4DV4L

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
123
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 16
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv4L00
2F4VL 2R92G 4BBRH 5C4XH 1UE1A 5IYDH 1YI2A 3PO3H 3GO5A 3KF8B 4KHPQ 2JA9A 3PO2H 4B3RQ 1XNRL 5FJ8H 1OXVA 4B3TQ 1N9WA 3EIVA 4QJFA 1PYSB 3S17H 2IX1A 4JV5Q 3AFPA 2CQOA 1PH5A 1YITA 3Q8DA 1TWCH 4POGA 1S3OA 2VS1A 2MFIA 4A3FG 2C35B 1KC8C 4DV0Q 3M4OH 4PZ8A 3JC66 4A3BG 1N36L 1PH7A 3U4ZA 5IYCG 3M4PA 3GTMH 4LFBL 1XTDA 4NXNL 4DUZQ 4DV4L 3KFUA 4A3DH 3CC2A 1KD1C 3HOUG 4DUYQ 1YNXA 2D0PA 3RLNA 5GADC 2UXBQ 1NE3A 4A76A 3RLOA 3STBC 4A4IA 2BH2A 3H15A 2IY5B 1N32Q 1N34Q 2CCZA 3F1ZA 5C0XJ 2E2HH 3K7UC 2NVXH 1JMCA 2ALYB 4GKKQ 1RIPA 2N3SA 4LF4L 3H3VI 1GO3E 3HFZB 4BXXG 3MXNB 1K83H 4O0AA 2E5LL 3W1BA 4A3KH 2R92H 1OTCA 1BKBA 2A19A 4C3IH 4A3JG 1E3PA 1BBUA 1A0IA 4BA1I 3HOVG 1U0LA 5JJLA 4AIMA 4DAYB 4LF5L 2WB1E 2F4VQ 4DV6L 3NENA 1O7IA 1HNZQ 2FXQA 1VQPA 4JI7Q 1K3RA 5EAYA 3CCUA 4B3SL 1N33L 4DR7L 4IPCA 4X64L 4YY3L 4A3MG 3T1YQ 3HOYG 4Y52H 2R7DA 2I5LX 4JI3L 4BY7G 3CCSA 3S2HH 1XMOL 2XTIA 2E2IH 4A3FH 4A3CG 1JJGA 1G51A 3AYHB 3K81C 1SROA 4PMWA 3RLFA 4AYBG 2YTYA 4DV1Q 4RG1A 4LF7L 4A3BH 1MKHA 5GROA 3U50C 4IFDI 5IYCH 1EQQA 4JI8L 1Q86C 2ES2A 3PCOB 2Y0SE 2YTVA 2ZTDA 3SGIA 4GOPA 1U5KA 4R4OA 3FHWA 2OCEA 1VQ4A 4OX9Q 2QA4A 3T1HL 3G6EA 4B3ML 1PH1A 4L5TA 2B29A 4JOIC 3B6YA 1XJVA 4R4QA 2AHOB 3UE0A 4APVA 4X66Q 3KDFB 5C0XI 3CMEA 4HIKA 5DLQE 1SLJA 1WCMG 2A8VA 4GOPB 4LF4Q 5LMUL 3S24A 2Z6KC 4GS3A 5H1SE 1VQ6A 1A63A 3I7FA 1JB7A 1X56A 2K5VA 4DAMA 1CUKA 5JEAJ 3STBD 1TXYA 2K4KA 4DV6Q 4GLXA 4L5SA 4DR5L 2R7ZG 4A3MH 3S1RH 5IWAL 3OTOL 4B3SQ 3HOYH 4OWWB 4DR7Q 3K8AA 3NEMA 4PG3A 3ULJA 3S16H 4PZ7A 1K9MC 4BY7H 2NZHA 4A3CH 2OQ0A 1TWHH 1YHBA 4AH6A 4JI3Q 2YYZA 3I4MG 1C0AA 4KLKA 2H5XA 5BR8L 2HIVA 2UUBL 2LXJA 3HKZG 4IFDG 1NBWA 4H02A 2VZAA 1L0WA 2Q2IA 4LF7Q 4GKJQ 4HIDA 2E8GA 2WP8J 2N49A 4C3HH 4UPAA 1Z47A 1VS0A 4JI8Q 2VW9A 4KHPL 3E0EA 3K7AH 4IPHA 3PO3G 4B3RL 1NMGA 5IP9G 4GNXA 4UP7A 1K73C 1QZHA 1VQCA 4R4CA 5GQOA 2AMCB 4B3TL 2PMZE 4JG2A 4QGUA 4L5QA 4YHHL 3U4VA 5ELOA 1OXUA 2OQKA 1WCMH 1I6HH 1MIUA 3BJUA 4LFAQ 4IJLA 1K0RA 5M5XH 2I0QA 3F2CA 5LMUQ 4GNXB 2VNUD 1E1OA 1Q1BA 4DUYL 2CWAA 1KL9A 1Z9FA 1HZAA 2R7ZH 4DV2L 3KF6A 2Q2HA 1X3GA 1D8LA 2A1AA 1A8VA 5GAHC 4DR5Q 5AJ3L 3U58A 1CKNA 1FVIA 3I4MH 1Y1WG 3TREA 4JBMA 1E1TA 1H95A 4GKKL 2VUMG 3PGZA 4LW1A 1JJ2A 3GTJH 4A3GH 4NXML 4EQ5A 1NJIC 2UUBQ 1WYDA 2Z0SA 3I4NG 1V9PA 1P16A 4JI1Q 4A3KG 1J5EQ 1V43A 2JJQA 1Y14B 1HNZL 3CCVA 4JI7L 1CKNB 3CP0A 5IP9H 1OXSC 1X54A 3T1YL 2DUDA 2UUCL 1YJ9A 3E9IA 3CC4A 1EQRA 1Q12A 1EYGA 1QVGA 4LF8Q 4LFCL 3ULPA 1RL2A 3CPFA 4XTCS 1YIJA 2YTXA 4DV1L 4YHHQ 1L1OA 4OO1I 5J3BA 1I94L 5C4JH 1XMQL 4YCWA 3CCJA 2N8NA 1FJGL 2VY3A 4IFDJ 4WJ3M 4WJ4A 1PH2A 5JEAG 4IPDA 3NELA 4LNQA 4OX9L 3PIPA 2NVTH 2ASBA 2MNAA 4DV2Q 4JYAQ 2ZJQA 4X66L 1L1OB 4DV5Q 3A0JA 1Y1WH 4FDBA 2Q2TA 5AJ3Q 5C44G 2R6GA 1M1KC 1EUJA 3PUZA 2B63G 2HT1A 2VUMH 2WB1G 3D0FA 2R93G 3ZJYC 4X6AH 3I2ZA 3GTLH 4YWLA 3F2DA 3TRZA 3I4NH 2F3IA 2KBNA 2EIFA 3GTPH 1KXLA 5LMNW 4LUZA 4NXMQ 2HHHQ 3L0OA 2PI2A 1ASYA 2UXCL 1SN8A 4O2DA 3J80i 1Q82C 1YBYA 1ASZA 3HOZH 5E7NA 4X65Q 1OXXK 2IT1A 4PZ6A 4DR1L 4BY1H 2UUCQ 4GOPC 2I5HA 2Y0SG 1PH4A 4IO9A 1IZ6A 3K0XA 4LFCQ 5M5YH 3UDGA 4OO1G 1VQIA 3WWVA 4GKJL 2WAQE 4R4TA 4UP8A 3GTQH 4JBWA 1I94Q 3I55A 1X65A 2JA5H 1XMQQ 3GTGH 3IRBA 1FJGQ 1V1QA 1CKOA 3TEHB 1VCIA 3S1QH 4DR2L 3PUXA 4TQUS 3GDEA 4DK6C 5C44H 2B63H 2RF4A 2R93H 4KI0A 4A93G 3EBEA 3UDXA 1AH9A 5IY0A 3DLLA 1B70B 3CQZH 4LFAL 1XPOA 1W2BA 2OTLA 3UE1A 3CXCA 5M3MG 1GM5A 4C2MH 3JAMc 5JJIA 1VQFA 2OWOA 1MJEA 1HZ9A 5M3FH 3HOXG 2R7FA 1JE5A 3ERSX 2UXCQ 4JI4L 1YHAA 3KYHC 4JI5L 3VDYA 3M7NA 4DV7L 3E9HA 4DR6L 1UE5A 3A74A 4DNIA 4AQYL 5IYBG 4DR1Q 3NBHB 1IL2A 3A5ZB 4MNOA 1VQDA 2YV5A 4QL5A 1VQEA 1IBKQ 2IX0A 2V1CC 3PF4A 4MTNA 3CAMA 1D7QA 2NN6I 2NVQH 2GN5A 3AFQA 1LYLA 1IBLQ 2JE6I 3PUYA 4A3GG 3I56A 4JI1L 1LUZA 3HKSA 1J5EL 3HOWG 3CCLA 4QQBX 1YEZA 2K52A 3FKIH 3CCEA 4DR4L 3I4OA 1G291 3CC7A 4YCUA 1UE6A 4GN4B 4LWCA 5FLXc 1VQ5A 4Y7NH 2MO0A 4UP9A 3CD6A 3ULLA 3L2PA 4DR2Q 4J15A 3EN2A 1HZCA 1VQJA 1Q1EA 4LF8L 1PVOA 5IT9c 4A93H 1UE7A 4XIGS 1J6QA 1I3QH 1Q8KA 3BZKA 2Z6KA 4IOAA 2Q2UA 1XNQL 1XPRA 1LM0A 5M3MH 3F8TA 5LMNL 3ICEA 4K0KQ 1E22A 1HNWL 1K8AC 1YVCA 2K50A 1K8GA 3S1MH 2HIXA 1SFOH 3OYYA 3HOXH 2D62A 1UWVA 4LF6L 1I5FA 3FP9A 5GAEC 3CCRA 4JYAL 1VQHA 4HJ8A 1OXTA 3OW2A 3S1NH 1VQBA 4JI4Q 4DV5L 4JI5Q 1EWIA 3JAMi 4DV7Q 1YHQA 5IYBH 3RZOH 4DR6Q 2IHEA 4A3EG 2KCTA 3HKZE 2VL6A 2UU9Q 1P8LA 2JEAI 2WFWA 2E2JH 4AQYQ 1HNXL 4QY7A 3BZCA 1PA6A 2NN6G 4HIMA 1IYJB 4BBSG 1KRTA 3KLWA 3HOWH 1NTGA 2HHHL 2NZOA 2MQHA 4EX5A 3KF6B 4HJAA 1L1OC 4DV3L 3RZDH 4GN3B 3TQYA 2KCMA 4DR4Q 1X6OA 1NY4A 4X65L 4IJHA 3HOZG 5FLMG 1VQGA 1R9TH 1PH3A 1DGSA 4X62L 1EIYB 4BY1G 4TVAB 4GLAC 4R1JA 5C3EG 2VQEL 1JT8A 4OONA 1HR0Q 4JI6L 1BBWA 1T9HA 4JBKA 1M90C 1KQSA 1XNQQ 2CWPA 2K5HA 3CCMA 4DR3L 5LMNQ 3W5OA 1AE3A 2UUAQ 4R4IA 1HNWQ 2PQAA 2JA5G 4P75A 3J81j 1FGUA 2QGQA 2RHQB 4JI2L 5JJKA 4JCVE 4LF6Q 5HGQA 2RCNA 1QVCA 2HQLA 3M85A 4A3EH 2JA6G 1GKHA 3MEFA 1PYBA 4GN5A 3CF5A 1KRSA 2UXDQ 2N78A 4A3IH 1TWGH 1KIXA 1CSQA 3RN5A 1HR0W 1YJWA 2ID0A 4BBSH 2PQAB 1HNXQ 1SR3A 2KHIA 2ZM6L 2JQOA 3CMAA 4HJ5A 5GAGC 4L5RC 2JA8G 5M3FG 3M9BA 4DV3Q 1X55A 5FLMH 2WAQG 1SRUA 4ME3A 4MZ9A 3UDIA 2VQFL 1X9NA 1C9OA 1SE8A 5C3EH 3RNUA 1IBKL 4LUVA 4X62Q 4BA2I 3PIOA 1GVPA 5IE8A 2MO1A 3PUWA 2AWNA 1PFSA 2VQEQ 2LXKA 1IBLL 4HJ7A 1Q46A 2IHFA 4JI6Q 3CPWA 1S40A 1FL0A 1X3FA 4OWXB 1TWFH 3KJPA 1S72A 1JJCB 4DR3Q 4UY8C 4IOCA 1W3SA 2XGTA 4A3LG 3FKIG 2QEXA 2EQSA 3W1GA 4JI2Q 3M3YH 3AEVA 2JA6H 2D0OA 3M4QA 2I5MX 2AKWB 4NB3A 2ZJPA 3PUVA 3TS2A 4RMFA 1XNRQ 4POFA 4HJ9A 1PHJA 3UDFA 4K0KL 1YZ6A 3G71A 3CCQA 1Q81C 3A5UA 4LUOA 2PNHA 2JA8H 4YWKA 3KDFA 2ZM6Q 1WFQA 2K5NA 4JC0A 1XPUA 3PF5A 1N8RC 1N36Q 4JI0L 3TS0A 2ATWA 2BA1A 1HJPA 2JEBI 2RHSB 3RR5A 1VQ9A 3HOUH 4NXNQ 1PH6A 4DV4Q 1IXRA 5IP7G 4AYBE 2UU9L 1GD7A 4LFBQ 3S15H 2VQFQ 5M5WH 3J81c 4GNXC 4YCVA 3AQQA 3CW2C 3RN2A 1I50H 1MJCA 4BXXH 3G48A 1B7YB 3PSIA 4A3LH 4A3JH 2KENA 4GLVB 4JBJA 3F2BA 3HOVH 4C3JH 2E5LQ 2OTJA 1B8AA 4KHZA 2GVBA 4LF9L 4IPGA 1VQ7A 4JOIA 5K36G 1A62A 1VQOA 4LF5Q 4OXPA 3H0GG 1SMXA 1YJNA 1QUQA 3GTKH 1G6PA 4P73A 1N33Q 1HR0L 1BVSA 4X64Q 4YY3Q 2YU9H 1WI5A 1LTLA 2JA7G 1VQAA 1EIFA 1UEBA 1CKMA 1C7YA 1Y1VG 2UUAL 2NVYH 1XMOQ 3DM3A 1VQNA 1IBML 3S2DH 4P72A 5HY6A 4P71A 3G4SA 3J7A5 2DGYA 3D31A 1HH2P 1QUQB 1KHIA 2BH8A 3GD7A 4DKAC 3S14H 1E24A 1L2FA 2AWOA 4BBRG 3J7ZC 5IP7H 1CSPA 1TWAH 5IYDG 2CFMA 4JI0Q 3KJOA 5C4XG 2UXDL 1NMFA 5ELNA 1EOVA 3PV0A 3T1HQ 1VQMA 4B3MQ 3PO2G 4NPSA 1HZBA 5FJ8G 4JV5L 2EXDA 5C0XG 4A3IG 1PH8A 1AE2A 2CKZB 2GVAA 4QIWE 3H3VH 4DV0L 4HIOA 2F52A 3L7ZC 4A75A 1VQ8A 1WOCA 2ZTCA 3J81i 4P74A 2JK8A 2ZTEA 4DPGA 2L15A 4OWTB 2PI2E 4DK3C 4DUZL 2BA0A 3BU2A 3KOJA 2B3GA 2ZJRA 4YWMA 1QVFA 1X3EA 4LF9Q 2KHJA 3H0GH 3K80C 4A3DG 2UXBL 3LGJA 4ALPA 2LSSA 1N32L 2JA7H 5IWAQ 1N34L 3OTOQ 1EFWA 1PH9A 1Y1VH 3GTOH 1KAWA 3ER0A 2K75A 1Q7YC 1PV4A 1E7ZA 3J80c 1VQLA 5BR8Q 2K14A 1IBMQ 1VQKA 1WJJA 1QZGA
chains in the Genus database with same CATH superfamily
1KLUD 2CW0D 4BBRH 4C3IG 1STAA 2OXPA 1V1PB 4KHPQ 4FO2A 3S14B 1HA6A 1XNRL 1FNUA 1M8AA 4B3TQ 5BN3A 1TWAB 2IX1A 4JV5Q 1B3QA 2D2CC 2XWBB 1G91A 3K59A 4QF4A 1KC8C 2IPKD 3U4ZA 1LTRD 3M4PA 1EOTA 2J7ZA 4DV4L 1FNVA 3SDZA 1YNXA 5GADC 1DYQA 4A76A 3RLOA 3H15A 2IY5B 5E3FA 3H0GB 1N32Q 5C3XA 1B4OA 2E2HH 1T5EA 4C56C 2JA7B 3I91A 3IFTA 4LF4L 3F2UA 1GO3E 3HFZB 4BXXG 3GTOB 2E5LL 1SNPA 1BKBA 5JJLA 4LF5L 3NENA 4IUNA 1VQPA 1SE4A 5EAYA 4B3SL 2HCIA 2PW5A 5JAVA 4BBRB 1CM9A 2OF1A 1AN8A 3T1YQ 4Y52H 2R7DA 4V0BA 1JOOA 1G51A 1SSOA 1SROA 4PMWA 4A3BH 1H9MA 1EQQA 2ES2A 4XYQA 1G8ZD 4R4OA 2L55A 3J7AV 3LNNA 3G6EA 4B3ML 4RWSC 1TS3A 1A15A 3T53B 1B3AA 1QB5D 4JOIC 2Z8LA 3T56B 1XJVA 3UE0A 3FPPA 4HIKA 2XIWA 1R4PB 4KN4C 1WCMG 1CHQD 1TVXA 3VR5A 5LMUL 2E2HB 1STHA 3CU7A 3MVVA 2K5VA 3SK8A 1TXYA 4DV6Q 4HSVA 4GLXA 4DR5L 2R7ZG 4A3MH 1AW7A 3NEMA 4XXEA 4BY7H 2E74C 2NZHA 1TWHH 1YHBA 4JI3Q 2YYZA 5EQ0A 2I46A 1TY0A 4KLKA 4GZYC 5BR8L 1W6KA 3EJIA 4DXGA 2VZAA 4LF7Q 4HSPA 4X3KA 4HIDA 2E8GA 5D3IB 4A3BB 3E0EA 4IPHA 3MXGA 3PO3G 4B3RL 5IP9G 1QZHA 2CH4A 3EFXD 2RCFA 1OXUA 1MIUA 4LFAQ 2X6GA 4IJLA 1K0RA 1BCPF 3F2CA 2VNUD 1E1OA 2L5TA 2FFKB 3FEWX 2CWAA 3WDNA 3TP6A 2A1AA 1HFGA 2FHTA 1A8VA 1WD1A 1CKNA 1W6JA 1E1TA 4GKKL 4A3MB 2Z4IA 4X3UA 3GTJH 4BY7B 2UUBQ 4DGZA 1TWHB 2Z4HA 3VYRA 3J7YW 2PZWA 1Y14B 3WOEA 3DWPA 1PDQA 1OXSC 1X54A 2FJ2A 2SNMA 1CI3M 3R2TA 1YJ9A 1ZYRD 1ZXTA 2ENBA 4UHVA 1A3UA 4LF8Q 1RL2A 3CPFA 4YHHQ 4MN3A 1CA5A 4OO1I 5CBAE 5J3BA 1U4MA 4YCWA 1FJGL 4B9WA 3JAML 5JEAG 4IPDA 1PTOD 3NELA 1JWUD 4RCNA 4DK1A 4DV2Q 1EY6A 4LMQD 2A6EC 3PUZA 2HT1A 5D14A 4YWLA 3F2DA 4L8JA 2KBNA 4K2KA 2B2YC 4HMJA 5LMNW 2EDGA 3GTJB 3OPOA 1ASYA 1ICFB 1SN8A 3J80i 5C5LA 5FLXL 3HOZH 5E7NA 1OXXK 2IT1A 2PPBC 4BY1H 4IALA 5ISRA 4LFCQ 3OW7A 4OO1G 5CYUA 3I55A 1X65A 2E75C 2L1BA 1XMQQ 3GTGH 4RKBA 1QG7A 3URYA 1VDZA 4FNFA 3S1QH 3PUXA 2EYMA 3A54A 2A73B 4CKCA 3UDXA 3VYSA 3CQZH 1BO0A 2EJMA 1O7YA 4EQNA 1BBXC 4HTHA 5M3MG 1FYCA 4C2MH 3JAMc 1D2BA 2R7FA 3ERSX 1X3PA 2UXCQ 4DV7L 3A74A 4DNIA 1GOZA 3NBHB 3HOZB 1IBKQ 1VQEA 1DONA 2IX0A 2GN5A 1RHPA 5EJWA 4CJ0B 3N52A 3I56A 3BDOA 1PMRA 3HOWG 1ENFA 1YEZA 4PV1C 1SEBD 3KLSA 3BZDB 3CCEA 1VF7A 1E0BA 5FLXc 4GN4B 3O13A 5TSSA 3WOFA 3EQLC 