2SNMA

In a staphylococcal nuclease mutant the side-chain of a lysine replacing valine 66 is fully buried in the hydrophobic core
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMKENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title In a staphylococcal nuclease mutant the side-chain of a lysine replacing valine 66 is fully buried in the hydrophobic core.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 37
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1991-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2snmA00
4KHVA 4RKLA 3DHQA 2KHSA 3EROA 3P1HA 5DAUA 5JAVA 2F3WA 1NSNS 1KDBA 2EYMA 2F0WA 2PW5A 4QMGA 3PMFA 1EY5A 5CV7A 5I9OA 5IGEA 4RKBA 2OEOA 5F2DA 4ZUIA 5NUCA 4KY7A 5IODA 2EYPA 4F7XA 5J1ZA 5KYIA 3EVQA 2F0FA 5J22A 1EY7A 1SYGA 3T13A 2ENBA 4NMZA 2KQ3A 5IIFA 4K8JA 1SNDA 5C3XA 4K5XA 2EY5A 1SYDA 2F0KA 4N9TA 2F0PA 4IUNA 3SK5A 3SR1A 3VA5A 1II3A 3QOJA 3HZXA 4EVOA 2F0MA 2F0SA 2F0IA 4PMCA 5CGKA 5ISRA 3NHHA 5KGUA 1EZ6A 5C5MA 5E3FA 5CC4A 1STHA 3OMCA 5M9OA 2F3VA 2F0EA 2EYOA 2F0QA 2F0DA 3D4WA 5C5LA 2F0LA 1SNPA 5K5PA 2WACA 4PNYA 4NKLA 3OMGA 4H7BA 4J6HA 5I6YA 3MHBA 1EY0A 3SK6A 3NK9A 3TP5A 1SNOA 1KDAA 3V2TA 5CR3A 4YIJA 4B9WA 1STGA 4KY6A 4EQPA 1SYEA 1SNQA 2PW7A 4HTHA 4K2LA 3TP6A 2SOBA 3TMEA 1IHZA 2F0HA 5IGFA 4ZUJA 2F0TA 3OSOA 5CV4A 3U9OA 3S9WA 4ZQ3A 3C1EA 2EYFA 4K2KA 3MEHA 5EKLA 4IZ8A 4F8MA 1EZ8A 3MZ5A 3NQTA 1A3VA 5IGCA 2EYHA 3SK8A 4DGZA 2LKVA 5IGDA 3C1FA 2OXPA 1SNMA 2SNMA 4QF4A 5C4HA 3LX0A 1SYBA 1STAA 5I6WA 2F0UA 2O4XA 5CV9A 2EYLA 4G57A 4K8IA 4NP5A 3TP8A 3RUZA 5CV6A 1JOQA 3ITPA 4B9XA 2NUCA 4K5WA 2QDBA 3NXWA 2EY1A 2M00A 2SNSA 4N9PA 1KDCA 3MVVA 3T16A 5CV8A 5IOCA 2RBMA 5HGTA 5HURA 1ENAA 1EY9A 1TQOA 3D6CA 5E1FA 4DFAA 1SYCA 4ID6A 3QB3A 5KIXA 2F0JA 1TT2A 2F0VA 1NUCA 1F2MA 1F2YA 4QB4A 4KY5A 3BDLA 4K5VA 5EKKA 4IALA 4OL7A 1JORA 3TP7A 3P75A 1AEXA 4KV6A 4HMIA 1A2TA 4NDXA 1EY4A 2HQEA 3R3OA 2PYKA 2PQEA 5CV5A 4I65A 4TRDA 2EY6A 3D4DA 3OWFA 4WRDA 4K14A 1JOOA 1EYDA 4S3SA 2EXZA 5IGGA 5KEEA 3H6MA 4LAAA 5EGTA 2F0GA 1U9RA 1ENCA 2PZWA 1KABA 3EJIA 1F2ZA 5DEHA 4KD3A 3ERQA 4WORA 1JOKA 3BDCA 4KD4A 3SHLA 4HMJA 3SXHA 4DF7A 3DMUA 5C4ZA 5KRUA 5I9PA 5JOBA 2RKSA 4EQNA 1SYFA 5IGBA 1EY8A 4K6DA 1EYAA 2EYJA 2EY2A 4J1MA 1KAAA 3D8GA 3MXPA 1RKNA 4MIUA 3QOLA 2PZTA 2F0NA 4KTAA 1TR5A 5KYLA 2F0OA 4KJNA 1STBA 1EY6A 1STNA 3E5SA 4ME5A 1SNCA 1A2UA 4PMBA 4DU9A 3HEJA 5C3WA 2RDFA 1A3UA 3NUCA 1EQVA 4KJOA 4EQOA 5J39A 4ODGA 3NP8A 4R8NA 2OF1A 3SK4A 1A3TA 4E6IA 1EYCA 1STYA 5C6AA 2PZUA
chains in the Genus database with same CATH superfamily
1I4XA 4P74A 2XN9C 3BVMA 5ELEA 1LT3D 4JI6L 4QMGA 1Q7YC 1BKBA 1ZYRC 2EJFC 2PO4A 4G7ZC 2EYPA 2OT2A 1WJJA 1T5EA 1X3GA 2F4IA 2X69A 1GVPA 2LMCB 4LF9Q 4LF4L 3K5NA 4IUNA 3QOJA 2MP1A 3NHHA 4BBRG 2TMPA 1FNUA 1STHA 1FNVA 1HHVA 2EYOA 3ER0A 4BS9A 2A73B 2JA9A 1X3QA 3CXCA 4DAVA 2BDOA 3M3YB 1EQTA 2Z6KC 4OO1H 2NVXB 4X62L 1KL9A 1CKOA 2XWBB 3WDNA 3GTOB 4GN4B 4FXKC 4TVAB 1G2TA 3BVGA 4PG3A 2IT1A 5DNFA 2R7ZG 1PH9A 5I6WA 2VQEL 4DNRB 2NYZD 5FOBB 3PO3B 4OONA 1A0IA 3CCQA 2DY7A 3D0FA 2K6AA 2L55A 1BCPC 3I2ZA 4N9PA 1VQ5A 3M9BA 3E3XA 4Y52H 4LFBQ 5EKIA 1CT1D 5CBEE 3K7AH 3K5MA 2AKWB 3E6ZX 3PO2H 2N88A 2B2YC 4K5VA 1YHAA 5FKAC 5GAHC 4IFDJ 3BS1A 1WI5A 4NDXA 4CKCA 2HQEA 4C3HB 5CV5A 1SSOA 3NWSA 1X3FA 3S16B 1YIJA 2B2VC 3IKJA 3NEMA 2OQKA 3GTJH 4LAAA 4DV6Q 1G291 2F0GA 4PMWA 3L0OA 1H9KA 3KLRA 3PF5A 3KJPA 1KAWA 1VQ9A 5ELDA 4DR2L 3GTGB 4MIUA 1PH1A 3T1HL 3HFZB 3QOLA 1QUQB 1XNRL 1TWCH 5C4XB 1F9RA 3S15B 3I4MH 1NR2A 5M3MB 5M3FB 1LLRD 3KDFB 3NP8A 3VYSA 4A3FB 4JVZA 1JT8A 1G2SA 5FLXE 1N8RC 5JAVA 5C44G 5D65A 4ZK9B 4IUQA 4DNTB 1BUVT 1SMYC 4JBWA 1TIID 2MO1A 2VQFL 2E2JB 2ALYB 1QE6A 1AH9A 4F7XA 3GTQB 5J1ZA 3EVQA 3ND8A 4NMZA 1HNWQ 3PUZA 4JC0A 1G91A 3Q23A 4JYAQ 4FXDA 1DOKA 1RD9D 4B08A 4BBSH 2HDLA 4LF6Q 1WOCA 3AYHB 5IYBG 3CCEA 1VQ6A 3H0GG 4DUYQ 4IPCA 2QGQA 1HQMC 4QIWB 1KRTA 1PA6A 2QEJC 5IGFA 3I4NH 1PHJA 3X3MA 2ZJQA 1NNXA 3OW2A 1VQ8A 2A6ED 3MEHA 2CVRA 5IGCA 1LTSD 1A62A 2GVBA 2HT1A 3C1FA 2OXPA 3PUXA 5FLXL 1LV9A 2NVTB 2F0UA 2O4XA 4BY1H 4AH6A 4GOPA 2EYLA 4A3DB 1DOMA 5CV6A 2E76C 2JA7H 1XMOL 3GDEA 1YI2A 4DR3Q 1Q82C 5JVH3 5ELFA 4DR1Q 3MAQA 2BCOA 4LFBL 1EY9A 1PH8A 3QB3A 5JJZA 2Q8TA 1F2MA 2UXBQ 2IJ0A 3CD6A 1NCVA 4C3IG 4JK1C 4WRDA 4OO1G 5LMNW 2QW7A 4BWGB 4MTNA 4DV6L 4XQNA 4X3KA 2B2UA 4NW2A 1EEFD 5DLQE 2AHOB 5C4ZA 3LGJA 3U4ZA 2RKSA 2Z9HA 4EQNA 2PI2A 1TY0A 5EPJA 2NVYB 1K73C 4RCNA 4HSPA 1YNND 4GN3B 2XSCA 1SE8A 3BYTB 4YWKA 1PLFA 4PMBA 2VUMG 1A3UA 4EQOA 3CCSA 3SK4A 1A8VA 3GTPH 3RLOA 2JA5G 3CCRA 1XJVA 1Y8OB 5EAYA 3PO2G 3HP3A 1W6KA 2K05A 1QJOA 1I6HB 5K5PA 5IODA 5F2DA 4BA2I 5HGQA 1R9TB 2ES2A 4YY3Q 1I4QA 1U0LA 2YTXA 4R4IA 3I91A 1HNWL 2EOTA 2BDNA 1YNJD 4A3IH 1WFQA 1W2BA 3SK5A 1I50B 2L0CA 1PH6A 1U4MA 3S1MB 4O42A 3E0JA 2O5IC 4LF6L 2V1CC 3LNNA 1HA6A 1OXTA 4PNYA 1WTWA 2WIIB 3NK9A 4DUYL 2ASBA 1EIYB 1OTCA 3DM1A 5KNDA 1UWVA 4R9WA 3K5OA 2Z6BA 4KI0A 1WTHA 4RGOS 4DKAC 2TSSA 1FL0A 1PTOD 2F03A 4Q5VA 3CPFA 3WOFA 4KHPL 4AIMA 2E2IH 4C2MB 1PRTD 1MBYA 5FO7B 3HOZH 1PH7A 2N55A 4JOIA 4NPSA 2L5TA 4DR3L 3K81C 3DUZA 4WJ3M 3M4OH 2B3GA 2YYZA 3S2HH 5E1FA 4DFAA 3S2DB 1Q1EA 3DWPA 1VQNA 1UEAB 4CKBA 2UXBL 2UUCL 4OL7A 2H5XA 1NMGA 2ZT9C 1Y8NB 4DV0Q 5EQ0A 3AQQA 2K7VA 2ZTDA 1ZYRD 4C3JH 1JJCB 4GZYC 3I4NG 2IX3A 3CMEA 1WD1A 2ID0A 3HGBA 3GO5A 4GKJQ 2R6GA 4LW1A 3UE1A 1PFBA 3D8GA 3T53B 2PZTA 2F0NA 4X6AH 4LUOA 5KYLA 1OXUA 4BY1G 3HKZE 2R93B 1HRJA 1SE2A 4IPHA 1D1KA 4JI4Q 2H1EA 2JA8B 1GJXA 2MNAA 2JA7G 4FNFA 4M8AA 2GA4B 2CW0D 5ELOA 5DAUA 2F52A 2EPBA 1VQIA 3PMFA 3KF8A 1LTGD 1U5KA 1IKLA 2WB1E 4ZUIA 3KBXA 1XPOA 4YY3L 3G7LA 1GUGA 4GOPB 1JE5A 2E2HB 4JG2A 1JB7A 2I5MX 1UNSA 2EVBA 1I4HA 1VF7A 1O7ZA 1TWFB 5ISRA 2JN4A 2Q2TA 2KHIA 1HR0L 1X32A 2WINB 3OMGA 3FKIB 4CJ0B 4HIMA 2NZHA 3WWVA 4B9WA 3VR5A 5CR3A 3JAME 1PH3A 3L7ZC 4HTHA 4PZ8A 2F0HA 2DY8A 4XIGS 2JA6B 4ZLTF 1TWGB 4YWMA 2B29A 3CCMA 4H44C 3I90A 4F8MA 4GNXC 3BDOA 1I4RA 2MGSA 4BY7B 1SJHD 4FDBA 1EIFA 1LM0A 2G5DA 4UPAA 2HIVA 3FP9A 2JEAI 3URYA 4DK3C 2D62A 4A3IG 4POFA 4A3KG 1ENAA 4IURA 4IQZA 5EKKA 4NXNQ 1UAPA 3NE5B 4NXMQ 2B2TC 2AWNA 1N9WA 3HOYG 2R7ZB 2WAQG 2B2YA 2EQSA 4DV0L 5FLXc 1L0WA 3D4DA 3S14B 2JXMB 4JI1Q 1V8QA 4N8X1 1KNEA 2AQ1B 3JAML 4V0BA 5DEHA 3SHLA 3DMUA 1VQKA 1S40A 1LTBD 2KBNA 4K6DA 4RGNA 4A3MH 4LUZA 4GKJL 3OWEB 2Y0SG 1QOHA 1RKNA 3M4QA 2K14A 3OPOA 5IYDH 1OXSC 1U4LA 3E5SA 3HOZG 1HTLD 1EWCA 3F2DA 1TWHH 4JI4L 1YITA 1RIPA 4CJ2C 4LMQD 2XIWA 2ZTEA 3K80C 2JP1A 2OEOA 2XTIA 3RZDH 3I3CA 4GLVB 1VCIA 1R4QB 2F0FA 2NN6H 2RSNA 5C4JB 2FFKB 2ICEC 3J7AF 3R2IA 1SLJA 3IFDA 1II3A 5CGKA 2DJFC 3GP7A 1YZ6A 4C3JG 2YTYA 4A3LH 1Y1WH 3K59A 5C44B 1UE1A 2WACA 1C48A 2IY5B 3I70A 2FXQA 1QNKA 4LFCQ 5CBAE 4QY7A 2MPMA 2Q2UA 1SYEA 1SNQA 1ILQA 2D0PA 4FXGC 2SOBA 4A3EH 1MGSA 3U9OA 1VQAA 4RG1A 3JAMi 1PRTB 5I2XA 2AWOA 1QG7A 4UY8C 3CU7A 4JI0Q 5K36G 3KF6B 3H0GB 5JEAH 3SK8A 4K5WA 1Y69U 3T16A 1YJWA 1HZAA 1WVLA 1IBMQ 5T1GA 4DA2A 2A68D 4X62Q 1SN8A 1TY2A 1NUCA 2A19A 4NXNL 4A3CH 4NXML 1ESFA 1PRTF 5C3EB 4KLKA 2CWPA 1LTLA 3TBIB 1D7QA 3T51B 1BDOA 2K33A 1MIUA 2ZM6L 4R8IA 4JI1L 2RVLA 1Z7TA 2B63B 1U9RA 2GN5A 1OXVA 4PV1C 2VB3X 1KNAA 3KUPA 4O1NA 5JOBA 1PFMA 3I4LA 5M5XH 3Q6SA 4X66Q 5G3LD 1EYAA 2EYJA 4J1MA 1TWAB 3Q22A 2K04A 1WYDA 4JPBW 1X54A 5GADC 4C3IB 4QQBX 1EYCA 2KCTA 4GLAC 1TKWB 2JJQA 2WB1B 3E0EA 2F3WA 1I4GA 3BU2A 3M7NA 2K5NA 2L9HA 4AQYQ 4YCUA 3GTLH 3Q8DA 1BBXC 4P75A 1QCBD 1AFPA 4IFDH 1DM0B 4DR2Q 5EPKA 1EFWA 3GTMB 4K8JA 3GTKH 4A3JH 2F3IA 1K9MC 4A3BH 1K0SA 2VUMB 1X56A 1CKNA 1CKMA 1CZWA 2F0KA 2WV6D 4KN7C 3BZCA 4GN5A 4PMCA 3J81j 1HH2P 5KGUA 5C5MA 1GD7A 2K4KA 3KLSA 2JA5B 2F0QA 3K7AB 2F0LA 1PYSB 1PH5A 3RZOB 3UE0A 3HOUH 1RJTA 3PQIA 5IYDG 2R7FA 4B3TL 2VQFQ 5CMDA 3HS0C 5E4XA 4LFCL 2AUJD 4EQPA 5JEAJ 2SDFA 1J8IA 5IY0A 1SEBD 3TP6A 1PV4A 1IHZA 4RH6A 1S4ZA 3TREA 2EYFA 3G4SA 4OX9Q 5LMNQ 4IZ8A 3ERSX 3CPWA 2LKVA 5IE8A 1SNMA 4EGVA 4WJWA 5IP7G 1KD1C 2N78A 1YHQA 4JI0L 3S1QB 2C9OA 1JR0D 3BZDB 4G57A 3TP8A 2NN6G 3I4OA 2NUCA 3P7JA 4ZAIA 4OHJA 1IBML 1KIXA 1QNUA 1EIHA 4ID6A 3S17H 2CQAA 1L0YB 1B50A 2LXKA 5AJ3L 3S1NB 5A2QL 4A3LG 3FDTA 4N8FA 4DV1Q 1Y1WG 3G6EA 2CWAA 3GQBA 4AYBE 1AE3A 1B4OA 4S3SA 2EXZA 3W1GA 3H6MA 3W3AA 3T1YL 3SDZA 4KMUC 4K0KL 1HNXQ 3RLNA 3BJUA 1F2ZA 5DM63 3CC7A 4A3EG 1XMOQ 3IRBA 3SEBA 4ZRZA 1F2LA 1EY8A 4RCOA 4X66L 1HZ9A 1JMCA 1KTKA 4KTAA 2F0OA 4EQ5A 2IPKD 4QCLA 3KK7A 1AP0A 4DU9A 3BG3A 5JEAG 5HURA 1O78A 1D8LA 4UHVA 3HOXH 2IL8A 3P1HA 4H0LC 2NB0A 2L12A 3VDYA 5KNCA 3NBHA 3JAMc 3IAYA 4AQYL 2R92H 4DR7Q 1PH4A 3CHBD 5GAEC 3OYYA 3NQIA 1B8AA 1XWEA 4OWXB 3V05A 4U673 2EY5A 2F0PA 1EIGA 2RA4A 1BQQT 