2SNMA

In a staphylococcal nuclease mutant the side-chain of a lysine replacing valine 66 is fully buried in the hydrophobic core
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMKENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In a staphylococcal nuclease mutant the side-chain of a lysine replacing valine 66 is fully buried in the hydrophobic core.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 37
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1991-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2snmA00
5J22A 2EY6A 1EY0A 1STAA 5IOCA 2PW5A 4TRDA 3SK5A 3NUCA 5KYIA 5IGBA 1STNA 2F0DA 4IZ8A 1A2TA 3HEJA 4IUNA 1F2MA 4WRDA 5EGTA 5C5LA 3SHLA 5ISRA 4N9TA 4S3SA 5EKKA 4QMGA 3T13A 2O4XA 5JAVA 4K14A 1A3UA 5IGEA 4KY7A 1ENCA 3EVQA 5HURA 3ERQA 2EY5A 2EYOA 1EQVA 2F0FA 2EYHA 1JOKA 4KJNA 5JOBA 4B9WA 2F3VA 4KV6A 1SYBA 4K5XA 3D4DA 1SYFA 2SOBA 1SNOA 5CV4A 2F0SA 2PQEA 4K2KA 2KQ3A 1KDAA 3BDLA 3D8GA 3EROA 4HMJA 3U9OA 4DU9A 2NUCA 3H6MA 5C3XA 1EY6A 2EXZA 2WACA 3QOLA 5CR3A 5C4ZA 2PW7A 4RKBA 3SK8A 2LKVA 1EY5A 1EYAA 1IHZA 1SYCA 1EZ6A 2F0UA 4NP5A 3TMEA 2PZWA 4G57A 2KHSA 3OMCA 4ZUJA 3C1FA 5DAUA 4K8IA 4DGZA 2RKSA 1TQOA 5E1FA 1NSNS 4K2LA 2F0OA 4I65A 3MHBA 1U9RA 4WORA 4ZQ3A 3TP8A 3OWFA 3NQTA 5C3WA 2F0WA 5KGUA 5M9OA 1SYEA 3DHQA 3D4WA 2F0QA 4J6HA 2EY2A 1A3VA 4PMBA 5C4HA 2PZUA 4KHVA 3P75A 1JORA 5CV7A 1NUCA 5CGKA 2EYMA 1EY7A 1KABA 1EYDA 2SNMA 3T16A 1EY4A 2OEOA 5KRUA 3P1HA 5IIFA 1JOQA 1STBA 3OSOA 1SNCA 4K5WA 4EQNA 3PMFA 5C5MA 4K8JA 4K6DA 3LX0A 4N9PA 2PZTA 5IGGA 1JOOA 4MIUA 2ENBA 3MZ5A 1EY8A 2SNSA 3OMGA 4KD3A 3TP6A 1TR5A 3D6CA 2F0NA 4H7BA 1STGA 3C1EA 4E6IA 4QB4A 4KY6A 2RDFA 3EJIA 3MXPA 3NP8A 1EZ8A 2EYFA 3NXWA 4KJOA 1KDCA 1SNMA 1SYGA 2F0TA 4IALA 3R3OA 4PNYA 4DF7A 3SK4A 5CC4A 4F8MA 1RKNA 5KEEA 4RKLA 2HQEA 4HMIA 4KY5A 2OXPA 2PYKA 5NUCA 1SNPA 4EQPA 4KD4A 5K5PA 2RBMA 4EVOA 1F2ZA 1AEXA 2F0MA 2OF1A 4KTAA 5EKLA 3MVVA 4R8NA 4EQOA 3DMUA 3MEHA 1TT2A 2F0KA 4ZUIA 1A2UA 5J39A 1KDBA 3BDCA 4PMCA 3NHHA 4YIJA 1ENAA 4NDXA 2F0JA 2F0PA 3SXHA 4NMZA 1F2YA 3SK6A 1EYCA 1KAAA 2EYJA 2F0VA 3ITPA 4ODGA 4OL7A 3TP7A 2QDBA 4HTHA 5CV5A 5I6WA 3QOJA 2EYLA 2F0EA 3HZXA 5I9PA 4ID6A 3RUZA 3S9WA 5I9OA 1EY9A 4DFAA 2EYPA 1SNDA 2F0LA 2M00A 5DEHA 4NKLA 1STYA 5IGCA 4LAAA 5IODA 5F2DA 2F0HA 4B9XA 4F7XA 5HGTA 5IGDA 5IGFA 1II3A 3V2TA 4QF4A 4ME5A 2F0GA 5CV6A 5I6YA 1SYDA 3NK9A 5KIXA 5C6AA 5CV9A 2EY1A 3SR1A 4J1MA 2F0IA 1SNQA 5KYLA 3TP5A 3QB3A 5CV8A 3VA5A 4K5VA 2F3WA 1STHA 1A3TA 3E5SA 5E3FA 5J1ZA
chains in the Genus database with same CATH superfamily
4FP5D 3S1NB 2IPKD 4OO1G 1LV9A 4C1NI 5HGQA 2BE5D 2XIWA 4RG1A 1VQGA 1X65A 1UUPA 3AYHB 4KY7A 2JQOA 5HURA 4RWSC 2JN4A 1F9SA 4KK7A 1CM9A 1JCKB 4K5XA 2UUAL 1TWGH 1CTMA 2WB1E 1GUGA 4BA2I 1KDAA 4WJWA 4OWXB 4BY1H 5JPNC 2WB1G 2QCPX 4ZKBB 5LL6S 1LTTD 3T1YQ 5IYDH 1HFNA 2GVAA 4K8IA 4OWWB 4ZQ3A 1W6KA 4JI2L 2KCCA 1V8QA 3DHQA 1I50H 1QNUA 3A54A 5KRUA 4JI7Q 3OSOA 1Y8OB 1PZKD 2NZ1D 2MPMA 1CUKA 2EDGA 3A7AB 3KYHC 4F88A 1IKMA 2R93B 2WAQG 3HS0C 1HNZL 3T1HL 3PIO3 5M3MG 1QB5D 2VQEQ 1QWYA 3CPFA 3NP8A 5FO9B 1VQIA 1ML0D 3RR5A 4DPGA 1UEBA 1E2WA 3H0GG 3A74A 2O5IC 3TREA 1L1OC 4HCEA 2A6HC 4MHEA 1MBYA 4X66Q 4NDXA 1WTRA 1D6EC 4BY7G 1KTKA 3GTQB 3CCLA 2KHIA 1AP0A 4G7OC 3CCVA 2RQXA 2ALYB 4LFAQ 2WV6D 3G48A 1PFMA 2XRSD 5F2DA 3X3MA 3J81c 4JG2A 4ZRZA 3I90A 4A3MG 1XNQQ 3FKIB 2ICIA 2F0GA 2X69A 2IT1A 1DYQA 4UP8A 2H5XA 5J1ZA 3S2HB 1RDPD 2R7ZH 1Y1VG 1EWCA 1TKWB 1HZBA 2QILA 4NPSA 2FFKB 4RA8A 2L4NA 3KF6A 1XTCD 2MO1A 3QR8A 4HJAA 2VNUD 1WTVA 4QCLA 3R8BA 4LF4L 1DOLA 1RD9D 5CV4A 4LWCA 3A8IE 1AZPA 2R92G 4FF1A 2IWHA 1KRTA 2Z4HA 4JV5Q 1EY6A 3E0EA 4DV4L 2KEEA 2PW7A 4CKCA 2B2TA 4DV6L 2WKDA 5I2YA 2E2IH 3J7AV 1ILPA 2JA6H 1HTLD 3M4YA 4I65A 1BBUA 5E4WC 1VQNA 1XTDA 3TZUA 3S14H 5EBDA 2JEAI 3FPUB 1JE5A 1U4LA 1JORA 4YHHQ 5CV7A 2ZTEA 2MNAA 3J7ZC 2K5DA 3T16A 4IFDH 1JOQA 3EA6A 3S15B 3W1BA 4DR1L 2CH4W 5IGGA 1XX8A 1UWVA 5C44B 4A3GB 4BBRG 4KD3A 3I55A 3M85A 1XPUA 1XPRA 1FD7D 5C3EB 1X3PA 5ELOA 1I94L 2MQHA 2MUYA 1CA6A 2XWBB 1O7LA 5EKLA 2D9UA 4EQOA 2WINB 1TT2A 1EWIA 2OT2A 3STBC 1C48A 2JJQA 2F0PA 5C0XJ 3H3VI 3JAML 3U9SA 4A3EH 1PYSB 4DR3L 2E76C 2VZAA 4A3MH 2E2HH 1CKOA 2KVMA 5I9PA 4ID6A 4DV1L 3RUZA 4IOAA 1SFOH 4C3IH 2JXMB 4QGUA 4ZAIA 2I0QA 1SNDA 5DEHA 1G6ZA 1PZID 5JJLA 3GDEA 2IJ0A 1JR0D 1Y1VH 4HSPA 1II3A 2RCNA 2CWAA 3DUZA 3NK9A 3TBIB 2KBNA 3TP5A 3VA5A 1SJED 2HD3A 3T53B 4O1NA 2XNAC 3GTQH 3KLWA 3BG3A 1UE1A 5J22A 1EY0A 2Q2TA 1MKHA 4TRDA 1B44D 4WRDA 2ZM6L 4KN4C 2AKWB 4WJ4A 2JA7G 1LACA 3TS2A 1OXSC 5IGEA 4ALPA 3V96A 3A5UA 1EQVA 4IPGA 3RNUA 4KN7C 4DKAC 1Y1WB 4C3IB 1CQFA 3W2DA 1YITA 4IUPA 3FMCA 2FINB 3CMAA 2KENA 1NAPA 4FF4A 1JC7A 1IL2A 2OTJA 1EY5A 4RCOA 3FRPB 3TMEA 4F87A 4QUFA 3S17H 3VR3A 4HIOA 3A5ZB 3ND8A 3HOVG 2AMCB 3UI2A 1HR0L 1CZWA 3KF6B 2DNCA 1PRTB 1E3PA 4K2LA 4DV0Q 1HQMC 2HCCA 3PO2G 1HR0W 1PVOA 3S16B 4ZCKA 3GTGB 4A93H 3GV3A 4X66L 4DR4Q 4KKUA 2NZOA 1KXLA 3S1MH 2ZTCA 3BVMA 5EPKA 1K8MA 1TY0A 2CHBD 1N34L 1HR0Q 1HNXL 4HJ7A 1H9JA 1EY8A 1G51A 2BDNA 4H7BA 2R3ZA 4QY7A 5IYBH 3M3YH 1SROA 4P74A 4ULLA 3EJIA 1TWGB 3I4LA 2Q2IA 3NELA 4AYBB 5BN4A 4A4IA 1DONA 2BOSA 2CH4A 1BO0A 1VQOA 4KD4A 1TU2B 4J15A 1UE5A 2M9VA 4A3IH 1R4QB 2K28A 2QA4A 3I4NH 1VF7A 5A2QE 2F4VQ 2B2UA 3TP7A 2UXDQ 1V1PA 3CQZB 1UE7A 2JA7B 2Q2HA 2IHEA 4I7AA 4DFAA 3H3VH 1A15A 4P73A 4BXXH 4C3JB 5GAGC 5LMNW 1WTWA 4A3KH 4DV6Q 2CQOA 2E2DC 4WJ3M 1O80A 3BVZA 5T1IA 1WJJA 2QEJC 1GUSA 1L2FA 1NCVA 5C4XB 3DLLA 4HJ5A 3A8KE 3NUCA 1PH7A 3A55A 5IGBA 1TWCH 5IE8A 1KQSA 4IUNA 1BUVT 1N32Q 1TWHH 1EOTA 5ISRA 1HA5A 4DV5L 1JE4A 1HQRD 1X56A 4DR6L 1DCZA 3JAMc 3TEHB 1IBKL 4JYAL 3CCQA 1U5KA 2F3VA 2JA5B 3R2IA 4DNIA 5C0XI 3NBIA 2KQ3A 1T9HA 2B39A 2VUMG 2FJ2A 1IHZA 3BZDB 5H1SE 4X3UA 1RCVD 3PO3H 1FYCA 4GNXC 4JI2Q 3RMHA 4ZLTF 4JYAQ 4LFBQ 1LTRD 3PUVA 1M1KC 4WORA 3D3RA 4A3GG 3FVQA 4DR7L 2LSSA 1TS2A 1LTLA 3CCRA 1EU3A 3LWEA 1F9RA 1W3SA 2E74C 3NBHA 2EYMA 2Y0SB 2ES2A 4NXML 1J8IA 3J80i 3FDTA 1R9TH 3PMFA 2F4IA 2NVQB 1NY4A 3AEVA 4YCWA 3E0JA 3L2PA 4X65Q 5C44G 4FO2A 3GV6A 3S1RH 2DUDA 2KJXA 1SNMA 2NZHA 3KJOA 3MTSA 4O0AA 5IT9L 1O7ZA 4EVOA 1PFSA 3I4MG 2AHOB 5JEAJ 1MGSA 4GLAC 1CI3M 2EPBA 4XQQA 4YIJA 4JC0A 1IBMQ 5C4HA 1EYCA 4A3JH 2DN8A 4IN3A 4POFA 2AWOA 4KHPL 3G6JB 4DV3Q 4DR1Q 3E6ZX 3K81C 2EYPA 4A75A 3T1YL 4LF6L 3QO2A 2YU9B 4HEDA 1K8AC 5HGTA 1WD1A 1E7ZA 3ER0A 4GOPC 3HOXH 4KKTA 2JEBI 1G8ZD 4K5VA 2K5WA 5D65A 2KCNA 3HOYG 2G5DA 1VQKA 2BA0A 4DV7L 3T56B 1D1IA 3CC4A 5LMNL 1TIID 1NE3A 4X64Q 2KUMA 1HA6A 4LF4Q 4DAYA 2EYOA 4J8QA 1OTCA 2OCEA 3RLOA 3PO3G 2E2HB 4R4OA 3IRBA 4HMJA 3SGIA 2UXCQ 3BU2A 4DXFA 4B08A 3M4PA 1T5EA 4K0KQ 4G4KA 4NP5A 2Z4IA 1D1KA 1JMCA 4JI7L 1Y1WG 1XXGA 2PQAB 4M8AA 2RDHA 1VQDA 2EOTA 2N78A 1Y14B 2F0WA 2RHSB 1XYIA 4DR2L 2ZXPA 2EY2A 3HOWH 5FJ8H 5ELCA 3P75A 3TSSA 1NUCA 4C2MH 5D14A 4HSVA 4RGOS 4K8JA 4C3JH 4A93G 2I5HA 3TDQA 4RMFA 1DOMA 3RLNA 2WAQB 5I4DA 2R93G 1VQPA 3TS0A 1EQTA 1IZ6A 3KUPA 4P75A 3MWYW 2K4KA 1I6HB 4XTCS 1ILQA 2BDOA 3M4OH 5K5PA 5NUCA 3URYA 1YHQA 4DNRB 1YNJD 1WD0A 1Q1BA 5DNFA 3PF5A 4JI6L 1S72A 3PUWA 2F0JA 3SK6A 1H9SA 3NSWA 3T4AC 2EE1A 1B50A 4DAMA 2WB1B 2K52A 4JI5Q 2QGQA 4NKLA 1ET9A 3HOYH 1AE2A 1H9RA 2F0HA 1Y8NB 1ASZA 5JVG3 2DJGC 2IX0A 1HNWQ 1BOSA 4IQZA 5EPJA 2F0IA 3SR1A 5AJ3Q 5GROA 4ZK9B 3FPPA 4POGA 4JI5L 1JWUD 1JB3A 1SBBB 3MC0B 2JYOA 3HGBA 2I5LX 4UY8C 3HOXB 5IP9G 2WKCA 4K14A 1Q3LA 3K5MA 3EVQA 2R7ZG 1GUWA 2K33A 4R1JA 1Q8IA 4OO1H 1LO5D 5JOBA 4KV6A 3K6OA 1BCPD 1SNOA 4LNQA 3CPWA 3J80c 2E75C 5IWAL 1BF4A 4HIKA 1ET6A 1D5MC 4B3ML 2F52A 1QUQB 1SJHD 4JI8L 4GNXA 2PZWA 3PIOA 4IFDI 3LWUA 1X32A 1G91A 4KLKA 1HZAA 1Q1EA 2F0OA 4B3TQ 3MHBA 2XVSA 4BY1B 1WTOA 3ULJA 2K03A 4J6HA 1STEA 3RN2A 3IL8A 4LF8Q 2NTSA 2ZJPA 1STBA 5BR8Q 2UUBL 3GQBA 5FLXE 2L1BA 3LX0A 1BCPB 1K73C 2PZTA 3J81L 4AQYL 3I70A 5C0XG 3GTOB 1NMFA 1X3EA 3CP0A 4JI0Q 2I07B 3OIQA 3C1EA 3HRZC 2OQ0A 3PCOB 1IW7D 1S40A 1V1PB 1JB7A 3MXNB 4F8MA 4A3BB 1QZHA 2DY8A 3D0FA 1EQRA 1I6VC 2RBMA 2O5JC 1F77A 5EJWA 1HXYD 2D62A 2CVRA 1NBWA 2B63B 1PYWD 5C4JB 3HOUB 4X3KA 5FLXc 3H0GB 3MXNA 5IT9E 4DAYB 5ELBA 1YJ9A 2RDGA 3OW7A 3VYUA 2H4OA 1EY9A 1OXUA 4QQBX 2K04A 1EEFD 2ZJRA 5J3BA 4YHHL 5IGCA 4B9XA 1B9NA 1FGUA 1SYDA 3PQIA 1BCPF 1E24A 3DWAA 2A74C 4LUOA 2WAQE 4KMUC 4QL5A 1XNRQ 5AJ3L 2A68C 1LABA 4R9WA 1EEID 4N8X1 3ULLA 1EIYB 4IOCA 2F0DA 1A2TA 2HDLA 2B2WC 3K8AA 4JI1Q 4OEMB 3OIPA 5ELNA 3K57A 1FGBD 1QUQA 3E3XA 3GTMB 5JJZA 2V1CC 5IYDG 1AH9A 2J7ZA 2JA7H 2SOBA 1WTPA 1G2TA 4BS9A 5HY6A 3PIP3 4QIWB 5CR3A 5IGFA 1V1OA 1E0BA 5M5WB 4DUYQ 2K32A 1WOCA 2VL6A 2ZXRA 3MA2B 2R92H 2D5DA 1HUMA 4M1UB 1TWAB 1U9RA 2YU9H 1VS0A 4RCNA 