1WTXA

Hyperthermophile chromosomal protein sac7d single mutant v26a in complex with dna gtaattac
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
b'MVKVKFKYKGEEKEVDTSKIKKVWRAGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*TP*AP*AP*TP*TP*AP*C)-3'
molecule tags Dna binding protein/dna
source organism Sulfolobus acidocaldarius
publication title Probing the DNA kink structure induced by the hyperthermophilic chromosomal protein Sac7d
pubmed doi rcsb
total genus 12
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wtxA00
2FMMA 3TN2A 2RVLA 1G6ZA 1F9QA 4OIKA 4RAUC 1B53A 2FFKB 2K01A 1F9RA 2RSNA 1JE4A 3R93A 1QG7A 2MPMA 3G7LA 1IKLA 4UAIA 3UI2A 5JJZA 1BBXC 2KUMA 1ILQA 1U4RA 2L12A 3QO2A 1AP0A 2J7ZA 1HUNA 1X3QA 2K04A 4RA8A 2SDFA 2B2VC 3GV6A 5E4WC 1HHVA 1C8CA 3Q6SA 2B2YA 1NCVA 4CJ1B 5CMDA 2L11A 2FHTA 4CJ0B 2Q8RE 1ICWA 1B3AA 1AZQA 2HUGA 1RHPA 5DNFA 5D14A 1RTOA 1BF4A 2EOTA 4R9WA 1EIGA 2CVRA 3FPUB 1B2TA 4ZAIA 1ILPA 1WTQA 2KVMA 1G91A 3TZDA 4IUVA 4ZKCB 4ZLTF 2N55A 3SVMA 5EPLA 1NR4A 4OIJA 3HP3A 4HEDA 4X3KA 2KEDA 1RJTA 1EL0A 1O80A 4IUTA 4CJ2C 1HA6A 3FDTA 1A15A 4ZK9B 1QNKA 2B2VA 2MGSA 4NW2A 1DZ1A 2KECA 4X3TA 3LWEA 1PFMA 2X69A 5EPJA 1WTWA 2K03A 1JICA 1X3PA 3I8ZA 3ONAB 5EPKA 1MSHA 1BNZA 1SSOA 1NR2A 2HCIA 4MHEA 1HFNA 2DY7A 5D65A 2B2WA 1B4OA 2X6LA 2EE1A 4IURA 4IUQA 1ZXTA 1WTPA 1X32A 2B2WC 1B50A 3KBXA 1GUWA 5AFWA 1RTNA 1SAPA 2N88A 1VMCA 1J9OA 1F2LA 1F9SA 4X3SA 2FINB 2B2UA 2RA4A 4U68A 1HUMA 1NAPA 2B2YC 4IUPA 1S4ZA 2L1BA 2L9HA 3D6WA 1PDQA 5EQ0A 1AZPA 1EIHA 2VXWA 2IL8A 2X6GA 1LV9A 2D9UA 2K1BA 3MWYW 3P7JA 2XIWA 4O42A 1KNAA 5EKIA 2FJ2A 4ZKBB 4R8IA 2KOLA 1CA6A 2NWGA 1TVXA 1WTVA 3F2UA 1MI2A 1DOMA 1ML0D 2DY8A 1F9PA 5EJWA 5T1IA 5T1GA 2KEEA 1WD1A 5CBEE 1IL8A 1O7ZA 2EPBA 1WTOA 2NZ1D 2L4NA 1WTRA 1HFGA 2HDLA 2HCCA 2B2TC 4HCSA 2HDMA 1DOLA 4IUUA 1BO0A 1PFNA 4QUFA 1KNEA 1QE6A 1MSGA 4LMQD 1DOKA 3IFDA 3H91A 2M2LA 5COYA 4HAEA 1U4LA 5E4XA 3GV3A 2RSOA 1WVLA 1DONA 3KUPA 4DN4M 1ESRA 1VMPA 5CBAE 1RODA 2BDNA 2B2TA 4XT1B 2R3ZA 3I90A 2MP1A 3I3CA 1CM9A 1M8AA 1SDFA 4HSVA 4RWSC 1J8IA 3I91A 1G2TA 2K28A 2JYOA 2MJ8A 1MGSA 1WD0A 1Q3LA 2H1EA 1XYIA 2JP1A 2NYZD 4X3UA 3DEPA 1E0BA 3DM1A 3DEOA 1G2SA 4QUCA 5CORA 1WTXA 2K05A 1EOTA 1IKMA 3IL8A 1XX8A 4MN3A 1O7YA 1HRJA 1CA5A 4XDXA 1U4MA 2B2UC 3N52A 2Q8TA 1PFBA 1U4PA 3MTSA 1PLFA 1EQTA 4XT3B
chains in the Genus database with same CATH superfamily
2OQKA 4OIKA 1LTLA 2RSNA 1STHA 1CK1A 3A5UA 1X9NA 2L12A 2E2JB 5FLXc 4JI8L 1ENAA 2K5DA 3KK7A 2E75C 1TWCH 1C8CA 1MJEA 2ASBA 3GO5A 4BA2I 3DM3A 4LK1C 1VQKA 1Y1WB 2BH8A 3KOJA 1BF4A 3FHWA 5ELCA 4TVAB 1B2TA 4ZAIA 2KQ3A 1VQPA 3TZDA 2F0SA 2LFNA 1CZGA 3KLRA 1EIYB 5C3EG 2IW3A 2E74C 1ASZA 3GTLH 1XMQL 1KL9A 4GOPB 3RMHA 2LS01 2VNUD 1HQRD 5M5WB 3MZ5A 4ZYSA 1ZEQX 1XWEA 4C1NI 5IE8A 5C6AA 1DD2A 3HOWH 1HPCA 2WINB 2Q2HA 3GP7A 2Z8LA 1JMCA 1X3EA 5EGTA 3J81j 5ELNA 1NAPA 2B2YC 2L9HA 3D6WA 4DV6Q 2IL8A 1ASYA 4DNRB 2JK8A 4A75A 3GD7A 3BVMA 3QG1A 1H9SA 3MFYA 5CV7A 4XXEA 3DLLA 4AYBB 3NELA 1PFNA 1QE6A 3H91A 2OEOA 3GV3A 1BBWA 4A3MB 1WVLA 3S1NB 3KLSA 1QZHA 2NN6I 1XPUA 1STAA 1AH9A 3J80i 4L5SA 5C4HA 4BS9A 1SNDA 1CT1D 5KNBA 1MGSA 2C9OA 1JC7A 1VDZA 3V2TA 3PO3G 1SYEA 1IW7D 2Z1CA 1WTXA 1V9PA 4MN3A 4I7AA 2KA7A 1CA5A 2B2UC 3I4NH 1U4PA 2L5TA 5HY6A 1B44D 1PZKD 2O4XA 3NE5B 1LT6D 1TWGB 1D5ZC 4HIOA 5IGBA 1JE4A 1SYFA 1X3FA 3ERSX 5KNDA 4LF8Q 2NUCA 2KJXA 3NBHA 3S15B 4JI7Q 2Z6KC 1RIPA 4GKKQ 4A3GB 1CHQD 2A68D 1KABA 4JVZA 2L11A 1I50H 1XTCD 4LW1A 2N78A 2EJFC 1I4RA 3D0FA 1YITA 4DK1A 2WP8J 1Q8IA 1S5CD 4IPGA 1PH5A 1ET6A 4OO1I 3OYYA 4JI6L 1I94Q 2NVYH 4CDDC 1NTGA 2A5HA 4XQNA 4B9WA 4LFBQ 1XXGA 4A3FG 3IRBA 2D62A 2DGYA 2GVAA 1N33L 4DK0A 3HOVG 3D4RA 2UXDL 3CKIB 1C48A 4JI2L 2NTSA 2PQEA 1PTOB 2JA7B 3HOUH 2G5DA 4DR4Q 3AYHB 1GUWA 2CWPA 1EU4A 1HNZL 2QKIC 3H94A 4DA2A 2I5MX 1F9SA 3CD6A 2I5LX 3PUXA 4A3EH 5IT9E 2RA4A 5JOBA 4L5TA 4ABNA 3F1ZA 5ELEA 1Z6HA 3ND9A 4O1NA 2Z4HA 2RHQB 1D6EC 1V1PA 2KOLA 4HJ7A 4J8QA 3J7AF 3PF4A 1JWSD 1SE4A 1LTBD 2QEJC 4OWWB 4BY7G 1K8MA 2NZ1D 1EYDA 1UE7A 2BA1A 1FD7D 2EYMA 1VQ9A 1PV4A 1SR3A 1H9JA 2H4OA 2QW7A 4DXFA 1SYCA 3RLFA 4DR7L 4DN4M 1VMPA 1HNXL 1YEZA 1JJ2A 4UDUC 1CUKA 3UDGA 3L3OC 5FOBB 5IYCG 2J0TD 4KTAA 1D1KA 1XYIA 3CCMA 5LMNW 2JP1A 1TY0A 4A4IA 3NSWA 4J15A 5CGKA 2EYPA 5M9OA 2A69C 3K7AH 3AB9A 2MUYA 3BVGA 5LMUQ 4KY6A 4DUZL 2JXMB 4CKCA 3GQBA 1VQNA 3K5NA 3URYA 2UU9L 1KAAA 1J6QA 4JOIA 3U50C 3LX0A 1GUTA 2I46A 3WWVA 4V0BA 2D5DA 2Q2UA 3R93A 2XTIA 4POFA 4RKLA 3F2CA 3A74A 1HZAA 1JOOA 4DR3L 1E7ZA 4A3FB 4UY8C 2VY3A 4U673 4A3EB 5ELOA 4EQNA 4TKOB 2E2IH 3T1HL 5A2QE 3D31A 3S17B 4JI0Q 4DR5L 3CXCA 4QCLA 4OWXB 1PYSB 5F2DA 2E76C 4YHHL 4IZ8A 1HZ9A 1XMOQ 2ZT9C 4A3BG 1RTOA 1EY8A 3FPUB 1WTQA 2KVMA 1B9NA 4IUVA 1GD7A 3OMGA 3IKJA 1ZKOA 4FF1A 2OCEA 4J6HA 5DAUA 3W5OA 4HEDA 2ZJRA 5M5XH 3IFTA 2K75A 1EZ8A 2CCZA 1VS0A 1F77A 4POGA 2F0FA 4A3DG 1EQQA 4LFCQ 3HOWB 1NR2A 3T56B 4AYBG 1CQVA 1BR9A 3DUZA 3H3VI 2OXPA 3MXPA 1X65A 1GJXA 1K3RA 1Y14B 3PGZA 3G4SA 3A54A 1Z47A 1A62A 4BY1B 5IY0A 4A3JG 1B70B 1IBLQ 4C2MB 2FINB 2F3WA 1EY0A 2KENA 3K0YA 3MEHA 5EQ0A 5IYBG 4GLVB 1LV9A 4ZKBB 2VZAA 1EWCA 1IBML 2UXBL 1EQRA 2JJQA 2F52A 4DU9A 2EDGA 1WOCA 2KEEA 2J4XA 5K36H 2EPBA 1BCPB 1X6OA 2VQEL 3S17H 3VYSA 1BO0A 1XTDA 4OX9L 2EIFA 3U58A 1HXYD 4QJFA 5COYA 1PTOD 1U0LA 1N36L 1G6PA 3WDNA 1D5XC 1ESRA 1V43A 3HEJA 4XT1B 1PHJA 2MP1A 2HD3A 4A3MH 5JEAH 3MAQA 1TWAB 4RWSC 4JCVE 1QVCA 1N32L 3HOYG 3PO2H 2PW5A 1T5EA 5CV8A 4DV2Q 2EY2A 3HOYH 1VQ8A 3PO2G 4DV1L 3Q22A 3C1EA 3TDQA 2F3VA 3RUZA 4A3BB 1PFBA 3MTSA 5FLXE 1PLFA 3H0GH 5M5WH 4R4TA 2AQ2B 3A8KE 1HTLD 4DV7Q 4ZCKA 2MPMA 1BCPF 5JJZA 1YNND 3S1QH 3S1RH 5M3FG 3QR8A 3ERQA 5I6WA 1GOZA 2UUCQ 4QY7A 1AP0A 2ZXRA 4GNXA 2R92G 5C5LA 3ULPA 3J80L 2B2YA 1B9MA 3JC66 4NMZA 2HQLA 3TP8A 4LFBL 5E1FA 3UE0A 1K83B 2ZXOA 5ELFA 4EQPA 2UUAQ 1GHJA 4LF9Q 1JOKA 2QILA 2EXDA 3K80C 1EEFD 1G91A 1LABA 2MFIA 3A8JE 4F7XA 4ZLTF 1NNXA 3PO3H 2IY5B 3S2HH 1LT3D 1HNWL 4HJ8A 4DNTB 1GUSA 3J7ZC 1LTRD 4KHPL 4R8NA 3J81c 4NW2A 2PMZB 4IJHA 3LWEA 1PMRA 3CPFA 1WTWA 2F0PA 1W6KA 2QGQA 2E5LL 2D0PA 1VQAA 4OGQC 1AE3A 2RDGA 5IP7G 1M4VA 4LFAQ 1EY6A 2B2WA 4JBKA 1B4OA 3RLOA 3OTOL 1A63A 2XWJB 4F8MA 1QZGA 2N88A 4C3IG 1F2LA 4L6TB 2K5WA 3PCOB 1SE8A 1HUMA 3QWNA 3QOJA 1CQFA 4BA1I 1S4ZA 3VDYA 3RD4A 4NB3A 4DV4L 4B3RL 1UE1A 2NWGA 1H95A 1PFSA 1D8LA 3S15H 3X3MA 1PH7A 4C56C 3PMFA 3G6EA 2XN9C 1I50B 5C44G 2K50A 1W6JA 2RSOA 2VL6A 2BH2A 1EQVA 3NTIA 1K8GA 4I7ZC 4CKEA 5AJ3Q 3G6JB 1QB5D 1MJCA 1BKBA 2XRSD 4RGMA 4KJNA 1K3BC 2K5NA 1TS4A 5GAHC 2UU9Q 3R2IA 1BCPC 3NTHA 4QUCA 3E6ZX 1EOTA 1V1OA 4DR3Q 4LF4L 4GKJL 1VQ6A 2IHFA 1PTOH 2JA7H 3J81i 2FFKB 2C35B 2BE5D 3MEFA 3FRPB 5ELBA 4V190 2F4IA 3NP8A 3SGIA 1CTMA 1EEID 1P16A 1HUNA 3KF8B 1W2BA 4G7OC 2IX0A 4A3FH 2HHHQ 4JBMA 1SBBB 1N9WA 5E4WC 4DK6C 2FXQA 1A2UA 1WYDA 3WOFA 1ICWA 1B3AA 3H0GG 2JA8H 3I4MH 4DK3C 5DNFA 2OTLA 1SE2A 4R1JA 3WOEA 3SE0A 3PIP3 3MXGA 2WV6D 4BWGB 4FF3A 2N49A 1RJTA 2B63G 2Y0SG 4C3HB 4HJAA 1S3OA 4DAYA 3OHXC 3M4YA 2KECA 4X3TA 5C0XG 1HFNA 4L63B 3M9BA 1AN8A 5C0XH 4Y7NB 4K8IA 3J7AV 5C5MA 4HIKA 4O2DA 4KHVA 5IIFA 2UUBQ 3KBXA 4UHVA 3MHBA 3U4VA 3CU7A 2XNAC 1IYJB 5EBDA 3E5SA 1J9OA 3CP0A 2VUMB 4LF5L 3I2ZA 4C3HG 3DXJC 2NB0A 4X62Q 3NBIA 2B39A 2XIWA 4M8AA 2HIXA 3HKSA 3F2UA 1JORA 5EJWA 3K58A 1LT5D 3NUCA 5CC4A 3MC0B 4NXMQ 2E2IB 1VF7A 1MKHA 4DR1Q 4EGVA 1XNRL 4GLAC 1D5MC 1K73C 2E2HB 4LMQD 1DOKA 2WAQG 4LJZC 2K5HA 4IOCA 3TS0A 1HTPA 3C3LA 1NJIC 4P72A 1CKOA 1PTOF 2CKZB 1X55A 1C9OA 5LL6X 1A8VA 4HMJA 4JI1Q 3UDIA 2R93B 1CM9A 3NK9A 3SHLA 4YCWA 2L15A 2VB2X 1Q3LA 2IT1A 5IYDH 3UDXA 4C3HH 1KC8C 4WJ3M 1VQGA 1QVFA 5CORA 3W1GA 2JE6I 2A73B 4CBVA 3H0GB 1FGBD 1YNJC 1E2VA 2F1MA 4Z9CB 1UE5A 4IPHA 1KD1C 5BR8Q 4A3BH 1B53A 1I6VC 5JPNC 1VQLA 2PCFB 3E9HA 4FF4A 5IWAL 2Y0SB 1MIUA 1PH6A 1K0RA 2YYZA 4C3JG 3K6OA 2MQHA 3T51B 2UUAL 3OMCA 1E24A 2VW9A 2K7VA 2ZTDA 4IO9A 3EN2A 1AZQA 4JV5L 1JWUD 1KLUD 2EY6A 3PO3B 4H13C 3S2HB 3UE1A 2NZHA 4ALPA 2KHSA 4YCUA 4FP5D 1VQ5A 5M3MH 3SVMA 4X3KA 4A3JH 1Y8OB 5M3FB 3HOZB 2O5IC 4YIJA 1G291 2MGSA 3TREA 3UDFA 1DZ1A 4K6LA 5EPJA 5EPKA 1E22A 1MSHA 1SSOA 4RKBA 2ZM6L 4ID6A 2DY7A 4OHJA 5D65A 1VCIA 3CCRA 1SJHD 3GTQH 1EY4A 2AUJD 2NVQH 1ESFA 4B3RQ 1I4QA 1XJVA 5JPMC 1Q8KA 4OL7A 4R4IA 3RR5A 1PYBA 1EIHA 1QUQA 4JI4L 5L37A 1I94L 3NWSA 4KJOA 3CCSA 2IWHA 1IYUA 5C3EB 3R8BA 2F0QA 4B3SQ 4RCOA 4L5RC 4A3LG 1SXTA 1ICFB 4UP9A 1MSGA 4A3CG 1NBWA 3CQZH 4DAVA 2R61A 2EYLA 3L9AX 4DAPA 1N34Q 4GLXA 3I55A 4A3DB 1HZBA 2CHBD 1DCZA 4S3SA 4LF4Q 4A93G 3E0EA 2B29A 4IFDI 3PF5A 1HZCA 2DJGC 4FDBA 4LAAA 3GTJH 