1WTXA

Hyperthermophile chromosomal protein sac7d single mutant v26a in complex with dna gtaattac
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
MVKVKFKYKGEEKEVDTSKIKKVWRAGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*TP*AP*AP*TP*TP*AP*C)-3'
publication title Probing the DNA kink structure induced by the hyperthermophilic chromosomal protein Sac7d
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Dna binding protein/dna
total genus 12
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wtxA00
5CBEE 1O80A 2B2UC 1MGSA 1B4OA 1PFBA 1U4RA 1KNEA 2FINB 2HDMA 1B50A 1ILPA 4ZKBB 5EPJA 3LWEA 5CORA 2H1EA 2Q8TA 2X6GA 2B2TA 1PFNA 2DY7A 3SVMA 5CBAE 5JJZA 3FPUB 3G7LA 1QG7A 1QNKA 2K1BA 1NAPA 2X6LA 1MI2A 3F2UA 2K05A 1X3PA 4RWSC 4X3UA 1IL8A 1F9RA 1CA5A 1PDQA 3I3CA 4NW2A 1AZQA 1U4LA 2RVLA 1HFGA 3P7JA 1BF4A 5AFWA 1WTXA 1O7ZA 1Q3LA 2EE1A 3UI2A 1QE6A 3DM1A 1E0BA 1NR2A 1DZ1A 4HAEA 1HUNA 1HFNA 1VMCA 1RHPA 1SAPA 2JP1A 1TVXA 2FHTA 2CVRA 2KVMA 2KUMA 4MHEA 1F9QA 1WD0A 1WTRA 1BNZA 1G6ZA 5DNFA 5EQ0A 1HA6A 4UAIA 1J8IA 3I90A 3DEPA 1AP0A 2L12A 4QUCA 5EPLA 4RAUC 1F9PA 2B2TC 4CJ1B 2L9HA 2HCCA 4U68A 2HDLA 5D14A 1JICA 4HCSA 1BBXC 1WTPA 1WD1A 1XYIA 1G2SA 1NR4A 2RSOA 3HP3A 3MTSA 1J9OA 3IL8A 5EJWA 4ZAIA 1EIHA 2B2YA 4DN4M 2HUGA 1G91A 1F2LA 2R3ZA 3GV3A 1WTOA 1ESRA 1ZXTA 1EL0A 3KUPA 5CMDA 3GV6A 2K04A 2FMMA 1ILQA 4X3SA 1XX8A 1DOKA 2MPMA 4ZKCB 4ZLTF 1LV9A 2JYOA 2EOTA 3MWYW 4CJ2C 2MJ8A 3IFDA 2KECA 2FJ2A 1IKLA 1U4MA 1RTNA 4QUFA 2IL8A 2NWGA 1X3QA 5E4WC 1SDFA 3R93A 1IKMA 3Q6SA 4IUQA 4IUVA 1MSGA 1CM9A 2KEDA 2KEEA 4XT3B 1RTOA 1HHVA 1O7YA 2XIWA 3ONAB 4R9WA 1ICWA 1RJTA 1EOTA 3D6WA 1WTQA 3I8ZA 3I91A 1B2TA 4OIKA 2B2YC 2L4NA 4O42A 1MSHA 2J7ZA 4IUUA 4RA8A 1G2TA 4OIJA 1AZPA 4HEDA 5EKIA 2M2LA 2RA4A 2X69A 3QO2A 5T1GA 5EPKA 2RSNA 2B2VA 1HUMA 1VMPA 2VXWA 4X3KA 2B2WA 4IUPA 3N52A 2KOLA 4CJ0B 1BO0A 2B2UA 2NZ1D 1HRJA 4X3TA 4XT1B 1DONA 2MGSA 1WVLA 2DY8A 1WTWA 2HCIA 4HSVA 2SDFA 4IURA 1M8AA 2K28A 1KNAA 4XDXA 1A15A 1DOLA 1SSOA 1B3AA 2Q8RE 2D9UA 1RODA 3DEOA 4IUTA 1ML0D 1DOMA 1EIGA 4LMQD 3TZDA 5COYA 2K01A 2FFKB 1WTVA 4R8IA 2EPBA 2BDNA 3FDTA 1PLFA 4MN3A 1X32A 5T1IA 1B53A 1CA6A 2NYZD 2L11A 2L1BA 1F9SA 3KBXA 5D65A 2B2VC 2MP1A 2N55A 3H91A 1NCVA 3TN2A 2B2WC 2N88A 1S4ZA 2K03A 5E4XA 1PFMA 4ZK9B 1JE4A 1EQTA 1GUWA 1C8CA 1U4PA
chains in the Genus database with same CATH superfamily
1R9TB 1CHPD 2R7ZB 1ESFA 4NMZA 5I6YA 3ERSX 4B3RQ 4XIGS 2QILA 1BXTA 1ENAA 1M90C 2QDLA 4BBRB 4A76A 2OTJA 2DGYA 2B63H 1OXVA 2CQOA 3VYTA 1X3PA 2LXJA 3J81i 3GTQB 1ET6A 3TS0A 1KLUD 2XWBB 4R8NA 5CR3A 4Z9CB 3CD6A 3H09A 2VS1A 1FJGQ 3KOJA 5C0XG 2ZTCA 4A3BH 4G7OC 2K75A 1JB3A 1D5MC 3GTOH 1F9PA 4IPDA 3ULPA 5C3WA 1W2BA 3GTPB 2UUCQ 3S2HB 4CKEA 5IP9G 2VY3A 1J9OA 4OL7A 1UEBA 3MXUA 1K9MC 4PG3A 4DV1Q 1VQ4A 2A8VA 1ONLA 4R4CA 3FHWA 4DR2L 5CMDA 2PZUA 3GV6A 3PUZA 2K04A 4LF4Q 5GAGC 3T1HQ 3CQZB 2EOTA 5I2XA 2F0NA 4DV0L 4O0AA 1RTNA 2NWGA 1KLGD 3GQBA 4I65A 1NY4A 2KEEA 3S14H 4CHTB 1RTOA 3H0GB 1GUTA 4B3ML 2EYFA 4I7ZC 4LFBQ 4JI4L 1K0SA 1AE3A 2KQ3A 4A93H 4XQJA 4PMCA 1G8ZD 3NELA 4PZ6A 4ZUIA 2R93B 5M5YH 5JEAJ 2WP8J 5IODA 4WJ3M 3J7A5 2EXZA 2NZ1D 5C4ZA 5E7NA 1TWGH 1PH7A 2DY8A 3GTMH 1IBKL 2YV5A 1Y1VH 4AYBG 1OO9B 2NVXH 3NXWA 2I5LX 1TWHH 2OTLA 3A0JA 2WKCA 1QB5D 4LFAQ 3HFZB 1L1OA 5GAEC 1D6EC 2JJQA 1FVIA 3HOVG 1J5EQ 1HZCA 3M9BA 4J6HA 4KJNA 4QJFA 2RHQB 2F0DA 3HGBA 3K0YA 4DXGA 4A3MB 3W1GA 2XN9C 3SXHA 1OXUA 4DAMA 2H1EA 5I9PA 3R3OA 5HY6A 3SVMA 1F77A 1A6XA 3J80i 1FL0A 4GN5A 3A5UA 3PF4A 1XPUA 1ZYRD 1L1OC 1F9RA 2D0OA 3M7GA 3M4OH 3U4ZA 3I3CA 4N9TA 1EUJA 5EBCA 3DXJC 4A3IG 3RN2A 3JAMi 1VQFA 2FHTA 4MHEA 3CCSA 1SNPA 2K50A 1SYCA 3QB3A 1ZKOA 3PIPA 4AYBE 2HDLA 3MHBA 4R1JA 1Q82C 4HCSA 3J80L 1TWCH 1O7LA 1EIHA 2ZTEA 1K83B 1P8LA 1D8LA 1X3GA 3Q8DA 2K5NA 1NBWA 5CV4A 5ISRA 4BY7H 3KUPA 1STNA 5M3FB 1CTMA 1PH3A 1ILQA 4A4IA 4HIMA 1C48A 4ZKCB 4DR7L 3HOZB 3RN5A 2FJ2A 4DAPA 4RGMA 1S5DD 3NE5B 4B3TQ 4A3DG 3U9SA 4EVOA 2AQ2B 5BN3A 1X3EA 2BE5C 2CWAA 3K59A 3BVMA 1R4QB 3I4OA 1RF2D 3OYYA 1OXXK 2PW5A 4RHRA 4DR5L 4IUUA 1Y69U 2L15A 2K6AA 1LTTD 2RA4A 3OTOQ 4A3FG 1U0LA 4Y52H 3PO2B 3M4QA 2B2WA 2EJGC 2QKIC 4KN4C 3H15A 4K6LA 4KY6A 3RLFA 3IAYA 3M4PA 5ELEA 4JI1Q 2HHHQ 5FLXE 4JI5L 2AUKA 4DV5Q 4C3HB 3S15B 2UXCL 1JR0D 2Q8RE 2NUCA 2PNHA 4HCEA 2NN6G 2VB2X 3G4SA 3MEHA 3TP5A 2F0QA 1WCMB 1PLFA 5FLXc 1Q12A 2OQ0A 1LTID 4GKJQ 2ZJPA 1DD2A 4LFCQ 2MP1A 3H91A 3K5MA 1MHWC 2B2WC 2UU9L 2I07B 2YTVA 1JE4A 1II3A 1N36Q 1PMRA 2CW0D 3PV0A 3AFPA 5C3EB 4JVZA 2PO4A 5C44H 3K5OA 4OELB 1CFMA 1SJED 1CZWA 3NBIA 2GVBA 5I2YA 2K1BA 1P16A 4P2CB 1JMCA 3D6CA 5AJ3Q 2IT1A 4ME3A 2Z6KA 3MXNA 3J7YW 2RDFA 1PYWD 2MUYA 4YHHL 4ZYSA 1MJCA 1HFNA 1VMCA 1QZGA 4OWXB 4JBJA 1EIFA 2AMCB 4RMFA 4GLVB 4UAIA 3I90A 1AP0A 5D3DA 4C1NI 4PV1C 2YU9H 2NVYB 1I4QA 1UE7A 1H95A 3A54A 5IGGA 3HS0C 3ITPA 4K5VA 4DUYL 1M4VA 1SNCA 2BA0A 1JT8A 3WOFA 1PH4A 5BN4A 1ZEQX 2EYPA 3M7NA 2Z6KC 2CW0C 1EL0A 2KCCA 4ALPA 4A3BG 1H9KA 1B1ZA 5LL6S 2WV6D 2DJFC 3BZDB 1HNWL 1PYSB 2IL8A 3S17H 1B44D 2AWNA 3CHBD 5JEAG 1Z6HA 2WINB 1Q81C 1XMQL 5GROA 3QOLA 1HTLD 4RH6A 3UE1A 1WTQA 3I91A 3VA5A 2F0UA 4Q5VA 2E2HB 3NQTA 3HOWG 2F0HA 2MNAA 2X69A 4TRDA 4R4IA 1JWSD 1WI5A 3TEHB 4DK6C 3I4MB 1PH1A 1XTDA 3JC66 1WFQA 4GOPA 4A3EB 5JJLA 2JA7G 4UPAA 1WTWA 1PZID 2SEBD 3A55A 4IURA 3EN2A 4A3CH 1LM0A 4XDXA 3CRLC 1UWVA 4POFA 3X3NA 5D3IB 4A93G 4OX9L 2D5DA 1JOOA 1EY4A 2A74C 4NP5A 4IO9A 4YWKA 2ES2A 4OONA 4JI8Q 3G6JB 3BS1A 1PTOF 3I55A 1E1OA 4RGOS 1IHZA 4GOPC 1K0RA 2OQKA 4AQYL 4JG2A 3GO5A 1LTGD 1KNEA 3VYRA 4IPHA 1KABA 3M3YB 1E22A 3SEBA 3S16H 1HR0Q 1A2TA 4BBSB 3NTKA 2O5IC 1S5FD 1YHBA 4QCLA 3DM3A 4DR1L 1PH8A 5IT9E 1FNVA 1LACA 4DV4Q 3P7JA 1T5XD 3DM1A 2IX1A 3MFYA 2NB0A 5IT9c 2A6HD 3KLSX 4R4OA 2AUJD 1MD2D 3S1RB 5J39A 2OWOA 5DNFA 1DJRD 2Y0SG 3RNUA 2Q2UA 5BR8L 3KFUA 2ICEC 3K5NA 1F2YA 1GO3E 1DM0B 1B3QA 3K58A 4FXDA 4WFN3 2B2YA 3RLNA 3OWEB 2LMCB 3T1YL 3A7LA 1SE8A 2ZTDA 1N33Q 3F2BA 1ESRA 5IP9H 3BYTB 3AQQA 1L0WA 3NBHA 4KLKA 1RCVD 1I94L 2KBNA 2ATWA 2KECA 4L5QA 2E8GA 4FNFA 4RGNA 4C2MH 4YY3Q 3T13A 1G291 3M4YA 4I7AA 4L6TB 5CC4A 1QVGA 2EQSA 3D6WA 5IGDA 4A3LG 2K7VA 5KNCA 4DR3Q 3HOUG 2B2YC 2Q2IA 2J7ZA 4F8MA 3CCMA 1G2TA 3QIAA 1NNXA 2WAQG 3E3XA 3L0OA 1EY9A 2M2LA 4HEDA 2UXBQ 3EQLC 1RD9D 5FJ8H 1HUMA 2VXWA 3I4NH 1EFWA 4JI3Q 1PYBA 1K3BC 2Y0SE 3DHQA 4A3JB 4LJZC 3K7UC 2K28A 3BYYB 3K5LA 5CV7A 1OTCA 2LFNA 1B3AA 4Q0FA 1JQYD 2AQ1B 4BXXG 1VDZA 4NKLA 1CKNA 4FXKC 4DNIA 3EIVA 3CPFA 4JCVE 2VQFL 4JI6L 1GUSA 2EY6A 2NTSA 3J7ZC 3PO3H 1SMYD 5FO8B 2CWPA 4TSSA 4DFAA 1HNZL 1PV4A 5G3LD 3HOVH 4FF1A 4QGUA 2QW7A 4J1MA 1TY0A 2B63B 5C4JH 2ICIA 2A69C 3DWAA 3ERQA 5CBAE 5C4XH 4PZ8A 4RKBA 2ZM6L 2BDOA 1XMOL 3L2PA 1SN8A 4DK0A 2WAQE 4ID6A 5LMUL 4OEMB 2PQEA 1J6QA 2D62A 4HTHA 3UI2A 2K5VA 5FKAC 1YJWA 1HUNA 2F0OA 3GTGB 1LT6D 4HJ9A 2KHJA 1WD0A 3GTOB 1BNZA 1SR3A 5M5WB 4CDFC 1VQHA 1J8IA 1I4XA 2KJXA 3DEPA 4A3IH 3P20A 2L12A 1N32Q 2V1CC 4KTAA 2JA5B 5D14A 2F3VA 4ULLA 4C3IB 2UXDQ 3NTHA 3CC4A 1LTAD 3TQYA 5IYDG 3FKIG 2NVTH 3R8BA 4FF4A 4H44C 2F0MA 2EZVA 2DN8A 1VQ6A 2KEDA 3MEFA 3OMGA 4L8JA 3K6OA 3T16A 3NQIA 4C3JB 1EU3A 3BZKA 2JSOA 3ONAB 4A3DH 4A93B 5H1SE 1YNJD 3I8ZA 3C1FA 4IOAA 5M5YB 5EKIA 1AFPA 1TWFH 1G6PA 1B9NA 4GNXB 3HOYG 4OO1G 1TWGB 2B2UA 3OMCA 3GTMB 2EYLA 4N8X1 2EYJA 1STHA 1Y1VB 3H3VI 4KKSA 4QMGA 2Z6BA 1SSOA 1TWHB 3SK8A 4EQOA 1EIGA 1A62A 2F0LA 1WTVA 4R8IA 2ZT9C 3KLWA 4H0LC 4BA1I 4M1UB 1K8GA 1PZJD 1YI2A 3L7ZC 4H7BA 2NN6H 3PGZA 5FOBB 1IBLL 1VQOA 1Y14B 4MTNA 3LNNA 5I4DA 4Y7NH 2LY7A 1CKNB 1JORA 3HKZB 2K32A 4KY5A 4YCUA 5CBEE 2B2UC 1MGSA 4A3CG 3SHLA 5KEEA 3C1EA 1YNJC 3MC0B 3LWEA 2C5CA 1Z47A 1TR5A 5C5LA 3GD7A 4IOCA 4GLAC 3I70A 3HEJA 2UUCL 1CK1A 4RWSC 3HOXB 4KMUC 4CGYB 2F4VQ 1CQVA 2SOBA 3CC2A 4B3SQ 3MA2B 2XVSA 2KVMA 3FVQA 3MAQA 2ZJQA 1HA6A 1Y8OB 3FEWX 4X62Q 2E76C 3U9OA 3PIOA 4JBKA 1NUCA 1EYGA 4HJ8A 1C4QA 4BY7B 1K73C 4V190 1GHKA 4R4TA 2JA9A 3DMUA 1CZGA 3E9IA 1MKHA 4DV2Q 2KHIA 2JN4A 3VYUA 4GZYC 1LV9A 4CJ2C 2Q2HA 1SFOB 1GUGA 4O2DA 3CCJA 1DCZA 1LTLA 3O13A 3KBGA 5E4WC 1H9SA 2B29A 3SGIA 5GADC 2XNAC 2EY1A 5JEAH 3RZDH 5JJKA 4RA8A 3RZOH 1AZPA 2K4KA 4DV3Q 3QWNA 3J81L 1F2MA 3CAMA 2E2IH 1VMPA 3OIQA 4X3KA 4BY1G 1JJ2A 2E5LQ 3HOWH 4CJ0B 4UP9A 1BO0A 4IJLA 3CCQA 1EEID 1I6HH 4ZCKA 3C46A 4DR4Q 3I56A 3KYHC 2JA7H 3SK5A 5CV6A 1L0YB 2JA6G 2ID0A 4HIDA 5FJ8G 1VQMA 3I4NG 5KIXA 3KBXA 2JK8A 2VB3X 1CSPA 2FXQA 4K14A 1VQNA 5EBDA 2PI2E 4X66L 2JA8B 2F3WA 1PFBA 1U4RA 5C44B 4LAAA 3ND8A 1KC8C 1ET9A 3I72A 4KV6A 1CSQA 1YBYA 5CORA 1BCPF 1A3UA 2CQAA 2FMCA 3IFTA 2MO0A 2IJ0A 3G7LA 4NXML 5FLMG 