4Y7NH 3NHHA 4ID6A 2F0TA 1BNZA 3GTGB 4DR2Q 1Q1EA 4A93H 2K28A 3S1QB 3BZKA 4J8QA 2Z6KA 4IOAA 1A3VA 3KUPA 5LMNL 2WB1B 3F8TA 3H09A 3BVGA 1SFOH 3JAME 2K05A 4LF6L 1I5FA 4C2MB 4JYAL 3OW2A 3S1NH 1VQBA 4DV5L 1DJRD 4CJ2C 1EWIA 3JAMi 3RZOH 2WFWA 2E2JH 1TY2A 4QY7A 3TDQA 2Y0SB 2RDHA 1WTOA 4PMBA 3H91A 1X6OA 5FLXE 4IJHA 5CV5A 5ELDA 1R9TH 1DGSA 4X62L 4Y7NB 4OONA 4JI6L 1M90C 5JVH3 2NWGA 1KQSA 4A93B 3QG1A 2BDNA 1HNWQ 2ZXOA 2BOSA 5EKLA 3G7LA 4F7XA 4PNYA 2QGQA 1MSGA 1SFOB 1RCVD 3M85A 2RA4A 4A3EH 1PYBA 4QCLA 2CQAA 1TWGH 3J81L 1HR0W 3S1NB 3RZOB 2OEOA 5I4DA 4FP5D 1TU2B 5EPLA 2E2JB 1QJOA 3D3RA 4RAUC 3C1FA 4L5RC 1QNUA 3K58A 2X69A 1X55A 4OELB 3EROA 3OMCA 4MZ9A 1SE8A 5C3EH 4DAYA 4LUVA 4IURA 5IE8A 2LS01 2IJ0A 2DNCA 2MO1A 4Q0FA 2LXKA 1R9TB 3MAQA 2IHFA 2P5ZX 4LK1C 5KNCA 3PQIA 1S40A 1IKMA 1B53A 1JJCB 5COYA 1OO9B 2XGTA 4A3LG 3VYUA 3M3YH 2Z9HA 3AEVA 4KK7A 2JA6H 2H1EA 2I5MX 3VR2A 2ZJPA 1TKWB 4RMFA 1XNRQ 1RTNA 1K28A 4A3EB 2SNSA 4K0KL 1TWGB 2PNHA 5BN4A 3E5SA 3KDFA 2ZM6Q 3C2PA 1WFQA 1N8RC 1STGA 2JYOA 3TZDA 3NWSA 1VF5C 4DV4Q 4NKLA 1GD7A 3J81c 1SXTA 3CW2C 5C3EB 1I50H 1MJCA 3G48A 1L0YB 3PSIA 5IGEA 4A3JH 3HOVH 1LT3D 3F2BA 3SE0A 2E5LQ 4KHZA 2L4NA 4OEMB 1VQ7A 4JOIA 1A62A 4LF5Q 2F0QA 1YJNA 3H0GG 1SMXA 1HR0L 1BVSA 4K14A 3M3YB 1WI5A 2JA7G 2JA6B 1EIFA 1UEBA 1CKMA 1SJED 3G6JB 2NVYH 3N6RA 4TKOB 3DM3A 1RJTA 3TP8A 1GUSA 4P71A 2AQ1B 1I6VC 1HH2P 4QUCA 4BBRG 4JI0Q 5IP7H 1WD0A 4B3MQ 1C48A 2WAQB 1QNKA 4FF2A 3J81E 4QIWE 4DV0L 5CR3A 4S3SA 2F52A 4XQJA 2A68D 1VQ8A 4QB4A 3GV6A 3J81i 2JK8A 2ZTEA 2K1BA 4DK3C 1I50B 1I4HA 1QVFA 1S5BD 4LF9Q 4A3JB 3HOVB 4Q5VA 4ALPA 1F9RA 2MGSA 5EGTA 2LSSA 3E0JA 4MHEA 3DEOA 3KF8A 4HMIA 3QWNA 1EFWA 3MZ5A 3KK7A 1HUMA 5IGFA 2WACA 4JVZA 2K14A 5BR8Q 5KGUA 1WJJA 5K36H 2F4VL 1JQYD 5C4XH 5E4XA 2F0MA 2JA9A 1STBA 4BWGB 5A2QE 4B3RQ 2KJXA 5FJ8H 1OXVA 2SEBD 1N9WA 4QJFA 1LT5D 1Q90A 3P75A 1S3OA 4O1NA 1SYBA 2C35B 4PQXA 1FNWA 5EKIA 3M4OH 3JC66 2EYJA 2MUYA 4A3BG 5DAUA 4CBVA 1G2SA 4DUZQ 3KFUA 5FO7B 1WTVA 2D0PA 2UXBQ 3STBC 1EEID 2CCZA 1I4PA 2EJGC 3F1ZA 2NVXH 1JWMD 4GKKQ 4ABNA 2N3SA 2KECA 2A19A 2F0GA 1E3PA 1BBUA 4BA1I 1O78A 3TZUA 1DCZA 1O7IA 4K5WA 1TT2A 1ENAA 4IPCA 2QILA 4WORA 3T4AC 5C4XB 4A3MG 5I9OA 3S2HH 4BY7G 3CCSA 2B2YA 2XTIA 2E2IH 3M7GA 2QEJC 2K32A 2NTSA 5IYCH 3GP7A 4JI8L 3SGIA 3M4OB 1RKNA 1PH1A 2NYZD 5FKAC 4KJNA 1AZQA 3B6YA 4R4QA 2AHOB 4APVA 5C0XI 3CMEA 1YNJC 5IGBA 4RFBA 2A8VA 2O2LD 2Z6KC 5H1SE 2NVXB 1A63A 5ELBA 3I7FA 1JB7A 5JEAJ 2X6LA 3D4WA 4L5SA 2A6ED 3NPPA 3CKIB 1LTID 3HOYH 4DR7Q 3K8AA 3S16H 3ULJA 1K9MC 2D9UA 1C0AA 1TR5A 2HIVA 3HKZG 3S2HB 1NBWA 4H02A 1K3BC 2E2IB 1L0WA 2F1MA 4UPAA 1Z47A 1VS0A 2QW7A 3K7AH 4GNXA 1K73C 4EVOA 1NUCA 2PMZE 3DWAA 5CBEE 1I6HH 4M1UB 4EQOA 2I0QA 2B2VA 2F0SA 1EY7A 3SK6A 1WVLA 2MPMA 4ZUJA 1D8LA 5GAHC 5AJ3L 3CHBD 5LL6S 3I4MH 1CA6A 3TREA 4JBMA 1C4QA 1D5XC 3HOYB 3S16B 4A3GH 4IUUA 3HP3A 4NXML 1DOMA 1WYDA 4H13C 4AYBB 4A3KG 1HNZL 3IFDA 1SE3A 3NTHA 1BR9A 1CKNB 4HEDA 4DN4M 5IOCA 3BDLA 3K7AB 1Q12A 1QVGA 1L0XB 4DV1L 1TS2A 2RVLA 5KYLA 5C4JH 1I94L 4IFDJ 2N8NA 4WJ3M 1TIID 1I6HB 4WJ4A 2LY7A 4OX9L 4LNQA 1Y8PB 2ASBA 3DXJC 5CV6A 2J0TD 4JYAQ 1EFID 4X66L 4DV5Q 1Y1WH 2Q2TA 4FDBA 2WB1G 1SYCA 3NBIA 1ZEQX 4X6AH 3TRZA 3LWEA 2F3IA 3I4MB 4DA2A 3GTPH 1JR0D 1KXLA 3L0OA 1SNMA 4I7ZC 4A3GB 1CQFA 4O2DA 1WTQA 1Q82C 1YBYA 4PZ6A 2UUCQ 4GOPC 1DXMA 3K0YA 2B2WC 2Y0SG 1PH4A 4IO9A 3QOJA 1VQIA 4R4TA 4RH6A 4K5XA 1LTBD 1LTGD 1CKOA 1G6ZA 5FK9C 1UEAB 5C4JB 4FF4A 3D8GA 3GDEA 5C44H 2B63H 2RF4A 2R93H 4A93G 5IY0A 3DLLA 1B70B 3R93A 1Y1WB 4DU9A 1W2BA 2A69C 2OWOA 2KEEA 2RKSA 5M3FH 3GTPB 4JI4L 1SYEA 3KYHC 3M7NA 2CVRA 2I07B 2EOTA 2IWHA 4DR1Q 1JC7A 4MNOA 1PRTC 4QL5A 1D7QA 4MTNA 2F0WA 3CAMA 3AFQA 1LYLA 5CC4A 4C1NI 2PZUA 4ZUIA 1J5EL 1B44D 3FKIH 1IKLA 1EY5A 4LWCA 4UP9A 1ILQA 3CD6A 3L2PA 1SMYC 2ICIA 1VQJA 3EN2A 1UE7A 2PCFB 4XIGS 5KIXA 2GA4B 1XNQL 5C44B 2AQ3B 4OHJA 2B63B 1EEFD 4K0KQ 2R93B 1SE2A 3KBGA 4RGMA 2EY6A 3A7AB 3QJYA 4WRDA 3RUZA 1VQHA 5JVG3 4ODGA 4JI5Q 5ELEA 4DR6Q 1B9NA 4A3EG 3HKZE 3NQTA 4XQNA 4AQYQ 3BZCA 1F2YA 4FXKC 1KRTA 2BE5C 2R3ZA 3A8IE 5L37A 4EX5A 3KF6B 4ME5A 1L1OC 1MSHA 2EY2A 5C4HA 3TQYA 4DR4Q 3IKJA 1NY4A 4X65L 1LACA 3I90A 3FKIB 1VQGA 3MEHA 3CRLC 2SDFA 2HUGA 4TVAB 5C3EG 4R1JA 2VQEL 1HR0Q 4IN3A 1T9HA 2LKVA 2F03A 1HTLD 3CCMA 4DR3L 4DF7A 1AE3A 4K8IA 1GHKA 2PQAA 2JA5G 1FGUA 2RHQB 5EPJA 4N9PA 3C1EA 3OIPA 1EQVA 4P2CB 3BYYB 2JA6G 1GKHA 3S9WA 4ZAIA 4NMZA 2N78A 2A6HC 1CSQA 3TP7A 4BBSH 1HNXQ 3AU7A 2KHIA 2MHVA 2JQOA 1EU3A 4HJ5A 3T13A 1JOQA 4DV3Q 1PXUA 4HR7B 2PW7A 2WAQG 5CORA 1VMPA 4ME3A 4ILWA 1I4RA 3UDIA 2VQFL 1BCPB 1C9OA 3RMHA 4HN7A 3PUWA 4H7BA 1M4VA 4TSSA 5HGTA 3CPWA 4UDUC 1FL0A 4OWXB 1TWFH 1DZ1A 5CV4A 1S72A 4IOCA 3GQBA 2PO4A 2QEXA 3W1GA 4JI2Q 1QWYA 3M4QA 1BXTA 4I65A 2QDLA 2XSCA 1PRTF 2HCCA 5E4WC 3R8BA 3R3OA 1PHJA 1YZ6A 3DMUA 1A3TA 3L9AX 1LTAD 2F0IA 2HQEA 3SK5A 2JA8H 3V2TA 3I73A 4YWKA 4BBSB 1PLFA 1HFNA 2K5NA 2A5HA 1XPUA 2ATWA 3TS0A 5IP7G 2UU9L 1LTTD 4BS9A 3NUCA 2F0HA 3MXUA 5M5WH 4GNXC 3NXWA 4BY1B 2LFNA 3RN2A 5E1FA 2ICEC 1YNNC 4BXXH 3QB3A 2L9HA 2Q8RE 4G7ZC 1KABA 4JBJA 3A8JE 1FD7D 4C3JH 1U4PA 1TWFB 2CW0C 1G6PA 1QUQA 3KLRA 2B2VC 4P73A 2WIIB 1TS5A 5J39A 3D4RA 3BDCA 4ZRZA 1JWSD 1X32A 3S2DH 4P72A 4ZCKA 3CQZB 1RD9D 1KHIA 2EY1A 5K36G 1E24A 2AWOA 2JA8B 1CSPA 5C4XG 2CFMA 2UXDL 1NMFA 3I8ZA 3QO2A 2LMCB 4JV5L 4NPSA 1HZBA 5FJ8G 1A2TA 1EZ8A 1V8QA 4A3IG 1AE2A 1R4QB 1QOHA 2RSOA 3D6WA 1U4RA 5M5WB 3L7ZC 4RGOS 1NR2A 2K5QA 1IW7C 2AQ2B 4P74A 4DPGA 2PI2E 5EKKA 2BA0A 3BU2A 3KOJA 2ZJRA 1JORA 2EYHA 2KHJA 4KN7C 3KLSX 2KCNA 4C3JB 2WKCA 1YNJD 1AP0A 2K01A 1N32L 4U68A 4JW0A 3ER0A 5KNBA 1Q7YC 1E7ZA 1IBMQ 1F2MA 5IYDH 1ENCA 1YI2A 3GO5A 3KF8B 3MFGA 3PO3H 3S2DB 4CJ1B 4RHRA 2XNAC 1PYSB 3S17H 2VB3X 2CQOA 1PH5A 1YITA 3HRZC 1TWCH 4POGA 4HAEA 2MFIA 4F8MA 2WINB 1C8CA 5DEHA 3FMCA 4K5VA 3IAYA 5J1ZA 5IYCG 1SNQA 2M00A 3GTMH 4LFBL 1XTDA 1PFNA 1CQVA 4NXNL 3MXNA 4A3DH 2F3WA 1SNDA 1BDOA 1KD1C 3HOUG 1NE3A 4B9XA 4A4IA 3EA6A 3HGBA 1N34Q 4KKTA 5C0XJ 4KY6A 3K7UC 2ALYB 2Z1CA 2F0EA 1RIPA 1CTMA 3H3VI 2F0DA 4RHSA 1K83H 4O0AA 1SAPA 3W1BA 2R92H 3QOLA 1U0LA 2TMPA 5CV9A 5I2XA 1CK1A 4DV6L 1HNZQ 1HQRD 4YY3L 3PO3B 3HOYG 4JI3L 4RCOA 1K0SA 1XMOL 4A3FH 1LO5D 3AYHB 1I4GA 1BCPD 3E3XA 3P20A 3K81C 4AYBG 4DV1Q 4RG1A 4LF7L 3S17B 3MWYW 1TWCB 1CFMA 1Q86C 2YTVA 1RTOA 2ZTDA 4GOPA 4OX9Q 3FHWA 2OCEA 2B2WA 3T1HL 4L5TA 3W2DA 4OIJA 3GTMB 1CZWA 4J6HA 3VR4A 4K6LA 4A3DB 3A8KE 4C1NK 4X66Q 1B2TA 5DLQE 1F77A 5IGGA 4LF4Q 1A6XA 1VQ6A 1X56A 4DAMA 1K83B 2R92B 2K4KA 2KCCA 4WFN3 3OTOL 3NSWA 4B3SQ 4PZ7A 4A3CH 2F0VA 2OQ0A 4AH6A 5F2DA 3I4MG 4OO1H 4KKUA 2UUBL 2LXJA 1H9SA 4A3FB 2IL8A 2WP8J 5JPMC 4C3HH 3TMEA 2VW9A 2K03A 4UP7A 1PTOC 4R4CA 5GQOA 5G3LF 4X3TA 4L5QA 4QGUA 4YHHL 1ML0D 2OQKA 5IODA 2IW3A 1QILA 3ZYYX 1EQTA 4XDXA 5LMUQ 4GNXB 3QIAA 2F0NA 4DUYL 4RA8A 1Z9FA 1HZAA 3NTKA 4DV2L 1X3GA 2NBFA 4DR5Q 3NQIA 4KHVA 3AB9A 5FO9B 1Y1WG 1H95A 1PFBA 2HDMA 3PGZA 1JJ2A 1GUGA 4IFDH 1KNEA 4EQ5A 1NJIC 4G7OC 2Z0SA 1V9PA 2NVYB 1J5EQ 1V43A 1UNSA 2JJQA 2O5IC 2MP1A 2NTTA 3CCVA 4JI7L 2ZT9C 4K8JA 3D6CA 1CZGA 4N8FA 2F0OA 3SXHA 2DUDA 1PRTD 4C3HB 3E9IA 1O80A 2PQEA 3CC4A 1EQRA 1EYGA 3E6ZX 4LFCL 3X3MA 3ULPA 4XTCS 1YIJA 2YTXA 1L1OA 3V96A 2N88A 5HURA 1XMQL 3CCJA 4PMCA 1S5FD 1PH2A 1NNXA 1XWEA 2V4DA 1RF2D 3PIPA 2NVTH 2MNAA 1TQOA 1Z6HA 3Q22A 3A0JA 5C44G 2R6GA 1EUJA 4KTAA 2B63G 2VUMH 1ICWA 2JSOA 2R93G 2OT2A 3ZJYC 3BVMA 3I2ZA 4DFAA 4N8X1 3I4NH 4MIUA 2XRQD 4LUZA 4IUTA 2PI2A 2RBMA 5DM73 5IGCA 2B2UC 2UXCL 5IIFA 1ASZA 3LX0A 4QIWB 4X65Q 3Q0AA 4ZQ3A 1EL0A 2I5HA 1II3A 4FF3A 4KJOA 2BE5D 3U9SA 2N55A 1E2ZA 4XT3B 3WWVA 2L0CA 4GKJL 3GTQH 1BF4A 4JBWA 1FJGQ 1V1QA 4DR2L 4TQUS 4ZLTF 4DK6C 2NVTB 2XRSD 3P7JA 3EBEA 1AH9A 1NCVA 2M9VA 1XPOA 1BOSA 4L63B 2VUMB 2K7VA 1GM5A 3I72A 1IYUA 2BCOA 1WTXA 1JE5A 3I4NB 2WKDA 5DM63 3VDYA 2QCPX 2DJGC 1PTOF 3E9HA 1GUTA 3I3CA 1UE5A 1GXDC 1Y69U 2RDGA 1IL2A 3OMGA 3PF4A 1XXGA 2V1CC 3NP8A 2JE6I 3PUYA 4JI1L 1LUZA 3DHQA 1DOLA 1BUVT 3CCLA 4QQBX 3I4OA 3QR8A 1G291 4YCUA 1UE6A 3GTQB 2MO0A 1MHWC 4YIJA 1D6EC 4QMGA 1UAPA 1PVOA 1MGSA 3HEJA 1Q8KA 4ZK9B 1XPRA 1LM0A 1B50A 1O7LA 3PIP3 1HNWL 1SBBB 1YVCA 1EY8A 3S1MH 2HIXA 1ONLA 3OYYA 3HOXH 4FVMA 2F0UA 5GAEC 1OXTA 1AZPA 4DV7Q 5IYBH 4G7HC 2UU9Q 4CHTB 2VL6A 1O7ZA 1P8LA 2JEAI 3ND8A 1Y8OB 1PA6A 1IYJB 2NUCA 4BBSG 2XVSA 1NTGA 1KDAA 3L3OC 2HHHL 2NZOA 1KNAA 1Q8IA 2MQHA 4HJAA 3RZDH 4GN3B 3HOZG 2HDLA 4BY1G 1JT8A 1YNND 4JBKA 2O4XA 2EYFA 2KUMA 4RGTA 2CWPA 5I6YA 5LMNQ 1ET9A 4CDEC 3J81j 3DUZA 3S1MB 4LF6Q 3HOXB 1LTSD 2RCNA 3MEFA 3HS0C 4GN5A 3CF5A 4KD3A 2UXDQ 1KIXA 3BVZA 2NN6H 1ILPA 2ID0A 3M4YA 2PQAB 1EYDA 3DWQA 3LWUA 2ZM6L 1STNA 5GAGC 2JA8G 3EVQA 2PMZB 1EWHA 3M9BA 3K57A 4F87A 1BQQT 5FLMH 2EE1A 1EY4A 4FF1A 1HPCA 1X9NA 3RZDB 5C5MA 4BA2I 4X62Q 3PIOA 1GVPA 1T5XD 1PFSA 1IBLL 1WTRA 4JI6Q 1IW7D 2QKIC 4LJZC 5ELFA 4FXGC 4UY8C 4I7AA 1W3SA 4ULLA 2EQSA 4C3JG 5G3LD 1F9PA 3PUVA 4POFA 4HJ9A 3UDFA 3G71A 2O5JC 1Q81C 4LUOA 1MBYA 2PYKA 1H9JA 1PZID 4FYDA 4JC0A 1QE6A 3PF5A 2A68C 4JI0L 3K5MA 2EZVA 2BA1A 4R8NA 4LFBQ 2AUKA 4NXNQ 1S5CD 3S15H 4DNRB 1G2TA 1DOKA 2G9HD 3TSSA 3NE5B 3Q6SA 3AQQA 3VR3A 5CV7A 2ZXPA 3J80L 2KENA 2K5DA 1B8AA 2GVBA 1XTCD 4IPGA 4LF9L 3MXPA 2F0KA 2K04A 1VQOA 5M9OA 3GTKH 4IUPA 4YY3Q 3SR1A 1LTLA 4UAIA 1C7YA 4DK0A 2UUAL 1XMOQ 2QF7A 1WTHA 1VQNA 5HY6A 2G5DA 3G4SA 3NWTA 2DGYA 4DAVA 1QUQB 3FVQA 1D1IA 1KDCA 2BH8A 2VB2X 2EPBA 3RD4A 