1UAPA

Nmr structure of the ntr domain from human pcolce1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
131
structure length
131
Chain Sequence
SPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREPGEGLAVTVSLIGAYKTGGLDLPSPPTGASLKFYVPCKQCPPMKKGVSYLLMGQVEENRGPVLPPESFVVLHRPNQDQILTNLSKRKCPSQPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Procollagen C-proteinase enhancer protein
publication title NMR Structure of the Netrin-like Domain (NTR) of Human Type I Procollagen C-Proteinase Enhancer Defines Structural Consensus of NTR Domains and Assesses Potential Proteinase Inhibitory Activity and Ligand Binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2003-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01759 NTR UNC-6/NTR/C345C module
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1uapA00
3CU7A 4FXGC 5FO8B 5JPMC 5JPNC 1UEAB 1XWEA 2I07B 2WIIB 4FXKC 5FOBB 3FRPB 3I70A 2B39A 2QKIC 2A74C 1D2BA 5FO9B 3HRZC 1BUVT 3HS0C 1JC7A 1BQQT 3T4AC 1GXDC 3CKIB 2E2DC 1OO9B 1JB3A 1PXUA 2WINB 2ICEC 1UAPA 1BR9A 2XWBB 3MA2B 2TMPA 3OHXC 5FO7B 4ILWA 2XWJB 3G6JB 2J0TD 3KLSA 2A73B 3V96A 3L3OC
chains in the Genus database with same CATH superfamily
1YNXA 3TREA 3PUYA 4X64Q 1HFNA 1KTKA 4OHJA 3UE0A 1KD1C 4CKBA 5CC4A 1EYAA 2Y0SE 4K0KL 4C1NK 3IFDA 1SYFA 1JMCA 4KY7A 3HS0C 1U4RA 2M2LA 4A3JG 2UXCL 1UE7A 5EKKA 1XX8A 4HSVA 4GLXA 2C35B 4O1NA 2OTLA 4BBRG 4G7OC 2UXBQ 2PQAB 1VMPA 1Z47A 1WCMH 5IYCG 4JW0A 2IWHA 3TZDA 4U673 4DV5Q 1X32A 1YBYA 2RVLA 5FOBB 3PO2B 3D4WA 2B29A 2EYLA 1RL2A 3TRZA 3NUCA 1O7ZA 3EVQA 4MIUA 1EFWA 2KUMA 1G6PA 4A3IH 1S40A 2HQEA 1XNRL 4FYDA 3E0JA 3PUWA 4K2LA 3T1YQ 4E6IA 1FD7D 1PZID 1NR4A 4WORA 3FMCA 3W1BA 5C44B 1WCMG 2DJGC 4PZ8A 4WFN3 1Q82C 1VQ5A 4A3FB 4KY5A 4XT1B 4XYQA 1GUWA 1KL9A 3A55A 3PF5A 5EAYA 1I6HB 2B2YC 4A3IG 4X62Q 4A3MB 3MEHA 2XVSA 1XNQQ 4NB3A 2DJFC 2L9HA 4AYBE 4DV0Q 2A6EC 4CJ1B 2R92H 1EEFD 1IL8A 1SJED 1WOCA 2PZWA 2JEBI 1YI2A 1OTCA 4HAEA 5JPNC 3TQYA 1PA6A 3D8GA 4X3TA 4H44C 1QE6A 1VMCA 2AQ2B 3L7ZC 3K58A 1NE3A 4IO9A 5D14A 2R7FA 3K0XA 4OWWB 4N9TA 1NCVA 1FR3A 1H9JA 4TSSA 2R92G 4GKKQ 2WFWA 3ER0A 3I7FA 4DV4L 1SYEA 2EQSA 5CORA 3RLNA 2F0MA 3PO2H 3DM1A 4HSPA 3MTSA 4MTNA 1PFSA 5CMDA 4LF6L 4MNOA 4LFCQ 2A68C 2V4DA 2VB2X 4GKJL 1CQVA 1X3PA 1ESRA 1JC7A 1ENAA 1ZYRD 3I90A 2CH4W 5J39A 4B3MQ 3HOUG 1CZWA 1D5MC 4DR5Q 2IJ0A 3CRLC 2F0WA 5C44H 1Y8NB 1D7QA 1HUNA 2MPMA 1PH2A 5D3DA 3IKJA 4IALA 4A3FH 4LF7L 1LTID 2F0EA 3A74A 3T1HQ 3L2PA 1AP0A 2NUCA 4RCNA 3R2IA 2TSSA 1K83B 3A5ZB 3BVGA 1I6HH 2Z8LA 4A3MH 4ZUIA 3I70A 2B39A 1VQKA 1MHWC 4IUNA 3NWSA 1X3GA 1H9SB 3JAMc 4NXML 4IZ8A 1RHPA 5IT9c 4DR1Q 1HJPA 2F52A 5C44G 4BXXH 2B63G 4WJ3M 2D62A 2PPBC 2KBNA 4RGNA 4X66Q 4AIMA 3D6CA 5M3MB 3I91A 2F0NA 2FINB 1K9MC 2XSCA 3R3OA 3CXCA 1KDAA 1TT2A 3FEWX 1MBYA 4A3MG 4GOPA 4RGMA 2KCNA 4K14A 3WOFA 5C3WA 1ASYA 2JEAI 2SOBA 2A8VA 2ZM6Q 2ZTEA 3EFXD 2XGTA 1ET6A 2KA7A 2IW3A 3DWAA 1C0AA 1EUJA 5M3FB 4CDDC 2IHEA 1VCIA 3VYSA 5KYIA 4JBJA 1SNQA 1I4GA 2B2WA 1PTOF 4JBWA 4K5VA 1WTXA 3GTJB 4ZRZA 3OIQA 1B9NA 1SMYC 3E6ZX 2K5VA 5C4HA 1ENFA 3OIPA 3TS2A 3PGZA 2DNCA 1G2SA 4RAUC 1DOMA 3S15H 2NVYB 2KVMA 1UAPA 4DV1Q 2L11A 1K3RA 2K50A 3KLSA 1LT4D 2QDBA 3HP3A 4A3KB 5CV9A 5E7NA 3SR1A 2MHVA 3DUZA 1STHA 4F87A 2PQAA 2ZTCA 4FP5D 1JORA 1HA6A 4QMGA 1VQAA 5M3MH 3MXPA 5C4XB 2Q8RE 4PZ6A 1LT5D 1LTAD 1NBWA 4QB4A 3FHWA 2XWBB 2SEBD 4N9PA 3DXJC 1SNDA 4DF7A 1XXGA 2B2TA 2DGYA 2WAQE 1KDCA 2KCMA 3I3CA 4R8IA 4BY1H 5IODA 1FL0A 5IYBH 5M3MG 1HRJA 1JWMD 3CKIB 1AE2A 1N9WA 2F4IA 4A3LH 1N33L 3KBGA 4Y7NB 4FF2A 1LT3D 2WB1E 1JWUD 4APVA 1VQ4A 1J9OA 3GTJH 3P1HA 3HOVB 4XXEA 3I2ZA 1BCPB 1EU4A 1SJHD 4B3TQ 4XQQA 1KRSA 4HJ8A 4DV5L 2ID0A 4JV5Q 1PVOA 4BY1G 4A93G 4IUVA 4HIKA 4KY6A 2Q2HA 1Q1BA 2E2HH 2JA8H 1SXTA 1K73C 1STNA 2VXWA 3STBD 3I4NB 4A3KH 1CA6A 2E76C 3T1YL 3EN2A 4J6HA 1VF7A 2FHTA 4ZK9B 3AFPA 4PV1C 3FKIB 4LF8Q 1YNJD 2ZXRA 1WD1A 5BN5A 1NJIC 2ZXPA 2A6HD 2LXKA 2JA8G 1LYLA 1E22A 2E75C 2KOLA 4X62L 4TRDA 3PIP3 1XNQL 4PMBA 1I5FA 2AQ3B 3U4ZA 4DK0A 1PH6A 2WB1B 2Z6KA 1JJGA 2J4XA 3KOJA 1IL2A 3S16B 1HQMC 1XPUA 4YCUA 3PO3B 3L0OA 1Y1WB 3P75A 5G3LD 3M4YA 4LWCA 1G91A 4IFDH 2A19A 4JOIA 3BDLA 5KNBA 3RN5A 1M4VA 3J7YW 3URYA 1S5FD 1B2TA 2UXCQ 3OTOQ 5COYA 2N49A 1A0IA 2AUKA 2D9UA 1NMGA 1TWFH 3KYHC 1IYJB 4DGZA 2F0JA 3MXNB 1H9SA 4YHHL 5A2QL 4LK1C 1HCZA 4K8JA 1L0YB 3BZDB 4IFDG 2EYFA 1MSHA 4HJ5A 1HNXQ 1B53A 3M3YB 3V05A 1QVFA 4LFCL 3S1RB 2Q2IA 2M9VA 3X3MA 4DV2Q 3I4NH 3VA5A 3K6OA 1S5BD 1T9HA 1U9RA 1HUMA 2DN8A 2LMCB 1J5EQ 4B3ML 2Z4HA 4DR5L 1A6XA 3K81C 1VQOA 2H4OA 1SBBB 4UDUC 2O5JC 3HOZB 3T1HL 1WVLA 1STGA 5T1GA 2C9OA 4F7XA 2CWAA 2DY8A 1BBUA 1N8RC 5C0XH 4JOIC 4LF5L 2FXQA 4IFDI 2PW5A 2R6GA 5FO9B 3M85A 3I4NG 4JC0A 1XMOQ 5C3EH 4OL7A 2AUJD 4GLAC 3S16H 2JJQA 2BDOA 3OHXC 4HR7B 4YCWA 5IP7H 1Y1WH 4X66L 2NTTA 1KLUD 2EJGC 1T5XD 4LFAL 1M90C 1S5DD 1R4PB 5KIXA 4QIWB 4C3IG 2HIVA 1BF4A 3NTHA 1KRTA 4B3SL 1FNUA 3A54A 2PO4A 1OXXK 1C4QA 5C0XG 1YHBA 1Q3LA 1X65A 2QDLA 2F03A 2OTJA 5C3EG 2AMCB 2XRSD 5ISRA 2MP1A 1EIFA 1PH7A 3SK5A 4RH6A 3CMEA 4DV4Q 4G7ZC 1FYCA 4ID6A 2E2IB 4IURA 2A69D 3RLOA 2QEXA 4R4TA 2E74C 1DYQA 3OWEB 3M3YH 4LF6Q 5HURA 2JA5B 4C2MB 1CZGA 2ZTDA 3HOWB 4C3JB 3F1ZA 1XTDA 1I3QB 3DEOA 3VA7A 2NVXB 3SDZA 5C0XI 4KKTA 3J80i 1CK1A 1DCZA 4NMZA 1RDPD 1S5CD 3CP0A 3HOZH 3GTGB 4DV1L 2UUBQ 2OWOA 1Q90A 1ICWA 3L3OC 4DUZL 2EYPA 5KRUA 2PYKA 1K8GA 2RBMA 3NENA 3NWTA 3I55A 5FLXL 1V43A 1LV9A 3H09A 2QGQA 4DR4L 1LTTD 1Q8KA 2VS1A 2VZAA 1JJCB 3A8IE 4OEMB 2P5ZX 5M5YB 3TZUA 5FKAC 3QOJA 1YVCA 4KJNA 5CGKA 1K8AC 2L12A 4EVOA 4UP7A 3HOZG 4L5RC 3HOXG 1RIPA 1AEXA 3J80E 4PMCA 2G5DA 5C6AA 4DR7Q 2FJ2A 4RMFA 2LY7A 3VR3A 5FO8B 3OW2A 5CBAE 2UUCQ 3BDCA 4BBRB 1LLRD 3VYUA 1PZJD 2HUGA 2XTIA 1TS2A 3DHQA 1KNAA 2R61A 4JBKA 3HRZC 1D6EC 3GDEA 1IYUA 3U58A 2E2IH 4JI6L 4X3KA 3MA2B 1J8IA 5KNDA 2K5WA 4DK6C 5DM63 4C2MH 2JA5H 3HOWH 4C3JH 5JVH3 1CUKA 1O7IA 3QOLA 1I3QH 5IE8A 2CVRA 2NVXH 1TS4A 4A3CG 3N52A 4B3RL 1PYSB 4B3TL 1WCMB 2BCOA 1H9KA 4P74A 5C5LA 2VB3X 4RCOA 4JV5L 1F9QA 3SK8A 3QO2A 2GVAA 1FNVA 1SYCA 5HY6A 3GTGH 3SE0A 2PZUA 1BCPC 1SE2A 5K36H 3NELA 1II3A 1IZ6A 3CHBD 4H13C 3S24A 3U9OA 1HNZQ 1EIGA 4L63B 1X56A 5FLXc 4C3JG 1QCBD 2YYZA 2EJMA 1S72A 3U4VA 1AN8A 1QNUA 5M5YH 3MXNA 1B3AA 2A6ED 5JVG3 4KTAA 3TP7A 1V1OA 4MN3A 5K36G 1BR9A 4HIDA 2K04A 4UHVA 5F2DA 3S2HB 3VR5A 4R8NA 2Q8IB 2K1BA 2R92B 4HIMA 1RTNA 2BOSA 4B08A 1Q1EA 5IYCH 4R4CA 5AJ3Q 3X3NA 3H15A 1Q12A 2L5TA 3CCSA 3MEFA 3PCOB 5LHY1 2B3GA 1NTGA 2Z0SA 3ULJA 1XYIA 1HNWQ 5DEHA 2N88A 3OTOL 2KHJA 1PYWD 2G9HD 1N33Q 3RMHA 1CSPA 3CPFA 2A68D 1R9TH 1EEID 3HOUB 3J81c 2D2CC 3J7A5 2ICIA 4PZ7A 3F2BA 4DN4M 1SNMA 2B8FA 4QQBX 3I56A 1HNXL 3H3VH 3GTKB 3LWUA 1GD7A 4HJAA 2I5HA 3DMUA 1STAA 1H95A 1GVPA 2QCPX 3UI2A 1QB5D 4DV2L 4A3DH 2R7DA 2K32A 5GROA 3DM3A 1RTOA 2PW7A 2N78A 4NXNL 1J5EL 2B2UA 3PMFA 1IKMA 4EGVA 2JQOA 2OF1A 2B63B 1XPRA 3GTMH 4JI2Q 3SK6A 2IY5B 1EQVA 1IXRA 2F0OA 3FRPB 1LUZA 3TS0A 1PFBA 1F2YA 5KEEA 5CV4A 5EKLA 2BE5C 3NQIA 1VQPA 1SNOA 3BS1A 1VQJA 4CJ2C 4A3DG 3MXUA 4JI1L 4HMIA 4R4QA 1TR5A 1XMOL 3S2HH 3PV0A 3I72A 3JAML 5IT9L 5DLQE 4B9XA 2JA6B 3RZDH 5H1SE 3H0GB 4NKLA 2CHBD 3U9SA 1WD0A 1JOQA 2IT1A 5GAHC 1JWSD 3NE5B 2CWPA 2EXZA 4OONA 4KJOA 2EE1A 3HGBA 3H3VI 1LTSD 1H9MA 1IKLA 3HOUH 2K28A 5DAUA 2QILA 2D5DA 4KV6A 5KGUA 2J7ZA 4YHHQ 2K33A 4HN7A 4AQYQ 3CU7A 3K0YA 4KHPQ 2CQOA 3W1GA 1SMYD 3HOYG 1EY9A 4OWTB 3CCRA 1B3QA 4B9WA 1LACA 3GTKH 2MUYA 5JJKA 1I6VC 1PFNA 1U4MA 1G51A 4NW2A 5CV6A 1SDFA 3FPPA 2KCCA 2EYMA 1F9SA 3KUPA 1PV4A 4DK1A 3CCLA 1PYBA 4KMUC 1GO3E 3C46A 1EOVA 3SHLA 1VQMA 1DOKA 2B63H 3TP5A 1E3PA 1WTRA 4CDFC 3LWEA 1JE4A 4K8IA 3S15B 2EJFC 1VQLA 1O80A 2UUBL 1ILPA 3WDNA 2BDNA 2JYOA 1HZAA 1QUQB 1KIXA 2VUMG 1HZBA 5E4WC 4LF5Q 1HH2P 1K8MA 5G3LF 1VQNA 2O2LD 3E9HA 3GTQB 3GTPB 1DM0B 3AU7A 4JI3L 1V1PB 3F8TA 3PUVA 3NK9A 4KK7A 1C9OA 4X3SA 2JA6H 3HKZB 1BKBA 2K4KA 3H0GH 4DK3C 1HTPA 4ALPA 1KC8C 2YU9B 4LFAQ 5HGQA 1TQOA 1F77A 3DWPA 3ICEA 4KN4C 3NHHA 1MI2A 1TY2A 2YTYA 1N36Q 1K8OA 4OIKA 4B3SQ 4YIJA 4DR7L 3S2DB 1YHAA 1Y1VB 4DNIA 1I4RA 5IIFA 1FJGL 2UUCL 4FF4A 1AFPA 1SN8A 2LFNA 2GN5A 4O0AA 