1WTXA

Hyperthermophile chromosomal protein sac7d single mutant v26a in complex with dna gtaattac
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
MVKVKFKYKGEEKEVDTSKIKKVWRAGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*GP*TP*AP*AP*TP*TP*AP*C)-3'
publication title Probing the DNA kink structure induced by the hyperthermophilic chromosomal protein Sac7d
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
total genus 12
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wtxA00
4IURA 1EOTA 3FPUB 2EOTA 1WTVA 4O42A 4U68A 4QUFA 1RJTA 2H1EA 2B2VC 1QG7A 4X3KA 1VMCA 2MP1A 3DEOA 1NAPA 1IKMA 2HCIA 2KEDA 3FDTA 4IUVA 1CA6A 1BNZA 1EL0A 1NR2A 1O7ZA 1M8AA 5EPLA 1C8CA 4UAIA 4CJ1B 4R9WA 2NYZD 4CJ2C 2X6GA 1O80A 1JICA 1MI2A 3LWEA 1A15A 3G7LA 4IUPA 4LMQD 1G2SA 1DOKA 4XT3B 1E0BA 3Q6SA 1ILPA 4MN3A 2KVMA 1MGSA 1WD1A 2L1BA 1RTOA 3GV3A 3TZDA 3I91A 4OIJA 1J9OA 1EIGA 1SDFA 1WD0A 1WVLA 1HA6A 1HFGA 2R3ZA 3F2UA 3HP3A 1G2TA 1XX8A 2B2YC 5CBEE 1F9SA 1F9QA 1ML0D 2HCCA 2KEEA 2L4NA 3D6WA 3H91A 5T1GA 1O7YA 2NZ1D 4CJ0B 4HEDA 2DY7A 1HUMA 1WTQA 2IL8A 2HDLA 1LV9A 4R8IA 1U4PA 4X3SA 1WTRA 1DOMA 2DY8A 2XIWA 2HUGA 1ILQA 1SAPA 5EKIA 4ZKBB 3I90A 4IUTA 2CVRA 4XDXA 4RAUC 1CM9A 1RTNA 5DNFA 2N55A 5CMDA 1G6ZA 2B2YA 1MSHA 1HUNA 3TN2A 5CBAE 1BF4A 4X3TA 2SDFA 3UI2A 1QE6A 4XT1B 1WTXA 5E4WC 1NR4A 2B2VA 1XYIA 5EQ0A 1EQTA 1PFNA 2EPBA 1HFNA 1ESRA 1NCVA 1RHPA 1U4LA 1X3PA 5EPJA 1KNEA 5D65A 2FMMA 5EJWA 2K04A 5JJZA 1DZ1A 3R93A 1ZXTA 1HRJA 2L11A 1IKLA 5EPKA 1B3AA 4NW2A 5COYA 1WTPA 1U4MA 1B4OA 4ZLTF 1AZQA 2FFKB 2RSOA 1SSOA 2B2WC 1BO0A 2KUMA 1S4ZA 2K05A 1F9PA 1PDQA 3MTSA 1F2LA 1Q3LA 2K1BA 1KNAA 2L9HA 2VXWA 3I3CA 1PLFA 3ONAB 2N88A 2RSNA 4HSVA 1CA5A 2M2LA 1U4RA 5CORA 2JP1A 3P7JA 4IUQA 1AZPA 4ZAIA 4RWSC 2B2TC 2FINB 4X3UA 4QUCA 3SVMA 4MHEA 5E4XA 2X6LA 4HAEA 1B50A 3QO2A 1ICWA 2JYOA 3IL8A 2B2UC 1F9RA 1RODA 2BDNA 2Q8TA 1GUWA 2K03A 3N52A 1PFMA 2RVLA 2NWGA 2D9UA 2K28A 3GV6A 1PFBA 5AFWA 3KBXA 1B53A 3IFDA 1DONA 2J7ZA 2RA4A 3DM1A 3I8ZA 2B2WA 1VMPA 2FHTA 4RA8A 4ZK9B 1AP0A 1G91A 1HHVA 1X3QA 1J8IA 2Q8RE 2KOLA 2KECA 1B2TA 1EIHA 2MJ8A 5D14A 2B2TA 2L12A 3KUPA 3MWYW 2EE1A 2X69A 5T1IA 1IL8A 1WTWA 1MSGA 2B2UA 1QNKA 4HCSA 4IUUA 2HDMA 2MPMA 1X32A 4DN4M 2MGSA 1TVXA 1DOLA 3DEPA 1BBXC 4ZKCB 4OIKA 2FJ2A 2K01A 1WTOA 1JE4A
chains in the Genus database with same CATH superfamily
1K73C 4DXGA 3DWQA 4DR3Q 4KHZA 3X3NA 4A3KG 2NZHA 5C44H 1QG7A 2EY6A 4JI3L 1NR2A 2PO4A 2BDOA 2PMZB 1FGUA 4A3MG 3PO2G 1PH5A 4K8JA 1BDOA 5FO9B 2X6GA 5IGCA 4DR7Q 1NY4A 3OYYA 3F8TA 3IRBA 4K6LA 4DR3L 3I4OA 2XTIA 3C1FA 1IBLQ 2ES2A 3EROA 3OWEB 4ODGA 1XJVA 4DAVA 4XIGS 2JA9A 3A54A 1VQ9A 3GTGH 4GNXC 3G6JB 4UPAA 4A93H 2NZOA 2HDLA 1LV9A 3K0XA 1EFID 3MXPA 2XIWA 1ILQA 1VQJA 4DPGA 5I4DA 1E1TA 1S72A 1HZAA 2AUJD 5LMUL 3DMUA 1LUZA 1MSHA 1PH8A 3W1BA 3I4MB 2WB1E 2HIXA 3VR4A 4JBKA 5IP9G 3HOZB 3BDOA 4U673 3GTGB 3K80C 3Q22A 4HJ9A 4A93B 2BOSA 1STBA 1W6JA 1HH2P 3AMUA 3EVQA 1U9RA 4NKLA 5JVH3 2I5MX 4CHTB 1HRJA 3Q8DA 4PV1C 3CCVA 3KDFB 2F3VA 1BCPF 2B2WC 1C9OA 3TQYA 4LUZA 4KV6A 3Q0AA 1Q46A 3CCQA 4YIJA 4C2MB 4GN4B 2F52A 3HOUG 2X6LA 3S17H 1SYEA 1GUWA 3U4VA 3RN5A 5M5YH 2RVLA 3OWFA 1ICFB 2PW7A 3E9IA 3HOWB 2CWAA 3RR5A 1ENAA 1Q7YC 5GROA 1A2UA 4Z9CB 1N34Q 1KRSA 1TIID 3I55A 3S17B 1MBYA 5D14A 4IJHA 4APVA 3KUPA 2WAQB 5C4HA 4RCOA 1WTWA 1MD2D 4QY7A 2KCNA 2PI2A 4UP9A 3L7ZC 1KAAA 2MPMA 4S3SA 4TKOB 4DN4M 1UE7A 2KHIA 4ZKCB 2H4OA 4MZ9A 1B7YB 4YWKA 2HT1A 2OQKA 1J5EQ 1N34L 4XYQA 4IUVA 3AFQA 3GD7A 1M8AA 5CV9A 1SMXA 5EKLA 4IOCA 1A2TA 1A3UA 4DR6L 3T1YQ 4QMGA 3J81j 2KJXA 3J7AV 3A55A 3BG3A 1J5EL 4OO1G 1U5KA 1QVGA 3RZDH 1K9MC 1TWCB 2RHQB 2F0FA 2JA5H 3QR8A 2RCNA 1NMGA 4HIMA 2F0EA 5BN4A 1O7YA 1XXGA 3KF6B 2CQAA 3HOVH 4IQZA 1PH9A 5JPMC 3AEVA 2K33A 4DV6L 2E75C 2DY8A 3U9OA 2K5DA 1SAPA 2EYOA 3JAMi 3DHQA 2NB0A 2CHBD 3CCMA 4IUTA 3RZDB 1GVPA 5IYCH 1RTNA 5DNFA 5K36G 4DNTB 1ASZA 3K7AH 1A8VA 1D5XC 1EYCA 4DV3Q 3I7FA 3P1HA 2F0TA 1Q90A 3GTKH 2JSOA 4IFDG 1PYBA 2J4XA 3VDYA 5KEEA 4HN7A 5HY6A 2KUMA 2LMCB 1Q3LA 3K7AB 2EIFA 2VB2X 2I5HA 1HR0L 1FR3A 1B70B 2M2LA 2XNAC 5CORA 4DV3L 1I3QB 4RMFA 3AYHB 3PUZA 4ZUIA 3E5SA 3GTOH 2JYOA 3HG9A 4QB4A 4K5VA 2BDNA 1PYSB 4KK7A 1QNUA 1EWIA 1LTBD 1N33Q 1Z6HA 1PZID 4GOPC 4C1NI 5C3XA 3EIVA 3NEMA 3GTLB 4DV0L 5J39A 3NELA 2EYHA 3MWYW 5J1ZA 4JI4Q 1MSGA 4FVMA 1KABA 3MEFA 1N33L 3EJIA 1QILA 5L37A 1M4VA 1LT5D 3JC66 4LWCA 2XSCA 1PA6A 1VQHA 4GNXB 4U68A 4A3DH 4OELB 3NWSA 3VR5A 2WKDA 1SFOB 1HZ9A 1SR3A 1WCMH 3HKZG 3CHBD 4KY5A 3MHBA 1Q8IA 1EIFA 2HD3A 4I7AA 2N3SA 5CV7A 4YY3L 1E0BA 4V0BA 5BN3A 4P71A 2L1BA 1RTOA 3J80E 4JOIA 2DJGC 4A3DB 3E6ZX 4JVZA 1SDFA 5I2YA 5EGTA 2NN6H 1X55A 4Q5VA 1HFGA 3Q24A 2IX1A 3PV0A 3K81C 3PSIA 1F9SA 3C2PA 4UHVA 1WCMB 4HMJA 3K59A 5C4JB 1KRTA 3Q23A 5DEHA 3H6MA 3S24A 4H7BA 2PW5A 3QJYA 1E1OA 1H9MA 4BBSB 1XTCD 1HNZQ 3I4LA 3A8IE 1X65A 4A3BH 1NE3A 1LTSD 2UXCL 1O78A 3TN2A 3VYSA 5FLXE 1K8MA 1WOCA 1TWHB 1UUPA 4A3EG 4DUZL 3EBEA 2D5DA 4Y52H 4B9XA 1I6HH 4NXNQ 2N8NA 4JI5L 3M4OB 3TRZA 3D8GA 2LXKA 3H0GB 4J8QA 4ZYSA 3HZXA 5I9OA 1VCIA 2K4KA 4O0AA 2R7ZG 1HNZL 2Q2HA 1F77A 4EX5A 3A0JA 2NTTA 2JA5G 1ZKOA 3P7JA 3SVMA 1I6HB 2B2TC 4HAEA 4JCVE 1CQVA 3ULLA 4XQJA 3HOVG 4IPCA 1LTRD 2K32A 2K28A 4JBWA 4X66Q 2WB1G 2F0LA 4C3HH 4DK0A 1JJCB 5IT9L 1AP0A 1Y1VB 3CXCA 1VQ4A 1JR0D 2PZWA 2EYJA 1M90C 1P16A 1PZKD 3TEHB 4JV5L 1I4PA 5T1IA 3DLLA 4X66L 2AWOA 3DEPA 2AHOB 1K0SA 4YCUA 2PNRC 2DN8A 4IALA 3VYUA 4QUFA 4KJNA 1JWMD 4J15A 2LS01 1EL0A 1B44D 1BNZA 2R61A 4TVAB 2EVBA 2ZXPA 2KCTA 3FP9A 5C0XI 4DGZA 4DV5L 3GDEA 4XT3B 3T1HQ 3NBIA 4A3JH 3A8JE 3CC4A 2EYMA 2QW7A 4L5SA 2AMCB 1SYDA 1IBML 1XX8A 2KEEA 1UEAB 2HCCA 1V1QA 2XWJB 1IBKL 4AH6A 3FEWX 2A68C 4LFBQ 2QF7A 1Y1WH 3G48A 2B63B 2NVYH 1HCZA 1TY2A 3T1HL 4A3JB 4BY1H 4I7ZC 3TREA 4FNFA 1HTLD 3NQTA 4XYOA 2CVRA 2NUCA 4A4IA 1PTOF 3VYTA 1L0XB 2OTLA 2BH2A 4LFBL 4X3TA 1B1ZA 4WJWA 4K5WA 1VQMA 4DR5L 4L5QA 2LKVA 1SRUA 3F2BA 4JI1Q 4IOAA 1WTPA 5A2QE 5IP7G 1G51A 4IO9A 3NENA 3K8AA 4HCEA 5I6YA 1CA5A 5BR8Q 1GHKA 1RF2D 4JK1C 1XMOL 1YIJA 1S5ED 5A35A 4L5TA 1WJJA 3QO2A 2FMCA 4OXPA 2R6GA 4JI1L 2Q8TA 1Q8KA 1VQIA 4UDUC 3S2HH 5M5WH 4XQQA 3HRZC 2RF4A 1YHBA 1PH4A 1X3GA 2WV6D 5BR8L 2ZM6Q 4A3BG 2WACA 2LSSA 5M3FB 4A3KH 4OEMB 1YNJD 4F87A 2C5CA 1LT3D 5CC4A 4KI0A 1BBWA 3U58A 3S2HB 3K0YA 3OHXC 2F0KA 5M5WB 3PO2H 3R2IA 3KF8A 1GUTA 3NTKA 4UY8C 2EYPA 2F0IA 2ZM6L 1K8GA 4X62Q 1VQ6A 2VS1A 3S16H 1AFPA 2H1EA 1PH1A 4KLKA 4DUYQ 3PO3H 4A3LH 1PH6A 1Q1BA 4H13C 1NJIC 3TDQA 4JI2Q 3FMCA 4R9WA 1EQVA 4A3MB 4QIWE 1A15A 1BOSA 1ENFA 5C3EG 1SYFA 2D2CC 3HEJA 3A56A 2C35B 3ERSX 4X62L 4RH6A 3S16B 4X65Q 1KLUD 3RZOH 2LY7A 3UE0A 4DUYL 1GM5A 4QL5A 3K5LA 1G2TA 3MVVA 2K6AA 4CKCA 3K5MA 1NNXA 1V9PA 4CJ0B 4AIMA 2K14A 1KAWA 5IP9H 1Y8OB 4X3SA 3HOXH 4K5XA 3NP8A 1D5MC 4MTNA 1DGSA 2JA8G 3S14H 1SYGA 2OF1A 1YNJC 4XDXA 2V4DA 3D31A 2L5TA 2BCOA 5JEAJ 3IAYA 2OCEA 1SYBA 1XPOA 2SDFA 1YNXA 1SXTA 2RCFA 4DV7L 4C3JH 1TWAH 1A0IA 1EQTA 5GAGC 2KQ3A 3S14B 2R92B 3TBIB 1VQDA 1EY6A 3E9HA 3QG1A 4K14A 1HA6A 1LLRD 4B3MQ 3AQQA 4H0LC 1Y8PB 4BY7G 3FRPB 3ND9A 4RWSC 1TWAB 1YHQA 5CV4A 2D62A 4DR4L 2B2UC 3E0EA 1SJHD 3HOUB 1RD9D 1EU4A 5C5LA 2CW0C 2EJMA 2QILA 1W3SA 4BY1G 4DR1Q 3IFDA 2IY5B 2R7FA 2J7ZA 4LFCQ 2Y0SB 3LWUA 1Q86C 1U0LA 1J8IA 3MA2B 1QNKA 1VS0A 5CYUA 2HDMA 4LF6Q 3H15A 3A7LA 1FJGQ 5FJ8H 5D3DA 1FNWA 1I4GA 4CBVA 2JXMB 2F0QA 2Q2IA 1EWHA 1HR0W 5JPNC 3DEOA 4C3IH 3F1ZA 3BZKA 4M8AA 1CA6A 4OO1H 2EJGC 4EGVA 1CTMA 1TWGB 4K2KA 4B3RQ 4LF6L 3RUZA 1FJGL 4JI6Q 3F2DA 4RCNA 1MJCA 3GTPB 3S1QH 1F2ZA 2Q2UA 4YHHL 4MN3A 3WDNA 1EFWA 2YTYA 2CWPA 4NMZA 5JAVA 5J22A 1EIGA 2SEBD 3VA5A 1D1KA 2UUBQ 5CBEE 3J7A5 2WAQE 3D3RA 3ZJYC 5K36H 2KCCA 1L1OA 5NUCA 1RKNA 3T4AC 1PRTB 4ALPA 3K5NA 1BBUA 2F0SA 4ZKBB 1EU3A 4PMBA 4KY6A 4IFDH 4DF7A 2N55A 5KNBA 3PO3G 1G6ZA 4A3LG 1HJPA 4KD3A 4HTHA 5C44B 2A6HD 1VQ8A 1EY5A 1MHWC 3PIOA 4OO1I 1HFNA 1PVOA 1XTDA 4BWGB 3SHLA 3F2CA 4ILWA 2FMMA 1YITA 1YNNC 4DR7L 4KHVA 1S5BD 2L11A 4PQXA 2A6EC 5IGFA 2EZVA 3I56A 2K05A 2GA4B 1STYA 4HSVA 2RSNA 1IBLL 4RKBA 3JAME 1IXRA 2RHSB 3SE0A 2VQFQ 4IUQA 1HXYD 2F0GA 1CZGA 1CK1A 5KYLA 4QUCA 1O7IA 5D3IB 2VNUD 1F9RA 4IPHA 1RODA 3FKIG 3S15H 4RGMA 3HOXG 1PFMA 2LFNA 1V1PA 4K2LA 1DONA 4NP5A 2D0PA 1EUJA 2F03A 1C4QA 3K57A 4IFDI 3M7GA 5IT9c 1B2TA 2V1CC 3KBGA 4C3JG 1FL0A 4K0KQ 1LTGD 3DM3A 4BA1I 1JORA 3ITPA 3MAQA 2A6HC 1CHQD 2PQAB 3SR1A 1I94Q 4CKEA 3AU7A 1E7ZA 5BN5A 4XQNA 4DAPA 2F0JA 2JJQA 1C8CA 4UAIA 2NYZD 4K0KL 3HKZB 1MI2A 3LWEA 3PIP3 1PTOH 1IYUA 1FNUA 2ZJRA 1WD1A 2CH4W 5M5YB 1EEFD 5IIFA 1SLJA 4HIOA 1I94L 1WI5A 3U9SA 