5C3WA 3J7ZC 3TP5A 5IYDG 5M3FB 1U9RA 3PMFA 1PFMA 5ELNA 3T1HQ 3PV0A 2M2LA 5A35A 4IUQA 1PH8A 3S15B 5KYIA 2ZTCA 2L15A 4OWTB 4DUZL 1XX8A 1X3EA 3PIO3 4A3DG 3X3NA 2UXBL 3OWEB 5EBCA 1HCZA 1V1PA 2DNEA 3OTOQ 2EYLA 2L12A 1Y1VH 1KAWA 3GTKB 2K75A 3ERQA 3J80c 1NSNS 1VQLA 2QDBA 4H0LC 1VQKA 2B39A 2R92G 3OOCA 3U9OA 1UE1A 2E2DC 5LL6X 3PO2H 4R8IA 5C0XH 3EIVA 3AFPA 4CDFC 1GUOA 3Q8DA 2VS1A 4A3FG 4DV0Q 1NR4A 4PZ8A 4KY7A 1N36L 1PH7A 3A7LA 5CV8A 4OL7A 1I4QA 4ZKBB 3CC2A 3BS1A 4DUYQ 4DXFA 3RLNA 1IHZA 2BH2A 1IYVA 4RGNA 1EIHA 1JMCA 1B9MA 4HCSA 4E6IA 1D5MC 3MXNB 3J80E 1Y1VB 4A3KH 2F0LA 1OTCA 4C3IH 4A3JG 1GUWA 3HOVG 1A0IA 3HKZB 5IGDA 1CHPD 2JN4A 1KTKA 2WB1E 4AIMA 4DAYB 5CGKA 2AUJD 2F4VQ 1HQMC 2KA7A 2KHSA 2FXQA 3ND9A 4JI7Q 1K3RA 1N33L 3CCUA 4DR7L 1STEA 2B8GA 4X64L 1JE4A 1LLRD 2I5LX 1JJGA 4A3CG 2E76C 3PO2B 2B8FA 3RLFA 2B2UA 3A55A 2YTYA 4KKSA 4U673 1MKHA 5GROA 3U50C 4IFDI 4IUVA 1EWCA 4CKBA 3PCOB 2Y0SE 5JOBA 1GHJA 1VQ4A 1KLGD 1U5KA 4C3HG 3MHBA 2QA4A 3VR6A 1PYWD 1JOKA 1PZJD 2B29A 3KDFB 1EYCA 1SLJA 4GOPB 3S24A 4GS3A 3MFYA 3Q23A 1CUKA 3HG9A 3STBD 2FMCA 4G4KA 4A3KB 1XYIA 4C3IB 2EYPA 3S1RH 5IWAL 4O42A 1S4ZA 3VA5A 4OWWB 4PG3A 4NDXA 4G57A 1QCBD 1GUNA 1B1ZA 1SYDA 2G9DA 2H5XA 4IFDG 4GKJQ 2Q2IA 2N49A 4JI8Q 5C6AA 4KHPL 5D65A 1NMGA 2WV6D 3MA2B 2C5CA 5BN5A 4B3TL 1VQCA 2AMCB 5NUCA 2DY7A 1D1KA 4JG2A 1H9SB 3U4VA 2ZXRA 5ELOA 1WCMH 4HCEA 3BJUA 2B2TC 4QUFA 4ZKCB 1H9RA 2JXMB 5M5XH 1PRTB 2CHBD 1Q1BA 1RDPD 3GV3A 1KL9A 2R7ZH 1KDBA 3KF6A 2Q2HA 4OIKA 3U58A 1F9QA 3IL8A 1FVIA 3S1RB 4LW1A 2VUMG 4EGVA 2RSNA 3K6OA 3I4NG 1HRJA 2F3VA 3K5LA 2EYOA 3T51B 1P16A 4RKLA 1LABA 5ELCA 4JI1Q 2A74C 1VMCA 1F2ZA 3CP0A 5IP9H 1HUNA 2F0FA 3R2IA 3T1YL 2UUCL 2KEDA 4J1MA 2KOLA 4TRDA 4ZYSA 4MTKA 1E2VA 4R9WA 1FGBD 3NTIA 3BG3A 3NK9A 2VY3A 1WCMB 4FXDA 4WJWA 5M5XB 1EYAA 2ZJQA 1STYA 1L1OB 1JB3A 5AJ3Q 1M1KC 1TS4A 2R7ZB 5C4ZA 2EJFC 2CH4W 2EVBA 3C3LA 4V190 3T16A 2XWJB 1A2UA 3D0FA 5K5PA 3GTLH 2FMMA 2EIFA 2Q8TA 5KEEA 4NXMQ 2HHHQ 3K5OA 1JICA 2DY8A 3AMUA 4DR1L 4DNTB 2MJ8A 5IT9L 5D3DA 4CDDC 5LHY1 1LT4D 1EU4A 1IZ6A 3K0XA 4JPBW 5M5YH 3UDGA 2F0PA 2WAQE 4UP8A 1I94Q 4K2LA 2JA5H 3VYTA 5JEAH 1WTWA 3IRBA 3TEHB 1DD2A 1VCIA 1WTPA 3SEBA 2C9OA 1MD2D 5A2QL 4M8AA 5T1GA 4KI0A 1IL8A 1LV9A 4LFAL 3NBHA 4B08A 2OTLA 1AFPA 4X3SA 3SK4A 1H9KA 3UE1A 3CXCA 1DM0B 2H4OA 5JJIA 1VQFA 1MJEA 3GTLB 1HZ9A 5KRUA 3SVMA 5JPNC 3HOXG 1HHVA 1YHAA 4JI5L 4DR6L 1EY9A 4NP5A 3V05A 4AQYL 5IYBG 5FOBB 1SNOA 3A5ZB 1VQDA 2YV5A 1ZYRC 2VXWA 2NN6I 2NVQH 3CRKC 1IBLQ 3I4LA 4A3GG 3HKSA 2J4XA 3VA7A 5KNDA 2K52A 5M5YB 4DR4L 3CC7A 3MTSA 3OHXC 1VQ5A 3D4DA 1ESFA 2JA5B 1HXYD 3ULLA 4J15A 1HZCA 4LF8L 3BYTB 4LAAA 5IT9c 3MC0B 3OWFA 2PZTA 4IQZA 4CKEA 1J6QA 1J9OA 1I3QH 4NW2A 2Q2UA 1SYGA 1HTPA 2Z6BA 5M3MH 1U4LA 3ICEA 1E22A 1K8AC 2K50A 1K8GA 5I6WA 4CDCC 2D62A 2K6AA 1UWVA 3FP9A 1V1OA 3CCRA 4HJ8A 4JI4Q 3SHLA 1YHQA 3P1HA 4KD4A 2IHEA 2KCTA 1GJXA 1S5ED 3DEPA 3H3VC 1HNXL 2A69D 2NN6G 4HIMA 3KLWA 3HOWH 3FPUB 2IX3A 2K33A 2NVQB 5T1IA 4DV3L 2KCMA 2NZ1D 3DM1A 2XN9C 5FLMG 2KQ3A 1PH3A 5AFWA 1EIYB 4GLAC 5IT9E 1MI2A 1BBWA 4KV6A 1XNQQ 2K5HA 2UUAQ 3W5OA 1I3QB 5EPKA 4R4IA 2HD3A 4P75A 1Z7TA 5M3MB 4JI2L 1SMYD 1ESRA 5JJKA 2SOBA 4JCVE 5HGQA 1KAAA 3TN2A 1QVCA 2HQLA 3HZXA 5JJZA 1JCKB 1KRSA 2RDFA 4JK1C 4A3IH 3RN5A 1YJWA 1K8OA 2L11A 1SR3A 1EZ6A 3CMAA 1EY0A 1E2WA 1F2LA 3OIQA 3HOWB 5M3FG 1NAPA 4F88A 1SRUA 1UUPA 2RQXA 3RNUA 1IBKL 2F4IA 2AWNA 4XT1B 2VQEQ 4HJ7A 1Q46A 4KY5A 2R61A 1X3FA 3KJPA 3I70A 4DR3Q 3ITPA 3H94A 3FKIG 1PZKD 1X3QA 3W3AA 3ONAB 1Q3LA 2D0OA 2NB0A 4K6DA 1SJHD 2AKWB 3FDTA 4NB3A 5I9PA 3TS2A 4L6TB 3K5NA 4IZ8A 3CCQA 4Z9CB 3A5UA 2Q8IB 5I2YA 4A3IB 1RODA 1N36Q 5FO8B 1HJPA 2JEBI 2RHSB 3RR5A 1VQ9A 3HOUH 1PH6A 1CT1D 1IXRA 1D5ZC 2A6HD 4AYBE 5EBDA 1SYFA 2VQFQ 3C46A 2DJFC 4YCVA 2KVMA 3Q24A 1F9SA 3FRPB 2TSSA 1B7YB 4A3LH 4GLVB 4N9TA 2OTJA 2PNRC 5CMDA 1ET6A 1ZKOA 2BDOA 4CGYB 2EXZA 3A56A 1SDFA 2F0JA 4OXPA 1AEXA 1N33Q 1PTOH 1HA5A 1K8MA 4X64Q 2YU9H 1VQAA 4KMUC 2JP1A 1Y1VG 1S5DD 2K5WA 1IBML 1FR3A 3J7A5 2FINB 3D31A 3H6MA 4OGQC 3TBIB 3S14H 4DKAC 3GD7A 5J22A 1L2FA 1TWAH 3KJOA 3KBXA 1EOVA 3OSOA 1EIGA 4H44C 1VQMA 3PO2G 1LT6D 3HOUB 2EXDA 5C0XG 2CKZB 2GVAA 4XYOA 3H3VH 4HIOA 4A75A 4DAPA 1WOCA 3UI2A 2DN8A 1SNCA 2B3GA 4YWMA 4EQPA 3H0GH 3K80C 5DNFA 3LGJA 3J7AF 2JA7H 5IWAQ 1N34L 2B2TA 2D5DA 1PH9A 3GTOH 1J8IA 1PTOB 1Y8NB 1PV4A 2YU9B 4XQQA 1I4XA 2EY5A 1BCPC 1QZGA
chains in the Genus database with same CATH topology
2F4VL 2R92G 4BBRH 5C4XH 1UE1A 5IYDH 1YI2A 3PO3H 3GO5A 3KF8B 4KHPQ 2JA9A 3PO2H 4B3RQ 1XNRL 5FJ8H 1OXVA 4B3TQ 1N9WA 3EIVA 4QJFA 1PYSB 3S17H 2IX1A 4JV5Q 3AFPA 2CQOA 1PH5A 1YITA 3Q8DA 1TWCH 4POGA 1S3OA 2VS1A 2MFIA 4A3FG 2C35B 1KC8C 4DV0Q 3M4OH 4PZ8A 3JC66 4A3BG 1N36L 1PH7A 3U4ZA 5IYCG 3M4PA 3GTMH 4LFBL 1XTDA 4NXNL 4DUZQ 4DV4L 3KFUA 4A3DH 3CC2A 1KD1C 3HOUG 4DUYQ 1YNXA 2D0PA 3RLNA 5GADC 2UXBQ 1NE3A 4A76A 3RLOA 3STBC 4A4IA 2BH2A 3H15A 2IY5B 1N32Q 1N34Q 2CCZA 3F1ZA 5C0XJ 2E2HH 3K7UC 2NVXH 1JMCA 2ALYB 4GKKQ 1RIPA 2N3SA 4LF4L 3H3VI 1GO3E 3HFZB 4BXXG 3MXNB 1K83H 4O0AA 2E5LL 3W1BA 4A3KH 2R92H 1OTCA 1BKBA 2A19A 4C3IH 4A3JG 1E3PA 1BBUA 1A0IA 4BA1I 3HOVG 1U0LA 5JJLA 4AIMA 4DAYB 4LF5L 2WB1E 2F4VQ 4DV6L 3NENA 1O7IA 1HNZQ 2FXQA 1VQPA 4JI7Q 1K3RA 5EAYA 3CCUA 4B3SL 1N33L 4DR7L 4IPCA 4X64L 4YY3L 4A3MG 3T1YQ 3HOYG 4Y52H 2R7DA 2I5LX 4JI3L 4BY7G 3CCSA 3S2HH 1XMOL 2XTIA 2E2IH 4A3FH 4A3CG 1JJGA 1G51A 3AYHB 3K81C 1SROA 4PMWA 3RLFA 4AYBG 2YTYA 4DV1Q 4RG1A 4LF7L 4A3BH 1MKHA 5GROA 3U50C 4IFDI 5IYCH 1EQQA 4JI8L 1Q86C 2ES2A 3PCOB 2Y0SE 2YTVA 2ZTDA 3SGIA 4GOPA 1U5KA 4R4OA 3FHWA 2OCEA 1VQ4A 4OX9Q 2QA4A 3T1HL 3G6EA 4B3ML 1PH1A 4L5TA 2B29A 4JOIC 3B6YA 1XJVA 4R4QA 2AHOB 3UE0A 4APVA 4X66Q 3KDFB 5C0XI 3CMEA 4HIKA 5DLQE 1SLJA 1WCMG 2A8VA 4GOPB 4LF4Q 5LMUL 3S24A 2Z6KC 4GS3A 5H1SE 1VQ6A 1A63A 3I7FA 1JB7A 1X56A 2K5VA 4DAMA 1CUKA 5JEAJ 3STBD 1TXYA 2K4KA 4DV6Q 4GLXA 4L5SA 4DR5L 2R7ZG 4A3MH 3S1RH 5IWAL 3OTOL 4B3SQ 3HOYH 4OWWB 4DR7Q 3K8AA 3NEMA 4PG3A 3ULJA 3S16H 4PZ7A 1K9MC 4BY7H 2NZHA 4A3CH 2OQ0A 1TWHH 1YHBA 4AH6A 4JI3Q 2YYZA 3I4MG 1C0AA 4KLKA 2H5XA 5BR8L 2HIVA 2UUBL 2LXJA 3HKZG 4IFDG 1NBWA 4H02A 2VZAA 1L0WA 2Q2IA 4LF7Q 4GKJQ 4HIDA 2E8GA 2WP8J 2N49A 4C3HH 4UPAA 1Z47A 1VS0A 4JI8Q 2VW9A 4KHPL 3E0EA 3K7AH 4IPHA 3PO3G 4B3RL 1NMGA 5IP9G 4GNXA 4UP7A 1K73C 1QZHA 1VQCA 4R4CA 5GQOA 2AMCB 4B3TL 2PMZE 4JG2A 4QGUA 4L5QA 4YHHL 3U4VA 5ELOA 1OXUA 2OQKA 1WCMH 1I6HH 1MIUA 3BJUA 4LFAQ 4IJLA 1K0RA 5M5XH 2I0QA 3F2CA 5LMUQ 4GNXB 2VNUD 1E1OA 1Q1BA 4DUYL 2CWAA 1KL9A 1Z9FA 1HZAA 2R7ZH 4DV2L 3KF6A 2Q2HA 1X3GA 1D8LA 2A1AA 1A8VA 5GAHC 4DR5Q 5AJ3L 3U58A 1CKNA 1FVIA 3I4MH 1Y1WG 3TREA 4JBMA 1E1TA 1H95A 4GKKL 2VUMG 3PGZA 4LW1A 1JJ2A 3GTJH 4A3GH 4NXML 4EQ5A 1NJIC 2UUBQ 1WYDA 2Z0SA 3I4NG 1V9PA 1P16A 4JI1Q 4A3KG 1J5EQ 1V43A 2JJQA 1Y14B 1HNZL 3CCVA 4JI7L 1CKNB 3CP0A 5IP9H 1OXSC 1X54A 3T1YL 2DUDA 2UUCL 1YJ9A 3E9IA 3CC4A 1EQRA 1Q12A 1EYGA 1QVGA 4LF8Q 4LFCL 3ULPA 1RL2A 3CPFA 4XTCS 1YIJA 2YTXA 4DV1L 4YHHQ 1L1OA 4OO1I 5J3BA 1I94L 5C4JH 1XMQL 4YCWA 3CCJA 2N8NA 1FJGL 2VY3A 4IFDJ 4WJ3M 4WJ4A 1PH2A 5JEAG 4IPDA 3NELA 4LNQA 4OX9L 3PIPA 2NVTH 2ASBA 2MNAA 4DV2Q 4JYAQ 2ZJQA 4X66L 1L1OB 4DV5Q 3A0JA 1Y1WH 4FDBA 2Q2TA 5AJ3Q 5C44G 2R6GA 1M1KC 1EUJA 3PUZA 2B63G 2HT1A 2VUMH 2WB1G 3D0FA 2R93G 3ZJYC 4X6AH 3I2ZA 3GTLH 4YWLA 3F2DA 3TRZA 3I4NH 2F3IA 2KBNA 2EIFA 3GTPH 1KXLA 5LMNW 4LUZA 4NXMQ 2HHHQ 3L0OA 2PI2A 1ASYA 2UXCL 1SN8A 4O2DA 3J80i 1Q82C 1YBYA 1ASZA 3HOZH 5E7NA 4X65Q 1OXXK 2IT1A 4PZ6A 4DR1L 4BY1H 2UUCQ 4GOPC 2I5HA 2Y0SG 1PH4A 4IO9A 1IZ6A 3K0XA 4LFCQ 5M5YH 3UDGA 4OO1G 1VQIA 3WWVA 4GKJL 2WAQE 4R4TA 4UP8A 3GTQH 4JBWA 1I94Q 3I55A 1X65A 2JA5H 1XMQQ 3GTGH 3IRBA 1FJGQ 1V1QA 1CKOA 3TEHB 1VCIA 3S1QH 4DR2L 3PUXA 4TQUS 3GDEA 4DK6C 5C44H 2B63H 2RF4A 2R93H 4KI0A 4A93G 3EBEA 3UDXA 1AH9A 5IY0A 3DLLA 1B70B 3CQZH 4LFAL 1XPOA 1W2BA 2OTLA 3UE1A 3CXCA 5M3MG 1GM5A 4C2MH 3JAMc 5JJIA 1VQFA 2OWOA 1MJEA 1HZ9A 5M3FH 3HOXG 2R7FA 1JE5A 3ERSX 2UXCQ 4JI4L 1YHAA 3KYHC 4JI5L 3VDYA 3M7NA 4DV7L 3E9HA 4DR6L 1UE5A 3A74A 4DNIA 4AQYL 5IYBG 4DR1Q 3NBHB 1IL2A 3A5ZB 4MNOA 1VQDA 2YV5A 4QL5A 1VQEA 1IBKQ 2IX0A 2V1CC 3PF4A 4MTNA 3CAMA 1D7QA 2NN6I 2NVQH 2GN5A 3AFQA 1LYLA 1IBLQ 2JE6I 3PUYA 4A3GG 3I56A 4JI1L 1LUZA 3HKSA 1J5EL 3HOWG 3CCLA 4QQBX 1YEZA 2K52A 3FKIH 3CCEA 4DR4L 3I4OA 1G291 3CC7A 4YCUA 1UE6A 4GN4B 4LWCA 5FLXc 1VQ5A 4Y7NH 2MO0A 4UP9A 3CD6A 3ULLA 3L2PA 4DR2Q 4J15A 3EN2A 1HZCA 1VQJA 1Q1EA 4LF8L 1PVOA 5IT9c 4A93H 1UE7A 4XIGS 1J6QA 1I3QH 1Q8KA 3BZKA 2Z6KA 4IOAA 2Q2UA 1XNQL 1XPRA 1LM0A 5M3MH 3F8TA 5LMNL 3ICEA 4K0KQ 1E22A 1HNWL 1K8AC 1YVCA 2K50A 1K8GA 3S1MH 2HIXA 1SFOH 3OYYA 3HOXH 2D62A 1UWVA 4LF6L 1I5FA 3FP9A 5GAEC 3CCRA 4JYAL 1VQHA 4HJ8A 1OXTA 3OW2A 3S1NH 1VQBA 4JI4Q 4DV5L 4JI5Q 1EWIA 3JAMi 4DV7Q 1YHQA 5IYBH 3RZOH 4DR6Q 2IHEA 4A3EG 2KCTA 3HKZE 2VL6A 2UU9Q 1P8LA 2JEAI 2WFWA 2E2JH 4AQYQ 1HNXL 4QY7A 3BZCA 1PA6A 2NN6G 4HIMA 1IYJB 4BBSG 1KRTA 3KLWA 3HOWH 1NTGA 2HHHL 2NZOA 2MQHA 4EX5A 3KF6B 4HJAA 1L1OC 4DV3L 3RZDH 4GN3B 3TQYA 2KCMA 4DR4Q 1X6OA 1NY4A 4X65L 4IJHA 3HOZG 5FLMG 1VQGA 1R9TH 1PH3A 1DGSA 4X62L 1EIYB 4BY1G 4TVAB 4GLAC 4R1JA 5C3EG 2VQEL 1JT8A 4OONA 1HR0Q 4JI6L 1BBWA 1T9HA 4JBKA 1M90C 1KQSA 1XNQQ 2CWPA 2K5HA 3CCMA 4DR3L 5LMNQ 3W5OA 1AE3A 2UUAQ 4R4IA 1HNWQ 2PQAA 2JA5G 4P75A 3J81j 1FGUA 2QGQA 2RHQB 4JI2L 5JJKA 4JCVE 4LF6Q 5HGQA 2RCNA 1QVCA 2HQLA 3M85A 4A3EH 2JA6G 1GKHA 3MEFA 