2SNMA

In a staphylococcal nuclease mutant the side-chain of a lysine replacing valine 66 is fully buried in the hydrophobic core
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMKENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In a staphylococcal nuclease mutant the side-chain of a lysine replacing valine 66 is fully buried in the hydrophobic core.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 37
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1991-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2snmA00
5IODA 1U9RA 2M00A 5DAUA 4DF7A 4QF4A 1F2MA 5I6WA 2WACA 2RKSA 4KY7A 5C5MA 2EYJA 5CV6A 4DFAA 5IIFA 2OEOA 2F0DA 2F0LA 4QMGA 4ZUIA 4I65A 5IGFA 3D6CA 2F0KA 3SK6A 4PMCA 4DU9A 2RDFA 5JOBA 3RUZA 4KV6A 3U9OA 1SNQA 4KD3A 3OWFA 4B9WA 1RKNA 1SNPA 5I9OA 2F0TA 1SNOA 3P75A 2EYMA 5J1ZA 3LX0A 4HMIA 1EZ6A 4IZ8A 5CV9A 1A3VA 4K5XA 5C3XA 1A2UA 3D4WA 4K5WA 3SK8A 5E1FA 4YIJA 3HEJA 5NUCA 4DGZA 4MIUA 2HQEA 1NSNS 2QDBA 2NUCA 1A3UA 1KDCA 2F0HA 1EQVA 1STBA 4NDXA 4TRDA 2F0JA 2EXZA 1A2TA 1SNCA 1STGA 2F3WA 2LKVA 4S3SA 2SNMA 5K5PA 3SK5A 2PW7A 3VA5A 2PQEA 4N9TA 1TQOA 1EYDA 2PZUA 3DMUA 5CC4A 1KAAA 5IOCA 3PMFA 5IGEA 5CGKA 3NK9A 3D4DA 2F0IA 1EYAA 4EQPA 2EYLA 2F0GA 2PZTA 2PZWA 2O4XA 4PNYA 2EY2A 1EYCA 3DHQA 2F0EA 1STNA 2KHSA 2F0SA 2F0VA 3C1FA 3QB3A 3OSOA 4NMZA 5HURA 5KYLA 5CV4A 5C3WA 1SNMA 1EZ8A 2EY5A 5KGUA 4K2LA 4K6DA 1SYFA 3QOLA 3C1EA 2SOBA 4KY6A 4H7BA 3BDLA 1JOOA 4K14A 2EYOA 3TP8A 3MVVA 1SYBA 3OMCA 3TP7A 3SK4A 4WRDA 3SR1A 2F3VA 3ITPA 5JAVA 1KDBA 3E5SA 2F0NA 5CV5A 5CV8A 2EY1A 1KDAA 4LAAA 2PYKA 5EKLA 3EJIA 1JOKA 4PMBA 3MXPA 4HMJA 5KRUA 1ENCA 4ZQ3A 3NP8A 4WORA 1II3A 5IGGA 3MEHA 1STHA 3ERQA 4KD4A 5HGTA 1EY7A 1SYDA 2KQ3A 3SHLA 4IUNA 3T13A 4N9PA 1JOQA 4K5VA 2EYHA 4KHVA 5J22A 1KABA 3BDCA 4K2KA 2F0QA 3HZXA 4J6HA 4KTAA 5EKKA 5KIXA 5C6AA 4ZUJA 2SNSA 5E3FA 1EY5A 4ME5A 5ISRA 3OMGA 4NP5A 3TP6A 2F0MA 1EY6A 2F0OA 3H6MA 5IGCA 2EYFA 5J39A 3P1HA 4IALA 4KJOA 5M9OA 2OF1A 3TP5A 2PW5A 4RKLA 2EYPA 1TR5A 2OXPA 4KY5A 5I6YA 1EY8A 3NUCA 4J1MA 4E6IA 5KEEA 1SYCA 1F2ZA 5I9PA 3MHBA 1STYA 5F2DA 5C5LA 1F2YA 4G57A 2RBMA 4R8NA 3MZ5A 3QOJA 1STAA 5CV7A 4F8MA 4QB4A 4EQNA 1EY0A 3EROA 3D8GA 4ID6A 4K8JA 4NKLA 4EVOA 3T16A 4KJNA 5C4ZA 2F0WA 3V2TA 4HTHA 4RKBA 1A3TA 4ODGA 5CR3A 5IGBA 2EY6A 2F0FA 3SXHA 1JORA 1TT2A 3NXWA 4K8IA 3TMEA 1AEXA 1ENAA 4EQOA 3S9WA 1EY4A 5EGTA 5KYIA 3NHHA 2ENBA 3EVQA 1EY9A 3R3OA 1NUCA 4OL7A 2F0UA 4B9XA 2F0PA 5DEHA 1SYEA 5C4HA 5IGDA 1SNDA 4F7XA 1SYGA 1IHZA 3NQTA
chains in the Genus database with same CATH superfamily
1XNRQ 4V190 1BBUA 4LF5L 3NSWA 4PG3A 3HRZC 4U673 2RKSA 3S1RH 1QCBD 2FMCA 4HIOA 2DY7A 4L6TB 5C44G 3D6CA 3OHXC 4Q0FA 2KCTA 2VUMG 2WFWA 3QR8A 1PDQA 1Q90A 3LX0A 1EZ6A 3CW2C 4YIJA 5IYBH 2HQEA 1NSNS 5DM73 5FLMG 1PLFA 1HH2P 2K52A 3M3YH 2NTSA 4N9TA 3D0FA 1GUOA 3DMUA 2R93B 1J8IA 5FK9C 2GA4B 4XXEA 5DM63 1ILPA 5ELNA 1BOSA 2BCOA 4NMZA 3A7AB 4IOCA 4O0AA 1NMFA 2K5DA 2I5LX 1WI5A 4KY6A 4QIWB 2Z9HA 4PZ8A 5CMDA 3BDLA 1YNND 1W3SA 3K81C 4C2MH 3G6EA 2FXQA 1SYBA 1Q81C 3PSIA 1QE6A 1D6EC 5CV8A 1BXTA 3K6OA 4DV5Q 1VQCA 4IPGA 1P16A 1DYQA 3MXPA 1EL0A 5LMNQ 3VYUA 1IBLQ 1II3A 4KD4A 1IBMQ 2O5JC 5H1SE 1A15A 1X32A 5FJ8H 5LMUQ 1D2BA 4OWTB 1MSHA 1K83H 4ZKBB 2F0QA 2ZTEA 1YHAA 4PQXA 1EY5A 4ME5A 1DOKA 1VQ9A 2PI2E 3M4PA 3R2TA 1K3BC 1X9NA 2NYZD 1WTOA 3OOCA 3DWQA 3WOFA 3VYSA 4X65Q 1E2VA 1UUPA 1Y1WB 4MTNA 1S3OA 3K57A 3QOJA 1AW7A 1S5CD 2RHQB 3RZOB 1LTLA 3BVMA 1DOMA 3D4RA 1YIJA 3S15H 2NVTB 2G5DA 4L5RC 3I2ZA 4K8IA 2RDGA 2R7ZB 1OXXK 4A3IH 3S1MH 1BNZA 5KYIA 4KHPQ 1RODA 2JK8A 1JWMD 3OWFA 3BVGA 1BQQT 2UXBL 1CFMA 3J80c 4JI6L 1RHPA 1QVGA 1XNQQ 1RIPA 3CC7A 4I65A 1Y1WG 2R7ZH 1NY4A 1WYDA 2BOSA 3BVZA 2E2IH 1DXMA 4DV4L 2LMCB 1Q12A 5M5YB 1Y1VH 1ENFA 1AH9A 3J81i 2IJ0A 4Q5VA 3S15B 3U4ZA 2J4XA 3IFTA 4A3EH 2JXMB 2A69C 3I4MH 2Q2HA 3EBEA 1UE7A 5FLXE 4A3DG 4DV6Q 1WTXA 1SJED 4FXGC 2K28A 4XT1B 1B9MA 1U5KA 2A5HA 2OQ0A 2XRQD 4YY3Q 3T1HL 1PYSB 3PCOB 1K3RA 1VQ5A 5M3MG 3KF8B 4GN5A 4M8AA 2JA5H 3A54A 3I70A 2F0SA 2F0VA 4DV7Q 1S5FD 5C3WA 4EX5A 3MXGA 1D1IA 4K6DA 2VL6A 1YI2A 1JOOA 1WTPA 4GKKQ 3R93A 3NE5B 1NTGA 2R6GA 4KHZA 3EJIA 1JOKA 3KK7A 2IHEA 1NAPA 2PI2A 1JE4A 2C5CA 1E2ZA 1EU3A 4LJZC 1XNRL 2KQ3A 2CFMA 3K5NA 4MZ9A 1Q46A 2A1AA 2KBNA 3KLSA 2SNSA 4LFBQ 3H6MA 1HJPA 2B2VA 1PRTD 1XX8A 2YU9B 1MGSA 2WB1G 1UE1A 4HSPA 5LHY1 2F3IA 4HIDA 1F2YA 4GZYC 3MWYW 1Y1VG 5CV7A 1OXSC 4A3FB 4QB4A 4LF4L 2MHVA 3MTSA 3VR4A 3GTMB 5C0XG 4H0LC 1HUMA 4CJ1B 4BBSG 2HHHQ 1N36Q 1XTCD 2B3GA 3GO5A 3JC66 4IJLA 3HOWH 3S17H 5JJLA 4XTCS 3NXWA 3BU2A 3TMEA 3CCUA 2K03A 3NHHA 4JI3L 4JI0Q 5C4JH 3F2CA 4LFAL 4U68A 2K4KA 3PUZA 4PMBA 2NVQH 3TREA 2A8VA 5CV6A 1TS2A 1QVCA 2OEOA 3CAMA 3A56A 2X6GA 2RDFA 3OW7A 5FO9B 3U9OA 1ESRA 3C3LA 2YTVA 3S16B 1ZKOA 3K80C 2UXDQ 2VB3X 3GTMH 1HZAA 4HMIA 4DAVA 3VDYA 5LMNL 1O7IA 3D4WA 2N88A 1BBWA 3VYRA 2ASBA 2I07B 1A2TA 1STGA 2LKVA 2A6HD 3CPFA 3CU7A 1A8VA 2PW7A 2VUMH 1UAPA 2M2LA 1EYDA 1Y14B 2JP1A 1VQLA 1JMCA 2YV5A 1I94L 1EYAA 4PZ6A 4HIMA 5A35A 2JA8G 5J3BA 5KYLA 3S2HH 4BY1H 2Q8TA 1EEID 1EZ8A 3EFXD 1N34Q 1IL2A 1EQQA 3MVVA 1SJHD 4UHVA 4GNXB 3J7AV 3S1NB 1H9JA 4KN7C 1OXUA 4LAAA 3F8TA 1I50B 3KDFB 4HMJA 2Y0SG 4DR7Q 2RDHA 4OXPA 1SYDA 1GHKA 4IUNA 3T13A 2K6AA 1CZWA 4X66Q 1YITA 4A3GG 1B3QA 5C6AA 2MJ8A 4DV5L 1XMQQ 5J39A 4WJ3M 1MHWC 5ELEA 2EXDA 4JYAL 1C0AA 4RHRA 3AFPA 3E6ZX 1O7LA 4B3SL 3EROA 3DXJC 2ICIA 5C4XB 2F0WA 4ULLA 4ME3A 3S1QH 2ZXRA 4RCOA 5IGBA 1PH6A 1XPUA 2Y0SB 4OX9L 1BVSA 4DV1L 1QZHA 3PV0A 1QNUA 2AUKA 5IP9H 2ENBA 1TVXA 1I4HA 1IYUA 3RZDH 4OL7A 1LABA 4LF6L 5HGQA 1SXTA 3MXNB 3HOZG 3L7ZC 5IODA 1R9TH 1V9PA 3NEMA 1G6PA 1VQDA 1SMXA 2Z0SA 4HJ9A 4JI7Q 1BF4A 2A6EC 3OIQA 5JOBA 4KV6A 3NELA 4DR5Q 5C4XH 1KRSA 1B8AA 4JI6Q 3UE0A 4EQ5A 5NUCA 3KYHC 4IUVA 5COYA 4XQNA 4OELB 4HJ7A 2IPKD 2BH8A 1KIXA 3HOYH 2NZ1D 2BH2A 2F0JA 4NXNQ 4V0BA 4WJ4A 1GVPA 1TY0A 4DAYA 2ZM6Q 1EWCA 5IGEA 1N32Q 4RCNA 1I3QH 1K8OA 3GV6A 1FNWA 3NPPA 2IW3A 2EYLA 2O4XA 1J5EQ 1GUNA 1CHPD 2CQAA 4A3MG 5EPJA 2QKIC 5HURA 2XGTA 1WTRA 1SAPA 4NXMQ 4X64Q 3HOVB 3S2DB 1SEBD 4R4QA 2L5TA 5T1IA 1I4RA 2EDGA 4BBRB 1X3EA 2UUAQ 2EPBA 4DXFA 3C2PA 3SK4A 4X3TA 2NN6G 1KRTA 5FOBB 2CWAA 1KAWA 1H9KA 4DK0A 2CW0D 4Z9CB 4DR3L 4B3TL 1U4MA 4MN3A 1JR0D 3ICEA 2B39A 1AE3A 1XPRA 1PYWD 3BDCA 1SE2A 2EVBA 4ZUJA 5E4XA 5ISRA 1NJIC 4A3BG 5IGCA 1EY6A 4JI8L 3I90A 3P1HA 4RKLA 1EY8A 1KXLA 4HJ8A 4DAYB 2Z6KC 1KTKA 1Q8KA 4A93B 3KLRA 4OONA 4F8MA 1U0LA 4P73A 5D3DA 1OTCA 4X3KA 2HUGA 4AYBE 4XQJA 3D8GA 3KBXA 4K8JA 2NB0A 5CR3A 3GTGH 5JEAJ 4UP9A 3DM3A 4A76A 4TSSA 2XVSA 3UDFA 3ONAB 1ZYRC 1IBKL 3PO3H 4A3LH 2XNAC 3I56A 4O1NA 1PH4A 3BDOA 1VQ8A 2VNUD 2F0PA 1SYEA 4IQZA 1EYGA 3T1YL 5EBDA 4DR4L 1N36L 4HR7B 1YHQA 3H0GG 3ZJYC 4DV0L 3MXNA 3HG9A 5BR8L 2HIXA 3DWPA 3PIO3 1G91A 2Z4IA 4RWSC 2F0KA 2KVMA 4AQYQ 2HIVA 1STEA 1VQPA 3J80E 3P75A 1ET6A 3BG3A 1VQNA 4DGZA 3S2HB 2R7FA 3GTPH 4N8X1 4R9WA 2JA6G 4A75A 2NWGA 5IWAQ 1EQVA 3IRBA 1IKLA 1STBA 2X6LA 3HOUH 2L12A 3PUXA 2PZUA 1M8AA 4OIKA 5IOCA 2K5NA 3NK9A 5IP7G 2AUJD 4K6LA 5JVH3 2B2TA 2UXCL 1AP0A 1I6HB 3J80L 3L2PA 5CV4A 1DD2A 2EY5A 2PNHA 4K2LA 3UE1A 1E1TA 1UWVA 3CQZB 1X6OA 3VR6A 1E2WA 4H7BA 3I91A 3PO2H 4GKJQ 3OMCA 1HNWL 1OO9B 2CHBD 1Z9FA 5CV5A 2EZVA 2AQ3B 4IFDH 1X3GA 2IL8A 4L5SA 3SE0A 4PZ7A 3P7JA 1S40A 4LF4Q 2CWPA 2HDLA 2VZAA 2ZTDA 3ERQA 4LF5Q 1FGUA 4F87A 1MI2A 2UU9Q 4RAUC 1IBML 5KIXA 4YCUA 1TWHB 3CCVA 3G48A 3BZCA 3KF6A 3AMUA 3K8AA 3T53B 3E9HA 4ALPA 1STYA 2NBFA 1LTSD 2RBMA 4NB3A 1STAA 4EQNA 1FNVA 1L1OC 3H3VC 1H9SB 2NVXB 4WFN3 4DR2Q 1UNSA 3J7ZC 1A3TA 1CQFA 5CBEE 2EY6A 2F0FA 4GKKL 4C56C 2ZXOA 2Z4HA 1ZEQX 2HD3A 4A3EB 1NUCA 2UUBQ 2OWOA 1JJCB 2K14A 1UEAB 4ZQ3A 4JI5L 1YBYA 4UAIA 4QCLA 1I4QA 5I6WA 1C4QA 3WOEA 5JPMC 4GN3B 1L1OB 2EOTA 3Q22A 3NBIA 4HJAA 3S1QB 3EIVA 2Q8IB 3I3CA 1FNUA 2F0TA 4QL5A 4X62Q 2EYMA 3D3RA 4GOPA 2RF4A 3CP0A 3DLLA 4RGOS 1LTID 1PTOD 3SK8A 3RN2A 1PTOH 4A3IB 5M5WB 1OXTA 2KEEA 1HPCA 5ELCA 1PFMA 4AIMA 2RVLA 2EXZA 1WTQA 1VQBA 2L1BA 2D2CC 3VA5A 2EQSA 4JBWA 1I6VC 3PO2G 4LF7Q 2K75A 3CF5A 5ELOA 2AQ1B 3H94A 3ULPA 3SVMA 1TWAH 1G2SA 4B3RQ 5ELBA 3IKJA 3BJUA 3TS2A 5M3FH 5CBAE 4G7HC 4BS9A 2XRSD 1L0XB 3QOLA 1UE6A 2SOBA 3I4NG 2R61A 3U58A 3TP8A 1V1OA 2DNEA 1LACA 5M5XH 5G3LD 3SEBA 4IUPA 2NVYB 1Q7YC 2B2TC 4LF8L 4JBJA 4BY1B 4R4OA 3KLSX 4KMUC 4PV1C 2F03A 1ENCA 5L37A 4B3SQ 5K36G 4FO2A 5I2YA 1XTDA 4JOIC 1QG7A 1RDPD 3PO2B 2R93H 1K8GA 4NP5A 4JOIA 3I4MG 3A55A 4IALA 2PQAA 4OO1I 2OF1A 3KJPA 1U4PA 2GN5A 2H1EA 2QILA 3RNUA 4E6IA 2MGSA 1VQ6A 2AQ2B 3GDEA 3MHBA 1Y8OB 1HRJA 4DUYL 3M4YA 1GD7A 1TWCB 3G6JB 2A73B 1EY0A 4OO1G 1QUQA 4EVOA 4LF8Q 2C35B 3I4LA 4KJNA 