5IGGA

Crystal structure of staphylococcal nuclease variant delta+phs v66h/i72e at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
130
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKEEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66H/I72E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5iggA00
4TRDA 5CV4A 3U9OA 4DFAA 5HURA 2F0VA 5IGBA 5KYLA 5C4HA 3QB3A 1F2YA 4KD4A 4HMJA 3TP8A 3OMCA 3V2TA 2EXZA 3QOJA 1TQOA 5C5LA 2ENBA 5IGEA 3BDCA 3SK8A 2F0UA 3NP8A 4WORA 2PZTA 3NK9A 4ME5A 1NUCA 2F0FA 3D4DA 3D6CA 3TP5A 3MZ5A 2EYHA 5DEHA 4MIUA 5IOCA 1SNCA 2F0LA 3PMFA 4K5VA 4KJNA 2F0QA 2F3VA 1EY6A 5IIFA 2EYPA 2EYLA 2EY1A 4NDXA 3TMEA 4G57A 1JOOA 5J39A 5CV9A 2EYMA 1SNMA 1STNA 4ODGA 3SK4A 1EZ6A 2F0SA 1TT2A 4LAAA 4K5XA 4J6HA 1EQVA 4OL7A 3QOLA 2PQEA 4ZUIA 4YIJA 5EGTA 3HEJA 4K5WA 2PW5A 4EVOA 3R3OA 4KY6A 4WRDA 1KDBA 3ERQA 1SNPA 5CR3A 2F0EA 1U9RA 2PZUA 2EYFA 5IODA 4QMGA 3NUCA 3T16A 2F0GA 5EKKA 4DGZA 3C1EA 4PMBA 3RUZA 3P75A 5IGFA 4ZQ3A 3EJIA 3VA5A 2M00A 4HTHA 1EYCA 5F2DA 5CC4A 4K2KA 2F0DA 1SYGA 1NSNS 3NHHA 5J1ZA 4K6DA 1SYBA 4KJOA 4HMIA 3TP6A 1STAA 5HGTA 2EY6A 5KEEA 4I65A 1F2ZA 3EROA 3H6MA 2WACA 2KHSA 5NUCA 1EY7A 2F0PA 2EYJA 2F0KA 3MEHA 4IZ8A 5I9OA 1SNDA 4NMZA 4PMCA 1EYAA 3NXWA 5DAUA 5IGDA 5KYIA 2OF1A 5IGCA 3BDLA 1AEXA 1A3VA 4RKBA 2O4XA 5I6YA 5M9OA 1STYA 5CGKA 1IHZA 5CV5A 5CV6A 4KY7A 1EZ8A 1SYEA 2F0MA 4PNYA 5ISRA 3LX0A 4F7XA 4DU9A 4RKLA 4E6IA 1A3UA 1JOKA 3SR1A 1F2MA 1KDAA 1II3A 3SK5A 2SOBA 4R8NA 2F0NA 3MHBA 5C5MA 4DF7A 2PYKA 2KQ3A 5E1FA 1JOQA 2EYOA 3EVQA 2F0HA 2SNSA 1KABA 3MVVA 2F0TA 4KTAA 4N9TA 1A3TA 5C3WA 5C3XA 2PW7A 5KGUA 3ITPA 1SYFA 2F0IA 3D4WA 3E5SA 3MXPA 4J1MA 4NP5A 5CV7A 5K5PA 4F8MA 1ENCA 5C6AA 1KAAA 2RDFA 4IUNA 3OSOA 3OWFA 2LKVA 3NQTA 4IALA 3SHLA 5KIXA 1A2UA 4B9XA 4QB4A 4KHVA 5C4ZA 4KD3A 1SYCA 4K14A 3DMUA 3S9WA 4ID6A 1EY9A 4H7BA 5I6WA 2F0JA 3HZXA 1JORA 4NKLA 3SK6A 5I9PA 1ENAA 1STGA 2PZWA 2EY2A 5J22A 2F0OA 2NUCA 1STHA 3D8GA 4K2LA 1RKNA 1SNOA 5KRUA 1STBA 4KY5A 2QDBA 4EQPA 5JAVA 4EQNA 1EY8A 2RBMA 4EQOA 5JOBA 4S3SA 2EY5A 5E3FA 5EKLA 2OEOA 5IGGA 4KV6A 4ZUJA 1EY4A 1EY5A 1KDCA 1EY0A 1TR5A 2OXPA 4K8JA 3SXHA 3T13A 1SNQA 4QF4A 2HQEA 4B9WA 3C1FA 3DHQA 2F0WA 5CV8A 4N9PA 3OMGA 2SNMA 4K8IA 3P1HA 1A2TA 1EYDA 2F3WA 1SYDA 2RKSA 3TP7A
chains in the Genus database with same CATH superfamily
4K0KQ 4OWXB 5HURA 1UEBA 4DV3L 1QUQB 1SAPA 4KKUA 1XNRL 2HQLA 2R92B 2R92H 5C3EH 1N36Q 1E24A 2C35B 4RH6A 4G4KA 3NK9A 3J81j 2G9HD 3D4DA 3D6CA 3MZ5A 5ELBA 3DLLA 1XMQQ 2F3VA 3KLRA 2AKWB 4RGMA 3F2UA 1VQJA 4DV1Q 2L12A 3KBXA 4HEDA 3D4RA 3TRZA 3SEBA 1VQ5A 1JWMD 4PZ8A 2PO4A 1KXLA 1KRTA 4ABNA 2F0EA 3H0GG 3TEHB 1NMFA 3K57A 3DWQA 1OXUA 3DWPA 4DXGA 2K01A 1PH1A 1YVCA 3NHHA 5FLMG 1GUTA 4KJOA 4M8AA 1CTMA 4IQZA 3HOZG 3FVQA 2DN8A 2HIXA 4X3KA 1YI2A 2IY5B 4CJ1B 4FF2A 2LXJA 1IBML 3OYYA 1STYA 2ZTEA 2L0CA 5IY0A 4B3MQ 3I4NH 5DM63 1HNWL 4UY8C 1VQ7A 1KL9A 2KEEA 1RJTA 3K80C 1WCMB 1ONLA 1WCMH 1KNEA 1PH2A 4DF7A 1ASYA 2JA9A 1Y8NB 5GAEC 1W3SA 4NXNL 1K83B 1K83H 1IW7C 3GQBA 1ENCA 4BY1G 1SE3A 3MEFA 1RHPA 2UUAQ 2ZXOA 2CH4W 3L2PA 4A3DB 4A3DH 5J3BA 2A68D 4HIKA 3S9WA 2ALYB 4A3IG 2ZXPA 4I7ZC 4X65Q 1RL2A 2KCNA 3UE1A 1K73C 3K5MA 2D0PA 2RCFA 2K5WA 5JOBA 3R93A 1ZEQX 2EOTA 4JBJA 1SDFA 2LXKA 4DR5L 3U4VA 1S40A 2NZOA 5IT9L 1VQBA 4U68A 1G8ZD 2F0WA 2O5IC 5CV8A 4K8IA 1BBUA 5LMNQ 4B3SQ 4JI1L 2J7ZA 2B2UC 1VQMA 4PG3A 5IGBA 3CCQA 1EYGA 4CBVA 1AE2A 4N8FA 4B3RQ 4LUZA 1EQTA 3PIO3 3M4YA 5CORA 1PXUA 1NUCA 3MFGA 2EYHA 4MIUA 1NR2A 1SR3A 1QVFA 4JK1C 4LF5L 2EYPA 1ZYRD 1QJOA 2JA6G 1FNUA 5IYDH 1V1QA 1YNNC 5G3LF 2EJFC 4K5XA 2A6HD 2SEBD 4J6HA 4C2MB 4C2MH 2PQEA 2J4XA 2O2LD 2WB1B 3KFUA 4DV3Q 1IKMA 1XNRQ 2HDLA 2R93B 4XTCS 2B2TC 2R93H 1YNXA 4ZKCB 3W3AA 3I4OA 4CJ0B 3T16A 5EKKA 2N49A 1JJ2A 3HKZE 2F4VL 1BO0A 4RMFA 3QG1A 1VQ9A 1G6ZA 1UE7A 4A93G 3TBIB 5C4XB 5C4XH 1X6OA 2R92G 4X6AH 1WTRA 2Z6KA 2EDGA 5A2QL 2B29A 4QIWE 2FHTA 2ZJPA 3K59A 4KHZA 3UI2A 1YHAA 1EZ8A 4F7XA 5ELCA 1G51A 1U4PA 1AH9A 4HCEA 1CUKA 1PTOC 2DY8A 4O2DA 3G6JB 2GVBA 4IFDI 1N9WA 3CU7A 4JVZA 4J1MA 1O7ZA 2YV5A 4F8MA 1KQSA 4DNIA 3CCVA 4OO1H 1JB3A 1IBMQ 3AMUA 3J7AF 4IOAA 4Y52H 3Q8DA 4GOPB 1HNWQ 1RIPA 4DN4M 1WTWA 1M1KC 1G91A 2A5HA 3D8GA 1CFMA 3BVZA 2NWGA 1UE6A 5LMUL 2K04A 4A3BG 4NXNQ 4EX5A 1HNXL 4LNQA 1OTCA 3CRLC 2E76C 2HDMA 4A3FH 2QCPX 3IFDA 1XNQL 1WCMG 2EE1A 2R3ZA 3M4QA 5JVG3 1D7QA 2K7VA 4A3GB 2RSNA 4FDBA 4A3GH 3TP7A 3S16B 4R8IA 4JI0L 1O80A 2ICIA 3I72A 3VYSA 3V2TA 1PH5A 4RGOS 4IPCA 3BG3A 2YTYA 1F9PA 2B2VC 4AQYL 4R1JA 1FNWA 4DR5Q 4A3JB 4A3JH 3CCEA 2EYMA 3CMEA 1EQVA 1CKOA 1FR3A 4JI1Q 3F1ZA 4DNTB 2K32A 4WRDA 1KDBA 3NENA 3IRBA 4DK1A 1VDZA 3H09A 1TXYA 4C3JH 4BBRB 4BBRH 1WVLA 1N34L 4DGZA 3RUZA 4O1NA 2A19A 2KCCA 2UXDL 4IPGA 2E2IB 4LF5Q 5IT9E 5FO7B 1BBXC 1MSHA 1B53A 3H6MA 2VUMB 2VUMH 4TKOB 3ZJYC 1P8LA 5LMNW 5KNBA 4GNXA 3VYTA 1AEXA 4V190 2RVLA 3PSIA 3LX0A 5IYDG 4DK6C 1R4PB 2F4VQ 1HJPA 1H9KA 1MSGA 3H3VH 2WB1G 1VQFA 3EVQA 1JICA 3O13A 1SYFA 4NP5A 3J81i 4RCNA 4OHJA 2BDNA 4IPDA 3CC4A 3E0JA 1BBWA 1F77A 2R6GA 5C4XG 1Q12A 4ID6A 3W2DA 5I2YA 3JAMi 4FF4A 3CPWA 2AMCB 1SXTA 3BZCA 1VQGA 4PV1C 4YWKA 4WFN3 1J5EL 4RGTA 2O5JC 3NTKA 2EY5A 3EA6A 2VQFL 2XRSD 5A2QE 1RDPD 4HIDA 5FJ8G 1RD9D 1EY0A 1TR5A 1W6KA 2A6ED 2CW0D 2Q8RE 2OWOA 3DHQA 1JJCB 1K3RA 5BR8L 2RKSA 4GLXA 4FF3A 4IJLA 1CQVA 4DFAA 1BCPC 4ZK9B 3OMCA 5LMUQ 1LTID 3V05A 2V4DA 3J81L 2WKCA 1UE1A 1K0RA 1L0YB 4QUCA 1HNXQ 4YWMA 2AWNA 2LS01 4HSVA 4BXXG 2CKZB 2YU9B 4C1NK 2YU9H 4OX9L 4FF1A 1XNQQ 2MQHA 3K0XA 3JAML 1JWUD 4X3TA 1EEID 2L15A 1SNMA 1XXGA 1EU3A 1EZ6A 4LF4L 1I6VC 4ZUIA 4YIJA 4JI0Q 1FNVA 4P71A 2NB0A 3VR3A 4BY7B 4BY7H 3S24A 4NXML 1E3PA 4AQYQ 2Z4HA 4B3TL 2AUKA 4A3GG 2IT1A 1LTGD 1EYCA 1CHPD 4K2KA 4ZYSA 5J1ZA 2EVBA 1NSNS 1HZBA 3GTMB 1SYBA 3GTMH 1TWFH 1X55A 3STBC 1AZPA 3MEHA 1NMGA 3OPOA 4OIKA 5M5YB 5M5YH 3K6OA 4RKBA 3K5NA 3CCRA 2O4XA 4KN7C 1WJJA 4A3JG 1UEAB 1RODA 1N34Q 3A5ZB 2ATWA 2KA7A 4XT3B 4DU9A 1LYLA 1BXTA 3A56A 1AP0A 1G6PA 2ZTDA 2NYZD 1Z47A 2UXDQ 4OWWB 2EYOA 2WAQE 2TSSA 1JR0D 2PW7A 1PV4A 4DV6L 3VYUA 2MO1A 5T1GA 5FLXc 1X3EA 2LKVA 2NZ1D 4JCVE 3Q24A 4JOIC 1TWCB 3RMHA 1TWCH 5ELOA 2N3SA 4CGYB 1TIID 2R7ZB 1DYQA 2R7ZH 1YJWA 4M1UB 1OXXK 1STGA 2RSOA 2I46A 2IHFA 2B2UA 1SNOA 1PH8A 3EIVA 4KY5A 1GM5A 4EQNA 1EWIA 3RZOH 2JYOA 4A3LG 3I4MB 2I0QA 2NVTB 2NVTH 1QCBD 1EU4A 3AU7A 1KDCA 3T13A 2BE5D 3TN2A 4LMQD 1EYDA 3S2HB 4JI6Q 3S2HH 5AJ3L 2N88A 1ILPA 2YYZA 3TP8A 3C3LA 1GJXA 1BUVT 1J5EQ 2PI2A 1P16A 2XSCA 2VQFQ 3UDXA 1EUJA 1WTQA 2RHQB 2F0LA 1CA6A 2B63B 3A7LA 1D5ZC 2EY1A 4NDXA 2A68C 5J39A 4NPSA 3A8IE 3H0GB 3H0GH 3SK4A 5CYUA 4JI8L 5BR8Q 4R4OA 1U4LA 2RCNA 2F1MA 1SEBD 1X54A 2IHEA 3WDNA 3AFQA 3CD6A 1SJED 1S5ED 1YITA 1TS4A 5FLMH 4QMGA 2R61A 4DA2A 2OCEA 2B2YA 4MTNA 3VR2A 1G291 1LO5D 4OX9Q 1K9MC 2N55A 2G9DA 3NELA 5FO8B 2MNAA 2VXWA 3ICEA 1IZ6A 1LABA 4LF4Q 3DM1A 5E7NA 1Q46A 4CKEA 3S14B 1TY2A 3S14H 3QR8A 1IHZA 2K52A 1PYSB 3J81E 1PYBA 1SYEA 4NXMQ 1TS2A 4R4CA 2KECA 4B3TQ 1MIUA 1SN8A 3PQIA 2XNAC 5C5MA 2PYKA 3FDTA 5HY6A 2D2CC 1ZYRC 1KRSA 1BNZA 2WFWA 1I3QB 1UUPA 4EGVA 1HFNA 4GNXB 3OWFA 2VW9A 1YNJD 1HH2P 2PMZB 1S3OA 4DPGA 4JI4L 3H15A 4LFAL 1C48A 4H0LC 1LTTD 3DEPA 3HOXB 3W5OA 2EY2A 5J22A 3AEVA 1Q1EA 4DV4L 2EJMA 1H9JA 1EOTA 1S5BD 4DV6Q 2RBMA 3PF5A 2K4KA 2L55A 5EKLA 3TREA 5JEAJ 1PH6A 3KJOA 3PUZA 4HJ8A 1MHWC 3KYHC 5EJWA 3P1HA 3QIAA 4JI3L 4ZAIA 3A8JE 3KF6A 5D65A 1AW7A 3L3OC 2EXZA 2R7DA 3HKSA 5IGEA 1XPUA 3BDCA 3A5UA 2JA6B 1Q90A 3K5OA 2JA6H 3I8ZA 4WORA 2F0FA 1JMCA 3GTQB 2EPBA 2FJ2A 2PCFB 2HCCA 4IFDJ 2GN5A 1CM9A 4PMWA 1Z9FA 2JA5B 2JA5H 1UE5A 4DKAC 4LF8L 3I4MG 1Q3LA 5AJ3Q 2PW5A 3CQZB 3CQZH 3TDQA 1O7IA 4GKJL 3S2DB 3S2DH 4A93B 4A93H 1M4VA 5L37A 2IX3A 5EBCA 1PH7A 1RTOA 1Q7YC 2AHOB 3VA5A 2WIIB 4GS3A 1X32A 1DOLA 4OXPA 1TWAB 4JI8Q 4R4IA 5DAUA 1WTOA 2OF1A 4C56C 2FXQA 3Q6SA 4H02A 5M9OA 1CQFA 3CCJA 1IBKL 2B63G 3GTGH 1HTPA 5CV6A 4DAYA 3GTGB 1AFPA 5ISRA 1QVCA 4IUTA 1PYWD 4HJ9A 1XX8A 4J15A 2X6LA 3SGIA 4KTAA 3VR5A 4H44C 3OW7A 3FMCA 1VS0A 4JBWA 2NN6G 3UDFA 4XQNA 1GKHA 2RDFA 5D3IB 4ZKBB 3HOWB 1N32L 4KHVA 3K7UC 4DAMA 4BA2I 2NBFA 4A3BB 4A3BH 2K5DA 4NKLA 1QVGA 1TS5A 2F0OA 3GP7A 2Q8TA 1D1IA 1W6JA 2A8VA 2MFIA 1EIGA 3PUYA 1EY8A 1NAPA 3PF4A 3LGJA 5IGGA 4ME3A 2A69D 4DR6L 2OXPA 4XDXA 1VQ4A 2PQAA 2HQEA 1U5KA 2JEBI 4JI4Q 1IXRA 3PIPA 1B3AA 3E0EA 4LFAQ 1SYDA 4APVA 1N33Q 4TRDA 3HS0C 3G71A 5FKAC 4DV4Q 4A3EG 1A8VA 4HMJA 4IN3A 4ULLA 1UWVA 1V8QA 2J0TD 2PMZE 5C5LA 1SE8A 2MPMA 1LTBD 3U58A 3NP8A 1E0BA 3H3VI 4EQ5A 2L4NA 2IW3A 2Z6BA 3HOXG 1HCZA 4FP5D 4DK0A 4L5TA 4G57A 4UP7A 5G3LD 4LAAA 3MXUA 1QWYA 4JI3Q 4LFCL 5C0XG 