1WTXA

Hyperthermophile chromosomal protein sac7d single mutant v26a in complex with dna gtaattac
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
MVKVKFKYKGEEKEVDTSKIKKVWRAGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the DNA kink structure induced by the hyperthermophilic chromosomal protein Sac7d
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*GP*TP*AP*AP*TP*TP*AP*C)-3'
total genus 12
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wtxA00
1HUMA 1VMPA 1AP0A 4OIJA 5D14A 2HDMA 1HA6A 2R3ZA 3I3CA 2B2UC 2FMMA 2N55A 2KVMA 4IUUA 1RTOA 1E0BA 1O80A 2B2WA 4QUCA 1RODA 2FINB 1NR4A 1WD1A 1DOKA 2B2WC 1IKLA 3F2UA 1ML0D 1WTQA 2KEDA 1PFMA 2MP1A 2K28A 1NAPA 1HFGA 2B2YC 2Q8TA 1IL8A 1O7YA 1IKMA 2B2TA 5CORA 2MGSA 1ICWA 4ZK9B 2FHTA 2KECA 3N52A 1AZPA 4UAIA 1U4MA 1XYIA 1M8AA 1BNZA 2L4NA 1ZXTA 1G2TA 4RA8A 5COYA 5EQ0A 1BBXC 1SAPA 2JP1A 1BF4A 1EIHA 1G91A 1WTWA 4IURA 2L12A 2RVLA 1XX8A 1MGSA 2IL8A 4MHEA 1U4RA 2BDNA 1TVXA 2VXWA 3IFDA 4HSVA 1PFNA 4XDXA 2FFKB 3KBXA 4RAUC 1G2SA 3SVMA 1CA5A 1QNKA 1B2TA 2L1BA 1MSGA 1CM9A 2FJ2A 3HP3A 1F9RA 1JE4A 2DY8A 2X6LA 3DM1A 2NZ1D 2D9UA 5DNFA 2B2TC 2L9HA 1LV9A 1A15A 4X3TA 2NYZD 3I91A 4LMQD 1G6ZA 1WTRA 3FDTA 2HCIA 1ILPA 3FPUB 4MN3A 1B53A 4R9WA 3MTSA 1WTPA 1WTVA 4CJ1B 4ZKCB 2K04A 2B2VA 2N88A 1AZQA 4O42A 3GV6A 1Q3LA 3KUPA 3G7LA 4XT3B 1ILQA 1KNAA 1X32A 2H1EA 1HUNA 2EOTA 1NCVA 1PLFA 3DEPA 2DY7A 2NWGA 5JJZA 2Q8RE 1WTOA 4U68A 1C8CA 4IUTA 2EPBA 1B50A 1EL0A 2HUGA 3IL8A 3QO2A 1J8IA 4ZLTF 2CVRA 4RWSC 3D6WA 4IUQA 4XT1B 5T1GA 2RSNA 5CBAE 1J9OA 2L11A 5EKIA 1KNEA 1HRJA 4DN4M 2MJ8A 1F9PA 3P7JA 4ZAIA 3Q6SA 1U4PA 2K1BA 4X3KA 4IUVA 1RHPA 1EOTA 4CJ0B 1MI2A 1NR2A 2K03A 5EPLA 2EE1A 3H91A 4QUFA 1U4LA 2HDLA 4X3UA 1X3PA 2B2UA 1WD0A 1F9QA 2HCCA 3TZDA 5CBEE 1HHVA 2XIWA 2MPMA 5EPKA 2M2LA 1CA6A 4NW2A 2SDFA 4R8IA 1ESRA 1EQTA 2RA4A 1O7ZA 1B3AA 4HAEA 4HEDA 5E4WC 1F2LA 3LWEA 3R93A 2X6GA 2K01A 2B2VC 2K05A 2J7ZA 1DZ1A 4OIKA 1HFNA 1SSOA 2RSOA 5D65A 1BO0A 1DOMA 1PFBA 2JYOA 4IUPA 1RTNA 1RJTA 1EIGA 3ONAB 3I8ZA 1SDFA 3I90A 4CJ2C 1DONA 3GV3A 3DEOA 1WVLA 4HCSA 2X69A 1X3QA 1DOLA 1B4OA 1WTXA 1QE6A 1QG7A 1VMCA 5E4XA 1PDQA 4X3SA 5EJWA 3MWYW 5EPJA 5AFWA 1MSHA 2B2YA 2KEEA 3UI2A 5CMDA 1S4ZA 1GUWA 3TN2A 5T1IA 2KUMA 2KOLA 4ZKBB 1JICA 1F9SA
chains in the Genus database with same CATH superfamily
1X56A 1N9WA 3KF6A 2Z8LA 1UE7A 4OX9Q 1WCMB 3OYYA 1NR4A 4J1MA 5CV6A 3NTKA 1SN8A 2JSOA 1R4PB 1JJ2A 1ENCA 1FJGL 2CQOA 2LS01 5C3XA 3CC2A 1BBUA 2JA5B 3RR5A 4B3SL 2K5QA 4EQ5A 4G7OC 1BBXC 1SAPA 5JOBA 1G91A 3PUZA 1MBYA 4OWXB 3G6JB 1H95A 2ICIA 4HN7A 1G2SA 3A8IE 3Q24A 1AFPA 3WOEA 2K14A 5CYUA 1L1OA 2KA7A 4LF5Q 3RN5A 4KY7A 1CKNA 1A15A 3QJYA 3RUZA 3PIPA 1GUNA 3FDTA 3HOZH 2VB3X 2ES2A 1DM0B 4LFCQ 4B3SQ 3S24A 1X9NA 1JB7A 2CW0C 1Q8IA 1HUNA 1VQOA 1C8CA 2F0PA 4IUTA 2PZTA 2NTSA 2E2JH 4H02A 5M5XH 3X3NA 5I2YA 3F2BA 1NMFA 1S72A 3PIOA 5EKIA 3GTMB 1H9RA 2XVSA 3NQIA 5CR3A 2H5XA 4Y52H 4YY3Q 1GD7A 3CCQA 4QUFA 1ZYRC 4K0KL 3GD7A 3OIQA 5H1SE 1N36Q 1HPCA 1TIID 2WAQG 3BYYB 2UU9L 4LF6Q 2K50A 4JBJA 3HOXH 5EKKA 1EEID 1ESRA 4C3HB 5IYCG 2YTVA 3BVZA 4P73A 1UWVA 3D31A 1WCMH 4I7AA 2J4XA 2F1MA 4H7BA 1JWUD 2PI2A 4A3BG 5EBDA 1HR0Q 3KLRA 5IP9H 4IUPA 2BDOA 1SRUA 4DV7Q 3L9AX 2RQXA 2MQHA 2JA5H 2NN6H 2N78A 5EPJA 1ONLA 3EIVA 3BZDB 1Y1WH 2NB0A 2A6ED 3E3XA 2F0WA 4DKAC 4K0KQ 4DV4Q 4OXPA 4C1NK 5D14A 5IP7G 1QVFA 1B7YB 5C3EB 4X64L 1L0XB 1V1QA 1SE8A 4IPDA 5ELCA 1WD1A 3A8KE 5IWAL 4LFBQ 3CCSA 3T51B 4QY7A 1KABA 2R7ZB 2F0TA 2PCFB 4DNIA 5LMUQ 4DV6Q 2A1AA 3A54A 1XYIA 5J3BA 1JB3A 3SHLA 2JA6B 1G2TA 4WRDA 5COYA 1X3GA 4LFCL 2QEJC 2AQ2B 4DUYL 4K8IA 3HOWG 3IKJA 1XX8A 1H9SA 1MGSA 3GTKB 1MJCA 2PMZB 5EGTA 3WOFA 2E2JB 1TVXA 3IFDA 5M5XB 1RD9D 3H3VC 3GTMH 2DY8A 3DM1A 4UY8C 5DNFA 1LV9A 2XGTA 2PI2E 3NQTA 1G291 4DV0L 4KV6A 1QVCA 2F0FA 1TWCH 1R9TB 1YI2A 1EWHA 2PNRC 1TY0A 2H1EA 1OXUA 2EYHA 1O7IA 4EQPA 2PZUA 1ICFB 1IHZA 2UU9Q 1GUTA 3NBHB 4JI5L 4Q5VA 1BQQT 1CTMA 1TT2A 2Z0SA 4IOCA 1KQSA 4QIWE 2RSNA 3U4VA 1J9OA 2VUMG 1YEZA 1KNEA 4P72A 5FLMH 3W1GA 3NEMA 4LNQA 5CV5A 4CDDC 4GN4B 1PTOD 3CHBD 4DAPA 2JA8H 4MIUA 2CWPA 4HR7B 1GUOA 4JW0A 2ALYB 1YNND 1Y1WB 3K5LA 5KRUA 2SDFA 3KDFA 3DUZA 2LXJA 1XXGA 1II3A 1PTOF 3D4DA 1HNZQ 3C3LA 4JK1C 1CT1D 4UP7A 2AKWB 5JJLA 2OEOA 4KY6A 1DZ1A 5C3EH 2RSOA 2MO0A 1BO0A 2A6HC 3TP5A 1DOMA 1QNUA 3CCJA 3KBGA 1NNXA 1OXVA 3H6MA 4JI4L 2AUKA 2R7ZH 2I5MX 5D3DA 3NPPA 4PMCA 2JA6H 5T1IA 3QR8A 1BUVT 2EJFC 1F9SA 1AP0A 2A6HD 3CXCA 4ALPA 2I46A 3GTKH 4LUOA 1O80A 5LMNW 1CHPD 3LWUA 1CQVA 1SNCA 2XN9C 1ML0D 2H4OA 3V2TA 3PO2G 4A3LG 4CGYB 2O2LD 4LW1A 2BE5D 5DAUA 3IRBA 4MTNA 5I4DA 1BR9A 1TWCB 3MAQA 1R9TH 1WTHA 1TS3A 3K5OA 3B6YA 4IPHA 1RKNA 4RA8A 4KHVA 1HZAA 2EYPA 3PUVA 2QCPX 4P71A 4LF4L 5JVH3 2A74C 3I73A 1VQ5A 1LLRD 2CH4W 4JOIC 3HRZC 4LAAA 2CFMA 1JOKA 4TVAB 2HHHL 1QNKA 2BE5C 4OWWB 2O5IC 1TWFH 4AYBB 1D5XC 4K5WA 1C48A 2L0CA 4LF9L 5TSSA 1MHWC 1MIUA 1A8VA 4K5VA 5DM63 4WORA 2JA8B 5IYDH 3ULJA 1TWHH 1MJEA 1Q3LA 3QG1A 3T4AC 3G7LA 3RD4A 1PRTF 1IYUA 4GOPA 1JJGA 4RFBA 4CDCC 1N36L 4PV1C 1FYCA 1UNSA 2IX0A 2R7FA 2I0QA 3EN2A 1IL2A 1PRTD 1EYCA 1XNRL 4ZCKA 3NENA 5T1GA 2BA0A 2OTLA 2MJ8A 4AYBG 4JI7L 3R2TA 3R3OA 1E22A 1F9QA 1IBMQ 4UHVA 4UDUC 5C0XI 3PO2H 3A55A 1SYEA 4A3LH 1SR3A 4YIJA 4R8NA 4YWLA 1D1KA 2VY3A 2JA7G 2CWAA 2K05A 3S9WA 4IJHA 3QWNA 3W2DA 2HD3A 4JG2A 1D8LA 4QF4A 2ZXOA 3FP9A 2EDGA 3I90A 2OCEA 1Q1BA 1WVLA 4JYAQ 2CKZB 5EJWA 4AH6A 3DWPA 3UI2A 1ASZA 2EXZA 3C1EA 3ZJYC 4A3IH 2TSSA 3HOVB 1EFID 4A3DH 1FR3A 4HIKA 2OQ0A 1EIYB 3J7AF 5E3FA 1BCPB 1TWFB 3T56B 1NJIC 1E2ZA 1T5XD 5I6WA 5IGCA 2K28A 3PQIA 5C4XH 1IL8A 1LTSD 3V96A 5GROA 4HJ9A 1TWHB 3ERQA 1GXDC 3SR1A 3FPPA 4QB4A 4DR3Q 5BR8Q 1ZXTA 1B9NA 2E74C 2WB1B 3K59A 2QDLA 1SYFA 2VQFQ 5IYCH 2IL8A 1VQ9A 3A56A 4FF4A 3HZXA 3SVMA 1BCPD 4BXXH 2KCTA 2L1BA 4JI6Q 1MSGA 1JE4A 4XIGS 2DJGC 4HSPA 2UXCQ 2B2TC 1SLJA 2G9DA 2UXDQ 1WTVA 1CK1A 2LSSA 1BCPF 3DMUA 4XQNA 3CD6A 3PO2B 3OOCA 4JI5Q 1FNVA 1UE6A 4RKLA 4LF8Q 1LUZA 3GP7A 3GQBA 5HY6A 1RIPA 2HUGA 4HTHA 1BKBA 4J15A 4GKKL 1YNJC 3FKIB 3C1FA 4IUQA 4KK7A 3VYRA 4AYBE 1HNWQ 4DN4M 5HGTA 1F9PA 2JJQA 1VQCA 4DAYB 1Q90A 3Q6SA 1DXMA 2F4IA 4IUVA 3RNUA 1MI2A 1PH8A 4C3HG 3AEVA 1NY4A 2LFNA 2IY5B 1SNMA 4DK0A 4L5SA 3W5OA 1CA6A 2NZOA 1M90C 5JJKA 4A3GG 4A3IB 2Q2TA 3J7A5 3CAMA 2C5CA 3HOVH 5BN3A 4A3DB 1K3RA 1HXYD 1F2YA 2XNAC 5DEHA 1K0SA 2KBNA 3KLSX 5IGFA 4QL5A 4RHRA 3I8ZA 1IBML 1KDBA 3AFQA 5C4XB 3GV3A 2RCFA 2UUAL 1S5BD 1XTDA 4KN4C 5KNBA 2NVXB 1IZ6A 3OTOL 1GOZA 4HMJA 2ZJRA 3WWVA 1KC8C 1SEBD 2OT2A 3SK5A 2KOLA 3HKZB 1NMGA 4P2CB 1TS4A 3HGBA 3ND9A 1TKWB 1TS5A 4OIJA 2N55A 4CKCA 4DUYQ 4BY1B 3D8GA 2GVBA 1SFOB 4ZQ3A 1JE5A 5IGGA 2MP1A 4JCVE 5LMUL 1JMCA 5FO9B 4DR5Q 1WJJA 5LL6X 1IKMA 3P75A 2B2TA 4UAIA 4ZUJA 2NBFA 2KHJA 3DWAA 1PH6A 1XJVA 2ZTDA 3FMCA 4GNXC 1YVCA 1SROA 1PFNA 3FKIH 3KBXA 4XDXA 5C3EG 4NB3A 2F3IA 4BBRG 1EOVA 2L9HA 2PO4A 1YJ9A 2DNCA 2Q2IA 1FD7D 3KYHC 3EA6A 3L0OA 2JQOA 1XMOL 1Q81C 5G3LF 5IP9G 2AWNA 1STAA 1SMYC 3H15A 1HR0W 2WB1E 2NZHA 3MFYA 3K57A 3GTJH 2NWGA 4UP9A 2Q8RE 4DXGA 5C44G 4GKKQ 3R2IA 1VQDA 2R93H 4RWSC 3F2DA 1U0LA 1HTLD 3BVMA 1D6EC 1H9MA 4BBRB 1VQGA 1NR2A 2NVXH 2UXDL 3JC66 2DUDA 4PZ8A 1O7LA 1HH2P 1VS0A 5M3MG 1S5FD 1ESFA 1I94L 1I5FA 2RA4A 1B3AA 3OPOA 4L5TA 2OXPA 3BZKA 1D5ZC 4BY1H 1Q46A 1SFOH 2WIIB 3NHHA 5KGUA 1PA6A 3CC4A 3AU7A 5BR8L 4KHPQ 1BOSA 2VW9A 4O2DA 4DFAA 1EQRA 4AQYL 3FKIG 4LF8L 4U673 2ENBA 1Q82C 2KEEA 4PZ7A 3I4OA 1KL9A 1GO3E 1KXLA 4DK1A 4QGUA 2FMCA 4DUZQ 2EY1A 2R93G 4CDEC 1K9MC 4L8JA 2FINB 4A3GB 3K7UC 1PXUA 1A6XA 2BCOA 4EQNA 4OELB 4C3IG 4Y7NB 3AYHB 2RHSB 4DR1L 2D62A 1LTID 1ZYRD 1VQAA 5C4HA 2Q2HA 1W2BA 4JBMA 1K8AC 3K0XA 4M8AA 3GTJB 3M3YH 1QB5D 3ND8A 2DN8A 3A5ZB 2R93B 3JAML 1PMRA 5CV8A 1Y8NB 1GJXA 4DF7A 2B29A 2EQSA 2RDGA 5L37A 4BBRH 2NYZD 3W3AA 2VB2X 1WTRA 2O4XA 1Q12A 2K33A 4GNXB 4FXDA 1WTPA 3MZ5A 3RLFA 2B2VA 2D5DA 5FLXL 2CCZA 1I4HA 4DPGA 4CBVA 3S2HH 2CHBD 2NVQH 3A7AB 1SBBB 4BXXG 3DEPA 2DY7A 3NXWA 1FNWA 2Y0SB 2UUBL 1LTRD 4PQXA 3NTHA 3M4PA 4CKEA 2YTYA 3G6EA 4MNOA 3P7JA 5FLMG 1N34L 1N32L 2NN6G 4ULLA 2EYLA 2MUYA 3H91A 3UDGA 4LUVA 4HIMA 4DV0Q 4HMIA 4A3JG 1LO5D 4GOPC 1PRTC 3JAMc 4OIKA 2JA9A 1W6JA 1F2MA 1SYDA 4OO1I 4A3GH 1KAAA 3MA2B 3E9IA 4POFA 3S16B 4Y7NH 4DAVA 1K0RA 3RLNA 1M1KC 3TP8A 4JV5Q 1B70B 1VMCA 5IYBG 1PRTB 4WJ3M 1AN8A 1FGBD 2B3GA 1EUJA 1G51A 1LYLA 2KUMA 2PZWA 3M3YB 3M85A 4IN3A 5JEAH 2HQLA 3RZOH 3TZUA 4A3JB 3HOUG 2FMMA 3TS2A 2B8GA 3T53B 4PZ6A 4QUCA 5IIFA 2A6EC 2SOBA 1DOKA 3F2UA 2F3WA 4KD3A 1K28A 2JEBI 4NXMQ 5LMNL 2MGSA 2AWOA 1SYGA 5KYLA 1M8AA 2EYFA 