3BJUA 1S5CD 2RSOA 2E2JB 2F0QA 4OHJA 5M3FB 4XQJA 4JOIA 4BBSG 1ICFB 1JJCB 4P2CB 1KABA 1YIJA 2OEOA 1RJTA 3P1HA 1E22A 4K5WA 3K59A 3AB9A 4DV2Q 1N36Q 3AFQA 5L37A 2MHVA 1D5ZC 1LT3D 3F8TA 4NXNQ 4L5TA 4DUZL 4KY6A 1PH8A 1KDCA 1GUNA 2VQFL 1E1OA 3M7GA 4OGQC 2IY5B 1EIFA 4BY7H 3M4QA 4A3IB 2R93H 4DR6Q 5IYBG 4GKKL 4ZUIA 4FNFA 4GZYC 5IY0A 1Z6HA 5IP7G 3UDGA 5JVH3 1PH3A 1XMQL 4A3BH 2F0VA 1J5EQ 2TSSA 1BCPC 3UE0A 1S5FD 4JCVE 2VQFQ 1IYVA 2EYLA 3CW2C 4A3FB 3UDFA 4H44C 1BBXC 1ASYA 2Y0SG 3CAMA 2HIVA 2NN6H 3U4ZA 3FKIH 4RAUC 4LAAA 4A3EG 4JI3L 3PO3B 1RODA 2OQKA 2Q8IB 3KDFB 2EY1A 1K83H 3EBEA 1CSPA 2TMPA 3BS1A 5LMNQ 4U68A 2O2LD 3BYYB 3R93A 1PZJD 2PNHA 4A3KG 4IZ8A 4PZ7A 4N9TA 4L5RC 1KAWA 2JA5G 1A63A 2EJFC 3GTPH 4A3LG 3O13A 1X9NA 2EY5A 1VQ4A 3HKZB 1HZ9A 4DK0A 4RH6A 2IL8A 3D4DA 1K3RA 5KNBA 3SE0A 4YWLA 5IP9H 3U9OA 1K83B 1LTID 3MXUA 2PMZE 3QOLA 1CZGA 1TWAH 5C4ZA 1SYCA 1MSGA 2QKIC 4BBSH 4MNOA 2EIFA 1Q90A 1SSOA 3F1ZA 1LYLA 4JBJA 5FLMG 4KHPQ 3D4WA 4CJ0B 4CKEA 2UU9L 4A3DH 1I6HH 3I4MB 1HCZA 2E8GA 4CDCC 1KL9A 4JOIC 4DR5Q 1EY7A 3HOZH 3LGJA 2A69D 1A62A 1AN8A 2OWOA 3S15H 3OTOQ 1ESRA 5ELEA 4N9PA 5KNDA 4A3CG 4JPBW 2A8VA 3ICEA 4MIUA 5IWAQ 3K7UC 3NTHA 1K9MC 2F0NA 3ONAB 2BH2A 3VDYA 3D6WA 2MJ8A 3NXWA 1SYGA 2OTLA 4OIJA 3VA7A 1V9PA 2B2TC 3RLFA 3MVVA 2D0OA 3K58A 2ID0A 1I4PA 1HZCA 2E2IB 2HCIA 2Q8RE 4GLVB 1DOKA 4AYBE 4QIWE 4B3SQ 4JK1C 1W2BA 2B8FA 1UEAB 2MGSA 3I3CA 4A3KB 2X6LA 3I4NB 1STYA 4XYQA 5IODA 1UNSA 1EWHA 1VQ5A 5CYUA 4K6LA 4A76A 3I2ZA 1CA5A 1GKHA 2DNEA 2F3WA 3CQZH 2JA5H 4P71A 3U4VA 3J7A5 1GO3E 5IOCA 4CJ1B 4BWGB 1RF2D 5JEAG 3SEBA 2XN9C 2KA7A 5C5LA 1C7YA 1L1OA 2AQ3B 4S3SA 3IFDA 4A3FG 4X3SA 4OX9L 4RHSA 4L5QA 3OPOA 3MXGA 5C4XH 3HKZE 2N3SA 5LHY1 2B2VA 3I56A 1LTGD 1SYFA 2AUKA 5CMDA 5D3IB 1PA6A 1M8AA 2MFIA 4DNTB 2WACA 1D5XC 1VF5C 2VB3X 1VQBA 3BDOA 4YWMA 3SK8A 2L11A 4B3SL 1EYAA 2F0UA 4RGMA 1PMRA 2K7VA 5COYA 2VY3A 3CCMA 4DGZA 3HOZB 3L0OA 1TQOA 4FXDA 3S2HH 2GN5A 5C3WA 1WFQA 3OHXC 4GOPB 1CQVA 3T1HQ 1FNUA 3TN2A 2ATWA 3GTGH 1H95A 2A19A 1PV4A 4L8JA 1Y1WH 2A68D 1CSQA 1A6XA 1J5EL 1H9KA 1D7QA 1SMYC 1PTOH 4RHRA 3ULPA 1QCBD 2JE6I 3H91A 4EQNA 1X3FA 5M3FG 5CBAE 3B6YA 2SNSA 1D2BA 4UAIA 3I72A 3CD6A 5BN3A 2K14A 1SLJA 4IFDG 2LFNA 3GTJH 2SDFA 3M3YB 3I4NG 2H1EA 1NR2A 3R3OA 3S2DB 4LUVA 3SK4A 4UDUC 1N8RC 3H3VC 2Y0SE 1FNWA 4OXPA 2A6HD 3DWPA 1CFMA 3K0XA 2VW9A 4KI0A 5AFWA 2GVBA 1LM0A 2HHHL 4DXGA 1YI2A 4DR3Q 3NHHA 2M2LA 3S2DH 1LLRD 2K5HA 4ILWA 3ITPA 2VB2X 3KLRA 5FO7B 3RZDH 1XMOQ 3SDZA 1B3AA 3C46A 2KCTA 3QWNA 3S1QH 5M5YH 2NVXB 3KF8B 4CBVA 3F2DA 4V0BA 2JA6B 1X55A 2CQAA 1O7IA 3H15A 3EN2A 3AMUA 2UUCL 1B8AA 1HHVA 4CJ2C 3F2UA 4L5SA 4B3RQ 2AQ2B 1FL0A 2E2JH 4LFAL 2PW5A 2CW0C 5GAEC 1EL0A 1VDZA 3HEJA 3T13A 2O4XA 4CKBA 4Q0FA 2YV5A 1C9OA 2B63G 1GHJA 1EOVA 3ERQA 2XWJB 4GKJL 4G7ZC 1KIXA 3HOWB 2PCFB 3LNNA 5C3EH 1RIPA 3P20A 3PSIA 1Q7YC 3QIAA 1KRSA 4UPAA 3FHWA 3V05A 1NR4A 1Y1VB 2B2WA 3W3AA 4ZUJA 1HJPA 2JP1A 2VS1A 3K7AH 1Q86C 1PTOF 4ME3A 1SFOB 4OWTB 3CCJA 1K28A 1B70B 3RZOB 1HTPA 4R4QA 4NB3A 4A3MB 3NTIA 1SE3A 2EQSA 5GQOA 4A3EB 5KNCA 2UUCQ 5IYCH 1F2LA 3GTLB 4GLXA 4XDXA 1EYDA 4LFCL 5M3MH 3KDFA 3EFXD 1QJOA 3K5OA 1X3QA 1K0RA 1I3QH 4A3DG 3DM3A 4PG3A 2ENBA 1X6OA 3MZ5A 3C2PA 3OMGA 2G9DA 4OELB 4X6AH 3ZYYX 1SE2A 4GOPA 1C0AA 2RSNA 4EGVA 3R2TA 3HP3A 1VMCA 2ZXOA 2F0TA 2IHFA 4P72A 2QEXA 4EQPA 2K1BA 3DXJC 5E4XA 3CF5A 1AEXA 2BCOA 4HN7A 1VQAA 2BH8A 3DMUA 4PZ6A 2KOLA 1CT1D 4HCSA 5K36H 1PTOB 4HJ9A 3NE5B 1KAAA 2R7ZB 4DR5L 1LT5D 3S14B 5CV5A 3QOJA 4UHVA 2EZVA 2Z0SA 4A3IG 1S5DD 1IL8A 2K5VA 4R8IA 1Z47A 1NMGA 5JJIA 5FKAC 3UDXA 4DV0L 3GTPB 2D2CC 1GM5A 3CMEA 3IAYA 5BR8L 1TS3A 5CV9A 4CDEC 2L15A 1DM0B 4ZYSA 2QF7A 3S16H 3E5SA 5E3FA 3CXCA 4N8FA 1XWEA 3S1RB 5EBCA 1LTSD 1WCMB 2EY6A 2C5CA 2JA9A 5KYIA 1EYGA 3TP6A 4B3RL 1PTOD 2WIIB 1GHKA 2MO0A 1FNVA 1ENCA 2YYZA 3SVMA 3QG1A 2F0FA 3CCUA 1WYDA 4RGTA 3HFZB 1IYJB 3I4OA 1CKNB 2Z6KC 2MP1A 4LF6Q 4OIKA 3GTJB 1MHWC 4FYDA 1MJCA 1AW7A 5FLMH 1I4RA 1EZ6A 1KNAA 1RTNA 1YNJC 1QZGA 2KHSA 2PO4A 1HNXQ 5IYCG 5I2XA 2RKSA 4BY7B 1NSNS 1LUZA 2NWGA 1CKMA 3VR5A 1YNXA 2EJMA 3X3NA 1WCMH 2VUMH 4TQUS 1QVGA 1BQQT 1Q12A 4H0LC 4A3JB 1A3VA 2XGTA 1VQ7A 4X3TA 1YNND 3HG9A 1VQLA 3F2CA 2A69C 4IJHA 1SRUA 3AFPA 2ZTDA 1VQCA 2UXCL 3D6CA 1QOHA 5E7NA 1IW7C 1PH1A 3HKSA 4E6IA 2A73B 2PI2A 3Q8DA 3GTLH 2N8NA 3MXPA 2XTIA 2EYFA 4IALA 2UXDL 5KEEA 5EAYA 2HDMA 1UAPA 4RKLA 2Z9HA 3VR4A 4EQ5A 4KY5A 1PHJA 4A3BG 1RHPA 1SNPA 1EIHA 2B2YA 1IYUA 4ABNA 2YTYA 4XT3B 3I91A 1HUNA 3A8JE 3AU7A 1A2UA 1IBLL 4MTNA 2NN6G 1BVSA 1Q81C 1S5ED 4DV3L 4MTKA 3S1NH 1O7YA 2LXKA 4DK6C 1I4GA 1PDQA 4DK3C 4Q5VA 2Q2UA 1L0WA 1MD2D 2EJGC 3Q0AA 1SMYD 5IP7H 3GTKB 4DR4L 1P16A 2D0PA 1I5FA 5G3LD 3Q6SA 4JV5L 1SXTA 3HOYB 4B3MQ 2KECA 5I6YA 3KJPA 4FXKC 1XMQQ 4KKSA 1ZYRD 3GP7A 2CCZA 1HPCA 1B7YB 3A7LA 3I7FA 1BBWA 4HR7B 3J81E 4PQXA 2RA4A 4JI6Q 3T51B 4IJLA 1VQMA 2DGYA 2NBFA 3AQQA 2JSOA 5EKKA 4QMGA 5JAVA 1RL2A 4BY1G 4L63B 2JA8B 2F03A 5G3LF 3J81i 4LW1A 2LY7A 5M5YB 3UDIA 4XYOA 4RFBA 4DR7Q 2R6GA 2UU9Q 4DU9A 2K01A 3PO2H 1B4OA 1GUTA 4UP7A 4JI4Q 4DAVA 3S24A 1Y8PB 3ERSX 2EVBA 5E1FA 2CWPA 1JJGA 3TP8A 1AZQA 3M7NA 4TKOB 3VR2A 2Z6BA 4A3DB 1WTQA 4JI4L 2IX1A 2Z8LA 2RCFA 2HUGA 1TY2A 4QUCA 3D31A 5IIFA 3P7JA 2F1MA 2IW3A 1WVLA 3CU7A 1I4QA 1E2ZA 4IUUA 2K75A 1ZKOA 1J9OA 2AWNA 2QW7A 2Z1CA 2NVXH 1JICA 4QB4A 2B8GA 1K8OA 1LTAD 4NW2A 2PNRC 4FF3A 1H9SB 4WFN3 2FMCA 3OTOL 1KHIA 1VQ6A 4IO9A 1EQQA 2F0KA 2PQAA 3ZJYC 1KDBA 3BDCA 3N52A 2G9HD 4ODGA 4A93B 3RN5A 1IBLQ 1VMPA 1PTOC 4O2DA 1UE6A 1OXXK 4K0KL 4XT1B 3CCEA 2AUJD 5I9OA 5M5XB 4LF7Q 1XNQL 2F0LA 4IPHA 3IKJA 4F7XA 2NVQH 1DZ1A 1OXVA 4DAPA 2EXDA 5CV6A 3IFTA 4OX9Q 1FJGQ 1N33Q 1I50B 4J1MA 5M5XH 1SNQA 2A1AA 3A56A 4A3FH 3MEFA 3WDNA 1CHPD 1PFBA 3CC2A 2E5LQ 1TS4A 1PH4A 1PH2A 2JA8H 1VQ8A 2UXBL 4GN4B 5FK9C 3G71A 3KF8A 1KNEA 1PXUA 2WP8J 4JVZA 4DV1Q 4DV5Q 2LS01 4KJNA 5BN5A 3NWSA 1I4HA 1IBML 2JA6G 2F0SA 1OO9B 5DM63 3L3OC 2C35B 3DM1A 2XRQD 4A3LH 1DD2A 3I8ZA 1DXMA 3CKIB 3GO5A 1VQEA 2HHHQ 4O42A 5IT9c 4V190 3W5OA 5M5WH 3C1FA 1ONLA 4C3HH 3VYSA 1XNRL 3GD7A 1G6PA 4XIGS 4UP9A 3OWFA 3CCSA 4GKKQ 1A0IA 1XPOA 5LL6X 5M3FH 2AQ1B 2VQEL 4PMBA 2RHQB 2HT1A 3GTMH 2HQLA 4DN4M 5FOBB 3KBGA 1FVIA 4FXGC 1NNXA 5FO8B 5C44H 1WCMG 3ND9A 1JQYD 4DK1A 3E9IA 1J6QA 4R4TA 1TXYA 1SN8A 1TWFH 1JJ2A 1AFPA 4IFDJ 4Y52H 4IPCA 2A6EC 2L5TA 4X64L 1TWFB 1JOOA 1S4ZA 3PO2B 4FVMA 1GJXA 1I94Q 5ELFA 2X6GA 3OW2A 1STGA 4YCVA 5EKIA 4X62L 3HOZG 1U4RA 2CKZB 4X65L 3NQIA 1GVPA 1XMOL 2B2YC 3G6EA 4HMIA 1GOZA 1ICWA 4GN3B 2NVYH 3K7AB 3JAME 4KTAA 4C56C 2N88A 2QDLA 1LT6D 2NVYB 1QG7A 3BZKA 4PMCA 4C3IG 4GS3A 1T5XD 3RZDB 1N9WA 4DV4Q 1K8GA 5A2QL 2F0EA 2CW0D 1PFNA 3CC7A 2PI2E 4AIMA 2M00A 1SEBD 1KC8C 1OXTA 5EQ0A 3WOEA 2SEBD 3NBHB 1KLUD 1U4PA 3CHBD 5IGDA 1TVXA 4R4IA 1GUOA 4QF4A 1V43A 4Y7NB 5KIXA 1K0SA 5KYLA 1EFID 1LTBD 3NEMA 3QB3A 3KOJA 4LF8L 3HOUH 1FJGL 1QNKA 2VXWA 1YZ6A 1LT4D 4R4CA 3J7AF 3OWEB 1STAA 1NJIC 1YHAA 3PIPA 3GTOH 4I7ZC 1STNA 2VUMB 2FMMA 1F2MA 1BDOA 3SHLA 4H02A 2NB0A 2B29A 1RTOA 3S17B 1YVCA 2EYHA 1DGSA 3Q22A 2RVLA 4HAEA 5JEAH 3K5LA 3PUZA 2L9HA 1B1ZA 1PLFA 4K2KA 1QVFA 3D8GA 2DJFC 3MAQA 2I5MX 3H6MA 5C3XA 3EIVA 5EPLA 1L1OB 3U50C 5C4XG 1ZYRC 4G57A 3HOWG 4LF5L 4JBKA 5C3EG 3K80C 1YJWA 4AQYQ 1Z9FA 2V4DA 3NPPA 1VQHA 3NQTA 2B2VC 5KGUA 5M9OA 3KK7A 4JI0L 4PZ8A 4C3JG 1BKBA 1E1TA 1VQ9A 2PZUA 1JWMD 3I73A 4KHVA 3JAMi 4BBRH 5JJKA 3TZDA 1MJEA 1SNCA 2KHJA 5T1GA 1SMXA 3WOFA 2B3GA 1Q46A 2NN6I 1PH9A 1E2VA 1R9TB 4JBMA 1YJNA 1ENFA 2LXJA 5A35A 1R4PB 1SE8A 4U673 4G7HC 3F2BA 2L0CA 1X3GA 2RDFA 5C6AA 4GKJQ 3DEPA 1P8LA 2F3IA 2FXQA 1MI2A 1RKNA 2BE5C 1JT8A 2OXPA 1CHQD 4BA1I 3KLSA 5CORA 4AYBG 3PV0A 3M9BA 1B53A 3J81j 3U58A 1KD1C 2R92B 3MEHA 3BZCA 2K5NA 3BYTB 1ZEQX 4JI8Q 3BVGA 1HH2P 4LF5Q 1ENAA 3HKZG 1Q8KA 4C1NK 4OL7A 2GA4B 2EYJA 4IURA 2QDBA 1WI5A 4HTHA 3W1GA 4H13C 5D3DA 3STBD 3C3LA 3CRKC 1V1QA 2I46A 1EU4A 3J80L 3VYRA 1DJRD 4XQNA 2UUAQ 1K3BC 1MIUA 2ZM6Q 5LMUL 4MN3A 4PMWA 1B2TA 3V2TA 2J4XA 4MZ9A 4LUZA 1XJVA 1TWCB 5CV8A 1A3TA 3FKIG 3PUXA 1HNWL 4FF2A 4QJFA 3OYYA 1N34Q 4CDDC 2A5HA 4DR2Q 1QILA 1FR3A 4TVAB 1F9PA 1A3UA 4Z9CB 2NVTH 1CKNA 4B9WA 3G4SA 4IUQA 3HOVB 3PGZA 2PQEA 3K0YA 2R7FA 1HNZQ 1B3QA 1SR3A 4HJ8A 2B63H 2NVTB 4A3GH 4JI1L 2LKVA 2N49A 1N33L 2RF4A 1TWHB 4CGYB 3OMCA 2XSCA 3H09A 5M3MB 3UE1A 3A0JA 1PH6A 1N36L 5LMUQ 2B2UC 3G7LA 2ASBA 4GN5A 4DV7Q 3E9HA 2WFWA 5ELDA 2K05A 3Q24A 4OONA 4NXMQ 4IPDA 5FLXL 5C0XH 3K5NA 2SNMA 5JPMC 4DUYL 1KLGD 4LK1C 2P5ZX 4K6DA 3H94A 3M4OB 4EX5A 2NTTA 4IUTA 1YNNC 3PUYA 2ICEC 1TR5A 1Z7TA 5C4JH 2NYZD 4YY3L 3Q23A 5GADC 4IUVA 4YWKA 4DF7A 4PNYA 1N32L 4A3CH 1W6JA 5DLQE 2J0TD 2PYKA 3J7YW 