5IGGA

Crystal structure of staphylococcal nuclease variant delta+phs v66h/i72e at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
130
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKEEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66H/I72E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 36
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5iggA00
1EYDA 4QB4A 1ENAA 2F0KA 3HEJA 3TP6A 3V2TA 2PZWA 5CV8A 3SK6A 2F0NA 1EZ8A 2RKSA 1F2MA 4K5VA 5KYIA 5NUCA 3D8GA 4G57A 2EYHA 2NUCA 3DHQA 3MEHA 2EYPA 2OXPA 1STAA 3H6MA 4R8NA 5C4ZA 5M9OA 5IGFA 3S9WA 2SOBA 2F0QA 4H7BA 3OMCA 3D4WA 3MZ5A 1EZ6A 4J6HA 5CV9A 3SK5A 4LAAA 1KDAA 2HQEA 3OMGA 4B9WA 1JOOA 5DAUA 1EY4A 3SR1A 4OL7A 2F0OA 4DU9A 5JOBA 2PW5A 5KIXA 1SNMA 2F0MA 2ENBA 3QB3A 3P1HA 4HMIA 2SNMA 5IGBA 2PZTA 1EYAA 2M00A 3PMFA 1SNOA 4KD4A 2F0VA 4RKLA 1F2YA 2OEOA 2F3VA 4F8MA 5CC4A 5C5MA 5EGTA 3T16A 5HURA 1JOQA 2F0PA 4PMCA 1EY0A 2F0FA 3VA5A 1STHA 4I65A 4KY7A 5EKKA 2LKVA 3NQTA 2PQEA 5CGKA 4S3SA 1NUCA 2F0DA 3OWFA 3TP5A 5K5PA 1SNQA 1KDBA 1SYDA 3SK8A 4ODGA 3SHLA 4N9PA 3EROA 3EVQA 4K2KA 4DF7A 1A3UA 4K5XA 1RKNA 1KDCA 4EQOA 5CV4A 4ZUJA 4NKLA 2SNSA 5IIFA 5F2DA 3MVVA 5I6YA 1EY5A 2EXZA 1SYBA 4QF4A 4MIUA 1TT2A 2EYMA 5CV6A 3OSOA 4ZQ3A 5IODA 5IGDA 4QMGA 1SNPA 4KY5A 3SK4A 1F2ZA 3NXWA 4RKBA 5C5LA 4ID6A 1STYA 2F0GA 4KJOA 3C1EA 2PW7A 3D4DA 2EYJA 5DEHA 3T13A 5J39A 1SNCA 1KAAA 2EYFA 5E1FA 2F0EA 3NHHA 2RDFA 3NP8A 4DFAA 4KJNA 5ISRA 2EYOA 1EY9A 3MXPA 4K2LA 1SNDA 4KY6A 1STBA 3TP8A 2F0HA 4IALA 1TR5A 5IGEA 5EKLA 5HGTA 4NMZA 2F0IA 4YIJA 2O4XA 3QOLA 3R3OA 1SYFA 2F3WA 3MHBA 3ERQA 4KD3A 5C6AA 2EY2A 5C3XA 5J22A 4K6DA 5CV7A 5J1ZA 3SXHA 4ME5A 2EY1A 1EY6A 3E5SA 4N9TA 4K8IA 5CV5A 2OF1A 1STNA 2PYKA 1EQVA 4KHVA 1EYCA 4NP5A 3P75A 3D6CA 3TP7A 5C4HA 1JORA 3U9OA 3BDCA 4J1MA 1ENCA 5I6WA 5KEEA 2EYLA 5KYLA 4TRDA 1KABA 2F0LA 4K8JA 3RUZA 1A3TA 4IUNA 5JAVA 1EY7A 1A2TA 1SYGA 4IZ8A 5IGGA 5CR3A 2RBMA 3QOJA 1TQOA 2KHSA 4DGZA 2F0JA 3BDLA 4NDXA 4PNYA 3HZXA 1EY8A 2EY6A 3NUCA 4WRDA 1A3VA 2F0SA 2KQ3A 4HMJA 3ITPA 4B9XA 5C3WA 4EVOA 2F0TA 1AEXA 1NSNS 2PZUA 3DMUA 1STGA 2F0UA 4PMBA 3LX0A 5IOCA 1IHZA 4HTHA 1JOKA 3C1FA 4K5WA 3NK9A 4KV6A 3EJIA 4WORA 1U9RA 2QDBA 2WACA 4E6IA 2F0WA 4EQPA 4K14A 5I9PA 1SYCA 5IGCA 5I9OA 4EQNA 4F7XA 5KGUA 5KRUA 3TMEA 1SYEA 2EY5A 4KTAA 4ZUIA 1A2UA 5E3FA 1II3A
chains in the Genus database with same CATH superfamily
2F0KA 3T1HQ 5G3LD 2YU9H 1HZAA 1HR0W 1BO0A 2JEBI 4RAUC 4AQYQ 1DXMA 2L5TA 3ND9A 2NUCA 4NW2A 4EX5A 2UUCL 2F0QA 4H7BA 5I4DA 3K5LA 5M5YB 3A55A 3SDZA 5C0XI 5M5XH 4DUYL 4G4KA 3SE0A 5C0XH 2EE1A 4EGVA 3J7AF 2PZTA 4DXFA 4BXXG 1G8ZD 3S16B 3KF6A 1G6ZA 3T16A 1K0RA 1LYLA 3K7AH 1BCPB 4A3GB 1G291 2LKVA 3M7NA 1N32Q 5IYCH 2CWAA 1VQDA 3J81E 4DF7A 2NZOA 1LV9A 1YI2A 3BDOA 1VQAA 3L9AX 1EFWA 3K5NA 2GA4B 1H95A 2NVXB 4A3FH 2YV5A 3Q22A 3HOWH 2WFWA 1RHPA 3CCUA 2L12A 4CDCC 1FNWA 4IFDG 2E75C 4A93G 1XTDA 5ISRA 2DUDA 1SJHD 3GQBA 1SNDA 2IX1A 2KOLA 1UE6A 4LK1C 1TR5A 1PH3A 1HQRD 2OTLA 3WDNA 4UPAA 3MHBA 2E8GA 4DUZL 1YZ6A 2BA1A 4HAEA 2E2HH 3G48A 2EY1A 4BBSG 1CQFA 3AB9A 1Y8OB 1JE5A 1XNRL 2R7ZB 2ES2A 2AQ3B 3BVZA 2PNRC 1E1TA 3VA7A 3W1BA 3WOFA 4LF6L 1DZ1A 1A15A 3BDCA 2QGQA 2JJQA 3W3AA 1KABA 1NCVA 4K8JA 4AQYL 3EA6A 1IYUA 4CDDC 1SMXA 2A68D 3D3RA 2R92H 5GAHC 4XQNA 1MD2D 2EY6A 1EU3A 1C4QA 2PZUA 2Z9HA 2ZT9C 3LX0A 2R93G 2JA5G 3NK9A 1D5MC 1KTKA 3I4NG 4XXEA 2CVRA 3MXGA 2AWNA 1A6XA 2JA8B 4DK1A 3F2UA 3FKIH 3GTPH 2FXQA 2JA8H 2K14A 3MTSA 4G57A 1HCZA 1EFID 5M5XB 4A3CH 3UI2A 3ULLA 3MZ5A 5CYUA 3IL8A 4CJ2C 5C44H 2R93B 1PYSB 3EBEA 3OMGA 5DM73 4IPDA 4BBSH 3LWUA 3Q6SA 3QB3A 2OCEA 3P1HA 5GADC 1VQLA 1LTID 2B2YA 2OEOA 4JI2L 1JOQA 3S1QB 2Z4IA 2NWGA 3E9IA 5CGKA 4LF9L 1ONLA 3GTMH 3N6RA 5D3DA 1B53A 3SHLA 1SRUA 4OXPA 2RDHA 1EWCA 3CHBD 4EQOA 4RWSC 3PQIA 4I7ZC 4IJLA 4HIMA 2BH8A 3JAME 1NNXA 3S14H 3M4OH 1SXTA 1X3FA 4F88A 4H44C 1M90C 4ID6A 1Y1WB 1FGUA 4R4OA 2D2CC 2R7DA 1R9TH 4BA2I 1TKWB 3RN2A 2VL6A 3TS0A 1DCZA 2LFNA 3NTIA 5BR8Q 3GTGB 4DV4L 3PUZA 4JI6L 4FYDA 3IAYA 1G91A 4JYAQ 1FNVA 1J9OA 2BE5C 1B9NA 1A62A 2R92G 3R3OA 4IPGA 1HUMA 2R7ZH 2G9DA 3I8ZA 1H9SB 1Q8IA 3K80C 2HD3A 3G4SA 5C4HA 1KC8C 3BZDB 1N36Q 3HG9A 1I4GA 2PI2E 1A8VA 2A68C 5LHY1 1X3QA 2CHBD 2A6HD 1NBWA 4OONA 3KLSA 3QOJA 3F2DA 3X3MA 5C4XB 4HMJA 2KCCA 1T5EA 1FVIA 3HS0C 1VQJA 4FO2A 4B3SL 4K5WA 2UU9L 2K28A 3G6JB 4MZ9A 5IYDH 3CC4A 4K5VA 3P7JA 3QR8A 1MGSA 1XTCD 3OIPA 1YNXA 3LGJA 1JB7A 5CV9A 3TQYA 4EQ5A 3GTOH 3AFPA 5T1IA 1WTRA 2ZJQA 2F0OA 1X32A 3WWVA 1JB3A 1QVCA 3Q23A 1VQFA 4GOPA 1C7YA 2NN6I 4GN4B 5T1GA 4DV2L 3K5OA 2F0PA 2I5MX 4IO9A 4JBJA 5EKKA 4C3JG 3OWFA 3W2DA 1WTVA 1G6PA 4DAYA 3NEMA 4JV5L 4XTCS 1DYQA 2B29A 4Y52H 4DR2L 4DN4M 3HOUH 1E24A 2JA6H 2A5HA 3NBHB 2CQOA 4A4IA 1VQ4A 4L6TB 1QWYA 1I50H 3MA2B 5COYA 3GDEA 5DNFA 4KJOA 2D0OA 4TSSA 5E4WC 3HOXG 2X6LA 1KAAA 2K05A 3F2BA 3Q24A 3VYTA 5AJ3Q 3O13A 2LSSA 1I94L 3K58A 2D5DA 2A6EC 4X64Q 4IALA 3BVGA 3G71A 5E4XA 2L11A 4A3JG 2LXJA 3NWSA 3E9HA 5M5YH 1E3PA 1IW7C 2R7ZG 3KDFA 1CA6A 1K8AC 2Q8RE 2K7VA 4BBSB 4X6AH 3DUZA 4A3EB 3S16H 5E7NA 2N78A 3BZKA 3I4LA 4HIOA 2VQFL 3TP7A 2XRSD 1JORA 3CQZH 1VQIA 3I2ZA 3JC66 1S5ED 3RUZA 1I4RA 3A8IE 1FD7D 3E6ZX 1S5BD 2JK8A 1CI3M 1WD0A 4YY3Q 5FKAC 1WCMH 4UP7A 1MKHA 4ZYSA 3BS1A 1Y1WG 3HFZB 1Y1VH 1ZXTA 1PH6A 4KHPQ 2MUYA 1JE4A 1JJCB 4JBKA 1B1ZA 4CBVA 4JI3Q 1UUPA 4OIJA 1PYWD 4ZUIA 1PVOA 4LF5Q 2EJGC 1VMCA 2XGTA 3RZDH 1ILPA 3VYUA 2VUMH 1YEZA 2R61A 1EZ6A 1Q81C 1TXYA 3GTGH 5IYDG 3S1QH 5K36G 1D5XC 4OL7A 2QKIC 2VZAA 3J81i 4A3BH 3PO3B 3JAMi 1LACA 1RTOA 1EYAA 2F52A 5LMNW 1WVLA 1GM5A 1EY0A 1OXTA 1B2TA 2BA0A 3PUXA 2M2LA 2H4OA 3E0JA 1YITA 3I4MH 1B50A 4RGTA 3ERSX 3MVVA 5I6YA 4C3HB 4G7ZC 4KY5A 2L15A 1F9RA 1VQ9A 4HSVA 4POFA 3H15A 4PZ7A 1U4LA 5CORA 4RHRA 2PCFB 1S5FD 1VQBA 5E1FA 4GKJL 3NP8A 2JA7G 4ILWA 3HKZB 1SSOA 2E2IH 2WP8J 3FPPA 3MXUA 4C2MB 3T51B 3RZOB 2VQEL 1VF5C 1GUWA 2YTYA 2N3SA 2EJMA 3ERQA 4LF4L 2K5HA 1XWEA 4CKEA 5C3EH 2Q8TA 4N9TA 4LFBQ 4K8IA 1IBKQ 3P75A 4HJAA 2XSCA 4Y7NH 1I5FA 1L0XB 3U9OA 1CA5A 2RVLA 5KNBA 1NY4A 5FLXL 5C44G 4DKAC 2UUBQ 3PO3H 4V190 3A5UA 1A2TA 1SYGA 1PXUA 3BG3A 4A76A 4DUZQ 1E2WA 3S14B 1L1OB 3HZXA 4XIGS 4DV0L 4JI6Q 4CKBA 1VQOA 4TKOB 3I4NH 3M4QA 4MHEA 1CZWA 2FMCA 5IOCA 5ELBA 3C1FA 4LW1A 4A3KG 5M5WB 3S2HB 1U9RA 1EWIA 2A19A 4K14A 1IBML 5JEAG 2VQEQ 2EZVA 3OPOA 3NQIA 5E3FA 2A1AA 3FPUB 1F2MA 3GV3A 4WJWA 3R93A 5JEAJ 5CMDA 2K4KA 4JCVE 2B2TA 3U50C 2SOBA 3PIOA 4DV5Q 2B2UC 2PMZB 5IYBH 4A3IB 1XPOA 4XYQA 3VYSA 1XMOL 1Q12A 1TU2B 5DLQE 4IPHA 1D1IA 4DU9A 4KKTA 5LMUQ 4IPCA 4WFN3 3E0EA 5LMNQ 1YIJA 1FYCA 3J80L 5EJWA 1N8RC 5A2QL 3KLRA 4OEMB 2F3VA 2WAQB 5EPLA 4OX9L 3J7AV 1HRJA 3KF8A 5HURA 4K0KL 2RHQB 4MNOA 1PRTF 4C3JH 4S3SA 1NUCA 3A5ZB 4KLKA 4HJ9A 5G3LF 1BNZA 3U4ZA 1WTOA 1RKNA 4AYBB 2ZXPA 2HHHQ 1TWFH 5F2DA 1SYBA 4X3KA 2Q8IB 2Z6KC 1SBBB 4LF7L 2E2JB 2IW3A 1PTOH 2DJFC 3H0GH 1BCPC 3CCLA 1YVCA 3GTQB 4GN5A 4A3JB 3PV0A 3V05A 3HOVG 4XT3B 5C6AA 5EQ0A 1E1OA 4DPGA 1ZKOA 1I4QA 3ICEA 1STNA 1LLRD 2KA7A 3TN2A 1L0YB 2ICEC 4IOCA 1QCBD 1IYJB 1KL9A 1ENCA 2O5JC 1F77A 4JI7L 4QUCA 4A3EH 1PFBA 5IGGA 3OWEB 1LTLA 2K03A 1TQOA 4IQZA 3CAMA 1BBUA 4HIKA 4MN3A 1Q8KA 4EVOA 5C4XH 3KBGA 3NE5B 1GHKA 4A3KH 3TRZA 4PZ6A 5FJ8H 1SN8A 3B6YA 1PH4A 1SYCA 2X69A 2KBNA 3T56B 1A63A 3TMEA 4C3IG 1EIYB 3KJOA 5JEAH 1C0AA 1CFMA 1R4PB 1WTQA 2ATWA 5FLMH 1RF2D 5LMUL 3KDFB 1N34L 2OTJA 1H9SA 2RSOA 1GHJA 4DR4L 1M4VA 1DM0B 3I7FA 2DN8A 3RMHA 1YJ9A 1NTGA 5DAUA 1EY4A 2K04A 2E2DC 2F0MA 1PRTD 2HUGA 1DD2A 2MP1A 4WJ3M 5M3MH 1TWCB 1WTHA 1TWGB 4YY3L 4TVAB 4DR2Q 1I3QB 2IPKD 3C46A 1UEBA 2KHIA 1IBMQ 3J81c 1S72A 1V1OA 1GKHA 3AU7A 2V1CC 2IWHA 1H9JA 1WD1A 1MIUA 1PA6A 1K8MA 2GVAA 3K0YA 1KDCA 4ZUJA 4LFBL 3CMEA 2YYZA 1YNJC 4MIUA 1HZBA 2OQKA 3QJYA 4A75A 4LF4Q 3PGZA 3PUVA 1IBLL 1SNPA 1EOVA 3KF8B 1JC7A 1O80A 4QIWE 4DNTB 1WYDA 1EEFD 1STYA 3DWQA 3GTQH 1O7ZA 1K28A 1N33Q 5J39A 5ELEA 3EFXD 1KD1C 1MBYA 3J81L 3JAML 4JI1L 1JT8A 3CCVA 2WAQE 5M3FH 4A3DH 2F3WA 3LWEA 5J22A 1CKNA 1Q86C 1EYGA 2VB2X 1EYCA 1IXRA 3F1ZA 2VNUD 1UE1A 1EEID 1TS3A 3AFQA 1IYVA 4DXGA 1KIXA 4AIMA 4CDEC 3K5MA 3L0OA 2VUMG 4X3SA 2FHTA 1RCVD 3F8TA 4B08A 2RBMA 4B3ML 3RLOA 4CKCA 2Y0SB 4XDXA 5IT9E 3TDQA 1XX8A 1AEXA 2WAQG 5D3IB 4A93H 2HDMA 2Z4HA 4P72A 1FJGL 1STGA 4QQBX 1HH2P 2KCTA 1QUQA 4FXKC 2A74C 1CKOA 4YCVA 3UDXA 3I56A 3H94A 4F7XA 4GLVB 1TWAB 2VB3X 4DV7Q 1SYEA 1HR0L 1KRSA 3DWAA 3KBXA 4ZKBB 2TSSA 2AUJD 3TP6A 3TZDA 2RKSA 1VQCA 3MAQA 1OXUA 2IHEA 2EYPA 2I0QA 4F87A 2D0PA 5IGFA 2AQ1B 4GKKL 1W6KA 4XYOA 4B3SQ 3FDTA 5J3BA 3KOJA 4X64L 4DR6Q 4L5TA 1MJCA 3W5OA 4GKJQ 3ND8A 3BYYB 5IP7G 4IOAA 1R4QB 1BOSA 