3F2UA 4KKUA 3W2DA 3E0JA 4JBJA 2VUMG 2VZAA 2EXZA 4GN3B 2MFIA 3TMEA 5C4XG 4A3EH 1VQNA 5FJ8G 3HOYG 2E2HH 4O2DA 2XVSA 2R7ZH 5CMDA 4C3IG 3A74A 2TSSA 4XT1B 1A3VA 2B2VA 2ZXOA 3IKJA 3VA7A 2K7VA 5EQ0A 4DK1A 1VQGA 2EDGA 1RDPD 1WTHA 5ELEA 2K04A 5JOBA 1H9KA 3T1YL 1D2BA 2E2HB 3G6EA 2F0PA 3S1RH 1SE4A 2R7ZB 1JMCA 2PCFB 1EY4A 1SE8A 1PMRA 5C3WA 1ONLA 2JA5B 4EVOA 3SGIA 1ICWA 3MFGA 4FXKC 2B39A 1YVCA 5KNDA 1HQMC 3HOVB 3CAMA 4PG3A 2K03A 1K8OA 1VQ7A 2D9UA 3J7AF 2WB1B 2E2IH 1HHVA 1X3QA 1X9NA 1PH2A 4JPBW 4KN4C 3BZDB 3TP8A 2GN5A 3G4SA 2NTSA 5ELBA 1X54A 1DOLA 1QUQA 3PQIA 3EA6A 3GTKB 3NTIA 5ELOA 4LF5Q 2JA7H 3T51B 2F3IA 1XNRQ 3OTOQ 1G8ZD 3IFTA 1SMYC 2HCIA 2WINB 4EQNA 3RN2A 2OWOA 4POGA 4ZCKA 3T53B 2YV5A 1L0YB 4I65A 1C7YA 1NMFA 4IUPA 5DM63 3GTOB 2OTJA 3I4MG 1JOKA 1HNXQ 5E1FA 4LF5L 1XNRL 2K75A 3KF8B 4DV2Q 2Z6BA 3PUXA 4CDEC 2R3ZA 1ML0D 3D6WA 3GP7A 3KYHC 1HTPA 5FKAC 2E2JH 5DAUA 3V05A 3OW2A 1X3FA 1E2ZA 2HHHQ 3BJUA 1SNPA 3WOFA 2K5VA 3OMCA 1JJGA 1HNXL 4R8IA 4JI4L 1DOMA 4DV2L 2L55A 1S5DD 5EBDA 3SDZA 2WFWA 2PQEA 2E2JB 1IYJB 2B2YA 3SXHA 5IP7H 1E24A 2GVBA 3EN2A 2MNAA 1F2YA 2IX3A 4NXMQ 2ZXRA 3D0FA 1STHA 1SN8A 1TQOA 4HR7B 1GXDC 1UAPA 4FXGC 1IKLA 3O13A 2WAQG 2E5LQ 2CCZA 5IGBA 3I3CA 4AYBB 3CD6A 2SNMA 1YJ9A 4JBMA 3A7AB 4GN5A 1N8RC 1HZBA 2DNCA 4LF7Q 3ND8A 4UP8A 4NXML 1DYQA 3V2TA 1KLGD 1EZ8A 5FOBB 1XNQQ 2K52A 3HFZB 4OGQC 5ELCA 2MO1A 3CQZH 3STBD 2IT1A 2E5LL 1PFBA 3CMEA 4RHSA 2XGTA 1IW7C 3D4DA 4R8NA 2Z9HA 1TU2B 3KK7A 4LUVA 4DV4Q 1GUGA 4LF7L 4A3BB 4LNQA 2B8FA 1R9TH 1XNQL 3H94A 1NBWA 2NN6I 2MGSA 4NXNL 1D8LA 4OIKA 3FHWA 3TS2A 2KHJA 1Q81C 3J81c 2Z6KA 3K5OA 5C3EH 1EOTA 1LO5D 1SNDA 2MUYA 4DV4L 1CKOA 2K5NA 2B2VC 2A68D 2MP1A 1NAPA 2PQAA 1OXTA 1EZ6A 1R9TB 4DKAC 1O7ZA 1PYWD 1D1IA 4IUNA 3AFPA 4H02A 1IHZA 4DXFA 3GTJH 1Q12A 3DWPA 2ZTCA 3S2DH 2F4VQ 1CT1D 5C3EB 4CKBA 5M3MH 1Q82C 3BVZA 4IPDA 4FF2A 1TS2A 4C3HB 2JA8H 3J80L 1F9QA 3CPFA 3STBC 1N32Q 1X6OA 4DNIA 2F0NA 4NPSA 3K6OA 4F8MA 2BH8A 2ASBA 3PCOB 2JA7G 1LABA 2ALYB 1I4RA 1I5FA 2XWBB 2ZT9C 3MFYA 4RG1A 1N32L 5E3FA 5LMNQ 1HUNA 3OMGA 2HQLA 2Z1CA 4BY7H 4EQ5A 1L1OB 5EPJA 1X3PA 5D65A 2Z0SA 1SROA 1I4XA 2XRSD 4NW2A 1SJED 2A1AA 5COYA 2K50A 1L0WA 2ZTEA 1VQAA 3NTHA 3A5ZB 5G3LD 5LMNL 4PZ6A 3M7NA 1PXUA 4YCWA 3M4PA 4YWMA 1YEZA 1SNMA 5I9PA 1GJXA 2CQOA 2BA0A 1TWFH 1AZPA 4A3IH 4E6IA 1UEBA 1Y1WB 4DV1Q 1IYVA 1P8LA 3BVMA 3N52A 2NVYB 2O2LD 1BCPB 4L5RC 3I8ZA 4BY1B 3M85A 1GD7A 3CKIB 2FHTA 4MNOA 5HGTA 1GO3E 1JE5A 1STNA 3NE5B 2KECA 1CKNA 3BZCA 1X3EA 1PRTC 1HPCA 4DV1L 3GO5A 1VQEA 3GTQH 2NVQH 2JE6I 3OOCA 1OXXK 1FNVA 3I73A 4A3FG 4JOIC 2OEOA 2AUKA 1V1PB 3MXNA 2YU9H 4JYAQ 1GUOA 4RGNA 5IYDH 2R93G 2OT2A 1UE1A 3NXWA 4KKSA 1M1KC 4P2CB 2ZJQA 4BBSG 3GTQB 2JA6H 4IPGA 2P5ZX 4ZRZA 1A63A 3P20A 4QCLA 2N49A 2L15A 4K6DA 4O1NA 2YU9B 4JYAL 5C5MA 2Y0SE 5KNCA 4RGTA 1HZCA 1SE3A 2JEAI 3CCRA 2RDGA 4R4QA 4F88A 4LW1A 1DM0B 2CFMA 3KLSA 3NBHA 4CGYB 4A3KB 2Q8IB 4FF1A 2YYZA 2YTVA 3SK6A 1G6PA 3C46A 1SYCA 3UDFA 3PO2B 1PH3A 3GTMH 3A8KE 3AB9A 4B3SQ 4RFBA 1EQQA 3NK9A 2NBFA 5CBAE 5ELNA 3PO3B 5C0XJ 5LL6X 2CW0D 1KDBA 2OQ0A 2UUAQ 4JI2L 1XMQQ 1GUNA 2R7DA 3CRKC 1T5XD 3J7ZC 4AQYQ 1JJ2A 3FKIH 3PUYA 1R4PB 2RSOA 3U50C 2Z8LA 1BO0A 3D4RA 5M3MG 4B3SL 2BE5D 1F2LA 3M3YH 1K28A 1Y69U 4X65L 4B9WA 4LF9Q 3RZOB 2JQOA 4BBRG 2F4IA 1NTGA 5A2QL 2JP1A 2JK8A 4FDBA 4MHEA 5KRUA 1XMQL 3ERQA 1S3OA 3IL8A 1B3QA 5IGGA 2UU9Q 2PMZE 1ZYRC 3TS0A 1EWCA 5JEAG 1N36Q 3SEBA 1ZEQX 3FKIB 4BA2I 3KBXA 1FYCA 3HOXB 4LJZC 3M3YB 2B2WA 1TKWB 4LF9L 1KDAA 4F7XA 1KDCA 3H3VH 1K8AC 4MIUA 2UU9L 2EXDA 1PTOC 1VF5C 2O5JC 4IUUA 1H9SA 1YJNA 1CI3M 1H9JA 1X32A 3BYYB 4C3JB 3CCUA 2VQEQ 1IL2A 1QCBD 1X56A 4YCVA 3T56B 3NWTA 3W3AA 2ICIA 4GZYC 2LXJA 1BKBA 5FLMH 4O42A 4DR2Q 4ME3A 2B63G 1H95A 3OSOA 4WJ3M 4R4OA 4B3ML 1LM0A 1D7QA 3NUCA 1I50H 5CR3A 4A3IG 2ICEC 4CJ2C 4P75A 2VUMH 4TRDA 2VQEL 1JICA 1TS4A 2BE5C 1EY0A 1SNOA 1ESFA 2PNHA 4YWLA 2A19A 2Q2TA 4IJLA 1QUQB 3GV3A 5C4XH 3J81L 4DR2L 1K3RA 1K83H 4DR1L 1WD0A 5IY0A 1CHPD 1WVLA 2QDBA 4CDCC 5JJKA 3HOYH 5CV6A 3L3OC 4LFCL 2RKSA 1FD7D 2B29A 4DA2A 4A3CH 5T1GA 4OWWB 2VUMB 4LF4Q 5IODA 4G57A 1YNND 4IZ8A 3BYTB 2DUDA 3CCJA 3H3VI 4L8JA 4FP5D 2A6ED 1AE3A 1LTTD 5C4XB 3QOLA 3CW2C 2KA7A 1S5FD 1CQFA 1CM9A 1STEA 2K5HA 5IYDG 3NSWA 4WJ4A 4LF4L 5C6AA 4QIWB 1I4HA 4C3IB 1WTXA 2A69C 4N8FA 4L63B 1PFNA 1EEID 3RLNA 4KJOA 1EIYB 3OIQA 2JA6G 4B3RL 4JI6L 3NPPA 4GKKQ 3OW7A 4ZUJA 1VQKA 3S1QB 2M9VA 5IOCA 5ELDA 1KNAA 2EYLA 3QIAA 4N9TA 4J1MA 3CF5A 3TZUA 2EY1A 2UUBL 3FPPA 1B50A 4A76A 4C1NK 3I4NG 4PMCA 3V96A 4DAYA 2J0TD 4GKKL 4Y7NH 2C9OA 3GV6A 5AFWA 4FF4A 4OX9Q 4FXDA 4A3GG 4ZK9B 1VMPA 1JC7A 1II3A 1PHJA 2Q8RE 2BA1A 4KD4A 2EJFC 5DM73 3UDXA 1KXLA 4Y7NB 3I2ZA 1KHIA 5CGKA 4OX9L 1TR5A 4RHRA 3DUZA 4GOPA 5LMUQ 5IYBG 4KKTA 3C3LA 4B3TQ 2EOTA 3I4MH 4QJFA 3QOJA 3URYA 1VMCA 2TMPA 4POFA 3HOZH 2JN4A 2VQFL 2EQSA 1BXTA 2PYKA 1Y8NB 2E8GA 1ASYA 4LMQD 1JOOA 3PIO3 2KVMA 3S15B 3CC2A 1VQCA 4B3TL 2K5QA 3PIPA 4C2MH 5LHY1 2R92G 3H91A 1VQLA 1I6VC 4GLAC 2WP8J 3J80c 2I5LX 2G9HD 1JQYD 2IL8A 4BXXG 3MXGA 3HOWH 3ZYYX 5GAHC 1UE6A 1STAA 1QOHA 2DNEA 1Y14B 2K5WA 4KN7C 1SE2A 4RAUC 1LTAD 1HA5A 5FLMG 2A8VA 3CU7A 2PZTA 3KOJA 1OXUA 2F0VA 5E4WC 1QVCA 1GOZA 3I70A 1TT2A 2EPBA 3OPOA 1NCVA 2Y0SG 4R4TA 1L2FA 3LX0A 5DLQE 3BVGA 5GQOA 5EPKA 1PTOB 3K7UC 1NSNS 2MQHA 5FLXc 1RL2A 3MTSA 1T5EA 1PFSA 1I4QA 1F9PA 1PDQA 1S4ZA 1W6KA 1YZ6A 1KQSA 4QF4A 1PLFA 2VL6A 2VB3X 4A3CG 2F0HA 2NVTH 3HKSA 1V43A 5E4XA 4DR6Q 1LYLA 3JAML 1BQQT 1C48A 2QCPX 2IJ0A 1TXYA 4OHJA 3M9BA 1A62A 2PPBC 4A3EB 1Z9FA 1UE5A 1TWCH 1D5ZC 1SMYD 2E2DC 3DM1A 1C0AA 4RA8A 1G91A 1WFQA 2QEJC 1BCPD 1EYGA 2NVTB 2B2TA 1KIXA 3PF4A 2L12A 1EY9A 2EE1A 4DV6Q 3MXUA 3VR2A 3SK8A 4UP7A 4GLVB 1VDZA 1TS3A 2K01A 2NVXH 4HMIA 1LT4D 1LTLA 3FPUB 4AYBE 5LMNW 1RJTA 2SNSA 2SOBA 3S1RB 2KEDA 1AW7A 3L0OA 3TP5A 1A3TA 5IGEA 2EY2A 1B9MA 2AKWB 5M9OA 2Z4IA 1CKNB 1L1OC 2F0DA 4R4CA 2RDFA 2NVXB 1ET9A 5C44G 3SK4A 1EYAA 1HR0Q 4OL7A 3WOEA 4IFDJ 1I3QH 3HGBA 3MXNB 2E2IB 2MO0A 2DJFC 2H5XA 3M4QA 1HUMA 1S40A 3MC0B 1WTQA 1U4PA 1BCPC 3VR3A 3CCEA 3CCLA 1QJOA 3GTLH 4DV0Q 2JA7B 4ID6A 4WFN3 3S9WA 3OTOL 1K0RA 3HOZG 4HJ7A 1BF4A 1PZJD 4A93G 2Z4HA 1NR4A 1GUSA 5M5XH 1ESRA 3NBHB 1U4LA 1HNWQ 4H44C 1KNEA 1IW7D 4P74A 1DZ1A 3R93A 1ZXTA 3KLRA 4N8X1 3KFUA 1U4MA 2FFKB 2K1BA 1SFOH 4G4KA 2N88A 4HIDA 1EY8A 4HJ8A 1F2MA 3H09A 4P73A 4X3UA 5M5XB 1SEBD 3PF5A 2IW3A 3E3XA 1HNWL 1TS5A 3U4ZA 4YY3Q 1JWUD 1S5CD 2FXQA 4NB3A 4C56C 3MZ5A 5IT9E 2HHHL 2XN9C 3HOWG 2NWGA 1OXVA 2KENA 1OO9B 3PGZA 2D0OA 4B08A 5C4JH 4A3FH 3BS1A 3PUWA 1EIHA 1T9HA 2MJ8A 2ZJPA 3DXJC 4LF8Q 1XPUA 2R93H 2X69A 3RMHA 2ZTDA 4HCSA 1QWYA 5CV5A 4BBSH 5KYIA 2FJ2A 1VQBA 1JE4A 2ENBA 4IURA 2UXCQ 1YBYA 3CP0A 4A3FB 4X3KA 5J3BA 1TWHH 3CCSA 4DUZQ 2CKZB 4LF8L 4A75A 1OXSC 2R93B 4Q0FA 4TSSA 2WKCA 4JI5Q 3M4OH 4OWXB 2VW9A 3H0GH 4DNRB 4HIKA 3CRLC 1PRTF 1EYDA 4OONA 1H9SB 1ILPA 1SNQA 3CQZB 4LK1C 4EQOA 3T13A 5EBCA 1E3PA 1QB5D 2I46A 1GHJA 1CKMA 1D6EC 2NZ1D 5FO8B 2AQ3B 5I6WA 1ENCA 1EY7A 3S1NH 1CUKA 1WTRA 3KDFA 2OXPA 5EKIA 2QA4A 3R3OA 5G3LF 1Y1VH 1EOVA 4IN3A 2L0CA 5C0XH 2G5DA 2E76C 1DJRD 2AWNA 3N6RA 1AE2A 1YHAA 4KY7A 4RGOS 5EKKA 4CDDC 1OTCA 2EY5A 1W2BA 3BU2A 4JV5Q 2I0QA 4OWTB 4LFAQ 1K3BC 5LL6S 4HJAA 4BBRH 4K8IA 1B8AA 3S1NB 2IHEA 1VQOA 1RCVD 3P75A 5JJZA 5K5PA 3GTJB 2O5IC 5IYCG 5JVG3 3LGJA 2RDHA 4M1UB 4DK6C 4G7OC 4ZLTF 1AZQA 1KD1C 2F4VL 3S2DB 3H3VC 5JEAH 2UUCQ 2VXWA 2YTXA 1PRTD 4KMUC 5M3MB 4PMWA 3J7YW 4LFAL 3L9AX 4PNYA 5E7NA 3VR6A 2JA8B 4ZAIA 4BBRB 4QGUA 5TSSA 4DV5Q 5IWAQ 3L2PA 4GLXA 3ULJA 4L6TB 1Z47A 1E2WA 3EFXD 3KLWA 2A74C 2B8GA 3KLSX 5FLXL 2UUCL 3G71A 4QQBX 4JC0A 2PI2E 1VQPA 3OIPA 1IBMQ 5AJ3Q 1IBKQ 1FGBD 5H1SE 2KOLA 1LTID 5IWAL 2B63H 4DFAA 4ME5A 3GQBA 2B2UA 4JI8Q 3T16A 3J80i 3DWAA 4BY7B 1DXMA 2XRQD 3UE1A 4LAAA 4DAYB 1STGA 2M00A 4KTAA 4KHPQ 4GKJQ 5AJ3L 1WTVA 5JJLA 4WORA 3VYRA 3KF6A 1CSQA 3TSSA 2DGYA 3R8BA 5F2DA 1O7LA 4DR5Q 4JI8L 1TWFB 2F0MA 4A3IB 1EQRA 5KIXA 1G2SA 4KHPL 1V8QA 2O4XA 3C1EA 4JI0Q 4GKJL 1BVSA 1MGSA 4A3DG 4MTKA 4OIJA 1IZ6A 1J9OA 4GOPB 3HP3A 1WCMG 1XMOQ 3EQLC 2B2YC 2B3GA 4ZQ3A 2JEBI 1Z7TA 2MHVA 5FO7B 1AN8A 2WIIB 4HEDA 3MEHA 2DY7A 3QWNA 4AYBG 4JI0L 3TP7A 2NN6G 2F3WA 3UDIA 2A5HA 1SNCA 3I90A 2NVQB 1E2VA 4XTCS 5M3FH 3BDLA 1V1OA 2F0WA 3PUVA 4PZ8A 2RQXA 3KJPA 4HJ5A 1QE6A 1ZYRD 4JI7Q 4WRDA 3H0GG 4RKLA 4FF3A 3D4WA 3NQIA 1RHPA 4R1JA 3RD4A 3RNUA 1ET6A 3I4NH 3RLOA 2JA6B 2GVAA 1B3AA 5ISRA 1B4OA 2KBNA 4JG2A 5GAEC 4NDXA 5ELFA 1AH9A 1AEXA 3ONAB 1KC8C 4A3GH 1PTOD 5HURA 4JI7L 3PMFA 4A3MH 1VQFA 1H9RA 1GKHA 2EYFA 1JCKB 4X6AH 3I4NB 3S1MH 3KJOA 1QZHA 3JAMc 4GNXA 1B53A 4EQPA 1Y1VG 2RA4A 2Z6KC 1G291 1JB3A 5C0XG 4ABNA 1WYDA 2IWHA 1XPRA 4A3GB 1QVFA 3SK5A 3GTMB 2AQ2B 5EAYA 3R2TA 3J81E 5IYBH 1QZGA 1DCZA 1CSPA 1IL8A 5FK9C 1KTKA 3CPWA 3S1MB 4C3HG 3BDCA 1TVXA 2UUAL 3I72A 1HQRD 4N9PA 3TP6A 2IPKD 1BUVT 4GS3A 1J6QA 3ULPA 1JB7A 4AQYL 2G9DA 1PV4A 1IKMA 4LUOA 3FDTA 3CC7A 4DV7Q 2HIVA 3M4YA 5EPLA 1LACA 2PZUA 1UNSA 3ER0A 1FVIA 4CJ1B 1YI2A 1MJEA 1B9NA 1O80A 2R92H 1N9WA 4G7HC 3G7LA 3W1GA 1DOKA 3Q6SA 4HSPA 2ATWA 3W5OA 1VQ5A 3TZDA 1N36L 3I91A 4BXXH 4G7ZC 3HS0C 1JWSD 2I07B 2A69D 4DK3C 1BR9A 2L4NA 4DR4Q 2AQ1B 3HOUH 3ICEA 2F1MA 4FYDA 2KCMA 1CFMA 4BS9A 3A5UA 2VY3A 5CV8A 3RLFA 4A3JG 1DD2A 4FO2A 2HQEA 1MIUA 1CZWA 5KGUA 2HUGA 4J6HA 2IHFA 2F0UA 2E74C 5IE8A 2QKIC 3K58A 2N78A 2QGQA 3X3MA 1Y1WG 1MKHA 2UXDQ 5C4ZA 5GADC 3LNNA 3UI2A 1R4QB 1XYIA 1SBBB 3FVQA 1LT6D 1I50B 5JJIA 5EJWA 4DAMA 2UXBQ 4X64Q 1E22A 4R4IA 4CDFC 2ID0A 1JOQA 1SSOA 3D6CA 2L9HA 3NHHA 1NUCA 2UXDL 5IGDA 1XWEA 1K83B 1TWGH 1TY0A 1U4RA 2IX0A 1YJWA 2QEXA 2FINB 3HOYB 2KHSA 2F0OA 2A73B 3GTPH 2RBMA 2UXBL 4YHHQ 4V190 4X64L 1KL9A 3HKZE 1JT8A 2QDLA 4JW0A 1Q1EA 4ULLA 5M3FG 4DU9A 1UWVA 4XXEA 4P72A 4PZ7A 2CH4A 3J81i 3QB3A 3CMAA 3UDGA 4JI3Q 5I2XA 1VF7A 1PH7A 1RIPA 5HGQA 3B6YA 1BBXC 1A6XA 4TQUS 3WWVA 1WTOA
