1SYFA

Engineering alternative beta-turn types in staphylococcal nuclease
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKTNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(phosphoric diester)
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Engineering alternative beta-turn types in staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 35
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1syfA00
3MZ5A 1KABA 3VA5A 2F0IA 4EQNA 3MVVA 1TQOA 4ID6A 1AEXA 4KJOA 4ZUJA 1II3A 1STBA 3P75A 4K8IA 4YIJA 5CV5A 1JOKA 4RKBA 5F2DA 5E3FA 3HZXA 4OL7A 3SHLA 4F7XA 2EY2A 2F3VA 3PMFA 4IZ8A 4ODGA 5I9PA 5JOBA 2EYOA 2PZWA 1EY0A 3P1HA 4ZUIA 3TMEA 1SNOA 3SK5A 5KGUA 1A2TA 3NXWA 3NUCA 4PNYA 4HTHA 3C1EA 5C4ZA 2PZTA 5CV4A 1JOOA 1SYCA 3TP5A 2F0EA 3MHBA 1JORA 1SNCA 1KDBA 4K8JA 5C4HA 1SYEA 1A3UA 3SXHA 2KHSA 5C5MA 5I6WA 5KIXA 1ENAA 5IGBA 2QDBA 1EY6A 4J6HA 3U9OA 5IGDA 3ERQA 3ITPA 4PMBA 2RKSA 4KV6A 1SNQA 1SNMA 1SYDA 2EY6A 5C6AA 1EZ6A 3T13A 1A2UA 1EZ8A 3T16A 3OSOA 2EYHA 4DF7A 4B9XA 3OWFA 5CV7A 2OEOA 2F0MA 5EGTA 2F0QA 2RDFA 4KTAA 4B9WA 3SK8A 5I9OA 3V2TA 5KRUA 1SYFA 4R8NA 3D8GA 1NUCA 2O4XA 5IOCA 5J39A 2F0FA 3TP6A 5KYLA 3OMCA 5NUCA 5CV6A 3LX0A 5DEHA 4QMGA 5CC4A 2EY1A 4KY7A 5C3XA 1EY4A 4K5XA 1SNPA 5HURA 3S9WA 5C5LA 4HMIA 1KDAA 2HQEA 5IGCA 4DGZA 1SYBA 1U9RA 5JAVA 1F2ZA 1SYGA 3NQTA 3MXPA 3RUZA 2PW5A 4EQOA 2F0PA 5HGTA 1KDCA 2F0OA 4IUNA 5EKKA 4EVOA 1EQVA 1EY9A 4K2KA 5K5PA 4HMJA 2ENBA 3D4DA 3H6MA 4K5WA 4K2LA 4K6DA 4J1MA 3NHHA 2F0TA 2NUCA 2EXZA 2OXPA 3DMUA 4LAAA 5CV9A 2EYFA 4NP5A 1JOQA 1EYCA 3NP8A 2F0GA 2F0HA 4NKLA 5KYIA 5ISRA 3TP7A 2PW7A 3MEHA 1SNDA 3C1FA 1EY5A 2M00A 3QB3A 5C3WA 1TT2A 1STGA 2EYPA 4NDXA 5I6YA 5IIFA 4TRDA 2F0KA 4WRDA 3SR1A 5IGGA 1ENCA 5EKLA 3D6CA 4QB4A 1EY7A 3DHQA 4ZQ3A 5IGFA 1STAA 4WORA 1STNA 5KEEA 5CV8A 3HEJA 2EYMA 2F0WA 2EY5A 4F8MA 4RKLA 5E1FA 2KQ3A 3EVQA 2SNMA 4KD4A 4I65A 1STHA 5CR3A 1EY8A 5J1ZA 3EJIA 2F0NA 2F0VA 2SOBA 4IALA 2PQEA 1STYA 2LKVA 4KY5A 3D4WA 3OMGA 5IGEA 4KY6A 3BDCA 4EQPA 4DU9A 2SNSA 5M9OA 2EYJA 3QOLA 2F0LA 2PYKA 1NSNS 5IODA 5DAUA 1A3VA 4PMCA 2OF1A 4QF4A 3SK4A 5CGKA 4K14A 1TR5A 2F0JA 2WACA 4N9TA 2F0DA 1F2MA 4KD3A 1RKNA 5J22A 1A3TA 2EYLA 2F3WA 2RBMA 3BDLA 4MIUA 3E5SA 4KHVA 3TP8A 4E6IA 1EYDA 2F0UA 3NK9A 4N9PA 2PZUA 2F0SA 3R3OA 4NMZA 1F2YA 3SK6A 3EROA 4G57A 3QOJA 4K5VA 4H7BA 4S3SA 4KJNA 4DFAA 1KAAA 1IHZA 1EYAA 4ME5A
chains in the Genus database with same CATH superfamily
4DK1A 2UUBQ 1FVIA 3KDFB 4K8IA 1SROA 1SRUA 1VQLA 1EWHA 1SMYD 4A3KH 2XIWA 2UXCL 2QW7A 1SNOA 3R8BA 4XXEA 4IOCA 1PHJA 2CKZB 4C2MH 4C2MB 2ALYB 4YY3Q 1KDBA 3SXHA 4G4KA 2L11A 1HNWL 3U9OA 3RR5A 1YI2A 1YNJD 2BOSA 4X64Q 1GUOA 2F03A 4UP8A 4I7ZC 1QNUA 1XTDA 4A75A 1GUTA 4H13C 5CV6A 1I4RA 4N8X1 4OO1H 4QMGA 1RJTA 2FINB 3PIPA 3ER0A 2YU9B 4IPCA 3S9WA 2ZTDA 4UDUC 2PI2A 1MJEA 2RA4A 4RH6A 1FGUA 2IPKD 1SE4A 2K7VA 1X3PA 1ASZA 2JYOA 1UE1A 3TN2A 1PFSA 1QCBD 1NE3A 2KEEA 4JI5L 1KRSA 4JVZA 1B1ZA 1VF7A 3NP8A 2ZT9C 3W2DA 3A5ZB 1H9JA 4BY1G 5FO9B 3Q22A 1HPCA 5IIFA 1XNQL 1PA6A 3I3CA 2JEBI 2MGSA 1VQ7A 4B3SL 4GLXA 4A3BH 4A3BB 4OEMB 1ZKOA 1U0LA 4MHEA 4A3IG 1E1OA 3TREA 5IYDH 1H9KA 1K9MC 4FNFA 3J80E 4YHHQ 1MJCA 4R4QA 3C2PA 2P5ZX 4PQXA 1STYA 1BVSA 2Y0SB 3OMGA 2HCCA 5M5YH 4RCNA 3AU7A 5JPMC 2XGTA 2BA0A 2K75A 2HDLA 3KF8A 2K5WA 1PZJD 3TP8A 4C3IH 4X3UA 3BZKA 1C9OA 3EROA 2Z0SA 1UEAB 3BDOA 4CJ1B 1G6ZA 4PZ6A 1DOLA 4LF7Q 3W1GA 1M1KC 3QR8A 5E3FA 3QJYA 2JA5G 4CJ2C 4BY7G 4QQBX 5I2XA 3T53B 1G51A 4GLAC 1CA6A 5ELNA 2KBNA 4DV3L 1GO3E 2IWHA 5KGUA 3S2DB 1K83H 1K83B 1LYLA 1ET9A 3MXGA 1HUMA 1D2BA 1JJGA 3CC4A 4ME3A 4JI3Q 2F0EA 1JJCB 4QL5A 3DM3A 1L0WA 2NVTB 3S15B 4K0KL 4NXML 4IFDJ 1S5ED 5C3EG 1GXDC 1N32Q 1I4QA 2N3SA 3RLNA 2K5NA 1PTOB 4YWMA 1PZID 3L9AX 1G2SA 1F9RA 5IWAL 1P16A 2RDFA 3U9SA 4AYBG 3UDGA 5IP7G 2F0FA 3S24A 1ICFB 2F1MA 5C3XA 5A2QL 2NZOA 5FO8B 1MIUA 2L12A 1SNPA 3K57A 3VR4A 2R92H 3HOUH 1MKHA 3RLFA 1Z47A 2X6GA 4LF6L 1A62A 4C1NI 4GKKQ 1L2FA 3PIO3 1MHWC 3KJOA 3AYHB 2EVBA 5CBAE 2R61A 4A3GB 1EL0A 4LFAL 4NKLA 1NMFA 4BBRH 2TMPA 1I50H 1I50B 2M00A 4NXNL 1WTWA 5DM63 4CDEC 2K50A 3KF8B 3SR1A 5BN5A 4JOIC 5EKLA 4HIMA 4BY1B 1VF5C 1Y8OB 1GOZA 2EYMA 3AFQA 4XQQA 2EY5A 2NB0A 1ET6A 3EVQA 1HNZL 1AW7A 5CR3A 4A3IB 4IUPA 1UAPA 2NZHA 2CW0D 1D7QA 1Q3LA 5GAGC 4FO2A 5KNDA 4R8IA 3F1ZA 4K14A 3R2TA 4PMWA 4X66L 2J7ZA 3CCLA 4FF1A 1W6KA 5EPJA 1IBKL 1EU3A 1O7IA 1YJ9A 2R6GA 3PF5A 3ONAB 4HJ8A 5BN3A 3NTIA 1QE6A 1KABA 1I4GA 2M2LA 1VQ8A 1CI3M 5JVH3 5IGFA 3BG3A 4OL7A 4L5SA 4O2DA 3F2BA 5I9PA 4IUVA 5JOBA 4KHZA 3Q24A 2QEJC 4BY7H 2JA5H 1H9SA 2RCFA 3HKZE 2PZTA 2CFMA 1JICA 1SYCA 1XPRA 3MHBA 4IURA 1SYEA 2YV5A 1HA6A 4I7AA 1BXTA 3ITPA 1DYQA 4P73A 3CHBD 2BE5D 3IKJA 1EZ6A 4DNTB 5C3EH 5C3EB 3S1RB 4DUZQ 4ZKCB 1O80A 2PPBC 5COYA 2XWJB 2D2CC 1J8IA 1SN8A 4DV7Q 4R8NA 2F4VL 3NSWA 3D8GA 5IOCA 4HSVA 1I94L 4OONA 1N9WA 4TKOB 2FHTA 5IP7H 4A3FG 3J80i 2B8FA 1HJPA 3CXCA 4YCWA 1R4QB 3QWNA 2R7ZG 4IUNA 1CFMA 3FMCA 5M5WH 1EY9A 5M5WB 1PH6A 4H02A 5D65A 2KEDA 2OT2A 2PMZE 1VQDA 1HNWQ 2Z9HA 1BBUA 4A4IA 2WP8J 4NPSA 3HG9A 4P75A 2L9HA 3K5OA 1X6OA 4PV1C 3RNUA 4A3LG 2KJXA 1WTXA 3NBHA 3CRLC 4KMUC 1SEBD 4JOIA 5IGGA 1WCMH 3FP9A 3URYA 1FGBD 1OXXK 1A8VA 4MNOA 1C0AA 2PCFB 4XQNA 3T4AC 3X3NA 2PYKA 1NSNS 2KCTA 1EQRA 4QF4A 3FPUB 1KXLA 2N88A 3BZCA 3M4OB 1RKNA 3K7UC 4RCOA 1H9SB 3GTGB 3DUZA 2K52A 2VNUD 3PCOB 1MBYA 4JI5Q 1K0RA 3A54A 2JA8G 4ZUJA 1Q82C 3GDEA 2B2YC 3P75A 5JEAH 3S16H 3S16B 1EWCA 4YY3L 5ELBA 3H09A 1JWSD 2AUKA 2F3VA 5JJZA 2NVXH 2NVXB 4B3SQ 3QO2A 1X9NA 2BDOA 4ZLTF 5ELDA 2KUMA 2VQFL 3UDXA 2DNCA 2HDMA 4JCVE 1K8GA 2B8GA 4BBSB 2UUAQ 2OWOA 4QJFA 5EQ0A 3A56A 3KFUA 3E3XA 1LT5D 1LTAD 3OSOA 3TRZA 2EYHA 4L8JA 1F9QA 4DXFA 4L5RC 1GUSA 1FR3A 4R4OA 3PV0A 1PRTD 4ALPA 2IX3A 3LX0A 4K6LA 2E76C 4Z9CB 2EY1A 1EY4A 4IN3A 5C5LA 2A68D 3VR3A 1C8CA 1CT1D 3NBHB 4A3FH 1Y1WG 1ESRA 1YEZA 1HTLD 1LUZA 5IYBG 1RD9D 3PO3G 2F0OA 4DPGA 4YCVA 5EAYA 5K5PA 3D4DA 4A76A 3HOWG 2R7ZB 3K7AH 3G71A 4JI2Q 5M3MH 3AQQA 3M4QA 1BQQT 5AJ3L 4JI4L 2XVSA 1LTRD 1SNDA 1Y8PB 4OHJA 4YHHL 1AH9A 2PO4A 1VS0A 2LY7A 4DK0A 4WJ4A 4OWTB 1STGA 3CCSA 2B2UC 4GLVB 5IWAQ 4KI0A 3Q6SA 5GROA 3MC0B 3D31A 4A93H 2A69C 2JXMB 2RQXA 4U673 2KCCA 3A0JA 5M5XB 4RKLA 3S1QH 4I65A 1EY8A 3OWEB 4B08A 3H3VI 2PQEA 3HRZC 2LKVA 4KY6A 3BDCA 1SLJA 1XJVA 1X56A 2E2DC 1TR5A 2F0DA 1B4OA 3MTSA 3MAQA 4R1JA 4E6IA 2K14A 4LF6Q 1V9PA 2F0SA 2SEBD 1H9RA 1K8OA 3M3YH 2F3IA 3HOVG 4LFAQ 1JCKB 2B2YA 4KJOA 2E74C 1A63A 3OPOA 4NXNQ 3B6YA 3HZXA 2CQOA 3ND8A 3WWVA 3CPWA 3VDYA 2JA8B 2J0TD 5FKAC 1GVPA 3G7LA 3TZDA 2OCEA 1R9TH 2CCZA 1EY0A 1BNZA 4LUZA 1V8QA 3D3RA 4CBVA 3A7LA 1JWMD 1SMXA 1MGSA 3STBC 3J81i 4KV6A 4RGMA 5LHY1 1EZ8A 4A3KG 4X66Q 1CKMA 1KQSA 5GQOA 1IBKQ 2WFWA 3SK8A 4J8QA 1DONA 4DNIA 4RA8A 3P20A 2KCMA 1I6HH 4JBJA 3NE5B 3FKIB 3FEWX 1HA5A 2NTSA 1I4PA 1PH3A 4FYDA 1XX8A 2CVRA 4K5XA 2MNAA 1YNNC 5HURA 4BWGB 3KDFA 3A5UA 5C44H 4RWSC 1Y1WB 4TVAB 2JJQA 3PO3B 3SVMA 3IFTA 3RZDH 2JA6H 1IYJB 1XNRL 1SJED 5C0XH 4OO1G 3K80C 3HOWH 3HOWB 3TP7A 3J81j 3HS0C 5IYCH 4AIMA 1Q86C 2ASBA 3OW2A 2B2UA 1VQNA 4XT1B 2NBFA 3PO2G 2MQHA 4LF9Q 1VDZA 2E2HH 1X3EA 3KLSX 2E2HB 5KNCA 1ESFA 1I94Q 1Q90A 2N55A 4F8MA 4GN4B 1FD7D 1OXTA 1PRTF 2YTVA 3W3AA 4IPDA 2OQ0A 4KY5A 3WOEA 2KECA 1SR3A 5EKIA 2ICIA 3VR2A 2L1BA 4N9TA 2AUJD 5DNFA 4HJ5A 4Y52H 3GTPB 1QILA 1DCZA 3V96A 3OIPA 4KHVA 3OYYA 1QVGA 2IW3A 3BS1A 3SE0A 3GTMH 3GTMB 2PI2E 2I5HA 4EQ5A 3KUPA 2RVLA 1S5FD 1AEXA 2EJMA 1B50A 5CV5A 4X3TA 3HOVH 3HOVB 4F7XA 1PFMA 4G7OC 3PUVA 2UXDQ 3KF6A 4DAMA 