1UAPA

Nmr structure of the ntr domain from human pcolce1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
131
structure length
131
Chain Sequence
SPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREPGEGLAVTVSLIGAYKTGGLDLPSPPTGASLKFYVPCKQCPPMKKGVSYLLMGQVEENRGPVLPPESFVVLHRPNQDQILTNLSKRKCPSQPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Procollagen C-proteinase enhancer protein
publication title NMR Structure of the Netrin-like Domain (NTR) of Human Type I Procollagen C-Proteinase Enhancer Defines Structural Consensus of NTR Domains and Assesses Potential Proteinase Inhibitory Activity and Ligand Binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 18
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2003-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01759 NTR UNC-6/NTR/C345C module
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1uapA00
3KLSA 5FO9B 1XWEA 5JPNC 1GXDC 2E2DC 2QKIC 2WINB 3HRZC 3MA2B 3T4AC 3L3OC 4FXKC 2A73B 3CKIB 5FO7B 3G6JB 2A74C 3I70A 2ICEC 5FO8B 3HS0C 1UAPA 2TMPA 3CU7A 4FXGC 1JC7A 1UEAB 1D2BA 1BUVT 1BR9A 3FRPB 2J0TD 3OHXC 2B39A 2XWJB 2I07B 1JB3A 2WIIB 3V96A 5FOBB 1OO9B 4ILWA 5JPMC 1BQQT 1PXUA 2XWBB
chains in the Genus database with same CATH superfamily
1STBA 3DM1A 3DUZA 1R4QB 4JI7L 1EWCA 4AQYQ 2JK8A 5CGKA 4LF9L 1JMCA 2CFMA 4OEMB 2Q8TA 2WKDA 5IYBG 5EAYA 4PQXA 1B4OA 1ZYRD 3CU7A 4UDUC 3VR6A 3S16B 1XNRL 1ILQA 1LTSD 4JI2Q 4CDEC 3VA7A 2JA5H 3SHLA 3PIP3 1VF7A 2F0IA 2ICIA 4C3JH 3EJIA 5CC4A 2PW5A 5NUCA 4IUUA 3I4MG 2HHHQ 2OCEA 1DYQA 4JI1L 4KJNA 2E76C 4QCLA 3CQZB 1ASZA 2WB1E 4FP5D 4RHSA 2KJXA 1QILA 2Z6BA 2EY1A 5IP7H 3UDGA 1A3VA 1CZWA 2NZHA 2XN9C 4X62Q 1HJPA 1OXXK 4O0AA 1XMOL 1K8AC 4BY7B 2MPMA 3D0FA 1I6VC 1WCMG 3A7AB 3NTHA 3Q22A 4A3KG 3QB3A 1IYVA 5C44G 4C3IG 1G51A 4DR6Q 1H95A 2FINB 4GKKL 4ILWA 1K73C 3NBHB 1ZXTA 2KBNA 1KLGD 1AZPA 1KDAA 3KLSX 1KL9A 1EY9A 1VQKA 1EQTA 1KAWA 1VF5C 1L1OC 4JV5L 4GOPC 2EY5A 3G6EA 4ZKCB 4F88A 4KHPL 2A5HA 2JA9A 4JI3L 3JAMi 1B1ZA 3CP0A 4RGMA 1X54A 4TRDA 4QB4A 1C0AA 1STAA 1JB7A 5FLXc 1L0XB 3F2BA 1IW7C 1D8LA 1MSHA 4DUZQ 5C5MA 4DV5Q 3F8TA 3S9WA 2K1BA 5CORA 1BXTA 1HTLD 5IWAQ 1SR3A 2B63G 1PRTC 2N88A 4FXGC 3PV0A 4H02A 1PFSA 5DAUA 5IYCH 4B3TL 2HT1A 2EJMA 4WORA 3A8KE 1SLJA 4DNRB 2UXCQ 1OO9B 1B9MA 2F0KA 4HIOA 4UY8C 2JEBI 2R3ZA 2PI2E 1O7ZA 3OWEB 4Q0FA 3I56A 3NQTA 4EQOA 2QEXA 1TS2A 2LFNA 3I70A 3OMGA 2PQAA 4A3BB 2VS1A 4PMCA 2EYOA 4JI5Q 1I4PA 5LMNL 1HQRD 5M3FG 4KN4C 4HSVA 3FDTA 4RKLA 4DR3L 1DM0B 3HOUH 4IUPA 4TQUS 1BCPD 3KFUA 1GUSA 1HH2P 3CC4A 3FEWX 3A7LA 1EU3A 1PH2A 1EZ8A 1EY8A 1NR4A 3H0GG 1OXSC 2UUAQ 1PTOF 4IURA 2R7DA 4LJZC 2D9UA 3UDFA 2F4IA 3LNNA 1E22A 1JWMD 1SSOA 4L5QA 1IZ6A 4CJ0B 1EQQA 4JOIA 1Q82C 1Y1WB 2OWOA 1ENCA 1CFMA 4BXXG 3S1MB 4DV2L 1I4HA 1MSGA 1VQLA 1XNQQ 2E2JB 1TWAH 1TS5A 3GTPH 1STEA 1N32L 2KHSA 5IYBH 1NUCA 2MFIA 3JAMc 3HOVG 3KF6B 4KKTA 5D65A 3X3MA 2PZWA 1VQAA 4B9XA 1M4VA 3QOJA 5GROA 2KCNA 2IJ0A 2R93H 2NYZD 2UUBL 2B2UA 1GVPA 3A55A 4GS3A 1YHQA 1HXYD 1VQ6A 1YHAA 4IALA 3I4MH 4A3DH 2C35B 1WJJA 1YJ9A 2PQEA 1LTBD 1WI5A 3VYSA 4HJAA 3PUVA 4IN3A 2KHIA 4DA2A 4J1MA 2RCNA 4QY7A 2K5VA 5CR3A 2UUCL 2Z6KA 3KUPA 2EYMA 1CUKA 1Q86C 2DN8A 3CKIB 5ELCA 4FNFA 2RF4A 4IPHA 1R9TH 1WCMH 3NUCA 1ICFB 3S1RH 4A3KH 1G2TA 1KD1C 5C44H 4C3IH 4IFDJ 1CA5A 2N3SA 3TN2A 2BA0A 3Q8DA 3HOWH 1E2WA 3MXUA 4LF9Q 2ID0A 2K05A 2GN5A 2OQKA 2RDHA 2VY3A 4JYAL 2SOBA 3CD6A 2K4KA 3BYYB 1XNRQ 1P8LA 3SVMA 1VS0A 1BBUA 4HJ8A 1WFQA 1XPUA 5E1FA 5KGUA 4L6TB 3CCLA 1G8ZD 4C2MB 3D4RA 1EY0A 4C1NI 1QUQB 1UEBA 3PF4A 3I4NG 4A3GB 3AFQA 4JBKA 4JI1Q 3UE1A 1WTPA 3CCUA 5GAGC 4GKJL 4RKBA 1TWCH 1SFOB 1MIUA 2HCCA 2EYLA 3K5OA 2FMMA 5LHY1 1J9OA 2B63H 5G3LD 5KIXA 2Q8RE 5EKKA 5KYLA 2AHOB 4GKKQ 5EJWA 1UAPA 1A8VA 2E2HH 1S5BD 3D6WA 4JI4L 4GLVB 4XDXA 5EBDA 2MP1A 3KJPA 3T53B 5LMNW 3A54A 1HZ9A 1PFMA 5HY6A 5ISRA 2F0UA 5M5XH 4CKBA 1WD0A 4KHPQ 2JA6G 4I65A 4JI3Q 1IBMQ 5JPNC 2AQ1B 4I7AA 3PO3B 2A73B 3K81C 3MFGA 3B6YA 1W6JA 4R8NA 1YNJC 3CMAA 4A3MB 3J80i 5M3FH 2R92G 2NVYH 2QDLA 3ULLA 2MO0A 1NJIC 1VQIA 1K28A 3MVVA 1HNWL 3H0GH 5I2YA 2RDFA 1QVGA 4FXDA 5KNCA 4A3IG 1YJNA 4JK1C 1ENFA 2F1MA 3T13A 1PLFA 3RN2A 4DR4L 4B3TQ 1T9HA 3J81E 1LTLA 3U9SA 1WOCA 2BA1A 1GUWA 3SK6A 2PMZE 1VQHA 3M4PA 2R7ZB 3PCOB 4KJOA 3SK8A 5M5YB 4OHJA 3OTOL 1RIPA 2XIWA 3SE0A 2FJ2A 1SRUA 4UPAA 3VR4A 2Z4IA 1HZBA 2I5LX 2ZXPA 4EX5A 5IGCA 5LMNQ 3HOVH 5DLQE 2N55A 1L0YB 4DR3Q 3H3VI 3W5OA 1KDCA 1D5XC 2F0PA 3KK7A 2SNMA 4XTCS 3AQQA 5FLMG 3E9IA 4K2LA 1MHWC 1OXTA 3I8ZA 1IW7D 1IKMA 3GTLB 1XYIA 1A62A 1S72A 1A3UA 2F0QA 2FMCA 3CCMA 1FR3A 2EE1A 3DWAA 3HOYG 1RHPA 4FF1A 3CF5A 3MA2B 1LTTD 1B9NA 3VYRA 1PRTD 1UE6A 1V1PB 3MEHA 2GVBA 4K6DA 5CV7A 2CWAA 5EPLA 4DV2Q 2CKZB 3MEFA 1H9KA 4BBRB 1BR9A 4A3JG 1N32Q 5IT9L 1KNEA 3MXNB 3K59A 1EU4A 2NN6I 1Y8NB 1DOLA 1Q46A 1IXRA 3I2ZA 2M9VA 1FGUA 3J7ZC 4IJLA 3J80c 1EOVA 3I7FA 2UUBQ 3TP7A 4LK1C 3S2DB 1AW7A 3MFYA 3I4NH 1JCKB 4PV1C 4YWLA 3M9BA 1CHPD 4IOCA 2EYJA 3N6RA 2UUCQ 2G9DA 2F0FA 4RGNA 1CZGA 5C4JH 3S17H 1D1KA 3RLOA 5COYA 3W3AA 3OIPA 1RTNA 4LUOA 2RCFA 2O5JC 2F0JA 3HOZG 1CI3M 1NY4A 4MNOA 4JYAQ 1F77A 5JJZA 4RGOS 1Q7YC 2F03A 1UUPA 2J0TD 5EKIA 3K7UC 4OONA 2M2LA 2JA6H 5LMUL 4KHZA 2ZM6L 2EPBA 5TSSA 1LT5D 2KECA 4NW2A 5CV4A 2IX0A 2WKCA 2CHBD 5FLXL 2F0NA 4GKJQ 1E0BA 2AUJD 2EYPA 1KDBA 1LTGD 5BN4A 4CDDC 2CH4A 4RCOA 1SNDA 5T1IA 3FRPB 2NN6G 3G4SA 2VNUD 1II3A 1FVIA 4MTNA 4CDFC 4QGUA 3A74A 1B7YB 4JI4Q 2QKIC 3I55A 3RR5A 2BE5C 5I9PA 1AE3A 3OW7A 4AIMA 4CJ1B 5JJIA 4DUYQ 2L4NA 1NSNS 1XMQL 1X56A 2F0WA 2JE6I 5ELOA 4HCSA 4ZCKA 2KCCA 3RD4A 1PV4A 1NBWA 3S1QB 4DFAA 2AKWB 1L1OB 3BS1A 1GJXA 4GOPB 2SEBD 4JI5L 5M5WH 3RLNA 5IE8A 5IGBA 1B44D 4NPSA 1J8IA 4AYBB 1HR0L 4DR7L 1YNNC 3D31A 4N8X1 2B2WC 4XYQA 3EA6A 1BCPF 1I4XA 4KTAA 5FLMH 3GTQB 2HIVA 2CH4W 1HNWQ 3DMUA 1VMPA 1X3PA 5JEAH 1WTQA 2NVTB 3ZYYX 4EQPA 1PDQA 1AZQA 1FYCA 4X6AH 2L15A 2PZUA 4DR4Q 3KDFB 3HOYH 4U673 1XX8A 3PMFA 3E0JA 5EGTA 4J15A 2NB0A 2A6HC 4DV0L 1HFNA 1KC8C 1H9RA 3OTOQ 4PZ6A 1NAPA 3ULPA 2L55A 3BU2A 4A3JH 1XPOA 4OX9L 1H9SB 3JAML 1A2UA 1LO5D 2K01A 1PHJA 5E3FA 3KBGA 1EFID 3LGJA 1I6HB 1BOSA 3A5UA 3MC0B 1YNJD 4QUFA 3PUYA 3QG1A 2ICEC 1C7YA 1VQ9A 4LAAA 1SXTA 1LM0A 4R8IA 3M7GA 1ASYA 3MAQA 2QCPX 5ELFA 2N49A 1CSQA 1E3PA 3T1YL 4U68A 2I07B 2N8NA 2EXZA 3H3VH 2RBMA 4B3ML 1MI2A 2NBFA 4LNQA 1XWEA 4FO2A 1L2FA 4KY7A 1PZJD 2F0OA 1R4PB 4IUTA 5M3MG 3W1BA 1B70B 3TS2A 1MD2D 2JA5B 1JC7A 4IOAA 2K04A 3GP7A 1B3AA 3KBXA 4C3JB 1ET9A 3C1FA 1EUJA 1G291 4X64L 2OXPA 4DR1L 2WAQE 2J7ZA 3DEPA 4EVOA 1XXGA 4JVZA 1YEZA 1WTVA 1Y1WG 4P71A 3BYTB 4LFBL 1JWUD 5GAEC 4HJ9A 4R4IA 3IAYA 2IHEA 3NBHA 1RODA 2NTTA 3HOXG 1CQFA 4QL5A 3PIOA 1XTCD 2Z9HA 4MN3A 3GDEA 1GM5A 5IP9G 4QIWE 1D2BA 2NN6H 4QF4A 5G3LF 3S16H 2DNCA 4HR7B 2K5WA 5BR8Q 1H9MA 1TY2A 4LFAL 3SR1A 2EVBA 3F2CA 3GV3A 1X3EA 3QWNA 1X3GA 4A4IA 1GUGA 1SMXA 2B2YC 4FXKC 3TREA 1HR0W 1K3RA 5CMDA 4LF7L 1F2MA 1JT8A 1LLRD 3GO5A 5LMUQ 1IBML 3A0JA 3TP5A 1WVLA 2ZM6Q 2BDNA 3L7ZC 1UE5A 1HQMC 3KF8B 3GTKH 4HIKA 1JE4A 1YVCA 2Y0SE 4UP7A 2O4XA 1ZEQX 3F1ZA 3J81i 3VYUA 4DK0A 5IYDG 1EIGA 1UE7A 3STBC 3DLLA 3TQYA 4NKLA 2F0VA 5EBCA 4L63B 1N34L 1QWYA 1VQ5A 3S1NH 3MWYW 3U4VA 5DM73 4DV3L 4JI6L 1PTOC 1PVOA 1IKLA 3CXCA 2K03A 4RWSC 2F0LA 4CHTB 2QILA 4HAEA 2PPBC 3QJYA 1XMQQ 2RSNA 1Y1VG 1B8AA 4KD3A 4K5VA 3IL8A 3K5MA 3HOUB 3CW2C 4IFDI 2HDMA 1NNXA 3T51B 3HEJA 1HR0Q 2ZXOA 2K7VA 4DR7Q 3ND9A 1SBBB 4DXFA 1MGSA 1EIFA 4C3HG 2LKVA 2B29A 5A2QL 1VDZA 3KOJA 1TWFH 2D5DA 4FDBA 5CV8A 2VB3X 2XVSA 3TP8A 3C2PA 4YCWA 5D14A 3HKZB 1E24A 3LX0A 1JR0D 2HUGA 4QJFA 3L0OA 1IBLL 2QF7A 1JE5A 5DM63 3E3XA 5IT9E 3PO3G 3PQIA 3DEOA 4UHVA 5KNBA 4EQNA 2NVQB 4N9PA 4A3MG 1AEXA 1PRTF 1E7ZA 1TWAB 5HGQA 3GTPB 3KF6A 4LMQD 3AMUA 4DV0Q 1X9NA 4DR5L 1ESFA 2J4XA 2A19A 4K14A 2VW9A 1UNSA 2BE5D 3I90A 2JA8B 5CBAE 2L0CA 1A15A 5M3MH 1GXDC 1SNCA 2PW7A 1CKNB 5HURA 4OX9Q 2R93B 1KAAA 2LS01 4A3EG 2OF1A 3I4MB 4A3DB 3QO2A 3D8GA 2VZAA 4CBVA 1J5EL 2A6EC 4GN5A 1WTHA 2ZJPA 4LF6L 3J80L 3EQLC 2WIIB 1Y1WH 4K5XA 3J81c 4DV4L 1KTKA 3SGIA 1YNND 4QMGA 4PMBA 2DJGC 4K5WA 1WCMB 1BBXC 3S1RB 4A3KB 5M9OA 2PNHA 2ASBA 3SDZA 5C44B 3HOXH 