2DUDA

Crystal structure of human mitochondrial single-stranded dna-binding protein(hmtssb)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
112
structure length
95
Chain Sequence
RSLNRVHLLGRVGQDPVLRNPVTIFSLATNEMWVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-stranded DNA-binding protein
publication title Crystal structure of human mitochondrial single-stranded DNA-binding protein(hmtSSB)
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 14
structure length 95
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2dudA00
4LF6Q 4DV7L 5C44G 2YTVA 4IFDI 1CKMA 4BBSH 3FKIG 3ER0A 2Q2UA 2YTYA 4YY3Q 3LGJA 1Z9FA 3HOUG 3NENA 2YV5A 1K3RA 4BXXH 4B3RL 2BA1A 4JC0A 4DUZQ 2R92G 1IBLQ 1I5FA 5M5WH 3DM3A 2UU9Q 3S1RH 2HT1A 1OXSC 2F4VQ 4IOAA 1Q7YC 3M4OH 1UE1A 3ULPA 3OYYA 4A93G 5IY0A 2VUMG 5GAGC 4LFBL 3I4MG 1SE8A 5E7NA 3AYHB 3GDEA 1KRSA 2Y0SE 1MJEA 4HJ8A 4R4TA 3F2BA 1YI2A 1X3FA 1A8VA 2L15A 3CXCA 1U5KA 4IO9A 1EIFA 1SFOH 2JA5H 1WCMH 2B63H 4DR7Q 2ZTEA 3BU2A 1JJGA 1VQHA 2AKWB 3I7FA 4DV2Q 3T1YQ 1N36L 3GTOH 1JB7A 3MXNB 1XMQL 3HOYG 4A75A 2GVAA 1PH6A 5C4XH 1HNXQ 1KQSA 4DV5Q 4LF5Q 4YY3L 4GLVB 4JG2A 4A3EG 3I56A 4JI7Q 1O7IA 3STBC 1VQOA 3CCRA 3J81c 1HNZL 2Q2IA 3PUXA 5FLMH 3UDIA 4LF8L 5BR8L 1Y1VH 3PV0A 2ATWA 4AH6A 1YJNA 1HZBA 4K0KL 3PO2G 4DR1Q 4KI0A 2A8VA 2IHEA 3S2HH 4OWXB 1XPOA 5C0XI 1C0AA 2VNUD 5M3MG 3H3VH 1PH9A 1B8AA 1VQLA 3M85A 3A5UA 5IYBG 3UDGA 5M3FH 4C3HH 5C4JH 4X65L 4QQBX 3I55A 1R9TH 1PFSA 1QUQB 5JEAG 4X62Q 2EIFA 4HJ9A 3TS0A 3ICEA 1P16A 2BH8A 3A0JA 2E8GA 4DUYQ 2OQKA 1M1KC 4NXNQ 1N33L 4DV2L 3T1YL 5LMNQ 3S24A 3VDYA 1QVGA 2KCTA 5FJ8H 2VY3A 1I94L 4LFCQ 4R4QA 1RL2A 1WYDA 2WAQG 3E9HA 3CPWA 1HNXL 1A0IA 4GOPC 2IX1A 2R7ZG 1X56A 3RLFA 1NTGA 1V9PA 3JC66 4A3BH 4GLXA 4HIMA 3JAMc 3W1GA 1Q86C 1X55A 4GN3B 3KOJA 4GLAC 3UE1A 5IWAQ 3KJOA 1N34L 2AHOB 2NN6G 4LWCA 1PH8A 1VQ8A 4LF9Q 4JBMA 1XMOQ 1X3GA 4P75A 1Y1WG 3U50C 1YZ6A 4BBRH 3G71A 3A5ZB 1A63A 1VQ4A 3Q8DA 4R4IA 2QA4A 1VQ5A 4HJAA 2D0OA 3CW2C 5JEAJ 4AQYQ 4A3FG 1YEZA 3CCJA 4A3MG 1KRTA 4H02A 4JI0L 2XTIA 1YBYA 2LXJA 2JA6G 2JA7G 4DV7Q 1FJGL 1S72A 4GKJL 3RN5A 1SRUA 2C35B 5IYDH 1FL0A 4P73A 4NXNL 1WOCA 4YWKA 4GNXA 5JJKA 4RMFA 2A1AA 2CWPA 3CMAA 4HJ7A 5LMNL 1E1OA 1N8RC 4DV3Q 4B3MQ 2R92H 1B7YB 1PVOA 3CCLA 4B3RQ 4A3IH 2NZHA 1XNQL 4GOPA 1ASYA 1KD1C 1KAWA 4A3GH 3K0XA 3HOVG 4UPAA 3RZOH 1NJIC 2UXDL 4A3KG 3M7NA 1YJWA 3CF5A 4LNQA 1BKBA 2A19A 1OXUA 1N32L 3RLNA 1UWVA 2LSSA 1K9MC 5M5XH 3H3VI 1VQMA 2H5XA 1C9OA 4DR2Q 1EQRA 4QY7A 1XMOL 3F2CA 4JI4L 2YTXA 4IPDA 3HKSA 2I0QA 5IYCH 3T1HL 3ULLA 1P8LA 1HR0L 3AQQA 4GN5A 3CCQA 4DV6L 4X6AH 3K81C 4AQYL 2JA8H 2UUBL 4JOIC 2PQAB 3TRZA 1YIJA 5IP9G 3E0EA 5LMNW 3KF6B 1N36Q 5J3BA 1XMQQ 2K5VA 4JI3L 1KHIA 4DAYB 4A3JG 3M9BA 4J15A 1VQJA 4LW1A 2ZJPA 3HOWH 3K7UC 2JEAI 4HJ5A 2B29A 4P74A 3ZJYC 4QGUA 5ELNA 1VS0A 2JEBI 1Q46A 4DV3L 1LUZA 1YJ9A 4B3ML 4WJ3M 3BJUA 3EIVA 4UP9A 4DK3C 1GM5A 3K7AH 4ME3A 1HNZQ 4LF8Q 2Y0SG 2VW9A 5BR8Q 2QEXA 1X54A 4A3LG 3CCUA 3RN2A 1PYSB 1J6QA 4K0KQ 5C3EG 1M90C 4GNXB 4JI8L 1HR0W 1TWCH 4LUVA 1PV4A 1QVFA 5IYBH 4EQ5A 4APVA 4A3CH 4DR2L 4L5RC 4BA2I 4NB3A 5H1SE 2Q2TA 4AYBG 4WJ4A 2PMZE 2E5LQ 4DR6Q 4X65Q 1VQBA 2NVYH 2CKZB 2XGTA 4IFDJ 5AJ3L 2MFIA 3UDFA 1N33Q 1BBUA 1W3SA 3GTLH 4JI5L 3S1QH 1X65A 2R7FA 1OXTA 1X3EA 2VZAA 1VQDA 5M5YH 1TWFH 1PH1A 1I94Q 4BY1G 3OTOQ 1TWHH 5FLXc 2R7DA 2ZTCA 3E9IA 1T9HA 4QL5A 5LMUL 1GO3E 1VQPA 3CC4A 1PH3A 2F52A 4POGA 3G48A 2JQOA 1HZ9A 3HOZH 4JI1L 3J81j 2NVXH 2I5LX 3STBD 1I3QH 3RR5A 1HNWL 1N34Q 3M4QA 1L1OB 5IP7H 4POFA 2E2JH 4OX9L 3GO5A 4UY8C 5ELOA 1NMGA 2R93G 4R1JA 2K50A 3PUVA 1GVPA 1JJ2A 3KJPA 1EUJA 4PZ7A 1WJJA 2AWOA 2ZM6L 2OCEA 3K8AA 5C0XG 4LF4L 2N49A 3H0GG 1KC8C 1FGUA 3PO3G 1C7YA 3S1MH 1GD7A 3L7ZC 2VQEL 4LFAL 2V1CC 1YNXA 2N78A 4IPCA 3HKZG 1VQGA 4YHHL 3GTJH 4JI6Q 2E5LL 4JI0Q 3CP0A 4DR6L 4JBWA 1FJGQ 4GKJQ 1VQCA 4BBSG 2Z6KC 5JJLA 3EN2A 4OO1I 1L0WA 4BY7H 1OXVA 3OTOL 2ASBA 3UDXA 3KLWA 3TREA 4DR5Q 1XNQQ 3S1NH 2UXBL 3CMEA 4A3KH 1VQIA 2WB1G 1PYBA 2K5HA 2VL6A 3CCEA 1HH2P 1IBKL 1E7ZA 2GN5A 4JCVE 3D31A 2UUCL 2UXDQ 1D8LA 2E2HH 2OTLA 4X66Q 1OXXK 1XPUA 3BZKA 2ZJRA 1N32Q 2N3SA 5GADC 5C0XJ 1JMCA 1J5EL 4P72A 1SN8A 2HHHL 1VQNA 1SR3A 2K52A 4YCWA 4JI2Q 4UP8A 4KLKA 1DGSA 4JI4Q 1IL2A 4A3DG 2K75A 3T1HQ 1HR0Q 2UUAQ 4DV6Q 2MO0A 2Z0SA 3U58A 5K36G 2JA5G 1WCMG 2AMCB 4PG3A 1E24A 3CC7A 1K8AC 5DLQE 1UEBA 3RLOA 2UUBQ 1VQFA 1PHJA 1CKNA 4YWLA 1VCIA 3RNUA 1I6HH 4DV4L 4B3SL 5C44H 4JI6L 4QJFA 4JI3Q 1OTCA 2CQOA 3FKIH 2Z6KA 1TWAH 3KDFA 4OONA 5C4XG 4KHPL 3HOUH 5IT9c 2JJQA 1BBWA 3J81i 4YCUA 4C3IH 3G4SA 3F2DA 3CCMA 1G291 3I4NG 2I5HA 1XPRA 4NXMQ 4DR5L 1PH7A 2MNAA 5FLMG 3OW2A 4HIDA 1IYJB 1Y1VG 4JBKA 4A93H 2VUMH 1AE2A 3J80i 3S15H 4XTCS 3I4MH 1Q8KA 4X66L 2Q2HA 4DK6C 4JI8Q 3GTQH 4NPSA 4DPGA 2JA9A 4L5SA 4OWWB 2OQ0A 4JI2L 5M3FG 3PGZA 1K0RA 2UUAL 2K4KA 3WWVA 4HIOA 3PF4A 4EX5A 4A3CG 1D7QA 1XNRQ 1MJCA 5AJ3Q 1XJVA 3HOYH 4IJLA 1I50H 4JI5Q 3AFPA 5FJ8G 3I2ZA 3CD6A 4LF7Q 4IPHA 1CSQA 4A3EH 2MO1A 4LUOA 3F1ZA 5LMUQ 4A3BG 4IFDG 3KF8B 2MQHA 3I4OA 1HJPA 2KENA 1VQKA 3K80C 2FXQA 3L0OA 4JI1Q 4DV0L 1CKOA 4NXML 2I5MX 1FVIA 1HNWQ 1SLJA 1NBWA 4A76A 4OX9Q 2BH2A 2GVBA 2DUDA 1QZGA 1WFQA 4BBRG 3PO2H 5JJIA 1TXYA 3CCSA 5M3MH 3L2PA 1SMXA 2RF4A 3PO3H 2DGYA 4R4CA 2ZM6Q 4LF4Q 1Y14B 4P71A 2OWOA 2VQFL 3SGIA 1IZ6A 1UE7A 1YVCA 2VQEQ 4LFAQ 4GOPB 1AE3A 2YU9H 1G6PA 4YHHQ 2UXCQ 3D0FA 3W1BA 2WP8J 4C2MH 4JOIA 4PMWA 5IYDG 1TWGH 1XNRL 4JYAL 4YWMA 4X64Q 4OO1G 1Q1BA 2NVTH 3A74A 2IY5B 3PCOB 3RZDH 3HOXG 1K83H 2JK8A 4A3IG 4LF7L 2R7ZH 3IRBA 1QUQA 2E2IH 4A3GG 2UXBQ 1KXLA 1YITA 3CQZH 1IBKQ 3J7ZC 1K8GA 2KHIA 1PH2A 2UUCQ 1Q81C 3S16H 4B3TQ 1SROA 1Y1WH 1E22A 1J5EQ 4A3DH 2HHHQ 2RHQB 3TQYA 4GN4B 3B6YA 2KCMA 4PZ6A 1Z47A 1YHAA 4QIWE 1QVCA 4TVAB 5IYCG 4A3FH 1KL9A 1L2FA 4A3MH 1GKHA 1JJCB 2IHFA 2JA8G 3GTGH 2ID0A 5EAYA 4AYBE 1JT8A 3GTPH 4GKKL 4LF6L 2NZOA 2JA6H 2JA7H 4DV4Q 1V1QA 3AFQA 4B3SQ 2UXCL 2ZJQA 1X9NA 3HOWG 2WFWA 5GROA 1WI5A 1N9WA 4OXPA 4KHPQ 1E3PA 2D0PA 4X64L 4DR3Q 4R4OA 4JV5Q 1RIPA 3I4NH 1VQEA 4DUZL 1KIXA 4L5TA 1IBLL 1NY4A 3TS2A 1EIYB 2AWNA 2UU9L 4BXXG 3HOVH 2F4VL 3S2DH 1IXRA 4UP7A 3J80c 3CAMA 2LXKA 2YYZA 4OWTB 3BZCA 3PUZA 2F3IA 4A4IA 1EQQA 4B3TL 1Q82C 1MKHA 4O2DA 1VQ6A 1LM0A 2NVQH 5HGQA 5GAEC 4DNIA 1VQ7A 3U4VA 1QZHA 4DR4Q 2K5NA 3PIOA 1U0LA 3GTKH 4DR7L 3NELA 3CC2A 1H95A 3TEHB 4GNXC 5IP9H 2B63G 4C3JH 3HKZE 2BA0A 4HIKA 3EBEA 1PA6A 3FHWA 4XIGS 3M4PA 3H15A 4A3JH 2HIVA 4IOCA 4TQUS 4AIMA 4DV5L 4LF5L 4DAMA 4ALPA 3PF5A 3KYHC 4JI7L 3ULJA 4DR3L 5GAHC 2PQAA 1S3OA 4JV5L 2PNHA 1B70B 1VQAA 1LYLA 3KF6A 5HY6A 3HOZG 1LTLA 2WAQE 2NN6I 3DLLA 4DV0Q 2WB1E 2CWAA 1EYGA 4LUZA 5GQOA 4JBJA 3S14H 4A3LH 4YCVA 5IP7G 4DKAC 3CCVA 2RHSB 4DV1Q 4DR1L 2PI2A 1YHQA 5IE8A 5C3EH 1MIUA 2KHJA 4Y52H 1XTDA 1IBMQ 4FDBA 1CUKA 4MZ9A 2JE6I 3GTMH 3U4ZA 3PSIA 2VQFQ 2B3GA 4O0AA 1L1OC 4KHZA 3GD7A 2D62A 4DR4L 2N8NA 4X62L 1EOVA 3HFZB 4DUYL 4RG1A 1BVSA 2IX0A 1NMFA 2EQSA 3UE0A 4Y7NH 3PIPA 1YHBA 2HQLA 2CFMA 4JYAQ 2IT1A 3F8TA 4LFCL 3HOXH 4BY1H 1VQ9A 2VS1A 3NBHB 3J7A5 4BY7G 2QGQA 4L5QA 1EWIA 2RCNA 3AEVA 1HZCA 1A62A 1G51A 3S17H 1S40A 1CSPA 3ERSX 3NEMA 2EXDA 3JAMi 4LFBQ 1UE5A 4GS3A 2ZTDA 5IWAL 4LF9L 1Q12A 1AH9A 4BA1I 4MNOA 3KFUA 2ALYB 1HZAA 2HIXA 2CCZA 2ES2A 1NE3A 1CKNB 4IPGA 2R93H 1W2BA 2R6GA 4DV1L 2KBNA 3PUYA 2OTJA 1E1TA 1JE5A 3PUWA 1UE6A 1X6OA 4IJHA 3KDFB 1PH5A 4MTNA 1V43A 1IBML 3H0GH 3G6EA 3M3YH 1EFWA 3MEFA 2PI2E 3W5OA 3FP9A 1K73C 1L1OA 1ASZA 1Q1EA 3CPFA 4PZ8A 2K14A 1PH4A 4GKKQ
chains in the Genus database with same CATH superfamily
4LF6Q 1CFMA 2J7ZA 1IBLQ 2UU9Q 4ME5A 2HT1A 3M4OH 4A93G 1EY6A 3P20A 4K8IA 4O42A 2XWJB 5E7NA 5C44B 2LS01 1KRSA 3FKIB 5EKLA 4DXGA 1TWAB 3L3OC 4R4TA 5HGTA 4C3IB 4X3SA 2B63H 4IO9A 1EIFA 2JA5H 2ZTEA 3BU2A 1VQHA 2VUMB 1N36L 1JICA 3I4MB 2GVAA 2RDFA 4QIWB 5EKIA 1A15A 1PH6A 5C4XH 3GTQB 1KQSA 2AQ1B 3BZDB 3NQTA 4YY3L 4JG2A 4A3EG 3P7JA 4FYDA 1HFGA 3M4YA 4LJZC 3UDIA 5BR8L 1Y1VH 2ATWA 4CDCC 4HSPA 3HOYB 4K0KL 1EOTA 3S2HH 2A8VA 4HEDA 1XPOA 2VNUD 1S5FD 3H3VH 3A56A 1B8AA 4G7HC 3M85A 1Y8NB 4RFBA 1Y8OB 3GP7A 2TMPA 1WTVA 1XX8A 2QDLA 1R9TH 1QUQB 3TS0A 1N33L 2E8GA 3MEHA 1KAAA 2KCTA 5FJ8H 1QNUA 3ND8A 2EYLA 2J0TD 3E9HA 5M3MB 3CPWA 1HNXL 2F0HA 1A0IA 2IX1A 1EWHA 1X56A 3RLFA 4A3BH 3JC66 4HSVA 2DJFC 3JAMc 1Q86C 2B2TA 5T1IA 1N34L 2NN6G 1SNCA 4C2MB 1X3GA 3U50C 1YZ6A 3ITPA 4FF4A 2F0EA 3I70A 2WIIB 1A2TA 4R4IA 4FNFA 3RZDB 3MVVA 2NYZD 3IFTA 2E2IB 4OL7A 2PPBC 1C48A 2K6AA 2JA7G 4GKJL 4H7BA 1WOCA 4GNXA 1Y1WB 1HPCA 1FNUA 5LMNL 1D6EC 2R92H 4NDXA 2Z9HA 3H6MA 4B3RQ 1LT6D 4A3FB 1QWYA 3HOVG 1NJIC 3GTGB 3M7NA 5CMDA 4MHEA 3D8GA 2GA4B 1OXUA 5DEHA 3OWFA 1VQMA 2H5XA 4DA2A 3C46A 1EQRA 2F3VA 3NHHA 1TR5A 1EEID 4HN7A 2YTXA 1IW7C 4JI4L 2EJMA 1KABA 3CCQA 3K81C 2M9VA 4AQYL 1EYDA 4KY5A 1VF7A 3BG3A 1YIJA 3EVQA 3E0EA 2LFNA 3KF6B 4C3JG 5LMNW 1XMQQ 4A3JG 3X3NA 4DAYB 2ZJPA 3HOWH 4MN3A 2JEAI 2WKCA 4QGUA 5ELNA 1PRTC 1PZJD 1VS0A 1Q46A 4DV3L 2NVQB 3BJUA 4DK3C 4C3IG 1HNZQ 3R3OA 1JWUD 1HQMC 5D65A 1PYWD 5C3EG 4GNXB 1KNAA 2XRSD 4XDXA 5IYBH 4EQ5A 3P75A 4BA2I 4L5RC 5H1SE 4DR6Q 5DNFA 4X65Q 3J80L 3K58A 4K6LA 2MJ8A 4KJNA 3GTLH 3S1QH 1BBUA 5M5YH 3V05A 1NNXA 3E9IA 2KJXA 5A2QE 1GO3E 4POGA 4B9XA 2G9DA 4ODGA 5J22A 3STBD 3DWPA 1K8MA 3M4QA 1L1OB 1X3PA 4OX9L 3GO5A 1NMGA 3HGBA 2EYFA 1JJ2A 5JVG3 1U4LA 3F2UA 3DMUA 2Z6BA 5C0XG 4LF4L 1S5BD 2N49A 3PO3G 3HZXA 4LFAL 2N78A 4IPCA 3HKZG 3GTJH 1KNEA 4QMGA 2E75C 2RQXA 3J81E 4PQXA 1MHWC 2R93B 