1JOQA

Ensemble structures for staphylococcal nuclease-h124l in ternary complex with ca2+ and thymidine-3',5'-bisphosphate
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
149
structure length
149
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords staphylococcal nuclease
publication title Solution structures of staphylococcal nuclease from multidimensional, multinuclear NMR: nuclease-H124L and its ternary complex with Ca2+ and thymidine-3',5'-bisphosphate.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 26
structure length 149
sequence length 149
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2001-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1joqA00
2EXZA 2F0KA 3D4DA 4K14A 2F0JA 4ZQ3A 4KD4A 3LX0A 5E3FA 5NUCA 3TP5A 5KYIA 1EY4A 5J22A 3DMUA 3D8GA 1EYCA 5EGTA 4B9XA 5C4ZA 5JAVA 2F0NA 3E5SA 4J6HA 1EQVA 3QOJA 4F8MA 4ME5A 4KTAA 2OEOA 4YIJA 2PZTA 1II3A 2NUCA 4RKBA 4K2LA 5EKKA 2HQEA 1KDBA 4K8IA 5C3WA 5IGEA 2OXPA 3EJIA 3MXPA 3NP8A 2F0GA 3TP6A 4EVOA 2ENBA 5C4HA 5CR3A 2O4XA 5IGCA 5KIXA 5ISRA 4R8NA 5J1ZA 5DEHA 1SYEA 3D6CA 2EYLA 5HGTA 1A2UA 1KDCA 4K5XA 1A2TA 4HTHA 5CV7A 3T16A 1JORA 3HZXA 2SNMA 3R3OA 4DFAA 5IGGA 4KY6A 4DGZA 5CV5A 2EYMA 2F0WA 2KHSA 2EYFA 4S3SA 3SHLA 4OL7A 4PMBA 4NP5A 1EY7A 5IODA 2F0MA 5C5LA 2F0VA 3OMCA 3SK4A 3TP7A 2OF1A 4KV6A 3HEJA 3QOLA 1SYBA 1SYDA 2F3WA 4KY5A 4KY7A 4K8JA 4WRDA 5JOBA 1EYDA 2F0TA 5CGKA 2PW5A 4EQPA 2EY6A 4N9PA 3U9OA 2EY5A 1A3UA 2PZUA 1EZ8A 1KDAA 4ID6A 4K5VA 2EYHA 3NHHA 3MVVA 5CV8A 4WORA 4PMCA 5IGFA 1NUCA 1SNOA 2PZWA 5IOCA 2WACA 4LAAA 1SNQA 1STYA 2EY2A 4H7BA 2F0SA 3MZ5A 3S9WA 2PYKA 5I9PA 5HURA 5KEEA 5J39A 1NSNS 4QMGA 2EY1A 1EZ6A 3PMFA 1SNDA 5KYLA 1STHA 1STBA 1U9RA 4N9TA 3MHBA 1KABA 2KQ3A 3NQTA 3NUCA 2F0FA 1JOKA 3OWFA 4IALA 3RUZA 1KAAA 3ERQA 4NDXA 4TRDA 3VA5A 3P1HA 1A3TA 4EQOA 1EY8A 3T13A 5I6YA 5IIFA 1F2ZA 1SNPA 3C1FA 4E6IA 2PW7A 1TT2A 5I9OA 1STGA 2RBMA 4KJNA 3SK8A 5F2DA 2QDBA 4J1MA 2RKSA 4MIUA 2LKVA 5M9OA 3D4WA 1EY0A 2F0OA 4ZUIA 5C3XA 3TP8A 2M00A 3MEHA 5C6AA 1JOQA 4NKLA 1SNMA 3QB3A 5CV6A 5DAUA 4IZ8A 3SXHA 1A3VA 3H6MA 1SNCA 3OSOA 4QB4A 1IHZA 1SYCA 3SK6A 2F0QA 4K2KA 1STAA 1TQOA 4I65A 2F0UA 2F0DA 1EYAA 3NXWA 3ITPA 5EKLA 4DU9A 5K5PA 5C5MA 3EVQA 3SK5A 2PQEA 3OMGA 2EYPA 3EROA 2F3VA 4HMJA 2EYOA 3P75A 5CV9A 3SR1A 1EY9A 2F0PA 2F0LA 2SNSA 3V2TA 4EQNA 4K5WA 2SOBA 2F0HA 1F2YA 2F0EA 1EY5A 4K6DA 4RKLA 1ENAA 1SYFA 1JOOA 5IGDA 1ENCA 1EY6A 4DF7A 1RKNA 1SYGA 3BDLA 4IUNA 4NMZA 4QF4A 1F2MA 5IGBA 4KJOA 5CV4A 3TMEA 4ZUJA 5CC4A 5I6WA 5KGUA 4G57A 1STNA 5KRUA 2F0IA 2EYJA 4KHVA 3C1EA 3DHQA 1AEXA 4HMIA 4KD3A 3BDCA 4PNYA 2RDFA 4ODGA 4B9WA 4F7XA 5E1FA 1TR5A 3NK9A
chains in the Genus database with same CATH superfamily
1DYQA 3D4DA 4LF4L 4K14A 2JE6I 3TP5A 4ZLTF 3QIAA 4RG1A 3WOEA 2A19A 4A3BB 3FHWA 4DV0Q 1IBKL 1FVIA 2BOSA 3NTKA 4R4OA 5I2XA 4PV1C 2UUAQ 2A69C 1N32Q 3OTOQ 4GZYC 2K33A 1G8ZD 1HQMC 1Y1WH 1X55A 1B1ZA 4OONA 4ZKBB 1VQ8A 4KI0A 5KNBA 3PF4A 5C4XG 3EA6A 3L0OA 5CV7A 3T16A 1N34L 3HZXA 2ZT9C 4DGZA 1K0RA 1PH1A 3CQZH 2F0WA 2KHSA 4YCUA 4AQYL 3RZDB 2RDHA 4HR7B 1LTID 1VQLA 3LWUA 4A3FG 2VW9A 2TMPA 3HS0C 3AEVA 2AUJD 3ONAB 1WCMG 3RLNA 1HXYD 1WTOA 1KL9A 1Q82C 5C3EB 1N36Q 1ILQA 2PW5A 4UPAA 2K03A 3I4NH 3A8IE 4L5RC 3MVVA 1XMQQ 2TSSA 4G7HC 3PUWA 4JI0Q 3RLOA 4LFCL 2KHIA 1X3GA 2MPMA 3L3OC 2A73B 1C7YA 2DUDA 1EEFD 1O7IA 5LMNQ 1D1KA 1Y69U 2C35B 3RUZA 1MSGA 1WYDA 1WTPA 1L1OC 1KLGD 5I6YA 4PZ6A 5IIFA 1PH9A 3S17B 3L7ZC 1UE7A 4YWKA 1CI3M 3SK8A 4A3JG 1AFPA 1XNQQ 1WFQA 4QUCA 4LNQA 4GNXA 3CU7A 3B6YA 2R7ZH 1A3VA 1RIPA 3I90A 4LF4Q 4CDEC 2XWJB 4K2KA 3T56B 3DM1A 4R1JA 5JPMC 4HCEA 1IBKQ 4IPDA 1UUPA 1NCVA 4B3MQ 4DA2A 1FJGL 1YI2A 3G6JB 2J7ZA 3SR1A 3VR3A 3R93A 1HQRD 4ABNA 1K3BC 3CMEA 1ENCA 4DF7A 4DV6L 3GV3A 1N34Q 1EIGA 5KNDA 3L9AX 3GTMH 2JEBI 4CKEA 2QEJC 1GUNA 1TR5A 3LWEA 1MI2A 4A3IH 3I73A 4LF6L 2JXMB 4ZRZA 1Q46A 5CYUA 4YCWA 4A3EG 5FLXc 3NENA 4OHJA 5M5XH 1PZJD 1IYVA 3GTQB 4RKBA 1BBXC 2ZTEA 1KDBA 3T53B 3NP8A 4LF7L 1GUTA 1PTOD 3KOJA 4L5TA 1SMYD 1HHVA 2ICIA 4HAEA 4C56C 4DK3C 4BY7B 4YY3L 4KY6A 5EKIA 1BBUA 5IYBH 2XWBB 4K6LA 2HIXA 4IOAA 1WTWA 3HFZB 1C9OA 1K8MA 2F1MA 3BVGA 1Y1VB 3TZDA 1PH2A 3E9IA 3STBC 2B63H 4APVA 2VUMH 3MFYA 2AKWB 3FKIH 1WTRA 1D5ZC 1TU2B 1EIFA 1XXGA 1MGSA 1B3QA 5IYCH 1SNOA 3HOWH 1TS5A 2WACA 4FP5D 1DONA 3MZ5A 1D6EC 1JWUD 4JI8Q 3JAME 1ZEQX 1TWGH 2V1CC 4DR2Q 4X65Q 1M90C 3PCOB 1LM0A 5DLQE 4DUYQ 1CM9A 2K5VA 4IURA 3OWFA 2AQ1B 4L6TB 1LUZA 2MO1A 3M4QA 3U9SA 1EY8A 1EWHA 1G291 4DV6Q 4OIKA 3K7AB 3A54A 4BXXG 3I4MH 3AB9A 1HNXL 2RKSA 3J81L 3VR5A 1G2SA 3W1GA 1CQVA 4IO9A 1DJRD 4ZUIA 1KIXA 1SNMA 5AJ3Q 1ASZA 4A3CH 4FYDA 1SNCA 4LJZC 2JA9A 4WJ4A 2IW3A 3KLWA 4KN7C 1SE3A 2FINB 1EYAA 2XN9C 3X3MA 4DR3L 3P7JA 5IE8A 4R4CA 1DD2A 2WIIB 3PUZA 1HJPA 1QNKA 1QVCA 3PUVA 4IFDG 4LF7Q 4KN4C 4A3MG 1SYFA 3CCVA 1GVPA 4IUNA 1HUNA 1PRTB 4O42A 1HZBA 1D1IA 4HMIA 5LL6X 2HHHL 3HRZC 1YJWA 5EBCA 4HSVA 1R4QB 1Y1WB 5J3BA 3E3XA 1I4XA 1EY4A 2VL6A 5JAVA 1SLJA 1LTTD 2ID0A 2VB2X 1F9QA 3CQZB 4IPGA 5LMUL 4I7AA 1ESFA 5EKKA 5IGEA 1E22A 5C4HA 4YCVA 2KJXA 1BXTA 3LGJA 5J1ZA 3RD4A 1GJXA 5FLMH 5HGTA 5FJ8G 2F4IA 1SE2A 5I4DA 1JORA 4DFAA 5ELOA 4JBKA 4LFAL 3I4NB 4X3SA 2D62A 1S40A 3O13A 1IW7C 1C4QA 1JWMD 1BKBA 4MZ9A 1MJCA 1ET9A 2RA4A 1SAPA 1JR0D 4EX5A 2F3WA 2F0TA 4CDDC 1VQAA 1VQ7A 4ID6A 4XYOA 3ULJA 5CV8A 5IGFA 1U4LA 3TRZA 2NYZD 5KEEA 3HOVG 1SR3A 4GOPA 3G4SA 1T9HA 4N9TA 3CC4A 4A3LH 2MUYA 3HG9A 2R7ZB 1JJ2A 2C5CA 3UDFA 4YWMA 3UDIA 1A3TA 2Y0SE 3S1QH 3KUPA 2JA7H 5IP7G 4IQZA 4BBSG 2NVTH 3NBIA 4WJWA 3QB3A 2A5HA 2PI2A 3A8JE 4IPCA 3ZJYC 4A4IA 4H02A 1PH6A 1GD7A 2MQHA 3VR4A 4A3KG 2ZM6L 4JI4L 1KAWA 2OCEA 4JV5L 1RCVD 3OMGA 3V05A 3GTMB 2PQAB 1U4MA 2B39A 4PZ7A 4A3IB 1MIUA 3I91A 3AFPA 4CJ1B 3CPFA 1PDQA 1YNXA 4LUZA 3R2TA 3M4OH 5M5XB 4KHVA 4LFAQ 4KD3A 1A8VA 1JICA 3JC66 1CK1A 1XNRQ 3ER0A 3NPPA 1ZYRC 2VQEL 5KYIA 2R92G 4A3BG 3CHBD 4JBWA 1GHJA 1V8QA 1YBYA 2OXPA 2F0GA 4IUVA 4KKSA 4B3SQ 5CR3A 2E75C 4JVZA 4XT1B 3NEMA 1EU3A 2DJGC 4DR6L 1AP0A 4C2MH 2B63B 3DXJC 5A2QL 3J81j 1CHPD 2VUMB 2UXBL 2EYFA 4B3RL 3FKIB 2AQ2B 3GTOH 1L0WA 1KNEA 5FLXE 4IJHA 3N52A 3HOWB 4R8IA 1PZID 5JVG3 1E7ZA 1B53A 2P5ZX 1TKWB 4HCSA 2LFNA 2Z9HA 3QOLA 2K32A 1LYLA 1CUKA 1TWGB 3NQIA 4HEDA 2A68C 4IUPA 3TSSA 5A35A 1GKHA 5M3MG 4JI2L 2Z4IA 1SNQA 2R7FA 5M3FG 3I4MB 3EIVA 3RZOH 1BCPF 4GS3A 4RMFA 2AQ3B 4JI3L 2UXCL 1GHKA 4RGTA 4IALA 3ERQA 4NDXA 3G71A 2F52A 3IL8A 1EQRA 4G7OC 4E6IA 2RQXA 4NXNQ 1STGA 1AZPA 1R4PB 4J1MA 2EDGA 2QW7A 2M00A 3MEHA 2FHTA 2UU9Q 4LW1A 3OSOA 1WTXA 1S72A 2VQEQ 3BS1A 4DR5L 3KF6B 2NBFA 3WOFA 1LV9A 1TWCH 1VQHA 5EKLA 3PO2H 2N78A 1W3SA 2KCTA 4M8AA 4FF2A 4DUZQ 3M4PA 1MHWC 1MBYA 4Z9CB 5CV9A 1EY9A 1SEBD 1SRUA 4EQNA 2DY7A 4V0BA 2IT1A 2IL8A 3NWSA 4NMZA 1W6JA 3PV0A 3HKSA 4RGNA 2E2JH 4DR4Q 2EYJA 4RHSA 3IKJA 1F2LA 1FNVA 3OW2A 2E8GA 2RDFA 4B3RQ 4B9XA 4OO1H 4ME5A 4DK1A 4R4QA 1U0LA 1IZ6A 2I5HA 1AE2A 1UAPA 1HH2P 3OHXC 3DMUA 1GUGA 3M4YA 2D9UA 4P71A 5ELNA 3D4RA 1F9RA 4C1NK 3JAML 1RTOA 2PMZB 1LTSD 2X6LA 4K8IA 4DV1L 1B50A 1A63A 1PFNA 1TIID 1A2UA 4XYQA 1A0IA 2B2TC 4BY7G 2Z6BA 2EYMA 2IHEA 3QR8A 3BZKA 4JI3Q 4AYBE 5DNFA 2B29A 2Q2IA 4DV3L 2RHQB 2Y0SG 1FNWA 3UE0A 3SGIA 5JOBA 2G9HD 3PF5A 2N55A 2HD3A 2EYHA 4PMCA 1G2TA 1QUQB 5IOCA 1U4PA 4JI7L 5ELCA 2K14A 3S1QB 2JA7B 2PNHA 3A0JA 2UUBL 3H0GG 4POFA 5JEAG 2CW0D 2NVTB 1CKMA 1QG7A 3PIP3 3HOUG 3SDZA 2KQ3A 2HIVA 4C3HG 4DXFA 2JN4A 2VQFQ 1LTBD 3W3AA 2EIFA 5BN5A 4EQ5A 1TT2A 4GKJL 4BA2I 2D2CC 5EPKA 1E2ZA 4GOPC 2K1BA 3TBIB 4JPBW 1K8GA 2IY5B 3K8AA 2Q2UA 3DLLA 1HNZQ 3CAMA 4JYAL 3CC2A 1LT3D 1TQOA 1SROA 4G7ZC 2K50A 5EJWA 5IP9G 3OW7A 3M4OB 4YHHL 3F1ZA 4DV5L 5E4XA 2EQSA 4QIWB 1CZWA 1OO9B 2QDLA 3HOYH 3MWYW 4CDFC 1N8RC 2KA7A 1NJIC 1D7QA 1VS0A 2YYZA 2ZTDA 4X6AH 3AYHB 3KBGA 3KYHC 3GQBA 3GTKH 3IAYA 1EOVA 1EL0A 2MFIA 2F0KA 1STEA 3EFXD 2OT2A 4DV3Q 2QGQA 1WTHA 5GADC 2KOLA 3BDOA 3I4LA 3NBHB 4C2MB 4K0KL 5C0XH 4GOPB 1VQ9A 2JA6H 3QOJA 2DNCA 3GTOB 3EJIA 3W5OA 4EVOA 5ELEA 2K5QA 4LF9L 5KNCA 4B3TL 2EXDA 3J7AV 5C4JH 2UUBQ 2UXDL 2JA8H 2JQOA 1G91A 4P73A 2K04A 2K4KA 2NN6H 3KK7A 4JI5L 1I50H 1EY7A 5IODA 1DCZA 1VCIA 3TP7A 2K7VA 4KV6A 4GKJQ 2Z8LA 2F4VQ 4A3GG 1SYBA 1GO3E 4LF5L 1ILPA 3S2DH 2L1BA 3RZOB 3A5UA 2CWPA 3I8ZA 4OEMB 2EY6A 2WAQB 3NSWA 1S5CD 2Q8TA 1Q8IA 2R6GA 4X66Q 4MNOA 3GDEA 4WORA 4JYAQ 1SSOA 4LAAA 3UDXA 5LL6S 3CW2C 5AFWA 2FMCA 1PH4A 1I94Q 3VYSA 1BF4A 1U9RA 2PQAA 2R7ZG 1QILA 4IJLA 1OXXK 2F0FA 1JOKA 1SJED 4XQNA 2QF7A 1HR0W 4GN3B 1TWCB 5IT9L 1HUMA 1WTQA 3PO2B 1VQIA 1D8LA 2QDBA 4ZKCB 4F87A 3GTLH 2K5HA 5C6AA 4DNIA 4QUFA 4JI6L 2YTVA 2NTSA 4HIKA 2QA4A 4DPGA 4KKUA 2R3ZA 2EVBA 4ULLA 1MSHA 4K0KQ 