1A3TA 1MJCA 4DAYB 4JI7Q 2JA6G 2JA7B 1T5EA 3H0GG 4BY1B 4KKSA 4A93B 1I4HA 4IQZA 4CBVA 2FFKB 3D6WA 2KEEA 4LUZA 1L2FA 2Y0SG 2A73B 2NZ1D 3CF5A 2C5CA 1N32Q 2Q2TA 2UXDL 4RGTA 5EGTA 2Q8TA 4BY7H 2F3WA 1PFMA 2K01A 1DXMA 2Q2UA 4WJ4A 4ODGA 4FF1A 5DNFA 3S14H 2EYHA 1F2LA 1VQGA 1CKNB 1GOZA 4PMWA 4WRDA 2ATWA 4P73A 2RDGA 3QG1A 2E2HB 5LMNW 2JA8B 4DUZQ 2F0GA 4HEDA 4BWGB 5IP9G 1B50A 1HNZL 2OQKA 4BY7G 4DR2Q 3GTQH 4DR4Q 3GTPH 1EY4A 5C3XA 4ME3A 4GOPC 4FO2A 3S1MH 1BUVT 1ICFB 5L37A 1E1OA 4BA1I 2F0HA 2YU9H 4CDCC 3AQQA 1P16A 5EPJA 4V190 1PRTC 1PTOB 5IGBA 3Q24A 1A2TA 3S2DH 4JCVE 4FXDA 1Y1VH 5LL6X 1HXYD 2NTSA 4KI0A 1D1IA 2E8GA 1QWYA 2SNMA 2ES2A 3R93A 2B2WC 3CCMA 1MGSA 3HKZG 1U0LA 2I5MX 1A63A 2JA7H 5AJ3L 3Q8DA 5C5MA 1CI3M 4A93H 3ZJYC 4HIOA 4JI6Q 2VL6A 1HNWL 1TWAB 5I6YA 2RKSA 3I73A 2IX3A 1Y1VG 3G6JB 3OOCA 1TWFB 4XTCS 2CKZB 1E0BA 1L0WA 4B3RQ 2A5HA 4ULLA 4G57A 5JJZA 1V8QA 2UUAQ 2JA7G 2F0FA 1TY0A 5JJLA 4QJFA 1I94L 1OXUA 1VDZA 4Z9CB 1JICA 4JK1C 2JP1A 2IPKD 2HT1A 1K3BC 1WI5A 2IX0A 1YZ6A 4LUVA 1IBMQ 1LO5D 3OWFA 2MQHA 1IBLQ 2MO0A 4J8QA 4C3HG 1WTQA 1AH9A 2DNEA 4JI2L 4K5XA 2B2TC 1UNSA 3A56A 4EQPA 1W6JA 4C3IB 1UE1A 1PLFA 4OX9Q 3OPOA 1PTOH 3TDQA 1SROA 2NZHA 1SFOH 1A2UA 1E2ZA 1VF5C 5C3EB 3V2TA 3EQLC 3UE1A 1UEAB 2PMZE 5A2QE 1G291 1ET9A 4UP9A 1V9PA 1TXYA 1E2VA 4TVAB 5I6WA 4OWXB 3E9IA 1TWAH 4N8FA 4JVZA 2CCZA 4M8AA 2E2DC 4JI8Q 1QUQA 5CR3A 5EBCA 4C56C 2VNUD 2ICEC 1VQIA 1SSOA 3GTOH 4N8X1 1EL0A 1MJEA 1B9MA 3SK4A 1I50B 1QVGA 2SDFA 2RHQB 1V1PA 4QIWE 2PQEA 4AQYL 3GV6A 3J81j 4KHPL 1CKOA 2M00A 1B8AA 1SEBD 1ZEQX 3P7JA 5I9OA 3A5UA 3ERQA 1FNWA 1JB7A 1AZPA 4P75A 2WKCA 2NB0A 1HZCA 1EY5A 2K5NA 3LNNA 1SYGA 2RSNA 4A76A 3R8BA 5ELNA 4DV6L 4MZ9A 1TS5A 2OCEA 3ZYYX 4DXGA 3PIOA 2VQEL 4NXNQ 3MWYW 5ELFA 3VYRA 1NNXA 3K57A 4DAYA 1PZKD 2YTXA 1YJ9A 1XMQQ 2Z6KC 5CV8A 4C3IH 5DM73 2HIXA 2PMZB 3HOXB 3NQTA 3K5LA 1D5ZC 1OXVA 2SNSA 3E3XA 4X6AH 2KJXA 5JEAH 1JT8A 2A74C 3G6EA 2LKVA 1F2ZA 4JI1Q 2BA0A 4JYAQ 1V1QA 3CC2A 2HCCA 4UAIA 4DU9A 1GUTA 3AB9A 4GLVB 3T51B 4GS3A 3UDFA 1CKNA 4I7AA 1K0RA 3ND9A 3FDTA 3UDIA 5IYDG 2XIWA 1N36L 2MJ8A 5JEAG 1AZQA 4FDBA 1DZ1A 3CW2C 3G7LA 1O7YA 1WTWA 3MC0B 2MGSA 1Z9FA 4DNRB 4DUYL 1W3SA 2F0LA 4KHZA 5FJ8H 2LXJA 1I50H 5EPLA 5IGDA 4JI7L 3L9AX 4EQ5A 5KYLA 2HDMA 2L55A 1HQRD 3LGJA 4GN4B 2WV6D 2WAQG 1GUOA 2LS01 1TWCH 5BR8Q 2JXMB 2K75A 1N32L 5ELOA 2EOTA 2QA4A 4K6DA 1YNNC 3T56B 1BCPD 2F4VQ 3VYTA 1VQ8A 3C1EA 5FJ8G 1XJVA 2O5IC 1Y8OB 4A3BG 3Q0AA 4DV3L 2MNAA 3CCUA 1VQDA 1BBWA 4CHTB 3K5MA 3EIVA 3HOXH 1EZ6A 3I4MG 4AH6A 2KCTA 3F2UA 3H6MA 2FMCA 5D65A 3PF4A 1GUSA 3KBXA 4H0LC 1BNZA 1EWHA 4ZAIA 1HZ9A 1Z6HA 2L15A 4DR2L 2K14A 2AWOA 1GM5A 2L1BA 4JI3Q 3IL8A 3E5SA 4DA2A 5BN4A 2NVTB 4UY8C 3ULPA 5JOBA 2Z4IA 3ULLA 2GA4B 2YTVA 1VQFA 1F9RA 4OXPA 3J7AF 4KD4A 1STYA 1F9PA 1ILQA 1B4OA 4EQOA 2R7ZG 1X3FA 3ND8A 1SE8A 2OQ0A 5J3BA 2XN9C 1FJGQ 2BA1A 2F0TA 1PTOC 4POFA 2K03A 4DNTB 3DLLA 2FMMA 3VR2A 4A3CH 3G48A 1ESFA 2QF7A 5M5WB 1EU3A 3NSWA 1SNCA 3U50C 1DJRD 3K80C 4KD3A 1EIHA 3CRKC 3EBEA 1H9RA 4PG3A 3RR5A 1CT1D 2K5QA 3S17H 4KKUA 5CBEE 4CGYB 2UXDQ 1IYVA 1HHVA 4ZUJA 4XT3B 3BU2A 5EBDA 4DR3Q 1RJTA 2X69A 3IRBA 3QWNA 3RNUA 2F0VA 1R9TB 1C8CA 4LNQA 3NEMA 3J81L 1L1OA 2ZT9C 5M5XB 2UUAL 2WP8J 1JR0D 1LM0A 3DWQA 1STBA 2Z1CA 2KEDA 1EQRA 1G8ZD 3K59A 3S1QB 4A3DB 3OYYA 5KNCA 2I5LX 2UU9Q 3BYYB 1IBML 3CC4A 5LMNL 1OXTA 2BE5D 2CW0C 3CC7A 1IBLL 1RKNA 1SR3A 2K52A 3PUXA 1GUGA 1SYDA 3GTMB 1EZ8A 2NVTH 1GJXA 3AEVA 1CA5A 2QEJC 1EY0A 4OX9L 4X3UA 2MFIA 2L4NA 1UE5A 3Q6SA 1NY4A 5C4JB 2K7VA 3K5NA 2ZJQA 4LF9Q 2EYJA 2RCNA 4YWLA 2KHIA 4HJ7A 2QW7A 2B8GA 3SGIA 3RZDB 5M5WH 1QZHA 3HOYB 2ZJPA 3BJUA 1F2MA 2F0DA 1TWGB 1FGBD 5HGTA 3M4OB 3BDOA 3FP9A 4JI8L 2XNAC 5E1FA 3TEHB 1NSNS 2K5HA 1DGSA 4IJHA 4XIGS 3MHBA 4U68A 1LTLA 4YWKA 3RLFA 4ZKBB 4ZCKA 1B70B 2ASBA 4L5TA 1X3QA 3KF6B 3SEBA 5M5XH 3GP7A 4UP8A 3J80c 2B2YA 1JJ2A 1I94Q 3PUZA 4QGUA 2E2JH 2XRQD 1TKWB 5K5PA 4A3EH 2VUMB 1YJWA 3S1QH 1KXLA 4JI4Q 4L5QA 1EY8A 1CTMA 4J1MA 3M7NA 1BXTA 1IW7C 4CJ0B 1OXSC 3A8KE 1Q8IA 4KN7C 3OMGA 4FXGC 2PI2E 3UDGA 1RF2D 3JAME 3CCEA 1KAAA 5IT9E 2ZJRA 4BBSB 3K7AB 1WFQA 1XMQL 2OEOA 1S3OA 1MKHA 2B2VA 4G4KA 1Y8PB 3QIAA 3CD6A 3KJOA 4A3EG 3SVMA 5C4JH 2F3VA 4DR6L 3H94A 4JYAL 5IGCA 4CKEA 1EWIA 3GD7A 5M9OA 4KHVA 3HOYH 1NUCA 5IGFA 3I4LA 4KLKA 1Q46A 1E2WA 2Y0SB 1KLGD 4JPBW 1FVIA 1PH9A 1Q7YC 3MZ5A 1TWGH 5I2XA 1A15A 3M4OH 3FVQA 3VR6A 4YY3L 1GUNA 1I4PA 3HKZE 1NAPA 1BDOA 2PNRC 1N34Q 5JJIA 4QUFA 4J15A 2B2UC 4EX5A 2EDGA 4P2CB 1WTPA 3A0JA 5BR8L 3W5OA 1VQ6A 3RN2A 1JOOA 1EQQA 2VUMH 2CQAA 4XDXA 3TSSA 2F4VL 4BY7B 2B2VC 5IGEA 4DV6Q 2CH4A 2VQFQ 1B44D 4QF4A 3IAYA 2VQEQ 4IUPA 1R4QB 1A62A 3S14B 1Y14B 2J0TD 4BBSH 1X55A 3D4DA 3K7AH 1SLJA 2NWGA 1U4LA 2EYOA 3K8AA 4LAAA 3HG9A 2YV5A 4QCLA 3J7AV 1IBKQ 1MD2D 4R1JA 4S3SA 1PH8A 2HHHL 5C4ZA 1Y69U 3M4QA 1KABA 1PRTD 1C48A 4CKCA 4DPGA 4O42A 5EJWA 1DOLA 2N55A 3T4AC 1SRUA 1WTOA 1KQSA 1QVCA 1WJJA 1X9NA 4AYBB 3S1MB 4QUCA 3HZXA 2A1AA 4BBSG 1YHQA 1MSGA 3PO2G 1ASZA 1EIYB 5IWAQ 4HMJA 1AE3A 5IOCA 4OO1H 1HR0L 1JQYD 2IL8A 4DKAC 1PHJA 4DUYQ 5GAEC 2L0CA 3EJIA 2EVBA 3OW7A 1CSQA 5ELBA 4LFBQ 3P20A 1DONA 3E0EA 5FK9C 2OXPA 3JC66 4A3FG 1J6QA 1ZXTA 2JN4A 2KHSA 4CDEC 1PDQA 3BVMA 1PH1A 4OO1G 2F1MA 5IP9H 2NVQB 3N6RA 1XWEA 1K28A 2K5DA 3OMCA 5EKIA 4DR3L 4IPCA 2BH8A 3NBHA 3TMEA 2H5XA 1VQ9A 3CPWA 4I7ZC 2O4XA 3A7LA 4L6TB 4LF4L 2VW9A 3OSOA 5TSSA 4C3HB 4BXXG 2F0IA 3HKSA 4WJWA 4DV3Q 1WYDA 3NTKA 2RSOA 2RHSB 1PH5A 2AWNA 5E4XA 2NBFA 1DD2A 3WOEA 2NN6H 4MHEA 2UU9L 1JOKA 4JG2A 2KECA 4Q5VA 3H3VC 4C1NI 3D3RA 1KNEA 2IHFA 3MFGA 2K05A 4OO1I 1EYCA 3C1FA 1Q86C 1E1TA 3M9BA 3TP8A 4EQNA 4UPAA 1HTLD 3KF6A 4RGOS 1ZYRC 5NUCA 4QY7A 3CMAA 1K83H 1SFOB 2PNHA 2NN6G 2RA4A 4LF9L 3A8JE 1SMXA 3HEJA 4RA8A 2HD3A 3R2TA 4X65L 3PIO3 2E5LQ 1I4QA 3CAMA 4H02A 4JI5Q 4AYBG 1U4PA 4PNYA 2MO1A 2WACA 1EYDA 1BCPF 1OO9B 3MAQA 3VDYA 1LT6D 3PSIA 1XPOA 2AQ1B 1QILA 2OT2A 2NVQH 2I46A 2PCFB 4V0BA 3V96A 2JE6I 4Y52H 2NYZD 1CQFA 3ITPA 4IJLA 3GTOB 5JPMC 4DV7Q 2ALYB 4X64L 5ELEA 4YCVA 4GZYC 3K7UC 4FXKC 2EZVA 1BBXC 4C3HH 1JE5A 2NN6I 4RKBA 4RKLA 4GN3B 1NMFA 3MFYA 3T16A 5M3FH 4DXFA 1HFGA 3BZKA 2R93B 3D4RA 1NR2A 4R4OA 4JI4L 3MXGA 1P8LA 3I4OA 2UXBL 4IOAA 1M8AA 5LMNQ 4JI0Q 1FGUA 4A3GB 2R3ZA 4R9WA 2RDFA 2F0PA 1EWCA 3PQIA 5LMUQ 5IYBG 1EY7A 2NVYH 2NZOA 3NXWA 2VY3A 3KLRA 3WWVA 2PI2A 5M3FG 4PQXA 4ZKCB 4A3LG 5CV5A 1PH3A 3KLWA 2CFMA 4DAMA 3KFUA 1VQEA 4M1UB 1GHKA 5IGGA 4I65A 2RQXA 2DUDA 2EXDA 1L1OB 5LL6S 2GVBA 2F0UA 4LJZC 4IPHA 4HJ9A 4LMQD 3Q22A 1UUPA 1QG7A 5D3IB 1PMRA 5ELDA 2WAQB 3GQBA 4GNXB 5C4XH 2AKWB 3A7AB 3K5OA 1EOTA 1UWVA 1D2BA 2Z9HA 1TWHB 3AMUA 1TIID 1RODA 1UE6A 4A3KG 5I2YA 1PXUA 4POGA 4DV0L 5FO7B 1ML0D 4IOCA 1HA5A 1N34L 5CV7A 1D1KA 1YNND 3HFZB 4A3BB 3CCVA 4P71A 4G7HC 4K0KQ 4TQUS 5C4XG 1XTCD 3KDFB 1TWCB 3RZOB 3I4MB 1M1KC 4RFBA 2R93H 4Y7NH 1X54A 2HCIA 2RDHA 5I9PA 5ELCA 4NDXA 1EYGA 3J7ZC 2EIFA 4F88A 2VQFL 4DAVA 1CFMA 1LTBD 3QB3A 2XWJB 3HOVH 4GKKL 4A3GH 1QZGA 1BVSA 4IUUA 1WTVA 3G4SA 1IHZA 3KF8B 3CQZB 4DAPA 2I07B 3KK7A 1G2TA 2ENBA 1L0XB 1IBKL 2JA9A 5IYDH 2EY1A 3TN2A 2R7ZB 2R93G 4OIJA 1EFID 1KHIA 3DEPA 5FLMH 1YIJA 1XNRQ 1BQQT 3TP6A 5GAGC 3FPUB 1JB3A 4RHRA 4K6LA 4DR6Q 3EA6A 3HOVG 3FKIH 4A3GG 4RG1A 4ZQ3A 4LUOA 4Q0FA 1PTOD 1HR0W 1LABA 2V1CC 2LSSA 3STBC 1SNPA 5IWAL 2N3SA 4YWMA 1TWHH 5FLMG 1MIUA 1D8LA 4YY3Q 1YNJC 4O2DA 4DR1L 2EPBA 1TS3A 2KENA 1EQTA 2KQ3A 4HCEA 4LFBL 1JCKB 3FKIG 3TBIB 2A6HC 4A75A 4A3BH 3CCQA 1QJOA 2HDLA 2HQLA 3PO3H 1TVXA 1LTGD 5GADC 1B1ZA 5J22A 5I4DA 4H7BA 4BA2I 1SYBA 2D0OA 3NBIA 3I4MH 3RZOH 1STEA 4IPGA 3BYTB 1K0SA 1O78A 1B7YB 3S17B 2BH2A 3T13A 1U5KA 4MTKA 2F0KA 5FLXE 3ERSX 5GQOA 2RF4A 2WB1G 4K5WA 5IY0A 2ZM6L 4JBMA 2Z6BA 1CKMA 2X6LA 4HTHA 1BO0A 5E3FA 5IP7G 2F0QA 4ZLTF 1Y1WG 3PO3G 2TMPA 5AFWA 1VQHA 5A35A 2CW0D 1SAPA 2I0QA 3CQZH 4RWSC 4XYOA 1X3EA 2AHOB 2R7ZH 4DFAA 3GV3A 3S1RH 2JK8A 1W2BA 2HHHQ 4RHSA 2WIIB 1X6OA 4IUQA 1VS0A 4GKJQ 3PIPA 2WKDA 1QNKA 2QKIC 3QJYA 3J81i 4IN3A 4IPDA 1S4ZA 2D0PA 1SE3A 5BN3A 3M7GA 3W3AA 5EQ0A 1SE4A 4TKOB 2WINB 3UDXA 4HCSA 1KDBA 3ONAB 2G9DA 4LF7Q 1A3UA 4NPSA 3D31A 1EY6A 1LTRD 1C7YA 1E7ZA 1Q81C 1HR0Q 3BVZA 3NP8A 4P72A 4IFDJ 1HPCA 4NXMQ 1YJNA 3NPPA 3Q23A 2E5LL 1TU2B 4JI5L 4FNFA 2N8NA 1A3VA 4L5SA 3QR8A 3J81E 4OGQC 4K2KA 3KLSX 2F3IA 1CM9A 5EPKA 1QOHA 3O13A 3F2CA 3S1NB 1VQCA 3SXHA 1VQ7A 4A3JB 3GTLB 2JSOA 1GHJA 1CHPD 4ZYSA 3I8ZA 4XQNA 4F8MA 1S5ED 4DV7L 2EY2A 1G6ZA 3G71A 2X6GA 3RUZA 3T53B 4LF4Q 4ME5A 1IW7D 3MVVA 4ABNA 4NP5A 1PRTF 1E24A 1WTHA 3J80L 1W6KA 3F2DA 4L8JA 4GNXA 1AW7A 1KAWA 3H91A 2E2JB 1I4XA 3RD4A 4A3EB 2ZXOA 4OELB 2F0SA 3S9WA 4XQJA 4FF3A 1O7LA 1ENCA 2IX1A 4JI0L 1GKHA 2A69C 5JEAJ 5C0XJ 4QL5A 3VR4A 2H1EA 3M4PA 5LMUL 2RCFA 3AFQA 1UEBA 1VQBA 3W2DA 4A4IA 4FVMA 4LW1A 1RD9D 2DY7A 3KDFA 2JA5G 3BZCA 4GOPB 4A3IB 1PH4A 3B6YA 3HOWG 5CYUA 1CHQD 1Z7TA 3NBHB 2EY5A 2EY6A 3C3LA 2PZTA 4IUTA 4GN5A 1PRTB 5J1ZA 4X65Q 4LF8L 3C2PA 5JAVA 1ONLA 1A8VA 1D5XC 3AYHB 3EROA 3GO5A 4BS9A 3IFTA 1BOSA 1L1OC 1RCVD 3S1NH 1GXDC 3KF8A 3CCJA 4A3JH 3LX0A 1YEZA 3GTLH 4R4IA 3BG3A 4ILWA 3KJPA 4GNXC 1ZKOA 1YITA 5T1IA 2K6AA 3NTIA 3D0FA 3JAMi 4BBRH
