5IGGA

Crystal structure of staphylococcal nuclease variant delta+phs v66h/i72e at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
130
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKEEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66H/I72E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5iggA00
4G57A 2F0TA 2RBMA 3P75A 4K5VA 4IALA 4YIJA 2F3VA 3OMCA 5ISRA 3ERQA 5IGDA 2EYJA 1EY9A 5E1FA 3SK5A 5CV4A 2F0NA 4H7BA 2F0JA 4K2KA 5DAUA 3SXHA 1A2TA 3TP8A 1F2MA 4IUNA 2WACA 5IGEA 2NUCA 2EXZA 3NP8A 1SNDA 5IGCA 2EYLA 3TP5A 3SHLA 4KV6A 1EQVA 1TQOA 1EYAA 2F0VA 2SNSA 4DU9A 4EVOA 5I9OA 1STHA 4PNYA 2SNMA 1SYGA 5EKKA 2EYHA 1EYDA 3BDLA 3HZXA 5CGKA 2EY1A 1U9RA 1IHZA 2EYFA 5C4ZA 3BDCA 2SOBA 3D4WA 4NDXA 5KIXA 1KDBA 5I6WA 5CV9A 3HEJA 4K8JA 2OF1A 2OXPA 2F3WA 1SNPA 3SK6A 5CV6A 2ENBA 4K6DA 1A3UA 2F0PA 2F0FA 2PYKA 3NQTA 5IODA 5KGUA 1STYA 4HTHA 1TR5A 3TMEA 1KDAA 5CV5A 3RUZA 1KDCA 1SNQA 3EROA 1EY4A 4NP5A 4ID6A 2PW5A 3D4DA 1A3TA 3P1HA 4QB4A 4TRDA 5EKLA 2PZTA 4NMZA 5CC4A 5J39A 5E3FA 4KTAA 1EZ8A 4RKBA 1JORA 4KHVA 4PMCA 3T16A 1NUCA 2QDBA 4K5WA 4R8NA 5JOBA 4B9XA 3R3OA 4N9PA 5C3WA 4K14A 5K5PA 1JOKA 2EYPA 2PZUA 3MHBA 5DEHA 4B9WA 5J22A 1A2UA 3U9OA 2O4XA 1EYCA 3E5SA 5I6YA 1AEXA 4NKLA 1II3A 5C5MA 5KEEA 5CV7A 2F0GA 3NHHA 2EYOA 4DGZA 3DMUA 1NSNS 4K8IA 3SR1A 5IGBA 3H6MA 4LAAA 4QMGA 4F8MA 3EJIA 1JOOA 1RKNA 5HURA 3EVQA 1STAA 1SYDA 3MEHA 2F0LA 3MZ5A 4KY6A 5KRUA 5IGFA 3DHQA 1SYEA 1SYCA 5C3XA 2F0MA 1EY6A 2F0SA 4ME5A 4I65A 5M9OA 3C1FA 3T13A 4KY5A 5C6AA 1F2YA 3C1EA 4KJNA 3TP7A 5HGTA 3OWFA 1EY0A 4J6HA 4ZUJA 5JAVA 5KYIA 2F0KA 5C5LA 5IGGA 1SNOA 4N9TA 3NK9A 3TP6A 2PZWA 3SK4A 5F2DA 4EQPA 1SNMA 4DFAA 1KAAA 2M00A 2OEOA 4KY7A 4MIUA 1SYBA 1SNCA 3ITPA 5IOCA 1STNA 4RKLA 2F0OA 1STGA 4HMJA 3VA5A 2RKSA 4IZ8A 2F0QA 1ENCA 1ENAA 1EY8A 2KQ3A 4OL7A 5KYLA 3QOJA 4QF4A 4ZUIA 4DF7A 4WRDA 4HMIA 4EQOA 3V2TA 4S3SA 2RDFA 5C4HA 2F0DA 2EYMA 2F0IA 4K5XA 1F2ZA 4KD3A 5IIFA 4J1MA 2EY6A 4F7XA 3S9WA 3D8GA 4ZQ3A 2PQEA 1JOQA 3QB3A 3MVVA 3LX0A 3MXPA 1A3VA 2F0HA 2LKVA 4KJOA 5EGTA 1KABA 1SYFA 1EY7A 2F0EA 3PMFA 4K2LA 2PW7A 2F0UA 1TT2A 2HQEA 4E6IA 2F0WA 2KHSA 3OMGA 1EY5A 1STBA 3NXWA 4ODGA 3SK8A 2EY5A 3OSOA 1EZ6A 4KD4A 4PMBA 5I9PA 4WORA 3QOLA 2EY2A 5CV8A 5CR3A 5NUCA 3NUCA 3D6CA 4EQNA 5J1ZA
chains in the Genus database with same CATH superfamily
2Z1CA 4IQZA 4MZ9A 5D65A 4JV5L 2MO0A 2CQOA 4UP9A 1BCPF 1LV9A 3M4QA 1I4HA 3CRLC 3I7FA 4DR6Q 5EKIA 1VQDA 5EKKA 2K32A 1M4VA 3PF5A 1BUVT 4C2MB 3ULLA 1NJIC 2B2WA 4DR3L 4RGTA 2VQEQ 2NVQB 3HEJA 2R7ZH 4JI4L 2OXPA 3ICEA 5JEAH 1HNWL 1SNPA 5C4JB 4DV3L 4LF7Q 3CMEA 1PFMA 4DUZQ 3HGBA 4IUTA 2HIXA 3JAME 2DJGC 5D3IB 5DM63 3BZKA 1CI3M 5IP9H 4A3EG 1LTLA 1YJ9A 4DV1L 4FF2A 3VR3A 1RDPD 3KF8A 4PMCA 1ET6A 5JOBA 1S3OA 2IT1A 1HNZL 1JCKB 2DNEA 2Z6BA 4RHSA 3HFZB 4OO1G 2A19A 4OX9Q 2UUCL 2PCFB 4DV2Q 4GLAC 4A3DG 3VR2A 3CCSA 4DXGA 1X3PA 3FHWA 3AMUA 1SRUA 2RQXA 3RNUA 4K0KQ 3AFPA 3MXUA 1LT3D 4DR7Q 2UXCQ 1ONLA 4AYBB 1GUTA 1MHWC 1TS2A 5IE8A 2UXDQ 5IGGA 2RSOA 2A73B 1SNMA 2OT2A 4GNXB 5A2QE 1CHQD 2NVYH 3TSSA 1XNRQ 1VQ8A 3CCUA 4YCUA 2NBFA 4A3JB 4IZ8A 4C3HB 5KYLA 4KLKA 3RLOA 2UXBL 4EQOA 3VYRA 2HHHL 3J7AV 4KD3A 3NELA 4RA8A 3ZYYX 5C3EG 1BBWA 2VZAA 5EGTA 4JI1Q 3CCJA 1VMCA 1R4PB 3NE5B 3H09A 4A3BB 2VUMG 4DV7Q 1GHJA 1STBA 3FEWX 1Q81C 3A74A 3LGJA 1S5DD 2EY5A 3I56A 1U4LA 2O2LD 3KYHC 3OSOA 5NUCA 3KJOA 4AIMA 1AE3A 5ISRA 4YIJA 4YWLA 4RGNA 1XNQL 3KLRA 1MBYA 4CDFC 1K3BC 1F2MA 2DNCA 1PHJA 4KKTA 1D6EC 2B8GA 5TSSA 1XJVA 2B39A 4X64Q 1AW7A 4O1NA 3AEVA 4A3KG 1U9RA 1IHZA 2EYFA 5C4ZA 4A3MB 1KDBA 5I6WA 1EL0A 3CC2A 2TSSA 5C0XH 4IPGA 2NVTB 4UP7A 5IYBG 2YU9B 4LJZC 2WB1B 1WVLA 1PTOB 3SEBA 1HHVA 1PTOD 2RCNA 1G51A 1N36Q 3MAQA 1X3QA 5FLMH 1K28A 2A74C 3BS1A 2RSNA 3ND9A 1KAWA 2C35B 3ZJYC 5GAGC 1EZ8A 3CCLA 4A3LG 1RIPA 1C8CA 3IAYA 2CWAA 1NUCA 4C2MH 2C5CA 4X65L 1HXYD 2DGYA 3UDIA 1LT4D 3MHBA 5J3BA 2EXDA 3A5UA 2Z4IA 1KIXA 1N33Q 3GTMB 4B3RL 1HZAA 1DJRD 2K01A 4QJFA 5JJLA 1HTPA 3ND8A 4PV1C 4BY1B 1PH3A 1D5XC 3X3MA 3M9BA 1NY4A 4QUFA 2F0MA 2XTIA 5DNFA 4POGA 1L0WA 1TXYA 1EQTA 2NN6H 3C1EA 3CD6A 2PQAB 5F2DA 3VR4A 3M4PA 4JBKA 4MIUA 4YY3L 3HOWB 4HMJA 5G3LF 1LT6D 1R9TH 3RR5A 1QNUA 4DF7A 1EQRA 3MTSA 4GN4B 4HR7B 1TWCH 1WTOA 1BO0A 2E8GA 4GOPB 3M7NA 4OWWB 3D8GA 1A3VA 1LTBD 5ELEA 3J81E 4GKJQ 1TVXA 5ELCA 2OTLA 1ILPA 3PIP3 4PZ8A 4UY8C 3DM1A 4WORA 4C3HH 2E75C 3TREA 1XX8A 1W6KA 4QQBX 1KL9A 3T4AC 3WOEA 4GNXC 1Y1WG 3HOZB 3K57A 3CU7A 5DAUA 2CVRA 2VW9A 1TKWB 2XRSD 1ICFB 4JI5L 3SHLA 4EVOA 2Q2IA 3BDLA 5CGKA 4HIKA 1WTWA 4A3BH 2EY1A 2ZXPA 1S4ZA 3D31A 3AYHB 5KIXA 2A6ED 1XMOL 2JSOA 1YHBA 2OQ0A 3T1HQ 1FJGL 1W2BA 3H3VH 2ENBA 4HJ5A 4A3GH 4LFCL 1TR5A 1D1IA 1I4PA 5CV5A 2ZJQA 4LF5Q 4BY7G 4JI6L 1MI2A 5CORA 3D4RA 2LXJA 2PZTA 4NMZA 3U4VA 3CPWA 3KLWA 4I7AA 4F87A 1QNKA 4A3MH 1JWSD 5KNDA 1AEXA 5KEEA 1HZCA 1AN8A 2D0PA 2NVTH 4QL5A 4BBSB 3HOXG 4HJAA 3KF6B 3I4MH 4B3MQ 5ELOA 5M3MH 1SYDA 4RH6A 2LS01 3MXNA 3T53B 4C3IH 1QZHA 1IBML 3GDEA 3CC4A 2WINB 1O7IA 5GROA 4QGUA 4I65A 5M9OA 1CTMA 2NYZD 1EFID 5C44G 4LF4Q 1K73C 1C4QA 1IYVA 2A5HA 4IO9A 1D5ZC 1NAPA 1YVCA 2M00A 1DONA 4BY1H 1N34L 2WB1E 2CHBD 1T5XD 2B8FA 2F3IA 3PIO3 4X3KA 5M5WB 1VQMA 2K03A 4NB3A 2M2LA 4HJ7A 5JPNC 2F0IA 1VQAA 2HIVA 1Z6HA 1PV4A 2R7FA 3CQZH 4BXXH 3S2HB 1VMPA 1K9MC 2BH8A 1EQQA 3K80C 3HOWH 1PRTB 3DWPA 3I55A 5EBCA 4X62Q 3A0JA 5CYUA 2IY5B 2PI2E 3CAMA 4PZ6A 3OMCA 1ILQA 3M3YH 3ERQA 1P8LA 1D5MC 3DM3A 3RMHA 4TVAB 5IGCA 1HH2P 1TIID 1VCIA 2NZOA 1LUZA 2A8VA 1IYJB 1STHA 1GUSA 3S16B 4DR6L 2PPBC 4C3JH 1X9NA 1J9OA 3S1NH 2B63B 4GOPC 4FF3A 2EE1A 1B70B 5AJ3Q 2F0PA 1C9OA 3JAML 3HOZH 4DUZL 3F2CA 2JA6B 2F52A 4FXGC 2VQFQ 2LMCB 5CBAE 1XPOA 5CC4A 2CH4W 1BBXC 1JORA 1EEFD 1I4QA 4XTCS 5C3WA 1H9MA 3G48A 3FKIG 5IYDG 5GQOA 3S17H 2RHSB 4XQNA 4DV6L 4OX9L 3GTOH 1H9SB 1K8OA 4DUYQ 4R4QA 1JICA 2Q2HA 4DAYA 2K5WA 4QMGA 1EUJA 2A6EC 4KY6A 4WFN3 1Q90A 2K7VA 1U5KA 1SDFA 1B53A 2R92B 1PH9A 5GAEC 4OWTB 1YNXA 3GTJB 4K0KL 3U58A 4DR7L 2VB3X 5JAVA 5C5LA 4PQXA 1DOLA 2K5NA 5A2QL 1VQ5A 1FR3A 3HOVB 1UNSA 5HGQA 1STGA 4GN5A 3PV0A 1ENCA 3KFUA 4UPAA 3A5ZB 3SGIA 1ESFA 2EVBA 4MNOA 1PTOF 3I91A 4PG3A 1I4RA 1J5EL 1KABA 1IBKQ 2Q8RE 3ONAB 1HPCA 4JK1C 3PUVA 1B3AA 4DV7L 5M5WH 2K5HA 4N8X1 2DN8A 1OXVA 2GVBA 4OELB 3I4NG 2AQ1B 2K5DA 4JBWA 1EOVA 1NR4A 2F3VA 1G6PA 3L2PA 4YHHL 3J81j 4DK1A 2EDGA 1SROA 4GLVB 1Y69U 2KCMA 2EXZA 1XWEA 2DJFC 1QUQB 5EPKA 1S5ED 3PO3G 4LK1C 3CXCA 2ID0A 1IW7D 3NWSA 4X64L 3S2HH 1B9MA 3GTKB 2RHQB 2JA7B 3H0GG 2ZTDA 1DOMA 2IJ0A 4HCSA 2KBNA 3SK6A 3GTLB 4K6DA 4DNIA 4EX5A 2KHJA 1PZID 1Q8KA 3PQIA 1SFOB 1K8MA 2AUJD 1EOTA 4OIJA 2B29A 1BCPC 3A7AB 1VQ9A 5LHY1 2FINB 3R2IA 4IFDH 3P7JA 1EIGA 2IWHA 3H91A 3W1BA 3S16H 1ML0D 2MFIA 2UU9Q 2L1BA 1L0YB 4ME3A 2E2DC 2KCTA 1HR0L 1KTKA 4K8IA 1GUGA 2JA6H 2GA4B 2WKCA 1F77A 4A93H 2L11A 2JA8H 4MTNA 1I4GA 2K50A 2FMCA 1SYCA 4ZRZA 1BDOA 1E0BA 3CCQA 2HUGA 2IHEA 4DR1Q 3AU7A 3EFXD 3T51B 3BYYB 3GTGH 3RN2A 2OEOA 1GVPA 4UHVA 2L9HA 4ZKCB 1MKHA 3GTPH 5M5YB 4WRDA 3EIVA 5C4HA 2UUBL 2D2CC 1FVIA 1Y8NB 2EY6A 3GTJH 5FKAC 3MVVA 4EGVA 5GAHC 2J7ZA 3P20A 3J81L 1WCMG 3HOVH 3BU2A 2KEEA 4E6IA 1JWMD 1TWGB 3ULJA 4A3EB 4GKJL 3OIQA 3SK8A 3K81C 4GKKQ 3QOLA 1KLUD 3TP5A 4F88A 4CJ2C 3P75A 5FJ8H 4LFBQ 5IGDA 1VQPA 5CV4A 1ZYRC 2VL6A 3UE1A 2J0TD 5JEAG 4PZ7A 1F2LA 1TWFB 3BZDB 1BBUA 4A3DB 1IKMA 1X55A 1PH1A 1OTCA 3PUZA 1EYDA 3AFQA 4BBRH 5A35A 2JA5H 2Z8LA 3RZDH 3UE0A 4LNQA 1B3QA 4Y52H 1PFNA 4K8JA 4A3IG 1A15A 1ENFA 1VQJA 3T1HL 2BE5D 3CRKC 4DR5Q 3RD4A 1VQFA 2AQ2B 2ZM6L 1VF7A 4LF5L 3I4LA 4JOIC 3WOFA 3VR6A 1WTXA 2E2IB 2O5IC 1YEZA 4U68A 2E5LQ 3GTKH 4N9PA 2JA7H 4C56C 1SSOA 1MD2D 4IPHA 2CWPA 2WFWA 1I6VC 2KJXA 5CV7A 3GTLH 4L63B 2B2VC 1IW7C 1SFOH 5C3EB 4NXNQ 4A3FG 2K33A 3NBHB 2CW0C 1RF2D 4B3ML 5KRUA 1L1OA 1SYEA 4IUQA 1PRTF 3TS0A 2VUMB 1QVFA 4JI3Q 2QEXA 2NVXB 2BDOA 4KKSA 1YJWA 3TP7A 3E3XA 3FMCA 2VNUD 1L2FA 3BJUA 5KYIA 1JB7A 1V1PB 4N9TA 1JMCA 1CFMA 2IX3A 4HIDA 3CCRA 1RD9D 3R8BA 5KNCA 3TS2A 3S24A 4OEMB 4RKLA 2YTXA 4OL7A 2JN4A 3G71A 3A56A 4ZUIA 4A3KB 1PLFA 5D3DA 1QB5D 4X3SA 1P16A 2R93H 1ET9A 1PVOA 4K5XA 1TWAH 1F2ZA 4MTKA 4HN7A 1E2VA 2ZJPA 4DV5Q 1TS4A 2F0HA 2NB0A 3N6RA 1NMGA 5I2YA 1LTAD 2LXKA 2KOLA 2KHSA 3GQBA 1QCBD 4L5SA 1KD1C 2H5XA 1EIHA 1E24A 2JJQA 5M5YH 4X62L 1Q46A 4M8AA 2JYOA 5BN5A 4I7ZC 5J22A 1O7LA 2XGTA 3NP8A 3F2BA 5C0XG 1Y8OB 1TQOA 3S15B 4A3EH 4DN4M 1TWGH 1W6JA 3F2UA 3TDQA 5LMUL 4IUPA 4R4CA 4DPGA 2F3WA 4CDCC 3QG1A 5CV6A 4CKEA 5AJ3L 1C7YA 4DR2Q 2X6GA 5FO8B 4OO1H 2LSSA 1TWFH 2VB2X 4AQYQ 2L15A 2Z4HA 2VQFL 2YTVA 1GO3E 3T16A 4B9XA 1JT8A 1VF5C 1JOKA 2B2WC 1JB3A 3T1YL 1SAPA 3S1RB 