2DUDA

Crystal structure of human mitochondrial single-stranded dna-binding protein(hmtssb)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
112
structure length
95
Chain Sequence
RSLNRVHLLGRVGQDPVLRNPVTIFSLATNEMWVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Single-stranded DNA-binding protein
publication title Crystal structure of human mitochondrial single-stranded DNA-binding protein(hmtSSB)
rcsb
source organism Homo sapiens
total genus 14
structure length 95
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2dudA00
3WWVA 4L5TA 1UE5A 4DR6Q 1YJWA 2JA8H 4Y7NH 4OWWB 4DR2Q 1TWGH 4MTNA 1P16A 4BXXG 1VQIA 4HIOA 5JJLA 2Z6KC 4A3GH 1I5FA 1LUZA 3HOZH 3OYYA 3CCLA 3HOYG 4BY7H 4DR7Q 5BR8L 1I94L 4B3TL 1PV4A 3J80c 1XTDA 4POGA 1VQBA 2RHQB 1NMGA 1PFSA 4K0KQ 4DR3L 1I50H 2N78A 1W3SA 1NY4A 4X62Q 5C4JH 1XPUA 1IZ6A 2Q2UA 4IFDJ 1K3RA 3JC66 2WAQE 1A0IA 1N36Q 1I3QH 2K14A 2EXDA 4LNQA 2RHSB 1X56A 1VQKA 1VQ6A 2YYZA 3KFUA 3TS2A 2E5LQ 2UXDQ 4LFBQ 3AYHB 3AEVA 4A3CH 1WYDA 2FXQA 2CQOA 2R7DA 5IYCG 4JBWA 2Q2TA 1NJIC 5H1SE 5M5YH 2JQOA 4B3SL 2ZJPA 3M4OH 4HJ7A 1VCIA 3CF5A 4AQYL 1Y1VG 5LMUL 2IX0A 4DV0Q 1YJNA 2R92G 1PA6A 3KOJA 3U58A 4LF4Q 2LXKA 4JC0A 4JOIC 4KI0A 4LFCL 3CCEA 3PUVA 3CCMA 4A3BH 2QGQA 1Q46A 3BU2A 4BXXH 4UP7A 1PH4A 5JJIA 1MIUA 5E7NA 2K52A 2Y0SG 4ALPA 1VQGA 4DKAC 3GTMH 2XGTA 3L0OA 4X65L 3HOYH 3S16H 3F2BA 3GDEA 1XNQL 1DGSA 2UUCL 4JI6L 5M5XH 4DAYB 1NBWA 3HOWG 1CKMA 3HKSA 2UUAL 1YHBA 5JJKA 1PYSB 2AWNA 4R4TA 1TWAH 2ZTEA 4RG1A 1EFWA 2NVQH 3S1MH 1QUQB 2DGYA 3DM3A 5EAYA 2OQ0A 4JI8Q 1XNRL 5ELNA 1S3OA 2HIVA 4RMFA 5AJ3Q 3VDYA 1QVFA 2YV5A 2A8VA 1L1OA 4A4IA 3RZOH 5IYCH 1KIXA 4LUZA 1TXYA 3PO2H 4IOAA 1BBUA 2Q2IA 1VQDA 2ES2A 4XTCS 4NXMQ 2UUBQ 1Y1VH 3CC4A 2KCMA 2ID0A 1N34Q 1B70B 2NN6G 4PZ8A 3UE0A 3KF6A 1PH6A 3RLOA 2BA1A 1K8AC 3PUZA 4DV6L 2ZJRA 1IBMQ 3CQZH 4R1JA 4DV2L 5C4XG 1BBWA 3I7FA 3UDGA 2XTIA 4H02A 1X65A 2EIFA 2UU9L 4OX9Q 4L5SA 1BKBA 1J5EQ 2VNUD 4EQ5A 1VQCA 1K0RA 5IWAL 4J15A 1SROA 2CWPA 3STBC 3HOWH 4JI4Q 1NE3A 3ULLA 1VQFA 4R4QA 1CKOA 4JI3Q 3CMEA 5IP7G 4X64L 4JI5L 1HNXQ 4HJAA 4KLKA 4A3JG 3CXCA 5GADC 1C9OA 1W2BA 3EBEA 1IYJB 4LFAQ 4GKKL 4B3MQ 3I56A 4X6AH 1EQRA 2ZM6L 5FLMG 3I4MH 3GTOH 3M4QA 1A8VA 4R4CA 3FKIG 2I5HA 4IPHA 3HOXG 4DV5Q 5GQOA 4HJ8A 2F52A 2QA4A 4UP9A 5J3BA 1PH7A 2KBNA 1M90C 1N33Q 2H5XA 4GN5A 1V9PA 3E9HA 1JE5A 2IT1A 3CCVA 3HOUG 1FVIA 2JEBI 2NZHA 4L5RC 4DV1L 3NBHB 2BH8A 1J6QA 2B63G 2UXCL 3G6EA 2YTYA 4PMWA 3A5UA 1G291 3CCSA 4IO9A 1PH2A 4DR4Q 2VQFL 4GLAC 1JJCB 1YI2A 2OCEA 1N32Q 1UWVA 3M3YH 3HKZE 1GD7A 4LF5L 3J81j 3IRBA 5C44G 1NTGA 2WFWA 4MZ9A 1BVSA 4BBSG 3GTPH 1VQHA 1E24A 1MJEA 1N9WA 4OONA 3W1BA 4JI0L 1VQPA 5IP7H 4X62L 5GAEC 1EQQA 2WAQG 4LF8Q 5IY0A 1N36L 4X66Q 2RCNA 2LXJA 4HJ5A 3CMAA 1U0LA 2A1AA 2PQAB 4A3FG 1M1KC 4JI2L 2YTVA 2R7ZG 4JYAL 1VQAA 1EWIA 2D0PA 3I4NG 1L0WA 2E5LL 3KJPA 1YEZA 2PI2E 1N8RC 4LF6Q 3FKIH 4AH6A 1VS0A 3HOXH 3RN2A 1PHJA 1KQSA 1C0AA 5IYDG 1IBLL 5C0XJ 4IPCA 5DLQE 3RLFA 2JA6G 3H3VH 4QGUA 4NXNQ 3HOUH 3M85A 2K50A 1XPOA 1VQJA 3JAMi 1KRSA 2JA5G 2JA7G 3HFZB 5IYBG 4POFA 3S1RH 3NELA 2GVBA 4NPSA 5K36G 3CW2C 1RL2A 3ERSX 3KDFA 3CPFA 4DV4L 1Q8KA 1Q82C 4YCVA 2WP8J 4OWXB 1WCMG 4IPDA 1VQ8A 2KHJA 3S24A 2F3IA 4DR1Q 2CKZB 1K83H 3KF8B 5C44H 2K4KA 2K5HA 1EIFA 3EIVA 4A3IG 5LMNQ 1PH5A 1WOCA 3PUYA 3AFPA 4DV3L 2UXBL 1KD1C 1HR0Q 2HIXA 1L2FA 1SMXA 3FP9A 5C3EG 1YJ9A 3KLWA 3K0XA 4JI8L 1EUJA 4ME3A 4DR5L 1Q1BA 1VQ4A 4C3IH 2R7ZH 3OW2A 1Z9FA 1SRUA 4A75A 4WJ4A 4JV5Q 3ULJA 5AJ3L 1HH2P 2K75A 1HNWQ 1YBYA 3NENA 4IOCA 5IYDH 3S1QH 1TWHH 2JA6H 5BR8Q 2K5VA 1L1OC 2BA0A 3J7ZC 4B3TQ 1TWFH 4JI1L 3MXNB 3F2CA 2JA7H 4A3MG 2UUBL 5IYBH 1GM5A 4QJFA 4B3RL 1N34L 3J7A5 1UEBA 5M3FG 2ZTDA 3Q8DA 1IBKQ 2IX1A 3FHWA 2PMZE 3KYHC 4A3DG 1WCMH 4A93G 1V43A 3S1NH 3TEHB 5M5WH 1J5EL 3I55A 1X3EA 4QQBX 5C0XG 3CC7A 3L7ZC 4DUYQ 1A63A 3PSIA 3OTOL 1P8LA 4JI3L 3K7UC 2I5MX 4B3SQ 4JBJA 1VQOA 3K7AH 1EYGA 1L1OB 2R92H 4AYBG 3TREA 1X9NA 4JOIA 5LMUQ 1AE3A 5JEAJ 5GAGC 2ALYB 3NEMA 2CFMA 4NB3A 3CCRA 4GOPA 1VQMA 4B3ML 4YWMA 3GTGH 5C0XI 1CKNA 1EOVA 4LFCQ 1UE6A 2C35B 1PH1A 1SR3A 4JI7L 1FL0A 1G51A 1XMOL 4DV5L 4HIKA 4O2DA 2JJQA 3T1HQ 3KF6B 3ER0A 1OXSC 1KHIA 2MO0A 1YITA 2Z0SA 1XNQQ 3K81C 3T1YL 2UUCQ 4JI6Q 4A3EG 3J81i 1H95A 4A3MH 3E0EA 2UUAQ 2R93G 4KHPL 2VQEL 1C7YA 2EQSA 4LF9L 5M3FH 3A5ZB 1MJCA 4P74A 1K9MC 1SN8A 4PZ7A 5FJ8G 1E1TA 4TQUS 3DLLA 1G6PA 3PIOA 4DR4L 1XNRQ 3HOVG 4JBKA 1YIJA 4A3DH 3PCOB 4YHHL 4A93H 4TVAB 5IT9c 1X6OA 3D31A 3GO5A 3BZCA 1ASYA 4QIWE 3STBD 2ZTCA 1B8AA 4UY8C 4YY3L 4FDBA 1I6HH 1CUKA 1CSPA 2GVAA 4DV7L 4GNXA 2OWOA 1WJJA 4LF7L 1VQ7A 2E2IH 3LGJA 3CPWA 1HZAA 4DR6L 1EIYB 1KL9A 4DR2L 4PG3A 5C4XH 1VQ9A 3B6YA 2JA8G 4DV6Q 2AHOB 4MNOA 4DV2Q 2B3GA 4DR7L 2JEAI 1OXXK 2E8GA 4YWKA 3RR5A 4DUZQ 4BY7G 1VQNA 4K0KL 1OXTA 1X54A 5IWAQ 2CCZA 1E7ZA 2R93H 3S15H 4P75A 3K80C 2MQHA 4A3JH 1E1OA 3K8AA 3TQYA 1SFOH 4JI5Q 1X3GA 5JEAG 3H0GG 3CCUA 4WJ3M 3HOVH 3E9IA 3CCQA 1SE8A 5FLMH 3PUWA 2UXDL 4GKKQ 4EX5A 4DR1L 3J80i 4LFBL 3CCJA 1GVPA 1Y14B 2ZM6Q 1HJPA 1VQ5A 1Q1EA 2A19A 4A3CG 3RNUA 1XMQQ 3G71A 2HHHQ 5ELOA 3ULPA 4GLVB 1OXVA 1U5KA 4DV0L 4HIDA 1FJGQ 1YZ6A 1OTCA 3W1GA 2B63H 4LF4L 4YCWA 3I4OA 1LM0A 3RLNA 1PVOA 4UPAA 1IL2A 2UXCQ 3S14H 4JV5L 2KHIA 2F4VQ 4A3BG 3U50C 3GTQH 1IXRA 3KJOA 1QVCA 2VL6A 1PH3A 3GTLH 4DAMA 4OO1I 2VQFQ 1HNWL 2Q2HA 5M3MG 4A3LG 3KDFB 1Z47A 1S72A 3PUXA 4LF5Q 4BBSH 3PF4A 3MEFA 2WB1E 3SGIA 3F2DA 4XIGS 3TS0A 4A3KG 1KC8C 1UE7A 3CAMA 2QEXA 5IE8A 4GLXA 2KCTA 2NZOA 4YCUA 4GKJQ 5GROA 3G48A 4JI0Q 1YHAA 2MFIA 4IJHA 4BBRG 3JAMc 1HZCA 2YTXA 1IBKL 1HNZQ 1R9TH 3TRZA 4A3FH 1YNXA 3H0GH 3F1ZA 1WI5A 1QZHA 2Z6KA 3M9BA 3I4NH 4JI2Q 3G4SA 1AE2A 4R4OA 4JYAQ 1KAWA 5HGQA 1JT8A 2YU9H 5GAHC 2MNAA 2GN5A 4BY1G 4DUYL 3ZJYC 1I94Q 3AQQA 2IHFA 2BH2A 4DK3C 1IBLQ 3S2DH 4NXML 2JA5H 1QVGA 3PO2G 4DR3Q 1S40A 1Y1WG 2IHEA 4R4IA 5FLXc 5LMNW 1YVCA 3BJUA 1QZGA 4P73A 4BA2I 1IBML 4DPGA 1JB7A 4GN3B 3S2HH 1K8GA 2VY3A 4DV4Q 1HR0W 4OX9L 4QY7A 4GOPC 1AH9A 1HZ9A 1MKHA 4Y52H 3M4PA 5M3MH 3T1HL 1PH8A 4A3LH 1Q7YC 1QUQA 4A3IH 1YHQA 1K73C 4HIMA 3ICEA 4JI4L 4A3KH 3F8TA 4LUVA 4GS3A 3UE1A 1FGUA 3UDXA 3PV0A 1HNXL 5C3EH 3RN5A 2VS1A 2V1CC 1JJ2A 2OTLA 4DV3Q 2UXBQ 1PH9A 4BBRH 4A76A 4AQYQ 2NVXH 3GTKH 4P71A 4BA1I 4LFAL 2OTJA 4DNIA 2KENA 1Q81C 1V1QA 2N3SA 1GO3E 4P72A 3H15A 1WFQA 4DR5Q 3CC2A 2CWAA 2MO1A 3RZDH 3I4MG 1ASZA 2K5NA 2Y0SE 4C2MH 4X65Q 4IPGA 1VQLA 4BY1H 1N33L 2RF4A 3PO3G 4GOPB 4OWTB 2N8NA 2D0OA 1CKNB 1KXLA 4PZ6A 4O0AA 4AIMA 1VQEA 1Y1WH 4GNXC 4JI1Q 1HZBA 5IP9G 4B3RQ 1D7QA 2AWOA 2I5LX 3M7NA 3GTJH 4IFDG 4C3HH 3BZKA 3HKZG 3PF5A 1D8LA 1N32L 2AKWB 1LTLA 5HY6A 3PGZA 2VUMG 2JA9A 2VW9A 2R7FA 2JK8A 1GKHA 2OQKA 4DUZL 3UDFA 1KRTA 3L2PA 2E2HH 4JG2A 4UP8A 4DK6C 1RIPA 1OXUA 2NN6I 3A74A 1NMFA 3OTOQ 1JMCA 4IFDI 2AMCB 4LF8L 2ASBA 4QL5A 4X66L 3J81c 4GN4B 1PYBA 2D62A 3U4ZA 3I2ZA 4GNXB 4AYBE 4LF6L 2L15A 1SLJA 3AFQA 1B7YB 4KHZA 1UE1A 4A3GG 2UU9Q 4JI7Q 3EN2A 1X55A 3D0FA 2NVTH 1XMOQ 3HOZG 3A0JA 4LUOA 4LWCA 4NXNL 1XMQL 3PO3H 1O7IA 1Q86C 1E3PA 2JE6I 2HHHL 4A3EH 2ZJQA 4JBMA 4OXPA 2N49A 2HT1A 2IY5B 3GD7A 3T1YQ 1FJGL 4JCVE 4IJLA 1X3FA 2B29A 5IP9H 1XPRA 4X64Q 2VQEQ 4KHPQ 1A62A 5FJ8H 2I0QA 4LF9Q 1LYLA 1Q12A 2DUDA 2HQLA 3CP0A 3W5OA 3S17H 1JJGA 2VZAA 2F4VL 2NVYH 4L5QA 3UDIA 2PI2A 2PNHA 1CSQA 3H3VI 4YHHQ 2VUMH 2E2JH 2LSSA 5LMNL 2ATWA 2WB1G 4YWLA 1E22A 4OO1G 3CD6A 1HR0L 1T9HA 2PQAA 4YY3Q 4DV7Q 3U4VA 3PIPA 4HJ9A 4GKJL 4LW1A 2R6GA 1HNZL 4LF7Q 4DV1Q 1XJVA 4C3JH 4APVA 1TWCH
chains in the Genus database with same CATH superfamily
2A6ED 1D5ZC 1TWGH 4MTNA 4BXXG 2EDGA 4MHEA 1JWSD 2K33A 3E6ZX 3DWQA 4A3GH 4KHVA 5BR8L 2CH4A 3J80c 1EIGA 4DAVA 2EY6A 4NKLA 3V2TA 3I4NB 2N78A 3QOJA 2YU9B 2B2YA 3TP8A 4XT3B 2K14A 1F9QA 1VQKA 3TS2A 1ZKOA 3KLSX 3W2DA 1JWMD 2FXQA 2AQ1B 2R7DA 3P75A 1SE3A 4JBWA 4OO1H 1CTMA 1ML0D 4RKLA 2NWGA 3S2HB 2DNEA 2H1EA 1XTCD 2WV6D 4DV0Q 1SYBA 1PA6A 2R92G 4ILWA 1STNA 4JC0A 4JOIC 4KI0A 4A3KB 4A3BH 5JJIA 4UP7A 1STEA 5LL6X 2K5DA 2EJGC 5C3EB 3HOYH 3GTMH 3S16H 1PXUA 1LT4D 1DGSA 2UUCL 5CC4A 4JI6L 4IZ8A 5M5XH 2K6AA 2UUAL 1RTOA 3DEOA 1ET9A 4R4TA 2ZTEA 4RG1A 3GQBA 4XQJA 1EFWA 5CMDA 2XVSA 2F0PA 1QG7A 1B1ZA 2F3VA 3BG3A 4DK0A 1H9SA 1M8AA 5I6YA 4G4KA 5AJ3Q 3VDYA 1MSGA 2YV5A 2A8VA 4TRDA 3RZOH 1KIXA 3FDTA 1AZQA 4UAIA 1TXYA 1RDPD 5LHY1 4NXMQ 4XTCS 2UUBQ 3CC4A 1S5CD 2HQEA 2KCMA 2PCFB 4PZ8A 3RLOA 1ESFA 2FMCA 1QE6A 4R1JA 3I7FA 3UDGA 4H02A 2UU9L 4ZUIA 1J5EQ 2F0JA 3MC0B 3SXHA 2VNUD 2CVRA 4J15A 1SROA 3CKIB 1X32A 3HOWH 1NE3A 3CMEA 5IP7G 3SK6A 4HJAA 1C9OA 1IL8A 1A2UA 4A3EB 4B3MQ 4GKKL 1U9RA 4IUQA 1A8VA 4R4CA 2I5HA 4DV5Q 4HJ8A 1KABA 2F0DA 2EE1A 4UP9A 4ODGA 1O7LA 1IYUA 1JB3A 2H5XA 4Q0FA 4CBVA 5EQ0A 3E9HA 1JE5A 1G2SA 1CI3M 2JEBI 2ICIA 3TP7A 4DV1L 4P2CB 3A5UA 2J7ZA 2HCIA 3M3YH 3HGBA 3J81j 5JPMC 5CV7A 5EGTA 4C3JB 1TWCB 2WKCA 4BBSG 2JA8B 1VQHA 2AUKA 4OONA 2F0SA 4NW2A 3TMEA 2HUGA 3TP6A 3W1BA 4X62L 2A69D 1O80A 5JJZA 4LF8Q 1N36L 1U0LA 2A1AA 4JYAL 1VQAA 1EWIA 2E5LL 1ICFB 1YEZA 4S3SA 4AH6A 1VS0A 1PHJA 2JXMB 1S5FD 2A73B 4IPCA 3KBXA 4QGUA 1SYDA 1XPOA 3I8ZA 5AFWA 2JA5G 4L6TB 3U9SA 2GVBA 4NPSA 5K36G 5C3XA 4EVOA 5KNBA 1D2BA 2SNMA 1Q8KA 5KIXA 3P1HA 2QCPX 5M5YB 1E2WA 2F3IA 1A3UA 5LMNQ 2K01A 1PZJD 2M2LA 5E4WC 1YJ9A 1EQVA 4ME3A 1BO0A 3OIPA 4C3IH 2R7ZH 1SRUA 4A75A 1SYGA 3OOCA 3ULJA 1TWAB 3NENA 4BBRB 3A8JE 3K59A 1VDZA 4K8JA 5IYDH 2ZXPA 3S1QH 3RUZA 1TWHH 5L37A 4TSSA 4B9WA 3J7YW 2JA6H 2B39A 3SVMA 1EQTA 1GM5A 1L0XB 