chains in the Genus database with same CATH topology
3PUYA 1HFNA 1KTKA 4OHJA 4CKBA 5CC4A 1EYAA 4C1NK 3IFDA 1SYFA 4KY7A 3HS0C 1U4RA 2M2LA 5EKKA 1XX8A 4HSVA 4O1NA 4G7OC 1VMPA 1Z47A 3TZDA 2IWHA 4U673 1X32A 2RVLA 5FOBB 3PO2B 3D4WA 2EYLA 3NUCA 1O7ZA 3EVQA 4MIUA 2KUMA 2HQEA 4FYDA 3E0JA 3PUWA 4K2LA 4E6IA 1FD7D 1PZID 1NR4A 4WORA 3FMCA 5C44B 4WFN3 4A3FB 4KY5A 4XT1B 4XYQA 1GUWA 3A55A 1I6HB 2B2YC 4A3MB 3MEHA 2XVSA 2L9HA 2A6EC 4CJ1B 1EEFD 1IL8A 1SJED 2PZWA 2JEBI 4HAEA 5JPNC 3D8GA 4X3TA 4H44C 1QE6A 1VMCA 2AQ2B 3L7ZC 3K58A 5D14A 4N9TA 1NCVA 1FR3A 1H9JA 4TSSA 1SYEA 5CORA 2F0MA 3DM1A 4HSPA 3MTSA 5CMDA 2A68C 2V4DA 2VB2X 1CQVA 1X3PA 1ESRA 1JC7A 1ENAA 1ZYRD 3I90A 5J39A 1CZWA 1D5MC 2IJ0A 3CRLC 2F0WA 1Y8NB 1HUNA 2MPMA 5D3DA 3IKJA 4IALA 1LTID 2F0EA 1AP0A 2NUCA 4RCNA 3R2IA 2TSSA 1K83B 3BVGA 2Z8LA 4ZUIA 3I70A 2B39A 4IUNA 3NWSA 1H9SB 4IZ8A 1RHPA 2D62A 2PPBC 4RGNA 3D6CA 5M3MB 3I91A 2F0NA 2FINB 2XSCA 3R3OA 1KDAA 1TT2A 3FEWX 1MBYA 4RGMA 2KCNA 4K14A 3WOFA 5C3WA 2JEAI 2SOBA 3EFXD 1ET6A 2KA7A 2IW3A 3DWAA 5M3FB 1VCIA 3VYSA 5KYIA 1SNQA 1I4GA 2B2WA 1PTOF 4JBWA 4K5VA 1WTXA 3GTJB 4ZRZA 3OIQA 1B9NA 1SMYC 3E6ZX 5C4HA 1ENFA 3OIPA 2DNCA 1G2SA 4RAUC 1DOMA 2NVYB 2KVMA 1UAPA 2L11A 3KLSA 1LT4D 2QDBA 3HP3A 4A3KB 5CV9A 3SR1A 2MHVA 3DUZA 1STHA 4F87A 4FP5D 1JORA 1HA6A 4QMGA 5C4XB 3MXPA 2Q8RE 1LT5D 1LTAD 4QB4A 2XWBB 2SEBD 4N9PA 3DXJC 1SNDA 4DF7A 1XXGA 2B2TA 1KDCA 3I3CA 4R8IA 5IODA 1HRJA 1JWMD 3CKIB 2F4IA 3KBGA 4Y7NB 4FF2A 1LT3D 1JWUD 1J9OA 3P1HA 3HOVB 4XXEA 1BCPB 1EU4A 1SJHD 4XQQA 2ID0A 4IUVA 4KY6A 1Q1BA 1SXTA 1STNA 2VXWA 3I4NB 1CA6A 2E76C 4J6HA 1VF7A 2FHTA 4ZK9B 4PV1C 3FKIB 1YNJD 2ZXRA 1WD1A 5BN5A 2ZXPA 2A6HD 2E75C 2KOLA 4TRDA 3PIP3 4PMBA 2AQ3B 4DK0A 2WB1B 2J4XA 3S16B 1HQMC 3PO3B 1Y1WB 3P75A 5G3LD 3M4YA 1G91A 4IFDH 3BDLA 5KNBA 1M4VA 3J7YW 3URYA 1S5FD 1B2TA 5COYA 2AUKA 2D9UA 4DGZA 2F0JA 1H9SA 5A2QL 4LK1C 1HCZA 4K8JA 1L0YB 3BZDB 4IFDG 2EYFA 1MSHA 1B53A 3M3YB 3V05A 3S1RB 2M9VA 3X3MA 3VA5A 3K6OA 1S5BD 1U9RA 1HUMA 2DN8A 2LMCB 2Z4HA 1A6XA 2H4OA 1SBBB 4UDUC 2O5JC 3HOZB 1WVLA 1STGA 5T1GA 2C9OA 4F7XA 2DY8A 5C0XH 4IFDI 2PW5A 2R6GA 5FO9B 3M85A 4OL7A 2AUJD 2BDOA 3OHXC 4HR7B 2NTTA 1KLUD 2EJGC 1T5XD 1S5DD 5KIXA 1R4PB 4QIWB 4C3IG 1BF4A 3NTHA 1FNUA 3A54A 2PO4A 1OXXK 1C4QA 5C0XG 1Q3LA 2F03A 2XRSD 5ISRA 2MP1A 3SK5A 4RH6A 4G7ZC 1FYCA 4ID6A 2E2IB 4IURA 2A69D 2E74C 1DYQA 3OWEB 5HURA 2JA5B 4C2MB 1CZGA 3HOWB 4C3JB 1I3QB 3DEOA 3VA7A 2NVXB 3SDZA 5C0XI 4KKTA 1CK1A 1DCZA 4NMZA 1RDPD 1S5CD 3GTGB 1Q90A 1ICWA 3L3OC 2EYPA 5KRUA 2PYKA 2RBMA 3NWTA 5FLXL 1V43A 1LV9A 3H09A 1LTTD 3A8IE 5M5YB 3TZUA 5FKAC 3QOJA 4KJNA 5CGKA 2L12A 4EVOA 1AEXA 3J80E 4PMCA 5C6AA 2FJ2A 5FO8B 2LY7A 3VR3A 5CBAE 3BDCA 4BBRB 1LLRD 3VYUA 1PZJD 2HUGA 1TS2A 3DHQA 1KNAA 2R61A 3HRZC 1D6EC 1IYUA 4X3KA 3MA2B 1J8IA 5KNDA 2K5WA 5DM63 5JVH3 3QOLA 2CVRA 1TS4A 3N52A 1WCMB 2BCOA 1H9KA 5C5LA 2VB3X 4RCOA 1F9QA 3SK8A 3QO2A 1FNVA 1SYCA 3SE0A 2PZUA 1BCPC 1SE2A 5K36H 1II3A 3CHBD 4H13C 3U9OA 1EIGA 4L63B 4C3JG 1QCBD 2YYZA 2EJMA 1AN8A 1QNUA 3MXNA 1B3AA 2A6ED 5JVG3 4KTAA 3TP7A 1V1OA 4MN3A 5K36G 1BR9A 2K04A 5F2DA 3S2HB 3VR5A 4R8NA 2Q8IB 2K1BA 2R92B 1RTNA 2BOSA 4B08A 1Q1EA 3X3NA 1Q12A 2L5TA 5LHY1 1XYIA 5DEHA 2N88A 1PYWD 2G9HD 3RMHA 2A68D 1EEID 3HOUB 2D2CC 2ICIA 4DN4M 1SNMA 2B8FA 3GTKB 3LWUA 3DMUA 1STAA 2QCPX 3UI2A 1QB5D 2K32A 1RTOA 2PW7A 2B2UA 3PMFA 1IKMA 4EGVA 2OF1A 2B63B 3SK6A 1EQVA 2F0OA 3FRPB 1PFBA 1F2YA 5KEEA 5CV4A 5EKLA 2BE5C 3NQIA 1SNOA 3BS1A 4CJ2C 3MXUA 4HMIA 1TR5A 3PV0A 3I72A 3JAML 5IT9L 4B9XA 2JA6B 3H0GB 4NKLA 2CHBD 3U9SA 1WD0A 1JOQA 2IT1A 1JWSD 3NE5B 2EXZA 4KJOA 2EE1A 3HGBA 1LTSD 1H9MA 1IKLA 2K28A 5DAUA 2QILA 2D5DA 4KV6A 5KGUA 2J7ZA 2K33A 4HN7A 3CU7A 3K0YA 1SMYD 1EY9A 4B9WA 1LACA 2MUYA 1I6VC 1PFNA 1U4MA 4NW2A 5CV6A 1SDFA 3FPPA 2KCCA 2EYMA 1F9SA 3KUPA 4DK1A 4KMUC 3C46A 3SHLA 1DOKA 3TP5A 1WTRA 3LWEA 1JE4A 4K8IA 3S15B 2EJFC 1O80A 1ILPA 3WDNA 2BDNA 2JYOA 5E4WC 1K8MA 5G3LF 2O2LD 3GTQB 3GTPB 1DM0B 3AU7A 1V1PB 3PUVA 3NK9A 4KK7A 4X3SA 3HKZB 1HTPA 2YU9B 1TQOA 1F77A 3DWPA 4KN4C 3NHHA 1MI2A 1TY2A 1K8OA 4OIKA 3S2DB 4YIJA 1Y1VB 1I4RA 5IIFA 4FF4A 1AFPA 2LFNA 1A3TA 2JA7B 1T5EA 4BY1B 4KKSA 4A93B 1I4HA 4IQZA 4CBVA 2FFKB 2KEEA 3D6WA 2A73B 2NZ1D 2C5CA 4RGTA 5EGTA 2Q8TA 2F3WA 1PFMA 2K01A 1DXMA 4ODGA 4FF1A 5DNFA 2EYHA 1F2LA 1GOZA 4PMWA 4WRDA 2RDGA 3QG1A 2E2HB 2JA8B 2F0GA 4HEDA 4BWGB 1B50A 1EY4A 5C3XA 4FO2A 1BUVT 4BA1I 2F0HA 5EPJA 4V190 1PRTC 1PTOB 5IGBA 3Q24A 1A2TA 4FXDA 5LL6X 1HXYD 2NTSA 4KI0A 1D1IA 1QWYA 2SNMA 3R93A 2B2WC 1MGSA 5C5MA 1CI3M 1TWAB 5I6YA 2RKSA 3I73A 2IX3A 3G6JB 3OOCA 1TWFB 4XTCS 1E0BA 2A5HA 4ULLA 4G57A 5JJZA 1V8QA 2F0FA 1TY0A 1OXUA 1VDZA 4Z9CB 1JICA 4JK1C 2JP1A 2IPKD 2IX0A 1LO5D 3OWFA 4J8QA 4C3HG 1WTQA 2DNEA 4K5XA 2B2TC 1UNSA 3A56A 4EQPA 1W6JA 4C3IB 1PLFA 3OPOA 1PTOH 3TDQA 1A2UA 1E2ZA 1VF5C 5C3EB 3V2TA 3EQLC 1UEAB 5A2QE 1G291 1ET9A 1E2VA 5I6WA 4M8AA 2E2DC 5CR3A 5EBCA 4C56C 2VNUD 2ICEC 1SSOA 1EL0A 1B9MA 3SK4A 1I50B 2SDFA 1V1PA 2PQEA 3GV6A 2M00A 1SEBD 1ZEQX 3P7JA 5I9OA 3ERQA 1FNWA 1AZPA 2WKCA 2NB0A 1EY5A 3LNNA 1SYGA 2RSNA 3R8BA 1TS5A 3ZYYX 4DXGA 3MWYW 5ELFA 3VYRA 3K57A 4DAYA 1PZKD 5CV8A 5DM73 2PMZB 3HOXB 3NQTA 3K5LA 1D5ZC 1OXVA 2SNSA 2KJXA 5JEAH 2A74C 2LKVA 1F2ZA 2BA0A 2HCCA 4UAIA 4DU9A 1GUTA 3AB9A 3T51B 3ND9A 3FDTA 2XIWA 2MJ8A 5JEAG 1AZQA 1DZ1A 3G7LA 1O7YA 1WTWA 3MC0B 2MGSA 4DNRB 2F0LA 4KHZA 5IGDA 5EPLA 3L9AX 5KYLA 2HDMA 2L55A 1HQRD 2WV6D 1GUOA 2LS01 2JXMB 2EOTA 4K6DA 1YNNC 3T56B 1BCPD 3VYTA 3C1EA 2O5IC 1Y8OB 3Q0AA 4CHTB 3K5MA 1EZ6A 3F2UA 3H6MA 2FMCA 5D65A 1GUSA 3KBXA 4H0LC 1BNZA 1EWHA 4ZAIA 1Z6HA 2AWOA 2L1BA 3IL8A 3E5SA 4DA2A 5BN4A 2NVTB 5JOBA 2Z4IA 2GA4B 1F9RA 3J7AF 4KD4A 1STYA 1F9PA 1ILQA 1B4OA 4EQOA 3ND8A 2XN9C 2BA1A 2F0TA 1PTOC 2K03A 4DNTB 2FMMA 3VR2A 1ESFA 2QF7A 5M5WB 1EU3A 3NSWA 1SNCA 1EIHA 1DJRD 4KD3A 3CRKC 1H9RA 1CT1D 2K5QA 1IYVA 4KKUA 5CBEE 4CGYB 1HHVA 4ZUJA 4XT3B 5EBDA 1RJTA 2X69A 3QWNA 1R9TB 2F0VA 1C8CA 3J81L 2ZT9C 5M5XB 2WP8J 1JR0D 3DWQA 1STBA 2Z1CA 2KEDA 1G8ZD 3K59A 3S1QB 4A3DB 5KNCA 3BYYB 1OXTA 2BE5D 2CW0C 1RKNA 3PUXA 1GUGA 1SYDA 3GTMB 1EZ8A 1GJXA 1CA5A 2QEJC 1EY0A 4X3UA 2L4NA 3Q6SA 5C4JB 2K7VA 3K5NA 2EYJA 2B8GA 3RZDB 3HOYB 1F2MA 2F0DA 1TWGB 1FGBD 5HGTA 3M4OB 3BDOA 2XNAC 5E1FA 1NSNS 4XIGS 3MHBA 4U68A 3RLFA 4ZKBB 3SEBA 1X3QA 3GP7A 2B2YA 3PUZA 2XRQD 1TKWB 5K5PA 2VUMB 1EY8A 1CTMA 4J1MA 3M7NA 1BXTA 1IW7C 4CJ0B 1OXSC 3A8KE 1Q8IA 4KN7C 3OMGA 4FXGC 1RF2D 3JAME 1KAAA 5IT9E 4BBSB 3K7AB 2OEOA 2B2VA 4G4KA 1Y8PB 3QIAA 3SVMA 2F3VA 3H94A 5IGCA 4CKEA 3GD7A 5M9OA 4KHVA 1NUCA 5IGFA 3I4LA 1E2WA 2Y0SB 1KLGD 3MZ5A 5I2XA 1A15A 3FVQA 3VR6A 1GUNA 1I4PA 1NAPA 1BDOA 2PNRC 4QUFA 2B2UC 2EDGA 4P2CB 1WTPA 1JOOA 2CQAA 4XDXA 3TSSA 4BY7B 2B2VC 5IGEA 1B44D 4QF4A 3IAYA 4IUPA 1R4QB 3S14B 2J0TD 3D4DA 2NWGA 1U4LA 2EYOA 4LAAA 3HG9A 4QCLA 3J7AV 1MD2D 4S3SA 5C4ZA 1Y69U 1KABA 1PRTD 1C48A 4CKCA 4O42A 5EJWA 1DOLA 2N55A 3T4AC 1WTOA 4AYBB 3S1MB 4QUCA 3HZXA 1MSGA 4HMJA 5IOCA 4OO1H 1JQYD 2IL8A 2L0CA 3EJIA 2EVBA 3OW7A 5ELBA 3P20A 1DONA 5FK9C 2OXPA 1ZXTA 2KHSA 1PDQA 3BVMA 4OO1G 2F1MA 2NVQB 3N6RA 1XWEA 2K5DA 3OMCA 5EKIA 3NBHA 3TMEA 4I7ZC 2O4XA 3A7LA 4L6TB 3OSOA 