3QIAA 4KY7A 1TY0A 1LTBD 3DM1A 2NVTH 1SYDA 4ODGA 4N9PA 1IKMA 2LS01 4HSPA 4LUOA 1BVSA 3BVMA 3JAMc 2AKWB 1E2VA 2ZTEA 3HOXH 3BZCA 2B2TC 2MPMA 4KN7C 5CV6A 4DNIA 2JE6I 4IN3A 3J80i 1L0WA 2N55A 1XNQQ 1NR2A 1PZID 4FF2A 2UUCQ 5DEHA 3I72A 1HTPA 2K75A 4GS3A 1BBXC 4JW0A 2NVQB 5EKLA 2F0IA 3PSIA 2EY2A 4RFBA 5C4JH 1QNUA 1SMYD 4NP5A 4PQXA 2ZTCA 2NZHA 2R93H 1L1OC 3VR6A 4HJ5A 1TWCH 1QZGA 1VQEA 3IFDA 3W1GA 1GJXA 5IYBG 2RDGA 1FGBD 4C3JB 4B3TQ 4OO1H 4P73A 1EY7A 4NXNQ 4JG2A 4Q0FA 4BBRH 2NBFA 2KHSA 4QJFA 2Q2IA 2F0JA 1QVFA 3KFUA 1PH1A 4HN7A 1EY8A 2F0UA 1C9OA 1B70B 2QDBA 2IX3A 3HOUB 4R4QA 4K0KQ 1VQ6A 2K6AA 4ME3A 1TS2A 2VS1A 3VR5A 1MJEA 1X56A 5BN4A 5JVH3 5CV8A 2ZM6L 3J80c 4ZLTF 1WJJA 3MEHA 3M7GA 2OXPA 4A3BG 4RMFA 4LFCQ 1CM9A 4R4CA 1K8GA 5M3FB 5EPJA 4HJ7A 4KK7A 4ZKCB 4DK3C 2AMCB 5JJIA 1CK1A 2BDNA 4OGQC 3HOWG 2ZTDA 1IW7D 5FO9B 4JYAL 3I4MG 1N33L 1XMQL 4A3BB 3G7LA 2UU9Q 5EBDA 2F0VA 4RKLA 1NR4A 2E74C 3HP3A 1K73C 3A8JE 1B9MA 3GTLB 2NTTA 1TWGH 1A3UA 4IFDJ 3TS2A 3FKIG 1HNXQ 4DV7L 1HR0Q 2FMMA 2R7FA 1BUVT 1V1QA 4JV5Q 5I2YA 1M8AA 4XQJA 1E22A 4MTKA 1YHQA 2BE5D 3KYHC 5C5LA 1XYIA 3FMCA 1ICWA 1YNJD 2YTVA 2JSOA 3KF6B 5HGQA 1JJGA 4V0BA 5C4XG 5GAEC 1Z6HA 4KY6A 1STBA 3TP8A 2CCZA 2D9UA 3R8BA 4NXNL 2MJ8A 1F9QA 3N52A 1MSGA 4C1NK 4CDFC 4XT1B 3AMUA 3H0GB 3K81C 3MXNB 3GTKH 4K6DA 1ESRA 2Z8LA 1I4HA 3SVMA 1KXLA 1IL8A 3E5SA 1Q90A 3CQZB 1EQVA 1WOCA 4RCNA 3J7YW 2O5IC 4J1MA 2J7ZA 3OOCA 1C48A 4TRDA 3J81j 2IHFA 2MO0A 3SGIA 1H9RA 1AE2A 1CZGA 1VMPA 2ZJPA 3J7ZC 2QDLA 4LFAQ 1LABA 4HIDA 4U68A 4A3FB 4WRDA 2EPBA 5IP9H 5C3WA 2UXCL 1Y8NB 2HCCA 1WTXA 3KJPA 1AW7A 4JI8Q 1PH2A 4BA1I 2B8GA 4UY8C 1YJWA 1PFSA 3Q0AA 2B2WA 1II3A 2A6HC 2OWOA 2QF7A 4P75A 4JI8L 5KYIA 4B3TL 5ELFA 2EYHA 1PTOF 2NVQH 1PRTB 4J6HA 4DV6L 2JA5B 2IL8A 4NB3A 2Z0SA 1GUTA 2ZJRA 4NXMQ 1LTSD 1FNUA 4FXDA 3K59A 4JI0L 5ELDA 4FNFA 1SNOA 1RDPD 1LT6D 1IZ6A 2UXDQ 4A3IG 1STHA 2G9HD 2PNHA 3OHXC 3KK7A 2QW7A 3K0XA 1J5EQ 1XPUA 1B4OA 3QG1A 3M3YH 2O2LD 1X6OA 2F4VQ 5CV4A 4X3UA 4PMWA 1PH5A 1AZQA 4OWWB 3V96A 3HOYH 3HOVH 3OSOA 4ZQ3A 4ZCKA 1PZKD 3GTJH 3CRLC 4BY1B 2C9OA 5LL6X 1Z47A 1ENFA 3S1RH 1J5EL 2EYFA 2HIVA 2HQLA 2Y0SG 3RZOH 2PO4A 1QUQB 3E3XA 5FOBB 2CKZB 1LUZA 4NMZA 4A3JH 2B2VC 1BKBA 1K83B 1SJED 4Q5VA 4N8FA 3VR4A 2BDOA 3S17B 1ICFB 1L1OA 4KHVA 4HCSA 2NN6H 2AQ2B 1PH8A 5IYCG 1D7QA 2K5WA 2L0CA 1KNEA 3K7UC 3T1HL 1I6HB 5IWAL 1OXSC 3OW7A 3F2CA 1V1PB 3EQLC 1YHAA 2K52A 3NTKA 2Y0SE 2V4DA 3I4OA 4IJHA 4JI5L 3GTLH 1U4MA 1HNWQ 2C5CA 3PF4A 3HOXB 3I73A 2JA7H 2SDFA 3KUPA 1IHZA 4KV6A 1X3EA 1X54A 4E6IA 4DR5L 1HHVA 3HOZH 4GOPC 1P16A 3U4VA 3GP7A 2Z1CA 4H13C 2B39A 1PYBA 1ET9A 1ENAA 1YJNA 2F03A 4DAMA 1K9MC 2AHOB 1CKNB 3D8GA 1K8OA 4APVA 2KUMA 4R4IA 3H6MA 5FO8B 3S9WA 2NN6G 3MXNA 3D4WA 3OMCA 4A3GG 5BN3A 1GUNA 1SROA 3I90A 1CQVA 2ALYB 2NVYB 3RD4A 5IGBA 2M00A 1BBWA 2YTXA 2KEEA 3D31A 2WKCA 2XRQD 4QIWB 2CW0C 2ZM6Q 3D0FA 4OO1I 3NQTA 1ESFA 2F0DA 4YWLA 2JN4A 4LJZC 2K5QA 2F3IA 3PCOB 4JOIA 4G7HC 4RCOA 5GQOA 2WKDA 1TT2A 3G6EA 1U0LA 3VR3A 3CCQA 1P8LA 1CHQD 1GVPA 1UEAB 5JPMC 4LF6Q 3GV6A 2IJ0A 1J6QA 3CCMA 1K3BC 4KJNA 4C3HH 1FR3A 4O0AA 4N8X1 3FP9A 1VQ5A 1XNRQ 4RHSA 2M9VA 1L2FA 1KHIA 2XN9C 5IGEA 1Z7TA 1Z9FA 3S1MB 3OTOQ 3S15B 3IRBA 2I07B 4BWGB 1G2SA 1LT3D 4M8AA 1GO3E 1BR9A 1TIID 4DV5L 4GOPB 1ASYA 1EOTA 3CCEA 4H02A 4UP9A 1I3QH 5KNDA 2JP1A 5AJ3L 1QB5D 1Y8PB 4KKUA 2E5LQ 2KENA 1B3AA 2LY7A 2L1BA 2I46A 1S4ZA 4WORA 2P5ZX 3STBC 2NVXH 5EBCA 2EDGA 2WACA 5KRUA 1ILQA 2HHHL 2EY5A 1VQGA 4DR1Q 4Z9CB 1TWAH 3P20A 3ZJYC 4DV3Q 3NBIA 1EYDA 1HQMC 4QB4A 4HR7B 5EPKA 3HEJA 2E2JH 5FJ8G 2E2IB 5M5WH 2H1EA 3DHQA 5H1SE 2UXBL 4O42A 4R9WA 4OX9Q 1RIPA 2K5DA 2AWOA 1HA6A 1OXVA 2PW5A 3DXJC 1RL2A 4HMIA 4OELB 2EOTA 3C3LA 4JI4Q 1B8AA 3CCSA 2HIXA 1Q1BA 4FVMA 2DY7A 4PG3A 1NAPA 5EGTA 4BY7G 4ZK9B 1K0SA 1LT5D 1QG7A 3GD7A 3NELA 3J7A5 1OTCA 3I4NB 5FO7B 3SK8A 2K1BA 2OQ0A 1JICA 4ABNA 1XJVA 3OYYA 4AYBE 3S1RB 4DK6C 4QF4A 4WJ4A 4DA2A 1UWVA 5IGDA 3EIVA 1PFMA 3SK4A 1HZ9A 3NXWA 3HKZE 3URYA 1LTGD 3S1NH 3AEVA 2PW7A 3WOEA 1QVGA 1N36L 1U4PA 3MC0B 3A0JA 2VUMB 2XIWA 2RDFA 4OIKA 3MXPA 2LXKA 1H9MA 1S40A 1PH7A 4O1NA 5BN5A 2E5LL 4UAIA 1HPCA 4DR1L 3FRPB 1BQQT 2ASBA 1DONA 2BCOA 4DR7L 4LWCA 2LMCB 1S5CD 5BR8L 3EN2A 3GTKB 5JJLA 3D6CA 1K3RA 1XPRA 4JBWA 3UE1A 3BU2A 3CCRA 2HCIA 4POGA 3R2IA 2VXWA 3MWYW 4IUNA 1UE5A 3HKZG 4GLAC 3MFYA 2PI2A 4R1JA 5M3MB 1ET6A 4KMUC 4DR6L 3DEOA 3IFTA 3CC2A 5IT9c 3BDLA 4BBRB 3HOZB 2F1MA 1PH9A 4OO1G 4A93B 1V9PA 1NMGA 1GD7A 2F0TA 4LFCL 4CGYB 5FLXE 4PMBA 2BH2A 1HA5A 1D2BA 1JOKA 1B44D 1PZJD 2NZ1D 3UDGA 4EQPA 2F0WA 5I9PA 4A3DG 5IGCA 3L3OC 2XWJB 3HOWB 4LNQA 1DOLA 2WB1E 4FXGC 3TBIB 3SK6A 2F0NA 1KLUD 1MI2A 3DM3A 3M4YA 1ZYRC 2MO1A 3C2PA 1HNXL 1HTLD 1STAA 4LF9Q 1PHJA 5JJKA 5IT9L 3H3VC 1GOZA 3RZDB 3QWNA 4NPSA 4RGOS 3CC7A 2FINB 1CTMA 5JVG3 1YBYA 4O2DA 2SNMA 3VDYA 1C8CA 3MFGA 5EAYA 2JQOA 3HOYG 5CC4A 5C5MA 1TS5A 5HY6A 4ULLA 4HJ8A 1CT1D 2XTIA 4UP8A 2F0FA 4ZAIA 3H3VI 2HT1A 2MQHA 3I70A 1CHPD 1NMFA 2WB1G 4C3IB 3SEBA 4A3CG 1G51A 3EVQA 3NBHA 4K5XA 2OT2A 2BOSA 2JA8G 4JI3L 4JI4L 3PO2H 1PDQA 3HKSA 2JA6G 5IODA 4DV1L 2C35B 2UUAL 3S1NB 1IL2A 2KHJA 3M3YB 3U58A 1QJOA 4KHZA 1EQRA 3GTPB 2EYJA 3T13A 1PTOB 4C56C 1HUNA 2A8VA 4DFAA 1JJ2A 1T5XD 1EY9A 1EUJA 3AYHB 2L55A 4YIJA 1QNKA 2O4XA 4BY1G 1U5KA 1KAWA 4R8IA 4DV2Q 3CMAA 2KCMA 4C3HG 3GO5A 4DR5Q 2K01A 4DNRB 4X65Q 4DR3L 4B3RQ 3PF5A 3NWTA 3TREA 4L8JA 4YHHL 5I6WA 5KYLA 1A3TA 3H0GG 2KCNA 4HEDA 2PPBC 5LMNL 1AFPA 4PZ8A 1PRTC 1SE8A 3ITPA 1VCIA 4P74A 3RLFA 4HTHA 2QEXA 2QCPX 4OWTB 1Y1WH 4UHVA 1NJIC 3R2TA 1ZYRD 4KTAA 3RNUA 2ICIA 4IUUA 1GUGA 2Z6KA 3V2TA 3X3NA 3M4PA 2A69D 2E2HB 5NUCA 1F2LA 2UUBL 3OW2A 1Q82C 4R8NA 3M85A 1X9NA 2PQAA 1VQHA 1SR3A 4JI2Q 4FF3A 2RCFA 4B9WA 2HQEA 1WTPA 1I6VC 2UUAQ 4LUZA 3CKIB 3SR1A 4DV0Q 4H0LC 1W2BA 3HRZC 2ENBA 1U4RA 4YWKA 1X55A 2B2VA 4QL5A 1HJPA 5C0XJ 4BBRG 4IUPA 4I7AA 3KLSX 4KD4A 1Y1VG 4L5SA 2KVMA 2IT1A 1NE3A 4GNXA 2F4VL 2EXDA 1HNWL 4PMCA 1V43A 1PTOD 4I65A 4JPBW 5C0XG 4Y7NB 2L9HA 1YNNC 1EWHA 5JPNC 3EROA 4YHHQ 1AZPA 3T4AC 4IUTA 2SNSA 5IP9G 2DNCA 4RG1A 1N32L 1EY5A 3CRKC 3VR2A 3PO2G 2EXZA 2K5VA 1X65A 4P2CB 1X3GA 1WCMB 4C2MH 4DR7Q 3NENA 1VQPA 3HOVB 3STBD 3DLLA 1RJTA 3C1EA 3VYRA 4UDUC 2XWBB 1D8LA 1GUOA 4DV6Q 1KNAA 2F0EA 1R9TB 3NHHA 3KLWA 2B2UA 3T53B 2EYOA 2ZXRA 4K2LA 4LF7Q 2CFMA 2X6GA 5FLMG 2IX0A 2KEDA 4G7OC 3ONAB 3QOLA 1HFNA 1SYFA 2PMZE 1EL0A 1EIFA 3ULJA 4LFAL 5C3XA 5CV7A 1K83H 3UDFA 4ME5A 4IFDI 4P71A 5IWAQ 3NPPA 1GUSA 4JC0A 5ELCA 2FFKB 1CKMA 4CJ1B 3GTMB 2EVBA 4L5RC 3A7AB 2EYLA 2MGSA 3BJUA 1KQSA 2MHVA 2R92B 1E0BA 4FF1A 5CR3A 1PMRA 4RGMA 1VS0A 3I3CA 3S2DH 1HFGA 2I5HA 1QILA 4X62Q 4PNYA 3TSSA 2JA6B 2F0SA 2KQ3A 4BY7B 2J4XA 4QY7A 3PO2B 4M1UB 4X66L 1IKLA 3A7LA 1FL0A 2A69C 3GTJB 2GVBA 1T9HA 1PLFA 1HNZL 2CQAA 2KJXA 1SEBD 4DAPA 1VQ7A 3CPFA 1KRTA 1VQNA 1WFQA 4B3MQ 4LAAA 5C4JB 4A3GH 4AH6A 4DK0A 1EIHA 1HNZQ 1SNMA 4QCLA 1AE3A 1F9SA 3BYTB 2NYZD 1AN8A 1SFOH 2QA4A 1CSQA 4DUYQ 1B3QA 1TS4A 2QEJC 1TWFB 1JMCA 1GXDC 3FHWA 3T1YQ 2RCNA 3TP5A 5K5PA 2Q2HA 1IBKL 4RGNA 1KDBA 1Q1EA 2VY3A 1RD9D 2NVTB 1HXYD 3A56A 2UXDL 2JYOA 1H9KA 5IP7H 4DR4Q 4A3MH 1M1KC 4DAYB 1S3OA 1XMQQ 4XQQA 1J8IA 4GNXB 2E76C 2DY8A 4NXML 2DJGC 4RKBA 1XXGA 4KN4C 3HOZG 1SE2A 5IY0A 2B63B 2CH4A 3D4DA 3NTHA 2UXBQ 4JOIC 1SNCA 3S17H 3MEFA 5TSSA 1IBLQ 1I50B 1VQKA 2GN5A 2F0HA 4JK1C 2I5LX 1D1KA 1D6EC 2PQAB 4BXXH 3S15H 2HDLA 1ASZA 3AQQA 4DV1Q 1CSPA 1BCPD 5J1ZA 2K5NA 4A3EG 2R6GA 1PV4A 1EY6A 1DOMA 3RLNA 3ULPA 5D65A 2ZXOA 4KKSA 2OF1A 4AYBG 2PYKA 4PV1C 1AH9A 1SAPA 1SE4A 1SE3A 2MFIA 4FDBA 5GROA 3H09A 1EU4A 3ER0A 3K7AB 2CH4W 2D62A 3H3VH 1JR0D 4IZ8A 4A3MG 1STEA 4DGZA 1MHWC 4NDXA 1BF4A 2JEAI 1XMOQ 4YCWA 2RA4A 1WI5A 3PO3G 2JA7B 2XVSA 2WINB 1VF7A 1NSNS 3CP0A 3DMUA 1MSHA 1V1PA 1YHBA 2N8NA 4FF4A 2EIFA 2FJ2A 5KGUA 5C3EG 2MNAA 2Q2TA 4A3IH 5CBEE 1E2ZA 3UE0A 2PZWA 2B2WC 2NVYH 4OWXB 2J0TD 5CBAE 3PUWA 5C4ZA 3HGBA 1JCKB 5M9OA 2EJFC 3S24A 1KDAA 1LTTD 1I4XA 1JOOA 2YU9B 5JOBA 5KIXA 5C3EB 1XNQL 1LO5D 3A74A 1LT4D 3RR5A 3HOUG 2B8FA 1OXXK 4YWMA 3PMFA 4GNXC 4JI5Q 1F2YA 2RSNA 1Y69U 1EQQA 2ID0A 2JA5H 1KLGD 4A3MB 2Q2UA 5DM63 4TQUS 3VA5A 3UDIA 3I55A 2EQSA 4JBMA 1VDZA 2VQFQ 1JQYD 3FEWX 4K2KA 2JA9A 4QGUA 1BCPF 1QE6A 3S2HH 5A35A 1N34Q 1TY2A 1D5ZC 1O78A 3L2PA 4JI0Q 2EYMA 2K33A 3OTOL 4ALPA 4YCUA 4A3FG 1I94Q 2K32A 1BDOA 4LUVA 2DGYA 2RF4A 2A6ED 4FP5D 1JWUD 4IFDH 1PFNA 1AP0A 1FJGQ 1LM0A 2CW0D 4X65L 4DR3Q 2B63G 4B3RL 1TWHB 2AUKA 3M9BA 5HGTA 1W3SA 1SLJA 2CWPA 5M3MG 3NSWA 2VW9A 1Y14B 2WV6D 4KD3A 1F9PA 4DAVA 4QUFA 3SXHA 3QO2A 3FVQA 2DNEA 3DWPA 3Q8DA 5JJZA 1N9WA 5I2XA 5KEEA 1EIGA 4IURA 2F4IA 4BY7H 4KI0A 4L5QA 4GN3B 1JWMD 5JAVA 3IKJA 3M4OB 3DEPA 3HOYB 2WB1B 3CD6A 3CW2C 4JI1Q 2QILA 2B3GA 4B9XA 2RQXA 3OIQA 3PIPA 4GLXA 3PUYA 5GAGC 4ZRZA 1O7LA 3A8KE 3FKIB 3EJIA 1OO9B 1SMYC 1WCMG 2N49A 3J80E 2K50A 4LF8L 5ELOA 1BXTA 3CU7A 1EZ8A 4KHPL 4GZYC 4BS9A 4CJ0B 2B63H 2RHSB 4A3DB 2KECA 1Q46A 3A54A 3S1MH 4A3LG 4J8QA 3SK5A 1S5DD 1ZEQX 4CHTB 2UXCQ 3D4RA 4L63B 4RA8A 3PIP3 3PIO3 4DV3L 1QZHA 4HCEA 4F8MA 4X66Q 4DV4Q 1O7IA 1I6HH 4C3IH 5K36H 5M3FG 2PQEA 3TZUA 1WTWA 3S2DB 1SNQA 4U673 4OHJA 1G2TA 5KNCA 1ML0D 1YNND 3K8AA 1RTNA 2XNAC 1PTOC 4MTNA 4IUVA 4NKLA 5FK9C 5IIFA 3T1YL 3I91A 1SDFA 5EKIA 4LF5L 4QMGA 3CPWA 1TWHH 4X3TA 1F2ZA 3RN5A 4A3KB 1HZCA 3CF5A 2NTSA 3D6WA 1X3PA 2F0GA 4K6LA 2JXMB 1Q7YC 2TMPA 3H91A 1I4PA 2A73B 4GKKQ 1A0IA 1TVXA 1B7YB 2N88A 4X62L 3CCJA 1VQMA 1LTAD 3K57A 1RODA 4BY1H 1LTRD 3LNNA 3K6OA 5IE8A 4R4TA 1V8QA 2G5DA 3CXCA 3ZYYX 5A2QE 5C44B 4J15A 4JI7Q 2NB0A 1QOHA 5CV5A 5LL6S 5D14A 3GTOB 2H5XA 1JWSD 2Z6BA 1E7ZA 1SFOB 2WIIB 1UNSA 2F0LA 4IUQA 1EQTA 2L4NA 1O7YA 5L37A 1W6JA 1Y1VB 4LF8Q 1UE7A 1UAPA 3L7ZC 1CUKA 2SEBD 5FLXc 3NUCA 1A3VA 1Q3LA 5AFWA 4A3LH 2IY5B 4C1NI 2B2YC 1DOKA 4LMQD 4RH6A 2R3ZA 3I4MB 4JVZA 5I9OA 4EQNA 1VQ8A 1DGSA 3TEHB 5ELNA 3U9SA 1DJRD 1A2UA