3AEVA 1VF7A 1QUQA 1MI2A 1YHAA 3A5ZB 3SR1A 3ULLA 4X3UA 1HZBA 3PO3G 2WB1G 1YHQA 1HH2P 2EE1A 4H13C 1CQFA 2PNRC 1NR2A 5M5XH 1TVXA 3BVGA 2SNMA 2B8FA 2YU9B 4IN3A 2MO1A 3CPWA 3H3VH 5C4XG 4OO1I 4KKTA 3VR6A 2F0PA 3EJIA 4P72A 1GXDC 4KK7A 3F2DA 4K0KL 3Q0AA 4FXGC 3K7AB 2BOSA 2BE5D 3L3OC 1LO5D 1ZXTA 1IBML 2PPBC 4RCOA 3OTOL 4DV0Q 1D2BA 4UHVA 3S17B 3CMAA 1U4MA 3C2PA 1PXUA 2QDBA 1X3QA 1CHQD 4JI1L 4XT3B 4IFDJ 3D0FA 4DV5L 4F88A 1NTGA 4A3GB 4MTKA 2F0VA 2KCMA 3HRZC 1IZ6A 3B6YA 5DLQE 1PTOH 2WB1E 4A3LH 2KCTA 3D4RA 1MIUA 3HOUH 1KQSA 3ND9A 2C35B 1T5EA 3IKJA 3PUXA 1Q8IA 5M3MG 3DWQA 3JAML 1E2WA 1IBKQ 5A2QL 1L2FA 1Q86C 1EQQA 1Z9FA 3UDGA 1A3TA 2EJMA 4X65Q 3DEOA 1ML0D 1I4PA 1GVPA 3S1MB 2H5XA 2UUBL 4EQNA 4CDEC 2K5QA 2O2LD 3PQIA 2L1BA 1Q90A 2J0TD 5CGKA 2AHOB 5AJ3L 3W2DA 4BXXH 4DUZQ 5E4XA 2K14A 5K5PA 4KN7C 1JWUD 2QF7A 3J81E 1O80A 5F2DA 2VW9A 2FINB 2D2CC 5EAYA 2TSSA 2RKSA 1NMGA 3S2DB 3U58A 1I3QH 1QG7A 3GDEA 3S1NH 3D8GA 1EFID 2X6LA 5IGBA 1BCPD 3S1QB 3SE0A 2RQXA 1ASYA 1QVFA 1IYVA 5I6WA 2EYMA 1E0BA 3NP8A 5A35A 2NVQB 1KRTA 3CQZH 4FF2A 1L1OB 3S24A 3F1ZA 1GUOA 3NSWA 5JJIA 2L9HA 3H0GH 4HJ7A 3I7FA 1HNXL 5LMNQ 1NR4A 4HN7A 2NBFA 4DN4M 5HGQA 1HTPA 2HUGA 2R3ZA 1QJOA 3K0XA 4DR7Q 1SNDA 1STBA 3QJYA 3VA7A 1Z7TA 4GKKQ 4RGTA 4S3SA 1G51A 4C2MB 3ICEA 4DAVA 3F2CA 1O7IA 5IOCA 5IYDH 3FKIH 4APVA 1VQ7A 2NZHA 1IYUA 5FO7B 3RMHA 3PIO3 2F1MA 2XIWA 1BCPC 2M9VA 1Y1WH 1SXTA 4DV6L 1E2ZA 4L5TA 1VCIA 1PRTF 3KF8A 1GKHA 4DNTB 4KHPQ 2RCFA 3RD4A 3LWUA 1JOKA 4BS9A 2QCPX 1ASZA 1GUNA 2B8GA 1CI3M 4DAYA 2F4IA 3E9HA 5C3XA 3CCRA 4A3MH 1WVLA 4AH6A 3TSSA 1EYAA 3HOYH 4OO1H 2LKVA 5HGTA 1XPRA 1DOLA 2IHFA 1VQPA 2OF1A 4WRDA 1KDCA 3Q22A 4AYBB 1S72A 4JI7L 4N8FA 1H9JA 4JV5L 3VR4A 5JPMC 4JYAQ 1C0AA 2BDNA 4MN3A 5C6AA 3GTLH 1X3FA 4ILWA 3SK4A 4A75A 1CA6A 1EY6A 2UU9Q 2R7DA 2Q8IB 1I4RA 3TN2A 3J80E 1Y8PB 2E2JH 2RDHA 4DV7Q 4GN4B 5ELFA 3BG3A 3HOVB 3GP7A 1K8OA 3GTJH 2HDMA 3PUVA 5JPNC 3J80c 3BDCA 3JAME 3A7AB 5KRUA 2OT2A 3UDIA 1PH9A 3ZYYX 1HA5A 3FPUB 1M1KC 1QVCA 1QNKA 1NAPA 1EZ6A 1K83H 1TXYA 2DNCA 4YHHQ 2RVLA 1BF4A 1V1PA 1N33L 1K8AC 4PZ7A 5I9OA 3P1HA 5M3FH 1EIYB 3CCVA 1B7YB 4JOIA 2A1AA 4LF6L 4DU9A 4A3IB 2CVRA 1LT3D 3HOZH 2WACA 2R92G 5EQ0A 3M85A 5IWAQ 4JI2L 4KHVA 1YIJA 4DR6L 5ELNA 3UDXA 3DWPA 2CHBD 2NZOA 1XWEA 2RF4A 4GN3B 1G2SA 1JB7A 3SK6A 1SNOA 1PZKD 1XNRQ 4DR3L 4J8QA 4IFDG 2NVTB 2K5WA 3QG1A 1BCPB 2UXBL 1RKNA 1AEXA 4JOIC 1DOKA 3HG9A 4K8IA 1EWCA 4ZLTF 1N8RC 4LNQA 2JXMB 1B8AA 4JI3L 2KCNA 1XMQQ 1VQLA 3W3AA 4H02A 1TIID 1HZAA 3QR8A 2R7FA 3MXNB 4IUVA 4A3DB 1UE1A 2Z1CA 1YZ6A 2VUMG 2E75C 2O4XA 4C3HH 5LMNW 4JBWA 3L9AX 2IY5B 1TWFB 2P5ZX 3OPOA 4QF4A 1QCBD 1VQJA 3OHXC 3R2IA 1I6VC 5EPKA 4A3FB 2Q2TA 4OGQC 1X54A 1XNQQ 3C3LA 3AYHB 1VQBA 1FNWA 1PRTD 3U4VA 4BY1H 5IGEA 2B3GA 4OX9Q 1EYDA 1TU2B 1E1TA 1U9RA 3MXGA 5NUCA 2YTYA 2CFMA 1S5ED 2N3SA 4LMQD 1A2UA 5T1IA 5KNBA 1FYCA 1BQQT 2A69D 2KHSA 4JW0A 4HJ5A 4Y7NB 2JA6H 2N55A 2CKZB 1EQTA 2R7ZG 4XYOA 4P74A 1I50H 2A5HA 4PQXA 3URYA 3GTKB 1QWYA 1JJCB 3G6EA 2X6GA 1QZHA 4GOPB 4LUZA 1KXLA 1A3VA 2F0EA 1VS0A 2NVYH 5J1ZA 5C0XJ 1O78A 3F2UA 1A0IA 1VQGA 1NMFA 1D5ZC 5FLMH 1PRTC 5C5MA 3ULJA 5CV9A 1RIPA 2SNSA 4CKCA 3S9WA 2BH8A 4LF9Q 1VQIA 1BOSA 5GAHC 4GLXA 1MJEA 3TS2A 1PTOD 2HCCA 2RBMA 3A8KE 3T1YQ 3HP3A 2Z9HA 2QGQA 4UP8A 2MFIA 4HIOA 3OW2A 2EY5A 3BU2A 3J7AV 1CUKA 1SYEA 3TP6A 3H3VC 4ODGA 3P75A 3PMFA 2F0JA 5KYIA 4A3BB 3I4MH 3CW2C 5CV5A 1N34L 1TWAH 4EX5A 3D4DA 2PMZB 3R93A 1SDFA 5K36G 2ZXRA 4IUQA 1DGSA 3H0GG 1HR0W 3VR5A 3NHHA 3RZDB 4C56C 1STEA 2PCFB 4KD3A 3CCEA 3RZOB 4PNYA 3CXCA 1B2TA 2R93G 3QOJA 3HZXA 4OIJA 2TMPA 2E2IB 2UUAQ 5JVH3 3T4AC 2K5DA 3HOWB 4V0BA 2RSNA 3LX0A 4UDUC 1SJHD 1I6HB 4RKLA 4G7HC 4DGZA 1PTOC 3FRPB 3S14B 2JA7B 1FGUA 3NBHB 4K6DA 5M3MH 1VQDA 4G4KA 1Y1WG 1EWHA 1RL2A 4JBMA 4LF5Q 5M9OA 4KD4A 3TZDA 4FYDA 4LW1A 3VR2A 2FFKB 5L37A 5IE8A 1DYQA 2NTTA 1B53A 3E5SA 1F9SA 1I4HA 3D3RA 2F4VL 2DUDA 3W1BA 4LF8Q 1STYA 1HQRD 1WOCA 1YNXA 4B3SL 4A3MG 3EBEA 1U4PA 4IFDI 2DNEA 4QB4A 1VQ9A 5C4HA 4UP7A 3WWVA 3AU7A 2A6ED 2EYHA 2HIXA 4B3RL 5LL6X 2N49A 1PFNA 2ZM6Q 2NVXB 2VQEQ 2AWOA 1H9RA 3SDZA 1GHJA 3FP9A 1KL9A 3AMUA 1E24A 1JJGA 4KY7A 4NW2A 1U4LA 1HFGA 1WTXA 2L0CA 5M5XB 2F52A 2BA1A 1E7ZA 4JI0Q 1DZ1A 2G9DA 3CKIB 1SYGA 2ENBA 2C9OA 4YWLA 2QEXA 1FJGL 2XRQD 2PZTA 1GM5A 4PMBA 4FDBA 4QUCA 2Y0SB 2Z4HA 3CP0A 2RSOA 3M4OB 1GJXA 2LS01 1G91A 4EQ5A 5M3FG 1WTOA 3NK9A 2EJFC 1KIXA 5J3BA 4DV1L 3TDQA 2FMMA 3A8JE 3HOZG 4R4QA 5IGCA 4LF4L 2A6EC 4POGA 4QUFA 3T1HL 2CH4A 2MQHA 4X64Q 2JQOA 4FF3A 1LYLA 1ENCA 1HHVA 3E0JA 4DR4L 5DM63 1PTOB 1TWCB 2HQLA 1RJTA 4GS3A 4LFBL 1SBBB 4XXEA 3HOUB 3PO2G 2WAQB 2B2VA 5BN5A 4AIMA 4LF7Q 3N52A 5IYBH 1LTRD 1IYJB 4NXNQ 4ME5A 4C3HG 2HCIA 2L55A 4DF7A 1SRUA 4MIUA 5ELCA 1RODA 1OXSC 4IJHA 1DXMA 3T53B 1WCMG 3BDLA 1SNMA 2EPBA 1K3RA 1X32A 1IBLQ 4FVMA 3CRKC 2JEAI 4LFAL 2CH4W 2B2VC 3WDNA 2ALYB 1BDOA 3F8TA 1VQEA 1PFMA 1SYFA 3NENA 5C3EG 1J5EL 4QIWB 1F2ZA 3GTGH 1C7YA 3RR5A 1SLJA 4P73A 1VQ5A 3E0EA 5M5WH 3KJPA 2G9HD 4E6IA 3R2TA 1I3QB 1HCZA 1SE2A 3S1NB 4K2KA 2JA5H 2D0PA 1D1KA 2H4OA 4ZUJA 2IW3A 4OHJA 2K52A 1CA5A 4C3IH 3KDFA 1JC7A 4K8JA 3UE0A 1LLRD 1YJNA 1QE6A 2A68D 5FLXL 3K57A 1F9QA 4L5RC 3BJUA 1LTSD 4HIKA 1OXTA 3MFGA 3T56B 5CYUA 1Q7YC 5E1FA 4A3KH 2QA4A 4U68A 2HT1A 2R92H 4C3JH 1SE4A 3IL8A 2YTXA 2I0QA 2XGTA 2PI2A 3K8AA 1QNUA 1FD7D 4X3SA 1KD1C 5KYLA 2V4DA 2IX3A 4RG1A 3FKIB 4IFDH 1R4PB 3CC7A 2XRSD 3CMEA 3A56A 4YWMA 1CM9A 3DUZA 4B3TL 2G5DA 3K81C 3NWSA 4QY7A 2N78A 1Y1WB 1ICWA 4LUVA 2R6GA 1PFSA 1L0XB 4X65L 2VUMH 2A68C 4O42A 2JEBI 3BZCA 5IP7G 4DR2Q 3G48A 4OWTB 1WYDA 3I4MG 4OWWB 1LT5D 3OIPA 5TSSA 3ZJYC 4KHZA 4ZRZA 1X65A 4TQUS 4A3EG 1YITA 4DUZL 3KLRA 4YCWA 3HOYB 1JWMD 1HRJA 2F0FA 1BUVT 1GOZA 1LUZA 4B3MQ 3TP8A 2SDFA 5JAVA 1XTCD 5EKLA 1A15A 3TZUA 2HHHL 4JI4Q 3I2ZA 3KLSA 3GTLB 1VQKA 3K80C 1XPOA 2K01A 1H9SB 1PH6A 4K2LA 1KDAA 2Z0SA 2E2JB 2WIIB 4DPGA 3HOXH 4RFBA 4X66Q 1X55A 5ELOA 4GKJL 4XYQA 2M00A 4LFCL 3GTJB 2F0GA 2ASBA 1B4OA 4K5WA 1N36L 2DJGC 4IQZA 3EA6A 1UUPA 1R9TH 2R7ZH 4B08A 4NXMQ 4BBSG 1EEFD 2B2TA 4JK1C 4F87A 1V1QA 1VQAA 4NPSA 1JE5A 4OXPA 2EYOA 4BBRH 5LMNL 1KAWA 1UE6A 5AFWA 1O7ZA 1BVSA 2RHSB 3GTQH 4DA2A 3X3MA 2JE6I 4HAEA 4GKKL 2KUMA 3KDFB 3I4LA 3V05A 1SFOH 1EYCA 3S16B 1V1OA 1SEBD 2B2TC 4K0KQ 4G57A 1ZYRC 2XWJB 4LUOA 5GQOA 2VZAA 1BBXC 2PYKA 3J81c 1PVOA 5E3FA 4QL5A 1IBMQ 4ZAIA 3GTPH 3S2HH 4CDCC 3PSIA 1F2LA 1Q1BA 4N9PA 1VQ8A 1EY7A 2EXDA 1D5XC 2I46A 3OWFA 3U50C 4KHPL 1D7QA 5JOBA 2MPMA 1QUQB 2JYOA 1NE3A 3MWYW 1VF5C 1TS3A 3D4WA 1Q1EA 1TS4A 5IYCG 1E3PA 1HXYD 1AH9A 2XSCA 5IT9L 3MZ5A 3TMEA 1YNND 1QILA 3IRBA 4FO2A 5C0XI 1O7YA 5FK9C 2BH2A 3Q23A 5K36H 2E2DC 1MSHA 4JYAL 2MHVA 1UEAB 1X9NA 2R93H 2F0TA 1IW7D 1N9WA 2KOLA 4DV7L 4BY1B 2I5HA 4A3JG 4DKAC 4XT1B 2JA8H 2MGSA 2B39A 4F7XA 3E6ZX 1M8AA 1GD7A 5KNDA 1B9MA 3TBIB 3G71A 2D9UA 2UUBQ 1DOMA 1XXGA 4PMWA 1TKWB 4DR5Q 4C1NK 2JA6B 3FDTA 2YYZA 4B9WA 4WJ4A 5J22A 3PCOB 1YVCA 5D65A 5IYBG 3I4NB 4JI8L 2PQAA 3I73A 2F0IA 1LTBD 1EQVA 1I50B 2RDGA 3OW7A 5DAUA 1MBYA 4ZK9B 1W6KA 1YNNC 4P71A 2F0KA 2VL6A 1YJ9A 5EGTA 1NSNS 4JI5Q 2UXCQ 2B63G 1EY5A 2IPKD 5IWAL 4YIJA 2K33A 4XTCS 1XJVA 3Q24A 2DY7A 1A8VA 3CCLA 1HPCA 2EY2A 1HR0L 3W5OA 1TS2A 1IW7C 4U673 4IUNA 3K7AH 1XNRL 3OSOA 1EZ8A 4DXFA 3NPPA 3J81j 3PO3B 2WB1B 1Q3LA 1KHIA 2A73B 4DV4L 4TKOB 3H6MA 1RHPA 1SAPA 1AE2A 1IXRA 1BBWA 1EOVA 3CU7A 5C4JB 2KA7A 2HQEA 1SYBA 4KI0A 2JA5G 1HNXQ 5C4XB 5A2QE 4FP5D 3V2TA 5DEHA 4RCNA 4XQNA 1WD1A 4C3IG 2F03A 4A3GH 3MTSA 1PA6A 1SMXA 2VNUD 1EU4A 3EROA 2ZXOA 3MVVA 3JAMc 1PHJA 1TS5A 1TWAB 2OEOA 1UAPA 1KAAA 1XNQL 4IALA 4A3KG 3VYSA 3STBD 3NWTA 2IHEA 4C3JG 4YY3L 2KENA 4DUYQ 2CCZA 2IWHA 4DK3C 4DV6Q 1EWIA 4HR7B 5G3LF 4K5XA 4NB3A 2F0WA 3S1MH 4KJOA 5DM73 4EGVA 2QEJC 5T1GA 1UNSA 2PMZE 1HNWQ 1V9PA 4UY8C 3PO2H 1BKBA 4RHSA 1C9OA 1Y1VG 5LHY1 5M3MB 3VR3A 4B9XA 4HSVA 5EKKA 1STGA 1HJPA 3BVZA 4DNRB 1K8MA 1X6OA 4JI7Q 4JV5Q 3S15H 5COYA 1VQCA 3S2DH 3RLOA 3RUZA 3FMCA 1CKMA 2Z8LA 2L11A 1WCMH 1D1IA 3STBC 3S1QH 1S5BD 3HKZG 4WJWA 4QQBX 4DK1A 1C8CA 2IX0A 1LT4D 3KF8B 3OOCA 2O5JC 2PQAB 2NVQH 4LF9L 1ILPA 5C0XH 5C3EH 2Q8TA 4X6AH 1EQRA 4DAYB 3FPPA 3CF5A 1BBUA 2J4XA 4IZ8A 1PH5A 3HOXG 2EDGA 4WORA 1PDQA 2NN6I 4LF6Q 1W3SA 3NTIA 4AQYQ 2JP1A 1FR3A 4NDXA 4JI2Q 2HD3A 1WTRA 2F3IA 4YCVA 3MXPA 3PUYA 3A8IE 4DR6Q 3PF5A 5EPLA 1SROA 1E2VA 2Z4IA 3PIP3 4BBRG 1JICA 5JVG3 4DR1Q 1N32L 1Q46A 4BY7G 4GNXA 1XYIA 2BCOA 5EJWA 4HMIA 5ELDA 2A6HC 4IPCA 3VDYA 1AW7A 1WTHA 2XTIA 1RDPD 2ZXPA 4CDDC 2UXDL 3HKZE 2GN5A 2UUAL 1I5FA 1V43A 1XX8A 4BA2I 4L5SA 3IFDA 1IKLA 1QOHA 1PH2A 1V1PB 1IKMA 5BR8Q 5IGFA 1MSGA 4MZ9A 1HZ9A 1EY8A 2LSSA 3PUWA 4R9WA 3A74A 4GNXC 4LF5L 1FGBD 3TRZA 3ER0A 2L5TA 4CKBA 3WOEA 1JCKB 3QO2A 1IL2A 1I94Q 2E2HH 2PZWA 1S3OA 3AFQA 5IP7H 4IUPA 5HURA 4LF8L 2I5MX 4IPGA 2F0SA 3KF6A 4X3TA 1DONA 4A3EH 2R61A 4JC0A 3KK7A 4L63B 4G7ZC 4IUTA 4TVAB 1S40A 2VQEL 3N6RA 1CKOA 1K28A 2NYZD 4J15A 4MNOA 3J7AF 2JA8G 1V8QA 4M8AA 4JI0L 2AQ3B 5C44G 1B50A 3TREA 4ZKBB 5EPJA 1UE5A 3M3YH 5JJZA 4HJAA 2N8NA 2HIVA 4BBSH 1SMYC 2K05A 4XQQA 4O1NA 1IL8A 2VQFQ 1I4GA 4JI6Q 1AZQA 1TT2A 3EVQA 1T9HA 4HSPA 3UDFA 4QIWE 4ZQ3A 1KDBA 3BDOA 1AN8A 2K5HA 1HNZQ 2GA4B 3V96A 1CT1D 1TQOA 1G6ZA 4A3KB 4LK1C 2R92B 1PRTB 1H9MA 4RAUC 1S5CD 4BWGB 3S1RH 4CJ1B 4X64L 1EY0A 5FO9B 2GVAA 1U5KA 1XMOQ 2EVBA 3LGJA 5KGUA 1WTPA 4X62L 5LMUQ 1NJIC 3GV3A 4EQPA 4HMJA 3T51B 5IIFA 5CV8A 1N34Q 4ABNA 2EIFA 5ELBA 4A3FH 2MJ8A 4P75A 4DV2L 4LF7L 3TP7A 3D31A 1STAA 1KRSA 1JOQA 1HQMC 1SYDA 2OCEA 1W6JA 3Q6SA 4NXNL 4A3GG 1BR9A 3HKSA 4CBVA 1LABA 2ZJRA 1TY2A 5IYCH 2VUMB 1EOTA 1ENFA 3H94A 4OIKA 3AB9A 2L4NA 4JPBW 1WJJA 2AKWB 3KJOA 4LWCA 3EFXD 4DV3L 3CCUA 2LXKA 3NUCA 1Q8KA 2WKDA 2E5LL 1X56A 1KTKA 2A19A 3DLLA 1KNAA 4A3JH 1YEZA 1SNQA 1SE3A 3KF6B 3GTKH 2PW7A 4KKUA 1FNUA 2OXPA 1A63A 2WFWA 5IY0A 3NEMA 1NCVA 2RCNA 2N88A 1B70B 1S4ZA 1Y8NB 2E74C 2K03A 1ICFB 1GUWA