4IFDG 2A74C 1B3QA 3T1YQ 5IP9H 1V43A 2E5LL 3K0XA 2JA7G 3R2IA 4B3MQ 3HOWB 5C4XB 4BBSG 1VCIA 5C4HA 1B2TA 1ONLA 1TT2A 3C3LA 2ZTEA 1QUQA 3OPOA 2Z1CA 3PO2B 5FLXE 2PCFB 4EQ5A 2DNEA 3BJUA 4V0BA 2I46A 4KY6A 1TS4A 2A6HD 1D1IA 2WAQG 2D2CC 1LTRD 4X64Q 3UDXA 1K0RA 4GNXB 4DR1Q 1TWGH 1K8GA 1SNOA 3HZXA 3VR5A 3K80C 2XTIA 3RZDH 4HJ7A 5E4XA 3ULJA 4LFBQ 3VDYA 2XWJB 1SNQA 4K0KL 2B63B 1U0LA 5FO9B 5LL6X 5IYDH 1UWVA 2FXQA 3HRZC 5FK9C 1NMGA 2LMCB 4NB3A 1S5CD 3FHWA 4LFAQ 3R2TA 3M3YH 3MZ5A 2DGYA 5M5XB 3E9HA 1ML0D 1MBYA 2L9HA 4DAYB 4DUYL 1Q12A 1AH9A 3EVQA 1ESRA 4H7BA 3PUXA 3RZOH 4LF7Q 4BA1I 1YZ6A 4G7OC 3L2PA 1Y1VH 2PYKA 3X3NA 5M3FB 4P74A 2NVYB 1VQ7A 4A3FB 2Y0SG 3FKIG 3W1GA 1VQNA 4YCVA 3H0GB 3BVZA 2F3IA 1NMFA 4LF4L 4LF5L 4C3HH 2IX3A 1VQBA 1ICWA 2IL8A 4DK1A 1S40A 2YYZA 4WRDA 2I5HA 4DAMA 4L5TA 1STYA 2F3WA 1FGBD 1N34Q 2QEJC 5CV6A 1SYFA 4IUNA 1Y8PB 2EXDA 5D3IB 4DV3Q 1N36Q 4JI6Q 2A8VA 1QJOA 1RJTA 3PO3H 4QQBX 1EYDA 2YU9H 3GTJH 2MGSA 3JAME 4A3MH 3LWUA 1YHBA 5IIFA 3TRZA 2BH8A 2JQOA 4BXXH 1SROA 2A69C 2DJFC 4K8JA 3HOVB 1JOKA 4F7XA 3NWTA 4IPGA 5C0XJ 1I3QB 3MXGA 2K5NA 1HA5A 1IBKL 5D3DA 4A3EH 1HNZL 4N9TA 4JOIC 2K75A 1HCZA 1EY4A 1Q1EA 2B2WA 2E2IH 1A0IA 4JCVE 3URYA 1UEAB 1V1QA 1MJEA 4A75A 2AWOA 5C3EB 4YWKA 2G5DA 1JQYD 4GN4B 5IGDA 1WTOA 4GZYC 2ENBA 4OWWB 3RUZA 3NTKA 1A3TA 2K5HA 1V1PA 2F0DA 3CCQA 1CSPA 3OOCA 4XQQA 1IBLQ 3Q6SA 3STBD 4X66L 2QA4A 3OW2A 3S15B 4IFDH 5I4DA 3GTGH 4IPCA 3S14B 4DK6C 3U50C 1JORA 1X32A 2JA7H 1WD1A 5K5PA 1BNZA 2ZTDA 3MXNA 5FO8B 4Y7NB 1C4QA 4BBSH 1JJCB 2RQXA 1SN8A 3V2TA 4GLAC 3TBIB 5JJLA 4DR5Q 4GN3B 1HPCA 4CJ2C 4GNXC 4NMZA 1GUOA 3KLWA 1PH6A 1GOZA 2H1EA 4UAIA 4G57A 5JEAJ 1FNVA 3TDQA 1W6KA 4J6HA 2LXJA 1UE1A 3I4NB 1GO3E 2X6GA 2G9HD 1J5EQ 2WB1B 2K50A 1STNA 1ENAA 3G6JB 4LF6Q 5I6YA 1JWSD 1LACA 2MHVA 1TY0A 3PUZA 2K6AA 3VA5A 3R93A 4DV4Q 3D3RA 3SK4A 5C4JB 3TSSA 2KEDA 2LY7A 1VQMA 2KVMA 1J6QA 2MO1A 4HIMA 3J81j 2P5ZX 3SK5A 2V4DA 1PMRA 2CQAA 2E5LQ 4R4QA 1Q90A 3VYTA 3GTOH 2ALYB 1TKWB 2CCZA 5BR8L 4HTHA 4KKUA 1QOHA 4O1NA 3CCSA 1AE2A 1D5MC 4R4TA 4EGVA 2JA6B 1MKHA 1T5EA 1LABA 1K8MA 1K3BC 1RD9D 1S5ED 4FYDA 1EYCA 1KQSA 1S4ZA 3E5SA 2GA4B 1W3SA 5E4WC 5EQ0A 1KIXA 1YNXA 2AQ2B 3FKIH 3S24A 1DXMA 2M00A 2JEAI 3DWPA 5J1ZA 2R92H 3R3OA 1SYBA 2LSSA 4K0KQ 4PZ7A 3BVMA 2A6ED 3J7YW 3I91A 2WP8J 3M4OH 4LWCA 2Q2HA 4TVAB 1IYUA 1VMCA 2D0OA 3MXPA 2B2TC 4A3IH 2EY2A 4LFCL 4C3JG 4KI0A 3S2HH 4PZ8A 4HN7A 1YBYA 3ONAB 1BKBA 2B3GA 5ELNA 3OMCA 1M8AA 4DN4M 1QG7A 3JC66 4JI0L 1DZ1A 3VR2A 2F0TA 5EPKA 4JBJA 1XPRA 1EY6A 1PH3A 1L1OA 2IT1A 1OXUA 2B2YA 4GOPA 4IO9A 4A3LG 5H1SE 1V1OA 1QB5D 1CK1A 2VXWA 4X3KA 1T5XD 5A2QE 2VL6A 3NBIA 3G71A 2H4OA 1O7IA 5M5WB 4M8AA 4O2DA 1HZAA 4V190 4BY7G 2ZT9C 1EQVA 1TWHH 4NXML 2JN4A 4KKSA 1EWIA 3D6CA 4BY1B 2AMCB 2K32A 1RCVD 4ULLA 5F2DA 1EWHA 2NUCA 4L5RC 4LF4Q 4LF5Q 2DY7A 2EZVA 5L37A 4B9WA 2MUYA 1V9PA 3CC7A 1X55A 3HOYB 3H09A 1E1OA 3PIPA 4H44C 2FHTA 3PF5A 1VQOA 3EFXD 1FJGL 4N8FA 4APVA 5EPJA 3UI2A 4ALPA 2VUMB 4ZK9B 2B8GA 1SJED 1LT4D 1H9SA 5LL6S 4XQNA 1PTOB 3ER0A 1K83H 2RA4A 2OT2A 3ND8A 5I2XA 3EBEA 4S3SA 1I50H 1IBKQ 4ZKBB 1LT6D 4RMFA 2HIXA 4PNYA 3BVGA 1STHA 1HNZQ 4A93B 4LF8L 4FVMA 2ES2A 1DD2A 1NTGA 4BA2I 3EN2A 2Z4HA 1KRSA 1VQJA 2Q2IA 3L9AX 4KMUC 2TSSA 1HUMA 3K0YA 5JJKA 1RTOA 3J81L 2NVXH 4R1JA 2JYOA 2H5XA 1I5FA 3GD7A 1YJWA 2EY6A 1Q3LA 2PNRC 4X66Q 2X6LA 2IX1A 4A3BG 1A2TA 4HMIA 1FNUA 3I3CA 2XWBB 1Y14B 4CKCA 1SYCA 3GTMH 4MIUA 4G7HC 4KY5A 2L12A 1EY7A 5FO7B 1I6HH 3HOZH 3AEVA 3WOFA 2TMPA 1M90C 1SE2A 3HKZG 2A69D 4M1UB 5K36G 4YIJA 4DAVA 2EYHA 3HG9A 4DR2L 3K7AH 1SDFA 2K33A 3I4LA 1PH5A 4WJ3M 3W2DA 3AFPA 5IT9c 1B50A 1BO0A 3L3OC 1VQCA 3TZUA 2JSOA 3NWSA 3HS0C 1PH8A 2JA8G 1SNPA 1CKOA 4LUZA 2Q2TA 2WV6D 4CKEA 2ZJQA 2R93G 4NXNL 1VQEA 1EYAA 1N33L 5CYUA 1GHJA 2K28A 3CHBD 4LUVA 3K8AA 4A3DG 3IFDA 1SMYC 5GQOA 3HKSA 1KRTA 3I72A 4YWMA 3EROA 5IGEA 3OYYA 5FJ8G 1JOOA 3KF8A 1ILPA 4DNIA 1I4QA 2IWHA 2B2VC 4A3LH 1RL2A 3FPUB 3FMCA 4MTKA 2FFKB 5JVH3 4B3SL 3CQZH 3GTKB 4HJ5A 4UP8A 1BVSA 3F2UA 1U5KA 5KNDA 1Q8IA 4BY7H 1M1KC 2EDGA 3BZKA 3H15A 2CW0C 1GHKA 1F2LA 2K52A 1S5DD 3HOWG 5C4XG 4OELB 1NE3A 1ET6A 2BDOA 1FD7D 2F52A 4C1NK 4CDCC 4DNTB 4ABNA 3E0EA 1N8RC 3S1NB 1CHQD 3T16A 1D5ZC 2UXBL 3PO2G 2F4VL 1PFBA 2CQOA 2Q8IB 2EQSA 4LFCQ 2PMZB 5C3WA 2F3VA 1VQDA 2VQFL 1N36L 1TU2B 2RKSA 3NPPA 1BBWA 3P7JA 3QR8A 3I73A 2HQLA 4JI0Q 1PH7A 1Z47A 1QZHA 4POFA 2XRQD 4A3GG 4ZLTF 1WYDA 1RF2D 2KEEA 1HUNA 4OO1I 4JI8L 4HCEA 1SYDA 2QDBA 5HGTA 1SEBD 2HCIA 3A5ZB 5J22A 2QW7A 4HMJA 1G91A 1HFGA 3J7A5 1NR2A 1PYWD 4NXMQ 4RH6A 4YHHL 1SE8A 4F87A 1EL0A 2D62A 4X3UA 4P2CB 1TWFB 1VQ8A 2EYFA 4RG1A 5ELEA 2KOLA 4JG2A 3VR3A 4CGYB 2KQ3A 3ITPA 1YITA 5KEEA 3H3VC 3PUWA 4RAUC 1U9RA 2UU9L 1XTDA 3BZDB 3T4AC 4K8IA 2DY8A 2NTSA 3AU7A 4JBWA 4MZ9A 4BWGB 3TS0A 3KYHC 1O7LA 1PYBA 4H0LC 1AFPA 1KLUD 3PIO3 1FJGQ 1G6ZA 1X3QA 4KK7A 4A3FG 2PZTA 4A3BH 1Z6HA 1CKNA 1DGSA 2UXDL 2PQAB 5M3MB 4GLXA 3DM3A 2KUMA 1TIID 4AYBE 1L0WA 2OTLA 1EY5A 1WTRA 2WINB 1JICA 1IL8A 2VQEL 4YY3L 1W2BA 1G6PA 4G4KA 3RNUA 1E2VA 4LF8Q 2ZTCA 5CV9A 3P75A 5K36H 5JVG3 1I94L 3CPWA 4HIDA 3A8JE 3HGBA 4B3RQ 2KCMA 4DV7L 4BS9A 1HZCA 2NVQH 4OO1G 4IPDA 2EOTA 3HOXB 1RKNA 3AB9A 2IW3A 2R7ZG 1SE3A 2HQEA 3BDOA 4PMWA 3R8BA 2AQ3B 3S1MH 3CCEA 1R9TB 1Q81C 2R7FA 2JA8H 1I4RA 3C1EA 4C3IB 1CA6A 2E2JH 3RN5A 1SNMA 1DJRD 4P72A 3WOEA 3T1HL 3J7AF 3CRKC 4R4CA 2O5IC 1GD7A 2EJGC 1X65A 4A76A 5J3BA 1CTMA 4GNXA 2JP1A 3M85A 2A1AA 4DKAC 3H91A 1EEFD 2CVRA 3KLRA 5C3EG 1P16A 5FJ8H 3K58A 5I9OA 5AJ3L 1S3OA 4IUQA 1TWGB 3CRLC 4JBMA 4HSPA 1HNXL 4ODGA 1LT3D 3F2DA 3RZDB 1X6OA 4DR2Q 1KABA 3UE0A 4DK3C 1TWCB 2E75C 2C5CA 1EYGA 4JI7Q 1BDOA 2A68C 5C4XH 2E8GA 3AYHB 5C0XI 3U58A 1QNKA 1V8QA 4HEDA 4P73A 4BBRG 3PO2H 3FPPA 3M3YB 2E2HB 4DPGA 3SXHA 4POGA 4NXNQ 4DAYA 1TQOA 2BH2A 5GADC 4DV1L 3BZCA 1N33Q 1Q8KA 3DWQA 2WB1G 2Z8LA 3NSWA 4C2MH 3RZOB 3FP9A 1E1TA 4OL7A 4RGTA 1G2SA 1Y69U 4A3GH 2E74C 1Y1VB 2QGQA 1TXYA 1BF4A 1XMOQ 4XXEA 4ZYSA 1SFOH 4B3SQ 2KENA 2Z0SA 1VQPA 4OWTB 2L1BA 3C46A 2IHFA 4ID6A 2XNAC 4IZ8A 1YI2A 4C56C 2L11A 1PZKD 1PA6A 1DOMA 1QZGA 4C3HB 4KHVA 1U4LA 1LTID 2MJ8A 3NK9A 3BDCA 3U9OA 4JV5Q 4WJWA 1STGA 2MQHA 3M4QA 4YCUA 3NXWA 4P75A 3MTSA 3V96A 2UXBQ 3IFTA 2F4VQ 2B2TA 2YU9B 1PH1A 2E2DC 5IY0A 1HRJA 3GTJB 3P1HA 1TS3A 2VQFQ 3ICEA 5DNFA 4B08A 4A3FH 2F0MA 3K5LA 5KYIA 4ME5A 4MHEA 3TP6A 1BCPB 2ZXRA 4JI8Q 4PG3A 5C0XG 4TKOB 4DV6L 2B39A 1FNWA 1B53A 3A8IE 1SMYD 4A3EB 1VQFA 2EJFC 1IHZA 5ELBA 3M7NA 2NZOA 4YHHQ 4OXPA 2E2IB 3NENA 3NQIA 3D4WA 1O78A 3Q0AA 1RDPD 4ZUJA 1OXVA 5C4ZA 2RHSB 3G7LA 3CCRA 3CMEA 1GUTA 3TEHB 1Z7TA 1ZYRC 2UU9Q 2BCOA 4OO1H 2CW0D 4X65L 1AN8A 3BG3A 4KN7C 5IOCA 3PGZA 3GQBA 1F9PA 5IGFA 5JPMC 2R7ZH 3LWEA 3K5NA 3GTGB 3IRBA 1VQGA 2JA7B 5M5YH 1NCVA 4QUCA 4E6IA 1I3QH 4BBSB 2JJQA 5FKAC 2KHJA 1HTPA 3NELA 4BY1G 5IODA 1EOTA 2AUKA 4RCNA 3HFZB 2UXDQ 2B2UC 2Q2UA 3O13A 1DOKA 4AYBG 2C9OA 1PTOD 5JEAG 4FF2A 3QIAA 3P20A 4ZAIA 4DAPA 5CV5A 2YTYA 3GV6A 2WACA 2IPKD 2WAQB 3V05A 2VQEQ 4YY3Q 1BQQT 4H13C 5C3EH 5GAHC 4RA8A 4OIKA 2Z6KC 4NP5A 3GTLH 2SNSA 3KLSA 1F9RA 1C9OA 4K6LA 5IGGA 4XIGS 1I94Q 1O80A 2AWNA 3MHBA 4ZRZA 3HKZE 3K57A 3NP8A 4ME3A 4DV7Q 3S15H 4WJ4A 2F0SA 2RHQB 2L5TA 4L8JA 3U4ZA 1D6EC 1KXLA 2VUMG 3S14H 1PYSB 4K2KA 1E2ZA 4QIWB 1O7YA 1JJGA 4A3CG 1N9WA 4Y7NH 4AQYL 1BUVT 4XT3B 2MNAA 3ERSX 1LTAD 3S17B 2K5DA 1K0SA 1EZ6A 2IY5B 4BBRH 1PXUA 3SEBA 1F2ZA 1SAPA 3WWVA 3NEMA 3GTOB 4JI2L 3T1HQ 1FL0A 3HP3A 5EKLA 4NDXA 4A93G 4LW1A 1QCBD 1SYEA 5JOBA 1LYLA 3CPFA 2RVLA 3DHQA 3RLFA 2HHHL 4KV6A 1EFWA 2RDGA 4RHRA 1DCZA 1KHIA 3ERQA 3NE5B 3NHHA 4IQZA 3S2DH 3T56B 5JAVA 1TR5A 1YIJA 5AJ3Q 2K14A 2K5QA 4X62L 1S5FD 3OIQA 4JW0A 1HNXQ 1C48A 1TVXA 3WDNA 4WFN3 2Y0SB 1JOQA 3FKIB 3CCVA 4IJHA 2R92B 2N78A 2NWGA 3DXJC 4ZQ3A 1Z9FA 4DR6L 3M4YA 4R9WA 1LUZA 5BN5A 3M4OB 1EQRA 3FVQA 4Q5VA 5I6WA 2F0EA 3OSOA 4L5SA 1SYGA 2YV5A 3PSIA 3KJOA 1A63A 2PI2A 2BOSA 1H9JA 4A3IB 1CKMA 3Q24A 2DUDA 4DGZA 3S2HB 1MJCA 4DF7A 2CWPA 1VQ4A 2JA5G 4IUVA 1BCPC 2B8FA 5ELDA 2GVAA 3CCJA 4DV1Q 4X3TA 5DEHA 3OWFA 3N52A 4KD4A 3E6ZX 1D7QA 3Q23A 3ZJYC 3RMHA 5C3XA 4DUZL 4DV5L 1U4RA 5IP7G 2V1CC 3QOLA 1EEID 5C0XH 2B2VA 4RFBA 5T1GA 1IL2A 5E7NA 1TWHB 5IWAL 1QNUA 3CC2A 1GKHA 1EIYB 4G7ZC 2NZ1D 5A35A 3UDIA 3J7AV 1JB3A 3EIVA 2OQ0A 1X3FA 1OTCA 3K6OA 5C6AA 2OTJA 2R6GA 1DONA 1HHVA 2UXCL 1PZID 2EIFA 1CQVA 2F0HA 3KDFA 1F9QA 2A68D 3IKJA 4OIJA 1PFNA 4AH6A 2YTVA 4Z9CB 4FF3A 1QVCA 4JC0A 1CM9A 2OEOA 1K8OA 4FF4A 2F0GA 1HA6A 1AP0A 4UP9A 2I0QA 3S1QH 4DU9A 2RSOA 2HDLA 4BY1H 1SE4A 2KCTA 1K83B 1WTWA 2R61A 1IYJB 4DV6Q 1I4GA 4A3JB 1I50B 1F2YA 2UUAL 2D0PA 3J80E 5KRUA 4R4OA 3GTQH 2I5MX 4XQJA 4DXGA 4JPBW 1PH9A 1ZKOA 2O2LD 5IYCG 2NVTH 3H6MA 3BDLA 4TSSA 1LV9A 3H94A 2XSCA 3A56A 4X3SA 3TMEA 4XT1B 1PRTB 1SJHD 4B3RL 1CT1D 2PO4A 4OGQC 2VUMH 2NVXB 1A6XA 1U4MA 4X65Q 1JJ2A 3G48A 2LXKA 1XNQL 4A3CH 4O42A 3NTIA 1C8CA 1PTOH 1F9SA 3OHXC 2HD3A 2YTXA 2KA7A 1Q1BA 2WFWA 5FOBB 1K9MC 3HOUG 3TZDA 5BN3A 3GTMB 1EIHA 5C5LA 4A93H 3HOZB 2X69A 4KLKA 4OWXB 2ATWA 1PH4A 2SDFA 3D4DA 1U4PA 3I4OA 2JXMB 4J8QA 1Y8OB 1WTXA 4I7ZC 1GUNA 4Y52H 1QE6A 4F8MA 1XJVA 3CAMA 5CBEE 3K7AB 4XYOA 2ZJRA 5J39A 1KNAA 1QVFA 4ZUIA 2XGTA 5AFWA 2XRSD 2VB2X