chains in the Genus database with same CATH topology
2F0KA 5G3LD 1BO0A 2JEBI 4RAUC 1DXMA 2L5TA 3ND9A 2NUCA 4NW2A 2F0QA 4H7BA 5I4DA 3K5LA 5M5YB 3A55A 3SDZA 5C0XI 4G4KA 3SE0A 5C0XH 2EE1A 4EGVA 3J7AF 2PZTA 4DXFA 1G8ZD 3S16B 1G6ZA 3T16A 1BCPB 4A3GB 1G291 2LKVA 3M7NA 3J81E 4DF7A 1LV9A 3BDOA 3L9AX 3K5NA 2GA4B 2NVXB 3Q22A 1RHPA 2L12A 1FNWA 4IFDG 2E75C 5ISRA 3GQBA 1SJHD 1SNDA 2IX1A 2KOLA 4LK1C 1TR5A 1HQRD 3WDNA 3MHBA 2BA1A 4HAEA 2EY1A 1CQFA 3AB9A 1Y8OB 2R7ZB 2AQ3B 3BVZA 2PNRC 3VA7A 3WOFA 1DZ1A 1A15A 3BDCA 3W3AA 1KABA 1NCVA 4K8JA 3EA6A 1IYUA 2A68D 3D3RA 4XQNA 1MD2D 2EY6A 1EU3A 1C4QA 2PZUA 2ZT9C 3LX0A 3NK9A 1D5MC 1KTKA 4XXEA 2CVRA 3MXGA 2AWNA 1A6XA 2JA8B 4DK1A 3F2UA 3MTSA 4G57A 1HCZA 1EFID 5M5XB 3UI2A 3MZ5A 5CYUA 3IL8A 4CJ2C 2R93B 3OMGA 5DM73 3LWUA 3Q6SA 3QB3A 3P1HA 1LTID 2B2YA 2OEOA 1JOQA 3S1QB 2Z4IA 2NWGA 5CGKA 1ONLA 3N6RA 5D3DA 1B53A 3SHLA 2RDHA 1EWCA 3CHBD 4EQOA 4RWSC 4I7ZC 3JAME 1SXTA 4F88A 4H44C 4ID6A 1Y1WB 2D2CC 4BA2I 1TKWB 1DCZA 2LFNA 3NTIA 3GTGB 3PUZA 4FYDA 3IAYA 1G91A 1FNVA 1J9OA 2BE5C 1B9NA 3R3OA 1HUMA 2G9DA 3I8ZA 1H9SB 1Q8IA 5C4HA 3BZDB 3HG9A 1I4GA 2A68C 5LHY1 1X3QA 2CHBD 2A6HD 3KLSA 3QOJA 3X3MA 5C4XB 4HMJA 2KCCA 1T5EA 3HS0C 4FO2A 4K5WA 2K28A 3G6JB 4K5VA 3P7JA 1MGSA 1XTCD 3OIPA 5CV9A 5T1IA 1WTRA 2F0OA 1X32A 1JB3A 3Q23A 2NN6I 5T1GA 3K5OA 2F0PA 5EKKA 4C3JG 3OWFA 3W2DA 1WTVA 4DAYA 4XTCS 1DYQA 4DN4M 2A5HA 4L6TB 1QWYA 3MA2B 5COYA 5DNFA 4KJOA 4TSSA 5E4WC 2X6LA 1KAAA 2K05A 3Q24A 3VYTA 3O13A 3K58A 2D5DA 2A6EC 4IALA 3BVGA 5E4XA 2L11A 3NWSA 1IW7C 1CA6A 2Q8RE 2K7VA 4BBSB 3DUZA 4A3EB 3I4LA 3TP7A 2XRSD 1JORA 1S5ED 3RUZA 1I4RA 3A8IE 1FD7D 3E6ZX 1S5BD 1WD0A 1CI3M 5FKAC 4ZYSA 3BS1A 1ZXTA 2MUYA 1JE4A 1B1ZA 4CBVA 1UUPA 4OIJA 1PYWD 4ZUIA 2EJGC 1VMCA 1ILPA 3VYUA 2R61A 1EZ6A 5K36G 1D5XC 4OL7A 2QKIC 3PO3B 1LACA 1RTOA 1EYAA 1WVLA 1EY0A 1OXTA 1B2TA 2BA0A 3PUXA 2M2LA 2H4OA 3E0JA 1B50A 4RGTA 3MVVA 5I6YA 4C3HB 4G7ZC 4KY5A 1F9RA 4HSVA 1U4LA 5CORA 4RHRA 2PCFB 1S5FD 5E1FA 3NP8A 4ILWA 3HKZB 1SSOA 2WP8J 3FPPA 4C2MB 3MXUA 3T51B 3RZOB 1VF5C 1GUWA 2EJMA 3ERQA 1XWEA 4CKEA 2Q8TA 4N9TA 4K8IA 3P75A 2XSCA 1L0XB 3U9OA 1CA5A 2RVLA 5KNBA 5FLXL 4V190 1A2TA 1SYGA 1PXUA 3BG3A 1E2WA 3S14B 3HZXA 4XIGS 4CKBA 4TKOB 4MHEA 1CZWA 2FMCA 5IOCA 5ELBA 3C1FA 3S2HB 5M5WB 1U9RA 4K14A 5JEAG 2EZVA 3OPOA 3NQIA 5E3FA 3FPUB 1F2MA 3GV3A 4WJWA 3R93A 5CMDA 5JEAJ 2B2TA 2SOBA 4A3IB 2B2UC 2PMZB 4XYQA 3VYSA 1Q12A 1TU2B 1D1IA 4DU9A 4KKTA 4WFN3 1FYCA 3J80L 5EJWA 5A2QL 3KLRA 2F3VA 2WAQB 5EPLA 3J7AV 1HRJA 3KF8A 5HURA 1PRTF 4S3SA 1NUCA 5G3LF 1BNZA 1WTOA 1RKNA 4AYBB 2ZXPA 5F2DA 1SYBA 4X3KA 2Q8IB 1SBBB 2E2JB 2IW3A 1PTOH 1BCPC 3GTQB 4A3JB 3PV0A 3V05A 4XT3B 5C6AA 5EQ0A 1ZKOA 1I4QA 1STNA 1LLRD 2KA7A 3TN2A 1L0YB 2ICEC 1QCBD 1ENCA 2O5JC 1F77A 4QUCA 1PFBA 5IGGA 3OWEB 2K03A 1TQOA 4IQZA 4MN3A 4EVOA 3KBGA 3NE5B 1GHKA 1SYCA 2X69A 3T56B 3TMEA 4C3IG 5JEAH 1CFMA 1R4PB 1WTQA 1RF2D 1H9SA 2RSOA 1GHJA 1M4VA 1DM0B 2DN8A 3RMHA 5DAUA 1EY4A 2K04A 2E2DC 2F0MA 1PRTD 2HUGA 1DD2A 2MP1A 1TWCB 1TWGB 1I3QB 2IPKD 3C46A 1V1OA 3AU7A 2IWHA 1H9JA 1WD1A 1K8MA 3K0YA 1KDCA 4ZUJA 2YYZA 1YNJC 4MIUA 3QJYA 3PUVA 1SNPA 4DNTB 1JC7A 1O80A 1EEFD 1STYA 3DWQA 1O7ZA 5J39A 5ELEA 3EFXD 1MBYA 3J81L 3JAML 2F3WA 3LWEA 5J22A 2VB2X 1EYCA 2VNUD 1EEID 1TS3A 1IYVA 4DXGA 3K5MA 4X3SA 2FHTA 1RCVD 4B08A 2RBMA 4CKCA 2Y0SB 4XDXA 5IT9E 3TDQA 1XX8A 1AEXA 5D3IB 2HDMA 2Z4HA 1STGA 4FXKC 2A74C 3H94A 4F7XA 1TWAB 2VB3X 1SYEA 3DWAA 3KBXA 4ZKBB 2TSSA 2AUJD 3TP6A 3TZDA 2RKSA 3MAQA 1OXUA 2EYPA 4F87A 5IGFA 2AQ1B 1W6KA 4XYOA 3FDTA 3ND8A 3BYYB 1R4QB 1BOSA 3QIAA 4KY7A 1TY0A 1LTBD 3DM1A 1SYDA 4ODGA 4N9PA 1IKMA 2LS01 4HSPA 3BVMA 1E2VA 2B2TC 2MPMA 4KN7C 5CV6A 2JE6I 4IN3A 2N55A 1NR2A 1PZID 4FF2A 5DEHA 3I72A 1HTPA 1BBXC 2NVQB 5EKLA 2F0IA 2EY2A 4RFBA 1QNUA 1SMYD 4NP5A 4PQXA 3VR6A 1GJXA 3IFDA 2RDGA 1FGBD 4C3JB 4OO1H 1EY7A 4Q0FA 2NBFA 2KHSA 2F0JA 4HN7A 1EY8A 2F0UA 2QDBA 3HOUB 2IX3A 2K6AA 1TS2A 3VR5A 5BN4A 5JVH3 5CV8A 4ZLTF 3MEHA 3M7GA 2OXPA 1CM9A 5M3FB 5EPJA 4KK7A 4ZKCB 1CK1A 2BDNA 4OGQC 1IW7D 5FO9B 4A3BB 3G7LA 5EBDA 2F0VA 4RKLA 1NR4A 2E74C 3HP3A 3A8JE 1B9MA 3GTLB 2NTTA 1A3UA 4IFDJ 2FMMA 1BUVT 5I2YA 1M8AA 4XQJA 1XYIA 2BE5D 5C5LA 3FMCA 1ICWA 1YNJD 2JSOA 4V0BA 1Z6HA 4KY6A 1STBA 3TP8A 2D9UA 3R8BA 2MJ8A 1F9QA 3N52A 1MSGA 4C1NK 4XT1B 3AMUA 3H0GB 4K6DA 1ESRA 2Z8LA 1I4HA 3SVMA 1IL8A 3E5SA 1Q90A 3CQZB 1EQVA 4RCNA 3J7YW 2O5IC 4J1MA 2J7ZA 3OOCA 1C48A 4TRDA 1H9RA 1CZGA 1VMPA 1LABA 4U68A 4A3FB 4WRDA 2EPBA 5C3WA 1Y8NB 2HCCA 1WTXA 1AW7A 4BA1I 2B8GA 3Q0AA 2B2WA 1II3A 2A6HC 2QF7A 5KYIA 5ELFA 2EYHA 1PTOF 1PRTB 4J6HA 2JA5B 2IL8A 1GUTA 1LTSD 1FNUA 4FXDA 3K59A 5ELDA 4FNFA 1SNOA 1RDPD 1LT6D 1STHA 2G9HD 3OHXC 3KK7A 1B4OA 3QG1A 2O2LD 5CV4A 4X3UA 4PMWA 1AZQA 3V96A 3OSOA 4ZQ3A 1PZKD 3CRLC 4BY1B 2C9OA 5LL6X 1Z47A 1ENFA 2EYFA 2PO4A 5FOBB 4NMZA 2B2VC 1K83B 1SJED 4Q5VA 3VR4A 2BDOA 3S17B 4KHVA 4HCSA 2NN6H 2AQ2B 2K5WA 2L0CA 1KNEA 1I6HB 1OXSC 3OW7A 1V1PB 3EQLC 3NTKA 2V4DA 1U4MA 2C5CA 3HOXB 3I73A 2SDFA 3KUPA 1IHZA 4KV6A 1HHVA 4E6IA 3GP7A 2Z1CA 4H13C 2B39A 1ET9A 1ENAA 2F03A 3D8GA 1K8OA 2KUMA 3H6MA 5FO8B 3S9WA 2NN6G 3MXNA 3D4WA 3OMCA 5BN3A 1GUNA 3I90A 1CQVA 2NVYB 3RD4A 5IGBA 2M00A 2KEEA 3D31A 2WKCA 2XRQD 4QIWB 2CW0C 4OO1I 3NQTA 1ESFA 2F0DA 4LJZC 2K5QA 4G7HC 4RCOA 2WKDA 1TT2A 3VR3A 1CHQD 1UEAB 5JPMC 3GV6A 2IJ0A 4KJNA 1FR3A 4RHSA 2M9VA 5IGEA 2XN9C 1Z7TA 3S1MB 3S15B 2I07B 4BWGB 1G2SA 1LT3D 4M8AA 1TIID 1BR9A 1EOTA 5KNDA 2JP1A 1QB5D 1Y8PB 4KKUA 1B3AA 2LY7A 2L1BA 2I46A 1S4ZA 4WORA 5EBCA 2EDGA 2WACA 5KRUA 1ILQA 2EY5A 4Z9CB 3P20A 3M4OB 3NBIA 1EYDA 1HQMC 4QB4A 4HR7B 5EPKA 3HEJA 2E2IB 2H1EA 3DHQA 4O42A 4R9WA 2K5DA 2AWOA 1HA6A 1OXVA 2PW5A 3DXJC 4HMIA 2EOTA 3C3LA 1Q1BA 4FVMA 2DY7A 1NAPA 5EGTA 4ZK9B 1LT5D 1QG7A 3GD7A 3I4NB 5FO7B 3SK8A 2K1BA 1JICA 4ABNA 3S1RB 4QF4A 4DA2A 5IGDA 1PFMA 3SK4A 3NXWA 3URYA 1LTGD 2PW7A 3WOEA 1U4PA 3MC0B 2VUMB 2XIWA 2RDFA 4OIKA 3MXPA 1H9MA 4O1NA 5BN5A 4UAIA 1HPCA 3FRPB 1BQQT 1DONA 2BCOA 2LMCB 1S5CD 3GTKB 3D6CA 4JBWA 2HCIA 3R2IA 2VXWA 3MWYW 4IUNA 3MFYA 5M3MB 1ET6A 4KMUC 3DEOA 3IFTA 3BDLA 4BBRB 3HOZB 2F1MA 4OO1G 4A93B 2F0TA 4CGYB 5FLXE 4PMBA 1HA5A 1D2BA 1JOKA 1B44D 1PZJD 2NZ1D 4EQPA 2F0WA 5I9PA 5IGCA 3L3OC 2XWJB 3HOWB 1DOLA 4FXGC 3TBIB 3SK6A 2F0NA 1KLUD 1MI2A 3M4YA 1ZYRC 3C2PA 1HTLD 1STAA 5IT9L 3H3VC 1GOZA 3RZDB 3QWNA 4RGOS 2FINB 1CTMA 5JVG3 2SNMA 1C8CA 3MFGA 5CC4A 5C5MA 1TS5A 4ULLA 1CT1D 4ZAIA 2F0FA 3I70A 1CHPD 4C3IB 3SEBA 3EVQA 3NBHA 2OT2A 4K5XA 2BOSA 1PDQA 5IODA 3S1NB 3M3YB 1QJOA 4KHZA 3GTPB 3T13A 2EYJA 1PTOB 4C56C 1HUNA 4DFAA 1T5XD 1EY9A 2L55A 4YIJA 1QNKA 2O4XA 4R8IA 4C3HG 3GO5A 2K01A 4DNRB 3NWTA 4L8JA 5I6WA 5KYLA 1A3TA 2KCNA 4HEDA 2PPBC 1AFPA 1PRTC 3ITPA 1VCIA 3RLFA 4HTHA 2QCPX 3R2TA 1ZYRD 4KTAA 2ICIA 4IUUA 1GUGA 3V2TA 3X3NA 2A69D 2E2HB 5NUCA 1F2LA 4R8NA 3M85A 4FF3A 1WTPA 2HQEA 4B9WA 1I6VC 3CKIB 3SR1A 4H0LC 3HRZC 2ENBA 1U4RA 2B2VA 5C0XJ 4IUPA 3KLSX 4KD4A 2KVMA 2IT1A 4PMCA 1V43A 1PTOD 4I65A 5C0XG 4Y7NB 2L9HA 1YNNC 1EWHA 5JPNC 3EROA 1AZPA 3T4AC 4IUTA 2SNSA 2DNCA 1EY5A 3CRKC 3VR2A 2EXZA 4P2CB 1WCMB 3HOVB 1RJTA 3C1EA 3VYRA 4UDUC 2XWBB 1GUOA 1KNAA 2F0EA 1R9TB 3NHHA 2B2UA 3T53B 2EYOA 2ZXRA 4K2LA 2X6GA 2IX0A 2KEDA 4G7OC 3ONAB 3QOLA 1HFNA 1SYFA 1EL0A 5C3XA 5CV7A 4ME5A 4IFDI 3NPPA 1GUSA 5ELCA 2FFKB 4CJ1B 3GTMB 2EVBA 3A7AB 2EYLA 2MGSA 2MHVA 2R92B 1E0BA 4FF1A 5CR3A 1PMRA 