3E3XA 4BY7H 3TMEA 3NUCA 3KLWA 3SK5A 3TREA 4DR5Q 2F0JA 4BS9A 2WB1G 3CCEA 1G2SA 2GN5A 3D31A 2NZ1D 2UXDQ 2HDMA 1F9SA 1XPUA 2YU9B 5GADC 5C0XJ 1JMCA 4P72A 1NAPA 3H94A 2HCIA 3HG9A 1SR3A 1I4XA 4UP8A 1CZGA 2UUAQ 5M5WB 2EY5A 3OIPA 2JA5G 1E24A 1K8AC 1TVXA 3N52A 2IPKD 4JI6L 2EPBA 3QOLA 2E76C 2Z6KA 4OONA 1EYCA 5C4XG 3VYTA 5IT9c 1HRJA 1GUSA 2PW7A 3CCMA 1G291 3VYUA 2HUGA 1RCVD 2F0QA 1WTOA 1Y1VG 1OO9B 3J80i 3GTOB 1Q8KA 2Q2HA 1PRTF 3RMHA 3DEOA 5IOCA 1EU4A 5AFWA 4V190 3O13A 3I4NB 3WWVA 5AJ3Q 1XJVA 2D5DA 2EJFC 5FJ8G 3TP6A 2K04A 1DXMA 1CZWA 1TQOA 4NMZA 5LMUQ 4A3BG 2KENA 5M3FB 4C3HB 4DV0L 4JI1Q 1SLJA 4IUUA 2OT2A 2PZUA 3PO2H 1WFQA 2H1EA 3DWQA 5JJIA 1MBYA 3L2PA 4E6IA 2ZM6Q 1WTXA 4K6DA 2VQFL 4O1NA 1V8QA 1ZKOA 3SGIA 1YVCA 1UE7A 2JXMB 1K8OA 3T53B 3Q24A 4JOIA 4JPBW 2RVLA 3SEBA 1QILA 3PCOB 3BDOA 4LF7L 2RSOA 3GV6A 1PTOD 3J7ZC 2KHIA 1PH2A 5FO8B 1U4MA 1BXTA 5EGTA 1E22A 1J5EQ 2RHQB 3A7LA 2HCCA 5CBAE 1K3BC 4EGVA 5TSSA 2F03A 2K32A 4TVAB 4XQQA 5FLXE 4A3MH 5EQ0A 4AYBE 4LF6L 2JA6H 2ZT9C 3AFQA 2B8FA 4IQZA 2UXCL 3HOWG 5GROA 4OXPA 4X64L 1VQEA 4R9WA 2B2TC 1KIXA 4V0BA 4L5TA 1IBLL 1NY4A 3BVGA 2AWNA 3OW7A 2UU9L 1IYVA 3S2DH 1H9SA 1BOSA 1IXRA 2A6EC 4UP7A 2YYZA 4OWTB 2B2UA 3BZCA 1VF5C 3KLRA 4A4IA 3OWEB 1MKHA 2V4DA 1DZ1A 2CH4A 2BE5C 5I4DA 2CW0D 4G7ZC 4GNXC 1FR3A 3D6CA 5IP9H 4RGOS 1JB3A 4HIKA 3EBEA 1PA6A 1O80A 5C5MA 1TWCB 4C1NK 3JAME 4DAMA 2F0TA 3E5SA 1B70B 3DLLA 4B9WA 1EYGA 5GQOA 3S14H 2RHSB 2PI2A 3J7AV 1ESRA 4UAIA 1MIUA 2BDNA 1TWHB 3A8KE 5JOBA 4MZ9A 2JE6I 3GQBA 3PSIA 5DAUA 1L1OC 5FO9B 3HOZB 2NVXB 1CTMA 1I3QB 4RG1A 2K05A 1NMFA 3TZDA 5I2YA 1YHBA 2HQLA 1VQ9A 2VS1A 4BY7G 2F0NA 4U673 3NXWA 1A62A 1G51A 1ONLA 2EYPA 3S17H 3A8IE 2P5ZX 3KFUA 3SK4A 4HAEA 4H44C 2R6GA 4EVOA 5D14A 2OTJA 1JE5A 1I6VC 3DM1A 1DOLA 1B2TA 4FXGC 2IWHA 3H0GH 3G6EA 3S1NB 1EFWA 3K5NA 2PI2E 3FP9A 2ZXRA 4I7ZC 2A6HC 5CV6A 1O7YA 4DN4M 3K57A 2YTYA 5KYIA 1BO0A 4B3RL 1QE6A 2PMZB 4X6AH 1OXSC 1Q7YC 1T5XD 3ULPA 2H4OA 4LFBL 4RGTA 1SE8A 1I6HB 2ENBA 3AYHB 3GDEA 1EWCA 1LO5D 4EQNA 3F2BA 1YI2A 2IX3A 1A8VA 1SFOH 4DR7Q 2AQ3B 3URYA 4A93B 2JSOA 4DV2Q 3T1YQ 3S15B 1XMQL 2B2VA 4A75A 5E4WC 4RKLA 1LT5D 1TU2B 5ISRA 4DV5Q 1ILQA 4GLVB 4DK1A 2NTSA 4L6TB 1RD9D 3CCRA 3J81c 1HNZL 3PUXA 2RA4A 4R8IA 1HHVA 3PO2G 1I50B 4DR1Q 1LLRD 2IHEA 2X6LA 3NE5B 1A2UA 1DYQA 3LX0A 4A3EB 3H09A 5C4JH 4X65L 4HJ9A 4X62Q 2C5CA 3ICEA 1JOOA 1HA5A 1P16A 4NXNQ 1F9QA 2F0OA 1ZYRD 4DUYQ 2RBMA 3MXGA 4LFCQ 2EE1A 1WYDA 2JN4A 1O7LA 5ELDA 5CBEE 4XT3B 1HXYD 2PYKA 4DXFA 1V1OA 3FPPA 4RGMA 1SNDA 4GN3B 3KOJA 3UE1A 4LF9Q 3KJOA 2AHOB 4LWCA 1VQ8A 2I46A 4JBMA 2KCCA 1XMOQ 1JCKB 1F2ZA 3KF8A 1AN8A 2QA4A 5FOBB 1VQ5A 2D0OA 1K83B 3CCJA 4A3MG 3CQZB 5M9OA 3H91A 3S16B 2JA6G 2F0PA 1SRUA 2KUMA 2L0CA 1FL0A 3MWYW 2TSSA 4YWKA 1E1OA 4B3MQ 1B7YB 2F0LA 4G4KA 4DU9A 1GUTA 4GOPA 3FRPB 5T1GA 1ASYA 1KAWA 4A3GH 3Q22A 2UXDL 2EJGC 4UDUC 3EFXD 2A19A 2JA7B 3RLNA 1K9MC 3C1FA 4CJ1B 4H13C 5M5XH 2R61A 2JP1A 4FP5D 4KTAA 4IPDA 3HKSA 1NR4A 3ULLA 1P8LA 3AQQA 4GN5A 3HOVB 4JOIC 2F0GA 3ND9A 2KOLA 5IP9G 1VMPA 2B2YC 1VQJA 4LW1A 1EU3A 3K7UC 2B29A 3IAYA 2F4IA 4R8NA 5A35A 1AW7A 2JEBI 2XSCA 2A5HA 4UP9A 1GM5A 3GTKB 3QO2A 4LF8Q 2VW9A 1R4QB 4C3JB 2EY2A 1J6QA 4A3JB 1M90C 2K01A 3VR4A 5BN3A 3MAQA 4PV1C 5ELFA 1SE4A 4DR2L 4F88A 3I91A 1WTRA 2KHSA 4WJ4A 1STHA 3OPOA 5E4XA 4IFDJ 5AJ3L 4OO1I 1W3SA 1X65A 2R7FA 1OXTA 5CV7A 5C3EB 1TWFH 1I94Q 4XYQA 5FLXc 2R7DA 2ZTCA 1T9HA 4ZKBB 4QL5A 2RKSA 5LMUL 3CC4A 2KEEA 1PH3A 2LKVA 3G48A 1PTOH 1HZ9A 4JI1L 3J81j 2I5LX 3RR5A 1E2ZA 4KD3A 5IP7H 2Z4IA 5ELOA 1LTGD 2DNCA 2K50A 5C3WA 2FFKB 2WKDA 1EUJA 3KJPA 1X32A 3AMUA 2AWOA 2ZM6L 1STNA 1EY9A 3H0GG 1KC8C 2QKIC 4CBVA 1GD7A 3K0YA 2FJ2A 2E5LL 4JI0Q 1SNOA 4XQJA 4JBWA 1EZ8A 5JJLA 4EQOA 2LMCB 4RHSA 4XYOA 1OXVA 3OTOL 2ASBA 3CMEA 4A3KH 1VQIA 1PYBA 3PO3B 4JCVE 1SBBB 1ESFA 3HKZB 2OTLA 1OXXK 1PXUA 1W6JA 1N32Q 1J5EL 4DNRB 1F9RA 3W2DA 4YCWA 2K52A 5C5LA 1SAPA 1Y69U 4A3DG 2MHVA 1IL2A 2MO0A 2WB1B 2AMCB 3M4OB 3NPPA 3RLOA 1JORA 1VQFA 1GJXA 4YWLA 1VCIA 3RNUA 2F3WA 1D1KA 4QJFA 4JI3Q 2QW7A 2X6GA 5CV9A 3HOUH 1TY2A 1LTTD 2JJQA 1BBWA 3J81i 3F2DA 4NXMQ 4J6HA 1Y8PB 2MNAA 2EY1A 2K28A 2JA5B 1IYJB 4JBKA 2XVSA 1V1PA 1DCZA 3RUZA 1I4HA 3DHQA 1KDCA 1UAPA 4X66L 1PMRA 4DK6C 4JI8Q 5C4XB 1HUMA 4Q5VA 1D5XC 2SEBD 4JI2L 1WD1A 1I4GA 4L8JA 1HTPA 2XNAC 1Y1VB 2RCFA 3A54A 2L12A 4HIOA 3PF4A 1D7QA 1I4RA 2EYHA 1CSQA 4I7AA 3I72A 4ZCKA 2MQHA 1HJPA 1PRTD 2ICIA 3L0OA 3MXNA 3KUPA 1EFID 1R9TB 1FD7D 3NQIA 2G9HD 1QZGA 1EL0A 5EPJA 1AZQA 1VDZA 3VYSA 3CCSA 2L1BA 4XQNA 1SMXA 2F0FA 3VR3A 4A3BB 4QUFA 4ULLA 1IZ6A 2VQEQ 4IUVA 2YU9H 1V1PB 5EPKA 2K33A 4PMWA 1TWGH 1XNRL 4YWMA 3S9WA 1WTHA 2NVTH 1C8CA 3HOXG 2R7ZH 3HEJA 3IRBA 1ENAA 4A3GG 1YITA 3VR5A 2PNRC 1IBKQ 1BR9A 2UUCQ 1Q81C 3OMCA 2MP1A 4B3TQ 1J8IA 4PMBA 1LT3D 1BF4A 3G7LA 2R92B 1HCZA 3B6YA 4PZ6A 1Z47A 1YHAA 4X3KA 1B9NA 3N6RA 3JAML 1L2FA 2CVRA 1GKHA 1ZXTA 2IHFA 1PLFA 3GTPH 2NZOA 2F0VA 4DV4Q 1JWSD 4B3SQ 3MFGA 4F8MA 4FF2A 2D0PA 4N8X1 1RIPA 3I4NH 4G7OC 1M4VA 3TS2A 5C4HA 1EIYB 1S5DD 1SEBD 1LTID 1RTOA 1JQYD 5C3XA 5I6WA 3MC0B 4RWSC 2Q8RE 3HOWB 5KYLA 2EYOA 2F0UA 1DOMA 2K7VA 2Q8TA 4DNTB 4NP5A 4DR4Q 3DXJC 3TBIB 4K5WA 4DR7L 4TKOB 2B63G 4IURA 2BA0A 3M4PA 3SXHA 4B08A 4TQUS 2AUJD 4DV5L 2L55A 4QF4A 4ALPA 2PO4A 3ULJA 1QNKA 1SYGA 5GAHC 2PQAA 1S3OA 5EBCA 4CHTB 2PNHA 1RF2D 4DR3L 1VQAA 3EQLC 4JV5L 1LYLA 1LTLA 2WAQE 2NN6I 2CWAA 2ZXOA 5IP7G 3GTLB 3S1QB 3LWUA 1EYAA 1KDAA 4DGZA 2CH4W 4DV1Q 4DR1L 3SK6A 5IE8A 4PMCA 5M5YB 5HURA 5CYUA 5JPMC 4Y52H 2QCPX 1IBMQ 2DJGC 2N8NA 4X62L 4ILWA 3HFZB 4DUYL 5DM73 1BVSA 3NWTA 3UE0A 2EQSA 4Y7NH 4CJ0B 3PIPA 1SJHD 2CFMA 4JYAQ 2IT1A 3F8TA 4LFCL 1YNND 4BY1H 1LACA 3P1HA 2RCNA 3AEVA 1HZCA 2L11A 3JAMi 2EXDA 2IJ0A 2BCOA 4GS3A 2A69C 2ZTDA 3GTJB 4LF9L 3A7AB 1ET6A 1TS4A 1AH9A 1DJRD 4BA1I 4MNOA 2ALYB 1S5CD 2HIXA 3BYYB 1TS5A 2ICEC 5KNBA 3PUYA 2KBNA 4BY7B 4IJHA 2M00A 1B1ZA 4KY7A 3EJIA 4MTNA 1V43A 3SHLA 3TDQA 3VA7A 2ZXPA 3CPFA 1OTCA 3FPUB 1IKLA 2WACA 4X3TA 3SK8A 4OIJA 3ZYYX 2BOSA 4M1UB 1CKMA 4BBSH 1GUOA 4YY3Q 5C4ZA 1Z9FA 3HOUG 2B2WA 3NENA 2YV5A 1K3RA 4BXXH 1CI3M 4JC0A 1IKMA 2R92G 3V2TA 4IOAA 3QWNA 3S1RH 2F4VQ 4ZQ3A 1UE1A 1WTPA 5COYA 3TZUA 2DY7A 3NTKA 1SNPA 2Y0SE 4FO2A 1X3FA 4K5XA 5IGBA 3K5MA 3CXCA 1WCMH 1JJGA 1B3AA 2AKWB 3I7FA 1JB7A 2QILA 1ZEQX 2OF1A 5KNCA 5CORA 1HNXQ 1HQRD 4LF5Q 2F0WA 4JI7Q 3Q0AA 1O7IA 3D3RA 1H9RA 2SDFA 2Q2IA 4LF8L 4UHVA 3PV0A 5CGKA 2SNMA 1A3TA 1BCPB 3H3VC 5IT9L 1TKWB 5C0XI 1I4PA 3C3LA 4WJWA 5IYBG 3UDGA 1YNJC 3KLSA 1WTWA 1PFSA 2BE5D 3K7AB 1GXDC 2BH8A 1M1KC 1RDPD 5LMNQ 1EZ6A 3S24A 3PO2B 1QVGA 1I94L 2VY3A 4R4QA 4U68A 2WAQG 3SE0A 5ELBA 2R7ZG 2K5WA 4IFDH 4GLXA 4HIMA 1LV9A 3W1GA 5CC4A 1X55A 3Q23A 1MSGA 4P75A 2A68D 4BBRH 2CW0C 3A5ZB 4MIUA 3ERQA 3Q8DA 1VQ4A 4HJAA 4AQYQ 1YEZA 3A55A 1BDOA 3CU7A 2RSNA 1KRTA 4JI0L 3KBGA 1H9SB 4DV7Q 3LWEA 1S72A 1D1IA 3RN5A 1G8ZD 2F1MA 5IYDH 4P73A 5JJKA 4QUCA 1II3A 4RMFA 2CWPA 2E2JB 4HJ7A 3MXPA 1N8RC 4DV3Q 2EYMA 3MZ5A 2NZHA 4A3IH 1DONA 3K0XA 4A3MB 4UPAA 3RZOH 2WINB 1NCVA 4ZUJA 3CF5A 4LNQA 1BKBA 1SJED 2JA6B 1N32L 2KCNA 1UWVA 2VB2X 4FXKC 3H3VI 4FVMA 1C9OA 3F2CA 2RDGA 3QOJA 1JOKA 5IYCH 4IUTA 4CJ2C 5LL6S 3S2DB 2JA8H 3J7YW 3CKIB 5J3BA 4JI3L 1KHIA 3M9BA 4J15A 5IGEA 2A6HD 4HJ5A 4P74A 4MTKA 4ZUIA 4WJ3M 4XXEA 3EIVA 2Q8IB 2KEDA 5G3LF 2Y0SG 2R3ZA 1CK1A 5KNDA 3BVZA 3RN2A 5I2XA 4JI8L 1RHPA 4APVA 4CKBA 4NB3A 4AYBG 4DAPA 1B50A 2PMZE 1K28A 2NVYH 4KN7C 5LL6X 2QDBA 2CKZB 1CHPD 2XGTA 3QB3A 4DFAA 5ELEA 2MFIA 3UDFA 3S14B 1X3EA 1VQDA 2KVMA 1EEFD 1STGA 4BY1G 4ABNA 2B39A 3PIP3 1E2WA 1VQPA 5JPNC 1HA6A 2Z8LA 1GUGA 2JQOA 3VA5A 5BN5A 3KLSX 4LK1C 4POFA 4UY8C 4R1JA 1ICWA 4PZ7A 1WJJA 4KKSA 1NUCA 2QF7A 4OIKA 1FGUA 3S17B 3S1MH 2VQEL 2V1CC 1YNXA 4JW0A 4JI6Q 4DR6L 1FJGQ 1VQCA 4BBSG 2Z6KC 1W6KA 1MSHA 1L0XB 4ZYSA 3T56B 4IUNA 3UDXA 1UEAB 2N55A 4RH6A 3WOFA 1XNQQ 3H0GB 1RJTA 2F0KA 2K5HA 2VL6A 2OXPA 3K59A 1HH2P 5L37A 1IBKL 1A3UA 2UUCL 1D8LA 1O78A 2E2HH 1KLGD 4IALA 2ZJRA 3NBHA 1LTBD 3CRKC 4K2LA 4KLKA 3T1HQ 1HR0Q 4CDEC 4XT1B 4DV6Q 4YIJA 2Z0SA 2O4XA 4RHRA 1WCMG 2UUBQ 1EQVA 1Q3LA 1UEBA 5DLQE 1CKNA 4DV4L 4B3SL 2L5TA 5C44H 3FKIH 3KDFA 1TWAH 3NWSA 4CDDC 1AP0A 4C3IH 4A3DB 3G4SA 1SNQA 2I5HA 4DR5L 1PH7A 1JWMD 4OELB 3OW2A 4P2CB 1WTQA 1AE2A 2VUMH 3R2IA 4XTCS 3I4MH 4Q0FA 1ENFA 2MUYA 1E2VA 3GTQH 4NPSA 2K03A 4DPGA 5CV4A 2JA9A 1LTSD 4OWWB 1F9PA 2OQ0A 1JC7A 1BCPC 3C2PA 1K0RA 2UUAL 3ONAB 2K4KA 1QJOA 2NUCA 4EX5A 1MJCA 5IODA 5A2QL 4RAUC 3HOYH 4IJLA 4JI5Q 1DD2A 3CD6A 4LF7Q 3M7GA 3NBIA 3F1ZA 4IFDG 3KF8B 4ZK9B 1MD2D 3D4DA 4L63B 3K80C 5C4JB 4EQPA 1VQKA 5D3DA 1CKOA 2I5MX 1FVIA 1HNWQ 2GVBA 2DUDA 4BBRG 3FVQA 1TXYA 5M3MH 1SMYC 1SYBA 2RF4A 3PO3H 3EROA 2DGYA 2AUKA 4R4CA 4KV6A 3J81L 5IIFA 2EYJA 5IGDA 3L9AX 4GOPB 1AE3A 1G6PA 4YHHQ 5JEAH 2UXCQ 3D0FA 2EY6A 3W1BA 2WP8J 4LMQD 3D4RA 3FMCA 4C2MH 5IYDG 4JYAL 3G6JB 4X64Q 1Q1BA 5E3FA 4F7XA 3A74A 3DEPA 1FYCA 2SOBA 3RZDH 1WD0A 4RCNA 4A3IG 1U4RA 1QUQA 2E2IH 2UXBQ 2CHBD 2Z1CA 4KY6A 3GTMB 1BUVT 3IFDA 4FF1A 2B2UC 5KEEA 1SROA 1Y1WH 4F87A 1F2MA 2HHHQ 1QOHA 3TQYA 1GHJA 3HOXB 4QIWE 1QVCA 5IYCG 4A3FH 1AZPA 1KL9A 4A3GB 2JA8G 3GTGH 1CQVA 2ID0A 2VXWA 1JT8A 3GV3A 1F2YA 2ZJQA 1PDQA 5M5XB 1X9NA 1WI5A 3U9SA 4KHPQ 1FNVA 4R4OA 3A8JE 1VMCA 3MTSA 2F4VL 2IL8A 3M3YB 4KKTA 4HCSA 3J80c 3CAMA 2LXKA 1XXGA 4K14A 1E0BA 1ILPA 4TRDA 1EY5A 1EY8A 3NTHA 3DUZA 4IZ8A 3FEWX 3MXUA 1LM0A 1X3QA 2NVQH 5GAEC 1IYUA 3U4VA 1VQ7A 1QZHA 2K5NA 3PIOA 1U0LA 3RD4A 3E6ZX 3NELA 