chains in the Genus database with same CATH topology
4DXGA 3DWQA 4KHZA 3X3NA 1QG7A 2EY6A 1NR2A 2PO4A 2BDOA 2PMZB 4K8JA 1BDOA 5FO9B 2X6GA 5IGCA 4K6LA 3C1FA 3EROA 3OWEB 4ODGA 4DAVA 4XIGS 3A54A 3G6JB 2HDLA 1LV9A 1EFID 3MXPA 2XIWA 1ILQA 5I4DA 2AUJD 3DMUA 1MSHA 3I4MB 3VR4A 3HOZB 3BDOA 4U673 3GTGB 3Q22A 4A93B 2BOSA 1STBA 1W6JA 3AMUA 3EVQA 1U9RA 4NKLA 5JVH3 4CHTB 1HRJA 4PV1C 2F3VA 1BCPF 2B2WC 4KV6A 3Q0AA 4YIJA 4C2MB 2X6LA 1SYEA 1GUWA 2RVLA 3OWFA 2PW7A 3HOWB 1ENAA 1A2UA 4Z9CB 1TIID 3S17B 1MBYA 5D14A 3KUPA 2WAQB 4RCOA 1WTWA 1MD2D 2KCNA 3L7ZC 1KAAA 2MPMA 4S3SA 4TKOB 4DN4M 4ZKCB 2H4OA 4XYQA 4IUVA 3GD7A 1M8AA 5CV9A 5EKLA 1A2TA 1A3UA 4QMGA 2KJXA 3J7AV 3A55A 3BG3A 4OO1G 1TWCB 2F0FA 2F0EA 5BN4A 1O7YA 1XXGA 2CQAA 4IQZA 5JPMC 2K33A 2E75C 2DY8A 3U9OA 2K5DA 1SAPA 2EYOA 3DHQA 2NB0A 2CHBD 4IUTA 3RZDB 1RTNA 5DNFA 5K36G 4DNTB 1D5XC 1EYCA 3P1HA 2F0TA 1Q90A 2JSOA 4IFDG 2J4XA 5KEEA 4HN7A 2KUMA 2LMCB 1Q3LA 3K7AB 2VB2X 1FR3A 2M2LA 2XNAC 5CORA 1I3QB 3PUZA 4ZUIA 3E5SA 2JYOA 3HG9A 4QB4A 4K5VA 2BDNA 4KK7A 1QNUA 1LTBD 1Z6HA 1PZID 4C1NI 5C3XA 3GTLB 5J39A 2EYHA 3MWYW 5J1ZA 1MSGA 4FVMA 1KABA 3EJIA 1QILA 1M4VA 1LT5D 2XSCA 4U68A 3NWSA 3VR5A 2WKDA 1SFOB 3CHBD 4KY5A 3MHBA 1Q8IA 5CV7A 1E0BA 4V0BA 5BN3A 2L1BA 1RTOA 3J80E 4A3DB 3E6ZX 1SDFA 5I2YA 5EGTA 2NN6H 4Q5VA 3Q24A 1HFGA 2IX1A 3PV0A 1F9SA 3C2PA 1WCMB 4HMJA 3K59A 5C4JB 3Q23A 5DEHA 3H6MA 4H7BA 2PW5A 3QJYA 1H9MA 4BBSB 1XTCD 3I4LA 3A8IE 1LTSD 1O78A 3TN2A 3VYSA 5FLXE 1K8MA 1TWHB 1UUPA 2D5DA 4B9XA 3M4OB 3D8GA 3H0GB 4J8QA 4ZYSA 3HZXA 5I9OA 1VCIA 1F77A 2NTTA 1ZKOA 3P7JA 3SVMA 1I6HB 2B2TC 4HAEA 1CQVA 4XQJA 1LTRD 2K32A 2K28A 4JBWA 2F0LA 4DK0A 5IT9L 1AP0A 1Y1VB 1JR0D 2PZWA 2EYJA 1PZKD 1I4PA 5T1IA 2AWOA 3DEPA 2PNRC 2DN8A 4IALA 3VYUA 4QUFA 4KJNA 1JWMD 2LS01 1EL0A 1B44D 1BNZA 2R61A 2EVBA 2ZXPA 5C0XI 4DGZA 4XT3B 3NBIA 3A8JE 2EYMA 1SYDA 1XX8A 2KEEA 1UEAB 2HCCA 2XWJB 3FEWX 2A68C 2QF7A 2B63B 1HCZA 1TY2A 4A3JB 4I7ZC 4FNFA 1HTLD 3NQTA 4XYOA 2CVRA 2NUCA 1PTOF 3VYTA 1L0XB 4X3TA 1B1ZA 4WJWA 4K5WA 2LKVA 1WTPA 5A2QE 4HCEA 5I6YA 1CA5A 1GHKA 1RF2D 4JK1C 1S5ED 5A35A 3QO2A 2FMCA 2R6GA 2Q8TA 4UDUC 4XQQA 3HRZC 2WV6D 2WACA 5M3FB 1YNJD 4F87A 2C5CA 1LT3D 5CC4A 4KI0A 3S2HB 3K0YA 3OHXC 2F0KA 5M5WB 3R2IA 3KF8A 1GUTA 3NTKA 2EYPA 2F0IA 1AFPA 2H1EA 1Q1BA 4H13C 3TDQA 3FMCA 4R9WA 1EQVA 4A3MB 1A15A 1BOSA 1ENFA 1SYFA 2D2CC 3HEJA 3A56A 4RH6A 3S16B 1KLUD 2LY7A 3K5LA 1G2TA 3MVVA 2K6AA 4CKCA 3K5MA 4CJ0B 1Y8OB 4X3SA 4K5XA 3NP8A 1D5MC 1SYGA 2OF1A 1YNJC 4XDXA 2V4DA 3D31A 2L5TA 2BCOA 5JEAJ 3IAYA 1SYBA 2SDFA 1SXTA 1EQTA 2KQ3A 3S14B 2R92B 3TBIB 1EY6A 3QG1A 4K14A 1HA6A 1LLRD 4H0LC 1Y8PB 3FRPB 3ND9A 4RWSC 1TWAB 5CV4A 2D62A 2B2UC 1SJHD 3HOUB 1RD9D 1EU4A 5C5LA 2CW0C 2EJMA 2QILA 3IFDA 2J7ZA 2Y0SB 3LWUA 1J8IA 3MA2B 1QNKA 5CYUA 2HDMA 3A7LA 5D3DA 1FNWA 1I4GA 4CBVA 2JXMB 2F0QA 1EWHA 5JPNC 3DEOA 4M8AA 1CA6A 4OO1H 2EJGC 4EGVA 1CTMA 1TWGB 4K2KA 3RUZA 4RCNA 3GTPB 1F2ZA 4MN3A 3WDNA 4NMZA 5JAVA 5J22A 1EIGA 2SEBD 3VA5A 1D1KA 5CBEE 3D3RA 5K36H 2KCCA 5NUCA 1RKNA 3T4AC 1PRTB 3K5NA 2F0SA 4ZKBB 1EU3A 4PMBA 4KY6A 4IFDH 4DF7A 2N55A 5KNBA 1G6ZA 4KD3A 4HTHA 5C44B 2A6HD 1EY5A 4OO1I 1HFNA 4BWGB 3SHLA 4ILWA 2FMMA 1YNNC 4KHVA 1S5BD 2L11A 4PQXA 2A6EC 5IGFA 2EZVA 2K05A 2GA4B 1STYA 4HSVA 2RSNA 4RKBA 3JAME 3SE0A 4IUQA 1HXYD 2F0GA 1CZGA 1CK1A 5KYLA 4QUCA 5D3IB 2VNUD 1F9RA 1RODA 4RGMA 1PFMA 2LFNA 1V1PA 4K2LA 1DONA 4NP5A 2F03A 1C4QA 3K57A 4IFDI 3M7GA 1B2TA 3KBGA 4C3JG 1LTGD 4BA1I 1JORA 3ITPA 3MAQA 2A6HC 1CHQD 3SR1A 4CKEA 3AU7A 5BN5A 4XQNA 4DAPA 2F0JA 1C8CA 4UAIA 2NYZD 3HKZB 1MI2A 3LWEA 3PIP3 1PTOH 1IYUA 1FNUA 1WD1A 5M5YB 1EEFD 5IIFA 3U9SA 3F2UA 4KKUA 3W2DA 3E0JA 2EXZA 3TMEA 2XVSA 5CMDA 4C3IG 4XT1B 2TSSA 1A3VA 2B2VA 2ZXOA 3IKJA 3VA7A 2K7VA 5EQ0A 4DK1A 2EDGA 1RDPD 5ELEA 2K04A 5JOBA 1H9KA 1D2BA 2E2HB 2F0PA 1SE4A 2R7ZB 2PCFB 1EY4A 1PMRA 5C3WA 1ONLA 2JA5B 4EVOA 1ICWA 3MFGA 4FXKC 2B39A 5KNDA 1HQMC 3HOVB 2K03A 1K8OA 2D9UA 3J7AF 2WB1B 1HHVA 1X3QA 4KN4C 3BZDB 3TP8A 2NTSA 5ELBA 1DOLA 3EA6A 3GTKB 3NTIA 3T51B 1G8ZD 3IFTA 1SMYC 2HCIA 2WINB 4EQNA 3T53B 1L0YB 4I65A 4IUPA 5DM63 3GTOB 1JOKA 5E1FA 3PUXA 2R3ZA 1ML0D 5FKAC 3D6WA 1HTPA 3GP7A 5DAUA 3V05A 1E2ZA 1SNPA 3WOFA 3OMCA 4R8IA 1DOMA 2L55A 1S5DD 5EBDA 3SDZA 2PQEA 2E2JB 2B2YA 3SXHA 1F2YA 2IX3A 2ZXRA 1STHA 4HR7B 1TQOA 1GXDC 1UAPA 4FXGC 1IKLA 3O13A 5IGBA 3I3CA 4AYBB 2SNMA 3A7AB 2DNCA 3ND8A 1DYQA 3V2TA 1KLGD 1EZ8A 5FOBB 4OGQC 5ELCA 2IT1A 1PFBA 4RHSA 1IW7C 3D4DA 4R8NA 1TU2B 3KK7A 1GUGA 4A3BB 2B8FA 3H94A 2NN6I 2MGSA 4OIKA 3K5OA 1EOTA 1LO5D 1SNDA 2MUYA 2B2VC 2A68D 2MP1A 1NAPA 1OXTA 1EZ6A 1R9TB 1O7ZA 1PYWD 1D1IA 4IUNA 1IHZA 4DXFA 1Q12A 3DWPA 1CT1D 5C3EB 4CKBA 3BVZA 4FF2A 1TS2A 4C3HB 3J80L 1F9QA 2F0NA 3K6OA 4F8MA 1LABA 1I4RA 2XWBB 2ZT9C 3MFYA 5E3FA 1HUNA 3OMGA 2Z1CA 5EPJA 1X3PA 5D65A 2XRSD 1I4XA 4NW2A 1SJED 5COYA 3NTHA 5G3LD 3M7NA 1PXUA 5I9PA 1GJXA 1SNMA 2BA0A 1AZPA 4E6IA 1Y1WB 1IYVA 3BVMA 3N52A 2NVYB 2O2LD 1BCPB 3I8ZA 4BY1B 3M85A 3CKIB 2FHTA 5HGTA 1STNA 3NE5B 2KECA 1PRTC 1HPCA 3GO5A 2JE6I 3OOCA 1OXXK 1FNVA 3I73A 2OEOA 2AUKA 1V1PB 3MXNA 1GUOA 4RGNA 2OT2A 3NXWA 4KKSA 4P2CB 3GTQB 4ZRZA 3P20A 4QCLA 4O1NA 4K6DA 2YU9B 5C5MA 5KNCA 4RGTA 1SE3A 2JEAI 2RDGA 4F88A 1DM0B 3KLSA 4CGYB 3NBHA 4A3KB 2Q8IB 4FF1A 2YYZA 3SK6A 3C46A 1SYCA 3PO2B 3A8KE 3AB9A 4RFBA 3NK9A 2NBFA 5CBAE 3PO3B 5C0XJ 5LL6X 2CW0D 1KDBA 1GUNA 3CRKC 1T5XD 3PUYA 1R4PB 2RSOA 2Z8LA 1BO0A 3D4RA 2BE5D 1F2LA 1Y69U 4B9WA 3RZOB 2F4IA 5A2QL 2JP1A 4MHEA 5KRUA 3ERQA 3IL8A 5IGGA 1ZYRC 1EWCA 5JEAG 3SEBA 1ZEQX 3FKIB 4BA2I 3KBXA 1FYCA 3HOXB 4LJZC 3M3YB 2B2WA 1TKWB 1KDAA 4F7XA 1KDCA 4MIUA 1PTOC 1VF5C 2O5JC 4IUUA 1H9SA 1CI3M 1H9JA 1X32A 3BYYB 4C3JB 1QCBD 3T56B 3NWTA 3W3AA 2ICIA 4GZYC 4O42A 3OSOA 3NUCA 5CR3A 2ICEC 4CJ2C 4TRDA 1JICA 1TS4A 2BE5C 1EY0A 1SNOA 1ESFA 3J81L 3GV3A 1WD0A 1WVLA 1CHPD 2QDBA 5CV6A 3L3OC 2RKSA 1FD7D 4DA2A 5T1GA 2VUMB 5IODA 4G57A 1YNND 4IZ8A 3BYTB 4L8JA 4FP5D 2A6ED 1LTTD 5C4XB 3QOLA 2KA7A 1S5FD 1CQFA 1CM9A 1STEA 3NSWA 5C6AA 4QIWB 1I4HA 4C3IB 1WTXA 2A69C 4L63B 1PFNA 1EEID 4KJOA 3OIQA 3NPPA 3OW7A 4ZUJA 3S1QB 2M9VA 5IOCA 5ELDA 1KNAA 2EYLA 3QIAA 4N9TA 4J1MA 3TZUA 2EY1A 3FPPA 1B50A 4C1NK 4PMCA 3V96A 4DAYA 2J0TD 2C9OA 3GV6A 5AFWA 4FF4A 4FXDA 4ZK9B 1VMPA 1JC7A 1II3A 2Q8RE 2BA1A 4KD4A 2EJFC 5DM73 4Y7NB 5CGKA 1TR5A 4RHRA 3DUZA 3C3LA 4KKTA 2EOTA 3QOJA 3URYA 1VMCA 2TMPA 1BXTA 2PYKA 1Y8NB 4LMQD 1JOOA 3PIO3 2KVMA 3S15B 2K5QA 5LHY1 3H91A 1I6VC 2WP8J 2G9HD 1JQYD 2IL8A 3MXGA 3ZYYX 1STAA 1QOHA 2DNEA 2K5WA 4KN7C 1SE2A 4RAUC 1LTAD 1HA5A 3CU7A 2PZTA 1OXUA 2F0VA 5E4WC 1GOZA 3I70A 1TT2A 2EPBA 3OPOA 1NCVA 3LX0A 3BVGA 5EPKA 1PTOB 1NSNS 1W6KA 1T5EA 3MTSA 1S4ZA 1I4QA 1F9PA 1PDQA 4QF4A 1PLFA 2VB3X 2F0HA 1V43A 5E4XA 3JAML 1BQQT 1C48A 2QCPX 2IJ0A 4OHJA 2PPBC 4A3EB 1SMYD 1D5ZC 2E2DC 3DM1A 1G91A 4RA8A 2QEJC 1BCPD 2NVTB 2B2TA 2L12A 1EY9A 2EE1A 3MXUA 3VR2A 3SK8A 1VDZA 1TS3A 2K01A 4HMIA 1LT4D 3FPUB 1RJTA 2SNSA 2SOBA 3S1RB 2KEDA 1AW7A 3TP5A 1A3TA 5IGEA 2EY2A 1B9MA 5M9OA 2Z4IA 2F0DA 2RDFA 2NVXB 1ET9A 3SK4A 1EYAA 4OL7A 3WOEA 4IFDJ 3HGBA 2E2IB 1HUMA 3MC0B 1WTQA 1U4PA 1BCPC 3VR3A 1QJOA 2JA7B 4ID6A 4WFN3 3S9WA 1BF4A 1PZJD 2Z4HA 1NR4A 1GUSA 1ESRA 1U4LA 4H44C 1KNEA 1IW7D 1DZ1A 3R93A 1ZXTA 3KLRA 1U4MA 2FFKB 2K1BA 4G4KA 2N88A 1EY8A 1F2MA 3H09A 4X3UA 5M5XB 