4RGMA 3I3CA 1HFGA 1QILA 4PNYA 3TSSA 2JA6B 2F0SA 2KQ3A 4BY7B 2J4XA 3PO2B 4M1UB 1IKLA 3A7LA 2A69C 3GTJB 1PLFA 2CQAA 2KJXA 1SEBD 4DAPA 4LAAA 5C4JB 4DK0A 1EIHA 1SNMA 4QCLA 1F9SA 3BYTB 2NYZD 1AN8A 2QEJC 1TS4A 1TWFB 1GXDC 3TP5A 5K5PA 4RGNA 1KDBA 1Q1EA 1RD9D 2NVTB 1HXYD 3A56A 2JYOA 1H9KA 4XQQA 1J8IA 2E76C 2DY8A 4RKBA 1XXGA 4KN4C 1SE2A 2B63B 3NTHA 3D4DA 1SNCA 5TSSA 1I50B 2F0HA 4JK1C 1D1KA 1D6EC 2HDLA 1BCPD 5J1ZA 2R6GA 1EY6A 1DOMA 5D65A 2ZXOA 4KKSA 2OF1A 2PYKA 4PV1C 1SAPA 1SE4A 1SE3A 3H09A 1EU4A 3K7AB 2D62A 1JR0D 4IZ8A 1STEA 4DGZA 4NDXA 1BF4A 2JEAI 2RA4A 2JA7B 2XVSA 2WINB 1VF7A 1NSNS 3DMUA 1MSHA 1V1PA 4FF4A 2FJ2A 5KGUA 5CBEE 1E2ZA 2PZWA 2B2WC 2J0TD 5CBAE 3PUWA 5C4ZA 3HGBA 1JCKB 5M9OA 2EJFC 1KDAA 1LTTD 1I4XA 1JOOA 2YU9B 5JOBA 5KIXA 5C3EB 1LO5D 1LT4D 2B8FA 1OXXK 3PMFA 1F2YA 2RSNA 1Y69U 2ID0A 1KLGD 4A3MB 5DM63 4TQUS 3VA5A 1VDZA 1JQYD 3FEWX 4K2KA 1BCPF 1QE6A 5A35A 1TY2A 1D5ZC 1O78A 2EYMA 2K33A 2K32A 1BDOA 2A6ED 4FP5D 1JWUD 4IFDH 1PFNA 1AP0A 2CW0D 1TWHB 2AUKA 5HGTA 3NSWA 2WV6D 4KD3A 1F9PA 4DAVA 4QUFA 3SXHA 3QO2A 3FVQA 2DNEA 3DWPA 5JJZA 5I2XA 5KEEA 1EIGA 4IURA 2F4IA 4KI0A 1JWMD 5JAVA 3IKJA 3DEPA 3HOYB 2WB1B 2QILA 4B9XA 2RQXA 3OIQA 3PUYA 4ZRZA 1O7LA 3A8KE 3FKIB 3EJIA 1OO9B 1SMYC 3J80E 1BXTA 3CU7A 1EZ8A 4GZYC 4BS9A 4CJ0B 4A3DB 2KECA 3A54A 4J8QA 3SK5A 1S5DD 1ZEQX 4CHTB 3D4RA 4L63B 4RA8A 3PIP3 3PIO3 4HCEA 4F8MA 5K36H 2PQEA 3TZUA 1WTWA 3S2DB 1SNQA 4U673 4OHJA 1G2TA 5KNCA 1ML0D 1YNND 1RTNA 2XNAC 1PTOC 4IUVA 4NKLA 5FK9C 5IIFA 3I91A 1SDFA 5EKIA 4QMGA 4X3TA 1F2ZA 4A3KB 2NTSA 3D6WA 1X3PA 2F0GA 4K6LA 2JXMB 2TMPA 1I4PA 2A73B 3H91A 1TVXA 2N88A 1LTAD 3K57A 1RODA 1LTRD 3LNNA 3K6OA 1V8QA 3ZYYX 5A2QE 5C44B 2NB0A 1QOHA 5CV5A 5LL6S 5D14A 3GTOB 1JWSD 1SFOB 2WIIB 1UNSA 2F0LA 4IUQA 1EQTA 2L4NA 1O7YA 1W6JA 1Y1VB 1UAPA 3L7ZC 2SEBD 3NUCA 1A3VA 1Q3LA 5AFWA 4C1NI 2B2YC 1DOKA 4LMQD 4RH6A 2R3ZA 3I4MB 5I9OA 4EQNA 3U9SA 1DJRD 1A2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYD A;  4QB4 A;  1ENA A;  2F0K A;  3HEJ A;  3TP6 A;  3V2T A;  2PZW A;  5CV8 A;  3SK6 A;  2F0N A;  1EZ8 A;  2RKS A;  1F2M A;  4K5V A;  5KYI A;  5NUC A;  3D8G A;  4G57 A;  2EYH A;  2NUC A;  3DHQ A;  3MEH A;  2EYP A;  2OXP A;  1STA A;  3H6M A;  4R8N A;  5C4Z A;  5M9O A;  5IGF A;  3S9W A;  2SOB A;  2F0Q A;  4H7B A;  3OMC A;  3D4W A;  3MZ5 A;  1EZ6 A;  4J6H A;  5CV9 A;  3SK5 A;  4LAA A;  1KDA A;  2HQE A;  3OMG A;  4B9W A;  1JOO A;  5DAU A;  1EY4 A;  3SR1 A;  4OL7 A;  2F0O A;  4DU9 A;  5JOB A;  2PW5 A;  5KIX A;  1SNM A;  2F0M A;  2ENB A;  3QB3 A;  3P1H A;  4HMI A;  2SNM A;  5IGB A;  2PZT A;  1EYA A;  2M00 A;  3PMF A;  1SNO A;  4KD4 A;  2F0V A;  4RKL A;  1F2Y A;  2OEO A;  2F3V A;  4F8M A;  5CC4 A;  5C5M A;  5EGT A;  3T16 A;  5HUR A;  1JOQ A;  2F0P A;  4PMC A;  1EY0 A;  2F0F A;  3VA5 A;  1STH A;  4I65 A;  4KY7 A;  5EKK A;  2LKV A;  3NQT A;  2PQE A;  5CGK A;  4S3S A;  1NUC A;  2F0D A;  3OWF A;  3TP5 A;  5K5P A;  1SNQ A;  1KDB A;  1SYD A;  3SK8 A;  4ODG A;  3SHL A;  4N9P A;  3ERO A;  3EVQ A;  4K2K A;  4DF7 A;  1A3U A;  4K5X A;  1RKN A;  1KDC A;  4EQO A;  5CV4 A;  4ZUJ A;  4NKL A;  2SNS A;  5IIF A;  5F2D A;  3MVV A;  5I6Y A;  1EY5 A;  2EXZ A;  1SYB A;  4QF4 A;  4MIU A;  1TT2 A;  2EYM A;  5CV6 A;  3OSO A;  4ZQ3 A;  5IOD A;  5IGD A;  4QMG A;  1SNP A;  4KY5 A;  3SK4 A;  1F2Z A;  3NXW A;  4RKB A;  5C5L A;  4ID6 A;  1STY A;  2F0G A;  4KJO A;  3C1E A;  2PW7 A;  3D4D A;  2EYJ A;  5DEH A;  3T13 A;  5J39 A;  1SNC A;  1KAA A;  2EYF A;  5E1F A;  2F0E A;  3NHH A;  2RDF A;  3NP8 A;  4DFA A;  4KJN A;  5ISR A;  2EYO A;  1EY9 A;  3MXP A;  4K2L A;  1SND A;  4KY6 A;  1STB A;  3TP8 A;  2F0H A;  4IAL A;  1TR5 A;  5IGE A;  5EKL A;  5HGT A;  4NMZ A;  2F0I A;  4YIJ A;  2O4X A;  3QOL A;  3R3O A;  1SYF A;  2F3W A;  3MHB A;  3ERQ A;  4KD3 A;  5C6A A;  2EY2 A;  5C3X A;  5J22 A;  4K6D A;  5CV7 A;  5J1Z A;  3SXH A;  4ME5 A;  2EY1 A;  1EY6 A;  3E5S A;  4N9T A;  4K8I A;  5CV5 A;  2OF1 A;  1STN A;  2PYK A;  1EQV A;  4KHV A;  1EYC A;  4NP5 A;  3P75 A;  3D6C A;  3TP7 A;  5C4H A;  1JOR A;  3U9O A;  3BDC A;  4J1M A;  1ENC A;  5I6W A;  5KEE A;  2EYL A;  5KYL A;  4TRD A;  1KAB A;  2F0L A;  4K8J A;  3RUZ A;  1A3T A;  4IUN A;  5JAV A;  1EY7 A;  1A2T A;  1SYG A;  4IZ8 A;  5IGG A;  5CR3 A;  2RBM A;  3QOJ A;  1TQO A;  2KHS A;  4DGZ A;  2F0J A;  3BDL A;  4NDX A;  4PNY A;  3HZX A;  1EY8 A;  2EY6 A;  3NUC A;  4WRD A;  1A3V A;  2F0S A;  2KQ3 A;  4HMJ A;  3ITP A;  4B9X A;  5C3W A;  4EVO A;  2F0T A;  1AEX A;  1NSN S;  2PZU A;  3DMU A;  1STG A;  2F0U A;  4PMB A;  3LX0 A;  5IOC A;  1IHZ A;  4HTH A;  1JOK A;  3C1F A;  4K5W A;  3NK9 A;  4KV6 A;  3EJI A;  4WOR A;  1U9R A;  2QDB A;  2WAC A;  4E6I A;  2F0W A;  4EQP A;  4K14 A;  5I9P A;  1SYC A;  5IGC A;  5I9O A;  4EQN A;  4F7X A;  5KGU A;  5KRU A;  3TME A;  1SYE A;  2EY5 A;  4KTA A;  4ZUI A;  1A2U A;  5E3F A;  1II3 A; 
#chains in the Genus database with same CATH topology
 2F0K A;  3T1H Q;  5G3L D;  2YU9 H;  1HZA A;  1HR0 W;  1BO0 A;  2JEB I;  4RAU C;  4AQY Q;  1DXM A;  2L5T A;  3ND9 A;  2NUC A;  4NW2 A;  4EX5 A;  2UUC L;  2F0Q A;  4H7B A;  5I4D A;  3K5L A;  5M5Y B;  3A55 A;  3SDZ A;  5C0X I;  5M5X H;  4DUY L;  4G4K A;  3SE0 A;  5C0X H;  2EE1 A;  4EGV A;  3J7A F;  2PZT A;  4DXF A;  4BXX G;  1G8Z D;  3S16 B;  3KF6 A;  1G6Z A;  3T16 A;  1K0R A;  1LYL A;  3K7A H;  1BCP B;  4A3G B;  1G29 1;  2LKV A;  3M7N A;  1N32 Q;  5IYC H;  2CWA A;  1VQD A;  3J81 E;  4DF7 A;  2NZO A;  1LV9 A;  1YI2 A;  3BDO A;  1VQA A;  3L9A X;  1EFW A;  3K5N A;  2GA4 B;  1H95 A;  2NVX B;  4A3F H;  2YV5 A;  3Q22 A;  3HOW H;  2WFW A;  1RHP A;  3CCU A;  2L12 A;  4CDC C;  1FNW A;  4IFD G;  2E75 C;  4A93 G;  1XTD A;  5ISR A;  2DUD A;  1SJH D;  3GQB A;  1SND A;  2IX1 A;  2KOL A;  1UE6 A;  4LK1 C;  1TR5 A;  1PH3 A;  1HQR D;  2OTL A;  3WDN A;  4UPA A;  3MHB A;  2E8G A;  4DUZ L;  1YZ6 A;  2BA1 A;  4HAE A;  2E2H H;  3G48 A;  2EY1 A;  4BBS G;  1CQF A;  3AB9 A;  1Y8O B;  1JE5 A;  1XNR L;  2R7Z B;  2ES2 A;  2AQ3 B;  3BVZ A;  2PNR C;  1E1T A;  3VA7 A;  3W1B A;  3WOF A;  4LF6 L;  1DZ1 A;  1A15 A;  3BDC A;  2QGQ A;  2JJQ A;  3W3A A;  1KAB A;  1NCV A;  4K8J A;  4AQY L;  3EA6 A;  1IYU A;  4CDD C;  1SMX A;  2A68 D;  3D3R A;  2R92 H;  5GAH C;  4XQN A;  1MD2 D;  2EY6 A;  1EU3 A;  1C4Q A;  2PZU A;  2Z9H A;  2ZT9 C;  3LX0 A;  2R93 G;  2JA5 G;  3NK9 A;  1D5M C;  1KTK A;  3I4N G;  4XXE A;  2CVR A;  3MXG A;  2AWN A;  1A6X A;  2JA8 B;  4DK1 A;  3F2U A;  3FKI H;  3GTP H;  2FXQ A;  2JA8 H;  2K14 A;  3MTS A;  4G57 A;  1HCZ A;  1EFI D;  5M5X B;  4A3C H;  3UI2 A;  3ULL A;  3MZ5 A;  5CYU A;  3IL8 A;  4CJ2 C;  5C44 H;  2R93 B;  1PYS B;  3EBE A;  3OMG A;  5DM7 3;  4IPD A;  4BBS H;  3LWU A;  3Q6S A;  3QB3 A;  2OCE A;  3P1H A;  5GAD C;  1VQL A;  1LTI D;  2B2Y A;  2OEO A;  4JI2 L;  1JOQ A;  3S1Q B;  2Z4I A;  2NWG A;  3E9I A;  5CGK A;  4LF9 L;  1ONL A;  3GTM H;  3N6R A;  5D3D A;  1B53 A;  3SHL A;  1SRU A;  4OXP A;  2RDH A;  1EWC A;  3CHB D;  4EQO A;  4RWS C;  3PQI A;  4I7Z C;  4IJL A;  4HIM A;  2BH8 A;  3JAM E;  1NNX A;  3S14 H;  3M4O H;  1SXT A;  1X3F A;  4F88 A;  4H44 C;  1M90 C;  4ID6 A;  1Y1W B;  1FGU A;  4R4O A;  2D2C C;  2R7D A;  1R9T H;  4BA2 I;  1TKW B;  3RN2 A;  2VL6 A;  3TS0 A;  1DCZ A;  2LFN A;  3NTI A;  5BR8 Q;  3GTG B;  4DV4 L;  3PUZ A;  4JI6 L;  4FYD A;  3IAY A;  1G91 A;  4JYA Q;  1FNV A;  1J9O A;  2BE5 C;  1B9N A;  1A62 A;  2R92 G;  3R3O A;  4IPG A;  1HUM A;  2R7Z H;  2G9D A;  3I8Z A;  1H9S B;  1Q8I A;  3K80 C;  2HD3 A;  3G4S A;  5C4H A;  1KC8 C;  3BZD B;  1N36 Q;  3HG9 A;  1I4G A;  2PI2 E;  1A8V A;  2A68 C;  5LHY 1;  1X3Q A;  2CHB D;  2A6H D;  1NBW A;  4OON A;  3KLS A;  3QOJ A;  3F2D A;  3X3M A;  5C4X B;  4HMJ A;  2KCC A;  1T5E A;  1FVI A;  3HS0 C;  1VQJ A;  4FO2 A;  4B3S L;  4K5W A;  2UU9 L;  2K28 A;  3G6J B;  4MZ9 A;  5IYD H;  3CC4 A;  4K5V A;  3P7J A;  3QR8 A;  1MGS A;  1XTC D;  3OIP A;  1YNX A;  3LGJ A;  1JB7 A;  5CV9 A;  3TQY A;  4EQ5 A;  3GTO H;  3AFP A;  5T1I A;  1WTR A;  2ZJQ A;  2F0O A;  1X32 A;  3WWV A;  1JB3 A;  1QVC A;  3Q23 A;  1VQF A;  4GOP A;  1C7Y A;  2NN6 I;  4GN4 B;  5T1G A;  4DV2 L;  3K5O A;  2F0P A;  2I5M X;  4IO9 A;  4JBJ A;  5EKK A;  4C3J G;  3OWF A;  3W2D A;  1WTV A;  1G6P A;  4DAY A;  3NEM A;  4JV5 L;  4XTC S;  1DYQ A;  2B29 A;  4Y52 H;  4DR2 L;  4DN4 M;  3HOU H;  1E24 A;  2JA6 H;  2A5H A;  3NBH B;  2CQO A;  4A4I A;  1VQ4 A;  4L6T B;  1QWY A;  1I50 H;  3MA2 B;  5COY A;  3GDE A;  5DNF A;  4KJO A;  2D0O A;  4TSS A;  5E4W C;  