4DV4L

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 16
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv4L00
2HT1A 4MNOA 2A19A 3VDYA 4YWLA 5M5WH 1IBMQ 3ERSX 3STBD 3U4ZA 3A5UA 1VQ7A 4IPHA 4GLAC 4A3MG 3S1NH 2VUMG 1PH5A 1PVOA 1K8AC 1B7YB 1CKMA 5H1SE 5M3MH 4IPGA 4P73A 1Q81C 4POFA 4DAYB 3I55A 5C3EG 3GTGH 5C0XG 3GD7A 3A74A 4QY7A 4DV4Q 3HOWH 4JI8Q 4JI6Q 2JA5H 4UY8C 2RCNA 4R4OA 1AE2A 3HKZG 1L0WA 1VQJA 4R4IA 1YIJA 3HOUG 3I56A 1ASZA 2KCTA 3ZJYC 2ZTEA 4IFDG 1K83H 3KDFB 3PCOB 4P75A 2BH8A 1C7YA 5FJ8G 5JEAG 1HNZL 1HNZQ 1VQ8A 2HQLA 3F8TA 3G4SA 1N33L 1N33Q 1Y1VH 1EQQA 4JI2L 4DNIA 2OTLA 3I7FA 4BA2I 4A3JH 4L5SA 2QGQA 1PH6A 1E7ZA 3ULPA 1JJCB 2IX1A 1JT8A 2ZM6L 2ZM6Q 2D0OA 2XGTA 5IYDG 4BY1H 4LF6Q 2PNHA 4LF6L 2ALYB 4JV5Q 4JV5L 2UUCL 3GDEA 2F52A 1HZ9A 3J80i 1QZGA 3I4MG 4JYAL 4B3TL 3RR5A 3PUYA 1J5EQ 1DGSA 5IYCG 4B3SQ 1VQAA 4L5TA 2F3IA 1X55A 2UUAL 1YI2A 1OXVA 4EQ5A 2VW9A 4EX5A 2GVBA 3CPWA 3S1MH 1UE7A 1X3EA 4QJFA 2FXQA 3RLFA 4DUYL 4DV2L 4DV2Q 5C0XI 3I4NH 3FKIG 2IT1A 4IJHA 4AIMA 1VQ9A 1VQFA 2CQOA 3UE1A 2VL6A 5GAHC 3H15A 2D0PA 4NXNQ 5IY0A 1HJPA 1HNXQ 1HNXL 2OCEA 4LF9L 4LF9Q 2HIVA 1P8LA 3W1GA 2NVXH 1V9PA 4AYBG 3PO2H 4A3DG 4DV5L 1PFSA 4DR4L 2HIXA 4DR4Q 2JA8H 4BXXH 2UXDQ 3AFPA 1SMXA 4IFDI 5LMNQ 3J81c 1X3FA 3ULJA 3HFZB 4L5RC 3S2HH 1Z47A 4C2MH 2NVYH 2OWOA 1OXUA 4HIOA 5GQOA 3BU2A 3A5ZB 4A76A 1LM0A 2Z0SA 5BR8Q 5BR8L 1VQIA 1VQKA 3MEFA 3M3YH 5J3BA 2YTYA 4R4TA 4GNXB 4LFCL 2ID0A 1OTCA 3U50C 4LF4Q 1VCIA 1WI5A 3PGZA 1GKHA 4YHHL 1Y1WH 5FLXc 4ALPA 4GS3A 2KENA 3AQQA 3NEMA 3F2DA 2NZHA 4LWCA 1X56A 3GTPH 2OTJA 1A62A 4LUZA 3CP0A 3OTOL 1G51A 1WFQA 3CQZH 1JE5A 2ZTDA 3OTOQ 4HJ9A 2R7ZH 5K36G 2ZJRA 3E9IA 2VUMH 3GTLH 3L0OA 1Q46A 4POGA 1NJIC 4WJ4A 3EN2A 4O0AA 4X62Q 2JA7G 4X66L 4X66Q 3CC7A 3KJOA 4JBJA 3JAMc 1RIPA 4A75A 2E5LQ 4JI7Q 5GAGC 1I94Q 3MXNB 4UP7A 1Q82C 3I2ZA 3K0XA 1X3GA 4X65L 3S24A 4P72A 1PH7A 3M9BA 1X54A 2K52A 5IP9H 2R7FA 4HJAA 3CCVA 3CCRA 3RN5A 4A3EG 1W2BA 2Z6KC 2JEAI 1B8AA 3HOVH 1FJGL 2ZJQA 1MKHA 2YV5A 3B6YA 2F4VL 1VQDA 1I5FA 3F2CA 3TREA 1D7QA 1B70B 4FDBA 1GD7A 4UP8A 1PH3A 5IT9c 1S40A 1KQSA 1HR0W 1J6QA 1V1QA 1VQ5A 4LF7Q 4LF7L 4B3RQ 2UXBQ 3KF6A 3RZDH 2WFWA 1X65A 1KRSA 3BZCA 1V43A 4A4IA 1VQ4A 4GN3B 2R92G 1EIFA 4A93G 3UE0A 2I0QA 3W1BA 3CCEA 3LGJA 2E2IH 2A8VA 2LXKA 4BBRG 3S1QH 4A3BH 2UU9L 2JQOA 1K0RA 2I5HA 2NN6G 3L2PA 2Q2UA 2UU9Q 1KIXA 3M4QA 1W3SA 3CCSA 2B3GA 3GTKH 3L7ZC 4GNXC 1K9MC 2WB1E 2MO1A 4GN5A 3K7AH 4IPDA 4LW1A 2V1CC 4BA1I 1PHJA 1QUQB 1HZCA 4GN4B 4JI4L 1IZ6A 1RL2A 3BZKA 3GTOH 1OXSC 3BJUA 1AE3A 3D0FA 2A1AA 3PSIA 1PH8A 4BY7G 5IP7H 3E9HA 1Z9FA 1CKNB 2H5XA 1PH4A 4A3LG 5C4XG 3CCUA 1SFOH 3HOYG 1U0LA 4DR3L 1E1TA 4DR3Q 1Q1EA 2BH2A 3PF5A 4QQBX 1YVCA 2CKZB 1YNXA 1IYJB 2MQHA 2RF4A 3UDFA 4DR1L 4A3GH 4OO1G 4LF8L 2GN5A 4LF8Q 1X6OA 1N32L 5IYBH 1A0IA 1E1OA 4DK3C 1KXLA 2IHEA 5C0XJ 1N8RC 4L5QA 1WOCA 4DAMA 1LTLA 1N36L 1VQMA 4PZ6A 5E7NA 2VS1A 3AFQA 4MTNA 1YJNA 4DUZL 2CCZA 4A3IG 2KBNA 3H3VI 1Q8KA 4JI2Q 1Y14B 2L15A 1WYDA 5HY6A 1EWIA 4BBSH 4A3CH 2JJQA 3K8AA 4Y7NH 1WCMG 4JI0L 3CCQA 4JI0Q 1FGUA 3KDFA 4IFDJ 2UUCQ 1P16A 1I6HH 2NN6I 4JYAQ 2AMCB 1UE5A 1I50H 5M3FG 3CCLA 1YITA 4B3TQ 2KCMA 3PO3H 4X6AH 5JEAJ 5C4JH 2UUBL 4JOIC 4PMWA 3STBC 2EXDA 4O2DA 4AH6A 2K4KA 3TQYA 1IXRA 2UUAQ 2WP8J 3K80C 4TVAB 2B63G 2JA6G 4DR7L 2K5NA 3H0GG 4DUYQ 2AWNA 4P74A 2HHHL 1SRUA 1YZ6A 2CWPA 4A3FH 2BA0A 2B29A 1HNWQ 1HNWL 3NBHB 3RN2A 1L1OB 3CPFA 1XMOL 4KHPL 4OO1I 4DV5Q 3CMEA 4APVA 2Z6KA 3A0JA 4KLKA 3S2DH 2YYZA 2MFIA 2K5HA 1MJEA 3HOZH 1M1KC 2UXCL 1FL0A 2UXCQ 4GKJL 4GKJQ 1Q12A 5GROA 1QVGA 3ER0A 4C3HH 5M3MG 2LXJA 2R6GA 5FLMH 3S1RH 1Q7YC 4LF5L 2YTXA 1UE6A 5LMUL 5LMUQ 2K75A 1PV4A 1XNQL 1I3QH 4PZ8A 4LFCQ 1XNQQ 1PYBA 1CSQA 2NVQH 3HOWG 2WAQE 2IY5B 4YHHQ 4DV6Q 2JK8A 4DV6L 3PIOA 3CF5A 4LUOA 1IBKL 2Y0SE 3CAMA 3RNUA 4K0KL 1HH2P 3RLNA 4DKAC 2PI2E 1C0AA 3S16H 3NELA 2EIFA 5JJLA 1XJVA 1IL2A 1HR0L 4A3MH 1GVPA 4NXML 4NXMQ 4DR2L 4GNXA 5IE8A 1NTGA 3TRZA 1MJCA 1Q1BA 3J81i 1XTDA 3G71A 4JBMA 4DPGA 4IO9A 1Y1VG 1BBWA 3T1YL 4A3JG 5GADC 5C3EH 4HIMA 1NE3A 5IWAL 5IWAQ 1VQLA 4BY1G 1KL9A 4X65Q 3TS0A 4YCWA 4RG1A 2ATWA 4JC0A 4YY3L 4P71A 3IRBA 3HOUH 3F1ZA 2Q2IA 1FJGQ 3OYYA 2F4VQ 2N3SA 1JJGA 1UE1A 3W5OA 1L1OC 1SR3A 2K5VA 2PQAB 4C3JH 4H02A 3M4PA 4LNQA 5FJ8H 1JMCA 3JC66 5LMNW 1NMFA 2DGYA 3FHWA 3GTJH 1TWHH 3CW2C 3SGIA 4UPAA 3I4NG 2R93G 4R4QA 1CUKA 5M5XH 3HKZE 3T1HQ 3T1HL 4OXPA 1WCMH 2JA9A 5IYDH 4GKKQ 4GKKL 3FP9A 4B3ML 1HZBA 2E2JH 1KRTA 1XNRL 5ELNA 3I4MH 1YHBA 3EIVA 4HJ8A 3PO2G 4X64L 2BA1A 1EFWA 1T9HA 4OWTB 5IYCH 2JA8G 4BXXG 5DLQE 1HZAA 1EOVA 1EQRA 4JOIA 4YWMA 3CC4A 1BKBA 1R9TH 3CCMA 4KI0A 3HOXG 1PH2A 1LUZA 1UWVA 2ASBA 3UDIA 4DR6L 1YHQA 4JI4Q 2C35B 4KHZA 5JJKA 2JA6H 1JJ2A 3GTQH 3RLOA 3KOJA 3FKIH 5AJ3L 3CD6A 1GO3E 1K8GA 2AHOB 2I5LX 4R1JA 4DV7L 5M5YH 5C44G 1PH9A 4ME3A 1QUQA 1KAWA 4A3DH 1IBML 4DR1Q 1GM5A 1M90C 1N32Q 3K7UC 2EQSA 3PUZA 2VQEL 2VQEQ 5HGQA 3CCJA 1NBWA 2R7ZG 2ZJPA 1CKNA 2QA4A 3M4OH 4QIWE 4J15A 2MO0A 4LFAQ 3U4VA 1XPRA 1N36Q 4LUVA 1VQOA 4LFAL 1G6PA 4DUZQ 2NZOA 1BVSA 1VQNA 2RHSB 1SE8A 1S3OA 2PI2A 3I4OA 3U58A 2YU9H 4A3KG 4AYBE 3J80c 4XIGS 4DV4L 4JI8L 1TWAH 1PYSB 4JI6L 3G48A 2E2HH 1E22A 5IP9G 3HOVG 1VQGA 2OQKA 1EYGA 4YCUA 4Y52H 1Q86C 2Q2HA 2UUBQ 1EUJA 2XTIA 4HIDA 4OWXB 1S72A 1QVFA 2AKWB 4GOPC 2VZAA 1XPOA 1YHAA 4IPCA 2WB1G 2JA7H 2VNUD 4DR7Q 1L2FA 1SROA 2HHHQ 3UDGA 3HKSA 4HIKA 1O7IA 1IBLL 1IBLQ 4RMFA 1AH9A 3K81C 4GLVB 4DV0L 4DV0Q 3EBEA 5EAYA 1LYLA 1KD1C 4A3EH 4OX9L 1XMOQ 4OX9Q 4XTCS 3KFUA 4KHPQ 4A3BG 1J5EL 3WWVA 4C3IH 4JI1L 4JI1Q 4B3SL 1CSPA 1NY4A 2VY3A 3G6EA 3F2BA 1KC8C 3PUWA 1K3RA 4IOAA 1VQBA 3DLLA 2ZTCA 4JI5L 4AQYL 1L1OA 4AQYQ 1JB7A 4JI5Q 4UP9A 4LF5Q 2R93H 1MIUA 2VQFL 3J81j 2VQFQ 3H3VH 1A63A 4QGUA 4MZ9A 5IP7G 1K73C 4YCVA 2R92H 1YBYA 4NXNL 5GAEC 3D31A 1C9OA 1IBKQ 4A93H 3J7A5 2JA5G 1WJJA 2CWAA 1OXTA 4BBRH 2Q2TA 4WJ3M 3PV0A 3GTMH 2QEXA 3KLWA 4A3GG 4NPSA 2N8NA 4R4CA 4DR5L 4DR5Q 2UXDL 1HR0Q 5LMNL 1A8VA 2I5MX 3KF8B 5IYBG 3PIPA 1D8LA 3GO5A 2JE6I 2KHIA 4DR2Q 3S17H 3HOXH 3NENA 1SN8A 1E24A 4GLXA 4OWWB 2CFMA 3OW2A 1FVIA 4JG2A 2PMZE 3Q8DA 3KJPA 2D62A 3T1YQ 1X9NA 4BY7H 4BBSG 4A3CG 2OQ0A 4DV3L 4DV3Q 1TWFH 1N34L 5ELOA 5C4XH 1N34Q 4A3LH 3PUVA 5C44H 4LF4L 1XPUA 3HOYH 1ASYA 3M7NA 1UEBA 1VQCA 4PZ7A 2K50A 4YY3Q 2MNAA 3PO3G 1YJ9A 1KHIA 3S14H 3TS2A 1CKOA 4JI3L 4JI3Q 2N49A 3DM3A 3M85A 1BBUA 3UDXA 2R7DA 2RHQB 4X62L 3CC2A 2ES2A 2IX0A 4A3IH 2E5LL 1TWCH 3AEVA 4NB3A 4QL5A 1VQ6A 1VQPA 4IOCA 4JI7L 3RZOH 1VS0A 3E0EA 4IJLA 4TQUS 3CXCA 4A3FG 1I94L 3AYHB 5JJIA 2GVAA 3JAMi 4A3KH 1TXYA 1QZHA 1OXXK 2DUDA 2NVTH 4B3MQ 4HJ7A 2K14A 1EIYB 1NMGA 1E3PA 2PQAA 4GOPB 1XNRQ 2E8GA 3PF4A 4JCVE 5M3FH 4PG3A 3KF6B 4DK6C 4X64Q 3S15H 4OONA 1U5KA 1YEZA 2WAQG 4HJ5A 4LFBL 4LFBQ 3J7ZC 1SLJA 2Y0SG 1PH1A 3HOZG 3KYHC 4YWKA 4JBWA 2JEBI 1YJWA 1N9WA 2AWOA 3TEHB 4DR6Q 4DV1L 1VQEA 4DV1Q 1TWGH 2LSSA 5FLMG 3H0GH 4GOPA 1PA6A 2B63H 4B3RL 2N78A 2UXBL 1H95A 1G291 2IHFA 2KHJA 4JBKA 5AJ3Q 3CMAA 4DV7Q 3ICEA 1VQHA 1XMQQ 3PUXA 1XMQL 1QVCA 3ULLA 1Y1WG 4K0KQ 2YTVA
chains in the Genus database with same CATH superfamily
3VDYA 2A19A 4YWLA 5M5WH 2KCNA 4KMUC 2F3VA 1D5XC 3U4ZA 1ZXTA 2KOLA 3QO2A 1OO9B 4IQZA 1PVOA 1CKMA 1RKNA 5H1SE 1BCPD 1Q81C 3I55A 3GTGH 3HOWH 4C1NI 5T1IA 5FOBB 1AP0A 2F0MA 2RCNA 4XDXA 3I56A 2NVYB 3Q24A 3DWQA 1TKWB 3PCOB 1ET9A 1U9RA 5JEAG 3M3YB 1N33L 3I7FA 4ILWA 2QGQA 4HTHA 1PH6A 5E4WC 2ZM6L 2D0OA 2XGTA 2WKCA 2VB2X 2UUCL 2F52A 1J8IA 4B3TL 4B9WA 2R7ZB 2WINB 1J5EQ 1D2BA 1E2WA 2VUMB 4RCNA 4V0BA 4L5TA 5HGTA 1OXVA 1KNAA 1EQVA 3X3NA 4EQOA 1UE7A 4FXDA 1X3EA 3RLFA 3C2PA 1G91A 4DV2L 1PLFA 3I4NH 1TS4A 2Z4HA 4IJHA 3QG1A 1VQFA 5GAHC 2VL6A 3H15A 3VR4A 5IY0A 4LF9L 3W1GA 4UHVA 5D65A 2NVXH 3PO2H 5CV5A 4DR4L 4L8JA 4BXXH 1HA6A 1S5CD 3TP6A 4C2MH 2OWOA 1OXUA 3RZDB 1B50A 3A5ZB 4A76A 1LM0A 1KLGD 4FF2A 5CV6A 1VQKA 2YTYA 2E2IB 2KQ3A 4GNXB 2ID0A 1OTCA 4LF4Q 3S1QB 1EFID 4GS3A 4WRDA 4LWCA 4G7HC 3I70A 2EXZA 3FPUB 4LUZA 1ICFB 1WFQA 3CQZH 5K36G 1JE5A 4HJ9A 1ENAA 4POGA 4X62Q 1F2MA 2JA7G 3CC7A 4JBJA 4A75A 5CC4A 3ITPA 4JI7Q 5LL6X 1I94Q 3VR3A 2PW5A 4AYBB 1ENFA 5JPMC 3RN5A 5IP9H 2R7FA 4EQPA 4A3EG 2JEAI 3HOVH 4FVMA 2L5TA 4C3IG 2Q8TA 2ZJQA 1I4PA 5DM63 1D7QA 1GD7A 1PH3A 5IT9c 4C3HG 4BBSB 5IT9E 4RGOS 4B3RQ 3NUCA 5KGUA 1VQ4A 4KJNA 1EIFA 1EIGA 3FPPA 4K5WA 3LGJA 5C4JB 1CM9A 1K0RA 2I5HA 4G4KA 2K05A 1CFMA 4LK1C 4JI4L 1IZ6A 1RL2A 3BZKA 3T4AC 1AE3A 1SFOH 1SYEA 4FF4A 1LT5D 3S2DB 2Y0SB 1YNXA 2MQHA 4A3GH 4F8MA 1PFBA 2SDFA 1WTRA 2JXMB 2E76C 1A0IA 2DJFC 1QNKA 5C0XJ 1STGA 4L5QA 3M7GA 2C9OA 1N36L 4PZ6A 5E7NA 4MTNA 2KBNA 2XWBB 4PV1C 2BOSA 2PMZB 1Y14B 4A3CH 2JJQA 3KDFA 1DJRD 4RKBA 2UUCQ 2AMCB 4IURA 1I50H 1YITA 4B3TQ 3PO3H 3H6MA 2UUBL 4JOIC 4O2DA 2NB0A 2K4KA 3TQYA 1G2TA 3K80C 2IL8A 3OSOA 4TVAB 4M1UB 2JA6G 2XNAC 1BCPC 3H0GG 4P2CB 1V8QA 2HHHL 3G6JB 5BN5A 1ILQA 2J4XA 3EVQA 4S3SA 5CV4A 2BA0A 2K32A 1HNWL 1SXTA 4KD4A 3ONAB 3RN2A 2X6LA 1XMOL 1GXDC 4KHPL 3KLRA 3BVMA 4X3KA 3VYTA 2UXCQ 1B53A 2TMPA 2ENBA 3D6CA 1Q12A 4ZUJA 4WORA 2LXJA 1PFMA 3BG3A 4LF5L 1STHA 1WCMB 4FXGC 3KBGA 2K75A 4HCEA 1XNQL 4PZ8A 1PYBA 3HOWG 4ZLTF 2WAQE 4DV6L 1IBKL 4LUOA 3DWAA 3CHBD 3RNUA 3A55A 4ABNA 1HH2P 4DKAC 3S16H 4A3MH 1GVPA 1XX8A 1BQQT 4CDEC 1TWGB 1NTGA 2L1BA 4L6TB 5KNCA 1XTDA 5JVH3 4IO9A 3EJIA 4CKBA 1O7LA 2ICIA 5C0XH 5IWAQ 1K3BC 1KL9A 3OHXC 4TRDA 2ATWA 4Z9CB 3FRPB 3F1ZA 3M4OB 3DEPA 5CMDA 5IGFA 1S5DD 