4C3IG 5FO7B 1JOOA 4C3JG 5EBCA 4DUZL 5EJWA 2E2JB 1SNCA 4JBMA 4QCLA 3AEVA 4DV7L 4QY7A 1DGSA 3ERQA 3GD7A 2H4OA 2XRSD 4HN7A 1D5XC 3CCQA 1I4HA 3PUZA 2FMCA 4FF2A 4HJ7A 2HT1A 1SFOH 1QZHA 5M3FH 1SFOB 4A3KB 3KBXA 2QGQA 2PQAA 1HR0W 3CQZH 2EQSA 3K81C 1PH1A 5CC4A 2H1EA 4UP7A 2Q2IA 1NCVA 3RLOA 1WTQA 4CKBA 1CHQD 4FDBA 1U4LA 1F2ZA 3DEPA 2PW5A 5EBDA 2B39A 1OXVA 1KLGD 3GQBA 4K5WA 1P8LA 2A5HA 2VQFQ 1JB7A 3I4NH 1TIID 2LFNA 4LAAA 3I8ZA 3KLWA 2JN4A 5ISRA 4IOAA 3KYHC 1HHVA 5FLXL 1I5FA 2R92G 3HOZG 3D6WA 3E0EA 1QVCA 1KLUD 2NN6H 3CRKC 2F0KA 1EIFA 3HOUG 3LWEA 3M85A 1K8AC 1UE5A 4ZQ3A 3AMUA 1XMQL 5CV8A 3PO2H 1ZEQX 3PO2B 2VS1A 1KTKA 1PZKD 1UEBA 2LXJA 5IT9L 2A6HD 2YTYA 1SBBB 3G48A 4BBRG 1O7LA 1HH2P 2SDFA 1PDQA 5M9OA 2C5CA 2F0LA 3MFYA 4TSSA 4WFN3 5CGKA 2R7DA 2F4IA 1LTGD 1JE5A 3X3MA 3KF6B 1HUNA 3S2HH 1VQ9A 1QB5D 3JAML 2F0UA 1WD1A 2RCNA 3QOJA 5D3IB 4AH6A 3E9HA 3OIQA 5AJ3Q 4JI4Q 1F9PA 4QGUA 2YYZA 2K05A 3TS0A 1Z6HA 1HZCA 2UUAL 3K5NA 3C46A 1N33Q 1QG7A 4GOPC 5M5YB 4IFDI 4JI0Q 1FNVA 2PQAB 1W6JA 4L5TA 4RMFA 1S4ZA 1Z7TA 4C3IB 2KHSA 3BVGA 2B63G 5IGBA 4C3JH 4C3JB 1CQFA 1DJRD 1E2WA 5GAEC 1OXSC 2EZVA 5DM73 1X54A 1ASYA 5DLQE 1TWHH 1MI2A 3VR6A 1J9OA 4B9WA 5IE8A 3V2TA 1SYFA 1EFID 2O4XA 2K04A 5J39A 3TP6A 5GAHC 1TXYA 1MSGA 2ICEC 3ZJYC 1TWGH 3GV3A 1K28A 3R93A 3K5LA 2NVQH 4POGA 2IT1A 3CD6A 4LW1A 1YBYA 1IZ6A 1NMGA 3F2DA 4JI2L 2JA7G 3RUZA 1IW7D 1V43A 3IRBA 1KDCA 4XTCS 2IY5B 5K36H 4JC0A 4CKEA 2E2IH 2K32A 2Z4HA 4DV5L 2E2IB 2R3ZA 3I7FA 3GTQH 1NAPA 3DMUA 5CV9A 4XQJA 4LF8L 3GTQB 4PZ7A 4ZKBB 1GJXA 1BCPC 2F0HA 3TQYA 5FLXc 1UWVA 1HQMC 2N8NA 4LUOA 1EIHA 1PRTC 3TZUA 1H95A 3M4YA 3HOZH 1U4PA 2XWBB 1EY7A 2R92B 3HOUB 1B7YB 3KBGA 2ZXPA 1Q12A 1T9HA 5E1FA 2ES2A 2IX1A 2QDLA 2C9OA 5G3LD 3I55A 1FYCA 4B3ML 2K28A 3M9BA 2OF1A 2L5TA 4LF5L 2BH2A 4BBRB 3I73A 1K3BC 2Q8IB 1PTOD 5J22A 1WCMG 2JQOA 4JPBW 3T56B 3M7NA 5A2QE 5FK9C 1LACA 1A0IA 4XIGS 1S5BD 4H7BA 4S3SA 1EIGA 1XYIA 1XNRQ 1WYDA 3MZ5A 3R2IA 4YWLA 4YIJA 4A3DH 3FVQA 5F2DA 2MUYA 2OQKA 3L7ZC 4ZAIA 4A3JG 4GOPA 1QUQA 2G5DA 4ODGA 5CYUA 2EYOA 3RN5A 4DXGA 3MXNA 3NUCA 3S17H 2UUCL 1AN8A 1ZYRD 3DWQA 4LFCL 1B3QA 3L0OA 2XRQD 2VL6A 3H0GH 4DV2L 5JJIA 2JSOA 1V1QA 4DR1Q 1Q46A 5JEAG 1WOCA 3A8IE 2K1BA 1SJHD 4XYQA 2WB1E 3VA7A 2B63H 1A2UA 1Y14B 4OX9L 5E7NA 4C1NK 4B9XA 5CV7A 3I90A 4GNXC 1M8AA 4U68A 2VXWA 4BY7B 2JA5B 4KY7A 4HJAA 1GUWA 1E7ZA 2ZXOA 3CU7A 2KCNA 4DGZA 5EPLA 1VQEA 1E0BA 1L0YB 4ZRZA 1RHPA 1M4VA 1AP0A 4XT3B 2O5IC 4X62L 3ULJA 2OTJA 3FPPA 2JA7H 2JA7B 1V1PA 3GTJH 3SEBA 4ABNA 4LF9L 3H15A 1VQIA 4UAIA 4NP5A 4G7HC 3HOXH 1RCVD 4DA2A 1LT4D 4AYBB 1PH9A 1EEFD 4IO9A 2VB3X 3QB3A 5ELFA 4OWXB 4TRDA 4ZYSA 1BF4A 1R4PB 4KLKA 1D5MC 4WORA 4DV1L 4LFBL 3E0JA 3BU2A 3CKIB 4A3CH 2NVYH 2NVYB 1LT3D 1JB3A 4OO1I 4GZYC 4IJLA 1OTCA 2WAQG 4BS9A 1TKWB 4DAYA 5M3MG 5LMNW 4EQPA 5ELOA 1CZGA 4GOPB 1V1OA 1QUQB 1B8AA 4L63B 1VQAA 2E75C 3GTKH 4FF4A 3MXNB 4MIUA 1LO5D 2A19A 2DUDA 2RBMA 3BDLA 2EIFA 4R4CA 4DK3C 2ZM6L 1CK1A 2I46A 4A93G 1F2YA 2RDGA 2N49A 1WCMB 2UXDL 1PV4A 3EBEA 3J7A5 4JI6L 3CF5A 2F0IA 4EQNA 1IL8A 3NQIA 1YJWA 4IZ8A 1Y1VH 2EJGC 2LMCB 4OIJA 1A2TA 4A3JH 3NXWA 4A3JB 1XMQQ 5C4ZA 1TWAH 3TP5A 1AFPA 3CC7A 3CP0A 3KLRA 1X32A 1A3UA 1NJIC 2V4DA 4CDCC 2QDBA 3PF4A 4P71A 5C6AA 5I2YA 5G3LF 1RIPA 1IYVA 5IP9G 2D5DA 1Q81C 3RN2A 5EGTA 2F0QA 4KTAA 4GNXA 1V1PB 1PTOF 3M7GA 2DY7A 3W5OA 5KRUA 4HIKA 2QA4A 1NUCA 3CCUA 2X6LA 2HIVA 1BCPB 1O7YA 1EQQA 2F52A 2VW9A 2E5LQ 4HMIA 2OTLA 1PRTB 1I4XA 2AQ2B 1I3QH 1I3QB 1SYGA 3V05A 4P2CB 2B29A 4FXKC 4JV5L 5EKKA 1TY2A 3I4MH 3CCEA 4KN7C 2KHIA 4BXXG 1JQYD 3NHHA 3K6OA 1BUVT 1O7ZA 3UI2A 1CKOA 4HIOA 4DAYB 1Q1BA 2G9DA 3F2CA 2F0GA 2L0CA 3MEHA 4TQUS 1SMYC 5I6YA 4HAEA 5BR8L 3IFDA 5LL6X 2K5HA 1ENCA 5C44G 4A3FB 1I6VC 1NY4A 1J6QA 5C4XG 4L5QA 1EFWA 4FXGC 4JG2A 5L37A 1RF2D 2JA6G 1T5EA 2KA7A 1ILQA 5C0XG 1VQFA 4M1UB 5IGEA 2R93H 3K0YA 2Q8RE 2SNSA 3VR5A 5IYCG 3S1MH 4O0AA 4LWCA 1X55A 4ULLA 1YNJC 2WAQB 3K7AB 5M3MB 3T51B 1W2BA 4A3MH 2RSOA 4DK6C 1N8RC 2WIIB 2IJ0A 4RGOS 2K6AA 1BDOA 1N33L 4DV5Q 4IJHA 1EYGA 3P7JA 1M90C 3S1NH 4LF8Q 2LSSA 1CQVA 1LTBD 4POFA 4JI0L 4A93B 1TQOA 3BYTB 1QOHA 1HZ9A 3S1QB 1HTPA 5JJKA 2Z6KC 3PMFA 4P74A 4GNXB 1VCIA 2WKDA 4V0BA 2A6HC 3HFZB 1G6PA 2CHBD 5FLMH 1BR9A 3EIVA 3DXJC 1TVXA 2YTXA 2EDGA 1JMCA 1AE2A 2L55A 5IGDA 2H5XA 4B3MQ 1SNQA 3M3YB 4APVA 1U5KA 3K5MA 1QNKA 3T16A 4LF5Q 4IPGA 5D14A 1RL2A 3BVZA 4DF7A 1WTRA 3FDTA 5LL6S 5IP9H 3OTOL 3UDIA 3CMAA 1R9TB 5C4JH 2Q8TA 5DEHA 4LF4L 3PGZA 4YCUA 1Y8NB 3LGJA 3T1YL 5JPNC 4CDFC 4DV6Q 2A8VA 4GN3B 4DR4L 5JAVA 3MXPA 4RGTA 4R4TA 1HNXL 2MO1A 5CORA 3DWPA 3U50C 2UUCQ 4LFCQ 4C3HH 5M3FG 4J1MA 3I4OA 4DV4L 2EXZA 3DWAA 2CH4W 4DV2Q 4BXXH 4Q0FA 1HZBA 1EYCA 2B2WC 2EJFC 1I6HB 4LMQD 1CM9A 2LXKA 1D1KA 1CTMA 5LMUL 1HR0L 2NTTA 4OX9Q 4WRDA 4RFBA 1X3QA 1PLFA 5T1GA 3TS2A 2GVBA 3NPPA 1STEA 1OO9B 3GTLH 1BKBA 3K8AA 2K5VA 5C44B 3I4NG 5CBEE 1S72A 1B3AA 3FRPB 1EOVA 1VQHA 5C4XH 5C4XB 1IW7C 2Y0SE 3RZDB 2JA6B 1KC8C 4UY8C 3K59A 2EPBA 1E1TA 5DAUA 1K8MA 2WACA 2ATWA 2NN6G 4X62Q 4OWWB 1GHJA 1EUJA 2IHEA 1LTID 4MN3A 1EYDA 1CA5A 1E24A 4DFAA 4ME5A 4HJ9A 1NNXA 4Y7NH 2VUMG 1QVFA 3C3LA 3L3OC 4B3RQ 1WTPA 3SHLA 2Z6KA 1BBXC 4DR1L 3BJUA 4QUFA 1OXUA 4ZUIA 1Q8KA 2DGYA 2J4XA 4LFBQ 4DV1Q 1LTLA 1XPOA 1PYSB 1O78A 5C4HA 2WV6D 1SDFA 3U4VA 2KOLA 4BA1I 4EGVA 2O5JC 2K03A 3NEMA 1EY6A 1PFNA 4J6HA 4KKUA 1KRTA 2O2LD 3ND9A 1CUKA 1T5XD 2DN8A 1CSPA 1NR4A 2OEOA 2F0MA 3IAYA 3OOCA 2ZM6Q 1LV9A 5I9OA 5KNBA 4XDXA 3OMCA 1IBML 4AQYL 3M4PA 1Q1EA 4JI6Q 2UXBQ 1U4MA 2CW0C 3PUWA 1NR2A 1AZPA 5ELEA 4JBKA 3UDFA 3J7AV 4QIWB 1ZYRC 2Q2UA 5JVG3 3NQTA 2JP1A 4A3EH 4DR6Q 4K2KA 3ULPA 1HCZA 3I70A 2RHSB 1GHKA 4FVMA 3TSSA 3D0FA 5I4DA 2B2WA 4KKSA 5M3FB 2V1CC 1BO0A 3CQZB 1VQCA 3GTOH 4RG1A 1VQOA 2HCIA 1PMRA 3CCJA 5K36G 3S14H 3S14B 1PH5A 1AZQA 1C4QA 3DHQA 2KVMA 1Q7YC 1STAA 5JEAJ 3CMEA 2CWAA 1RODA 3K0XA 2SNMA 1WFQA 3EJIA 1DD2A 1VQGA 1VQJA 3QG1A 3KLSA 3I4NB 1UUPA 2BE5C 2EYJA 4PG3A 1SE8A 3SK4A 2JA9A 4DR3L 1F2MA 1L1OC 4JV5Q 2EYLA 5E4WC 2RDHA 1PH4A 3NBIA 3TMEA 4ID6A 4ZCKA 2K4KA 2FJ2A 2JEAI 1LTTD 3G6EA 5BR8Q 2VUMH 2VUMB 4RGNA 1FJGQ 4DR7Q 1G8ZD 2AQ1B 2QILA 3MWYW 2A74C 2EXDA 1B70B 2XN9C 1NTGA 2A69D 2YU9H 5FLXE 2QKIC 3S2HB 3CCVA 4K8JA 1WTOA 5I6WA 4MTKA 1SNMA 2HD3A 4A3DG 1YNXA 3RMHA 3J80L 4A3GG 3PUYA 2BH8A 2AMCB 2E5LL 3OWFA 1X3GA 5IT9E 5HGQA 4JYAQ 1W3SA 2NYZD 4FP5D 4OGQC 2GVAA 4DAVA 1LTSD 1B53A 1LM0A 4AYBE 4O1NA 2B2TC 3H0GG 3E6ZX 3NTHA 5AFWA 3JAME 1EIYB 2AHOB 3F2UA 2AQ3B 3EFXD 2HIXA 4EVOA 4OELB 4K2LA 4K6DA 4CKCA 2F0TA 1TWHB 4KN4C 1N34L 2ZJRA 3MEFA 1DXMA 4NB3A 1UE6A 4EX5A 2PW7A 3STBD 4XYOA 2RSNA 1EY5A 4HR7B 1TWGB 4DAPA 1XTCD 1LT6D 4B3TQ 1GM5A 2NVQB 4DR5L 4QB4A 2MHVA 2WINB 3OTOQ 1IXRA 2F0WA 1XXGA 4R9WA 3Q0AA 1S3OA 4LF4Q 4KD4A 5HY6A 4F88A 2VZAA 4F87A 3T1YQ 5H1SE 1J5EL 3D4WA 3HOXG 4CGYB 3J7YW 3JC66 3BZDB 1BBWA 2NWGA 1YNND 2XTIA 3S2DH 4HSPA 4DR4Q 4DN4M 1VQKA 1L1OA 4KD3A 2NVTH 1HNXQ 2AWNA 2Q2TA 3S15H 4M8AA 4O42A 2I5MX 3A55A 3SK6A 3J7AF 1N36L 2L4NA 4K5VA 4DV4Q 1CKNA 4A3CG 4KJNA 3HOZB 5J3BA 5C0XI 2RHQB 1QJOA 1PTOH 2K33A 1II3A 2A68C 5IT9c 4RKBA 1FNUA 5IY0A 1PH8A 1HR0Q 5LMUQ 1F2LA 3CW2C 2I07B 4OXPA 3P1HA 5LMNL 1YHQA 4HTHA 1MD2D 3C1EA 1K3RA 1VQ4A 3JAMc 3J7ZC 2A73B 1B2TA 5C5MA 3NWSA 1E2ZA 1H9MA 3CCRA 1YIJA 1ILPA 3MA2B 3J80c 1SYDA 4N8FA 1LLRD 1UE7A 4CDDC 3GP7A 3N6RA 4DUYL 1BOSA 2ZXRA 1Y1VG 3HOYG 4A3DB 4DV6L 4LUVA 5C0XJ 3CAMA 4A3GH 4DKAC 4JI1L 5CMDA 2M9VA 3I56A 1TY0A 4H0LC 2DNEA 3FHWA 2B2TA 3S17B 4LJZC 1PXUA 3H3VH 4HCSA 4DNRB 2MP1A 3Q23A 1S5DD 1KDAA 