1EUJA 5D3IB 4CKEA 1QWYA 4KKSA 3E0JA 1EIHA 3J80i 1HA6A 4LUZA 1EY4A 3BYTB 2Z6BA 1PFNA 4K0KL 4DV2L 1TWHH 2F0UA 1NE3A 3NQTA 1C7YA 3J81c 1IYJB 1MKHA 4IOAA 1B50A 4HEDA 4KY7A 5C44H 2B2YC 1VQMA 1RTNA 5G3LF 2JEBI 3PO3G 1ILQA 2DUDA 4PMCA 3RUZA 4X62L 3TDQA 1WTVA 2B2YA 4B9WA 1ZXTA 4C2MB 1EIFA 2OQKA 4FP5D 4DK1A 2NZOA 3BYYB 2LXKA 5BR8Q 3NBHB 1KD1C 1I6HH 4UDUC 1EOVA 4LUOA 1NR2A 3I7FA 4X3UA 1QJOA 2F0HA 4BBRG 2QEXA 4NDXA 3JAML 4TRDA 5M3FG 1IXRA 1JT8A 5K5PA 3SK5A 2A68C 4XDXA 3K0XA 3V05A 3KFUA 4A3CH 4DV4Q 1UEBA 1Q86C 2PZTA 1E3PA 3CRKC 1SLJA 1I94Q 5J1ZA 1EFWA 3QB3A 4LUVA 3OTOL 5KNBA 1W6JA 1EIYB 3CC4A 5EPKA 4YHHL 2IX3A 4DNRB 1KQSA 1SR3A 1Y8NB 2B63G 4NPSA 3HKSA 4JI5Q 3S24A 4DNIA 4FF3A 2JN4A 3ITPA 3JAMi 1VQJA 2LY7A 3FKIG 4C3IG 2K32A 3T56B 4ZLTF 4A93G 3S1RB 2B2VC 2K04A 1RF2D 5JJIA 3OWEB 4KKUA 1B4OA 3G7LA 3AFQA 1TS3A 3Q0AA 5E4WC 4O42A 2EYFA 2MFIA 2FFKB 2EYPA 3A8KE 1CKOA 2CH4W 3LWUA 4R8IA 4C3JH 2CQOA 4NW2A 1DM0B 1VS0A 1XJVA 1GJXA 2B63B 5JEAH 4ID6A 4OX9Q 2N55A 2DY8A 3DUZA 3SXHA 4G7ZC 4FVMA 4P74A 4L8JA 2B8FA 1PA6A 3A74A 4DK3C 1F77A 1WCMB 4IURA 4LF9L 4IUTA 3HOXB 2B2WA 2K5QA 1SROA 5DNFA 3FPPA 2PO4A 1PH3A 4B3RL 5IWAL 2V4DA 3M85A 3J81j 3NWTA 1RL2A 4PMWA 4A3JH 2K5WA 4P72A 4DA2A 4JI2Q 1FJGQ 1ICFB 1PZJD 4GS3A 1YEZA 1MJEA 2Z8LA 1I4XA 1XWEA 1RKNA 1HCZA 3RMHA 4ZAIA 4JI7L 2CVRA 1CZGA 2HT1A 3VYTA 4IZ8A 3RLNA 1CI3M 1YZ6A 4BBSH 1PZKD 2CH4A 4NXNL 2R92B 1V1QA 1X3PA 4ZKCB 2IT1A 2DJGC 1X56A 3NENA 1DGSA 1I3QB 1MJCA 3ND9A 2ICEC 2F4VQ 1R4PB 1S5BD 1JQYD 1C48A 2J7ZA 1K83B 3VR3A 5T1GA 1IBKQ 3GV3A 4DR6L 2UXDL 1PH7A 1NCVA 1JB3A 2EY2A 1EYCA 3PIOA 1GXDC 3CPWA 1G291 1F2LA 2L4NA 1HA5A 1SYFA 1B3AA 1QB5D 5EJWA 4NXML 5JEAG 2ZXPA 3Q23A 4IFDJ 1BCPC 3SR1A 4BY7G 2K1BA 3HOYB 2UUAL 2WAQB 2A19A 4DPGA 1EQTA 5IGGA 3H15A 3RLFA 1NMGA 1F9QA 3KF6B 4N9PA 1XMOQ 2KENA 4IUUA 2BE5C 4K2KA 3GP7A 3Q6SA 4KI0A 2V1CC 4CDFC 1G8ZD 4CBVA 1IKMA 5ELDA 2QA4A 2F1MA 3QWNA 4YWLA 1R9TB 5FLXL 2HCCA 5BN4A 5KEEA 2OCEA 1B1ZA 1ET9A 4G57A 4RGNA 3HOXH 4APVA 3HOVH 2K05A 4BY7B 2DGYA 3STBD 3W2DA 5IT9E 4C3HH 4L63B 4ODGA 1VQHA 2DJFC 1FR3A 4RGTA 4O2DA 1AEXA 2D9UA 4YHHQ 5LMNW 1MSGA 4BA1I 2RSOA 4AH6A 1ESFA 2B63H 4P71A 1G6ZA 4DV0Q 1CHQD 3PF4A 3UDIA 5IGDA 2EIFA 3PF5A 2R93G 3PGZA 2A6HC 4XYQA 3AEVA 2R7DA 5C5MA 2I5HA 3CCLA 4JI2L 1FJGL 4DFAA 1EU4A 1VQGA 4WJWA 3HP3A 1ML0D 1MBYA 3VA7A 1JCKB 1S4ZA 2WKDA 5FO8B 5IT9L 3GTOB 5C4JB 5FLXc 3E9IA 4OO1H 1A3VA 4DR1Q 1PTOB 5C3EG 3TN2A 1WD1A 2B8GA 2LS01 4FNFA 5EAYA 2VXWA 2MNAA 1K0SA 4TVAB 5IYCH 3HOWB 2M9VA 1B2TA 4DKAC 2WIIB 4J15A 4QJFA 1VQIA 5EBCA 4EGVA 5IP9G 5AJ3L 3TS0A 3EA6A 3NWSA 2ALYB 1KAAA 1LT6D 2L9HA 4I7AA 2HDMA 3K5OA 2RQXA 2JE6I 4PNYA 4R4CA 3TZUA 1Q82C 4LFAQ 1ZYRD 1O7ZA 3FHWA 3DHQA 3FDTA 2JJQA 1SNMA 4JI4L 3M4QA 2IX1A 2VUMB 4F88A 3O13A 1V1PA 3GTQB 3S16H 1VQOA 1LTRD 1K9MC 2I0QA 1K73C 4FDBA 4C3JB 1H9MA 1PH8A 1PRTB 1YNJD 1EFID 1PTOF 2WB1E 1KABA 3HOVG 3TP6A 1U4RA 3A8JE 3FKIH 4C3IH 5GAHC 1J6QA 2RHSB 3D31A 4IPCA 5M9OA 1WD0A 1YNXA 1X55A 2XSCA 2NVQB 1M4VA 5CORA 2L0CA 1WVLA 1PYBA 4RH6A 1RTOA 1LTGD 4JPBW 3KDFA 4HTHA 4RHSA 1OXVA 4HN7A 2K33A 3SGIA 1KL9A 1Y8PB 1EWHA 3C46A 2K5VA 5I2XA 4A3BB 4C3JG 5IYDH 5IE8A 4DV3L 4A3DB 1J9OA 4GNXC 4B9XA 1HZ9A 4DR5L 2BA0A 4DAMA 3HS0C 3HKZE 4DF7A 4QF4A 3DM1A 3PIP3 4R4TA 3PUWA 1PRTF 5IIFA 4QUCA 1N33Q 3MA2B 4LFCQ 1SNQA 3W1BA 1XMOL 2Q2UA 3PUVA 2VY3A 4ZYSA 1PFBA 4YWMA 5IYBG 1VDZA 1XMQL 3K58A 3OTOQ 1ASYA 1JICA 3NBHA 3CXCA 1X54A 4GN4B 2JA5B 1BBXC 1SNCA 4Y7NB 4A3LG 4KHPL 1PXUA 3I4NH 3FKIB 4C3IB 4M1UB 4RGMA 3AYHB 3KUPA 4XIGS 3QO2A 3KLWA 3S17B 1YJNA 3GTLH 3G4SA 1VQ4A 1CKMA 1MD2D 3R2IA 4GLXA 3C1FA 1EWIA 1STNA 3FMCA 3NTIA 2K50A 5GAGC 4DR2L 4QQBX 2EJGC 1V1PB 3QG1A 1HQRD 1Y1VB 3I55A 3BS1A 4HSVA 4WRDA 1KHIA 1M90C 3MC0B 1HZCA 2ATWA 1VCIA 1LV9A 3MEHA 1U4LA 3E0EA 3M7NA 4H44C 1JOQA 1PRTC 2E2IB 1GUGA 4JI1Q 2FHTA 3JAMc 1K28A 1DONA 2HQLA 3OMGA 3H3VH 3S1MB 2OTJA 1WCMG 4X65L 2UUCQ 5M5XB 1I5FA 1LT4D 2O5IC 5JJZA 2B2UA 2XTIA 4CDCC 3R8BA 3CC2A 4HJ5A 3LWEA 4JK1C 2AHOB 3S14H 1NBWA 5DLQE 3M3YB 3J81L 2N8NA 4IFDG 1ENAA 3A0JA 5JPNC 1TKWB 3N52A 5CYUA 3UDGA 2CKZB 1GHJA 3H3VI 1E1OA 3A5UA 1FYCA 1SYGA 3J7YW 5M5WH 4POFA 1UE5A 2OT2A 1V43A 1FL0A 1MIUA 2F0LA 4ZUIA 1PH9A 1D7QA 4DXGA 2D5DA 4IPDA 2SEBD 3HKZG 4A3FG 1NNXA 1QZGA 2L11A 3W1GA 4J8QA 3MAQA 3DWAA 1L0YB 2AMCB 2MP1A 4BBSB 3J81E 4K5WA 3GTJH 1GM5A 4JI8Q 4BXXH 1CTMA 1LYLA 2IWHA 2ZT9C 4P2CB 4DUZQ 1G51A 1YJWA 2PQEA 4FF1A 1K8MA 3U50C 4TQUS 1K0RA 2PZWA 1QOHA 1I4GA 5LL6S 2K01A 4R1JA 1R4QB 4A3DH 1TWFB 4DNTB 1GKHA 1JJ2A 1WOCA 1Z6HA 2OTLA 4K14A 2EYOA 3T1YQ 2JEAI 5M3MH 4LWCA 3OYYA 1KDBA 2ZJRA 4MNOA 2PYKA 3FP9A 4H13C 1CSQA 2KEDA 3MEFA 4UPAA 3CCRA 3NP8A 2A69D 3CCSA 4DUZL 1X3QA 3SHLA 3GTLB 4K5VA 2VW9A 1CT1D 3K5LA 3HZXA 4ABNA 5EKKA 4LF6Q 3OPOA 3ND8A 5ELFA 3GTKH 3HOZH 3I4NB 4FF2A 2JA8B 1LLRD 3TP5A 4B3MQ 1WFQA 2E2DC 3U4VA 4KY5A 4J1MA 1QNKA 1BCPB 4JVZA 1F2ZA 2JYOA 4BY1G 1N34L 4DR6Q 2QGQA 3ERSX 1LTBD 2E5LL 1DZ1A 4GLVB 4KK7A 4NKLA 1XYIA 1TXYA 3V2TA 2PCFB 2QF7A 1HNWQ 3ULJA 1I4PA 4GNXA 2D62A 1HHVA 1V8QA 4R4IA 5EGTA 2E2JB 1TU2B 2J0TD 4IUQA 1TWGB 4OEMB 1D8LA 1KLGD 4B08A 1W2BA 2VQEL 3DEOA 5GAEC 1VMPA 1AZQA 4F7XA 2SDFA 4IFDI 1LTTD 1VQFA 3V96A 3HOWG 1VMCA 3K7UC 4DV3Q 2F0DA 5IGFA 3SK6A 1SFOB 2VS1A 5BN3A 3K59A 4KD3A 2QCPX 3CHBD 1SNOA 3GTPB 1RJTA 1JWSD 4K0KQ 2PMZB 1IW7C 4JI4Q 4MIUA 3W3AA 4I7ZC 4HCEA 1KDCA 3F1ZA 4S3SA 1IL8A 2SNMA 2TMPA 1TQOA 3PO3B 1GUSA 4BWGB 5BN5A 1CM9A 3PMFA 4CGYB 3HOZB 4CJ0B 3CCQA 2BDNA 3AB9A 1O78A 1T5XD 4AYBB 1SE3A 2JA7G 3WDNA 3ZYYX 2UXCQ 1EQRA 3RD4A 2KHIA 2IY5B 2KOLA 2QW7A 4G4KA 3GTQH 4X6AH 1Y69U 1YJ9A 2YYZA 1KDAA 4BY7H 5EKLA 1LUZA 3PUYA 4DR7L 2LXJA 1CA6A 1QVFA 1TWFH 1VF7A 1QUQB 4WORA 4A3FH 1VF5C 1LT5D 4N8FA 1GOZA 1F9RA 3QJYA 1HNZL 5EPLA 1A62A 1S5ED 1PFSA 2F0MA 3H0GB 3GQBA 1CQVA 4A3MB 5AJ3Q 1TY2A 3EQLC 1HFGA 2ZJPA 1TR5A 2OXPA 4CKCA 1NR4A 3I8ZA 5FLMH 4A4IA 2Q2IA 4BBRH 1BKBA 3AQQA 2MQHA 4LW1A 4R8NA 3TBIB 3RR5A 3GTJB 2O2LD 3AU7A 1XNQL 3T16A 1SE8A 1HZBA 3CCEA 1JORA 2NVYH 1IZ6A 1AFPA 1AE2A 1BO0A 2F4VL 1E7ZA 3S9WA 3KJOA 4LK1C 1SMYD 1KNEA 2L55A 3S2DH 2WINB 3R3OA 1RCVD 1ICWA 5JJKA 5C4HA 1DCZA 1TWAB 2A6ED 3PIPA 5DAUA 2JA5G 5FO7B 1L2FA 3F2DA 4RFBA 1HFNA 5EKIA 3MFYA 2XN9C 2AWNA 1KLUD 4C3HB 5M3MB 3UDXA 5FJ8G 2G9DA 1F9PA 1ONLA 1TWCH 5E1FA 3WWVA 1HTPA 2NUCA 3T51B 1Q3LA 4YCWA 1A6XA 5M5YH 3D6WA 3GD7A 3RZDB 5KNDA 2FJ2A 3QIAA 5CC4A 1A0IA 1EIGA 2ZTCA 1LO5D 2JA9A 3L3OC 3FPUB 3KBGA 2E74C 4L5QA 1GUWA 2F0GA 5EQ0A 1PZID 5LL6X 2MPMA 2EJFC 3MXUA 2L15A 2E5LQ 2R92G 4ZK9B 4LFBL 1JJGA 3Q8DA 2NN6H 1YHBA 1YNJC 1E22A 5C0XH 3TP7A 2UUCL 1N33L 2WB1B 2WKCA 1IBLL 2JA6B 4GLAC 5AFWA 1HNXQ 4OGQC 4A3KB 4IPHA 1HTLD 4LNQA 2E76C 3M4OH 1Y1WH 3NTKA 2HHHL 3J7AF 1CK1A 5E3FA 1I50H 2Q8RE 4OIJA 3W5OA 2ID0A 1BUVT 2PW5A 4HIKA 2XWBB 3JAME 5TSSA 3NUCA 3CCJA 5D65A 1SYCA 5I9PA 5C5LA 5IYDG 3I72A 3MZ5A 4IO9A 3HOUG 1FGBD 3M7GA 4LF9Q 4KN4C 2FINB 4DUYQ 3HFZB 2PPBC 4DV7L 3URYA 5HY6A 3S1NH 2QEJC 2EE1A 5IP7H 4JYAQ 3IL8A 4A3IG 3HKZB 3L0OA 3J7A5 2X69A 2N49A 1EOTA 2ZM6L 5I4DA 2Z6KA 2B2UC 3F2BA 1JB7A 2VQFQ 1W6KA 1LTAD 1WJJA 5DEHA 1SNDA 2DN8A 4FXDA 4KKTA 2E2HH 2H5XA 4MHEA 1YVCA 4DV1Q 2I5MX 5GADC 1CA5A 2K7VA 2A68D 4XYOA 1H95A 4FF4A 4DAPA 2F4IA 2E75C 2MO0A 3HOUB 2ES2A 1AZPA 1VQAA 5GQOA 3VR5A 3A5ZB 2DNCA 2RCFA 4BXXG 1A63A 5CV9A 1C8CA 3CD6A 1A2UA 2KCCA 2QDBA 4GOPC 4DV6L 1A3UA 2PNRC 1D1KA 1BCPD 4JW0A 4OHJA 1PVOA 1VQEA 1BR9A 2F3WA 2QDLA 1PMRA 2UUBL 3A7LA 5C44B 4A3GH 3CMAA 4JBKA 1YNNC 2PQAB 4OWXB 2KCNA 3K5MA 3VR2A 4EQPA 1KNAA 2CCZA 1X65A 2AWOA 2KHJA 3CCMA 3OSOA 2YTXA 4A3GB 1DOLA 5KGUA 4L5TA 2RSNA 1D5MC 4JG2A 4CDEC 2RA4A 4HAEA 1CUKA 2YU9H 1H9SA 1J5EL 2F3VA 1P8LA 5C3EH 1SDFA 2EY1A 2WAQE 3NQIA 2FMMA 1C9OA 2N3SA 1Z47A 1JWUD 2UXBQ 5HGTA 4MTKA 2UU9L 2A74C 5C4XG 2D0OA 5J22A 2WP8J 4J6HA 4YCVA 5FKAC 4G7OC 3HGBA 2GVAA 1XPOA 1IYVA 1SRUA 1PTOC 3TSSA 1Q8IA 4A3BH 1N9WA 4CHTB 5I6YA 2KUMA 5IYCG 3K7AH 2AKWB 4RG1A 3FEWX 2EJMA 4HCSA 1TS4A 4A3CG 2NTTA 4QUFA 1K8AC 5C4ZA 1TIID 1B53A 2HCIA 3CRLC 2NVTH 4LMQD 2XIWA 3CMEA 2MUYA 1VQKA 1G2TA 3RZOH 1EEFD 5M3FB 4FYDA 4H02A 3CKIB 1B7YB 3ER0A 3I4MB 2E8GA 1U9RA 2M00A 4OWWB 1F2MA 3TRZA 2D0PA 2WACA 4UY8C 2BDOA 3FRPB 4QMGA 3MFGA 3FVQA 4DU9A 2TSSA 3S14B 4FXKC 3BZDB 4RA8A 5I9OA 2R7ZG 3GTGB 2C9OA 1TS5A 1HR0W 4AYBG 2JA7B 1N8RC 1HXYD 4X64L 2E2HB 2KECA 4A93H 4CDDC 4JI1L 5IY0A 1QILA 4GOPB 2KJXA 3ULLA 2P5ZX 4LF7L 1BCPF 1T9HA 4CKBA 1O7YA 5CGKA 1S5DD 1BDOA 3D4DA 3EN2A 2KA7A 1PH1A 1B70B 2K5HA 2PMZE 3PQIA 1PH2A 4JV5Q 4JBMA 1WTHA 2LSSA 2KHSA 1T5EA 2VQFL 4ILWA 3C1EA 3GTOH 4UP8A 1SBBB 1X3FA 5JAVA 4C1NK 3E5SA 2F0NA 2NVXH 1DJRD 1E0BA 3Q24A 5KRUA 4DK6C 4TKOB 