1M1KC 1VMPA 2F0IA 4IJHA 3H15A 3OMCA 1LTAD 1K3BC 1E2VA 1LT4D 1KHIA 1SAPA 4MTKA 4H7BA 4A93B 3SK6A 1STGA 1EEID 1HXYD 2FMMA 1H9MA 1WCMG 1JICA 3M3YH 2DUDA 4XXEA 1IKMA 1CM9A 2NVXH 3AU7A 4ZQ3A 2KOLA 3C1EA 4OX9L 5LMNL 4RGMA 2UUAL 1EFID 4HIOA 4Q0FA 1IBKQ 3L2PA 1BF4A 3GTOH 1LUZA 1STAA 3KOJA 4GNXA 1K0RA 4IFDG 1TS4A 4A3JG 4A3BG 5HGTA 4JI3Q 3D6CA 4L5SA 4HJ8A 3PO3H 1CK1A 4R4OA 1SYCA 1EOTA 3F2BA 1RHPA 2K28A 3DWAA 4DV1L 3R3OA 4JI8L 1RODA 1N36Q 3M4YA 4MNOA 4TRDA 1IYVA 4B3SL 3A54A 4KHPQ 2B2TA 2IX0A 2GVAA 4KK7A 1PDQA 4PZ6A 5EBCA 4C3HH 1CHPD 3NENA 1ENCA 1MSGA 2PZWA 1KABA 1HNXL 3G6JB 3S16H 2KECA 2PI2E 4A3KB 4XQQA 1QB5D 1GHJA 1VQ4A 5I4DA 1XYIA 5IWAL 1W3SA 4X64L 1R4PB 1DOLA 2FJ2A 2UUCQ 3HOYB 4JCVE 3GTGH 4HIDA 4QB4A 2KUMA 5C4XH 4KHVA 2ZXOA 3EROA 2LSSA 5C0XH 1F9PA 5M3MH 5M3FH 2UUBQ 5G3LF 4A3FH 2PNHA 4XYOA 4DR7L 2AMCB 2FMCA 2Z8LA 4CJ1B 3PSIA 1SYGA 3A5ZB 5C0XI 2E2JH 1VQEA 1G8ZD 4C1NK 2EE1A 3AB9A 1MKHA 2JK8A 1VQCA 3F1ZA 4CGYB 4LF8L 2F0DA 2VB2X 1PZID 3TP5A 4YIJA 1B3AA 1G6PA 3QR8A 3PUVA 1HPCA 1D5ZC 1XPRA 1VQ7A 3HOXG 1HFNA 2HD3A 3CQZB 2EJMA 5IT9E 3HOWB 4IPDA 2K5WA 1KXLA 2BE5D 2AUKA 1KC8C 3H3VH 1IBKL 2SNMA 3S1RB 2R92G 2E75C 2UXDL 1CSPA 1E2ZA 1H9RA 1HR0Q 4B9XA 2HHHL 1GOZA 2E8GA 2B8FA 2NVTH 4TKOB 2QILA 4JI3L 1GXDC 3TDQA 4A3DH 1AN8A 2CH4A 3H3VI 2HQLA 4L6TB 4DV5Q 3I4MG 1PZKD 4AYBB 3E9HA 4P72A 1SE3A 1VQGA 3NTIA 4IALA 3F2UA 3H91A 3NBHB 1N33Q 4KV6A 1GUSA 1A2TA 1X3EA 3KJOA 4RHSA 3L9AX 1SFOB 3DWQA 1N36L 1FGUA 1GHKA 2EY6A 3BZKA 2WKDA 4HSVA 4NB3A 4DXFA 2NWGA 4H02A 4G7OC 4BXXH 1TS2A 4OWTB 3CF5A 4UP8A 2OCEA 1BXTA 4A3GB 1ENFA 3BDCA 3J7A5 4XYQA 5C0XJ 2PNRC 3MWYW 1PFSA 1IBLQ 1AE2A 3ZJYC 3TS0A 3EIVA 5FO8B 4BBSG 5IT9L 1A63A 1TR5A 4QGUA 2B2WC 4LFAL 1IW7C 1SNCA 1A2UA 1PMRA 1EQVA 3DEPA 2NVYH 3I8ZA 4O2DA 4EX5A 4RWSC 2QF7A 2D5DA 3PO3G 2MQHA 5M5YB 2XWJB 2UUBL 1SRUA 1F77A 1V1QA 1SR3A 4IUTA 4KY7A 1B44D 2RHSB 3J80E 3A5UA 1Y1VH 1I3QB 4UAIA 1I6HH 5M5WB 4OIKA 3ULJA 1R9TH 4EVOA 1LO5D 2F0MA 2F0SA 1D6EC 4C56C 3C3LA 4PQXA 3U9SA 1UEBA 3C46A 3QJYA 1I50H 2IW3A 2HCIA 1O7IA 3MXNA 3S1MH 2RDHA 3QWNA 2XGTA 1EY0A 2I46A 1WTXA 2CH4W 2DNCA 3EA6A 1C8CA 2AQ2B 3PIP3 3NTHA 1BR9A 2RCFA 5HY6A 3OHXC 5C4XG 2N49A 3LWUA 1JC7A 1BOSA 2JSOA 3HOVB 5M3MG 5M3FG 2QEXA 4X65Q 5C4HA 2E2DC 4A3FG 1SYBA 4JI2Q 3FPUB 3Q0AA 2I07B 2KHJA 4DAPA 3HKSA 1Z6HA 1BCPD 4OIJA 3UDXA 1IL8A 4C2MH 3HRZC 3J80L 2OTJA 1NY4A 3QIAA 3CAMA 4YHHQ 3EN2A 4DV5L 5KIXA 2J7ZA 1F2YA 2Z6KA 3MA2B 1JQYD 2X6GA 5IP9H 1N33L 3TS2A 3S2DH 2YV5A 3CKIB 4L5TA 2IWHA 4BBRB 1VQFA 3NWTA 2NTSA 5IGGA 5KEEA 3TRZA 3WOEA 2DGYA 1W6JA 2WP8J 3KBGA 4JW0A 3K57A 3EJIA 5JVG3 4IOAA 1EWHA 1K3RA 2E5LQ 3L3OC 1L2FA 3H94A 4MZ9A 1IBLL 1CUKA 1K28A 2NZ1D 3RD4A 1B9NA 1VQPA 1E22A 2YU9B 1STBA 4ME5A 3BYYB 4JI7Q 1E7ZA 2OF1A 3RMHA 4JV5Q 1STYA 4RKLA 2ZM6Q 2YTVA 2R93H 2A6HC 1NSNS 4A3EB 2JA8H 1SMYD 1NMFA 4HJ7A 2PQAA 1I4PA 2B2VA 4FYDA 3MC0B 3OW7A 1D1IA 3X3NA 4IJLA 1XPUA 4P71A 3VR4A 4WFN3 1VDZA 4OELB 2Q2IA 3VA5A 4RAUC 3J80i 3J7YW 4BXXG 1EZ6A 1FNWA 1IXRA 3TEHB 2E2HH 1PVOA 1X3PA 2NZOA 1SNPA 4DR6Q 1TWFH 2RDGA 4RMFA 1RTNA 4IOCA 2X6LA 4K2LA 4DR4Q 1SE4A 2Z4IA 3FKIH 4DAMA 4B3RQ 1ONLA 2F0TA 4LK1C 1XTDA 3DM3A 5CV4A 1X9NA 1GM5A 5EKLA 1FJGQ 5GQOA 1K83B 1KLGD 1A3VA 2J0TD 4XDXA 3MEFA 2MJ8A 2JA6H 4QF4A 4X65L 1V1OA 1TWGH 3LX0A 4A76A 4Y7NB 4JI2L 4L5QA 3J81E 3ULPA 1JOQA 1E0BA 1HUMA 4KKSA 1JE4A 1Y1VG 4BY7H 1H9SA 5IOCA 2EY1A 4UDUC 2UU9Q 4I7ZC 1KDCA 3MVVA 1K8MA 2NVQB 4B3TQ 4CDFC 1NTGA 1CTMA 1KRSA 1WCMB 4HR7B 4YHHL 1QZGA 1RDPD 2OWOA 3GV3A 3AEVA 3BDLA 4QL5A 1PTOB 2F4VL 4J8QA 1HFGA 3G71A 5I2YA 1XMQQ 2IX1A 2E74C 4OWWB 1E2WA 3AMUA 4K14A 1H95A 4TQUS 4HJ5A 3P20A 2R7ZH 2N3SA 4X3SA 1M4VA 2M2LA 3S14H 1MJCA 2E5LL 3W1BA 3PUWA 5J3BA 4DV2L 2EY2A 1PTOF 5BN5A 4CDDC 5AJ3Q 1AZPA 1RCVD 1O7LA 3MXNB 1T5XD 1XTCD 3TSSA 1S5ED 1YNNC 3KF8B 5C3WA 1RF2D 4XTCS 4JI7L 1L1OC 3A8JE 3J81L 3VYRA 1ESRA 3I7FA 5E3FA 4JV5L 1D5MC 1PYWD 1GUTA 2XNAC 3T1YQ 1NE3A 1YNXA 4K0KQ 5I9OA 1T9HA 1JJ2A 3F8TA 4DUZQ 2ZJPA 5NUCA 1DXMA 1SMXA 5LL6X 2A8VA 1M8AA 4FP5D 4HAEA 3K6OA 1FYCA 3PIPA 2RHQB 3PIOA 3ZYYX 2K5DA 5IT9c 2N8NA 1ILPA 5FLMH 3HZXA 1VQHA 5C4JH 1XX8A 4QJFA 1GKHA 4IPGA 4ABNA 3FVQA 1YEZA 5M9OA 3IL8A 2BA1A 2I5HA 4LF7Q 3MTSA 4DR6L 3KLWA 3LWEA 2WAQE 4HCEA 4UP7A 5C44H 3RN2A 3UDIA 1C4QA 3W2DA 4DR4L 4B3RL 3EFXD 2LXJA 1VS0A 3OSOA 3S9WA 4HEDA 3A74A 1C7YA 3ONAB 2R93G 1FJGL 3MZ5A 4R4CA 2Y0SE 2EYHA 4DGZA 2Z0SA 1CFMA 4CDCC 4B3ML 1PRTC 1BCPB 1EOVA 1ASYA 2VY3A 4C1NI 2HUGA 2BOSA 2SEBD 1YJNA 4A3MG 3PO2B 1GO3E 3QO2A 4IO9A 2UU9L 5IYBH 1G6ZA 1TQOA 1B70B 3H0GH 1TT2A 4L63B 3CCUA 3A7LA 4HJAA 1C0AA 1IZ6A 4ZYSA 1IYUA 2QCPX 3W5OA 1AEXA 3KFUA 1MHWC 2PQAB 3FEWX 3VR6A 3GTJB 5H1SE 2PQEA 3A8IE 1XMQL 2UUAQ 3NTKA 1BCPF 1CSQA 3RN5A 4XQJA 2R3ZA 5C3EH 5EJWA 3KYHC 1JB3A 4DXGA 3FKIG 5JJKA 1OO9B 2A74C 4KD4A 4DK6C 1TWCB 4YCWA 3J80c 4JBMA 1XNQQ 2MHVA 3RNUA 4OXPA 3I4MB 1V43A 2B63H 1NAPA 2JA6G 1GUNA 4ZKCB 5EPLA 1NJIC 1EY6A 3HEJA 4JI8Q 1TWAH 4ODGA 2EZVA 4BY7G 4B3SQ 2B2WA 1DCZA 1LYLA 1LTTD 2CW0C 2KHSA 2R61A 4R4TA 4C3IH 5CV7A 2EYMA 2F0WA 3O13A 2L4NA 4DUZL 2K75A 2NTTA 5J22A 1BNZA 2KA7A 1LT5D 3I72A 5E7NA 5IWAQ 3U50C 4X64Q 1CA6A 4BBSB 5IIFA 1VQJA 1EQQA 3K5LA 1JWSD 1FD7D 1H9SB 3SR1A 4OO1I 3J7AV 5CYUA 3GTMH 4IUPA 3CCJA 1B1ZA 2F3VA 2VUMH 4LF7L 3D4WA 5C5LA 1F9QA 2Q8IB 1DONA 2OTLA 2KVMA 1ICFB 3I4NB 1JJGA 1EQRA 2JYOA 2JA5H 1S3OA 4A3CG 2KEEA 2PMZE 5IYCH 3RZOH 1HTPA 2K1BA 2MFIA 1VQBA 4IUVA 4BY1B 1XXGA 2EIFA 4G7HC 2JA7B 5IGDA 1BVSA 1SJED 4LF8Q 2VW9A 1B2TA 1E1OA 4DV7Q 1ZKOA 3UDFA 3U58A 4OGQC 3NXWA 1I94L 2M00A 4APVA 4DV4Q 2RBMA 3S1QH 4KKUA 5FLMG 4FO2A 2BH8A 4F87A 2B8GA 1B3QA 2PCFB 2MUYA 3SVMA 3PCOB 1HZBA 1HUNA 1MSHA 4DN4M 3S1NH 4ILWA 1EYDA 2A6HD 2L1BA 2QKIC 2UXDQ 3STBC 3CP0A 3CW2C 2DNEA 2P5ZX 3V96A 3S24A 3ERQA 2HHHQ 3M7GA 3SXHA 2CQOA 3H09A 1XNQL 3CC4A 3MXGA 2K52A 4RGTA 5A35A 1ET9A 3Q24A 2F1MA 5FK9C 1B53A 1HJPA 4LF9L 4KN4C 3VYUA 3GTPB 1QWYA 2CHBD 4HIKA 3NUCA 3MXUA 1SDFA 4KKTA 1KQSA 2PZUA 4V190 2RSOA 3HOUG 3TZDA 3NPPA 5GROA 1S72A 1TVXA 3A0JA 1CKNB 2K5QA 4A3IB 1JWMD 2JQOA 4XT3B 2KEDA 5L37A 2KQ3A 4P73A 2A1AA 2M9VA 3A8KE 3I56A 5C3XA 2FINB 1SYDA 5C3EG 1PZJD 3E9IA 4LFAQ 4OEMB 2WAQB 3J81c 1UE6A 1HQRD 1E3PA 1QVFA 5JJIA 3S15H 1P8LA 2ICIA 1PH2A 2B63G 1WTQA 2DJGC 5I6YA 3FRPB 3MHBA 2KCMA 3HKZG 2EXDA 1HA5A 2Y0SB 3TMEA 2I5LX 4A93H 2E2IB 5LL6S 4BA1I 3HOZB 4DK0A 1VMCA 3GTQH 1C9OA 2RQXA 1LACA 4QUFA 1TXYA 1UE5A 4XT1B 4YCVA 4R4QA 5FJ8H 2WB1G 3DLLA 4DV7L 3M4OB 3S2HB 2RCNA 5BN4A 2JEBI 3RUZA 2R7DA 2XRSD 2D0OA 4DV4L 2A68C 3SE0A 2F0VA 1NBWA 4CBVA 4KY5A 4FF1A 4GLXA 3P75A 3CCVA 1EY4A 3H3VC 4TSSA 3M85A 5D14A 4C3JB 1UE7A 3TZUA 1JOOA 1K8GA 2A69C 5E4WC 2EJGC 1Y1VB 5IYCG 1O80A 4Z9CB 3C2PA 3NELA 4JBJA 2ZJRA 1AW7A 1BBUA 1SYFA 3OIPA 1KAAA 3MXPA 2VNUD 1SBBB 3OTOQ 1HZCA 4A3KH 4JYAL 4KJNA 4HJ9A 1VQLA 1JORA 4KJOA 5J39A 1Q1BA 1QILA 5C6AA 1U4RA 5BR8Q 1YJ9A 2H4OA 3DHQA 3HOYH 4K6LA 2K5HA 1L1OA 1VQDA 4GS3A 4IUUA 1WTVA 2PW5A 4LWCA 4PZ7A 1STEA 1E1TA 5DM73 1EY7A 4ULLA 1A6XA 3T13A 2ENBA 4HCSA 5LHY1 4K5XA 3AFPA 1Q90A 2MO0A 1J6QA 3R93A 5CC4A 1LABA 2F0EA 4ZCKA 2PMZB 2KJXA 2G9DA 2D9UA 4JBKA 2FHTA 4DR1L 3V2TA 2KENA 5D3IB 1SNOA 2QA4A 4DV3Q 1Q46A 1HNZQ 1ML0D 3NSWA 2CFMA 2BH2A 4LNQA 3U4VA 4GNXB 2K01A 1EZ8A 2ZTCA 3R2TA 3K0YA 5ELCA 4C3HG 1AZQA 1JWUD 3MFYA 1SROA 2K32A 5CV9A 3CQZH 3DXJC 3HOWH 3PF4A 2QDBA 3S1RH 2SNSA 3ULLA 5CV8A 1TS3A 4G4KA 1V1PA 2G9HD 1MI2A 1EWIA 2RF4A 3KF6A 4L5RC 3PIO3 3A7AB 2EDGA 3CMAA 2HCCA 2HIXA 3HG9A 5JPMC 4YWLA 1TS5A 1F9SA 2LS01 1N34Q 2PYKA 5C0XG 2VS1A 4R1JA 3OWFA 2IHFA 1PYBA 4A3MB 1SFOH 1WTPA 1IYJB 4A93G 1RL2A 2Z1CA 5K36H 5I9PA 4CDEC 4LF5Q 3EBEA 1TWHB 3JC66 2Q2HA 3N6RA 5BN3A 4A3GH 1MD2D 3OTOL 4A75A 1I6VC 1FGBD 1CHQD 5FJ8G 4POGA 1STNA 3QG1A 2F4VQ 2RDFA 4U68A 2AQ3B 5D3DA 3RR5A 2C35B 1QVCA 4R8NA 2CCZA 1K8OA 4ZUJA 1Z9FA 2D2CC 2KCNA 2L11A 3PGZA 5BR8L 3RZDB 4F88A 4DR5Q 1UUPA 4WJ4A 1X55A 1Q86C 1EY5A 1J5EQ 4GKKQ 3D6WA 4RHRA 4RKBA 5KYIA 3ICEA 1IL2A 3D31A 2UXCQ 1NR4A 1PXUA 1TU2B 5M5YH 3VA7A 4DV2Q 1CI3M 1VF5C 1SNDA 2J4XA 3CCLA 1Y1WB 4N9TA 3BVZA 3EQLC 5GAGC 4J15A 1Q12A 1I3QH 4H13C 4ZKBB 5M5WH 2JE6I 4DAYA 3D4RA 1CQFA 3A55A 5LMUQ 1CQVA 4A3DG 3B6YA 5EBDA 1DD2A 1KDAA 4DV3L 1SXTA 2OQ0A 3OOCA 1D5XC 4KY6A 1HNZL 1DZ1A 5T1IA 2ATWA 1B9MA 1S5CD 4JI5Q 4M1UB 1ICWA 3UI2A 4RFBA 4MN3A 1CA5A 1I5FA 4K2KA 3VYTA 3CRLC 1EU4A 3NQTA 1MJEA 4GOPC 2XVSA 3PUYA 1WD0A 1GUOA 3STBD 4X3UA 3J7ZC 1DJRD 4NP5A 3HOVH 5FO9B 2ZXRA 1ASZA 1S5DD 3CRKC 1BBWA 2A5HA 1HR0W 1GUWA 4ALPA 1Y8PB 1S5FD 2VZAA 3M4PA 1L1OB 2O2LD 3DEOA 1FVIA 1D2BA 4CKEA 1WTRA 3K7UC 1N34L 1N32Q 2VXWA 2A6EC 1B7YB 2B2UC 3SGIA 1JCKB 2K03A 2XRQD 4CHTB 1CZGA 