4BY1H 2HQEA 3ZYYX 4MTNA 3H0GB 1TWFH 1TWFB 4X65Q 1YVCA 1KD1C 5HGTA 2F0PA 1L0XB 2Z4IA 2EOTA 3DLLA 2B63B 4L6TB 2VB2X 2GA4B 3TDQA 4A3IH 2A6ED 2ENBA 4HMJA 2KENA 3T1HL 4KK7A 4C56C 3SGIA 2L15A 2WAQE 2XSCA 2VQEL 4RAUC 3C1FA 4WJWA 4MZ9A 2FXQA 5C3WA 2IL8A 1L1OB 1HZAA 2EYPA 4DV0Q 2B3GA 1TS3A 4BA2I 4H44C 3I4MG 4CJ0B 3D4RA 3NTKA 1CKNB 1SXTA 3PQIA 3EA6A 1IBMQ 1GUGA 4AQYQ 1STHA 4DR2L 1FNWA 1KL9A 5FOBB 2QEXA 1VQ5A 1IL2A 3GTJB 3N52A 4IUQA 3A7AB 1ONLA 1G2TA 1YITA 4PMCA 1C48A 4BBSG 3HOXB 4JW0A 2WKCA 2DJGC 1LABA 4B3RL 3HP3A 3NK9A 3K58A 1D6EC 1UNSA 1VQMA 1TWCH 1TWCB 3CPFA 1KAAA 1IHZA 1WJJA 4KHPL 3PUXA 3S1RH 3MVVA 2BA1A 2R93G 1HXYD 3VYRA 3ICEA 3VYUA 2NN6I 3JAMi 1G291 3J81L 1IBLL 2ZJQA 2ZJPA 3PIOA 2UU9L 1Q8IA 2IHFA 4A3MG 2E8GA 2CQAA 3G6JB 4IUUA 2DY8A 3GTKB 2G9HD 2HHHL 1RTNA 1HFNA 4GKJL 4JI8L 1KNAA 2WB1G 2QF7A 1KAWA 2LS01 2UXCQ 1ICWA 2RKSA 4JI7L 1A6XA 2EY6A 2UXBL 2X69A 4DR3Q 1YJNA 1E2VA 4UPAA 1AE3A 1XPUA 4WJ3M 4KKTA 1JT8A 3J81E 4ILWA 3UE1A 3HKZG 4HEDA 3MFGA 1Y1VB 3HOYH 3HOYB 2ZTEA 3WOFA 5FLMG 1HQRD 2B2VC 5GADC 3L2PA 4DR6L 2NZ1D 1TWAB 1IYUA 3Q8DA 5IGCA 1U9RA 1RDPD 1KNEA 1XMOL 2BDNA 1QZGA 1F77A 2HUGA 2RF4A 1X65A 3A74A 3H6MA 3AFPA 3ERSX 2EYFA 2UUBL 3TEHB 5E4XA 4X3SA 3M4OH 2XNAC 1CHPD 3LNNA 4NDXA 4IFDG 1RTOA 3GTGH 1TS5A 4RHSA 1B9MA 3OW7A 4HCEA 3CC2A 1EEID 4FXDA 1STNA 3NWTA 5KEEA 3HEJA 1CZWA 4C3HG 4IUTA 2D62A 4G7ZC 1EQTA 3I4MB 1PH2A 3LWUA 2F0NA 2F0VA 2SOBA 1XNQQ 1SE2A 1JJ2A 3OHXC 4DU9A 4NW2A 1IKLA 3CCMA 1CSQA 2F0JA 4X64L 1SE3A 2Z6BA 1A3TA 4BBSH 3BYYB 3R3OA 1FJGL 4DR7L 3KK7A 4G57A 4V190 1D5ZC 2CWPA 1N34Q 4FF3A 3VA5A 1JWUD 2AWOA 1K0SA 1BCPD 4X3KA 3SK5A 1E22A 1JOKA 3J81c 1B9NA 3FKIG 2EY2A 3DEOA 2R93B 3A8KE 4DR5Q 3S1MB 4PNYA 2QCPX 5ELCA 4A3MB 1JORA 4JYAL 3U58A 5KIXA 1G91A 1J5EQ 4QIWE 3VYTA 4J15A 3E9IA 4DV3Q 3S1NB 2D9UA 2WB1B 2Q2HA 1U4RA 1C7YA 1E3PA 2MPMA 5FJ8G 2R7ZH 1KIXA 1ML0D 4K0KQ 4NXMQ 1ZXTA 3EQLC 3IL8A 1N36Q 2B2VA 3HKSA 5KYLA 3HKZB 4QUCA 2JE6I 2N78A 1A15A 1MSHA 3NELA 1EU4A 4A3LH 1SYBA 1SSOA 1Y69U 5JJLA 1YZ6A 5T1IA 1XWEA 3DM1A 5M5XH 1IKMA 5LMNQ 1PVOA 5BN4A 1EQVA 2D0PA 1HRJA 4B3TL 4GN5A 2NUCA 2OXPA 3H94A 2JK8A 4X6AH 2PNRC 4LF7L 2K01A 5C4JB 1D1IA 1JR0D 1QWYA 3EN2A 1VQ6A 4Q5VA 4DUYQ 1VQBA 1SAPA 2ID0A 2MJ8A 2ZTCA 1VMCA 4IFDH 2PNHA 1NBWA 4JI1Q 4A3EG 4R4IA 4JBWA 2I5LX 4JI3L 2KQ3A 3O13A 2C35B 4UP9A 4IALA 2JA8H 4C3HB 5TSSA 2PMZB 1N32L 3QOLA 1JE4A 2EE1A 5IODA 3AB9A 2CH4A 4OIKA 1K73C 1PH7A 1HNZQ 3RZOH 3RZOB 5A35A 3W1BA 2PZUA 1PFBA 3T1HQ 1VQPA 2VY3A 3MXUA 5D3DA 1EYAA 3KOJA 2DJFC 1D8LA 3GTLB 2VQEQ 4PZ8A 1STBA 4IQZA 2D0OA 1WTHA 2HQLA 1TS2A 2PZWA 1WI5A 2FMMA 3FKIH 2Z1CA 1DOMA 5CV4A 4GKKL 3HGBA 4DR2Q 3G4SA 1Z9FA 2MO0A 3NENA 1ENAA 3F8TA 4PMBA 3SDZA 3A8JE 1EOTA 4P72A 1Y1WH 3I72A 4Y7NB 1X3FA 3T13A 5IYBH 3PO3H 2BCOA 3UE0A 1F9SA 4X65L 5FJ8H 3I4LA 3H91A 1EWIA 2A1AA 2KHJA 5NUCA 1WVLA 3U4ZA 2GN5A 4LNQA 4KHPQ 5EPKA 4CHTB 1BCPF 3GO5A 4JK1C 4RHRA 1IBLQ 2F4VQ 1YHBA 4UHVA 3TBIB 4EQOA 1PTOC 1GD7A 2UU9Q 1B44D 2K5QA 1WTVA 2R7FA 1HFGA 1GUNA 3PSIA 4DV0L 4GS3A 2HHHQ 2FFKB 4GKJQ 4JI8Q 3KJPA 1JC7A 2MFIA 1JOQA 5KYIA 3PIP3 1YHAA 4JI7Q 3VYSA 3I91A 3QIAA 2TSSA 2IX0A 3GTPH 1S5CD 4A3BG 4IPHA 1TT2A 1ENFA 5IYDG 3I2ZA 3WDNA 3D6CA 2Z8LA 2Y0SG 1FL0A 3RD4A 5J1ZA 4A3EB 1PYWD 2I0QA 1TU2B 1PYBA 1DZ1A 4ZK9B 1WD0A 4LK1C 1DOKA 2AKWB 2A6EC 1A3VA 3ULLA 4YWKA 1KHIA 1DM0B 1VMPA 1XMOQ 3BVMA 3H3VC 4HIDA 2E2JH 2F3WA 3GTOB 3E5SA 4N9PA 4NMZA 1GKHA 1TS4A 3GV6A 1S40A 2K5DA
chains in the Genus database with same CATH topology
4DK1A 4K8IA 1EWHA 1SMYD 2XIWA 1SNOA 3R8BA 4XXEA 4C2MB 1KDBA 3SXHA 4G4KA 2L11A 3U9OA 1YNJD 2BOSA 1GUOA 2F03A 4I7ZC 1QNUA 1GUTA 4H13C 5CV6A 1I4RA 4OO1H 4QMGA 1RJTA 2FINB 2YU9B 3S9WA 4UDUC 2RA4A 4RH6A 2IPKD 1SE4A 2K7VA 1X3PA 2JYOA 3TN2A 1QCBD 2KEEA 1B1ZA 1VF7A 3NP8A 2ZT9C 3W2DA 1H9JA 5FO9B 3Q22A 1HPCA 5IIFA 3I3CA 2JEBI 2MGSA 4A3BB 1ZKOA 4MHEA 1H9KA 4FNFA 3J80E 3C2PA 4PQXA 1STYA 2Y0SB 3OMGA 2HCCA 4RCNA 3AU7A 5JPMC 2BA0A 2HDLA 3KF8A 2K5WA 1PZJD 3TP8A 4X3UA 3EROA 4CJ1B 1UEAB 3BDOA 1G6ZA 1DOLA 5E3FA 3QJYA 4CJ2C 5I2XA 3T53B 1CA6A 2IWHA 5KGUA 3S2DB 1K83B 1ET9A 3MXGA 1HUMA 1D2BA 2F0EA 2NVTB 3S15B 4IFDJ 1S5ED 1GXDC 1I4QA 1PTOB 1PZID 3L9AX 1G2SA 1F9RA 2RDFA 3U9SA 2F0FA 2F1MA 5C3XA 5A2QL 5FO8B 2L12A 1SNPA 3K57A 3VR4A 3RLFA 1Z47A 2X6GA 4C1NI 3PIO3 2EVBA 5CBAE 2R61A 4A3GB 1EL0A 4NKLA 2TMPA 1I50B 1WTWA 2M00A 5DM63 3SR1A 5BN5A 5EKLA 4BY1B 1VF5C 1Y8OB 1GOZA 2EYMA 4XQQA 2EY5A 2NB0A 1ET6A 3EVQA 1AW7A 5CR3A 4A3IB 4IUPA 1UAPA 2CW0D 1Q3LA 4FO2A 5KNDA 4R8IA 4K14A 3R2TA 4PMWA 2J7ZA 4FF1A 1W6KA 5EPJA 1EU3A 2R6GA 3ONAB 5BN3A 3NTIA 1QE6A 1KABA 1I4GA 2M2LA 1CI3M 5JVH3 5IGFA 3BG3A 4OL7A 5I9PA 4IUVA 5JOBA 4KHZA 3Q24A 2QEJC 1H9SA 2PZTA 1JICA 1SYCA 3MHBA 4IURA 1SYEA 1HA6A 1BXTA 3ITPA 1DYQA 3CHBD 2BE5D 3IKJA 1EZ6A 4DNTB 5C3EB 3S1RB 4ZKCB 1O80A 2PPBC 5COYA 2XWJB 2D2CC 1J8IA 4R8NA 3NSWA 3D8GA 5IOCA 4HSVA 4TKOB 2FHTA 2B8FA 1R4QB 3QWNA 4IUNA 1CFMA 3FMCA 5M5WB 1EY9A 5D65A 2KEDA 2OT2A 2WP8J 3HG9A 2L9HA 3K5OA 4PV1C 2KJXA 1WTXA 3NBHA 3CRLC 4KMUC 1SEBD 5IGGA 3URYA 1FGBD 1OXXK 2PCFB 4XQNA 3T4AC 3X3NA 2PYKA 1NSNS 4QF4A 3FPUB 2N88A 3M4OB 1RKNA 4RCOA 1H9SB 3GTGB 3DUZA 2VNUD 1MBYA 3A54A 4ZUJA 3P75A 2B2YC 5JEAH 3S16B 1EWCA 5ELBA 3H09A 1JWSD 2AUKA 2F3VA 5JJZA 2NVXB 3QO2A 2BDOA 4ZLTF 5ELDA 2KUMA 2DNCA 2HDMA 2B8GA 4BBSB 5EQ0A 3A56A 1LT5D 1LTAD 3OSOA 2EYHA 4L8JA 1F9QA 4DXFA 1GUSA 1FR3A 3PV0A 1PRTD 2IX3A 3LX0A 4K6LA 2E76C 4Z9CB 2EY1A 1EY4A 4IN3A 5C5LA 2A68D 3VR3A 1C8CA 1CT1D 1ESRA 1HTLD 1RD9D 2F0OA 5K5PA 3D4DA 2R7ZB 1BQQT 2XVSA 1LTRD 4OHJA 1SNDA 1Y8PB 2PO4A 2LY7A 4DK0A 1STGA 2B2UC 4KI0A 3Q6SA 3MC0B 3D31A 2A69C 2JXMB 2RQXA 4U673 2KCCA 5M5XB 4RKLA 4I65A 1EY8A 3OWEB 4B08A 2PQEA 3HRZC 2LKVA 4KY6A 3BDCA 2E2DC 1TR5A 2F0DA 1B4OA 3MTSA 3MAQA 4E6IA 2F0SA 2SEBD 1H9RA 1K8OA 1JCKB 2B2YA 4KJOA 2E74C 3OPOA 3HZXA 3ND8A 2JA8B 2J0TD 5FKAC 3G7LA 3TZDA 1EY0A 1BNZA 1V8QA 3D3RA 4CBVA 3A7LA 1JWMD 1MGSA 4KV6A 4RGMA 5LHY1 1EZ8A 3SK8A 4J8QA 1DONA 4RA8A 3P20A 3NE5B 3FKIB 3FEWX 1HA5A 2NTSA 1I4PA 4FYDA 1XX8A 2CVRA 4K5XA 1YNNC 5HURA 4BWGB 4RWSC 1Y1WB 3PO3B 3SVMA 3IFTA 1SJED 5C0XH 4OO1G 3HOWB 3TP7A 3HS0C 2B2UA 4XT1B 2NBFA 1VDZA 2E2HB 3KLSX 5KNCA 1ESFA 1Q90A 2N55A 4F8MA 1FD7D 1OXTA 1PRTF 3W3AA 4KY5A 3WOEA 2KECA 5EKIA 2ICIA 3VR2A 2L1BA 4N9TA 2AUJD 5DNFA 3GTPB 1QILA 1DCZA 3V96A 3OIPA 4KHVA 2IW3A 3BS1A 3SE0A 3GTMB 3KUPA 2RVLA 1S5FD 1AEXA 2EJMA 1B50A 5CV5A 4X3TA 3HOVB 4F7XA 1PFMA 4G7OC 3PUVA 4C3IG 5FO7B 1JOOA 4C3JG 5EBCA 5EJWA 2E2JB 1SNCA 4QCLA 3ERQA 3GD7A 2H4OA 2XRSD 4HN7A 1D5XC 1I4HA 3PUZA 2FMCA 4FF2A 1SFOB 4A3KB 3KBXA 5CC4A 2H1EA 1NCVA 1WTQA 4CKBA 1CHQD 1U4LA 1F2ZA 3DEPA 2PW5A 5EBDA 2B39A 1OXVA 1KLGD 3GQBA 4K5WA 2A5HA 1TIID 2LFNA 4LAAA 3I8ZA 5ISRA 1HHVA 5FLXL 3D6WA 2NN6H 1KLUD 3CRKC 2F0KA 3LWEA 3M85A 4ZQ3A 3AMUA 5CV8A 3PO2B 1ZEQX 1KTKA 1PZKD 5IT9L 2A6HD 1SBBB 1O7LA 2SDFA 5M9OA 1PDQA 4WFN3 2C5CA 2F0LA 3MFYA 4TSSA 5CGKA 2F4IA 1LTGD 3X3MA 1HUNA 1QB5D 3JAML 2F0UA 1WD1A 3QOJA 5D3IB 3OIQA 1F9PA 2YYZA 2K05A 1Z6HA 3C46A 3K5NA 1QG7A 5M5YB 4IFDI 1FNVA 1W6JA 1S4ZA 1Z7TA 4C3IB 2KHSA 3BVGA 5IGBA 4C3JB 1CQFA 1DJRD 1E2WA 1OXSC 2EZVA 5DM73 1MI2A 3VR6A 1J9OA 4B9WA 3V2TA 1SYFA 1EFID 2O4XA 2K04A 5J39A 3TP6A 1MSGA 2ICEC 3GV3A 3R93A 3K5LA 2IT1A 3RUZA 1IW7D 1V43A 5K36H 1KDCA 4XTCS 4CKEA 2E2IB 2K32A 2Z4HA 2R3ZA 3GTQB 1NAPA 3DMUA 5CV9A 4XQJA 1GJXA 4ZKBB 1BCPC 2F0HA 1HQMC 1EIHA 1PRTC 3TZUA 3M4YA 2R92B 1U4PA 2XWBB 1EY7A 3HOUB 3KBGA 2ZXPA 1Q12A 5E1FA 2IX1A 2C9OA 5G3LD 1FYCA 2K28A 2OF1A 