1H95A 3IL8A 3HKZE 5EJWA 3FHWA 4XIGS 1GUWA 4IOCA 3OOCA 4AIMA 4LF5L 1HFNA 3NP8A 5D3IB 1BCPF 1CQFA 4JI7L 5LHY1 3KF6A 4RGNA 2WB1E 4S3SA 4DAYA 4A3LH 2B63B 4C1NI 4YCVA 4JK1C 4DKAC 2K1BA 1TWFB 1O7ZA 1M8AA 1SE2A 4FDBA 3K5OA 1CUKA 2D2CC 3WOEA 5I9OA 1PTOB 5FO7B 1Z7TA 1IW7D 3KBXA 4CKEA 1KDBA 3VR2A 5J1ZA 3J7A5 4KJOA 1KLUD 3S2HB 4NW2A 3WDNA 1LTRD 4KMUC 4KD4A 1ICFB 4LAAA 3BVMA 4LFBQ 1CSPA 3ERSX 3NEMA 4KN4C 1EQTA 1UE5A 2HDLA 2F0MA 1Q12A 3FDTA 2ES2A 3C1EA 1NE3A 1WVLA 2R93H 5FLXL 1E1TA 2E74C 1UE6A 1XWEA 1PH5A 2XRQD 4A3KB 5EPLA 1ASZA 4JVZA 1K73C 1L1OA 2K14A 1PH4A 4Z9CB 4GKKQ 2B2VC 2EOTA 4DV7L 5C44G 2YTVA 4IFDI 1SDFA 3FKIG 3ER0A 4K5VA 5JAVA 2F0DA 3T16A 3LGJA 2Q2UA 3J7AF 4OHJA 4PNYA 2VB3X 2BA1A 2E2DC 4DUZQ 1XTCD 1I5FA 5M5WH 3DM3A 1B44D 3OYYA 5IY0A 2VUMG 1CM9A 5GAGC 1CA5A 1BQQT 5NUCA 3I4MG 1B4OA 1MJEA 1EIHA 4HJ8A 3HOUB 1T5EA 4KKUA 3I3CA 2L15A 2L9HA 3R8BA 5K36H 1U5KA 3BS1A 2EDGA 3GTOH 3MXNB 3HOYG 3R93A 3OHXC 4N9PA 1Z6HA 3I56A 3STBC 1VQOA 2HQEA 5FLMH 2FINB 2CQAA 4AH6A 1YJNA 2NB0A 1HZBA 4RKBA 3K5LA 2FHTA 4KI0A 4OWXB 5IGFA 1C0AA 1JE4A 5M3MG 3R2TA 1PH9A 1VQLA 3A5UA 1SNMA 1B3QA 3I73A 5M3FH 4C3HH 3HP3A 4QQBX 1AFPA 3I55A 4J8QA 1CT1D 5JEAG 1JR0D 2EIFA 5JVH3 4HMJA 2J4XA 3A0JA 4A3CH 2OQKA 2EVBA 3SVMA 4DV2L 3T1YL 1LT4D 3VDYA 1QB5D 2X69A 1RL2A 4G57A 1U9RA 4GOPC 1NTGA 1V9PA 3OSOA 4GLAC 5IWAQ 2F0IA 1PH8A 1Y1WG 1MGSA 1TWGB 1JOQA 3G71A 2D9UA 2NVTB 2N88A 1A63A 1S5ED 2WAQB 3CW2C 5JEAJ 4A3FG 2R7ZB 1QCBD 3TSSA 4X3UA 4H02A 1PFNA 2XTIA 1YBYA 4M8AA 2LXJA 1FJGL 2C35B 4NXNL 4OO1H 1PFBA 2A1AA 3CMAA 3T4AC 1PVOA 3CCLA 1XNQL 1EY0A 1KD1C 1TS3A 2DNEA 4BWGB 1R4PB 4A3KG 3QG1A 5C6AA 4DK0A 1YJWA 3GTPB 5E1FA 3VYRA 2IW3A 2OEOA 2LSSA 5IGCA 2A69D 3Q6SA 4DR2Q 1XMOL 4QY7A 1EY7A 5KRUA 2I0QA 1L0YB 3T1HL 1HR0L 4DV6L 3UI2A 1YNNC 4HTHA 2UUBL 2PQAB 3TRZA 1N36Q 4GZYC 2G5DA 3PIO3 2K5VA 5EKKA 3OMGA 4NKLA 4ZLTF 3ZJYC 4TSSA 1YJ9A 1LUZA 4B3ML 2PCFB 2JYOA 3K7AH 4ME3A 5CV5A 3T51B 2WV6D 5BR8Q 3V96A 2QEXA 1X54A 4A3LG 3CCUA 3CHBD 1PYSB 4K0KQ 1HR0W 1TWCH 1PV4A 1QVFA 3NTIA 3NSWA 3U9OA 5IGGA 1AEXA 5CR3A 1CHQD 5I9PA 1ET9A 2Q2TA 2I07B 2AQ2B 2E5LQ 2PQEA 1VQBA 2Y0SB 1A6XA 1STYA 1F77A 1N33Q 2MPMA 4JI5L 2BDOA 2VZAA 2B2YA 1PH1A 3OTOQ 1TWHH 5G3LD 1Q8IA 1I4QA 1PTOC 2FMCA 1GUNA 2F52A 3I90A 4AYBB 3HOZH 2NVXH 4KHVA 1I3QH 1HNWL 2SNSA 1N34Q 1CA6A 2E2JH 4Y7NB 5I6YA 2C9OA 2R93G 1TT2A 3PUVA 1GVPA 4BY1B 3SR1A 2A6ED 4RCOA 3BYTB 2OCEA 3K8AA 4ID6A 1C7YA 3L7ZC 4N8FA 1VQGA 4YHHL 1STAA 1YNJD 3CP0A 4GKJQ 3EN2A 1H9KA 1L0WA 3HRZC 3J80E 3DWAA 3S1NH 2UXBL 3IKJA 1E7ZA 1STBA 4CGYB 4X66Q 1TIID 3BZKA 1NR2A 1STEA 2N3SA 3LNNA 4WFN3 4BBSB 1SN8A 3HS0C 4I65A 2HHHL 1QG7A 4K2KA 1VQNA 1H9MA 5DM63 1LTAD 3BDCA 4JI2Q 4JI4Q 1G6ZA 3I4LA 1DGSA 2K75A 5K36G 3U58A 3S1RB 4PG3A 3CC7A 3D6WA 1PHJA 5K5PA 1I6HH 2CQOA 1GHKA 1RKNA 1Q90A 4KHPL 2RDHA 2HD3A 2NWGA 4YCUA 2A68C 2FMMA 3I4NG 1XPRA 1BNZA 1PZID 5FLMG 4HIDA 1WCMB 4A93H 3PMFA 3S15H 3AU7A 3TP5A 3MA2B 1XYIA 4L5SA 3QIAA 4QB4A 5M3FG 3PGZA 4C3HG 1KTKA 5EBDA 2DY8A 3I8ZA 4A3CG 1EY4A 1XNRQ 1UUPA 1F2LA 3PQIA 4IUPA 1I50H 4J1MA 3AFPA 3I2ZA 2EXZA 4IPHA 3BDLA 4A3EH 2MO1A 4LUOA 3QR8A 2MGSA 5J39A 3I4OA 4C56C 2FXQA 4NXML 1HTLD 3VR6A 1D5MC 1DOKA 1SXTA 1NBWA 4A76A 4OX9Q 2BH2A 3NK9A 1PTOF 1A3VA 3QJYA 4LF4Q 1LABA 1Y14B 2Z4HA 4IUQA 4P71A 2OWOA 3SDZA 4LFAQ 1J9OA 3X3MA 1D2BA 1DM0B 4OO1G 5ELCA 4BBRB 2IY5B 1G91A 1TS2A 1K83H 2JK8A 2F0SA 1KXLA 3CQZH 1K8GA 3AB9A 1UNSA 3KK7A 3S16H 1B9MA 2NN6H 1RTNA 4CKCA 4ZKCB 1FGBD 3K6OA 4A3DH 4GN4B 3T13A 2KCMA 1K0SA 1D5ZC 4A3IB 2XIWA 1JJCB 3RZOB 1H9JA 5EAYA 2O5IC 2XWBB 4GKKL 2K5QA 2EZVA 2JA7H 4N9TA 1V1QA 3EA6A 2WFWA 2KQ3A 1N9WA 1E3PA 4DR3Q 4JV5Q 3OIQA 3W3AA 4DUZL 4DAVA 4DF7A 1IHZA 2A73B 4BXXG 3HOVH 3E0JA 2JA8B 5FKAC 1B53A 4FXDA 3CRLC 4KK7A 2NTTA 1MI2A 5FK9C 1SYFA 3PUZA 2QEJC 2F3IA 1EQQA 4B3TL 4HCEA 1Q82C 2PW5A 3MFYA 1SE3A 4O2DA 1VQ6A 2KECA 2NBFA 5HGQA 4DNIA 4ZRZA 1RODA 2B8GA 3GTKH 1ZYRC 1PRTB 2DN8A 2O2LD 3CC2A 2LY7A 3TEHB 2O5JC 4C3JH 1U4PA 1SYEA 2XN9C 5F2DA 2PZTA 3H15A 4A3JH 1SYCA 2HIVA 5KIXA 3PF5A 1NSNS 3KYHC 3TN2A 5HY6A 1C4QA 3HOZG 4WORA 4CDFC 4DV0Q 3D4WA 2NVYB 4LUZA 4JBJA 1SFOB 3CCVA 1YHQA 5C3EH 5JJZA 4HMIA 1G2TA 2KHJA 1XTDA 3GTMH 1SSOA 3U4ZA 1PZKD 2PZWA 2VQFQ 2B3GA 5IT9E 4O0AA 4KHZA 3TP8A 3GD7A 2D62A 4DR4L 1EOVA 4WRDA 1BCPD 2A74C 2IX0A 1ML0D 1TY0A 1SYDA 3HOXH 4ZAIA 2B2WC 3NBHB 4HR7B 2QGQA 2L4NA 1S4ZA 4L5QA 1EWIA 1ENCA 2M2LA 4QCLA 1HUNA 4FF3A 1GOZA 1S40A 4OGQC 3S1MB 2KA7A 5IWAL 3TP7A 5BN4A 4OEMB 1HZAA 2CCZA 4K8JA 4IPGA 1CKNB 3MHBA 1PFMA 1W2BA 4DV1L 1EIGA 2K5DA 3PUWA 4RA8A 1BBXC 1X6OA 1FNWA 3KDFB 4IN3A 5C0XH 5KGUA 1IL8A 1IBML 3M3YH 4H0LC 3MEFA 1SMYD 5CV8A 3W5OA 1Q1EA 4PZ8A 4LUVA 2E2HB
chains in the Genus database with same CATH topology
4LF6Q 4DV7L 5C44G 2YTVA 4IFDI 1CKMA 4BBSH 3FKIG 3ER0A 2Q2UA 2YTYA 4YY3Q 3LGJA 1Z9FA 3HOUG 3NENA 2YV5A 1K3RA 4BXXH 4B3RL 2BA1A 4JC0A 4DUZQ 2R92G 1IBLQ 1I5FA 5M5WH 3DM3A 2UU9Q 3S1RH 2HT1A 1OXSC 2F4VQ 4IOAA 1Q7YC 3M4OH 1UE1A 3ULPA 3OYYA 4A93G 5IY0A 2VUMG 5GAGC 4LFBL 3I4MG 1SE8A 5E7NA 3AYHB 3GDEA 1KRSA 2Y0SE 1MJEA 4HJ8A 4R4TA 3F2BA 1YI2A 1X3FA 1A8VA 2L15A 3CXCA 1U5KA 4IO9A 1EIFA 1SFOH 2JA5H 1WCMH 2B63H 4DR7Q 2ZTEA 3BU2A 1JJGA 1VQHA 2AKWB 3I7FA 4DV2Q 3T1YQ 1N36L 3GTOH 1JB7A 3MXNB 1XMQL 3HOYG 4A75A 2GVAA 1PH6A 5C4XH 1HNXQ 1KQSA 4DV5Q 4LF5Q 4YY3L 4GLVB 4JG2A 4A3EG 3I56A 4JI7Q 1O7IA 3STBC 1VQOA 3CCRA 3J81c 1HNZL 2Q2IA 3PUXA 5FLMH 3UDIA 4LF8L 5BR8L 1Y1VH 3PV0A 2ATWA 4AH6A 1YJNA 1HZBA 4K0KL 3PO2G 4DR1Q 4KI0A 2A8VA 2IHEA 3S2HH 4OWXB 1XPOA 5C0XI 1C0AA 2VNUD 5M3MG 3H3VH 1PH9A 1B8AA 1VQLA 3M85A 3A5UA 5IYBG 3UDGA 5M3FH 4C3HH 5C4JH 4X65L 4QQBX 3I55A 1R9TH 1PFSA 1QUQB 5JEAG 4X62Q 2EIFA 4HJ9A 3TS0A 3ICEA 1P16A 2BH8A 3A0JA 2E8GA 4DUYQ 2OQKA 1M1KC 4NXNQ 1N33L 4DV2L 3T1YL 5LMNQ 3S24A 3VDYA 1QVGA 2KCTA 5FJ8H 2VY3A 1I94L 4LFCQ 4R4QA 1RL2A 1WYDA 2WAQG 3E9HA 3CPWA 1HNXL 1A0IA 4GOPC 2IX1A 2R7ZG 1X56A 3RLFA 1NTGA 1V9PA 3JC66 4A3BH 4GLXA 4HIMA 3JAMc 3W1GA 1Q86C 1X55A 4GN3B 3KOJA 4GLAC 3UE1A 5IWAQ 3KJOA 1N34L 2AHOB 2NN6G 4LWCA 1PH8A 1VQ8A 4LF9Q 4JBMA 1XMOQ 1X3GA 4P75A 1Y1WG 3U50C 1YZ6A 4BBRH 3G71A 3A5ZB 1A63A 1VQ4A 3Q8DA 4R4IA 2QA4A 1VQ5A 4HJAA 2D0OA 3CW2C 5JEAJ 4AQYQ 4A3FG 1YEZA 3CCJA 4A3MG 1KRTA 4H02A 4JI0L 2XTIA 1YBYA 2LXJA 2JA6G 2JA7G 4DV7Q 1FJGL 1S72A 4GKJL 3RN5A 1SRUA 2C35B 5IYDH 1FL0A 4P73A 4NXNL 1WOCA 4YWKA 4GNXA 5JJKA 4RMFA 2A1AA 2CWPA 3CMAA 4HJ7A 5LMNL 1E1OA 1N8RC 4DV3Q 4B3MQ 2R92H 1B7YB 1PVOA 3CCLA 4B3RQ 4A3IH 2NZHA 1XNQL 4GOPA 1ASYA 1KD1C 1KAWA 4A3GH 3K0XA 3HOVG 4UPAA 3RZOH 1NJIC 2UXDL 4A3KG 3M7NA 1YJWA 3CF5A 4LNQA 1BKBA 2A19A 1OXUA 1N32L 3RLNA 1UWVA 2LSSA 1K9MC 5M5XH 3H3VI 1VQMA 2H5XA 1C9OA 4DR2Q 1EQRA 4QY7A 1XMOL 3F2CA 4JI4L 2YTXA 4IPDA 3HKSA 2I0QA 5IYCH 3T1HL 3ULLA 1P8LA 1HR0L 3AQQA 4GN5A 3CCQA 4DV6L 4X6AH 3K81C 4AQYL 2JA8H 2UUBL 4JOIC 2PQAB 3TRZA 1YIJA 5IP9G 3E0EA 5LMNW 3KF6B 1N36Q 5J3BA 1XMQQ 2K5VA 4JI3L 1KHIA 4DAYB 4A3JG 3M9BA 4J15A 1VQJA 4LW1A 2ZJPA 3HOWH 3K7UC 2JEAI 4HJ5A 2B29A 4P74A 3ZJYC 4QGUA 5ELNA 1VS0A 2JEBI 1Q46A 4DV3L 1LUZA 1YJ9A 4B3ML 4WJ3M 3BJUA 3EIVA 4UP9A 4DK3C 1GM5A 3K7AH 4ME3A 1HNZQ 4LF8Q 2Y0SG 2VW9A 5BR8Q 2QEXA 1X54A 4A3LG 3CCUA 3RN2A 1PYSB 1J6QA 4K0KQ 5C3EG 1M90C 4GNXB 4JI8L 1HR0W 1TWCH 4LUVA 1PV4A 1QVFA 5IYBH 4EQ5A 4APVA 4A3CH 4DR2L 4L5RC 4BA2I 4NB3A 5H1SE 2Q2TA 4AYBG 4WJ4A 2PMZE 2E5LQ 4DR6Q 4X65Q 1VQBA 2NVYH 2CKZB 2XGTA 4IFDJ 5AJ3L 2MFIA 3UDFA 1N33Q 1BBUA 1W3SA 3GTLH 4JI5L 3S1QH 1X65A 2R7FA 1OXTA 1X3EA 2VZAA 1VQDA 5M5YH 1TWFH 1PH1A 1I94Q 4BY1G 3OTOQ 1TWHH 5FLXc 2R7DA 2ZTCA 3E9IA 1T9HA 4QL5A 5LMUL 1GO3E 1VQPA 3CC4A 1PH3A 2F52A 4POGA 3G48A 2JQOA 1HZ9A 3HOZH 4JI1L 3J81j 2NVXH 2I5LX 3STBD 1I3QH 3RR5A 1HNWL 1N34Q 3M4QA 1L1OB 5IP7H 4POFA 2E2JH 4OX9L 3GO5A 4UY8C 5ELOA 1NMGA 2R93G 4R1JA 2K50A 3PUVA 1GVPA 1JJ2A 3KJPA 1EUJA 4PZ7A 1WJJA 2AWOA 2ZM6L 2OCEA 3K8AA 5C0XG 4LF4L 2N49A 3H0GG 1KC8C 1FGUA 3PO3G 1C7YA 3S1MH 1GD7A 3L7ZC 2VQEL 4LFAL 2V1CC 1YNXA 2N78A 4IPCA 3HKZG 1VQGA 4YHHL 3GTJH 4JI6Q 2E5LL 4JI0Q 3CP0A 4DR6L 4JBWA 1FJGQ 4GKJQ 1VQCA 4BBSG 2Z6KC 5JJLA 3EN2A 4OO1I 1L0WA 4BY7H 1OXVA 3OTOL 2ASBA 3UDXA 3KLWA 3TREA 4DR5Q 1XNQQ 3S1NH 2UXBL 3CMEA 4A3KH 1VQIA 2WB1G 1PYBA 2K5HA 2VL6A 3CCEA 1HH2P 1IBKL 1E7ZA 2GN5A 4JCVE 3D31A 2UUCL 2UXDQ 1D8LA 2E2HH 2OTLA 4X66Q 1OXXK 1XPUA 3BZKA 2ZJRA 1N32Q 2N3SA 5GADC 5C0XJ 1JMCA 1J5EL 4P72A 1SN8A 2HHHL 1VQNA 1SR3A 2K52A 4YCWA 4JI2Q 4UP8A 4KLKA 1DGSA 4JI4Q 1IL2A 4A3DG 2K75A 3T1HQ 1HR0Q 2UUAQ 4DV6Q 2MO0A 2Z0SA 3U58A 5K36G 2JA5G 1WCMG 2AMCB 4PG3A 1E24A 3CC7A 1K8AC 5DLQE 1UEBA 3RLOA 2UUBQ 1VQFA 1PHJA 1CKNA 4YWLA 1VCIA 3RNUA 1I6HH 4DV4L 4B3SL 5C44H 4JI6L 4QJFA 4JI3Q 1OTCA 2CQOA 3FKIH 2Z6KA 1TWAH 3KDFA 4OONA 5C4XG 4KHPL 3HOUH 5IT9c 2JJQA 1BBWA 3J81i 4YCUA 4C3IH 3G4SA 3F2DA 3CCMA 1G291 3I4NG 2I5HA 1XPRA 4NXMQ 4DR5L 1PH7A 2MNAA 5FLMG 3OW2A 4HIDA 1IYJB 1Y1VG 4JBKA 4A93H 2VUMH 1AE2A 3J80i 3S15H 4XTCS 3I4MH 1Q8KA 4X66L 2Q2HA 4DK6C 4JI8Q 3GTQH 4NPSA 4DPGA 2JA9A 4L5SA 4OWWB 2OQ0A 4JI2L 5M3FG 3PGZA 1K0RA 2UUAL 2K4KA 3WWVA 4HIOA 3PF4A 4EX5A 4A3CG 1D7QA 1XNRQ 1MJCA 5AJ3Q 1XJVA 3HOYH 4IJLA 1I50H 4JI5Q 3AFPA 5FJ8G 3I2ZA 3CD6A 4LF7Q 4IPHA 1CSQA 4A3EH 2MO1A 4LUOA 3F1ZA 5LMUQ 4A3BG 4IFDG 3KF8B 2MQHA 3I4OA 1HJPA 2KENA 1VQKA 3K80C 2FXQA 3L0OA 4JI1Q 4DV0L 1CKOA 4NXML 2I5MX 1FVIA 1HNWQ 1SLJA 1NBWA 4A76A 4OX9Q 2BH2A 2GVBA 2DUDA 1QZGA 1WFQA 4BBRG 3PO2H 5JJIA 1TXYA 3CCSA 5M3MH 3L2PA 1SMXA 2RF4A 3PO3H 2DGYA 4R4CA 