5IGGA

Crystal structure of staphylococcal nuclease variant delta+phs v66h/i72e at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
130
structure length
130
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKEEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66H/I72E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5iggA00
4KD3A 2F0UA 3EROA 1SNCA 2OXPA 1STHA 5CV6A 1KAAA 1NSNS 2EYFA 5IGGA 3DMUA 1SYCA 1F2MA 1EY4A 1EY0A 1SNOA 3TP5A 4NMZA 1JOOA 2LKVA 5HURA 2F0VA 2PW7A 1EY9A 2HQEA 2F0DA 2OF1A 3MHBA 4NDXA 3EJIA 5J39A 2F0IA 1JOKA 3BDLA 5J22A 1F2ZA 3D6CA 4K5WA 4B9WA 4RKLA 4EQNA 1SNDA 2EYOA 3ERQA 4HTHA 4KD4A 4KJNA 4ZUJA 2F3VA 3D8GA 4N9PA 5CV9A 4NP5A 3OMCA 4R8NA 5IGCA 4IZ8A 1EQVA 2EY6A 2WACA 4H7BA 4K5XA 1A3UA 3HEJA 5E3FA 3TP8A 3V2TA 3BDCA 2F0LA 5EKLA 2RKSA 3D4WA 4WRDA 3T16A 5ISRA 2SNSA 1STGA 3E5SA 4RKBA 4YIJA 5IGBA 5IOCA 1EYCA 1EZ6A 2EY2A 1U9RA 2EYLA 2RDFA 4K2LA 5EKKA 5F2DA 5C5MA 5HGTA 5IGEA 3PMFA 3QB3A 4HMJA 4KV6A 1STNA 2EYJA 3DHQA 3C1EA 1A3TA 2PYKA 2PZUA 3QOLA 3R3OA 1SYDA 2EYHA 2F0WA 1A2UA 3OMGA 5JOBA 1EZ8A 4ME5A 3RUZA 3NP8A 4F8MA 4OL7A 2F0TA 5KIXA 5IGDA 5C4ZA 1EYAA 1STBA 1EY6A 1SNPA 1TT2A 3MXPA 3P1HA 4KY6A 4PMBA 2F0PA 4QF4A 3SK4A 2F0SA 1A3VA 2F0GA 5J1ZA 3NHHA 3SK5A 3C1FA 5CV4A 4HMIA 4J6HA 3T13A 3MZ5A 4ZUIA 5KGUA 4PMCA 5KRUA 2EY1A 4WORA 5DAUA 2EYPA 2O4XA 5I6YA 4G57A 4EQOA 4KTAA 4KY7A 1ENAA 2F3WA 3LX0A 2F0NA 3TP6A 4B9XA 5CC4A 4ZQ3A 5M9OA 1SNMA 3EVQA 5CV8A 4EVOA 5C4HA 2SOBA 5CV5A 5I9OA 1II3A 2NUCA 5IIFA 1F2YA 1SYFA 4K6DA 3NUCA 4NKLA 3SXHA 3TMEA 5K5PA 1EYDA 4QMGA 1TR5A 4K14A 3SK8A 1JOQA 3D4DA 3NXWA 2EYMA 3SK6A 3VA5A 3ITPA 5CR3A 1KDCA 2PZTA 3MEHA 3NQTA 5JAVA 5I6WA 3HZXA 3OWFA 4I65A 4TRDA 4E6IA 1ENCA 4DGZA 2F0JA 1KDBA 5NUCA 5CV7A 1KDAA 3QOJA 2KQ3A 4S3SA 3SHLA 5KYLA 5C5LA 1AEXA 1STYA 4LAAA 4MIUA 5C3XA 5KEEA 4DFAA 4PNYA 2F0FA 2EXZA 1EY7A 2RBMA 1RKNA 1SYBA 3NK9A 2EY5A 4J1MA 4K8JA 1EY8A 4KJOA 2F0HA 2OEOA 2PZWA 4KHVA 3SR1A 2M00A 1SYGA 2F0MA 5DEHA 2PW5A 4ODGA 5C3WA 1JORA 2F0OA 1IHZA 1NUCA 2SNMA 3P75A 4IALA 4IUNA 4K8IA 2QDBA 5C6AA 5KYIA 2F0KA 1EY5A 5I9PA 5CGKA 4DU9A 4F7XA 5IGFA 3S9WA 1SNQA 1KABA 3H6MA 4DF7A 5IODA 3MVVA 1A2TA 2PQEA 4KY5A 4QB4A 4N9TA 5E1FA 3U9OA 4EQPA 1TQOA 3OSOA 4ID6A 4K2KA 2F0QA 2F0EA 4K5VA 2ENBA 2KHSA 5EGTA 1STAA 3TP7A 1SYEA
chains in the Genus database with same CATH superfamily
1ML0D 1N32Q 1SYCA 1F2MA 3L2PA 3SVMA 1W3SA 4JI8Q 3GTGB 1RHPA 5HGQA 3EJIA 1O7ZA 4RCOA 4LJZC 3S16H 1PH2A 3A5ZB 3GTLB 3G7LA 3MWYW 2VUMB 3KF6B 4WFN3 5G3LF 4HN7A 1CSQA 1OXXK 3DXJC 4A3GG 1EYCA 1KQSA 4N8FA 5ELEA 3HOZG 2PMZE 1X65A 4X3KA 4JI7Q 1CQVA 3R3OA 2QGQA 2F52A 1WTPA 2PYKA 4L5RC 1LT3D 1MHWC 4GKKQ 3ND9A 4DV0Q 4DR2L 1HNZQ 1HZ9A 3C1FA 4YWLA 4ZUIA 1PDQA 4ZKCB 5I4DA 2B63G 2N3SA 2EYPA 1DJRD 1AE3A 1KTKA 4KTAA 4QCLA 2C9OA 1ENAA 5M9OA 1Q12A 4NXML 4ZLTF 2SOBA 5CV5A 2J4XA 2CWPA 2HDLA 1SYFA 5M3FH 2K7VA 3RZDH 2AHOB 1EYDA 1VQOA 3PO3G 2ZXPA 5CR3A 1F9PA 2K52A 2KJXA 1B44D 4BA1I 3MEHA 3KLSA 2VY3A 1YNND 3IRBA 1PRTC 3I8ZA 5C5LA 5IT9L 2MQHA 1IBML 4FF1A 2JA6G 3T56B 4RH6A 2EXZA 1S72A 3K7AH 1DXMA 4K8JA 2N88A 2NVXB 3S17H 2KHIA 4OHJA 3CPFA 4IALA 4JK1C 3GQBA 4YCVA 2K03A 1OXSC 4BWGB 4DU9A 4P2CB 4HSVA 3ERSX 1ZYRC 4A3MG 3FEWX 2H1EA 5E1FA 2G9DA 3BJUA 2Q8TA 4HIOA 1LUZA 2JA8B 1NJIC 4P75A 3J7A5 1BVSA 1XTDA 5EGTA 2LMCB 3TREA 5BR8L 1IKLA 3HOVB 4WJ4A 3V96A 3EROA 1M90C 4RHSA 2JXMB 5A2QE 3DWAA 4EX5A 2HD3A 3KYHC 1HNZL 1FJGQ 3HOUG 5COYA 1G291 3CP0A 1HJPA 4C3IB 4FYDA 4X6AH 4DR1Q 2I5MX 2EVBA 3K0YA 4LF6Q 5IGBA 4RMFA 3J81E 1Q82C 1KHIA 3S15B 1XMOL 1FNVA 2CQAA 5NUCA 3X3NA 2I46A 2BA0A 4K0KQ 3K6OA 1TWFH 4KI0A 1NY4A 3K5LA 1MGSA 1QILA 3CD6A 2TSSA 2MGSA 2ZXRA 5C0XG 4HAEA 4DV6Q 3K80C 1CQFA 1Q1EA 1HPCA 2WP8J 4R4TA 5D65A 1D2BA 1A63A 1SR3A 1TIID 4FO2A 4EVOA 4FP5D 4JVZA 1WTHA 4A3IG 4B3RL 1VCIA 4HR7B 1I4XA 3F1ZA 2B2WA 3S1MH 3D3RA 3NXWA 4ZYSA 1XYIA 4QIWB 2NVQH 2WAQE 3U58A 4JV5Q 1D1KA 3HZXA 3AU7A 1E1OA 4E6IA 3AYHB 2MJ8A 1D6EC 1IW7C 1N36Q 1AFPA 1EU3A 3SHLA 2BOSA 3KBXA 3UE1A 1RIPA 5E4XA 1HR0L 2H4OA 3M4QA 3CXCA 1EY7A 1R4QB 3I2ZA 4R1JA 3R8BA 2A19A 4ME3A 2KECA 4J1MA 4KHVA 3X3MA 4GNXC 4N8X1 2SNMA 4K8IA 3C2PA 2QDBA 3NTKA 3HKZB 5D3IB 1O7LA 1UE7A 2IWHA 1CA6A 5FO7B 4F7XA 2JA5H 4A3KH 4DF7A 1JJGA 1BBUA 2XGTA 1J8IA 4UY8C 2EIFA 2UXCQ 1WI5A 4DR1L 4LF6L 2F0EA 3J7AV 4DV1L 2RF4A 4K5VA 1D1IA 4LFAL 2A69D 4FXGC 3TDQA 1ZEQX 1G2TA 4KD3A 3J80c 3MA2B 2E2JH 3ULPA 3CCVA 1SJED 4LF7L 1VF7A 1V8QA 2IJ0A 2Q2TA 3HOYB 1XTCD 4DAMA 4LF5L 5EQ0A 4JI3Q 1JOKA 4LUVA 4YCWA 1SNDA 2EYOA 2SEBD 2F3VA 4B3SQ 2WV6D 4IZ8A 1EQVA 1K8AC 1RDPD 3PUWA 1QVGA 2SNSA 2Z8LA 2FINB 2EY2A 2KOLA 3HKSA 3K5NA 3RMHA 1MJCA 4Y7NB 1L1OA 1PTOH 3HOXH 5HY6A 3SGIA 2DNCA 1IYVA 2HHHL 4QF4A 3FHWA 3OPOA 4QL5A 3RLOA 4CGYB 1A3VA 3L7ZC 2ICIA 2YTYA 4R9WA 1TWHB 1HCZA 1I94Q 4H0LC 2Z4HA 3KLRA 3Q23A 1BNZA 3M9BA 4GS3A 2UU9Q 2RHSB 4X64Q 4G7HC 5CC4A 1PYBA 4CDFC 4A3FH 3KOJA 4FF2A 5CV8A 1JWMD 3W1GA 2KENA 1XNRL 2NUCA 1K73C 2NVTB 3TMEA 1YITA 3WOEA 4J15A 4C1NI 1EIFA 3AQQA 4ABNA 5M5WH 1D7QA 4OWWB 1UWVA 5A2QL 2E2HB 2R3ZA 2LS01 5C0XJ 1ICWA 1XXGA 4X66L 2D2CC 1V9PA 1JC7A 3PO2G 4JC0A 2QA4A 2A74C 1PRTD 2KHJA 1B1ZA 1D5MC 3OWEB 2F0OA 4IUUA 5IWAL 2V4DA 3P75A 4X3UA 4IURA 1E24A 1LTBD 3OTOQ 1VQEA 1L0XB 4B3SL 3CRLC 1Y69U 5LMNW 4GNXB 1ZYRD 2VQFL 3GO5A 3D4RA 4PZ7A 5DNFA 1BF4A 3I4MB 5FLMH 3J81j 4A3JH 4RGOS 4X65Q 2K14A 5K5PA 2YYZA 2LXKA 3FPUB 4CKEA 2UUAL 1GM5A 2ZJQA 2RA4A 3EIVA 4GLVB 2Q2HA 1VQKA 1JWUD 1PZJD 2O5JC 2RSOA 1B50A 2Q2IA 3AB9A 1R9TH 4CJ0B 1Q46A 1CHPD 4DV7Q 4ZRZA 1EQQA 5ELCA 3DEPA 5GAEC 2ZJRA 3O13A 3D8GA 5LMUQ 1WCMG 4DR4Q 2DGYA 3H0GG 2VW9A 3TP8A 1PH3A 1E22A 1JMCA 5CYUA 3MXNA 1EYGA 3P7JA 2XVSA 4RKBA 4JBWA 1U9RA 4F88A 4DUYL 4OO1G 1HNWQ 3ONAB 3S2HH 1OO9B 1SN8A 2XRQD 4HCEA 3OW2A 3BVZA 3K0XA 4C3HG 1VQLA 2F0TA 1G2SA 4XXEA 3P1HA 4ALPA 1EWCA 2R92G 1QG7A 1RTNA 5C0XH 5EBDA 1Y1VG 2EY1A 1Y1WH 5M3FB 2O5IC 3RZDB 1DOKA 2AQ1B 3E9HA 4OGQC 4C2MH 3PCOB 5GADC 1II3A 1GKHA 2MFIA 3I4MG 1GUOA 1TR5A 3G71A 4CJ2C 3S1QH 1VQIA 2VZAA 4B3TQ 4OIKA 3NELA 4DPGA 2BCOA 5C4XB 4C3JB 1WD0A 4FDBA 2XTIA 3PUVA 3FKIG 5IT9c 3S17B 3HOWG 5KYLA 4X65L 3PF4A 4DK1A 4A3DG 1I50B 1PA6A 4DNRB 1IW7D 3CCEA 2QKIC 4IOCA 1TS5A 4DV7L 1W6KA 1H9SA 4HIDA 2K5QA 3D31A 3H6MA 5LMUL 3BZCA 1WTWA 3K81C 1TQOA 3A7LA 2KA7A 3M4YA 1FL0A 2C5CA 2OCEA 4Y52H 4U673 1EEID 1L0YB 4O1NA 2EOTA 5IYCG 4DV4Q 1ONLA 3HKZE 3PF5A 2ENBA 1S40A 3TP7A 4QJFA 3GTKH 2E2DC 2IX3A 5FJ8H 1CSPA 4H13C 5CBAE 5ELOA 3BS1A 2E2IB 1EQTA 1X6OA 1Y8OB 2ES2A 1YJ9A 4YHHL 2OF1A 4GKJQ 1Y14B 1EFWA 2PNRC 3ERQA 3M4PA 1XX8A 2HIVA 5DLQE 3JAME 1TS2A 1K0SA 1VS0A 4CBVA 1PVOA 2AUJD 5JPNC 1NR4A 4GLAC 1SAPA 5FKAC 2RKSA 1IKMA 1STGA 4HEDA 3VR3A 2EYLA 1EZ6A 2B2UA 2FMCA 2VL6A 5CMDA 1SYDA 3M7NA 1A2UA 2PO4A 4GLXA 3PUXA 5JJZA 1HRJA 2F1MA 5LL6S 5C4ZA 3STBC 4EQ5A 1B4OA 3NTHA 4A93H 4A3EB 1XPRA 5JEAG 4IUVA 3RLNA 2CH4W 1YI2A 3EQLC 3SK5A 1W2BA 5C3EG 5DAUA 2O4XA 4V0BA 2KEEA 4G57A 4EQOA 3MEFA 3S1MB 3JAMi 2NVQB 5IYDG 1K0RA 3L3OC 4K6DA 3CAMA 4A75A 1JB7A 2A5HA 1H9RA 1S3OA 2EYMA 2KCNA 3I70A 3CMEA 5FLXL 3V05A 5CBEE 3NWTA 4TVAB 1IBLL 3OWFA 1E2ZA 3GTQH 5GAHC 2YTVA 4MHEA 3AFQA 4IJHA 1AEXA 3G6EA 4DR5L 3LWEA 2EJGC 3T4AC 4JBJA 1PH1A 4A3BH 3UI2A 2WAQB 4TKOB 2JA5B 1EY8A 2OEOA 2B8GA 4IFDJ 1QNKA 3G48A 5C3WA 3CC7A 4O2DA 2K05A 4UPAA 4R4QA 3I56A 1SDFA 1O7IA 1PZKD 2WINB 1RODA 2KCTA 2WKDA 4N9TA 1K3BC 3DUZA 3WWVA 4R4CA 4X3TA 5T1GA 1U4MA 1YJWA 5C44H 1SJHD 2HCIA 4LF4Q 2SDFA 3LWUA 3S2DH 5FO9B 2F0UA 4IPGA 1ASYA 2LSSA 3KF8B 1S5DD 2ZTDA 1BQQT 4KN7C 2RCNA 3TP5A 3PQIA 2HUGA 4PG3A 1QOHA 1MD2D 4AYBG 1BXTA 5JJIA 5J22A 4X62Q 4K5WA 1Q86C 1WTOA 5IYBG 4J8QA 3CCRA 4XTCS 3ZYYX 1Q90A 1BCPC 1LACA 1Z47A 1UE6A 3HEJA 3V2TA 3TS2A 4DA2A 1PTOB 3HOXB 2QDLA 1KNAA 1U4LA 1H9JA 3K59A 5EKKA 1X3PA 1SSOA 4HMJA 2PQAB 1VQNA 2JQOA 2EYHA 5BN4A 1QJOA 4UP7A 3NE5B 3VR4A 1SNPA 3A8KE 4DXGA 1GUSA 3ER0A 1U5KA 2QCPX 3NENA 4XQQA 3J7ZC 5LMNL 1EQRA 3MZ5A 4IUPA 4HJ9A 1JT8A 1VMPA 3IKJA 4GZYC 2F4VQ 4LF8L 1D5ZC 4IFDH 5I9OA 5M5WB 2Y0SG 1RTOA 1KXLA 5H1SE 4LFBQ 4M1UB 1KDCA 3FMCA 3U50C 5JEAJ 3I73A 4KLKA 2O2LD 1PV4A 5JPMC 3HOWH 1JWSD 2B8FA 2JA7H 2KQ3A 4L5SA 1RJTA 3LGJA 4A3DH 3JC66 1STYA 2XRSD 4ZK9B 4PQXA 4YCUA 4BBSH 4DV5Q 2RBMA 3VR6A 3JAML 4GOPA 3SR1A 3UDFA 5IP7H 2F0HA 1VQGA 3UDGA 2F0MA 2N78A 3MFGA 2N55A 4JI5Q 4JI6Q 4DV2Q 4IPDA 4X62L 4U68A 3I4NG 1WVLA 1QNUA 2E75C 4XT3B 3BG3A 3UE0A 1DM0B 3S9WA 4A3JB 4OIJA 4P74A 3VA7A 2Z6KC 2MP1A 3QG1A 1GUWA 4OEMB 3G6JB 2UXBQ 1R9TB 3AEVA 1N32L 1GJXA 5FOBB 4JI8L 1LT6D 2VUMG 1EIYB 4MTKA 1MSHA 4G7OC 2TMPA 1Q3LA 1TS4A 4LF9Q 2CKZB 4H44C 2F0IA 1LYLA 1Y8NB 2R93B 2F4VL 1PTOD 