L;  4DKA C;  2VW9 A;  3CCE A;  2MFI A;  2NZO A;  2KCT A;  5EAY A;  3W1B A;  2XGT A;  5BR8 L;  4KI0 A;  3CMA A;  4QIW E;  3KFU A;  1I94 L;  3I4O A;  1HZA A;  4C3J H;  2HQL A;  3CW2 C;  5FLM H;  4LF7 L;  3RZO H;  1QVG A;  4DR6 Q;  1NBW A;  3OTO Q;  3CP0 A;  1EUJ A;  2HIX A;  1XNQ L;  4PZ8 A;  4DV4 L;  1NMF A;  4LWC A;  2I5H A;  1Q1E A;  1CKO A;  4JI4 Q;  1EOV A;  2WFW A;  3CC4 A;  4EX5 A;  4A3B H;  4POF A;  1K73 C;  1IXR A;  4A3K G;  4DR7 Q;  1I6H H;  2VQF L;  1N36 Q;  3HKZ E;  3S1N H;  4LF8 L;  2I5L X;  4B3S L;  2Z6K A;  1AE3 A;  4OWT B;  4JI5 Q;  1MKH A;  4DR1 L;  1B8A A;  1VQC A;  5M5Y H;  4B3T Q;  4JI3 Q;  1XNR L;  4DV0 L;  3FHW A;  4JV5 Q;  1IBK L;  1QUQ A;  2WB1 E;  4JI0 L;  4LFA L;  1QZH A;  3KOJ A;  3ER0 A;  3A5Z B;  3CC2 A;  4C3H H;  3CD6 A;  4JG2 A;  1PA6 A;  4BBR H;  4JI1 L;  3PIO A;  4NXM L;  3J80 c;  1K9M C;  3HOZ H;  2MO1 A;  1KL9 A;  4X64 L;  3CAM A;  1L1O A;  2HHH L;  1R9T H;  3I55 A;  1SFO H;  1V1Q A;  2H5X A;  3M4Q A;  4XTC S;  4NPS A;  2EIF A;  2Y0S E;  1N33 Q;  1VQB A;  2GVA A;  3PUZ A;  5C3E H;  1VQ5 A;  4A76 A;  4DV3 L;  1YI2 A;  3RLO A;  2JJQ A;  2CQO A;  2RCN A;  1LUZ A;  4DUY Q;  1PH2 A;  1TWH H;  1VQP A;  4BXX H;  1CKN B;  4YWM A;  5LMN L;  3RZD H;  4P72 A;  3PIP A;  3I2Z A;  1W3S A;  1Z9F A;  5M5X H;  1W2B A;  4IOC A;  1HNZ L;  1KQS A;  4GLA C;  1HJP A;  4B3M Q;  1PH6 A;  4QY7 A;  4DR5 Q;  2DUD A;  2JA9 A;  2JA5 H;  1N33 L;  1X3G A;  3KLW A;  1YIT A;  3JAM c;  2JK8 A;  1QVC A;  2UXC L;  2R7D A;  1CSQ A;  4GOP A;  3CCM A;  2JQO A;  4DR7 L;  1UE7 A;  3S15 H;  1RIP A;  1XMO Q;  3M4O H;  1IBL L;  1MJE A;  1GM5 A;  4A3L H;  1E3P A;  4JCV E;  1XPO A;  3F8T A;  3G4S A;  1EFW A;  2UXB Q;  3PO3 H;  5C0X G;  1PH1 A;  4AYB G;  4ME3 A;  4JI0 Q;  4GLV B;  3CC7 A;  2JA6 G;  1CKM A;  2D62 A;  4JI8 Q;  1HZ9 A;  1Y1V H;  1X9N A;  1PVO A;  3GTM H;  1A63 A;  2EXD A;  1Y14 B;  1I5F A;  4POG A;  4DV6 Q;  1HNX L;  4A3L G;  3NEN A;  3H3V I;  4R4T A;  2VQE L;  2R93 H;  3GTG H;  4LUV A;  1M90 C;  3STB C;  1IBL Q;  4B3R Q;  4LFC L;  4LFB L;  1X56 A;  5LMN W;  2DGY A;  3PUX A;  4YHH Q;  2HIV A;  5JEA J;  1CKN A;  1EIF A;  2NVT H;  1OXV A;  3D31 A;  4OWW B;  3DM3 A;  1PH7 A;  4X62 Q;  3T1Y L;  1CSP A;  1L1O C;  1LM0 A;  3F2B A;  4ALP A;  4H02 A; 
#chains in the Genus database with same CATH topology
 2KEN A;  2NTS A;  4JBJ A;  1RD9 D;  5EKL A;  3LGJ A;  2Z0S A;  3K80 C;  3P75 A;  3PF4 A;  1HNX Q;  3M3Y B;  1EWH A;  3AQQ A;  5J3B A;  1HNZ Q;  2L9H A;  5KEE A;  4HIM A;  3TP7 A;  2FFK B;  3NTK A;  3T56 B;  2YTY A;  4DUY L;  1JIC A;  4IUQ A;  1EIG A;  3D6W A;  4DK1 A;  5HUR A;  2CW0 C;  1IBM L;  1Y1W H;  3D3R A;  4K8I A;  4X64 Q;  1WYD A;  2EZV A;  1H9M A;  1KXL A;  1SMY C;  1HHV A;  4Y7N H;  4A3E B;  4KHZ A;  3BU2 A;  3ULP A;  4N9P A;  1HNW Q;  5M3F G;  4DR2 L;  4IFD H;  3GTL B;  1UAP A;  3UDI A;  1DZ1 A;  3PUY A;  3MA2 B;  4HJ9 A;  2SDF A;  4HJ7 A;  2O5I C;  3TEH B;  3E0J A;  1RF2 D;  3HZX A;  1ENA A;  2V4D A;  1WTO A;  5C0X H;  1FVI A;  1HUM A;  2WAQ G;  1PZJ D;  4A3I H;  1K3R A;  2FHT A;  1IKL A;  4APV A;  4A3G H;  1VCI A;  2B2V A;  4A3F H;  1KTK A;  1HQR D;  3MVV A;  2E2D C;  2F0Q A;  1PRT D;  1VMC A;  4R4Q A;  4B9W A;  2E2J H;  4OX9 L;  3FVQ A;  3PQI A;  2F0U A;  3A5U A;  4RMF A;  4G57 A;  2WB1 B;  4JI6 L;  5E4X A;  1RCV D;  4LJZ C;  2WP8 J;  3S1R H;  3PSI A;  2NTT A;  1EFI D;  3CKI B;  2BH8 A;  4G4K A;  4CKC A;  3CQZ B;  4IUU A;  2VZA A;  2G5D A;  5IYB G;  4LMQ D;  3U9O A;  2CW0 D;  2LXK A;  2PMZ E;  2Y0S G;  2VS1 A;  3J7A V;  1NY4 A;  4OIK A;  4BY1 B;  4UP7 A;  2EE1 A;  2IPK D;  3G48 A;  2B63 H;  3EJI A;  4XYO A;  3L7Z C;  1WTQ A;  4AYB E;  2JE6 I;  2PQA B;  1S5E D;  3J81 i;  3U4Z A;  4A3M H;  3AEV A;  1J8I A;  3KLS X;  2F4V L;  1QUQ B;  4FNF A;  1RKN A;  2RVL A;  3OIP A;  3NWS A;  2RQX A;  1WTP A;  2OEO A;  3OIQ A;  2DY8 A;  1FD7 D;  1Q86 C;  2A69 C;  5C3E G;  1ASY A;  4WJ3 M;  4OX9 Q;  3PO2 H;  1P16 A;  1MSG A;  4WJ4 A;  3V2T A;  3L2P A;  5FJ8 G;  2C35 B;  3UI2 A;  4R4C A;  4GKK L;  2N88 A;  1K28 A;  1A8V A;  3FPP A;  2MO0 A;  5LMU Q;  3PIO 3;  2R7Z H;  2EY5 A;  1ZEQ X;  3A8I E;  1HR0 L;  3HOU H;  2E5L Q;  2K5V A;  1X3P A;  2XWJ B;  2R3Z A;  1Q8I A;  3CQZ H;  1TII D;  4Z9C B;  4DR3 Q;  1TR5 A;  4R4I A;  4IPH A;  3TBI B;  4YY3 Q;  4DV1 L;  4DV7 L;  2JA6 B;  1T5E A;  3J7Z C;  3J7A F;  1DD2 A;  3I90 A;  2OQK A;  5M5X B;  3W5O A;  1NMG A;  3F1Z A;  5C5L A;  1GUT A;  2BDN A;  3SR1 A;  2O2L D;  5AJ3 Q;  2BA0 A;  2OTJ A;  3GV6 A;  5JJK A;  2QEX