3HOX G;  2X6L A;  1KAA A;  2K05 A;  3F2B A;  3Q24 A;  3VYT A;  5AJ3 Q;  3O13 A;  2LSS A;  1I94 L;  3K58 A;  2D5D A;  2A6E C;  4X64 Q;  4IAL A;  3BVG A;  3G71 A;  5E4X A;  2L11 A;  4A3J G;  2LXJ A;  3NWS A;  3E9H A;  5M5Y H;  1E3P A;  1IW7 C;  2R7Z G;  3KDF A;  1CA6 A;  1K8A C;  2Q8R E;  2K7V A;  4BBS B;  4X6A H;  3DUZ A;  4A3E B;  3S16 H;  5E7N A;  2N78 A;  3BZK A;  3I4L A;  4HIO A;  2VQF L;  3TP7 A;  2XRS D;  1JOR A;  3CQZ H;  1VQI A;  3I2Z A;  3JC6 6;  1S5E D;  3RUZ A;  1I4R A;  3A8I E;  1FD7 D;  3E6Z X;  1S5B D;  2JK8 A;  1CI3 M;  1WD0 A;  4YY3 Q;  5FKA C;  1WCM H;  4UP7 A;  1MKH A;  4ZYS A;  3BS1 A;  1Y1W G;  3HFZ B;  1Y1V H;  1ZXT A;  1PH6 A;  4KHP Q;  2MUY A;  1JE4 A;  1JJC B;  4JBK A;  1B1Z A;  4CBV A;  4JI3 Q;  1UUP A;  4OIJ A;  1PYW D;  4ZUI A;  1PVO A;  4LF5 Q;  2EJG C;  1VMC A;  2XGT A;  3RZD H;  1ILP A;  3VYU A;  2VUM H;  1YEZ A;  2R61 A;  1EZ6 A;  1Q81 C;  1TXY A;  3GTG H;  5IYD G;  3S1Q H;  5K36 G;  1D5X C;  4OL7 A;  2QKI C;  2VZA A;  3J81 i;  4A3B H;  3PO3 B;  3JAM i;  1LAC A;  1RTO A;  1EYA A;  2F52 A;  5LMN W;  1WVL A;  1GM5 A;  1EY0 A;  1OXT A;  1B2T A;  2BA0 A;  3PUX A;  2M2L A;  2H4O A;  3E0J A;  1YIT A;  3I4M H;  1B50 A;  4RGT A;  3ERS X;  3MVV A;  5I6Y A;  4C3H B;  4G7Z C;  4KY5 A;  2L15 A;  1F9R A;  1VQ9 A;  4HSV A;  4POF A;  3H15 A;  4PZ7 A;  1U4L A;  5COR A;  4RHR A;  2PCF B;  1S5F D;  1VQB A;  5E1F A;  4GKJ L;  3NP8 A;  2JA7 G;  4ILW A;  3HKZ B;  1SSO A;  2E2I H;  2WP8 J;  3FPP A;  3MXU A;  4C2M B;  3T51 B;  3RZO B;  2VQE L;  1VF5 C;  1GUW A;  2YTY A;  2N3S A;  2EJM A;  3ERQ A;  4LF4 L;  2K5H A;  1XWE A;  4CKE A;  5C3E H;  2Q8T A;  4N9T A;  4LFB Q;  4K8I A;  1IBK Q;  3P75 A;  4HJA A;  2XSC A;  4Y7N H;  1I5F A;  1L0X B;  3U9O A;  1CA5 A;  2RVL A;  5KNB A;  1NY4 A;  5FLX L;  5C44 G;  4DKA C;  2UUB Q;  3PO3 H;  4V19 0;  3A5U A;  1A2T A;  1SYG A;  1PXU A;  3BG3 A;  4A76 A;  4DUZ Q;  1E2W A;  3S14 B;  1L1O B;  3HZX A;  4XIG S;  4DV0 L;  4JI6 Q;  4CKB A;  1VQO A;  4TKO B;  3I4N H;  3M4Q A;  4MHE A;  1CZW A;  2FMC A;  5IOC A;  5ELB A;  3C1F A;  4LW1 A;  4A3K G;  5M5W B;  3S2H B;  1U9R A;  1EWI A;  2A19 A;  4K14 A;  1IBM L;  5JEA G;  2VQE Q;  2EZV A;  3OPO A;  3NQI A;  5E3F A;  2A1A A;  3FPU B;  1F2M A;  3GV3 A;  4WJW A;  3R93 A;  5JEA J;  5CMD A;  2K4K A;  4JCV E;  2B2T A;  3U50 C;  2SOB A;  3PIO A;  4DV5 Q;  2B2U C;  2PMZ B;  5IYB H;  4A3I B;  1XPO A;  4XYQ A;  3VYS A;  1XMO L;  1Q12 A;  1TU2 B;  5DLQ E;  4IPH A;  1D1I A;  4DU9 A;  4KKT A;  5LMU Q;  4IPC A;  4WFN 3;  3E0E A;  5LMN Q;  1YIJ A;  1FYC A;  3J80 L;  5EJW A;  1N8R C;  5A2Q L;  3KLR A;  4OEM B;  2F3V A;  2WAQ B;  5EPL A;  4OX9 L;  3J7A V;  1HRJ A;  3KF8 A;  5HUR A;  4K0K L;  2RHQ B;  4MNO A;  1PRT F;  4C3J H;  4S3S A;  1NUC A;  3A5Z B;  4KLK A;  4HJ9 A;  5G3L F;  1BNZ A;  3U4Z A;  1WTO A;  1RKN A;  4AYB B;  2ZXP A;  2HHH Q;  1TWF H;  5F2D A;  1SYB A;  4X3K A;  2Q8I B;  2Z6K C;  1SBB B;  4LF7 L;  2E2J B;  2IW3 A;  1PTO H;  2DJF C;  3H0G H;  1BCP C;  3CCL A;  1YVC A;  3GTQ B;  4GN5 A;  4A3J B;  3PV0 A;  3V05 A;  3HOV G;  4XT3 B;  5C6A A;  5EQ0 A;  1E1O A;  4DPG A;  1ZKO A;  1I4Q A;  3ICE A;  1STN A;  1LLR D;  2KA7 A;  3TN2 A;  1L0Y B;  2ICE C;  4IOC A;  1QCB D;  1IYJ B;  1KL9 A;  1ENC A;  2O5J C;  1F77 A;  4JI7 L;  4QUC A;  4A3E H;  1PFB A;  5IGG A;  3OWE B;  1LTL A;  2K03 A;  1TQO A;  4IQZ A;  3CAM A;  1BBU A;  4HIK A;  4MN3 A;  1Q8K A;  4EVO A;  5C4X H;  3KBG A;  3NE5 B;  1GHK A;  4A3K H;  3TRZ A;  4PZ6 A;  5FJ8 H;  1SN8 A;  3B6Y A;  1PH4 A;  1SYC A;  2X69 A;  2KBN A;  3T56 B;  1A63 A;  3TME A;  4C3I G;  1EIY B;  3KJO A;  5JEA H;  1C0A A;  1CFM A;  1R4P B;  1WTQ A;  2ATW A;  5FLM H;  1RF2 D;  5LMU L;  3KDF B;  1N34 L;  2OTJ A;  1H9S A;  2RSO A;  1GHJ A;  4DR4 L;  1M4V A;  1DM0 B;  3I7F A;  2DN8 A;  3RMH A;  1YJ9 A;  1NTG A;  5DAU A;  1EY4 A;  2K04 A;  2E2D C;  2F0M A;  1PRT D;  2HUG A;  1DD2 A;  2MP1 A;  4WJ3 M;  5M3M H;  1TWC B;  1WTH A;  1TWG B;  4YY3 L;  4TVA B;  4DR2 Q;  1I3Q B;  2IPK D;  3C46 A;  1UEB A;  2KHI A;  1IBM Q;  3J81 c;  1S72 A;  1V1O A;  1GKH A;  3AU7 A;  2V1C C;  2IWH A;  1H9J A;  1WD1 A;  1MIU A;  1PA6 A;  1K8M A;  2GVA A;  3K0Y A;  1KDC A;  4ZUJ A;  4LFB L;  3CME A;  2YYZ A;  1YNJ C;  4MIU A;  1HZB A;  2OQK A;  3QJY A;  4A75 A;  4LF4 Q;  3PGZ A;  3PUV A;  1IBL L;  1SNP A;  1EOV A;  3KF8 B;  1JC7 A;  1O80 A;  4QIW E;  4DNT B;  1WYD A;  1EEF D;  1STY A;  3DWQ A;  3GTQ H;  1O7Z A;  1K28 A;  1N33 Q;  5J39 A;  5ELE A;  3EFX D;  1KD1 C;  1MBY A;  3J81 L;  3JAM L;  4JI1 L;  1JT8 A;  3CCV A;  2WAQ E;  5M3F H;  4A3D H;  2F3W A;  3LWE A;  5J22 A;  1CKN A;  1Q86 C;  1EYG A;  2VB2 X;  1EYC A;  1IXR A;  3F1Z A;  2VNU D;  1UE1 A;  1EEI D;  1TS3 A;  3AFQ A;  1IYV A;  4DXG A;  1KIX A;  4AIM A;  4CDE C;  3K5M A;  3L0O A;  2VUM G;  4X3S A;  2FHT A;  1RCV D;  3F8T A;  4B08 A;  2RBM A;  4B3M L;  3RLO A;  4CKC A;  2Y0S B;  4XDX A;  5IT9 E;  3TDQ A;  1XX8 A;  1AEX A;  2WAQ G;  5D3I B;  4A93 H;  2HDM A;  2Z4H A;  4P72 A;  1FJG L;  1STG A;  4QQB X;  1HH2 P;  2KCT A;  1QUQ A;  4FXK C;  2A74 C;  1CKO A;  4YCV A;  3UDX A;  3I56 A;  3H94 A;  4F7X A;  4GLV B;  1TWA B;  2VB3 X;  4DV7 Q;  1SYE A;  1HR0 L;  1KRS A;  3DWA A;  3KBX A;  4ZKB B;  2TSS A;  2AUJ D;  3TP6 A;  3TZD A;  2RKS A;  1VQC A;  3MAQ A;  1OXU A;  2IHE A;  2EYP A;  2I0Q A;  4F87 A;  2D0P A;  5IGF A;  2AQ1 B;  4GKK L;  1W6K A;  4XYO A;  4B3S Q;  3FDT A;  5J3B A;  3KOJ A;  4X64 L;  4DR6 Q;  4L5T A;  1MJC A;  3W5O A;  4GKJ Q;  3ND8 A;  3BYY B;  5IP7 G;  4IOA A;  1R4Q B;  1BOS A;  3QIA A;  4KY7 A;  1TY0 A;  1LTB D;  3DM1 A;  2NVT H;  1SYD A;  4ODG A;  4N9P A;  1IKM A;  2LS0 1;  4HSP A;  4LUO A;  1BVS A;  3BVM A;  3JAM c;  2AKW B;  1E2V A;  2ZTE A;  3HOX H;  3BZC A;  2B2T C;  2MPM A;  4KN7 C;  5CV6 A;  4DNI A;  2JE6 I;  4IN3 A;  3J80 i;  1L0W A;  2N55 A;  1XNQ Q;  1NR2 A;  1PZI D;  4FF2 A;  2UUC Q;  5DEH A;  3I72 A;  1HTP A;  2K75 A;  4GS3 A;  1BBX C;  4JW0 A;  2NVQ B;  5EKL A;  2F0I A;  3PSI A;  2EY2 A;  4RFB A;  5C4J H;  1QNU A;  1SMY D;  4NP5 A;  4PQX A;  2ZTC A;  2NZH A;  2R93 H;  1L1O C;  3VR6 A;  4HJ5 A;  1TWC H;  1QZG A;  1VQE A;  3IFD A;  3W1G A;  1GJX A;  5IYB G;  2RDG A;  1FGB D;  4C3J B;  4B3T Q;  4OO1 H;  4P73 A;  1EY7 A;  4NXN Q;  4JG2 A;  4Q0F A;  4BBR H;  2NBF A;  2KHS A;  4QJF A;  2Q2I A;  2F0J A;  1QVF A;  3KFU A;  1PH1 A;  4HN7 A;  1EY8 A;  2F0U A;  1C9O A;  1B70 B;  2QDB A;  2IX3 A;  3HOU B;  4R4Q A;  4K0K Q;  1VQ6 A;  2K6A A;  4ME3 A;  1TS2 A;  2VS1 A;  3VR5 A;  1MJE A;  1X56 A;  5BN4 A;  5JVH 3;  5CV8 A;  2ZM6 L;  3J80 c;  4ZLT F;  1WJJ A;  3MEH A;  3M7G A;  2OXP A;  4A3B G;  4RMF A;  4LFC Q;  1CM9 A;  4R4C A;  1K8G A;  5M3F B;  5EPJ A;  4HJ7 A;  4KK7 A;  4ZKC B;  4DK3 C;  2AMC B;  5JJI A;  1CK1 A;  2BDN A;  4OGQ C;  3HOW G;  2ZTD A;  1IW7 D;  5FO9 B;  4JYA L;  3I4M G;  1N33 L;  1XMQ L;  4A3B B;  3G7L A;  2UU9 Q;  5EBD A;  2F0V A;  4RKL A;  1NR4 A;  2E74 C;  3HP3 A;  1K73 C;  3A8J E;  1B9M A;  3GTL B;  2NTT A;  1TWG H;  1A3U A;  4IFD J;  3TS2 A;  3FKI G;  1HNX Q;  4DV7 L;  1HR0 Q;  2FMM A;  2R7F A;  1BUV T;  1V1Q A;  4JV5 Q;  5I2Y A;  1M8A A;  4XQJ A;  1E22 A;  4MTK A;  1YHQ A;  2BE5 D;  3KYH C;  5C5L A;  1XYI A;  3FMC A;  1ICW A;  1YNJ D;  2YTV A;  2JSO A;  3KF6 B;  5HGQ A;  1JJG A;  4V0B A;  5C4X G;  5GAE C;  1Z6H A;  4KY6 A;  1STB A;  3TP8 A;  2CCZ A;  2D9U A;  3R8B A;  4NXN L;  2MJ8 A;  1F9Q A;  3N52 A;  1MSG A;  4C1N K;  4CDF C;  4XT1 B;  3AMU A;  3H0G B;  3K81 C;  3MXN B;  3GTK H;  4K6D A;  1ESR A;  2Z8L A;  1I4H A;  3SVM A;  1KXL A;  1IL8 A;  3E5S A;  1Q90 A;  3CQZ B;  1EQV A;  1WOC A;  4RCN A;  3J7Y W;  2O5I C;  4J1M A;  2J7Z A;  3OOC A;  1C48 A;  4TRD A;  3J81 j;  2IHF A;  2MO0 A;  3SGI A;  1H9R A;  1AE2 A;  1CZG A;  1VMP A;  2ZJP A;  3J7Z C;  2QDL A;  4LFA Q;  1LAB A;  4HID A;  4U68 A;  4A3F B;  4WRD A;  2EPB A;  5IP9 H;  5C3W A;  2UXC L;  1Y8N B;  2HCC A;  1WTX A;  3KJP A;  1AW7 A;  4JI8 Q;  1PH2 A;  4BA1 I;  2B8G A;  4UY8 C;  1YJW A;  1PFS A;  3Q0A A;  2B2W A;  1II3 A;  2A6H C;  2OWO A;  2QF7 A;  4P75 A;  4JI8 L;  5KYI A;  4B3T L;  5ELF A;  2EYH A;  1PTO F;  2NVQ H;  1PRT B;  4J6H A;  4DV6 L;  2JA5 B;  2IL8 A;  4NB3 A;  2Z0S A;  1GUT A;  2ZJR A;  4NXM Q;  1LTS D;  1FNU A;  4FXD A;  3K59 A;  4JI0 L;  5ELD A;  4FNF A;  1SNO A;  1RDP D;  1LT6 D;  1IZ6 A;  2UXD Q;  4A3I G;  1STH A;  2G9H D;  2PNH A;  3OHX C;  3KK7 A;  2QW7 A;  3K0X A;  1J5E Q;  1XPU