2ZM6Q 4LF4Q 1Y14B 4P71A 2OWOA 2VQFL 3SGIA 1IZ6A 1UE7A 1YVCA 2VQEQ 4LFAQ 4GOPB 1AE3A 2YU9H 1G6PA 4YHHQ 2UXCQ 3D0FA 3W1BA 2WP8J 4C2MH 4JOIA 4PMWA 5IYDG 1TWGH 1XNRL 4JYAL 4YWMA 4X64Q 4OO1G 1Q1BA 2NVTH 3A74A 2IY5B 3PCOB 3RZDH 3HOXG 1K83H 2JK8A 4A3IG 4LF7L 2R7ZH 3IRBA 1QUQA 2E2IH 4A3GG 2UXBQ 1KXLA 1YITA 3CQZH 1IBKQ 3J7ZC 1K8GA 2KHIA 1PH2A 2UUCQ 1Q81C 3S16H 4B3TQ 1SROA 1Y1WH 1E22A 1J5EQ 4A3DH 2HHHQ 2RHQB 3TQYA 4GN4B 3B6YA 2KCMA 4PZ6A 1Z47A 1YHAA 4QIWE 1QVCA 4TVAB 5IYCG 4A3FH 1KL9A 1L2FA 4A3MH 1GKHA 1JJCB 2IHFA 2JA8G 3GTGH 2ID0A 5EAYA 4AYBE 1JT8A 3GTPH 4GKKL 4LF6L 2NZOA 2JA6H 2JA7H 4DV4Q 1V1QA 3AFQA 4B3SQ 2UXCL 2ZJQA 1X9NA 3HOWG 2WFWA 5GROA 1WI5A 1N9WA 4OXPA 4KHPQ 1E3PA 2D0PA 4X64L 4DR3Q 4R4OA 4JV5Q 1RIPA 3I4NH 1VQEA 4DUZL 1KIXA 4L5TA 1IBLL 1NY4A 3TS2A 1EIYB 2AWNA 2UU9L 4BXXG 3HOVH 2F4VL 3S2DH 1IXRA 4UP7A 3J80c 3CAMA 2LXKA 2YYZA 4OWTB 3BZCA 3PUZA 2F3IA 4A4IA 1EQQA 4B3TL 1Q82C 1MKHA 4O2DA 1VQ6A 1LM0A 2NVQH 5HGQA 5GAEC 4DNIA 1VQ7A 3U4VA 1QZHA 4DR4Q 2K5NA 3PIOA 1U0LA 3GTKH 4DR7L 3NELA 3CC2A 1H95A 3TEHB 4GNXC 5IP9H 2B63G 4C3JH 3HKZE 2BA0A 4HIKA 3EBEA 1PA6A 3FHWA 4XIGS 3M4PA 3H15A 4A3JH 2HIVA 4IOCA 4TQUS 4AIMA 4DV5L 4LF5L 4DAMA 4ALPA 3PF5A 3KYHC 4JI7L 3ULJA 4DR3L 5GAHC 2PQAA 1S3OA 4JV5L 2PNHA 1B70B 1VQAA 1LYLA 3KF6A 5HY6A 3HOZG 1LTLA 2WAQE 2NN6I 3DLLA 4DV0Q 2WB1E 2CWAA 1EYGA 4LUZA 5GQOA 4JBJA 3S14H 4A3LH 4YCVA 5IP7G 4DKAC 3CCVA 2RHSB 4DV1Q 4DR1L 2PI2A 1YHQA 5IE8A 5C3EH 1MIUA 2KHJA 4Y52H 1XTDA 1IBMQ 4FDBA 1CUKA 4MZ9A 2JE6I 3GTMH 3U4ZA 3PSIA 2VQFQ 2B3GA 4O0AA 1L1OC 4KHZA 3GD7A 2D62A 4DR4L 2N8NA 4X62L 1EOVA 3HFZB 4DUYL 4RG1A 1BVSA 2IX0A 1NMFA 2EQSA 3UE0A 4Y7NH 3PIPA 1YHBA 2HQLA 2CFMA 4JYAQ 2IT1A 3F8TA 4LFCL 3HOXH 4BY1H 1VQ9A 2VS1A 3NBHB 3J7A5 4BY7G 2QGQA 4L5QA 1EWIA 2RCNA 3AEVA 1HZCA 1A62A 1G51A 3S17H 1S40A 1CSPA 3ERSX 3NEMA 2EXDA 3JAMi 4LFBQ 1UE5A 4GS3A 2ZTDA 5IWAL 4LF9L 1Q12A 1AH9A 4BA1I 4MNOA 3KFUA 2ALYB 1HZAA 2HIXA 2CCZA 2ES2A 1NE3A 1CKNB 4IPGA 2R93H 1W2BA 2R6GA 4DV1L 2KBNA 3PUYA 2OTJA 1E1TA 1JE5A 3PUWA 1UE6A 1X6OA 4IJHA 3KDFB 1PH5A 4MTNA 1V43A 1IBML 3H0GH 3G6EA 3M3YH 1EFWA 3MEFA 2PI2E 3W5OA 3FP9A 1K73C 1L1OA 1ASZA 1Q1EA 3CPFA 4PZ8A 2K14A 1PH4A 4GKKQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 Q;  4DV7 L;  5C44 G;  2YTV A;  4IFD I;  1CKM A;  4BBS H;  3FKI G;  3ER0 A;  2Q2U A;  2YTY A;  4YY3 Q;  3LGJ A;  1Z9F A;  3HOU G;  3NEN A;  2YV5 A;  1K3R A;  4BXX H;  4B3R L;  2BA1 A;  4JC0 A;  4DUZ Q;  2R92 G;  1IBL Q;  1I5F A;  5M5W H;  3DM3 A;  2UU9 Q;  3S1R H;  2HT1 A;  1OXS C;  2F4V Q;  4IOA A;  1Q7Y C;  3M4O H;  1UE1 A;  3ULP A;  3OYY A;  4A93 G;  5IY0 A;  2VUM G;  5GAG C;  4LFB L;  3I4M G;  1SE8 A;  5E7N A;  3AYH B;  3GDE A;  1KRS A;  2Y0S E;  1MJE A;  4HJ8 A;  4R4T A;  3F2B A;  1YI2 A;  1X3F A;  1A8V A;  2L15 A;  3CXC A;  1U5K A;  4IO9 A;  1EIF A;  1SFO H;  2JA5 H;  1WCM H;  2B63 H;  4DR7 Q;  2ZTE A;  3BU2 A;  1JJG A;  1VQH A;  2AKW B;  3I7F A;  4DV2 Q;  3T1Y Q;  1N36 L;  3GTO H;  1JB7 A;  3MXN B;  1XMQ L;  3HOY G;  4A75 A;  2GVA A;  1PH6 A;  5C4X H;  1HNX Q;  1KQS A;  4DV5 Q;  4LF5 Q;  4YY3 L;  4GLV B;  4JG2 A;  4A3E G;  3I56 A;  4JI7 Q;  1O7I A;  3STB C;  1VQO A;  3CCR A;  3J81 c;  1HNZ L;  2Q2I A;  3PUX A;  5FLM H;  3UDI A;  4LF8 L;  5BR8 L;  1Y1V H;  3PV0 A;  2ATW A;  4AH6 A;  1YJN A;  1HZB A;  4K0K L;  3PO2 G;  4DR1 Q;  4KI0 A;  2A8V A;  2IHE A;  3S2H H;  4OWX B;  1XPO A;  5C0X I;  1C0A A;  2VNU D;  5M3M G;  3H3V H;  1PH9 A;  1B8A A;  1VQL A;  3M85 A;  3A5U A;  5IYB G;  3UDG A;  5M3F H;  4C3H H;  5C4J H;  4X65 L;  4QQB X;  3I55 A;  1R9T H;  1PFS A;  1QUQ B;  5JEA G;  4X62 Q;  2EIF A;  4HJ9 A;  3TS0 A;  3ICE A;  1P16 A;  2BH8 A;  3A0J A;  2E8G A;  4DUY Q;  2OQK A;  1M1K C;  4NXN Q;  1N33 L;  4DV2 L;  3T1Y L;  5LMN Q;  3S24 A;  3VDY A;  1QVG A;  2KCT A;  5FJ8 H;  2VY3 A;  1I94 L;  4LFC Q;  4R4Q A;  1RL2 A;  1WYD A;  2WAQ G;  3E9H A;  3CPW A;  1HNX L;  1A0I A;  4GOP C;  2IX1 A;  2R7Z G;  1X56 A;  3RLF A;  1NTG A;  1V9P A;  3JC6 6;  4A3B H;  4GLX A;  4HIM A;  3JAM c;  3W1G A;  1Q86 C;  1X55 A;  4GN3 B;  3KOJ A;  4GLA C;  3UE1 A;  5IWA Q;  3KJO A;  1N34 L;  2AHO B;  2NN6 G;  4LWC A;  1PH8 A;  1VQ8 A;  4LF9 Q;  4JBM A;  1XMO Q;  1X3G A;  4P75 A;  1Y1W G;  3U50 C;  1YZ6 A;  4BBR H;  3G71 A;  3A5Z B;  1A63 A;  1VQ4 A;  3Q8D A;  4R4I A;  2QA4 A;  1VQ5 A;  4HJA A;  2D0O A;  3CW2 C;  5JEA J;  4AQY Q;  4A3F G;  1YEZ A;  3CCJ A;  4A3M G;  1KRT A;  4H02 A;  4JI0 L;  2XTI A;  1YBY A;  2LXJ A;  2JA6 G;  2JA7 G;  4DV7 Q;  1FJG L;  1S72 A;  4GKJ L;  3RN5 A;  1SRU A;  2C35 B;  5IYD H;  1FL0 A;  4P73 A;  4NXN L;  1WOC A;  4YWK A;  4GNX A;  5JJK A;  4RMF A;  2A1A A;  2CWP A;  3CMA A;  4HJ7 A;  5LMN L;  1E1O A;  1N8R C;  4DV3 Q;  4B3M Q;  2R92 H;  1B7Y B;  1PVO A;  3CCL A;  4B3R Q;  4A3I H;  2NZH A;  1XNQ L;  4GOP A;  1ASY A;  1KD1 C;  1KAW A;  4A3G H;  3K0X A;  3HOV G;  4UPA A;  3RZO H;  1NJI C;  2UXD L;  4A3K G;  3M7N A;  1YJW A;  3CF5 A;  4LNQ A;  1BKB A;  2A19 A;  1OXU A;  1N32 L;  3RLN A;  1UWV A;  2LSS A;  1K9M C;  5M5X H;  3H3V I;  1VQM A;  2H5X A;  1C9O A;  4DR2 Q;  1EQR A;  4QY7 A;  1XMO L;  3F2C A;  4JI4 L;  2YTX A;  4IPD A;  3HKS A;  2I0Q A;  5IYC H;  3T1H L;  3ULL A;  1P8L A;  1HR0 L;  3AQQ A;  4GN5 A;  3CCQ A;  4DV6 L;  4X6A H;  3K81 C;  4AQY L;  2JA8 H;  2UUB L;  4JOI C;  2PQA B;  3TRZ A;  1YIJ A;  5IP9 G;  3E0E A;  5LMN W;  3KF6 B;  1N36 Q;  5J3B A;  1XMQ Q;  2K5V A;  4JI3 L;  1KHI A;  4DAY B;  4A3J G;  3M9B A;  4J15 A;  1VQJ A;  4LW1 A;  2ZJP A;  3HOW H;  3K7U C;  2JEA I;  4HJ5 A;  2B29 A;  4P74 A;  3ZJY C;  4QGU A;  5ELN A;  1VS0 A;  2JEB I;  1Q46 A;  4DV3 L;  1LUZ A;  1YJ9 A;  4B3M L;  4WJ3 M;  3BJU A;  3EIV A;  4UP9 A;  4DK3 C;  1GM5 A;  3K7A H;  4ME3 A;  1HNZ Q;  4LF8 Q;  2Y0S G;  2VW9 A;  5BR8 Q;  2QEX A;  1X54 A;  4A3L G;  3CCU A;  3RN2 A;  1PYS B;  1J6Q A;  4K0K Q;  5C3E G;  1M90 C;  4GNX B;  4JI8 L;  1HR0 W;  1TWC H;  4LUV A;  1PV4 A;  1QVF A;  5IYB H;  4EQ5 A;  4APV A;  4A3C H;  4DR2 L;  4L5R C;  4BA2 I;  4NB3 A;  5H1S E;  2Q2T A;  4AYB G;  4WJ4 A;  2PMZ E;  2E5L Q;  4DR6 Q;  4X65 Q;  1VQB A;  2NVY H;  2CKZ B;  2XGT A;  4IFD J;  5AJ3 L;  2MFI A;  3UDF A;  1N33 Q;  1BBU A;  1W3S A;  3GTL H;  4JI5 L;  3S1Q H;  1X65 A;  2R7F A;  1OXT A;  1X3E A;  2VZA A;  1VQD A;  5M5Y H;  1TWF H;  1PH1 A;  1I94 Q;  4BY1 G;  3OTO Q;  1TWH H;  5FLX c;  2R7D A;  2ZTC A;  3E9I A;  1T9H A;  4QL5 A;  5LMU L;  1GO3 E;  1VQP A;  3CC4 A;  1PH3 A;  2F52 A;  4POG A;  3G48 A;  2JQO A;  1HZ9 A;  3HOZ H;  4JI1 L;  3J81 j;  2NVX H;  2I5L X;  3STB D;  1I3Q H;  3RR5 A;  1HNW L;  1N34 Q;  3M4Q A;  1L1O B;  5IP7 H;  4POF A;  2E2J H;  4OX9 L;  3GO5 A;  4UY8 C;  5ELO A;  1NMG A;  2R93 G;  4R1J A;  2K50 A;  3PUV A;  1GVP A;  1JJ2 A;  3KJP A;  1EUJ A;  4PZ7 A;  1WJJ A;  2AWO A;  2ZM6 L;  2OCE A;  3K8A A;  5C0X G;  4LF4 L;  2N49 A;  3H0G G;  1KC8 C;  1FGU A;  3PO3 G;  1C7Y A;  3S1M H;  1GD7 A;  3L7Z C;  2VQE L;  4LFA L;  2V1C C;  1YNX A;  2N78 A;  4IPC A;  3HKZ G;  1VQG A;  4YHH L;  3GTJ H;  4JI6 Q;  2E5L L;  4JI0 Q;  3CP0 A;  4DR6 L;  4JBW A;  1FJG Q;  4GKJ Q;  1VQC A;  4BBS G;  2Z6K C;  5JJL A;  3EN2 A;  4OO1 I;  1L0W A;  4BY7 H;  1OXV A;  3OTO L;  2ASB A;  3UDX A;  3KLW A;  3TRE A;  4DR5 Q;  1XNQ Q;  3S1N H;  2UXB L;  3CME A;  4A3K H;  1VQI A;  2WB1 G;  1PYB A;  2K5H A;  2VL6 A;  3CCE A;  1HH2 P;  1IBK L;  1E7Z A;  2GN5 A;  4JCV E;  3D31 A;  2UUC L;  2UXD Q;  1D8L A;  2E2H H;  2OTL A;  4X66 Q;  1OXX K;  1XPU A;  3BZK A;  2ZJR A;  1N32 Q;  2N3S A;  5GAD C;  5C0X J;  1JMC A;  1J5E L;  4P72 A;  1SN8 A;  2HHH L;  1VQN A;  1SR3 A;  2K52 A;  4YCW A;  4JI2 Q;  4UP8 A;  4KLK A;  1DGS A;  4JI4 Q;  1IL2 A;  4A3D G;  2K75 A;  3T1H Q;  1HR0 Q;  2UUA Q;  4DV6 Q;  2MO0 A;  2Z0S A;  3U58 A;  5K36 G;  2JA5 G;  1WCM G;  2AMC B;  4PG3 A;  1E24 A;  3CC7 A;  1K8A C;  5DLQ E;  1UEB A;  3RLO A;  2UUB Q;  1VQF A;  1PHJ A;  1CKN A;  4YWL A;  1VCI A;  3RNU A;  1I6H H;  4DV4 L;  4B3S L;  5C44 H;  4JI6 L;  4QJF A;  4JI3 Q;  1OTC A;  2CQO A;  3FKI H;  2Z6K A;  1TWA H;  3KDF A;  4OON A;  5C4X G;  4KHP L;  3HOU H;  5IT9 c;  2JJQ A;  1BBW A;  3J81 i;  4YCU A;  4C3I H;  3G4S A;  3F2D A;  3CCM A;  1G29 1;  3I4N G;  2I5H A;  1XPR A;  4NXM Q;  4DR5 L;  1PH7 A;  2MNA A;  5FLM G;  3OW2 A;  4HID A;  1IYJ B;  1Y1V G;  4JBK A;  4A93 H;  2VUM H;  1AE2 A;  3J80 i;  3S15 H;  4XTC S;  3I4M H;  1Q8K A;  4X66 L;  2Q2H A;  4DK6 C;  4JI8 Q;  3GTQ H;  4NPS A;  4DPG A;  2JA9 A;  4L5S A;  4OWW B;  2OQ0 A;  4JI2 L;  5M3F G;  3PGZ A;  1K0R A;  2UUA L;  2K4K A;  3WWV A;  4HIO A;  3PF4 A;  4EX5 A;  4A3C G;  1D7Q A;  1XNR Q;  1MJC A;  5AJ3 Q;  1XJV A;  3HOY H;  4IJL A;  1I50 H;  4JI5 Q;  3AFP A;  5FJ8 G;  3I2Z A;  3CD6 A;  4LF7 Q;  4IPH A;  1CSQ A;  4A3E H;  2MO1 A;  4LUO A;  3F1Z A;  5LMU Q;  4A3B G;  4IFD G;  3KF8 B;  2MQH A;  3I4O A;  1HJP A;  2KEN A;  1VQK A;  3K80 C;  2FXQ A;  3L0O A;  4JI1 Q;  4DV0 L;  1CKO A;  4NXM L;  2I5M X;  1FVI A;  1HNW Q;  1SLJ A;  1NBW A;  4A76 A;  4OX9 Q;  2BH2 A;  2GVB A;  2DUD A;  1QZG A;  1WFQ A;  4BBR G;  3PO2 H;  5JJI A;  1TXY A;  3CCS A;  5M3M H;  3L2P A;  1SMX A;  2RF4 A;  3PO3 H;  2DGY A;  4R4C A;  2ZM6 Q;  4LF4 Q;  1Y14 B;  4P71 A;  2OWO A;  2VQF L;  3SGI A;  1IZ6 A;  1UE7 A;  1YVC A;  2VQE Q;  4LFA Q;  4GOP B;  1AE3 A;  