1IZ6A 3PO2G 1E22A 4P73A 2E2HB 2NZHA 2Y0SG 3GTQB 2EYOA 2EZVA 3I72A 1I94Q 1HNXL 4DUYL 4QUCA 4C1NI 4G7OC 3URYA 3FRPB 4BS9A 3PIPA 3HKZB 2F0SA 1Q1EA 1AH9A 2BE5C 4DNTB 2V1CC 3CPFA 1E1TA 2A1AA 3DEPA 1I6HB 4ZUJA 1EY0A 2I5LX 1CKNB 5FO7B 2NVQH 1Y1WB 3Q23A 3A55A 1Q82C 5C4JH 1KAAA 1SJHD 3FDTA 5DLQE 4P75A 1WD0A 4B3TQ 1BVSA 1SMXA 2BA0A 1EYGA 1RTNA 2VUMH 4X3TA 1OO9B 1B7YB 1H9JA 4HSPA 5IIFA 2EQSA 2BA1A 4LFAL 1VQLA 3QB3A 3LX0A 3FPPA 1JWUD 1SE8A 1O7YA 1EY7A 2F0EA 5EQ0A 2E2JB 3DEOA 4BY7B 1TT2A 1UE6A 2X6LA 5COYA 2XWJB 1Q86C 1WJJA 1IBLQ 3J7A5 2AQ3B 5CV8A 2B2UA 3D6CA 3KOJA 4A3KH 3NTKA 1PYBA 4QIWB 3GO5A 1NMFA 3TRZA 4ILWA 2N88A 1HUMA 1EWHA 1FNWA 3TP8A 1E7ZA 1SMYD 4FYDA 1SNDA 5IYBH 1Q7YC 4KV6A 3HOXB 4A3GG 3A8IE 3K59A 1K0SA 1AP0A 2FFKB 2KHIA 3D4WA 4NDXA 3HKZG 2NTSA 3RZOB 2DUDA 1LTID 4A3LH 4HIOA 2CCZA 1PH2A 4DR4L 3OTOL 4A3JH 1VDZA 5C44B 4IPDA 3TMEA 3RUZA 1HZ9A 1X54A 4X66Q 4NPSA 1MJCA 2Y0SE 2PW5A 1SR3A 2CQAA 3PIOA 4QB4A 4TRDA 3V96A 3HG9A 4LUZA 2JEAI 4KTAA 5JJKA 2QILA 1B44D 3F2DA 4JYAQ 5EPJA 3I4MG 2N49A 2PZUA 2QA4A 1A2UA 4C3IG 3E5SA 5I6YA 4NKLA 3WWVA 4ZKBB 3K5OA 1NSNS 5IGBA 1VQEA 4JI7Q 5EBDA 1W3SA 1RJTA 5HURA 1Y14B 3MEHA 3HOUG 2PQAA 4HCEA 4JCVE 3VYTA 3H15A 3IFDA 4HJ9A 3KUPA 5K36G 3UI2A 3MWYW 3S1RH 4DR1L 4K6LA 1KNEA 5BN4A 3GTQH 4GOPA 3CKIB 1LLRD 3OIPA 1I3QB 2QF7A 3ITPA 4IUVA 2YU9H 1PTOH 3BZCA 3MFGA 2RKSA 4APVA 2RVLA 1LABA 3C3LA 4H13C 2K5VA 4QCLA 1CQFA 2IL8A 2XNAC 3HP3A 1YNND 4JBJA 4XQQA 3SVMA 4TSSA 3GV3A 2JK8A 3GTMH 1HFGA 3U4ZA 4DV3Q 3OMGA 2MO1A 1ESRA 4R4IA 1G6ZA 3JAMc 1PDQA 5T1IA 2B2YA 3R93A 2SEBD 1HA6A 3FPUB 1LACA 1FYCA 3A54A 4RAUC 2MP1A 3HKZE 4DV1Q 1UAPA 1EY9A 3FKIB 4R4TA 4H7BA 4IUUA 3SXHA 1XMQQ 1YITA 4L6TB 4IUNA 1QVCA 1HNZQ 5BR8L 1EQVA 1A8VA 1SYGA 2E2JH 5M3FG 1YHQA 2SOBA 1GM5A 2LFNA 4RHRA 1T5EA 1BCPB 4KHZA 1BCPD 2ICEC 3KLSA 1A3UA 5IODA 4DAPA 2WAQG 1KNAA 3D0FA 1RCVD 3NWTA 1KDAA 1DZ1A 4NP5A 2X69A 1JC7A 4H0LC 4A75A 3FVQA 5HY6A 1AFPA 3EBEA 2XRQD 2LY7A 4FDBA 3I2ZA 4FP5D 3U9SA 1D7QA 3KF6A 2I46A 1WYDA 2JE6I 2E5LL 1C0AA 1SMYC 3RZOH 4EQ5A 3G7LA 3DUZA 5IYCG 4MHEA 1BR9A 2ZT9C 2ES2A 2VQEL 3DMUA 2AUKA 3NEMA 4QIWE 3N52A 4LF7L 2UXBQ 1JOOA 4NXNL 1STAA 2HHHQ 1LT5D 1SXTA 3J80i 2Z9HA 5C3XA 1PH6A 1L0XB 1H95A 1WI5A 1SE2A 3X3NA 3C1FA 4JI3L 4N8FA 3DWQA 4NXMQ 3I4NB 2JQOA 1I50B 1DD2A 3TBIB 1GD7A 1OXUA 2NWGA 4KY7A 1SYBA 1CKOA 1UUPA 3K5NA 3CHBD 2BH2A 4CJ1B 3S14B 4DV2L 3PO3B 2Z6KA 4XDXA 1V8QA 3MEFA 1XNQQ 4M1UB 4XYOA 4QF4A 3TEHB 3TQYA 4HMIA 4OWXB 3H0GB 3T56B 1EWCA 1CKMA 3CCMA 5H1SE 2LKVA 4IN3A 3KBGA 4A4IA 4P2CB 2UXCL 1STEA 1K83B 1D1KA 1ICWA 2F0UA 1G91A 1G2SA 1I3QH 2ZTCA 2UXDL 2F03A 4CBVA 2IHFA 3CMAA 2A69D 4BBSH 4LF8Q 1ZYRD 2EY2A 4QY7A 5CR3A 3OW7A 1XNRL 5GADC 3G6EA 4ZLTF 2KA7A 4OXPA 2HT1A 2D62A 2Z0SA 2F0VA 2B2TA 5FK9C 3HOYG 2K05A 4Q5VA 2D0OA 4B3RQ 2HDMA 3KDFB 4JI1L 1RL2A 1PYWD 1LTRD 1YNNC 3W1GA 3RN5A 4IFDG 3NQTA 2K14A 1HFNA 3DLLA 2XSCA 2Q8TA 3UDFA 1DXMA 2H4OA 3FKIH 2VS1A 4O42A 4DR2L 1X3GA 2EIFA 3S1QB 4A3CG 1B4OA 1NR2A 3D4DA 1H9SA 4JI8Q 2KECA 4AQYL 1VS0A 4CHTB 1PH7A 2K6AA 1UE1A 2QDBA 5C0XI 1UEBA 4A93G 2ZXOA 1IL8A 3STBC 3VR5A 4B9WA 2JA8G 1VQKA 2CW0D 2ATWA 1SN8A 2PMZE 1DYQA 2MHVA 2HCCA 1S5BD 3H6MA 4LAAA 1CM9A 1I94L 3EVQA 3A8KE 1NNXA 2XWBB 3PCOB 4BA2I 1WCMB 4ULLA 2M9VA 3OPOA 1N36L 1BOSA 1HA5A 4L8JA 1YNJC 4CDEC 5C4XG 3W5OA 3IKJA 2A68D 3J81c 4J6HA 4J8QA 1GUWA 2OTJA 4P74A 4GZYC 2B63H 2PZWA 2MNAA 3MC0B 4B3SQ 1CK1A 2G9DA 1N33L 4DK0A 2ZTEA 3KJPA 1YHAA 4B3TL 5EJWA 1WOCA 2UUAQ 3I4OA 4R1JA 1RTOA 4S3SA 2MGSA 2N8NA 4A3IB 1QWYA 2IW3A 3O13A 3VA7A 1Y1VG 1JR0D 3OYYA 4UP8A 1E3PA 1XMOQ 4DAMA 5FJ8G 1LYLA 1SEBD 3ERSX 1FL0A 2JA9A 3H94A 5M5XB 1BF4A 2FMMA 4ABNA 3S14H 1QUQA 1WTRA 4RWSC 1EWIA 2PNHA 2Q8IB 3K58A 1N9WA 2RBMA 4BBRG 4WJ4A 1EIYB 2JA5G 4IJHA 2YV5A 2HCIA 2R92H 3A7LA 1FGUA 4RMFA 1U4RA 4KHPQ 4A3FB 2ICIA 1K83H 4P72A 3A8JE 4UAIA 1VQ6A 4LW1A 2MJ8A 2FJ2A 1NTGA 2GN5A 4LF9Q 1K8GA 1GJXA 1KRSA 2PYKA 1JQYD 5KGUA 1IBMQ 4JI2Q 3K0XA 3Q8DA 2FXQA 2A69C 4X66L 2MPMA 1FNUA 3NTHA 2BDNA 2Q2TA 2R7ZG 5E3FA 1MJEA 4YCVA 3S2DB 2AHOB 3VYSA 4DK3C 2EOTA 4JYAL 1KRTA 3H3VI 4K14A 2AWNA 2QEJC 1A63A 5DEHA 3CCVA 4P71A 5IP9G 1EYCA 4POFA 2GVAA 1N34Q 1SE4A 3AB9A 2F0GA 1K3RA 1SLJA 3BDOA 3E0EA 3E9HA 4DGZA 1WTQA 3K6OA 3KF8B 2RF4A 1WD1A 4JI7L 3S1QH 3MZ5A 3GV6A 4R9WA 5IGFA 3DHQA 2I5MX 2YYZA 2NZ1D 3DXJC 4DK6C 1QJOA 3F1ZA 4ME5A 4KI0A 4X6AH 4DNRB 3J7AF 1PZKD 2AKWB 3OWFA 3SK4A 4EQPA 2OQKA 5JEAJ 2ZXRA 1H9KA 1EIFA 1WCMH 2F0QA 2KQ3A 3NPPA 3K5MA 1GHKA 1IXRA 1SBBB 3I8ZA 3F8TA 2QDLA 4WJWA 2EYMA 1F9RA 1VQ4A 2PQEA 1AZPA 3QWNA 5IP7H 3MXPA 4KJOA 1AZQA 3M85A 4KK7A 1OXSC 3PMFA 1PA6A 2YTYA 4LF4L 2PW7A 2HQEA 2QW7A 2A6HC 2PO4A 1CHPD 2A68C 4LUVA 1EZ6A 1Z47A 4JW0A 3J80E 2EYJA 4A3IH 1EFWA 3PO2B 4MN3A 4K2KA 2JEBI 1MGSA 2Y0SB 1XMQL 4DU9A 2SNSA 1B9NA 1N32Q 4PNYA 5FOBB 5M5XH 4DV6Q 4G7ZC 2OF1A 4KMUC 3LWEA 4NW2A 4H44C 1S5FD 2KVMA 1STYA 2E76C 1GUNA 1KDCA 1SNQA 3HRZC 1EY4A 5JJZA 4DAVA 1I4XA 1R9TB 1YZ6A 3P1HA 1DGSA 1TWCB 4WJ3M 4O0AA 1HQRD 4A3FH 3NBHA 4KHVA 3WDNA 1E2ZA 2O5JC 4JG2A 2K5QA 5FLMG 3PF4A 2K52A 4ZYSA 3SR1A 5LMNQ 1BQQT 4F8MA 2DY8A 1V1PA 2BCOA 1BKBA 1NBWA 1RODA 3TZUA 2IPKD 2R61A 3PUYA 1J5EQ 4A3DH 3S2DH 4GN3B 3IL8A 2CFMA 1QVGA 1SE3A 1TU2B 2AWOA 3G4SA 4GLXA 4KJNA 1D8LA 5HGTA 4NXML 2K1BA 4OIKA 4Q0FA 3PSIA 1QOHA 3M4OB 5C0XJ 2F0OA 4YHHQ 5AFWA 4A3GB 2NN6G 3NBIA 5ELBA 1L1OC 4G7HC 1Q1BA 2L12A 2EPBA 4YWMA 3PUWA 4GNXA 2RDFA 1A62A 4KN7C 3K8AA 1PH4A 2E2IH 1JOQA 4HAEA 2F4VQ 5FO9B 2SDFA 5JPMC 2I07B 1Q8IA 4DKAC 3S1MB 2F0WA 1G291 3L3OC 1YI2A 5C3EH 3KBXA 4AYBG 5IY0A 4LF8L 1ZXTA 4ZAIA 3I4MB 5M3MB 1NCVA 5LMNW 4C3IB 2F0JA 3V05A 1A2TA 2NVXH 3K0YA 1M90C 3OOCA 1B2TA 4LF6Q 4A3JG 4C3HG 2EYHA 1HR0Q 3BDCA 3HOUB 1IBKL 4JBMA 3I73A 2D5DA 4IPCA 5JVG3 1KC8C 2F0FA 3D6WA 1CZGA 1C48A 4CGYB 3PO2H 4ID6A 4A3BG 1CUKA 3VYUA 1FD7D 4CKCA 1XPRA 3EQLC 5I2XA 4JI8L 5IT9E 1HCZA 2QGQA 3R3OA 5K5PA 1LM0A 2EYPA 1YBYA 1ASZA 1UE5A 3CQZB 5CBEE 1VQNA 3NHHA 1QG7A 5ELNA 2CH4A 5EPLA 2KUMA 4IFDI 1CKNA 5DM73 2UUBQ 3RLFA 1QE6A 4A3MG 2WV6D 4DV4Q 2TMPA 3M3YB 1LTTD 1WFQA 1PH8A 4H02A 1I5FA 1S5CD 3T13A 5BN3A 5ELFA 2WB1G 5IWAQ 4Y7NB 3S15H 4R8IA 1X32A 2PI2A 2R6GA 4L5TA 4RGMA 2K75A 1CSPA 5T1GA 5M3MG 1SNOA 2UU9L 2R7DA 3TP6A 4C3JB 4IOCA 3MXNB 1HR0W 3ER0A 1KQSA 3S1NB 2IX1A 4B3SL 1UEAB 1HUNA 5FLXE 2N55A 3HS0C 3SE0A 1XTDA 1STNA 2D9UA 4HEDA 3UDGA 4L5RC 4DV0Q 5M3FB 4HIMA 3E9IA 4IJLA 4JI0Q 1HRJA 1PH5A 1KHIA 3K7AB 3V2TA 3I90A 2UUAL 4RCOA 2F0DA 3CCEA 3M7GA 3BG3A 4AYBE 4BY1G 1HZBA 4FVMA 4A76A 2K04A 4ZK9B 2WAQB 2E2HH 3M4OH 3S17B 4ODGA 1NE3A 4XXEA 1TY2A 4PMBA 2UUCQ 3GTOB 1TY0A 2ZM6Q 3IFTA 1DOKA 1HJPA 2F0TA 4IOAA 3ULPA 1U4PA 4JV5Q 5CMDA 5E1FA 1CT1D 4BXXG 1DM0B 2XVSA 1AE2A 5IGEA 3E6ZX 3H3VC 5EAYA 3HOWG 1I6HH 5I9OA 2SNMA 4KKUA 1D2BA 3HZXA 4L5QA 3S1MH 4DR3Q 4KHPL 1Y1WH 1Z9FA 3E0JA 3VDYA 1GOZA 4JI4Q 3BVGA 1HNWQ 1QILA 2OCEA 1GUOA 1J8IA 2PMZB 2B2UC 2JP1A 1GKHA 3Q0AA 4LF9L 4YWKA 4GKKL 1V1QA 4JI2L 5D14A 4C3JG 1A3TA 4XT3B 3STBD 4LFBL 5J39A 1PTOC 3K7UC 4LWCA 1FNVA 2E74C 3EA6A 5IOCA 4CJ0B 4K5WA 3HOUH 1UWVA 2OWOA 4C1NK 2KCCA 4BY7H 3HOZG 1QZGA 3U9OA 1Z7TA 2VXWA 2EJMA 5K36H 3PGZA 1O7ZA 2HDLA 1VQBA 2IX0A 3JC66 3MXGA 1XYIA 3J80c 1G8ZD 2F4IA 3EJIA 1RKNA 1YNJD 1XXGA 4X3UA 4DR5L 1Q12A 4U673 1SJED 1WTHA 1CQVA 1LTGD 3R2TA 1G2TA 2B3GA 1BNZA 3HOXH 1EU3A 4LMQD 4KY5A 4RFBA 1E1OA 1F2YA 1X65A 2G9HD 1Q3LA 4DAYB 2DY7A 3DWAA 1PMRA 2J4XA 1U4MA 3QJYA 3C2PA 1PRTD 1VQGA 5C44H 1PXUA 3HOYB 1FGBD 3JAMi 2CKZB 3TN2A 1J6QA 4Y7NH 4J1MA 4CDDC 4BBSG 1DCZA 3W3AA 1U0LA 2PNRC 3CW2C 5LMUQ 1TWHB 1WTPA 3RLNA 3MA2B 1VQCA 2L0CA 1EY5A 3NXWA 2L55A 4KD4A 5I9PA 3BVMA 3GP7A 5M3FH 2BOSA 3I3CA 5J1ZA 4G57A 3K7AH 3J80L 4A93B 3U50C 4JC0A 2JA8B 1GXDC 1PFSA 2WACA 1S72A 1EEID 5KNBA 2EYLA 4J15A 4XYQA 1A0IA 3T1YQ 3NQIA 1CA5A 1N32L 4DV5L 1HTLD 2RCFA 3B6YA 1N8RC 3GTGB 4Z9CB 1HNXQ 3CC7A 1HQMC 1B8AA 2B2YC 1S40A 1JJ2A 3MFYA 2C9OA 5C4XB 1R4QB 3EROA 5IYCH 1WTVA 1K0RA 2MQHA 3GTPB 1CZWA 4V0BA 4FF4A 2MUYA 5EKLA 2WIIB 4FNFA 4RKBA 4BWGB 1ZEQX 4X65Q 2WAQE 4R8NA 1E2WA 1LTSD 3L9AX 4IURA 1MSHA 1O80A 1V9PA 3GD7A 1II3A 4OO1I 1UE7A 2RDGA 1KXLA 1Y1VB 2R3ZA 2ALYB 3LWUA 1YJNA 5LMNL 1TS5A 5IYDH 3OHXC 2B63G 2AMCB 4LFAQ 4DA2A 1EY6A 2NTTA 4GS3A 5LL6X 3CP0A 2K28A 2I5HA 5I4DA 1ZKOA 1IYUA 3M4YA 1YIJA 2JA6G 4FXKC 3QR8A 2F0KA 4BBRB 1F9QA 3NK9A 2JA5B 3RZDB 4YY3Q 4LUOA 1SNCA 3Q22A 2L5TA 4R4OA 1V43A 3AQQA 1K8AC 1EU4A 2VY3A 4RCNA 1RHPA 4XT1B 5E4XA 3FP9A 1XTCD 1B1ZA 2EJGC 5IT9c 2G5DA 2JXMB 3K5LA 4F7XA 4IFDJ 1JJCB 2A6HD 4OGQC 2F4VL 1M8AA 2RA4A 3NSWA 3QIAA 2R92G 4DR4Q 4BA1I 3OTOQ 2XIWA 2R7ZB 1H9RA 1X56A 2Z6KC 5JVH3 1KLGD 4EQNA 3HOYH 1IL2A 3NENA 3NUCA 1V1OA 2EJFC 2ASBA 1VQHA 2ZJRA 1VQIA 2HQLA 3KDFA 4IALA 4K5VA 2HD3A 2NN6I 4OONA 1PRTC 3SK5A 1OXXK 2F0NA 3KK7A 3HOVG 1JJGA 3L7ZC 1MIUA 4JI5Q 4JOIA 2NUCA 4FXDA 1EYAA 1TWHH 2L4NA 3I4NH 4JVZA 1I50H 1PZJD 2F1MA 4LF6L 5E4WC 5ELDA 4A3CH 5FLXc 5G3LD 5CV9A 1FJGQ 4XQJA 3EN2A 1T9HA 4FF1A 3J7ZC 5LL6S 4LFCQ 1BXTA 3PO3H 2P5ZX 2B2VA 3I70A 4HTHA 1IBLL 4JI6Q 4UDUC 4XIGS 2FHTA 3H0GH 4JPBW 3OW2A 2R93B 2N78A 1TWAB 3G6JB 3PUXA 5IT9L 2B2TC 1A6XA 3SDZA 3C46A 1IKLA 2H1EA 3HKSA 3W2DA 4B08A 1LO5D 4V190 4O2DA 4HSVA 3J81i 2O4XA 5JJIA 1X3FA 5C5MA 4ZCKA 4OHJA 5C4XH 1CSQA 2NVYB 4ALPA 3J7YW 3D3RA 4DXFA 2F0LA 4PMWA 2JA7G 1PYSB 4TKOB 1CA6A 2Q2UA 3BYTB 1B50A 4DV4L 2KENA 3TZDA 2XN9C 5C6AA 3QO2A 1X3EA 4YCWA 5IWAL 1ASYA 2V4DA 4G4KA 1XPUA 2N3SA 3NTIA 3BVZA 1Y8PB 1VQOA 1L1OB 4KN4C 1M1KC 4CKBA 1VQ7A 2I0QA 4DFAA 5FLXL 1PFBA 1Y1VH 3Q6SA 4TQUS 3UDXA 3KLSX 5E7NA 5IP7G 3LNNA 1OXTA 3VA5A 1ENAA 1EY8A 2WP8J 3QOJA 3IRBA 1MSGA 4DV0L 4JI0L 5BR8Q 2K4KA 1JE5A 1F9SA 2QCPX 3S9WA 4ZQ3A 3Q24A 2QKIC 4HJ8A 3OWEB 5L37A 1SYFA 1O78A 4K2LA 4AH6A 3CF5A 2WKDA 1JE4A 2RDHA 3L0OA 2KCNA 4FO2A 4RG1A 1TS3A 2R93G 1F9PA 1X6OA 4RGOS 2KEDA