1SEBD 2IW3A 1TS5A 1JWUD 1S5CD 4C56C 3MZ5A 5IT9E 2XN9C 2NWGA 1OXVA 1OO9B 4B08A 3BS1A 3PUWA 1EIHA 2MJ8A 3DXJC 2X69A 3RMHA 4HCSA 1QWYA 5CV5A 5KYIA 2FJ2A 1JE4A 2ENBA 4IURA 4A3FB 4X3KA 1OXSC 2R93B 4Q0FA 4TSSA 2WKCA 4DNRB 3CRLC 1PRTF 1EYDA 1H9SB 1ILPA 1SNQA 3CQZB 4LK1C 4EQOA 3T13A 5EBCA 1QB5D 2I46A 1GHJA 1D6EC 2NZ1D 5FO8B 2AQ3B 5I6WA 1ENCA 1EY7A 1WTRA 2OXPA 5EKIA 3R3OA 5G3LF 4IN3A 2L0CA 5C0XH 2E76C 1DJRD 2AWNA 3N6RA 4KY7A 4RGOS 5EKKA 2EY5A 5LL6S 4K8IA 3S1NB 1RCVD 3P75A 5JJZA 5K5PA 3GTJB 2O5IC 5JVG3 2RDHA 4M1UB 4G7OC 4ZLTF 1AZQA 3S2DB 3H3VC 5JEAH 2VXWA 1PRTD 4KMUC 5M3MB 4PMWA 3J7YW 3L9AX 4PNYA 3VR6A 2JA8B 4ZAIA 4BBRB 5TSSA 4L6TB 1Z47A 1E2WA 3EFXD 2A74C 2B8GA 3KLSX 5FLXL 3OIPA 1FGBD 2KOLA 1LTID 4DFAA 4ME5A 3GQBA 2B2UA 3T16A 3DWAA 4BY7B 1DXMA 2XRQD 4LAAA 1STGA 2M00A 4KTAA 1WTVA 4WORA 3VYRA 3TSSA 3R8BA 5F2DA 1O7LA 1TWFB 2F0MA 4A3IB 5KIXA 1G2SA 1V8QA 2O4XA 3C1EA 1MGSA 4OIJA 1J9OA 3HP3A 3EQLC 2B2YC 4ZQ3A 2JEBI 1Z7TA 2MHVA 5FO7B 1AN8A 2WIIB 4HEDA 3MEHA 2DY7A 3QWNA 3TP7A 2NN6G 2F3WA 2A5HA 1SNCA 3I90A 2NVQB 1E2VA 4XTCS 3BDLA 1V1OA 2F0WA 3PUVA 2RQXA 1QE6A 1ZYRD 4WRDA 4FF3A 4RKLA 3D4WA 3NQIA 1RHPA 3RD4A 1ET6A 2JA6B 1B3AA 5ISRA 1B4OA 4NDXA 5ELFA 1AEXA 3ONAB 1PTOD 5HURA 3PMFA 1H9RA 2EYFA 1JCKB 3I4NB 1B53A 4EQPA 2RA4A 1G291 1JB3A 5C0XG 4ABNA 2IWHA 4A3GB 3SK5A 3GTMB 2AQ2B 3R2TA 3J81E 1DCZA 1IL8A 5FK9C 1KTKA 3S1MB 4C3HG 3BDCA 1TVXA 3I72A 1HQRD 4N9PA 3TP6A 2IPKD 1BUVT 2G9DA 1IKMA 3FDTA 3M4YA 5EPLA 1LACA 2PZUA 1UNSA 4CJ1B 1B9NA 1O80A 4G7HC 3G7LA 1DOKA 3Q6SA 4HSPA 3TZDA 3I91A 4G7ZC 3HS0C 1JWSD 2I07B 2A69D 1BR9A 2L4NA 2AQ1B 2F1MA 4FYDA 1CFMA 4BS9A 5CV8A 3RLFA 1DD2A 4FO2A 2HQEA 1CZWA 5KGUA 2HUGA 4J6HA 2F0UA 2E74C 2QKIC 3K58A 3X3MA 5C4ZA 3LNNA 3UI2A 1R4QB 1XYIA 1SBBB 3FVQA 1LT6D 1I50B 5EJWA 1JOQA 2ID0A 1SSOA 3D6CA 2L9HA 3NHHA 1NUCA 5IGDA 1XWEA 1K83B 1TY0A 1U4RA 2IX0A 3HOYB 2FINB 2KHSA 2F0OA 2A73B 2RBMA 4V190 1Q1EA 4ULLA 4DU9A 4XXEA 3QB3A 5I2XA 1VF7A 1BBXC 1A6XA 4TQUS 5C4HA 1WTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUR A;  1EOT A;  3FPU B;  2EOT A;  1WTV A;  4O42 A;  4U68 A;  4QUF A;  1RJT A;  2H1E A;  2B2V C;  1QG7 A;  4X3K A;  1VMC A;  2MP1 A;  3DEO A;  1NAP A;  1IKM A;  2HCI A;  2KED A;  3FDT A;  4IUV A;  1CA6 A;  1BNZ A;  1EL0 A;  1NR2 A;  1O7Z A;  1M8A A;  5EPL A;  1C8C A;  4UAI A;  4CJ1 B;  4R9W A;  2NYZ D;  4CJ2 C;  2X6G A;  1O80 A;  1JIC A;  1MI2 A;  3LWE A;  1A15 A;  3G7L A;  4IUP A;  4LMQ D;  1G2S A;  1DOK A;  4XT3 B;  1E0B A;  3Q6S A;  1ILP A;  4MN3 A;  2KVM A;  1MGS A;  1WD1 A;  2L1B A;  1RTO A;  3GV3 A;  3TZD A;  3I91 A;  4OIJ A;  1J9O A;  1EIG A;  1SDF A;  1WD0 A;  1WVL A;  1HA6 A;  1HFG A;  2R3Z A;  3F2U A;  3HP3 A;  1G2T A;  1XX8 A;  2B2Y C;  5CBE E;  1F9S A;  1F9Q A;  1ML0 D;  2HCC A;  2KEE A;  2L4N A;  3D6W A;  3H91 A;  5T1G A;  1O7Y A;  2NZ1 D;  4CJ0 B;  4HED A;  2DY7 A;  1HUM A;  1WTQ A;  2IL8 A;  2HDL A;  1LV9 A;  4R8I A;  1U4P A;  4X3S A;  1WTR A;  1DOM A;  2DY8 A;  2XIW A;  2HUG A;  1ILQ A;  1SAP A;  5EKI A;  4ZKB B;  3I90 A;  4IUT A;  2CVR A;  4XDX A;  4RAU C;  1CM9 A;  1RTN A;  5DNF A;  2N55 A;  5CMD A;  1G6Z A;  2B2Y A;  1MSH A;  1HUN A;  3TN2 A;  5CBA E;  1BF4 A;  4X3T A;  2SDF A;  3UI2 A;  1QE6 A;  4XT1 B;  1WTX A;  5E4W C;  1NR4 A;  2B2V A;  1XYI A;  5EQ0 A;  1EQT A;  1PFN A;  2EPB A;  1HFN A;  1ESR A;  1NCV A;  1RHP A;  1U4L A;  1X3P A;  5EPJ A;  1KNE A;  5D65 A;  2FMM A;  5EJW A;  2K04 A;  5JJZ A;  1DZ1 A;  3R93 A;  1ZXT A;  1HRJ A;  2L11 A;  1IKL A;  5EPK A;  1B3A A;  4NW2 A;  5COY A;  1WTP A;  1U4M A;  1B4O A;  4ZLT F;  1AZQ A;  2FFK B;  2RSO A;  1SSO A;  2B2W C;  1BO0 A;  2KUM A;  1S4Z A;  2K05 A;  1F9P A;  1PDQ A;  3MTS A;  1F2L A;  1Q3L A;  2K1B A;  1KNA A;  2L9H A;  2VXW A;  3I3C A;  1PLF A;  3ONA B;  2N88 A;  2RSN A;  4HSV A;  1CA5 A;  2M2L A;  1U4R A;  5COR A;  2JP1 A;  3P7J A;  4IUQ A;  1AZP A;  4ZAI A;  4RWS C;  2B2T C;  2FIN B;  4X3U A;  4QUC A;  3SVM A;  4MHE A;  5E4X A;  2X6L A;  4HAE A;  1B50 A;  3QO2 A;  1ICW A;  2JYO A;  3IL8 A;  2B2U C;  1F9R A;  1ROD A;  2BDN A;  2Q8T A;  1GUW A;  2K03 A;  3N52 A;  1PFM A;  2RVL A;  2NWG A;  2D9U A;  2K28 A;  3GV6 A;  1PFB A;  5AFW A;  3KBX A;  1B53 A;  3IFD A;  1DON A;  2J7Z A;  2RA4 A;  3DM1 A;  3I8Z A;  2B2W A;  1VMP A;  2FHT A;  4RA8 A;  4ZK9 B;  1AP0 A;  1G91 A;  1HHV A;  1X3Q A;  1J8I A;  2Q8R E;  2KOL A;  2KEC A;  1B2T A;  1EIH A;  2MJ8 A;  5D14 A;  2B2T A;  2L12 A;  3KUP A;  3MWY W;  2EE1 A;  2X69 A;  5T1I A;  1IL8 A;  1WTW A;  1MSG A;  2B2U A;  1QNK A;  4HCS A;  4IUU A;  2HDM A;  2MPM A;  1X32 A;  4DN4 M;  2MGS A;  1TVX A;  1DOL A;  3DEP A;  1BBX C;  4ZKC B;  4OIK A;  2FJ2 A;  2K01 A;  1WTO A;  1JE4 A; 
#chains in the Genus database with same CATH topology
 1K73 C;  4DXG A;  3DWQ A;  4DR3 Q;  4KHZ A;  3X3N A;  4A3K G;  2NZH A;  5C44 H;  1QG7 A;  2EY6 A;  4JI3 L;  1NR2 A;  2PO4 A;  2BDO A;  2PMZ B;  1FGU A;  4A3M G;  3PO2 G;  1PH5 A;  4K8J A;  1BDO A;  5FO9 B;  2X6G A;  5IGC A;  4DR7 Q;  1NY4 A;  3OYY A;  3F8T A;  3IRB A;  4K6L A;  4DR3 L;  3I4O A;  2XTI A;  3C1F A;  1IBL Q;  2ES2 A;  3ERO A;  3OWE B;  4ODG A;  1XJV A;  4DAV A;  4XIG S;  2JA9 A;  3A54 A;  1VQ9 A;  3GTG H;  4GNX C;  3G6J B;  4UPA A;  4A93 H;  2NZO A;  2HDL A;  1LV9 A;  3K0X A;  1EFI D;  3MXP A;  2XIW A;  1ILQ A;  1VQJ A;  4DPG A;  5I4D A;  1E1T A;  1S72 A;  1HZA A;  2AUJ D;  5LMU L;  3DMU A;  1LUZ A;  1MSH A;  1PH8 A;  3W1B A;  3I4M B;  2WB1 E;  2HIX A;  3VR4 A;  4JBK A;  5IP9 G;  3HOZ B;  3BDO A;  4U67 3;  3GTG B;  3K80 C;  3Q22 A;  4HJ9 A;  4A93 B;  2BOS A;  1STB A;  1W6J A;  1HH2 P;  3AMU A;  3EVQ A;  1U9R A;  4NKL A;  5JVH 3;  2I5M X;  4CHT B;  1HRJ A;  3Q8D A;  4PV1 C;  3CCV A;  3KDF B;  2F3V A;  1BCP F;  2B2W C;  1C9O A;  3TQY A;  4LUZ A;  4KV6 A;  3Q0A A;  1Q46 A;  3CCQ A;  4YIJ A;  4C2M B;  4GN4 B;  2F52 A;  3HOU G;  2X6L A;  3S17 H;  1SYE A;  1GUW A;  3U4V A;  3RN5 A;  5M5Y H;  2RVL A;  3OWF A;  1ICF B;  2PW7 A;  3E9I A;  3HOW B;  2CWA A;  3RR5 A;  1ENA A;  1Q7Y C;  5GRO A;  1A2U A;  4Z9C B;  1N34 Q;  1KRS A;  1TII D;  3I55 A;  3S17 B;  1MBY A;  5D14 A;  4IJH A;  4APV A;  3KUP A;  2WAQ B;  5C4H A;  4RCO A;  1WTW A;  1MD2 D;  4QY7 A;  2KCN A;  2PI2 A;  4UP9 A;  3L7Z C;  1KAA A;  2MPM A;  4S3S A;  4TKO B;  4DN4 M;  1UE7 A;  2KHI A;  4ZKC B;  2H4O A;  4MZ9 A;  1B7Y B;  4YWK A;  2HT1 A;  2OQK A;  1J5E Q;  1N34 L;  4XYQ A;  4IUV A;  3AFQ A;  3GD7 A;  1M8A A;  5CV9 A;  1SMX A;  5EKL A;  4IOC A;  1A2T A;  1A3U A;  4DR6 L;  3T1Y Q;  4QMG A;  3J81 j;  2KJX A;  3J7A V;  3A55 A;  3BG3 A;  1J5E L;  4OO1 G;  1U5K A;  1QVG A;  3RZD H;  1K9M C;  1TWC B;  2RHQ B;  2F0F A;  2JA5 H;  3QR8 A;  2RCN A;  1NMG A;  4HIM A;  2F0E A;  5BN4 A;  1O7Y A;  1XXG A;  3KF6 B;  2CQA A;  3HOV H;  4IQZ A;  1PH9 A;  5JPM C;  3AEV A;  2K33 A;  4DV6 L;  2E75 C;  2DY8 A;  3U9O A;  2K5D A;  1SAP A;  2EYO A;  3JAM i;  3DHQ A;  2NB0 A;  2CHB D;  3CCM A;  4IUT A;  3RZD B;  1GVP A;  5IYC H;  1RTN A;  5DNF A;  5K36 G;  4DNT B;  1ASZ A;  3K7A H;  1A8V A;  1D5X C;  1EYC A;  4DV3 Q;  3I7F A;  3P1H A;  2F0T A;  1Q90 A;  3GTK H;  2JSO A;  4IFD G;  1PYB A;  2J4X A;  3VDY A;  5KEE A;  4HN7 A;  5HY6 A;  2KUM A;  2LMC B;  1Q3L A;  3K7A B;  2EIF A;  2VB2 X;  2I5H A;  1HR0 L;  1FR3 A;  1B70 B;  2M2L A;  2XNA C;  5COR A;  4DV3 L;  1I3Q B;  4RMF A;  3AYH B;  3PUZ A;  4ZUI A;  3E5S A;  3GTO H;  2JYO A;  3HG9 A;  4QB4 A;  4K5V A;  2BDN A;  1PYS B;  4KK7 A;  1QNU A;  1EWI A;  1LTB D;  1N33 Q;  1Z6H A;  1PZI D;  4GOP C;  4C1N I;  5C3X A;  3EIV A;  3NEM A;  3GTL B;  4DV0 L;  5J39 A;  3NEL A;  2EYH A;  3MWY W;  5J1Z A;  4JI4 Q;  1MSG A;  4FVM A;  1KAB A;  3MEF A;  1N33 L;  3EJI A;  1QIL A;  5L37 A;  1M4V A;  1LT5 D;  3JC6 6;  4LWC A;  2XSC A;  1PA6 A;  1VQH A;  4GNX B;  4U68 A;  4A3D H;  4OEL B;  3NWS A;  3VR5 A;  2WKD A;  1SFO B;  1HZ9 A;  1SR3 A;  1WCM H;  3HKZ G;  3CHB D;  4KY5 A;  3MHB A;  1Q8I A;  1EIF A;  2HD3 A;  4I7A A;  2N3S A;  5CV7 A;  4YY3 L;  1E0B A;  4V0B A;  5BN3 A;  4P71 A;  2L1B A;  1RTO A;  3J80 E;  4JOI A;  2DJG C;  4A3D B;  3E6Z X;  4JVZ A;  1SDF A;  5I2Y A;  5EGT A;  2NN6 H;  1X55 A;  4Q5V A;  1HFG A;  3Q24 A;  2IX1 A;  3PV0 A;  3K81 C;  3PSI A;  1F9S A;  3C2P A;  4UHV A;  1WCM B;  4HMJ A;  3K59 A;  5C4J B;  1KRT A;  3Q23 A;  5DEH A;  3H6M A;  3S24 A;  4H7B A;  2PW5 A;  3QJY A;  1E1O A;  1H9M A;  4BBS B;  1XTC D;  1HNZ Q;  3I4L A;  3A8I E;  1X65 A;  4A3B H;  1NE3 A;  