1FR3A 4B3MQ 1O7YA 1A15A 3I73A 5M5XB 5EGTA 1YHBA 2I0QA 4BBRH 2KCCA 1YVCA 1L0XB 5IP7H 4KD3A 4WORA 1JOKA 4DF7A 4HMJA 2L15A 3N52A 4O0AA 3T56B 4LF5L 3A56A 4DNIA 4UP9A 1VQMA 2BA0A 1Y14B 1K8AC 3KLSX 4P2CB 2IHEA 3HOWG 3RLFA 1BO0A 3GTLB 2QDLA 2NN6I 2YU9H 1X65A 3G48A 3F2CA 4DR5L 4JI6Q 5AFWA 1KDBA 1QZHA 2K50A 5IGEA 1J5EL 3GTKB 3T4AC 1YBYA 4A3JB 4GKKL 3PV0A 4A3BB 2WKCA 3R8BA 2UXCL 4AYBG 5JPNC 4LF4Q 1E24A 1Q8KA 4LJZC 4I7AA 4MHEA 3MFGA 4ME3A 1V9PA 1V1PB 3HOUB 4HN7A 3FMCA 3TQYA 3AFQA 1QUQA 1G51A 2Q8RE 5JJLA 5LMUL 4NKLA 1M90C 1X6OA 1EYGA 1ET6A 4J6HA 4A3GG 3KDFA 2V4DA 3FHWA 1P16A 5IP9G 4X3TA 2LFNA 2PW7A 5KNBA 3FPPA 4JI5L 2C5CA 2CKZB 1ZEQX 4KHZA 4A4IA 1Q8IA 1EUJA 1YNJC 4QIWE 4JOIC 5KRUA 4DK1A 2BE5C 4L8JA 2WFWA 2A69D 2VQEQ 4FF3A 2VL6A 4FVMA 1J9OA 5ELNA 1OXXK 4K8IA 3CC2A 1K83H 4DPGA 3ITPA 3S17B 2NBFA 3ND9A 4FF4A 3NBIA 4FF2A 1U4PA 4RA8A 3HKZB 4Y7NH 3TN2A 3GD7A 3UDGA 1DYQA 3GV6A 2F0JA 2O5JC 3K8AA 3K0XA 3I55A 3TP7A 2NVQH 1KLUD 4HMIA 1WCMH 1PFNA 3OIQA 1ZXTA 3VR2A 1VQOA 1PTOC 4I65A 1N32L 3IFTA 4LUVA 1Q3LA 2JA8G 2PPBC 2LY7A 1PTOH 1H9JA 2B39A 3D3RA 1I94Q 5COYA 1HCZA 4IN3A 5ELBA 5IGBA 3J81i 1EL0A 2Z4HA 3K58A 4DAYB 1QVGA 1Z47A 3T1HQ 2DN8A 2K5VA 3VR3A 1S5BD 1XNRQ 5CORA 1LTID 3HOXB 1LT6D 2ZXPA 4QUCA 1EU3A 1IW7D 1Q81C 1DGSA 5A2QE 1LTRD 2HDMA 1RTOA 3HOVG 1WTOA 5TSSA 4E6IA 1A3TA 4IFDI 2R92B
chains in the Genus database with same CATH topology
1I4XA 2XN9C 3BVMA 5ELEA 1LT3D 4QMGA 1ZYRC 2EJFC 2PO4A 4G7ZC 2EYPA 2OT2A 1T5EA 2X69A 2F4IA 2LMCB 3K5NA 4IUNA 3QOJA 2MP1A 3NHHA 2TMPA 1FNUA 1STHA 1FNVA 1HHVA 2EYOA 4BS9A 2A73B 1X3QA 4DAVA 2BDOA 3M3YB 1EQTA 4OO1H 2NVXB 2XWBB 3WDNA 3GTOB 4FXKC 1G2TA 3BVGA 2IT1A 5DNFA 5I6WA 4DNRB 2NYZD 5FOBB 3PO3B 2DY7A 2K6AA 2L55A 1BCPC 4N9PA 5EKIA 1CT1D 5CBEE 3K5MA 3E6ZX 2N88A 2B2YC 4K5VA 5FKAC 4IFDJ 3BS1A 4NDXA 4CKCA 2HQEA 4C3HB 5CV5A 1SSOA 3NWSA 3S16B 2B2VC 3IKJA 4LAAA 1G291 2F0GA 4PMWA 1H9KA 3KLRA 5ELDA 3GTGB 4MIUA 3QOLA 5C4XB 1F9RA 3S15B 1NR2A 5M3MB 5M3FB 1LLRD 3NP8A 3VYSA 4A3FB 1G2SA 5FLXE 5JAVA 5D65A 4ZK9B 4IUQA 4DNTB 1BUVT 1SMYC 4JBWA 1TIID 2E2JB 1QE6A 4F7XA 3GTQB 5J1ZA 3EVQA 3ND8A 4NMZA 3PUZA 1G91A 3Q23A 4FXDA 1DOKA 1RD9D 4B08A 2HDLA 1HQMC 4QIWB 2QEJC 5IGFA 3X3MA 2A6ED 3MEHA 2CVRA 5IGCA 1LTSD 3C1FA 2OXPA 3PUXA 5FLXL 1LV9A 2NVTB 2F0UA 2O4XA 2EYLA 4A3DB 1DOMA 5CV6A 2E76C 5JVH3 5ELFA 3MAQA 2BCOA 1EY9A 3QB3A 5JJZA 2Q8TA 1F2MA 2IJ0A 1NCVA 4C3IG 4JK1C 4WRDA 4OO1G 4BWGB 4XQNA 4X3KA 2B2UA 4NW2A 1EEFD 5C4ZA 2RKSA 4EQNA 1TY0A 5EPJA 2NVYB 4RCNA 4HSPA 1YNND 2XSCA 3BYTB 1PLFA 4PMBA 4EQOA 1A3UA 3SK4A 1Y8OB 3HP3A 1W6KA 2K05A 1QJOA 1I6HB 5K5PA 5IODA 5F2DA 4BA2I 1R9TB 1I4QA 3I91A 2EOTA 2BDNA 1YNJD 3SK5A 1I50B 2L0CA 1U4MA 3S1MB 4O42A 3E0JA 2O5IC 3LNNA 1HA6A 1OXTA 4PNYA 1WTWA 2WIIB 3NK9A 3DM1A 5KNDA 4R9WA 3K5OA 4KI0A 4RGOS 2TSSA 1PTOD 2F03A 4Q5VA 3WOFA 4C2MB 1PRTD 1MBYA 5FO7B 2N55A 2L5TA 3DUZA 2YYZA 5E1FA 4DFAA 3S2DB 1Q1EA 3DWPA 1UEAB 4CKBA 4OL7A 2ZT9C 1Y8NB 5EQ0A 2K7VA 1ZYRD 4GZYC 2IX3A 1WD1A 2ID0A 3HGBA 3GO5A 2R6GA 1PFBA 3D8GA 3T53B 2PZTA 2F0NA 5KYLA 1OXUA 2R93B 1HRJA 1SE2A 1D1KA 2H1EA 2JA8B 1GJXA 4FNFA 4M8AA 2GA4B 2CW0D 5DAUA 2EPBA 3PMFA 3KF8A 1LTGD 1IKLA 4ZUIA 3KBXA 3G7LA 1GUGA 2E2HB 1UNSA 2EVBA 1I4HA 1VF7A 1O7ZA 1TWFB 5ISRA 1X32A 2WINB 3OMGA 3FKIB 4CJ0B 4B9WA 3VR5A 5CR3A 3JAME 3L7ZC 4HTHA 2F0HA 2DY8A 4XIGS 2JA6B 4ZLTF 1TWGB 4H44C 3I90A 4F8MA 3BDOA 1I4RA 2MGSA 4BY7B 1SJHD 2JEAI 3URYA 2D62A 1ENAA 4IURA 4IQZA 5EKKA 1UAPA 3NE5B 2B2TC 2AWNA 2R7ZB 2B2YA 3D4DA 3S14B 2JXMB 1V8QA 1KNEA 2AQ1B 3JAML 4V0BA 5DEHA 3SHLA 3DMUA 1LTBD 4K6DA 4RGNA 3OWEB 1QOHA 1RKNA 3OPOA 1OXSC 1U4LA 3E5SA 1HTLD 1EWCA 4CJ2C 4LMQD 2XIWA 2JP1A 2OEOA 3I3CA 1VCIA 1R4QB 2F0FA 2NN6H 2RSNA 5C4JB 2FFKB 2ICEC 3J7AF 3R2IA 3IFDA 1II3A 5CGKA 3GP7A 4C3JG 3K59A 5C44B 2WACA 1C48A 3I70A 1QNKA 5CBAE 2MPMA 1SYEA 1SNQA 1ILQA 4FXGC 2SOBA 1MGSA 3U9OA 1PRTB 5I2XA 2AWOA 1QG7A 3CU7A 5K36G 3H0GB 5JEAH 3SK8A 4K5WA 1Y69U 3T16A 1WVLA 5T1GA 4DA2A 2A68D 1TY2A 1NUCA 1ESFA 1PRTF 5C3EB 3TBIB 3T51B 1BDOA 2K33A 4R8IA 2RVLA 1Z7TA 2B63B 1U9RA 1OXVA 4PV1C 2VB3X 1KNAA 3KUPA 4O1NA 5JOBA 1PFMA 3I4LA 3Q6SA 5G3LD 1EYAA 2EYJA 4J1MA 1TWAB 3Q22A 2K04A 4C3IB 1EYCA 1TKWB 2WB1B 2F3WA 1I4GA 3M7NA 2L9HA 1BBXC 1QCBD 1AFPA 4IFDH 1DM0B 5EPKA 3GTMB 4K8JA 2VUMB 2F0KA 1CZWA 2WV6D 4KN7C 4PMCA 5KGUA 5C5MA 3KLSA 2JA5B 2F0QA 3K7AB 2F0LA 3RZOB 1RJTA 5CMDA 3HS0C 5E4XA 2AUJD 4EQPA 5JEAJ 2SDFA 1J8IA 1SEBD 3TP6A 1IHZA 4RH6A 1S4ZA 2EYFA 4IZ8A 2LKVA 1SNMA 4EGVA 4WJWA 3S1QB 2C9OA 3TP8A 1JR0D 3BZDB 4G57A 2NN6G 2NUCA 3P7JA 4ZAIA 4OHJA 1QNUA 1EIHA 4ID6A 2CQAA 1L0YB 1B50A 3S1NB 5A2QL 3FDTA 3GQBA 1B4OA 4S3SA 2EXZA 3H6MA 3W3AA 3SDZA 4KMUC 5DM63 1F2ZA 3SEBA 4ZRZA 1F2LA 1EY8A 4RCOA 1KTKA 4KTAA 2F0OA 2IPKD 4QCLA 3KK7A 1AP0A 4DU9A 3BG3A 5JEAG 5HURA 1O78A 2IL8A 3P1HA 4H0LC 2NB0A 2L12A 5KNCA 3NBHA 3IAYA 3CHBD 3NQIA 1XWEA 3V05A 4U673 2EY5A 2F0PA 1EIGA 2RA4A 1BQQT 1VMPA 2F0IA 3OMCA 1LTAD 1E2VA 1LT4D 1SAPA 4H7BA 4A93B 3SK6A 1STGA 1EEID 1HXYD 2FMMA 1H9MA 1JICA 4XXEA 1IKMA 1CM9A 3AU7A 4ZQ3A 2KOLA 3C1EA 4RGMA 1EFID 4Q0FA 1BF4A 1STAA 4IFDG 1TS4A 5HGTA 3D6CA 1CK1A 1SYCA 1EOTA 1RHPA 2K28A 3DWAA 3R3OA 1RODA 3M4YA 4TRDA 1IYVA 3A54A 2B2TA 2IX0A 4KK7A 1PDQA 5EBCA 1CHPD 1ENCA 1MSGA 2PZWA 1KABA 3G6JB 2KECA 4A3KB 4XQQA 1QB5D 1GHJA 5I4DA 1XYIA 1R4PB 1DOLA 2FJ2A 3HOYB 4QB4A 2KUMA 4KHVA 2ZXOA 3EROA 5C0XH 1F9PA 5G3LF 4XYOA 2FMCA 2Z8LA 4CJ1B 1SYGA 5C0XI 1G8ZD 4C1NK 2EE1A 3AB9A 4CGYB 2F0DA 2VB2X 1PZID 3TP5A 4YIJA 1B3AA 3PUVA 1HPCA 1D5ZC 1HFNA 3CQZB 2EJMA 5IT9E 3HOWB 2K5WA 2BE5D 2AUKA 2SNMA 3S1RB 2E75C 1E2ZA 1H9RA 4B9XA 1GOZA 2B8FA 4TKOB 2QILA 1GXDC 3TDQA 1AN8A 4L6TB 1PZKD 4AYBB 1SE3A 4IALA 3NTIA 3F2UA 3H91A 4KV6A 1GUSA 1A2TA 4RHSA 3L9AX 1SFOB 3DWQA 1GHKA 2EY6A 2WKDA 4HSVA 4DXFA 2NWGA 4G7OC 1TS2A 1BXTA 4A3GB 1ENFA 3BDCA 4XYQA 5C0XJ 2PNRC 3MWYW 5FO8B 5IT9L 1TR5A 2B2WC 1IW7C 1SNCA 1A2UA 1PMRA 1EQVA 3DEPA 3I8ZA 4RWSC 2QF7A 2D5DA 5M5YB 2XWJB 1F77A 4IUTA 4KY7A 1B44D 3J80E 1I3QB 4UAIA 5M5WB 4OIKA 4EVOA 1LO5D 2F0MA 2F0SA 1D6EC 4C56C 3C3LA 4PQXA 3U9SA 3C46A 3QJYA 2IW3A 2HCIA 3MXNA 2RDHA 3QWNA 1EY0A 2I46A 1WTXA 2DNCA 3EA6A 1C8CA 2AQ2B 3PIP3 3NTHA 1BR9A 3OHXC 3LWUA 1JC7A 1BOSA 2JSOA 3HOVB 5C4HA 2E2DC 1SYBA 3FPUB 3Q0AA 2I07B 4DAPA 1Z6HA 1BCPD 4OIJA 1IL8A 3HRZC 3J80L 3QIAA 5KIXA 2J7ZA 1F2YA 3MA2B 1JQYD 2X6GA 3CKIB 2IWHA 4BBRB 3NWTA 2NTSA 5IGGA 5KEEA 3WOEA 1W6JA 2WP8J 3KBGA 3K57A 3EJIA 5JVG3 1EWHA 3L3OC 3H94A 2NZ1D 3RD4A 1B9NA 2YU9B 1STBA 4ME5A 3BYYB 2OF1A 3RMHA 1STYA 4RKLA 2A6HC 1NSNS 4A3EB 1SMYD 1I4PA 2B2VA 4FYDA 3MC0B 3OW7A 1D1IA 3X3NA 3VR4A 4WFN3 1VDZA 3VA5A 4RAUC 3J7YW 1EZ6A 1FNWA 1X3PA 1SNPA 2RDGA 1RTNA 2X6LA 4K2LA 1SE4A 2Z4IA 1ONLA 2F0TA 4LK1C 5CV4A 5EKLA 1K83B 1KLGD 1A3VA 2J0TD 4XDXA 2MJ8A 4QF4A 1V1OA 3LX0A 4Y7NB 3J81E 1JOQA 1E0BA 1HUMA 4KKSA 1JE4A 1H9SA 5IOCA 2EY1A 4UDUC 4I7ZC 1KDCA 3MVVA 1K8MA 2NVQB 1CTMA 1WCMB 4HR7B 1RDPD 3GV3A 3BDLA 1PTOB 4J8QA 1HFGA 5I2YA 2IX1A 2E74C 1E2WA 3AMUA 4K14A 4TQUS 3P20A 4X3SA 1M4VA 2M2LA 3PUWA 2EY2A 1PTOF 5BN5A 1AZPA 1RCVD 1O7LA 1T5XD 1XTCD 3TSSA 1S5ED 1YNNC 5C3WA 1RF2D 4XTCS 3A8JE 3J81L 3VYRA 1ESRA 5E3FA 1D5MC 1PYWD 1GUTA 2XNAC 5I9OA 5NUCA 1DXMA 5LL6X 1M8AA 4FP5D 4HAEA 3K6OA 1FYCA 3ZYYX 2K5DA 1ILPA 3HZXA 1XX8A 4ABNA 3FVQA 5M9OA 3IL8A 2BA1A 3MTSA 3LWEA 4HCEA 1C4QA 3W2DA 3EFXD 3OSOA 3S9WA 4HEDA 3ONAB 3MZ5A 2EYHA 4DGZA 1CFMA 1PRTC 1BCPB 4C1NI 2HUGA 2BOSA 2SEBD 3PO2B 3QO2A 1G6ZA 1TQOA 1TT2A 4L63B 3A7LA 4ZYSA 1IYUA 2QCPX 1AEXA 3VR6A 3FEWX 3GTJB 2PQEA 3A8IE 3NTKA 1BCPF 4XQJA 2R3ZA 5EJWA 1JB3A 4DXGA 1OO9B 2A74C 4KD4A 1TWCB 2MHVA 3I4MB 1V43A 1NAPA 1GUNA 4ZKCB 5EPLA 1EY6A 3HEJA 4ODGA 2EZVA 2B2WA 1DCZA 1LTTD 2CW0C 2KHSA 2R61A 5CV7A 2EYMA 2F0WA 3O13A 2L4NA 2NTTA 5J22A 1BNZA 2KA7A 1LT5D 3I72A 1CA6A 4BBSB 5IIFA 3K5LA 1JWSD 1FD7D 1H9SB 3SR1A 4OO1I 3J7AV 5CYUA 4IUPA 1B1ZA 2F3VA 3D4WA 5C5LA 1F9QA 2Q8IB 1DONA 2KVMA 3I4NB 2JYOA 2KEEA 1HTPA 2K1BA 4IUVA 4BY1B 1XXGA 4G7HC 2JA7B 5IGDA 1SJED 1B2TA 1ZKOA 4OGQC 3NXWA 2M00A 2RBMA 4KKUA 4FO2A 4F87A 2B8GA 2PCFB 2MUYA 3SVMA 1HUNA 1MSHA 4DN4M 4ILWA 1EYDA 2A6HD 2L1BA 2QKIC 2DNEA 3V96A 3ERQA 3M7GA 3SXHA 3H09A 3MXGA 4RGTA 5A35A 1ET9A 3Q24A 2F1MA 5FK9C 1B53A 4KN4C 3VYUA 3GTPB 1QWYA 2CHBD 3NUCA 3MXUA 1SDFA 4KKTA 4V190 2PZUA 2RSOA 3TZDA 3NPPA 1TVXA 2K5QA 4A3IB 1JWMD 4XT3B 2KEDA 2KQ3A 2M9VA 3A8KE 5C3XA 2FINB 1SYDA 1PZJD 2WAQB 1HQRD 2ICIA 1WTQA 5I6YA 3FRPB 3MHBA 1HA5A 2Y0SB 3TMEA 2E2IB 5LL6S 4BA1I 3HOZB 4DK0A 1VMCA 2RQXA 1LACA 4QUFA 4XT1B 3M4OB 3S2HB 5BN4A 2JEBI 3RUZA 2XRSD 2A68C 3SE0A 2F0VA 4CBVA 4KY5A 4FF1A 3P75A 1EY4A 3H3VC 4TSSA 3M85A 5D14A 