A;  5KND A;  2QGQ A;  4JYA L;  3HOY G;  1A15 A;  1I4G A;  3NSW A;  3HRZ C;  4MTK A;  5IP9 H;  4HMI A;  1ICF B;  1SMX A;  2F0D A;  4GN4 B;  2C5C A;  4KN4 C;  4RFB A;  3PO3 G;  3ZJY C;  5LL6 S;  3Q23 A;  2A68 D;  2HQE A;  3M85 A;  3S1Q H;  5JOB A;  1K3B C;  2E2I B;  3DM1 A;  3T16 A;  5KNB A;  2XRQ D;  3S1N B;  1YVC A;  1YHB A;  2CH4 A;  3ERO A;  4PNY A;  4DK3 C;  1STH A;  1Y1V B;  4DR4 Q;  4A3B G;  3QIA A;  4HJA A;  1CA5 A;  2K5H A;  2AWO A;  4IPD A;  5IP7 G;  4GLX A;  4BBS H;  4A3E H;  1B7Y B;  1I94 Q;  2YU9 H;  4MZ9 A;  1I50 B;  4KY5 A;  3S9W A;  2D5D A;  1TY2 A;  2FMC A;  1NUC A;  1A62 A;  3DXJ C;  1B9N A;  1SYC A;  3OWE B;  1FNW A;  2IJ0 A;  1BKB A;  4P74 A;  4B3R L;  2JA5 G;  1TWF H;  1EL0 A;  2I46 A;  4H13 C;  5C4Z A;  3RN5 A;  5IYC G;  1TY0 A;  2F0K A;  4JI8 L;  1MHW C;  3JAM L;  2H1E A;  4BS9 A;  1HA5 A;  1UEB A;  1JR0 D;  4CHT B;  2DJF C;  4N9T A;  2R6G A;  1BR9 A;  4ZQ3 A;  1V1P A;  2KCN A;  1SJE D;  2PQA A;  2IX1 A;  1LLR D;  3J7Y W;  1SNQ A;  1H9S A;  3OWF A;  4N8X 1;  3KDF A;  5AJ3 L;  2Q2T A;  3KLS A;  3DHQ A;  1KD1 C;  1S5C D;  1HR0 W;  1EWC A;  1DOL A;  1PH3 A;  1MD2 D;  5DNF A;  3X3N A;  4XIG S;  4DR5 L;  1JE5 A;  3BYT B;  4IJL A;  1HPC A;  5ELC A;  2XRS D;  4K0K L;  2PYK A;  4DV0 Q;  3CME A;  5D3I B;  4J15 A;  4UDU C;  5C4J B;  3J7A 5;  2JN4 A;  1O7L A;  4N8F A;  1HTP A;  5TSS A;  5C44 H;  1OO9 B;  1CFM A;  3IFD A;  4UHV A;  2AKW B;  1YJW A;  2IWH A;  1Q1B A;  2KCC A;  1CQV A;  2RDH A;  4FP5 D;  5C44 B;  1ZYR C;  1J5E Q;  2QIL A;  3A56 A;  3T51 B;  2BE5 D;  1L0Y B;  2IX3 A;  1O7Y A;  1WTX A;  3S17 H;  3AYH B;  4IFD G;  2UXC Q;  1RL2 A;  2EPB A;  1FL0 A;  2D0P A;  4JV5 L;  3AMU A;  2F3I A;  2A1A A;  4DR1 Q;  1T9H A;  2UU9 L;  2E5L L;  4PZ6 A;  4ZUJ A;  1C7Y A;  3BJU A;  1JJ2 A;  1PTO H;  4IFD I;  5E7N A;  4ID6 A;  5G3L D;  5C4X H;  2OTL A;  1B44 D;  4HN7 A;  1EY5 A;  2ZXO A;  1K83 H;  4UAI A;  3PO2 G;  3GTQ H;  4KLK A;  3RLN A;  1VQD A;  2K14 A;  2QDB A;  2VL6 A;  3WWV A;  1O7Z A;  2XIW A;  1WOC A;  4LF4 Q;  2E75 C;  2EYM A;  1LTI D;  1AZQ A;  1Q3L A;  3B6Y A;  1CUK A;  2JA8 B;  1L1O B;  4ILW A;  1Z6H A;  1UE1 A;  1ASZ A;  1X55 A;  3D0F A;  5D14 A;  4BY1 H;  2ZXR A;  3FP9 A;  3GTP H;  1IYU A;  2EXZ A;  3UE1 A;  1EY4 A;  2RHS B;  4KTA A;  2A19 A;  3L3O C;  1JJC B;  3BYY B;  2O4X A;  1SYF A;  4LF9 Q;  4JBW A;  2RCF A;  1KNE A;  1X3E A;  5CR3 A;  4C3I G;  3J80 L;  1BDO A;  2EQS A;  2NVT B;  5L37 A;  4PV1 C;  3R8B A;  2FIN B;  1PFN A;  3LWU A;  4RHS A;  2ZM6 L;  3TN2 A;  4ZK9 B;  4FF1 A;  1XTC D;  4KY7 A;  2KED A;  3W1B A;  4QIW E;  1ML0 D;  3KFU A;  4IZ8 A;  1I94 L;  1FGB D;  4JK1 C;  1XXG A;  4LF7 L;  3CW2 C;  4DR6 Q;  1QVG A;  4OEM B;  2HIX A;  1XNQ L;  2ZT9 C;  4PZ8 A;  2VB3 X;  4JI4 Q;  2WFW A;  1K73 C;  1TKW B;  4A3K G;  4KK7 A;  4DR7 Q;  2VQF L;  1I6H H;  1JOQ A;  3S1N H;  2VB2 X;  5IGD A;  4B3S L;  4OO1 H;  4CKB A;  1MKH A;  1TS2 A;  3SE0 A;  4DR1 L;  1B8A A;  1VQC A;  1XNR L;  4DV0 L;  3FHW A;  1R4P B;  1QUQ A;  1SYG A;  2A68 C;  1AFP A;  1QZH A;  1KNA A;  3A5Z B;  1BQQ T;  3IAY A;  3I91 A;  2X69 A;  1ESF A;  4S3S A;  3J80 c;  3CAM A;  2YU9 B;  1L1O A;  1R9T H;  1SFO H;  1V1Q A;  1TU2 B;  1SXT A;  3NQT A;  3M4Q A;  4XTC S;  4NPS A;  3MAQ A;  1GHK A;  1VQ5 A;  3VA5 A;  4DUY Q;  1LUZ A;  4BXX H;  1MBY A;  1VQP A;  1DYQ A;  3I2Z A;  2A74 C;  2H4O A;  4IOC A;  5JAV A;  3MXN A;  3BG3 A;  4NKL A;  1F9R A;  2JA5 H;  2VUM B;  4KMU C;  4QMG A;  1GUN A;  2F1M A;  1QVC A;  2UXC L;  2R7D A;  1I3Q B;  2JQO A;  1CHQ D;  4DR7 L;  4ZCK A;  1RIP A;  2L11 A;  3KUP A;  4OHJ A;  5NUC A;  4JCV E;  1XPO A;  1EY7 A;  3PO3 H;  4AYB G;  3K5N A;  4FF3 A;  3S1R B;  2IL8 A;  2D62 A;  4WFN 3;  1X9N A;  1Y1V H;  2R93 B;  2EXD A;  1Y14 B;  4POG A;  4DV6 Q;  3NEN A;  5JJZ A;  2R93 H;  3OPO A;  1M90 C;  3STB C;  4LFC L;  1X56 A;  5LMN W;  1RTO A;  2LS0 1;  4YHH Q;  2HIV A;  1BBX C;  1CKN A;  1EIF A;  3D31 A;  1PH7 A;  1EY0 A;  2EYF A;  3QOJ A;  3F2B A;  1I4R A;  4H02 A;  4V19 0;  2QKI C;  2B29 A;  2R92 G;  5A35 A;  4JPB W;  4A3J H;  1LTB D;  1X6O A;  4ZKB B;  3A55 A;  1WD1 A;  3C2P A;  1II3 A;  4OIJ A;  1PYW D;  2K01 A;  1K0R A;  1TWH B;  2YV5 A;  3HGB A;  3AB9 A;  2MNA A;  1K8A C;  5JVG 3;  1ENF A;  5IGG A;  4QB4 A;  1G6P A;  1OTC A;  2DNC A;  4BBS B;  1S40 A;  5IY0 A;  1BCP F;  2M9V A;  4BBR G;  4ABN A;  2IX0 A;  4JI7 Q;  2JYO A;  5JEA H;  1XNR Q;  2ZTD A;  2JA8 G;  1NR4 A;  3GTJ B;  1GO3 E;  2B2Y C;  5ELE A;  4ZKC B;  5C0X I;  1DON A;  5C0X J;  