chains in the Genus database with same CATH topology
2Z1CA 4IQZA 5D65A 1BCPF 1LV9A 1I4HA 3CRLC 5EKIA 5EKKA 2K32A 1M4VA 1BUVT 4C2MB 2B2WA 4RGTA 2NVQB 3HEJA 2OXPA 5JEAH 1SNPA 5C4JB 1PFMA 3HGBA 4IUTA 3JAME 5D3IB 5DM63 1CI3M 4FF2A 3VR3A 1RDPD 3KF8A 4PMCA 1ET6A 5JOBA 2IT1A 1JCKB 2DNEA 4RHSA 4OO1G 2PCFB 3VR2A 4DXGA 1X3PA 3AMUA 2RQXA 3MXUA 1LT3D 1ONLA 4AYBB 1GUTA 1TS2A 5IGGA 2RSOA 2A73B 1SNMA 2OT2A 5A2QE 1CHQD 3TSSA 2NBFA 4A3JB 4IZ8A 4C3HB 5KYLA 4EQOA 3VYRA 3J7AV 4KD3A 4RA8A 3ZYYX 5EGTA 1VMCA 1R4PB 3NE5B 3H09A 4A3BB 1GHJA 1STBA 3FEWX 1S5DD 2EY5A 1U4LA 2O2LD 3OSOA 5NUCA 5ISRA 4YIJA 4RGNA 3KLRA 1MBYA 1F2MA 2DNCA 4KKTA 1D6EC 2B8GA 5TSSA 2B39A 1AW7A 4O1NA 1U9RA 1IHZA 2EYFA 5C4ZA 4A3MB 1KDBA 5I6WA 1EL0A 2TSSA 5C0XH 2NVTB 2YU9B 4LJZC 2WB1B 1WVLA 1PTOB 3SEBA 1HHVA 1PTOD 3MAQA 1X3QA 2A74C 3BS1A 2RSNA 3ND9A 1EZ8A 1C8CA 3IAYA 1NUCA 2C5CA 1HXYD 1LT4D 3MHBA 2Z4IA 3GTMB 1DJRD 2K01A 1HTPA 3ND8A 4PV1C 4BY1B 1D5XC 3X3MA 4QUFA 2F0MA 5DNFA 1EQTA 2NN6H 3C1EA 5F2DA 3VR4A 4MIUA 3HOWB 4HMJA 5G3LF 1LT6D 1QNUA 4DF7A 3MTSA 4HR7B 1WTOA 1BO0A 3M7NA 3D8GA 1A3VA 1LTBD 5ELEA 3J81E 1TVXA 5ELCA 1ILPA 3PIP3 3DM1A 4WORA 2E75C 1XX8A 1W6KA 3T4AC 3WOEA 3HOZB 3K57A 3CU7A 5DAUA 2CVRA 1TKWB 2XRSD 3SHLA 4EVOA 3BDLA 5CGKA 1WTWA 2EY1A 2ZXPA 1S4ZA 3D31A 5KIXA 2A6ED 2JSOA 2ENBA 1TR5A 1D1IA 1I4PA 5CV5A 1MI2A 5CORA 3D4RA 2PZTA 4NMZA 4F87A 1QNKA 1JWSD 5KNDA 1AEXA 5KEEA 1AN8A 4BBSB 1SYDA 4RH6A 2LS01 3MXNA 3T53B 2WINB 4I65A 5M9OA 1CTMA 2NYZD 1EFID 1C4QA 1IYVA 2A5HA 1D5ZC 1NAPA 2M00A 1DONA 2CHBD 1T5XD 2B8FA 3PIO3 5M5WB 4X3KA 2K03A 2M2LA 5JPNC 2F0IA 1Z6HA 3S2HB 1VMPA 1PRTB 3DWPA 5EBCA 5CYUA 3OMCA 1ILQA 3ERQA 1D5MC 3RMHA 5IGCA 1TIID 1VCIA 1STHA 1GUSA 3S16B 2PPBC 1J9OA 2B63B 4FF3A 2EE1A 2F0PA 3JAML 2JA6B 4FXGC 2LMCB 5CBAE 5CC4A 1BBXC 1JORA 1EEFD 1I4QA 4XTCS 5C3WA 1H9MA 4XQNA 1H9SB 1K8OA 1JICA 4DAYA 2K5WA 4QMGA 2A6EC 4KY6A 4WFN3 1Q90A 2K7VA 1SDFA 1B53A 2R92B 3GTJB 2VB3X 5JAVA 5C5LA 4PQXA 1DOLA 5A2QL 1FR3A 3HOVB 1UNSA 1STGA 3PV0A 1ENCA 1ESFA 2EVBA 1PTOF 3I91A 1I4RA 1KABA 2Q8RE 3ONAB 1HPCA 4JK1C 3PUVA 1B3AA 2DN8A 1OXVA 2AQ1B 2K5DA 4JBWA 1NR4A 2F3VA 4DK1A 2EDGA 1Y69U 2EXZA 1XWEA 5EPKA 1S5ED 4LK1C 2ID0A 1IW7D 3NWSA 1B9MA 3GTKB 2JA7B 1DOMA 2IJ0A 4HCSA 3SK6A 3GTLB 4K6DA 1PZID 1SFOB 1K8MA 2AUJD 1EOTA 4OIJA 1BCPC 3A7AB 5LHY1 2FINB 3R2IA 4IFDH 3P7JA 1EIGA 2IWHA 3H91A 1ML0D 2L1BA 1L0YB 2E2DC 1KTKA 4K8IA 1GUGA 2GA4B 2WKCA 1F77A 2L11A 1I4GA 2FMCA 1SYCA 4ZRZA 1BDOA 1E0BA 2HUGA 3AU7A 3EFXD 3T51B 3BYYB 2OEOA 2L9HA 4ZKCB 5M5YB 4WRDA 5C4HA 2D2CC 1Y8NB 2EY6A 5FKAC 3MVVA 4EGVA 2J7ZA 3P20A 3J81L 2KEEA 4E6IA 1JWMD 1TWGB 4A3EB 3OIQA 3SK8A 3QOLA 1KLUD 3TP5A 4F88A 4CJ2C 3P75A 5IGDA 5CV4A 1ZYRC 2J0TD 5JEAG 1F2LA 1TWFB 3BZDB 4A3DB 1IKMA 3PUZA 1EYDA 5A35A 2Z8LA 1PFNA 4K8JA 1A15A 1ENFA 2BE5D 3CRKC 3RD4A 2AQ2B 1VF7A 3I4LA 3WOFA 3VR6A 1WTXA 2E2IB 2O5IC 4U68A 4N9PA 4C56C 1SSOA 1MD2D 1I6VC 2KJXA 5CV7A 4L63B 2B2VC 1IW7C 5C3EB 2K33A 2CW0C 1RF2D 5KRUA 1SYEA 4IUQA 1PRTF 2VUMB 2NVXB 2BDOA 4KKSA 3TP7A 3FMCA 2VNUD 5KYIA 1V1PB 4N9TA 1CFMA 2IX3A 1RD9D 3R8BA 5KNCA 4RKLA 4OL7A 3A56A 4ZUIA 4A3KB 1PLFA 5D3DA 1QB5D 4X3SA 1ET9A 4K5XA 1F2ZA 4HN7A 1E2VA 1TS4A 2F0HA 2NB0A 3N6RA 5I2YA 1LTAD 2KOLA 2KHSA 3GQBA 1QCBD 1EIHA 4M8AA 2JYOA 5BN5A 4I7ZC 5J22A 1O7LA 3NP8A 5C0XG 1Y8OB 1TQOA 3S15B 4DN4M 1W6JA 3F2UA 3TDQA 4IUPA 2F3WA 3QG1A 5CV6A 4CKEA 2X6GA 5FO8B 4OO1H 2VB2X 2Z4HA 3T16A 4B9XA 1VF5C 1JOKA 2B2WC 1JB3A 3S1RB 1SAPA 2E2HB 3GTQB 2EYOA 2EZVA 3I72A 4QUCA 4C1NI 4G7OC 3URYA 3FRPB 4BS9A 3HKZB 2F0SA 1Q1EA 2BE5C 4DNTB 3DEPA 1I6HB 4ZUJA 1EY0A 5FO7B 1Y1WB 3Q23A 3A55A 1KAAA 1SJHD 3FDTA 1WD0A 2BA0A 1RTNA 4X3TA 1OO9B 1H9JA 4HSPA 5IIFA 2BA1A 3QB3A 3LX0A 3FPPA 1JWUD 1O7YA 1EY7A 2F0EA 5EQ0A 2E2JB 3DEOA 4BY7B 1TT2A 2X6LA 5COYA 2XWJB 2AQ3B 5CV8A 2B2UA 3D6CA 3NTKA 4QIWB 3GO5A 4ILWA 2N88A 1HUMA 1EWHA 1FNWA 3TP8A 1SMYD 4FYDA 1SNDA 4KV6A 3HOXB 3A8IE 3K59A 1AP0A 2FFKB 3D4WA 4NDXA 2NTSA 3RZOB 1LTID 1VDZA 5C44B 3TMEA 3RUZA 2PW5A 2CQAA 4QB4A 4TRDA 3V96A 3HG9A 2JEAI 4KTAA 2QILA 1B44D 5EPJA 2PZUA 1A2UA 4C3IG 3E5SA 5I6YA 4NKLA 4ZKBB 3K5OA 1NSNS 5IGBA 5EBDA 1RJTA 5HURA 3MEHA 4HCEA 3VYTA 3IFDA 3KUPA 5K36G 3UI2A 3MWYW 4K6LA 1KNEA 5BN4A 3CKIB 1LLRD 3OIPA 1I3QB 2QF7A 3ITPA 4IUVA 1PTOH 3MFGA 2RKSA 2RVLA 1LABA 3C3LA 4H13C 4QCLA 1CQFA 2IL8A 2XNAC 3HP3A 1YNND 4XQQA 3SVMA 4TSSA 3GV3A 1HFGA 3OMGA 1ESRA 1G6ZA 1PDQA 5T1IA 2B2YA 3R93A 2SEBD 1HA6A 3FPUB 1LACA 1FYCA 3A54A 4RAUC 2MP1A 1UAPA 1EY9A 3FKIB 4H7BA 4IUUA 3SXHA 4L6TB 4IUNA 1EQVA 1SYGA 2SOBA 2LFNA 4RHRA 1T5EA 1BCPB 4KHZA 1BCPD 2ICEC 3KLSA 1A3UA 5IODA 4DAPA 1KNAA 1RCVD 3NWTA 1KDAA 1DZ1A 4NP5A 2X69A 1JC7A 4H0LC 3FVQA 1AFPA 2XRQD 2LY7A 3U9SA 4FP5D 2I46A 2JE6I 1SMYC 3G7LA 3DUZA 4MHEA 1BR9A 2ZT9C 3DMUA 2AUKA 3N52A 1JOOA 1STAA 1LT5D 1SXTA 5C3XA 1L0XB 1SE2A 3X3NA 3C1FA 3DWQA 3I4NB 1I50B 1DD2A 3TBIB 1OXUA 2NWGA 4KY7A 1SYBA 1UUPA 3K5NA 3CHBD 4CJ1B 3S14B 3PO3B 4XDXA 1V8QA 4M1UB 4XYOA 4QF4A 4HMIA 3H0GB 3T56B 1EWCA 2LKVA 4IN3A 3KBGA 4P2CB 1STEA 1K83B 1D1KA 1ICWA 2F0UA 1G91A 1G2SA 2F03A 4CBVA 2A69D 1ZYRD 2EY2A 5CR3A 3OW7A 4ZLTF 2KA7A 2D62A 2F0VA 2B2TA 5FK9C 2K05A 4Q5VA 2HDMA 1PYWD 1LTRD 1YNNC 4IFDG 3NQTA 1HFNA 2XSCA 2Q8TA 1DXMA 2H4OA 4O42A 3S1QB 1B4OA 1NR2A 3D4DA 1H9SA 2KECA 4CHTB 2K6AA 2QDBA 5C0XI 2ZXOA 1IL8A 3VR5A 4B9WA 2CW0D 1DYQA 2MHVA 2HCCA 1S5BD 3H6MA 4LAAA 1CM9A 3EVQA 3A8KE 2XWBB 4BA2I 1WCMB 4ULLA 2M9VA 3OPOA 1BOSA 1HA5A 4L8JA 1YNJC 3IKJA 2A68D 4J6HA 4J8QA 1GUWA 4GZYC 2PZWA 3MC0B 1CK1A 2G9DA 4DK0A 5EJWA 1RTOA 4S3SA 2MGSA 4A3IB 1QWYA 2IW3A 3O13A 3VA7A 1JR0D 1SEBD 3H94A 5M5XB 1BF4A 2FMMA 4ABNA 1WTRA 4RWSC 2Q8IB 3K58A 2RBMA 2HCIA 3A7LA 1U4RA 4A3FB 2ICIA 3A8JE 4UAIA 2MJ8A 2FJ2A 1GJXA 2PYKA 1JQYD 5KGUA 2A69C 2MPMA 1FNUA 3NTHA 2BDNA 5E3FA 3S2DB 3VYSA 2EOTA 4K14A 2AWNA 2QEJC 5DEHA 1EYCA 1SE4A 3AB9A 2F0GA 3BDOA 4DGZA 1WTQA 3K6OA 1WD1A 3MZ5A 3GV6A 4R9WA 5IGFA 3DHQA 2YYZA 2NZ1D 3DXJC 1QJOA 4ME5A 4KI0A 4DNRB 3J7AF 1PZKD 3OWFA 3SK4A 4EQPA 5JEAJ 2ZXRA 1H9KA 2F0QA 2KQ3A 3NPPA 3K5MA 1GHKA 1SBBB 3I8ZA 4WJWA 2EYMA 1F9RA 2PQEA 1AZPA 3QWNA 3MXPA 4KJOA 1AZQA 3M85A 4KK7A 1OXSC 3PMFA 2PW7A 2HQEA 2A6HC 2PO4A 1CHPD 2A68C 1EZ6A 1Z47A 3J80E 2EYJA 3PO2B 4MN3A 4K2KA 2JEBI 1MGSA 2Y0SB 4DU9A 2SNSA 1B9NA 4PNYA 5FOBB 4G7ZC 2OF1A 4KMUC 3LWEA 4NW2A 4H44C 1S5FD 2KVMA 1STYA 2E76C 1GUNA 1KDCA 1SNQA 3HRZC 1EY4A 5JJZA 4DAVA 1I4XA 1R9TB 3P1HA 1TWCB 1HQRD 3NBHA 4KHVA 3WDNA 1E2ZA 2O5JC 2K5QA 4ZYSA 3SR1A 1BQQT 4F8MA 2DY8A 1V1PA 2BCOA 1RODA 3TZUA 2IPKD 2R61A 3PUYA 3IL8A 1SE3A 1TU2B 2AWOA 4KJNA 5HGTA 2K1BA 4OIKA 4Q0FA 1QOHA 3M4OB 5C0XJ 2F0OA 5AFWA 4A3GB 2NN6G 3NBIA 5ELBA 4G7HC 1Q1BA 2L12A 2EPBA 3PUWA 2RDFA 4KN7C 1JOQA 4HAEA 5FO9B 2SDFA 5JPMC 2I07B 1Q8IA 3S1MB 2F0WA 1G291 3L3OC 3KBXA 1ZXTA 4ZAIA 3I4MB 5M3MB 1NCVA 4C3IB 2F0JA 3V05A 1A2TA 3K0YA 3OOCA 1B2TA 4C3HG 2EYHA 3BDCA 3HOUB 3I73A 2D5DA 5JVG3 2F0FA 3D6WA 1CZGA 1C48A 4CGYB 4ID6A 3VYUA 1FD7D 4CKCA 3EQLC 5I2XA 5IT9E 1HCZA 3R3OA 5K5PA 2EYPA 3CQZB 5CBEE 3NHHA 1QG7A 5EPLA 2KUMA 4IFDI 5DM73 3RLFA 1QE6A 2WV6D 3M3YB 2TMPA 1LTTD 1S5CD 3T13A 5BN3A 5ELFA 4Y7NB 4R8IA 1X32A 4RGMA 2R6GA 5T1GA 1SNOA 3TP6A 4C3JB 3S1NB 2IX1A 1UEAB 1HUNA 5FLXE 2N55A 3HS0C 3SE0A 1STNA 2D9UA 4HEDA 5M3FB 1HRJA 3K7AB 3V2TA 3I90A 4RCOA 2F0DA 3M7GA 3BG3A 4FVMA 2K04A 4ZK9B 2WAQB 3S17B 4ODGA 4XXEA 1TY2A 4PMBA 3GTOB 1TY0A 3IFTA 1DOKA 2F0TA 1U4PA 5CMDA 5E1FA 