1N34L 3J7A5 3TZDA 4BY1B 2F0LA 3Q8DA 1ZEQX 4CDCC 1V43A 1DYQA 3LWEA 1HXYD 1BDOA 2MJ8A 1TS3A 3I55A 1X3EA 3SK8A 1MBYA 4OL7A 1AN8A 4QQBX 1A3TA 1ILQA 3VR3A 1PMRA 4DGZA 4KJNA 3K7AH 1L1OB 5EPJA 1LTSD 3T56B 1GJXA 2F0EA 4Q5VA 1K8MA 3NEMA 1VQMA 5CV4A 1C4QA 1L0YB 4LFCQ 5FK9C 4O2DA 3T1HQ 1F2YA 1TS4A 1EY7A 3BZDB 3DM1A 1YITA 3K81C 4PMCA 3Q0AA 1H95A 1EIHA 4A3MH 2R93G 4U68A 1X3QA 3I4MB 2EQSA 2BDNA 3GTOB 5M3FH 3A5ZB 3V05A 3PO3B 1K9MC 4OIJA 5FJ8G 1E1TA 1G6PA 3PIOA 3VR2A 4DR4L 1XNRQ 3D3RA 3HOVG 1YIJA 4YHHL 4A93H 5IT9c 4C1NI 1O7ZA 4YY3L 4FDBA 1I6HH 4IUTA 1CSPA 1KTKA 4GNXA 1WTOA 3H3VC 2IJ0A 2JP1A 1JOOA 3QJYA 3T16A 1EIYB 4DR6L 4EGVA 1LTAD 4PG3A 4G7HC 5C4XH 4OHJA 3VR5A 4MNOA 4K5WA 5IGBA 3E5SA 4K0KL 3D4DA 5IWAQ 1E7ZA 4MIUA 3EROA 3V96A 4X3UA 4ZAIA 5CGKA 4NDXA 3EVQA 1S4ZA 1NCVA 3QIAA 2EOTA 4K6LA 3CCUA 3J7AV 3HOUB 1SE8A 4EX5A 2ZM6Q 5C4JB 2DJGC 2MPMA 1QJOA 3H09A 3G7LA 2DY7A 4GLVB 2J0TD 1U4MA 5E3FA 1FJGQ 1OTCA 4KK7A 4O1NA 3RMHA 4A3BG 1PH3A 4OO1I 1NNXA 3T13A 4DAMA 2Q2HA 3PUXA 4RH6A 3SGIA 4A3KG 1A2TA 1UE7A 4BWGB 3HG9A 1SNQA 2KCTA 2NZOA 4YCUA 4GKJQ 5GROA 2H4OA 1KDAA 4IJHA 3JAMc 2YTXA 1HNZQ 1R9TH 3TRZA 4A3FH 3H0GH 4H7BA 4CJ2C 3M9BA 2B8FA 1TWFB 1SSOA 2I46A 2MNAA 5I2YA 2KEDA 4DK3C 4CDDC 1X3PA 1IBLQ 1II3A 1S40A 5M5WB 2BCOA 1YVCA 2K05A 1UAPA 5BN4A 1GUTA 1IBML 1CHQD 5CBAE 2VY3A 4DAYA 1GUGA 1AH9A 1E0BA 1MKHA 1LV9A 4A3LH 2R92B 4JI4L 3OWFA 3UE1A 1JJ2A 2OTLA 2L1BA 3IL8A 4A76A 4P71A 1D5XC 4P72A 4QMGA 3T53B 3MWYW 2CWAA 3G6JB 1ASZA 4X65Q 2RF4A 2N8NA 3QOLA 1CKNB 4PZ6A 3E3XA 4A3DB 2EZVA 1Y1WH 2B2VC 2DJFC 4FP5D 3GTJH 4C3HH 1D8LA 1LTLA 4OEMB 1GKHA 3UDFA 1DONA 1V1PB 4DK6C 5DM63 4PV1C 4X66L 3J81c 3VR6A 5EKLA 5FO9B 3Q24A 5FO7B 2J4XA 4LF6L 1SLJA 2LKVA 1RHPA 1SBBB 3AFQA 5C3WA 5CYUA 3D0FA 1K3BC 3NBHA 3P20A 1LT5D 1EL0A 4JBMA 4ID6A 2HT1A 2IY5B 1X3FA 2IL8A 4KHPQ 2VQEQ 1GXDC 1A62A 2DUDA 2HQLA 3W5OA 1JJGA 2TMPA 1QCBD 2NVYH 2PI2A 1HUMA 1CSQA 3TSSA 2E2JH 2LSSA 2JSOA 1G2TA 2XNAC 1T9HA 3U4VA 4LW1A 1SEBD 2RBMA 3R2IA 2R6GA 1GOZA 4LF7Q 1XJVA 4HEDA 3F2UA 1ENFA 1FNVA 1UE5A 4L5TA 1YJWA 4BBSB 4DR2Q 3QR8A 3OYYA 1B2TA 4DR7Q 4BY7H 1I94L 4B3TL 4ZYSA 1PV4A 1XTDA 4KV6A 1VQBA 2RHQB 1PFSA 4IALA 1W3SA 1BR9A 3R3OA 1JQYD 3NWSA 1IZ6A 3PMFA 3KF8A 2A6HC 1I4PA 2Q2UA 5DM73 2EXDA 2RHSB 1X56A 1Z6HA 3S2DB 2JA5B 2KVMA 2PPBC 2PO4A 4LFBQ 4A3CH 1WYDA 2CQOA 4QCLA 1NUCA 1NJIC 4B3SL 3M4OH 3S1NB 4HJ7A 3CF5A 5C5LA 1EWCA 5M3MB 5LMUL 1YJNA 5EPKA 3KOJA 2XWJB 3U58A 4LF4Q 2LXKA 3CCEA 3N6RA 3K5MA 3BU2A 1PTOB 5E7NA 2Y0SG 3MXNA 4ALPA 4DKAC 2XGTA 1VF5C 2D5DA 1XNQL 3GTKB 2K04A 2K1BA 4ZKCB 1SJED 3OMCA 1QNUA 1NBWA 4X3KA 1CKMA 3GTGB 1YHBA 1PYSB 1M4VA 2NVQH 1QUQB 4U673 3HRZC 1CHPD 2OQ0A 4JI8Q 5JVG3 5ELNA 1S3OA 3URYA 1AEXA 5HURA 5IYCH 4LUZA 1PRTF 2SEBD 4IOAA 2Q2IA 2PZWA 1STBA 5J22A 1Y1VH 4Z9CB 1D5MC 2NN6G 3UE0A 3KF6A 1K8AC 2ZJRA 2EYJA 3CQZH 4DV2L 5C4XG 1X65A 3A55A 2E2IB 4OX9Q 4KN4C 4L5SA 3CRKC 1I4QA 5BN5A 3STBC 1KDBA 3QG1A 3ULLA 1HQRD 1VQFA 4X64L 2F0TA 3A7LA 3BS1A 2XRSD 2X69A 5C4ZA 2CW0C 3QB3A 4X6AH 1EQRA 3DWAA 2R93B 2ICEC 5KGUA 4HR7B 4IPHA 3HOXG 5KEEA 1SMYC 1I6VC 3KK7A 5NUCA 2N55A 1N33Q 4GN5A 3S17B 1AFPA 1Q8IA 3CCVA 3HOUG 2XWBB 3HKZB 1FVIA 3P7JA 1J9OA 2VUMB 3QWNA 2CW0D 4IFDH 2QDLA 1G291 1SE2A 4IO9A 1LT3D 1PH2A 1YI2A 2Z8LA 1UWVA 2Z4HA 3HKZE 1SMYD 3W3AA 5EBCA 4JK1C 4MZ9A 5CV9A 5D65A 5IGEA 1STGA 1TWGB 4XQNA 1N9WA 4JI0L 5D3IB 1EQQA 2WAQG 1I4GA 3OMGA 1Y8OB 2LXJA 1HFNA 4HJ5A 4JI2L 4A3FG 3BYYB 1QWYA 2Z6BA 3NSWA 3VA7A 2PW7A 1N8RC 3FKIH 2PQEA 3VR4A 3RLFA 3H3VH 4NXNQ 3DEPA 3M85A 3VYUA 2FHTA 1AP0A 2JA7G 4IN3A 2F4IA 1EY0A 4NP5A 5IYBG 4FNFA 3K6OA 1RL2A 3ERSX 3KDFA 1UNSA 4R9WA 2F0IA 3BVMA 2IX3A 4J1MA 4ZQ3A 1K83H 5C44H 2K5HA 3EIVA 1FGBD 1WOCA 4A3BB 2EY1A 1PZID 3PUYA 1KD1C 2R3ZA 5JOBA 3FP9A 1KDCA 3KLWA 3HOYB 3K0XA 3GTMB 3S16B 1DCZA 4LMQD 3HZXA 1Q1BA 4DR5L 3OW2A 4WJ4A 5AJ3L 1HH2P 1HNWQ 2NVXB 2WKDA 3SK5A 4MN3A 5BR8Q 3A8IE 2BA0A 4RA8A 3NQIA 1FR3A 3F2CA 2UUBL 4B3RL 3RZDB 4DF7A 4RKBA 4C2MB 2ZTDA 1IBKQ 3RZOB 4C3HG 4A3DG 3KYHC 1A3VA 1WCMH 2JYOA 3TEHB 4FF3A 2PYKA 1J5EL 1F9SA 5D3DA 1PRTC 3CC7A 3FRPB 3OTOL 3K5OA 1ZXTA 2V4DA 2KJXA 1QB5D 2OXPA 3E0JA 4JBJA 1EYGA 1LLRD 1PYWD 5I9OA 1AE3A 5JEAJ 5GAGC 3CCRA 4B3ML 3I90A 1WVLA 4YWMA 1WD0A 4DV5L 1PRTD 3KBGA 1OXSC 4DXGA 3ITPA 3EQLC 3T1YL 2UUCQ 4JI6Q 2UUAQ 1C7YA 5I2XA 1SYEA 4C1NK 3D6CA 3DLLA 1VMCA 2EYLA 3PCOB 4TVAB 1PFNA 4UDUC 4HSVA 4DAPA 1ASYA 2EYHA 3BZCA 2EJFC 5KYLA 2ZTCA 1B8AA 1F77A 4DV7L 2B2VA 1NR2A 1WJJA 3FPPA 3M3YB 3CPWA 3BVGA 1KL9A 1GHJA 4G57A 1VQ9A 1TQOA 2AHOB 4KMUC 2B3GA 2EY2A 4ZCKA 2JEAI 4ZRZA 5T1GA 2O2LD 3CRLC 1BCPB 4YWKA 2PNRC 3MHBA 2F0FA 4DUZQ 4BY7G 5A35A 1X54A 2RCFA 2X6LA 4P75A 4EQPA 5JVH3 4A3JH 1E1OA 2A68C 1MI2A 4E6IA 2DNCA 3J80L 4WJ3M 3E9IA 3CCQA 3WDNA 5FLMH 2UXDL 1TS2A 4GKKQ 3J80i 1GVPA 3WOEA 1YNNC 4HAEA 4A3CG 1I3QB 3G71A 3ULPA 1K28A 1OXVA 2E75C 1UUPA 2A68D 2B63H 5EKKA 4YCWA 3J80E 3X3NA 3I4OA 3MAQA 3RLNA 4UPAA 1IL2A 3AU7A 3S14H 2F4VQ 3U50C 3KJOA 3GTLH 5M3MG 1Z47A 1WD1A 3VA5A 3PF4A 4XIGS 1KC8C 4C3IB 4GLXA 5IE8A 2MFIA 3DHQA 3SHLA 1V1OA 5JPNC 4CDFC 3I73A 5CBEE 3S1QB 1YNXA 2F03A 1TWHB 1WI5A 2R61A 5IIFA 1E2VA 4JYAQ 1ET6A 1KAWA 1QILA 5HGQA 5GAHC 1EYDA 3ZJYC 3AQQA 2IHFA 2BH2A 1G91A 1QVGA 4WJWA 3H91A 2F1MA 4DR3Q 2IHEA 5FLXc 3OIQA 1QZGA 4P73A 2LS01 4DPGA 2C9OA 1K8GA 4RCOA 1O78A 4GOPC 1SXTA 4RHSA 1PH8A 3T1HL 3K7AB 4CJ0B 4A3IH 1HA6A 1HRJA 1RD9D 1YHQA 2KOLA 1K73C 2KECA 4XYOA 3ICEA 2SOBA 3F8TA 1HNXL 2Y0SB 3RN5A 2VS1A 2V1CC 4BBRH 1FNUA 1IKMA 4AQYQ 4LFAL 4DNIA 1Q81C 3TZUA 2N3SA 1PDQA 4N9TA 4PMBA 1VF7A 4G7ZC 4LJZC 5M3FB 5DNFA 2Y0SE 4BY1H 4IPGA 1AW7A 1K0SA 4OWTB 1IKLA 1VQEA 3BDCA 1HZBA 4N9PA 4HMIA 1SYFA 1WTHA 3BDOA 1C8CA 4IFDG 1I6HB 3HKZG 1N32L 4EQNA 4HSPA 3RD4A 2VUMG 1BNZA 1JE4A 2JA9A 2R7FA 2JK8A 4IURA 2E2HH 3C1FA 4KN7C 5C4XB 4UP8A 1RIPA 3M4YA 1NMFA 4IFDI 4QL5A 1XX8A 1ONLA 2VB2X 1BF4A 2MHVA 3I2ZA 4ABNA 4GNXB 3GTPB 2QEJC 1JC7A 4KHZA 4A3GG 1RTNA 2NVTH 4N8FA 3PO3H 2Z9HA 3WOFA 1A15A 4LUOA 1ILPA 2F0MA 2KEEA 1FNWA 1FJGL 1WTXA 5IP9H 1S5ED 1XPRA 2Z4IA 3HOXB 2I0QA 1LYLA 1Q12A 2RDFA 1HA5A 3NP8A 2NBFA 1B9NA 2MP1A 1TKWB 3H3VI 4YHHQ 2ATWA 2WB1G 1DZ1A 4XDXA 1ZYRC 4OO1G 2E74C 1HR0L 2PQAA 4YY3Q 3C2PA 4GKJL 2A5HA 4K5VA 1NSNS 1HNZL 1XYIA 1JWUD 3WWVA 4DR6Q 1V8QA 1SE4A 5KYIA 4Y7NH 2OT2A 1VQIA 4KD4A 1SNCA 4HIOA 5JJLA 1G8ZD 1I5FA 1LUZA 3HOZH 2WAQB 3CCLA 3HOYG 3U9OA 1ZYRD 1S5DD 1R9TB 4A3FB 3H0GB 4K0KQ 1I50H 1CT1D 1NY4A 5C4JH 1XPUA 5JEAH 2O5IC 4IFDJ 1K3RA 3JC66 2WAQE 1MHWC 4CKEA 4LNQA 3EFXD 1LABA 4X3SA 2YYZA 5KNCA 2SNSA 2JA7B 5IGCA 3FPUB 1ENCA 1GHKA 1EEID 3AYHB 1TU2B 4EQOA 2Q2TA 3K5LA 5H1SE 2O5JC 2ZJPA 1VCIA 1LTRD 2IX0A 4X3TA 3CCMA 3PUVA 4BXXH 1Q46A 1GUOA 1PH4A 2K52A 4ZUJA 4X65L 1QNKA 3GDEA 3NQTA 4DAYB 3FEWX 3HOWG 2L11A 2AWNA 3S1MH 2FJ2A 4CKCA 3O13A 2ZXOA 4ME5A 2DGYA 3DM3A 4KY7A 1DJRD 2RSOA 3D8GA 4K8IA 4K2LA 1Y1WB 1QVFA 3I70A 3K57A 5IGDA 4C3HB 3PO2H 1BBUA 4KKSA 1VQDA 4CKBA 2ES2A 5IT9L 2ID0A 1B70B 1PH6A 4DV6L 1IBMQ 1BBWA 1HPCA 2EIFA 5ELFA 1BKBA 5A2QL 1K0RA 4FVMA 2CWPA 3M7GA 1SNPA 1TIID 2DN8A 5IT9E 4JI4Q 1HHVA 4R4QA 4JI3Q 1CKOA 4JI5L 1WTRA 4KLKA 2Q8RE 4A3JG 3EBEA 1IYJB 1Z7TA 2DY8A 3SR1A 2MGSA 5FLMG 5A2QE 3M4QA 3KLRA 5GQOA 3BVZA 2HDLA 2K7VA 1PH7A 2KBNA 5IGFA 2IT1A 2NVYB 3MXUA 3NBHB 2F0KA 2E2JB 3IKJA 3HP3A 1J6QA 3VYRA 5IODA 2B63G 2UXCL 1JR0D 3CCSA 1EY5A 2QDBA 4GLAC 1JJCB 2VQFL 1HTLD 1GD7A 2K5QA 4LF5L 1KAAA 1CQVA 1F2ZA 2WFWA 2WINB 1EZ8A 1BVSA 2PZTA 2LFNA 4OGQC 1VQPA 5IP7H 3EJIA 3ERQA 4BY7B 5IY0A 4X66Q 4HTHA 3DMUA 3CMAA 1M1KC 4C3IG 2R7ZG 2KA7A 3FMCA 5ELEA 3KJPA 2PI2E 4LF6Q 2G5DA 2XIWA 3RN2A 2EVBA 5ISRA 5IYDG 5C0XJ 4FO2A 5I4DA 3JAML 1FD7D 2JA6G 2BDOA 1VQJA 3JAMi 3NPPA 3MFGA 4POFA 3S1RH 3NELA 2HDMA 3CW2C 4DV4L 1YNJC 1I4RA 1Q82C 4RGMA 2WP8J 4FYDA 3GV3A 1GUWA 4OWXB 4IPDA 1VQ8A 5I9PA 4DR1Q 2CKZB 4OIKA 3KF8B 4QF4A 3JAME 2K4KA 4A3IG 3DXJC 1LACA 3IFTA 4J8QA 1PH5A 3AFPA 4DV3L 2UXBL 2HIXA 3L9AX 3C46A 1L2FA 2A6HD 1H9JA 3GV6A 4JI8L 1YNJD 1R4PB 3Q6SA 1R4QB 1Z9FA 4RHRA 4JV5Q 2NVQB 2AUJD 1YBYA 4I65A 4IOCA 4B3TQ 1L1OC 3J7ZC 4JI1L 3MXNB 1F2LA 1HTPA 5KNDA 2ZXRA 4A3MG 3J7AF 5K36H 5M3FG 2IX1A 4A93G 3S1NH 1SNMA 1FYCA 1Y1VB 2B2TC 4DUYQ 1SNOA 2D2CC 3AMUA 1P8LA 3CQZB 3TN2A 4FXDA 2RVLA 1PTOH 4B3SQ 2NTTA 2XRQD 1VQOA 4H13C 4JPBW 1WTPA 2KCNA 1LO5D 5LMUQ 2ALYB 4PQXA 4NB3A 3GTGH 4GOPA 1EOVA 3K58A 2EJMA 4CDEC 4JI7L 1ENAA 3MEHA 1XMOL 4HMJA 4PNYA 4HIKA 2JJQA 3KF6B 3ER0A 3J81L 4JVZA 1KHIA 2MO0A 1XNQQ 1W6JA 1BQQT 1LTID 2KCCA 3J81i 5C4HA 2CHBD 1D1KA 3E0EA 3TBIB 5DAUA 4LF9L 1STYA 5EPLA 4RCNA 4P74A 3Q22A 4PZ7A 2EYMA 4DK1A 4KY6A 2AQ3B 1X6OA 5C6AA 2EY5A 2IW3A 3J81E 3GO5A 2LMCB 3R93A 3MFYA 3STBD 1CUKA 2OWOA 2F0OA 1EYCA 2Z1CA 2E2IH 2RQXA 3LGJA 1HZAA 1EWHA 3MVVA 2K5WA 4K2KA 3NBIA 3NXWA 4DV2Q 1WTVA 1Q90A 1TS5A 2E8GA 1OXTA 2R93H 3S15H 4A3GB 2OEOA 2B2WC 3FKIB 3A7AB 3LNNA 1B9MA 1SFOH 5JEAG 1EYAA 3H0GG 2KUMA 4F87A 3HOVH 4NMZA 3MA2B 4HCSA 3ND8A 3CCJA 1Y14B 1VQ5A 1Q1EA 2A19A 2E2DC 1XMQQ 4BS9A 2HHHQ 3H94A 1WTWA 1HCZA 5G3LF 2K28A 1U5KA 4UHVA 4DV0L 1YZ6A 2WB1B 3W1GA 1K83B 5C44B 3OW7A 2XN9C 1PVOA 1CQFA 2KHIA 5C5MA 3GTQH 3DUZA 1HNWL 1CK1A 4G7OC 4A3LG 3KDFB 1S72A 1TY0A 1U4RA 2WB1E 2F0WA 3TS0A 4GZYC 3CAMA 3ZYYX 4JI0Q 1YHAA 3EA6A 1IBKL 1HZCA 1PTOF 5D14A 4H44C 3F1ZA 3D4RA 5M5XB 3OSOA 4XQQA 3I4NH 1EU3A 4JI2Q 2NUCA 4RWSC 1EOTA 3L3OC 4I7AA 1JT8A 4R8NA 2YU9H 3I91A 3T51B 3NE5B 4NXML 3PO2G 1WCMB 1Y1WG 4R4IA 4RAUC 3BJUA 1B50A 4KY5A 2L0CA 2GA4B 3S2HH 3LX0A 3PIO3 