1LTS D;  2UXC L;  1O78 A;  3TN2 A;  3VYS A;  5FLX E;  1K8M A;  1WOC A;  1TWH B;  1UUP A;  4A3E G;  4DUZ L;  3EBE A;  2D5D A;  4Y52 H;  4B9X A;  1I6H H;  4NXN Q;  2N8N A;  4JI5 L;  3M4O B;  3TRZ A;  3D8G A;  2LXK A;  3H0G B;  4J8Q A;  4ZYS A;  3HZX A;  5I9O A;  1VCI A;  2K4K A;  4O0A A;  2R7Z G;  1HNZ L;  2Q2H A;  1F77 A;  4EX5 A;  3A0J A;  2NTT A;  2JA5 G;  1ZKO A;  3P7J A;  3SVM A;  1I6H B;  2B2T C;  4HAE A;  4JCV E;  1CQV A;  3ULL A;  4XQJ A;  3HOV G;  4IPC A;  1LTR D;  2K32 A;  2K28 A;  4JBW A;  4X66 Q;  2WB1 G;  2F0L A;  4C3H H;  4DK0 A;  1JJC B;  5IT9 L;  1AP0 A;  1Y1V B;  3CXC A;  1VQ4 A;  1JR0 D;  2PZW A;  2EYJ A;  1M90 C;  1P16 A;  1PZK D;  3TEH B;  4JV5 L;  1I4P A;  5T1I A;  3DLL A;  4X66 L;  2AWO A;  3DEP A;  2AHO B;  1K0S A;  4YCU A;  2PNR C;  2DN8 A;  4IAL A;  3VYU A;  4QUF A;  4KJN A;  1JWM D;  4J15 A;  2LS0 1;  1EL0 A;  1B44 D;  1BNZ A;  2R61 A;  4TVA B;  2EVB A;  2ZXP A;  2KCT A;  3FP9 A;  5C0X I;  4DGZ A;  4DV5 L;  3GDE A;  4XT3 B;  3T1H Q;  3NBI A;  4A3J H;  3A8J E;  3CC4 A;  2EYM A;  2QW7 A;  4L5S A;  2AMC B;  1SYD A;  1IBM L;  1XX8 A;  2KEE A;  1UEA B;  2HCC A;  1V1Q A;  2XWJ B;  1IBK L;  4AH6 A;  3FEW X;  2A68 C;  4LFB Q;  2QF7 A;  1Y1W H;  3G48 A;  2B63 B;  2NVY H;  1HCZ A;  1TY2 A;  3T1H L;  4A3J B;  4BY1 H;  4I7Z C;  3TRE A;  4FNF A;  1HTL D;  3NQT A;  4XYO A;  2CVR A;  2NUC A;  4A4I A;  1PTO F;  3VYT A;  1L0X B;  2OTL A;  2BH2 A;  4LFB L;  4X3T A;  1B1Z A;  4WJW A;  4K5W A;  1VQM A;  4DR5 L;  4L5Q A;  2LKV A;  1SRU A;  3F2B A;  4JI1 Q;  4IOA A;  1WTP A;  5A2Q E;  5IP7 G;  1G51 A;  4IO9 A;  3NEN A;  3K8A A;  4HCE A;  5I6Y A;  1CA5 A;  5BR8 Q;  1GHK A;  1RF2 D;  4JK1 C;  1XMO L;  1YIJ A;  1S5E D;  5A35 A;  4L5T A;  1WJJ A;  3QO2 A;  2FMC A;  4OXP A;  2R6G A;  4JI1 L;  2Q8T A;  1Q8K A;  1VQI A;  4UDU C;  3S2H H;  5M5W H;  4XQQ A;  3HRZ C;  2RF4 A;  1YHB A;  1PH4 A;  1X3G A;  2WV6 D;  5BR8 L;  2ZM6 Q;  4A3B G;  2WAC A;  2LSS A;  5M3F B;  4A3K H;  4OEM B;  1YNJ D;  4F87 A;  2C5C A;  1LT3 D;  5CC4 A;  4KI0 A;  1BBW A;  3U58 A;  3S2H B;  3K0Y A;  3OHX C;  2F0K A;  5M5W B;  3PO2 H;  3R2I A;  3KF8 A;  1GUT A;  3NTK A;  4UY8 C;  2EYP A;  2F0I A;  2ZM6 L;  1K8G A;  4X62 Q;  1VQ6 A;  2VS1 A;  3S16 H;  1AFP A;  2H1E A;  1PH1 A;  4KLK A;  4DUY Q;  3PO3 H;  4A3L H;  1PH6 A;  1Q1B A;  4H13 C;  1NJI C;  3TDQ A;  4JI2 Q;  3FMC A;  4R9W A;  1EQV A;  4A3M B;  4QIW E;  1A15 A;  1BOS A;  1ENF A;  5C3E G;  1SYF A;  2D2C C;  3HEJ A;  3A56 A;  2C35 B;  3ERS X;  4X62 L;  4RH6 A;  3S16 B;  4X65 Q;  1KLU D;  3RZO H;  2LY7 A;  3UE0 A;  4DUY L;  1GM5 A;  4QL5 A;  3K5L A;  1G2T A;  3MVV A;  2K6A A;  4CKC A;  3K5M A;  1NNX A;  1V9P A;  4CJ0 B;  4AIM A;  2K14 A;  1KAW A;  5IP9 H;  1Y8O B;  4X3S A;  3HOX H;  4K5X A;  3NP8 A;  1D5M C;  4MTN A;  1DGS A;  2JA8 G;  3S14 H;  1SYG A;  2OF1 A;  1YNJ C;  4XDX A;  2V4D A;  3D31 A;  2L5T A;  2BCO A;  5JEA J;  3IAY A;  2OCE A;  1SYB A;  1XPO A;  2SDF A;  1YNX A;  1SXT A;  2RCF A;  4DV7 L;  4C3J H;  1TWA H;  1A0I A;  1EQT A;  5GAG C;  2KQ3 A;  3S14 B;  2R92 B;  3TBI B;  1VQD A;  1EY6 A;  3E9H A;  3QG1 A;  4K14 A;  1HA6 A;  1LLR D;  4B3M Q;  3AQQ A;  4H0L C;  1Y8P B;  4BY7 G;  3FRP B;  3ND9 A;  4RWS C;  1TWA B;  1YHQ A;  5CV4 A;  2D62 A;  4DR4 L;  2B2U C;  3E0E A;  1SJH D;  3HOU B;  1RD9 D;  1EU4 A;  5C5L A;  2CW0 C;  2EJM A;  2QIL A;  1W3S A;  4BY1 G;  4DR1 Q;  3IFD A;  2IY5 B;  2R7F A;  2J7Z A;  4LFC Q;  2Y0S B;  3LWU A;  1Q86 C;  1U0L A;  1J8I A;  3MA2 B;  1QNK A;  1VS0 A;  5CYU A;  2HDM A;  4LF6 Q;  3H15 A;  3A7L A;  1FJG Q;  5FJ8 H;  5D3D A;  1FNW A;  1I4G A;  4CBV A;  2JXM B;  2F0Q A;  2Q2I A;  1EWH A;  1HR0 W;  5JPN C;  3DEO A;  4C3I H;  3F1Z A;  3BZK A;  4M8A A;  1CA6 A;  4OO1 H;  2EJG C;  4EGV A;  1CTM A;  1TWG B;  4K2K A;  4B3R Q;  4LF6 L;  3RUZ A;  1FJG L;  4JI6 Q;  3F2D A;  4RCN A;  1MJC A;  3GTP B;  3S1Q H;  1F2Z A;  2Q2U A;  4YHH L;  4MN3 A;  3WDN A;  1EFW A;  2YTY A;  2CWP A;  4NMZ A;  5JAV A;  5J22 A;  1EIG A;  2SEB D;  3VA5 A;  1D1K A;  2UUB Q;  5CBE E;  3J7A 5;  2WAQ E;  3D3R A;  3ZJY C;  5K36 H;  2KCC A;  1L1O A;  5NUC A;  1RKN A;  3T4A C;  1PRT B;  4ALP A;  3K5N A;  1BBU A;  2F0S A;  4ZKB B;  1EU3 A;  4PMB A;  4KY6 A;  4IFD H;  4DF7 A;  2N55 A;  5KNB A;  3PO3 G;  1G6Z A;  4A3L G;  1HJP A;  4KD3 A;  4HTH A;  5C44 B;  2A6H D;  1VQ8 A;  1EY5 A;  1MHW C;  3PIO A;  4OO1 I;  1HFN A;  1PVO A;  1XTD A;  4BWG B;  3SHL A;  3F2C A;  4ILW A;  2FMM A;  1YIT A;  1YNN C;  4DR7 L;  4KHV A;  1S5B D;  2L11 A;  4PQX A;  2A6E C;  5IGF A;  2EZV A;  3I56 A;  2K05 A;  2GA4 B;  1STY A;  4HSV A;  2RSN A;  1IBL L;  4RKB A;  3JAM E;  1IXR A;  2RHS B;  3SE0 A;  2VQF Q;  4IUQ A;  1HXY D;  2F0G A;  1CZG A;  1CK1 A;  5KYL A;  4QUC A;  1O7I A;  5D3I B;  2VNU D;  1F9R A;  4IPH A;  1ROD A;  3FKI G;  3S15 H;  4RGM A;  3HOX G;  1PFM A;  2LFN A;  1V1P A;  4K2L A;  1DON A;  4NP5 A;  2D0P A;  1EUJ A;  2F03 A;  1C4Q A;  3K57 A;  4IFD I;  3M7G A;  5IT9 c;  1B2T A;  2V1C C;  3KBG A;  4C3J G;  1FL0 A;  4K0K Q;  1LTG D;  3DM3 A;  4BA1 I;  1JOR A;  3ITP A;  3MAQ A;  2A6H C;  1CHQ D;  2PQA B;  3SR1 A;  1I94 Q;  4CKE A;  3AU7 A;  1E7Z A;  5BN5 A;  4XQN A;  4DAP A;  2F0J A;  2JJQ A;  1C8C A;  4UAI A;  2NYZ D;  4K0K L;  3HKZ B;  1MI2 A;  3LWE A;  3PIP 3;  1PTO H;  1IYU A;  1FNU A;  2ZJR A;  1WD1 A;  2CH4 W;  5M5Y B;  1EEF D;  5IIF A;  1SLJ A;  4HIO A;  1I94 L;  1WI5 A;  3U9S A;  3F2U A;  4KKU A;  3W2D A;  3E0J A;  4JBJ A;  2VUM G;  2VZA A;  2EXZ A;  4GN3 B;  2MFI A;  3TME A;  5C4X G;  4A3E H;  1VQN A;  5FJ8 G;  3HOY G;  2E2H H;  4O2D A;  2XVS A;  2R7Z H;  5CMD A;  4C3I G;  3A74 A;  2TSS A;  4XT1 B;  1A3V A;  2B2V A;  2ZXO A;  3IKJ A;  3VA7 A;  2K7V A;  5EQ0 A;  4DK1 A;  1VQG A;  2EDG A;  1RDP D;  1WTH A;  5ELE A;  2K04 A;  5JOB A;  1H9K A;  3T1Y L;  1D2B A;  2E2H B;  3G6E A;  2F0P A;  3S1R H;  1SE4 A;  2R7Z B;  1JMC A;  2PCF B;  1EY4 A;  1SE8 A;  1PMR A;  5C3W A;  1ONL A;  2JA5 B;  4EVO A;  3SGI A;  1ICW A;  3MFG A;  4FXK C;  2B39 A;  1YVC A;  5KND A;  1HQM C;  3HOV B;  3CAM A;  4PG3 A;  2K03 A;  1K8O A;  1VQ7 A;  2D9U A;  3J7A F;  2WB1 B;  2E2I H;  1HHV A;  1X3Q A;  1X9N A;  1PH2 A;  4JPB W;  4KN4 C;  3BZD B;  3TP8 A;  2GN5 A;  3G4S A;  2NTS A;  5ELB A;  1X54 A;  1DOL A;  1QUQ A;  3PQI A;  3EA6 A;  3GTK B;  3NTI A;  5ELO A;  4LF5 Q;  2JA7 H;  3T51 B;  2F3I A;  1XNR Q;  3OTO Q;  1G8Z D;  3IFT A;  1SMY C;  2HCI A;  2WIN B;  4EQN A;  3RN2 A;  2OWO A;  4POG A;  4ZCK A;  3T53 B;  2YV5 A;  1L0Y B;  4I65 A;  1C7Y A;  1NMF A;  4IUP A;  5DM6 3;  3GTO B;  2OTJ A;  3I4M G;  1JOK A;  1HNX Q;  5E1F A;  4LF5 L;  1XNR L;  2K75 A;  3KF8 B;  4DV2 Q;  2Z6B A;  3PUX A;  4CDE C;  2R3Z A;  1ML0 D;  3D6W A;  3GP7 A;  3KYH C;  1HTP A;  5FKA C;  2E2J H;  5DAU A;  3V05 A;  3OW2 A;  1X3F A;  1E2Z A;  2HHH Q;  3BJU A;  1SNP A;  3WOF A;  2K5V A;  3OMC A;  1JJG A;  1HNX L;  4R8I A;  4JI4 L;  1DOM A;  4DV2 L;  2L55 A;  1S5D D;  5EBD A;  3SDZ A;  2WFW A;  2PQE A;  2E2J B;  1IYJ B;  2B2Y A;  3SXH A;  5IP7 H;  1E24 A;  2GVB A;  3EN2 A;  2MNA A;  1F2Y A;  2IX3 A;  4NXM Q;  2ZXR A;  3D0F A;  1STH A;  1SN8 A;  1TQO A;  4HR7 B;  1GXD C;  1UAP A;  4FXG C;  1IKL A;  3O13 A;  2WAQ G;  2E5L Q;  2CCZ A;  5IGB A;  3I3C A;  4AYB B;  3CD6 A;  2SNM A;  1YJ9 A;  4JBM A;  3A7A B;  4GN5 A;  1N8R C;  1HZB A;  2DNC A;  4LF7 Q;  3ND8 A;  4UP8 A;  4NXM L;  1DYQ A;  3V2T A;  1KLG D;  1EZ8 A;  5FOB B;  1XNQ Q;  2K52 A;  3HFZ B;  4OGQ C;  5ELC A;  2MO1 A;  3CQZ H;  3STB D;  2IT1 A;  2E5L L;  1PFB A;  3CME A;  4RHS A;  2XGT A;  1IW7 C;  3D4D A;  4R8N A;  2Z9H A;  1TU2 B;  3KK7 A;  4LUV A;  4DV4 Q;  1GUG A;  4LF7 L;  4A3B B;  4LNQ A;  2B8F A;  1R9T H;  1XNQ L;  3H94 A;  1NBW A;  2NN6 I;  2MGS A;  4NXN L;  1D8L A;  4OIK A;  3FHW A;  3TS2 A;  2KHJ A;  1Q81 C;  3J81 c;  2Z6K A;  3K5O A;  5C3E H;  1EOT A;  1LO5 D;  1SND A;  2MUY A;  4DV4 L;  1CKO A;  2K5N A;  2B2V C;  2A68 D;  2MP1 A;  1NAP A;  2PQA A;  1OXT A;  1EZ6 A;  1R9T B;  4DKA C;  1O7Z A;  1PYW D;  1D1I A;  4IUN A;  3AFP A;  4H02 A;  1IHZ A;  4DXF A;  3GTJ H;  1Q12 A;  3DWP A;  2ZTC A;  3S2D H;  2F4V Q;  1CT1 D;  5C3E B;  4CKB A;  5M3M H;  1Q82 C;  3BVZ A;  4IPD A;  4FF2 A;  1TS2 A;  4C3H B;  2JA8 H;  3J80 L;  1F9Q A;  3CPF A;  3STB C;  1N32 Q;  1X6O A;  4DNI A;  2F0N A;  4NPS A;  3K6O A;  4F8M A;  2BH8 A;  2ASB A;  3PCO B;  2JA7 G;  1LAB A;  2ALY B;  1I4R A;  1I5F A;  2XWB B;  