3A56A 1EOVA 3KF6A 1O7YA 5CV4A 1Q81C 2A8VA 1SNCA 4RGTA 4APVA 1SRUA 2Z9HA 1HA5A 1F9QA 2R7FA 1L0XB 2F0TA 3GTQB 3M7NA 3AQQA 1H9MA 2LXJA 2WAQE 1TS2A 2ID0A 2A6HD 4DR2L 1U4RA 1F2YA 2FMCA 1K9MC 1Q1BA 1X3QA 3BDOA 3A8IE 4RG1A 1STBA 2B2VC 3BZCA 4I65A 2DN8A 4JI6Q 3CCVA 3M4PA 2PNHA 4K0KL 3TS2A 3I4OA 2KHIA 2D2CC 2LMCB 1Y1VG 3HKZE 1Y69U 4QMGA 2RDFA 1B3QA 2AWOA 2Y0SE 2A6EC 1STNA 1GVPA 3B6YA 4ZKCB 1K28A 4NPSA 3NEMA 4J1MA 2UXDQ 4K8JA 4JI2Q 1V1PB 3PO2B 3PIOA 4IFDG 4IN3A 2VS1A 5CR3A 1VQJA 3A5ZB 1IHZA 4E6IA 2YU9H 2JA6B 2R7ZH 1A0IA 1LM0A 4NKLA 2VQFQ 2DJFC 1JQYD 3EVQA 2R7ZG 2K4KA 1PRTF 2GVBA 3T1HQ 3EIVA 1HHVA 2WIIB 1O7IA 1YHAA 2VUMH 2HT1A 1ENCA 1SAPA 1VQOA 3S16B 5IYBH 3CAMA 4DR6L 1XMOL 1S5DD 5C4XG 2DNEA 4OELB 5JJKA 2D9UA 2ICEC 1V1QA 3FMCA 4C2MH 4HJ5A 5G3LD 3BDCA 5CV6A 2EY5A 2E2JH 4DR7Q 1YJWA 4KD3A 5T1IA 2I5HA 2K52A 1TT2A 1JOQA 2HCCA 1BDOA 4X66Q 4HSPA 4XYQA 5J1ZA 1H9RA 3ZYYX 2R93H 1DONA 2F0DA 3I4MB 4BBSB 4LF6L 2IX1A 1BBUA 5JVH3 3K8AA 1J8IA 2MJ8A 2Q2TA 4DV3Q 2LY7A 3VYRA 3DEPA 1E0BA 1QOHA 1QUQB 2A19A 3DEOA 4BXXH 3VR3A 4JI3Q 5G3LF 3T1YQ 3I4LA 3IL8A 5IWAQ 1Y1VB 1SJED 4XT3B 1E2WA 2RHSB 4RAUC 1OXUA 4N9TA 5FKAC 4DR5Q 3JAME 1ET9A 1Y1WG 1PRTB 4UAIA 3C1FA 4M1UB 3NQIA 1Z7TA 4YHHQ 2LXKA 4H44C 1N36Q 1GM5A 5H1SE 4XQJA 4ZRZA 1PA6A 1KLGD 1IXRA 5GQOA 2UXCL 2CW0D 4KV6A 4CJ1B 2JEBI 3SEBA 2F0VA 1YHBA 3X3NA 1RHPA 4H7BA 1I4PA 3KF6B 3KLSX 4QF4A 3TP6A 1MHWC 2Z6KA 3PSIA 2ZM6Q 3CCJA 1EL0A 4CJ2C 1G51A 2SNMA 3ITPA 3EROA 4P74A 1ONLA 3HOZH 4KY5A 1X3PA 4B9XA 3I72A 2ATWA 1X56A 4KLKA 2HCIA 4JYAQ 1JJCB 3HRZC 3KYHC 1L0WA 2IJ0A 1SNQA 1K8OA 1X32A 4RHSA 3RZOH 4U68A 4A93B 3DHQA 3F2BA 1HJPA 2ZJQA 3DWPA 4ME5A 1G8ZD 3NPPA 1DOMA 1ML0D 1QVGA 1T9HA 1WD1A 4AQYL 1WTRA 3HG9A 2B2TC 4KHPQ 5IT9L 1XMQQ 3T13A 3KJPA 4KY7A 2BDOA 4EX5A 1FR3A 1VQDA 1IW7C 1IBKQ 2A6HC 3VR5A 2EVBA 3CQZB 3CMEA 3V96A 1CSQA 3GTOH 2KCMA 1TWFH 2XGTA 5FLXL 5JAVA 5IP9H 2MNAA 4C3IB 4BBRH 4B3MQ 2BA0A 4DV7L 2R92H 2B63H 1WCMB 1TS3A 2WKDA 4XDXA 1LTAD 4DR2Q 1TR5A 2K33A 1EQTA 4A3GG 4EQ5A 4H0LC 2NVQB 3JAMc 1EUJA 3UI2A 3TP5A 1SMYC 4K0KQ 1PTOC 1ILQA 3P1HA 4JPBW 1A3UA 2M9VA 1II3A 2E2HH 1L2FA 1TWCB 3QJYA 5JJLA 3STBD 1EYAA 1Y8PB 3M4OH 4X65L 3G71A 1Y1WH 4JBWA 5GAEC 2TSSA 4PMBA 1Q1EA 4MIUA 5LMNQ 1NUCA 3EA6A 3NWTA 3CCQA 4A3DH 4ZK9B 1PH3A 3A55A 1PYWD 2B8FA 5CV5A 3SK4A 1KTKA 1FGUA 2F0WA 2F0LA 3QIAA 4DR6Q 1LUZA 1J5EL 3S14B 1WCMH 4GKKL 4DV4Q 1P8LA 4FXKC 4QIWB 1SFOB 4Y7NH 2H5XA 5KGUA 4N8FA 2IHEA 1AEXA 2EYOA 1R4PB 2L1BA 4PMWA 2VXWA 2OWOA 1D1IA 1C0AA 3M3YB 1EY9A 1V8QA 2XRQD 3SDZA 5I2YA 5JJIA 5I9OA 2DY8A 4WFN3 2I07B 3MFGA 3VR4A 2HDLA 1SROA 3J80c 2V4DA 5M3MB 2F0HA 4DV3L 4IFDJ 1VQHA 3K81C 3U4ZA 2BDNA 2MO1A 5FO7B 5DM63 1PH9A 3I3CA 2UUBL 2EYJA 2JYOA 5IYDG 1NMFA 1R4QB 1SEBD 3PIPA 1CSPA 2P5ZX 4BY7H 4HMIA 3TQYA 1CI3M 4WRDA 3J7YW 4Q5VA 1DYQA 4X62L 2NBFA 4Q0FA 1B7YB 1KHIA 3AFPA 5TSSA 2NVXB 1D7QA 1QCBD 3S1MH 5EBCA 3HOVH 5IGGA 1A3TA 2FMMA 3W3AA 1Y1VH 1C7YA 1SN8A 2PI2E 4O0AA 4WJ4A 2MHVA 3KDFA 1YNXA 4BY1H 2NZOA 1PXUA 1L1OA 3SR1A 2EY1A 5C3EH 4A3EG 5ELDA 3ND8A 2AKWB 1KAWA 2EYFA 2RCFA 1STGA 3QB3A 3PIO3 4DV0L 5NUCA 5HGTA 1Q12A 1W3SA 5E3FA 4OO1H 2EOTA 4TQUS 2CVRA 2OTJA 3I7FA 1HH2P 2YTXA 3I70A 5E7NA 4OWTB 2GN5A 1O78A 3HFZB 1TXYA 3QOLA 4KD4A 1GXDC 4JYAL 2PZWA 1FNUA 5BR8L 3GTJB 1QNKA 1OXSC 5C4XH 4DUYQ 4K6DA 2PZTA 3E9IA 4DFAA 4A3JB 1TQOA 1S5FD 1EYCA 1IYVA 3DMUA 3FKIG 4JI0L 1LTGD 1I5FA 2XVSA 1ZXTA 1B50A 2B2WC 3PUYA 4A93H 1JE5A 3VYUA 1AFPA 3HOUB 1ENFA 1VMCA 4L5QA 2B2UA 1FNVA 2L0CA 4LUOA 1PH4A 1JT8A 2EJMA 4DR1L 1PDQA 1AZPA 1XNRQ 2K1BA 2YV5A 3MWYW 3RZOB 1NSNS 3LGJA 1EWIA 3S1QB 3BZKA 1YIJA 3OWEB 1F9PA 4JW0A 3ULJA 1IBKL 1WTOA 4GOPA 2L4NA 1HFGA 1DOLA 4IUUA 3GTKH 1B1ZA 1Y8NB 2EJGC 3GTPH 1KNEA 4LF8L 1HR0L 1BUVT 1L1OC 4NXNL 1VQ7A 1EWHA 1TWFB 3SXHA 1I4GA 2AUKA 3BDLA 1OTCA 4LF7Q 3I90A 4ZQ3A 1SE3A 3KJOA 1M8AA 4UP7A 2LKVA 2B63B 2NYZD 4KHZA 4RFBA 5C4JB 2F0NA 2E8GA 2IX3A 2K05A 5FK9C 4C3IH 4JI4Q 3N52A 2Q8TA 3EFXD 3SK8A 2K5VA 2F0IA 2R92B 1L0YB 3TMEA 2RVLA 2RBMA 2YTVA 4ZUJA 4JK1C 1E1TA 3CRKC 1STEA 4K5WA 4YY3L 2QCPX 4JV5Q 5C4ZA 3K59A 4P71A 3HKZG 2QEXA 1UEBA 4RA8A 3ULLA 4CGYB 4GNXC 2A69D 1HNZQ 4CJ0B 1PH2A 1N32Q 4A3KG 4FVMA 3S1NH 4HR7B 1Q46A 1KDBA 5C44B 2OT2A 3S2DB 2K5QA 2NN6H 4WORA 5CYUA 5C3WA 4JBJA 2N55A 1A6XA 3TBIB 1O80A 4IUTA 4KKUA 2R93G 1YHQA 4RGOS 3VR2A 4XTCS 3E3XA 4HN7A 2OQ0A 2K03A 3MVVA 4PG3A 4PMCA 4YWMA 3S14H 4LUZA 3H3VH 5GADC 3F2DA 2UUCL 1HNXQ 2YTYA 1BOSA 1FJGL 1EZ6A 4PZ7A 5AFWA 3S24A 3K5LA 2JA5B 4AYBE 3PUZA 4L8JA 1TKWB 1X54A 3KLWA 5LMUL 1SNMA 2PO4A 4DUZQ 4IUNA 2DUDA 1SYDA 1IL8A 1O7ZA 1DXMA 1HQMC 4HCSA 3TSSA 2EXZA 4FF2A 1UE6A 1NE3A 5D3DA 4DV5L 2ZJPA 2E5LQ 2M2LA 2JA6G 1I4HA 2K32A 1SNPA 3M4OB 1S72A 1CHPD 3KF8A 4FNFA 2WKCA 1PVOA 3FVQA 2F03A 3OIQA 2HQEA 3TRZA 1BXTA 3P75A 2HIVA 4QGUA 4A3KB 2KBNA 2EYHA 4JOIC 2PNRC 3KUPA 3M4QA 1WTHA 3TN2A 3EJIA 3S1RB 1F9RA 1HR0W 3Q8DA 3K5OA 1A2TA 2C5CA 4PQXA 4DAYB 1IKLA 4UP8A 1XNQL 4LUVA 1SFOH 1GUNA 5IOCA 5K36G 4GS3A 1I4XA 3TEHB 2J7ZA 4YWKA 2G9HD 4CDFC 3T4AC 1PZID 5AJ3L 2PQAA 2PYKA 3EBEA 3Q6SA 4AH6A 4DNIA 4AIMA 1QNUA 1U9RA 2Q8RE 2KCNA 1K8AC 2AHOB 4JI8Q 3GTMH 4UPAA 4JI5Q 5D14A 4XIGS 5JEAG 1EIGA 5LL6S 2WAQB 1ILPA 1CKNB 1IBMQ 3GTOB 2PPBC 2ES2A 4OIJA 1I6HB 1JR0D 3FDTA 2GA4B 3CHBD 1B8AA 2AWNA 1VQ4A 3ONAB 3GTGB 1JWMD 2OF1A 2F4VQ 4GZYC 3KFUA 5LHY1 1Q7YC 1RDPD 4BY1G 3VR6A 1YVCA 3NHHA 4TSSA 1T5XD 2F0MA 3MXNB 3A7AB 1ZYRD 5CV9A 1F2MA 5C3XA 3RNUA 1FNWA 3BU2A 2JA7G 2WB1G 3I56A 4K2KA 4R8IA 5C0XJ 2NVTH 1CA6A 5GROA 3OSOA 3CCLA 5EKKA 1I3QH 3GTKB 1D2BA 4QL5A 1F2ZA 3E0JA 1Q82C 3D4WA 4QUFA 3TP7A 2ZTCA 1RCVD 4IQZA 1S5BD 1M90C 2I0QA 3IFDA 5M5XB 1KRTA 2F0KA 4JI3L 2BCOA 1LTID 2R3ZA 4MZ9A 5IGDA 1LTTD 5FO8B 3EQLC 3T53B 2K6AA 5M3FH 3D8GA 2F0GA 2B8GA 2RKSA 4YY3Q 1TIID 2EQSA 1YJNA 5DLQE 3HGBA 2XSCA 3M3YH 4JC0A 1EYGA 2K04A 4BBSG 4KKSA 2WACA 1VQFA 2F0UA 2SDFA 3HOXB 1CZWA 5GAGC 3OTOQ 2NVTB 2M00A 1PH8A 1YJ9A 1KQSA 4A76A 1I3QB 2HUGA 4JI7L 3CW2C 4ME3A 5IODA 3S9WA 3V05A 2JA8B 3BVZA 5KYIA 1TWAH 3GTPB 4F88A 4DKAC 3GTLB 1NR4A 1TWHH 2WB1B 3FP9A 3HP3A 5EAYA 5J39A 3HOYB 2B2VA 1YNNC 1PFMA 2PW7A 4P73A 4IFDH 1JICA 3NBHB 4HTHA 3H15A 1RF2D 4A3MG 1IL2A 3BJUA 4KI0A 1BNZA 1OXXK 4GNXB 1UEAB 4B3TL 4YCVA 4DPGA 2WFWA 3P20A 2EE1A 1NMGA 2XWBB 1RL2A 4A3IB 5A2QL 4NP5A 1O7LA 1RTNA 3NXWA 3Q0AA 1X3GA 5KRUA 2CQAA 2VUMG 5FJ8H 1LT4D 3D6CA 2O2LD 3A7LA 4G57A 4AQYQ 1DGSA 3W2DA 4RH6A 2X6GA 4DR4L 2FJ2A 4K2LA 4Y52H 4KN7C 1EY5A 4IPDA 1R9TH 4RHRA 3I4MG 3CF5A 3MA2B 2R6GA 3OWFA 5IP9G 1SYGA 2F3IA 4X64L 3T16A 1GHKA 1OXTA 2R7DA 2QDBA 3CCUA 1C4QA 3L0OA 4G4KA 5CBAE 1VQBA 1XPRA 1RODA 1J5EQ 5I4DA 1VF5C 2HHHL 1UUPA 3CC2A 4R4QA 2RF4A 3OPOA 1SDFA 1GO3E 2Q8IB 3K7UC 3O13A 3GDEA 1STYA 1EY7A 5DM73 3HOWG 2CW0C 2AQ3B 5IT9c 2WB1E 4A3LH 3FPPA 3BYYB 3CCEA 1HRJA 2Q2IA 1XNQQ 4ULLA 5IGFA 3MXUA 4OXPA 4KKTA 1TY2A 4A3KH 1RKNA 1VQCA 1MD2D 2NVXH 3I4NG 3HKZB 1DM0B 1N33Q 3LWUA 4KK7A 5I6YA 5C0XI 4B3SL 3HOVB 3SK6A 1CFMA 1JB3A 2TMPA 2Z0SA 1YI2A 1BBXC 3L2PA 4DGZA 3QO2A 3G48A 4YWLA 4EQOA 5FLMG 4JI5L 3J81L 3U9OA 4C3JB 1N34L 3ER0A 1LTSD 1ZYRC 2CQOA 5IGEA 3L7ZC 3NTKA 5CMDA 2A1AA 5LMNL 2G9DA 1R9TB 4NDXA 3PQIA 3M85A 4LF5Q 1AW7A 4CKBA 1WCMG 3GTMB 1YBYA 4P75A 4FXDA 3DWQA 4CHTB 3H3VC 5C4JH 4BBSH 1RD9D 1TS5A 1H9SB 3OW2A 1BCPD 3RZDB 4PV1C 2AQ1B 1PRTC 1AE2A 2RCNA 3CPWA 5FO9B 5IP7H 3TZUA 2DNCA 3CC7A 2EZVA 5C4XB 4R4CA 5JVG3 3D3RA 5BN5A 5A35A 3C2PA 4ZUIA 1DJRD 2KCTA 3J80E 4FYDA 2CWAA 1GKHA 4KN4C 4KMUC 1Z9FA 4RGNA 3BS1A 1CKMA 3RLNA 1TVXA 1WTVA 3IAYA 4R4OA 1E2ZA 5CBEE 1NY4A 2PZUA 5C44H 4OEMB 3S2DH 3D4DA 4QIWE 5D3IB 3F8TA 4GN3B 3C46A 5KYLA 5E4XA 5KNCA 2VQFL 3JAML 4PNYA 4JG2A 2L55A 2VQEQ 2ZXPA 1PH1A 4K14A 1SMYD 3U9SA 1EFWA 4OX9Q 2V1CC 3NQTA 4HSVA 4PZ6A 1GUOA 1WD0A 2LSSA 3SK5A 1KXLA 1I6HH 4P2CB 3DM1A 3HOUG 2AMCB 1OXVA 1XX8A 1S5ED 3HS0C 2N3SA 1BQQT 2RQXA 2D0OA 4CDEC 1E1OA 3R2TA 1EFID 1N8RC 1PZJD 4OO1G 1Q86C 2K01A 4DV1Q 3H09A 1QG7A 3G7LA 4X66L 1SMXA 1S40A 2IPKD 1OO9B 4HIMA 4LFCL 1HR0Q 2Z6BA 2MO0A 1JJGA 4NXNQ 1YZ6A 4DV0Q 4X6AH 2E2DC 4N8X1 4PZ8A 1H9KA 4LNQA 3HZXA 3A0JA 3GV6A 2KCCA 4A3CH 4LF7L 4G7HC 4DAMA 2JA8G 5M5YH 1NCVA 3OIPA 1IBLL 3OW7A 1WFQA 2F0OA 4BBRG 3R3OA 3NENA 1UAPA 4DUYL 1EIFA 2Z4IA 3BZDB 2ALYB 2UXBQ 3VYTA 1XPOA 2A68C 4EVOA 3BG3A 4XQQA 2JA6H 4B3TQ 5DEHA 2CH4A 1KIXA 2A6ED 1EU3A 2X69A 3ICEA 2F0EA 4A3IG 4LWCA 1HNWQ 4OONA 2YU9B 4A3IH 2BE5C 2R7ZB 1HCZA 2ZTEA 4IURA 4BXXG 4DXGA 3KBGA 2KHJA 3CC4A 2VB3X 1Q90A 1QILA 5HGQA 5K5PA 4ODGA 4DV2L 4X64Q 4IUPA 2JA5H 4LFAL 2JA9A 2O5JC 5JEAJ 3P7JA 5EKIA 1KNAA 1KDCA 4WJWA 3Q24A 4DF7A 5ISRA 4DV6L 1TU2B 2HDMA 