4F8MA 1HR0W 3LWUA 4QY7A 5ELDA 3N52A 4RGOS 1HZ9A 4B08A 1PLFA 2F0QA 1EEFD 1JCKB 1T5XD 1H9SB 2F3WA 4HIMA 2X6GA 1T5EA 1HQMC 4A3KH 4FF4A 5E4XA 5EKIA 1FGUA 4ZLTF 3UDXA 3PV0A 4IQZA 5C3EH 1NR4A 3OHXC 4WFN3 2NVXH 3CHBD 4BA1I 2OTJA 4KKTA 2KENA 3HOWB 1V1QA 1GO3E 3H15A 4DR5Q 5EBDA 3RZDH 1F2MA 4I7ZC 2K5NA 4C2MH 2M00A 3KUPA 2L12A 4IUUA 2D0OA 4O0AA 2L4NA 4B3RQ 2I5LX 3M7NA 3BZKA 3PF5A 3C1EA 2A74C 5I6WA 3PGZA 2VW9A 4DUZL 2OQKA 5C0XH 4AYBB 4WORA 3L2PA 3X3MA 2OF1A 1OXUA 3A74A 3OTOQ 1JMCA 4LF8L 4V190 2ASBA 3MXGA 1EY9A 5HGTA 2B2UA 4AYBE 4TKOB 1B7YB 1EY6A 2UU9Q 3EN2A 1X55A 4A3JB 3A0JA 4FXKC 4LWCA 1O7IA 5TSSA 2ZJQA 4A3EH 1OO9B 2N49A 2RDHA 3GD7A 5J1ZA 3T1YQ 1ICWA 4IJLA 2B29A 2A69C 3CP0A 1S5BD 1NAPA 3AB9A 5CORA 2F4VL 4L5QA 3UDIA 1IYVA 2PNHA 5E1FA 2QF7A 5LMNL 4K14A 2B63B 4XXEA 4LAAA 3S14B 4DV7Q 4HJ9A 3GTLB 1JICA 3UI2A 4DV1Q 4C3JH 4APVA 1TWCH 5KRUA 2JA8H 2QW7A 4OWWB 3NTIA 1P16A 3QO2A 2Z6KC 1YNND 1CZWA 1BXTA 2NYZD 4ULLA 4POGA 1NMGA 2R7ZB 5G3LD 4DR3L 5IGGA 3NWTA 2F0UA 4X62Q 1PTOC 2NB0A 2JA6B 1N36Q 3S9WA 1A0IA 1I3QH 5BN3A 1VQ6A 3KFUA 3T4AC 5FO8B 2E5LQ 2UXDQ 4C56C 3AEVA 5IYCG 5M5YH 2EYFA 4DNTB 2JQOA 4YIJA 5FKAC 1PTOD 4AQYL 1Y1VG 4A3IB 1EZ6A 4LFCL 1EU4A 2QGQA 1I4HA 1MIUA 1VQGA 2EXZA 3L0OA 3F2BA 2IPKD 1SDFA 3KLSA 4M8AA 3HKSA 2PW5A 5JJKA 3NK9A 4XT1B 1TWAH 3A56A 4FXGC 5J39A 1MGSA 5EAYA 2EYOA 1XNRL 3BDLA 2M9VA 2WIIB 3D4WA 4A3MB 4DU9A 2HIVA 4RMFA 4LK1C 1L1OA 4A4IA 1AZPA 4A93B 2QILA 1N34Q 3IAYA 2BA1A 3PUZA 2E2HB 1SAPA 2XTIA 4HN7A 2B2TA 2EYPA 1O7YA 4EQ5A 1VQCA 5IWAL 1SYCA 1DD2A 1HNXQ 2NVTB 3D6WA 3CXCA 5GADC 4L63B 1W2BA 1A6XA 4LFAQ 4QUFA 3I56A 2K03A 2VXWA 1BCPF 1J8IA 2ZM6L 3I4MH 2XSCA 3GTOH 3FKIG 2F52A 2QA4A 3BYTB 1B53A 5J3BA 1M90C 1V9PA 2NZHA 4DXFA 1K8OA 4L5RC 2BH8A 1I4XA 3I4LA 2NN6H 3G6EA 2YTYA 2ENBA 1KNAA 4PMWA 1RODA 4DR4Q 2QKIC 3K5NA 2OCEA 1CA6A 1N32Q 3C3LA 2F0HA 4ZKBB 3IRBA 5C44G 1NTGA 4HCEA 1SJHD 4V0BA 3GTPH 4Y7NB 1E24A 1MJEA 4DN4M 5GAEC 3I3CA 3HOZB 2RCNA 2B2YC 2PQAB 2NZ1D 2YTVA 1CFMA 2D0PA 1LTBD 3I4NG 1L0WA 1I50B 4B9XA 3HOXH 1KQSA 1C0AA 1F9RA 1IBLL 1RCVD 1PFMA 5DLQE 2VB3X 3NTKA 3HOUH 2K50A 1KRSA 2B2WA 3HFZB 1BBXC 5COYA 1LT6D 3CPFA 1G6ZA 2IWHA 4YCVA 1WCMG 4DA2A 2KHJA 3S24A 3NUCA 5FLXL 1EIFA 1HFGA 1EFID 3TDQA 2E76C 1HR0Q 1Q3LA 1SMXA 1XWEA 2MUYA 5C3EG 3CU7A 1JORA 3SE0A 1EUJA 2F0GA 5CR3A 1DOLA 4JW0A 1VQ4A 2JN4A 5CV6A 3S1MB 5FLXE 2K75A 1DM0B 4KKUA 1C48A 2EPBA 2BE5C 2PMZB 2K5VA 2AQ2B 3OWEB 4RGTA 4F7XA 1TWFH 4O42A 3VYTA 2JA7H 1TY2A 3OPOA 5IYBH 4QJFA 2Q8TA 1UEBA 5IOCA 1UEAB 4CJ1B 2BOSA 3FHWA 2CH4W 2PMZE 4J6HA 5CV5A 4F88A 3PO2B 1JOQA 2N88A 4DNRB 5M5WH 3SDZA 1D6EC 2BE5D 1DOKA 5C0XG 3GTJB 1JOKA 3VYSA 3L7ZC 1A63A 3PSIA 4JI3L 2SDFA 3K7UC 4OELB 1TT2A 1KLGD 2I5MX 5JAVA 2R92H 4AYBG 3TREA 1EY4A 4JOIA 1X9NA 3SK4A 1EY8A 2CFMA 1LTGD 2B2UC 1CZGA 1RKNA 1CKNA 1VMPA 5C0XI 1H9RA 1UE6A 2C35B 1PH1A 1SR3A 1FL0A 1G51A 3NHHA 3K0YA 4FF2A 2Z0SA 2K32A 2RSNA 4A3EG 4XYQA 3PIP3 4QIWB 1PRTB 2VQEL 4KHPL 1RF2D 1KNEA 1MJCA 1SN8A 4TQUS 2PZUA 2FFKB 1BCPC 1WTQA 1V1PA 4A3DH 1PZKD 4JBKA 3D31A 4WRDA 4QIWE 1D1IA 5ELCA 3NTHA 4UY8C 1U4LA 2GVAA 2FINB 2TSSA 4LF7L 1VQ7A 1DOMA 3A8KE 4KJOA 1TR5A 4DR2L 4C3JG 1BCPD 2LY7A 3B6YA 4IUNA 4DV6Q 2JA8G 4K5XA 4DR7L 1ESRA 1OXXK 3RR5A 1VQNA 1W6KA 2B8GA 3PQIA 4M1UB 1E2ZA 3IFDA 3HS0C 2WACA 3K80C 2MQHA 3K8AA 3TQYA 1MSHA 4JI5Q 1X3GA 1BOSA 1GUSA 2RA4A 3ND9A 4MTKA 3PUWA 1HUNA 4LFBL 4DR1L 3S1RB 1HJPA 2KQ3A 3RNUA 5EJWA 5ELOA 2I07B 4HIDA 3ONAB 4ZK9B 5CV8A 2F0NA 4LF4L 1LM0A 4KD3A 2UXCQ 4R8IA 4RGNA 4JV5L 5T1IA 2L5TA 1IXRA 1QVCA 2VL6A 3M4OB 2VQFQ 4LF5Q 1TVXA 4BBSH 2HD3A 3MEFA 3F2DA 2RDGA 1MD2D 1B4OA 2QEXA 3G48A 5M9OA 4BBRG 3FVQA 1B3AA 2HCCA 2Z6KA 1QZHA 3SEBA 4IUVA 3G4SA 1AE2A 2CQAA 2L55A 4R4OA 4FF1A 1RJTA 2GN5A 4BY1G 4DUYL 3I72A 1I94Q 3A54A 5LL6S 1H9MA 4KTAA 3Q23A 3S2DH 2JA5H 2Q8IB 1Y69U 5LMNW 5ELBA 4BA2I 2F0VA 3HEJA 1JB7A 1Y8PB 4GN3B 4DV4Q 4OX9L 4IUPA 3M4PA 5M3MH 4Y52H 1Q7YC 1QUQA 4QB4A 4LUVA 2NTSA 1DXMA 4GS3A 2C5CA 4DV3Q 2UXBQ 1PH9A 3R2TA 3GTKH 1B3QA 4QUCA 5FOBB 4CHTB 1WFQA 2G9DA 4DFAA 3CC2A 3TP5A 1LTTD 2MO1A 3I4MG 3H6MA 1N33L 4H0LC 3PO3G 1VQLA 4GOPB 1KXLA 1F9PA 1STAA 4AIMA 1IW7C 4GNXC 2P5ZX 4JI1Q 4L8JA 5IP9G 1D7QA 2AWOA 1PFBA 2O4XA 1Y8NB 2AKWB 4CGYB 5HY6A 4RFBA 1KLUD 1SNDA 1KRTA 2RKSA 4JG2A 3MZ5A 2NN6I 1IW7D 1CA5A 2AMCB 4GN4B 1PYBA 2G9HD 2D62A 2L9HA 3MXPA 3U4ZA 1CM9A 2L15A 3S15B 1UE1A 1U4PA 4JI7Q 3HOZG 1XMOQ 4NXNL 1XMQL 4N8X1 2D9UA 1SFOB 4K6DA 1E3PA 2JE6I 1Q86C 2HHHL 4OXPA 2KHSA 3HOVB 5F2DA 1XXGA 4JCVE 1STHA 4X64Q 2FMMA 5FJ8H 4LF9Q 3DWPA 3S17H 5DEHA 2VZAA 2A6EC 3GP7A 1BUVT 2VUMH 1B44D 1GUNA 4YWLA 1H9KA 1E22A 2ZT9C 3CD6A 3MTSA 1QOHA 3PIPA 3GTQB 1IHZA 5K5PA 3R8BA 2CCZA
chains in the Genus database with same CATH topology
3WWVA 4L5TA 1UE5A 4DR6Q 1YJWA 2JA8H 4Y7NH 4OWWB 4DR2Q 1TWGH 4MTNA 1P16A 4BXXG 1VQIA 4HIOA 5JJLA 2Z6KC 4A3GH 1I5FA 1LUZA 3HOZH 3OYYA 3CCLA 3HOYG 4BY7H 4DR7Q 5BR8L 1I94L 4B3TL 1PV4A 3J80c 1XTDA 4POGA 1VQBA 2RHQB 1NMGA 1PFSA 4K0KQ 4DR3L 1I50H 2N78A 1W3SA 1NY4A 4X62Q 5C4JH 1XPUA 1IZ6A 2Q2UA 4IFDJ 1K3RA 3JC66 2WAQE 1A0IA 1N36Q 1I3QH 2K14A 2EXDA 4LNQA 2RHSB 1X56A 1VQKA 1VQ6A 2YYZA 3KFUA 3TS2A 2E5LQ 2UXDQ 4LFBQ 3AYHB 3AEVA 4A3CH 1WYDA 2FXQA 2CQOA 2R7DA 5IYCG 4JBWA 2Q2TA 1NJIC 5H1SE 5M5YH 2JQOA 4B3SL 2ZJPA 3M4OH 4HJ7A 1VCIA 3CF5A 4AQYL 1Y1VG 5LMUL 2IX0A 4DV0Q 1YJNA 2R92G 1PA6A 3KOJA 3U58A 4LF4Q 2LXKA 4JC0A 4JOIC 4KI0A 4LFCL 3CCEA 3PUVA 3CCMA 4A3BH 2QGQA 1Q46A 3BU2A 4BXXH 4UP7A 1PH4A 5JJIA 1MIUA 5E7NA 2K52A 2Y0SG 4ALPA 1VQGA 4DKAC 3GTMH 2XGTA 3L0OA 4X65L 3HOYH 3S16H 3F2BA 3GDEA 1XNQL 1DGSA 2UUCL 4JI6L 5M5XH 4DAYB 1NBWA 3HOWG 1CKMA 3HKSA 2UUAL 1YHBA 5JJKA 1PYSB 2AWNA 4R4TA 1TWAH 2ZTEA 4RG1A 1EFWA 2NVQH 3S1MH 1QUQB 2DGYA 3DM3A 5EAYA 2OQ0A 4JI8Q 1XNRL 5ELNA 1S3OA 2HIVA 4RMFA 5AJ3Q 3VDYA 1QVFA 2YV5A 2A8VA 1L1OA 4A4IA 3RZOH 5IYCH 1KIXA 4LUZA 1TXYA 3PO2H 4IOAA 1BBUA 2Q2IA 1VQDA 2ES2A 4XTCS 4NXMQ 2UUBQ 1Y1VH 3CC4A 2KCMA 2ID0A 1N34Q 1B70B 2NN6G 4PZ8A 3UE0A 3KF6A 1PH6A 3RLOA 2BA1A 1K8AC 3PUZA 4DV6L 2ZJRA 1IBMQ 3CQZH 4R1JA 4DV2L 5C4XG 1BBWA 3I7FA 3UDGA 2XTIA 4H02A 1X65A 2EIFA 2UU9L 4OX9Q 4L5SA 1BKBA 1J5EQ 2VNUD 4EQ5A 1VQCA 1K0RA 5IWAL 4J15A 1SROA 2CWPA 3STBC 3HOWH 4JI4Q 1NE3A 3ULLA 1VQFA 4R4QA 1CKOA 4JI3Q 3CMEA 5IP7G 4X64L 4JI5L 1HNXQ 4HJAA 4KLKA 4A3JG 3CXCA 5GADC 1C9OA 1W2BA 3EBEA 1IYJB 4LFAQ 4GKKL 4B3MQ 3I56A 4X6AH 1EQRA 2ZM6L 5FLMG 3I4MH 3GTOH 3M4QA 1A8VA 4R4CA 3FKIG 2I5HA 4IPHA 3HOXG 4DV5Q 5GQOA 4HJ8A 2F52A 2QA4A 4UP9A 5J3BA 1PH7A 2KBNA 1M90C 1N33Q 2H5XA 4GN5A 1V9PA 3E9HA 1JE5A 2IT1A 3CCVA 3HOUG 1FVIA 2JEBI 2NZHA 4L5RC 4DV1L 3NBHB 2BH8A 1J6QA 2B63G 2UXCL 3G6EA 2YTYA 4PMWA 3A5UA 1G291 3CCSA 4IO9A 1PH2A 4DR4Q 2VQFL 4GLAC 1JJCB 1YI2A 2OCEA 1N32Q 1UWVA 3M3YH 3HKZE 1GD7A 4LF5L 3J81j 3IRBA 5C44G 1NTGA 2WFWA 4MZ9A 1BVSA 4BBSG 3GTPH 1VQHA 1E24A 1MJEA 1N9WA 4OONA 3W1BA 4JI0L 1VQPA 5IP7H 4X62L 5GAEC 1EQQA 2WAQG 4LF8Q 5IY0A 1N36L 4X66Q 2RCNA 2LXJA 4HJ5A 3CMAA 1U0LA 2A1AA 2PQAB 4A3FG 1M1KC 4JI2L 2YTVA 2R7ZG 4JYAL 1VQAA 1EWIA 2D0PA 3I4NG 1L0WA 2E5LL 3KJPA 1YEZA 2PI2E 1N8RC 4LF6Q 3FKIH 4AH6A 1VS0A 3HOXH 3RN2A 1PHJA 1KQSA 1C0AA 5IYDG 1IBLL 5C0XJ 4IPCA 5DLQE 3RLFA 2JA6G 3H3VH 4QGUA 4NXNQ 3HOUH 3M85A 2K50A 1XPOA 1VQJA 3JAMi 1KRSA 2JA5G 2JA7G 3HFZB 5IYBG 4POFA 3S1RH 3NELA 2GVBA 4NPSA 5K36G 3CW2C 1RL2A 3ERSX 3KDFA 3CPFA 4DV4L 1Q8KA 1Q82C 4YCVA 2WP8J 4OWXB 1WCMG 4IPDA 1VQ8A 2KHJA 3S24A 2F3IA 4DR1Q 2CKZB 1K83H 3KF8B 5C44H 2K4KA 2K5HA 1EIFA 3EIVA 4A3IG 5LMNQ 1PH5A 1WOCA 3PUYA 3AFPA 4DV3L 2UXBL 1KD1C 1HR0Q 2HIXA 1L2FA 1SMXA 3FP9A 5C3EG 1YJ9A 3KLWA 3K0XA 4JI8L 1EUJA 4ME3A 4DR5L 1Q1BA 1VQ4A 4C3IH 2R7ZH 3OW2A 1Z9FA 1SRUA 4A75A 4WJ4A 4JV5Q 3ULJA 5AJ3L 1HH2P 2K75A 1HNWQ 1YBYA 3NENA 4IOCA 5IYDH 3S1QH 1TWHH 2JA6H 5BR8Q 2K5VA 1L1OC 2BA0A 3J7ZC 4B3TQ 1TWFH 4JI1L 3MXNB 3F2CA 2JA7H 4A3MG 2UUBL 5IYBH 1GM5A 4QJFA 4B3RL 1N34L 3J7A5 1UEBA 5M3FG 2ZTDA 3Q8DA 1IBKQ 2IX1A 3FHWA 2PMZE 3KYHC 4A3DG 1WCMH 4A93G 1V43A 3S1NH 3TEHB 5M5WH 1J5EL 3I55A 1X3EA 4QQBX 5C0XG 3CC7A 3L7ZC 4DUYQ 1A63A 3PSIA 3OTOL 1P8LA 4JI3L 3K7UC 2I5MX 4B3SQ 4JBJA 1VQOA 3K7AH 1EYGA 1L1OB 2R92H 4AYBG 3TREA 1X9NA 4JOIA 5LMUQ 1AE3A 5JEAJ 5GAGC 2ALYB 3NEMA 2CFMA 4NB3A 3CCRA 4GOPA 1VQMA 4B3ML 4YWMA 3GTGH 5C0XI 1CKNA 1EOVA 4LFCQ 1UE6A 2C35B 1PH1A 1SR3A 4JI7L 1FL0A 1G51A 1XMOL 4DV5L 4HIKA 4O2DA 2JJQA 3T1HQ 3KF6B 3ER0A 1OXSC 1KHIA 2MO0A 1YITA 2Z0SA 1XNQQ 3K81C 3T1YL 2UUCQ 4JI6Q 4A3EG 3J81i 1H95A 4A3MH 3E0EA 2UUAQ 2R93G 4KHPL 2VQEL 1C7YA 2EQSA 4LF9L 5M3FH 3A5ZB 1MJCA 4P74A 1K9MC 1SN8A 4PZ7A 5FJ8G 1E1TA 4TQUS 3DLLA 1G6PA 3PIOA 4DR4L 1XNRQ 3HOVG 4JBKA 1YIJA 4A3DH 3PCOB 4YHHL 4A93H 4TVAB 5IT9c 1X6OA 3D31A 3GO5A 3BZCA 1ASYA 4QIWE 3STBD 2ZTCA 1B8AA 4UY8C 4YY3L 4FDBA 1I6HH 1CUKA 1CSPA 2GVAA 4DV7L 4GNXA 2OWOA 1WJJA 4LF7L 1VQ7A 2E2IH 3LGJA 3CPWA 1HZAA 4DR6L 1EIYB 1KL9A 4DR2L 4PG3A 5C4XH 1VQ9A 3B6YA 2JA8G 4DV6Q 2AHOB 4MNOA 4DV2Q 2B3GA 4DR7L 2JEAI 1OXXK 2E8GA 4YWKA 3RR5A 4DUZQ 4BY7G 1VQNA 4K0KL 1OXTA 1X54A 5IWAQ 2CCZA 1E7ZA 2R93H 3S15H 4P75A 3K80C 2MQHA 4A3JH 1E1OA 3K8AA 3TQYA 1SFOH 4JI5Q 1X3GA 5JEAG 3H0GG 3CCUA 4WJ3M 3HOVH 3E9IA 3CCQA 1SE8A 5FLMH 3PUWA 2UXDL 4GKKQ 4EX5A 4DR1L 3J80i 4LFBL 3CCJA 1GVPA 1Y14B 2ZM6Q 1HJPA 1VQ5A 1Q1EA 2A19A 4A3CG 3RNUA 1XMQQ 3G71A 2HHHQ 5ELOA 3ULPA 4GLVB 1OXVA 1U5KA 4DV0L 4HIDA 1FJGQ 1YZ6A 1OTCA 3W1GA 2B63H 4LF4L 4YCWA 3I4OA 1LM0A 3RLNA 1PVOA 4UPAA 1IL2A 2UXCQ 3S14H 4JV5L 2KHIA 2F4VQ 4A3BG 3U50C 