4C3JB 3TZUA 1JOOA 2A69C 5E4WC 2EJGC 1Y1VB 1O80A 4Z9CB 3C2PA 1AW7A 1SYFA 3OIPA 1KAAA 3MXPA 2VNUD 1SBBB 4KJNA 1JORA 4KJOA 5J39A 1Q1BA 1QILA 5C6AA 1U4RA 2H4OA 3DHQA 4K6LA 1WTVA 4IUUA 2PW5A 1STEA 5DM73 1EY7A 4ULLA 1A6XA 3T13A 2ENBA 4HCSA 5LHY1 4K5XA 1Q90A 3R93A 5CC4A 1LABA 2F0EA 2PMZB 2KJXA 2G9DA 2D9UA 2FHTA 3V2TA 5D3IB 1SNOA 1ML0D 3NSWA 2K01A 1EZ8A 3K0YA 4C3HG 3R2TA 5ELCA 1AZQA 1JWUD 3MFYA 2K32A 5CV9A 3DXJC 2QDBA 2SNSA 5CV8A 1TS3A 4G4KA 1V1PA 2G9HD 1MI2A 3PIO3 3A7AB 2EDGA 2HCCA 3HG9A 5JPMC 1TS5A 1F9SA 2LS01 2PYKA 5C0XG 3OWFA 4A3MB 1WTPA 2Z1CA 5K36H 5I9PA 1TWHB 3N6RA 5BN3A 1MD2D 1I6VC 1FGBD 1CHQD 1STNA 3QG1A 2RDFA 4U68A 2AQ3B 5D3DA 4R8NA 1K8OA 4ZUJA 2D2CC 2L11A 2KCNA 3RZDB 4F88A 1UUPA 1EY5A 3D6WA 4RHRA 4RKBA 5KYIA 3D31A 1NR4A 1PXUA 1TU2B 3VA7A 1CI3M 1VF5C 1SNDA 2J4XA 1Y1WB 4N9TA 3BVZA 3EQLC 1Q12A 4H13C 4ZKBB 2JE6I 4DAYA 3D4RA 1CQFA 3A55A 1CQVA 5EBDA 1DD2A 1KDAA 1SXTA 3OOCA 1D5XC 4KY6A 1DZ1A 5T1IA 1B9MA 1S5CD 4M1UB 1ICWA 3UI2A 4RFBA 4MN3A 1CA5A 3VYTA 4K2KA 3CRLC 1EU4A 3NQTA 2XVSA 3PUYA 1WD0A 1GUOA 4X3UA 1DJRD 4NP5A 5FO9B 2ZXRA 1S5DD 3CRKC 2A5HA 1GUWA 1Y8PB 1S5FD 2O2LD 3DEOA 1D2BA 4CKEA 1WTRA 2VXWA 2A6EC 2B2UC 1JCKB 2K03A 2XRQD 4CHTB 1CZGA 1FR3A 1O7YA 1A15A 3I73A 5M5XB 5EGTA 2KCCA 1L0XB 4KD3A 4WORA 1JOKA 4DF7A 4HMJA 3N52A 3T56B 3A56A 2BA0A 3KLSX 4P2CB 3RLFA 1BO0A 3GTLB 2NN6I 5AFWA 1KDBA 5IGEA 3GTKB 3T4AC 4A3JB 3PV0A 4A3BB 2WKCA 3R8BA 5JPNC 4LJZC 4MHEA 3MFGA 1V1PB 3HOUB 4HN7A 3FMCA 2Q8RE 4NKLA 1ET6A 4J6HA 2V4DA 4X3TA 2LFNA 2PW7A 5KNBA 3FPPA 2C5CA 1ZEQX 4KHZA 1Q8IA 1YNJC 5KRUA 4DK1A 2BE5C 4L8JA 2A69D 4FF3A 4FVMA 1J9OA 1OXXK 4K8IA 3ITPA 3S17B 2NBFA 3ND9A 4FF4A 3NBIA 4FF2A 1U4PA 4RA8A 3HKZB 3TN2A 3GD7A 1DYQA 3GV6A 2F0JA 2O5JC 3TP7A 1KLUD 4HMIA 3VR2A 1PFNA 1ZXTA 3OIQA 1PTOC 4I65A 3IFTA 1Q3LA 2PPBC 2LY7A 1PTOH 1H9JA 2B39A 3D3RA 5COYA 1HCZA 4IN3A 5ELBA 5IGBA 1EL0A 2Z4HA 3K58A 1Z47A 2DN8A 3VR3A 1S5BD 5CORA 1LTID 3HOXB 1LT6D 2ZXPA 4QUCA 1EU3A 1IW7D 5A2QE 1LTRD 2HDMA 1RTOA 1WTOA 5TSSA 4E6IA 1A3TA 4IFDI 2R92B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHV A;  4RKL A;  3DHQ A;  2KHS A;  3ERO A;  3P1H A;  5DAU A;  5JAV A;  2F3W A;  1NSN S;  1KDB A;  2EYM A;  2F0W A;  2PW5 A;  4QMG A;  3PMF A;  1EY5 A;  5CV7 A;  5I9O A;  5IGE A;  4RKB A;  2OEO A;  5F2D A;  4ZUI A;  5NUC A;  4KY7 A;  5IOD A;  2EYP A;  4F7X A;  5J1Z A;  5KYI A;  3EVQ A;  2F0F A;  5J22 A;  1EY7 A;  1SYG A;  3T13 A;  2ENB A;  4NMZ A;  2KQ3 A;  5IIF A;  4K8J A;  1SND A;  5C3X A;  4K5X A;  2EY5 A;  1SYD A;  2F0K A;  4N9T A;  2F0P A;  4IUN A;  3SK5 A;  3SR1 A;  3VA5 A;  1II3 A;  3QOJ A;  3HZX A;  4EVO A;  2F0M A;  2F0S A;  2F0I A;  4PMC A;  5CGK A;  5ISR A;  3NHH A;  5KGU A;  1EZ6 A;  5C5M A;  5E3F A;  5CC4 A;  1STH A;  3OMC A;  5M9O A;  2F3V A;  2F0E A;  2EYO A;  2F0Q A;  2F0D A;  3D4W A;  5C5L A;  2F0L A;  1SNP A;  5K5P A;  2WAC A;  4PNY A;  4NKL A;  3OMG A;  4H7B A;  4J6H A;  5I6Y A;  3MHB A;  1EY0 A;  3SK6 A;  3NK9 A;  3TP5 A;  1SNO A;  1KDA A;  3V2T A;  5CR3 A;  4YIJ A;  4B9W A;  1STG A;  4KY6 A;  4EQP A;  1SYE A;  1SNQ A;  2PW7 A;  4HTH A;  4K2L A;  3TP6 A;  2SOB A;  3TME A;  1IHZ A;  2F0H A;  5IGF A;  4ZUJ A;  2F0T A;  3OSO A;  5CV4 A;  3U9O A;  3S9W A;  4ZQ3 A;  3C1E A;  2EYF A;  4K2K A;  3MEH A;  5EKL A;  4IZ8 A;  4F8M A;  1EZ8 A;  3MZ5 A;  3NQT A;  1A3V A;  5IGC A;  2EYH A;  3SK8 A;  4DGZ A;  2LKV A;  5IGD A;  3C1F A;  2OXP A;  1SNM A;  2SNM A;  4QF4 A;  5C4H A;  3LX0 A;  1SYB A;  1STA A;  5I6W A;  2F0U A;  2O4X A;  5CV9 A;  2EYL A;  4G57 A;  4K8I A;  4NP5 A;  3TP8 A;  3RUZ A;  5CV6 A;  1JOQ A;  3ITP A;  4B9X A;  2NUC A;  4K5W A;  2QDB A;  3NXW A;  2EY1 A;  2M00 A;  2SNS A;  4N9P A;  1KDC A;  3MVV A;  3T16 A;  5CV8 A;  5IOC A;  2RBM A;  5HGT A;  5HUR A;  1ENA A;  1EY9 A;  1TQO A;  3D6C A;  5E1F A;  4DFA A;  1SYC A;  4ID6 A;  3QB3 A;  5KIX A;  2F0J A;  1TT2 A;  2F0V A;  1NUC A;  1F2M A;  1F2Y A;  4QB4 A;  4KY5 A;  3BDL A;  4K5V A;  5EKK A;  4IAL A;  4OL7 A;  1JOR A;  3TP7 A;  3P75 A;  1AEX A;  4KV6 A;  4HMI A;  1A2T A;  4NDX A;  1EY4 A;  2HQE A;  3R3O A;  2PYK A;  2PQE A;  5CV5 A;  4I65 A;  4TRD A;  2EY6 A;  3D4D A;  3OWF A;  4WRD A;  4K14 A;  1JOO A;  1EYD A;  4S3S A;  2EXZ A;  5IGG A;  5KEE A;  3H6M A;  4LAA A;  5EGT A;  2F0G A;  1U9R A;  1ENC A;  2PZW A;  1KAB A;  3EJI A;  1F2Z A;  5DEH A;  4KD3 A;  3ERQ A;  4WOR A;  1JOK A;  3BDC A;  4KD4 A;  3SHL A;  4HMJ A;  3SXH A;  4DF7 A;  3DMU A;  5C4Z A;  5KRU A;  5I9P A;  5JOB A;  2RKS A;  4EQN A;  1SYF A;  5IGB A;  1EY8 A;  4K6D A;  1EYA A;  2EYJ A;  2EY2 A;  4J1M A;  1KAA A;  3D8G A;  3MXP A;  1RKN A;  4MIU A;  3QOL A;  2PZT A;  2F0N A;  4KTA A;  1TR5 A;  5KYL A;  2F0O A;  4KJN A;  1STB A;  1EY6 A;  1STN A;  3E5S A;  4ME5 A;  1SNC A;  1A2U A;  4PMB A;  4DU9 A;  3HEJ A;  5C3W A;  2RDF A;  1A3U A;  3NUC A;  1EQV A;  4KJO A;  4EQO A;  5J39 A;  4ODG A;  3NP8 A;  4R8N A;  2OF1 A;  3SK4 A;  1A3T A;  4E6I A;  1EYC A;  1STY A;  5C6A A;  2PZU A; 
#chains in the Genus database with same CATH topology
 1I4X A;  4P74 A;  2XN9 C;  3BVM A;  5ELE A;  1LT3 D;  4JI6 L;  4QMG A;  1Q7Y C;  1BKB A;  1ZYR C;  2EJF C;  2PO4 A;  4G7Z C;  2EYP A;  2OT2 A;  1WJJ A;  1T5E A;  1X3G A;  2F4I A;  2X69 A;  1GVP A;  2LMC B;  4LF9 Q;  4LF4 L;  3K5N A;  4IUN A;  3QOJ A;  2MP1 A;  3NHH A;  4BBR G;  2TMP A;  1FNU A;  1STH A;  1FNV A;  1HHV A;  2EYO A;  3ER0 A;  4BS9 A;  2A73 B;  2JA9 A;  1X3Q A;  3CXC A;  4DAV A;  2BDO A;  3M3Y B;  1EQT A;  2Z6K C;  4OO1 H;  2NVX B;  4X62 L;  1KL9 A;  1CKO A;  2XWB B;  3WDN A;  3GTO B;  4GN4 B;  4FXK C;  4TVA B;  1G2T A;  3BVG A;  4PG3 A;  2IT1 A;  5DNF A;  2R7Z G;  1PH9 A;  5I6W A;  2VQE L;  4DNR B;  2NYZ D;  5FOB B;  3PO3 B;  4OON A;  1A0I A;  3CCQ A;  2DY7 A;  3D0F A;  2K6A A;  2L55 A;  1BCP C;  3I2Z A;  4N9P A;  1VQ5 A;  3M9B A;  3E3X A;  4Y52 H;  4LFB Q;  5EKI A;  1CT1 D;  5CBE E;  3K7A H;  3K5M A;  2AKW B;  3E6Z X;  3PO2 H;  2N88 A;  2B2Y C;  4K5V A;  1YHA A;  5FKA C;  5GAH C;  4IFD J;  3BS1 A;  1WI5 A;  4NDX A;  4CKC A;  2HQE A;  4C3H B;  5CV5 A;  1SSO A;  3NWS A;  1X3F A;  3S16 B;  1YIJ A;  2B2V C;  3IKJ A;  3NEM A;  2OQK A;  3GTJ H;  4LAA A;  4DV6 Q;  1G29 1;  2F0G A;  4PMW A;  3L0O A;  1H9K A;  3KLR A;  3PF5 A;  3KJP A;  1KAW A;  1VQ9 A;  5ELD A;  4DR2 L;  3GTG B;  4MIU A;  1PH1 A;  3T1H L;  3HFZ B;  3QOL A;  1QUQ B;  1XNR L;  1TWC H;  5C4X B;  1F9R A;  3S15 B;  3I4M H;  1NR2 A;  5M3M B;  5M3F B;  1LLR D;  3KDF B;  3NP8 A;  3VYS A;  4A3F B;  4JVZ A;  1JT8 A;  1G2S A;  5FLX E;  1N8R C;  5JAV A;  5C44 G;  5D65 A;  4ZK9 B;  4IUQ A;  4DNT B;  1BUV T;  1SMY C;  4JBW A;  1TII D;  2MO1 A;  2VQF L;  2E2J B;  2ALY B;  1QE6 A;  1AH9 A;  4F7X A;  3GTQ B;  5J1Z A;  3EVQ A;  3ND8 A;  4NMZ A;  1HNW Q;  3PUZ A;  4JC0 A;  1G91 A;  3Q23 A;  4JYA Q;  4FXD A;  1DOK A;  1RD9 D;  4B08 A;  4BBS H;  2HDL A;  4LF6 Q;  1WOC A;  3AYH B;  5IYB G;  3CCE A;  1VQ6 A;  3H0G G;  4DUY Q;  4IPC A;  2QGQ A;  1HQM C;  4QIW B;  1KRT A;  1PA6 A;  2QEJ C;  5IGF A;  3I4N H;  1PHJ A;  3X3M A;  2ZJQ A;  1NNX A;  3OW2 A;  1VQ8 A;  2A6E D;  3MEH A;  2CVR A;  5IGC A;  1LTS D;  1A62 A;  2GVB A;  2HT1 A;  3C1F A;  2OXP A;  3PUX A;  5FLX L;  1LV9 A;  2NVT B;  2F0U A;  2O4X A;  4BY1 H;  4AH6 A;  4GOP A;  2EYL A;  4A3D B;  1DOM A;  5CV6 A;  2E76 C;  2JA7 H;  1XMO L;  3GDE A;  1YI2 A;  4DR3 Q;  1Q82 C;  5JVH 3;  5ELF A;  4DR1 Q;  3MAQ A;  2BCO A;  4LFB L;  1EY9 A;  1PH8 A;  3QB3 A;  5JJZ A;  2Q8T A;  1F2M A;  2UXB Q;  2IJ0 A;  3CD6 A;  1NCV A;  4C3I G;  4JK1 C;  4WRD A;  4OO1 G;  5LMN W;  2QW7 A;  4BWG B;  4MTN A;  4DV6 L;  4XQN A;  4X3K A;  2B2U A;  4NW2 A;  1EEF D;  5DLQ E;  2AHO B;  5C4Z A;  3LGJ A;  3U4Z A;  2RKS A;  2Z9H A;  4EQN A;  2PI2 A;  1TY0 A;  5EPJ A;  2NVY B;  1K73 C;  4RCN A;  4HSP A;  1YNN D;  4GN3 B;  2XSC A;  1SE8 A;  3BYT B;  4YWK A;  1PLF A;  4PMB A;  2VUM G;  1A3U A;  4EQO A;  3CCS A;  3SK4 A;  1A8V A;  3GTP H;  3RLO A;  2JA5 G;  3CCR A;  1XJV A;  1Y8O B;  5EAY A;  3PO2 G;  3HP3 A;  1W6K A;  2K05 A;  1QJO A;  1I6H B;  5K5P A;  5IOD A;  5F2D A;  4BA2 I;  5HGQ A;  1R9T B;  2ES2 A;  4YY3 Q;  1I4Q A;  1U0L A;  2YTX A;  4R4I A;  3I91 A;  1HNW L;  2EOT A;  2BDN A;  1YNJ D;  4A3I H;  1WFQ A;  1W2B A;  3SK5 A;  1I50 B;  2L0C A;  1PH6 A;  1U4M A;  3S1M B;  4O42 A;  3E0J A;  2O5I C;  4LF6 L;  2V1C C;  3LNN A;  1HA6 A;  1OXT A;  4PNY A;  1WTW A;  2WII B;  3NK9 A;  4DUY L;  2ASB A;  1EIY B;  1OTC A;  3DM1 A;  5KND A;  1UWV A;  4R9W A;  3K5O A;  2Z6B A;  4KI0 