1SEB D;  4OXP A;  5CBE E;  2NN6 G;  3HG9 A;  1LT5 D;  2AQ1 B;  3QWN A;  3KJP A;  4IPG A;  4A3D G;  3NEM A;  3WOE A;  5KYI A;  2KA7 A;  5IYD H;  1J5E L;  4LF6 L;  2EYH A;  3PIP 3;  4RAU C;  2GVB A;  1XJV A;  4KJO A;  2ES2 A;  2A69 D;  3OTO L;  4O2D A;  1D6E C;  4OWX B;  2TMP A;  2HCC A;  3P7J A;  1HA6 A;  3GTO H;  1VQK A;  4JOI A;  2AWN A;  2CQA A;  4K0K Q;  1ET6 A;  1P8L A;  3SDZ A;  1CM9 A;  4JI4 L;  3AU7 A;  3PGZ A;  1HFG A;  3GDE A;  2EJM A;  3S14 B;  2NVQ H;  4BWG B;  2D9U A;  4A3D B;  2F0V A;  1AP0 A;  1LTR D;  3PV0 A;  1EY6 A;  3RLF A;  1SYB A;  3G6E A;  1C48 A;  2EY6 A;  1H9R A;  2PCF B;  2PI2 E;  2Z8L A;  4IAL A;  1K83 B;  4A3K H;  2B8G A;  4NMZ A;  1YBY A;  1GUS A;  5EJW A;  5I9O A;  3AFP A;  1FNU A;  2VQF Q;  2QA4 A;  1NJI C;  2RSN A;  1IYJ B;  2UUB Q;  3NP8 A;  3P1H A;  4A3C G;  1H9J A;  3ND9 A;  3CF5 A;  4JC0 A;  1X3F A;  1G51 A;  1T5X D;  3G7L A;  3TRE A;  3V05 A;  1HH2 P;  1R9T B;  4AIM A;  1X32 A;  1G6Z A;  3ERS X;  1XMQ L;  3J81 L;  3CCR A;  1LO5 D;  2YTV A;  2F3W A;  2XN9 C;  3S1M B;  4MN3 A;  2Z6K C;  2EOT A;  1VQM A;  5AFW A;  5GAD C;  2JA5 B;  4P2C B;  4BXX G;  1Q82 C;  4KN7 C;  3F2U A;  1FJG Q;  1VQL A;  4L6T B;  1FR3 A;  2CFM A;  3BVG A;  1LTT D;  3S1M H;  1VQ8 A;  2HUG A;  1RDP D;  1F9S A;  2Q8R E;  4P71 A;  1XMQ Q;  1GKH A;  1LT3 D;  2ASB A;  3VDY A;  1F2Z A;  4BY7 B;  4HCE A;  5COR A;  4PMW A;  4F8M A;  1KAW A;  3S1Q B;  1JC7 A;  1STY A;  4WJW A;  3OW7 A;  1JB7 A;  3BVZ A;  3TP5 A;  1KLG D;  2B2W A;  1HCZ A;  4Y7N B;  5CMD A;  2IHF A;  4YWK A;  1B70 B;  2XTI A;  2LMC B;  3NEL A;  1ROD A;  3D4D A;  5LL6 X;  1O80 A;  2PZU A;  2UXD L;  4PQX A;  3I8Z A;  3CCS A;  1DM0 B;  3HOY H;  1ILP A;  4DA2 A;  3QOL A;  1E1O A;  4H44 C;  1TWC B;  2R61 A;  4JI3 L;  4CGY B;  5A2Q L;  3VYU A;  1BCP B;  2K6A A;  4JYA Q;  2LKV A;  3N6R A;  3EBE A;  3R2T A;  3I56 A;  4A3J B;  4RCO A;  4C3J G;  4OON A;  1I6V C;  2KHI A;  1JB3 A;  1XMO L;  4JI6 Q;  5D3D A;  4HIO A;  5M9O A;  2PNH A;  2CVR A;  1KRS A;  2ATW A;  3J80 E;  1E7Z A;  3N52 A;  3W1G A;  2VQE Q;  3CCJ A;  3MHB A;  1D5Z C;  1EOT A;  3HOZ G;  5ELN A;  4LF8 Q;  4OEL B;  4ZRZ A;  4EVO A;  2RDF A;  1ONL A;  5IT9 c;  5IE8 A;  1S3O A;  1SLJ A;  3EIV A;  2TSS A;  2EYL A;  4RHR A;  1WFQ A;  2DJG C;  3K6O A;  4KY6 A;  1U4L A;  3K81 C;  2QDL A;  1KRT A;  2F0P A;  1EIH A;  2JA8 H;  3S2H H;  3NBH A;  1VF5 C;  3QR8 A;  4M8A A;  5J1Z A;  3OMC A;  1QNU A;  3P20 A;  4K2L A;  2UUC L;  4PZ7 A;  5ELO A;  3U58 A;  3HOX G;  1SRU A;  3CPW A;  3W3A A;  4MIU A;  2OQ0 A;  1A2T A;  1EQQ A;  2JA7 G;  2JEA I;  3OYY A;  4CDE C;  3KF8 B;  2F0E A;  1JE4 A;  3FKI G;  4DAY B;  4HSV A;  1L0W A;  1S72 A;  2CWA A;  1S5B D;  4YCU A;  3JC6 6;  1Q90 A;  3GTM B;  1RJT A;  2NYZ D;  3CCQ A;  1PHJ A;  3NBH B;  1PYB A;  1VQ4 A;  2E2H H;  1PRT C;  1SMY D;  1N32 L;  2CWP A;  3GV3 A;  1PTO B;  5I9P A;  1XPR A;  4IPC A;  3PUV A;  1STN A;  4GNX B;  4GKJ Q;  1LYL A;  3BZC A;  3OW2 A;  1VQE A;  1N9W A;  1OXX K;  3HOU B;  1QZG A;  3HOV H;  1XYI A;  3H3V C;  1E2Z A;  4LF6 Q;  4IJH A;  2Q2H A;  4KHP Q;  1WCM B;  1PFM A;  1XX8 A;  1I50 H;  1BF4 A;  2WB1 G;  4RKL A;  1AE2 A;  3CRK C;  1CT1 D;  1F2M A;  1SN8 A;  2ZTE A;  3S2D B;  1SJH D;  1VMP A;  1WI5 A;  1D1K A;  3C1E A;  1STE A;  4WRD A;  1E24 A;  3RN2 A;  3I3C A;  4K5X A;  1SFO B;  4PG3 A;  3T1H L;  1D7Q A;  1VQ6 A;  1H95 A;  3A54 A;  4FDB A;  3QG1 A;  5M3M B;  5IYD G;  1K8M A;  4QL5 A;  1PDQ A;  2XVS A;  1A6X A;  1BBW A;  4RKB A;  3UE0 A;  2EY1 A;  2BA1 A;  2WIN B;  4JBM A;  4LUZ A;  4GOP B;  5M5Y B;  1SE4 A;  4L5T A;  2BOS A;  2BE5 C;  1KIX A;  1QE6 A;  5FK9 C;  1CA6 A;  1EIY B;  4LF5 L;  1JCK B;  2B2W C;  1D1I A;  1MGS A;  2E2I H;  4L5R C;  3TS0 A;  4ZLT F;  3S14 H;  1ENC A;  2HDL A;  1SR3 A;  4LW1 A;  5FLX c;  2F0H A;  3G71 A;  2DY7 A;  3NQI A;  5C4J H;  4KHP L;  1O7I A;  4DAP A;  3H15 A;  1EQT A;  2DNE A;  3NK9 A;  4K2K A;  1CZW A;  3VR2 A;  5J22 A;  3GTK B;  2OWO A;  1PH5 A;  4DV2 L;  3SVM A;  1GVP A;  4DKA C;  3OOC A;  2RDG A;  2PQE A;  4KJN A;  5BR8 L;  1PRT F;  3CMA A;  1ZYR D;  3I4O A;  5FLM H;  2F0M A;  4C2M B;  1NBW A;  3OTO Q;  5K36 H;  3CP0 A;  1U4P A;  5EBD A;  4DV4 L;  4LWC A;  2I5H A;  4RGO S;  1CKO A;  1B4O A;  1BCP D;  4EX5 A;  4EQN A;  1IXR A;  3E5S A;  3ND8 A;  3DWP A;  1AE3 A;  5EBC A;  3VYT A;  4DFA A;  1S5D D;  5M5Y H;  4JV5 Q;  1IBK L;  4LFA L;  1B53 A;  1AEX A;  1AN8 A;  2SEB D;  2L0C A;  3ER0 A;  5JPM C;  1EYA A;  3CC2 A;  3BDL A;  4XT3 B;  1JOO A;  3CD6 A;  