2K5VA 5AFWA 2FINB 3N52A 2DGYA 1AZQA 1MGSA 2PQEA 1BNZA 3CW2C 3SGIA 4UPAA 3I4NG 3TDQA 1B2TA 3T1HQ 5TSSA 1EOTA 2JA9A 4GKKL 1WTHA 2E2JH 1SYDA 1XNRL 3EIVA 3PO2G 4CDCC 4OWTB 1HFGA 1LTSD 3LWEA 2F0WA 4BXXG 5DLQE 2H4OA 2F0JA 2WACA 2JA7B 1KAAA 1R9TH 5KYIA 3IKJA 3IL8A 4QMGA 1UWVA 3UDIA 4JI4Q 4KHZA 5JJKA 2IPKD 2A69D 1JJ2A 2I07B 3E0JA 3CD6A 1GO3E 3NQTA 5A35A 2I5LX 4A3EB 3DMUA 2D2CC 2R3ZA 4ME5A 1L0XB 1HHVA 4ME3A 4C3IB 2QCPX 3L9AX 1KAWA 5IGBA 5I9OA 2XRQD 3PUZA 2VQEQ 3S1MB 3T13A 4QIWE 2MO0A 4LFAL 1N36Q 2R93B 1G6PA 2G9DA 1HPCA 5DAUA 4XIGS 4JI8L 1TWAH 1PYSB 4FXKC 4JI6L 2JN4A 5IP9G 3T56B 3HOVG 1VQGA 4YCUA 3MC0B 2Q2HA 2UUBQ 4EQNA 2CQAA 3OWFA 2Z9HA 5CBEE 2AKWB 5IT9L 1L0YB 2HHHQ 3UDGA 4HIKA 1IBLQ 4KY7A 1AH9A 3K81C 3NTKA 4GLVB 2K5QA 2MP1A 2RKSA 2TSSA 3EBEA 4DV0Q 3AMUA 4OX9L 1XMOQ 4KHPQ 1BO0A 1FYCA 4B3SL 4XQQA 3A7LA 3G6EA 3M4YA 4O1NA 1EEFD 1KC8C 1K3RA 3RZOB 3QB3A 3OIQA 4JI5L 4AQYQ 1JB7A 4UP9A 2MJ8A 4LF5Q 4BS9A 2NVTB 3H3VH 4K6DA 3J81j 4QGUA 4NXNL 3S15B 1IBKQ 3H3VC 4BBRH 1STAA 2PYKA 5I6WA 5ISRA 4A3GG 4DR5L 4KHVA 1WVLA 3H0GB 3S17H 2R61A 1TIID 2CFMA 4OWWB 2K04A 3Q8DA 3IFTA 4PQXA 2EY1A 4PMCA 4B9XA 3J7AV 4A3CG 1N34L 1TWFH 5ELOA 4K6LA 3HOYH 1C4QA 1XPUA 5M5WB 2KUMA 4PZ7A 5EBCA 3SVMA 2K50A 3PQIA 3PO3G 3S14H 3E6ZX 4KV6A 1CKOA 2N49A 1F9QA 3M85A 2XN9C 3H91A 2OT2A 3GTGB 4KK7A 1TWCH 1VQPA 3HOWB 1VMPA 1KTKA 3E3XA 4A3KH 3TP5A 1LTID 1EIYB 2OXPA 4GOPB 1XNRQ 4DK6C 1LLRD 3TN2A 1CHQD 1SLJA 1DOLA 2JEBI 3WOEA 3MXPA 4DV1L 4GOPA 1TWGH 1PA6A 1Y69U 2UXBL 1EY9A 1I6HB 2K5WA 1XMQQ 3PUXA 1B3AA 3A8IE 4FF3A 4K0KL 5IODA 5KEEA 2MGSA 3CKIB 3A5UA 3GV3A 5F2DA 5JOBA 1VQ7A 4A3MG 3S1NH 3DXJC 2VUMG 1B7YB 5DM73 3I4NB 2J0TD 1BUVT 4P73A 4DAYB 1TS3A 5C0XG 3GD7A 2B2UA 3RD4A 2NVXB 4JI8Q 2BE5D 1D1IA 4JI6Q 4R4OA 3BS1A 3HOZB 4LAAA 1L0WA 4C2MB 2ZTEA 3NWSA 4EVOA 2HQEA 2K28A 4DF7A 4G7ZC 1LTBD 1STYA 3KK7A 2A69C 4BA2I 2Q8IB 1AFPA 5EKKA 4A3JH 4L5SA 3ULPA 4LF6Q 1LABA 1JB3A 2PNHA 3GDEA 3J80i 1HZ9A 2BCOA 4JVZA 1QZGA 3RR5A 4KKUA 4B3SQ 1VQAA 1HUMA 3GP7A 2LMCB 1V1PB 2VW9A 5ELCA 2RDFA 4EX5A 3CPWA 2HUGA 3S1MH 1K28A 4QJFA 5C5MA 1GUTA 4DUYL 5FKAC 5CBAE 4RAUC 1VQ9A 3HOVB 2CQOA 3UE1A 3HKZB 4ZUIA 4NXNQ 2VB3X 4OL7A 2OCEA 2HIVA 1P8LA 4AYBG 2XWJB 2QDLA 4OIKA 1SMXA 1NSNS 1F9PA 1ET6A 3HFZB 1HXYD 4L5RC 2AUJD 2HDMA 1IYVA 4XYOA 4YIJA 1Y8NB 3BU2A 3MZ5A 5I6YA 2B2TC 1VQIA 1K0SA 5J3BA 3MEHA 4N8X1 1CZGA 3PGZA 4MIUA 5FLXc 1ZEQX 2B2WA 3AQQA 3HZXA 1ESRA 1A62A 4RHSA 1WTXA 1G51A 2ZTDA 4FYDA 3L0OA 1Q46A 1Q3LA 1NJIC 3EN2A 3KJOA 3JAMc 1S5BD 1SFOB 4JW0A 3MXNB 1RCVD 2RSOA 3I2ZA 3S24A 2HCIA 3GTPH 2G5DA 1PFNA 2I46A 1B8AA 2F4VL 3B6YA 1KLUD 3MXNA 1B70B 4UP8A 2G9HD 1KQSA 3EFXD 5C3XA 1J6QA 2QF7A 2UXBQ 3KF6A 2WFWA 3BVZA 4M8AA 1X65A 1KRSA 3BZCA 1SNPA 1I50B 4QF4A 1EYAA 2WV6D 3T51B 3PO3B 5D3DA 2I0QA 4FO2A 1VDZA 4BBRG 4A3BH 2JQOA 3CC4A 1BCPB 3M4QA 2BDNA 2B3GA 3I3CA 1K9MC 2WB1E 4GN5A 4J8QA 3SEBA 2O5JC 4LW1A 5EPJA 3T53B 1QUQB 5I9PA 1KDBA 3PSIA 1PH8A 5ELEA 5IGEA 1PH4A 1CKNB 2KJXA 1FR3A 3HOYG 3HEJA 1PZJD 1E1TA 1Q1EA 3WOFA 4X3TA 4KD3A 1CI3M 1H9SB 4DR1L 3MFYA 1N32L 1X6OA 1SNDA 5EKIA 3MXGA 1KXLA 3OW7A 1N8RC 1II3A 4DAMA 1LTLA 2KEEA 3G7LA 2VS1A 3AFQA 5C3WA 1H9SA 1QJOA 4Y7NH 1R4QB 2L0CA 1WCMG 3CCQA 3S16B 4IFDJ 3IAYA 1I6HH 4Q5VA 1UE5A 4A3MB 3CCLA 2KCMA 3I8ZA 3NXWA 3I4LA 4AH6A 2DNCA 4WJWA 4DUYQ 1Q90A 1TY0A 5KNBA 2CWPA 4XQNA 2B29A 3NBHB 2BE5C 1S5ED 1U4RA 1F2ZA 2Z6KA 3A0JA 4KLKA 1RD9D 2MFIA 1MJEA 3HOZH 2UXCL 2D5DA 4A3IB 3NP8A 5GROA 1EU4A 3S1RH 4HEDA 1PXUA 2F1MA 3BYTB 3LX0A 2E2JB 4IZ8A 1CSQA 1LACA 1JORA 1SBBB 2JK8A 4ZKBB 2Y0SE 3NELA 1R9TB 5JJLA 1IL2A 3KLSX 3C1FA 4NXMQ 4GNXA 1EQTA 1F9SA 2Z1CA 5BN3A 2N88A 4MTKA 5C3EH 4HIMA 4A3JG 5IWAL 1VQLA 2QILA 1LT6D 1SAPA 3Q22A 2MHVA 1SSOA 4HAEA 4JC0A 3HOUH 1HQMC 3MA2B 1TY2A 5ELFA 3OYYA 2F4VQ 3SK4A 4IFDH 4HMJA 2B8FA 2EJMA 1L1OC 2PQAB 4LNQA 3M4PA 5LMNW 1NMFA 3GTJH 1TWHH 2R93G 3D4RA 1EU3A 1TWAB 4R4QA 4K8JA 4K8IA 3T1HL 4OXPA 5IYDH 5EKLA 3FP9A 3V05A 4B3ML 1D5ZC 1EL0A 1YHBA 2BA1A 1EFWA 5IYCH 1EOVA 4KN4C 2E75C 2EYHA 4KI0A 3OMCA 1PH2A 1LUZA 1PTOD 2XVSA 5G3LD 2ASBA 4DR6L 1YHQA 1NNXA 3P1HA 2L55A 4BY1B 5FO9B 1K8GA 1DONA 1S4ZA 4R1JA 1A3TA 1PH9A 5FLXL 4QCLA 4A3DH 1AEXA 1EZ8A 3D8GA 1IBML 4DR1Q 1M90C 1N32Q 2EQSA 2VQEL 1ZYRD 4ULLA 2LKVA 1EIHA 4FP5D 2FHTA 3JAML 2JYOA 2NZOA 3C46A 1S3OA 3J80c 4DV4L 4BBRB 2E2HH 3J80E 1E22A 2OQKA 3GQBA 3MXUA 1SJHD 2RSNA 3ND8A 5IGGA 1RODA 4KY5A 3S17B 4HIDA 4OWXB 2B2YA 2O5IC 1GHKA 2SNSA 2VZAA 4IPCA 1TWFB 2B2VA 5JJZA 3CU7A 3HOYB 1DCZA 1O7IA 4ZK9B 4DU9A 5KIXA 1IBLL 3TBIB 1WTQA 1AN8A 4DV0L 1LYLA 3S14B 4HN7A 4XTCS 4A3BG 1IYUA 3PIO3 4OEMB 2RDHA 4IOAA 1TWCB 3U9OA 1IHZA 3NE5B 4AQYL 1HUNA 4A3KB 4K2LA 1IKLA 5CYUA 2VQFQ 1DOMA 4MZ9A 4XT3B 1K73C 4YCVA 3QOJA 3D31A 2EYPA 3J7A5 2CH4W 3AB9A 2CWAA 1EWCA 1F9RA 3SDZA 2NN6H 2UXDL 3KLWA 4NPSA 1QOHA 3KF8B 1TS5A 4CJ1B 2KHIA 3HOXH 4GLXA 3H09A 3KJPA 5CGKA 4QB4A 5JPNC 5C44H 4CDDC 1LTTD 2P5ZX 3NBIA 1ASYA 3NK9A 4DK1A 3K57A 4CGYB 2NWGA 4TSSA 1AW7A 1VF7A 3S1NB 1KHIA 2B39A 4OO1H 4CHTB 5C4ZA 1EY4A 4JI3Q 3DM3A 4DN4M 1QB5D 4DNTB 4I65A 1O78A 5D3IB 2F0EA 4C1NK 4A3IH 3AEVA 2K6AA 4F88A 4IOCA 4DGZA 3RUZA 2GVAA 3JAMi 1TXYA 4NP5A 1OXXK 3Q6SA 4XT1B 4B3MQ 4ODGA 2K14A 1CHPD 1F2LA 4HJ7A 3PF4A 2E8GA 1ICWA 4JCVE 1U5KA 1YEZA 2NTSA 3MVVA 3SK5A 1CA6A 3HOZG 1GUGA 4OELB 1MSHA 1N9WA 3TEHB 4DR6Q 4A3JB 2JP1A 1JOOA 2PO4A 1CZWA 1U4MA 2IHFA 1EY0A 3CMAA 4G7OC 1HA5A 2FMCA 3DHQA 5IIFA 2CVRA 1XMQL 3ULLA 2DN8A 3LNNA 4V190 2EJGC 4MNOA 3K58A 3Q23A 1IBMQ 3STBD 4GLAC 3K59A 4WFN3 3I91A 4QUFA 2F0DA 4A3FB 4IUUA 1PRTB 5C3EG 3WDNA 4DV4Q 1R4PB 4RKLA 2JA5H 1A3UA 1NUCA 1AE2A 2RDGA 3HKZG 3V96A 1VQJA 2BDOA 4R4IA 3HOUG 5LL6S 3RMHA 1ASZA 1PTOH 2IWHA 4DAVA 4IFDG 2Z8LA 1H9KA 1K83H 3VR2A 2EOTA 1JWMD 1GHJA 1SE2A 1HNZQ 1RDPD 1PTOC 1VQ8A 3HGBA 2HQLA 3F8TA 3HS0C 1Y1VH 1M4VA 1EQQA 1E7ZA 3TSSA 5E3FA 4LF6L 5IYDG 4BY1H 2DY8A 2QDBA 1H9JA 4JV5Q 4JYAL 3T16A 4HR7B 1HTPA 4RWSC 5IYCG 4X3SA 1PDQA 2F3IA 1O7ZA 1ZYRC 1YI2A 3A8JE 4IUQA 4EQ5A 1PYWD 3VYUA 1QE6A 5A2QL 3SHLA 4DK0A 5C0XI 1JWUD 1BCPF 4AIMA 3GTPB 2WIIB 3R2IA 5KRUA 1HQRD 2F0TA 1HJPA 1HNXQ 2K7VA 1GUSA 2F0OA 5D14A 4A3DG 1PFSA 2UXDQ 2JA8H 3AFPA 1CQFA 2A6HD 2WKDA 3I73A 3S2HH 1JICA 1Z47A 3I90A 3SE0A 4U673 2H1EA 1LT4D 5GQOA 5BR8Q 2EY5A 2XRSD 5I2YA 4R4TA 3J80L 1XTCD 4Q0FA 3U50C 1VCIA 4A3BB 1GKHA 1Y1WH 1DD2A 2PZWA 4KKSA 3X3MA 1X56A 2OTJA 3OTOQ 3CP0A 5ELDA 1GJXA 4B08A 3GTLH 3E9IA 4QIWB 3R93A 4WJ4A 4O0AA 3K5LA 4X66Q 5FO8B 4UP7A 1ESFA 1Q82C 3DEOA 3K0XA 3NTHA 3U9SA 4P72A 1PH7A 1SEBD 2K52A 5I4DA 4HJAA 4UDUC 4JPBW 4OIJA 1A2UA 3DUZA 1MKHA 2YV5A 2EJFC 4RGNA 3F2CA 2EYOA 4N9PA 1I4HA 2FJ2A 4IALA 5CR3A 1HR0W 1V1QA 1VQ5A 4Y7NB 4LF7Q 4ZYSA 2J7ZA 4RGTA 1QWYA 2EDGA 4K2KA 5DEHA 1S5FD 2OEOA 1E2ZA 4CJ0B 1B9NA 1KDAA 2A8VA 2UU9Q 2NN6G 1O7YA 1JCKB 2DY7A 3K7AH 2V1CC 4GN4B 1V1OA 1W6KA 3GTOH 1OXSC 3BJUA 1JR0D 1D5MC 3D0FA 2A1AA 3A8KE 5L37A 5IP7H 3K0YA 1X32A 4DR3Q 3SK8A 1STBA 5K5PA 2CKZB 4QUCA 1IYJB 4KJOA 3UDFA 4OO1G 3NPPA 4LF8Q 2GN5A 4DAYA 2F0KA 5IYBH 5M9OA 1E1OA 1FGBD 3TZDA 4DK3C 4UAIA 3S1RB 1WOCA 1VQMA 2F0HA 4A3IG 3H3VI 2R92B 2FFKB 1WYDA 1EWIA 4JI0Q 3QWNA 1FGUA 1Z6HA 4FNFA 5KNDA 4JYAQ 2PNRC 1ONLA 2IX3A 1SNCA 1B4OA 5EPKA 3STBC 2EXDA 1IKMA 2NYZD 2WP8J 2ZXPA 3QIAA 4H0LC 5C3EB 1K8MA 4H44C 3C3LA 1SRUA 1YZ6A 4A3FH 2NUCA 2ZXRA 1HCZA 4JK1C 5CV8A 1XXGA 1V1PA 3QJYA 3HOUB 1L1OB 1FNUA 3MAQA 4APVA 1SMYD 2L12A 1H9RA 2NTTA 4GKJQ 1DXMA 2AQ2B 3GTJB 1TWHB 2HCCA 1SNOA 1QVGA 1STNA 4C3HH 1DOKA 2AQ1B 3BDLA 2YTXA 1UE6A 5LMUQ 3URYA 1RTNA 4LJZC 5FK9C 2M00A 1PV4A 4MHEA 1I3QH 2QEJC 3PIOA 5EBDA 3CAMA 3RLNA 1C0AA 5FLXE 2EIFA 1XJVA 4NXML 3TRZA 3OOCA 3J81i 4XXEA 4CJ2C 4DPGA 1Y1VG 1BBWA 3T1YL 2LS01 5GADC 3JAME 4KKTA 4A3DB 4BY1G 3TS0A 1TT2A 4PMBA 4YCWA 4RG1A 1T5EA 1VMCA 2EY2A 1LTRD 2Q2IA 1UE1A 2A6HC 3D3RA 1YNND 1MSGA 1QNUA 4C3JH 1ENCA 5FJ8H 3JC66 3FHWA 3W2DA 1NCVA 1CUKA 2E2HB 2Z4IA 1M8AA 5IGDA 1HZBA 5ELNA 3I4MH 1TU2B 4HJ8A 4OHJA 3A54A 2JA8G 1WD1A 3K5MA 1EQRA 4JOIA 5COYA 1BKBA 3CCMA 3P20A 3L3OC 2JA6H 1LT3D 3GTQH 1ILPA 2A5HA 3FKIH 5AJ3L 2AHOB 4DV7L 5M5YH 2M2LA 3VR5A 3VA5A 2K5DA 1QUQA 2A73B 4DAPA 4R8IA 1MHWC 1CQVA 1GM5A 4F7XA 2KECA 5HGQA 3NHHA 1I4XA 2ZJPA 1CKNA 2QA4A 4J15A 5NUCA 4LUVA 4NKLA 1BVSA 2L11A 2F0PA 3U58A 2YU9H 4A3KG 4AYBE 1X3QA 2F0IA 1EYGA 1Q86C 2Z6BA 1EUJA 2XTIA 3HOXB 1BR9A 3MTSA 1QVFA 1YNJD 4GOPC 1XPOA 5T1GA 2VNUD 1JOKA 5ELBA 1L2FA 5C44B 3HKSA 4RH6A 1G8ZD 4RMFA 1G2SA 1SYCA 1SYBA 2NZ1D 5EAYA 4EGVA 3KFUA 2CW0D 1B44D 1F2YA 1RF2D 3WWVA 2DJGC 4JI1Q 1CSPA 2VY3A 1TS2A 4K5VA 1VQBA 1EEID 2KHSA 4X3UA 2ZTCA 3NBHA 4J1MA 5J1ZA 2CH4A 1SDFA 1EY6A 3PMFA 2B2UC 2VQFL 2GA4B 5IP7G 2R92H 4A93H 1C9OA 2X69A 2AUKA 3E5SA 2Q2TA 4WJ3M 3PV0A 3GTMH 2QEXA 1HTLD 2N8NA 1TVXA 2QKIC 5LMNL 5IYBG 1PRTF 3PIPA 2WB1B 3QR8A 5JVG3 2LY7A 3GO5A 4XQJA 3NENA 5CV7A 4MN3A 3P7JA 2PMZE 3R2TA 3T1YQ 4BY7H 3OPOA 2OQ0A 5C6AA 4DV3Q 4A3LH 5C4XH 1JOQA 3PUVA 4KN7C 1UUPA 2Q8RE 3IFDA 3D4DA 1VQCA 2A74C 3GTKB 3GV6A 1SNQA 1LTGD 1YJ9A 3HRZC 1SMYC 1NR4A 3TS2A 2PCFB 4FF1A 4JI3L 2R7DA 2RHQB 3CC2A 4OGQC 2ES2A 2E5LL 4NB3A 4QL5A 1VS0A 4IJLA 3NQIA 2ZT9C 4TQUS 5C5LA 3CXCA 3AYHB 4A3FG 1QZHA 2JA5B 1NMGA 2PQAA 3K6OA 4ID6A 5M3FH 4PG3A 1PTOB 2C5CA 3J7YW 4OONA 2WAQG 4LFBQ 1K83B 1SNMA 3KYHC 3OMGA 1FD7D 1Y1VB 1KNEA 1VQEA 2B63H 2LSSA 1JC7A 2E2DC 1J9OA 5AJ3Q 2ZXOA 2SEBD 4DV7Q 5A2QE 1VQHA 4J6HA 3D4WA 2B2WC 4NMZA 2XIWA 1A3VA 2YTVA 2F0NA 