chains in the Genus database with same CATH topology
1R9TB 1CHPD 2R7ZB 1ESFA 4NMZA 5I6YA 4XIGS 2QILA 1BXTA 1ENAA 4BBRB 1OXVA 3VYTA 1X3PA 3GTQB 1ET6A 1KLUD 2XWBB 4R8NA 5CR3A 4Z9CB 3H09A 5C0XG 4G7OC 1JB3A 1D5MC 1F9PA 5C3WA 3GTPB 3S2HB 4CKEA 1J9OA 4OL7A 3MXUA 1ONLA 5CMDA 2PZUA 3GV6A 3PUZA 2K04A 3CQZB 2EOTA 5I2XA 2F0NA 1RTNA 2NWGA 1KLGD 3GQBA 4I65A 2KEEA 4CHTB 1RTOA 3H0GB 1GUTA 2EYFA 4I7ZC 2KQ3A 4XQJA 4PMCA 1G8ZD 2R93B 4ZUIA 5JEAJ 2WP8J 5IODA 2EXZA 2NZ1D 5C4ZA 2DY8A 1OO9B 3NXWA 2WKCA 1QB5D 1D6EC 4J6HA 4KJNA 2F0DA 3HGBA 3K0YA 4DXGA 4A3MB 2XN9C 3SXHA 1OXUA 2H1EA 5I9PA 3R3OA 3SVMA 1F77A 1A6XA 1ZYRD 3M7GA 1F9RA 3I3CA 4N9TA 5EBCA 3DXJC 2FHTA 4MHEA 1SNPA 1SYCA 3QB3A 1ZKOA 2HDLA 3MHBA 4HCSA 3J80L 1O7LA 1EIHA 1K83B 5CV4A 5ISRA 3KUPA 1STNA 5M3FB 1CTMA 1ILQA 1C48A 4ZKCB 3HOZB 2FJ2A 4DAPA 4RGMA 1S5DD 3NE5B 3U9SA 4EVOA 2AQ2B 5BN3A 2BE5C 3K59A 3BVMA 1R4QB 1RF2D 1OXXK 2PW5A 4RHRA 4IUUA 1Y69U 2K6AA 1LTTD 2RA4A 3PO2B 2B2WA 2EJGC 2QKIC 4KN4C 4K6LA 4KY6A 3RLFA 3IAYA 5ELEA 5FLXE 2AUKA 4C3HB 3S15B 1JR0D 2Q8RE 2NUCA 4HCEA 2NN6G 2VB2X 3MEHA 3TP5A 2F0QA 1WCMB 1PLFA 1Q12A 1LTID 1DD2A 2MP1A 3H91A 3K5MA 2B2WC 2I07B 1JE4A 1II3A 1PMRA 2CW0D 3PV0A 5C3EB 2PO4A 3K5OA 1CFMA 1SJED 1CZWA 3NBIA 5I2YA 2K1BA 4P2CB 3D6CA 2IT1A 3MXNA 3J7YW 2RDFA 1PYWD 2MUYA 4ZYSA 1HFNA 1VMCA 4UAIA 3I90A 1AP0A 5D3DA 4C1NI 4PV1C 2NVYB 1I4QA 3A54A 5IGGA 3HS0C 3ITPA 4K5VA 1M4VA 1SNCA 2BA0A 3WOFA 5BN4A 1ZEQX 2EYPA 3M7NA 2CW0C 1EL0A 2KCCA 1H9KA 1B1ZA 5LL6S 2WV6D 3BZDB 2IL8A 1B44D 2AWNA 3CHBD 5JEAG 1Z6HA 2WINB 3QOLA 1HTLD 4RH6A 1WTQA 3I91A 3VA5A 2F0UA 4Q5VA 2E2HB 3NQTA 2F0HA 2X69A 4TRDA 1JWSD 3I4MB 4A3EB 1WTWA 1PZID 2SEBD 3A55A 4IURA 4XDXA 3CRLC 3X3NA 5D3IB 2D5DA 1JOOA 1EY4A 2A74C 4NP5A 3G6JB 3BS1A 1PTOF 4RGOS 1IHZA 3GO5A 1LTGD 1KNEA 3VYRA 1KABA 3M3YB 3SEBA 1A2TA 4BBSB 3NTKA 2O5IC 1S5FD 4QCLA 5IT9E 1FNVA 1LACA 3P7JA 1T5XD 3DM1A 2IX1A 3MFYA 2NB0A 2A6HD 3KLSX 2AUJD 1MD2D 3S1RB 5J39A 5DNFA 1DJRD 2ICEC 3K5NA 1F2YA 1DM0B 3K58A 4FXDA 4WFN3 2B2YA 3OWEB 2LMCB 3A7LA 1ESRA 3BYTB 3NBHA 1RCVD 2KECA 4FNFA 4RGNA 3T13A 1G291 3M4YA 4L6TB 5CC4A 3D6WA 5IGDA 2K7VA 5KNCA 2B2YC 4F8MA 2J7ZA 1G2TA 3QIAA 4HEDA 1EY9A 2M2LA 3EQLC 1RD9D 1HUMA 2VXWA 3DHQA 4A3JB 4LJZC 2K28A 3BYYB 3K5LA 5CV7A 2LFNA 1B3AA 4Q0FA 1JQYD 2AQ1B 1VDZA 4NKLA 4FXKC 1GUSA 2EY6A 2NTSA 1SMYD 5FO8B 4TSSA 4DFAA 5G3LD 4FF1A 4J1MA 1TY0A 2B63B 2ICIA 2A69C 3DWAA 3ERQA 5CBAE 4RKBA 2BDOA 4DK0A 4ID6A 2PQEA 2D62A 4HTHA 3UI2A 5FKAC 1HUNA 2F0OA 3GTGB 1LT6D 1WD0A 3GTOB 1BNZA 5M5WB 1J8IA 1I4XA 2KJXA 3DEPA 3P20A 2L12A 4KTAA 2JA5B 5D14A 2F3VA 4ULLA 4C3IB 3NTHA 1LTAD 3R8BA 4FF4A 4H44C 2F0MA 2EZVA 2DN8A 2KEDA 4L8JA 3OMGA 3K6OA 3T16A 3NQIA 4C3JB 1EU3A 2JSOA 3ONAB 4A93B 1YNJD 3I8ZA 3C1FA 5M5YB 5EKIA 1AFPA 1B9NA 4OO1G 1TWGB 2B2UA 3OMCA 3GTMB 2EYLA 2EYJA 1STHA 1Y1VB 4KKSA 4QMGA 1SSOA 1TWHB 3SK8A 4EQOA 1EIGA 2F0LA 1WTVA 4R8IA 2ZT9C 4H0LC 4BA1I 4M1UB 1PZJD 3L7ZC 4H7BA 2NN6H 5FOBB 3LNNA 5I4DA 2LY7A 1JORA 3HKZB 2K32A 4KY5A 5CBEE 2B2UC 1MGSA 3SHLA 5KEEA 3C1EA 1YNJC 3MC0B 3LWEA 2C5CA 1Z47A 1TR5A 5C5LA 3GD7A 3I70A 3HEJA 1CK1A 4RWSC 3HOXB 4KMUC 4CGYB 1CQVA 2SOBA 3MA2B 2XVSA 2KVMA 3FVQA 3MAQA 1HA6A 1Y8OB 3FEWX 2E76C 3U9OA 1NUCA 1C4QA 4BY7B 4V190 1GHKA 3DMUA 1CZGA 3VYUA 4GZYC 1LV9A 4CJ2C 1SFOB 1GUGA 1DCZA 3O13A 3KBGA 5E4WC 1H9SA 2XNAC 2EY1A 5JEAH 4RA8A 1AZPA 3QWNA 3J81L 1F2MA 1VMPA 3OIQA 4X3KA 4CJ0B 1BO0A 1EEID 3C46A 3SK5A 5CV6A 1L0YB 2ID0A 5KIXA 3KBXA 2VB3X 4K14A 5EBDA 2JA8B 2F3WA 1PFBA 1U4RA 5C44B 4LAAA 3ND8A 1ET9A 3I72A 4KV6A 5CORA 1BCPF 1A3UA 2CQAA 2FMCA 3IFTA 2IJ0A 3G7LA 1VF7A 1MI2A 3SR1A 4X3UA 2EE1A 4H13C 1CQFA 2PNRC 1NR2A 1TVXA 3BVGA 2SNMA 2B8FA 2YU9B 4IN3A 4OO1I 4KKTA 3VR6A 2F0PA 3EJIA 1GXDC 4KK7A 3Q0AA 4FXGC 3K7AB 2BOSA 2BE5D 3L3OC 1LO5D 1ZXTA 2PPBC 4RCOA 1D2BA 3S17B 1U4MA 3C2PA 1PXUA 2QDBA 1X3QA 1CHQD 4XT3B 4IFDJ 4F88A 4A3GB 2F0VA 3HRZC 1PTOH 3D4RA 3ND9A 1T5EA 3IKJA 3PUXA 1Q8IA 3DWQA 3JAML 1E2WA 5A2QL 1A3TA 2EJMA 3DEOA 1ML0D 1I4PA 3S1MB 4EQNA 2K5QA 2O2LD 2L1BA 1Q90A 2J0TD 5CGKA 3W2DA 5E4XA 5K5PA 4KN7C 1JWUD 2QF7A 3J81E 1O80A 5F2DA 2FINB 2D2CC 2TSSA 2RKSA 3S2DB 1QG7A 3D8GA 1EFID 2X6LA 5IGBA 1BCPD 3S1QB 3SE0A 2RQXA 1IYVA 5I6WA 2EYMA 1E0BA 3NP8A 5A35A 2NVQB 4FF2A 1GUOA 3NSWA 2L9HA 1NR4A 4HN7A 2NBFA 4DN4M 1HTPA 2HUGA 2R3ZA 1QJOA 1SNDA 1STBA 3QJYA 3VA7A 1Z7TA 4RGTA 4S3SA 4C2MB 4DAVA 5IOCA 1IYUA 5FO7B 3RMHA 3PIO3 2F1MA 2XIWA 1BCPC 2M9VA 1SXTA 1E2ZA 1VCIA 1PRTF 3KF8A 4DNTB 3RD4A 3LWUA 1JOKA 4BS9A 2QCPX 1GUNA 2B8GA 1CI3M 4DAYA 2F4IA 5C3XA 1WVLA 3TSSA 1EYAA 4OO1H 2LKVA 5HGTA 1DOLA 2OF1A 4WRDA 1KDCA 3Q22A 4AYBB 1H9JA 3VR4A 5JPMC 2BDNA 4MN3A 5C6AA 4ILWA 3SK4A 1CA6A 1EY6A 2Q8IB 1I4RA 3TN2A 3J80E 1Y8PB 2RDHA 5ELFA 3BG3A 3HOVB 3GP7A 1K8OA 2HDMA 3PUVA 5JPNC 3BDCA 3JAME 3A7AB 5KRUA 2OT2A 3ZYYX 1HA5A 3FPUB 1QNKA 1NAPA 1EZ6A 2DNCA 2RVLA 1BF4A 1V1PA 5I9OA 3P1HA 4DU9A 4A3IB 2CVRA 1LT3D 2WACA 5EQ0A 3M85A 4KHVA 3DWPA 2CHBD 1XWEA 1G2SA 3SK6A 1SNOA 1PZKD 4J8QA 4IFDG 2NVTB 2K5WA 3QG1A 1BCPB 1RKNA 1AEXA 4K8IA 1DOKA 3HG9A 1EWCA 4ZLTF 2JXMB 2KCNA 3W3AA 1TIID 4IUVA 4A3DB 2Z1CA 2E75C 2O4XA 4JBWA 3L9AX 1TWFB 3OPOA 4QF4A 1QCBD 3OHXC 3R2IA 1I6VC 5EPKA 4A3FB 4OGQC 3C3LA 1FNWA 1PRTD 5IGEA 1EYDA 1TU2B 1U9RA 3MXGA 5NUCA 1S5ED 4LMQD 1A2UA 5T1IA 5KNBA 1FYCA 1BQQT 2A69D 2KHSA 4Y7NB 2N55A 1EQTA 4XYOA 2A5HA 4PQXA 3URYA 3GTKB 1QWYA 2X6GA 1A3VA 2F0EA 5J1ZA 5C0XJ 1O78A 3F2UA 1D5ZC 1PRTC 5C5MA 5CV9A 2SNSA 4CKCA 3S9WA 1BOSA 1PTOD 2HCCA 2RBMA 3A8KE 3HP3A 3J7AV 2EY5A 1SYEA 3TP6A 3H3VC 4ODGA 3P75A 3PMFA 2F0JA 5KYIA 4A3BB 5CV5A 3D4DA 2PMZB 3R93A 1SDFA 5K36G 2ZXRA 4IUQA 3VR5A 3NHHA 3RZDB 4C56C 1STEA 2PCFB 4KD3A 3RZOB 4PNYA 1B2TA 3QOJA 3HZXA 4OIJA 2TMPA 2E2IB 5JVH3 3T4AC 2K5DA 3HOWB 4V0BA 2RSNA 3LX0A 4UDUC 1SJHD 1I6HB 4RKLA 4G7HC 4DGZA 1PTOC 3FRPB 3S14B 2JA7B 4K6DA 4G4KA 1EWHA 5M9OA 4KD4A 3TZDA 4FYDA 3VR2A 2FFKB 1DYQA 2NTTA 1B53A 3E5SA 1F9SA 1I4HA 3D3RA 1STYA 1HQRD 1U4PA 4IFDI 2DNEA 4QB4A 5C4HA 3AU7A 2A6ED 2EYHA 5LL6X 2NVXB 1PFNA 2AWOA 1H9RA 3SDZA 1GHJA 3AMUA 4KY7A 4NW2A 1U4LA 1HFGA 1WTXA 2L0CA 5M5XB 2BA1A 1DZ1A 2G9DA 3CKIB 1SYGA 2ENBA 2C9OA 2XRQD 2PZTA 4PMBA 4QUCA 2Y0SB 2Z4HA 2RSOA 3M4OB 1GJXA 2LS01 1G91A 1WTOA 2EJFC 3NK9A 3TDQA 2FMMA 3A8JE 5IGCA 2A6EC 4QUFA 4FF3A 1ENCA 1HHVA 3E0JA 5DM63 1PTOB 1TWCB 1RJTA 1SBBB 4XXEA 3HOUB 2WAQB 2B2VA 5BN5A 3N52A 1LTRD 4ME5A 4C3HG 2HCIA 2L55A 4DF7A 4MIUA 5ELCA 1RODA 1OXSC 1DXMA 3T53B 3BDLA 1SNMA 2EPBA 1X32A 4FVMA 3CRKC 2JEAI 2B2VC 3WDNA 1BDOA 1PFMA 1SYFA 4QIWB 1F2ZA 2G9HD 4E6IA 3R2TA 1I3QB 1HCZA 1SE2A 3S1NB 4K2KA 1D1KA 2H4OA 4ZUJA 2IW3A 4OHJA 1CA5A 1JC7A 4K8JA 1LLRD 1QE6A 2A68D 5FLXL 3K57A 1F9QA 1LTSD 1OXTA 3MFGA 3T56B 5CYUA 5E1FA 4U68A 1SE4A 3IL8A 1QNUA 1FD7D 4X3SA 5KYLA 2V4DA 2IX3A 3FKIB 4IFDH 1R4PB 2XRSD 3A56A 1CM9A 3DUZA 3NWSA 1Y1WB 1ICWA 2R6GA 1L0XB 2A68C 4O42A 2JEBI 1LT5D 3OIPA 5TSSA 4KHZA 4ZRZA 4TQUS 3KLRA 3HOYB 1JWMD 1HRJA 2F0FA 1BUVT 1GOZA 3TP8A 2SDFA 5JAVA 1XTCD 5EKLA 1A15A 3TZUA 3KLSA 3GTLB 2K01A 1H9SB 4K2LA 1KDAA 2E2JB 2WIIB 4RFBA 4XYQA 2M00A 3GTJB 2F0GA 1B4OA 4K5WA 4IQZA 3EA6A 1UUPA 4B08A 1EEFD 2B2TA 4JK1C 4F87A 2EYOA 5AFWA 1O7ZA 4DA2A 3X3MA 2JE6I 4HAEA 2KUMA 3I4LA 3V05A 1EYCA 3S16B 1V1OA 1SEBD 2B2TC 4G57A 1ZYRC 2XWJB 1BBXC 2PYKA 5E3FA 4ZAIA 1F2LA 1Q1BA 