4BBSB 1F2ZA 3DWQA 1EIGA 4C2MB 4HIDA 4JI3Q 3J80E 4LJZC 1G2SA 1PRTF 3EQLC 4NMZA 1C4QA 3NTKA 2CFMA 2A6ED 3HZXA 3TRZA 4LF9Q 3S9WA 1ESFA 1SE4A 3JC66 4RGNA 1VQJA 2C9OA 3L7ZC 2PMZB 3MFYA 5K36G 1NTGA 1IXRA 4APVA 1YHBA 2KCMA 4X62Q 2YTVA 3DEOA 2F4VL 4BBRB 3S1QB 2PPBC 2IX3A 4XXEA 1U4MA 4B3TL 5DM73 1PRTD 4LMQD 1B9MA 2UXBQ 1G291 1QVCA 4YY3Q 1JWSD 1L0XB 4NXNL 3SK5A 4DA2A 5EGTA 1VQFA 1Q82C 1HFGA 4KHZA 3HOUG 4LFCQ 1ZXTA 3WWVA 1YEZA 1JOKA 3N6RA 1MSHA 3MFGA 4LFBL 1GXDC 1SYBA 1GD7A 2LMCB 1EUJA 2R61A 3EROA 3BDLA 4C3HG 2NUCA 2EXZA 2K5QA 4RKBA 1EFWA 3OOCA 4TSSA 3QJYA 5FJ8G 1L0YB 1AE3A 2FHTA 5DAUA 3RD4A 3PF4A 1S3OA 3GTKH 2K6AA 1SYEA 3NENA 3HOVH 1PH5A 4Y7NH 5GAHC 4CDFC 5CGKA 1EY4A 1I3QB 4OO1I 1BXTA 1SDFA 1Y69U 5C5MA 2L12A 2BA1A 2R7DA 3L9AX 1I4XA 4PV1C 3FP9A 2HIXA 4DV2L 3CRLC 2E5LL 1BR9A 5TSSA 2Q8TA 4ZKCB 1SAPA 1IBKQ 1S5BD 1D8LA 1EZ8A 4KJOA 5CC4A 3RZOH 1WTXA 1HRJA 2HQEA 4DUZQ 3KFUA 4LF7L 2F0MA 2OF1A 2ZJQA 4R8NA 1VCIA 4C3HB 1F9QA 1C8CA 2L55A 1QE6A 5J39A 4HIMA 3KLSX 1M90C 3S1MB 1M4VA 4JW0A 3SXHA 1U0LA 1F2YA 4GNXB 1H9MA 2DY7A 4L6TB 1BNZA 3H0GH 5I6WA 3I4MH 4CHTB 3HOXG 2YTXA 1IKLA 5CBEE 2UUBQ 2Z6KA 1O78A 1YBYA 1WTHA 2K50A 2JK8A 4LF9L 1CK1A 1X54A 3TQYA 3VR6A 4AH6A 4A3JG 1A8VA 1PYBA 2ZT9C 2KEDA 4FDBA 4ME5A 1TS5A 3FEWX 3NWTA 3VYTA 2JA8G 3KBXA 2N55A 1STHA 1PRTC 4YCUA 3D4RA 4JBWA 4BXXG
chains in the Genus database with same CATH topology
4FP5D 3S1NB 2IPKD 4OO1G 1LV9A 4C1NI 2BE5D 2XIWA 1UUPA 4KY7A 5HURA 4RWSC 1F9SA 4KK7A 1CM9A 1JCKB 4K5XA 1CTMA 1GUGA 4BA2I 1KDAA 4WJWA 5JPNC 2QCPX 4ZKBB 5LL6S 1LTTD 1HFNA 4K8IA 4ZQ3A 1W6KA 2KCCA 1V8QA 3DHQA 1QNUA 3A54A 5KRUA 3OSOA 1Y8OB 1PZKD 2NZ1D 2MPMA 2EDGA 3A7AB 4F88A 1IKMA 2R93B 3HS0C 3PIO3 1QB5D 1QWYA 3NP8A 5FO9B 1ML0D 1E2WA 2O5IC 4HCEA 2A6HC 4MHEA 1MBYA 4NDXA 1WTRA 1D6EC 1KTKA 3GTQB 1AP0A 4G7OC 2RQXA 2WV6D 1PFMA 2XRSD 5F2DA 3X3MA 4ZRZA 3I90A 3FKIB 2ICIA 2F0GA 2X69A 2IT1A 1DYQA 5J1ZA 3S2HB 1RDPD 1EWCA 1TKWB 2QILA 2FFKB 4RA8A 2L4NA 1XTCD 2VNUD 1WTVA 4QCLA 3R8BA 1DOLA 1RD9D 5CV4A 3A8IE 1AZPA 4FF1A 2IWHA 2Z4HA 1EY6A 2KEEA 2PW7A 4CKCA 2B2TA 2WKDA 5I2YA 3J7AV 1ILPA 1HTLD 3M4YA 4I65A 5E4WC 3TZUA 5EBDA 2JEAI 3FPUB 1U4LA 1JORA 5CV7A 2K5DA 3T16A 4IFDH 1JOQA 3EA6A 3S15B 5IGGA 1XX8A 5C44B 4A3GB 4KD3A 3M85A 1FD7D 5C3EB 1X3PA 2MUYA 1CA6A 2XWBB 1O7LA 5EKLA 2D9UA 4EQOA 2WINB 1TT2A 2OT2A 1C48A 2F0PA 5C0XJ 3JAML 3U9SA 2E76C 2KVMA 5I9PA 4ID6A 3RUZA 2JXMB 4ZAIA 1SNDA 5DEHA 1G6ZA 1PZID 2IJ0A 1JR0D 4HSPA 1II3A 3DUZA 3NK9A 3TBIB 3TP5A 3VA5A 1SJED 3T53B 4O1NA 2XNAC 3BG3A 5J22A 1EY0A 4TRDA 1B44D 4WRDA 4KN4C 1LACA 1OXSC 5IGEA 3V96A 1EQVA 4KN7C 1Y1WB 4C3IB 1CQFA 3W2DA 4IUPA 3FMCA 2FINB 1NAPA 4FF4A 1JC7A 1EY5A 4RCOA 3FRPB 3TMEA 4F87A 4QUFA 3VR3A 3ND8A 3UI2A 1CZWA 2DNCA 1PRTB 4K2LA 1HQMC 2HCCA 3S16B 3GTGB 3GV3A 4KKUA 3BVMA 5EPKA 1K8MA 1TY0A 2CHBD 1H9JA 1EY8A 2BDNA 4H7BA 2R3ZA 4ULLA 3EJIA 1TWGB 3I4LA 5BN4A 4AYBB 1DONA 2BOSA 1BO0A 4KD4A 1TU2B 2M9VA 1R4QB 2K28A 1VF7A 5A2QE 2B2UA 3TP7A 1V1PA 3CQZB 2JA7B 4DFAA 1A15A 4C3JB 1WTWA 2E2DC 1O80A 3BVZA 5T1IA 2QEJC 1GUSA 1NCVA 5C4XB 3A8KE 3NUCA 3A55A 5IGBA 4IUNA 1BUVT 5ISRA 1EOTA 1HA5A 1JE4A 1HQRD 1DCZA 2F3VA 2JA5B 3R2IA 5C0XI 2KQ3A 3NBIA 2B39A 2FJ2A 1IHZA 3BZDB 4X3UA 1RCVD 1FYCA 3RMHA 4ZLTF 1LTRD 3PUVA 4WORA 3D3RA 3FVQA 1TS2A 1EU3A 3LWEA 1F9RA 2E74C 3NBHA 2EYMA 2Y0SB 1J8IA 3FDTA 3PMFA 2F4IA 2NVQB 3E0JA 4FO2A 3GV6A 2KJXA 1SNMA 3MTSA 5IT9L 1O7ZA 4EVOA 5JEAJ 1MGSA 1CI3M 2EPBA 4XQQA 4YIJA 5C4HA 1EYCA 2DN8A 4IN3A 2AWOA 3G6JB 3E6ZX 2EYPA 3QO2A 2YU9B 4HEDA 5HGTA 1WD1A 4KKTA 2JEBI 1G8ZD 4K5VA 2K5WA 5D65A 2KCNA 2BA0A 3T56B 1D1IA 1TIID 2KUMA 1HA6A 4DAYA 2EYOA 4J8QA 2E2HB 4HMJA 4DXFA 4B08A 1T5EA 4G4KA 4NP5A 2Z4IA 1D1KA 1XXGA 4M8AA 2RDHA 2EOTA 2F0WA 1XYIA 2ZXPA 2EY2A 5ELCA 3P75A 3TSSA 1NUCA 5D14A 4HSVA 4RGOS 4K8JA 3TDQA 1DOMA 5I4DA 2WAQB 1EQTA 3KUPA 3MWYW 1I6HB 4XTCS 1ILQA 2BDOA 5K5PA 5NUCA 3URYA 4DNRB 1YNJD 1WD0A 1Q1BA 5DNFA 3PUWA 2F0JA 3SK6A 1H9SA 3NSWA 3T4AC 2EE1A 1B50A 2WB1B 4NKLA 1ET9A 1H9RA 2F0HA 1Y8NB 5JVG3 2IX0A 1BOSA 4IQZA 5EPJA 2F0IA 3SR1A 4ZK9B 3FPPA 1JWUD 1JB3A 1SBBB 3MC0B 2JYOA 3HGBA 3HOXB 2WKCA 4K14A 1Q3LA 3K5MA 3EVQA 1GUWA 2K33A 1Q8IA 4OO1H 1LO5D 5JOBA 4KV6A 3K6OA 1BCPD 1SNOA 2E75C 1BF4A 1ET6A 1D5MC 1SJHD 2PZWA 4IFDI 3LWUA 1X32A 1G91A 1Q1EA 2F0OA 3MHBA 2XVSA 4BY1B 1WTOA 2K03A 4J6HA 1STEA 3IL8A 2NTSA 1STBA 3GQBA 5FLXE 2L1BA 3LX0A 1BCPB 2PZTA 3J81L 3I70A 5C0XG 3GTOB 2I07B 3OIQA 3C1EA 3HRZC 1IW7D 1V1PB 4F8MA 4A3BB 2DY8A 1I6VC 2O5JC 2RBMA 1F77A 5EJWA 1HXYD 2D62A 2CVRA 2B63B 1PYWD 5C4JB 3HOUB 4X3KA 3H0GB 3MXNA 5IT9E 5ELBA 2RDGA 3OW7A 3VYUA 2H4OA 1EY9A 1OXUA 2K04A 1EEFD 5IGCA 4B9XA 1B9NA 1SYDA 1BCPF 3DWAA 2A74C 4KMUC 2A68C 1LABA 4R9WA 1EEID 2F0DA 1A2TA 2HDLA 2B2WC 3OIPA 3K57A 1FGBD 3GTMB 5JJZA 2J7ZA 2SOBA 1WTPA 1G2TA 4BS9A 3PIP3 4QIWB 5CR3A 5IGFA 1V1OA 1E0BA 5M5WB 2K32A 2ZXRA 3MA2B 2D5DA 1HUMA 4M1UB 1TWAB 1U9RA 4RCNA 1S5CD 2RSOA 2E2JB 2F0QA 4OHJA 5M3FB 4XQJA 4P2CB 1KABA 2OEOA 1RJTA 3P1HA 4K5WA 3K59A 3AB9A 2MHVA 1D5ZC 1LT3D 4KY6A 1KDCA 1GUNA 3M7GA 4OGQC 4A3IB 4ZUIA 4FNFA 4GZYC 1Z6HA 5JVH3 2F0VA 2TSSA 1BCPC 1S5FD 1IYVA 2EYLA 4A3FB 4H44C 1BBXC 2NN6H 4RAUC 4LAAA 3PO3B 1RODA 2Q8IB 2EY1A 2TMPA 3BS1A 4U68A 2O2LD 3BYYB 3R93A 1PZJD 4IZ8A 4N9TA 2EJFC 3O13A 2EY5A 3HKZB 4DK0A 4RH6A 2IL8A 3D4DA 5KNBA 3SE0A 3U9OA 1K83B 1LTID 3MXUA 3QOLA 5C4ZA 1CZGA 1SYCA 1MSGA 2QKIC 1Q90A 1SSOA 3D4WA 4CJ0B 4CKEA 3I4MB 1HCZA 1EY7A 2A69D 1AN8A 1ESRA 5ELEA 4N9PA 5KNDA 4MIUA 3NTHA 2F0NA 3ONAB 3D6WA 2MJ8A 3NXWA 1SYGA 4OIJA 3VA7A 2B2TC 3RLFA 3MVVA 3K58A 2ID0A 1I4PA 2E2IB 2HCIA 2Q8RE 1DOKA 4JK1C 2B8FA 1UEAB 2MGSA 3I3CA 4A3KB 2X6LA 3I4NB 1STYA 4XYQA 5IODA 1UNSA 1EWHA 5CYUA 4K6LA 1CA5A 2DNEA 2F3WA 5IOCA 4CJ1B 4BWGB 1RF2D 5JEAG 3SEBA 2XN9C 2KA7A 5C5LA 2AQ3B 4S3SA 3IFDA 4X3SA 4RHSA 3OPOA 3MXGA 5LHY1 2B2VA 1LTGD 1SYFA 2AUKA 5CMDA 5D3IB 1M8AA 4DNTB 2WACA 1D5XC 1VF5C 2VB3X 3BDOA 3SK8A 2L11A 1EYAA 2F0UA 4RGMA 1PMRA 2K7VA 5COYA 4DGZA 3HOZB 1TQOA 4FXDA 5C3WA 3OHXC 1CQVA 1FNUA 3TN2A 4L8JA 2A68D 1A6XA 1H9KA 1SMYC 1PTOH 4RHRA 1QCBD 2JE6I 3H91A 4EQNA 5CBAE 2SNSA 1D2BA 4UAIA 3I72A 5BN3A 4IFDG 2LFNA 2SDFA 3M3YB 2H1EA 1NR2A 3R3OA 3S2DB 3SK4A 4UDUC 3H3VC 1FNWA 2A6HD 3DWPA 1CFMA 4KI0A 5AFWA 4DXGA 3NHHA 2M2LA 1LLRD 4ILWA 3ITPA 2VB2X 3KLRA 5FO7B 3SDZA 1B3AA 3C46A 3QWNA 2NVXB 4CBVA 4V0BA 2JA6B 2CQAA 3AMUA 1HHVA 4CJ2C 3F2UA 2AQ2B 2PW5A 2CW0C 1EL0A 1VDZA 3HEJA 3T13A 2O4XA 4CKBA 4Q0FA 1GHJA 3ERQA 2XWJB 4G7ZC 3HOWB 2PCFB 3LNNA 3P20A 3QIAA 3V05A 1NR4A 1Y1VB 2B2WA 3W3AA 4ZUJA 2JP1A 1PTOF 1SFOB 3RZOB 1HTPA 4A3MB 3NTIA 1SE3A 4A3EB 5KNCA 3GTLB 1F2LA 4XDXA 1EYDA 3EFXD 1QJOA 3K5OA 1X3QA 2ENBA 3MZ5A 3C2PA 3OMGA 2G9DA 3ZYYX 1SE2A 2RSNA 4EGVA 3R2TA 3HP3A 1VMCA 2ZXOA 2F0TA 4EQPA 2K1BA 3DXJC 5E4XA 1AEXA 2BCOA 4HN7A 3DMUA 2KOLA 1CT1D 4HCSA 5K36H 1PTOB 3NE5B 1KAAA 2R7ZB 3S14B 1LT5D 5CV5A 3QOJA 2EZVA 1S5DD 1IL8A 4R8IA 1Z47A 5FKAC 3GTPB 2D2CC 3IAYA 1TS3A 5CV9A 1DM0B 4ZYSA 2QF7A 3E5SA 5E3FA 1XWEA 3S1RB 5EBCA 1LTSD 1WCMB 2EY6A 2C5CA 5KYIA 3TP6A 1PTOD 2WIIB 1GHKA 1FNVA 1ENCA 2YYZA 3SVMA 3QG1A 2F0FA 4RGTA 2MP1A 4OIKA 3GTJB 4FYDA 1AW7A 1I4RA 1EZ6A 1KNAA 1RTNA 1YNJC 2KHSA 2PO4A 5I2XA 2RKSA 4BY7B 1NSNS 2NWGA 3VR5A 2EJMA 3X3NA 4TQUS 1BQQT 1Q12A 4H0LC 4A3JB 1A3VA 4X3TA 1YNND 3HG9A 2A69C 3D6CA 1QOHA 1IW7C 4E6IA 2A73B 3MXPA 2EYFA 4IALA 5KEEA 2HDMA 1UAPA 4RKLA 3VR4A 4KY5A 1RHPA 1SNPA 1EIHA 2B2YA 1IYUA 4ABNA 4XT3B 3I91A 1HUNA 3A8JE 3AU7A 1A2UA 2NN6G 1S5ED 1O7YA 1I4GA 1PDQA 4Q5VA 1MD2D 2EJGC 3Q0AA 1SMYD 3GTKB 5G3LD 3Q6SA 1SXTA 3HOYB 2KECA 5I6YA 4FXKC 4KKSA 1ZYRD 3GP7A 1HPCA 3A7LA 4HR7B 3J81E 4PQXA 2RA4A 3T51B 2NBFA 2JSOA 5EKKA 4QMGA 5JAVA 4L63B 2JA8B 2F03A 5G3LF 2LY7A 5M5YB 4XYOA 4RFBA 2R6GA 4DU9A 2K01A 1B4OA 1GUTA 4DAVA 1Y8PB 2EVBA 5E1FA 3TP8A 1AZQA 3M7NA 4TKOB 3VR2A 4A3DB 1WTQA 2IX1A 2Z8LA 2HUGA 1TY2A 4QUCA 3D31A 5IIFA 3P7JA 2F1MA 2IW3A 1WVLA 3CU7A 1I4QA 1E2ZA 4IUUA 1ZKOA 1J9OA 2AWNA 2Z1CA 1JICA 4QB4A 2B8GA 1K8OA 1LTAD 4NW2A 2PNRC 4FF3A 1H9SB 4WFN3 2FMCA 2F0KA 1KDBA 3BDCA 3N52A 2G9HD 4ODGA 4A93B 1VMPA 1PTOC 1OXXK 4XT1B 2AUJD 5I9OA 5M5XB 2F0LA 3IKJA 4F7XA 1DZ1A 1OXVA 4DAPA 5CV6A 3IFTA 1I50B 4J1MA 1SNQA 3A56A 3WDNA 1CHPD 1PFBA 1TS4A 5FK9C 3KF8A 1KNEA 1PXUA 2WP8J 2LS01 4KJNA 5BN5A 3NWSA 1I4HA 2F0SA 1OO9B 5DM63 3L3OC 3DM1A 2XRQD 1DD2A 3I8ZA 1DXMA 3CKIB 3GO5A 4O42A 4V190 3C1FA 1ONLA 3VYSA 3GD7A 4XIGS 3OWFA 5LL6X 2AQ1B 4PMBA 4DN4M 5FOBB 3KBGA 4FXGC 5FO8B 3ND9A 1JQYD 4DK1A 1AFPA 4IFDJ 2A6EC 2L5TA 1TWFB 1JOOA 1S4ZA 3PO2B 4FVMA 1GJXA 5ELFA 2X6GA 1STGA 5EKIA 1U4RA 3NQIA 2B2YC 4HMIA 1GOZA 1ICWA 3K7AB 3JAME 4KTAA 4C56C 