1ESRA 1LACA 1SBBB 1IYUA 4L6TB 5CR3A 5K36H 1I4RA 2L11A 3PUWA 4Y7NB 4Y7NH 1WTVA 1PRTF 1GOZA 2HCIA 2XTIA 2RHSB 2B2WA 4RA8A 3CC2A 1BKBA 2IWHA 1Q82C 2CW0C 1YZ6A 4P72A 1DOMA 5JJKA 4XQJA 1MGSA 5FOBB 5CMDA 4LF8Q 3NPPA 2EYJA 2F0KA 2B3GA 1LLRD 3SDZA 4HR7B 3BDLA 1BDOA 2JP1A 4DV0L 4GKJQ 5EPJA 2KUMA 3G48A 1PMRA 5GROA 5M5WB 5M5WH 2DJGC 1MKHA 4AYBB 2JA5G 1DCZA 1KDAA 2UXCL 4LFBL 2KQ3A 3SE0A 1KC8C 2UUBL 2JEAI 1WOCA 2CH4A 2WKDA 1E1OA 2TMPA 3H94A 1FL0A 4IUQA 4BA1I 3AFPA 1XYIA 2WV6D 2EXDA 3MXNB 4V0BA 4ILWA 3KOJA 4DUYL 2LFNA 2D62A 3B6YA 2F0JA 3D3RA 3RNUA 2FMMA 1STHA 2NUCA 3QJYA 1T9HA 4CJ2C 3KBGA 5COYA 5KNCA 5FJ8H 5BN3A 4LUVA 3K5LA 1DONA 1BF4A 2DGYA 4UAIA 2AUJD 4EQOA 1OXTA 1H9RA 4K8JA 1N32Q 1SNQA 4QF4A 2XN9C 1WI5A 4JBMA 1I4QA 4A75A 2CWAA 2KBNA 2MJ8A 2XVSA 1NTGA 2Z0SA 5IT9c 3A55A 4JW0A 3KLWA 3QB3A 3MXGA 3HOWG 3S17B 4RHSA 3S17H 1L1OA 4BXXH 3VYRA 1DM0B 3UDIA 1WD1A 4DR6Q 1VQAA 2AWOA 3HOUB 3HOUH 3GTLB 4BBSG 2K28A 3GTLH 4CDFC 4QQBX 2EJGC 3KF6B 1HR0L 3RN5A 3S16H 4N8X1 1U9RA 5D14A 1ZXTA 3CC7A 3GTOB 3GTOH 4X3UA 5JVH3 1SYGA 2BE5C 2I07B 3CCUA 3TSSA 2FINB 1F2ZA 1E7ZA 5NUCA 3K58A 4GOPC 1EL0A 3M85A 4LFCQ 4PMCA 3WOEA 5IGCA 3NTIA 5IE8A 4GKKL 4DR2L 2CFMA 1EIFA 4KY7A 4OEMB 1XPOA 3BZDB 5ELDA 3CMAA 3D6WA 1VCIA 1PZJD 2RA4A 3LWUA 1OXSC 2NZHA 1PFBA 1PH4A 3MHBA 2XRQD 1JJGA 3EN2A 5K36G 2E2IH 4DR1L 2JE6I 3E5SA 3D4WA 1VQCA 3G6EA 4HAEA 4IUNA 3RLNA 4DV0Q 4DAYB 1B8AA 1HHVA 4MHEA 3J7YW 3G7LA 1VQKA 3HP3A 1HUNA 1SRUA 1I4HA 2UXCQ 3T4AC 4A3LH 4LFBQ 1NR4A 1RKNA 2AQ2B 2UUBQ 2OT2A 1I94L 2WB1E 2VY3A 2X6GA 4MTKA 1U4RA 3OTOL 2XIWA 4AYBG 4XXEA 5I9PA 1EY4A 1IW7D 1DZ1A 3F8TA 1NNXA 3C1FA 1ML0D 4DUYQ 1A15A 2UXBL 1YHQA 3NWTA 3GV3A 4JG2A 1VQ6A 2QF7A 3FHWA 4A3KB 4A3KH 4AIMA 5C4HA 1HTLD 2FMCA 2KCMA 2V1CC 3Q0AA 4YHHL 5KNDA 1E2ZA 2VQEL 1LM0A 1MBYA 1I4XA 1YHBA 2PQAB 2HHHL 1CI3M 3M3YB 1YNJC 5IP9H 1SMXA 4QGUA 1FGUA 1UNSA 1K28A 5EGTA 4JBKA 4K5WA 3V96A 2MHVA 3ND9A 3ERQA 2IL8A 2M2LA 2EQSA 3H3VC 1VQHA 2NVYB 2NVYH 2EZVA 1Y1VG 3HGBA 3RD4A 3EJIA 1CSPA 2BDOA 2Z1CA 2OTJA 3A7AB 2B8GA 1PZID 1ILQA 2VL6A 1Y8PB 1V1OA 5C0XI 1PDQA 5KEEA 1QZGA 3GTJB 1B7YB 5I9OA 1CZGA 1Y14B 3Q22A 3NXWA 1IBLL 1VMPA 5CV5A 1LT6D 1XWEA 4HN7A 4JI7L 3HOUG 2E74C 1HPCA 3QWNA 1VQNA 2Y0SB 1II3A 4NB3A 3TZDA 2KENA 2F0HA 2SNSA 4LUOA 5C3XA 2JA8B 2JA8H 2F0IA 3KLSA 5K5PA 3I55A 1KAAA 2HIVA 4IUUA 2AQ3B 4GKKQ 4DR2Q 4KD3A 1CSQA 5EQ0A 1SYCA 1Y69U 3I7FA 4XYQA 5EBDA 1NCVA 3GV6A 4JPBW 1K8OA 1STEA 5DLQE 1GUOA 3EQLC 3NSWA 1GHJA 2OQ0A 4DR1Q 2PPBC 1TVXA 1BR9A 3K0YA 3HFZB 4YWLA 1PH9A 3SXHA 1EIYB 4Z9CB 3MAQA 4JV5L 3URYA 3I70A 1A2TA 5KIXA 1GVPA 1A63A 4C3IB 1RF2D 3CF5A 2CWPA 5CV4A 3U9OA 1VMCA 3HG9A 1PRTB 1I94Q 1TQOA 1CA5A 1DXMA 2XGTA 1UAPA 1HRJA 3NBHA 3HOYB 3OTOQ 5IOCA 1JQYD 4WJWA 1PTOF 3TP5A 2BCOA 3U50C 5JJZA 3J81c 4K5VA 3I4MH 5IIFA 2EYLA 3T56B 2ICEC 4I7AA 4P75A 2UXBQ 1AN8A 1O78A 2QGQA 2JJQA 1JB7A 1J8IA 1D5XC 3OIQA 3JAMc 1KTKA 2CHBD 4RCOA 1L1OB 4LF9L 4POFA 2I5HA 4F88A 2PZUA 1K8GA 2OQKA 2F0GA 3A54A 3AYHB 4TSSA 4YHHQ 4HJ5A 1ET9A 2VQEQ 2B2TA 3ER0A 2Z6KC 4A3KG 2HHHQ 3GO5A 1B44D 5CBAE 4K6DA 4KKSA 5GADC 2MUYA 1VQEA 4I65A 2B63H 4B08A 1EY7A 1EWHA 3J80L 1EYAA 1I5FA 3T53B 1A3VA 1ESFA 1V1PA 4KN4C 1QZHA 5IP9G 2MO0A 4TVAB 4OGQC 1EQQA 4DAPA 1A3UA 3SR1A 1F2MA 2NN6H 4UPAA 2Q2IA 5JJLA 3MVVA 1V9PA 2K5NA 1PVOA 2KCTA 3MXPA 2Z8LA 2JA7G 3PO2G 3M7NA 5DM73 2UUCL 1S4ZA 1IBLQ 2IPKD 1J6QA 2JN4A 4A3CH 4K14A 2NVQB 4ZLTF 2NVQH 4JI7Q 1EY9A 1OO9B 1JC7A 2CVRA 4H13C 4KHPL 1HXYD 5JPNC 3E9HA 2EIFA 3QO2A 5I2XA 4DNRB 5KRUA 3TS2A 5EKIA 1Q1BA 3I91A 5DNFA 4C3HB 4C3HH 1TWHB 1TWHH 5E3FA 2OEOA 4KV6A 2Y0SG 5JEAG 2JQOA 1I3QH 2A6HC 1HR0W 1VQIA 4A3EB 4G7OC 4A3EH 2RDGA 4L63B 4BWGB 2H4OA 2ZT9C 3OMGA 3PUXA 5ELFA 1ASZA 3BJUA 2JA8G 3I4LA 1LTSD 4MN3A 4FNFA 3F2DA 1HZ9A 3BVGA 1VQDA 3HOXH 1S5FD 3X3MA 3M9BA 3SK8A 3MTSA 4PZ6A 4P2CB 1JCKB 2B39A 1SNCA 5C0XH 1EY6A 3CPFA 4JV5Q 2B2VA 1GUWA 2JK8A 2JSOA 5FK9C 4MNOA 2AQ1B 3HEJA 2KHIA 4KY6A 1YIJA 1SFOB 1SFOH 1KAWA 2RF4A 2RQXA 5IODA 1HA6A 4R4TA 1B9MA 1B2TA 1HFGA 4PMBA 1RCVD 4C3IG 1DGSA 4FYDA 3I73A 3OW2A 3GTQH 2SDFA 1TWGB 1TWGH 4P73A 2I5LX 2NTTA 3VA7A 2LY7A 2F4IA 1HQMC 2E2HB 3HOYG 2E2HH 3PIOA 4JC0A 5I6YA 2OTLA 4LF9Q 4JYAL 1OXVA 4Q0FA 3S1RB 3S1RH 4GN5A 1PH3A 3FRPB 3J7ZC 4KLKA 5ELEA 1B3QA 1KLGD 1BCPF 3CP0A 4DAVA 2WINB 3R8BA 5HGQA 4DV5L 3E6ZX 2F0TA 1A3TA 2QA4A 2QEXA 5IYCG 1Q8IA 3M7GA 2ZXRA 1TWAH 1S5DD 1TKWB 4GLAC 3STBD 2F03A 3PGZA 3HKZB 5H1SE 1V43A 5C44B 5C44H 1MI2A 4CKBA 1VQPA 5C3EB 1XPRA 4K2LA 1YEZA 1CKNA 4DV2L 4BS9A 2CQAA 1H9MA 4QIWB 5A35A 5JAVA 2E2DC 4CDDC 3TQYA 1F9SA 3J80E 2HT1A 2UUCQ 1A6XA 3I2ZA 5AFWA 2M9VA 2VS1A 2X69A 2XWBB 3HOWH 4LWCA 1WTHA 3NEMA 3HZXA 4LK1C 1R9TH 1R9TB 4KHPQ 5CBEE 1NE3A 3KK7A 4A3CG 2Q2HA 3OOCA 2PZTA 3K8AA 4BBSB 4BBSH 1FYCA 4F87A 1SMYD 4RWSC 3P20A 3PMFA 2K50A 3ULPA 5LL6S 3TMEA 1NBWA 1EIHA 5TSSA 4ODGA 2NVXB 2K1BA 2NVXH 2PNRC 4C3HG 3QOLA 4RG1A 3I4NB 1XTCD 3A0JA 3PV0A 2B8FA 1C9OA 3R3OA 2QW7A 5IWAL 1MJCA 2EYFA 4J8QA 1XTDA 3IFTA 3NBHB 1PRTD 3P75A 2ES2A 2E2JB 2DY7A 2E2JH 1K0SA 5F2DA 5CC4A 2Q2TA 3AQQA 1C4QA 4HMIA 1STAA 4CHTB 1LTRD 3A8KE 1DOKA 4JI2L 3WWVA 4IJHA 2VNUD 2A73B 3MFYA 4GZYC 2N78A 1K8AC 2WP8J 3T1HL 2ZJRA 3MWYW 4RHRA 3EFXD 3BS1A 2F0NA 1SROA 3VR6A 1GUNA 2CQOA 3BYYB 5KGUA 3X3NA 3I3CA 2A6EC 3U4ZA 1D2BA 1CKMA 4XT1B 1Z6HA 2IJ0A 1V1PB 5C4ZA 4DR7L 4JYAQ 3S1QB 3T1YL 3S1QH 5M5XB 5M5XH 3DMUA 3L7ZC 2BA0A 1JWSD 4JOIA 1R4QB 1FD7D 3GTPB 3GTPH 4X3SA 3L0OA 1ENFA 4DV5Q 1C0AA 3DWAA 3ULLA 5IYBG 1PTOB 1PTOH 1GXDC 2D5DA 1HZAA 2A74C 4ZUJA 1AE3A 1IL2A 2ID0A 4B9WA 2CCZA 2Q2UA 2RDHA 1PFMA 5C0XJ 1J9OA 4U673 1IBKQ 1QE6A 3IAYA 1QNKA 3CKIB 2H5XA 1KLUD 1QILA 2UU9L 4LJZC 1VQ8A 4KD4A 3C2PA 3QOJA 4DV2Q 1X3QA 3HKZG 2E75C 2ENBA 3S15B 2YTVA 3S15H 1YBYA 4KMUC 5C44G 4ALPA 5C4JB 1QB5D 5C4JH 3I90A 1JT8A 1X3PA 5C3EG 3ULJA 3CW2C 1LT5D 1ICWA 1HNZL 2QDLA 4IPHA 5CV9A 1X3GA 3SVMA 4WJ4A 2F0SA 5GAGC 5EPLA 1VQLA 3S1NH 3S1NB 1BVSA 1Y1VB 1Y1VH 1EFWA 1K3BC 2B2YC 4PZ7A 1GUSA 1H95A 3IL8A 5IGFA 4L5RC 4ZQ3A 4OONA 3RLOA 3FPPA 1I4GA 2L5TA 3TZUA 1B1ZA 3EROA 2DNEA 1LTLA 4IZ8A 4NMZA 4JI5L 5IGDA 1SE2A 2KOLA 3PCOB 4A3MB 4A3MH 4FVMA 5IWAQ 3DM3A 1HUMA 4YCUA 2FFKB 2K6AA 3SK5A 3PIP3 3H91A 3I4NG 1I50B 1I50H 5E1FA 1JOQA 1EEFD 4N9TA 4ZRZA 4A3FB 2L1BA 4OIJA 3D31A 4JI2Q 4IOCA 5C6AA 5EAYA 1GO3E 3OSOA 1B70B 4CDCC 1D5MC 1U4MA 1A2UA 2K75A 4RFBA 1B9NA 3ONAB 1D1KA 3CHBD 2R7FA 3T1HQ 4RAUC 2H1EA 4A3DG 2LMCB 4LF7L 1STBA 1E1TA 2K14A 1FJGL 2ASBA 1TS3A 1MD2D 2PI2E 2NTSA 5ELNA 3WOFA 1YJNA 4DR7Q 1H9SA 2XWJB 3T1YQ 1XMOL 4N9PA 3LWEA 3D0FA 1X9NA 3RLFA 4A76A 1VF7A 2WAQB 1S5CD 5KYLA 1LT3D 4C3JB 1F2YA 3FEWX 1CKNB 2N8NA 1KD1C 1LUZA 4TQUS 2NN6I 5I4DA 1BOSA 3DXJC 5DEHA 3RR5A 3LNNA 1HQRD 2MP1A 1ET6A 2KHJA 2DNCA 4AYBE 2K03A 3KJPA 3AB9A 5BN5A 3UE0A 1JOOA 3HOVB 3HOVH 3UDGA 1MJEA 4UHVA 4IURA 2UU9Q 3KDFA 1EQRA 1CZWA 2IX0A 5JJIA 1SSOA 2ZJQA 2K5VA 3BU2A 2KEDA 5BN4A 3MC0B 2QKIC 1BCPB 3NUCA 1IKLA 1G2SA 3ZYYX 5JPMC 5D3DA 2C5CA 2R93G 3DEOA 1ICFB 3KF8A 2BOSA 1WYDA 1HNZQ 3N6RA 3M3YH 1IL8A 5EPKA 1SNDA 3ERSX 3J7A5 4XYOA 4HSPA 1C7YA 2K5QA 1VQOA 4KKTA 4KI0A 4DR4L 1T5XD 4JI6L 4PNYA 4KK7A 4E6IA 2HUGA 3CAMA 3S1MB 1PHJA 4R8NA 3S1MH 2JA7H 2JA7B 3PO2B 3MA2B 3PO2H 5FLXL 4LF6L 1B4OA 1EOVA 1Y1WB 1Y1WH 3EBEA 1F9QA 2DJFC 5CV7A 1K8MA 2D0OA 3GTJH 4HIMA 4JI5Q 2QILA 3R2TA 3SHLA 5FO9B 3K81C 1C8CA 1HR0Q 1YNND 1L0WA 4OO1G 4H7BA 2ZM6L 3CCLA 2PZWA 4DXFA 1QUQA 2LSSA 5JEAH 1WFQA 3NE5B 4A3MG 4DR3L 4EQPA 1X65A 2VB2X 3RN2A 2D9UA 2Z9HA 3CXCA 1TY0A 4MZ9A 2E5LL 4X64L 5M3MB 5M3MH 4HIOA 3PUVA 4QJFA 4XIGS 3U9SA 1W2BA 3M4OB 3M4OH 4LW1A 3CCSA 2SNMA 2GVAA 1HA5A 1QOHA 4HTHA 4A3FG 4O42A 3T51B 4IUPA 3M4PA 5LL6X 5M3FB 5M3FH 2JXMB 1B50A 4LF7Q 4X62L 2F3IA 5IP7H 1FJGQ 1ZKOA 4IFDH 2F0UA 4ME5A 4CKCA 1PTOD 3CCMA 1TWFB 3N52A 1O7LA 3OHXC 1EFID 4KJNA 1U0LA 2F0QA 3E9IA 1XMOQ 1IYVA 2K5HA 2I5MX 1D8LA 1SJHD 4OL7A 1WTPA 4R4QA 3FKIB 3FKIH 4EVOA 4IUVA 1XJVA 4C3IH 4AH6A 4A4IA 1SNPA 4UP9A 2B2WC 4HJ7A 4O0AA 3BVMA 3R2IA 4K6LA 5GQOA 3J80i 1VF5C 1S72A 4CDEC 4FXGC 2M00A 2WAQG 1M8AA 3HOYH 1G2TA 4C3JG 4BBRG 3TP6A 5HGTA 4UP8A 2MGSA 2KHSA 2K05A 1Z7TA 1I4PA 5KYIA 4L5SA 2E8GA 4FO2A 1KIXA 4X66L 4DV7L 4DUZL 2VUMG 3PO3B 1TU2B 5T1IA 3PO3H 3HOVG 2GA4B 3K7AB 3K7AH 5IYCH 4NW2A 1PA6A 2Q8IB 3VDYA 1QNUA 1SMYC 1E22A 3RZOB 5C3WA 1KABA 3IKJA 2A69C 3ITPA 2A1AA 4QL5A 4YCWA 1A62A 1PFNA 3GDEA 3NQTA 2BA1A 4QB4A 2IX1A 2L9HA 4YY3L 4DR4Q 5E4XA 1PZKD 1PRTC 2VB3X 1JORA 4K0KL 1FVIA 2VZAA 4LF6Q 1NJIC 2ZTCA 4OWTB 1N36L 3BZKA 1PLFA 4QY7A 3GTKB 1QG7A 3F2BA 3GTKH 1EY5A 3OIPA 1CT1D 3I56A 1XMQL 3BDOA 3F2CA 2BH2A 5LHY1 4DV1L 1L1OC 1Y1WG 4S3SA 1WD0A 2ZM6Q 4P74A 1N8RC 3TS0A 3W1GA 2F0VA 1E2WA 5FLXE 1Q81C 1Q86C 1IYJB 1X56A 4DR3Q 3HOZB 4ZCKA 3HOZH 2HD3A 3JC66 4L5QA 2BH8A 2YTXA 3DUZA 1HZCA 1KNAA 3NTHA 4XQQA 4C1NI 4X64Q 4IO9A 2E5LQ 1H9SB 2C9OA 4PQXA 2Y0SE 1E2VA 1STNA 3NQIA 3HRZC 1TT2A 2P5ZX 3NWSA 4HJAA 4OELB 3MXNA 4DK3C 5M3MG 3OWEB 3CRKC 4X62Q 4B3ML 1Y8OB 4FXKC 4RGNA 1X3FA 1T5EA 3G4SA 1JE5A 4BY1B 4BY1H 3C1EA 1CK1A 3ND8A 5E4WC 3RZDB 3RZDH 3JAME 1I6HB 1I6HH 1YJ9A 2F52A 5M3FG 2F0DA 4BY7G 4GN4B 4QCLA 1BQQT 1SLJA 1A0IA 4A3IH 2EY6A 4A3IB 1AZQA 2WACA 3A74A 3KDFB 5IP7G 2F0PA 4IFDG 1JE4A 1L0XB 4YCVA 2UUAL 1FGBD 3E3XA 1KHIA 1M90C 2KJXA 3KUPA 5CGKA 1GHKA 3FPUB 1N33L 4GOPA 2F0MA 1D6EC 2K33A 3J80c 1LV9A 3L9AX 1O7YA 4RKLA 1GUGA 3C46A 1JOKA 1DJRD 4L8JA 1BCPD 2SOBA 4X65L 3FKIG 1SE4A 3KF8B 3W1BA 4QUFA 2Z4IA 4GLVB 4Q5VA 3Q23A 3VR4A 4GNXC 4FXDA 3J7AV 1NY4A 3NBIA 4GN3B 4IALA 3GD7A 4B9XA 5GAHC 4X66Q 1CHQD 4DV7Q 4DUZQ 4WJ3M 3FP9A 1LT4D 1EWCA 1PFSA 2KVMA 5I6WA 5IYBH 5LMNL 3KLSX 4B3SL 1Q8KA 3SK6A 4G7HC 1ENAA 3P7JA 4POGA 4UDUC 2G5DA 1WTXA 3BYTB 4B3RL 2R7ZG 1F9RA 2PNHA 2QDBA 3PO3G 1RTNA 1DD2A 4R9WA 1LTAD 4OO1I 1L2FA 1GD7A 1F2LA 4YY3Q 2QEJC 2DUDA 4HCSA 4G7ZC 2F3WA