1CKMA 3MFYA 5DM63 1K8OA 3KLSX 1UUPA 3I7FA 4GOPB 3S2HB 1PFMA 3T16A 4JI4Q 1PLFA 4JI7L 3T1HQ 5EPJA 1STNA 1BCPB 2EYJA 3DHQA 3QOLA 1SEBD 2PZUA 3VYTA 4GKKL 2R6GA 4DV0L 1Y1WB 3GTPH 1NE3A 4OL7A 5C0XI 4OX9Q 5JEAH 1C7YA 4A3LG 3W5OA 1P16A 2NVYH 5J1ZA 5M3MH 1CK1A 5C3EH 4C2MB 4DR3Q 3S14B 3MXUA 4J6HA 1HTPA 1BUVT 3STBD 4XYOA 4DV5L 5IYDH 3KUPA 3S1QB 1I4GA 1TWCH 1ET6A 1HA5A 4JI5L 4IJLA 3SXHA 4DV2L 1HTLD 1K9MC 3H3VH 3QO2A 4RG1A 5M5YH 5GAGC 2R7DA 4MTNA 1ILPA 3CMAA 5I6WA 1XMQQ 2YU9H 2F0JA 1JJCB 1TWGB 2K1BA 1TWAH 1KDAA 3HP3A 1VMCA 4DAVA 2BA1A 3OHXC 2MNAA 2EQSA 1ICFB 4DFAA 2F0FA 3HS0C 3MC0B 2KUMA 3NK9A 3F2UA 2KCMA 4DAYA 1SYGA 3ULJA 2JA8G 2FHTA 4IUNA 3CCJA 1KAWA 5I9PA 2VB2X 3HOVG 5M5XB 1FGUA 5IGFA 3J81i 1B7YB 2B2VC 1BBXC 1LLRD 3VYSA 4QB4A 1QB5D 2B2TC 3GTKB 1SE4A 2NN6G 1KIXA 3TSSA 2IHEA 4JI4L 1DYQA 3A55A 2KHSA 3AMUA 2JK8A 1V1PA 3T1HL 4A3CH 4BXXG 1NSNS 3OW7A 2EYFA 1IL2A 3H94A 3DMUA 4LUZA 1EY0A 4C3IG 1PRTB 1MJEA 1DCZA 1I5FA 3KK7A 1G6PA 4DR3L 4JYAQ 1FJGL 1JQYD 2B2YC 1F2ZA 1A62A 4JI2Q 1X3GA 1A15A 2XIWA 4F87A 5CV9A 4DUZQ 1KD1C 4I7ZC 4R8NA 4QGUA 1P8LA 3K8AA 1E3PA 1I4QA 5E3FA 4P73A 4DAYB 3L9AX 4JCVE 1BCPD 4ULLA 1YNJD 4A93B 2OT2A 3E0JA 1QVFA 4KV6A 2BH2A 4FNFA 1MI2A 4DV3Q 2JA9A 2R7FA 3QR8A 2R61A 4K0KL 1EUJA 2RHQB 3NSWA 4PMBA 3CPWA 4JI0Q 3NHHA 1QCBD 4DV6L 3CC2A 2NTTA 3T1YQ 4KHZA 1V1PB 4FVMA 1Z6HA 4B9XA 1BKBA 1N33Q 1WFQA 4A3GH 4L6TB 2X6GA 2RDGA 3HOZH 1UE1A 1WYDA 3CF5A 4NKLA 1N34Q 3CW2C 2KBNA 3GTQB 3GTOH 5FLXc 1KL9A 3SK6A 4JV5L 4XQNA 3NQTA 5JAVA 3CCLA 1N36L 4A3BB 5ELNA 4UDUC 4O42A 4DGZA 1NCVA 1SE8A 1PYWD 3HKZG 4A4IA 2B63H 2R7ZB 4LAAA 3CQZH 1R4PB 4GNXA 3I3CA 4OXPA 4QUFA 3KDFA 3GTJH 1SYBA 2QEJC 3Q0AA 1FVIA 2CW0C 2J7ZA 4ODGA 1UAPA 3EA6A 1S5BD 5C6AA 5C4JH 4BY1B 3I4NH 3PO3H 5C44B 2FMMA 2EZVA 1V1OA 2QEXA 3ICEA 4DUZL 1A2TA 1VQFA 4OELB 2UXCL 2JEBI 4BBRB 4BY7B 2K32A 3TZUA 5JVG3 3NBIA 1NR2A 2LXJA 3HOYG 3M4OH 4UHVA 2JA6H 3E3XA 1AH9A 2ZXOA 1AP0A 4YWKA 2YTXA 3GTLH 1GHJA 2CH4A 2IW3A 2VUMH 2VNUD 1SMXA 1WOCA 4CDDC 2GVBA 3BYYB 2DY7A 3QJYA 1IBKQ 5HURA 2HQEA 1RF2D 4A3MH 4JI3L 4LFCQ 2L55A 3J81L 5FO8B 4N9PA 3I4OA 4KKTA 3SEBA 4NXNQ 4QUCA 2WACA 2WB1B 5J3BA 2CQOA 3KDFB 3OIPA 2XN9C 1B3AA 5LL6X 1K83H 3BZKA 4WRDA 1K28A 5IGEA 1I4HA 1HQMC 3Q6SA 2ZTEA 3QWNA 1IXRA 1GD7A 1JR0D 1FYCA 3S16B 3C1EA 2Q2UA 2F0WA 1DGSA 3H3VC 2A6HC 4Q5VA 4KY6A 2JYOA 1OXTA 3B6YA 3HOUH 1I94L 3F2CA 1G8ZD 4BY1G 1X54A 2FFKB 2UU9L 1S5ED 4X64L 2EPBA 4IFDI 1ILQA 4LMQD 4B08A 2ASBA 4DK6C 3BU2A 1PTOF 1GOZA 3R2TA 2IY5B 4QMGA 3RN2A 2JA7B 2NVXH 1AW7A 5K36G 3K5OA 4BBSB 4TRDA 2LFNA 2XWBB 3QOJA 1GUTA 4MZ9A 1EIHA 2P5ZX 2K04A 3ULLA 1LM0A 3BDOA 4PNYA 4IOAA 3JAMc 1J5EQ 3TS0A 4HIKA 1VQ5A 5D3DA 3E9IA 1LTRD 4YWMA 4A3IH 1IBKL 2NZHA 2ATWA 4LFCL 3I90A 1C8CA 3OTOL 1I3QH 1VQAA 1FNUA 1IYUA 4DK0A 4RGTA 2IPKD 1AN8A 4KY5A 2Z4IA 3IAYA 2NN6H 1X3EA 1CT1D 3T53B 3K7AB 3NPPA 4ID6A 3CCQA 2AQ3B 5BN3A 4UP9A 3E0EA 4BXXH 3VYUA 3M3YH 4FF4A 1EEFD 4DN4M 1F77A 1HUMA 4C3IH 1CZGA 1YEZA 1SNOA 3GTMH 4NMZA 3VR2A 1UNSA 2L5TA 2PW7A 2Z0SA 1V43A 1LTSD 3MHBA 4JOIC 1LTTD 4P72A 4KK7A 2Q8RE 4RKLA 3RZOH 1B70B 4DR4L 2OQ0A 2EXDA 5I2XA 3C3LA 1HZCA 4K5XA 2ZTCA 1KLGD 5EKLA 4PV1C 1WD1A 3GTPB 4R4OA 1HNWL 1HFGA 1G51A 2NVYB 3PMFA 5M3MB 5M3FG 4NB3A 2A68C 2UXDQ 2XNAC 3OMGA 2K4KA 2F0SA 4O0AA 1TWCB 4BA2I 1HQRD 2K6AA 5GROA 4WORA 1FNWA 3VR5A 1TS3A 3RR5A 5C4XG 1J9OA 5M5YB 4C3JG 2RDHA 3TQYA 3H3VI 3S1RH 1PFNA 5IIFA 3CRKC 1C48A 1I6VC 2D9UA 2YU9B 1TWFB 1EU4A 2E5LQ 1TWAB 4B3TL 2F4IA 2GA4B 2J0TD 4L5QA 2ZT9C 1BCPF 1LT4D 3AFPA 1IYJB 1PZID 1Q7YC 1SROA 4NW2A 3GD7A 2DUDA 5C3XA 2YV5A 5BN5A 5LHY1 3DWQA 4LK1C 1VQ4A 1RKNA 4KJOA 1JB3A 1CTMA 3KJPA 1QZGA 1F2LA 1IZ6A 1XJVA 2RQXA 3KF8A 4RWSC 4CHTB 3A8JE 5CGKA 2CW0D 3BVMA 1CZWA 1O80A 2VS1A 2Z9HA 4DV4L 1PH8A 2WIIB 1EOVA 4K2KA 1J6QA 4FXKC 1HR0W 3K7UC 1XNQQ 3PO2H 4HSPA 1KNEA 5FK9C 2PI2E 1BR9A 4P71A 1TVXA 1QWYA 3HFZB 1HNXQ 1IL8A 3DLLA 2HQLA 4A3KB 1EY4A 1VQDA 1K8MA 1MSGA 2AQ2B 1PH7A 5CORA 2F0VA 1TKWB 2E8GA 1VF5C 4GKJL 1ZXTA 2PQAA 4NDXA 1GUNA 4HTHA 2MHVA 1YIJA 2E2JB 1HH2P 5I2YA 4POFA 1NMGA 1BBWA 3CU7A 4A3EG 2NYZD 5IOCA 1X3FA 2A6EC 4H02A 4A76A 2E5LL 3EFXD 5HGTA 1YNXA 2WB1E 1M4VA 1BOSA 1F9RA 1KLUD 4ME5A 3K57A 1A8VA 1PRTF 4XIGS 1LTID 3I72A 4G4KA 4DR2Q 1TXYA 4A3GB 5CV4A 1WCMH 3T13A 3HOZB 3H0GH 1X3QA 4PMCA 3F8TA 1EWIA 1E2VA 4RCNA 3GTOB 1OXVA 2IHFA 4Q0FA 1EFID 3E6ZX 1NBWA 4OO1H 3RLFA 3A74A 3RD4A 3EN2A 3SK8A 2B63B 4C3HH 4OWXB 1PHJA 3HG9A 3VA5A 3CQZB 2WAQG 4HCSA 4RGNA 2JA5G 1Q8IA 1FGBD 1YBYA 1E7ZA 2R92H 2DNEA 1PMRA 4I65A 1LTAD 3GTJB 1XNQL 4QQBX 1KDBA 2A1AA 4A3FB 1Y1VH 5CV7A 4S3SA 4KKUA 1EOTA 1PH4A 1VQ8A 1HNXL 3K5MA 1IBMQ 5C4JB 3PO3B 3S1NH 1YHAA 1ASZA 3GP7A 2HIXA 1Q81C 4TQUS 3I4MH 3A5UA 1JORA 1U4PA 1PH5A 4XDXA 3A0JA 2D0PA 1B9MA 3M4OB 2JA6B 4WJWA 1WTQA 4X3SA 1E2WA 2L15A 1O78A 4AQYQ 3T51B 3FKIH 1YJNA 1U4RA 4LF4L 1W6JA 4I7AA 2NTSA 2JN4A 1Q8KA 1SYEA 2XSCA 4A3MB 5BR8Q 5EAYA 4ILWA 4PMWA 1STHA 1M8AA 1AZPA 2CVRA 1I6HH 4ZCKA 5TSSA 4RFBA 3HOXG 3J81c 2K28A 2F0DA 1LV9A 3BDLA 1K83B 4EQNA 5IYCH 4IN3A 4KN4C 3M7GA 4NP5A 3CHBD 1C9OA 3OIQA 1S5CD 5EBCA 3BDCA 3UDXA 2F0LA 3D4WA 1TY0A 4A3FG 3PUYA 1CM9A 4K2LA 5D14A 2I5LX 3TN2A 3HOUB 3PIO3 2B29A 1XMOQ 3BZDB 1STBA 3MAQA 1D5XC 2F0GA 2A68D 3KJOA 5C4XH 3WOFA 1BO0A 1VQHA 4KKSA 2AMCB 1Z9FA 1HXYD 2ZJPA 3P20A 4C3JH 1YHQA 2RSNA 2CWAA 3J7YW 2F0NA 2K5VA 1HZAA 1X32A 1E0BA 5C4HA 3TEHB 1KRSA 4K6LA 1C0AA 1I50H 3NUCA 4LFBL 1BDOA 4B3RQ 2AKWB 4CKBA 2AWNA 4AQYL 1STEA 1HHVA 1FD7D 3MXGA 3A7AB 2B2WC 4CDCC 1CKNA 1FR3A 4HJ8A 4TSSA 2MO0A 4A3IB 1JJ2A 4QY7A 1PFBA 4CJ1B 5FLMG 1I3QB 4A3JG 1HR0Q 4IPHA 2M00A 4JI6L 4LUOA 2NN6I 2Z6KA 2D62A 3DM3A 2WFWA 2KCCA 1SRUA 2K50A 3S24A 1S5FD 2PQEA 3TZDA 3M3YB 2LY7A 2E2IH 2UXBL 4GN4B 4XQJA 3R93A 4IQZA 1ZKOA 4MN3A 3GTMB 4DV1Q 3H15A 2VQEQ 4LFAQ 2R93G 1LT5D 2Z1CA 3RZOB 2RVLA 4LF7Q 2LKVA 2K5DA 5JJLA 4POGA 2CCZA 4LF9L 2L11A 1CKOA 1RD9D 5J39A 1CKNB 4C56C 2NZOA 4AYBE 3D6CA 4LF5Q 3U4VA 1G91A 3OMCA 4L5TA 3F2BA 2ALYB 1T5EA 4H7BA 1QUQA 2CHBD 4AH6A 3NTIA 1Y1WG 2MPMA 4NPSA 4A3EH 5GQOA 3ZJYC 2ZM6Q 5ISRA 2PNHA 2AWOA 2F3IA 3IFTA 3VDYA 3CC4A 2RDFA 1QE6A 1H9KA 4AIMA 1A3TA 2A6ED 4OX9L 4M8AA 5JOBA 3RUZA 3NP8A 2HT1A 1SE3A 2FJ2A 1EYAA 1EY6A 1X55A 2JEAI 1L1OC 2F0PA 3PIOA 5IYBH 1SFOH 2HHHQ 2PPBC 2I0QA 4HMIA 3S1RB 1GHKA 4XYQA 3GV3A 2KVMA 1Q1BA 1X56A 4KMUC 4KY7A 2F3WA 3IL8A 2BDOA 2WKCA 1LO5D 1Y8PB 4DNTB 2F03A 1XNRQ 2Y0SE 4DK3C 1TY2A 1N8RC 1JICA 2BDNA 4K14A 1JOQA 3VYRA 1B2TA 1XMQL 2NWGA 2PZTA 3K58A 4KHPQ 3CCMA 2L0CA 1LTLA 2PI2A 2OTJA 2IX0A 4C1NK 1QUQB 2G5DA 1CHQD 5KNBA 5KNCA 4HJ7A 1V1QA 2EDGA 2L9HA 2VQEL 4X66Q 1DONA 3A56A 1VQCA 1VQ9A 1MKHA 2PW5A 5FJ8G 2B2VA 5KYIA 2CFMA 2F0KA 3FPPA 1KRTA 4UP8A 1RCVD 5IWAQ 2B2TA 4ZKBB 3W1BA 3PO2B 3J7AF 1CFMA 1K3RA 1SNQA 3NBHA 1T9HA 2M9VA 1VDZA 1L0WA 1VQ7A 2VB3X 2GN5A 3RNUA 1MBYA 2F0QA 2ZM6L 3GDEA 2VQFQ 2L12A 4DNIA 3I91A 3PSIA 4DR6Q 4L63B 2UUAQ 5IGGA 2B2YA 1B8AA 1H9MA 3UDIA 4JYAL 3KLWA 1NNXA 1A6XA 2I5HA 1O7YA 4JI2L 1EL0A 1SMYC 4WJ3M 2X69A 4B9WA 4A93G 3S2DB 2GVAA 3A8IE 2DN8A 3GTGH 5JJKA 2EY6A 4DAPA 3OOCA 1B53A 1ET9A 3GV6A 2HCCA 2MO1A 4LNQA 1JE5A 3CCSA 3FVQA 3QIAA 4DV3L 3QB3A 4IUQA 4DUYQ 4FXDA 4KHPL 1WCMB 3NBHB 3H0GB 4B3MQ 1DOMA 5JVH3 4V190 4JI0L 1NAPA 3EBEA 1OXUA 2FXQA 1XPOA 1D8LA 5ELFA 3CCUA 4DXFA 3T1YL 5KGUA 4XT1B 1GO3E 2D0OA 5KRUA 2Q8IB 3J80E 2K5WA 3Q24A 4UAIA 1N33L 4GN3B 2NB0A 4OO1I 1EIGA 4C3HB 4A3BG 4ZQ3A 1L1OB 1U0LA 1I4PA 1N34L 2R7ZG 2R92B 1F2YA 1Y1VB 3W3AA 3R2IA 4A3LH 1ESFA 1PH6A 2N8NA 2E74C 3S1NB 1Z7TA 3SE0A 1GVPA 4RHRA 2G9HD 5KEEA 5AJ3Q 2DJGC 1YVCA 5C44G 3Q8DA 3CKIB 2BE5C 4DR6L 4RAUC 3FP9A 5L37A 4L8JA 3W2DA 3H91A 4BBRG 2EY5A 2M2LA 3J80i 4BY7G 5FLXE 5DEHA 4JPBW 5E4WC 1NUCA 3L0OA 3FKIB 2K5NA 3HOWB 1KC8C 4A3DB 2D5DA 5A35A 1UEBA 1WTRA 5G3LD 2C35B 1OTCA 2ICEC 3OSOA 2K33A 5IP9G 2UUBQ 1WTVA 4JBKA 2KEDA 1I6HB 4R4IA 2K5HA 1ENFA 1STAA 3LNNA 1AZQA 3C46A 3KFUA 2R93H 4LWCA 1SNCA 2QILA 2OXPA 2JA8H 4APVA 3URYA 1VQPA 2V1CC 4YY3Q 1QZHA 4B3ML 2BH8A 2WB1G 1JOOA 3HOVH 2DY8A 1VQ6A 4CDEC 4YHHQ 1GUGA 4Z9CB 2L1BA 4NXNL 4CKCA 2PMZB 3FDTA 1WTXA 3DEOA 1B9NA 1JCKB 5KNDA 3MTSA 5IGCA 5IE8A 5EJWA 1A3UA 3H09A 1N9WA 2VXWA 3S14H 3TBIB 4YIJA 3PUZA 4JG2A 5C5MA 3U9SA 1F9QA 5IY0A 4IFDG 1DD2A 3Q22A 3PIP3 1C4QA 2JP1A 2UUCQ 4MNOA 1A0IA 5KIXA 3NQIA 2B2UC 1SE2A 4DR7Q 5AFWA 1GXDC 4BS9A 5IGDA 3HGBA 3MXPA 3SK4A 5AJ3L 3S15H 2NBFA 5EPLA 1HUNA 2K01A 1M1KC 3MXNB 2JA7G 1AE2A 2EJMA 5I6YA 3BVGA 1LTGD 1B3QA 2I07B 4QIWE 1PFSA 4BBSG 1TWGH 1CA5A 4JI1Q 1SBBB 5IP7G 4HIMA 1UEAB 2A8VA 2DJFC 3ND8A 5C3EB 1YNNC 3N52A 3OYYA 3ITPA 3D0FA 1RL2A 2UUBL 1K8GA 4EGVA 1XPUA 1IBLQ 1VQJA 3D6WA 5M5XH 2OTLA 5ELDA 1VQMA 1J5EL 4LW1A 5E7NA 4DR5Q 3M85A 1MIUA 4YY3L 1SLJA 2QF7A 2JJQA 1VQBA 3NWSA 2JE6I 1PTOC 3DM1A 2Z6BA 1KABA 1PYSB 2H5XA 3MVVA 4PZ6A 1I4RA 2EE1A 4JBMA 1H95A 2IX1A 2N49A 3U4ZA 3TRZA 1PH9A 3J80L 1HZBA 5CV6A 1H9SB 1KAAA 2UUCL 4JOIA 3IFDA 4R8IA 4DR7L 3PGZA 3HRZC 2QW7A 1EY9A 2A73B 2EJFC 5IT9E 3WDNA 1CI3M 4G7ZC 4JW0A 2PCFB 2K75A 4KD4A 4KJNA 4ZAIA 4ZUJA 5M3MG 2MUYA 3HOYH 4RGMA 3FRPB 1SXTA 1SMYD 3I55A 4HJAA 4JI1L 2IL8A 3E5SA 4AYBB 5F2DA 2NZ1D 2UXDL 3RN5A 1SFOB 1YHBA 2XWJB 4IUTA 1EZ8A 1L2FA 4IPCA 2AUKA 1TT2A 4F8MA 3PV0A 3PIPA 1NMFA 4Y7NH 4GN5A 4IO9A 2L4NA 1S4ZA 1F9SA 1CUKA 1E1TA 2X6LA 5LMNQ 1X9NA 3A54A 3TP6A 3LX0A 4PZ8A 2JSOA 4LF8Q 1T5XD 1SNMA 3EVQA 1JE4A 2R7ZH 1HA6A 3BYTB 1TWHH 4RA8A 4FF3A 1NTGA 1G6ZA 5DM73 4OONA 1TU2B 4HJ5A 1WJJA 2E76C 1ESRA 3D4DA 3N6RA 4DKAC 2OQKA 3SDZA 2RCFA 2NVTH 4OWTB 1ENCA 4BY1H 2Y0SB 5ELBA 4MIUA 2A6HD 1UE5A 1XWEA 5EPKA 4BBRH 2ID0A 3KF6A 4BY7H 2E2HH 2HDMA 3I4LA 3G4SA 1QVCA 2B39A 2PZWA 4A3CG 1LABA 1IHZA 2BE5D 4NXMQ 5EKIA 4GOPC 1EY5A 5T1IA 2IT1A 1EWHA 3NEMA 3KBGA 1YZ6A 5K36H 2B3GA 5IODA 3F2DA 1HFNA 4EQPA 3U9OA 4A3KG 1DZ1A 5IP9H 2A69C 2OWOA 1PXUA 1YNJC 1DOLA 3DWPA 3I4NB