2HT1A 1NR2A 1EY7A 3FDTA 3ERSX 4IPHA 4DFAA 1YNNC 1PH5A 1K8AC 1DZ1A 5M3MH 1QCBD 4IPGA 1BOSA 4POFA 3MHBA 1GUOA 3A74A 4QY7A 1WTWA 2JA8B 4UY8C 4CBVA 4DXFA 4ZQ3A 3S2HB 1YIJA 2A6ED 2KCTA 3ZJYC 1D6EC 2EPBA 3KDFB 2K01A 4P75A 4C3JG 4ZKCB 2BH8A 3R8BA 5FJ8G 1C7YA 1HNZL 2MPMA 4F87A 3G4SA 1N33Q 2NVQB 4JI2L 4CKEA 4DNIA 2OTLA 1HFNA 2IX1A 4HCSA 1Y1WB 4DA2A 1JJCB 3H94A 4DNRB 1JT8A 2ZM6Q 2X6GA 4IUPA 3LWUA 2ALYB 4JV5L 3I4MG 3PUYA 1DGSA 3GTLB 1BF4A 1X55A 2UUAL 2DNEA 2GVBA 2FXQA 4DV2Q 1TR5A 5JAVA 3FKIG 2IT1A 2RBMA 4ZRZA 2D0PA 1HNXL 4LF9Q 1C48A 1V9PA 4DV5L 4DR4Q 2HIXA 4IFDI 5LMNQ 1EYDA 3J81c 1X3FA 3ULJA 1YNJC 2NVYH 2SOBA 3J81E 4HIOA 1RTOA 1RHPA 5M5XB 2Z0SA 5BR8L 3MEFA 3VR6A 3M3YH 4I7ZC 4CDFC 4LFCL 1CTMA 3KF8A 1W6JA 1WI5A 3Q0AA 4YHHL 1MBYA 4ALPA 1EZ6A 2KENA 3NEMA 2CW0C 2NZHA 3F2DA 3K7AB 4K5XA 3OTOL 5EPLA 2M9VA 2R7ZH 2ZJRA 2VUMH 2D9UA 3GTOB 1KABA 2RCFA 4X66L 2E5LQ 1RIPA 5GAGC 1WTPA 1UEAB 1KDCA 1X3GA 4X65L 3M9BA 1X54A 2E74C 2CHBD 3CCVA 3CCRA 1W2BA 2Z6KC 3UI2A 1SE3A 2F4IA 1FJGL 1LV9A 3NWTA 1VQDA 1I5FA 3TREA 1STEA 1K8OA 4FDBA 2IJ0A 3ND9A 5IGCA 1S40A 2L9HA 4LF7L 3RZDH 4PNYA 1V43A 4A4IA 4GN3B 2R92G 2RA4A 4A93G 3R3OA 3UE0A 3W1BA 1Z7TA 3CCEA 2E2IH 1Y8OB 2LXKA 3S1QH 3D6WA 2UU9L 3L2PA 2Q2UA 1KIXA 3CCSA 1W3SA 3GTKH 3L7ZC 4GNXC 2MO1A 3V2TA 2V4DA 4IPDA 4BA1I 4XYQA 2XSCA 1PHJA 1B3QA 1HZCA 2EE1A 2F0UA 1ML0D 4BY7G 3E9HA 1Z9FA 4A3LG 2H5XA 5C4XG 5EJWA 3CCUA 1U0LA 2K1BA 2SNMA 4DR3L 2BH2A 2WAQB 3PF5A 4QQBX 1YVCA 5E1FA 2RF4A 1A6XA 3ZYYX 5C4HA 4LF8L 4HMIA 2HD3A 4C3HB 2IHEA 1IW7D 1XYIA 3BYYB 1YJNA 2K33A 4DUZL 2CCZA 1I3QB 2O2LD 1Q8KA 4JI2Q 2L15A 1DM0B 2O4XA 5HY6A 3FVQA 4BBSH 1C8CA 3K8AA 2B2TA 3A7AB 4NDXA 2KEDA 4JI0L 5E4XA 4C56C 3TP8A 4KY6A 1Y8PB 1P16A 2NN6I 4H13C 3KLSA 5M3FG 4X6AH 1PRTD 1B9MA 4RGMA 5JEAJ 5C4JH 4PMWA 3TMEA 3I72A 2UUAQ 1IXRA 1BBXC 3PIP3 2B63G 4DR7L 2K5NA 2AWNA 4P74A 1D1KA 2ICEC 3EA6A 3TP7A 1HNWQ 5DNFA 2EY6A 1BDOA 3CPFA 4OO1I 3HG9A 5HURA 4DV5Q 3CMEA 3S2DH 4C3JB 2YYZA 2A6EC 2K5HA 4RCOA 1M1KC 1FL0A 3OWEB 4GKJL 3ER0A 5M3MG 2R6GA 5FLMH 1Q7YC 5LMUL 1EYCA 5BN4A 1I4GA 3K5NA 3DWPA 1XNQQ 4LFCQ 3I4MB 2NVQH 2IY5B 3OIPA 5CORA 4YHHQ 3BDOA 4DV6Q 3DM1A 3CF5A 2PI2E 2B2YC 1FNVA 3VA7A 1FNWA 1HR0L 2A68D 2EYFA 4DR2L 5IE8A 2JA6B 3GTQB 1MJCA 1Q1BA 3G71A 2B2VC 2F0SA 4JBMA 3FKIB 5M5YB 1GUNA 1NE3A 2EYMA 4X65Q 1SJED 5J39A 1ZKOA 1O80A 1Q8IA 4YY3L 4O42A 4P71A 3IRBA 1X3PA 1FJGQ 2NBFA 2N3SA 3TZUA 5J22A 1JJGA 1F77A 3W5OA 2EZVA 1SR3A 4H02A 2PZUA 5JEAH 1JMCA 3FMCA 4R9WA 3P75A 2YU9B 1EY8A 1SYFA 1CT1D 5M5XH 2N55A 4IUVA 3HKZE 3KUPA 1WCMH 4GKKQ 4GZYC 3F2UA 1KRTA 2EVBA 4X64L 1T9HA 2KA7A 4N9TA 3J81L 2RVLA 5EGTA 3MWYW 1HZAA 4YWMA 1JE4A 4CKCA 3HOXG 3NSWA 2C35B 3RLOA 3KOJA 1EWHA 2FMMA 5IOCA 5C44G 1WTVA 4ZCKA 2B8GA 1DYQA 4IUTA 3CRLC 3AU7A 1JQYD 3K7UC 4L63B 3CCJA 1NBWA 2R7ZG 2K03A 4N8FA 3M4OH 2RQXA 3U4VA 4LFAQ 1XPRA 2F0QA 4LMQD 1VQOA 2EYLA 4DUZQ 1CK1A 1VQNA 3HP3A 2RHSB 1B1ZA 2QW7A 1SE8A 1SYGA 2PI2A 4A93B 3I4OA 2JSOA 3PO2B 3N6RA 2F0FA 3EROA 3FEWX 3G48A 3GTMB 2MUYA 2HDLA 3NTIA 4Y52H 4NW2A 2L4NA 4I7AA 5K36H 3K5OA 1H9MA 1S72A 1U4LA 3BVGA 3VYSA 1YHAA 3ERQA 2WB1G 4TKOB 2JA7H 4BY7B 4RFBA 4DR7Q 5C4XB 1PTOF 1SROA 5G3LF 1I6VC 1JWSD 2F0LA 2EYJA 3EQLC 2F03A 1UAPA 1LTAD 1KD1C 4A3EH 4KTAA 4OX9Q 4HSPA 3CQZB 1G6ZA 1I4RA 1PZKD 1J5EL 4HSVA 4C3IH 4JI1L 1RJTA 4E6IA 4H7BA 1NY4A 3F2BA 1GOZA 3PUWA 1E2VA 3DLLA 1IW7C 3MFGA 3BZDB 3A56A 4JI5Q 1L1OA 1QILA 2KVMA 1UNSA 2R93H 1TQOA 1MIUA 4ZAIA 1A63A 1CA5A 1YBYA 5GAEC 5M3FB 4DXGA 2JA5G 1AZPA 1WJJA 3S9WA 1OXTA 1U4PA 1PRTC 3QOLA 4R4CA 4DR5Q 5KYLA 1HR0Q 1A8VA 2I5MX 1MI2A 1LO5D 1D8LA 4DR2Q 1PZID 2JE6I 2B63B 1SN8A 1E24A 1VF5C 3OW2A 1FVIA 3SXHA 1IL8A 1PMRA 4JG2A 2F0GA 2D62A 1A15A 1X9NA 2VXWA 4BBSG 4DV3L 1N34Q 1EY5A 3CRKC 1BXTA 4LF4L 1HRJA 3SR1A 1MD2D 3M7NA 1UEBA 3J7AF 4IUNA 2LFNA 4YY3Q 2MNAA 2AQ3B 1I4QA 5CV9A 2PPBC 5LHY1 3BDCA 5M3MB 2OF1A 1BBUA 3UDXA 4BWGB 2KCCA 4X62L 1WD0A 3O13A 1WTOA 2IX0A 2PZTA 1VQ6A 1XWEA 3RZOH 4JI7L 3E0EA 3W3AA 1I94L 5JJIA 4G57A 1GUWA 4RA8A 2DUDA 2NVTH 4IN3A 3SK6A 4A3GB 1E3PA 2F0VA 3C1EA 4U68A 2IW3A 3S15H 3KF6B 4X64Q 2PW7A 5EQ0A 3VYRA 4LFBL 4HJ5A 1A2TA 1SE4A 3KBXA 3J7ZC 2Y0SG 1PH1A 2A68C 5FO7B 4YWKA 1NAPA 4JBWA 1YJWA 2AWOA 1T5XD 4K14A 4DV1Q 5FLMG 3H0GH 1QG7A 1H95A 4B3RL 2N78A 1G291 2KHJA 4JBKA 1E0BA 4RHRA 3ICEA 4R8NA 1QVCA 5I2XA 1Y1WG 2F3WA 4K0KQ
chains in the Genus database with same CATH topology
2HT1A 4MNOA 2A19A 3VDYA 4YWLA 5M5WH 1IBMQ 3ERSX 3STBD 3U4ZA 3A5UA 1VQ7A 4IPHA 4GLAC 4A3MG 3S1NH 2VUMG 1PH5A 1PVOA 1K8AC 1B7YB 1CKMA 5H1SE 5M3MH 4IPGA 4P73A 1Q81C 4POFA 4DAYB 3I55A 5C3EG 3GTGH 5C0XG 3GD7A 3A74A 4QY7A 4DV4Q 3HOWH 4JI8Q 4JI6Q 2JA5H 4UY8C 2RCNA 4R4OA 1AE2A 3HKZG 1L0WA 1VQJA 4R4IA 1YIJA 3HOUG 3I56A 1ASZA 2KCTA 3ZJYC 2ZTEA 4IFDG 1K83H 3KDFB 3PCOB 4P75A 2BH8A 1C7YA 5FJ8G 5JEAG 1HNZL 1HNZQ 1VQ8A 2HQLA 3F8TA 3G4SA 1N33L 1N33Q 1Y1VH 1EQQA 4JI2L 4DNIA 2OTLA 3I7FA 4BA2I 4A3JH 4L5SA 2QGQA 1PH6A 1E7ZA 3ULPA 1JJCB 2IX1A 1JT8A 2ZM6L 2ZM6Q 2D0OA 2XGTA 5IYDG 4BY1H 4LF6Q 2PNHA 4LF6L 2ALYB 4JV5Q 4JV5L 2UUCL 3GDEA 2F52A 1HZ9A 3J80i 1QZGA 3I4MG 4JYAL 4B3TL 3RR5A 3PUYA 1J5EQ 1DGSA 5IYCG 4B3SQ 1VQAA 4L5TA 2F3IA 1X55A 2UUAL 1YI2A 1OXVA 4EQ5A 2VW9A 4EX5A 2GVBA 3CPWA 3S1MH 1UE7A 1X3EA 4QJFA 2FXQA 3RLFA 4DUYL 4DV2L 4DV2Q 5C0XI 3I4NH 3FKIG 2IT1A 4IJHA 4AIMA 1VQ9A 1VQFA 2CQOA 3UE1A 2VL6A 5GAHC 3H15A 2D0PA 4NXNQ 5IY0A 1HJPA 1HNXQ 1HNXL 2OCEA 4LF9L 4LF9Q 2HIVA 1P8LA 3W1GA 2NVXH 1V9PA 4AYBG 3PO2H 4A3DG 4DV5L 1PFSA 4DR4L 2HIXA 4DR4Q 2JA8H 4BXXH 2UXDQ 3AFPA 1SMXA 4IFDI 5LMNQ 3J81c 1X3FA 3ULJA 3HFZB 4L5RC 3S2HH 1Z47A 4C2MH 2NVYH 2OWOA 1OXUA 4HIOA 5GQOA 3BU2A 3A5ZB 4A76A 1LM0A 2Z0SA 5BR8Q 5BR8L 1VQIA 1VQKA 3MEFA 3M3YH 5J3BA 2YTYA 4R4TA 4GNXB 4LFCL 2ID0A 1OTCA 3U50C 4LF4Q 1VCIA 1WI5A 3PGZA 1GKHA 4YHHL 1Y1WH 5FLXc 4ALPA 4GS3A 2KENA 3AQQA 3NEMA 3F2DA 2NZHA 4LWCA 1X56A 3GTPH 2OTJA 1A62A 4LUZA 3CP0A 3OTOL 1G51A 1WFQA 3CQZH 1JE5A 2ZTDA 3OTOQ 4HJ9A 2R7ZH 5K36G 2ZJRA 3E9IA 2VUMH 3GTLH 3L0OA 1Q46A 4POGA 1NJIC 4WJ4A 3EN2A 4O0AA 4X62Q 2JA7G 4X66L 4X66Q 3CC7A 3KJOA 4JBJA 3JAMc 1RIPA 4A75A 2E5LQ 4JI7Q 5GAGC 1I94Q 3MXNB 4UP7A 1Q82C 3I2ZA 3K0XA 1X3GA 4X65L 3S24A 4P72A 1PH7A 3M9BA 1X54A 2K52A 5IP9H 2R7FA 4HJAA 3CCVA 3CCRA 3RN5A 4A3EG 1W2BA 2Z6KC 2JEAI 1B8AA 3HOVH 1FJGL 2ZJQA 1MKHA 2YV5A 3B6YA 2F4VL 1VQDA 1I5FA 3F2CA 3TREA 1D7QA 1B70B 4FDBA 1GD7A 4UP8A 1PH3A 5IT9c 1S40A 1KQSA 1HR0W 1J6QA 1V1QA 1VQ5A 4LF7Q 4LF7L 4B3RQ 2UXBQ 3KF6A 3RZDH 2WFWA 1X65A 1KRSA 3BZCA 1V43A 4A4IA 1VQ4A 4GN3B 2R92G 1EIFA 4A93G 3UE0A 2I0QA 3W1BA 3CCEA 3LGJA 2E2IH 2A8VA 2LXKA 4BBRG 3S1QH 4A3BH 2UU9L 2JQOA 1K0RA 2I5HA 2NN6G 3L2PA 2Q2UA 2UU9Q 1KIXA 3M4QA 1W3SA 3CCSA 2B3GA 3GTKH 3L7ZC 4GNXC 1K9MC 2WB1E 2MO1A 4GN5A 3K7AH 4IPDA 4LW1A 2V1CC 4BA1I 1PHJA 1QUQB 1HZCA 4GN4B 4JI4L 1IZ6A 1RL2A 3BZKA 3GTOH 1OXSC 3BJUA 1AE3A 3D0FA 2A1AA 3PSIA 1PH8A 4BY7G 5IP7H 3E9HA 1Z9FA 1CKNB 2H5XA 1PH4A 4A3LG 5C4XG 3CCUA 1SFOH 3HOYG 1U0LA 4DR3L 1E1TA 4DR3Q 1Q1EA 2BH2A 3PF5A 4QQBX 1YVCA 2CKZB 1YNXA 1IYJB 2MQHA 2RF4A 3UDFA 4DR1L 4A3GH 4OO1G 4LF8L 2GN5A 4LF8Q 1X6OA 1N32L 5IYBH 1A0IA 1E1OA 4DK3C 1KXLA 2IHEA 5C0XJ 1N8RC 4L5QA 1WOCA 4DAMA 1LTLA 1N36L 1VQMA 4PZ6A 5E7NA 2VS1A 3AFQA 4MTNA 1YJNA 4DUZL 2CCZA 4A3IG 2KBNA 3H3VI 1Q8KA 4JI2Q 1Y14B 2L15A 1WYDA 5HY6A 1EWIA 4BBSH 4A3CH 2JJQA 3K8AA 4Y7NH 1WCMG 4JI0L 3CCQA 4JI0Q 1FGUA 3KDFA 4IFDJ 2UUCQ 1P16A 1I6HH 2NN6I 4JYAQ 2AMCB 1UE5A 1I50H 5M3FG 3CCLA 1YITA 4B3TQ 2KCMA 3PO3H 4X6AH 5JEAJ 5C4JH 2UUBL 4JOIC 4PMWA 3STBC 2EXDA 4O2DA 4AH6A 2K4KA 3TQYA 1IXRA 2UUAQ 2WP8J 3K80C 4TVAB 2B63G 2JA6G 4DR7L 2K5NA 3H0GG 4DUYQ 2AWNA 4P74A 2HHHL 1SRUA 1YZ6A 2CWPA 4A3FH 2BA0A 2B29A 1HNWQ 1HNWL 3NBHB 3RN2A 1L1OB 3CPFA 1XMOL 4KHPL 4OO1I 4DV5Q 3CMEA 4APVA 2Z6KA 3A0JA 4KLKA 3S2DH 2YYZA 2MFIA 2K5HA 1MJEA 3HOZH 1M1KC 2UXCL 1FL0A 2UXCQ 4GKJL 4GKJQ 1Q12A 5GROA 1QVGA 3ER0A 4C3HH 5M3MG 2LXJA 2R6GA 5FLMH 3S1RH 1Q7YC 4LF5L 2YTXA 1UE6A 5LMUL 5LMUQ 2K75A 1PV4A 1XNQL 1I3QH 4PZ8A 4LFCQ 1XNQQ 1PYBA 1CSQA 2NVQH 3HOWG 2WAQE 2IY5B 4YHHQ 4DV6Q 2JK8A 4DV6L 3PIOA 3CF5A 4LUOA 1IBKL 2Y0SE 3CAMA 3RNUA 4K0KL 1HH2P 3RLNA 4DKAC 2PI2E 1C0AA 3S16H 3NELA 2EIFA 5JJLA 1XJVA 1IL2A 1HR0L 4A3MH 1GVPA 4NXML 4NXMQ 4DR2L 4GNXA 5IE8A 1NTGA 3TRZA 1MJCA 1Q1BA 3J81i 1XTDA 3G71A 4JBMA 4DPGA 4IO9A 1Y1VG 1BBWA 3T1YL 4A3JG 5GADC 5C3EH 4HIMA 1NE3A 5IWAL 5IWAQ 1VQLA 4BY1G 1KL9A 4X65Q 3TS0A 4YCWA 4RG1A 2ATWA 4JC0A 4YY3L 4P71A 3IRBA 3HOUH 3F1ZA 2Q2IA 1FJGQ 3OYYA 2F4VQ 2N3SA 1JJGA 1UE1A 3W5OA 1L1OC 1SR3A 2K5VA 2PQAB 4C3JH 4H02A 3M4PA 4LNQA 5FJ8H 1JMCA 3JC66 5LMNW 1NMFA 2DGYA 3FHWA 3GTJH 1TWHH 3CW2C 3SGIA 4UPAA 3I4NG 2R93G 4R4QA 1CUKA 5M5XH 3HKZE 3T1HQ 3T1HL 4OXPA 1WCMH 2JA9A 5IYDH 4GKKQ 4GKKL 3FP9A 4B3ML 1HZBA 2E2JH 1KRTA 1XNRL 5ELNA 3I4MH 1YHBA 3EIVA 4HJ8A 3PO2G 4X64L 2BA1A 1EFWA 1T9HA 4OWTB 5IYCH 2JA8G 4BXXG 5DLQE 1HZAA 1EOVA 1EQRA 4JOIA 4YWMA 3CC4A 1BKBA 1R9TH 3CCMA 4KI0A 3HOXG 1PH2A 1LUZA 1UWVA 2ASBA 3UDIA 4DR6L 1YHQA 4JI4Q 2C35B 4KHZA 5JJKA 2JA6H 1JJ2A 3GTQH 3RLOA 3KOJA 3FKIH 5AJ3L 3CD6A 1GO3E 1K8GA 2AHOB 2I5LX 4R1JA 4DV7L 5M5YH 5C44G 1PH9A 4ME3A 1QUQA 1KAWA 4A3DH 1IBML 4DR1Q 1GM5A 1M90C 1N32Q 3K7UC 2EQSA 3PUZA 2VQEL 2VQEQ 5HGQA 3CCJA 1NBWA 2R7ZG 2ZJPA 1CKNA 2QA4A 3M4OH 4QIWE 4J15A 2MO0A 4LFAQ 3U4VA 1XPRA 1N36Q 4LUVA 1VQOA 4LFAL 1G6PA 4DUZQ 2NZOA 1BVSA 1VQNA 2RHSB 1SE8A 1S3OA 2PI2A 3I4OA 3U58A 