2L5TA 4BBRB 3I73A 2Q8IB 1PTOD 5J22A 3T56B 3M7NA 5A2QE 5FK9C 1LACA 4XIGS 1S5BD 4H7BA 4S3SA 1EIGA 1XYIA 3MZ5A 3R2IA 4YIJA 3FVQA 5F2DA 2MUYA 3L7ZC 4ZAIA 4ODGA 5CYUA 2EYOA 4DXGA 3MXNA 3NUCA 1AN8A 1ZYRD 3DWQA 2XRQD 2JSOA 5JEAG 3A8IE 2K1BA 1SJHD 4XYQA 3VA7A 1A2UA 4C1NK 4B9XA 5CV7A 3I90A 1M8AA 4U68A 2VXWA 4BY7B 2JA5B 4KY7A 1GUWA 2ZXOA 3CU7A 2KCNA 4DGZA 5EPLA 1E0BA 1L0YB 4ZRZA 1RHPA 1M4VA 1AP0A 4XT3B 2O5IC 3FPPA 2JA7B 1V1PA 3SEBA 4ABNA 4UAIA 4NP5A 4G7HC 1RCVD 4DA2A 1LT4D 4AYBB 1EEFD 2VB3X 3QB3A 5ELFA 4TRDA 4ZYSA 1BF4A 1R4PB 1D5MC 4WORA 3E0JA 3CKIB 2NVYB 1LT3D 1JB3A 4OO1I 4GZYC 4BS9A 1TKWB 4DAYA 4EQPA 1CZGA 1V1OA 4L63B 2E75C 4FF4A 4MIUA 1LO5D 3BDLA 2RBMA 1CK1A 2I46A 1F2YA 2RDGA 1WCMB 2F0IA 4EQNA 1IL8A 3NQIA 4IZ8A 2EJGC 2LMCB 4OIJA 1A2TA 4A3JB 3NXWA 5C4ZA 3TP5A 1AFPA 3KLRA 1X32A 1A3UA 2V4DA 2QDBA 5C6AA 5I2YA 5G3LF 1IYVA 2D5DA 5EGTA 2F0QA 4KTAA 1V1PB 1PTOF 3M7GA 2DY7A 5KRUA 1NUCA 2X6LA 1BCPB 1O7YA 4HMIA 1PRTB 1I4XA 2AQ2B 1I3QB 1SYGA 3V05A 4P2CB 4FXKC 5EKKA 1TY2A 4KN7C 1JQYD 3NHHA 3K6OA 1BUVT 1O7ZA 3UI2A 1Q1BA 2G9DA 2F0GA 2L0CA 3MEHA 4TQUS 1SMYC 5I6YA 4HAEA 3IFDA 5LL6X 1ENCA 4A3FB 1I6VC 4FXGC 1RF2D 1T5EA 2KA7A 1ILQA 5C0XG 4M1UB 5IGEA 3K0YA 2Q8RE 2SNSA 3VR5A 4ULLA 1YNJC 2WAQB 3K7AB 5M3MB 3T51B 2RSOA 2WIIB 2IJ0A 4RGOS 2K6AA 1BDOA 3P7JA 1CQVA 1LTBD 4A93B 1TQOA 3BYTB 1QOHA 3S1QB 1HTPA 3PMFA 1VCIA 2WKDA 4V0BA 2A6HC 2CHBD 1BR9A 3DXJC 1TVXA 2EDGA 2L55A 5IGDA 1SNQA 3M3YB 3K5MA 1QNKA 3T16A 4DF7A 5D14A 3BVZA 1WTRA 3FDTA 5LL6S 1R9TB 2Q8TA 5DEHA 1Y8NB 5JPNC 5JAVA 3MXPA 4RGTA 5CORA 3DWPA 4J1MA 2EXZA 3DWAA 4Q0FA 1EYCA 2B2WC 2EJFC 1I6HB 4LMQD 1CM9A 1D1KA 1CTMA 2NTTA 4WRDA 4RFBA 1X3QA 1PLFA 5T1GA 3NPPA 1STEA 1OO9B 5C44B 5CBEE 1B3AA 3FRPB 5C4XB 1IW7C 3RZDB 2JA6B 3K59A 2EPBA 5DAUA 1K8MA 2WACA 2NN6G 1GHJA 1LTID 4MN3A 1EYDA 1CA5A 4DFAA 4ME5A 3C3LA 3L3OC 1WTPA 3SHLA 1BBXC 4QUFA 1OXUA 4ZUIA 2J4XA 1O78A 5C4HA 2WV6D 1SDFA 4EGVA 2KOLA 4BA1I 2O5JC 2K03A 1EY6A 1PFNA 4J6HA 4KKUA 2O2LD 3ND9A 1T5XD 2DN8A 1NR4A 2OEOA 2F0MA 3IAYA 3OOCA 1LV9A 5I9OA 5KNBA 4XDXA 3OMCA 1Q1EA 1U4MA 2CW0C 3PUWA 1NR2A 1AZPA 5ELEA 3J7AV 4QIWB 1ZYRC 5JVG3 3NQTA 2JP1A 4K2KA 1HCZA 3I70A 1GHKA 4FVMA 3TSSA 5I4DA 2B2WA 4KKSA 5M3FB 1BO0A 3CQZB 2HCIA 1PMRA 5K36G 3S14B 1AZQA 1C4QA 3DHQA 2KVMA 1STAA 5JEAJ 1RODA 2SNMA 3EJIA 1DD2A 3QG1A 3KLSA 3I4NB 1UUPA 2BE5C 2EYJA 3SK4A 1F2MA 2EYLA 5E4WC 2RDHA 3NBIA 3TMEA 4ID6A 2FJ2A 2JEAI 1LTTD 2VUMB 4RGNA 1G8ZD 2AQ1B 2QILA 3MWYW 2A74C 2XN9C 2A69D 5FLXE 2QKIC 3S2HB 4K8JA 1WTOA 5I6WA 1SNMA 3RMHA 3J80L 3PUYA 3OWFA 5IT9E 2NYZD 4FP5D 4OGQC 4DAVA 1LTSD 1B53A 4O1NA 2B2TC 3E6ZX 3NTHA 5AFWA 3JAME 3F2UA 2AQ3B 3EFXD 4EVOA 4K2LA 4K6DA 4CKCA 2F0TA 1TWHB 4KN4C 1DXMA 2PW7A 4XYOA 2RSNA 1EY5A 4HR7B 1TWGB 4DAPA 1XTCD 1LT6D 2NVQB 4QB4A 2MHVA 2WINB 2F0WA 1XXGA 4R9WA 3Q0AA 4KD4A 4F88A 4F87A 3D4WA 4CGYB 3J7YW 3BZDB 2NWGA 1YNND 4HSPA 4DN4M 4KD3A 2AWNA 4O42A 4M8AA 3A55A 3SK6A 3J7AF 2L4NA 4K5VA 4KJNA 3HOZB 5C0XI 1QJOA 1PTOH 2K33A 1II3A 2A68C 4RKBA 1FNUA 1F2LA 2I07B 3P1HA 4HTHA 1MD2D 3C1EA 2A73B 1B2TA 5C5MA 3NWSA 1E2ZA 1H9MA 1ILPA 3MA2B 1SYDA 1LLRD 3GP7A 3N6RA 1BOSA 2ZXRA 4A3DB 5C0XJ 5CMDA 2M9VA 1TY0A 4H0LC 2DNEA 2B2TA 3S17B 4LJZC 1PXUA 4HCSA 4DNRB 2MP1A 3Q23A 1S5DD 1KDAA 2HQEA 3ZYYX 3H0GB 1TWFB 5HGTA 2F0PA 1L0XB 2Z4IA 2EOTA 2B63B 4L6TB 2VB2X 2GA4B 3TDQA 2A6ED 2ENBA 4HMJA 4KK7A 4C56C 2XSCA 4RAUC 3C1FA 4WJWA 5C3WA 2IL8A 2EYPA 1TS3A 4BA2I 4H44C 4CJ0B 3D4RA 3NTKA 1SXTA 3EA6A 1GUGA 1STHA 1FNWA 5FOBB 3GTJB 3N52A 4IUQA 3A7AB 1ONLA 1G2TA 4PMCA 1C48A 3HOXB 2WKCA 1LABA 3HP3A 3NK9A 3K58A 1D6EC 1UNSA 1TWCB 1KAAA 1IHZA 3PUXA 3MVVA 2BA1A 1HXYD 3VYRA 3VYUA 2NN6I 1G291 3J81L 1Q8IA 2CQAA 3G6JB 4IUUA 2DY8A 3GTKB 2G9HD 1RTNA 1HFNA 1KNAA 2QF7A 2LS01 1ICWA 2RKSA 1A6XA 2EY6A 2X69A 1E2VA 4KKTA 3J81E 4ILWA 4HEDA 3MFGA 1Y1VB 3HOYB 3WOFA 1HQRD 2B2VC 2NZ1D 1TWAB 1IYUA 5IGCA 1U9RA 1RDPD 1KNEA 2BDNA 1F77A 2HUGA 3H6MA 2EYFA 5E4XA 4X3SA 2XNAC 1CHPD 3LNNA 4NDXA 4IFDG 1RTOA 1TS5A 4RHSA 1B9MA 3OW7A 4HCEA 1EEID 4FXDA 1STNA 3NWTA 5KEEA 3HEJA 1CZWA 4C3HG 4IUTA 2D62A 4G7ZC 1EQTA 3I4MB 3LWUA 2F0NA 2F0VA 2SOBA 1SE2A 3OHXC 4DU9A 4NW2A 1IKLA 2F0JA 1SE3A 1A3TA 3BYYB 3R3OA 3KK7A 4G57A 4V190 1D5ZC 4FF3A 3VA5A 1JWUD 2AWOA 1BCPD 4X3KA 3SK5A 1JOKA 1B9NA 2EY2A 3DEOA 2R93B 3A8KE 3S1MB 4PNYA 2QCPX 5ELCA 4A3MB 1JORA 5KIXA 1G91A 3VYTA 3S1NB 2D9UA 2WB1B 1U4RA 2MPMA 1ML0D 1ZXTA 3EQLC 3IL8A 2B2VA 5KYLA 3HKZB 4QUCA 2JE6I 1A15A 1MSHA 1EU4A 1SYBA 1SSOA 1Y69U 5T1IA 1XWEA 3DM1A 1IKMA 5BN4A 1EQVA 1HRJA 2NUCA 2OXPA 3H94A 2PNRC 2K01A 5C4JB 1D1IA 1JR0D 1QWYA 4Q5VA 1SAPA 2ID0A 2MJ8A 1VMCA 4IFDH 4JBWA 2KQ3A 3O13A 4IALA 4C3HB 5TSSA 2PMZB 3QOLA 1JE4A 2EE1A 5IODA 3AB9A 4OIKA 3RZOB 5A35A 2PZUA 1PFBA 3MXUA 5D3DA 1EYAA 3GTLB 1STBA 4IQZA 1TS2A 2PZWA 2FMMA 2Z1CA 1DOMA 5CV4A 3HGBA 1ENAA 4PMBA 3SDZA 3A8JE 1EOTA 3I72A 4Y7NB 3T13A 2BCOA 1F9SA 3I4LA 3H91A 5NUCA 1WVLA 5EPKA 4CHTB 1BCPF 3GO5A 4JK1C 4RHRA 3TBIB 4EQOA 1PTOC 1B44D 2K5QA 1WTVA 1HFGA 1GUNA 2FFKB 1JC7A 1JOQA 5KYIA 3PIP3 3VYSA 3I91A 3QIAA 2TSSA 2IX0A 1S5CD 1TT2A 1ENFA 3WDNA 3D6CA 2Z8LA 3RD4A 5J1ZA 4A3EB 1PYWD 1TU2B 1DZ1A 4ZK9B 1WD0A 4LK1C 1DOKA 2A6EC 1A3VA 1DM0B 1VMPA 3BVMA 3H3VC 2F3WA 3GTOB 3E5SA 4N9PA 4NMZA 1TS4A 3GV6A 2K5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MZ5 A;  1KAB A;  3VA5 A;  2F0I A;  4EQN A;  3MVV A;  1TQO A;  4ID6 A;  1AEX A;  4KJO A;  4ZUJ A;  1II3 A;  1STB A;  3P75 A;  4K8I A;  4YIJ A;  5CV5 A;  1JOK A;  4RKB A;  5F2D A;  5E3F A;  3HZX A;  4OL7 A;  3SHL A;  4F7X A;  2EY2 A;  2F3V A;  3PMF A;  4IZ8 A;  4ODG A;  5I9P A;  5JOB A;  2EYO A;  2PZW A;  1EY0 A;  3P1H A;  4ZUI A;  3TME A;  1SNO A;  3SK5 A;  5KGU A;  1A2T A;  3NXW A;  3NUC A;  4PNY A;  4HTH A;  3C1E A;  5C4Z A;  2PZT A;  5CV4 A;  1JOO A;  1SYC A;  3TP5 A;  2F0E A;  3MHB A;  1JOR A;  1SNC A;  1KDB A;  4K8J A;  5C4H A;  1SYE A;  1A3U A;  3SXH A;  2KHS A;  5C5M A;  5I6W A;  5KIX A;  1ENA A;  5IGB A;  2QDB A;  1EY6 A;  4J6H A;  3U9O A;  5IGD A;  3ERQ A;  3ITP A;  4PMB A;  2RKS A;  4KV6 A;  1SNQ A;  1SNM A;  1SYD A;  2EY6 A;  5C6A A;  1EZ6 A;  3T13 A;  1A2U A;  1EZ8 A;  3T16 A;  3OSO A;  2EYH A;  4DF7 A;  4B9X A;  3OWF A;  5CV7 A;  2OEO A;  2F0M A;  5EGT A;  2F0Q A;  2RDF A;  4KTA A;  4B9W A;  3SK8 A;  5I9O A;  3V2T A;  5KRU A;  1SYF A;  4R8N A;  3D8G A;  1NUC A;  2O4X A;  5IOC A;  5J39 A;  2F0F A;  3TP6 A;  5KYL A;  3OMC A;  5NUC A;  5CV6 A;  3LX0 A;  5DEH A;  4QMG A;  5CC4 A;  2EY1 A;  4KY7 A;  5C3X A;  1EY4 A;  4K5X A;  1SNP A;  5HUR A;  3S9W A;  5C5L A;  4HMI A;  1KDA A;  2HQE A;  5IGC A;  4DGZ A;  1SYB A;  1U9R A;  5JAV A;  1F2Z A;  1SYG A;  3NQT A;  3MXP A;  3RUZ A;  2PW5 A;  4EQO A;  2F0P A;  5HGT A;  1KDC A;  2F0O A;  4IUN A;  5EKK A;  4EVO A;  1EQV A;  1EY9 A;  4K2K A;  5K5P A;  4HMJ A;  2ENB A;  3D4D A;  3H6M A;  4K5W A;  4K2L A;  4K6D A;  4J1M A;  3NHH A;  2F0T A;  2NUC A;  2EXZ A;  2OXP A;  3DMU A;  4LAA A;  5CV9 A;  2EYF A;  4NP5 A;  1JOQ A;  1EYC A;  3NP8 A;  2F0G A;  2F0H A;  4NKL A;  5KYI A;  5ISR A;  3TP7 A;  2PW7 A;  3MEH A;  1SND A;  3C1F A;  1EY5 A;  2M00 A;  3QB3 A;  5C3W A;  1TT2 A;  1STG A;  2EYP A;  4NDX A;  5I6Y A;  5IIF A;  4TRD A;  2F0K A;  4WRD A;  3SR1 A;  5IGG A;  1ENC A;  5EKL A;  3D6C A;  4QB4 A;  1EY7 A;  3DHQ A;  4ZQ3 A;  5IGF A;  1STA A;  4WOR A;  1STN A;  5KEE A;  5CV8 A;  3HEJ A;  2EYM A;  2F0W A;  2EY5 A;  4F8M A;  4RKL A;  5E1F A;  2KQ3 A;  3EVQ A;  2SNM A;  4KD4 A;  4I65 A;  1STH A;  5CR3 A;  1EY8 A;  5J1Z A;  3EJI A;  2F0N A;  2F0V A;  2SOB A;  4IAL A;  2PQE A;  1STY A;  2LKV A;  4KY5 A;  3D4W A;  3OMG A;  5IGE A;  4KY6 A;  3BDC A;  4EQP A;  4DU9 A;  2SNS A;  5M9O A;  2EYJ A;  3QOL A;  2F0L A;  2PYK A;  1NSN S;  5IOD A;  5DAU A;  1A3V A;  4PMC A;  2OF1 A;  4QF4 A;  3SK4 A;  5CGK A;  4K14 A;  1TR5 A;  2F0J A;  2WAC A;  4N9T A;  2F0D A;  1F2M A;  4KD3 A;  1RKN A;  5J22 A;  1A3T A;  2EYL A;  2F3W A;  2RBM A;  3BDL A;  4MIU A;  3E5S A;  4KHV A;  3TP8 A;  4E6I A;  1EYD A;  2F0U A;  3NK9 A;  4N9P A;  2PZU A;  2F0S A;  3R3O A;  4NMZ A;  1F2Y A;  3SK6 A;  3ERO A;  4G57 A;  3QOJ A;  4K5V A;  4H7B A;  4S3S A;  4KJN A;  4DFA A;  1KAA A;  1IHZ A;  1EYA A;  4ME5 A; 