A;  1B4O A;  3QG1 A;  3M3Y H;  2O2L D;  1X6O A;  2F4V Q;  5CV4 A;  4X3U A;  4PMW A;  1PH5 A;  1AZQ A;  4OWW B;  3V96 A;  3HOY H;  3HOV H;  3OSO A;  4ZQ3 A;  4ZCK A;  1PZK D;  3GTJ H;  3CRL C;  4BY1 B;  2C9O A;  5LL6 X;  1Z47 A;  1ENF A;  3S1R H;  1J5E L;  2EYF A;  2HIV A;  2HQL A;  2Y0S G;  3RZO H;  2PO4 A;  1QUQ B;  3E3X A;  5FOB B;  2CKZ B;  1LUZ A;  4NMZ A;  4A3J H;  2B2V C;  1BKB A;  1K83 B;  1SJE D;  4Q5V A;  4N8F A;  3VR4 A;  2BDO A;  3S17 B;  1ICF B;  1L1O A;  4KHV A;  4HCS A;  2NN6 H;  2AQ2 B;  1PH8 A;  5IYC G;  1D7Q A;  2K5W A;  2L0C A;  1KNE A;  3K7U C;  3T1H L;  1I6H B;  5IWA L;  1OXS C;  3OW7 A;  3F2C A;  1V1P B;  3EQL C;  1YHA A;  2K52 A;  3NTK A;  2Y0S E;  2V4D A;  3I4O A;  4IJH A;  4JI5 L;  3GTL H;  1U4M A;  1HNW Q;  2C5C A;  3PF4 A;  3HOX B;  3I73 A;  2JA7 H;  2SDF A;  3KUP A;  1IHZ A;  4KV6 A;  1X3E A;  1X54 A;  4E6I A;  4DR5 L;  1HHV A;  3HOZ H;  4GOP C;  1P16 A;  3U4V A;  3GP7 A;  2Z1C A;  4H13 C;  2B39 A;  1PYB A;  1ET9 A;  1ENA A;  1YJN A;  2F03 A;  4DAM A;  1K9M C;  2AHO B;  1CKN B;  3D8G A;  1K8O A;  4APV A;  2KUM A;  4R4I A;  3H6M A;  5FO8 B;  3S9W A;  2NN6 G;  3MXN A;  3D4W A;  3OMC A;  4A3G G;  5BN3 A;  1GUN A;  1SRO A;  3I90 A;  1CQV A;  2ALY B;  2NVY B;  3RD4 A;  5IGB A;  2M00 A;  1BBW A;  2YTX A;  2KEE A;  3D31 A;  2WKC A;  2XRQ D;  4QIW B;  2CW0 C;  2ZM6 Q;  3D0F A;  4OO1 I;  3NQT A;  1ESF A;  2F0D A;  4YWL A;  2JN4 A;  4LJZ C;  2K5Q A;  2F3I A;  3PCO B;  4JOI A;  4G7H C;  4RCO A;  5GQO A;  2WKD A;  1TT2 A;  3G6E A;  1U0L A;  3VR3 A;  3CCQ A;  1P8L A;  1CHQ D;  1GVP A;  1UEA B;  5JPM C;  4LF6 Q;  3GV6 A;  2IJ0 A;  1J6Q A;  3CCM A;  1K3B C;  4KJN A;  4C3H H;  1FR3 A;  4O0A A;  4N8X 1;  3FP9 A;  1VQ5 A;  1XNR Q;  4RHS A;  2M9V A;  1L2F A;  1KHI A;  2XN9 C;  5IGE A;  1Z7T A;  1Z9F A;  3S1M B;  3OTO Q;  3S15 B;  3IRB A;  2I07 B;  4BWG B;  1G2S A;  1LT3 D;  4M8A A;  1GO3 E;  1BR9 A;  1TII D;  4DV5 L;  4GOP B;  1ASY A;  1EOT A;  3CCE A;  4H02 A;  4UP9 A;  1I3Q H;  5KND A;  2JP1 A;  5AJ3 L;  1QB5 D;  1Y8P B;  4KKU A;  2E5L Q;  2KEN A;  1B3A A;  2LY7 A;  2L1B A;  2I46 A;  1S4Z A;  4WOR A;  2P5Z X;  3STB C;  2NVX H;  5EBC A;  2EDG A;  2WAC A;  5KRU A;  1ILQ A;  2HHH L;  2EY5 A;  1VQG A;  4DR1 Q;  4Z9C B;  1TWA H;  3P20 A;  3ZJY C;  4DV3 Q;  3NBI A;  1EYD A;  1HQM C;  4QB4 A;  4HR7 B;  5EPK A;  3HEJ A;  2E2J H;  5FJ8 G;  2E2I B;  5M5W H;  2H1E A;  3DHQ A;  5H1S E;  2UXB L;  4O42 A;  4R9W A;  4OX9 Q;  1RIP A;  2K5D A;  2AWO A;  1HA6 A;  1OXV A;  2PW5 A;  3DXJ C;  1RL2 A;  4HMI A;  4OEL B;  2EOT A;  3C3L A;  4JI4 Q;  1B8A A;  3CCS A;  2HIX A;  1Q1B A;  4FVM A;  2DY7 A;  4PG3 A;  1NAP A;  5EGT A;  4BY7 G;  4ZK9 B;  1K0S A;  1LT5 D;  1QG7 A;  3GD7 A;  3NEL A;  3J7A 5;  1OTC A;  3I4N B;  5FO7 B;  3SK8 A;  2K1B A;  2OQ0 A;  1JIC A;  4ABN A;  1XJV A;  3OYY A;  4AYB E;  3S1R B;  4DK6 C;  4QF4 A;  4WJ4 A;  4DA2 A;  1UWV A;  5IGD A;  3EIV A;  1PFM A;  3SK4 A;  1HZ9 A;  3NXW A;  3HKZ E;  3URY A;  1LTG D;  3S1N H;  3AEV A;  2PW7 A;  3WOE A;  1QVG A;  1N36 L;  1U4P A;  3MC0 B;  3A0J A;  2VUM B;  2XIW A;  2RDF A;  4OIK A;  3MXP A;  2LXK A;  1H9M A;  1S40 A;  1PH7 A;  4O1N A;  5BN5 A;  2E5L L;  4UAI A;  1HPC A;  4DR1 L;  3FRP B;  1BQQ T;  2ASB A;  1DON A;  2BCO A;  4DR7 L;  4LWC A;  2LMC B;  1S5C D;  5BR8 L;  3EN2 A;  3GTK B;  5JJL A;  3D6C A;  1K3R A;  1XPR A;  4JBW A;  3UE1 A;  3BU2 A;  3CCR A;  2HCI A;  4POG A;  3R2I A;  2VXW A;  3MWY W;  4IUN A;  1UE5 A;  3HKZ G;  4GLA C;  3MFY A;  2PI2 A;  4R1J A;  5M3M B;  1ET6 A;  4KMU C;  4DR6 L;  3DEO A;  3IFT A;  3CC2 A;  5IT9 c;  3BDL A;  4BBR B;  3HOZ B;  2F1M A;  1PH9 A;  4OO1 G;  4A93 B;  1V9P A;  1NMG A;  1GD7 A;  2F0T A;  4LFC L;  4CGY B;  5FLX E;  4PMB A;  2BH2 A;  1HA5 A;  1D2B A;  1JOK A;  1B44 D;  1PZJ D;  2NZ1 D;  3UDG A;  4EQP A;  2F0W A;  5I9P A;  4A3D G;  5IGC A;  3L3O C;  2XWJ B;  3HOW B;  4LNQ A;  1DOL A;  2WB1 E;  4FXG C;  3TBI B;  3SK6 A;  2F0N A;  1KLU D;  1MI2 A;  3DM3 A;  3M4Y A;  1ZYR C;  2MO1 A;  3C2P A;  1HNX L;  1HTL D;  1STA A;  4LF9 Q;  1PHJ A;  5JJK A;  5IT9 L;  3H3V C;  1GOZ A;  3RZD B;  3QWN A;  4NPS A;  4RGO S;  3CC7 A;  2FIN B;  1CTM A;  5JVG 3;  1YBY A;  4O2D A;  2SNM A;  3VDY A;  1C8C A;  3MFG A;  5EAY A;  2JQO A;  3HOY G;  5CC4 A;  5C5M A;  1TS5 A;  5HY6 A;  4ULL A;  4HJ8 A;  1CT1 D;  2XTI A;  4UP8 A;  2F0F A;  4ZAI A;  3H3V I;  2HT1 A;  2MQH A;  3I70 A;  1CHP D;  1NMF A;  2WB1 G;  4C3I B;  3SEB A;  4A3C G;  1G51 A;  3EVQ A;  3NBH A;  4K5X A;  2OT2 A;  2BOS A;  2JA8 G;  4JI3 L;  4JI4 L;  3PO2 H;  1PDQ A;  3HKS A;  2JA6 G;  5IOD A;  4DV1 L;  2C35 B;  2UUA L;  3S1N B;  1IL2 A;  2KHJ A;  3M3Y B;  3U58 A;  1QJO A;  4KHZ A;  1EQR A;  3GTP B;  2EYJ A;  3T13 A;  1PTO B;  4C56 C;  1HUN A;  2A8V A;  4DFA A;  1JJ2 A;  1T5X D;  1EY9 A;  1EUJ A;  3AYH B;  2L55 A;  4YIJ A;  1QNK A;  2O4X A;  4BY1 G;  1U5K A;  1KAW A;  4R8I A;  4DV2 Q;  3CMA A;  2KCM A;  4C3H G;  3GO5 A;  4DR5 Q;  2K01 A;  4DNR B;  4X65 Q;  4DR3 L;  4B3R Q;  3PF5 A;  3NWT A;  3TRE A;  4L8J A;  4YHH L;  5I6W A;  5KYL A;  1A3T A;  3H0G G;  2KCN A;  4HED A;  2PPB C;  5LMN L;  1AFP A;  4PZ8 A;  1PRT C;  1SE8 A;  3ITP A;  1VCI A;  4P74 A;  3RLF A;  4HTH A;  2QEX A;  2QCP X;  4OWT B;  1Y1W H;  4UHV A;  1NJI C;  3R2T A;  1ZYR D;  4KTA A;  3RNU A;  2ICI A;  4IUU A;  1GUG A;  2Z6K A;  3V2T A;  3X3N A;  3M4P A;  2A69 D;  2E2H B;  5NUC A;  1F2L A;  2UUB L;  3OW2 A;  1Q82 C;  4R8N A;  3M85 A;  1X9N A;  2PQA A;  1VQH A;  1SR3 A;  4JI2 Q;  4FF3 A;  2RCF A;  4B9W A;  2HQE A;  1WTP A;  1I6V C;  2UUA Q;  4LUZ A;  3CKI B;  3SR1 A;  4DV0 Q;  4H0L C;  1W2B A;  3HRZ C;  2ENB A;  1U4R A;  4YWK A;  1X55 A;  2B2V A;  4QL5 A;  1HJP A;  5C0X J;  4BBR G;  4IUP A;  4I7A A;  3KLS X;  4KD4 A;  1Y1V G;  4L5S A;  2KVM A;  2IT1 A;  1NE3 A;  4GNX A;  2F4V L;  2EXD A;  1HNW L;  4PMC A;  1V43 A;  1PTO D;  4I65 A;  4JPB W;  5C0X G;  4Y7N B;  2L9H A;  1YNN C;  1EWH A;  5JPN C;  3ERO A;  4YHH Q;  1AZP A;  3T4A C;  4IUT A;  2SNS A;  5IP9 G;  2DNC A;  4RG1 A;  1N32 L;  1EY5 A;  3CRK C;  3VR2 A;  3PO2 G;  2EXZ A;  2K5V A;  1X65 A;  4P2C B;  1X3G A;  1WCM B;  4C2M H;  4DR7 Q;  3NEN A;  1VQP A;  3HOV B;  3STB D;  3DLL A;  1RJT A;  3C1E A;  3VYR A;  4UDU C;  2XWB B;  1D8L A;  1GUO A;  4DV6 Q;  1KNA A;  2F0E A;  1R9T B;  3NHH A;  3KLW A;  2B2U A;  3T53 B;  2EYO A;  2ZXR A;  4K2L A;  4LF7 Q;  2CFM A;  2X6G A;  5FLM G;  2IX0 A;  2KED A;  4G7O C;  3ONA B;  3QOL A;  1HFN A;  1SYF A;  2PMZ E;  1EL0 A;  1EIF A;  3ULJ A;  4LFA L;  5C3X A;  5CV7 A;  1K83 H;  3UDF A;  4ME5 A;  4IFD I;  4P71 A;  5IWA Q;  3NPP A;  1GUS A;  4JC0 A;  5ELC A;  2FFK B;  1CKM A;  4CJ1 B;  3GTM B;  2EVB A;  4L5R C;  3A7A B;  2EYL A;  2MGS A;  3BJU A;  1KQS A;  2MHV A;  2R92 B;  1E0B A;  4FF1 A;  5CR3 A;  1PMR A;  4RGM A;  1VS0 A;  3I3C A;  3S2D H;  1HFG A;  2I5H A;  1QIL A;  4X62 Q;  4PNY A;  3TSS A;  2JA6 B;  2F0S A;  2KQ3 A;  4BY7 B;  2J4X A;  4QY7 A;  3PO2 B;  4M1U B;  4X66 L;  1IKL A;  3A7L A;  1FL0 A;  2A69 C;  3GTJ B;  2GVB A;  1T9H A;  1PLF A;  1HNZ L;  2CQA A;  2KJX A;  1SEB D;  4DAP A;  1VQ7 A;  3CPF A;  1KRT A;  1VQN A;  1WFQ A;  4B3M Q;  4LAA A;  5C4J B;  4A3G H;  4AH6 A;  4DK0 A;  1EIH A;  1HNZ Q;  1SNM A;  4QCL A;  1AE3 A;  1F9S A;  3BYT B;  2NYZ D;  1AN8 A;  1SFO H;  2QA4 A;  1CSQ A;  4DUY Q;  1B3Q A;  1TS4 A;  2QEJ C;  1TWF B;  1JMC A;  1GXD C;  3FHW A;  3T1Y Q;  2RCN A;  3TP5 A;  5K5P A;  2Q2H A;  1IBK L;  4RGN A;  1KDB A;  1Q1E A;  2VY3 A;  1RD9 D;  2NVT B;  1HXY D;  3A56 A;  2UXD L;  2JYO A;  1H9K A;  5IP7 H;  4DR4 Q;  4A3M H;  1M1K C;  4DAY B;  1S3O A;  1XMQ Q;  4XQQ A;  1J8I A;  4GNX B;  2E76 C;  2DY8 A;  4NXM L;  2DJG C;  4RKB A;  1XXG A;  4KN4 C;  3HOZ G;  1SE2 A;  5IY0 A;  2B63 B;  2CH4 A;  3D4D A;  3NTH A;  2UXB Q;  4JOI C;  1SNC A;  3S17 H;  3MEF A;  5TSS A;  1IBL Q;  1I50 B;  1VQK A;  2GN5 A;  2F0H A;  4JK1 C;  2I5L X;  1D1K A;  1D6E C;  2PQA B;  4BXX H;  3S15 H;  2HDL A;  1ASZ A;  3AQQ A;  4DV1 Q;  1CSP A;  1BCP D;  5J1Z A;  2K5N A;  4A3E G;  2R6G A;  1PV4 A;  1EY6 A;  1DOM A;  3RLN A;  3ULP A;  5D65 A;  2ZXO A;  4KKS A;  2OF1 A;  4AYB G;  2PYK A;  4PV1 C;  1AH9 A;  1SAP A;  1SE4 A;  1SE3 A;  2MFI A;  4FDB A;  5GRO A;  3H09 A;  1EU4 A;  3ER0 A;  3K7A B;  2CH4 W;  2D62 A;  3H3V H;  1JR0 D;  4IZ8 A;  4A3M G;  1STE A;  4DGZ A;  1MHW C;  4NDX A;  1BF4 A;  2JEA I;  1XMO Q;  4YCW A;  2RA4 A;  1WI5 A;  3PO3 G;  2JA7 B;  2XVS A;  2WIN