5CGKA

Crystal structure of staphylococcal nuclease variant delta+phs v66d/n100e at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMDENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVEEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66D/N100E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5cgkA00
5IGEA 1EQVA 4ID6A 4G57A 1SYFA 3QOLA 2EY1A 4R8NA 3T16A 1SNPA 4KJNA 1F2YA 3LX0A 3NQTA 2EY5A 1STYA 3TP5A 3SK8A 5CV4A 3MXPA 2F0MA 3MEHA 4OL7A 4PMBA 2F0LA 5CR3A 5IIFA 5DEHA 1F2MA 4PNYA 5E3FA 3SXHA 1EYCA 1A3VA 2F0PA 1IHZA 5C5MA 5E1FA 1II3A 5KIXA 4DFAA 3EJIA 2KHSA 1SNDA 2OEOA 3OMCA 5I6WA 2SOBA 2ENBA 4EQOA 1NUCA 1SNCA 4QB4A 4B9WA 2F0JA 4K2LA 4N9PA 5CC4A 3MHBA 3HZXA 1KDCA 2WACA 4IUNA 2PYKA 4KY6A 4MIUA 1EYAA 1SNQA 2LKVA 4NMZA 4EVOA 5KEEA 5C3WA 5C4ZA 5KGUA 4KJOA 5CV9A 4HTHA 1KDAA 4DF7A 5I9PA 5K5PA 1EY7A 4K5VA 1RKNA 2HQEA 5DAUA 5J1ZA 2OF1A 5IGFA 4K8JA 4DGZA 4YIJA 5KYLA 4HMJA 2F0FA 2PZWA 3S9WA 1SYCA 4KY5A 3D6CA 1SNMA 1TT2A 2EYLA 1KAAA 4B9XA 4QF4A 2QDBA 2EYPA 2F0SA 3E5SA 1EY0A 1AEXA 5CV5A 5NUCA 5C4HA 4TRDA 1STGA 2F0DA 5EKKA 4PMCA 3ITPA 1SYDA 5JAVA 3BDLA 3EROA 3QOJA 4E6IA 5JOBA 4F7XA 5C6AA 3R3OA 1F2ZA 2F0WA 1EYDA 1NSNS 3MVVA 4KHVA 1JORA 1EZ8A 3T13A 4N9TA 4HMIA 5IOCA 4EQPA 1ENCA 5CV6A 3TP8A 2F0TA 4K2KA 2RBMA 2EY2A 4J1MA 5CV7A 2RDFA 5ISRA 5I9OA 4K6DA 4S3SA 3V2TA 2F0VA 1SYEA 2EYFA 1SYBA 1TQOA 4IALA 5CGKA 3BDCA 1ENAA 3DMUA 3EVQA 1EZ6A 4K5WA 4NKLA 1A3UA 3DHQA 3ERQA 1KDBA 3TP6A 1EY9A 3C1EA 4I65A 1JOOA 2PW7A 3NK9A 3SK4A 4ZUJA 4NDXA 2EYOA 2F0HA 1A3TA 3C1FA 5HGTA 5M9OA 3OWFA 4ODGA 2EY6A 4KY7A 2PZTA 5IGGA 4NP5A 1STNA 3SHLA 4WORA 3P1HA 3U9OA 2PZUA 2F0QA 1KABA 1EY5A 4KD4A 3NXWA 1EY4A 2RKSA 2EYMA 3D8GA 5IODA 1A2TA 3D4DA 1STBA 2F0KA 1EY8A 2F0OA 2SNMA 3NHHA 5C5LA 1SYGA 4IZ8A 1JOKA 1STAA 2O4XA 4RKLA 2F3VA 5F2DA 2KQ3A 1A2UA 3RUZA 5J22A 5IGCA 1EY6A 5J39A 4KTAA 4K5XA 5HURA 4H7BA 3PMFA 3HEJA 2PW5A 5EKLA 2F3WA 3SK6A 3VA5A 3H6MA 4K8IA 3QB3A 4EQNA 1STHA 3SR1A 3D4WA 4LAAA 3MZ5A 2NUCA 3OMGA 4ZQ3A 3SK5A 2EYHA 5KRUA 3NP8A 5C3XA 2PQEA 1JOQA 4RKBA 2EYJA 1TR5A 3NUCA 4K14A 2M00A 1SNOA 2EXZA 2F0GA 4KD3A 4F8MA 2F0IA 2F0NA 3OSOA 3TMEA 5KYIA 5EGTA 3P75A 1U9RA 2OXPA 4KV6A 2SNSA 4QMGA 4ME5A 3TP7A 4DU9A 5IGDA 5IGBA 2F0EA 5I6YA 4ZUIA 4J6HA 2F0UA 4WRDA 5CV8A
chains in the Genus database with same CATH superfamily
4LMQD 4IJLA 4EGVA 1Q81C 1GUGA 1HXYD 5LMNL 2BE5C 1XMQL 3H15A 2KA7A 4DUZQ 2MP1A 1XPRA 2GVBA 4V190 4IUTA 2B29A 2EJMA 1K8MA 5KIXA 1TKWB 3LWUA 1UE6A 2A6EC 4ULLA 2DNCA 4EQOA 1H9JA 4FF1A 4N8X1 1SROA 2F0JA 4KKUA 1I4GA 3I4MH 1ILQA 4ZAIA 1XX8A 1D5ZC 3I70A 1XYIA 1FR3A 2XRSD 2VQEL 1SEBD 4R4CA 3PO2H 3CKIB 5I9PA 3E3XA 4OIJA 1SMYC 2RF4A 2FJ2A 3I4MB 4ILWA 4YCVA 2K52A 3BG3A 4XQQA 2E5LL 3PF5A 3PO2B 1JT8A 2RDHA 2B2VA 3BDLA 3KUPA 1YNNC 4JBKA 2L55A 2DY7A 5IOCA 1Q8IA 3TN2A 1UEAB 4LF7L 4IFDJ 2F1MA 2AQ2B 1SRUA 3T1YL 1HJPA 1SBBB 3HKSA 1PH1A 4C2MH 1A3UA 5IP7G 4GNXC 2WKDA 4TQUS 3S17H 4ODGA 4OXPA 2EY6A 1E1TA 2BE5D 1VS0A 4QGUA 1YI2A 2HDMA 4ME3A 4HAEA 3NTHA 1MIUA 3CCEA 1YVCA 3UE1A 1XMOQ 3S17B 3F8TA 5C0XJ 5CBEE 2A6ED 2FXQA 2Q2IA 2HD3A 2VB2X 3GDEA 5E7NA 3PMFA 2L4NA 2Z4HA 3H6MA 5IT9L 2NZ1D 4GLAC 5KRUA 1V9PA 4FXDA 4V0BA 5KYIA 1SN8A 1SMYD 1U9RA 3I4MG 4K0KL 2HHHL 5KNDA 3TP7A 5IGBA 2FFKB 3TS2A 2QKIC 3HOZH 1SYFA 1N32L 3STBC 3PO2G 3IRBA 3S1RB 1YNND 2KOLA 3NSWA 2QEJC 5LL6S 1VMCA 4X3UA 2VNUD 3HOZB 4G7ZC 3RLNA 4DK0A 2ZM6Q 2ICIA 3A7LA 5ELCA 1U5KA 2RSNA 1QZGA 3FKIH 1HZBA 1CHQD 3DM1A 3HZXA 2WACA 2TMPA 2B8GA 4MIUA 5GROA 2ZJPA 1VQEA 1IYJB 5EPJA 3R2IA 1KDAA 3S16H 2ALYB 4RHSA 1A8VA 2YYZA 3N52A 2JN4A 3FKIB 2HQEA 3M7NA 5E4XA 3TREA 1NMGA 3M4YA 3TDQA 1FJGQ 3FMCA 5IYCG 3S16B 4X65Q 1MJEA 4AH6A 3S14H 2B2WA 5ELBA 3W3AA 2A68C 2X6LA 2V4DA 5K36G 4NXML 3VYUA 3RZDH 3Q6SA 1ENCA 4DV7L 2AHOB 5ISRA 2K5VA 3OWEB 2JQOA 4IALA 3S14B 2DNEA 3VA7A 1N36Q 2N55A 3FEWX 1FL0A 4A3BH 2P5ZX 1KDBA 2ZXPA 3RLFA 3FPUB 1VQBA 3RZDB 1VQIA 4NDXA 3C1FA 3WDNA 2UXBQ 2VQFQ 1F9RA 3STBD 2MGSA 4LWCA 4XYQA 4CJ0B 3GTLB 2L11A 3EBEA 3RNUA 3MFGA 4A3BB 1WTHA 3UDFA 1RDPD 4MHEA 3HOZG 2F0KA 3NHHA 3HP3A 4IZ8A 4R4QA 2OQKA 1VQKA 3HOWH 3S1QH 2IJ0A 5EKLA 4LF6Q 1PZID 1CM9A 1PYSB 3PSIA 2B63G 1EOVA 2R7ZG 1JOQA 3QJYA 4HCEA 2M00A 5JJLA 3HOWB 1DD2A 3VR6A 2F0NA 3S1QB 3G7LA 4JI2Q 1K8AC 2JJQA 1HNZL 2XTIA 4KMUC 2NBFA 3FKIG 4KHPL 5GAGC 2SNSA 5JJKA 2NVYH 5IGDA 2RHSB 4FF3A 5FK9C 4EQPA 3OIQA 3ZJYC 1EQVA 1CKMA 2Z6BA 3LX0A 2WFWA 3SK8A 2J0TD 2F0MA 1CZGA 3HG9A 2A68D 2NVYB 5T1GA 1HUMA 4RA8A 3A0JA 5C5MA 1B4OA 1L1OA 1IBMQ 5I6WA 1TWCB 2PNRC 4IPHA 3VYTA 1QILA 1SNQA 5FO8B 3CCMA 4WJWA 1LT4D 1WTOA 3I91A 2JA8B 2MQHA 4POGA 3ND9A 4A3BG 4G4KA 1SSOA 4A3JH 3DWPA 4RWSC 4M8AA 1KAAA 4JI8L 1GUSA 1MSHA 2KCMA 3HS0C 4A3CG 1FGUA 1GO3E 1Q90A 2R3ZA 4JI1L 5BR8L 4RCOA 3JAMi 4LF9Q 4A3JB 4IFDH 3GTMB 3T13A 1Y8OB 1KC8C 1GUTA 1WD0A 4LFAL 2LXKA 2NN6G 3J7A5 3I4OA 2A5HA 3HOWG 2KENA 4X66Q 1XPOA 3AMUA 4BWGB 1Y1VH 3I8ZA 2A8VA 4L63B 3HOXH 4HR7B 2CKZB 3PIPA 1PFNA 4R9WA 2WKCA 4RAUC 1AP0A 5A2QL 4JI3Q 3U9OA 1Y1VB 3HOXB 3J7AF 4RHRA 4A3LH 2L15A 5C0XH 5FLXc 3M4QA 4DV4L 1SYGA 1V1PB 2WIIB 2O4XA 4DAMA 1V43A 3SVMA 1BOSA 1EY6A 3J80i 2N8NA 1PRTB 2QILA 3T1HQ 1I4HA 3CCQA 2EDGA 1Z9FA 3CRLC 4DV6L 1G6ZA 1NBWA 1U4RA 3CF5A 2EYHA 1JB7A 1PH7A 1LTRD 2JA8G 5IWAL 3DEPA 2F0IA 3AB9A 5BN4A 5LMNQ 4YCWA 4JCVE 3L7ZC 2K28A 1RODA 2Q2TA 5M3MB 1ESFA 1KIXA 1G6PA 2D0OA 3F2UA 2JE6I 4KJNA 1EEFD 5EKIA 4HJ7A 2I46A 5IYDG 2ZXRA 5IIFA 3VYRA 2KCTA 2L1BA 3K7AH 1OXTA 4A3JG 5I4DA 2F4VQ 2HDLA 3QO2A 4RMFA 2E2IH 5E1FA 2VQEQ 4A3GH 3QR8A 2OEOA 5GQOA 3FVQA 1SNCA 3CPWA 4K2LA 1SAPA 4IUPA 3MFYA 4DR1L 2AUJD 3NWTA 2E74C 4ZKCB 4MTNA 2E2IB 2Q8IB 2E5LQ 3DEOA 4OONA 4IQZA 4A3GB 5DNFA 1XNQL 5CV9A 4XQJA 2DJFC 1JICA 4OO1I 1S5ED 2JK8A 1JWUD 1M8AA 1OO9B 1OXXK 3KLRA 4XXEA 1BDOA 1BBWA 1Y1VG 2FMCA 3HOXG 1XWEA 3A7AB 3I55A 3KYHC 4LF7Q 3FDTA 2AMCB 1MGSA 1PH3A 1SYDA 2MO1A 3T1YQ 3CCRA 2K01A 1GM5A 1PTOB 1TU2B 3W5OA 2SDFA 1B3AA 5C0XG 4L5QA 3HGBA 3L0OA 2MPMA 1ILPA 1LT3D 3MXUA 1HTLD 1HZAA 4A93H 2PQAB 4RH6A 1WTWA 1V1PA 5FLXE 3ERQA 1W2BA 3CAMA 1HZCA 4QUCA 1C4QA 4CKBA 1U0LA 1A3TA 5M3MG 1RIPA 1D1KA 4HEDA 3J81j 4A93B 4GLVB 2R93B 1ICWA 1SFOB 2ATWA 4WFN3 2VS1A 1ASYA 1PH4A 5ELFA 3OIPA 4AIMA 3DLLA 1A15A 1FGBD 1SJHD 3SEBA 3K59A 3R2TA 4IOAA 4CDEC 1A6XA 3W1BA 4MN3A 1LO5D 4CBVA 1JOKA 1Y1WB 2F3VA 3IFDA 4OWWB 4OIKA 2KECA 4B3TL 1DOLA 3EIVA 4HSVA 4K0KQ 1O7LA 2HHHQ 4BY7H 1T5XD 3MZ5A 3OMGA 3K58A 3SK5A 5IP9G 4DV2L 4A3GG 1KNEA 2EYJA 4K14A 4JOIA 1PHJA 1HRJA 2OTJA 3T51B 1HNXL 1IW7C 2G5DA 2HIVA 3H0GH 3HKZE 1EIYB 4IJHA 1BBXC 1BXTA 1S4ZA 1K0SA 4ZYSA 1H9MA 3MAQA 1Q7YC 3K7UC 1EYCA 1AH9A 2F0PA 1PXUA 4I7ZC 3R93A 3H0GB 4YCUA 2KHJA 2KHSA 2BA0A 5DM73 2H4OA 3OPOA 4WJ4A 1JQYD 2PYKA 2NTTA 1GHJA 3LWEA 5C4ZA 5EBDA 2B2WC 3RZOH 3HKZG 3J7ZC 5K5PA 1EY7A 1I6HH 4A93G 1JJGA 2R93G 5KYLA 2HUGA 1SMXA 2I07B 2CW0C 4JPBW 5A35A 1HFGA 3S9WA 1SYCA 2PQAA 2OQ0A 3RZOB 3E0JA 2EYPA 2F0SA 4DV7Q 1AEXA 1HQMC 3AFPA 4RFBA 4ZRZA 1I6HB 1Y1WG 2HCIA 4GOPA 1F2ZA 4C3HG 2E2JB 1PFMA 5LMNW 4N9TA 3AQQA 4ALPA 5M5WH 1EOTA 2LFNA 3NQIA 5M5XH 2F0VA 1N34Q 1ENAA 1G2TA 3OHXC 1DXMA 2RHQB 2NZHA 3M85A 2CWAA 2L5TA 1IW7D 5M5WB 4ZUJA 3GTJH 5HGTA 2D2CC 5ELOA 4DR4L 3A55A 4X6AH 2OT2A 4KY7A 5M5XB 4A3EG 1E7ZA 4BY1B 1V8QA 1CKOA 1HPCA 4BXXG 2F0QA 4MZ9A 1KABA 4A3MB 1X3EA 3IKJA 4X3TA 1A2TA 3EFXD 3H94A 2C35B 1VMPA 4DV1L 3VR5A 1JCKB 5JVH3 1XNRL 4A75A 3BU2A 1ESRA 1HNZQ 5G3LD 4KHPQ 1EIGA 2ID0A 2L9HA 1VF5C 2GN5A 2CQOA 1NR2A 4UAIA 1ICFB 1B1ZA 1F9PA 5EGTA 3K57A 3RN5A 2E2DC 2CW0D 3QIAA 1EFID 5COYA 4DNTB 3OTOL 1RF2D 1PYBA 4PZ8A 5CV8A 4ID6A 1BCPC 3GTPH 1B44D 3TEHB 4YY3L 3M4OH 2KBNA 1ZXTA 1UAPA 2XVSA 2KJXA 4HIOA 3TZUA 3A5UA 4R4TA 1GKHA 2UUBL 4JI5L 3GTPB 3OMCA 3PV0A 2VZAA 4RGNA 3GTOH 3QWNA 3M4OB 3RMHA 3F2DA 3MHBA 4J15A 1JMCA 3E9IA 1G8ZD 1X3PA 3J7YW 4DV5L 2K5DA 2Z6KA 1B9MA 4C3JH 1R4QB 4P74A 4DKAC 4BY1G 4DR7L 4JI1Q 1P16A 2WINB 5BR8Q 5C4JH 1TWHH 1WTVA 4A3MG 1AW7A 2KCCA 3E6ZX 1B70B 2WV6D 1TVXA 5JEAJ 4LFAQ 2SEBD 4C3JB 3BVGA 3GTGH 3E5SA 2BDOA 5EKKA 1N9WA 2UU9Q 2PMZE 1E22A 5C4JB 4KK7A 1VQOA 1E3PA 4NB3A 1HH2P 3G48A 4BA1I 2NZOA 1J5EQ 3W2DA 4R4OA 1I94L 3NEMA 5CV7A 5I9OA 2L0CA 1LLRD 5CGKA 2AKWB 3EVQA 1LTAD 1LV9A 2ZXOA 1KLUD 4RGTA 1YHQA 4QCLA 3KBGA 2M9VA 1BCPD 3L2PA 3VR3A 4DV4Q 3JAMc 4GKKL 4C1NI 4JBJA 3BJUA 5IY0A 4FF2A 3CCSA 3NXWA 2XSCA 2PI2A 1CHPD 4DV6Q 4LW1A 1STBA 2RQXA 4RCNA 2NVTH 1CUKA 1SR3A 3BDOA 5J39A 3BVMA 1NMFA 5IWAQ 4JV5L 5KNCA 1XPUA 2LS01 3RLOA 1SLJA 4EQNA 4CDFC 1HA6A 2XN9C 2NVTB 1B3QA 5DLQE 5ELNA 5AJ3L 1M4VA 2RCNA 3CCJA 1J9OA 4WJ3M 2A69C 1TWFH 1JC7A 4C2MB 4PQXA 1VQHA 1HFNA 1X3GA 3MTSA 