#chains in the Genus database with same CATH topology
 4DK1 A;  2UUB Q;  1FVI A;  3KDF B;  4K8I A;  1SRO A;  1SRU A;  1VQL A;  1EWH A;  1SMY D;  4A3K H;  2XIW A;  2UXC L;  2QW7 A;  1SNO A;  3R8B A;  4XXE A;  4IOC A;  1PHJ A;  2CKZ B;  4C2M H;  4C2M B;  2ALY B;  4YY3 Q;  1KDB A;  3SXH A;  4G4K A;  2L11 A;  1HNW L;  3U9O A;  3RR5 A;  1YI2 A;  1YNJ D;  2BOS A;  4X64 Q;  1GUO A;  2F03 A;  4UP8 A;  4I7Z C;  1QNU A;  1XTD A;  4A75 A;  1GUT A;  4H13 C;  5CV6 A;  1I4R A;  4N8X 1;  4OO1 H;  4QMG A;  1RJT A;  2FIN B;  3PIP A;  3ER0 A;  2YU9 B;  4IPC A;  3S9W A;  2ZTD A;  4UDU C;  2PI2 A;  1MJE A;  2RA4 A;  4RH6 A;  1FGU A;  2IPK D;  1SE4 A;  2K7V A;  1X3P A;  1ASZ A;  2JYO A;  1UE1 A;  3TN2 A;  1PFS A;  1QCB D;  1NE3 A;  2KEE A;  4JI5 L;  1KRS A;  4JVZ A;  1B1Z A;  1VF7 A;  3NP8 A;  2ZT9 C;  3W2D A;  3A5Z B;  1H9J A;  4BY1 G;  5FO9 B;  3Q22 A;  1HPC A;  5IIF A;  1XNQ L;  1PA6 A;  3I3C A;  2JEB I;  2MGS A;  1VQ7 A;  4B3S L;  4GLX A;  4A3B H;  4A3B B;  4OEM B;  1ZKO A;  1U0L A;  4MHE A;  4A3I G;  1E1O A;  3TRE A;  5IYD H;  1H9K A;  1K9M C;  4FNF A;  3J80 E;  4YHH Q;  1MJC A;  4R4Q A;  3C2P A;  2P5Z X;  4PQX A;  1STY A;  1BVS A;  2Y0S B;  3OMG A;  2HCC A;  5M5Y H;  4RCN A;  3AU7 A;  5JPM C;  2XGT A;  2BA0 A;  2K75 A;  2HDL A;  3KF8 A;  2K5W A;  1PZJ D;  3TP8 A;  4C3I H;  4X3U A;  3BZK A;  1C9O A;  3ERO A;  2Z0S A;  1UEA B;  3BDO A;  4CJ1 B;  1G6Z A;  4PZ6 A;  1DOL A;  4LF7 Q;  3W1G A;  1M1K C;  3QR8 A;  5E3F A;  3QJY A;  2JA5 G;  4CJ2 C;  4BY7 G;  4QQB X;  5I2X A;  3T53 B;  1G51 A;  4GLA C;  1CA6 A;  5ELN A;  2KBN A;  4DV3 L;  1GO3 E;  2IWH A;  5KGU A;  3S2D B;  1K83 H;  1K83 B;  1LYL A;  1ET9 A;  3MXG A;  1HUM A;  1D2B A;  1JJG A;  3CC4 A;  4ME3 A;  4JI3 Q;  2F0E A;  1JJC B;  4QL5 A;  3DM3 A;  1L0W A;  2NVT B;  3S15 B;  4K0K L;  4NXM L;  4IFD J;  1S5E D;  5C3E G;  1GXD C;  1N32 Q;  1I4Q A;  2N3S A;  3RLN A;  2K5N A;  1PTO B;  4YWM A;  1PZI D;  3L9A X;  1G2S A;  1F9R A;  5IWA L;  1P16 A;  2RDF A;  3U9S A;  4AYB G;  3UDG A;  5IP7 G;  2F0F A;  3S24 A;  1ICF B;  2F1M A;  5C3X A;  5A2Q L;  2NZO A;  5FO8 B;  1MIU A;  2L12 A;  1SNP A;  3K57 A;  3VR4 A;  2R92 H;  3HOU H;  1MKH A;  3RLF A;  1Z47 A;  2X6G A;  4LF6 L;  1A62 A;  4C1N I;  4GKK Q;  1L2F A;  3PIO 3;  1MHW C;  3KJO A;  3AYH B;  2EVB A;  5CBA E;  2R61 A;  4A3G B;  1EL0 A;  4LFA L;  4NKL A;  1NMF A;  4BBR H;  2TMP A;  1I50 H;  1I50 B;  2M00 A;  4NXN L;  1WTW A;  5DM6 3;  4CDE C;  2K50 A;  3KF8 B;  3SR1 A;  5BN5 A;  4JOI C;  5EKL A;  4HIM A;  4BY1 B;  1VF5 C;  1Y8O B;  1GOZ A;  2EYM A;  3AFQ A;  4XQQ A;  2EY5 A;  2NB0 A;  1ET6 A;  3EVQ A;  1HNZ L;  1AW7 A;  5CR3 A;  4A3I B;  4IUP A;  1UAP A;  2NZH A;  2CW0 D;  1D7Q A;  1Q3L A;  5GAG C;  4FO2 A;  5KND A;  4R8I A;  3F1Z A;  4K14 A;  3R2T A;  4PMW A;  4X66 L;  2J7Z A;  3CCL A;  4FF1 A;  1W6K A;  5EPJ A;  1IBK L;  1EU3 A;  1O7I A;  1YJ9 A;  2R6G A;  3PF5 A;  3ONA B;  4HJ8 A;  5BN3 A;  3NTI A;  1QE6 A;  1KAB A;  1I4G A;  2M2L A;  1VQ8 A;  1CI3 M;  5JVH 3;  5IGF A;  3BG3 A;  4OL7 A;  4L5S A;  4O2D A;  3F2B A;  5I9P A;  4IUV A;  5JOB A;  4KHZ A;  3Q24 A;  2QEJ C;  4BY7 H;  2JA5 H;  1H9S A;  2RCF A;  3HKZ E;  2PZT A;  2CFM A;  1JIC A;  1SYC A;  1XPR A;  3MHB A;  4IUR A;  1SYE A;  2YV5 A;  1HA6 A;  4I7A A;  1BXT A;  3ITP A;  1DYQ A;  4P73 A;  3CHB D;  2BE5 D;  3IKJ A;  1EZ6 A;  4DNT B;  5C3E H;  5C3E B;  3S1R B;  4DUZ Q;  4ZKC B;  1O80 A;  2PPB C;  5COY A;  2XWJ B;  2D2C C;  1J8I A;  1SN8 A;  4DV7 Q;  4R8N A;  2F4V L;  3NSW A;  3D8G A;  5IOC A;  4HSV A;  1I94 L;  4OON A;  1N9W A;  4TKO B;  2FHT A;  5IP7 H;  4A3F G;  3J80 i;  2B8F A;  1HJP A;  3CXC A;  4YCW A;  1R4Q B;  3QWN A;  2R7Z G;  4IUN A;  1CFM A;  3FMC A;  5M5W H;  1EY9 A;  5M5W B;  1PH6 A;  4H02 A;  5D65 A;  2KED A;  2OT2 A;  2PMZ E;  1VQD A;  1HNW Q;  2Z9H A;  1BBU A;  4A4I A;  2WP8 J;  4NPS A;  3HG9 A;  4P75 A;  2L9H A;  3K5O A;  1X6O A;  4PV1 C;  3RNU A;  4A3L G;  2KJX A;  1WTX A;  3NBH A;  3CRL C;  4KMU C;  1SEB D;  4JOI A;  5IGG A;  1WCM H;  3FP9 A;  3URY A;  1FGB D;  1OXX K;  1A8V A;  4MNO A;  1C0A A;  2PCF B;  4XQN A;  3T4A C;  3X3N A;  2PYK A;  1NSN S;  2KCT A;  1EQR A;  4QF4 A;  3FPU B;  1KXL A;  2N88 A;  3BZC A;  3M4O B;  1RKN A;  3K7U C;  4RCO A;  1H9S B;  3GTG B;  3DUZ A;  2K52 A;  2VNU D;  3PCO B;  1MBY A;  4JI5 Q;  1K0R A;  3A54 A;  2JA8 G;  4ZUJ A;  1Q82 C;  3GDE A;  2B2Y C;  3P75 A;  5JEA H;  3S16 H;  3S16 B;  1EWC A;  4YY3 L;  5ELB A;  3H09 A;  1JWS D;  2AUK A;  2F3V A;  5JJZ A;  2NVX H;  2NVX B;  4B3S Q;  3QO2 A;  1X9N A;  2BDO A;  4ZLT F;  5ELD A;  2KUM A;  2VQF L;  3UDX A;  2DNC A;  2HDM A;  4JCV E;  1K8G A;  2B8G A;  4BBS B;  2UUA Q;  2OWO A;  4QJF A;  5EQ0 A;  3A56 A;  3KFU A;  3E3X A;  1LT5 D;  1LTA D;  3OSO A;  3TRZ A;  2EYH A;  4L8J A;  1F9Q A;  4DXF A;  4L5R C;  1GUS A;  1FR3 A;  4R4O A;  3PV0 A;  1PRT D;  4ALP A;  2IX3 A;  3LX0 A;  4K6L A;  2E76 C;  4Z9C B;  2EY1 A;  1EY4 A;  4IN3 A;  5C5L A;  2A68 D;  3VR3 A;  1C8C A;  1CT1 D;  3NBH B;  4A3F H;  1Y1W G;  1ESR A;  1YEZ A;  1HTL D;  1LUZ A;  5IYB G;  1RD9 D;  3PO3 G;  2F0O A;  4DPG A;  4YCV A;  5EAY A;  5K5P A;  3D4D A;  4A76 A;  3HOW G;  2R7Z B;  3K7A H;  3G71 A;  4JI2 Q;  5M3M H;  3AQQ A;  3M4Q A;  1BQQ T;  5AJ3 L;  4JI4 L;  2XVS A;  1LTR D;  1SND A;  1Y8P B;  4OHJ A;  4YHH L;  1AH9 A;  2PO4 A;  1VS0 A;  2LY7 A;  4DK0 A;  4WJ4 A;  4OWT B;  1STG A;  3CCS A;  2B2U C;  4GLV B;  5IWA Q;  4KI0 A;  3Q6S A;  5GRO A;  3MC0 B;  3D31 A;  4A93 H;  2A69 C;  2JXM B;  2RQX A;  4U67 3;  2KCC A;  3A0J A;  5M5X B;  4RKL A;  3S1Q H;  4I65 A;  1EY8 A;  3OWE B;  4B08 A;  3H3V I;  2PQE A;  3HRZ C;  2LKV A;  4KY6 A;  3BDC A;  1SLJ A;  1XJV A;  1X56 A;  2E2D C;  1TR5 A;  2F0D A;  1B4O A;  3MTS A;  3MAQ A;  4R1J A;  4E6I A;  2K14 A;  4LF6 Q;  1V9P A;  2F0S A;  2SEB D;  1H9R A;  1K8O A;  3M3Y H;  2F3I A;  3HOV G;  4LFA Q;  1JCK B;  2B2Y A;  4KJO A;  2E74 C;  1A63 A;  3OPO A;  4NXN Q;  3B6Y A;  3HZX A;  2CQO A;  3ND8 A;  3WWV A;  3CPW A;  3VDY A;  2JA8 B;  2J0T D;  5FKA C;  1GVP A;  3G7L A;  3TZD A;  2OCE A;  1R9T H;  2CCZ A;  1EY0 A;  1BNZ A;  4LUZ A;  1V8Q A;  3D3R A;  4CBV A;  3A7L A;  1JWM D;  1SMX A;  1MGS A;  3STB C;  3J81 i;  4KV6 A;  4RGM A;  5LHY 1;  1EZ8 A;  4A3K G;  4X66 Q;  1CKM A;  1KQS A;  5GQO A;  1IBK Q;  2WFW A;  3SK8 A;  4J8Q A;  1DON A;  4DNI A;  4RA8 A;  3P20 A;  2KCM A;  1I6H H;  4JBJ A;  3NE5 B;  3FKI B;  3FEW X;  1HA5 A;  2NTS A;  1I4P A;  1PH3 A;  4FYD A;  1XX8 A;  2CVR A;  4K5X A;  2MNA A;  1YNN C;  5HUR A;  4BWG B;  3KDF A;  3A5U A;  5C44 H;  4RWS C;  1Y1W B;  4TVA B;  2JJQ A;  3PO3 B;  3SVM A;  3IFT A;  3RZD H;  