2ZT9 C;  3MFY A;  4RG1 A;  1N32 L;  5E3F A;  5LMN Q;  1HUN A;  3OMG A;  2HQL A;  2Z1C A;  4BY7 H;  4EQ5 A;  1L1O B;  5EPJ A;  1X3P A;  5D65 A;  2Z0S A;  1SRO A;  1I4X A;  2XRS D;  4NW2 A;  1SJE D;  2A1A A;  5COY A;  2K50 A;  1L0W A;  2ZTE A;  1VQA A;  3NTH A;  3A5Z B;  5G3L D;  5LMN L;  4PZ6 A;  3M7N A;  1PXU A;  4YCW A;  3M4P A;  4YWM A;  1YEZ A;  1SNM A;  5I9P A;  1GJX A;  2CQO A;  2BA0 A;  1TWF H;  1AZP A;  4A3I H;  4E6I A;  1UEB A;  1Y1W B;  4DV1 Q;  1IYV A;  1P8L A;  3BVM A;  3N52 A;  2NVY B;  2O2L D;  1BCP B;  4L5R C;  3I8Z A;  4BY1 B;  3M85 A;  1GD7 A;  3CKI B;  2FHT A;  4MNO A;  5HGT A;  1GO3 E;  1JE5 A;  1STN A;  3NE5 B;  2KEC A;  1CKN A;  3BZC A;  1X3E A;  1PRT C;  1HPC A;  4DV1 L;  3GO5 A;  1VQE A;  3GTQ H;  2NVQ H;  2JE6 I;  3OOC A;  1OXX K;  1FNV A;  3I73 A;  4A3F G;  4JOI C;  2OEO A;  2AUK A;  1V1P B;  3MXN A;  2YU9 H;  4JYA Q;  1GUO A;  4RGN A;  5IYD H;  2R93 G;  2OT2 A;  1UE1 A;  3NXW A;  4KKS A;  1M1K C;  4P2C B;  2ZJQ A;  4BBS G;  3GTQ B;  2JA6 H;  4IPG A;  2P5Z X;  4ZRZ A;  1A63 A;  3P20 A;  4QCL A;  2N49 A;  2L15 A;  4K6D A;  4O1N A;  2YU9 B;  4JYA L;  5C5M A;  2Y0S E;  5KNC A;  4RGT A;  1HZC A;  1SE3 A;  2JEA I;  3CCR A;  2RDG A;  4R4Q A;  4F88 A;  4LW1 A;  1DM0 B;  2CFM A;  3KLS A;  3NBH A;  4CGY B;  4A3K B;  2Q8I B;  4FF1 A;  2YYZ A;  2YTV A;  3SK6 A;  1G6P A;  3C46 A;  1SYC A;  3UDF A;  3PO2 B;  1PH3 A;  3GTM H;  3A8K E;  3AB9 A;  4B3S Q;  4RFB A;  1EQQ A;  3NK9 A;  2NBF A;  5CBA E;  5ELN A;  3PO3 B;  5C0X J;  5LL6 X;  2CW0 D;  1KDB A;  2OQ0 A;  2UUA Q;  4JI2 L;  1XMQ Q;  1GUN A;  2R7D A;  3CRK C;  1T5X D;  3J7Z C;  4AQY Q;  1JJ2 A;  3FKI H;  3PUY A;  1R4P B;  2RSO A;  3U50 C;  2Z8L A;  1BO0 A;  3D4R A;  5M3M G;  4B3S L;  2BE5 D;  1F2L A;  3M3Y H;  1K28 A;  1Y69 U;  4X65 L;  4B9W A;  4LF9 Q;  3RZO B;  2JQO A;  4BBR G;  2F4I A;  1NTG A;  5A2Q L;  2JP1 A;  2JK8 A;  4FDB A;  4MHE A;  5KRU A;  1XMQ L;  3ERQ A;  1S3O A;  3IL8 A;  1B3Q A;  5IGG A;  2UU9 Q;  2PMZ E;  1ZYR C;  3TS0 A;  1EWC A;  5JEA G;  1N36 Q;  3SEB A;  1ZEQ X;  3FKI B;  4BA2 I;  3KBX A;  1FYC A;  3HOX B;  4LJZ C;  3M3Y B;  2B2W A;  1TKW B;  4LF9 L;  1KDA A;  4F7X A;  1KDC A;  3H3V H;  1K8A C;  4MIU A;  2UU9 L;  2EXD A;  1PTO C;  1VF5 C;  2O5J C;  4IUU A;  1H9S A;  1YJN A;  1CI3 M;  1H9J A;  1X32 A;  3BYY B;  4C3J B;  3CCU A;  2VQE Q;  1IL2 A;  1QCB D;  1X56 A;  4YCV A;  3T56 B;  3NWT A;  3W3A A;  2ICI A;  4GZY C;  2LXJ A;  1BKB A;  5FLM H;  4O42 A;  4DR2 Q;  4ME3 A;  2B63 G;  1H95 A;  3OSO A;  4WJ3 M;  4R4O A;  4B3M L;  1LM0 A;  1D7Q A;  3NUC A;  1I50 H;  5CR3 A;  4A3I G;  2ICE C;  4CJ2 C;  4P75 A;  2VUM H;  4TRD A;  2VQE L;  1JIC A;  1TS4 A;  2BE5 C;  1EY0 A;  1SNO A;  1ESF A;  2PNH A;  4YWL A;  2A19 A;  2Q2T A;  4IJL A;  1QUQ B;  3GV3 A;  5C4X H;  3J81 L;  4DR2 L;  1K3R A;  1K83 H;  4DR1 L;  1WD0 A;  5IY0 A;  1CHP D;  1WVL A;  2QDB A;  4CDC C;  5JJK A;  3HOY H;  5CV6 A;  3L3O C;  4LFC L;  2RKS A;  1FD7 D;  2B29 A;  4DA2 A;  4A3C H;  5T1G A;  4OWW B;  2VUM B;  4LF4 Q;  5IOD A;  4G57 A;  1YNN D;  4IZ8 A;  3BYT B;  2DUD A;  3CCJ A;  3H3V I;  4L8J A;  4FP5 D;  2A6E D;  1AE3 A;  1LTT D;  5C4X B;  3QOL A;  3CW2 C;  2KA7 A;  1S5F D;  1CQF A;  1CM9 A;  1STE A;  2K5H A;  5IYD G;  3NSW A;  4WJ4 A;  4LF4 L;  5C6A A;  4QIW B;  1I4H A;  4C3I B;  1WTX A;  2A69 C;  4N8F A;  4L63 B;  1PFN A;  1EEI D;  3RLN A;  4KJO A;  1EIY B;  3OIQ A;  2JA6 G;  4B3R L;  4JI6 L;  3NPP A;  4GKK Q;  3OW7 A;  4ZUJ A;  1VQK A;  3S1Q B;  2M9V A;  5IOC A;  5ELD A;  1KNA A;  2EYL A;  3QIA A;  4N9T A;  4J1M A;  3CF5 A;  3TZU A;  2EY1 A;  2UUB L;  3FPP A;  1B50 A;  4A76 A;  4C1N K;  3I4N G;  4PMC A;  3V96 A;  4DAY A;  2J0T D;  4GKK L;  4Y7N H;  2C9O A;  3GV6 A;  5AFW A;  4FF4 A;  4OX9 Q;  4FXD A;  4A3G G;  4ZK9 B;  1VMP A;  1JC7 A;  1II3 A;  1PHJ A;  2Q8R E;  2BA1 A;  4KD4 A;  2EJF C;  5DM7 3;  3UDX A;  1KXL A;  4Y7N B;  3I2Z A;  1KHI A;  5CGK A;  4OX9 L;  1TR5 A;  4RHR A;  3DUZ A;  4GOP A;  5LMU Q;  5IYB G;  4KKT A;  3C3L A;  4B3T Q;  2EOT A;  3I4M H;  4QJF A;  3QOJ A;  3URY A;  1VMC A;  2TMP A;  4POF A;  3HOZ H;  2JN4 A;  2VQF L;  2EQS A;  1BXT A;  2PYK A;  1Y8N B;  2E8G A;  1ASY A;  4LMQ D;  1JOO A;  3PIO 3;  2KVM A;  3S15 B;  3CC2 A;  1VQC A;  4B3T L;  2K5Q A;  3PIP A;  4C2M H;  5LHY 1;  2R92 G;  3H91 A;  1VQL A;  1I6V C;  4GLA C;  2WP8 J;  3J80 c;  2I5L X;  2G9H D;  1JQY D;  2IL8 A;  4BXX G;  3MXG A;  3HOW H;  3ZYY X;  5GAH C;  1UE6 A;  1STA A;  1QOH A;  2DNE A;  1Y14 B;  2K5W A;  4KN7 C;  1SE2 A;  4RAU C;  1LTA D;  1HA5 A;  5FLM G;  2A8V A;  3CU7 A;  2PZT A;  3KOJ A;  1OXU A;  2F0V A;  5E4W C;  1QVC A;  1GOZ A;  3I70 A;  1TT2 A;  2EPB A;  3OPO A;  1NCV A;  2Y0S G;  4R4T A;  1L2F A;  3LX0 A;  5DLQ E;  3BVG A;  5GQO A;  5EPK A;  1PTO B;  3K7U C;  1NSN S;  2MQH A;  5FLX c;  1RL2 A;  3MTS A;  1T5E A;  1PFS A;  1I4Q A;  1F9P A;  1PDQ A;  1S4Z A;  1W6K A;  1YZ6 A;  1KQS A;  4QF4 A;  1PLF A;  2VL6 A;  2VB3 X;  4A3C G;  2F0H A;  2NVT H;  3HKS A;  1V43 A;  5E4X A;  4DR6 Q;  1LYL A;  3JAM L;  1BQQ T;  1C48 A;  2QCP X;  2IJ0 A;  1TXY A;  4OHJ A;  3M9B A;  1A62 A;  2PPB C;  4A3E B;  1Z9F A;  1UE5 A;  1TWC H;  1D5Z C;  1SMY D;  2E2D C;  3DM1 A;  1C0A A;  4RA8 A;  1G91 A;  1WFQ A;  2QEJ C;  1BCP D;  1EYG A;  2NVT B;  2B2T A;  1KIX A;  3PF4 A;  2L12 A;  1EY9 A;  2EE1 A;  4DV6 Q;  3MXU A;  3VR2 A;  3SK8 A;  4UP7 A;  4GLV B;  1VDZ A;  1TS3 A;  2K01 A;  2NVX H;  4HMI A;  1LT4 D;  1LTL A;  3FPU B;  4AYB E;  5LMN W;  1RJT A;  2SNS A;  2SOB A;  3S1R B;  2KED A;  1AW7 A;  3L0O A;  3TP5 A;  1A3T A;  5IGE A;  2EY2 A;  1B9M A;  2AKW B;  5M9O A;  2Z4I A;  1CKN B;  1L1O C;  2F0D A;  4R4C A;  2RDF A;  2NVX B;  1ET9 A;  5C44 G;  3SK4 A;  1EYA A;  1HR0 Q;  4OL7 A;  3WOE A;  4IFD J;  1I3Q H;  3HGB A;  3MXN B;  2E2I B;  2MO0 A;  2DJF C;  2H5X A;  3M4Q A;  1HUM A;  1S40 A;  3MC0 B;  1WTQ A;  1U4P A;  1BCP C;  3VR3 A;  3CCE A;  3CCL A;  1QJO A;  3GTL H;  4DV0 Q;  2JA7 B;  4ID6 A;  4WFN 3;  3S9W A;  3OTO L;  1K0R A;  3HOZ G;  4HJ7 A;  1BF4 A;  1PZJ D;  4A93 G;  2Z4H A;  1NR4 A;  1GUS A;  5M5X H;  1ESR A;  3NBH B;  1U4L A;  1HNW Q;  4H44 C;  1KNE A;  1IW7 D;  4P74 A;  1DZ1 A;  3R93 A;  1ZXT A;  3KLR A;  4N8X 1;  3KFU A;  1U4M A;  2FFK B;  2K1B A;  1SFO H;  4G4K A;  2N88 A;  4HID A;  1EY8 A;  4HJ8 A;  1F2M A;  3H09 A;  4P73 A;  4X3U A;  5M5X B;  1SEB D;  3PF5 A;  2IW3 A;  3E3X A;  1HNW L;  1TS5 A;  3U4Z A;  4YY3 Q;  1JWU D;  1S5C D;  2FXQ A;  4NB3 A;  4C56 C;  3MZ5 A;  5IT9 E;  2HHH L;  2XN9 C;  3HOW G;  2NWG A;  1OXV A;  2KEN A;  1OO9 B;  3PGZ A;  2D0O A;  4B08 A;  5C4J H;  4A3F H;  3BS1 A;  3PUW A;  1EIH A;  1T9H A;  2MJ8 A;  2ZJP A;  3DXJ C;  4LF8 Q;  1XPU A;  2R93 H;  2X69 A;  3RMH A;  2ZTD A;  4HCS A;  1QWY A;  5CV5 A;  4BBS H;  5KYI A;  2FJ2 A;  1VQB A;  1JE4 A;  2ENB A;  4IUR A;  2UXC Q;  1YBY A;  3CP0 A;  4A3F B;  4X3K A;  5J3B A;  1TWH H;  3CCS A;  4DUZ Q;  2CKZ B;  4LF8 L;  4A75 A;  1OXS C;  2R93 B;  4Q0F A;  4TSS A;  2WKC A;  4JI5 Q;  3M4O H;  4OWX B;  2VW9 A;  3H0G H;  4DNR B;  4HIK A;  3CRL C;  1PRT F;  1EYD A;  4OON A;  1H9S B;  1ILP A;  1SNQ A;  3CQZ B;  4LK1 C;  4EQO A;  3T13 A;  5EBC A;  1E3P A;  1QB5 D;  2I46 A;  1GHJ A;  1CKM A;  1D6E C;  2NZ1 D;  5FO8 B;  2AQ3 B;  5I6W A;  1ENC A;  1EY7 A;  3S1N H;  1CUK A;  1WTR A;  3KDF A;  2OXP A;  5EKI A;  2QA4 A;  3R3O A;  5G3L F;  1Y1V H;  1EOV A;  4IN3 A;  2L0C A;  5C0X H;  2G5D A;  2E76 C;  1DJR D;  2AWN A;  3N6R A;  1AE2 A;  1YHA A;  4KY7 A;  4RGO S;  5EKK A;  4CDD C;  1OTC A;  2EY5 A;  1W2B A;  3BU2 A;  4JV5 Q;  2I0Q A;  4OWT B;  4LFA Q;  1K3B C;  5LL6 S;  4HJA A;  4BBR H;  4K8I A;  1B8A A;  3S1N B;  2IHE A;  1VQO A;  1RCV D;  3P75 A;  5JJZ A;  5K5P A;  3GTJ B;  2O5I C;  5IYC G;  5JVG 3;  3LGJ A;  2RDH A;  4M1U B;  4DK6 C;  4G7O C;  4ZLT F;  1AZQ A;  1KD1 C;  2F4V L;  3S2D B;  3H3V C;  5JEA H;  2UUC Q;  2VXW A;  2YTX A;  1PRT D;  4KMU C;  5M3M B;  4PMW A;  3J7Y W;  4LFA L;  3L9A X;  4PNY A;  5E7N A;  3VR6 A;  2JA8 B;  4ZAI A;  4BBR B;  4QGU A;  5TSS A;  4DV5 Q;  5IWA Q;  3L2P A;  4GLX A;  3ULJ A;  4L6T B;  1Z47 A;  1E2W A;  3EFX D;  3KLW A;  2A74 C;  2B8G A;  3KLS X;  5FLX L;  2UUC L;  3G71 A;  4QQB X;  4JC0 A;  2PI2 E;  1VQP A;  3OIP A;  1IBM Q;  5AJ3 Q;  1IBK Q;  1FGB D;  5H1S E;  2KOL A;  1LTI D;  5IWA L;  2B63 H;  4DFA A;  4ME5 A;  3GQB A;  2B2U A;  4JI8 Q;  3T16 A;  3J80 i;  3DWA A;  4BY7 B;  1DXM