3J80c 4C3JG 1X3QA 1STYA 3HOYH 1TWFB 5CV4A 3ERSX 1F2MA 4DR1Q 1G51A 2JP1A 2B2YA 3EJIA 1H95A 1XNQQ 3GTKH 3I73A 3HOYB 1B8AA 1D2BA 1IKMA 1L2FA 2Z4IA 3F2BA 1WYDA 1B7YB 3BYYB 3GTQH 3R8BA 1SXTA 4EX5A 2DGYA 3HOVH 1X9NA 3GTKB 3CU7A 4DF7A 1WCMH 2K03A 1RKNA 4R4IA 4B3ML 5DAUA 5J1ZA 4K8JA 1PRTF 2ICEC 4OGQC 4KKTA 1SDFA 3GTQB 3E9HA 2QEXA 3GQBA 2QDLA 4KKSA 1WCMB 1RD9D 1E1OA 4OELB 5C4XH 1U4LA 4O2DA 4K6LA 1W3SA 4DV3L 2WAQB 3JAME 1NJIC 1NE3A 4QY7A 1SE2A 1VDZA 2J7ZA 3TP8A 5EAYA 3URYA 3M9BA 1GD7A 4H02A 1B53A 3V2TA 5C4XB 1TS4A 2A69D 2KEEA 1PH2A 4NKLA 4LUVA 4HIDA 5JVG3 3C1EA 2PW7A 3SK4A 1L1OB 1LACA 2XIWA 3NE5B 4Q0FA 4OO1H 1D6EC 2EE1A 3S2DH 2PZTA 4OWTB 3MA2B 1D1IA 2EQSA 1XTDA 2Z9HA 2PZUA 4P75A 4XT1B 2JEBI 3OOCA 2LMCB 5AFWA 4M1UB 2ZTDA 2C9OA 3A8IE 3K0XA 3S2DB 5F2DA 2KQ3A 3HOYG 5IGCA 3CXCA 3HEJA 3SK6A 3J80E 2DUDA 2I5MX 2WAQE 1AE3A 3NPPA 1MJCA 1QG7A 1PFSA 2K50A 4APVA 2BCOA 2ZT9C 1MHWC 1OXSC 2XWBB 3P75A 4GN4B 5KNBA 4IN3A 1R4PB 1LTTD 3Q8DA 1PTOF 4IUUA 4R8NA 3T16A 1BF4A 1WCMG 2O5IC 3TP5A 1C9OA 1EUJA 2F0LA 2MJ8A 1PTOC 1RCVD 1K83H 2WAQG 4IPCA 4BBRH 1BNZA 2FHTA 1CSQA 3U4VA 3MEFA 3CP0A 3PQIA 1M90C 1YBYA 5C4XG 2KHIA 1FYCA 5CC4A 4MTKA 3S2HH 2IHFA 3KDFB 1K83B 4EVOA 1Q86C 1PH5A 1PZJD 1ZEQX 3S1NH 3IFTA 1EU4A 4RGMA 1N33L 3S2HB 4YIJA 5D65A 2B2TC 2B3GA 5JEAH 1K8GA 4JI0L 4PZ7A 1TT2A 3HOUH 2QDBA 3ND8A 1QNUA 4PMCA 2VW9A 5GAEC 1EEID 3JC66 1EYDA 2QA4A 1BQQT 3HOUB 4LNQA 2KCNA 4C1NK 4J1MA 4A3KH 1CT1D 3I90A 2UUAL 1M1KC 4NXNQ 1SYBA 4X3SA 2Q8TA 3K80C 3DMUA 3N6RA 5ELDA 4K5WA 1HNWQ 4DV0L 2ZJQA 5FKAC 4A3IH 2JXMB 1BBUA 1EFWA 4A3KB 2D62A 3CC4A 2Z1CA 4JBMA 1PLFA 1LT5D 4DR6L 4DV1Q 4FXGC 1STNA 1HTPA 1N8RC 1XNRQ 3D31A 1PTOD 4A3IB 2OTLA 1LT6D 1EY5A 2WB1B 1VQGA 4KD4A 1EY4A 3D8GA 5IODA 4UDUC 1OXUA 3F1ZA 2H1EA 4C3IH 2PCFB 3H09A 4CKEA 5JJZA 1A2UA 1GOZA 5HURA 4BBSH 4JYAL 1GJXA 3D4WA 4O42A 4UPAA 4C3IB 1KHIA 1X32A 4YHHL 5FOBB 2UXCQ 4IUQA 4L8JA 4DK1A 3TS0A 4KD3A 4BBSB 4YY3Q 2AUKA 4A76A 1YJNA 3AEVA 1ET6A 3KDFA 2CH4W 2UUBQ 4JI5Q 3I4NH 1F2YA 2CFMA 4Y7NH 1L0YB 3MEHA 2CCZA 4DXGA 1I6VC 4CDDC 3G71A 3SXHA 1DONA 1HA5A 5JEAG 5CORA 2K1BA 1VQ6A 3HRZC 3HOUG 4DFAA 3I4NB 2AQ1B 4Y7NB 2BDNA 3VDYA 4B9WA 2CWPA 3ULPA 1IXRA 4DR7Q 1SE3A 1XMQQ 4MNOA 1WTQA 4KJOA 3H3VC 3Q23A 2YTYA 3A74A 4HTHA 4L6TB 1QZHA 2Q2HA 1CSPA 3MC0B 1Q12A 4JI6L 4DR2L 1QVCA 2RCFA 4A3IG 2WB1G 2PZWA 1F2LA 2Y0SB 1J8IA 4HJ8A 4TKOB 3CCVA 1K73C 1S40A 1K3RA 1I4PA 1WFQA 5C6AA 1T9HA 3K7AB 4XYOA 4IFDG 2B2VC 2VB3X 2VXWA 3KJOA 5EQ0A 4OHJA 2GA4B 4FXKC 3KF6B 4GKKQ 4BBSG 2A74C 1DCZA 1H9KA 3ONAB 1XMOL 2N49A 1D5XC 2UXDL 3PO3H 1Y8PB 2TSSA 1B50A 1TWGH 1SE4A 1VQDA 3FP9A 1Y14B 4JC0A 5TSSA 4CJ2C 3KJPA 4A3LG 1R9TH 2Y0SE 2EJGC 3BZCA 1Q46A 3PO3B 3I4NG 4HSPA 3PIOA 5AJ3Q 2M2LA 3D4RA 4A3DH 2H5XA 4HJAA 3M4PA 4DAYB 2F3WA 5EPKA 1E0BA 1I4RA 2NB0A 2IX0A 2IY5B 4J8QA 1VQ9A 2UUCL 4DPGA 1H9RA 4GOPB 2VUMH 2YU9H 1WOCA 4DNRB 2DJGC 4F8MA 2ZTCA 2B2YC 3M7GA 4QMGA 5I6YA 1PYWD 1YNXA 2XGTA 3DM3A 4WRDA 2Y0SG 1X65A 4G57A 2K14A 2VUMB 1KNAA 2K4KA 3BYTB 4DN4M 1PV4A 3MXPA 4O0AA 1FNVA 1UUPA 3LGJA 3MXNB 2BOSA 3SE0A 3EQLC 2KEDA 4IO9A 4LF5L 3BZDB 4F87A 4JW0A 2SOBA 4LFCL 1N32Q 4AQYL 1CFMA 4GLXA 4B3MQ 3K5OA 2Q8RE 2DN8A 4BY7B 5KGUA 4X65L 1GUNA 3EN2A 5ELEA 3SGIA 3WOEA 1LTSD 2K04A 3K81C 2K5HA 2OF1A 4X64L 3KF6A 1TWAH 1PFBA 4DV3Q 1U4MA 4KY5A 2IL8A 3PO3G 4B3SL 1EY0A 1F9SA 1J6QA 1EQRA 5CV5A 5NUCA 3U58A 4XTCS 1YZ6A 4H13C 2VL6A 4E6IA 3KBXA 5JJIA 1TWAB 2AWNA 3CC7A 2N88A 1A63A 1PH8A 1RTOA 2EY2A 3V05A 2QW7A 2K6AA 1SYEA 1KXLA 4XT3B 2Z0SA 1KLGD 2F52A 1ASZA 3X3NA 5M9OA 2IX1A 2X69A 1NAPA 2E75C 3GV6A 1IZ6A 1MI2A 4DAYA 4NXMQ 2VUMG 3T56B 2WP8J 1NY4A 5CMDA 3P7JA 5FLXL 3NBHA 4LF6L 4IUVA 1JB3A 3L3OC 1X3FA 2EYMA 4GN5A 4IURA 3D4DA 1S5FD 1CZWA 2F0OA 4JI2L 2I5HA 3CQZH 3VR4A 5FJ8H 1ZKOA 4K8IA 1W6JA 4ZCKA 1VQMA 1PH9A 1CQFA 4BY7G 3MXNA 4NPSA 1B2TA 5I2YA 3CQZB 3ZYYX 5IT9c 2RDGA 4JI4L 2E8GA 5D14A 4KV6A 3BZKA 5BN3A 1YJWA 4HCSA 2BH2A 3GTJB 2YTXA 1E2WA 1TS2A 3PIO3 3H0GG 2PNHA 3AU7A 3NQTA 2MNAA 1STEA 2B39A 3W1GA 4NW2A 2G9HD 1LTID 4PMBA 4OL7A 1GHKA 3TBIB 1K9MC 4A4IA 4PNYA 4LFBL 1WD1A 1II3A 3OW2A 3KLSX 4FO2A 3RN2A 4KHZA 1RJTA 1Y69U 4A3FH 1NUCA 2IHEA 1XTCD 1L1OC 4FF4A 2NWGA 3DWQA 1I4QA 4JI0Q 4OX9L 4QQBX 2I5LX 1AZPA 4A3FB 2K5QA 4YWLA 1Q3LA 2HIXA 5HGQA 3CPFA 3X3MA 1VQ7A 2XWJB 4PV1C 4LK1C 3K0YA 2CQAA 3CC2A 3BVZA 2UUAQ 1DJRD 1VQFA 3A8JE 5JAVA 1Y8NB 5JOBA 2F0WA 4DV0Q 1C0AA 3MVVA 1DM0B 2JEAI 4HIMA 4UP9A 2MUYA 1SJED 1YJ9A 2NTSA 1KQSA 4DR6Q 4JI3L 2EYFA 4JI8Q 3GTOB 1EZ6A 2O2LD 4GN3B 2PI2E 4ABNA 2XNAC 1EIHA 1JE4A 1EY9A 4BS9A 2ES2A 1JOOA 5I2XA 3K6OA 2LSSA 4DK3C 1VQ8A 1EWCA 4CJ1B 5IGGA 3J81i 2KUMA 3T1HL 4WORA 3S24A 3ULLA 4FVMA 1TWHB 4JYAQ 2RVLA 1PMRA 5EBCA 1QCBD 2QCPX 5M5YH 4GZYC 1HR0L 2HCCA 5IT9E 4YHHQ 1DGSA 3GTGB 1DOKA 1L0WA 1VF7A 5J22A 4POFA 1AN8A 1PZKD 4H7BA 4C56C 5LHY1 4I7AA 5M5YB 1ML0D 1TR5A 1UEBA 3NUCA 4A3FG 1JWSD 3PUWA 3TMEA 3TSSA 1HZ9A 2F4VL 1KRSA 1RTNA 4FDBA 2F0EA 4XQNA 3GV3A 3L9AX 4LF8L 3I2ZA 4G7HC 2V1CC 3RD4A 1Q1EA 1QVGA 3FRPB 1XXGA 4JK1C 3KK7A 1RL2A 1P8LA 1KD1C 3NTIA 1SNDA 1U4PA 1G291 2MHVA 4KI0A 4QB4A 3PUZA 3A56A 4JI6Q 4CHTB 4DR2Q 1L0XB 3KLWA 3CCLA 1Q8KA 1FD7D 1DZ1A 1HUNA 4K5VA 1FNWA 4ZKBB 4HMJA 1E2ZA 5IYCH 3UDGA 5C3EH 2IWHA 1MD2D 3CRKC 5D3IB 1YHAA 4TRDA 4P71A 2F0DA 3IL8A 3S15H 4F7XA 1VQPA 1OTCA 1JJ2A 5K36H 5C3EB 3DXJC 3Q22A 5LMUL 1SE8A 5CV6A 5JPNC 2RBMA 3QG1A 2UXDQ 2RDFA 2DY8A 1S72A 1TQOA 4DR5L 1BO0A 4JI7L 3S15B 3KF8B 4HN7A 1C48A 1EQTA 3DHQA 4I65A 2ZJRA 2G9DA 3Q24A 3NBIA 2J4XA 3HOVB 3S1RH 4XIGS 3FHWA 3A5ZB 1GUWA 1EU3A 4CDCC 1PRTC 1IBKL 1Z47A 2JSOA 1NR4A 3CMAA 5GAHC 4DR3L 3KFUA 3G6EA 1EY8A 2SNMA 2UUCQ 2K32A 1V1OA 1TS3A 3VYSA 3RUZA 1QJOA 3UE0A 4ZLTF 5EPLA 4DNIA 4LAAA 2I0QA 2EPBA 1ENFA 2B63H 2R7ZH 1D5MC 2PPBC 3TZDA 5C3XA 4RKBA 1JJCB 1RHPA 2JA5H 5DM63 3H3VI 4Y52H 1KAWA 2B8FA 4IOCA 3TQYA 5J3BA 4B3TQ 4ZUIA 2B63B 2R7ZB 2F0UA 4JOIC 5IGEA 2JA5B 3PUYA 1WTXA 4LF5Q 3CD6A 4GKJL 3PGZA 4UHVA 4DV2Q 3EA6A 4LFCQ 4AQYQ 3KLSA 2D9UA 3WWVA 4BA2I 4FYDA 5CR3A 5EJWA 3MXGA 3OYYA 5DEHA 4TSSA 4IPDA 5C3EG 1BKBA 1S5DD 1BCPB 2VY3A 3T4AC 1HNXQ 1D7QA 3H91A 1NTGA 4U68A 2ENBA 3CHBD 2JA6H 4N9PA 2JYOA 5LL6X 4X64Q 1KDCA 4IUNA 4NMZA 4QL5A 4X62L 1O78A 2CVRA 2GVAA 5IYBH 1VQ5A 2EXDA 1HCZA 2B2UA 1VQ4A 4B3SQ 2EVBA 3GTLH 3HOVG 2ZTEA 2JA6B 1PRTD 5IGFA 4DUYL 2Z8LA 3RR5A 4DGZA 1JR0D 1UNSA 3KF8A 3AYHB 2JA9A 3D6CA 1SNMA 2EYLA 2XRQD 5BN5A 4A3CH 1N34L 1VQCA 4B3RL 2K7VA 5C4HA 4AYBB 1STGA 1QE6A 4L5RC 2LY7A 4KHVA 4DAPA 3C2PA 1JORA 2NN6H 1Z6HA 4BBRB 4GOPC 3C46A 2F3IA 1IYUA 2BH8A 1IL8A 1AFPA 4IPGA 2KVMA 3CMEA 1ZYRC 1K28A 5A2QE 2CHBD 3JAML 1YIJA 3PF4A 4PZ6A 1VQAA 4FP5D 4OO1G 2RSOA 4DXFA 2JA5G 1TY2A 4GS3A 2L12A 3NENA 3P1HA 3S1NB 3NTKA 1CTMA 2FMMA 3VR2A 2K5NA 1GXDC 1TY0A 2RKSA 3G6JB 3BS1A 1LTGD 3PUVA 2Q2UA 4LJZC 4DR4Q 4RKLA 1TWCH 5HY6A 1IBLL 4YWMA 4AYBE 1KTKA 3VA5A 1MKHA 5T1IA 3WOFA 4JI4Q 3QB3A 3Q0AA 1STHA 1NCVA 1CA6A 1YITA 2N3SA 2OWOA 2JA8H 4LUOA 4HJ5A 4Q5VA 1VQLA 1SNOA 2EXZA 1WJJA 4DA2A 5D3DA 2JA6G 1CKNB 3J80L 3A8KE 3ER0A 4GNXB 2YV5A 4LFBQ 2K5WA 3PCOB 3QOLA 5IYBG 4UP7A 1SNPA 5IYDH 2R61A 2EY5A 2HQLA 1UE7A 2A1AA 4AYBG 1K0RA 2HT1A 4B08A 4R8IA 3GTMH 4UY8C 5E3FA 1XJVA 4U673 4LF4L 1A3VA 1S5CD 3OTOQ 4BBRG 1G2SA 4OX9Q 1FNUA 1O80A 1EQQA 1T5EA 1X54A 1ZYRD 1QB5D 2E2HH 4DUZL 5FO7B 4KY6A 4CKCA 4KLKA 1C7YA 2O5JC 3J7AV 1PH6A 1C8CA 1WI5A 2UU9L 4LUZA 1CA5A 2E2HB 1J5EL 2Z6KC 2NVQH 3K8AA 2WB1E 1I5FA 2D0PA 4B9XA 4KN7C 1I4XA 2EZVA 2IT1A 2EIFA 4QF4A 4DV5Q 3LNNA 3ITPA 2A73B 3R3OA 1NSNS 1Q1BA 2NVQB 1G91A 4OWXB 4JVZA 1EWIA 4K6DA 2X6GA 4A3KG 1LUZA 4JG2A 1K3BC 3I4LA 3S1MH 1HQRD 3TP6A 2QGQA 1TXYA 1BUVT 2RA4A 1QUQB 5M3MH 3F2CA 3A54A 1HR0Q 5M3FH 1I94Q 4QIWB 5IE8A 4NP5A 2QF7A 3S1MB 4DAVA 2FINB 3ULJA 1I3QH 1CKNA 1IYVA 1I50H 2F03A 4C3IG 5M3FB 1HHVA 1YEZA 4GNXA 2E76C 2MO0A 3TRZA 4K5XA 2YTVA 3AFQA 1DOMA 1I3QB 3UDIA 3SDZA 3SR1A 5IP9H 1I50B 2NUCA 3B6YA 3J81c 3M3YH 2PQEA 4LF8Q 1PVOA 2JA7H 2CH4A 2F0GA 3CCUA 4L5TA 2OXPA 1TS5A 4JV5Q 1A62A 1LM0A 4J6HA 3M3YB 1K8OA 1JE5A 3DWAA 2JA7B 4RG1A 1VQJA 1EYGA 3PUXA 4QIWE 1TWGB 1O7IA 1AZQA 1EWHA 1OXVA 1PTOH 2EJFC 1H9SB 1R9TB 1IHZA 2NVXH 3NBHB 1DYQA 1YHBA 4H44C 2OCEA 1PA6A 4A3DB 3D3RA 4DK6C 2R7DA 3K5MA 2LKVA 2NVXB 5FLMH 2ZM6L 1V1QA 1WTPA 2YU9B 1A0IA 3D0FA 2R93H 1SFOH 3K5LA 1UWVA 4HIKA 1O7ZA 5H1SE 2F0FA 4OEMB 1S3OA 2R7FA 3HKZB 5LMUQ 1S5BD 1Y1WH 5M3FG 1QUQA 2NN6I 3G4SA 5CYUA 2IX3A 4DR5Q 3EROA 4JI7Q 1KRTA 4C3HH 5C44H 1JWMD 1MBYA 1X55A 3KOJA 1FJGL 1F77A 4K2KA 1X56A 1D8LA 4S3SA 1ET9A 3HFZB 2C5CA 4C3HB 5C44B 3D6WA 1W6KA 1ONLA 5JPMC 1IBKQ 3PIP3 4P2CB 3GD7A 3NK9A 4DR3Q 1LYLA 3I72A 1VCIA 1B9NA 1X6OA 4A3EH 3NELA 2JA7G 1N36L 4BXXH 3SHLA 3I56A 1GUOA 1KL9A 3J81E 3V96A 4P73A 1QNKA 2UXBL 2VQFL 3I3CA 4HJ9A 4A3EB 3K5NA 3OW7A 2R6GA 1O7YA 2K33A 3CW2C 4KTAA 4A3DG 4UP8A 5G3LF 3UDXA 2R92H 1QWYA 1BVSA 1F9QA 2A6HC 2K05A 1H9SA 4PMWA 4GKJQ 4Z9CB 4N8FA 1QVFA 3DUZA 4ME5A 2R92B 3FPPA 5FLMG 2EY1A 4F88A 3O13A 1YNJC 1MSGA 4KN4C 2E2JH 4H0LC 2B2UC 1TIID 3IAYA 4X62Q 4IFDI 3E0EA 3U50C 1IL2A 4X3KA 1HR0W 2EOTA 1BR9A 1UE1A 4P72A 4R1JA 5C44G 1LTLA 4DUYQ 2IPKD 5KEEA 1EYAA 1LABA 4QJFA 1IKLA 3U9SA 5C3WA 1FVIA 2B2TA 1IBML 3H3VH 4B3RQ 4BY1H 2LXJA 3T53B 2NYZD 4A3MH 2BA1A 4NXNL 4YWKA 5C0XI 1HNWL 1WTRA 3QOJA 5FO9B 2K75A 1EZ8A 3GO5A 1N33Q 4HMIA 2ASBA 1AE2A 2MFIA 2F0TA 2A6HD 1NNXA 2AWOA 3J81L 3BDCA 4LF9L 3C3LA 4XDXA 1EIFA 4RGOS 4G7OC 4FNFA 4JBWA 1GVPA 4ZK9B 1EL0A 2R92G 2EYOA 1Z7TA 2F0HA 3NWSA 4CGYB 3OWFA 1CI3M 2D5DA 1BCPF 3MWYW 1YNJD 5CBAE 2N78A 1IBLQ 4X66L 1CQVA 2AQ3B 5L37A 2PO4A 4L5SA 1LTBD 1UE5A 2UXCL 1CK1A 1QOHA 5C5LA 1WVLA 1STAA 2PMZB 3GP7A 5GADC 1E24A 1VQNA 5E4WC 1Q82C 2F4IA 2PW5A 5IP7H 5FJ8G 1E2VA 3UI2A 4PG3A 4ZQ3A 3NP8A 1PDQA 3ICEA 4O1NA 3P20A 4TVAB 3OSOA 4QUFA 3I7FA 3U4ZA 4DU9A 4EQ5A 2A19A 2IW3A 4LF4Q