2JA6 H;  1IYJ B;  1XNR L;  1SJE D;  5C0X H;  4OO1 G;  3K80 C;  3HOW H;  3HOW B;  3TP7 A;  3J81 j;  3HS0 C;  5IYC H;  4AIM A;  1Q86 C;  2ASB A;  3OW2 A;  2B2U A;  1VQN A;  4XT1 B;  2NBF A;  3PO2 G;  2MQH A;  4LF9 Q;  1VDZ A;  2E2H H;  1X3E A;  3KLS X;  2E2H B;  5KNC A;  1ESF A;  1I94 Q;  1Q90 A;  2N55 A;  4F8M A;  4GN4 B;  1FD7 D;  1OXT A;  1PRT F;  2YTV A;  3W3A A;  4IPD A;  2OQ0 A;  4KY5 A;  3WOE A;  2KEC A;  1SR3 A;  5EKI A;  2ICI A;  3VR2 A;  2L1B A;  4N9T A;  2AUJ D;  5DNF A;  4HJ5 A;  4Y52 H;  3GTP B;  1QIL A;  1DCZ A;  3V96 A;  3OIP A;  4KHV A;  3OYY A;  1QVG A;  2IW3 A;  3BS1 A;  3SE0 A;  3GTM H;  3GTM B;  2PI2 E;  2I5H A;  4EQ5 A;  3KUP A;  2RVL A;  1S5F D;  1AEX A;  2EJM A;  1B50 A;  5CV5 A;  4X3T A;  3HOV H;  3HOV B;  4F7X A;  1PFM A;  4G7O C;  3PUV A;  2UXD Q;  3KF6 A;  4DAM A;  4C3I G;  5FO7 B;  1JOO A;  4C3J G;  5EBC A;  4DUZ L;  5EJW A;  2E2J B;  1SNC A;  4JBM A;  4QCL A;  3AEV A;  4DV7 L;  4QY7 A;  1DGS A;  3ERQ A;  3GD7 A;  2H4O A;  2XRS D;  4HN7 A;  1D5X C;  3CCQ A;  1I4H A;  3PUZ A;  2FMC A;  4FF2 A;  4HJ7 A;  2HT1 A;  1SFO H;  1QZH A;  5M3F H;  1SFO B;  4A3K B;  3KBX A;  2QGQ A;  2PQA A;  1HR0 W;  3CQZ H;  2EQS A;  3K81 C;  1PH1 A;  5CC4 A;  2H1E A;  4UP7 A;  2Q2I A;  1NCV A;  3RLO A;  1WTQ A;  4CKB A;  1CHQ D;  4FDB A;  1U4L A;  1F2Z A;  3DEP A;  2PW5 A;  5EBD A;  2B39 A;  1OXV A;  1KLG D;  3GQB A;  4K5W A;  1P8L A;  2A5H A;  2VQF Q;  1JB7 A;  3I4N H;  1TII D;  2LFN A;  4LAA A;  3I8Z A;  3KLW A;  2JN4 A;  5ISR A;  4IOA A;  3KYH C;  1HHV A;  5FLX L;  1I5F A;  2R92 G;  3HOZ G;  3D6W A;  3E0E A;  1QVC A;  1KLU D;  2NN6 H;  3CRK C;  2F0K A;  1EIF A;  3HOU G;  3LWE A;  3M85 A;  1K8A C;  1UE5 A;  4ZQ3 A;  3AMU A;  1XMQ L;  5CV8 A;  3PO2 H;  1ZEQ X;  3PO2 B;  2VS1 A;  1KTK A;  1PZK D;  1UEB A;  2LXJ A;  5IT9 L;  2A6H D;  2YTY A;  1SBB B;  3G48 A;  4BBR G;  1O7L A;  1HH2 P;  2SDF A;  1PDQ A;  5M9O A;  2C5C A;  2F0L A;  3MFY A;  4TSS A;  4WFN 3;  5CGK A;  2R7D A;  2F4I A;  1LTG D;  1JE5 A;  3X3M A;  3KF6 B;  1HUN A;  3S2H H;  1VQ9 A;  1QB5 D;  3JAM L;  2F0U A;  1WD1 A;  2RCN A;  3QOJ A;  5D3I B;  4AH6 A;  3E9H A;  3OIQ A;  5AJ3 Q;  4JI4 Q;  1F9P A;  4QGU A;  2YYZ A;  2K05 A;  3TS0 A;  1Z6H A;  1HZC A;  2UUA L;  3K5N A;  3C46 A;  1N33 Q;  1QG7 A;  4GOP C;  5M5Y B;  4IFD I;  4JI0 Q;  1FNV A;  2PQA B;  1W6J A;  4L5T A;  4RMF A;  1S4Z A;  1Z7T A;  4C3I B;  2KHS A;  3BVG A;  2B63 G;  5IGB A;  4C3J H;  4C3J B;  1CQF A;  1DJR D;  1E2W A;  5GAE C;  1OXS C;  2EZV A;  5DM7 3;  1X54 A;  1ASY A;  5DLQ E;  1TWH H;  1MI2 A;  3VR6 A;  1J9O A;  4B9W A;  5IE8 A;  3V2T A;  1SYF A;  1EFI D;  2O4X A;  2K04 A;  5J39 A;  3TP6 A;  5GAH C;  1TXY A;  1MSG A;  2ICE C;  3ZJY C;  1TWG H;  3GV3 A;  1K28 A;  3R93 A;  3K5L A;  2NVQ H;  4POG A;  2IT1 A;  3CD6 A;  4LW1 A;  1YBY A;  1IZ6 A;  1NMG A;  3F2D A;  4JI2 L;  2JA7 G;  3RUZ A;  1IW7 D;  1V43 A;  3IRB A;  1KDC A;  4XTC S;  2IY5 B;  5K36 H;  4JC0 A;  4CKE A;  2E2I H;  2K32 A;  2Z4H A;  4DV5 L;  2E2I B;  2R3Z A;  3I7F A;  3GTQ H;  1NAP A;  3DMU A;  5CV9 A;  4XQJ A;  4LF8 L;  3GTQ B;  4PZ7 A;  4ZKB B;  1GJX A;  1BCP C;  2F0H A;  3TQY A;  5FLX c;  1UWV A;  1HQM C;  2N8N A;  4LUO A;  1EIH A;  1PRT C;  3TZU A;  1H95 A;  3M4Y A;  3HOZ H;  1U4P A;  2XWB B;  1EY7 A;  2R92 B;  3HOU B;  1B7Y B;  3KBG A;  2ZXP A;  1Q12 A;  1T9H A;  5E1F A;  2ES2 A;  2IX1 A;  2QDL A;  2C9O A;  5G3L D;  3I55 A;  1FYC A;  4B3M L;  2K28 A;  3M9B A;  2OF1 A;  2L5T A;  4LF5 L;  2BH2 A;  4BBR B;  3I73 A;  1K3B C;  2Q8I B;  1PTO D;  5J22 A;  1WCM G;  2JQO A;  4JPB W;  3T56 B;  3M7N A;  5A2Q E;  5FK9 C;  1LAC A;  1A0I A;  4XIG S;  1S5B D;  4H7B A;  4S3S A;  1EIG A;  1XYI A;  1XNR Q;  1WYD A;  3MZ5 A;  3R2I A;  4YWL A;  4YIJ A;  4A3D H;  3FVQ A;  5F2D A;  2MUY A;  2OQK A;  3L7Z C;  4ZAI A;  4A3J G;  4GOP A;  1QUQ A;  2G5D A;  4ODG A;  5CYU A;  2EYO A;  3RN5 A;  4DXG A;  3MXN A;  3NUC A;  3S17 H;  2UUC L;  1AN8 A;  1ZYR D;  3DWQ A;  4LFC L;  1B3Q A;  3L0O A;  2XRQ D;  2VL6 A;  3H0G H;  4DV2 L;  5JJI A;  2JSO A;  1V1Q A;  4DR1 Q;  1Q46 A;  5JEA G;  1WOC A;  3A8I E;  2K1B A;  1SJH D;  4XYQ A;  2WB1 E;  3VA7 A;  2B63 H;  1A2U A;  1Y14 B;  4OX9 L;  5E7N A;  4C1N K;  4B9X A;  5CV7 A;  3I90 A;  4GNX C;  1M8A A;  4U68 A;  2VXW A;  4BY7 B;  2JA5 B;  4KY7 A;  4HJA A;  1GUW A;  1E7Z A;  2ZXO A;  3CU7 A;  2KCN A;  4DGZ A;  5EPL A;  1VQE A;  1E0B A;  1L0Y B;  4ZRZ A;  1RHP A;  1M4V A;  1AP0 A;  4XT3 B;  2O5I C;  4X62 L;  3ULJ A;  2OTJ A;  3FPP A;  2JA7 H;  2JA7 B;  1V1P A;  3GTJ H;  3SEB A;  4ABN A;  4LF9 L;  3H15 A;  1VQI A;  4UAI A;  4NP5 A;  4G7H C;  3HOX H;  1RCV D;  4DA2 A;  1LT4 D;  4AYB B;  1PH9 A;  1EEF D;  4IO9 A;  2VB3 X;  3QB3 A;  5ELF A;  4OWX B;  4TRD A;  4ZYS A;  1BF4 A;  1R4P B;  4KLK A;  1D5M C;  4WOR A;  4DV1 L;  4LFB L;  3E0J A;  3BU2 A;  3CKI B;  4A3C H;  2NVY H;  2NVY B;  1LT3 D;  1JB3 A;  4OO1 I;  4GZY C;  4IJL A;  1OTC A;  2WAQ G;  4BS9 A;  1TKW B;  4DAY A;  5M3M G;  5LMN W;  4EQP A;  5ELO A;  1CZG A;  4GOP B;  1V1O A;  1QUQ B;  1B8A A;  4L63 B;  1VQA A;  2E75 C;  3GTK H;  4FF4 A;  3MXN B;  4MIU A;  1LO5 D;  2A19 A;  2DUD A;  2RBM A;  3BDL A;  2EIF A;  4R4C A;  4DK3 C;  2ZM6 L;  1CK1 A;  2I46 A;  4A93 G;  1F2Y A;  2RDG A;  2N49 A;  1WCM B;  2UXD L;  1PV4 A;  3EBE A;  3J7A 5;  4JI6 L;  3CF5 A;  2F0I A;  4EQN A;  1IL8 A;  3NQI A;  1YJW A;  4IZ8 A;  1Y1V H;  2EJG C;  2LMC B;  4OIJ A;  1A2T A;  4A3J H;  3NXW A;  4A3J B;  1XMQ Q;  5C4Z A;  1TWA H;  3TP5 A;  1AFP A;  3CC7 A;  3CP0 A;  3KLR A;  1X32 A;  1A3U A;  1NJI C;  2V4D A;  4CDC C;  2QDB A;  3PF4 A;  4P71 A;  5C6A A;  5I2Y A;  5G3L F;  1RIP A;  1IYV A;  5IP9 G;  2D5D A;  1Q81 C;  3RN2 A;  5EGT A;  2F0Q A;  4KTA A;  4GNX A;  1V1P B;  1PTO F;  3M7G A;  2DY7 A;  3W5O A;  5KRU A;  4HIK A;  2QA4 A;  1NUC A;  3CCU A;  2X6L A;  2HIV A;  1BCP B;  1O7Y A;  1EQQ A;  2F52 A;  2VW9 A;  2E5L Q;  4HMI A;  2OTL A;  1PRT B;  1I4X A;  2AQ2 B;  1I3Q H;  1I3Q B;  1SYG A;  3V05 A;  4P2C B;  2B29 A;  4FXK C;  4JV5 L;  5EKK A;  1TY2 A;  3I4M H;  3CCE A;  4KN7 C;  2KHI A;  4BXX G;  1JQY D;  3NHH A;  3K6O A;  1BUV T;  1O7Z A;  3UI2 A;  1CKO A;  4HIO A;  4DAY B;  1Q1B A;  2G9D A;  3F2C A;  2F0G A;  2L0C A;  3MEH A;  4TQU S;  1SMY C;  5I6Y A;  4HAE A;  5BR8 L;  3IFD A;  5LL6 X;  2K5H A;  1ENC A;  5C44 G;  4A3F B;  1I6V C;  1NY4 A;  1J6Q A;  5C4X G;  4L5Q A;  1EFW A;  4FXG C;  4JG2 A;  5L37 A;  1RF2 D;  2JA6 G;  1T5E A;  2KA7 A;  1ILQ A;  5C0X G;  1VQF A;  4M1U B;  5IGE A;  2R93 H;  3K0Y A;  2Q8R E;  2SNS A;  3VR5 A;  5IYC G;  3S1M H;  4O0A A;  4LWC A;  1X55 A;  4ULL A;  1YNJ C;  2WAQ B;  3K7A B;  5M3M B;  3T51 B;  1W2B A;  4A3M H;  2RSO A;  4DK6 C;  1N8R C;  2WII B;  2IJ0 A;  4RGO S;  2K6A A;  1BDO A;  1N33 L;  4DV5 Q;  4IJH A;  1EYG A;  3P7J A;  1M90 C;  3S1N H;  4LF8 Q;  2LSS A;  1CQV A;  1LTB D;  4POF A;  4JI0 L;  4A93 B;  1TQO A;  3BYT B;  1QOH A;  1HZ9 A;  3S1Q B;  1HTP A;  5JJK A;  2Z6K C;  3PMF A;  4P74 A;  4GNX B;  1VCI A;  2WKD A;  4V0B A;  2A6H C;  3HFZ B;  1G6P A;  2CHB D;  5FLM H;  1BR9 A;  3EIV A;  3DXJ C;  1TVX A;  2YTX A;  2EDG A;  1JMC A;  1AE2 A;  2L55 A;  5IGD A;  2H5X A;  4B3M Q;  1SNQ A;  3M3Y B;  4APV A;  1U5K A;  3K5M A;  1QNK A;  3T16 A;  4LF5 Q;  4IPG A;  5D14 A;  1RL2 A;  3BVZ A;  4DF7 A;  1WTR A;  3FDT A;  5LL6 S;  5IP9 H;  3OTO L;  3UDI A;  3CMA A;  