3GTQH 1IXRA 3KJOA 1QVCA 2VL6A 1PH3A 3GTLH 4DAMA 4OO1I 2VQFQ 1HNWL 2Q2HA 5M3MG 4A3LG 3KDFB 1Z47A 1S72A 3PUXA 4LF5Q 4BBSH 3PF4A 3MEFA 2WB1E 3SGIA 3F2DA 4XIGS 3TS0A 4A3KG 1KC8C 1UE7A 3CAMA 2QEXA 5IE8A 4GLXA 2KCTA 2NZOA 4YCUA 4GKJQ 5GROA 3G48A 4JI0Q 1YHAA 2MFIA 4IJHA 4BBRG 3JAMc 1HZCA 2YTXA 1IBKL 1HNZQ 1R9TH 3TRZA 4A3FH 1YNXA 3H0GH 3F1ZA 1WI5A 1QZHA 2Z6KA 3M9BA 3I4NH 4JI2Q 3G4SA 1AE2A 4R4OA 4JYAQ 1KAWA 5HGQA 1JT8A 2YU9H 5GAHC 2MNAA 2GN5A 4BY1G 4DUYL 3ZJYC 1I94Q 3AQQA 2IHFA 2BH2A 4DK3C 1IBLQ 3S2DH 4NXML 2JA5H 1QVGA 3PO2G 4DR3Q 1S40A 1Y1WG 2IHEA 4R4IA 5FLXc 5LMNW 1YVCA 3BJUA 1QZGA 4P73A 4BA2I 1IBML 4DPGA 1JB7A 4GN3B 3S2HH 1K8GA 2VY3A 4DV4Q 1HR0W 4OX9L 4QY7A 4GOPC 1AH9A 1HZ9A 1MKHA 4Y52H 3M4PA 5M3MH 3T1HL 1PH8A 4A3LH 1Q7YC 1QUQA 4A3IH 1YHQA 1K73C 4HIMA 3ICEA 4JI4L 4A3KH 3F8TA 4LUVA 4GS3A 3UE1A 1FGUA 3UDXA 3PV0A 1HNXL 5C3EH 3RN5A 2VS1A 2V1CC 1JJ2A 2OTLA 4DV3Q 2UXBQ 1PH9A 4BBRH 4A76A 4AQYQ 2NVXH 3GTKH 4P71A 4BA1I 4LFAL 2OTJA 4DNIA 2KENA 1Q81C 1V1QA 2N3SA 1GO3E 4P72A 3H15A 1WFQA 4DR5Q 3CC2A 2CWAA 2MO1A 3RZDH 3I4MG 1ASZA 2K5NA 2Y0SE 4C2MH 4X65Q 4IPGA 1VQLA 4BY1H 1N33L 2RF4A 3PO3G 4GOPB 4OWTB 2N8NA 2D0OA 1CKNB 1KXLA 4PZ6A 4O0AA 4AIMA 1VQEA 1Y1WH 4GNXC 4JI1Q 1HZBA 5IP9G 4B3RQ 1D7QA 2AWOA 2I5LX 3M7NA 3GTJH 4IFDG 4C3HH 3BZKA 3HKZG 3PF5A 1D8LA 1N32L 2AKWB 1LTLA 5HY6A 3PGZA 2VUMG 2JA9A 2VW9A 2R7FA 2JK8A 1GKHA 2OQKA 4DUZL 3UDFA 1KRTA 3L2PA 2E2HH 4JG2A 4UP8A 4DK6C 1RIPA 1OXUA 2NN6I 3A74A 1NMFA 3OTOQ 1JMCA 4IFDI 2AMCB 4LF8L 2ASBA 4QL5A 4X66L 3J81c 4GN4B 1PYBA 2D62A 3U4ZA 3I2ZA 4GNXB 4AYBE 4LF6L 2L15A 1SLJA 3AFQA 1B7YB 4KHZA 1UE1A 4A3GG 2UU9Q 4JI7Q 3EN2A 1X55A 3D0FA 2NVTH 1XMOQ 3HOZG 3A0JA 4LUOA 4LWCA 4NXNL 1XMQL 3PO3H 1O7IA 1Q86C 1E3PA 2JE6I 2HHHL 4A3EH 2ZJQA 4JBMA 4OXPA 2N49A 2HT1A 2IY5B 3GD7A 3T1YQ 1FJGL 4JCVE 4IJLA 1X3FA 2B29A 5IP9H 1XPRA 4X64Q 2VQEQ 4KHPQ 1A62A 5FJ8H 2I0QA 4LF9Q 1LYLA 1Q12A 2DUDA 2HQLA 3CP0A 3W5OA 3S17H 1JJGA 2VZAA 2F4VL 2NVYH 4L5QA 3UDIA 2PI2A 2PNHA 1CSQA 3H3VI 4YHHQ 2VUMH 2E2JH 2LSSA 5LMNL 2ATWA 2WB1G 4YWLA 1E22A 4OO1G 3CD6A 1HR0L 1T9HA 2PQAA 4YY3Q 4DV7Q 3U4VA 3PIPA 4HJ9A 4GKJL 4LW1A 2R6GA 1HNZL 4LF7Q 4DV1Q 1XJVA 4C3JH 4APVA 1TWCH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WWV A;  4L5T A;  1UE5 A;  4DR6 Q;  1YJW A;  2JA8 H;  4Y7N H;  4OWW B;  4DR2 Q;  1TWG H;  4MTN A;  1P16 A;  4BXX G;  1VQI A;  4HIO A;  5JJL A;  2Z6K C;  4A3G H;  1I5F A;  1LUZ A;  3HOZ H;  3OYY A;  3CCL A;  3HOY G;  4BY7 H;  4DR7 Q;  5BR8 L;  1I94 L;  4B3T L;  1PV4 A;  3J80 c;  1XTD A;  4POG A;  1VQB A;  2RHQ B;  1NMG A;  1PFS A;  4K0K Q;  4DR3 L;  1I50 H;  2N78 A;  1W3S A;  1NY4 A;  4X62 Q;  5C4J H;  1XPU A;  1IZ6 A;  2Q2U A;  4IFD J;  1K3R A;  3JC6 6;  2WAQ E;  1A0I A;  1N36 Q;  1I3Q H;  2K14 A;  2EXD A;  4LNQ A;  2RHS B;  1X56 A;  1VQK A;  1VQ6 A;  2YYZ A;  3KFU A;  3TS2 A;  2E5L Q;  2UXD Q;  4LFB Q;  3AYH B;  3AEV A;  4A3C H;  1WYD A;  2FXQ A;  2CQO A;  2R7D A;  5IYC G;  4JBW A;  2Q2T A;  1NJI C;  5H1S E;  5M5Y H;  2JQO A;  4B3S L;  2ZJP A;  3M4O H;  4HJ7 A;  1VCI A;  3CF5 A;  4AQY L;  1Y1V G;  5LMU L;  2IX0 A;  4DV0 Q;  1YJN A;  2R92 G;  1PA6 A;  3KOJ A;  3U58 A;  4LF4 Q;  2LXK A;  4JC0 A;  4JOI C;  4KI0 A;  4LFC L;  3CCE A;  3PUV A;  3CCM A;  4A3B H;  2QGQ A;  1Q46 A;  3BU2 A;  4BXX H;  4UP7 A;  1PH4 A;  5JJI A;  1MIU A;  5E7N A;  2K52 A;  2Y0S G;  4ALP A;  1VQG A;  4DKA C;  3GTM H;  2XGT A;  3L0O A;  4X65 L;  3HOY H;  3S16 H;  3F2B A;  3GDE A;  1XNQ L;  1DGS A;  2UUC L;  4JI6 L;  5M5X H;  4DAY B;  1NBW A;  3HOW G;  1CKM A;  3HKS A;  2UUA L;  1YHB A;  5JJK A;  1PYS B;  2AWN A;  4R4T A;  1TWA H;  2ZTE A;  4RG1 A;  1EFW A;  2NVQ H;  3S1M H;  1QUQ B;  2DGY A;  3DM3 A;  5EAY A;  2OQ0 A;  4JI8 Q;  1XNR L;  5ELN A;  1S3O A;  2HIV A;  4RMF A;  5AJ3 Q;  3VDY A;  1QVF A;  2YV5 A;  2A8V A;  1L1O A;  4A4I A;  3RZO H;  5IYC H;  1KIX A;  4LUZ A;  1TXY A;  3PO2 H;  4IOA A;  1BBU A;  2Q2I A;  1VQD A;  2ES2 A;  4XTC S;  4NXM Q;  2UUB Q;  1Y1V H;  3CC4 A;  2KCM A;  2ID0 A;  1N34 Q;  1B70 B;  2NN6 G;  4PZ8 A;  3UE0 A;  3KF6 A;  1PH6 A;  3RLO A;  2BA1 A;  1K8A C;  3PUZ A;  4DV6 L;  2ZJR A;  1IBM Q;  3CQZ H;  4R1J A;  4DV2 L;  5C4X G;  1BBW A;  3I7F A;  3UDG A;  2XTI A;  4H02 A;  1X65 A;  2EIF A;  2UU9 L;  4OX9 Q;  4L5S A;  1BKB A;  1J5E Q;  2VNU D;  4EQ5 A;  1VQC A;  1K0R A;  5IWA L;  4J15 A;  1SRO A;  2CWP A;  3STB C;  3HOW H;  4JI4 Q;  1NE3 A;  3ULL A;  1VQF A;  4R4Q A;  1CKO A;  4JI3 Q;  3CME A;  5IP7 G;  4X64 L;  4JI5 L;  1HNX Q;  4HJA A;  4KLK A;  4A3J G;  3CXC A;  5GAD C;  1C9O A;  1W2B A;  3EBE A;  1IYJ B;  4LFA Q;  4GKK L;  4B3M Q;  3I56 A;  4X6A H;  1EQR A;  2ZM6 L;  5FLM G;  3I4M H;  3GTO H;  3M4Q A;  1A8V A;  4R4C A;  3FKI G;  2I5H A;  4IPH A;  3HOX G;  4DV5 Q;  5GQO A;  4HJ8 A;  2F52 A;  2QA4 A;  4UP9 A;  5J3B A;  1PH7 A;  2KBN A;  1M90 C;  1N33 Q;  2H5X A;  4GN5 A;  1V9P A;  3E9H A;  1JE5 A;  2IT1 A;  3CCV A;  3HOU G;  1FVI A;  2JEB I;  2NZH A;  4L5R C;  4DV1 L;  3NBH B;  2BH8 A;  1J6Q A;  2B63 G;  2UXC L;  3G6E A;  2YTY A;  4PMW A;  3A5U A;  1G29 1;  3CCS A;  4IO9 A;  1PH2 A;  4DR4 Q;  2VQF L;  4GLA C;  1JJC B;  1YI2 A;  2OCE A;  1N32 Q;  1UWV A;  3M3Y H;  3HKZ E;  1GD7 A;  4LF5 L;  3J81 j;  3IRB A;  5C44 G;  1NTG A;  2WFW A;  4MZ9 A;  1BVS A;  4BBS G;  3GTP H;  1VQH A;  1E24 A;  1MJE A;  1N9W A;  4OON A;  3W1B A;  4JI0 L;  1VQP A;  5IP7 H;  4X62 L;  5GAE C;  1EQQ A;  2WAQ G;  4LF8 Q;  5IY0 A;  1N36 L;  4X66 Q;  2RCN A;  2LXJ A;  4HJ5 A;  3CMA A;  1U0L A;  2A1A A;  2PQA B;  4A3F G;  1M1K C;  4JI2 L;  2YTV A;  2R7Z G;  4JYA L;  1VQA A;  1EWI A;  2D0P A;  3I4N G;  1L0W A;  2E5L L;  3KJP A;  1YEZ A;  2PI2 E;  1N8R C;  4LF6 Q;  3FKI H;  4AH6 A;  1VS0 A;  3HOX H;  3RN2 A;  1PHJ A;  1KQS A;  1C0A A;  5IYD G;  1IBL L;  5C0X J;  4IPC A;  5DLQ E;  3RLF A;  2JA6 G;  3H3V H;  4QGU A;  4NXN Q;  3HOU H;  3M85 A;  2K50 A;  1XPO A;  1VQJ A;  3JAM i;  1KRS A;  2JA5 G;  2JA7 G;  3HFZ B;  5IYB G;  4POF A;  3S1R H;  3NEL A;  2GVB A;  4NPS A;  5K36 G;  3CW2 C;  1RL2 A;  3ERS X;  3KDF A;  3CPF A;  4DV4 L;  1Q8K A;  1Q82 C;  4YCV A;  2WP8 J;  4OWX B;  1WCM G;  4IPD A;  1VQ8 A;  2KHJ A;  3S24 A;  2F3I A;  4DR1 Q;  2CKZ B;  1K83 H;  3KF8 B;  5C44 H;  2K4K A;  2K5H A;  1EIF A;  3EIV A;  4A3I G;  5LMN Q;  1PH5 A;  1WOC A;  3PUY A;  3AFP A;  4DV3 L;  2UXB L;  1KD1 C;  1HR0 Q;  2HIX A;  1L2F A;  1SMX A;  3FP9 A;  5C3E G;  1YJ9 A;  3KLW A;  3K0X A;  4JI8 L;  1EUJ A;  4ME3 A;  4DR5 L;  1Q1B A;  1VQ4 A;  4C3I H;  2R7Z H;  3OW2 A;  1Z9F A;  1SRU A;  4A75 A;  4WJ4 A;  4JV5 Q;  3ULJ A;  5AJ3 L;  1HH2 P;  2K75 A;  1HNW Q;  1YBY A;  3NEN A;  4IOC A;  5IYD H;  3S1Q H;  1TWH H;  2JA6 H;  5BR8 Q;  2K5V A;  1L1O C;  2BA0 A;  3J7Z C;  4B3T Q;  1TWF H;  4JI1 L;  3MXN B;  3F2C A;  2JA7 H;  4A3M G;  2UUB L;  5IYB H;  1GM5 A;  4QJF A;  4B3R L;  1N34 L;  3J7A 5;  1UEB A;  5M3F G;  2ZTD A;  3Q8D A;  1IBK Q;  2IX1 A;  3FHW A;  2PMZ E;  3KYH C;  4A3D G;  1WCM H;  4A93 G;  1V43 A;  3S1N H;  3TEH B;  5M5W H;  1J5E L;  3I55 A;  1X3E A;  4QQB X;  5C0X G;  3CC7 A;  3L7Z C;  4DUY Q;  1A63 A;  3PSI A;  3OTO L;  1P8L A;  4JI3 L;  3K7U C;  2I5M X;  4B3S Q;  4JBJ A;  1VQO A;  3K7A H;  1EYG A;  1L1O B;  2R92 H;  4AYB G;  3TRE A;  1X9N A;  4JOI A;  5LMU Q;  1AE3 A;  5JEA J;  5GAG C;  2ALY B;  3NEM A;  2CFM A;  4NB3 A;  3CCR A;  4GOP A;  1VQM A;  4B3M L;  4YWM A;  3GTG H;  5C0X I;  1CKN A;  1EOV A;  4LFC Q;  1UE6 A;  2C35 B;  1PH1 A;  1SR3 A;  4JI7 L;  1FL0 A;  1G51 A;  1XMO L;  4DV5 L;  4HIK A;  4O2D A;  2JJQ A;  3T1H Q;  3KF6 B;  3ER0 A;  1OXS C;  1KHI A;  2MO0 A;  1YIT A;  2Z0S A;  1XNQ Q;  3K81 C;  3T1Y L;  2UUC Q;  4JI6 Q;  4A3E G;  3J81 i;  1H95 A;  4A3M H;  3E0E A;  2UUA Q;  2R93 G;  4KHP L;  2VQE L;  1C7Y A;  2EQS A;  4LF9 L;  5M3F H;  3A5Z B;  1MJC A;  4P74 A;  1K9M C;  1SN8 A;  4PZ7 A;  5FJ8 G;  1E1T A;  4TQU S;  3DLL A;  1G6P A;  3PIO A;  4DR4 L;  1XNR Q;  3HOV G;  4JBK A;  1YIJ A;  4A3D H;  3PCO B;  4YHH L;  4A93 H;  4TVA B;  5IT9 c;  1X6O A;  3D31 A;  3GO5 A;  3BZC A;  1ASY A;  4QIW E;  3STB D;  2ZTC A;  1B8A A;  4UY8 C;  4YY3 L;  4FDB A;  1I6H H;  1CUK A;  1CSP A;  2GVA A;  4DV7 L;  4GNX A;  2OWO A;  1WJJ A;  4LF7 L;  1VQ7 A;  2E2I H;  3LGJ A;  3CPW A;  1HZA A;  4DR6 L;  1EIY B;  1KL9 A;  4DR2 L;  4PG3 A;  5C4X H;  1VQ9 A;  3B6Y A;  2JA8 G;  4DV6 Q;  2AHO B;  4MNO A;  4DV2 Q;  2B3G A;  4DR7 L;  2JEA I;  1OXX K;  2E8G A;  4YWK A;  3RR5 A;  4DUZ Q;  4BY7 G;  1VQN A;  4K0K L;  1OXT A;  1X54 A;  5IWA Q;  2CCZ A;  1E7Z A;  2R93 H;  3S15 H;  4P75 A;  3K80 C;  2MQH A;  4A3J H;  1E1O A;  3K8A A;  3TQY A;  1SFO H;  4JI5 Q;  1X3G A;  5JEA G;  3H0G G;  3CCU A;  4WJ3 M;  3HOV H;  3E9I A;  3CCQ A;  1SE8 A;  5FLM H;  3PUW A;  2UXD L;  4GKK Q;  4EX5 A;  4DR1 L;  3J80 i;  4LFB L;  3CCJ A;  1GVP A;  1Y14 B;  2ZM6 Q;  1HJP A;  1VQ5 A;  1Q1E A;  2A19 A;  4A3C G;  3RNU A;  1XMQ Q;  3G71 A;  2HHH Q;  5ELO A;  3ULP A;  4GLV B;  1OXV A;  1U5K A;  4DV0 L;  4HID A;  1FJG Q;  1YZ6 A;  1OTC A;  3W1G A;  2B63 H;  4LF4 L;  4YCW A;  3I4O A;  1LM0 A;  3RLN A;  1PVO A;  4UPA A;  1IL2 A;  2UXC Q;  3S14 H;  4JV5 L;  2KHI A;  2F4V Q;  4A3B G;  3U50 C;  3GTQ H;  1IXR A;  3KJO A;  1QVC A;  2VL6 A;  1PH3 A;  3GTL H;  4DAM A;  4OO1 I;  2VQF Q;  1HNW L;  2Q2H A;  5M3M G;  4A3L