4N9PA 1EY7A 1D5XC 2I46A 3OWFA 5JOBA 2MPMA 2JYOA 3MWYW 1VF5C 1TS3A 3D4WA 1Q1EA 1TS4A 1HXYD 2XSCA 5IT9L 3MZ5A 3TMEA 1YNND 1QILA 4FO2A 5C0XI 1O7YA 5FK9C 3Q23A 5K36H 2E2DC 1MSHA 2MHVA 1UEAB 2F0TA 1IW7D 2KOLA 4BY1B 4XT1B 2MGSA 2B39A 4F7XA 3E6ZX 1M8AA 5KNDA 1B9MA 3TBIB 2D9UA 1DOMA 1XXGA 4PMWA 1TKWB 4C1NK 2JA6B 3FDTA 2YYZA 4B9WA 5J22A 3I4NB 5D65A 3I73A 2F0IA 1LTBD 1EQVA 1I50B 5DAUA 2RDGA 3OW7A 1MBYA 4ZK9B 1W6KA 1YNNC 2F0KA 5EGTA 1NSNS 1EY5A 2IPKD 4YIJA 2K33A 4XTCS 3Q24A 2DY7A 1HPCA 2EY2A 1TS2A 1IW7C 4U673 4IUNA 3OSOA 1EZ8A 4DXFA 3NPPA 3PO3B 2WB1B 1Q3LA 2A73B 4TKOB 3H6MA 1RHPA 1SAPA 3CU7A 5C4JB 2KA7A 2HQEA 1SYBA 4KI0A 5C4XB 5A2QE 4FP5D 3V2TA 5DEHA 4RCNA 4XQNA 1WD1A 4C3IG 2F03A 3MTSA 2VNUD 1EU4A 3EROA 2ZXOA 3MVVA 1TS5A 1TWAB 2OEOA 1UAPA 1KAAA 4IALA 3VYSA 3NWTA 4C3JG 2IWHA 4HR7B 5G3LF 4K5XA 2F0WA 4KJOA 5DM73 4EGVA 2QEJC 5T1GA 1UNSA 4RHSA 5M3MB 5LHY1 3VR3A 4B9XA 4HSVA 5EKKA 1STGA 3BVZA 4DNRB 1K8MA 5COYA 3RUZA 3FMCA 2Z8LA 2L11A 1D1IA 1S5BD 4WJWA 4DK1A 1C8CA 2IX0A 1LT4D 3OOCA 2O5JC 1ILPA 5C0XH 2Q8TA 3FPPA 2J4XA 4IZ8A 2EDGA 4WORA 1PDQA 2NN6I 3NTIA 2JP1A 1FR3A 4NDXA 1WTRA 3MXPA 3PUYA 3A8IE 5EPLA 1E2VA 2Z4IA 3PIP3 1JICA 5JVG3 1XYIA 2BCOA 5EJWA 4HMIA 5ELDA 2A6HC 1AW7A 1RDPD 2ZXPA 1V43A 1XX8A 4BA2I 3IFDA 1IKLA 1QOHA 1V1PB 1IKMA 5IGFA 1MSGA 1EY8A 3PUWA 4R9WA 1FGBD 2L5TA 4CKBA 3WOEA 1JCKB 3QO2A 2PZWA 4IUPA 5HURA 2F0SA 4X3TA 1DONA 2R61A 3KK7A 4L63B 4G7ZC 4IUTA 3N6RA 2NYZD 3J7AF 1V8QA 4M8AA 2AQ3B 1B50A 4ZKBB 5EPJA 5JJZA 1SMYC 2K05A 4XQQA 4O1NA 1IL8A 1I4GA 1AZQA 1TT2A 3EVQA 4HSPA 4ZQ3A 1KDBA 3BDOA 1AN8A 2GA4B 3V96A 1CT1D 1TQOA 1G6ZA 4A3KB 4LK1C 2R92B 1PRTB 1H9MA 4RAUC 1S5CD 4BWGB 4CJ1B 1EY0A 5FO9B 2EVBA 5KGUA 1WTPA 3GV3A 4EQPA 4HMJA 3T51B 5IIFA 5CV8A 4ABNA 5ELBA 2MJ8A 3TP7A 3D31A 1STAA 1JOQA 1HQMC 1SYDA 1W6JA 3Q6SA 1BR9A 4CBVA 1LABA 1TY2A 2VUMB 1EOTA 1ENFA 3H94A 4OIKA 3AB9A 2L4NA 3EFXD 3NUCA 2WKDA 1KTKA 1KNAA 1SNQA 1SE3A 2PW7A 4KKUA 1FNUA 2OXPA 1NCVA 2N88A 1S4ZA 1Y8NB 2E74C 2K03A 1GUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CBE E;  1O80 A;  2B2U C;  1MGS A;  1B4O A;  1PFB A;  1U4R A;  1KNE A;  2FIN B;  2HDM A;  1B50 A;  1ILP A;  4ZKB B;  5EPJ A;  3LWE A;  5COR A;  2H1E A;  2Q8T A;  2X6G A;  2B2T A;  1PFN A;  2DY7 A;  3SVM A;  5CBA E;  5JJZ A;  3FPU B;  3G7L A;  1QG7 A;  1QNK A;  2K1B A;  1NAP A;  2X6L A;  1MI2 A;  3F2U A;  2K05 A;  1X3P A;  4RWS C;  4X3U A;  1IL8 A;  1F9R A;  1CA5 A;  1PDQ A;  3I3C A;  4NW2 A;  1AZQ A;  1U4L A;  2RVL A;  1HFG A;  3P7J A;  1BF4 A;  5AFW A;  1WTX A;  1O7Z A;  1Q3L A;  2EE1 A;  3UI2 A;  1QE6 A;  3DM1 A;  1E0B A;  1NR2 A;  1DZ1 A;  4HAE A;  1HUN A;  1HFN A;  1VMC A;  1RHP A;  1SAP A;  2JP1 A;  1TVX A;  2FHT A;  2CVR A;  2KVM A;  2KUM A;  4MHE A;  1F9Q A;  1WD0 A;  1WTR A;  1BNZ A;  1G6Z A;  5DNF A;  5EQ0 A;  1HA6 A;  4UAI A;  1J8I A;  3I90 A;  3DEP A;  1AP0 A;  2L12 A;  4QUC A;  5EPL A;  4RAU C;  1F9P A;  2B2T C;  4CJ1 B;  2L9H A;  2HCC A;  4U68 A;  2HDL A;  5D14 A;  1JIC A;  4HCS A;  1BBX C;  1WTP A;  1WD1 A;  1XYI A;  1G2S A;  1NR4 A;  2RSO A;  3HP3 A;  3MTS A;  1J9O A;  3IL8 A;  5EJW A;  4ZAI A;  1EIH A;  2B2Y A;  4DN4 M;  2HUG A;  1G91 A;  1F2L A;  2R3Z A;  3GV3 A;  1WTO A;  1ESR A;  1ZXT A;  1EL0 A;  3KUP A;  5CMD A;  3GV6 A;  2K04 A;  2FMM A;  1ILQ A;  4X3S A;  1XX8 A;  1DOK A;  2MPM A;  4ZKC B;  4ZLT F;  1LV9 A;  2JYO A;  2EOT A;  3MWY W;  4CJ2 C;  2MJ8 A;  3IFD A;  2KEC A;  2FJ2 A;  1IKL A;  1U4M A;  1RTN A;  4QUF A;  2IL8 A;  2NWG A;  1X3Q A;  5E4W C;  1SDF A;  3R93 A;  1IKM A;  3Q6S A;  4IUQ A;  4IUV A;  1MSG A;  1CM9 A;  2KED A;  2KEE A;  4XT3 B;  1RTO A;  1HHV A;  1O7Y A;  2XIW A;  3ONA B;  4R9W A;  1ICW A;  1RJT A;  1EOT A;  3D6W A;  1WTQ A;  3I8Z A;  3I91 A;  1B2T A;  4OIK A;  2B2Y C;  2L4N A;  4O42 A;  1MSH A;  2J7Z A;  4IUU A;  4RA8 A;  1G2T A;  4OIJ A;  1AZP A;  4HED A;  5EKI A;  2M2L A;  2RA4 A;  2X69 A;  3QO2 A;  5T1G A;  5EPK A;  2RSN A;  2B2V A;  1HUM A;  1VMP A;  2VXW A;  4X3K A;  2B2W A;  4IUP A;  3N52 A;  2KOL A;  4CJ0 B;  1BO0 A;  2B2U A;  2NZ1 D;  1HRJ A;  4X3T A;  4XT1 B;  1DON A;  2MGS A;  1WVL A;  2DY8 A;  1WTW A;  2HCI A;  4HSV A;  2SDF A;  4IUR A;  1M8A A;  2K28 A;  1KNA A;  4XDX A;  1A15 A;  1DOL A;  1SSO A;  1B3A A;  2Q8R E;  2D9U A;  1ROD A;  3DEO A;  4IUT A;  1ML0 D;  1DOM A;  1EIG A;  4LMQ D;  3TZD A;  5COY A;  2K01 A;  2FFK B;  1WTV A;  4R8I A;  2EPB A;  2BDN A;  3FDT A;  1PLF A;  4MN3 A;  1X32 A;  5T1I A;  1B53 A;  1CA6 A;  2NYZ D;  2L11 A;  2L1B A;  1F9S A;  3KBX A;  5D65 A;  2B2V C;  2MP1 A;  2N55 A;  3H91 A;  1NCV A;  3TN2 A;  2B2W C;  2N88 A;  1S4Z A;  2K03 A;  5E4X A;  1PFM A;  4ZK9 B;  1JE4 A;  1EQT A;  1GUW A;  1C8C A;  1U4P A; 
#chains in the Genus database with same CATH topology
 1R9T B;  1CHP D;  2R7Z B;  1ESF A;  4NMZ A;  5I6Y A;  3ERS X;  4B3R Q;  4XIG S;  2QIL A;  1BXT A;  1ENA A;  1M90 C;  2QDL A;  4BBR B;  4A76 A;  2OTJ A;  2DGY A;  2B63 H;  1OXV A;  2CQO A;  3VYT A;  1X3P A;  2LXJ A;  3J81 i;  3GTQ B;  1ET6 A;  3TS0 A;  1KLU D;  2XWB B;  4R8N A;  5CR3 A;  4Z9C B;  3CD6 A;  3H09 A;  2VS1 A;  1FJG Q;  3KOJ A;  5C0X G;  2ZTC A;  4A3B H;  4G7O C;  2K75 A;  1JB3 A;  1D5M C;  3GTO H;  1F9P A;  4IPD A;  3ULP A;  5C3W A;  1W2B A;  3GTP B;  2UUC Q;  3S2H B;  4CKE A;  5IP9 G;  2VY3 A;  1J9O A;  4OL7 A;  1UEB A;  3MXU A;  1K9M C;  4PG3 A;  4DV1 Q;  1VQ4 A;  2A8V A;  1ONL A;  4R4C A;  3FHW A;  4DR2 L;  5CMD A;  2PZU A;  3GV6 A;  3PUZ A;  2K04 A;  4LF4 Q;  5GAG C;  3T1H Q;  3CQZ B;  2EOT A;  5I2X A;  2F0N A;  4DV0 L;  4O0A A;  1RTN A;  2NWG A;  1KLG D;  3GQB A;  4I65 A;  1NY4 A;  2KEE A;  3S14 H;  4CHT B;  1RTO A;  3H0G B;  1GUT A;  4B3M L;  2EYF A;  4I7Z C;  4LFB Q;  4JI4 L;  1K0S A;  1AE3 A;  2KQ3 A;  4A93 H;  4XQJ A;  4PMC A;  1G8Z D;  3NEL A;  4PZ6 A;  4ZUI A;  2R93 B;  5M5Y H;  5JEA J;  2WP8 J;  5IOD A;  4WJ3 M;  3J7A 5;  2EXZ A;  2NZ1 D;  5C4Z A;  5E7N A;  1TWG H;  1PH7 A;  2DY8 A;  3GTM H;  1IBK L;  2YV5 A;  1Y1V H;  4AYB G;  1OO9 B;  2NVX H;  3NXW A;  2I5L X;  1TWH H;  2OTL A;  3A0J A;  2WKC A;  1QB5 D;  4LFA Q;  3HFZ B;  1L1O A;  5GAE C;  1D6E C;  2JJQ A;  1FVI A;  3HOV G;  1J5E Q;  1HZC A;  3M9B A;  4J6H A;  4KJN A;  4QJF A;  2RHQ B;  2F0D A;  3HGB A;  3K0Y A;  4DXG A;  4A3M B;  3W1G A;  2XN9 C;  3SXH A;  1OXU A;  4DAM A;  2H1E A;  5I9P A;  3R3O A;  5HY6 A;  3SVM A;  1F77 A;  1A6X A;  3J80 i;  1FL0 A;  4GN5 A;  3A5U A;  3PF4 A;  1XPU A;  1ZYR D;  1L1O C;  1F9R A;  2D0O A;  3M7G A;  3M4O H;  3U4Z A;  3I3C A;  4N9T A;  1EUJ A;  5EBC A;  3DXJ C;  4A3I G;  3RN2 A;  3JAM i;  1VQF A;  2FHT A;  4MHE A;  3CCS A;  1SNP A;  2K50 A;  1SYC A;  3QB3 A;  1ZKO A;  3PIP A;  4AYB E;  2HDL A;  3MHB A;  4R1J A;  1Q82 C;  4HCS A;  3J80 L;  1TWC H;  1O7L A;  1EIH A;  2ZTE A;  1K83 B;  1P8L A;  1D8L A;  1X3G A;  3Q8D A;  2K5N A;  1NBW A;  5CV4 A;  5ISR A;  4BY7 H;  3KUP A;  1STN A;  5M3F B;  1CTM A;  1PH3 A;  1ILQ A;  4A4I A;  4HIM A;  1C48 A;  4ZKC B;  4DR7 L;  3HOZ B;  3RN5 A;  2FJ2 A;  4DAP A;  4RGM A;  1S5D D;  3NE5 B;  4B3T Q;  4A3D G;  3U9S A;  4EVO A;  2AQ2 B;  5BN3 A;  1X3E A;  2BE5 C;  2CWA A;  3K59 A;  3BVM A;  1R4Q B;  3I4O A;  1RF2 D;  3OYY A;  1OXX K;  2PW5 A;  4RHR A;  4DR5 L;  4IUU A;  1Y69 U;  2L15 A;  2K6A A;  1LTT D;  2RA4 A;  3OTO Q;  4A3F G;  1U0L A;  4Y52 H;  3PO2 B;  3M4Q A;  2B2W A;  2EJG C;  2QKI C;  4KN4 C;  3H15 A;  4K6L A;  4KY6 A;  3RLF A;  3IAY A;  3M4P A;  5ELE A;  4JI1 Q;  2HHH Q;  5FLX E;  4JI5 L;  2AUK A;  4DV5 Q;  4C3H B;  3S15 B;  2UXC L;  1JR0 D;  2Q8R E;  2NUC A;  2PNH A;  4HCE A;  2NN6 G;  2VB2 X;  3G4S A;  3MEH A;  3TP5 A;  2F0Q A;  1WCM B;  1PLF A;  5FLX c;  1Q12 A;  2OQ0 A;  1LTI D;  4GKJ Q;  2ZJP A;  1DD2 A;  4LFC Q;  2MP1 A;  3H91 A;  3K5M A;  1MHW C;  2B2W C;  2UU9 L;  2I07 B;  2YTV A;  1JE4 A;  1II3 A;  1N36 Q;  1PMR A;  2CW0 D;  3PV0 A;  3AFP A;  5C3E B;  4JVZ A;  2PO4 A;  5C44 H;  3K5O A;  4OEL B;  1CFM A;  1SJE D;  1CZW A;  3NBI A;  2GVB A;  5I2Y A;  2K1B A;  1P16 A;  4P2C B;  1JMC A;  3D6C A;  5AJ3 Q;  2IT1 A;  4ME3 A;  2Z6K A;  3MXN A;  3J7Y W;  2RDF A;  1PYW D;  2MUY A;  4YHH L;  4ZYS A;  1MJC A;  1HFN A;  1VMC A;  1QZG A;  4OWX B;  4JBJ A;  1EIF A;  2AMC B;  4RMF A;  4GLV B;  4UAI A;  3I90 A;  1AP0 A;  5D3D A;  4C1N I;  4PV1 C;  2YU9 H;  2NVY B;  1I4Q A;  1UE7 A;  1H95 A;  3A54 A;  5IGG A;  3HS0 C;  3ITP A;  4K5V A;  4DUY L;  1M4V A;  1SNC A;  2BA0 A;  1JT8 A;  3WOF A;  1PH4 A;  