1R9T B;  5C4J H;  2Q8T A;  5DEH A;  4LF4 L;  3PGZ A;  4YCU A;  1Y8N B;  3LGJ A;  3T1Y L;  5JPN C;  4CDF C;  4DV6 Q;  2A8V A;  4GN3 B;  4DR4 L;  5JAV A;  3MXP A;  4RGT A;  4R4T A;  1HNX L;  2MO1 A;  5COR A;  3DWP A;  3U50 C;  2UUC Q;  4LFC Q;  4C3H H;  5M3F G;  4J1M A;  3I4O A;  4DV4 L;  2EXZ A;  3DWA A;  2CH4 W;  4DV2 Q;  4BXX H;  4Q0F A;  1HZB A;  1EYC A;  2B2W C;  2EJF C;  1I6H B;  4LMQ D;  1CM9 A;  2LXK A;  1D1K A;  1CTM A;  5LMU L;  1HR0 L;  2NTT A;  4OX9 Q;  4WRD A;  4RFB A;  1X3Q A;  1PLF A;  5T1G A;  3TS2 A;  2GVB A;  3NPP A;  1STE A;  1OO9 B;  3GTL H;  1BKB A;  3K8A A;  2K5V A;  5C44 B;  3I4N G;  5CBE E;  1S72 A;  1B3A A;  3FRP B;  1EOV A;  1VQH A;  5C4X H;  5C4X B;  1IW7 C;  2Y0S E;  3RZD B;  2JA6 B;  1KC8 C;  4UY8 C;  3K59 A;  2EPB A;  1E1T A;  5DAU A;  1K8M A;  2WAC A;  2ATW A;  2NN6 G;  4X62 Q;  4OWW B;  1GHJ A;  1EUJ A;  2IHE A;  1LTI D;  4MN3 A;  1EYD A;  1CA5 A;  1E24 A;  4DFA A;  4ME5 A;  4HJ9 A;  1NNX A;  4Y7N H;  2VUM G;  1QVF A;  3C3L A;  3L3O C;  4B3R Q;  1WTP A;  3SHL A;  2Z6K A;  1BBX C;  4DR1 L;  3BJU A;  4QUF A;  1OXU A;  4ZUI A;  1Q8K A;  2DGY A;  2J4X A;  4LFB Q;  4DV1 Q;  1LTL A;  1XPO A;  1PYS B;  1O78 A;  5C4H A;  2WV6 D;  1SDF A;  3U4V A;  2KOL A;  4BA1 I;  4EGV A;  2O5J C;  2K03 A;  3NEM A;  1EY6 A;  1PFN A;  4J6H A;  4KKU A;  1KRT A;  2O2L D;  3ND9 A;  1CUK A;  1T5X D;  2DN8 A;  1CSP A;  1NR4 A;  2OEO A;  2F0M A;  3IAY A;  3OOC A;  2ZM6 Q;  1LV9 A;  5I9O A;  5KNB A;  4XDX A;  3OMC A;  1IBM L;  4AQY L;  3M4P A;  1Q1E A;  4JI6 Q;  2UXB Q;  1U4M A;  2CW0 C;  3PUW A;  1NR2 A;  1AZP A;  5ELE A;  4JBK A;  3UDF A;  3J7A V;  4QIW B;  1ZYR C;  2Q2U A;  5JVG 3;  3NQT A;  2JP1 A;  4A3E H;  4DR6 Q;  4K2K A;  3ULP A;  1HCZ A;  3I70 A;  2RHS B;  1GHK A;  4FVM A;  3TSS A;  3D0F A;  5I4D A;  2B2W A;  4KKS A;  5M3F B;  2V1C C;  1BO0 A;  3CQZ B;  1VQC A;  3GTO H;  4RG1 A;  1VQO A;  2HCI A;  1PMR A;  3CCJ A;  5K36 G;  3S14 H;  3S14 B;  1PH5 A;  1AZQ A;  1C4Q A;  3DHQ A;  2KVM A;  1Q7Y C;  1STA A;  5JEA J;  3CME A;  2CWA A;  1ROD A;  3K0X A;  2SNM A;  1WFQ A;  3EJI A;  1DD2 A;  1VQG A;  1VQJ A;  3QG1 A;  3KLS A;  3I4N B;  1UUP A;  2BE5 C;  2EYJ A;  4PG3 A;  1SE8 A;  3SK4 A;  2JA9 A;  4DR3 L;  1F2M A;  1L1O C;  4JV5 Q;  2EYL A;  5E4W C;  2RDH A;  1PH4 A;  3NBI A;  3TME A;  4ID6 A;  4ZCK A;  2K4K A;  2FJ2 A;  2JEA I;  1LTT D;  3G6E A;  5BR8 Q;  2VUM H;  2VUM B;  4RGN A;  1FJG Q;  4DR7 Q;  1G8Z D;  2AQ1 B;  2QIL A;  3MWY W;  2A74 C;  2EXD A;  1B70 B;  2XN9 C;  1NTG A;  2A69 D;  2YU9 H;  5FLX E;  2QKI C;  3S2H B;  3CCV A;  4K8J A;  1WTO A;  5I6W A;  4MTK A;  1SNM A;  2HD3 A;  4A3D G;  1YNX A;  3RMH A;  3J80 L;  4A3G G;  3PUY A;  2BH8 A;  2AMC B;  2E5L L;  3OWF A;  1X3G A;  5IT9 E;  5HGQ A;  4JYA Q;  1W3S A;  2NYZ D;  4FP5 D;  4OGQ C;  2GVA A;  4DAV A;  1LTS D;  1B53 A;  1LM0 A;  4AYB E;  4O1N A;  2B2T C;  3H0G G;  3E6Z X;  3NTH A;  5AFW A;  3JAM E;  1EIY B;  2AHO B;  3F2U A;  2AQ3 B;  3EFX D;  2HIX A;  4EVO A;  4OEL B;  4K2L A;  4K6D A;  4CKC A;  2F0T A;  1TWH B;  4KN4 C;  1N34 L;  2ZJR A;  3MEF A;  1DXM A;  4NB3 A;  1UE6 A;  4EX5 A;  2PW7 A;  3STB D;  4XYO A;  2RSN A;  1EY5 A;  4HR7 B;  1TWG B;  4DAP A;  1XTC D;  1LT6 D;  4B3T Q;  1GM5 A;  2NVQ B;  4DR5 L;  4QB4 A;  2MHV A;  2WIN B;  3OTO Q;  1IXR A;  2F0W A;  1XXG A;  4R9W A;  3Q0A A;  1S3O A;  4LF4 Q;  4KD4 A;  5HY6 A;  4F88 A;  2VZA A;  4F87 A;  3T1Y Q;  5H1S E;  1J5E L;  3D4W A;  3HOX G;  4CGY B;  3J7Y W;  3JC6 6;  3BZD B;  1BBW A;  2NWG A;  1YNN D;  2XTI A;  3S2D H;  4HSP A;  4DR4 Q;  4DN4 M;  1VQK A;  1L1O A;  4KD3 A;  2NVT H;  1HNX Q;  2AWN A;  2Q2T A;  3S15 H;  4M8A A;  4O42 A;  2I5M X;  3A55 A;  3SK6 A;  3J7A F;  1N36 L;  2L4N A;  4K5V A;  4DV4 Q;  1CKN A;  4A3C G;  4KJN A;  3HOZ B;  5J3B A;  5C0X I;  2RHQ B;  1QJO A;  1PTO H;  2K33 A;  1II3 A;  2A68 C;  5IT9 c;  4RKB A;  1FNU A;  5IY0 A;  1PH8 A;  1HR0 Q;  5LMU Q;  1F2L A;  3CW2 C;  2I07 B;  4OXP A;  3P1H A;  5LMN L;  1YHQ A;  4HTH A;  1MD2 D;  3C1E A;  1K3R A;  1VQ4 A;  3JAM c;  3J7Z C;  2A73 B;  1B2T A;  5C5M A;  3NWS A;  1E2Z A;  1H9M A;  3CCR A;  1YIJ A;  1ILP A;  3MA2 B;  3J80 c;  1SYD A;  4N8F A;  1LLR D;  1UE7 A;  4CDD C;  3GP7 A;  3N6R A;  4DUY L;  1BOS A;  2ZXR A;  1Y1V G;  3HOY G;  4A3D B;  4DV6 L;  4LUV A;  5C0X J;  3CAM A;  4A3G H;  4DKA C;  4JI1 L;  5CMD A;  2M9V A;  3I56 A;  1TY0 A;  4H0L C;  2DNE A;  3FHW A;  2B2T A;  3S17 B;  4LJZ C;  1PXU A;  3H3V H;  4HCS A;  4DNR B;  2MP1 A;  3Q23 A;  1S5D D;  1KDA A;  4BY1 H;  2HQE A;  3ZYY X;  4MTN A;  3H0G B;  1TWF H;  1TWF B;  4X65 Q;  1YVC A;  1KD1 C;  5HGT A;  2F0P A;  1L0X B;  2Z4I A;  2EOT A;  3DLL A;  2B63 B;  4L6T B;  2VB2 X;  2GA4 B;  3TDQ A;  4A3I H;  2A6E D;  2ENB A;  4HMJ A;  2KEN A;  3T1H L;  4KK7 A;  4C56 C;  3SGI A;  2L15 A;  2WAQ E;  2XSC A;  2VQE L;  4RAU C;  3C1F A;  4WJW A;  4MZ9 A;  2FXQ A;  5C3W A;  2IL8 A;  1L1O B;  1HZA A;  2EYP A;  4DV0 Q;  2B3G A;  1TS3 A;  4BA2 I;  4H44 C;  3I4M G;  4CJ0 B;  3D4R A;  3NTK A;  1CKN B;  1SXT A;  3PQI A;  3EA6 A;  1IBM Q;  1GUG A;  4AQY Q;  1STH A;  4DR2 L;  1FNW A;  1KL9 A;  5FOB B;  2QEX A;  1VQ5 A;  1IL2 A;  3GTJ B;  3N52 A;  4IUQ A;  3A7A B;  1ONL A;  1G2T A;  1YIT A;  4PMC A;  1C48 A;  4BBS G;  3HOX B;  4JW0 A;  2WKC A;  2DJG C;  1LAB A;  4B3R L;  3HP3 A;  3NK9 A;  3K58 A;  1D6E C;  1UNS A;  1VQM A;  1TWC H;  1TWC B;  3CPF A;  1KAA A;  1IHZ A;  1WJJ A;  4KHP L;  3PUX A;  3S1R H;  3MVV A;  2BA1 A;  2R93 G;  1HXY D;  3VYR A;  3ICE A;  3VYU A;  2NN6 I;  3JAM i;  1G29 1;  3J81 L;  1IBL L;  2ZJQ A;  2ZJP A;  3PIO A;  2UU9 L;  1Q8I A;  2IHF A;  4A3M G;  2E8G A;  2CQA A;  3G6J B;  4IUU A;  2DY8 A;  3GTK B;  2G9H D;  2HHH L;  1RTN A;  1HFN A;  4GKJ L;  4JI8 L;  1KNA A;  2WB1 G;  2QF7 A;  1KAW A;  2LS0 1;  2UXC Q;  1ICW A;  2RKS A;  4JI7 L;  1A6X A;  2EY6 A;  2UXB L;  2X69 A;  4DR3 Q;  1YJN A;  1E2V A;  4UPA A;  1AE3 A;  1XPU A;  4WJ3 M;  4KKT A;  1JT8 A;  3J81 E;  4ILW A;  3UE1 A;  3HKZ G;  4HED A;  3MFG A;  1Y1V B;  3HOY H;  3HOY B;  2ZTE A;  3WOF A;  5FLM G;  1HQR D;  2B2V C;  5GAD C;  3L2P A;  4DR6 L;  2NZ1 D;  1TWA B;  1IYU A;  3Q8D A;  5IGC A;  1U9R A;  1RDP D;  1KNE A;  1XMO L;  2BDN A;  1QZG A;  1F77 A;  2HUG A;  2RF4 A;  1X65 A;  3A74 A;  3H6M A;  3AFP A;  3ERS X;  2EYF A;  2UUB L;  3TEH B;  5E4X A;  4X3S A;  3M4O H;  2XNA C;  1CHP D;  3LNN A;  4NDX A;  4IFD G;  1RTO A;  3GTG H;  1TS5 A;  4RHS A;  1B9M A;  3OW7 A;  4HCE A;  3CC2 A;  1EEI D;  4FXD A;  1STN A;  3NWT A;  5KEE A;  3HEJ A;  1CZW A;  4C3H G;  4IUT A;  2D62 A;  4G7Z C;  1EQT A;  3I4M B;  1PH2 A;  3LWU A;  2F0N A;  2F0V A;  2SOB A;  1XNQ Q;  1SE2 A;  1JJ2 A;  3OHX C;  4DU9 A;  4NW2 A;  1IKL A;  3CCM A;  1CSQ A;  2F0J A;  4X64 L;  1SE3 A;  2Z6B A;  1A3T A;  4BBS H;  3BYY B;  3R3O A;  1FJG L;  4DR7 L;  3KK7 A;  4G57 A;  4V19 0;  1D5Z C;  2CWP A;  1N34 Q;  4FF3 A;  3VA5 A;  1JWU D;  2AWO A;  1K0S A;  1BCP D;  4X3K A;  3SK5 A;  1E22 A;  1JOK A;  3J81 c;  1B9N A;  3FKI G;  2EY2 A;  3DEO A;  2R93 B;  3A8K E;  4DR5 Q;  3S1M B;  4PNY A;  2QCP X;  5ELC A;  4A3M B;  1JOR A;  4JYA L;  3U58 A;  5KIX A;  1G91 A;  1J5E Q;  4QIW E;  3VYT A;  4J15 A;  3E9I A;  4DV3 Q;  3S1N B;  2D9U A;  2WB1 B;  2Q2H A;  1U4R A;  1C7Y A;  1E3P A;  2MPM A;  5FJ8 G;  2R7Z H;  1KIX A;  1ML0 D;  4K0K Q;  4NXM Q;  1ZXT A;  3EQL C;  3IL8 A;  1N36 Q;  