chains in the Genus database with same CATH topology
1STBA 3DM1A 3DUZA 1R4QB 1EWCA 5CGKA 2Q8TA 2WKDA 4PQXA 1B4OA 1ZYRD 3CU7A 4UDUC 3VR6A 3S16B 1ILQA 1LTSD 3VA7A 3SHLA 3PIP3 1VF7A 2F0IA 2ICIA 3EJIA 5CC4A 2PW5A 5NUCA 4IUUA 1DYQA 4KJNA 2E76C 4QCLA 3CQZB 4FP5D 4RHSA 2KJXA 1QILA 2EY1A 1A3VA 1CZWA 2XN9C 1OXXK 4BY7B 2MPMA 1I6VC 3A7AB 3NTHA 3Q22A 3QB3A 1IYVA 4C3IG 2FINB 4ILWA 1ZXTA 1KLGD 1AZPA 1KDAA 3KLSX 1EY9A 1EQTA 1VF5C 2EY5A 4ZKCB 4F88A 2A5HA 1B1ZA 4RGMA 4TRDA 4QB4A 1STAA 1L0XB 1IW7C 1MSHA 5C5MA 3S9WA 2K1BA 5CORA 1BXTA 1HTLD 1PRTC 2N88A 4FXGC 3PV0A 5DAUA 2EJMA 4WORA 3A8KE 4DNRB 1OO9B 1B9MA 2F0KA 2JEBI 2R3ZA 1O7ZA 3OWEB 4Q0FA 3NQTA 4EQOA 1TS2A 2LFNA 3I70A 3OMGA 4A3BB 4PMCA 2EYOA 1I4PA 1HQRD 4KN4C 4HSVA 3FDTA 4RKLA 1DM0B 4IUPA 4TQUS 1BCPD 1GUSA 3FEWX 3A7LA 1EU3A 1EZ8A 1EY8A 1NR4A 1OXSC 1PTOF 4IURA 4LJZC 2D9UA 2F4IA 3LNNA 1JWMD 1SSOA 4CJ0B 1Y1WB 1ENCA 1CFMA 3S1MB 1I4HA 1MSGA 2E2JB 1TS5A 1STEA 2KHSA 1NUCA 4KKTA 5D65A 3X3MA 2PZWA 4B9XA 1M4VA 3QOJA 2KCNA 2IJ0A 2NYZD 2B2UA 3A55A 1HXYD 4IALA 2PQEA 1LTBD 3VYSA 3PUVA 4IN3A 4DA2A 4J1MA 5CR3A 3KUPA 2EYMA 2DN8A 3CKIB 5ELCA 4FNFA 3NUCA 1G2TA 4IFDJ 1CA5A 3TN2A 2BA0A 1E2WA 3MXUA 2ID0A 2K05A 2RDHA 2SOBA 3BYYB 3SVMA 5E1FA 5KGUA 4L6TB 1G8ZD 4C2MB 3D4RA 1EY0A 4C1NI 4A3GB 1WTPA 4RKBA 1SFOB 2HCCA 2EYLA 3K5OA 2FMMA 5LHY1 1J9OA 5G3LD 5KIXA 2Q8RE 5EKKA 5KYLA 5EJWA 1UAPA 1S5BD 3D6WA 4XDXA 5EBDA 2MP1A 3T53B 3A54A 1PFMA 5ISRA 2F0UA 4CKBA 1WD0A 4I65A 5JPNC 2AQ1B 3PO3B 2A73B 3MFGA 1W6JA 4R8NA 1YNJC 4A3MB 3MVVA 5I2YA 2RDFA 4FXDA 5KNCA 4JK1C 1ENFA 2F1MA 3T13A 1PLFA 3J81E 3U9SA 2BA1A 1GUWA 3SK6A 2R7ZB 4KJOA 3SK8A 5M5YB 4OHJA 2XIWA 3SE0A 2FJ2A 3VR4A 2Z4IA 2ZXPA 5IGCA 2N55A 1L0YB 1KDCA 1D5XC 2F0PA 3KK7A 2SNMA 4XTCS 4K2LA 1OXTA 3I8ZA 1IW7D 1IKMA 3GTLB 1XYIA 1A3UA 2F0QA 2FMCA 1FR3A 2EE1A 3DWAA 1RHPA 4FF1A 3MA2B 1LTTD 1B9NA 3VYRA 1PRTD 3MEHA 1V1PB 4K6DA 5CV7A 5EPLA 1H9KA 4BBRB 1BR9A 5IT9L 1KNEA 3K59A 1EU4A 2NN6I 1Y8NB 1DOLA 2M9VA 3TP7A 4LK1C 3S2DB 1AW7A 3MFYA 1JCKB 4PV1C 1CHPD 2EYJA 3N6RA 2G9DA 2F0FA 4RGNA 1CZGA 1D1KA 5COYA 3W3AA 3OIPA 1RTNA 2O5JC 2F0JA 1CI3M 1F77A 5JJZA 4RGOS 2F03A 1UUPA 2J0TD 5EKIA 2M2LA 4KHZA 2EPBA 5TSSA 1LT5D 2KECA 4NW2A 5CV4A 2IX0A 2WKCA 2CHBD 5FLXL 2F0NA 1E0BA 2AUJD 2EYPA 1KDBA 1LTGD 5BN4A 4RCOA 1SNDA 5T1IA 3FRPB 2NN6G 2VNUD 1II3A 2QKIC 2BE5C 5I9PA 3OW7A 4CJ1B 2L4NA 1NSNS 2F0WA 2JE6I 4HCSA 2KCCA 3RD4A 3S1QB 4DFAA 3BS1A 1GJXA 2SEBD 5IGBA 1B44D 1J8IA 4AYBB 1YNNC 3D31A 2B2WC 4XYQA 3EA6A 1BCPF 1I4XA 4KTAA 3GTQB 3DMUA 1VMPA 1X3PA 5JEAH 1WTQA 2NVTB 3ZYYX 4EQPA 1PDQA 1AZQA 1FYCA 2PZUA 4U673 1XX8A 3PMFA 3E0JA 5EGTA 2NB0A 2A6HC 1HFNA 1H9RA 1NAPA 2L55A 1H9SB 3JAML 1A2UA 1LO5D 2K01A 5E3FA 3KBGA 1EFID 1I6HB 1BOSA 3MC0B 1YNJD 4QUFA 3PUYA 3QG1A 2ICEC 4LAAA 1SXTA 4R8IA 3M7GA 3MAQA 2QCPX 5ELFA 4U68A 2I07B 2EXZA 2RBMA 1MI2A 2NBFA 1XWEA 4FO2A 4KY7A 1PZJD 2F0OA 1R4PB 4IUTA 1MD2D 2JA5B 1JC7A 2K04A 4C3JB 3GP7A 1B3AA 3KBXA 1ET9A 3C1FA 1G291 2OXPA 2J7ZA 3DEPA 4EVOA 1XXGA 1WTVA 3BYTB 1JWUD 3IAYA 3NBHA 1RODA 2NTTA 1CQFA 1XTCD 4MN3A 1D2BA 2NN6H 4QF4A 5G3LF 2DNCA 4HR7B 2K5WA 1H9MA 1TY2A 3SR1A 2EVBA 3GV3A 3QWNA 1GUGA 2B2YC 4FXKC 5CMDA 1F2MA 1LLRD 3GO5A 3TP5A 1WVLA 2BDNA 3L7ZC 1HQMC 1JE4A 2O4XA 1ZEQX 3VYUA 4DK0A 1EIGA 4NKLA 2F0VA 5EBCA 4L63B 1QWYA 3MWYW 5DM73 1PTOC 1IKLA 2K03A 4RWSC 2F0LA 4CHTB 2QILA 4HAEA 2PPBC 3QJYA 2RSNA 4KD3A 4K5VA 3IL8A 3K5MA 3HOUB 4IFDI 2HDMA 3T51B 3HEJA 2ZXOA 2K7VA 3ND9A 1SBBB 4DXFA 1MGSA 4C3HG 2LKVA 5A2QL 1VDZA 2D5DA 5CV8A 2VB3X 2XVSA 3TP8A 3C2PA 5D14A 3HKZB 3LX0A 1JR0D 2HUGA 2QF7A 5DM63 5IT9E 3DEOA 5KNBA 4EQNA 2NVQB 4N9PA 1AEXA 1PRTF 1TWAB 3GTPB 4LMQD 3AMUA 1ESFA 2J4XA 4K14A 1UNSA 2BE5D 3I90A 2JA8B 5CBAE 2L0CA 1A15A 1GXDC 1SNCA 2PW7A 5HURA 2R93B 1KAAA 2LS01 2OF1A 3I4MB 4A3DB 3QO2A 3D8GA 4CBVA 2A6EC 3J80L 3EQLC 2WIIB 4K5XA 1KTKA 1YNND 4QMGA 4PMBA 4K5WA 1WCMB 1BBXC 3S1RB 4A3KB 5M9OA 3SDZA 5C44B 4IFDG 2A74C 1V43A 3R2IA 3HOWB 5C4XB 1VCIA 5C4HA 1B2TA 1ONLA 1TT2A 3C3LA 3OPOA 2Z1CA 3PO2B 5FLXE 2PCFB 2DNEA 4V0BA 2I46A 4KY6A 1TS4A 2A6HD 1D1IA 2D2CC 1LTRD 1SNOA 3HZXA 3VR5A 5E4XA 2XWJB 1SNQA 2B63B 5FO9B 5LL6X 3HRZC 5FK9C 2LMCB 1S5CD 3R2TA 3MZ5A 5M5XB 1ML0D 1MBYA 2L9HA 1Q12A 3EVQA 1ESRA 4H7BA 3PUXA 4BA1I 4G7OC 2PYKA 3X3NA 5M3FB 2NVYB 4A3FB 3H0GB 3BVZA 2IX3A 1ICWA 2IL8A 4DK1A 2YYZA 4WRDA 1STYA 2F3WA 1FGBD 2QEJC 5CV6A 1SYFA 4IUNA 1Y8PB 5D3IB 1QJOA 1RJTA 1EYDA 2MGSA 3JAME 3LWUA 5IIFA 2A69C 4K8JA 3HOVB 1JOKA 4F7XA 3NWTA 5C0XJ 1I3QB 3MXGA 1HA5A 5D3DA 4N9TA 1HCZA 1EY4A 1Q1EA 2B2WA 3URYA 1UEAB 2AWOA 5C3EB 1WTOA 1JQYD 5IGDA 4GZYC 2ENBA 3RUZA 3NTKA 1A3TA 1V1PA 2F0DA 4XQQA 3OOCA 3Q6SA 3S15B 4IFDH 5I4DA 3S14B 1JORA 1X32A 1WD1A 5K5PA 1BNZA 3MXNA 5FO8B 4Y7NB 1C4QA 2RQXA 3V2TA 3TBIB 1HPCA 4CJ2C 4NMZA 1GUOA 1GOZA 2H1EA 4UAIA 4G57A 5JEAJ 1FNVA 3TDQA 1W6KA 4J6HA 3I4NB 2X6GA 2G9HD 2WB1B 1STNA 1ENAA 3G6JB 5I6YA 1JWSD 1LACA 2MHVA 1TY0A 3PUZA 2K6AA 3VA5A 3R93A 3D3RA 3SK4A 5C4JB 3TSSA 2KEDA 2LY7A 2KVMA 3SK5A 2V4DA 1PMRA 2CQAA 1Q90A 3VYTA 1TKWB 4HTHA 4KKUA 1QOHA 4O1NA 1D5MC 2JA6B 4EGVA 1T5EA 1LABA 1K8MA 1S5ED 1RD9D 4FYDA 1EYCA 1S4ZA 3E5SA 2GA4B 5E4WC 5EQ0A 2AQ2B 1DXMA 2M00A 2JEAI 3DWPA 5J1ZA 3R3OA 1SYBA 3BVMA 2A6ED 3J7YW 3I91A 2WP8J 1IYUA 1VMCA 3MXPA 2B2TC 2EY2A 4C3JG 4KI0A 4HN7A 3ONAB 3OMCA 1M8AA 4DN4M 1QG7A 1DZ1A 3VR2A 2F0TA 5EPKA 1EY6A 2IT1A 1OXUA 2B2YA 1V1OA 1QB5D 1CK1A 2VXWA 4X3KA 1T5XD 5A2QE 3NBIA 2H4OA 5M5WB 4M8AA 4V190 2ZT9C 1EQVA 4KKSA 4BY1B 3D6CA 2K32A 1RCVD 4ULLA 5F2DA 1EWHA 2NUCA 2DY7A 2EZVA 4B9WA 2MUYA 3HOYB 3H09A 4H44C 2FHTA 3EFXD 5EPJA 3UI2A 2VUMB 4ZK9B 2B8GA 1SJED 1LT4D 1H9SA 5LL6S 4XQNA 1PTOB 2RA4A 2OT2A 3ND8A 5I2XA 4S3SA 4ZKBB 1LT6D 4PNYA 3BVGA 1STHA 4A93B 4FVMA 1DD2A 4BA2I 2Z4HA 3L9AX 4KMUC 2TSSA 1HUMA 3K0YA 1RTOA 3J81L 2JYOA 3GD7A 2EY6A 1Q3LA 2PNRC 2X6LA 2IX1A 1A2TA 4HMIA 1FNUA 3I3CA 2XWBB 4CKCA 1SYCA 4MIUA 4G7HC 4KY5A 2L12A 1EY7A 5FO7B 3WOFA 2TMPA 1SE2A 2A69D 4M1UB 5K36G 4YIJA 4DAVA 2EYHA 3HG9A 1SDFA 2K33A 3I4LA 3W2DA 1B50A 1BO0A 3L3OC 3TZUA 2JSOA 3NWSA 3HS0C 1SNPA 2WV6D 4CKEA 1EYAA 5CYUA 1GHJA 2K28A 3CHBD 3IFDA 1SMYC 3I72A 3EROA 5IGEA 1JOOA 3KF8A 1ILPA 1I4QA 2IWHA 2B2VC 3FPUB 3FMCA 2FFKB 5JVH3 3GTKB 3F2UA 5KNDA 1Q8IA 2EDGA 2CW0C 1GHKA 1F2LA 1S5DD 4DNTB 1ET6A 2BDOA 1FD7D 4C1NK 4ABNA 3S1NB 1CHQD 3T16A 1D5ZC 1PFBA 2Q8IB 2PMZB 5C3WA 2F3VA 1TU2B 2RKSA 3NPPA 3P7JA 3I73A 1Z47A 2XRQD 4ZLTF 1RF2D 2KEEA 1HUNA 4OO1I 4HCEA 1SYDA 2QDBA 5HGTA 1SEBD 2HCIA 5J22A 4HMJA 1G91A 1HFGA 1NR2A 1PYWD 4RH6A 4F87A 1EL0A 2D62A 4X3UA 4P2CB 1TWFB 2EYFA 5ELEA 2KOLA 3VR3A 4CGYB 2KQ3A 3ITPA 3H3VC 5KEEA 3PUWA 4RAUC 1U9RA 3BZDB 3T4AC 4K8IA 2DY8A 2NTSA 3AU7A 4JBWA 4BWGB 1O7LA 4H0LC 1AFPA 1KLUD 3PIO3 1G6ZA 1X3QA 4KK7A 2PZTA 1Z6HA 5M3MB 2KUMA 1TIID 1EY5A 1WTRA 2WINB 1JICA 1IL8A 4G4KA 1E2VA 5CV9A 3P75A 5K36H 5JVG3 3A8JE 3HGBA 4BS9A 4OO1G 2EOTA 3HOXB 1RKNA 3AB9A 2IW3A 1SE3A 2HQEA 3BDOA 4PMWA 3R8BA 2AQ3B 1R9TB 1I4RA 3C1EA 4C3IB 1CA6A 1SNMA 1DJRD 3WOEA 3J7AF 3CRKC 2O5IC 2EJGC 1CTMA 2JP1A 3M85A 3H91A 1EEFD 2CVRA 3KLRA 3K58A 5I9OA 4IUQA 1TWGB 3CRLC 4HSPA 4ODGA 1LT3D 3RZDB 1KABA 1TWCB 2E75C 