3S2HB 5ELBA 4JPBW 1WOCA 5EQ0A 2NVQB 1VQ6A 3VYSA 2E76C 4OX9L 1VCIA 3TBIB 3VA7A 5FK9C 4POGA 4UP8A 2RF4A 3J80c 1CQFA 4QQBX 4DV1Q 1XPRA 4A93H 3BS1A 1CA5A 2K75A 2A69C 1B2TA 4I7ZC 2D0PA 5IGEA 3I91A 1G6ZA 1HNXQ 3CRKC 3TREA 4QJFA 3K58A 1E1OA 3CP0A 2SNSA 4BS9A 4XT3B 2CW0D 4RH6A 2KENA 2EOTA 3UE0A 2IX1A 5A35A 3TRZA 1I6HH 3PIP3 1KHIA 2WB1G 2A69D 2A68C 2GVAA 3G4SA 4RCNA 5LHY1 3QO2A 2NTTA 5ELOA 3VR5A 3T1YQ 4A3FH 2ZXPA 1IW7D 3KFUA 3A74A 3S16H 4JI1L 4DR6Q 1PH9A 4A3IG 1X3EA 4LWCA 3VA5A 1QOHA 4BY7G 1IYJB 1K3BC 3SK6A 1Q8KA 4R8IA 3RZOB 3X3MA 3PSIA 4K5XA 4A3JH 4HAEA 2SNMA 1YNNC 2B2VC 3KF8B 3BJUA 1JJCB 2KHSA 4C1NI 5NUCA 4TKOB 5J39A 1LTAD 1QCBD 1EIGA 1OXSC 5C6AA 2PQEA 1X3QA 4B08A 4ZYSA 2KCCA 4UPAA 4IPCA 3GO5A 5CMDA 2ICEC 1FVIA 1NUCA 1CI3M 4TQUS 1VQPA 2WAQE 1PH5A 1PH7A 4A93B 2QW7A 3MC0B 1EYDA 4DU9A 2L5TA 1XMOQ 1K8GA 2B63B 1QVGA 1EY7A 1NE3A 3LGJA 4OO1H 1UUPA 3SK4A 3LNNA 1NAPA 4BBSH 4K8JA 2XTIA 4GLVB 2XWJB 1X3FA 4KKTA 2F3VA 2XWBB 1U4MA 3NELA 1KRSA 1VQNA 2KCMA 1EY6A 4G4KA 1I6HB 1X65A 2QEXA 4GNXA 1I4GA 4TRDA 5K36H 2RKSA 3RLOA 3SDZA 1JOOA 4R4OA 4A3FB 1DGSA 1DCZA 3AFPA 2VZAA 4X62L 2NZ1D 1QUQA 4JI0L 4X3TA 4L63B 1I6VC 3MHBA 4JI3Q 2LKVA 3FPUB 5GAEC 1YHAA 4R9WA 3U9SA 4IFDG 3KK7A 4YHHQ 1PZJD 3BG3A 1E7ZA 1SE2A 2PQAA 1I4QA 4X65L 1X32A 2YU9H 4YWKA 4L5RC 4PMWA 3L3OC 2SEBD 2F0HA 4XTCS 2Q8IB 4KJNA 2DGYA 4FP5D 4KN7C 1KD1C 1RL2A 2F03A 1LT6D 1EEFD 5IGBA 5M3FG 1VQBA 3S1QH 1Y1WG 1UEBA 3E0JA 4DV2L 2RDHA 3GTGB 2F0DA 1SMYD 3IFTA 3TDQA 1H9JA 4JBKA 3D6CA 4YHHL 1S5ED 2M2LA 3D4WA 2CH4A 1DJRD 1Q7YC 4K14A 4TSSA 2IPKD 1F2LA 3LWEA 3NWTA 4CHTB 1EFWA 2HT1A 5IP7H 2O5JC 1VF7A 2K7VA 2B63H 1CZGA 1S5DD 4LFAL 2Z4IA 3T1HL 1SDFA 3GTOH 4BBSB 1Z7TA 2E2IH 4R1JA 2BOSA 1PYWD 4KD4A 3RN2A 1QE6A 3SE0A 2MHVA 2ZXRA 3MXNB 3MWYW 5AFWA 2EJMA 2XRSD 4OEMB 1STNA 3J7YW 1PHJA 1TS2A 4DUZL 4YY3L 1Y69U 1VQ4A 5C0XJ 1EY8A 5FLXc 2E8GA 2TMPA 1RTOA 5HGQA 3UDXA 2ASBA 1B8AA 2B2WC 1IKLA 4AQYQ 4J8QA 1Q1EA 2F0KA 2Q8TA 2D0OA 4KTAA 4BA1I 1AZPA 2KECA 1JC7A 4B3RL 4DK3C 2YU9B 3FRPB 2B39A 4A3EG 1TU2B 3OMCA 3E9HA 3CC7A 3PGZA 3MXUA 1C9OA 3K6OA 2VXWA 1GUSA 2FFKB 1UAPA 3OMGA 1KLUD 1L2FA 4JV5L 3S1QB 1QJOA 4YWMA 2HCIA 3GTGH 4BY1G 1SE3A 3T13A 5IT9L 3KF6B 4DR4L 3D0FA 1PH3A 1EWIA 4ABNA 4FF2A 2IW3A 3TS0A 3E0EA 3TSSA 1ILQA 2A19A 2EPBA 3NWSA 1Y1VB 2K32A 2EZVA 3S15B 1CHQD 4ZLTF 3D6WA 4KI0A 1VQMA 4JYAL 1VQHA 1B3QA 1GUGA 2L11A 4FVMA 1PH2A 2OTJA 4OWTB 2F0LA 3OWFA 4RGNA 3SEBA 4V190 1N34Q 3GTOB 2E2IB 1AE3A 3MXNA 4WFN3 1U4LA 3DM3A 4X3UA 1WD0A 3ER0A 4XQQA 3TZDA 3VR2A 4JI0Q 5BN5A 5CV9A 2QF7A 2UUBQ 2JE6I 2QKIC 3GTLB 3S17H 4LF9Q 4GN5A 5JAVA 3BYTB 1A2TA 1EY0A 5ELEA 1PFBA 5J22A 1QZGA 1RJTA 4GS3A 4NKLA 4GKJQ 2NUCA 4H0LC 3DEOA 3U58A 3MEHA 3STBD 4CJ2C 3OWEB 4N9TA 3I55A 3I4MH 1MSHA 2Z9HA 3KLSA 5LMNQ 3J80E 1A3VA 3HKZE 3SGIA 3VR6A 1GUWA 3ERSX 1E24A 2A5HA 3C2PA 1B9MA 4LJZC 1HA6A 3I3CA 1SMXA 2KVMA 4FF3A 4Z9CB 1D5MC 4G7ZC 3MXGA 1D1IA 2EIFA 5IODA 4KMUC 3H3VH 4EQOA 1V43A 1VDZA 2E2DC 3UE1A 1B44D 3EJIA 4ZK9B 5IYDG 1HNWL 4DV4L 1GHJA 1H9KA 1BNZA 3KOJA 3K0YA 1NBWA 2V1CC 1BF4A 3CCLA 2PW7A 3J81L 4DGZA 3K81C 1Y1VH 2RVLA 4N8FA 3PO3B 2EYOA 3S15H 4B3MQ 1U9RA 4HSVA 1HCZA 3TEHB 3J7ZC 1PYSB 3DLLA 4DV7L 3H09A 4L5QA 3HP3A 1F9RA 5CC4A 3M7GA 4HIOA 2JXMB 2C9OA 5JVG3 1ILPA 4MN3A 3EQLC 4CKBA 5ISRA 1VF5C 1V1OA 4DR6L 3A8JE 4O42A 4OONA 4B9WA 5I6YA 3ULLA 1PLFA 5EKLA 2VNUD 2F0QA 5FLXE 2WFWA 4IZ8A 1C0AA 3LX0A 3GTLH 2QA4A 3S17B 2WACA 1YITA 3PF4A 2QGQA 1E3PA 2BH8A 3S2DH 1MD2D 1HZ9A 3R8BA 5GAGC 4JI2Q 4KKUA 2UXCL 1HTPA 2JEAI 2F0OA 4RGTA 4KLKA 5EPLA 5EBCA 5JEAG 2HDLA 3M4YA 2NVTH 1RCVD 2JA6G 3I4MB 4IPGA 5C3WA 4XYQA 1YZ6A 5LL6S 4X66L 1JR0D 3CQZH 3WDNA 4X66Q 1S5CD 5E4WC 1Z9FA 2F0NA 1TXYA 1O78A 1W3SA 2F0SA 3DXJC 5KNDA 5FOBB 2A8VA 2KQ3A 4JI4Q 3T1YL 2OWOA 1CKNB 1L0YB 3TP7A 1YJNA 5IT9c 2PMZE 2P5ZX 2UUCL 3K5MA 5E4XA 3BDLA 3ITPA 5D3IB 1PYBA 3J80i 4DR1Q 3K8AA 3OSOA 1HUMA 1VMPA 4R4IA 2I07B 3PO3H 1K8OA 5JPNC 3A5UA 2B2UC 1J6QA 2Z6KA 4DNTB 4IFDJ 5C4JB 3J80L 1OXTA 2ZTCA 2IT1A 5M3FH 5A2QL 2XRQD 3D4RA 1YNJD 4DR2L 1BDOA 5CORA 3HOZG 3N52A 1CUKA 1OXXK 4IUNA 3BU2A 1PVOA 2HQEA 2ZT9C 4EVOA 1LT3D 2BA1A 2JP1A 1NSNS 1B1ZA 3L7ZC 4OL7A 1WTWA 5DLQE 4NPSA 1UEAB 1EU4A 1P16A 3CPFA 4MHEA 1K83H 4RAUC 1RDPD 5KEEA 4X62Q 3S2DB 4GZYC 3Q8DA 4FO2A 1XMQL 2D9UA 4R4CA 3PUWA 4R4QA 2RDFA 3HS0C 3H0GG 3BDCA 1PV4A 1YIJA 4XXEA 4DR7L 3OHXC 2NVTB 4X65Q 1AZQA 3GV6A 4HJAA 3EBEA 1EZ8A 1KNAA 3CQZB 1LTTD 5JJZA 2JA7H 1GM5A 1E2WA 1ET6A 1B50A 1EY4A 3PCOB 4A4IA 1E1TA 4JI8Q 5FJ8H 1KRTA 4IQZA 1V8QA 2Z6KC 2EJGC 2PNHA 2K5WA 3HOYG 1STEA 3HFZB 3GDEA 3STBC 3M9BA 3I2ZA 5M3MB 1RHPA 4APVA 4CJ0B 2F0UA 2AUJD 3QB3A 1EYGA 1SXTA 3F2CA 5ELDA 4OO1G 4G57A 4LF4Q 2MPMA 2YYZA 3C46A 3M4OH 3URYA 3V05A 1ZEQX 1XNQQ 4H13C 1O7ZA 4FXGC 3S1MB 3P1HA 5D65A 1C7YA 5C4JH 4F87A 4JC0A 4G7HC 3DWQA 3HOYB 3OW2A 5M3FB 5JPMC 3GTPH 1XPOA 4JBWA 1Q86C 3G71A 4YCVA 5CGKA 1STBA 4GLXA 1PDQA 4X3SA 3MEFA 5ELFA 1K73C 3VYUA 1S4ZA 2EXDA 3W1BA 3NBHA 1KTKA 3M4QA 1JICA 2KHIA 5IYBH 1LT5D 2A68D 2EY5A 3NTIA 4C3JG 3SXHA 5KYIA 4DV3Q 4JI1Q 2MFIA 4DV5L 1K83B 5I9PA 1SYCA 2B2WA 1EY5A 1JCKB 3I4LA 3PUXA 1STGA 5FJ8G 1CFMA 1YHQA 3FHWA 2LY7A 4L6TB 1JWMD 5F2DA 4HJ5A 2UUAQ 1FL0A 2LXKA 4DNRB 3K80C 2JA7B 2YV5A 3J81j 4A76A 1IYVA 4JVZA 4Q0FA 1TWGH 5C44H 2E5LL 1U4RA 3T1HQ 5E1FA 4NMZA 5GAHC 4YCWA 3OIPA 1CSQA 2I5LX 1T5EA 3JAME 4A93G 1D7QA 5M3MH 1KLGD 3TMEA 5C4XG 3CKIB 4CJ1B 3BDOA 2Y0SG 1Z47A 2EYJA 3E6ZX 2IWHA 3M4OB 2F0GA 1NCVA 2MO1A 3HOVG 4NP5A 3I70A 4HJ7A 2E5LQ 4A3EB 1MKHA 1X54A 3RZDH 1IBLQ 3S1MH 2K4KA 1XNQL 3VR4A 3CF5A 1OO9B 4RHSA 3Q0AA 4EGVA 1FGUA 3U50C 1STHA 1HRJA 4RG1A 5C0XG 3HOYH 2F0EA 3SK8A 2N3SA 1A0IA 1FNUA 3QOJA 2K1BA 3GTPB 4JI7Q 1SJED 2R7DA 2OQKA 2EYMA 2B2UA 4MZ9A 3ZYYX 1WCMG 5CV7A 3Q22A 3KJPA 1IBKQ 4NXML 3BZCA 2K6AA 4ODGA 1HJPA 4IOAA 4EX5A 4GN3B 1SSOA 4RCOA 3NUCA 3EVQA 4DR7Q 3QOLA 5FO8B 2JYOA 2VQFL 3AQQA 4J6HA 4IALA 5JJIA 1WI5A 2X69A 5IT9E 1QG7A 3F8TA 3TN2A 3CU7A 4GOPB 3I72A 1ASYA 2B8FA 4P75A 2WV6D 1GHKA 4MTKA 2AQ1B 5K36G 2AHOB 2UXBQ 4B3ML 1TWGB 1PTOH 5C44B 3K7AB 1T9HA 4DV3L 2VL6A 4GKJL 3HKSA 2KEDA 2G5DA 2B2YC 1VQFA 2GA4B 5J1ZA 1ET9A 1KDCA 1X6OA 2FHTA 3NK9A 4I65A 4BY7B 1PZKD 3S14B 2G9HD 3ICEA 4X64Q 1L1OC 4A3EH 1A3TA 2L12A 4IFDI 2WKDA 1EWCA 1VQKA 3RZDB 4DK6C 1EZ6A 1I4RA 2FXQA 3HEJA 1GKHA 3CCEA 2QDBA 4CDFC 1KDAA 1TR5A 1CM9A 2FJ2A 5CV4A 4PG3A 5ELNA 1EIFA 4LMQD 1PZID 2E2HB 1EQVA 3ULPA 3RMHA 1BXTA 3I4NH 2K04A 2N88A 2PW5A 3KUPA 3NP8A 1U5KA 4U68A 5M5YB 3CMAA 5C5LA 1GVPA 1EL0A 2YTXA 3PO3G 1V1PB 1J8IA 1SE4A 1CSPA 1XNRQ 3U4ZA 1IW7C 1V9PA 3A0JA 4QIWB 3N6RA 1DD2A 3IAYA 2CQAA 1U4PA 3KF8A 1F2ZA 1VQIA 2XSCA 2NN6I 4LK1C 4O0AA 2F4VL 1E2VA 1N33L 1ENAA 4KJOA 3J81E 1I50H 2KJXA 1LTLA 1LACA 4WJWA 4A3BH 1PTOB 3HOUH 3K7AH 1W6KA 3CW2C 5IOCA 1I3QB 1SNDA 2R92G 5IGDA 1QUQB 1JT8A 2DNEA 2PPBC 1Y1VG 1FJGQ 4C2MH 1RTNA 1IBLL 3KLWA 1AEXA 1AE2A 2VQEQ 4RMFA 1PTOC 4HCSA 1X55A 1B4OA 1WTXA 3DHQA 4E6IA 5DM73 3HOWB 4A3KB 4O1NA 4BY7H 4KKSA 4DR2Q 3S14H 1YBYA 1CKMA 1LTBD 2B63G 1F77A 1XWEA 2RHQB 4LUZA 3MXPA 1EY9A 4FF1A 4IUUA 4JI6L 1C4QA 3HOXG 1AW7A 4XQJA 1PFSA 2E2HH 4N8X1 1LTGD 1PFMA 1HFGA 3E5SA 4HJ8A 4AIMA 4B3TL 3CCRA 1O7YA 4BWGB 2IJ0A 3I4NB 4JI2L 4DR3L 4KHZA 1BVSA 3JAMi 4YCUA 4A3KG 2L4NA 3MVVA 1S40A 4N9PA 4A3FG 2F4VQ 2VUMB 2JA5G 5M5YH 1CKOA 1V1PA 3NBIA 2BDNA 1TQOA 4RGOS 1TY2A 2Z4HA 3I56A 2M9VA 1QZHA 3KDFB 3A7LA 2K5DA 3PF5A 2WAQB 2K5NA 1PH1A 4B9XA 4ZKCB 1HQRD 1L1OB 3FVQA 1I50B 1EYAA 2Z1CA 1LM0A 1N33Q 2ATWA 4A3BB 3HOUB 1TWAH 4F88A 1I3QH 4XYOA 5CBAE 3VYTA 1EU3A 3FEWX 4IJLA 2J0TD 4JI3L 4WJ4A 4A3CG 1I4XA 1WFQA 1Y8OB 4C2MB 4IO9A 4X3KA 1EOTA 2QILA 3P20A 2AQ3B 2EE1A 5AJ3Q 2UXBL 3H0GB 1PH4A 3HOWH 4A3KH 4LFBL 5CBEE 2WP8J 4NW2A 4DA2A 2IX3A 3CCUA 3J81i 3OTOQ 3AB9A 4NXNQ 3CPWA 2HIVA 4HEDA 2X6GA 2K01A 1M4VA 3O13A 2AMCB 2J7ZA 2NVYB 2WINB 4ILWA 4BBSG 4FDBA 3TQYA 1AH9A 2ZJQA 4A3MB 4DAMA 5KNCA 1S3OA 4A3DG 5I9OA 1QWYA 4S3SA 1Z6HA 4HCEA 1DONA 5JEAJ 2L55A 4LF5L 4DV6L 3CMEA 1G8ZD 4C3JB 4V0BA 1N8RC 4FYDA 2N8NA 2PQAB 1ENFA 5GQOA 2VUMH 4LF7Q 1HQMC 2HDMA 2R3ZA 2JA8G 1BBWA 4QMGA 3CCMA 2LMCB 1KIXA 1LT4D 1ZKOA 1WTQA 2K5VA 2Y0SE 2F0JA 1SNPA 4F7XA 2R92B 2Z6BA 4H44C 1IBKL 1D2BA 1G6PA 4IFDH 5A2QE 3BVGA 3UDFA 5M5WB 4A3CH 3NSWA 3CRLC 5K5PA 4A75A 1JORA 1UE1A 2R7ZG 1EIHA 3U9OA 1XTCD 2PYKA 2C35B 3EROA 3T16A 1WYDA 3F1ZA 1TWAB 4KHPL 4QCLA 3H94A 5G3LD 1SNQA 1LABA 1H9SB 4HIDA 5FO7B 2ZTEA 4B3RQ 1B53A 1NTGA 1RF2D 3H0GH 4LFAQ 1JQYD 1J5EL 2BH2A 1UE5A 2GN5A 5FKAC 4RKBA 2UUCQ 3S1NH 1WTOA 4FNFA 4ZRZA 2M00A 3I4NG 3GTQB 2K52A 2NVYH 3IL8A 3PV0A 4B3TQ 4XT1B 3L2PA 1CZWA 2ID0A 1HNXL 1BCPC 4A3MH 4ZAIA 3S1RH 1DYQA 2VS1A 4GLAC 2KCNA 2K03A 3CCVA 4FXKC 1A2UA 1X3PA 5GADC 4C3JH 4DR4Q 2F0MA 2ZM6Q 1EQQA 1JOQA 1HHVA 2XIWA 5IE8A 2EY6A 3VR3A 1R4QB 1VQJA 1STYA 3NE5B 1SYBA 2V4DA 4ME5A 1Y8PB 2F0VA 5BN4A 1HFNA 3D3RA 2HIXA 4DV5Q 2E75C 2N49A 3ONAB 2IHEA 4ZUIA 1SNOA 1YHBA 5KIXA 2R92H 4C3IH 1DOLA 5M5WH 1I94Q 4DV2Q 1QILA 4LF7L 1YJWA 3KJOA 4DV1L 4NXNL 3J7AV 1JWSD 2F52A 2K5HA 1E0BA 1RODA 1YNXA 4DXFA 3PUYA 1VQ7A 3HG9A 4KY5A 3Q23A 3MFGA 1OTCA 4RGMA 3I4MG 1ICWA 1P8LA 4K6DA 4A3MG 2IHFA 3PMFA 5M9OA 1VQ8A 3H3VI 5C4ZA 1IXRA 2EVBA 3S1NB 4IURA 4K2KA 4DAYA 3GTQH 5IWAQ 4K6LA 2F0IA 2WKCA 1VQEA 2EY2A 5AJ3L 3K5NA 4OGQC 5IY0A 4JOIA 2X6LA 4JI8L 3S1RB 1SJHD 4R4TA 4ID6A 1L0WA 2JK8A 2ZJPA 1K8MA 2D2CC 3MTSA 4K2LA 5C5MA 3TP6A 4C56C 1HZCA 1I4PA 4F8MA 2OF1A 1HZBA 3I7FA 1Y14B 1XMQQ 2R61A 4PMBA 2DJFC 2CVRA 1KAWA 4DR5L 2Q2UA 5E7NA 2HHHQ 3PIO3 1XPUA 3UDIA 1A3UA 3AMUA 5C0XH 4BA2I 3HOZB 3HKZG 4C3IB 1N32Q 2JN4A 4LF6L 2R6GA 2HCCA 3EFXD 5EPKA 2RCNA 1HA5A 2I5HA 1VQLA 2L15A 1EQTA 3OW7A 3M7NA 4M1UB 3R93A 1A62A 1HR0L 3G48A 4NDXA 1J5EQ 2RBMA 3QIAA 3J81c 2VQEL 3VDYA 2ZM6L 4ME3A 5HURA 1A63A 1HNZL 4PNYA 5EAYA 5I2XA 4P74A 2B2YA 4OHJA 2A73B 2MNAA 3HOXB 4X6AH 4C3HH 4ZKBB