chains in the Genus database with same CATH topology
1ML0D 1SYCA 1F2MA 3SVMA 3GTGB 1RHPA 3EJIA 1O7ZA 4RCOA 4LJZC 3GTLB 3G7LA 3MWYW 2VUMB 4WFN3 5G3LF 4HN7A 1OXXK 3DXJC 1EYCA 5ELEA 4X3KA 1CQVA 3R3OA 1WTPA 2PYKA 1LT3D 3ND9A 3C1FA 4ZKCB 4ZUIA 1PDQA 5I4DA 2EYPA 1DJRD 1KTKA 4KTAA 4QCLA 2C9OA 1ENAA 5M9OA 1Q12A 4ZLTF 2SOBA 5CV5A 2J4XA 2HDLA 1SYFA 2K7VA 1EYDA 2ZXPA 5CR3A 1F9PA 2KJXA 1B44D 4BA1I 3MEHA 3KLSA 1YNND 1PRTC 3I8ZA 5C5LA 5IT9L 4FF1A 3T56B 4RH6A 2EXZA 4K8JA 1DXMA 2NVXB 2N88A 4OHJA 4IALA 4JK1C 3GQBA 2K03A 1OXSC 4BWGB 4DU9A 4P2CB 4HSVA 1ZYRC 3FEWX 2H1EA 5E1FA 2G9DA 2Q8TA 2JA8B 5EGTA 2LMCB 3HOVB 1IKLA 3V96A 3EROA 4RHSA 2JXMB 5A2QE 3DWAA 5COYA 1G291 4C3IB 4FYDA 2EVBA 3K0YA 5IGBA 3J81E 3S15B 1FNVA 2CQAA 5NUCA 3X3NA 2I46A 2BA0A 3K6OA 4KI0A 3K5LA 1MGSA 1QILA 2TSSA 2MGSA 2ZXRA 5C0XG 4HAEA 1CQFA 1Q1EA 1HPCA 2WP8J 5D65A 1D2BA 1TIID 4FO2A 4EVOA 4FP5D 1VCIA 4HR7B 1I4XA 2B2WA 3D3RA 3NXWA 4ZYSA 1XYIA 4QIWB 1D1KA 3HZXA 3AU7A 4E6IA 2MJ8A 1D6EC 1IW7C 1AFPA 1EU3A 3SHLA 2BOSA 3KBXA 5E4XA 2H4OA 1EY7A 1R4QB 3R8BA 2KECA 4J1MA 4KHVA 3X3MA 2SNMA 4K8IA 3C2PA 2QDBA 3NTKA 3HKZB 5D3IB 1O7LA 2IWHA 1CA6A 5FO7B 4F7XA 4DF7A 1J8IA 2F0EA 3J7AV 4K5VA 1D1IA 2A69D 4FXGC 3TDQA 1ZEQX 1G2TA 4KD3A 3MA2B 1SJED 1VF7A 1V8QA 2IJ0A 3HOYB 1XTCD 5EQ0A 1JOKA 1SNDA 2EYOA 2SEBD 2F3VA 2WV6D 4IZ8A 1EQVA 1RDPD 3PUWA 2SNSA 2Z8LA 2FINB 2EY2A 2KOLA 3K5NA 3RMHA 4Y7NB 1PTOH 2DNCA 1IYVA 4QF4A 3OPOA 4CGYB 1A3VA 3L7ZC 2ICIA 4R9WA 1TWHB 1HCZA 4H0LC 2Z4HA 3KLRA 3Q23A 1BNZA 4G7HC 5CC4A 4FF2A 5CV8A 1JWMD 2NUCA 2NVTB 3TMEA 3WOEA 4C1NI 4ABNA 5A2QL 2E2HB 2R3ZA 2LS01 5C0XJ 1ICWA 1XXGA 2D2CC 1JC7A 2A74C 1PRTD 1B1ZA 1D5MC 3OWEB 2F0OA 4IUUA 2V4DA 3P75A 4X3UA 4IURA 1LTBD 1L0XB 3CRLC 1Y69U 1ZYRD 3GO5A 3D4RA 5DNFA 1BF4A 3I4MB 4RGOS 5K5PA 2YYZA 3FPUB 4CKEA 2RA4A 1JWUD 1PZJD 2O5JC 2RSOA 1B50A 3AB9A 4CJ0B 1CHPD 4ZRZA 5ELCA 3DEPA 3O13A 3D8GA 3TP8A 5CYUA 3MXNA 3P7JA 2XVSA 4RKBA 4JBWA 1U9RA 4F88A 4OO1G 3ONAB 1OO9B 2XRQD 4HCEA 3BVZA 4C3HG 2F0TA 1G2SA 4XXEA 3P1HA 1EWCA 1QG7A 1RTNA 5C0XH 5EBDA 2EY1A 5M3FB 2O5IC 3RZDB 1DOKA 2AQ1B 4OGQC 1II3A 1GUOA 1TR5A 4CJ2C 4OIKA 5C4XB 2BCOA 4C3JB 1WD0A 3PUVA 3S17B 5KYLA 4DK1A 1I50B 4DNRB 1IW7D 2QKIC 1TS5A 1W6KA 1H9SA 2K5QA 3D31A 3H6MA 1WTWA 1TQOA 3A7LA 2KA7A 3M4YA 2C5CA 4U673 1EEID 1L0YB 4O1NA 2EOTA 1ONLA 2ENBA 3TP7A 2E2DC 2IX3A 4H13C 5CBAE 3BS1A 2E2IB 1EQTA 1Y8OB 2OF1A 2PNRC 3ERQA 1XX8A 3JAME 1TS2A 4CBVA 2AUJD 5JPNC 1NR4A 5FKAC 1SAPA 2RKSA 1IKMA 1STGA 4HEDA 3VR3A 2EYLA 1EZ6A 2B2UA 2FMCA 5CMDA 1SYDA 3M7NA 1A2UA 2PO4A 3PUXA 5JJZA 1HRJA 2F1MA 5C4ZA 5LL6S 1B4OA 3NTHA 4A3EB 5JEAG 4IUVA 3EQLC 3SK5A 5DAUA 2O4XA 4V0BA 2KEEA 4G57A 4EQOA 3S1MB 2NVQB 3L3OC 4K6DA 2A5HA 1H9RA 2EYMA 2KCNA 3I70A 5FLXL 3V05A 5CBEE 3NWTA 3OWFA 1E2ZA 4MHEA 1AEXA 3LWEA 2EJGC 3T4AC 3UI2A 2WAQB 4TKOB 2JA5B 1EY8A 2OEOA 2B8GA 4IFDJ 1QNKA 5C3WA 2K05A 1SDFA 1PZKD 2WINB 1RODA 2WKDA 4N9TA 3DUZA 4X3TA 5T1GA 1U4MA 1SJHD 2HCIA 2SDFA 3LWUA 5FO9B 2F0UA 1S5DD 1BQQT 4KN7C 3TP5A 2HUGA 1QOHA 1MD2D 1BXTA 5J22A 4K5WA 1WTOA 4J8QA 4XTCS 3ZYYX 1Q90A 1BCPC 1LACA 1Z47A 3HEJA 3V2TA 4DA2A 1PTOB 3HOXB 1KNAA 1U4LA 1H9JA 3K59A 5EKKA 1X3PA 1SSOA 4HMJA 2EYHA 5BN4A 1QJOA 3NE5B 3VR4A 1SNPA 3A8KE 4DXGA 1GUSA 2QCPX 4XQQA 3MZ5A 4IUPA 1VMPA 3IKJA 4GZYC 1D5ZC 4IFDH 5I9OA 5M5WB 1RTOA 4M1UB 1KDCA 3FMCA 5JEAJ 3I73A 2O2LD 5JPMC 1JWSD 2B8FA 2KQ3A 1RJTA 1STYA 2XRSD 4ZK9B 4PQXA 2RBMA 3VR6A 3JAML 3SR1A 2F0HA 2F0MA 3MFGA 2N55A 4U68A 1WVLA 1QNUA 2E75C 4XT3B 3BG3A 3S9WA 1DM0B 4A3JB 4OIJA 3VA7A 2MP1A 3QG1A 1GUWA 3G6JB 1R9TB 1GJXA 5FOBB 1LT6D 1MSHA 4G7OC 2TMPA 1Q3LA 1TS4A 4H44C 2F0IA 1Y8NB 2R93B 1PTOD 3MFYA 5DM63 1K8OA 3KLSX 1UUPA 3S2HB 1PFMA 3T16A 1PLFA 5EPJA 1STNA 1BCPB 2EYJA 3DHQA 3QOLA 1SEBD 2PZUA 3VYTA 2R6GA 1Y1WB 4OL7A 5C0XI 5JEAH 5J1ZA 1CK1A 4C2MB 3S14B 3MXUA 4J6HA 1HTPA 1BUVT 4XYOA 3KUPA 3S1QB 1I4GA 1ET6A 1HA5A 3SXHA 1HTLD 3QO2A 1ILPA 5I6WA 2F0JA 1TWGB 2K1BA 1KDAA 3HP3A 1VMCA 4DAVA 2BA1A 3OHXC 4DFAA 2F0FA 3HS0C 3MC0B 2KUMA 3NK9A 3F2UA 4DAYA 1SYGA 2FHTA 4IUNA 5I9PA 2VB2X 5M5XB 5IGFA 2B2VC 1BBXC 1LLRD 3VYSA 4QB4A 1QB5D 2B2TC 3GTKB 1SE4A 2NN6G 3TSSA 1DYQA 3A55A 2KHSA 3AMUA 1V1PA 1NSNS 3OW7A 2EYFA 3H94A 3DMUA 1EY0A 4C3IG 1PRTB 1DCZA 3KK7A 1JQYD 2B2YC 1F2ZA 1A15A 4F87A 2XIWA 5CV9A 4I7ZC 4R8NA 1I4QA 5E3FA 3L9AX 1BCPD 4ULLA 1YNJD 4A93B 2OT2A 3E0JA 4KV6A 4FNFA 1MI2A 2R61A 3NSWA 4PMBA 3NHHA 1QCBD 2NTTA 4KHZA 1V1PB 4FVMA 1Z6HA 4B9XA 4L6TB 2X6GA 2RDGA 4NKLA 3GTQB 3SK6A 4XQNA 3NQTA 5JAVA 4A3BB 4UDUC 4O42A 4DGZA 1NCVA 1PYWD 2R7ZB 4LAAA 1R4PB 3I3CA 4QUFA 1SYBA 2QEJC 3Q0AA 2CW0C 2J7ZA 4ODGA 1UAPA 3EA6A 1S5BD 5C6AA 4BY1B 5C44B 2FMMA 2EZVA 1V1OA 1A2TA 2JEBI 4BBRB 4BY7B 2K32A 3TZUA 5JVG3 3NBIA 1NR2A 2ZXOA 1AP0A 1GHJA 2IW3A 2VNUD 3BYYB 2DY7A 3QJYA 5HURA 2HQEA 1RF2D 2L55A 3J81L 5FO8B 4N9PA 4KKTA 3SEBA 4QUCA 2WACA 2WB1B 3OIPA 2XN9C 1B3AA 5LL6X 4WRDA 5IGEA 1I4HA 1HQMC 3Q6SA 3QWNA 3S16B 1JR0D 1FYCA 3C1EA 2F0WA 3H3VC 2A6HC 4Q5VA 4KY6A 2JYOA 1OXTA 1G8ZD 2FFKB 1S5ED 2EPBA 4IFDI 1ILQA 4LMQD 4B08A 1PTOF 1GOZA 3R2TA 4QMGA 2JA7B 1AW7A 5K36G 3K5OA 4BBSB 4TRDA 2LFNA 2XWBB 3QOJA 1GUTA 1EIHA 2K04A 3BDOA 4PNYA 5D3DA 1LTRD 3I90A 1C8CA 1FNUA 1IYUA 4DK0A 4RGTA 2IPKD 1AN8A 4KY5A 2Z4IA 3IAYA 2NN6H 1CT1D 3T53B 3K7AB 3NPPA 4ID6A 2AQ3B 5BN3A 3VYUA 4FF4A 1EEFD 4DN4M 1F77A 1HUMA 1CZGA 1SNOA 4NMZA 3VR2A 1UNSA 2L5TA 2PW7A 1V43A 1LTSD 3MHBA 1LTTD 4KK7A 2Q8RE 4RKLA 5I2XA 3C3LA 4K5XA 1KLGD 5EKLA 4PV1C 1WD1A 3GTPB 1HFGA 2NVYB 3PMFA 5M3MB 2A68C 2XNAC 3OMGA 2F0SA 1TWCB 4BA2I 1HQRD 2K6AA 4WORA 1FNWA 3VR5A 1TS3A 1J9OA 5M5YB 4C3JG 2RDHA 1PFNA 5IIFA 3CRKC 1C48A 1I6VC 2D9UA 2YU9B 1TWFB 1EU4A 1TWAB 2F4IA 2GA4B 2J0TD 2ZT9C 1BCPF 1LT4D 1PZID 4NW2A 3GD7A 5C3XA 5BN5A 5LHY1 3DWQA 4LK1C 1RKNA 4KJOA 1JB3A 1CTMA 1F2LA 2RQXA 3KF8A 4RWSC 4CHTB 3A8JE 5CGKA 2CW0D 3BVMA 1CZWA 1O80A 2WIIB 4K2KA 4FXKC 4HSPA 1KNEA 5FK9C 1BR9A 1TVXA 1QWYA 1IL8A 4A3KB 1EY4A 1K8MA 1MSGA 2AQ2B 5CORA 2F0VA 1TKWB 1VF5C 1ZXTA 4NDXA 1GUNA 4HTHA 2MHVA 2E2JB 5I2YA 3CU7A 2NYZD 5IOCA 2A6EC 3EFXD 5HGTA 1M4VA 1BOSA 1F9RA 1KLUD 4ME5A 3K57A 1PRTF 4XIGS 1LTID 3I72A 4G4KA 4A3GB 5CV4A 3T13A 3HOZB 1X3QA 4PMCA 1E2VA 4RCNA 3GTOB 1OXVA 4Q0FA 1EFID 3E6ZX 4OO1H 3RLFA 3RD4A 3SK8A 2B63B 3HG9A 3VA5A 3CQZB 4HCSA 4RGNA 1Q8IA 1FGBD 2DNEA 1PMRA 4I65A 1LTAD 3GTJB 1KDBA 4A3FB 5CV7A 4S3SA 4KKUA 1EOTA 3K5MA 5C4JB 3PO3B 3GP7A 4TQUS 1JORA 1U4PA 4XDXA 1B9MA 3M4OB 2JA6B 4WJWA 1WTQA 4X3SA 1E2WA 1O78A 3T51B 1U4RA 1W6JA 2NTSA 1SYEA 2XSCA 4A3MB 4ILWA 4PMWA 1STHA 1M8AA 1AZPA 2CVRA 5TSSA 4RFBA 2K28A 2F0DA 1LV9A 3BDLA 1K83B 4EQNA 4IN3A 4KN4C 3M7GA 4NP5A 3CHBD 3OIQA 1S5CD 5EBCA 3BDCA 2F0LA 3D4WA 1TY0A 3PUYA 1CM9A 4K2LA 5D14A 3TN2A 3HOUB 3PIO3 3BZDB 1STBA 3MAQA 1D5XC 2F0GA 2A68D 3WOFA 1BO0A 4KKSA 1HXYD 3P20A 2RSNA 3J7YW 2F0NA 1X32A 1E0BA 5C4HA 4K6LA 3NUCA 1BDOA 4CKBA 2AWNA 1STEA 1HHVA 1FD7D 3MXGA 3A7AB 2B2WC 1FR3A 4TSSA 4A3IB 1PFBA 4CJ1B 1I3QB 2M00A 2NN6I 2D62A 2KCCA 1S5FD 2PQEA 3TZDA 3M3YB 2LY7A 4XQJA 3R93A 4IQZA 1ZKOA 4MN3A 3GTMB 1LT5D 2Z1CA 3RZOB 2RVLA 2LKVA 2K5DA 2L11A 1RD9D 5J39A 4C56C 3D6CA 1G91A 3OMCA 1T5EA 4H7BA 2CHBD 3NTIA 2MPMA 5ISRA 2AWOA 3IFTA 2RDFA 1QE6A 1H9KA 1A3TA 2A6ED 4M8AA 5JOBA 3RUZA 3NP8A 1SE3A 2FJ2A 1EYAA 1EY6A 2JEAI 2F0PA 2PPBC 4HMIA 3S1RB 1GHKA 4XYQA 3GV3A 2KVMA 1Q1BA 4KMUC 4KY7A 2F3WA 3IL8A 2BDOA 2WKCA 1LO5D 1Y8PB 4DNTB 2F03A 1TY2A 1JICA 2BDNA 