2N88A 1LT6D 2NVYB 1QG7A 4PMCA 4C3IG 1T5XD 3RZDB 5A2QL 2F0EA 2CW0D 1PFNA 2M00A 1SEBD 1OXTA 5EQ0A 3WOEA 2SEBD 1KLUD 1U4PA 3CHBD 5IGDA 1TVXA 1GUOA 4QF4A 1V43A 4Y7NB 5KIXA 5KYLA 1EFID 1LTBD 3QB3A 1QNKA 2VXWA 1LT4D 3J7AF 3OWEB 1STAA 4I7ZC 1STNA 2VUMB 2FMMA 1F2MA 1BDOA 3SHLA 2NB0A 1RTOA 3S17B 2EYHA 3Q22A 2RVLA 4HAEA 5JEAH 3K5LA 3PUZA 2L9HA 1B1ZA 1PLFA 4K2KA 3D8GA 3MAQA 3H6MA 5C3XA 5EPLA 1ZYRC 4G57A 2V4DA 3NPPA 3NQTA 2B2VC 5KGUA 5M9OA 3KK7A 4C3JG 2PZUA 1JWMD 3I73A 4KHVA 3TZDA 1SNCA 5T1GA 3WOFA 2NN6I 1E2VA 1R9TB 1ENFA 5A35A 1R4PB 4U673 4G7HC 2L0CA 2RDFA 5C6AA 3DEPA 1MI2A 1RKNA 2BE5C 2OXPA 1CHQD 4BA1I 3KLSA 5CORA 3PV0A 1B53A 2R92B 3MEHA 3BYTB 1ZEQX 3BVGA 1ENAA 4C1NK 2GA4B 4OL7A 2EYJA 4IURA 2QDBA 4HTHA 4H13C 5D3DA 3C3LA 3CRKC 2I46A 1EU4A 3J80L 3VYRA 1DJRD 4XQNA 4MN3A 4PMWA 1B2TA 3V2TA 2J4XA 1TWCB 5CV8A 1A3TA 3PUXA 4FF2A 2A5HA 1QILA 1FR3A 1F9PA 1A3UA 4Z9CB 4B9WA 4IUQA 3HOVB 2PQEA 3K0YA 2NVTB 2LKVA 1TWHB 4CGYB 3OMCA 2XSCA 3H09A 5M3MB 2B2UC 3G7LA 5ELDA 2K05A 3Q24A 5FLXL 5C0XH 3K5NA 2SNMA 5JPMC 1KLGD 4LK1C 4K6DA 3H94A 3M4OB 2NTTA 4IUTA 1YNNC 3PUYA 2ICEC 1TR5A 1Z7TA 2NYZD 3Q23A 4IUVA 4DF7A 4PNYA 1W6JA 2J0TD 2PYKA 3J7YW 4BBSB 1F2ZA 3DWQA 1EIGA 4C2MB 3J80E 4LJZC 1G2SA 1PRTF 3EQLC 4NMZA 1C4QA 3NTKA 2A6ED 3HZXA 3S9WA 1ESFA 1SE4A 4RGNA 5K36G 2C9OA 3L7ZC 2PMZB 3MFYA 3DEOA 4BBRB 3S1QB 2PPBC 2IX3A 4XXEA 1U4MA 5DM73 1PRTD 4LMQD 1B9MA 1G291 1JWSD 1L0XB 3SK5A 4DA2A 5EGTA 1HFGA 4KHZA 1ZXTA 1JOKA 3N6RA 1MSHA 3MFGA 1GXDC 1SYBA 2LMCB 4C3HG 2R61A 3EROA 3BDLA 2NUCA 2EXZA 2K5QA 4RKBA 3OOCA 4TSSA 3QJYA 1L0YB 2FHTA 5DAUA 3RD4A 2K6AA 1SYEA 5CGKA 1EY4A 1I3QB 4OO1I 1BXTA 1SDFA 1Y69U 5C5MA 2L12A 2BA1A 3L9AX 1I4XA 4PV1C 3CRLC 1BR9A 5TSSA 2Q8TA 4ZKCB 1SAPA 1S5BD 1EZ8A 4KJOA 5CC4A 1WTXA 1HRJA 2HQEA 2F0MA 2OF1A 4R8NA 1VCIA 4C3HB 1F9QA 1C8CA 2L55A 1QE6A 5J39A 3KLSX 3S1MB 1M4VA 3SXHA 1F2YA 1H9MA 2DY7A 4L6TB 1BNZA 5I6WA 4CHTB 1IKLA 5CBEE 1O78A 1CK1A 3VR6A 2ZT9C 2KEDA 4ME5A 1TS5A 3FEWX 3NWTA 3VYTA 3KBXA 2N55A 1STHA 1PRTC 3D4RA 4JBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J22 A;  2EY6 A;  1EY0 A;  1STA A;  5IOC A;  2PW5 A;  4TRD A;  3SK5 A;  3NUC A;  5KYI A;  5IGB A;  1STN A;  2F0D A;  4IZ8 A;  1A2T A;  3HEJ A;  4IUN A;  1F2M A;  4WRD A;  5EGT A;  5C5L A;  3SHL A;  5ISR A;  4N9T A;  4S3S A;  5EKK A;  4QMG A;  3T13 A;  2O4X A;  5JAV A;  4K14 A;  1A3U A;  5IGE A;  4KY7 A;  1ENC A;  3EVQ A;  5HUR A;  3ERQ A;  2EY5 A;  2EYO A;  1EQV A;  2F0F A;  2EYH A;  1JOK A;  4KJN A;  5JOB A;  4B9W A;  2F3V A;  4KV6 A;  1SYB A;  4K5X A;  3D4D A;  1SYF A;  2SOB A;  1SNO A;  5CV4 A;  2F0S A;  2PQE A;  4K2K A;  2KQ3 A;  1KDA A;  3BDL A;  3D8G A;  3ERO A;  4HMJ A;  3U9O A;  4DU9 A;  2NUC A;  3H6M A;  5C3X A;  1EY6 A;  2EXZ A;  2WAC A;  3QOL A;  5CR3 A;  5C4Z A;  2PW7 A;  4RKB A;  3SK8 A;  2LKV A;  1EY5 A;  1EYA A;  1IHZ A;  1SYC A;  1EZ6 A;  2F0U A;  4NP5 A;  3TME A;  2PZW A;  4G57 A;  2KHS A;  3OMC A;  4ZUJ A;  3C1F A;  5DAU A;  4K8I A;  4DGZ A;  2RKS A;  1TQO A;  5E1F A;  1NSN S;  4K2L A;  2F0O A;  4I65 A;  3MHB A;  1U9R A;  4WOR A;  4ZQ3 A;  3TP8 A;  3OWF A;  3NQT A;  5C3W A;  2F0W A;  5KGU A;  5M9O A;  1SYE A;  3DHQ A;  3D4W A;  2F0Q A;  4J6H A;  2EY2 A;  1A3V A;  4PMB A;  5C4H A;  2PZU A;  4KHV A;  3P75 A;  1JOR A;  5CV7 A;  1NUC A;  5CGK A;  2EYM A;  1EY7 A;  1KAB A;  1EYD A;  2SNM A;  3T16 A;  1EY4 A;  2OEO A;  5KRU A;  3P1H A;  5IIF A;  1JOQ A;  1STB A;  3OSO A;  1SNC A;  4K5W A;  4EQN A;  3PMF A;  5C5M A;  4K8J A;  4K6D A;  3LX0 A;  4N9P A;  2PZT A;  5IGG A;  1JOO A;  4MIU A;  2ENB A;  3MZ5 A;  1EY8 A;  2SNS A;  3OMG A;  4KD3 A;  3TP6 A;  1TR5 A;  3D6C A;  2F0N A;  4H7B A;  1STG A;  3C1E A;  4E6I A;  4QB4 A;  4KY6 A;  2RDF A;  3EJI A;  3MXP A;  3NP8 A;  1EZ8 A;  2EYF A;  3NXW A;  4KJO A;  1KDC A;  1SNM A;  1SYG A;  2F0T A;  4IAL A;  3R3O A;  4PNY A;  4DF7 A;  3SK4 A;  5CC4 A;  4F8M A;  1RKN A;  5KEE A;  4RKL A;  2HQE A;  4HMI A;  4KY5 A;  2OXP A;  2PYK A;  5NUC A;  1SNP A;  4EQP A;  4KD4 A;  5K5P A;  2RBM A;  4EVO A;  1F2Z A;  1AEX A;  2F0M A;  2OF1 A;  4KTA A;  5EKL A;  3MVV A;  4R8N A;  4EQO A;  3DMU A;  3MEH A;  1TT2 A;  2F0K A;  4ZUI A;  1A2U A;  5J39 A;  1KDB A;  3BDC A;  4PMC A;  3NHH A;  4YIJ A;  1ENA A;  4NDX A;  2F0J A;  2F0P A;  3SXH A;  4NMZ A;  1F2Y A;  3SK6 A;  1EYC A;  1KAA A;  2EYJ A;  2F0V A;  3ITP A;  4ODG A;  4OL7 A;  3TP7 A;  2QDB A;  4HTH A;  5CV5 A;  5I6W A;  3QOJ A;  2EYL A;  2F0E A;  3HZX A;  5I9P A;  4ID6 A;  3RUZ A;  3S9W A;  5I9O A;  1EY9 A;  4DFA A;  2EYP A;  1SND A;  2F0L A;  2M00 A;  5DEH A;  4NKL A;  1STY A;  5IGC A;  4LAA A;  5IOD A;  5F2D A;  2F0H A;  4B9X A;  4F7X A;  5HGT A;  5IGD A;  5IGF A;  1II3 A;  3V2T A;  4QF4 A;  4ME5 A;  2F0G A;  5CV6 A;  5I6Y A;  1SYD A;  3NK9 A;  5KIX A;  5C6A A;  5CV9 A;  2EY1 A;  3SR1 A;  4J1M A;  2F0I A;  1SNQ A;  5KYL A;  3TP5 A;  3QB3 A;  5CV8 A;  3VA5 A;  4K5V A;  2F3W A;  1STH A;  1A3T A;  3E5S A;  5E3F A;  5J1Z A; 
#chains in the Genus database with same CATH topology
 4FP5 D;  3S1N B;  2IPK D;  4OO1 G;  1LV9 A;  4C1N I;  5HGQ A;  2BE5 D;  2XIW A;  4RG1 A;  1VQG A;  1X65 A;  1UUP A;  3AYH B;  4KY7 A;  2JQO A;  5HUR A;  4RWS C;  2JN4 A;  1F9S A;  4KK7 A;  1CM9 A;  1JCK B;  4K5X A;  2UUA L;  1TWG H;  1CTM A;  2WB1 E;  1GUG A;  4BA2 I;  1KDA A;  4WJW A;  4OWX B;  4BY1 H;  5JPN C;  2WB1 G;  2QCP X;  4ZKB B;  5LL6 S;  1LTT D;  3T1Y Q;  5IYD H;  1HFN A;  2GVA A;  4K8I A;  4OWW B;  4ZQ3 A;  1W6K A;  4JI2 L;  2KCC A;  1V8Q A;  3DHQ A;  1I50 H;  1QNU A;  3A54 A;  5KRU A;  4JI7 Q;  3OSO A;  1Y8O B;  1PZK D;  2NZ1 D;  2MPM A;  1CUK A;  2EDG A;  3A7A B;  3KYH C;  4F88 A;  1IKM A;  2R93 B;  2WAQ G;  3HS0 C;  1HNZ L;  3T1H L;  3PIO 3;  5M3M G;  1QB5 D;  2VQE Q;  1QWY A;  3CPF A;  3NP8 A;  5FO9 B;  1VQI A;  1ML0 D;  3RR5 A;  4DPG A;  1UEB A;  1E2W A;  3H0G G;  3A74 A;  2O5I C;  3TRE A;  1L1O C;  4HCE A;  2A6H C;  4MHE A;  1MBY A;  4X66 Q;  4NDX A;  1WTR A;  1D6E C;  4BY7 G;  1KTK A;  3GTQ B;  3CCL A;  2KHI A;  1AP0 A;  4G7O C;  3CCV A;  2RQX A;  2ALY B;  4LFA Q;  2WV6 D;  3G48 A;  1PFM A;  2XRS D;  5F2D A;  3X3M A;  3J81 c;  4JG2 A;  4ZRZ A;  3I90 A;  4A3M G;  1XNQ Q;  3FKI B;  2ICI A;  2F0G A;  2X69 A;  2IT1 A;  1DYQ A;  4UP8 A;  2H5X A;  5J1Z A;  3S2H B;  1RDP D;  2R7Z H;  1Y1V G;  1EWC A;  1TKW B;  1HZB A;  2QIL A;  4NPS A;  2FFK B;  4RA8 A;  2L4N A;  3KF6 A;  1XTC D;  2MO1 A;  3QR8 A;  4HJA A;  2VNU D;  1WTV A;  4QCL A;  3R8B A;  4LF4 L;  1DOL A;  1RD9 D;  5CV4 A;  4LWC A;  3A8I E;  1AZP A;  2R92 G;  4FF1 A;  2IWH A;  1KRT A;  2Z4H A;  4JV5 Q;  1EY6 A;  3E0E A;  4DV4 L;  2KEE A;  2PW7 A;  4CKC A;  2B2T A;  4DV6 L;  2WKD A;  5I2Y A;  2E2I H;  3J7A V;  1ILP A;  2JA6 H;  1HTL D;  3M4Y A;  4I65 A;  1BBU A;  5E4W C;  1VQN A;  1XTD A;  3TZU A;  3S14 H;  5EBD A;  2JEA I;  3FPU B;  1JE5 A;  1U4L A;  1JOR A;  4YHH Q;  5CV7 A;  2ZTE A;  2MNA A;  3J7Z C;  2K5D A;  3T16 A;  4IFD H;  1JOQ A;  3EA6 A;  3S15 B;  3W1B A;  4DR1 L;  2CH4 W;  5IGG A;  1XX8 A;  1UWV A;  5C44 B;  4A3G B;  4BBR G;  4KD3 A;  3I55 A;  3M85 A;  1XPU A;  1XPR A;  1FD7 D;  5C3E B;  1X3P A;  5ELO A;  1I94 L;  2MQH A;  2MUY A;  1CA6 A;  2XWB B;  1O7L A;  5EKL A;  2D9U A;  4EQO A;  2WIN B;  1TT2 A;  1EWI A;  2OT2 A;  3STB C;  1C48 A;  2JJQ A;  2F0P A;  5C0X J;  3H3V I;  3JAM L;  3U9S A;  4A3E H;  1PYS B;  4DR3 L;  2E76 C;  2VZA A;  4A3M H;  2E2H H;  1CKO A;  2KVM A;  5I9P A;  4ID6 A;  4DV1 L;  3RUZ A;  4IOA A;  1SFO H;  4C3I H;  2JXM B;  4QGU A;  4ZAI A;  2I0Q A;  1SND A;  5DEH A;  1G6Z A;  1PZI D;  5JJL A;  3GDE A;  2IJ0 A;  1JR0 D;  1Y1V H;  4HSP A;  1II3 A;  2RCN A;  2CWA A;  3DUZ A;  3NK9 A;  3TBI B;  2KBN A;  3TP5 A;  3VA5 A;  1SJE D;  2HD3 A;  3T53 B;  4O1N A;  2XNA C;  3GTQ H;  3KLW A;  3BG3 A;  1UE1 A;  5J22 A;  1EY0 A;  2Q2T A;  1MKH A;  4TRD A;  1B44 D;  4WRD A;  2ZM6 L;  4KN4 C;  2AKW B;  4WJ4 A;  2JA7 G;  1LAC A;  3TS2 A;  1OXS C;  5IGE A;  4ALP A;  3V96 A;  3A5U A;  1EQV A;  4IPG A;  3RNU A;  4KN7 C;  4DKA C;  1Y1W B;  4C3I B;  1CQF A;  3W2D A;  1YIT A;  4IUP A;  3FMC A;  2FIN B;  3CMA A;  2KEN A;  1NAP A;  4FF4 A;  1JC7 A;  1IL2 A;  2OTJ A;  1EY5 A;  4RCO A;  3FRP B;  3TME A;  4F87 A;  4QUF A;  3S17 H;  3VR3 A;  4HIO A;  3A5Z B;  3ND8 A;  3HOV G;  2AMC B;  3UI2 A;  1HR0 L;  1CZW A;  3KF6 B;  2DNC A;  1PRT B;  1E3P A;  4K2L A;  4DV0 Q;  1HQM C;  2HCC A;  3PO2 G;  1HR0 W;  1PVO A;  3S16 B;  4ZCK A;  3GTG B;  4A93 H;  3GV3 A;  4X66 L;  4DR4 Q;  4KKU A;  