2C5CA 1BDOA 2A68C 5C0XI 1QNKA 1V8QA 4HEDA 3FPPA 3M3YB 2E2HB 3SXHA 4DAYA 1TQOA 3DWQA 3NSWA 2Z8LA 3RZOB 4OL7A 4RGTA 1G2SA 1Y69U 2E74C 1Y1VB 1BF4A 4XXEA 4ZYSA 3C46A 2L1BA 4ID6A 2XNAC 4IZ8A 4C56C 2L11A 1PZKD 1DOMA 4C3HB 4KHVA 1U4LA 1LTID 2MJ8A 3NK9A 3BDCA 3U9OA 4WJWA 1STGA 3NXWA 3MTSA 3V96A 3IFTA 2B2TA 2YU9B 2E2DC 1HRJA 3GTJB 3P1HA 1TS3A 5DNFA 4B08A 2F0MA 3K5LA 5KYIA 4ME5A 4MHEA 3TP6A 1BCPB 2ZXRA 5C0XG 4TKOB 2B39A 1FNWA 1B53A 3A8IE 1SMYD 4A3EB 2EJFC 1IHZA 5ELBA 3M7NA 2E2IB 3NQIA 3D4WA 1O78A 3Q0AA 1RDPD 4ZUJA 1OXVA 5C4ZA 3G7LA 1GUTA 1Z7TA 1ZYRC 2BCOA 4OO1H 2CW0D 1AN8A 3BG3A 4KN7C 5IOCA 3GQBA 1F9PA 5IGFA 5JPMC 3LWEA 3K5NA 3GTGB 2JA7B 1NCVA 4QUCA 4E6IA 4BBSB 5FKAC 1HTPA 5IODA 1EOTA 2AUKA 4RCNA 2B2UC 3O13A 1DOKA 2C9OA 1PTOD 5JEAG 4FF2A 3QIAA 3P20A 4ZAIA 4DAPA 5CV5A 3GV6A 2WACA 2IPKD 2WAQB 3V05A 1BQQT 4H13C 4RA8A 4OIKA 4NP5A 2SNSA 3KLSA 1F9RA 4K6LA 5IGGA 4XIGS 1O80A 2AWNA 3MHBA 4ZRZA 3K57A 3NP8A 2F0SA 2L5TA 4L8JA 1D6EC 4K2KA 1E2ZA 4QIWB 1O7YA 1BUVT 4XT3B 1LTAD 3S17B 2K5DA 1EZ6A 1PXUA 3SEBA 1F2ZA 1SAPA 3GTOB 3HP3A 5EKLA 4NDXA 1QCBD 1SYEA 5JOBA 2RVLA 3DHQA 3RLFA 4KV6A 2RDGA 4RHRA 1DCZA 3NHHA 3ERQA 3NE5B 4IQZA 3T56B 5JAVA 1TR5A 2K5QA 1S5FD 3OIQA 1C48A 1TVXA 3WDNA 4WFN3 2Y0SB 1JOQA 3FKIB 2R92B 3DXJC 2NWGA 4ZQ3A 3M4YA 4R9WA 5BN5A 3M4OB 3FVQA 4Q5VA 5I6WA 2F0EA 3OSOA 1SYGA 2BOSA 1H9JA 4A3IB 3Q24A 4DGZA 3S2HB 4DF7A 4IUVA 1BCPC 2B8FA 5ELDA 4X3TA 5DEHA 3OWFA 3N52A 4KD4A 3E6ZX 3Q23A 3RMHA 5C3XA 1U4RA 3QOLA 1EEID 5C0XH 2B2VA 4RFBA 5T1GA 1TWHB 1QNUA 4G7ZC 2NZ1D 5A35A 3J7AV 1JB3A 3K6OA 5C6AA 2R6GA 1DONA 1HHVA 1PZID 1CQVA 2F0HA 1F9QA 2A68D 3IKJA 4OIJA 1PFNA 4Z9CB 4FF3A 1CM9A 2OEOA 1K8OA 4FF4A 2F0GA 1HA6A 1AP0A 4DU9A 2RSOA 2HDLA 1SE4A 1K83B 1WTWA 2R61A 1I4GA 4A3JB 1I50B 1F2YA 3J80E 5KRUA 4XQJA 4DXGA 1ZKOA 2O2LD 3H6MA 3BDLA 4TSSA 1LV9A 3H94A 2XSCA 3A56A 4X3SA 3TMEA 4XT1B 1PRTB 1SJHD 1CT1D 2PO4A 4OGQC 1A6XA 2NVXB 1U4MA 4O42A 3NTIA 1C8CA 1PTOH 1F9SA 3OHXC 2KA7A 1Q1BA 5FOBB 3TZDA 5BN3A 3GTMB 1EIHA 5C5LA 3HOZB 2X69A 2SDFA 3D4DA 1U4PA 2JXMB 4J8QA 1Y8OB 1WTXA 4I7ZC 1GUNA 1QE6A 4F8MA 5CBEE 3K7AB 4XYOA 5J39A 1KNAA 4ZUIA 5AFWA 2XRSD 2VB2X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KLS A;  5FO9 B;  1XWE A;  5JPN C;  1GXD C;  2E2D C;  2QKI C;  2WIN B;  3HRZ C;  3MA2 B;  3T4A C;  3L3O C;  4FXK C;  2A73 B;  3CKI B;  5FO7 B;  3G6J B;  2A74 C;  3I70 A;  2ICE C;  5FO8 B;  3HS0 C;  1UAP A;  2TMP A;  3CU7 A;  4FXG C;  1JC7 A;  1UEA B;  1D2B A;  1BUV T;  1BR9 A;  3FRP B;  2J0T D;  3OHX C;  2B39 A;  2XWJ B;  2I07 B;  1JB3 A;  2WII B;  3V96 A;  5FOB B;  1OO9 B;  4ILW A;  5JPM C;  1BQQ T;  1PXU A;  2XWB B; 
#chains in the Genus database with same CATH topology
 1STB A;  3DM1 A;  3DUZ A;  1R4Q B;  4JI7 L;  1EWC A;  4AQY Q;  2JK8 A;  5CGK A;  4LF9 L;  1JMC A;  2CFM A;  4OEM B;  2Q8T A;  2WKD A;  5IYB G;  5EAY A;  4PQX A;  1B4O A;  1ZYR D;  3CU7 A;  4UDU C;  3VR6 A;  3S16 B;  1XNR L;  1ILQ A;  1LTS D;  4JI2 Q;  4CDE C;  3VA7 A;  2JA5 H;  3SHL A;  3PIP 3;  1VF7 A;  2F0I A;  2ICI A;  4C3J H;  3EJI A;  5CC4 A;  2PW5 A;  5NUC A;  4IUU A;  3I4M G;  2HHH Q;  2OCE A;  1DYQ A;  4JI1 L;  4KJN A;  2E76 C;  4QCL A;  3CQZ B;  1ASZ A;  2WB1 E;  4FP5 D;  4RHS A;  2KJX A;  1QIL A;  2Z6B A;  2EY1 A;  5IP7 H;  3UDG A;  1A3V A;  1CZW A;  2NZH A;  2XN9 C;  4X62 Q;  1HJP A;  1OXX K;  4O0A A;  1XMO L;  1K8A C;  4BY7 B;  2MPM A;  3D0F A;  1I6V C;  1WCM G;  3A7A B;  3NTH A;  3Q22 A;  4A3K G;  3QB3 A;  1IYV A;  5C44 G;  4C3I G;  1G51 A;  4DR6 Q;  1H95 A;  2FIN B;  4GKK L;  4ILW A;  1K73 C;  3NBH B;  1ZXT A;  2KBN A;  1KLG D;  1AZP A;  1KDA A;  3KLS X;  1KL9 A;  1EY9 A;  1VQK A;  1EQT A;  1KAW A;  1VF5 C;  1L1O C;  4JV5 L;  4GOP C;  2EY5 A;  3G6E A;  4ZKC B;  4F88 A;  4KHP L;  2A5H A;  2JA9 A;  4JI3 L;  3JAM i;  1B1Z A;  3CP0 A;  4RGM A;  1X54 A;  4TRD A;  4QB4 A;  1C0A A;  1STA A;  1JB7 A;  5FLX c;  1L0X B;  3F2B A;  1IW7 C;  1D8L A;  1MSH A;  4DUZ Q;  5C5M A;  4DV5 Q;  3F8T A;  3S9W A;  2K1B A;  5COR A;  1BXT A;  1HTL D;  5IWA Q;  1SR3 A;  2B63 G;  1PRT C;  2N88 A;  4FXG C;  3PV0 A;  4H02 A;  1PFS A;  5DAU A;  5IYC H;  4B3T L;  2HT1 A;  2EJM A;  4WOR A;  3A8K E;  1SLJ A;  4DNR B;  2UXC Q;  1OO9 B;  1B9M A;  2F0K A;  4HIO A;  4UY8 C;  2JEB I;  2R3Z A;  2PI2 E;  1O7Z A;  3OWE B;  4Q0F A;  3I56 A;  3NQT A;  4EQO A;  2QEX A;  1TS2 A;  2LFN A;  3I70 A;  3OMG A;  2PQA A;  4A3B B;  2VS1 A;  4PMC A;  2EYO A;  4JI5 Q;  1I4P A;  5LMN L;  1HQR D;  5M3F G;  4KN4 C;  4HSV A;  3FDT A;  4RKL A;  4DR3 L;  1DM0 B;  3HOU H;  4IUP A;  4TQU S;  1BCP D;  3KFU A;  1GUS A;  1HH2 P;  3CC4 A;  3FEW X;  3A7L A;  1EU3 A;  1PH2 A;  1EZ8 A;  1EY8 A;  1NR4 A;  3H0G G;  1OXS C;  2UUA Q;  1PTO F;  4IUR A;  2R7D A;  4LJZ C;  2D9U A;  3UDF A;  2F4I A;  3LNN A;  1E22 A;  1JWM D;  1SSO A;  4L5Q A;  1IZ6 A;  4CJ0 B;  1EQQ A;  4JOI A;  1Q82 C;  1Y1W B;  2OWO A;  1ENC A;  1CFM A;  4BXX G;  3S1M B;  4DV2 L;  1I4H A;  1MSG A;  1VQL A;  1XNQ Q;  2E2J B;  1TWA H;  1TS5 A;  3GTP H;  1STE A;  1N32 L;  2KHS A;  5IYB H;  1NUC A;  2MFI A;  3JAM c;  3HOV G;  3KF6 B;  4KKT A;  5D65 A;  3X3M A;  2PZW A;  1VQA A;  4B9X A;  1M4V A;  3QOJ A;  5GRO A;  2KCN A;  2IJ0 A;  2R93 H;  2NYZ D;  2UUB L;  2B2U A;  1GVP A;  3A55 A;  4GS3 A;  1YHQ A;  1HXY D;  1VQ6 A;  1YHA A;  4IAL A;  3I4M H;  4A3D H;  2C35 B;  1WJJ A;  1YJ9 A;  2PQE A;  1LTB D;  1WI5 A;  3VYS A;  4HJA A;  3PUV A;  4IN3 A;  2KHI A;  4DA2 A;  4J1M A;  2RCN A;  4QY7 A;  2K5V A;  5CR3 A;  2UUC L;  2Z6K A;  3KUP A;  2EYM A;  1CUK A;  1Q86 C;  2DN8 A;  3CKI B;  5ELC A;  4FNF A;  2RF4 A;  4IPH A;  1R9T H;  1WCM H;  3NUC A;  1ICF B;  3S1R H;  4A3K H;  1G2T A;  1KD1 C;  5C44 H;  4C3I H;  4IFD J;  1CA5 A;  2N3S A;  3TN2 A;  2BA0 A;  3Q8D A;  3HOW H;  1E2W A;  3MXU A;  4LF9 Q;  2ID0 A;  2K05 A;  2GN5 A;  2OQK A;  2RDH A;  2VY3 A;  4JYA L;  2SOB A;  3CD6 A;  2K4K A;  3BYY B;  1XNR Q;  1P8L A;  3SVM A;  1VS0 A;  1BBU A;  4HJ8 A;  1WFQ A;  1XPU A;  5E1F A;  5KGU A;  4L6T B;  3CCL A;  1G8Z D;  4C2M B;  3D4R A;  1EY0 A;  4C1N I;  1QUQ B;  1UEB A;  3PF4 A;  3I4N G;  4A3G B;  3AFQ A;  4JBK A;  4JI1 Q;  3UE1 A;  1WTP A;  3CCU A;  5GAG C;  4GKJ L;  4RKB A;  1TWC H;  1SFO B;  1MIU A;  2HCC A;  2EYL A;  3K5O A;  2FMM A;  5LHY 1;  1J9O A;  2B63 H;  5G3L D;  5KIX A;  2Q8R E;  5EKK A;  5KYL A;  2AHO B;  4GKK Q;  5EJW A;  1UAP A;  1A8V A;  2E2H H;  1S5B D;  3D6W A;  4JI4 L;  4GLV B;  4XDX A;  5EBD A;  2MP1 A;  3KJP A;  3T53 B;  5LMN W;  3A54 A;  1HZ9 A;  1PFM A;  5HY6 A;  5ISR A;  2F0U A;  5M5X H;  4CKB A;  1WD0 A;  4KHP Q;  2JA6 G;  4I65 A;  4JI3 Q;  1IBM Q;  5JPN C;  2AQ1 B;  4I7A A;  3PO3 B;  2A73 B;  3K81 C;  3MFG A;  3B6Y A;  1W6J A;  4R8N A;  1YNJ C;  3CMA A;  4A3M B;  3J80 i;  5M3F H;  2R92 G;  2NVY H;  2QDL A;  3ULL A;  2MO0 A;  1NJI C;  1VQI A;  1K28 A;  3MVV A;  1HNW L;  3H0G H;  5I2Y A;  2RDF A;  1QVG A;  4FXD A;  5KNC A;  4A3I G;  1YJN A;  4JK1 C;  1ENF A;  2F1M A;  3T13 A;  1PLF A;  3RN2 A;  4DR4 L;  4B3T Q;  1T9H A;  3J81 E;  1LTL A;  3U9S A;  1WOC A;  2BA1 A;  1GUW A;  3SK6 A;  2PMZ E;  1VQH A;  3M4P A;  2R7Z B;  3PCO B;  4KJO A;  3SK8 A;  5M5Y B;  4OHJ A;  3OTO L;  1RIP A;  2XIW A;  3SE0 A;  2FJ2 A;  1SRU A;  4UPA A;  3VR4 A;  2Z4I A;  1HZB A;  2I5L X;  2ZXP A;  4EX5 A;  5IGC A;  5LMN Q;  3HOV H;  5DLQ E;  2N55 A;  1L0Y B;  4DR3 Q;  3H3V I;  3W5O A;  1KDC A;  1D5X C;  2F0P A;  3KK7 A;  2SNM A;  4XTC S;  3AQQ A;  5FLM G;  3E9I A;  4K2L A;  1MHW C;  1OXT A;  3I8Z A;  1IW7 D;  1IKM A;  3GTL B;  1XYI A;  1A62 A;  1S72 A;  1A3U A;  2F0Q A;  2FMC A;  3CCM A;  1FR3 A;  2EE1 A;  3DWA A;  3HOY G;  1RHP A;  4FF1 A;  3CF5 A;  3MA2 B;  1LTT D;  1B9N A;  3VYR A;  1PRT D;  1UE6 A;  1V1P B;  3MEH A;  2GVB A;  4K6D A;  5CV7 A;  2CWA A;  5EPL A;  4DV2 Q;  2CKZ B;  3MEF A;  1H9K A;  4BBR B;  1BR9 A;  4A3J G;  1N32 Q;  5IT9 L;  1KNE A;  3MXN B;  3K59 A;  1EU4 A;  2NN6 I;  1Y8N B;  1DOL A;  1Q46 A;  1IXR A;  3I2Z A;  2M9V A;  1FGU A;  3J7Z C;  4IJL A;  3J80 c;  1EOV A;  3I7F A;  2UUB