1PYBA 4GN5A 3CF5A 1KRSA 2UXDQ 2N78A 4A3IH 1TWGH 1KIXA 1CSQA 3RN5A 1HR0W 1YJWA 2ID0A 4BBSH 2PQAB 1HNXQ 1SR3A 2KHIA 2ZM6L 2JQOA 3CMAA 4HJ5A 5GAGC 4L5RC 2JA8G 5M3FG 3M9BA 4DV3Q 1X55A 5FLMH 2WAQG 1SRUA 4ME3A 4MZ9A 3UDIA 2VQFL 1X9NA 1C9OA 1SE8A 5C3EH 3RNUA 1IBKL 4LUVA 4X62Q 4BA2I 3PIOA 1GVPA 5IE8A 2MO1A 3PUWA 2AWNA 1PFSA 2VQEQ 2LXKA 1IBLL 4HJ7A 1Q46A 2IHFA 4JI6Q 3CPWA 1S40A 1FL0A 1X3FA 4OWXB 1TWFH 3KJPA 1S72A 1JJCB 4DR3Q 4UY8C 4IOCA 1W3SA 2XGTA 4A3LG 3FKIG 2QEXA 2EQSA 3W1GA 4JI2Q 3M3YH 3AEVA 2JA6H 2D0OA 3M4QA 2I5MX 2AKWB 4NB3A 2ZJPA 3PUVA 3TS2A 4RMFA 1XNRQ 4POFA 4HJ9A 1PHJA 3UDFA 4K0KL 1YZ6A 3G71A 3CCQA 1Q81C 3A5UA 4LUOA 2PNHA 2JA8H 4YWKA 3KDFA 2ZM6Q 1WFQA 2K5NA 4JC0A 1XPUA 3PF5A 1N8RC 1N36Q 4JI0L 3TS0A 2ATWA 2BA1A 1HJPA 2JEBI 2RHSB 3RR5A 1VQ9A 3HOUH 4NXNQ 1PH6A 4DV4Q 1IXRA 5IP7G 4AYBE 2UU9L 1GD7A 4LFBQ 3S15H 2VQFQ 5M5WH 3J81c 4GNXC 4YCVA 3AQQA 3CW2C 3RN2A 1I50H 1MJCA 4BXXH 3G48A 1B7YB 3PSIA 4A3LH 4A3JH 2KENA 4GLVB 4JBJA 3F2BA 3HOVH 4C3JH 2E5LQ 2OTJA 1B8AA 4KHZA 2GVBA 4LF9L 4IPGA 1VQ7A 4JOIA 5K36G 1A62A 1VQOA 4LF5Q 4OXPA 3H0GG 1SMXA 1YJNA 1QUQA 3GTKH 1G6PA 4P73A 1N33Q 1HR0L 1BVSA 4X64Q 4YY3Q 2YU9H 1WI5A 1LTLA 2JA7G 1VQAA 1EIFA 1UEBA 1CKMA 1C7YA 1Y1VG 2UUAL 2NVYH 1XMOQ 3DM3A 1VQNA 1IBML 3S2DH 4P72A 5HY6A 4P71A 3G4SA 3J7A5 2DGYA 3D31A 1HH2P 1QUQB 1KHIA 2BH8A 3GD7A 4DKAC 3S14H 1E24A 1L2FA 2AWOA 4BBRG 3J7ZC 5IP7H 1CSPA 1TWAH 5IYDG 2CFMA 4JI0Q 3KJOA 5C4XG 2UXDL 1NMFA 5ELNA 1EOVA 3PV0A 3T1HQ 1VQMA 4B3MQ 3PO2G 4NPSA 1HZBA 5FJ8G 4JV5L 2EXDA 5C0XG 4A3IG 1PH8A 1AE2A 2CKZB 2GVAA 4QIWE 3H3VH 4DV0L 4HIOA 2F52A 3L7ZC 4A75A 1VQ8A 1WOCA 2ZTCA 3J81i 4P74A 2JK8A 2ZTEA 4DPGA 2L15A 4OWTB 2PI2E 4DK3C 4DUZL 2BA0A 3BU2A 3KOJA 2B3GA 2ZJRA 4YWMA 1QVFA 1X3EA 4LF9Q 2KHJA 3H0GH 3K80C 4A3DG 2UXBL 3LGJA 4ALPA 2LSSA 1N32L 2JA7H 5IWAQ 1N34L 3OTOQ 1EFWA 1PH9A 1Y1VH 3GTOH 1KAWA 3ER0A 2K75A 1Q7YC 1PV4A 1E7ZA 3J80c 1VQLA 5BR8Q 2K14A 1IBMQ 1VQKA 1WJJA 1QZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V L;  2R92 G;  4BBR H;  5C4X H;  1UE1 A;  5IYD H;  1YI2 A;  3PO3 H;  3GO5 A;  3KF8 B;  4KHP Q;  2JA9 A;  3PO2 H;  4B3R Q;  1XNR L;  5FJ8 H;  1OXV A;  4B3T Q;  1N9W A;  3EIV A;  4QJF A;  1PYS B;  3S17 H;  2IX1 A;  4JV5 Q;  3AFP A;  2CQO A;  1PH5 A;  1YIT A;  3Q8D A;  1TWC H;  4POG A;  1S3O A;  2VS1 A;  2MFI A;  4A3F G;  2C35 B;  1KC8 C;  4DV0 Q;  3M4O H;  4PZ8 A;  3JC6 6;  4A3B G;  1N36 L;  1PH7 A;  3U4Z A;  5IYC G;  3M4P A;  3GTM H;  4LFB L;  1XTD A;  4NXN L;  4DUZ Q;  4DV4 L;  3KFU A;  4A3D H;  3CC2 A;  1KD1 C;  3HOU G;  4DUY Q;  1YNX A;  2D0P A;  3RLN A;  5GAD C;  2UXB Q;  1NE3 A;  4A76 A;  3RLO A;  3STB C;  4A4I A;  2BH2 A;  3H15 A;  2IY5 B;  1N32 Q;  1N34 Q;  2CCZ A;  3F1Z A;  5C0X J;  2E2H H;  3K7U C;  2NVX H;  1JMC A;  2ALY B;  4GKK Q;  1RIP A;  2N3S A;  4LF4 L;  3H3V I;  1GO3 E;  3HFZ B;  4BXX G;  3MXN B;  1K83 H;  4O0A A;  2E5L L;  3W1B A;  4A3K H;  2R92 H;  1OTC A;  1BKB A;  2A19 A;  4C3I H;  4A3J G;  1E3P A;  1BBU A;  1A0I A;  4BA1 I;  3HOV G;  1U0L A;  5JJL A;  4AIM A;  4DAY B;  4LF5 L;  2WB1 E;  2F4V Q;  4DV6 L;  3NEN A;  1O7I A;  1HNZ Q;  2FXQ A;  1VQP A;  4JI7 Q;  1K3R A;  5EAY A;  3CCU A;  4B3S L;  1N33 L;  4DR7 L;  4IPC A;  4X64 L;  4YY3 L;  4A3M G;  3T1Y Q;  3HOY G;  4Y52 H;  2R7D A;  2I5L X;  4JI3 L;  4BY7 G;  3CCS A;  3S2H H;  1XMO L;  2XTI A;  2E2I H;  4A3F H;  4A3C G;  1JJG A;  1G51 A;  3AYH B;  3K81 C;  1SRO A;  4PMW A;  3RLF A;  4AYB G;  2YTY A;  4DV1 Q;  4RG1 A;  4LF7 L;  4A3B H;  1MKH A;  5GRO A;  3U50 C;  4IFD I;  5IYC H;  1EQQ A;  4JI8 L;  1Q86 C;  2ES2 A;  3PCO B;  2Y0S E;  2YTV A;  2ZTD A;  3SGI A;  4GOP A;  1U5K A;  4R4O A;  3FHW A;  2OCE A;  1VQ4 A;  4OX9 Q;  2QA4 A;  3T1H L;  3G6E A;  4B3M L;  1PH1 A;  4L5T A;  2B29 A;  4JOI C;  3B6Y A;  1XJV A;  4R4Q A;  2AHO B;  3UE0 A;  4APV A;  4X66 Q;  3KDF B;  5C0X I;  3CME A;  4HIK A;  5DLQ E;  1SLJ A;  1WCM G;  2A8V A;  4GOP B;  4LF4 Q;  5LMU L;  3S24 A;  2Z6K C;  4GS3 A;  5H1S E;  1VQ6 A;  1A63 A;  3I7F A;  1JB7 A;  1X56 A;  2K5V A;  4DAM A;  1CUK A;  5JEA J;  3STB D;  1TXY A;  2K4K A;  4DV6 Q;  4GLX A;  4L5S A;  4DR5 L;  2R7Z G;  4A3M H;  3S1R H;  5IWA L;  3OTO L;  4B3S Q;  3HOY H;  4OWW B;  4DR7 Q;  3K8A A;  3NEM A;  4PG3 A;  3ULJ A;  3S16 H;  4PZ7 A;  1K9M C;  4BY7 H;  2NZH A;  4A3C H;  2OQ0 A;  1TWH H;  1YHB A;  4AH6 A;  4JI3 Q;  2YYZ A;  3I4M G;  1C0A A;  4KLK A;  2H5X A;  5BR8 L;  2HIV A;  2UUB L;  2LXJ A;  3HKZ G;  4IFD G;  1NBW A;  4H02 A;  2VZA A;  1L0W A;  2Q2I A;  4LF7 Q;  4GKJ Q;  4HID A;  2E8G A;  2WP8 J;  2N49 A;  4C3H H;  4UPA A;  1Z47 A;  1VS0 A;  4JI8 Q;  2VW9 A;  4KHP L;  3E0E A;  3K7A H;  4IPH A;  3PO3 G;  4B3R L;  1NMG A;  5IP9 G;  4GNX A;  4UP7 A;  1K73 C;  1QZH A;  1VQC A;  4R4C A;  5GQO A;  2AMC B;  4B3T L;  2PMZ E;  4JG2 A;  4QGU A;  4L5Q A;  4YHH L;  3U4V A;  5ELO A;  1OXU A;  2OQK A;  1WCM H;  1I6H H;  1MIU A;  3BJU A;  4LFA Q;  4IJL A;  1K0R A;  5M5X H;  2I0Q A;  3F2C A;  5LMU Q;  4GNX B;  2VNU D;  1E1O A;  1Q1B A;  4DUY L;  2CWA A;  1KL9 A;  1Z9F A;  1HZA A;  2R7Z H;  4DV2 L;  3KF6 A;  2Q2H A;  1X3G A;  1D8L A;  2A1A A;  1A8V A;  5GAH C;  4DR5 Q;  5AJ3 L;  3U58 A;  1CKN A;  1FVI A;  3I4M H;  1Y1W G;  3TRE A;  4JBM A;  1E1T A;  1H95 A;  4GKK L;  2VUM G;  3PGZ A;  4LW1 A;  1JJ2 A;  3GTJ H;  4A3G H;  4NXM L;  4EQ5 A;  1NJI C;  2UUB Q;  1WYD A;  2Z0S A;  3I4N G;  1V9P A;  1P16 A;  4JI1 Q;  4A3K G;  1J5E Q;  1V43 A;  2JJQ A;  1Y14 B;  1HNZ L;  3CCV A;  4JI7 L;  1CKN B;  3CP0 A;  5IP9 H;  1OXS C;  1X54 A;  3T1Y L;  2DUD A;  2UUC L;  1YJ9 A;  3E9I A;  3CC4 A;  1EQR A;  1Q12 A;  1EYG A;  1QVG A;  4LF8 Q;  4LFC L;  3ULP A;  1RL2 A;  3CPF A;  4XTC S;  1YIJ A;  2YTX A;  4DV1 L;  4YHH Q;  1L1O A;  4OO1 I;  5J3B A;  1I94 L;  5C4J H;  1XMQ L;  4YCW A;  3CCJ A;  2N8N A;  1FJG L;  2VY3 A;  4IFD J;  4WJ3 M;  4WJ4 A;  1PH2 A;  5JEA G;  4IPD A;  3NEL A;  4LNQ A;  4OX9 L;  3PIP A;  2NVT H;  2ASB A;  2MNA A;  4DV2 Q;  4JYA Q;  2ZJQ A;  4X66 L;  1L1O B;  4DV5 Q;  3A0J A;  1Y1W H;  4FDB A;  2Q2T A;  5AJ3 Q;  5C44 G;  2R6G A;  1M1K C;  1EUJ A;  3PUZ A;  2B63 G;  2HT1 A;  2VUM H;  2WB1 G;  3D0F A;  2R93 G;  3ZJY C;  4X6A H;  3I2Z A;  3GTL H;  4YWL A;  3F2D A;  3TRZ A;  3I4N H;  2F3I A;  2KBN A;  2EIF A;  3GTP H;  1KXL A;  5LMN W;  4LUZ A;  4NXM Q;  2HHH Q;  3L0O A;  2PI2 A;  1ASY A;  2UXC L;  1SN8 A;  4O2D A;  3J80 i;  1Q82 C;  1YBY A;  1ASZ A;  3HOZ H;  5E7N A;  4X65 Q;  1OXX K;  2IT1 A;  4PZ6 A;  4DR1 L;  4BY1 H;  2UUC Q;  4GOP C;  2I5H A;  2Y0S G;  1PH4 A;  4IO9 A;  1IZ6 A;  3K0X A;  4LFC Q;  5M5Y H;  3UDG A;  4OO1 G;  1VQI A;  3WWV A;  4GKJ L;  2WAQ E;  4R4T A;  4UP8 A;  3GTQ H;  4JBW A;  1I94 Q;  3I55 A;  1X65 A;  2JA5 H;  1XMQ Q;  3GTG H;  3IRB A;  1FJG Q;  1V1Q A;  1CKO A;  3TEH B;  1VCI A;  3S1Q H;  4DR2 L;  3PUX A;  4TQU S;  3GDE A;  4DK6 C;  5C44 H;  2B63 H;  2RF4 A;  2R93 H;  4KI0 A;  4A93 G;  3EBE A;  3UDX A;  1AH9 A;  5IY0 A;  3DLL A;  1B70 B;  3CQZ H;  4LFA L;  1XPO A;  1W2B A;  2OTL A;  3UE1 A;  3CXC A;  5M3M G;  1GM5 A;  4C2M H;  3JAM c;  5JJI A;  1VQF A;  2OWO A;  1MJE A;  1HZ9 A;  5M3F H;  3HOX G;  2R7F A;  1JE5 A;  3ERS X;  2UXC Q;  4JI4 L;  1YHA A;  3KYH C;  4JI5 L;  3VDY A;  3M7N A;  4DV7 L;  3E9H A;  4DR6 L;  1UE5 A;  3A74 A;  4DNI A;  4AQY L;  5IYB G;  4DR1 Q;  3NBH B;  1IL2 A;  3A5Z B;  4MNO A;  1VQD A;  2YV5 A;  4QL5 A;  1VQE A;  1IBK Q;  2IX0 A;  2V1C C;  3PF4 A;  4MTN A;  3CAM A;  1D7Q A;  2NN6 I;  2NVQ H;  2GN5 A;  3AFQ A;  1LYL A;  1IBL Q;  2JE6 I;  3PUY A;  4A3G G;  3I56 A;  4JI1 L;  1LUZ A;  3HKS A;  1J5E L;  3HOW G;  3CCL A;  4QQB X;  1YEZ A;  2K52 A;  3FKI H;  3CCE A;  4DR4 L;  3I4O A;  1G29 1;  3CC7 A;  4YCU A;  1UE6 A;  4GN4 B;  4LWC A;  5FLX c;  1VQ5 A;  4Y7N H;  2MO0 A;  4UP9 A;  3CD6 A;  3ULL A;  3L2P A;  4DR2 Q;  4J15 A;  3EN2 A;  1HZC A;  1VQJ A;  1Q1E A;  4LF8 L;  1PVO A;  5IT9 c;  4A93 H;  1UE7 A;  4XIG S;  1J6Q A;  1I3Q H;  1Q8K A;  3BZK A;  2Z6K A;  4IOA A;  2Q2U A;  1XNQ L;  1XPR A;  1LM0 A;  5M3M H;  3F8T A;  5LMN L;  3ICE A;  4K0K Q;  1E22 A;  1HNW L;  1K8A C;  1YVC A;  2K50 A;  1K8G A;  3S1M H;  2HIX A;  1SFO H;  3OYY A;  3HOX H;  2D62 A;  1UWV A;  4LF6 L;  1I5F A;  3FP9 A;  5GAE C;  3CCR A;  4JYA L;  1VQH A;  4HJ8 A;  1OXT A;  3OW2 A;  3S1N H;  1VQB A;  4JI4 Q;  4DV5 L;  4JI5 Q;  1EWI A;  3JAM i;  4DV7 Q;  1YHQ A;  5IYB H;  3RZO H;  4DR6 Q;  2IHE A;  4A3E G;  2KCT A;  3HKZ E;  2VL6 A;  2UU9 Q;  1P8L A;  2JEA I;  2WFW A;  2E2J H;  4AQY Q;  1HNX L;  4QY7 A;  3BZC A;  1PA6 A;  2NN6 G;  4HIM A;  1IYJ B;  4BBS G;  1KRT A;  3KLW A;  3HOW H;  1NTG A;  2HHH L;  2NZO A;  2MQH A;  4EX5 A;  3KF6 B;  4HJA A;  1L1O C;  4DV3 L;  3RZD H;  4GN3 B;  3TQY A;  2KCM A;  4DR4 Q;  1X6O A;  1NY4 A;  4X65 L;  4IJH A;  3HOZ G;  5FLM G;  1VQG A;  1R9T H;  1PH3 A;  1DGS A;  4X62 L;  1EIY B;  4BY1 G;  4TVA B;  4GLA C;  4R1J A;  5C3E G;  2VQE L;  1JT8 A;  4OON A;  1HR0 Q;  4JI6 L;  1BBW A;  1T9H A;  4JBK A;  1M90 C;  1KQS A;  1XNQ Q;  2CWP A;  2K5H A;  3CCM A;  4DR3 L;  5LMN Q;  3W5O A;  1AE3 A;  2UUA Q;  4R4I A;  1HNW Q;  2PQA A;  2JA5 G;  4P75 A;  3J81 j;  1FGU A;  2QGQ A;  2RHQ B;  4JI2 L;  5JJK A;  4JCV E;  4LF6 Q;  5HGQ A;  2RCN A;  1QVC A;  2HQL A;  3M85 A;  4A3E