A;  2XRQ D;  3UE1 A;  4LAA A;  4DAY B;  1STG A;  2M00 A;  4KTA A;  4KHP Q;  4GKJ Q;  5AJ3 L;  1WTV A;  5JJL A;  4WOR A;  3VYR A;  3KF6 A;  1CSQ A;  3TSS A;  2DGY A;  3R8B A;  5F2D A;  1O7L A;  4DR5 Q;  4JI8 L;  1TWF B;  2F0M A;  4A3I B;  1EQR A;  5KIX A;  1G2S A;  4KHP L;  1V8Q A;  2O4X A;  3C1E A;  4JI0 Q;  4GKJ L;  1BVS A;  1MGS A;  4A3D G;  4MTK A;  4OIJ A;  1IZ6 A;  1J9O A;  4GOP B;  3HP3 A;  1WCM G;  1XMO Q;  3EQL C;  2B2Y C;  2B3G A;  4ZQ3 A;  2JEB I;  1Z7T A;  2MHV A;  5FO7 B;  1AN8 A;  2WII B;  4HED A;  3MEH A;  2DY7 A;  3QWN A;  4AYB G;  4JI0 L;  3TP7 A;  2NN6 G;  2F3W A;  3UDI A;  2A5H A;  1SNC A;  3I90 A;  2NVQ B;  1E2V A;  4XTC S;  5M3F H;  3BDL A;  1V1O A;  2F0W A;  3PUV A;  4PZ8 A;  2RQX A;  3KJP A;  4HJ5 A;  1QE6 A;  1ZYR D;  4JI7 Q;  4WRD A;  3H0G G;  4RKL A;  4FF3 A;  3D4W A;  3NQI A;  1RHP A;  4R1J A;  3RD4 A;  3RNU A;  1ET6 A;  3I4N H;  3RLO A;  2JA6 B;  2GVA A;  1B3A A;  5ISR A;  1B4O A;  2KBN A;  4JG2 A;  5GAE C;  4NDX A;  5ELF A;  1AH9 A;  1AEX A;  3ONA B;  1KC8 C;  4A3G H;  1PTO D;  5HUR A;  4JI7 L;  3PMF A;  4A3M H;  1VQF A;  1H9R A;  1GKH A;  2EYF A;  1JCK B;  4X6A H;  3I4N B;  3S1M H;  3KJO A;  1QZH A;  3JAM c;  4GNX A;  1B53 A;  4EQP A;  1Y1V G;  2RA4 A;  2Z6K C;  1G29 1;  1JB3 A;  5C0X G;  4ABN A;  1WYD A;  2IWH A;  1XPR A;  4A3G B;  1QVF A;  3SK5 A;  3GTM B;  2AQ2 B;  5EAY A;  3R2T A;  3J81 E;  5IYB H;  1QZG A;  1DCZ A;  1CSP A;  1IL8 A;  5FK9 C;  1KTK A;  3CPW A;  3S1M B;  4C3H G;  3BDC A;  1TVX A;  2UUA L;  3I72 A;  1HQR D;  4N9P A;  3TP6 A;  2IPK D;  1BUV T;  4GS3 A;  1J6Q A;  3ULP A;  1JB7 A;  4AQY L;  2G9D A;  1PV4 A;  1IKM A;  4LUO A;  3FDT A;  3CC7 A;  4DV7 Q;  2HIV A;  3M4Y A;  5EPL A;  1LAC A;  2PZU A;  1UNS A;  3ER0 A;  1FVI A;  4CJ1 B;  1YI2 A;  1MJE A;  1B9N A;  1O80 A;  2R92 H;  1N9W A;  4G7H C;  3G7L A;  3W1G A;  1DOK A;  3Q6S A;  4HSP A;  2ATW A;  3W5O A;  1VQ5 A;  3TZD A;  1N36 L;  3I91 A;  4BXX H;  4G7Z C;  3HS0 C;  1JWS D;  2I07 B;  2A69 D;  4DK3 C;  1BR9 A;  2L4N A;  4DR4 Q;  2AQ1 B;  3HOU H;  3ICE A;  2F1M A;  4FYD A;  2KCM A;  1CFM A;  4BS9 A;  3A5U A;  2VY3 A;  5CV8 A;  3RLF A;  4A3J G;  1DD2 A;  4FO2 A;  2HQE A;  1MIU A;  1CZW A;  5KGU A;  2HUG A;  4J6H A;  2IHF A;  2F0U A;  2E74 C;  5IE8 A;  2QKI C;  3K58 A;  2N78 A;  2QGQ A;  3X3M A;  1Y1W G;  1MKH A;  2UXD Q;  5C4Z A;  5GAD C;  3LNN A;  3UI2 A;  1R4Q B;  1XYI A;  1SBB B;  3FVQ A;  1LT6 D;  1I50 B;  5JJI A;  5EJW A;  4DAM A;  2UXB Q;  4X64 Q;  1E22 A;  4R4I A;  4CDF C;  2ID0 A;  1JOQ A;  1SSO A;  3D6C A;  2L9H A;  3NHH A;  1NUC A;  2UXD L;  5IGD A;  1XWE A;  1K83 B;  1TWG H;  1TY0 A;  1U4R A;  2IX0 A;  1YJW A;  2QEX A;  2FIN B;  3HOY B;  2KHS A;  2F0O A;  2A73 B;  3GTP H;  2RBM A;  2UXB L;  4YHH Q;  4V19 0;  4X64 L;  1KL9 A;  3HKZ E;  1JT8 A;  2QDL A;  4JW0 A;  1Q1E A;  4ULL A;  5M3F G;  4DU9 A;  1UWV A;  4XXE A;  4P72 A;  4PZ7 A;  2CH4 A;  3J81 i;  3QB3 A;  3CMA A;  3UDG A;  4JI3 Q;  5I2X A;  1VF7 A;  1PH7 A;  1RIP A;  5HGQ A;  3B6Y A;  1BBX C;  1A6X A;  4TQU S;  3WWV A;  1WTO A; 
#chains in the Genus database with same CATH homology
 4DXG A;  3DWQ A;  4KHZ A;  3X3N A;  1QG7 A;  2EY6 A;  1NR2 A;  2PO4 A;  2BDO A;  2PMZ B;  4K8J A;  1BDO A;  5FO9 B;  2X6G A;  5IGC A;  4K6L A;  3C1F A;  3ERO A;  3OWE B;  4ODG A;  4DAV A;  4XIG S;  3A54 A;  3G6J B;  2HDL A;  1LV9 A;  1EFI D;  3MXP A;  2XIW A;  1ILQ A;  5I4D A;  2AUJ D;  3DMU A;  1MSH A;  3I4M B;  3VR4 A;  3HOZ B;  3BDO A;  4U67 3;  3GTG B;  3Q22 A;  4A93 B;  2BOS A;  1STB A;  1W6J A;  3AMU A;  3EVQ A;  1U9R A;  4NKL A;  5JVH 3;  4CHT B;  1HRJ A;  4PV1 C;  2F3V A;  1BCP F;  2B2W C;  4KV6 A;  3Q0A A;  4YIJ A;  4C2M B;  2X6L A;  1SYE A;  1GUW A;  2RVL A;  3OWF A;  2PW7 A;  3HOW B;  1ENA A;  1A2U A;  4Z9C B;  1TII D;  3S17 B;  1MBY A;  5D14 A;  3KUP A;  2WAQ B;  4RCO A;  1WTW A;  1MD2 D;  2KCN A;  3L7Z C;  1KAA A;  2MPM A;  4S3S A;  4TKO B;  4DN4 M;  4ZKC B;  2H4O A;  4XYQ A;  4IUV A;  3GD7 A;  1M8A A;  5CV9 A;  5EKL A;  1A2T A;  1A3U A;  4QMG A;  2KJX A;  3J7A V;  3A55 A;  3BG3 A;  4OO1 G;  1TWC B;  2F0F A;  2F0E A;  5BN4 A;  1O7Y A;  1XXG A;  2CQA A;  4IQZ A;  5JPM C;  2K33 A;  2E75 C;  2DY8 A;  3U9O A;  2K5D A;  1SAP A;  2EYO A;  3DHQ A;  2NB0 A;  2CHB D;  4IUT A;  3RZD B;  1RTN A;  5DNF A;  5K36 G;  4DNT B;  1D5X C;  1EYC A;  3P1H A;  2F0T A;  1Q90 A;  2JSO A;  4IFD G;  2J4X A;  5KEE A;  4HN7 A;  2KUM A;  2LMC B;  1Q3L A;  3K7A B;  2VB2 X;  1FR3 A;  2M2L A;  2XNA C;  5COR A;  1I3Q B;  3PUZ A;  4ZUI A;  3E5S A;  2JYO A;  3HG9 A;  4QB4 A;  4K5V A;  2BDN A;  4KK7 A;  1QNU A;  1LTB D;  1Z6H A;  1PZI D;  4C1N I;  5C3X A;  3GTL B;  5J39 A;  2EYH A;  3MWY W;  5J1Z A;  1MSG A;  4FVM A;  1KAB A;  3EJI A;  1QIL A;  1M4V A;  1LT5 D;  2XSC A;  4U68 A;  3NWS A;  3VR5 A;  2WKD A;  1SFO B;  3CHB D;  4KY5 A;  3MHB A;  1Q8I A;  5CV7 A;  1E0B A;  4V0B A;  5BN3 A;  2L1B A;  1RTO A;  3J80 E;  4A3D B;  3E6Z X;  1SDF A;  5I2Y A;  5EGT A;  2NN6 H;  4Q5V A;  3Q24 A;  1HFG A;  2IX1 A;  3PV0 A;  1F9S A;  3C2P A;  1WCM B;  4HMJ A;  3K59 A;  5C4J B;  3Q23 A;  5DEH A;  3H6M A;  4H7B A;  2PW5 A;  3QJY A;  1H9M A;  4BBS B;  1XTC D;  3I4L A;  3A8I E;  1LTS D;  1O78 A;  3TN2 A;  3VYS A;  5FLX E;  1K8M A;  1TWH B;  1UUP A;  2D5D A;  4B9X A;  3M4O B;  3D8G A;  3H0G B;  4J8Q A;  4ZYS A;  3HZX A;  5I9O A;  1VCI A;  1F77 A;  2NTT A;  1ZKO A;  3P7J A;  3SVM A;  1I6H B;  2B2T C;  4HAE A;  1CQV A;  4XQJ A;  1LTR D;  2K32 A;  2K28 A;  4JBW A;  2F0L A;  4DK0 A;  5IT9 L;  1AP0 A;  1Y1V B;  1JR0 D;  2PZW A;  2EYJ A;  1PZK D;  1I4P A;  5T1I A;  2AWO A;  3DEP A;  2PNR C;  2DN8 A;  4IAL A;  3VYU A;  4QUF A;  4KJN A;  1JWM D;  2LS0 1;  1EL0 A;  1B44 D;  1BNZ A;  2R61 A;  2EVB A;  2ZXP A;  5C0X I;  4DGZ A;  4XT3 B;  3NBI A;  3A8J E;  2EYM A;  1SYD A;  1XX8 A;  2KEE A;  1UEA B;  2HCC A;  2XWJ B;  3FEW X;  2A68 C;  2QF7 A;  2B63 B;  1HCZ A;  1TY2 A;  4A3J B;  4I7Z C;  4FNF A;  1HTL D;  3NQT A;  4XYO A;  2CVR A;  2NUC A;  1PTO F;  3VYT A;  1L0X B;  4X3T A;  1B1Z A;  4WJW A;  4K5W A;  2LKV A;  1WTP A;  5A2Q E;  4HCE A;  5I6Y A;  1CA5 A;  1GHK A;  1RF2 D;  4JK1 C;  1S5E D;  5A35 A;  3QO2 A;  2FMC A;  2R6G A;  2Q8T A;  4UDU C;  4XQQ A;  3HRZ C;  2WV6 D;  2WAC A;  5M3F B;  1YNJ D;  4F87 A;  2C5C A;  1LT3 D;  5CC4 A;  4KI0 A;  3S2H B;  3K0Y A;  3OHX C;  2F0K A;  5M5W B;  3R2I A;  3KF8 A;  1GUT A;  3NTK A;  2EYP A;  2F0I A;  1AFP A;  2H1E A;  1Q1B A;  4H13 C;  3TDQ A;  3FMC A;  4R9W A;  1EQV A;  4A3M B;  1A15 A;  1BOS A;  1ENF A;  1SYF A;  2D2C C;  3HEJ A;  3A56 A;  4RH6 A;  3S16 B;  1KLU D;  2LY7 A;  3K5L A;  1G2T A;  3MVV A;  2K6A A;  4CKC A;  3K5M A;  4CJ0 B;  1Y8O B;  4X3S A;  4K5X A;  3NP8 A;  1D5M C;  1SYG A;  2OF1 A;  1YNJ C;  4XDX A;  2V4D A;  3D31 A;  2L5T A;  2BCO A;  5JEA J;  3IAY A;  1SYB A;  2SDF A;  1SXT A;  1EQT A;  2KQ3 A;  3S14 B;  2R92 B;  3TBI B;  1EY6 A;  3QG1 A;  4K14 A;  1HA6 A;  1LLR D;  4H0L C;  1Y8P B;  3FRP B;  3ND9 A;  4RWS C;  1TWA B;  5CV4 A;  2D62 A;  2B2U C;  1SJH D;  3HOU B;  1RD9 D;  1EU4 A;  5C5L A;  2CW0 C;  2EJM A;  2QIL A;  3IFD A;  2J7Z A;  2Y0S B;  3LWU A;  1J8I A;  3MA2 B;  1QNK A;  5CYU A;  2HDM A;  3A7L A;  5D3D A;  1FNW A;  1I4G A;  4CBV A;  2JXM B;  2F0Q A;  1EWH A;  5JPN C;  3DEO A;  4M8A A;  1CA6 A;  4OO1 H;  2EJG C;  4EGV A;  1CTM A;  1TWG B;  4K2K A;  3RUZ A;  4RCN A;  3GTP B;  1F2Z A;  4MN3 A;  3WDN A;  4NMZ A;  5JAV A;  5J22 A;  1EIG A;  2SEB D;  3VA5 A;  1D1K A;  5CBE E;  3D3R A;  5K36 H;  2KCC A;  5NUC A;  1RKN A;  3T4A C;  1PRT B;  3K5N A;  2F0S A;  4ZKB B;  1EU3 A;  4PMB A;  4KY6 A;  4IFD H;  4DF7 A;  2N55 A;  5KNB A;  1G6Z A;  4KD3 A;  4HTH A;  5C44 B;  2A6H D;  1EY5 A;  4OO1 I;  1HFN A;  4BWG B;  3SHL A;  4ILW A;  2FMM A;  1YNN C;  4KHV A;  1S5B D;  2L11 A;  4PQX A;  2A6E C;  5IGF A;  2EZV A;  2K05 A;  2GA4 B;  1STY A;  4HSV A;  2RSN A;  4RKB A;  3JAM E;  3SE0 A;  4IUQ A;  1HXY D;  2F0G A;  1CZG A;  1CK1 A;  5KYL A;  4QUC A;  5D3I B;  2VNU D;  1F9R A;  1ROD A;  4RGM A;  1PFM A;  2LFN A;  1V1P A;  4K2L A;  1DON A;  4NP5 A;  2F03 A;  1C4Q A;  3K57 A;  4IFD I;  3M7G A;  1B2T A;  3KBG A;  4C3J G;  1LTG D;  4BA1 I;  1JOR A;  3ITP A;  3MAQ A;  2A6H C;  1CHQ D;  3SR1 A;  4CKE A;  3AU7 A;  5BN5 A;  4XQN A;  4DAP A;  2F0J A;  1C8C A;  4UAI A;  2NYZ D;  3HKZ B;  1MI2 A;  3LWE A;  3PIP 3;  1PTO H;  1IYU A;  1FNU A;  1WD1 A;  5M5Y B;  1EEF