Q;  3TP7 A;  4LK1 C;  3S2D B;  1AW7 A;  3MFY A;  3I4N H;  1JCK B;  4PV1 C;  4YWL A;  3M9B A;  1CHP D;  4IOC A;  2EYJ A;  3N6R A;  2UUC Q;  2G9D A;  2F0F A;  4RGN A;  1CZG A;  5C4J H;  3S17 H;  1D1K A;  3RLO A;  5COY A;  3W3A A;  3OIP A;  1RTN A;  4LUO A;  2RCF A;  2O5J C;  2F0J A;  3HOZ G;  1CI3 M;  1NY4 A;  4MNO A;  4JYA Q;  1F77 A;  5JJZ A;  4RGO S;  1Q7Y C;  2F03 A;  1UUP A;  2J0T D;  5EKI A;  3K7U C;  4OON A;  2M2L A;  2JA6 H;  5LMU L;  4KHZ A;  2ZM6 L;  2EPB A;  5TSS A;  1LT5 D;  2KEC A;  4NW2 A;  5CV4 A;  2IX0 A;  2WKC A;  2CHB D;  5FLX L;  2F0N A;  4GKJ Q;  1E0B A;  2AUJ D;  2EYP A;  1KDB A;  1LTG D;  5BN4 A;  4CDD C;  2CH4 A;  4RCO A;  1SND A;  5T1I A;  3FRP B;  2NN6 G;  3G4S A;  2VNU D;  1II3 A;  1FVI A;  4MTN A;  4CDF C;  4QGU A;  3A74 A;  1B7Y B;  4JI4 Q;  2QKI C;  3I55 A;  3RR5 A;  2BE5 C;  5I9P A;  1AE3 A;  3OW7 A;  4AIM A;  4CJ1 B;  5JJI A;  4DUY Q;  2L4N A;  1NSN S;  1XMQ L;  1X56 A;  2F0W A;  2JE6 I;  5ELO A;  4HCS A;  4ZCK A;  2KCC A;  3RD4 A;  1PV4 A;  1NBW A;  3S1Q B;  4DFA A;  2AKW B;  1L1O B;  3BS1 A;  1GJX A;  4GOP B;  2SEB D;  4JI5 L;  5M5W H;  3RLN A;  5IE8 A;  5IGB A;  1B44 D;  4NPS A;  1J8I A;  4AYB B;  1HR0 L;  4DR7 L;  1YNN C;  3D31 A;  4N8X 1;  2B2W C;  4XYQ A;  3EA6 A;  1BCP F;  1I4X A;  4KTA A;  5FLM H;  3GTQ B;  2HIV A;  2CH4 W;  1HNW Q;  3DMU A;  1VMP A;  1X3P A;  5JEA H;  1WTQ A;  2NVT B;  3ZYY X;  4EQP A;  1PDQ A;  1AZQ A;  1FYC A;  4X6A H;  2L15 A;  2PZU A;  4DR4 Q;  3KDF B;  3HOY H;  4U67 3;  1XX8 A;  3PMF A;  3E0J A;  5EGT A;  4J15 A;  2NB0 A;  2A6H C;  4DV0 L;  1HFN A;  1KC8 C;  1H9R A;  3OTO Q;  4PZ6 A;  1NAP A;  3ULP A;  2L55 A;  3BU2 A;  4A3J H;  1XPO A;  4OX9 L;  1H9S B;  3JAM L;  1A2U A;  1LO5 D;  2K01 A;  1PHJ A;  5E3F A;  3KBG A;  1EFI D;  3LGJ A;  1I6H B;  1BOS A;  3A5U A;  3MC0 B;  1YNJ D;  4QUF A;  3PUY A;  3QG1 A;  2ICE C;  1C7Y A;  1VQ9 A;  4LAA A;  1SXT A;  1LM0 A;  4R8I A;  3M7G A;  1ASY A;  3MAQ A;  2QCP X;  5ELF A;  2N49 A;  1CSQ A;  1E3P A;  3T1Y L;  4U68 A;  2I07 B;  2N8N A;  2EXZ A;  3H3V H;  2RBM A;  4B3M L;  1MI2 A;  2NBF A;  4LNQ A;  1XWE A;  4FO2 A;  1L2F A;  4KY7 A;  1PZJ D;  2F0O A;  1R4P B;  4IUT A;  5M3M G;  3W1B A;  1B70 B;  3TS2 A;  1MD2 D;  2JA5 B;  1JC7 A;  4IOA A;  2K04 A;  3GP7 A;  1B3A A;  3KBX A;  4C3J B;  1ET9 A;  3C1F A;  1EUJ A;  1G29 1;  4X64 L;  2OXP A;  4DR1 L;  2WAQ E;  2J7Z A;  3DEP A;  4EVO A;  1XXG A;  4JVZ A;  1YEZ A;  1WTV A;  1Y1W G;  4P71 A;  3BYT B;  4LFB L;  1JWU D;  5GAE C;  4HJ9 A;  4R4I A;  3IAY A;  2IHE A;  3NBH A;  1ROD A;  2NTT A;  3HOX G;  1CQF A;  4QL5 A;  3PIO A;  1XTC D;  2Z9H A;  4MN3 A;  3GDE A;  1GM5 A;  5IP9 G;  4QIW E;  1D2B A;  2NN6 H;  4QF4 A;  5G3L F;  3S16 H;  2DNC A;  4HR7 B;  2K5W A;  5BR8 Q;  1H9M A;  1TY2 A;  4LFA L;  3SR1 A;  2EVB A;  3F2C A;  3GV3 A;  1X3E A;  3QWN A;  1X3G A;  4A4I A;  1GUG A;  1SMX A;  2B2Y C;  4FXK C;  3TRE A;  1HR0 W;  1K3R A;  5CMD A;  4LF7 L;  1F2M A;  1JT8 A;  1LLR D;  3GO5 A;  5LMU Q;  1IBM L;  3A0J A;  3TP5 A;  1WVL A;  2ZM6 Q;  2BDN A;  3L7Z C;  1UE5 A;  1HQM C;  3KF8 B;  3GTK H;  4HIK A;  1JE4 A;  1YVC A;  2Y0S E;  4UP7 A;  2O4X A;  1ZEQ X;  3F1Z A;  3J81 i;  3VYU A;  4DK0 A;  5IYD G;  1EIG A;  1UE7 A;  3STB C;  3DLL A;  3TQY A;  4NKL A;  2F0V A;  5EBC A;  4L63 B;  1N34 L;  1QWY A;  1VQ5 A;  3S1N H;  3MWY W;  3U4V A;  5DM7 3;  4DV3 L;  4JI6 L;  1PTO C;  1PVO A;  1IKL A;  3CXC A;  2K03 A;  4RWS C;  2F0L A;  4CHT B;  2QIL A;  4HAE A;  2PPB C;  3QJY A;  1XMQ Q;  2RSN A;  1Y1V G;  1B8A A;  4KD3 A;  4K5V A;  3IL8 A;  3K5M A;  3HOU B;  3CW2 C;  4IFD I;  2HDM A;  1NNX A;  3T51 B;  3HEJ A;  1HR0 Q;  2ZXO A;  2K7V A;  4DR7 Q;  3ND9 A;  1SBB B;  4DXF A;  1MGS A;  1EIF A;  4C3H G;  2LKV A;  2B29 A;  5A2Q L;  1VDZ A;  3KOJ A;  1TWF H;  2D5D A;  4FDB A;  5CV8 A;  2VB3 X;  2XVS A;  3TP8 A;  3C2P A;  4YCW A;  5D14 A;  3HKZ B;  1E24 A;  3LX0 A;  1JR0 D;  2HUG A;  4QJF A;  3L0O A;  1IBL L;  2QF7 A;  1JE5 A;  5DM6 3;  3E3X A;  5IT9 E;  3PO3 G;  3PQI A;  3DEO A;  4UHV A;  5KNB A;  4EQN A;  2NVQ B;  4N9P A;  4A3M G;  1AEX A;  1PRT F;  1E7Z A;  1TWA B;  5HGQ A;  3GTP B;  3KF6 A;  4LMQ D;  3AMU A;  4DV0 Q;  1X9N A;  4DR5 L;  1ESF A;  2J4X A;  2A19 A;  4K14 A;  2VW9 A;  1UNS A;  2BE5 D;  3I90 A;  2JA8 B;  5CBA E;  2L0C A;  1A15 A;  5M3M H;  1GXD C;  1SNC A;  2PW7 A;  1CKN B;  5HUR A;  4OX9 Q;  2R93 B;  1KAA A;  2LS0 1;  4A3E G;  2OF1 A;  3I4M B;  4A3D B;  3QO2 A;  3D8G A;  2VZA A;  4CBV A;  1J5E L;  2A6E C;  4GN5 A;  1WTH A;  2ZJP A;  4LF6 L;  3J80 L;  3EQL C;  2WII B;  1Y1W H;  4K5X A;  3J81 c;  4DV4 L;  1KTK A;  3SGI A;  1YNN D;  4QMG A;  4PMB A;  2DJG C;  4K5W A;  1WCM B;  1BBX C;  3S1R B;  4A3K B;  5M9O A;  2PNH A;  2ASB A;  3SDZ A;  5C44 B;  3HOX H;  4IFD G;  2A74 C;  1B3Q A;  3T1Y Q;  5IP9 H;  1V43 A;  2E5L L;  3K0X A;  2JA7 G;  3R2I A;  4B3M Q;  3HOW B;  5C4X B;  4BBS G;  1VCI A;  5C4H A;  1B2T A;  1ONL A;  1TT2 A;  3C3L A;  2ZTE A;  1QUQ A;  3OPO A;  2Z1C A;  3PO2 B;  5FLX E;  2PCF B;  4EQ5 A;  2DNE A;  3BJU A;  4V0B A;  2I46 A;  4KY6 A;  1TS4 A;  2A6H D;  1D1I A;  2WAQ G;  2D2C C;  1LTR D;  4X64 Q;  3UDX A;  1K0R A;  4GNX B;  4DR1 Q;  1TWG H;  1K8G A;  1SNO A;  3HZX A;  3VR5 A;  3K80 C;  2XTI A;  3RZD H;  4HJ7 A;  5E4X A;  3ULJ A;  4LFB Q;  3VDY A;  2XWJ B;  1SNQ A;  4K0K L;  2B63 B;  1U0L A;  5FO9 B;  5LL6 X;  5IYD H;  1UWV A;  2FXQ A;  3HRZ C;  5FK9 C;  1NMG A;  2LMC B;  4NB3 A;  1S5C D;  3FHW A;  4LFA Q;  3R2T A;  3M3Y H;  3MZ5 A;  2DGY A;  5M5X B;  3E9H A;  1ML0 D;  1MBY A;  2L9H A;  4DAY B;  4DUY L;  1Q12 A;  1AH9 A;  3EVQ A;  1ESR A;  4H7B A;  3PUX A;  3RZO H;  4LF7 Q;  4BA1 I;  1YZ6 A;  4G7O C;  3L2P A;  1Y1V H;  2PYK A;  3X3N A;  5M3F B;  4P74 A;  2NVY B;  1VQ7 A;  4A3F B;  2Y0S G;  3FKI G;  3W1G A;  1VQN A;  4YCV A;  3H0G B;  3BVZ A;  2F3I A;  1NMF A;  4LF4 L;  4LF5 L;  4C3H H;  2IX3 A;  1VQB A;  1ICW A;  2IL8 A;  4DK1 A;  1S40 A;  2YYZ A;  4WRD A;  2I5H A;  4DAM A;  4L5T A;  1STY A;  2F3W A;  1FGB D;  1N34 Q;  2QEJ C;  5CV6 A;  1SYF A;  4IUN A;  1Y8P B;  2EXD A;  5D3I B;  4DV3 Q;  1N36 Q;  4JI6 Q;  2A8V A;  1QJO A;  1RJT A;  3PO3 H;  4QQB X;  1EYD A;  2YU9 H;  3GTJ H;  2MGS A;  3JAM E;  4A3M H;  3LWU A;  1YHB A;  5IIF A;  3TRZ A;  2BH8 A;  2JQO A;  4BXX H;  1SRO A;  2A69 C;  2DJF C;  4K8J A;  3HOV B;  1JOK A;  4F7X A;  3NWT A;  4IPG A;  5C0X J;  1I3Q B;  3MXG A;  2K5N A;  1HA5 A;  1IBK L;  5D3D A;  4A3E H;  1HNZ L;  4N9T A;  4JOI C;  2K75 A;  1HCZ A;  1EY4 A;  1Q1E A;  2B2W A;  2E2I H;  1A0I A;  4JCV E;  3URY A;  1UEA B;  1V1Q A;  1MJE A;  4A75 A;  2AWO A;  5C3E B;  4YWK A;  2G5D A;  1JQY D;  4GN4 B;  5IGD A;  1WTO A;  4GZY C;  2ENB A;  4OWW B;  3RUZ A;  3NTK A;  1A3T A;  2K5H A;  1V1P A;  2F0D A;  3CCQ A;  1CSP A;  3OOC A;  4XQQ A;  1IBL Q;  3Q6S A;  3STB D;  4X66 L;  2QA4 A;  3OW2 A;  3S15 B;  4IFD H;  5I4D A;  3GTG H;  4IPC A;  3S14 B;  4DK6 C;  3U50 C;  1JOR A;  1X32 A;  2JA7 H;  1WD1 A;  5K5P A;  1BNZ A;  2ZTD A;  3MXN A;  5FO8 B;  4Y7N B;  1C4Q A;  4BBS H;  1JJC B;  2RQX A;  1SN8 A;  3V2T A;  4GLA C;  3TBI B;  5JJL A;  4DR5 Q;  4GN3 B;  1HPC A;  4CJ2 C;  4GNX C;  4NMZ A;  1GUO A;  3KLW A;  1PH6 A;  1GOZ A;  2H1E A;  4UAI A;  4G57 A;  5JEA J;  1FNV A;  3TDQ A;  1W6K A;  4J6H A;  2LXJ A;  1UE1 A;  3I4N B;  1GO3 E;  2X6G A;  2G9H D;  1J5E Q;  2WB1 B;  2K50 A;  1STN A;  1ENA A;  3G6J B;  4LF6 Q;  5I6Y A;  1JWS D;  1LAC A;  2MHV A;  1TY0 A;  3PUZ A;  2K6A A;  3VA5 A;  3R93 A;  4DV4 Q;  3D3R A;  3SK4 A;  5C4J B;  3TSS A;  2KED A;  2LY7 A;  1VQM A;  2KVM A;  1J6Q A;  2MO1 A;  4HIM A;  3J81 j;  2P5Z X;  3SK5 A;  2V4D A;  1PMR A;  2CQA A;  2E5L Q;  4R4Q A;  1Q90 A;  3VYT A;  3GTO H;  2ALY B;  1TKW B;  2CCZ A;  5BR8 L;  4HTH A;  4KKU A;  1QOH A;  4O1N A;  3CCS A;  1AE2 A;  1D5M C;  4R4T A;  4EGV A;  2JA6 B;  1MKH A;  1T5E A;  1LAB A;  1K8M A;  1K3B C;  1RD9 D;  1S5E D;  4FYD A;  1EYC A;  1KQS A;  1S4Z A;  3E5S A;  2GA4 B;  1W3S A;  5E4W C;  5EQ0 A;  1KIX A;  1YNX