3K80C 4BA1I 2E2JB 3S14H 2PQEA 2NVXH 2L5TA 1NR4A 4ZYSA 4DNTB 4A3IG 3HOZH 3P75A 1E2VA 1IXRA 1YHAA 2C9OA 5DM63 1HNWL 1JOOA 1CA6A 1SYGA 4X64L 1VQGA 3NTIA 3H09A 4ZUJA 5CORA 1BO0A 2IX0A 4IUQA 3OIQA 3C1EA 1GM5A 1AEXA 4NXML 4JI1L 3SE0A 4AYBG 3PIPA 4XDXA 4DV4L 3S16B 1TS4A 1IYUA 2F0NA 3BU2A 1VQ4A 4J6HA 1A6XA 3OPOA 5C4XH 1PXUA 5T1IA 2RVLA 1II3A 4K2LA 1UWVA 3C2PA 3S2HH 2JA5H 1VF5C 5DEHA 2Q8RE 2MP1A 4A3FH 2B63G 3SVMA 1WCMH 1PTOH 4AQYQ 5IGGA 3KLRA 3CMAA 2YTXA 4C3JG 1EIHA 3S15H 3TS2A 2EPBA 1HA6A 5IYCG 5JEAJ 3HOWG 2OWOA 3K0YA 3PSIA 1SDFA 4X3TA 3I3CA 1QVGA 1ZXTA 2ATWA 4TKOB 1HRJA 2CCZA 1X9NA 2KHJA 2XTIA 1K83H 4JI6Q 2YU9H 5CMDA 1KDAA 3NHHA 4LFCQ 4CGYB 1NUCA 2R61A 3KF6A 1Q90A 1V1PB 2L0CA 2F0SA 2EY1A 1XPRA 2PCFB 2KEEA 3MXGA 5EBDA 4ZCKA 5CBAE 2PI2E 4A3JH 4P75A 3NQTA 5ELDA 1WJJA 2EJFC 3P1HA 1HNWQ 5L37A 2EZVA 4KK7A 3T13A 1PRTF 4NW2A 1K73C 2I0QA 3OOCA 1ICFB 3S1RH 4NXMQ 1E3PA 4JBMA 3HOYB 4IZ8A 4XTCS 1HFNA 3CRKC 4Y52H 1QNUA 2A1AA 1CKNA 4DV4Q 4I65A 4DK0A 1VMPA 5BN3A 4DK6C 1GUOA 1PRTC 1FJGQ 3NELA 1TY2A 2EYPA 3GTKB 1PYBA 2RSOA 4PZ8A 4YWLA 1X3PA 3K81C 1XJVA 4X3KA 4IPHA 1LLRD 4K5WA 3GD7A 1EUJA 1Y8PB 1LABA 1D5MC 2K05A 4RCOA 1F2MA 1UEBA 4KJOA 1PYSB 1FD7D 4BS9A 1J6QA 1X3QA 2MGSA 4UP7A 2JA6B 3VYTA 1Y8OB 2UUCL 4A3EH 5E1FA 1TY0A 4LF6Q 3KLSX 3K59A 2F0JA 4CDCC 1PH5A 1GUWA 2RF4A 4A76A 1YNJC 1NAPA 5C4JB 3A7LA 2JA8B 3DWPA 2N3SA 1IL2A 2L9HA 1I50B 4CJ0B 2ZXPA 1VMCA 4FF3A 1QUQA 3MXPA 3V96A 3MFGA 3I72A 2BA0A 1HR0L 3CCUA 1O80A 2JYOA 4MTNA 4YY3Q 3S2DB 1ZYRD 4LF8L 4UP8A 2CVRA 1S5FD 1QZHA 4ILWA 3BZCA 2F0VA 2B2TA 2HUGA 3PIO3 1QB5D 3F8TA 3HOXG 1NY4A 1Q8KA 4UAIA 1Q86C 4RH6A 1PH8A 3H3VH 1KRSA 5K36G 2XSCA 1DM0B 4P72A 3FEWX 1I5FA 1UE6A 3HGBA 2JA7G 1B8AA 1TXYA 3K0XA 5I9PA 2IPKD 3VDYA 1H9SB 1SNDA 3H91A 3CCJA 1MJEA 1X6OA 4EGVA 3GTLB 3Q8DA 4PG3A 2IHFA 1KABA 4RAUC 4RWSC 1PH7A 1HZCA 5HY6A 4TQUS 3BVMA 4HJAA 4FNFA 4A93G 5IWAL 3PO3H 3K58A 4A75A 1F2ZA 3IFDA 1HNXQ 1RL2A 4X62L 1KTKA 4KJNA 4IUTA 3S14B 4MIUA 1PTOC 4Q5VA 2NVXB 2RCNA 3SXHA 4HJ5A 3HOZB 1L0XB 4DR3Q 2ZJRA 4IFDH 2RDGA 1UNSA 3NBHA 2I5LX 4TVAB 2CKZB 3C3LA 3M3YH 1AZQA 1RF2D 3K57A 1Q1BA 1KNAA 1HR0Q 5CV4A 1E24A 3AU7A 4A3DH 1BCPD 2HHHQ 2NZHA 5C4XB 2F0IA 2SDFA 4P74A 1HZAA 4LF8Q 3AMUA 1VQ5A 3S2HB 1B9NA 4ZK9B 3RN5A 2JA5B 1K9MC 4BBRH 3M85A 3LX0A 1YJ9A 2F3IA 4A3FB 1S4ZA 1WCMB 1PTOB 3K5OA 1EYGA 5FJ8H 5FKAC 5LMUQ 1PH3A 1B70B 2OEOA 2LXJA 3NTHA 3EN2A 3GTGH 5E7NA 3FP9A 3S15B 2HQEA 1EU4A 3NWTA 1W6KA 3K6OA 1JB3A 1U5KA 5D14A 4K5XA 4RFBA 1JJGA 3BYTB 5IYDG 1NBWA 3TEHB 1CFMA 4S3SA 3SHLA 1K83B 4DAMA 2YU9B 3QO2A 2BE5D 4PMBA 2EE1A 2J4XA 3ND8A 4O2DA 3H15A 3D6WA 5IWAQ 2EOTA 4QCLA 4C3IH 4X62Q 3CCRA 1Q81C 5CBEE 1ML0D 4HJ8A 3HOVH 4L63B 3T1YL 3U9OA 4A3JB 2CFMA 4K5VA 1P8LA 4KLKA 4LUVA 2KENA 2ICEC 4UP9A 5J39A 2QKIC 4GLXA 1CZGA 3MC0B 3N6RA 3PMFA 3S1RB 1XYIA 5IP7H 2CH4A 3U50C 4BBSH 5FO7B 3NUCA 3VA5A 1KAAA 4AIMA 4EQOA 5C3EG 1K8AC 5I9OA 4A3KH 1HZ9A 1VQCA 5ELBA 1IYJB 4G4KA 3DWAA 4DAYB 2L15A 1CA5A 1YNND 1KHIA 1DOKA 5IY0A 3H6MA 1VDZA 2ES2A 1IHZA 5HGQA 2ZM6Q 4JI4Q 2A6HD 1M1KC 4JV5Q 4O1NA 2KVMA 4JCVE 3PIOA 3E6ZX 4A3EB 3H3VC 2BCOA 2F0PA 2A6ED 1N9WA 1EQTA 4GLVB 3BZDB 5KGUA 1SE8A 2OQ0A 4OIJA 1FGUA 1PYWD 2R92H 3RNUA 5LMNW 2K52A 1V43A 3M7GA 2G9DA 2YV5A 4WFN3 5NUCA 4IOCA 1VQFA 2FJ2A 1I3QH 4FXKC 2F03A 3BYYB 3W1BA 3T1YQ 3J7YW 1I4HA 1XTDA 5BN4A 2H1EA 1JB7A 1V1PA 2ENBA 4DR6Q 2CHBD 1G51A 3D6CA 4DXGA 1A2TA 2UXBQ 2CWAA 4ME3A 1O7YA 1CSPA 1B9MA 3DEPA 1XX8A 1VQ6A 3FVQA 1CKNB 2JSOA 3TZUA 1HCZA 1K8OA 4O0AA 1OXSC 5M3MH 5EQ0A 4KY5A 4DV2L 4GN5A 5M3FH 2K75A 3Q24A 1SJHD 4JI2Q 2KECA 4DKAC 2BH2A 1LTGD 1H9MA 2EY2A 3PO3B 1MKHA 4QMGA 2LY7A 2A8VA 1ESRA 1KLUD 1Y8NB 4KHPL 2SEBD 2UXCQ 2NZOA 1PFSA 1Y1VG 1VQNA 5E4WC 5G3LF 3KJOA 1S5ED 2A69D 1BNZA 4DR1L 1YVCA 4CBVA 5C3XA 3HOYG 3M3YB 1ZKOA 3QJYA 1JOQA 3LNNA 4DR5Q 1HPCA 1O7ZA 1XWEA 3PUXA 4DNRB 1A62A 1HFGA 2WP8J 1E0BA 4UY8C 4A3DB 1FR3A 2JK8A 3E0JA 5DM73 4L8JA 3EROA 2EYOA 3J80i 3F2UA 4BBRB 3PGZA 4DV7L 3J80c 3PQIA 4QF4A 4L5SA 1VQMA 2LS01 5CC4A 5C0XG 2M2LA 3G7LA 3K5NA 1O7LA 1RDPD 3BVZA 4B9WA 3CKIB 1M4VA 3GTGB 4M1UB 4L5QA 4QJFA 4OWWB 1NE3A 2VS1A 1UE5A 4ZQ3A 4OX9L 4HN7A 2B2WC 4N8X1 2Q2HA 1Q1EA 2ZJPA 5FOBB 4DV0L 1OTCA 1RJTA 3D0FA 4DV1Q 1G6PA 4GN4B 1E2WA 4C1NI 1N32L 1TS3A 2BH8A 4FXDA 1B2TA 1ONLA 4C3IB 1H9SA 4R4TA 1V1QA 3HOVB 4KHPQ 5CV5A 2M9VA 1YZ6A 1Y1WG 2AWNA 4JW0A 1V9PA 1S5BD 3EQLC 2V4DA 1IL8A 2A74C 4DR1Q 1SYDA 2AUKA 3RR5A 2N8NA 3Q22A 3H0GH 4BBSB 2HDLA 1A3UA 1H9JA 1I4RA 3G48A 4JI7Q 2IX1A 3HOUH 4BY1H 2WKCA 4C3HH 3T1HL 1STYA 3MA2B 4JI0L 5HURA 3S1NH 1GUSA 3FMCA 4LMQD 2ZTCA 2K6AA 3I4NG 2WKDA 4Y7NH 1EFWA 5LMNL 2K28A 3KDFB 4DV7Q 3X3NA 3U58A 2R93H 2EJMA 1CSQA 1JQYD 2K5WA 2RBMA 2XRSD 2Z0SA 2PMZE 1PFMA 5IP9H 1XNQL 3HOZG 4NKLA 2B2UC 1Z9FA 4FXGC 1Z6HA 3FPUB 1SYCA 2OQKA 1DXMA 4OX9Q 1RODA 3ITPA 4YHHQ 1P16A 4DV5Q 1PLFA 3URYA 2R92B 1KRTA 4KHZA 1TWHH 5M5YH 1RD9D 4B3ML 2F3VA 2WINB 2D0PA 5D3DA 2PO4A 3STBD 3V2TA 2VB3X 5C44H 1SMXA 1F2YA 1WI5A 1X32A 1RKNA 3BDLA 1I3QB 3TMEA 1STNA 3DHQA 1Y14B 4ODGA 2Q8IB 1CTMA 4MHEA 3GO5A 1QWYA 2JA5G 2Z6KC 4FF4A 2K5NA 2CW0C 2JP1A 1PRTD 2E76C 1SFOH 1SN8A 4F88A 5M5WH 5BR8L 4KTAA 2E2IH 3UE1A 3KF8B 1H9RA 4LF9Q 4B3TQ 5FLXL 3T1HQ 2LMCB 1OXUA 2Z4HA 2UXDQ 1SYEA 2EYLA 4JOIC 5EPLA 5M3MB 1D5XC 4J15A 4HTHA 1JT8A 4JI5Q 5M3FB 4A3GH 2KEDA 2GVBA 1GOZA 1YNJD 1JE5A 5JJZA 4LF5Q 2PPBC 3HEJA 4XT3B 4QIWE 1BUVT 5A2QE 4KY7A 5IYBG 2L11A 1EWCA 4DAYA 4EQPA 3RN2A 1CT1D 3RMHA 2O5JC 2PZUA 5LHY1 1EZ8A 1VQJA 2RHSB 3VR2A 2WB1B 2PZWA 1YIJA 1C0AA 5EAYA 3S9WA 3AFQA 2VUMG 5KYLA 1VQPA 4JI8L 3FKIG 1F9PA 5IT9c 4DR2L 4X65L 2DGYA 4J8QA 4BWGB 1H95A 2I46A 4DUYL 5JPNC 1X3FA 1UE1A 2RCFA 4JG2A 3M7NA 1NNXA 4DN4M 1ASYA 1SNPA 1B4OA 3T51B 2B2VA 1QVFA 3S1MH 3H94A 1BVSA 2B2YA 3GP7A 2F0OA 3PUYA 3UI2A 4HJ9A 3CCEA 5C0XJ 4OELB 5AJ3L 3I55A 1L1OB 2HT1A 3I4MG 1E1TA 1X54A 4OO1I 2I5MX 1IW7D 3I4OA 5BR8Q 1TS2A 2FXQA 4A3CG 3E0EA 2IX3A 2E5LL 1M8AA 2SNSA 4PMWA 4AH6A 2LSSA 4X64Q 4RKLA 4CJ2C 5IGDA 1TWAH 4CKBA 4LUOA 1EY6A 2O5IC 1JC7A 3GTJH 2JJQA 4MTKA 1J9OA 2X6GA 2WAQE 4JI1Q 5EPJA 3HKZB 4OGQC 2GN5A 4KD4A 2KCNA 1LTRD 3ZYYX 1HA5A 3A74A 3D8GA 5C4ZA 2Y0SB 3E5SA 1F77A 4UHVA 1NMGA 3J80E 4FDBA 4QGUA 4YIJA 4NB3A 3G6EA 3TREA 4NPSA 4C3JH 3FPPA 5IGCA 1NR2A 3VR6A 4WJ3M 1U4RA 1I4PA 1NMFA 4Q0FA 1CHQD 1VQBA 3H0GB 2ASBA 1LACA 3MAQA 5GAEC 1PVOA 3WDNA 2GVAA 3HOUB 4BY1B 5FLMG 2IJ0A 4C3HB 2OF1A 4LK1C 1H9KA 3S1NB 1QE6A 2NTTA 4WRDA 4K8JA 4Y7NB 2L4NA 4N9PA 1I4GA 1ET6A 3CC7A 3PO3G 1A15A 2R93B 1LO5D 3J7AF 2PYKA 1WD0A 4H44C 3K7UC 2RSNA 2E2HH 5GAGC 2ZXRA 1EIYB 4OXPA 2E5LQ 2KCCA 5JJKA 1AE3A 4KKTA 2DN8A 2KCMA 3DWQA 4FF1A 1PFBA 4IUUA 1PV4A 1B7YB 2O2LD 3C1FA 4A3LG 3MXNB 2QEXA 1J5EL 1TWHB 3TDQA 5M5YB 2CQOA 3TP8A 2VNUD 2WB1E 3KBXA 3A7AB 5C44B 3SK6A 1KC8C 4P2CB 3TS0A 1AW7A 4FO2A 1PTOF 1YHBA 5FO8B 4A3DG 3SEBA 1FL0A 3HP3A 4BXXH 2NVYH 3J81i 3SK5A 5T1GA 4HSPA 2BA1A 1K3RA 3UDGA 3J81c 3ND9A 1R9TH 4HMJA 4GKKL 4BBRG 2SOBA 2F0HA 2F0EA 5C0XI 4HJ7A 1KQSA 2A68D 2AMCB 1TWFH 1SFOB 1AN8A 4R9WA 5I6WA 2UUCQ 5M5WB 1X65A 2E2IB 1EEID 1SMYC 3CRLC 1LTLA 1L0YB 1N33L 3F2DA 4X3UA 4K6DA 2EXZA 1SXTA 1RHPA 1OXTA 1XNRL 4A3MH 1BOSA 2NN6I 3CXCA 4H13C 1QCBD 3KLSA 3D31A 3ERSX 4A3GB 1Q12A 1C48A 2PZTA 2B8FA 2NUCA 2WFWA 2B2WA 2L55A 5ISRA 4B3SL 4C3IG 4RGOS 4OWXB 4HIMA 3HKZE 1X3EA 1EWIA 3HOXH 3QG1A 1PZKD 1VQDA 2DJFC 5K36H 3KDFA 5C5LA 2DY8A 1T5EA 4N8FA 2N88A 3E9HA 1KXLA 2CH4W 3P20A 1BR9A 1J5EQ 2Q2TA 3A55A 3IRBA 1OXVA 3GTPH 3MEFA 5GROA 2FFKB 2NWGA 3U4ZA 3S24A 4A93H 1AH9A 1NSNS 3S1MB 3CCQA 2D5DA 4V190 2B3GA 2NZ1D 1LTAD 3CP0A 4OWTB 1VF7A 3MHBA 4IN3A 4GKKQ 2BDNA 4QY7A 2NB0A 3BG3A 4GNXC 2CQAA 1SE4A 2NVQH 4H0LC 2PW7A 2WAQG 3OIPA 4NXNL 1JJCB 2XVSA 1L2FA 3BJUA 1N33Q 3VYUA 5CV6A 3F2BA 3MTSA 1ICWA 3CCMA 1I6HH 2UU9L 1QZGA 4ZAIA 1TWAB 4AYBB 5IT9E 3GTJB 2F0UA 1WVLA 1K0SA 2B2VC 3FRPB 4DU9A 5C5MA 3EVQA 5GQOA 3I7FA 2B2UA 3MXUA 2B2YC 3KF8A 1Q3LA 1BBWA 4DUZL 5KIXA 2OTJA 4RHRA 2IWHA 1GXDC 1MD2D 1QJOA 4I7ZC 1XTCD 3PO2G 1C8CA 4U673 1XPOA 4G57A 4HIOA 1Z47A 3CCSA 5KRUA 1XMOL 4PNYA 4DR4L 3BDCA 4GNXB 1X56A 3ICEA 4C3JB 1VQEA 5G3LD 2E74C 2H4OA 3T4AC 5E3FA 4LFBL 2KUMA 3GV6A 5J22A 1PMRA 1FGBD 2HCIA 1EQVA 4F8MA 1CKOA 4OO1G 1D2BA 1J8IA 5IYDH 2Z6KA 2LXKA 2PNRC 4XIGS 5H1SE 2O4XA 3OWEB 4R8NA 3A56A 4A3BH 1WD1A 4RGMA 1I6VC 5JVH3 5JJLA 2EJGC 1JWSD 1IKLA 3C46A 4NP5A 4DR7L 3I70A 4KMUC 4JOIA 3OMCA 2YTYA 2AHOB 2E2DC 2B8GA 3K5LA 2E2HB 1KD1C 1EOTA 2MO0A 3J7A5 1EYDA 4IFDJ 4RCNA 1JE4A 4POGA 3CF5A 2EY5A 3RZDH 3K5MA 3R8BA 1BCPC 1FNUA 2WB1G 1T5XD 1FYCA 1L1OA 4H7BA 5JJIA 3DEOA 3DUZA 2WV6D 1EZ6A 5C3EH 2H5XA 2BDOA 5FO9B 4HIDA 1STHA 3Q6SA 3ULLA 1IBML 2DNEA 3D3RA 2XNAC 