chains in the Genus database with same CATH topology
4LMQD 4EGVA 1GUGA 1HXYD 2BE5C 2KA7A 2MP1A 4V190 4IUTA 2EJMA 1K8MA 5KIXA 1TKWB 3LWUA 2A6EC 4ULLA 2DNCA 4EQOA 1H9JA 4FF1A 2F0JA 4KKUA 1I4GA 1ILQA 4ZAIA 1XX8A 1D5ZC 3I70A 1XYIA 1FR3A 2XRSD 1SEBD 3CKIB 5I9PA 4OIJA 1SMYC 2FJ2A 3I4MB 4ILWA 3BG3A 4XQQA 3PO2B 2RDHA 2B2VA 3BDLA 3KUPA 1YNNC 2L55A 2DY7A 5IOCA 1Q8IA 3TN2A 1UEAB 4IFDJ 2F1MA 2AQ2B 1SBBB 1A3UA 2WKDA 4TQUS 4ODGA 2EY6A 2BE5D 2HDMA 4HAEA 3NTHA 3S17B 5C0XJ 5CBEE 2A6ED 2VB2X 3PMFA 2L4NA 2Z4HA 3H6MA 5IT9L 2NZ1D 5KRUA 4FXDA 4V0BA 5KYIA 1SMYD 1U9RA 5KNDA 3TP7A 5IGBA 2FFKB 2QKIC 1SYFA 3S1RB 1YNND 2KOLA 3NSWA 2QEJC 5LL6S 1VMCA 4X3UA 2VNUD 3HOZB 4G7ZC 4DK0A 2ICIA 3A7LA 5ELCA 2RSNA 1CHQD 3DM1A 3HZXA 2WACA 2TMPA 2B8GA 4MIUA 5EPJA 3R2IA 1KDAA 4RHSA 2YYZA 3N52A 3M7NA 3FKIB 2HQEA 5E4XA 3M4YA 3TDQA 3FMCA 3S16B 2B2WA 5ELBA 3W3AA 2A68C 2X6LA 2V4DA 5K36G 3VYUA 3Q6SA 1ENCA 5ISRA 3OWEB 4IALA 3S14B 2DNEA 3VA7A 2N55A 3FEWX 2ZXPA 1KDBA 3RLFA 3FPUB 3RZDB 4NDXA 3WDNA 3C1FA 1F9RA 2MGSA 4XYQA 4CJ0B 3GTLB 2L11A 3MFGA 4A3BB 1RDPD 4MHEA 2F0KA 3NHHA 3HP3A 4IZ8A 2IJ0A 5EKLA 1PZID 1CM9A 1JOQA 3QJYA 4HCEA 2M00A 3HOWB 1DD2A 3VR6A 2F0NA 3S1QB 3G7LA 4KMUC 2NBFA 2SNSA 5IGDA 4FF3A 5FK9C 4EQPA 3OIQA 1EQVA 3LX0A 3SK8A 2J0TD 2F0MA 1CZGA 3HG9A 2A68D 2NVYB 5T1GA 1HUMA 4RA8A 5C5MA 1B4OA 5I6WA 1TWCB 2PNRC 3VYTA 1QILA 1SNQA 5FO8B 4WJWA 1LT4D 1WTOA 3I91A 2JA8B 3ND9A 4G4KA 1SSOA 3DWPA 4RWSC 4M8AA 1KAAA 1GUSA 1MSHA 3HS0C 1Q90A 2R3ZA 4RCOA 4A3JB 4IFDH 3GTMB 3T13A 1Y8OB 1GUTA 1WD0A 2NN6G 2A5HA 3AMUA 4BWGB 3I8ZA 4L63B 4HR7B 1PFNA 4R9WA 2WKCA 4RAUC 1AP0A 5A2QL 3U9OA 1Y1VB 3HOXB 3J7AF 4RHRA 5C0XH 1SYGA 1V1PB 2WIIB 2O4XA 1V43A 3SVMA 1BOSA 1EY6A 1PRTB 2QILA 1I4HA 2EDGA 3CRLC 1G6ZA 1U4RA 2EYHA 1LTRD 3DEPA 2F0IA 3AB9A 5BN4A 3L7ZC 2K28A 1RODA 5M3MB 1ESFA 3F2UA 2JE6I 4KJNA 1EEFD 5EKIA 2I46A 2ZXRA 5IIFA 3VYRA 2L1BA 1OXTA 5I4DA 2HDLA 3QO2A 5E1FA 2OEOA 3FVQA 1SNCA 4K2LA 1SAPA 4IUPA 3MFYA 2AUJD 3NWTA 2E74C 4ZKCB 2E2IB 2Q8IB 3DEOA 4IQZA 4A3GB 5DNFA 5CV9A 4XQJA 1JICA 4OO1I 1S5ED 1JWUD 1M8AA 1OO9B 1OXXK 3KLRA 4XXEA 1BDOA 2FMCA 1XWEA 3A7AB 3FDTA 1MGSA 1SYDA 2K01A 1PTOB 1TU2B 2SDFA 1B3AA 5C0XG 3HGBA 2MPMA 1ILPA 1LT3D 3MXUA 1HTLD 4RH6A 1WTWA 1V1PA 5FLXE 3ERQA 4QUCA 1C4QA 4CKBA 1A3TA 1D1KA 4HEDA 4A93B 2R93B 1ICWA 1SFOB 4WFN3 5ELFA 3OIPA 1A15A 1FGBD 1SJHD 3SEBA 3K59A 3R2TA 1A6XA 4MN3A 1LO5D 4CBVA 1JOKA 1Y1WB 2F3VA 3IFDA 4OIKA 2KECA 1DOLA 4HSVA 1O7LA 1T5XD 3MZ5A 3OMGA 3K58A 3SK5A 1KNEA 2EYJA 4K14A 1HRJA 3T51B 1IW7C 1BBXC 1BXTA 1S4ZA 4ZYSA 1H9MA 3MAQA 1EYCA 2F0PA 1PXUA 4I7ZC 3R93A 3H0GB 2KHSA 2BA0A 5DM73 2H4OA 3OPOA 1JQYD 2PYKA 2NTTA 1GHJA 3LWEA 5C4ZA 5EBDA 2B2WC 5K5PA 1EY7A 5KYLA 2HUGA 2I07B 2CW0C 5A35A 1HFGA 3S9WA 1SYCA 3RZOB 3E0JA 2EYPA 2F0SA 1AEXA 1HQMC 4ZRZA 4RFBA 1I6HB 2HCIA 1F2ZA 4C3HG 2E2JB 1PFMA 4N9TA 1EOTA 2LFNA 3NQIA 2F0VA 1ENAA 1G2TA 3OHXC 1DXMA 3M85A 2L5TA 1IW7D 5M5WB 4ZUJA 5HGTA 2D2CC 3A55A 2OT2A 4KY7A 5M5XB 4BY1B 1V8QA 1HPCA 2F0QA 1KABA 4A3MB 3IKJA 4X3TA 1A2TA 3EFXD 3H94A 1VMPA 3VR5A 1JCKB 5JVH3 1ESRA 5G3LD 1EIGA 2ID0A 2L9HA 1VF5C 1NR2A 4UAIA 1B1ZA 1F9PA 5EGTA 3K57A 2E2DC 2CW0D 3QIAA 1EFID 5COYA 4DNTB 1RF2D 5CV8A 4ID6A 1BCPC 1B44D 1ZXTA 1UAPA 2XVSA 2KJXA 3TZUA 3GTPB 3OMCA 3PV0A 4RGNA 3QWNA 3M4OB 3RMHA 3MHBA 1G8ZD 1X3PA 3J7YW 2K5DA 1B9MA 1R4QB 2WINB 1WTVA 1AW7A 2KCCA 3E6ZX 2WV6D 1TVXA 5JEAJ 2SEBD 4C3JB 3BVGA 3E5SA 2BDOA 5EKKA 5C4JB 4KK7A 4BA1I 3W2DA 5CV7A 5I9OA 2L0CA 1LLRD 5CGKA 3EVQA 1LTAD 1LV9A 2ZXOA 1KLUD 4RGTA 4QCLA 3KBGA 2M9VA 1BCPD 3VR3A 4C1NI 4FF2A 3NXWA 2XSCA 1CHPD 1STBA 2RQXA 4RCNA 3BDOA 5J39A 3BVMA 5KNCA 2LS01 4EQNA 1HA6A 2XN9C 2NVTB 1M4VA 1J9OA 2A69C 1JC7A 4C2MB 4PQXA 1HFNA 3MTSA 4C3JG 1X3QA 1STYA 1TWFB 5CV4A 1F2MA 2JP1A 2B2YA 3EJIA 3I73A 3HOYB 1D2BA 1IKMA 2Z4IA 3BYYB 3R8BA 1SXTA 3GTKB 3CU7A 4DF7A 2K03A 1RKNA 5DAUA 5J1ZA 4K8JA 1PRTF 2ICEC 4OGQC 4KKTA 1SDFA 3GTQB 3GQBA 4KKSA 1WCMB 1RD9D 1U4LA 4K6LA 2WAQB 3JAME 1SE2A 1VDZA 2J7ZA 3TP8A 3URYA 3V2TA 1B53A 5C4XB 1TS4A 2A69D 2KEEA 4NKLA 5JVG3 3C1EA 2PW7A 3SK4A 1LACA 2XIWA 3NE5B 4Q0FA 4OO1H 1D6EC 2EE1A 2PZTA 3MA2B 1D1IA 2PZUA 4XT1B 2JEBI 3OOCA 2LMCB 5AFWA 4M1UB 2C9OA 3A8IE 3S2DB 5F2DA 2KQ3A 5IGCA 3HEJA 3SK6A 3J80E 3NPPA 1QG7A 2BCOA 2ZT9C 1OXSC 2XWBB 3P75A 5KNBA 4IN3A 1R4PB 1LTTD 1PTOF 4IUUA 4R8NA 3T16A 1BF4A 2O5IC 3TP5A 2F0LA 2MJ8A 1PTOC 1RCVD 1BNZA 2FHTA 1FYCA 5CC4A 1K83B 4EVOA 1PZJD 1ZEQX 3IFTA 1EU4A 4RGMA 3S2HB 4YIJA 5D65A 2B2TC 5JEAH 1TT2A 2QDBA 3ND8A 1QNUA 4PMCA 1EEID 1EYDA 1BQQT 3HOUB 2KCNA 4C1NK 4J1MA 1CT1D 3I90A 1SYBA 4X3SA 2Q8TA 3DMUA 3N6RA 5ELDA 4K5WA 5FKAC 2JXMB 4A3KB 2D62A 2Z1CA 1PLFA 1LT5D 4FXGC 1STNA 1HTPA 3D31A 1PTOD 4A3IB 1LT6D 1EY5A 2WB1B 4KD4A 1EY4A 3D8GA 5IODA 4UDUC 1OXUA 2H1EA 2PCFB 3H09A 4CKEA 5JJZA 1A2UA 1GOZA 5HURA 1GJXA 3D4WA 4O42A 4C3IB 1X32A 5FOBB 4IUQA 4L8JA 4DK1A 4KD3A 4BBSB 2AUKA 1ET6A 1F2YA 1L0YB 3MEHA 4DXGA 1I6VC 3SXHA 1DONA 1HA5A 5JEAG 5CORA 2K1BA 3HRZC 4DFAA 3I4NB 2AQ1B 4Y7NB 2BDNA 4B9WA 1SE3A 1WTQA 4KJOA 3H3VC 3Q23A 4HTHA 4L6TB 3MC0B 1Q12A 2PZWA 1F2LA 2Y0SB 1J8IA 4TKOB 1I4PA 5C6AA 3K7AB 4XYOA 4IFDG 2B2VC 2VB3X 2VXWA 5EQ0A 4OHJA 2GA4B 4FXKC 2A74C 1DCZA 1H9KA 3ONAB 1D5XC 1Y8PB 2TSSA 1B50A 1SE4A 5TSSA 4CJ2C 2EJGC 3PO3B 4HSPA 2M2LA 3D4RA 2F3WA 5EPKA 1E0BA 1I4RA 2NB0A 2IX0A 4J8QA 1H9RA 4DNRB 4F8MA 2B2YC 3M7GA 4QMGA 5I6YA 1PYWD 4WRDA 4G57A 2VUMB 1KNAA 3BYTB 4DN4M 3MXPA 1FNVA 1UUPA 2BOSA 3SE0A 3EQLC 2KEDA 3BZDB 4F87A 2SOBA 1CFMA 3K5OA 2Q8RE 2DN8A 4BY7B 5KGUA 1GUNA 5ELEA 3WOEA 1LTSD 2K04A 2OF1A 1PFBA 1U4MA 4KY5A 2IL8A 1EY0A 1F9SA 5CV5A 5NUCA 4XTCS 4H13C 4E6IA 3KBXA 1TWAB 2AWNA 2N88A 1RTOA 2EY2A 3V05A 2K6AA 1SYEA 4XT3B 1KLGD 3X3NA 5M9OA 2IX1A 2X69A 1NAPA 2E75C 3GV6A 1MI2A 4DAYA 3T56B 2WP8J 5CMDA 3P7JA 5FLXL 3NBHA 4IUVA 1JB3A 3L3OC 2EYMA 4IURA 3D4DA 1S5FD 1CZWA 2F0OA 3VR4A 1ZKOA 4K8IA 1W6JA 1CQFA 3MXNA 1B2TA 5I2YA 3CQZB 3ZYYX 2RDGA 5D14A 4KV6A 5BN3A 4HCSA 3GTJB 1E2WA 1TS2A 3PIO3 3AU7A 3NQTA 1STEA 2B39A 4NW2A 2G9HD 1LTID 4PMBA 4OL7A 1GHKA 3TBIB 4PNYA 1WD1A 1II3A 3KLSX 4FO2A 4KHZA 1RJTA 1Y69U 1NUCA 1XTCD 4FF4A 2NWGA 3DWQA 1I4QA 1AZPA 4A3FB 2K5QA 1Q3LA 3X3MA 2XWJB 4PV1C 4LK1C 3K0YA 2CQAA 3BVZA 1DJRD 3A8JE 5JAVA 1Y8NB 5JOBA 2F0WA 3MVVA 1DM0B 2JEAI 2MUYA 1SJED 2NTSA 2EYFA 3GTOB 1EZ6A 2O2LD 4ABNA 2XNAC 1EIHA 1JE4A 1EY9A 4BS9A 1JOOA 5I2XA 3K6OA 1EWCA 4CJ1B 5IGGA 2KUMA 4WORA 4FVMA 1TWHB 2RVLA 1PMRA 5EBCA 1QCBD 2QCPX 4GZYC 2HCCA 5IT9E 3GTGB 1DOKA 1VF7A 5J22A 1AN8A 1PZKD 4H7BA 4C56C 5LHY1 5M5YB 1ML0D 1TR5A 3NUCA 1JWSD 3PUWA 3TMEA 3TSSA 1RTNA 2F0EA 4XQNA 3GV3A 3L9AX 4G7HC 3RD4A 1Q1EA 3FRPB 1XXGA 4JK1C 3KK7A 3NTIA 1SNDA 1U4PA 1G291 2MHVA 4KI0A 4QB4A 3PUZA 3A56A 4CHTB 1L0XB 1FD7D 1DZ1A 1HUNA 4K5VA 1FNWA 4ZKBB 4HMJA 1E2ZA 2IWHA 1MD2D 3CRKC 5D3IB 4TRDA 2F0DA 3IL8A 4F7XA 5K36H 5C3EB 3DXJC 3Q22A 5CV6A 5JPNC 2RBMA 3QG1A 2RDFA 2DY8A 1TQOA 1BO0A 3S15B 4HN7A 1C48A 1EQTA 3DHQA 4I65A 2G9DA 3Q24A 3NBIA 2J4XA 3HOVB 4XIGS 1GUWA 1EU3A 1PRTC 1Z47A 2JSOA 1NR4A 1EY8A 2SNMA 2K32A 1V1OA 1TS3A 3VYSA 3RUZA 1QJOA 4ZLTF 5EPLA 4LAAA 2EPBA 1ENFA 1D5MC 2PPBC 3TZDA 5C3XA 4RKBA 1RHPA 5DM63 2B8FA 4ZUIA 2B63B 2R7ZB 2F0UA 5IGEA 2JA5B 3PUYA 1WTXA 3EA6A 4FYDA 3KLSA 2D9UA 4BA2I 5CR3A 5EJWA 3MXGA 5DEHA 4TSSA 1S5DD 1BCPB 3T4AC 3H91A 4U68A 2ENBA 3CHBD 4N9PA 2JYOA 5LL6X 1KDCA 4IUNA 4NMZA 1O78A 2CVRA 1HCZA 2B2UA 2EVBA 2JA6B 1PRTD 5IGFA 2Z8LA 4DGZA 