4JI1 L;  2F0F A;  4NXM L;  2F0L A;  2OF1 A;  3FRP B;  3FPU B;  2MO1 A;  1KL9 A;  4X64 L;  4CDF C;  2BCO A;  1DJR D;  2K33 A;  1CZG A;  2JP1 A;  4I65 A;  1LTA D;  1PLF A;  2CHB D;  2EIF A;  2Y0S E;  1CHP D;  4FF4 A;  2KOL A;  5C3E H;  3NPP A;  2CQO A;  2RCN A;  5FLX E;  3RZD H;  2KQ3 A;  4HMJ A;  3PIP A;  1A2U A;  1Z9F A;  5M5X H;  1W2B A;  3S2H B;  2C9O A;  1HJP A;  1PH6 A;  2AUK A;  2K5Q A;  4QY7 A;  2JA9 A;  4IUN A;  1EU3 A;  2JK8 A;  4K14 A;  1CSQ A;  3RZD B;  2MJ8 A;  2J4X A;  4NW2 A;  3SHL A;  5E3F A;  2KUM A;  3T4A C;  5EPL A;  1XMO Q;  1SNO A;  4G7O C;  1MJE A;  3NWT A;  1GM5 A;  5IGE A;  4A3L H;  1E3P A;  2I07 B;  1UUP A;  1C8C A;  2E2H B;  1TQO A;  4GLV B;  4JI8 Q;  3X3M A;  1A63 A;  3GTM H;  3V96 A;  1EY9 A;  4IUR A;  3VR4 A;  3H3V I;  4ZUI A;  3C46 A;  2B2U A;  4B3R Q;  1TVX A;  4O1N A;  4A3K B;  5JEA J;  3VYS A;  3DM3 A;  5ELB A;  3T1Y L;  4QIW B;  5KIX A;  4ALP A;  4GOP A;  4UY8 C;  3S16 B;  2F0J A;  2K03 A;  3ICE A;  3CHB D;  5BN5 A;  5IGC A;  4XT1 B;  4DV6 L;  3GTL H;  1AW7 A;  3HS0 C;  3QO2 A;  3HOX B;  4NXN L;  3HOV B;  1TWF B;  4QJF A;  4DR2 Q;  4FXG C;  4TRD A;  5HGQ A;  4LAA A;  3F2D A;  3HOV G;  1VQO A;  4X3K A;  2R92 H;  3HEJ A;  3KDF B;  1TWA H;  5H1S E;  3F2C A;  3HKZ G;  3VR3 A;  5FJ8 H;  3DEO A;  3H0G G;  2ICE C;  2F0T A;  3DUZ A;  3ITP A;  3R93 A;  2L5T A;  4DV7 Q;  4LFB Q;  2F0O A;  2YTX A;  3T1H Q;  4OO1 I;  4JI5 L;  4O42 A;  4B3S Q;  2EYO A;  2UU9 Q;  1UE5 A;  3BZK A;  2F0N A;  4XYQ A;  1TWG H;  4BY7 H;  1GD7 A;  4IFD J;  2NVY H;  1U5K A;  3I70 A;  4ZAI A;  1UWV A;  4G7Z C;  4C3J B;  2KJX A;  3NUC A;  2NVX H;  2NN6 H;  4A3D H;  3OHX C;  1XNQ Q;  1D2B A;  4DU9 A;  3I7F A;  3TQY A;  1I4X A;  3CCL A;  3PUW A;  1PH4 A;  4QCL A;  2NWG A;  1ZXT A;  3H3V H;  1QCB D;  1Q12 A;  2AHO B;  1ICW A;  1BXT A;  1U0L A;  1VQG A;  1V9P A;  1XWE A;  5G3L F;  2XWB B;  2IW3 A;  2A6E D;  4LF7 Q;  4DR6 L;  4QUF A;  5BN4 A;  2UUA L;  3A8K E;  1XPU A;  4A3G B;  1YJN A;  4HCS A;  3WDN A;  4MHE A;  3BVM A;  4A3I B;  2ICI A;  3IRB A;  2F0I A;  3SK6 A;  1SYE A;  3NXW A;  3Q22 A;  1EEF D;  1UE6 A;  2VUM H;  4LF9 L;  1C0A A;  1GJX A;  4BBS G;  3MXP A;  3GP7 A;  2HD3 A;  4A3E G;  2ALY B;  5ISR A;  2UUA Q;  4GS3 A;  5CV8 A;  1CTM A;  2K5N A;  1IBM Q;  1WD0 A;  3BDC A;  3MXN B;  2PW5 A;  2XSC A;  3UDG A;  3A8J E;  1QIL A;  5GAE C;  2JA7 B;  4O0A A;  3STB D;  4GKK Q;  2ZTC A;  5BR8 Q;  3NHH A;  4LF4 L;  2MQH A;  2LY7 A;  3U50 C;  2ZM6 Q;  4X65 L;  3U9S A;  4C3I B;  1MJC A;  4A4I A;  3I4M H;  3M4Y A;  3J80 i;  2XNA C;  2IHE A;  1AH9 A;  4C3H G;  3HOW H;  2L4N A;  1B9M A;  4LFC Q;  1NR2 A;  1RTN A;  4QUC A;  3MC0 B;  1LT4 D;  1EQV A;  1I4Q A;  5C6A A;  2K5D A;  4CBV A;  3JAM E;  2ID0 A;  1GUO A;  5JVH 3;  2R7F A;  4DUZ L;  2IT1 A;  3TP8 A;  3HOW B;  4BY1 G;  4FF2 A;  1TS5 A;  4GOP C;  5K36 G;  2N8N A;  5EKK A;  4A3I G;  3T13 A;  4AYB B;  5FOB B;  1STA A;  4B08 A;  1Q7Y C;  5EPK A;  1HXY D;  2K5W A;  1IL8 A;  2Q2I A;  4A3G G;  2N49 A;  5LHY 1;  1SSO A;  3GQB A;  3J81 j;  4RCN A;  2MP1 A;  5KGU A;  3I4L A;  3PO2 B;  2EY2 A;  1O78 A;  2A6H D;  5KYL A;  1YNJ D;  4J8Q A;  2N55 A;  1B50 A;  1NE3 A;  2Z4H A;  2MUY A;  2VY3 A;  2EJG C;  3URY A;  1YNN D;  2UUC Q;  4DAM A;  1JQY D;  3K0X A;  2O5J C;  5JJI A;  4A93 G;  2JA6 H;  1Y1W G;  3D6C A;  4RGN A;  5M5W H;  3MZ5 A;  1W6K A;  1NAP A;  1F9Q A;  4E6I A;  2ZXP A;  5CBA E;  3Q8D A;  2SOB A;  4YHH L;  5EGT A;  1S5F D;  2WAQ B;  4FXD A;  4P73 A;  4JI1 Q;  4NXM Q;  1V8Q A;  2A73 B;  4UP8 A;  3C3L A;  1LT6 D;  3K5O A;  1VQN A;  2B63 G;  4U68 A;  3BZD B;  4LK1 C;  3KBX A;  4GKJ L;  4DPG A;  5T1G A;  3RUZ A;  4OO1 G;  2GA4 B;  2Q8T A;  4DR4 L;  4BBR B;  1SE2 A;  2V1C C;  5EPJ A;  1N32 Q;  4NDX A;  3H0G B;  4HED A;  1HRJ A;  2NVY B;  2F3V A;  4FXK C;  4DV2 Q;  2YYZ A;  4GN5 A;  3VR6 A;  2K28 A;  5ELD A;  1VQ7 A;  1H9S B;  1PTO F;  1C4Q A;  2F4V Q;  4F88 A;  1PFS A;  4IUT A;  1LTG D;  1I6H B;  1GOZ A;  4AQY L;  1EQR A;  2Z1C A;  4B9X A;  4C3I H;  4YY3 L;  4DV1 Q;  4CJ0 B;  1SE8 A;  5T1I A;  1C9O A;  1EYD A;  3LWE A;  3L0O A;  5FO8 B;  3CCU A;  4CDC C;  1Q81 C;  3EFX D;  3RNU A;  3EN2 A;  1HZB A;  1J6Q A;  1X65 A;  3MXG A;  1U4M A;  1YEZ A;  1W6J A;  2CKZ B;  3K5M A;  3KBG A;  4DNR B;  4FYD A;  3KF6 B;  5GQO A;  2EVB A;  2A6H C;  3PCO B;  1LV9 A;  4A3F B;  1A0I A;  3DWQ A;  5CV5 A;  4L5Q A;  5M3M H;  2K4K A;  5IYB H;  4DV5 Q;  3M7N A;  4R4O A;  1TS3 A;  2I0Q A;  1A3U A;  1PYS B;  1TS4 A;  4DR3 L;  3LNN A;  1Y1V G;  