3KF8A 2Q2TA 4ZRZA 3STBC 4XQQA 3M4OB 4YWKA 2EYHA 4KHVA 3K0YA 2ZJQA 4RMFA 1Q1EA 2GVBA 4KTAA 4B3ML 4A3KH 2Z1CA 3E3XA 4DR1L 4UP7A 2JA6H 3TEHB 5D14A 3M9BA 4Y7NH 1D5XC 5K36H 1AN8A 4A3JG 3H09A 1HQMC 4DR4Q 5IT9c 4JC0A 3TZDA 3G71A 2VB2X 1Q1BA 1H9RA 4QGUA 1GO3E 1PV4A 2YTYA 2F52A 1JC7A 4XT3B 4RKBA 4AQYL 3KOJA 4C3HG 1B44D 1D5ZC 1Z7TA 3F2UA 1F9SA 4EQOA 4A3MH 2R3ZA 1SMYC 5C0XI 1EY9A 3NTHA 3TQYA 1LM0A 1E24A 1IHZA 1SE4A 1O80A 1HR0L 4Y52H 3B6YA 2VQEQ 2B2WC 1SFOH 2EYJA 4A3JB 1WCMH 3LNNA 1CSPA 2I46A 1HUNA 2BE5D 3I4OA 1SN8A 2MO1A 1SNPA 5LMUL 4JI0L 4YY3L 4JI3Q 4K5XA 5C3XA 1TWGH 3HOYG 3HEJA 2E2JH 2JQOA 3OIPA 2JA7H 1PHJA 1WTWA 4BA2I 2N78A 2NZHA 4GKJL 1XXGA 3HOXG 1N32L 3X3MA 4KLKA 1B9NA 1HNXL 1FVIA 4A3KG 2F0IA 1M1KC 5JVG3 3RN5A 4ZCKA 3IAYA 3P20A 2Y0SE 2F0EA 2R92H 1S72A 5C0XJ 2JSOA 2KCMA 2JA8H 3UI2A 2XWJB 5KNCA 1ASZA 3GTKB 4IJHA 4QY7A 1L0WA 2CW0C 3X3NA 2B29A 3N6RA 3IFDA 3CQZH 4IN3A 4B3TQ 1GUTA 3H0GH 4DV2Q 1RD9D 3T4AC 4DN4M 2RCNA 5A2QL 1STHA 1HNZQ 1EY7A 3K7AB 2NN6I 4LFCL 3H91A 2H4OA 4DR3Q 1VQ7A 1LT3D 1IW7D 1SSOA 3OW2A 4P75A 2F0OA 2LFNA 3RLOA 4KJOA 4A3EG 4QIWE 3DEPA 1FD7D 3U9SA 4POGA 3BZKA 5F2DA 5GROA 1JE5A 2IX0A 3T1HQ 2WV6D 4CJ2C 4C1NI 3SDZA 3A8IE 2WAQG 4X3SA 5C3EB 5E7NA 4X66L 5A2QE 1TT2A 3LGJA 3L9AX 2IHFA 3I73A 1PH5A 4JCVE 2BA1A 3EVQA 1HR0Q 1CKNA 1CKNB 1L1OA 2G9HD 4JV5L 1KC8C
chains in the Genus database with same CATH topology
4V190 3NSWA 3HRZC 4U673 2RKSA 1QCBD 2FMCA 2DY7A 4L6TB 3D6CA 3OHXC 4Q0FA 1PDQA 1Q90A 3LX0A 1EZ6A 4YIJA 2HQEA 1NSNS 5DM73 1PLFA 2NTSA 4N9TA 1GUOA 3DMUA 2R93B 1J8IA 5FK9C 2GA4B 4XXEA 5DM63 1ILPA 1BOSA 2BCOA 4NMZA 3A7AB 2K5DA 4KY6A 5CMDA 4QIWB 3BDLA 1YNND 1SYBA 1QE6A 1D6EC 5CV8A 1BXTA 3K6OA 1DYQA 3MXPA 1EL0A 3VYUA 1II3A 4KD4A 2O5JC 1A15A 1X32A 1D2BA 1MSHA 4ZKBB 2F0QA 4PQXA 1EY5A 4ME5A 1DOKA 3R2TA 2NYZD 1WTOA 3OOCA 3DWQA 3WOFA 3VYSA 1E2VA 1UUPA 1Y1WB 3K57A 3QOJA 1AW7A 1S5CD 3RZOB 3BVMA 1DOMA 3D4RA 2NVTB 4K8IA 2RDGA 2R7ZB 1OXXK 1BNZA 5KYIA 1RODA 1JWMD 3OWFA 3BVGA 1BQQT 1CFMA 1RHPA 4I65A 2BOSA 3BVZA 1DXMA 2LMCB 1Q12A 5M5YB 1ENFA 3S15B 2IJ0A 4Q5VA 2J4XA 3IFTA 2JXMB 2A69C 5FLXE 1WTXA 1SJED 4FXGC 2K28A 4XT1B 1B9MA 2A5HA 2XRQD 4M8AA 3A54A 3I70A 2F0SA 2F0VA 1S5FD 5C3WA 3MXGA 1D1IA 4K6DA 1JOOA 1WTPA 3R93A 3NE5B 2R6GA 4KHZA 3EJIA 1JOKA 3KK7A 1NAPA 1JE4A 2C5CA 1E2ZA 1EU3A 4LJZC 2KQ3A 3K5NA 3KLSA 2SNSA 3H6MA 2B2VA 1PRTD 1XX8A 2YU9B 1MGSA 4HSPA 5LHY1 1F2YA 4GZYC 3MWYW 5CV7A 1OXSC 4A3FB 4QB4A 2MHVA 3MTSA 3VR4A 3GTMB 5C0XG 4H0LC 1HUMA 4CJ1B 1XTCD 3GO5A 4XTCS 3NXWA 3TMEA 2K03A 3NHHA 4U68A 3PUZA 4PMBA 5CV6A 1TS2A 2OEOA 3A56A 2X6GA 2RDFA 3OW7A 5FO9B 3U9OA 1ESRA 3C3LA 3S16B 1ZKOA 2VB3X 4HMIA 4DAVA 3D4WA 2N88A 3VYRA 2I07B 1A2TA 1STGA 2LKVA 2A6HD 3CU7A 2PW7A 1UAPA 2M2LA 1EYDA 2JP1A 1EYAA 5A35A 5KYLA 2Q8TA 1EEID 1EZ8A 3EFXD 3MVVA 1SJHD 3S1NB 3J7AV 1H9JA 4KN7C 1OXUA 4LAAA 1I50B 4HMJA 2RDHA 1SYDA 1GHKA 4IUNA 3T13A 2K6AA 1CZWA 5C6AA 2MJ8A 5J39A 5ELEA 4RHRA 3E6ZX 1O7LA 3EROA 3DXJC 2ICIA 5C4XB 2F0WA 4ULLA 2ZXRA 4RCOA 5IGBA 2Y0SB 3PV0A 1QNUA 2AUKA 2ENBA 1TVXA 1I4HA 1IYUA 4OL7A 1LABA 1SXTA 3L7ZC 5IODA 1BF4A 2A6EC 3OIQA 5JOBA 4KV6A 5NUCA 4IUVA 4XQNA 5COYA 2IPKD 2NZ1D 2F0JA 4V0BA 1TY0A 4DAYA 1EWCA 5IGEA 4RCNA 1K8OA 3GV6A 1FNWA 3NPPA 2IW3A 2EYLA 2O4XA 1GUNA 1CHPD 2CQAA 5EPJA 2QKIC 5HURA 1WTRA 1SAPA 3S2DB 3HOVB 1SEBD 2L5TA 5T1IA 1I4RA 2EDGA 4BBRB 2EPBA 4DXFA 3C2PA 3SK4A 4X3TA 2NN6G 5FOBB 1H9KA 4DK0A 2CW0D 4Z9CB 1U4MA 4MN3A 1JR0D 2B39A 1PYWD 3BDCA 1SE2A 2EVBA 4ZUJA 5E4XA 5ISRA 5IGCA 1EY6A 3I90A 3P1HA 4RKLA 1EY8A 1KTKA 4A93B 3KLRA 4F8MA 5D3DA 4X3KA 2HUGA 4XQJA 3D8GA 3KBXA 4K8JA 2NB0A 5CR3A 5JEAJ 4TSSA 2XVSA 3ONAB 1ZYRC 2XNAC 4O1NA 3BDOA 2VNUD 2F0PA 1SYEA 4IQZA 5EBDA 4HR7B 3MXNA 3HG9A 3DWPA 3PIO3 1G91A 2Z4IA 4RWSC 2F0KA 2KVMA 1STEA 3J80E 3P75A 1ET6A 3BG3A 4DGZA 3S2HB 4R9WA 2NWGA 1EQVA 1IKLA 1STBA 2X6LA 2L12A 3PUXA 2PZUA 1M8AA 4OIKA 5IOCA 3NK9A 2AUJD 4K6LA 5JVH3 2B2TA 1AP0A 1I6HB 3J80L 1DD2A 5CV4A 2EY5A 4K2LA 3CQZB 3VR6A 1E2WA 4H7BA 3I91A 3OMCA 1OO9B 2CHBD 5CV5A 2EZVA 2AQ3B 4IFDH 2IL8A 3SE0A 3P7JA 2HDLA 3ERQA 4F87A 1MI2A 4RAUC 5KIXA 1TWHB 3AMUA 3T53B 1STYA 2NBFA 1LTSD 2RBMA 1STAA 4EQNA 1FNVA 3H3VC 1H9SB 2NVXB 4WFN3 1UNSA 1A3TA 1CQFA 5CBEE 2EY6A 2F0FA 4C56C 2ZXOA 2Z4HA 1ZEQX 4A3EB 1NUCA 1UEAB 4ZQ3A 4UAIA 4QCLA 1I4QA 5I6WA 1C4QA 3WOEA 5JPMC 2EOTA 3Q22A 3NBIA 3S1QB 2Q8IB 3I3CA 1FNUA 2F0TA 2EYMA 3D3RA 4RGOS 1LTID 1PTOD 3SK8A 1PTOH 4A3IB 5M5WB 1OXTA 2KEEA 1HPCA 5ELCA 1PFMA 2RVLA 2EXZA 1WTQA 2L1BA 2D2CC 3VA5A 4JBWA 1I6VC 2AQ1B 3H94A 3SVMA 1G2SA 5ELBA 3IKJA 5CBAE 4G7HC 4BS9A 2XRSD 1L0XB 3QOLA 2SOBA 2R61A 3TP8A 1V1OA 2DNEA 1LACA 5G3LD 3SEBA 4IUPA 2NVYB 2B2TC 4BY1B 3KLSX 4KMUC 4PV1C 2F03A 1ENCA 5K36G 4FO2A 5I2YA 1QG7A 1RDPD 3PO2B 4NP5A 3A55A 4IALA 4OO1I 2OF1A 1U4PA 2H1EA 2QILA 4E6IA 2MGSA 2AQ2B 3MHBA 1Y8OB 1HRJA 3M4YA 1TWCB 3G6JB 2A73B 1EY0A 4OO1G 4EVOA 3I4LA 4KJNA 5D3IB 4CKEA 1QWYA 4KKSA 3E0JA 1EIHA 1HA6A 1EY4A 3BYTB 1PFNA 2F0UA 3NQTA 1B50A 4HEDA 4KY7A 2B2YC 1RTNA 5G3LF 2JEBI 1ILQA 4PMCA 3RUZA 3TDQA 1WTVA 2B2YA 4B9WA 1ZXTA 4C2MB 4FP5D 4DK1A 3BYYB 4UDUC 1NR2A 4X3UA 1QJOA 2F0HA 4NDXA 3JAML 4TRDA 5K5PA 3SK5A 2A68C 4XDXA 3V05A 2PZTA 3CRKC 5J1ZA 3QB3A 5KNBA 1W6JA 5EPKA 2IX3A 4DNRB 1Y8NB 4FF3A 3ITPA 2LY7A 4C3IG 2K32A 3T56B 4ZLTF 3S1RB 2B2VC 2K04A 1RF2D 3OWEB 4KKUA 1B4OA 3G7LA 1TS3A 3Q0AA 5E4WC 4O42A 2EYFA 2FFKB 2EYPA 3A8KE 3LWUA 4R8IA 4NW2A 1DM0B 1GJXA 2B63B 5JEAH 4ID6A 2N55A 2DY8A 3DUZA 3SXHA 4G7ZC 4FVMA 4L8JA 2B8FA 1F77A 1WCMB 4IURA 4IUTA 3HOXB 2B2WA 2K5QA 5DNFA 3FPPA 2PO4A 2V4DA 3M85A 3NWTA 4PMWA 2K5WA 4DA2A 1PZJD 2Z8LA 1I4XA 1XWEA 1RKNA 1HCZA 3RMHA 4ZAIA 2CVRA 1CZGA 3VYTA 4IZ8A 1CI3M 1PZKD 2R92B 1X3PA 4ZKCB 2IT1A 1I3QB 3ND9A 2ICEC 1R4PB 1S5BD 1JQYD 1C48A 2J7ZA 1K83B 3VR3A 5T1GA 3GV3A 1NCVA 1JB3A 2EY2A 1EYCA 1GXDC 1G291 1F2LA 2L4NA 1HA5A 1SYFA 1B3AA 1QB5D 5EJWA 5JEAG 2ZXPA 3Q23A 4IFDJ 1BCPC 3SR1A 2K1BA 3HOYB 2WAQB 1EQTA 5IGGA 3RLFA 1F9QA 4N9PA 4IUUA 2BE5C 4K2KA 3GP7A 3Q6SA 4KI0A 4CBVA 1G8ZD 1IKMA 5ELDA 2F1MA 3QWNA 1R9TB 5FLXL 2HCCA 5BN4A 5KEEA 1B1ZA 1ET9A 4G57A 4RGNA 2K05A 4BY7B 3W2DA 5IT9E 4L63B 4ODGA 1FR3A 4RGTA 1AEXA 2D9UA 1MSGA 4BA1I 2RSOA 1ESFA 1G6ZA 1CHQD 5IGDA 2A6HC 4XYQA 5C5MA 4DFAA 1EU4A 4WJWA 3HP3A 1ML0D 1MBYA 3VA7A 1JCKB 1S4ZA 2WKDA 5FO8B 5IT9L 3GTOB 5C4JB 4OO1H 1A3VA 1PTOB 3TN2A 1WD1A 2B8GA 2LS01 4FNFA 2VXWA 3HOWB 2M9VA 1B2TA 2WIIB 5EBCA 4EGVA 3EA6A 3NWSA 1KAAA 1LT6D 2L9HA 2HDMA 3K5OA 2RQXA 2JE6I 4PNYA 3TZUA 1ZYRD 1O7ZA 3DHQA 3FDTA 1SNMA 2IX1A 2VUMB 4F88A 3O13A 1V1PA 3GTQB 1LTRD 4C3JB 1H9MA 1PRTB 1YNJD 1EFID 1PTOF 1KABA 3TP6A 1U4RA 3A8JE 3D31A 5M9OA 1WD0A 2XSCA 2NVQB 1M4VA 5CORA 2L0CA 1WVLA 4RH6A 1RTOA 1LTGD 4HTHA 4RHSA 1OXVA 4HN7A 2K33A 3C46A 1Y8PB 1EWHA 5I2XA 4A3BB 4C3JG 4A3DB 1J9OA 4B9XA 2BA0A 3HS0C 4DF7A 4QF4A 3DM1A 3PIP3 3PUWA 1PRTF 5IIFA 4QUCA 3MA2B 1SNQA 3PUVA 4ZYSA 1PFBA 1VDZA 3K58A 1JICA 3NBHA 2JA5B 1BBXC 1SNCA 4Y7NB 1PXUA 3FKIB 4C3IB 4M1UB 4RGMA 3KUPA 4XIGS 3QO2A 3S17B 1MD2D 3R2IA 3C1FA 1STNA 3FMCA 3NTIA 2EJGC 1V1PB 3QG1A 1HQRD 1Y1VB 3BS1A 4HSVA 4WRDA 3MC0B 1VCIA 1LV9A 3MEHA 1U4LA 3M7NA 4H44C 1JOQA 1PRTC 2E2IB 1GUGA 2FHTA 1DONA 3OMGA 3S1MB 5M5XB 1LT4D 2O5IC 5JJZA 2B2UA 3R8BA 3LWEA 4JK1C 3M3YB 3J81L 4IFDG 1ENAA 5JPNC 1TKWB 3N52A 5CYUA 1GHJA 1FYCA 1SYGA 3J7YW 2OT2A 1V43A 2F0LA 4ZUIA 4DXGA 2D5DA 2SEBD 2L11A 4J8QA 3MAQA 3DWAA 1L0YB 2MP1A 4BBSB 3J81E 4K5WA 1CTMA 2IWHA 2ZT9C 4P2CB 2PQEA 4FF1A 1K8MA 4TQUS 2PZWA 1QOHA 1I4GA 5LL6S 2K01A 1R4QB 1TWFB 4DNTB 1Z6HA 4K14A 2EYOA 2JEAI 1KDBA 2PYKA 4H13C 2KEDA 3NP8A 2A69D 1X3QA 3SHLA 3GTLB 4K5VA 1CT1D 3K5LA 3HZXA 4ABNA 5EKKA 3OPOA 3ND8A 5ELFA 3I4NB 4FF2A 2JA8B 1LLRD 3TP5A 2E2DC 4KY5A 4J1MA 1QNKA 1BCPB 1F2ZA 2JYOA 1LTBD 1DZ1A 4KK7A 4NKLA 1XYIA 3V2TA 2PCFB 2QF7A 1I4PA 2D62A 1HHVA 1V8QA 5EGTA 2E2JB 1TU2B 2J0TD 4IUQA 1TWGB 1KLGD 4B08A 3DEOA 1VMPA 1AZQA 4F7XA 2SDFA 4IFDI 1LTTD 3V96A 1VMCA 2F0DA 5IGFA 3SK6A 1SFOB 5BN3A 3K59A 4KD3A 2QCPX 3CHBD 1SNOA 3GTPB 1RJTA 1JWSD 2PMZB 1IW7C 4MIUA 3W3AA 4I7ZC 4HCEA 1KDCA 4S3SA 1IL8A 2SNMA 2TMPA 1TQOA 3PO3B 1GUSA 4BWGB 5BN5A 1CM9A 3PMFA 3HOZB 4CGYB 4CJ0B 2BDNA 3AB9A 1O78A 1T5XD 4AYBB 1SE3A 3WDNA 3ZYYX 3RD4A 2KOLA 4G4KA 1Y69U 2YYZA 1KDAA 5EKLA 3PUYA 1CA6A 1VF7A 4WORA 1VF5C 1LT5D 1GOZA 1F9RA 3QJYA 5EPLA 1S5ED 2F0MA 3H0GB 3GQBA 1CQVA 4A3MB 1TY2A 3EQLC 1HFGA 1TR5A 2OXPA 4CKCA 1NR4A 3I8ZA 4R8NA 3TBIB 3GTJB 2O2LD 3AU7A 3T16A 1JORA 1AFPA 1BO0A 3S9WA 4LK1C 1SMYD 1KNEA 2L55A 2WINB 3R3OA 1RCVD 1ICWA 5C4HA 1DCZA 1TWAB 2A6ED 5DAUA 5FO7B 4RFBA 1HFNA 5EKIA 3MFYA 2XN9C 2AWNA 1KLUD 4C3HB 5M3MB 2G9DA 1F9PA 1ONLA 