1CT1D 1DM0B 2XVSA 5IGEA 3E6ZX 3H3VC 5I9OA 2SNMA 4KKUA 1D2BA 3HZXA 3E0JA 1GOZA 3BVGA 1QILA 1GUOA 1J8IA 2PMZB 2B2UC 2JP1A 3Q0AA 5D14A 4C3JG 1A3TA 4XT3B 5J39A 1PTOC 1FNVA 2E74C 3EA6A 5IOCA 4CJ0B 4K5WA 4C1NK 2KCCA 3U9OA 1Z7TA 2VXWA 2EJMA 5K36H 1O7ZA 2HDLA 2IX0A 3MXGA 1XYIA 1G8ZD 2F4IA 3EJIA 1RKNA 1YNJD 1XXGA 4X3UA 1Q12A 4U673 1SJED 1CQVA 1LTGD 3R2TA 1G2TA 1BNZA 1EU3A 4LMQD 4KY5A 4RFBA 1F2YA 2G9HD 1Q3LA 2DY7A 3DWAA 1PMRA 2J4XA 1U4MA 3QJYA 3C2PA 1PRTD 1PXUA 3HOYB 1FGBD 3TN2A 4J1MA 1DCZA 3W3AA 2PNRC 1TWHB 1WTPA 3MA2B 2L0CA 1EY5A 3NXWA 2L55A 4KD4A 5I9PA 3BVMA 3GP7A 2BOSA 3I3CA 5J1ZA 4G57A 3J80L 4A93B 2JA8B 1GXDC 2WACA 1EEID 5KNBA 2EYLA 4XYQA 3NQIA 1CA5A 1HTLD 3GTGB 4Z9CB 1HQMC 2B2YC 3MFYA 2C9OA 5C4XB 1R4QB 3EROA 1WTVA 3GTPB 1CZWA 4V0BA 4FF4A 2MUYA 5EKLA 2WIIB 4FNFA 4RKBA 4BWGB 1ZEQX 4R8NA 1E2WA 1LTSD 3L9AX 4IURA 1MSHA 1O80A 3GD7A 1II3A 4OO1I 2RDGA 1Y1VB 2R3ZA 3LWUA 1TS5A 3OHXC 4DA2A 1EY6A 2NTTA 5LL6X 2K28A 5I4DA 1ZKOA 1IYUA 3M4YA 4FXKC 2F0KA 4BBRB 1F9QA 3NK9A 2JA5B 3RZDB 1SNCA 3Q22A 2L5TA 1V43A 1EU4A 4RCNA 1RHPA 4XT1B 5E4XA 1XTCD 1B1ZA 2EJGC 2JXMB 3K5LA 4F7XA 4IFDJ 2A6HD 4OGQC 1M8AA 2RA4A 3NSWA 3QIAA 4BA1I 2XIWA 2R7ZB 1H9RA 5JVH3 1KLGD 4EQNA 1V1OA 2EJFC 3NUCA 4K5VA 4IALA 2NN6I 1PRTC 3SK5A 1OXXK 2F0NA 3KK7A 3L7ZC 2NUCA 4FXDA 1EYAA 2L4NA 1PZJD 2F1MA 5E4WC 5ELDA 5G3LD 5CV9A 4XQJA 4FF1A 5LL6S 1BXTA 2B2VA 3I70A 4HTHA 4UDUC 4XIGS 2FHTA 2R93B 1TWAB 3G6JB 3PUXA 5IT9L 2B2TC 1A6XA 3SDZA 3C46A 1IKLA 2H1EA 3W2DA 4B08A 4V190 1LO5D 4HSVA 2O4XA 5C5MA 4OHJA 2NVYB 3J7YW 3D3RA 4DXFA 2F0LA 4PMWA 4TKOB 1CA6A 3BYTB 1B50A 3TZDA 2XN9C 5C6AA 3QO2A 2V4DA 4G4KA 3NTIA 3BVZA 1Y8PB 4KN4C 4CKBA 4DFAA 5FLXL 1PFBA 3Q6SA 4TQUS 3KLSX 3LNNA 1OXTA 3VA5A 1ENAA 1EY8A 2WP8J 3QOJA 1MSGA 1F9SA 2QCPX 3S9WA 3Q24A 4ZQ3A 2QKIC 3OWEB 1SYFA 1O78A 4K2LA 2WKDA 1JE4A 2RDHA 2KCNA 4FO2A 1TS3A 1F9PA 4RGOS 2KEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G57 A;  2F0T A;  2RBM A;  3P75 A;  4K5V A;  4IAL A;  4YIJ A;  2F3V A;  3OMC A;  5ISR A;  3ERQ A;  5IGD A;  2EYJ A;  1EY9 A;  5E1F A;  3SK5 A;  5CV4 A;  2F0N A;  4H7B A;  2F0J A;  4K2K A;  5DAU A;  3SXH A;  1A2T A;  3TP8 A;  1F2M A;  4IUN A;  2WAC A;  5IGE A;  2NUC A;  2EXZ A;  3NP8 A;  1SND A;  5IGC A;  2EYL A;  3TP5 A;  3SHL A;  4KV6 A;  1EQV A;  1TQO A;  1EYA A;  2F0V A;  2SNS A;  4DU9 A;  4EVO A;  5I9O A;  1STH A;  4PNY A;  2SNM A;  1SYG A;  5EKK A;  2EYH A;  1EYD A;  3BDL A;  3HZX A;  5CGK A;  2EY1 A;  1U9R A;  1IHZ A;  2EYF A;  5C4Z A;  3BDC A;  2SOB A;  3D4W A;  4NDX A;  5KIX A;  1KDB A;  5I6W A;  5CV9 A;  3HEJ A;  4K8J A;  2OF1 A;  2OXP A;  2F3W A;  1SNP A;  3SK6 A;  5CV6 A;  2ENB A;  4K6D A;  1A3U A;  2F0P A;  2F0F A;  2PYK A;  3NQT A;  5IOD A;  5KGU A;  1STY A;  4HTH A;  1TR5 A;  3TME A;  1KDA A;  5CV5 A;  3RUZ A;  1KDC A;  1SNQ A;  3ERO A;  1EY4 A;  4NP5 A;  4ID6 A;  2PW5 A;  3D4D A;  1A3T A;  3P1H A;  4QB4 A;  4TRD A;  5EKL A;  2PZT A;  4NMZ A;  5CC4 A;  5J39 A;  5E3F A;  4KTA A;  1EZ8 A;  4RKB A;  1JOR A;  4KHV A;  4PMC A;  3T16 A;  1NUC A;  2QDB A;  4K5W A;  4R8N A;  5JOB A;  4B9X A;  3R3O A;  4N9P A;  5C3W A;  4K14 A;  5K5P A;  1JOK A;  2EYP A;  2PZU A;  3MHB A;  5DEH A;  4B9W A;  5J22 A;  1A2U A;  3U9O A;  2O4X A;  1EYC A;  3E5S A;  5I6Y A;  1AEX A;  4NKL A;  1II3 A;  5C5M A;  5KEE A;  5CV7 A;  2F0G A;  3NHH A;  2EYO A;  4DGZ A;  3DMU A;  1NSN S;  4K8I A;  3SR1 A;  5IGB A;  3H6M A;  4LAA A;  4QMG A;  4F8M A;  3EJI A;  1JOO A;  1RKN A;  5HUR A;  3EVQ A;  1STA A;  1SYD A;  3MEH A;  2F0L A;  3MZ5 A;  4KY6 A;  5KRU A;  5IGF A;  3DHQ A;  1SYE A;  1SYC A;  5C3X A;  2F0M A;  1EY6 A;  2F0S A;  4ME5 A;  4I65 A;  5M9O A;  3C1F A;  3T13 A;  4KY5 A;  5C6A A;  1F2Y A;  3C1E A;  4KJN A;  3TP7 A;  5HGT A;  3OWF A;  1EY0 A;  4J6H A;  4ZUJ A;  5JAV A;  5KYI A;  2F0K A;  5C5L A;  5IGG A;  1SNO A;  4N9T A;  3NK9 A;  3TP6 A;  2PZW A;  3SK4 A;  5F2D A;  4EQP A;  1SNM A;  4DFA A;  1KAA A;  2M00 A;  2OEO A;  4KY7 A;  4MIU A;  1SYB A;  1SNC A;  3ITP A;  5IOC A;  1STN A;  4RKL A;  2F0O A;  1STG A;  4HMJ A;  3VA5 A;  2RKS A;  4IZ8 A;  2F0Q A;  1ENC A;  1ENA A;  1EY8 A;  2KQ3 A;  4OL7 A;  5KYL A;  3QOJ A;  4QF4 A;  4ZUI A;  4DF7 A;  4WRD A;  4HMI A;  4EQO A;  3V2T A;  4S3S A;  2RDF A;  5C4H A;  2F0D A;  2EYM A;  2F0I A;  4K5X A;  1F2Z A;  4KD3 A;  5IIF A;  4J1M A;  2EY6 A;  4F7X A;  3S9W A;  3D8G A;  4ZQ3 A;  2PQE A;  1JOQ A;  3QB3 A;  3MVV A;  3LX0 A;  3MXP A;  1A3V A;  2F0H A;  2LKV A;  4KJO A;  5EGT A;  1KAB A;  1SYF A;  1EY7 A;  2F0E A;  3PMF A;  4K2L A;  2PW7 A;  2F0U A;  1TT2 A;  2HQE A;  4E6I A;  2F0W A;  2KHS A;  3OMG A;  1EY5 A;  1STB A;  3NXW A;  4ODG A;  3SK8 A;  2EY5 A;  3OSO A;  1EZ6 A;  4KD4 A;  4PMB A;  5I9P A;  4WOR A;  3QOL A;  2EY2 A;  5CV8 A;  5CR3 A;  5NUC A;  3NUC A;  3D6C A;  4EQN A;  5J1Z A; 
#chains in the Genus database with same CATH topology
 2Z1C A;  4IQZ A;  4MZ9 A;  5D65 A;  4JV5 L;  2MO0 A;  2CQO A;  4UP9 A;  1BCP F;  1LV9 A;  3M4Q A;  1I4H A;  3CRL C;  3I7F A;  4DR6 Q;  5EKI A;  1VQD A;  5EKK A;  2K32 A;  1M4V A;  3PF5 A;  1BUV T;  4C2M B;  3ULL A;  1NJI C;  2B2W A;  4DR3 L;  4RGT A;  2VQE Q;  2NVQ B;  3HEJ A;  2R7Z H;  4JI4 L;  2OXP A;  3ICE A;  5JEA H;  1HNW L;  1SNP A;  5C4J B;  4DV3 L;  4LF7 Q;  3CME A;  1PFM A;  4DUZ Q;  3HGB A;  4IUT A;  2HIX A;  3JAM E;  2DJG C;  5D3I B;  5DM6 3;  3BZK A;  1CI3 M;  5IP9 H;  4A3E G;  1LTL A;  1YJ9 A;  4DV1 L;  4FF2 A;  3VR3 A;  1RDP D;  3KF8 A;  4PMC A;  1ET6 A;  5JOB A;  1S3O A;  2IT1 A;  1HNZ L;  1JCK B;  2DNE A;  2Z6B A;  4RHS A;  3HFZ B;  4OO1 G;  2A19 A;  4OX9 Q;  2UUC L;  2PCF B;  4DV2 Q;  4GLA C;  4A3D G;  3VR2 A;  3CCS A;  4DXG A;  1X3P A;  3FHW A;  3AMU A;  1SRU A;  2RQX A;  3RNU A;  4K0K Q;  3AFP A;  3MXU A;  1LT3 D;  4DR7 Q;  2UXC Q;  1ONL A;  4AYB B;  1GUT A;  1MHW C;  1TS2 A;  5IE8 A;  2UXD Q;  5IGG A;  2RSO A;  2A73 B;  1SNM A;  2OT2 A;  4GNX B;  5A2Q E;  1CHQ D;  2NVY H;  3TSS A;  1XNR Q;  1VQ8 A;  3CCU A;  4YCU A;  2NBF A;  4A3J B;  4IZ8 A;  4C3H B;  5KYL A;  4KLK A;  3RLO A;  2UXB L;  4EQO A;  3VYR A;  2HHH L;  3J7A V;  4KD3 A;  3NEL A;  4RA8 A;  3ZYY X;  5C3E G;  1BBW A;  2VZA A;  5EGT A;  4JI1 Q;  3CCJ A;  1VMC A;  1R4P B;  3NE5 B;  3H09 A;  4A3B B;  2VUM G;  4DV7 Q;  1GHJ A;  1STB A;  3FEW X;  1Q81 C;  3A74 A;  3LGJ A;  1S5D D;  2EY5 A;  3I56 A;  1U4L A;  2O2L D;  3KYH C;  3OSO A;  5NUC A;  3KJO A;  4AIM A;  1AE3 A;  5ISR A;  4YIJ A;  4YWL A;  4RGN A;  1XNQ L;  3KLR A;  1MBY A;  4CDF C;  1K3B C;  1F2M A;  2DNC A;  1PHJ A;  4KKT A;  1D6E C;  2B8G A;  5TSS A;  1XJV A;  2B39 A;  4X64 Q;  1AW7 A;  4O1N A;  3AEV A;  4A3K G;  1U9R A;  1IHZ A;  2EYF A;  5C4Z A;  4A3M B;  1KDB A;  5I6W A;  1EL0 A;  3CC2 A;  2TSS A;  5C0X H;  4IPG A;  2NVT B;  4UP7 A;  5IYB G;  2YU9 B;  4LJZ C;  2WB1 B;  1WVL A;  1PTO B;  3SEB A;  1HHV A;  1PTO D;  2RCN A;  1G51 A;  1N36 Q;  3MAQ A;  1X3Q A;  5FLM H;  1K28 A;  2A74 C;  3BS1 A;  2RSN A;  3ND9 A;  1KAW A;  2C35 B;  3ZJY C;  5GAG C;  1EZ8 A;  3CCL A;  4A3L G;  1RIP A;  1C8C A;  3IAY A;  2CWA A;  1NUC A;  4C2M H;  2C5C A;  4X65 L;  1HXY D;  2DGY A;  3UDI A;  1LT4 D;  3MHB A;  5J3B A;  2EXD A;  3A5U A;  2Z4I A;  1KIX A;  1N33 Q;  3GTM B;  4B3R L;  1HZA A;  1DJR D;  2K01 A;  4QJF A;  5JJL A;  1HTP A;  3ND8 A;  4PV1 C;  4BY1 B;  1PH3 A;  1D5X C;  3X3M A;  3M9B A;  1NY4 A;  4QUF A;  2F0M A;  2XTI A;  5DNF A;  4POG A;  1L0W A;  1TXY A;  1EQT A;  2NN6 H;  3C1E A;  3CD6 A;  2PQA B;  5F2D A;  3VR4 A;  3M4P A;  4JBK A;  4MIU A;  4YY3 L;  3HOW B;  4HMJ A;  5G3L F;  1LT6 D;  1R9T H;  3RR5 A;  1QNU A;  4DF7 A;  1EQR A;  3MTS A;  4GN4 B;  4HR7 B;  1TWC H;  1WTO A;  1BO0 A;  2E8G A;  4GOP B;  3M7N A;  4OWW B;  3D8G A;  1A3V A;  1LTB D;  5ELE A;  3J81 E;  4GKJ Q;  1TVX A;  5ELC A;  2OTL A;  1ILP A;  3PIP 3;  4PZ8 A;  4UY8 C;  3DM1 A;  4WOR A;  4C3H H;  2E75 C;  3TRE A;  1XX8 A;  1W6K A;  4QQB X;  1KL9 A;  3T4A C;  3WOE A;  4GNX C;  1Y1W G;  3HOZ B;  3K57 A;  3CU7 A;  5DAU A;  2CVR A;  2VW9 A;  1TKW B;  2XRS D;  1ICF B;  4JI5 L;  3SHL A;  4EVO A;  2Q2I A;  3BDL A;  5CGK A;  4HIK A;  1WTW A;  4A3B H;  2EY1 A;  2ZXP A;  1S4Z A;  3D31 A;  3AYH B;  5KIX A;  2A6E D;  1XMO L;  2JSO A;  1YHB A;  2OQ0 A;  3T1H Q;  1FJG L;  1W2B A;  3H3V H;  2ENB A;  4HJ5 A;  4A3G H;  4LFC L;  1TR5 A;  1D1I A;  1I4P A;  5CV5 A;  2ZJQ A;  4LF5 Q;  4BY7 G;  4JI6 L;  1MI2 A;  5COR A;  3D4R A;  2LXJ A;  2PZT A;  4NMZ A;  3U4V A;  3CPW A;  3KLW A;  