D;  5IIF A;  3U9S A;  3F2U A;  4KKU A;  3W2D A;  3E0J A;  2EXZ A;  3TME A;  2XVS A;  5CMD A;  4C3I G;  4XT1 B;  2TSS A;  1A3V A;  2B2V A;  2ZXO A;  3IKJ A;  3VA7 A;  2K7V A;  5EQ0 A;  4DK1 A;  2EDG A;  1RDP D;  5ELE A;  2K04 A;  5JOB A;  1H9K A;  1D2B A;  2E2H B;  2F0P A;  1SE4 A;  2R7Z B;  2PCF B;  1EY4 A;  1PMR A;  5C3W A;  1ONL A;  2JA5 B;  4EVO A;  1ICW A;  3MFG A;  4FXK C;  2B39 A;  5KND A;  1HQM C;  3HOV B;  2K03 A;  1K8O A;  2D9U A;  3J7A F;  2WB1 B;  1HHV A;  1X3Q A;  4KN4 C;  3BZD B;  3TP8 A;  2NTS A;  5ELB A;  1DOL A;  3EA6 A;  3GTK B;  3NTI A;  3T51 B;  1G8Z D;  3IFT A;  1SMY C;  2HCI A;  2WIN B;  4EQN A;  3T53 B;  1L0Y B;  4I65 A;  4IUP A;  5DM6 3;  3GTO B;  1JOK A;  5E1F A;  3PUX A;  2R3Z A;  1ML0 D;  5FKA C;  3D6W A;  1HTP A;  3GP7 A;  5DAU A;  3V05 A;  1E2Z A;  1SNP A;  3WOF A;  3OMC A;  4R8I A;  1DOM A;  2L55 A;  1S5D D;  5EBD A;  3SDZ A;  2PQE A;  2E2J B;  2B2Y A;  3SXH A;  1F2Y A;  2IX3 A;  2ZXR A;  1STH A;  4HR7 B;  1TQO A;  1GXD C;  1UAP A;  4FXG C;  1IKL A;  3O13 A;  5IGB A;  3I3C A;  4AYB B;  2SNM A;  3A7A B;  2DNC A;  3ND8 A;  1DYQ A;  3V2T A;  1KLG D;  1EZ8 A;  5FOB B;  4OGQ C;  5ELC A;  2IT1 A;  1PFB A;  4RHS A;  1IW7 C;  3D4D A;  4R8N A;  1TU2 B;  3KK7 A;  1GUG A;  4A3B B;  2B8F A;  3H94 A;  2NN6 I;  2MGS A;  4OIK A;  3K5O A;  1EOT A;  1LO5 D;  1SND A;  2MUY A;  2B2V C;  2A68 D;  2MP1 A;  1NAP A;  1OXT A;  1EZ6 A;  1R9T B;  1O7Z A;  1PYW D;  1D1I A;  4IUN A;  1IHZ A;  4DXF A;  1Q12 A;  3DWP A;  1CT1 D;  5C3E B;  4CKB A;  3BVZ A;  4FF2 A;  1TS2 A;  4C3H B;  3J80 L;  1F9Q A;  2F0N A;  3K6O A;  4F8M A;  1LAB A;  1I4R A;  2XWB B;  2ZT9 C;  3MFY A;  5E3F A;  1HUN A;  3OMG A;  2Z1C A;  5EPJ A;  1X3P A;  5D65 A;  2XRS D;  1I4X A;  4NW2 A;  1SJE D;  5COY A;  3NTH A;  5G3L D;  3M7N A;  1PXU A;  5I9P A;  1GJX A;  1SNM A;  2BA0 A;  1AZP A;  4E6I A;  1Y1W B;  1IYV A;  3BVM A;  3N52 A;  2NVY B;  2O2L D;  1BCP B;  3I8Z A;  4BY1 B;  3M85 A;  3CKI B;  2FHT A;  5HGT A;  1STN A;  3NE5 B;  2KEC A;  1PRT C;  1HPC A;  3GO5 A;  2JE6 I;  3OOC A;  1OXX K;  1FNV A;  3I73 A;  2OEO A;  2AUK A;  1V1P B;  3MXN A;  1GUO A;  4RGN A;  2OT2 A;  3NXW A;  4KKS A;  4P2C B;  3GTQ B;  4ZRZ A;  3P20 A;  4QCL A;  4O1N A;  4K6D A;  2YU9 B;  5C5M A;  5KNC A;  4RGT A;  1SE3 A;  2JEA I;  2RDG A;  4F88 A;  1DM0 B;  3KLS A;  4CGY B;  3NBH A;  4A3K B;  2Q8I B;  4FF1 A;  2YYZ A;  3SK6 A;  3C46 A;  1SYC A;  3PO2 B;  3A8K E;  3AB9 A;  4RFB A;  3NK9 A;  2NBF A;  5CBA E;  3PO3 B;  5C0X J;  5LL6 X;  2CW0 D;  1KDB A;  1GUN A;  3CRK C;  1T5X D;  3PUY A;  1R4P B;  2RSO A;  2Z8L A;  1BO0 A;  3D4R A;  2BE5 D;  1F2L A;  1Y69 U;  4B9W A;  3RZO B;  2F4I A;  5A2Q L;  2JP1 A;  4MHE A;  5KRU A;  3ERQ A;  3IL8 A;  5IGG A;  1ZYR C;  1EWC A;  5JEA G;  3SEB A;  1ZEQ X;  3FKI B;  4BA2 I;  3KBX A;  1FYC A;  3HOX B;  4LJZ C;  3M3Y B;  2B2W A;  1TKW B;  1KDA A;  4F7X A;  1KDC A;  4MIU A;  1PTO C;  1VF5 C;  2O5J C;  4IUU A;  1H9S A;  1CI3 M;  1H9J A;  1X32 A;  3BYY B;  4C3J B;  1QCB D;  3T56 B;  3NWT A;  3W3A A;  2ICI A;  4GZY C;  4O42 A;  3OSO A;  3NUC A;  5CR3 A;  2ICE C;  4CJ2 C;  4TRD A;  1JIC A;  1TS4 A;  2BE5 C;  1EY0 A;  1SNO A;  1ESF A;  3J81 L;  3GV3 A;  1WD0 A;  1WVL A;  1CHP D;  2QDB A;  5CV6 A;  3L3O C;  2RKS A;  1FD7 D;  4DA2 A;  5T1G A;  2VUM B;  5IOD A;  4G57 A;  1YNN D;  4IZ8 A;  3BYT B;  4L8J A;  4FP5 D;  2A6E D;  1LTT D;  5C4X B;  3QOL A;  2KA7 A;  1S5F D;  1CQF A;  1CM9 A;  1STE A;  3NSW A;  5C6A A;  4QIW B;  1I4H A;  4C3I B;  1WTX A;  2A69 C;  4L63 B;  1PFN A;  1EEI D;  4KJO A;  3OIQ A;  3NPP A;  3OW7 A;  4ZUJ A;  3S1Q B;  2M9V A;  5IOC A;  5ELD A;  1KNA A;  2EYL A;  3QIA A;  4N9T A;  4J1M A;  3TZU A;  2EY1 A;  3FPP A;  1B50 A;  4C1N K;  4PMC A;  3V96 A;  4DAY A;  2J0T D;  2C9O A;  3GV6 A;  5AFW A;  4FF4 A;  4FXD A;  4ZK9 B;  1VMP A;  1JC7 A;  1II3 A;  2Q8R E;  2BA1 A;  4KD4 A;  2EJF C;  5DM7 3;  4Y7N B;  5CGK A;  1TR5 A;  4RHR A;  3DUZ A;  3C3L A;  4KKT A;  2EOT A;  3QOJ A;  3URY A;  1VMC A;  2TMP A;  1BXT A;  2PYK A;  1Y8N B;  4LMQ D;  1JOO A;  3PIO 3;  2KVM A;  3S15 B;  2K5Q A;  5LHY 1;  3H91 A;  1I6V C;  2WP8 J;  2G9H D;  1JQY D;  2IL8 A;  3MXG A;  3ZYY X;  1STA A;  1QOH A;  2DNE A;  2K5W A;  4KN7 C;  1SE2 A;  4RAU C;  1LTA D;  1HA5 A;  3CU7 A;  2PZT A;  1OXU A;  2F0V A;  5E4W C;  1GOZ A;  3I70 A;  1TT2 A;  2EPB A;  3OPO A;  1NCV A;  3LX0 A;  3BVG A;  5EPK A;  1PTO B;  1NSN S;  1W6K A;  1T5E A;  3MTS A;  1S4Z A;  1I4Q A;  1F9P A;  1PDQ A;  4QF4 A;  1PLF A;  2VB3 X;  2F0H A;  1V43 A;  5E4X A;  3JAM L;  1BQQ T;  1C48 A;  2QCP X;  2IJ0 A;  4OHJ A;  2PPB C;  4A3E B;  1SMY D;  1D5Z C;  2E2D C;  3DM1 A;  1G91 A;  4RA8 A;  2QEJ C;  1BCP D;  2NVT B;  2B2T A;  2L12 A;  1EY9 A;  2EE1 A;  3MXU A;  3VR2 A;  3SK8 A;  1VDZ A;  1TS3 A;  2K01 A;  4HMI A;  1LT4 D;  3FPU B;  1RJT A;  2SNS A;  2SOB A;  3S1R B;  2KED A;  1AW7 A;  3TP5 A;  1A3T A;  5IGE A;  2EY2 A;  1B9M A;  5M9O A;  2Z4I A;  2F0D A;  2RDF A;  2NVX B;  1ET9 A;  3SK4 A;  1EYA A;  4OL7 A;  3WOE A;  4IFD J;  3HGB A;  2E2I B;  1HUM A;  3MC0 B;  1WTQ A;  1U4P A;  1BCP C;  3VR3 A;  1QJO A;  2JA7 B;  4ID6 A;  4WFN 3;  3S9W A;  1BF4 A;  1PZJ D;  2Z4H A;  1NR4 A;  1GUS A;  1ESR A;  1U4L A;  4H44 C;  1KNE A;  1IW7 D;  1DZ1 A;  3R93 A;  1ZXT A;  3KLR A;  1U4M A;  2FFK B;  2K1B A;  4G4K A;  2N88 A;  1EY8 A;  1F2M A;  3H09 A;  4X3U A;  5M5X B;  1SEB D;  2IW3 A;  1TS5 A;  1JWU D;  1S5C D;  4C56 C;  3MZ5 A;  5IT9 E;  2XN9 C;  2NWG A;  1OXV A;  1OO9 B;  4B08 A;  3BS1 A;  3PUW A;  1EIH A;  2MJ8 A;  3DXJ C;  2X69 A;  3RMH A;  4HCS A;  1QWY A;  5CV5 A;  5KYI A;  2FJ2 A;  1JE4 A;  2ENB A;  4IUR A;  4A3F B;  4X3K A;  1OXS C;  2R93 B;  4Q0F A;  4TSS A;  2WKC A;  4DNR B;  3CRL C;  1PRT F;  1EYD A;  1H9S B;  1ILP A;  1SNQ A;  3CQZ B;  4LK1 C;  4EQO A;  3T13 A;  5EBC A;  1QB5 D;  2I46 A;  1GHJ A;  1D6E C;  2NZ1 D;  5FO8 B;  2AQ3 B;  5I6W A;  1ENC A;  1EY7 A;  1WTR A;  2OXP A;  5EKI A;  3R3O A;  5G3L F;  4IN3 A;  2L0C A;  5C0X H;  2E76 C;  1DJR D;  2AWN A;  3N6R A;  4KY7 A;  4RGO S;  5EKK A;  2EY5 A;  5LL6 S;  4K8I A;  3S1N B;  1RCV D;  3P75 A;  5JJZ A;  5K5P A;  3GTJ B;  2O5I C;  5JVG 3;  2RDH A;  4M1U B;  4G7O C;  4ZLT F;  1AZQ A;  3S2D B;  3H3V C;  5JEA H;  2VXW A;  1PRT D;  4KMU C;  5M3M B;  4PMW A;  3J7Y W;  3L9A X;  4PNY A;  3VR6 A;  2JA8 B;  4ZAI A;  4BBR B;  5TSS A;  4L6T B;  1Z47 A;  1E2W A;  3EFX D;  2A74 C;  2B8G A;  3KLS X;  5FLX L;  3OIP A;  1FGB D;  2KOL A;  1LTI D;  4DFA A;  4ME5 A;  3GQB A;  2B2U A;  3T16 A;  3DWA A;  4BY7 B;  1DXM A;  2XRQ D;  4LAA A;  1STG A;  2M00 A;  4KTA A;  1WTV A;  4WOR A;  3VYR A;  3TSS A;  3R8B A;  5F2D A;  1O7L A;  1TWF B;  2F0M A;  4A3I B;  5KIX A;  1G2S A;  1V8Q A;  2O4X A;  3C1E A;  1MGS A;  4OIJ A;  1J9O A;  3HP3 A;  3EQL C;  2B2Y C;  4ZQ3 A;  2JEB I;  1Z7T A;  2MHV A;  5FO7 B;  1AN8 A;  2WII B;  4HED A;  3MEH A;  2DY7 A;  3QWN A;  3TP7 A;  2NN6 G;  2F3W A;  2A5H A;  1SNC A;  3I90 A;  2NVQ B;  1E2V A;  4XTC S;  3BDL A;  1V1O A;  2F0W A;  3PUV A;  2RQX A;  1QE6 A;  1ZYR D;  4WRD A;  4FF3 A;  4RKL A;  3D4W A;  3NQI A;  1RHP A;  3RD4 A;  1ET6 A;  2JA6 B;  1B3A A;  5ISR A;  1B4O A;  4NDX A;  5ELF A;  1AEX A;  3ONA B;  1PTO D;  5HUR A;  3PMF A;  1H9R A;  2EYF A;  1JCK B;  3I4N B;  1B53 A;  4EQP A;  2RA4 A;  1G29 1;  1JB3 A;  5C0X G;  4ABN A;  2IWH A;  4A3G B;  3SK5 A;  3GTM B;  2AQ2 B;  3R2T A;  3J81 E;  1DCZ A;  1IL8 A;  5FK9 C;  1KTK A;  3S1M B;  4C3H G;  3BDC A;  1TVX A;  3I72 A;  1HQR D;  4N9P A;  3TP6 A;  2IPK D;  1BUV T;  2G9D A;  1IKM A;  3FDT A;  3M4Y A;  5EPL A;  1LAC A;  2PZU A;  1UNS A;  4CJ1 B;  1B9N A;  1O80 A;  4G7H C;  3G7L A;  1DOK A;  3Q6S A;  4HSP A;  3TZD A;  3I91 A;  4G7Z C;  3HS0 C;  1JWS D;  2I07 B;  2A69 D;  1BR9 A;  2L4N A;  2AQ1 B;  2F1M A;  4FYD A;  1CFM A;  4BS9 A;  5CV8 A;  3RLF A;  1DD2 A;  4FO2 A;  2HQE A;  1CZW A;  5KGU A;  2HUG A;  4J6H A;  2F0U A;  2E74 C;  2QKI C;  3K58 A;  3X3M A;  5C4Z A;  3LNN A;  3UI2 A;  1R4Q B;  1XYI A;  1SBB B;  3FVQ A;  1LT6 D;  1I50 B;  5EJW A;  1JOQ A;  2ID0 A;  1SSO A;  3D6C A;  2L9H A;  3NHH A;  1NUC A;  5IGD A;  1XWE A;  1K83 B;  1TY0 A;  1U4R A;  2IX0 A;  3HOY B;  2FIN B;  2KHS A;  2F0O A;  2A73 B;  2RBM A;  4V19 0;  1Q1E A;  4ULL A;  4DU9 A;  4XXE A;  3QB3 A;  5I2X A;  1VF7 A;  1BBX C;  1A6X A;  4TQU S;  5C4H A;  1WTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...