1E1OA 1I4QA 4TRDA 4MN3A 2OTLA 1DZ1A 2ZXOA 4JK1C 2VQFL 1O78A 1YITA 3EBEA 1W2BA 5I2YA 2J0TD 5F2DA 2X69A 2NVYB 3TQYA 5M9OA 2LKVA 1XMOQ 1YEZA 4FVMA 1R9TB 1IBLL 5ELFA 3J80L 4QB4A 2AWOA 1HNZL 3CCLA 1TWFB 1K28A 4LFBQ 2F0DA 1LT5D 3NXWA 3S17H 2BE5C 3NE5B 2KBNA 2L12A 1BDOA 3M9BA 1BQQT 1BCPB 2F0LA 2ZJQA 2MHVA 1EY5A 4A3MB 5IGBA 1DOLA 1DGSA 3S16H 3W2DA 4JBJA 3L2PA 1ENFA 3HKZG 3I2ZA 4JC0A 4F7XA 1TVXA 3NK9A 4RA8A 4DR7Q 4CHTB 3FDTA 5GAHC 4ALPA 4GLAC 2R7DA 1QOHA 3J81E 5D3IB 1EYCA 5EGTA 1JCKB 3J7ZC 1JMCA 4XQQA 4B08A 3U4VA 4DAPA 3CPWA 3HOXB 1B44D 2VZAA 3Q0AA 3TN2A 5C3WA 3TP6A 4CKCA 3H3VI 1YNNC 5COYA 2JA6G 1KDCA 1RTNA 1YJNA 3KJPA 3R3OA 2SNMA 2K01A 1IBMQ 2FMMA 3KFUA 3Q23A 3GTQH 2A6HC 2N49A 3JAMi 4OL7A 3GTPB 4BY1G 1NTGA 2F0MA 3JAMc 3SK4A 3I56A 2JA8G 1Z7TA 4A93B 4DV2Q 2GA4B 2VY3A 3IFTA 1Q7YC 3F2CA 2A6EC 3MXNA 1VQKA 2NN6G 2F4VL 4U68A 5CGKA 4BY7H 3VYRA 2UUAL 1IBLQ 4TSSA 3OTOL 4XQJA 4X66L 2R93G 1F9SA 5FK9C 3A5ZB 1B3AA 2NVQB 1Y1VH 4LWCA 3WWVA 1WOCA 2XGTA 1IKMA 1CQFA 3DM3A 1STBA 3RLFA 4DAVA 2VXWA 3R2IA 2JEAI 1I94L 2XRQD 1XPUA 4IFDI 4XXEA 1I6HB 1EQQA 5D65A 2XIWA 1YHQA 2QCPX 1S5DD 4QQBX 1N36L 1SBBB 3D4WA 1HTLD 1HTPA 5JEAH 1EY0A 2HQLA 3OYYA 5DAUA 1VQOA 1LT4D 3AQQA 2HDMA 4PQXA 5C44G 4QL5A 1XMQL 3CD6A 4R4IA 2F0QA 1STAA 2MNAA 4A3KB 2QILA 2HCCA 3K7AH 3VA7A 1G6ZA 5K5PA 1WTVA 1S3OA 2Z1CA 3QWNA 3A8KE 1LT6D 2ALYB 2I07B 1PHJA 1EFID 1PA6A 5TSSA 2K5DA 1ENAA 1DOMA 2MJ8A 4UDUC 1UEAB 1V1OA 3ULPA 2D0OA 2G5DA
chains in the Genus database with same CATH topology
1DYQA 3D4DA 4K14A 2JE6I 3TP5A 4ZLTF 3QIAA 3WOEA 4A3BB 2BOSA 3NTKA 5I2XA 4PV1C 2A69C 4GZYC 2K33A 1G8ZD 1HQMC 1B1ZA 4ZKBB 4KI0A 5KNBA 3EA6A 5CV7A 3T16A 3HZXA 2ZT9C 4DGZA 2F0WA 2KHSA 3RZDB 2RDHA 4HR7B 1LTID 3LWUA 2TMPA 3HS0C 2AUJD 3ONAB 1HXYD 1WTOA 5C3EB 1ILQA 2PW5A 2K03A 3A8IE 3MVVA 2TSSA 4G7HC 3PUWA 2MPMA 3L3OC 2A73B 1EEFD 1D1KA 1Y69U 3RUZA 1MSGA 1WTPA 1KLGD 5I6YA 5IIFA 3S17B 3L7ZC 1CI3M 3SK8A 1AFPA 4QUCA 3CU7A 1A3VA 3I90A 2XWJB 4K2KA 3T56B 3DM1A 5JPMC 4HCEA 1UUPA 1NCVA 4DA2A 3G6JB 2J7ZA 3SR1A 3VR3A 3R93A 1HQRD 4ABNA 1ENCA 4DF7A 3GV3A 1EIGA 5KNDA 3L9AX 2JEBI 4CKEA 2QEJC 1GUNA 1TR5A 3LWEA 1MI2A 3I73A 2JXMB 4ZRZA 5CYUA 4OHJA 1PZJD 1IYVA 3GTQB 4RKBA 1BBXC 1KDBA 3T53B 3NP8A 1GUTA 1PTOD 1SMYD 1HHVA 2ICIA 4HAEA 4C56C 4BY7B 4KY6A 5EKIA 2XWBB 4K6LA 1WTWA 1K8MA 2F1MA 3BVGA 1Y1VB 3TZDA 3MFYA 1WTRA 1D5ZC 1TU2B 1XXGA 1MGSA 1SNOA 1TS5A 2WACA 4FP5D 1DONA 3MZ5A 1D6EC 1JWUD 3JAME 1ZEQX 1CM9A 4IURA 3OWFA 2AQ1B 4L6TB 3U9SA 1EY8A 1EWHA 1G291 4OIKA 3K7AB 3A54A 3AB9A 2RKSA 3J81L 3VR5A 1G2SA 1CQVA 1DJRD 4ZUIA 1SNMA 4FYDA 1SNCA 4LJZC 2IW3A 4KN7C 1SE3A 2FINB 1EYAA 2XN9C 3X3MA 3P7JA 1DD2A 2WIIB 3PUZA 1QNKA 3PUVA 4IFDG 4KN4C 1SYFA 4IUNA 1HUNA 1PRTB 4O42A 1D1IA 4HMIA 5LL6X 3HRZC 5EBCA 4HSVA 1R4QB 1Y1WB 1I4XA 1EY4A 5JAVA 1LTTD 2ID0A 2VB2X 1F9QA 3CQZB 1ESFA 5EKKA 5IGEA 5C4HA 2KJXA 1BXTA 5J1ZA 3RD4A 1GJXA 5HGTA 2F4IA 1SE2A 5I4DA 1JORA 4DFAA 3I4NB 4X3SA 2D62A 3O13A 1IW7C 1C4QA 1JWMD 1ET9A 2RA4A 1SAPA 1JR0D 2F3WA 2F0TA 4ID6A 4XYOA 5CV8A 5IGFA 1U4LA 2NYZD 5KEEA 4N9TA 2MUYA 3HG9A 2R7ZB 2C5CA 1A3TA 3KUPA 4IQZA 3NBIA 4WJWA 3QB3A 2A5HA 3A8JE 3VR4A 1RCVD 3OMGA 3V05A 3GTMB 1U4MA 2B39A 4A3IB 3I91A 4CJ1B 1PDQA 3R2TA 5M5XB 4KHVA 4KD3A 1JICA 1CK1A 3NPPA 1ZYRC 5KYIA 3CHBD 4JBWA 1GHJA 1V8QA 2OXPA 2F0GA 4IUVA 4KKSA 5CR3A 2E75C 4XT1B 1EU3A 1AP0A 2B63B 3DXJC 5A2QL 2VUMB 1CHPD 2EYFA 3FKIB 2AQ2B 1KNEA 5FLXE 3N52A 3HOWB 4R8IA 1PZID 5JVG3 1B53A 1TKWB 4HCSA 2LFNA 3QOLA 2K32A 1TWGB 3NQIA 4HEDA 2A68C 4IUPA 3TSSA 5A35A 2Z4IA 1SNQA 3I4MB 1BCPF 2AQ3B 1GHKA 4RGTA 4IALA 3ERQA 4NDXA 3IL8A 4G7OC 4E6IA 2RQXA 1STGA 1AZPA 1R4PB 4J1MA 2EDGA 2M00A 3MEHA 2FHTA 3OSOA 1WTXA 3BS1A 3WOFA 2NBFA 1LV9A 5EKLA 4M8AA 4FF2A 1MBYA 4Z9CB 5CV9A 1EY9A 1SEBD 4EQNA 2DY7A 4V0BA 2IT1A 2IL8A 3NWSA 4NMZA 1W6JA 3PV0A 4RGNA 2EYJA 4RHSA 3IKJA 1F2LA 1FNVA 2RDFA 4B9XA 4OO1H 4ME5A 4DK1A 1UAPA 3OHXC 3DMUA 1GUGA 3M4YA 2D9UA 3D4RA 1F9RA 4C1NK 3JAML 1RTOA 2PMZB 1LTSD 2X6LA 4K8IA 1B50A 1PFNA 1TIID 1A2UA 4XYQA 2B2TC 2EYMA 5DNFA 1FNWA 5JOBA 2G9HD 2N55A 2EYHA 4PMCA 1G2TA 5IOCA 1U4PA 5ELCA 3S1QB 2JA7B 5JEAG 2CW0D 2NVTB 1QG7A 3PIP3 3SDZA 2KQ3A 4C3HG 4DXFA 1LTBD 3W3AA 5BN5A 1TT2A 4BA2I 2D2CC 5EPKA 1E2ZA 2K1BA 3TBIB 1LT3D 1TQOA 4G7ZC 5EJWA 3OW7A 3M4OB 5E4XA 4QIWB 1CZWA 1OO9B 3MWYW 2KA7A 2YYZA 3KBGA 3GQBA 3IAYA 1EL0A 2F0KA 1STEA 3EFXD 2OT2A 2KOLA 3BDOA 3I4LA 4C2MB 5C0XH 3QOJA 2DNCA 3GTOB 3EJIA 4EVOA 5ELEA 2K5QA 5KNCA 3J7AV 1G91A 2K04A 2NN6H 3KK7A 1EY7A 5IODA 1DCZA 1VCIA 3TP7A 2K7VA 4KV6A 2Z8LA 1SYBA 1ILPA 3RZOB 2L1BA 3I8ZA 2EY6A 2WAQB 3NSWA 1S5CD 2Q8TA 1Q8IA 2R6GA 4WORA 1SSOA 4LAAA 5LL6S 5AFWA 2FMCA 3VYSA 1BF4A 1U9RA 1QILA 1OXXK 2F0FA 1JOKA 1SJED 4XQNA 2QF7A 1TWCB 5IT9L 1HUMA 1WTQA 3PO2B 2QDBA 4ZKCB 4F87A 5C6AA 4QUFA 2NTSA 4KKUA 2R3ZA 2EVBA 4ULLA 1MSHA 4BA1I 2E2JB 2PQEA 2L5TA 1NR4A 4ZYSA 4DNTB 3P75A 1E2VA 2C9OA 5DM63 1JOOA 1CA6A 1SYGA 3NTIA 3H09A 4ZUJA 5CORA 1BO0A 2IX0A 4IUQA 3OIQA 3C1EA 1AEXA 3SE0A 4XDXA 3S16B 1TS4A 1IYUA 2F0NA 4J6HA 1A6XA 3OPOA 1PXUA 5T1IA 2RVLA 1II3A 4K2LA 3C2PA 1VF5C 5DEHA 2Q8RE 2MP1A 3SVMA 1PTOH 5IGGA 3KLRA 4C3JG 1EIHA 1HA6A 2EPBA 5JEAJ 3K0YA 1SDFA 4X3TA 3I3CA 1ZXTA 4TKOB 1HRJA 5CMDA 1KDAA 3NHHA 4CGYB 1NUCA 2R61A 1Q90A 1V1PB 2L0CA 2F0SA 2EY1A 2PCFB 2KEEA 3MXGA 5EBDA 5CBAE 3NQTA 5ELDA 2EJFC 3P1HA 2EZVA 4KK7A 3T13A 1PRTF 4NW2A 3OOCA 3HOYB 4IZ8A 4XTCS 1HFNA 3CRKC 1QNUA 4I65A 4DK0A 1VMPA 5BN3A 1GUOA 1PRTC 1TY2A 2EYPA 3GTKB 2RSOA 1X3PA 4X3KA 1LLRD 4K5WA 3GD7A 1Y8PB 1LABA 4RCOA 1D5MC 2K05A 1F2MA 4KJOA 1FD7D 4BS9A 2MGSA 1X3QA 2JA6B 3VYTA 1Y8OB 5E1FA 1TY0A 3KLSX 3K59A 2F0JA 1GUWA 1YNJC 1NAPA 5C4JB 3A7LA 2JA8B 3DWPA 2L9HA 1I50B 4CJ0B 2ZXPA 1VMCA 4FF3A 3MXPA 3V96A 3MFGA 3I72A 2BA0A 1O80A 2JYOA 3S2DB 1ZYRD 2CVRA 1S5FD 4ILWA 2F0VA 2B2TA 2HUGA 3PIO3 1QB5D 4UAIA 4RH6A 5K36G 2XSCA 1DM0B 3FEWX 3HGBA 5I9PA 2IPKD 1H9SB 1SNDA 3H91A 4EGVA 3GTLB 1KABA 4RAUC 4RWSC 4TQUS 3BVMA 4FNFA 3K58A 1F2ZA 3IFDA 1KTKA 4KJNA 4IUTA 3S14B 4MIUA 1PTOC 4Q5VA 2NVXB 3SXHA 3HOZB 1L0XB 4IFDH 2RDGA 1UNSA 3NBHA 3C3LA 1AZQA 1RF2D 3K57A 1Q1BA 1KNAA 5CV4A 3AU7A 1BCPD 5C4XB 2F0IA 2SDFA 3AMUA 3S2HB 1B9NA 4ZK9B 2JA5B 3M85A 3LX0A 4A3FB 1S4ZA 1WCMB 1PTOB 3K5OA 5FKAC 2OEOA 3NTHA 3S15B 2HQEA 1EU4A 3NWTA 1W6KA 3K6OA 1JB3A 5D14A 4K5XA 4RFBA 3BYTB 1CFMA 4S3SA 3SHLA 1K83B 2YU9B 3QO2A 2BE5D 4PMBA 2EE1A 2J4XA 3ND8A 3D6WA 2EOTA 4QCLA 5CBEE 1ML0D 4L63B 3U9OA 4A3JB 4K5VA 2ICEC 5J39A 2QKIC 1CZGA 3MC0B 3N6RA 3PMFA 3S1RB 1XYIA 5FO7B 3NUCA 3VA5A 1KAAA 4EQOA 5I9OA 5ELBA 4G4KA 3DWAA 1CA5A 1YNND 1DOKA 3H6MA 1VDZA 1IHZA 2A6HD 4O1NA 2KVMA 3E6ZX 4A3EB 3H3VC 2BCOA 2F0PA 2A6ED 1EQTA 3BZDB 5KGUA 4OIJA 1PYWD 1V43A 3M7GA 2G9DA 4WFN3 5NUCA 2FJ2A 4FXKC 2F03A 3BYYB 3J7YW 1I4HA 5BN4A 2H1EA 1V1PA 2ENBA 2CHBD 3D6CA 4DXGA 1A2TA 1O7YA 1B9MA 3DEPA 1XX8A 3FVQA 2JSOA 3TZUA 1HCZA 1K8OA 1OXSC 5EQ0A 4KY5A 3Q24A 1SJHD 2KECA 1LTGD 1H9MA 2EY2A 3PO3B 4QMGA 2LY7A 1ESRA 1KLUD 1Y8NB 2SEBD 5E4WC 5G3LF 1S5ED 2A69D 1BNZA 4CBVA 5C3XA 1JOQA 3M3YB 1ZKOA 3QJYA 3LNNA 1HPCA 1O7ZA 1XWEA 3PUXA 4DNRB 1HFGA 2WP8J 1E0BA 4A3DB 1FR3A 3E0JA 5DM73 4L8JA 3EROA 2EYOA 3F2UA 4BBRB 4QF4A 2LS01 5CC4A 5C0XG 2M2LA 3G7LA 3K5NA 1O7LA 1RDPD 3BVZA 4B9WA 3CKIB 1M4VA 3GTGB 4M1UB 4ZQ3A 4HN7A 2B2WC 1Q1EA 5FOBB 1RJTA 1E2WA 4C1NI 1TS3A 4FXDA 1B2TA 1ONLA 4C3IB 1H9SA 3HOVB 5CV5A 2M9VA 2AWNA 1S5BD 3EQLC 2V4DA 1IL8A 2A74C 1SYDA 2AUKA 3Q22A 4BBSB 2HDLA 1A3UA 1H9JA 1I4RA 2IX1A 2WKCA 1STYA 3MA2B 5HURA 1GUSA 3FMCA 4LMQD 2K6AA 2WKDA 2K28A 3X3NA 2EJMA 1JQYD 2K5WA 2RBMA 2XRSD 1PFMA 4NKLA 2B2UC 4FXGC 1Z6HA 3FPUB 1SYCA 1DXMA 1RODA 3ITPA 1PLFA 3URYA 2R92B 4KHZA 1RD9D 2F3VA 2WINB 5D3DA 2PO4A 3V2TA 2VB3X 1F2YA 1X32A 1RKNA 3BDLA 1I3QB 3TMEA 1STNA 3DHQA 4ODGA 2Q8IB 1CTMA 4MHEA 3GO5A 1QWYA 4FF4A 2CW0C 2JP1A 1PRTD 2E76C 4F88A 4KTAA 1H9RA 5FLXL 2LMCB 1OXUA 2Z4HA 1SYEA 2EYLA 5EPLA 5M3MB 1D5XC 4HTHA 5M3FB 2KEDA 1GOZA 1YNJD 5JJZA 2PPBC 3HEJA 4XT3B 1BUVT 5A2QE 4KY7A 2L11A 1EWCA 4DAYA 4EQPA 1CT1D 3RMHA 2O5JC 2PZUA 5LHY1 1EZ8A 3VR2A 2WB1B 2PZWA 3S9WA 5KYLA 1F9PA 4J8QA 4BWGB 2I46A 5JPNC 3M7NA 4DN4M 1SNPA 1B4OA 3T51B 2B2VA 3H94A 3GP7A 2B2YA 2F0OA 3PUYA 3UI2A 5C0XJ 4OO1I 1IW7D 1TS2A 2IX3A 1M8AA 2SNSA 4PMWA 4RKLA 4CJ2C 5IGDA 4CKBA 2O5IC 1EY6A 1JC7A 1J9OA 2X6GA 5EPJA 3HKZB 4OGQC 4KD4A 2KCNA 1LTRD 3ZYYX 1HA5A 3D8GA 5C4ZA 2Y0SB 3E5SA 1F77A 3J80E 4YIJA 3FPPA 5IGCA 1NR2A 3VR6A 1U4RA 1I4PA 4Q0FA 1CHQD 3H0GB 1LACA 3MAQA 3WDNA 3HOUB 4BY1B 2IJ0A 4C3HB 2OF1A 4LK1C 1H9KA 3S1NB 1QE6A 2NTTA 4WRDA 4K8JA 4Y7NB 2L4NA 4N9PA 1I4GA 1ET6A 1A15A 2R93B 1LO5D 3J7AF 2PYKA 1WD0A 4H44C 2RSNA 2ZXRA 2KCCA 4KKTA 