3HOXH 3RN2A 5M5YB 4HAEA 1LYLA 1WI5A 1K0SA 2RDHA 2B2TA 2QA4A 2JEAI 1FJGQ 3MXNA 1UNSA 3I91A 2H1EA 3H6MA 1LO5D 3J7A5 1G2SA 4C1NK 2JA5G 4LF9L 3I4NB 1WJJA 3W1BA 2SOBA 4H02A 5IGCA 4ILWA 1TWGH 1U5KA 3J81E 1KRSA 5BN4A 4IJLA 2SNSA 4HCEA 1VQMA 1G6ZA 2ICIA 4HJ9A 4IPCA 3HOXG 4XYOA 3CMAA 2B3GA 4C3JH 2NN6G 4DV5Q 2KUMA 3LNNA 4GKJQ 3N6RA 1KDAA 5I2XA 1YNJD 4QQBX 1GUGA 3K0XA 2QF7A 4MTKA 1LACA 1VQIA 3DWAA 4CDCC 2F0JA 2FHTA 4GN4B 5BN3A 4A3GH 2A74C 4MNOA 3VA5A 3STBC 5I9PA 1E3PA 4B3ML 2NVYB 4R9WA 3M7GA 3I73A 4GN5A 5M3MG 1PRTD 1VQEA 5EPLA 3RZDH 2KEDA 4K5XA 1SLJA 5FJ8G 5KEEA 1HA6A 3PUVA 1A15A 2PI2A 2ENBA 2CFMA 2NTTA 1M1KC 3PV0A 3AFQA 3AMUA 3I8ZA 1IZ6A 3FKIH 4MHEA 2SEBD 4G7ZC 5EKLA 4RMFA 1UWVA 5FLMH 4LF6Q 4BY7B 5KIXA 1QJOA 4RCNA 2X6LA 4MTNA 4IUQA 5HURA 1WTPA 3GTGH 3FEWX 5IYCH 4K5VA 3S1MB 4X3SA 3BYTB 3K57A 1FYCA 3ZJYC 1JCKB 4X65Q 3T1YL 4O42A 1SYBA 4TRDA 1MI2A 4FO2A 2JQOA 5T1GA 5J3BA 4B08A 2JN4A 3AU7A 4FXGC 3CRLC 1FL0A 3OOCA 2CH4W 3RN5A 3KDFB 1JB7A 1U4LA 1TWHB 1BVSA 1L1OB 2BOSA 4NXML 1K83H 1LLRD 2F4VL 3AEVA 3HOZG 2UXCQ 4HIDA 1A3VA 2PQAB 1G2TA 2K28A 2K14A 3PUWA 4F87A 1SNOA 4N9PA 1FVIA 4X3UA 2QDLA 3Q23A 1MBYA 4GOPC 2N8NA 5J22A 1IKMA 3JAMi 4JI1L 1U4MA 2JSOA 2PMZE 4IALA 4BBRB 3K5MA 1CKNA 3FKIB 4QB4A 3K7AB 3VA7A 1QWYA 4IOAA 3S16H
chains in the Genus database with same CATH topology
4OIKA 2RSNA 1STHA 1CK1A 2L12A 2E2JB 1ENAA 2K5DA 3KK7A 2E75C 1C8CA 3GO5A 4BA2I 4LK1C 1Y1WB 1BF4A 5ELCA 1B2TA 4ZAIA 2KQ3A 3TZDA 2F0SA 2LFNA 1CZGA 3KLRA 2IW3A 2E74C 3RMHA 2LS01 2VNUD 1HQRD 5M5WB 3MZ5A 4ZYSA 1ZEQX 1XWEA 4C1NI 5C6AA 1DD2A 1HPCA 2WINB 3GP7A 2Z8LA 5EGTA 1NAPA 2B2YC 2L9HA 3D6WA 2IL8A 4DNRB 3GD7A 3BVMA 3QG1A 1H9SA 3MFYA 5CV7A 4XXEA 4AYBB 1PFNA 1QE6A 3H91A 2OEOA 3GV3A 4A3MB 1WVLA 3S1NB 3KLSA 2NN6I 1STAA 5C4HA 4BS9A 1SNDA 1CT1D 5KNBA 1MGSA 2C9OA 1JC7A 1VDZA 3V2TA 1SYEA 1IW7D 2Z1CA 1WTXA 4MN3A 2KA7A 1CA5A 2B2UC 1U4PA 2L5TA 1B44D 1PZKD 2O4XA 1LT6D 3NE5B 1TWGB 1D5ZC 5IGBA 1JE4A 1SYFA 5KNDA 2NUCA 2KJXA 3NBHA 3S15B 4A3GB 1CHQD 2A68D 1KABA 2L11A 1XTCD 2EJFC 1I4RA 4DK1A 2WP8J 1Q8IA 1S5CD 1ET6A 4OO1I 2A5HA 4XQNA 4B9WA 1XXGA 2D62A 4DK0A 3D4RA 3CKIB 1C48A 2NTSA 2PQEA 1PTOB 2JA7B 1GUWA 1EU4A 2QKIC 3H94A 4DA2A 1F9SA 3PUXA 5IT9E 2RA4A 5JOBA 4ABNA 5ELEA 1Z6HA 3ND9A 4O1NA 2Z4HA 1D6EC 1V1PA 2KOLA 4J8QA 3J7AF 1JWSD 1SE4A 1LTBD 2QEJC 1K8MA 2NZ1D 1EYDA 2BA1A 1FD7D 2EYMA 1H9JA 2H4OA 4DXFA 1SYCA 3RLFA 4DN4M 1VMPA 4UDUC 3L3OC 5FOBB 2J0TD 4KTAA 1D1KA 1XYIA 2JP1A 1TY0A 3NSWA 5CGKA 2EYPA 5M9OA 2A69C 3AB9A 2MUYA 3BVGA 4KY6A 2JXMB 4CKCA 3GQBA 3K5NA 3URYA 1KAAA 3LX0A 1GUTA 2I46A 4V0BA 2D5DA 3R93A 4RKLA 1JOOA 4A3FB 4U673 4A3EB 4EQNA 4TKOB 5A2QE 3D31A 3S17B 4QCLA 5F2DA 2E76C 4IZ8A 2ZT9C 1RTOA 1EY8A 3FPUB 1WTQA 2KVMA 1B9NA 4IUVA 3OMGA 3IKJA 1ZKOA 4FF1A 5DAUA 4J6HA 4HEDA 3IFTA 1EZ8A 1F77A 2F0FA 3HOWB 1NR2A 3T56B 1CQVA 1BR9A 3DUZA 2OXPA 3MXPA 1GJXA 3A54A 1Z47A 4BY1B 4C2MB 2FINB 2F3WA 1EY0A 3K0YA 3MEHA 5EQ0A 1LV9A 4ZKBB 1EWCA 4DU9A 2EDGA 2KEEA 2J4XA 5K36H 2EPBA 1BCPB 3VYSA 1BO0A 1HXYD 5COYA 1PTOD 3WDNA 1D5XC 1ESRA 1V43A 3HEJA 4XT1B 2MP1A 5JEAH 3MAQA 1TWAB 4RWSC 2PW5A 1T5EA 5CV8A 2EY2A 3Q22A 3C1EA 3TDQA 2F3VA 3RUZA 4A3BB 1PFBA 3MTSA 5FLXE 1PLFA 2AQ2B 3A8KE 1HTLD 2MPMA 1BCPF 5JJZA 1YNND 3ERQA 5I6WA 1GOZA 1AP0A 2ZXRA 5C5LA 3J80L 2B2YA 1B9MA 4NMZA 3TP8A 5E1FA 1K83B 2ZXOA 4EQPA 5ELFA 1GHJA 1JOKA 2QILA 1EEFD 1G91A 1LABA 3A8JE 4F7XA 4ZLTF 1LT3D 4DNTB 1GUSA 1LTRD 4R8NA 4NW2A 2PMZB 3LWEA 1PMRA 1WTWA 2F0PA 1W6KA 4OGQC 2RDGA 1M4VA 1EY6A 2B2WA 1B4OA 2XWJB 4F8MA 2N88A 4C3IG 1F2LA 4L6TB 2K5WA 1HUMA 3QWNA 3QOJA 1CQFA 4BA1I 1S4ZA 3RD4A 2NWGA 3X3MA 4C56C 3PMFA 2XN9C 1I50B 1W6JA 2RSOA 1EQVA 3NTIA 4I7ZC 4CKEA 3G6JB 1QB5D 2XRSD 4RGMA 4KJNA 1TS4A 3R2IA 1BCPC 3NTHA 4QUCA 3E6ZX 1EOTA 1V1OA 1PTOH 2FFKB 2BE5D 3FRPB 5ELBA 4V190 2F4IA 3NP8A 1CTMA 1EEID 1HUNA 4G7OC 2IX0A 1SBBB 5E4WC 1A2UA 3WOFA 1ICWA 1B3AA 5DNFA 1SE2A 3PIP3 3SE0A 3WOEA 3MXGA 2WV6D 4BWGB 4FF3A 1RJTA 4C3HB 4DAYA 3OHXC 3M4YA 2KECA 4X3TA 5C0XG 1HFNA 4L63B 1AN8A 5C0XH 4Y7NB 4K8IA 3J7AV 5C5MA 5IIFA 4KHVA 3KBXA 3MHBA 3CU7A 2XNAC 5EBDA 3E5SA 1J9OA 2VUMB 4C3HG 3DXJC 2NB0A 3NBIA 2B39A 2XIWA 4M8AA 3F2UA 1JORA 5EJWA 3K58A 1LT5D 3NUCA 5CC4A 3MC0B 2E2IB 1VF7A 4EGVA 1D5MC 2E2HB 4LMQD 1DOKA 4LJZC 3C3LA 1HTPA 1PTOF 5LL6X 4HMJA 2R93B 1CM9A 3NK9A 3SHLA 2VB2X 1Q3LA 2IT1A 5CORA 2JE6I 2A73B 4CBVA 3H0GB 1FGBD 1YNJC 1E2VA 2F1MA 4Z9CB 1B53A 1I6VC 5JPNC 2PCFB 4FF4A 2Y0SB 2YYZA 4C3JG 3K6OA 3T51B 3OMCA 2K7VA 1AZQA 1JWUD 1KLUD 2EY6A 3PO3B 4H13C 3S2HB 2KHSA 4FP5D 3SVMA 4X3KA 1Y8OB 5M3FB 3HOZB 2O5IC 4YIJA 1G291 2MGSA 1DZ1A 4K6LA 5EPJA 5EPKA 1MSHA 1SSOA 4RKBA 4ID6A 2DY7A 4OHJA 5D65A 1VCIA 1SJHD 1EY4A 2AUJD 1ESFA 1I4QA 5JPMC 4OL7A 1EIHA 3NWSA 4KJOA 2IWHA 1IYUA 5C3EB 3R8BA 2F0QA 4RCOA 1SXTA 1MSGA 4DAVA 2R61A 2EYLA 3L9AX 4DAPA 4A3DB 2CHBD 1DCZA 4S3SA 4IFDI 4LAAA 3A56A 1O7YA 5CV4A 1SNCA 4RGTA 1HA5A 1F9QA 1L0XB 2F0TA 3GTQB 3M7NA 1H9MA 1TS2A 2ID0A 2A6HD 1U4RA 1F2YA 2FMCA 1Q1BA 1X3QA 3BDOA 3A8IE 1STBA 2B2VC 4I65A 2DN8A 2D2CC 2LMCB 1Y69U 4QMGA 2RDFA 2AWOA 2A6EC 1STNA 4ZKCB 4J1MA 4K8JA 1V1PB 3PO2B 4IFDG 4IN3A 5CR3A 4E6IA 1IHZA 2JA6B 4NKLA 1JQYD 3EVQA 1PRTF 1HHVA 2WIIB 1ENCA 1SAPA 3S16B 1S5DD 2DNEA 2D9UA 2ICEC 3FMCA 5G3LD 3BDCA 5CV6A 2EY5A 4KD3A 5T1IA 1TT2A 1JOQA 2HCCA 1BDOA 4HSPA 4XYQA 5J1ZA 1H9RA 3ZYYX 1DONA 2F0DA 3I4MB 4BBSB 2IX1A 5JVH3 1J8IA 2MJ8A 2LY7A 3VYRA 3DEPA 1E0BA 1QOHA 3DEOA 3VR3A 5G3LF 3I4LA 3IL8A 1Y1VB 1SJED 4XT3B 1E2WA 4RAUC 1OXUA 4N9TA 5FKAC 3JAME 1ET9A 1PRTB 4UAIA 3C1FA 4M1UB 3NQIA 1Z7TA 4H44C 4XQJA 4ZRZA 1KLGD 2CW0D 4KV6A 4CJ1B 2JEBI 3SEBA 2F0VA 3X3NA 1RHPA 4H7BA 3TP6A 1I4PA 3KLSX 4QF4A 1EL0A 4CJ2C 2SNMA 3ITPA 3EROA 1ONLA 4KY5A 1X3PA 4B9XA 3I72A 2HCIA 3HRZC 2IJ0A 1SNQA 1K8OA 1X32A 4RHSA 4U68A 4A93B 3DHQA 3DWPA 4ME5A 1G8ZD 3NPPA 1DOMA 1ML0D 1WD1A 1WTRA 3HG9A 2B2TC 5IT9L 3T13A 4KY7A 2BDOA 1FR3A 1IW7C 2A6HC 3VR5A 2EVBA 3CQZB 3V96A 5FLXL 5JAVA 4C3IB 2BA0A 1WCMB 1TS3A 2WKDA 4XDXA 1LTAD 1TR5A 2K33A 1EQTA 4H0LC 2NVQB 3UI2A 3TP5A 1SMYC 1PTOC 1ILQA 3P1HA 1A3UA 2M9VA 1II3A 1TWCB 3QJYA 1EYAA 1Y8PB 4JBWA 2TSSA 4PMBA 1Q1EA 4MIUA 1NUCA 3EA6A 3NWTA 4ZK9B 3A55A 1PYWD 2B8FA 5CV5A 3SK4A 1KTKA 2F0WA 2F0LA 3QIAA 3S14B 4FXKC 4QIWB 1SFOB 5KGUA 1AEXA 2EYOA 1R4PB 2L1BA 4PMWA 2VXWA 1D1IA 3M3YB 1EY9A 1V8QA 2XRQD 3SDZA 5I2YA 5I9OA 2DY8A 4WFN3 2I07B 3MFGA 3VR4A 2HDLA 2V4DA 5M3MB 2F0HA 4IFDJ 2BDNA 5FO7B 5DM63 3I3CA 2EYJA 2JYOA 1R4QB 1SEBD 4HMIA 1CI3M 4WRDA 3J7YW 4Q5VA 1DYQA 2NBFA 4Q0FA 5TSSA 2NVXB 1QCBD 5EBCA 5IGGA 1A3TA 2FMMA 3W3AA 2MHVA 1PXUA 3SR1A 2EY1A 5ELDA 3ND8A 2EYFA 3QB3A 1STGA 3PIO3 5NUCA 5HGTA 1Q12A 5E3FA 4OO1H 2EOTA 4TQUS 2CVRA 3I70A 1O78A 3QOLA 4KD4A 1GXDC 2PZWA 1FNUA 3GTJB 1QNKA 1OXSC 4K6DA 2PZTA 4DFAA 4A3JB 1TQOA 1S5FD 1EYCA 1IYVA 3DMUA 1LTGD 1B50A 2XVSA 1ZXTA 2B2WC 3PUYA 3VYUA 1AFPA 3HOUB 1ENFA 1VMCA 2B2UA 1FNVA 2L0CA 2EJMA 1PDQA 1AZPA 2K1BA 3RZOB 3MWYW 1NSNS 3S1QB 3OWEB 1F9PA 1WTOA 2L4NA 1HFGA 1DOLA 4IUUA 1B1ZA 1Y8NB 2EJGC 1KNEA 1BUVT 1EWHA 1TWFB 3SXHA 1I4GA 2AUKA 3BDLA 3I90A 4ZQ3A 1SE3A 1M8AA 2LKVA 2B63B 2NYZD 4KHZA 4RFBA 5C4JB 2F0NA 2IX3A 2K05A 5FK9C 3N52A 2Q8TA 3EFXD 3SK8A 2R92B 2F0IA 1L0YB 3TMEA 2RVLA 4ZUJA 2RBMA 4JK1C 3CRKC 1STEA 4K5WA 2QCPX 5C4ZA 3K59A 4RA8A 4CGYB 2A69D 4CJ0B 4FVMA 4HR7B 1KDBA 5C44B 2OT2A 3S2DB 2K5QA 2NN6H 4WORA 5CYUA 5C3WA 2N55A 1A6XA 3TBIB 1O80A 4IUTA 4KKUA 4RGOS 3VR2A 4XTCS 4HN7A 2K03A 3MVVA 4PMCA 1BOSA 1EZ6A 5AFWA 3K5LA 2JA5B 3PUZA 4L8JA 1TKWB 1SNMA 2PO4A 4IUNA 1SYDA 1IL8A 1O7ZA 1DXMA 1HQMC 4HCSA 3TSSA 2EXZA 4FF2A 5D3DA 2M2LA 1I4HA 2K32A 1SNPA 3M4OB 1CHPD 3KF8A 4FNFA 2WKCA 3FVQA 2F03A 3OIQA 2HQEA 1BXTA 3P75A 4A3KB 2EYHA 2PNRC 3KUPA 3TN2A 3EJIA 3S1RB 1F9RA 3K5OA 1A2TA 2C5CA 4PQXA 1IKLA 1GUNA 5IOCA 5K36G 1I4XA 2J7ZA 2G9HD 3T4AC 1PZID 2PYKA 3Q6SA 1QNUA 1U9RA 2Q8RE 2KCNA 5D14A 5JEAG 4XIGS 1EIGA 5LL6S 2WAQB 1ILPA 3GTOB 2PPBC 4OIJA 1I6HB 1JR0D 3FDTA 2GA4B 3CHBD 2AWNA 3ONAB 3GTGB 1JWMD 2OF1A 4GZYC 5LHY1 1RDPD 3VR6A 3NHHA 4TSSA 1T5XD 2F0MA 3A7AB 1ZYRD 5CV9A 1F2MA 5C3XA 1FNWA 4K2KA 4R8IA 5C0XJ 1CA6A 3OSOA 5EKKA 3GTKB 1D2BA 1F2ZA 3E0JA 3D4WA 4QUFA 3TP7A 4IQZA 1RCVD 1S5BD 3IFDA 5M5XB 2F0KA 2BCOA 1LTID 2R3ZA 5IGDA 1LTTD 5FO8B 3EQLC 3T53B 2K6AA 3D8GA 2F0GA 2B8GA 2RKSA 1TIID 3HGBA 2XSCA 2K04A 4KKSA 2WACA 2F0UA 2SDFA 3HOXB 1CZWA 2NVTB 2M00A 1I3QB 2HUGA 5IODA 3S9WA 3V05A 2JA8B 3BVZA 5KYIA 3GTPB 4F88A 3GTLB 1NR4A 5J39A 2WB1B 3HP3A 3HOYB 2B2VA 1YNNC 1PFMA 2PW7A 4IFDH 1JICA 4HTHA 1RF2D 4KI0A 1BNZA 1OXXK 1UEAB 3P20A 2EE1A 2XWBB 4A3IB 5A2QL 4NP5A 1O7LA 