H;  2JA6 G;  1GKH A;  3MEF A;  1PYB A;  4GN5 A;  3CF5 A;  1KRS A;  2UXD Q;  2N78 A;  4A3I H;  1TWG H;  1KIX A;  1CSQ A;  3RN5 A;  1HR0 W;  1YJW A;  2ID0 A;  4BBS H;  2PQA B;  1HNX Q;  1SR3 A;  2KHI A;  2ZM6 L;  2JQO A;  3CMA A;  4HJ5 A;  5GAG C;  4L5R C;  2JA8 G;  5M3F G;  3M9B A;  4DV3 Q;  1X55 A;  5FLM H;  2WAQ G;  1SRU A;  4ME3 A;  4MZ9 A;  3UDI A;  2VQF L;  1X9N A;  1C9O A;  1SE8 A;  5C3E H;  3RNU A;  1IBK L;  4LUV A;  4X62 Q;  4BA2 I;  3PIO A;  1GVP A;  5IE8 A;  2MO1 A;  3PUW A;  2AWN A;  1PFS A;  2VQE Q;  2LXK A;  1IBL L;  4HJ7 A;  1Q46 A;  2IHF A;  4JI6 Q;  3CPW A;  1S40 A;  1FL0 A;  1X3F A;  4OWX B;  1TWF H;  3KJP A;  1S72 A;  1JJC B;  4DR3 Q;  4UY8 C;  4IOC A;  1W3S A;  2XGT A;  4A3L G;  3FKI G;  2QEX A;  2EQS A;  3W1G A;  4JI2 Q;  3M3Y H;  3AEV A;  2JA6 H;  2D0O A;  3M4Q A;  2I5M X;  2AKW B;  4NB3 A;  2ZJP A;  3PUV A;  3TS2 A;  4RMF A;  1XNR Q;  4POF A;  4HJ9 A;  1PHJ A;  3UDF A;  4K0K L;  1YZ6 A;  3G71 A;  3CCQ A;  1Q81 C;  3A5U A;  4LUO A;  2PNH A;  2JA8 H;  4YWK A;  3KDF A;  2ZM6 Q;  1WFQ A;  2K5N A;  4JC0 A;  1XPU A;  3PF5 A;  1N8R C;  1N36 Q;  4JI0 L;  3TS0 A;  2ATW A;  2BA1 A;  1HJP A;  2JEB I;  2RHS B;  3RR5 A;  1VQ9 A;  3HOU H;  4NXN Q;  1PH6 A;  4DV4 Q;  1IXR A;  5IP7 G;  4AYB E;  2UU9 L;  1GD7 A;  4LFB Q;  3S15 H;  2VQF Q;  5M5W H;  3J81 c;  4GNX C;  4YCV A;  3AQQ A;  3CW2 C;  3RN2 A;  1I50 H;  1MJC A;  4BXX H;  3G48 A;  1B7Y B;  3PSI A;  4A3L H;  4A3J H;  2KEN A;  4GLV B;  4JBJ A;  3F2B A;  3HOV H;  4C3J H;  2E5L Q;  2OTJ A;  1B8A A;  4KHZ A;  2GVB A;  4LF9 L;  4IPG A;  1VQ7 A;  4JOI A;  5K36 G;  1A62 A;  1VQO A;  4LF5 Q;  4OXP A;  3H0G G;  1SMX A;  1YJN A;  1QUQ A;  3GTK H;  1G6P A;  4P73 A;  1N33 Q;  1HR0 L;  1BVS A;  4X64 Q;  4YY3 Q;  2YU9 H;  1WI5 A;  1LTL A;  2JA7 G;  1VQA A;  1EIF A;  1UEB A;  1CKM A;  1C7Y A;  1Y1V G;  2UUA L;  2NVY H;  1XMO Q;  3DM3 A;  1VQN A;  1IBM L;  3S2D H;  4P72 A;  5HY6 A;  4P71 A;  3G4S A;  3J7A 5;  2DGY A;  3D31 A;  1HH2 P;  1QUQ B;  1KHI A;  2BH8 A;  3GD7 A;  4DKA C;  3S14 H;  1E24 A;  1L2F A;  2AWO A;  4BBR G;  3J7Z C;  5IP7 H;  1CSP A;  1TWA H;  5IYD G;  2CFM A;  4JI0 Q;  3KJO A;  5C4X G;  2UXD L;  1NMF A;  5ELN A;  1EOV A;  3PV0 A;  3T1H Q;  1VQM A;  4B3M Q;  3PO2 G;  4NPS A;  1HZB A;  5FJ8 G;  4JV5 L;  2EXD A;  5C0X G;  4A3I G;  1PH8 A;  1AE2 A;  2CKZ B;  2GVA A;  4QIW E;  3H3V H;  4DV0 L;  4HIO A;  2F52 A;  3L7Z C;  4A75 A;  1VQ8 A;  1WOC A;  2ZTC A;  3J81 i;  4P74 A;  2JK8 A;  2ZTE A;  4DPG A;  2L15 A;  4OWT B;  2PI2 E;  4DK3 C;  4DUZ L;  2BA0 A;  3BU2 A;  3KOJ A;  2B3G A;  2ZJR A;  4YWM A;  1QVF A;  1X3E A;  4LF9 Q;  2KHJ A;  3H0G H;  3K80 C;  4A3D G;  2UXB L;  3LGJ A;  4ALP A;  2LSS A;  1N32 L;  2JA7 H;  5IWA Q;  1N34 L;  3OTO Q;  1EFW A;  1PH9 A;  1Y1V H;  3GTO H;  1KAW A;  3ER0 A;  2K75 A;  1Q7Y C;  1PV4 A;  1E7Z A;  3J80 c;  1VQL A;  5BR8 Q;  2K14 A;  1IBM Q;  1VQK A;  1WJJ A;  1QZG A; 
#chains in the Genus database with same CATH topology
 1KLU D;  2CW0 D;  4BBR H;  4C3I G;  1STA A;  2OXP A;  1V1P B;  4KHP Q;  4FO2 A;  3S14 B;  1HA6 A;  1XNR L;  1FNU A;  1M8A A;  4B3T Q;  5BN3 A;  1TWA B;  2IX1 A;  4JV5 Q;  1B3Q A;  2D2C C;  2XWB B;  1G91 A;  3K59 A;  4QF4 A;  1KC8 C;  2IPK D;  3U4Z A;  1LTR D;  3M4P A;  1EOT A;  2J7Z A;  4DV4 L;  1FNV A;  3SDZ A;  1YNX A;  5GAD C;  1DYQ A;  4A76 A;  3RLO A;  3H15 A;  2IY5 B;  5E3F A;  3H0G B;  1N32 Q;  5C3X A;  1B4O A;  2E2H H;  1T5E A;  4C56 C;  2JA7 B;  3I91 A;  3IFT A;  4LF4 L;  3F2U A;  1GO3 E;  3HFZ B;  4BXX G;  3GTO B;  2E5L L;  1SNP A;  1BKB A;  5JJL A;  4LF5 L;  3NEN A;  4IUN A;  1VQP A;  1SE4 A;  5EAY A;  4B3S L;  2HCI A;  2PW5 A;  5JAV A;  4BBR B;  1CM9 A;  2OF1 A;  1AN8 A;  3T1Y Q;  4Y52 H;  2R7D A;  4V0B A;  1JOO A;  1G51 A;  1SSO A;  1SRO A;  4PMW A;  4A3B H;  1H9M A;  1EQQ A;  2ES2 A;  4XYQ A;  1G8Z D;  4R4O A;  2L55 A;  3J7A V;  3LNN A;  3G6E A;  4B3M L;  4RWS C;  1TS3 A;  1A15 A;  3T53 B;  1B3A A;  1QB5 D;  4JOI C;  2Z8L A;  3T56 B;  1XJV A;  3UE0 A;  3FPP A;  4HIK A;  2XIW A;  1R4P B;  4KN4 C;  1WCM G;  1CHQ D;  1TVX A;  3VR5 A;  5LMU L;  2E2H B;  1STH A;  3CU7 A;  3MVV A;  2K5V A;  3SK8 A;  1TXY A;  4DV6 Q;  4HSV A;  4GLX A;  4DR5 L;  2R7Z G;  4A3M H;  1AW7 A;  3NEM A;  4XXE A;  4BY7 H;  2E74 C;  2NZH A;  1TWH H;  1YHB A;  4JI3 Q;  2YYZ A;  5EQ0 A;  2I46 A;  1TY0 A;  4KLK A;  4GZY C;  5BR8 L;  1W6K A;  3EJI A;  4DXG A;  2VZA A;  4LF7 Q;  4HSP A;  4X3K A;  4HID A;  2E8G A;  5D3I B;  4A3B B;  3E0E A;  4IPH A;  3MXG A;  3PO3 G;  4B3R L;  5IP9 G;  1QZH A;  2CH4 A;  3EFX D;  2RCF A;  1OXU A;  1MIU A;  4LFA Q;  2X6G A;  4IJL A;  1K0R A;  1BCP F;  3F2C A;  2VNU D;  1E1O A;  2L5T A;  2FFK B;  3FEW X;  2CWA A;  3WDN A;  3TP6 A;  2A1A A;  1HFG A;  2FHT A;  1A8V A;  1WD1 A;  1CKN A;  1W6J A;  1E1T A;  4GKK L;  4A3M B;  2Z4I A;  4X3U A;  3GTJ H;  4BY7 B;  2UUB Q;  4DGZ A;  1TWH B;  2Z4H A;  3VYR A;  3J7Y W;  2PZW A;  1Y14 B;  3WOE A;  3DWP A;  1PDQ A;  1OXS C;  1X54 A;  2FJ2 A;  2SNM A;  1CI3 M;  3R2T A;  1YJ9 A;  1ZYR D;  1ZXT A;  2ENB A;  4UHV A;  1A3U A;  4LF8 Q;  1RL2 A;  3CPF A;  4YHH Q;  4MN3 A;  1CA5 A;  4OO1 I;  5CBA E;  5J3B A;  1U4M A;  4YCW A;  1FJG L;  4B9W A;  3JAM L;  5JEA G;  4IPD A;  1PTO D;  3NEL A;  1JWU D;  4RCN A;  4DK1 A;  4DV2 Q;  1EY6 A;  4LMQ D;  2A6E C;  3PUZ A;  2HT1 A;  5D14 A;  4YWL A;  3F2D A;  4L8J A;  2KBN A;  4K2K A;  2B2Y C;  4HMJ A;  5LMN W;  2EDG A;  3GTJ B;  3OPO A;  1ASY A;  1ICF B;  1SN8 A;  3J80 i;  5C5L A;  5FLX L;  3HOZ H;  5E7N A;  1OXX K;  2IT1 A;  2PPB C;  4BY1 H;  4IAL A;  5ISR A;  4LFC Q;  3OW7 A;  4OO1 G;  5CYU A;  3I55 A;  1X65 A;  2E75 C;  2L1B A;  1XMQ Q;  3GTG H;  4RKB A;  1QG7 A;  3URY A;  1VDZ A;  4FNF A;  3S1Q H;  3PUX A;  2EYM A;  3A54 A;  2A73 B;  4CKC A;  3UDX A;  3VYS A;  3CQZ H;  1BO0 A;  2EJM A;  1O7Y A;  4EQN A;  1BBX C;  4HTH A;  5M3M G;  1FYC A;  4C2M H;  3JAM c;  1D2B A;  2R7F A;  3ERS X;  1X3P A;  2UXC Q;  4DV7 L;  3A74 A;  4DNI A;  1GOZ A;  3NBH B;  3HOZ B;  1IBK Q;  1VQE A;  1DON A;  2IX0 A;  2GN5 A;  1RHP A;  5EJW A;  4CJ0 B;  3N52 A;  3I56 A;  3BDO A;  1PMR A;  3HOW G;  1ENF A;  1YEZ A;  4PV1 C;  1SEB D;  3KLS A;  3BZD B;  3CCE A;  1VF7 A;  1E0B A;  5FLX c;  4GN4 B;  3O13 A;  5TSS A;  3WOF A;  3EQL C;  4Y7N H;  3NHH A;  4ID6 A;  2F0T A;  1BNZ A;  3GTG B;  4DR2 Q;  1Q1E A;  4A93 H;  2K28 A;  3S1Q B;  3BZK A;  4J8Q A;  2Z6K A;  4IOA A;  1A3V A;  3KUP A;  5LMN L;  2WB1 B;  3F8T A;  3H09 A;  3BVG A;  1SFO H;  3JAM E;  2K05 A;  4LF6 L;  1I5F A;  4C2M B;  4JYA L;  3OW2 A;  3S1N H;  1VQB A;  4DV5 L;  1DJR D;  4CJ2 C;  1EWI A;  3JAM i;  3RZO H;  2WFW A;  2E2J H;  1TY2 A;  4QY7 A;  3TDQ A;  2Y0S B;  2RDH A;  1WTO A;  4PMB A;  3H91 A;  1X6O A;  5FLX E;  4IJH A;  5CV5 A;  5ELD A;  1R9T H;  1DGS A;  4X62 L;  4Y7N B;  4OON A;  4JI6 L;  1M90 C;  5JVH 3;  2NWG A;  1KQS A;  4A93 B;  3QG1 A;  2BDN A;  1HNW Q;  2ZXO A;  2BOS A;  5EKL A;  3G7L A;  4F7X A;  4PNY A;  2QGQ A;  1MSG A;  1SFO B;  1RCV D;  3M85 A;  2RA4 A;  4A3E H;  1PYB A;  4QCL A;  2CQA A;  1TWG H;  3J81 L;  1HR0 W;  3S1N B;  3RZO B;  2OEO A;  5I4D A;  4FP5 D;  1TU2 B;  5EPL A;  2E2J B;  1QJO A;  3D3R A;  4RAU C;  3C1F A;  4L5R C;  1QNU A;  3K58 A;  2X69 A;  1X55 A;  4OEL B;  3ERO A;  3OMC A;  4MZ9 A;  1SE8 A;  5C3E H;  4DAY A;  4LUV A;  4IUR A;  5IE8 A;  2LS0 1;  2IJ0 A;  2DNC A;  2MO1 A;  4Q0F A;  2LXK A;  1R9T B;  3MAQ A;  2IHF A;  2P5Z X;  4LK1 C;  5KNC A;  3PQI A;  1S40 A;  1IKM A;  1B53 A;  1JJC B;  5COY A;  1OO9 B;  2XGT A;  4A3L G;  3VYU A;  3M3Y H;  2Z9H A;  3AEV A;  4KK7 A;  2JA6 H;  2H1E A;  2I5M X;  3VR2 A;  2ZJP A;  1TKW B;  4RMF A;  1XNR Q;  1RTN A;  1K28 A;  4A3E B;  2SNS A;  4K0K L;  1TWG B;  2PNH A;  5BN4 A;  3E5S A;  3KDF A;  2ZM6 Q;  3C2P A;  1WFQ A;  1N8R C;  1STG A;  2JYO A;  3TZD A;  3NWS A;  1VF5 C;  4DV4 Q;  4NKL A;  1GD7 A;  3J81 c;  1SXT A;  3CW2 C;  5C3E B;  1I50 H;  1MJC A;  3G48 A;  1L0Y B;  3PSI A;  5IGE A;  4A3J H;  3HOV H;  1LT3 D;  3F2B A;  3SE0 A;  2E5L Q;  4KHZ A;  2L4N A;  4OEM B;  1VQ7 A;  4JOI A;  1A62 A;  4LF5 Q;  2F0Q A;  1YJN A;  3H0G G;  1SMX A;  1HR0 L;  1BVS A;  4K14 A;  3M3Y B;  1WI5 A;  2JA7 G;  2JA6 B;  1EIF A;  1UEB A;  1CKM A;  1SJE D;  3G6J B;  2NVY H;  3N6R A;  4TKO B;  3DM3 A;  1RJT A;  3TP8 A;  1GUS A;  4P71 A;  2AQ1 B;  1I6V C;  1HH2 P;  4QUC A;  4BBR G;  4JI0 Q;  5IP7 H;  1WD0 A;  4B3M Q;  1C48 A;  2WAQ B;  1QNK A;  4FF2 A;  3J81 E;  4QIW E;  4DV0 L;  5CR3 A;  4S3S A;  2F52 A;  4XQJ A;  2A68 D;  1VQ8 A;  4QB4 A;  3GV6 A;  3J81 i;  2JK8 A;  2ZTE A;  2K1B A;  4DK3 C;  1I50 B;  1I4H A;  1QVF A;  1S5B D;  4LF9 Q;  4A3J B;  3HOV B;  4Q5V A;  4ALP A;  1F9R A;  2MGS A;  5EGT A;  2LSS A;  3E0J A;  4MHE A;  3DEO A;  3KF8 A;  4HMI A;  3QWN A;  1EFW A;  3MZ5 A;  3KK7 A;  1HUM A;  5IGF A;  2WAC A;  4JVZ A;  2K14 A;  5BR8 Q;  5KGU A;  1WJJ A;  5K36 H;  2F4V L;  1JQY D;  5C4X H;  5E4X A;  2F0M A;  2JA9 A;  1STB A;  4BWG B;  5A2Q E;  4B3R Q;  2KJX A;  5FJ8 H;  1OXV A;  2SEB D;  1N9W A;  4QJF A;  1LT5 D;  1Q90 A;  3P75 A;  1S3O A;  4O1N A;  1SYB A;  2C35 B;  4PQX A;  1FNW A;  5EKI A;  3M4O H;  3JC6 6;  2EYJ A;  2MUY A;  4A3B G;  5DAU A;  4CBV A;  1G2S A;  4DUZ Q;  3KFU