chains in the Genus database with same CATH topology
2Z8LA 1WCMB 1NR4A 4J1MA 5CV6A 3NTKA 2JSOA 1R4PB 1ENCA 2LS01 5C3XA 2JA5B 2K5QA 4G7OC 1BBXC 1SAPA 5JOBA 1G91A 3PUZA 1MBYA 3G6JB 2ICIA 4HN7A 1G2SA 3A8IE 3Q24A 1AFPA 3WOEA 5CYUA 2KA7A 4KY7A 1A15A 3QJYA 3RUZA 1GUNA 3FDTA 2VB3X 1DM0B 2CW0C 1Q8IA 1HUNA 1C8CA 2F0PA 4IUTA 2PZTA 2NTSA 3X3NA 5I2YA 5EKIA 3GTMB 1H9RA 2XVSA 3NQIA 5CR3A 4QUFA 1ZYRC 3GD7A 3OIQA 1HPCA 1TIID 3BYYB 5EKKA 1EEID 1ESRA 4C3HB 3BVZA 3D31A 2J4XA 2F1MA 4H7BA 1JWUD 5EBDA 3KLRA 4IUPA 2BDOA 3L9AX 2RQXA 2NN6H 5EPJA 1ONLA 3BZDB 2NB0A 2A6ED 2F0WA 4C1NK 5D14A 5C3EB 1L0XB 5ELCA 1WD1A 3A8KE 3T51B 1KABA 2R7ZB 2F0TA 2PCFB 3A54A 1XYIA 1JB3A 3SHLA 2JA6B 1G2TA 4WRDA 5COYA 2QEJC 2AQ2B 4K8IA 3IKJA 1XX8A 1H9SA 1MGSA 3GTKB 2PMZB 5EGTA 3WOFA 2E2JB 1TVXA 3IFDA 5M5XB 1RD9D 3H3VC 2DY8A 3DM1A 5DNFA 1LV9A 3NQTA 1G291 4KV6A 2F0FA 1R9TB 1EWHA 2PNRC 1TY0A 2H1EA 1OXUA 2EYHA 4EQPA 2PZUA 1IHZA 1GUTA 4Q5VA 1BQQT 1CTMA 1TT2A 2RSNA 1J9OA 1KNEA 5CV5A 1PTOD 3CHBD 4DAPA 4MIUA 4HR7B 1GUOA 1YNND 1Y1WB 3K5LA 5KRUA 2SDFA 3DUZA 1XXGA 1II3A 1PTOF 3D4DA 3C3LA 4JK1C 1CT1D 2OEOA 4KY6A 1DZ1A 2RSOA 1BO0A 2A6HC 3TP5A 1DOMA 1QNUA 3KBGA 1OXVA 3H6MA 2AUKA 5D3DA 3NPPA 4PMCA 5T1IA 1BUVT 2EJFC 1F9SA 1AP0A 2A6HD 2I46A 1O80A 1CHPD 3LWUA 1CQVA 1SNCA 2XN9C 1ML0D 2H4OA 3V2TA 4CGYB 2O2LD 2BE5D 5DAUA 5I4DA 1BR9A 1TWCB 3MAQA 1TS3A 3K5OA 1RKNA 4RA8A 4KHVA 2EYPA 3PUVA 2QCPX 5JVH3 2A74C 3I73A 1LLRD 4LAAA 3HRZC 1JOKA 2O5IC 1QNKA 2BE5C 4AYBB 1D5XC 4K5WA 1C48A 2L0CA 5TSSA 4K5VA 5DM63 4WORA 2JA8B 1Q3LA 3QG1A 3T4AC 3G7LA 3RD4A 1PRTF 1IYUA 4RFBA 4PV1C 1FYCA 1UNSA 2IX0A 1PRTD 1EYCA 5T1GA 2BA0A 2MJ8A 3R2TA 3R3OA 1F9QA 4UDUC 5C0XI 3A55A 1SYEA 4YIJA 4R8NA 1D1KA 2K05A 3S9WA 3QWNA 3W2DA 4QF4A 2ZXOA 2EDGA 3I90A 1Q1BA 1WVLA 5EJWA 3DWPA 3UI2A 2EXZA 3C1EA 2TSSA 3HOVB 1EFID 1FR3A 3J7AF 5E3FA 1BCPB 1TWFB 3T56B 1E2ZA 1T5XD 5I6WA 5IGCA 2K28A 1IL8A 1LTSD 3V96A 1TWHB 3ERQA 1GXDC 3SR1A 3FPPA 4QB4A 1ZXTA 1B9NA 2E74C 2WB1B 3K59A 1SYFA 2IL8A 3A56A 4FF4A 3HZXA 3SVMA 1BCPD 2L1BA 1MSGA 1JE4A 4XIGS 4HSPA 2B2TC 2G9DA 1WTVA 1CK1A 1BCPF 3DMUA 4XQNA 3PO2B 3OOCA 1FNVA 4RKLA 3GP7A 3GQBA 4HTHA 2HUGA 1YNJC 3FKIB 3C1FA 4IUQA 4KK7A 3VYRA 4DN4M 5HGTA 1F9PA 1Q90A 3Q6SA 1DXMA 2F4IA 4IUVA 1MI2A 4C3HG 2LFNA 1SNMA 4DK0A 1CA6A 4A3IB 2C5CA 5BN3A 4A3DB 1HXYD 1F2YA 2XNAC 5DEHA 3KLSX 5IGFA 4RHRA 3I8ZA 1KDBA 5C4XB 3GV3A 2NVXB 1S5BD 4KN4C 5KNBA 1GOZA 4HMJA 1SEBD 2OT2A 3SK5A 2KOLA 3HKZB 4P2CB 1TS4A 3HGBA 3ND9A 1TKWB 1TS5A 4OIJA 2N55A 4CKCA 4BY1B 3D8GA 1SFOB 4ZQ3A 5IGGA 2MP1A 5FO9B 5LL6X 1IKMA 3P75A 2B2TA 4UAIA 4ZUJA 2NBFA 3DWAA 3FMCA 1PFNA 4XDXA 3KBXA 2L9HA 2PO4A 2DNCA 1FD7D 3EA6A 5G3LF 2AWNA 1STAA 1SMYC 3MFYA 3K57A 2NWGA 2Q8RE 4DXGA 3R2IA 4RWSC 1HTLD 3BVMA 1D6EC 1H9MA 4BBRB 1NR2A 1O7LA 1S5FD 1ESFA 2RA4A 1B3AA 3OPOA 2OXPA 1D5ZC 2WIIB 3NHHA 5KGUA 3AU7A 1BOSA 4DFAA 4U673 2ENBA 2KEEA 4DK1A 2FMCA 2EY1A 4L8JA 2FINB 4A3GB 1PXUA 1A6XA 2BCOA 4EQNA 4C3IG 4Y7NB 2D62A 1LTID 1ZYRD 5C4HA 4M8AA 3GTJB 1QB5D 3ND8A 2DN8A 2R93B 3JAML 1PMRA 5CV8A 1Y8NB 1GJXA 4DF7A 2RDGA 2NYZD 3W3AA 2VB2X 1WTRA 2O4XA 1Q12A 2K33A 4FXDA 1WTPA 3MZ5A 3RLFA 2B2VA 2D5DA 5FLXL 1I4HA 4CBVA 2CHBD 3A7AB 1SBBB 3DEPA 2DY7A 3NXWA 1FNWA 2Y0SB 1LTRD 4PQXA 3NTHA 4CKEA 3P7JA 2NN6G 4ULLA 2EYLA 2MUYA 3H91A 4HMIA 1LO5D 1PRTC 4OIKA 1W6JA 1F2MA 1SYDA 4OO1I 1KAAA 3MA2B 3S16B 4DAVA 3TP8A 1VMCA 1PRTB 1AN8A 1FGBD 2KUMA 2PZWA 3M3YB 3M85A 4IN3A 5JEAH 3TZUA 4A3JB 2FMMA 2B8GA 3T53B 4QUCA 5IIFA 2A6EC 2SOBA 1DOKA 3F2UA 2F3WA 4KD3A 2JEBI 2MGSA 2AWOA 1SYGA 5KYLA 1M8AA 2EYFA 3S2HB 5ELBA 5EQ0A 2NVQB 3VYSA 2E76C 1VCIA 3TBIB 3VA7A 5FK9C 1CQFA 3BS1A 1CA5A 2A69C 1B2TA 4I7ZC 5IGEA 3I91A 1G6ZA 3CRKC 3K58A 2SNSA 4BS9A 4XT3B 2CW0D 4RH6A 2EOTA 2IX1A 5A35A 3PIP3 2A69D 2A68C 4RCNA 5LHY1 3QO2A 2NTTA 3VR5A 2ZXPA 1IW7D 3VA5A 1QOHA 3SK6A 4R8IA 3RZOB 3X3MA 4K5XA 4HAEA 2SNMA 1YNNC 2B2VC 2KHSA 4C1NI 5NUCA 4TKOB 5J39A 1LTAD 1QCBD 1EIGA 1OXSC 5C6AA 2PQEA 1X3QA 4B08A 4ZYSA 2KCCA 3GO5A 5CMDA 2ICEC 1NUCA 1CI3M 4TQUS 4A93B 3MC0B 1EYDA 4DU9A 2L5TA 2B63B 1EY7A 4OO1H 1UUPA 3SK4A 3LNNA 1NAPA 4K8JA 2XWJB 4KKTA 2F3VA 2XWBB 1U4MA 1EY6A 4G4KA 1I6HB 1I4GA 4TRDA 5K36H 2RKSA 3SDZA 1JOOA 4A3FB 1DCZA 2NZ1D 4X3TA 4L63B 1I6VC 3MHBA 2LKVA 3FPUB 4R9WA 3U9SA 4IFDG 3KK7A 1PZJD 3BG3A 1SE2A 1I4QA 1X32A 4PMWA 3L3OC 2SEBD 2F0HA 4XTCS 2Q8IB 4FP5D 4KJNA 4KN7C 2F03A 1LT6D 1EEFD 5IGBA 3E0JA 2RDHA 3GTGB 2F0DA 1SMYD 3IFTA 3TDQA 1H9JA 3D6CA 1S5ED 2M2LA 3D4WA 1DJRD 4K14A 4TSSA 2IPKD 1F2LA 3LWEA 3NWTA 4CHTB 2O5JC 1VF7A 2K7VA 1CZGA 1S5DD 2Z4IA 1SDFA 4BBSB 1Z7TA 2BOSA 1PYWD 4KD4A 1QE6A 3SE0A 2MHVA 2ZXRA 3MWYW 5AFWA 2EJMA 2XRSD 1STNA 3J7YW 1TS2A 1Y69U 5C0XJ 1EY8A 2TMPA 1RTOA 2B2WC 1IKLA 4J8QA 1Q1EA 2F0KA 2Q8TA 4KTAA 4BA1I 1AZPA 2KECA 1JC7A 2YU9B 3FRPB 2B39A 1TU2B 3OMCA 3MXUA 3K6OA 2VXWA 1GUSA 2FFKB 1UAPA 3OMGA 1KLUD 3S1QB 1QJOA 2HCIA 1SE3A 3T13A 5IT9L 4ABNA 4FF2A 2IW3A 3TSSA 1ILQA 2EPBA 3NWSA 1Y1VB 2K32A 2EZVA 3S15B 1CHQD 4ZLTF 3D6WA 4KI0A 2L11A 1GUGA 4FVMA 2F0LA 3OWFA 4RGNA 3SEBA 4V190 3GTOB 2E2IB 3MXNA 4WFN3 1U4LA 4X3UA 1WD0A 4XQQA 3TZDA 3VR2A 5BN5A 5CV9A 2QF7A 2JE6I 2QKIC 3GTLB 5JAVA 3BYTB 1A2TA 1EY0A 5ELEA 1PFBA 5J22A 1RJTA 4NKLA 2NUCA 4H0LC 3DEOA 3MEHA 4CJ2C 3OWEB 4N9TA 1MSHA 3KLSA 3J80E 1A3VA 1GUWA 3VR6A 2A5HA 3C2PA 1B9MA 4LJZC 1HA6A 3I3CA 2KVMA 4FF3A 4Z9CB 1D5MC 4G7ZC 3MXGA 1D1IA 5IODA 4KMUC 4EQOA 1V43A 1VDZA 2E2DC 1B44D 3EJIA 4ZK9B 1GHJA 1H9KA 1BNZA 3K0YA 1BF4A 2PW7A 3J81L 4DGZA 2RVLA 3PO3B 2EYOA 1U9RA 4HSVA 1HCZA 3H09A 3HP3A 1F9RA 5CC4A 3M7GA 5JVG3 2JXMB 2C9OA 1ILPA 4MN3A 3EQLC 4CKBA 5ISRA 1VF5C 1V1OA 3A8JE 4O42A 4B9WA 5I6YA 1PLFA 5EKLA 2VNUD 2F0QA 5FLXE 4IZ8A 3LX0A 3S17B 2WACA 1MD2D 3R8BA 4KKUA 1HTPA 2JEAI 2F0OA 4RGTA 5EPLA 5EBCA 5JEAG 2HDLA 3M4YA 1RCVD 3I4MB 5C3WA 4XYQA 5LL6S 1JR0D 3WDNA 1S5CD 5E4WC 2F0NA 3DXJC 1O78A 2F0SA 5KNDA 5FOBB 2KQ3A 1L0YB 3TP7A 3K5MA 5E4XA 3BDLA 3ITPA 5D3IB 3OSOA 1HUMA 1VMPA 2I07B 1K8OA 5JPNC 2B2UC 4DNTB 4IFDJ 5C4JB 3J80L 1OXTA 2IT1A 5A2QL 2XRQD 3D4RA 1YNJD 1BDOA 5CORA 3N52A 1OXXK 4IUNA 2HQEA 2ZT9C 4EVOA 1LT3D 2BA1A 2JP1A 1NSNS 1B1ZA 3L7ZC 4OL7A 1WTWA 1UEAB 1EU4A 4MHEA 4RAUC 1RDPD 5KEEA 3S2DB 4GZYC 4FO2A 2D9UA 3PUWA 2RDFA 3HS0C 3BDCA 4XXEA 2NVTB 3OHXC 1AZQA 3GV6A 1EZ8A 1KNAA 3CQZB 1LTTD 5JJZA 1E2WA 1ET6A 1B50A 1EY4A 4IQZA 1V8QA 2EJGC 2K5WA 1STEA 5M3MB 1RHPA 4CJ0B 2F0UA 2AUJD 3QB3A 1SXTA 4OO1G 5ELDA 4G57A 2MPMA 2YYZA 3C46A 3URYA 3V05A 1ZEQX 4H13C 1O7ZA 4FXGC 3S1MB 3P1HA 5D65A 4F87A 4G7HC 3DWQA 3HOYB 5M3FB 5JPMC 4JBWA 5CGKA 1STBA 1PDQA 4X3SA 5ELFA 3VYUA 1S4ZA 3NBHA 1KTKA 1JICA 1LT5D 2A68D 2EY5A 3NTIA 4C3JG 3SXHA 5KYIA 1K83B 5I9PA 1SYCA 2B2WA 1EY5A 1JCKB 3I4LA 3PUXA 1STGA 1CFMA 2LY7A 4L6TB 1JWMD 5F2DA 4DNRB 2JA7B 1IYVA 4Q0FA 1U4RA 5E1FA 4NMZA 3OIPA 1T5EA 3JAME 1KLGD 3TMEA 3CKIB 4CJ1B 3BDOA 1Z47A 2EYJA 3E6ZX 2IWHA 3M4OB 2F0GA 1NCVA 4NP5A 3I70A 4A3EB 3VR4A 1OO9B 4RHSA 3Q0AA 4EGVA 1STHA 1HRJA 5C0XG 2F0EA 3SK8A 1FNUA 3QOJA 2K1BA 3GTPB 1SJED 2EYMA 2B2UA 3ZYYX 5CV7A 3Q22A 2K6AA 4ODGA 4RCOA 1SSOA 3NUCA 3EVQA 3QOLA 5FO8B 2JYOA 4J6HA 4IALA 2X69A 5IT9E 1QG7A 3TN2A 3CU7A 3I72A 2B8FA 2WV6D 1GHKA 2AQ1B 5K36G 1TWGB 1PTOH 5C44B 3K7AB 2KEDA 2B2YC 2GA4B 5J1ZA 1ET9A 1KDCA 2FHTA 3NK9A 4I65A 4BY7B 1PZKD 3S14B 2G9HD 1A3TA 2L12A 4IFDI 2WKDA 1EWCA 3RZDB 1EZ6A 