5E1FA 1HTPA 2NUCA 3T51B 1Q3LA 1A6XA 3D6WA 3GD7A 3RZDB 5KNDA 2FJ2A 3QIAA 5CC4A 1EIGA 1LO5D 3L3OC 3FPUB 3KBGA 2E74C 1GUWA 2F0GA 5EQ0A 1PZID 5LL6X 2MPMA 2EJFC 3MXUA 4ZK9B 2NN6H 1YNJC 5C0XH 3TP7A 2WB1B 2WKCA 2JA6B 5AFWA 4OGQC 4A3KB 1HTLD 2E76C 3NTKA 3J7AF 1CK1A 5E3FA 2Q8RE 4OIJA 2ID0A 1BUVT 2PW5A 2XWBB 3JAME 5TSSA 3NUCA 5D65A 1SYCA 5I9PA 5C5LA 3I72A 3MZ5A 1FGBD 3M7GA 4KN4C 2FINB 2PPBC 3URYA 2QEJC 2EE1A 3IL8A 3HKZB 2X69A 1EOTA 5I4DA 2B2UC 1W6KA 1LTAD 5DEHA 1SNDA 2DN8A 4FXDA 4KKTA 4MHEA 1CA5A 2K7VA 2A68D 4XYOA 4FF4A 4DAPA 2F4IA 2E75C 3HOUB 1AZPA 3VR5A 2DNCA 5CV9A 1C8CA 1A2UA 2KCCA 2QDBA 1A3UA 2PNRC 1D1KA 1BCPD 4OHJA 1BR9A 2F3WA 1PMRA 3A7LA 5C44B 1YNNC 2KCNA 3K5MA 3VR2A 4EQPA 1KNAA 2AWOA 3OSOA 4A3GB 1DOLA 5KGUA 2RSNA 1D5MC 2RA4A 4HAEA 1H9SA 2F3VA 1SDFA 2EY1A 3NQIA 2FMMA 1Z47A 1JWUD 5HGTA 2A74C 5J22A 2WP8J 4J6HA 5FKAC 4G7OC 3HGBA 1IYVA 1PTOC 3TSSA 1Q8IA 4CHTB 5I6YA 2KUMA 3FEWX 2EJMA 4HCSA 1TS4A 2NTTA 4QUFA 5C4ZA 1TIID 1B53A 2HCIA 3CRLC 4LMQD 2XIWA 2MUYA 1G2TA 1EEFD 5M3FB 4FYDA 3CKIB 3I4MB 1U9RA 2M00A 1F2MA 2WACA 2BDOA 3FRPB 4QMGA 3MFGA 3FVQA 4DU9A 2TSSA 3S14B 4FXKC 3BZDB 4RA8A 5I9OA 3GTGB 2C9OA 1TS5A 2JA7B 1HXYD 2E2HB 2KECA 1QILA 2KJXA 1BCPF 4CKBA 1O7YA 5CGKA 1S5DD 1BDOA 3D4DA 2KA7A 2KHSA 1T5EA 4ILWA 3C1EA 1SBBB 5JAVA 4C1NK 3E5SA 2F0NA 1DJRD 1E0BA 3Q24A 5KRUA 4TKOB 3KF8A 4ZRZA 4XQQA 3M4OB 2EYHA 4KHVA 3K0YA 1Q1EA 4KTAA 2Z1CA 5D14A 1D5XC 5K36H 1AN8A 3H09A 1HQMC 3TZDA 2VB2X 1Q1BA 1H9RA 1JC7A 4XT3B 4RKBA 4C3HG 1B44D 1D5ZC 1Z7TA 3F2UA 1F9SA 4EQOA 2R3ZA 1SMYC 5C0XI 1EY9A 3NTHA 1IHZA 1SE4A 1O80A 2B2WC 2EYJA 4A3JB 3LNNA 2I46A 1HUNA 2BE5D 1SNPA 4K5XA 5C3XA 3HEJA 3OIPA 1WTWA 4BA2I 1XXGA 3X3MA 1B9NA 2F0IA 5JVG3 3IAYA 3P20A 2F0EA 5C0XJ 2JSOA 3UI2A 2XWJB 5KNCA 3GTKB 2CW0C 3X3NA 3N6RA 3IFDA 4IN3A 1GUTA 1RD9D 3T4AC 4DN4M 5A2QL 1STHA 1EY7A 3K7AB 2NN6I 3H91A 2H4OA 1LT3D 1IW7D 1SSOA 2F0OA 2LFNA 4KJOA 3DEPA 1FD7D 3U9SA 5F2DA 2IX0A 2WV6D 4CJ2C 4C1NI 3SDZA 3A8IE 4X3SA 5C3EB 5A2QE 1TT2A 3L9AX 3I73A 2BA1A 3EVQA 2G9HD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOD A;  1U9R A;  2M00 A;  5DAU A;  4DF7 A;  4QF4 A;  1F2M A;  5I6W A;  2WAC A;  2RKS A;  4KY7 A;  5C5M A;  2EYJ A;  5CV6 A;  4DFA A;  5IIF A;  2OEO A;  2F0D A;  2F0L A;  4QMG A;  4ZUI A;  4I65 A;  5IGF A;  3D6C A;  2F0K A;  3SK6 A;  4PMC A;  4DU9 A;  2RDF A;  5JOB A;  3RUZ A;  4KV6 A;  3U9O A;  1SNQ A;  4KD3 A;  3OWF A;  4B9W A;  1RKN A;  1SNP A;  5I9O A;  2F0T A;  1SNO A;  3P75 A;  2EYM A;  5J1Z A;  3LX0 A;  4HMI A;  1EZ6 A;  4IZ8 A;  5CV9 A;  1A3V A;  4K5X A;  5C3X A;  1A2U A;  3D4W A;  4K5W A;  3SK8 A;  5E1F A;  4YIJ A;  3HEJ A;  5NUC A;  4DGZ A;  4MIU A;  2HQE A;  1NSN S;  2QDB A;  2NUC A;  1A3U A;  1KDC A;  2F0H A;  1EQV A;  1STB A;  4NDX A;  4TRD A;  2F0J A;  2EXZ A;  1A2T A;  1SNC A;  1STG A;  2F3W A;  2LKV A;  4S3S A;  2SNM A;  5K5P A;  3SK5 A;  2PW7 A;  3VA5 A;  2PQE A;  4N9T A;  1TQO A;  1EYD A;  2PZU A;  3DMU A;  5CC4 A;  1KAA A;  5IOC A;  3PMF A;  5IGE A;  5CGK A;  3NK9 A;  3D4D A;  2F0I A;  1EYA A;  4EQP A;  2EYL A;  2F0G A;  2PZT A;  2PZW A;  2O4X A;  4PNY A;  2EY2 A;  1EYC A;  3DHQ A;  2F0E A;  1STN A;  2KHS A;  2F0S A;  2F0V A;  3C1F A;  3QB3 A;  3OSO A;  4NMZ A;  5HUR A;  5KYL A;  5CV4 A;  5C3W A;  1SNM A;  1EZ8 A;  2EY5 A;  5KGU A;  4K2L A;  4K6D A;  1SYF A;  3QOL A;  3C1E A;  2SOB A;  4KY6 A;  4H7B A;  3BDL A;  1JOO A;  4K14 A;  2EYO A;  3TP8 A;  3MVV A;  1SYB A;  3OMC A;  3TP7 A;  3SK4 A;  4WRD A;  3SR1 A;  2F3V A;  3ITP A;  5JAV A;  1KDB A;  3E5S A;  2F0N A;  5CV5 A;  5CV8 A;  2EY1 A;  1KDA A;  4LAA A;  2PYK A;  5EKL A;  3EJI A;  1JOK A;  4PMB A;  3MXP A;  4HMJ A;  5KRU A;  1ENC A;  4ZQ3 A;  3NP8 A;  4WOR A;  1II3 A;  5IGG A;  3MEH A;  1STH A;  3ERQ A;  4KD4 A;  5HGT A;  1EY7 A;  1SYD A;  2KQ3 A;  3SHL A;  4IUN A;  3T13 A;  4N9P A;  1JOQ A;  4K5V A;  2EYH A;  4KHV A;  5J22 A;  1KAB A;  3BDC A;  4K2K A;  2F0Q A;  3HZX A;  4J6H A;  4KTA A;  5EKK A;  5KIX A;  5C6A A;  4ZUJ A;  2SNS A;  5E3F A;  1EY5 A;  4ME5 A;  5ISR A;  3OMG A;  4NP5 A;  3TP6 A;  2F0M A;  1EY6 A;  2F0O A;  3H6M A;  5IGC A;  2EYF A;  5J39 A;  3P1H A;  4IAL A;  4KJO A;  5M9O A;  2OF1 A;  3TP5 A;  2PW5 A;  4RKL A;  2EYP A;  1TR5 A;  2OXP A;  4KY5 A;  5I6Y A;  1EY8 A;  3NUC A;  4J1M A;  4E6I A;  5KEE A;  1SYC A;  1F2Z A;  5I9P A;  3MHB A;  1STY A;  5F2D A;  5C5L A;  1F2Y A;  4G57 A;  2RBM A;  4R8N A;  3MZ5 A;  3QOJ A;  1STA A;  5CV7 A;  4F8M A;  4QB4 A;  4EQN A;  1EY0 A;  3ERO A;  3D8G A;  4ID6 A;  4K8J A;  4NKL A;  4EVO A;  3T16 A;  4KJN A;  5C4Z A;  2F0W A;  3V2T A;  4HTH A;  4RKB A;  1A3T A;  4ODG A;  5CR3 A;  5IGB A;  2EY6 A;  2F0F A;  3SXH A;  1JOR A;  1TT2 A;  3NXW A;  4K8I A;  3TME A;  1AEX A;  1ENA A;  4EQO A;  3S9W A;  1EY4 A;  5EGT A;  5KYI A;  3NHH A;  2ENB A;  3EVQ A;  1EY9 A;  3R3O A;  1NUC A;  4OL7 A;  2F0U A;  4B9X A;  2F0P A;  5DEH A;  1SYE A;  5C4H A;  5IGD A;  1SND A;  4F7X A;  1SYG A;  1IHZ A;  3NQT A; 
#chains in the Genus database with same CATH topology
 1XNR Q;  4V19 0;  1BBU A;  4LF5 L;  3NSW A;  4PG3 A;  3HRZ C;  4U67 3;  2RKS A;  3S1R H;  1QCB D;  2FMC A;  4HIO A;  2DY7 A;  4L6T B;  5C44 G;  3D6C A;  3OHX C;  4Q0F A;  2KCT A;  2VUM G;  2WFW A;  3QR8 A;  1PDQ A;  1Q90 A;  3LX0 A;  1EZ6 A;  3CW2 C;  4YIJ A;  5IYB H;  2HQE A;  1NSN S;  5DM7 3;  5FLM G;  1PLF A;  1HH2 P;  2K52 A;  3M3Y H;  2NTS A;  4N9T A;  3D0F A;  1GUO A;  3DMU A;  2R93 B;  1J8I A;  5FK9 C;  2GA4 B;  4XXE A;  5DM6 3;  1ILP A;  5ELN A;  1BOS A;  2BCO A;  4NMZ A;  3A7A B;  4IOC A;  4O0A A;  1NMF A;  2K5D A;  2I5L X;  1WI5 A;  4KY6 A;  4QIW B;  2Z9H A;  4PZ8 A;  5CMD A;  3BDL A;  1YNN D;  1W3S A;  3K81 C;  4C2M H;  3G6E A;  2FXQ A;  1SYB A;  1Q81 C;  3PSI A;  1QE6 A;  1D6E C;  5CV8 A;  1BXT A;  3K6O A;  4DV5 Q;  1VQC A;  4IPG A;  1P16 A;  1DYQ A;  3MXP A;  1EL0 A;  5LMN Q;  3VYU A;  1IBL Q;  1II3 A;  4KD4 A;  1IBM Q;  2O5J C;  5H1S E;  1A15 A;  1X32 A;  5FJ8 H;  5LMU Q;  1D2B A;  4OWT B;  1MSH A;  1K83 H;  4ZKB B;  2F0Q A;  2ZTE A;  1YHA A;  4PQX A;  1EY5 A;  4ME5 A;  1DOK A;  1VQ9 A;  2PI2 E;  3M4P A;  3R2T A;  1K3B C;  1X9N A;  2NYZ D;  1WTO A;  3OOC A;  3DWQ A;  3WOF A;  3VYS A;  4X65 Q;  1E2V A;  1UUP A;  1Y1W B;  4MTN A;  1S3O A;  3K57 A;  3QOJ A;  1AW7 A;  1S5C D;  2RHQ B;  3RZO B;  1LTL A;  3BVM A;  1DOM A;  3D4R A;  1YIJ A;  3S15 H;  2NVT B;  2G5D A;  4L5R C;  3I2Z A;  4K8I A;  2RDG A;  2R7Z B;  1OXX K;  4A3I H;  3S1M H;  1BNZ A;  5KYI A;  4KHP Q;  1ROD A;  2JK8 A;  1JWM D;  3OWF A;  3BVG A;  1BQQ T;  2UXB L;  1CFM A;  3J80 c;  4JI6 L;  1RHP A;  1QVG A;  1XNQ Q;  1RIP A;  3CC7 A;  4I65 A;  1Y1W G;  2R7Z H;  1NY4 A;  1WYD A;  2BOS A;  3BVZ A;  2E2I H;  1DXM A;  4DV4 L;  2LMC B;  1Q12 A;  5M5Y B;  1Y1V H;  1ENF A;  1AH9 A;  3J81 i;  2IJ0 A;  4Q5V A;  3S15 B;  3U4Z A;  2J4X A;  3IFT A;  4A3E H;  2JXM B;  2A69 C;  3I4M H;  2Q2H A;  3EBE A;  1UE7 A;  5FLX E;  4A3D G;  4DV6 Q;  1WTX A;  1SJE D;  4FXG C;  2K28 A;  4XT1 B;  1B9M A;  1U5K A;  2A5H A;  2OQ0 A;  2XRQ D;  4YY3 Q;  3T1H L;  1PYS B;  3PCO B;  1K3R A;  1VQ5 A;  5M3M G;  3KF8 B;  4GN5 A;  4M8A A;  2JA5 H;  3A54 A;  3I70 A;  2F0S A;  2F0V A;  4DV7 Q;  1S5F D;  5C3W A;  4EX5 A;  3MXG A;  1D1I A;  4K6D A;  2VL6 A;  1YI2 A;  1JOO A;  1WTP A;  4GKK Q;  3R93 A;  3NE5 B;  1NTG A;  2R6G A;  4KHZ A;  3EJI A;  1JOK A;  3KK7 A;  2IHE A;  1NAP A;  2PI2 A;  1JE4 A;  2C5C A;  1E2Z A;  1EU3 A;  4LJZ C;  1XNR L;  2KQ3 A;  2CFM A;  3K5N A;  4MZ9 A;  1Q46 A;  2A1A A;  2KBN A;  3KLS A;  2SNS A;  4LFB Q;  3H6M A;  1HJP A;  2B2V A;  1PRT D;  1XX8 A;  2YU9 B;  1MGS A;  2WB1 G;  1UE1 A;  4HSP A;  5LHY 1;  2F3I A;  4HID A;  1F2Y A;  4GZY C;  3MWY W;  1Y1V G;  5CV7 A;  1OXS C;  4A3F B;  4QB4 A;  4LF4 L;  2MHV A;  3MTS A;  3VR4 A;  3GTM B;  5C0X G;  4H0L C;  1HUM A;  4CJ1 B;  4BBS G;  2HHH Q;  1N36 Q;  1XTC D;  2B3G A;  3GO5 A;  3JC6 6;  4IJL A;  3HOW H;  3S17 H;  5JJL A;  4XTC S;  3NXW A;  3BU2 A;  3TME A;  3CCU A;  2K03 A;  3NHH A;  4JI3 L;  4JI0 Q;  5C4J H;  3F2C A;  4LFA L;  4U68 A;  2K4K A;  3PUZ A;  4PMB A;  2NVQ H;  3TRE A;  2A8V A;  5CV6 A;  1TS2 A;  1QVC A;  2OEO A;  3CAM A;  3A56 A;  2X6G A;  2RDF A;  3OW7 A;  5FO9 B;  3U9O A;  1ESR A;  3C3L A;  2YTV A;  3S16 B;  1ZKO A;  3K80 C;  2UXD Q;  2VB3 X;  3GTM H;  1HZA A;  4HMI A;  4DAV A;  3VDY A;  5LMN L;  1O7I A;  3D4W A;  2N88 A;  1BBW A;  3VYR A;  2ASB A;  2I07 B;  1A2T A;  1STG A;  2LKV A;  2A6H D;  3CPF A;  3CU7 A;  1A8V A;  2PW7 A;  