1RTNA 3NXWA 3Q0AA 5KRUA 2CQAA 1LT4D 3D6CA 2O2LD 3A7LA 4G57A 3W2DA 4RH6A 2X6GA 2FJ2A 4K2LA 4KN7C 1EY5A 4RHRA 3MA2B 2R6GA 3OWFA 1SYGA 3T16A 1GHKA 1OXTA 2QDBA 1C4QA 4G4KA 5CBAE 1RODA 5I4DA 1VF5C 1UUPA 3OPOA 1SDFA 2Q8IB 3O13A 1STYA 1EY7A 5DM73 2CW0C 2AQ3B 3FPPA 3BYYB 1HRJA 4ULLA 5IGFA 3MXUA 4KKTA 1TY2A 1RKNA 1MD2D 3HKZB 1DM0B 3LWUA 4KK7A 5I6YA 5C0XI 3HOVB 3SK6A 1CFMA 1JB3A 2TMPA 1BBXC 4DGZA 3QO2A 4EQOA 3J81L 3U9OA 4C3JB 1LTSD 1ZYRC 5IGEA 3L7ZC 3NTKA 5CMDA 2G9DA 1R9TB 4NDXA 3M85A 1AW7A 4CKBA 3GTMB 4FXDA 3DWQA 4CHTB 3H3VC 1RD9D 1TS5A 1H9SB 1BCPD 3RZDB 4PV1C 2AQ1B 1PRTC 5FO9B 3TZUA 2DNCA 2EZVA 5C4XB 5JVG3 3D3RA 5BN5A 5A35A 3C2PA 4ZUIA 1DJRD 3J80E 4FYDA 4KN4C 4KMUC 4RGNA 3BS1A 1TVXA 1WTVA 3IAYA 1E2ZA 5CBEE 2PZUA 3D4DA 5D3IB 3C46A 5KYLA 5E4XA 5KNCA 3JAML 4PNYA 2L55A 2ZXPA 4K14A 1SMYD 3U9SA 4HSVA 3NQTA 1GUOA 1WD0A 3SK5A 4P2CB 3DM1A 1OXVA 1XX8A 1S5ED 3HS0C 2RQXA 1BQQT 3R2TA 1EFID 1PZJD 4OO1G 2K01A 3H09A 1QG7A 3G7LA 2IPKD 1OO9B 2E2DC 1H9KA 3HZXA 3GV6A 2KCCA 4G7HC 1NCVA 3OIPA 3OW7A 2F0OA 3R3OA 1UAPA 2Z4IA 3BZDB 3VYTA 2A68C 4EVOA 3BG3A 4XQQA 5DEHA 2A6ED 1EU3A 2X69A 2F0EA 2YU9B 2BE5C 2R7ZB 1HCZA 4IURA 4DXGA 3KBGA 2VB3X 1Q90A 1QILA 5K5PA 4ODGA 4IUPA 2O5JC 5JEAJ 3P7JA 5EKIA 1KNAA 1KDCA 4WJWA 3Q24A 4DF7A 5ISRA 1TU2B 2HDMA 5M5YB 4HAEA 2RDHA 2B2TA 2JEAI 3MXNA 1UNSA 3I91A 2H1EA 3H6MA 1LO5D 1G2SA 4C1NK 3I4NB 2SOBA 5IGCA 4ILWA 3J81E 5BN4A 2SNSA 4HCEA 1G6ZA 2ICIA 4XYOA 2NN6G 2KUMA 3LNNA 3N6RA 1KDAA 5I2XA 1YNJD 1GUGA 2QF7A 1LACA 3DWAA 2F0JA 2FHTA 5BN3A 2A74C 3VA5A 5I9PA 2NVYB 4R9WA 3M7GA 3I73A 1PRTD 5EPLA 2KEDA 4K5XA 5KEEA 1HA6A 3PUVA 1A15A 2ENBA 2NTTA 3PV0A 3AMUA 3I8ZA 4MHEA 2SEBD 4G7ZC 5EKLA 4BY7B 5KIXA 1QJOA 4RCNA 2X6LA 4IUQA 5HURA 1WTPA 3FEWX 4K5VA 3S1MB 4X3SA 3BYTB 3K57A 1FYCA 1JCKB 4O42A 1SYBA 4TRDA 1MI2A 4FO2A 5T1GA 4B08A 3AU7A 4FXGC 3CRLC 3OOCA 1U4LA 1TWHB 2BOSA 1LLRD 1A3VA 1G2TA 2K28A 3PUWA 4F87A 1SNOA 4N9PA 4X3UA 3Q23A 1MBYA 5J22A 1IKMA 1U4MA 2JSOA 4BBRB 4IALA 3K5MA 3FKIB 4QB4A 3K7AB 3VA7A 1QWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FMM A;  3TN2 A;  2RVL A;  1G6Z A;  1F9Q A;  4OIK A;  4RAU C;  1B53 A;  2FFK B;  2K01 A;  1F9R A;  2RSN A;  1JE4 A;  3R93 A;  1QG7 A;  2MPM A;  3G7L A;  1IKL A;  4UAI A;  3UI2 A;  5JJZ A;  1BBX C;  2KUM A;  1ILQ A;  1U4R A;  2L12 A;  3QO2 A;  1AP0 A;  2J7Z A;  1HUN A;  1X3Q A;  2K04 A;  4RA8 A;  2SDF A;  2B2V C;  3GV6 A;  5E4W C;  1HHV A;  1C8C A;  3Q6S A;  2B2Y A;  1NCV A;  4CJ1 B;  5CMD A;  2L11 A;  2FHT A;  4CJ0 B;  2Q8R E;  1ICW A;  1B3A A;  1AZQ A;  2HUG A;  1RHP A;  5DNF A;  5D14 A;  1RTO A;  1BF4 A;  2EOT A;  4R9W A;  1EIG A;  2CVR A;  3FPU B;  1B2T A;  4ZAI A;  1ILP A;  1WTQ A;  2KVM A;  1G91 A;  3TZD A;  4IUV A;  4ZKC B;  4ZLT F;  2N55 A;  3SVM A;  5EPL A;  1NR4 A;  4OIJ A;  3HP3 A;  4HED A;  4X3K A;  2KED A;  1RJT A;  1EL0 A;  1O80 A;  4IUT A;  4CJ2 C;  1HA6 A;  3FDT A;  1A15 A;  4ZK9 B;  1QNK A;  2B2V A;  2MGS A;  4NW2 A;  1DZ1 A;  2KEC A;  4X3T A;  3LWE A;  1PFM A;  2X69 A;  5EPJ A;  1WTW A;  2K03 A;  1JIC A;  1X3P A;  3I8Z A;  3ONA B;  5EPK A;  1MSH A;  1BNZ A;  1SSO A;  1NR2 A;  2HCI A;  4MHE A;  1HFN A;  2DY7 A;  5D65 A;  2B2W A;  1B4O A;  2X6L A;  2EE1 A;  4IUR A;  4IUQ A;  1ZXT A;  1WTP A;  1X32 A;  2B2W C;  1B50 A;  3KBX A;  1GUW A;  5AFW A;  1RTN A;  1SAP A;  2N88 A;  1VMC A;  1J9O A;  1F2L A;  1F9S A;  4X3S A;  2FIN B;  2B2U A;  2RA4 A;  4U68 A;  1HUM A;  1NAP A;  2B2Y C;  4IUP A;  1S4Z A;  2L1B A;  2L9H A;  3D6W A;  1PDQ A;  5EQ0 A;  1AZP A;  1EIH A;  2VXW A;  2IL8 A;  2X6G A;  1LV9 A;  2D9U A;  2K1B A;  3MWY W;  3P7J A;  2XIW A;  4O42 A;  1KNA A;  5EKI A;  2FJ2 A;  4ZKB B;  4R8I A;  2KOL A;  1CA6 A;  2NWG A;  1TVX A;  1WTV A;  3F2U A;  1MI2 A;  1DOM A;  1ML0 D;  2DY8 A;  1F9P A;  5EJW A;  5T1I A;  5T1G A;  2KEE A;  1WD1 A;  5CBE E;  1IL8 A;  1O7Z A;  2EPB A;  1WTO A;  2NZ1 D;  2L4N A;  1WTR A;  1HFG A;  2HDL A;  2HCC A;  2B2T C;  4HCS A;  2HDM A;  1DOL A;  4IUU A;  1BO0 A;  1PFN A;  4QUF A;  1KNE A;  1QE6 A;  1MSG A;  4LMQ D;  1DOK A;  3IFD A;  3H91 A;  2M2L A;  5COY A;  4HAE A;  1U4L A;  5E4X A;  3GV3 A;  2RSO A;  1WVL A;  1DON A;  3KUP A;  4DN4 M;  1ESR A;  1VMP A;  5CBA E;  1ROD A;  2BDN A;  2B2T A;  4XT1 B;  2R3Z A;  3I90 A;  2MP1 A;  3I3C A;  1CM9 A;  1M8A A;  1SDF A;  4HSV A;  4RWS C;  1J8I A;  3I91 A;  1G2T A;  2K28 A;  2JYO A;  2MJ8 A;  1MGS A;  1WD0 A;  1Q3L A;  2H1E A;  1XYI A;  2JP1 A;  2NYZ D;  4X3U A;  3DEP A;  1E0B A;  3DM1 A;  3DEO A;  1G2S A;  4QUC A;  5COR A;  1WTX A;  2K05 A;  1EOT A;  1IKM A;  3IL8 A;  1XX8 A;  4MN3 A;  1O7Y A;  1HRJ A;  1CA5 A;  4XDX A;  1U4M A;  2B2U C;  3N52 A;  2Q8T A;  1PFB A;  1U4P A;  3MTS A;  1PLF A;  1EQT A;  4XT3 B; 
#chains in the Genus database with same CATH topology
 2OQK A;  4OIK A;  1LTL A;  2RSN A;  1STH A;  1CK1 A;  3A5U A;  1X9N A;  2L12 A;  2E2J B;  5FLX c;  4JI8 L;  1ENA A;  2K5D A;  3KK7 A;  2E75 C;  1TWC H;  1C8C A;  1MJE A;  2ASB A;  3GO5 A;  4BA2 I;  3DM3 A;  4LK1 C;  1VQK A;  1Y1W B;  2BH8 A;  3KOJ A;  1BF4 A;  3FHW A;  5ELC A;  4TVA B;  1B2T A;  4ZAI A;  2KQ3 A;  1VQP A;  3TZD A;  2F0S A;  2LFN A;  1CZG A;  3KLR A;  1EIY B;  5C3E G;  2IW3 A;  2E74 C;  1ASZ A;  3GTL H;  1XMQ L;  1KL9 A;  4GOP B;  3RMH A;  2LS0 1;  2VNU D;  1HQR D;  5M5W B;  3MZ5 A;  4ZYS A;  1ZEQ X;  1XWE A;  4C1N I;  5IE8 A;  5C6A A;  1DD2 A;  3HOW H;  1HPC A;  2WIN B;  2Q2H A;  3GP7 A;  2Z8L A;  1JMC A;  1X3E A;  5EGT A;  3J81 j;  5ELN A;  1NAP A;  2B2Y C;  2L9H A;  3D6W A;  4DV6 Q;  2IL8 A;  1ASY A;  4DNR B;  2JK8 A;  4A75 A;  3GD7 A;  3BVM A;  3QG1 A;  1H9S A;  3MFY A;  5CV7 A;  4XXE A;  3DLL A;  4AYB B;  3NEL A;  1PFN A;  1QE6 A;  3H91 A;  2OEO A;  3GV3 A;  1BBW A;  4A3M B;  1WVL A;  3S1N B;  3KLS A;  1QZH A;  2NN6 I;  1XPU A;  1STA A;  1AH9 A;  3J80 i;  4L5S A;  5C4H A;  4BS9 A;  1SND A;  1CT1 D;  5KNB A;  1MGS A;  2C9O A;  1JC7 A;  1VDZ A;  3V2T A;  3PO3 G;  1SYE A;  1IW7 D;  2Z1C A;  1WTX A;  1V9P A;  4MN3 A;  4I7A A;  2KA7 A;  1CA5 A;  2B2U C;  3I4N H;  1U4P A;  2L5T A;  5HY6 A;  1B44 D;  1PZK D;  2O4X A;  3NE5 B;  1LT6 D;  1TWG B;  1D5Z C;  4HIO A;  5IGB A;  1JE4 A;  1SYF A;  1X3F A;  3ERS X;  5KND A;  4LF8 Q;  2NUC A;  2KJX A;  3NBH A;  3S15 B;  4JI7 Q;  2Z6K C;  1RIP A;  4GKK Q;  4A3G B;  1CHQ D;  2A68 D;  1KAB A;  4JVZ A;  2L11 A;  1I50 H;  1XTC D;  4LW1 A;  2N78 A;  2EJF C;  1I4R A;  3D0F A;  1YIT A;  4DK1 A;  2WP8 J;  1Q8I A;  1S5C D;  4IPG A;  1PH5 A;  1ET6 A;  4OO1 I;  3OYY A;  4JI6 L;  1I94 Q;  2NVY H;  4CDD C;  1NTG A;  2A5H A;  4XQN A;  4B9W A;  4LFB Q;  1XXG A;  4A3F G;  3IRB A;  2D62 A;  2DGY A;  2GVA A;  1N33 L;  4DK0 A;  3HOV G;  3D4R A;  2UXD L;  3CKI B;  1C48 A;  4JI2 L;  2NTS A;  2PQE A;  1PTO B;  2JA7 B;  3HOU H;  2G5D A;  4DR4 Q;  3AYH B;  1GUW A;  2CWP A;  1EU4 A;  1HNZ L;  2QKI C;  3H94 A;  4DA2 A;  2I5M X;  1F9S A;  3CD6 A;  2I5L X;  3PUX A;  4A3E H;  5IT9 E;  2RA4 A;  5JOB A;  4L5T A;  4ABN A;  3F1Z A;  5ELE A;  1Z6H A;  3ND9 A;  4O1N A;  2Z4H A;  2RHQ B;  1D6E C;  1V1P A;  2KOL A;  4HJ7 A;  4J8Q A;  3J7A F;  3PF4 A;  1JWS D;  1SE4 A;  1LTB D;  2QEJ C;  4OWW B;  4BY7 G;  1K8M A;  2NZ1 D;  1EYD A;  1UE7 A;  2BA1 A;  1FD7 D;  2EYM A;  1VQ9 A;  1PV4 A;  1SR3 A;  1H9J A;  2H4O A;  2QW7 A;  4DXF A;  1SYC A;  3RLF A;  4DR7 L;  4DN4 M;  1VMP A;  1HNX L;  1YEZ A;  1JJ2 A;  4UDU C;  1CUK A;  3UDG A;  3L3O C;  5FOB B;  5IYC G;  2J0T D;  4KTA A;  1D1K A;  1XYI A;  3CCM A;  5LMN W;  2JP1 A;  1TY0 A;  4A4I A;  3NSW A;  4J15 A;  5CGK A;  2EYP A;  5M9O A;  2A69 C;  3K7A H;  3AB9 A;  2MUY A;  3BVG A;  5LMU Q;  4KY6 A;  4DUZ L;  2JXM B;  4CKC A;  3GQB A;  1VQN A;  3K5N A;  3URY A;  2UU9 L;  1KAA A;  1J6Q A;  4JOI A;  3U50 C;  3LX0 A;  1GUT A;  2I46 A;  3WWV A;  4V0B A;  2D5D A;  2Q2U A;  3R93 A;  2XTI A;  4POF A;  4RKL A;  3F2C A;  3A74 A;  1HZA A;  1JOO A;  4DR3 L;  1E7Z A;  4A3F B;  4UY8 C;  2VY3 A;  4U67 3;  4A3E B;  5ELO A;  4EQN A;  4TKO B;  2E2I H;  3T1H L;  5A2Q E;  3D31 A;  3S17 B;  4JI0 Q;  4DR5 L;  3CXC A;  4QCL A;  4OWX B;  1PYS B;  5F2D A;  2E76 C;  4YHH L;  4IZ8 A;  1HZ9 A;  1XMO Q;  2ZT9 C;  4A3B G;  1RTO A;  1EY8 A;  3FPU B;  1WTQ A;  2KVM A;  1B9N A;  4IUV A;  1GD7 A;  3OMG A;  3IKJ A;  1ZKO A;  4FF1 A;  2OCE A;  4J6H A;  5DAU A;  3W5O A;  4HED A;  2ZJR A;  5M5X H;  3IFT A;  2K75 A;  1EZ8 A;  2CCZ A;  1VS0 A;  1F77 A;  4POG A;  2F0F A;  4A3D G;  1EQQ A;  4LFC Q;  3HOW B;  1NR2 