5TSSA 4C3HB 2F0IA 4WJWA 3NTKA 2RSOA 2AWNA 5E4XA 2NBFA 1DD2A 3WOEA 2NN6H 4MHEA 1JOKA 2KECA 4Q5VA 3H3VC 4C1NI 3D3RA 1KNEA 3MFGA 2K05A 4OO1I 1EYCA 3C1FA 3TP8A 4EQNA 1HTLD 4RGOS 1ZYRC 5NUCA 1SFOB 2NN6G 2RA4A 3A8JE 3HEJA 4RA8A 3R2TA 3PIO3 1I4QA 1U4PA 4PNYA 2WACA 1EYDA 1BCPF 1OO9B 3MAQA 1LT6D 2AQ1B 1QILA 2OT2A 2I46A 2PCFB 4V0BA 3V96A 2JE6I 2NYZD 1CQFA 3ITPA 3GTOB 5JPMC 5ELEA 4GZYC 4FXKC 2EZVA 1BBXC 2NN6I 4RKBA 4RKLA 3MFYA 3T16A 4DXFA 1HFGA 2R93B 3D4RA 1NR2A 3MXGA 1M8AA 4A3GB 2R3ZA 4R9WA 2RDFA 2F0PA 1EWCA 1EY7A 3NXWA 3KLRA 4PQXA 4ZKCB 5CV5A 4M1UB 1GHKA 5IGGA 4I65A 2RQXA 5LL6S 2F0UA 4LJZC 4LMQD 3Q22A 1UUPA 1QG7A 5D3IB 1PMRA 5ELDA 2WAQB 3GQBA 3A7AB 3K5OA 1EOTA 1D2BA 3AMUA 1TWHB 1TIID 1RODA 5I2YA 1PXUA 5FO7B 1ML0D 1HA5A 5CV7A 1D1KA 1YNND 4A3BB 4G7HC 4TQUS 1XTCD 1TWCB 3RZOB 3I4MB 4RFBA 2HCIA 2RDHA 5I9PA 5ELCA 4NDXA 4F88A 4DAVA 1CFMA 1LTBD 3QB3A 2XWJB 4IUUA 1WTVA 4DAPA 1IHZA 3CQZB 2I07B 3KK7A 1G2TA 2ENBA 1L0XB 2EY1A 3TN2A 2R7ZB 4OIJA 1EFID 3DEPA 1BQQT 3TP6A 3FPUB 1JB3A 4RHRA 4K6LA 3EA6A 4ZQ3A 4Q0FA 1PTOD 1LABA 1SNPA 1YNJC 2EPBA 1TS3A 2KQ3A 1EQTA 4HCEA 1JCKB 3TBIB 2A6HC 1QJOA 2HDLA 1TVXA 1LTGD 1B1ZA 5J22A 5I4DA 4H7BA 4BA2I 1SYBA 3NBIA 1STEA 3BYTB 1O78A 3S17B 3T13A 2F0KA 5FLXE 4K5WA 2X6LA 4HTHA 5E3FA 1BO0A 2F0QA 4ZLTF 2TMPA 5AFWA 5A35A 2CW0D 1SAPA 4RWSC 4XYOA 4DFAA 3GV3A 4RHSA 2WIIB 4IUQA 2WKDA 1QNKA 2QKIC 3QJYA 4IN3A 1S4ZA 1SE3A 5BN3A 3M7GA 3W3AA 5EQ0A 1SE4A 4TKOB 2WINB 4HCSA 1KDBA 2G9DA 3ONAB 1A3UA 3D31A 1EY6A 1LTRD 3BVZA 3NP8A 4IFDJ 1HPCA 3NPPA 3Q23A 1TU2B 4FNFA 1A3VA 3J81E 4OGQC 4K2KA 3KLSX 1CM9A 5EPKA 1QOHA 3O13A 3S1NB 3SXHA 4A3JB 3GTLB 2JSOA 1GHJA 1CHPD 4ZYSA 3I8ZA 4XQNA 4F8MA 1S5ED 2EY2A 1G6ZA 2X6GA 3RUZA 3T53B 4ME5A 1IW7D 3MVVA 4ABNA 4NP5A 1PRTF 3J80L 1W6KA 4L8JA 1AW7A 3H91A 2E2JB 1I4XA 3RD4A 4A3EB 2ZXOA 4FF3A 2F0SA 3S9WA 4XQJA 1O7LA 1ENCA 2IX1A 2A69C 5JEAJ 5C0XJ 3VR4A 2H1EA 3W2DA 4FVMA 1RD9D 2DY7A 4A3IB 5CYUA 1CHQD 1Z7TA 2EY5A 2EY6A 3C3LA 2PZTA 4IUTA 1PRTB 5J1ZA 3C2PA 5JAVA 1ONLA 1D5XC 3EROA 3GO5A 4BS9A 3IFTA 1BOSA 1RCVD 1GXDC 3KF8A 3LX0A 3BG3A 4ILWA 1ZKOA 5T1IA 2K6AA 3NTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CU7 A;  4FXG C;  5FO8 B;  5JPM C;  5JPN C;  1UEA B;  1XWE A;  2I07 B;  2WII B;  4FXK C;  5FOB B;  3FRP B;  3I70 A;  2B39 A;  2QKI C;  2A74 C;  1D2B A;  5FO9 B;  3HRZ C;  1BUV T;  3HS0 C;  1JC7 A;  1BQQ T;  3T4A C;  1GXD C;  3CKI B;  2E2D C;  1OO9 B;  1JB3 A;  1PXU A;  2WIN B;  2ICE C;  1UAP A;  1BR9 A;  2XWB B;  3MA2 B;  2TMP A;  3OHX C;  5FO7 B;  4ILW A;  2XWJ B;  3G6J B;  2J0T D;  3KLS A;  2A73 B;  3V96 A;  3L3O C; 
#chains in the Genus database with same CATH topology
 1YNX A;  3TRE A;  3PUY A;  4X64 Q;  1HFN A;  1KTK A;  4OHJ A;  3UE0 A;  1KD1 C;  4CKB A;  5CC4 A;  1EYA A;  2Y0S E;  4K0K L;  4C1N K;  3IFD A;  1SYF A;  1JMC A;  4KY7 A;  3HS0 C;  1U4R A;  2M2L A;  4A3J G;  2UXC L;  1UE7 A;  5EKK A;  1XX8 A;  4HSV A;  4GLX A;  2C35 B;  4O1N A;  2OTL A;  4BBR G;  4G7O C;  2UXB Q;  2PQA B;  1VMP A;  1Z47 A;  1WCM H;  5IYC G;  4JW0 A;  2IWH A;  3TZD A;  4U67 3;  4DV5 Q;  1X32 A;  1YBY A;  2RVL A;  5FOB B;  3PO2 B;  3D4W A;  2B29 A;  2EYL A;  1RL2 A;  3TRZ A;  3NUC A;  1O7Z A;  3EVQ A;  4MIU A;  1EFW A;  2KUM A;  1G6P A;  4A3I H;  1S40 A;  2HQE A;  1XNR L;  4FYD A;  3E0J A;  3PUW A;  4K2L A;  3T1Y Q;  4E6I A;  1FD7 D;  1PZI D;  1NR4 A;  4WOR A;  3FMC A;  3W1B A;  5C44 B;  1WCM G;  2DJG C;  4PZ8 A;  4WFN 3;  1Q82 C;  1VQ5 A;  4A3F B;  4KY5 A;  4XT1 B;  4XYQ A;  1GUW A;  1KL9 A;  3A55 A;  3PF5 A;  5EAY A;  1I6H B;  2B2Y C;  4A3I G;  4X62 Q;  4A3M B;  3MEH A;  2XVS A;  1XNQ Q;  4NB3 A;  2DJF C;  2L9H A;  4AYB E;  4DV0 Q;  2A6E C;  4CJ1 B;  2R92 H;  1EEF D;  1IL8 A;  1SJE D;  1WOC A;  2PZW A;  2JEB I;  1YI2 A;  1OTC A;  4HAE A;  5JPN C;  3TQY A;  1PA6 A;  3D8G A;  4X3T A;  4H44 C;  1QE6 A;  1VMC A;  2AQ2 B;  3L7Z C;  3K58 A;  1NE3 A;  4IO9 A;  5D14 A;  2R7F A;  3K0X A;  4OWW B;  4N9T A;  1NCV A;  1FR3 A;  1H9J A;  4TSS A;  2R92 G;  4GKK Q;  2WFW A;  3ER0 A;  3I7F A;  4DV4 L;  1SYE A;  2EQS A;  5COR A;  3RLN A;  2F0M A;  3PO2 H;  3DM1 A;  4HSP A;  3MTS A;  4MTN A;  1PFS A;  5CMD A;  4LF6 L;  4MNO A;  4LFC Q;  2A68 C;  2V4D A;  2VB2 X;  4GKJ L;  1CQV A;  1X3P A;  1ESR A;  1JC7 A;  1ENA A;  1ZYR D;  3I90 A;  2CH4 W;  5J39 A;  4B3M Q;  3HOU G;  1CZW A;  1D5M C;  4DR5 Q;  2IJ0 A;  3CRL C;  2F0W A;  5C44 H;  1Y8N B;  1D7Q A;  1HUN A;  2MPM A;  1PH2 A;  5D3D A;  3IKJ A;  4IAL A;  4A3F H;  4LF7 L;  1LTI D;  2F0E A;  3A74 A;  3T1H Q;  3L2P A;  1AP0 A;  2NUC A;  4RCN A;  3R2I A;  2TSS A;  1K83 B;  3A5Z B;  3BVG A;  1I6H H;  2Z8L A;  4A3M H;  4ZUI A;  3I70 A;  2B39 A;  1VQK A;  1MHW C;  4IUN A;  3NWS A;  1X3G A;  1H9S B;  3JAM c;  4NXM L;  4IZ8 A;  1RHP A;  5IT9 c;  4DR1 Q;  1HJP A;  2F52 A;  5C44 G;  4BXX H;  2B63 G;  4WJ3 M;  2D62 A;  2PPB C;  2KBN A;  4RGN A;  4X66 Q;  4AIM A;  3D6C A;  5M3M B;  3I91 A;  2F0N A;  2FIN B;  1K9M C;  2XSC A;  3R3O A;  3CXC A;  1KDA A;  1TT2 A;  3FEW X;  1MBY A;  4A3M G;  4GOP A;  4RGM A;  2KCN A;  4K14 A;  3WOF A;  5C3W A;  1ASY A;  2JEA I;  2SOB A;  2A8V A;  2ZM6 Q;  2ZTE A;  3EFX D;  2XGT A;  1ET6 A;  2KA7 A;  2IW3 A;  3DWA A;  1C0A A;  1EUJ A;  5M3F B;  4CDD C;  2IHE A;  1VCI A;  3VYS A;  5KYI A;  4JBJ A;  1SNQ A;  1I4G A;  2B2W A;  1PTO F;  4JBW A;  4K5V A;  1WTX A;  3GTJ B;  4ZRZ A;  3OIQ A;  1B9N A;  1SMY C;  3E6Z X;  2K5V A;  5C4H A;  1ENF A;  3OIP A;  3TS2 A;  3PGZ A;  2DNC A;  1G2S A;  4RAU C;  1DOM A;  3S15 H;  2NVY B;  2KVM A;  1UAP A;  4DV1 Q;  2L11 A;  1K3R A;  2K50 A;  3KLS A;  1LT4 D;  2QDB A;  3HP3 A;  4A3K B;  5CV9 A;  5E7N A;  3SR1 A;  2MHV A;  3DUZ A;  1STH A;  4F87 A;  2PQA A;  2ZTC A;  4FP5 D;  1JOR A;  1HA6 A;  4QMG A;  1VQA A;  5M3M H;  3MXP A;  5C4X B;  2Q8R E;  4PZ6 A;  1LT5 D;  1LTA D;  1NBW A;  4QB4 A;  3FHW A;  2XWB B;  2SEB D;  4N9P A;  3DXJ C;  1SND A;  4DF7 A;  1XXG A;  2B2T A;  2DGY A;  2WAQ E;  1KDC A;  2KCM A;  3I3C A;  4R8I A;  4BY1 H;  5IOD A;  1FL0 A;  5IYB H;  5M3M G;  1HRJ A;  1JWM D;  3CKI B;  1AE2 A;  1N9W A;  2F4I A;  4A3L H;  1N33 L;  3KBG A;  4Y7N B;  4FF2 A;  1LT3 D;  2WB1 E;  1JWU D;  4APV A;  1VQ4 A;  1J9O A;  3GTJ H;  3P1H A;  3HOV B;  4XXE A;  3I2Z A;  1BCP B;  1EU4 A;  1SJH D;  4B3T Q;  4XQQ A;  1KRS A;  4HJ8 A;  4DV5 L;  2ID0 A;  4JV5 Q;  1PVO A;  4BY1 G;  4A93 G;  4IUV A;  4HIK A;  4KY6 A;  2Q2H A;  1Q1B A;  2E2H H;  2JA8 H;  1SXT A;  1K73 C;  1STN A;  2VXW A;  3STB D;  3I4N B;  4A3K H;  1CA6 A;  2E76 C;  3T1Y L;  3EN2 A;  4J6H A;  1VF7 A;  2FHT A;  4ZK9 B;  3AFP A;  4PV1 C;  3FKI B;  4LF8 Q;  1YNJ D;  2ZXR A;  1WD1 A;  5BN5 A;  1NJI C;  2ZXP A;  2A6H D;  2LXK A;  2JA8 G;  1LYL A;  1E22 A;  2E75 C;  2KOL A;  4X62 L;  4TRD A;  3PIP 3;  1XNQ L;  4PMB A;  1I5F A;  2AQ3 B;  3U4Z A;  4DK0 A;  1PH6 A;  2WB1 B;  2Z6K A;  1JJG A;  2J4X A;  3KOJ A;  1IL2 A;  3S16 B;  1HQM C;  1XPU A;  4YCU A;  3PO3 B;  3L0O A;  1Y1W B;  3P75 A;  5G3L D;  3M4Y A;  4LWC A;  1G91 A;  4IFD H;  2A19 A;  4JOI A;  3BDL A;  5KNB A;  3RN5 A;  1M4V A;  3J7Y W;  3URY A;  1S5F D;  1B2T A;  2UXC Q;  3OTO Q;  5COY A;  2N49 A;  1A0I A;  2AUK A;  2D9U A;  1NMG A;  1TWF H;  3KYH C;  1IYJ B;  4DGZ A;  2F0J A;  3MXN B;  1H9S A;  4YHH L;  5A2Q L;  4LK1 C;  1HCZ A;  4K8J A;  1L0Y B;  3BZD B;  4IFD G;  2EYF A;  1MSH A;  4HJ5 A;  1HNX Q;  1B53 A;  3M3Y B;  3V05 A;  1QVF A;  4LFC L;  3S1R B;  2Q2I A;  2M9V A;  3X3M A;  4DV2 Q;  3I4N H;  3VA5 A;  3K6O A;  1S5B D;  1T9H A;  1U9R A;  1HUM A;  2DN8 A;  2LMC B;  1J5E Q;  4B3M L;  2Z4H A;  4DR5 L;  1A6X A;  3K81 C;  1VQO A;  2H4O A;  1SBB B;  4UDU C;  2O5J C;  3HOZ B;  3T1H L;  1WVL A;  1STG A;  5T1G A;  2C9O A;  4F7X A;  2CWA A;  2DY8 A;  1BBU A;  1N8R C;  5C0X H;  4JOI C;  4LF5 L;  2FXQ A;  4IFD I;  2PW5 A;  2R6G A;  5FO9 B;  3M85 A;  3I4N G;  4JC0 A;  1XMO Q;  5C3E H;  4OL7 A;  2AUJ D;  4GLA C;  3S16 H;  2JJQ A;  2BDO A;  3OHX C;  4HR7 B;  4YCW A;  5IP7 H;  1Y1W H;  4X66 L;  2NTT A;  1KLU D;  2EJG C;  1T5X