2YU9H 4A3KG 4AYBE 3J80c 4XIGS 4DV4L 4JI8L 1TWAH 1PYSB 4JI6L 3G48A 2E2HH 1E22A 5IP9G 3HOVG 1VQGA 2OQKA 1EYGA 4YCUA 4Y52H 1Q86C 2Q2HA 2UUBQ 1EUJA 2XTIA 4HIDA 4OWXB 1S72A 1QVFA 2AKWB 4GOPC 2VZAA 1XPOA 1YHAA 4IPCA 2WB1G 2JA7H 2VNUD 4DR7Q 1L2FA 1SROA 2HHHQ 3UDGA 3HKSA 4HIKA 1O7IA 1IBLL 1IBLQ 4RMFA 1AH9A 3K81C 4GLVB 4DV0L 4DV0Q 3EBEA 5EAYA 1LYLA 1KD1C 4A3EH 4OX9L 1XMOQ 4OX9Q 4XTCS 3KFUA 4KHPQ 4A3BG 1J5EL 3WWVA 4C3IH 4JI1L 4JI1Q 4B3SL 1CSPA 1NY4A 2VY3A 3G6EA 3F2BA 1KC8C 3PUWA 1K3RA 4IOAA 1VQBA 3DLLA 2ZTCA 4JI5L 4AQYL 1L1OA 4AQYQ 1JB7A 4JI5Q 4UP9A 4LF5Q 2R93H 1MIUA 2VQFL 3J81j 2VQFQ 3H3VH 1A63A 4QGUA 4MZ9A 5IP7G 1K73C 4YCVA 2R92H 1YBYA 4NXNL 5GAEC 3D31A 1C9OA 1IBKQ 4A93H 3J7A5 2JA5G 1WJJA 2CWAA 1OXTA 4BBRH 2Q2TA 4WJ3M 3PV0A 3GTMH 2QEXA 3KLWA 4A3GG 4NPSA 2N8NA 4R4CA 4DR5L 4DR5Q 2UXDL 1HR0Q 5LMNL 1A8VA 2I5MX 3KF8B 5IYBG 3PIPA 1D8LA 3GO5A 2JE6I 2KHIA 4DR2Q 3S17H 3HOXH 3NENA 1SN8A 1E24A 4GLXA 4OWWB 2CFMA 3OW2A 1FVIA 4JG2A 2PMZE 3Q8DA 3KJPA 2D62A 3T1YQ 1X9NA 4BY7H 4BBSG 4A3CG 2OQ0A 4DV3L 4DV3Q 1TWFH 1N34L 5ELOA 5C4XH 1N34Q 4A3LH 3PUVA 5C44H 4LF4L 1XPUA 3HOYH 1ASYA 3M7NA 1UEBA 1VQCA 4PZ7A 2K50A 4YY3Q 2MNAA 3PO3G 1YJ9A 1KHIA 3S14H 3TS2A 1CKOA 4JI3L 4JI3Q 2N49A 3DM3A 3M85A 1BBUA 3UDXA 2R7DA 2RHQB 4X62L 3CC2A 2ES2A 2IX0A 4A3IH 2E5LL 1TWCH 3AEVA 4NB3A 4QL5A 1VQ6A 1VQPA 4IOCA 4JI7L 3RZOH 1VS0A 3E0EA 4IJLA 4TQUS 3CXCA 4A3FG 1I94L 3AYHB 5JJIA 2GVAA 3JAMi 4A3KH 1TXYA 1QZHA 1OXXK 2DUDA 2NVTH 4B3MQ 4HJ7A 2K14A 1EIYB 1NMGA 1E3PA 2PQAA 4GOPB 1XNRQ 2E8GA 3PF4A 4JCVE 5M3FH 4PG3A 3KF6B 4DK6C 4X64Q 3S15H 4OONA 1U5KA 1YEZA 2WAQG 4HJ5A 4LFBL 4LFBQ 3J7ZC 1SLJA 2Y0SG 1PH1A 3HOZG 3KYHC 4YWKA 4JBWA 2JEBI 1YJWA 1N9WA 2AWOA 3TEHB 4DR6Q 4DV1L 1VQEA 4DV1Q 1TWGH 2LSSA 5FLMG 3H0GH 4GOPA 1PA6A 2B63H 4B3RL 2N78A 2UXBL 1H95A 1G291 2IHFA 2KHJA 4JBKA 5AJ3Q 3CMAA 4DV7Q 3ICEA 1VQHA 1XMQQ 3PUXA 1XMQL 1QVCA 3ULLA 1Y1WG 4K0KQ 2YTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HT1 A;  4MNO A;  2A19 A;  3VDY A;  4YWL A;  5M5W H;  1IBM Q;  3ERS X;  3STB D;  3U4Z A;  3A5U A;  1VQ7 A;  4IPH A;  4GLA C;  4A3M G;  3S1N H;  2VUM G;  1PH5 A;  1PVO A;  1K8A C;  1B7Y B;  1CKM A;  5H1S E;  5M3M H;  4IPG A;  4P73 A;  1Q81 C;  4POF A;  4DAY B;  3I55 A;  5C3E G;  3GTG H;  5C0X G;  3GD7 A;  3A74 A;  4QY7 A;  4DV4 Q;  3HOW H;  4JI8 Q;  4JI6 Q;  2JA5 H;  4UY8 C;  2RCN A;  4R4O A;  1AE2 A;  3HKZ G;  1L0W A;  1VQJ A;  4R4I A;  1YIJ A;  3HOU G;  3I56 A;  1ASZ A;  2KCT A;  3ZJY C;  2ZTE A;  4IFD G;  1K83 H;  3KDF B;  3PCO B;  4P75 A;  2BH8 A;  1C7Y A;  5FJ8 G;  5JEA G;  1HNZ L;  1HNZ Q;  1VQ8 A;  2HQL A;  3F8T A;  3G4S A;  1N33 L;  1N33 Q;  1Y1V H;  1EQQ A;  4JI2 L;  4DNI A;  2OTL A;  3I7F A;  4BA2 I;  4A3J H;  4L5S A;  2QGQ A;  1PH6 A;  1E7Z A;  3ULP A;  1JJC B;  2IX1 A;  1JT8 A;  2ZM6 L;  2ZM6 Q;  2D0O A;  2XGT A;  5IYD G;  4BY1 H;  4LF6 Q;  2PNH A;  4LF6 L;  2ALY B;  4JV5 Q;  4JV5 L;  2UUC L;  3GDE A;  2F52 A;  1HZ9 A;  3J80 i;  1QZG A;  3I4M G;  4JYA L;  4B3T L;  3RR5 A;  3PUY A;  1J5E Q;  1DGS A;  5IYC G;  4B3S Q;  1VQA A;  4L5T A;  2F3I A;  1X55 A;  2UUA L;  1YI2 A;  1OXV A;  4EQ5 A;  2VW9 A;  4EX5 A;  2GVB A;  3CPW A;  3S1M H;  1UE7 A;  1X3E A;  4QJF A;  2FXQ A;  3RLF A;  4DUY L;  4DV2 L;  4DV2 Q;  5C0X I;  3I4N H;  3FKI G;  2IT1 A;  4IJH A;  4AIM A;  1VQ9 A;  1VQF A;  2CQO A;  3UE1 A;  2VL6 A;  5GAH C;  3H15 A;  2D0P A;  4NXN Q;  5IY0 A;  1HJP A;  1HNX Q;  1HNX L;  2OCE A;  4LF9 L;  4LF9 Q;  2HIV A;  1P8L A;  3W1G A;  2NVX H;  1V9P A;  4AYB G;  3PO2 H;  4A3D G;  4DV5 L;  1PFS A;  4DR4 L;  2HIX A;  4DR4 Q;  2JA8 H;  4BXX H;  2UXD Q;  3AFP A;  1SMX A;  4IFD I;  5LMN Q;  3J81 c;  1X3F A;  3ULJ A;  3HFZ B;  4L5R C;  3S2H H;  1Z47 A;  4C2M H;  2NVY H;  2OWO A;  1OXU A;  4HIO A;  5GQO A;  3BU2 A;  3A5Z B;  4A76 A;  1LM0 A;  2Z0S A;  5BR8 Q;  5BR8 L;  1VQI A;  1VQK A;  3MEF A;  3M3Y H;  5J3B A;  2YTY A;  4R4T A;  4GNX B;  4LFC L;  2ID0 A;  1OTC A;  3U50 C;  4LF4 Q;  1VCI A;  1WI5 A;  3PGZ A;  1GKH A;  4YHH L;  1Y1W H;  5FLX c;  4ALP A;  4GS3 A;  2KEN A;  3AQQ A;  3NEM A;  3F2D A;  2NZH A;  4LWC A;  1X56 A;  3GTP H;  2OTJ A;  1A62 A;  4LUZ A;  3CP0 A;  3OTO L;  1G51 A;  1WFQ A;  3CQZ H;  1JE5 A;  2ZTD A;  3OTO Q;  4HJ9 A;  2R7Z H;  5K36 G;  2ZJR A;  3E9I A;  2VUM H;  3GTL H;  3L0O A;  1Q46 A;  4POG A;  1NJI C;  4WJ4 A;  3EN2 A;  4O0A A;  4X62 Q;  2JA7 G;  4X66 L;  4X66 Q;  3CC7 A;  3KJO A;  4JBJ A;  3JAM c;  1RIP A;  4A75 A;  2E5L Q;  4JI7 Q;  5GAG C;  1I94 Q;  3MXN B;  4UP7 A;  1Q82 C;  3I2Z A;  3K0X A;  1X3G A;  4X65 L;  3S24 A;  4P72 A;  1PH7 A;  3M9B A;  1X54 A;  2K52 A;  5IP9 H;  2R7F A;  4HJA A;  3CCV A;  3CCR A;  3RN5 A;  4A3E G;  1W2B A;  2Z6K C;  2JEA I;  1B8A A;  3HOV H;  1FJG L;  2ZJQ A;  1MKH A;  2YV5 A;  3B6Y A;  2F4V L;  1VQD A;  1I5F A;  3F2C A;  3TRE A;  1D7Q A;  1B70 B;  4FDB A;  1GD7 A;  4UP8 A;  1PH3 A;  5IT9 c;  1S40 A;  1KQS A;  1HR0 W;  1J6Q A;  1V1Q A;  1VQ5 A;  4LF7 Q;  4LF7 L;  4B3R Q;  2UXB Q;  3KF6 A;  3RZD H;  2WFW A;  1X65 A;  1KRS A;  3BZC A;  1V43 A;  4A4I A;  1VQ4 A;  4GN3 B;  2R92 G;  1EIF A;  4A93 G;  3UE0 A;  2I0Q A;  3W1B A;  3CCE A;  3LGJ A;  2E2I H;  2A8V A;  2LXK A;  4BBR G;  3S1Q H;  4A3B H;  2UU9 L;  2JQO A;  1K0R A;  2I5H A;  2NN6 G;  3L2P A;  2Q2U A;  2UU9 Q;  1KIX A;  3M4Q A;  1W3S A;  3CCS A;  2B3G A;  3GTK H;  3L7Z C;  4GNX C;  1K9M C;  2WB1 E;  2MO1 A;  4GN5 A;  3K7A H;  4IPD A;  4LW1 A;  2V1C C;  4BA1 I;  1PHJ A;  1QUQ B;  1HZC A;  4GN4 B;  4JI4 L;  1IZ6 A;  1RL2 A;  3BZK A;  3GTO H;  1OXS C;  3BJU A;  1AE3 A;  3D0F A;  2A1A A;  3PSI A;  1PH8 A;  4BY7 G;  5IP7 H;  3E9H A;  1Z9F A;  1CKN B;  2H5X A;  1PH4 A;  4A3L G;  5C4X G;  3CCU A;  1SFO H;  3HOY G;  1U0L A;  4DR3 L;  1E1T A;  4DR3 Q;  1Q1E A;  2BH2 A;  3PF5 A;  4QQB X;  1YVC A;  2CKZ B;  1YNX A;  1IYJ B;  2MQH A;  2RF4 A;  3UDF A;  4DR1 L;  4A3G H;  4OO1 G;  4LF8 L;  2GN5 A;  4LF8 Q;  1X6O A;  1N32 L;  5IYB H;  1A0I A;  1E1O A;  4DK3 C;  1KXL A;  2IHE A;  5C0X J;  1N8R C;  4L5Q A;  1WOC A;  4DAM A;  1LTL A;  1N36 L;  1VQM A;  4PZ6 A;  5E7N A;  2VS1 A;  3AFQ A;  4MTN A;  1YJN A;  4DUZ L;  2CCZ A;  4A3I G;  2KBN A;  3H3V I;  1Q8K A;  4JI2 Q;  1Y14 B;  2L15 A;  1WYD A;  5HY6 A;  1EWI A;  4BBS H;  4A3C H;  2JJQ A;  3K8A A;  4Y7N H;  1WCM G;  4JI0 L;  3CCQ A;  4JI0 Q;  1FGU A;  3KDF A;  4IFD J;  2UUC Q;  1P16 A;  1I6H H;  2NN6 I;  4JYA Q;  2AMC B;  1UE5 A;  1I50 H;  5M3F G;  3CCL A;  1YIT A;  4B3T Q;  2KCM A;  3PO3 H;  4X6A H;  5JEA J;  5C4J H;  2UUB L;  4JOI C;  4PMW A;  3STB C;  2EXD A;  4O2D A;  4AH6 A;  2K4K A;  3TQY A;  1IXR A;  2UUA Q;  2WP8 J;  3K80 C;  4TVA B;  2B63 G;  2JA6 G;  4DR7 L;  2K5N A;  3H0G G;  4DUY Q;  2AWN A;  4P74 A;  2HHH L;  1SRU A;  1YZ6 A;  2CWP A;  4A3F H;  2BA0 A;  2B29 A;  1HNW Q;  1HNW L;  3NBH B;  3RN2 A;  1L1O B;  3CPF A;  1XMO L;  4KHP L;  4OO1 I;  4DV5 Q;  3CME A;  4APV A;  2Z6K A;  3A0J A;  4KLK A;  3S2D H;  2YYZ A;  2MFI A;  2K5H A;  1MJE A;  3HOZ H;  1M1K C;  2UXC L;  1FL0 A;  2UXC Q;  4GKJ L;  4GKJ Q;  1Q12 A;  5GRO A;  1QVG A;  3ER0 A;  4C3H H;  5M3M G;  2LXJ A;  2R6G A;  5FLM H;  3S1R H;  1Q7Y C;  4LF5 L;  2YTX A;  1UE6 A;  5LMU L;  5LMU Q;  2K75 A;  1PV4 A;  1XNQ L;  1I3Q H;  4PZ8 A;  4LFC Q;  1XNQ Q;  1PYB A;  1CSQ A;  2NVQ H;  3HOW G;  2WAQ E;  2IY5 B;  4YHH Q;  4DV6 Q;  2JK8 A;  4DV6 L;  3PIO A;  3CF5 A;  4LUO A;  1IBK L;  2Y0S E;  3CAM A;  3RNU A;  4K0K L;  1HH2 P;  3RLN A;  4DKA C;  2PI2 E;  1C0A A;  3S16 H;  3NEL A;  2EIF A;  5JJL A;  1XJV A;  1IL2 A;  1HR0 L;  4A3M H;  1GVP A;  4NXM L;  4NXM Q;  4DR2 L;  4GNX A;  5IE8 A;  1NTG A;  3TRZ A;  1MJC A;  1Q1B A;  3J81 i;  1XTD A;  3G71 A;  4JBM A;  4DPG A;  4IO9 A;  1Y1V G;  1BBW A;  3T1Y L;  4A3J G;  5GAD C;  5C3E H;  4HIM A;  1NE3 A;  5IWA L;  5IWA Q;  1VQL A;  4BY1 G;  1KL9 A;  4X65 Q;  3TS0 A;  4YCW A;  4RG1 A;  2ATW A;  4JC0 A;  4YY3 L;  4P71 A;  3IRB A;  3HOU H;  3F1Z A;  2Q2I A;  1FJG Q;  3OYY A;  2F4V Q;  2N3S A;  1JJG A;  1UE1 A;  3W5O A;  1L1O C;  1SR3 A;  2K5V A;  2PQA B;  4C3J H;  4H02 A;  3M4P A;  4LNQ A;  5FJ8 H;  1JMC A;  3JC6 6;  5LMN W;  1NMF A;  2DGY A;  3FHW A;  3GTJ H;  1TWH H;  3CW2 C;  3SGI A;  4UPA A;  3I4N G;  2R93 G;  4R4Q A;  1CUK A;  5M5X H;  3HKZ E;  3T1H Q;  3T1H L;  4OXP A;  1WCM H;  2JA9 A;  5IYD H;  4GKK Q;  4GKK L;  3FP9 A;  4B3M L;  1HZB A;  2E2J H;  1KRT A;  1XNR L;  5ELN A;  3I4M H;  1YHB A;  3EIV A;  4HJ8 A;  3PO2 G;  4X64 L;  2BA1 A;  1EFW A;  1T9H A;  4OWT B;  5IYC H;  2JA8 G;  4BXX G;  5DLQ E;  1HZA A;  1EOV A;  1EQR A;  4JOI A;  4YWM A;  3CC4 A;  1BKB A;  1R9T H;  3CCM A;  4KI0 A;  3HOX G;  1PH2 A;  1LUZ A;  1UWV A;  2ASB A;  3UDI A;  4DR6 L;  1YHQ A;  4JI4 Q;  2C35 B;  4KHZ A;  5JJK A;  2JA6 H;  1JJ2 A;  3GTQ H;  3RLO A;  3KOJ A;  3FKI H;  5AJ3 L;  3CD6 A;  1GO3 E;  1K8G A;  2AHO B;  2I5L X;  4R1J A;  4DV7 L;  5M5Y H;  5C44 G;  1PH9 A;  4ME3 A;  1QUQ A;  1KAW A;  4A3D H;  1IBM L;  4DR1 Q;  1GM5 A;  1M90 C;  1N32 Q;  3K7U C;  2EQS A;  3PUZ A;  2VQE L;  2VQE Q;  5HGQ A;  3CCJ A;  1NBW A;  2R7Z G;  2ZJP A;  1CKN A;  2QA4 A;  3M4O H;  4QIW E;  4J15 A;  2MO0 A;  4LFA Q;  3U4V A;  1XPR A;  1N36 Q;  4LUV A;  1VQO A;  4LFA L;  1G6P A;  4DUZ Q;  2NZO A;  1BVS A;  1VQN A;  2RHS B;  1SE8 A;  1S3O A;  2PI2 A;  3I4O A;  3U58 A;  2YU9 H;  4A3K G;  4AYB E;  3J80 c;  4XIG S;  4DV4 L;  4JI8 L;  1TWA H;  1PYS B;  4JI6 L;  3G48 A;  2E2H H;  1E22 A;  5IP9 G;  3HOV G;  1VQG A;  2OQK A;  1EYG A;  4YCU A;  4Y52 H;  1Q86 C;  2Q2H A;  2UUB Q;  1EUJ A;  2XTI A;  4HID A;  4OWX B;  1S72 A;  1QVF A;  2AKW B;  4GOP C;  2VZA A;  1XPO A;  1YHA A;  4IPC A;  2WB1 G;  2JA7 H;  2VNU D;  4DR7 Q;  1L2F A;  1SRO A;  2HHH Q;  3UDG A;  3HKS A;  4HIK A;  1O7I A;  1IBL L;  1IBL Q;  4RMF A;  1AH9 A;  3K81 C;  4GLV B;  4DV0 L;  4DV0 Q;  3EBE A;  5EAY A;  1LYL A;  1KD1 C;  4A3E H;  4OX9 L;  1XMO Q;  4OX9 Q;  4XTC S;  3KFU A;  4KHP Q;  4A3B G;  1J5E L;  3WWV A;  4C3I H;  4JI1 L;  4JI1 Q;  4B3S L;  1CSP A;  1NY4 A;  2VY3 A;  3G6E A;  3F2B A;  1KC8 C;  3PUW A;  1K3R A;  4IOA A;  1VQB A;  3DLL A;  2ZTC A;  4JI5 L;  4AQY L;  1L1O A;  4AQY Q;  1JB7 A;  4JI5 Q;  4UP9 A;  4LF5 Q;  2R93 H;  1MIU A;  2VQF L;  3J81 j;  2VQF Q;  3H3V H;  1A63 A;  4QGU A;  4MZ9 A;  5IP7 G;  1K73 C;  4YCV A;  2R92 H;  1YBY A;  4NXN L;  5GAE C;  3D31 A;  1C9O A;  1IBK Q;  4A93 H;  3J7A 5;  2JA5 G;  1WJJ A;  2CWA A;  1OXT A;  4BBR H;  2Q2T A;  4WJ3 M;  3PV0 A;  3GTM H;  2QEX A;  3KLW A;  4A3G G;  4NPS A;  2N8N A;  4R4C A;  4DR5 L;  4DR5 Q;  2UXD L;  1HR0 Q;  5LMN L;  1A8V A;  2I5M X;  3KF8 B;  5IYB G;  3PIP A;  1D8L A;  3GO5 A;  2JE6 I;  2KHI A;  4DR2 Q;  3S17 H;  3HOX H;  3NEN A;  1SN8 A;  1E24 A;  4GLX A;  4OWW B;  2CFM A;  3OW2 A;  1FVI A;  4JG2 A;  2PMZ E;  3Q8D A;  3KJP A;  2D62 A;  3T1Y Q;  1X9N A;  4BY7 H;  4BBS G;  4A3C G;  2OQ0 A;  4DV3 L;  4DV3 Q;  1TWF H;  1N34 L;  5ELO A;  5C4X H;  1N34 Q;  4A3L H;  3PUV A;  5C44 H;  4LF4 L;  1XPU A;  3HOY H;  1ASY A;  3M7N A;  1UEB A;  1VQC A;  4PZ7 A;  2K50 A;  4YY3 Q;  2MNA A;  3PO3 G;  1YJ9 A;  1KHI A;  3S14 H;  3TS2 A;  1CKO A;  4JI3 L;  4JI3 Q;  2N49 A;  3DM3 A;  3M85 A;  1BBU A;  3UDX A;  2R7D A;  2RHQ B;  4X62 L;  3CC2 A;  2ES2 A;  2IX0 A;  4A3I H;  2E5L L;  1TWC H;  3AEV A;  4NB3 A;  4QL5 A;  1VQ6 A;  1VQP A;  4IOC A;  4JI7 L;  3RZO H;  1VS0 A;  3E0E A;  4IJL A;  4TQU S;  3CXC A;  4A3F G;  1I94 L;  3AYH B;  5JJI A;  2GVA A;  3JAM i;  4A3K H;  1TXY A;  1QZH A;  1OXX K;  2DUD A;  2NVT H;  4B3M Q;  4HJ7 A;  2K14 A;  1EIY B;  1NMG A;  1E3P A;  2PQA A;  4GOP B;  1XNR Q;  2E8G A;  3PF4 A;  4JCV E;  5M3F H;  4PG3 A;  3KF6 B;  4DK6 C;  4X64 Q;  3S15 H;  4OON A;  1U5K A;  1YEZ A;  2WAQ G;  4HJ5 A;  4LFB L;  4LFB Q;  3J7Z C;  1SLJ A;  2Y0S G;  1PH1 A;  3HOZ G;  3KYH C;  4YWK A;  4JBW A;  2JEB I;  1YJW A;  1N9W A;  2AWO A;  3TEH B;  4DR6 Q;  4DV1 L;  1VQE A;  4DV1 Q;  1TWG H;  2LSS A;  5FLM G;  3H0G H;  4GOP A;  1PA6 A;  2B63 H;  4B3R L;  2N78 A;  2UXB L;  1H95 A;  1G29 1;  2IHF A;  2KHJ A;  4JBK A;  5AJ3 Q;  3CMA A;  4DV7 Q;  3ICE A;  1VQH A;  1XMQ Q;  3PUX A;  1XMQ L;  1QVC A;  3ULL A;  1Y1W G;  4K0K Q;  2YTV A; 
#chains in the Genus database with same CATH topology
 3VDY A;  2A19 A;  4YWL A;  5M5W H;  2KCN A;  4KMU C;  2F3V A;  1D5X C;  3U4Z A;  1ZXT A;  2KOL A;  3QO2 A;  1OO9 B;  4IQZ A;  1PVO A;  1CKM A;  1RKN A;  5H1S E;  1BCP D;  1Q81 C;  3I55 A;  3GTG H;  3HOW H;  4C1N I;  5T1I A;  5FOB B;  1AP0 A;  2F0M A;  2RCN A;  4XDX A;  3I56 A;  2NVY B;  3Q24 A;  3DWQ A;  1TKW B;  3PCO B;  1ET9 A;  1U9R A;  5JEA G;  3M3Y B;  1N33 L;  3I7F A;  4ILW A;  2QGQ A;  4HTH A;  1PH6 A;  5E4W C;  2ZM6 L;  2D0O A;  2XGT A;  2WKC A;  2VB2 X;  2UUC L;  2F52 A;  1J8I A;  4B3T L;  4B9W A;  2R7Z B;  2WIN B;  1J5E Q;  1D2B A;  1E2W A;  2VUM B;  4RCN A;  4V0B A;  4L5T A;  5HGT A;  1OXV A;  1KNA A;  1EQV A;  3X3N A;  4EQO A;  1UE7 A;  4FXD A;  1X3E A;  3RLF A;  3C2P A;  1G91 A;  4DV2 L;  1PLF A;  3I4N H;  1TS4 A;  2Z4H A;  4IJH A;  3QG1 A;  1VQF A;  5GAH C;  2VL6 A;  3H15 A;  3VR4 A;  5IY0 A;  4LF9 L;  3W1G A;  4UHV A;  5D65 A;  2NVX H;  3PO2 H;  5CV5 A;  4DR4 L;  4L8J A;  4BXX H;  1HA6 A;  1S5C D;  3TP6 A;  4C2M H;  2OWO A;  1OXU A;  3RZD B;  1B50 A;  3A5Z B;  4A76 A;  1LM0 A;  1KLG D;  4FF2 A;  5CV6 A;  1VQK A;  2YTY A;  2E2I B;  2KQ3 A;  4GNX B;  2ID0 A;  1OTC A;  4LF4 Q;  3S1Q B;  1EFI D;  4GS3 A;  4WRD A;  4LWC A;  4G7H C;  3I70 A;  2EXZ A;  3FPU B;  4LUZ A;  1ICF B;  1WFQ A;  3CQZ H;  5K36 G;  1JE5 A;  4HJ9 A;  1ENA A;  4POG A;  4X62 Q;  1F2M A;  2JA7 G;  3CC7 A;  4JBJ A;  4A75 A;  5CC4 A;  3ITP A;  4JI7 Q;  5LL6 X;  1I94 Q;  3VR3 A;  2PW5 A;  4AYB B;  1ENF A;  5JPM C;  3RN5 A;  5IP9 H;  2R7F A;  4EQP A;  4A3E G;  2JEA I;  3HOV H;  4FVM A;  2L5T A;  4C3I G;  2Q8T A;  2ZJQ A;  1I4P A;  5DM6 3;  1D7Q A;  1GD7 A;  1PH3 A;  5IT9 c;  4C3H G;  4BBS B;  5IT9 E;  4RGO S;  4B3R Q;  3NUC A;  5KGU A;  1VQ4 A;  4KJN A;  1EIF A;  1EIG A;  3FPP A;  4K5W A;  3LGJ A;  5C4J B;  1CM9 A;  1K0R A;  2I5H A;  4G4K A;  2K05 A;  1CFM A;  4LK1 C;  4JI4 L;  1IZ6 A;  1RL2 A;  3BZK A;  3T4A C;  1AE3 A;  1SFO H;  1SYE A;  4FF4 A;  1LT5 D;  3S2D B;  2Y0S B;  1YNX A;  2MQH A;  4A3G H;  4F8M A;  1PFB A;  2SDF A;  1WTR A;  2JXM B;  2E76 C;  1A0I A;  2DJF C;  1QNK A;  5C0X J;  1STG A;  4L5Q A;  3M7G A;  2C9O A;  1N36 L;  4PZ6 A;  5E7N A;  4MTN A;  2KBN A;  2XWB B;  4PV1 C;  2BOS A;  2PMZ B;  1Y14 B;  4A3C H;  2JJQ A;  3KDF A;  1DJR D;  4RKB A;  2UUC Q;  2AMC B;  4IUR A;  1I50 H;  1YIT A;  4B3T Q;  3PO3 H;  3H6M A;  2UUB L;  4JOI C;  4O2D A;  2NB0 A;  2K4K A;  3TQY A;  1G2T A;  3K80 C;  2IL8 A;  3OSO A;  4TVA B;  4M1U B;  2JA6 G;  2XNA C;  1BCP C;  3H0G G;  4P2C B;  1V8Q A;  2HHH L;  3G6J B;  5BN5 A;  1ILQ A;  2J4X A;  3EVQ A;  4S3S A;  5CV4 A;  2BA0 A;  2K32 A;  1HNW L;  1SXT A;  4KD4 A;  3ONA B;  3RN2 A;  2X6L A;  1XMO L;  1GXD C;  4KHP L;  3KLR A;  3BVM A;  4X3K A;  3VYT A;  2UXC Q;  1B53 A;  2TMP A;  2ENB A;  3D6C A;  1Q12 A;  4ZUJ A;  4WOR A;  2LXJ A;  1PFM A;  3BG3 A;  4LF5 L;  1STH A;  1WCM B;  4FXG C;  3KBG A;  2K75 A;  4HCE A;  1XNQ L;  4PZ8 A;  1PYB A;  3HOW G;  4ZLT F;  2WAQ E;  4DV6 L;  1IBK L;  4LUO A;  3DWA A;  3CHB D;  3RNU A;  3A55 A;  4ABN A;  1HH2 P;  4DKA C;  3S16 H;  4A3M H;  1GVP A;  1XX8 A;  1BQQ T;  4CDE C;  1TWG B;  1NTG A;  2L1B A;  4L6T B;  5KNC A;  1XTD A;  5JVH 3;  4IO9 A;  3EJI A;  4CKB A;  1O7L A;  2ICI A;  5C0X H;  5IWA Q;  1K3B C;  1KL9 A;  3OHX C;  4TRD A;  2ATW A;  4Z9C B;  3FRP B;  3F1Z A;  3M4O B;  3DEP A;  5CMD A;  5IGF A;  1S5D D;  2K5V A;  5AFW A;  2FIN B;  3N52 A;  2DGY A;  1AZQ A;  1MGS A;  2PQE A;  1BNZ A;  3CW2 C;  3SGI A;  4UPA A;  3I4N G;  3TDQ A;  1B2T A;  3T1H Q;  5TSS A;  1EOT A;  2JA9 A;  4GKK L;  1WTH A;  2E2J H;  1SYD A;  1XNR L;  3EIV A;  3PO2 G;  4CDC C;  4OWT B;  1HFG A;  1LTS D;  3LWE A;  2F0W A;  4BXX G;  5DLQ E;  2H4O A;  2F0J A;  2WAC A;  2JA7 B;  1KAA A;  1R9T H;  5KYI A;  3IKJ A;  3IL8 A;  4QMG A;  1UWV A;  3UDI A;  4JI4 Q;  4KHZ A;  5JJK A;  2IPK D;  2A69 D;  1JJ2 A;  2I07 B;  3E0J A;  3CD6 A;  1GO3 E;  3NQT A;  5A35 A;  2I5L X;  4A3E B;  3DMU A;  2D2C C;  2R3Z A;  4ME5 A;  1L0X B;  1HHV A;  4ME3 A;  4C3I B;  2QCP X;  3L9A X;  1KAW A;  5IGB A;  5I9O A;  2XRQ D;  3PUZ A;  2VQE Q;  3S1M B;  3T13 A;  4QIW E;  2MO0 A;  4LFA L;  1N36 Q;  2R93 B;  1G6P A;  2G9D A;  1HPC A;  5DAU A;  4XIG S;  4JI8 L;  1TWA H;  1PYS B;  4FXK C;  4JI6 L;  2JN4 A;  5IP9 G;  3T56 B;  3HOV G;  1VQG A;  4YCU A;  3MC0 B;  2Q2H A;  2UUB Q;  4EQN A;  2CQA A;  3OWF A;  2Z9H A;  5CBE E;  2AKW B;  5IT9 L;  1L0Y B;  2HHH Q;  3UDG A;  4HIK A;  1IBL Q;  4KY7 A;  1AH9 A;  3K81 C;  3NTK A;  4GLV B;  2K5Q A;  2MP1 A;  2RKS A;  2TSS A;  3EBE A;  4DV0 Q;  3AMU A;  4OX9 L;  1XMO Q;  4KHP Q;  1BO0 A;  1FYC A;  4B3S L;  4XQQ A;  3A7L A;  3G6E A;  3M4Y A;  4O1N A;  1EEF D;  1KC8 C;  1K3R A;  3RZO B;  3QB3 A;  3OIQ A;  4JI5 L;  4AQY Q;  1JB7 A;  4UP9 A;  2MJ8 A;  4LF5 Q;  4BS9 A;  2NVT B;  3H3V H;  4K6D A;  3J81 j;  4QGU A;  4NXN L;  3S15 B;  1IBK Q;  3H3V C;  4BBR H;  1STA A;  2PYK A;  5I6W A;  5ISR A;  4A3G G;  4DR5 L;  4KHV A;  1WVL A;  3H0G B;  3S17 H;  2R61 A;  1TII D;  2CFM A;  4OWW B;  2K04 A;  3Q8D A;  3IFT A;  4PQX A;  2EY1 A;  4PMC A;  4B9X A;  3J7A V;  4A3C G;  1N34 L;  1TWF H;  5ELO A;  4K6L A;  3HOY H;  1C4Q A;  1XPU A;  5M5W B;  2KUM A;  4PZ7 A;  5EBC A;  3SVM A;  2K50 A;  3PQI A;  3PO3 G;  3S14 H;  3E6Z X;  4KV6 A;  1CKO A;  2N49 A;  1F9Q A;  3M85 A;  2XN9 C;  3H91 A;  2OT2 A;  3GTG B;  4KK7 A;  1TWC H;  1VQP A;  3HOW B;  1VMP A;  1KTK A;  3E3X A;  4A3K H;  3TP5 A;  1LTI D;  1EIY B;  2OXP A;  4GOP B;  1XNR Q;  4DK6 C;  1LLR D;  3TN2 A;  1CHQ D;  1SLJ A;  1DOL A;  2JEB I;  3WOE A;  3MXP A;  4DV1 L;  4GOP A;  1TWG H;  1PA6 A;  1Y69 U;  2UXB L;  1EY9 A;  1I6H B;  2K5W A;  1XMQ Q;  3PUX A;  1B3A A;  3A8I E;  4FF3 A;  4K0K L;  5IOD A;  5KEE A;  2MGS A;  3CKI B;  3A5U A;  3GV3 A;  5F2D A;  5JOB A;  1VQ7 A;  4A3M G;  3S1N H;  3DXJ C;  2VUM G;  1B7Y B;  5DM7 3;  3I4N B;  2J0T D;  1BUV T;  4P73 A;  4DAY B;  1TS3 A;  5C0X G;  3GD7 A;  2B2U A;  3RD4 A;  2NVX B;  4JI8 Q;  2BE5 D;  1D1I A;  4JI6 Q;  4R4O A;  3BS1 A;  3HOZ B;  4LAA A;  1L0W A;  4C2M B;  2ZTE A;  3NWS A;  4EVO A;  2HQE A;  2K28 A;  4DF7 A;  4G7Z C;  1LTB D;  1STY A;  3KK7 A;  2A69 C;  4BA2 I;  2Q8I B;  1AFP A;  5EKK A;  4A3J H;  4L5S A;  3ULP A;  4LF6 Q;  1LAB A;  1JB3 A;  2PNH