5BN4 A;  1ZEQ X;  2EYP A;  3M7N A;  2Z6K C;  2CW0 C;  1EL0 A;  2KCC A;  4ALP A;  4A3B G;  1H9K A;  1B1Z A;  5LL6 S;  2WV6 D;  2DJF C;  3BZD B;  1HNW L;  1PYS B;  2IL8 A;  3S17 H;  1B44 D;  2AWN A;  3CHB D;  5JEA G;  1Z6H A;  2WIN B;  1Q81 C;  1XMQ L;  5GRO A;  3QOL A;  1HTL D;  4RH6 A;  3UE1 A;  1WTQ A;  3I91 A;  3VA5 A;  2F0U A;  4Q5V A;  2E2H B;  3NQT A;  3HOW G;  2F0H A;  2MNA A;  2X69 A;  4TRD A;  4R4I A;  1JWS D;  1WI5 A;  3TEH B;  4DK6 C;  3I4M B;  1PH1 A;  1XTD A;  3JC6 6;  1WFQ A;  4GOP A;  4A3E B;  5JJL A;  2JA7 G;  4UPA A;  1WTW A;  1PZI D;  2SEB D;  3A55 A;  4IUR A;  3EN2 A;  4A3C H;  1LM0 A;  4XDX A;  3CRL C;  1UWV A;  4POF A;  3X3N A;  5D3I B;  4A93 G;  4OX9 L;  2D5D A;  1JOO A;  1EY4 A;  2A74 C;  4NP5 A;  4IO9 A;  4YWK A;  2ES2 A;  4OON A;  4JI8 Q;  3G6J B;  3BS1 A;  1PTO F;  3I55 A;  1E1O A;  4RGO S;  1IHZ A;  4GOP C;  1K0R A;  2OQK A;  4AQY L;  4JG2 A;  3GO5 A;  1LTG D;  1KNE A;  3VYR A;  4IPH A;  1KAB A;  3M3Y B;  1E22 A;  3SEB A;  3S16 H;  1HR0 Q;  1A2T A;  4BBS B;  3NTK A;  2O5I C;  1S5F D;  1YHB A;  4QCL A;  3DM3 A;  4DR1 L;  1PH8 A;  5IT9 E;  1FNV A;  1LAC A;  4DV4 Q;  3P7J A;  1T5X D;  3DM1 A;  2IX1 A;  3MFY A;  2NB0 A;  5IT9 c;  2A6H D;  3KLS X;  4R4O A;  2AUJ D;  1MD2 D;  3S1R B;  5J39 A;  2OWO A;  5DNF A;  1DJR D;  2Y0S G;  3RNU A;  2Q2U A;  5BR8 L;  3KFU A;  2ICE C;  3K5N A;  1F2Y A;  1GO3 E;  1DM0 B;  1B3Q A;  3K58 A;  4FXD A;  4WFN 3;  2B2Y A;  3RLN A;  3OWE B;  2LMC B;  3T1Y L;  3A7L A;  1SE8 A;  2ZTD A;  1N33 Q;  3F2B A;  1ESR A;  5IP9 H;  3BYT B;  3AQQ A;  1L0W A;  3NBH A;  4KLK A;  1RCV D;  1I94 L;  2KBN A;  2ATW A;  2KEC A;  4L5Q A;  2E8G A;  4FNF A;  4RGN A;  4C2M H;  4YY3 Q;  3T13 A;  1G29 1;  3M4Y A;  4I7A A;  4L6T B;  5CC4 A;  1QVG A;  2EQS A;  3D6W A;  5IGD A;  4A3L G;  2K7V A;  5KNC A;  4DR3 Q;  3HOU G;  2B2Y C;  2Q2I A;  2J7Z A;  4F8M A;  3CCM A;  1G2T A;  3QIA A;  1NNX A;  2WAQ G;  3E3X A;  3L0O A;  1EY9 A;  2M2L A;  4HED A;  2UXB Q;  3EQL C;  1RD9 D;  5FJ8 H;  1HUM A;  2VXW A;  3I4N H;  1EFW A;  4JI3 Q;  1PYB A;  1K3B C;  2Y0S E;  3DHQ A;  4A3J B;  4LJZ C;  3K7U C;  2K28 A;  3BYY B;  3K5L A;  5CV7 A;  1OTC A;  2LFN A;  1B3A A;  4Q0F A;  1JQY D;  2AQ1 B;  4BXX G;  1VDZ A;  4NKL A;  1CKN A;  4FXK C;  4DNI A;  3EIV A;  3CPF A;  4JCV E;  2VQF L;  4JI6 L;  1GUS A;  2EY6 A;  2NTS A;  3J7Z C;  3PO3 H;  1SMY D;  5FO8 B;  2CWP A;  4TSS A;  4DFA A;  1HNZ L;  1PV4 A;  5G3L D;  3HOV H;  4FF1 A;  4QGU A;  2QW7 A;  4J1M A;  1TY0 A;  2B63 B;  5C4J H;  2ICI A;  2A69 C;  3DWA A;  3ERQ A;  5CBA E;  5C4X H;  4PZ8 A;  4RKB A;  2ZM6 L;  2BDO A;  1XMO L;  3L2P A;  1SN8 A;  4DK0 A;  2WAQ E;  4ID6 A;  5LMU L;  4OEM B;  2PQE A;  1J6Q A;  2D62 A;  4HTH A;  3UI2 A;  2K5V A;  5FKA C;  1YJW A;  1HUN A;  2F0O A;  3GTG B;  1LT6 D;  4HJ9 A;  2KHJ A;  1WD0 A;  3GTO B;  1BNZ A;  1SR3 A;  5M5W B;  4CDF C;  1VQH A;  1J8I A;  1I4X A;  2KJX A;  3DEP A;  4A3I H;  3P20 A;  2L12 A;  1N32 Q;  2V1C C;  4KTA A;  2JA5 B;  5D14 A;  2F3V A;  4ULL A;  4C3I B;  2UXD Q;  3NTH A;  3CC4 A;  1LTA D;  3TQY A;  5IYD G;  3FKI G;  2NVT H;  3R8B A;  4FF4 A;  4H44 C;  2F0M A;  2EZV A;  2DN8 A;  1VQ6 A;  2KED A;  3MEF A;  3OMG A;  4L8J A;  3K6O A;  3T16 A;  3NQI A;  4C3J B;  1EU3 A;  3BZK A;  2JSO A;  3ONA B;  4A3D H;  4A93 B;  5H1S E;  1YNJ D;  3I8Z A;  3C1F A;  4IOA A;  5M5Y B;  5EKI A;  1AFP A;  1TWF H;  1G6P A;  1B9N A;  4GNX B;  3HOY G;  4OO1 G;  1TWG B;  2B2U A;  3OMC A;  3GTM B;  2EYL A;  4N8X 1;  2EYJ A;  1STH A;  1Y1V B;  3H3V I;  4KKS A;  4QMG A;  2Z6B A;  1SSO A;  1TWH B;  3SK8 A;  4EQO A;  1EIG A;  1A62 A;  2F0L A;  1WTV A;  4R8I A;  2ZT9 C;  3KLW A;  4H0L C;  4BA1 I;  4M1U B;  1K8G A;  1PZJ D;  1YI2 A;  3L7Z C;  4H7B A;  2NN6 H;  3PGZ A;  5FOB B;  1IBL L;  1VQO A;  1Y14 B;  4MTN A;  3LNN A;  5I4D A;  4Y7N H;  2LY7 A;  1CKN B;  1JOR A;  3HKZ B;  2K32 A;  4KY5 A;  4YCU A;  5CBE E;  2B2U C;  1MGS A;  4A3C G;  3SHL A;  5KEE A;  3C1E A;  1YNJ C;  3MC0 B;  3LWE A;  2C5C A;  1Z47 A;  1TR5 A;  5C5L A;  3GD7 A;  4IOC A;  4GLA C;  3I70 A;  3HEJ A;  2UUC L;  1CK1 A;  4RWS C;  3HOX B;  4KMU C;  4CGY B;  2F4V Q;  1CQV A;  2SOB A;  3CC2 A;  4B3S Q;  3MA2 B;  2XVS A;  2KVM A;  3FVQ A;  3MAQ A;  2ZJQ A;  1HA6 A;  1Y8O B;  3FEW X;  4X62 Q;  2E76 C;  3U9O A;  3PIO A;  4JBK A;  1NUC A;  1EYG A;  4HJ8 A;  1C4Q A;  4BY7 B;  1K73 C;  4V19 0;  1GHK A;  4R4T A;  2JA9 A;  3DMU A;  1CZG A;  3E9I A;  1MKH A;  4DV2 Q;  2KHI A;  2JN4 A;  3VYU A;  4GZY C;  1LV9 A;  4CJ2 C;  2Q2H A;  1SFO B;  1GUG A;  4O2D A;  3CCJ A;  1DCZ A;  1LTL A;  3O13 A;  3KBG A;  5E4W C;  1H9S A;  2B29 A;  3SGI A;  5GAD C;  2XNA C;  2EY1 A;  5JEA H;  3RZD H;  5JJK A;  4RA8 A;  3RZO H;  1AZP A;  2K4K A;  4DV3 Q;  3QWN A;  3J81 L;  1F2M A;  3CAM A;  2E2I H;  1VMP A;  3OIQ A;  4X3K A;  4BY1 G;  1JJ2 A;  2E5L Q;  3HOW H;  4CJ0 B;  4UP9 A;  1BO0 A;  4IJL A;  3CCQ A;  1EEI D;  1I6H H;  4ZCK A;  3C46 A;  4DR4 Q;  3I56 A;  3KYH C;  2JA7 H;  3SK5 A;  5CV6 A;  1L0Y B;  2JA6 G;  2ID0 A;  4HID A;  5FJ8 G;  1VQM A;  3I4N G;  5KIX A;  3KBX A;  2JK8 A;  2VB3 X;  1CSP A;  2FXQ A;  4K14 A;  1VQN A;  5EBD A;  2PI2 E;  4X66 L;  2JA8 B;  2F3W A;  1PFB A;  1U4R A;  5C44 B;  4LAA A;  3ND8 A;  1KC8 C;  1ET9 A;  3I72 A;  4KV6 A;  1CSQ A;  1YBY A;  5COR A;  1BCP F;  1A3U A;  2CQA A;  2FMC A;  3IFT A;  2MO0 A;  2IJ0 A;  3G7L A;  4NXM L;  5FLM G;  3AEV A;  1VF7 A;  1QUQ A;  1MI2 A;  1YHA A;  3A5Z B;  3SR1 A;  3ULL A;  4X3U A;  1HZB A;  3PO3 G;  2WB1 G;  1YHQ A;  1HH2 P;  2EE1 A;  4H13 C;  1CQF A;  2PNR C;  1NR2 A;  5M5X H;  1TVX A;  3BVG A;  2SNM A;  2B8F A;  2YU9 B;  4IN3 A;  2MO1 A;  3CPW A;  3H3V H;  5C4X G;  4OO1 I;  4KKT A;  3VR6 A;  2F0P A;  3EJI A;  4P72 A;  1GXD C;  4KK7 A;  3F2D A;  4K0K L;  3Q0A A;  4FXG C;  3K7A B;  2BOS A;  2BE5 D;  3L3O C;  1LO5 D;  1ZXT A;  1IBM L;  2PPB C;  4RCO A;  3OTO L;  4DV0 Q;  1D2B A;  4UHV A;  3S17 B;  3CMA A;  1U4M A;  3C2P A;  1PXU A;  2QDB A;  1X3Q A;  1CHQ D;  4JI1 L;  4XT3 B;  4IFD J;  3D0F A;  4DV5 L;  4F88 A;  1NTG A;  4A3G B;  4MTK A;  2F0V A;  2KCM A;  3HRZ C;  1IZ6 A;  3B6Y A;  5DLQ E;  1PTO H;  2WB1 E;  4A3L H;  2KCT A;  3D4R A;  1MIU A;  3HOU H;  1KQS A;  3ND9 A;  2C35 B;  1T5E A;  3IKJ A;  3PUX A;  1Q8I A;  5M3M G;  3DWQ A;  3JAM L;  1E2W A;  1IBK Q;  5A2Q L;  1L2F A;  1Q86 C;  1EQQ A;  1Z9F A;  3UDG A;  1A3T A;  2EJM A;  4X65 Q;  3DEO A;  1ML0 D;  1I4P A;  1GVP A;  3S1M B;  2H5X A;  2UUB L;  4EQN A;  4CDE C;  2K5Q A;  2O2L D;  3PQI A;  2L1B A;  1Q90 A;  2J0T D;  5CGK A;  2AHO B;  5AJ3 L;  3W2D A;  4BXX H;  4DUZ Q;  5E4X A;  2K14 A;  5K5P A;  4KN7 C;  1JWU D;  2QF7 A;  3J81 E;  1O80 A;  5F2D A;  2VW9 A;  2FIN B;  2D2C C;  5EAY A;  2TSS A;  2RKS A;  1NMG A;  3S2D B;  3U58 A;  1I3Q H;  1QG7 A;  3GDE A;  3S1N H;  3D8G A;  1EFI D;  2X6L A;  5IGB A;  1BCP D;  3S1Q B;  3SE0 A;  2RQX A;  1ASY A;  1QVF A;  1IYV A;  5I6W A;  2EYM A;  1E0B A;  3NP8 A;  5A35 A;  2NVQ B;  1KRT A;  3CQZ H;  4FF2 A;  1L1O B;  3S24 A;  3F1Z A;  1GUO A;  3NSW A;  5JJI A;  2L9H A;  3H0G H;  4HJ7 A;  3I7F A;  1HNX L;  5LMN Q;  1NR4 A;  4HN7 A;  2NBF A;  4DN4 M;  5HGQ A;  1HTP A;  2HUG A;  2R3Z A;  1QJO A;  3K0X A;  4DR7 Q;  1SND A;  1STB A;  3QJY A;  3VA7 A;  1Z7T A;  4GKK Q;  4RGT A;  4S3S A;  1G51 A;  4C2M B;  3ICE A;  4DAV A;  3F2C A;  1O7I A;  5IOC A;  5IYD H;  3FKI H;  4APV A;  1VQ7 A;  2NZH A;  1IYU A;  5FO7 B;  3RMH A;  3PIO 3;  2F1M A;  2XIW A;  1BCP C;  2M9V A;  1Y1W H;  1SXT A;  4DV6 L;  1E2Z A;  4L5T A;  1VCI A;  1PRT F;  3KF8 A;  1GKH A;  4DNT B;  4KHP Q;  2RCF A;  3RD4 A;  3LWU A;  1JOK A;  4BS9 A;  2QCP X;  1ASZ A;  1GUN A;  2B8G A;  1CI3 M;  4DAY A;  2F4I A;  3E9H A;  5C3X A;  3CCR A;  4A3M H;  1WVL A;  4AH6 A;  3TSS A;  1EYA A;  3HOY H;  4OO1 H;  2LKV A;  5HGT A;  1XPR A;  1DOL A;  2IHF A;  1VQP A;  2OF1 A;  4WRD A;  1KDC A;  3Q22 A;  4AYB B;  1S72 A;  4JI7 L;  4N8F A;  1H9J A;  4JV5 L;  3VR4 A;  5JPM C;  4JYA Q;  1C0A A;  2BDN A;  4MN3 A;  5C6A A;  3GTL H;  1X3F A;  4ILW A;  3SK4 A;  4A75 A;  1CA6 A;  1EY6 A;  2UU9 Q;  2R7D A;  2Q8I B;  1I4R A;  3TN2 A;  3J80 E;  1Y8P B;  2E2J H;  2RDH A;  4DV7 Q;  4GN4 B;  5ELF A;  3BG3 A;  3HOV B;  3GP7 A;  1K8O A;  3GTJ H;  2HDM A;  3PUV A;  5JPN C;  3J80 c;  3BDC A;  3JAM E;  3A7A B;  5KRU A;  2OT2 A;  3UDI A;  1PH9 A;  3ZYY X;  1HA5 A;  3FPU B;  1M1K C;  1QVC A;  1QNK A;  1NAP A;  1EZ6 A;  1K83 