D;  4LFA L;  1M90 C;  1S5D D;  1R4P B;  5KIX A;  4QIW B;  4C3I G;  2HIV A;  1BF4 A;  3NTH A;  1KRT A;  4B3S L;  1FNU A;  3A54 A;  2PO4 A;  1OXX K;  1C4Q A;  5C0X G;  1YHB A;  1Q3L A;  1X65 A;  2QDL A;  2F03 A;  2OTJ A;  5C3E G;  2AMC B;  2XRS D;  5ISR A;  2MP1 A;  1EIF A;  1PH7 A;  3SK5 A;  4RH6 A;  3CME A;  4DV4 Q;  4G7Z C;  1FYC A;  4ID6 A;  2E2I B;  4IUR A;  2A69 D;  3RLO A;  2QEX A;  4R4T A;  2E74 C;  1DYQ A;  3OWE B;  3M3Y H;  4LF6 Q;  5HUR A;  2JA5 B;  4C2M B;  1CZG A;  2ZTD A;  3HOW B;  4C3J B;  3F1Z A;  1XTD A;  1I3Q B;  3DEO A;  3VA7 A;  2NVX B;  3SDZ A;  5C0X I;  4KKT A;  3J80 i;  1CK1 A;  1DCZ A;  4NMZ A;  1RDP D;  1S5C D;  3CP0 A;  3HOZ H;  3GTG B;  4DV1 L;  2UUB Q;  2OWO A;  1Q90 A;  1ICW A;  3L3O C;  4DUZ L;  2EYP A;  5KRU A;  2PYK A;  1K8G A;  2RBM A;  3NEN A;  3NWT A;  3I55 A;  5FLX L;  1V43 A;  1LV9 A;  3H09 A;  2QGQ A;  4DR4 L;  1LTT D;  1Q8K A;  2VS1 A;  2VZA A;  1JJC B;  3A8I E;  4OEM B;  2P5Z X;  5M5Y B;  3TZU A;  5FKA C;  3QOJ A;  1YVC A;  4KJN A;  5CGK A;  1K8A C;  2L12 A;  4EVO A;  4UP7 A;  3HOZ G;  4L5R C;  3HOX G;  1RIP A;  1AEX A;  3J80 E;  4PMC A;  2G5D A;  5C6A A;  4DR7 Q;  2FJ2 A;  4RMF A;  2LY7 A;  3VR3 A;  5FO8 B;  3OW2 A;  5CBA E;  2UUC Q;  3BDC A;  4BBR B;  1LLR D;  3VYU A;  1PZJ D;  2HUG A;  2XTI A;  1TS2 A;  3DHQ A;  1KNA A;  2R61 A;  4JBK A;  3HRZ C;  1D6E C;  3GDE A;  1IYU A;  3U58 A;  2E2I H;  4JI6 L;  4X3K A;  3MA2 B;  1J8I A;  5KND A;  2K5W A;  4DK6 C;  5DM6 3;  4C2M H;  2JA5 H;  3HOW H;  4C3J H;  5JVH 3;  1CUK A;  1O7I A;  3QOL A;  1I3Q H;  5IE8 A;  2CVR A;  2NVX H;  1TS4 A;  4A3C G;  3N52 A;  4B3R L;  1PYS B;  4B3T L;  1WCM B;  2BCO A;  1H9K A;  4P74 A;  5C5L A;  2VB3 X;  4RCO A;  4JV5 L;  1F9Q A;  3SK8 A;  3QO2 A;  2GVA A;  1FNV A;  1SYC A;  5HY6 A;  3GTG H;  3SE0 A;  2PZU A;  1BCP C;  1SE2 A;  5K36 H;  3NEL A;  1II3 A;  1IZ6 A;  3CHB D;  4H13 C;  3S24 A;  3U9O A;  1HNZ Q;  1EIG A;  4L63 B;  1X56 A;  5FLX c;  4C3J G;  1QCB D;  2YYZ A;  2EJM A;  1S72 A;  3U4V A;  1AN8 A;  1QNU A;  5M5Y H;  3MXN A;  1B3A A;  2A6E D;  5JVG 3;  4KTA A;  3TP7 A;  1V1O A;  4MN3 A;  5K36 G;  1BR9 A;  4HID A;  2K04 A;  4UHV A;  5F2D A;  3S2H B;  3VR5 A;  4R8N A;  2Q8I B;  2K1B A;  2R92 B;  4HIM A;  1RTN A;  2BOS A;  4B08 A;  1Q1E A;  5IYC H;  4R4C A;  5AJ3 Q;  3X3N A;  3H15 A;  1Q12 A;  2L5T A;  3CCS A;  3MEF A;  3PCO B;  5LHY 1;  2B3G A;  1NTG A;  2Z0S A;  3ULJ A;  1XYI A;  1HNW Q;  5DEH A;  2N88 A;  3OTO L;  2KHJ A;  1PYW D;  2G9H D;  1N33 Q;  3RMH A;  1CSP A;  3CPF A;  2A68 D;  1R9T H;  1EEI D;  3HOU B;  3J81 c;  2D2C C;  3J7A 5;  2ICI A;  4PZ7 A;  3F2B A;  4DN4 M;  1SNM A;  2B8F A;  4QQB X;  3I56 A;  1HNX L;  3H3V H;  3GTK B;  3LWU A;  1GD7 A;  4HJA A;  2I5H A;  3DMU A;  1STA A;  1H95 A;  1GVP A;  2QCP X;  3UI2 A;  1QB5 D;  4DV2 L;  4A3D H;  2R7D A;  2K32 A;  5GRO A;  3DM3 A;  1RTO A;  2PW7 A;  2N78 A;  4NXN L;  1J5E L;  2B2U A;  3PMF A;  1IKM A;  4EGV A;  2JQO A;  2OF1 A;  2B63 B;  1XPR A;  3GTM H;  4JI2 Q;  3SK6 A;  2IY5 B;  1EQV A;  1IXR A;  2F0O A;  3FRP B;  1LUZ A;  3TS0 A;  1PFB A;  1F2Y A;  5KEE A;  5CV4 A;  5EKL A;  2BE5 C;  3NQI A;  1VQP A;  1SNO A;  3BS1 A;  1VQJ A;  4CJ2 C;  4A3D G;  3MXU A;  4JI1 L;  4HMI A;  4R4Q A;  1TR5 A;  1XMO L;  3S2H H;  3PV0 A;  3I72 A;  3JAM L;  5IT9 L;  5DLQ E;  4B9X A;  2JA6 B;  3RZD H;  5H1S E;  3H0G B;  4NKL A;  2CHB D;  3U9S A;  1WD0 A;  1JOQ A;  2IT1 A;  5GAH C;  1JWS D;  3NE5 B;  2CWP A;  2EXZ A;  4OON A;  4KJO A;  2EE1 A;  3HGB A;  3H3V I;  1LTS D;  1H9M A;  1IKL A;  3HOU H;  2K28 A;  5DAU A;  2QIL A;  2D5D A;  4KV6 A;  5KGU A;  2J7Z A;  4YHH Q;  2K33 A;  4HN7 A;  4AQY Q;  3CU7 A;  3K0Y A;  4KHP Q;  2CQO A;  3W1G A;  1SMY D;  3HOY G;  1EY9 A;  4OWT B;  3CCR A;  1B3Q A;  4B9W A;  1LAC A;  3GTK H;  2MUY A;  5JJK A;  1I6V C;  1PFN A;  1U4M A;  1G51 A;  4NW2 A;  5CV6 A;  1SDF A;  3FPP A;  2KCC A;  2EYM A;  1F9S A;  3KUP A;  1PV4 A;  4DK1 A;  3CCL A;  1PYB A;  4KMU C;  1GO3 E;  3C46 A;  1EOV A;  3SHL A;  1VQM A;  1DOK A;  2B63 H;  3TP5 A;  1E3P A;  1WTR A;  4CDF C;  3LWE A;  1JE4 A;  4K8I A;  3S15 B;  2EJF C;  1VQL A;  1O80 A;  2UUB L;  1ILP A;  3WDN A;  2BDN A;  2JYO A;  1HZA A;  1QUQ B;  1KIX A;  2VUM G;  1HZB A;  5E4W C;  4LF5 Q;  1HH2 P;  1K8M A;  5G3L F;  1VQN A;  2O2L D;  3E9H A;  3GTQ B;  3GTP B;  1DM0 B;  3AU7 A;  4JI3 L;  1V1P B;  3F8T A;  3PUV A;  3NK9 A;  4KK7 A;  1C9O A;  4X3S A;  2JA6 H;  3HKZ B;  1BKB A;  2K4K A;  3H0G H;  4DK3 C;  1HTP A;  4ALP A;  1KC8 C;  2YU9 B;  4LFA Q;  5HGQ A;  1TQO A;  1F77 A;  3DWP A;  3ICE A;  4KN4 C;  3NHH A;  1MI2 A;  1TY2 A;  2YTY A;  1N36 Q;  1K8O A;  4OIK A;  4B3S Q;  4YIJ A;  4DR7 L;  3S2D B;  1YHA A;  1Y1V B;  4DNI A;  1I4R A;  5IIF A;  1FJG L;  2UUC L;  4FF4 A;  1AFP A;  1SN8 A;  2LFN A;  2GN5 A;  4O0A A;  1A3T A;  1MJC A;  4DAY B;  4JI7 Q;  2JA6 G;  2JA7 B;  1T5E A;  3H0G G;  4BY1 B;  4KKS A;  4A93 B;  1I4H A;  4IQZ A;  4CBV A;  2FFK B;  3D6W A;  2KEE A;  4LUZ A;  1L2F A;  2Y0S G;  2A73 B;  2NZ1 D;  3CF5 A;  2C5C A;  1N32 Q;  2Q2T A;  2UXD L;  4RGT A;  5EGT A;  2Q8T A;  4BY7 H;  2F3W A;  1PFM A;  2K01 A;  1DXM A;  2Q2U A;  4WJ4 A;  4ODG A;  4FF1 A;  5DNF A;  3S14 H;  2EYH A;  1F2L A;  1VQG A;  1CKN B;  1GOZ A;  4PMW A;  4WRD A;  2ATW A;  4P73 A;  2RDG A;  3QG1 A;  2E2H B;  5LMN W;  2JA8 B;  4DUZ Q;  2F0G A;  4HED A;  4BWG B;  5IP9 G;  1B50 A;  1HNZ L;  2OQK A;  4BY7 G;  4DR2 Q;  3GTQ H;  4DR4 Q;  3GTP H;  1EY4 A;  5C3X A;  4ME3 A;  4GOP C;  4FO2 A;  3S1M H;  1BUV T;  1ICF B;  5L37 A;  1E1O A;  4BA1 I;  2F0H A;  2YU9 H;  4CDC C;  3AQQ A;  1P16 A;  5EPJ A;  4V19 0;  1PRT C;  1PTO B;  5IGB A;  3Q24 A;  1A2T A;  3S2D H;  4JCV E;  4FXD A;  1Y1V H;  5LL6 X;  1HXY D;  2NTS A;  4KI0 A;  1D1I A;  2E8G A;  1QWY A;  2SNM A;  2ES2 A;  3R93 A;  2B2W C;  3CCM A;  1MGS A;  3HKZ G;  1U0L A;  2I5M X;  1A63 A;  2JA7 H;  5AJ3 L;  3Q8D A;  5C5M A;  1CI3 M;  4A93 H;  3ZJY C;  4HIO A;  4JI6 Q;  2VL6 A;  1HNW L;  1TWA B;  5I6Y A;  2RKS A;  3I73 A;  2IX3 A;  1Y1V G;  3G6J B;  3OOC A;  1TWF B;  4XTC S;  2CKZ B;  1E0B A;  1L0W A;  4B3R Q;  2A5H A;  4ULL A;  4G57 A;  5JJZ A;  1V8Q A;  2UUA Q;  2JA7 G;  2F0F A;  1TY0 A;  5JJL A;  4QJF A;  1I94 L;  1OXU A;  1VDZ A;  4Z9C B;  1JIC A;  4JK1 C;  2JP1 A;  2IPK D;  2HT1 A;  1K3B C;  1WI5 A;  2IX0 A;  1YZ6 A;  4LUV A;  1IBM Q;  1LO5 D;  3OWF A;  2MQH A;  1IBL Q;  2MO0 A;  4J8Q A;  4C3H G;  1WTQ A;  1AH9 A;  2DNE A;  4JI2 L;  4K5X A;  2B2T C;  1UNS A;  3A56 A;  4EQP A;  1W6J A;  4C3I B;  1UE1 A;  1PLF A;  4OX9 Q;  3OPO A;  1PTO H;  3TDQ A;  1SRO A;  2NZH A;  1SFO H;  1A2U A;  1E2Z A;  1VF5 C;  5C3E B;  3V2T A;  3EQL C;  3UE1 A;  1UEA B;  2PMZ E;  5A2Q E;  1G29 1;  1ET9 A;  4UP9 A;  1V9P A;  1TXY A;  1E2V A;  4TVA B;  5I6W A;  4OWX B;  3E9I A;  1TWA H;  4N8F A;  4JVZ A;  2CCZ A;  4M8A A;  2E2D C;  4JI8 Q;  1QUQ A;  5CR3 A;  5EBC A;  4C56 C;  2VNU D;  2ICE C;  1VQI A;  1SSO A;  3GTO H;  4N8X 1;  1EL0 A;  1MJE A;  1B9M A;  3SK4 A;  1I50 B;  1QVG A;  2SDF A;  2RHQ B;  1V1P A;  4QIW E;  2PQE A;  4AQY L;  3GV6 A;  3J81 j;  4KHP L;  1CKO A;  2M00 A;  1B8A A;  1SEB D;  1ZEQ X;  3P7J A;  5I9O A;  3A5U A;  3ERQ A;  1FNW A;  1JB7 A;  1AZP A;  4P75 A;  2WKC A;  2NB0 A;  1HZC A;  1EY5 A;  2K5N A;  3LNN A;  1SYG A;  2RSN A;  4A76 A;  3R8B A;  5ELN A;  4DV6 L;  4MZ9 A;  1TS5 A;  2OCE A;  3ZYY X;  4DXG A;  3PIO A;  2VQE L;  4NXN Q;  3MWY W;  5ELF A;  3VYR A;  1NNX A;  3K57 A;  4DAY A;  1PZK D;  2YTX A;  1YJ9 A;  1XMQ Q;  2Z6K C;  5CV8 A;  4C3I H;  5DM7 3;  2HIX A;  2PMZ B;  3HOX B;  3NQT A;  3K5L A;  1D5Z C;  1OXV A;  2SNS A;  3E3X A;  4X6A H;  2KJX A;  5JEA H;  1JT8 A;  2A74 C;  3G6E A;  2LKV A;  1F2Z A;  4JI1 Q;  2BA0 A;  4JYA Q;  1V1Q A;  3CC2 A;  2HCC A;  4UAI A;  4DU9 A;  1GUT A;  3AB9 A;  4GLV B;  3T51 B;  4GS3 A;  3UDF A;  1CKN A;  4I7A A;  1K0R A;  3ND9 A;  3FDT A;  3UDI A;  5IYD G;  2XIW A;  1N36 L;  2MJ8 A;  5JEA G;  1AZQ A;  4FDB A;  1DZ1 A;  3CW2 C;  3G7L A;  1O7Y