A;  3GDE A;  3J80 i;  1HZ9 A;  2BCO A;  4JVZ A;  1QZG A;  3RR5 A;  4KKU A;  4B3S Q;  1VQA A;  1HUM A;  3GP7 A;  2LMC B;  1V1P B;  2VW9 A;  5ELC A;  2RDF A;  4EX5 A;  3CPW A;  2HUG A;  3S1M H;  1K28 A;  4QJF A;  5C5M A;  1GUT A;  4DUY L;  5FKA C;  5CBA E;  4RAU C;  1VQ9 A;  3HOV B;  2CQO A;  3UE1 A;  3HKZ B;  4ZUI A;  4NXN Q;  2VB3 X;  4OL7 A;  2OCE A;  2HIV A;  1P8L A;  4AYB G;  2XWJ B;  2QDL A;  4OIK A;  1SMX A;  1NSN S;  1F9P A;  1ET6 A;  3HFZ B;  1HXY D;  4L5R C;  2AUJ D;  2HDM A;  1IYV A;  4XYO A;  4YIJ A;  1Y8N B;  3BU2 A;  3MZ5 A;  5I6Y A;  2B2T C;  1VQI A;  1K0S A;  5J3B A;  3MEH A;  4N8X 1;  1CZG A;  3PGZ A;  4MIU A;  5FLX c;  1ZEQ X;  2B2W A;  3AQQ A;  3HZX A;  1ESR A;  1A62 A;  4RHS A;  1WTX A;  1G51 A;  2ZTD A;  4FYD A;  3L0O A;  1Q46 A;  1Q3L A;  1NJI C;  3EN2 A;  3KJO A;  3JAM c;  1S5B D;  1SFO B;  4JW0 A;  3MXN B;  1RCV D;  2RSO A;  3I2Z A;  3S24 A;  2HCI A;  3GTP H;  2G5D A;  1PFN A;  2I46 A;  1B8A A;  2F4V L;  3B6Y A;  1KLU D;  3MXN A;  1B70 B;  4UP8 A;  2G9H D;  1KQS A;  3EFX D;  5C3X A;  1J6Q A;  2QF7 A;  2UXB Q;  3KF6 A;  2WFW A;  3BVZ A;  4M8A A;  1X65 A;  1KRS A;  3BZC A;  1SNP A;  1I50 B;  4QF4 A;  1EYA A;  2WV6 D;  3T51 B;  3PO3 B;  5D3D A;  2I0Q A;  4FO2 A;  1VDZ A;  4BBR G;  4A3B H;  2JQO A;  3CC4 A;  1BCP B;  3M4Q A;  2BDN A;  2B3G A;  3I3C A;  1K9M C;  2WB1 E;  4GN5 A;  4J8Q A;  3SEB A;  2O5J C;  4LW1 A;  5EPJ A;  3T53 B;  1QUQ B;  5I9P A;  1KDB A;  3PSI A;  1PH8 A;  5ELE A;  5IGE A;  1PH4 A;  1CKN B;  2KJX A;  1FR3 A;  3HOY G;  3HEJ A;  1PZJ D;  1E1T A;  1Q1E A;  3WOF A;  4X3T A;  4KD3 A;  1CI3 M;  1H9S B;  4DR1 L;  3MFY A;  1N32 L;  1X6O A;  1SND A;  5EKI A;  3MXG A;  1KXL A;  3OW7 A;  1N8R C;  1II3 A;  4DAM A;  1LTL A;  2KEE A;  3G7L A;  2VS1 A;  3AFQ A;  5C3W A;  1H9S A;  1QJO A;  4Y7N H;  1R4Q B;  2L0C A;  1WCM G;  3CCQ A;  3S16 B;  4IFD J;  3IAY A;  1I6H H;  4Q5V A;  1UE5 A;  4A3M B;  3CCL A;  2KCM A;  3I8Z A;  3NXW A;  3I4L A;  4AH6 A;  2DNC A;  4WJW A;  4DUY Q;  1Q90 A;  1TY0 A;  5KNB A;  2CWP A;  4XQN A;  2B29 A;  3NBH B;  2BE5 C;  1S5E D;  1U4R A;  1F2Z A;  2Z6K A;  3A0J A;  4KLK A;  1RD9 D;  2MFI A;  1MJE A;  3HOZ H;  2UXC L;  2D5D A;  4A3I B;  3NP8 A;  5GRO A;  1EU4 A;  3S1R H;  4HED A;  1PXU A;  2F1M A;  3BYT B;  3LX0 A;  2E2J B;  4IZ8 A;  1CSQ A;  1LAC A;  1JOR A;  1SBB B;  2JK8 A;  4ZKB B;  2Y0S E;  3NEL A;  1R9T B;  5JJL A;  1IL2 A;  3KLS X;  3C1F A;  4NXM Q;  4GNX A;  1EQT A;  1F9S A;  2Z1C A;  5BN3 A;  2N88 A;  4MTK A;  5C3E H;  4HIM A;  4A3J G;  5IWA L;  1VQL A;  2QIL A;  1LT6 D;  1SAP A;  3Q22 A;  2MHV A;  1SSO A;  4HAE A;  4JC0 A;  3HOU H;  1HQM C;  3MA2 B;  1TY2 A;  5ELF A;  3OYY A;  2F4V Q;  3SK4 A;  4IFD H;  4HMJ A;  2B8F A;  2EJM A;  1L1O C;  2PQA B;  4LNQ A;  3M4P A;  5LMN W;  1NMF A;  3GTJ H;  1TWH H;  2R93 G;  3D4R A;  1EU3 A;  1TWA B;  4R4Q A;  4K8J A;  4K8I A;  3T1H L;  4OXP A;  5IYD H;  5EKL A;  3FP9 A;  3V05 A;  4B3M L;  1D5Z C;  1EL0 A;  1YHB A;  2BA1 A;  1EFW A;  5IYC H;  1EOV A;  4KN4 C;  2E75 C;  2EYH A;  4KI0 A;  3OMC A;  1PH2 A;  1LUZ A;  1PTO D;  2XVS A;  5G3L D;  2ASB A;  4DR6 L;  1YHQ A;  1NNX A;  3P1H A;  2L55 A;  4BY1 B;  5FO9 B;  1K8G A;  1DON A;  1S4Z A;  4R1J A;  1A3T A;  1PH9 A;  5FLX L;  4QCL A;  4A3D H;  1AEX A;  1EZ8 A;  3D8G A;  1IBM L;  4DR1 Q;  1M90 C;  1N32 Q;  2EQS A;  2VQE L;  1ZYR D;  4ULL A;  2LKV A;  1EIH A;  4FP5 D;  2FHT A;  3JAM L;  2JYO A;  2NZO A;  3C46 A;  1S3O A;  3J80 c;  4DV4 L;  4BBR B;  2E2H H;  3J80 E;  1E22 A;  2OQK A;  3GQB A;  3MXU A;  1SJH D;  2RSN A;  3ND8 A;  5IGG A;  1ROD A;  4KY5 A;  3S17 B;  4HID A;  4OWX B;  2B2Y A;  2O5I C;  1GHK A;  2SNS A;  2VZA A;  4IPC A;  1TWF B;  2B2V A;  5JJZ A;  3CU7 A;  3HOY B;  1DCZ A;  1O7I A;  4ZK9 B;  4DU9 A;  5KIX A;  1IBL L;  3TBI B;  1WTQ A;  1AN8 A;  4DV0 L;  1LYL A;  3S14 B;  4HN7 A;  4XTC S;  4A3B G;  1IYU A;  3PIO 3;  4OEM B;  2RDH A;  4IOA A;  1TWC B;  3U9O A;  1IHZ A;  3NE5 B;  4AQY L;  1HUN A;  4A3K B;  4K2L A;  1IKL A;  5CYU A;  2VQF Q;  1DOM A;  4MZ9 A;  4XT3 B;  1K73 C;  4YCV A;  3QOJ A;  3D31 A;  2EYP A;  3J7A 5;  2CH4 W;  3AB9 A;  2CWA A;  1EWC A;  1F9R A;  3SDZ A;  2NN6 H;  2UXD L;  3KLW A;  4NPS A;  1QOH A;  3KF8 B;  1TS5 A;  4CJ1 B;  2KHI A;  3HOX H;  4GLX A;  3H09 A;  3KJP A;  5CGK A;  4QB4 A;  5JPN C;  5C44 H;  4CDD C;  1LTT D;  2P5Z X;  3NBI A;  1ASY A;  3NK9 A;  4DK1 A;  3K57 A;  4CGY B;  2NWG A;  4TSS A;  1AW7 A;  1VF7 A;  3S1N B;  1KHI A;  2B39 A;  4OO1 H;  4CHT B;  5C4Z A;  1EY4 A;  4JI3 Q;  3DM3 A;  4DN4 M;  1QB5 D;  4DNT B;  4I65 A;  1O78 A;  5D3I B;  2F0E A;  4C1N K;  4A3I H;  3AEV A;  2K6A A;  4F88 A;  4IOC A;  4DGZ A;  3RUZ A;  2GVA A;  3JAM i;  1TXY A;  4NP5 A;  1OXX K;  3Q6S A;  4XT1 B;  4B3M Q;  4ODG A;  2K14 A;  1CHP D;  1F2L A;  4HJ7 A;  3PF4 A;  2E8G A;  1ICW A;  4JCV E;  1U5K A;  1YEZ A;  2NTS A;  3MVV A;  3SK5 A;  1CA6 A;  3HOZ G;  1GUG A;  4OEL B;  1MSH A;  1N9W A;  3TEH B;  4DR6 Q;  4A3J B;  2JP1 A;  1JOO A;  2PO4 A;  1CZW A;  1U4M A;  2IHF A;  1EY0 A;  3CMA A;  4G7O C;  1HA5 A;  2FMC A;  3DHQ A;  5IIF A;  2CVR A;  1XMQ L;  3ULL A;  2DN8 A;  3LNN A;  4V19 0;  2EJG C;  4MNO A;  3K58 A;  3Q23 A;  1IBM Q;  3STB D;  4GLA C;  3K59 A;  4WFN 3;  3I91 A;  4QUF A;  2F0D A;  4A3F B;  4IUU A;  1PRT B;  5C3E G;  3WDN A;  4DV4 Q;  1R4P B;  4RKL A;  2JA5 H;  1A3U A;  1NUC A;  1AE2 A;  2RDG A;  3HKZ G;  3V96 A;  1VQJ A;  2BDO A;  4R4I A;  3HOU G;  5LL6 S;  3RMH A;  1ASZ A;  1PTO H;  2IWH A;  4DAV A;  4IFD G;  2Z8L A;  1H9K A;  1K83 H;  3VR2 A;  2EOT A;  1JWM D;  1GHJ A;  1SE2 A;  1HNZ Q;  1RDP D;  1PTO C;  1VQ8 A;  3HGB A;  2HQL A;  3F8T A;  3HS0 C;  1Y1V H;  1M4V A;  1EQQ A;  1E7Z A;  3TSS A;  5E3F A;  4LF6 L;  5IYD G;  4BY1 H;  2DY8 A;  2QDB A;  1H9J A;  4JV5 Q;  4JYA L;  3T16 A;  4HR7 B;  1HTP A;  4RWS C;  5IYC G;  4X3S A;  1PDQ A;  2F3I A;  1O7Z A;  1ZYR C;  1YI2 A;  3A8J E;  4IUQ A;  4EQ5 A;  1PYW D;  3VYU A;  1QE6 A;  5A2Q L;  3SHL A;  4DK0 A;  5C0X I;  1JWU D;  1BCP F;  4AIM A;  3GTP B;  2WII B;  3R2I A;  5KRU A;  1HQR D;  2F0T A;  1HJP A;  1HNX Q;  2K7V A;  1GUS A;  2F0O A;  5D14 A;  4A3D G;  1PFS A;  2UXD Q;  2JA8 H;  3AFP A;  1CQF A;  2A6H D;  2WKD A;  3I73 A;  3S2H H;  1JIC A;  1Z47 A;  3I90 A;  3SE0 A;  4U67 3;  2H1E A;  1LT4 D;  5GQO A;  5BR8 Q;  2EY5 A;  2XRS D;  5I2Y A;  4R4T A;  3J80 L;  1XTC D;  4Q0F A;  3U50 C;  1VCI A;  4A3B B;  1GKH A;  1Y1W H;  1DD2 A;  2PZW A;  4KKS A;  3X3M A;  1X56 A;  2OTJ A;  3OTO Q;  3CP0 A;  5ELD A;  1GJX A;  4B08 A;  3GTL H;  3E9I A;  4QIW B;  3R93 A;  4WJ4 A;  4O0A A;  3K5L A;  4X66 Q;  5FO8 B;  4UP7 A;  1ESF A;  1Q82 C;  3DEO A;  3K0X A;  3NTH A;  3U9S A;  4P72 A;  1PH7 A;  1SEB D;  2K52 A;  5I4D A;  4HJA A;  4UDU C;  4JPB W;  4OIJ A;  1A2U A;  3DUZ A;  1MKH A;  2YV5 A;  2EJF C;  4RGN A;  3F2C A;  2EYO A;  4N9P A;  1I4H A;  2FJ2 A;  4IAL A;  5CR3 A;  1HR0 W;  1V1Q A;  1VQ5 A;  4Y7N B;  4LF7 Q;  4ZYS A;  2J7Z A;  4RGT A;  1QWY A;  2EDG A;  4K2K A;  5DEH A;  1S5F D;  2OEO A;  1E2Z A;  4CJ0 B;  1B9N A;  1KDA A;  2A8V A;  2UU9 Q;  2NN6 G;  1O7Y A;  1JCK B;  2DY7 A;  3K7A H;  2V1C C;  4GN4 B;  1V1O A;  1W6K A;  3GTO H;  1OXS C;  3BJU A;  1JR0 D;  1D5M C;  3D0F A;  2A1A A;  3A8K E;  5L37 A;  5IP7 H;  3K0Y A;  1X32 A;  4DR3 Q;  3SK8 A;  1STB A;  5K5P A;  2CKZ B;  4QUC A;  1IYJ B;  4KJO A;  3UDF A;  4OO1 G;  3NPP A;  4LF8 Q;  2GN5 A;  4DAY A;  2F0K A;  5IYB H;  5M9O A;  1E1O A;  1FGB D;  3TZD A;  4DK3 C;  4UAI A;  3S1R B;  1WOC A;  1VQM A;  2F0H A;  4A3I G;  3H3V I;  2R92 B;  2FFK B;  1WYD A;  1EWI A;  4JI0 Q;  3QWN A;  1FGU A;  1Z6H A;  4FNF A;  5KND A;  4JYA Q;  2PNR C;  1ONL A;  2IX3 A;  1SNC A;  1B4O A;  5EPK A;  3STB C;  2EXD A;  1IKM A;  2NYZ D;  2WP8 J;  2ZXP A;  3QIA A;  4H0L C;  5C3E B;  1K8M A;  4H44 C;  3C3L A;  1SRU A;  1YZ6 A;  4A3F H;  2NUC A;  2ZXR A;  1HCZ A;  4JK1 C;  5CV8 A;  1XXG A;  1V1P A;  3QJY A;  3HOU B;  1L1O B;  1FNU A;  3MAQ A;  4APV A;  1SMY D;  2L12 A;  1H9R A;  2NTT A;  4GKJ Q;  1DXM A;  2AQ2 B;  3GTJ B;  1TWH B;  2HCC A;  1SNO A;  1QVG A;  1STN A;  4C3H H;  1DOK A;  2AQ1 B;  3BDL A;  2YTX A;  1UE6 A;  5LMU Q;  3URY A;  1RTN A;  4LJZ C;  5FK9 C;  2M00 A;  1PV4 A;  4MHE A;  1I3Q H;  2QEJ C;  3PIO A;  5EBD A;  3CAM A;  3RLN A;  1C0A A;  5FLX E;  2EIF A;  1XJV A;  4NXM L;  3TRZ A;  3OOC A;  3J81 i;  4XXE A;  4CJ2 C;  4DPG A;  1Y1V G;  1BBW A;  3T1Y L;  2LS0 1;  5GAD C;  3JAM E;  4KKT A;  4A3D B;  4BY1 G;  3TS0 A;  1TT2 A;  4PMB A;  4YCW A;  4RG1 A;  1T5E A;  1VMC A;  2EY2 A;  1LTR D;  2Q2I A;  1UE1 A;  2A6H C;  3D3R A;  1YNN D;  1MSG A;  1QNU A;  4C3J H;  1ENC A;  5FJ8 H;  3JC6 6;  3FHW A;  3W2D A;  1NCV A;  1CUK A;  2E2H B;  2Z4I A;  1M8A A;  5IGD A;  1HZB A;  5ELN A;  3I4M H;  1TU2 B;  4HJ8 A;  4OHJ A;  3A54 A;  2JA8 G;  1WD1 A;  3K5M A;  1EQR A;  4JOI A;  5COY A;  1BKB A;  3CCM A;  3P20 A;  3L3O C;  2JA6 H;  1LT3 D;  3GTQ H;  1ILP A;  2A5H A;  3FKI H;  5AJ3 L;  2AHO B;  4DV7 L;  5M5Y H;  2M2L A;  3VR5 A;  3VA5 A;  2K5D A;  1QUQ A;  2A73 B;  4DAP A;  4R8I A;  1MHW C;  1CQV A;  1GM5 A;  4F7X A;  2KEC A;  5HGQ A;  3NHH A;  1I4X A;  2ZJP A;  1CKN A;  2QA4 A;  4J15 A;  5NUC A;  4LUV A;  4NKL A;  