1JR0D 1UNSA 3KF8A 3D6CA 1SNMA 2EYLA 2XRQD 5BN5A 2K7VA 5C4HA 4AYBB 1STGA 1QE6A 2LY7A 4KHVA 4DAPA 3C2PA 1JORA 2NN6H 1Z6HA 4BBRB 3C46A 1IYUA 1IL8A 1AFPA 2KVMA 1ZYRC 5A2QE 2CHBD 3JAML 4FP5D 4OO1G 2RSOA 4DXFA 1TY2A 2L12A 3P1HA 3S1NB 3NTKA 1CTMA 2FMMA 3VR2A 1GXDC 1TY0A 2RKSA 3G6JB 3BS1A 1LTGD 3PUVA 4LJZC 4RKLA 1KTKA 3VA5A 5T1IA 3WOFA 3QB3A 3Q0AA 1STHA 1NCVA 1CA6A 4Q5VA 1SNOA 2EXZA 4DA2A 5D3DA 3J80L 3A8KE 2K5WA 3QOLA 1SNPA 2R61A 2EY5A 4B08A 4R8IA 5E3FA 4U673 1A3VA 1S5CD 1G2SA 1FNUA 1O80A 1T5EA 1ZYRD 1QB5D 5FO7B 4KY6A 4CKCA 2O5JC 3J7AV 1C8CA 1CA5A 2E2HB 4B9XA 4KN7C 1I4XA 2EZVA 2IT1A 4QF4A 3LNNA 3ITPA 2A73B 3R3OA 1NSNS 1Q1BA 2NVQB 1G91A 4K6DA 2X6GA 3I4LA 1HQRD 3TP6A 2RA4A 1BUVT 3A54A 4QIWB 4NP5A 2QF7A 3S1MB 4DAVA 2FINB 1IYVA 2F03A 4C3IG 5M3FB 1HHVA 2E76C 4K5XA 1DOMA 1I3QB 3SDZA 3SR1A 1I50B 2NUCA 2PQEA 2F0GA 2OXPA 1TS5A 4J6HA 3M3YB 1K8OA 3DWAA 2JA7B 3PUXA 1TWGB 1AZQA 1EWHA 1OXVA 1PTOH 2EJFC 1H9SB 1R9TB 1IHZA 1DYQA 4H44C 4A3DB 3D3RA 3K5MA 2LKVA 2NVXB 1WTPA 2YU9B 3K5LA 1O7ZA 2F0FA 3HKZB 1S5BD 2NN6I 5CYUA 2IX3A 3EROA 1JWMD 1MBYA 1F77A 4K2KA 4S3SA 1ET9A 4C3HB 2C5CA 5C44B 3D6WA 1W6KA 1ONLA 5JPMC 3PIP3 4P2CB 3GD7A 3NK9A 3I72A 1VCIA 1B9NA 3SHLA 1GUOA 3J81E 3V96A 1QNKA 3I3CA 4A3EB 3K5NA 3OW7A 2R6GA 1O7YA 2K33A 4KTAA 5G3LF 1QWYA 1F9QA 2A6HC 2K05A 1H9SA 4PMWA 4Z9CB 3DUZA 4ME5A 2R92B 3FPPA 2EY1A 4F88A 3O13A 1YNJC 1MSGA 4KN4C 4H0LC 2B2UC 1TIID 3IAYA 4IFDI 4X3KA 2EOTA 1BR9A 2IPKD 5KEEA 1EYAA 1LABA 1IKLA 3U9SA 5C3WA 2B2TA 3T53B 2NYZD 2BA1A 5C0XI 1WTRA 3QOJA 5FO9B 1EZ8A 3GO5A 4HMIA 2F0TA 2A6HD 2AWOA 3J81L 3BDCA 3C3LA 4XDXA 4RGOS 4G7OC 4FNFA 4JBWA 4ZK9B 1EL0A 2EYOA 1Z7TA 2F0HA 3NWSA 4CGYB 3OWFA 1CI3M 2D5DA 1BCPF 3MWYW 1YNJD 5CBAE 1CQVA 2AQ3B 2PO4A 1LTBD 1CK1A 1QOHA 5C5LA 1WVLA 1STAA 2PMZB 3GP7A 5E4WC 2F4IA 2PW5A 1E2VA 3UI2A 4ZQ3A 3NP8A 1PDQA 4O1NA 3P20A 3OSOA 4QUFA 4DU9A 2IW3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGE A;  1EQV A;  4ID6 A;  4G57 A;  1SYF A;  3QOL A;  2EY1 A;  4R8N A;  3T16 A;  1SNP A;  4KJN A;  1F2Y A;  3LX0 A;  3NQT A;  2EY5 A;  1STY A;  3TP5 A;  3SK8 A;  5CV4 A;  3MXP A;  2F0M A;  3MEH A;  4OL7 A;  4PMB A;  2F0L A;  5CR3 A;  5IIF A;  5DEH A;  1F2M A;  4PNY A;  5E3F A;  3SXH A;  1EYC A;  1A3V A;  2F0P A;  1IHZ A;  5C5M A;  5E1F A;  1II3 A;  5KIX A;  4DFA A;  3EJI A;  2KHS A;  1SND A;  2OEO A;  3OMC A;  5I6W A;  2SOB A;  2ENB A;  4EQO A;  1NUC A;  1SNC A;  4QB4 A;  4B9W A;  2F0J A;  4K2L A;  4N9P A;  5CC4 A;  3MHB A;  3HZX A;  1KDC A;  2WAC A;  4IUN A;  2PYK A;  4KY6 A;  4MIU A;  1EYA A;  1SNQ A;  2LKV A;  4NMZ A;  4EVO A;  5KEE A;  5C3W A;  5C4Z A;  5KGU A;  4KJO A;  5CV9 A;  4HTH A;  1KDA A;  4DF7 A;  5I9P A;  5K5P A;  1EY7 A;  4K5V A;  1RKN A;  2HQE A;  5DAU A;  5J1Z A;  2OF1 A;  5IGF A;  4K8J A;  4DGZ A;  4YIJ A;  5KYL A;  4HMJ A;  2F0F A;  2PZW A;  3S9W A;  1SYC A;  4KY5 A;  3D6C A;  1SNM A;  1TT2 A;  2EYL A;  1KAA A;  4B9X A;  4QF4 A;  2QDB A;  2EYP A;  2F0S A;  3E5S A;  1EY0 A;  1AEX A;  5CV5 A;  5NUC A;  5C4H A;  4TRD A;  1STG A;  2F0D A;  5EKK A;  4PMC A;  3ITP A;  1SYD A;  5JAV A;  3BDL A;  3ERO A;  3QOJ A;  4E6I A;  5JOB A;  4F7X A;  5C6A A;  3R3O A;  1F2Z A;  2F0W A;  1EYD A;  1NSN S;  3MVV A;  4KHV A;  1JOR A;  1EZ8 A;  3T13 A;  4N9T A;  4HMI A;  5IOC A;  4EQP A;  1ENC A;  5CV6 A;  3TP8 A;  2F0T A;  4K2K A;  2RBM A;  2EY2 A;  4J1M A;  5CV7 A;  2RDF A;  5ISR A;  5I9O A;  4K6D A;  4S3S A;  3V2T A;  2F0V A;  1SYE A;  2EYF A;  1SYB A;  1TQO A;  4IAL A;  5CGK A;  3BDC A;  1ENA A;  3DMU A;  3EVQ A;  1EZ6 A;  4K5W A;  4NKL A;  1A3U A;  3DHQ A;  3ERQ A;  1KDB A;  3TP6 A;  1EY9 A;  3C1E A;  4I65 A;  1JOO A;  2PW7 A;  3NK9 A;  3SK4 A;  4ZUJ A;  4NDX A;  2EYO A;  2F0H A;  1A3T A;  3C1F A;  5HGT A;  5M9O A;  3OWF A;  4ODG A;  2EY6 A;  4KY7 A;  2PZT A;  5IGG A;  4NP5 A;  1STN A;  3SHL A;  4WOR A;  3P1H A;  3U9O A;  2PZU A;  2F0Q A;  1KAB A;  1EY5 A;  4KD4 A;  3NXW A;  1EY4 A;  2RKS A;  2EYM A;  3D8G A;  5IOD A;  1A2T A;  3D4D A;  1STB A;  2F0K A;  1EY8 A;  2F0O A;  2SNM A;  3NHH A;  5C5L A;  1SYG A;  4IZ8 A;  1JOK A;  1STA A;  2O4X A;  4RKL A;  2F3V A;  5F2D A;  2KQ3 A;  1A2U A;  3RUZ A;  5J22 A;  5IGC A;  1EY6 A;  5J39 A;  4KTA A;  4K5X A;  5HUR A;  4H7B A;  3PMF A;  3HEJ A;  2PW5 A;  5EKL A;  2F3W A;  3SK6 A;  3VA5 A;  3H6M A;  4K8I A;  3QB3 A;  4EQN A;  1STH A;  3SR1 A;  3D4W A;  4LAA A;  3MZ5 A;  2NUC A;  3OMG A;  4ZQ3 A;  3SK5 A;  2EYH A;  5KRU A;  3NP8 A;  5C3X A;  2PQE A;  1JOQ A;  4RKB A;  2EYJ A;  1TR5 A;  3NUC A;  4K14 A;  2M00 A;  1SNO A;  2EXZ A;  2F0G A;  4KD3 A;  4F8M A;  2F0I A;  2F0N A;  3OSO A;  3TME A;  5KYI A;  5EGT A;  3P75 A;  1U9R A;  2OXP A;  4KV6 A;  2SNS A;  4QMG A;  4ME5 A;  3TP7 A;  4DU9 A;  5IGD A;  5IGB A;  2F0E A;  5I6Y A;  4ZUI A;  4J6H A;  2F0U A;  4WRD A;  5CV8 A; 
#chains in the Genus database with same CATH topology
 4LMQ D;  4IJL A;  4EGV A;  1Q81 C;  1GUG A;  1HXY D;  5LMN L;  2BE5 C;  1XMQ L;  3H15 A;  2KA7 A;  4DUZ Q;  2MP1 A;  1XPR A;  2GVB A;  4V19 0;  4IUT A;  2B29 A;  2EJM A;  1K8M A;  5KIX A;  1TKW B;  3LWU A;  1UE6 A;  2A6E C;  4ULL A;  2DNC A;  4EQO A;  1H9J A;  4FF1 A;  4N8X 1;  1SRO A;  2F0J A;  4KKU A;  1I4G A;  3I4M H;  1ILQ A;  4ZAI A;  1XX8 A;  1D5Z C;  3I70 A;  1XYI A;  1FR3 A;  2XRS D;  2VQE L;  1SEB D;  4R4C A;  3PO2 H;  3CKI B;  5I9P A;  3E3X A;  4OIJ A;  1SMY C;  2RF4 A;  2FJ2 A;  3I4M B;  4ILW A;  4YCV A;  2K52 A;  3BG3 A;  4XQQ A;  2E5L L;  3PF5 A;  3PO2 B;  1JT8 A;  2RDH A;  2B2V A;  3BDL A;  3KUP A;  1YNN C;  4JBK A;  2L55 A;  2DY7 A;  5IOC A;  1Q8I A;  3TN2 A;  1UEA B;  4LF7 L;  4IFD J;  2F1M A;  2AQ2 B;  1SRU A;  3T1Y L;  1HJP A;  1SBB B;  3HKS A;  1PH1 A;  4C2M H;  1A3U A;  5IP7 G;  4GNX C;  2WKD A;  4TQU S;  3S17 H;  4ODG A;  4OXP A;  2EY6 A;  1E1T A;  2BE5 D;  1VS0 A;  4QGU A;  1YI2 A;  2HDM A;  4ME3 A;  4HAE A;  3NTH A;  1MIU A;  3CCE A;  1YVC A;  3UE1 A;  1XMO Q;  3S17 B;  3F8T A;  5C0X J;  5CBE E;  2A6E D;  2FXQ A;  2Q2I A;  2HD3 A;  2VB2 X;  3GDE A;  5E7N A;  3PMF A;  2L4N A;  2Z4H A;  3H6M A;  5IT9 L;  2NZ1 D;  4GLA C;  5KRU A;  1V9P A;  4FXD A;  4V0B A;  5KYI A;  1SN8 A;  1SMY D;  1U9R A;  3I4M G;  4K0K L;  2HHH L;  5KND A;  3TP7 A;  5IGB A;  2FFK B;  3TS2 A;  2QKI C;  3HOZ H;  1SYF A;  1N32 L;  3STB C;  3PO2 G;  3IRB A;  3S1R B;  1YNN D;  2KOL A;  3NSW A;  2QEJ C;  5LL6 S;  1VMC A;  4X3U A;  2VNU D;  3HOZ B;  4G7Z C;  3RLN A;  4DK0 A;  2ZM6 Q;  2ICI A;  3A7L A;  5ELC A;  1U5K A;  2RSN A;  1QZG A;  3FKI H;  1HZB A;  1CHQ D;  3DM1 A;  3HZX A;  2WAC A;  2TMP A;  2B8G A;  4MIU A;  5GRO A;  2ZJP A;  1VQE A;  1IYJ B;  5EPJ A;  3R2I A;  1KDA A;  3S16 H;  2ALY B;  4RHS A;  1A8V A;  2YYZ A;  3N52 A;  2JN4 A;  3FKI B;  2HQE A;  3M7N A;  5E4X A;  3TRE A;  1NMG A;  3M4Y A;  3TDQ A;  1FJG Q;  3FMC A;  5IYC G;  3S16 B;  4X65 Q;  1MJE A;  4AH6 A;  3S14 H;  2B2W A;  5ELB A;  3W3A A;  2A68 C;  2X6L A;  2V4D A;  5K36 G;  4NXM L;  3VYU A;  3RZD H;  3Q6S A;  1ENC A;  4DV7 L;  2AHO B;  5ISR A;  2K5V A;  3OWE B;  2JQO A;  4IAL A;  3S14 B;  2DNE A;  3VA7 A;  1N36 Q;  2N55 A;  3FEW X;  1FL0 A;  4A3B H;  2P5Z X;  1KDB A;  2ZXP A;  3RLF A;  3FPU B;  1VQB A;  3RZD B;  1VQI A;  4NDX A;  3C1F A;  3WDN A;  2UXB Q;  2VQF Q;  1F9R A;  3STB D;  2MGS A;  4LWC A;  4XYQ A;  4CJ0 B;  3GTL B;  2L11 A;  3EBE A;  3RNU A;  3MFG A;  4A3B B;  1WTH A;  3UDF A;  1RDP D;  4MHE A;  3HOZ G;  2F0K A;  3NHH A;  3HP3 A;  4IZ8 A;  4R4Q A;  2OQK A;  1VQK A;  3HOW H;  3S1Q H;  2IJ0 A;  5EKL A;  4LF6 Q;  1PZI D;  1CM9 A;  1PYS B;  3PSI A;  2B63 G;  1EOV A;  2R7Z G;  1JOQ A;  3QJY A;  4HCE A;  2M00 A;  5JJL A;  3HOW B;  1DD2 A;  3VR6 A;  2F0N A;  3S1Q B;  3G7L A;  4JI2 Q;  1K8A C;  2JJQ A;  1HNZ L;  2XTI A;  4KMU C;  2NBF A;  3FKI G;  4KHP L;  5GAG C;  2SNS A;  5JJK A;  2NVY H;  5IGD A;  2RHS B;  4FF3 A;  5FK9 C;  4EQP A;  3OIQ A;  3ZJY C;  1EQV A;  1CKM A;  2Z6B A;  3LX0 A;  2WFW A;  3SK8 A;  2J0T D;  2F0M A;  1CZG A;  3HG9 A;  2A68 D;  2NVY B;  5T1G A;  1HUM A;  4RA8 A;  3A0J A;  5C5M A;  1B4O A;  1L1O A;  1IBM Q;  5I6W A;  1TWC B;  2PNR C;  4IPH A;  3VYT A;  1QIL A;  1SNQ A;  5FO8 B;  3CCM A;  4WJW A;  1LT4 D;  1WTO A;  3I91 A;  2JA8 B;  2MQH A;  4POG A;  3ND9 A;  4A3B G;  4G4K A;  1SSO A;  4A3J H;  3DWP A;  4RWS C;  4M8A A;  1KAA A;  4JI8 L;  1GUS A;  1MSH A;  2KCM A;  3HS0 C;  4A3C G;  1FGU A;  1GO3 E;  1Q90 A;  2R3Z A;  4JI1 L;  5BR8 L;  4RCO A;  3JAM i;  4LF9 Q;  4A3J B;  