chains in the Genus database with same CATH topology
5HURA 1SAPA 4KKUA 2R92B 4RH6A 4G4KA 3NK9A 2G9HD 3D4DA 3D6CA 3MZ5A 5ELBA 2F3VA 3KLRA 4RGMA 3F2UA 2L12A 3KBXA 4HEDA 3D4RA 3SEBA 1JWMD 2PO4A 4ABNA 2F0EA 3K57A 3DWQA 1OXUA 3DWPA 4DXGA 2K01A 3NHHA 1GUTA 4KJOA 4M8AA 1CTMA 4IQZA 3FVQA 2DN8A 4X3KA 4CJ1B 4FF2A 1STYA 2L0CA 5DM63 2KEEA 1RJTA 1WCMB 1ONLA 1KNEA 4DF7A 1Y8NB 1K83B 1IW7C 3GQBA 1ENCA 1SE3A 1RHPA 2ZXOA 4A3DB 2A68D 3S9WA 2ZXPA 4I7ZC 2KCNA 3K5MA 2K5WA 5JOBA 3R93A 1ZEQX 2EOTA 1SDFA 5IT9L 4U68A 1G8ZD 2F0WA 2O5IC 5CV8A 4K8IA 2J7ZA 2B2UC 5IGBA 4CBVA 1EQTA 3PIO3 3M4YA 5CORA 1PXUA 1NUCA 3MFGA 2EYHA 4MIUA 1NR2A 4JK1C 2EYPA 1ZYRD 1QJOA 1FNUA 1YNNC 5G3LF 2EJFC 4K5XA 2A6HD 2SEBD 4J6HA 4C2MB 2PQEA 2J4XA 2O2LD 2WB1B 1IKMA 2HDLA 2R93B 4XTCS 2B2TC 4ZKCB 3W3AA 4CJ0B 3T16A 5EKKA 1BO0A 3QG1A 1G6ZA 3TBIB 5C4XB 1WTRA 2EDGA 5A2QL 2FHTA 3K59A 4KHZA 3UI2A 1EZ8A 4F7XA 5ELCA 1U4PA 4HCEA 1PTOC 2DY8A 3G6JB 4IFDI 3CU7A 4J1MA 1O7ZA 4F8MA 4OO1H 1JB3A 3AMUA 3J7AF 4DN4M 1WTWA 1G91A 2A5HA 3D8GA 1CFMA 3BVZA 2NWGA 2K04A 3CRLC 2E76C 2HDMA 2QCPX 3IFDA 2EE1A 2R3ZA 5JVG3 2K7VA 4A3GB 2RSNA 3TP7A 3S16B 4R8IA 1O80A 2ICIA 3I72A 3VYSA 3V2TA 4RGOS 3BG3A 1F9PA 2B2VC 1FNWA 4A3JB 2EYMA 1EQVA 1FR3A 4DNTB 2K32A 4WRDA 1KDBA 4DK1A 1VDZA 3H09A 4BBRB 1WVLA 4DGZA 3RUZA 4O1NA 2KCCA 2E2IB 5IT9E 5FO7B 1BBXC 1MSHA 1B53A 3H6MA 2VUMB 4TKOB 5KNBA 3VYTA 1AEXA 4V190 2RVLA 3LX0A 1R4PB 1H9KA 1MSGA 3EVQA 1JICA 3O13A 1SYFA 4NP5A 4RCNA 4OHJA 2BDNA 3E0JA 1F77A 2R6GA 1Q12A 4ID6A 3W2DA 5I2YA 4FF4A 1SXTA 4PV1C 4WFN3 4RGTA 2O5JC 3NTKA 2EY5A 3EA6A 2XRSD 5A2QE 1RDPD 1RD9D 1EY0A 1TR5A 1W6KA 2A6ED 2CW0D 2Q8RE 3DHQA 2RKSA 4FF3A 1CQVA 4DFAA 1BCPC 4ZK9B 3OMCA 1LTID 3V05A 2V4DA 3J81L 2WKCA 1L0YB 4QUCA 2AWNA 2LS01 4HSVA 2YU9B 4C1NK 4FF1A 3JAML 1JWUD 4X3TA 1EEID 1SNMA 1XXGA 1EU3A 1EZ6A 1I6VC 4ZUIA 4YIJA 1FNVA 2NB0A 3VR3A 4BY7B 2Z4HA 2AUKA 2IT1A 1LTGD 1EYCA 1CHPD 4K2KA 4ZYSA 5J1ZA 2EVBA 1NSNS 3GTMB 1SYBA 1AZPA 3MEHA 3OPOA 4OIKA 5M5YB 3K6OA 4RKBA 3K5NA 2O4XA 4KN7C 1UEAB 1RODA 2KA7A 4XT3B 4DU9A 1BXTA 3A56A 1AP0A 2NYZD 1Z47A 2EYOA 2TSSA 1JR0D 2PW7A 3VYUA 5T1GA 2LKVA 2NZ1D 3Q24A 3RMHA 1TWCB 4CGYB 1TIID 2R7ZB 1DYQA 4M1UB 1OXXK 1STGA 2RSOA 2I46A 2B2UA 1SNOA 4KY5A 4EQNA 2JYOA 3I4MB 2NVTB 1QCBD 1EU4A 3AU7A 1KDCA 3T13A 2BE5D 3TN2A 4LMQD 1EYDA 3S2HB 2N88A 1ILPA 2YYZA 3TP8A 3C3LA 1GJXA 1BUVT 2XSCA 1WTQA 2F0LA 1CA6A 2B63B 3A7LA 1D5ZC 2EY1A 4NDXA 2A68C 5J39A 3A8IE 3H0GB 3SK4A 5CYUA 1U4LA 2F1MA 1SEBD 3WDNA 1SJED 1S5ED 1TS4A 4QMGA 2R61A 4DA2A 2B2YA 3VR2A 1G291 1LO5D 2N55A 2G9DA 5FO8B 2VXWA 1LABA 3DM1A 4CKEA 3S14B 1TY2A 1IHZA 3J81E 1SYEA 1TS2A 2KECA 2XNAC 5C5MA 2PYKA 3FDTA 2D2CC 1ZYRC 1BNZA 1I3QB 1UUPA 4EGVA 1HFNA 3OWFA 1YNJD 2PMZB 1C48A 4H0LC 1LTTD 3DEPA 3HOXB 2EY2A 5J22A 1Q1EA 2EJMA 1H9JA 1EOTA 1S5BD 2RBMA 2L55A 5EKLA 5JEAJ 3PUZA 5EJWA 3P1HA 3QIAA 4ZAIA 3A8JE 5D65A 1AW7A 3L3OC 2EXZA 5IGEA 3BDCA 2JA6B 1Q90A 3K5OA 3I8ZA 4WORA 2F0FA 3GTQB 2EPBA 2FJ2A 2PCFB 2HCCA 4IFDJ 1CM9A 4PMWA 2JA5B 1Q3LA 2PW5A 3CQZB 3TDQA 3S2DB 4A93B 1M4VA 2IX3A 5EBCA 1RTOA 3VA5A 2WIIB 1X32A 1DOLA 1TWAB 5DAUA 1WTOA 2OF1A 4C56C 3Q6SA 5M9OA 1CQFA 3GTGB 1HTPA 5CV6A 4DAYA 1AFPA 5ISRA 4IUTA 1PYWD 1XX8A 2X6LA 3VR5A 4KTAA 4H44C 3OW7A 3FMCA 4JBWA 2NN6G 4XQNA 2RDFA 5D3IB 4ZKBB 3HOWB 4KHVA 4BA2I 2NBFA 4A3BB 2K5DA 4NKLA 1TS5A 2F0OA 3GP7A 2Q8TA 1D1IA 1W6JA 1EIGA 3PUYA 1EY8A 1NAPA 5IGGA 2A69D 2OXPA 4XDXA 2HQEA 2JEBI 1B3AA 1SYDA 4TRDA 3HS0C 5FKAC 4HMJA 4IN3A 4ULLA 1V8QA 2J0TD 5C5LA 2MPMA 1LTBD 3NP8A 1E0BA 2L4NA 2IW3A 1HCZA 4FP5D 4DK0A 4G57A 5G3LD 4LAAA 3MXUA 1QWYA 5C0XG 1ESRA 1LACA 1SBBB 1IYUA 4L6TB 5CR3A 5K36H 1I4RA 2L11A 3PUWA 4Y7NB 1WTVA 1PRTF 1GOZA 2HCIA 4RA8A 2B2WA 2IWHA 2CW0C 1DOMA 4XQJA 1MGSA 5FOBB 5CMDA 3NPPA 2EYJA 2F0KA 1LLRD 3SDZA 4HR7B 3BDLA 1BDOA 2JP1A 5EPJA 2KUMA 1PMRA 5M5WB 4AYBB 1DCZA 1KDAA 2KQ3A 3SE0A 2JEAI 2WKDA 2TMPA 3H94A 4IUQA 4BA1I 1XYIA 2WV6D 4V0BA 4ILWA 2LFNA 2D62A 2F0JA 3D3RA 2FMMA 1STHA 2NUCA 3QJYA 4CJ2C 5KNCA 3KBGA 5COYA 5BN3A 3K5LA 1DONA 1BF4A 4UAIA 2AUJD 4EQOA 1OXTA 1H9RA 4K8JA 1SNQA 4QF4A 2XN9C 1I4QA 2MJ8A 2XVSA 3A55A 3QB3A 3MXGA 3S17B 4RHSA 3VYRA 1DM0B 1WD1A 2AWOA 3HOUB 3GTLB 2K28A 2EJGC 1U9RA 5D14A 1ZXTA 3GTOB 4X3UA 5JVH3 1SYGA 2BE5C 2I07B 3TSSA 2FINB 1F2ZA 5NUCA 3K58A 1EL0A 3M85A 4PMCA 3WOEA 5IGCA 3NTIA 4KY7A 3BZDB 5ELDA 3D6WA 1VCIA 1PZJD 2RA4A 1OXSC 3LWUA 1PFBA 3MHBA 2XRQD 5K36G 2JE6I 3E5SA 3D4WA 4HAEA 4IUNA 1HHVA 4MHEA 3J7YW 3G7LA 3HP3A 1HUNA 1I4HA 3T4AC 1NR4A 1RKNA 2AQ2B 2OT2A 2X6GA 1U4RA 2XIWA 4XXEA 5I9PA 1EY4A 1IW7D 1DZ1A 3C1FA 1ML0D 1A15A 3NWTA 3GV3A 2QF7A 4A3KB 5C4HA 1HTLD 2FMCA 3Q0AA 5KNDA 1E2ZA 1MBYA 1I4XA 1CI3M 3M3YB 1YNJC 1UNSA 5EGTA 4K5WA 3V96A 2MHVA 3ND9A 3ERQA 2IL8A 2M2LA 3H3VC 2NVYB 2EZVA 3HGBA 3RD4A 3EJIA 2BDOA 2Z1CA 3A7AB 2B8GA 1PZID 1ILQA 1Y8PB 1V1OA 5C0XI 1PDQA 5KEEA 3GTJB 5I9OA 1CZGA 3Q22A 3NXWA 1VMPA 5CV5A 1LT6D 1XWEA 4HN7A 2E74C 1HPCA 3QWNA 2Y0SB 1II3A 3TZDA 2F0HA 2SNSA 5C3XA 2JA8B 2F0IA 3KLSA 5K5PA 1KAAA 4IUUA 2AQ3B 4KD3A 5EQ0A 1SYCA 1Y69U 4XYQA 5EBDA 1NCVA 3GV6A 1K8OA 1STEA 1GUOA 3EQLC 3NSWA 1GHJA 2PPBC 1TVXA 1BR9A 3K0YA 3SXHA 4Z9CB 3MAQA 3URYA 3I70A 1A2TA 5KIXA 4C3IB 1RF2D 5CV4A 3U9OA 1VMCA 3HG9A 1PRTB 1TQOA 1CA5A 1DXMA 1UAPA 1HRJA 3NBHA 3HOYB 5IOCA 1JQYD 4WJWA 1PTOF 3TP5A 2BCOA 5JJZA 4K5VA 5IIFA 2EYLA 3T56B 2ICEC 1AN8A 1O78A 1J8IA 1D5XC 3OIQA 1KTKA 2CHBD 4RCOA 4F88A 2PZUA 3A54A 2F0GA 4TSSA 1ET9A 2B2TA 3GO5A 1B44D 5CBAE 4K6DA 4KKSA 2MUYA 4I65A 4B08A 1EY7A 1EWHA 3J80L 1EYAA 3T53B 1A3VA 1ESFA 1V1PA 4KN4C 4OGQC 4DAPA 1A3UA 3SR1A 1F2MA 2NN6H 3MVVA 3MXPA 2Z8LA 3M7NA 5DM73 1S4ZA 2IPKD 4K14A 2NVQB 4ZLTF 1EY9A 1OO9B 1JC7A 2CVRA 4H13C 1HXYD 5JPNC 3QO2A 5I2XA 4DNRB 5KRUA 5EKIA 1Q1BA 3I91A 5DNFA 4C3HB 1TWHB 5E3FA 2OEOA 4KV6A 5JEAG 2A6HC 4G7OC 4A3EB 2RDGA 4L63B 4BWGB 2H4OA 2ZT9C 3OMGA 3PUXA 5ELFA 3I4LA 1LTSD 4MN3A 4FNFA 3BVGA 1S5FD 3X3MA 3SK8A 3MTSA 4P2CB 1JCKB 2B39A 1SNCA 5C0XH 1EY6A 2B2VA 1GUWA 2JSOA 5FK9C 2AQ1B 3HEJA 4KY6A 1SFOB 2RQXA 5IODA 1HA6A 1B9MA 1B2TA 1HFGA 4PMBA 1RCVD 4C3IG 4FYDA 3I73A 2SDFA 1TWGB 2NTTA 3VA7A 2LY7A 2F4IA 1HQMC 2E2HB 5I6YA 1OXVA 4Q0FA 3S1RB 3FRPB 5ELEA 1KLGD 1BCPF 4DAVA 2WINB 3R8BA 3E6ZX 2F0TA 1A3TA 1Q8IA 3M7GA 2ZXRA 1S5DD 1TKWB 2F03A 3HKZB 1V43A 5C44B 1MI2A 4CKBA 5C3EB 4K2LA 4BS9A 2CQAA 1H9MA 4QIWB 5A35A 5JAVA 2E2DC 1F9SA 3J80E 1A6XA 5AFWA 2M9VA 2X69A 2XWBB 3HZXA 4LK1C 1R9TB 5CBEE 3KK7A 3OOCA 2PZTA 4BBSB 1FYCA 4F87A 1SMYD 4RWSC 3P20A 3PMFA 5LL6S 3TMEA 1EIHA 5TSSA 4ODGA 2NVXB 2K1BA 2PNRC 4C3HG 3QOLA 3I4NB 1XTCD 3PV0A 2B8FA 3R3OA 2EYFA 4J8QA 3IFTA 1PRTD 3P75A 2E2JB 2DY7A 5F2DA 5CC4A 1C4QA 4HMIA 1STAA 4CHTB 1LTRD 3A8KE 1DOKA 2VNUD 2A73B 3MFYA 4GZYC 2WP8J 3MWYW 4RHRA 3EFXD 3BS1A 2F0NA 3VR6A 1GUNA 3BYYB 5KGUA 3X3NA 3I3CA 2A6EC 1D2BA 4XT1B 1Z6HA 2IJ0A 1V1PB 5C4ZA 3S1QB 5M5XB 3DMUA 3L7ZC 2BA0A 1JWSD 1R4QB 1FD7D 3GTPB 4X3SA 1ENFA 3DWAA 1PTOB 1PTOH 1GXDC 2D5DA 2A74C 4ZUJA 2ID0A 4B9WA 2RDHA 1PFMA 5C0XJ 1J9OA 4U673 3IAYA 1QE6A 1QNKA 3CKIB 1KLUD 1QILA 4LJZC 4KD4A 3C2PA 3QOJA 1X3QA 2E75C 2ENBA 3S15B 4KMUC 5C4JB 1QB5D 3I90A 1X3PA 1LT5D 1ICWA 5CV9A 3SVMA 2F0SA 5EPLA 3S1NB 1Y1VB 2B2YC 1GUSA 3IL8A 5IGFA 4ZQ3A 3FPPA 1I4GA 2L5TA 3TZUA 1B1ZA 3EROA 2DNEA 4IZ8A 4NMZA 5IGDA 1SE2A 2KOLA 4A3MB 4FVMA 1HUMA 2FFKB 2K6AA 3SK5A 3PIP3 3H91A 1I50B 5E1FA 1JOQA 1EEFD 4N9TA 4ZRZA 4A3FB 2L1BA 4OIJA 3D31A 5C6AA 3OSOA 1D5MC 