2YU9 H;  1G6P A;  4YHH Q;  2UXC Q;  3D0F A;  3W1B A;  2WP8 J;  4C2M H;  4JOI A;  4PMW A;  5IYD G;  1TWG H;  1XNR L;  4JYA L;  4YWM A;  4X64 Q;  4OO1 G;  1Q1B A;  2NVT H;  3A74 A;  2IY5 B;  3PCO B;  3RZD H;  3HOX G;  1K83 H;  2JK8 A;  4A3I G;  4LF7 L;  2R7Z H;  3IRB A;  1QUQ A;  2E2I H;  4A3G G;  2UXB Q;  1KXL A;  1YIT A;  3CQZ H;  1IBK Q;  3J7Z C;  1K8G A;  2KHI A;  1PH2 A;  2UUC Q;  1Q81 C;  3S16 H;  4B3T Q;  1SRO A;  1Y1W H;  1E22 A;  1J5E Q;  4A3D H;  2HHH Q;  2RHQ B;  3TQY A;  4GN4 B;  3B6Y A;  2KCM A;  4PZ6 A;  1Z47 A;  1YHA A;  4QIW E;  1QVC A;  4TVA B;  5IYC G;  4A3F H;  1KL9 A;  1L2F A;  4A3M H;  1GKH A;  1JJC B;  2IHF A;  2JA8 G;  3GTG H;  2ID0 A;  5EAY A;  4AYB E;  1JT8 A;  3GTP H;  4GKK L;  4LF6 L;  2NZO A;  2JA6 H;  2JA7 H;  4DV4 Q;  1V1Q A;  3AFQ A;  4B3S Q;  2UXC L;  2ZJQ A;  1X9N A;  3HOW G;  2WFW A;  5GRO A;  1WI5 A;  1N9W A;  4OXP A;  4KHP Q;  1E3P A;  2D0P A;  4X64 L;  4DR3 Q;  4R4O A;  4JV5 Q;  1RIP A;  3I4N H;  1VQE A;  4DUZ L;  1KIX A;  4L5T A;  1IBL L;  1NY4 A;  3TS2 A;  1EIY B;  2AWN A;  2UU9 L;  4BXX G;  3HOV H;  2F4V L;  3S2D H;  1IXR A;  4UP7 A;  3J80 c;  3CAM A;  2LXK A;  2YYZ A;  4OWT B;  3BZC A;  3PUZ A;  2F3I A;  4A4I A;  1EQQ A;  4B3T L;  1Q82 C;  1MKH A;  4O2D A;  1VQ6 A;  1LM0 A;  2NVQ H;  5HGQ A;  5GAE C;  4DNI A;  1VQ7 A;  3U4V A;  1QZH A;  4DR4 Q;  2K5N A;  3PIO A;  1U0L A;  3GTK H;  4DR7 L;  3NEL A;  3CC2 A;  1H95 A;  3TEH B;  4GNX C;  5IP9 H;  2B63 G;  4C3J H;  3HKZ E;  2BA0 A;  4HIK A;  3EBE A;  1PA6 A;  3FHW A;  4XIG S;  3M4P A;  3H15 A;  4A3J H;  2HIV A;  4IOC A;  4TQU S;  4AIM A;  4DV5 L;  4LF5 L;  4DAM A;  4ALP A;  3PF5 A;  3KYH C;  4JI7 L;  3ULJ A;  4DR3 L;  5GAH C;  2PQA A;  1S3O A;  4JV5 L;  2PNH A;  1B70 B;  1VQA A;  1LYL A;  3KF6 A;  5HY6 A;  3HOZ G;  1LTL A;  2WAQ E;  2NN6 I;  3DLL A;  4DV0 Q;  2WB1 E;  2CWA A;  1EYG A;  4LUZ A;  5GQO A;  4JBJ A;  3S14 H;  4A3L H;  4YCV A;  5IP7 G;  4DKA C;  3CCV A;  2RHS B;  4DV1 Q;  4DR1 L;  2PI2 A;  1YHQ A;  5IE8 A;  5C3E H;  1MIU A;  2KHJ A;  4Y52 H;  1XTD A;  1IBM Q;  4FDB A;  1CUK A;  4MZ9 A;  2JE6 I;  3GTM H;  3U4Z A;  3PSI A;  2VQF Q;  2B3G A;  4O0A A;  1L1O C;  4KHZ A;  3GD7 A;  2D62 A;  4DR4 L;  2N8N A;  4X62 L;  1EOV A;  3HFZ B;  4DUY L;  4RG1 A;  1BVS A;  2IX0 A;  1NMF A;  2EQS A;  3UE0 A;  4Y7N H;  3PIP A;  1YHB A;  2HQL A;  2CFM A;  4JYA Q;  2IT1 A;  3F8T A;  4LFC L;  3HOX H;  4BY1 H;  1VQ9 A;  2VS1 A;  3NBH B;  3J7A 5;  4BY7 G;  2QGQ A;  4L5Q A;  1EWI A;  2RCN A;  3AEV A;  1HZC A;  1A62 A;  1G51 A;  3S17 H;  1S40 A;  1CSP A;  3ERS X;  3NEM A;  2EXD A;  3JAM i;  4LFB Q;  1UE5 A;  4GS3 A;  2ZTD A;  5IWA L;  4LF9 L;  1Q12 A;  1AH9 A;  4BA1 I;  4MNO A;  3KFU A;  2ALY B;  1HZA A;  2HIX A;  2CCZ A;  2ES2 A;  1NE3 A;  1CKN B;  4IPG A;  2R93 H;  1W2B A;  2R6G A;  4DV1 L;  2KBN A;  3PUY A;  2OTJ A;  1E1T A;  1JE5 A;  3PUW A;  1UE6 A;  1X6O A;  4IJH A;  3KDF B;  1PH5 A;  4MTN A;  1V43 A;  1IBM L;  3H0G H;  3G6E A;  3M3Y H;  1EFW A;  3MEF A;  2PI2 E;  3W5O A;  3FP9 A;  1K73 C;  1L1O A;  1ASZ A;  1Q1E A;  3CPF A;  4PZ8 A;  2K14 A;  1PH4 A;  4GKK Q; 
#chains in the Genus database with same CATH topology
 4LF6 Q;  1CFM A;  2J7Z A;  1IBL Q;  2UU9 Q;  4ME5 A;  2HT1 A;  3M4O H;  4A93 G;  1EY6 A;  3P20 A;  4K8I A;  4O42 A;  2XWJ B;  5E7N A;  5C44 B;  2LS0 1;  1KRS A;  3FKI B;  5EKL A;  4DXG A;  1TWA B;  3L3O C;  4R4T A;  5HGT A;  4C3I B;  4X3S A;  2B63 H;  4IO9 A;  1EIF A;  2JA5 H;  2ZTE A;  3BU2 A;  1VQH A;  2VUM B;  1N36 L;  1JIC A;  3I4M B;  2GVA A;  2RDF A;  4QIW B;  5EKI A;  1A15 A;  1PH6 A;  5C4X H;  3GTQ B;  1KQS A;  2AQ1 B;  3BZD B;  3NQT A;  4YY3 L;  4JG2 A;  4A3E G;  3P7J A;  4FYD A;  1HFG A;  3M4Y A;  4LJZ C;  3UDI A;  5BR8 L;  1Y1V H;  2ATW A;  4CDC C;  4HSP A;  3HOY B;  4K0K L;  1EOT A;  3S2H H;  2A8V A;  4HED A;  1XPO A;  2VNU D;  1S5F D;  3H3V H;  3A56 A;  1B8A A;  4G7H C;  3M85 A;  1Y8N B;  4RFB A;  1Y8O B;  3GP7 A;  2TMP A;  1WTV A;  1XX8 A;  2QDL A;  1R9T H;  1QUQ B;  3TS0 A;  1N33 L;  2E8G A;  3MEH A;  1KAA A;  2KCT A;  5FJ8 H;  1QNU A;  3ND8 A;  2EYL A;  2J0T D;  3E9H A;  5M3M B;  3CPW A;  1HNX L;  2F0H A;  1A0I A;  2IX1 A;  1EWH A;  1X56 A;  3RLF A;  4A3B H;  3JC6 6;  4HSV A;  2DJF C;  3JAM c;  1Q86 C;  2B2T A;  5T1I A;  1N34 L;  2NN6 G;  1SNC A;  4C2M B;  1X3G A;  3U50 C;  1YZ6 A;  3ITP A;  4FF4 A;  2F0E A;  3I70 A;  2WII B;  1A2T A;  4R4I A;  4FNF A;  3RZD B;  3MVV A;  2NYZ D;  3IFT A;  2E2I B;  4OL7 A;  2PPB C;  1C48 A;  2K6A A;  2JA7 G;  4GKJ L;  4H7B A;  1WOC A;  4GNX A;  1Y1W B;  1HPC A;  1FNU A;  5LMN L;  1D6E C;  2R92 H;  4NDX A;  2Z9H A;  3H6M A;  4B3R Q;  1LT6 D;  4A3F B;  1QWY A;  3HOV G;  1NJI C;  3GTG B;  3M7N A;  5CMD A;  4MHE A;  3D8G A;  2GA4 B;  1OXU A;  5DEH A;  3OWF A;  1VQM A;  2H5X A;  4DA2 A;  3C46 A;  1EQR A;  2F3V A;  3NHH A;  1TR5 A;  1EEI D;  4HN7 A;  2YTX A;  1IW7 C;  4JI4 L;  2EJM A;  1KAB A;  3CCQ A;  3K81 C;  2M9V A;  4AQY L;  1EYD A;  4KY5 A;  1VF7 A;  3BG3 A;  1YIJ A;  3EVQ A;  3E0E A;  2LFN A;  3KF6 B;  4C3J G;  5LMN W;  1XMQ Q;  4A3J G;  3X3N A;  4DAY B;  2ZJP A;  3HOW H;  4MN3 A;  2JEA I;  2WKC A;  4QGU A;  5ELN A;  1PRT C;  1PZJ D;  1VS0 A;  1Q46 A;  4DV3 L;  2NVQ B;  3BJU A;  4DK3 C;  4C3I G;  1HNZ Q;  3R3O A;  1JWU D;  1HQM C;  5D65 A;  1PYW D;  5C3E G;  4GNX B;  1KNA A;  2XRS D;  4XDX A;  5IYB H;  4EQ5 A;  3P75 A;  4BA2 I;  4L5R C;  5H1S E;  4DR6 Q;  5DNF A;  4X65 Q;  3J80 L;  3K58 A;  4K6L A;  2MJ8 A;  4KJN A;  3GTL H;  3S1Q H;  1BBU A;  5M5Y H;  3V05 A;  1NNX A;  3E9I A;  2KJX A;  5A2Q E;  1GO3 E;  4POG A;  4B9X A;  2G9D A;  4ODG A;  5J22 A;  3STB D;  3DWP A;  1K8M A;  3M4Q A;  1L1O B;  1X3P A;  4OX9 L;  3GO5 A;  1NMG A;  3HGB A;  2EYF A;  1JJ2 A;  5JVG 3;  1U4L A;  3F2U A;  3DMU A;  2Z6B A;  5C0X G;  4LF4 L;  1S5B D;  2N49 A;  3PO3 G;  3HZX A;  4LFA L;  2N78 A;  4IPC A;  3HKZ G;  3GTJ H;  1KNE A;  4QMG A;  2E75 C;  2RQX A;  3J81 E;  4PQX A;  1MHW C;  2R93 B;  3E3X A;  4BY7 H;  3TME A;  3NUC A;  3KLW A;  3SK5 A;  3TRE A;  4DR5 Q;  2F0J A;  4BS9 A;  2WB1 G;  3CCE A;  1G2S A;  2GN5 A;  3D31 A;  2NZ1 D;  2UXD Q;  2HDM A;  1F9S A;  1XPU A;  2YU9 B;  5GAD C;  5C0X J;  1JMC A;  4P72 A;  1NAP A;  3H94 A;  2HCI A;  3HG9 A;  1SR3 A;  1I4X A;  4UP8 A;  1CZG A;  2UUA Q;  5M5W B;  2EY5 A;  3OIP A;  2JA5 G;  1E24 A;  1K8A C;  1TVX A;  3N52 A;  2IPK D;  4JI6 L;  2EPB A;  3QOL A;  2E76 C;  2Z6K A;  4OON A;  1EYC A;  5C4X G;  3VYT A;  5IT9 c;  1HRJ A;  1GUS A;  2PW7 A;  3CCM A;  1G29 1;  3VYU A;  2HUG A;  1RCV D;  2F0Q A;  1WTO A;  1Y1V G;  1OO9 B;  3J80 i;  3GTO B;  1Q8K A;  2Q2H A;  1PRT F;  3RMH A;  3DEO A;  5IOC A;  1EU4 A;  5AFW A;  4V19 0;  3O13 A;  3I4N B;  3WWV A;  5AJ3 Q;  1XJV A;  2D5D A;  2EJF C;  5FJ8 G;  3TP6 A;  2K04 A;  1DXM A;  1CZW A;  1TQO A;  4NMZ A;  5LMU Q;  4A3B G;  2KEN A;  5M3F B;  4C3H B;  4DV0 L;  4JI1 Q;  1SLJ A;  4IUU A;  2OT2 A;  2PZU A;  3PO2 H;  1WFQ A;  2H1E A;  3DWQ A;  5JJI A;  1MBY A;  3L2P A;  4E6I A;  2ZM6 Q;  1WTX A;  4K6D A;  2VQF L;  4O1N A;  1V8Q A;  1ZKO A;  3SGI A;  1YVC A;  1UE7 A;  2JXM B;  1K8O A;  3T53 B;  3Q24 A;  4JOI A;  4JPB W;  2RVL A;  3SEB A;  1QIL A;  3PCO B;  3BDO A;  4LF7 L;  2RSO A;  3GV6 A;  1PTO D;  3J7Z C;  2KHI A;  1PH2 A;  5FO8 B;  1U4M A;  1BXT A;  5EGT A;  1E22 A;  1J5E Q;  2RHQ B;  3A7L A;  2HCC A;  5CBA E;  1K3B C;  4EGV A;  5TSS A;  2F03 A;  2K32 A;  4TVA B;  4XQQ A;  5FLX E;  4A3M H;  5EQ0 A;  4AYB E;  4LF6 L;  2JA6 H;  2ZT9 C;  3AFQ A;  2B8F A;  4IQZ A;  2UXC L;  3HOW G;  5GRO A;  4OXP A;  4X64 L;  1VQE A;  4R9W A;  2B2T C;  1KIX A;  4V0B A;  4L5T A;  1IBL L;  1NY4 A;  3BVG A;  2AWN A;  3OW7 A;  2UU9 L;  1IYV A;  3S2D H;  1H9S A;  1BOS A;  1IXR A;  2A6E C;  4UP7 A;  2YYZ A;  4OWT B;  2B2U A;  3BZC A;  1VF5 C;  3KLR A;  4A4I A;  3OWE B;  1MKH A;  2V4D A;  1DZ1 A;  2CH4 A;  2BE5 C;  5I4D A;  2CW0 D;  4G7Z C;  4GNX C;  1FR3 A;  3D6C A;  5IP9 H;  4RGO S;  1JB3 A;  4HIK A;  3EBE A;  1PA6 A;  1O80 A;  5C5M A;  1TWC B;  4C1N K;  3JAM E;  4DAM A;  2F0T A;  3E5S A;  1B70 B;  3DLL A;  4B9W A;  1EYG A;  5GQO A;  3S14 H;  2RHS B;  2PI2 A;  3J7A V;  1ESR A;  4UAI A;  1MIU A;  2BDN A;  1TWH B;  3A8K E;  5JOB A;  4MZ9 A;  2JE6 I;  3GQB A;  3PSI A;  5DAU A;  1L1O C;  5FO9 B;  3HOZ B;  2NVX B;  1CTM A;  1I3Q B;  4RG1 A;  2K05 A;  1NMF A;  3TZD A;  5I2Y A;  1YHB A;  2HQL A;  1VQ9 A;  2VS1 A;  4BY7 G;  2F0N A;  4U67 3;  3NXW A;  1A62 A;  1G51 A;  1ONL A;  2EYP A;  3S17 H;  3A8I E;  2P5Z X;  3KFU A;  3SK4 A;  4HAE A;  4H44 C;  2R6G A;  4EVO A;  5D14 A;  2OTJ A;  1JE5 A;  1I6V C;  3DM1 A;  1DOL A;  1B2T A;  4FXG C;  2IWH A;  3H0G H;  3G6E A;  3S1N B;  1EFW A;  3K5N A;  2PI2 E;  3FP9 A;  2ZXR A;  4I7Z C;  2A6H C;  5CV6 A;  1O7Y A;  4DN4 M;  3K57 A;  2YTY A;  5KYI A;  1BO0 A;  4B3R L;  1QE6 A;  2PMZ B;  4X6A H;  1OXS C;  1Q7Y C;  1T5X D;  3ULP A;  2H4O A;  4LFB L;  4RGT A;  1SE8 A;  1I6H B;  2ENB A;  3AYH B;  3GDE A;  1EWC A;  1LO5 D;  4EQN A;  3F2B A;  1YI2 A;  2IX3 A;  1A8V A;  1SFO H;  4DR7 Q;  2AQ3 B;  3URY A;  4A93 B;  2JSO A;  4DV2 Q;  3T1Y Q;  3S15 B;  1XMQ L;  2B2V A;  4A75 A;  5E4W C;  4RKL A;  1LT5 D;  1TU2 B;  5ISR A;  4DV5 Q;  1ILQ A;  4GLV B;  4DK1 A;  2NTS A;  4L6T B;  1RD9 D;  3CCR A;  3J81 