A;  2AQ2 B;  3FKI H;  3S24 A;  1DXM A;  2M00 A;  2JEA I;  3DWP A;  5J1Z A;  2R92 H;  3R3O A;  1SYB A;  2LSS A;  4K0K Q;  4PZ7 A;  3BVM A;  2A6E D;  3J7Y W;  3I91 A;  2WP8 J;  3M4O H;  4LWC A;  2Q2H A;  4TVA B;  1IYU A;  1VMC A;  2D0O A;  3MXP A;  2B2T C;  4A3I H;  2EY2 A;  4LFC L;  4C3J G;  4KI0 A;  3S2H H;  4PZ8 A;  4HN7 A;  1YBY A;  3ONA B;  1BKB A;  2B3G A;  5ELN A;  3OMC A;  1M8A A;  4DN4 M;  1QG7 A;  3JC6 6;  4JI0 L;  1DZ1 A;  3VR2 A;  2F0T A;  5EPK A;  4JBJ A;  1XPR A;  1EY6 A;  1PH3 A;  1L1O A;  2IT1 A;  1OXU A;  2B2Y A;  4GOP A;  4IO9 A;  4A3L G;  5H1S E;  1V1O A;  1QB5 D;  1CK1 A;  2VXW A;  4X3K A;  1T5X D;  5A2Q E;  2VL6 A;  3NBI A;  3G71 A;  2H4O A;  1O7I A;  5M5W B;  4M8A A;  4O2D A;  1HZA A;  4V19 0;  4BY7 G;  2ZT9 C;  1EQV A;  1TWH H;  4NXM L;  2JN4 A;  4KKS A;  1EWI A;  3D6C A;  4BY1 B;  2AMC B;  2K32 A;  1RCV D;  4ULL A;  5F2D A;  1EWH A;  2NUC A;  4L5R C;  4LF4 Q;  4LF5 Q;  2DY7 A;  2EZV A;  5L37 A;  4B9W A;  2MUY A;  1V9P A;  3CC7 A;  1X55 A;  3HOY B;  3H09 A;  1E1O A;  3PIP A;  4H44 C;  2FHT A;  3PF5 A;  1VQO A;  3EFX D;  1FJG L;  4N8F A;  4APV A;  5EPJ A;  3UI2 A;  4ALP A;  2VUM B;  4ZK9 B;  2B8G A;  1SJE D;  1LT4 D;  1H9S A;  5LL6 S;  4XQN A;  1PTO B;  3ER0 A;  1K83 H;  2RA4 A;  2OT2 A;  3ND8 A;  5I2X A;  3EBE A;  4S3S A;  1I50 H;  1IBK Q;  4ZKB B;  1LT6 D;  4RMF A;  2HIX A;  4PNY A;  3BVG A;  1STH A;  1HNZ Q;  4A93 B;  4LF8 L;  4FVM A;  2ES2 A;  1DD2 A;  1NTG A;  4BA2 I;  3EN2 A;  2Z4H A;  1KRS A;  1VQJ A;  2Q2I A;  3L9A X;  4KMU C;  2TSS A;  1HUM A;  3K0Y A;  5JJK A;  1RTO A;  3J81 L;  2NVX H;  4R1J A;  2JYO A;  2H5X A;  1I5F A;  3GD7 A;  1YJW A;  2EY6 A;  1Q3L A;  2PNR C;  4X66 Q;  2X6L A;  2IX1 A;  4A3B G;  1A2T A;  4HMI A;  1FNU A;  3I3C A;  2XWB B;  1Y14 B;  4CKC A;  1SYC A;  3GTM H;  4MIU A;  4G7H C;  4KY5 A;  2L12 A;  1EY7 A;  5FO7 B;  1I6H H;  3HOZ H;  3AEV A;  3WOF A;  2TMP A;  1M90 C;  1SE2 A;  3HKZ G;  2A69 D;  4M1U B;  5K36 G;  4YIJ A;  4DAV A;  2EYH A;  3HG9 A;  4DR2 L;  3K7A H;  1SDF A;  2K33 A;  3I4L A;  1PH5 A;  4WJ3 M;  3W2D A;  3AFP A;  5IT9 c;  1B50 A;  1BO0 A;  3L3O C;  1VQC A;  3TZU A;  2JSO A;  3NWS A;  3HS0 C;  1PH8 A;  2JA8 G;  1SNP A;  1CKO A;  4LUZ A;  2Q2T A;  2WV6 D;  4CKE A;  2ZJQ A;  2R93 G;  4NXN L;  1VQE A;  1EYA A;  1N33 L;  5CYU A;  1GHJ A;  2K28 A;  3CHB D;  4LUV A;  3K8A A;  4A3D G;  3IFD A;  1SMY C;  5GQO A;  3HKS A;  1KRT A;  3I72 A;  4YWM A;  3ERO A;  5IGE A;  3OYY A;  5FJ8 G;  1JOO A;  3KF8 A;  1ILP A;  4DNI A;  1I4Q A;  2IWH A;  2B2V C;  4A3L H;  1RL2 A;  3FPU B;  3FMC A;  4MTK A;  2FFK B;  5JVH 3;  4B3S L;  3CQZ H;  3GTK B;  4HJ5 A;  4UP8 A;  1BVS A;  3F2U A;  1U5K A;  5KND A;  1Q8I A;  4BY7 H;  1M1K C;  2EDG A;  3BZK A;  3H15 A;  2CW0 C;  1GHK A;  1F2L A;  2K52 A;  1S5D D;  3HOW G;  5C4X G;  4OEL B;  1NE3 A;  1ET6 A;  2BDO A;  1FD7 D;  2F52 A;  4C1N K;  4CDC C;  4DNT B;  4ABN A;  3E0E A;  1N8R C;  3S1N B;  1CHQ D;  3T16 A;  1D5Z C;  2UXB L;  3PO2 G;  2F4V L;  1PFB A;  2CQO A;  2Q8I B;  2EQS A;  4LFC Q;  2PMZ B;  5C3W A;  2F3V A;  1VQD A;  2VQF L;  1N36 L;  1TU2 B;  2RKS A;  3NPP A;  1BBW A;  3P7J A;  3QR8 A;  3I73 A;  2HQL A;  4JI0 Q;  1PH7 A;  1Z47 A;  1QZH A;  4POF A;  2XRQ D;  4A3G G;  4ZLT F;  1WYD A;  1RF2 D;  2KEE A;  1HUN A;  4OO1 I;  4JI8 L;  4HCE A;  1SYD A;  2QDB A;  5HGT A;  1SEB D;  2HCI A;  3A5Z B;  5J22 A;  2QW7 A;  4HMJ A;  1G91 A;  1HFG A;  3J7A 5;  1NR2 A;  1PYW D;  4NXM Q;  4RH6 A;  4YHH L;  1SE8 A;  4F87 A;  1EL0 A;  2D62 A;  4X3U A;  4P2C B;  1TWF B;  1VQ8 A;  2EYF A;  4RG1 A;  5ELE A;  2KOL A;  4JG2 A;  3VR3 A;  4CGY B;  2KQ3 A;  3ITP A;  1YIT A;  5KEE A;  3H3V C;  3PUW A;  4RAU C;  1U9R A;  2UU9 L;  1XTD A;  3BZD B;  3T4A C;  4K8I A;  2DY8 A;  2NTS A;  3AU7 A;  4JBW A;  4MZ9 A;  4BWG B;  3TS0 A;  3KYH C;  1O7L A;  1PYB A;  4H0L C;  1AFP A;  1KLU D;  3PIO 3;  1FJG Q;  1G6Z A;  1X3Q A;  4KK7 A;  4A3F G;  2PZT A;  4A3B H;  1Z6H A;  1CKN A;  1DGS A;  2UXD L;  2PQA B;  5M3M B;  4GLX A;  3DM3 A;  2KUM A;  1TII D;  4AYB E;  1L0W A;  2OTL A;  1EY5 A;  1WTR A;  2WIN B;  1JIC A;  1IL8 A;  2VQE L;  4YY3 L;  1W2B A;  1G6P A;  4G4K A;  3RNU A;  1E2V A;  4LF8 Q;  2ZTC A;  5CV9 A;  3P75 A;  5K36 H;  5JVG 3;  1I94 L;  3CPW A;  4HID A;  3A8J E;  3HGB A;  4B3R Q;  2KCM A;  4DV7 L;  4BS9 A;  1HZC A;  2NVQ H;  4OO1 G;  4IPD A;  2EOT A;  3HOX B;  1RKN A;  3AB9 A;  2IW3 A;  2R7Z G;  1SE3 A;  2HQE A;  3BDO A;  4PMW A;  3R8B A;  2AQ3 B;  3S1M H;  3CCE A;  1R9T B;  1Q81 C;  2R7F A;  2JA8 H;  1I4R A;  3C1E A;  4C3I B;  1CA6 A;  2E2J H;  3RN5 A;  1SNM A;  1DJR D;  4P72 A;  3WOE A;  3T1H L;  3J7A F;  3CRK C;  4R4C A;  2O5I C;  1GD7 A;  2EJG C;  1X65 A;  4A76 A;  5J3B A;  1CTM A;  4GNX A;  2JP1 A;  3M85 A;  2A1A A;  4DKA C;  3H91 A;  1EEF D;  2CVR A;  3KLR A;  5C3E G;  1P16 A;  5FJ8 H;  3K58 A;  5I9O A;  5AJ3 L;  1S3O A;  4IUQ A;  1TWG B;  3CRL C;  4JBM A;  4HSP A;  1HNX L;  4ODG A;  1LT3 D;  3F2D A;  3RZD B;  1X6O A;  4DR2 Q;  1KAB A;  3UE0 A;  4DK3 C;  1TWC B;  2E75 C;  2C5C A;  1EYG A;  4JI7 Q;  1BDO A;  2A68 C;  5C4X H;  2E8G A;  3AYH B;  5C0X I;  3U58 A;  1QNK A;  1V8Q A;  4HED A;  4P73 A;  4BBR G;  3PO2 H;  3FPP A;  3M3Y B;  2E2H B;  4DPG A;  3SXH A;  4POG A;  4NXN Q;  4DAY A;  1TQO A;  2BH2 A;  5GAD C;  4DV1 L;  3BZC A;  1N33 Q;  1Q8K A;  3DWQ A;  2WB1 G;  2Z8L A;  3NSW A;  4C2M H;  3RZO B;  3FP9 A;  1E1T A;  4OL7 A;  4RGT A;  1G2S A;  1Y69 U;  4A3G H;  2E74 C;  1Y1V B;  2QGQ A;  1TXY A;  1BF4 A;  1XMO Q;  4XXE A;  4ZYS A;  1SFO H;  4B3S Q;  2KEN A;  2Z0S A;  1VQP A;  4OWT B;  2L1B A;  3C46 A;  2IHF A;  4ID6 A;  2XNA C;  4IZ8 A;  1YI2 A;  4C56 C;  2L11 A;  1PZK D;  1PA6 A;  1DOM A;  1QZG A;  4C3H B;  4KHV A;  1U4L A;  1LTI D;  2MJ8 A;  3NK9 A;  3BDC A;  3U9O A;  4JV5 Q;  4WJW A;  1STG A;  2MQH A;  3M4Q A;  4YCU A;  3NXW A;  4P75 A;  3MTS A;  3V96 A;  2UXB Q;  3IFT A;  2F4V Q;  2B2T A;  2YU9 B;  1PH1 A;  2E2D C;  5IY0 A;  1HRJ A;  3GTJ B;  3P1H A;  1TS3 A;  2VQF Q;  3ICE A;  5DNF A;  4B08 A;  4A3F H;  2F0M A;  3K5L A;  5KYI A;  4ME5 A;  4MHE A;  3TP6 A;  1BCP B;  2ZXR A;  4JI8 Q;  4PG3 A;  5C0X G;  4TKO B;  4DV6 L;  2B39 A;  1FNW A;  1B53 A;  3A8I E;  1SMY D;  4A3E B;  1VQF A;  2EJF C;  1IHZ A;  5ELB A;  3M7N A;  2NZO A;  4YHH Q;  4OXP A;  2E2I B;  3NEN A;  3NQI A;  3D4W A;  1O78 A;  3Q0A A;  1RDP D;  4ZUJ A;  1OXV A;  5C4Z A;  2RHS B;  3G7L A;  3CCR A;  3CME A;  1GUT A;  3TEH B;  1Z7T A;  1ZYR C;  2UU9 Q;  2BCO A;  4OO1 H;  2CW0 D;  4X65 L;  1AN8 A;  3BG3 A;  4KN7 C;  5IOC A;  3PGZ A;  3GQB A;  1F9P A;  5IGF A;  5JPM C;  2R7Z H;  3LWE A;  3K5N A;  3GTG B;  3IRB A;  1VQG A;  2JA7 B;  5M5Y H;  1NCV A;  4QUC A;  4E6I A;  1I3Q H;  4BBS B;  2JJQ A;  5FKA C;  2KHJ A;  1HTP A;  3NEL A;  4BY1 G;  5IOD A;  1EOT A;  2AUK A;  4RCN A;  3HFZ B;  2UXD Q;  2B2U C;  2Q2U A;  3O13 A;  1DOK A;  4AYB G;  2C9O A;  1PTO D;  5JEA G;  4FF2 A;  3QIA A;  3P20 A;  4ZAI A;  4DAP A;  5CV5 A;  2YTY A;  3GV6 A;  2WAC A;  2IPK D;  2WAQ B;  3V05 A;  2VQE Q;  4YY3 Q;  1BQQ T;  4H13 C;  5C3E H;  5GAH C;  4RA8 A;  4OIK A;  2Z6K C;  4NP5 A;  3GTL H;  2SNS A;  3KLS A;  1F9R A;  1C9O A;  4K6L A;  5IGG A;  4XIG S;  1I94 Q;  1O80 A;  2AWN A;  3MHB A;  4ZRZ A;  3HKZ E;  3K57 A;  3NP8 A;  4ME3 A;  4DV7 Q;  3S15 H;  4WJ4 A;  2F0S A;  2RHQ B;  2L5T A;  4L8J A;  3U4Z A;  1D6E C;  1KXL A;  2VUM G;  3S14 H;  1PYS B;  4K2K A;  1E2Z A;  4QIW B;  1O7Y A;  1JJG A;  4A3C G;  1N9W A;  4Y7N H;  4AQY L;  1BUV T;  4XT3 B;  2MNA A;  3ERS X;  1LTA D;  3S17 B;  2K5D A;  1K0S A;  1EZ6 A;  2IY5 B;  4BBR H;  1PXU A;  3SEB A;  1F2Z A;  1SAP A;  3WWV A;  3NEM A;  3GTO B;  4JI2 L;  3T1H Q;  1FL0 A;  3HP3 A;  5EKL A;  4NDX A;  4A93 G;  4LW1 A;  1QCB D;  1SYE A;  5JOB A;  1LYL A;  3CPF A;  2RVL A;  3DHQ A;  3RLF A;  2HHH L;  4KV6 A;  1EFW A;  2RDG A;  4RHR A;  1DCZ A;  1KHI A;  3ERQ A;  3NE5 B;  3NHH A;  4IQZ A;  3S2D H;  3T56 B;  5JAV A;  1TR5 A;  1YIJ A;  5AJ3 Q;  2K14 A;  2K5Q A;  4X62 L;  