4IFD H;  3GTM B;  3T13 A;  1Y8O B;  1KC8 C;  1GUT A;  1WD0 A;  4LFA L;  2LXK A;  2NN6 G;  3J7A 5;  3I4O A;  2A5H A;  3HOW G;  2KEN A;  4X66 Q;  1XPO A;  3AMU A;  4BWG B;  1Y1V H;  3I8Z A;  2A8V A;  4L63 B;  3HOX H;  4HR7 B;  2CKZ B;  3PIP A;  1PFN A;  4R9W A;  2WKC A;  4RAU C;  1AP0 A;  5A2Q L;  4JI3 Q;  3U9O A;  1Y1V B;  3HOX B;  3J7A F;  4RHR A;  4A3L H;  2L15 A;  5C0X H;  5FLX c;  3M4Q A;  4DV4 L;  1SYG A;  1V1P B;  2WII B;  2O4X A;  4DAM A;  1V43 A;  3SVM A;  1BOS A;  1EY6 A;  3J80 i;  2N8N A;  1PRT B;  2QIL A;  3T1H Q;  1I4H A;  3CCQ A;  2EDG A;  1Z9F A;  3CRL C;  4DV6 L;  1G6Z A;  1NBW A;  1U4R A;  3CF5 A;  2EYH A;  1JB7 A;  1PH7 A;  1LTR D;  2JA8 G;  5IWA L;  3DEP A;  2F0I A;  3AB9 A;  5BN4 A;  5LMN Q;  4YCW A;  4JCV E;  3L7Z C;  2K28 A;  1ROD A;  2Q2T A;  5M3M B;  1ESF A;  1KIX A;  1G6P A;  2D0O A;  3F2U A;  2JE6 I;  4KJN A;  1EEF D;  5EKI A;  4HJ7 A;  2I46 A;  5IYD G;  2ZXR A;  5IIF A;  3VYR A;  2KCT A;  2L1B A;  3K7A H;  1OXT A;  4A3J G;  5I4D A;  2F4V Q;  2HDL A;  3QO2 A;  4RMF A;  2E2I H;  5E1F A;  2VQE Q;  4A3G H;  3QR8 A;  2OEO A;  5GQO A;  3FVQ A;  1SNC A;  3CPW A;  4K2L A;  1SAP A;  4IUP A;  3MFY A;  4DR1 L;  2AUJ D;  3NWT A;  2E74 C;  4ZKC B;  4MTN A;  2E2I B;  2Q8I B;  2E5L Q;  3DEO A;  4OON A;  4IQZ A;  4A3G B;  5DNF A;  1XNQ L;  5CV9 A;  4XQJ A;  2DJF C;  1JIC A;  4OO1 I;  1S5E D;  2JK8 A;  1JWU D;  1M8A A;  1OO9 B;  1OXX K;  3KLR A;  4XXE A;  1BDO A;  1BBW A;  1Y1V G;  2FMC A;  3HOX G;  1XWE A;  3A7A B;  3I55 A;  3KYH C;  4LF7 Q;  3FDT A;  2AMC B;  1MGS A;  1PH3 A;  1SYD A;  2MO1 A;  3T1Y Q;  3CCR A;  2K01 A;  1GM5 A;  1PTO B;  1TU2 B;  3W5O A;  2SDF A;  1B3A A;  5C0X G;  4L5Q A;  3HGB A;  3L0O A;  2MPM A;  1ILP A;  1LT3 D;  3MXU A;  1HTL D;  1HZA A;  4A93 H;  2PQA B;  4RH6 A;  1WTW A;  1V1P A;  5FLX E;  3ERQ A;  1W2B A;  3CAM A;  1HZC A;  4QUC A;  1C4Q A;  4CKB A;  1U0L A;  1A3T A;  5M3M G;  1RIP A;  1D1K A;  4HED A;  3J81 j;  4A93 B;  4GLV B;  2R93 B;  1ICW A;  1SFO B;  2ATW A;  4WFN 3;  2VS1 A;  1ASY A;  1PH4 A;  5ELF A;  3OIP A;  4AIM A;  3DLL A;  1A15 A;  1FGB D;  1SJH D;  3SEB A;  3K59 A;  3R2T A;  4IOA A;  4CDE C;  1A6X A;  3W1B A;  4MN3 A;  1LO5 D;  4CBV A;  1JOK A;  1Y1W B;  2F3V A;  3IFD A;  4OWW B;  4OIK A;  2KEC A;  4B3T L;  1DOL A;  3EIV A;  4HSV A;  4K0K Q;  1O7L A;  2HHH Q;  4BY7 H;  1T5X D;  3MZ5 A;  3OMG A;  3K58 A;  3SK5 A;  5IP9 G;  4DV2 L;  4A3G G;  1KNE A;  2EYJ A;  4K14 A;  4JOI A;  1PHJ A;  1HRJ A;  2OTJ A;  3T51 B;  1HNX L;  1IW7 C;  2G5D A;  2HIV A;  3H0G H;  3HKZ E;  1EIY B;  4IJH A;  1BBX C;  1BXT A;  1S4Z A;  1K0S A;  4ZYS A;  1H9M A;  3MAQ A;  1Q7Y C;  3K7U C;  1EYC A;  1AH9 A;  2F0P A;  1PXU A;  4I7Z C;  3R93 A;  3H0G B;  4YCU A;  2KHJ A;  2KHS A;  2BA0 A;  5DM7 3;  2H4O A;  3OPO A;  4WJ4 A;  1JQY D;  2PYK A;  2NTT A;  1GHJ A;  3LWE A;  5C4Z A;  5EBD A;  2B2W C;  3RZO H;  3HKZ G;  3J7Z C;  5K5P A;  1EY7 A;  1I6H H;  4A93 G;  1JJG A;  2R93 G;  5KYL A;  2HUG A;  1SMX A;  2I07 B;  2CW0 C;  4JPB W;  5A35 A;  1HFG A;  3S9W A;  1SYC A;  2PQA A;  2OQ0 A;  3RZO B;  3E0J A;  2EYP A;  2F0S A;  4DV7 Q;  1AEX A;  1HQM C;  3AFP A;  4RFB A;  4ZRZ A;  1I6H B;  1Y1W G;  2HCI A;  4GOP A;  1F2Z A;  4C3H G;  2E2J B;  1PFM A;  5LMN W;  4N9T A;  3AQQ A;  4ALP A;  5M5W H;  1EOT A;  2LFN A;  3NQI A;  5M5X H;  2F0V A;  1N34 Q;  1ENA A;  1G2T A;  3OHX C;  1DXM A;  2RHQ B;  2NZH A;  3M85 A;  2CWA A;  2L5T A;  1IW7 D;  5M5W B;  4ZUJ A;  3GTJ H;  5HGT A;  2D2C C;  5ELO A;  4DR4 L;  3A55 A;  4X6A H;  2OT2 A;  4KY7 A;  5M5X B;  4A3E G;  1E7Z A;  4BY1 B;  1V8Q A;  1CKO A;  1HPC A;  4BXX G;  2F0Q A;  4MZ9 A;  1KAB A;  4A3M B;  1X3E A;  3IKJ A;  4X3T A;  1A2T A;  3EFX D;  3H94 A;  2C35 B;  1VMP A;  4DV1 L;  3VR5 A;  1JCK B;  5JVH 3;  1XNR L;  4A75 A;  3BU2 A;  1ESR A;  1HNZ Q;  5G3L D;  4KHP Q;  1EIG A;  2ID0 A;  2L9H A;  1VF5 C;  2GN5 A;  2CQO A;  1NR2 A;  4UAI A;  1ICF B;  1B1Z A;  1F9P A;  5EGT A;  3K57 A;  3RN5 A;  2E2D C;  2CW0 D;  3QIA A;  1EFI D;  5COY A;  4DNT B;  3OTO L;  1RF2 D;  1PYB A;  4PZ8 A;  5CV8 A;  4ID6 A;  1BCP C;  3GTP H;  1B44 D;  3TEH B;  4YY3 L;  3M4O H;  2KBN A;  1ZXT A;  1UAP A;  2XVS A;  2KJX A;  4HIO A;  3TZU A;  3A5U A;  4R4T A;  1GKH A;  2UUB L;  4JI5 L;  3GTP B;  3OMC A;  3PV0 A;  2VZA A;  4RGN A;  3GTO H;  3QWN A;  3M4O B;  3RMH A;  3F2D A;  3MHB A;  4J15 A;  1JMC A;  3E9I A;  1G8Z D;  1X3P A;  3J7Y W;  4DV5 L;  2K5D A;  2Z6K A;  1B9M A;  4C3J H;  1R4Q B;  4P74 A;  4DKA C;  4BY1 G;  4DR7 L;  4JI1 Q;  1P16 A;  2WIN B;  5BR8 Q;  5C4J H;  1TWH H;  1WTV A;  4A3M G;  1AW7 A;  2KCC A;  3E6Z X;  1B70 B;  2WV6 D;  1TVX A;  5JEA J;  4LFA Q;  2SEB D;  4C3J B;  3BVG A;  3GTG H;  3E5S A;  2BDO A;  5EKK A;  1N9W A;  2UU9 Q;  2PMZ E;  1E22 A;  5C4J B;  4KK7 A;  1VQO A;  1E3P A;  4NB3 A;  1HH2 P;  3G48 A;  4BA1 I;  2NZO A;  1J5E Q;  3W2D A;  4R4O A;  1I94 L;  3NEM A;  5CV7 A;  5I9O A;  2L0C A;  1LLR D;  5CGK A;  2AKW B;  3EVQ A;  1LTA D;  1LV9 A;  2ZXO A;  1KLU D;  4RGT A;  1YHQ A;  4QCL A;  3KBG A;  2M9V A;  1BCP D;  3L2P A;  3VR3 A;  4DV4 Q;  3JAM c;  4GKK L;  4C1N I;  4JBJ A;  3BJU A;  5IY0 A;  4FF2 A;  3CCS A;  3NXW A;  2XSC A;  2PI2 A;  1CHP D;  4DV6 Q;  4LW1 A;  1STB A;  2RQX A;  4RCN A;  2NVT H;  1CUK A;  1SR3 A;  3BDO A;  5J39 A;  3BVM A;  1NMF A;  5IWA Q;  4JV5 L;  5KNC A;  1XPU A;  2LS0 1;  3RLO A;  1SLJ A;  4EQN A;  4CDF C;  1HA6 A;  2XN9 C;  2NVT B;  1B3Q A;  5DLQ E;  5ELN A;  5AJ3 L;  1M4V A;  2RCN A;  3CCJ A;  1J9O A;  4WJ3 M;  2A69 C;  1TWF H;  1JC7 A;  4C2M B;  4PQX A;  1VQH A;  1HFN A;  1X3G A;  3MTS A;  3J80 c;  4C3J G;  1X3Q A;  1STY A;  3HOY H;  1TWF B;  5CV4 A;  3ERS X;  1F2M A;  4DR1 Q;  1G51 A;  2JP1 A;  2B2Y A;  3EJI A;  1H95 A;  1XNQ Q;  3GTK H;  3I73 A;  3HOY B;  1B8A A;  1D2B A;  1IKM A;  1L2F A;  2Z4I A;  3F2B A;  1WYD A;  1B7Y B;  3BYY B;  3GTQ H;  3R8B A;  1SXT A;  4EX5 A;  2DGY A;  3HOV H;  1X9N A;  3GTK B;  3CU7 A;  4DF7 A;  1WCM H;  2K03 A;  1RKN A;  4R4I A;  4B3M L;  5DAU A;  5J1Z A;  4K8J A;  1PRT F;  2ICE C;  4OGQ C;  4KKT A;  1SDF A;  3GTQ B;  3E9H A;  2QEX A;  3GQB A;  2QDL A;  4KKS A;  1WCM B;  1RD9 D;  1E1O A;  4OEL B;  5C4X H;  1U4L A;  4O2D A;  4K6L A;  1W3S A;  4DV3 L;  2WAQ B;  3JAM E;  1NJI C;  1NE3 A;  4QY7 A;  1SE2 A;  1VDZ A;  2J7Z A;  3TP8 A;  5EAY A;  3URY A;  3M9B A;  1GD7 A;  4H02 A;  1B53 A;  3V2T A;  5C4X B;  1TS4 A;  2A69 D;  2KEE A;  1PH2 A;  4NKL A;  4LUV A;  4HID A;  5JVG 3;  3C1E A;  2PW7 A;  3SK4 A;  1L1O B;  1LAC A;  2XIW A;  3NE5 B;  4Q0F A;  4OO1 H;  1D6E C;  2EE1 A;  3S2D H;  2PZT A;  4OWT B;  3MA2 B;  1D1I A;  2EQS A;  1XTD A;  2Z9H A;  2PZU A;  4P75 A;  4XT1 B;  2JEB I;  3OOC A;  2LMC B;  5AFW A;  4M1U B;  2ZTD A;  2C9O A;  3A8I E;  3K0X A;  3S2D B;  5F2D A;  2KQ3 A;  3HOY G;  5IGC A;  3CXC A;  3HEJ A;  3SK6 A;  3J80 E;  2DUD A;  2I5M X;  2WAQ E;  1AE3 A;  3NPP A;  1MJC A;  1QG7 A;  1PFS A;  2K50 A;  4APV A;  2BCO A;  2ZT9 C;  1MHW C;  1OXS C;  2XWB B;  3P75 A;  4GN4 B;  5KNB A;  4IN3 A;  1R4P B;  1LTT D;  3Q8D A;  1PTO F;  4IUU A;  4R8N A;  3T16 A;  1BF4 A;  1WCM G;  2O5I C;  3TP5 A;  1C9O A;  1EUJ A;  2F0L A;  2MJ8 A;  1PTO C;  1RCV D;  1K83 H;  2WAQ G;  4IPC A;  4BBR H;  1BNZ A;  2FHT A;  1CSQ A;  3U4V A;  3MEF A;  3CP0 A;  3PQI A;  1M90 C;  1YBY A;  5C4X G;  2KHI A;  1FYC A;  5CC4 A;  4MTK A;  3S2H H;  2IHF A;  3KDF B;  1K83 B;  4EVO A;  1Q86 C;  1PH5 A;  1PZJ D;  1ZEQ X;  3S1N H;  3IFT A;  1EU4 A;  4RGM A;  1N33 L;  3S2H B;  4YIJ A;  5D65 A;  2B2T C;  2B3G A;  5JEA H;  1K8G A;  4JI0 L;  4PZ7 A;  1TT2 A;  3HOU H;  2QDB A;  3ND8 A;  1QNU A;  4PMC A;  2VW9 A;  5GAE C;  1EEI D;  3JC6 6;  1EYD A;  2QA4 A;  1BQQ T;  3HOU B;  4LNQ A;  2KCN A;  4C1N K;  4J1M A;  4A3K H;  1CT1 D;  3I90 A;  2UUA L;  1M1K C;  4NXN Q;  1SYB A;  4X3S A;  2Q8T A;  3K80 C;  3DMU A;  3N6R A;  5ELD A;  4K5W A;  1HNW Q;  4DV0 L;  2ZJQ A;  5FKA C;  4A3I H;  2JXM B;  1BBU A;  1EFW A;  4A3K B;  2D62 A;  3CC4 A;  2Z1C A;  4JBM A;  1PLF A;  1LT5 D;  4DR6 L;  4DV1 Q;  4FXG C;  1STN A;  1HTP A;  1N8R C;  1XNR Q;  3D31 A;  1PTO D;  4A3I B;  2OTL A;  1LT6 D;  1EY5 A;  2WB1 B;  1VQG A;  4KD4 A;  1EY4 A;  3D8G A;  5IOD A;  4UDU C;  1OXU A;  3F1Z A;  2H1E A;  4C3I H;  2PCF B;  3H09 A;  4CKE A;  5JJZ A;  1A2U A;  1GOZ A;  5HUR A;  4BBS H;  4JYA L;  1GJX A;  3D4W A;  4O42 A;  4UPA A;  4C3I B;  1KHI A;  1X32 A;  4YHH L;  5FOB B;  2UXC Q;  4IUQ A;  