G;  3KDF B;  1Z47 A;  1S72 A;  3PUX A;  4LF5 Q;  4BBS H;  3PF4 A;  3MEF A;  2WB1 E;  3SGI A;  3F2D A;  4XIG S;  3TS0 A;  4A3K G;  1KC8 C;  1UE7 A;  3CAM A;  2QEX A;  5IE8 A;  4GLX A;  2KCT A;  2NZO A;  4YCU A;  4GKJ Q;  5GRO A;  3G48 A;  4JI0 Q;  1YHA A;  2MFI A;  4IJH A;  4BBR G;  3JAM c;  1HZC A;  2YTX A;  1IBK L;  1HNZ Q;  1R9T H;  3TRZ A;  4A3F H;  1YNX A;  3H0G H;  3F1Z A;  1WI5 A;  1QZH A;  2Z6K A;  3M9B A;  3I4N H;  4JI2 Q;  3G4S A;  1AE2 A;  4R4O A;  4JYA Q;  1KAW A;  5HGQ A;  1JT8 A;  2YU9 H;  5GAH C;  2MNA A;  2GN5 A;  4BY1 G;  4DUY L;  3ZJY C;  1I94 Q;  3AQQ A;  2IHF A;  2BH2 A;  4DK3 C;  1IBL Q;  3S2D H;  4NXM L;  2JA5 H;  1QVG A;  3PO2 G;  4DR3 Q;  1S40 A;  1Y1W G;  2IHE A;  4R4I A;  5FLX c;  5LMN W;  1YVC A;  3BJU A;  1QZG A;  4P73 A;  4BA2 I;  1IBM L;  4DPG A;  1JB7 A;  4GN3 B;  3S2H H;  1K8G A;  2VY3 A;  4DV4 Q;  1HR0 W;  4OX9 L;  4QY7 A;  4GOP C;  1AH9 A;  1HZ9 A;  1MKH A;  4Y52 H;  3M4P A;  5M3M H;  3T1H L;  1PH8 A;  4A3L H;  1Q7Y C;  1QUQ A;  4A3I H;  1YHQ A;  1K73 C;  4HIM A;  3ICE A;  4JI4 L;  4A3K H;  3F8T A;  4LUV A;  4GS3 A;  3UE1 A;  1FGU A;  3UDX A;  3PV0 A;  1HNX L;  5C3E H;  3RN5 A;  2VS1 A;  2V1C C;  1JJ2 A;  2OTL A;  4DV3 Q;  2UXB Q;  1PH9 A;  4BBR H;  4A76 A;  4AQY Q;  2NVX H;  3GTK H;  4P71 A;  4BA1 I;  4LFA L;  2OTJ A;  4DNI A;  2KEN A;  1Q81 C;  1V1Q A;  2N3S A;  1GO3 E;  4P72 A;  3H15 A;  1WFQ A;  4DR5 Q;  3CC2 A;  2CWA A;  2MO1 A;  3RZD H;  3I4M G;  1ASZ A;  2K5N A;  2Y0S E;  4C2M H;  4X65 Q;  4IPG A;  1VQL A;  4BY1 H;  1N33 L;  2RF4 A;  3PO3 G;  4GOP B;  4OWT B;  2N8N A;  2D0O A;  1CKN B;  1KXL A;  4PZ6 A;  4O0A A;  4AIM A;  1VQE A;  1Y1W H;  4GNX C;  4JI1 Q;  1HZB A;  5IP9 G;  4B3R Q;  1D7Q A;  2AWO A;  2I5L X;  3M7N A;  3GTJ H;  4IFD G;  4C3H H;  3BZK A;  3HKZ G;  3PF5 A;  1D8L A;  1N32 L;  2AKW B;  1LTL A;  5HY6 A;  3PGZ A;  2VUM G;  2JA9 A;  2VW9 A;  2R7F A;  2JK8 A;  1GKH A;  2OQK A;  4DUZ L;  3UDF A;  1KRT A;  3L2P A;  2E2H H;  4JG2 A;  4UP8 A;  4DK6 C;  1RIP A;  1OXU A;  2NN6 I;  3A74 A;  1NMF A;  3OTO Q;  1JMC A;  4IFD I;  2AMC B;  4LF8 L;  2ASB A;  4QL5 A;  4X66 L;  3J81 c;  4GN4 B;  1PYB A;  2D62 A;  3U4Z A;  3I2Z A;  4GNX B;  4AYB E;  4LF6 L;  2L15 A;  1SLJ A;  3AFQ A;  1B7Y B;  4KHZ A;  1UE1 A;  4A3G G;  2UU9 Q;  4JI7 Q;  3EN2 A;  1X55 A;  3D0F A;  2NVT H;  1XMO Q;  3HOZ G;  3A0J A;  4LUO A;  4LWC A;  4NXN L;  1XMQ L;  3PO3 H;  1O7I A;  1Q86 C;  1E3P A;  2JE6 I;  2HHH L;  4A3E H;  2ZJQ A;  4JBM A;  4OXP A;  2N49 A;  2HT1 A;  2IY5 B;  3GD7 A;  3T1Y Q;  1FJG L;  4JCV E;  4IJL A;  1X3F A;  2B29 A;  5IP9 H;  1XPR A;  4X64 Q;  2VQE Q;  4KHP Q;  1A62 A;  5FJ8 H;  2I0Q A;  4LF9 Q;  1LYL A;  1Q12 A;  2DUD A;  2HQL A;  3CP0 A;  3W5O A;  3S17 H;  1JJG A;  2VZA A;  2F4V L;  2NVY H;  4L5Q A;  3UDI A;  2PI2 A;  2PNH A;  1CSQ A;  3H3V I;  4YHH Q;  2VUM H;  2E2J H;  2LSS A;  5LMN L;  2ATW A;  2WB1 G;  4YWL A;  1E22 A;  4OO1 G;  3CD6 A;  1HR0 L;  1T9H A;  2PQA A;  4YY3 Q;  4DV7 Q;  3U4V A;  3PIP A;  4HJ9 A;  4GKJ L;  4LW1 A;  2R6G A;  1HNZ L;  4LF7 Q;  4DV1 Q;  1XJV A;  4C3J H;  4APV A;  1TWC H; 
#chains in the Genus database with same CATH topology
 2A6E D;  1D5Z C;  1TWG H;  4MTN A;  4BXX G;  2EDG A;  4MHE A;  1JWS D;  2K33 A;  3E6Z X;  3DWQ A;  4A3G H;  4KHV A;  5BR8 L;  2CH4 A;  3J80 c;  1EIG A;  4DAV A;  2EY6 A;  4NKL A;  3V2T A;  3I4N B;  2N78 A;  3QOJ A;  2YU9 B;  2B2Y A;  3TP8 A;  4XT3 B;  2K14 A;  1F9Q A;  1VQK A;  3TS2 A;  1ZKO A;  3KLS X;  3W2D A;  1JWM D;  2FXQ A;  2AQ1 B;  2R7D A;  3P75 A;  1SE3 A;  4JBW A;  4OO1 H;  1CTM A;  1ML0 D;  4RKL A;  2NWG A;  3S2H B;  2DNE A;  2H1E A;  1XTC D;  2WV6 D;  4DV0 Q;  1SYB A;  1PA6 A;  2R92 G;  4ILW A;  1STN A;  4JC0 A;  4JOI C;  4KI0 A;  4A3K B;  4A3B H;  5JJI A;  4UP7 A;  1STE A;  5LL6 X;  2K5D A;  2EJG C;  5C3E B;  3HOY H;  3GTM H;  3S16 H;  1PXU A;  1LT4 D;  1DGS A;  2UUC L;  5CC4 A;  4JI6 L;  4IZ8 A;  5M5X H;  2K6A A;  2UUA L;  1RTO A;  3DEO A;  1ET9 A;  4R4T A;  2ZTE A;  4RG1 A;  3GQB A;  4XQJ A;  1EFW A;  5CMD A;  2XVS A;  2F0P A;  1QG7 A;  1B1Z A;  2F3V A;  3BG3 A;  4DK0 A;  1H9S A;  1M8A A;  5I6Y A;  4G4K A;  5AJ3 Q;  3VDY A;  1MSG A;  2YV5 A;  2A8V A;  4TRD A;  3RZO H;  1KIX A;  3FDT A;  1AZQ A;  4UAI A;  1TXY A;  1RDP D;  5LHY 1;  4NXM Q;  4XTC S;  2UUB Q;  3CC4 A;  1S5C D;  2HQE A;  2KCM A;  2PCF B;  4PZ8 A;  3RLO A;  1ESF A;  2FMC A;  1QE6 A;  4R1J A;  3I7F A;  3UDG A;  4H02 A;  2UU9 L;  4ZUI A;  1J5E Q;  2F0J A;  3MC0 B;  3SXH A;  2VNU D;  2CVR A;  4J15 A;  1SRO A;  3CKI B;  1X32 A;  3HOW H;  1NE3 A;  3CME A;  5IP7 G;  3SK6 A;  4HJA A;  1C9O A;  1IL8 A;  1A2U A;  4A3E B;  4B3M Q;  4GKK L;  1U9R A;  4IUQ A;  1A8V A;  4R4C A;  2I5H A;  4DV5 Q;  4HJ8 A;  1KAB A;  2F0D A;  2EE1 A;  4UP9 A;  4ODG A;  1O7L A;  1IYU A;  1JB3 A;  2H5X A;  4Q0F A;  4CBV A;  5EQ0 A;  3E9H A;  1JE5 A;  1G2S A;  1CI3 M;  2JEB I;  2ICI A;  3TP7 A;  4DV1 L;  4P2C B;  3A5U A;  2J7Z A;  2HCI A;  3M3Y H;  3HGB A;  3J81 j;  5JPM C;  5CV7 A;  5EGT A;  4C3J B;  1TWC B;  2WKC A;  4BBS G;  2JA8 B;  1VQH A;  2AUK A;  4OON A;  2F0S A;  4NW2 A;  3TME A;  2HUG A;  3TP6 A;  3W1B A;  4X62 L;  2A69 D;  1O80 A;  5JJZ A;  4LF8 Q;  1N36 L;  1U0L A;  2A1A A;  4JYA L;  1VQA A;  1EWI A;  2E5L L;  1ICF B;  1YEZ A;  4S3S A;  4AH6 A;  1VS0 A;  1PHJ A;  2JXM B;  1S5F D;  2A73 B;  4IPC A;  3KBX A;  4QGU A;  1SYD A;  1XPO A;  3I8Z A;  5AFW A;  2JA5 G;  4L6T B;  3U9S A;  2GVB A;  4NPS A;  5K36 G;  5C3X A;  4EVO A;  5KNB A;  1D2B A;  2SNM A;  1Q8K A;  5KIX A;  3P1H A;  2QCP X;  5M5Y B;  1E2W A;  2F3I A;  1A3U A;  5LMN Q;  2K01 A;  1PZJ D;  2M2L A;  5E4W C;  1YJ9 A;  1EQV A;  4ME3 A;  1BO0 A;  3OIP A;  4C3I H;  2R7Z H;  1SRU A;  4A75 A;  1SYG A;  3OOC A;  3ULJ A;  1TWA B;  3NEN A;  4BBR B;  3A8J E;  3K59 A;  1VDZ A;  4K8J A;  5IYD H;  2ZXP A;  3S1Q H;  3RUZ A;  1TWH H;  5L37 A;  4TSS A;  4B9W A;  3J7Y W;  2JA6 H;  2B39 A;  3SVM A;  1EQT A;  1GM5 A;  1L0X B;  1N34 L;  3J7A 5;  3TZD A;  4BY1 B;  2F0L A;  3Q8D A;  1ZEQ X;  4CDC C;  1V43 A;  1DYQ A;  3LWE A;  1HXY D;  1BDO A;  2MJ8 A;  1TS3 A;  3I55 A;  1X3E A;  3SK8 A;  1MBY A;  4OL7 A;  1AN8 A;  4QQB X;  1A3T A;  1ILQ A;  3VR3 A;  1PMR A;  4DGZ A;  4KJN A;  3K7A H;  1L1O B;  5EPJ A;  1LTS D;  3T56 B;  1GJX A;  2F0E A;  4Q5V A;  1K8M A;  3NEM A;  1VQM A;  5CV4 A;  1C4Q A;  1L0Y B;  4LFC Q;  5FK9 C;  4O2D A;  3T1H Q;  1F2Y A;  1TS4 A;  1EY7 A;  3BZD B;  3DM1 A;  1YIT A;  3K81 C;  4PMC A;  3Q0A A;  1H95 A;  1EIH A;  4A3M H;  2R93 G;  4U68 A;  1X3Q A;  3I4M B;  2EQS A;  2BDN A;  3GTO B;  5M3F H;  3A5Z B;  3V05 A;  3PO3 B;  1K9M C;  4OIJ A;  5FJ8 G;  1E1T A;  1G6P A;  3PIO A;  3VR2 A;  4DR4 L;  1XNR Q;  3D3R A;  3HOV G;  1YIJ A;  4YHH L;  4A93 H;  5IT9 c;  4C1N I;  1O7Z A;  4YY3 L;  4FDB A;  1I6H H;  4IUT A;  1CSP A;  1KTK A;  4GNX A;  1WTO A;  3H3V C;  2IJ0 A;  2JP1 A;  1JOO A;  3QJY A;  3T16 A;  1EIY B;  4DR6 L;  4EGV A;  1LTA D;  4PG3 A;  4G7H C;  5C4X H;  4OHJ A;  3VR5 A;  4MNO A;  4K5W A;  5IGB A;  3E5S A;  4K0K L;  3D4D A;  5IWA Q;  1E7Z A;  4MIU A;  3ERO A;  3V96 A;  4X3U A;  4ZAI A;  5CGK A;  4NDX A;  3EVQ A;  1S4Z A;  1NCV A;  3QIA A;  2EOT A;  4K6L A;  3CCU A;  3J7A V;  3HOU B;  1SE8 A;  4EX5 A;  2ZM6 Q;  5C4J B;  2DJG C;  2MPM A;  1QJO A;  3H09 A;  3G7L A;  2DY7 A;  4GLV B;  2J0T D;  1U4M A;  5E3F A;  1FJG Q;  1OTC A;  4KK7 A;  4O1N A;  3RMH A;  4A3B G;  1PH3 A;  4OO1 I;  1NNX A;  3T13 A;  4DAM A;  2Q2H A;  3PUX A;  4RH6 A;  3SGI A;  4A3K G;  1A2T A;  1UE7 A;  4BWG B;  3HG9 A;  1SNQ A;  2KCT A;  2NZO A;  4YCU A;  4GKJ Q;  5GRO A;  2H4O A;  1KDA A;  4IJH A;  3JAM c;  2YTX A;  1HNZ Q;  1R9T H;  3TRZ A;  4A3F H;  3H0G H;  4H7B A;  4CJ2 C;  3M9B A;  2B8F A;  1TWF B;  1SSO A;  2I46 A;  2MNA A;  5I2Y A;  2KED A;  4DK3 C;  4CDD C;  1X3P A;  1IBL Q;  1II3 A;  1S40 A;  5M5W B;  2BCO A;  1YVC A;  2K05 A;  1UAP A;  5BN4 A;  1GUT A;  1IBM L;  1CHQ D;  5CBA E;  2VY3 A;  4DAY A;  1GUG A;  1AH9 A;  1E0B A;  1MKH A;  1LV9 A;  4A3L H;  2R92 B;  4JI4 L;  3OWF A;  3UE1 A;  1JJ2 A;  2OTL A;  2L1B A;  3IL8 A;  4A76 A;  4P71 A;  1D5X C;  4P72 A;  4QMG A;  3T53 B;  3MWY W;  2CWA A;  3G6J B;  1ASZ A;  4X65 Q;  2RF4 A;  2N8N A;  3QOL A;  1CKN B;  4PZ6 A;  3E3X A;  4A3D B;  2EZV A;  1Y1W H;  2B2V C;  2DJF C;  4FP5 D;  3GTJ H;  4C3H H;  1D8L A;  1LTL A;  4OEM B;  1GKH A;  3UDF A;  1DON A;  1V1P B;  4DK6 C;  5DM6 3;  4PV1 C;  4X66 L;  3J81 c;  3VR6 A;  5EKL A;  5FO9 B;  3Q24 A;  5FO7 B;  2J4X A;  4LF6 L;  1SLJ A;  2LKV A;  1RHP A;  1SBB B;  3AFQ A;  5C3W A;  5CYU A;  3D0F A;  1K3B C;  3NBH A;  3P20 A;  1LT5 D;  1EL0 A;  4JBM A;  4ID6 A;  2HT1 A;  2IY5 B;  1X3F A;  2IL8 A;  4KHP Q;  2VQE Q;  1GXD C;  1A62 A;  2DUD A;  2HQL A;  3W5O A;  1JJG A;  2TMP A;  1QCB D;  2NVY H;  2PI2 A;  1HUM A;  1CSQ A;  3TSS A;  2E2J H;  2LSS A;  2JSO A;  1G2T A;  2XNA C;  1T9H A;  3U4V A;  4LW1 A;  1SEB D;  2RBM A;  3R2I A;  2R6G A;  1GOZ A;  4LF7 Q;  1XJV A;  4HED A;  3F2U A;  1ENF A;  1FNV A;  1UE5 A;  4L5T A;  1YJW A;  4BBS B;  4DR2 Q;  3QR8 A;  3OYY A;  1B2T A;  4DR7 Q;  4BY7 H;  1I94 L;  4B3T L;  4ZYS A;  1PV4 A;  1XTD A;  4KV6 A;  1VQB A;  2RHQ B;  1PFS A;  4IAL A;  1W3S A;  1BR9 A;  3R3O A;  1JQY D;  3NWS A;  1IZ6 A;  3PMF