4K14A 1JOQA 3VYRA 1B2TA 2NWGA 2PZTA 3K58A 2L0CA 2IX0A 4C1NK 1CHQD 5KNBA 5KNCA 2EDGA 2L9HA 1DONA 3A56A 2PW5A 2B2VA 5KYIA 2F0KA 3FPPA 1RCVD 2B2TA 4ZKBB 3PO2B 3J7AF 1CFMA 1SNQA 3NBHA 2M9VA 1VDZA 2VB3X 1MBYA 2F0QA 2L12A 3I91A 4L63B 5IGGA 2B2YA 1H9MA 1A6XA 1O7YA 1EL0A 1SMYC 2X69A 4B9WA 3S2DB 3A8IE 2DN8A 2EY6A 4DAPA 3OOCA 1B53A 1ET9A 3GV6A 2HCCA 3FVQA 3QIAA 3QB3A 4IUQA 4FXDA 1WCMB 3H0GB 1DOMA 5JVH3 4V190 1NAPA 1OXUA 5ELFA 4DXFA 5KGUA 4XT1B 3J80E 5KRUA 2Q8IB 2K5WA 3Q24A 4UAIA 2NB0A 4OO1I 1EIGA 4C3HB 4ZQ3A 1I4PA 2R92B 1F2YA 1Y1VB 3W3AA 3R2IA 1ESFA 2E74C 3S1NB 1Z7TA 3SE0A 4RHRA 2G9HD 5KEEA 3CKIB 2BE5C 4RAUC 4L8JA 3W2DA 3H91A 2EY5A 2M2LA 5FLXE 5DEHA 5E4WC 1NUCA 3FKIB 3HOWB 4A3DB 2D5DA 5A35A 1WTRA 5G3LD 2ICEC 3OSOA 2K33A 1WTVA 2KEDA 1I6HB 1ENFA 1STAA 3LNNA 1AZQA 3C46A 1SNCA 2QILA 2OXPA 3URYA 1JOOA 2DY8A 1GUGA 4Z9CB 2L1BA 4CKCA 2PMZB 3FDTA 1WTXA 3DEOA 1B9NA 1JCKB 5KNDA 3MTSA 5IGCA 5EJWA 1A3UA 3H09A 2VXWA 3TBIB 4YIJA 3PUZA 3U9SA 5C5MA 1F9QA 4IFDG 1DD2A 3Q22A 3PIP3 1C4QA 2JP1A 5KIXA 3NQIA 2B2UC 1SE2A 5AFWA 1GXDC 4BS9A 5IGDA 3HGBA 3MXPA 3SK4A 2NBFA 5EPLA 1HUNA 2K01A 2EJMA 5I6YA 3BVGA 1LTGD 2I07B 1CA5A 1SBBB 1UEAB 3ND8A 5C3EB 1YNNC 3N52A 3ITPA 4EGVA 3D6WA 5ELDA 3M85A 2QF7A 3NWSA 2JE6I 1PTOC 3DM1A 1KABA 3MVVA 1I4RA 2EE1A 2IX1A 3J80L 5CV6A 1H9SB 1KAAA 3IFDA 4R8IA 3HRZC 1EY9A 2A73B 2EJFC 5IT9E 3WDNA 1CI3M 4G7ZC 2PCFB 4ZAIA 4KD4A 4KJNA 4ZUJA 2MUYA 4RGMA 3FRPB 1SXTA 1SMYD 2IL8A 3E5SA 4AYBB 5F2DA 2NZ1D 1SFOB 2XWJB 4IUTA 1EZ8A 2AUKA 1TT2A 4F8MA 3PV0A 2L4NA 1S4ZA 1F9SA 2X6LA 3A54A 3TP6A 3LX0A 2JSOA 1T5XD 1SNMA 3EVQA 1JE4A 1HA6A 3BYTB 4RA8A 4FF3A 1G6ZA 5DM73 1TU2B 2E76C 1ESRA 3D4DA 3N6RA 3SDZA 1ENCA 2Y0SB 5ELBA 4MIUA 2A6HD 1XWEA 5EPKA 2ID0A 2HDMA 3I4LA 2B39A 2PZWA 1LABA 1IHZA 2BE5D 5EKIA 1EY5A 5T1IA 2IT1A 1EWHA 3KBGA 5K36H 5IODA 1HFNA 4EQPA 3U9OA 1DZ1A 2A69C 1PXUA 1YNJC 1DOLA 3DWPA 3I4NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KD3 A;  2F0U A;  3ERO A;  1SNC A;  2OXP A;  1STH A;  5CV6 A;  1KAA A;  1NSN S;  2EYF A;  5IGG A;  3DMU A;  1SYC A;  1F2M A;  1EY4 A;  1EY0 A;  1SNO A;  3TP5 A;  4NMZ A;  1JOO A;  2LKV A;  5HUR A;  2F0V A;  2PW7 A;  1EY9 A;  2HQE A;  2F0D A;  2OF1 A;  3MHB A;  4NDX A;  3EJI A;  5J39 A;  2F0I A;  1JOK A;  3BDL A;  5J22 A;  1F2Z A;  3D6C A;  4K5W A;  4B9W A;  4RKL A;  4EQN A;  1SND A;  2EYO A;  3ERQ A;  4HTH A;  4KD4 A;  4KJN A;  4ZUJ A;  2F3V A;  3D8G A;  4N9P A;  5CV9 A;  4NP5 A;  3OMC A;  4R8N A;  5IGC A;  4IZ8 A;  1EQV A;  2EY6 A;  2WAC A;  4H7B A;  4K5X A;  1A3U A;  3HEJ A;  5E3F A;  3TP8 A;  3V2T A;  3BDC A;  2F0L A;  5EKL A;  2RKS A;  3D4W A;  4WRD A;  3T16 A;  5ISR A;  2SNS A;  1STG A;  3E5S A;  4RKB A;  4YIJ A;  5IGB A;  5IOC A;  1EYC A;  1EZ6 A;  2EY2 A;  1U9R A;  2EYL A;  2RDF A;  4K2L A;  5EKK A;  5F2D A;  5C5M A;  5HGT A;  5IGE A;  3PMF A;  3QB3 A;  4HMJ A;  4KV6 A;  1STN A;  2EYJ A;  3DHQ A;  3C1E A;  1A3T A;  2PYK A;  2PZU A;  3QOL A;  3R3O A;  1SYD A;  2EYH A;  2F0W A;  1A2U A;  3OMG A;  5JOB A;  1EZ8 A;  4ME5 A;  3RUZ A;  3NP8 A;  4F8M A;  4OL7 A;  2F0T A;  5KIX A;  5IGD A;  5C4Z A;  1EYA A;  1STB A;  1EY6 A;  1SNP A;  1TT2 A;  3MXP A;  3P1H A;  4KY6 A;  4PMB A;  2F0P A;  4QF4 A;  3SK4 A;  2F0S A;  1A3V A;  2F0G A;  5J1Z A;  3NHH A;  3SK5 A;  3C1F A;  5CV4 A;  4HMI A;  4J6H A;  3T13 A;  3MZ5 A;  4ZUI A;  5KGU A;  4PMC A;  5KRU A;  2EY1 A;  4WOR A;  5DAU A;  2EYP A;  2O4X A;  5I6Y A;  4G57 A;  4EQO A;  4KTA A;  4KY7 A;  1ENA A;  2F3W A;  3LX0 A;  2F0N A;  3TP6 A;  4B9X A;  5CC4 A;  4ZQ3 A;  5M9O A;  1SNM A;  3EVQ A;  5CV8 A;  4EVO A;  5C4H A;  2SOB A;  5CV5 A;  5I9O A;  1II3 A;  2NUC A;  5IIF A;  1F2Y A;  1SYF A;  4K6D A;  3NUC A;  4NKL A;  3SXH A;  3TME A;  5K5P A;  1EYD A;  4QMG A;  1TR5 A;  4K14 A;  3SK8 A;  1JOQ A;  3D4D A;  3NXW A;  2EYM A;  3SK6 A;  3VA5 A;  3ITP A;  5CR3 A;  1KDC A;  2PZT A;  3MEH A;  3NQT A;  5JAV A;  5I6W A;  3HZX A;  3OWF A;  4I65 A;  4TRD A;  4E6I A;  1ENC A;  4DGZ A;  2F0J A;  1KDB A;  5NUC A;  5CV7 A;  1KDA A;  3QOJ A;  2KQ3 A;  4S3S A;  3SHL A;  5KYL A;  5C5L A;  1AEX A;  1STY A;  4LAA A;  4MIU A;  5C3X A;  5KEE A;  4DFA A;  4PNY A;  2F0F A;  2EXZ A;  1EY7 A;  2RBM A;  1RKN A;  1SYB A;  3NK9 A;  2EY5 A;  4J1M A;  4K8J A;  1EY8 A;  4KJO A;  2F0H A;  2OEO A;  2PZW A;  4KHV A;  3SR1 A;  2M00 A;  1SYG A;  2F0M A;  5DEH A;  2PW5 A;  4ODG A;  5C3W A;  1JOR A;  2F0O A;  1IHZ A;  1NUC A;  2SNM A;  3P75 A;  4IAL A;  4IUN A;  4K8I A;  2QDB A;  5C6A A;  5KYI A;  2F0K A;  1EY5 A;  5I9P A;  5CGK A;  4DU9 A;  4F7X A;  5IGF A;  3S9W A;  1SNQ A;  1KAB A;  3H6M A;  4DF7 A;  5IOD A;  3MVV A;  1A2T A;  2PQE A;  4KY5 A;  4QB4 A;  4N9T A;  5E1F A;  3U9O A;  4EQP A;  1TQO A;  3OSO A;  4ID6 A;  4K2K A;  2F0Q A;  2F0E A;  4K5V A;  2ENB A;  2KHS A;  5EGT A;  1STA A;  3TP7 A;  1SYE A; 
#chains in the Genus database with same CATH topology
 1ML0 D;  1N32 Q;  1SYC A;  1F2M A;  3L2P A;  3SVM A;  1W3S A;  4JI8 Q;  3GTG B;  1RHP A;  5HGQ A;  3EJI A;  1O7Z A;  4RCO A;  4LJZ C;  3S16 H;  1PH2 A;  3A5Z B;  3GTL B;  3G7L A;  3MWY W;  2VUM B;  3KF6 B;  4WFN 3;  5G3L F;  4HN7 A;  1CSQ A;  1OXX K;  3DXJ C;  4A3G G;  1EYC A;  1KQS A;  4N8F A;  5ELE A;  3HOZ G;  2PMZ E;  1X65 A;  4X3K A;  4JI7 Q;  1CQV A;  3R3O A;  2QGQ A;  2F52 A;  1WTP A;  2PYK A;  4L5R C;  1LT3 D;  1MHW C;  4GKK Q;  3ND9 A;  4DV0 Q;  4DR2 L;  1HNZ Q;  1HZ9 A;  3C1F A;  4YWL A;  4ZUI A;  1PDQ A;  4ZKC B;  5I4D A;  2B63 G;  2N3S A;  2EYP A;  1DJR D;  1AE3 A;  1KTK A;  4KTA A;  4QCL A;  2C9O A;  1ENA A;  5M9O A;  1Q12 A;  4NXM L;  4ZLT F;  2SOB A;  5CV5 A;  2J4X A;  2CWP A;  2HDL A;  1SYF A;  5M3F H;  2K7V A;  3RZD H;  2AHO B;  1EYD A;  1VQO A;  3PO3 G;  2ZXP A;  5CR3 A;  1F9P A;  2K52 A;  2KJX A;  1B44 D;  4BA1 I;  3MEH A;  3KLS A;  2VY3 A;  1YNN D;  3IRB A;  1PRT C;  3I8Z A;  5C5L A;  5IT9 L;  2MQH A;  1IBM L;  4FF1 A;  2JA6 G;  3T56 B;  4RH6 A;  2EXZ A;  1S72 A;  3K7A H;  1DXM A;  4K8J A;  2N88 A;  2NVX B;  3S17 H;  2KHI A;  4OHJ A;  3CPF A;  4IAL A;  4JK1 C;  3GQB A;  4YCV A;  2K03 A;  1OXS C;  4BWG B;  4DU9 A;  4P2C B;  4HSV A;  3ERS X;  1ZYR C;  4A3M G;  3FEW X;  2H1E A;  5E1F A;  2G9D A;  3BJU A;  2Q8T A;  4HIO A;  1LUZ A;  2JA8 B;  1NJI C;  4P75 A;  3J7A 5;  1BVS A;  1XTD A;  5EGT A;  2LMC B;  3TRE A;  5BR8 L;  1IKL A;  3HOV B;  4WJ4 A;  3V96 A;  3ERO A;  1M90 C;  4RHS A;  2JXM B;  5A2Q E;  3DWA A;  4EX5 A;  2HD3 A;  3KYH C;  1HNZ L;  1FJG Q;  3HOU G;  5COY A;  1G29 1;  3CP0 A;  1HJP A;  4C3I B;  4FYD A;  4X6A H;  4DR1 Q;  2I5M X;  2EVB A;  3K0Y A;  4LF6 Q;  5IGB A;  4RMF A;  3J81 E;  1Q82 C;  1KHI A;  3S15 B;  1XMO L;  1FNV A;  2CQA A;  5NUC A;  3X3N A;  2I46 A;  2BA0 A;  4K0K Q;  3K6O A;  1TWF H;  4KI0 A;  1NY4 A;  3K5L A;  1MGS A;  1QIL A;  3CD6 A;  2TSS A;  2MGS A;  2ZXR A;  5C0X G;  4HAE A;  4DV6 Q;  3K80 C;  1CQF A;  1Q1E A;  1HPC A;  2WP8 J;  4R4T A;  5D65 A;  1D2B A;  1A63 A;  1SR3 A;  1TII D;  4FO2 A;  4EVO A;  4FP5 D;  4JVZ A;  1WTH A;  4A3I G;  4B3R L;  1VCI A;  4HR7 B;  1I4X A;  3F1Z A;  2B2W A;  3S1M H;  3D3R A;  3NXW A;  4ZYS A;  1XYI A;  4QIW B;  2NVQ H;  2WAQ E;  3U58 A;  4JV5 Q;  1D1K A;  3HZX A;  3AU7 A;  1E1O A;  4E6I A;  3AYH B;  2MJ8 A;  1D6E C;  1IW7 C;  1N36 Q;  1AFP A;  1EU3 A;  3SHL A;  2BOS A;  3KBX A;  3UE1 A;  1RIP A;  5E4X A;  1HR0 L;  2H4O A;  3M4Q A;  3CXC A;  1EY7 A;  1R4Q B;  3I2Z A;  4R1J A;  3R8B A;  2A19 A;  4ME3 A;  2KEC A;  4J1M A;  4KHV A;  3X3M A;  4GNX C;  4N8X 1;  2SNM A;  4K8I A;  3C2P A;  2QDB A;  3NTK A;  3HKZ B;  5D3I B;  1O7L A;  1UE7 A;  2IWH A;  1CA6 A;  5FO7 B;  4F7X A;  2JA5 H;  4A3K H;  4DF7 A;  1JJG A;  1BBU A;  2XGT A;  1J8I A;  4UY8 C;  2EIF A;  2UXC Q;  1WI5 A;  4DR1 L;  4LF6 L;  2F0E A;  3J7A V;  4DV1 L;  2RF4 A;  4K5V A;  1D1I A;  4LFA L;  2A69 D;  4FXG C;  3TDQ A;  1ZEQ X;  1G2T A;  4KD3 A;  3J80 c;  3MA2 B;  2E2J H;  3ULP A;  3CCV A;  1SJE D;  4LF7 L;  1VF7 A;  1V8Q A;  2IJ0 A;  2Q2T A;  3HOY B;  1XTC D;  4DAM A;  4LF5 L;  5EQ0 A;  4JI3 Q;  1JOK A;  4LUV A;  4YCW A;  1SND A;  2EYO A;  2SEB D;  2F3V A;  4B3S Q;  2WV6 D;  4IZ8 A;  1EQV A;  1K8A C;  1RDP D;  3PUW A;  1QVG A;  2SNS A;  2Z8L A;  2FIN B;  2EY2 A;  2KOL A;  3HKS A;  3K5N A;  3RMH A;  1MJC A;  4Y7N B;  1L1O A;  1PTO H;  3HOX H;  5HY6 A;  3SGI A;  2DNC A;  1IYV A;  2HHH L;  4QF4 A;  3FHW A;  3OPO A;  4QL5 A;  3RLO A;  4CGY B;  1A3V A;  3L7Z C;  2ICI A;  2YTY A;  4R9W A;  1TWH B;  1HCZ A;  1I94 Q;  