B;  1VF7 A;  1NSN S;  3CP0 A;  3DMU A;  1MSH A;  1V1P A;  1YHB A;  2N8N A;  4FF4 A;  2EIF A;  2FJ2 A;  5KGU A;  5C3E G;  2MNA A;  2Q2T A;  4A3I H;  5CBE E;  1E2Z A;  3UE0 A;  2PZW A;  2B2W C;  2NVY H;  4OWX B;  2J0T D;  5CBA E;  3PUW A;  5C4Z A;  3HGB A;  1JCK B;  5M9O A;  2EJF C;  3S24 A;  1KDA A;  1LTT D;  1I4X A;  1JOO A;  2YU9 B;  5JOB A;  5KIX A;  5C3E B;  1XNQ L;  1LO5 D;  3A74 A;  1LT4 D;  3RR5 A;  3HOU G;  2B8F A;  1OXX K;  4YWM A;  3PMF A;  4GNX C;  4JI5 Q;  1F2Y A;  2RSN A;  1Y69 U;  1EQQ A;  2ID0 A;  2JA5 H;  1KLG D;  4A3M B;  2Q2U A;  5DM6 3;  4TQU S;  3VA5 A;  3UDI A;  3I55 A;  2EQS A;  4JBM A;  1VDZ A;  2VQF Q;  1JQY D;  3FEW X;  4K2K A;  2JA9 A;  4QGU A;  1BCP F;  1QE6 A;  3S2H H;  5A35 A;  1N34 Q;  1TY2 A;  1D5Z C;  1O78 A;  3L2P A;  4JI0 Q;  2EYM A;  2K33 A;  3OTO L;  4ALP A;  4YCU A;  4A3F G;  1I94 Q;  2K32 A;  1BDO A;  4LUV A;  2DGY A;  2RF4 A;  2A6E D;  4FP5 D;  1JWU D;  4IFD H;  1PFN A;  1AP0 A;  1FJG Q;  1LM0 A;  2CW0 D;  4X65 L;  4DR3 Q;  2B63 G;  4B3R L;  1TWH B;  2AUK A;  3M9B A;  5HGT A;  1W3S A;  1SLJ A;  2CWP A;  5M3M G;  3NSW A;  2VW9 A;  1Y14 B;  2WV6 D;  4KD3 A;  1F9P A;  4DAV A;  4QUF A;  3SXH A;  3QO2 A;  3FVQ A;  2DNE A;  3DWP A;  3Q8D A;  5JJZ A;  1N9W A;  5I2X A;  5KEE A;  1EIG A;  4IUR A;  2F4I A;  4BY7 H;  4KI0 A;  4L5Q A;  4GN3 B;  1JWM D;  5JAV A;  3IKJ A;  3M4O B;  3DEP A;  3HOY B;  2WB1 B;  3CD6 A;  3CW2 C;  4JI1 Q;  2QIL A;  2B3G A;  4B9X A;  2RQX A;  3OIQ A;  3PIP A;  4GLX A;  3PUY A;  5GAG C;  4ZRZ A;  1O7L A;  3A8K E;  3FKI B;  3EJI A;  1OO9 B;  1SMY C;  1WCM G;  2N49 A;  3J80 E;  2K50 A;  4LF8 L;  5ELO A;  1BXT A;  3CU7 A;  1EZ8 A;  4KHP L;  4GZY C;  4BS9 A;  4CJ0 B;  2B63 H;  2RHS B;  4A3D B;  2KEC A;  1Q46 A;  3A54 A;  3S1M H;  4A3L G;  4J8Q A;  3SK5 A;  1S5D D;  1ZEQ X;  4CHT B;  2UXC Q;  3D4R A;  4L63 B;  4RA8 A;  3PIP 3;  3PIO 3;  4DV3 L;  1QZH A;  4HCE A;  4F8M A;  4X66 Q;  4DV4 Q;  1O7I A;  1I6H H;  4C3I H;  5K36 H;  5M3F G;  2PQE A;  3TZU A;  1WTW A;  3S2D B;  1SNQ A;  4U67 3;  4OHJ A;  1G2T A;  5KNC A;  1ML0 D;  1YNN D;  3K8A A;  1RTN A;  2XNA C;  1PTO C;  4MTN A;  4IUV A;  4NKL A;  5FK9 C;  5IIF A;  3T1Y L;  3I91 A;  1SDF A;  5EKI A;  4LF5 L;  4QMG A;  3CPW A;  1TWH H;  4X3T A;  1F2Z A;  3RN5 A;  4A3K B;  1HZC A;  3CF5 A;  2NTS A;  3D6W A;  1X3P A;  2F0G A;  4K6L A;  2JXM B;  1Q7Y C;  2TMP A;  3H91 A;  1I4P A;  2A73 B;  4GKK Q;  1A0I A;  1TVX A;  1B7Y B;  2N88 A;  4X62 L;  3CCJ A;  1VQM A;  1LTA D;  3K57 A;  1ROD A;  4BY1 H;  1LTR D;  3LNN A;  3K6O A;  5IE8 A;  4R4T A;  1V8Q A;  2G5D A;  3CXC A;  3ZYY X;  5A2Q E;  5C44 B;  4J15 A;  4JI7 Q;  2NB0 A;  1QOH A;  5CV5 A;  5LL6 S;  5D14 A;  3GTO B;  2H5X A;  1JWS D;  2Z6B A;  1E7Z A;  1SFO B;  2WII B;  1UNS A;  2F0L A;  4IUQ A;  1EQT A;  2L4N A;  1O7Y A;  5L37 A;  1W6J A;  1Y1V B;  4LF8 Q;  1UE7 A;  1UAP A;  3L7Z C;  1CUK A;  2SEB D;  5FLX c;  3NUC A;  1A3V A;  1Q3L A;  5AFW A;  4A3L H;  2IY5 B;  4C1N I;  2B2Y C;  1DOK A;  4LMQ D;  4RH6 A;  2R3Z A;  3I4M B;  4JVZ A;  5I9O A;  4EQN A;  1VQ8 A;  1DGS A;  3TEH B;  5ELN A;  3U9S A;  1DJR D;  1A2U A; 
#chains in the Genus database with same CATH homology
 2F0K A;  5G3L D;  1BO0 A;  2JEB I;  4RAU C;  1DXM A;  2L5T A;  3ND9 A;  2NUC A;  4NW2 A;  2F0Q A;  4H7B A;  5I4D A;  3K5L A;  5M5Y B;  3A55 A;  3SDZ A;  5C0X I;  4G4K A;  3SE0 A;  5C0X H;  2EE1 A;  4EGV A;  3J7A F;  2PZT A;  4DXF A;  1G8Z D;  3S16 B;  1G6Z A;  3T16 A;  1BCP B;  4A3G B;  1G29 1;  2LKV A;  3M7N A;  3J81 E;  4DF7 A;  1LV9 A;  3BDO A;  3L9A X;  3K5N A;  2GA4 B;  2NVX B;  3Q22 A;  1RHP A;  2L12 A;  1FNW A;  4IFD G;  2E75 C;  5ISR A;  3GQB A;  1SJH D;  1SND A;  2IX1 A;  2KOL A;  4LK1 C;  1TR5 A;  1HQR D;  3WDN A;  3MHB A;  2BA1 A;  4HAE A;  2EY1 A;  1CQF A;  3AB9 A;  1Y8O B;  2R7Z B;  2AQ3 B;  3BVZ A;  2PNR C;  3VA7 A;  3WOF A;  1DZ1 A;  1A15 A;  3BDC A;  3W3A A;  1KAB A;  1NCV A;  4K8J A;  3EA6 A;  1IYU A;  2A68 D;  3D3R A;  4XQN A;  1MD2 D;  2EY6 A;  1EU3 A;  1C4Q A;  2PZU A;  2ZT9 C;  3LX0 A;  3NK9 A;  1D5M C;  1KTK A;  4XXE A;  2CVR A;  3MXG A;  2AWN A;  1A6X A;  2JA8 B;  4DK1 A;  3F2U A;  3MTS A;  4G57 A;  1HCZ A;  1EFI D;  5M5X B;  3UI2 A;  3MZ5 A;  5CYU A;  3IL8 A;  4CJ2 C;  2R93 B;  3OMG A;  5DM7 3;  3LWU A;  3Q6S A;  3QB3 A;  3P1H A;  1LTI D;  2B2Y A;  2OEO A;  1JOQ A;  3S1Q B;  2Z4I A;  2NWG A;  5CGK A;  1ONL A;  3N6R A;  5D3D A;  1B53 A;  3SHL A;  2RDH A;  1EWC A;  3CHB D;  4EQO A;  4RWS C;  4I7Z C;  3JAM E;  1SXT A;  4F88 A;  4H44 C;  4ID6 A;  1Y1W B;  2D2C C;  4BA2 I;  1TKW B;  1DCZ A;  2LFN A;  3NTI A;  3GTG B;  3PUZ A;  4FYD A;  3IAY A;  1G91 A;  1FNV A;  1J9O A;  2BE5 C;  1B9N A;  3R3O A;  1HUM A;  2G9D A;  3I8Z A;  1H9S B;  1Q8I A;  5C4H A;  3BZD B;  3HG9 A;  1I4G A;  2A68 C;  5LHY 1;  1X3Q A;  2CHB D;  2A6H D;  3KLS A;  3QOJ A;  3X3M A;  5C4X B;  4HMJ A;  2KCC A;  1T5E A;  3HS0 C;  4FO2 A;  4K5W A;  2K28 A;  3G6J B;  4K5V A;  3P7J A;  1MGS A;  1XTC D;  3OIP A;  5CV9 A;  5T1I A;  1WTR A;  2F0O A;  1X32 A;  1JB3 A;  3Q23 A;  2NN6 I;  5T1G A;  3K5O A;  2F0P A;  5EKK A;  4C3J G;  3OWF A;  3W2D A;  1WTV A;  4DAY A;  4XTC S;  1DYQ A;  4DN4 M;  2A5H A;  4L6T B;  1QWY A;  3MA2 B;  5COY A;  5DNF A;  4KJO A;  4TSS A;  5E4W C;  2X6L A;  1KAA A;  2K05 A;  3Q24 A;  3VYT A;  3O13 A;  3K58 A;  2D5D A;  2A6E C;  4IAL A;  3BVG A;  5E4X A;  2L11 A;  3NWS A;  1IW7 C;  1CA6 A;  2Q8R E;  2K7V A;  4BBS B;  3DUZ A;  4A3E B;  3I4L A;  3TP7 A;  2XRS D;  1JOR A;  1S5E D;  3RUZ A;  1I4R A;  3A8I E;  1FD7 D;  3E6Z X;  1S5B D;  1WD0 A;  1CI3 M;  5FKA C;  4ZYS A;  3BS1 A;  1ZXT A;  2MUY A;  1JE4 A;  1B1Z A;  4CBV A;  1UUP A;  4OIJ A;  1PYW D;  4ZUI A;  2EJG C;  1VMC A;  1ILP A;  3VYU A;  2R61 A;  1EZ6 A;  5K36 G;  1D5X C;  4OL7 A;  2QKI C;  3PO3 B;  1LAC A;  1RTO A;  1EYA A;  1WVL A;  1EY0 A;  1OXT A;  1B2T A;  2BA0 A;  3PUX A;  2M2L A;  2H4O A;  3E0J A;  1B50 A;  4RGT A;  3MVV A;  5I6Y A;  4C3H B;  4G7Z C;  4KY5 A;  1F9R A;  4HSV A;  1U4L A;  5COR A;  4RHR A;  2PCF B;  1S5F D;  5E1F A;  3NP8 A;  4ILW A;  3HKZ B;  1SSO A;  2WP8 J;  3FPP A;  4C2M B;  3MXU A;  3T51 B;  3RZO B;  1VF5 C;  1GUW A;  2EJM A;  3ERQ A;  1XWE A;  4CKE A;  2Q8T A;  4N9T A;  4K8I A;  3P75 A;  2XSC A;  1L0X B;  3U9O A;  1CA5 A;  2RVL A;  5KNB A;  5FLX L;  4V19 0;  1A2T A;  1SYG A;  1PXU A;  3BG3 A;  1E2W A;  3S14 B;  3HZX A;  4XIG S;  4CKB A;  4TKO B;  4MHE A;  1CZW A;  2FMC A;  5IOC A;  5ELB A;  3C1F A;  3S2H B;  5M5W B;  1U9R A;  4K14 A;  5JEA G;  2EZV A;  3OPO A;  3NQI A;  5E3F A;  3FPU B;  1F2M A;  3GV3 A;  4WJW A;  3R93 A;  5CMD A;  5JEA J;  2B2T A;  2SOB A;  4A3I B;  2B2U C;  2PMZ B;  4XYQ A;  3VYS A;  1Q12 A;  1TU2 B;  1D1I A;  4DU9 A;  4KKT A;  4WFN 3;  1FYC A;  3J80 L;  5EJW A;  5A2Q L;  3KLR A;  2F3V A;  2WAQ B;  5EPL A;  3J7A V;  1HRJ A;  3KF8 A;  5HUR A;  1PRT F;  4S3S A;  1NUC A;  5G3L F;  1BNZ A;  1WTO A;  1RKN A;  4AYB B;  2ZXP A;  5F2D A;  1SYB A;  4X3K A;  2Q8I B;  1SBB B;  2E2J B;  2IW3 A;  1PTO H;  1BCP C;  3GTQ B;  4A3J B;  3PV0 A;  3V05 A;  4XT3 B;  5C6A A;  5EQ0 A;  1ZKO A;  1I4Q A;  1STN A;  1LLR D;  2KA7 A;  3TN2 A;  1L0Y B;  2ICE C;  1QCB D;  1ENC A;  2O5J C;  1F77 A;  4QUC A;  1PFB A;  5IGG A;  3OWE B;  2K03 A;  1TQO A;  4IQZ A;  4MN3 A;  4EVO A;  3KBG A;  3NE5 B;  1GHK A;  1SYC A;  2X69 A;  3T56 B;  3TME A;  4C3I G;  5JEA H;  1CFM A;  1R4P B;  1WTQ A;  1RF2 D;  1H9S A;  2RSO A;  1GHJ A;  1M4V A;  1DM0 B;  2DN8 A;  3RMH A;  5DAU A;  1EY4 A;  2K04 A;  2E2D C;  2F0M A;  1PRT D;  2HUG A;  1DD2 A;  2MP1 A;  1TWC B;  1TWG B;  1I3Q B;  2IPK D;  3C46 A;  1V1O A;  3AU7 A;  2IWH A;  1H9J A;  1WD1 A;  1K8M A;  3K0Y A;  1KDC A;  4ZUJ A;  2YYZ A;  1YNJ C;  4MIU A;  3QJY A;  3PUV A;  1SNP A;  4DNT B;  1JC7 A;  1O80 A;  1EEF D;  1STY A;  3DWQ A;  1O7Z A;  5J39 A;  5ELE A;  3EFX D;  1MBY A;  3J81 L;  3JAM L;  2F3W A;  3LWE A;  5J22 A;  2VB2 X;  1EYC A;  2VNU D;  1EEI D;  1TS3 A;  1IYV A;  4DXG A;  3K5M A;  4X3S A;  2FHT A;  1RCV D;  4B08 A;  2RBM A;  4CKC A;  2Y0S B;  4XDX A;  5IT9 E;  3TDQ A;  1XX8 A;  1AEX A;  5D3I B;  2HDM A;  2Z4H A;  1STG A;  4FXK C;  2A74 C;  3H94 A;  4F7X A;  1TWA B;  2VB3 X;  1SYE A;  3DWA A;  3KBX A;  4ZKB B;  2TSS A;  2AUJ D;  3TP6 A;  3TZD A;  2RKS A;  3MAQ A;  1OXU A;  2EYP A;  4F87 A;  5IGF A;  2AQ1 B;  1W6K A;  4XYO A;  3FDT A;  3ND8 A;  3BYY B;  1R4Q B;  1BOS A;  3QIA A;  4KY7 A;  1TY0 A;  1LTB D;  