c;  1HNZ L;  3PUX A;  2RA4 A;  4R8I A;  1HHV A;  3PO2 G;  1I50 B;  4DR1 Q;  1LLR D;  2IHE A;  2X6L A;  3NE5 B;  1A2U A;  1DYQ A;  3LX0 A;  4A3E B;  3H09 A;  5C4J H;  4X65 L;  4HJ9 A;  4X62 Q;  2C5C A;  3ICE A;  1JOO A;  1HA5 A;  1P16 A;  4NXN Q;  1F9Q A;  2F0O A;  1ZYR D;  4DUY Q;  2RBM A;  3MXG A;  4LFC Q;  2EE1 A;  1WYD A;  2JN4 A;  1O7L A;  5ELD A;  5CBE E;  4XT3 B;  1HXY D;  2PYK A;  4DXF A;  1V1O A;  3FPP A;  4RGM A;  1SND A;  4GN3 B;  3KOJ A;  3UE1 A;  4LF9 Q;  3KJO A;  2AHO B;  4LWC A;  1VQ8 A;  2I46 A;  4JBM A;  2KCC A;  1XMO Q;  1JCK B;  1F2Z A;  3KF8 A;  1AN8 A;  2QA4 A;  5FOB B;  1VQ5 A;  2D0O A;  1K83 B;  3CCJ A;  4A3M G;  3CQZ B;  5M9O A;  3H91 A;  3S16 B;  2JA6 G;  2F0P A;  1SRU A;  2KUM A;  2L0C A;  1FL0 A;  3MWY W;  2TSS A;  4YWK A;  1E1O A;  4B3M Q;  1B7Y B;  2F0L A;  4G4K A;  4DU9 A;  1GUT A;  4GOP A;  3FRP B;  5T1G A;  1ASY A;  1KAW A;  4A3G H;  3Q22 A;  2UXD L;  2EJG C;  4UDU C;  3EFX D;  2A19 A;  2JA7 B;  3RLN A;  1K9M C;  3C1F A;  4CJ1 B;  4H13 C;  5M5X H;  2R61 A;  2JP1 A;  4FP5 D;  4KTA A;  4IPD A;  3HKS A;  1NR4 A;  3ULL A;  1P8L A;  3AQQ A;  4GN5 A;  3HOV B;  4JOI C;  2F0G A;  3ND9 A;  2KOL A;  5IP9 G;  1VMP A;  2B2Y C;  1VQJ A;  4LW1 A;  1EU3 A;  3K7U C;  2B29 A;  3IAY A;  2F4I A;  4R8N A;  5A35 A;  1AW7 A;  2JEB I;  2XSC A;  2A5H A;  4UP9 A;  1GM5 A;  3GTK B;  3QO2 A;  4LF8 Q;  2VW9 A;  1R4Q B;  4C3J B;  2EY2 A;  1J6Q A;  4A3J B;  1M90 C;  2K01 A;  3VR4 A;  5BN3 A;  3MAQ A;  4PV1 C;  5ELF A;  1SE4 A;  4DR2 L;  4F88 A;  3I91 A;  1WTR A;  2KHS A;  4WJ4 A;  1STH A;  3OPO A;  5E4X A;  4IFD J;  5AJ3 L;  4OO1 I;  1W3S A;  1X65 A;  2R7F A;  1OXT A;  5CV7 A;  5C3E B;  1TWF H;  1I94 Q;  4XYQ A;  5FLX c;  2R7D A;  2ZTC A;  1T9H A;  4ZKB B;  4QL5 A;  2RKS A;  5LMU L;  3CC4 A;  2KEE A;  1PH3 A;  2LKV A;  3G48 A;  1PTO H;  1HZ9 A;  4JI1 L;  3J81 j;  2I5L X;  3RR5 A;  1E2Z A;  4KD3 A;  5IP7 H;  2Z4I A;  5ELO A;  1LTG D;  2DNC A;  2K50 A;  5C3W A;  2FFK B;  2WKD A;  1EUJ A;  3KJP A;  1X32 A;  3AMU A;  2AWO A;  2ZM6 L;  1STN A;  1EY9 A;  3H0G G;  1KC8 C;  2QKI C;  4CBV A;  1GD7 A;  3K0Y A;  2FJ2 A;  2E5L L;  4JI0 Q;  1SNO A;  4XQJ A;  4JBW A;  1EZ8 A;  5JJL A;  4EQO A;  2LMC B;  4RHS A;  4XYO A;  1OXV A;  3OTO L;  2ASB A;  3CME A;  4A3K H;  1VQI A;  1PYB A;  3PO3 B;  4JCV E;  1SBB B;  1ESF A;  3HKZ B;  2OTL A;  1OXX K;  1PXU A;  1W6J A;  1N32 Q;  1J5E L;  4DNR B;  1F9R A;  3W2D A;  4YCW A;  2K52 A;  5C5L A;  1SAP A;  1Y69 U;  4A3D G;  2MHV A;  1IL2 A;  2MO0 A;  2WB1 B;  2AMC B;  3M4O B;  3NPP A;  3RLO A;  1JOR A;  1VQF A;  1GJX A;  4YWL A;  1VCI A;  3RNU A;  2F3W A;  1D1K A;  4QJF A;  4JI3 Q;  2QW7 A;  2X6G A;  5CV9 A;  3HOU H;  1TY2 A;  1LTT D;  2JJQ A;  1BBW A;  3J81 i;  3F2D A;  4NXM Q;  4J6H A;  1Y8P B;  2MNA A;  2EY1 A;  2K28 A;  2JA5 B;  1IYJ B;  4JBK A;  2XVS A;  1V1P A;  1DCZ A;  3RUZ A;  1I4H A;  3DHQ A;  1KDC A;  1UAP A;  4X66 L;  1PMR A;  4DK6 C;  4JI8 Q;  5C4X B;  1HUM A;  4Q5V A;  1D5X C;  2SEB D;  4JI2 L;  1WD1 A;  1I4G A;  4L8J A;  1HTP A;  2XNA C;  1Y1V B;  2RCF A;  3A54 A;  2L12 A;  4HIO A;  3PF4 A;  1D7Q A;  1I4R A;  2EYH A;  1CSQ A;  4I7A A;  3I72 A;  4ZCK A;  2MQH A;  1HJP A;  1PRT D;  2ICI A;  3L0O A;  3MXN A;  3KUP A;  1EFI D;  1R9T B;  1FD7 D;  3NQI A;  2G9H D;  1QZG A;  1EL0 A;  5EPJ A;  1AZQ A;  1VDZ A;  3VYS A;  3CCS A;  2L1B A;  4XQN A;  1SMX A;  2F0F A;  3VR3 A;  4A3B B;  4QUF A;  4ULL A;  1IZ6 A;  2VQE Q;  4IUV A;  2YU9 H;  1V1P B;  5EPK A;  2K33 A;  4PMW A;  1TWG H;  1XNR L;  4YWM A;  3S9W A;  1WTH A;  2NVT H;  1C8C A;  3HOX G;  2R7Z H;  3HEJ A;  3IRB A;  1ENA A;  4A3G G;  1YIT A;  3VR5 A;  2PNR C;  1IBK Q;  1BR9 A;  2UUC Q;  1Q81 C;  3OMC A;  2MP1 A;  4B3T Q;  1J8I A;  4PMB A;  1LT3 D;  1BF4 A;  3G7L A;  2R92 B;  1HCZ A;  3B6Y A;  4PZ6 A;  1Z47 A;  1YHA A;  4X3K A;  1B9N A;  3N6R A;  3JAM L;  1L2F A;  2CVR A;  1GKH A;  1ZXT A;  2IHF A;  1PLF A;  3GTP H;  2NZO A;  2F0V A;  4DV4 Q;  1JWS D;  4B3S Q;  3MFG A;  4F8M A;  4FF2 A;  2D0P A;  4N8X 1;  1RIP A;  3I4N H;  4G7O C;  1M4V A;  3TS2 A;  5C4H A;  1EIY B;  1S5D D;  1SEB D;  1LTI D;  1RTO A;  1JQY D;  5C3X A;  5I6W A;  3MC0 B;  4RWS C;  2Q8R E;  3HOW B;  5KYL A;  2EYO A;  2F0U A;  1DOM A;  2K7V A;  2Q8T A;  4DNT B;  4NP5 A;  4DR4 Q;  3DXJ C;  3TBI B;  4K5W A;  4DR7 L;  4TKO B;  2B63 G;  4IUR A;  2BA0 A;  3M4P A;  3SXH A;  4B08 A;  4TQU S;  2AUJ D;  4DV5 L;  2L55 A;  4QF4 A;  4ALP A;  2PO4 A;  3ULJ A;  1QNK A;  1SYG A;  5GAH C;  2PQA A;  1S3O A;  5EBC A;  4CHT B;  2PNH A;  1RF2 D;  4DR3 L;  1VQA A;  3EQL C;  4JV5 L;  1LYL A;  1LTL A;  2WAQ E;  2NN6 I;  2CWA A;  2ZXO A;  5IP7 G;  3GTL B;  3S1Q B;  3LWU A;  1EYA A;  1KDA A;  4DGZ A;  2CH4 W;  4DV1 Q;  4DR1 L;  3SK6 A;  5IE8 A;  4PMC A;  5M5Y B;  5HUR A;  5CYU A;  5JPM C;  4Y52 H;  2QCP X;  1IBM Q;  2DJG C;  2N8N A;  4X62 L;  4ILW A;  3HFZ B;  4DUY L;  5DM7 3;  1BVS A;  3NWT A;  3UE0 A;  2EQS A;  4Y7N H;  4CJ0 B;  3PIP A;  1SJH D;  2CFM A;  4JYA Q;  2IT1 A;  3F8T A;  4LFC L;  1YNN D;  4BY1 H;  1LAC A;  3P1H A;  2RCN A;  3AEV A;  1HZC A;  2L11 A;  3JAM i;  2EXD A;  2IJ0 A;  2BCO A;  4GS3 A;  2A69 C;  2ZTD A;  3GTJ B;  4LF9 L;  3A7A B;  1ET6 A;  1TS4 A;  1AH9 A;  1DJR D;  4BA1 I;  4MNO A;  2ALY B;  1S5C D;  2HIX A;  3BYY B;  1TS5 A;  2ICE C;  5KNB A;  3PUY A;  2KBN A;  4BY7 B;  4IJH A;  2M00 A;  1B1Z A;  4KY7 A;  3EJI A;  4MTN A;  1V43 A;  3SHL A;  3TDQ A;  3VA7 A;  2ZXP A;  3CPF A;  1OTC A;  3FPU B;  1IKL A;  2WAC A;  4X3T A;  3SK8 A;  4OIJ A;  3ZYY X;  2BOS A;  4M1U B;  1CKM A;  4BBS H;  1GUO A;  4YY3 Q;  5C4Z A;  1Z9F A;  3HOU G;  2B2W A;  3NEN A;  2YV5 A;  1K3R A;  4BXX H;  1CI3 M;  4JC0 A;  1IKM A;  2R92 G;  3V2T A;  4IOA A;  3QWN A;  3S1R H;  2F4V Q;  4ZQ3 A;  1UE1 A;  1WTP A;  5COY A;  3TZU A;  2DY7 A;  3NTK A;  1SNP A;  2Y0S E;  4FO2 A;  1X3F A;  4K5X A;  5IGB A;  3K5M A;  3CXC A;  1WCM H;  1JJG A;  1B3A A;  2AKW B;  3I7F A;  1JB7 A;  2QIL A;  1ZEQ X;  2OF1 A;  5KNC A;  5COR A;  1HNX Q;  1HQR D;  4LF5 Q;  2F0W A;  4JI7 Q;  3Q0A A;  1O7I A;  3D3R A;  1H9R A;  2SDF A;  2Q2I A;  4LF8 L;  4UHV A;  3PV0 A;  5CGK A;  2SNM A;  1A3T A;  1BCP B;  3H3V C;  5IT9 L;  1TKW B;  5C0X I;  1I4P A;  3C3L A;  4WJW A;  5IYB G;  3UDG A;  1YNJ C;  3KLS A;  1WTW A;  1PFS A;  2BE5 D;  3K7A B;  1GXD C;  2BH8 A;  1M1K C;  1RDP D;  5LMN Q;  1EZ6 A;  3S24 A;  3PO2 B;  1QVG A;  1I94 L;  2VY3 A;  4R4Q A;  4U68 A;  2WAQ G;  3SE0 A;  5ELB A;  2R7Z G;  2K5W A;  4IFD H;  4GLX A;  4HIM A;  1LV9 A;  3W1G A;  5CC4 A;  1X55 A;  3Q23 A;  1MSG A;  4P75 A;  2A68 D;  4BBR H;  2CW0 C;  3A5Z B;  4MIU A;  3ERQ A;  3Q8D A;  1VQ4 A;  4HJA A;  4AQY Q;  1YEZ A;  3A55 A;  1BDO A;  3CU7 A;  2RSN A;  1KRT A;  4JI0 L;  3KBG A;  1H9S B;  4DV7 Q;  3LWE A;  1S72 A;  1D1I A;  3RN5 A;  1G8Z D;  2F1M A;  5IYD H;  4P73 A;  5JJK A;  4QUC A;  1II3 A;  4RMF A;  2CWP A;  2E2J B;  4HJ7 A;  3MXP A;  1N8R C;  4DV3 Q;  2EYM A;  3MZ5 A;  2NZH A;  4A3I H;  1DON A;  3K0X A;  4A3M B;  4UPA A;  3RZO H;  2WIN B;  1NCV A;  4ZUJ A;  3CF5 A;  4LNQ A;  1BKB A;  1SJE D;  2JA6 B;  1N32 L;  2KCN A;  1UWV A;  2VB2 X;  4FXK C;  3H3V I;  4FVM A;  1C9O A;  3F2C A;  2RDG A;  3QOJ A;  1JOK A;  5IYC H;  4IUT A;  4CJ2 C;  5LL6 S;  3S2D B;  2JA8 H;  3J7Y W;  3CKI B;  5J3B A;  4JI3 L;  1KHI A;  3M9B A;  4J15 A;  5IGE A;  2A6H D;  4HJ5 A;  4P74 A;  4MTK A;  4ZUI A;  4WJ3 M;  4XXE A;  3EIV A;  2Q8I B;  2KED A;  5G3L F;  2Y0S G;  2R3Z A;  1CK1 A;  5KND A;  3BVZ A;  3RN2 A;  5I2X A;  4JI8 L;  1RHP A;  4APV A;  4CKB A;  4NB3 A;  4AYB G;  4DAP A;  1B50 A;  2PMZ E;  1K28 A;  2NVY H;  4KN7 C;  5LL6 X;  2QDB A;  2CKZ B;  1CHP D;  2XGT A;  3QB3 A;  4DFA A;  5ELE A;  2MFI A;  3UDF A;  3S14 B;  1X3E A;  1VQD A;  2KVM A;  1EEF D;  1STG A;  4BY1 G;  4ABN A;  2B39 A;  3PIP 3;  1E2W A;  1VQP A;  5JPN C;  1HA6 A;  2Z8L A;  1GUG A;  2JQO A;  3VA5 A;  5BN5 A;  3KLS X;  4LK1 C;  4POF A;  4UY8 C;  4R1J A;  1ICW A;  4PZ7 A;  1WJJ A;  4KKS A;  1NUC A;  2QF7 A;  4OIK A;  1FGU A;  3S17 B;  3S1M H;  2VQE L;  2V1C C;  1YNX A;  4JW0 A;  4JI6 Q;  4DR6 L;  1FJG Q;  1VQC A;  4BBS G;  2Z6K C;  1W6K A;  1MSH A;  1L0X B;  4ZYS A;  3T56 B;  4IUN A;  3UDX A;  1UEA B;  2N55 A;  4RH6 A;  3WOF A;  1XNQ Q;  3H0G B;  1RJT A;  2F0K A;  2K5H A;  2VL6 A;  2OXP A;  3K59 A;  1HH2 P;  5L37 A;  1IBK L;  1A3U A;  2UUC L;  1D8L A;  1O78 A;  2E2H H;  1KLG D;  4IAL A;  2ZJR A;  3NBH A;  1LTB D;  3CRK C;  4K2L A;  4KLK A;  3T1H Q;  1HR0 Q;  4CDE C;  4XT1 B;  4DV6 Q;  4YIJ A;  2Z0S A;  2O4X A;  4RHR A;  1WCM G;  2UUB Q;  1EQV A;  1Q3L A;  1UEB A;  5DLQ E;  1CKN A;  4DV4 L;  4B3S L;  2L5T A;  5C44 H;  3FKI H;  3KDF A;  1TWA H;  3NWS A;  4CDD C;  1AP0 A;  4C3I H;  4A3D B;  3G4S A;  1SNQ A;  2I5H A;  4DR5 L;  1PH7 A;  1JWM D;  4OEL B;  3OW2 A;  4P2C B;  1WTQ A;  1AE2 A;  2VUM H;  3R2I A;  4XTC S;  3I4M H;  4Q0F A;  1ENF A;  2MUY A;  1E2V A;  3GTQ H;  4NPS A;  2K03 A;  4DPG A;  5CV4 A;  2JA9 A;  1LTS D;  4OWW B;  1F9P A;  2OQ0 A;  1JC7 A;  1BCP C;  3C2P A;  1K0R A;  2UUA L;  3ONA B;  2K4K A;  1QJO A;  2NUC A;  4EX5 A;  1MJC A;  5IOD A;  5A2Q L;  4RAU C;  3HOY H;  4IJL A;  4JI5 Q;  1DD2 A;  3CD6 A;  4LF7 Q;  3M7G A;  3NBI A;  3F1Z A;  4IFD G;  3KF8 B;  4ZK9 B;  1MD2 D;  3D4D