1S5F D;  3OIQ A;  4JW0 A;  1HNX Q;  1C48 A;  1TVX A;  3WDN A;  4WFN 3;  2Y0S B;  1JOQ A;  3FKI B;  3CCV A;  4IJH A;  2R92 B;  2N78 A;  2NWG A;  3DXJ C;  4ZQ3 A;  1Z9F A;  4DR6 L;  3M4Y A;  4R9W A;  1LUZ A;  5BN5 A;  3M4O B;  1EQR A;  3FVQ A;  4Q5V A;  5I6W A;  2F0E A;  3OSO A;  4L5S A;  1SYG A;  2YV5 A;  3PSI A;  3KJO A;  1A63 A;  2PI2 A;  2BOS A;  1H9J A;  4A3I B;  1CKM A;  3Q24 A;  2DUD A;  4DGZ A;  3S2H B;  1MJC A;  4DF7 A;  2CWP A;  1VQ4 A;  2JA5 G;  4IUV A;  1BCP C;  2B8F A;  5ELD A;  2GVA A;  3CCJ A;  4DV1 Q;  4X3T A;  5DEH A;  3OWF A;  3N52 A;  4KD4 A;  3E6Z X;  1D7Q A;  3Q23 A;  3ZJY C;  3RMH A;  5C3X A;  4DUZ L;  4DV5 L;  1U4R A;  5IP7 G;  2V1C C;  3QOL A;  1EEI D;  5C0X H;  2B2V A;  4RFB A;  5T1G A;  1IL2 A;  5E7N A;  1TWH B;  5IWA L;  1QNU A;  3CC2 A;  1GKH A;  1EIY B;  4G7Z C;  2NZ1 D;  5A35 A;  3UDI A;  3J7A V;  1JB3 A;  3EIV A;  2OQ0 A;  1X3F A;  1OTC A;  3K6O A;  5C6A A;  2OTJ A;  2R6G A;  1DON A;  1HHV A;  2UXC L;  1PZI D;  2EIF A;  1CQV A;  2F0H A;  3KDF A;  1F9Q A;  2A68 D;  3IKJ A;  4OIJ A;  1PFN A;  4AH6 A;  2YTV A;  4Z9C B;  4FF3 A;  1QVC A;  4JC0 A;  1CM9 A;  2OEO A;  1K8O A;  4FF4 A;  2F0G A;  1HA6 A;  1AP0 A;  4UP9 A;  2I0Q A;  3S1Q H;  4DU9 A;  2RSO A;  2HDL A;  4BY1 H;  1SE4 A;  2KCT A;  1K83 B;  1WTW A;  2R61 A;  1IYJ B;  4DV6 Q;  1I4G A;  4A3J B;  1I50 B;  1F2Y A;  2UUA L;  2D0P A;  3J80 E;  5KRU A;  4R4O A;  3GTQ H;  2I5M X;  4XQJ A;  4DXG A;  4JPB W;  1PH9 A;  1ZKO A;  2O2L D;  5IYC G;  2NVT H;  3H6M A;  3BDL A;  4TSS A;  1LV9 A;  3H94 A;  2XSC A;  3A56 A;  4X3S A;  3TME A;  4XT1 B;  1PRT B;  1SJH D;  4B3R L;  1CT1 D;  2PO4 A;  4OGQ C;  2VUM H;  2NVX B;  1A6X A;  1U4M A;  4X65 Q;  1JJ2 A;  3G48 A;  2LXK A;  1XNQ L;  4A3C H;  4O42 A;  3NTI A;  1C8C A;  1PTO H;  1F9S A;  3OHX C;  2HD3 A;  2YTX A;  2KA7 A;  1Q1B A;  2WFW A;  5FOB B;  1K9M C;  3HOU G;  3TZD A;  5BN3 A;  3GTM B;  1EIH A;  5C5L A;  4A93 H;  3HOZ B;  2X69 A;  4KLK A;  4OWX B;  2ATW A;  1PH4 A;  2SDF A;  3D4D A;  1U4P A;  3I4O A;  2JXM B;  4J8Q A;  1Y8O B;  1WTX A;  4I7Z C;  1GUN A;  4Y52 H;  1QE6 A;  4F8M A;  1XJV A;  3CAM A;  5CBE E;  3K7A B;  4XYO A;  2ZJR A;  5J39 A;  1KNA A;  1QVF A;  4ZUI A;  2XGT A;  5AFW A;  2XRS D;  2VB2 X; 
#chains in the Genus database with same CATH homology
 1STB A;  3DM1 A;  3DUZ A;  1R4Q B;  1EWC A;  5CGK A;  2Q8T A;  2WKD A;  4PQX A;  1B4O A;  1ZYR D;  3CU7 A;  4UDU C;  3VR6 A;  3S16 B;  1ILQ A;  1LTS D;  3VA7 A;  3SHL A;  3PIP 3;  1VF7 A;  2F0I A;  2ICI A;  3EJI A;  5CC4 A;  2PW5 A;  5NUC A;  4IUU A;  1DYQ A;  4KJN A;  2E76 C;  4QCL A;  3CQZ B;  4FP5 D;  4RHS A;  2KJX A;  1QIL A;  2EY1 A;  1A3V A;  1CZW A;  2XN9 C;  1OXX K;  4BY7 B;  2MPM A;  1I6V C;  3A7A B;  3NTH A;  3Q22 A;  3QB3 A;  1IYV A;  4C3I G;  2FIN B;  4ILW A;  1ZXT A;  1KLG D;  1AZP A;  1KDA A;  3KLS X;  1EY9 A;  1EQT A;  1VF5 C;  2EY5 A;  4ZKC B;  4F88 A;  2A5H A;  1B1Z A;  4RGM A;  4TRD A;  4QB4 A;  1STA A;  1L0X B;  1IW7 C;  1MSH A;  5C5M A;  3S9W A;  2K1B A;  5COR A;  1BXT A;  1HTL D;  1PRT C;  2N88 A;  4FXG C;  3PV0 A;  5DAU A;  2EJM A;  4WOR A;  3A8K E;  4DNR B;  1OO9 B;  1B9M A;  2F0K A;  2JEB I;  2R3Z A;  1O7Z A;  3OWE B;  4Q0F A;  3NQT A;  4EQO A;  1TS2 A;  2LFN A;  3I70 A;  3OMG A;  4A3B B;  4PMC A;  2EYO A;  1I4P A;  1HQR D;  4KN4 C;  4HSV A;  3FDT A;  4RKL A;  1DM0 B;  4IUP A;  4TQU S;  1BCP D;  1GUS A;  3FEW X;  3A7L A;  1EU3 A;  1EZ8 A;  1EY8 A;  1NR4 A;  1OXS C;  1PTO F;  4IUR A;  4LJZ C;  2D9U A;  2F4I A;  3LNN A;  1JWM D;  1SSO A;  4CJ0 B;  1Y1W B;  1ENC A;  1CFM A;  3S1M B;  1I4H A;  1MSG A;  2E2J B;  1TS5 A;  1STE A;  2KHS A;  1NUC A;  4KKT A;  5D65 A;  3X3M A;  2PZW A;  4B9X A;  1M4V A;  3QOJ A;  2KCN A;  2IJ0 A;  2NYZ D;  2B2U A;  3A55 A;  1HXY D;  4IAL A;  2PQE A;  1LTB D;  3VYS A;  3PUV A;  4IN3 A;  4DA2 A;  4J1M A;  5CR3 A;  3KUP A;  2EYM A;  2DN8 A;  3CKI B;  5ELC A;  4FNF A;  3NUC A;  1G2T A;  4IFD J;  1CA5 A;  3TN2 A;  2BA0 A;  1E2W A;  3MXU A;  2ID0 A;  2K05 A;  2RDH A;  2SOB A;  3BYY B;  3SVM A;  5E1F A;  5KGU A;  4L6T B;  1G8Z D;  4C2M B;  3D4R A;  1EY0 A;  4C1N I;  4A3G B;  1WTP A;  4RKB A;  1SFO B;  2HCC A;  2EYL A;  3K5O A;  2FMM A;  5LHY 1;  1J9O A;  5G3L D;  5KIX A;  2Q8R E;  5EKK A;  5KYL A;  5EJW A;  1UAP A;  1S5B D;  3D6W A;  4XDX A;  5EBD A;  2MP1 A;  3T53 B;  3A54 A;  1PFM A;  5ISR A;  2F0U A;  4CKB A;  1WD0 A;  4I65 A;  5JPN C;  2AQ1 B;  3PO3 B;  2A73 B;  3MFG A;  1W6J A;  4R8N A;  1YNJ C;  4A3M B;  3MVV A;  5I2Y A;  2RDF A;  4FXD A;  5KNC A;  4JK1 C;  1ENF A;  2F1M A;  3T13 A;  1PLF A;  3J81 E;  3U9S A;  2BA1 A;  1GUW A;  3SK6 A;  2R7Z B;  4KJO A;  3SK8 A;  5M5Y B;  4OHJ A;  2XIW A;  3SE0 A;  2FJ2 A;  3VR4 A;  2Z4I A;  2ZXP A;  5IGC A;  2N55 A;  1L0Y B;  1KDC A;  1D5X C;  2F0P A;  3KK7 A;  2SNM A;  4XTC S;  4K2L A;  1OXT A;  3I8Z A;  1IW7 D;  1IKM A;  3GTL B;  1XYI A;  1A3U A;  2F0Q A;  2FMC A;  1FR3 A;  2EE1 A;  3DWA A;  1RHP A;  4FF1 A;  3MA2 B;  1LTT D;  1B9N A;  3VYR A;  1PRT D;  3MEH A;  1V1P B;  4K6D A;  5CV7 A;  5EPL A;  1H9K A;  4BBR B;  1BR9 A;  5IT9 L;  1KNE A;  3K59 A;  1EU4 A;  2NN6 I;  1Y8N B;  1DOL A;  2M9V A;  3TP7 A;  4LK1 C;  3S2D B;  1AW7 A;  3MFY A;  1JCK B;  4PV1 C;  1CHP D;  2EYJ A;  3N6R A;  2G9D A;  2F0F A;  4RGN A;  1CZG A;  1D1K A;  5COY A;  3W3A A;  3OIP A;  1RTN A;  2O5J C;  2F0J A;  1CI3 M;  1F77 A;  5JJZ A;  4RGO S;  2F03 A;  1UUP A;  2J0T D;  5EKI A;  2M2L A;  4KHZ A;  2EPB A;  5TSS A;  1LT5 D;  2KEC A;  4NW2 A;  5CV4 A;  2IX0 A;  2WKC A;  2CHB D;  5FLX L;  2F0N A;  1E0B A;  2AUJ D;  2EYP A;  1KDB A;  1LTG D;  5BN4 A;  4RCO A;  1SND A;  5T1I A;  3FRP B;  2NN6 G;  2VNU D;  1II3 A;  2QKI C;  2BE5 C;  5I9P A;  3OW7 A;  4CJ1 B;  2L4N A;  1NSN S;  2F0W A;  2JE6 I;  4HCS A;  2KCC A;  3RD4 A;  3S1Q B;  4DFA A;  3BS1 A;  1GJX A;  2SEB D;  5IGB A;  1B44 D;  1J8I A;  4AYB B;  1YNN C;  3D31 A;  2B2W C;  4XYQ A;  3EA6 A;  1BCP F;  1I4X A;  4KTA A;  3GTQ B;  3DMU A;  1VMP A;  1X3P A;  5JEA H;  1WTQ A;  2NVT B;  3ZYY X;  4EQP A;  1PDQ A;  1AZQ A;  1FYC A;  2PZU A;  4U67 3;  1XX8 A;  3PMF A;  3E0J A;  5EGT A;  2NB0 A;  2A6H C;  1HFN A;  1H9R A;  1NAP A;  2L55 A;  1H9S B;  3JAM L;  1A2U A;  1LO5 D;  2K01 A;  5E3F A;  3KBG A;  1EFI D;  1I6H B;  1BOS A;  3MC0 B;  1YNJ D;  4QUF A;  3PUY A;  3QG1 A;  2ICE C;  4LAA A;  1SXT A;  4R8I A;  3M7G A;  3MAQ A;  2QCP X;  5ELF A;  4U68 A;  2I07 B;  2EXZ A;  2RBM A;  1MI2 A;  2NBF A;  1XWE A;  4FO2 A;  4KY7 A;  1PZJ D;  2F0O A;  1R4P B;  4IUT A;  1MD2 D;  2JA5 B;  1JC7 A;  2K04 A;  4C3J B;  3GP7 A;  1B3A A;  3KBX A;  1ET9 A;  3C1F A;  1G29 1;  2OXP A;  2J7Z A;  3DEP A;  4EVO A;  1XXG A;  1WTV A;  3BYT B;  1JWU D;  3IAY A;  3NBH A;  1ROD A;  2NTT A;  1CQF A;  1XTC D;  4MN3 A;  1D2B A;  2NN6 H;  4QF4 A;  5G3L F;  2DNC A;  4HR7 B;  2K5W A;  1H9M A;  1TY2 A;  3SR1 A;  2EVB A;  3GV3 A;  3QWN A;  1GUG A;  2B2Y C;  4FXK C;  5CMD A;  1F2M A;  1LLR D;  3GO5 A;  3TP5 A;  1WVL A;  2BDN A;  3L7Z C;  1HQM C;  1JE4 A;  2O4X A;  1ZEQ X;  3VYU A;  4DK0 A;  1EIG A;  4NKL A;  2F0V A;  5EBC A;  4L63 B;  1QWY A;  3MWY W;  5DM7 3;  1PTO C;  1IKL A;  2K03 A;  4RWS C;  2F0L A;  4CHT B;  2QIL A;  4HAE A;  2PPB C;  3QJY A;  2RSN A;  4KD3 A;  4K5V A;  3IL8 A;  3K5M A;  3HOU B;  4IFD I;  2HDM A;  3T51 B;  3HEJ A;  2ZXO A;  2K7V A;  3ND9 A;  1SBB B;  4DXF A;  1MGS A;  4C3H G;  2LKV A;  5A2Q L;  1VDZ A;  2D5D A;  5CV8 A;  2VB3 X;  2XVS A;  3TP8 A;  3C2P A;  5D14 A;  3HKZ B;  3LX0 A;  1JR0 D;  2HUG A;  2QF7 A;  5DM6 3;  5IT9 E;  3DEO A;  5KNB A;  4EQN A;  2NVQ B;  4N9P A;  1AEX A;  1PRT F;  1TWA B;  3GTP B;  4LMQ D;  3AMU A;  1ESF A;  2J4X A;  4K14 A;  1UNS A;  2BE5 D;  3I90 A;  2JA8 B;  5CBA E;  2L0C A;  1A15 A;  1GXD C;  1SNC A;  2PW7 A;  5HUR A;  2R93 B;  1KAA A;  2LS0 1;  2OF1 A;  3I4M B;  4A3D B;  3QO2 A;  3D8G A;  4CBV A;  2A6E C;  3J80 L;  3EQL C;  2WII B;  4K5X A;  1KTK A;  1YNN D;  4QMG A;  4PMB A;  4K5W A;  1WCM B;  1BBX C;  3S1R B;  4A3K B;  