A;  1WTW A;  3MC0 B;  2MGS A;  1Z9F A;  4DNR B;  4DUY L;  1W3S A;  2F0L A;  4KHZ A;  5FJ8 H;  2LXJ A;  1I50 H;  5EPL A;  5IGD A;  4JI7 L;  3L9A X;  4EQ5 A;  5KYL A;  2HDM A;  2L55 A;  1HQR D;  3LGJ A;  4GN4 B;  2WV6 D;  2WAQ G;  1GUO A;  2LS0 1;  1TWC H;  5BR8 Q;  2JXM B;  2K75 A;  1N32 L;  5ELO A;  2EOT A;  2QA4 A;  4K6D A;  1YNN C;  3T56 B;  1BCP D;  2F4V Q;  3VYT A;  1VQ8 A;  3C1E A;  5FJ8 G;  1XJV A;  2O5I C;  1Y8O B;  4A3B G;  3Q0A A;  4DV3 L;  2MNA A;  3CCU A;  1VQD A;  1BBW A;  4CHT B;  3K5M A;  3EIV A;  3HOX H;  1EZ6 A;  3I4M G;  4AH6 A;  2KCT A;  3F2U A;  3H6M A;  2FMC A;  5D65 A;  3PF4 A;  1GUS A;  3KBX A;  4H0L C;  1BNZ A;  1EWH A;  4ZAI A;  1HZ9 A;  1Z6H A;  2L15 A;  4DR2 L;  2K14 A;  2AWO A;  1GM5 A;  2L1B A;  4JI3 Q;  3IL8 A;  3E5S A;  4DA2 A;  5BN4 A;  2NVT B;  4UY8 C;  3ULP A;  5JOB A;  2Z4I A;  3ULL A;  2GA4 B;  2YTV A;  1VQF A;  1F9R A;  4OXP A;  3J7A F;  4KD4 A;  1STY A;  1F9P A;  1ILQ A;  1B4O A;  4EQO A;  2R7Z G;  1X3F A;  3ND8 A;  1SE8 A;  2OQ0 A;  5J3B A;  2XN9 C;  1FJG Q;  2BA1 A;  2F0T A;  1PTO C;  4POF A;  2K03 A;  4DNT B;  3DLL A;  2FMM A;  3VR2 A;  4A3C H;  3G48 A;  1ESF A;  2QF7 A;  5M5W B;  1EU3 A;  3NSW A;  1SNC A;  3U50 C;  1DJR D;  3K80 C;  4KD3 A;  1EIH A;  3CRK C;  3EBE A;  1H9R A;  4PG3 A;  3RR5 A;  1CT1 D;  2K5Q A;  3S17 H;  4KKU A;  5CBE E;  4CGY B;  2UXD Q;  1IYV A;  1HHV A;  4ZUJ A;  4XT3 B;  3BU2 A;  5EBD A;  4DR3 Q;  1RJT A;  2X69 A;  3IRB A;  3QWN A;  3RNU A;  2F0V A;  1R9T B;  1C8C A;  4LNQ A;  3NEM A;  3J81 L;  1L1O A;  2ZT9 C;  5M5X B;  2UUA L;  2WP8 J;  1JR0 D;  1LM0 A;  3DWQ A;  1STB A;  2Z1C A;  2KED A;  1EQR A;  1G8Z D;  3K59 A;  3S1Q B;  4A3D B;  3OYY A;  5KNC A;  2I5L X;  2UU9 Q;  3BYY B;  1IBM L;  3CC4 A;  5LMN L;  1OXT A;  2BE5 D;  2CW0 C;  3CC7 A;  1IBL L;  1RKN A;  1SR3 A;  2K52 A;  3PUX A;  1GUG A;  1SYD A;  3GTM B;  1EZ8 A;  2NVT H;  1GJX A;  3AEV A;  1CA5 A;  2QEJ C;  1EY0 A;  4OX9 L;  4X3U A;  2MFI A;  2L4N A;  1UE5 A;  3Q6S A;  1NY4 A;  5C4J B;  2K7V A;  3K5N A;  2ZJQ A;  4LF9 Q;  2EYJ A;  2RCN A;  4YWL A;  2KHI A;  4HJ7 A;  2QW7 A;  2B8G A;  3SGI A;  3RZD B;  5M5W H;  1QZH A;  3HOY B;  2ZJP A;  3BJU A;  1F2M A;  2F0D A;  1TWG B;  1FGB D;  5HGT A;  3M4O B;  3BDO A;  3FP9 A;  4JI8 L;  2XNA C;  5E1F A;  3TEH B;  1NSN S;  2K5H A;  1DGS A;  4IJH A;  4XIG S;  3MHB A;  4U68 A;  1LTL A;  4YWK A;  3RLF A;  4ZKB B;  4ZCK A;  1B70 B;  2ASB A;  4L5T A;  1X3Q A;  3KF6 B;  3SEB A;  5M5X H;  3GP7 A;  4UP8 A;  3J80 c;  2B2Y A;  1JJ2 A;  1I94 Q;  3PUZ A;  4QGU A;  2E2J H;  2XRQ D;  1TKW B;  5K5P A;  4A3E H;  2VUM B;  1YJW A;  3S1Q H;  1KXL A;  4JI4 Q;  4L5Q A;  1EY8 A;  1CTM A;  4J1M A;  3M7N A;  1BXT A;  1IW7 C;  4CJ0 B;  1OXS C;  3A8K E;  1Q8I A;  4KN7 C;  3OMG A;  4FXG C;  2PI2 E;  3UDG A;  1RF2 D;  3JAM E;  3CCE A;  1KAA A;  5IT9 E;  2ZJR A;  4BBS B;  3K7A B;  1WFQ A;  1XMQ L;  2OEO A;  1S3O A;  1MKH A;  2B2V A;  4G4K A;  1Y8P B;  3QIA A;  3CD6 A;  3KJO A;  4A3E G;  3SVM A;  5C4J H;  2F3V A;  4DR6 L;  3H94 A;  4JYA L;  5IGC A;  4CKE A;  1EWI A;  3GD7 A;  5M9O A;  4KHV A;  3HOY H;  1NUC A;  5IGF A;  3I4L A;  4KLK A;  1Q46 A;  1E2W A;  2Y0S B;  1KLG D;  4JPB W;  1FVI A;  1PH9 A;  1Q7Y C;  3MZ5 A;  1TWG H;  5I2X A;  1A15 A;  3M4O H;  3FVQ A;  3VR6 A;  4YY3 L;  1GUN A;  1I4P A;  3HKZ E;  1NAP A;  1BDO A;  2PNR C;  1N34 Q;  5JJI A;  4QUF A;  4J15 A;  2B2U C;  4EX5 A;  2EDG A;  4P2C B;  1WTP A;  3A0J A;  5BR8 L;  3W5O A;  1VQ6 A;  3RN2 A;  1JOO A;  1EQQ A;  2VUM H;  2CQA A;  4XDX A;  3TSS A;  2F4V L;  4BY7 B;  2B2V C;  5IGE A;  4DV6 Q;  2CH4 A;  2VQF Q;  1B44 D;  4QF4 A;  3IAY A;  2VQE Q;  4IUP A;  1R4Q B;  1A62 A;  3S14 B;  1Y14 B;  2J0T D;  4BBS H;  1X55 A;  3D4D A;  3K7A H;  1SLJ A;  2NWG A;  1U4L A;  2EYO A;  3K8A A;  4LAA A;  3HG9 A;  2YV5 A;  4QCL A;  3J7A V;  1IBK Q;  1MD2 D;  4R1J A;  4S3S A;  1PH8 A;  2HHH L;  5C4Z A;  1Y69 U;  3M4Q A;  1KAB A;  1PRT D;  1C48 A;  4CKC A;  4DPG A;  4O42 A;  5EJW A;  1DOL A;  2N55 A;  3T4A C;  1SRU A;  1WTO A;  1KQS A;  1QVC A;  1WJJ A;  1X9N A;  4AYB B;  3S1M B;  4QUC A;  3HZX A;  2A1A A;  4BBS G;  1YHQ A;  1MSG A;  3PO2 G;  1ASZ A;  1EIY B;  5IWA Q;  4HMJ A;  1AE3 A;  5IOC A;  4OO1 H;  1HR0 L;  1JQY D;  2IL8 A;  4DKA C;  1PHJ A;  4DUY Q;  5GAE C;  2L0C A;  3EJI A;  2EVB A;  3OW7 A;  1CSQ A;  5ELB A;  4LFB Q;  3P20 A;  1DON A;  3E0E A;  5FK9 C;  2OXP A;  3JC6 6;  4A3F G;  1J6Q A;  1ZXT A;  2JN4 A;  2KHS A;  4CDE C;  1PDQ A;  3BVM A;  1PH1 A;  4OO1 G;  2F1M A;  5IP9 H;  2NVQ B;  3N6R A;  1XWE A;  1K28 A;  2K5D A;  3OMC A;  5EKI A;  4DR3 L;  4IPC A;  2BH8 A;  3NBH A;  3TME A;  2H5X A;  1VQ9 A;  3CPW A;  4I7Z C;  2O4X A;  3A7L A;  4L6T B;  4LF4 L;  2VW9 A;  3OSO A;  5TSS A;  4C3H B;  4BXX G;  2F0I A;  3HKS A;  4WJW A;  4DV3 Q;  1WYD A;  3NTK A;  2RSO A;  2RHS B;  1PH5 A;  2AWN A;  5E4X A;  2NBF A;  1DD2 A;  3WOE A;  2NN6 H;  4MHE A;  2UU9 L;  1JOK A;  4JG2 A;  2KEC A;  4Q5V A;  3H3V C;  4C1N I;  3D3R A;  1KNE A;  2IHF A;  3MFG A;  2K05 A;  4OO1 I;  1EYC A;  3C1F A;  1Q86 C;  1E1T A;  3M9B A;  3TP8 A;  4EQN A;  4UPA A;  1HTL D;  3KF6 A;  4RGO S;  1ZYR C;  5NUC A;  4QY7 A;  3CMA A;  1K83 H;  1SFO B;  2PNH A;  2NN6 G;  2RA4 A;  4LF9 L;  3A8J E;  1SMX A;  3HEJ A;  4RA8 A;  2HD3 A;  3R2T A;  4X65 L;  3PIO 3;  2E5L Q;  1I4Q A;  3CAM A;  4H02 A;  4JI5 Q;  4AYB G;  1U4P A;  4PNY A;  2MO1 A;  2WAC A;  1EYD A;  1BCP F;  1OO9 B;  3MAQ A;  3VDY A;  1LT6 D;  3PSI A;  1XPO A;  2AQ1 B;  1QIL A;  2OT2 A;  2NVQ H;  2I46 A;  2PCF B;  4V0B A;  3V96 A;  2JE6 I;  4Y52 H;  2NYZ D;  1CQF A;  3ITP A;  4IJL A;  3GTO B;  5JPM C;  4DV7 Q;  2ALY B;  4X64 L;  5ELE A;  4YCV A;  4GZY C;  3K7U C;  4FXK C;  2EZV A;  1BBX C;  4C3H H;  1JE5 A;  2NN6 I;  4RKB A;  4RKL A;  4GN3 B;  1NMF A;  3MFY A;  3T16 A;  5M3F H;  4DXF A;  1HFG A;  3BZK A;  2R93 B;  3D4R A;  1NR2 A;  4R4O A;  4JI4 L;  3MXG A;  1P8L A;  3I4O A;  2UXB L;  4IOA A;  1M8A A;  5LMN Q;  4JI0 Q;  1FGU A;  4A3G B;  2R3Z A;  4R9W A;  2RDF A;  2F0P A;  1EWC A;  3PQI A;  5LMU Q;  5IYB G;  1EY7 A;  2NVY H;  2NZO A;  3NXW A;  2VY3 A;  3KLR A;  3WWV A;  2PI2 A;  5M3F G;  4PQX A;  4ZKC B;  4A3L G;  5CV5 A;  1PH3 A;  3KLW A;  2CFM A;  4DAM A;  3KFU A;  1VQE A;  4M1U B;  1GHK A;  5IGG A;  4I65 A;  2RQX A;  2DUD A;  2EXD A;  1L1O B;  5LL6 S;  2GVB A;  2F0U A;  4LJZ C;  4IPH A;  4HJ9 A;  4LMQ D;  3Q22 A;  1UUP A;  1QG7 A;  5D3I B;  1PMR A;  5ELD A;  2WAQ B;  3GQB A;  4GNX B;  5C4X H;  2AKW B;  3A7A B;  3K5O A;  1EOT A;  1UWV A;  1D2B A;  2Z9H A;  1TWH B;  3AMU A;  1TII D;  1ROD A;  1UE6 A;  4A3K G;  5I2Y A;  1PXU A;  4POG A;  4DV0 L;  5FO7 B;  1ML0 D;  4IOC A;  1HA5 A;  1N34 L;  5CV7 A;  1D1K A;  1YNN D;  3HFZ B;  4A3B B;  3CCV A;  4P71 A;  4G7H C;  4K0K Q;  4TQU S;  5C4X G;  1XTC D;  3KDF B;  1TWC B;  3RZO B;  3I4M B;  1M1K C;  4RFB A;  2R93 H;  4Y7N H;  1X54 A;  2HCI A;  2RDH A;  5I9P A;  5ELC A;  4NDX A;  1EYG A;  3J7Z C;  2EIF A;  4F88 A;  2VQF L;  4DAV A;  1CFM A;  1LTB D;  3QB3 A;  2XWJ B;  3HOV H;  4GKK L;  4A3G H;  1QZG A;  1BVS A;  4IUU A;  1WTV A;  3G4S A;  1IHZ A;  3KF8 B;  3CQZ B;  4DAP A;  2I07 B;  3KK7 A;  1G2T A;  2ENB A;  1L0X B;  1IBK L;  2JA9 A;  5IYD H;  2EY1 A;  3TN2 A;  2R7Z B;  2R93 G;  4OIJ A;  1EFI D;  1KHI A;  3DEP A;  5FLM H;  1YIJ A;  1XNR Q;  1BQQ T;  3TP6 A;  5GAG C;  3FPU B;  1JB3 A;  4RHR A;  4K6L A;  4DR6 Q;  3EA6 A;  3HOV G;  3FKI H;  4A3G G;  4RG1 A;  4ZQ3 A;  4LUO A;  4Q0F A;  1PTO D;  1HR0 W;  1LAB A;  2V1C C;  2LSS A;  3STB C;  1SNP A;  5IWA L;  2N3S A;  4YWM A;  1TWH H;  5FLM G;  1MIU A;  1D8L A;  4YY3 Q;  1YNJ C;  4O2D A;  4DR1 L;  2EPB A;  1TS3 A;  2KEN A;  1EQT A;  2KQ3 A;  4HCE A;  4LFB L;  1JCK B;  3FKI G;  3TBI B;  2A6H C;  4A75 A;  4A3B H;  3CCQ A;  1QJO A;  2HDL A;  2HQL A;  3PO3 H;  1TVX A;  1LTG D;  5GAD C;  1B1Z A;  5J22 A;  5I4D A;  4H7B A;  4BA2 I;  1SYB A;  2D0O A;  3NBI A;  3I4M H;  3RZO H;  1STE A;  4IPG A;  3BYT B;  1K0S A;  1O78 A;  1B7Y