A;  1WTH A;  4RGO S;  4DKA C;  2TSS A;  1FL0 A;  1PTO D;  2F03 A;  4Q5V A;  3CPF A;  3WOF A;  4KHP L;  4AIM A;  2E2I H;  4C2M B;  1PRT D;  1MBY A;  5FO7 B;  3HOZ H;  1PH7 A;  2N55 A;  4JOI A;  4NPS A;  2L5T A;  4DR3 L;  3K81 C;  3DUZ A;  4WJ3 M;  3M4O H;  2B3G A;  2YYZ A;  3S2H H;  5E1F A;  4DFA A;  3S2D B;  1Q1E A;  3DWP A;  1VQN A;  1UEA B;  4CKB A;  2UXB L;  2UUC L;  4OL7 A;  2H5X A;  1NMG A;  2ZT9 C;  1Y8N B;  4DV0 Q;  5EQ0 A;  3AQQ A;  2K7V A;  2ZTD A;  1ZYR D;  4C3J H;  1JJC B;  4GZY C;  3I4N G;  2IX3 A;  3CME A;  1WD1 A;  2ID0 A;  3HGB A;  3GO5 A;  4GKJ Q;  2R6G A;  4LW1 A;  3UE1 A;  1PFB A;  3D8G A;  3T53 B;  2PZT A;  2F0N A;  4X6A H;  4LUO A;  5KYL A;  1OXU A;  4BY1 G;  3HKZ E;  2R93 B;  1HRJ A;  1SE2 A;  4IPH A;  1D1K A;  4JI4 Q;  2H1E A;  2JA8 B;  1GJX A;  2MNA A;  2JA7 G;  4FNF A;  4M8A A;  2GA4 B;  2CW0 D;  5ELO A;  5DAU A;  2F52 A;  2EPB A;  1VQI A;  3PMF A;  3KF8 A;  1LTG D;  1U5K A;  1IKL A;  2WB1 E;  4ZUI A;  3KBX A;  1XPO A;  4YY3 L;  3G7L A;  1GUG A;  4GOP B;  1JE5 A;  2E2H B;  4JG2 A;  1JB7 A;  2I5M X;  1UNS A;  2EVB A;  1I4H A;  1VF7 A;  1O7Z A;  1TWF B;  5ISR A;  2JN4 A;  2Q2T A;  2KHI A;  1HR0 L;  1X32 A;  2WIN B;  3OMG A;  3FKI B;  4CJ0 B;  4HIM A;  2NZH A;  3WWV A;  4B9W A;  3VR5 A;  5CR3 A;  3JAM E;  1PH3 A;  3L7Z C;  4HTH A;  4PZ8 A;  2F0H A;  2DY8 A;  4XIG S;  2JA6 B;  4ZLT F;  1TWG B;  4YWM A;  2B29 A;  3CCM A;  4H44 C;  3I90 A;  4F8M A;  4GNX C;  3BDO A;  1I4R A;  2MGS A;  4BY7 B;  1SJH D;  4FDB A;  1EIF A;  1LM0 A;  2G5D A;  4UPA A;  2HIV A;  3FP9 A;  2JEA I;  3URY A;  4DK3 C;  2D62 A;  4A3I G;  4POF A;  4A3K G;  1ENA A;  4IUR A;  4IQZ A;  5EKK A;  4NXN Q;  1UAP A;  3NE5 B;  4NXM Q;  2B2T C;  2AWN A;  1N9W A;  3HOY G;  2R7Z B;  2WAQ G;  2B2Y A;  2EQS A;  4DV0 L;  5FLX c;  1L0W A;  3D4D A;  3S14 B;  2JXM B;  4JI1 Q;  1V8Q A;  4N8X 1;  1KNE A;  2AQ1 B;  3JAM L;  4V0B A;  5DEH A;  3SHL A;  3DMU A;  1VQK A;  1S40 A;  1LTB D;  2KBN A;  4K6D A;  4RGN A;  4A3M H;  4LUZ A;  4GKJ L;  3OWE B;  2Y0S G;  1QOH A;  1RKN A;  3M4Q A;  2K14 A;  3OPO A;  5IYD H;  1OXS C;  1U4L A;  3E5S A;  3HOZ G;  1HTL D;  1EWC A;  3F2D A;  1TWH H;  4JI4 L;  1YIT A;  1RIP A;  4CJ2 C;  4LMQ D;  2XIW A;  2ZTE A;  3K80 C;  2JP1 A;  2OEO A;  2XTI A;  3RZD H;  3I3C A;  4GLV B;  1VCI A;  1R4Q B;  2F0F A;  2NN6 H;  2RSN A;  5C4J B;  2FFK B;  2ICE C;  3J7A F;  3R2I A;  1SLJ A;  3IFD A;  1II3 A;  5CGK A;  2DJF C;  3GP7 A;  1YZ6 A;  4C3J G;  2YTY A;  4A3L H;  1Y1W H;  3K59 A;  5C44 B;  1UE1 A;  2WAC A;  1C48 A;  2IY5 B;  3I70 A;  2FXQ A;  1QNK A;  4LFC Q;  5CBA E;  4QY7 A;  2MPM A;  2Q2U A;  1SYE A;  1SNQ A;  1ILQ A;  2D0P A;  4FXG C;  2SOB A;  4A3E H;  1MGS A;  3U9O A;  1VQA A;  4RG1 A;  3JAM i;  1PRT B;  5I2X A;  2AWO A;  1QG7 A;  4UY8 C;  3CU7 A;  4JI0 Q;  5K36 G;  3KF6 B;  3H0G B;  5JEA H;  3SK8 A;  4K5W A;  1Y69 U;  3T16 A;  1YJW A;  1HZA A;  1WVL A;  1IBM Q;  5T1G A;  4DA2 A;  2A68 D;  4X62 Q;  1SN8 A;  1TY2 A;  1NUC A;  2A19 A;  4NXN L;  4A3C H;  4NXM L;  1ESF A;  1PRT F;  5C3E B;  4KLK A;  2CWP A;  1LTL A;  3TBI B;  1D7Q A;  3T51 B;  1BDO A;  2K33 A;  1MIU A;  2ZM6 L;  4R8I A;  4JI1 L;  2RVL A;  1Z7T A;  2B63 B;  1U9R A;  2GN5 A;  1OXV A;  4PV1 C;  2VB3 X;  1KNA A;  3KUP A;  4O1N A;  5JOB A;  1PFM A;  3I4L A;  5M5X H;  3Q6S A;  4X66 Q;  5G3L D;  1EYA A;  2EYJ A;  4J1M A;  1TWA B;  3Q22 A;  2K04 A;  1WYD A;  4JPB W;  1X54 A;  5GAD C;  4C3I B;  4QQB X;  1EYC A;  2KCT A;  4GLA C;  1TKW B;  2JJQ A;  2WB1 B;  3E0E A;  2F3W A;  1I4G A;  3BU2 A;  3M7N A;  2K5N A;  2L9H A;  4AQY Q;  4YCU A;  3GTL H;  3Q8D A;  1BBX C;  4P75 A;  1QCB D;  1AFP A;  4IFD H;  1DM0 B;  4DR2 Q;  5EPK A;  1EFW A;  3GTM B;  4K8J A;  3GTK H;  4A3J H;  2F3I A;  1K9M C;  4A3B H;  1K0S A;  2VUM B;  1X56 A;  1CKN A;  1CKM A;  1CZW A;  2F0K A;  2WV6 D;  4KN7 C;  3BZC A;  4GN5 A;  4PMC A;  3J81 j;  1HH2 P;  5KGU A;  5C5M A;  1GD7 A;  2K4K A;  3KLS A;  2JA5 B;  2F0Q A;  3K7A B;  2F0L A;  1PYS B;  1PH5 A;  3RZO B;  3UE0 A;  3HOU H;  1RJT A;  3PQI A;  5IYD G;  2R7F A;  4B3T L;  2VQF Q;  5CMD A;  3HS0 C;  5E4X A;  4LFC L;  2AUJ D;  4EQP A;  5JEA J;  2SDF A;  1J8I A;  5IY0 A;  1SEB D;  3TP6 A;  1PV4 A;  1IHZ A;  4RH6 A;  1S4Z A;  3TRE A;  2EYF A;  3G4S A;  4OX9 Q;  5LMN Q;  4IZ8 A;  3ERS X;  3CPW A;  2LKV A;  5IE8 A;  1SNM A;  4EGV A;  4WJW A;  5IP7 G;  1KD1 C;  2N78 A;  1YHQ A;  4JI0 L;  3S1Q B;  2C9O A;  1JR0 D;  3BZD B;  4G57 A;  3TP8 A;  2NN6 G;  3I4O A;  2NUC A;  3P7J A;  4ZAI A;  4OHJ A;  1IBM L;  1KIX A;  1QNU A;  1EIH A;  4ID6 A;  3S17 H;  2CQA A;  1L0Y B;  1B50 A;  2LXK A;  5AJ3 L;  3S1N B;  5A2Q L;  4A3L G;  3FDT A;  4N8F A;  4DV1 Q;  1Y1W G;  3G6E A;  2CWA A;  3GQB A;  4AYB E;  1AE3 A;  1B4O A;  4S3S A;  2EXZ A;  3W1G A;  3H6M A;  3W3A A;  3T1Y L;  3SDZ A;  4KMU C;  4K0K L;  1HNX Q;  3RLN A;  3BJU A;  1F2Z A;  5DM6 3;  3CC7 A;  4A3E G;  1XMO Q;  3IRB A;  3SEB A;  4ZRZ A;  1F2L A;  1EY8 A;  4RCO A;  4X66 L;  1HZ9 A;  1JMC A;  1KTK A;  4KTA A;  2F0O A;  4EQ5 A;  2IPK D;  4QCL A;  3KK7 A;  1AP0 A;  4DU9 A;  3BG3 A;  5JEA G;  5HUR A;  1O78 A;  1D8L A;  4UHV A;  3HOX H;  2IL8 A;  3P1H A;  4H0L C;  2NB0 A;  2L12 A;  3VDY A;  5KNC A;  3NBH A;  3JAM c;  3IAY A;  4AQY L;  2R92 H;  4DR7 Q;  1PH4 A;  3CHB D;  5GAE C;  3OYY A;  3NQI A;  1B8A A;  1XWE A;  4OWX B;  3V05 A;  4U67 3;  2EY5 A;  2F0P A;  1EIG A;  2RA4 A;  1BQQ T;  1M1K C;  1VMP A;  2F0I A;  4IJH A;  3H15 A;  3OMC A;  1LTA D;  1K3B C;  1E2V A;  1LT4 D;  1KHI A;  1SAP A;  4MTK A;  4H7B A;  4A93 B;  3SK6 A;  1STG A;  1EEI D;  1HXY D;  2FMM A;  1H9M A;  1WCM G;  1JIC A;  3M3Y H;  2DUD A;  4XXE A;  1IKM A;  1CM9 A;  2NVX H;  3AU7 A;  4ZQ3 A;  2KOL A;  3C1E A;  4OX9 L;  5LMN L;  4RGM A;  2UUA L;  1EFI D;  4HIO A;  4Q0F A;  1IBK Q;  3L2P A;  1BF4 A;  3GTO H;  1LUZ A;  1STA A;  3KOJ A;  4GNX A;  1K0R A;  4IFD G;  1TS4 A;  4A3J G;  4A3B G;  5HGT A;  4JI3 Q;  3D6C A;  4L5S A;  4HJ8 A;  3PO3 H;  1CK1 A;  4R4O A;  1SYC A;  1EOT A;  3F2B A;  1RHP A;  2K28 A;  3DWA A;  4DV1 L;  3R3O A;  4JI8 L;  1ROD A;  1N36 Q;  3M4Y A;  4MNO A;  4TRD A;  1IYV A;  4B3S L;  3A54 A;  4KHP Q;  2B2T A;  2IX0 A;  2GVA A;  4KK7 A;  1PDQ A;  4PZ6 A;  5EBC A;  4C3H H;  1CHP D;  3NEN A;  1ENC A;  1MSG A;  2PZW A;  1KAB A;  1HNX L;  3G6J B;  3S16 H;  2KEC A;  2PI2 E;  4A3K B;  4XQQ A;  1QB5 D;  1GHJ A;  1VQ4 A;  5I4D A;  1XYI A;  5IWA L;  1W3S A;  4X64 L;  1R4P B;  1DOL A;  2FJ2 A;  2UUC Q;  3HOY B;  4JCV E;  3GTG H;  4HID A;  4QB4 A;  2KUM A;  5C4X H;  4KHV A;  2ZXO A;  3ERO A;  2LSS A;  5C0X H;  1F9P A;  5M3M H;  5M3F H;  2UUB Q;  5G3L F;  4A3F H;  2PNH A;  4XYO A;  4DR7 L;  2AMC B;  2FMC A;  2Z8L A;  4CJ1 B;  3PSI A;  1SYG A;  3A5Z B;  5C0X I;  2E2J H;  1VQE A;  1G8Z D;  4C1N K;  2EE1 A;  3AB9 A;  1MKH A;  2JK8 A;  1VQC A;  3F1Z A;  4CGY B;  4LF8 L;  2F0D A;  2VB2 X;  1PZI D;  3TP5 A;  4YIJ A;  1B3A A;  1G6P A;  3QR8 A;  3PUV A;  1HPC A;  1D5Z C;  1XPR A;  1VQ7 A;  3HOX G;  1HFN A;  2HD3 A;  3CQZ B;  2EJM A;  5IT9 E;  3HOW B;  4IPD A;  2K5W A;  1KXL A;  2BE5 D;  2AUK A;  1KC8 C;  3H3V H;  1IBK L;  2SNM A;  3S1R B;  2R92 G;  2E75 C;  2UXD L;  1CSP A;  1E2Z A;  1H9R A;  1HR0 Q;  4B9X A;  2HHH L;  1GOZ A;  2E8G A;  2B8F A;  2NVT H;  4TKO B;  2QIL A;  4JI3 L;  1GXD C;  3TDQ A;  4A3D H;  1AN8 A;  2CH4 A;  3H3V I;  2HQL A;  4L6T B;  4DV5 Q;  3I4M G;  1PZK D;  4AYB B;  3E9H A;  4P72 A;  1SE3 A;  1VQG A;  3NTI A;  4IAL A;  3F2U A;  3H91 A;  3NBH B;  1N33 Q;  4KV6 A;  1GUS A;  1A2T A;  1X3E A;  3KJO A;  4RHS A;  3L9A X;  1SFO B;  3DWQ A;  1N36 L;  1FGU A;  1GHK A;  2EY6 A;  3BZK A;  2WKD A;  4HSV A;  4NB3 A;  4DXF A;  2NWG A;  4H02 A;  4G7O C;  4BXX H;  1TS2 A;  4OWT B;  3CF5 A;  4UP8 A;  2OCE A;  1BXT A;  4A3G B;  1ENF A;  3BDC A;  3J7A 5;  4XYQ A;  5C0X J;  2PNR C;  3MWY W;  1PFS A;  1IBL Q;  1AE2 A;  3ZJY C;  3TS0 A;  3EIV A;  5FO8 B;  4BBS G;  5IT9 L;  1A63 A;  1TR5 A;  4QGU A;  2B2W C;  4LFA L;  1IW7 C;  1SNC A;  1A2U A;  1PMR A;  1EQV A;  3DEP A;  2NVY H;  3I8Z A;  4O2D A;  4EX5 A;  4RWS C;  2QF7 A;  2D5D A;  3PO3 G;  2MQH A;  5M5Y B;  2XWJ B;  2UUB L;  1SRU A;  1F77 A;  1V1Q A;  1SR3 A;  4IUT A;  4KY7 A;  1B44 D;  2RHS B;  3J80 E;  3A5U A;  1Y1V H;  1I3Q B;  4UAI A;  1I6H H;  5M5W B;  4OIK A;  3ULJ A;  1R9T H;  4EVO A;  1LO5 D;  2F0M A;  2F0S A;  1D6E C;  4C56 C;  3C3L A;  4PQX A;  3U9S A;  1UEB A;  3C46 A;  3QJY A;  1I50 H;  2IW3 A;  2HCI A;  1O7I A;  3MXN