4I7A A;  4F87 A;  1QNK A;  4A3M H;  1JWS D;  5KND A;  1AEX A;  5KEE A;  1HZC A;  1AN8 A;  2D0P A;  2NVT H;  4QL5 A;  4BBS B;  3HOX G;  4HJA A;  3KF6 B;  3I4M H;  4B3M Q;  5ELO A;  5M3M H;  1SYD A;  4RH6 A;  2LS0 1;  3MXN A;  3T53 B;  4C3I H;  1QZH A;  1IBM L;  3GDE A;  3CC4 A;  2WIN B;  1O7I A;  5GRO A;  4QGU A;  4I65 A;  5M9O A;  1CTM A;  2NYZ D;  1EFI D;  5C44 G;  4LF4 Q;  1K73 C;  1C4Q A;  1IYV A;  2A5H A;  4IO9 A;  1D5Z C;  1NAP A;  1YVC A;  2M00 A;  1DON A;  4BY1 H;  1N34 L;  2WB1 E;  2CHB D;  1T5X D;  2B8F A;  2F3I A;  3PIO 3;  4X3K A;  5M5W B;  1VQM A;  2K03 A;  4NB3 A;  2M2L A;  4HJ7 A;  5JPN C;  2F0I A;  1VQA A;  2HIV A;  1Z6H A;  1PV4 A;  2R7F A;  3CQZ H;  4BXX H;  3S2H B;  1VMP A;  1K9M C;  2BH8 A;  1EQQ A;  3K80 C;  3HOW H;  1PRT B;  3DWP A;  3I55 A;  5EBC A;  4X62 Q;  3A0J A;  5CYU A;  2IY5 B;  2PI2 E;  3CAM A;  4PZ6 A;  3OMC A;  1ILQ A;  3M3Y H;  3ERQ A;  1P8L A;  1D5M C;  3DM3 A;  3RMH A;  4TVA B;  5IGC A;  1HH2 P;  1TII D;  1VCI A;  2NZO A;  1LUZ A;  2A8V A;  1IYJ B;  1STH A;  1GUS A;  3S16 B;  4DR6 L;  2PPB C;  4C3J H;  1X9N A;  1J9O A;  3S1N H;  2B63 B;  4GOP C;  4FF3 A;  2EE1 A;  1B70 B;  5AJ3 Q;  2F0P A;  1C9O A;  3JAM L;  3HOZ H;  4DUZ L;  3F2C A;  2JA6 B;  2F52 A;  4FXG C;  2VQF Q;  2LMC B;  5CBA E;  1XPO A;  5CC4 A;  2CH4 W;  1BBX C;  1JOR A;  1EEF D;  1I4Q A;  4XTC S;  5C3W A;  1H9M A;  3G48 A;  3FKI G;  5IYD G;  5GQO A;  3S17 H;  2RHS B;  4XQN A;  4DV6 L;  4OX9 L;  3GTO H;  1H9S B;  1K8O A;  4DUY Q;  4R4Q A;  1JIC A;  2Q2H A;  4DAY A;  2K5W A;  4QMG A;  1EUJ A;  2A6E C;  4KY6 A;  4WFN 3;  1Q90 A;  2K7V A;  1U5K A;  1SDF A;  1B53 A;  2R92 B;  1PH9 A;  5GAE C;  4OWT B;  1YNX A;  3GTJ B;  4K0K L;  3U58 A;  4DR7 L;  2VB3 X;  5JAV A;  5C5L A;  4PQX A;  1DOL A;  2K5N A;  5A2Q L;  1VQ5 A;  1FR3 A;  3HOV B;  1UNS A;  5HGQ A;  1STG A;  4GN5 A;  3PV0 A;  1ENC A;  3KFU A;  4UPA A;  3A5Z B;  3SGI A;  1ESF A;  2EVB A;  4MNO A;  1PTO F;  3I91 A;  4PG3 A;  1I4R A;  1J5E L;  1KAB A;  1IBK Q;  2Q8R E;  3ONA B;  1HPC A;  4JK1 C;  3PUV A;  1B3A A;  4DV7 L;  5M5W H;  2K5H A;  4N8X 1;  2DN8 A;  1OXV A;  2GVB A;  4OEL B;  3I4N G;  2AQ1 B;  2K5D A;  4JBW A;  1EOV A;  1NR4 A;  2F3V A;  1G6P A;  3L2P A;  4YHH L;  3J81 j;  4DK1 A;  2EDG A;  1SRO A;  4GLV B;  1Y69 U;  2KCM A;  2EXZ A;  1XWE A;  2DJF C;  1QUQ B;  5EPK A;  1S5E D;  3PO3 G;  4LK1 C;  3CXC A;  2ID0 A;  1IW7 D;  3NWS A;  4X64 L;  3S2H H;  1B9M A;  3GTK B;  2RHQ B;  2JA7 B;  3H0G G;  2ZTD A;  1DOM A;  2IJ0 A;  4HCS A;  2KBN A;  3SK6 A;  3GTL B;  4K6D A;  4DNI A;  4EX5 A;  2KHJ A;  1PZI D;  1Q8K A;  3PQI A;  1SFO B;  1K8M A;  2AUJ D;  1EOT A;  4OIJ A;  2B29 A;  1BCP C;  3A7A B;  1VQ9 A;  5LHY 1;  2FIN B;  3R2I A;  4IFD H;  3P7J A;  1EIG A;  2IWH A;  3H91 A;  3W1B A;  3S16 H;  1ML0 D;  2MFI A;  2UU9 Q;  2L1B A;  1L0Y B;  4ME3 A;  2E2D C;  2KCT A;  1HR0 L;  1KTK A;  4K8I A;  1GUG A;  2JA6 H;  2GA4 B;  2WKC A;  1F77 A;  4A93 H;  2L11 A;  2JA8 H;  4MTN A;  1I4G A;  2K50 A;  2FMC A;  1SYC A;  4ZRZ A;  1BDO A;  1E0B A;  3CCQ A;  2HUG A;  2IHE A;  4DR1 Q;  3AU7 A;  3EFX D;  3T51 B;  3BYY B;  3GTG H;  3RN2 A;  2OEO A;  1GVP A;  4UHV A;  2L9H A;  4ZKC B;  1MKH A;  3GTP H;  5M5Y B;  4WRD A;  3EIV A;  5C4H A;  2UUB L;  2D2C C;  1FVI A;  1Y8N B;  2EY6 A;  3GTJ H;  5FKA C;  3MVV A;  4EGV A;  5GAH C;  2J7Z A;  3P20 A;  3J81 L;  1WCM G;  3HOV H;  3BU2 A;  2KEE A;  4E6I A;  1JWM D;  1TWG B;  3ULJ A;  4A3E B;  4GKJ L;  3OIQ A;  3SK8 A;  3K81 C;  4GKK Q;  3QOL A;  1KLU D;  3TP5 A;  4F88 A;  4CJ2 C;  3P75 A;  5FJ8 H;  4LFB Q;  5IGD A;  1VQP A;  5CV4 A;  1ZYR C;  2VL6 A;  3UE1 A;  2J0T D;  5JEA G;  4PZ7 A;  1F2L A;  1TWF B;  3BZD B;  1BBU A;  4A3D B;  1IKM A;  1X55 A;  1PH1 A;  1OTC A;  3PUZ A;  1EYD A;  3AFQ A;  4BBR H;  5A35 A;  2JA5 H;  2Z8L A;  3RZD H;  3UE0 A;  4LNQ A;  1B3Q A;  4Y52 H;  1PFN A;  4K8J A;  4A3I G;  1A15 A;  1ENF A;  1VQJ A;  3T1H L;  2BE5 D;  3CRK C;  4DR5 Q;  3RD4 A;  1VQF A;  2AQ2 B;  2ZM6 L;  1VF7 A;  4LF5 L;  3I4L A;  4JOI C;  3WOF A;  3VR6 A;  1WTX A;  2E2I B;  2O5I C;  1YEZ A;  4U68 A;  2E5L Q;  3GTK H;  4N9P A;  2JA7 H;  4C56 C;  1SSO A;  1MD2 D;  4IPH A;  2CWP A;  2WFW A;  1I6V C;  2KJX A;  5CV7 A;  3GTL H;  4L63 B;  2B2V C;  1IW7 C;  1SFO H;  5C3E B;  4NXN Q;  4A3F G;  2K33 A;  3NBH B;  2CW0 C;  1RF2 D;  4B3M L;  5KRU A;  1L1O A;  1SYE A;  4IUQ A;  1PRT F;  3TS0 A;  2VUM B;  1QVF A;  4JI3 Q;  2QEX A;  2NVX B;  2BDO A;  4KKS A;  1YJW A;  3TP7 A;  3E3X A;  3FMC A;  2VNU D;  1L2F A;  3BJU A;  5KYI A;  1JB7 A;  1V1P B;  4N9T A;  1JMC A;  1CFM A;  2IX3 A;  4HID A;  3CCR A;  1RD9 D;  3R8B A;  5KNC A;  3TS2 A;  3S24 A;  4OEM B;  4RKL A;  2YTX A;  4OL7 A;  2JN4 A;  3G71 A;  3A56 A;  4ZUI A;  4A3K B;  1PLF A;  5D3D A;  1QB5 D;  4X3S A;  1P16 A;  2R93 H;  1ET9 A;  1PVO A;  4K5X A;  1TWA H;  1F2Z A;  4MTK A;  4HN7 A;  1E2V A;  2ZJP A;  4DV5 Q;  1TS4 A;  2F0H A;  2NB0 A;  3N6R A;  1NMG A;  5I2Y A;  1LTA D;  2LXK A;  2KOL A;  2KHS A;  3GQB A;  1QCB D;  4L5S A;  1KD1 C;  2H5X A;  1EIH A;  1E24 A;  2JJQ A;  5M5Y H;  4X62 L;  1Q46 A;  4M8A A;  2JYO A;  5BN5 A;  4I7Z C;  5J22 A;  1O7L A;  2XGT A;  3NP8 A;  3F2B A;  5C0X G;  1Y8O B;  1TQO A;  3S15 B;  4A3E H;  4DN4 M;  1TWG H;  1W6J A;  3F2U A;  3TDQ A;  5LMU L;  4IUP A;  4R4C A;  4DPG A;  2F3W A;  4CDC C;  3QG1 A;  5CV6 A;  4CKE A;  5AJ3 L;  1C7Y A;  4DR2 Q;  2X6G A;  5FO8 B;  4OO1 H;  2LSS A;  1TWF H;  2VB2 X;  4AQY Q;  2L15 A;  2Z4H A;  2VQF L;  2YTV A;  1GO3 E;  3T16 A;  4B9X A;  1JT8 A;  1VF5 C;  1JOK A;  2B2W C;  1JB3 A;  3T1Y L;  1SAP A;  3S1R B;  1IZ6 A;  3PO2 G;  1E22 A;  4P73 A;  2E2H B;  2NZH A;  2Y0S G;  3GTQ B;  2EYO A;  2EZV A;  3I72 A;  1I94 Q;  1HNX L;  4DUY L;  4QUC A;  4C1N I;  4G7O C;  3URY A;  3FRP B;  4BS9 A;  3PIP A;  3HKZ B;  2F0S A;  1Q1E A;  1AH9 A;  2BE5 C;  4DNT B;  2V1C C;  3CPF A;  1E1T A;  2A1A A;  3DEP A;  1I6H B;  4ZUJ A;  1EY0 A;  2I5L X;  1CKN B;  5FO7 B;  2NVQ H;  1Y1W B;  3Q23 A;  3A55 A;  1Q82 C;  5C4J H;  1KAA A;  1SJH D;  3FDT A;  5DLQ E;  4P75 A;  1WD0 A;  4B3T Q;  1BVS A;  1SMX A;  2BA0 A;  1EYG A;  1RTN A;  2VUM H;  4X3T A;  1OO9 B;  1B7Y B;  1H9J A;  4HSP A;  5IIF A;  2EQS A;  2BA1 A;  4LFA L;  1VQL A;  3QB3 A;  3LX0 A;  3FPP A;  1JWU D;  1SE8 A;  1O7Y A;  1EY7 A;  2F0E A;  5EQ0 A;  2E2J B;  3DEO A;  4BY7 B;  1TT2 A;  1UE6 A;  2X6L A;  5COY A;  2XWJ B;  1Q86 C;  1WJJ A;  1IBL Q;  3J7A 5;  2AQ3 B;  5CV8 A;  2B2U A;  3D6C A;  3KOJ A;  4A3K H;  3NTK A;  1PYB A;  4QIW B;  3GO5 A;  1NMF A;  3TRZ A;  4ILW A;  2N88 A;  1HUM A;  1EWH A;  1FNW A;  3TP8 A;  1E7Z A;  1SMY D;  4FYD A;  1SND A;  5IYB H;  1Q7Y C;  4KV6 A;  3HOX B;  4A3G G;  3A8I E;  3K59 A;  1K0S A;  1AP0 A;  2FFK B;  2KHI A;  3D4W A;  4NDX A;  3HKZ G;  2NTS A;  3RZO B;  2DUD A;  1LTI D;  4A3L H;  4HIO A;  2CCZ A;  1PH2 A;  4DR4 L;  3OTO L;  4A3J H;  1VDZ A;  5C44 B;  4IPD A;  3TME A;  3RUZ A;  1HZ9 A;  1X54 A;  4X66 Q;  4NPS A;  1MJC A;  2Y0S E;  2PW5 A;  1SR3 A;  2CQA A;  3PIO A;  4QB4 A;  4TRD A;  3V96 A;  3HG9 A;  4LUZ A;  2JEA I;  4KTA A;  5JJK A;  2QIL A;  1B44 D;  3F2D A;  4JYA Q;  5EPJ A;  3I4M G;  2N49 A;  2PZU A;  2QA4 A;  1A2U A;  4C3I G;  3E5S A;  5I6Y A;  4NKL A;  3WWV A;  4ZKB B;  3K5O A;  1NSN S;  5IGB A;  1VQE A;  4JI7 Q;  5EBD A;  1W3S A;  1RJT A;  5HUR A;  1Y14 B;  3MEH A;  3HOU G;  2PQA A;  4HCE A;  4JCV E;  3VYT A;  3H15 A;  3IFD A;  4HJ9 A;  3KUP A;  5K36 G;  3UI2 A;  3MWY W;  3S1R H;  4DR1 L;  4K6L A;  1KNE A;  5BN4 A;  3GTQ H;  4GOP A;  3CKI B;  1LLR D;  3OIP A;  1I3Q B;  2QF7 A;  3ITP A;  4IUV A;  2YU9 H;  1PTO H;  3BZC A;  3MFG A;  2RKS A;  4APV A;  2RVL A;  1LAB A;  3C3L A;  4H13 C;  2K5V A;  4QCL A;  1CQF A;  2IL8 A;  2XNA C;  3HP3 A;  1YNN D;  4JBJ A;  4XQQ A;  3SVM A;  4TSS A;  3GV3 A;  2JK8 A;  3GTM H;  1HFG A;  3U4Z A;  4DV3 Q;  3OMG A;  2MO1 A;  1ESR A;  4R4I A;  1G6Z A;  3JAM c;  1PDQ A;  5T1I A;  2B2Y A;  3R93 A;  2SEB D;  1HA6 A;  3FPU B;  1LAC A;  1FYC A;  3A54 A;  4RAU C;  2MP1 A;  3HKZ E;  4DV1 Q;  1UAP A;  1EY9 A;  3FKI B;  4R4T A;  4H7B A;  4IUU A;  3SXH A;  1XMQ Q;  1YIT A;  4L6T B;  4IUN A;  1QVC A;  1HNZ Q;  5BR8 L;  1EQV A;  1A8V A;  1SYG A;  2E2J H;  5M3F G;  1YHQ A;  2SOB A;  1GM5 A;  2LFN A;  4RHR A;  1T5E A;  1BCP B;  4KHZ A;  1BCP D;  2ICE C;  3KLS A;  1A3U A;  5IOD A;  4DAP A;  2WAQ G;  1KNA A;  3D0F A;  1RCV D;  3NWT A;  1KDA A;  1DZ1 A;  4NP5 A;  2X69 A;  