2DN8A 3DWQA 4FF1A 1PFBA 4IUUA 2O2LD 3C1FA 1TWHB 3TDQA 5M5YB 3TP8A 2VNUD 3KBXA 3A7AB 5C44B 3SK6A 4P2CB 1AW7A 4FO2A 1PTOF 5FO8B 3SEBA 3HP3A 3SK5A 5T1GA 4HSPA 2BA1A 3ND9A 4HMJA 2SOBA 2F0HA 2F0EA 5C0XI 2A68D 1SFOB 1AN8A 4R9WA 5I6WA 5M5WB 2E2IB 1EEID 1SMYC 3CRLC 1L0YB 4X3UA 4K6DA 2EXZA 1SXTA 1RHPA 1OXTA 1BOSA 2NN6I 4H13C 1QCBD 3KLSA 3D31A 4A3GB 1Q12A 1C48A 2PZTA 2B8FA 2NUCA 2B2WA 2L55A 5ISRA 4C3IG 4RGOS 3QG1A 1PZKD 5K36H 5C5LA 2DY8A 1T5EA 2N88A 3P20A 1BR9A 3A55A 1OXVA 2FFKB 2NWGA 1NSNS 3S1MB 2D5DA 4V190 2NZ1D 1LTAD 1VF7A 3MHBA 4IN3A 2BDNA 2NB0A 3BG3A 2CQAA 1SE4A 4H0LC 2PW7A 3OIPA 2XVSA 3VYUA 5CV6A 3MTSA 1ICWA 4ZAIA 1TWAB 4AYBB 5IT9E 3GTJB 2F0UA 1WVLA 2B2VC 3FRPB 4DU9A 5C5MA 3EVQA 3MXUA 2B2UA 2B2YC 3KF8A 1Q3LA 5KIXA 4RHRA 2IWHA 1GXDC 1MD2D 1QJOA 4I7ZC 1XTCD 1C8CA 4U673 4G57A 1Z47A 5KRUA 4PNYA 3BDCA 4C3JB 5G3LD 2E74C 2H4OA 3T4AC 5E3FA 2KUMA 3GV6A 5J22A 1PMRA 1FGBD 2HCIA 1EQVA 4F8MA 4OO1G 1D2BA 1J8IA 2PNRC 4XIGS 2O4XA 3OWEB 4R8NA 3A56A 1WD1A 4RGMA 1I6VC 5JVH3 2EJGC 1JWSD 1IKLA 3C46A 4NP5A 3I70A 4KMUC 3OMCA 2E2DC 3K5LA 2B8GA 2E2HB 1EOTA 1EYDA 4IFDJ 4RCNA 1JE4A 2EY5A 3K5MA 3R8BA 1BCPC 1FNUA 1T5XD 1FYCA 4H7BA 3DEOA 3DUZA 2WV6D 1EZ6A 2BDOA 5FO9B 1STHA 3Q6SA 2DNEA 3D3RA 2XNAC 1I4QA 4TRDA 4MN3A 1DZ1A 2ZXOA 4JK1C 1O78A 5I2YA 2J0TD 5F2DA 2X69A 2NVYB 5M9OA 2LKVA 4FVMA 1R9TB 5ELFA 3J80L 4QB4A 2AWOA 1TWFB 2F0DA 1LT5D 3NXWA 2BE5C 3NE5B 2L12A 1BDOA 1BQQT 1BCPB 2F0LA 2MHVA 1EY5A 4A3MB 5IGBA 1DOLA 3W2DA 1ENFA 4F7XA 1TVXA 3NK9A 4RA8A 4CHTB 3FDTA 1QOHA 3J81E 5D3IB 1EYCA 5EGTA 1JCKB 4XQQA 4B08A 4DAPA 3HOXB 1B44D 3Q0AA 3TN2A 5C3WA 3TP6A 4CKCA 1YNNC 5COYA 1KDCA 1RTNA 3R3OA 2SNMA 2K01A 2FMMA 3Q23A 2A6HC 4OL7A 3GTPB 2F0MA 3SK4A 1Z7TA 4A93B 2GA4B 3IFTA 2A6EC 3MXNA 2NN6G 4U68A 5CGKA 3VYRA 4TSSA 4XQJA 1F9SA 5FK9C 1B3AA 2NVQB 1IKMA 1CQFA 1STBA 3RLFA 4DAVA 2VXWA 3R2IA 2JEAI 2XRQD 4IFDI 4XXEA 1I6HB 5D65A 2XIWA 2QCPX 1S5DD 1SBBB 3D4WA 1HTLD 1HTPA 5JEAH 1EY0A 5DAUA 1LT4D 2HDMA 4PQXA 2F0QA 1STAA 4A3KB 2QILA 2HCCA 3VA7A 1G6ZA 5K5PA 1WTVA 2Z1CA 3QWNA 3A8KE 1LT6D 2I07B 1EFID 5TSSA 2K5DA 1ENAA 1DOMA 2MJ8A 4UDUC 1UEAB 1V1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EXZ A;  2F0K A;  3D4D A;  4K14 A;  2F0J A;  4ZQ3 A;  4KD4 A;  3LX0 A;  5E3F A;  5NUC A;  3TP5 A;  5KYI A;  1EY4 A;  5J22 A;  3DMU A;  3D8G A;  1EYC A;  5EGT A;  4B9X A;  5C4Z A;  5JAV A;  2F0N A;  3E5S A;  4J6H A;  1EQV A;  3QOJ A;  4F8M A;  4ME5 A;  4KTA A;  2OEO A;  4YIJ A;  2PZT A;  1II3 A;  2NUC A;  4RKB A;  4K2L A;  5EKK A;  2HQE A;  1KDB A;  4K8I A;  5C3W A;  5IGE A;  2OXP A;  3EJI A;  3MXP A;  3NP8 A;  2F0G A;  3TP6 A;  4EVO A;  2ENB A;  5C4H A;  5CR3 A;  2O4X A;  5IGC A;  5KIX A;  5ISR A;  4R8N A;  5J1Z A;  5DEH A;  1SYE A;  3D6C A;  2EYL A;  5HGT A;  1A2U A;  1KDC A;  4K5X A;  1A2T A;  4HTH A;  5CV7 A;  3T16 A;  1JOR A;  3HZX A;  2SNM A;  3R3O A;  4DFA A;  5IGG A;  4KY6 A;  4DGZ A;  5CV5 A;  2EYM A;  2F0W A;  2KHS A;  2EYF A;  4S3S A;  3SHL A;  4OL7 A;  4PMB A;  4NP5 A;  1EY7 A;  5IOD A;  2F0M A;  5C5L A;  2F0V A;  3OMC A;  3SK4 A;  3TP7 A;  2OF1 A;  4KV6 A;  3HEJ A;  3QOL A;  1SYB A;  1SYD A;  2F3W A;  4KY5 A;  4KY7 A;  4K8J A;  4WRD A;  5JOB A;  1EYD A;  2F0T A;  5CGK A;  2PW5 A;  4EQP A;  2EY6 A;  4N9P A;  3U9O A;  2EY5 A;  1A3U A;  2PZU A;  1EZ8 A;  1KDA A;  4ID6 A;  4K5V A;  2EYH A;  3NHH A;  3MVV A;  5CV8 A;  4WOR A;  4PMC A;  5IGF A;  1NUC A;  1SNO A;  2PZW A;  5IOC A;  2WAC A;  4LAA A;  1SNQ A;  1STY A;  2EY2 A;  4H7B A;  2F0S A;  3MZ5 A;  3S9W A;  2PYK A;  5I9P A;  5HUR A;  5KEE A;  5J39 A;  1NSN S;  4QMG A;  2EY1 A;  1EZ6 A;  3PMF A;  1SND A;  5KYL A;  1STH A;  1STB A;  1U9R A;  4N9T A;  3MHB A;  1KAB A;  2KQ3 A;  3NQT A;  3NUC A;  2F0F A;  1JOK A;  3OWF A;  4IAL A;  3RUZ A;  1KAA A;  3ERQ A;  4NDX A;  4TRD A;  3VA5 A;  3P1H A;  1A3T A;  4EQO A;  1EY8 A;  3T13 A;  5I6Y A;  5IIF A;  1F2Z A;  1SNP A;  3C1F A;  4E6I A;  2PW7 A;  1TT2 A;  5I9O A;  1STG A;  2RBM A;  4KJN A;  3SK8 A;  5F2D A;  2QDB A;  4J1M A;  2RKS A;  4MIU A;  2LKV A;  5M9O A;  3D4W A;  1EY0 A;  2F0O A;  4ZUI A;  5C3X A;  3TP8 A;  2M00 A;  3MEH A;  5C6A A;  1JOQ A;  4NKL A;  1SNM A;  3QB3 A;  5CV6 A;  5DAU A;  4IZ8 A;  3SXH A;  1A3V A;  3H6M A;  1SNC A;  3OSO A;  4QB4 A;  1IHZ A;  1SYC A;  3SK6 A;  2F0Q A;  4K2K A;  1STA A;  1TQO A;  4I65 A;  2F0U A;  2F0D A;  1EYA A;  3NXW A;  3ITP A;  5EKL A;  4DU9 A;  5K5P A;  5C5M A;  3EVQ A;  3SK5 A;  2PQE A;  3OMG A;  2EYP A;  3ERO A;  2F3V A;  4HMJ A;  2EYO A;  3P75 A;  5CV9 A;  3SR1 A;  1EY9 A;  2F0P A;  2F0L A;  2SNS A;  3V2T A;  4EQN A;  4K5W A;  2SOB A;  2F0H A;  1F2Y A;  2F0E A;  1EY5 A;  4K6D A;  4RKL A;  1ENA A;  1SYF A;  1JOO A;  5IGD A;  1ENC A;  1EY6 A;  4DF7 A;  1RKN A;  1SYG A;  3BDL A;  4IUN A;  4NMZ A;  4QF4 A;  1F2M A;  5IGB A;  4KJO A;  5CV4 A;  3TME A;  4ZUJ A;  5CC4 A;  5I6W A;  5KGU A;  4G57 A;  1STN A;  5KRU A;  2F0I A;  2EYJ A;  4KHV A;  3C1E A;  3DHQ A;  1AEX A;  4HMI A;  4KD3 A;  3BDC A;  4PNY A;  2RDF A;  4ODG A;  4B9W A;  4F7X A;  5E1F A;  1TR5 A;  3NK9 A; 
#chains in the Genus database with same CATH topology
 1DYQ A;  3D4D A;  4LF4 L;  4K14 A;  2JE6 I;  3TP5 A;  4ZLT F;  3QIA A;  4RG1 A;  3WOE A;  2A19 A;  4A3B B;  3FHW A;  4DV0 Q;  1IBK L;  1FVI A;  2BOS A;  3NTK A;  4R4O A;  5I2X A;  4PV1 C;  2UUA Q;  2A69 C;  1N32 Q;  3OTO Q;  4GZY C;  2K33 A;  1G8Z D;  1HQM C;  1Y1W H;  1X55 A;  1B1Z A;  4OON A;  4ZKB B;  1VQ8 A;  4KI0 A;  5KNB A;  3PF4 A;  5C4X G;  3EA6 A;  3L0O A;  5CV7 A;  3T16 A;  1N34 L;  3HZX A;  2ZT9 C;  4DGZ A;  1K0R A;  1PH1 A;  3CQZ H;  2F0W A;  2KHS A;  4YCU A;  4AQY L;  3RZD B;  2RDH A;  4HR7 B;  1LTI D;  1VQL A;  3LWU A;  4A3F G;  2VW9 A;  2TMP A;  3HS0 C;  3AEV A;  2AUJ D;  3ONA B;  1WCM G;  3RLN A;  1HXY D;  1WTO A;  1KL9 A;  1Q82 C;  5C3E B;  1N36 Q;  1ILQ A;  2PW5 A;  4UPA A;  2K03 A;  3I4N H;  3A8I E;  4L5R C;  3MVV A;  1XMQ Q;  2TSS A;  4G7H C;  3PUW A;  4JI0 Q;  3RLO A;  4LFC L;  2KHI A;  1X3G A;  2MPM A;  3L3O C;  2A73 B;  1C7Y A;  2DUD A;  1EEF D;  1O7I A;  5LMN Q;  1D1K A;  1Y69 U;  2C35 B;  3RUZ A;  1MSG A;  1WYD A;  1WTP A;  1L1O C;  1KLG D;  5I6Y A;  4PZ6 A;  5IIF A;  1PH9 A;  3S17 B;  3L7Z C;  1UE7 A;  4YWK A;  1CI3 M;  3SK8 A;  4A3J G;  1AFP A;  1XNQ Q;  1WFQ A;  4QUC A;  4LNQ A;  4GNX A;  3CU7 A;  3B6Y A;  2R7Z H;  1A3V A;  1RIP A;  3I90 A;  4LF4 Q;  4CDE C;  2XWJ B;  4K2K A;  3T56 B;  3DM1 A;  4R1J A;  5JPM C;  4HCE A;  1IBK Q;  4IPD A;  1UUP A;  1NCV A;  4B3M Q;  4DA2 A;  1FJG L;  1YI2 A;  3G6J B;  2J7Z A;  3SR1 A;  3VR3 A;  3R93 A;  1HQR D;  4ABN A;  1K3B C;  3CME A;  1ENC A;  4DF7 A;  4DV6 L;  3GV3 A;  1N34 Q;  1EIG A;  5KND A;  3L9A X;  3GTM H;  2JEB I;  4CKE A;  2QEJ C;  1GUN A;  1TR5 A;  3LWE A;  1MI2 A;  4A3I H;  3I73 A;  4LF6 L;  2JXM B;  4ZRZ A;  1Q46 A;  5CYU A;  4YCW A;  4A3E G;  5FLX c;  3NEN A;  4OHJ A;  5M5X H;  1PZJ D;  1IYV A;  3GTQ B;  4RKB A;  1BBX C;  2ZTE A;  1KDB A;  3T53 B;  3NP8 A;  4LF7 L;  1GUT A;  1PTO D;  3KOJ A;  4L5T A;  1SMY D;  1HHV A;  2ICI A;  4HAE A;  4C56 C;  4DK3 C;  4BY7 B;  4YY3 L;  4KY6 A;  5EKI A;  1BBU A;  5IYB H;  2XWB B;  4K6L A;  2HIX A;  4IOA A;  1WTW A;  3HFZ B;  1C9O A;  1K8M A;  2F1M A;  3BVG A;  1Y1V B;  3TZD A;  1PH2 A;  3E9I A;  3STB C;  2B63 H;  4APV A;  2VUM H;  3MFY A;  2AKW B;  3FKI H;  1WTR A;  1D5Z C;  1TU2 B;  1EIF A;  1XXG A;  1MGS A;  1B3Q A;  5IYC H;  1SNO A;  3HOW H;  1TS5 A;  2WAC A;  4FP5 D;  1DON A;  3MZ5 A;  1D6E C;  1JWU D;  4JI8 Q;  3JAM E;  1ZEQ X;  1TWG H;  2V1C C;  4DR2 Q;  4X65 Q;  1M90 C;  3PCO B;  1LM0 A;  5DLQ E;  4DUY Q;  1CM9 A;  2K5V A;  4IUR A;  3OWF A;  2AQ1 B;  4L6T B;  1LUZ A;  2MO1 A;  3M4Q A;  3U9S A;  1EY8 A;  1EWH A;  1G29 1;  4DV6 Q;  4OIK A;  3K7A B;  3A54 A;  4BXX G;  3I4M H;  3AB9 A;  1HNX L;  2RKS A;  3J81 L;  3VR5 A;  1G2S A;  3W1G A;  1CQV A;  4IO9 A;  1DJR D;  4ZUI A;  1KIX A;  1SNM A;  5AJ3 Q;  1ASZ A;  4A3C H;  4FYD A;  1SNC A;  4LJZ C;  2JA9 A;  4WJ4 A;  2IW3 A;  3KLW A;  4KN7 C;  1SE3 A;  2FIN B;  1EYA A;  2XN9 C;  3X3M A;  4DR3 L;  3P7J A;  5IE8 A;  4R4C A;  1DD2 A;  2WII B;  3PUZ A;  1HJP A;  1QNK A;  1QVC A;  3PUV A;  4IFD G;  4LF7 Q;  4KN4 C;  4A3M G;  1SYF A;  3CCV A;  1GVP A;  4IUN A;  1HUN A;  1PRT B;  4O42 A;  1HZB A;  1D1I A;  4HMI A;  5LL6 X;  2HHH L;  3HRZ C;  1YJW A;  5EBC A;  4HSV A;  1R4Q B;  1Y1W B;  5J3B A;  3E3X A;  1I4X A;  1EY4 A;  2VL6 A;  5JAV A;  1SLJ A;  1LTT D;  2ID0 A;  2VB2 X;  1F9Q A;  3CQZ B;  4IPG A;  5LMU L;  4I7A