1BVS A;  2L11 A;  2F0P A;  3U58 A;  2YU9 H;  4A3K G;  4AYB E;  1X3Q A;  2F0I A;  1EYG A;  1Q86 C;  2Z6B A;  1EUJ A;  2XTI A;  3HOX B;  1BR9 A;  3MTS A;  1QVF A;  1YNJ D;  4GOP C;  1XPO A;  5T1G A;  2VNU D;  1JOK A;  5ELB A;  1L2F A;  5C44 B;  3HKS A;  4RH6 A;  1G8Z D;  4RMF A;  1G2S A;  1SYC A;  1SYB A;  2NZ1 D;  5EAY A;  4EGV A;  3KFU A;  2CW0 D;  1B44 D;  1F2Y A;  1RF2 D;  3WWV A;  2DJG C;  4JI1 Q;  1CSP A;  2VY3 A;  1TS2 A;  4K5V A;  1VQB A;  1EEI D;  2KHS A;  4X3U A;  2ZTC A;  3NBH A;  4J1M A;  5J1Z A;  2CH4 A;  1SDF A;  1EY6 A;  3PMF A;  2B2U C;  2VQF L;  2GA4 B;  5IP7 G;  2R92 H;  4A93 H;  1C9O A;  2X69 A;  2AUK A;  3E5S A;  2Q2T A;  4WJ3 M;  3PV0 A;  3GTM H;  2QEX A;  1HTL D;  2N8N A;  1TVX A;  2QKI C;  5LMN L;  5IYB G;  1PRT F;  3PIP A;  2WB1 B;  3QR8 A;  5JVG 3;  2LY7 A;  3GO5 A;  4XQJ A;  3NEN A;  5CV7 A;  4MN3 A;  3P7J A;  2PMZ E;  3R2T A;  3T1Y Q;  4BY7 H;  3OPO A;  2OQ0 A;  5C6A A;  4DV3 Q;  4A3L H;  5C4X H;  1JOQ A;  3PUV A;  4KN7 C;  1UUP A;  2Q8R E;  3IFD A;  3D4D A;  1VQC A;  2A74 C;  3GTK B;  3GV6 A;  1SNQ A;  1LTG D;  1YJ9 A;  3HRZ C;  1SMY C;  1NR4 A;  3TS2 A;  2PCF B;  4FF1 A;  4JI3 L;  2R7D A;  2RHQ B;  3CC2 A;  4OGQ C;  2ES2 A;  2E5L L;  4NB3 A;  4QL5 A;  1VS0 A;  4IJL A;  3NQI A;  2ZT9 C;  4TQU S;  5C5L A;  3CXC A;  3AYH B;  4A3F G;  1QZH A;  2JA5 B;  1NMG A;  2PQA A;  3K6O A;  4ID6 A;  5M3F H;  4PG3 A;  1PTO B;  2C5C A;  3J7Y W;  4OON A;  2WAQ G;  4LFB Q;  1K83 B;  1SNM A;  3KYH C;  3OMG A;  1FD7 D;  1Y1V B;  1KNE A;  1VQE A;  2B63 H;  2LSS A;  1JC7 A;  2E2D C;  1J9O A;  5AJ3 Q;  2ZXO A;  2SEB D;  4DV7 Q;  5A2Q E;  1VQH A;  4J6H A;  3D4W A;  2B2W C;  4NMZ A;  2XIW A;  1A3V A;  2YTV A;  2F0N A;  2HT1 A;  1NR2 A;  1EY7 A;  3FDT A;  3ERS X;  4IPH A;  4DFA A;  1YNN C;  1PH5 A;  1K8A C;  1DZ1 A;  5M3M H;  1QCB D;  4IPG A;  1BOS A;  4POF A;  3MHB A;  1GUO A;  3A74 A;  4QY7 A;  1WTW A;  2JA8 B;  4UY8 C;  4CBV A;  4DXF A;  4ZQ3 A;  3S2H B;  1YIJ A;  2A6E D;  2KCT A;  3ZJY C;  1D6E C;  2EPB A;  3KDF B;  2K01 A;  4P75 A;  4C3J G;  4ZKC B;  2BH8 A;  3R8B A;  5FJ8 G;  1C7Y A;  1HNZ L;  2MPM A;  4F87 A;  3G4S A;  1N33 Q;  2NVQ B;  4JI2 L;  4CKE A;  4DNI A;  2OTL A;  1HFN A;  2IX1 A;  4HCS A;  1Y1W B;  4DA2 A;  1JJC B;  3H94 A;  4DNR B;  1JT8 A;  2ZM6 Q;  2X6G A;  4IUP A;  3LWU A;  2ALY B;  4JV5 L;  3I4M G;  3PUY A;  1DGS A;  3GTL B;  1BF4 A;  1X55 A;  2UUA L;  2DNE A;  2GVB A;  2FXQ A;  4DV2 Q;  1TR5 A;  5JAV A;  3FKI G;  2IT1 A;  2RBM A;  4ZRZ A;  2D0P A;  1HNX L;  4LF9 Q;  1C48 A;  1V9P A;  4DV5 L;  4DR4 Q;  2HIX A;  4IFD I;  5LMN Q;  1EYD A;  3J81 c;  1X3F A;  3ULJ A;  1YNJ C;  2NVY H;  2SOB A;  3J81 E;  4HIO A;  1RTO A;  1RHP A;  5M5X B;  2Z0S A;  5BR8 L;  3MEF A;  3VR6 A;  3M3Y H;  4I7Z C;  4CDF C;  4LFC L;  1CTM A;  3KF8 A;  1W6J A;  1WI5 A;  3Q0A A;  4YHH L;  1MBY A;  4ALP A;  1EZ6 A;  2KEN A;  3NEM A;  2CW0 C;  2NZH A;  3F2D A;  3K7A B;  4K5X A;  3OTO L;  5EPL A;  2M9V A;  2R7Z H;  2ZJR A;  2VUM H;  2D9U A;  3GTO B;  1KAB A;  2RCF A;  4X66 L;  2E5L Q;  1RIP A;  5GAG C;  1WTP A;  1UEA B;  1KDC A;  1X3G A;  4X65 L;  3M9B A;  1X54 A;  2E74 C;  2CHB D;  3CCV A;  3CCR A;  1W2B A;  2Z6K C;  3UI2 A;  1SE3 A;  2F4I A;  1FJG L;  1LV9 A;  3NWT A;  1VQD A;  1I5F A;  3TRE A;  1STE A;  1K8O A;  4FDB A;  2IJ0 A;  3ND9 A;  5IGC A;  1S40 A;  2L9H A;  4LF7 L;  3RZD H;  4PNY A;  1V43 A;  4A4I A;  4GN3 B;  2R92 G;  2RA4 A;  4A93 G;  3R3O A;  3UE0 A;  3W1B A;  1Z7T A;  3CCE A;  2E2I H;  1Y8O B;  2LXK A;  3S1Q H;  3D6W A;  2UU9 L;  3L2P A;  2Q2U A;  1KIX A;  3CCS A;  1W3S A;  3GTK H;  3L7Z C;  4GNX C;  2MO1 A;  3V2T A;  2V4D A;  4IPD A;  4BA1 I;  4XYQ A;  2XSC A;  1PHJ A;  1B3Q A;  1HZC A;  2EE1 A;  2F0U A;  1ML0 D;  4BY7 G;  3E9H A;  1Z9F A;  4A3L G;  2H5X A;  5C4X G;  5EJW A;  3CCU A;  1U0L A;  2K1B A;  2SNM A;  4DR3 L;  2BH2 A;  2WAQ B;  3PF5 A;  4QQB X;  1YVC A;  5E1F A;  2RF4 A;  1A6X A;  3ZYY X;  5C4H A;  4LF8 L;  4HMI A;  2HD3 A;  4C3H B;  2IHE A;  1IW7 D;  1XYI A;  3BYY B;  1YJN A;  2K33 A;  4DUZ L;  2CCZ A;  1I3Q B;  2O2L D;  1Q8K A;  4JI2 Q;  2L15 A;  1DM0 B;  2O4X A;  5HY6 A;  3FVQ A;  4BBS H;  1C8C A;  3K8A A;  2B2T A;  3A7A B;  4NDX A;  2KED A;  4JI0 L;  5E4X A;  4C56 C;  3TP8 A;  4KY6 A;  1Y8P B;  1P16 A;  2NN6 I;  4H13 C;  3KLS A;  5M3F G;  4X6A H;  1PRT D;  1B9M A;  4RGM A;  5JEA J;  5C4J H;  4PMW A;  3TME A;  3I72 A;  2UUA Q;  1IXR A;  1BBX C;  3PIP 3;  2B63 G;  4DR7 L;  2K5N A;  2AWN A;  4P74 A;  1D1K A;  2ICE C;  3EA6 A;  3TP7 A;  1HNW Q;  5DNF A;  2EY6 A;  1BDO A;  3CPF A;  4OO1 I;  3HG9 A;  5HUR A;  4DV5 Q;  3CME A;  3S2D H;  4C3J B;  2YYZ A;  2A6E C;  2K5H A;  4RCO A;  1M1K C;  1FL0 A;  3OWE B;  4GKJ L;  3ER0 A;  5M3M G;  2R6G A;  5FLM H;  1Q7Y C;  5LMU L;  1EYC A;  5BN4 A;  1I4G A;  3K5N A;  3DWP A;  1XNQ Q;  4LFC Q;  3I4M B;  2NVQ H;  2IY5 B;  3OIP A;  5COR A;  4YHH Q;  3BDO A;  4DV6 Q;  3DM1 A;  3CF5 A;  2PI2 E;  2B2Y C;  1FNV A;  3VA7 A;  1FNW A;  1HR0 L;  2A68 D;  2EYF A;  4DR2 L;  5IE8 A;  2JA6 B;  3GTQ B;  1MJC A;  1Q1B A;  3G71 A;  2B2V C;  2F0S A;  4JBM A;  3FKI B;  5M5Y B;  1GUN A;  1NE3 A;  2EYM A;  4X65 Q;  1SJE D;  5J39 A;  1ZKO A;  1O80 A;  1Q8I A;  4YY3 L;  4O42 A;  4P71 A;  3IRB A;  1X3P A;  1FJG Q;  2NBF A;  2N3S A;  3TZU A;  5J22 A;  1JJG A;  1F77 A;  3W5O A;  2EZV A;  1SR3 A;  4H02 A;  2PZU A;  5JEA H;  1JMC A;  3FMC A;  4R9W A;  3P75 A;  2YU9 B;  1EY8 A;  1SYF A;  1CT1 D;  5M5X H;  2N55 A;  4IUV A;  3HKZ E;  3KUP A;  1WCM H;  4GKK Q;  4GZY C;  3F2U A;  1KRT A;  2EVB A;  4X64 L;  1T9H A;  2KA7 A;  4N9T A;  3J81 L;  2RVL A;  5EGT A;  3MWY W;  1HZA A;  4YWM A;  1JE4 A;  4CKC A;  3HOX G;  3NSW A;  2C35 B;  3RLO A;  3KOJ A;  1EWH A;  2FMM A;  5IOC A;  5C44 G;  1WTV A;  4ZCK A;  2B8G A;  1DYQ A;  4IUT A;  3CRL C;  3AU7 A;  1JQY D;  3K7U C;  4L63 B;  3CCJ A;  1NBW A;  2R7Z G;  2K03 A;  4N8F A;  3M4O H;  2RQX A;  3U4V A;  4LFA Q;  1XPR A;  2F0Q A;  4LMQ D;  1VQO A;  2EYL A;  4DUZ Q;  1CK1 A;  1VQN A;  3HP3 A;  2RHS B;  1B1Z A;  2QW7 A;  1SE8 A;  1SYG A;  2PI2 A;  4A93 B;  3I4O A;  2JSO A;  3PO2 B;  3N6R A;  2F0F A;  3ERO A;  3FEW X;  3G48 A;  3GTM B;  2MUY A;  2HDL A;  3NTI A;  4Y52 H;  4NW2 A;  2L4N A;  4I7A A;  5K36 H;  3K5O A;  1H9M A;  1S72 A;  1U4L A;  3BVG A;  3VYS A;  1YHA A;  3ERQ A;  2WB1 G;  4TKO B;  2JA7 H;  4BY7 B;  4RFB A;  4DR7 Q;  5C4X B;  1PTO F;  1SRO A;  5G3L F;  1I6V C;  1JWS D;  2F0L A;  2EYJ A;  3EQL C;  2F03 A;  1UAP A;  1LTA D;  1KD1 C;  4A3E H;  4KTA A;  4OX9 Q;  4HSP A;  3CQZ B;  1G6Z A;  1I4R A;  1PZK D;  1J5E L;  4HSV A;  4C3I H;  4JI1 L;  1RJT A;  4E6I A;  4H7B A;  1NY4 A;  3F2B A;  1GOZ A;  3PUW A;  1E2V A;  3DLL A;  1IW7 C;  3MFG A;  3BZD B;  3A56 A;  4JI5 Q;  1L1O A;  1QIL A;  2KVM A;  1UNS A;  2R93 H;  1TQO A;  1MIU A;  4ZAI A;  1A63 A;  1CA5 A;  1YBY A;  5GAE C;  5M3F B;  4DXG A;  2JA5 G;  1AZP A;  1WJJ A;  3S9W A;  1OXT A;  1U4P A;  1PRT C;  3QOL A;  4R4C A;  4DR5 Q;  5KYL A;  1HR0 Q;  1A8V A;  2I5M X;  1MI2 A;  1LO5 D;  1D8L A;  4DR2 Q;  1PZI D;  2JE6 I;  2B63 B;  1SN8 A;  1E24 A;  1VF5 C;  3OW2 A;  1FVI A;  3SXH A;  1IL8 A;  1PMR A;  4JG2 A;  2F0G A;  2D62 A;  1A15 A;  1X9N A;  2VXW A;  4BBS G;  4DV3 L;  1N34 Q;  1EY5 A;  3CRK C;  1BXT A;  4LF4 L;  1HRJ A;  3SR1 A;  1MD2 D;  3M7N A;  1UEB A;  3J7A F;  4IUN A;  2LFN A;  4YY3 Q;  2MNA A;  2AQ3 B;  1I4Q A;  5CV9 A;  2PPB C;  5LHY 1;  3BDC A;  5M3M B;  2OF1 A;  1BBU A;  3UDX A;  4BWG B;  2KCC A;  4X62 L;  1WD0 A;  3O13 A;  1WTO A;  2IX0 A;  2PZT A;  1VQ6 A;  1XWE A;  3RZO H;  4JI7 L;  3E0E A;  3W3A A;  1I94 L;  5JJI A;  4G57 A;  1GUW A;  4RA8 A;  2DUD A;  2NVT H;  4IN3 A;  3SK6 A;  4A3G B;  1E3P A;  2F0V A;  3C1E A;  4U68 A;  2IW3 A;  3S15 H;  3KF6 B;  4X64 Q;  2PW7 A;  5EQ0 A;  3VYR A;  4LFB L;  4HJ5 A;  1A2T A;  1SE4 A;  3KBX A;  3J7Z C;  2Y0S G;  1PH1 A;  2A68 C;  5FO7 B;  4YWK A;  1NAP A;  4JBW A;  1YJW A;  2AWO A;  1T5X D;  4K14 A;  4DV1 Q;  5FLM G;  3H0G H;  1QG7 A;  1H95 A;  4B3R L;  2N78 A;  1G29 1;  2KHJ A;  4JBK A;  1E0B A;  4RHR A;  3ICE A;  4R8N A;  1QVC A;  5I2X A;  1Y1W G;  2F3W A;  4K0K Q; 
#chains in the Genus database with same CATH homology