4L8J A;  4DK1 A;  3TS0 A;  4KD3 A;  4BBS B;  4YY3 Q;  2AUK A;  4A76 A;  1YJN A;  3AEV A;  1ET6 A;  3KDF A;  2CH4 W;  2UUB Q;  4JI5 Q;  3I4N H;  1F2Y A;  2CFM A;  4Y7N H;  1L0Y B;  3MEH A;  2CCZ A;  4DXG A;  1I6V C;  4CDD C;  3G71 A;  3SXH A;  1DON A;  1HA5 A;  5JEA G;  5COR A;  2K1B A;  1VQ6 A;  3HRZ C;  3HOU G;  4DFA A;  3I4N B;  2AQ1 B;  4Y7N B;  2BDN A;  3VDY A;  4B9W A;  2CWP A;  3ULP A;  1IXR A;  4DR7 Q;  1SE3 A;  1XMQ Q;  4MNO A;  1WTQ A;  4KJO A;  3H3V C;  3Q23 A;  2YTY A;  3A74 A;  4HTH A;  4L6T B;  1QZH A;  2Q2H A;  1CSP A;  3MC0 B;  1Q12 A;  4JI6 L;  4DR2 L;  1QVC A;  2RCF A;  4A3I G;  2WB1 G;  2PZW A;  1F2L A;  2Y0S B;  1J8I A;  4HJ8 A;  4TKO B;  3CCV A;  1K73 C;  1S40 A;  1K3R A;  1I4P A;  1WFQ A;  5C6A A;  1T9H A;  3K7A B;  4XYO A;  4IFD G;  2B2V C;  2VB3 X;  2VXW A;  3KJO A;  5EQ0 A;  4OHJ A;  2GA4 B;  4FXK C;  3KF6 B;  4GKK Q;  4BBS G;  2A74 C;  1DCZ A;  1H9K A;  3ONA B;  1XMO L;  2N49 A;  1D5X C;  2UXD L;  3PO3 H;  1Y8P B;  2TSS A;  1B50 A;  1TWG H;  1SE4 A;  1VQD A;  3FP9 A;  1Y14 B;  4JC0 A;  5TSS A;  4CJ2 C;  3KJP A;  4A3L G;  1R9T H;  2Y0S E;  2EJG C;  3BZC A;  1Q46 A;  3PO3 B;  3I4N G;  4HSP A;  3PIO A;  5AJ3 Q;  2M2L A;  3D4R A;  4A3D H;  2H5X A;  4HJA A;  3M4P A;  4DAY B;  2F3W A;  5EPK A;  1E0B A;  1I4R A;  2NB0 A;  2IX0 A;  2IY5 B;  4J8Q A;  1VQ9 A;  2UUC L;  4DPG A;  1H9R A;  4GOP B;  2VUM H;  2YU9 H;  1WOC A;  4DNR B;  2DJG C;  4F8M A;  2ZTC A;  2B2Y C;  3M7G A;  4QMG A;  5I6Y A;  1PYW D;  1YNX A;  2XGT A;  3DM3 A;  4WRD A;  2Y0S G;  1X65 A;  4G57 A;  2K14 A;  2VUM B;  1KNA A;  2K4K A;  3BYT B;  4DN4 M;  1PV4 A;  3MXP A;  4O0A A;  1FNV A;  1UUP A;  3LGJ A;  3MXN B;  2BOS A;  3SE0 A;  3EQL C;  2KED A;  4IO9 A;  4LF5 L;  3BZD B;  4F87 A;  4JW0 A;  2SOB A;  4LFC L;  1N32 Q;  4AQY L;  1CFM A;  4GLX A;  4B3M Q;  3K5O A;  2Q8R E;  2DN8 A;  4BY7 B;  5KGU A;  4X65 L;  1GUN A;  3EN2 A;  5ELE A;  3SGI A;  3WOE A;  1LTS D;  2K04 A;  3K81 C;  2K5H A;  2OF1 A;  4X64 L;  3KF6 A;  1TWA H;  1PFB A;  4DV3 Q;  1U4M A;  4KY5 A;  2IL8 A;  3PO3 G;  4B3S L;  1EY0 A;  1F9S A;  1J6Q A;  1EQR A;  5CV5 A;  5NUC A;  3U58 A;  4XTC S;  1YZ6 A;  4H13 C;  2VL6 A;  4E6I A;  3KBX A;  5JJI A;  1TWA B;  2AWN A;  3CC7 A;  2N88 A;  1A63 A;  1PH8 A;  1RTO A;  2EY2 A;  3V05 A;  2QW7 A;  2K6A A;  1SYE A;  1KXL A;  4XT3 B;  2Z0S A;  1KLG D;  2F52 A;  1ASZ A;  3X3N A;  5M9O A;  2IX1 A;  2X69 A;  1NAP A;  2E75 C;  3GV6 A;  1IZ6 A;  1MI2 A;  4DAY A;  4NXM Q;  2VUM G;  3T56 B;  2WP8 J;  1NY4 A;  5CMD A;  3P7J A;  5FLX L;  3NBH A;  4LF6 L;  4IUV A;  1JB3 A;  3L3O C;  1X3F A;  2EYM A;  4GN5 A;  4IUR A;  3D4D A;  1S5F D;  1CZW A;  2F0O A;  4JI2 L;  2I5H A;  3CQZ H;  3VR4 A;  5FJ8 H;  1ZKO A;  4K8I A;  1W6J A;  4ZCK A;  1VQM A;  1PH9 A;  1CQF A;  4BY7 G;  3MXN A;  4NPS A;  1B2T A;  5I2Y A;  3CQZ B;  3ZYY X;  5IT9 c;  2RDG A;  4JI4 L;  2E8G A;  5D14 A;  4KV6 A;  3BZK A;  5BN3 A;  1YJW A;  4HCS A;  2BH2 A;  3GTJ B;  2YTX A;  1E2W A;  1TS2 A;  3PIO 3;  3H0G G;  2PNH A;  3AU7 A;  3NQT A;  2MNA A;  1STE A;  2B39 A;  3W1G A;  4NW2 A;  2G9H D;  1LTI D;  4PMB A;  4OL7 A;  1GHK A;  3TBI B;  1K9M C;  4A4I A;  4PNY A;  4LFB L;  1WD1 A;  1II3 A;  3OW2 A;  3KLS X;  4FO2 A;  3RN2 A;  4KHZ A;  1RJT A;  1Y69 U;  4A3F H;  1NUC A;  2IHE A;  1XTC D;  1L1O C;  4FF4 A;  2NWG A;  3DWQ A;  1I4Q A;  4JI0 Q;  4OX9 L;  4QQB X;  2I5L X;  1AZP A;  4A3F B;  2K5Q A;  4YWL A;  1Q3L A;  2HIX A;  5HGQ A;  3CPF A;  3X3M A;  1VQ7 A;  2XWJ B;  4PV1 C;  4LK1 C;  3K0Y A;  2CQA A;  3CC2 A;  3BVZ A;  2UUA Q;  1DJR D;  1VQF A;  3A8J E;  5JAV A;  1Y8N B;  5JOB A;  2F0W A;  4DV0 Q;  1C0A A;  3MVV A;  1DM0 B;  2JEA I;  4HIM A;  4UP9 A;  2MUY A;  1SJE D;  1YJ9 A;  2NTS A;  1KQS A;  4DR6 Q;  4JI3 L;  2EYF A;  4JI8 Q;  3GTO B;  1EZ6 A;  2O2L D;  4GN3 B;  2PI2 E;  4ABN A;  2XNA C;  1EIH A;  1JE4 A;  1EY9 A;  4BS9 A;  2ES2 A;  1JOO A;  5I2X A;  3K6O A;  2LSS A;  4DK3 C;  1VQ8 A;  1EWC A;  4CJ1 B;  5IGG A;  3J81 i;  2KUM A;  3T1H L;  4WOR A;  3S24 A;  3ULL A;  4FVM A;  1TWH B;  4JYA Q;  2RVL A;  1PMR A;  5EBC A;  1QCB D;  2QCP X;  5M5Y H;  4GZY C;  1HR0 L;  2HCC A;  5IT9 E;  4YHH Q;  1DGS A;  3GTG B;  1DOK A;  1L0W A;  1VF7 A;  5J22 A;  4POF A;  1AN8 A;  1PZK D;  4H7B A;  4C56 C;  5LHY 1;  4I7A A;  5M5Y B;  1ML0 D;  1TR5 A;  1UEB A;  3NUC A;  4A3F G;  1JWS D;  3PUW A;  3TME A;  3TSS A;  1HZ9 A;  2F4V L;  1KRS A;  1RTN A;  4FDB A;  2F0E A;  4XQN A;  3GV3 A;  3L9A X;  4LF8 L;  3I2Z A;  4G7H C;  2V1C C;  3RD4 A;  1Q1E A;  1QVG A;  3FRP B;  1XXG A;  4JK1 C;  3KK7 A;  1RL2 A;  1P8L A;  1KD1 C;  3NTI A;  1SND A;  1U4P A;  1G29 1;  2MHV A;  4KI0 A;  4QB4 A;  3PUZ A;  3A56 A;  4JI6 Q;  4CHT B;  4DR2 Q;  1L0X B;  3KLW A;  3CCL A;  1Q8K A;  1FD7 D;  1DZ1 A;  1HUN A;  4K5V A;  1FNW A;  4ZKB B;  4HMJ A;  1E2Z A;  5IYC H;  3UDG A;  5C3E H;  2IWH A;  1MD2 D;  3CRK C;  5D3I B;  1YHA A;  4TRD A;  4P71 A;  2F0D A;  3IL8 A;  3S15 H;  4F7X A;  1VQP A;  1OTC A;  1JJ2 A;  5K36 H;  5C3E B;  3DXJ C;  3Q22 A;  5LMU L;  1SE8 A;  5CV6 A;  5JPN C;  2RBM A;  3QG1 A;  2UXD Q;  2RDF A;  2DY8 A;  1S72 A;  1TQO A;  4DR5 L;  1BO0 A;  4JI7 L;  3S15 B;  3KF8 B;  4HN7 A;  1C48 A;  1EQT A;  3DHQ A;  4I65 A;  2ZJR A;  2G9D A;  3Q24 A;  3NBI A;  2J4X A;  3HOV B;  3S1R H;  4XIG S;  3FHW A;  3A5Z B;  1GUW A;  1EU3 A;  4CDC C;  1PRT C;  1IBK L;  1Z47 A;  2JSO A;  1NR4 A;  3CMA A;  5GAH C;  4DR3 L;  3KFU A;  3G6E A;  1EY8 A;  2SNM A;  2UUC Q;  2K32 A;  1V1O A;  1TS3 A;  3VYS A;  3RUZ A;  1QJO A;  3UE0 A;  4ZLT F;  5EPL A;  4DNI A;  4LAA A;  2I0Q A;  2EPB A;  1ENF A;  2B63 H;  2R7Z H;  1D5M C;  2PPB C;  3TZD A;  5C3X A;  4RKB A;  1JJC B;  1RHP A;  2JA5 H;  5DM6 3;  3H3V I;  4Y52 H;  1KAW A;  2B8F A;  4IOC A;  3TQY A;  5J3B A;  4B3T Q;  4ZUI A;  2B63 B;  2R7Z B;  2F0U A;  4JOI C;  5IGE A;  2JA5 B;  3PUY A;  1WTX A;  4LF5 Q;  3CD6 A;  4GKJ L;  3PGZ A;  4UHV A;  4DV2 Q;  3EA6 A;  4LFC Q;  4AQY Q;  3KLS A;  2D9U A;  3WWV A;  4BA2 I;  4FYD A;  5CR3 A;  5EJW A;  3MXG A;  3OYY A;  5DEH A;  4TSS A;  4IPD A;  5C3E G;  1BKB A;  1S5D D;  1BCP B;  2VY3 A;  3T4A C;  1HNX Q;  1D7Q A;  3H91 A;  1NTG A;  4U68 A;  2ENB A;  3CHB D;  2JA6 H;  4N9P A;  2JYO A;  5LL6 X;  4X64 Q;  1KDC A;  4IUN A;  4NMZ A;  4QL5 A;  4X62 L;  1O78 A;  2CVR A;  2GVA A;  5IYB H;  1VQ5 A;  2EXD A;  1HCZ A;  2B2U A;  1VQ4 A;  4B3S Q;  2EVB A;  3GTL H;  3HOV G;  2ZTE A;  2JA6 B;  1PRT D;  5IGF A;  4DUY L;  2Z8L A;  3RR5 A;  4DGZ A;  1JR0 D;  1UNS A;  3KF8 A;  3AYH B;  2JA9 A;  3D6C A;  1SNM A;  2EYL A;  2XRQ D;  5BN5 A;  4A3C H;  1N34 L;  1VQC A;  4B3R L;  2K7V A;  5C4H A;  4AYB B;  1STG A;  1QE6 A;  4L5R C;  2LY7 A;  4KHV A;  4DAP A;  3C2P A;  1JOR A;  2NN6 H;  1Z6H A;  4BBR B;  4GOP C;  3C46 A;  2F3I A;  1IYU A;  2BH8 A;  1IL8 A;  1AFP A;  4IPG A;  2KVM A;  3CME A;  1ZYR C;  1K28 A;  5A2Q E;  2CHB D;  3JAM L;  1YIJ A;  3PF4 A;  4PZ6 A;  1VQA A;  4FP5 D;  4OO1 G;  2RSO A;  4DXF A;  2JA5 G;  1TY2 A;  4GS3 A;  2L12 A;  3NEN A;  3P1H A;  3S1N B;  3NTK A;  1CTM A;  2FMM A;  3VR2 A;  2K5N A;  1GXD C;  1TY0 A;  2RKS A;  3G6J B;  3BS1 A;  1LTG D;  3PUV A;  2Q2U A;  4LJZ C;  4DR4 Q;  4RKL A;  1TWC H;  5HY6 A;  1IBL L;  4YWM A;  4AYB E;  1KTK A;  3VA5 A;  1MKH A;  5T1I A;  3WOF A;  4JI4 Q;  3QB3 A;  3Q0A A;  1STH A;  1NCV A;  1CA6 A;  1YIT A;  2N3S A;  2OWO A;  2JA8 H;  4LUO A;  4HJ5 A;  4Q5V A;  1VQL A;  1SNO A;  2EXZ A;  1WJJ A;  4DA2 A;  5D3D A;  2JA6 G;  1CKN B;  3J80 L;  3A8K E;  3ER0 A;  4GNX B;  2YV5 A;  4LFB Q;  2K5W A;  3PCO B;  3QOL A;  5IYB G;  4UP7 A;  1SNP A;  5IYD H;  2R61 A;  2EY5 A;  2HQL A;  1UE7 A;  2A1A A;  4AYB G;  1K0R A;  2HT1 A;  4B08 A;  4R8I A;  3GTM H;  4UY8 C;  5E3F A;  1XJV A;  4U67 3;  4LF4 L;  1A3V A;  1S5C D;  3OTO Q;  4BBR G;  1G2S A;  4OX9 Q;  1FNU A;  1O80 A;  1EQQ A;  1T5E A;  1X54 A;  1ZYR D;  1QB5 D;  2E2H H;  4DUZ L;  5FO7 B;  4KY6 A;  4CKC A;  4KLK A;  1C7Y A;  2O5J C;  3J7A V;  1PH6 A;  1C8C A;  1WI5 A;  2UU9 L;  4LUZ A;  1CA5 A;  2E2H B;  1J5E L;  2Z6K C;  2NVQ H;  3K8A A;  2WB1 E;  1I5F A;  2D0P A;  4B9X A;  4KN7 C;  1I4X A;  2EZV A;  2IT1 A;  2EIF A;  4QF4 A;  4DV5 Q;  3LNN A;  3ITP A;  2A73 B;  3R3O A;  1NSN S;  1Q1B A;  2NVQ B;  1G91 A;  4OWX B;  4JVZ A;  1EWI A;  4K6D A;  2X6G A;  4A3K G;  1LUZ A;  4JG2 A;  1K3B C;  3I4L A;  3S1M H;  1HQR D;  3TP6 A;  2QGQ A;  1TXY A;  1BUV T;  2RA4 A;  1QUQ B;  5M3M H;  3F2C A;  3A54 A;  