2VUM H;  1UAP A;  2M2L A;  1EYD A;  1Y14 B;  2JP1 A;  1VQL A;  1JMC A;  2YV5 A;  1I94 L;  1EYA A;  4PZ6 A;  4HIM A;  5A35 A;  2JA8 G;  5J3B A;  5KYL A;  3S2H H;  4BY1 H;  2Q8T A;  1EEI D;  1EZ8 A;  3EFX D;  1N34 Q;  1IL2 A;  1EQQ A;  3MVV A;  1SJH D;  4UHV A;  4GNX B;  3J7A V;  3S1N B;  1H9J A;  4KN7 C;  1OXU A;  4LAA A;  3F8T A;  1I50 B;  3KDF B;  4HMJ A;  2Y0S G;  4DR7 Q;  2RDH A;  4OXP A;  1SYD A;  1GHK A;  4IUN A;  3T13 A;  2K6A A;  1CZW A;  4X66 Q;  1YIT A;  4A3G G;  1B3Q A;  5C6A A;  2MJ8 A;  4DV5 L;  1XMQ Q;  5J39 A;  4WJ3 M;  1MHW C;  5ELE A;  2EXD A;  4JYA L;  1C0A A;  4RHR A;  3AFP A;  3E6Z X;  1O7L A;  4B3S L;  3ERO A;  3DXJ C;  2ICI A;  5C4X B;  2F0W A;  4ULL A;  4ME3 A;  3S1Q H;  2ZXR A;  4RCO A;  5IGB A;  1PH6 A;  1XPU A;  2Y0S B;  4OX9 L;  1BVS A;  4DV1 L;  1QZH A;  3PV0 A;  1QNU A;  2AUK A;  5IP9 H;  2ENB A;  1TVX A;  1I4H A;  1IYU A;  3RZD H;  4OL7 A;  1LAB A;  4LF6 L;  5HGQ A;  1SXT A;  3MXN B;  3HOZ G;  3L7Z C;  5IOD A;  1R9T H;  1V9P A;  3NEM A;  1G6P A;  1VQD A;  1SMX A;  2Z0S A;  4HJ9 A;  4JI7 Q;  1BF4 A;  2A6E C;  3OIQ A;  5JOB A;  4KV6 A;  3NEL A;  4DR5 Q;  5C4X H;  1KRS A;  1B8A A;  4JI6 Q;  3UE0 A;  4EQ5 A;  5NUC A;  3KYH C;  4IUV A;  5COY A;  4XQN A;  4OEL B;  4HJ7 A;  2IPK D;  2BH8 A;  1KIX A;  3HOY H;  2NZ1 D;  2BH2 A;  2F0J A;  4NXN Q;  4V0B A;  4WJ4 A;  1GVP A;  1TY0 A;  4DAY A;  2ZM6 Q;  1EWC A;  5IGE A;  1N32 Q;  4RCN A;  1I3Q H;  1K8O A;  3GV6 A;  1FNW A;  3NPP A;  2IW3 A;  2EYL A;  2O4X A;  1J5E Q;  1GUN A;  1CHP D;  2CQA A;  4A3M G;  5EPJ A;  2QKI C;  5HUR A;  2XGT A;  1WTR A;  1SAP A;  4NXM Q;  4X64 Q;  3HOV B;  3S2D B;  1SEB D;  4R4Q A;  2L5T A;  5T1I A;  1I4R A;  2EDG A;  4BBR B;  1X3E A;  2UUA Q;  2EPB A;  4DXF A;  3C2P A;  3SK4 A;  4X3T A;  2NN6 G;  1KRT A;  5FOB B;  2CWA A;  1KAW A;  1H9K A;  4DK0 A;  2CW0 D;  4Z9C B;  4DR3 L;  4B3T L;  1U4M A;  4MN3 A;  1JR0 D;  3ICE A;  2B39 A;  1AE3 A;  1XPR A;  1PYW D;  3BDC A;  1SE2 A;  2EVB A;  4ZUJ A;  5E4X A;  5ISR A;  1NJI C;  4A3B G;  5IGC A;  1EY6 A;  4JI8 L;  3I90 A;  3P1H A;  4RKL A;  1EY8 A;  1KXL A;  4HJ8 A;  4DAY B;  2Z6K C;  1KTK A;  1Q8K A;  4A93 B;  3KLR A;  4OON A;  4F8M A;  1U0L A;  4P73 A;  5D3D A;  1OTC A;  4X3K A;  2HUG A;  4AYB E;  4XQJ A;  3D8G A;  3KBX A;  4K8J A;  2NB0 A;  5CR3 A;  3GTG H;  5JEA J;  4UP9 A;  3DM3 A;  4A76 A;  4TSS A;  2XVS A;  3UDF A;  3ONA B;  1ZYR C;  1IBK L;  3PO3 H;  4A3L H;  2XNA C;  3I56 A;  4O1N A;  1PH4 A;  3BDO A;  1VQ8 A;  2VNU D;  2F0P A;  1SYE A;  4IQZ A;  1EYG A;  3T1Y L;  5EBD A;  4DR4 L;  1N36 L;  4HR7 B;  1YHQ A;  3H0G G;  3ZJY C;  4DV0 L;  3MXN A;  3HG9 A;  5BR8 L;  2HIX A;  3DWP A;  3PIO 3;  1G91 A;  2Z4I A;  4RWS C;  2F0K A;  2KVM A;  4AQY Q;  2HIV A;  1STE A;  1VQP A;  3J80 E;  3P75 A;  1ET6 A;  3BG3 A;  1VQN A;  4DGZ A;  3S2H B;  2R7F A;  3GTP H;  4N8X 1;  4R9W A;  2JA6 G;  4A75 A;  2NWG A;  5IWA Q;  1EQV A;  3IRB A;  1IKL A;  1STB A;  2X6L A;  3HOU H;  2L12 A;  3PUX A;  2PZU A;  1M8A A;  4OIK A;  5IOC A;  2K5N A;  3NK9 A;  5IP7 G;  2AUJ D;  4K6L A;  5JVH 3;  2B2T A;  2UXC L;  1AP0 A;  1I6H B;  3J80 L;  3L2P A;  5CV4 A;  1DD2 A;  2EY5 A;  2PNH A;  4K2L A;  3UE1 A;  1E1T A;  1UWV A;  3CQZ B;  1X6O A;  3VR6 A;  1E2W A;  4H7B A;  3I91 A;  3PO2 H;  4GKJ Q;  3OMC A;  1HNW L;  1OO9 B;  2CHB D;  1Z9F A;  5CV5 A;  2EZV A;  2AQ3 B;  4IFD H;  1X3G A;  2IL8 A;  4L5S A;  3SE0 A;  4PZ7 A;  3P7J A;  1S40 A;  4LF4 Q;  2CWP A;  2HDL A;  2VZA A;  2ZTD A;  3ERQ A;  4LF5 Q;  1FGU A;  4F87 A;  1MI2 A;  2UU9 Q;  4RAU C;  1IBM L;  5KIX A;  4YCU A;  1TWH B;  3CCV A;  3G48 A;  3BZC A;  3KF6 A;  3AMU A;  3K8A A;  3T53 B;  3E9H A;  4ALP A;  1STY A;  2NBF A;  1LTS D;  2RBM A;  4NB3 A;  1STA A;  4EQN A;  1FNV A;  1L1O C;  3H3V C;  1H9S B;  2NVX B;  4WFN 3;  4DR2 Q;  1UNS A;  3J7Z C;  1A3T A;  1CQF A;  5CBE E;  2EY6 A;  2F0F A;  4GKK L;  4C56 C;  2ZXO A;  2Z4H A;  1ZEQ X;  2HD3 A;  4A3E B;  1NUC A;  2UUB Q;  2OWO A;  1JJC B;  2K14 A;  1UEA B;  4ZQ3 A;  4JI5 L;  1YBY A;  4UAI A;  4QCL A;  1I4Q A;  5I6W A;  1C4Q A;  3WOE A;  5JPM C;  4GN3 B;  1L1O B;  2EOT A;  3Q22 A;  3NBI A;  4HJA A;  3S1Q B;  3EIV A;  2Q8I B;  3I3C A;  1FNU A;  2F0T A;  4QL5 A;  4X62 Q;  2EYM A;  3D3R A;  4GOP A;  2RF4 A;  3CP0 A;  3DLL A;  4RGO S;  1LTI D;  1PTO D;  3SK8 A;  3RN2 A;  1PTO H;  4A3I B;  5M5W B;  1OXT A;  2KEE A;  1HPC A;  5ELC A;  1PFM A;  4AIM A;  2RVL A;  2EXZ A;  1WTQ A;  1VQB A;  2L1B A;  2D2C C;  3VA5 A;  2EQS A;  4JBW A;  1I6V C;  3PO2 G;  4LF7 Q;  2K75 A;  3CF5 A;  5ELO A;  2AQ1 B;  3H94 A;  3ULP A;  3SVM A;  1TWA H;  1G2S A;  4B3R Q;  5ELB A;  3IKJ A;  3BJU A;  3TS2 A;  5M3F H;  5CBA E;  4G7H C;  4BS9 A;  2XRS D;  1L0X B;  3QOL A;  1UE6 A;  2SOB A;  3I4N G;  2R61 A;  3U58 A;  3TP8 A;  1V1O A;  2DNE A;  1LAC A;  5M5X H;  5G3L D;  3SEB A;  4IUP A;  2NVY B;  1Q7Y C;  2B2T C;  4LF8 L;  4JBJ A;  4BY1 B;  4R4O A;  3KLS X;  4KMU C;  4PV1 C;  2F03 A;  1ENC A;  5L37 A;  4B3S Q;  5K36 G;  4FO2 A;  5I2Y A;  1XTD A;  4JOI C;  1QG7 A;  1RDP D;  3PO2 B;  2R93 H;  1K8G A;  4NP5 A;  4JOI A;  3I4M G;  3A55 A;  4IAL A;  2PQA A;  4OO1 I;  2OF1 A;  3KJP A;  1U4P A;  2GN5 A;  2H1E A;  2QIL A;  3RNU A;  4E6I A;  2MGS A;  1VQ6 A;  2AQ2 B;  3GDE A;  3MHB A;  1Y8O B;  1HRJ A;  4DUY L;  3M4Y A;  1GD7 A;  1TWC B;  3G6J B;  2A73 B;  1EY0 A;  4OO1 G;  1QUQ A;  4EVO A;  4LF8 Q;  2C35 B;  3I4L A;  4KJN A;  1EUJ A;  5D3I B;  4CKE A;  1QWY A;  4KKS A;  3E0J A;  1EIH A;  3J80 i;  1HA6 A;  4LUZ A;  1EY4 A;  3BYT B;  2Z6B A;  1PFN A;  4K0K L;  4DV2 L;  1TWH H;  2F0U A;  1NE3 A;  3NQT A;  1C7Y A;  3J81 c;  1IYJ B;  1MKH A;  4IOA A;  1B50 A;  4HED A;  4KY7 A;  5C44 H;  2B2Y C;  1VQM A;  1RTN A;  5G3L F;  2JEB I;  3PO3 G;  1ILQ A;  2DUD A;  4PMC A;  3RUZ A;  4X62 L;  3TDQ A;  1WTV A;  2B2Y A;  4B9W A;  1ZXT A;  4C2M B;  1EIF A;  2OQK A;  4FP5 D;  4DK1 A;  2NZO A;  3BYY B;  2LXK A;  5BR8 Q;  3NBH B;  1KD1 C;  1I6H H;  4UDU C;  1EOV A;  4LUO A;  1NR2 A;  3I7F A;  4X3U A;  1QJO A;  2F0H A;  4BBR G;  2QEX A;  4NDX A;  3JAM L;  4TRD A;  5M3F G;  1IXR A;  1JT8 A;  5K5P A;  3SK5 A;  2A68 C;  4XDX A;  3K0X A;  3V05 A;  3KFU A;  4A3C H;  4DV4 Q;  1UEB A;  1Q86 C;  2PZT A;  1E3P A;  3CRK C;  1SLJ A;  1I94 Q;  5J1Z A;  1EFW A;  3QB3 A;  4LUV A;  3OTO L;  5KNB A;  1W6J A;  1EIY B;  3CC4 A;  5EPK A;  4YHH L;  2IX3 A;  4DNR B;  1KQS A;  1SR3 A;  1Y8N B;  2B63 G;  4NPS A;  3HKS A;  4JI5 Q;  3S24 A;  4DNI A;  4FF3 A;  2JN4 A;  3ITP A;  3JAM i;  1VQJ A;  2LY7 A;  3FKI G;  4C3I G;  2K32 A;  3T56 B;  4ZLT F;  4A93 G;  3S1R B;  2B2V C;  2K04 A;  1RF2 D;  5JJI A;  3OWE B;  4KKU A;  1B4O A;  3G7L A;  3AFQ A;  1TS3 A;  3Q0A A;  5E4W C;  4O42 A;  2EYF A;  2MFI A;  2FFK B;  2EYP A;  3A8K E;  1CKO A;  2CH4 W;  3LWU A;  4R8I A;  4C3J H;  2CQO A;  4NW2 A;  1DM0 B;  1VS0 A;  1XJV A;  1GJX A;  2B63 B;  5JEA H;  4ID6 A;  4OX9 Q;  2N55 A;  2DY8 A;  3DUZ A;  3SXH A;  4G7Z C;  4FVM A;  4P74 A;  4L8J A;  2B8F A;  1PA6 A;  3A74 A;  4DK3 C;  1F77 A;  1WCM B;  4IUR A;  4LF9 L;  4IUT A;  3HOX B;  2B2W A;  2K5Q A;  1SRO A;  5DNF A;  3FPP A;  2PO4 A;  1PH3 A;  4B3R L;  5IWA L;  2V4D A;  3M85 A;  3J81 j;  3NWT A;  1RL2 A;  4PMW A;  4A3J H;  2K5W A;  4P72 A;  4DA2 A;  4JI2 Q;  1FJG Q;  1ICF B;  1PZJ D;  4GS3 A;  1YEZ A;  1MJE A;  2Z8L A;  1I4X A;  1XWE A;  1RKN A;  1HCZ A;  3RMH A;  4ZAI A;  4JI7 L;  2CVR A;  1CZG A;  2HT1 A;  3VYT A;  4IZ8 A;  3RLN A;  1CI3 M;  1YZ6 A;  4BBS H;  1PZK D;  2CH4 A;  4NXN L;  2R92 B;  1V1Q A;  1X3P A;  4ZKC B;  2IT1 A;  2DJG C;  1X56 A;  3NEN A;  1DGS A;  1I3Q B;  1MJC A;  3ND9 A;  2ICE C;  2F4V Q;  1R4P B;  1S5B D;  1JQY D;  1C48 A;  2J7Z A;  1K83 B;  3VR3 A;  5T1G A;  1IBK Q;  3GV3 A;  4DR6 L;  2UXD L;  1PH7 A;  1NCV A;  1JB3 A;  2EY2 A;  1EYC A;  3PIO A;  1GXD C;  3CPW A;  1G29 1;  1F2L A;  2L4N A;  1HA5 A;  1SYF A;  1B3A A;  1QB5 D;  5EJW A;  4NXM L;  5JEA G;  2ZXP A;  3Q23 A;  4IFD J;  1BCP C;  3SR1 A;  4BY7 G;  2K1B A;  3HOY B;  2UUA L;  2WAQ B;  2A19 A;  4DPG A;  1EQT A;  5IGG A;  3H15 A;  3RLF A;  1NMG A;  1F9Q A;  3KF6 B;  4N9P A;  1XMO Q;  2KEN A;  4IUU A;  2BE5 C;  4K2K A;  3GP7 A;  3Q6S A;  4KI0 A;  2V1C C;  4CDF C;  1G8Z D;  4CBV A;  1IKM A;  5ELD A;  2QA4 A;  2F1M A;  3QWN A;  4YWL A;  1R9T B;  5FLX L;  2HCC A;  5BN4 A;  5KEE A;  2OCE A;  1B1Z A;  1ET9 A;  4G57 A;  4RGN A;  3HOX H;  4APV A;  3HOV H;  2K05 A;  4BY7 B;  2DGY A;  3STB D;  3W2D A;  5IT9 E;  4C3H H;  