 2HT1 A;  4MNO A;  2A19 A;  3VDY A;  4YWL A;  5M5W H;  1IBM Q;  3ERS X;  3STB D;  3U4Z A;  3A5U A;  1VQ7 A;  4IPH A;  4GLA C;  4A3M G;  3S1N H;  2VUM G;  1PH5 A;  1PVO A;  1K8A C;  1B7Y B;  1CKM A;  5H1S E;  5M3M H;  4IPG A;  4P73 A;  1Q81 C;  4POF A;  4DAY B;  3I55 A;  5C3E G;  3GTG H;  5C0X G;  3GD7 A;  3A74 A;  4QY7 A;  4DV4 Q;  3HOW H;  4JI8 Q;  4JI6 Q;  2JA5 H;  4UY8 C;  2RCN A;  4R4O A;  1AE2 A;  3HKZ G;  1L0W A;  1VQJ A;  4R4I A;  1YIJ A;  3HOU G;  3I56 A;  1ASZ A;  2KCT A;  3ZJY C;  2ZTE A;  4IFD G;  1K83 H;  3KDF B;  3PCO B;  4P75 A;  2BH8 A;  1C7Y A;  5FJ8 G;  5JEA G;  1HNZ L;  1HNZ Q;  1VQ8 A;  2HQL A;  3F8T A;  3G4S A;  1N33 L;  1N33 Q;  1Y1V H;  1EQQ A;  4JI2 L;  4DNI A;  2OTL A;  3I7F A;  4BA2 I;  4A3J H;  4L5S A;  2QGQ A;  1PH6 A;  1E7Z A;  3ULP A;  1JJC B;  2IX1 A;  1JT8 A;  2ZM6 L;  2ZM6 Q;  2D0O A;  2XGT A;  5IYD G;  4BY1 H;  4LF6 Q;  2PNH A;  4LF6 L;  2ALY B;  4JV5 Q;  4JV5 L;  2UUC L;  3GDE A;  2F52 A;  1HZ9 A;  3J80 i;  1QZG A;  3I4M G;  4JYA L;  4B3T L;  3RR5 A;  3PUY A;  1J5E Q;  1DGS A;  5IYC G;  4B3S Q;  1VQA A;  4L5T A;  2F3I A;  1X55 A;  2UUA L;  1YI2 A;  1OXV A;  4EQ5 A;  2VW9 A;  4EX5 A;  2GVB A;  3CPW A;  3S1M H;  1UE7 A;  1X3E A;  4QJF A;  2FXQ A;  3RLF A;  4DUY L;  4DV2 L;  4DV2 Q;  5C0X I;  3I4N H;  3FKI G;  2IT1 A;  4IJH A;  4AIM A;  1VQ9 A;  1VQF A;  2CQO A;  3UE1 A;  2VL6 A;  5GAH C;  3H15 A;  2D0P A;  4NXN Q;  5IY0 A;  1HJP A;  1HNX Q;  1HNX L;  2OCE A;  4LF9 L;  4LF9 Q;  2HIV A;  1P8L A;  3W1G A;  2NVX H;  1V9P A;  4AYB G;  3PO2 H;  4A3D G;  4DV5 L;  1PFS A;  4DR4 L;  2HIX A;  4DR4 Q;  2JA8 H;  4BXX H;  2UXD Q;  3AFP A;  1SMX A;  4IFD I;  5LMN Q;  3J81 c;  1X3F A;  3ULJ A;  3HFZ B;  4L5R C;  3S2H H;  1Z47 A;  4C2M H;  2NVY H;  2OWO A;  1OXU A;  4HIO A;  5GQO A;  3BU2 A;  3A5Z B;  4A76 A;  1LM0 A;  2Z0S A;  5BR8 Q;  5BR8 L;  1VQI A;  1VQK A;  3MEF A;  3M3Y H;  5J3B A;  2YTY A;  4R4T A;  4GNX B;  4LFC L;  2ID0 A;  1OTC A;  3U50 C;  4LF4 Q;  1VCI A;  1WI5 A;  3PGZ A;  1GKH A;  4YHH L;  1Y1W H;  5FLX c;  4ALP A;  4GS3 A;  2KEN A;  3AQQ A;  3NEM A;  3F2D A;  2NZH A;  4LWC A;  1X56 A;  3GTP H;  2OTJ A;  1A62 A;  4LUZ A;  3CP0 A;  3OTO L;  1G51 A;  1WFQ A;  3CQZ H;  1JE5 A;  2ZTD A;  3OTO Q;  4HJ9 A;  2R7Z H;  5K36 G;  2ZJR A;  3E9I A;  2VUM H;  3GTL H;  3L0O A;  1Q46 A;  4POG A;  1NJI C;  4WJ4 A;  3EN2 A;  4O0A A;  4X62 Q;  2JA7 G;  4X66 L;  4X66 Q;  3CC7 A;  3KJO A;  4JBJ A;  3JAM c;  1RIP A;  4A75 A;  2E5L Q;  4JI7 Q;  5GAG C;  1I94 Q;  3MXN B;  4UP7 A;  1Q82 C;  3I2Z A;  3K0X A;  1X3G A;  4X65 L;  3S24 A;  4P72 A;  1PH7 A;  3M9B A;  1X54 A;  2K52 A;  5IP9 H;  2R7F A;  4HJA A;  3CCV A;  3CCR A;  3RN5 A;  4A3E G;  1W2B A;  2Z6K C;  2JEA I;  1B8A A;  3HOV H;  1FJG L;  2ZJQ A;  1MKH A;  2YV5 A;  3B6Y A;  2F4V L;  1VQD A;  1I5F A;  3F2C A;  3TRE A;  1D7Q A;  1B70 B;  4FDB A;  1GD7 A;  4UP8 A;  1PH3 A;  5IT9 c;  1S40 A;  1KQS A;  1HR0 W;  1J6Q A;  1V1Q A;  1VQ5 A;  4LF7 Q;  4LF7 L;  4B3R Q;  2UXB Q;  3KF6 A;  3RZD H;  2WFW A;  1X65 A;  1KRS A;  3BZC A;  1V43 A;  4A4I A;  1VQ4 A;  4GN3 B;  2R92 G;  1EIF A;  4A93 G;  3UE0 A;  2I0Q A;  3W1B A;  3CCE A;  3LGJ A;  2E2I H;  2A8V A;  2LXK A;  4BBR G;  3S1Q H;  4A3B H;  2UU9 L;  2JQO A;  1K0R A;  2I5H A;  2NN6 G;  3L2P A;  2Q2U A;  2UU9 Q;  1KIX A;  3M4Q A;  1W3S A;  3CCS A;  2B3G A;  3GTK H;  3L7Z C;  4GNX C;  1K9M C;  2WB1 E;  2MO1 A;  4GN5 A;  3K7A H;  4IPD A;  4LW1 A;  2V1C C;  4BA1 I;  1PHJ A;  1QUQ B;  1HZC A;  4GN4 B;  4JI4 L;  1IZ6 A;  1RL2 A;  3BZK A;  3GTO H;  1OXS C;  3BJU A;  1AE3 A;  3D0F A;  2A1A A;  3PSI A;  1PH8 A;  4BY7 G;  5IP7 H;  3E9H A;  1Z9F A;  1CKN B;  2H5X A;  1PH4 A;  4A3L G;  5C4X G;  3CCU A;  1SFO H;  3HOY G;  1U0L A;  4DR3 L;  1E1T A;  4DR3 Q;  1Q1E A;  2BH2 A;  3PF5 A;  4QQB X;  1YVC A;  2CKZ B;  1YNX A;  1IYJ B;  2MQH A;  2RF4 A;  3UDF A;  4DR1 L;  4A3G H;  4OO1 G;  4LF8 L;  2GN5 A;  4LF8 Q;  1X6O A;  1N32 L;  5IYB H;  1A0I A;  1E1O A;  4DK3 C;  1KXL A;  2IHE A;  5C0X J;  1N8R C;  4L5Q A;  1WOC A;  4DAM A;  1LTL A;  1N36 L;  1VQM A;  4PZ6 A;  5E7N A;  2VS1 A;  3AFQ A;  4MTN A;  1YJN A;  4DUZ L;  2CCZ A;  4A3I G;  2KBN A;  3H3V I;  1Q8K A;  4JI2 Q;  1Y14 B;  2L15 A;  1WYD A;  5HY6 A;  1EWI A;  4BBS H;  4A3C H;  2JJQ A;  3K8A A;  4Y7N H;  1WCM G;  4JI0 L;  3CCQ A;  4JI0 Q;  1FGU A;  3KDF A;  4IFD J;  2UUC Q;  1P16 A;  1I6H H;  2NN6 I;  4JYA Q;  2AMC B;  1UE5 A;  1I50 H;  5M3F G;  3CCL A;  1YIT A;  4B3T Q;  2KCM A;  3PO3 H;  4X6A H;  5JEA J;  5C4J H;  2UUB L;  4JOI C;  4PMW A;  3STB C;  2EXD A;  4O2D A;  4AH6 A;  2K4K A;  3TQY A;  1IXR A;  2UUA Q;  2WP8 J;  3K80 C;  4TVA B;  2B63 G;  2JA6 G;  4DR7 L;  2K5N A;  3H0G G;  4DUY Q;  2AWN A;  4P74 A;  2HHH L;  1SRU A;  1YZ6 A;  2CWP A;  4A3F H;  2BA0 A;  2B29 A;  1HNW Q;  1HNW L;  3NBH B;  3RN2 A;  1L1O B;  3CPF A;  1XMO L;  4KHP L;  4OO1 I;  4DV5 Q;  3CME A;  4APV A;  2Z6K A;  3A0J A;  4KLK A;  3S2D H;  2YYZ A;  2MFI A;  2K5H A;  1MJE A;  3HOZ H;  1M1K C;  2UXC L;  1FL0 A;  2UXC Q;  4GKJ L;  4GKJ Q;  1Q12 A;  5GRO A;  1QVG A;  3ER0 A;  4C3H H;  5M3M G;  2LXJ A;  2R6G A;  5FLM H;  3S1R H;  1Q7Y C;  4LF5 L;  2YTX A;  1UE6 A;  5LMU L;  5LMU Q;  2K75 A;  1PV4 A;  1XNQ L;  1I3Q H;  4PZ8 A;  4LFC Q;  1XNQ Q;  1PYB A;  1CSQ A;  2NVQ H;  3HOW G;  2WAQ E;  2IY5 B;  4YHH Q;  4DV6 Q;  2JK8 A;  4DV6 L;  3PIO A;  3CF5 A;  4LUO A;  1IBK L;  2Y0S E;  3CAM A;  3RNU A;  4K0K L;  1HH2 P;  3RLN A;  4DKA C;  2PI2 E;  1C0A A;  3S16 H;  3NEL A;  2EIF A;  5JJL A;  1XJV A;  1IL2 A;  1HR0 L;  4A3M H;  1GVP A;  4NXM L;  4NXM Q;  4DR2 L;  4GNX A;  5IE8 A;  1NTG A;  3TRZ A;  1MJC A;  1Q1B A;  3J81 i;  1XTD A;  3G71 A;  4JBM A;  4DPG A;  4IO9 A;  1Y1V G;  1BBW A;  3T1Y L;  4A3J G;  5GAD C;  5C3E H;  4HIM A;  1NE3 A;  5IWA L;  5IWA Q;  1VQL A;  4BY1 G;  1KL9 A;  4X65 Q;  3TS0 A;  4YCW A;  4RG1 A;  2ATW A;  4JC0 A;  4YY3 L;  4P71 A;  3IRB A;  3HOU H;  3F1Z A;  2Q2I A;  1FJG Q;  3OYY A;  2F4V Q;  2N3S A;  1JJG A;  1UE1 A;  3W5O A;  1L1O C;  1SR3 A;  2K5V A;  2PQA B;  4C3J H;  4H02 A;  3M4P A;  4LNQ A;  5FJ8 H;  1JMC A;  3JC6 6;  5LMN W;  1NMF A;  2DGY A;  3FHW A;  3GTJ H;  1TWH H;  3CW2 C;  3SGI A;  4UPA A;  3I4N G;  2R93 G;  4R4Q A;  1CUK A;  5M5X H;  3HKZ E;  3T1H Q;  3T1H L;  4OXP A;  1WCM H;  2JA9 A;  5IYD H;  4GKK Q;  4GKK L;  3FP9 A;  4B3M L;  1HZB A;  2E2J H;  1KRT A;  1XNR L;  5ELN A;  3I4M H;  1YHB A;  3EIV A;  4HJ8 A;  3PO2 G;  4X64 L;  2BA1 A;  1EFW A;  1T9H A;  4OWT B;  5IYC H;  2JA8 G;  4BXX G;  5DLQ E;  1HZA A;  1EOV A;  1EQR A;  4JOI A;  4YWM A;  3CC4 A;  1BKB A;  1R9T H;  3CCM A;  4KI0 A;  3HOX G;  1PH2 A;  1LUZ A;  1UWV A;  2ASB A;  3UDI A;  4DR6 L;  1YHQ A;  4JI4 Q;  2C35 B;  4KHZ A;  5JJK A;  2JA6 H;  1JJ2 A;  3GTQ H;  3RLO A;  3KOJ A;  3FKI H;  5AJ3 L;  3CD6 A;  1GO3 E;  1K8G A;  2AHO B;  2I5L X;  4R1J A;  4DV7 L;  5M5Y H;  5C44 G;  1PH9 A;  4ME3 A;  1QUQ A;  1KAW A;  4A3D H;  1IBM L;  4DR1 Q;  1GM5 A;  1M90 C;  1N32 Q;  3K7U C;  2EQS A;  3PUZ A;  2VQE L;  2VQE Q;  5HGQ A;  3CCJ A;  1NBW A;  2R7Z G;  2ZJP A;  1CKN A;  2QA4 A;  3M4O H;  4QIW E;  4J15 A;  2MO0 A;  4LFA Q;  3U4V A;  1XPR A;  1N36 Q;  4LUV A;  1VQO A;  4LFA L;  1G6P A;  4DUZ Q;  2NZO A;  1BVS A;  1VQN A;  2RHS B;  1SE8 A;  1S3O A;  2PI2 A;  3I4O A;  3U58 A;  2YU9 H;  4A3K G;  4AYB E;  3J80 c;  4XIG S;  4DV4 L;  4JI8 L;  1TWA H;  1PYS B;  4JI6 L;  3G48 A;  2E2H H;  1E22 A;  5IP9 G;  3HOV G;  1VQG A;  2OQK A;  1EYG A;  4YCU A;  4Y52 H;  1Q86 C;  2Q2H A;  2UUB Q;  1EUJ A;  2XTI A;  4HID A;  4OWX B;  1S72 A;  1QVF A;  2AKW B;  4GOP C;  2VZA A;  1XPO A;  1YHA A;  4IPC A;  2WB1 G;  2JA7 H;  2VNU D;  4DR7 Q;  1L2F A;  1SRO A;  2HHH Q;  3UDG A;  3HKS A;  4HIK A;  1O7I A;  1IBL L;  1IBL Q;  4RMF A;  1AH9 A;  3K81 C;  4GLV B;  4DV0 L;  4DV0 Q;  3EBE A;  5EAY A;  1LYL A;  1KD1 C;  4A3E H;  4OX9 L;  1XMO Q;  4OX9 Q;  4XTC S;  3KFU A;  4KHP Q;  4A3B G;  1J5E L;  3WWV A;  4C3I H;  4JI1 L;  4JI1 Q;  4B3S L;  1CSP A;  1NY4 A;  2VY3 A;  3G6E A;  3F2B A;  1KC8 C;  3PUW A;  1K3R A;  4IOA A;  1VQB A;  3DLL A;  2ZTC A;  4JI5 L;  4AQY L;  1L1O A;  4AQY Q;  1JB7 A;  4JI5 Q;  4UP9 A;  4LF5 Q;  2R93 H;  1MIU A;  2VQF L;  3J81 j;  2VQF Q;  3H3V H;  1A63 A;  4QGU A;  4MZ9 A;  5IP7 G;  1K73 C;  4YCV A;  2R92 H;  1YBY A;  4NXN L;  5GAE C;  3D31 A;  1C9O A;  1IBK Q;  4A93 H;  3J7A 5;  2JA5 G;  1WJJ A;  2CWA A;  1OXT A;  4BBR H;  2Q2T A;  4WJ3 M;  3PV0 A;  3GTM H;  2QEX A;  3KLW A;  4A3G G;  4NPS A;  2N8N A;  4R4C A;  4DR5 L;  4DR5 Q;  2UXD L;  1HR0 Q;  5LMN L;  1A8V A;  2I5M X;  3KF8 B;  5IYB G;  3PIP A;  1D8L A;  3GO5 A;  2JE6 I;  2KHI A;  4DR2 Q;  3S17 H;  3HOX H;  3NEN A;  1SN8 A;  1E24 A;  4GLX A;  4OWW B;  2CFM A;  3OW2 A;  1FVI A;  4JG2 A;  2PMZ E;  3Q8D A;  3KJP A;  2D62 A;  3T1Y Q;  1X9N A;  4BY7 H;  4BBS G;  4A3C G;  2OQ0 A;  4DV3 L;  4DV3 Q;  1TWF H;  1N34 L;  5ELO A;  5C4X H;  1N34 Q;  4A3L H;  3PUV A;  5C44 H;  4LF4 L;  1XPU A;  3HOY H;  1ASY A;  3M7N A;  1UEB A;  1VQC A;  4PZ7 A;  2K50 A;  4YY3 Q;  2MNA A;  3PO3 G;  1YJ9 A;  1KHI A;  3S14 H;  3TS2 A;  1CKO A;  4JI3 L;  4JI3 Q;  2N49 A;  3DM3 A;  3M85 A;  1BBU A;  3UDX A;  2R7D A;  2RHQ B;  4X62 L;  3CC2 A;  2ES2 A;  2IX0 A;  4A3I H;  2E5L L;  1TWC H;  3AEV A;  4NB3 A;  4QL5 A;  1VQ6 A;  1VQP A;  4IOC A;  4JI7 L;  3RZO H;  1VS0 A;  3E0E A;  4IJL A;  4TQU S;  3CXC A;  4A3F G;  1I94 L;  3AYH B;  5JJI A;  2GVA A;  3JAM i;  4A3K H;  1TXY A;  1QZH A;  1OXX K;  2DUD A;  2NVT H;  4B3M Q;  4HJ7 A;  2K14 A;  1EIY B;  1NMG A;  1E3P A;  2PQA A;  4GOP B;  1XNR Q;  2E8G A;  3PF4 A;  4JCV E;  5M3F H;  4PG3 A;  3KF6 B;  4DK6 C;  4X64 Q;  3S15 H;  4OON A;  1U5K A;  1YEZ A;  2WAQ G;  4HJ5 A;  4LFB L;  4LFB Q;  3J7Z C;  1SLJ A;  2Y0S G;  1PH1 A;  3HOZ G;  3KYH C;  4YWK A;  4JBW A;  2JEB I;  1YJW A;  1N9W A;  2AWO A;  3TEH B;  4DR6 Q;  4DV1 L;  1VQE A;  4DV1 Q;  1TWG H;  2LSS A;  5FLM G;  3H0G H;  4GOP A;  1PA6 A;  2B63 H;  4B3R L;  2N78 A;  2UXB L;  1H95 A;  1G29 1;  2IHF A;  2KHJ A;  4JBK A;  5AJ3 Q;  3CMA A;  4DV7 Q;  3ICE A;  1VQH A;  1XMQ Q;  3PUX A;  1XMQ L;  1QVC A;  3ULL A;  1Y1W G;  4K0K Q;  2YTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...