A;  1ESF A;  5EKK A;  5IGE A;  1E22 A;  5C4H A;  4YCV A;  2KJX A;  1BXT A;  3LGJ A;  5J1Z A;  3RD4 A;  1GJX A;  5FLM H;  5HGT A;  5FJ8 G;  2F4I A;  1SE2 A;  5I4D A;  1JOR A;  4DFA A;  5ELO A;  4JBK A;  4LFA L;  3I4N B;  4X3S A;  2D62 A;  1S40 A;  3O13 A;  1IW7 C;  1C4Q A;  1JWM D;  1BKB A;  4MZ9 A;  1MJC A;  1ET9 A;  2RA4 A;  1SAP A;  1JR0 D;  4EX5 A;  2F3W A;  2F0T A;  4CDD C;  1VQA A;  1VQ7 A;  4ID6 A;  4XYO A;  3ULJ A;  5CV8 A;  5IGF A;  1U4L A;  3TRZ A;  2NYZ D;  5KEE A;  3HOV G;  1SR3 A;  4GOP A;  3G4S A;  1T9H A;  4N9T A;  3CC4 A;  4A3L H;  2MUY A;  3HG9 A;  2R7Z B;  1JJ2 A;  2C5C A;  3UDF A;  4YWM A;  3UDI A;  1A3T A;  2Y0S E;  3S1Q H;  3KUP A;  2JA7 H;  5IP7 G;  4IQZ A;  4BBS G;  2NVT H;  3NBI A;  4WJW A;  3QB3 A;  2A5H A;  2PI2 A;  3A8J E;  4IPC A;  3ZJY C;  4A4I A;  4H02 A;  1PH6 A;  1GD7 A;  2MQH A;  3VR4 A;  4A3K G;  2ZM6 L;  4JI4 L;  1KAW A;  2OCE A;  4JV5 L;  1RCV D;  3OMG A;  3V05 A;  3GTM B;  2PQA B;  1U4M A;  2B39 A;  4PZ7 A;  4A3I B;  1MIU A;  3I91 A;  3AFP A;  4CJ1 B;  3CPF A;  1PDQ A;  1YNX A;  4LUZ A;  3R2T A;  3M4O H;  5M5X B;  4KHV A;  4LFA Q;  4KD3 A;  1A8V A;  1JIC A;  3JC6 6;  1CK1 A;  1XNR Q;  3ER0 A;  3NPP A;  1ZYR C;  2VQE L;  5KYI A;  2R92 G;  4A3B G;  3CHB D;  4JBW A;  1GHJ A;  1V8Q A;  1YBY A;  2OXP A;  2F0G A;  4IUV A;  4KKS A;  4B3S Q;  5CR3 A;  2E75 C;  4JVZ A;  4XT1 B;  3NEM A;  1EU3 A;  2DJG C;  4DR6 L;  1AP0 A;  4C2M H;  2B63 B;  3DXJ C;  5A2Q L;  3J81 j;  1CHP D;  2VUM B;  2UXB L;  2EYF A;  4B3R L;  3FKI B;  2AQ2 B;  3GTO H;  1L0W A;  1KNE A;  5FLX E;  4IJH A;  3N52 A;  3HOW B;  4R8I A;  1PZI D;  5JVG 3;  1E7Z A;  1B53 A;  2P5Z X;  1TKW B;  4HCS A;  2LFN A;  2Z9H A;  3QOL A;  2K32 A;  1LYL A;  1CUK A;  1TWG B;  3NQI A;  4HED A;  2A68 C;  4IUP A;  3TSS A;  5A35 A;  1GKH A;  5M3M G;  4JI2 L;  2Z4I A;  1SNQ A;  2R7F A;  5M3F G;  3I4M B;  3EIV A;  3RZO H;  1BCP F;  4GS3 A;  4RMF A;  2AQ3 B;  4JI3 L;  2UXC L;  1GHK A;  4RGT A;  4IAL A;  3ERQ A;  4NDX A;  3G71 A;  2F52 A;  3IL8 A;  1EQR A;  4G7O C;  4E6I A;  2RQX A;  4NXN Q;  1STG A;  1AZP A;  1R4P B;  4J1M A;  2EDG A;  2QW7 A;  2M00 A;  3MEH A;  2FHT A;  2UU9 Q;  4LW1 A;  3OSO A;  1WTX A;  1S72 A;  2VQE Q;  3BS1 A;  4DR5 L;  3KF6 B;  2NBF A;  3WOF A;  1LV9 A;  1TWC H;  1VQH A;  5EKL A;  3PO2 H;  2N78 A;  1W3S A;  2KCT A;  4M8A A;  4FF2 A;  4DUZ Q;  3M4P A;  1MHW C;  1MBY A;  4Z9C B;  5CV9 A;  1EY9 A;  1SEB D;  1SRU A;  4EQN A;  2DY7 A;  4V0B A;  2IT1 A;  2IL8 A;  3NWS A;  4NMZ A;  1W6J A;  3PV0 A;  3HKS A;  4RGN A;  2E2J H;  4DR4 Q;  2EYJ A;  4RHS A;  3IKJ A;  1F2L A;  1FNV A;  3OW2 A;  2E8G A;  2RDF A;  4B3R Q;  4B9X A;  4OO1 H;  4ME5 A;  4DK1 A;  4R4Q A;  1U0L A;  1IZ6 A;  2I5H A;  1AE2 A;  1UAP A;  1HH2 P;  3OHX C;  3DMU A;  1GUG A;  3M4Y A;  2D9U A;  4P71 A;  5ELN A;  3D4R A;  1F9R A;  4C1N K;  3JAM L;  1RTO A;  2PMZ B;  1LTS D;  2X6L A;  4K8I A;  4DV1 L;  1B50 A;  1A63 A;  1PFN A;  1TII D;  1A2U A;  4XYQ A;  1A0I A;  2B2T C;  4BY7 G;  2Z6B A;  2EYM A;  2IHE A;  3QR8 A;  3BZK A;  4JI3 Q;  4AYB E;  5DNF A;  2B29 A;  2Q2I A;  4DV3 L;  2RHQ B;  2Y0S G;  1FNW A;  3UE0 A;  3SGI A;  5JOB A;  2G9H D;  3PF5 A;  2N55 A;  2HD3 A;  2EYH A;  4PMC A;  1G2T A;  1QUQ B;  5IOC A;  1U4P A;  4JI7 L;  5ELC A;  2K14 A;  3S1Q B;  2JA7 B;  2PNH A;  3A0J A;  2UUB L;  3H0G G;  4POF A;  5JEA G;  2CW0 D;  2NVT B;  1CKM A;  1QG7 A;  3PIP 3;  3HOU G;  3SDZ A;  2KQ3 A;  2HIV A;  4C3H G;  4DXF A;  2JN4 A;  2VQF Q;  1LTB D;  3W3A A;  2EIF A;  5BN5 A;  4EQ5 A;  1TT2 A;  4GKJ L;  4BA2 I;  2D2C C;  5EPK A;  1E2Z A;  4GOP C;  2K1B A;  3TBI B;  4JPB W;  1K8G A;  2IY5 B;  3K8A A;  2Q2U A;  3DLL A;  1HNZ Q;  3CAM A;  4JYA L;  3CC2 A;  1LT3 D;  1TQO A;  1SRO A;  4G7Z C;  2K50 A;  5EJW A;  5IP9 G;  3OW7 A;  3M4O B;  4YHH L;  3F1Z A;  4DV5 L;  5E4X A;  2EQS A;  4QIW B;  1CZW A;  1OO9 B;  2QDL A;  3HOY H;  3MWY W;  4CDF C;  1N8R C;  2KA7 A;  1NJI C;  1D7Q A;  1VS0 A;  2YYZ A;  2ZTD A;  4X6A H;  3AYH B;  3KBG A;  3KYH C;  3GQB A;  3GTK H;  3IAY A;  1EOV A;  1EL0 A;  2MFI A;  2F0K A;  1STE A;  3EFX D;  2OT2 A;  4DV3 Q;  2QGQ A;  1WTH A;  5GAD C;  2KOL A;  3BDO A;  3I4L A;  3NBH B;  4C2M B;  4K0K L;  5C0X H;  4GOP B;  1VQ9 A;  2JA6 H;  3QOJ A;  2DNC A;  3GTO B;  3EJI A;  3W5O A;  4EVO A;  5ELE A;  2K5Q A;  4LF9 L;  5KNC A;  4B3T L;  2EXD A;  3J7A V;  5C4J H;  2UUB Q;  2UXD L;  2JA8 H;  2JQO A;  1G91 A;  4P73 A;  2K04 A;  2K4K A;  2NN6 H;  3KK7 A;  4JI5 L;  1I50 H;  1EY7 A;  5IOD A;  1DCZ A;  1VCI A;  3TP7 A;  2K7V A;  4KV6 A;  4GKJ Q;  2Z8L A;  2F4V Q;  4A3G G;  1SYB A;  1GO3 E;  4LF5 L;  1ILP A;  3S2D H;  2L1B A;  3RZO B;  3A5U A;  2CWP A;  3I8Z A;  4OEM B;  2EY6 A;  2WAQ B;  3NSW A;  1S5C D;  2Q8T A;  1Q8I A;  2R6G A;  4X66 Q;  4MNO A;  3GDE A;  4WOR A;  4JYA Q;  1SSO A;  4LAA A;  3UDX A;  5LL6 S;  3CW2 C;  5AFW A;  2FMC A;  1PH4 A;  1I94 Q;  3VYS A;  1BF4 A;  1U9R A;  2PQA A;  2R7Z G;  1QIL A;  4IJL A;  1OXX K;  2F0F A;  1JOK A;  1SJE D;  4XQN A;  2QF7 A;  1HR0 W;  4GN3 B;  1TWC B;  5IT9 L;  1HUM A;  1WTQ A;  3PO2 B;  1VQI A;  1D8L A;  2QDB A;  4ZKC B;  4F87 A;  3GTL H;  2K5H A;  5C6A A;  4DNI A;  4QUF A;  4JI6 L;  2YTV A;  2NTS A;  4HIK A;  2QA4 A;  4DPG A;  4KKU A;  2R3Z A;  2EVB A;  4ULL A;  1MSH A;  4K0K Q;  3K80 C;  4BA1 I;  2E2J B;  3S14 H;  2PQE A;  2NVX H;  2L5T A;  1NR4 A;  4ZYS A;  4DNT B;  4A3I G;  3HOZ H;  3P75 A;  1E2V A;  1IXR A;  1YHA A;  2C9O A;  5DM6 3;  1HNW L;  1JOO A;  1CA6 A;  1SYG A;  4X64 L;  1VQG A;  3NTI A;  3H09 A;  4ZUJ A;  5COR A;  1BO0 A;  2IX0 A;  4IUQ A;  3OIQ A;  3C1E A;  1GM5 A;  1AEX A;  4NXM L;  4JI1 L;  3SE0 A;  4AYB G;  3PIP A;  4XDX A;  4DV4 L;  3S16 B;  1TS4 A;  1IYU A;  2F0N A;  3BU2 A;  1VQ4 A;  4J6H A;  1A6X A;  3OPO A;  5C4X H;  1PXU A;  5T1I A;  2RVL A;  1II3 A;  4K2L A;  1UWV A;  3C2P A;  3S2H H;  2JA5 H;  1VF5 C;  5DEH A;  2Q8R E;  2MP1 A;  4A3F H;  2B63 G;  3SVM A;  1WCM H;  1PTO H;  4AQY Q;  5IGG A;  3KLR A;  3CMA A;  2YTX A;  4C3J G;  1EIH A;  3S15 H;  3TS2 A;  2EPB A;  1HA6 A;  5IYC G;  5JEA J;  3HOW G;  2OWO A;  3K0Y A;  3PSI A;  1SDF A;  4X3T A;  3I3C A;  1QVG A;  1ZXT A;  2ATW A;  4TKO B;  1HRJ A;  2CCZ A;  1X9N A;  2KHJ A;  2XTI A;  1K83 H;  4JI6 Q;  2YU9 H;  5CMD A;  1KDA A;  3NHH A;  4LFC Q;  4CGY B;  1NUC A;  2R61 A;  3KF6 A;  1Q90 A;  1V1P B;  2L0C A;  2F0S A;  2EY1 A;  1XPR A;  2PCF B;  2KEE A;  3MXG A;  5EBD A;  4ZCK A;  5CBA E;  2PI2 E;  4A3J H;  4P75 A;  3NQT A;  5ELD A;  1WJJ A;  2EJF C;  3P1H A;  1HNW Q;  5L37 A;  2EZV A;  4KK7 A;  3T13 A;  1PRT F;  4NW2 A;  1K73 C;  2I0Q A;  3OOC A;  1ICF B;  3S1R H;  4NXM Q;  1E3P A;  4JBM A;  3HOY B;  4IZ8 A;  4XTC S;  1HFN A;  3CRK C;  4Y52 H;  1QNU A;  2A1A A;  1CKN A;  4DV4 Q;  4I65 A;  4DK0 A;  1VMP A;  5BN3 A;  4DK6 C;  1GUO A;  1PRT C;  1FJG Q;  3NEL A;  1TY2 A;  2EYP A;  3GTK B;  1PYB A;  2RSO A;  4PZ8 A;  4YWL A;  1X3P A;  3K81 C;  1XJV A;  4X3K A;  4IPH A;  1LLR D;  4K5W A;  3GD7 A;  1EUJ A;  1Y8P B;  1LAB A;  1D5M C;  2K05 A;  4RCO A;  1F2M A;  1UEB A;  4KJO A;  1PYS B;  1FD7 D;  4BS9 A;  1J6Q A;  1X3Q A;  2MGS A;  4UP7 A;  2JA6 B;  3VYT A;  1Y8O B;  2UUC L;  4A3E H;  5E1F A;  1TY0 A;  4LF6 Q;  3KLS X;  3K59 A;  2F0J A;  4CDC C;  1PH5 A;  1GUW A;  2RF4 A;  4A76 A;  1YNJ C;  1NAP A;  5C4J B;  3A7L A;  2JA8 B;  3DWP A;  2N3S A;  1IL2 A;  2L9H A;  1I50 B;  4CJ0 B;  2ZXP A;  1VMC A;  4FF3 A;  1QUQ A;  3MXP A;  3V96 A;  3MFG A;  3I72 A;  2BA0 A;  1HR0 L;  3CCU A;  1O80 A;  2JYO A;  4MTN A;  4YY3 Q;  3S2D B;  1ZYR D;  4LF8 L;  4UP8 A;  2CVR A;  1S5F D;  1QZH A;  4ILW A;  3BZC A;  2F0V A;  2B2T A;  2HUG A;  3PIO 3;  1QB5 D;  3F8T A;  3HOX G;  1NY4 A;  1Q8K A;  4UAI A;  1Q86 C;  4RH6 A;  1PH8 A;  3H3V H;  1KRS A;  5K36 G;  2XSC A;  1DM0 B;  4P72 A;  3FEW X;  1I5F A;  1UE6 A;  3HGB A;  2JA7 G;  1B8A A;  1TXY A;  3K0X A;  5I9P A;  2IPK D;  3VDY A;  1H9S B;  1SND A;  3H91 A;  3CCJ A;  1MJE A;  1X6O A;  4EGV A;  3GTL B;  3Q8D A;  4PG3 A;  2IHF A;  1KAB A;  4RAU C;  4RWS C;  1PH7 A;  1HZC A;  5HY6 A;  4TQU S;  3BVM A;  4HJA A;  4FNF A;  4A93 G;  5IWA L;  3PO3 H;  3K58 A;  4A75 A;  1F2Z A;  3IFD A;  1HNX Q;  1RL2 A;  4X62 L;  1KTK A;  4KJN A;  4IUT A;  3S14 B;  4MIU A;  1PTO C;  4Q5V A;  2NVX B;  2RCN A;  3SXH A;  4HJ5 A;  3HOZ B;  1L0X B;  4DR3 Q;  2ZJR A;  4IFD H;  2RDG A;  1UNS A;  3NBH A;  2I5L X;  4TVA B;  2CKZ B;  3C3L A;  3M3Y H;  1AZQ A;  1RF2 D;  3K57 A;  1Q1B A;  1KNA A;  1HR0 Q;  5CV4 A;  1E24 