1JC7 A;  4H0L C;  4A75 A;  3FVQ A;  5HY6 A;  1AFP A;  3EBE A;  2XRQ D;  2LY7 A;  4FDB A;  3I2Z A;  4FP5 D;  3U9S A;  1D7Q A;  3KF6 A;  2I46 A;  1WYD A;  2JE6 I;  2E5L L;  1C0A A;  1SMY C;  3RZO H;  4EQ5 A;  3G7L A;  3DUZ A;  5IYC G;  4MHE A;  1BR9 A;  2ZT9 C;  2ES2 A;  2VQE L;  3DMU A;  2AUK A;  3NEM A;  4QIW E;  3N52 A;  4LF7 L;  2UXB Q;  1JOO A;  4NXN L;  1STA A;  2HHH Q;  1LT5 D;  1SXT A;  3J80 i;  2Z9H A;  5C3X A;  1PH6 A;  1L0X B;  1H95 A;  1WI5 A;  1SE2 A;  3X3N A;  3C1F A;  4JI3 L;  4N8F A;  3DWQ A;  4NXM Q;  3I4N B;  2JQO A;  1I50 B;  1DD2 A;  3TBI B;  1GD7 A;  1OXU A;  2NWG A;  4KY7 A;  1SYB A;  1CKO A;  1UUP A;  3K5N A;  3CHB D;  2BH2 A;  4CJ1 B;  3S14 B;  4DV2 L;  3PO3 B;  2Z6K A;  4XDX A;  1V8Q A;  3MEF A;  1XNQ Q;  4M1U B;  4XYO A;  4QF4 A;  3TEH B;  3TQY A;  4HMI A;  4OWX B;  3H0G B;  3T56 B;  1EWC A;  1CKM A;  3CCM A;  5H1S E;  2LKV A;  4IN3 A;  3KBG A;  4A4I A;  4P2C B;  2UXC L;  1STE A;  1K83 B;  1D1K A;  1ICW A;  2F0U A;  1G91 A;  1G2S A;  1I3Q H;  2ZTC A;  2UXD L;  2F03 A;  4CBV A;  2IHF A;  3CMA A;  2A69 D;  4BBS H;  4LF8 Q;  1ZYR D;  2EY2 A;  4QY7 A;  5CR3 A;  3OW7 A;  1XNR L;  5GAD C;  3G6E A;  4ZLT F;  2KA7 A;  4OXP A;  2HT1 A;  2D62 A;  2Z0S A;  2F0V A;  2B2T A;  5FK9 C;  3HOY G;  2K05 A;  4Q5V A;  2D0O A;  4B3R Q;  2HDM A;  3KDF B;  4JI1 L;  1RL2 A;  1PYW D;  1LTR D;  1YNN C;  3W1G A;  3RN5 A;  4IFD G;  3NQT A;  2K14 A;  1HFN A;  3DLL A;  2XSC A;  2Q8T A;  3UDF A;  1DXM A;  2H4O A;  3FKI H;  2VS1 A;  4O42 A;  4DR2 L;  1X3G A;  2EIF A;  3S1Q B;  4A3C G;  1B4O A;  1NR2 A;  3D4D A;  1H9S A;  4JI8 Q;  2KEC A;  4AQY L;  1VS0 A;  4CHT B;  1PH7 A;  2K6A A;  1UE1 A;  2QDB A;  5C0X I;  1UEB A;  4A93 G;  2ZXO A;  1IL8 A;  3STB C;  3VR5 A;  4B9W A;  2JA8 G;  1VQK A;  2CW0 D;  2ATW A;  1SN8 A;  2PMZ E;  1DYQ A;  2MHV A;  2HCC A;  1S5B D;  3H6M A;  4LAA A;  1CM9 A;  1I94 L;  3EVQ A;  3A8K E;  1NNX A;  2XWB B;  3PCO B;  4BA2 I;  1WCM B;  4ULL A;  2M9V A;  3OPO A;  1N36 L;  1BOS A;  1HA5 A;  4L8J A;  1YNJ C;  4CDE C;  5C4X G;  3W5O A;  3IKJ A;  2A68 D;  3J81 c;  4J6H A;  4J8Q A;  1GUW A;  2OTJ A;  4P74 A;  4GZY C;  2B63 H;  2PZW A;  2MNA A;  3MC0 B;  4B3S Q;  1CK1 A;  2G9D A;  1N33 L;  4DK0 A;  2ZTE A;  3KJP A;  1YHA A;  4B3T L;  5EJW A;  1WOC A;  2UUA Q;  3I4O A;  4R1J A;  1RTO A;  4S3S A;  2MGS A;  2N8N A;  4A3I B;  1QWY A;  2IW3 A;  3O13 A;  3VA7 A;  1Y1V G;  1JR0 D;  3OYY A;  4UP8 A;  1E3P A;  1XMO Q;  4DAM A;  5FJ8 G;  1LYL A;  1SEB D;  3ERS X;  1FL0 A;  2JA9 A;  3H94 A;  5M5X B;  1BF4 A;  2FMM A;  4ABN A;  3S14 H;  1QUQ A;  1WTR A;  4RWS C;  1EWI A;  2PNH A;  2Q8I B;  3K58 A;  1N9W A;  2RBM A;  4BBR G;  4WJ4 A;  1EIY B;  2JA5 G;  4IJH A;  2YV5 A;  2HCI A;  2R92 H;  3A7L A;  1FGU A;  4RMF A;  1U4R A;  4KHP Q;  4A3F B;  2ICI A;  1K83 H;  4P72 A;  3A8J E;  4UAI A;  1VQ6 A;  4LW1 A;  2MJ8 A;  2FJ2 A;  1NTG A;  2GN5 A;  4LF9 Q;  1K8G A;  1GJX A;  1KRS A;  2PYK A;  1JQY D;  5KGU A;  1IBM Q;  4JI2 Q;  3K0X A;  3Q8D A;  2FXQ A;  2A69 C;  4X66 L;  2MPM A;  1FNU A;  3NTH A;  2BDN A;  2Q2T A;  2R7Z G;  5E3F A;  1MJE A;  4YCV A;  3S2D B;  2AHO B;  3VYS A;  4DK3 C;  2EOT A;  4JYA L;  1KRT A;  3H3V I;  4K14 A;  2AWN A;  2QEJ C;  1A63 A;  5DEH A;  3CCV A;  4P71 A;  5IP9 G;  1EYC A;  4POF A;  2GVA A;  1N34 Q;  1SE4 A;  3AB9 A;  2F0G A;  1K3R A;  1SLJ A;  3BDO A;  3E0E A;  3E9H A;  4DGZ A;  1WTQ A;  3K6O A;  3KF8 B;  2RF4 A;  1WD1 A;  4JI7 L;  3S1Q H;  3MZ5 A;  3GV6 A;  4R9W A;  5IGF A;  3DHQ A;  2I5M X;  2YYZ A;  2NZ1 D;  3DXJ C;  4DK6 C;  1QJO A;  3F1Z A;  4ME5 A;  4KI0 A;  4X6A H;  4DNR B;  3J7A F;  1PZK D;  2AKW B;  3OWF A;  3SK4 A;  4EQP A;  2OQK A;  5JEA J;  2ZXR A;  1H9K A;  1EIF A;  1WCM H;  2F0Q A;  2KQ3 A;  3NPP A;  3K5M A;  1GHK A;  1IXR A;  1SBB B;  3I8Z A;  3F8T A;  2QDL A;  4WJW A;  2EYM A;  1F9R A;  1VQ4 A;  2PQE A;  1AZP A;  3QWN A;  5IP7 H;  3MXP A;  4KJO A;  1AZQ A;  3M85 A;  4KK7 A;  1OXS C;  3PMF A;  1PA6 A;  2YTY A;  4LF4 L;  2PW7 A;  2HQE A;  2QW7 A;  2A6H C;  2PO4 A;  1CHP D;  2A68 C;  4LUV A;  1EZ6 A;  1Z47 A;  4JW0 A;  3J80 E;  2EYJ A;  4A3I H;  1EFW A;  3PO2 B;  4MN3 A;  4K2K A;  2JEB I;  1MGS A;  2Y0S B;  1XMQ L;  4DU9 A;  2SNS A;  1B9N A;  1N32 Q;  4PNY A;  5FOB B;  5M5X H;  4DV6 Q;  4G7Z C;  2OF1 A;  4KMU C;  3LWE A;  4NW2 A;  4H44 C;  1S5F D;  2KVM A;  1STY A;  2E76 C;  1GUN A;  1KDC A;  1SNQ A;  3HRZ C;  1EY4 A;  5JJZ A;  4DAV A;  1I4X A;  1R9T B;  1YZ6 A;  3P1H A;  1DGS A;  1TWC B;  4WJ3 M;  4O0A A;  1HQR D;  4A3F H;  3NBH A;  4KHV A;  3WDN A;  1E2Z A;  2O5J C;  4JG2 A;  2K5Q A;  5FLM G;  3PF4 A;  2K52 A;  4ZYS A;  3SR1 A;  5LMN Q;  1BQQ T;  4F8M A;  2DY8 A;  1V1P A;  2BCO A;  1BKB A;  1NBW A;  1ROD A;  3TZU A;  2IPK D;  2R61 A;  3PUY A;  1J5E Q;  4A3D H;  3S2D H;  4GN3 B;  3IL8 A;  2CFM A;  1QVG A;  1SE3 A;  1TU2 B;  2AWO A;  3G4S A;  4GLX A;  4KJN A;  1D8L A;  5HGT A;  4NXM L;  2K1B A;  4OIK A;  4Q0F A;  3PSI A;  1QOH A;  3M4O B;  5C0X J;  2F0O A;  4YHH Q;  5AFW A;  4A3G B;  2NN6 G;  3NBI A;  5ELB A;  1L1O C;  4G7H C;  1Q1B A;  2L12 A;  2EPB A;  4YWM A;  3PUW A;  4GNX A;  2RDF A;  1A62 A;  4KN7 C;  3K8A A;  1PH4 A;  2E2I H;  1JOQ A;  4HAE A;  2F4V Q;  5FO9 B;  2SDF A;  5JPM C;  2I07 B;  1Q8I A;  4DKA C;  3S1M B;  2F0W A;  1G29 1;  3L3O C;  1YI2 A;  5C3E H;  3KBX A;  4AYB G;  5IY0 A;  4LF8 L;  1ZXT A;  4ZAI A;  3I4M B;  5M3M B;  1NCV A;  5LMN W;  4C3I B;  2F0J A;  3V05 A;  1A2T A;  2NVX H;  3K0Y A;  1M90 C;  3OOC A;  1B2T A;  4LF6 Q;  4A3J G;  4C3H G;  2EYH A;  1HR0 Q;  3BDC A;  3HOU B;  1IBK L;  4JBM A;  3I73 A;  2D5D A;  4IPC A;  5JVG 3;  1KC8 C;  2F0F A;  3D6W A;  1CZG A;  1C48 A;  4CGY B;  3PO2 H;  4ID6 A;  4A3B G;  1CUK A;  3VYU A;  1FD7 D;  4CKC A;  1XPR A;  3EQL C;  5I2X A;  4JI8 L;  5IT9 E;  1HCZ A;  2QGQ A;  3R3O A;  5K5P A;  1LM0 A;  2EYP A;  1YBY A;  1ASZ A;  1UE5 A;  3CQZ B;  5CBE E;  1VQN A;  3NHH A;  1QG7 A;  5ELN A;  2CH4 A;  5EPL A;  2KUM A;  4IFD I;  1CKN A;  5DM7 3;  2UUB Q;  3RLF A;  1QE6 A;  4A3M G;  2WV6 D;  4DV4 Q;  2TMP A;  3M3Y B;  1LTT D;  1WFQ A;  1PH8 A;  4H02 A;  1I5F A;  1S5C D;  3T13 A;  5BN3 A;  5ELF A;  2WB1 G;  5IWA Q;  4Y7N B;  3S15 H;  4R8I A;  1X32 A;  2PI2 A;  2R6G A;  4L5T A;  4RGM A;  2K75 A;  1CSP A;  5T1G A;  5M3M G;  1SNO A;  2UU9 L;  2R7D A;  3TP6 A;  4C3J B;  4IOC A;  3MXN B;  1HR0 W;  3ER0 A;  1KQS A;  3S1N B;  2IX1 A;  4B3S L;  1UEA B;  1HUN A;  5FLX E;  2N55 A;  3HS0 C;  3SE0 A;  1XTD A;  1STN A;  2D9U A;  4HED A;  3UDG A;  4L5R C;  4DV0 Q;  5M3F B;  4HIM A;  3E9I A;  4IJL A;  4JI0 Q;  1HRJ A;  1PH5 A;  1KHI A;  3K7A B;  3V2T A;  3I90 A;  2UUA L;  4RCO A;  2F0D A;  3CCE A;  3M7G A;  3BG3 A;  4AYB E;  4BY1 G;  1HZB A;  4FVM A;  4A76 A;  2K04 A;  4ZK9 B;  2WAQ B;  2E2H H;  3M4O H;  3S17 B;  4ODG A;  1NE3 A;  4XXE A;  1TY2 A;  4PMB A;  2UUC Q;  3GTO B;  1TY0 A;  2ZM6 Q;  3IFT A;  1DOK A;  1HJP A;  2F0T A;  4IOA A;  3ULP A;  1U4P A;  4JV5 Q;  5CMD A;  5E1F A;  1CT1 D;  4BXX G;  1DM0 B;  2XVS A;  1AE2 A;  5IGE A;  3E6Z X;  3H3V C;  5EAY A;  3HOW G;  1I6H H;  5I9O A;  2SNM A;  4KKU A;  1D2B A;  3HZX A;  4L5Q A;  3S1M H;  4DR3 Q;  4KHP L;  1Y1W H;  1Z9F A;  3E0J A;  3VDY A;  1GOZ A;  4JI4 Q;  3BVG A;  1HNW Q;  1QIL A;  2OCE A;  1GUO A;  1J8I A;  2PMZ B;  2B2U C;  2JP1 A;  1GKH A;  3Q0A A;  4LF9 L;  4YWK A;  4GKK L;  1V1Q A;  4JI2 L;  5D14 A;  4C3J G;  1A3T A;  4XT3 B;  3STB D;  4LFB L;  5J39 A;  1PTO C;  3K7U C;  4LWC A;  1FNV A;  2E74 C;  3EA6 A;  5IOC A;  4CJ0 B;  4K5W A;  3HOU H;  1UWV A;  2OWO A;  4C1N K;  2KCC A;  4BY7 H;  3HOZ G;  1QZG A;  3U9O A;  1Z7T A;  2VXW A;  2EJM A;  5K36 H;  3PGZ A;  1O7Z A;  2HDL A;  1VQB A;  2IX0 A;  3JC6 6;  3MXG A;  1XYI A;  3J80 c;  1G8Z D;  2F4I A;  3EJI A;  1RKN A;  1YNJ D;  1XXG A;  4X3U A;  4DR5 L;  1Q12 A;  4U67 3;  1SJE D;  1WTH A;  1CQV A;  1LTG D;  3R2T A;  1G2T A;  2B3G A;  1BNZ A;  3HOX H;  1EU3 A;  4LMQ D;  4KY5 A;  4RFB A;  1E1O A;  1F2Y A;  1X65 A;  2G9H D;  1Q3L A;  4DAY B;  2DY7 A;  3DWA A;  1PMR A;  2J4X A;  1U4M A;  3QJY A;  3C2P A;  1PRT D;  1VQG A;  5C44 H;  1PXU A;  3HOY B;  1FGB D;  3JAM i;  2CKZ B;  3TN2 A;  1J6Q A;  4Y7N H;  4J1M A;  4CDD C;  4BBS G;  1DCZ A;  3W3A A;  1U0L A;  2PNR C;  3CW2 C;  5LMU Q;  1TWH B;  1WTP A;  3RLN A;  3MA2 B;  1VQC A;  2L0C A;  1EY5 A;  3NXW A;  2L55 A;  4KD4 A;  5I9P A;  3BVM A;  3GP7 A;  5M3F H;  2BOS A;  3I3C A;  5J1Z A;  4G57 A;  3K7A H;  