A;  4L63 B;  3K80 C;  5C4J B;  4EQP A;  1VQK A;  5D3D A;  1CKO A;  2I5M X;  1FVI A;  1HNW Q;  2GVB A;  2DUD A;  4BBR G;  3FVQ A;  1TXY A;  5M3M H;  1SMY C;  1SYB A;  2RF4 A;  3PO3 H;  3ERO A;  2DGY A;  2AUK A;  4R4C A;  4KV6 A;  3J81 L;  5IIF A;  2EYJ A;  5IGD A;  3L9A X;  4GOP B;  1AE3 A;  1G6P A;  4YHH Q;  5JEA H;  2UXC Q;  3D0F A;  2EY6 A;  3W1B A;  2WP8 J;  4LMQ D;  3D4R A;  3FMC A;  4C2M H;  5IYD G;  4JYA L;  3G6J B;  4X64 Q;  1Q1B A;  5E3F A;  4F7X A;  3A74 A;  3DEP A;  1FYC A;  2SOB A;  3RZD H;  1WD0 A;  4RCN A;  4A3I G;  1U4R A;  1QUQ A;  2E2I H;  2UXB Q;  2CHB D;  2Z1C A;  4KY6 A;  3GTM B;  1BUV T;  3IFD A;  4FF1 A;  2B2U C;  5KEE A;  1SRO A;  1Y1W H;  4F87 A;  1F2M A;  2HHH Q;  1QOH A;  3TQY A;  1GHJ A;  3HOX B;  4QIW E;  1QVC A;  5IYC G;  4A3F H;  1AZP A;  1KL9 A;  4A3G B;  2JA8 G;  3GTG H;  1CQV A;  2ID0 A;  2VXW A;  1JT8 A;  3GV3 A;  1F2Y A;  2ZJQ A;  1PDQ A;  5M5X B;  1X9N A;  1WI5 A;  3U9S A;  4KHP Q;  1FNV A;  4R4O A;  3A8J E;  1VMC A;  3MTS A;  2F4V L;  2IL8 A;  3M3Y B;  4KKT A;  4HCS A;  3J80 c;  3CAM A;  2LXK A;  1XXG A;  4K14 A;  1E0B A;  1ILP A;  4TRD A;  1EY5 A;  1EY8 A;  3NTH A;  3DUZ A;  4IZ8 A;  3FEW X;  3MXU A;  1LM0 A;  1X3Q A;  2NVQ H;  5GAE C;  1IYU A;  3U4V A;  1VQ7 A;  1QZH A;  2K5N A;  3PIO A;  1U0L A;  3RD4 A;  3E6Z X;  3NEL A;  1H95 A;  3IL8 A;  3HKZ E;  5EJW A;  3FHW A;  4XIG S;  1GUW A;  4IOC A;  3OOC A;  4AIM A;  4LF5 L;  1HFN A;  3NP8 A;  5D3I B;  1BCP F;  1CQF A;  4JI7 L;  5LHY 1;  3KF6 A;  4RGN A;  2WB1 E;  4S3S A;  4DAY A;  4A3L H;  2B63 B;  4C1N I;  4YCV A;  4JK1 C;  4DKA C;  2K1B A;  1TWF B;  1O7Z A;  1M8A A;  1SE2 A;  4FDB A;  3K5O A;  1CUK A;  2D2C C;  3WOE A;  5I9O A;  1PTO B;  5FO7 B;  1Z7T A;  1IW7 D;  3KBX A;  4CKE A;  1KDB A;  3VR2 A;  5J1Z A;  3J7A 5;  4KJO A;  1KLU D;  3S2H B;  4NW2 A;  3WDN A;  1LTR D;  4KMU C;  4KD4 A;  1ICF B;  4LAA A;  3BVM A;  4LFB Q;  1CSP A;  3ERS X;  3NEM A;  4KN4 C;  1EQT A;  1UE5 A;  2HDL A;  2F0M A;  1Q12 A;  3FDT A;  2ES2 A;  3C1E A;  1NE3 A;  1WVL A;  2R93 H;  5FLX L;  1E1T A;  2E74 C;  1UE6 A;  1XWE A;  1PH5 A;  2XRQ D;  4A3K B;  5EPL A;  1ASZ A;  4JVZ A;  1K73 C;  1L1O A;  2K14 A;  1PH4 A;  4Z9C B;  4GKK Q;  2B2V C;  2EOT A;  4DV7 L;  5C44 G;  2YTV A;  4IFD I;  1SDF A;  3FKI G;  3ER0 A;  4K5V A;  5JAV A;  2F0D A;  3T16 A;  3LGJ A;  2Q2U A;  3J7A F;  4OHJ A;  4PNY A;  2VB3 X;  2BA1 A;  2E2D C;  4DUZ Q;  1XTC D;  1I5F A;  5M5W H;  3DM3 A;  1B44 D;  3OYY A;  5IY0 A;  2VUM G;  1CM9 A;  5GAG C;  1CA5 A;  1BQQ T;  5NUC A;  3I4M G;  1B4O A;  1MJE A;  1EIH A;  4HJ8 A;  3HOU B;  1T5E A;  4KKU A;  3I3C A;  2L15 A;  2L9H A;  3R8B A;  5K36 H;  1U5K A;  3BS1 A;  2EDG A;  3GTO H;  3MXN B;  3HOY G;  3R93 A;  3OHX C;  4N9P A;  1Z6H A;  3I56 A;  3STB C;  1VQO A;  2HQE A;  5FLM H;  2FIN B;  2CQA A;  4AH6 A;  1YJN A;  2NB0 A;  1HZB A;  4RKB A;  3K5L A;  2FHT A;  4KI0 A;  4OWX B;  5IGF A;  1C0A A;  1JE4 A;  5M3M G;  3R2T A;  1PH9 A;  1VQL A;  3A5U A;  1SNM A;  1B3Q A;  3I73 A;  5M3F H;  4C3H H;  3HP3 A;  4QQB X;  1AFP A;  3I55 A;  4J8Q A;  1CT1 D;  5JEA G;  1JR0 D;  2EIF A;  5JVH 3;  4HMJ A;  2J4X A;  3A0J A;  4A3C H;  2OQK A;  2EVB A;  3SVM A;  4DV2 L;  3T1Y L;  1LT4 D;  3VDY A;  1QB5 D;  2X69 A;  1RL2 A;  4G57 A;  1U9R A;  4GOP C;  1NTG A;  1V9P A;  3OSO A;  4GLA C;  5IWA Q;  2F0I A;  1PH8 A;  1Y1W G;  1MGS A;  1TWG B;  1JOQ A;  3G71 A;  2D9U A;  2NVT B;  2N88 A;  1A63 A;  1S5E D;  2WAQ B;  3CW2 C;  5JEA J;  4A3F G;  2R7Z B;  1QCB D;  3TSS A;  4X3U A;  4H02 A;  1PFN A;  2XTI A;  1YBY A;  4M8A A;  2LXJ A;  1FJG L;  2C35 B;  4NXN L;  4OO1 H;  1PFB A;  2A1A A;  3CMA A;  3T4A C;  1PVO A;  3CCL A;  1XNQ L;  1EY0 A;  1KD1 C;  1TS3 A;  2DNE A;  4BWG B;  1R4P B;  4A3K G;  3QG1 A;  5C6A A;  4DK0 A;  1YJW A;  3GTP B;  5E1F A;  3VYR A;  2IW3 A;  2OEO A;  2LSS A;  5IGC A;  2A69 D;  3Q6S A;  4DR2 Q;  1XMO L;  4QY7 A;  1EY7 A;  5KRU A;  2I0Q A;  1L0Y B;  3T1H L;  1HR0 L;  4DV6 L;  3UI2 A;  1YNN C;  4HTH A;  2UUB L;  2PQA B;  3TRZ A;  1N36 Q;  4GZY C;  2G5D A;  3PIO 3;  2K5V A;  5EKK A;  3OMG A;  4NKL A;  4ZLT F;  3ZJY C;  4TSS A;  1YJ9 A;  1LUZ A;  4B3M L;  2PCF B;  2JYO A;  3K7A H;  4ME3 A;  5CV5 A;  3T51 B;  2WV6 D;  5BR8 Q;  3V96 A;  2QEX A;  1X54 A;  4A3L G;  3CCU A;  3CHB D;  1PYS B;  4K0K Q;  1HR0 W;  1TWC H;  1PV4 A;  1QVF A;  3NTI A;  3NSW A;  3U9O A;  5IGG A;  1AEX A;  5CR3 A;  1CHQ D;  5I9P A;  1ET9 A;  2Q2T A;  2I07 B;  2AQ2 B;  2E5L Q;  2PQE A;  1VQB A;  2Y0S B;  1A6X A;  1STY A;  1F77 A;  1N33 Q;  2MPM A;  4JI5 L;  2BDO A;  2VZA A;  2B2Y A;  1PH1 A;  3OTO Q;  1TWH H;  5G3L D;  1Q8I A;  1I4Q A;  1PTO C;  2FMC A;  1GUN A;  2F52 A;  3I90 A;  4AYB B;  3HOZ H;  2NVX H;  4KHV A;  1I3Q H;  1HNW L;  2SNS A;  1N34 Q;  1CA6 A;  2E2J H;  4Y7N B;  5I6Y A;  2C9O A;  2R93 G;  1TT2 A;  3PUV A;  1GVP A;  4BY1 B;  3SR1 A;  2A6E D;  4RCO A;  3BYT B;  2OCE A;  3K8A A;  4ID6 A;  1C7Y A;  3L7Z C;  4N8F A;  1VQG A;  4YHH L;  1STA A;  1YNJ D;  3CP0 A;  4GKJ Q;  3EN2 A;  1H9K A;  1L0W A;  3HRZ C;  3J80 E;  3DWA A;  3S1N H;  2UXB L;  3IKJ A;  1E7Z A;  1STB A;  4CGY B;  4X66 Q;  1TII D;  3BZK A;  1NR2 A;  1STE A;  2N3S A;  3LNN A;  4WFN 3;  4BBS B;  1SN8 A;  3HS0 C;  4I65 A;  2HHH L;  1QG7 A;  4K2K A;  1VQN A;  1H9M A;  5DM6 3;  1LTA D;  3BDC A;  4JI2 Q;  4JI4 Q;  1G6Z A;  3I4L A;  1DGS A;  2K75 A;  5K36 G;  3U58 A;  3S1R B;  4PG3 A;  3CC7 A;  3D6W A;  1PHJ A;  5K5P A;  1I6H H;  2CQO A;  1GHK A;  1RKN A;  1Q90 A;  4KHP L;  2RDH A;  2HD3 A;  2NWG A;  4YCU A;  2A68 C;  2FMM A;  3I4N G;  1XPR A;  1BNZ A;  1PZI D;  5FLM G;  4HID A;  1WCM B;  4A93 H;  3PMF A;  3S15 H;  3AU7 A;  3TP5 A;  3MA2 B;  1XYI A;  4L5S A;  3QIA A;  4QB4 A;  5M3F G;  3PGZ A;  4C3H G;  1KTK A;  5EBD A;  2DY8 A;  3I8Z A;  4A3C G;  1EY4 A;  1XNR Q;  1UUP A;  1F2L A;  3PQI A;  4IUP A;  1I50 H;  4J1M A;  3AFP A;  3I2Z A;  2EXZ A;  4IPH A;  3BDL A;  4A3E H;  2MO1 A;  4LUO A;  3QR8 A;  2MGS A;  5J39 A;  3I4O A;  4C56 C;  2FXQ A;  4NXM L;  1HTL D;  3VR6 A;  1D5M C;  1DOK A;  1SXT A;  1NBW A;  4A76 A;  4OX9 Q;  2BH2 A;  3NK9 A;  1PTO F;  1A3V A;  3QJY A;  4LF4 Q;  1LAB A;  1Y14 B;  2Z4H A;  4IUQ A;  4P71 A;  2OWO A;  3SDZ A;  4LFA Q;  1J9O A;  3X3M A;  1D2B A;  1DM0 B;  4OO1 G;  5ELC A;  4BBR B;  2IY5 B;  1G91 A;  1TS2 A;  1K83 H;  2JK8 A;  2F0S A;  1KXL A;  3CQZ H;  1K8G A;  3AB9 A;  1UNS A;  3KK7 A;  3S16 H;  1B9M A;  2NN6 H;  1RTN A;  4CKC A;  4ZKC B;  1FGB D;  3K6O A;  4A3D H;  4GN4 B;  3T13 A;  2KCM A;  1K0S A;  1D5Z C;  4A3I B;  2XIW A;  1JJC B;  3RZO B;  1H9J A;  5EAY A;  2O5I C;  2XWB B;  4GKK L;  2K5Q A;  2EZV A;  2JA7 H;  4N9T A;  1V1Q A;  3EA6 A;  2WFW A;  2KQ3 A;  1N9W A;  1E3P A;  4DR3 Q;  4JV5 Q;  3OIQ A;  3W3A A;  4DUZ L;  4DAV A;  4DF7 A;  1IHZ A;  2A73 B;  4BXX G;  3HOV H;  3E0J A;  2JA8 B;  5FKA C;  1B53 A;  4FXD A;  3CRL C;  4KK7 A;  2NTT A;  1MI2 A;  5FK9 C;  1SYF A;  3PUZ A;  2QEJ C;  2F3I A;  1EQQ A;  4B3T L;  4HCE A;  1Q82 C;  2PW5 A;  3MFY A;  1SE3 A;  4O2D A;  1VQ6 A;  2KEC A;  2NBF A;  5HGQ A;  4DNI A;  4ZRZ A;  1ROD A;  2B8G A;  3GTK H;  1ZYR C;  1PRT B;  2DN8 A;  2O2L D;  3CC2 A;  2LY7 A;  3TEH B;  2O5J C;  4C3J H;  1U4P A;  1SYE A;  2XN9 C;  5F2D A;  2PZT A;  3H15 A;  4A3J H;  1SYC A;  2HIV A;  5KIX A;  3PF5 A;  1NSN S;  3KYH C;  3TN2 A;  5HY6 A;  1C4Q A;  3HOZ G;  4WOR A;  4CDF C;  4DV0 Q;  3D4W A;  2NVY B;  4LUZ A;  4JBJ A;  1SFO B;  3CCV A;  1YHQ A;  5C3E H;  5JJZ A;  4HMI A;  1G2T A;  2KHJ A;  1XTD A;  3GTM H;  1SSO A;  3U4Z A;  1PZK D;  2PZW A;  2VQF Q;  2B3G A;  5IT9 E;  4O0A A;  4KHZ A;  3TP8 A;  3GD7 A;  2D62 A;  4DR4 L;  1EOV A;  4WRD A;  1BCP D;  2A74 C;  2IX0 A;  1ML0 D;  1TY0 A;  1SYD A;  3HOX H;  4ZAI A;  2B2W C;  3NBH B;  4HR7 B;  2QGQ A;  2L4N A;  1S4Z A;  4L5Q A;  1EWI A;  1ENC A;  2M2L A;  4QCL A;  1HUN A;  4FF3 A;  1GOZ A;  1S40 A;  4OGQ C;  3S1M B;  2KA7 A;  5IWA L;  3TP7 A;  5BN4 A;  4OEM B;  1HZA A;  2CCZ A;  4K8J A;  4IPG A;  1CKN B;  3MHB A;  1PFM A;  1W2B A;  4DV1 L;  1EIG A;  2K5D A;  3PUW A;  4RA8 A;  1BBX C;  1X6O A;  1FNW A;  3KDF B;  4IN3 A;  5C0X H;  5KGU A;  1IL8 A;  1IBM L;  3M3Y H;  4H0L C;  3MEF A;  1SMY D;  5CV8 A;  3W5O A;  1Q1E A;  4PZ8 A;  4LUV A;  2E2H B; 
#chains in the Genus database with same CATH homology