1I4RA 3HEJA 2QDBA 1KDAA 1TR5A 1CM9A 2FJ2A 5CV4A 4LMQD 1PZID 2E2HB 1EQVA 3RMHA 1BXTA 2K04A 2N88A 2PW5A 3KUPA 3NP8A 4U68A 5M5YB 5C5LA 1EL0A 1J8IA 1V1PB 1SE4A 1IW7C 4QIWB 3N6RA 1DD2A 3IAYA 2CQAA 1U4PA 3KF8A 1F2ZA 2XSCA 2NN6I 4LK1C 1E2VA 1ENAA 4KJOA 3J81E 2KJXA 1LACA 4WJWA 1PTOB 5IOCA 1W6KA 1I3QB 1SNDA 5IGDA 2DNEA 2PPBC 1RTNA 1AEXA 1PTOC 4HCSA 1B4OA 1WTXA 3DHQA 4E6IA 5DM73 3HOWB 4A3KB 4O1NA 4KKSA 1LTBD 1F77A 1XWEA 3MXPA 1EY9A 4FF1A 4IUUA 1C4QA 1AW7A 4XQJA 1LTGD 1PFMA 1HFGA 3E5SA 1O7YA 4BWGB 2IJ0A 3I4NB 4KHZA 2L4NA 3MVVA 4N9PA 2VUMB 1V1PA 3NBIA 2BDNA 1TQOA 4RGOS 1TY2A 2Z4HA 2M9VA 3A7LA 2K5DA 2WAQB 4B9XA 4ZKCB 1HQRD 3FVQA 1I50B 1EYAA 2Z1CA 4A3BB 3HOUB 4F88A 4XYOA 5CBAE 3VYTA 1EU3A 3FEWX 2J0TD 1I4XA 1Y8OB 4C2MB 4X3KA 1EOTA 2QILA 3P20A 2AQ3B 2EE1A 3H0GB 5CBEE 2WP8J 4NW2A 4DA2A 2IX3A 3AB9A 4HEDA 2X6GA 2K01A 1M4VA 2WINB 2NVYB 2J7ZA 3O13A 4ILWA 4A3MB 5KNCA 5I9OA 1QWYA 4S3SA 1Z6HA 4HCEA 1DONA 5JEAJ 2L55A 1G8ZD 4C3JB 4V0BA 4FYDA 1ENFA 1HQMC 2HDMA 2R3ZA 4QMGA 2LMCB 1LT4D 1ZKOA 1WTQA 2F0JA 1SNPA 4F7XA 2R92B 4H44C 1D2BA 4IFDH 5A2QE 3BVGA 5M5WB 3NSWA 3CRLC 5K5PA 1JORA 1EIHA 3U9OA 1XTCD 2PYKA 3EROA 3T16A 1TWAB 4QCLA 3H94A 5G3LD 1SNQA 1LABA 1H9SB 5FO7B 1B53A 1RF2D 1JQYD 5FKAC 4RKBA 1WTOA 4FNFA 4ZRZA 2M00A 3GTQB 3IL8A 3PV0A 4XT1B 1CZWA 2ID0A 1BCPC 4ZAIA 1DYQA 2KCNA 2K03A 4FXKC 1A2UA 1X3PA 2F0MA 1JOQA 1HHVA 2XIWA 2EY6A 3VR3A 1R4QB 1STYA 3NE5B 1SYBA 2V4DA 4ME5A 1Y8PB 2F0VA 5BN4A 1HFNA 3D3RA 2E75C 3ONAB 4ZUIA 1SNOA 5KIXA 1DOLA 1QILA 3J7AV 1JWSD 1E0BA 1RODA 4DXFA 3PUYA 3HG9A 4KY5A 3Q23A 3MFGA 4RGMA 1ICWA 4K6DA 5M9OA 3PMFA 5C4ZA 2EVBA 3S1NB 4IURA 4K2KA 4DAYA 4K6LA 2F0IA 2WKCA 2EY2A 3K5NA 4OGQC 2X6LA 3S1RB 1SJHD 4ID6A 1K8MA 2D2CC 3MTSA 4K2LA 5C5MA 3TP6A 4C56C 1I4PA 4F8MA 2OF1A 2R61A 4PMBA 2CVRA 3PIO3 1A3UA 3AMUA 5C0XH 4BA2I 3HOZB 4C3IB 2R6GA 2HCCA 3EFXD 5EPKA 1HA5A 3OW7A 1EQTA 3M7NA 4M1UB 3R93A 4NDXA 2RBMA 3QIAA 5HURA 4PNYA 5I2XA 2B2YA 4OHJA 2A73B 3HOXB 4ZKBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HUM A;  1VMP A;  1AP0 A;  4OIJ A;  5D14 A;  2HDM A;  1HA6 A;  2R3Z A;  3I3C A;  2B2U C;  2FMM A;  2N55 A;  2KVM A;  4IUU A;  1RTO A;  1E0B A;  1O80 A;  2B2W A;  4QUC A;  1ROD A;  2FIN B;  1NR4 A;  1WD1 A;  1DOK A;  2B2W C;  1IKL A;  3F2U A;  1ML0 D;  1WTQ A;  2KED A;  1PFM A;  2MP1 A;  2K28 A;  1NAP A;  1HFG A;  2B2Y C;  2Q8T A;  1IL8 A;  1O7Y A;  1IKM A;  2B2T A;  5COR A;  2MGS A;  1ICW A;  4ZK9 B;  2FHT A;  2KEC A;  3N52 A;  1AZP A;  4UAI A;  1U4M A;  1XYI A;  1M8A A;  1BNZ A;  2L4N A;  1ZXT A;  1G2T A;  4RA8 A;  5COY A;  5EQ0 A;  1BBX C;  1SAP A;  2JP1 A;  1BF4 A;  1EIH A;  1G91 A;  1WTW A;  4IUR A;  2L12 A;  2RVL A;  1XX8 A;  1MGS A;  2IL8 A;  4MHE A;  1U4R A;  2BDN A;  1TVX A;  2VXW A;  3IFD A;  4HSV A;  1PFN A;  4XDX A;  2FFK B;  3KBX A;  4RAU C;  1G2S A;  3SVM A;  1CA5 A;  1QNK A;  1B2T A;  2L1B A;  1MSG A;  1CM9 A;  2FJ2 A;  3HP3 A;  1F9R A;  1JE4 A;  2DY8 A;  2X6L A;  3DM1 A;  2NZ1 D;  2D9U A;  5DNF A;  2B2T C;  2L9H A;  1LV9 A;  1A15 A;  4X3T A;  2NYZ D;  3I91 A;  4LMQ D;  1G6Z A;  1WTR A;  3FDT A;  2HCI A;  1ILP A;  3FPU B;  4MN3 A;  1B53 A;  4R9W A;  3MTS A;  1WTP A;  1WTV A;  4CJ1 B;  4ZKC B;  2K04 A;  2B2V A;  2N88 A;  1AZQ A;  4O42 A;  3GV6 A;  1Q3L A;  3KUP A;  3G7L A;  4XT3 B;  1ILQ A;  1KNA A;  1X32 A;  2H1E A;  1HUN A;  2EOT A;  1NCV A;  1PLF A;  3DEP A;  2DY7 A;  2NWG A;  5JJZ A;  2Q8R E;  1WTO A;  4U68 A;  1C8C A;  4IUT A;  2EPB A;  1B50 A;  1EL0 A;  2HUG A;  3IL8 A;  3QO2 A;  1J8I A;  4ZLT F;  2CVR A;  4RWS C;  3D6W A;  4IUQ A;  4XT1 B;  5T1G A;  2RSN A;  5CBA E;  1J9O A;  2L11 A;  5EKI A;  1KNE A;  1HRJ A;  4DN4 M;  2MJ8 A;  1F9P A;  3P7J A;  4ZAI A;  3Q6S A;  1U4P A;  2K1B A;  4X3K A;  4IUV A;  1RHP A;  1EOT A;  4CJ0 B;  1MI2 A;  1NR2 A;  2K03 A;  5EPL A;  2EE1 A;  3H91 A;  4QUF A;  1U4L A;  2HDL A;  4X3U A;  1X3P A;  2B2U A;  1WD0 A;  1F9Q A;  2HCC A;  3TZD A;  5CBE E;  1HHV A;  2XIW A;  2MPM A;  5EPK A;  2M2L A;  1CA6 A;  4NW2 A;  2SDF A;  4R8I A;  1ESR A;  1EQT A;  2RA4 A;  1O7Z A;  1B3A A;  4HAE A;  4HED A;  5E4W C;  1F2L A;  3LWE A;  3R93 A;  2X6G A;  2K01 A;  2B2V C;  2K05 A;  2J7Z A;  1DZ1 A;  4OIK A;  1HFN A;  1SSO A;  2RSO A;  5D65 A;  1BO0 A;  1DOM A;  1PFB A;  2JYO A;  4IUP A;  1RTN A;  1RJT A;  1EIG A;  3ONA B;  3I8Z A;  1SDF A;  3I90 A;  4CJ2 C;  1DON A;  3GV3 A;  3DEO A;  1WVL A;  4HCS A;  2X69 A;  1X3Q A;  1DOL A;  1B4O A;  1WTX A;  1QE6 A;  1QG7 A;  1VMC A;  5E4X A;  1PDQ A;  4X3S A;  5EJW A;  3MWY W;  5EPJ A;  5AFW A;  1MSH A;  2B2Y A;  2KEE A;  3UI2 A;  5CMD A;  1S4Z A;  1GUW A;  3TN2 A;  5T1I A;  2KUM A;  2KOL A;  4ZKB B;  1JIC A;  1F9S A; 
#chains in the Genus database with same CATH topology
 1X56 A;  1N9W A;  3KF6 A;  2Z8L A;  1UE7 A;  4OX9 Q;  1WCM B;  3OYY A;  1NR4 A;  4J1M A;  5CV6 A;  3NTK A;  1SN8 A;  2JSO A;  1R4P B;  1JJ2 A;  1ENC A;  1FJG L;  2CQO A;  2LS0 1;  5C3X A;  3CC2 A;  1BBU A;  2JA5 B;  3RR5 A;  4B3S L;  2K5Q A;  4EQ5 A;  4G7O C;  1BBX C;  1SAP A;  5JOB A;  1G91 A;  3PUZ A;  1MBY A;  4OWX B;  3G6J B;  1H95 A;  2ICI A;  4HN7 A;  1G2S A;  3A8I E;  3Q24 A;  1AFP A;  3WOE A;  2K14 A;  5CYU A;  1L1O A;  2KA7 A;  4LF5 Q;  3RN5 A;  4KY7 A;  1CKN A;  1A15 A;  3QJY A;  3RUZ A;  3PIP A;  1GUN A;  3FDT A;  3HOZ H;  2VB3 X;  2ES2 A;  1DM0 B;  4LFC Q;  4B3S Q;  3S24 A;  1X9N A;  1JB7 A;  2CW0 C;  1Q8I A;  1HUN A;  1VQO A;  1C8C A;  2F0P A;  4IUT A;  2PZT A;  2NTS A;  2E2J H;  4H02 A;  5M5X H;  3X3N A;  5I2Y A;  3F2B A;  1NMF A;  1S72 A;  3PIO A;  5EKI A;  3GTM B;  1H9R A;  2XVS A;  3NQI A;  5CR3 A;  2H5X A;  4Y52 H;  4YY3 Q;  1GD7 A;  3CCQ A;  4QUF A;  1ZYR C;  4K0K L;  3GD7 A;  3OIQ A;  5H1S E;  1N36 Q;  1HPC A;  1TII D;  2WAQ G;  3BYY B;  2UU9 L;  4LF6 Q;  2K50 A;  4JBJ A;  3HOX H;  5EKK A;  1EEI D;  1ESR A;  4C3H B;  5IYC G;  2YTV A;  3BVZ A;  4P73 A;  1UWV A;  3D31 A;  1WCM H;  4I7A A;  2J4X A;  2F1M A;  4H7B A;  1JWU D;  2PI2 A;  4A3B G;  5EBD A;  1HR0 Q;  3KLR A;  5IP9 H;  4IUP A;  2BDO A;  1SRU A;  4DV7 Q;  3L9A X;  2RQX A;  2MQH A;  2JA5 H;  2NN6 H;  2N78 A;  5EPJ A;  1ONL A;  3EIV A;  3BZD B;  1Y1W H;  2NB0 A;  2A6E D;  3E3X A;  2F0W A;  4DKA C;  4K0K Q;  4DV4 Q;  4OXP A;  4C1N K;  5D14 A;  5IP7 G;  1QVF A;  1B7Y B;  5C3E B;  4X64 L;  1L0X B;  1V1Q A;  1SE8 A;  4IPD A;  5ELC A;  1WD1 A;  3A8K E;  5IWA L;  4LFB Q;  3CCS A;  3T51 B;  4QY7 A;  1KAB A;  2R7Z B;  2F0T A;  2PCF B;  4DNI A;  5LMU Q;  4DV6 Q;  2A1A A;  3A54 A;  1XYI A;  5J3B A;  1JB3 A;  3SHL A;  2JA6 B;  1G2T A;  4WRD A;  5COY A;  1X3G A;  4LFC L;  2QEJ C;  2AQ2 B;  4DUY L;  4K8I A;  3HOW G;  3IKJ A;  1XX8 A;  1H9S A;  1MGS A;  3GTK B;  1MJC A;  2PMZ B;  5EGT A;  3WOF A;  2E2J B;  1TVX A;  3IFD A;  5M5X B;  1RD9 D;  3H3V C;  3GTM H;  2DY8 A;  3DM1 A;  4UY8 C;  5DNF A;  1LV9 A;  2XGT A;  2PI2 E;  3NQT A;  1G29 1;  4DV0 L;  4KV6 A;  1QVC A;  2F0F A;  1TWC H;  1R9T B;  1YI2 A;  1EWH A;  2PNR C;  1TY0 A;  2H1E A;  1OXU A;  2EYH A;  1O7I A;  4EQP A;  2PZU A;  1ICF B;  1IHZ A;  2UU9 Q;  1GUT A;  3NBH B;  4JI5 L;  4Q5V A;  1BQQ T;  1CTM A;  1TT2 A;  2Z0S A;  4IOC A;  1KQS A;  4QIW E;  2RSN A;  3U4V A;  1J9O A;  2VUM G;  1YEZ A;  1KNE A;  4P72 A;  5FLM H;  3W1G A;  3NEM A;  4LNQ A;  5CV5 A;  4CDD C;  4GN4 B;  1PTO D;  3CHB D;  4DAP A;  2JA8 H;  4MIU A;  2CWP A;  4HR7 B;  1GUO A;  4JW0 A;  2ALY B;  1YNN D;  1Y1W B;  3K5L A;  5KRU A;  2SDF A;  3KDF A;  3DUZ A;  2LXJ A;  1XXG A;  1II3 A;  1PTO F;  3D4D A;  1HNZ Q;  3C3L A;  4JK1 C;  1CT1 D;  4UP7 A;  2AKW B;  5JJL A;  2OEO A;  4KY6 A;  1DZ1 A;  5C3E H;  2RSO A;  2MO0 A;  1BO0 A;  2A6H C;  3TP5 A;  1DOM A;  1QNU A;  3CCJ A;  3KBG A;  1NNX A;  1OXV A;  3H6M A;  4JI4 L;  2AUK A;  2R7Z H;  2I5M X;  5D3D A;  3NPP A;  4PMC A;  2JA6 H;  5T1I A;  3QR8 A;  1BUV T;  2EJF C;  1F9S A;  1AP0 A;  2A6H D;  3CXC A;  4ALP A;  2I46 A;  3GTK H;  4LUO A;  1O80 A;  5LMN W;  1CHP D;  3LWU A;  1CQV A;  1SNC A;  2XN9 C;  1ML0 D;  2H4O A;  3V2T A;  3PO2 G;  4A3L G;  4CGY B;  2O2L D;  4LW1 A;  2BE5 D;  5DAU A;  3IRB A;  4MTN A;  5I4D A;  1BR9 A;  1TWC B;  3MAQ A;  1R9T H;  1WTH A;  1TS3 A;  3K5O A;  3B6Y A;  4IPH A;  1RKN A;  4RA8 A;  4KHV A;  1HZA A;  2EYP A;  3PUV A;  2QCP X;  4P71 A;  4LF4 L;  5JVH 3;  2A74 C;  3I73 A;  1VQ5 A;  1LLR D;  2CH4 W;  4JOI C;  3HRZ C;  4LAA A;  2CFM A;  1JOK A;  4TVA B;  2HHH L;  1QNK A;  2BE5 C;  4OWW B;  2O5I C;  1TWF H;  4AYB