4H0L C;  2Z4H A;  3KLR A;  3Q23 A;  1BNZ A;  3M9B A;  4GS3 A;  2UU9 Q;  2RHS B;  4X64 Q;  4G7H C;  5CC4 A;  1PYB A;  4CDF C;  4A3F H;  3KOJ A;  4FF2 A;  5CV8 A;  1JWM D;  3W1G A;  2KEN A;  1XNR L;  2NUC A;  1K73 C;  2NVT B;  3TME A;  1YIT A;  3WOE A;  4J15 A;  4C1N I;  1EIF A;  3AQQ A;  4ABN A;  5M5W H;  1D7Q A;  4OWW B;  1UWV A;  5A2Q L;  2E2H B;  2R3Z A;  2LS0 1;  5C0X J;  1ICW A;  1XXG A;  4X66 L;  2D2C C;  1V9P A;  1JC7 A;  3PO2 G;  4JC0 A;  2QA4 A;  2A74 C;  1PRT D;  2KHJ A;  1B1Z A;  1D5M C;  3OWE B;  2F0O A;  4IUU A;  5IWA L;  2V4D A;  3P75 A;  4X3U A;  4IUR A;  1E24 A;  1LTB D;  3OTO Q;  1VQE A;  1L0X B;  4B3S L;  3CRL C;  1Y69 U;  5LMN W;  4GNX B;  1ZYR D;  2VQF L;  3GO5 A;  3D4R A;  4PZ7 A;  5DNF A;  1BF4 A;  3I4M B;  5FLM H;  3J81 j;  4A3J H;  4RGO S;  4X65 Q;  2K14 A;  5K5P A;  2YYZ A;  2LXK A;  3FPU B;  4CKE A;  2UUA L;  1GM5 A;  2ZJQ A;  2RA4 A;  3EIV A;  4GLV B;  2Q2H A;  1VQK A;  1JWU D;  1PZJ D;  2O5J C;  2RSO A;  1B50 A;  2Q2I A;  3AB9 A;  1R9T H;  4CJ0 B;  1Q46 A;  1CHP D;  4DV7 Q;  4ZRZ A;  1EQQ A;  5ELC A;  3DEP A;  5GAE C;  2ZJR A;  3O13 A;  3D8G A;  5LMU Q;  1WCM G;  4DR4 Q;  2DGY A;  3H0G G;  2VW9 A;  3TP8 A;  1PH3 A;  1E22 A;  1JMC A;  5CYU A;  3MXN A;  1EYG A;  3P7J A;  2XVS A;  4RKB A;  4JBW A;  1U9R A;  4F88 A;  4DUY L;  4OO1 G;  1HNW Q;  3ONA B;  3S2H H;  1OO9 B;  1SN8 A;  2XRQ D;  4HCE A;  3OW2 A;  3BVZ A;  3K0X A;  4C3H G;  1VQL A;  2F0T A;  1G2S A;  4XXE A;  3P1H A;  4ALP A;  1EWC A;  2R92 G;  1QG7 A;  1RTN A;  5C0X H;  5EBD A;  1Y1V G;  2EY1 A;  1Y1W H;  5M3F B;  2O5I C;  3RZD B;  1DOK A;  2AQ1 B;  3E9H A;  4OGQ C;  4C2M H;  3PCO B;  5GAD C;  1II3 A;  1GKH A;  2MFI A;  3I4M G;  1GUO A;  1TR5 A;  3G71 A;  4CJ2 C;  3S1Q H;  1VQI A;  2VZA A;  4B3T Q;  4OIK A;  3NEL A;  4DPG A;  2BCO A;  5C4X B;  4C3J B;  1WD0 A;  4FDB A;  2XTI A;  3PUV A;  3FKI G;  5IT9 c;  3S17 B;  3HOW G;  5KYL A;  4X65 L;  3PF4 A;  4DK1 A;  4A3D G;  1I50 B;  1PA6 A;  4DNR B;  1IW7 D;  3CCE A;  2QKI C;  4IOC A;  1TS5 A;  4DV7 L;  1W6K A;  1H9S A;  4HID A;  2K5Q A;  3D31 A;  3H6M A;  5LMU L;  3BZC A;  1WTW A;  3K81 C;  1TQO A;  3A7L A;  2KA7 A;  3M4Y A;  1FL0 A;  2C5C A;  2OCE A;  4Y52 H;  4U67 3;  1EEI D;  1L0Y B;  4O1N A;  2EOT A;  5IYC G;  4DV4 Q;  1ONL A;  3HKZ E;  3PF5 A;  2ENB A;  1S40 A;  3TP7 A;  4QJF A;  3GTK H;  2E2D C;  2IX3 A;  5FJ8 H;  1CSP A;  4H13 C;  5CBA E;  5ELO A;  3BS1 A;  2E2I B;  1EQT A;  1X6O A;  1Y8O B;  2ES2 A;  1YJ9 A;  4YHH L;  2OF1 A;  4GKJ Q;  1Y14 B;  1EFW A;  2PNR C;  3ERQ A;  3M4P A;  1XX8 A;  2HIV A;  5DLQ E;  3JAM E;  1TS2 A;  1K0S A;  1VS0 A;  4CBV A;  1PVO A;  2AUJ D;  5JPN C;  1NR4 A;  4GLA C;  1SAP A;  5FKA C;  2RKS A;  1IKM A;  1STG A;  4HED A;  3VR3 A;  2EYL A;  1EZ6 A;  2B2U A;  2FMC A;  2VL6 A;  5CMD A;  1SYD A;  3M7N A;  1A2U A;  2PO4 A;  4GLX A;  3PUX A;  5JJZ A;  1HRJ A;  2F1M A;  5LL6 S;  5C4Z A;  3STB C;  4EQ5 A;  1B4O A;  3NTH A;  4A93 H;  4A3E B;  1XPR A;  5JEA G;  4IUV A;  3RLN A;  2CH4 W;  1YI2 A;  3EQL C;  3SK5 A;  1W2B A;  5C3E G;  5DAU A;  2O4X A;  4V0B A;  2KEE A;  4G57 A;  4EQO A;  3MEF A;  3S1M B;  3JAM i;  2NVQ B;  5IYD G;  1K0R A;  3L3O C;  4K6D A;  3CAM A;  4A75 A;  1JB7 A;  2A5H A;  1H9R A;  1S3O A;  2EYM A;  2KCN A;  3I70 A;  3CME A;  5FLX L;  3V05 A;  5CBE E;  3NWT A;  4TVA B;  1IBL L;  3OWF A;  1E2Z A;  3GTQ H;  5GAH C;  2YTV A;  4MHE A;  3AFQ A;  4IJH A;  1AEX A;  3G6E A;  4DR5 L;  3LWE A;  2EJG C;  3T4A C;  4JBJ A;  1PH1 A;  4A3B H;  3UI2 A;  2WAQ B;  4TKO B;  2JA5 B;  1EY8 A;  2OEO A;  2B8G A;  4IFD J;  1QNK A;  3G48 A;  5C3W A;  3CC7 A;  4O2D A;  2K05 A;  4UPA A;  4R4Q A;  3I56 A;  1SDF A;  1O7I A;  1PZK D;  2WIN B;  1ROD A;  2KCT A;  2WKD A;  4N9T A;  1K3B C;  3DUZ A;  3WWV A;  4R4C A;  4X3T A;  5T1G A;  1U4M A;  1YJW A;  5C44 H;  1SJH D;  2HCI A;  4LF4 Q;  2SDF A;  3LWU A;  3S2D H;  5FO9 B;  2F0U A;  4IPG A;  1ASY A;  2LSS A;  3KF8 B;  1S5D D;  2ZTD A;  1BQQ T;  4KN7 C;  2RCN A;  3TP5 A;  3PQI A;  2HUG A;  4PG3 A;  1QOH A;  1MD2 D;  4AYB G;  1BXT A;  5JJI A;  5J22 A;  4X62 Q;  4K5W A;  1Q86 C;  1WTO A;  5IYB G;  4J8Q A;  3CCR A;  4XTC S;  3ZYY X;  1Q90 A;  1BCP C;  1LAC A;  1Z47 A;  1UE6 A;  3HEJ A;  3V2T A;  3TS2 A;  4DA2 A;  1PTO B;  3HOX B;  2QDL A;  1KNA A;  1U4L A;  1H9J A;  3K59 A;  5EKK A;  1X3P A;  1SSO A;  4HMJ A;  2PQA B;  1VQN A;  2JQO A;  2EYH A;  5BN4 A;  1QJO A;  4UP7 A;  3NE5 B;  3VR4 A;  1SNP A;  3A8K E;  4DXG A;  1GUS A;  3ER0 A;  1U5K A;  2QCP X;  3NEN A;  4XQQ A;  3J7Z C;  5LMN L;  1EQR A;  3MZ5 A;  4IUP A;  4HJ9 A;  1JT8 A;  1VMP A;  3IKJ A;  4GZY C;  2F4V Q;  4LF8 L;  1D5Z C;  4IFD H;  5I9O A;  5M5W B;  2Y0S G;  1RTO A;  1KXL A;  5H1S E;  4LFB Q;  4M1U B;  1KDC A;  3FMC A;  3U50 C;  5JEA J;  3I73 A;  4KLK A;  2O2L D;  1PV4 A;  5JPM C;  3HOW H;  1JWS D;  2B8F A;  2JA7 H;  2KQ3 A;  4L5S A;  1RJT A;  3LGJ A;  4A3D H;  3JC6 6;  1STY A;  2XRS D;  4ZK9 B;  4PQX A;  4YCU A;  4BBS H;  4DV5 Q;  2RBM A;  3VR6 A;  3JAM L;  4GOP A;  3SR1 A;  3UDF A;  5IP7 H;  2F0H A;  1VQG A;  3UDG A;  2F0M A;  2N78 A;  3MFG A;  2N55 A;  4JI5 Q;  4JI6 Q;  4DV2 Q;  4IPD A;  4X62 L;  4U68 A;  3I4N G;  1WVL A;  1QNU A;  2E75 C;  4XT3 B;  3BG3 A;  3UE0 A;  1DM0 B;  3S9W A;  4A3J B;  4OIJ A;  4P74 A;  3VA7 A;  2Z6K C;  2MP1 A;  3QG1 A;  1GUW A;  4OEM B;  3G6J B;  2UXB Q;  1R9T B;  3AEV A;  1N32 L;  1GJX A;  5FOB B;  4JI8 L;  1LT6 D;  2VUM G;  1EIY B;  4MTK A;  1MSH A;  4G7O C;  2TMP A;  1Q3L A;  1TS4 A;  4LF9 Q;  2CKZ B;  4H44 C;  2F0I A;  1LYL A;  1Y8N B;  2R93 B;  2F4V L;  1PTO D;  1CKM A;  3MFY A;  5DM6 3;  1K8O A;  3KLS X;  1UUP A;  3I7F A;  4GOP B;  3S2H B;  1PFM A;  3T16 A;  4JI4 Q;  1PLF A;  4JI7 L;  3T1H Q;  5EPJ A;  1STN A;  1BCP B;  2EYJ A;  3DHQ A;  3QOL A;  1SEB D;  2PZU A;  3VYT A;  4GKK L;  2R6G A;  4DV0 L;  1Y1W B;  3GTP H;  1NE3 A;  4OL7 A;  5C0X I;  4OX9 Q;  5JEA H;  1C7Y A;  4A3L G;  3W5O A;  1P16 A;  2NVY H;  5J1Z A;  5M3M H;  1CK1 A;  5C3E H;  4C2M B;  4DR3 Q;  3S14 B;  3MXU A;  4J6H A;  1HTP A;  1BUV T;  3STB D;  4XYO A;  4DV5 L;  5IYD H;  3KUP A;  3S1Q B;  1I4G A;  1TWC H;  1ET6 A;  1HA5 A;  4JI5 L;  4IJL A;  3SXH A;  4DV2 L;  1HTL D;  1K9M C;  3H3V H;  3QO2 A;  4RG1 A;  5M5Y H;  5GAG C;  2R7D A;  4MTN A;  1ILP A;  3CMA A;  5I6W A;  1XMQ Q;  2YU9 H;  2F0J A;  1JJC B;  1TWG B;  2K1B A;  1TWA H;  1KDA A;  3HP3 A;  1VMC A;  4DAV A;  2BA1 A;  3OHX C;  2MNA A;  2EQS A;  1ICF B;  4DFA A;  2F0F A;  3HS0 C;  3MC0 B;  2KUM A;  3NK9 A;  3F2U A;  2KCM A;  4DAY A;  1SYG A;  3ULJ A;  2JA8 G;  2FHT A;  4IUN A;  3CCJ A;  1KAW A;  5I9P A;  2VB2 X;  3HOV G;  5M5X B;  1FGU A;  5IGF A;  3J81 i;  1B7Y B;  2B2V C;  1BBX C;  1LLR D;  3VYS A;  4QB4 A;  1QB5 D;  2B2T C;  3GTK B;  1SE4 A;  2NN6 G;  1KIX A;  3TSS A;  2IHE A;  4JI4 L;  1DYQ A;  3A55 A;  2KHS A;  3AMU A;  2JK8 A;  1V1P A;  3T1H L;  4A3C H;  4BXX G;  1NSN S;  3OW7 A;  2EYF A;  1IL2 A;  3H94 A;  3DMU A;  4LUZ A;  1EY0 A;  4C3I G;  1PRT B;  1MJE A;  1DCZ A;  1I5F A;  3KK7 A;  1G6P A;  4DR3 L;  4JYA Q;  1FJG L;  1JQY D;  2B2Y C;  1F2Z A;  1A62 A;  4JI2 Q;  1X3G A;  1A15 A;  2XIW A;  4F87 A;  5CV9 A;  4DUZ Q;  1KD1 C;  4I7Z C;  4R8N A;  4QGU A;  1P8L A;  3K8A A;  1E3P A;  1I4Q A;  5E3F A;  4P73 A;  4DAY B;  3L9A X;  4JCV E;  1BCP D;  4ULL A;  1YNJ D;  4A93 B;  2OT2 A;  3E0J A;  1QVF A;  4KV6 A;  2BH2 A;  4FNF A;  1MI2 A;  4DV3 Q;  2JA9 A;  2R7F A;  3QR8 A;  2R61 A;  4K0K L;  1EUJ A;  2RHQ B;  3NSW A;  4PMB A;  3CPW A;  4JI0 Q;  3NHH A;  1QCB D;  4DV6 L;  3CC2 A;  2NTT A;  3T1Y Q;  4KHZ A;  1V1P B;  4FVM A;  1Z6H A;  4B9X A;  1BKB A;  1N33 Q;  1WFQ A;  4A3G H;  4L6T B;  2X6G A;  2RDG A;  3HOZ H;  1UE1 A;  1WYD A;  3CF5 A;  4NKL A;  1N34 Q;  3CW2 C;  2KBN A;  3GTQ B;  3GTO H;  5FLX c;  1KL9 A;  3SK6 A;  4JV5 L;  4XQN A;  3NQT A;  5JAV A;  3CCL A;  1N36 L;  4A3B B;  5ELN A;  4UDU C;  4O42 A;  4DGZ A;  1NCV A;  1SE8 A;  1PYW D;  3HKZ G;  4A4I A;  2B63 H;  2R7Z B;  4LAA A;  3CQZ H;  1R4P B;  4GNX A;  3I3C A;  4OXP A;  4QUF A;  3KDF A;  3GTJ H;  1SYB A;  2QEJ C;  3Q0A A;  1FVI A;  2CW0 C;  2J7Z A;  4ODG A;  1UAP A;  3EA6 A;  1S5B D;  5C6A A;  5C4J H;  4BY1 B;  3I4N H;  3PO3 H;  5C44 B;  2FMM A;  2EZV A;  1V1O A;  2QEX A;  3ICE A;  4DUZ L;  1A2T A;  1VQF A;  4OEL B;  2UXC L;  2JEB I;  4BBR B;  4BY7 B;  2K32 A;  3TZU A;  5JVG 3;  3NBI A;  1NR2 A;  2LXJ A;  3HOY G;  3M4O H;  4UHV A;  2JA6 H;  3E3X A;  