H;  1TXY A;  2DNC A;  4YHH Q;  2RVL A;  1BF4 A;  1V1P A;  1N33 L;  1K8A C;  4PZ7 A;  5I9O A;  3P1H A;  5M3F H;  1EIY B;  3CCV A;  1B7Y B;  4JOI A;  2A1A A;  4LF6 L;  4DU9 A;  4A3I B;  2CVR A;  1LT3 D;  3HOZ H;  2WAC A;  2R92 G;  5EQ0 A;  3M85 A;  5IWA Q;  4JI2 L;  4KHV A;  1YIJ A;  4DR6 L;  5ELN A;  3UDX A;  3DWP A;  2CHB D;  2NZO A;  1XWE A;  2RF4 A;  4GN3 B;  1G2S A;  1JB7 A;  3SK6 A;  1SNO A;  1PZK D;  1XNR Q;  4DR3 L;  4J8Q A;  4IFD G;  2NVT B;  2K5W A;  3QG1 A;  1BCP B;  2UXB L;  1RKN A;  1AEX A;  4JOI C;  1DOK A;  3HG9 A;  4K8I A;  1EWC A;  4ZLT F;  1N8R C;  4LNQ A;  2JXM B;  1B8A A;  4JI3 L;  2KCN A;  1XMQ Q;  1VQL A;  3W3A A;  4H02 A;  1TII D;  1HZA A;  3QR8 A;  2R7F A;  3MXN B;  4IUV A;  4A3D B;  1UE1 A;  2Z1C A;  1YZ6 A;  2VUM G;  2E75 C;  2O4X A;  4C3H H;  5LMN W;  4JBW A;  3L9A X;  2IY5 B;  1TWF B;  2P5Z X;  3OPO A;  4QF4 A;  1QCB D;  1VQJ A;  3OHX C;  3R2I A;  1I6V C;  5EPK A;  4A3F B;  2Q2T A;  4OGQ C;  1X54 A;  1XNQ Q;  3C3L A;  3AYH B;  1VQB A;  1FNW A;  1PRT D;  3U4V A;  4BY1 H;  5IGE A;  2B3G A;  4OX9 Q;  1EYD A;  1TU2 B;  1E1T A;  1U9R A;  3MXG A;  5NUC A;  2YTY A;  2CFM A;  1S5E D;  2N3S A;  4LMQ D;  1A2U A;  5T1I A;  5KNB A;  1FYC A;  1BQQ T;  2A69 D;  2KHS A;  4JW0 A;  4HJ5 A;  4Y7N B;  2JA6 H;  2N55 A;  2CKZ B;  1EQT A;  2R7Z G;  4XYO A;  4P74 A;  1I50 H;  2A5H A;  4PQX A;  3URY A;  3GTK B;  1QWY A;  1JJC B;  3G6E A;  2X6G A;  1QZH A;  4GOP B;  4LUZ A;  1KXL A;  1A3V A;  2F0E A;  1VS0 A;  2NVY H;  5J1Z A;  5C0X J;  1O78 A;  3F2U A;  1A0I A;  1VQG A;  1NMF A;  1D5Z C;  5FLM H;  1PRT C;  5C5M A;  3ULJ A;  5CV9 A;  1RIP A;  2SNS A;  4CKC A;  3S9W A;  2BH8 A;  4LF9 Q;  1VQI A;  1BOS A;  5GAH C;  4GLX A;  1MJE A;  3TS2 A;  1PTO D;  2HCC A;  2RBM A;  3A8K E;  3T1Y Q;  3HP3 A;  2Z9H A;  2QGQ A;  4UP8 A;  2MFI A;  4HIO A;  3OW2 A;  2EY5 A;  3BU2 A;  3J7A V;  1CUK A;  1SYE A;  3TP6 A;  3H3V C;  4ODG A;  3P75 A;  3PMF A;  2F0J A;  5KYI A;  4A3B B;  3I4M H;  3CW2 C;  5CV5 A;  1N34 L;  1TWA H;  4EX5 A;  3D4D A;  2PMZ B;  3R93 A;  1SDF A;  5K36 G;  2ZXR A;  4IUQ A;  1DGS A;  3H0G G;  1HR0 W;  3VR5 A;  3NHH A;  3RZD B;  4C56 C;  1STE A;  2PCF B;  4KD3 A;  3CCE A;  3RZO B;  4PNY A;  3CXC A;  1B2T A;  2R93 G;  3QOJ A;  3HZX A;  4OIJ A;  2TMP A;  2E2I B;  2UUA Q;  5JVH 3;  3T4A C;  2K5D A;  3HOW B;  4V0B A;  2RSN A;  3LX0 A;  4UDU C;  1SJH D;  1I6H B;  4RKL A;  4G7H C;  4DGZ A;  1PTO C;  3FRP B;  3S14 B;  2JA7 B;  1FGU A;  3NBH B;  4K6D A;  5M3M H;  1VQD A;  4G4K A;  1Y1W G;  1EWH A;  1RL2 A;  4JBM A;  4LF5 Q;  5M9O A;  4KD4 A;  3TZD A;  4FYD A;  4LW1 A;  3VR2 A;  2FFK B;  5L37 A;  5IE8 A;  1DYQ A;  2NTT A;  1B53 A;  3E5S A;  1F9S A;  1I4H A;  3D3R A;  2F4V L;  2DUD A;  3W1B A;  4LF8 Q;  1STY A;  1HQR D;  1WOC A;  1YNX A;  4B3S L;  4A3M G;  3EBE A;  1U4P A;  4IFD I;  2DNE A;  4QB4 A;  1VQ9 A;  5C4H A;  4UP7 A;  3WWV A;  3AU7 A;  2A6E D;  2EYH A;  2HIX A;  4B3R L;  5LL6 X;  2N49 A;  1PFN A;  2ZM6 Q;  2NVX B;  2VQE Q;  2AWO A;  1H9R A;  3SDZ A;  1GHJ A;  3FP9 A;  1KL9 A;  3AMU A;  1E24 A;  1JJG A;  4KY7 A;  4NW2 A;  1U4L A;  1HFG A;  1WTX A;  2L0C A;  5M5X B;  2F52 A;  2BA1 A;  1E7Z A;  4JI0 Q;  1DZ1 A;  2G9D A;  3CKI B;  1SYG A;  2ENB A;  2C9O A;  4YWL A;  2QEX A;  1FJG L;  2XRQ D;  2PZT A;  1GM5 A;  4PMB A;  4FDB A;  4QUC A;  2Y0S B;  2Z4H A;  3CP0 A;  2RSO A;  3M4O B;  1GJX A;  2LS0 1;  1G91 A;  4EQ5 A;  5M3F G;  1WTO A;  3NK9 A;  2EJF C;  1KIX A;  5J3B A;  4DV1 L;  3TDQ A;  2FMM A;  3A8J E;  3HOZ G;  4R4Q A;  5IGC A;  4LF4 L;  2A6E C;  4POG A;  4QUF A;  3T1H L;  2CH4 A;  2MQH A;  4X64 Q;  2JQO A;  4FF3 A;  1LYL A;  1ENC A;  1HHV A;  3E0J A;  4DR4 L;  5DM6 3;  1PTO B;  1TWC B;  2HQL A;  1RJT A;  4GS3 A;  4LFB L;  1SBB B;  4XXE A;  3HOU B;  3PO2 G;  2WAQ B;  2B2V A;  5BN5 A;  4AIM A;  4LF7 Q;  3N52 A;  5IYB H;  1LTR D;  1IYJ B;  4NXN Q;  4ME5 A;  4C3H G;  2HCI A;  2L55 A;  4DF7 A;  1SRU A;  4MIU A;  5ELC A;  1ROD A;  1OXS C;  4IJH A;  1DXM A;  3T53 B;  1WCM G;  3BDL A;  1SNM A;  2EPB A;  1K3R A;  1X32 A;  1IBL Q;  4FVM A;  3CRK C;  2JEA I;  4LFA L;  2CH4 W;  2B2V C;  3WDN A;  2ALY B;  1BDO A;  3F8T A;  1VQE A;  1PFM A;  1SYF A;  3NEN A;  5C3E G;  1J5E L;  4QIW B;  1F2Z A;  3GTG H;  1C7Y A;  3RR5 A;  1SLJ A;  4P73 A;  1VQ5 A;  3E0E A;  5M5W H;  3KJP A;  2G9H D;  4E6I A;  3R2T A;  1I3Q B;  1HCZ A;  1SE2 A;  3S1N B;  4K2K A;  2JA5 H;  2D0P A;  1D1K A;  2H4O A;  4ZUJ A;  2IW3 A;  4OHJ A;  2K52 A;  1CA5 A;  4C3I H;  3KDF A;  1JC7 A;  4K8J A;  3UE0 A;  1LLR D;  1YJN A;  1QE6 A;  2A68 D;  5FLX L;  3K57 A;  1F9Q A;  4L5R C;  3BJU A;  1LTS D;  4HIK A;  1OXT A;  3MFG A;  3T56 B;  5CYU A;  1Q7Y C;  5E1F A;  4A3K H;  2QA4 A;  4U68 A;  2HT1 A;  2R92 H;  4C3J H;  1SE4 A;  3IL8 A;  2YTX A;  2I0Q A;  2XGT A;  2PI2 A;  3K8A A;  1QNU A;  1FD7 D;  4X3S A;  1KD1 C;  5KYL A;  2V4D A;  2IX3 A;  4RG1 A;  3FKI B;  4IFD H;  1R4P B;  3CC7 A;  2XRS D;  3CME A;  3A56 A;  4YWM A;  1CM9 A;  3DUZ A;  4B3T L;  2G5D A;  3K81 C;  3NWS A;  4QY7 A;  2N78 A;  1Y1W B;  1ICW A;  4LUV A;  2R6G A;  1PFS A;  1L0X B;  4X65 L;  2VUM H;  2A68 C;  4O42 A;  2JEB I;  3BZC A;  5IP7 G;  4DR2 Q;  3G48 A;  4OWT B;  1WYD A;  3I4M G;  4OWW B;  1LT5 D;  3OIP A;  5TSS A;  3ZJY C;  4KHZ A;  4ZRZ A;  1X65 A;  4TQU S;  4A3E G;  1YIT A;  4DUZ L;  3KLR A;  4YCW A;  3HOY B;  1JWM D;  1HRJ A;  2F0F A;  1BUV T;  1GOZ A;  1LUZ A;  4B3M Q;  3TP8 A;  2SDF A;  5JAV A;  1XTC D;  5EKL A;  1A15 A;  3TZU A;  2HHH L;  4JI4 Q;  3I2Z A;  3KLS A;  3GTL B;  1VQK A;  3K80 C;  1XPO A;  2K01 A;  1H9S B;  1PH6 A;  4K2L A;  1KDA A;  2Z0S A;  2E2J B;  2WII B;  4DPG A;  3HOX H;  4RFB A;  4X66 Q;  1X55 A;  5ELO A;  4GKJ L;  4XYQ A;  2M00 A;  4LFC L;  3GTJ B;  2F0G A;  2ASB A;  1B4O A;  4K5W A;  1N36 L;  2DJG C;  4IQZ A;  3EA6 A;  1UUP A;  1R9T H;  2R7Z H;  4B08 A;  4NXM Q;  4BBS G;  1EEF D;  2B2T A;  4JK1 C;  4F87 A;  1V1Q A;  1VQA A;  4NPS A;  1JE5 A;  4OXP A;  2EYO A;  4BBR H;  5LMN L;  1KAW A;  1UE6 A;  5AFW A;  1O7Z A;  1BVS A;  2RHS B;  3GTQ H;  4DA2 A;  3X3M A;  2JE6 I;  4HAE A;  4GKK L;  2KUM A;  3KDF B;  3I4L A;  3V05 A;  1SFO H;  1EYC A;  3S16 B;  1V1O A;  1SEB D;  2B2T C;  4K0K Q;  4G57 A;  1ZYR C;  2XWJ B;  4LUO A;  5GQO A;  2VZA A;  1BBX C;  2PYK A;  3J81 c;  1PVO A;  5E3F A;  4QL5 A;  1IBM Q;  4ZAI A;  3GTP H;  3S2H H;  4CDC C;  3PSI A;  1F2L A;  1Q1B A;  4N9P A;  1VQ8 A;  1EY7 A;  2EXD A;  1D5X C;  2I46 A;  3OWF A;  3U50 C;  4KHP L;  1D7Q A;  5JOB A;  2MPM A;  1QUQ B;  2JYO A;  1NE3 A;  3MWY W;  1VF5 C;  1TS3 A;  3D4W A;  1Q1E A;  1TS4 A;  5IYC G;  1E3P A;  1HXY D;  1AH9 A;  2XSC A;  5IT9 L;  3MZ5 A;  3TME A;  1YNN D;  1QIL A;  3IRB A;  4FO2 A;  5C0X I;  1O7Y A;  5FK9 C;  2BH2 A;  3Q23 A;  5K36 H;  2E2D C;  1MSH A;  4JYA L;  2MHV A;  1UEA B;  1X9N A;  2R93 H;  2F0T A;  1IW7 D;  1N9W A;  2KOL A;  4DV7 L;  4BY1 B;  2I5H A;  4A3J G;  4DKA C;  4XT1 B;  2JA8 H;  2MGS A;  2B39 A;  4F7X A;  3E6Z X;  1M8A A;  1GD7 A;  5KND A;  1B9M A;  3TBI B;  3G71 A;  2D9U A;  2UUB Q;  1DOM A;  1XXG A;  4PMW A;  1TKW B;  4DR5 Q;  4C1N K;  2JA6 B;  3FDT A;  2YYZ A;  4B9W A;  4WJ4 A;  5J22 A;  3PCO B;  1YVC A;  5D65 A;  5IYB G;  3I4N B;  4JI8 L;  2PQA A;  3I73 A;  2F0I A;  1LTB D;  1EQV A;  1I50 B;  2RDG A;  3OW7 A;  5DAU A;  1MBY A;  4ZK9 B;  1W6K A;  1YNN C;  4P71 A;  2F0K A;  2VL6 A;  1YJ9 A;  5EGT A;  1NSN S;  4JI5 Q;  2UXC Q;  2B63 G;  1EY5 A;  2IPK D;  5IWA L;  4YIJ A;  2K33 A;  4XTC S;  1XJV A;  3Q24 A;  2DY7 A;  1A8V A;  3CCL A;  1HPC A;  2EY2 A;  1HR0 L;  3W5O A;  1TS2 A;  1IW7 C;  4U67 3;  4IUN A;  3K7A H;  1XNR L;  3OSO A;  1EZ8 A;  4DXF A;  3NPP A;  3J81 j;  3PO3 B;  2WB1 B;  1Q3L A;  1KHI A;  2A73 B;  4DV4 L;  4TKO B;  3H6M A;  1RHP A;  1SAP A;  1AE2 A;  1IXR A;  1BBW A;  1EOV A;  3CU7 A;  5C4J B;  2KA7 A;  2HQE A;  1SYB A;  4KI0 A;  2JA5 G;  1HNX Q;  5C4X B;  5A2Q E;  4FP5 D;  3V2T A;  5DEH A;  4RCN A;  4XQN A;  1WD1 A;  4C3I G;  2F03 A;  4A3G H;  3MTS A;  1PA6 A;  1SMX A;  2VNU D;  1EU4 A;  3ERO A;  2ZXO A;  3MVV A;  3JAM c;  1PHJ A;  1TS5 A;  1TWA B;  2OEO A;  1UAP A;  1KAA A;  1XNQ L;  4IAL A;  4A3K G;  3VYS A;  3STB D;  3NWT A;  2IHE A;  4C3J G;  4YY3 L;  2KEN A;  4DUY Q;  2CCZ A;  2IWH A;  4DK3 C;  4DV6 Q;  1EWI A;  4HR7 B;  5G3L F;  4K5X A;  4NB3 A;  2F0W A;  3S1M H;  4KJO A;  5DM7 3;  4EGV A;  2QEJ C;  5T1G A;  1UNS A;  2PMZ E;  1HNW Q;  1V9P A;  