B;  3S17 B;  2BH2 A;  3T13 A;  1U5K A;  4MTK A;  2F0K A;  5FLX E;  3ERS X;  5GQO A;  2RF4 A;  2WB1 G;  4K5W A;  5IY0 A;  2ZM6 L;  4JBM A;  2Z6B A;  1CKM A;  2X6L A;  4HTH A;  1BO0 A;  5E3F A;  5IP7 G;  2F0Q A;  4ZLT F;  1Y1W G;  3PO3 G;  2TMP A;  5AFW A;  1VQH A;  5A35 A;  2CW0 D;  1SAP A;  2I0Q A;  3CQZ H;  4RWS C;  4XYO A;  1X3E A;  2AHO B;  2R7Z H;  4DFA A;  3GV3 A;  3S1R H;  2JK8 A;  1W2B A;  2HHH Q;  4RHS A;  2WII B;  1X6O A;  4IUQ A;  1VS0 A;  4GKJ Q;  3PIP A;  2WKD A;  1QNK A;  2QKI C;  3QJY A;  3J81 i;  4IN3 A;  4IPD A;  1S4Z A;  2D0P A;  1SE3 A;  5BN3 A;  3M7G A;  3W3A A;  5EQ0 A;  1SE4 A;  4TKO B;  2WIN B;  3UDX A;  4HCS A;  1KDB A;  3ONA B;  2G9D A;  4LF7 Q;  1A3U A;  4NPS A;  3D31 A;  1EY6 A;  1LTR D;  1C7Y A;  1E7Z A;  1Q81 C;  1HR0 Q;  3BVZ A;  3NP8 A;  4P72 A;  4IFD J;  1HPC A;  4NXM Q;  1YJN A;  3NPP A;  3Q23 A;  2E5L L;  1TU2 B;  4JI5 L;  4FNF A;  2N8N A;  1A3V A;  4L5S A;  3QR8 A;  3J81 E;  4OGQ C;  4K2K A;  3KLS X;  2F3I A;  1CM9 A;  5EPK A;  1QOH A;  3O13 A;  3F2C A;  3S1N B;  1VQC A;  3SXH A;  1VQ7 A;  4A3J B;  3GTL B;  2JSO A;  1GHJ A;  1CHP D;  4ZYS A;  3I8Z A;  4XQN A;  4F8M A;  1S5E D;  4DV7 L;  2EY2 A;  1G6Z A;  3G71 A;  2X6G A;  3RUZ A;  3T53 B;  4LF4 Q;  4ME5 A;  1IW7 D;  3MVV A;  4ABN A;  4NP5 A;  1PRT F;  1E24 A;  1WTH A;  3J80 L;  1W6K A;  3F2D A;  4L8J A;  4GNX A;  1AW7 A;  1KAW A;  3H91 A;  2E2J B;  1I4X A;  3RD4 A;  4A3E B;  2ZXO A;  4OEL B;  2F0S A;  3S9W A;  4XQJ A;  4FF3 A;  1O7L A;  1ENC A;  2IX1 A;  4JI0 L;  1GKH A;  2A69 C;  5JEA J;  5C0X J;  4QL5 A;  3VR4 A;  2H1E A;  3M4P A;  5LMU L;  2RCF A;  3AFQ A;  1UEB A;  1VQB A;  3W2D A;  4A4I A;  4FVM A;  4LW1 A;  1RD9 D;  2DY7 A;  3KDF A;  2JA5 G;  3BZC A;  4GOP B;  4A3I B;  1PH4 A;  3B6Y A;  3HOW G;  5CYU A;  1CHQ D;  1Z7T A;  3NBH B;  2EY5 A;  2EY6 A;  3C3L A;  2PZT A;  4IUT A;  4GN5 A;  1PRT B;  5J1Z A;  4X65 Q;  4LF8 L;  3C2P A;  5JAV A;  1ONL A;  1A8V A;  1D5X C;  3AYH B;  3ERO A;  3GO5 A;  4BS9 A;  3IFT A;  1BOS A;  1L1O C;  1RCV D;  3S1N H;  1GXD C;  3KF8 A;  3CCJ A;  4A3J H;  3LX0 A;  1YEZ A;  3GTL H;  4R4I A;  3BG3 A;  4ILW A;  3KJP A;  4GNX C;  1ZKO A;  1YIT A;  5T1I A;  2K6A A;  3NTI A;  3D0F A;  3JAM i;  4BBR H; 
#chains in the Genus database with same CATH homology
 3PUY A;  1HFN A;  1KTK A;  4OHJ A;  4CKB A;  5CC4 A;  1EYA A;  4C1N K;  3IFD A;  1SYF A;  4KY7 A;  3HS0 C;  1U4R A;  2M2L A;  5EKK A;  1XX8 A;  4HSV A;  4O1N A;  4G7O C;  1VMP A;  1Z47 A;  3TZD A;  2IWH A;  4U67 3;  1X32 A;  2RVL A;  5FOB B;  3PO2 B;  3D4W A;  2EYL A;  3NUC A;  1O7Z A;  3EVQ A;  4MIU A;  2KUM A;  2HQE A;  4FYD A;  3E0J A;  3PUW A;  4K2L A;  4E6I A;  1FD7 D;  1PZI D;  1NR4 A;  4WOR A;  3FMC A;  5C44 B;  4WFN 3;  4A3F B;  4KY5 A;  4XT1 B;  4XYQ A;  1GUW A;  3A55 A;  1I6H B;  2B2Y C;  4A3M B;  3MEH A;  2XVS A;  2L9H A;  2A6E C;  4CJ1 B;  1EEF D;  1IL8 A;  1SJE D;  2PZW A;  2JEB I;  4HAE A;  5JPN C;  3D8G A;  4X3T A;  4H44 C;  1QE6 A;  1VMC A;  2AQ2 B;  3L7Z C;  3K58 A;  5D14 A;  4N9T A;  1NCV A;  1FR3 A;  1H9J A;  4TSS A;  1SYE A;  5COR A;  2F0M A;  3DM1 A;  4HSP A;  3MTS A;  5CMD A;  2A68 C;  2V4D A;  2VB2 X;  1CQV A;  1X3P A;  1ESR A;  1JC7 A;  1ENA A;  1ZYR D;  3I90 A;  5J39 A;  1CZW A;  1D5M C;  2IJ0 A;  3CRL C;  2F0W A;  1Y8N B;  1HUN A;  2MPM A;  5D3D A;  3IKJ A;  4IAL A;  1LTI D;  2F0E A;  1AP0 A;  2NUC A;  4RCN A;  3R2I A;  2TSS A;  1K83 B;  3BVG A;  2Z8L A;  4ZUI A;  3I70 A;  2B39 A;  4IUN A;  3NWS A;  1H9S B;  4IZ8 A;  1RHP A;  2D62 A;  2PPB C;  4RGN A;  3D6C A;  5M3M B;  3I91 A;  2F0N A;  2FIN B;  2XSC A;  3R3O A;  1KDA A;  1TT2 A;  3FEW X;  1MBY A;  4RGM A;  2KCN A;  4K14 A;  3WOF A;  5C3W A;  2JEA I;  2SOB A;  3EFX D;  1ET6 A;  2KA7 A;  2IW3 A;  3DWA A;  5M3F B;  1VCI A;  3VYS A;  5KYI A;  1SNQ A;  1I4G A;  2B2W A;  1PTO F;  4JBW A;  4K5V A;  1WTX A;  3GTJ B;  4ZRZ A;  3OIQ A;  1B9N A;  1SMY C;  3E6Z X;  5C4H A;  1ENF A;  3OIP A;  2DNC A;  1G2S A;  4RAU C;  1DOM A;  2NVY B;  2KVM A;  1UAP A;  2L11 A;  3KLS A;  1LT4 D;  2QDB A;  3HP3 A;  4A3K B;  5CV9 A;  3SR1 A;  2MHV A;  3DUZ A;  1STH A;  4F87 A;  4FP5 D;  1JOR A;  1HA6 A;  4QMG A;  5C4X B;  3MXP A;  2Q8R E;  1LT5 D;  1LTA D;  4QB4 A;  2XWB B;  2SEB D;  4N9P A;  3DXJ C;  1SND A;  4DF7 A;  1XXG A;  2B2T A;  1KDC A;  3I3C A;  4R8I A;  5IOD A;  1HRJ A;  1JWM D;  3CKI B;  2F4I A;  3KBG A;  4Y7N B;  4FF2 A;  1LT3 D;  1JWU D;  1J9O A;  3P1H A;  3HOV B;  4XXE A;  1BCP B;  1EU4 A;  1SJH D;  4XQQ A;  2ID0 A;  4IUV A;  4KY6 A;  1Q1B A;  1SXT A;  1STN A;  2VXW A;  3I4N B;  1CA6 A;  2E76 C;  4J6H A;  1VF7 A;  2FHT A;  4ZK9 B;  4PV1 C;  3FKI B;  1YNJ D;  2ZXR A;  1WD1 A;  5BN5 A;  2ZXP A;  2A6H D;  2E75 C;  2KOL A;  4TRD A;  3PIP 3;  4PMB A;  2AQ3 B;  4DK0 A;  2WB1 B;  2J4X A;  3S16 B;  1HQM C;  3PO3 B;  1Y1W B;  3P75 A;  5G3L D;  3M4Y A;  1G91 A;  4IFD H;  3BDL A;  5KNB A;  1M4V A;  3J7Y W;  3URY A;  1S5F D;  1B2T A;  5COY A;  2AUK A;  2D9U A;  4DGZ A;  2F0J A;  1H9S A;  5A2Q L;  4LK1 C;  1HCZ A;  4K8J A;  1L0Y B;  3BZD B;  4IFD G;  2EYF A;  1MSH A;  1B53 A;  3M3Y B;  3V05 A;  3S1R B;  2M9V A;  3X3M A;  3VA5 A;  3K6O A;  1S5B D;  1U9R A;  1HUM A;  2DN8 A;  2LMC B;  2Z4H A;  1A6X A;  2H4O A;  1SBB B;  4UDU C;  2O5J C;  3HOZ B;  1WVL A;  1STG A;  5T1G A;  2C9O A;  4F7X A;  2DY8 A;  5C0X H;  4IFD I;  2PW5 A;  2R6G A;  5FO9 B;  3M85 A;  4OL7 A;  2AUJ D;  2BDO A;  3OHX C;  4HR7 B;  2NTT A;  1KLU D;  2EJG C;  1T5X D;  1S5D D;  5KIX A;  1R4P B;  4QIW B;  4C3I G;  1BF4 A;  3NTH A;  1FNU A;  3A54 A;  2PO4 A;  1OXX K;  1C4Q A;  5C0X G;  1Q3L A;  2F03 A;  2XRS D;  5ISR A;  2MP1 A;  3SK5 A;  4RH6 A;  4G7Z C;  1FYC A;  4ID6 A;  2E2I B;  4IUR A;  2A69 D;  2E74 C;  1DYQ A;  3OWE B;  5HUR A;  2JA5 B;  4C2M B;  1CZG A;  3HOW B;  4C3J B;  1I3Q B;  3DEO A;  3VA7 A;  2NVX B;  3SDZ A;  5C0X I;  4KKT A;  1CK1 A;  1DCZ A;  4NMZ A;  1RDP D;  1S5C D;  3GTG B;  1Q90 A;  1ICW A;  3L3O C;  2EYP A;  5KRU A;  2PYK A;  2RBM A;  3NWT A;  5FLX L;  1V43 A;  1LV9 A;  3H09 A;  1LTT D;  3A8I E;  5M5Y B;  3TZU A;  5FKA C;  3QOJ A;  4KJN A;  5CGK A;  2L12 A;  4EVO A;  1AEX A;  3J80 E;  4PMC A;  5C6A A;  2FJ2 A;  5FO8 B;  2LY7 A;  3VR3 A;  5CBA E;  3BDC A;  4BBR B;  1LLR D;  3VYU A;  1PZJ D;  2HUG A;  1TS2 A;  3DHQ A;  1KNA A;  2R61 A;  3HRZ C;  1D6E C;  1IYU A;  4X3K A;  3MA2 B;  1J8I A;  5KND A;  2K5W A;  5DM6 3;  5JVH 3;  3QOL A;  2CVR A;  1TS4 A;  3N52 A;  1WCM B;  2BCO A;  1H9K A;  5C5L A;  2VB3 X;  4RCO A;  1F9Q A;  3SK8 A;  3QO2 A;  1FNV A;  1SYC A;  3SE0 A;  2PZU A;  1BCP C;  1SE2 A;  5K36 H;  1II3 A;  3CHB D;  4H13 C;  3U9O A;  1EIG A;  4L63 B;  4C3J G;  1QCB D;  2YYZ A;  2EJM A;  1AN8 A;  1QNU A;  3MXN A;  1B3A A;  2A6E D;  5JVG 3;  4KTA A;  3TP7 A;  1V1O A;  4MN3 A;  5K36 G;  1BR9 A;  2K04 A;  5F2D A;  3S2H B;  3VR5 A;  4R8N A;  2Q8I B;  2K1B A;  2R92 B;  1RTN A;  2BOS A;  4B08 A;  1Q1E A;  3X3N A;  1Q12 A;  2L5T A;  5LHY 1;  1XYI A;  5DEH A;  2N88 A;  1PYW D;  2G9H D;  3RMH A;  2A68 D;  1EEI D;  3HOU B;  2D2C C;  2ICI A;  4DN4 M;  1SNM A;  2B8F A;  3GTK B;  3LWU A;  3DMU A;  1STA A;  2QCP X;  3UI2 A;  1QB5 D;  2K32 A;  1RTO A;  2PW7 A;  2B2U A;  3PMF A;  1IKM A;  4EGV A;  2OF1 A;  2B63 B;  3SK6 A;  1EQV A;  2F0O A;  3FRP B;  1PFB A;  1F2Y A;  5KEE A;  5CV4 A;  5EKL A;  2BE5 C;  3NQI A;  1SNO A;  3BS1 A;  4CJ2 C;  3MXU A;  4HMI A;  1TR5 A;  3PV0 A;  3I72 A;  3JAM L;  5IT9 L;  4B9X A;  2JA6 B;  3H0G B;  4NKL A;  2CHB D;  3U9S A;  1WD0 A;  1JOQ A;  2IT1 A;  1JWS D;  3NE5 B;  2EXZ A;  4KJO A;  2EE1 A;  3HGB A;  1LTS D;  1H9M A;  1IKL A;  2K28 A;  5DAU A;  2QIL A;  2D5D A;  4KV6 A;  5KGU A;  2J7Z A;  2K33 A;  4HN7 A;  3CU7 A;  3K0Y A;  1SMY D;  1EY9 A;  4B9W A;  1LAC A;  2MUY A;  1I6V C;  1PFN A;  1U4M A;  4NW2 A;  5CV6 A;  1SDF A;  3FPP A;  2KCC A;  2EYM A;  1F9S A;  3KUP A;  4DK1 A;  4KMU C;  3C46 A;  3SHL A;  1DOK A;  3TP5 A;  1WTR A;  3LWE A;  1JE4 A;  4K8I A;  3S15 B;  2EJF C;  1O80 A;  1ILP