1U4MA 1A2UA 4RFBA 1B9NA 3ONAB 1D1KA 3CHBD 4RAUC 2H1EA 2LMCB 1STBA 1TS3A 1MD2D 2NTSA 3WOFA 1H9SA 2XWJB 4N9PA 3LWEA 3RLFA 1VF7A 2WAQB 1S5CD 5KYLA 1LT3D 4C3JB 1F2YA 3FEWX 4TQUS 2NN6I 5I4DA 1BOSA 3DXJC 5DEHA 3LNNA 1HQRD 2MP1A 1ET6A 2DNCA 2K03A 3AB9A 5BN5A 1JOOA 3HOVB 4IURA 1CZWA 2IX0A 1SSOA 5BN4A 2KEDA 3MC0B 2QKIC 1BCPB 3NUCA 1IKLA 1G2SA 3ZYYX 5JPMC 5D3DA 2C5CA 3DEOA 3KF8A 2BOSA 3N6RA 1IL8A 5EPKA 1SNDA 4XYOA 4HSPA 2K5QA 4KKTA 4KI0A 1T5XD 4PNYA 4KK7A 4E6IA 2HUGA 3S1MB 4R8NA 2JA7B 3PO2B 3MA2B 5FLXL 1B4OA 1Y1WB 1F9QA 5CV7A 1K8MA 2QILA 3R2TA 3SHLA 5FO9B 1C8CA 1YNND 4OO1G 4H7BA 2PZWA 4DXFA 5JEAH 3NE5B 4EQPA 2VB2X 2D9UA 1TY0A 5M3MB 3PUVA 4XIGS 3U9SA 3M4OB 2SNMA 1HA5A 1QOHA 4HTHA 4O42A 3T51B 4IUPA 5LL6X 5M3FB 2JXMB 1B50A 4IFDH 1ZKOA 2F0UA 4ME5A 4CKCA 1PTOD 1TWFB 3N52A 1O7LA 3OHXC 1EFID 4KJNA 2F0QA 1IYVA 1SJHD 4OL7A 1WTPA 3FKIB 4EVOA 4IUVA 1SNPA 2B2WC 3BVMA 3R2IA 4K6LA 1VF5C 4FXGC 2M00A 1M8AA 1G2TA 4C3JG 3TP6A 5HGTA 2MGSA 2KHSA 2K05A 1Z7TA 1I4PA 5KYIA 4FO2A 3PO3B 1TU2B 5T1IA 2GA4B 3K7AB 4NW2A 2Q8IB 1QNUA 1SMYC 3RZOB 5C3WA 1KABA 3IKJA 2A69C 3ITPA 1PFNA 3NQTA 2BA1A 4QB4A 2IX1A 2L9HA 5E4XA 1PZKD 1PRTC 2VB3X 1JORA 1PLFA 3GTKB 1QG7A 1EY5A 3OIPA 1CT1D 3BDOA 5LHY1 4S3SA 1WD0A 2F0VA 1E2WA 5FLXE 3HOZB 3DUZA 1KNAA 3NTHA 4XQQA 4C1NI 1H9SB 2C9OA 4PQXA 1E2VA 1STNA 3NQIA 3HRZC 1TT2A 3NWSA 3MXNA 3OWEB 3CRKC 1Y8OB 4FXKC 4RGNA 1T5EA 4BY1B 3C1EA 1CK1A 3ND8A 5E4WC 3RZDB 3JAME 1I6HB 2F0DA 4QCLA 1BQQT 4A3IB 2EY6A 1AZQA 2WACA 2F0PA 4IFDG 1JE4A 1L0XB 1FGBD 2KJXA 3KUPA 5CGKA 1GHKA 3FPUB 2F0MA 1D6EC 2K33A 1LV9A 3L9AX 1O7YA 4RKLA 1GUGA 3C46A 1JOKA 4L8JA 1DJRD 1BCPD 2SOBA 1SE4A 4QUFA 2Z4IA 4Q5VA 3Q23A 3VR4A 4FXDA 3J7AV 3NBIA 4IALA 3GD7A 4B9XA 1CHQD 1LT4D 1EWCA 2KVMA 5I6WA 3KLSX 4G7HC 3SK6A 1ENAA 3P7JA 4UDUC 1WTXA 3BYTB 1F9RA 2QDBA 1RTNA 1DD2A 4R9WA 1LTAD 4OO1I 1F2LA 2QEJC 4HCSA 4G7ZC 2F3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TRD A;  5CV4 A;  3U9O A;  4DFA A;  5HUR A;  2F0V A;  5IGB A;  5KYL A;  5C4H A;  3QB3 A;  1F2Y A;  4KD4 A;  4HMJ A;  3TP8 A;  3OMC A;  3V2T A;  2EXZ A;  3QOJ A;  1TQO A;  5C5L A;  2ENB A;  5IGE A;  3BDC A;  3SK8 A;  2F0U A;  3NP8 A;  4WOR A;  2PZT A;  3NK9 A;  4ME5 A;  1NUC A;  2F0F A;  3D4D A;  3D6C A;  3TP5 A;  3MZ5 A;  2EYH A;  5DEH A;  4MIU A;  5IOC A;  1SNC A;  2F0L A;  3PMF A;  4K5V A;  4KJN A;  2F0Q A;  2F3V A;  1EY6 A;  5IIF A;  2EYP A;  2EYL A;  2EY1 A;  4NDX A;  3TME A;  4G57 A;  1JOO A;  5J39 A;  5CV9 A;  2EYM A;  1SNM A;  1STN A;  4ODG A;  3SK4 A;  1EZ6 A;  2F0S A;  1TT2 A;  4LAA A;  4K5X A;  4J6H A;  1EQV A;  4OL7 A;  3QOL A;  2PQE A;  4ZUI A;  4YIJ A;  5EGT A;  3HEJ A;  4K5W A;  2PW5 A;  4EVO A;  3R3O A;  4KY6 A;  4WRD A;  1KDB A;  3ERQ A;  1SNP A;  5CR3 A;  2F0E A;  1U9R A;  2PZU A;  2EYF A;  5IOD A;  4QMG A;  3NUC A;  3T16 A;  2F0G A;  5EKK A;  4DGZ A;  3C1E A;  4PMB A;  3RUZ A;  3P75 A;  5IGF A;  4ZQ3 A;  3EJI A;  3VA5 A;  2M00 A;  4HTH A;  1EYC A;  5F2D A;  5CC4 A;  4K2K A;  2F0D A;  1SYG A;  1NSN S;  3NHH A;  5J1Z A;  4K6D A;  1SYB A;  4KJO A;  4HMI A;  3TP6 A;  1STA A;  5HGT A;  2EY6 A;  5KEE A;  4I65 A;  1F2Z A;  3ERO A;  3H6M A;  2WAC A;  2KHS A;  5NUC A;  1EY7 A;  2F0P A;  2EYJ A;  2F0K A;  3MEH A;  4IZ8 A;  5I9O A;  1SND A;  4NMZ A;  4PMC A;  1EYA A;  3NXW A;  5DAU A;  5IGD A;  5KYI A;  2OF1 A;  5IGC A;  3BDL A;  1AEX A;  1A3V A;  4RKB A;  2O4X A;  5I6Y A;  5M9O A;  1STY A;  5CGK A;  1IHZ A;  5CV5 A;  5CV6 A;  4KY7 A;  1EZ8 A;  1SYE A;  2F0M A;  4PNY A;  5ISR A;  3LX0 A;  4F7X A;  4DU9 A;  4RKL A;  4E6I A;  1A3U A;  1JOK A;  3SR1 A;  1F2M A;  1KDA A;  1II3 A;  3SK5 A;  2SOB A;  4R8N A;  2F0N A;  3MHB A;  5C5M A;  4DF7 A;  2PYK A;  2KQ3 A;  5E1F A;  1JOQ A;  2EYO A;  3EVQ A;  2F0H A;  2SNS A;  1KAB A;  3MVV A;  2F0T A;  4KTA A;  4N9T A;  1A3T A;  5C3W A;  5C3X A;  2PW7 A;  5KGU A;  3ITP A;  1SYF A;  2F0I A;  3D4W A;  3E5S A;  3MXP A;  4J1M A;  4NP5 A;  5CV7 A;  5K5P A;  4F8M A;  1ENC A;  5C6A A;  1KAA A;  2RDF A;  4IUN A;  3OSO A;  3OWF A;  2LKV A;  3NQT A;  4IAL A;  3SHL A;  5KIX A;  1A2U A;  4B9X A;  4QB4 A;  4KHV A;  5C4Z A;  4KD3 A;  1SYC A;  4K14 A;  3DMU A;  3S9W A;  4ID6 A;  1EY9 A;  4H7B A;  5I6W A;  2F0J A;  3HZX A;  1JOR A;  4NKL A;  3SK6 A;  5I9P A;  1ENA A;  1STG A;  2PZW A;  2EY2 A;  5J22 A;  2F0O A;  2NUC A;  1STH A;  3D8G A;  4K2L A;  1RKN A;  1SNO A;  5KRU A;  1STB A;  4KY5 A;  2QDB A;  4EQP A;  5JAV A;  4EQN A;  1EY8 A;  2RBM A;  4EQO A;  5JOB A;  4S3S A;  2EY5 A;  5E3F A;  5EKL A;  2OEO A;  5IGG A;  4KV6 A;  4ZUJ A;  1EY4 A;  1EY5 A;  1KDC A;  1EY0 A;  1TR5 A;  2OXP A;  4K8J A;  3SXH A;  3T13 A;  1SNQ A;  4QF4 A;  2HQE A;  4B9W A;  3C1F A;  3DHQ A;  2F0W A;  5CV8 A;  4N9P A;  3OMG A;  2SNM A;  4K8I A;  3P1H A;  1A2T A;  1EYD A;  2F3W A;  1SYD A;  2RKS A;  3TP7 A; 
#chains in the Genus database with same CATH topology
 4K0K Q;  4OWX B;  5HUR A;  1UEB A;  4DV3 L;  1QUQ B;  1SAP A;  4KKU A;  1XNR L;  2HQL A;  2R92 B;  2R92 H;  5C3E H;  1N36 Q;  1E24 A;  2C35 B;  4RH6 A;  4G4K A;  3NK9 A;  3J81 j;  2G9H D;  3D4D A;  3D6C A;  3MZ5 A;  5ELB A;  3DLL A;  1XMQ Q;  2F3V A;  3KLR A;  2AKW B;  4RGM A;  3F2U A;  1VQJ A;  4DV1 Q;  2L12 A;  3KBX A;  4HED A;  3D4R A;  3TRZ A;  3SEB A;  1VQ5 A;  1JWM D;  4PZ8 A;  2PO4 A;  1KXL A;  1KRT A;  4ABN A;  2F0E A;  3H0G G;  3TEH B;  1NMF A;  3K57 A;  3DWQ A;  1OXU A;  3DWP A;  4DXG A;  2K01 A;  1PH1 A;  1YVC A;  3NHH A;  5FLM G;  1GUT A;  4KJO A;  4M8A A;  1CTM A;  4IQZ A;  3HOZ G;  3FVQ A;  2DN8 A;  2HIX A;  4X3K A;  1YI2 A;  2IY5 B;  4CJ1 B;  4FF2 A;  2LXJ A;  1IBM L;  3OYY A;  1STY A;  2ZTE A;  2L0C A;  5IY0 A;  4B3M Q;  3I4N H;  5DM6 3;  1HNW L;  4UY8 C;  1VQ7 A;  1KL9 A;  2KEE A;  1RJT A;  3K80 C;  1WCM B;  1ONL A;  1WCM H;  1KNE A;  1PH2 A;  4DF7 A;  1ASY A;  2JA9 A;  1Y8N B;  5GAE C;  1W3S A;  4NXN L;  1K83 B;  1K83 H;  1IW7 C;  3GQB A;  1ENC A;  4BY1 G;  1SE3 A;  3MEF A;  1RHP A;  2UUA Q;  2ZXO A;  2CH4 W;  3L2P A;  4A3D B;  4A3D H;  5J3B A;  2A68 D;  4HIK A;  3S9W A;  2ALY B;  4A3I G;  2ZXP A;  4I7Z C;  4X65 Q;  1RL2 A;  2KCN A;  3UE1 A;  1K73 C;  3K5M A;  2D0P A;  2RCF A;  2K5W A;  5JOB A;  3R93 A;  1ZEQ X;  2EOT A;  4JBJ A;  1SDF A;  2LXK A;  4DR5 L;  3U4V A;  1S40 A;  2NZO A;  5IT9 L;  1VQB A;  4U68 A;  1G8Z D;  2F0W A;  2O5I C;  5CV8 A;  4K8I A;  1BBU A;  5LMN Q;  4B3S Q;  4JI1 L;  2J7Z A;  2B2U C;  1VQM A;  4PG3 A;  5IGB A;  3CCQ A;  1EYG A;  4CBV A;  1AE2 A;  4N8F A;  4B3R Q;  4LUZ A;  1EQT A;  3PIO 3;  3M4Y A;  5COR A;  1PXU A;  1NUC A;  3MFG A;  2EYH A;  4MIU A;  1NR2 A;  1SR3 A;  1QVF A;  4JK1 C;  4LF5 L;  2EYP A;  1ZYR D;  1QJO A;  2JA6 G;  1FNU A;  5IYD H;  1V1Q A;  1YNN C;  5G3L F;  2EJF C;  4K5X A;  2A6H D;  2SEB D;  4J6H A;  4C2M B;  4C2M H;  2PQE A;  2J4X A;  2O2L D;  2WB1 B;  3KFU A;  4DV3 Q;  1IKM A;  1XNR Q;  2HDL A;  2R93 B;  4XTC S;  2B2T C;  2R93 H;  1YNX A;  4ZKC B;  3W3A A;  3I4O A;  4CJ0 B;  3T16 A;  5EKK A;  2N49 A;  1JJ2 A;  3HKZ E;  2F4V L;  1BO0 A;  4RMF A;  3QG1 A;  1VQ9 A;  1G6Z A;  1UE7 A;  4A93 G;  3TBI B;  5C4X B;  5C4X H;  1X6O A;  2R92 G;  4X6A H;  1WTR A;  2Z6K A;  2EDG A;  5A2Q L;  2B29 A;  4QIW E;  2FHT A;  2ZJP A;  3K59 A;  4KHZ A;  3UI2 A;  1YHA A;  1EZ8 A;  4F7X A;  5ELC A;  1G51 A;  1U4P A;  1AH9 A;  4HCE A;  1CUK A;  1PTO C;  2DY8 A;  4O2D A;  3G6J B;  2GVB A;  4IFD I;  1N9W A;  3CU7 A;  4JVZ A;  4J1M A;  1O7Z A;  2YV5 A;  4F8M A;  1KQS A;  4DNI A;  3CCV A;  4OO1 H;  1JB3 A;  1IBM Q;  3AMU A;  3J7A F;  4IOA A;  4Y52 H;  3Q8D A;  4GOP B;  1HNW Q;  1RIP A;  4DN4 M;  1WTW A;  1M1K C;  1G91 A;  2A5H A;  3D8G A;  1CFM A;  3BVZ A;  2NWG A;  1UE6 A;  5LMU L;  2K04 A;  4A3B G;  4NXN Q;  4EX5 A;  1HNX L;  4LNQ A;  1OTC A;  3CRL C;  2E76 C;  2HDM A;  4A3F H;  2QCP X;  3IFD A;  1XNQ L;  1WCM G;  2EE1 A;  2R3Z A;  3M4Q A;  5JVG 3;  1D7Q A;  2K7V A;  4A3G B;  2RSN A;  4FDB A;  4A3G H;  3TP7 A;  3S16 B;  4R8I A;  4JI0 L;  1O80 A;  2ICI A;  3I72 A;  3VYS A;  3V2T A;  1PH5 A;  4RGO S;  4IPC A;  3BG3 A;  2YTY A;  1F9P A;  2B2V C;  4AQY L;  4R1J A;  1FNW A;  4DR5 Q;  4A3J B;  4A3J H;  3CCE A;  2EYM A;  3CME A;  1EQV A;  1CKO A;  1FR3 A;  4JI1 Q;  3F1Z A;  4DNT B;  2K32 A;  4WRD A;  1KDB A;  3NEN A;  3IRB A;  4DK1 A;  1VDZ A;  3H09 A;  1TXY A;  4C3J H;  4BBR B;  4BBR H;  1WVL A;  1N34 L;  4DGZ A;  3RUZ A;  4O1N A;  2A19 A;  2KCC A;  2UXD L;  4IPG A;  2E2I B;  4LF5 Q;  5IT9 E;  5FO7 B;  1BBX C;  1MSH A;  