1G2T A;  4NB3 A;  5I6W A;  1Q46 A;  4CDD C;  3A7L A;  1PFB A;  5CC4 A;  3SK5 A;  3TRZ A;  4YCW A;  5CV6 A;  1B3A A;  3H0G H;  3QJY A;  4FVM A;  2NBF A;  1MSH A;  4A3J G;  3KF6 A;  1VQF A;  4IUP A;  1JWU D;  4DAY A;  5FLX L;  3KF8 A;  4K8J A;  1TWG B;  3PO3 B;  1QWY A;  2I5M X;  3RZO B;  1EYG A;  2LSS A;  1N34 Q;  1HNW L;  1WCM G;  2F03 A;  1IZ6 A;  3CRL C;  4UP9 A;  1H9K A;  2X6L A;  3K58 A;  5IP7 H;  5E1F A;  5K5P A;  3HOU G;  2JXM B;  1VS0 A;  1OXT A;  2QCP X;  5JEA G;  3E0E A;  3AFQ A;  3M3Y H;  3FEW X;  4DV5 L;  4U67 3;  4MTN A;  4TQU S;  1SRO A;  2L15 A;  3M4P A;  3FKI H;  3HOW G;  2NB0 A;  5CYU A;  3R2I A;  3ERQ A;  4TVA B;  2WKD A;  3MEF A;  2OCE A;  3NBI A;  1PZI D;  4IQZ A;  4HIK A;  2D2C C;  1KDC A;  1YJ9 A;  4A75 A;  1VQJ A;  1E0B A;  1EEI D;  4R8I A;  1LAC A;  3SGI A;  1BNZ A;  3HKZ B;  2AMC B;  2K05 A;  4IO9 A;  1JWS D;  3CU7 A;  4GNX C;  1WTW A;  4JBK A;  2AUJ D;  1KC8 C;  2ZJQ A;  4HAE A;  3MTS A;  4X3S A;  5CV4 A;  3SK8 A;  3NTI A;  1PXU A;  3JAM i;  3FDT A;  3CCE A;  2XGT A;  2LFN A;  4R9W A;  4JVZ A;  5A2Q E;  1HZA A;  4TKO B;  2HQL A;  5I4D A;  3RZO H;  2R7Z B;  2R92 B;  2Q8I B;  3GTP B;  1NMF A;  3FMC A;  1SYD A;  1CI3 M;  1Q1E A;  4CJ1 B;  1KLU D;  4A3B H;  1N36 Q;  4K5V A;  3H91 A;  3OMG A;  2I5L X;  2WV6 D;  4PMC A;  2Z6K A;  4L8J A;  4OWT B;  1WTV A;  3E6Z X;  4B3T Q;  1EU4 A;  4IN3 A;  1SE3 A;  4C3H H;  4BBR H;  3PIO A;  4KV6 A;  2E2J B;  1KAB A;  3I72 A;  2H5X A;  2B39 A;  4QF4 A;  1N33 Q;  1VQB A;  3PUZ A;  3Q0A A;  1QJO A;  3RLO A;  5DEH A;  1Y1W B;  1PH2 A;  4A93 B;  5E4W C;  1STG A;  4RA8 A;  4P72 A;  1BUV T;  3WOF A;  1HNZ L;  1NCV A;  5I2X A;  1G2S A;  1KQS A;  4GLA C;  4B3M Q;  3Q24 A;  4DR5 Q;  4C1N I;  1N33 L;  1X3G A;  3KLW A;  4TSS A;  1YIT A;  3HOY B;  1F9P A;  1GHJ A;  3CCM A;  1UE7 A;  3S15 H;  1IBL L;  3K5L A;  4F87 A;  1QG7 A;  5EQ0 A;  2UXB Q;  5C0X G;  4ME3 A;  1M4V A;  2JA6 G;  3CC7 A;  4X3U A;  1HZ9 A;  1I5F A;  1HNX L;  4A3L G;  4R4T A;  2VQE L;  5COY A;  4LUV A;  1IBL Q;  4LFB L;  2DGY A;  3PUX A;  4Q0F A;  4X3T A;  2F4I A;  5IOD A;  1OXV A;  4X62 Q;  1CSP A;  1L1O C;  1GXD C;  1K0S A;  1SBB B;  2FXQ A;  1VQ9 A;  4KKU A;  5JJL A;  2EYP A;  1I3Q H;  4CKE A;  2L12 A;  4ZYS A;  5HGT A;  3Q6S A;  4OL7 A;  3UDX A;  5C3E B;  1LTS D;  4YWL A;  3A74 A;  1IBK Q;  2KCM A;  1X3Q A;  4XQN A;  4BA2 I;  1FGU A;  1SAP A;  3ZYY X;  3K7A H;  4DK6 C;  1AZP A;  4C56 C;  3HKS A;  1UNS A;  3SK4 A;  5M3F H;  1IW7 C;  5C4X G;  2RHQ B;  2GN5 A;  4HSP A;  2J0T D;  4JI2 Q;  3TP6 A;  1PMR A;  4DV4 Q;  2Q2U A;  4A3M G;  4RGM A;  5KRU A;  3HOZ B;  3L9A X;  4B3T L;  3KJO A;  3ULJ A;  3OSO A;  4AQY Q;  2Y0S B;  5DM6 3;  3MWY W;  4DV3 Q;  4P75 A;  4QQB X;  3K8A A;  1LAB A;  4BA1 I;  4ODG A;  4X6A H;  4X62 L;  5LMU L;  2K1B A;  1SDF A;  1JT8 A;  2M00 A;  1EZ6 A;  1Y8O B;  4Y52 H;  1Z7T A;  1BCP C;  2K50 A;  5M3M G;  3RMH A;  1ZKO A;  1NTG A;  2Z4I A;  3C1F A;  3IFT A;  1G91 A;  1S4Z A;  1EWI A;  3A0J A;  2B2T C;  3D8G A;  1VQA A;  1KHI A;  4LF5 Q;  5IGB A;  4DK0 A;  3GTJ H;  1LTL A;  2KEC A;  2B2T A;  4H7B A;  2JA7 H;  5FKA C;  1HZC A;  2OXP A;  2WAC A;  4EQP A;  3I4N H;  1EZ8 A;  4X66 Q;  4AH6 A;  2M2L A;  4R8N A;  4GN3 B;  4DF7 A;  4B3M L;  1VQH A;  1FYC A;  1HTL D;  4FO2 A;  1TWA B;  3DLL A;  1G29 1;  4KHV A;  1ILQ A;  1IYV A;  1I4H A;  2RSO A;  1YIJ A;  2LXJ A;  1NSN S;  2VXW A;  2IY5 B;  3TS2 A;  4XQQ A;  4X66 L;  2K52 A;  4DUZ Q;  3I4M B;  1E22 A;  2P5Z X;  4KKT A;  1JWM D;  1N36 L;  3QB3 A;  1B2T A;  2QF7 A;  2B2Y A;  4C3H B;  2K32 A;  4EQ5 A;  1FJG L;  4NP5 A;  4I7A A;  4HJ8 A;  1PH8 A;  1DOK A;  1YHA A;  2A5H A;  1YNJ C;  1F77 A;  3GD7 A;  4CJ2 C;  4R1J A;  3VR5 A;  1QOH A;  5I6Y A;  4IUV A;  1I4P A;  1GUW A;  2NZH A;  2K7V A;  5KNC A;  1HQM C;  4YCV A;  2D0O A;  2E8G A;  3KK7 A;  1ESR A;  2UUB L;  2PW7 A;  3HOX H;  4WOR A;  2NVX B;  3S24 A;  1DGS A;  1G8Z D;  3RR5 A;  1N34 L;  3E3X A;  3S15 B;  1YZ6 A;  1OXS C;  3I4M G;  1BO0 A;  1Y8N B;  2G9D A;  5IT9 E;  2R93 G;  1M8A A;  2EDG A;  3K57 A;  5C5M A;  4RG1 A;  1IL2 A;  4LNQ A;  3E9H A;  2UXD Q;  4F7X A;  4JI7 L;  1JJG A;  4NXN Q;  1K8O A;  4DGZ A;  4JI2 L;  2OT2 A;  1XTD A;  1SNP A;  5DLQ E;  2RA4 A;  3H94 A;  2K04 A;  3M7G A;  1R4Q B;  5IP9 G;  5IIF A;  1D5X C;  1QB5 D;  2E76 C;  2B3G A;  3SXH A;  2VUM G;  2KHJ A;  3CXC A;  1U4R A;  1E2W A;  1V43 A;  3MFY A;  2QEJ C;  1QNK A;  1L0X B;  4C1N K;  1X54 A;  2PO4 A;  1VQI A;  1J9O A;  2EJF C;  4HJ5 A;  3UDF A;  5HY6 A;  