4L63 B;  4ODG A;  1VQH A;  2DJF C;  1FR3 A;  4RGT A;  4O2D A;  1AEX A;  2D9U A;  4YHH Q;  5LMN W;  1MSG A;  4BA1 I;  2RSO A;  4AH6 A;  1ESF A;  2B63 H;  4P71 A;  1G6Z A;  4DV0 Q;  1CHQ D;  3PF4 A;  3UDI A;  5IGD A;  2EIF A;  3PF5 A;  2R93 G;  3PGZ A;  2A6H C;  4XYQ A;  3AEV A;  2R7D A;  5C5M A;  2I5H A;  3CCL A;  4JI2 L;  1FJG L;  4DFA A;  1EU4 A;  1VQG A;  4WJW A;  3HP3 A;  1ML0 D;  1MBY A;  3VA7 A;  1JCK B;  1S4Z A;  2WKD A;  5FO8 B;  5IT9 L;  3GTO B;  5C4J B;  5FLX c;  3E9I A;  4OO1 H;  1A3V A;  4DR1 Q;  1PTO B;  5C3E G;  3TN2 A;  1WD1 A;  2B8G A;  2LS0 1;  4FNF A;  5EAY A;  2VXW A;  2MNA A;  1K0S A;  4TVA B;  5IYC H;  3HOW B;  2M9V A;  1B2T A;  4DKA C;  2WII B;  4J15 A;  4QJF A;  1VQI A;  5EBC A;  4EGV A;  5IP9 G;  5AJ3 L;  3TS0 A;  3EA6 A;  3NWS A;  2ALY B;  1KAA A;  1LT6 D;  2L9H A;  4I7A A;  2HDM A;  3K5O A;  2RQX A;  2JE6 I;  4PNY A;  4R4C A;  3TZU A;  1Q82 C;  4LFA Q;  1ZYR D;  1O7Z A;  3FHW A;  3DHQ A;  3FDT A;  2JJQ A;  1SNM A;  4JI4 L;  3M4Q A;  2IX1 A;  2VUM B;  4F88 A;  3O13 A;  1V1P A;  3GTQ B;  3S16 H;  1VQO A;  1LTR D;  1K9M C;  2I0Q A;  1K73 C;  4FDB A;  4C3J B;  1H9M A;  1PH8 A;  1PRT B;  1YNJ D;  1EFI D;  1PTO F;  2WB1 E;  1KAB A;  3HOV G;  3TP6 A;  1U4R A;  3A8J E;  3FKI H;  4C3I H;  5GAH C;  1J6Q A;  2RHS B;  3D31 A;  4IPC A;  5M9O A;  1WD0 A;  1YNX A;  1X55 A;  2XSC A;  2NVQ B;  1M4V A;  5COR A;  2L0C A;  1WVL A;  1PYB A;  4RH6 A;  1RTO A;  1LTG D;  4JPB W;  3KDF A;  4HTH A;  4RHS A;  1OXV A;  4HN7 A;  2K33 A;  3SGI A;  1KL9 A;  1Y8P B;  1EWH A;  3C46 A;  2K5V A;  5I2X A;  4A3B B;  4C3J G;  5IYD H;  5IE8 A;  4DV3 L;  4A3D B;  1J9O A;  4GNX C;  4B9X A;  1HZ9 A;  4DR5 L;  2BA0 A;  4DAM A;  3HS0 C;  3HKZ E;  4DF7 A;  4QF4 A;  3DM1 A;  3PIP 3;  4R4T A;  3PUW A;  1PRT F;  5IIF A;  4QUC A;  1N33 Q;  3MA2 B;  4LFC Q;  1SNQ A;  3W1B A;  1XMO L;  2Q2U A;  3PUV A;  2VY3 A;  4ZYS A;  1PFB A;  4YWM A;  5IYB G;  1VDZ A;  1XMQ L;  3K58 A;  3OTO Q;  1ASY A;  1JIC A;  3NBH A;  3CXC A;  1X54 A;  4GN4 B;  2JA5 B;  1BBX C;  1SNC A;  4Y7N B;  4A3L G;  4KHP L;  1PXU A;  3I4N H;  3FKI B;  4C3I B;  4M1U B;  4RGM A;  3AYH B;  3KUP A;  4XIG S;  3QO2 A;  3KLW A;  3S17 B;  1YJN A;  3GTL H;  3G4S A;  1VQ4 A;  1CKM A;  1MD2 D;  3R2I A;  4GLX A;  3C1F A;  1EWI A;  1STN A;  3FMC A;  3NTI A;  2K50 A;  5GAG C;  4DR2 L;  4QQB X;  2EJG C;  1V1P B;  3QG1 A;  1HQR D;  1Y1V B;  3I55 A;  3BS1 A;  4HSV A;  4WRD A;  1KHI A;  1M90 C;  3MC0 B;  1HZC A;  2ATW A;  1VCI A;  1LV9 A;  3MEH A;  1U4L A;  3E0E A;  3M7N A;  4H44 C;  1JOQ A;  1PRT C;  2E2I B;  1GUG A;  4JI1 Q;  2FHT A;  3JAM c;  1K28 A;  1DON A;  2HQL A;  3OMG A;  3H3V H;  3S1M B;  2OTJ A;  1WCM G;  4X65 L;  2UUC Q;  5M5X B;  1I5F A;  1LT4 D;  2O5I C;  5JJZ A;  2B2U A;  2XTI A;  4CDC C;  3R8B A;  3CC2 A;  4HJ5 A;  3LWE A;  4JK1 C;  2AHO B;  3S14 H;  1NBW A;  5DLQ E;  3M3Y B;  3J81 L;  2N8N A;  4IFD G;  1ENA A;  3A0J A;  5JPN C;  1TKW B;  3N52 A;  5CYU A;  3UDG A;  2CKZ B;  1GHJ A;  3H3V I;  1E1O A;  3A5U A;  1FYC A;  1SYG A;  3J7Y W;  5M5W H;  4POF A;  1UE5 A;  2OT2 A;  1V43 A;  1FL0 A;  1MIU A;  2F0L A;  4ZUI A;  1PH9 A;  1D7Q A;  4DXG A;  2D5D A;  4IPD A;  2SEB D;  3HKZ G;  4A3F G;  1NNX A;  1QZG A;  2L11 A;  3W1G A;  4J8Q A;  3MAQ A;  3DWA A;  1L0Y B;  2AMC B;  2MP1 A;  4BBS B;  3J81 E;  4K5W A;  3GTJ H;  1GM5 A;  4JI8 Q;  4BXX H;  1CTM A;  1LYL A;  2IWH A;  2ZT9 C;  4P2C B;  4DUZ Q;  1G51 A;  1YJW A;  2PQE A;  4FF1 A;  1K8M A;  3U50 C;  4TQU S;  1K0R A;  2PZW A;  1QOH A;  1I4G A;  5LL6 S;  2K01 A;  4R1J A;  1R4Q B;  4A3D H;  1TWF B;  4DNT B;  1GKH A;  1JJ2 A;  1WOC A;  1Z6H A;  2OTL A;  4K14 A;  2EYO A;  3T1Y Q;  2JEA I;  5M3M H;  4LWC A;  3OYY A;  1KDB A;  2ZJR A;  4MNO A;  2PYK A;  3FP9 A;  4H13 C;  1CSQ A;  2KED A;  3MEF A;  4UPA A;  3CCR A;  3NP8 A;  2A69 D;  3CCS A;  4DUZ L;  1X3Q A;  3SHL A;  3GTL B;  4K5V A;  2VW9 A;  1CT1 D;  3K5L A;  3HZX A;  4ABN A;  5EKK A;  4LF6 Q;  3OPO A;  3ND8 A;  5ELF A;  3GTK H;  3HOZ H;  3I4N B;  4FF2 A;  2JA8 B;  1LLR D;  3TP5 A;  4B3M Q;  1WFQ A;  2E2D C;  3U4V A;  4KY5 A;  4J1M A;  1QNK A;  1BCP B;  4JVZ A;  1F2Z A;  2JYO A;  4BY1 G;  1N34 L;  4DR6 Q;  2QGQ A;  3ERS X;  1LTB D;  2E5L L;  1DZ1 A;  4GLV B;  4KK7 A;  4NKL A;  1XYI A;  1TXY A;  3V2T A;  2PCF B;  2QF7 A;  1HNW Q;  3ULJ A;  1I4P A;  4GNX A;  2D62 A;  1HHV A;  1V8Q A;  4R4I A;  5EGT A;  2E2J B;  1TU2 B;  2J0T D;  4IUQ A;  1TWG B;  4OEM B;  1D8L A;  1KLG D;  4B08 A;  1W2B A;  2VQE L;  3DEO A;  5GAE C;  1VMP A;  1AZQ A;  4F7X A;  2SDF A;  4IFD I;  1LTT D;  1VQF A;  3V96 A;  3HOW G;  1VMC A;  3K7U C;  4DV3 Q;  2F0D A;  5IGF A;  3SK6 A;  1SFO B;  2VS1 A;  5BN3 A;  3K59 A;  4KD3 A;  2QCP X;  3CHB D;  1SNO A;  3GTP B;  1RJT A;  1JWS D;  4K0K Q;  2PMZ B;  1IW7 C;  4JI4 Q;  4MIU A;  3W3A A;  4I7Z C;  4HCE A;  1KDC A;  3F1Z A;  4S3S A;  1IL8 A;  2SNM A;  2TMP A;  1TQO A;  3PO3 B;  1GUS A;  4BWG B;  5BN5 A;  1CM9 A;  3PMF A;  4CGY B;  3HOZ B;  4CJ0 B;  3CCQ A;  2BDN A;  3AB9 A;  1O78 A;  1T5X D;  4AYB B;  1SE3 A;  2JA7 G;  3WDN A;  3ZYY X;  2UXC Q;  1EQR A;  3RD4 A;  2KHI A;  2IY5 B;  2KOL A;  2QW7 A;  4G4K A;  3GTQ H;  4X6A H;  1Y69 U;  1YJ9 A;  2YYZ A;  1KDA A;  4BY7 H;  5EKL A;  1LUZ A;  3PUY A;  4DR7 L;  2LXJ A;  1CA6 A;  1QVF A;  1TWF H;  1VF7 A;  1QUQ B;  4WOR A;  4A3F H;  1VF5 C;  1LT5 D;  4N8F A;  1GOZ A;  1F9R A;  3QJY A;  1HNZ L;  5EPL A;  1A62 A;  1S5E D;  1PFS A;  2F0M A;  3H0G B;  3GQB A;  1CQV A;  4A3M B;  5AJ3 Q;  1TY2 A;  3EQL C;  1HFG A;  2ZJP A;  1TR5 A;  2OXP A;  4CKC A;  1NR4 A;  3I8Z A;  5FLM H;  4A4I A;  2Q2I A;  4BBR H;  1BKB A;  3AQQ A;  2MQH A;  4LW1 A;  4R8N A;  3TBI B;  3RR5 A;  3GTJ B;  2O2L D;  3AU7 A;  1XNQ L;  3T16 A;  1SE8 A;  1HZB A;  3CCE A;  1JOR A;  2NVY H;  1IZ6 A;  1AFP A;  1AE2 A;  1BO0 A;  2F4V L;  1E7Z A;  3S9W A;  3KJO A;  4LK1 C;  1SMY D;  1KNE A;  2L55 A;  3S2D H;  2WIN B;  3R3O A;  1RCV D;  1ICW A;  5JJK A;  5C4H A;  1DCZ A;  1TWA B;  2A6E D;  3PIP A;  5DAU A;  2JA5 G;  5FO7 B;  1L2F A;  3F2D A;  4RFB A;  1HFN A;  5EKI A;  3MFY A;  2XN9 C;  2AWN A;  1KLU D;  4C3H B;  5M3M B;  3UDX A;  5FJ8 G;  2G9D A;  1F9P A;  1ONL A;  1TWC H;  5E1F A;  3WWV A;  1HTP A;  2NUC A;  3T51 B;  1Q3L A;  4YCW A;  1A6X A;  5M5Y H;  3D6W A;  3GD7 A;  3RZD B;  5KND A;  2FJ2 A;  3QIA A;  5CC4 A;  1A0I A;  1EIG A;  2ZTC A;  1LO5 D;  2JA9 A;  3L3O C;  3FPU B;  3KBG A;  2E74 C;  4L5Q A;  1GUW A;  2F0G A;  5EQ0 A;  1PZI D;  5LL6 X;  2MPM A;  2EJF C;  3MXU A;  2L15 A;  2E5L Q;  2R92 G;  4ZK9 B;  4LFB L;  1JJG A;  3Q8D A;  2NN6 H;  1YHB A;  1YNJ C;  1E22 A;  5C0X H;  3TP7 A;  2UUC L;  1N33 L;  2WB1 B;  2WKC A;  1IBL L;  2JA6 B;  4GLA C;  5AFW A;  1HNX Q;  4OGQ C;  4A3K B;  4IPH A;  1HTL D;  4LNQ A;  2E76 C;  3M4O H;  1Y1W H;  3NTK A;  2HHH L;  3J7A F;  1CK1 A;  5E3F A;  1I50 H;  2Q8R E;  4OIJ A;  3W5O A;  2ID0 A;  1BUV T;  2PW5 A;  4HIK A;  2XWB B;  3JAM E;  5TSS A;  3NUC A;  3CCJ A;  5D65 A;  1SYC A;  5I9P A;  5C5L A;  5IYD G;  3I72 A;  3MZ5 A;  4IO9 A;  3HOU G;  1FGB D;  3M7G A;  4LF9 Q;  4KN4 C;  2FIN B;  4DUY Q;  3HFZ B;  2PPB C;  4DV7 L;  3URY A;  5HY6 A;  3S1N H;  2QEJ C;  2EE1 A;  5IP7 H;  4JYA Q;  3IL8 A;  4A3I G;  3HKZ B;  3L0O A;  3J7A 5;  2X69 A;  2N49 A;  1EOT A;  2ZM6 L;  5I4D A;  2Z6K A;  2B2U C;  3F2B A;  1JB7 A;  2VQF Q;  1W6K A;  1LTA D;  1WJJ A;  5DEH A;  1SND A;  2DN8 A;  4FXD A;  4KKT A;  2E2H H;  2H5X A;  4MHE A;  1YVC A;  4DV1 Q;  2I5M X;  5GAD C;  1CA5 A;  2K7V A;  2A68 D;  4XYO A;  1H95 A;  4FF4 A;  4DAP A;  2F4I A;  2E75 C;  2MO0 A;  3HOU B;  2ES2 A;  1AZP A;  1VQA A;  5GQO A;  3VR5 A;  3A5Z B;  2DNC A;  2RCF A;  4BXX G;  1A63 A;  5CV9 A;  1C8C A;  3CD6 A;  1A2U A;  2KCC A;  2QDB A;  4GOP C;  4DV6 L;  1A3U A;  2PNR C;  1D1K A;  1BCP D;  4JW0 A;  4OHJ A;  1PVO A;  1VQE A;  1BR9 A;  2F3W A;  2QDL A;  1PMR A;  2UUB L;  3A7L A;  5C44 B;  4A3G H;  3CMA A;  4JBK A;  1YNN C;  2PQA B;  4OWX B;  2KCN A;  3K5M A;  3VR2 A;  4EQP A;  1KNA A;  2CCZ A;  1X65 A;  2AWO A;  2KHJ A;  3CCM A;  3OSO A;  2YTX A;  4A3G B;  1DOL A;  5KGU A;  4L5T A;  2RSN A;  1D5M C;  4JG2 A;  4CDE C;  2RA4 A;  4HAE A;  1CUK A;  2YU9 H;  1H9S A;  1J5E L;  2F3V A;  1P8L A;  5C3E H;  1SDF A;  2EY1 A;  2WAQ E;  3NQI A;  2FMM A;  1C9O A;  2N3S A;  1Z47 A;  1JWU D;  2UXB Q;  5HGT A;  4MTK A;  2UU9 L;  2A74 C;  5C4X G;  2D0O A;  5J22 A;  2WP8 J;  4J6H A;  4YCV A;  5FKA C;  4G7O C;  3HGB A;  2GVA A;  1XPO A;  