3J80 L;  4A93 B;  3U50 C;  4JC0 A;  2JA8 B;  1GXD C;  1PFS A;  2WAC A;  1S72 A;  1EEI D;  5KNB A;  2EYL A;  4J15 A;  4XYQ A;  1A0I A;  3T1Y Q;  3NQI A;  1CA5 A;  1N32 L;  4DV5 L;  1HTL D;  2RCF A;  3B6Y A;  1N8R C;  3GTG B;  4Z9C B;  1HNX Q;  3CC7 A;  1HQM C;  1B8A A;  2B2Y C;  1S40 A;  1JJ2 A;  3MFY A;  2C9O A;  5C4X B;  1R4Q B;  3ERO A;  5IYC H;  1WTV A;  1K0R A;  2MQH A;  3GTP B;  1CZW A;  4V0B A;  4FF4 A;  2MUY A;  5EKL A;  2WII B;  4FNF A;  4RKB A;  4BWG B;  1ZEQ X;  4X65 Q;  2WAQ E;  4R8N A;  1E2W A;  1LTS D;  3L9A X;  4IUR A;  1MSH A;  1O80 A;  1V9P A;  3GD7 A;  1II3 A;  4OO1 I;  1UE7 A;  2RDG A;  1KXL A;  1Y1V B;  2R3Z A;  2ALY B;  3LWU A;  1YJN A;  5LMN L;  1TS5 A;  5IYD H;  3OHX C;  2B63 G;  2AMC B;  4LFA Q;  4DA2 A;  1EY6 A;  2NTT A;  4GS3 A;  5LL6 X;  3CP0 A;  2K28 A;  2I5H A;  5I4D A;  1ZKO A;  1IYU A;  3M4Y A;  1YIJ A;  2JA6 G;  4FXK C;  3QR8 A;  2F0K A;  4BBR B;  1F9Q A;  3NK9 A;  2JA5 B;  3RZD B;  4YY3 Q;  4LUO A;  1SNC A;  3Q22 A;  2L5T A;  4R4O A;  1V43 A;  3AQQ A;  1K8A C;  1EU4 A;  2VY3 A;  4RCN A;  1RHP A;  4XT1 B;  5E4X A;  3FP9 A;  1XTC D;  1B1Z A;  2EJG C;  5IT9 c;  2G5D A;  2JXM B;  3K5L A;  4F7X A;  4IFD J;  1JJC B;  2A6H D;  4OGQ C;  2F4V L;  1M8A A;  2RA4 A;  3NSW A;  3QIA A;  2R92 G;  4DR4 Q;  4BA1 I;  3OTO Q;  2XIW A;  2R7Z B;  1H9R A;  1X56 A;  2Z6K C;  5JVH 3;  1KLG D;  4EQN A;  3HOY H;  1IL2 A;  3NEN A;  3NUC A;  1V1O A;  2EJF C;  2ASB A;  1VQH A;  2ZJR A;  1VQI A;  2HQL A;  3KDF A;  4IAL A;  4K5V A;  2HD3 A;  2NN6 I;  4OON A;  1PRT C;  3SK5 A;  1OXX K;  2F0N A;  3KK7 A;  3HOV G;  1JJG A;  3L7Z C;  1MIU A;  4JI5 Q;  4JOI A;  2NUC A;  4FXD A;  1EYA A;  1TWH H;  2L4N A;  3I4N H;  4JVZ A;  1I50 H;  1PZJ D;  2F1M A;  4LF6 L;  5E4W C;  5ELD A;  4A3C H;  5FLX c;  5G3L D;  5CV9 A;  1FJG Q;  4XQJ A;  3EN2 A;  1T9H A;  4FF1 A;  3J7Z C;  5LL6 S;  4LFC Q;  1BXT A;  3PO3 H;  2P5Z X;  2B2V A;  3I70 A;  4HTH A;  1IBL L;  4JI6 Q;  4UDU C;  4XIG S;  2FHT A;  3H0G H;  4JPB W;  3OW2 A;  2R93 B;  2N78 A;  1TWA B;  3G6J B;  3PUX A;  5IT9 L;  2B2T C;  1A6X A;  3SDZ A;  3C46 A;  1IKL A;  2H1E A;  3HKS A;  3W2D A;  4B08 A;  1LO5 D;  4V19 0;  4O2D A;  4HSV A;  3J81 i;  2O4X A;  5JJI A;  1X3F A;  5C5M A;  4ZCK A;  4OHJ A;  5C4X H;  1CSQ A;  2NVY B;  4ALP A;  3J7Y W;  3D3R A;  4DXF A;  2F0L A;  4PMW A;  2JA7 G;  1PYS B;  4TKO B;  1CA6 A;  2Q2U A;  3BYT B;  1B50 A;  4DV4 L;  2KEN A;  3TZD A;  2XN9 C;  5C6A A;  3QO2 A;  1X3E A;  4YCW A;  5IWA L;  1ASY A;  2V4D A;  4G4K A;  1XPU A;  2N3S A;  3NTI A;  3BVZ A;  1Y8P B;  1VQO A;  1L1O B;  4KN4 C;  1M1K C;  4CKB A;  1VQ7 A;  2I0Q A;  4DFA A;  5FLX L;  1PFB A;  1Y1V H;  3Q6S A;  4TQU S;  3UDX A;  3KLS X;  5E7N A;  5IP7 G;  3LNN A;  1OXT A;  3VA5 A;  1ENA A;  1EY8 A;  2WP8 J;  3QOJ A;  3IRB A;  1MSG A;  4DV0 L;  4JI0 L;  5BR8 Q;  2K4K A;  1JE5 A;  1F9S A;  2QCP X;  3S9W A;  4ZQ3 A;  3Q24 A;  2QKI C;  4HJ8 A;  3OWE B;  5L37 A;  1SYF A;  1O78 A;  4K2L A;  4AH6 A;  3CF5 A;  2WKD A;  1JE4 A;  2RDH A;  3L0O A;  2KCN A;  4FO2 A;  4RG1 A;  1TS3 A;  2R93 G;  1F9P A;  1X6O A;  4RGO S;  2KED A; 
#chains in the Genus database with same CATH homology
 2Z1C A;  4IQZ A;  5D65 A;  1BCP F;  1LV9 A;  1I4H A;  3CRL C;  5EKI A;  5EKK A;  2K32 A;  1M4V A;  1BUV T;  4C2M B;  2B2W A;  4RGT A;  2NVQ B;  3HEJ A;  2OXP A;  5JEA H;  1SNP A;  5C4J B;  1PFM A;  3HGB A;  4IUT A;  3JAM E;  5D3I B;  5DM6 3;  1CI3 M;  4FF2 A;  3VR3 A;  1RDP D;  3KF8 A;  4PMC A;  1ET6 A;  5JOB A;  2IT1 A;  1JCK B;  2DNE A;  4RHS A;  4OO1 G;  2PCF B;  3VR2 A;  4DXG A;  1X3P A;  3AMU A;  2RQX A;  3MXU A;  1LT3 D;  1ONL A;  4AYB B;  1GUT A;  1TS2 A;  5IGG A;  2RSO A;  2A73 B;  1SNM A;  2OT2 A;  5A2Q E;  1CHQ D;  3TSS A;  2NBF A;  4A3J B;  4IZ8 A;  4C3H B;  5KYL A;  4EQO A;  3VYR A;  3J7A V;  4KD3 A;  4RA8 A;  3ZYY X;  5EGT A;  1VMC A;  1R4P B;  3NE5 B;  3H09 A;  4A3B B;  1GHJ A;  1STB A;  3FEW X;  1S5D D;  2EY5 A;  1U4L A;  2O2L D;  3OSO A;  5NUC A;  5ISR A;  4YIJ A;  4RGN A;  3KLR A;  1MBY A;  1F2M A;  2DNC A;  4KKT A;  1D6E C;  2B8G A;  5TSS A;  2B39 A;  1AW7 A;  4O1N A;  1U9R A;  1IHZ A;  2EYF A;  5C4Z A;  4A3M B;  1KDB A;  5I6W A;  1EL0 A;  2TSS A;  5C0X H;  2NVT B;  2YU9 B;  4LJZ C;  2WB1 B;  1WVL A;  1PTO B;  3SEB A;  1HHV A;  1PTO D;  3MAQ A;  1X3Q A;  2A74 C;  3BS1 A;  2RSN A;  3ND9 A;  1EZ8 A;  1C8C A;  3IAY A;  1NUC A;  2C5C A;  1HXY D;  1LT4 D;  3MHB A;  2Z4I A;  3GTM B;  1DJR D;  2K01 A;  1HTP A;  3ND8 A;  4PV1 C;  4BY1 B;  1D5X C;  3X3M A;  4QUF A;  2F0M A;  5DNF A;  1EQT A;  2NN6 H;  3C1E A;  5F2D A;  3VR4 A;  4MIU A;  3HOW B;  4HMJ A;  5G3L F;  1LT6 D;  1QNU A;  4DF7 A;  3MTS A;  4HR7 B;  1WTO A;  1BO0 A;  3M7N A;  3D8G A;  1A3V A;  1LTB D;  5ELE A;  3J81 E;  1TVX A;  5ELC A;  1ILP A;  3PIP 3;  3DM1 A;  4WOR A;  2E75 C;  1XX8 A;  1W6K A;  3T4A C;  3WOE A;  3HOZ B;  3K57 A;  3CU7 A;  5DAU A;  2CVR A;  1TKW B;  2XRS D;  3SHL A;  4EVO A;  3BDL A;  5CGK A;  1WTW A;  2EY1 A;  2ZXP A;  1S4Z A;  3D31 A;  5KIX A;  2A6E D;  2JSO A;  2ENB A;  1TR5 A;  1D1I A;  1I4P A;  5CV5 A;  1MI2 A;  5COR A;  3D4R A;  2PZT A;  4NMZ A;  4F87 A;  1QNK A;  1JWS D;  5KND A;  1AEX A;  5KEE A;  1AN8 A;  4BBS B;  1SYD A;  4RH6 A;  2LS0 1;  3MXN A;  3T53 B;  2WIN B;  4I65 A;  5M9O A;  1CTM A;  2NYZ D;  1EFI D;  1C4Q A;  1IYV A;  2A5H A;  1D5Z C;  1NAP A;  2M00 A;  1DON A;  2CHB D;  1T5X D;  2B8F A;  3PIO 3;  5M5W B;  4X3K A;  2K03 A;  2M2L A;  5JPN C;  2F0I A;  1Z6H A;  3S2H B;  1VMP A;  1PRT B;  3DWP A;  5EBC A;  5CYU A;  3OMC A;  1ILQ A;  3ERQ A;  1D5M C;  3RMH A;  5IGC A;  1TII D;  1VCI A;  1STH A;  1GUS A;  3S16 B;  2PPB C;  1J9O A;  2B63 B;  4FF3 A;  2EE1 A;  2F0P A;  3JAM L;  2JA6 B;  4FXG C;  2LMC B;  5CBA E;  5CC4 A;  1BBX C;  1JOR A;  1EEF D;  1I4Q A;  4XTC S;  5C3W A;  1H9M A;  4XQN A;  1H9S B;  1K8O A;  1JIC A;  4DAY A;  2K5W A;  4QMG A;  2A6E C;  4KY6 A;  4WFN 3;  1Q90 A;  2K7V A;  1SDF A;  1B53 A;  2R92 B;  3GTJ B;  2VB3 X;  5JAV A;  5C5L A;  4PQX A;  1DOL A;  5A2Q L;  1FR3 A;  3HOV B;  1UNS A;  1STG A;  3PV0 A;  1ENC A;  1ESF A;  2EVB A;  1PTO F;  3I91 A;  1I4R A;  1KAB A;  2Q8R E;  3ONA B;  1HPC A;  4JK1 C;  3PUV A;  1B3A A;  2DN8 A;  1OXV A;  2AQ1 B;  2K5D A;  4JBW A;  1NR4 A;  2F3V A;  4DK1 A;  2EDG A;  1Y69 U;  2EXZ A;  1XWE A;  5EPK A;  1S5E D;  4LK1 C;  2ID0 A;  1IW7 D;  3NWS A;  1B9M A;  3GTK B;  2JA7 B;  1DOM A;  2IJ0 A;  4HCS A;  3SK6 A;  3GTL B;  4K6D A;  1PZI D;  1SFO B;  1K8M A;  2AUJ D;  1EOT A;  4OIJ A;  1BCP C;  3A7A B;  5LHY 1;  2FIN B;  3R2I A;  4IFD H;  3P7J A;  1EIG A;  2IWH A;  3H91 A;  1ML0 D;  2L1B A;  1L0Y B;  2E2D C;  1KTK A;  4K8I A;  1GUG A;  2GA4 B;  2WKC A;  1F77 A;  2L11 A;  1I4G A;  2FMC A;  1SYC A;  4ZRZ A;  1BDO A;  1E0B A;  2HUG A;  3AU7 A;  3EFX D;  3T51 B;  3BYY B;  2OEO A;  2L9H A;  4ZKC B;  5M5Y B;  4WRD A;  5C4H A;  2D2C C;  1Y8N B;  2EY6 A;  5FKA C;  3MVV A;  4EGV A;  2J7Z A;  3P20 A;  3J81 L;  2KEE A;  4E6I A;  1JWM D;  1TWG B;  4A3E B;  3OIQ A;  3SK8 A;  3QOL A;  1KLU D;  3TP5 A;  4F88 A;  4CJ2 C;  3P75 A;  5IGD A;  5CV4 A;  1ZYR C;  2J0T D;  5JEA G;  1F2L A;  1TWF B;  3BZD B;  4A3D B;  1IKM A;  3PUZ A;  1EYD A;  5A35 A;  2Z8L A;  1PFN A;  4K8J A;  1A15 A;  1ENF A;  2BE5 D;  3CRK C;  3RD4 A;  2AQ2 B;  1VF7 A;  3I4L A;  3WOF A;  3VR6 A;  1WTX A;  2E2I B;  2O5I C;  4U68 A;  4N9P A;  4C56 C;  1SSO A;  1MD2 D;  1I6V C;  2KJX A;  5CV7 A;  4L63 B;  2B2V C;  1IW7 C;  5C3E B;  2K33 A;  2CW0 C;  1RF2 D;  5KRU A;  1SYE A;  4IUQ A;  1PRT F;  2VUM B;  2NVX B;  2BDO A;  4KKS A;  3TP7 A;  3FMC A;  2VNU D;  5KYI A;  1V1P B;  4N9T A;  1CFM A;  2IX3 A;  1RD9 D;  3R8B A;  5KNC A;  4RKL A;  4OL7 A;  3A56 A;  4ZUI A;  4A3K B;  1PLF A;  5D3D A;  1QB5 D;  4X3S A;  1ET9 A;  4K5X A;  1F2Z A;  4HN7 A;  1E2V A;  1TS4 A;  2F0H A;  2NB0 A;  3N6R A;  5I2Y A;  1LTA D;  2KOL A;  2KHS A;  3GQB A;  1QCB D;  1EIH A;  4M8A A;  2JYO A;  5BN5 A;  4I7Z C;  5J22 A;  1O7L A;  3NP8 A;  5C0X G;  1Y8O B;  1TQO A;  3S15 B;  4DN4 M;  1W6J A;  3F2U A;  3TDQ A;  4IUP A;  2F3W A;  3QG1 A;  5CV6 A;  4CKE A;  2X6G A;  5FO8 B;  4OO1 H;  2VB2 X;  2Z4H A;  3T16 A;  4B9X A;  1VF5 C;  1JOK A;  2B2W C;  1JB3 A;  3S1R B;  1SAP A;  2E2H B;  3GTQ B;  2EYO A;  2EZV A;  3I72 A;  4QUC A;  4C1N I;  4G7O C;  3URY A;  3FRP B;  4BS9 A;  3HKZ B;  2F0S A;  1Q1E A;  2BE5 C;  4DNT B;  3DEP A;  1I6H B;  4ZUJ A;  1EY0 A;  5FO7 B;  1Y1W