A;  3KF8 A;  2A6H C;  1I4P A;  2Q2U A;  5DM7 3;  2EXD A;  2RHS B;  1X56 A;  1Z6H A;  3S2D B;  2JA5 B;  2KVM A;  2PPB C;  2PO4 A;  4LFB Q;  4A3C H;  1WYD A;  2CQO A;  4QCL A;  1NUC A;  1NJI C;  4B3S L;  3M4O H;  3S1N B;  4HJ7 A;  3CF5 A;  5C5L A;  1EWC A;  5M3M B;  5LMU L;  1YJN A;  5EPK A;  3KOJ A;  2XWJ B;  3U58 A;  4LF4 Q;  2LXK A;  3CCE A;  3N6R A;  3K5M A;  3BU2 A;  1PTO B;  5E7N A;  2Y0S G;  3MXN A;  4ALP A;  4DKA C;  2XGT A;  1VF5 C;  2D5D A;  1XNQ L;  3GTK B;  2K04 A;  2K1B A;  4ZKC B;  1SJE D;  3OMC A;  1QNU A;  1NBW A;  4X3K A;  1CKM A;  3GTG B;  1YHB A;  1PYS B;  1M4V A;  2NVQ H;  1QUQ B;  4U67 3;  3HRZ C;  1CHP D;  2OQ0 A;  4JI8 Q;  5JVG 3;  5ELN A;  1S3O A;  3URY A;  1AEX A;  5HUR A;  5IYC H;  4LUZ A;  1PRT F;  2SEB D;  4IOA A;  2Q2I A;  2PZW A;  1STB A;  5J22 A;  1Y1V H;  4Z9C B;  1D5M C;  2NN6 G;  3UE0 A;  3KF6 A;  1K8A C;  2ZJR A;  2EYJ A;  3CQZ H;  4DV2 L;  5C4X G;  1X65 A;  3A55 A;  2E2I B;  4OX9 Q;  4KN4 C;  4L5S A;  3CRK C;  1I4Q A;  5BN5 A;  3STB C;  1KDB A;  3QG1 A;  3ULL A;  1HQR D;  1VQF A;  4X64 L;  2F0T A;  3A7L A;  3BS1 A;  2XRS D;  2X69 A;  5C4Z A;  2CW0 C;  3QB3 A;  4X6A H;  1EQR A;  3DWA A;  2R93 B;  2ICE C;  5KGU A;  4HR7 B;  4IPH A;  3HOX G;  5KEE A;  1SMY C;  1I6V C;  3KK7 A;  5NUC A;  2N55 A;  1N33 Q;  4GN5 A;  3S17 B;  1AFP A;  1Q8I A;  3CCV A;  3HOU G;  2XWB B;  3HKZ B;  1FVI A;  3P7J A;  1J9O A;  2VUM B;  3QWN A;  2CW0 D;  4IFD H;  2QDL A;  1G29 1;  1SE2 A;  4IO9 A;  1LT3 D;  1PH2 A;  1YI2 A;  2Z8L A;  1UWV A;  2Z4H A;  3HKZ E;  1SMY D;  3W3A A;  5EBC A;  4JK1 C;  4MZ9 A;  5CV9 A;  5D65 A;  5IGE A;  1STG A;  1TWG B;  4XQN A;  1N9W A;  4JI0 L;  5D3I B;  1EQQ A;  2WAQ G;  1I4G A;  3OMG A;  1Y8O B;  2LXJ A;  1HFN A;  4HJ5 A;  4JI2 L;  4A3F G;  3BYY B;  1QWY A;  2Z6B A;  3NSW A;  3VA7 A;  2PW7 A;  1N8R C;  3FKI H;  2PQE A;  3VR4 A;  3RLF A;  3H3V H;  4NXN Q;  3DEP A;  3M85 A;  3VYU A;  2FHT A;  1AP0 A;  2JA7 G;  4IN3 A;  2F4I A;  1EY0 A;  4NP5 A;  5IYB G;  4FNF A;  3K6O A;  1RL2 A;  3ERS X;  3KDF A;  1UNS A;  4R9W A;  2F0I A;  3BVM A;  2IX3 A;  4J1M A;  4ZQ3 A;  1K83 H;  5C44 H;  2K5H A;  3EIV A;  1FGB D;  1WOC A;  4A3B B;  2EY1 A;  1PZI D;  3PUY A;  1KD1 C;  2R3Z A;  5JOB A;  3FP9 A;  1KDC A;  3KLW A;  3HOY B;  3K0X A;  3GTM B;  3S16 B;  1DCZ A;  4LMQ D;  3HZX A;  1Q1B A;  4DR5 L;  3OW2 A;  4WJ4 A;  5AJ3 L;  1HH2 P;  1HNW Q;  2NVX B;  2WKD A;  3SK5 A;  4MN3 A;  5BR8 Q;  3A8I E;  2BA0 A;  4RA8 A;  3NQI A;  1FR3 A;  3F2C A;  2UUB L;  4B3R L;  3RZD B;  4DF7 A;  4RKB A;  4C2M B;  2ZTD A;  1IBK Q;  3RZO B;  4C3H G;  4A3D G;  3KYH C;  1A3V A;  1WCM H;  2JYO A;  3TEH B;  4FF3 A;  2PYK A;  1J5E L;  1F9S A;  5D3D A;  1PRT C;  3CC7 A;  3FRP B;  3OTO L;  3K5O A;  1ZXT A;  2V4D A;  2KJX A;  1QB5 D;  2OXP A;  3E0J A;  4JBJ A;  1EYG A;  1LLR D;  1PYW D;  5I9O A;  1AE3 A;  5JEA J;  5GAG C;  3CCR A;  4B3M L;  3I90 A;  1WVL A;  4YWM A;  1WD0 A;  4DV5 L;  1PRT D;  3KBG A;  1OXS C;  4DXG A;  3ITP A;  3EQL C;  3T1Y L;  2UUC Q;  4JI6 Q;  2UUA Q;  1C7Y A;  5I2X A;  1SYE A;  4C1N K;  3D6C A;  3DLL A;  1VMC A;  2EYL A;  3PCO B;  4TVA B;  1PFN A;  4UDU C;  4HSV A;  4DAP A;  1ASY A;  2EYH A;  3BZC A;  2EJF C;  5KYL A;  2ZTC A;  1B8A A;  1F77 A;  4DV7 L;  2B2V A;  1NR2 A;  1WJJ A;  3FPP A;  3M3Y B;  3CPW A;  3BVG A;  1KL9 A;  1GHJ A;  4G57 A;  1VQ9 A;  1TQO A;  2AHO B;  4KMU C;  2B3G A;  2EY2 A;  4ZCK A;  2JEA I;  4ZRZ A;  5T1G A;  2O2L D;  3CRL C;  1BCP B;  4YWK A;  2PNR C;  3MHB A;  2F0F A;  4DUZ Q;  4BY7 G;  5A35 A;  1X54 A;  2RCF A;  2X6L A;  4P75 A;  4EQP A;  5JVH 3;  4A3J H;  1E1O A;  2A68 C;  1MI2 A;  4E6I A;  2DNC A;  3J80 L;  4WJ3 M;  3E9I A;  3CCQ A;  3WDN A;  5FLM H;  2UXD L;  1TS2 A;  4GKK Q;  3J80 i;  1GVP A;  3WOE A;  1YNN C;  4HAE A;  4A3C G;  1I3Q B;  3G71 A;  3ULP A;  1K28 A;  1OXV A;  2E75 C;  1UUP A;  2A68 D;  2B63 H;  5EKK A;  4YCW A;  3J80 E;  3X3N A;  3I4O A;  3MAQ A;  3RLN A;  4UPA A;  1IL2 A;  3AU7 A;  3S14 H;  2F4V Q;  3U50 C;  3KJO A;  3GTL H;  5M3M G;  1Z47 A;  1WD1 A;  3VA5 A;  3PF4 A;  4XIG S;  1KC8 C;  4C3I B;  4GLX A;  5IE8 A;  2MFI A;  3DHQ A;  3SHL A;  1V1O A;  5JPN C;  4CDF C;  3I73 A;  5CBE E;  3S1Q B;  1YNX A;  2F03 A;  1TWH B;  1WI5 A;  2R61 A;  5IIF A;  1E2V A;  4JYA Q;  1ET6 A;  1KAW A;  1QIL A;  5HGQ A;  5GAH C;  1EYD A;  3ZJY C;  3AQQ A;  2IHF A;  2BH2 A;  1G91 A;  1QVG A;  4WJW A;  3H91 A;  2F1M A;  4DR3 Q;  2IHE A;  5FLX c;  3OIQ A;  1QZG A;  4P73 A;  2LS0 1;  4DPG A;  2C9O A;  1K8G A;  4RCO A;  1O78 A;  4GOP C;  1SXT A;  4RHS A;  1PH8 A;  3T1H L;  3K7A B;  4CJ0 B;  4A3I H;  1HA6 A;  1HRJ A;  1RD9 D;  1YHQ A;  2KOL A;  1K73 C;  2KEC A;  4XYO A;  3ICE A;  2SOB A;  3F8T A;  1HNX L;  2Y0S B;  3RN5 A;  2VS1 A;  2V1C C;  4BBR H;  1FNU A;  1IKM A;  4AQY Q;  4LFA L;  4DNI A;  1Q81 C;  3TZU A;  2N3S A;  1PDQ A;  4N9T A;  4PMB A;  1VF7 A;  4G7Z C;  4LJZ C;  5M3F B;  5DNF A;  2Y0S E;  4BY1 H;  4IPG A;  1AW7 A;  1K0S A;  4OWT B;  1IKL A;  1VQE A;  3BDC A;  1HZB A;  4N9P A;  4HMI A;  1SYF A;  1WTH A;  3BDO A;  1C8C A;  4IFD G;  1I6H B;  3HKZ G;  1N32 L;  4EQN A;  4HSP A;  3RD4 A;  2VUM G;  1BNZ A;  1JE4 A;  2JA9 A;  2R7F A;  2JK8 A;  4IUR A;  2E2H H;  3C1F A;  4KN7 C;  5C4X B;  4UP8 A;  1RIP A;  3M4Y A;  1NMF A;  4IFD I;  4QL5 A;  1XX8 A;  1ONL A;  2VB2 X;  1BF4 A;  2MHV A;  3I2Z A;  4ABN A;  4GNX B;  3GTP B;  2QEJ C;  1JC7 A;  4KHZ A;  4A3G G;  1RTN A;  2NVT H;  4N8F A;  3PO3 H;  2Z9H A;  3WOF A;  1A15 A;  4LUO A;  1ILP A;  2F0M A;  2KEE A;  1FNW A;  1FJG L;  1WTX A;  5IP9 H;  1S5E D;  1XPR A;  2Z4I A;  3HOX B;  2I0Q A;  1LYL A;  1Q12 A;  2RDF A;  1HA5 A;  3NP8 A;  2NBF A;  1B9N A;  2MP1 A;  1TKW B;  3H3V I;  4YHH Q;  2ATW A;  2WB1 G;  1DZ1 A;  4XDX A;  1ZYR C;  4OO1 G;  2E74 C;  1HR0 L;  2PQA A;  4YY3 Q;  3C2P A;  4GKJ L;  2A5H A;  4K5V A;  1NSN S;  1HNZ L;  1XYI A;  1JWU D;  3WWV A;  4DR6 Q;  1V8Q A;  1SE4 A;  5KYI A;  4Y7N H;  2OT2 A;  1VQI A;  4KD4 A;  1SNC A;  4HIO A;  5JJL A;  1G8Z D;  1I5F A;  1LUZ A;  3HOZ H;  2WAQ B;  3CCL A;  3HOY G;  3U9O A;  1ZYR D;  1S5D D;  1R9T B;  4A3F B;  3H0G B;  4K0K Q;  1I50 H;  1CT1 D;  1NY4 A;  5C4J H;  1XPU A;  5JEA H;  2O5I C;  4IFD J;  1K3R A;  3JC6 6;  2WAQ E;  1MHW C;  4CKE A;  4LNQ A;  3EFX D;  1LAB A;  4X3S A;  2YYZ A;  5KNC A;  2SNS A;  2JA7 B;  5IGC A;  3FPU B;  1ENC A;  1GHK A;  1EEI D;  3AYH B;  1TU2 B;  4EQO A;  2Q2T A;  3K5L A;  5H1S E;  2O5J C;  2ZJP A;  1VCI A;  1LTR D;  2IX0 A;  4X3T A;  3CCM A;  3PUV A;  4BXX H;  1Q46 A;  1GUO A;  1PH4 A;  2K52 A;  4ZUJ A;  4X65 L;  1QNK A;  3GDE A;  3NQT A;  4DAY B;  3FEW X;  3HOW G;  2L11 A;  2AWN A;  3S1M H;  2FJ2 A;  4CKC A;  3O13 A;  2ZXO A;  4ME5 A;  2DGY A;  3DM3 A;  4KY7 A;  1DJR D;  2RSO A;  3D8G A;  4K8I A;  4K2L A;  1Y1W B;  1QVF A;  3I70 A;  3K57 A;  5IGD A;  4C3H B;  3PO2 H;  1BBU A;  4KKS A;  1VQD A;  4CKB A;  2ES2 A;  5IT9 L;  2ID0 A;  1B70 B;  1PH6 A;  4DV6 L;  1IBM Q;  1BBW A;  1HPC A;  2EIF A;  5ELF A;  1BKB A;  5A2Q L;  1K0R A;  4FVM A;  2CWP A;  3M7G A;  1SNP A;  1TII D;  2DN8 A;  5IT9 E;  4JI4 Q;  1HHV A;  4R4Q A;  4JI3 Q;  1CKO A;  4JI5 L;  1WTR A;  4KLK A;  2Q8R E;  4A3J G;  3EBE A;  1IYJ B;  1Z7T A;  2DY8 A;  3SR1 A;  2MGS A;  5FLM G;  5A2Q E;  3M4Q A;  3KLR A;  5GQO A;  3BVZ A;  2HDL A;  2K7V A;  1PH7 A;  2KBN A;  5IGF A;  2IT1 A;  2NVY B;  3MXU A;  3NBH B;  2F0K A;  2E2J B;  3IKJ A;  3HP3 A;  1J6Q A;  3VYR A;  5IOD A;  2B63 G;  2UXC L;  1JR0 D;  3CCS A;  1EY5 A;  2QDB A;  4GLA C;  1JJC B;  2VQF L;  1HTL D;  1GD7 A;  2K5Q A;  4LF5 L;  1KAA A;  1CQV A;  1F2Z A;  2WFW A;  2WIN B;  1EZ8 A;  1BVS A;  2PZT A;  2LFN A;  4OGQ C;  1VQP A;  5IP7 H;  3EJI A;  3ERQ A;  4BY7 B;  5IY0 A;  4X66 Q;  4HTH A;  3DMU A;  3CMA A;  1M1K C;  4C3I G;  2R7Z G;  2KA7 A;  3FMC A;  5ELE A;  3KJP A;  2PI2 E;  4LF6 Q;  2G5D A;  2XIW A;  3RN2 A;  2EVB A;  5ISR A;  5IYD G;  5C0X J;  4FO2 A;  5I4D A;  3JAM L;  1FD7 D;  2JA6 G;  2BDO A;  1VQJ A;  3JAM i;  3NPP A;  3MFG A;  4POF A;  3S1R H;  3NEL A;  2HDM A;  3CW2 C;  4DV4 L;  1YNJ C;  1I4R A;  1Q82 C;  4RGM A;  2WP8 J;  4FYD A;  3GV3 A;  1GUW A;  4OWX B;  4IPD A;  1VQ8 A;  5I9P A;  4DR1 Q;  2CKZ B;  4OIK A;  3KF8 B;  4QF4 A;  3JAM E;  2K4K A;  4A3I G;  3DXJ C;  1LAC A;  3IFT A;  4J8Q A;  1PH5 A;  3AFP A;  4DV3 L;  2UXB L;  2HIX A;  3L9A X;  3C46 A;  1L2F A;  2A6H D;  1H9J A;  3GV6 A;  4JI8 L;  1YNJ D;  1R4P B;  3Q6S A;  1R4Q B;  1Z9F A;  4RHR A;  4JV5 Q;  2NVQ B;  2AUJ D;  1YBY A;  4I65 A;  4IOC A;  4B3T Q;  1L1O C;  3J7Z C;  4JI1 L;  3MXN B;  1F2L A;  1HTP A;  5KND A;  2ZXR A;  4A3M G;  3J7A F;  5K36 H;  5M3F G;  2IX1 A;  4A93 G;  3S1N H;  1SNM A;  1FYC A;  1Y1V B;  2B2T C;  4DUY Q;  1SNO A;  2D2C C;  3AMU A;  1P8L A;  3CQZ B;  3TN2 A;  4FXD A;  2RVL A;  1PTO H;  4B3S Q;  2NTT A;  2XRQ D;  1VQO A;  4H13 C;  4JPB W;  1WTP A;  2KCN A;  1LO5 D;  5LMU Q;  2ALY B;  4PQX A;  4NB3 A;  3GTG H;  4GOP A;  1EOV A;  3K58 A;  2EJM A;  4CDE C;  4JI7 L;  1ENA A;  3MEH A;  1XMO L;  4HMJ A;  4PNY A;  4HIK A;  2JJQ A;  3KF6 B;  3ER0 A;  3J81 L;  4JVZ A;  1KHI A;  2MO0 A;  1XNQ Q;  1W6J A;  1BQQ T;  1LTI D;  2KCC A;  3J81 i;  5C4H A;  2CHB D;  1D1K A;  3E0E A;  3TBI B;  5DAU A;  4LF9 L;  1STY A;  5EPL A;  4RCN A;  4P74 