1IYV A;  1SRU A;  1PTO C;  3TSS A;  1Q8I A;  4A3B H;  1N9W A;  4CHT B;  5I6Y A;  2KUM A;  5IYC G;  3K7A H;  2AKW B;  4RG1 A;  3FEW X;  2EJM A;  4HCS A;  1TS4 A;  4A3C G;  2NTT A;  4QUF A;  1K8A C;  5C4Z A;  1TII D;  1B53 A;  2HCI A;  3CRL C;  2NVT H;  4LMQ D;  2XIW A;  3CME A;  2MUY A;  1VQK A;  1G2T A;  3RZO H;  1EEF D;  5M3F B;  4FYD A;  4H02 A;  3CKI B;  1B7Y B;  3ER0 A;  3I4M B;  2E8G A;  1U9R A;  2M00 A;  4OWW B;  1F2M A;  3TRZ A;  2D0P A;  2WAC A;  4UY8 C;  2BDO A;  3FRP B;  4QMG A;  3MFG A;  3FVQ A;  4DU9 A;  2TSS A;  3S14 B;  4FXK C;  3BZD B;  4RA8 A;  5I9O A;  2R7Z G;  3GTG B;  2C9O A;  1TS5 A;  1HR0 W;  4AYB G;  2JA7 B;  1N8R C;  1HXY D;  4X64 L;  2E2H B;  2KEC A;  4A93 H;  4CDD C;  4JI1 L;  5IY0 A;  1QIL A;  4GOP B;  2KJX A;  3ULL A;  2P5Z X;  4LF7 L;  1BCP F;  1T9H A;  4CKB A;  1O7Y A;  5CGK A;  1S5D D;  1BDO A;  3D4D A;  3EN2 A;  2KA7 A;  1PH1 A;  1B70 B;  2K5H A;  2PMZ E;  3PQI A;  1PH2 A;  4JV5 Q;  4JBM A;  1WTH A;  2LSS A;  2KHS A;  1T5E A;  2VQF L;  4ILW A;  3C1E A;  3GTO H;  4UP8 A;  1SBB B;  1X3F A;  5JAV A;  4C1N K;  3E5S A;  2F0N A;  2NVX H;  1DJR D;  1E0B A;  3Q24 A;  5KRU A;  4DK6 C;  4TKO B;  3KF8 A;  2Q2T A;  4ZRZ A;  3STB C;  4XQQ A;  3M4O B;  4YWK A;  2EYH A;  4KHV A;  3K0Y A;  2ZJQ A;  4RMF A;  1Q1E A;  2GVB A;  4KTA A;  4B3M L;  4A3K H;  2Z1C A;  3E3X A;  4DR1 L;  4UP7 A;  2JA6 H;  3TEH B;  5D14 A;  3M9B A;  4Y7N H;  1D5X C;  5K36 H;  1AN8 A;  4A3J G;  3H09 A;  1HQM C;  4DR4 Q;  5IT9 c;  4JC0 A;  3TZD A;  3G71 A;  2VB2 X;  1Q1B A;  1H9R A;  4QGU A;  1GO3 E;  1PV4 A;  2YTY A;  2F52 A;  1JC7 A;  4XT3 B;  4RKB A;  4AQY L;  3KOJ A;  4C3H G;  1B44 D;  1D5Z C;  1Z7T A;  3F2U A;  1F9S A;  4EQO A;  4A3M H;  2R3Z A;  1SMY C;  5C0X I;  1EY9 A;  3NTH A;  3TQY A;  1LM0 A;  1E24 A;  1IHZ A;  1SE4 A;  1O80 A;  1HR0 L;  4Y52 H;  3B6Y A;  2VQE Q;  2B2W C;  1SFO H;  2EYJ A;  4A3J B;  1WCM H;  3LNN A;  1CSP A;  2I46 A;  1HUN A;  2BE5 D;  3I4O A;  1SN8 A;  2MO1 A;  1SNP A;  5LMU L;  4JI0 L;  4YY3 L;  4JI3 Q;  4K5X A;  5C3X A;  1TWG H;  3HOY G;  3HEJ A;  2E2J H;  2JQO A;  3OIP A;  2JA7 H;  1PHJ A;  1WTW A;  4BA2 I;  2N78 A;  2NZH A;  4GKJ L;  1XXG A;  3HOX G;  1N32 L;  3X3M A;  4KLK A;  1B9N A;  1HNX L;  1FVI A;  4A3K G;  2F0I A;  1M1K C;  5JVG 3;  3RN5 A;  4ZCK A;  3IAY A;  3P20 A;  2Y0S E;  2F0E A;  2R92 H;  1S72 A;  5C0X J;  2JSO A;  2KCM A;  2JA8 H;  3UI2 A;  2XWJ B;  5KNC A;  1ASZ A;  3GTK B;  4IJH A;  4QY7 A;  1L0W A;  2CW0 C;  3X3N A;  2B29 A;  3N6R A;  3IFD A;  3CQZ H;  4IN3 A;  4B3T Q;  1GUT A;  3H0G H;  4DV2 Q;  1RD9 D;  3T4A C;  4DN4 M;  2RCN A;  5A2Q L;  1STH A;  1HNZ Q;  1EY7 A;  3K7A B;  2NN6 I;  4LFC L;  3H91 A;  2H4O A;  4DR3 Q;  1VQ7 A;  1LT3 D;  1IW7 D;  1SSO A;  3OW2 A;  4P75 A;  2F0O A;  2LFN A;  3RLO A;  4KJO A;  4A3E G;  4QIW E;  3DEP A;  1FD7 D;  3U9S A;  4POG A;  3BZK A;  5F2D A;  5GRO A;  1JE5 A;  2IX0 A;  3T1H Q;  2WV6 D;  4CJ2 C;  4C1N I;  3SDZ A;  3A8I E;  2WAQ G;  4X3S A;  5C3E B;  5E7N A;  4X66 L;  5A2Q E;  1TT2 A;  3LGJ A;  3L9A X;  2IHF A;  3I73 A;  1PH5 A;  4JCV E;  2BA1 A;  3EVQ A;  1HR0 Q;  1CKN A;  1CKN B;  1L1O A;  2G9H D;  4JV5 L;  1KC8 C; 
#chains in the Genus database with same CATH homology
 4V19 0;  3NSW A;  3HRZ C;  4U67 3;  2RKS A;  1QCB D;  2FMC A;  2DY7 A;  4L6T B;  3D6C A;  3OHX C;  4Q0F A;  1PDQ A;  1Q90 A;  3LX0 A;  1EZ6 A;  4YIJ A;  2HQE A;  1NSN S;  5DM7 3;  1PLF A;  2NTS A;  4N9T A;  1GUO A;  3DMU A;  2R93 B;  1J8I A;  5FK9 C;  2GA4 B;  4XXE A;  5DM6 3;  1ILP A;  1BOS A;  2BCO A;  4NMZ A;  3A7A B;  2K5D A;  4KY6 A;  5CMD A;  4QIW B;  3BDL A;  1YNN D;  1SYB A;  1QE6 A;  1D6E C;  5CV8 A;  1BXT A;  3K6O A;  1DYQ A;  3MXP A;  1EL0 A;  3VYU A;  1II3 A;  4KD4 A;  2O5J C;  1A15 A;  1X32 A;  1D2B A;  1MSH A;  4ZKB B;  2F0Q A;  4PQX A;  1EY5 A;  4ME5 A;  1DOK A;  3R2T A;  2NYZ D;  1WTO A;  3OOC A;  3DWQ A;  3WOF A;  3VYS A;  1E2V A;  1UUP A;  1Y1W B;  3K57 A;  3QOJ A;  1AW7 A;  1S5C D;  3RZO B;  3BVM A;  1DOM A;  3D4R A;  2NVT B;  4K8I A;  2RDG A;  2R7Z B;  1OXX K;  1BNZ A;  5KYI A;  1ROD A;  1JWM D;  3OWF A;  3BVG A;  1BQQ T;  1CFM A;  1RHP A;  4I65 A;  2BOS A;  3BVZ A;  1DXM A;  2LMC B;  1Q12 A;  5M5Y B;  1ENF A;  3S15 B;  2IJ0 A;  4Q5V A;  2J4X A;  3IFT A;  2JXM B;  2A69 C;  5FLX E;  1WTX A;  1SJE D;  4FXG C;  2K28 A;  4XT1 B;  1B9M A;  2A5H A;  2XRQ D;  4M8A A;  3A54 A;  3I70 A;  2F0S A;  2F0V A;  1S5F D;  5C3W A;  3MXG A;  1D1I A;  4K6D A;  1JOO A;  1WTP A;  3R93 A;  3NE5 B;  2R6G A;  4KHZ A;  3EJI A;  1JOK A;  3KK7 A;  1NAP A;  1JE4 A;  2C5C A;  1E2Z A;  1EU3 A;  4LJZ C;  2KQ3 A;  3K5N A;  3KLS A;  2SNS A;  3H6M A;  2B2V A;  1PRT D;  1XX8 A;  2YU9 B;  1MGS A;  4HSP A;  5LHY 1;  1F2Y A;  4GZY C;  3MWY W;  5CV7 A;  1OXS C;  4A3F B;  4QB4 A;  2MHV A;  3MTS A;  3VR4 A;  3GTM B;  5C0X G;  4H0L C;  1HUM A;  4CJ1 B;  1XTC D;  3GO5 A;  4XTC S;  3NXW A;  3TME A;  2K03 A;  3NHH A;  4U68 A;  3PUZ A;  4PMB A;  5CV6 A;  1TS2 A;  2OEO A;  3A56 A;  2X6G A;  2RDF A;  3OW7 A;  5FO9 B;  3U9O A;  1ESR A;  3C3L A;  3S16 B;  1ZKO A;  2VB3 X;  4HMI A;  4DAV A;  3D4W A;  2N88 A;  3VYR A;  2I07 B;  1A2T A;  1STG A;  2LKV A;  2A6H D;  3CU7 A;  2PW7 A;  1UAP A;  2M2L A;  1EYD A;  2JP1 A;  1EYA A;  5A35 A;  5KYL A;  2Q8T A;  1EEI D;  1EZ8 A;  3EFX D;  3MVV A;  1SJH D;  3S1N B;  3J7A V;  1H9J A;  4KN7 C;  1OXU A;  4LAA A;  1I50 B;  4HMJ A;  2RDH A;  1SYD A;  1GHK A;  4IUN A;  3T13 A;  2K6A A;  1CZW A;  5C6A A;  2MJ8 A;  5J39 A;  5ELE A;  4RHR A;  3E6Z X;  1O7L A;  3ERO A;  3DXJ C;  2ICI A;  5C4X B;  2F0W A;  4ULL A;  2ZXR A;  4RCO A;  5IGB A;  2Y0S B;  3PV0 A;  1QNU A;  2AUK A;  2ENB A;  1TVX A;  1I4H A;  1IYU A;  4OL7 A;  1LAB A;  1SXT A;  3L7Z C;  5IOD A;  1BF4 A;  2A6E C;  3OIQ A;  5JOB A;  4KV6 A;  5NUC A;  4IUV A;  4XQN A;  5COY A;  2IPK D;  2NZ1 D;  2F0J A;  4V0B A;  1TY0 A;  4DAY A;  1EWC A;  5IGE A;  4RCN A;  1K8O A;  3GV6 A;  1FNW A;  3NPP A;  2IW3 A;  2EYL A;  2O4X A;  1GUN A;  1CHP D;  2CQA A;  5EPJ A;  2QKI C;  5HUR A;  1WTR A;  1SAP A;  3S2D B;  3HOV B;  1SEB D;  2L5T A;  5T1I A;  1I4R A;  2EDG A;  4BBR B;  2EPB A;  4DXF A;  3C2P A;  3SK4 A;  4X3T A;  2NN6 G;  5FOB B;  1H9K A;  4DK0 A;  2CW0 D;  4Z9C B;  1U4M A;  4MN3 A;  1JR0 D;  2B39 A;  1PYW D;  3BDC A;  1SE2 A;  2EVB A;  4ZUJ A;  5E4X A;  5ISR A;  5IGC A;  1EY6 A;  3I90 A;  3P1H A;  4RKL A;  1EY8 A;  1KTK A;  4A93 B;  3KLR A;  4F8M A;  5D3D A;  4X3K A;  2HUG A;  4XQJ A;  3D8G A;  3KBX A;  4K8J A;  2NB0 A;  5CR3 A;  5JEA J;  4TSS A;  2XVS A;  3ONA B;  1ZYR C;  2XNA C;  4O1N A;  3BDO A;  2VNU D;  2F0P A;  1SYE A;  4IQZ A;  5EBD A;  4HR7 B;  3MXN A;  3HG9 A;  3DWP A;  3PIO 3;  1G91 A;  2Z4I A;  4RWS C;  2F0K A;  2KVM A;  1STE A;  3J80 E;  3P75 A;  1ET6 A;  3BG3 A;  4DGZ A;  3S2H B;  4R9W A;  2NWG A;  1EQV A;  1IKL A;  1STB A;  2X6L A;  2L12 A;  3PUX A;  2PZU A;  1M8A A;  4OIK A;  5IOC A;  3NK9 A;  2AUJ D;  4K6L A;  5JVH 3;  2B2T A;  1AP0 A;  1I6H B;  3J80 L;  1DD2 A;  5CV4 A;  2EY5 A;  4K2L A;  3CQZ B;  3VR6 A;  1E2W A;  4H7B A;  3I91 A;  3OMC A;  1OO9 B;  2CHB D;  5CV5 A;  2EZV A;  2AQ3 B;  4IFD H;  2IL8 A;  3SE0 A;  3P7J A;  2HDL A;  3ERQ A;  4F87 A;  1MI2 A;  4RAU C;  5KIX A;  1TWH B;  3AMU A;  3T53 B;  1STY A;  2NBF A;  1LTS D;  2RBM A;  1STA A;  4EQN A;  1FNV A;  3H3V C;  1H9S B;  2NVX B;  4WFN 3;  1UNS A;  1A3T A;  1CQF A;  5CBE E;  2EY6 A;  2F0F A;  4C56 C;  2ZXO A;  2Z4H A;  1ZEQ X;  4A3E B;  1NUC A;  1UEA B;  4ZQ3 A;  4UAI A;  4QCL A;  1I4Q A;  5I6W A;  1C4Q A;  3WOE A;  5JPM C;  2EOT A;  3Q22 A;  3NBI A;  3S1Q B;  2Q8I B;  3I3C A;  1FNU A;  2F0T A;  2EYM A;  3D3R A;  4RGO S;  1LTI D;  1PTO D;  3SK8 A;  1PTO H;  4A3I B;  5M5W B;  1OXT A;  2KEE A;  1HPC A;  5ELC A;  1PFM A;  2RVL A;  2EXZ A;  1WTQ A;  2L1B A;  2D2C C;  3VA5 A;  4JBW A;  1I6V C;  2AQ1 B;  3H94 A;  3SVM A;  1G2S A;  5ELB A;  3IKJ A;  5CBA E;  4G7H C;  4BS9 A;  2XRS D;  1L0X B;  3QOL A;  2SOB A;  2R61 A;  3TP8 A;  1V1O A;  2DNE A;  1LAC A;  5G3L D;  3SEB A;  4IUP A;  2NVY B;  2B2T C;  4BY1 B;  3KLS X;  4KMU C;  4PV1 C;  2F03 A;  1ENC A;  5K36 G;  4FO2 A;  5I2Y A;  1QG7 A;  1RDP D;  3PO2 B;  4NP5 A;  3A55 A;  4IAL A;  4OO1 I;  2OF1 A;  1U4P A;  2H1E A;  2QIL A;  4E6I A;  2MGS A;  2AQ2 B;  3MHB A;  1Y8O B;  1HRJ A;  3M4Y A;  1TWC B;  3G6J B;  2A73 B;  1EY0 A;  4OO1 G;  4EVO A;  3I4L A;  4KJN A;  5D3I B;  4CKE A;  1QWY A;  4KKS A;  3E0J A;  1EIH A;  1HA6 A;  1EY4 A;  