B;  3Q23 A;  3A55 A;  1KAA A;  1SJH D;  3FDT A;  1WD0 A;  2BA0 A;  1RTN A;  4X3T A;  1OO9 B;  1H9J A;  4HSP A;  5IIF A;  2BA1 A;  3QB3 A;  3LX0 A;  3FPP A;  1JWU D;  1O7Y A;  1EY7 A;  2F0E A;  5EQ0 A;  2E2J B;  3DEO A;  4BY7 B;  1TT2 A;  2X6L A;  5COY A;  2XWJ B;  2AQ3 B;  5CV8 A;  2B2U A;  3D6C A;  3NTK A;  4QIW B;  3GO5 A;  4ILW A;  2N88 A;  1HUM A;  1EWH A;  1FNW A;  3TP8 A;  1SMY D;  4FYD A;  1SND A;  4KV6 A;  3HOX B;  3A8I E;  3K59 A;  1AP0 A;  2FFK B;  3D4W A;  4NDX A;  2NTS A;  3RZO B;  1LTI D;  1VDZ A;  5C44 B;  3TME A;  3RUZ A;  2PW5 A;  2CQA A;  4QB4 A;  4TRD A;  3V96 A;  3HG9 A;  2JEA I;  4KTA A;  2QIL A;  1B44 D;  5EPJ A;  2PZU A;  1A2U A;  4C3I G;  3E5S A;  5I6Y A;  4NKL A;  4ZKB B;  3K5O A;  1NSN S;  5IGB A;  5EBD A;  1RJT A;  5HUR A;  3MEH A;  4HCE A;  3VYT A;  3IFD A;  3KUP A;  5K36 G;  3UI2 A;  3MWY W;  4K6L A;  1KNE A;  5BN4 A;  3CKI B;  1LLR D;  3OIP A;  1I3Q B;  2QF7 A;  3ITP A;  4IUV A;  1PTO H;  3MFG A;  2RKS A;  2RVL A;  1LAB A;  3C3L A;  4H13 C;  4QCL A;  1CQF A;  2IL8 A;  2XNA C;  3HP3 A;  1YNN D;  4XQQ A;  3SVM A;  4TSS A;  3GV3 A;  1HFG A;  3OMG A;  1ESR A;  1G6Z A;  1PDQ A;  5T1I A;  2B2Y A;  3R93 A;  2SEB D;  1HA6 A;  3FPU B;  1LAC A;  1FYC A;  3A54 A;  4RAU C;  2MP1 A;  1UAP A;  1EY9 A;  3FKI B;  4H7B A;  4IUU A;  3SXH A;  4L6T B;  4IUN A;  1EQV A;  1SYG A;  2SOB A;  2LFN A;  4RHR A;  1T5E A;  1BCP B;  4KHZ A;  1BCP D;  2ICE C;  3KLS A;  1A3U A;  5IOD A;  4DAP A;  1KNA A;  1RCV D;  3NWT A;  1KDA A;  1DZ1 A;  4NP5 A;  2X69 A;  1JC7 A;  4H0L C;  3FVQ A;  1AFP A;  2XRQ D;  2LY7 A;  3U9S A;  4FP5 D;  2I46 A;  2JE6 I;  1SMY C;  3G7L A;  3DUZ A;  4MHE A;  1BR9 A;  2ZT9 C;  3DMU A;  2AUK A;  3N52 A;  1JOO A;  1STA A;  1LT5 D;  1SXT A;  5C3X A;  1L0X B;  1SE2 A;  3X3N A;  3C1F A;  3DWQ A;  3I4N B;  1I50 B;  1DD2 A;  3TBI B;  1OXU A;  2NWG A;  4KY7 A;  1SYB A;  1UUP A;  3K5N A;  3CHB D;  4CJ1 B;  3S14 B;  3PO3 B;  4XDX A;  1V8Q A;  4M1U B;  4XYO A;  4QF4 A;  4HMI A;  3H0G B;  3T56 B;  1EWC A;  2LKV A;  4IN3 A;  3KBG A;  4P2C B;  1STE A;  1K83 B;  1D1K A;  1ICW A;  2F0U A;  1G91 A;  1G2S A;  2F03 A;  4CBV A;  2A69 D;  1ZYR D;  2EY2 A;  5CR3 A;  3OW7 A;  4ZLT F;  2KA7 A;  2D62 A;  2F0V A;  2B2T A;  5FK9 C;  2K05 A;  4Q5V A;  2HDM A;  1PYW D;  1LTR D;  1YNN C;  4IFD G;  3NQT A;  1HFN A;  2XSC A;  2Q8T A;  1DXM A;  2H4O A;  4O42 A;  3S1Q B;  1B4O A;  1NR2 A;  3D4D A;  1H9S A;  2KEC A;  4CHT B;  2K6A A;  2QDB A;  5C0X I;  2ZXO A;  1IL8 A;  3VR5 A;  4B9W A;  2CW0 D;  1DYQ A;  2MHV A;  2HCC A;  1S5B D;  3H6M A;  4LAA A;  1CM9 A;  3EVQ A;  3A8K E;  2XWB B;  4BA2 I;  1WCM B;  4ULL A;  2M9V A;  3OPO A;  1BOS A;  1HA5 A;  4L8J A;  1YNJ C;  3IKJ A;  2A68 D;  4J6H A;  4J8Q A;  1GUW A;  4GZY C;  2PZW A;  3MC0 B;  1CK1 A;  2G9D A;  4DK0 A;  5EJW A;  1RTO A;  4S3S A;  2MGS A;  4A3I B;  1QWY A;  2IW3 A;  3O13 A;  3VA7 A;  1JR0 D;  1SEB D;  3H94 A;  5M5X B;  1BF4 A;  2FMM A;  4ABN A;  1WTR A;  4RWS C;  2Q8I B;  3K58 A;  2RBM A;  2HCI A;  3A7L A;  1U4R A;  4A3F B;  2ICI A;  3A8J E;  4UAI A;  2MJ8 A;  2FJ2 A;  1GJX A;  2PYK A;  1JQY D;  5KGU A;  2A69 C;  2MPM A;  1FNU A;  3NTH A;  2BDN A;  5E3F A;  3S2D B;  3VYS A;  2EOT A;  4K14 A;  2AWN A;  2QEJ C;  5DEH A;  1EYC A;  1SE4 A;  3AB9 A;  2F0G A;  3BDO A;  4DGZ A;  1WTQ A;  3K6O A;  1WD1 A;  3MZ5 A;  3GV6 A;  4R9W A;  5IGF A;  3DHQ A;  2YYZ A;  2NZ1 D;  3DXJ C;  1QJO A;  4ME5 A;  4KI0 A;  4DNR B;  3J7A F;  1PZK D;  3OWF A;  3SK4 A;  4EQP A;  5JEA J;  2ZXR A;  1H9K A;  2F0Q A;  2KQ3 A;  3NPP A;  3K5M A;  1GHK A;  1SBB B;  3I8Z A;  4WJW A;  2EYM A;  1F9R A;  2PQE A;  1AZP A;  3QWN A;  3MXP A;  4KJO A;  1AZQ A;  3M85 A;  4KK7 A;  1OXS C;  3PMF A;  2PW7 A;  2HQE A;  2A6H C;  2PO4 A;  1CHP D;  2A68 C;  1EZ6 A;  1Z47 A;  3J80 E;  2EYJ A;  3PO2 B;  4MN3 A;  4K2K A;  2JEB I;  1MGS A;  2Y0S B;  4DU9 A;  2SNS A;  1B9N A;  4PNY A;  5FOB B;  4G7Z C;  2OF1 A;  4KMU C;  3LWE A;  4NW2 A;  4H44 C;  1S5F D;  2KVM A;  1STY A;  2E76 C;  1GUN A;  1KDC A;  1SNQ A;  3HRZ C;  1EY4 A;  5JJZ A;  4DAV A;  1I4X A;  1R9T B;  3P1H A;  1TWC B;  1HQR D;  3NBH A;  4KHV A;  3WDN A;  1E2Z A;  2O5J C;  2K5Q A;  4ZYS A;  3SR1 A;  1BQQ T;  4F8M A;  2DY8 A;  1V1P A;  2BCO A;  1ROD A;  3TZU A;  2IPK D;  2R61 A;  3PUY A;  3IL8 A;  1SE3 A;  1TU2 B;  2AWO A;  4KJN A;  5HGT A;  2K1B A;  4OIK A;  4Q0F A;  1QOH A;  3M4O B;  5C0X J;  2F0O A;  5AFW A;  4A3G B;  2NN6 G;  3NBI A;  5ELB A;  4G7H C;  1Q1B A;  2L12 A;  2EPB A;  3PUW A;  2RDF A;  4KN7 C;  1JOQ A;  4HAE A;  5FO9 B;  2SDF A;  5JPM C;  2I07 B;  1Q8I A;  3S1M B;  2F0W A;  1G29 1;  3L3O C;  3KBX A;  1ZXT A;  4ZAI A;  3I4M B;  5M3M B;  1NCV A;  4C3I B;  2F0J A;  3V05 A;  1A2T A;  3K0Y A;  3OOC A;  1B2T A;  4C3H G;  2EYH A;  3BDC A;  3HOU B;  3I73 A;  2D5D A;  5JVG 3;  2F0F A;  3D6W A;  1CZG A;  1C48 A;  4CGY B;  4ID6 A;  3VYU A;  1FD7 D;  4CKC A;  3EQL C;  5I2X A;  5IT9 E;  1HCZ A;  3R3O A;  5K5P A;  2EYP A;  3CQZ B;  5CBE E;  3NHH A;  1QG7 A;  5EPL A;  2KUM A;  4IFD I;  5DM7 3;  3RLF A;  1QE6 A;  2WV6 D;  3M3Y B;  2TMP A;  1LTT D;  1S5C D;  3T13 A;  5BN3 A;  5ELF A;  4Y7N B;  4R8I A;  1X32 A;  4RGM A;  2R6G A;  5T1G A;  1SNO A;  3TP6 A;  4C3J B;  3S1N B;  2IX1 A;  1UEA B;  1HUN A;  5FLX E;  2N55 A;  3HS0 C;  3SE0 A;  1STN A;  2D9U A;  4HED A;  5M3F B;  1HRJ A;  3K7A B;  3V2T A;  3I90 A;  4RCO A;  2F0D A;  3M7G A;  3BG3 A;  4FVM A;  2K04 A;  4ZK9 B;  2WAQ B;  3S17 B;  4ODG A;  4XXE A;  1TY2 A;  4PMB A;  3GTO B;  1TY0 A;  3IFT A;  1DOK A;  2F0T A;  1U4P A;  5CMD A;  5E1F A;  1CT1 D;  1DM0 B;  2XVS A;  5IGE A;  3E6Z X;  3H3V C;  5I9O A;  2SNM A;  4KKU A;  1D2B A;  3HZX A;  3E0J A;  1GOZ A;  3BVG A;  1QIL A;  1GUO A;  1J8I A;  2PMZ B;  2B2U C;  2JP1 A;  3Q0A A;  5D14 A;  4C3J G;  1A3T A;  4XT3 B;  5J39 A;  1PTO C;  1FNV A;  2E74 C;  3EA6 A;  5IOC A;  4CJ0 B;  4K5W A;  4C1N K;  2KCC A;  3U9O A;  1Z7T A;  2VXW A;  2EJM A;  5K36 H;  1O7Z A;  2HDL A;  2IX0 A;  3MXG A;  1XYI A;  1G8Z D;  2F4I A;  3EJI A;  1RKN A;  1YNJ D;  1XXG A;  4X3U A;  1Q12 A;  4U67 3;  1SJE D;  1CQV A;  1LTG D;  3R2T A;  1G2T A;  1BNZ A;  1EU3 A;  4LMQ D;  4KY5 A;  4RFB A;  1F2Y A;  2G9H D;  1Q3L A;  2DY7 A;  3DWA A;  1PMR A;  2J4X A;  1U4M A;  3QJY A;  3C2P A;  1PRT D;  1PXU A;  3HOY B;  1FGB D;  3TN2 A;  4J1M A;  1DCZ A;  3W3A A;  2PNR C;  1TWH B;  1WTP A;  3MA2 B;  2L0C A;  1EY5 A;  3NXW A;  2L55 A;  4KD4 A;  5I9P A;  3BVM A;  3GP7 A;  2BOS A;  3I3C A;  5J1Z A;  4G57 A;  3J80 L;  4A93 B;  2JA8 B;  1GXD C;  2WAC A;  1EEI D;  5KNB A;  2EYL A;  4XYQ A;  3NQI A;  1CA5 A;  1HTL D;  3GTG B;  4Z9C B;  1HQM C;  2B2Y C;  3MFY A;  2C9O A;  5C4X B;  1R4Q B;  3ERO A;  1WTV A;  3GTP B;  1CZW A;  4V0B A;  4FF4 A;  2MUY A;  5EKL A;  2WII B;  4FNF A;  4RKB A;  4BWG B;  1ZEQ X;  4R8N A;  1E2W A;  1LTS D;  3L9A X;  4IUR A;  1MSH A;  1O80 A;  3GD7 A;  1II3 A;  4OO1 I;  2RDG A;  1Y1V B;  2R3Z A;  3LWU A;  1TS5 A;  3OHX C;  4DA2 A;  1EY6 A;  2NTT A;  5LL6 X;  2K28 A;  5I4D A;  1ZKO A;  1IYU A;  3M4Y A;  4FXK C;  2F0K A;  4BBR B;  1F9Q A;  3NK9 A;  2JA5 B;  3RZD B;  1SNC A;  3Q22 A;  2L5T A;  1V43 A;  1EU4 A;  4RCN A;  1RHP A;  4XT1 B;  5E4X A;  1XTC D;  1B1Z A;  2EJG C;  2JXM B;  3K5L A;  4F7X A;  4IFD J;  2A6H D;  4OGQ C;  1M8A A;  2RA4 A;  3NSW A;  3QIA A;  4BA1 I;  2XIW A;  2R7Z B;  1H9R A;  5JVH 3;  1KLG D;  4EQN A;  1V1O A;  2EJF C;  3NUC A;  4K5V A;  4IAL A;  2NN6 I;  1PRT C;  3SK5 A;  1OXX K;  2F0N A;  3KK7 A;  3L7Z C;  2NUC A;  4FXD A;  1EYA A;  2L4N A;  1PZJ D;  2F1M A;  5E4W C;  5ELD A;  5G3L D;  5CV9 A;  4XQJ A;  4FF1 A;  5LL6 S;  1BXT A;  2B2V A;  3I70 A;  4HTH A;  4UDU C;  4XIG S;  2FHT A;  2R93 B;  1TWA B;  3G6J B;  3PUX A;  5IT9 L;  2B2T C;  1A6X A;  3SDZ A;  3C46 A;  1IKL A;  2H1E A;  3W2D A;  4B08 A;  4V19 0;  1LO5 D;  4HSV A;  2O4X A;  5C5M A;  4OHJ A;  2NVY B;  3J7Y W;  3D3R A;  4DXF A;  2F0L A;  4PMW A;  4TKO B;  1CA6 A;  3BYT B;  1B50 A;  3TZD A;  2XN9 C;  5C6A A;  3QO2 A;  2V4D A;  4G4K A;  3NTI A;  3BVZ A;  1Y8P B;  4KN4 C;  4CKB A;  4DFA A;  5FLX L;  1PFB A;  3Q6S A;  4TQU S;  3KLS X;  3LNN A;  1OXT A;  3VA5 A;  1ENA A;  1EY8 A;  2WP8 J;  3QOJ A;  1MSG A;  1F9S A;  2QCP X;  3S9W A;  3Q24 A;  4ZQ3 A;  2QKI C;  3OWE B;  1SYF A;  1O78 A;  4K2L A;  2WKD A;  1JE4 A;  2RDH A;  2KCN A;  4FO2 A;  1TS3 A;  1F9P A;  4RGO S;  2KED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...