B;  1D5X C;  4K5W A;  1C48 A;  2L0C A;  4LF9 L;  5TSS A;  1MHW C;  1MIU A;  1A8V A;  4K5V A;  5DM6 3;  4WOR A;  2JA8 B;  5IYD H;  3ULJ A;  1TWH H;  1MJE A;  1Q3L A;  3QG1 A;  3T4A C;  3G7L A;  3RD4 A;  1PRT F;  1IYU A;  4GOP A;  1JJG A;  4RFB A;  4CDC C;  1N36 L;  4PV1 C;  1FYC A;  1UNS A;  2IX0 A;  2R7F A;  2I0Q A;  3EN2 A;  1IL2 A;  1PRT D;  1EYC A;  1XNR L;  4ZCK A;  3NEN A;  5T1G A;  2BA0 A;  2OTL A;  2MJ8 A;  4AYB G;  4JI7 L;  3R2T A;  3R3O A;  1E22 A;  1F9Q A;  1IBM Q;  4UHV A;  4UDU C;  5C0X I;  3PO2 H;  3A55 A;  1SYE A;  4A3L H;  1SR3 A;  4YIJ A;  4R8N A;  4YWL A;  1D1K A;  2VY3 A;  2JA7 G;  2CWA A;  2K05 A;  3S9W A;  4IJH A;  3QWN A;  3W2D A;  2HD3 A;  4JG2 A;  1D8L A;  4QF4 A;  2ZXO A;  3FP9 A;  2EDG A;  3I90 A;  2OCE A;  1Q1B A;  1WVL A;  4JYA Q;  2CKZ B;  5EJW A;  4AH6 A;  3DWP A;  3UI2 A;  1ASZ A;  2EXZ A;  3C1E A;  3ZJY C;  4A3I H;  2TSS A;  3HOV B;  1EFI D;  4A3D H;  1FR3 A;  4HIK A;  2OQ0 A;  1EIY B;  3J7A F;  5E3F A;  1BCP B;  1TWF B;  3T56 B;  1NJI C;  1E2Z A;  1T5X D;  5I6W A;  5IGC A;  2K28 A;  3PQI A;  5C4X H;  1IL8 A;  1LTS D;  3V96 A;  5GRO A;  4HJ9 A;  1TWH B;  3ERQ A;  1GXD C;  3SR1 A;  3FPP A;  4QB4 A;  4DR3 Q;  5BR8 Q;  1ZXT A;  1B9N A;  2E74 C;  2WB1 B;  3K59 A;  2QDL A;  1SYF A;  2VQF Q;  5IYC H;  2IL8 A;  1VQ9 A;  3A56 A;  4FF4 A;  3HZX A;  3SVM A;  1BCP D;  4BXX H;  2KCT A;  2L1B A;  4JI6 Q;  1MSG A;  1JE4 A;  4XIG S;  2DJG C;  4HSP A;  2UXC Q;  2B2T C;  1SLJ A;  2G9D A;  2UXD Q;  1WTV A;  1CK1 A;  2LSS A;  1BCP F;  3DMU A;  4XQN A;  3CD6 A;  3PO2 B;  3OOC A;  4JI5 Q;  1FNV A;  1UE6 A;  4RKL A;  4LF8 Q;  1LUZ A;  3GP7 A;  3GQB A;  5HY6 A;  1RIP A;  2HUG A;  4HTH A;  1BKB A;  4J15 A;  4GKK L;  1YNJ C;  3FKI B;  3C1F A;  4IUQ A;  4KK7 A;  3VYR A;  4AYB E;  1HNW Q;  4DN4 M;  5HGT A;  1F9P A;  2JJQ A;  1VQC A;  4DAY B;  1Q90 A;  3Q6S A;  1DXM A;  2F4I A;  4IUV A;  3RNU A;  1MI2 A;  1PH8 A;  4C3H G;  3AEV A;  1NY4 A;  2LFN A;  2IY5 B;  1SNM A;  4DK0 A;  4L5S A;  3W5O A;  1CA6 A;  2NZO A;  1M90 C;  5JJK A;  4A3G G;  4A3I B;  2Q2T A;  3J7A 5;  3CAM A;  2C5C A;  3HOV H;  5BN3 A;  4A3D B;  1K3R A;  1HXY D;  1F2Y A;  2XNA C;  5DEH A;  1K0S A;  2KBN A;  3KLS X;  5IGF A;  4QL5 A;  4RHR A;  3I8Z A;  1IBM L;  1KDB A;  3AFQ A;  5C4X B;  3GV3 A;  2RCF A;  2UUA L;  1S5B D;  1XTD A;  4KN4 C;  5KNB A;  2NVX B;  1IZ6 A;  3OTO L;  1GOZ A;  4HMJ A;  2ZJR A;  3WWV A;  1KC8 C;  1SEB D;  2OT2 A;  3SK5 A;  2KOL A;  3HKZ B;  1NMG A;  4P2C B;  1TS4 A;  3HGB A;  3ND9 A;  1TKW B;  1TS5 A;  4OIJ A;  2N55 A;  4CKC A;  4DUY Q;  4BY1 B;  3D8G A;  2GVB A;  1SFO B;  4ZQ3 A;  1JE5 A;  5IGG A;  2MP1 A;  4JCV E;  5LMU L;  1JMC A;  5FO9 B;  4DR5 Q;  1WJJ A;  5LL6 X;  1IKM A;  3P75 A;  2B2T A;  4UAI A;  4ZUJ A;  2NBF A;  2KHJ A;  3DWA A;  1PH6 A;  1XJV A;  2ZTD A;  3FMC A;  4GNX C;  1YVC A;  1SRO A;  1PFN A;  3FKI H;  3KBX A;  4XDX A;  5C3E G;  4NB3 A;  2F3I A;  4BBR G;  1EOV A;  2L9H A;  2PO4 A;  1YJ9 A;  2DNC A;  2Q2I A;  1FD7 D;  3KYH C;  3EA6 A;  3L0O A;  2JQO A;  1XMO L;  1Q81 C;  5G3L F;  5IP9 G;  2AWN A;  1STA A;  1SMY C;  3H15 A;  1HR0 W;  2WB1 E;  2NZH A;  3MFY A;  3K57 A;  3GTJ H;  2NWG A;  4UP9 A;  2Q8R E;  4DXG A;  5C44 G;  4GKK Q;  3R2I A;  1VQD A;  2R93 H;  4RWS C;  3F2D A;  1U0L A;  1HTL D;  3BVM A;  1D6E C;  1H9M A;  4BBR B;  1VQG A;  1NR2 A;  2NVX H;  2UXD L;  3JC6 6;  2DUD A;  4PZ8 A;  1O7L A;  1HH2 P;  1VS0 A;  5M3M G;  1S5F D;  1ESF A;  1I94 L;  1I5F A;  2RA4 A;  1B3A A;  3OPO A;  4L5T A;  2OXP A;  3BZK A;  1D5Z C;  4BY1 H;  1Q46 A;  1SFO H;  2WII B;  3NHH A;  5KGU A;  1PA6 A;  3CC4 A;  3AU7 A;  5BR8 L;  4KHP Q;  1BOS A;  2VW9 A;  4O2D A;  4DFA A;  1EQR A;  4AQY L;  3FKI G;  4LF8 L;  4U67 3;  2ENB A;  1Q82 C;  2KEE A;  4PZ7 A;  3I4O A;  1KL9 A;  1GO3 E;  1KXL A;  4DK1 A;  4QGU A;  2FMC A;  4DUZ Q;  2EY1 A;  2R93 G;  4CDE C;  1K9M C;  4L8J A;  2FIN B;  4A3G B;  3K7U C;  1PXU A;  1A6X A;  2BCO A;  4EQN A;  4OEL B;  4C3I G;  4Y7N B;  3AYH B;  2RHS B;  4DR1 L;  2D62 A;  1LTI D;  1ZYR D;  1VQA A;  5C4H A;  2Q2H A;  1W2B A;  4JBM A;  1K8A C;  3K0X A;  4M8A A;  3GTJ B;  3M3Y H;  1QB5 D;  3ND8 A;  2DN8 A;  3A5Z B;  2R93 B;  3JAM L;  1PMR A;  5CV8 A;  1Y8N B;  1GJX A;  4DF7 A;  2B29 A;  2EQS A;  2RDG A;  5L37 A;  4BBR H;  2NYZ D;  3W3A A;  2VB2 X;  1WTR A;  2O4X A;  1Q12 A;  2K33 A;  4GNX B;  4FXD A;  1WTP A;  3MZ5 A;  3RLF A;  2B2V A;  2D5D A;  5FLX L;  2CCZ A;  1I4H A;  4DPG A;  4CBV A;  3S2H H;  2CHB D;  2NVQ H;  3A7A B;  1SBB B;  4BXX G;  3DEP A;  2DY7 A;  3NXW A;  1FNW A;  2Y0S B;  2UUB L;  1LTR D;  4PQX A;  3NTH A;  3M4P A;  4CKE A;  2YTY A;  3G6E A;  4MNO A;  3P7J A;  5FLM G;  1N34 L;  1N32 L;  2NN6 G;  4ULL A;  2EYL A;  2MUY A;  3H91 A;  3UDG A;  4LUV A;  4HIM A;  4DV0 Q;  4HMI A;  4A3J G;  1LO5 D;  4GOP C;  1PRT C;  3JAM c;  4OIK A;  2JA9 A;  1W6J A;  1F2M A;  1SYD A;  4OO1 I;  4A3G H;  1KAA A;  3MA2 B;  3E9I A;  4POF A;  3S16 B;  4Y7N H;  4DAV A;  1K0R A;  3RLN A;  1M1K C;  3TP8 A;  4JV5 Q;  1B70 B;  1VMC A;  5IYB G;  1PRT B;  4WJ3 M;  1AN8 A;  1FGB D;  2B3G A;  1EUJ A;  1G51 A;  1LYL A;  2KUM A;  2PZW A;  3M3Y B;  3M85 A;  4IN3 A;  5JEA H;  2HQL A;  3RZO H;  3TZU A;  4A3J B;  3HOU G;  2FMM A;  3TS2 A;  2B8G A;  3T53 B;  4PZ6 A;  4QUC A;  5IIF A;  2A6E C;  2SOB A;  1DOK A;  3F2U A;  2F3W A;  4KD3 A;  1K28 A;  2JEB I;  4NXM Q;  5LMN L;  2MGS A;  2AWO A;  1SYG A;  5KYL A;  1M8A A;  2EYF A;  3S2H B;  5ELB A;  4JPB W;  1WOC A;  5EQ0 A;  2NVQ B;  1VQ6 A;  3VYS A;  2E76 C;  4OX9 L;  1VCI A;  3TBI B;  3VA7 A;  5FK9 C;  4POG A;  4UP8 A;  2RF4 A;  3J80 c;  1CQF A;  4QQB X;  4DV1 Q;  1XPR A;  4A93 H;  3BS1 A;  1CA5 A;  2K75 A;  2A69 C;  1B2T A;  4I7Z C;  2D0P A;  5IGE A;  3I91 A;  1G6Z A;  1HNX Q;  3CRK C;  3TRE A;  4QJF A;  3K58 A;  1E1O A;  3CP0 A;  2SNS A;  4BS9 A;  4XT3 B;  2CW0 D;  4RH6 A;  2KEN A;  2EOT A;  3UE0 A;  2IX1 A;  5A35 A;  3TRZ A;  1I6H H;  3PIP 3;  1KHI A;  2WB1 G;  2A69 D;  2A68 C;  2GVA A;  3G4S A;  4RCN A;  5LHY 1;  3QO2 A;  2NTT A;  5ELO A;  3VR5 A;  3T1Y Q;  4A3F H;  2ZXP A;  1IW7 D;  3KFU A;  3A74 A;  3S16 H;  4JI1 L;  4DR6 Q;  1PH9 A;  4A3I G;  1X3E A;  4LWC A;  3VA5 A;  1QOH A;  4BY7 G;  1IYJ B;  1K3B C;  3SK6 A;  1Q8K A;  4R8I A;  3RZO B;  3X3M A;  3PSI A;  4K5X A;  4A3J H;  4HAE A;  2SNM A;  1YNN C;  2B2V C;  3KF8 B;  3BJU A;  1JJC B;  2KHS A;  4C1N I;  5NUC A;  4TKO B;  5J39 A;  1LTA D;  1QCB D;  1EIG A;  1OXS C;  5C6A A;  2PQE A;  1X3Q A;  4B08 A;  4ZYS A;  2KCC A;  4UPA A;  4IPC A;  3GO5 A;  5CMD A;  2ICE C;  1FVI A;  1NUC A;  1CI3 M;  4TQU S;  1VQP A;  2WAQ E;  1PH5 A;  1PH7 A;  4A93 B;  2QW7 A;  3MC0 B;  1EYD A;  4DU9 A;  2L5T A;  1XMO Q;  1K8G A;  2B63 B;  1QVG A;  1EY7 A;  1NE3 A;  3LGJ A;  4OO1 H;  1UUP A;  3SK4 A;  3LNN A;  1NAP A;  4BBS H;  4K8J A;  2XTI A;  4GLV B;  2XWJ B;  1X3F A;  4KKT A;  2F3V A;  2XWB B;  1U4M A;  3NEL A;  1KRS A;  1VQN A;  2KCM A;  1EY6 A;  4G4K A;  1I6H B;  1X65 A;  2QEX A;  4GNX A;  1I4G A;  4TRD A;  5K36 H;  2RKS A;  3RLO A;  3SDZ A;  1JOO A;  4R4O A;  4A3F B;  1DGS A;  1DCZ A;  3AFP A;  2VZA A;  4X62 L;  2NZ1 D;  1QUQ A;  4JI0 L;  4X3T A;  4L63 B;  1I6V C;  3MHB A;  4JI3 Q;  2LKV A;  3FPU B;  5GAE C;  1YHA A;  4R9W A;  3U9S A;  4IFD G;  3KK7 A;  4YHH Q;  1PZJ D;  3BG3 A;  1E7Z A;  1SE2 A;  2PQA A;  1I4Q A;  4X65 L;  1X32 A;  2YU9 H;  4YWK A;  4L5R C;  4PMW A;  3L3O C;  2SEB D;  2F0H A;  4XTC S;  2Q8I B;  4KJN A;  2DGY A;  4FP5 D;  4KN7 C;  1KD1 C;  1RL2 A;  2F03 A;  1LT6 D;  1EEF D;  5IGB A;  5M3F G;  1VQB A;  3S1Q H;  1Y1W G;  1UEB A;  3E0J A;  4DV2 L;  2RDH A;  3GTG B;  2F0D A;  1SMY D;  3IFT A;  3TDQ A;  1H9J A;  4JBK A;  3D6C A;  4YHH L;  1S5E D;  2M2L A;  3D4W A;  2CH4 A;  1DJR D;  1Q7Y C;  4K14 A;  4TSS A;  2IPK D;  1F2L A;  3LWE A;  3NWT A;  4CHT B;  1EFW A;  2HT1 A;  5IP7 H;  2O5J C;  1VF7 A;  2K7V A;  2B63 H;  1CZG A;  1S5D D;  4LFA L;  2Z4I A;  3T1H L;  1SDF A;  3GTO H;  4BBS B;  1Z7T A;  2E2I H;  4R1J A;  2BOS A;  1PYW D;  4KD4 A;  3RN2 A;  1QE6 A;  3SE0 A;  2MHV A;  2ZXR A;  3MXN B;  3MWY W;  5AFW A;  2EJM A;  2XRS D;  4OEM B;  1STN A;  3J7Y W;  1PHJ A;  1TS2 A;  4DUZ L;  4YY3 L;  1Y69 U;  1VQ4 A;  5C0X J;  1EY8 A;  5FLX c;  2E8G A;  2TMP A;  1RTO A;  5HGQ A;  3UDX A;  2ASB A;  1B8A A;  2B2W C;  1IKL A;  4AQY Q;  4J8Q A;  1Q1E A;  2F0K A;  2Q8T A;  2D0O A;  4KTA A;  4BA1 I;  1AZP A;  2KEC A;  1JC7 