A;  5FO7 B;  1WTV A;  2D0P A;  2UXB Q;  3STB C;  1EEI D;  2CCZ A;  1I4P A;  2EJG C;  3F1Z A;  2NVX H;  1JWM D;  4GKK Q;  4ABN A;  2N3S A;  2KEC A;  2A19 A;  2F0G A;  1E3P A;  1BBU A;  4BA1 I;  1O78 A;  3TZU A;  1DCZ A;  1O7I A;  4K5W A;  1TT2 A;  1ENA A;  4IPC A;  2QIL A;  4WOR A;  3T4A C;  5C4X B;  4A3M G;  5I9O A;  3S2H H;  4BY7 G;  3CCS A;  2B2Y A;  2XTI A;  2E2I H;  3M7G A;  2QEJ C;  2K32 A;  2NTS A;  5IYC H;  3GP7 A;  4JI8 L;  3SGI A;  3M4O B;  1RKN A;  1PH1 A;  2NYZ D;  5FKA C;  4KJN A;  1AZQ A;  3B6Y A;  4R4Q A;  2AHO B;  4APV A;  5C0X I;  3CME A;  1YNJ C;  5IGB A;  4RFB A;  2A8V A;  2O2L D;  2Z6K C;  5H1S E;  2NVX B;  1A63 A;  5ELB A;  3I7F A;  1JB7 A;  5JEA J;  2X6L A;  3D4W A;  4L5S A;  2A6E D;  3NPP A;  3CKI B;  1LTI D;  3HOY H;  4DR7 Q;  3K8A A;  3S16 H;  3ULJ A;  1K9M C;  2D9U A;  1C0A A;  1TR5 A;  2HIV A;  3HKZ G;  3S2H B;  1NBW A;  4H02 A;  1K3B C;  2E2I B;  1L0W A;  2F1M A;  4UPA A;  1Z47 A;  1VS0 A;  2QW7 A;  3K7A H;  4GNX A;  1K73 C;  4EVO A;  1NUC A;  2PMZ E;  3DWA A;  5CBE E;  1I6H H;  4M1U B;  4EQO A;  2I0Q A;  2B2V A;  2F0S A;  1EY7 A;  3SK6 A;  1WVL A;  2MPM A;  4ZUJ A;  1D8L A;  5GAH C;  5AJ3 L;  3CHB D;  5LL6 S;  3I4M H;  1CA6 A;  3TRE A;  4JBM A;  1C4Q A;  1D5X C;  3HOY B;  3S16 B;  4A3G H;  4IUU A;  3HP3 A;  4NXM L;  1DOM A;  1WYD A;  4H13 C;  4AYB B;  4A3K G;  1HNZ L;  3IFD A;  1SE3 A;  3NTH A;  1BR9 A;  1CKN B;  4HED A;  4DN4 M;  5IOC A;  3BDL A;  3K7A B;  1Q12 A;  1QVG A;  1L0X B;  4DV1 L;  1TS2 A;  2RVL A;  5KYL A;  5C4J H;  1I94 L;  4IFD J;  2N8N A;  4WJ3 M;  1TII D;  1I6H B;  4WJ4 A;  2LY7 A;  4OX9 L;  4LNQ A;  1Y8P B;  2ASB A;  3DXJ C;  5CV6 A;  2J0T D;  4JYA Q;  1EFI D;  4X66 L;  4DV5 Q;  1Y1W H;  2Q2T A;  4FDB A;  2WB1 G;  1SYC A;  3NBI A;  1ZEQ X;  4X6A H;  3TRZ A;  3LWE A;  2F3I A;  3I4M B;  4DA2 A;  3GTP H;  1JR0 D;  1KXL A;  3L0O A;  1SNM A;  4I7Z C;  4A3G B;  1CQF A;  4O2D A;  1WTQ A;  1Q82 C;  1YBY A;  4PZ6 A;  2UUC Q;  4GOP C;  1DXM A;  3K0Y A;  2B2W C;  2Y0S G;  1PH4 A;  4IO9 A;  3QOJ A;  1VQI A;  4R4T A;  4RH6 A;  4K5X A;  1LTB D;  1LTG D;  1CKO A;  1G6Z A;  5FK9 C;  1UEA B;  5C4J B;  4FF4 A;  3D8G A;  3GDE A;  5C44 H;  2B63 H;  2RF4 A;  2R93 H;  4A93 G;  5IY0 A;  3DLL A;  1B70 B;  3R93 A;  1Y1W B;  4DU9 A;  1W2B A;  2A69 C;  2OWO A;  2KEE A;  2RKS A;  5M3F H;  3GTP B;  4JI4 L;  1SYE A;  3KYH C;  3M7N A;  2CVR A;  2I07 B;  2EOT A;  2IWH A;  4DR1 Q;  1JC7 A;  4MNO A;  1PRT C;  4QL5 A;  1D7Q A;  4MTN A;  2F0W A;  3CAM A;  3AFQ A;  1LYL A;  5CC4 A;  4C1N I;  2PZU A;  4ZUI A;  1J5E L;  1B44 D;  3FKI H;  1IKL A;  1EY5 A;  4LWC A;  4UP9 A;  1ILQ A;  3CD6 A;  3L2P A;  1SMY C;  2ICI A;  1VQJ A;  3EN2 A;  1UE7 A;  2PCF B;  4XIG S;  5KIX A;  2GA4 B;  1XNQ L;  5C44 B;  2AQ3 B;  4OHJ A;  2B63 B;  1EEF D;  4K0K Q;  2R93 B;  1SE2 A;  3KBG A;  4RGM A;  2EY6 A;  3A7A B;  3QJY A;  4WRD A;  3RUZ A;  1VQH A;  5JVG 3;  4ODG A;  4JI5 Q;  5ELE A;  4DR6 Q;  1B9N A;  4A3E G;  3HKZ E;  3NQT A;  4XQN A;  4AQY Q;  3BZC A;  1F2Y A;  4FXK C;  1KRT A;  2BE5 C;  2R3Z A;  3A8I E;  5L37 A;  4EX5 A;  3KF6 B;  4ME5 A;  1L1O C;  1MSH A;  2EY2 A;  5C4H A;  3TQY A;  4DR4 Q;  3IKJ A;  1NY4 A;  4X65 L;  1LAC A;  3I90 A;  3FKI B;  1VQG A;  3MEH A;  3CRL C;  2SDF A;  2HUG A;  4TVA B;  5C3E G;  4R1J A;  2VQE L;  1HR0 Q;  4IN3 A;  1T9H A;  2LKV A;  2F03 A;  1HTL D;  3CCM A;  4DR3 L;  4DF7 A;  1AE3 A;  4K8I A;  1GHK A;  2PQA A;  2JA5 G;  1FGU A;  2RHQ B;  5EPJ A;  4N9P A;  3C1E A;  3OIP A;  1EQV A;  4P2C B;  3BYY B;  2JA6 G;  1GKH A;  3S9W A;  4ZAI A;  4NMZ A;  2N78 A;  2A6H C;  1CSQ A;  3TP7 A;  4BBS H;  1HNX Q;  3AU7 A;  2KHI A;  2MHV A;  2JQO A;  1EU3 A;  4HJ5 A;  3T13 A;  1JOQ A;  4DV3 Q;  1PXU A;  4HR7 B;  2PW7 A;  2WAQ G;  5COR A;  1VMP A;  4ME3 A;  4ILW A;  1I4R A;  3UDI A;  2VQF L;  1BCP B;  1C9O A;  3RMH A;  4HN7 A;  3PUW A;  4H7B A;  1M4V A;  4TSS A;  5HGT A;  3CPW A;  4UDU C;  1FL0 A;  4OWX B;  1TWF H;  1DZ1 A;  5CV4 A;  1S72 A;  4IOC A;  3GQB A;  2PO4 A;  2QEX A;  3W1G A;  4JI2 Q;  1QWY A;  3M4Q A;  1BXT A;  4I65 A;  2QDL A;  2XSC A;  1PRT F;  2HCC A;  5E4W C;  3R8B A;  3R3O A;  1PHJ A;  1YZ6 A;  3DMU A;  1A3T A;  3L9A X;  1LTA D;  2F0I A;  2HQE A;  3SK5 A;  2JA8 H;  3V2T A;  3I73 A;  4YWK A;  4BBS B;  1PLF A;  1HFN A;  2K5N A;  2A5H A;  1XPU A;  2ATW A;  3TS0 A;  5IP7 G;  2UU9 L;  1LTT D;  4BS9 A;  3NUC A;  2F0H A;  3MXU A;  5M5W H;  4GNX C;  3NXW A;  4BY1 B;  2LFN A;  3RN2 A;  5E1F A;  2ICE C;  1YNN C;  4BXX H;  3QB3 A;  2L9H A;  2Q8R E;  4G7Z C;  1KAB A;  4JBJ A;  3A8J E;  1FD7 D;  4C3J H;  1U4P A;  1TWF B;  2CW0 C;  1G6P A;  1QUQ A;  3KLR A;  2B2V C;  4P73 A;  2WII B;  1TS5 A;  5J39 A;  3D4R A;  3BDC A;  4ZRZ A;  1JWS D;  1X32 A;  3S2D H;  4P72 A;  4ZCK A;  3CQZ B;  1RD9 D;  1KHI A;  2EY1 A;  5K36 G;  1E24 A;  2AWO A;  2JA8 B;  1CSP A;  5C4X G;  2CFM A;  2UXD L;  1NMF A;  3I8Z A;  3QO2 A;  2LMC B;  4JV5 L;  4NPS A;  1HZB A;  5FJ8 G;  1A2T A;  1EZ8 A;  1V8Q A;  4A3I G;  1AE2 A;  1R4Q B;  1QOH A;  2RSO A;  3D6W A;  1U4R A;  5M5W B;  3L7Z C;  4RGO S;  1NR2 A;  2K5Q A;  1IW7 C;  2AQ2 B;  4P74 A;  4DPG A;  2PI2 E;  5EKK A;  2BA0 A;  3BU2 A;  3KOJ A;  2ZJR A;  1JOR A;  2EYH A;  2KHJ A;  4KN7 C;  3KLS X;  2KCN A;  4C3J B;  2WKC A;  1YNJ D;  1AP0 A;  2K01 A;  1N32 L;  4U68 A;  4JW0 A;  3ER0 A;  5KNB A;  1Q7Y C;  1E7Z A;  1IBM Q;  1F2M A;  5IYD H;  1ENC A;  1YI2 A;  3GO5 A;  3KF8 B;  3MFG A;  3PO3 H;  3S2D B;  4CJ1 B;  4RHR A;  2XNA C;  1PYS B;  3S17 H;  2VB3 X;  2CQO A;  1PH5 A;  1YIT A;  3HRZ C;  1TWC H;  4POG A;  4HAE A;  2MFI A;  4F8M A;  2WIN B;  1C8C A;  5DEH A;  3FMC A;  4K5V A;  3IAY A;  5J1Z A;  5IYC G;  1SNQ A;  2M00 A;  3GTM H;  4LFB L;  1XTD A;  1PFN A;  1CQV A;  4NXN L;  3MXN A;  4A3D H;  2F3W A;  1SND A;  1BDO A;  1KD1 C;  3HOU G;  1NE3 A;  4B9X A;  4A4I A;  3EA6 A;  3HGB A;  1N34 Q;  4KKT A;  5C0X J;  4KY6 A;  3K7U C;  2ALY B;  2Z1C A;  2F0E A;  1RIP A;  1CTM A;  3H3V I;  2F0D A;  4RHS A;  1K83 H;  4O0A A;  1SAP A;  3W1B A;  2R92 H;  3QOL A;  1U0L A;  2TMP A;  5CV9 A;  5I2X A;  1CK1 A;  4DV6 L;  1HNZ Q;  1HQR D;  4YY3 L;  3PO3 B;  3HOY G;  4JI3 L;  4RCO A;  1K0S A;  1XMO L;  4A3F H;  1LO5 D;  3AYH B;  1I4G A;  1BCP D;  3E3X A;  3P20 A;  3K81 C;  4AYB G;  4DV1 Q;  4RG1 A;  4LF7 L;  3S17 B;  3MWY W;  1TWC B;  1CFM A;  1Q86 C;  2YTV A;  1RTO A;  2ZTD A;  4GOP A;  4OX9 Q;  3FHW A;  2OCE A;  2B2W A;  3T1H L;  4L5T A;  3W2D A;  4OIJ A;  3GTM B;  1CZW A;  4J6H A;  3VR4 A;  4K6L A;  4A3D B;  3A8K E;  4C1N K;  4X66 Q;  1B2T A;  5DLQ E;  1F77 A;  5IGG A;  4LF4 Q;  1A6X A;  1VQ6 A;  1X56 A;  4DAM A;  1K83 B;  2R92 B;  2K4K A;  2KCC A;  4WFN 3;  3OTO L;  3NSW A;  4B3S Q;  4PZ7 A;  4A3C H;  2F0V A;  2OQ0 A;  4AH6 A;  5F2D A;  3I4M G;  4OO1 H;  4KKU A;  2UUB L;  2LXJ A;  1H9S A;  4A3F B;  2IL8 A;  2WP8 J;  5JPM C;  4C3H H;  3TME A;  2VW9 A;  2K03 A;  4UP7 A;  1PTO C;  4R4C A;  5GQO A;  5G3L F;  4X3T A;  4L5Q A;  4QGU A;  4YHH L;  1ML0 D;  2OQK A;  5IOD A;  2IW3 A;  1QIL A;  3ZYY X;  1EQT A;  4XDX A;  5LMU Q;  4GNX B;  3QIA A;  2F0N A;  4DUY L;  4RA8 A;  1Z9F A;  1HZA A;  3NTK A;  4DV2 L;  1X3G A;  2NBF A;  4DR5 Q;  3NQI A;  4KHV A;  3AB9 A;  5FO9 B;  1Y1W G;  1H95 A;  1PFB A;  2HDM A;  3PGZ A;  1JJ2 A;  1GUG A;  4IFD H;  1KNE A;  4EQ5 A;  1NJI C;  4G7O C;  2Z0S A;  1V9P A;  2NVY B;  1J5E Q;  1V43 A;  1UNS A;  2JJQ A;  2O5I C;  2MP1 A;  2NTT A;  3CCV A;  4JI7 L;  2ZT9 C;  4K8J A;  3D6C A;  1CZG A;  4N8F A;  2F0O A;  3SXH A;  2DUD A;  1PRT D;  4C3H B;  3E9I A;  1O80 A;  2PQE A;  3CC4 A;  1EQR A;  1EYG A;  3E6Z X;  4LFC L;  3X3M A;  3ULP A;  4XTC S;  1YIJ A;  2YTX A;  1L1O A;  3V96 A;  2N88 A;  5HUR A;  1XMQ L;  3CCJ A;  4PMC A;  1S5F D;  1PH2 A;  1NNX A;  1XWE A;  2V4D A;  1RF2 D;  3PIP A;  2NVT H;  2MNA A;  1TQO A;  1Z6H A;  3Q22 A;  3A0J A;  5C44 G;  2R6G A;  1EUJ A;  4KTA A;  2B63 G;  2VUM H;  1ICW A;  2JSO A;  2R93 G;  2OT2 A;  3ZJY C;  3BVM A;  3I2Z A;  4DFA A;  4N8X 1;  3I4N H;  4MIU A;  2XRQ D;  4LUZ A;  4IUT A;  2PI2 A;  2RBM A;  5DM7 3;  5IGC A;  2B2U C;  2UXC L;  5IIF A;  1ASZ A;  3LX0 A;  4QIW B;  4X65 Q;  3Q0A A;  4ZQ3 A;  1EL0 A;  2I5H A;  1II3 A;  4FF3 A;  4KJO A;  2BE5 D;  3U9S A;  2N55 A;  1E2Z A;  4XT3 B;  3WWV A;  2L0C A;  4GKJ L;  3GTQ H;  1BF4 A;  4JBW A;  1FJG Q;  1V1Q A;  4DR2 L;  4TQU S;  4ZLT F;  4DK6 C;  2NVT B;  2XRS D;  3P7J A;  3EBE A;  1AH9 A;  1NCV A;  2M9V A;  1XPO A;  1BOS A;  4L63 B;  2VUM B;  2K7V A;  1GM5 A;  3I72 A;  1IYU A;  2BCO A;  1WTX A;  1JE5 A;  3I4N B;  2WKD A;  5DM6 3;  3VDY A;  2QCP X;  2DJG C;  1PTO F;  3E9H A;  1GUT A;  3I3C A;  1UE5 A;  1GXD C;  1Y69 U;  2RDG A;  1IL2 A;  3OMG A;  3PF4 A;  1XXG A;  2V1C C;  3NP8 A;  2JE6 I;  3PUY A;  4JI1 L;  1LUZ A;  3DHQ A;  1DOL A;  1BUV T;  3CCL A;  4QQB X;  3I4O A;  3QR8 A;  1G29 1;  4YCU A;  1UE6 A;  3GTQ B;  2MO0 A;  1MHW C;  4YIJ A;  1D6E C;  4QMG A;  1UAP A;  1PVO A;  1MGS A;  3HEJ A;  1Q8K A;  4ZK9 B;  1XPR A;  1LM0 A;  1B50 A;  1O7L A;  3PIP 3;  1HNW L;  1SBB B;  1YVC A;  1EY8 A;  3S1M H;  2HIX A;  1ONL A;  3OYY A;  3HOX H;  4FVM A;  2F0U A;  5GAE C;  1OXT A;  1AZP A;  4DV7 Q;  5IYB H;  4G7H C;  2UU9 Q;  4CHT B;  2VL6 A;  1O7Z