1OXU A;  1HR0 Q;  1B3Q A;  5FLM G;  3SEB A;  5C44 G;  4DXG A;  5CV7 A;  4A93 H;  4EGV A;  1E2V A;  2B2V C;  3E9I A;  3M9B A;  3T1Y Q;  1TT2 A;  2F0S A;  3O13 A;  2ZJR A;  2CCZ A;  2AQ3 B;  2RKS A;  4L5S A;  2MHV A;  2QW7 A;  4C2M H;  1GUG A;  1MI2 A;  2BH2 A;  2FMM A;  5FO7 B;  4L63 B;  3EA6 A;  1JMC A;  4JW0 A;  1DCZ A;  4A3M B;  5IWA L;  4A3C H;  3DMU A;  1PRT B;  1WJJ A;  3A7A B;  4G7H C;  3DEP A;  3CCV A;  4RGT A;  5IYC H;  1TXY A;  2PNR C;  5BN3 A;  3FKI B;  3DWA A;  2HHH Q;  3D4R A;  5DM7 3;  2G9H D;  5IT9 L;  4DN4 M;  4IOA A;  3T53 B;  2B2U C;  2BDO A;  3TSS A;  1IHZ A;  4J6H A;  3S16 H;  2NVQ B;  2DN8 A;  2N78 A;  2NUC A;  1Q8K A;  3J81 E;  4ME5 A;  5LMN Q;  3MXU A;  3CPF A;  1ET9 A;  1YNN C;  1Y69 U;  3D4W A;  4GNX A;  3I73 A;  5J39 A;  3I4N B;  3S2D H;  2K75 A;  4LFA Q;  4XXE A;  2NZ1 D;  1YNX A;  3K7A B;  5F2D A;  2VNU D;  2ZJP A;  4KKS A;  4HID A;  2Z9H A;  3NTH A;  4A3B B;  1SND A;  1BVS A;  1VDZ A;  1Y8P B;  5M5W B;  1YHQ A;  2B63 B;  2UXB L;  2KEE A;  1E1T A;  1PH9 A;  5CGK A;  1QVF A;  3TZD A;  4JOI C;  1D5M C;  1KDA A;  2A8V A;  3ULL A;  3ONA B;  1JOR A;  2PI2 A;  5GAH C;  5GAG C;  3W2D A;  1B1Z A;  1MIU A;  1NNX A;  2HT1 A;  1U9R A;  4KD3 A;  5IOC A;  3EVQ A;  1FNV A;  2JEB I;  1IW7 D;  2MGS A;  3GTK H;  4M1U B;  4K6D A;  4RWS C;  2F0W A;  3GO5 A;  5EKI A;  5C4H A;  5FO9 B;  2FJ2 A;  4KD4 A;  4H0L C;  5GRO A;  3BDO A;  1L2F A;  3MFG A;  1VF7 A;  1KAA A;  3H6M A;  2WKC A;  3U4V A;  2L55 A;  3G6J B;  4DNI A;  4X65 Q;  2KVM A;  3J81 c;  3LX0 A;  3G4S A;  3M4O H;  2NN6 I;  3S17 B;  1WCM H;  3IKJ A;  2N3S A;  5I2Y A;  3HFZ B;  3VYR A;  1K8G A;  1BBU A;  4PMB A;  5D65 A;  1HFN A;  2X6G A;  2KBN A;  3KLR A;  4V0B A;  4BY7 G;  4UPA A;  2SNM A;  3M4O B;  4A3F G;  1N8R C;  1TWC H;  4MNO A;  2CH4 W;  4QGU A;  3TME A;  1F2Y A;  3I4N G;  3GTG B;  2RF4 A;  4XDX A;  5C4X B;  4OGQ C;  3K7U C;  3KYH C;  2AQ2 B;  2F0G A;  4RH6 A;  1V1O A;  1PV4 A;  2A6E C;  2F52 A;  4LUO A;  1D8L A;  2Z6B A;  1Z47 A;  2R7Z G;  2SNS A;  2WAQ E;  1SNM A;  1DOM A;  1PTO D;  5IWA Q;  1M1K C;  3PF5 A;  3K59 A;  3NE5 B;  2VW9 A;  2MFI A;  4HTH A;  2NZO A;  1A3T A;  2KCT A;  5EAY A;  4KI0 A;  3MEH A;  1WVL A;  4C3J H;  3TZU A;  2PZW A;  3PMF A;  4DAV A;  5C3W A;  1EUJ A;  1BOS A;  2PMZ B;  4I7Z C;  2HCI A;  3HP3 A;  3R3O A;  1EOV A;  3CC4 A;  4POF A;  3HKZ E;  4LF8 L;  1UEA B;  4K5W A;  4JI5 Q;  5ELF A;  4JI3 Q;  4JI0 L;  2WB1 E;  2JSO A;  2KHS A;  3KOJ A;  1RHP A;  2EYJ A;  5IGF A;  2WII B;  4JG2 A;  1PA6 A;  1STB A;  3HOZ H;  1K9M C;  4DXF A;  1CQF A;  1WTR A;  2HHH L;  3GTO B;  1PTO C;  4HR7 B;  3I55 A;  1PZK D;  4J1M A;  3BS1 A;  2GVA A;  3RD4 A;  4A76 A;  4DV3 L;  5DAU A;  1YI2 A;  2JJQ A;  1DXM A;  4DNT B;  4EQO A;  1TWH H;  1CKN B;  2HDM A;  4YWM A;  5LMN L;  1W3S A;  3EQL C;  2PPB C;  3GTQ B;  3K0Y A;  1CK1 A;  4GZY C;  2DUD A;  3VA7 A;  3JAM c;  1KDB A;  4Q5V A;  1SNC A;  2E74 C;  1EY8 A;  5C3X A;  1HUN A;  1V1P B;  1JOK A;  5CV9 A;  2PZT A;  1EYC A;  3H09 A;  4K6L A;  1F2L A;  1WTH A;  3F8T A;  1EFW A;  2ENB A;  3TDQ A;  1PH1 A;  4JI0 Q;  4ULL A;  1CKM A;  2B8F A;  5JPN C;  1PVO A;  2L1B A;  5M3F B;  3IL8 A;  3GTG H;  2MPM A;  4XQJ A;  1A3V A;  2NVT H;  1IKM A;  2J7Z A;  4OWW B;  4YIJ A;  1LM0 A;  2RBM A; 
#chains in the Genus database with same CATH homology
 2KEN A;  4JBJ A;  3PF4 A;  2FXQ A;  2B29 A;  3LGJ A;  2Z0S A;  3K80 C;  1VQ9 A;  2R92 G;  4DV6 L;  1HNX Q;  3ICE A;  5JJL A;  3AQQ A;  1I3Q H;  5J3B A;  1HNZ Q;  3GTL H;  4A3J H;  4HIM A;  4NXN L;  1X6O A;  4QJF A;  2YTY A;  4DR2 Q;  3UDX A;  4DUY L;  5HGQ A;  4YWL A;  3HOV G;  3F2D A;  3A74 A;  1VQO A;  1IBK Q;  2R92 H;  2KCM A;  3KDF B;  4BA2 I;  1TWA H;  5H1S E;  1K0R A;  2YV5 A;  3F2C A;  1FGU A;  3HKZ G;  3K7A H;  4DK6 C;  1IBM L;  1Y1W H;  3HKS A;  2MNA A;  1K8A C;  4X64 Q;  5M3F H;  1WYD A;  4UY8 C;  5FJ8 H;  1KXL A;  5C4X G;  2RHQ B;  2GN5 A;  4JI2 Q;  4Y7N H;  1G6P A;  1OTC A;  4KHZ A;  3H0G G;  4DV4 Q;  2Q2U A;  3BU2 A;  3ULP A;  1S40 A;  5IY0 A;  4A3M G;  1HNW Q;  4DV7 Q;  4LFB Q;  4BBR G;  5M3F G;  4DR2 L;  2YTX A;  2IX0 A;  4JI7 Q;  4B3T L;  3KJO A;  3UDI A;  3ULJ A;  3T1H Q;  2ZTD A;  1XNR Q;  3PUY A;  4AQY Q;  2JA8 G;  4OO1 I;  4JI5 L;  4HJ9 A;  1GO3 E;  4B3S Q;  4HJ7 A;  4DV3 Q;  2UU9 Q;  1UE5 A;  3BZK A;  3TEH B;  4P75 A;  5C0X I;  3K8A A;  5C0X J;  4QQB X;  4BA1 I;  4OXP A;  2NN6 G;  4A3D G;  1TWG H;  3KJP A;  4IPG A;  4BY7 H;  4X6A H;  3NEM A;  4X62 L;  5LMU L;  1GD7 A;  4IFD J;  