1B53 A;  3H6M A;  2VUM B;  2VUM H;  4TKO B;  3ZJY C;  1P8L A;  5LMN W;  5KNB A;  4GNX A;  3VYT A;  1AEX A;  4V19 0;  2RVL A;  3PSI A;  3LX0 A;  5IYD G;  4DK6 C;  1R4P B;  2F4V Q;  1HJP A;  1H9K A;  1MSG A;  3H3V H;  2WB1 G;  1VQF A;  3EVQ A;  1JIC A;  3O13 A;  1SYF A;  4NP5 A;  3J81 i;  4RCN A;  4OHJ A;  2BDN A;  4IPD A;  3CC4 A;  3E0J A;  1BBW A;  1F77 A;  2R6G A;  5C4X G;  1Q12 A;  4ID6 A;  3W2D A;  5I2Y A;  3JAM i;  4FF4 A;  3CPW A;  2AMC B;  1SXT A;  3BZC A;  1VQG A;  4PV1 C;  4YWK A;  4WFN 3;  1J5E L;  4RGT A;  2O5J C;  3NTK A;  2EY5 A;  3EA6 A;  2VQF L;  2XRS D;  5A2Q E;  1RDP D;  4HID A;  5FJ8 G;  1RD9 D;  1EY0 A;  1TR5 A;  1W6K A;  2A6E D;  2CW0 D;  2Q8R E;  2OWO A;  3DHQ A;  1JJC B;  1K3R A;  5BR8 L;  2RKS A;  4GLX A;  4FF3 A;  4IJL A;  1CQV A;  4DFA A;  1BCP C;  4ZK9 B;  3OMC A;  5LMU Q;  1LTI D;  3V05 A;  2V4D A;  3J81 L;  2WKC A;  1UE1 A;  1K0R A;  1L0Y B;  4QUC A;  1HNX Q;  4YWM A;  2AWN A;  2LS0 1;  4HSV A;  4BXX G;  2CKZ B;  2YU9 B;  4C1N K;  2YU9 H;  4OX9 L;  4FF1 A;  1XNQ Q;  2MQH A;  3K0X A;  3JAM L;  1JWU D;  4X3T A;  1EEI D;  2L15 A;  1SNM A;  1XXG A;  1EU3 A;  1EZ6 A;  4LF4 L;  1I6V C;  4ZUI A;  4YIJ A;  4JI0 Q;  1FNV A;  4P71 A;  2NB0 A;  3VR3 A;  4BY7 B;  4BY7 H;  3S24 A;  4NXM L;  1E3P A;  4AQY Q;  2Z4H A;  4B3T L;  2AUK A;  4A3G G;  2IT1 A;  1LTG D;  1EYC A;  1CHP D;  4K2K A;  4ZYS A;  5J1Z A;  2EVB A;  1NSN S;  1HZB A;  3GTM B;  1SYB A;  3GTM H;  1TWF H;  1X55 A;  3STB C;  1AZP A;  3MEH A;  1NMG A;  3OPO A;  4OIK A;  5M5Y B;  5M5Y H;  3K6O A;  4RKB A;  3K5N A;  3CCR A;  2O4X A;  4KN7 C;  1WJJ A;  4A3J G;  1UEA B;  1ROD A;  1N34 Q;  3A5Z B;  2ATW A;  2KA7 A;  4XT3 B;  4DU9 A;  1LYL A;  1BXT A;  3A56 A;  1AP0 A;  1G6P A;  2ZTD A;  2NYZ D;  1Z47 A;  2UXD Q;  4OWW B;  2EYO A;  2WAQ E;  2TSS A;  1JR0 D;  2PW7 A;  1PV4 A;  4DV6 L;  3VYU A;  2MO1 A;  5T1G A;  5FLX c;  1X3E A;  2LKV A;  2NZ1 D;  4JCV E;  3Q24 A;  4JOI C;  1TWC B;  3RMH A;  1TWC H;  5ELO A;  2N3S A;  4CGY B;  1TII D;  2R7Z B;  1DYQ A;  2R7Z H;  1YJW A;  4M1U B;  1OXX K;  1STG A;  2RSO A;  2I46 A;  2IHF A;  2B2U A;  1SNO A;  1PH8 A;  3EIV A;  4KY5 A;  1GM5 A;  4EQN A;  1EWI A;  3RZO H;  2JYO A;  4A3L G;  3I4M B;  2I0Q A;  2NVT B;  2NVT H;  1QCB D;  1EU4 A;  3AU7 A;  1KDC A;  3T13 A;  2BE5 D;  3TN2 A;  4LMQ D;  1EYD A;  3S2H B;  4JI6 Q;  3S2H H;  5AJ3 L;  2N88 A;  1ILP A;  2YYZ A;  3TP8 A;  3C3L A;  1GJX A;  1BUV T;  1J5E Q;  2PI2 A;  1P16 A;  2XSC A;  2VQF Q;  3UDX A;  1EUJ A;  1WTQ A;  2RHQ B;  2F0L A;  1CA6 A;  2B63 B;  3A7L A;  1D5Z C;  2EY1 A;  4NDX A;  2A68 C;  5J39 A;  4NPS A;  3A8I E;  3H0G B;  3H0G H;  3SK4 A;  5CYU A;  4JI8 L;  5BR8 Q;  4R4O A;  1U4L A;  2RCN A;  2F1M A;  1SEB D;  1X54 A;  2IHE A;  3WDN A;  3AFQ A;  3CD6 A;  1SJE D;  1S5E D;  1YIT A;  1TS4 A;  5FLM H;  4QMG A;  2R61 A;  4DA2 A;  2OCE A;  2B2Y A;  4MTN A;  3VR2 A;  1G29 1;  1LO5 D;  4OX9 Q;  1K9M C;  2N55 A;  2G9D A;  3NEL A;  5FO8 B;  2MNA A;  2VXW A;  3ICE A;  1IZ6 A;  1LAB A;  4LF4 Q;  3DM1 A;  5E7N A;  1Q46 A;  4CKE A;  3S14 B;  1TY2 A;  3S14 H;  3QR8 A;  1IHZ A;  2K52 A;  1PYS B;  3J81 E;  1PYB A;  1SYE A;  4NXM Q;  1TS2 A;  4R4C A;  2KEC A;  4B3T Q;  1MIU A;  1SN8 A;  3PQI A;  2XNA C;  5C5M A;  2PYK A;  3FDT A;  5HY6 A;  2D2C C;  1ZYR C;  1KRS A;  1BNZ A;  2WFW A;  1I3Q B;  1UUP A;  4EGV A;  1HFN A;  4GNX B;  3OWF A;  2VW9 A;  1YNJ D;  1HH2 P;  2PMZ B;  1S3O A;  4DPG A;  4JI4 L;  3H15 A;  4LFA L;  1C48 A;  4H0L C;  1LTT D;  3DEP A;  3HOX B;  3W5O A;  2EY2 A;  5J22 A;  3AEV A;  1Q1E A;  4DV4 L;  2EJM A;  1H9J A;  1EOT A;  1S5B D;  4DV6 Q;  2RBM A;  3PF5 A;  2K4K A;  2L55 A;  5EKL A;  3TRE A;  5JEA J;  1PH6 A;  3KJO A;  3PUZ A;  4HJ8 A;  1MHW C;  3KYH C;  5EJW A;  3P1H A;  3QIA A;  4JI3 L;  4ZAI A;  3A8J E;  3KF6 A;  5D65 A;  1AW7 A;  3L3O C;  2EXZ A;  2R7D A;  3HKS A;  5IGE A;  1XPU A;  3BDC A;  3A5U A;  2JA6 B;  1Q90 A;  3K5O A;  2JA6 H;  3I8Z A;  4WOR A;  2F0F A;  1JMC A;  3GTQ B;  2EPB A;  2FJ2 A;  2PCF B;  2HCC A;  4IFD J;  2GN5 A;  1CM9 A;  4PMW A;  1Z9F A;  2JA5 B;  2JA5 H;  1UE5 A;  4DKA C;  4LF8 L;  3I4M G;  1Q3L A;  5AJ3 Q;  2PW5 A;  3CQZ B;  3CQZ H;  3TDQ A;  1O7I A;  4GKJ L;  3S2D B;  3S2D H;  4A93 B;  4A93 H;  1M4V A;  5L37 A;  2IX3 A;  5EBC A;  1PH7 A;  1RTO A;  1Q7Y C;  2AHO B;  3VA5 A;  2WII B;  4GS3 A;  1X32 A;  1DOL A;  4OXP A;  1TWA B;  4JI8 Q;  4R4I A;  5DAU A;  1WTO A;  2OF1 A;  4C56 C;  2FXQ A;  3Q6S A;  4H02 A;  5M9O A;  1CQF A;  3CCJ A;  1IBK L;  2B63 G;  3GTG H;  1HTP A;  5CV6 A;  4DAY A;  3GTG B;  1AFP A;  5ISR A;  1QVC A;  4IUT A;  1PYW D;  4HJ9 A;  1XX8 A;  4J15 A;  2X6L A;  3SGI A;  4KTA A;  3VR5 A;  4H44 C;  3OW7 A;  3FMC A;  1VS0 A;  4JBW A;  2NN6 G;  3UDF A;  4XQN A;  1GKH A;  2RDF A;  5D3I B;  4ZKB B;  3HOW B;  1N32 L;  4KHV A;  3K7U C;  4DAM A;  4BA2 I;  2NBF A;  4A3B B;  4A3B H;  2K5D A;  4NKL A;  1QVG A;  1TS5 A;  2F0O A;  3GP7 A;  2Q8T A;  1D1I A;  1W6J A;  2A8V A;  2MFI A;  1EIG A;  3PUY A;  1EY8 A;  1NAP A;  3PF4 A;  3LGJ A;  5IGG A;  4ME3 A;  2A69 D;  4DR6 L;  2OXP A;  4XDX A;  1VQ4 A;  2PQA A;  2HQE A;  1U5K A;  2JEB I;  4JI4 Q;  1IXR A;  3PIP A;  1B3A A;  3E0E A;  4LFA Q;  1SYD A;  4APV A;  1N33 Q;  4TRD A;  3HS0 C;  3G71 A;  5FKA C;  4DV4 Q;  4A3E G;  1A8V A;  4HMJ A;  4IN3 A;  4ULL A;  1UWV A;  1V8Q A;  2J0T D;  2PMZ E;  5C5L A;  1SE8 A;  2MPM A;  1LTB D;  3U58 A;  3NP8 A;  1E0B A;  3H3V I;  4EQ5 A;  2L4N A;  2IW3 A;  2Z6B A;  3HOX G;  1HCZ A;  4FP5 D;  4DK0 A;  4L5T A;  4G57 A;  4UP7 A;  5G3L D;  4LAA A;  3MXU A;  1QWY A;  4JI3 Q;  4LFC L;  5C0X G;  1ESR A;  1LAC A;  1SBB B;  1IYU A;  4L6T B;  5CR3 A;  5K36 H;  1I4R A;  2L11 A;  3PUW A;  4Y7N B;  4Y7N H;  1WTV A;  1PRT F;  1GOZ A;  2HCI A;  2XTI A;  2RHS B;  2B2W A;  4RA8 A;  3CC2 A;  1BKB A;  2IWH A;  1Q82 C;  2CW0 C;  1YZ6 A;  4P72 A;  1DOM A;  5JJK A;  4XQJ A;  1MGS A;  5FOB B;  5CMD A;  4LF8 Q;  3NPP A;  2EYJ A;  2F0K A;  2B3G A;  1LLR D;  3SDZ A;  4HR7 B;  3BDL A;  1BDO A;  2JP1 A;  4DV0 L;  4GKJ Q;  5EPJ A;  2KUM A;  3G48 A;  1PMR A;  5GRO A;  5M5W B;  5M5W H;  2DJG C;  1MKH A;  4AYB B;  2JA5 G;  1DCZ A;  1KDA A;  2UXC L;  4LFB L;  2KQ3 A;  3SE0 A;  1KC8 C;  2UUB L;  2JEA I;  1WOC A;  2CH4 A;  2WKD A;  1E1O A;  2TMP A;  3H94 A;  1FL0 A;  4IUQ A;  4BA1 I;  3AFP A;  1XYI A;  2WV6 D;  2EXD A;  3MXN B;  4V0B A;  4ILW A;  3KOJ A;  4DUY L;  2LFN A;  2D62 A;  3B6Y A;  2F0J A;  3D3R A;  3RNU A;  2FMM A;  1STH A;  2NUC A;  3QJY A;  1T9H A;  4CJ2 C;  3KBG A;  5COY A;  5KNC A;  5FJ8 H;  5BN3 A;  4LUV A;  3K5L A;  1DON A;  1BF4 A;  2DGY A;  4UAI A;  2AUJ D;  4EQO A;  1OXT A;  1H9R A;  4K8J A;  1N32 Q;  1SNQ A;  4QF4 A;  2XN9 C;  1WI5 A;  4JBM A;  1I4Q A;  4A75 A;  2CWA A;  2KBN A;  2MJ8 A;  2XVS A;  1NTG A;  2Z0S A;  5IT9 c;  3A55 A;  4JW0 A;  3KLW A;  3QB3 A;  3MXG A;  3HOW G;  3S17 B;  4RHS A;  3S17 H;  1L1O A;  4BXX H;  3VYR A;  1DM0 B;  3UDI A;  1WD1 A;  4DR6 Q;  1VQA A;  2AWO A;  3HOU B;  3HOU H;  3GTL B;  4BBS G;  2K28 A;  3GTL H;  4CDF C;  4QQB X;  2EJG C;  3KF6 B;  1HR0 L;  3RN5 A;  3S16 H;  4N8X 1;  1U9R A;  5D14 A;  1ZXT A;  3CC7 A;  3GTO B;  3GTO H;  4X3U A;  5JVH 3;  1SYG A;  2BE5 C;  2I07 B;  3CCU A;  3TSS A;  2FIN B;  1F2Z A;  1E7Z A;  5NUC A;  3K58 A;  4GOP C;  1EL0 A;  3M85 A;  4LFC Q;  4PMC A;  3WOE A;  5IGC A;  3NTI A;  5IE8 A;  4GKK L;  4DR2 L;  2CFM A;  1EIF A;  4KY7 A;  4OEM B;  1XPO A;  3BZD B;  5ELD A;  3CMA A;  3D6W A;  1VCI A;  1PZJ D;  2RA4 A;  3LWU A;  1OXS C;  2NZH A;  1PFB A;  1PH4 A;  3MHB A;  2XRQ D;  1JJG A;  3EN2 A;  5K36 G;  2E2I H;  4DR1 L;  2JE6 I;  3E5S A;  3D4W A;  1VQC A;  3G6E A;  4HAE A;  4IUN A;  3RLN A;  4DV0 Q;  4DAY B;  1B8A A;  1HHV A;  4MHE A;  3J7Y W;  3G7L A;  1VQK A;  3HP3 A;  1HUN A;  1SRU A;  1I4H A;  2UXC Q;  3T4A C;  4A3L H;  4LFB Q;  1NR4 A;  1RKN A;  2AQ2 B;  2UUB Q;  2OT2 A;  1I94 L;  2WB1 E;  2VY3 A;  2X6G A;  4MTK A;  1U4R A;  3OTO L;  2XIW A;  4AYB G;  4XXE A;  5I9P A;  1EY4 A;  1IW7 D;  1DZ1 A;  3F8T A;  1NNX A;  3C1F A;  1ML0 D;  4DUY Q;  1A15 A;  2UXB L;  1YHQ A;  3NWT A;  3GV3 A;  4JG2 A;  1VQ6 A;  2QF7 A;  3FHW A;  4A3K B;  4A3K H;  4AIM A;  5C4H A;  1HTL D;  2FMC A;  2KCM A;  2V1C C;  3Q0A A;  4YHH L;  5KND A;  1E2Z A;  2VQE L;  1LM0 A;  1MBY A;  1I4X A;  1YHB A;  2PQA B;  2HHH L;  1CI3 M;  3M3Y B;  1YNJ C;  5IP9 H;  1SMX A;  4QGU A;  1FGU A;  1UNS A;  1K28 A;  5EGT A;  4JBK A;  4K5W A;  