A;  3T56 B;  4AYB G;  1CQV A;  1BR9 A;  3DUZ A;  3H3V I;  2OXP A;  3MXP A;  1X65 A;  1GJX A;  1K3R A;  1Y14 B;  3PGZ A;  3G4S A;  3A54 A;  1Z47 A;  1A62 A;  4BY1 B;  5IY0 A;  4A3J G;  1B70 B;  1IBL Q;  4C2M B;  2FIN B;  2F3W A;  1EY0 A;  2KEN A;  3K0Y A;  3MEH A;  5EQ0 A;  5IYB G;  4GLV B;  1LV9 A;  4ZKB B;  2VZA A;  1EWC A;  1IBM L;  2UXB L;  1EQR A;  2JJQ A;  2F52 A;  4DU9 A;  2EDG A;  1WOC A;  2KEE A;  2J4X A;  5K36 H;  2EPB A;  1BCP B;  1X6O A;  2VQE L;  3S17 H;  3VYS A;  1BO0 A;  1XTD A;  4OX9 L;  2EIF A;  3U58 A;  1HXY D;  4QJF A;  5COY A;  1PTO D;  1U0L A;  1N36 L;  1G6P A;  3WDN A;  1D5X C;  1ESR A;  1V43 A;  3HEJ A;  4XT1 B;  1PHJ A;  2MP1 A;  2HD3 A;  4A3M H;  5JEA H;  3MAQ A;  1TWA B;  4RWS C;  4JCV E;  1QVC A;  1N32 L;  3HOY G;  3PO2 H;  2PW5 A;  1T5E A;  5CV8 A;  4DV2 Q;  2EY2 A;  3HOY H;  1VQ8 A;  3PO2 G;  4DV1 L;  3Q22 A;  3C1E A;  3TDQ A;  2F3V A;  3RUZ A;  4A3B B;  1PFB A;  3MTS A;  5FLX E;  1PLF A;  3H0G H;  5M5W H;  4R4T A;  2AQ2 B;  3A8K E;  1HTL D;  4DV7 Q;  4ZCK A;  2MPM A;  1BCP F;  5JJZ A;  1YNN D;  3S1Q H;  3S1R H;  5M3F G;  3QR8 A;  3ERQ A;  5I6W A;  1GOZ A;  2UUC Q;  4QY7 A;  1AP0 A;  2ZXR A;  4GNX A;  2R92 G;  5C5L A;  3ULP A;  3J80 L;  2B2Y A;  1B9M A;  3JC6 6;  4NMZ A;  2HQL A;  3TP8 A;  4LFB L;  5E1F A;  3UE0 A;  1K83 B;  2ZXO A;  5ELF A;  4EQP A;  2UUA Q;  1GHJ A;  4LF9 Q;  1JOK A;  2QIL A;  2EXD A;  3K80 C;  1EEF D;  1G91 A;  1LAB A;  2MFI A;  3A8J E;  4F7X A;  4ZLT F;  1NNX A;  3PO3 H;  2IY5 B;  3S2H H;  1LT3 D;  1HNW L;  4HJ8 A;  4DNT B;  1GUS A;  3J7Z C;  1LTR D;  4KHP L;  4R8N A;  3J81 c;  4NW2 A;  2PMZ B;  4IJH A;  3LWE A;  1PMR A;  3CPF A;  1WTW A;  2F0P A;  1W6K A;  2QGQ A;  2E5L L;  2D0P A;  1VQA A;  4OGQ C;  1AE3 A;  2RDG A;  5IP7 G;  1M4V A;  4LFA Q;  1EY6 A;  2B2W A;  4JBK A;  1B4O A;  3RLO A;  3OTO L;  1A63 A;  2XWJ B;  4F8M A;  1QZG A;  2N88 A;  4C3I G;  1F2L A;  4L6T B;  2K5W A;  3PCO B;  1SE8 A;  1HUM A;  3QWN A;  3QOJ A;  1CQF A;  4BA1 I;  1S4Z A;  3VDY A;  3RD4 A;  4NB3 A;  4DV4 L;  4B3R L;  1UE1 A;  2NWG A;  1H95 A;  1PFS A;  1D8L A;  3S15 H;  3X3M A;  1PH7 A;  4C56 C;  3PMF A;  3G6E A;  2XN9 C;  1I50 B;  5C44 G;  2K50 A;  1W6J A;  2RSO A;  2VL6 A;  2BH2 A;  1EQV A;  3NTI A;  1K8G A;  4I7Z C;  4CKE A;  5AJ3 Q;  3G6J B;  1QB5 D;  1MJC A;  1BKB A;  2XRS D;  4RGM A;  4KJN A;  1K3B C;  2K5N A;  1TS4 A;  5GAH C;  2UU9 Q;  3R2I A;  1BCP C;  3NTH A;  4QUC A;  3E6Z X;  1EOT A;  1V1O A;  4DR3 Q;  4LF4 L;  4GKJ L;  1VQ6 A;  2IHF A;  1PTO H;  2JA7 H;  3J81 i;  2FFK B;  2C35 B;  2BE5 D;  3MEF A;  3FRP B;  5ELB A;  4V19 0;  2F4I A;  3NP8 A;  3SGI A;  1CTM A;  1EEI D;  1P16 A;  1HUN A;  3KF8 B;  1W2B A;  4G7O C;  2IX0 A;  4A3F H;  2HHH Q;  4JBM A;  1SBB B;  1N9W A;  5E4W C;  4DK6 C;  2FXQ A;  1A2U A;  1WYD A;  3WOF A;  1ICW A;  1B3A A;  3H0G G;  2JA8 H;  3I4M H;  4DK3 C;  5DNF A;  2OTL A;  1SE2 A;  4R1J A;  3WOE A;  3SE0 A;  3PIP 3;  3MXG A;  2WV6 D;  4BWG B;  4FF3 A;  2N49 A;  1RJT A;  2B63 G;  2Y0S G;  4C3H B;  4HJA A;  1S3O A;  4DAY A;  3OHX C;  3M4Y A;  2KEC A;  4X3T A;  5C0X G;  1HFN A;  4L63 B;  3M9B A;  1AN8 A;  5C0X H;  4Y7N B;  4K8I A;  3J7A V;  5C5M A;  4HIK A;  4O2D A;  4KHV A;  5IIF A;  2UUB Q;  3KBX A;  4UHV A;  3MHB A;  3U4V A;  3CU7 A;  2XNA C;  1IYJ B;  5EBD A;  3E5S A;  1J9O A;  3CP0 A;  2VUM B;  4LF5 L;  3I2Z A;  4C3H G;  3DXJ C;  2NB0 A;  4X62 Q;  3NBI A;  2B39 A;  2XIW A;  4M8A A;  2HIX A;  3HKS A;  3F2U A;  1JOR A;  5EJW A;  3K58 A;  1LT5 D;  3NUC A;  5CC4 A;  3MC0 B;  4NXM Q;  2E2I B;  1VF7 A;  1MKH A;  4DR1 Q;  4EGV A;  1XNR L;  4GLA C;  1D5M C;  1K73 C;  2E2H B;  4LMQ D;  1DOK A;  2WAQ G;  4LJZ C;  2K5H A;  4IOC A;  3TS0 A;  1HTP A;  3C3L A;  1NJI C;  4P72 A;  1CKO A;  1PTO F;  2CKZ B;  1X55 A;  1C9O A;  5LL6 X;  1A8V A;  4HMJ A;  4JI1 Q;  3UDI A;  2R93 B;  1CM9 A;  3NK9 A;  3SHL A;  4YCW A;  2L15 A;  2VB2 X;  1Q3L A;  2IT1 A;  5IYD H;  3UDX A;  4C3H H;  1KC8 C;  4WJ3 M;  1VQG A;  1QVF A;  5COR A;  3W1G A;  2JE6 I;  2A73 B;  4CBV A;  3H0G B;  1FGB D;  1YNJ C;  1E2V A;  2F1M A;  4Z9C B;  1UE5 A;  4IPH A;  1KD1 C;  5BR8 Q;  4A3B H;  1B53 A;  1I6V C;  5JPN C;  1VQL A;  2PCF B;  3E9H A;  4FF4 A;  5IWA L;  2Y0S B;  1MIU A;  1PH6 A;  1K0R A;  2YYZ A;  4C3J G;  3K6O A;  2MQH A;  3T51 B;  2UUA L;  3OMC A;  1E24 A;  2VW9 A;  2K7V A;  2ZTD A;  4IO9 A;  3EN2 A;  1AZQ A;  4JV5 L;  1JWU D;  1KLU D;  2EY6 A;  3PO3 B;  4H13 C;  3S2H B;  3UE1 A;  2NZH A;  4ALP A;  2KHS A;  4YCU A;  4FP5 D;  1VQ5 A;  5M3M H;  3SVM A;  4X3K A;  4A3J H;  1Y8O B;  5M3F B;  3HOZ B;  2O5I C;  4YIJ A;  1G29 1;  2MGS A;  3TRE A;  3UDF A;  1DZ1 A;  4K6L A;  5EPJ A;  5EPK A;  1E22 A;  1MSH A;  1SSO A;  4RKB A;  2ZM6 L;  4ID6 A;  2DY7 A;  4OHJ A;  5D65 A;  1VCI A;  3CCR A;  1SJH D;  3GTQ H;  1EY4 A;  2AUJ D;  2NVQ H;  1ESF A;  4B3R Q;  1I4Q A;  1XJV A;  5JPM C;  1Q8K A;  4OL7 A;  4R4I A;  3RR5 A;  1PYB A;  1EIH A;  1QUQ A;  4JI4 L;  5L37 A;  1I94 L;  3NWS A;  4KJO A;  3CCS A;  2IWH A;  1IYU A;  5C3E B;  3R8B A;  2F0Q A;  4B3S Q;  4RCO A;  4L5R C;  4A3L G;  1SXT A;  1ICF B;  4UP9 A;  1MSG A;  4A3C G;  1NBW A;  3CQZ H;  4DAV A;  2R61 A;  2EYL A;  3L9A X;  4DAP A;  1N34 Q;  4GLX A;  3I55 A;  4A3D B;  1HZB A;  2CHB D;  1DCZ A;  4S3S A;  4LF4 Q;  4A93 G;  3E0E A;  2B29 A;  4IFD I;  3PF5 A;  1HZC A;  2DJG C;  4FDB A;  4LAA A;  3GTJ H;  3A56 A;  1EOV A;  3KF6 A;  1O7Y A;  5CV4 A;  1Q81 C;  2A8V A;  1SNC A;  4RGT A;  4APV A;  1SRU A;  2Z9H A;  1HA5 A;  1F9Q A;  2R7F A;  1L0X B;  2F0T A;  3GTQ B;  3M7N A;  3AQQ A;  1H9M A;  2LXJ A;  2WAQ E;  1TS2 A;  2ID0 A;  2A6H D;  4DR2 L;  1U4R A;  1F2Y A;  2FMC A;  1K9M C;  1Q1B A;  1X3Q A;  3BDO A;  3A8I E;  4RG1 A;  1STB A;  2B2V C;  3BZC A;  4I65 A;  2DN8 A;  4JI6 Q;  3CCV A;  3M4P A;  2PNH A;  4K0K L;  3TS2 A;  3I4O A;  2KHI A;  2D2C C;  2LMC B;  1Y1V G;  3HKZ E;  1Y69 U;  4QMG A;  2RDF A;  1B3Q A;  2AWO A;  2Y0S E;  2A6E C;  1STN A;  1GVP A;  3B6Y A;  4ZKC B;  1K28 A;  4NPS A;  3NEM A;  4J1M A;  2UXD Q;  4K8J A;  4JI2 Q;  1V1P B;  3PO2 B;  3PIO A;  4IFD G;  4IN3 A;  2VS1 A;  5CR3 A;  1VQJ A;  3A5Z B;  1IHZ A;  4E6I A;  2YU9 H;  2JA6 B;  2R7Z H;  1A0I A;  1LM0 A;  4NKL A;  2VQF Q;  2DJF C;  1JQY D;  3EVQ A;  2R7Z G;  2K4K A;  1PRT F;  2GVB A;  3T1H Q;  3EIV A;  1HHV A;  2WII B;  1O7I A;  1YHA A;  2VUM H;  2HT1 A;  1ENC A;  1SAP A;  1VQO A;  3S16 B;  5IYB H;  3CAM A;  4DR6 L;  1XMO L;  1S5D D;  5C4X G;  2DNE A;  4OEL B;  5JJK A;  2D9U A;  2ICE C;  1V1Q A;  3FMC A;  4C2M H;  4HJ5 A;  5G3L D;  3BDC A;  5CV6 A;  2EY5 A;  2E2J H;  4DR7 Q;  1YJW A;  4KD3 A;  5T1I A;  2I5H A;  2K52 A;  1TT2 A;  1JOQ A;  2HCC A;  1BDO A;  4X66 Q;  4HSP A;  4XYQ A;  5J1Z A;  1H9R A;  3ZYY X;  2R93 H;  1DON A;  2F0D A;  3I4M B;  4BBS B;  4LF6 L;  2IX1 A;  1BBU A;  5JVH 3;  3K8A A;  1J8I A;  2MJ8 A;  2Q2T A;  4DV3 Q;  2LY7 A;  3VYR A;  3DEP A;  1E0B A;  1QOH A;  1QUQ B;  2A19 A;  3DEO A;  4BXX H;  3VR3 A;  4JI3 Q;  5G3L F;  3T1Y Q;  3I4L A;  3IL8 A;  5IWA Q;  1Y1V B;  1SJE D;  4XT3 B;  1E2W A;  2RHS B;  4RAU C;  1OXU A;  4N9T A;  5FKA C;  4DR5 Q;  3JAM E;  1ET9 A;  1Y1W G;  1PRT B;  4UAI A;  3C1F A;  4M1U B;  3NQI A;  1Z7T A;  4YHH Q;  2LXK A;  4H44 C;  1N36 Q;  1GM5 A;  5H1S E;  4XQJ A;  4ZRZ A;  1PA6 A;  1KLG D;  1IXR A;  5GQO A;  2UXC L;  2CW0 D;  4KV6 A;  4CJ1 B;  2JEB I;  3SEB A;  2F0V A;  1YHB A;  3X3N A;  1RHP A;  4H7B A;  1I4P A;  3KF6 B;  3KLS X;  4QF4 A;  3TP6 A;  1MHW C;  2Z6K A;  3PSI A;  2ZM6 Q;  3CCJ A;  1EL0 A;  4CJ2 C;  1G51 A;  2SNM A;  3ITP A;  3ERO A;  4P74 A;  1ONL A;  3HOZ H;  4KY5 A;  1X3P A;  4B9X A;  3I72 A;  2ATW A;  1X56 A;  4KLK A;  2HCI A;  4JYA Q;  1JJC B;  3HRZ C;  3KYH C;  1L0W A;  2IJ0 A;  1SNQ A;  1K8O A;  1X32 A;  4RHS A;  3RZO H;  4U68 A;  4A93 B;  3DHQ A;  3F2B A;  1HJP A;  2ZJQ A;  3DWP A;  4ME5 A;  1G8Z D;  3NPP A;  1DOM A;  1ML0 D;  1QVG A;  1T9H A;  1WD1 A;  4AQY L;  1WTR A;  3HG9 A;  2B2T C;  4KHP Q;  5IT9 L;  1XMQ Q;  3T13 A;  3KJP A;  4KY7 A;  2BDO A;  4EX5 A;  1FR3 A;  1VQD A;  1IW7 C;  1IBK Q;  2A6H C;  3VR5 A;  2EVB A;  3CQZ B;  3CME A;  3V96 A;  1CSQ A;  3GTO H;  2KCM A;  1TWF H;  2XGT A;  5FLX L;  5JAV A;  5IP9 H;  2MNA A;  4C3I B;  4BBR H;  4B3M Q;  2BA0 A;  4DV7 L;  2R92 H;  2B63 H;  1WCM B;  1TS3 A;  2WKD A;  4XDX A;  1LTA D;  4DR2 Q;  1TR5 A;  2K33 A;  1EQT A;  4A3G G;  4EQ5 A;  4H0L C;  2NVQ B;  3JAM c;  1EUJ A;  3UI2 A;  3TP5 A;  1SMY C;  4K0K Q;  1PTO C;  1ILQ A;  3P1H A;  4JPB W;  1A3U A;  2M9V A;  1II3 A;  2E2H H;  1L2F A;  1TWC B;  3QJY A;  5JJL A;  3STB D;  1EYA A;  1Y8P B;  3M4O H;  4X65 L;  3G71 A;  1Y1W H;  4JBW A;  5GAE C;  2TSS A;  4PMB A;  1Q1E A;  4MIU A;  5LMN Q;  1NUC A;  3EA6 A;  3NWT A;  3CCQ A;  4A3D H;  4ZK9 B;  1PH3 A;  3A55 A;  1PYW D;  2B8F A;  5CV5 A;  3SK4 A;  1KTK A;  1FGU A;  2F0W A;  2F0L A;  3QIA A;  4DR6 Q;  1LUZ A;  1J5E L;  3S14 B;  1WCM H;  4GKK L;  4DV4 Q;  1P8L A;  4FXK C;  4QIW B;  1SFO B;  4Y7N H;  2H5X A;  5KGU A;  4N8F A;  2IHE A;  1AEX A;  2EYO A;  1R4P B;  2L1B A;  4PMW A;  2VXW A;  2OWO A;  1D1I A;  1C0A A;  3M3Y B;  1EY9 A;  1V8Q A;  2XRQ D;  3SDZ A;  5I2Y A;  5JJI A;  5I9O A;  2DY8 A;  4WFN 3;  2I07 B;  3MFG A;  3VR4 A;  2HDL A;  1SRO A;  3J80 c;  2V4D A;  5M3M B;  2F0H A;  4DV3 L;  4IFD J;  1VQH A;  3K81 C;  3U4Z A;  2BDN A;  2MO1 A;  5FO7 B;  5DM6 3;  1PH9 A;  3I3C A;  2UUB L;  2EYJ A;  2JYO A;  5IYD G;  1NMF A;  1R4Q B;  1SEB D;  3PIP A;  1CSP A;  2P5Z X;  4BY7 H;  4HMI A;  3TQY A;  1CI3 M;  4WRD A;  3J7Y W;  4Q5V A;  1DYQ A;  4X62 L;  2NBF A;  4Q0F A;  1B7Y B;  1KHI A;  3AFP A;  5TSS A;  2NVX B;  1D7Q A;  1QCB D;  3S1M H;  5EBC A;  3HOV H;  5IGG A;  1A3T A;  2FMM A;  3W3A A;  1Y1V H;  1C7Y A;  1SN8 A;  2PI2 E;  4O0A A;  4WJ4 A;  2MHV A;  3KDF A;  1YNX A;  4BY1 H;  2NZO A;  1PXU A;  1L1O A;  3SR1 A;  2EY1 A;  5C3E H;  4A3E G;  5ELD A;  3ND8 A;  2AKW B;  1KAW A;  2EYF A;  2RCF A;  1STG A;  3QB3 A;  3PIO 3;  4DV0 L;  5NUC A;  5HGT A;  1Q12 A;  1W3S A;  5E3F A;  4OO1 H;  2EOT A;  4TQU S;  2CVR A;  2OTJ A;  3I7F A;  1HH2 P;  2YTX A;  3I70 A;  5E7N A;  4OWT B;  2GN5 A;  1O78 A;  3HFZ B;  1TXY A;  3QOL A;  4KD4 A;  1GXD C;  4JYA L;  2PZW A;  1FNU A;  5BR8 L;  3GTJ B;  1QNK A;  1OXS C;  5C4X H;  4DUY Q;  4K6D A;  2PZT A;  3E9I A;  4DFA A;  4A3J B;  1TQO A;  1S5F D;  1EYC A;  1IYV A;  3DMU A;  3FKI G;  4JI0 L;  1LTG D;  1I5F A;  2XVS A;  1ZXT A;  1B50 A;  2B2W C;  3PUY A;  4A93 H;  1JE5 A;  3VYU A;  1AFP A;  3HOU B;  1ENF A;  1VMC A;  4L5Q A;  2B2U A;  1FNV A;  2L0C A;  4LUO A;  1PH4 A;  1JT8 A;  2EJM A;  4DR1 L;  1PDQ A;  1AZP A;  1XNR Q;  2K1B A;  2YV5 A;  3MWY W;  3RZO B;  1NSN S;  3LGJ A;  1EWI A;  3S1Q B;  3BZK A;  1YIJ A;  3OWE B;  1F9P A;  4JW0 A;  3ULJ A;  1IBK L;  1WTO A;  4GOP A;  2L4N A;  1HFG A;  1DOL A;  4IUU A;  3GTK H;  1B1Z A;  1Y8N B;  2EJG C;  3GTP H;  1KNE A;  4LF8 L;  1HR0 L;  1BUV T;  1L1O C;  4NXN L;  1VQ7 A;  1EWH A;  1TWF B;  3SXH A;  1I4G A;  2AUK A;  3BDL A;  1OTC A;  4LF7 Q;  3I90 A;  4ZQ3 A;  1SE3 A;  3KJO A;  1M8A A;  4UP7 A;  2LKV A;  2B63 B;  2NYZ D;  4KHZ A;  4RFB A;  5C4J B;  2F0N A;  2E8G A;  2IX3 A;  2K05 A;  5FK9 C;  4C3I H;  4JI4 Q;  3N52 A;  2Q8T A;  3EFX D;  3SK8 A;  2K5V A;  2F0I A;  2R92 B;  1L0Y B;  3TME A;  2RVL A;  2RBM A;  2YTV A;  4ZUJ A;  4JK1 C;  1E1T A;  3CRK C;  1STE A;  4K5W A;  4YY3 L;  2QCP X;  4JV5 Q;  5C4Z A;  3K59 A;  4P71 A;  3HKZ G;  2QEX A;  1UEB A;  4RA8 A;  3ULL A;  4CGY B;  4GNX C;  2A69 D;  1HNZ Q;  4CJ0 B;  1PH2 A;  1N32 Q;  4A3K G;  4FVM A;  3S1N H;  4HR7 B;  1Q46 A;  1KDB A;  5C44 B;  2OT2 A;  3S2D B;  2K5Q A;  2NN6 H;  4WOR A;  5CYU A;  5C3W A;  4JBJ A;  2N55 A;  1A6X A;  3TBI B;  1O80 A;  4IUT A;  4KKU A;  2R93 G;  1YHQ A;  4RGO S;  3VR2 A;  4XTC S;  3E3X A;  4HN7 A;  2OQ0 A;  2K03 A;  3MVV A;  4PG3 A;  4PMC A;  4YWM A;  3S14 H;  4LUZ A;  3H3V H;  5GAD C;  3F2D A;  2UUC L;  1HNX Q;  2YTY A;  1BOS A;  1FJG L;  1EZ6 A;  4PZ7 A;  5AFW A;  3S24 A;  3K5L A;  2JA5 B;  4AYB E;  3PUZ A;  4L8J A;  1TKW B;  1X54 A;  3KLW A;  5LMU L;  1SNM A;  2PO4 A;  4DUZ Q;  4IUN A;  2DUD A;  1SYD A;  1IL8 A;  1O7Z A;  1DXM A;  1HQM C;  4HCS A;  3TSS A;  2EXZ A;  4FF2 A;  1UE6 A;  1NE3 A;  5D3D A;  4DV5 L;  2ZJP A;  2E5L Q;  2M2L A;  2JA6 G;  1I4H A;  2K32 A;  1SNP A;  3M4O B;  1S72 A;  1CHP D;  3KF8 A;  4FNF A;  2WKC A;  1PVO A;  3FVQ A;  2F03 A;  3OIQ A;  2HQE A;  3TRZ A;  1BXT A;  3P75 A;  2HIV A;  4QGU A;  4A3K B;  2KBN A;  2EYH A;  4JOI C;  2PNR C;  3KUP A;  3M4Q A;  1WTH A;  3TN2 A;  3EJI A;  3S1R B;  1F9R A;  1HR0 W;  3Q8D A;  3K5O A;  1A2T A;  2C5C A;  4PQX A;  4DAY B;  1IKL A;  4UP8 A;  1XNQ L;  4LUV A;  1SFO H;  1GUN A;  5IOC A;  5K36 G;  4GS3 A;  1I4X A;  3TEH B;  2J7Z A;  4YWK A;  2G9H D;  4CDF C;  3T4A C;  1PZI D;  5AJ3 L;  2PQA A;  2PYK A;  3EBE A;  3Q6S A;  4AH6 A;  4DNI A;  4AIM A;  1QNU A;  1U9R A;  2Q8R E;  2KCN A;  1K8A C;  2AHO B;  4JI8 Q;  3GTM H;  4UPA A;  4JI5 Q;  5D14 A;  4XIG S;  5JEA G;  1EIG A;  5LL6 S;  2WAQ B;  1ILP A;  1CKN B;  1IBM Q;  3GTO B;  2PPB C;  2ES2 A;  4OIJ A;  1I6H B;  1JR0 D;  3FDT A;  2GA4 B;  3CHB D;  1B8A A;  2AWN A;  1VQ4 A;  3ONA B;  3GTG B;  1JWM D;  2OF1 A;  2F4V Q;  4GZY C;  3KFU A;  5LHY 1;  1Q7Y C;  1RDP D;  4BY1 G;  3VR6 A;  1YVC A;  3NHH A;  4TSS A;  1T5X D;  2F0M A;  3MXN B;  3A7A B;  1ZYR D;  5CV9 A;  1F2M A;  5C3X A;  3RNU A;  1FNW A;  3BU2 A;  2JA7 G;  2WB1 G;  3I56 A;  4K2K A;  4R8I A;  5C0X J;  2NVT H;  1CA6 A;  5GRO A;  3OSO A;  3CCL A;  5EKK A;  1I3Q H;  3GTK B;  1D2B A;  4QL5 A;  1F2Z A;  3E0J A;  1Q82 C;  3D4W A;  4QUF A;  3TP7 A;  2ZTC A;  1RCV D;  4IQZ A;  1S5B D;  1M90 C;  2I0Q A;  3IFD A;  5M5X B;  1KRT A;  2F0K A;  4JI3 L;  2BCO A;  1LTI D;  2R3Z A;  4MZ9 A;  5IGD A;  1LTT D;  5FO8 B;  3EQL C;  3T53 B;  2K6A A;  5M3F H;  3D8G A;  2F0G A;  2B8G A;  2RKS A;  4YY3 Q;  1TII D;  2EQS A;  1YJN A;  5DLQ E;  3HGB A;  2XSC A;  3M3Y H;  4JC0 A;  1EYG A;  2K04 A;  4BBS G;  4KKS A;  2WAC A;  1VQF A;  2F0U A;  2SDF A;  3HOX B;  1CZW A;  5GAG C;  3OTO Q;  2NVT B;  2M00 A;  1PH8 A;  1YJ9 A;  1KQS A;  4A76 A;  1I3Q B;  2HUG A;  4JI7 L;  3CW2 C;  4ME3 A;  5IOD A;  3S9W A;  3V05 A;  2JA8 B;  3BVZ A;  5KYI A;  1TWA H;  3GTP B;  4F88 A;  4DKA C;  3GTL B;  1NR4 A;  1TWH H;  2WB1 B;  3FP9 A;  3HP3 A;  5EAY A;  5J39 A;  3HOY B;  2B2V A;  1YNN C;  1PFM A;  2PW7 A;  4P73 A;  4IFD H;  1JIC A;  3NBH B;  4HTH A;  3H15 A;  1RF2 D;  4A3M G;  1IL2 A;  3BJU A;  4KI0 A;  1BNZ A;  1OXX K;  4GNX B;  1UEA B;  4B3T L;  4YCV A;  4DPG A;  2WFW A;  3P20 A;  2EE1 A;  1NMG A;  2XWB B;  1RL2 A;  4A3I B;  5A2Q L;  4NP5 A;  1O7L A;  1RTN A;  3NXW A;  3Q0A A;  1X3G A;  5KRU A;  2CQA A;  2VUM G;  5FJ8 H;  1LT4 D;  3D6C A;  2O2L D;  3A7L A;  4G57 A;  4AQY Q;  1DGS A;  3W2D A;  4RH6 A;  2X6G A;  4DR4 L;  2FJ2 A;  4K2L A;  4Y52 H;  4KN7 C;  1EY5 A;  4IPD A;  1R9T H;  4RHR A;  3I4M G;  3CF5 A;  3MA2 B;  2R6G A;  3OWF A;  5IP9 G;  1SYG A;  2F3I A;  4X64 L;  3T16 A;  1GHK A;  1OXT A;  2R7D A;  2QDB A;  3CCU A;  1C4Q A;  3L0O A;  4G4K A;  5CBA E;  1VQB A;  1XPR A;  1ROD A;  1J5E Q;  5I4D A;  1VF5 C;  2HHH L;  1UUP A;  3CC2 A;  4R4Q A;  2RF4 A;  3OPO A;  1SDF A;  1GO3 E;  2Q8I B;  3K7U C;  3O13 A;  3GDE A;  1STY A;  1EY7 A;  5DM7 3;  3HOW G;  2CW0 C;  2AQ3 B;  5IT9 c;  2WB1 E;  4A3L H;  3FPP A;  3BYY B;  3CCE A;  1HRJ A;  2Q2I A;  1XNQ Q;  4ULL A;  5IGF A;  3MXU A;  4OXP A;  4KKT A;  1TY2 A;  4A3K H;  1RKN A;  1VQC A;  1MD2 D;  2NVX H;  3I4N G;  3HKZ B;  1DM0 B;  1N33 Q;  3LWU A;  4KK7 A;  5I6Y A;  5C0X I;  4B3S L;  3HOV B;  3SK6 A;  1CFM A;  1JB3 A;  2TMP A;  2Z0S A;  1YI2 A;  1BBX C;  3L2P A;  4DGZ A;  3QO2 A;  3G48 A;  4YWL A;  4EQO A;  5FLM G;  4JI5 L;  3J81 L;  3U9O A;  4C3J B;  1N34 L;  3ER0 A;  1LTS D;  1ZYR C;  2CQO A;  5IGE A;  3L7Z C;  3NTK A;  5CMD A;  2A1A A;  5LMN L;  2G9D A;  1R9T B;  4NDX A;  3PQI A;  3M85 A;  4LF5 Q;  1AW7 A;  4CKB A;  1WCM G;  3GTM B;  1YBY A;  4P75 A;  4FXD A;  3DWQ A;  4CHT B;  3H3V C;  5C4J H;  4BBS H;  1RD9 D;  1TS5 A;  1H9S B;  3OW2 A;  1BCP D;  3RZD B;  4PV1 C;  2AQ1 B;  1PRT C;  1AE2 A;  2RCN A;  3CPW A;  5FO9 B;  5IP7 H;  3TZU A;  2DNC A;  3CC7 A;  2EZV A;  5C4X B;  4R4C A;  5JVG 3;  3D3R A;  5BN5 A;  5A35 A;  3C2P A;  4ZUI A;  1DJR D;  2KCT A;  3J80 E;  4FYD A;  2CWA A;  1GKH A;  4KN4 C;  4KMU C;  1Z9F A;  4RGN A;  3BS1 A;  1CKM A;  3RLN A;  1TVX A;  1WTV A;  3IAY A;  4R4O A;  1E2Z A;  5CBE E;  1NY4 A;  2PZU A;  5C44 H;  4OEM B;  3S2D H;  3D4D A;  4QIW E;  5D3I B;  3F8T A;  4GN3 B;  3C46 A;  5KYL A;  5E4X A;  5KNC A;  2VQF L;  3JAM L;  4PNY A;  4JG2 A;  2L55 A;  2VQE Q;  2ZXP A;  1PH1 A;  4K14 A;  1SMY D;  3U9S A;  1EFW A;  4OX9 Q;  2V1C C;  3NQT A;  4HSV A;  4PZ6 A;  1GUO A;  1WD0 A;  2LSS A;  3SK5 A;  1KXL A;  1I6H H;  4P2C B;  3DM1 A;  3HOU G;  