3BYT B;  1PFN A;  2F0U A;  3NQT A;  1B50 A;  4HED A;  4KY7 A;  2B2Y C;  1RTN A;  5G3L F;  2JEB I;  1ILQ A;  4PMC A;  3RUZ A;  3TDQ A;  1WTV A;  2B2Y A;  4B9W A;  1ZXT A;  4C2M B;  4FP5 D;  4DK1 A;  3BYY B;  4UDU C;  1NR2 A;  4X3U A;  1QJO A;  2F0H A;  4NDX A;  3JAM L;  4TRD A;  5K5P A;  3SK5 A;  2A68 C;  4XDX A;  3V05 A;  2PZT A;  3CRK C;  5J1Z A;  3QB3 A;  5KNB A;  1W6J A;  5EPK A;  2IX3 A;  4DNR B;  1Y8N B;  4FF3 A;  3ITP A;  2LY7 A;  4C3I G;  2K32 A;  3T56 B;  4ZLT F;  3S1R B;  2B2V C;  2K04 A;  1RF2 D;  3OWE B;  4KKU A;  1B4O A;  3G7L A;  1TS3 A;  3Q0A A;  5E4W C;  4O42 A;  2EYF A;  2FFK B;  2EYP A;  3A8K E;  3LWU A;  4R8I A;  4NW2 A;  1DM0 B;  1GJX A;  2B63 B;  5JEA H;  4ID6 A;  2N55 A;  2DY8 A;  3DUZ A;  3SXH A;  4G7Z C;  4FVM A;  4L8J A;  2B8F A;  1F77 A;  1WCM B;  4IUR A;  4IUT A;  3HOX B;  2B2W A;  2K5Q A;  5DNF A;  3FPP A;  2PO4 A;  2V4D A;  3M85 A;  3NWT A;  4PMW A;  2K5W A;  4DA2 A;  1PZJ D;  2Z8L A;  1I4X A;  1XWE A;  1RKN A;  1HCZ A;  3RMH A;  4ZAI A;  2CVR A;  1CZG A;  3VYT A;  4IZ8 A;  1CI3 M;  1PZK D;  2R92 B;  1X3P A;  4ZKC B;  2IT1 A;  1I3Q B;  3ND9 A;  2ICE C;  1R4P B;  1S5B D;  1JQY D;  1C48 A;  2J7Z A;  1K83 B;  3VR3 A;  5T1G A;  3GV3 A;  1NCV A;  1JB3 A;  2EY2 A;  1EYC A;  1GXD C;  1G29 1;  1F2L A;  2L4N A;  1HA5 A;  1SYF A;  1B3A A;  1QB5 D;  5EJW A;  5JEA G;  2ZXP A;  3Q23 A;  4IFD J;  1BCP C;  3SR1 A;  2K1B A;  3HOY B;  2WAQ B;  1EQT A;  5IGG A;  3RLF A;  1F9Q A;  4N9P A;  4IUU A;  2BE5 C;  4K2K A;  3GP7 A;  3Q6S A;  4KI0 A;  4CBV A;  1G8Z D;  1IKM A;  5ELD A;  2F1M A;  3QWN A;  1R9T B;  5FLX L;  2HCC A;  5BN4 A;  5KEE A;  1B1Z A;  1ET9 A;  4G57 A;  4RGN A;  2K05 A;  4BY7 B;  3W2D A;  5IT9 E;  4L63 B;  4ODG A;  1FR3 A;  4RGT A;  1AEX A;  2D9U A;  1MSG A;  4BA1 I;  2RSO A;  1ESF A;  1G6Z A;  1CHQ D;  5IGD A;  2A6H C;  4XYQ A;  5C5M A;  4DFA A;  1EU4 A;  4WJW A;  3HP3 A;  1ML0 D;  1MBY A;  3VA7 A;  1JCK B;  1S4Z A;  2WKD A;  5FO8 B;  5IT9 L;  3GTO B;  5C4J B;  4OO1 H;  1A3V A;  1PTO B;  3TN2 A;  1WD1 A;  2B8G A;  2LS0 1;  4FNF A;  2VXW A;  3HOW B;  2M9V A;  1B2T A;  2WII B;  5EBC A;  4EGV A;  3EA6 A;  3NWS A;  1KAA A;  1LT6 D;  2L9H A;  2HDM A;  3K5O A;  2RQX A;  2JE6 I;  4PNY A;  3TZU A;  1ZYR D;  1O7Z A;  3DHQ A;  3FDT A;  1SNM A;  2IX1 A;  2VUM B;  4F88 A;  3O13 A;  1V1P A;  3GTQ B;  1LTR D;  4C3J B;  1H9M A;  1PRT B;  1YNJ D;  1EFI D;  1PTO F;  1KAB A;  3TP6 A;  1U4R A;  3A8J E;  3D31 A;  5M9O A;  1WD0 A;  2XSC A;  2NVQ B;  1M4V A;  5COR A;  2L0C A;  1WVL A;  4RH6 A;  1RTO A;  1LTG D;  4HTH A;  4RHS A;  1OXV A;  4HN7 A;  2K33 A;  3C46 A;  1Y8P B;  1EWH A;  5I2X A;  4A3B B;  4C3J G;  4A3D B;  1J9O A;  4B9X A;  2BA0 A;  3HS0 C;  4DF7 A;  4QF4 A;  3DM1 A;  3PIP 3;  3PUW A;  1PRT F;  5IIF A;  4QUC A;  3MA2 B;  1SNQ A;  3PUV A;  4ZYS A;  1PFB A;  1VDZ A;  3K58 A;  1JIC A;  3NBH A;  2JA5 B;  1BBX C;  1SNC A;  4Y7N B;  1PXU A;  3FKI B;  4C3I B;  4M1U B;  4RGM A;  3KUP A;  4XIG S;  3QO2 A;  3S17 B;  1MD2 D;  3R2I A;  3C1F A;  1STN A;  3FMC A;  3NTI A;  2EJG C;  1V1P B;  3QG1 A;  1HQR D;  1Y1V B;  3BS1 A;  4HSV A;  4WRD A;  3MC0 B;  1VCI A;  1LV9 A;  3MEH A;  1U4L A;  3M7N A;  4H44 C;  1JOQ A;  1PRT C;  2E2I B;  1GUG A;  2FHT A;  1DON A;  3OMG A;  3S1M B;  5M5X B;  1LT4 D;  2O5I C;  5JJZ A;  2B2U A;  3R8B A;  3LWE A;  4JK1 C;  3M3Y B;  3J81 L;  4IFD G;  1ENA A;  5JPN C;  1TKW B;  3N52 A;  5CYU A;  1GHJ A;  1FYC A;  1SYG A;  3J7Y W;  2OT2 A;  1V43 A;  2F0L A;  4ZUI A;  4DXG A;  2D5D A;  2SEB D;  2L11 A;  4J8Q A;  3MAQ A;  3DWA A;  1L0Y B;  2MP1 A;  4BBS B;  3J81 E;  4K5W A;  1CTM A;  2IWH A;  2ZT9 C;  4P2C B;  2PQE A;  4FF1 A;  1K8M A;  4TQU S;  2PZW A;  1QOH A;  1I4G A;  5LL6 S;  2K01 A;  1R4Q B;  1TWF B;  4DNT B;  1Z6H A;  4K14 A;  2EYO A;  2JEA I;  1KDB A;  2PYK A;  4H13 C;  2KED A;  3NP8 A;  2A69 D;  1X3Q A;  3SHL A;  3GTL B;  4K5V A;  1CT1 D;  3K5L A;  3HZX A;  4ABN A;  5EKK A;  3OPO A;  3ND8 A;  5ELF A;  3I4N B;  4FF2 A;  2JA8 B;  1LLR D;  3TP5 A;  2E2D C;  4KY5 A;  4J1M A;  1QNK A;  1BCP B;  1F2Z A;  2JYO A;  1LTB D;  1DZ1 A;  4KK7 A;  4NKL A;  1XYI A;  3V2T A;  2PCF B;  2QF7 A;  1I4P A;  2D62 A;  1HHV A;  1V8Q A;  5EGT A;  2E2J B;  1TU2 B;  2J0T D;  4IUQ A;  1TWG B;  1KLG D;  4B08 A;  3DEO A;  1VMP A;  1AZQ A;  4F7X A;  2SDF A;  4IFD I;  1LTT D;  3V96 A;  1VMC A;  2F0D A;  5IGF A;  3SK6 A;  1SFO B;  5BN3 A;  3K59 A;  4KD3 A;  2QCP X;  3CHB D;  1SNO A;  3GTP B;  1RJT A;  1JWS D;  2PMZ B;  1IW7 C;  4MIU A;  3W3A A;  4I7Z C;  4HCE A;  1KDC A;  4S3S A;  1IL8 A;  2SNM A;  2TMP A;  1TQO A;  3PO3 B;  1GUS A;  4BWG B;  5BN5 A;  1CM9 A;  3PMF A;  3HOZ B;  4CGY B;  4CJ0 B;  2BDN A;  3AB9 A;  1O78 A;  1T5X D;  4AYB B;  1SE3 A;  3WDN A;  3ZYY X;  3RD4 A;  2KOL A;  4G4K A;  1Y69 U;  2YYZ A;  1KDA A;  5EKL A;  3PUY A;  1CA6 A;  1VF7 A;  4WOR A;  1VF5 C;  1LT5 D;  1GOZ A;  1F9R A;  3QJY A;  5EPL A;  1S5E D;  2F0M A;  3H0G B;  3GQB A;  1CQV A;  4A3M B;  1TY2 A;  3EQL C;  1HFG A;  1TR5 A;  2OXP A;  4CKC A;  1NR4 A;  3I8Z A;  4R8N A;  3TBI B;  3GTJ B;  2O2L D;  3AU7 A;  3T16 A;  1JOR A;  1AFP A;  1BO0 A;  3S9W A;  4LK1 C;  1SMY D;  1KNE A;  2L55 A;  2WIN B;  3R3O A;  1RCV D;  1ICW A;  5C4H A;  1DCZ A;  1TWA B;  2A6E D;  5DAU A;  5FO7 B;  4RFB A;  1HFN A;  5EKI A;  3MFY A;  2XN9 C;  2AWN A;  1KLU D;  4C3H B;  5M3M B;  2G9D A;  1F9P A;  1ONL A;  5E1F A;  1HTP A;  2NUC A;  3T51 B;  1Q3L A;  1A6X A;  3D6W A;  3GD7 A;  3RZD B;  5KND A;  2FJ2 A;  3QIA A;  5CC4 A;  1EIG A;  1LO5 D;  3L3O C;  3FPU B;  3KBG A;  2E74 C;  1GUW A;  2F0G A;  5EQ0 A;  1PZI D;  5LL6 X;  2MPM A;  2EJF C;  3MXU A;  4ZK9 B;  2NN6 H;  1YNJ C;  5C0X H;  3TP7 A;  2WB1 B;  2WKC A;  2JA6 B;  5AFW A;  4OGQ C;  4A3K B;  1HTL D;  2E76 C;  3NTK A;  3J7A F;  1CK1 A;  5E3F A;  2Q8R E;  4OIJ A;  2ID0 A;  1BUV T;  2PW5 A;  2XWB B;  3JAM E;  5TSS A;  3NUC A;  5D65 A;  1SYC A;  5I9P A;  5C5L A;  3I72 A;  3MZ5 A;  1FGB D;  3M7G A;  4KN4 C;  2FIN B;  2PPB C;  3URY A;  2QEJ C;  2EE1 A;  3IL8 A;  3HKZ B;  2X69 A;  1EOT A;  5I4D A;  2B2U C;  1W6K A;  1LTA D;  5DEH A;  1SND A;  2DN8 A;  4FXD A;  4KKT A;  4MHE A;  1CA5 A;  2K7V A;  2A68 D;  4XYO A;  4FF4 A;  4DAP A;  2F4I A;  2E75 C;  3HOU B;  1AZP A;  3VR5 A;  2DNC A;  5CV9 A;  1C8C A;  1A2U A;  2KCC A;  2QDB A;  1A3U A;  2PNR C;  1D1K A;  1BCP D;  4OHJ A;  1BR9 A;  2F3W A;  1PMR A;  3A7L A;  5C44 B;  1YNN C;  2KCN A;  3K5M A;  3VR2 A;  4EQP A;  1KNA A;  2AWO A;  3OSO A;  4A3G B;  1DOL A;  5KGU A;  2RSN A;  1D5M C;  2RA4 A;  4HAE A;  1H9S A;  2F3V A;  1SDF A;  2EY1 A;  3NQI A;  2FMM A;  1Z47 A;  1JWU D;  5HGT A;  2A74 C;  5J22 A;  2WP8 J;  4J6H A;  5FKA C;  4G7O C;  3HGB A;  1IYV A;  1PTO C;  3TSS A;  1Q8I A;  4CHT B;  5I6Y A;  2KUM A;  3FEW X;  2EJM A;  4HCS A;  1TS4 A;  2NTT A;  4QUF A;  5C4Z A;  1TII D;  1B53 A;  2HCI A;  3CRL C;  4LMQ D;  2XIW A;  2MUY A;  1G2T A;  1EEF D;  5M3F B;  4FYD A;  3CKI B;  3I4M B;  1U9R A;  2M00 A;  1F2M A;  2WAC A;  2BDO A;  3FRP B;  4QMG A;  3MFG A;  3FVQ A;  4DU9 A;  2TSS A;  3S14 B;  4FXK C;  3BZD B;  4RA8 A;  5I9O A;  3GTG B;  2C9O A;  1TS5 A;  2JA7 B;  1HXY D;  2E2H B;  2KEC A;  1QIL A;  2KJX A;  1BCP F;  4CKB A;  1O7Y A;  5CGK A;  1S5D D;  1BDO A;  3D4D A;  2KA7 A;  2KHS A;  1T5E A;  4ILW A;  3C1E A;  1SBB B;  5JAV A;  4C1N K;  3E5S A;  2F0N A;  1DJR D;  1E0B A;  3Q24 A;  5KRU A;  4TKO B;  3KF8 A;  4ZRZ A;  4XQQ A;  3M4O B;  2EYH A;  4KHV A;  3K0Y A;  1Q1E A;  4KTA A;  2Z1C A;  5D14 A;  1D5X C;  5K36 H;  1AN8 A;  3H09 A;  1HQM C;  3TZD A;  2VB2 X;  1Q1B A;  1H9R A;  1JC7 A;  4XT3 B;  4RKB A;  4C3H G;  1B44 D;  1D5Z C;  1Z7T A;  3F2U A;  1F9S A;  4EQO A;  2R3Z A;  1SMY C;  5C0X I;  1EY9 A;  3NTH A;  1IHZ A;  1SE4 A;  1O80 A;  2B2W C;  2EYJ A;  4A3J B;  3LNN A;  2I46 A;  1HUN A;  2BE5 D;  1SNP A;  4K5X A;  5C3X A;  3HEJ A;  3OIP A;  1WTW A;  4BA2 I;  1XXG A;  3X3M A;  1B9N A;  2F0I A;  5JVG 3;  3IAY A;  3P20 A;  2F0E A;  5C0X J;  2JSO A;  3UI2 A;  2XWJ B;  5KNC A;  3GTK B;  2CW0 C;  3X3N A;  3N6R A;  3IFD A;  4IN3 A;  1GUT A;  1RD9 D;  3T4A C;  4DN4 M;  5A2Q L;  1STH A;  1EY7 A;  3K7A B;  2NN6 I;  3H91 A;  2H4O A;  1LT3 D;  1IW7 D;  1SSO A;  2F0O A;  2LFN A;  4KJO A;  3DEP A;  1FD7 D;  3U9S A;  5F2D A;  2IX0 A;  2WV6 D;  4CJ2 C;  4C1N I;  3SDZ A;  3A8I E;  4X3S A;  5C3E B;  5A2Q E;  1TT2 A;  3L9A X;  3I73 A;  2BA1 A;  3EVQ A;  2G9H D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...