3V96 A;  2MHV A;  3ND9 A;  3ERQ A;  2IL8 A;  2M2L A;  2EQS A;  3H3V C;  1VQH A;  2NVY B;  2NVY H;  2EZV A;  1Y1V G;  3HGB A;  3RD4 A;  3EJI A;  1CSP A;  2BDO A;  2Z1C A;  2OTJ A;  3A7A B;  2B8G A;  1PZI D;  1ILQ A;  2VL6 A;  1Y8P B;  1V1O A;  5C0X I;  1PDQ A;  5KEE A;  1QZG A;  3GTJ B;  1B7Y B;  5I9O A;  1CZG A;  1Y14 B;  3Q22 A;  3NXW A;  1IBL L;  1VMP A;  5CV5 A;  1LT6 D;  1XWE A;  4HN7 A;  4JI7 L;  3HOU G;  2E74 C;  1HPC A;  3QWN A;  1VQN A;  2Y0S B;  1II3 A;  4NB3 A;  3TZD A;  2KEN A;  2F0H A;  2SNS A;  4LUO A;  5C3X A;  2JA8 B;  2JA8 H;  2F0I A;  3KLS A;  5K5P A;  3I55 A;  1KAA A;  2HIV A;  4IUU A;  2AQ3 B;  4GKK Q;  4DR2 Q;  4KD3 A;  1CSQ A;  5EQ0 A;  1SYC A;  1Y69 U;  3I7F A;  4XYQ A;  5EBD A;  1NCV A;  3GV6 A;  4JPB W;  1K8O A;  1STE A;  5DLQ E;  1GUO A;  3EQL C;  3NSW A;  1GHJ A;  2OQ0 A;  4DR1 Q;  2PPB C;  1TVX A;  1BR9 A;  3K0Y A;  3HFZ B;  4YWL A;  1PH9 A;  3SXH A;  1EIY B;  4Z9C B;  3MAQ A;  4JV5 L;  3URY A;  3I70 A;  1A2T A;  5KIX A;  1GVP A;  1A63 A;  4C3I B;  1RF2 D;  3CF5 A;  2CWP A;  5CV4 A;  3U9O A;  1VMC A;  3HG9 A;  1PRT B;  1I94 Q;  1TQO A;  1CA5 A;  1DXM A;  2XGT A;  1UAP A;  1HRJ A;  3NBH A;  3HOY B;  3OTO Q;  5IOC A;  1JQY D;  4WJW A;  1PTO F;  3TP5 A;  2BCO A;  3U50 C;  5JJZ A;  3J81 c;  4K5V A;  3I4M H;  5IIF A;  2EYL A;  3T56 B;  2ICE C;  4I7A A;  4P75 A;  2UXB Q;  1AN8 A;  1O78 A;  2QGQ A;  2JJQ A;  1JB7 A;  1J8I A;  1D5X C;  3OIQ A;  3JAM c;  1KTK A;  2CHB D;  4RCO A;  1L1O B;  4LF9 L;  4POF A;  2I5H A;  4F88 A;  2PZU A;  1K8G A;  2OQK A;  2F0G A;  3A54 A;  3AYH B;  4TSS A;  4YHH Q;  4HJ5 A;  1ET9 A;  2VQE Q;  2B2T A;  3ER0 A;  2Z6K C;  4A3K G;  2HHH Q;  3GO5 A;  1B44 D;  5CBA E;  4K6D A;  4KKS A;  5GAD C;  2MUY A;  1VQE A;  4I65 A;  2B63 H;  4B08 A;  1EY7 A;  1EWH A;  3J80 L;  1EYA A;  1I5F A;  3T53 B;  1A3V A;  1ESF A;  1V1P A;  4KN4 C;  1QZH A;  5IP9 G;  2MO0 A;  4TVA B;  4OGQ C;  1EQQ A;  4DAP A;  1A3U A;  3SR1 A;  1F2M A;  2NN6 H;  4UPA A;  2Q2I A;  5JJL A;  3MVV A;  1V9P A;  2K5N A;  1PVO A;  2KCT A;  3MXP A;  2Z8L A;  2JA7 G;  3PO2 G;  3M7N A;  5DM7 3;  2UUC L;  1S4Z A;  1IBL Q;  2IPK D;  1J6Q A;  2JN4 A;  4A3C H;  4K14 A;  2NVQ B;  4ZLT F;  2NVQ H;  4JI7 Q;  1EY9 A;  1OO9 B;  1JC7 A;  2CVR A;  4H13 C;  4KHP L;  1HXY D;  5JPN C;  3E9H A;  2EIF A;  3QO2 A;  5I2X A;  4DNR B;  5KRU A;  3TS2 A;  5EKI A;  1Q1B A;  3I91 A;  5DNF A;  4C3H B;  4C3H H;  1TWH B;  1TWH H;  5E3F A;  2OEO A;  4KV6 A;  2Y0S G;  5JEA G;  2JQO A;  1I3Q H;  2A6H C;  1HR0 W;  1VQI A;  4A3E B;  4G7O C;  4A3E H;  2RDG A;  4L63 B;  4BWG B;  2H4O A;  2ZT9 C;  3OMG A;  3PUX A;  5ELF A;  1ASZ A;  3BJU A;  2JA8 G;  3I4L A;  1LTS D;  4MN3 A;  4FNF A;  3F2D A;  1HZ9 A;  3BVG A;  1VQD A;  3HOX H;  1S5F D;  3X3M A;  3M9B A;  3SK8 A;  3MTS A;  4PZ6 A;  4P2C B;  1JCK B;  2B39 A;  1SNC A;  5C0X H;  1EY6 A;  3CPF A;  4JV5 Q;  2B2V A;  1GUW A;  2JK8 A;  2JSO A;  5FK9 C;  4MNO A;  2AQ1 B;  3HEJ A;  2KHI A;  4KY6 A;  1YIJ A;  1SFO B;  1SFO H;  1KAW A;  2RF4 A;  2RQX A;  5IOD A;  1HA6 A;  4R4T A;  1B9M A;  1B2T A;  1HFG A;  4PMB A;  1RCV D;  4C3I G;  1DGS A;  4FYD A;  3I73 A;  3OW2 A;  3GTQ H;  2SDF A;  1TWG B;  1TWG H;  4P73 A;  2I5L X;  2NTT A;  3VA7 A;  2LY7 A;  2F4I A;  1HQM C;  2E2H B;  3HOY G;  2E2H H;  3PIO A;  4JC0 A;  5I6Y A;  2OTL A;  4LF9 Q;  4JYA L;  1OXV A;  4Q0F A;  3S1R B;  3S1R H;  4GN5 A;  1PH3 A;  3FRP B;  3J7Z C;  4KLK A;  5ELE A;  1B3Q A;  1KLG D;  1BCP F;  3CP0 A;  4DAV A;  2WIN B;  3R8B A;  5HGQ A;  4DV5 L;  3E6Z X;  2F0T A;  1A3T A;  2QA4 A;  2QEX A;  5IYC G;  1Q8I A;  3M7G A;  2ZXR A;  1TWA H;  1S5D D;  1TKW B;  4GLA C;  3STB D;  2F03 A;  3PGZ A;  3HKZ B;  5H1S E;  1V43 A;  5C44 B;  5C44 H;  1MI2 A;  4CKB A;  1VQP A;  5C3E B;  1XPR A;  4K2L A;  1YEZ A;  1CKN A;  4DV2 L;  4BS9 A;  2CQA A;  1H9M A;  4QIW B;  5A35 A;  5JAV A;  2E2D C;  4CDD C;  3TQY A;  1F9S A;  3J80 E;  2HT1 A;  2UUC Q;  1A6X A;  3I2Z A;  5AFW A;  2M9V A;  2VS1 A;  2X69 A;  2XWB B;  3HOW H;  4LWC A;  1WTH A;  3NEM A;  3HZX A;  4LK1 C;  1R9T H;  1R9T B;  4KHP Q;  5CBE E;  1NE3 A;  3KK7 A;  4A3C G;  2Q2H A;  3OOC A;  2PZT A;  3K8A A;  4BBS B;  4BBS H;  1FYC A;  4F87 A;  1SMY D;  4RWS C;  3P20 A;  3PMF A;  2K50 A;  3ULP A;  5LL6 S;  3TME A;  1NBW A;  1EIH A;  5TSS A;  4ODG A;  2NVX B;  2K1B A;  2NVX H;  2PNR C;  4C3H G;  3QOL A;  4RG1 A;  3I4N B;  1XTC D;  3A0J A;  3PV0 A;  2B8F A;  1C9O A;  3R3O A;  2QW7 A;  5IWA L;  1MJC A;  2EYF A;  4J8Q A;  1XTD A;  3IFT A;  3NBH B;  1PRT D;  3P75 A;  2ES2 A;  2E2J B;  2DY7 A;  2E2J H;  1K0S A;  5F2D A;  5CC4 A;  2Q2T A;  3AQQ A;  1C4Q A;  4HMI A;  1STA A;  4CHT B;  1LTR D;  3A8K E;  1DOK A;  4JI2 L;  3WWV A;  4IJH A;  2VNU D;  2A73 B;  3MFY A;  4GZY C;  2N78 A;  1K8A C;  2WP8 J;  3T1H L;  2ZJR A;  3MWY W;  4RHR A;  3EFX D;  3BS1 A;  2F0N A;  1SRO A;  3VR6 A;  1GUN A;  2CQO A;  3BYY B;  5KGU A;  3X3N A;  3I3C A;  2A6E C;  3U4Z A;  1D2B A;  1CKM A;  4XT1 B;  1Z6H A;  2IJ0 A;  1V1P B;  5C4Z A;  4DR7 L;  4JYA Q;  3S1Q B;  3T1Y L;  3S1Q H;  5M5X B;  5M5X H;  3DMU A;  3L7Z C;  2BA0 A;  1JWS D;  4JOI A;  1R4Q B;  1FD7 D;  3GTP B;  3GTP H;  4X3S A;  3L0O A;  1ENF A;  4DV5 Q;  1C0A A;  3DWA A;  3ULL A;  5IYB G;  1PTO B;  1PTO H;  1GXD C;  2D5D A;  1HZA A;  2A74 C;  4ZUJ A;  1AE3 A;  1IL2 A;  2ID0 A;  4B9W A;  2CCZ A;  2Q2U A;  2RDH A;  1PFM A;  5C0X J;  1J9O A;  4U67 3;  1IBK Q;  1QE6 A;  3IAY A;  1QNK A;  3CKI B;  2H5X A;  1KLU D;  1QIL A;  2UU9 L;  4LJZ C;  1VQ8 A;  4KD4 A;  3C2P A;  3QOJ A;  4DV2 Q;  1X3Q A;  3HKZ G;  2E75 C;  2ENB A;  3S15 B;  2YTV A;  3S15 H;  1YBY A;  4KMU C;  5C44 G;  4ALP A;  5C4J B;  1QB5 D;  5C4J H;  3I90 A;  1JT8 A;  1X3P A;  5C3E G;  3ULJ A;  3CW2 C;  1LT5 D;  1ICW A;  1HNZ L;  2QDL A;  4IPH A;  5CV9 A;  1X3G A;  3SVM A;  4WJ4 A;  2F0S A;  5GAG C;  5EPL A;  1VQL A;  3S1N H;  3S1N B;  1BVS A;  1Y1V B;  1Y1V H;  1EFW A;  1K3B C;  2B2Y C;  4PZ7 A;  1GUS A;  1H95 A;  3IL8 A;  5IGF A;  4L5R C;  4ZQ3 A;  4OON A;  3RLO A;  3FPP A;  1I4G A;  2L5T A;  3TZU A;  1B1Z A;  3ERO A;  2DNE A;  1LTL A;  4IZ8 A;  4NMZ A;  4JI5 L;  5IGD A;  1SE2 A;  2KOL A;  3PCO B;  4A3M B;  4A3M H;  4FVM A;  5IWA Q;  3DM3 A;  1HUM A;  4YCU A;  2FFK B;  2K6A A;  3SK5 A;  3PIP 3;  3H91 A;  3I4N G;  1I50 B;  1I50 H;  5E1F A;  1JOQ A;  1EEF D;  4N9T A;  4ZRZ A;  4A3F B;  2L1B A;  4OIJ A;  3D31 A;  4JI2 Q;  4IOC A;  5C6A A;  5EAY A;  1GO3 E;  3OSO A;  1B70 B;  4CDC C;  1D5M C;  1U4M A;  1A2U A;  2K75 A;  4RFB A;  1B9N A;  3ONA B;  1D1K A;  3CHB D;  2R7F A;  3T1H Q;  4RAU C;  2H1E A;  4A3D G;  2LMC B;  4LF7 L;  1STB A;  1E1T A;  2K14 A;  1FJG L;  2ASB A;  1TS3 A;  1MD2 D;  2PI2 E;  2NTS A;  5ELN A;  3WOF A;  1YJN A;  4DR7 Q;  1H9S A;  2XWJ B;  3T1Y Q;  1XMO L;  4N9P A;  3LWE A;  3D0F A;  1X9N A;  3RLF A;  4A76 A;  1VF7 A;  2WAQ B;  1S5C D;  5KYL A;  1LT3 D;  4C3J B;  1F2Y A;  3FEW X;  1CKN B;  2N8N A;  1KD1 C;  1LUZ A;  4TQU S;  2NN6 I;  5I4D A;  1BOS A;  3DXJ C;  5DEH A;  3RR5 A;  3LNN A;  1HQR D;  2MP1 A;  1ET6 A;  2KHJ A;  2DNC A;  4AYB E;  2K03 A;  3KJP A;  3AB9 A;  5BN5 A;  3UE0 A;  1JOO A;  3HOV B;  3HOV H;  3UDG A;  1MJE A;  4UHV A;  4IUR A;  2UU9 Q;  3KDF A;  1EQR A;  1CZW A;  2IX0 A;  5JJI A;  1SSO A;  2ZJQ A;  2K5V A;  3BU2 A;  2KED A;  5BN4 A;  3MC0 B;  2QKI C;  1BCP B;  3NUC A;  1IKL A;  1G2S A;  3ZYY X;  5JPM C;  5D3D A;  2C5C A;  2R93 G;  3DEO A;  1ICF B;  3KF8 A;  2BOS A;  1WYD A;  1HNZ Q;  3N6R A;  3M3Y H;  1IL8 A;  5EPK A;  1SND A;  3ERS X;  3J7A 5;  4XYO A;  4HSP A;  1C7Y A;  2K5Q A;  1VQO A;  4KKT A;  4KI0 A;  4DR4 L;  1T5X D;  4JI6 L;  4PNY A;  4KK7 A;  4E6I A;  2HUG A;  3CAM A;  3S1M B;  1PHJ A;  4R8N A;  3S1M H;  2JA7 H;  2JA7 B;  3PO2 B;  3MA2 B;  3PO2 H;  5FLX L;  4LF6 L;  1B4O A;  1EOV A;  1Y1W B;  1Y1W H;  3EBE A;  1F9Q A;  2DJF C;  5CV7 A;  1K8M A;  2D0O A;  3GTJ H;  4HIM A;  4JI5 Q;  2QIL A;  3R2T A;  3SHL A;  5FO9 B;  3K81 C;  1C8C A;  1HR0 Q;  1YNN D;  1L0W A;  4OO1 G;  4H7B A;  2ZM6 L;  3CCL A;  2PZW A;  4DXF A;  1QUQ A;  2LSS A;  5JEA H;  1WFQ A;  3NE5 B;  4A3M G;  4DR3 L;  4EQP A;  1X65 A;  2VB2 X;  3RN2 A;  2D9U A;  2Z9H A;  3CXC A;  1TY0 A;  4MZ9 A;  2E5L L;  4X64 L;  5M3M B;  5M3M H;  4HIO A;  3PUV A;  4QJF A;  4XIG S;  3U9S A;  1W2B A;  3M4O B;  3M4O H;  4LW1 A;  3CCS A;  2SNM A;  2GVA A;  1HA5 A;  1QOH A;  4HTH A;  4A3F G;  4O42 A;  3T51 B;  4IUP A;  3M4P A;  5LL6 X;  5M3F B;  