A;  4B3R L;  4DK3 C;  2YU9 B;  3FRP B;  2B39 A;  4A3E G;  1TU2 B;  3OMC A;  3E9H A;  3CC7 A;  3PGZ A;  3MXU A;  1C9O A;  3K6O A;  2VXW A;  1GUS A;  2FFK B;  1UAP A;  3OMG A;  1KLU D;  1L2F A;  4JV5 L;  3S1Q B;  1QJO A;  4YWM A;  2HCI A;  3GTG H;  4BY1 G;  1SE3 A;  3T13 A;  5IT9 L;  3KF6 B;  4DR4 L;  3D0F A;  1PH3 A;  1EWI A;  4ABN A;  4FF2 A;  2IW3 A;  3TS0 A;  3E0E A;  3TSS A;  1ILQ A;  2A19 A;  2EPB A;  3NWS A;  1Y1V B;  2K32 A;  2EZV A;  3S15 B;  1CHQ D;  4ZLT F;  3D6W A;  4KI0 A;  1VQM A;  4JYA L;  1VQH A;  1B3Q A;  1GUG A;  2L11 A;  4FVM A;  1PH2 A;  2OTJ A;  4OWT B;  2F0L A;  3OWF A;  4RGN A;  3SEB A;  4V19 0;  1N34 Q;  3GTO B;  2E2I B;  1AE3 A;  3MXN A;  4WFN 3;  1U4L A;  3DM3 A;  4X3U A;  1WD0 A;  3ER0 A;  4XQQ A;  3TZD A;  3VR2 A;  4JI0 Q;  5BN5 A;  5CV9 A;  2QF7 A;  2UUB Q;  2JE6 I;  2QKI C;  3GTL B;  3S17 H;  4LF9 Q;  4GN5 A;  5JAV A;  3BYT B;  1A2T A;  1EY0 A;  5ELE A;  1PFB A;  5J22 A;  1QZG A;  1RJT A;  4GS3 A;  4NKL A;  4GKJ Q;  2NUC A;  4H0L C;  3DEO A;  3U58 A;  3MEH A;  3STB D;  4CJ2 C;  3OWE B;  4N9T A;  3I55 A;  3I4M H;  1MSH A;  2Z9H A;  3KLS A;  5LMN Q;  3J80 E;  1A3V A;  3HKZ E;  3SGI A;  3VR6 A;  1GUW A;  3ERS X;  1E24 A;  2A5H A;  3C2P A;  1B9M A;  4LJZ C;  1HA6 A;  3I3C A;  1SMX A;  2KVM A;  4FF3 A;  4Z9C B;  1D5M C;  4G7Z C;  3MXG A;  1D1I A;  2EIF A;  5IOD A;  4KMU C;  3H3V H;  4EQO A;  1V43 A;  1VDZ A;  2E2D C;  3UE1 A;  1B44 D;  3EJI A;  4ZK9 B;  5IYD G;  1HNW L;  4DV4 L;  1GHJ A;  1H9K A;  1BNZ A;  3KOJ A;  3K0Y A;  1NBW A;  2V1C C;  1BF4 A;  3CCL A;  2PW7 A;  3J81 L;  4DGZ A;  3K81 C;  1Y1V H;  2RVL A;  4N8F A;  3PO3 B;  2EYO A;  3S15 H;  4B3M Q;  1U9R A;  4HSV A;  1HCZ A;  3TEH B;  3J7Z C;  1PYS B;  3DLL A;  4DV7 L;  3H09 A;  4L5Q A;  3HP3 A;  1F9R A;  5CC4 A;  3M7G A;  4HIO A;  2JXM B;  2C9O A;  5JVG 3;  1ILP A;  4MN3 A;  3EQL C;  4CKB A;  5ISR A;  1VF5 C;  1V1O A;  4DR6 L;  3A8J E;  4O42 A;  4OON A;  4B9W A;  5I6Y A;  3ULL A;  1PLF A;  5EKL A;  2VNU D;  2F0Q A;  5FLX E;  2WFW A;  4IZ8 A;  1C0A A;  3LX0 A;  3GTL H;  2QA4 A;  3S17 B;  2WAC A;  1YIT A;  3PF4 A;  2QGQ A;  1E3P A;  2BH8 A;  3S2D H;  1MD2 D;  1HZ9 A;  3R8B A;  5GAG C;  4JI2 Q;  4KKU A;  2UXC L;  1HTP A;  2JEA I;  2F0O A;  4RGT A;  4KLK A;  5EPL A;  5EBC A;  5JEA G;  2HDL A;  3M4Y A;  2NVT H;  1RCV D;  2JA6 G;  3I4M B;  4IPG A;  5C3W A;  4XYQ A;  1YZ6 A;  5LL6 S;  4X66 L;  1JR0 D;  3CQZ H;  3WDN A;  4X66 Q;  1S5C D;  5E4W C;  1Z9F A;  2F0N A;  1TXY A;  1O78 A;  1W3S A;  2F0S A;  3DXJ C;  5KND A;  5FOB B;  2A8V A;  2KQ3 A;  4JI4 Q;  3T1Y L;  2OWO A;  1CKN B;  1L0Y B;  3TP7 A;  1YJN A;  5IT9 c;  2PMZ E;  2P5Z X;  2UUC L;  3K5M A;  5E4X A;  3BDL A;  3ITP A;  5D3I B;  1PYB A;  3J80 i;  4DR1 Q;  3K8A A;  3OSO A;  1HUM A;  1VMP A;  4R4I A;  2I07 B;  3PO3 H;  1K8O A;  5JPN C;  3A5U A;  2B2U C;  1J6Q A;  2Z6K A;  4DNT B;  4IFD J;  5C4J B;  3J80 L;  1OXT A;  2ZTC A;  2IT1 A;  5M3F H;  5A2Q L;  2XRQ D;  3D4R A;  1YNJ D;  4DR2 L;  1BDO A;  5COR A;  3HOZ G;  3N52 A;  1CUK A;  1OXX K;  4IUN A;  3BU2 A;  1PVO A;  2HQE A;  2ZT9 C;  4EVO A;  1LT3 D;  2BA1 A;  2JP1 A;  1NSN S;  1B1Z A;  3L7Z C;  4OL7 A;  1WTW A;  5DLQ E;  4NPS A;  1UEA B;  1EU4 A;  1P16 A;  3CPF A;  4MHE A;  1K83 H;  4RAU C;  1RDP D;  5KEE A;  4X62 Q;  3S2D B;  4GZY C;  3Q8D A;  4FO2 A;  1XMQ L;  2D9U A;  4R4C A;  3PUW A;  4R4Q A;  2RDF A;  3HS0 C;  3H0G G;  3BDC A;  1PV4 A;  1YIJ A;  4XXE A;  4DR7 L;  3OHX C;  2NVT B;  4X65 Q;  1AZQ A;  3GV6 A;  4HJA A;  3EBE A;  1EZ8 A;  1KNA A;  3CQZ B;  1LTT D;  5JJZ A;  2JA7 H;  1GM5 A;  1E2W A;  1ET6 A;  1B50 A;  1EY4 A;  3PCO B;  4A4I A;  1E1T A;  4JI8 Q;  5FJ8 H;  1KRT A;  4IQZ A;  1V8Q A;  2Z6K C;  2EJG C;  2PNH A;  2K5W A;  3HOY G;  1STE A;  3HFZ B;  3GDE A;  3STB C;  3M9B A;  3I2Z A;  5M3M B;  1RHP A;  4APV A;  4CJ0 B;  2F0U A;  2AUJ D;  3QB3 A;  1EYG A;  1SXT A;  3F2C A;  5ELD A;  4OO1 G;  4G57 A;  4LF4 Q;  2MPM A;  2YYZ A;  3C46 A;  3M4O H;  3URY A;  3V05 A;  1ZEQ X;  1XNQ Q;  4H13 C;  1O7Z A;  4FXG C;  3S1M B;  3P1H A;  5D65 A;  1C7Y A;  5C4J H;  4F87 A;  4JC0 A;  4G7H C;  3DWQ A;  3HOY B;  3OW2 A;  5M3F B;  5JPM C;  3GTP H;  1XPO A;  4JBW A;  1Q86 C;  3G71 A;  4YCV A;  5CGK A;  1STB A;  4GLX A;  1PDQ A;  4X3S A;  3MEF A;  5ELF A;  1K73 C;  3VYU A;  1S4Z A;  2EXD A;  3W1B A;  3NBH A;  1KTK A;  3M4Q A;  1JIC A;  2KHI A;  5IYB H;  1LT5 D;  2A68 D;  2EY5 A;  3NTI A;  4C3J G;  3SXH A;  5KYI A;  4DV3 Q;  4JI1 Q;  2MFI A;  4DV5 L;  1K83 B;  5I9P A;  1SYC A;  2B2W A;  1EY5 A;  1JCK B;  3I4L A;  3PUX A;  1STG A;  5FJ8 G;  1CFM A;  1YHQ A;  3FHW A;  2LY7 A;  4L6T B;  1JWM D;  5F2D A;  4HJ5 A;  2UUA Q;  1FL0 A;  2LXK A;  4DNR B;  3K80 C;  2JA7 B;  2YV5 A;  3J81 j;  4A76 A;  1IYV A;  4JVZ A;  4Q0F A;  1TWG H;  5C44 H;  2E5L L;  1U4R A;  3T1H Q;  5E1F A;  4NMZ A;  5GAH C;  4YCW A;  3OIP A;  1CSQ A;  2I5L X;  1T5E A;  3JAM E;  4A93 G;  1D7Q A;  5M3M H;  1KLG D;  3TME A;  5C4X G;  3CKI B;  4CJ1 B;  3BDO A;  2Y0S G;  1Z47 A;  2EYJ A;  3E6Z X;  2IWH A;  3M4O B;  2F0G A;  1NCV A;  2MO1 A;  3HOV G;  4NP5 A;  3I70 A;  4HJ7 A;  2E5L Q;  4A3E B;  1MKH A;  1X54 A;  3RZD H;  1IBL Q;  3S1M H;  2K4K A;  1XNQ L;  3VR4 A;  3CF5 A;  1OO9 B;  4RHS A;  3Q0A A;  4EGV A;  1FGU A;  3U50 C;  1STH A;  1HRJ A;  4RG1 A;  5C0X G;  3HOY H;  2F0E A;  3SK8 A;  2N3S A;  1A0I A;  1FNU A;  3QOJ A;  2K1B A;  3GTP B;  4JI7 Q;  1SJE D;  2R7D A;  2OQK A;  2EYM A;  2B2U A;  4MZ9 A;  3ZYY X;  1WCM G;  5CV7 A;  3Q22 A;  3KJP A;  1IBK Q;  4NXM L;  3BZC A;  2K6A A;  4ODG A;  1HJP A;  4IOA A;  4EX5 A;  4GN3 B;  1SSO A;  4RCO A;  3NUC A;  3EVQ A;  4DR7 Q;  3QOL A;  5FO8 B;  2JYO A;  2VQF L;  3AQQ A;  4J6H A;  4IAL A;  5JJI A;  1WI5 A;  2X69 A;  5IT9 E;  1QG7 A;  3F8T A;  3TN2 A;  3CU7 A;  4GOP B;  3I72 A;  1ASY A;  2B8F A;  4P75 A;  2WV6 D;  1GHK A;  4MTK A;  2AQ1 B;  5K36 G;  2AHO B;  2UXB Q;  4B3M L;  1TWG B;  1PTO H;  5C44 B;  3K7A B;  1T9H A;  4DV3 L;  2VL6 A;  4GKJ L;  3HKS A;  2KED A;  2G5D A;  2B2Y C;  1VQF A;  2GA4 B;  5J1Z A;  1ET9 A;  1KDC A;  1X6O A;  2FHT A;  3NK9 A;  4I65 A;  4BY7 B;  1PZK D;  3S14 B;  2G9H D;  3ICE A;  4X64 Q;  1L1O C;  4A3E H;  1A3T A;  2L12 A;  4IFD I;  2WKD A;  1EWC A;  1VQK A;  3RZD B;  4DK6 C;  1EZ6 A;  1I4R A;  2FXQ A;  3HEJ A;  1GKH A;  3CCE A;  2QDB A;  4CDF C;  1KDA A;  1TR5 A;  1CM9 A;  2FJ2 A;  5CV4 A;  4PG3 A;  5ELN A;  1EIF A;  4LMQ D;  1PZI D;  2E2H B;  1EQV A;  3ULP A;  3RMH A;  1BXT A;  3I4N H;  2K04 A;  2N88 A;  2PW5 A;  3KUP A;  3NP8 A;  1U5K A;  4U68 A;  5M5Y B;  3CMA A;  5C5L A;  1GVP A;  1EL0 A;  2YTX A;  3PO3 G;  1V1P B;  1J8I A;  1SE4 A;  1CSP A;  1XNR Q;  3U4Z A;  1IW7 C;  1V9P A;  3A0J A;  4QIW B;  3N6R A;  1DD2 A;  3IAY A;  2CQA A;  1U4P A;  3KF8 A;  1F2Z A;  1VQI A;  2XSC A;  2NN6 I;  4LK1 C;  4O0A A;  2F4V L;  1E2V A;  1N33 L;  1ENA A;  4KJO A;  3J81 E;  1I50 H;  2KJX A;  1LTL A;  1LAC A;  4WJW A;  4A3B H;  1PTO B;  3HOU H;  3K7A H;  1W6K A;  3CW2 C;  5IOC A;  1I3Q B;  1SND A;  2R92 G;  5IGD A;  1QUQ B;  1JT8 A;  2DNE A;  2PPB C;  1Y1V G;  1FJG Q;  4C2M H;  1RTN A;  1IBL L;  3KLW A;  1AEX A;  1AE2 A;  2VQE Q;  4RMF A;  1PTO C;  4HCS A;  1X55 A;  1B4O A;  1WTX A;  3DHQ A;  4E6I A;  5DM7 3;  3HOW B;  4A3K B;  4O1N A;  4BY7 H;  4KKS A;  4DR2 Q;  3S14 H;  1YBY A;  1CKM A;  1LTB D;  2B63 G;  1F77 A;  1XWE A;  2RHQ B;  4LUZ A;  3MXP A;  1EY9 A;  4FF1 A;  4IUU A;  4JI6 L;  1C4Q A;  3HOX G;  1AW7 A;  4XQJ A;  1PFS A;  2E2H H;  4N8X 1;  1LTG D;  1PFM A;  1HFG A;  3E5S A;  4HJ8 A;  4AIM A;  4B3T L;  3CCR A;  1O7Y A;  4BWG B;  2IJ0 A;  3I4N B;  4JI2 L;  4DR3 L;  4KHZ A;  1BVS A;  3JAM i;  4YCU A;  4A3K G;  2L4N A;  3MVV A;  1S40 A;  4N9P A;  4A3F G;  2F4V Q;  2VUM B;  2JA5 G;  5M5Y H;  1CKO A;  1V1P A;  3NBI A;  2BDN A;  1TQO A;  4RGO S;  1TY2 A;  2Z4H A;  3I56 A;  2M9V A;  1QZH A;  3KDF B;  3A7L A;  2K5D A;  3PF5 A;  2WAQ B;  2K5N A;  1PH1 A;  4B9X A;  4ZKC B;  1HQR D;  1L1O B;  3FVQ A;  1I50 B;  1EYA A;  2Z1C A;  1LM0 A;  1N33 Q;  2ATW A;  4A3B B;  3HOU B;  1TWA H;  4F88 A;  1I3Q H;  4XYO A;  5CBA E;  3VYT A;  1EU3 A;  3FEW X;  4IJL A;  2J0T D;  4JI3 L;  4WJ4 A;  4A3C G;  1I4X A;  1WFQ A;  1Y8O B;  4C2M B;  4IO9 A;  4X3K A;  1EOT A;  2QIL A;  3P20 A;  2AQ3 B;  2EE1 A;  5AJ3 Q;  2UXB L;  3H0G B;  1PH4 A;  3HOW H;  4A3K H;  4LFB L;  5CBE E;  2WP8 J;  4NW2 A;  4DA2 A;  2IX3 A;  3CCU A;  