A;  3WDN A;  2BDN A;  2JYO A;  5E4W C;  1K8M A;  5G3L F;  2O2L D;  3GTQ B;  3GTP B;  1DM0 B;  3AU7 A;  1V1P B;  3PUV A;  3NK9 A;  4KK7 A;  4X3S A;  3HKZ B;  1HTP A;  2YU9 B;  1TQO A;  1F77 A;  3DWP A;  4KN4 C;  3NHH A;  1MI2 A;  1TY2 A;  1K8O A;  4OIK A;  3S2D B;  4YIJ A;  1Y1V B;  1I4R A;  5IIF A;  4FF4 A;  1AFP A;  2LFN A;  1A3T A;  2JA7 B;  1T5E A;  4BY1 B;  4KKS A;  4A93 B;  1I4H A;  4IQZ A;  4CBV A;  2FFK B;  2KEE A;  3D6W A;  2A73 B;  2NZ1 D;  2C5C A;  4RGT A;  5EGT A;  2Q8T A;  2F3W A;  1PFM A;  2K01 A;  1DXM A;  4ODG A;  4FF1 A;  5DNF A;  2EYH A;  1F2L A;  1GOZ A;  4PMW A;  4WRD A;  2RDG A;  3QG1 A;  2E2H B;  2JA8 B;  2F0G A;  4HED A;  4BWG B;  1B50 A;  1EY4 A;  5C3X A;  4FO2 A;  1BUV T;  4BA1 I;  2F0H A;  5EPJ A;  4V19 0;  1PRT C;  1PTO B;  5IGB A;  3Q24 A;  1A2T A;  4FXD A;  5LL6 X;  1HXY D;  2NTS A;  4KI0 A;  1D1I A;  1QWY A;  2SNM A;  3R93 A;  2B2W C;  1MGS A;  5C5M A;  1CI3 M;  1TWA B;  5I6Y A;  2RKS A;  3I73 A;  2IX3 A;  3G6J B;  3OOC A;  1TWF B;  4XTC S;  1E0B A;  2A5H A;  4ULL A;  4G57 A;  5JJZ A;  1V8Q A;  2F0F A;  1TY0 A;  1OXU A;  1VDZ A;  4Z9C B;  1JIC A;  4JK1 C;  2JP1 A;  2IPK D;  2IX0 A;  1LO5 D;  3OWF A;  4J8Q A;  4C3H G;  1WTQ A;  2DNE A;  4K5X A;  2B2T C;  1UNS A;  3A56 A;  4EQP A;  1W6J A;  4C3I B;  1PLF A;  3OPO A;  1PTO H;  3TDQ A;  1A2U A;  1E2Z A;  1VF5 C;  5C3E B;  3V2T A;  3EQL C;  1UEA B;  5A2Q E;  1G29 1;  1ET9 A;  1E2V A;  5I6W A;  4M8A A;  2E2D C;  5CR3 A;  5EBC A;  4C56 C;  2VNU D;  2ICE C;  1SSO A;  1EL0 A;  1B9M A;  3SK4 A;  1I50 B;  2SDF A;  1V1P A;  2PQE A;  3GV6 A;  2M00 A;  1SEB D;  1ZEQ X;  3P7J A;  5I9O A;  3ERQ A;  1FNW A;  1AZP A;  2WKC A;  2NB0 A;  1EY5 A;  3LNN A;  1SYG A;  2RSN A;  3R8B A;  1TS5 A;  3ZYY X;  4DXG A;  3MWY W;  5ELF A;  3VYR A;  3K57 A;  4DAY A;  1PZK D;  5CV8 A;  5DM7 3;  2PMZ B;  3HOX B;  3NQT A;  3K5L A;  1D5Z C;  1OXV A;  2SNS A;  2KJX A;  5JEA H;  2A74 C;  2LKV A;  1F2Z A;  2BA0 A;  2HCC A;  4UAI A;  4DU9 A;  1GUT A;  3AB9 A;  3T51 B;  3ND9 A;  3FDT A;  2XIW A;  2MJ8 A;  5JEA G;  1AZQ A;  1DZ1 A;  3G7L A;  1O7Y A;  1WTW A;  3MC0 B;  2MGS A;  4DNR B;  2F0L A;  4KHZ A;  5IGD A;  5EPL A;  3L9A X;  5KYL A;  2HDM A;  2L55 A;  1HQR D;  2WV6 D;  1GUO A;  2LS0 1;  2JXM B;  2EOT A;  4K6D A;  1YNN C;  3T56 B;  1BCP D;  3VYT A;  3C1E A;  2O5I C;  1Y8O B;  3Q0A A;  4CHT B;  3K5M A;  1EZ6 A;  3F2U A;  3H6M A;  2FMC A;  5D65 A;  1GUS A;  3KBX A;  4H0L C;  1BNZ A;  1EWH A;  4ZAI A;  1Z6H A;  2AWO A;  2L1B A;  3IL8 A;  3E5S A;  4DA2 A;  5BN4 A;  2NVT B;  5JOB A;  2Z4I A;  2GA4 B;  1F9R A;  3J7A F;  4KD4 A;  1STY A;  1F9P A;  1ILQ A;  1B4O A;  4EQO A;  3ND8 A;  2XN9 C;  2BA1 A;  2F0T A;  1PTO C;  2K03 A;  4DNT B;  2FMM A;  3VR2 A;  1ESF A;  2QF7 A;  5M5W B;  1EU3 A;  3NSW A;  1SNC A;  1EIH A;  1DJR D;  4KD3 A;  3CRK C;  1H9R A;  1CT1 D;  2K5Q A;  1IYV A;  4KKU A;  5CBE E;  4CGY B;  1HHV A;  4ZUJ A;  4XT3 B;  5EBD A;  1RJT A;  2X69 A;  3QWN A;  1R9T B;  2F0V A;  1C8C A;  3J81 L;  2ZT9 C;  5M5X B;  2WP8 J;  1JR0 D;  3DWQ A;  1STB A;  2Z1C A;  2KED A;  1G8Z D;  3K59 A;  3S1Q B;  4A3D B;  5KNC A;  3BYY B;  1OXT A;  2BE5 D;  2CW0 C;  1RKN A;  3PUX A;  1GUG A;  1SYD A;  3GTM B;  1EZ8 A;  1GJX A;  1CA5 A;  2QEJ C;  1EY0 A;  4X3U A;  2L4N A;  3Q6S A;  5C4J B;  2K7V A;  3K5N A;  2EYJ A;  2B8G A;  3RZD B;  3HOY B;  1F2M A;  2F0D A;  1TWG B;  1FGB D;  5HGT A;  3M4O B;  3BDO A;  2XNA C;  5E1F A;  1NSN S;  4XIG S;  3MHB A;  4U68 A;  3RLF A;  4ZKB B;  3SEB A;  1X3Q A;  3GP7 A;  2B2Y A;  3PUZ A;  2XRQ D;  1TKW B;  5K5P A;  2VUM B;  1EY8 A;  1CTM A;  4J1M A;  3M7N A;  1BXT A;  1IW7 C;  4CJ0 B;  1OXS C;  3A8K E;  1Q8I A;  4KN7 C;  3OMG A;  4FXG C;  1RF2 D;  3JAM E;  1KAA A;  5IT9 E;  4BBS B;  3K7A B;  2OEO A;  2B2V A;  4G4K A;  1Y8P B;  3QIA A;  3SVM A;  2F3V A;  3H94 A;  5IGC A;  4CKE A;  3GD7 A;  5M9O A;  4KHV A;  1NUC A;  5IGF A;  3I4L A;  1E2W A;  2Y0S B;  1KLG D;  3MZ5 A;  5I2X A;  1A15 A;  3FVQ A;  3VR6 A;  1GUN A;  1I4P A;  1NAP A;  1BDO A;  2PNR C;  4QUF A;  2B2U C;  2EDG A;  4P2C B;  1WTP A;  1JOO A;  2CQA A;  4XDX A;  3TSS A;  4BY7 B;  2B2V C;  5IGE A;  1B44 D;  4QF4 A;  3IAY A;  4IUP A;  1R4Q B;  3S14 B;  2J0T D;  3D4D A;  2NWG A;  1U4L A;  2EYO A;  4LAA A;  3HG9 A;  4QCL A;  3J7A V;  1MD2 D;  4S3S A;  5C4Z A;  1Y69 U;  1KAB A;  1PRT D;  1C48 A;  4CKC A;  4O42 A;  5EJW A;  1DOL A;  2N55 A;  3T4A C;  1WTO A;  4AYB B;  3S1M B;  4QUC A;  3HZX A;  1MSG A;  4HMJ A;  5IOC A;  4OO1 H;  1JQY D;  2IL8 A;  2L0C A;  3EJI A;  2EVB A;  3OW7 A;  5ELB A;  3P20 A;  1DON A;  5FK9 C;  2OXP A;  1ZXT A;  2KHS A;  1PDQ A;  3BVM A;  4OO1 G;  2F1M A;  2NVQ B;  3N6R A;  1XWE A;  2K5D A;  3OMC A;  5EKI A;  3NBH A;  3TME A;  4I7Z C;  2O4X A;  3A7L A;  4L6T B;  3OSO A;  5TSS A;  4C3H B;  2F0I A;  4WJW A;  3NTK A;  2RSO A;  2AWN A;  5E4X A;  2NBF A;  1DD2 A;  3WOE A;  2NN6 H;  4MHE A;  1JOK A;  2KEC A;  4Q5V A;  3H3V C;  4C1N I;  3D3R A;  1KNE A;  3MFG A;  2K05 A;  4OO1 I;  1EYC A;  3C1F A;  3TP8 A;  4EQN A;  1HTL D;  4RGO S;  1ZYR C;  5NUC A;  1SFO B;  2NN6 G;  2RA4 A;  3A8J E;  3HEJ A;  4RA8 A;  3R2T A;  3PIO 3;  1I4Q A;  1U4P A;  4PNY A;  2WAC A;  1EYD A;  1BCP F;  1OO9 B;  3MAQ A;  1LT6 D;  2AQ1 B;  1QIL A;  2OT2 A;  2I46 A;  2PCF B;  4V0B A;  3V96 A;  2JE6 I;  2NYZ D;  1CQF A;  3ITP A;  3GTO B;  5JPM C;  5ELE A;  4GZY C;  4FXK C;  2EZV A;  1BBX C;  2NN6 I;  4RKB A;  4RKL A;  3MFY A;  3T16 A;  4DXF A;  1HFG A;  2R93 B;  3D4R A;  1NR2 A;  3MXG A;  1M8A A;  4A3G B;  2R3Z A;  4R9W A;  2RDF A;  2F0P A;  1EWC A;  1EY7 A;  3NXW A;  3KLR A;  4PQX A;  4ZKC B;  5CV5 A;  4M1U B;  1GHK A;  5IGG A;  4I65 A;  2RQX A;  5LL6 S;  2F0U A;  4LJZ C;  4LMQ D;  3Q22 A;  1UUP A;  1QG7 A;  5D3I B;  1PMR A;  5ELD A;  2WAQ B;  3GQB A;  3A7A B;  3K5O A;  1EOT A;  1D2B A;  3AMU A;  1TWH B;  1TII D;  1ROD A;  5I2Y A;  1PXU A;  5FO7 B;  1ML0 D;  1HA5 A;  5CV7 A;  1D1K A;  1YNN D;  4A3B B;  4G7H C;  4TQU S;  1XTC D;  1TWC B;  3RZO B;  3I4M B;  4RFB A;  2HCI A;  2RDH A;  5I9P A;  5ELC A;  4NDX A;  4F88 A;  4DAV A;  1CFM A;  1LTB D;  3QB3 A;  2XWJ B;  4IUU A;  1WTV A;  4DAP A;  1IHZ A;  3CQZ B;  2I07 B;  3KK7 A;  1G2T A;  2ENB A;  1L0X B;  2EY1 A;  3TN2 A;  2R7Z B;  4OIJ A;  1EFI D;  3DEP A;  1BQQ T;  3TP6 A;  3FPU B;  1JB3 A;  4RHR A;  4K6L A;  3EA6 A;  4ZQ3 A;  4Q0F A;  1PTO D;  1LAB A;  1SNP A;  1YNJ C;  2EPB A;  1TS3 A;  2KQ3 A;  1EQT A;  4HCE A;  1JCK B;  3TBI B;  2A6H C;  1QJO A;  2HDL A;  1TVX A;  1LTG D;  1B1Z A;  5J22 A;  5I4D A;  4H7B A;  4BA2 I;  1SYB A;  3NBI A;  1STE A;  3BYT B;  1O78 A;  3S17 B;  3T13 A;  2F0K A;  5FLX E;  4K5W A;  2X6L A;  4HTH A;  5E3F A;  1BO0 A;  2F0Q A;  4ZLT F;  2TMP A;  5AFW A;  5A35 A;  2CW0 D;  1SAP A;  4RWS C;  4XYO A;  4DFA A;  3GV3 A;  4RHS A;  2WII B;  4IUQ A;  2WKD A;  1QNK A;  2QKI C;  3QJY A;  4IN3 A;  1S4Z A;  1SE3 A;  5BN3 A;  3M7G A;  3W3A A;  5EQ0 A;  1SE4 A;  4TKO B;  2WIN B;  4HCS A;  1KDB A;  2G9D A;  3ONA B;  1A3U A;  3D31 A;  1EY6 A;  1LTR D;  3BVZ A;  3NP8 A;  4IFD J;  1HPC A;  3NPP A;  3Q23 A;  1TU2 B;  4FNF A;  1A3V A;  3J81 E;  4OGQ C;  4K2K A;  3KLS X;  1CM9 A;  5EPK A;  1QOH A;  3O13 A;  3S1N B;  3SXH A;  4A3J B;  3GTL B;  2JSO A;  1GHJ A;  1CHP D;  4ZYS A;  3I8Z A;  4XQN A;  4F8M A;  1S5E D;  2EY2 A;  1G6Z A;  2X6G A;  3RUZ A;  3T53 B;  4ME5 A;  1IW7 D;  3MVV A;  4ABN A;  4NP5 A;  1PRT F;  3J80 L;  1W6K A;  4L8J A;  1AW7 A;  3H91 A;  2E2J B;  1I4X A;  3RD4 A;  4A3E B;  2ZXO A;  4FF3 A;  2F0S A;  3S9W A;  4XQJ A;  1O7L A;  1ENC A;  2IX1 A;  2A69 C;  5JEA J;  5C0X J;  3VR4 A;  2H1E A;  3W2D A;  4FVM A;  1RD9 D;  2DY7 A;  4A3I B;  5CYU A;  1CHQ D;  1Z7T A;  2EY5 A;  2EY6 A;  3C3L A;  2PZT A;  4IUT A;  1PRT B;  5J1Z A;  3C2P A;  5JAV A;  1ONL A;  1D5X C;  3ERO A;  3GO5 A;  4BS9 A;  3IFT A;  1BOS A;  1RCV D;  1GXD C;  3KF8 A;  3LX0 A;  3BG3 A;  4ILW A;  1ZKO A;  5T1I A;  2K6A A;  3NTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...