1JT8 A;  1FVI A;  2NVY H;  2WAQ G;  1U5K A;  4A3I H;  5IYD H;  1UWV A;  1K3R A;  1J5E L;  4NXM Q;  4LF6 L;  4Y52 H;  4APV A;  4A3G H;  1VCI A;  2NVX H;  4A3D H;  2GVB A;  2K50 A;  5M3M G;  1XNQ Q;  1XJV A;  4A3F H;  1NTG A;  2ES2 A;  3OTO L;  4O2D A;  1EWI A;  3I7F A;  3A0J A;  3TQY A;  4OWX B;  1VQA A;  1KHI A;  4R4Q A;  3CCL A;  4LF5 Q;  3PUW A;  2E2J H;  1PH4 A;  1VQK A;  4OX9 L;  3GTO H;  3GTJ H;  4JOI A;  2AWN A;  4K0K Q;  3A5U A;  4RMF A;  3H3V H;  1P8L A;  1Q12 A;  2AHO B;  1LTL A;  4JI6 L;  4JI4 L;  3PGZ A;  2JA7 H;  3GDE A;  2WP8 J;  1HZC A;  1U0L A;  1VQG A;  1V9P A;  3PSI A;  3S1R H;  3I4N H;  2BH8 A;  4X66 Q;  4AH6 A;  2NVQ H;  4LF7 Q;  4DR6 L;  4GN3 B;  2UUA L;  4B3M L;  1XPU A;  2VZA A;  1VQH A;  5IYB G;  3PV0 A;  1YJN A;  3RLF A;  3G6E A;  3DLL A;  2LXK A;  2Y0S G;  2PMZ E;  1G29 1;  3IRB A;  2VS1 A;  1NY4 A;  2PI2 E;  4UP7 A;  1YIJ A;  3G48 A;  2B63 H;  1UE6 A;  3L7Z C;  2VUM H;  4AYB E;  2JE6 I;  2LXJ A;  2PQA B;  4A3K H;  3J81 i;  2IY5 B;  4LF9 L;  4X66 L;  1YBY A;  2K52 A;  3WWV A;  4DUZ Q;  1E22 A;  3TS2 A;  4BBS G;  1C0A A;  3U4Z A;  4A3E G;  4A3M H;  2ALY B;  3AEV A;  2UUA Q;  3AFP A;  2F4V L;  1QUQ B;  4GS3 A;  2VQF Q;  2K5N A;  1N36 L;  1IBM Q;  2QA4 A;  1NJI C;  3MXN B;  1IYJ B;  2UUB Q;  4EQ5 A;  1FJG L;  4A3C G;  3UDG A;  4HJ8 A;  1PH8 A;  5GAE C;  1YHA A;  4JC0 A;  3CF5 A;  4O0A A;  1X3F A;  1G51 A;  3TRE A;  1Q86 C;  3GD7 A;  1HH2 P;  3STB D;  4GKK Q;  4R1J A;  4AIM A;  5C3E G;  1ASY A;  4WJ3 M;  4OX9 Q;  3PO2 H;  2ZTC A;  1P16 A;  3ERS X;  5BR8 Q;  4WJ4 A;  4LF4 L;  2NZH A;  3L2P A;  2MQH A;  5FJ8 G;  3U50 C;  3CCR A;  2YTV A;  2C35 B;  1XMQ L;  2ZM6 Q;  2Z6K C;  4R4C A;  4X65 L;  4GKK L;  1VQM A;  5GAD C;  1MJC A;  4A4I A;  3I4M H;  1A8V A;  2MO0 A;  3J80 i;  4YCV A;  2IHE A;  2D0O A;  2E8G A;  4BXX G;  1Q82 C;  1AH9 A;  3HOW H;  5LMU Q;  2UUB L;  1VQL A;  1FJG Q;  3HOX H;  2R7Z H;  4LFC Q;  3S24 A;  2CFM A;  3S1M H;  1DGS A;  3RR5 A;  1N34 L;  1VQ8 A;  1YZ6 A;  1OXS C;  3I4M G;  2ID0 A;  4P71 A;  1XMQ Q;  1HR0 L;  3HOU H;  1GKH A;  2ASB A;  3VDY A;  2R7F A;  2E5L Q;  2K5V A;  4DUZ L;  3CQZ H;  2IT1 A;  4DR3 Q;  4R4I A;  2R93 G;  4IPH A;  4BY1 G;  4YY3 Q;  4PMW A;  4DV1 L;  4GOP C;  4DV7 L;  5K36 G;  1KAW A;  2N8N A;  3J7Z C;  4A3I G;  4RG1 A;  1IL2 A;  4LNQ A;  3E9H A;  2UXD Q;  1Q7Y C;  2OQK A;  4JI7 L;  1JJG A;  4NXN Q;  2Q2I A;  4JI2 L;  4A3G G;  3W5O A;  1NMG A;  1XTD A;  2N49 A;  3F1Z A;  3J81 j;  1JB7 A;  5DLQ E;  5IP9 G;  5AJ3 Q;  2BA0 A;  2OTJ A;  5JJK A;  2QEX A;  2QGQ A;  1NE3 A;  4JYA L;  2IHF A;  3HOY G;  2VY3 A;  4YWK A;  2B3G A;  2VUM G;  2KHJ A;  1B70 B;  2XTI A;  3CXC A;  2UUC Q;  3NEL A;  1V43 A;  5IP9 H;  1SMX A;  4GN4 B;  4DAM A;  2UXD L;  3CCS A;  3K0X A;  1X54 A;  3HOY H;  3PO3 G;  3ZJY C;  5JJI A;  4A93 G;  3S1Q H;  1VQI A;  1E1O A;  3M85 A;  2JA6 H;  4JI3 L;  1Y1W G;  4HJ5 A;  3UDF A;  5HY6 A;  4JYA Q;  3EBE A;  3I56 A;  1OXU A;  5M5W H;  1HR0 Q;  5FLM G;  3Q8D A;  4OON A;  4YHH L;  2KHI A;  5C44 G;  4A93 H;  1YVC A;  4P73 A;  1XMO L;  3E9I A;  3M9B A;  4JI1 Q;  1YHB A;  4HIO A;  3T1Y Q;  4JI6 Q;  2ZJR A;  2PNH A;  4UP8 A;  2CCZ A;  1VQN A;  2B63 G;  4DK3 C;  4L5S A;  4DR4 Q;  4A3B G;  4HJA A;  1KRS A;  2AWO A;  2K5H A;  4IPD A;  5IP7 G;  4GLX A;  2ATW A;  4BBS H;  4C2M H;  1E7Z A;  2VQE Q;  3W1G A;  1B7Y B;  3CCJ A;  4A3E H;  4DPG A;  1I94 Q;  2YU9 H;  4GKJ L;  4OO1 G;  2BH2 A;  4MZ9 A;  4DR4 L;  3HOZ G;  5ELN A;  4LF8 Q;  1JMC A;  2V1C C;  5IWA L;  4A3C H;  1N32 Q;  5IT9 c;  5IE8 A;  1S3O A;  1SLJ A;  1WJJ A;  3EIV A;  3CCV A;  4DV2 Q;  1A62 A;  2YYZ A;  4GN5 A;  1WFQ A;  5IYC H;  3K81 C;  1TXY A;  1KRT A;  1BKB A;  2JA8 H;  4P74 A;  1VQ7 A;  2JA5 G;  4B3R L;  1TWF H;  2HHH Q;  3S2H H;  2F4V Q;  1PFS A;  4IOA A;  3RN5 A;  4AQY L;  5IYC G;  4JI8 L;  1EQR A;  3S16 H;  1UEB A;  2N78 A;  2UUC L;  4PZ7 A;  1Q8K A;  5ELO A;  2R6G A;  4YY3 L;  4C3I H;  4DV1 Q;  3HOX G;  1SRU A;  2PQA A;  3CPW A;  3U58 A;  2IX1 A;  1SE8 A;  5LMN Q;  2OQ0 A;  1EQQ A;  1C9O A;  2JA7 G;  2JEA I;  3CCU A;  3L0O A;  1Q81 C;  3OYY A;  3CPF A;  3RNU A;  3EN2 A;  3KDF A;  5AJ3 L;  3KF8 B;  2Q2T A;  3FKI G;  1HZB A;  4DAY B;  1J6Q A;  1L0W A;  1KD1 C;  1S72 A;  1X65 A;  1HR0 W;  2CWA A;  4YCU A;  3JC6 6;  1YEZ A;  4GNX A;  1PH3 A;  4XIG S;  2CKZ B;  4DR5 L;  1JE5 A;  3CCQ A;  1PHJ A;  3NBH B;  1PYB A;  1VQ4 A;  2E2H H;  3S2D H;  2K75 A;  3KF6 B;  4IJL A;  5GQO A;  3PCO B;  4LFA Q;  1N32 L;  1A0I A;  2CWP A;  4K0K