3J81 i;  3OTO Q;  3AB9 A;  4NXN Q;  3CPW A;  2HIV A;  4HED A;  2X6G A;  2K01 A;  1M4V A;  3O13 A;  2AMC B;  2J7Z A;  2NVY B;  2WIN B;  4ILW A;  4BBS G;  4FDB A;  3TQY A;  1AH9 A;  2ZJQ A;  4A3M B;  4DAM A;  5KNC A;  1S3O A;  4A3D G;  5I9O A;  1QWY A;  4S3S A;  1Z6H A;  4HCE A;  1DON A;  5JEA J;  2L55 A;  4LF5 L;  4DV6 L;  3CME A;  1G8Z D;  4C3J B;  4V0B A;  1N8R C;  4FYD A;  2N8N A;  2PQA B;  1ENF A;  5GQO A;  2VUM H;  4LF7 Q;  1HQM C;  2HDM A;  2R3Z A;  2JA8 G;  1BBW A;  4QMG A;  3CCM A;  2LMC B;  1KIX A;  1LT4 D;  1ZKO A;  1WTQ A;  2K5V A;  2Y0S E;  2F0J A;  1SNP A;  4F7X A;  2R92 B;  2Z6B A;  4H44 C;  1IBK L;  1D2B A;  1G6P A;  4IFD H;  5A2Q E;  3BVG A;  3UDF A;  5M5W B;  4A3C H;  3NSW A;  3CRL C;  5K5P A;  4A75 A;  1JOR A;  1UE1 A;  2R7Z G;  1EIH A;  3U9O A;  1XTC D;  2PYK A;  2C35 B;  3ERO A;  3T16 A;  1WYD A;  3F1Z A;  1TWA B;  4KHP L;  4QCL A;  3H94 A;  5G3L D;  1SNQ A;  1LAB A;  1H9S B;  4HID A;  5FO7 B;  2ZTE A;  4B3R Q;  1B53 A;  1NTG A;  1RF2 D;  3H0G H;  4LFA Q;  1JQY D;  1J5E L;  2BH2 A;  1UE5 A;  2GN5 A;  5FKA C;  4RKB A;  2UUC Q;  3S1N H;  1WTO A;  4FNF A;  4ZRZ A;  2M00 A;  3I4N G;  3GTQ B;  2K52 A;  2NVY H;  3IL8 A;  3PV0 A;  4B3T Q;  4XT1 B;  3L2P A;  1CZW A;  2ID0 A;  1HNX L;  1BCP C;  4A3M H;  4ZAI A;  3S1R H;  1DYQ A;  2VS1 A;  4GLA C;  2KCN A;  2K03 A;  3CCV A;  4FXK C;  1A2U A;  1X3P A;  5GAD C;  4C3J H;  4DR4 Q;  2F0M A;  2ZM6 Q;  1EQQ A;  1JOQ A;  1HHV A;  2XIW A;  5IE8 A;  2EY6 A;  3VR3 A;  1R4Q B;  1VQJ A;  1STY A;  3NE5 B;  1SYB A;  2V4D A;  4ME5 A;  1Y8P B;  2F0V A;  5BN4 A;  1HFN A;  3D3R A;  2HIX A;  4DV5 Q;  2E75 C;  2N49 A;  3ONA B;  2IHE A;  4ZUI A;  1SNO A;  1YHB A;  5KIX A;  2R92 H;  4C3I H;  1DOL A;  5M5W H;  1I94 Q;  4DV2 Q;  1QIL A;  4LF7 L;  1YJW A;  3KJO A;  4DV1 L;  4NXN L;  3J7A V;  1JWS D;  2F52 A;  2K5H A;  1E0B A;  1ROD A;  1YNX A;  4DXF A;  3PUY A;  1VQ7 A;  3HG9 A;  4KY5 A;  3Q23 A;  3MFG A;  1OTC A;  4RGM A;  3I4M G;  1ICW A;  1P8L A;  4K6D A;  4A3M G;  2IHF A;  3PMF A;  5M9O A;  1VQ8 A;  3H3V I;  5C4Z A;  1IXR A;  2EVB A;  3S1N B;  4IUR A;  4K2K A;  4DAY A;  3GTQ H;  5IWA Q;  4K6L A;  2F0I A;  2WKC A;  1VQE A;  2EY2 A;  5AJ3 L;  3K5N A;  4OGQ C;  5IY0 A;  4JOI A;  2X6L A;  4JI8 L;  3S1R B;  1SJH D;  4R4T A;  4ID6 A;  1L0W A;  2JK8 A;  2ZJP A;  1K8M A;  2D2C C;  3MTS A;  4K2L A;  5C5M A;  3TP6 A;  4C56 C;  1HZC A;  1I4P A;  4F8M A;  2OF1 A;  1HZB A;  3I7F A;  1Y14 B;  1XMQ Q;  2R61 A;  4PMB A;  2DJF C;  2CVR A;  1KAW A;  4DR5 L;  2Q2U A;  5E7N A;  2HHH Q;  3PIO 3;  1XPU A;  3UDI A;  1A3U A;  3AMU A;  5C0X H;  4BA2 I;  3HOZ B;  3HKZ G;  4C3I B;  1N32 Q;  2JN4 A;  4LF6 L;  2R6G A;  2HCC A;  3EFX D;  5EPK A;  2RCN A;  1HA5 A;  2I5H A;  1VQL A;  2L15 A;  1EQT A;  3OW7 A;  3M7N A;  4M1U B;  3R93 A;  1A62 A;  1HR0 L;  3G48 A;  4NDX A;  1J5E Q;  2RBM A;  3QIA A;  3J81 c;  2VQE L;  3VDY A;  2ZM6 L;  4ME3 A;  5HUR A;  1A63 A;  1HNZ L;  4PNY A;  5EAY A;  5I2X A;  4P74 A;  2B2Y A;  4OHJ A;  2A73 B;  2MNA A;  3HOX B;  4X6A H;  4C3H H;  4ZKB B; 
#chains in the Genus database with same CATH homology
 2Z8L A;  1WCM B;  1NR4 A;  4J1M A;  5CV6 A;  3NTK A;  2JSO A;  1R4P B;  1ENC A;  2LS0 1;  5C3X A;  2JA5 B;  2K5Q A;  4G7O C;  1BBX C;  1SAP A;  5JOB A;  1G91 A;  3PUZ A;  1MBY A;  3G6J B;  2ICI A;  4HN7 A;  1G2S A;  3A8I E;  3Q24 A;  1AFP A;  3WOE A;  5CYU A;  2KA7 A;  4KY7 A;  1A15 A;  3QJY A;  3RUZ A;  1GUN A;  3FDT A;  2VB3 X;  1DM0 B;  2CW0 C;  1Q8I A;  1HUN A;  1C8C A;  2F0P A;  4IUT A;  2PZT A;  2NTS A;  3X3N A;  5I2Y A;  5EKI A;  3GTM B;  1H9R A;  2XVS A;  3NQI A;  5CR3 A;  4QUF A;  1ZYR C;  3GD7 A;  3OIQ A;  1HPC A;  1TII D;  3BYY B;  5EKK A;  1EEI D;  1ESR A;  4C3H B;  3BVZ A;  3D31 A;  2J4X A;  2F1M A;  4H7B A;  1JWU D;  5EBD A;  3KLR A;  4IUP A;  2BDO A;  3L9A X;  2RQX A;  2NN6 H;  5EPJ A;  1ONL A;  3BZD B;  2NB0 A;  2A6E D;  2F0W A;  4C1N K;  5D14 A;  5C3E B;  1L0X B;  5ELC A;  1WD1 A;  3A8K E;  3T51 B;  1KAB A;  2R7Z B;  2F0T A;  2PCF B;  3A54 A;  1XYI A;  1JB3 A;  3SHL A;  2JA6 B;  1G2T A;  4WRD A;  5COY A;  2QEJ C;  2AQ2 B;  4K8I A;  3IKJ A;  1XX8 A;  1H9S A;  1MGS A;  3GTK B;  2PMZ B;  5EGT A;  3WOF A;  2E2J B;  1TVX A;  3IFD A;  5M5X B;  1RD9 D;  3H3V C;  2DY8 A;  3DM1 A;  5DNF A;  1LV9 A;  3NQT A;  1G29 1;  4KV6 A;  2F0F A;  1R9T B;  1EWH A;  2PNR C;  1TY0 A;  2H1E A;  1OXU A;  2EYH A;  4EQP A;  2PZU A;  1IHZ A;  1GUT A;  4Q5V A;  1BQQ T;  1CTM A;  1TT2 A;  2RSN A;  1J9O A;  1KNE A;  5CV5 A;  1PTO D;  3CHB D;  4DAP A;  4MIU A;  4HR7 B;  1GUO A;  1YNN D;  1Y1W B;  3K5L A;  5KRU A;  2SDF A;  3DUZ A;  1XXG A;  1II3 A;  1PTO F;  3D4D A;  3C3L A;  4JK1 C;  1CT1 D;  2OEO A;  4KY6 A;  1DZ1 A;  2RSO A;  1BO0 A;  2A6H C;  3TP5 A;  1DOM A;  1QNU A;  3KBG A;  1OXV A;  3H6M A;  2AUK A;  5D3D A;  3NPP A;  4PMC A;  5T1I A;  1BUV T;  2EJF C;  1F9S A;  1AP0 A;  2A6H D;  2I46 A;  1O80 A;  1CHP D;  3LWU A;  1CQV A;  1SNC A;  2XN9 C;  1ML0 D;  2H4O A;  3V2T A;  4CGY B;  2O2L D;  2BE5 D;  5DAU A;  5I4D A;  1BR9 A;  1TWC B;  3MAQ A;  1TS3 A;  3K5O A;  1RKN A;  4RA8 A;  4KHV A;  2EYP A;  3PUV A;  2QCP X;  5JVH 3;  2A74 C;  3I73 A;  1LLR D;  4LAA A;  3HRZ C;  1JOK A;  2O5I C;  1QNK A;  2BE5 C;  4AYB B;  1D5X C;  4K5W A;  1C48 A;  2L0C A;  5TSS A;  4K5V A;  5DM6 3;  4WOR A;  2JA8 B;  1Q3L A;  3QG1 A;  3T4A C;  3G7L A;  3RD4 A;  1PRT F;  1IYU A;  4RFB A;  4PV1 C;  1FYC A;  1UNS A;  2IX0 A;  1PRT D;  1EYC A;  5T1G A;  2BA0 A;  2MJ8 A;  3R2T A;  3R3O A;  1F9Q A;  4UDU C;  5C0X I;  3A55 A;  1SYE A;  4YIJ A;  4R8N A;  1D1K A;  2K05 A;  3S9W A;  3QWN A;  3W2D A;  4QF4 A;  2ZXO A;  2EDG A;  3I90 A;  1Q1B A;  1WVL A;  5EJW A;  3DWP A;  3UI2 A;  2EXZ A;  3C1E A;  2TSS A;  3HOV B;  1EFI D;  1FR3 A;  3J7A F;  5E3F A;  1BCP B;  1TWF B;  3T56 B;  1E2Z A;  1T5X D;  5I6W A;  5IGC A;  2K28 A;  1IL8 A;  1LTS D;  3V96 A;  1TWH B;  3ERQ A;  1GXD C;  3SR1 A;  3FPP A;  4QB4 A;  1ZXT A;  1B9N A;  2E74 C;  2WB1 B;  3K59 A;  1SYF A;  2IL8 A;  3A56 A;  4FF4 A;  3HZX A;  3SVM A;  1BCP D;  2L1B A;  1MSG A;  1JE4 A;  4XIG S;  4HSP A;  2B2T C;  2G9D A;  1WTV A;  1CK1 A;  1BCP F;  3DMU A;  4XQN A;  3PO2 B;  3OOC A;  1FNV A;  4RKL A;  3GP7 A;  3GQB A;  4HTH A;  2HUG A;  1YNJ C;  3FKI B;  3C1F A;  4IUQ A;  4KK7 A;  3VYR A;  4DN4 M;  5HGT A;  1F9P A;  1Q90 A;  3Q6S A;  1DXM A;  2F4I A;  4IUV A;  1MI2 A;  4C3H G;  2LFN A;  1SNM A;  4DK0 A;  1CA6 A;  4A3I B;  2C5C A;  5BN3 A;  4A3D B;  1HXY D;  1F2Y A;  2XNA C;  5DEH A;  3KLS X;  5IGF A;  4RHR A;  3I8Z A;  1KDB A;  5C4X B;  3GV3 A;  2NVX B;  1S5B D;  4KN4 C;  5KNB A;  1GOZ A;  4HMJ A;  1SEB D;  2OT2 A;  3SK5 A;  2KOL A;  3HKZ B;  4P2C B;  1TS4 A;  3HGB A;  3ND9 A;  1TKW B;  1TS5 A;  4OIJ A;  2N55 A;  4CKC A;  4BY1 B;  3D8G A;  1SFO B;  4ZQ3 A;  5IGG A;  2MP1 A;  5FO9 B;  5LL6 X;  1IKM A;  3P75 A;  2B2T A;  4UAI A;  4ZUJ A;  2NBF A;  3DWA A;  3FMC A;  1PFN A;  4XDX A;  3KBX A;  2L9H A;  2PO4 A;  2DNC A;  1FD7 D;  3EA6 A;  5G3L F;  2AWN A;  1STA A;  1SMY C;  3MFY A;  3K57 A;  2NWG A;  2Q8R E;  4DXG A;  3R2I A;  4RWS C;  1HTL D;  3BVM A;  1D6E C;  1H9M A;  4BBR B;  1NR2 A;  1O7L A;  1S5F D;  1ESF A;  2RA4 A;  1B3A A;  3OPO A;  2OXP A;  1D5Z C;  2WII B;  3NHH A;  5KGU A;  3AU7 A;  1BOS A;  4DFA A;  4U67 3;  2ENB A;  2KEE A;  4DK1 A;  2FMC A;  2EY1 A;  4L8J A;  2FIN B;  4A3G B;  1PXU A;  1A6X A;  2BCO A;  4EQN A;  4C3I G;  4Y7N B;  2D62 A;  1LTI D;  1ZYR D;  5C4H A;  4M8A A;  3GTJ B;  1QB5 D;  3ND8 A;  2DN8 A;  2R93 B;  3JAM L;  1PMR A;  5CV8 A;  1Y8N B;  1GJX A;  4DF7 A;  2RDG A;  2NYZ D;  3W3A A;  2VB2 X;  1WTR A;  2O4X A;  1Q12 A;  2K33 A;  4FXD A;  1WTP A;  3MZ5 A;  3RLF A;  2B2V A;  2D5D A;  5FLX L;  1I4H A;  4CBV A;  2CHB D;  3A7A B;  1SBB B;  3DEP A;  2DY7 A;  3NXW A;  1FNW A;  2Y0S B;  1LTR D;  4PQX A;  3NTH A;  4CKE A;  3P7J A;  2NN6 G;  4ULL A;  2EYL A;  2MUY A;  3H91 A;  4HMI A;  1LO5 D;  1PRT C;  4OIK A;  1W6J A;  1F2M A;  1SYD A;  4OO1 I;  1KAA A;  3MA2 B;  3S16 B;  4DAV A;  3TP8 A;  1VMC A;  1PRT B;  1AN8 A;  1FGB D;  2KUM A;  2PZW A;  3M3Y B;  3M85 A;  4IN3 A;  5JEA H;  3TZU A;  4A3J B;  2FMM A;  2B8G A;  3T53 B;  4QUC A;  5IIF A;  2A6E C;  2SOB A;  1DOK A;  3F2U A;  2F3W A;  4KD3 A;  2JEB I;  2MGS A;  2AWO A;  1SYG A;  5KYL A;  1M8A A;  2EYF A;  3S2H B;  5ELB A;  5EQ0 A;  2NVQ B;  3VYS A;  2E76 C;  1VCI A;  3TBI B;  3VA7 A;  