A;  3AU7 A;  4A3D H;  1BCP D;  2HHH Q;  2NZH A;  5C4X B;  2F0I A;  2SDF A;  4P74 A;  1HZA A;  4LF8 Q;  3AMU A;  1VQ5 A;  3S2H B;  1B9N A;  4ZK9 B;  3RN5 A;  2JA5 B;  1K9M C;  4BBR H;  3M85 A;  3LX0 A;  1YJ9 A;  2F3I A;  4A3F B;  1S4Z A;  1WCM B;  1PTO B;  3K5O A;  1EYG A;  5FJ8 H;  5FKA C;  5LMU Q;  1PH3 A;  1B70 B;  2OEO A;  2LXJ A;  3NTH A;  3EN2 A;  3GTG H;  5E7N A;  3FP9 A;  3S15 B;  2HQE A;  1EU4 A;  3NWT A;  1W6K A;  3K6O A;  1JB3 A;  1U5K A;  5D14 A;  4K5X A;  4RFB A;  1JJG A;  3BYT B;  5IYD G;  1NBW A;  3TEH B;  1CFM A;  4S3S A;  3SHL A;  1K83 B;  4DAM A;  2YU9 B;  3QO2 A;  2BE5 D;  4PMB A;  2EE1 A;  2J4X A;  3ND8 A;  4O2D A;  3H15 A;  3D6W A;  5IWA Q;  2EOT A;  4QCL A;  4C3I H;  4X62 Q;  3CCR A;  1Q81 C;  5CBE E;  1ML0 D;  4HJ8 A;  3HOV H;  4L63 B;  3T1Y L;  3U9O A;  4A3J B;  2CFM A;  4K5V A;  1P8L A;  4KLK A;  4LUV A;  2KEN A;  2ICE C;  4UP9 A;  5J39 A;  2QKI C;  4GLX A;  1CZG A;  3MC0 B;  3N6R A;  3PMF A;  3S1R B;  1XYI A;  5IP7 H;  2CH4 A;  3U50 C;  4BBS H;  5FO7 B;  3NUC A;  3VA5 A;  1KAA A;  4AIM A;  4EQO A;  5C3E G;  1K8A C;  5I9O A;  4A3K H;  1HZ9 A;  1VQC A;  5ELB A;  1IYJ B;  4G4K A;  3DWA A;  4DAY B;  2L15 A;  1CA5 A;  1YNN D;  1KHI A;  1DOK A;  5IY0 A;  3H6M A;  1VDZ A;  2ES2 A;  1IHZ A;  5HGQ A;  2ZM6 Q;  4JI4 Q;  2A6H D;  1M1K C;  4JV5 Q;  4O1N A;  2KVM A;  4JCV E;  3PIO A;  3E6Z X;  4A3E B;  3H3V C;  2BCO A;  2F0P A;  2A6E D;  1N9W A;  1EQT A;  4GLV B;  3BZD B;  5KGU A;  1SE8 A;  2OQ0 A;  4OIJ A;  1FGU A;  1PYW D;  2R92 H;  3RNU A;  5LMN W;  2K52 A;  1V43 A;  3M7G A;  2G9D A;  2YV5 A;  4WFN 3;  5NUC A;  4IOC A;  1VQF A;  2FJ2 A;  1I3Q H;  4FXK C;  2F03 A;  3BYY B;  3W1B A;  3T1Y Q;  3J7Y W;  1I4H A;  1XTD A;  5BN4 A;  2H1E A;  1JB7 A;  1V1P A;  2ENB A;  4DR6 Q;  2CHB D;  1G51 A;  3D6C A;  4DXG A;  1A2T A;  2UXB Q;  2CWA A;  4ME3 A;  1O7Y A;  1CSP A;  1B9M A;  3DEP A;  1XX8 A;  1VQ6 A;  3FVQ A;  1CKN B;  2JSO A;  3TZU A;  1HCZ A;  1K8O A;  4O0A A;  1OXS C;  5M3M H;  5EQ0 A;  4KY5 A;  4DV2 L;  4GN5 A;  5M3F H;  2K75 A;  3Q24 A;  1SJH D;  4JI2 Q;  2KEC A;  4DKA C;  2BH2 A;  1LTG D;  1H9M A;  2EY2 A;  3PO3 B;  1MKH A;  4QMG A;  2LY7 A;  2A8V A;  1ESR A;  1KLU D;  1Y8N B;  4KHP L;  2SEB D;  2UXC Q;  2NZO A;  1PFS A;  1Y1V G;  1VQN A;  5E4W C;  5G3L F;  3KJO A;  1S5E D;  2A69 D;  1BNZ A;  4DR1 L;  1YVC A;  4CBV A;  5C3X A;  3HOY G;  3M3Y B;  1ZKO A;  3QJY A;  1JOQ A;  3LNN A;  4DR5 Q;  1HPC A;  1O7Z A;  1XWE A;  3PUX A;  4DNR B;  1A62 A;  1HFG A;  2WP8 J;  1E0B A;  4UY8 C;  4A3D B;  1FR3 A;  2JK8 A;  3E0J A;  5DM7 3;  4L8J A;  3ERO A;  2EYO A;  3J80 i;  3F2U A;  4BBR B;  3PGZ A;  4DV7 L;  3J80 c;  3PQI A;  4QF4 A;  4L5S A;  1VQM A;  2LS0 1;  5CC4 A;  5C0X G;  2M2L A;  3G7L A;  3K5N A;  1O7L A;  1RDP D;  3BVZ A;  4B9W A;  3CKI B;  1M4V A;  3GTG B;  4M1U B;  4L5Q A;  4QJF A;  4OWW B;  1NE3 A;  2VS1 A;  1UE5 A;  4ZQ3 A;  4OX9 L;  4HN7 A;  2B2W C;  4N8X 1;  2Q2H A;  1Q1E A;  2ZJP A;  5FOB B;  4DV0 L;  1OTC A;  1RJT A;  3D0F A;  4DV1 Q;  1G6P A;  4GN4 B;  1E2W A;  4C1N I;  1N32 L;  1TS3 A;  2BH8 A;  4FXD A;  1B2T A;  1ONL A;  4C3I B;  1H9S A;  4R4T A;  1V1Q A;  3HOV B;  4KHP Q;  5CV5 A;  2M9V A;  1YZ6 A;  1Y1W G;  2AWN A;  4JW0 A;  1V9P A;  1S5B D;  3EQL C;  2V4D A;  1IL8 A;  2A74 C;  4DR1 Q;  1SYD A;  2AUK A;  3RR5 A;  2N8N A;  3Q22 A;  3H0G H;  4BBS B;  2HDL A;  1A3U A;  1H9J A;  1I4R A;  3G48 A;  4JI7 Q;  2IX1 A;  3HOU H;  4BY1 H;  2WKC A;  4C3H H;  3T1H L;  1STY A;  3MA2 B;  4JI0 L;  5HUR A;  3S1N H;  1GUS A;  3FMC A;  4LMQ D;  2ZTC A;  2K6A A;  3I4N G;  2WKD A;  4Y7N H;  1EFW A;  5LMN L;  2K28 A;  3KDF B;  4DV7 Q;  3X3N A;  3U58 A;  2R93 H;  2EJM A;  1CSQ A;  1JQY D;  2K5W A;  2RBM A;  2XRS D;  2Z0S A;  2PMZ E;  1PFM A;  5IP9 H;  1XNQ L;  3HOZ G;  4NKL A;  2B2U C;  1Z9F A;  4FXG C;  1Z6H A;  3FPU B;  1SYC A;  2OQK A;  1DXM A;  4OX9 Q;  1ROD A;  3ITP A;  4YHH Q;  1P16 A;  4DV5 Q;  1PLF A;  3URY A;  2R92 B;  1KRT A;  4KHZ A;  1TWH H;  5M5Y H;  1RD9 D;  4B3M L;  2F3V A;  2WIN B;  2D0P A;  5D3D A;  2PO4 A;  3STB D;  3V2T A;  2VB3 X;  5C44 H;  1SMX A;  1F2Y A;  1WI5 A;  1X32 A;  1RKN A;  3BDL A;  1I3Q B;  3TME A;  1STN A;  3DHQ A;  1Y14 B;  4ODG A;  2Q8I B;  1CTM A;  4MHE A;  3GO5 A;  1QWY A;  2JA5 G;  2Z6K C;  4FF4 A;  2K5N A;  2CW0 C;  2JP1 A;  1PRT D;  2E76 C;  1SFO H;  1SN8 A;  4F88 A;  5M5W H;  5BR8 L;  4KTA A;  2E2I H;  3UE1 A;  3KF8 B;  1H9R A;  4LF9 Q;  4B3T Q;  5FLX L;  3T1H Q;  2LMC B;  1OXU A;  2Z4H A;  2UXD Q;  1SYE A;  2EYL A;  4JOI C;  5EPL A;  5M3M B;  1D5X C;  4J15 A;  4HTH A;  1JT8 A;  4JI5 Q;  5M3F B;  4A3G H;  2KED A;  2GVB A;  1GOZ A;  1YNJ D;  1JE5 A;  5JJZ A;  4LF5 Q;  2PPB C;  3HEJ A;  4XT3 B;  4QIW E;  1BUV T;  5A2Q E;  4KY7 A;  5IYB G;  2L11 A;  1EWC A;  4DAY A;  4EQP A;  3RN2 A;  1CT1 D;  3RMH A;  2O5J C;  2PZU A;  5LHY 1;  1EZ8 A;  1VQJ A;  2RHS B;  3VR2 A;  2WB1 B;  2PZW A;  1YIJ A;  1C0A A;  5EAY A;  3S9W A;  3AFQ A;  2VUM G;  5KYL A;  1VQP A;  4JI8 L;  3FKI G;  1F9P A;  5IT9 c;  4DR2 L;  4X65 L;  2DGY A;  4J8Q A;  4BWG B;  1H95 A;  2I46 A;  4DUY L;  5JPN C;  1X3F A;  1UE1 A;  2RCF A;  4JG2 A;  3M7N A;  1NNX A;  4DN4 M;  1ASY A;  1SNP A;  1B4O A;  3T51 B;  2B2V A;  1QVF A;  3S1M H;  3H94 A;  1BVS A;  2B2Y A;  3GP7 A;  2F0O A;  3PUY A;  3UI2 A;  4HJ9 A;  3CCE A;  5C0X J;  4OEL B;  5AJ3 L;  3I55 A;  1L1O B;  2HT1 A;  3I4M G;  1E1T A;  1X54 A;  4OO1 I;  2I5M X;  1IW7 D;  3I4O A;  5BR8 Q;  1TS2 A;  2FXQ A;  4A3C G;  3E0E A;  2IX3 A;  2E5L L;  1M8A A;  2SNS A;  4PMW A;  4AH6 A;  2LSS A;  4X64 Q;  4RKL A;  4CJ2 C;  5IGD A;  1TWA H;  4CKB A;  4LUO A;  1EY6 A;  2O5I C;  1JC7 A;  3GTJ H;  2JJQ A;  4MTK A;  1J9O A;  2X6G A;  2WAQ E;  4JI1 Q;  5EPJ A;  3HKZ B;  4OGQ C;  2GN5 A;  4KD4 A;  2KCN A;  1LTR D;  3ZYY X;  1HA5 A;  3A74 A;  3D8G A;  5C4Z A;  2Y0S B;  3E5S A;  1F77 A;  4UHV A;  1NMG A;  3J80 E;  4FDB A;  4QGU A;  4YIJ A;  4NB3 A;  3G6E A;  3TRE A;  4NPS A;  4C3J H;  3FPP A;  5IGC A;  1NR2 A;  3VR6 A;  4WJ3 M;  1U4R A;  1I4P A;  1NMF A;  4Q0F A;  1CHQ D;  1VQB A;  3H0G B;  2ASB A;  1LAC A;  3MAQ A;  5GAE C;  1PVO A;  3WDN A;  2GVA A;  3HOU B;  4BY1 B;  5FLM G;  2IJ0 A;  4C3H B;  2OF1 A;  4LK1 C;  1H9K A;  3S1N B;  1QE6 A;  2NTT A;  4WRD A;  4K8J A;  4Y7N B;  2L4N A;  4N9P A;  1I4G A;  1ET6 A;  3CC7 A;  3PO3 G;  1A15 A;  2R93 B;  1LO5 D;  3J7A F;  2PYK A;  1WD0 A;  4H44 C;  3K7U C;  2RSN A;  2E2H H;  5GAG C;  2ZXR A;  1EIY B;  4OXP A;  2E5L Q;  2KCC A;  5JJK A;  1AE3 A;  4KKT A;  2DN8 A;  2KCM A;  3DWQ A;  4FF1 A;  1PFB A;  4IUU A;  1PV4 A;  1B7Y B;  2O2L D;  3C1F A;  4A3L G;  3MXN B;  2QEX A;  1J5E L;  1TWH B;  3TDQ A;  5M5Y B;  2CQO A;  3TP8 A;  2VNU D;  2WB1 E;  3KBX A;  3A7A B;  5C44 B;  3SK6 A;  1KC8 C;  4P2C B;  3TS0 A;  1AW7 A;  4FO2 A;  1PTO F;  1YHB A;  5FO8 B;  4A3D G;  3SEB A;  1FL0 A;  3HP3 A;  4BXX H;  2NVY H;  3J81 i;  3SK5 A;  5T1G A;  4HSP A;  2BA1 A;  1K3R A;  3UDG A;  3J81 c;  3ND9 A;  1R9T H;  4HMJ A;  4GKK L;  4BBR G;  2SOB A;  2F0H A;  2F0E A;  5C0X I;  4HJ7 A;  1KQS A;  2A68 D;  2AMC B;  1TWF H;  1SFO B;  1AN8 A;  4R9W A;  5I6W A;  2UUC Q;  5M5W B;  1X65 A;  2E2I B;  1EEI D;  1SMY C;  3CRL C;  1LTL A;  1L0Y B;  1N33 L;  3F2D A;  4X3U A;  4K6D A;  2EXZ A;  1SXT A;  1RHP A;  1OXT A;  1XNR L;  4A3M H;  1BOS A;  2NN6 I;  3CXC A;  4H13 C;  1QCB D;  3KLS A;  3D31 A;  3ERS X;  4A3G B;  1Q12 A;  1C48 A;  2PZT A;  2B8F A;  2NUC A;  2WFW A;  2B2W A;  2L55 A;  5ISR A;  4B3S L;  4C3I G;  4RGO S;  4OWX B;  4HIM A;  3HKZ E;  1X3E A;  1EWI A;  3HOX H;  3QG1 A;  1PZK D;  1VQD A;  2DJF C;  5K36 H;  3KDF A;  5C5L A;  2DY8 A;  1T5E A;  4N8F A;  2N88 A;  3E9H A;  1KXL A;  2CH4 W;  3P20 A;  1BR9 A;  1J5E Q;  2Q2T A;  3A55 A;  3IRB A;  1OXV A;  3GTP H;  3MEF A;  5GRO A;  2FFK B;  2NWG A;  3U4Z A;  3S24 A;  4A93 H;  1AH9 A;  1NSN S;  3S1M B;  3CCQ A;  2D5D A;  4V19 0;  2B3G A;  2NZ1 D;  1LTA D;  3CP0 A;  4OWT B;  1VF7 A;  3MHB A;  4IN3 A;  4GKK Q;  2BDN A;  4QY7 A;  2NB0 A;  3BG3 A;  4GNX C;  2CQA A;  1SE4 A;  2NVQ H;  4H0L C;  2PW7 A;  2WAQ G;  3OIP A;  4NXN L;  1JJC B;  2XVS A;  1L2F A;  3BJU A;  1N33 Q;  3VYU A;  5CV6 A;  3F2B A;  3MTS A;  1ICW A;  3CCM A;  1I6H H;  2UU9 L;  1QZG A;  4ZAI A;  1TWA B;  4AYB B;  5IT9 E;  3GTJ B;  2F0U A;  1WVL A;  1K0S A;  2B2V C;  3FRP B;  4DU9 A;  5C5M A;  3EVQ A;  5GQO A;  3I7F A;  2B2U A;  3MXU A;  2B2Y C;  3KF8 A;  1Q3L A;  1BBW A;  4DUZ L;  5KIX A;  2OTJ A;  4RHR A;  2IWH