L;  4L5Q A;  5M3M H;  3CME A;  4DV0 Q;  4J15 A;  1XPR A;  2K4K A;  4IPC A;  3J7A 5;  5IYB H;  4DV5 Q;  1YNX A;  3PUV A;  3M7N A;  4R4O A;  5C44 H;  2VNU D;  2ZJP A;  2I0Q A;  4GNX B;  4HID A;  1PYS B;  4GKJ Q;  4DR3 L;  1Y1V G;  1BVS A;  1LYL A;  2AKW B;  3BZC A;  4NB3 A;  1YHQ A;  1Q46 A;  3OW2 A;  1YJW A;  2UXB L;  1VQE A;  1N9W A;  1E1T A;  1Q1B A;  3TRZ A;  1OXX K;  1PH9 A;  1QZG A;  4YCW A;  3HOV H;  3H0G H;  1QVF A;  4LF6 Q;  4JOI C;  1J5E Q;  4IJH A;  2Q2H A;  4KHP Q;  4A3J G;  3S17 H;  1I50 H;  3KF6 A;  3AYH B;  2WB1 G;  2A8V A;  4IFD G;  3ULL A;  1AE2 A;  2UXC Q;  1VQF A;  2PI2 A;  1RL2 A;  1SN8 A;  5GAH C;  2ZTE A;  5GAG C;  1FL0 A;  2D0P A;  4JV5 L;  1WI5 A;  2F3I A;  2HT1 A;  1MIU A;  2A1A A;  1E24 A;  1T9H A;  2I5M X;  4DR1 Q;  3RN2 A;  2E5L L;  2UU9 L;  1EYG A;  4PG3 A;  2JEB I;  4PZ6 A;  2LSS A;  3T1H L;  1VQ6 A;  1D7Q A;  3GTK H;  4FDB A;  1N34 Q;  1H95 A;  1C7Y A;  3BJU A;  1JJ2 A;  4IFD I;  5IYD G;  5E7N A;  1HNW L;  1WCM G;  3GO5 A;  5C4X H;  4QL5 A;  2OTL A;  1IZ6 A;  4UP9 A;  5IP7 H;  5GRO A;  1L2F A;  1BBW A;  3UE0 A;  1K83 H;  3HOU G;  1VS0 A;  3PO2 G;  2BA1 A;  3GTQ H;  3U4V A;  1OXT A;  4DNI A;  3J81 c;  4KLK A;  4LUZ A;  4X65 Q;  4GOP B;  4JBM A;  3RLN A;  1VQD A;  2K14 A;  2NN6 I;  2VL6 A;  3E0E A;  1WCM H;  4L5T A;  3AFQ A;  2N3S A;  5JEA G;  1WOC A;  3HFZ B;  4LF4 Q;  1KIX A;  3M3Y H;  4DV5 L;  1K8G A;  4MTN A;  4TQU S;  1SRO A;  2L15 A;  3B6Y A;  3M4P A;  1BBU A;  1CUK A;  3FKI H;  1L1O B;  1EIY B;  4LF5 L;  2KBN A;  3HOW G;  1UE1 A;  4BY7 G;  4UPA A;  1ASZ A;  1X55 A;  3D0F A;  4A3F G;  1N8R C;  2E2I H;  4L5R C;  4TVA B;  3TS0 A;  4BY1 H;  3FP9 A;  1TWC H;  3MEF A;  3GTP H;  2OCE A;  3S14 H;  4MNO A;  4QGU A;  4HIK A;  1SR3 A;  3I4N G;  4LW1 A;  5FLX c;  3UE1 A;  1YJ9 A;  4A75 A;  2RF4 A;  1VQJ A;  3G71 A;  2RHS B;  5C4J H;  2A19 A;  3K7U C;  4KHP L;  1O7I A;  3H15 A;  1JJC B;  3KYH C;  3SGI A;  1PV4 A;  4LF9 Q;  2OWO A;  2F52 A;  4JBW A;  4LUO A;  2AMC B;  4IO9 A;  1D8L A;  1X3E A;  1PH5 A;  4GNX C;  4JBK A;  1Z47 A;  4DV2 L;  1KC8 C;  2EQS A;  2R7Z G;  2WAQ E;  2ZJQ A;  5IWA Q;  1GVP A;  1M1K C;  3PF5 A;  3JAM i;  2ZM6 L;  4DKA C;  2VW9 A;  3CCE A;  2MFI A;  2NZO A;  2KCT A;  5EAY A;  3W1B A;  2XGT A;  5BR8 L;  4KI0 A;  3CMA A;  4QIW E;  3KFU A;  1I94 L;  3I4O A;  1HZA A;  4C3J H;  2HQL A;  3CW2 C;  5FLM H;  4LF7 L;  3RZO H;  1QVG A;  4DR6 Q;  1NBW A;  3OTO Q;  3CP0 A;  1EUJ A;  2HIX A;  1XNQ L;  4PZ8 A;  4DV4 L;  1NMF A;  4LWC A;  2I5H A;  1Q1E A;  1CKO A;  4JI4 Q;  1EOV A;  2WFW A;  3CC4 A;  4EX5 A;  4A3B H;  4POF A;  1K73 C;  1IXR A;  4A3K G;  4DR7 Q;  1I6H H;  2VQF L;  1N36 Q;  3HKZ E;  3S1N H;  4LF8 L;  2I5L X;  4B3S L;  2Z6K A;  1AE3 A;  4OWT B;  4JI5 Q;  1MKH A;  4DR1 L;  1B8A A;  1VQC A;  5M5Y H;  4B3T Q;  4JI3 Q;  1XNR L;  4DV0 L;  3FHW A;  4JV5 Q;  1IBK L;  1QUQ A;  2WB1 E;  4JI0 L;  4LFA L;  1QZH A;  3KOJ A;  3ER0 A;  3A5Z B;  3CC2 A;  4C3H H;  3CD6 A;  4JG2 A;  1PA6 A;  4BBR H;  4JI1 L;  3PIO A;  4NXM L;  3J80 c;  1K9M C;  3HOZ H;  2MO1 A;  1KL9 A;  4X64 L;  3CAM A;  1L1O A;  2HHH L;  1R9T H;  3I55 A;  1SFO H;  1V1Q A;  2H5X A;  3M4Q A;  4XTC S;  4NPS A;  2EIF A;  2Y0S E;  1N33 Q;  1VQB A;  2GVA A;  3PUZ A;  5C3E H;  1VQ5 A;  4A76 A;  4DV3 L;  1YI2 A;  3RLO A;  2JJQ A;  2CQO A;  2RCN A;  1LUZ A;  4DUY Q;  1PH2 A;  1TWH H;  1VQP A;  4BXX H;  1CKN B;  4YWM A;  5LMN L;  3RZD H;  4P72 A;  3PIP A;  3I2Z A;  1W3S A;  1Z9F A;  5M5X H;  1W2B A;  4IOC A;  1HNZ L;  1KQS A;  4GLA C;  1HJP A;  4B3M Q;  1PH6 A;  4QY7 A;  4DR5 Q;  2DUD A;  2JA9 A;  2JA5 H;  1N33 L;  1X3G A;  3KLW A;  1YIT A;  3JAM c;  2JK8 A;  1QVC A;  2UXC L;  2R7D A;  1CSQ A;  4GOP A;  3CCM A;  2JQO A;  4DR7 L;  1UE7 A;  3S15 H;  1RIP A;  1XMO Q;  3M4O H;  1IBL L;  1MJE A;  1GM5 A;  4A3L H;  1E3P A;  4JCV E;  1XPO A;  3F8T A;  3G4S A;  1EFW A;  2UXB Q;  3PO3 H;  5C0X G;  1PH1 A;  4AYB G;  4ME3 A;  4JI0 Q;  4GLV B;  3CC7 A;  2JA6 G;  1CKM A;  2D62 A;  4JI8 Q;  1HZ9 A;  1Y1V H;  1X9N A;  1PVO A;  3GTM H;  1A63 A;  2EXD A;  1Y14 B;  1I5F A;  4POG A;  4DV6 Q;  1HNX L;  4A3L G;  3NEN A;  3H3V I;  4R4T A;  2VQE L;  2R93 H;  3GTG H;  4LUV A;  1M90 C;  3STB C;  1IBL Q;  4B3R Q;  4LFC L;  4LFB L;  1X56 A;  5LMN W;  2DGY A;  3PUX A;  4YHH Q;  2HIV A;  5JEA J;  1CKN A;  1EIF A;  2NVT H;  1OXV A;  3D31 A;  4OWW B;  3DM3 A;  1PH7 A;  4X62 Q;  3T1Y L;  1CSP A;  1L1O C;  1LM0 A;  3F2B A;  4ALP A;  4H02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...