A;  3S1M H;  2RDH A;  3QWN A;  2XGT A;  1EY0 A;  2I46 A;  1WTX A;  2CH4 W;  2DNC A;  3EA6 A;  1C8C A;  2AQ2 B;  3PIP 3;  3NTH A;  1BR9 A;  2RCF A;  5HY6 A;  3OHX C;  5C4X G;  2N49 A;  3LWU A;  1JC7 A;  1BOS A;  2JSO A;  3HOV B;  5M3M G;  5M3F G;  2QEX A;  4X65 Q;  5C4H A;  2E2D C;  4A3F G;  1SYB A;  4JI2 Q;  3FPU B;  3Q0A A;  2I07 B;  2KHJ A;  4DAP A;  3HKS A;  1Z6H A;  1BCP D;  4OIJ A;  3UDX A;  1IL8 A;  4C2M H;  3HRZ C;  3J80 L;  2OTJ A;  1NY4 A;  3QIA A;  3CAM A;  4YHH Q;  3EN2 A;  4DV5 L;  5KIX A;  2J7Z A;  1F2Y A;  2Z6K A;  3MA2 B;  1JQY D;  2X6G A;  5IP9 H;  1N33 L;  3TS2 A;  3S2D H;  2YV5 A;  3CKI B;  4L5T A;  2IWH A;  4BBR B;  1VQF A;  3NWT A;  2NTS A;  5IGG A;  5KEE A;  3TRZ A;  3WOE A;  2DGY A;  1W6J A;  2WP8 J;  3KBG A;  4JW0 A;  3K57 A;  3EJI A;  5JVG 3;  4IOA A;  1EWH A;  1K3R A;  2E5L Q;  3L3O C;  1L2F A;  3H94 A;  4MZ9 A;  1IBL L;  1CUK A;  1K28 A;  2NZ1 D;  3RD4 A;  1B9N A;  1VQP A;  1E22 A;  2YU9 B;  1STB A;  4ME5 A;  3BYY B;  4JI7 Q;  1E7Z A;  2OF1 A;  3RMH A;  4JV5 Q;  1STY A;  4RKL A;  2ZM6 Q;  2YTV A;  2R93 H;  2A6H C;  1NSN S;  4A3E B;  2JA8 H;  1SMY D;  1NMF A;  4HJ7 A;  2PQA A;  1I4P A;  2B2V A;  4FYD A;  3MC0 B;  3OW7 A;  1D1I A;  3X3N A;  4IJL A;  1XPU A;  4P71 A;  3VR4 A;  4WFN 3;  1VDZ A;  4OEL B;  2Q2I A;  3VA5 A;  4RAU C;  3J80 i;  3J7Y W;  4BXX G;  1EZ6 A;  1FNW A;  1IXR A;  3TEH B;  2E2H H;  1PVO A;  1X3P A;  2NZO A;  1SNP A;  4DR6 Q;  1TWF H;  2RDG A;  4RMF A;  1RTN A;  4IOC A;  2X6L A;  4K2L A;  4DR4 Q;  1SE4 A;  2Z4I A;  3FKI H;  4DAM A;  4B3R Q;  1ONL A;  2F0T A;  4LK1 C;  1XTD A;  3DM3 A;  5CV4 A;  1X9N A;  1GM5 A;  5EKL A;  1FJG Q;  5GQO A;  1K83 B;  1KLG D;  1A3V A;  2J0T D;  4XDX A;  3MEF A;  2MJ8 A;  2JA6 H;  4QF4 A;  4X65 L;  1V1O A;  1TWG H;  3LX0 A;  4A76 A;  4Y7N B;  4JI2 L;  4L5Q A;  3J81 E;  3ULP A;  1JOQ A;  1E0B A;  1HUM A;  4KKS A;  1JE4 A;  1Y1V G;  4BY7 H;  1H9S A;  5IOC A;  2EY1 A;  4UDU C;  2UU9 Q;  4I7Z C;  1KDC A;  3MVV A;  1K8M A;  2NVQ B;  4B3T Q;  4CDF C;  1NTG A;  1CTM A;  1KRS A;  1WCM B;  4HR7 B;  4YHH L;  1QZG A;  1RDP D;  2OWO A;  3GV3 A;  3AEV A;  3BDL A;  4QL5 A;  1PTO B;  2F4V L;  4J8Q A;  1HFG A;  3G71 A;  5I2Y A;  1XMQ Q;  2IX1 A;  2E74 C;  4OWW B;  1E2W A;  3AMU A;  4K14 A;  1H95 A;  4TQU S;  4HJ5 A;  3P20 A;  2R7Z H;  2N3S A;  4X3S A;  1M4V A;  2M2L A;  3S14 H;  1MJC A;  2E5L L;  3W1B A;  3PUW A;  5J3B A;  4DV2 L;  2EY2 A;  1PTO F;  5BN5 A;  4CDD C;  5AJ3 Q;  1AZP A;  1RCV D;  1O7L A;  3MXN B;  1T5X D;  1XTC D;  3TSS A;  1S5E D;  1YNN C;  3KF8 B;  5C3W A;  1RF2 D;  4XTC S;  4JI7 L;  1L1O C;  3A8J E;  3J81 L;  3VYR A;  1ESR A;  3I7F A;  5E3F A;  4JV5 L;  1D5M C;  1PYW D;  1GUT A;  2XNA C;  3T1Y Q;  1NE3 A;  1YNX A;  4K0K Q;  5I9O A;  1T9H A;  1JJ2 A;  3F8T A;  4DUZ Q;  2ZJP A;  5NUC A;  1DXM A;  1SMX A;  5LL6 X;  2A8V A;  1M8A A;  4FP5 D;  4HAE A;  3K6O A;  1FYC A;  3PIP A;  2RHQ B;  3PIO A;  3ZYY X;  2K5D A;  5IT9 c;  2N8N A;  1ILP A;  5FLM H;  3HZX A;  1VQH A;  5C4J H;  1XX8 A;  4QJF A;  1GKH A;  4IPG A;  4ABN A;  3FVQ A;  1YEZ A;  5M9O A;  3IL8 A;  2BA1 A;  2I5H A;  4LF7 Q;  3MTS A;  4DR6 L;  3KLW A;  3LWE A;  2WAQ E;  4HCE A;  4UP7 A;  5C44 H;  3RN2 A;  3UDI A;  1C4Q A;  3W2D A;  4DR4 L;  4B3R L;  3EFX D;  2LXJ A;  1VS0 A;  3OSO A;  3S9W A;  4HED A;  3A74 A;  1C7Y A;  3ONA B;  2R93 G;  1FJG L;  3MZ5 A;  4R4C A;  2Y0S E;  2EYH A;  4DGZ A;  2Z0S A;  1CFM A;  4CDC C;  4B3M L;  1PRT C;  1BCP B;  1EOV A;  1ASY A;  2VY3 A;  4C1N I;  2HUG A;  2BOS A;  2SEB D;  1YJN A;  4A3M G;  3PO2 B;  1GO3 E;  3QO2 A;  4IO9 A;  2UU9 L;  5IYB H;  1G6Z A;  1TQO A;  1B70 B;  3H0G H;  1TT2 A;  4L63 B;  3CCU A;  3A7L A;  4HJA A;  1C0A A;  1IZ6 A;  4ZYS A;  1IYU A;  2QCP X;  3W5O A;  1AEX A;  3KFU A;  1MHW C;  2PQA B;  3FEW X;  3VR6 A;  3GTJ B;  5H1S E;  2PQE A;  3A8I E;  1XMQ L;  2UUA Q;  3NTK A;  1BCP F;  1CSQ A;  3RN5 A;  4XQJ A;  2R3Z A;  5C3E H;  5EJW A;  3KYH C;  1JB3 A;  4DXG A;  3FKI G;  5JJK A;  1OO9 B;  2A74 C;  4KD4 A;  4DK6 C;  1TWC B;  4YCW A;  3J80 c;  4JBM A;  1XNQ Q;  2MHV A;  3RNU A;  4OXP A;  3I4M B;  1V43 A;  2B63 H;  1NAP A;  2JA6 G;  1GUN A;  4ZKC B;  5EPL A;  1NJI C;  1EY6 A;  3HEJ A;  4JI8 Q;  1TWA H;  4ODG A;  2EZV A;  4BY7 G;  4B3S Q;  2B2W A;  1DCZ A;  1LYL A;  1LTT D;  2CW0 C;  2KHS A;  2R61 A;  4R4T A;  4C3I H;  5CV7 A;  2EYM A;  2F0W A;  3O13 A;  2L4N A;  4DUZ L;  2K75 A;  2NTT A;  5J22 A;  1BNZ A;  2KA7 A;  1LT5 D;  3I72 A;  5E7N A;  5IWA Q;  3U50 C;  4X64 Q;  1CA6 A;  4BBS B;  5IIF A;  1VQJ A;  1EQQ A;  3K5L A;  1JWS D;  1FD7 D;  1H9S B;  3SR1 A;  4OO1 I;  3J7A V;  5CYU A;  3GTM H;  4IUP A;  3CCJ A;  1B1Z A;  2F3V A;  2VUM H;  4LF7 L;  3D4W A;  5C5L A;  1F9Q A;  2Q8I B;  1DON A;  2OTL A;  2KVM A;  1ICF B;  3I4N B;  1JJG A;  1EQR A;  2JYO A;  2JA5 H;  1S3O A;  4A3C G;  2KEE A;  2PMZ E;  5IYC H;  3RZO H;  1HTP A;  2K1B A;  2MFI A;  1VQB A;  4IUV A;  4BY1 B;  1XXG A;  2EIF A;  4G7H C;  2JA7 B;  5IGD A;  1BVS A;  1SJE D;  4LF8 Q;  2VW9 A;  1B2T A;  1E1O A;  4DV7 Q;  1ZKO A;  3UDF A;  3U58 A;  4OGQ C;  3NXW A;  1I94 L;  2M00 A;  4APV A;  4DV4 Q;  2RBM A;  3S1Q H;  4KKU A;  5FLM G;  4FO2 A;  2BH8 A;  4F87 A;  2B8G A;  1B3Q A;  2PCF B;  2MUY A;  3SVM A;  3PCO B;  1HZB A;  1HUN A;  1MSH A;  4DN4 M;  3S1N H;  4ILW A;  1EYD A;  2A6H D;  2L1B A;  2QKI C;  2UXD Q;  3STB C;  3CP0 A;  3CW2 C;  2DNE A;  2P5Z X;  3V96 A;  3S24 A;  3ERQ A;  2HHH Q;  3M7G A;  3SXH A;  2CQO A;  3H09 A;  1XNQ L;  3CC4 A;  3MXG A;  2K52 A;  4RGT A;  5A35 A;  1ET9 A;  3Q24 A;  2F1M A;  5FK9 C;  1B53 A;  1HJP A;  4LF9 L;  4KN4 C;  3VYU A;  3GTP B;  1QWY A;  2CHB D;  4HIK A;  3NUC A;  3MXU A;  1SDF A;  4KKT A;  1KQS A;  2PZU A;  4V19 0;  2RSO A;  3HOU G;  3TZD A;  3NPP A;  5GRO A;  1S72 A;  1TVX A;  3A0J A;  1CKN B;  2K5Q A;  4A3I B;  1JWM D;  2JQO A;  4XT3 B;  2KED A;  5L37 A;  2KQ3 A;  4P73 A;  2A1A A;  2M9V A;  3A8K E;  3I56 A;  5C3X A;  2FIN B;  1SYD A;  5C3E G;  1PZJ D;  3E9I A;  4LFA Q;  4OEM B;  2WAQ B;  3J81 c;  1UE6 A;  1HQR D;  1E3P A;  1QVF A;  5JJI A;  3S15 H;  1P8L A;  2ICI A;  1PH2 A;  2B63 G;  1WTQ A;  2DJG C;  5I6Y A;  3FRP B;  3MHB A;  2KCM A;  3HKZ G;  2EXD A;  1HA5 A;  2Y0S B;  3TME A;  2I5L X;  4A93 H;  2E2I B;  5LL6 S;  4BA1 I;  3HOZ B;  4DK0 A;  1VMC A;  3GTQ H;  1C9O A;  2RQX A;  1LAC A;  4QUF A;  1TXY A;  1UE5 A;  4XT1 B;  4YCV A;  4R4Q A;  5FJ8 H;  2WB1 G;  3DLL A;  4DV7 L;  3M4O B;  3S2H B;  2RCN A;  5BN4 A;  2JEB I;  3RUZ A;  2R7D A;  2XRS D;  2D0O A;  4DV4 L;  2A68 C;  3SE0 A;  2F0V A;  1NBW A;  4CBV A;  4KY5 A;  4FF1 A;  4GLX A;  3P75 A;  3CCV A;  1EY4 A;  3H3V C;  4TSS A;  3M85 A;  5D14 A;  4C3J B;  1UE7 A;  3TZU A;  1JOO A;  1K8G A;  2A69 C;  5E4W C;  2EJG C;  1Y1V B;  5IYC G;  1O80 A;  4Z9C B;  3C2P A;  3NEL A;  4JBJ A;  2ZJR A;  1AW7 A;  1BBU A;  1SYF A;  3OIP A;  1KAA A;  3MXP A;  2VNU D;  1SBB B;  3OTO Q;  1HZC A;  4A3K H;  4JYA L;  4KJN A;  4HJ9 A;  1VQL A;  1JOR A;  4KJO A;  5J39 A;  1Q1B A;  1QIL A;  5C6A A;  1U4R A;  5BR8 Q;  1YJ9 A;  2H4O A;  3DHQ A;  3HOY H;  4K6L A;  2K5H A;  1L1O A;  1VQD A;  4GS3 A;  4IUU A;  1WTV A;  2PW5 A;  4LWC A;  4PZ7 A;  1STE A;  1E1T A;  5DM7 3;  1EY7 A;  4ULL A;  1A6X A;  3T13 A;  2ENB A;  4HCS A;  5LHY 1;  4K5X A;  3AFP A;  1Q90 A;  2MO0 A;  1J6Q A;  3R93 A;  5CC4 A;  1LAB A;  2F0E A;  4ZCK A;  2PMZ B;  2KJX A;  2G9D A;  2D9U A;  4JBK A;  2FHT A;  4DR1 L;  3V2T A;  2KEN A;  5D3I B;  1SNO A;  2QA4 A;  4DV3 Q;  1Q46 A;  1HNZ Q;  1ML0 D;  3NSW A;  2CFM A;  2BH2 A;  4LNQ A;  3U4V A;  4GNX B;  2K01 A;  1EZ8 A;  2ZTC A;  3R2T A;  3K0Y A;  5ELC A;  4C3H G;  1AZQ A;  1JWU D;  3MFY A;  1SRO A;  2K32 A;  5CV9 A;  3CQZ H;  3DXJ C;  3HOW H;  3PF4 A;  2QDB A;  3S1R H;  2SNS A;  3ULL A;  5CV8 A;  1TS3 A;  4G4K A;  1V1P A;  2G9H D;  1MI2 A;  1EWI A;  2RF4 A;  3KF6 A;  4L5R C;  3PIO 3;  3A7A B;  2EDG A;  3CMA A;  2HCC A;  2HIX A;  3HG9 A;  5JPM C;  4YWL A;  1TS5 A;  1F9S A;  2LS0 1;  1N34 Q;  2PYK A;  5C0X G;  2VS1 A;  4R1J A;  3OWF A;  2IHF A;  1PYB A;  4A3M B;  1SFO H;  1WTP A;  1IYJ B;  4A93 G;  1RL2 A;  2Z1C A;  5K36 H;  5I9P A;  4CDE C;  4LF5 Q;  3EBE A;  1TWH B;  3JC6 6;  2Q2H A;  3N6R A;  5BN3 A;  4A3G H;  1MD2 D;  3OTO L;  4A75 A;  1I6V C;  1FGB D;  1CHQ D;  5FJ8 G;  4POG A;  1STN A;  3QG1 A;  2F4V Q;  2RDF A;  4U68 A;  2AQ3 B;  5D3D A;  3RR5 A;  2C35 B;  1QVC A;  4R8N A;  2CCZ A;  1K8O A;  4ZUJ A;  1Z9F A;  2D2C C;  2KCN A;  2L11 