1HR0 Q;  5M3F H;  1I94 Q;  4QIW B;  5IE8 A;  4NP5 A;  2QF7 A;  3S1M B;  4DAV A;  2FIN B;  3ULJ A;  1I3Q H;  1CKN A;  1IYV A;  1I50 H;  2F03 A;  4C3I G;  5M3F B;  1HHV A;  1YEZ A;  4GNX A;  2E76 C;  2MO0 A;  3TRZ A;  4K5X A;  2YTV A;  3AFQ A;  1DOM A;  1I3Q B;  3UDI A;  3SDZ A;  3SR1 A;  5IP9 H;  1I50 B;  2NUC A;  3B6Y A;  3J81 c;  3M3Y H;  2PQE A;  4LF8 Q;  1PVO A;  2JA7 H;  2CH4 A;  2F0G A;  3CCU A;  4L5T A;  2OXP A;  1TS5 A;  4JV5 Q;  1A62 A;  1LM0 A;  4J6H A;  3M3Y B;  1K8O A;  1JE5 A;  3DWA A;  2JA7 B;  4RG1 A;  1VQJ A;  1EYG A;  3PUX A;  4QIW E;  1TWG B;  1O7I A;  1AZQ A;  1EWH A;  1OXV A;  1PTO H;  2EJF C;  1H9S B;  1R9T B;  1IHZ A;  2NVX H;  3NBH B;  1DYQ A;  1YHB A;  4H44 C;  2OCE A;  1PA6 A;  4A3D B;  3D3R A;  4DK6 C;  2R7D A;  3K5M A;  2LKV A;  2NVX B;  5FLM H;  2ZM6 L;  1V1Q A;  1WTP A;  2YU9 B;  1A0I A;  3D0F A;  2R93 H;  1SFO H;  3K5L A;  1UWV A;  4HIK A;  1O7Z A;  5H1S E;  2F0F A;  4OEM B;  1S3O A;  2R7F A;  3HKZ B;  5LMU Q;  1S5B D;  1Y1W H;  5M3F G;  1QUQ A;  2NN6 I;  3G4S A;  5CYU A;  2IX3 A;  4DR5 Q;  3ERO A;  4JI7 Q;  1KRT A;  4C3H H;  5C44 H;  1JWM D;  1MBY A;  1X55 A;  3KOJ A;  1FJG L;  1F77 A;  4K2K A;  1X56 A;  1D8L A;  4S3S A;  1ET9 A;  3HFZ B;  2C5C A;  4C3H B;  5C44 B;  3D6W A;  1W6K A;  1ONL A;  5JPM C;  1IBK Q;  3PIP 3;  4P2C B;  3GD7 A;  3NK9 A;  4DR3 Q;  1LYL A;  3I72 A;  1VCI A;  1B9N A;  1X6O A;  4A3E H;  3NEL A;  2JA7 G;  1N36 L;  4BXX H;  3SHL A;  3I56 A;  1GUO A;  1KL9 A;  3J81 E;  3V96 A;  4P73 A;  1QNK A;  2UXB L;  2VQF L;  3I3C A;  4HJ9 A;  4A3E B;  3K5N A;  3OW7 A;  2R6G A;  1O7Y A;  2K33 A;  3CW2 C;  4KTA A;  4A3D G;  4UP8 A;  5G3L F;  3UDX A;  2R92 H;  1QWY A;  1BVS A;  1F9Q A;  2A6H C;  2K05 A;  1H9S A;  4PMW A;  4GKJ Q;  4Z9C B;  4N8F A;  1QVF A;  3DUZ A;  4ME5 A;  2R92 B;  3FPP A;  5FLM G;  2EY1 A;  4F88 A;  3O13 A;  1YNJ C;  1MSG A;  4KN4 C;  2E2J H;  4H0L C;  2B2U C;  1TII D;  3IAY A;  4X62 Q;  4IFD I;  3E0E A;  3U50 C;  1IL2 A;  4X3K A;  1HR0 W;  2EOT A;  1BR9 A;  1UE1 A;  4P72 A;  4R1J A;  5C44 G;  1LTL A;  4DUY Q;  2IPK D;  5KEE A;  1EYA A;  1LAB A;  4QJF A;  1IKL A;  3U9S A;  5C3W A;  1FVI A;  2B2T A;  1IBM L;  3H3V H;  4B3R Q;  4BY1 H;  2LXJ A;  3T53 B;  2NYZ D;  4A3M H;  2BA1 A;  4NXN L;  4YWK A;  5C0X I;  1HNW L;  1WTR A;  3QOJ A;  5FO9 B;  2K75 A;  1EZ8 A;  3GO5 A;  1N33 Q;  4HMI A;  2ASB A;  1AE2 A;  2MFI A;  2F0T A;  2A6H D;  1NNX A;  2AWO A;  3J81 L;  3BDC A;  4LF9 L;  3C3L A;  4XDX A;  1EIF A;  4RGO S;  4G7O C;  4FNF A;  4JBW A;  1GVP A;  4ZK9 B;  1EL0 A;  2R92 G;  2EYO A;  1Z7T A;  2F0H A;  3NWS A;  4CGY B;  3OWF A;  1CI3 M;  2D5D A;  1BCP F;  3MWY W;  1YNJ D;  5CBA E;  2N78 A;  1IBL Q;  4X66 L;  1CQV A;  2AQ3 B;  5L37 A;  2PO4 A;  4L5S A;  1LTB D;  1UE5 A;  2UXC L;  1CK1 A;  1QOH A;  5C5L A;  1WVL A;  1STA A;  2PMZ B;  3GP7 A;  5GAD C;  1E24 A;  1VQN A;  5E4W C;  1Q82 C;  2F4I A;  2PW5 A;  5IP7 H;  5FJ8 G;  1E2V A;  3UI2 A;  4PG3 A;  4ZQ3 A;  3NP8 A;  1PDQ A;  3ICE A;  4O1N A;  3P20 A;  4TVA B;  3OSO A;  4QUF A;  3I7F A;  3U4Z A;  4DU9 A;  4EQ5 A;  2A19 A;  2IW3 A;  4LF4 Q; 
#chains in the Genus database with same CATH homology
 4LMQ D;  4EGV A;  1GUG A;  1HXY D;  2BE5 C;  2KA7 A;  2MP1 A;  4V19 0;  4IUT A;  2EJM A;  1K8M A;  5KIX A;  1TKW B;  3LWU A;  2A6E C;  4ULL A;  2DNC A;  4EQO A;  1H9J A;  4FF1 A;  2F0J A;  4KKU A;  1I4G A;  1ILQ A;  4ZAI A;  1XX8 A;  1D5Z C;  3I70 A;  1XYI A;  1FR3 A;  2XRS D;  1SEB D;  3CKI B;  5I9P A;  4OIJ A;  1SMY C;  2FJ2 A;  3I4M B;  4ILW A;  3BG3 A;  4XQQ A;  3PO2 B;  2RDH A;  2B2V A;  3BDL A;  3KUP A;  1YNN C;  2L55 A;  2DY7 A;  5IOC A;  1Q8I A;  3TN2 A;  1UEA B;  4IFD J;  2F1M A;  2AQ2 B;  1SBB B;  1A3U A;  2WKD A;  4TQU S;  4ODG A;  2EY6 A;  2BE5 D;  2HDM A;  4HAE A;  3NTH A;  3S17 B;  5C0X J;  5CBE E;  2A6E D;  2VB2 X;  3PMF A;  2L4N A;  2Z4H A;  3H6M A;  5IT9 L;  2NZ1 D;  5KRU A;  4FXD A;  4V0B A;  5KYI A;  1SMY D;  1U9R A;  5KND A;  3TP7 A;  5IGB A;  2FFK B;  2QKI C;  1SYF A;  3S1R B;  1YNN D;  2KOL A;  3NSW A;  2QEJ C;  5LL6 S;  1VMC A;  4X3U A;  2VNU D;  3HOZ B;  4G7Z C;  4DK0 A;  2ICI A;  3A7L A;  5ELC A;  2RSN A;  1CHQ D;  3DM1 A;  3HZX A;  2WAC A;  2TMP A;  2B8G A;  4MIU A;  5EPJ A;  3R2I A;  1KDA A;  4RHS A;  2YYZ A;  3N52 A;  3M7N A;  3FKI B;  2HQE A;  5E4X A;  3M4Y A;  3TDQ A;  3FMC A;  3S16 B;  2B2W A;  5ELB A;  3W3A A;  2A68 C;  2X6L A;  2V4D A;  5K36 G;  3VYU A;  3Q6S A;  1ENC A;  5ISR A;  3OWE B;  4IAL A;  3S14 B;  2DNE A;  3VA7 A;  2N55 A;  3FEW X;  2ZXP A;  1KDB A;  3RLF A;  3FPU B;  3RZD B;  4NDX A;  3WDN A;  3C1F A;  1F9R A;  2MGS A;  4XYQ A;  4CJ0 B;  3GTL B;  2L11 A;  3MFG A;  4A3B B;  1RDP D;  4MHE A;  2F0K A;  3NHH A;  3HP3 A;  4IZ8 A;  2IJ0 A;  5EKL A;  1PZI D;  1CM9 A;  1JOQ A;  3QJY A;  4HCE A;  2M00 A;  3HOW B;  1DD2 A;  3VR6 A;  2F0N A;  3S1Q B;  3G7L A;  4KMU C;  2NBF A;  2SNS A;  5IGD A;  4FF3 A;  5FK9 C;  4EQP A;  3OIQ A;  1EQV A;  3LX0 A;  3SK8 A;  2J0T D;  2F0M A;  1CZG A;  3HG9 A;  2A68 D;  2NVY B;  5T1G A;  1HUM A;  4RA8 A;  5C5M A;  1B4O A;  5I6W A;  1TWC B;  2PNR C;  3VYT A;  1QIL A;  1SNQ A;  5FO8 B;  4WJW A;  1LT4 D;  1WTO A;  3I91 A;  2JA8 B;  3ND9 A;  4G4K A;  1SSO A;  3DWP A;  4RWS C;  4M8A A;  1KAA A;  1GUS A;  1MSH A;  3HS0 C;  1Q90 A;  2R3Z A;  4RCO A;  4A3J B;  4IFD H;  3GTM B;  3T13 A;  1Y8O B;  1GUT A;  1WD0 A;  2NN6 G;  2A5H A;  3AMU A;  4BWG B;  3I8Z A;  4L63 B;  4HR7 B;  1PFN A;  4R9W A;  2WKC A;  4RAU C;  1AP0 A;  5A2Q L;  3U9O A;  1Y1V B;  3HOX B;  3J7A F;  4RHR A;  5C0X H;  1SYG A;  1V1P B;  2WII B;  2O4X A;  1V43 A;  3SVM A;  1BOS A;  1EY6 A;  1PRT B;  2QIL A;  1I4H A;  2EDG A;  3CRL C;  1G6Z A;  1U4R A;  2EYH A;  1LTR D;  3DEP A;  2F0I A;  3AB9 A;  5BN4 A;  3L7Z C;  2K28 A;  1ROD A;  5M3M B;  1ESF A;  3F2U A;  2JE6 I;  4KJN A;  1EEF D;  5EKI A;  2I46 A;  2ZXR A;  5IIF A;  3VYR A;  2L1B A;  1OXT A;  5I4D A;  2HDL A;  3QO2 A;  5E1F A;  2OEO A;  3FVQ A;  1SNC A;  4K2L A;  1SAP A;  4IUP A;  3MFY A;  2AUJ D;  3NWT A;  2E74 C;  4ZKC B;  2E2I B;  2Q8I B;  3DEO A;  4IQZ A;  4A3G B;  5DNF A;  5CV9 A;  4XQJ A;  1JIC A;  4OO1 I;  1S5E D;  1JWU D;  1M8A A;  1OO9 B;  1OXX K;  3KLR A;  4XXE A;  1BDO A;  2FMC A;  1XWE A;  3A7A B;  3FDT A;  1MGS A;  1SYD A;  2K01 A;  1PTO B;  1TU2 B;  2SDF A;  1B3A A;  5C0X G;  3HGB A;  2MPM A;  1ILP A;  1LT3 D;  3MXU A;  1HTL D;  4RH6 A;  1WTW A;  1V1P A;  5FLX E;  3ERQ A;  4QUC A;  1C4Q A;  4CKB A;  1A3T A;  1D1K A;  4HED A;  4A93 B;  2R93 B;  1ICW A;  1SFO B;  4WFN 3;  5ELF A;  3OIP A;  1A15 A;  1FGB D;  1SJH D;  3SEB A;  3K59 A;  3R2T A;  1A6X A;  4MN3 A;  1LO5 D;  4CBV A;  1JOK A;  1Y1W B;  2F3V A;  3IFD A;  4OIK A;  2KEC A;  1DOL A;  4HSV A;  1O7L A;  1T5X D;  3MZ5 A;  3OMG A;  3K58 A;  3SK5 A;  1KNE A;  2EYJ A;  4K14 A;  1HRJ A;  3T51 B;  1IW7 C;  1BBX C;  1BXT A;  1S4Z A;  4ZYS A;  1H9M A;  3MAQ A;  1EYC A;  2F0P A;  1PXU A;  4I7Z C;  3R93 A;  3H0G B;  2KHS A;  2BA0 A;  5DM7 3;  2H4O A;  3OPO A;  1JQY D;  2PYK A;  2NTT A;  1GHJ A;  3LWE A;  5C4Z A;  5EBD A;  2B2W C;  5K5P A;  1EY7 A;  5KYL A;  2HUG A;  2I07 B;  2CW0 C;  5A35 A;  1HFG A;  3S9W A;  1SYC A;  3RZO B;  3E0J A;  2EYP A;  2F0S A;  1AEX A;  1HQM C;  4ZRZ A;  4RFB A;  1I6H B;  2HCI A;  1F2Z A;  4C3H G;  2E2J B;  1PFM A;  4N9T A;  1EOT A;  2LFN A;  3NQI A;  2F0V A;  1ENA A;  1G2T A;  3OHX C;  1DXM A;  3M85 A;  2L5T A;  1IW7 D;  5M5W B;  4ZUJ A;  5HGT A;  2D2C C;  3A55 A;  2OT2 A;  4KY7 A;  5M5X B;  4BY1 B;  1V8Q A;  1HPC A;  2F0Q A;  1KAB A;  4A3M B;  3IKJ A;  4X3T A;  1A2T A;  3EFX D;  3H94 A;  1VMP A;  3VR5 A;  1JCK B;  5JVH 3;  1ESR A;  5G3L D;  1EIG A;  2ID0 A;  2L9H A;  1VF5 C;  1NR2 A;  4UAI A;  1B1Z A;  1F9P A;  5EGT A;  3K57 A;  2E2D C;  2CW0 D;  3QIA A;  1EFI D;  5COY A;  4DNT B;  1RF2 D;  5CV8 A;  4ID6 A;  1BCP C;  1B44 D;  1ZXT A;  1UAP A;  2XVS A;  2KJX A;  3TZU A;  3GTP B;  3OMC A;  3PV0 A;  4RGN A;  3QWN A;  3M4O B;  3RMH A;  3MHB A;  1G8Z D;  1X3P A;  3J7Y W;  2K5D A;  1B9M A;  1R4Q B;  2WIN B;  1WTV A;  1AW7 A;  2KCC A;  3E6Z X;  2WV6 D;  1TVX A;  5JEA J;  2SEB D;  4C3J B;  3BVG A;  3E5S A;  2BDO A;  5EKK A;  5C4J B;  4KK7 A;  4BA1 I;  3W2D A;  5CV7 A;  5I9O A;  2L0C A;  1LLR D;  5CGK A;  3EVQ A;  1LTA D;  1LV9 A;  2ZXO A;  1KLU D;  4RGT A;  4QCL A;  3KBG A;  2M9V A;  1BCP D;  3VR3 A;  4C1N I;  4FF2 A;  3NXW A;  2XSC A;  1CHP D;  1STB A;  2RQX A;  4RCN