2NZO A;  1KXL A;  3S1M H;  2ZTC A;  3BVM A;  5EPK A;  1K8M A;  1TY0 A;  2CHB D;  1N34 L;  1HR0 Q;  1HNX L;  4HJ7 A;  1H9J A;  1EY8 A;  1G51 A;  2BDN A;  4H7B A;  2R3Z A;  4QY7 A;  5IYB H;  3M3Y H;  1SRO A;  4P74 A;  4ULL A;  3EJI A;  1TWG B;  3I4L A;  2Q2I A;  3NEL A;  4AYB B;  5BN4 A;  4A4I A;  1DON A;  2BOS A;  2CH4 A;  1BO0 A;  1VQO A;  4KD4 A;  1TU2 B;  4J15 A;  1UE5 A;  2M9V A;  4A3I H;  1R4Q B;  2K28 A;  2QA4 A;  3I4N H;  1VF7 A;  5A2Q E;  2F4V Q;  2B2U A;  3TP7 A;  2UXD Q;  1V1P A;  3CQZ B;  1UE7 A;  2JA7 B;  2Q2H A;  2IHE A;  4I7A A;  4DFA A;  3H3V H;  1A15 A;  4P73 A;  4BXX H;  4C3J B;  5GAG C;  5LMN W;  1WTW A;  4A3K H;  4DV6 Q;  2CQO A;  2E2D C;  4WJ3 M;  1O80 A;  3BVZ A;  5T1I A;  1WJJ A;  2QEJ C;  1GUS A;  1L2F A;  1NCV A;  5C4X B;  3DLL A;  4HJ5 A;  3A8K E;  3NUC A;  1PH7 A;  3A55 A;  5IGB A;  1TWC H;  5IE8 A;  1KQS A;  4IUN A;  1BUV T;  1N32 Q;  1TWH H;  1EOT A;  5ISR A;  1HA5 A;  4DV5 L;  1JE4 A;  1HQR D;  1X56 A;  4DR6 L;  1DCZ A;  3JAM c;  3TEH B;  1IBK L;  4JYA L;  3CCQ A;  1U5K A;  2F3V A;  2JA5 B;  3R2I A;  4DNI A;  5C0X I;  3NBI A;  2KQ3 A;  1T9H A;  2B39 A;  2VUM G;  2FJ2 A;  1IHZ A;  3BZD B;  5H1S E;  4X3U A;  1RCV D;  3PO3 H;  1FYC A;  4GNX C;  4JI2 Q;  3RMH A;  4ZLT F;  4JYA Q;  4LFB Q;  1LTR D;  3PUV A;  1M1K C;  4WOR A;  3D3R A;  4A3G G;  3FVQ A;  4DR7 L;  2LSS A;  1TS2 A;  1LTL A;  3CCR A;  1EU3 A;  3LWE A;  1F9R A;  1W3S A;  2E74 C;  3NBH A;  2EYM A;  2Y0S B;  2ES2 A;  4NXM L;  1J8I A;  3J80 i;  3FDT A;  1R9T H;  3PMF A;  2F4I A;  2NVQ B;  1NY4 A;  3AEV A;  4YCW A;  3E0J A;  3L2P A;  4X65 Q;  5C44 G;  4FO2 A;  3GV6 A;  3S1R H;  2DUD A;  2KJX A;  1SNM A;  2NZH A;  3KJO A;  3MTS A;  4O0A A;  5IT9 L;  1O7Z A;  4EVO A;  1PFS A;  3I4M G;  2AHO B;  5JEA J;  1MGS A;  4GLA C;  1CI3 M;  2EPB A;  4XQQ A;  4YIJ A;  4JC0 A;  1IBM Q;  5C4H A;  1EYC A;  4A3J H;  2DN8 A;  4IN3 A;  4POF A;  2AWO A;  4KHP L;  3G6J B;  4DV3 Q;  4DR1 Q;  3E6Z X;  3K81 C;  2EYP A;  4A75 A;  3T1Y L;  4LF6 L;  3QO2 A;  2YU9 B;  4HED A;  1K8A C;  5HGT A;  1WD1 A;  1E7Z A;  3ER0 A;  4GOP C;  3HOX H;  4KKT A;  2JEB I;  1G8Z D;  4K5V A;  2K5W A;  5D65 A;  2KCN A;  3HOY G;  2G5D A;  1VQK A;  2BA0 A;  4DV7 L;  3T56 B;  1D1I A;  3CC4 A;  5LMN L;  1TII D;  1NE3 A;  4X64 Q;  2KUM A;  1HA6 A;  4LF4 Q;  4DAY A;  2EYO A;  4J8Q A;  1OTC A;  2OCE A;  3RLO A;  3PO3 G;  2E2H B;  4R4O A;  3IRB A;  4HMJ A;  3SGI A;  2UXC Q;  3BU2 A;  4DXF A;  4B08 A;  3M4P A;  1T5E A;  4K0K Q;  4G4K A;  4NP5 A;  2Z4I A;  1D1K A;  1JMC A;  4JI7 L;  1Y1W G;  1XXG A;  2PQA B;  4M8A A;  2RDH A;  1VQD A;  2EOT A;  2N78 A;  1Y14 B;  2F0W A;  2RHS B;  1XYI A;  4DR2 L;  2ZXP A;  2EY2 A;  3HOW H;  5FJ8 H;  5ELC A;  3P75 A;  3TSS A;  1NUC A;  4C2M H;  5D14 A;  4HSV A;  4RGO S;  4K8J A;  4C3J H;  4A93 G;  2I5H A;  3TDQ A;  4RMF A;  1DOM A;  3RLN A;  2WAQ B;  5I4D A;  2R93 G;  1VQP A;  3TS0 A;  1EQT A;  1IZ6 A;  3KUP A;  4P75 A;  3MWY W;  2K4K A;  1I6H B;  4XTC S;  1ILQ A;  2BDO A;  3M4O H;  5K5P A;  5NUC A;  3URY A;  1YHQ A;  4DNR B;  1YNJ D;  1WD0 A;  1Q1B A;  5DNF A;  3PF5 A;  4JI6 L;  1S72 A;  3PUW A;  2F0J A;  3SK6 A;  1H9S A;  3NSW A;  3T4A C;  2EE1 A;  1B50 A;  4DAM A;  2WB1 B;  2K52 A;  4JI5 Q;  2QGQ A;  4NKL A;  1ET9 A;  3HOY H;  1AE2 A;  1H9R A;  2F0H A;  1Y8N B;  1ASZ A;  5JVG 3;  2DJG C;  2IX0 A;  1HNW Q;  1BOS A;  4IQZ A;  5EPJ A;  2F0I A;  3SR1 A;  5AJ3 Q;  5GRO A;  4ZK9 B;  3FPP A;  4POG A;  4JI5 L;  1JWU D;  1JB3 A;  1SBB B;  3MC0 B;  2JYO A;  3HGB A;  2I5L X;  4UY8 C;  3HOX B;  5IP9 G;  2WKC A;  4K14 A;  1Q3L A;  3K5M A;  3EVQ A;  2R7Z G;  1GUW A;  2K33 A;  4R1J A;  1Q8I A;  4OO1 H;  1LO5 D;  5JOB A;  4KV6 A;  3K6O A;  1BCP D;  1SNO A;  4LNQ A;  3CPW A;  3J80 c;  2E75 C;  5IWA L;  1BF4 A;  4HIK A;  1ET6 A;  1D5M C;  4B3M L;  2F52 A;  1QUQ B;  1SJH D;  4JI8 L;  4GNX A;  2PZW A;  3PIO A;  4IFD I;  3LWU A;  1X32 A;  1G91 A;  4KLK A;  1HZA A;  1Q1E A;  2F0O A;  4B3T Q;  3MHB A;  2XVS A;  4BY1 B;  1WTO A;  3ULJ A;  2K03 A;  4J6H A;  1STE A;  3RN2 A;  3IL8 A;  4LF8 Q;  2NTS A;  2ZJP A;  1STB A;  5BR8 Q;  2UUB L;  3GQB A;  5FLX E;  2L1B A;  3LX0 A;  1BCP B;  1K73 C;  2PZT A;  3J81 L;  4AQY L;  3I70 A;  5C0X G;  3GTO B;  1NMF A;  1X3E A;  3CP0 A;  4JI0 Q;  2I07 B;  3OIQ A;  3C1E A;  3HRZ C;  2OQ0 A;  3PCO B;  1IW7 D;  1S40 A;  1V1P B;  1JB7 A;  3MXN B;  4F8M A;  4A3B B;  1QZH A;  2DY8 A;  3D0F A;  1EQR A;  1I6V C;  2RBM A;  2O5J C;  1F77 A;  5EJW A;  1HXY D;  2D62 A;  2CVR A;  1NBW A;  2B63 B;  1PYW D;  5C4J B;  3HOU B;  4X3K A;  5FLX c;  3H0G B;  3MXN A;  5IT9 E;  4DAY B;  5ELB A;  1YJ9 A;  2RDG A;  3OW7 A;  3VYU A;  2H4O A;  1EY9 A;  1OXU A;  4QQB X;  2K04 A;  1EEF D;  2ZJR A;  5J3B A;  4YHH L;  5IGC A;  4B9X A;  1B9N A;  1FGU A;  1SYD A;  3PQI A;  1BCP F;  1E24 A;  3DWA A;  2A74 C;  4LUO A;  2WAQ E;  4KMU C;  4QL5 A;  1XNR Q;  5AJ3 L;  2A68 C;  1LAB A;  4R9W A;  1EEI D;  4N8X 1;  3ULL A;  1EIY B;  4IOC A;  2F0D A;  1A2T A;  2HDL A;  2B2W C;  3K8A A;  4JI1 Q;  4OEM B;  3OIP A;  5ELN A;  3K57 A;  1FGB D;  1QUQ A;  3E3X A;  3GTM B;  5JJZ A;  2V1C C;  5IYD G;  1AH9 A;  2J7Z A;  2JA7 H;  2SOB A;  1WTP A;  1G2T A;  4BS9 A;  5HY6 A;  3PIP 3;  4QIW B;  5CR3 A;  5IGF A;  1V1O A;  1E0B A;  5M5W B;  4DUY Q;  2K32 A;  1WOC A;  2VL6 A;  2ZXR A;  3MA2 B;  2R92 H;  2D5D A;  1HUM A;  4M1U B;  1TWA B;  1U9R A;  2YU9 H;  1VS0 A;  4RCN A;  3BJU A;  1S5C D;  2RSO A;  2E2J B;  2F0Q A;  4OHJ A;  5M3F B;  4XQJ A;  4JOI A;  4BBS G;  1ICF B;  1JJC B;  4P2C B;  1KAB A;  1YIJ A;  2OEO A;  1RJT A;  3P1H A;  1E22 A;  4K5W A;  3K59 A;  3AB9 A;  4DV2 Q;  1N36 Q;  3AFQ A;  5L37 A;  2MHV A;  1D5Z C;  1LT3 D;  3F8T A;  4NXN Q;  4L5T A;  4DUZ L;  4KY6 A;  1PH8 A;  1KDC A;  1GUN A;  2VQF L;  1E1O A;  3M7G A;  4OGQ C;  2IY5 B;  1EIF A;  4BY7 H;  3M4Q A;  4A3I B;  2R93 H;  4DR6 Q;  5IYB G;  4GKK L;  4ZUI A;  4FNF A;  4GZY C;  5IY0 A;  1Z6H A;  5IP7 G;  3UDG A;  5JVH 3;  1PH3 A;  1XMQ L;  4A3B H;  2F0V A;  1J5E Q;  2TSS A;  1BCP C;  3UE0 A;  1S5F D;  4JCV E;  2VQF Q;  1IYV A;  2EYL A;  3CW2 C;  4A3F B;  3UDF A;  4H44 C;  1BBX C;  1ASY A;  2Y0S G;  3CAM A;  2HIV A;  2NN6 H;  3U4Z A;  3FKI H;  4RAU C;  4LAA A;  4A3E G;  4JI3 L;  3PO3 B;  1ROD A;  2OQK A;  2Q8I B;  3KDF B;  2EY1 A;  1K83 H;  3EBE A;  1CSP A;  2TMP A;  3BS1 A;  5LMN Q;  4U68 A;  2O2L D;  3BYY B;  3R93 A;  1PZJ D;  2PNH A;  4A3K G;  4IZ8 A;  4PZ7 A;  4N9T A;  4L5R C;  1KAW A;  2JA5 G;  1A63 A;  2EJF C;  3GTP H;  4A3L G;  3O13 A;  1X9N A;  2EY5 A;  1VQ4 A;  3HKZ B;  1HZ9 A;  4DK0 A;  4RH6 A;  2IL8 A;  3D4D A;  1K3R A;  5KNB A;  3SE0 A;  4YWL A;  5IP9 H;  3U9O A;  1K83 B;  1LTI D;  3MXU A;  2PMZ E;  3QOL A;  1CZG A;  1TWA H;  5C4Z A;  1SYC A;  1MSG A;  2QKI C;  4BBS H;  4MNO A;  2EIF A;  1Q90 A;  1SSO A;  3F1Z A;  1LYL A;  4JBJ A;  5FLM G;  4KHP Q;  3D4W A;  4CJ0 B;  4CKE A;  2UU9 L;  4A3D H;  1I6H H;  3I4M B;  1HCZ A;  2E8G A;  4CDC C;  1KL9 A;  4JOI C;  4DR5 Q;  1EY7 A;  3HOZ H;  3LGJ A;  2A69 D;  1A62 A;  1AN8 A;  2OWO A;  3S15 H;  3OTO Q;  1ESR A;  5ELE A;  4N9P A;  5KND A;  4A3C G;  4JPB W;  2A8V A;  3ICE A;  4MIU A;  5IWA Q;  3K7U C;  3NTH A;  1K9M C;  2F0N A;  3ONA B;  2BH2 A;  3VDY A;  3D6W A;  2MJ8 A;  3NXW A;  1SYG A;  2OTL A;  4OIJ A;  3VA7 A;  1V9P A;  2B2T C;  3RLF A;  3MVV A;  2D0O A;  3K58 A;  2ID0 A;  1I4P A;  1HZC A;  2E2I B;  2HCI A;  2Q8R E;  4GLV B;  1DOK A;  4AYB E;  4QIW E;  4B3S Q;  4JK1 C;  1W2B A;  2B8F A;  1UEA B;  2MGS A;  3I3C A;  4A3K B;  2X6L A;  3I4N B;  1STY A;  4XYQ A;  5IOD A;  1UNS A;  1EWH A;  1VQ5 A;  5CYU A;  4K6L A;  4A76 A;  3I2Z A;  1CA5 A;  1GKH A;  2DNE A;  2F3W A;  3CQZ H;  2JA5 H;  4P71 A;  3U4V A;  3J7A 5;  1GO3 E;  5IOC A;  4CJ1 B;  4BWG B;  1RF2 D;  5JEA G;  3SEB A;  2XN9 C;  2KA7 A;  5C5L A;  1C7Y A;  1L1O A;  2AQ3 B;  4S3S A;  3IFD A;  4A3F G;  4X3S A;  4OX9 L;  4RHS A;  4L5Q A;  3OPO A;  3MXG A;  5C4X H;  3HKZ E;  2N3S A;  5LHY 1;  2B2V A;  3I56 A;  1LTG D;  1SYF A;  2AUK A;  5CMD A;  5D3I B;  1PA6 A;  1M8A A;  2MFI A;  4DNT B;  2WAC A;  1D5X C;  1VF5 C;  2VB3 X;  1VQB A;  3BDO A;  4YWM A;  3SK8 A;  2L11 A;  4B3S L;  1EYA A;  2F0U A;  4RGM A;  1PMR A;  2K7V A;  5COY A;  2VY3 A;  3CCM A;  4DGZ A;  3HOZ B;  3L0O A;  1TQO A;  4FXD A;  3S2H H;  2GN5 A;  5C3W A;  1WFQ A;  3OHX C;  4GOP B;  1CQV A;  3T1H Q;  1FNU A;  3TN2 A;  2ATW A;  3GTG H;  1H95 A;  2A19 A;  1PV4 A;  4L8J A;  1Y1W H;  2A68 D;  1CSQ A;  