4UY8 C;  3PO2 H;  1BKB A;  4RHS A;  1C9O A;  1Y1V G;  5LHY 1;  5M3M B;  3VR3 A;  4B9X A;  4HSV A;  5EKK A;  1STG A;  1HJP A;  3BVZ A;  4DNR B;  1K8M A;  1X6O A;  4JI7 Q;  4JV5 Q;  3S15 H;  5COY A;  1VQC A;  3S2D H;  3RLO A;  3RUZ A;  3FMC A;  1CKM A;  2Z8L A;  2L11 A;  1WCM H;  1D1I A;  3STB C;  3S1Q H;  1S5B D;  3HKZ G;  4WJW A;  4QQB X;  4DK1 A;  1C8C A;  2IX0 A;  1LT4 D;  3KF8 B;  3OOC A;  2O5J C;  2PQA B;  2NVQ H;  4LF9 L;  1ILP A;  5C0X H;  5C3E H;  2Q8T A;  4X6A H;  1EQR A;  4DAY B;  3FPP A;  3CF5 A;  1BBU A;  2J4X A;  4IZ8 A;  1PH5 A;  3HOX G;  2EDG A;  4WOR A;  1PDQ A;  2NN6 I;  4LF6 Q;  1W3S A;  3NTI A;  4AQY Q;  2JP1 A;  1FR3 A;  4NDX A;  4JI2 Q;  2HD3 A;  1WTR A;  2F3I A;  4YCV A;  3MXP A;  3PUY A;  3A8I E;  4DR6 Q;  3PF5 A;  5EPL A;  1SRO A;  1E2V A;  2Z4I A;  3PIP 3;  4BBR G;  1JIC A;  5JVG 3;  4DR1 Q;  1N32 L;  1Q46 A;  4BY7 G;  4GNX A;  1XYI A;  2BCO A;  5EJW A;  4HMI A;  5ELD A;  2A6H C;  4IPC A;  3VDY A;  1AW7 A;  1WTH A;  2XTI A;  1RDP D;  2ZXP A;  4CDD C;  2UXD L;  3HKZ E;  2GN5 A;  2UUA L;  1I5F A;  1V43 A;  1XX8 A;  4BA2 I;  4L5S A;  3IFD A;  1IKL A;  1QOH A;  1PH2 A;  1V1P B;  1IKM A;  5BR8 Q;  5IGF A;  1MSG A;  4MZ9 A;  1HZ9 A;  1EY8 A;  2LSS A;  3PUW A;  4R9W A;  3A74 A;  4GNX C;  4LF5 L;  1FGB D;  3TRZ A;  3ER0 A;  2L5T A;  4CKB A;  3WOE A;  1JCK B;  3QO2 A;  1IL2 A;  1I94 Q;  2E2H H;  2PZW A;  1S3O A;  3AFQ A;  5IP7 H;  4IUP A;  5HUR A;  4LF8 L;  2I5M X;  4IPG A;  2F0S A;  3KF6 A;  4X3T A;  1DON A;  4A3E H;  2R61 A;  4JC0 A;  3KK7 A;  4L63 B;  4G7Z C;  4IUT A;  4TVA B;  1S40 A;  2VQE L;  3N6R A;  1CKO A;  1K28 A;  2NYZ D;  4J15 A;  4MNO A;  3J7A F;  2JA8 G;  1V8Q A;  4M8A A;  4JI0 L;  2AQ3 B;  5C44 G;  1B50 A;  3TRE A;  4ZKB B;  5EPJ A;  1UE5 A;  3M3Y H;  5JJZ A;  4HJA A;  2N8N A;  2HIV A;  4BBS H;  1SMY C;  2K05 A;  4XQQ A;  4O1N A;  1IL8 A;  2VQF Q;  1I4G A;  4JI6 Q;  1AZQ A;  1TT2 A;  3EVQ A;  1T9H A;  4HSP A;  3UDF A;  4QIW E;  4ZQ3 A;  1KDB A;  3BDO A;  1AN8 A;  2K5H A;  1HNZ Q;  2GA4 B;  3V96 A;  1CT1 D;  1TQO A;  1G6Z A;  4A3K B;  4LK1 C;  2R92 B;  1PRT B;  1H9M A;  4RAU C;  1S5C D;  4BWG B;  3S1R H;  4CJ1 B;  4X64 L;  1EY0 A;  5FO9 B;  2GVA A;  1U5K A;  1XMO Q;  2EVB A;  3LGJ A;  5KGU A;  1WTP A;  4X62 L;  5LMU Q;  1NJI C;  3GV3 A;  4EQP A;  4HMJ A;  3T51 B;  5IIF A;  5CV8 A;  1N34 Q;  4ABN A;  2EIF A;  5ELB A;  4A3F H;  2MJ8 A;  4P75 A;  4DV2 L;  4LF7 L;  3TP7 A;  3D31 A;  1STA A;  1KRS A;  1JOQ A;  1HQM C;  1SYD A;  2OCE A;  1W6J A;  3Q6S A;  4NXN L;  4A3G G;  1BR9 A;  3HKS A;  4CBV A;  1LAB A;  2ZJR A;  1TY2 A;  5IYC H;  2VUM B;  1EOT A;  1ENF A;  3H94 A;  4OIK A;  3AB9 A;  2L4N A;  4JPB W;  1WJJ A;  2AKW B;  3KJO A;  4LWC A;  3EFX D;  4DV3 L;  3CCU A;  2LXK A;  3NUC A;  1Q8K A;  2WKD A;  2E5L L;  1X56 A;  1KTK A;  2A19 A;  3DLL A;  1KNA A;  4A3J H;  1YEZ A;  1SNQ A;  1SE3 A;  3KF6 B;  3GTK H;  2PW7 A;  4KKU A;  1FNU A;  2OXP A;  1A63 A;  2WFW A;  5IY0 A;  3NEM A;  1NCV A;  2RCN A;  2N88 A;  1B70 B;  1S4Z A;  1Y8N B;  2E74 C;  2K03 A;  1ICF B;  1GUW A; 
#chains in the Genus database with same CATH homology
 1R9T B;  1CHP D;  2R7Z B;  1ESF A;  4NMZ A;  5I6Y A;  4XIG S;  2QIL A;  1BXT A;  1ENA A;  4BBR B;  1OXV A;  3VYT A;  1X3P A;  3GTQ B;  1ET6 A;  1KLU D;  2XWB B;  4R8N A;  5CR3 A;  4Z9C B;  3H09 A;  5C0X G;  4G7O C;  1JB3 A;  1D5M C;  1F9P A;  5C3W A;  3GTP B;  3S2H B;  4CKE A;  1J9O A;  4OL7 A;  3MXU A;  1ONL A;  5CMD A;  2PZU A;  3GV6 A;  3PUZ A;  2K04 A;  3CQZ B;  2EOT A;  5I2X A;  2F0N A;  1RTN A;  2NWG A;  1KLG D;  3GQB A;  4I65 A;  2KEE A;  4CHT B;  1RTO A;  3H0G B;  1GUT A;  2EYF A;  4I7Z C;  2KQ3 A;  4XQJ A;  4PMC A;  1G8Z D;  2R93 B;  4ZUI A;  5JEA J;  2WP8 J;  5IOD A;  2EXZ A;  2NZ1 D;  5C4Z A;  2DY8 A;  1OO9 B;  3NXW A;  2WKC A;  1QB5 D;  1D6E C;  4J6H A;  4KJN A;  2F0D A;  3HGB A;  3K0Y A;  4DXG A;  4A3M B;  2XN9 C;  3SXH A;  1OXU A;  2H1E A;  5I9P A;  3R3O A;  3SVM A;  1F77 A;  1A6X A;  1ZYR D;  3M7G A;  1F9R A;  3I3C A;  4N9T A;  5EBC A;  3DXJ C;  2FHT A;  4MHE A;  1SNP A;  1SYC A;  3QB3 A;  1ZKO A;  2HDL A;  3MHB A;  4HCS A;  3J80 L;  1O7L A;  1EIH A;  1K83 B;  5CV4 A;  5ISR A;  3KUP A;  1STN A;  5M3F B;  1CTM A;  1ILQ A;  1C48 A;  4ZKC B;  3HOZ B;  2FJ2 A;  4DAP A;  4RGM A;  1S5D D;  3NE5 B;  3U9S A;  4EVO A;  2AQ2 B;  5BN3 A;  2BE5 C;  3K59 A;  3BVM A;  1R4Q B;  1RF2 D;  1OXX K;  2PW5 A;  4RHR A;  4IUU A;  1Y69 U;  2K6A A;  1LTT D;  2RA4 A;  3PO2 B;  2B2W A;  2EJG C;  2QKI C;  4KN4 C;  4K6L A;  4KY6 A;  3RLF A;  3IAY A;  5ELE A;  5FLX E;  2AUK A;  4C3H B;  3S15 B;  1JR0 D;  2Q8R E;  2NUC A;  4HCE A;  2NN6 G;  2VB2 X;  3MEH A;  3TP5 A;  2F0Q A;  1WCM B;  1PLF A;  1Q12 A;  1LTI D;  1DD2 A;  2MP1 A;  3H91 A;  3K5M A;  2B2W C;  2I07 B;  1JE4 A;  1II3 A;  1PMR A;  2CW0 D;  3PV0 A;  5C3E B;  2PO4 A;  3K5O A;  1CFM A;  1SJE D;  1CZW A;  3NBI A;  5I2Y A;  2K1B A;  4P2C B;  3D6C A;  2IT1 A;  3MXN A;  3J7Y W;  2RDF A;  1PYW D;  2MUY A;  4ZYS A;  1HFN A;  1VMC A;  4UAI A;  3I90 A;  1AP0 A;  5D3D A;  4C1N I;  4PV1 C;  2NVY B;  1I4Q A;  3A54 A;  5IGG A;  3HS0 C;  3ITP A;  4K5V A;  1M4V A;  1SNC A;  2BA0 A;  3WOF A;  5BN4 A;  1ZEQ X;  2EYP A;  3M7N A;  2CW0 C;  1EL0 A;  2KCC A;  1H9K A;  1B1Z A;  5LL6 S;  2WV6 D;  3BZD B;  2IL8 A;  1B44 D;  2AWN A;  3CHB D;  5JEA G;  1Z6H A;  2WIN B;  3QOL A;  1HTL D;  4RH6 A;  1WTQ A;  3I91 A;  3VA5 A;  2F0U A;  4Q5V A;  2E2H B;  3NQT A;  2F0H A;  2X69 A;  4TRD A;  1JWS D;  3I4M B;  4A3E B;  1WTW A;  1PZI D;  2SEB D;  3A55 A;  4IUR A;  4XDX A;  3CRL C;  3X3N A;  5D3I B;  2D5D A;  1JOO A;  1EY4 A;  2A74 C;  4NP5 A;  3G6J B;  3BS1 A;  1PTO F;  4RGO S;  1IHZ A;  3GO5 A;  1LTG D;  1KNE A;  3VYR A;  1KAB A;  3M3Y B;  3SEB A;  1A2T A;  4BBS B;  3NTK A;  2O5I C;  1S5F D;  4QCL A;  5IT9 E;  1FNV A;  1LAC A;  3P7J A;  1T5X D;  3DM1 A;  2IX1 A;  3MFY A;  2NB0 A;  2A6H D;  3KLS X;  2AUJ D;  1MD2 D;  3S1R B;  5J39 A;  5DNF A;  1DJR D;  2ICE C;  3K5N A;  1F2Y A;  1DM0 B;  3K58 A;  4FXD A;  4WFN 3;  2B2Y A;  3OWE B;  2LMC B;  3A7L A;  1ESR A;  3BYT B;  3NBH A;  1RCV D;  2KEC A;  4FNF A;  4RGN A;  3T13 A;  1G29 1;  3M4Y A;  4L6T B;  5CC4 A;  3D6W A;  5IGD A;  2K7V A;  5KNC A;  2B2Y C;  4F8M A;  2J7Z A;  1G2T A;  3QIA A;  4HED A;  1EY9 A;  2M2L A;  3EQL C;  1RD9 D;  1HUM A;  2VXW A;  3DHQ A;  4A3J B;  4LJZ C;  2K28 A;  3BYY B;  3K5L A;  5CV7 A;  2LFN A;  1B3A A;  4Q0F A;  1JQY D;  2AQ1 B;  1VDZ A;  4NKL A;  4FXK C;  1GUS A;  2EY6 A;  2NTS A;  1SMY D;  5FO8 B;  4TSS A;  4DFA A;  5G3L D;  4FF1 A;  4J1M A;  1TY0 A;  2B63 B;  2ICI A;  2A69 C;  3DWA A;  3ERQ A;  5CBA E;  4RKB A;  2BDO A;  4DK0 A;  4ID6 A;  2PQE A;  2D62 A;  4HTH A;  3UI2 A;  5FKA C;  1HUN A;  2F0O A;  3GTG B;  1LT6 D;  1WD0 A;  3GTO B;  1BNZ A;  5M5W B;  1J8I A;  1I4X A;  2KJX A;  3DEP A;  3P20 A;  2L12 A;  4KTA A;  2JA5 B;  5D14 A;  2F3V A;  4ULL A;  4C3I B;  3NTH A;  1LTA D;  3R8B A;  4FF4 A;  4H44 C;  2F0M A;  2EZV A;  2DN8 A;  2KED A;  4L8J A;  3OMG A;  3K6O A;  3T16 A;  3NQI A;  4C3J B;  1EU3 A;  2JSO A;  3ONA B;  4A93 B;  1YNJ D;  3I8Z A;  3C1F A;  5M5Y B;  5EKI A;  1AFP A;  1B9N A;  4OO1 G;  1TWG B;  2B2U A;  3OMC A;  3GTM B;  2EYL A;  2EYJ A;  1STH A;  1Y1V B;  4KKS A;  4QMG A;  1SSO A;  1TWH B;  3SK8 A;  4EQO A;  1EIG A;  2F0L A;  1WTV A;  4R8I A;  2ZT9 C;  4H0L C;  4BA1 I;  4M1U B;  1PZJ D;  3L7Z C;  4H7B A;  2NN6 H;  5FOB B;  3LNN A;  5I4D A;  2LY7 A;  1JOR A;  3HKZ B;  2K32 A;  4KY5 A;  5CBE E;  2B2U C;  1MGS A;  3SHL A;  5KEE A;  3C1E A;  1YNJ C;  3MC0 B;  3LWE A;  2C5C A;  1Z47 A;  1TR5 A;  5C5L A;  3GD7 A;  3I70 A;  3HEJ A;  1CK1 A;  4RWS C;  3HOX B;  4KMU C;  4CGY B;  1CQV A;  2SOB A;  3MA2 B;  2XVS A;  2KVM A;  3FVQ A;  3MAQ A;  1HA6 A;  1Y8O B;  3FEW X;  2E76 C;  3U9O A;  1NUC A;  1C4Q A;  4BY7 B;  4V19 0;  1GHK A;  3DMU A;  1CZG A;  3VYU A;  4GZY C;  1LV9 A;  4CJ2 C;  1SFO B;  1GUG A;  1DCZ A;  3O13 A;  3KBG A;  5E4W C;  1H9S A;  2XNA C;  2EY1 A;  5JEA H;  4RA8 A;  1AZP A;  3QWN A;  3J81 L;  1F2M A;  1VMP A;  3OIQ A;  4X3K A;  4CJ0 B;  1BO0 A;  1EEI D;  3C46 A;  3SK5 A;  5CV6 A;  1L0Y B;  2ID0 A;  5KIX A;  3KBX A;  2VB3 X;  4K14 A;  5EBD A;  2JA8 B;  2F3W A;  1PFB A;  1U4R A;  5C44 B;  4LAA A;  3ND8 A;  1ET9 A;  3I72 A;  4KV6 A;  5COR A;  1BCP F;  1A3U A;  2CQA A;  2FMC A;  3IFT A;  2IJ0 A;  3G7L A;  1VF7 A;  1MI2 A;  3SR1 A;  4X3U A;  