A;  3PGZ A;  5BR8 L;  3RZD B;  4F88 A;  4DR5 Q;  1UUP A;  4WJ4 A;  1X55 A;  1Q86 C;  1EY5 A;  1J5E Q;  4GKK Q;  3D6W A;  4RHR A;  4RKB A;  5KYI A;  3ICE A;  1IL2 A;  3D31 A;  2UXC Q;  1NR4 A;  1PXU A;  1TU2 B;  5M5Y H;  3VA7 A;  4DV2 Q;  1CI3 M;  1VF5 C;  1SND A;  2J4X A;  3CCL A;  1Y1W B;  4N9T A;  3BVZ A;  3EQL C;  5GAG C;  4J15 A;  1Q12 A;  1I3Q H;  4H13 C;  4ZKB B;  5M5W H;  2JE6 I;  4DAY A;  3D4R A;  1CQF A;  3A55 A;  5LMU Q;  1CQV A;  4A3D G;  3B6Y A;  5EBD A;  1DD2 A;  1KDA A;  4DV3 L;  1SXT A;  2OQ0 A;  3OOC A;  1D5X C;  4KY6 A;  1HNZ L;  1DZ1 A;  5T1I A;  2ATW A;  1B9M A;  1S5C D;  4JI5 Q;  4M1U B;  1ICW A;  3UI2 A;  4RFB A;  4MN3 A;  1CA5 A;  1I5F A;  4K2K A;  3VYT A;  3CRL C;  1EU4 A;  3NQT A;  1MJE A;  4GOP C;  2XVS A;  3PUY A;  1WD0 A;  1GUO A;  3STB D;  4X3U A;  3J7Z C;  1DJR D;  4NP5 A;  3HOV H;  5FO9 B;  2ZXR A;  1ASZ A;  1S5D D;  3CRK C;  1BBW A;  2A5H A;  1HR0 W;  1GUW A;  4ALP A;  1Y8P B;  1S5F D;  2VZA A;  3M4P A;  1L1O B;  2O2L D;  3DEO A;  1FVI A;  1D2B A;  4CKE A;  1WTR A;  3K7U C;  1N34 L;  1N32 Q;  2VXW A;  2A6E C;  1B7Y B;  2B2U C;  3SGI A;  1JCK B;  2K03 A;  2XRQ D;  4CHT B;  1CZG A;  1FR3 A;  4B3M Q;  1O7Y A;  1A15 A;  3I73 A;  5M5X B;  5EGT A;  1YHB A;  2I0Q A;  4BBR H;  2KCC A;  1YVC A;  1L0X B;  5IP7 H;  4KD3 A;  4WOR A;  1JOK A;  4DF7 A;  4HMJ A;  2L15 A;  3N52 A;  4O0A A;  3T56 B;  4LF5 L;  3A56 A;  4DNI A;  4UP9 A;  1VQM A;  2BA0 A;  1Y14 B;  1K8A C;  3KLS X;  4P2C B;  2IHE A;  3HOW G;  3RLF A;  1BO0 A;  3GTL B;  2QDL A;  2NN6 I;  2YU9 H;  1X65 A;  3G48 A;  3F2C A;  4DR5 L;  4JI6 Q;  5AFW A;  1KDB A;  1QZH A;  2K50 A;  5IGE A;  1J5E L;  3GTK B;  3T4A C;  1YBY A;  4A3J B;  4GKK L;  3PV0 A;  4A3B B;  2WKC A;  3R8B A;  2UXC L;  4AYB G;  5JPN C;  4LF4 Q;  1E24 A;  1Q8K A;  4LJZ C;  4I7A A;  4MHE A;  3MFG A;  4ME3 A;  1V9P A;  1V1P B;  3HOU B;  4HN7 A;  3FMC A;  3TQY A;  3AFQ A;  1QUQ A;  1G51 A;  2Q8R E;  5JJL A;  5LMU L;  4NKL A;  1M90 C;  1X6O A;  1EYG A;  1ET6 A;  4J6H A;  4A3G G;  3KDF A;  2V4D A;  3FHW A;  1P16 A;  5IP9 G;  4X3T A;  2LFN A;  2PW7 A;  5KNB A;  3FPP A;  4JI5 L;  2C5C A;  2CKZ B;  1ZEQ X;  4KHZ A;  4A4I A;  1Q8I A;  1EUJ A;  1YNJ C;  4QIW E;  4JOI C;  5KRU A;  4DK1 A;  2BE5 C;  4L8J A;  2WFW A;  2A69 D;  2VQE Q;  4FF3 A;  2VL6 A;  4FVM A;  1J9O A;  5ELN A;  1OXX K;  4K8I A;  3CC2 A;  1K83 H;  4DPG A;  3ITP A;  3S17 B;  2NBF A;  3ND9 A;  4FF4 A;  3NBI A;  4FF2 A;  1U4P A;  4RA8 A;  3HKZ B;  4Y7N H;  3TN2 A;  3GD7 A;  3UDG A;  1DYQ A;  3GV6 A;  2F0J A;  2O5J C;  3K8A A;  3K0X A;  3I55 A;  3TP7 A;  2NVQ H;  1KLU D;  4HMI A;  1WCM H;  1PFN A;  3OIQ A;  1ZXT A;  3VR2 A;  1VQO A;  1PTO C;  4I65 A;  1N32 L;  3IFT A;  4LUV A;  1Q3L A;  2JA8 G;  2PPB C;  2LY7 A;  1PTO H;  1H9J A;  2B39 A;  3D3R A;  1I94 Q;  5COY A;  1HCZ A;  4IN3 A;  5ELB A;  5IGB A;  3J81 i;  1EL0 A;  2Z4H A;  3K58 A;  4DAY B;  1QVG A;  1Z47 A;  3T1H Q;  2DN8 A;  2K5V A;  3VR3 A;  1S5B D;  1XNR Q;  5COR A;  1LTI D;  3HOX B;  1LT6 D;  2ZXP A;  4QUC A;  1EU3 A;  1IW7 D;  1Q81 C;  1DGS A;  5A2Q E;  1LTR D;  2HDM A;  1RTO A;  3HOV G;  1WTO A;  5TSS A;  4E6I A;  1A3T A;  4IFD I;  2R92 B; 
#chains in the Genus database with same CATH homology
 1I4X A;  2XN9 C;  3BVM A;  5ELE A;  1LT3 D;  4QMG A;  1ZYR C;  2EJF C;  2PO4 A;  4G7Z C;  2EYP A;  2OT2 A;  1T5E A;  2X69 A;  2F4I A;  2LMC B;  3K5N A;  4IUN A;  3QOJ A;  2MP1 A;  3NHH A;  2TMP A;  1FNU A;  1STH A;  1FNV A;  1HHV A;  2EYO A;  4BS9 A;  2A73 B;  1X3Q A;  4DAV A;  2BDO A;  3M3Y B;  1EQT A;  4OO1 H;  2NVX B;  2XWB B;  3WDN A;  3GTO B;  4FXK C;  1G2T A;  3BVG A;  2IT1 A;  5DNF A;  5I6W A;  4DNR B;  2NYZ D;  5FOB B;  3PO3 B;  2DY7 A;  2K6A A;  2L55 A;  1BCP C;  4N9P A;  5EKI A;  1CT1 D;  5CBE E;  3K5M A;  3E6Z X;  2N88 A;  2B2Y C;  4K5V A;  5FKA C;  4IFD J;  3BS1 A;  4NDX A;  4CKC A;  2HQE A;  4C3H B;  5CV5 A;  1SSO A;  3NWS A;  3S16 B;  2B2V C;  3IKJ A;  4LAA A;  1G29 1;  2F0G A;  4PMW A;  1H9K A;  3KLR A;  5ELD A;  3GTG B;  4MIU A;  3QOL A;  5C4X B;  1F9R A;  3S15 B;  1NR2 A;  5M3M B;  5M3F B;  1LLR D;  3NP8 A;  3VYS A;  4A3F B;  1G2S A;  5FLX E;  5JAV A;  5D65 A;  4ZK9 B;  4IUQ A;  4DNT B;  1BUV T;  1SMY C;  4JBW A;  1TII D;  2E2J B;  1QE6 A;  4F7X A;  3GTQ B;  5J1Z A;  3EVQ A;  3ND8 A;  4NMZ A;  3PUZ A;  1G91 A;  3Q23 A;  4FXD A;  1DOK A;  1RD9 D;  4B08 A;  2HDL A;  1HQM C;  4QIW B;  2QEJ C;  5IGF A;  3X3M A;  2A6E D;  3MEH A;  2CVR A;  5IGC A;  1LTS D;  3C1F A;  2OXP A;  3PUX A;  5FLX L;  1LV9 A;  2NVT B;  2F0U A;  2O4X A;  2EYL A;  4A3D B;  1DOM A;  5CV6 A;  2E76 C;  5JVH 3;  5ELF A;  3MAQ A;  2BCO A;  1EY9 A;  3QB3 A;  5JJZ A;  2Q8T A;  1F2M A;  2IJ0 A;  1NCV A;  4C3I G;  4JK1 C;  4WRD A;  4OO1 G;  4BWG B;  4XQN A;  4X3K A;  2B2U A;  4NW2 A;  1EEF D;  5C4Z A;  2RKS A;  4EQN A;  1TY0 A;  5EPJ A;  2NVY B;  4RCN A;  4HSP A;  1YNN D;  2XSC A;  3BYT B;  1PLF A;  4PMB A;  4EQO A;  1A3U A;  3SK4 A;  1Y8O B;  3HP3 A;  1W6K A;  2K05 A;  1QJO A;  1I6H B;  5K5P A;  5IOD A;  5F2D A;  4BA2 I;  1R9T B;  1I4Q A;  3I91 A;  2EOT A;  2BDN A;  1YNJ D;  3SK5 A;  1I50 B;  2L0C A;  1U4M A;  3S1M B;  4O42 A;  3E0J A;  2O5I C;  3LNN A;  1HA6 A;  1OXT A;  4PNY A;  1WTW A;  2WII B;  3NK9 A;  3DM1 A;  5KND A;  4R9W A;  3K5O A;  4KI0 A;  4RGO S;  2TSS A;  1PTO D;  2F03 A;  4Q5V A;  3WOF A;  4C2M B;  1PRT D;  1MBY A;  5FO7 B;  2N55 A;  2L5T A;  3DUZ A;  2YYZ A;  5E1F A;  4DFA A;  3S2D B;  1Q1E A;  3DWP A;  1UEA B;  4CKB A;  4OL7 A;  2ZT9 C;  1Y8N B;  5EQ0 A;  2K7V A;  1ZYR D;  4GZY C;  2IX3 A;  1WD1 A;  2ID0 A;  3HGB A;  3GO5 A;  2R6G A;  1PFB A;  3D8G A;  3T53 B;  2PZT A;  2F0N A;  5KYL A;  1OXU A;  2R93 B;  1HRJ A;  1SE2 A;  1D1K A;  2H1E A;  2JA8 B;  1GJX A;  4FNF A;  4M8A A;  2GA4 B;  2CW0 D;  5DAU A;  2EPB A;  3PMF A;  3KF8 A;  1LTG D;  1IKL A;  4ZUI A;  3KBX A;  3G7L A;  1GUG A;  2E2H B;  1UNS A;  2EVB A;  1I4H A;  1VF7 A;  1O7Z A;  1TWF B;  5ISR A;  1X32 A;  2WIN B;  3OMG A;  3FKI B;  4CJ0 B;  4B9W A;  3VR5 A;  5CR3 A;  3JAM E;  3L7Z C;  4HTH A;  2F0H A;  2DY8 A;  4XIG S;  2JA6 B;  4ZLT F;  1TWG B;  4H44 C;  3I90 A;  4F8M A;  3BDO A;  1I4R A;  2MGS A;  4BY7 B;  1SJH D;  2JEA I;  3URY A;  2D62 A;  1ENA A;  4IUR A;  4IQZ A;  5EKK A;  1UAP A;  3NE5 B;  2B2T C;  2AWN A;  2R7Z B;  2B2Y A;  3D4D A;  3S14 B;  2JXM B;  1V8Q A;  1KNE A;  2AQ1 B;  3JAM L;  4V0B A;  5DEH A;  3SHL A;  3DMU A;  1LTB D;  4K6D A;  4RGN A;  3OWE B;  1QOH A;  1RKN A;  3OPO A;  1OXS C;  1U4L A;  3E5S A;  1HTL D;  1EWC A;  4CJ2 C;  4LMQ D;  2XIW A;  2JP1 A;  2OEO A;  3I3C A;  1VCI A;  1R4Q B;  2F0F A;  2NN6 H;  2RSN A;  5C4J B;  2FFK B;  2ICE C;  3J7A F;  3R2I A;  3IFD A;  1II3 A;  5CGK A;  3GP7 A;  4C3J G;  3K59 A;  5C44 B;  2WAC A;  1C48 A;  3I70 A;  1QNK A;  5CBA E;  2MPM A;  1SYE A;  1SNQ A;  1ILQ A;  4FXG C;  2SOB A;  1MGS A;  3U9O A;  1PRT B;  5I2X A;  2AWO A;  1QG7 A;  3CU7 A;  5K36 G;  3H0G B;  5JEA H;  3SK8 A;  4K5W A;  1Y69 U;  3T16 A;  1WVL A;  5T1G A;  4DA2 A;  2A68 D;  1TY2 A;  1NUC A;  1ESF A;  1PRT F;  5C3E B;  3TBI B;  3T51 B;  1BDO A;  2K33 A;  4R8I A;  2RVL A;  1Z7T A;  2B63 B;  1U9R A;  1OXV A;  4PV1 C;  2VB3 X;  1KNA A;  3KUP A;  4O1N A;  5JOB A;  1PFM A;  3I4L A;  3Q6S A;  5G3L D;  1EYA A;  2EYJ A;  4J1M A;  1TWA B;  3Q22 A;  2K04 A;  4C3I B;  1EYC A;  1TKW B;  2WB1 B;  2F3W A;  1I4G A;  3M7N A;  2L9H A;  1BBX C;  1QCB D;  1AFP A;  4IFD H;  1DM0 B;  5EPK A;  3GTM B;  4K8J A;  2VUM B;  2F0K A;  1CZW A;  2WV6 D;  4KN7 C;  4PMC A;  5KGU A;  5C5M A;  3KLS A;  2JA5 B;  2F0Q A;  3K7A B;  2F0L A;  3RZO B;  1RJT A;  5CMD A;  3HS0 C;  5E4X A;  2AUJ D;  4EQP A;  5JEA J;  2SDF A;  1J8I A;  1SEB D;  3TP6 A;  1IHZ A;  4RH6 A;  1S4Z A;  2EYF A;  4IZ8 A;  2LKV A;  1SNM A;  4EGV A;  4WJW A;  3S1Q B;  2C9O A;  3TP8 A;  1JR0 D;  3BZD B;  4G57 A;  2NN6 G;  2NUC A;  3P7J A;  4ZAI A;  4OHJ A;  1QNU A;  1EIH A;  4ID6 A;  2CQA A;  1L0Y B;  1B50 A;  3S1N B;  5A2Q L;  3FDT A;  3GQB A;  1B4O A;  4S3S A;  2EXZ A;  3H6M A;  3W3A A;  3SDZ A;  4KMU C;  5DM6 3;  1F2Z A;  3SEB A;  4ZRZ A;  1F2L A;  1EY8 A;  4RCO A;  1KTK A;  4KTA A;  2F0O A;  2IPK D;  4QCL A;  3KK7 A;  1AP0 A;  4DU9 A;  3BG3 A;  5JEA G;  5HUR A;  1O78 A;  2IL8 A;  3P1H A;  4H0L C;  2NB0 A;  2L12 A;  5KNC A;  3NBH A;  3IAY A;  3CHB D;  3NQI A;  1XWE A;  3V05 A;  4U67 3;  2EY5 A;  2F0P A;  1EIG A;  2RA4 A;  1BQQ T;  1VMP A;  2F0I A;  3OMC A;  1LTA D;  1E2V A;  1LT4 D;  1SAP