1A6X A;  1J5E L;  1H9K A;  1D7Q A;  1SMY C;  1PTO H;  4RHR A;  3ULP A;  1QCB D;  2JE6 I;  3H91 A;  4EQN A;  1X3F A;  5M3F G;  5CBA E;  3B6Y A;  2SNS A;  1D2B A;  4UAI A;  3I72 A;  3CD6 A;  5BN3 A;  2K14 A;  1SLJ A;  4IFD G;  2LFN A;  3GTJ H;  2SDF A;  3M3Y B;  3I4N G;  2H1E A;  1NR2 A;  3R3O A;  3S2D B;  4LUV A;  3SK4 A;  4UDU C;  1N8R C;  3H3V C;  2Y0S E;  1FNW A;  4OXP A;  2A6H D;  3DWP A;  1CFM A;  3K0X A;  2VW9 A;  4KI0 A;  5AFW A;  2GVB A;  1LM0 A;  2HHH L;  4DXG A;  1YI2 A;  4DR3 Q;  3NHH A;  2M2L A;  3S2D H;  1LLR D;  2K5H A;  4ILW A;  3ITP A;  2VB2 X;  3KLR A;  5FO7 B;  3RZD H;  1XMO Q;  3SDZ A;  1B3A A;  3C46 A;  2KCT A;  3QWN A;  3S1Q H;  5M5Y H;  2NVX B;  3KF8 B;  4CBV A;  3F2D A;  4V0B A;  2JA6 B;  1X55 A;  2CQA A;  1O7I A;  3H15 A;  3EN2 A;  3AMU A;  2UUC L;  1B8A A;  1HHV A;  4CJ2 C;  3F2U A;  4L5S A;  4B3R Q;  2AQ2 B;  1FL0 A;  2E2J H;  4LFA L;  2PW5 A;  2CW0 C;  5GAE C;  1EL0 A;  1VDZ A;  3HEJ A;  3T13 A;  2O4X A;  4CKB A;  4Q0F A;  2YV5 A;  1C9O A;  2B63 G;  1GHJ A;  1EOV A;  3ERQ A;  2XWJ B;  4GKJ L;  4G7Z C;  1KIX A;  3HOW B;  2PCF B;  3LNN A;  5C3E H;  1RIP A;  3P20 A;  3PSI A;  1Q7Y C;  3QIA A;  1KRS A;  4UPA A;  3FHW A;  3V05 A;  1NR4 A;  1Y1V B;  2B2W A;  3W3A A;  4ZUJ A;  1HJP A;  2JP1 A;  2VS1 A;  3K7A H;  1Q86 C;  1PTO F;  4ME3 A;  1SFO B;  4OWT B;  3CCJ A;  1K28 A;  1B70 B;  3RZO B;  1HTP A;  4R4Q A;  4NB3 A;  4A3M B;  3NTI A;  1SE3 A;  2EQS A;  5GQO A;  4A3E B;  5KNC A;  2UUC Q;  5IYC H;  1F2L A;  3GTL B;  4GLX A;  4XDX A;  1EYD A;  4LFC L;  5M3M H;  3KDF A;  3EFX D;  1QJO A;  3K5O A;  1X3Q A;  1K0R A;  1I3Q H;  4A3D G;  3DM3 A;  4PG3 A;  2ENB A;  1X6O A;  3MZ5 A;  3C2P A;  3OMG A;  2G9D A;  4OEL B;  4X6A H;  3ZYY X;  1SE2 A;  4GOP A;  1C0A A;  2RSN A;  4EGV A;  3R2T A;  3HP3 A;  1VMC A;  2ZXO A;  2F0T A;  2IHF A;  4P72 A;  2QEX A;  4EQP A;  2K1B A;  3DXJ C;  5E4X A;  3CF5 A;  1AEX A;  2BCO A;  4HN7 A;  1VQA A;  2BH8 A;  3DMU A;  4PZ6 A;  2KOL A;  1CT1 D;  4HCS A;  5K36 H;  1PTO B;  4HJ9 A;  3NE5 B;  1KAA A;  2R7Z B;  4DR5 L;  1LT5 D;  3S14 B;  5CV5 A;  3QOJ A;  4UHV A;  2EZV A;  2Z0S A;  4A3I G;  1S5D D;  1IL8 A;  2K5V A;  4R8I A;  1Z47 A;  1NMG A;  5JJI A;  5FKA C;  3UDX A;  4DV0 L;  3GTP B;  2D2C C;  1GM5 A;  3CME A;  3IAY A;  5BR8 L;  1TS3 A;  5CV9 A;  4CDE C;  2L15 A;  1DM0 B;  4ZYS A;  2QF7 A;  3S16 H;  3E5S A;  5E3F A;  3CXC A;  4N8F A;  1XWE A;  3S1R B;  5EBC A;  1LTS D;  1WCM B;  2EY6 A;  2C5C A;  2JA9 A;  5KYI A;  1EYG A;  3TP6 A;  4B3R L;  1PTO D;  2WII B;  1GHK A;  2MO0 A;  1FNV A;  1ENC A;  2YYZ A;  3SVM A;  3QG1 A;  2F0F A;  3CCU A;  1WYD A;  4RGT A;  3HFZ B;  1IYJ B;  3I4O A;  1CKN B;  2Z6K C;  2MP1 A;  4LF6 Q;  4OIK A;  3GTJ B;  1MHW C;  4FYD A;  1MJC A;  1AW7 A;  5FLM H;  1I4R A;  1EZ6 A;  1KNA A;  1RTN A;  1YNJ C;  1QZG A;  2KHS A;  2PO4 A;  1HNX Q;  5IYC G;  5I2X A;  2RKS A;  4BY7 B;  1NSN S;  1LUZ A;  2NWG A;  1CKM A;  3VR5 A;  1YNX A;  2EJM A;  3X3N A;  1WCM H;  2VUM H;  4TQU S;  1QVG A;  1BQQ T;  1Q12 A;  4H0L C;  4A3J B;  1A3V A;  2XGT A;  1VQ7 A;  4X3T A;  1YNN D;  3HG9 A;  1VQL A;  3F2C A;  2A69 C;  4IJH A;  1SRU A;  3AFP A;  2ZTD A;  1VQC A;  2UXC L;  3D6C A;  1QOH A;  5E7N A;  1IW7 C;  1PH1 A;  3HKS A;  4E6I A;  2A73 B;  2PI2 A;  3Q8D A;  3GTL H;  2N8N A;  3MXP A;  2XTI A;  2EYF A;  4IAL A;  2UXD L;  5KEE A;  5EAY A;  2HDM A;  1UAP A;  4RKL A;  2Z9H A;  3VR4 A;  4EQ5 A;  4KY5 A;  1PHJ A;  4A3B G;  1RHP A;  1SNP A;  1EIH A;  2B2Y A;  1IYU A;  4ABN A;  2YTY A;  4XT3 B;  3I91 A;  1HUN A;  3A8J E;  3AU7 A;  1A2U A;  1IBL L;  4MTN A;  2NN6 G;  1BVS A;  1Q81 C;  1S5E D;  4DV3 L;  4MTK A;  3S1N H;  1O7Y A;  2LXK A;  4DK6 C;  1I4G A;  1PDQ A;  4DK3 C;  4Q5V A;  2Q2U A;  1L0W A;  1MD2 D;  2EJG C;  3Q0A A;  1SMY D;  5IP7 H;  3GTK B;  4DR4 L;  1P16 A;  2D0P A;  1I5F A;  5G3L D;  3Q6S A;  4JV5 L;  1SXT A;  3HOY B;  4B3M Q;  2KEC A;  5I6Y A;  3KJP A;  4FXK C;  1XMQ Q;  4KKS A;  1ZYR D;  3GP7 A;  2CCZ A;  1HPC A;  1B7Y B;  3A7L A;  3I7F A;  1BBW A;  4HR7 B;  3J81 E;  4PQX A;  2RA4 A;  4JI6 Q;  3T51 B;  4IJL A;  1VQM A;  2DGY A;  2NBF A;  3AQQ A;  2JSO A;  5EKK A;  4QMG A;  5JAV A;  1RL2 A;  4BY1 G;  4L63 B;  2JA8 B;  2F03 A;  5G3L F;  3J81 i;  4LW1 A;  2LY7 A;  5M5Y B;  3UDI A;  4XYO A;  4RFB A;  4DR7 Q;  2R6G A;  2UU9 Q;  4DU9 A;  2K01 A;  3PO2 H;  1B4O A;  1GUT A;  4UP7 A;  4JI4 Q;  4DAV A;  3S24 A;  1Y8P B;  3ERS X;  2EVB A;  5E1F A;  2CWP A;  1JJG A;  3TP8 A;  1AZQ A;  3M7N A;  4TKO B;  3VR2 A;  2Z6B A;  4A3D B;  1WTQ A;  4JI4 L;  2IX1 A;  2Z8L A;  2RCF A;  2HUG A;  1TY2 A;  4QUC A;  3D31 A;  5IIF A;  3P7J A;  2F1M A;  2IW3 A;  1WVL A;  3CU7 A;  1I4Q A;  1E2Z A;  4IUU A;  2K75 A;  1ZKO A;  1J9O A;  2AWN A;  2QW7 A;  2Z1C A;  2NVX H;  1JIC A;  4QB4 A;  2B8G A;  1K8O A;  1LTA D;  4NW2 A;  2PNR C;  4FF3 A;  1H9S B;  4WFN 3;  2FMC A;  3OTO L;  1KHI A;  1VQ6 A;  4IO9 A;  1EQQ A;  2F0K A;  2PQA A;  3ZJY C;  1KDB A;  3BDC A;  3N52 A;  2G9H D;  4ODG A;  4A93 B;  3RN5 A;  1IBL Q;  1VMP A;  1PTO C;  4O2D A;  1UE6 A;  1OXX K;  4K0K L;  4XT1 B;  3CCE A;  2AUJ D;  5I9O A;  5M5X B;  4LF7 Q;  1XNQ L;  2F0L A;  4IPH A;  3IKJ A;  4F7X A;  2NVQ H;  1DZ1 A;  1OXV A;  4DAP A;  2EXD A;  5CV6 A;  3IFT A;  4OX9 Q;  1FJG Q;  1N33 Q;  1I50 B;  4J1M A;  5M5X H;  1SNQ A;  2A1A A;  3A56 A;  4A3F H;  3MEF A;  3WDN A;  1CHP D;  1PFB A;  3CC2 A;  2E5L Q;  1TS4 A;  1PH4 A;  1PH2 A;  2JA8 H;  1VQ8 A;  2UXB L;  4GN4 B;  5FK9 C;  3G71 A;  3KF8 A;  1KNE A;  1PXU A;  2WP8 J;  4JVZ A;  4DV1 Q;  4DV5 Q;  2LS0 1;  4KJN A;  5BN5 A;  3NWS A;  1I4H A;  1IBM L;  2JA6 G;  2F0S A;  1OO9 B;  5DM6 3;  3L3O C;  2C35 B;  3DM1 A;  2XRQ D;  4A3L H;  1DD2 A;  3I8Z A;  1DXM A;  3CKI B;  3GO5 A;  1VQE A;  2HHH Q;  4O42 A;  5IT9 c;  4V19 0;  3W5O A;  5M5W H;  3C1F A;  1ONL A;  4C3H H;  3VYS A;  1XNR L;  3GD7 A;  1G6P A;  4XIG S;  4UP9 A;  3OWF A;  3CCS A;  4GKK Q;  1A0I A;  1XPO A;  5LL6 X;  5M3F H;  2AQ1 B;  2VQE L;  4PMB A;  2RHQ B;  2HT1 A;  3GTM H;  2HQL A;  4DN4 M;  5FOB B;  3KBG A;  1FVI A;  4FXG C;  1NNX A;  5FO8 B;  5C44 H;  1WCM G;  3ND9 A;  1JQY D;  4DK1 A;  3E9I A;  1J6Q A;  4R4T A;  1TXY A;  1SN8 A;  1TWF H;  1JJ2 A;  1AFP A;  4IFD J;  4Y52 H;  4IPC A;  2A6E C;  2L5T A;  4X64 L;  1TWF B;  1JOO A;  1S4Z A;  3PO2 B;  4FVM A;  1GJX A;  1I94 Q;  5ELF A;  2X6G A;  3OW2 A;  1STG A;  4YCV A;  5EKI A;  4X62 L;  3HOZ G;  1U4R A;  2CKZ B;  4X65 L;  3NQI A;  1GVP A;  1XMO L;  2B2Y C;  3G6E A;  4HMI A;  1GOZ A;  1ICW A;  4GN3 B;  2NVY H;  3K7A B;  3JAM E;  4KTA A;  4C56 C;  2N88 A;  2QDL A;  1LT6 D;  2NVY B;  1QG7 A;  3BZK A;  4PMC A;  4C3I G;  4GS3 A;  1T5X D;  3RZD B;  1N9W A;  4DV4 Q;  1K8G A;  5A2Q L;  2F0E A;  2CW0 D;  1PFN A;  3CC7 A;  2PI2 E;  4AIM A;  2M00 A;  1SEB D;  1KC8 C;  1OXT A;  5EQ0 A;  3WOE A;  2SEB D;  3NBH B;  1KLU D;  1U4P A;  3CHB D;  5IGD A;  1TVX A;  4R4I A;  1GUO A;  4QF4 A;  1V43 A;  4Y7N B;  5KIX A;  1K0S A;  5KYL A;  1EFI D;  1LTB D;  3NEM A;  3QB3 A;  3KOJ A;  4LF8 L;  3HOU H;  1FJG L;  1QNK A;  2VXW A;  1YZ6 A;  1LT4 D;  4R4C A;  3J7A F;  3OWE B;  1STA A;  1NJI C;  1YHA A;  3PIP A;  3GTO H;  4I7Z C;  1STN A;  2VUM B;  2FMM A;  1F2M A;  1BDO A;  3SHL A;  4H02 A;  2NB0 A;  2B29 A;  1RTO A;  3S17 B;  1YVC A;  2EYH A;  1DGS A;  3Q22 A;  2RVL A;  4HAE A;  5JEA H;  3K5L A;  3PUZ A;  2L9H A;  1B1Z A;  1PLF A;  4K2K A;  1QVF A;  3D8G A;  2DJF C;  3MAQ A;  2I5M X;  3H6M A;  5C3X A;  3EIV A;  5EPL A;  1L1O B;  3U50 C;  5C4X G;  1ZYR C;  4G57 A;  3HOW G;  4LF5 L;  4JBK A;  5C3E G;  3K80 C;  1YJW A;  4AQY Q;  1Z9F A;  2V4D A;  3NPP A;  1VQH A;  3NQT A;  2B2V C;  5KGU A;  5M9O A;  3KK7 A;  4JI0 L;  4PZ8 A;  4C3J G;  1BKB A;  1E1T A;  1VQ9 A;  2PZU A;  1JWM D;  3I73 A;  4KHV A;  3JAM i;  4BBR H;  5JJK A;  3TZD A;  1MJE A;  1SNC A;  2KHJ A;  5T1G A;  1SMX A;  3WOF A;  2B3G A;  1Q46 A;  2NN6 I;  1PH9 A;  1E2V A;  1R9T B;  4JBM A;  1YJN A;  1ENF A;  2LXJ A;  5A35 A;  1R4P B;  1SE8 A;  4U67 3;  4G7H C;  3F2B A;  2L0C A;  1X3G A;  2RDF A;  5C6A A;  4GKJ Q;  3DEP A;  1P8L A;  2F3I A;  2FXQ A;  1MI2 A;  1RKN A;  2BE5 C;  1JT8 A;  2OXP A;  1CHQ D;  4BA1 I;  3KLS A;  5COR A;  4AYB G;  3PV0 A;  3M9B A;  1B53 A;  3J81 j;  3U58 A;  1KD1 C;  2R92 B;  3MEH A;  3BZC A;  2K5N A;  3BYT B;  1ZEQ X;  4JI8 Q;  3BVG A;  1HH2 P;  4LF5 Q;  1ENA A;  3HKZ G;  1Q8K A;  4C1N K;  4OL7 A;  2GA4 B;  2EYJ A;  4IUR A;  2QDB A;  1WI5 A;  4HTH A;  3W1G