3DM1 A;  1SYD A;  4ODG A;  4N9P A;  1IKM A;  2LS0 1;  4HSP A;  3BVM A;  1E2V A;  2B2T C;  2MPM A;  4KN7 C;  5CV6 A;  2JE6 I;  4IN3 A;  2N55 A;  1NR2 A;  1PZI D;  4FF2 A;  5DEH A;  3I72 A;  1HTP A;  1BBX C;  2NVQ B;  5EKL A;  2F0I A;  2EY2 A;  4RFB A;  1QNU A;  1SMY D;  4NP5 A;  4PQX A;  3VR6 A;  1GJX A;  3IFD A;  2RDG A;  1FGB D;  4C3J B;  4OO1 H;  1EY7 A;  4Q0F A;  2NBF A;  2KHS A;  2F0J A;  4HN7 A;  1EY8 A;  2F0U A;  2QDB A;  3HOU B;  2IX3 A;  2K6A A;  1TS2 A;  3VR5 A;  5BN4 A;  5JVH 3;  5CV8 A;  4ZLT F;  3MEH A;  3M7G A;  2OXP A;  1CM9 A;  5M3F B;  5EPJ A;  4KK7 A;  4ZKC B;  1CK1 A;  2BDN A;  4OGQ C;  1IW7 D;  5FO9 B;  4A3B B;  3G7L A;  5EBD A;  2F0V A;  4RKL A;  1NR4 A;  2E74 C;  3HP3 A;  3A8J E;  1B9M A;  3GTL B;  2NTT A;  1A3U A;  4IFD J;  2FMM A;  1BUV T;  5I2Y A;  1M8A A;  4XQJ A;  1XYI A;  2BE5 D;  5C5L A;  3FMC A;  1ICW A;  1YNJ D;  2JSO A;  4V0B A;  1Z6H A;  4KY6 A;  1STB A;  3TP8 A;  2D9U A;  3R8B A;  2MJ8 A;  1F9Q A;  3N52 A;  1MSG A;  4C1N K;  4XT1 B;  3AMU A;  3H0G B;  4K6D A;  1ESR A;  2Z8L A;  1I4H A;  3SVM A;  1IL8 A;  3E5S A;  1Q90 A;  3CQZ B;  1EQV A;  4RCN A;  3J7Y W;  2O5I C;  4J1M A;  2J7Z A;  3OOC A;  1C48 A;  4TRD A;  1H9R A;  1CZG A;  1VMP A;  1LAB A;  4U68 A;  4A3F B;  4WRD A;  2EPB A;  5C3W A;  1Y8N B;  2HCC A;  1WTX A;  1AW7 A;  4BA1 I;  2B8G A;  3Q0A A;  2B2W A;  1II3 A;  2A6H C;  2QF7 A;  5KYI A;  5ELF A;  2EYH A;  1PTO F;  1PRT B;  4J6H A;  2JA5 B;  2IL8 A;  1GUT A;  1LTS D;  1FNU A;  4FXD A;  3K59 A;  5ELD A;  4FNF A;  1SNO A;  1RDP D;  1LT6 D;  1STH A;  2G9H D;  3OHX C;  3KK7 A;  1B4O A;  3QG1 A;  2O2L D;  5CV4 A;  4X3U A;  4PMW A;  1AZQ A;  3V96 A;  3OSO A;  4ZQ3 A;  1PZK D;  3CRL C;  4BY1 B;  2C9O A;  5LL6 X;  1Z47 A;  1ENF A;  2EYF A;  2PO4 A;  5FOB B;  4NMZ A;  2B2V C;  1K83 B;  1SJE D;  4Q5V A;  3VR4 A;  2BDO A;  3S17 B;  4KHV A;  4HCS A;  2NN6 H;  2AQ2 B;  2K5W A;  2L0C A;  1KNE A;  1I6H B;  1OXS C;  3OW7 A;  1V1P B;  3EQL C;  3NTK A;  2V4D A;  1U4M A;  2C5C A;  3HOX B;  3I73 A;  2SDF A;  3KUP A;  1IHZ A;  4KV6 A;  1HHV A;  4E6I A;  3GP7 A;  2Z1C A;  4H13 C;  2B39 A;  1ET9 A;  1ENA A;  2F03 A;  3D8G A;  1K8O A;  2KUM A;  3H6M A;  5FO8 B;  3S9W A;  2NN6 G;  3MXN A;  3D4W A;  3OMC A;  5BN3 A;  1GUN A;  3I90 A;  1CQV A;  2NVY B;  3RD4 A;  5IGB A;  2M00 A;  2KEE A;  3D31 A;  2WKC A;  2XRQ D;  4QIW B;  2CW0 C;  4OO1 I;  3NQT A;  1ESF A;  2F0D A;  4LJZ C;  2K5Q A;  4G7H C;  4RCO A;  2WKD A;  1TT2 A;  3VR3 A;  1CHQ D;  1UEA B;  5JPM C;  3GV6 A;  2IJ0 A;  4KJN A;  1FR3 A;  4RHS A;  2M9V A;  5IGE A;  2XN9 C;  1Z7T A;  3S1M B;  3S15 B;  2I07 B;  4BWG B;  1G2S A;  1LT3 D;  4M8A A;  1TII D;  1BR9 A;  1EOT A;  5KND A;  2JP1 A;  1QB5 D;  1Y8P B;  4KKU A;  1B3A A;  2LY7 A;  2L1B A;  2I46 A;  1S4Z A;  4WOR A;  5EBC A;  2EDG A;  2WAC A;  5KRU A;  1ILQ A;  2EY5 A;  4Z9C B;  3P20 A;  3M4O B;  3NBI A;  1EYD A;  1HQM C;  4QB4 A;  4HR7 B;  5EPK A;  3HEJ A;  2E2I B;  2H1E A;  3DHQ A;  4O42 A;  4R9W A;  2K5D A;  2AWO A;  1HA6 A;  1OXV A;  2PW5 A;  3DXJ C;  4HMI A;  2EOT A;  3C3L A;  1Q1B A;  4FVM A;  2DY7 A;  1NAP A;  5EGT A;  4ZK9 B;  1LT5 D;  1QG7 A;  3GD7 A;  3I4N B;  5FO7 B;  3SK8 A;  2K1B A;  1JIC A;  4ABN A;  3S1R B;  4QF4 A;  4DA2 A;  5IGD A;  1PFM A;  3SK4 A;  3NXW A;  3URY A;  1LTG D;  2PW7 A;  3WOE A;  1U4P A;  3MC0 B;  2VUM B;  2XIW A;  2RDF A;  4OIK A;  3MXP A;  1H9M A;  4O1N A;  5BN5 A;  4UAI A;  1HPC A;  3FRP B;  1BQQ T;  1DON A;  2BCO A;  2LMC B;  1S5C D;  3GTK B;  3D6C A;  4JBW A;  2HCI A;  3R2I A;  2VXW A;  3MWY W;  4IUN A;  3MFY A;  5M3M B;  1ET6 A;  4KMU C;  3DEO A;  3IFT A;  3BDL A;  4BBR B;  3HOZ B;  2F1M A;  4OO1 G;  4A93 B;  2F0T A;  4CGY B;  5FLX E;  4PMB A;  1HA5 A;  1D2B A;  1JOK A;  1B44 D;  1PZJ D;  2NZ1 D;  4EQP A;  2F0W A;  5I9P A;  5IGC A;  3L3O C;  2XWJ B;  3HOW B;  1DOL A;  4FXG C;  3TBI B;  3SK6 A;  2F0N A;  1KLU D;  1MI2 A;  3M4Y A;  1ZYR C;  3C2P A;  1HTL D;  1STA A;  5IT9 L;  3H3V C;  1GOZ A;  3RZD B;  3QWN A;  4RGO S;  2FIN B;  1CTM A;  5JVG 3;  2SNM A;  1C8C A;  3MFG A;  5CC4 A;  5C5M A;  1TS5 A;  4ULL A;  1CT1 D;  4ZAI A;  2F0F A;  3I70 A;  1CHP D;  4C3I B;  3SEB A;  3EVQ A;  3NBH A;  2OT2 A;  4K5X A;  2BOS A;  1PDQ A;  5IOD A;  3S1N B;  3M3Y B;  1QJO A;  4KHZ A;  3GTP B;  3T13 A;  2EYJ A;  1PTO B;  4C56 C;  1HUN A;  4DFA A;  1T5X D;  1EY9 A;  2L55 A;  4YIJ A;  1QNK A;  2O4X A;  4R8I A;  4C3H G;  3GO5 A;  2K01 A;  4DNR B;  3NWT A;  4L8J A;  5I6W A;  5KYL A;  1A3T A;  2KCN A;  4HED A;  2PPB C;  1AFP A;  1PRT C;  3ITP A;  1VCI A;  3RLF A;  4HTH A;  2QCP X;  3R2T A;  1ZYR D;  4KTA A;  2ICI A;  4IUU A;  1GUG A;  3V2T A;  3X3N A;  2A69 D;  2E2H B;  5NUC A;  1F2L A;  4R8N A;  3M85 A;  4FF3 A;  1WTP A;  2HQE A;  4B9W A;  1I6V C;  3CKI B;  3SR1 A;  4H0L C;  3HRZ C;  2ENB A;  1U4R A;  2B2V A;  5C0X J;  4IUP A;  3KLS X;  4KD4 A;  2KVM A;  2IT1 A;  4PMC A;  1V43 A;  1PTO D;  4I65 A;  5C0X G;  4Y7N B;  2L9H A;  1YNN C;  1EWH A;  5JPN C;  3ERO A;  1AZP A;  3T4A C;  4IUT A;  2SNS A;  2DNC A;  1EY5 A;  3CRK C;  3VR2 A;  2EXZ A;  4P2C B;  1WCM B;  3HOV B;  1RJT A;  3C1E A;  3VYR A;  4UDU C;  2XWB B;  1GUO A;  1KNA A;  2F0E A;  1R9T B;  3NHH A;  2B2U A;  3T53 B;  2EYO A;  2ZXR A;  4K2L A;  2X6G A;  2IX0 A;  2KED A;  4G7O C;  3ONA B;  3QOL A;  1HFN A;  1SYF A;  1EL0 A;  5C3X A;  5CV7 A;  4ME5 A;  4IFD I;  3NPP A;  1GUS A;  5ELC A;  2FFK B;  4CJ1 B;  3GTM B;  2EVB A;  3A7A B;  2EYL A;  2MGS A;  2MHV A;  2R92 B;  1E0B A;  4FF1 A;  5CR3 A;  1PMR A;  4RGM A;  3I3C A;  1HFG A;  1QIL A;  4PNY A;  3TSS A;  2JA6 B;  2F0S A;  2KQ3 A;  4BY7 B;  2J4X A;  3PO2 B;  4M1U B;  1IKL A;  3A7L A;  2A69 C;  3GTJ B;  1PLF A;  2CQA A;  2KJX A;  1SEB D;  4DAP A;  4LAA A;  5C4J B;  4DK0 A;  1EIH A;  1SNM A;  4QCL A;  1F9S A;  3BYT B;  2NYZ D;  1AN8 A;  2QEJ C;  1TS4 A;  1TWF B;  1GXD C;  3TP5 A;  5K5P A;  4RGN A;  1KDB A;  1Q1E A;  1RD9 D;  2NVT B;  1HXY D;  3A56 A;  2JYO A;  1H9K A;  4XQQ A;  1J8I A;  2E76 C;  2DY8 A;  4RKB A;  1XXG A;  4KN4 C;  1SE2 A;  2B63 B;  3NTH A;  3D4D A;  1SNC A;  5TSS A;  1I50 B;  2F0H A;  4JK1 C;  1D1K A;  1D6E C;  2HDL A;  1BCP D;  5J1Z A;  2R6G A;  1EY6 A;  1DOM A;  5D65 A;  2ZXO A;  4KKS A;  2OF1 A;  2PYK A;  4PV1 C;  1SAP A;  1SE4 A;  1SE3 A;  3H09 A;  1EU4 A;  3K7A B;  2D62 A;  1JR0 D;  4IZ8 A;  1STE A;  4DGZ A;  4NDX A;  1BF4 A;  2JEA I;  2RA4 A;  2JA7 B;  2XVS A;  2WIN B;  1VF7 A;  1NSN S;  3DMU A;  1MSH A;  1V1P A;  4FF4 A;  2FJ2 A;  5KGU A;  5CBE E;  1E2Z A;  2PZW A;  2B2W C;  2J0T D;  5CBA E;  3PUW A;  5C4Z A;  3HGB A;  1JCK B;  5M9O A;  2EJF C;  1KDA A;  1LTT D;  1I4X A;  1JOO A;  2YU9 B;  5JOB A;  5KIX A;  5C3E B;  1LO5 D;  1LT4 D;  2B8F A;  1OXX K;  3PMF A;  1F2Y A;  2RSN A;  1Y69 U;  2ID0 A;  1KLG D;  4A3M B;  5DM6 3;  4TQU S;  3VA5 A;  1VDZ A;  1JQY D;  3FEW X;  4K2K A;  1BCP F;  1QE6 A;  5A35 A;  1TY2 A;  1D5Z C;  1O78 A;  2EYM A;  2K33 A;  2K32 A;  1BDO A;  2A6E D;  4FP5 D;  1JWU D;  4IFD H;  1PFN A;  1AP0 A;  2CW0 D;  1TWH B;  2AUK A;  5HGT A;  3NSW A;  2WV6 D;  4KD3 A;  1F9P A;  4DAV A;  4QUF A;  3SXH A;  3QO2 A;  3FVQ A;  2DNE A;  3DWP A;  5JJZ A;  5I2X A;  5KEE A;  1EIG A;  4IUR A;  2F4I A;  4KI0 A;  1JWM D;  5JAV A;  3IKJ A;  3DEP A;  3HOY B;  2WB1 B;  2QIL A;  4B9X A;  2RQX A;  3OIQ A;  3PUY A;  4ZRZ A;  1O7L A;  3A8K E;  3FKI B;  3EJI A;  1OO9 B;  1SMY C;  3J80 E;  1BXT A;  3CU7 A;  1EZ8 A;  4GZY C;  4BS9 A;  4CJ0 B;  4A3D B;  2KEC A;  3A54 A;  4J8Q A;  3SK5 A;  1S5D D;  1ZEQ X;  4CHT B;  3D4R A;  4L63 B;  4RA8 A;  3PIP 3;  3PIO 3;  4HCE A;  4F8M A;  5K36 H;  2PQE A;  3TZU A;  1WTW A;  3S2D B;  1SNQ A;  4U67 3;  4OHJ A;  1G2T A;  5KNC A;  1ML0 D;  1YNN D;  1RTN A;  2XNA C;  1PTO C;  4IUV A;  4NKL A;  5FK9 C;  5IIF A;  3I91 A;  1SDF A;  5EKI A;  4QMG A;  4X3T A;  1F2Z A;  4A3K B;  2NTS A;  3D6W A;  1X3P A;  2F0G A;  4K6L A;  2JXM B;  2TMP A;  1I4P A;  2A73 B;  3H91 A;  1TVX A;  2N88 A;  1LTA D;  3K57 A;  1ROD A;  1LTR D;  3LNN A;  3K6O A;  1V8Q A;  3ZYY X;  5A2Q E;  5C44 B;  2NB0 A;  1QOH A;  5CV5 A;  5LL6 S;  5D14 A;  3GTO B;  1JWS D;  1SFO B;  2WII B;  1UNS A;  2F0L A;  4IUQ A;  1EQT A;  2L4N A;  1O7Y A;  1W6J A;  1Y1V B;  1UAP A;  3L7Z C;  2SEB D;  3NUC A;  1A3V A;  1Q3L A;  5AFW A;  4C1N I;  2B2Y C;  1DOK A;  4LMQ D;  4RH6 A;  2R3Z A;  3I4M B;  5I9O A;  4EQN A;  3U9S A;  1DJR D;  1A2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...