1AH9 A;  2ZXO A;  1AP0 A;  4YWK A;  2YTX A;  3GTL H;  1GHJ A;  2CH4 A;  2IW3 A;  2VUM H;  2VNU D;  1SMX A;  1WOC A;  4CDD C;  2GVB A;  3BYY B;  2DY7 A;  3QJY A;  1IBK Q;  5HUR A;  2HQE A;  1RF2 D;  4A3M H;  4JI3 L;  4LFC Q;  2L55 A;  3J81 L;  5FO8 B;  4N9P A;  3I4O A;  4KKT A;  3SEB A;  4NXN Q;  4QUC A;  2WAC A;  2WB1 B;  5J3B A;  2CQO A;  3KDF B;  3OIP A;  2XN9 C;  1B3A A;  5LL6 X;  1K83 H;  3BZK A;  4WRD A;  1K28 A;  5IGE A;  1I4H A;  1HQM C;  3Q6S A;  2ZTE A;  3QWN A;  1IXR A;  1GD7 A;  1JR0 D;  1FYC A;  3S16 B;  3C1E A;  2Q2U A;  2F0W A;  1DGS A;  3H3V C;  2A6H C;  4Q5V A;  4KY6 A;  2JYO A;  1OXT A;  3B6Y A;  3HOU H;  1I94 L;  3F2C A;  1G8Z D;  4BY1 G;  1X54 A;  2FFK B;  2UU9 L;  1S5E D;  4X64 L;  2EPB A;  4IFD I;  1ILQ A;  4LMQ D;  4B08 A;  2ASB A;  4DK6 C;  3BU2 A;  1PTO F;  1GOZ A;  3R2T A;  2IY5 B;  4QMG A;  3RN2 A;  2JA7 B;  2NVX H;  1AW7 A;  5K36 G;  3K5O A;  4BBS B;  4TRD A;  2LFN A;  2XWB B;  3QOJ A;  1GUT A;  4MZ9 A;  1EIH A;  2P5Z X;  2K04 A;  3ULL A;  1LM0 A;  3BDO A;  4PNY A;  4IOA A;  3JAM c;  1J5E Q;  3TS0 A;  4HIK A;  1VQ5 A;  5D3D A;  3E9I A;  1LTR D;  4YWM A;  4A3I H;  1IBK L;  2NZH A;  2ATW A;  4LFC L;  3I90 A;  1C8C A;  3OTO L;  1I3Q H;  1VQA A;  1FNU A;  1IYU A;  4DK0 A;  4RGT A;  2IPK D;  1AN8 A;  4KY5 A;  2Z4I A;  3IAY A;  2NN6 H;  1X3E A;  1CT1 D;  3T53 B;  3K7A B;  3NPP A;  4ID6 A;  3CCQ A;  2AQ3 B;  5BN3 A;  4UP9 A;  3E0E A;  4BXX H;  3VYU A;  3M3Y H;  4FF4 A;  1EEF D;  4DN4 M;  1F77 A;  1HUM A;  4C3I H;  1CZG A;  1YEZ A;  1SNO A;  3GTM H;  4NMZ A;  3VR2 A;  1UNS A;  2L5T A;  2PW7 A;  2Z0S A;  1V43 A;  1LTS D;  3MHB A;  4JOI C;  1LTT D;  4P72 A;  4KK7 A;  2Q8R E;  4RKL A;  3RZO H;  1B70 B;  4DR4 L;  2OQ0 A;  2EXD A;  5I2X A;  3C3L A;  1HZC A;  4K5X A;  2ZTC A;  1KLG D;  5EKL A;  4PV1 C;  1WD1 A;  3GTP B;  4R4O A;  1HNW L;  1HFG A;  1G51 A;  2NVY B;  3PMF A;  5M3M B;  5M3F G;  4NB3 A;  2A68 C;  2UXD Q;  2XNA C;  3OMG A;  2K4K A;  2F0S A;  4O0A A;  1TWC B;  4BA2 I;  1HQR D;  2K6A A;  5GRO A;  4WOR A;  1FNW A;  3VR5 A;  1TS3 A;  3RR5 A;  5C4X G;  1J9O A;  5M5Y B;  4C3J G;  2RDH A;  3TQY A;  3H3V I;  3S1R H;  1PFN A;  5IIF A;  3CRK C;  1C48 A;  1I6V C;  2D9U A;  2YU9 B;  1TWF B;  1EU4 A;  2E5L Q;  1TWA B;  4B3T L;  2F4I A;  2GA4 B;  2J0T D;  4L5Q A;  2ZT9 C;  1BCP F;  1LT4 D;  3AFP A;  1IYJ B;  1PZI D;  1Q7Y C;  1SRO A;  4NW2 A;  3GD7 A;  2DUD A;  5C3X A;  2YV5 A;  5BN5 A;  5LHY 1;  3DWQ A;  4LK1 C;  1VQ4 A;  1RKN A;  4KJO A;  1JB3 A;  1CTM A;  3KJP A;  1QZG A;  1F2L A;  1IZ6 A;  1XJV A;  2RQX A;  3KF8 A;  4RWS C;  4CHT B;  3A8J E;  5CGK A;  2CW0 D;  3BVM A;  1CZW A;  1O80 A;  2VS1 A;  2Z9H A;  4DV4 L;  1PH8 A;  2WII B;  1EOV A;  4K2K A;  1J6Q A;  4FXK C;  1HR0 W;  3K7U C;  1XNQ Q;  3PO2 H;  4HSP A;  1KNE A;  5FK9 C;  2PI2 E;  1BR9 A;  4P71 A;  1TVX A;  1QWY A;  3HFZ B;  1HNX Q;  1IL8 A;  3DLL A;  2HQL A;  4A3K B;  1EY4 A;  1VQD A;  1K8M A;  1MSG A;  2AQ2 B;  1PH7 A;  5COR A;  2F0V A;  1TKW B;  2E8G A;  1VF5 C;  4GKJ L;  1ZXT A;  2PQA A;  4NDX A;  1GUN A;  4HTH A;  2MHV A;  1YIJ A;  2E2J B;  1HH2 P;  5I2Y A;  4POF A;  1NMG A;  1BBW A;  3CU7 A;  4A3E G;  2NYZ D;  5IOC A;  1X3F A;  2A6E C;  4H02 A;  4A76 A;  2E5L L;  3EFX D;  5HGT A;  1YNX A;  2WB1 E;  1M4V A;  1BOS A;  1F9R A;  1KLU D;  4ME5 A;  3K57 A;  1A8V A;  1PRT F;  4XIG S;  1LTI D;  3I72 A;  4G4K A;  4DR2 Q;  1TXY A;  4A3G B;  5CV4 A;  1WCM H;  3T13 A;  3HOZ B;  3H0G H;  1X3Q A;  4PMC A;  3F8T A;  1EWI A;  1E2V A;  4RCN A;  3GTO B;  1OXV A;  2IHF A;  4Q0F A;  1EFI D;  3E6Z X;  1NBW A;  4OO1 H;  3RLF A;  3A74 A;  3RD4 A;  3EN2 A;  3SK8 A;  2B63 B;  4C3H H;  4OWX B;  1PHJ A;  3HG9 A;  3VA5 A;  3CQZ B;  2WAQ G;  4HCS A;  4RGN A;  2JA5 G;  1Q8I A;  1FGB D;  1YBY A;  1E7Z A;  2R92 H;  2DNE A;  1PMR A;  4I65 A;  1LTA D;  3GTJ B;  1XNQ L;  4QQB X;  1KDB A;  2A1A A;  4A3F B;  1Y1V H;  5CV7 A;  4S3S A;  4KKU A;  1EOT A;  1PH4 A;  1VQ8 A;  1HNX L;  3K5M A;  1IBM Q;  5C4J B;  3PO3 B;  3S1N H;  1YHA A;  1ASZ A;  3GP7 A;  2HIX A;  1Q81 C;  4TQU S;  3I4M H;  3A5U A;  1JOR A;  1U4P A;  1PH5 A;  4XDX A;  3A0J A;  2D0P A;  1B9M A;  3M4O B;  2JA6 B;  4WJW A;  1WTQ A;  4X3S A;  1E2W A;  2L15 A;  1O78 A;  4AQY Q;  3T51 B;  3FKI H;  1YJN A;  1U4R A;  4LF4 L;  1W6J A;  4I7A A;  2NTS A;  2JN4 A;  1Q8K A;  1SYE A;  2XSC A;  4A3M B;  5BR8 Q;  5EAY A;  4ILW A;  4PMW A;  1STH A;  1M8A A;  1AZP A;  2CVR A;  1I6H H;  4ZCK A;  5TSS A;  4RFB A;  3HOX G;  3J81 c;  2K28 A;  2F0D A;  1LV9 A;  3BDL A;  1K83 B;  4EQN A;  5IYC H;  4IN3 A;  4KN4 C;  3M7G A;  4NP5 A;  3CHB D;  1C9O A;  3OIQ A;  1S5C D;  5EBC A;  3BDC A;  3UDX A;  2F0L A;  3D4W A;  1TY0 A;  4A3F G;  3PUY A;  1CM9 A;  4K2L A;  5D14 A;  2I5L X;  3TN2 A;  3HOU B;  3PIO 3;  2B29 A;  1XMO Q;  3BZD B;  1STB A;  3MAQ A;  1D5X C;  2F0G A;  2A68 D;  3KJO A;  5C4X H;  3WOF A;  1BO0 A;  1VQH A;  4KKS A;  2AMC B;  1Z9F A;  1HXY D;  2ZJP A;  3P20 A;  4C3J H;  1YHQ A;  2RSN A;  2CWA A;  3J7Y W;  2F0N A;  2K5V A;  1HZA A;  1X32 A;  1E0B A;  5C4H A;  3TEH B;  1KRS A;  4K6L A;  1C0A A;  1I50 H;  3NUC A;  4LFB L;  1BDO A;  4B3R Q;  2AKW B;  4CKB A;  2AWN A;  4AQY L;  1STE A;  1HHV A;  1FD7 D;  3MXG A;  3A7A B;  2B2W C;  4CDC C;  1CKN A;  1FR3 A;  4HJ8 A;  4TSS A;  2MO0 A;  4A3I B;  1JJ2 A;  4QY7 A;  1PFB A;  4CJ1 B;  5FLM G;  1I3Q B;  4A3J G;  1HR0 Q;  4IPH A;  2M00 A;  4JI6 L;  4LUO A;  2NN6 I;  2Z6K A;  2D62 A;  3DM3 A;  2WFW A;  2KCC A;  1SRU A;  2K50 A;  3S24 A;  1S5F D;  2PQE A;  3TZD A;  3M3Y B;  2LY7 A;  2E2I H;  2UXB L;  4GN4 B;  4XQJ A;  3R93 A;  4IQZ A;  1ZKO A;  4MN3 A;  3GTM B;  4DV1 Q;  3H15 A;  2VQE Q;  4LFA Q;  2R93 G;  1LT5 D;  2Z1C A;  3RZO B;  2RVL A;  4LF7 Q;  2LKV A;  2K5D A;  5JJL A;  4POG A;  2CCZ A;  4LF9 L;  2L11 A;  1CKO A;  1RD9 D;  5J39 A;  1CKN B;  4C56 C;  2NZO A;  4AYB E;  3D6C A;  4LF5 Q;  3U4V A;  1G91 A;  3OMC A;  4L5T A;  3F2B A;  2ALY B;  1T5E A;  4H7B A;  1QUQ A;  2CHB D;  4AH6 A;  3NTI A;  1Y1W G;  2MPM A;  4NPS A;  4A3E H;  5GQO A;  3ZJY C;  2ZM6 Q;  5ISR A;  2PNH A;  2AWO A;  2F3I A;  3IFT A;  3VDY A;  3CC4 A;  2RDF A;  1QE6 A;  1H9K A;  4AIM A;  1A3T A;  2A6E D;  4OX9 L;  4M8A A;  5JOB A;  3RUZ A;  3NP8 A;  2HT1 A;  1SE3 A;  2FJ2 A;  1EYA A;  1EY6 A;  1X55 A;  2JEA I;  1L1O C;  2F0P A;  3PIO A;  5IYB H;  1SFO H;  2HHH Q;  2PPB C;  2I0Q A;  4HMI A;  3S1R B;  1GHK A;  4XYQ A;  3GV3 A;  2KVM A;  1Q1B A;  1X56 A;  4KMU C;  4KY7 A;  2F3W A;  3IL8 A;  2BDO A;  2WKC A;  1LO5 D;  1Y8P B;  4DNT B;  2F03 A;  1XNR Q;  2Y0S E;  4DK3 C;  1TY2 A;  1N8R C;  1JIC A;  2BDN A;  4K14 A;  1JOQ A;  3VYR A;  1B2T A;  1XMQ L;  2NWG A;  2PZT A;  3K58 A;  4KHP Q;  3CCM A;  2L0C A;  1LTL A;  2PI2 A;  2OTJ A;  2IX0 A;  4C1N K;  1QUQ B;  2G5D A;  1CHQ D;  5KNB A;  5KNC A;  4HJ7 A;  1V1Q A;  2EDG A;  2L9H A;  2VQE L;  4X66 Q;  1DON A;  3A56 A;  1VQC A;  1VQ9 A;  1MKH A;  2PW5 A;  5FJ8 G;  2B2V A;  5KYI A;  2CFM A;  2F0K A;  3FPP A;  1KRT A;  4UP8 A;  1RCV D;  5IWA Q;  2B2T A;  4ZKB B;  3W1B A;  3PO2 B;  3J7A F;  1CFM A;  1K3R A;  1SNQ A;  3NBH A;  1T9H A;  2M9V A;  1VDZ A;  1L0W A;  1VQ7 A;  2VB3 X;  2GN5 A;  3RNU A;  1MBY A;  2F0Q A;  2ZM6 L;  3GDE A;  2VQF Q;  2L12 A;  4DNI A;  3I91 A;  3PSI A;  4DR6 Q;  4L63 B;  2UUA Q;  5IGG A;  2B2Y A;  1B8A A;  1H9M A;  3UDI A;  4JYA L;  3KLW A;  1NNX A;  1A6X A;  2I5H A;  1O7Y A;  4JI2 L;  1EL0 A;  1SMY C;  4WJ3 M;  2X69 A;  4B9W A;  4A93 G;  3S2D B;  2GVA A;  3A8I E;  2DN8 A;  3GTG H;  5JJK A;  2EY6 A;  4DAP A;  3OOC A;  1B53 A;  1ET9 A;  3GV6 A;  2HCC A;  2MO1 A;  4LNQ A;  1JE5 A;  3CCS A;  3FVQ A;  3QIA A;  4DV3 L;  3QB3 A;  4IUQ A;  4DUY Q;  4FXD A;  4KHP L;  1WCM B;  3NBH B;  3H0G B;  4B3M Q;  1DOM A;  5JVH 3;  4V19 0;  4JI0 L;  1NAP A;  3EBE A;  1OXU A;  2FXQ A;  1XPO A;  1D8L A;  5ELF A;  3CCU A;  4DXF A;  3T1Y L;  5KGU A;  4XT1 B;  1GO3 E;  2D0O A;  5KRU A;  2Q8I B;  3J80 E;  2K5W A;  3Q24 A;  4UAI A;  1N33 L;  4GN3 B;  2NB0 A;  4OO1 I;  1EIG A;  4C3H B;  4A3B G;  4ZQ3 A;  1L1O B;  1U0L A;  1I4P A;  1N34 L;  2R7Z G;  2R92 B;  1F2Y A;  1Y1V B;  3W3A A;  3R2I A;  4A3L H;  1ESF A;  1PH6 A;  2N8N A;  2E74 C;  3S1N B;  1Z7T A;  3SE0 A;  1GVP A;  4RHR A;  2G9H D;  5KEE A;  5AJ3 Q;  2DJG C;  1YVC A;  5C44 G;  3Q8D A;  3CKI B;  2BE5 C;  4DR6 L;  4RAU C;  3FP9 A;  5L37 A;  4L8J A;  3W2D A;  3H91 A;  4BBR G;  2EY5 A;  2M2L A;  3J80 i;  4BY7 G;  5FLX E;  5DEH A;  4JPB