A;  4H13 C;  5D3D A;  3STB D;  3C3L A;  3CRK C;  1V1Q A;  2I46 A;  1EU4 A;  3J80 L;  3VYR A;  1DJR D;  4XQN A;  2UUA Q;  1K3B C;  1MIU A;  2ZM6 Q;  5LMU L;  4MN3 A;  4PMW A;  1B2T A;  3V2T A;  2J4X A;  4MZ9 A;  4LUZ A;  1XJV A;  1TWC B;  5CV8 A;  1A3T A;  3FKI G;  3PUX A;  1HNW L;  4FF2 A;  4QJF A;  3OYY A;  1N34 Q;  4CDD C;  2A5H A;  4DR2 Q;  1QIL A;  1FR3 A;  4TVA B;  1F9P A;  1A3U A;  4Z9C B;  2NVT H;  1CKN A;  4B9W A;  3G4S A;  4IUQ A;  3HOV B;  3PGZ A;  2PQE A;  3K0Y A;  2R7F A;  1HNZ Q;  1B3Q A;  1SR3 A;  4HJ8 A;  2B63 H;  2NVT B;  4A3G H;  4JI1 L;  2LKV A;  2N49 A;  1N33 L;  2RF4 A;  1TWH B;  4CGY B;  3OMC A;  2XSC A;  3H09 A;  5M3M B;  3UE1 A;  3A0J A;  1PH6 A;  1N36 L;  5LMU Q;  2B2U C;  3G7L A;  2ASB A;  4GN5 A;  4DV7 Q;  3E9H A;  2WFW A;  5ELD A;  2K05 A;  3Q24 A;  4OON A;  4NXM Q;  4IPD A;  5FLX L;  5C0X H;  3K5N A;  2SNM A;  5JPM C;  4DUY L;  1KLG D;  4LK1 C;  2P5Z X;  4K6D A;  3H94 A;  3M4O B;  4EX5 A;  2NTT A;  4IUT A;  1YNN C;  3PUY A;  2ICE C;  1TR5 A;  1Z7T A;  5C4J H;  2NYZ D;  4YY3 L;  3Q23 A;  5GAD C;  4IUV A;  4YWK A;  4DF7 A;  4PNY A;  1N32 L;  4A3C H;  1W6J A;  5DLQ E;  2J0T D;  2PYK A;  3J7Y W;  4BBS B;  1F2Z A;  3DWQ A;  1EIG A;  4C2M B;  4HID A;  4JI3 Q;  3J80 E;  4LJZ C;  1G2S A;  1PRT F;  3EQL C;  4NMZ A;  1C4Q A;  3NTK A;  2CFM A;  2A6E D;  3HZX A;  3TRZ A;  4LF9 Q;  3S9W A;  1ESF A;  1SE4 A;  3JC6 6;  4RGN A;  1VQJ A;  2C9O A;  3L7Z C;  2PMZ B;  3MFY A;  5K36 G;  1NTG A;  1IXR A;  4APV A;  1YHB A;  2KCM A;  4X62 Q;  2YTV A;  3DEO A;  2F4V L;  4BBR B;  3S1Q B;  2PPB C;  2IX3 A;  4XXE A;  1U4M A;  4B3T L;  5DM7 3;  1PRT D;  4LMQ D;  1B9M A;  2UXB Q;  1G29 1;  1QVC A;  4YY3 Q;  1JWS D;  1L0X B;  4NXN L;  3SK5 A;  4DA2 A;  5EGT A;  1VQF A;  1Q82 C;  1HFG A;  4KHZ A;  3HOU G;  4LFC Q;  1ZXT A;  3WWV A;  1YEZ A;  1JOK A;  3N6R A;  1MSH A;  3MFG A;  4LFB L;  1GXD C;  1SYB A;  1GD7 A;  2LMC B;  1EUJ A;  2R61 A;  3ERO A;  3BDL A;  4C3H G;  2NUC A;  2EXZ A;  2K5Q A;  4RKB A;  1EFW A;  3OOC A;  4TSS A;  3QJY A;  5FJ8 G;  1L0Y B;  1AE3 A;  2FHT A;  5DAU A;  3RD4 A;  3PF4 A;  1S3O A;  3GTK H;  2K6A A;  1SYE A;  3NEN A;  3HOV H;  1PH5 A;  4Y7N H;  5GAH C;  4CDF C;  5CGK A;  1EY4 A;  1I3Q B;  4OO1 I;  1BXT A;  1SDF A;  1Y69 U;  5C5M A;  2L12 A;  2BA1 A;  2R7D A;  3L9A X;  1I4X A;  4PV1 C;  3FP9 A;  2HIX A;  4DV2 L;  3CRL C;  2E5L L;  1BR9 A;  5TSS A;  2Q8T A;  4ZKC B;  1SAP A;  1IBK Q;  1S5B D;  1D8L A;  1EZ8 A;  4KJO A;  5CC4 A;  3RZO H;  1WTX A;  1HRJ A;  2HQE A;  4DUZ Q;  3KFU A;  4LF7 L;  2F0M A;  2OF1 A;  2ZJQ A;  4R8N A;  1VCI A;  4C3H B;  1F9Q A;  1C8C A;  2L55 A;  1QE6 A;  5J39 A;  4HIM A;  3KLS X;  1M90 C;  3S1M B;  1M4V A;  4JW0 A;  3SXH A;  1U0L A;  1F2Y A;  4GNX B;  1H9M A;  2DY7 A;  4L6T B;  1BNZ A;  3H0G H;  5I6W A;  3I4M H;  4CHT B;  3HOX G;  2YTX A;  1IKL A;  5CBE E;  2UUB Q;  2Z6K A;  1O78 A;  1YBY A;  1WTH A;  2K50 A;  2JK8 A;  4LF9 L;  1CK1 A;  1X54 A;  3TQY A;  3VR6 A;  4AH6 A;  4A3J G;  1A8V A;  1PYB A;  2ZT9 C;  2KED A;  4FDB A;  4ME5 A;  1TS5 A;  3FEW X;  3NWT A;  3VYT A;  2JA8 G;  3KBX A;  2N55 A;  1STH A;  1PRT C;  4YCU A;  3D4R A;  4JBW A;  4BXX G; 
#chains in the Genus database with same CATH homology
 4FP5 D;  3S1N B;  2IPK D;  4OO1 G;  1LV9 A;  4C1N I;  2BE5 D;  2XIW A;  1UUP A;  4KY7 A;  5HUR A;  4RWS C;  1F9S A;  4KK7 A;  1CM9 A;  1JCK B;  4K5X A;  1CTM A;  1GUG A;  4BA2 I;  1KDA A;  4WJW A;  5JPN C;  2QCP X;  4ZKB B;  5LL6 S;  1LTT D;  1HFN A;  4K8I A;  4ZQ3 A;  1W6K A;  2KCC A;  1V8Q A;  3DHQ A;  1QNU A;  3A54 A;  5KRU A;  3OSO A;  1Y8O B;  1PZK D;  2NZ1 D;  2MPM A;  2EDG A;  3A7A B;  4F88 A;  1IKM A;  2R93 B;  3HS0 C;  3PIO 3;  1QB5 D;  1QWY A;  3NP8 A;  5FO9 B;  1ML0 D;  1E2W A;  2O5I C;  4HCE A;  2A6H C;  4MHE A;  1MBY A;  4NDX A;  1WTR A;  1D6E C;  1KTK A;  3GTQ B;  1AP0 A;  4G7O C;  2RQX A;  2WV6 D;  1PFM A;  2XRS D;  5F2D A;  3X3M A;  4ZRZ A;  3I90 A;  3FKI B;  2ICI A;  2F0G A;  2X69 A;  2IT1 A;  1DYQ A;  5J1Z A;  3S2H B;  1RDP D;  1EWC A;  1TKW B;  2QIL A;  2FFK B;  4RA8 A;  2L4N A;  1XTC D;  2VNU D;  1WTV A;  4QCL A;  3R8B A;  1DOL A;  1RD9 D;  5CV4 A;  3A8I E;  1AZP A;  4FF1 A;  2IWH A;  2Z4H A;  1EY6 A;  2KEE A;  2PW7 A;  4CKC A;  2B2T A;  2WKD A;  5I2Y A;  3J7A V;  1ILP A;  1HTL D;  3M4Y A;  4I65 A;  5E4W C;  3TZU A;  5EBD A;  2JEA I;  3FPU B;  1U4L A;  1JOR A;  5CV7 A;  2K5D A;  3T16 A;  4IFD H;  1JOQ A;  3EA6 A;  3S15 B;  5IGG A;  1XX8 A;  5C44 B;  4A3G B;  4KD3 A;  3M85 A;  1FD7 D;  5C3E B;  1X3P A;  2MUY A;  1CA6 A;  2XWB B;  1O7L A;  5EKL A;  2D9U A;  4EQO A;  2WIN B;  1TT2 A;  2OT2 A;  1C48 A;  2F0P A;  5C0X J;  3JAM L;  3U9S A;  2E76 C;  2KVM A;  5I9P A;  4ID6 A;  3RUZ A;  2JXM B;  4ZAI A;  1SND A;  5DEH A;  1G6Z A;  1PZI D;  2IJ0 A;  1JR0 D;  4HSP A;  1II3 A;  3DUZ A;  3NK9 A;  3TBI B;  3TP5 A;  3VA5 A;  1SJE D;  3T53 B;  4O1N A;  2XNA C;  3BG3 A;  5J22 A;  1EY0 A;  4TRD A;  1B44 D;  4WRD A;  4KN4 C;  1LAC A;  1OXS C;  5IGE A;  3V96 A;  1EQV A;  4KN7 C;  1Y1W B;  4C3I B;  1CQF A;  3W2D A;  4IUP A;  3FMC A;  2FIN B;  1NAP A;  4FF4 A;  1JC7 A;  1EY5 A;  4RCO A;  3FRP B;  3TME A;  4F87 A;  4QUF A;  3VR3 A;  3ND8 A;  3UI2 A;  1CZW A;  2DNC A;  1PRT B;  4K2L A;  1HQM C;  2HCC A;  3S16 B;  3GTG B;  3GV3 A;  4KKU A;  3BVM A;  5EPK A;  1K8M A;  1TY0 A;  2CHB D;  1H9J A;  1EY8 A;  2BDN A;  4H7B A;  2R3Z A;  4ULL A;  3EJI A;  1TWG B;  3I4L A;  5BN4 A;  4AYB B;  1DON A;  2BOS A;  1BO0 A;  4KD4 A;  1TU2 B;  2M9V A;  1R4Q B;  2K28 A;  1VF7 A;  5A2Q E;  2B2U A;  3TP7 A;  1V1P A;  3CQZ B;  2JA7 B;  4DFA A;  1A15 A;  4C3J B;  1WTW A;  2E2D C;  1O80 A;  3BVZ A;  5T1I A;  2QEJ C;  1GUS A;  1NCV A;  5C4X B;  3A8K E;  3NUC A;  3A55 A;  5IGB A;  4IUN A;  1BUV T;  5ISR A;  1EOT A;  1HA5 A;  1JE4 A;  1HQR D;  1DCZ A;  2F3V A;  2JA5 B;  3R2I A;  5C0X I;  2KQ3 A;  3NBI A;  2B39 A;  2FJ2 A;  1IHZ A;  3BZD B;  4X3U A;  1RCV D;  1FYC A;  3RMH A;  4ZLT F;  1LTR D;  3PUV A;  4WOR A;  3D3R A;  3FVQ A;  1TS2 A;  1EU3 A;  3LWE A;  1F9R A;  2E74 C;  3NBH A;  2EYM A;  2Y0S B;  1J8I A;  3FDT A;  3PMF A;  2F4I A;  2NVQ B;  3E0J A;  4FO2 A;  3GV6 A;  2KJX A;  1SNM A;  3MTS A;  5IT9 L;  1O7Z A;  4EVO A;  5JEA J;  1MGS A;  1CI3 M;  2EPB A;  4XQQ A;  4YIJ A;  5C4H A;  1EYC A;  2DN8 A;  4IN3 A;  2AWO A;  3G6J B;  3E6Z X;  2EYP A;  3QO2 A;  2YU9 B;  4HED A;  5HGT A;  1WD1 A;  4KKT A;  2JEB I;  1G8Z D;  4K5V A;  2K5W A;  5D65 A;  2KCN A;  2BA0 A;  3T56 B;  1D1I A;  1TII D;  2KUM A;  1HA6 A;  4DAY A;  2EYO A;  4J8Q A;  2E2H B;  4HMJ A;  4DXF A;  4B08 A;  1T5E A;  4G4K A;  4NP5 A;  2Z4I A;  1D1K A;  1XXG A;  4M8A A;  2RDH A;  2EOT A;  2F0W A;  1XYI A;  2ZXP A;  2EY2 A;  5ELC A;  3P75 A;  3TSS A;  1NUC A;  5D14 A;  4HSV A;  4RGO S;  4K8J A;  3TDQ A;  1DOM A;  5I4D A;  2WAQ B;  1EQT A;  3KUP A;  3MWY W;  1I6H B;  4XTC S;  1ILQ A;  2BDO A;  5K5P A;  5NUC A;  3URY A;  4DNR B;  1YNJ D;  1WD0 A;  1Q1B A;  5DNF A;  3PUW A;  2F0J A;  3SK6 A;  1H9S A;  3NSW A;  3T4A C;  2EE1 A;  1B50 A;  2WB1 B;  4NKL A;  1ET9 A;  1H9R A;  2F0H A;  1Y8N B;  5JVG 3;  2IX0 A;  1BOS A;  4IQZ A;  5EPJ A;  2F0I A;  3SR1 A;  4ZK9 B;  3FPP A;  1JWU D;  1JB3 A;  1SBB B;  3MC0 B;  2JYO A;  3HGB A;  3HOX B;  2WKC A;  4K14 A;  1Q3L A;  3K5M A;  3EVQ A;  1GUW A;  2K33 A;  1Q8I A;  4OO1 H;  1LO5 D;  5JOB A;  4KV6 A;  3K6O A;  1BCP D;  1SNO A;  2E75 C;  1BF4 A;  1ET6 A;  1D5M C;  1SJH D;  2PZW A;  4IFD I;  3LWU A;  1X32 A;  1G91 A;  1Q1E A;  2F0O A;  3MHB A;  2XVS A;  4BY1 B;  1WTO A;  2K03 A;  4J6H A;  1STE A;  3IL8 A;  2NTS A;  1STB A;  3GQB A;  5FLX E;  2L1B A;  3LX0 A;  1BCP B;  2PZT A;  3J81 L;  3I70 A;  5C0X G;  3GTO B;  2I07 B;  3OIQ A;  3C1E A;  3HRZ C;  1IW7 D;  1V1P B;  4F8M A;  4A3B B;  2DY8 A;  1I6V C;  2O5J C;  2RBM A;  1F77 A;  5EJW A;  1HXY D;  2D62 A;  2CVR A;  2B63 B;  1PYW D;  5C4J B;  3HOU B;  4X3K A;  3H0G B;  3MXN A;  5IT9 E;  5ELB A;  2RDG A;  3OW7 A;  3VYU A;  2H4O A;  1EY9 A;  1OXU A;  2K04 A;  1EEF D;  5IGC A;  4B9X A;  1B9N A;  1SYD A;  1BCP F;  3DWA A;  2A74 C;  4KMU C;  2A68 C;  1LAB A;  4R9W A;  1EEI D;  2F0D A;  1A2T A;  2HDL A;  2B2W C;  3OIP A;  3K57 A;  1FGB D;  3GTM B;  5JJZ A;  2J7Z A;  2SOB A;  1WTP A;  1G2T A;  4BS9 A;  3PIP 3;  4QIW B;  5CR3 A;  5IGF A;  1V1O A;  1E0B A;  5M5W B;  2K32 A;  2ZXR A;  3MA2 B;  2D5D A;  1HUM A;  4M1U B;  1TWA B;  1U9R A;  4RCN A;  1S5C D;  2RSO A;  2E2J B;  2F0Q A;  4OHJ A;  5M3F