2AMC B;  1OXV A;  1XX8 A;  1S5E D;  3HS0 C;  2N3S A;  1BQQ T;  2RQX A;  2D0O A;  4CDE C;  1E1O A;  3R2T A;  1EFI D;  1N8R C;  1PZJ D;  4OO1 G;  1Q86 C;  2K01 A;  4DV1 Q;  3H09 A;  1QG7 A;  3G7L A;  4X66 L;  1SMX A;  1S40 A;  2IPK D;  1OO9 B;  4HIM A;  4LFC L;  1HR0 Q;  2Z6B A;  2MO0 A;  1JJG A;  4NXN Q;  1YZ6 A;  4DV0 Q;  4X6A H;  2E2D C;  4N8X 1;  4PZ8 A;  1H9K A;  4LNQ A;  3HZX A;  3A0J A;  3GV6 A;  2KCC A;  4A3C H;  4LF7 L;  4G7H C;  4DAM A;  2JA8 G;  5M5Y H;  1NCV A;  3OIP A;  1IBL L;  3OW7 A;  1WFQ A;  2F0O A;  4BBR G;  3R3O A;  3NEN A;  1UAP A;  4DUY L;  1EIF A;  2Z4I A;  3BZD B;  2ALY B;  2UXB Q;  3VYT A;  1XPO A;  2A68 C;  4EVO A;  3BG3 A;  4XQQ A;  2JA6 H;  4B3T Q;  5DEH A;  2CH4 A;  1KIX A;  2A6E D;  1EU3 A;  2X69 A;  3ICE A;  2F0E A;  4A3I G;  4LWC A;  1HNW Q;  4OON A;  2YU9 B;  4A3I H;  2BE5 C;  2R7Z B;  1HCZ A;  2ZTE A;  4IUR A;  4BXX G;  4DXG A;  3KBG A;  2KHJ A;  3CC4 A;  2VB3 X;  1Q90 A;  1QIL A;  5HGQ A;  5K5P A;  4ODG A;  4DV2 L;  4X64 Q;  4IUP A;  2JA5 H;  4LFA L;  2JA9 A;  2O5J C;  5JEA J;  3P7J A;  5EKI A;  1KNA A;  1KDC A;  4WJW A;  3Q24 A;  4DF7 A;  5ISR A;  4DV6 L;  1TU2 B;  2HDM A;  3HOX H;  3RN2 A;  5M5Y B;  4HAE A;  1LYL A;  1WI5 A;  1K0S A;  2RDH A;  2B2T A;  2QA4 A;  2JEA I;  1FJG Q;  3MXN A;  1UNS A;  3I91 A;  2H1E A;  3H6M A;  1LO5 D;  3J7A 5;  1G2S A;  4C1N K;  2JA5 G;  4LF9 L;  3I4N B;  1WJJ A;  3W1B A;  2SOB A;  4H02 A;  5IGC A;  4ILW A;  1TWG H;  1U5K A;  3J81 E;  1KRS A;  5BN4 A;  4IJL A;  2SNS A;  4HCE A;  1VQM A;  1G6Z A;  2ICI A;  4HJ9 A;  4IPC A;  3HOX G;  4XYO A;  3CMA A;  2B3G A;  4C3J H;  2NN6 G;  4DV5 Q;  2KUM A;  3LNN A;  4GKJ Q;  3N6R A;  1KDA A;  5I2X A;  1YNJ D;  4QQB X;  1GUG A;  3K0X A;  2QF7 A;  4MTK A;  1LAC A;  1VQI A;  3DWA A;  4CDC C;  2F0J A;  2FHT A;  4GN4 B;  5BN3 A;  4A3G H;  2A74 C;  4MNO A;  3VA5 A;  3STB C;  5I9P A;  1E3P A;  4B3M L;  2NVY B;  4R9W A;  3M7G A;  3I73 A;  4GN5 A;  5M3M G;  1PRT D;  1VQE A;  5EPL A;  3RZD H;  2KED A;  4K5X A;  1SLJ A;  5FJ8 G;  5KEE A;  1HA6 A;  3PUV A;  1A15 A;  2PI2 A;  2ENB A;  2CFM A;  2NTT A;  1M1K C;  3PV0 A;  3AFQ A;  3AMU A;  3I8Z A;  1IZ6 A;  3FKI H;  4MHE A;  2SEB D;  4G7Z C;  5EKL A;  4RMF A;  1UWV A;  5FLM H;  4LF6 Q;  4BY7 B;  5KIX A;  1QJO A;  4RCN A;  2X6L A;  4MTN A;  4IUQ A;  5HUR A;  1WTP A;  3GTG H;  3FEW X;  5IYC H;  4K5V A;  3S1M B;  4X3S A;  3BYT B;  3K57 A;  1FYC A;  3ZJY C;  1JCK B;  4X65 Q;  3T1Y L;  4O42 A;  1SYB A;  4TRD A;  1MI2 A;  4FO2 A;  2JQO A;  5T1G A;  5J3B A;  4B08 A;  2JN4 A;  3AU7 A;  4FXG C;  3CRL C;  1FL0 A;  3OOC A;  2CH4 W;  3RN5 A;  3KDF B;  1JB7 A;  1U4L A;  1TWH B;  1BVS A;  1L1O B;  2BOS A;  4NXM L;  1K83 H;  1LLR D;  2F4V L;  3AEV A;  3HOZ G;  2UXC Q;  4HID A;  1A3V A;  2PQA B;  1G2T A;  2K28 A;  2K14 A;  3PUW A;  4F87 A;  1SNO A;  4N9P A;  1FVI A;  4X3U A;  2QDL A;  3Q23 A;  1MBY A;  4GOP C;  2N8N A;  5J22 A;  1IKM A;  3JAM i;  4JI1 L;  1U4M A;  2JSO A;  2PMZ E;  4IAL A;  4BBR B;  3K5M A;  1CKN A;  3FKI B;  4QB4 A;  3K7A B;  3VA7 A;  1QWY A;  4IOA A;  3S16 H; 
#chains in the Genus database with same CATH homology
 4OIK A;  2RSN A;  1STH A;  1CK1 A;  2L12 A;  2E2J B;  1ENA A;  2K5D A;  3KK7 A;  2E75 C;  1C8C A;  3GO5 A;  4BA2 I;  4LK1 C;  1Y1W B;  1BF4 A;  5ELC A;  1B2T A;  4ZAI A;  2KQ3 A;  3TZD A;  2F0S A;  2LFN A;  1CZG A;  3KLR A;  2IW3 A;  2E74 C;  3RMH A;  2LS0 1;  2VNU D;  1HQR D;  5M5W B;  3MZ5 A;  4ZYS A;  1ZEQ X;  1XWE A;  4C1N I;  5C6A A;  1DD2 A;  1HPC A;  2WIN B;  3GP7 A;  2Z8L A;  5EGT A;  1NAP A;  2B2Y C;  2L9H A;  3D6W A;  2IL8 A;  4DNR B;  3GD7 A;  3BVM A;  3QG1 A;  1H9S A;  3MFY A;  5CV7 A;  4XXE A;  4AYB B;  1PFN A;  1QE6 A;  3H91 A;  2OEO A;  3GV3 A;  4A3M B;  1WVL A;  3S1N B;  3KLS A;  2NN6 I;  1STA A;  5C4H A;  4BS9 A;  1SND A;  1CT1 D;  5KNB A;  1MGS A;  2C9O A;  1JC7 A;  1VDZ A;  3V2T A;  1SYE A;  1IW7 D;  2Z1C A;  1WTX A;  4MN3 A;  2KA7 A;  1CA5 A;  2B2U C;  1U4P A;  2L5T A;  1B44 D;  1PZK D;  2O4X A;  1LT6 D;  3NE5 B;  1TWG B;  1D5Z C;  5IGB A;  1JE4 A;  1SYF A;  5KND A;  2NUC A;  2KJX A;  3NBH A;  3S15 B;  4A3G B;  1CHQ D;  2A68 D;  1KAB A;  2L11 A;  1XTC D;  2EJF C;  1I4R A;  4DK1 A;  2WP8 J;  1Q8I A;  1S5C D;  1ET6 A;  4OO1 I;  2A5H A;  4XQN A;  4B9W A;  1XXG A;  2D62 A;  4DK0 A;  3D4R A;  3CKI B;  1C48 A;  2NTS A;  2PQE A;  1PTO B;  2JA7 B;  1GUW A;  1EU4 A;  2QKI C;  3H94 A;  4DA2 A;  1F9S A;  3PUX A;  5IT9 E;  2RA4 A;  5JOB A;  4ABN A;  5ELE A;  1Z6H A;  3ND9 A;  4O1N A;  2Z4H A;  1D6E C;  1V1P A;  2KOL A;  4J8Q A;  3J7A F;  1JWS D;  1SE4 A;  1LTB D;  2QEJ C;  1K8M A;  2NZ1 D;  1EYD A;  2BA1 A;  1FD7 D;  2EYM A;  1H9J A;  2H4O A;  4DXF A;  1SYC A;  3RLF A;  4DN4 M;  1VMP A;  4UDU C;  3L3O C;  5FOB B;  2J0T D;  4KTA A;  1D1K A;  1XYI A;  2JP1 A;  1TY0 A;  3NSW A;  5CGK A;  2EYP A;  5M9O A;  2A69 C;  3AB9 A;  2MUY A;  3BVG A;  4KY6 A;  2JXM B;  4CKC A;  3GQB A;  3K5N A;  3URY A;  1KAA A;  3LX0 A;  1GUT A;  2I46 A;  4V0B A;  2D5D A;  3R93 A;  4RKL A;  1JOO A;  4A3F B;  4U67 3;  4A3E B;  4EQN A;  4TKO B;  5A2Q E;  3D31 A;  3S17 B;  4QCL A;  5F2D A;  2E76 C;  4IZ8 A;  2ZT9 C;  1RTO A;  1EY8 A;  3FPU B;  1WTQ A;  2KVM A;  1B9N A;  4IUV A;  3OMG A;  3IKJ A;  1ZKO A;  4FF1 A;  5DAU A;  4J6H A;  4HED A;  3IFT A;  1EZ8 A;  1F77 A;  2F0F A;  3HOW B;  1NR2 A;  3T56 B;  1CQV A;  1BR9 A;  3DUZ A;  2OXP A;  3MXP A;  1GJX A;  3A54 A;  1Z47 A;  4BY1 B;  4C2M B;  2FIN B;  2F3W A;  1EY0 A;  3K0Y A;  3MEH A;  5EQ0 A;  1LV9 A;  4ZKB B;  1EWC A;  4DU9 A;  2EDG A;  2KEE A;  2J4X A;  5K36 H;  2EPB A;  1BCP B;  3VYS A;  1BO0 A;  1HXY D;  5COY A;  1PTO D;  3WDN A;  1D5X C;  1ESR A;  1V43 A;  3HEJ A;  4XT1 B;  2MP1 A;  5JEA H;  3MAQ A;  1TWA B;  4RWS C;  2PW5 A;  1T5E A;  5CV8 A;  2EY2 A;  3Q22 A;  3C1E A;  3TDQ A;  2F3V A;  3RUZ A;  4A3B B;  1PFB A;  3MTS A;  5FLX E;  1PLF A;  2AQ2 B;  3A8K E;  1HTL D;  2MPM A;  1BCP F;  5JJZ A;  1YNN D;  3ERQ A;  5I6W A;  1GOZ A;  1AP0 A;  2ZXR A;  5C5L A;  3J80 L;  2B2Y A;  1B9M A;  4NMZ A;  3TP8 A;  5E1F A;  1K83 B;  2ZXO A;  4EQP A;  5ELF A;  1GHJ A;  1JOK A;  2QIL A;  1EEF D;  1G91 A;  1LAB A;  3A8J E;  4F7X A;  4ZLT F;  1LT3 D;  4DNT B;  1GUS A;  1LTR D;  4R8N A;  4NW2 A;  2PMZ B;  3LWE A;  1PMR A;  1WTW A;  2F0P A;  1W6K A;  4OGQ C;  2RDG A;  1M4V A;  1EY6 A;  2B2W A;  1B4O A;  2XWJ B;  4F8M A;  2N88 A;  4C3I G;  1F2L A;  4L6T B;  2K5W A;  1HUM A;  3QWN A;  3QOJ A;  1CQF A;  4BA1 I;  1S4Z A;  3RD4 A;  2NWG A;  3X3M A;  4C56 C;  3PMF A;  2XN9 C;  1I50 B;  1W6J A;  2RSO A;  1EQV A;  3NTI A;  4I7Z C;  4CKE A;  3G6J B;  1QB5 D;  2XRS D;  4RGM A;  4KJN A;  1TS4 A;  3R2I A;  1BCP C;  3NTH A;  4QUC A;  3E6Z X;  1EOT A;  1V1O A;  1PTO H;  2FFK B;  2BE5 D;  3FRP B;  5ELB A;  4V19 0;  2F4I A;  3NP8 A;  1CTM A;  1EEI D;  1HUN A;  4G7O C;  2IX0 A;  1SBB B;  5E4W C;  1A2U A;  3WOF A;  1ICW A;  1B3A A;  5DNF A;  1SE2 A;  3PIP 3;  3SE0 A;  3WOE A;  3MXG A;  2WV6 D;  4BWG B;  4FF3 A;  1RJT A;  4C3H B;  4DAY A;  3OHX C;  3M4Y A;  2KEC A;  4X3T A;  5C0X G;  1HFN A;  4L63 B;  1AN8 A;  5C0X H;  4Y7N B;  4K8I A;  3J7A V;  5C5M A;  5IIF A;  4KHV A;  3KBX A;  3MHB A;  3CU7 A;  2XNA C;  5EBD A;  3E5S A;  1J9O A;  2VUM B;  4C3H G;  3DXJ C;  2NB0 A;  3NBI A;  2B39 A;  2XIW A;  4M8A A;  3F2U A;  1JOR A;  5EJW A;  3K58 A;  1LT5 D;  3NUC A;  5CC4 A;  3MC0 B;  2E2I B;  1VF7 A;  4EGV A;  1D5M C;  2E2H B;  4LMQ D;  1DOK A;  4LJZ C;  3C3L A;  1HTP A;  1PTO F;  5LL6 X;  4HMJ A;  2R93 B;  1CM9 A;  3NK9 A;  3SHL A;  2VB2 X;  1Q3L A;  2IT1 A;  5COR A;  2JE6 I;  2A73 B;  4CBV A;  3H0G B;  1FGB D;  1YNJ C;  1E2V A;  2F1M A;  4Z9C B;  1B53 A;  1I6V C;  5JPN C;  2PCF B;  4FF4 A;  2Y0S B;  2YYZ A;  4C3J G;  3K6O A;  3T51 B;  3OMC A;  2K7V A;  1AZQ A;  1JWU D;  1KLU D;  2EY6 A;  3PO3 B;  4H13 C;  3S2H B;  2KHS A;  4FP5 D;  3SVM A;  4X3K A;  1Y8O B;  5M3F B;  3HOZ B;  2O5I C;  4YIJ A;  1G29 1;  2MGS A;  1DZ1 A;  4K6L A;  5EPJ A;  5EPK A;  1MSH A;  1SSO A;  4RKB A;  4ID6 A;  2DY7 A;  4OHJ A;  5D65 A;  1VCI A;  1SJH D;  1EY4 A;  2AUJ D;  1ESF A;  1I4Q A;  5JPM C;  4OL7 A;  1EIH A;  3NWS A;  4KJO A;  2IWH A;  1IYU A;  5C3E B;  3R8B A;  2F0Q A;  4RCO A;  1SXT A;  1MSG A;  4DAV A;  2R61 A;  2EYL A;  3L9A X;  4DAP A;  4A3D B;  2CHB D;  1DCZ A;  4S3S A;  4IFD I;  4LAA A;  3A56 A;  1O7Y A;  5CV4 A;  1SNC A;  4RGT A;  1HA5 A;  1F9Q A;  1L0X B;  2F0T A;  