A;  3Q22 A;  4PZ7 A;  2EYM A;  4DK1 A;  4KY6 A;  2AQ3 B;  1X6O A;  5C6A A;  2EY5 A;  2IW3 A;  3J81 E;  3GO5 A;  2LMC B;  3R93 A;  3MFY A;  3STB D;  1CUK A;  2OWO A;  2F0O A;  1EYC A;  2Z1C A;  2E2I H;  2RQX A;  3LGJ A;  1HZA A;  1EWH A;  3MVV A;  2K5W A;  4K2K A;  3NBI A;  3NXW A;  4DV2 Q;  1WTV A;  1Q90 A;  1TS5 A;  2E8G A;  1OXT A;  2R93 H;  3S15 H;  4A3G B;  2OEO A;  2B2W C;  3FKI B;  3A7A B;  3LNN A;  1B9M A;  1SFO H;  5JEA G;  1EYA A;  3H0G G;  2KUM A;  4F87 A;  3HOV H;  4NMZ A;  3MA2 B;  4HCS A;  3ND8 A;  3CCJ A;  1Y14 B;  1VQ5 A;  1Q1E A;  2A19 A;  2E2D C;  1XMQ Q;  4BS9 A;  2HHH Q;  3H94 A;  1WTW A;  1HCZ A;  5G3L F;  2K28 A;  1U5K A;  4UHV A;  4DV0 L;  1YZ6 A;  2WB1 B;  3W1G A;  1K83 B;  5C44 B;  3OW7 A;  2XN9 C;  1PVO A;  1CQF A;  2KHI A;  5C5M A;  3GTQ H;  3DUZ A;  1HNW L;  1CK1 A;  4G7O C;  4A3L G;  3KDF B;  1S72 A;  1TY0 A;  1U4R A;  2WB1 E;  2F0W A;  3TS0 A;  4GZY C;  3CAM A;  3ZYY X;  4JI0 Q;  1YHA A;  3EA6 A;  1IBK L;  1HZC A;  1PTO F;  5D14 A;  4H44 C;  3F1Z A;  3D4R A;  5M5X B;  3OSO A;  4XQQ A;  3I4N H;  1EU3 A;  4JI2 Q;  2NUC A;  4RWS C;  1EOT A;  3L3O C;  4I7A A;  1JT8 A;  4R8N A;  2YU9 H;  3I91 A;  3T51 B;  3NE5 B;  4NXM L;  3PO2 G;  1WCM B;  1Y1W G;  4R4I A;  4RAU C;  3BJU A;  1B50 A;  4KY5 A;  2L0C A;  2GA4 B;  3S2H H;  3LX0 A;  3PIO 3;  4F8M A;  1HR0 W;  3LWU A;  4QY7 A;  5ELD A;  3N52 A;  4RGO S;  1HZ9 A;  4B08 A;  1PLF A;  2F0Q A;  1EEF D;  1JCK B;  1T5X D;  1H9S B;  2F3W A;  4HIM A;  2X6G A;  1T5E A;  1HQM C;  4A3K H;  4FF4 A;  5E4X A;  5EKI A;  1FGU A;  4ZLT F;  3UDX A;  3PV0 A;  4IQZ A;  5C3E H;  1NR4 A;  3OHX C;  4WFN 3;  2NVX H;  3CHB D;  4BA1 I;  2OTJ A;  4KKT A;  2KEN A;  3HOW B;  1V1Q A;  1GO3 E;  3H15 A;  4DR5 Q;  5EBD A;  3RZD H;  1F2M A;  4I7Z C;  2K5N A;  4C2M H;  2M00 A;  3KUP A;  2L12 A;  4IUU A;  2D0O A;  4O0A A;  2L4N A;  4B3R Q;  2I5L X;  3M7N A;  3BZK A;  3PF5 A;  3C1E A;  2A74 C;  5I6W A;  3PGZ A;  2VW9 A;  4DUZ L;  2OQK A;  5C0X H;  4AYB B;  4WOR A;  3L2P A;  3X3M A;  2OF1 A;  1OXU A;  3A74 A;  3OTO Q;  1JMC A;  4LF8 L;  4V19 0;  2ASB A;  3MXG A;  1EY9 A;  5HGT A;  2B2U A;  4AYB E;  4TKO B;  1B7Y B;  1EY6 A;  2UU9 Q;  3EN2 A;  1X55 A;  4A3J B;  3A0J A;  4FXK C;  4LWC A;  1O7I A;  5TSS A;  2ZJQ A;  4A3E H;  1OO9 B;  2N49 A;  2RDH A;  3GD7 A;  5J1Z A;  3T1Y Q;  1ICW A;  4IJL A;  2B29 A;  2A69 C;  3CP0 A;  1S5B D;  1NAP A;  3AB9 A;  5COR A;  2F4V L;  4L5Q A;  3UDI A;  1IYV A;  2PNH A;  5E1F A;  2QF7 A;  5LMN L;  4K14 A;  2B63 B;  4XXE A;  4LAA A;  3S14 B;  4DV7 Q;  4HJ9 A;  3GTL B;  1JIC A;  3UI2 A;  4DV1 Q;  4C3J H;  4APV A;  1TWC H;  5KRU A;  2JA8 H;  2QW7 A;  4OWW B;  3NTI A;  1P16 A;  3QO2 A;  2Z6K C;  1YNN D;  1CZW A;  1BXT A;  2NYZ D;  4ULL A;  4POG A;  1NMG A;  2R7Z B;  5G3L D;  4DR3 L;  5IGG A;  3NWT A;  2F0U A;  4X62 Q;  1PTO C;  2NB0 A;  2JA6 B;  1N36 Q;  3S9W A;  1A0I A;  1I3Q H;  5BN3 A;  1VQ6 A;  3KFU A;  3T4A C;  5FO8 B;  2E5L Q;  2UXD Q;  4C56 C;  3AEV A;  5IYC G;  5M5Y H;  2EYF A;  4DNT B;  2JQO A;  4YIJ A;  5FKA C;  1PTO D;  4AQY L;  1Y1V G;  4A3I B;  1EZ6 A;  4LFC L;  1EU4 A;  2QGQ A;  1I4H A;  1MIU A;  1VQG A;  2EXZ A;  3L0O A;  3F2B A;  2IPK D;  1SDF A;  3KLS A;  4M8A A;  3HKS A;  2PW5 A;  5JJK A;  3NK9 A;  4XT1 B;  1TWA H;  3A56 A;  4FXG C;  5J39 A;  1MGS A;  5EAY A;  2EYO A;  1XNR L;  3BDL A;  2M9V A;  2WII B;  3D4W A;  4A3M B;  4DU9 A;  2HIV A;  4RMF A;  4LK1 C;  1L1O A;  4A4I A;  1AZP A;  4A93 B;  2QIL A;  1N34 Q;  3IAY A;  2BA1 A;  3PUZ A;  2E2H B;  1SAP A;  2XTI A;  4HN7 A;  2B2T A;  2EYP A;  1O7Y A;  4EQ5 A;  1VQC A;  5IWA L;  1SYC A;  1DD2 A;  1HNX Q;  2NVT B;  3D6W A;  3CXC A;  5GAD C;  4L63 B;  1W2B A;  1A6X A;  4LFA Q;  4QUF A;  3I56 A;  2K03 A;  2VXW A;  1BCP F;  1J8I A;  2ZM6 L;  3I4M H;  2XSC A;  3GTO H;  3FKI G;  2F52 A;  2QA4 A;  3BYT B;  1B53 A;  5J3B A;  1M90 C;  1V9P A;  2NZH A;  4DXF A;  1K8O A;  4L5R C;  2BH8 A;  1I4X A;  3I4L A;  2NN6 H;  3G6E A;  2YTY A;  2ENB A;  1KNA A;  4PMW A;  1ROD A;  4DR4 Q;  2QKI C;  3K5N A;  2OCE A;  1CA6 A;  1N32 Q;  3C3L A;  2F0H A;  4ZKB B;  3IRB A;  5C44 G;  1NTG A;  4HCE A;  1SJH D;  4V0B A;  3GTP H;  4Y7N B;  1E24 A;  1MJE A;  4DN4 M;  5GAE C;  3I3C A;  3HOZ B;  2RCN A;  2B2Y C;  2PQA B;  2NZ1 D;  2YTV A;  1CFM A;  2D0P A;  1LTB D;  3I4N G;  1L0W A;  1I50 B;  4B9X A;  3HOX H;  1KQS A;  1C0A A;  1F9R A;  1IBL L;  1RCV D;  1PFM A;  5DLQ E;  2VB3 X;  3NTK A;  3HOU H;  2K50 A;  1KRS A;  2B2W A;  3HFZ B;  1BBX C;  5COY A;  1LT6 D;  3CPF A;  1G6Z A;  2IWH A;  4YCV A;  1WCM G;  4DA2 A;  2KHJ A;  3S24 A;  3NUC A;  5FLX L;  1EIF A;  1HFG A;  1EFI D;  3TDQ A;  2E76 C;  1HR0 Q;  1Q3L A;  1SMX A;  1XWE A;  2MUY A;  5C3E G;  3CU7 A;  1JOR A;  3SE0 A;  1EUJ A;  2F0G A;  5CR3 A;  1DOL A;  4JW0 A;  1VQ4 A;  2JN4 A;  5CV6 A;  3S1M B;  5FLX E;  2K75 A;  1DM0 B;  4KKU A;  1C48 A;  2EPB A;  2BE5 C;  2PMZ B;  2K5V A;  2AQ2 B;  3OWE B;  4RGT A;  4F7X A;  1TWF H;  4O42 A;  3VYT A;  2JA7 H;  1TY2 A;  3OPO A;  5IYB H;  4QJF A;  2Q8T A;  1UEB A;  5IOC A;  1UEA B;  4CJ1 B;  2BOS A;  3FHW A;  2CH4 W;  2PMZ E;  4J6H A;  5CV5 A;  4F88 A;  3PO2 B;  1JOQ A;  2N88 A;  4DNR B;  5M5W H;  3SDZ A;  1D6E C;  2BE5 D;  1DOK A;  5C0X G;  3GTJ B;  1JOK A;  3VYS A;  3L7Z C;  1A63 A;  3PSI A;  4JI3 L;  2SDF A;  3K7U C;  4OEL B;  1TT2 A;  1KLG D;  2I5M X;  5JAV A;  2R92 H;  4AYB G;  3TRE A;  1EY4 A;  4JOI A;  1X9N A;  3SK4 A;  1EY8 A;  2CFM A;  1LTG D;  2B2U C;  1CZG A;  1RKN A;  1CKN A;  1VMP A;  5C0X I;  1H9R A;  1UE6 A;  2C35 B;  1PH1 A;  1SR3 A;  1FL0 A;  1G51 A;  3NHH A;  3K0Y A;  4FF2 A;  2Z0S A;  2K32 A;  2RSN A;  4A3E G;  4XYQ A;  3PIP 3;  4QIW B;  1PRT B;  2VQE L;  4KHP L;  1RF2 D;  1KNE A;  1MJC A;  1SN8 A;  4TQU S;  2PZU A;  2FFK B;  1BCP C;  1WTQ A;  1V1P A;  4A3D H;  1PZK D;  4JBK A;  3D31 A;  4WRD A;  4QIW E;  1D1I A;  5ELC A;  3NTH A;  4UY8 C;  1U4L A;  2GVA A;  2FIN B;  2TSS A;  4LF7 L;  1VQ7 A;  1DOM A;  3A8K E;  4KJO A;  1TR5 A;  4DR2 L;  4C3J G;  1BCP D;  2LY7 A;  3B6Y A;  4IUN A;  4DV6 Q;  2JA8 G;  4K5X A;  4DR7 L;  1ESR A;  1OXX K;  3RR5 A;  1VQN A;  1W6K A;  2B8G A;  3PQI A;  4M1U B;  1E2Z A;  3IFD A;  3HS0 C;  2WAC A;  3K80 C;  2MQH A;  3K8A A;  3TQY A;  1MSH A;  4JI5 Q;  1X3G A;  1BOS A;  1GUS A;  2RA4 A;  3ND9 A;  4MTK A;  3PUW A;  1HUN A;  4LFB L;  4DR1 L;  3S1R B;  1HJP A;  2KQ3 A;  3RNU A;  5EJW A;  5ELO A;  2I07 B;  4HID A;  3ONA B;  4ZK9 B;  5CV8 A;  2F0N A;  4LF4 L;  1LM0 A;  4KD3 A;  2UXC Q;  4R8I A;  4RGN A;  4JV5 L;  5T1I A;  2L5T A;  1IXR A;  1QVC A;  2VL6 A;  3M4O B;  2VQF Q;  4LF5 Q;  1TVX A;  4BBS H;  2HD3 A;  3MEF A;  3F2D A;  2RDG A;  1MD2 D;  1B4O A;  2QEX A;  3G48 A;  5M9O A;  4BBR G;  3FVQ A;  1B3A A;  2HCC A;  2Z6K A;  1QZH A;  3SEB A;  4IUV A;  3G4S A;  1AE2 A;  2CQA A;  2L55 A;  4R4O A;  4FF1 A;  1RJT A;  2GN5 A;  4BY1 G;  4DUY L;  3I72 A;  1I94 Q;  3A54 A;  5LL6 S;  1H9M A;  4KTA A;  3Q23 A;  3S2D H;  2JA5 H;  2Q8I B;  1Y69 U;  5LMN W;  5ELB A;  4BA2 I;  2F0V A;  3HEJ A;  1JB7 A;  1Y8P B;  4GN3 B;  4DV4 Q;  4OX9 L;  4IUP A;  3M4P A;  5M3M H;  4Y52 H;  1Q7Y C;  1QUQ A;  4QB4 A;  4LUV A;  2NTS A;  1DXM A;  4GS3 A;  2C5C A;  4DV3 Q;  2UXB Q;  1PH9 A;  3R2T A;  3GTK H;  1B3Q A;  4QUC A;  5FOB B;  4CHT B;  1WFQ A;  2G9D A;  4DFA A;  3CC2 A;  3TP5 A;  1LTT D;  2MO1 A;  3I4M G;  3H6M A;  1N33 L;  4H0L C;  3PO3 G;  1VQL A;  4GOP B;  1KXL A;  1F9P A;  1STA A;  4AIM A;  1IW7 C;  4GNX C;  2P5Z X;  4JI1 Q;  4L8J A;  5IP9 G;  1D7Q A;  2AWO A;  1PFB A;  2O4X A;  1Y8N B;  2AKW B;  4CGY B;  5HY6 A;  4RFB A;  1KLU D;  1SND A;  1KRT A;  2RKS A;  4JG2 A;  3MZ5 A;  2NN6 I;  1IW7 D;  1CA5 A;  2AMC B;  4GN4 B;  1PYB A;  2G9H D;  2D62 A;  2L9H A;  3MXP A;  3U4Z A;  1CM9 A;  2L15 A;  3S15 B;  1UE1 A;  1U4P A;  4JI7 Q;  3HOZ G;  1XMO Q;  4NXN L;  1XMQ L;  4N8X 1;  2D9U A;  1SFO B;  4K6D A;  1E3P A;  2JE6 I;  1Q86 C;  2HHH L;  4OXP A;  2KHS A;  3HOV B;  5F2D A;  1XXG A;  4JCV E;  1STH A;  4X64 Q;  2FMM A;  5FJ8 H;  4LF9 Q;  3DWP A;  3S17 H;  5DEH A;  2VZA A;  2A6E C;  3GP7 A;  1BUV T;  2VUM H;  1B44 D;  1GUN A;  4YWL A;  1H9K A;  1E22 A;  2ZT9 C;  3CD6 A;  3MTS A;  1QOH A;  3PIP A;  3GTQ B;  1IHZ A;  5K5P A;  3R8B A;  2CCZ A; 
#chains in the Genus database with same CATH homology