5M3F H;  2JXM B;  1B50 A;  4LF7 Q;  4X62 L;  2F3I A;  5IP7 H;  1FJG Q;  1ZKO A;  4IFD H;  2F0U A;  4ME5 A;  4CKC A;  1PTO D;  3CCM A;  1TWF B;  3N52 A;  1O7L A;  3OHX C;  1EFI D;  4KJN A;  1U0L A;  2F0Q A;  3E9I A;  1XMO Q;  1IYV A;  2K5H A;  2I5M X;  1D8L A;  1SJH D;  4OL7 A;  1WTP A;  4R4Q A;  3FKI B;  3FKI H;  4EVO A;  4IUV A;  1XJV A;  4C3I H;  4AH6 A;  4A4I A;  1SNP A;  4UP9 A;  2B2W C;  4HJ7 A;  4O0A A;  3BVM A;  3R2I A;  4K6L A;  5GQO A;  3J80 i;  1VF5 C;  1S72 A;  4CDE C;  4FXG C;  2M00 A;  2WAQ G;  1M8A A;  3HOY H;  1G2T A;  4C3J G;  4BBR G;  3TP6 A;  5HGT A;  4UP8 A;  2MGS A;  2KHS A;  2K05 A;  1Z7T A;  1I4P A;  5KYI A;  4L5S A;  2E8G A;  4FO2 A;  1KIX A;  4X66 L;  4DV7 L;  4DUZ L;  2VUM G;  3PO3 B;  1TU2 B;  5T1I A;  3PO3 H;  3HOV G;  2GA4 B;  3K7A B;  3K7A H;  5IYC H;  4NW2 A;  1PA6 A;  2Q8I B;  3VDY A;  1QNU A;  1SMY C;  1E22 A;  3RZO B;  5C3W A;  1KAB A;  3IKJ A;  2A69 C;  3ITP A;  2A1A A;  4QL5 A;  4YCW A;  1A62 A;  1PFN A;  3GDE A;  3NQT A;  2BA1 A;  4QB4 A;  2IX1 A;  2L9H A;  4YY3 L;  4DR4 Q;  5E4X A;  1PZK D;  1PRT C;  2VB3 X;  1JOR A;  4K0K L;  1FVI A;  2VZA A;  4LF6 Q;  1NJI C;  2ZTC A;  4OWT B;  1N36 L;  3BZK A;  1PLF A;  4QY7 A;  3GTK B;  1QG7 A;  3F2B A;  3GTK H;  1EY5 A;  3OIP A;  1CT1 D;  3I56 A;  1XMQ L;  3BDO A;  3F2C A;  2BH2 A;  5LHY 1;  4DV1 L;  1L1O C;  1Y1W G;  4S3S A;  1WD0 A;  2ZM6 Q;  4P74 A;  1N8R C;  3TS0 A;  3W1G A;  2F0V A;  1E2W A;  5FLX E;  1Q81 C;  1Q86 C;  1IYJ B;  1X56 A;  4DR3 Q;  3HOZ B;  4ZCK A;  3HOZ H;  2HD3 A;  3JC6 6;  4L5Q A;  2BH8 A;  2YTX A;  3DUZ A;  1HZC A;  1KNA A;  3NTH A;  4XQQ A;  4C1N I;  4X64 Q;  4IO9 A;  2E5L Q;  1H9S B;  2C9O A;  4PQX A;  2Y0S E;  1E2V A;  1STN A;  3NQI A;  3HRZ C;  1TT2 A;  2P5Z X;  3NWS A;  4HJA A;  4OEL B;  3MXN A;  4DK3 C;  5M3M G;  3OWE B;  3CRK C;  4X62 Q;  4B3M L;  1Y8O B;  4FXK C;  4RGN A;  1X3F A;  1T5E A;  3G4S A;  1JE5 A;  4BY1 B;  4BY1 H;  3C1E A;  1CK1 A;  3ND8 A;  5E4W C;  3RZD B;  3RZD H;  3JAM E;  1I6H B;  1I6H H;  1YJ9 A;  2F52 A;  5M3F G;  2F0D A;  4BY7 G;  4GN4 B;  4QCL A;  1BQQ T;  1SLJ A;  1A0I A;  4A3I H;  2EY6 A;  4A3I B;  1AZQ A;  2WAC A;  3A74 A;  3KDF B;  5IP7 G;  2F0P A;  4IFD G;  1JE4 A;  1L0X B;  4YCV A;  2UUA L;  1FGB D;  3E3X A;  1KHI A;  1M90 C;  2KJX A;  3KUP A;  5CGK A;  1GHK A;  3FPU B;  1N33 L;  4GOP A;  2F0M A;  1D6E C;  2K33 A;  3J80 c;  1LV9 A;  3L9A X;  1O7Y A;  4RKL A;  1GUG A;  3C46 A;  1JOK A;  1DJR D;  4L8J A;  1BCP D;  2SOB A;  4X65 L;  3FKI G;  1SE4 A;  3KF8 B;  3W1B A;  4QUF A;  2Z4I A;  4GLV B;  4Q5V A;  3Q23 A;  3VR4 A;  4GNX C;  4FXD A;  3J7A V;  1NY4 A;  3NBI A;  4GN3 B;  4IAL A;  3GD7 A;  4B9X A;  5GAH C;  4X66 Q;  1CHQ D;  4DV7 Q;  4DUZ Q;  4WJ3 M;  3FP9 A;  1LT4 D;  1EWC A;  1PFS A;  2KVM A;  5I6W A;  5IYB H;  5LMN L;  3KLS X;  4B3S L;  1Q8K A;  3SK6 A;  4G7H C;  1ENA A;  3P7J A;  4POG A;  4UDU C;  2G5D A;  1WTX A;  3BYT B;  4B3R L;  2R7Z G;  1F9R A;  2PNH A;  2QDB A;  3PO3 G;  1RTN A;  1DD2 A;  4R9W A;  1LTA D;  4OO1 I;  1L2F A;  1GD7 A;  1F2L A;  4YY3 Q;  2QEJ C;  2DUD A;  4HCS A;  4G7Z C;  2F3W A; 
#chains in the Genus database with same CATH homology
 5HUR A;  1SAP A;  4KKU A;  2R92 B;  4RH6 A;  4G4K A;  3NK9 A;  2G9H D;  3D4D A;  3D6C A;  3MZ5 A;  5ELB A;  2F3V A;  3KLR A;  4RGM A;  3F2U A;  2L12 A;  3KBX A;  4HED A;  3D4R A;  3SEB A;  1JWM D;  2PO4 A;  4ABN A;  2F0E A;  3K57 A;  3DWQ A;  1OXU A;  3DWP A;  4DXG A;  2K01 A;  3NHH A;  1GUT A;  4KJO A;  4M8A A;  1CTM A;  4IQZ A;  3FVQ A;  2DN8 A;  4X3K A;  4CJ1 B;  4FF2 A;  1STY A;  2L0C A;  5DM6 3;  2KEE A;  1RJT A;  1WCM B;  1ONL A;  1KNE A;  4DF7 A;  1Y8N B;  1K83 B;  1IW7 C;  3GQB A;  1ENC A;  1SE3 A;  1RHP A;  2ZXO A;  4A3D B;  2A68 D;  3S9W A;  2ZXP A;  4I7Z C;  2KCN A;  3K5M A;  2K5W A;  5JOB A;  3R93 A;  1ZEQ X;  2EOT A;  1SDF A;  5IT9 L;  4U68 A;  1G8Z D;  2F0W A;  2O5I C;  5CV8 A;  4K8I A;  2J7Z A;  2B2U C;  5IGB A;  4CBV A;  1EQT A;  3PIO 3;  3M4Y A;  5COR A;  1PXU A;  1NUC A;  3MFG A;  2EYH A;  4MIU A;  1NR2 A;  4JK1 C;  2EYP A;  1ZYR D;  1QJO A;  1FNU A;  1YNN C;  5G3L F;  2EJF C;  4K5X A;  2A6H D;  2SEB D;  4J6H A;  4C2M B;  2PQE A;  2J4X A;  2O2L D;  2WB1 B;  1IKM A;  2HDL A;  2R93 B;  4XTC S;  2B2T C;  4ZKC B;  3W3A A;  4CJ0 B;  3T16 A;  5EKK A;  1BO0 A;  3QG1 A;  1G6Z A;  3TBI B;  5C4X B;  1WTR A;  2EDG A;  5A2Q L;  2FHT A;  3K59 A;  4KHZ A;  3UI2 A;  1EZ8 A;  4F7X A;  5ELC A;  1U4P A;  4HCE A;  1PTO C;  2DY8 A;  3G6J B;  4IFD I;  3CU7 A;  4J1M A;  1O7Z A;  4F8M A;  4OO1 H;  1JB3 A;  3AMU A;  3J7A F;  4DN4 M;  1WTW A;  1G91 A;  2A5H A;  3D8G A;  1CFM A;  3BVZ A;  2NWG A;  2K04 A;  3CRL C;  2E76 C;  2HDM A;  2QCP X;  3IFD A;  2EE1 A;  2R3Z A;  5JVG 3;  2K7V A;  4A3G B;  2RSN A;  3TP7 A;  3S16 B;  4R8I A;  1O80 A;  2ICI A;  3I72 A;  3VYS A;  3V2T A;  4RGO S;  3BG3 A;  1F9P A;  2B2V C;  1FNW A;  4A3J B;  2EYM A;  1EQV A;  1FR3 A;  4DNT B;  2K32 A;  4WRD A;  1KDB A;  4DK1 A;  1VDZ A;  3H09 A;  4BBR B;  1WVL A;  4DGZ A;  3RUZ A;  4O1N A;  2KCC A;  2E2I B;  5IT9 E;  5FO7 B;  1BBX C;  1MSH A;  1B53 A;  3H6M A;  2VUM B;  4TKO B;  5KNB A;  3VYT A;  1AEX A;  4V19 0;  2RVL A;  3LX0 A;  1R4P B;  1H9K A;  1MSG A;  3EVQ A;  1JIC A;  3O13 A;  1SYF A;  4NP5 A;  4RCN A;  4OHJ A;  2BDN A;  3E0J A;  1F77 A;  2R6G A;  1Q12 A;  4ID6 A;  3W2D A;  5I2Y A;  4FF4 A;  1SXT A;  4PV1 C;  4WFN 3;  4RGT A;  2O5J C;  3NTK A;  2EY5 A;  3EA6 A;  2XRS D;  5A2Q E;  1RDP D;  1RD9 D;  1EY0 A;  1TR5 A;  1W6K A;  2A6E D;  2CW0 D;  2Q8R E;  3DHQ A;  2RKS A;  4FF3 A;  1CQV A;  4DFA A;  1BCP C;  4ZK9 B;  3OMC A;  1LTI D;  3V05 A;  2V4D A;  3J81 L;  2WKC A;  1L0Y B;  4QUC A;  2AWN A;  2LS0 1;  4HSV A;  2YU9 B;  4C1N K;  4FF1 A;  3JAM L;  1JWU D;  4X3T A;  1EEI D;  1SNM A;  1XXG A;  1EU3 A;  1EZ6 A;  1I6V C;  4ZUI A;  4YIJ A;  1FNV A;  2NB0 A;  3VR3 A;  4BY7 B;  2Z4H A;  2AUK A;  2IT1 A;  1LTG D;  1EYC A;  1CHP D;  4K2K A;  4ZYS A;  5J1Z A;  2EVB A;  1NSN S;  3GTM B;  1SYB A;  1AZP A;  3MEH A;  3OPO A;  4OIK A;  5M5Y B;  3K6O A;  4RKB A;  3K5N A;  2O4X A;  4KN7 C;  1UEA B;  1ROD A;  2KA7 A;  4XT3 B;  4DU9 A;  1BXT A;  3A56 A;  1AP0 A;  2NYZ D;  1Z47 A;  2EYO A;  2TSS A;  1JR0 D;  2PW7 A;  3VYU A;  5T1G A;  2LKV A;  2NZ1 D;  3Q24 A;  3RMH A;  1TWC B;  4CGY B;  1TII D;  2R7Z B;  1DYQ A;  4M1U B;  1OXX K;  1STG A;  2RSO A;  2I46 A;  2B2U A;  1SNO A;  4KY5 A;  4EQN A;  2JYO A;  3I4M B;  2NVT B;  1QCB D;  1EU4 A;  3AU7 A;  1KDC A;  3T13 A;  2BE5 D;  3TN2 A;  4LMQ D;  1EYD A;  3S2H B;  2N88 A;  1ILP A;  2YYZ A;  3TP8 A;  3C3L A;  1GJX A;  1BUV T;  2XSC A;  1WTQ A;  2F0L A;  1CA6 A;  2B63 B;  3A7L A;  1D5Z C;  2EY1 A;  4NDX A;  2A68 C;  5J39 A;  3A8I E;  3H0G B;  3SK4 A;  5CYU A;  1U4L A;  2F1M A;  1SEB D;  3WDN A;  1SJE D;  1S5E D;  1TS4 A;  4QMG A;  2R61 A;  4DA2 A;  2B2Y A;  3VR2 A;  1G29 1;  1LO5 D;  2N55 A;  2G9D A;  5FO8 B;  2VXW A;  1LAB A;  3DM1 A;  4CKE A;  3S14 B;  1TY2 A;  1IHZ A;  3J81 E;  1SYE A;  1TS2 A;  2KEC A;  2XNA C;  5C5M A;  2PYK A;  3FDT A;  2D2C C;  1ZYR C;  1BNZ A;  1I3Q B;  1UUP A;  4EGV A;  1HFN A;  3OWF A;  1YNJ D;  2PMZ B;  1C48 A;  4H0L C;  1LTT D;  3DEP A;  3HOX B;  2EY2 A;  5J22 A;  1Q1E A;  2EJM A;  1H9J A;  1EOT A;  1S5B D;  2RBM A;  2L55 A;  5EKL A;  5JEA J;  3PUZ A;  5EJW A;  3P1H A;  3QIA A;  4ZAI A;  3A8J E;  5D65 A;  1AW7 A;  3L3O C;  2EXZ A;  5IGE A;  3BDC A;  2JA6 B;  1Q90 A;  3K5O A;  3I8Z A;  4WOR A;  2F0F A;  3GTQ B;  2EPB A;  2FJ2 A;  2PCF B;  2HCC A;  4IFD J;  1CM9 A;  4PMW A;  2JA5 B;  1Q3L A;  2PW5 A;  3CQZ B;  3TDQ A;  3S2D B;  4A93 B;  1M4V A;  2IX3 A;  5EBC A;  1RTO A;  3VA5 A;  2WII B;  1X32 A;  1DOL A;  1TWA B;  5DAU A;  1WTO A;  2OF1 A;  4C56 C;  3Q6S A;  5M9O A;  1CQF A;  3GTG B;  1HTP A;  5CV6 A;  4DAY A;  1AFP A;  5ISR A;  4IUT A;  1PYW D;  1XX8 A;  2X6L A;  3VR5 A;  4KTA A;  4H44 C;  3OW7 A;  3FMC A;  4JBW A;  2NN6 G;  4XQN A;  2RDF A;  5D3I B;  4ZKB B;  3HOW B;  4KHV A;  4BA2 I;  2NBF A;  4A3B B;  2K5D A;  4NKL A;  1TS5 A;  2F0O A;  3GP7 A;  2Q8T A;  1D1I A;  1W6J A;  1EIG A;  3PUY A;  1EY8 A;  1NAP A;  5IGG A;  2A69 D;  2OXP A;  4XDX A;  2HQE A;  2JEB I;  1B3A A;  1SYD A;  4TRD A;  3HS0 C;  5FKA C;  4HMJ A;  4IN3 A;  4ULL A;  1V8Q A;  2J0T D;  5C5L A;  2MPM A;  1LTB D;  3NP8 A;  1E0B A;  2L4N A;  2IW3 A;  1HCZ A;  4FP5 D;  4DK0 A;  4G57 A;  5G3L D;  4LAA A;  3MXU A;  1QWY A;  5C0X G;  1ESR