3GTQ B;  3M7N A;  1H9M A;  1TS2 A;  2ID0 A;  2A6H D;  1U4R A;  1F2Y A;  2FMC A;  1Q1B A;  1X3Q A;  3BDO A;  3A8I E;  1STB A;  2B2V C;  4I65 A;  2DN8 A;  2D2C C;  2LMC B;  1Y69 U;  4QMG A;  2RDF A;  2AWO A;  2A6E C;  1STN A;  4ZKC B;  4J1M A;  4K8J A;  1V1P B;  3PO2 B;  4IFD G;  4IN3 A;  5CR3 A;  4E6I A;  1IHZ A;  2JA6 B;  4NKL A;  1JQY D;  3EVQ A;  1PRT F;  1HHV A;  2WII B;  1ENC A;  1SAP A;  3S16 B;  1S5D D;  2DNE A;  2D9U A;  2ICE C;  3FMC A;  5G3L D;  3BDC A;  5CV6 A;  2EY5 A;  4KD3 A;  5T1I A;  1TT2 A;  1JOQ A;  2HCC A;  1BDO A;  4HSP A;  4XYQ A;  5J1Z A;  1H9R A;  3ZYY X;  1DON A;  2F0D A;  3I4M B;  4BBS B;  2IX1 A;  5JVH 3;  1J8I A;  2MJ8 A;  2LY7 A;  3VYR A;  3DEP A;  1E0B A;  1QOH A;  3DEO A;  3VR3 A;  5G3L F;  3I4L A;  3IL8 A;  1Y1V B;  1SJE D;  4XT3 B;  1E2W A;  4RAU C;  1OXU A;  4N9T A;  5FKA C;  3JAM E;  1ET9 A;  1PRT B;  4UAI A;  3C1F A;  4M1U B;  3NQI A;  1Z7T A;  4H44 C;  4XQJ A;  4ZRZ A;  1KLG D;  2CW0 D;  4KV6 A;  4CJ1 B;  2JEB I;  3SEB A;  2F0V A;  3X3N A;  1RHP A;  4H7B A;  3TP6 A;  1I4P A;  3KLS X;  4QF4 A;  1EL0 A;  4CJ2 C;  2SNM A;  3ITP A;  3ERO A;  1ONL A;  4KY5 A;  1X3P A;  4B9X A;  3I72 A;  2HCI A;  3HRZ C;  2IJ0 A;  1SNQ A;  1K8O A;  1X32 A;  4RHS A;  4U68 A;  4A93 B;  3DHQ A;  3DWP A;  4ME5 A;  1G8Z D;  3NPP A;  1DOM A;  1ML0 D;  1WD1 A;  1WTR A;  3HG9 A;  2B2T C;  5IT9 L;  3T13 A;  4KY7 A;  2BDO A;  1FR3 A;  1IW7 C;  2A6H C;  3VR5 A;  2EVB A;  3CQZ B;  3V96 A;  5FLX L;  5JAV A;  4C3I B;  2BA0 A;  1WCM B;  1TS3 A;  2WKD A;  4XDX A;  1LTA D;  1TR5 A;  2K33 A;  1EQT A;  4H0L C;  2NVQ B;  3UI2 A;  3TP5 A;  1SMY C;  1PTO C;  1ILQ A;  3P1H A;  1A3U A;  2M9V A;  1II3 A;  1TWC B;  3QJY A;  1EYA A;  1Y8P B;  4JBW A;  2TSS A;  4PMB A;  1Q1E A;  4MIU A;  1NUC A;  3EA6 A;  3NWT A;  4ZK9 B;  3A55 A;  1PYW D;  2B8F A;  5CV5 A;  3SK4 A;  1KTK A;  2F0W A;  2F0L A;  3QIA A;  3S14 B;  4FXK C;  4QIW B;  1SFO B;  5KGU A;  1AEX A;  2EYO A;  1R4P B;  2L1B A;  4PMW A;  2VXW A;  1D1I A;  3M3Y B;  1EY9 A;  1V8Q A;  2XRQ D;  3SDZ A;  5I2Y A;  5I9O A;  2DY8 A;  4WFN 3;  2I07 B;  3MFG A;  3VR4 A;  2HDL A;  2V4D A;  5M3M B;  2F0H A;  4IFD J;  2BDN A;  5FO7 B;  5DM6 3;  3I3C A;  2EYJ A;  2JYO A;  1R4Q B;  1SEB D;  4HMI A;  1CI3 M;  4WRD A;  3J7Y W;  4Q5V A;  1DYQ A;  2NBF A;  4Q0F A;  5TSS A;  2NVX B;  1QCB D;  5EBC A;  5IGG A;  1A3T A;  2FMM A;  3W3A A;  2MHV A;  1PXU A;  3SR1 A;  2EY1 A;  5ELD A;  3ND8 A;  2EYF A;  3QB3 A;  1STG A;  3PIO 3;  5NUC A;  5HGT A;  1Q12 A;  5E3F A;  4OO1 H;  2EOT A;  4TQU S;  2CVR A;  3I70 A;  1O78 A;  3QOL A;  4KD4 A;  1GXD C;  2PZW A;  1FNU A;  3GTJ B;  1QNK A;  1OXS C;  4K6D A;  2PZT A;  4DFA A;  4A3J B;  1TQO A;  1S5F D;  1EYC A;  1IYV A;  3DMU A;  1LTG D;  1B50 A;  2XVS A;  1ZXT A;  2B2W C;  3PUY A;  3VYU A;  1AFP A;  3HOU B;  1ENF A;  1VMC A;  2B2U A;  1FNV A;  2L0C A;  2EJM A;  1PDQ A;  1AZP A;  2K1B A;  3RZO B;  3MWY W;  1NSN S;  3S1Q B;  3OWE B;  1F9P A;  1WTO A;  2L4N A;  1HFG A;  1DOL A;  4IUU A;  1B1Z A;  1Y8N B;  2EJG C;  1KNE A;  1BUV T;  1EWH A;  1TWF B;  3SXH A;  1I4G A;  2AUK A;  3BDL A;  3I90 A;  4ZQ3 A;  1SE3 A;  1M8A A;  2LKV A;  2B63 B;  2NYZ D;  4KHZ A;  4RFB A;  5C4J B;  2F0N A;  2IX3 A;  2K05 A;  5FK9 C;  3N52 A;  2Q8T A;  3EFX D;  3SK8 A;  2R92 B;  2F0I A;  1L0Y B;  3TME A;  2RVL A;  4ZUJ A;  2RBM A;  4JK1 C;  3CRK C;  1STE A;  4K5W A;  2QCP X;  5C4Z A;  3K59 A;  4RA8 A;  4CGY B;  2A69 D;  4CJ0 B;  4FVM A;  4HR7 B;  1KDB A;  5C44 B;  2OT2 A;  3S2D B;  2K5Q A;  2NN6 H;  4WOR A;  5CYU A;  5C3W A;  2N55 A;  1A6X A;  3TBI B;  1O80 A;  4IUT A;  4KKU A;  4RGO S;  3VR2 A;  4XTC S;  4HN7 A;  2K03 A;  3MVV A;  4PMC A;  1BOS A;  1EZ6 A;  5AFW A;  3K5L A;  2JA5 B;  3PUZ A;  4L8J A;  1TKW B;  1SNM A;  2PO4 A;  4IUN A;  1SYD A;  1IL8 A;  1O7Z A;  1DXM A;  1HQM C;  4HCS A;  3TSS A;  2EXZ A;  4FF2 A;  5D3D A;  2M2L A;  1I4H A;  2K32 A;  1SNP A;  3M4O B;  1CHP D;  3KF8 A;  4FNF A;  2WKC A;  3FVQ A;  2F03 A;  3OIQ A;  2HQE A;  1BXT A;  3P75 A;  4A3K B;  2EYH A;  2PNR C;  3KUP A;  3TN2 A;  3EJI A;  3S1R B;  1F9R A;  3K5O A;  1A2T A;  2C5C A;  4PQX A;  1IKL A;  1GUN A;  5IOC A;  5K36 G;  1I4X A;  2J7Z A;  2G9H D;  3T4A C;  1PZI D;  2PYK A;  3Q6S A;  1QNU A;  1U9R A;  2Q8R E;  2KCN A;  5D14 A;  5JEA G;  4XIG S;  1EIG A;  5LL6 S;  2WAQ B;  1ILP A;  3GTO B;  2PPB C;  4OIJ A;  1I6H B;  1JR0 D;  3FDT A;  2GA4 B;  3CHB D;  2AWN A;  3ONA B;  3GTG B;  1JWM D;  2OF1 A;  4GZY C;  5LHY 1;  1RDP D;  3VR6 A;  3NHH A;  4TSS A;  1T5X D;  2F0M A;  3A7A B;  1ZYR D;  5CV9 A;  1F2M A;  5C3X A;  1FNW A;  4K2K A;  4R8I A;  5C0X J;  1CA6 A;  3OSO A;  5EKK A;  3GTK B;  1D2B A;  1F2Z A;  3E0J A;  3D4W A;  4QUF A;  3TP7 A;  4IQZ A;  1RCV D;  1S5B D;  3IFD A;  5M5X B;  2F0K A;  2BCO A;  1LTI D;  2R3Z A;  5IGD A;  1LTT D;  5FO8 B;  3EQL C;  3T53 B;  2K6A A;  3D8G A;  2F0G A;  2B8G A;  2RKS A;  1TII D;  3HGB A;  2XSC A;  2K04 A;  4KKS A;  2WAC A;  2F0U A;  2SDF A;  3HOX B;  1CZW A;  2NVT B;  2M00 A;  1I3Q B;  2HUG A;  5IOD A;  3S9W A;  3V05 A;  2JA8 B;  3BVZ A;  5KYI A;  3GTP B;  4F88 A;  3GTL B;  1NR4 A;  5J39 A;  2WB1 B;  3HP3 A;  3HOY B;  2B2V A;  1YNN C;  1PFM A;  2PW7 A;  4IFD H;  1JIC A;  4HTH A;  1RF2 D;  4KI0 A;  1BNZ A;  1OXX K;  1UEA B;  3P20 A;  2EE1 A;  2XWB B;  4A3I B;  5A2Q L;  4NP5 A;  1O7L A;  1RTN A;  3NXW A;  3Q0A A;  5KRU A;  2CQA A;  1LT4 D;  3D6C A;  2O2L D;  3A7L A;  4G57 A;  3W2D A;  4RH6 A;  2X6G A;  2FJ2 A;  4K2L A;  4KN7 C;  1EY5 A;  4RHR A;  3MA2 B;  2R6G A;  3OWF A;  1SYG A;  3T16 A;  1GHK A;  1OXT A;  2QDB A;  1C4Q A;  4G4K A;  5CBA E;  1ROD A;  5I4D A;  1VF5 C;  1UUP A;  3OPO A;  1SDF A;  2Q8I B;  3O13 A;  1STY A;  1EY7 A;  5DM7 3;  2CW0 C;  2AQ3 B;  3FPP A;  3BYY B;  1HRJ A;  4ULL A;  5IGF A;  3MXU A;  4KKT A;  1TY2 A;  1RKN A;  1MD2 D;  3HKZ B;  1DM0 B;  3LWU A;  4KK7 A;  5I6Y A;  5C0X I;  3HOV B;  3SK6 A;  1CFM A;  1JB3 A;  2TMP A;  1BBX C;  4DGZ A;  3QO2 A;  4EQO A;  3J81 L;  3U9O A;  4C3J B;  1LTS D;  1ZYR C;  5IGE A;  3L7Z C;  3NTK A;  5CMD A;  2G9D A;  1R9T B;  4NDX A;  3M85 A;  1AW7 A;  4CKB A;  3GTM B;  4FXD A;  3DWQ A;  4CHT B;  3H3V C;  1RD9 D;  1TS5 A;  1H9S B;  1BCP D;  3RZD B;  4PV1 C;  2AQ1 B;  1PRT C;  5FO9 B;  3TZU A;  2DNC A;  2EZV A;  5C4X B;  5JVG 3;  3D3R A;  5BN5 A;  5A35 A;  3C2P A;  4ZUI A;  1DJR D;  3J80 E;  4FYD A;  4KN4 C;  4KMU C;  4RGN A;  3BS1 A;  1TVX A;  1WTV A;  3IAY A;  1E2Z A;  5CBE E;  2PZU A;  3D4D A;  5D3I B;  3C46 A;  5KYL A;  5E4X A;  5KNC A;  3JAM L;  4PNY A;  2L55 A;  2ZXP A;  4K14 A;  1SMY D;  3U9S A;  4HSV A;  3NQT A;  1GUO A;  1WD0 A;  3SK5 A;  4P2C B;  3DM1 A;  1OXV A;  1XX8 A;  1S5E D;  3HS0 C;  2RQX A;  1BQQ T;  3R2T A;  1EFI D;  1PZJ D;  4OO1 G;  2K01 A;  3H09 A;  1QG7 A;  3G7L A;  2IPK D;  1OO9 B;  2E2D C;  1H9K A;  3HZX A;  3GV6 A;  2KCC A;  4G7H C;  1NCV A;  3OIP A;  3OW7 A;  2F0O A;  3R3O A;  1UAP A;  2Z4I A;  3BZD B;  3VYT A;  2A68 C;  4EVO A;  3BG3 A;  4XQQ A;  5DEH A;  2A6E D;  1EU3 A;  2X69 A;  2F0E A;  2YU9 B;  2BE5 C;  2R7Z B;  1HCZ A;  4IUR A;  4DXG A;  3KBG A;  2VB3 X;  1Q90 A;  1QIL A;  5K5P A;  4ODG A;  4IUP A;  2O5J C;  5JEA J;  3P7J A;  5EKI A;  1KNA A;  1KDC A;  4WJW A;  3Q24 A;  4DF7 A;  5ISR A;  1TU2 B;  2HDM A;  5M5Y B;  4HAE A;  2RDH A;  2B2T A;  2JEA I;  3MXN A;  1UNS A;  3I91 A;  2H1E A;  3H6M A;  1LO5 D;  1G2S A;  4C1N K;  3I4N B;  2SOB A;  5IGC A;  4ILW A;  3J81 E;  5BN4 A;  2SNS A;  4HCE A;  1G6Z A;  2ICI A;  4XYO A;  2NN6 G;  2KUM A;  3LNN A;  3N6R A;  1KDA A;  5I2X A;  1YNJ D;  1GUG A;  2QF7 A;  1LAC A;  3DWA A;  2F0J A;  2FHT A;  5BN3 A;  2A74 C;  3VA5 A;  5I9P A;  2NVY B;  4R9W A;  3M7G A;  3I73 A;  1PRT D;  5EPL A;  2KED A;  4K5X A;  5KEE A;  1HA6 A;  3PUV A;  1A15 A;  2ENB A;  2NTT A;  3PV0 A;  3AMU A;  3I8Z A;  4MHE A;  2SEB D;  4G7Z C;  5EKL A;  4BY7 B;  5KIX A;  1QJO A;  4RCN A;  2X6L A;  4IUQ A;  5HUR A;  1WTP A;  3FEW X;  4K5V A;  3S1M B;  4X3S A;  3BYT B;  3K57 A;  1FYC A;  1JCK B;  4O42 A;  1SYB A;  4TRD A;  1MI2 A;  4FO2 A;  5T1G A;  4B08 A;  3AU7 A;  4FXG C;  3CRL C;  3OOC A;  1U4L A;  1TWH B;  2BOS A;  1LLR D;  1A3V A;  1G2T A;  2K28 A;  3PUW A;  4F87 A;  1SNO A;  4N9P A;  4X3U A;  3Q23 A;  1MBY A;  5J22 A;  1IKM A;  1U4M A;  2JSO A;  4BBR B;  4IAL A;  3K5M A;  3FKI B;  4QB4 A;  3K7A B;  3VA7 A;  1QWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...