 3WWV A;  4L5T A;  1UE5 A;  4DR6 Q;  1YJW A;  2JA8 H;  4Y7N H;  4OWW B;  4DR2 Q;  1TWG H;  4MTN A;  1P16 A;  4BXX G;  1VQI A;  4HIO A;  5JJL A;  2Z6K C;  4A3G H;  1I5F A;  1LUZ A;  3HOZ H;  3OYY A;  3CCL A;  3HOY G;  4BY7 H;  4DR7 Q;  5BR8 L;  1I94 L;  4B3T L;  1PV4 A;  3J80 c;  1XTD A;  4POG A;  1VQB A;  2RHQ B;  1NMG A;  1PFS A;  4K0K Q;  4DR3 L;  1I50 H;  2N78 A;  1W3S A;  1NY4 A;  4X62 Q;  5C4J H;  1XPU A;  1IZ6 A;  2Q2U A;  4IFD J;  1K3R A;  3JC6 6;  2WAQ E;  1A0I A;  1N36 Q;  1I3Q H;  2K14 A;  2EXD A;  4LNQ A;  2RHS B;  1X56 A;  1VQK A;  1VQ6 A;  2YYZ A;  3KFU A;  3TS2 A;  2E5L Q;  2UXD Q;  4LFB Q;  3AYH B;  3AEV A;  4A3C H;  1WYD A;  2FXQ A;  2CQO A;  2R7D A;  5IYC G;  4JBW A;  2Q2T A;  1NJI C;  5H1S E;  5M5Y H;  2JQO A;  4B3S L;  2ZJP A;  3M4O H;  4HJ7 A;  1VCI A;  3CF5 A;  4AQY L;  1Y1V G;  5LMU L;  2IX0 A;  4DV0 Q;  1YJN A;  2R92 G;  1PA6 A;  3KOJ A;  3U58 A;  4LF4 Q;  2LXK A;  4JC0 A;  4JOI C;  4KI0 A;  4LFC L;  3CCE A;  3PUV A;  3CCM A;  4A3B H;  2QGQ A;  1Q46 A;  3BU2 A;  4BXX H;  4UP7 A;  1PH4 A;  5JJI A;  1MIU A;  5E7N A;  2K52 A;  2Y0S G;  4ALP A;  1VQG A;  4DKA C;  3GTM H;  2XGT A;  3L0O A;  4X65 L;  3HOY H;  3S16 H;  3F2B A;  3GDE A;  1XNQ L;  1DGS A;  2UUC L;  4JI6 L;  5M5X H;  4DAY B;  1NBW A;  3HOW G;  1CKM A;  3HKS A;  2UUA L;  1YHB A;  5JJK A;  1PYS B;  2AWN A;  4R4T A;  1TWA H;  2ZTE A;  4RG1 A;  1EFW A;  2NVQ H;  3S1M H;  1QUQ B;  2DGY A;  3DM3 A;  5EAY A;  2OQ0 A;  4JI8 Q;  1XNR L;  5ELN A;  1S3O A;  2HIV A;  4RMF A;  5AJ3 Q;  3VDY A;  1QVF A;  2YV5 A;  2A8V A;  1L1O A;  4A4I A;  3RZO H;  5IYC H;  1KIX A;  4LUZ A;  1TXY A;  3PO2 H;  4IOA A;  1BBU A;  2Q2I A;  1VQD A;  2ES2 A;  4XTC S;  4NXM Q;  2UUB Q;  1Y1V H;  3CC4 A;  2KCM A;  2ID0 A;  1N34 Q;  1B70 B;  2NN6 G;  4PZ8 A;  3UE0 A;  3KF6 A;  1PH6 A;  3RLO A;  2BA1 A;  1K8A C;  3PUZ A;  4DV6 L;  2ZJR A;  1IBM Q;  3CQZ H;  4R1J A;  4DV2 L;  5C4X G;  1BBW A;  3I7F A;  3UDG A;  2XTI A;  4H02 A;  1X65 A;  2EIF A;  2UU9 L;  4OX9 Q;  4L5S A;  1BKB A;  1J5E Q;  2VNU D;  4EQ5 A;  1VQC A;  1K0R A;  5IWA L;  4J15 A;  1SRO A;  2CWP A;  3STB C;  3HOW H;  4JI4 Q;  1NE3 A;  3ULL A;  1VQF A;  4R4Q A;  1CKO A;  4JI3 Q;  3CME A;  5IP7 G;  4X64 L;  4JI5 L;  1HNX Q;  4HJA A;  4KLK A;  4A3J G;  3CXC A;  5GAD C;  1C9O A;  1W2B A;  3EBE A;  1IYJ B;  4LFA Q;  4GKK L;  4B3M Q;  3I56 A;  4X6A H;  1EQR A;  2ZM6 L;  5FLM G;  3I4M H;  3GTO H;  3M4Q A;  1A8V A;  4R4C A;  3FKI G;  2I5H A;  4IPH A;  3HOX G;  4DV5 Q;  5GQO A;  4HJ8 A;  2F52 A;  2QA4 A;  4UP9 A;  5J3B A;  1PH7 A;  2KBN A;  1M90 C;  1N33 Q;  2H5X A;  4GN5 A;  1V9P A;  3E9H A;  1JE5 A;  2IT1 A;  3CCV A;  3HOU G;  1FVI A;  2JEB I;  2NZH A;  4L5R C;  4DV1 L;  3NBH B;  2BH8 A;  1J6Q A;  2B63 G;  2UXC L;  3G6E A;  2YTY A;  4PMW A;  3A5U A;  1G29 1;  3CCS A;  4IO9 A;  1PH2 A;  4DR4 Q;  2VQF L;  4GLA C;  1JJC B;  1YI2 A;  2OCE A;  1N32 Q;  1UWV A;  3M3Y H;  3HKZ E;  1GD7 A;  4LF5 L;  3J81 j;  3IRB A;  5C44 G;  1NTG A;  2WFW A;  4MZ9 A;  1BVS A;  4BBS G;  3GTP H;  1VQH A;  1E24 A;  1MJE A;  1N9W A;  4OON A;  3W1B A;  4JI0 L;  1VQP A;  5IP7 H;  4X62 L;  5GAE C;  1EQQ A;  2WAQ G;  4LF8 Q;  5IY0 A;  1N36 L;  4X66 Q;  2RCN A;  2LXJ A;  4HJ5 A;  3CMA A;  1U0L A;  2A1A A;  2PQA B;  4A3F G;  1M1K C;  4JI2 L;  2YTV A;  2R7Z G;  4JYA L;  1VQA A;  1EWI A;  2D0P A;  3I4N G;  1L0W A;  2E5L L;  3KJP A;  1YEZ A;  2PI2 E;  1N8R C;  4LF6 Q;  3FKI H;  4AH6 A;  1VS0 A;  3HOX H;  3RN2 A;  1PHJ A;  1KQS A;  1C0A A;  5IYD G;  1IBL L;  5C0X J;  4IPC A;  5DLQ E;  3RLF A;  2JA6 G;  3H3V H;  4QGU A;  4NXN Q;  3HOU H;  3M85 A;  2K50 A;  1XPO A;  1VQJ A;  3JAM i;  1KRS A;  2JA5 G;  2JA7 G;  3HFZ B;  5IYB G;  4POF A;  3S1R H;  3NEL A;  2GVB A;  4NPS A;  5K36 G;  3CW2 C;  1RL2 A;  3ERS X;  3KDF A;  3CPF A;  4DV4 L;  1Q8K A;  1Q82 C;  4YCV A;  2WP8 J;  4OWX B;  1WCM G;  4IPD A;  1VQ8 A;  2KHJ A;  3S24 A;  2F3I A;  4DR1 Q;  2CKZ B;  1K83 H;  3KF8 B;  5C44 H;  2K4K A;  2K5H A;  1EIF A;  3EIV A;  4A3I G;  5LMN Q;  1PH5 A;  1WOC A;  3PUY A;  3AFP A;  4DV3 L;  2UXB L;  1KD1 C;  1HR0 Q;  2HIX A;  1L2F A;  1SMX A;  3FP9 A;  5C3E G;  1YJ9 A;  3KLW A;  3K0X A;  4JI8 L;  1EUJ A;  4ME3 A;  4DR5 L;  1Q1B A;  1VQ4 A;  4C3I H;  2R7Z H;  3OW2 A;  1Z9F A;  1SRU A;  4A75 A;  4WJ4 A;  4JV5 Q;  3ULJ A;  5AJ3 L;  1HH2 P;  2K75 A;  1HNW Q;  1YBY A;  3NEN A;  4IOC A;  5IYD H;  3S1Q H;  1TWH H;  2JA6 H;  5BR8 Q;  2K5V A;  1L1O C;  2BA0 A;  3J7Z C;  4B3T Q;  1TWF H;  4JI1 L;  3MXN B;  3F2C A;  2JA7 H;  4A3M G;  2UUB L;  5IYB H;  1GM5 A;  4QJF A;  4B3R L;  1N34 L;  3J7A 5;  1UEB A;  5M3F G;  2ZTD A;  3Q8D A;  1IBK Q;  2IX1 A;  3FHW A;  2PMZ E;  3KYH C;  4A3D G;  1WCM H;  4A93 G;  1V43 A;  3S1N H;  3TEH B;  5M5W H;  1J5E L;  3I55 A;  1X3E A;  4QQB X;  5C0X G;  3CC7 A;  3L7Z C;  4DUY Q;  1A63 A;  3PSI A;  3OTO L;  1P8L A;  4JI3 L;  3K7U C;  2I5M X;  4B3S Q;  4JBJ A;  1VQO A;  3K7A H;  1EYG A;  1L1O B;  2R92 H;  4AYB G;  3TRE A;  1X9N A;  4JOI A;  5LMU Q;  1AE3 A;  5JEA J;  5GAG C;  2ALY B;  3NEM A;  2CFM A;  4NB3 A;  3CCR A;  4GOP A;  1VQM A;  4B3M L;  4YWM A;  3GTG H;  5C0X I;  1CKN A;  1EOV A;  4LFC Q;  1UE6 A;  2C35 B;  1PH1 A;  1SR3 A;  4JI7 L;  1FL0 A;  1G51 A;  1XMO L;  4DV5 L;  4HIK A;  4O2D A;  2JJQ A;  3T1H Q;  3KF6 B;  3ER0 A;  1OXS C;  1KHI A;  2MO0 A;  1YIT A;  2Z0S A;  1XNQ Q;  3K81 C;  3T1Y L;  2UUC Q;  4JI6 Q;  4A3E G;  3J81 i;  1H95 A;  4A3M H;  3E0E A;  2UUA Q;  2R93 G;  4KHP L;  2VQE L;  1C7Y A;  2EQS A;  4LF9 L;  5M3F H;  3A5Z B;  1MJC A;  4P74 A;  1K9M C;  1SN8 A;  4PZ7 A;  5FJ8 G;  1E1T A;  4TQU S;  3DLL A;  1G6P A;  3PIO A;  4DR4 L;  1XNR Q;  3HOV G;  4JBK A;  1YIJ A;  4A3D H;  3PCO B;  4YHH L;  4A93 H;  4TVA B;  5IT9 c;  1X6O A;  3D31 A;  3GO5 A;  3BZC A;  1ASY A;  4QIW E;  3STB D;  2ZTC A;  1B8A A;  4UY8 C;  4YY3 L;  4FDB A;  1I6H H;  1CUK A;  1CSP A;  2GVA A;  4DV7 L;  4GNX A;  2OWO A;  1WJJ A;  4LF7 L;  1VQ7 A;  2E2I H;  3LGJ A;  3CPW A;  1HZA A;  4DR6 L;  1EIY B;  1KL9 A;  4DR2 L;  4PG3 A;  5C4X H;  1VQ9 A;  3B6Y A;  2JA8 G;  4DV6 Q;  2AHO B;  4MNO A;  4DV2 Q;  2B3G A;  4DR7 L;  2JEA I;  1OXX K;  2E8G A;  4YWK A;  3RR5 A;  4DUZ Q;  4BY7 G;  1VQN A;  4K0K L;  1OXT A;  1X54 A;  5IWA Q;  2CCZ A;  1E7Z A;  2R93 H;  3S15 H;  4P75 A;  3K80 C;  2MQH A;  4A3J H;  1E1O A;  3K8A A;  3TQY A;  1SFO H;  4JI5 Q;  1X3G A;  5JEA G;  3H0G G;  3CCU A;  4WJ3 M;  3HOV H;  3E9I A;  3CCQ A;  1SE8 A;  5FLM H;  3PUW A;  2UXD L;  4GKK Q;  4EX5 A;  4DR1 L;  3J80 i;  4LFB L;  3CCJ A;  1GVP A;  1Y14 B;  2ZM6 Q;  1HJP A;  1VQ5 A;  1Q1E A;  2A19 A;  4A3C G;  3RNU A;  1XMQ Q;  3G71 A;  2HHH Q;  5ELO A;  3ULP A;  4GLV B;  1OXV A;  1U5K A;  4DV0 L;  4HID A;  1FJG Q;  1YZ6 A;  1OTC A;  3W1G A;  2B63 H;  4LF4 L;  4YCW A;  3I4O A;  1LM0 A;  3RLN A;  1PVO A;  4UPA A;  1IL2 A;  2UXC Q;  3S14 H;  4JV5 L;  2KHI A;  2F4V Q;  4A3B G;  3U50 C;  3GTQ H;  1IXR A;  3KJO A;  1QVC A;  2VL6 A;  1PH3 A;  3GTL H;  4DAM A;  4OO1 I;  2VQF Q;  1HNW L;  2Q2H A;  5M3M G;  4A3L G;  3KDF B;  1Z47 A;  1S72 A;  3PUX A;  4LF5 Q;  4BBS H;  3PF4 A;  3MEF A;  2WB1 E;  3SGI A;  3F2D A;  4XIG S;  3TS0 A;  4A3K G;  1KC8 C;  1UE7 A;  3CAM A;  2QEX A;  5IE8 A;  4GLX A;  2KCT A;  2NZO A;  4YCU A;  4GKJ Q;  5GRO A;  3G48 A;  4JI0 Q;  1YHA A;  2MFI A;  4IJH A;  4BBR G;  3JAM c;  1HZC A;  2YTX A;  1IBK L;  1HNZ Q;  1R9T H;  3TRZ A;  4A3F H;  1YNX A;  3H0G H;  3F1Z A;  1WI5 A;  1QZH A;  2Z6K A;  3M9B A;  3I4N H;  4JI2 Q;  3G4S A;  1AE2 A;  4R4O A;  4JYA Q;  1KAW A;  5HGQ A;  1JT8 A;  2YU9 H;  5GAH C;  2MNA A;  2GN5 A;  4BY1 G;  4DUY L;  3ZJY C;  1I94 Q;  3AQQ A;  2IHF A;  2BH2 A;  4DK3 C;  1IBL Q;  3S2D H;  4NXM L;  2JA5 H;  1QVG A;  3PO2 G;  4DR3 Q;  1S40 A;  1Y1W G;  2IHE A;  4R4I A;  5FLX c;  5LMN W;  1YVC A;  3BJU A;  1QZG A;  4P73 A;  4BA2 I;  1IBM L;  4DPG A;  1JB7 A;  4GN3 B;  3S2H H;  1K8G A;  2VY3 A;  4DV4 Q;  1HR0 W;  4OX9 L;  4QY7 A;  4GOP C;  1AH9 A;  1HZ9 A;  1MKH A;  4Y52 H;  3M4P A;  5M3M H;  3T1H L;  1PH8 A;  4A3L H;  1Q7Y C;  1QUQ A;  4A3I H;  1YHQ A;  1K73 C;  4HIM A;  3ICE A;  4JI4 L;  4A3K H;  3F8T A;  4LUV A;  4GS3 A;  3UE1 A;  1FGU A;  3UDX A;  3PV0 A;  1HNX L;  5C3E H;  3RN5 A;  2VS1 A;  2V1C C;  1JJ2 A;  2OTL A;  4DV3 Q;  2UXB Q;  1PH9 A;  4BBR H;  4A76 A;  4AQY Q;  2NVX H;  3GTK H;  4P71 A;  4BA1 I;  4LFA L;  2OTJ A;  4DNI A;  2KEN A;  1Q81 C;  1V1Q A;  2N3S A;  1GO3 E;  4P72 A;  3H15 A;  1WFQ A;  4DR5 Q;  3CC2 A;  2CWA A;  2MO1 A;  3RZD H;  3I4M G;  1ASZ A;  2K5N A;  2Y0S E;  4C2M H;  4X65 Q;  4IPG A;  1VQL A;  4BY1 H;  1N33 L;  2RF4 A;  3PO3 G;  4GOP B;  4OWT B;  2N8N A;  2D0O A;  1CKN B;  1KXL A;  4PZ6 A;  4O0A A;  4AIM A;  1VQE A;  1Y1W H;  4GNX C;  4JI1 Q;  1HZB A;  5IP9 G;  4B3R Q;  1D7Q A;  2AWO A;  2I5L X;  3M7N A;  3GTJ H;  4IFD G;  4C3H H;  3BZK A;  3HKZ G;  3PF5 A;  1D8L A;  1N32 L;  2AKW B;  1LTL A;  5HY6 A;  3PGZ A;  2VUM G;  2JA9 A;  2VW9 A;  2R7F A;  2JK8 A;  1GKH A;  2OQK A;  4DUZ L;  3UDF A;  1KRT A;  3L2P A;  2E2H H;  4JG2 A;  4UP8 A;  4DK6 C;  1RIP A;  1OXU A;  2NN6 I;  3A74 A;  1NMF A;  3OTO Q;  1JMC A;  4IFD I;  2AMC B;  4LF8 L;  2ASB A;  4QL5 A;  4X66 L;  3J81 c;  4GN4 B;  1PYB A;  2D62 A;  3U4Z A;  3I2Z A;  4GNX B;  4AYB E;  4LF6 L;  2L15 A;  1SLJ A;  3AFQ A;  1B7Y B;  4KHZ A;  1UE1 A;  4A3G G;  2UU9 Q;  4JI7 Q;  3EN2 A;  1X55 A;  3D0F A;  2NVT H;  1XMO Q;  3HOZ G;  3A0J A;  4LUO A;  4LWC A;  4NXN L;  1XMQ L;  3PO3 H;  1O7I A;  1Q86 C;  1E3P A;  2JE6 I;  2HHH L;  4A3E H;  2ZJQ A;  4JBM A;  4OXP A;  2N49 A;  2HT1 A;  2IY5 B;  3GD7 A;  3T1Y Q;  1FJG L;  4JCV E;  4IJL A;  1X3F A;  2B29 A;  5IP9 H;  1XPR A;  4X64 Q;  2VQE Q;  4KHP Q;  1A62 A;  5FJ8 H;  2I0Q A;  4LF9 Q;  1LYL A;  1Q12 A;  2DUD A;  2HQL A;  3CP0 A;  3W5O A;  3S17 H;  1JJG A;  2VZA A;  2F4V L;  2NVY H;  4L5Q A;  3UDI A;  2PI2 A;  2PNH A;  1CSQ A;  3H3V I;  4YHH Q;  2VUM H;  2E2J H;  2LSS A;  5LMN L;  2ATW A;  2WB1 G;  4YWL A;  1E22 A;  4OO1 G;  3CD6 A;  1HR0 L;  1T9H A;  2PQA A;  4YY3 Q;  4DV7 Q;  3U4V A;  3PIP A;  4HJ9 A;  4GKJ L;  4LW1 A;  2R6G A;  1HNZ L;  4LF7 Q;  4DV1 Q;  1XJV A;  4C3J H;  4APV A;  1TWC H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...