5M9O A;  3SDZ A;  5C44 B;  4IFD G;  2A74 C;  1V43 A;  3R2I A;  3HOW B;  5C4X B;  1VCI A;  5C4H A;  1B2T A;  1ONL A;  1TT2 A;  3C3L A;  3OPO A;  2Z1C A;  3PO2 B;  5FLX E;  2PCF B;  2DNE A;  4V0B A;  2I46 A;  4KY6 A;  1TS4 A;  2A6H D;  1D1I A;  2D2C C;  1LTR D;  1SNO A;  3HZX A;  3VR5 A;  5E4X A;  2XWJ B;  1SNQ A;  2B63 B;  5FO9 B;  5LL6 X;  3HRZ C;  5FK9 C;  2LMC B;  1S5C D;  3R2T A;  3MZ5 A;  5M5X B;  1ML0 D;  1MBY A;  2L9H A;  1Q12 A;  3EVQ A;  1ESR A;  4H7B A;  3PUX A;  4BA1 I;  4G7O C;  2PYK A;  3X3N A;  5M3F B;  2NVY B;  4A3F B;  3H0G B;  3BVZ A;  2IX3 A;  1ICW A;  2IL8 A;  4DK1 A;  2YYZ A;  4WRD A;  1STY A;  2F3W A;  1FGB D;  2QEJ C;  5CV6 A;  1SYF A;  4IUN A;  1Y8P B;  5D3I B;  1QJO A;  1RJT A;  1EYD A;  2MGS A;  3JAM E;  3LWU A;  5IIF A;  2A69 C;  4K8J A;  3HOV B;  1JOK A;  4F7X A;  3NWT A;  5C0X J;  1I3Q B;  3MXG A;  1HA5 A;  5D3D A;  4N9T A;  1HCZ A;  1EY4 A;  1Q1E A;  2B2W A;  3URY A;  1UEA B;  2AWO A;  5C3E B;  1WTO A;  1JQY D;  5IGD A;  4GZY C;  2ENB A;  3RUZ A;  3NTK A;  1A3T A;  1V1P A;  2F0D A;  4XQQ A;  3OOC A;  3Q6S A;  3S15 B;  4IFD H;  5I4D A;  3S14 B;  1JOR A;  1X32 A;  1WD1 A;  5K5P A;  1BNZ A;  3MXN A;  5FO8 B;  4Y7N B;  1C4Q A;  2RQX A;  3V2T A;  3TBI B;  1HPC A;  4CJ2 C;  4NMZ A;  1GUO A;  1GOZ A;  2H1E A;  4UAI A;  4G57 A;  5JEA J;  1FNV A;  3TDQ A;  1W6K A;  4J6H A;  3I4N B;  2X6G A;  2G9H D;  2WB1 B;  1STN A;  1ENA A;  3G6J B;  5I6Y A;  1JWS D;  1LAC A;  2MHV A;  1TY0 A;  3PUZ A;  2K6A A;  3VA5 A;  3R93 A;  3D3R A;  3SK4 A;  5C4J B;  3TSS A;  2KED A;  2LY7 A;  2KVM A;  3SK5 A;  2V4D A;  1PMR A;  2CQA A;  1Q90 A;  3VYT A;  1TKW B;  4HTH A;  4KKU A;  1QOH A;  4O1N A;  1D5M C;  2JA6 B;  4EGV A;  1T5E A;  1LAB A;  1K8M A;  1S5E D;  1RD9 D;  4FYD A;  1EYC A;  1S4Z A;  3E5S A;  2GA4 B;  5E4W C;  5EQ0 A;  2AQ2 B;  1DXM A;  2M00 A;  2JEA I;  3DWP A;  5J1Z A;  3R3O A;  1SYB A;  3BVM A;  2A6E D;  3J7Y W;  3I91 A;  2WP8 J;  1IYU A;  1VMC A;  3MXP A;  2B2T C;  2EY2 A;  4C3J G;  4KI0 A;  4HN7 A;  3ONA B;  3OMC A;  1M8A A;  4DN4 M;  1QG7 A;  1DZ1 A;  3VR2 A;  2F0T A;  5EPK A;  1EY6 A;  2IT1 A;  1OXU A;  2B2Y A;  1V1O A;  1QB5 D;  1CK1 A;  2VXW A;  4X3K A;  1T5X D;  5A2Q E;  3NBI A;  2H4O A;  5M5W B;  4M8A A;  4V19 0;  2ZT9 C;  1EQV A;  4KKS A;  4BY1 B;  3D6C A;  2K32 A;  1RCV D;  4ULL A;  5F2D A;  1EWH A;  2NUC A;  2DY7 A;  2EZV A;  4B9W A;  2MUY A;  3HOY B;  3H09 A;  4H44 C;  2FHT A;  3EFX D;  5EPJ A;  3UI2 A;  2VUM B;  4ZK9 B;  2B8G A;  1SJE D;  1LT4 D;  1H9S A;  5LL6 S;  4XQN A;  1PTO B;  2RA4 A;  2OT2 A;  3ND8 A;  5I2X A;  4S3S A;  4ZKB B;  1LT6 D;  4PNY A;  3BVG A;  1STH A;  4A93 B;  4FVM A;  1DD2 A;  4BA2 I;  2Z4H A;  3L9A X;  4KMU C;  2TSS A;  1HUM A;  3K0Y A;  1RTO A;  3J81 L;  2JYO A;  3GD7 A;  2EY6 A;  1Q3L A;  2PNR C;  2X6L A;  2IX1 A;  1A2T A;  4HMI A;  1FNU A;  3I3C A;  2XWB B;  4CKC A;  1SYC A;  4MIU A;  4G7H C;  4KY5 A;  2L12 A;  1EY7 A;  5FO7 B;  3WOF A;  2TMP A;  1SE2 A;  2A69 D;  4M1U B;  5K36 G;  4YIJ A;  4DAV A;  2EYH A;  3HG9 A;  1SDF A;  2K33 A;  3I4L A;  3W2D A;  1B50 A;  1BO0 A;  3L3O C;  3TZU A;  2JSO A;  3NWS A;  3HS0 C;  1SNP A;  2WV6 D;  4CKE A;  1EYA A;  5CYU A;  1GHJ A;  2K28 A;  3CHB D;  3IFD A;  1SMY C;  3I72 A;  3ERO A;  5IGE A;  1JOO A;  3KF8 A;  1ILP A;  1I4Q A;  2IWH A;  2B2V C;  3FPU B;  3FMC A;  2FFK B;  5JVH 3;  3GTK B;  3F2U A;  5KND A;  1Q8I A;  2EDG A;  2CW0 C;  1GHK A;  1F2L A;  1S5D D;  4DNT B;  1ET6 A;  2BDO A;  1FD7 D;  4C1N K;  4ABN A;  3S1N B;  1CHQ D;  3T16 A;  1D5Z C;  1PFB A;  2Q8I B;  2PMZ B;  5C3W A;  2F3V A;  1TU2 B;  2RKS A;  3NPP A;  3P7J A;  3I73 A;  1Z47 A;  2XRQ D;  4ZLT F;  1RF2 D;  2KEE A;  1HUN A;  4OO1 I;  4HCE A;  1SYD A;  2QDB A;  5HGT A;  1SEB D;  2HCI A;  5J22 A;  4HMJ A;  1G91 A;  1HFG A;  1NR2 A;  1PYW D;  4RH6 A;  4F87 A;  1EL0 A;  2D62 A;  4X3U A;  4P2C B;  1TWF B;  2EYF A;  5ELE A;  2KOL A;  3VR3 A;  4CGY B;  2KQ3 A;  3ITP A;  3H3V C;  5KEE A;  3PUW A;  4RAU C;  1U9R A;  3BZD B;  3T4A C;  4K8I A;  2DY8 A;  2NTS A;  3AU7 A;  4JBW A;  4BWG B;  1O7L A;  4H0L C;  1AFP A;  1KLU D;  3PIO 3;  1G6Z A;  1X3Q A;  4KK7 A;  2PZT A;  1Z6H A;  5M3M B;  2KUM A;  1TII D;  1EY5 A;  1WTR A;  2WIN B;  1JIC A;  1IL8 A;  4G4K A;  1E2V A;  5CV9 A;  3P75 A;  5K36 H;  5JVG 3;  3A8J E;  3HGB A;  4BS9 A;  4OO1 G;  2EOT A;  3HOX B;  1RKN A;  3AB9 A;  2IW3 A;  1SE3 A;  2HQE A;  3BDO A;  4PMW A;  3R8B A;  2AQ3 B;  1R9T B;  1I4R A;  3C1E A;  4C3I B;  1CA6 A;  1SNM A;  1DJR D;  3WOE A;  3J7A F;  3CRK C;  2O5I C;  2EJG C;  1CTM A;  2JP1 A;  3M85 A;  3H91 A;  1EEF D;  2CVR A;  3KLR A;  3K58 A;  5I9O A;  4IUQ A;  1TWG B;  3CRL C;  4HSP A;  4ODG A;  1LT3 D;  3RZD B;  1KAB A;  1TWC B;  2E75 C;  2C5C A;  1BDO A;  2A68 C;  5C0X I;  1QNK A;  1V8Q A;  4HED A;  3FPP A;  3M3Y B;  2E2H B;  3SXH A;  4DAY A;  1TQO A;  3DWQ A;  3NSW A;  2Z8L A;  3RZO B;  4OL7 A;  4RGT A;  1G2S A;  1Y69 U;  2E74 C;  1Y1V B;  1BF4 A;  4XXE A;  4ZYS A;  3C46 A;  2L1B A;  4ID6 A;  2XNA C;  4IZ8 A;  4C56 C;  2L11 A;  1PZK D;  1DOM A;  4C3H B;  4KHV A;  1U4L A;  1LTI D;  2MJ8 A;  3NK9 A;  3BDC A;  3U9O A;  4WJW A;  1STG A;  3NXW A;  3MTS A;  3V96 A;  3IFT A;  2B2T A;  2YU9 B;  2E2D C;  1HRJ A;  3GTJ B;  3P1H A;  1TS3 A;  5DNF A;  4B08 A;  2F0M A;  3K5L A;  5KYI A;  4ME5 A;  4MHE A;  3TP6 A;  1BCP B;  2ZXR A;  5C0X G;  4TKO B;  2B39 A;  1FNW A;  1B53 A;  3A8I E;  1SMY D;  4A3E B;  2EJF C;  1IHZ A;  5ELB A;  3M7N A;  2E2I B;  3NQI A;  3D4W A;  1O78 A;  3Q0A A;  1RDP D;  4ZUJ A;  1OXV A;  5C4Z A;  3G7L A;  1GUT A;  1Z7T A;  1ZYR C;  2BCO A;  4OO1 H;  2CW0 D;  1AN8 A;  3BG3 A;  4KN7 C;  5IOC A;  3GQB A;  1F9P A;  5IGF A;  5JPM C;  3LWE A;  3K5N A;  3GTG B;  2JA7 B;  1NCV A;  4QUC A;  4E6I A;  4BBS B;  5FKA C;  1HTP A;  5IOD A;  1EOT A;  2AUK A;  4RCN A;  2B2U C;  3O13 A;  1DOK A;  2C9O A;  1PTO D;  5JEA G;  4FF2 A;  3QIA A;  3P20 A;  4ZAI A;  4DAP A;  5CV5 A;  3GV6 A;  2WAC A;  2IPK D;  2WAQ B;  3V05 A;  1BQQ T;  4H13 C;  4RA8 A;  4OIK A;  4NP5 A;  2SNS A;  3KLS A;  1F9R A;  4K6L A;  5IGG A;  4XIG S;  1O80 A;  2AWN A;  3MHB A;  4ZRZ A;  3K57 A;  3NP8 A;  2F0S A;  2L5T A;  4L8J A;  1D6E C;  4K2K A;  1E2Z A;  4QIW B;  1O7Y A;  1BUV T;  4XT3 B;  1LTA D;  3S17 B;  2K5D A;  1EZ6 A;  1PXU A;  3SEB A;  1F2Z A;  1SAP A;  3GTO B;  3HP3 A;  5EKL A;  4NDX A;  1QCB D;  1SYE A;  5JOB A;  2RVL A;  3DHQ A;  3RLF A;  4KV6 A;  2RDG A;  4RHR A;  1DCZ A;  3NHH A;  3ERQ A;  3NE5 B;  4IQZ A;  3T56 B;  5JAV A;  1TR5 A;  2K5Q A;  1S5F D;  3OIQ A;  1C48 A;  1TVX A;  3WDN A;  4WFN 3;  2Y0S B;  1JOQ A;  3FKI B;  2R92 B;  3DXJ C;  2NWG A;  4ZQ3 A;  3M4Y A;  4R9W A;  5BN5 A;  3M4O B;  3FVQ A;  4Q5V A;  5I6W A;  2F0E A;  3OSO A;  1SYG A;  2BOS A;  1H9J A;  4A3I B;  3Q24 A;  4DGZ A;  3S2H B;  4DF7 A;  4IUV A;  1BCP C;  2B8F A;  5ELD A;  4X3T A;  5DEH A;  3OWF A;  3N52 A;  4KD4 A;  3E6Z X;  3Q23 A;  3RMH A;  5C3X A;  1U4R A;  3QOL A;  1EEI D;  5C0X H;  2B2V A;  4RFB A;  5T1G A;  1TWH B;  1QNU A;  4G7Z C;  2NZ1 D;  5A35 A;  3J7A V;  1JB3 A;  3K6O A;  5C6A A;  2R6G A;  1DON A;  1HHV A;  1PZI D;  1CQV A;  2F0H A;  1F9Q A;  2A68 D;  3IKJ A;  4OIJ A;  1PFN A;  4Z9C B;  4FF3 A;  1CM9 A;  2OEO A;  1K8O A;  4FF4 A;  2F0G A;  1HA6 A;  1AP0 A;  4DU9 A;  2RSO A;  2HDL A;  1SE4 A;  1K83 B;  1WTW A;  2R61 A;  1I4G A;  4A3J B;  1I50 B;  1F2Y A;  3J80 E;  5KRU A;  4XQJ A;  4DXG A;  1ZKO A;  2O2L D;  3H6M A;  3BDL A;  4TSS A;  1LV9 A;  3H94 A;  2XSC A;  3A56 A;  4X3S A;  3TME A;  4XT1 B;  1PRT B;  1SJH D;  1CT1 D;  2PO4 A;  4OGQ C;  1A6X A;  2NVX B;  1U4M A;  4O42 A;  3NTI A;  1C8C A;  1PTO H;  1F9S A;  3OHX C;  2KA7 A;  1Q1B A;  5FOB B;  3TZD A;  5BN3 A;  3GTM B;  1EIH A;  5C5L A;  3HOZ B;  2X69 A;  2SDF A;  3D4D A;  1U4P A;  2JXM B;  4J8Q A;  1Y8O B;  1WTX A;  4I7Z C;  1GUN A;  1QE6 A;  4F8M A;  5CBE E;  3K7A B;  4XYO A;  5J39 A;  1KNA A;  4ZUI A;  5AFW A;  2XRS D;  2VB2 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...