2EE1 A;  4H13 C;  1CQF A;  2PNR C;  1NR2 A;  1TVX A;  3BVG A;  2SNM A;  2B8F A;  2YU9 B;  4IN3 A;  4OO1 I;  4KKT A;  3VR6 A;  2F0P A;  3EJI A;  1GXD C;  4KK7 A;  3Q0A A;  4FXG C;  3K7A B;  2BOS A;  2BE5 D;  3L3O C;  1LO5 D;  1ZXT A;  2PPB C;  4RCO A;  1D2B A;  3S17 B;  1U4M A;  3C2P A;  1PXU A;  2QDB A;  1X3Q A;  1CHQ D;  4XT3 B;  4IFD J;  4F88 A;  4A3G B;  2F0V A;  3HRZ C;  1PTO H;  3D4R A;  3ND9 A;  1T5E A;  3IKJ A;  3PUX A;  1Q8I A;  3DWQ A;  3JAM L;  1E2W A;  5A2Q L;  1A3T A;  2EJM A;  3DEO A;  1ML0 D;  1I4P A;  3S1M B;  4EQN A;  2K5Q A;  2O2L D;  2L1B A;  1Q90 A;  2J0T D;  5CGK A;  3W2D A;  5E4X A;  5K5P A;  4KN7 C;  1JWU D;  2QF7 A;  3J81 E;  1O80 A;  5F2D A;  2FIN B;  2D2C C;  2TSS A;  2RKS A;  3S2D B;  1QG7 A;  3D8G A;  1EFI D;  2X6L A;  5IGB A;  1BCP D;  3S1Q B;  3SE0 A;  2RQX A;  1IYV A;  5I6W A;  2EYM A;  1E0B A;  3NP8 A;  5A35 A;  2NVQ B;  4FF2 A;  1GUO A;  3NSW A;  2L9H A;  1NR4 A;  4HN7 A;  2NBF A;  4DN4 M;  1HTP A;  2HUG A;  2R3Z A;  1QJO A;  1SND A;  1STB A;  3QJY A;  3VA7 A;  1Z7T A;  4RGT A;  4S3S A;  4C2M B;  4DAV A;  5IOC A;  1IYU A;  5FO7 B;  3RMH A;  3PIO 3;  2F1M A;  2XIW A;  1BCP C;  2M9V A;  1SXT A;  1E2Z A;  1VCI A;  1PRT F;  3KF8 A;  4DNT B;  3RD4 A;  3LWU A;  1JOK A;  4BS9 A;  2QCP X;  1GUN A;  2B8G A;  1CI3 M;  4DAY A;  2F4I A;  5C3X A;  1WVL A;  3TSS A;  1EYA A;  4OO1 H;  2LKV A;  5HGT A;  1DOL A;  2OF1 A;  4WRD A;  1KDC A;  3Q22 A;  4AYB B;  1H9J A;  3VR4 A;  5JPM C;  2BDN A;  4MN3 A;  5C6A A;  4ILW A;  3SK4 A;  1CA6 A;  1EY6 A;  2Q8I B;  1I4R A;  3TN2 A;  3J80 E;  1Y8P B;  2RDH A;  5ELF A;  3BG3 A;  3HOV B;  3GP7 A;  1K8O A;  2HDM A;  3PUV A;  5JPN C;  3BDC A;  3JAM E;  3A7A B;  5KRU A;  2OT2 A;  3ZYY X;  1HA5 A;  3FPU B;  1QNK A;  1NAP A;  1EZ6 A;  2DNC A;  2RVL A;  1BF4 A;  1V1P A;  5I9O A;  3P1H A;  4DU9 A;  4A3I B;  2CVR A;  1LT3 D;  2WAC A;  5EQ0 A;  3M85 A;  4KHV A;  3DWP A;  2CHB D;  1XWE A;  1G2S A;  3SK6 A;  1SNO A;  1PZK D;  4J8Q A;  4IFD G;  2NVT B;  2K5W A;  3QG1 A;  1BCP B;  1RKN A;  1AEX A;  4K8I A;  1DOK A;  3HG9 A;  1EWC A;  4ZLT F;  2JXM B;  2KCN A;  3W3A A;  1TII D;  4IUV A;  4A3D B;  2Z1C A;  2E75 C;  2O4X A;  4JBW A;  3L9A X;  1TWF B;  3OPO A;  4QF4 A;  1QCB D;  3OHX C;  3R2I A;  1I6V C;  5EPK A;  4A3F B;  4OGQ C;  3C3L A;  1FNW A;  1PRT D;  5IGE A;  1EYD A;  1TU2 B;  1U9R A;  3MXG A;  5NUC A;  1S5E D;  4LMQ D;  1A2U A;  5T1I A;  5KNB A;  1FYC A;  1BQQ T;  2A69 D;  2KHS A;  4Y7N B;  2N55 A;  1EQT A;  4XYO A;  2A5H A;  4PQX A;  3URY A;  3GTK B;  1QWY A;  2X6G A;  1A3V A;  2F0E A;  5J1Z A;  5C0X J;  1O78 A;  3F2U A;  1D5Z C;  1PRT C;  5C5M A;  5CV9 A;  2SNS A;  4CKC A;  3S9W A;  1BOS A;  1PTO D;  2HCC A;  2RBM A;  3A8K E;  3HP3 A;  3J7A V;  2EY5 A;  1SYE A;  3TP6 A;  3H3V C;  4ODG A;  3P75 A;  3PMF A;  2F0J A;  5KYI A;  4A3B B;  5CV5 A;  3D4D A;  2PMZ B;  3R93 A;  1SDF A;  5K36 G;  2ZXR A;  4IUQ A;  3VR5 A;  3NHH A;  3RZD B;  4C56 C;  1STE A;  2PCF B;  4KD3 A;  3RZO B;  4PNY A;  1B2T A;  3QOJ A;  3HZX A;  4OIJ A;  2TMP A;  2E2I B;  5JVH 3;  3T4A C;  2K5D A;  3HOW B;  4V0B A;  2RSN A;  3LX0 A;  4UDU C;  1SJH D;  1I6H B;  4RKL A;  4G7H C;  4DGZ A;  1PTO C;  3FRP B;  3S14 B;  2JA7 B;  4K6D A;  4G4K A;  1EWH A;  5M9O A;  4KD4 A;  3TZD A;  4FYD A;  3VR2 A;  2FFK B;  1DYQ A;  2NTT A;  1B53 A;  3E5S A;  1F9S A;  1I4H A;  3D3R A;  1STY A;  1HQR D;  1U4P A;  4IFD I;  2DNE A;  4QB4 A;  5C4H A;  3AU7 A;  2A6E D;  2EYH A;  5LL6 X;  2NVX B;  1PFN A;  2AWO A;  1H9R A;  3SDZ A;  1GHJ A;  3AMU A;  4KY7 A;  4NW2 A;  1U4L A;  1HFG A;  1WTX A;  2L0C A;  5M5X B;  2BA1 A;  1DZ1 A;  2G9D A;  3CKI B;  1SYG A;  2ENB A;  2C9O A;  2XRQ D;  2PZT A;  4PMB A;  4QUC A;  2Y0S B;  2Z4H A;  2RSO A;  3M4O B;  1GJX A;  2LS0 1;  1G91 A;  1WTO A;  2EJF C;  3NK9 A;  3TDQ A;  2FMM A;  3A8J E;  5IGC A;  2A6E C;  4QUF A;  4FF3 A;  1ENC A;  1HHV A;  3E0J A;  5DM6 3;  1PTO B;  1TWC B;  1RJT A;  1SBB B;  4XXE A;  3HOU B;  2WAQ B;  2B2V A;  5BN5 A;  3N52 A;  1LTR D;  4ME5 A;  4C3H G;  2HCI A;  2L55 A;  4DF7 A;  4MIU A;  5ELC A;  1ROD A;  1OXS C;  1DXM A;  3T53 B;  3BDL A;  1SNM A;  2EPB A;  1X32 A;  4FVM A;  3CRK C;  2JEA I;  2B2V C;  3WDN A;  1BDO A;  1PFM A;  1SYF A;  4QIW B;  1F2Z A;  2G9H D;  4E6I A;  3R2T A;  1I3Q B;  1HCZ A;  1SE2 A;  3S1N B;  4K2K A;  1D1K A;  2H4O A;  4ZUJ A;  2IW3 A;  4OHJ A;  1CA5 A;  1JC7 A;  4K8J A;  1LLR D;  1QE6 A;  2A68 D;  5FLX L;  3K57 A;  1F9Q A;  1LTS D;  1OXT A;  3MFG A;  3T56 B;  5CYU A;  5E1F A;  4U68 A;  1SE4 A;  3IL8 A;  1QNU A;  1FD7 D;  4X3S A;  5KYL A;  2V4D A;  2IX3 A;  3FKI B;  4IFD H;  1R4P B;  2XRS D;  3A56 A;  1CM9 A;  3DUZ A;  3NWS A;  1Y1W B;  1ICW A;  2R6G A;  1L0X B;  2A68 C;  4O42 A;  2JEB I;  1LT5 D;  3OIP A;  5TSS A;  4KHZ A;  4ZRZ A;  4TQU S;  3KLR A;  3HOY B;  1JWM D;  1HRJ A;  2F0F A;  1BUV T;  1GOZ A;  3TP8 A;  2SDF A;  5JAV A;  1XTC D;  5EKL A;  1A15 A;  3TZU A;  3KLS A;  3GTL B;  2K01 A;  1H9S B;  4K2L A;  1KDA A;  2E2J B;  2WII B;  4RFB A;  4XYQ A;  2M00 A;  3GTJ B;  2F0G A;  1B4O A;  4K5W A;  4IQZ A;  3EA6 A;  1UUP A;  4B08 A;  1EEF D;  2B2T A;  4JK1 C;  4F87 A;  2EYO A;  5AFW A;  1O7Z A;  4DA2 A;  3X3M A;  2JE6 I;  4HAE A;  2KUM A;  3I4L A;  3V05 A;  1EYC A;  3S16 B;  1V1O A;  1SEB D;  2B2T C;  4G57 A;  1ZYR C;  2XWJ B;  1BBX C;  2PYK A;  5E3F A;  4ZAI A;  1F2L A;  1Q1B A;  4N9P A;  1EY7 A;  1D5X C;  2I46 A;  3OWF A;  5JOB A;  2MPM A;  2JYO A;  3MWY W;  1VF5 C;  1TS3 A;  3D4W A;  1Q1E A;  1TS4 A;  1HXY D;  2XSC A;  5IT9 L;  3MZ5 A;  3TME A;  1YNN D;  1QIL A;  4FO2 A;  5C0X I;  1O7Y A;  5FK9 C;  3Q23 A;  5K36 H;  2E2D C;  1MSH A;  2MHV A;  1UEA B;  2F0T A;  1IW7 D;  2KOL A;  4BY1 B;  4XT1 B;  2MGS A;  2B39 A;  4F7X A;  3E6Z X;  1M8A A;  5KND A;  1B9M A;  3TBI B;  2D9U A;  1DOM A;  1XXG A;  4PMW A;  1TKW B;  4C1N K;  2JA6 B;  3FDT A;  2YYZ A;  4B9W A;  5J22 A;  3I4N B;  5D65 A;  3I73 A;  2F0I A;  1LTB D;  1EQV A;  1I50 B;  5DAU A;  2RDG A;  3OW7 A;  1MBY A;  4ZK9 B;  1W6K A;  1YNN C;  2F0K A;  5EGT A;  1NSN S;  1EY5 A;  2IPK D;  4YIJ A;  2K33 A;  4XTC S;  3Q24 A;  2DY7 A;  1HPC A;  2EY2 A;  1TS2 A;  1IW7 C;  4U67 3;  4IUN A;  3OSO A;  1EZ8 A;  4DXF A;  3NPP A;  3PO3 B;  2WB1 B;  1Q3L A;  2A73 B;  4TKO B;  3H6M A;  1RHP A;  1SAP A;  3CU7 A;  5C4J B;  2KA7 A;  2HQE A;  1SYB A;  4KI0 A;  5C4X B;  5A2Q E;  4FP5 D;  3V2T A;  5DEH A;  4RCN A;  4XQN A;  1WD1 A;  4C3I G;  2F03 A;  3MTS A;  2VNU D;  1EU4 A;  3ERO A;  2ZXO A;  3MVV A;  1TS5 A;  1TWA B;  2OEO A;  1UAP A;  1KAA A;  4IAL A;  3VYS A;  3NWT A;  4C3J G;  2IWH A;  4HR7 B;  5G3L F;  4K5X A;  2F0W A;  4KJO A;  5DM7 3;  4EGV A;  2QEJ C;  5T1G A;  1UNS A;  4RHS A;  5M3M B;  5LHY 1;  3VR3 A;  4B9X A;  4HSV A;  5EKK A;  1STG A;  3BVZ A;  4DNR B;  1K8M A;  5COY A;  3RUZ A;  3FMC A;  2Z8L A;  2L11 A;  1D1I A;  1S5B D;  4WJW A;  4DK1 A;  1C8C A;  2IX0 A;  1LT4 D;  3OOC A;  2O5J C;  1ILP A;  5C0X H;  2Q8T A;  3FPP A;  2J4X A;  4IZ8 A;  2EDG A;  4WOR A;  1PDQ A;  2NN6 I;  3NTI A;  2JP1 A;  1FR3 A;  4NDX A;  1WTR A;  3MXP A;  3PUY A;  3A8I E;  5EPL A;  1E2V A;  2Z4I A;  3PIP 3;  1JIC A;  5JVG 3;  1XYI A;  2BCO A;  5EJW A;  4HMI A;  5ELD A;  2A6H C;  1AW7 A;  1RDP D;  2ZXP A;  1V43 A;  1XX8 A;  4BA2 I;  3IFD A;  1IKL A;  1QOH A;  1V1P B;  1IKM A;  5IGF A;  1MSG A;  1EY8 A;  3PUW A;  4R9W A;  1FGB D;  2L5T A;  4CKB A;  3WOE A;  1JCK B;  3QO2 A;  2PZW A;  4IUP A;  5HUR A;  2F0S A;  4X3T A;  1DON A;  2R61 A;  3KK7 A;  4L63 B;  4G7Z C;  4IUT A;  3N6R A;  2NYZ D;  3J7A F;  1V8Q A;  4M8A A;  2AQ3 B;  1B50 A;  4ZKB B;  5EPJ A;  5JJZ A;  1SMY C;  2K05 A;  4XQQ A;  4O1N A;  1IL8 A;  1I4G A;  1AZQ A;  1TT2 A;  3EVQ A;  4HSP A;  4ZQ3 A;  1KDB A;  3BDO A;  1AN8 A;  2GA4 B;  3V96 A;  1CT1 D;  1TQO A;  1G6Z A;  4A3K B;  4LK1 C;  2R92 B;  1PRT B;  1H9M A;  4RAU C;  1S5C D;  4BWG B;  4CJ1 B;  1EY0 A;  5FO9 B;  2EVB A;  5KGU A;  1WTP A;  3GV3 A;  4EQP A;  4HMJ A;  3T51 B;  5IIF A;  5CV8 A;  4ABN A;  5ELB A;  2MJ8 A;  3TP7 A;  3D31 A;  1STA A;  1JOQ A;  1HQM C;  1SYD A;  1W6J A;  3Q6S A;  1BR9 A;  4CBV A;  1LAB A;  1TY2 A;  2VUM B;  1EOT A;  1ENF A;  3H94 A;  4OIK A;  3AB9 A;  2L4N A;  3EFX D;  3NUC A;  2WKD A;  1KTK A;  1KNA A;  1SNQ A;  1SE3 A;  2PW7 A;  4KKU A;  1FNU A;  2OXP A;  1NCV A;  2N88 A;  1S4Z A;  1Y8N B;  2E74 C;  2K03 A;  1GUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...