A;  3BDO A;  5J39 A;  3BVM A;  5KNC A;  2LS0 1;  4EQN A;  1HA6 A;  2XN9 C;  2NVT B;  1M4V A;  1J9O A;  2A69 C;  1JC7 A;  4C2M B;  4PQX A;  1HFN A;  3MTS A;  4C3J G;  1X3Q A;  1STY A;  1TWF B;  5CV4 A;  1F2M A;  2JP1 A;  2B2Y A;  3EJI A;  3I73 A;  3HOY B;  1D2B A;  1IKM A;  2Z4I A;  3BYY B;  3R8B A;  1SXT A;  3GTK B;  3CU7 A;  4DF7 A;  2K03 A;  1RKN A;  5DAU A;  5J1Z A;  4K8J A;  1PRT F;  2ICE C;  4OGQ C;  4KKT A;  1SDF A;  3GTQ B;  3GQB A;  4KKS A;  1WCM B;  1RD9 D;  1U4L A;  4K6L A;  2WAQ B;  3JAM E;  1SE2 A;  1VDZ A;  2J7Z A;  3TP8 A;  3URY A;  3V2T A;  1B53 A;  5C4X B;  1TS4 A;  2A69 D;  2KEE A;  4NKL A;  5JVG 3;  3C1E A;  2PW7 A;  3SK4 A;  1LAC A;  2XIW A;  3NE5 B;  4Q0F A;  4OO1 H;  1D6E C;  2EE1 A;  2PZT A;  3MA2 B;  1D1I A;  2PZU A;  4XT1 B;  2JEB I;  3OOC A;  2LMC B;  5AFW A;  4M1U B;  2C9O A;  3A8I E;  3S2D B;  5F2D A;  2KQ3 A;  5IGC A;  3HEJ A;  3SK6 A;  3J80 E;  3NPP A;  1QG7 A;  2BCO A;  2ZT9 C;  1OXS C;  2XWB B;  3P75 A;  5KNB A;  4IN3 A;  1R4P B;  1LTT D;  1PTO F;  4IUU A;  4R8N A;  3T16 A;  1BF4 A;  2O5I C;  3TP5 A;  2F0L A;  2MJ8 A;  1PTO C;  1RCV D;  1BNZ A;  2FHT A;  1FYC A;  5CC4 A;  1K83 B;  4EVO A;  1PZJ D;  1ZEQ X;  3IFT A;  1EU4 A;  4RGM A;  3S2H B;  4YIJ A;  5D65 A;  2B2T C;  5JEA H;  1TT2 A;  2QDB A;  3ND8 A;  1QNU A;  4PMC A;  1EEI D;  1EYD A;  1BQQ T;  3HOU B;  2KCN A;  4C1N K;  4J1M A;  1CT1 D;  3I90 A;  1SYB A;  4X3S A;  2Q8T A;  3DMU A;  3N6R A;  5ELD A;  4K5W A;  5FKA C;  2JXM B;  4A3K B;  2D62 A;  2Z1C A;  1PLF A;  1LT5 D;  4FXG C;  1STN A;  1HTP A;  3D31 A;  1PTO D;  4A3I B;  1LT6 D;  1EY5 A;  2WB1 B;  4KD4 A;  1EY4 A;  3D8G A;  5IOD A;  4UDU C;  1OXU A;  2H1E A;  2PCF B;  3H09 A;  4CKE A;  5JJZ A;  1A2U A;  1GOZ A;  5HUR A;  1GJX A;  3D4W A;  4O42 A;  4C3I B;  1X32 A;  5FOB B;  4IUQ A;  4L8J A;  4DK1 A;  4KD3 A;  4BBS B;  2AUK A;  1ET6 A;  1F2Y A;  1L0Y B;  3MEH A;  4DXG A;  1I6V C;  3SXH A;  1DON A;  1HA5 A;  5JEA G;  5COR A;  2K1B A;  3HRZ C;  4DFA A;  3I4N B;  2AQ1 B;  4Y7N B;  2BDN A;  4B9W A;  1SE3 A;  1WTQ A;  4KJO A;  3H3V C;  3Q23 A;  4HTH A;  4L6T B;  3MC0 B;  1Q12 A;  2PZW A;  1F2L A;  2Y0S B;  1J8I A;  4TKO B;  1I4P A;  5C6A A;  3K7A B;  4XYO A;  4IFD G;  2B2V C;  2VB3 X;  2VXW A;  5EQ0 A;  4OHJ A;  2GA4 B;  4FXK C;  2A74 C;  1DCZ A;  1H9K A;  3ONA B;  1D5X C;  1Y8P B;  2TSS A;  1B50 A;  1SE4 A;  5TSS A;  4CJ2 C;  2EJG C;  3PO3 B;  4HSP A;  2M2L A;  3D4R A;  2F3W A;  5EPK A;  1E0B A;  1I4R A;  2NB0 A;  2IX0 A;  4J8Q A;  1H9R A;  4DNR B;  4F8M A;  2B2Y C;  3M7G A;  4QMG A;  5I6Y A;  1PYW D;  4WRD A;  4G57 A;  2VUM B;  1KNA A;  3BYT B;  4DN4 M;  3MXP A;  1FNV A;  1UUP A;  2BOS A;  3SE0 A;  3EQL C;  2KED A;  3BZD B;  4F87 A;  2SOB A;  1CFM A;  3K5O A;  2Q8R E;  2DN8 A;  4BY7 B;  5KGU A;  1GUN A;  5ELE A;  3WOE A;  1LTS D;  2K04 A;  2OF1 A;  1PFB A;  1U4M A;  4KY5 A;  2IL8 A;  1EY0 A;  1F9S A;  5CV5 A;  5NUC A;  4XTC S;  4H13 C;  4E6I A;  3KBX A;  1TWA B;  2AWN A;  2N88 A;  1RTO A;  2EY2 A;  3V05 A;  2K6A A;  1SYE A;  4XT3 B;  1KLG D;  3X3N A;  5M9O A;  2IX1 A;  2X69 A;  1NAP A;  2E75 C;  3GV6 A;  1MI2 A;  4DAY A;  3T56 B;  2WP8 J;  5CMD A;  3P7J A;  5FLX L;  3NBH A;  4IUV A;  1JB3 A;  3L3O C;  2EYM A;  4IUR A;  3D4D A;  1S5F D;  1CZW A;  2F0O A;  3VR4 A;  1ZKO A;  4K8I A;  1W6J A;  1CQF A;  3MXN A;  1B2T A;  5I2Y A;  3CQZ B;  3ZYY X;  2RDG A;  5D14 A;  4KV6 A;  5BN3 A;  4HCS A;  3GTJ B;  1E2W A;  1TS2 A;  3PIO 3;  3AU7 A;  3NQT A;  1STE A;  2B39 A;  4NW2 A;  2G9H D;  1LTI D;  4PMB A;  4OL7 A;  1GHK A;  3TBI B;  4PNY A;  1WD1 A;  1II3 A;  3KLS X;  4FO2 A;  4KHZ A;  1RJT A;  1Y69 U;  1NUC A;  1XTC D;  4FF4 A;  2NWG A;  3DWQ A;  1I4Q A;  1AZP A;  4A3F B;  2K5Q A;  1Q3L A;  3X3M A;  2XWJ B;  4PV1 C;  4LK1 C;  3K0Y A;  2CQA A;  3BVZ A;  1DJR D;  3A8J E;  5JAV A;  1Y8N B;  5JOB A;  2F0W A;  3MVV A;  1DM0 B;  2JEA I;  2MUY A;  1SJE D;  2NTS A;  2EYF A;  3GTO B;  1EZ6 A;  2O2L D;  4ABN A;  2XNA C;  1EIH A;  1JE4 A;  1EY9 A;  4BS9 A;  1JOO A;  5I2X A;  3K6O A;  1EWC A;  4CJ1 B;  5IGG A;  2KUM A;  4WOR A;  4FVM A;  1TWH B;  2RVL A;  1PMR A;  5EBC A;  1QCB D;  2QCP X;  4GZY C;  2HCC A;  5IT9 E;  3GTG B;  1DOK A;  1VF7 A;  5J22 A;  1AN8 A;  1PZK D;  4H7B A;  4C56 C;  5LHY 1;  5M5Y B;  1ML0 D;  1TR5 A;  3NUC A;  1JWS D;  3PUW A;  3TME A;  3TSS A;  1RTN A;  2F0E A;  4XQN A;  3GV3 A;  3L9A X;  4G7H C;  3RD4 A;  1Q1E A;  3FRP B;  1XXG A;  4JK1 C;  3KK7 A;  3NTI A;  1SND A;  1U4P A;  1G29 1;  2MHV A;  4KI0 A;  4QB4 A;  3PUZ A;  3A56 A;  4CHT B;  1L0X B;  1FD7 D;  1DZ1 A;  1HUN A;  4K5V A;  1FNW A;  4ZKB B;  4HMJ A;  1E2Z A;  2IWH A;  1MD2 D;  3CRK C;  5D3I B;  4TRD A;  2F0D A;  3IL8 A;  4F7X A;  5K36 H;  5C3E B;  3DXJ C;  3Q22 A;  5CV6 A;  5JPN C;  2RBM A;  3QG1 A;  2RDF A;  2DY8 A;  1TQO A;  1BO0 A;  3S15 B;  4HN7 A;  1C48 A;  1EQT A;  3DHQ A;  4I65 A;  2G9D A;  3Q24 A;  3NBI A;  2J4X A;  3HOV B;  4XIG S;  1GUW A;  1EU3 A;  1PRT C;  1Z47 A;  2JSO A;  1NR4 A;  1EY8 A;  2SNM A;  2K32 A;  1V1O A;  1TS3 A;  3VYS A;  3RUZ A;  1QJO A;  4ZLT F;  5EPL A;  4LAA A;  2EPB A;  1ENF A;  1D5M C;  2PPB C;  3TZD A;  5C3X A;  4RKB A;  1RHP A;  5DM6 3;  2B8F A;  4ZUI A;  2B63 B;  2R7Z B;  2F0U A;  5IGE A;  2JA5 B;  3PUY A;  1WTX A;  3EA6 A;  4FYD A;  3KLS A;  2D9U A;  4BA2 I;  5CR3 A;  5EJW A;  3MXG A;  5DEH A;  4TSS A;  1S5D D;  1BCP B;  3T4A C;  3H91 A;  4U68 A;  2ENB A;  3CHB D;  4N9P A;  2JYO A;  5LL6 X;  1KDC A;  4IUN A;  4NMZ A;  1O78 A;  2CVR A;  1HCZ A;  2B2U A;  2EVB A;  2JA6 B;  1PRT D;  5IGF A;  2Z8L A;  4DGZ A;  1JR0 D;  1UNS A;  3KF8 A;  3D6C A;  1SNM A;  2EYL A;  2XRQ D;  5BN5 A;  2K7V A;  5C4H A;  4AYB B;  1STG A;  1QE6 A;  2LY7 A;  4KHV A;  4DAP A;  3C2P A;  1JOR A;  2NN6 H;  1Z6H A;  4BBR B;  3C46 A;  1IYU A;  1IL8 A;  1AFP A;  2KVM A;  1ZYR C;  5A2Q E;  2CHB D;  3JAM L;  4FP5 D;  4OO1 G;  2RSO A;  4DXF A;  1TY2 A;  2L12 A;  3P1H A;  3S1N B;  3NTK A;  1CTM A;  2FMM A;  3VR2 A;  1GXD C;  1TY0 A;  2RKS A;  3G6J B;  3BS1 A;  1LTG D;  3PUV A;  4LJZ C;  4RKL A;  1KTK A;  3VA5 A;  5T1I A;  3WOF A;  3QB3 A;  3Q0A A;  1STH A;  1NCV A;  1CA6 A;  4Q5V A;  1SNO A;  2EXZ A;  4DA2 A;  5D3D A;  3J80 L;  3A8K E;  2K5W A;  3QOL A;  1SNP A;  2R61 A;  2EY5 A;  4B08 A;  4R8I A;  5E3F A;  4U67 3;  1A3V A;  1S5C D;  1G2S A;  1FNU A;  1O80 A;  1T5E A;  1ZYR D;  1QB5 D;  5FO7 B;  4KY6 A;  4CKC A;  2O5J C;  3J7A V;  1C8C A;  1CA5 A;  2E2H B;  4B9X A;  4KN7 C;  1I4X A;  2EZV A;  2IT1 A;  4QF4 A;  3LNN A;  3ITP A;  2A73 B;  3R3O A;  1NSN S;  1Q1B A;  2NVQ B;  1G91 A;  4K6D A;  2X6G A;  3I4L A;  1HQR D;  3TP6 A;  2RA4 A;  1BUV T;  3A54 A;  4QIW B;  4NP5 A;  2QF7 A;  3S1M B;  4DAV A;  2FIN B;  1IYV A;  2F03 A;  4C3I G;  5M3F B;  1HHV A;  2E76 C;  4K5X A;  1DOM A;  1I3Q B;  3SDZ A;  3SR1 A;  1I50 B;  2NUC A;  2PQE A;  2F0G A;  2OXP A;  1TS5 A;  4J6H A;  3M3Y B;  1K8O A;  3DWA A;  2JA7 B;  3PUX A;  1TWG B;  1AZQ A;  1EWH A;  1OXV A;  1PTO H;  2EJF C;  1H9S B;  1R9T B;  1IHZ A;  1DYQ A;  4H44 C;  4A3D B;  3D3R A;  3K5M A;  2LKV A;  2NVX B;  1WTP A;  2YU9 B;  3K5L A;  1O7Z A;  2F0F A;  3HKZ B;  1S5B D;  2NN6 I;  5CYU A;  2IX3 A;  3ERO A;  1JWM D;  1MBY A;  1F77 A;  4K2K A;  4S3S A;  1ET9 A;  4C3H B;  2C5C A;  5C44 B;  3D6W A;  1W6K A;  1ONL A;  5JPM C;  3PIP 3;  4P2C B;  3GD7 A;  3NK9 A;  3I72 A;  1VCI A;  1B9N A;  3SHL A;  1GUO A;  3J81 E;  3V96 A;  1QNK A;  3I3C A;  4A3E B;  3K5N A;  3OW7 A;  2R6G A;  1O7Y A;  2K33 A;  4KTA A;  5G3L F;  1QWY A;  1F9Q A;  2A6H C;  2K05 A;  1H9S A;  4PMW A;  4Z9C B;  3DUZ A;  4ME5 A;  2R92 B;  3FPP A;  2EY1 A;  4F88 A;  3O13 A;  1YNJ C;  1MSG A;  4KN4 C;  4H0L C;  2B2U C;  1TII D;  3IAY A;  4IFD I;  4X3K A;  2EOT A;  1BR9 A;  2IPK D;  5KEE A;  1EYA A;  1LAB A;  1IKL A;  3U9S A;  5C3W A;  2B2T A;  3T53 B;  2NYZ D;  2BA1 A;  5C0X I;  1WTR A;  3QOJ A;  5FO9 B;  1EZ8 A;  3GO5 A;  4HMI A;  2F0T A;  2A6H D;  2AWO A;  3J81 L;  3BDC A;  3C3L A;  4XDX A;  4RGO S;  4G7O C;  4FNF A;  4JBW A;  4ZK9 B;  1EL0 A;  2EYO A;  1Z7T A;  2F0H A;  3NWS A;  4CGY B;  3OWF A;  1CI3 M;  2D5D A;  1BCP F;  3MWY W;  1YNJ D;  5CBA E;  1CQV A;  2AQ3 B;  2PO4 A;  1LTB D;  1CK1 A;  1QOH A;  5C5L A;  1WVL A;  1STA A;  2PMZ B;  3GP7 A;  5E4W C;  2F4I A;  2PW5 A;  1E2V A;  3UI2 A;  4ZQ3 A;  3NP8 A;  1PDQ A;  4O1N A;  3P20 A;  3OSO A;  4QUF A;  4DU9 A;  2IW3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...