A;  1GXD C;  1MD2 D;  1QJO A;  4I7Z C;  1XTC D;  3PO2 G;  1C8C A;  4U67 3;  1XPO A;  4G57 A;  4HIO A;  1Z47 A;  3CCS A;  5KRU A;  1XMO L;  4PNY A;  4DR4 L;  3BDC A;  4GNX B;  1X56 A;  3ICE A;  4C3J B;  1VQE A;  5G3L D;  2E74 C;  2H4O A;  3T4A C;  5E3F A;  4LFB L;  2KUM A;  3GV6 A;  5J22 A;  1PMR A;  1FGB D;  2HCI A;  1EQV A;  4F8M A;  1CKO A;  4OO1 G;  1D2B A;  1J8I A;  5IYD H;  2Z6K A;  2LXK A;  2PNR C;  4XIG S;  5H1S E;  2O4X A;  3OWE B;  4R8N A;  3A56 A;  4A3B H;  1WD1 A;  4RGM A;  1I6V C;  5JVH 3;  5JJL A;  2EJG C;  1JWS D;  1IKL A;  3C46 A;  4NP5 A;  4DR7 L;  3I70 A;  4KMU C;  4JOI A;  3OMC A;  2YTY A;  2AHO B;  2E2D C;  2B8G A;  3K5L A;  2E2H B;  1KD1 C;  1EOT A;  2MO0 A;  3J7A 5;  1EYD A;  4IFD J;  4RCN A;  1JE4 A;  4POG A;  3CF5 A;  2EY5 A;  3RZD H;  3K5M A;  3R8B A;  1BCP C;  1FNU A;  2WB1 G;  1T5X D;  1FYC A;  1L1O A;  4H7B A;  5JJI A;  3DEO A;  3DUZ A;  2WV6 D;  1EZ6 A;  5C3E H;  2H5X A;  2BDO A;  5FO9 B;  4HID A;  1STH A;  3Q6S A;  3ULL A;  1IBM L;  2DNE A;  3D3R A;  2XNA C;  1E1O A;  1I4Q A;  4TRD A;  4MN3 A;  2OTL A;  1DZ1 A;  2ZXO A;  4JK1 C;  2VQF L;  1O78 A;  1YIT A;  3EBE A;  1W2B A;  5I2Y A;  2J0T D;  5F2D A;  2X69 A;  2NVY B;  3TQY A;  5M9O A;  2LKV A;  1XMO Q;  1YEZ A;  4FVM A;  1R9T B;  1IBL L;  5ELF A;  3J80 L;  4QB4 A;  2AWO A;  1HNZ L;  3CCL A;  1TWF B;  1K28 A;  4LFB Q;  2F0D A;  1LT5 D;  3NXW A;  3S17 H;  2BE5 C;  3NE5 B;  2KBN A;  2L12 A;  1BDO A;  3M9B A;  1BQQ T;  1BCP B;  2F0L A;  2ZJQ A;  2MHV A;  1EY5 A;  4A3M B;  5IGB A;  1DOL A;  1DGS A;  3S16 H;  3W2D A;  4JBJ A;  3L2P A;  1ENF A;  3HKZ G;  3I2Z A;  4JC0 A;  4F7X A;  1TVX A;  3NK9 A;  4RA8 A;  4DR7 Q;  4CHT B;  3FDT A;  5GAH C;  4ALP A;  4GLA C;  2R7D A;  1QOH A;  3J81 E;  5D3I B;  1EYC A;  5EGT A;  1JCK B;  3J7Z C;  1JMC A;  4XQQ A;  4B08 A;  3U4V A;  4DAP A;  3CPW A;  3HOX B;  1B44 D;  2VZA A;  3Q0A A;  3TN2 A;  5C3W A;  3TP6 A;  4CKC A;  3H3V I;  1YNN C;  5COY A;  2JA6 G;  1KDC A;  1RTN A;  1YJN A;  3KJP A;  3R3O A;  2SNM A;  2K01 A;  1IBM Q;  2FMM A;  3KFU A;  3Q23 A;  3GTQ H;  2A6H C;  2N49 A;  3JAM i;  4OL7 A;  3GTP B;  4BY1 G;  1NTG A;  2F0M A;  3JAM c;  3SK4 A;  3I56 A;  2JA8 G;  1Z7T A;  4A93 B;  4DV2 Q;  2GA4 B;  2VY3 A;  3IFT A;  1Q7Y C;  3F2C A;  2A6E C;  3MXN A;  1VQK A;  2NN6 G;  2F4V L;  4U68 A;  5CGK A;  4BY7 H;  3VYR A;  2UUA L;  1IBL Q;  4TSS A;  3OTO L;  4XQJ A;  4X66 L;  2R93 G;  1F9S A;  5FK9 C;  3A5Z B;  1B3A A;  2NVQ B;  1Y1V H;  4LWC A;  3WWV A;  1WOC A;  2XGT A;  1IKM A;  1CQF A;  3DM3 A;  1STB A;  3RLF A;  4DAV A;  2VXW A;  3R2I A;  2JEA I;  1I94 L;  2XRQ D;  1XPU A;  4IFD I;  4XXE A;  1I6H B;  1EQQ A;  5D65 A;  2XIW A;  1YHQ A;  2QCP X;  1S5D D;  4QQB X;  1N36 L;  1SBB B;  3D4W A;  1HTL D;  1HTP A;  5JEA H;  1EY0 A;  2HQL A;  3OYY A;  5DAU A;  1VQO A;  1LT4 D;  3AQQ A;  2HDM A;  4PQX A;  5C44 G;  4QL5 A;  1XMQ L;  3CD6 A;  4R4I A;  2F0Q A;  1STA A;  2MNA A;  4A3K B;  2QIL A;  2HCC A;  3K7A H;  3VA7 A;  1G6Z A;  5K5P A;  1WTV A;  1S3O A;  2Z1C A;  3QWN A;  3A8K E;  1LT6 D;  2ALY B;  2I07 B;  1PHJ A;  1EFI D;  1PA6 A;  5TSS A;  2K5D A;  1ENA A;  1DOM A;  2MJ8 A;  4UDU C;  1UEA B;  1V1O A;  3ULP A;  2D0O A;  2G5D A; 
#chains in the Genus database with same CATH homology
 1DYQ A;  3D4D A;  4K14 A;  2JE6 I;  3TP5 A;  4ZLT F;  3QIA A;  3WOE A;  4A3B B;  2BOS A;  3NTK A;  5I2X A;  4PV1 C;  2A69 C;  4GZY C;  2K33 A;  1G8Z D;  1HQM C;  1B1Z A;  4ZKB B;  4KI0 A;  5KNB A;  3EA6 A;  5CV7 A;  3T16 A;  3HZX A;  2ZT9 C;  4DGZ A;  2F0W A;  2KHS A;  3RZD B;  2RDH A;  4HR7 B;  1LTI D;  3LWU A;  2TMP A;  3HS0 C;  2AUJ D;  3ONA B;  1HXY D;  1WTO A;  5C3E B;  1ILQ A;  2PW5 A;  2K03 A;  3A8I E;  3MVV A;  2TSS A;  4G7H C;  3PUW A;  2MPM A;  3L3O C;  2A73 B;  1EEF D;  1D1K A;  1Y69 U;  3RUZ A;  1MSG A;  1WTP A;  1KLG D;  5I6Y A;  5IIF A;  3S17 B;  3L7Z C;  1CI3 M;  3SK8 A;  1AFP A;  4QUC A;  3CU7 A;  1A3V A;  3I90 A;  2XWJ B;  4K2K A;  3T56 B;  3DM1 A;  5JPM C;  4HCE A;  1UUP A;  1NCV A;  4DA2 A;  3G6J B;  2J7Z A;  3SR1 A;  3VR3 A;  3R93 A;  1HQR D;  4ABN A;  1ENC A;  4DF7 A;  3GV3 A;  1EIG A;  5KND A;  3L9A X;  2JEB I;  4CKE A;  2QEJ C;  1GUN A;  1TR5 A;  3LWE A;  1MI2 A;  3I73 A;  2JXM B;  4ZRZ A;  5CYU A;  4OHJ A;  1PZJ D;  1IYV A;  3GTQ B;  4RKB A;  1BBX C;  1KDB A;  3T53 B;  3NP8 A;  1GUT A;  1PTO D;  1SMY D;  1HHV A;  2ICI A;  4HAE A;  4C56 C;  4BY7 B;  4KY6 A;  5EKI A;  2XWB B;  4K6L A;  1WTW A;  1K8M A;  2F1M A;  3BVG A;  1Y1V B;  3TZD A;  3MFY A;  1WTR A;  1D5Z C;  1TU2 B;  1XXG A;  1MGS A;  1SNO A;  1TS5 A;  2WAC A;  4FP5 D;  1DON A;  3MZ5 A;  1D6E C;  1JWU D;  3JAM E;  1ZEQ X;  1CM9 A;  4IUR A;  3OWF A;  2AQ1 B;  4L6T B;  3U9S A;  1EY8 A;  1EWH A;  1G29 1;  4OIK A;  3K7A B;  3A54 A;  3AB9 A;  2RKS A;  3J81 L;  3VR5 A;  1G2S A;  1CQV A;  1DJR D;  4ZUI A;  1SNM A;  4FYD A;  1SNC A;  4LJZ C;  2IW3 A;  4KN7 C;  1SE3 A;  2FIN B;  1EYA A;  2XN9 C;  3X3M A;  3P7J A;  1DD2 A;  2WII B;  3PUZ A;  1QNK A;  3PUV A;  4IFD G;  4KN4 C;  1SYF A;  4IUN A;  1HUN A;  1PRT B;  4O42 A;  1D1I A;  4HMI A;  5LL6 X;  3HRZ C;  5EBC A;  4HSV A;  1R4Q B;  1Y1W B;  1I4X A;  1EY4 A;  5JAV A;  1LTT D;  2ID0 A;  2VB2 X;  1F9Q A;  3CQZ B;  1ESF A;  5EKK A;  5IGE A;  5C4H A;  2KJX A;  1BXT A;  5J1Z A;  3RD4 A;  1GJX A;  5HGT A;  2F4I A;  1SE2 A;  5I4D A;  1JOR A;  4DFA A;  3I4N B;  4X3S A;  2D62 A;  3O13 A;  1IW7 C;  1C4Q A;  1JWM D;  1ET9 A;  2RA4 A;  1SAP A;  1JR0 D;  2F3W A;  2F0T A;  4ID6 A;  4XYO A;  5CV8 A;  5IGF A;  1U4L A;  2NYZ D;  5KEE A;  4N9T A;  2MUY A;  3HG9 A;  2R7Z B;  2C5C A;  1A3T A;  3KUP A;  4IQZ A;  3NBI A;  4WJW A;  3QB3 A;  2A5H A;  3A8J E;  3VR4 A;  1RCV D;  3OMG A;  3V05 A;  3GTM B;  1U4M A;  2B39 A;  4A3I B;  3I91 A;  4CJ1 B;  1PDQ A;  3R2T A;  5M5X B;  4KHV A;  4KD3 A;  1JIC A;  1CK1 A;  3NPP A;  1ZYR C;  5KYI A;  3CHB D;  4JBW A;  1GHJ A;  1V8Q A;  2OXP A;  2F0G A;  4IUV A;  4KKS A;  5CR3 A;  2E75 C;  4XT1 B;  1EU3 A;  1AP0 A;  2B63 B;  3DXJ C;  5A2Q L;  2VUM B;  1CHP D;  2EYF A;  3FKI B;  2AQ2 B;  1KNE A;  5FLX E;  3N52 A;  3HOW B;  4R8I A;  1PZI D;  5JVG 3;  1B53 A;  1TKW B;  4HCS A;  2LFN A;  3QOL A;  2K32 A;  1TWG B;  3NQI A;  4HED A;  2A68 C;  4IUP A;  3TSS A;  5A35 A;  2Z4I A;  1SNQ A;  3I4M B;  1BCP F;  2AQ3 B;  1GHK A;  4RGT A;  4IAL A;  3ERQ A;  4NDX A;  3IL8 A;  4G7O C;  4E6I A;  2RQX A;  1STG A;  1AZP A;  1R4P B;  4J1M A;  2EDG A;  2M00 A;  3MEH A;  2FHT A;  3OSO A;  1WTX A;  3BS1 A;  3WOF A;  2NBF A;  1LV9 A;  5EKL A;  4M8A A;  4FF2 A;  1MBY A;  4Z9C B;  5CV9 A;  1EY9 A;  1SEB D;  4EQN A;  2DY7 A;  4V0B A;  2IT1 A;  2IL8 A;  3NWS A;  4NMZ A;  1W6J A;  3PV0 A;  4RGN A;  2EYJ A;  4RHS A;  3IKJ A;  1F2L A;  1FNV A;  2RDF A;  4B9X A;  4OO1 H;  4ME5 A;  4DK1 A;  1UAP A;  3OHX C;  3DMU A;  1GUG A;  3M4Y A;  2D9U A;  3D4R A;  1F9R A;  4C1N K;  3JAM L;  1RTO A;  2PMZ B;  1LTS D;  2X6L A;  4K8I A;  1B50 A;  1PFN A;  1TII D;  1A2U A;  4XYQ A;  2B2T C;  2EYM A;  5DNF A;  1FNW A;  5JOB A;  2G9H D;  2N55 A;  2EYH A;  4PMC A;  1G2T A;  5IOC A;  1U4P A;  5ELC A;  3S1Q B;  2JA7 B;  5JEA G;  2CW0 D;  2NVT B;  1QG7 A;  3PIP 3;  3SDZ A;  2KQ3 A;  4C3H G;  4DXF A;  1LTB D;  3W3A A;  5BN5 A;  1TT2 A;  4BA2 I;  2D2C C;  5EPK A;  1E2Z A;  2K1B A;  3TBI B;  1LT3 D;  1TQO A;  4G7Z C;  5EJW A;  3OW7 A;  3M4O B;  5E4X A;  4QIW B;  1CZW A;  1OO9 B;  3MWY W;  2KA7 A;  2YYZ A;  3KBG A;  3GQB A;  3IAY A;  1EL0 A;  2F0K A;  1STE A;  3EFX D;  2OT2 A;  2KOL A;  3BDO A;  3I4L A;  4C2M B;  5C0X H;  3QOJ A;  2DNC A;  3GTO B;  3EJI A;  4EVO A;  5ELE A;  2K5Q A;  5KNC A;  3J7A V;  1G91 A;  2K04 A;  2NN6 H;  3KK7 A;  1EY7 A;  5IOD A;  1DCZ A;  1VCI A;  3TP7 A;  2K7V A;  4KV6 A;  2Z8L A;  1SYB A;  1ILP A;  3RZO B;  2L1B A;  3I8Z A;  2EY6 A;  2WAQ B;  3NSW A;  1S5C D;  2Q8T A;  1Q8I A;  2R6G A;  4WOR A;  1SSO A;  4LAA A;  5LL6 S;  5AFW A;  2FMC A;  3VYS A;  1BF4 A;  1U9R A;  1QIL A;  1OXX K;  2F0F A;  1JOK A;  1SJE D;  4XQN A;  2QF7 A;  1TWC B;  5IT9 L;  1HUM A;  1WTQ A;  3PO2 B;  2QDB A;  4ZKC B;  4F87 A;  5C6A A;  4QUF A;  2NTS A;  4KKU A;  2R3Z A;  2EVB A;  4ULL A;  1MSH A;  4BA1 I;  2E2J B;  2PQE A;  2L5T A;  1NR4 A;  4ZYS A;  4DNT B;  3P75 A;  1E2V A;  2C9O A;  5DM6 3;  1JOO A;  1CA6 A;  1SYG A;  3NTI A;  3H09 A;  4ZUJ A;  5COR A;  1BO0 A;  2IX0 A;  4IUQ A;  3OIQ A;  3C1E A;  1AEX A;  3SE0 A;  4XDX A;  3S16 B;  1TS4 A;  1IYU A;  2F0N A;  4J6H A;  1A6X A;  3OPO A;  1PXU A;  5T1I