A;  4H7B A;  4A93 B;  3SK6 A;  1STG A;  1EEI D;  1HXY D;  2FMM A;  1H9M A;  1JIC A;  4XXE A;  1IKM A;  1CM9 A;  3AU7 A;  4ZQ3 A;  2KOL A;  3C1E A;  4RGM A;  1EFI D;  4Q0F A;  1BF4 A;  1STA A;  4IFD G;  1TS4 A;  5HGT A;  3D6C A;  1CK1 A;  1SYC A;  1EOT A;  1RHP A;  2K28 A;  3DWA A;  3R3O A;  1ROD A;  3M4Y A;  4TRD A;  1IYV A;  3A54 A;  2B2T A;  2IX0 A;  4KK7 A;  1PDQ A;  5EBC A;  1CHP D;  1ENC A;  1MSG A;  2PZW A;  1KAB A;  3G6J B;  2KEC A;  4A3K B;  4XQQ A;  1QB5 D;  1GHJ A;  5I4D A;  1XYI A;  1R4P B;  1DOL A;  2FJ2 A;  3HOY B;  4QB4 A;  2KUM A;  4KHV A;  2ZXO A;  3ERO A;  5C0X H;  1F9P A;  5G3L F;  4XYO A;  2FMC A;  2Z8L A;  4CJ1 B;  1SYG A;  5C0X I;  1G8Z D;  4C1N K;  2EE1 A;  3AB9 A;  4CGY B;  2F0D A;  2VB2 X;  1PZI D;  3TP5 A;  4YIJ A;  1B3A A;  3PUV A;  1HPC A;  1D5Z C;  1HFN A;  3CQZ B;  2EJM A;  5IT9 E;  3HOW B;  2K5W A;  2BE5 D;  2AUK A;  2SNM A;  3S1R B;  2E75 C;  1E2Z A;  1H9R A;  4B9X A;  1GOZ A;  2B8F A;  4TKO B;  2QIL A;  1GXD C;  3TDQ A;  1AN8 A;  4L6T B;  1PZK D;  4AYB B;  1SE3 A;  4IAL A;  3NTI A;  3F2U A;  3H91 A;  4KV6 A;  1GUS A;  1A2T A;  4RHS A;  3L9A X;  1SFO B;  3DWQ A;  1GHK A;  2EY6 A;  2WKD A;  4HSV A;  4DXF A;  2NWG A;  4G7O C;  1TS2 A;  1BXT A;  4A3G B;  1ENF A;  3BDC A;  4XYQ A;  5C0X J;  2PNR C;  3MWY W;  5FO8 B;  5IT9 L;  1TR5 A;  2B2W C;  1IW7 C;  1SNC A;  1A2U A;  1PMR A;  1EQV A;  3DEP A;  3I8Z A;  4RWS C;  2QF7 A;  2D5D A;  5M5Y B;  2XWJ B;  1F77 A;  4IUT A;  4KY7 A;  1B44 D;  3J80 E;  1I3Q B;  4UAI A;  5M5W B;  4OIK A;  4EVO A;  1LO5 D;  2F0M A;  2F0S A;  1D6E C;  4C56 C;  3C3L A;  4PQX A;  3U9S A;  3C46 A;  3QJY A;  2IW3 A;  2HCI A;  3MXN A;  2RDH A;  3QWN A;  1EY0 A;  2I46 A;  1WTX A;  2DNC A;  3EA6 A;  1C8C A;  2AQ2 B;  3PIP 3;  3NTH A;  1BR9 A;  3OHX C;  3LWU A;  1JC7 A;  1BOS A;  2JSO A;  3HOV B;  5C4H A;  2E2D C;  1SYB A;  3FPU B;  3Q0A A;  2I07 B;  4DAP A;  1Z6H A;  1BCP D;  4OIJ A;  1IL8 A;  3HRZ C;  3J80 L;  3QIA A;  5KIX A;  2J7Z A;  1F2Y A;  3MA2 B;  1JQY D;  2X6G A;  3CKI B;  2IWH A;  4BBR B;  3NWT A;  2NTS A;  5IGG A;  5KEE A;  3WOE A;  1W6J A;  2WP8 J;  3KBG A;  3K57 A;  3EJI A;  5JVG 3;  1EWH A;  3L3O C;  3H94 A;  2NZ1 D;  3RD4 A;  1B9N A;  2YU9 B;  1STB A;  4ME5 A;  3BYY B;  2OF1 A;  3RMH A;  1STY A;  4RKL A;  2A6H C;  1NSN S;  4A3E B;  1SMY D;  1I4P A;  2B2V A;  4FYD A;  3MC0 B;  3OW7 A;  1D1I A;  3X3N A;  3VR4 A;  4WFN 3;  1VDZ A;  3VA5 A;  4RAU C;  3J7Y W;  1EZ6 A;  1FNW A;  1X3P A;  1SNP A;  2RDG A;  1RTN A;  2X6L A;  4K2L A;  1SE4 A;  2Z4I A;  1ONL A;  2F0T A;  4LK1 C;  5CV4 A;  5EKL A;  1K83 B;  1KLG D;  1A3V A;  2J0T D;  4XDX A;  2MJ8 A;  4QF4 A;  1V1O A;  3LX0 A;  4Y7N B;  3J81 E;  1JOQ A;  1E0B A;  1HUM A;  4KKS A;  1JE4 A;  1H9S A;  5IOC A;  2EY1 A;  4UDU C;  4I7Z C;  1KDC A;  3MVV A;  1K8M A;  2NVQ B;  1CTM A;  1WCM B;  4HR7 B;  1RDP D;  3GV3 A;  3BDL A;  1PTO B;  4J8Q A;  1HFG A;  5I2Y A;  2IX1 A;  2E74 C;  1E2W A;  3AMU A;  4K14 A;  4TQU S;  3P20 A;  4X3S A;  1M4V A;  2M2L A;  3PUW A;  2EY2 A;  1PTO F;  5BN5 A;  1AZP A;  1RCV D;  1O7L A;  1T5X D;  1XTC D;  3TSS A;  1S5E D;  1YNN C;  5C3W A;  1RF2 D;  4XTC S;  3A8J E;  3J81 L;  3VYR A;  1ESR A;  5E3F A;  1D5M C;  1PYW D;  1GUT A;  2XNA C;  5I9O A;  5NUC A;  1DXM A;  5LL6 X;  1M8A A;  4FP5 D;  4HAE A;  3K6O A;  1FYC A;  3ZYY X;  2K5D A;  1ILP A;  3HZX A;  1XX8 A;  4ABN A;  3FVQ A;  5M9O A;  3IL8 A;  2BA1 A;  3MTS A;  3LWE A;  4HCE A;  1C4Q A;  3W2D A;  3EFX D;  3OSO A;  3S9W A;  4HED A;  3ONA B;  3MZ5 A;  2EYH A;  4DGZ A;  1CFM A;  1PRT C;  1BCP B;  4C1N I;  2HUG A;  2BOS A;  2SEB D;  3PO2 B;  3QO2 A;  1G6Z A;  1TQO A;  1TT2 A;  4L63 B;  3A7L A;  4ZYS A;  1IYU A;  2QCP X;  1AEX A;  3VR6 A;  3FEW X;  3GTJ B;  2PQE A;  3A8I E;  3NTK A;  1BCP F;  4XQJ A;  2R3Z A;  5EJW A;  1JB3 A;  4DXG A;  1OO9 B;  2A74 C;  4KD4 A;  1TWC B;  2MHV A;  3I4M B;  1V43 A;  1NAP A;  1GUN A;  4ZKC B;  5EPL A;  1EY6 A;  3HEJ A;  4ODG A;  2EZV A;  2B2W A;  1DCZ A;  1LTT D;  2CW0 C;  2KHS A;  2R61 A;  5CV7 A;  2EYM A;  2F0W A;  3O13 A;  2L4N A;  2NTT A;  5J22 A;  1BNZ A;  2KA7 A;  1LT5 D;  3I72 A;  1CA6 A;  4BBS B;  5IIF A;  3K5L A;  1JWS D;  1FD7 D;  1H9S B;  3SR1 A;  4OO1 I;  3J7A V;  5CYU A;  4IUP A;  1B1Z A;  2F3V A;  3D4W A;  5C5L A;  1F9Q A;  2Q8I B;  1DON A;  2KVM A;  3I4N B;  2JYO A;  2KEE A;  1HTP A;  2K1B A;  4IUV A;  4BY1 B;  1XXG A;  4G7H C;  2JA7 B;  5IGD A;  1SJE D;  1B2T A;  1ZKO A;  4OGQ C;  3NXW A;  2M00 A;  2RBM A;  4KKU A;  4FO2 A;  4F87 A;  2B8G A;  2PCF B;  2MUY A;  3SVM A;  1HUN A;  1MSH A;  4DN4 M;  4ILW A;  1EYD A;  2A6H D;  2L1B A;  2QKI C;  2DNE A;  3V96 A;  3ERQ A;  3M7G A;  3SXH A;  3H09 A;  3MXG A;  4RGT A;  5A35 A;  1ET9 A;  3Q24 A;  2F1M A;  5FK9 C;  1B53 A;  4KN4 C;  3VYU A;  3GTP B;  1QWY A;  2CHB D;  3NUC A;  3MXU A;  1SDF A;  4KKT A;  4V19 0;  2PZU A;  2RSO A;  3TZD A;  3NPP A;  1TVX A;  2K5Q A;  4A3I B;  1JWM D;  4XT3 B;  2KED A;  2KQ3 A;  2M9V A;  3A8K E;  5C3X A;  2FIN B;  1SYD A;  1PZJ D;  2WAQ B;  1HQR D;  2ICI A;  1WTQ A;  5I6Y A;  3FRP B;  3MHB A;  1HA5 A;  2Y0S B;  3TME A;  2E2I B;  5LL6 S;  4BA1 I;  3HOZ B;  4DK0 A;  1VMC A;  2RQX A;  1LAC A;  4QUF A;  4XT1 B;  3M4O B;  3S2H B;  5BN4 A;  2JEB I;  3RUZ A;  2XRS D;  2A68 C;  3SE0 A;  2F0V A;  4CBV A;  4KY5 A;  4FF1 A;  3P75 A;  1EY4 A;  3H3V C;  4TSS A;  3M85 A;  5D14 A;  4C3J B;  3TZU A;  1JOO A;  2A69 C;  5E4W C;  2EJG C;  1Y1V B;  1O80 A;  4Z9C B;  3C2P A;  1AW7 A;  1SYF A;  3OIP A;  1KAA A;  3MXP A;  2VNU D;  1SBB B;  4KJN A;  1JOR A;  4KJO A;  5J39 A;  1Q1B A;  1QIL A;  5C6A A;  1U4R A;  2H4O A;  3DHQ A;  4K6L A;  1WTV A;  4IUU A;  2PW5 A;  1STE A;  5DM7 3;  1EY7 A;  4ULL A;  1A6X A;  3T13 A;  2ENB A;  4HCS A;  5LHY 1;  4K5X A;  1Q90 A;  3R93 A;  5CC4 A;  1LAB A;  2F0E A;  2PMZ B;  2KJX A;  2G9D A;  2D9U A;  2FHT A;  3V2T A;  5D3I B;  1SNO A;  1ML0 D;  3NSW A;  2K01 A;  1EZ8 A;  3K0Y A;  4C3H G;  3R2T A;  5ELC A;  1AZQ A;  1JWU D;  3MFY A;  2K32 A;  5CV9 A;  3DXJ C;  2QDB A;  2SNS A;  5CV8 A;  1TS3 A;  4G4K A;  1V1P A;  2G9H D;  1MI2 A;  3PIO 3;  3A7A B;  2EDG A;  2HCC A;  3HG9 A;  5JPM C;  1TS5 A;  1F9S A;  2LS0 1;  2PYK A;  5C0X G;  3OWF A;  4A3M B;  1WTP A;  2Z1C A;  5K36 H;  5I9P A;  1TWH B;  3N6R A;  5BN3 A;  1MD2 D;  1I6V C;  1FGB D;  1CHQ D;  1STN A;  3QG1 A;  2RDF A;  4U68 A;  2AQ3 B;  5D3D A;  4R8N A;  1K8O A;  4ZUJ A;  2D2C C;  2L11 A;  2KCN A;  3RZD B;  4F88 A;  1UUP A;  1EY5 A;  3D6W A;  4RHR A;  4RKB A;  5KYI A;  3D31 A;  1NR4 A;  1PXU A;  1TU2 B;  3VA7 A;  1CI3 M;  1VF5 C;  1SND A;  2J4X A;  1Y1W B;  4N9T A;  3BVZ A;  3EQL C;  1Q12 A;  4H13 C;  4ZKB B;  2JE6 I;  4DAY A;  3D4R A;  1CQF A;  3A55 A;  1CQV A;  5EBD A;  1DD2 A;  1KDA A;  1SXT A;  3OOC A;  1D5X C;  4KY6 A;  1DZ1 A;  5T1I A;  1B9M A;  1S5C D;  4M1U B;  1ICW A;  3UI2 A;  4RFB A;  4MN3 A;  1CA5 A;  3VYT A;  4K2K A;  3CRL C;  1EU4 A;  3NQT A;  2XVS A;  3PUY A;  1WD0 A;  1GUO A;  4X3U A;  1DJR D;  4NP5 A;  5FO9 B;  2ZXR A;  1S5D D;  3CRK C;  2A5H A;  1GUW A;  1Y8P B;  1S5F D;  2O2L D;  3DEO A;  1D2B A;  4CKE A;  1WTR A;  2VXW A;  2A6E C;  2B2U C;  1JCK B;  2K03 A;  2XRQ D;  4CHT B;  1CZG A;  1FR3 A;  1O7Y A;  1A15 A;  3I73 A;  5M5X B;  5EGT A;  2KCC A;  1L0X B;  4KD3 A;  4WOR A;  1JOK A;  4DF7 A;  4HMJ A;  3N52 A;  3T56 B;  3A56 A;  2BA0 A;  3KLS X;  4P2C B;  3RLF A;  1BO0 A;  3GTL B;  2NN6 I;  5AFW A;  1KDB A;  5IGE A;  3GTK B;  3T4A C;  4A3J B;  3PV0 A;  4A3B B;  2WKC A;  3R8B A;  5JPN C;  4LJZ C;  4MHE A;  3MFG A;  1V1P B;  3HOU B;  4HN7 A;  3FMC A;  2Q8R E;  4NKL A;  1ET6 A;  4J6H A;  2V4D A;  4X3T A;  2LFN A;  2PW7 A;  5KNB A;  3FPP A;  2C5C A;  1ZEQ X;  4KHZ A;  1Q8I A;  1YNJ C;  5KRU A;  4DK1 A;  2BE5 C;  4L8J A;  2A69 D;  4FF3 A;  4FVM A;  1J9O A;  1OXX K;  4K8I A;  3ITP A;  3S17 B;  2NBF A;  3ND9 A;  4FF4 A;  3NBI A;  4FF2 A;  1U4P A;  4RA8 A;  3HKZ B;  3TN2 A;  3GD7 A;  1DYQ A;  3GV6 A;  2F0J A;  2O5J C;  3TP7 A;  1KLU D;  4HMI A;  3VR2 A;  1PFN A;  1ZXT A;  3OIQ A;  1PTO C;  4I65 A;  3IFT A;  1Q3L A;  2PPB C;  2LY7 A;  1PTO H;  1H9J A;  2B39 A;  3D3R A;  5COY A;  1HCZ A;  4IN3 A;  5ELB A;  5IGB A;  1EL0 A;  2Z4H A;  3K58 A;  1Z47 A;  2DN8 A;  3VR3 A;  1S5B D;  5COR A;  1LTI D;  3HOX B;  1LT6 D;  2ZXP A;  4QUC A;  1EU3 A;  1IW7 D;  5A2Q E;  1LTR D;  2HDM A;  1RTO A;  1WTO A;  5TSS A;  4E6I A;  1A3T A;  4IFD I;  2R92 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...