B;  4XQJ A;  4P2C B;  1KAB A;  2OEO A;  1RJT A;  3P1H A;  4K5W A;  3K59 A;  3AB9 A;  2MHV A;  1D5Z C;  1LT3 D;  4KY6 A;  1KDC A;  1GUN A;  3M7G A;  4OGQ C;  4A3I B;  4ZUI A;  4FNF A;  4GZY C;  1Z6H A;  5JVH 3;  2F0V A;  2TSS A;  1BCP C;  1S5F D;  1IYV A;  2EYL A;  4A3F B;  4H44 C;  1BBX C;  2NN6 H;  4RAU C;  4LAA A;  3PO3 B;  1ROD A;  2Q8I B;  2EY1 A;  2TMP A;  3BS1 A;  4U68 A;  2O2L D;  3BYY B;  3R93 A;  1PZJ D;  4IZ8 A;  4N9T A;  2EJF C;  3O13 A;  2EY5 A;  3HKZ B;  4DK0 A;  4RH6 A;  2IL8 A;  3D4D A;  5KNB A;  3SE0 A;  3U9O A;  1K83 B;  1LTI D;  3MXU A;  3QOL A;  5C4Z A;  1CZG A;  1SYC A;  1MSG A;  2QKI C;  1Q90 A;  1SSO A;  3D4W A;  4CJ0 B;  4CKE A;  3I4M B;  1HCZ A;  1EY7 A;  2A69 D;  1AN8 A;  1ESR A;  5ELE A;  4N9P A;  5KND A;  4MIU A;  3NTH A;  2F0N A;  3ONA B;  3D6W A;  2MJ8 A;  3NXW A;  1SYG A;  4OIJ A;  3VA7 A;  2B2T C;  3RLF A;  3MVV A;  3K58 A;  2ID0 A;  1I4P A;  2E2I B;  2HCI A;  2Q8R E;  1DOK A;  4JK1 C;  2B8F A;  1UEA B;  2MGS A;  3I3C A;  4A3K B;  2X6L A;  3I4N B;  1STY A;  4XYQ A;  5IOD A;  1UNS A;  1EWH A;  5CYU A;  4K6L A;  1CA5 A;  2DNE A;  2F3W A;  5IOC A;  4CJ1 B;  4BWG B;  1RF2 D;  5JEA G;  3SEB A;  2XN9 C;  2KA7 A;  5C5L A;  2AQ3 B;  4S3S A;  3IFD A;  4X3S A;  4RHS A;  3OPO A;  3MXG A;  5LHY 1;  2B2V A;  1LTG D;  1SYF A;  2AUK A;  5CMD A;  5D3I B;  1M8A A;  4DNT B;  2WAC A;  1D5X C;  1VF5 C;  2VB3 X;  3BDO A;  3SK8 A;  2L11 A;  1EYA A;  2F0U A;  4RGM A;  1PMR A;  2K7V A;  5COY A;  4DGZ A;  3HOZ B;  1TQO A;  4FXD A;  5C3W A;  3OHX C;  1CQV A;  1FNU A;  3TN2 A;  4L8J A;  2A68 D;  1A6X A;  1H9K A;  1SMY C;  1PTO H;  4RHR A;  1QCB D;  2JE6 I;  3H91 A;  4EQN A;  5CBA E;  2SNS A;  1D2B A;  4UAI A;  3I72 A;  5BN3 A;  4IFD G;  2LFN A;  2SDF A;  3M3Y B;  2H1E A;  1NR2 A;  3R3O A;  3S2D B;  3SK4 A;  4UDU C;  3H3V C;  1FNW A;  2A6H D;  3DWP A;  1CFM A;  4KI0 A;  5AFW A;  4DXG A;  3NHH A;  2M2L A;  1LLR D;  4ILW A;  3ITP A;  2VB2 X;  3KLR A;  5FO7 B;  3SDZ A;  1B3A A;  3C46 A;  3QWN A;  2NVX B;  4CBV A;  4V0B A;  2JA6 B;  2CQA A;  3AMU A;  1HHV A;  4CJ2 C;  3F2U A;  2AQ2 B;  2PW5 A;  2CW0 C;  1EL0 A;  1VDZ A;  3HEJ A;  3T13 A;  2O4X A;  4CKB A;  4Q0F A;  1GHJ A;  3ERQ A;  2XWJ B;  4G7Z C;  3HOW B;  2PCF B;  3LNN A;  3P20 A;  3QIA A;  3V05 A;  1NR4 A;  1Y1V B;  2B2W A;  3W3A A;  4ZUJ A;  2JP1 A;  1PTO F;  1SFO B;  3RZO B;  1HTP A;  4A3M B;  3NTI A;  1SE3 A;  4A3E B;  5KNC A;  3GTL B;  1F2L A;  4XDX A;  1EYD A;  3EFX D;  1QJO A;  3K5O A;  1X3Q A;  2ENB A;  3MZ5 A;  3C2P A;  3OMG A;  2G9D A;  3ZYY X;  1SE2 A;  2RSN A;  4EGV A;  3R2T A;  3HP3 A;  1VMC A;  2ZXO A;  2F0T A;  4EQP A;  2K1B A;  3DXJ C;  5E4X A;  1AEX A;  2BCO A;  4HN7 A;  3DMU A;  2KOL A;  1CT1 D;  4HCS A;  5K36 H;  1PTO B;  3NE5 B;  1KAA A;  2R7Z B;  3S14 B;  1LT5 D;  5CV5 A;  3QOJ A;  2EZV A;  1S5D D;  1IL8 A;  4R8I A;  1Z47 A;  5FKA C;  3GTP B;  2D2C C;  3IAY A;  1TS3 A;  5CV9 A;  1DM0 B;  4ZYS A;  2QF7 A;  3E5S A;  5E3F A;  1XWE A;  3S1R B;  5EBC A;  1LTS D;  1WCM B;  2EY6 A;  2C5C A;  5KYI A;  3TP6 A;  1PTO D;  2WII B;  1GHK A;  1FNV A;  1ENC A;  2YYZ A;  3SVM A;  3QG1 A;  2F0F A;  4RGT A;  2MP1 A;  4OIK A;  3GTJ B;  4FYD A;  1AW7 A;  1I4R A;  1EZ6 A;  1KNA A;  1RTN A;  1YNJ C;  2KHS A;  2PO4 A;  5I2X A;  2RKS A;  4BY7 B;  1NSN S;  2NWG A;  3VR5 A;  2EJM A;  3X3N A;  4TQU S;  1BQQ T;  1Q12 A;  4H0L C;  4A3J B;  1A3V A;  4X3T A;  1YNN D;  3HG9 A;  2A69 C;  3D6C A;  1QOH A;  1IW7 C;  4E6I A;  2A73 B;  3MXP A;  2EYF A;  4IAL A;  5KEE A;  2HDM A;  1UAP A;  4RKL A;  3VR4 A;  4KY5 A;  1RHP A;  1SNP A;  1EIH A;  2B2Y A;  1IYU A;  4ABN A;  4XT3 B;  3I91 A;  1HUN A;  3A8J E;  3AU7 A;  1A2U A;  2NN6 G;  1S5E D;  1O7Y A;  1I4G A;  1PDQ A;  4Q5V A;  1MD2 D;  2EJG C;  3Q0A A;  1SMY D;  3GTK B;  5G3L D;  3Q6S A;  1SXT A;  3HOY B;  2KEC A;  5I6Y A;  4FXK C;  4KKS A;  1ZYR D;  3GP7 A;  1HPC A;  3A7L A;  4HR7 B;  3J81 E;  4PQX A;  2RA4 A;  3T51 B;  2NBF A;  2JSO A;  5EKK A;  4QMG A;  5JAV A;  4L63 B;  2JA8 B;  2F03 A;  5G3L F;  2LY7 A;  5M5Y B;  4XYO A;  4RFB A;  2R6G A;  4DU9 A;  2K01 A;  1B4O A;  1GUT A;  4DAV A;  1Y8P B;  2EVB A;  5E1F A;  3TP8 A;  1AZQ A;  3M7N A;  4TKO B;  3VR2 A;  4A3D B;  1WTQ A;  2IX1 A;  2Z8L A;  2HUG A;  1TY2 A;  4QUC A;  3D31 A;  5IIF A;  3P7J A;  2F1M A;  2IW3 A;  1WVL A;  3CU7 A;  1I4Q A;  1E2Z A;  4IUU A;  1ZKO A;  1J9O A;  2AWN A;  2Z1C A;  1JIC A;  4QB4 A;  2B8G A;  1K8O A;  1LTA D;  4NW2 A;  2PNR C;  4FF3 A;  1H9S B;  4WFN 3;  2FMC A;  2F0K A;  1KDB A;  3BDC A;  3N52 A;  2G9H D;  4ODG A;  4A93 B;  1VMP A;  1PTO C;  1OXX K;  4XT1 B;  2AUJ D;  5I9O A;  5M5X B;  2F0L A;  3IKJ A;  4F7X A;  1DZ1 A;  1OXV A;  4DAP A;  5CV6 A;  3IFT A;  1I50 B;  4J1M A;  1SNQ A;  3A56 A;  3WDN A;  1CHP D;  1PFB A;  1TS4 A;  5FK9 C;  3KF8 A;  1KNE A;  1PXU A;  2WP8 J;  2LS0 1;  4KJN A;  5BN5 A;  3NWS A;  1I4H A;  2F0S A;  1OO9 B;  5DM6 3;  3L3O C;  3DM1 A;  2XRQ D;  1DD2 A;  3I8Z A;  1DXM A;  3CKI B;  3GO5 A;  4O42 A;  4V19 0;  3C1F A;  1ONL A;  3VYS A;  3GD7 A;  4XIG S;  3OWF A;  5LL6 X;  2AQ1 B;  4PMB A;  4DN4 M;  5FOB B;  3KBG A;  4FXG C;  5FO8 B;  3ND9 A;  1JQY D;  4DK1 A;  1AFP A;  4IFD J;  2A6E C;  2L5T A;  1TWF B;  1JOO A;  1S4Z A;  3PO2 B;  4FVM A;  1GJX A;  5ELF A;  2X6G A;  1STG A;  5EKI A;  1U4R A;  3NQI A;  2B2Y C;  4HMI A;  1GOZ A;  1ICW A;  3K7A B;  3JAM E;  4KTA A;  4C56 C;  2N88 A;  1LT6 D;  2NVY B;  1QG7 A;  4PMC A;  4C3I G;  1T5X D;  3RZD B;  5A2Q L;  2F0E A;  2CW0 D;  1PFN A;  2M00 A;  1SEB D;  1OXT A;  5EQ0 A;  3WOE A;  2SEB D;  1KLU D;  1U4P A;  3CHB D;  5IGD A;  1TVX A;  1GUO A;  4QF4 A;  1V43 A;  4Y7N B;  5KIX A;  5KYL A;  1EFI D;  1LTB D;  3QB3 A;  1QNK A;  2VXW A;  1LT4 D;  3J7A F;  3OWE B;  1STA A;  4I7Z C;  1STN A;  2VUM B;  2FMM A;  1F2M A;  1BDO A;  3SHL A;  2NB0 A;  1RTO A;  3S17 B;  2EYH A;  3Q22 A;  2RVL A;  4HAE A;  5JEA H;  3K5L A;  3PUZ A;  2L9H A;  1B1Z A;  1PLF A;  4K2K A;  3D8G A;  3MAQ A;  3H6M A;  5C3X A;  5EPL A;  1ZYR C;  4G57 A;  2V4D A;  3NPP A;  3NQT A;  2B2V C;  5KGU A;  5M9O A;  3KK7 A;  4C3J G;  2PZU A;  1JWM D;  3I73 A;  4KHV A;  3TZD A;  1SNC A;  5T1G A;  3WOF A;  2NN6 I;  1E2V A;  1R9T B;  1ENF A;  5A35 A;  1R4P B;  4U67 3;  4G7H C;  2L0C A;  2RDF A;  5C6A A;  3DEP A;  1MI2 A;  1RKN A;  2BE5 C;  2OXP A;  1CHQ D;  4BA1 I;  3KLS A;  5COR A;  3PV0 A;  1B53 A;  2R92 B;  3MEH A;  3BYT B;  1ZEQ X;  3BVG A;  1ENA A;  4C1N K;  2GA4 B;  4OL7 A;  2EYJ A;  4IUR A;  2QDB A;  4HTH A;  4H13 C;  5D3D A;  3C3L A;  3CRK C;  2I46 A;  1EU4 A;  3J80 L;  3VYR A;  1DJR D;  4XQN A;  4MN3 A;  4PMW A;  1B2T A;  3V2T A;  2J4X A;  1TWC B;  5CV8 A;  1A3T A;  3PUX A;  4FF2 A;  2A5H A;  1QIL A;  1FR3 A;  1F9P A;  1A3U A;  4Z9C B;  4B9W A;  4IUQ A;  3HOV B;  2PQE A;  3K0Y A;  2NVT B;  2LKV A;  1TWH B;  4CGY B;  3OMC A;  2XSC A;  3H09 A;  5M3M B;  2B2U C;  3G7L A;  5ELD A;  2K05 A;  3Q24 A;  5FLX L;  5C0X H;  3K5N A;  2SNM A;  5JPM C;  1KLG D;  4LK1 C;  4K6D A;  3H94 A;  3M4O B;  2NTT A;  4IUT A;  1YNN C;  3PUY A;  2ICE C;  1TR5 A;  1Z7T A;  2NYZ D;  3Q23 A;  4IUV A;  4DF7 A;  4PNY A;  1W6J A;  2J0T D;  2PYK A;  3J7Y W;  4BBS B;  1F2Z A;  3DWQ A;  1EIG A;  4C2M B;  3J80 E;  4LJZ C;  1G2S A;  1PRT F;  3EQL C;  4NMZ A;  1C4Q A;  3NTK A;  2A6E D;  3HZX A;  3S9W A;  1ESF A;  1SE4 A;  4RGN A;  5K36 G;  2C9O A;  3L7Z C;  2PMZ B;  3MFY A;  3DEO A;  4BBR B;  3S1Q B;  2PPB C;  2IX3 A;  4XXE A;  1U4M A;  5DM7 3;  1PRT D;  4LMQ D;  1B9M A;  1G29 1;  1JWS D;  1L0X B;  3SK5 A;  4DA2 A;  5EGT A;  1HFG A;  4KHZ A;  1ZXT A;  1JOK A;  3N6R A;  1MSH A;  3MFG A;  1GXD C;  1SYB A;  2LMC B;  4C3H G;  2R61 A;  3ERO A;  3BDL A;  2NUC A;  2EXZ A;  2K5Q A;  4RKB A;  3OOC A;  4TSS A;  3QJY A;  1L0Y B;  2FHT A;  5DAU A;  3RD4 A;  2K6A A;  1SYE A;  5CGK A;  1EY4 A;  1I3Q B;  4OO1 I;  1BXT A;  1SDF A;  1Y69 U;  5C5M A;  2L12 A;  2BA1 A;  3L9A X;  1I4X A;  4PV1 C;  3CRL C;  1BR9 A;  5TSS A;  2Q8T A;  4ZKC B;  1SAP A;  1S5B D;  1EZ8 A;  4KJO A;  5CC4 A;  1WTX A;  1HRJ A;  2HQE A;  2F0M A;  2OF1 A;  4R8N A;  1VCI A;  4C3H B;  1F9Q A;  1C8C A;  2L55 A;  1QE6 A;  5J39 A;  3KLS X;  3S1M B;  1M4V A;  3SXH A;  1F2Y A;  1H9M A;  2DY7 A;  4L6T B;  1BNZ A;  5I6W A;  4CHT B;  1IKL A;  5CBE E;  1O78 A;  1CK1 A;  3VR6 A;  2ZT9 C;  2KED A;  4ME5 A;  1TS5 A;  3FEW X;  3NWT A;  3VYT A;  3KBX A;  2N55 A;  1STH A;  1PRT C;  3D4R A;  4JBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...