5FK9 C;  1CQF A;  3BS1 A;  1CA5 A;  2A69 C;  1B2T A;  4I7Z C;  5IGE A;  3I91 A;  1G6Z A;  3CRK C;  3K58 A;  2SNS A;  4BS9 A;  4XT3 B;  2CW0 D;  4RH6 A;  2EOT A;  2IX1 A;  5A35 A;  3PIP 3;  2A69 D;  2A68 C;  4RCN A;  5LHY 1;  3QO2 A;  2NTT A;  3VR5 A;  2ZXP A;  1IW7 D;  3VA5 A;  1QOH A;  3SK6 A;  4R8I A;  3RZO B;  3X3M A;  4K5X A;  4HAE A;  2SNM A;  1YNN C;  2B2V C;  2KHS A;  4C1N I;  5NUC A;  4TKO B;  5J39 A;  1LTA D;  1QCB D;  1EIG A;  1OXS C;  5C6A A;  2PQE A;  1X3Q A;  4B08 A;  4ZYS A;  2KCC A;  3GO5 A;  5CMD A;  2ICE C;  1NUC A;  1CI3 M;  4TQU S;  4A93 B;  3MC0 B;  1EYD A;  4DU9 A;  2L5T A;  2B63 B;  1EY7 A;  4OO1 H;  1UUP A;  3SK4 A;  3LNN A;  1NAP A;  4K8J A;  2XWJ B;  4KKT A;  2F3V A;  2XWB B;  1U4M A;  1EY6 A;  4G4K A;  1I6H B;  1I4G A;  4TRD A;  5K36 H;  2RKS A;  3SDZ A;  1JOO A;  4A3F B;  1DCZ A;  2NZ1 D;  4X3T A;  4L63 B;  1I6V C;  3MHB A;  2LKV A;  3FPU B;  4R9W A;  3U9S A;  4IFD G;  3KK7 A;  1PZJ D;  3BG3 A;  1SE2 A;  1I4Q A;  1X32 A;  4PMW A;  3L3O C;  2SEB D;  2F0H A;  4XTC S;  2Q8I B;  4FP5 D;  4KJN A;  4KN7 C;  2F03 A;  1LT6 D;  1EEF D;  5IGB A;  3E0J A;  2RDH A;  3GTG B;  2F0D A;  1SMY D;  3IFT A;  3TDQ A;  1H9J A;  3D6C A;  1S5E D;  2M2L A;  3D4W A;  1DJR D;  4K14 A;  4TSS A;  2IPK D;  1F2L A;  3LWE A;  3NWT A;  4CHT B;  2O5J C;  1VF7 A;  2K7V A;  1CZG A;  1S5D D;  2Z4I A;  1SDF A;  4BBS B;  1Z7T A;  2BOS A;  1PYW D;  4KD4 A;  1QE6 A;  3SE0 A;  2MHV A;  2ZXR A;  3MWY W;  5AFW A;  2EJM A;  2XRS D;  1STN A;  3J7Y W;  1TS2 A;  1Y69 U;  5C0X J;  1EY8 A;  2TMP A;  1RTO A;  2B2W C;  1IKL A;  4J8Q A;  1Q1E A;  2F0K A;  2Q8T A;  4KTA A;  4BA1 I;  1AZP A;  2KEC A;  1JC7 A;  2YU9 B;  3FRP B;  2B39 A;  1TU2 B;  3OMC A;  3MXU A;  3K6O A;  2VXW A;  1GUS A;  2FFK B;  1UAP A;  3OMG A;  1KLU D;  3S1Q B;  1QJO A;  2HCI A;  1SE3 A;  3T13 A;  5IT9 L;  4ABN A;  4FF2 A;  2IW3 A;  3TSS A;  1ILQ A;  2EPB A;  3NWS A;  1Y1V B;  2K32 A;  2EZV A;  3S15 B;  1CHQ D;  4ZLT F;  3D6W A;  4KI0 A;  2L11 A;  1GUG A;  4FVM A;  2F0L A;  3OWF A;  4RGN A;  3SEB A;  4V19 0;  3GTO B;  2E2I B;  3MXN A;  4WFN 3;  1U4L A;  4X3U A;  1WD0 A;  4XQQ A;  3TZD A;  3VR2 A;  5BN5 A;  5CV9 A;  2QF7 A;  2JE6 I;  2QKI C;  3GTL B;  5JAV A;  3BYT B;  1A2T A;  1EY0 A;  5ELE A;  1PFB A;  5J22 A;  1RJT A;  4NKL A;  2NUC A;  4H0L C;  3DEO A;  3MEH A;  4CJ2 C;  3OWE B;  4N9T A;  1MSH A;  3KLS A;  3J80 E;  1A3V A;  1GUW A;  3VR6 A;  2A5H A;  3C2P A;  1B9M A;  4LJZ C;  1HA6 A;  3I3C A;  2KVM A;  4FF3 A;  4Z9C B;  1D5M C;  4G7Z C;  3MXG A;  1D1I A;  5IOD A;  4KMU C;  4EQO A;  1V43 A;  1VDZ A;  2E2D C;  1B44 D;  3EJI A;  4ZK9 B;  1GHJ A;  1H9K A;  1BNZ A;  3K0Y A;  1BF4 A;  2PW7 A;  3J81 L;  4DGZ A;  2RVL A;  3PO3 B;  2EYO A;  1U9R A;  4HSV A;  1HCZ A;  3H09 A;  3HP3 A;  1F9R A;  5CC4 A;  3M7G A;  5JVG 3;  2JXM B;  2C9O A;  1ILP A;  4MN3 A;  3EQL C;  4CKB A;  5ISR A;  1VF5 C;  1V1O A;  3A8J E;  4O42 A;  4B9W A;  5I6Y A;  1PLF A;  5EKL A;  2VNU D;  2F0Q A;  5FLX E;  4IZ8 A;  3LX0 A;  3S17 B;  2WAC A;  1MD2 D;  3R8B A;  4KKU A;  1HTP A;  2JEA I;  2F0O A;  4RGT A;  5EPL A;  5EBC A;  5JEA G;  2HDL A;  3M4Y A;  1RCV D;  3I4M B;  5C3W A;  4XYQ A;  5LL6 S;  1JR0 D;  3WDN A;  1S5C D;  5E4W C;  2F0N A;  3DXJ C;  1O78 A;  2F0S A;  5KND A;  5FOB B;  2KQ3 A;  1L0Y B;  3TP7 A;  3K5M A;  5E4X A;  3BDL A;  3ITP A;  5D3I B;  3OSO A;  1HUM A;  1VMP A;  2I07 B;  1K8O A;  5JPN C;  2B2U C;  4DNT B;  4IFD J;  5C4J B;  3J80 L;  1OXT A;  2IT1 A;  5A2Q L;  2XRQ D;  3D4R A;  1YNJ D;  1BDO A;  5COR A;  3N52 A;  1OXX K;  4IUN A;  2HQE A;  2ZT9 C;  4EVO A;  1LT3 D;  2BA1 A;  2JP1 A;  1NSN S;  1B1Z A;  3L7Z C;  4OL7 A;  1WTW A;  1UEA B;  1EU4 A;  4MHE A;  4RAU C;  1RDP D;  5KEE A;  3S2D B;  4GZY C;  4FO2 A;  2D9U A;  3PUW A;  2RDF A;  3HS0 C;  3BDC A;  4XXE A;  2NVT B;  3OHX C;  1AZQ A;  3GV6 A;  1EZ8 A;  1KNA A;  3CQZ B;  1LTT D;  5JJZ A;  1E2W A;  1ET6 A;  1B50 A;  1EY4 A;  4IQZ A;  1V8Q A;  2EJG C;  2K5W A;  1STE A;  5M3M B;  1RHP A;  4CJ0 B;  2F0U A;  2AUJ D;  3QB3 A;  1SXT A;  4OO1 G;  5ELD A;  4G57 A;  2MPM A;  2YYZ A;  3C46 A;  3URY A;  3V05 A;  1ZEQ X;  4H13 C;  1O7Z A;  4FXG C;  3S1M B;  3P1H A;  5D65 A;  4F87 A;  4G7H C;  3DWQ A;  3HOY B;  5M3F B;  5JPM C;  4JBW A;  5CGK A;  1STB A;  1PDQ A;  4X3S A;  5ELF A;  3VYU A;  1S4Z A;  3NBH A;  1KTK A;  1JIC A;  1LT5 D;  2A68 D;  2EY5 A;  3NTI A;  4C3J G;  3SXH A;  5KYI A;  1K83 B;  5I9P A;  1SYC A;  2B2W A;  1EY5 A;  1JCK B;  3I4L A;  3PUX A;  1STG A;  1CFM A;  2LY7 A;  4L6T B;  1JWM D;  5F2D A;  4DNR B;  2JA7 B;  1IYV A;  4Q0F A;  1U4R A;  5E1F A;  4NMZ A;  3OIP A;  1T5E A;  3JAM E;  1KLG D;  3TME A;  3CKI B;  4CJ1 B;  3BDO A;  1Z47 A;  2EYJ A;  3E6Z X;  2IWH A;  3M4O B;  2F0G A;  1NCV A;  4NP5 A;  3I70 A;  4A3E B;  3VR4 A;  1OO9 B;  4RHS A;  3Q0A A;  4EGV A;  1STH A;  1HRJ A;  5C0X G;  2F0E A;  3SK8 A;  1FNU A;  3QOJ A;  2K1B A;  3GTP B;  1SJE D;  2EYM A;  2B2U A;  3ZYY X;  5CV7 A;  3Q22 A;  2K6A A;  4ODG A;  4RCO A;  1SSO A;  3NUC A;  3EVQ A;  3QOL A;  5FO8 B;  2JYO A;  4J6H A;  4IAL A;  2X69 A;  5IT9 E;  1QG7 A;  3TN2 A;  3CU7 A;  3I72 A;  2B8F A;  2WV6 D;  1GHK A;  2AQ1 B;  5K36 G;  1TWG B;  1PTO H;  5C44 B;  3K7A B;  2KED A;  2B2Y C;  2GA4 B;  5J1Z A;  1ET9 A;  1KDC A;  2FHT A;  3NK9 A;  4I65 A;  4BY7 B;  1PZK D;  3S14 B;  2G9H D;  1A3T A;  2L12 A;  4IFD I;  2WKD A;  1EWC A;  3RZD B;  1EZ6 A;  1I4R A;  3HEJ A;  2QDB A;  1KDA A;  1TR5 A;  1CM9 A;  2FJ2 A;  5CV4 A;  4LMQ D;  1PZI D;  2E2H B;  1EQV A;  3RMH A;  1BXT A;  2K04 A;  2N88 A;  2PW5 A;  3KUP A;  3NP8 A;  4U68 A;  5M5Y B;  5C5L A;  1EL0 A;  1J8I A;  1V1P B;  1SE4 A;  1IW7 C;  4QIW B;  3N6R A;  1DD2 A;  3IAY A;  2CQA A;  1U4P A;  3KF8 A;  1F2Z A;  2XSC A;  2NN6 I;  4LK1 C;  1E2V A;  1ENA A;  4KJO A;  3J81 E;  2KJX A;  1LAC A;  4WJW A;  1PTO B;  5IOC A;  1W6K A;  1I3Q B;  1SND A;  5IGD A;  2DNE A;  2PPB C;  1RTN A;  1AEX A;  1PTO C;  4HCS A;  1B4O A;  1WTX A;  3DHQ A;  4E6I A;  5DM7 3;  3HOW B;  4A3K B;  4O1N A;  4KKS A;  1LTB D;  1F77 A;  1XWE A;  3MXP A;  1EY9 A;  4FF1 A;  4IUU A;  1C4Q A;  1AW7 A;  4XQJ A;  1LTG D;  1PFM A;  1HFG A;  3E5S A;  1O7Y A;  4BWG B;  2IJ0 A;  3I4N B;  4KHZ A;  2L4N A;  3MVV A;  4N9P A;  2VUM B;  1V1P A;  3NBI A;  2BDN A;  1TQO A;  4RGO S;  1TY2 A;  2Z4H A;  2M9V A;  3A7L A;  2K5D A;  2WAQ B;  4B9X A;  4ZKC B;  1HQR D;  3FVQ A;  1I50 B;  1EYA A;  2Z1C A;  4A3B B;  3HOU B;  4F88 A;  4XYO A;  5CBA E;  3VYT A;  1EU3 A;  3FEW X;  2J0T D;  1I4X A;  1Y8O B;  4C2M B;  4X3K A;  1EOT A;  2QIL A;  3P20 A;  2AQ3 B;  2EE1 A;  3H0G B;  5CBE E;  2WP8 J;  4NW2 A;  4DA2 A;  2IX3 A;  3AB9 A;  4HED A;  2X6G A;  2K01 A;  1M4V A;  2WIN B;  2NVY B;  2J7Z A;  3O13 A;  4ILW A;  4A3M B;  5KNC A;  5I9O A;  1QWY A;  4S3S A;  1Z6H A;  4HCE A;  1DON A;  5JEA J;  2L55 A;  1G8Z D;  4C3J B;  4V0B A;  4FYD A;  1ENF A;  1HQM C;  2HDM A;  2R3Z A;  4QMG A;  2LMC B;  1LT4 D;  1ZKO A;  1WTQ A;  2F0J A;  1SNP A;  4F7X A;  2R92 B;  4H44 C;  1D2B A;  4IFD H;  5A2Q E;  3BVG A;  5M5W B;  3NSW A;  3CRL C;  5K5P A;  1JOR A;  1EIH A;  3U9O A;  1XTC D;  2PYK A;  3ERO A;  3T16 A;  1TWA B;  4QCL A;  3H94 A;  5G3L D;  1SNQ A;  1LAB A;  1H9S B;  5FO7 B;  1B53 A;  1RF2 D;  1JQY D;  5FKA C;  4RKB A;  1WTO A;  4FNF A;  4ZRZ A;  2M00 A;  3GTQ B;  3IL8 A;  3PV0 A;  4XT1 B;  1CZW A;  2ID0 A;  1BCP C;  4ZAI A;  1DYQ A;  2KCN A;  2K03 A;  4FXK C;  1A2U A;  1X3P A;  2F0M A;  1JOQ A;  1HHV A;  2XIW A;  2EY6 A;  3VR3 A;  1R4Q B;  1STY A;  3NE5 B;  1SYB A;  2V4D A;  4ME5 A;  1Y8P B;  2F0V A;  5BN4 A;  1HFN A;  3D3R A;  2E75 C;  3ONA B;  4ZUI A;  1SNO A;  5KIX A;  1DOL A;  1QIL A;  3J7A V;  1JWS D;  1E0B A;  1ROD A;  4DXF A;  3PUY A;  3HG9 A;  4KY5 A;  3Q23 A;  3MFG A;  4RGM A;  1ICW A;  4K6D A;  5M9O A;  3PMF A;  5C4Z A;  2EVB A;  3S1N B;  4IUR A;  4K2K A;  4DAY A;  4K6L A;  2F0I A;  2WKC A;  2EY2 A;  3K5N A;  4OGQ C;  2X6L A;  3S1R B;  1SJH D;  4ID6 A;  1K8M A;  2D2C C;  3MTS A;  4K2L A;  5C5M A;  3TP6 A;  4C56 C;  1I4P A;  4F8M A;  2OF1 A;  2R61 A;  4PMB A;  2CVR A;  3PIO 3;  1A3U A;  3AMU A;  5C0X H;  4BA2 I;  3HOZ B;  4C3I B;  2R6G A;  2HCC A;  3EFX D;  5EPK A;  1HA5 A;  3OW7 A;  1EQT A;  3M7N A;  4M1U B;  3R93 A;  4NDX A;  2RBM A;  3QIA A;  5HUR A;  4PNY A;  5I2X A;  2B2Y A;  4OHJ A;  2A73 B;  3HOX B;  4ZKB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...