A;  2RVL A;  1II3 A;  4K2L A;  3C2P A;  1VF5 C;  5DEH A;  2Q8R E;  2MP1 A;  3SVM A;  1PTO H;  5IGG A;  3KLR A;  4C3J G;  1EIH A;  1HA6 A;  2EPB A;  5JEA J;  3K0Y A;  1SDF A;  4X3T A;  3I3C A;  1ZXT A;  4TKO B;  1HRJ A;  5CMD A;  1KDA A;  3NHH A;  4CGY B;  1NUC A;  2R61 A;  1Q90 A;  1V1P B;  2L0C A;  2F0S A;  2EY1 A;  2PCF B;  2KEE A;  3MXG A;  5EBD A;  5CBA E;  3NQT A;  5ELD A;  2EJF C;  3P1H A;  2EZV A;  4KK7 A;  3T13 A;  1PRT F;  4NW2 A;  3OOC A;  3HOY B;  4IZ8 A;  4XTC S;  1HFN A;  3CRK C;  1QNU A;  4I65 A;  4DK0 A;  1VMP A;  5BN3 A;  1GUO A;  1PRT C;  1TY2 A;  2EYP A;  3GTK B;  2RSO A;  1X3P A;  4X3K A;  1LLR D;  4K5W A;  3GD7 A;  1Y8P B;  1LAB A;  4RCO A;  1D5M C;  2K05 A;  1F2M A;  4KJO A;  1FD7 D;  4BS9 A;  2MGS A;  1X3Q A;  2JA6 B;  3VYT A;  1Y8O B;  5E1F A;  1TY0 A;  3KLS X;  3K59 A;  2F0J A;  1GUW A;  1YNJ C;  1NAP A;  5C4J B;  3A7L A;  2JA8 B;  3DWP A;  2L9H A;  1I50 B;  4CJ0 B;  2ZXP A;  1VMC A;  4FF3 A;  3MXP A;  3V96 A;  3MFG A;  3I72 A;  2BA0 A;  1O80 A;  2JYO A;  3S2D B;  1ZYR D;  2CVR A;  1S5F D;  4ILW A;  2F0V A;  2B2T A;  2HUG A;  3PIO 3;  1QB5 D;  4UAI A;  4RH6 A;  5K36 G;  2XSC A;  1DM0 B;  3FEW X;  3HGB A;  5I9P A;  2IPK D;  1H9S B;  1SND A;  3H91 A;  4EGV A;  3GTL B;  1KAB A;  4RAU C;  4RWS C;  4TQU S;  3BVM A;  4FNF A;  3K58 A;  1F2Z A;  3IFD A;  1KTK A;  4KJN A;  4IUT A;  3S14 B;  4MIU A;  1PTO C;  4Q5V A;  2NVX B;  3SXH A;  3HOZ B;  1L0X B;  4IFD H;  2RDG A;  1UNS A;  3NBH A;  3C3L A;  1AZQ A;  1RF2 D;  3K57 A;  1Q1B A;  1KNA A;  5CV4 A;  3AU7 A;  1BCP D;  5C4X B;  2F0I A;  2SDF A;  3AMU A;  3S2H B;  1B9N A;  4ZK9 B;  2JA5 B;  3M85 A;  3LX0 A;  4A3F B;  1S4Z A;  1WCM B;  1PTO B;  3K5O A;  5FKA C;  2OEO A;  3NTH A;  3S15 B;  2HQE A;  1EU4 A;  3NWT A;  1W6K A;  3K6O A;  1JB3 A;  5D14 A;  4K5X A;  4RFB A;  3BYT B;  1CFM A;  4S3S A;  3SHL A;  1K83 B;  2YU9 B;  3QO2 A;  2BE5 D;  4PMB A;  2EE1 A;  2J4X A;  3ND8 A;  3D6W A;  2EOT A;  4QCL A;  5CBE E;  1ML0 D;  4L63 B;  3U9O A;  4A3J B;  4K5V A;  2ICE C;  5J39 A;  2QKI C;  1CZG A;  3MC0 B;  3N6R A;  3PMF A;  3S1R B;  1XYI A;  5FO7 B;  3NUC A;  3VA5 A;  1KAA A;  4EQO A;  5I9O A;  5ELB A;  4G4K A;  3DWA A;  1CA5 A;  1YNN D;  1DOK A;  3H6M A;  1VDZ A;  1IHZ A;  2A6H D;  4O1N A;  2KVM A;  3E6Z X;  4A3E B;  3H3V C;  2BCO A;  2F0P A;  2A6E D;  1EQT A;  3BZD B;  5KGU A;  4OIJ A;  1PYW D;  1V43 A;  3M7G A;  2G9D A;  4WFN 3;  5NUC A;  2FJ2 A;  4FXK C;  2F03 A;  3BYY B;  3J7Y W;  1I4H A;  5BN4 A;  2H1E A;  1V1P A;  2ENB A;  2CHB D;  3D6C A;  4DXG A;  1A2T A;  1O7Y A;  1B9M A;  3DEP A;  1XX8 A;  3FVQ A;  2JSO A;  3TZU A;  1HCZ A;  1K8O A;  1OXS C;  5EQ0 A;  4KY5 A;  3Q24 A;  1SJH D;  2KEC A;  1LTG D;  1H9M A;  2EY2 A;  3PO3 B;  4QMG A;  2LY7 A;  1ESR A;  1KLU D;  1Y8N B;  2SEB D;  5E4W C;  5G3L F;  1S5E D;  2A69 D;  1BNZ A;  4CBV A;  5C3X A;  1JOQ A;  3M3Y B;  1ZKO A;  3QJY A;  3LNN A;  1HPC A;  1O7Z A;  1XWE A;  3PUX A;  4DNR B;  1HFG A;  2WP8 J;  1E0B A;  4A3D B;  1FR3 A;  3E0J A;  5DM7 3;  4L8J A;  3ERO A;  2EYO A;  3F2U A;  4BBR B;  4QF4 A;  2LS0 1;  5CC4 A;  5C0X G;  2M2L A;  3G7L A;  3K5N A;  1O7L A;  1RDP D;  3BVZ A;  4B9W A;  3CKI B;  1M4V A;  3GTG B;  4M1U B;  4ZQ3 A;  4HN7 A;  2B2W C;  1Q1E A;  5FOB B;  1RJT A;  1E2W A;  4C1N I;  1TS3 A;  4FXD A;  1B2T A;  1ONL A;  4C3I B;  1H9S A;  3HOV B;  5CV5 A;  2M9V A;  2AWN A;  1S5B D;  3EQL C;  2V4D A;  1IL8 A;  2A74 C;  1SYD A;  2AUK A;  3Q22 A;  4BBS B;  2HDL A;  1A3U A;  1H9J A;  1I4R A;  2IX1 A;  2WKC A;  1STY A;  3MA2 B;  5HUR A;  1GUS A;  3FMC A;  4LMQ D;  2K6A A;  2WKD A;  2K28 A;  3X3N A;  2EJM A;  1JQY D;  2K5W A;  2RBM A;  2XRS D;  1PFM A;  4NKL A;  2B2U C;  4FXG C;  1Z6H A;  3FPU B;  1SYC A;  1DXM A;  1ROD A;  3ITP A;  1PLF A;  3URY A;  2R92 B;  4KHZ A;  1RD9 D;  2F3V A;  2WIN B;  5D3D A;  2PO4 A;  3V2T A;  2VB3 X;  1F2Y A;  1X32 A;  1RKN A;  3BDL A;  1I3Q B;  3TME A;  1STN A;  3DHQ A;  4ODG A;  2Q8I B;  1CTM A;  4MHE A;  3GO5 A;  1QWY A;  4FF4 A;  2CW0 C;  2JP1 A;  1PRT D;  2E76 C;  4F88 A;  4KTA A;  1H9R A;  5FLX L;  2LMC B;  1OXU A;  2Z4H A;  1SYE A;  2EYL A;  5EPL A;  5M3M B;  1D5X C;  4HTH A;  5M3F B;  2KED A;  1GOZ A;  1YNJ D;  5JJZ A;  2PPB C;  3HEJ A;  4XT3 B;  1BUV T;  5A2Q E;  4KY7 A;  2L11 A;  1EWC A;  4DAY A;  4EQP A;  1CT1 D;  3RMH A;  2O5J C;  2PZU A;  5LHY 1;  1EZ8 A;  3VR2 A;  2WB1 B;  2PZW A;  3S9W A;  5KYL A;  1F9P A;  4J8Q A;  4BWG B;  2I46 A;  5JPN C;  3M7N A;  4DN4 M;  1SNP A;  1B4O A;  3T51 B;  2B2V A;  3H94 A;  3GP7 A;  2B2Y A;  2F0O A;  3PUY A;  3UI2 A;  5C0X J;  4OO1 I;  1IW7 D;  1TS2 A;  2IX3 A;  1M8A A;  2SNS A;  4PMW A;  4RKL A;  4CJ2 C;  5IGD A;  4CKB A;  2O5I C;  1EY6 A;  1JC7 A;  1J9O A;  2X6G A;  5EPJ A;  3HKZ B;  4OGQ C;  4KD4 A;  2KCN A;  1LTR D;  3ZYY X;  1HA5 A;  3D8G A;  5C4Z A;  2Y0S B;  3E5S A;  1F77 A;  3J80 E;  4YIJ A;  3FPP A;  5IGC A;  1NR2 A;  3VR6 A;  1U4R A;  1I4P A;  4Q0F A;  1CHQ D;  3H0G B;  1LAC A;  3MAQ A;  3WDN A;  3HOU B;  4BY1 B;  2IJ0 A;  4C3H B;  2OF1 A;  4LK1 C;  1H9K A;  3S1N B;  1QE6 A;  2NTT A;  4WRD A;  4K8J A;  4Y7N B;  2L4N A;  4N9P A;  1I4G A;  1ET6 A;  1A15 A;  2R93 B;  1LO5 D;  3J7A F;  2PYK A;  1WD0 A;  4H44 C;  2RSN A;  2ZXR A;  2KCC A;  4KKT A;  2DN8 A;  3DWQ A;  4FF1 A;  1PFB A;  4IUU A;  2O2L D;  3C1F A;  1TWH B;  3TDQ A;  5M5Y B;  3TP8 A;  2VNU D;  3KBX A;  3A7A B;  5C44 B;  3SK6 A;  4P2C B;  1AW7 A;  4FO2 A;  1PTO F;  5FO8 B;  3SEB A;  3HP3 A;  3SK5 A;  5T1G A;  4HSP A;  2BA1 A;  3ND9 A;  4HMJ A;  2SOB A;  2F0H A;  2F0E A;  5C0X I;  2A68 D;  1SFO B;  1AN8 A;  4R9W A;  5I6W A;  5M5W B;  2E2I B;  1EEI D;  1SMY C;  3CRL C;  1L0Y B;  4X3U A;  4K6D A;  2EXZ A;  1SXT A;  1RHP A;  1OXT A;  1BOS A;  2NN6 I;  4H13 C;  1QCB D;  3KLS A;  3D31 A;  4A3G B;  1Q12 A;  1C48 A;  2PZT A;  2B8F A;  2NUC A;  2B2W A;  2L55 A;  5ISR A;  4C3I G;  4RGO S;  3QG1 A;  1PZK D;  5K36 H;  5C5L A;  2DY8 A;  1T5E A;  2N88 A;  3P20 A;  1BR9 A;  3A55 A;  1OXV A;  2FFK B;  2NWG A;  1NSN S;  3S1M B;  2D5D A;  4V19 0;  2NZ1 D;  1LTA D;  1VF7 A;  3MHB A;  4IN3 A;  2BDN A;  2NB0 A;  3BG3 A;  2CQA A;  1SE4 A;  4H0L C;  2PW7 A;  3OIP A;  2XVS A;  3VYU A;  5CV6 A;  3MTS A;  1ICW A;  4ZAI A;  1TWA B;  4AYB B;  5IT9 E;  3GTJ B;  2F0U A;  1WVL A;  2B2V C;  3FRP B;  4DU9 A;  5C5M A;  3EVQ A;  3MXU A;  2B2U A;  2B2Y C;  3KF8 A;  1Q3L A;  5KIX A;  4RHR A;  2IWH A;  1GXD C;  1MD2 D;  1QJO A;  4I7Z C;  1XTC D;  1C8C A;  4U67 3;  4G57 A;  1Z47 A;  5KRU A;  4PNY A;  3BDC A;  4C3J B;  5G3L D;  2E74 C;  2H4O A;  3T4A C;  5E3F A;  2KUM A;  3GV6 A;  5J22 A;  1PMR A;  1FGB D;  2HCI A;  1EQV A;  4F8M A;  4OO1 G;  1D2B A;  1J8I A;  2PNR C;  4XIG S;  2O4X A;  3OWE B;  4R8N A;  3A56 A;  1WD1 A;  4RGM A;  1I6V C;  5JVH 3;  2EJG C;  1JWS D;  1IKL A;  3C46 A;  4NP5 A;  3I70 A;  4KMU C;  3OMC A;  2E2D C;  3K5L A;  2B8G A;  2E2H B;  1EOT A;  1EYD A;  4IFD J;  4RCN A;  1JE4 A;  2EY5 A;  3K5M A;  3R8B A;  1BCP C;  1FNU A;  1T5X D;  1FYC A;  4H7B A;  3DEO A;  3DUZ A;  2WV6 D;  1EZ6 A;  2BDO A;  5FO9 B;  1STH A;  3Q6S A;  2DNE A;  3D3R A;  2XNA C;  1I4Q A;  4TRD A;  4MN3 A;  1DZ1 A;  2ZXO A;  4JK1 C;  1O78 A;  5I2Y A;  2J0T D;  5F2D A;  2X69 A;  2NVY B;  5M9O A;  2LKV A;  4FVM A;  1R9T B;  5ELF A;  3J80 L;  4QB4 A;  2AWO A;  1TWF B;  2F0D A;  1LT5 D;  3NXW A;  2BE5 C;  3NE5 B;  2L12 A;  1BDO A;  1BQQ T;  1BCP B;  2F0L A;  2MHV A;  1EY5 A;  4A3M B;  5IGB A;  1DOL A;  3W2D A;  1ENF A;  4F7X A;  1TVX A;  3NK9 A;  4RA8 A;  4CHT B;  3FDT A;  1QOH A;  3J81 E;  5D3I B;  1EYC A;  5EGT A;  1JCK B;  4XQQ A;  4B08 A;  4DAP A;  3HOX B;  1B44 D;  3Q0A A;  3TN2 A;  5C3W A;  3TP6 A;  4CKC A;  1YNN C;  5COY A;  1KDC A;  1RTN A;  3R3O A;  2SNM A;  2K01 A;  2FMM A;  3Q23 A;  2A6H C;  4OL7 A;  3GTP B;  2F0M A;  3SK4 A;  1Z7T A;  4A93 B;  2GA4 B;  3IFT A;  2A6E C;  3MXN A;  2NN6 G;  4U68 A;  5CGK A;  3VYR A;  4TSS A;  4XQJ A;  1F9S A;  5FK9 C;  1B3A A;  2NVQ B;  1IKM A;  1CQF A;  1STB A;  3RLF A;  4DAV A;  2VXW A;  3R2I A;  2JEA I;  2XRQ D;  4IFD I;  4XXE A;  1I6H B;  5D65 A;  2XIW A;  2QCP X;  1S5D D;  1SBB B;  3D4W A;  1HTL D;  1HTP A;  5JEA H;  1EY0 A;  5DAU A;  1LT4 D;  2HDM A;  4PQX A;  2F0Q A;  1STA A;  4A3K B;  2QIL A;  2HCC A;  3VA7 A;  1G6Z A;  5K5P A;  1WTV A;  2Z1C A;  3QWN A;  3A8K E;  1LT6 D;  2I07 B;  1EFI D;  5TSS A;  2K5D A;  1ENA A;  1DOM A;  2MJ8 A;  4UDU C;  1UEA B;  1V1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...