A;  1LAC A;  1SBB B;  1IYU A;  4L6T B;  5CR3 A;  5K36 H;  1I4R A;  2L11 A;  3PUW A;  4Y7N B;  1WTV A;  1PRT F;  1GOZ A;  2HCI A;  4RA8 A;  2B2W A;  2IWH A;  2CW0 C;  1DOM A;  4XQJ A;  1MGS A;  5FOB B;  5CMD A;  3NPP A;  2EYJ A;  2F0K A;  1LLR D;  3SDZ A;  4HR7 B;  3BDL A;  1BDO A;  2JP1 A;  5EPJ A;  2KUM A;  1PMR A;  5M5W B;  4AYB B;  1DCZ A;  1KDA A;  2KQ3 A;  3SE0 A;  2JEA I;  2WKD A;  2TMP A;  3H94 A;  4IUQ A;  4BA1 I;  1XYI A;  2WV6 D;  4V0B A;  4ILW A;  2LFN A;  2D62 A;  2F0J A;  3D3R A;  2FMM A;  1STH A;  2NUC A;  3QJY A;  4CJ2 C;  5KNC A;  3KBG A;  5COY A;  5BN3 A;  3K5L A;  1DON A;  1BF4 A;  4UAI A;  2AUJ D;  4EQO A;  1OXT A;  1H9R A;  4K8J A;  1SNQ A;  4QF4 A;  2XN9 C;  1I4Q A;  2MJ8 A;  2XVS A;  3A55 A;  3QB3 A;  3MXG A;  3S17 B;  4RHS A;  3VYR A;  1DM0 B;  1WD1 A;  2AWO A;  3HOU B;  3GTL B;  2K28 A;  2EJG C;  1U9R A;  5D14 A;  1ZXT A;  3GTO B;  4X3U A;  5JVH 3;  1SYG A;  2BE5 C;  2I07 B;  3TSS A;  2FIN B;  1F2Z A;  5NUC A;  3K58 A;  1EL0 A;  3M85 A;  4PMC A;  3WOE A;  5IGC A;  3NTI A;  4KY7 A;  3BZD B;  5ELD A;  3D6W A;  1VCI A;  1PZJ D;  2RA4 A;  1OXS C;  3LWU A;  1PFB A;  3MHB A;  2XRQ D;  5K36 G;  2JE6 I;  3E5S A;  3D4W A;  4HAE A;  4IUN A;  1HHV A;  4MHE A;  3J7Y W;  3G7L A;  3HP3 A;  1HUN A;  1I4H A;  3T4A C;  1NR4 A;  1RKN A;  2AQ2 B;  2OT2 A;  2X6G A;  1U4R A;  2XIW A;  4XXE A;  5I9P A;  1EY4 A;  1IW7 D;  1DZ1 A;  3C1F A;  1ML0 D;  1A15 A;  3NWT A;  3GV3 A;  2QF7 A;  4A3K B;  5C4H A;  1HTL D;  2FMC A;  3Q0A A;  5KND A;  1E2Z A;  1MBY A;  1I4X A;  1CI3 M;  3M3Y B;  1YNJ C;  1UNS A;  5EGT A;  4K5W A;  3V96 A;  2MHV A;  3ND9 A;  3ERQ A;  2IL8 A;  2M2L A;  3H3V C;  2NVY B;  2EZV A;  3HGB A;  3RD4 A;  3EJI A;  2BDO A;  2Z1C A;  3A7A B;  2B8G A;  1PZI D;  1ILQ A;  1Y8P B;  1V1O A;  5C0X I;  1PDQ A;  5KEE A;  3GTJ B;  5I9O A;  1CZG A;  3Q22 A;  3NXW A;  1VMP A;  5CV5 A;  1LT6 D;  1XWE A;  4HN7 A;  2E74 C;  1HPC A;  3QWN A;  2Y0S B;  1II3 A;  3TZD A;  2F0H A;  2SNS A;  5C3X A;  2JA8 B;  2F0I A;  3KLS A;  5K5P A;  1KAA A;  4IUU A;  2AQ3 B;  4KD3 A;  5EQ0 A;  1SYC A;  1Y69 U;  4XYQ A;  5EBD A;  1NCV A;  3GV6 A;  1K8O A;  1STE A;  1GUO A;  3EQL C;  3NSW A;  1GHJ A;  2PPB C;  1TVX A;  1BR9 A;  3K0Y A;  3SXH A;  4Z9C B;  3MAQ A;  3URY A;  3I70 A;  1A2T A;  5KIX A;  4C3I B;  1RF2 D;  5CV4 A;  3U9O A;  1VMC A;  3HG9 A;  1PRT B;  1TQO A;  1CA5 A;  1DXM A;  1UAP A;  1HRJ A;  3NBH A;  3HOY B;  5IOC A;  1JQY D;  4WJW A;  1PTO F;  3TP5 A;  2BCO A;  5JJZ A;  4K5V A;  5IIF A;  2EYL A;  3T56 B;  2ICE C;  1AN8 A;  1O78 A;  1J8I A;  1D5X C;  3OIQ A;  1KTK A;  2CHB D;  4RCO A;  4F88 A;  2PZU A;  3A54 A;  2F0G A;  4TSS A;  1ET9 A;  2B2T A;  3GO5 A;  1B44 D;  5CBA E;  4K6D A;  4KKS A;  2MUY A;  4I65 A;  4B08 A;  1EY7 A;  1EWH A;  3J80 L;  1EYA A;  3T53 B;  1A3V A;  1ESF A;  1V1P A;  4KN4 C;  4OGQ C;  4DAP A;  1A3U A;  3SR1 A;  1F2M A;  2NN6 H;  3MVV A;  3MXP A;  2Z8L A;  3M7N A;  5DM7 3;  1S4Z A;  2IPK D;  4K14 A;  2NVQ B;  4ZLT F;  1EY9 A;  1OO9 B;  1JC7 A;  2CVR A;  4H13 C;  1HXY D;  5JPN C;  3QO2 A;  5I2X A;  4DNR B;  5KRU A;  5EKI A;  1Q1B A;  3I91 A;  5DNF A;  4C3H B;  1TWH B;  5E3F A;  2OEO A;  4KV6 A;  5JEA G;  2A6H C;  4G7O C;  4A3E B;  2RDG A;  4L63 B;  4BWG B;  2H4O A;  2ZT9 C;  3OMG A;  3PUX A;  5ELF A;  3I4L A;  1LTS D;  4MN3 A;  4FNF A;  3BVG A;  1S5F D;  3X3M A;  3SK8 A;  3MTS A;  4P2C B;  1JCK B;  2B39 A;  1SNC A;  5C0X H;  1EY6 A;  2B2V A;  1GUW A;  2JSO A;  5FK9 C;  2AQ1 B;  3HEJ A;  4KY6 A;  1SFO B;  2RQX A;  5IOD A;  1HA6 A;  1B9M A;  1B2T A;  1HFG A;  4PMB A;  1RCV D;  4C3I G;  4FYD A;  3I73 A;  2SDF A;  1TWG B;  2NTT A;  3VA7 A;  2LY7 A;  2F4I A;  1HQM C;  2E2H B;  5I6Y A;  1OXV A;  4Q0F A;  3S1R B;  3FRP B;  5ELE A;  1KLG D;  1BCP F;  4DAV A;  2WIN B;  3R8B A;  3E6Z X;  2F0T A;  1A3T A;  1Q8I A;  3M7G A;  2ZXR A;  1S5D D;  1TKW B;  2F03 A;  3HKZ B;  1V43 A;  5C44 B;  1MI2 A;  4CKB A;  5C3E B;  4K2L A;  4BS9 A;  2CQA A;  1H9M A;  4QIW B;  5A35 A;  5JAV A;  2E2D C;  1F9S A;  3J80 E;  1A6X A;  5AFW A;  2M9V A;  2X69 A;  2XWB B;  3HZX A;  4LK1 C;  1R9T B;  5CBE E;  3KK7 A;  3OOC A;  2PZT A;  4BBS B;  1FYC A;  4F87 A;  1SMY D;  4RWS C;  3P20 A;  3PMF A;  5LL6 S;  3TME A;  1EIH A;  5TSS A;  4ODG A;  2NVX B;  2K1B A;  2PNR C;  4C3H G;  3QOL A;  3I4N B;  1XTC D;  3PV0 A;  2B8F A;  3R3O A;  2EYF A;  4J8Q A;  3IFT A;  1PRT D;  3P75 A;  2E2J B;  2DY7 A;  5F2D A;  5CC4 A;  1C4Q A;  4HMI A;  1STA A;  4CHT B;  1LTR D;  3A8K E;  1DOK A;  2VNU D;  2A73 B;  3MFY A;  4GZY C;  2WP8 J;  3MWY W;  4RHR A;  3EFX D;  3BS1 A;  2F0N A;  3VR6 A;  1GUN A;  3BYY B;  5KGU A;  3X3N A;  3I3C A;  2A6E C;  1D2B A;  4XT1 B;  1Z6H A;  2IJ0 A;  1V1P B;  5C4Z A;  3S1Q B;  5M5X B;  3DMU A;  3L7Z C;  2BA0 A;  1JWS D;  1R4Q B;  1FD7 D;  3GTP B;  4X3S A;  1ENF A;  3DWA A;  1PTO B;  1PTO H;  1GXD C;  2D5D A;  2A74 C;  4ZUJ A;  2ID0 A;  4B9W A;  2RDH A;  1PFM A;  5C0X J;  1J9O A;  4U67 3;  3IAY A;  1QE6 A;  1QNK A;  3CKI B;  1KLU D;  1QIL A;  4LJZ C;  4KD4 A;  3C2P A;  3QOJ A;  1X3Q A;  2E75 C;  2ENB A;  3S15 B;  4KMU C;  5C4J B;  1QB5 D;  3I90 A;  1X3P A;  1LT5 D;  1ICW A;  5CV9 A;  3SVM A;  2F0S A;  5EPL A;  3S1N B;  1Y1V B;  2B2Y C;  1GUS A;  3IL8 A;  5IGF A;  4ZQ3 A;  3FPP A;  1I4G A;  2L5T A;  3TZU A;  1B1Z A;  3ERO A;  2DNE A;  4IZ8 A;  4NMZ A;  5IGD A;  1SE2 A;  2KOL A;  4A3M B;  4FVM A;  1HUM A;  2FFK B;  2K6A A;  3SK5 A;  3PIP 3;  3H91 A;  1I50 B;  5E1F A;  1JOQ A;  1EEF D;  4N9T A;  4ZRZ A;  4A3F B;  2L1B A;  4OIJ A;  3D31 A;  5C6A A;  3OSO A;  1D5M C;  1U4M A;  1A2U A;  4RFB A;  1B9N A;  3ONA B;  1D1K A;  3CHB D;  4RAU C;  2H1E A;  2LMC B;  1STB A;  1TS3 A;  1MD2 D;  2NTS A;  3WOF A;  1H9S A;  2XWJ B;  4N9P A;  3LWE A;  3RLF A;  1VF7 A;  2WAQ B;  1S5C D;  5KYL A;  1LT3 D;  4C3J B;  1F2Y A;  3FEW X;  4TQU S;  2NN6 I;  5I4D A;  1BOS A;  3DXJ C;  5DEH A;  3LNN A;  1HQR D;  2MP1 A;  1ET6 A;  2DNC A;  2K03 A;  3AB9 A;  5BN5 A;  1JOO A;  3HOV B;  4IUR A;  1CZW A;  2IX0 A;  1SSO A;  5BN4 A;  2KED A;  3MC0 B;  2QKI C;  1BCP B;  3NUC A;  1IKL A;  1G2S A;  3ZYY X;  5JPM C;  5D3D A;  2C5C A;  3DEO A;  3KF8 A;  2BOS A;  3N6R A;  1IL8 A;  5EPK A;  1SND A;  4XYO A;  4HSP A;  2K5Q A;  4KKT A;  4KI0 A;  1T5X D;  4PNY A;  4KK7 A;  4E6I A;  2HUG A;  3S1M B;  4R8N A;  2JA7 B;  3PO2 B;  3MA2 B;  5FLX L;  1B4O A;  1Y1W B;  1F9Q A;  5CV7 A;  1K8M A;  2QIL A;  3R2T A;  3SHL A;  5FO9 B;  1C8C A;  1YNN D;  4OO1 G;  4H7B A;  2PZW A;  4DXF A;  5JEA H;  3NE5 B;  4EQP A;  2VB2 X;  2D9U A;  1TY0 A;  5M3M B;  3PUV A;  4XIG S;  3U9S A;  3M4O B;  2SNM A;  1HA5 A;  1QOH A;  4HTH A;  4O42 A;  3T51 B;  4IUP A;  5LL6 X;  5M3F B;  2JXM B;  1B50 A;  4IFD H;  1ZKO A;  2F0U A;  4ME5 A;  4CKC A;  1PTO D;  1TWF B;  3N52 A;  1O7L A;  3OHX C;  1EFI D;  4KJN A;  2F0Q A;  1IYV A;  1SJH D;  4OL7 A;  1WTP A;  3FKI B;  4EVO A;  4IUV A;  1SNP A;  2B2W C;  3BVM A;  3R2I A;  4K6L A;  1VF5 C;  4FXG C;  2M00 A;  1M8A A;  1G2T A;  4C3J G;  3TP6 A;  5HGT A;  2MGS A;  2KHS A;  2K05 A;  1Z7T A;  1I4P A;  5KYI A;  4FO2 A;  3PO3 B;  1TU2 B;  5T1I A;  2GA4 B;  3K7A B;  4NW2 A;  2Q8I B;  1QNU A;  1SMY C;  3RZO B;  5C3W A;  1KAB A;  3IKJ A;  2A69 C;  3ITP A;  1PFN A;  3NQT A;  2BA1 A;  4QB4 A;  2IX1 A;  2L9H A;  5E4X A;  1PZK D;  1PRT C;  2VB3 X;  1JOR A;  1PLF A;  3GTK B;  1QG7 A;  1EY5 A;  3OIP A;  1CT1 D;  3BDO A;  5LHY 1;  4S3S A;  1WD0 A;  2F0V A;  1E2W A;  5FLX E;  3HOZ B;  3DUZ A;  1KNA A;  3NTH A;  4XQQ A;  4C1N I;  1H9S B;  2C9O A;  4PQX A;  1E2V A;  1STN A;  3NQI A;  3HRZ C;  1TT2 A;  3NWS A;  3MXN A;  3OWE B;  3CRK C;  1Y8O B;  4FXK C;  4RGN A;  1T5E A;  4BY1 B;  3C1E A;  1CK1 A;  3ND8 A;  5E4W C;  3RZD B;  3JAM E;  1I6H B;  2F0D A;  4QCL A;  1BQQ T;  4A3I B;  2EY6 A;  1AZQ A;  2WAC A;  2F0P A;  4IFD G;  1JE4 A;  1L0X B;  1FGB D;  2KJX A;  3KUP A;  5CGK A;  1GHK A;  3FPU B;  2F0M A;  1D6E C;  2K33 A;  1LV9 A;  3L9A X;  1O7Y A;  4RKL A;  1GUG A;  3C46 A;  1JOK A;  4L8J A;  1DJR D;  1BCP D;  2SOB A;  1SE4 A;  4QUF A;  2Z4I A;  4Q5V A;  3Q23 A;  3VR4 A;  4FXD A;  3J7A V;  3NBI A;  4IAL A;  3GD7 A;  4B9X A;  1CHQ D;  1LT4 D;  1EWC A;  2KVM A;  5I6W A;  3KLS X;  4G7H C;  3SK6 A;  1ENA A;  3P7J A;  4UDU C;  1WTX A;  3BYT B;  1F9R A;  2QDB A;  1RTN A;  1DD2 A;  4R9W A;  1LTA D;  4OO1 I;  1F2L A;  2QEJ C;  4HCS A;  4G7Z C;  2F3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...