W;  5E4W C;  1NUC A;  3L0O A;  3FKI B;  2K5N A;  3HOW B;  1KC8 C;  4A3D B;  2D5D A;  5A35 A;  1UEB A;  1WTR A;  5G3L D;  2C35 B;  1OTC A;  2ICE C;  3OSO A;  2K33 A;  5IP9 G;  2UUB Q;  1WTV A;  4JBK A;  2KED A;  1I6H B;  4R4I A;  2K5H A;  1ENF A;  1STA A;  3LNN A;  1AZQ A;  3C46 A;  3KFU A;  2R93 H;  4LWC A;  1SNC A;  2QIL A;  2OXP A;  2JA8 H;  4APV A;  3URY A;  1VQP A;  2V1C C;  4YY3 Q;  1QZH A;  4B3M L;  2BH8 A;  2WB1 G;  1JOO A;  3HOV H;  2DY8 A;  1VQ6 A;  4CDE C;  4YHH Q;  1GUG A;  4Z9C B;  2L1B A;  4NXN L;  4CKC A;  2PMZ B;  3FDT A;  1WTX A;  3DEO A;  1B9N A;  1JCK B;  5KND A;  3MTS A;  5IGC A;  5IE8 A;  5EJW A;  1A3U A;  3H09 A;  1N9W A;  2VXW A;  3S14 H;  3TBI B;  4YIJ A;  3PUZ A;  4JG2 A;  5C5M A;  3U9S A;  1F9Q A;  5IY0 A;  4IFD G;  1DD2 A;  3Q22 A;  3PIP 3;  1C4Q A;  2JP1 A;  2UUC Q;  4MNO A;  1A0I A;  5KIX A;  3NQI A;  2B2U C;  1SE2 A;  4DR7 Q;  5AFW A;  1GXD C;  4BS9 A;  5IGD A;  3HGB A;  3MXP A;  3SK4 A;  5AJ3 L;  3S15 H;  2NBF A;  5EPL A;  1HUN A;  2K01 A;  1M1K C;  3MXN B;  2JA7 G;  1AE2 A;  2EJM A;  5I6Y A;  3BVG A;  1LTG D;  1B3Q A;  2I07 B;  4QIW E;  1PFS A;  4BBS G;  1TWG H;  1CA5 A;  4JI1 Q;  1SBB B;  5IP7 G;  4HIM A;  1UEA B;  2A8V A;  2DJF C;  3ND8 A;  5C3E B;  1YNN C;  3N52 A;  3OYY A;  3ITP A;  3D0F A;  1RL2 A;  2UUB L;  1K8G A;  4EGV A;  1XPU A;  1IBL Q;  1VQJ A;  3D6W A;  5M5X H;  2OTL A;  5ELD A;  1VQM A;  1J5E L;  4LW1 A;  5E7N A;  4DR5 Q;  3M85 A;  1MIU A;  4YY3 L;  1SLJ A;  2QF7 A;  2JJQ A;  1VQB A;  3NWS A;  2JE6 I;  1PTO C;  3DM1 A;  2Z6B A;  1KAB A;  1PYS B;  2H5X A;  3MVV A;  4PZ6 A;  1I4R A;  2EE1 A;  4JBM A;  1H95 A;  2IX1 A;  2N49 A;  3U4Z A;  3TRZ A;  1PH9 A;  3J80 L;  1HZB A;  5CV6 A;  1H9S B;  1KAA A;  2UUC L;  4JOI A;  3IFD A;  4R8I A;  4DR7 L;  3PGZ A;  3HRZ C;  2QW7 A;  1EY9 A;  2A73 B;  2EJF C;  5IT9 E;  3WDN A;  1CI3 M;  4G7Z C;  4JW0 A;  2PCF B;  2K75 A;  4KD4 A;  4KJN A;  4ZAI A;  4ZUJ A;  5M3M G;  2MUY A;  3HOY H;  4RGM A;  3FRP B;  1SXT A;  1SMY D;  3I55 A;  4HJA A;  4JI1 L;  2IL8 A;  3E5S A;  4AYB B;  5F2D A;  2NZ1 D;  2UXD L;  3RN5 A;  1SFO B;  1YHB A;  2XWJ B;  4IUT A;  1EZ8 A;  1L2F A;  4IPC A;  2AUK A;  1TT2 A;  4F8M A;  3PV0 A;  3PIP A;  1NMF A;  4Y7N H;  4GN5 A;  4IO9 A;  2L4N A;  1S4Z A;  1F9S A;  1CUK A;  1E1T A;  2X6L A;  5LMN Q;  1X9N A;  3A54 A;  3TP6 A;  3LX0 A;  4PZ8 A;  2JSO A;  4LF8 Q;  1T5X D;  1SNM A;  3EVQ A;  1JE4 A;  2R7Z H;  1HA6 A;  3BYT B;  1TWH H;  4RA8 A;  4FF3 A;  1NTG A;  1G6Z A;  5DM7 3;  4OON A;  1TU2 B;  4HJ5 A;  1WJJ A;  2E76 C;  1ESR A;  3D4D A;  3N6R A;  4DKA C;  2OQK A;  3SDZ A;  2RCF A;  2NVT H;  4OWT B;  1ENC A;  4BY1 H;  2Y0S B;  5ELB A;  4MIU A;  2A6H D;  1UE5 A;  1XWE A;  5EPK A;  4BBR H;  2ID0 A;  3KF6 A;  4BY7 H;  2E2H H;  2HDM A;  3I4L A;  3G4S A;  1QVC A;  2B39 A;  2PZW A;  4A3C G;  1LAB A;  1IHZ A;  2BE5 D;  4NXM Q;  5EKI A;  4GOP C;  1EY5 A;  5T1I A;  2IT1 A;  1EWH A;  3NEM A;  3KBG A;  1YZ6 A;  5K36 H;  2B3G A;  5IOD A;  3F2D A;  1HFN A;  4EQP A;  3U9O A;  4A3K G;  1DZ1 A;  5IP9 H;  2A69 C;  2OWO A;  1PXU A;  1YNJ C;  1DOL A;  3DWP A;  3I4N B; 
#chains in the Genus database with same CATH homology
 1ML0 D;  1SYC A;  1F2M A;  3SVM A;  3GTG B;  1RHP A;  3EJI A;  1O7Z A;  4RCO A;  4LJZ C;  3GTL B;  3G7L A;  3MWY W;  2VUM B;  4WFN 3;  5G3L F;  4HN7 A;  1OXX K;  3DXJ C;  1EYC A;  5ELE A;  4X3K A;  1CQV A;  3R3O A;  1WTP A;  2PYK A;  1LT3 D;  3ND9 A;  3C1F A;  4ZKC B;  4ZUI A;  1PDQ A;  5I4D A;  2EYP A;  1DJR D;  1KTK A;  4KTA A;  4QCL A;  2C9O A;  1ENA A;  5M9O A;  1Q12 A;  4ZLT F;  2SOB A;  5CV5 A;  2J4X A;  2HDL A;  1SYF A;  2K7V A;  1EYD A;  2ZXP A;  5CR3 A;  1F9P A;  2KJX A;  1B44 D;  4BA1 I;  3MEH A;  3KLS A;  1YNN D;  1PRT C;  3I8Z A;  5C5L A;  5IT9 L;  4FF1 A;  3T56 B;  4RH6 A;  2EXZ A;  4K8J A;  1DXM A;  2NVX B;  2N88 A;  4OHJ A;  4IAL A;  4JK1 C;  3GQB A;  2K03 A;  1OXS C;  4BWG B;  4DU9 A;  4P2C B;  4HSV A;  1ZYR C;  3FEW X;  2H1E A;  5E1F A;  2G9D A;  2Q8T A;  2JA8 B;  5EGT A;  2LMC B;  3HOV B;  1IKL A;  3V96 A;  3ERO A;  4RHS A;  2JXM B;  5A2Q E;  3DWA A;  5COY A;  1G29 1;  4C3I B;  4FYD A;  2EVB A;  3K0Y A;  5IGB A;  3J81 E;  3S15 B;  1FNV A;  2CQA A;  5NUC A;  3X3N A;  2I46 A;  2BA0 A;  3K6O A;  4KI0 A;  3K5L A;  1MGS A;  1QIL A;  2TSS A;  2MGS A;  2ZXR A;  5C0X G;  4HAE A;  1CQF A;  1Q1E A;  1HPC A;  2WP8 J;  5D65 A;  1D2B A;  1TII D;  4FO2 A;  4EVO A;  4FP5 D;  1VCI A;  4HR7 B;  1I4X A;  2B2W A;  3D3R A;  3NXW A;  4ZYS A;  1XYI A;  4QIW B;  1D1K A;  3HZX A;  3AU7 A;  4E6I A;  2MJ8 A;  1D6E C;  1IW7 C;  1AFP A;  1EU3 A;  3SHL A;  2BOS A;  3KBX A;  5E4X A;  2H4O A;  1EY7 A;  1R4Q B;  3R8B A;  2KEC A;  4J1M A;  4KHV A;  3X3M A;  2SNM A;  4K8I A;  3C2P A;  2QDB A;  3NTK A;  3HKZ B;  5D3I B;  1O7L A;  2IWH A;  1CA6 A;  5FO7 B;  4F7X A;  4DF7 A;  1J8I A;  2F0E A;  3J7A V;  4K5V A;  1D1I A;  2A69 D;  4FXG C;  3TDQ A;  1ZEQ X;  1G2T A;  4KD3 A;  3MA2 B;  1SJE D;  1VF7 A;  1V8Q A;  2IJ0 A;  3HOY B;  1XTC D;  5EQ0 A;  1JOK A;  1SND A;  2EYO A;  2SEB D;  2F3V A;  2WV6 D;  4IZ8 A;  1EQV A;  1RDP D;  3PUW A;  2SNS A;  2Z8L A;  2FIN B;  2EY2 A;  2KOL A;  3K5N A;  3RMH A;  4Y7N B;  1PTO H;  2DNC A;  1IYV A;  4QF4 A;  3OPO A;  4CGY B;  1A3V A;  3L7Z C;  2ICI A;  4R9W A;  1TWH B;  1HCZ A;  4H0L C;  2Z4H A;  3KLR A;  3Q23 A;  1BNZ A;  4G7H C;  5CC4 A;  4FF2 A;  5CV8 A;  1JWM D;  2NUC A;  2NVT B;  3TME A;  3WOE A;  4C1N I;  4ABN A;  5A2Q L;  2E2H B;  2R3Z A;  2LS0 1;  5C0X J;  1ICW A;  1XXG A;  2D2C C;  1JC7 A;  2A74 C;  1PRT D;  1B1Z A;  1D5M C;  3OWE B;  2F0O A;  4IUU A;  2V4D A;  3P75 A;  4X3U A;  4IUR A;  1LTB D;  1L0X B;  3CRL C;  1Y69 U;  1ZYR D;  3GO5 A;  3D4R A;  5DNF A;  1BF4 A;  3I4M B;  4RGO S;  5K5P A;  2YYZ A;  3FPU B;  4CKE A;  2RA4 A;  1JWU D;  1PZJ D;  2O5J C;  2RSO A;  1B50 A;  3AB9 A;  4CJ0 B;  1CHP D;  4ZRZ A;  5ELC A;  3DEP A;  3O13 A;  3D8G A;  3TP8 A;  5CYU A;  3MXN A;  3P7J A;  2XVS A;  4RKB A;  4JBW A;  1U9R A;  4F88 A;  4OO1 G;  3ONA B;  1OO9 B;  2XRQ D;  4HCE A;  3BVZ A;  4C3H G;  2F0T A;  1G2S A;  4XXE A;  3P1H A;  1EWC A;  1QG7 A;  1RTN A;  5C0X H;  5EBD A;  2EY1 A;  5M3F B;  2O5I C;  3RZD B;  1DOK A;  2AQ1 B;  4OGQ C;  1II3 A;  1GUO A;  1TR5 A;  4CJ2 C;  4OIK A;  5C4X B;  2BCO A;  4C3J B;  1WD0 A;  3PUV A;  3S17 B;  5KYL A;  4DK1 A;  1I50 B;  4DNR B;  1IW7 D;  2QKI C;  1TS5 A;  1W6K A;  1H9S A;  2K5Q A;  3D31 A;  3H6M A;  1WTW A;  1TQO A;  3A7L A;  2KA7 A;  3M4Y A;  2C5C A;  4U67 3;  1EEI D;  1L0Y B;  4O1N A;  2EOT A;  1ONL A;  2ENB A;  3TP7 A;  2E2D C;  2IX3 A;  4H13 C;  5CBA E;  3BS1 A;  2E2I B;  1EQT A;  1Y8O B;  2OF1 A;  2PNR C;  3ERQ A;  1XX8 A;  3JAM E;  1TS2 A;  4CBV A;  2AUJ D;  5JPN C;  1NR4 A;  5FKA C;  1SAP A;  2RKS A;  1IKM A;  1STG A;  4HED A;  3VR3 A;  2EYL A;  1EZ6 A;  2B2U A;  2FMC A;  5CMD A;  1SYD A;  3M7N A;  1A2U A;  2PO4 A;  3PUX A;  5JJZ A;  1HRJ A;  2F1M A;  5C4Z A;  5LL6 S;  1B4O A;  3NTH A;  4A3E B;  5JEA G;  4IUV A;  3EQL C;  3SK5 A;  5DAU A;  2O4X A;  4V0B A;  2KEE A;  4G57 A;  4EQO A;  3S1M B;  2NVQ B;  3L3O C;  4K6D A;  2A5H A;  1H9R A;  2EYM A;  2KCN A;  3I70 A;  5FLX L;  3V05 A;  5CBE E;  3NWT A;  3OWF A;  1E2Z A;  4MHE A;  1AEX A;  3LWE A;  2EJG C;  3T4A C;  3UI2 A;  2WAQ B;  4TKO B;  2JA5 B;  1EY8 A;  2OEO A;  2B8G A;  4IFD J;  1QNK A;  5C3W A;  2K05 A;  1SDF A;  1PZK D;  2WIN B;  1ROD A;  2WKD A;  4N9T A;  3DUZ A;  4X3T A;  5T1G A;  1U4M A;  1SJH D;  2HCI A;  2SDF A;  3LWU A;  5FO9 B;  2F0U A;  1S5D D;  1BQQ T;  4KN7 C;  3TP5 A;  2HUG A;  1QOH A;  1MD2 D;  1BXT A;  5J22 A;  4K5W A;  1WTO A;  4J8Q A;  4XTC S;  3ZYY X;  1Q90 A;  1BCP C;  1LAC A;  1Z47 A;  3HEJ A;  3V2T A;  4DA2 A;  1PTO B;  3HOX B;  1KNA A;  1U4L A;  1H9J A;  3K59 A;  5EKK A;  1X3P A;  1SSO A;  4HMJ A;  2EYH A;  5BN4 A;  1QJO A;  3NE5 B;  3VR4 A;  1SNP A;  3A8K E;  4DXG A;  1GUS A;  2QCP X;  4XQQ A;  3MZ5 A;  4IUP A;  1VMP A;  3IKJ A;  4GZY C;  1D5Z C;  4IFD H;  5I9O A;  5M5W B;  1RTO A;  4M1U B;  1KDC A;  3FMC A;  5JEA J;  3I73 A;  2O2L D;  5JPM C;  1JWS D;  2B8F A;  2KQ3 A;  1RJT A;  1STY A;  2XRS D;  4ZK9 B;  4PQX A;  2RBM A;  3VR6 A;  3JAM L;  3SR1 A;  2F0H A;  2F0M A;  3MFG A;  2N55 A;  4U68 A;  1WVL A;  1QNU A;  2E75 C;  4XT3 B;  3BG3 A;  3S9W A;  1DM0 B;  4A3J B;  4OIJ A;  3VA7 A;  2MP1 A;  3QG1 A;  1GUW A;  3G6J B;  1R9T B;  1GJX A;  5FOB B;  1LT6 D;  1MSH A;  4G7O C;  2TMP A;  1Q3L