A;  1P8L A;  2JEA I;  3ND8 A;  1Y8O B;  1PA6 A;  1IYJ B;  2NUC A;  4BBS G;  2XVS A;  1NTG A;  1KDA A;  3L3O C;  2HHH L;  2NZO A;  1KNA A;  1Q8I A;  2MQH A;  4HJA A;  3RZD H;  4GN3 B;  3HOZ G;  2HDL A;  4BY1 G;  1JT8 A;  1YNN D;  4JBK A;  2O4X A;  2EYF A;  2KUM A;  4RGT A;  2CWP A;  5I6Y A;  5LMN Q;  1ET9 A;  4CDE C;  3J81 j;  3DUZ A;  3S1M B;  4LF6 Q;  3HOX B;  1LTS D;  2RCN A;  3MEF A;  3HS0 C;  4GN5 A;  3CF5 A;  4KD3 A;  2UXD Q;  1KIX A;  3BVZ A;  2NN6 H;  1ILP A;  2ID0 A;  3M4Y A;  2PQA B;  1EYD A;  3DWQ A;  3LWU A;  2ZM6 L;  1STN A;  5GAG C;  2JA8 G;  3EVQ A;  2PMZ B;  1EWH A;  3M9B A;  3K57 A;  4F87 A;  1BQQ T;  5FLM H;  2EE1 A;  1EY4 A;  4FF1 A;  1HPC A;  1X9N A;  3RZD B;  5C5M A;  4BA2 I;  4X62 Q;  3PIO A;  1GVP A;  1T5X D;  1PFS A;  1IBL L;  1WTR A;  4JI6 Q;  1IW7 D;  2QKI C;  4LJZ C;  5ELF A;  4FXG C;  4UY8 C;  4I7A A;  1W3S A;  4ULL A;  2EQS A;  4C3J G;  5G3L D;  1F9P A;  3PUV A;  4POF A;  4HJ9 A;  3UDF A;  3G71 A;  2O5J C;  1Q81 C;  4LUO A;  1MBY A;  2PYK A;  1H9J A;  1PZI D;  4FYD A;  4JC0 A;  1QE6 A;  3PF5 A;  2A68 C;  4JI0 L;  3K5M A;  2EZV A;  2BA1 A;  4R8N A;  4LFB Q;  2AUK A;  4NXN Q;  1S5C D;  3S15 H;  4DNR B;  1G2T A;  1DOK A;  2G9H D;  3TSS A;  3NE5 B;  3Q6S A;  3AQQ A;  3VR3 A;  5CV7 A;  2ZXP A;  3J80 L;  2KEN A;  2K5D A;  1B8A A;  2GVB A;  1XTC D;  4IPG A;  4LF9 L;  3MXP A;  2F0K A;  2K04 A;  1VQO A;  5M9O A;  3GTK H;  4IUP A;  4YY3 Q;  3SR1 A;  1LTL A;  4UAI A;  1C7Y A;  4DK0 A;  2UUA L;  1XMO Q;  2QF7 A;  1WTH A;  1VQN A;  5HY6 A;  2G5D A;  3G4S A;  3NWT A;  2DGY A;  4DAV A;  1QUQ B;  3FVQ A;  1D1I A;  1KDC A;  2BH8 A;  2VB2 X;  2EPB A;  3RD4 A;  5C3W A;  3J7Z C;  3TP5 A;  5IYD G;  5M3F B;  1U9R A;  3PMF A;  1PFM A;  5ELN A;  3T1H Q;  3PV0 A;  2M2L A;  5A35 A;  4IUQ A;  1PH8 A;  3S15 B;  5KYI A;  2ZTC A;  2L15 A;  4OWT B;  4DUZ L;  1XX8 A;  1X3E A;  3PIO 3;  4A3D G;  3X3N A;  2UXB L;  3OWE B;  5EBC A;  1HCZ A;  1V1P A;  2DNE A;  3OTO Q;  2EYL A;  2L12 A;  1Y1V H;  1KAW A;  3GTK B;  2K75 A;  3ERQ A;  3J80 c;  1NSN S;  1VQL A;  2QDB A;  4H0L C;  1VQK A;  2B39 A;  2R92 G;  3OOC A;  3U9O A;  1UE1 A;  2E2D C;  5LL6 X;  3PO2 H;  4R8I A;  5C0X H;  3EIV A;  3AFP A;  4CDF C;  1GUO A;  3Q8D A;  2VS1 A;  4A3F G;  4DV0 Q;  1NR4 A;  4PZ8 A;  4KY7 A;  1N36 L;  1PH7 A;  3A7L A;  5CV8 A;  4OL7 A;  1I4Q A;  4ZKB B;  3CC2 A;  3BS1 A;  4DUY Q;  4DXF A;  3RLN A;  1IHZ A;  2BH2 A;  1IYV A;  4RGN A;  1EIH A;  1JMC A;  1B9M A;  4HCS A;  4E6I A;  1D5M C;  3MXN B;  3J80 E;  1Y1V B;  4A3K H;  2F0L A;  1OTC A;  4C3I H;  4A3J G;  1GUW A;  3HOV G;  1A0I A;  3HKZ B;  5IGD A;  1CHP D;  2JN4 A;  1KTK A;  2WB1 E;  4AIM A;  4DAY B;  5CGK A;  2AUJ D;  2F4V Q;  1HQM C;  2KA7 A;  2KHS A;  2FXQ A;  3ND9 A;  4JI7 Q;  1K3R A;  1N33 L;  3CCU A;  4DR7 L;  1STE A;  2B8G A;  4X64 L;  1JE4 A;  1LLR D;  2I5L X;  1JJG A;  4A3C G;  2E76 C;  3PO2 B;  2B8F A;  3RLF A;  2B2U A;  3A55 A;  2YTY A;  4KKS A;  4U67 3;  1MKH A;  5GRO A;  3U50 C;  4IFD I;  4IUV A;  1EWC A;  4CKB A;  3PCO B;  2Y0S E;  5JOB A;  1GHJ A;  1VQ4 A;  1KLG D;  1U5K A;  4C3H G;  3MHB A;  2QA4 A;  3VR6 A;  1PYW D;  1JOK A;  1PZJ D;  2B29 A;  3KDF B;  1EYC A;  1SLJ A;  4GOP B;  3S24 A;  4GS3 A;  3MFY A;  3Q23 A;  1CUK A;  3HG9 A;  3STB D;  2FMC A;  4G4K A;  4A3K B;  1XYI A;  4C3I B;  2EYP A;  3S1R H;  5IWA L;  4O42 A;  1S4Z A;  3VA5 A;  4OWW B;  4PG3 A;  4NDX A;  4G57 A;  1QCB D;  1GUN A;  1B1Z A;  1SYD A;  2G9D A;  2H5X A;  4IFD G;  4GKJ Q;  2Q2I A;  2N49 A;  4JI8 Q;  5C6A A;  4KHP L;  5D65 A;  1NMG A;  2WV6 D;  3MA2 B;  2C5C A;  5BN5 A;  4B3T L;  1VQC A;  2AMC B;  5NUC A;  2DY7 A;  1D1K A;  4JG2 A;  1H9S B;  3U4V A;  2ZXR A;  5ELO A;  1WCM H;  4HCE A;  3BJU A;  2B2T C;  4QUF A;  4ZKC B;  1H9R A;  2JXM B;  5M5X H;  1PRT B;  2CHB D;  1Q1B A;  1RDP D;  3GV3 A;  1KL9 A;  2R7Z H;  1KDB A;  3KF6 A;  2Q2H A;  4OIK A;  3U58 A;  1F9Q A;  3IL8 A;  1FVI A;  3S1R B;  4LW1 A;  2VUM G;  4EGV A;  2RSN A;  3K6O A;  3I4N G;  1HRJ A;  2F3V A;  3K5L A;  2EYO A;  3T51 B;  1P16 A;  4RKL A;  1LAB A;  5ELC A;  4JI1 Q;  2A74 C;  1VMC A;  1F2Z A;  3CP0 A;  5IP9 H;  1HUN A;  2F0F A;  3R2I A;  3T1Y L;  2UUC L;  2KED A;  4J1M A;  2KOL A;  4TRD A;  4ZYS A;  4MTK A;  1E2V A;  4R9W A;  1FGB D;  3NTI A;  3BG3 A;  3NK9 A;  2VY3 A;  1WCM B;  4FXD A;  4WJW A;  5M5X B;  1EYA A;  2ZJQ A;  1STY A;  1L1O B;  1JB3 A;  5AJ3 Q;  1M1K C;  1TS4 A;  2R7Z B;  5C4Z A;  2EJF C;  2CH4 W;  2EVB A;  3C3L A;  4V19 0;  3T16 A;  2XWJ B;  1A2U A;  3D0F A;  5K5P A;  3GTL H;  2FMM A;  2EIF A;  2Q8T A;  5KEE A;  4NXM Q;  2HHH Q;  3K5O A;  1JIC A;  2DY8 A;  3AMU A;  4DR1 L;  4DNT B;  2MJ8 A;  5IT9 L;  5D3D A;  4CDD C;  5LHY 1;  1LT4 D;  1EU4 A;  1IZ6 A;  3K0X A;  4JPB W;  5M5Y H;  3UDG A;  2F0P A;  2WAQ E;  4UP8 A;  1I94 Q;  4K2L A;  2JA5 H;  3VYT A;  5JEA H;  1WTW A;  3IRB A;  3TEH B;  1DD2 A;  1VCI A;  1WTP A;  3SEB A;  2C9O A;  1MD2 D;  5A2Q L;  4M8A A;  5T1G A;  4KI0 A;  1IL8 A;  1LV9 A;  4LFA L;  3NBH A;  4B08 A;  2OTL A;  1AFP A;  4X3S A;  3SK4 A;  1H9K A;  3UE1 A;  3CXC A;  1DM0 B;  2H4O A;  5JJI A;  1VQF A;  1MJE A;  3GTL B;  1HZ9 A;  5KRU A;  3SVM A;  5JPN C;  3HOX G;  1HHV A;  1YHA A;  4JI5 L;  4DR6 L;  1EY9 A;  4NP5 A;  3V05 A;  4AQY L;  5IYB G;  5FOB B;  1SNO A;  3A5Z B;  1VQD A;  2YV5 A;  1ZYR C;  2VXW A;  2NN6 I;  2NVQ H;  3CRK C;  1IBL Q;  3I4L A;  4A3G G;  3HKS A;  2J4X A;  3VA7 A;  5KND A;  2K52 A;  5M5Y B;  4DR4 L;  3CC7 A;  3MTS A;  3OHX C;  1VQ5 A;  3D4D A;  1ESF A;  2JA5 B;  1HXY D;  3ULL A;  4J15 A;  1HZC A;  4LF8 L;  3BYT B;  4LAA A;  5IT9 c;  3MC0 B;  3OWF A;  2PZT A;  4IQZ A;  4CKE A;  1J6Q A;  1J9O A;  1I3Q H;  4NW2 A;  2Q2U A;  1SYG A;  1HTP A;  2Z6B A;  5M3M H;  1U4L A;  3ICE A;  1E22 A;  1K8A C;  2K50 A;  1K8G A;  5I6W A;  4CDC C;  2D62 A;  2K6A A;  1UWV A;  3FP9 A;  1V1O A;  3CCR A;  4HJ8 A;  4JI4 Q;  3SHL A;  1YHQ A;  3P1H A;  4KD4 A;  2IHE A;  2KCT A;  1GJX A;  1S5E D;  3DEP A;  3H3V C;  1HNX L;  2A69 D;  2NN6 G;  4HIM A;  3KLW A;  3HOW H;  3FPU B;  2IX3 A;  2K33 A;  2NVQ B;  5T1I A;  4DV3 L;  2KCM A;  2NZ1 D;  3DM1 A;  2XN9 C;  5FLM G;  2KQ3 A;  1PH3 A;  5AFW A;  1EIY B;  4GLA C;  5IT9 E;  1MI2 A;  1BBW A;  4KV6 A;  1XNQ Q;  2K5H A;  2UUA Q;  3W5O A;  1I3Q B;  5EPK A;  4R4I A;  2HD3 A;  4P75 A;  1Z7T A;  5M3M B;  4JI2 L;  1SMY D;  1ESR A;  5JJK A;  2SOB A;  4JCV E;  5HGQ A;  1KAA A;  3TN2 A;  1QVC A;  2HQL A;  3HZX A;  5JJZ A;  1JCK B;  1KRS A;  2RDF A;  4JK1 C;  4A3I H;  3RN5 A;  1YJW A;  1K8O A;  2L11 A;  1SR3 A;  1EZ6 A;  3CMA A;  1EY0 A;  1E2W A;  1F2L A;  3OIQ A;  3HOW B;  5M3F G;  1NAP A;  4F88 A;  1SRU A;  1UUP A;  2RQX A;  3RNU A;  1IBK L;  2F4I A;  2AWN A;  4XT1 B;  2VQE Q;  4HJ7 A;  1Q46 A;  4KY5 A;  2R61 A;  1X3F A;  3KJP A;  3I70 A;  4DR3 Q;  3ITP A;  3H94 A;  3FKI G;  1PZK D;  1X3Q A;  3W3A A;  3ONA B;  1Q3L A;  2D0O A;  2NB0 A;  4K6D A;  1SJH D;  2AKW B;  3FDT A;  4NB3 A;  5I9P A;  3TS2 A;  4L6T B;  3K5N A;  4IZ8 A;  3CCQ A;  4Z9C B;  3A5U A;  2Q8I B;  5I2Y A;  4A3I B;  1ROD A;  1N36 Q;  5FO8 B;  1HJP A;  2JEB I;  2RHS B;  3RR5 A;  1VQ9 A;  3HOU H;  1PH6 A;  1CT1 D;  1IXR A;  1D5Z C;  2A6H D;  4AYB E;  5EBD A;  1SYF A;  2VQF Q;  3C46 A;  2DJF C;  4YCV A;  2KVM A;  3Q24 A;  1F9S A;  3FRP B;  2TSS A;  1B7Y B;  4A3L H;  4GLV B;  4N9T A;  2OTJ A;  2PNR C;  5CMD A;  1ET6 A;  1ZKO A;  2BDO A;  4CGY B;  2EXZ A;  3A56 A;  1SDF A;  2F0J A;  4OXP A;  1AEX A;  1N33 Q;  1PTO H;  1HA5 A;  1K8M A;  4X64 Q;  2YU9 H;  1VQA A;  4KMU C;  2JP1 A;  1Y1V G;  1S5D D;  2K5W A;  1IBM L;  1FR3 A;  3J7A 5;  2FIN B;  3D31 A;  3H6M A;  4OGQ C;  3TBI B;  3S14 H;  4DKA C;  3GD7 A;  5J22 A;  1L2F A;  1TWA H;  3KJO A;  3KBX A;  1EOV A;  3OSO A;  1EIG A;  4H44 C;  1VQM A;  3PO2 G;  1LT6 D;  3HOU B;  2EXD A;  5C0X G;  2CKZ B;  2GVA A;  4XYO A;  3H3V H;  4HIO A;  4A75 A;  4DAP A;  1WOC A;  3UI2 A;  2DN8 A;  1SNC A;  2B3G A;  4YWM A;  4EQP A;  3H0G H;  3K80 C;  5DNF A;  3LGJ A;  3J7A F;  2JA7 H;  5IWA Q;  1N34 L;  2B2T A;  2D5D A;  1PH9 A;  3GTO H;  1J8I A;  1PTO B;  1Y8N B;  1PV4 A;  2YU9 B;  4XQQ A;  1I4X A;  2EY5 A;  1BCP C;  1QZG A; 
#chains in the Genus database with same CATH homology