 4LF6 Q;  4DV7 L;  5C44 G;  2YTV A;  4IFD I;  1CKM A;  4BBS H;  3FKI G;  3ER0 A;  2Q2U A;  2YTY A;  4YY3 Q;  3LGJ A;  1Z9F A;  3HOU G;  3NEN A;  2YV5 A;  1K3R A;  4BXX H;  4B3R L;  2BA1 A;  4JC0 A;  4DUZ Q;  2R92 G;  1IBL Q;  1I5F A;  5M5W H;  3DM3 A;  2UU9 Q;  3S1R H;  2HT1 A;  1OXS C;  2F4V Q;  4IOA A;  1Q7Y C;  3M4O H;  1UE1 A;  3ULP A;  3OYY A;  4A93 G;  5IY0 A;  2VUM G;  5GAG C;  4LFB L;  3I4M G;  1SE8 A;  5E7N A;  3AYH B;  3GDE A;  1KRS A;  2Y0S E;  1MJE A;  4HJ8 A;  4R4T A;  3F2B A;  1YI2 A;  1X3F A;  1A8V A;  2L15 A;  3CXC A;  1U5K A;  4IO9 A;  1EIF A;  1SFO H;  2JA5 H;  1WCM H;  2B63 H;  4DR7 Q;  2ZTE A;  3BU2 A;  1JJG A;  1VQH A;  2AKW B;  3I7F A;  4DV2 Q;  3T1Y Q;  1N36 L;  3GTO H;  1JB7 A;  3MXN B;  1XMQ L;  3HOY G;  4A75 A;  2GVA A;  1PH6 A;  5C4X H;  1HNX Q;  1KQS A;  4DV5 Q;  4LF5 Q;  4YY3 L;  4GLV B;  4JG2 A;  4A3E G;  3I56 A;  4JI7 Q;  1O7I A;  3STB C;  1VQO A;  3CCR A;  3J81 c;  1HNZ L;  2Q2I A;  3PUX A;  5FLM H;  3UDI A;  4LF8 L;  5BR8 L;  1Y1V H;  3PV0 A;  2ATW A;  4AH6 A;  1YJN A;  1HZB A;  4K0K L;  3PO2 G;  4DR1 Q;  4KI0 A;  2A8V A;  2IHE A;  3S2H H;  4OWX B;  1XPO A;  5C0X I;  1C0A A;  2VNU D;  5M3M G;  3H3V H;  1PH9 A;  1B8A A;  1VQL A;  3M85 A;  3A5U A;  5IYB G;  3UDG A;  5M3F H;  4C3H H;  5C4J H;  4X65 L;  4QQB X;  3I55 A;  1R9T H;  1PFS A;  1QUQ B;  5JEA G;  4X62 Q;  2EIF A;  4HJ9 A;  3TS0 A;  3ICE A;  1P16 A;  2BH8 A;  3A0J A;  2E8G A;  4DUY Q;  2OQK A;  1M1K C;  4NXN Q;  1N33 L;  4DV2 L;  3T1Y L;  5LMN Q;  3S24 A;  3VDY A;  1QVG A;  2KCT A;  5FJ8 H;  2VY3 A;  1I94 L;  4LFC Q;  4R4Q A;  1RL2 A;  1WYD A;  2WAQ G;  3E9H A;  3CPW A;  1HNX L;  1A0I A;  4GOP C;  2IX1 A;  2R7Z G;  1X56 A;  3RLF A;  1NTG A;  1V9P A;  3JC6 6;  4A3B H;  4GLX A;  4HIM A;  3JAM c;  3W1G A;  1Q86 C;  1X55 A;  4GN3 B;  3KOJ A;  4GLA C;  3UE1 A;  5IWA Q;  3KJO A;  1N34 L;  2AHO B;  2NN6 G;  4LWC A;  1PH8 A;  1VQ8 A;  4LF9 Q;  4JBM A;  1XMO Q;  1X3G A;  4P75 A;  1Y1W G;  3U50 C;  1YZ6 A;  4BBR H;  3G71 A;  3A5Z B;  1A63 A;  1VQ4 A;  3Q8D A;  4R4I A;  2QA4 A;  1VQ5 A;  4HJA A;  2D0O A;  3CW2 C;  5JEA J;  4AQY Q;  4A3F G;  1YEZ A;  3CCJ A;  4A3M G;  1KRT A;  4H02 A;  4JI0 L;  2XTI A;  1YBY A;  2LXJ A;  2JA6 G;  2JA7 G;  4DV7 Q;  1FJG L;  1S72 A;  4GKJ L;  3RN5 A;  1SRU A;  2C35 B;  5IYD H;  1FL0 A;  4P73 A;  4NXN L;  1WOC A;  4YWK A;  4GNX A;  5JJK A;  4RMF A;  2A1A A;  2CWP A;  3CMA A;  4HJ7 A;  5LMN L;  1E1O A;  1N8R C;  4DV3 Q;  4B3M Q;  2R92 H;  1B7Y B;  1PVO A;  3CCL A;  4B3R Q;  4A3I H;  2NZH A;  1XNQ L;  4GOP A;  1ASY A;  1KD1 C;  1KAW A;  4A3G H;  3K0X A;  3HOV G;  4UPA A;  3RZO H;  1NJI C;  2UXD L;  4A3K G;  3M7N A;  1YJW A;  3CF5 A;  4LNQ A;  1BKB A;  2A19 A;  1OXU A;  1N32 L;  3RLN A;  1UWV A;  2LSS A;  1K9M C;  5M5X H;  3H3V I;  1VQM A;  2H5X A;  1C9O A;  4DR2 Q;  1EQR A;  4QY7 A;  1XMO L;  3F2C A;  4JI4 L;  2YTX A;  4IPD A;  3HKS A;  2I0Q A;  5IYC H;  3T1H L;  3ULL A;  1P8L A;  1HR0 L;  3AQQ A;  4GN5 A;  3CCQ A;  4DV6 L;  4X6A H;  3K81 C;  4AQY L;  2JA8 H;  2UUB L;  4JOI C;  2PQA B;  3TRZ A;  1YIJ A;  5IP9 G;  3E0E A;  5LMN W;  3KF6 B;  1N36 Q;  5J3B A;  1XMQ Q;  2K5V A;  4JI3 L;  1KHI A;  4DAY B;  4A3J G;  3M9B A;  4J15 A;  1VQJ A;  4LW1 A;  2ZJP A;  3HOW H;  3K7U C;  2JEA I;  4HJ5 A;  2B29 A;  4P74 A;  3ZJY C;  4QGU A;  5ELN A;  1VS0 A;  2JEB I;  1Q46 A;  4DV3 L;  1LUZ A;  1YJ9 A;  4B3M L;  4WJ3 M;  3BJU A;  3EIV A;  4UP9 A;  4DK3 C;  1GM5 A;  3K7A H;  4ME3 A;  1HNZ Q;  4LF8 Q;  2Y0S G;  2VW9 A;  5BR8 Q;  2QEX A;  1X54 A;  4A3L G;  3CCU A;  3RN2 A;  1PYS B;  1J6Q A;  4K0K Q;  5C3E G;  1M90 C;  4GNX B;  4JI8 L;  1HR0 W;  1TWC H;  4LUV A;  1PV4 A;  1QVF A;  5IYB H;  4EQ5 A;  4APV A;  4A3C H;  4DR2 L;  4L5R C;  4BA2 I;  4NB3 A;  5H1S E;  2Q2T A;  4AYB G;  4WJ4 A;  2PMZ E;  2E5L Q;  4DR6 Q;  4X65 Q;  1VQB A;  2NVY H;  2CKZ B;  2XGT A;  4IFD J;  5AJ3 L;  2MFI A;  3UDF A;  1N33 Q;  1BBU A;  1W3S A;  3GTL H;  4JI5 L;  3S1Q H;  1X65 A;  2R7F A;  1OXT A;  1X3E A;  2VZA A;  1VQD A;  5M5Y H;  1TWF H;  1PH1 A;  1I94 Q;  4BY1 G;  3OTO Q;  1TWH H;  5FLX c;  2R7D A;  2ZTC A;  3E9I A;  1T9H A;  4QL5 A;  5LMU L;  1GO3 E;  1VQP A;  3CC4 A;  1PH3 A;  2F52 A;  4POG A;  3G48 A;  2JQO A;  1HZ9 A;  3HOZ H;  4JI1 L;  3J81 j;  2NVX H;  2I5L X;  3STB D;  1I3Q H;  3RR5 A;  1HNW L;  1N34 Q;  3M4Q A;  1L1O B;  5IP7 H;  4POF A;  2E2J H;  4OX9 L;  3GO5 A;  4UY8 C;  5ELO A;  1NMG A;  2R93 G;  4R1J A;  2K50 A;  3PUV A;  1GVP A;  1JJ2 A;  3KJP A;  1EUJ A;  4PZ7 A;  1WJJ A;  2AWO A;  2ZM6 L;  2OCE A;  3K8A A;  5C0X G;  4LF4 L;  2N49 A;  3H0G G;  1KC8 C;  1FGU A;  3PO3 G;  1C7Y A;  3S1M H;  1GD7 A;  3L7Z C;  2VQE L;  4LFA L;  2V1C C;  1YNX A;  2N78 A;  4IPC A;  3HKZ G;  1VQG A;  4YHH L;  3GTJ H;  4JI6 Q;  2E5L L;  4JI0 Q;  3CP0 A;  4DR6 L;  4JBW A;  1FJG Q;  4GKJ Q;  1VQC A;  4BBS G;  2Z6K C;  5JJL A;  3EN2 A;  4OO1 I;  1L0W A;  4BY7 H;  1OXV A;  3OTO L;  2ASB A;  3UDX A;  3KLW A;  3TRE A;  4DR5 Q;  1XNQ Q;  3S1N H;  2UXB L;  3CME A;  4A3K H;  1VQI A;  2WB1 G;  1PYB A;  2K5H A;  2VL6 A;  3CCE A;  1HH2 P;  1IBK L;  1E7Z A;  2GN5 A;  4JCV E;  3D31 A;  2UUC L;  2UXD Q;  1D8L A;  2E2H H;  2OTL A;  4X66 Q;  1OXX K;  1XPU A;  3BZK A;  2ZJR A;  1N32 Q;  2N3S A;  5GAD C;  5C0X J;  1JMC A;  1J5E L;  4P72 A;  1SN8 A;  2HHH L;  1VQN A;  1SR3 A;  2K52 A;  4YCW A;  4JI2 Q;  4UP8 A;  4KLK A;  1DGS A;  4JI4 Q;  1IL2 A;  4A3D G;  2K75 A;  3T1H Q;  1HR0 Q;  2UUA Q;  4DV6 Q;  2MO0 A;  2Z0S A;  3U58 A;  5K36 G;  2JA5 G;  1WCM G;  2AMC B;  4PG3 A;  1E24 A;  3CC7 A;  1K8A C;  5DLQ E;  1UEB A;  3RLO A;  2UUB Q;  1VQF A;  1PHJ A;  1CKN A;  4YWL A;  1VCI A;  3RNU A;  1I6H H;  4DV4 L;  4B3S L;  5C44 H;  4JI6 L;  4QJF A;  4JI3 Q;  1OTC A;  2CQO A;  3FKI H;  2Z6K A;  1TWA H;  3KDF A;  4OON A;  5C4X G;  4KHP L;  3HOU H;  5IT9 c;  2JJQ A;  1BBW A;  3J81 i;  4YCU A;  4C3I H;  3G4S A;  3F2D A;  3CCM A;  1G29 1;  3I4N G;  2I5H A;  1XPR A;  4NXM Q;  4DR5 L;  1PH7 A;  2MNA A;  5FLM G;  3OW2 A;  4HID A;  1IYJ B;  1Y1V G;  4JBK A;  4A93 H;  2VUM H;  1AE2 A;  3J80 i;  3S15 H;  4XTC S;  3I4M H;  1Q8K A;  4X66 L;  2Q2H A;  4DK6 C;  4JI8 Q;  3GTQ H;  4NPS A;  4DPG A;  2JA9 A;  4L5S A;  4OWW B;  2OQ0 A;  4JI2 L;  5M3F G;  3PGZ A;  1K0R A;  2UUA L;  2K4K A;  3WWV A;  4HIO A;  3PF4 A;  4EX5 A;  4A3C G;  1D7Q A;  1XNR Q;  1MJC A;  5AJ3 Q;  1XJV A;  3HOY H;  4IJL A;  1I50 H;  4JI5 Q;  3AFP A;  5FJ8 G;  3I2Z A;  3CD6 A;  4LF7 Q;  4IPH A;  1CSQ A;  4A3E H;  2MO1 A;  4LUO A;  3F1Z A;  5LMU Q;  4A3B G;  4IFD G;  3KF8 B;  2MQH A;  3I4O A;  1HJP A;  2KEN A;  1VQK A;  3K80 C;  2FXQ A;  3L0O A;  4JI1 Q;  4DV0 L;  1CKO A;  4NXM L;  2I5M X;  1FVI A;  1HNW Q;  1SLJ A;  1NBW A;  4A76 A;  4OX9 Q;  2BH2 A;  2GVB A;  2DUD A;  1QZG A;  1WFQ A;  4BBR G;  3PO2 H;  5JJI A;  1TXY A;  3CCS A;  5M3M H;  3L2P A;  1SMX A;  2RF4 A;  3PO3 H;  2DGY A;  4R4C A;  2ZM6 Q;  4LF4 Q;  1Y14 B;  4P71 A;  2OWO A;  2VQF L;  3SGI A;  1IZ6 A;  1UE7 A;  1YVC A;  2VQE Q;  4LFA Q;  4GOP B;  1AE3 A;  2YU9 H;  1G6P A;  4YHH Q;  2UXC Q;  3D0F A;  3W1B A;  2WP8 J;  4C2M H;  4JOI A;  4PMW A;  5IYD G;  1TWG H;  1XNR L;  4JYA L;  4YWM A;  4X64 Q;  4OO1 G;  1Q1B A;  2NVT H;  3A74 A;  2IY5 B;  3PCO B;  3RZD H;  3HOX G;  1K83 H;  2JK8 A;  4A3I G;  4LF7 L;  2R7Z H;  3IRB A;  1QUQ A;  2E2I H;  4A3G G;  2UXB Q;  1KXL A;  1YIT A;  3CQZ H;  1IBK Q;  3J7Z C;  1K8G A;  2KHI A;  1PH2 A;  2UUC Q;  1Q81 C;  3S16 H;  4B3T Q;  1SRO A;  1Y1W H;  1E22 A;  1J5E Q;  4A3D H;  2HHH Q;  2RHQ B;  3TQY A;  4GN4 B;  3B6Y A;  2KCM A;  4PZ6 A;  1Z47 A;  1YHA A;  4QIW E;  1QVC A;  4TVA B;  5IYC G;  4A3F H;  1KL9 A;  1L2F A;  4A3M H;  1GKH A;  1JJC B;  2IHF A;  2JA8 G;  3GTG H;  2ID0 A;  5EAY A;  4AYB E;  1JT8 A;  3GTP H;  4GKK L;  4LF6 L;  2NZO A;  2JA6 H;  2JA7 H;  4DV4 Q;  1V1Q A;  3AFQ A;  4B3S Q;  2UXC L;  2ZJQ A;  1X9N A;  3HOW G;  2WFW A;  5GRO A;  1WI5 A;  1N9W A;  4OXP A;  4KHP Q;  1E3P A;  2D0P A;  4X64 L;  4DR3 Q;  4R4O A;  4JV5 Q;  1RIP A;  3I4N H;  1VQE A;  4DUZ L;  1KIX A;  4L5T A;  1IBL L;  1NY4 A;  3TS2 A;  1EIY B;  2AWN A;  2UU9 L;  4BXX G;  3HOV H;  2F4V L;  3S2D H;  1IXR A;  4UP7 A;  3J80 c;  3CAM A;  2LXK A;  2YYZ A;  4OWT B;  3BZC A;  3PUZ A;  2F3I A;  4A4I A;  1EQQ A;  4B3T L;  1Q82 C;  1MKH A;  4O2D A;  1VQ6 A;  1LM0 A;  2NVQ H;  5HGQ A;  5GAE C;  4DNI A;  1VQ7 A;  3U4V A;  1QZH A;  4DR4 Q;  2K5N A;  3PIO A;  1U0L A;  3GTK H;  4DR7 L;  3NEL A;  3CC2 A;  1H95 A;  3TEH B;  4GNX C;  5IP9 H;  2B63 G;  4C3J H;  3HKZ E;  2BA0 A;  4HIK A;  3EBE A;  1PA6 A;  3FHW A;  4XIG S;  3M4P A;  3H15 A;  4A3J H;  2HIV A;  4IOC A;  4TQU S;  4AIM A;  4DV5 L;  4LF5 L;  4DAM A;  4ALP A;  3PF5 A;  3KYH C;  4JI7 L;  3ULJ A;  4DR3 L;  5GAH C;  2PQA A;  1S3O A;  4JV5 L;  2PNH A;  1B70 B;  1VQA A;  1LYL A;  3KF6 A;  5HY6 A;  3HOZ G;  1LTL A;  2WAQ E;  2NN6 I;  3DLL A;  4DV0 Q;  2WB1 E;  2CWA A;  1EYG A;  4LUZ A;  5GQO A;  4JBJ A;  3S14 H;  4A3L H;  4YCV A;  5IP7 G;  4DKA C;  3CCV A;  2RHS B;  4DV1 Q;  4DR1 L;  2PI2 A;  1YHQ A;  5IE8 A;  5C3E H;  1MIU A;  2KHJ A;  4Y52 H;  1XTD A;  1IBM Q;  4FDB A;  1CUK A;  4MZ9 A;  2JE6 I;  3GTM H;  3U4Z A;  3PSI A;  2VQF Q;  2B3G A;  4O0A A;  1L1O C;  4KHZ A;  3GD7 A;  2D62 A;  4DR4 L;  2N8N A;  4X62 L;  1EOV A;  3HFZ B;  4DUY L;  4RG1 A;  1BVS A;  2IX0 A;  1NMF A;  2EQS A;  3UE0 A;  4Y7N H;  3PIP A;  1YHB A;  2HQL A;  2CFM A;  4JYA Q;  2IT1 A;  3F8T A;  4LFC L;  3HOX H;  4BY1 H;  1VQ9 A;  2VS1 A;  3NBH B;  3J7A 5;  4BY7 G;  2QGQ A;  4L5Q A;  1EWI A;  2RCN A;  3AEV A;  1HZC A;  1A62 A;  1G51 A;  3S17 H;  1S40 A;  1CSP A;  3ERS X;  3NEM A;  2EXD A;  3JAM i;  4LFB Q;  1UE5 A;  4GS3 A;  2ZTD A;  5IWA L;  4LF9 L;  1Q12 A;  1AH9 A;  4BA1 I;  4MNO A;  3KFU A;  2ALY B;  1HZA A;  2HIX A;  2CCZ A;  2ES2 A;  1NE3 A;  1CKN B;  4IPG A;  2R93 H;  1W2B A;  2R6G A;  4DV1 L;  2KBN A;  3PUY A;  2OTJ A;  1E1T A;  1JE5 A;  3PUW A;  1UE6 A;  1X6O A;  4IJH A;  3KDF B;  1PH5 A;  4MTN A;  1V43 A;  1IBM L;  3H0G H;  3G6E A;  3M3Y H;  1EFW A;  3MEF A;  2PI2 E;  3W5O A;  3FP9 A;  1K73 C;  1L1O A;  1ASZ A;  1Q1E A;  3CPF A;  4PZ8 A;  2K14 A;  1PH4 A;  4GKK Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...