A;  1TS4 A;  4H44 C;  2F0I A;  1Y8N B;  2R93 B;  1PTO D;  3MFY A;  5DM6 3;  1K8O A;  3KLS X;  1UUP A;  3S2H B;  1PFM A;  3T16 A;  1PLF A;  5EPJ A;  1STN A;  1BCP B;  2EYJ A;  3DHQ A;  3QOL A;  1SEB D;  2PZU A;  3VYT A;  2R6G A;  1Y1W B;  4OL7 A;  5C0X I;  5JEA H;  5J1Z A;  1CK1 A;  4C2M B;  3S14 B;  3MXU A;  4J6H A;  1HTP A;  1BUV T;  4XYO A;  3KUP A;  3S1Q B;  1I4G A;  1ET6 A;  1HA5 A;  3SXH A;  1HTL D;  3QO2 A;  1ILP A;  5I6W A;  2F0J A;  1TWG B;  2K1B A;  1KDA A;  3HP3 A;  1VMC A;  4DAV A;  2BA1 A;  3OHX C;  4DFA A;  2F0F A;  3HS0 C;  3MC0 B;  2KUM A;  3NK9 A;  3F2U A;  4DAY A;  1SYG A;  2FHT A;  4IUN A;  5I9P A;  2VB2 X;  5M5X B;  5IGF A;  2B2V C;  1BBX C;  1LLR D;  3VYS A;  4QB4 A;  1QB5 D;  2B2T C;  3GTK B;  1SE4 A;  2NN6 G;  3TSS A;  1DYQ A;  3A55 A;  2KHS A;  3AMU A;  1V1P A;  1NSN S;  3OW7 A;  2EYF A;  3H94 A;  3DMU A;  1EY0 A;  4C3I G;  1PRT B;  1DCZ A;  3KK7 A;  1JQY D;  2B2Y C;  1F2Z A;  1A15 A;  4F87 A;  2XIW A;  5CV9 A;  4I7Z C;  4R8N A;  1I4Q A;  5E3F A;  3L9A X;  1BCP D;  4ULL A;  1YNJ D;  4A93 B;  2OT2 A;  3E0J A;  4KV6 A;  4FNF A;  1MI2 A;  2R61 A;  3NSW A;  4PMB A;  3NHH A;  1QCB D;  2NTT A;  4KHZ A;  1V1P B;  4FVM A;  1Z6H A;  4B9X A;  4L6T B;  2X6G A;  2RDG A;  4NKL A;  3GTQ B;  3SK6 A;  4XQN A;  3NQT A;  5JAV A;  4A3B B;  4UDU C;  4O42 A;  4DGZ A;  1NCV A;  1PYW D;  2R7Z B;  4LAA A;  1R4P B;  3I3C A;  4QUF A;  1SYB A;  2QEJ C;  3Q0A A;  2CW0 C;  2J7Z A;  4ODG A;  1UAP A;  3EA6 A;  1S5B D;  5C6A A;  4BY1 B;  5C44 B;  2FMM A;  2EZV A;  1V1O A;  1A2T A;  2JEB I;  4BBR B;  4BY7 B;  2K32 A;  3TZU A;  5JVG 3;  3NBI A;  1NR2 A;  2ZXO A;  1AP0 A;  1GHJ A;  2IW3 A;  2VNU D;  3BYY B;  2DY7 A;  3QJY A;  5HUR A;  2HQE A;  1RF2 D;  2L55 A;  3J81 L;  5FO8 B;  4N9P A;  4KKT A;  3SEB A;  4QUC A;  2WAC A;  2WB1 B;  3OIP A;  2XN9 C;  1B3A A;  5LL6 X;  4WRD A;  5IGE A;  1I4H A;  1HQM C;  3Q6S A;  3QWN A;  3S16 B;  1JR0 D;  1FYC A;  3C1E A;  2F0W A;  3H3V C;  2A6H C;  4Q5V A;  4KY6 A;  2JYO A;  1OXT A;  1G8Z D;  2FFK B;  1S5E D;  2EPB A;  4IFD I;  1ILQ A;  4LMQ D;  4B08 A;  1PTO F;  1GOZ A;  3R2T A;  4QMG A;  2JA7 B;  1AW7 A;  5K36 G;  3K5O A;  4BBS B;  4TRD A;  2LFN A;  2XWB B;  3QOJ A;  1GUT A;  1EIH A;  2K04 A;  3BDO A;  4PNY A;  5D3D A;  1LTR D;  3I90 A;  1C8C A;  1FNU A;  1IYU A;  4DK0 A;  4RGT A;  2IPK D;  1AN8 A;  4KY5 A;  2Z4I A;  3IAY A;  2NN6 H;  1CT1 D;  3T53 B;  3K7A B;  3NPP A;  4ID6 A;  2AQ3 B;  5BN3 A;  3VYU A;  4FF4 A;  1EEF D;  4DN4 M;  1F77 A;  1HUM A;  1CZG A;  1SNO A;  4NMZ A;  3VR2 A;  1UNS A;  2L5T A;  2PW7 A;  1V43 A;  1LTS D;  3MHB A;  1LTT D;  4KK7 A;  2Q8R E;  4RKL A;  5I2X A;  3C3L A;  4K5X A;  1KLG D;  5EKL A;  4PV1 C;  1WD1 A;  3GTP B;  1HFG A;  2NVY B;  3PMF A;  5M3M B;  2A68 C;  2XNA C;  3OMG A;  2F0S A;  1TWC B;  4BA2 I;  1HQR D;  2K6A A;  4WOR A;  1FNW A;  3VR5 A;  1TS3 A;  1J9O A;  5M5Y B;  4C3J G;  2RDH A;  1PFN A;  5IIF A;  3CRK C;  1C48 A;  1I6V C;  2D9U A;  2YU9 B;  1TWF B;  1EU4 A;  1TWA B;  2F4I A;  2GA4 B;  2J0T D;  2ZT9 C;  1BCP F;  1LT4 D;  1PZI D;  4NW2 A;  3GD7 A;  5C3X A;  5BN5 A;  5LHY 1;  3DWQ A;  4LK1 C;  1RKN A;  4KJO A;  1JB3 A;  1CTM A;  1F2L A;  2RQX A;  3KF8 A;  4RWS C;  4CHT B;  3A8J E;  5CGK A;  2CW0 D;  3BVM A;  1CZW A;  1O80 A;  2WII B;  4K2K A;  4FXK C;  4HSP A;  1KNE A;  5FK9 C;  1BR9 A;  1TVX A;  1QWY A;  1IL8 A;  4A3K B;  1EY4 A;  1K8M A;  1MSG A;  2AQ2 B;  5COR A;  2F0V A;  1TKW B;  1VF5 C;  1ZXT A;  4NDX A;  1GUN A;  4HTH A;  2MHV A;  2E2J B;  5I2Y A;  3CU7 A;  2NYZ D;  5IOC A;  2A6E C;  3EFX D;  5HGT A;  1M4V A;  1BOS A;  1F9R A;  1KLU D;  4ME5 A;  3K57 A;  1PRT F;  4XIG S;  1LTI D;  3I72 A;  4G4K A;  4A3G B;  5CV4 A;  3T13 A;  3HOZ B;  1X3Q A;  4PMC A;  1E2V A;  4RCN A;  3GTO B;  1OXV A;  4Q0F A;  1EFI D;  3E6Z X;  4OO1 H;  3RLF A;  3RD4 A;  3SK8 A;  2B63 B;  3HG9 A;  3VA5 A;  3CQZ B;  4HCS A;  4RGN A;  1Q8I A;  1FGB D;  2DNE A;  1PMR A;  4I65 A;  1LTA D;  3GTJ B;  1KDB A;  4A3F B;  5CV7 A;  4S3S A;  4KKU A;  1EOT A;  3K5M A;  5C4J B;  3PO3 B;  3GP7 A;  4TQU S;  1JOR A;  1U4P A;  4XDX A;  1B9M A;  3M4O B;  2JA6 B;  4WJW A;  1WTQ A;  4X3S A;  1E2W A;  1O78 A;  3T51 B;  1U4R A;  1W6J A;  2NTS A;  1SYE A;  2XSC A;  4A3M B;  4ILW A;  4PMW A;  1STH A;  1M8A A;  1AZP A;  2CVR A;  5TSS A;  4RFB A;  2K28 A;  2F0D A;  1LV9 A;  3BDL A;  1K83 B;  4EQN A;  4IN3 A;  4KN4 C;  3M7G A;  4NP5 A;  3CHB D;  3OIQ A;  1S5C D;  5EBC A;  3BDC A;  2F0L A;  3D4W A;  1TY0 A;  3PUY A;  1CM9 A;  4K2L A;  5D14 A;  3TN2 A;  3HOU B;  3PIO 3;  3BZD B;  1STB A;  3MAQ A;  1D5X C;  2F0G A;  2A68 D;  3WOF A;  1BO0 A;  4KKS A;  1HXY D;  3P20 A;  2RSN A;  3J7Y W;  2F0N A;  1X32 A;  1E0B A;  5C4H A;  4K6L A;  3NUC A;  1BDO A;  4CKB A;  2AWN A;  1STE A;  1HHV A;  1FD7 D;  3MXG A;  3A7A B;  2B2W C;  1FR3 A;  4TSS A;  4A3I B;  1PFB A;  4CJ1 B;  1I3Q B;  2M00 A;  2NN6 I;  2D62 A;  2KCC A;  1S5F D;  2PQE A;  3TZD A;  3M3Y B;  2LY7 A;  4XQJ A;  3R93 A;  4IQZ A;  1ZKO A;  4MN3 A;  3GTM B;  1LT5 D;  2Z1C A;  3RZO B;  2RVL A;  2LKV A;  2K5D A;  2L11 A;  1RD9 D;  5J39 A;  4C56 C;  3D6C A;  1G91 A;  3OMC A;  1T5E A;  4H7B A;  2CHB D;  3NTI A;  2MPM A;  5ISR A;  2AWO A;  3IFT A;  2RDF A;  1QE6 A;  1H9K A;  1A3T A;  2A6E D;  4M8A A;  5JOB A;  3RUZ A;  3NP8 A;  1SE3 A;  2FJ2 A;  1EYA A;  1EY6 A;  2JEA I;  2F0P A;  2PPB C;  4HMI A;  3S1R B;  1GHK A;  4XYQ A;  3GV3 A;  2KVM A;  1Q1B A;  4KMU C;  4KY7 A;  2F3W A;  3IL8 A;  2BDO A;  2WKC A;  1LO5 D;  1Y8P B;  4DNT B;  2F03 A;  1TY2 A;  1JIC A;  2BDN A;  4K14 A;  1JOQ A;  3VYR A;  1B2T A;  2NWG A;  2PZT A;  3K58 A;  2L0C A;  2IX0 A;  4C1N K;  1CHQ D;  5KNB A;  5KNC A;  2EDG A;  2L9H A;  1DON A;  3A56 A;  2PW5 A;  2B2V A;  5KYI A;  2F0K A;  3FPP A;  1RCV D;  2B2T A;  4ZKB B;  3PO2 B;  3J7A F;  1CFM A;  1SNQ A;  3NBH A;  2M9V A;  1VDZ A;  2VB3 X;  1MBY A;  2F0Q A;  2L12 A;  3I91 A;  4L63 B;  5IGG A;  2B2Y A;  1H9M A;  1A6X A;  1O7Y A;  1EL0 A;  1SMY C;  2X69 A;  4B9W A;  3S2D B;  3A8I E;  2DN8 A;  2EY6 A;  4DAP A;  3OOC A;  1B53 A;  1ET9 A;  3GV6 A;  2HCC A;  3FVQ A;  3QIA A;  3QB3 A;  4IUQ A;  4FXD A;  1WCM B;  3H0G B;  1DOM A;  5JVH 3;  4V19 0;  1NAP A;  1OXU A;  5ELF A;  4DXF A;  5KGU A;  4XT1 B;  3J80 E;  5KRU A;  2Q8I B;  2K5W A;  3Q24 A;  4UAI A;  2NB0 A;  4OO1 I;  1EIG A;  4C3H B;  4ZQ3 A;  1I4P A;  2R92 B;  1F2Y A;  1Y1V B;  3W3A A;  3R2I A;  1ESF A;  2E74 C;  3S1N B;  1Z7T A;  3SE0 A;  4RHR A;  2G9H D;  5KEE A;  3CKI B;  2BE5 C;  4RAU C;  4L8J A;  3W2D A;  3H91 A;  2EY5 A;  2M2L A;  5FLX E;  5DEH A;  5E4W C;  1NUC A;  3FKI B;  3HOW B;  4A3D B;  2D5D A;  5A35 A;  1WTR A;  5G3L D;  2ICE C;  3OSO A;  2K33 A;  1WTV A;  2KED A;  1I6H B;  1ENF A;  1STA A;  3LNN A;  1AZQ A;  3C46 A;  1SNC A;  2QIL A;  2OXP A;  3URY A;  1JOO A;  2DY8 A;  1GUG A;  4Z9C B;  2L1B A;  4CKC A;  2PMZ B;  3FDT A;  1WTX A;  3DEO A;  1B9N A;  1JCK B;  5KND A;  3MTS A;  5IGC A;  5EJW A;  1A3U A;  3H09 A;  2VXW A;  3TBI B;  4YIJ A;  3PUZ A;  3U9S A;  5C5M A;  1F9Q A;  4IFD G;  1DD2 A;  3Q22 A;  3PIP 3;  1C4Q A;  2JP1 A;  5KIX A;  3NQI A;  2B2U C;  1SE2 A;  5AFW A;  1GXD C;  4BS9 A;  5IGD A;  3HGB A;  3MXP A;  3SK4 A;  2NBF A;  5EPL A;  1HUN A;  2K01 A;  2EJM A;  5I6Y A;  3BVG A;  1LTG D;  2I07 B;  1CA5 A;  1SBB B;  1UEA B;  3ND8 A;  5C3E B;  1YNN C;  3N52 A;  3ITP A;  4EGV A;  3D6W A;  5ELD A;  3M85 A;  2QF7 A;  3NWS A;  2JE6 I;  1PTO C;  3DM1 A;  1KAB A;  3MVV A;  1I4R A;  2EE1 A;  2IX1 A;  3J80 L;  5CV6 A;  1H9S B;  1KAA A;  3IFD A;  4R8I A;  3HRZ C;  1EY9 A;  2A73 B;  2EJF C;  5IT9 E;  3WDN A;  1CI3 M;  4G7Z C;  2PCF B;  4ZAI A;  4KD4 A;  4KJN A;  4ZUJ A;  2MUY A;  4RGM A;  3FRP B;  1SXT A;  1SMY D;  2IL8 A;  3E5S A;  4AYB B;  5F2D A;  2NZ1 D;  1SFO B;  2XWJ B;  4IUT A;  1EZ8 A;  2AUK A;  1TT2 A;  4F8M A;  3PV0 A;  2L4N A;  1S4Z A;  1F9S A;  2X6L A;  3A54 A;  3TP6 A;  3LX0 A;  2JSO A;  1T5X D;  1SNM A;  3EVQ A;  1JE4 A;  1HA6 A;  3BYT B;  4RA8 A;  4FF3 A;  1G6Z A;  5DM7 3;  1TU2 B;  2E76 C;  1ESR A;  3D4D A;  3N6R A;  3SDZ A;  1ENC A;  2Y0S B;  5ELB A;  4MIU A;  2A6H D;  1XWE A;  5EPK A;  2ID0 A;  2HDM A;  3I4L A;  2B39 A;  2PZW A;  1LAB A;  1IHZ A;  2BE5 D;  5EKI A;  1EY5 A;  5T1I A;  2IT1 A;  1EWH A;  3KBG A;  5K36 H;  5IOD A;  1HFN A;  4EQP A;  3U9O A;  1DZ1 A;  2A69 C;  1PXU A;  1YNJ C;  1DOL A;  3DWP A;  3I4N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...