 2F4V L;  2R92 G;  4BBR H;  5C4X H;  1UE1 A;  5IYD H;  1YI2 A;  3PO3 H;  3GO5 A;  3KF8 B;  4KHP Q;  2JA9 A;  3PO2 H;  4B3R Q;  1XNR L;  5FJ8 H;  1OXV A;  4B3T Q;  1N9W A;  3EIV A;  4QJF A;  1PYS B;  3S17 H;  2IX1 A;  4JV5 Q;  3AFP A;  2CQO A;  1PH5 A;  1YIT A;  3Q8D A;  1TWC H;  4POG A;  1S3O A;  2VS1 A;  2MFI A;  4A3F G;  2C35 B;  1KC8 C;  4DV0 Q;  3M4O H;  4PZ8 A;  3JC6 6;  4A3B G;  1N36 L;  1PH7 A;  3U4Z A;  5IYC G;  3M4P A;  3GTM H;  4LFB L;  1XTD A;  4NXN L;  4DUZ Q;  4DV4 L;  3KFU A;  4A3D H;  3CC2 A;  1KD1 C;  3HOU G;  4DUY Q;  1YNX A;  2D0P A;  3RLN A;  5GAD C;  2UXB Q;  1NE3 A;  4A76 A;  3RLO A;  3STB C;  4A4I A;  2BH2 A;  3H15 A;  2IY5 B;  1N32 Q;  1N34 Q;  2CCZ A;  3F1Z A;  5C0X J;  2E2H H;  3K7U C;  2NVX H;  1JMC A;  2ALY B;  4GKK Q;  1RIP A;  2N3S A;  4LF4 L;  3H3V I;  1GO3 E;  3HFZ B;  4BXX G;  3MXN B;  1K83 H;  4O0A A;  2E5L L;  3W1B A;  4A3K H;  2R92 H;  1OTC A;  1BKB A;  2A19 A;  4C3I H;  4A3J G;  1E3P A;  1BBU A;  1A0I A;  4BA1 I;  3HOV G;  1U0L A;  5JJL A;  4AIM A;  4DAY B;  4LF5 L;  2WB1 E;  2F4V Q;  4DV6 L;  3NEN A;  1O7I A;  1HNZ Q;  2FXQ A;  1VQP A;  4JI7 Q;  1K3R A;  5EAY A;  3CCU A;  4B3S L;  1N33 L;  4DR7 L;  4IPC A;  4X64 L;  4YY3 L;  4A3M G;  3T1Y Q;  3HOY G;  4Y52 H;  2R7D A;  2I5L X;  4JI3 L;  4BY7 G;  3CCS A;  3S2H H;  1XMO L;  2XTI A;  2E2I H;  4A3F H;  4A3C G;  1JJG A;  1G51 A;  3AYH B;  3K81 C;  1SRO A;  4PMW A;  3RLF A;  4AYB G;  2YTY A;  4DV1 Q;  4RG1 A;  4LF7 L;  4A3B H;  1MKH A;  5GRO A;  3U50 C;  4IFD I;  5IYC H;  1EQQ A;  4JI8 L;  1Q86 C;  2ES2 A;  3PCO B;  2Y0S E;  2YTV A;  2ZTD A;  3SGI A;  4GOP A;  1U5K A;  4R4O A;  3FHW A;  2OCE A;  1VQ4 A;  4OX9 Q;  2QA4 A;  3T1H L;  3G6E A;  4B3M L;  1PH1 A;  4L5T A;  2B29 A;  4JOI C;  3B6Y A;  1XJV A;  4R4Q A;  2AHO B;  3UE0 A;  4APV A;  4X66 Q;  3KDF B;  5C0X I;  3CME A;  4HIK A;  5DLQ E;  1SLJ A;  1WCM G;  2A8V A;  4GOP B;  4LF4 Q;  5LMU L;  3S24 A;  2Z6K C;  4GS3 A;  5H1S E;  1VQ6 A;  1A63 A;  3I7F A;  1JB7 A;  1X56 A;  2K5V A;  4DAM A;  1CUK A;  5JEA J;  3STB D;  1TXY A;  2K4K A;  4DV6 Q;  4GLX A;  4L5S A;  4DR5 L;  2R7Z G;  4A3M H;  3S1R H;  5IWA L;  3OTO L;  4B3S Q;  3HOY H;  4OWW B;  4DR7 Q;  3K8A A;  3NEM A;  4PG3 A;  3ULJ A;  3S16 H;  4PZ7 A;  1K9M C;  4BY7 H;  2NZH A;  4A3C H;  2OQ0 A;  1TWH H;  1YHB A;  4AH6 A;  4JI3 Q;  2YYZ A;  3I4M G;  1C0A A;  4KLK A;  2H5X A;  5BR8 L;  2HIV A;  2UUB L;  2LXJ A;  3HKZ G;  4IFD G;  1NBW A;  4H02 A;  2VZA A;  1L0W A;  2Q2I A;  4LF7 Q;  4GKJ Q;  4HID A;  2E8G A;  2WP8 J;  2N49 A;  4C3H H;  4UPA A;  1Z47 A;  1VS0 A;  4JI8 Q;  2VW9 A;  4KHP L;  3E0E A;  3K7A H;  4IPH A;  3PO3 G;  4B3R L;  1NMG A;  5IP9 G;  4GNX A;  4UP7 A;  1K73 C;  1QZH A;  1VQC A;  4R4C A;  5GQO A;  2AMC B;  4B3T L;  2PMZ E;  4JG2 A;  4QGU A;  4L5Q A;  4YHH L;  3U4V A;  5ELO A;  1OXU A;  2OQK A;  1WCM H;  1I6H H;  1MIU A;  3BJU A;  4LFA Q;  4IJL A;  1K0R A;  5M5X H;  2I0Q A;  3F2C A;  5LMU Q;  4GNX B;  2VNU D;  1E1O A;  1Q1B A;  4DUY L;  2CWA A;  1KL9 A;  1Z9F A;  1HZA A;  2R7Z H;  4DV2 L;  3KF6 A;  2Q2H A;  1X3G A;  1D8L A;  2A1A A;  1A8V A;  5GAH C;  4DR5 Q;  5AJ3 L;  3U58 A;  1CKN A;  1FVI A;  3I4M H;  1Y1W G;  3TRE A;  4JBM A;  1E1T A;  1H95 A;  4GKK L;  2VUM G;  3PGZ A;  4LW1 A;  1JJ2 A;  3GTJ H;  4A3G H;  4NXM L;  4EQ5 A;  1NJI C;  2UUB Q;  1WYD A;  2Z0S A;  3I4N G;  1V9P A;  1P16 A;  4JI1 Q;  4A3K G;  1J5E Q;  1V43 A;  2JJQ A;  1Y14 B;  1HNZ L;  3CCV A;  4JI7 L;  1CKN B;  3CP0 A;  5IP9 H;  1OXS C;  1X54 A;  3T1Y L;  2DUD A;  2UUC L;  1YJ9 A;  3E9I A;  3CC4 A;  1EQR A;  1Q12 A;  1EYG A;  1QVG A;  4LF8 Q;  4LFC L;  3ULP A;  1RL2 A;  3CPF A;  4XTC S;  1YIJ A;  2YTX A;  4DV1 L;  4YHH Q;  1L1O A;  4OO1 I;  5J3B A;  1I94 L;  5C4J H;  1XMQ L;  4YCW A;  3CCJ A;  2N8N A;  1FJG L;  2VY3 A;  4IFD J;  4WJ3 M;  4WJ4 A;  1PH2 A;  5JEA G;  4IPD A;  3NEL A;  4LNQ A;  4OX9 L;  3PIP A;  2NVT H;  2ASB A;  2MNA A;  4DV2 Q;  4JYA Q;  2ZJQ A;  4X66 L;  1L1O B;  4DV5 Q;  3A0J A;  1Y1W H;  4FDB A;  2Q2T A;  5AJ3 Q;  5C44 G;  2R6G A;  1M1K C;  1EUJ A;  3PUZ A;  2B63 G;  2HT1 A;  2VUM H;  2WB1 G;  3D0F A;  2R93 G;  3ZJY C;  4X6A H;  3I2Z A;  3GTL H;  4YWL A;  3F2D A;  3TRZ A;  3I4N H;  2F3I A;  2KBN A;  2EIF A;  3GTP H;  1KXL A;  5LMN W;  4LUZ A;  4NXM Q;  2HHH Q;  3L0O A;  2PI2 A;  1ASY A;  2UXC L;  1SN8 A;  4O2D A;  3J80 i;  1Q82 C;  1YBY A;  1ASZ A;  3HOZ H;  5E7N A;  4X65 Q;  1OXX K;  2IT1 A;  4PZ6 A;  4DR1 L;  4BY1 H;  2UUC Q;  4GOP C;  2I5H A;  2Y0S G;  1PH4 A;  4IO9 A;  1IZ6 A;  3K0X A;  4LFC Q;  5M5Y H;  3UDG A;  4OO1 G;  1VQI A;  3WWV A;  4GKJ L;  2WAQ E;  4R4T A;  4UP8 A;  3GTQ H;  4JBW A;  1I94 Q;  3I55 A;  1X65 A;  2JA5 H;  1XMQ Q;  3GTG H;  3IRB A;  1FJG Q;  1V1Q A;  1CKO A;  3TEH B;  1VCI A;  3S1Q H;  4DR2 L;  3PUX A;  4TQU S;  3GDE A;  4DK6 C;  5C44 H;  2B63 H;  2RF4 A;  2R93 H;  4KI0 A;  4A93 G;  3EBE A;  3UDX A;  1AH9 A;  5IY0 A;  3DLL A;  1B70 B;  3CQZ H;  4LFA L;  1XPO A;  1W2B A;  2OTL A;  3UE1 A;  3CXC A;  5M3M G;  1GM5 A;  4C2M H;  3JAM c;  5JJI A;  1VQF A;  2OWO A;  1MJE A;  1HZ9 A;  5M3F H;  3HOX G;  2R7F A;  1JE5 A;  3ERS X;  2UXC Q;  4JI4 L;  1YHA A;  3KYH C;  4JI5 L;  3VDY A;  3M7N A;  4DV7 L;  3E9H A;  4DR6 L;  1UE5 A;  3A74 A;  4DNI A;  4AQY L;  5IYB G;  4DR1 Q;  3NBH B;  1IL2 A;  3A5Z B;  4MNO A;  1VQD A;  2YV5 A;  4QL5 A;  1VQE A;  1IBK Q;  2IX0 A;  2V1C C;  3PF4 A;  4MTN A;  3CAM A;  1D7Q A;  2NN6 I;  2NVQ H;  2GN5 A;  3AFQ A;  1LYL A;  1IBL Q;  2JE6 I;  3PUY A;  4A3G G;  3I56 A;  4JI1 L;  1LUZ A;  3HKS A;  1J5E L;  3HOW G;  3CCL A;  4QQB X;  1YEZ A;  2K52 A;  3FKI H;  3CCE A;  4DR4 L;  3I4O A;  1G29 1;  3CC7 A;  4YCU A;  1UE6 A;  4GN4 B;  4LWC A;  5FLX c;  1VQ5 A;  4Y7N H;  2MO0 A;  4UP9 A;  3CD6 A;  3ULL A;  3L2P A;  4DR2 Q;  4J15 A;  3EN2 A;  1HZC A;  1VQJ A;  1Q1E A;  4LF8 L;  1PVO A;  5IT9 c;  4A93 H;  1UE7 A;  4XIG S;  1J6Q A;  1I3Q H;  1Q8K A;  3BZK A;  2Z6K A;  4IOA A;  2Q2U A;  1XNQ L;  1XPR A;  1LM0 A;  5M3M H;  3F8T A;  5LMN L;  3ICE A;  4K0K Q;  1E22 A;  1HNW L;  1K8A C;  1YVC A;  2K50 A;  1K8G A;  3S1M H;  2HIX A;  1SFO H;  3OYY A;  3HOX H;  2D62 A;  1UWV A;  4LF6 L;  1I5F A;  3FP9 A;  5GAE C;  3CCR A;  4JYA L;  1VQH A;  4HJ8 A;  1OXT A;  3OW2 A;  3S1N H;  1VQB A;  4JI4 Q;  4DV5 L;  4JI5 Q;  1EWI A;  3JAM i;  4DV7 Q;  1YHQ A;  5IYB H;  3RZO H;  4DR6 Q;  2IHE A;  4A3E G;  2KCT A;  3HKZ E;  2VL6 A;  2UU9 Q;  1P8L A;  2JEA I;  2WFW A;  2E2J H;  4AQY Q;  1HNX L;  4QY7 A;  3BZC A;  1PA6 A;  2NN6 G;  4HIM A;  1IYJ B;  4BBS G;  1KRT A;  3KLW A;  3HOW H;  1NTG A;  2HHH L;  2NZO A;  2MQH A;  4EX5 A;  3KF6 B;  4HJA A;  1L1O C;  4DV3 L;  3RZD H;  4GN3 B;  3TQY A;  2KCM A;  4DR4 Q;  1X6O A;  1NY4 A;  4X65 L;  4IJH A;  3HOZ G;  5FLM G;  1VQG A;  1R9T H;  1PH3 A;  1DGS A;  4X62 L;  1EIY B;  4BY1 G;  4TVA B;  4GLA C;  4R1J A;  5C3E G;  2VQE L;  1JT8 A;  4OON A;  1HR0 Q;  4JI6 L;  1BBW A;  1T9H A;  4JBK A;  1M90 C;  1KQS A;  1XNQ Q;  2CWP A;  2K5H A;  3CCM A;  4DR3 L;  5LMN Q;  3W5O A;  1AE3 A;  2UUA Q;  4R4I A;  1HNW Q;  2PQA A;  2JA5 G;  4P75 A;  3J81 j;  1FGU A;  2QGQ A;  2RHQ B;  4JI2 L;  5JJK A;  4JCV E;  4LF6 Q;  5HGQ A;  2RCN A;  1QVC A;  2HQL A;  3M85 A;  4A3E H;  2JA6 G;  1GKH A;  3MEF A;  1PYB A;  4GN5 A;  3CF5 A;  1KRS A;  2UXD Q;  2N78 A;  4A3I H;  1TWG H;  1KIX A;  1CSQ A;  3RN5 A;  1HR0 W;  1YJW A;  2ID0 A;  4BBS H;  2PQA B;  1HNX Q;  1SR3 A;  2KHI A;  2ZM6 L;  2JQO A;  3CMA A;  4HJ5 A;  5GAG C;  4L5R C;  2JA8 G;  5M3F G;  3M9B A;  4DV3 Q;  1X55 A;  5FLM H;  2WAQ G;  1SRU A;  4ME3 A;  4MZ9 A;  3UDI A;  2VQF L;  1X9N A;  1C9O A;  1SE8 A;  5C3E H;  3RNU A;  1IBK L;  4LUV A;  4X62 Q;  4BA2 I;  3PIO A;  1GVP A;  5IE8 A;  2MO1 A;  3PUW A;  2AWN A;  1PFS A;  2VQE Q;  2LXK A;  1IBL L;  4HJ7 A;  1Q46 A;  2IHF A;  4JI6 Q;  3CPW A;  1S40 A;  1FL0 A;  1X3F A;  4OWX B;  1TWF H;  3KJP A;  1S72 A;  1JJC B;  4DR3 Q;  4UY8 C;  4IOC A;  1W3S A;  2XGT A;  4A3L G;  3FKI G;  2QEX A;  2EQS A;  3W1G A;  4JI2 Q;  3M3Y H;  3AEV A;  2JA6 H;  2D0O A;  3M4Q A;  2I5M X;  2AKW B;  4NB3 A;  2ZJP A;  3PUV A;  3TS2 A;  4RMF A;  1XNR Q;  4POF A;  4HJ9 A;  1PHJ A;  3UDF A;  4K0K L;  1YZ6 A;  3G71 A;  3CCQ A;  1Q81 C;  3A5U A;  4LUO A;  2PNH A;  2JA8 H;  4YWK A;  3KDF A;  2ZM6 Q;  1WFQ A;  2K5N A;  4JC0 A;  1XPU A;  3PF5 A;  1N8R C;  1N36 Q;  4JI0 L;  3TS0 A;  2ATW A;  2BA1 A;  1HJP A;  2JEB I;  2RHS B;  3RR5 A;  1VQ9 A;  3HOU H;  4NXN Q;  1PH6 A;  4DV4 Q;  1IXR A;  5IP7 G;  4AYB E;  2UU9 L;  1GD7 A;  4LFB Q;  3S15 H;  2VQF Q;  5M5W H;  3J81 c;  4GNX C;  4YCV A;  3AQQ A;  3CW2 C;  3RN2 A;  1I50 H;  1MJC A;  4BXX H;  3G48 A;  1B7Y B;  3PSI A;  4A3L H;  4A3J H;  2KEN A;  4GLV B;  4JBJ A;  3F2B A;  3HOV H;  4C3J H;  2E5L Q;  2OTJ A;  1B8A A;  4KHZ A;  2GVB A;  4LF9 L;  4IPG A;  1VQ7 A;  4JOI A;  5K36 G;  1A62 A;  1VQO A;  4LF5 Q;  4OXP A;  3H0G G;  1SMX A;  1YJN A;  1QUQ A;  3GTK H;  1G6P A;  4P73 A;  1N33 Q;  1HR0 L;  1BVS A;  4X64 Q;  4YY3 Q;  2YU9 H;  1WI5 A;  1LTL A;  2JA7 G;  1VQA A;  1EIF A;  1UEB A;  1CKM A;  1C7Y A;  1Y1V G;  2UUA L;  2NVY H;  1XMO Q;  3DM3 A;  1VQN A;  1IBM L;  3S2D H;  4P72 A;  5HY6 A;  4P71 A;  3G4S A;  3J7A 5;  2DGY A;  3D31 A;  1HH2 P;  1QUQ B;  1KHI A;  2BH8 A;  3GD7 A;  4DKA C;  3S14 H;  1E24 A;  1L2F A;  2AWO A;  4BBR G;  3J7Z C;  5IP7 H;  1CSP A;  1TWA H;  5IYD G;  2CFM A;  4JI0 Q;  3KJO A;  5C4X G;  2UXD L;  1NMF A;  5ELN A;  1EOV A;  3PV0 A;  3T1H Q;  1VQM A;  4B3M Q;  3PO2 G;  4NPS A;  1HZB A;  5FJ8 G;  4JV5 L;  2EXD A;  5C0X G;  4A3I G;  1PH8 A;  1AE2 A;  2CKZ B;  2GVA A;  4QIW E;  3H3V H;  4DV0 L;  4HIO A;  2F52 A;  3L7Z C;  4A75 A;  1VQ8 A;  1WOC A;  2ZTC A;  3J81 i;  4P74 A;  2JK8 A;  2ZTE A;  4DPG A;  2L15 A;  4OWT B;  2PI2 E;  4DK3 C;  4DUZ L;  2BA0 A;  3BU2 A;  3KOJ A;  2B3G A;  2ZJR A;  4YWM A;  1QVF A;  1X3E A;  4LF9 Q;  2KHJ A;  3H0G H;  3K80 C;  4A3D G;  2UXB L;  3LGJ A;  4ALP A;  2LSS A;  1N32 L;  2JA7 H;  5IWA Q;  1N34 L;  3OTO Q;  1EFW A;  1PH9 A;  1Y1V H;  3GTO H;  1KAW A;  3ER0 A;  2K75 A;  1Q7Y C;  1PV4 A;  1E7Z A;  3J80 c;  1VQL A;  5BR8 Q;  2K14 A;  1IBM Q;  1VQK A;  1WJJ A;  1QZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...