2B2V A;  3HKS A;  5KYL A;  3HKZ B;  4QUC A;  2JE6 I;  2N78 A;  1A15 A;  1MSH A;  3NEL A;  1EU4 A;  4A3L H;  1SYB A;  1SSO A;  1Y69 U;  5JJL A;  1YZ6 A;  5T1I A;  1XWE A;  3DM1 A;  5M5X H;  1IKM A;  5LMN Q;  1PVO A;  5BN4 A;  1EQV A;  2D0P A;  1HRJ A;  4B3T L;  4GN5 A;  2NUC A;  2OXP A;  3H94 A;  2JK8 A;  4X6A H;  2PNR C;  4LF7 L;  2K01 A;  5C4J B;  1D1I A;  1JR0 D;  1QWY A;  3EN2 A;  1VQ6 A;  4Q5V A;  4DUY Q;  1VQB A;  1SAP A;  2ID0 A;  2MJ8 A;  2ZTC A;  1VMC A;  4IFD H;  2PNH A;  1NBW A;  4JI1 Q;  4A3E G;  4R4I A;  4JBW A;  2I5L X;  4JI3 L;  2KQ3 A;  3O13 A;  2C35 B;  4UP9 A;  4IAL A;  2JA8 H;  4C3H B;  5TSS A;  2PMZ B;  1N32 L;  3QOL A;  1JE4 A;  2EE1 A;  5IOD A;  3AB9 A;  2CH4 A;  4OIK A;  1K73 C;  1PH7 A;  1HNZ Q;  3RZO H;  3RZO B;  5A35 A;  3W1B A;  2PZU A;  1PFB A;  3T1H Q;  1VQP A;  2VY3 A;  3MXU A;  5D3D A;  1EYA A;  3KOJ A;  2DJF C;  1D8L A;  3GTL B;  2VQE Q;  4PZ8 A;  1STB A;  4IQZ A;  2D0O A;  1WTH A;  2HQL A;  1TS2 A;  2PZW A;  1WI5 A;  2FMM A;  3FKI H;  2Z1C A;  1DOM A;  5CV4 A;  4GKK L;  3HGB A;  4DR2 Q;  3G4S A;  1Z9F A;  2MO0 A;  3NEN A;  1ENA A;  3F8T A;  4PMB A;  3SDZ A;  3A8J E;  1EOT A;  4P72 A;  1Y1W H;  3I72 A;  4Y7N B;  1X3F A;  3T13 A;  5IYB H;  3PO3 H;  2BCO A;  3UE0 A;  1F9S A;  4X65 L;  5FJ8 H;  3I4L A;  3H91 A;  1EWI A;  2A1A A;  2KHJ A;  5NUC A;  1WVL A;  3U4Z A;  2GN5 A;  4LNQ A;  4KHP Q;  5EPK A;  4CHT B;  1BCP F;  3GO5 A;  4JK1 C;  4RHR A;  1IBL Q;  2F4V Q;  1YHB A;  4UHV A;  3TBI B;  4EQO A;  1PTO C;  1GD7 A;  2UU9 Q;  1B44 D;  2K5Q A;  1WTV A;  2R7F A;  1HFG A;  1GUN A;  3PSI A;  4DV0 L;  4GS3 A;  2HHH Q;  2FFK B;  4GKJ Q;  4JI8 Q;  3KJP A;  1JC7 A;  2MFI A;  1JOQ A;  5KYI A;  3PIP 3;  1YHA A;  4JI7 Q;  3VYS A;  3I91 A;  3QIA A;  2TSS A;  2IX0 A;  3GTP H;  1S5C D;  4A3B G;  4IPH A;  1TT2 A;  1ENF A;  5IYD G;  3I2Z A;  3WDN A;  3D6C A;  2Z8L A;  2Y0S G;  1FL0 A;  3RD4 A;  5J1Z A;  4A3E B;  1PYW D;  2I0Q A;  1TU2 B;  1PYB A;  1DZ1 A;  4ZK9 B;  1WD0 A;  4LK1 C;  1DOK A;  2AKW B;  2A6E C;  1A3V A;  3ULL A;  4YWK A;  1KHI A;  1DM0 B;  1VMP A;  1XMO Q;  3BVM A;  3H3V C;  4HID A;  2E2J H;  2F3W A;  3GTO B;  3E5S A;  4N9P A;  4NMZ A;  1GKH A;  1TS4 A;  3GV6 A;  1S40 A;  2K5D A; 
#chains in the Genus database with same CATH homology
 4DK1 A;  4K8I A;  1EWH A;  1SMY D;  2XIW A;  1SNO A;  3R8B A;  4XXE A;  4C2M B;  1KDB A;  3SXH A;  4G4K A;  2L11 A;  3U9O A;  1YNJ D;  2BOS A;  1GUO A;  2F03 A;  4I7Z C;  1QNU A;  1GUT A;  4H13 C;  5CV6 A;  1I4R A;  4OO1 H;  4QMG A;  1RJT A;  2FIN B;  2YU9 B;  3S9W A;  4UDU C;  2RA4 A;  4RH6 A;  2IPK D;  1SE4 A;  2K7V A;  1X3P A;  2JYO A;  3TN2 A;  1QCB D;  2KEE A;  1B1Z A;  1VF7 A;  3NP8 A;  2ZT9 C;  3W2D A;  1H9J A;  5FO9 B;  3Q22 A;  1HPC A;  5IIF A;  3I3C A;  2JEB I;  2MGS A;  4A3B B;  1ZKO A;  4MHE A;  1H9K A;  4FNF A;  3J80 E;  3C2P A;  4PQX A;  1STY A;  2Y0S B;  3OMG A;  2HCC A;  4RCN A;  3AU7 A;  5JPM C;  2BA0 A;  2HDL A;  3KF8 A;  2K5W A;  1PZJ D;  3TP8 A;  4X3U A;  3ERO A;  4CJ1 B;  1UEA B;  3BDO A;  1G6Z A;  1DOL A;  5E3F A;  3QJY A;  4CJ2 C;  5I2X A;  3T53 B;  1CA6 A;  2IWH A;  5KGU A;  3S2D B;  1K83 B;  1ET9 A;  3MXG A;  1HUM A;  1D2B A;  2F0E A;  2NVT B;  3S15 B;  4IFD J;  1S5E D;  1GXD C;  1I4Q A;  1PTO B;  1PZI D;  3L9A X;  1G2S A;  1F9R A;  2RDF A;  3U9S A;  2F0F A;  2F1M A;  5C3X A;  5A2Q L;  5FO8 B;  2L12 A;  1SNP A;  3K57 A;  3VR4 A;  3RLF A;  1Z47 A;  2X6G A;  4C1N I;  3PIO 3;  2EVB A;  5CBA E;  2R61 A;  4A3G B;  1EL0 A;  4NKL A;  2TMP A;  1I50 B;  1WTW A;  2M00 A;  5DM6 3;  3SR1 A;  5BN5 A;  5EKL A;  4BY1 B;  1VF5 C;  1Y8O B;  1GOZ A;  2EYM A;  4XQQ A;  2EY5 A;  2NB0 A;  1ET6 A;  3EVQ A;  1AW7 A;  5CR3 A;  4A3I B;  4IUP A;  1UAP A;  2CW0 D;  1Q3L A;  4FO2 A;  5KND A;  4R8I A;  4K14 A;  3R2T A;  4PMW A;  2J7Z A;  4FF1 A;  1W6K A;  5EPJ A;  1EU3 A;  2R6G A;  3ONA B;  5BN3 A;  3NTI A;  1QE6 A;  1KAB A;  1I4G A;  2M2L A;  1CI3 M;  5JVH 3;  5IGF A;  3BG3 A;  4OL7 A;  5I9P A;  4IUV A;  5JOB A;  4KHZ A;  3Q24 A;  2QEJ C;  1H9S A;  2PZT A;  1JIC A;  1SYC A;  3MHB A;  4IUR A;  1SYE A;  1HA6 A;  1BXT A;  3ITP A;  1DYQ A;  3CHB D;  2BE5 D;  3IKJ A;  1EZ6 A;  4DNT B;  5C3E B;  3S1R B;  4ZKC B;  1O80 A;  2PPB C;  5COY A;  2XWJ B;  2D2C C;  1J8I A;  4R8N A;  3NSW A;  3D8G A;  5IOC A;  4HSV A;  4TKO B;  2FHT A;  2B8F A;  1R4Q B;  3QWN A;  4IUN A;  1CFM A;  3FMC A;  5M5W B;  1EY9 A;  5D65 A;  2KED A;  2OT2 A;  2WP8 J;  3HG9 A;  2L9H A;  3K5O A;  4PV1 C;  2KJX A;  1WTX A;  3NBH A;  3CRL C;  4KMU C;  1SEB D;  5IGG A;  3URY A;  1FGB D;  1OXX K;  2PCF B;  4XQN A;  3T4A C;  3X3N A;  2PYK A;  1NSN S;  4QF4 A;  3FPU B;  2N88 A;  3M4O B;  1RKN A;  4RCO A;  1H9S B;  3GTG B;  3DUZ A;  2VNU D;  1MBY A;  3A54 A;  4ZUJ A;  3P75 A;  2B2Y C;  5JEA H;  3S16 B;  1EWC A;  5ELB A;  3H09 A;  1JWS D;  2AUK A;  2F3V A;  5JJZ A;  2NVX B;  3QO2 A;  2BDO A;  4ZLT F;  5ELD A;  2KUM A;  2DNC A;  2HDM A;  2B8G A;  4BBS B;  5EQ0 A;  3A56 A;  1LT5 D;  1LTA D;  3OSO A;  2EYH A;  4L8J A;  1F9Q A;  4DXF A;  1GUS A;  1FR3 A;  3PV0 A;  1PRT D;  2IX3 A;  3LX0 A;  4K6L A;  2E76 C;  4Z9C B;  2EY1 A;  1EY4 A;  4IN3 A;  5C5L A;  2A68 D;  3VR3 A;  1C8C A;  1CT1 D;  1ESR A;  1HTL D;  1RD9 D;  2F0O A;  5K5P A;  3D4D A;  2R7Z B;  1BQQ T;  2XVS A;  1LTR D;  4OHJ A;  1SND A;  1Y8P B;  2PO4 A;  2LY7 A;  4DK0 A;  1STG A;  2B2U C;  4KI0 A;  3Q6S A;  3MC0 B;  3D31 A;  2A69 C;  2JXM B;  2RQX A;  4U67 3;  2KCC A;  5M5X B;  4RKL A;  4I65 A;  1EY8 A;  3OWE B;  4B08 A;  2PQE A;  3HRZ C;  2LKV A;  4KY6 A;  3BDC A;  2E2D C;  1TR5 A;  2F0D A;  1B4O A;  3MTS A;  3MAQ A;  4E6I A;  2F0S A;  2SEB D;  1H9R A;  1K8O A;  1JCK B;  2B2Y A;  4KJO A;  2E74 C;  3OPO A;  3HZX A;  3ND8 A;  2JA8 B;  2J0T D;  5FKA C;  3G7L A;  3TZD A;  1EY0 A;  1BNZ A;  1V8Q A;  3D3R A;  4CBV A;  3A7L A;  1JWM D;  1MGS A;  4KV6 A;  4RGM A;  5LHY 1;  1EZ8 A;  3SK8 A;  4J8Q A;  1DON A;  4RA8 A;  3P20 A;  3NE5 B;  3FKI B;  3FEW X;  1HA5 A;  2NTS A;  1I4P A;  4FYD A;  1XX8 A;  2CVR A;  4K5X A;  1YNN C;  5HUR A;  4BWG B;  4RWS C;  1Y1W B;  3PO3 B;  3SVM A;  3IFT A;  1SJE D;  5C0X H;  4OO1 G;  3HOW B;  3TP7 A;  3HS0 C;  2B2U A;  4XT1 B;  2NBF A;  1VDZ A;  2E2H B;  3KLS X;  5KNC A;  1ESF A;  1Q90 A;  2N55 A;  4F8M A;  1FD7 D;  1OXT A;  1PRT F;  3W3A A;  4KY5 A;  3WOE A;  2KEC A;  5EKI A;  2ICI A;  3VR2 A;  2L1B A;  4N9T A;  2AUJ D;  5DNF A;  3GTP B;  1QIL A;  1DCZ A;  3V96 A;  3OIP A;  4KHV A;  2IW3 A;  3BS1 A;  3SE0 A;  3GTM B;  3KUP A;  2RVL A;  1S5F D;  1AEX A;  2EJM A;  1B50 A;  5CV5 A;  4X3T A;  3HOV B;  4F7X A;  1PFM A;  4G7O C;  3PUV A;  4C3I G;  5FO7 B;  1JOO A;  4C3J G;  5EBC A;  5EJW A;  2E2J B;  1SNC A;  4QCL A;  3ERQ A;  3GD7 A;  2H4O A;  2XRS D;  4HN7 A;  1D5X C;  1I4H A;  3PUZ A;  2FMC A;  4FF2 A;  1SFO B;  4A3K B;  3KBX A;  5CC4 A;  2H1E A;  1NCV A;  1WTQ A;  4CKB A;  1CHQ D;  1U4L A;  1F2Z A;  3DEP A;  2PW5 A;  5EBD A;  2B39 A;  1OXV A;  1KLG D;  3GQB A;  4K5W A;  2A5H A;  1TII D;  2LFN A;  4LAA A;  3I8Z A;  5ISR A;  1HHV A;  5FLX L;  3D6W A;  2NN6 H;  1KLU D;  3CRK C;  2F0K A;  3LWE A;  3M85 A;  4ZQ3 A;  3AMU A;  5CV8 A;  3PO2 B;  1ZEQ X;  1KTK A;  1PZK D;  5IT9 L;  2A6H D;  1SBB B;  1O7L A;  2SDF A;  5M9O A;  1PDQ A;  4WFN 3;  2C5C A;  2F0L A;  3MFY A;  4TSS A;  5CGK A;  2F4I A;  1LTG D;  3X3M A;  1HUN A;  1QB5 D;  3JAM L;  2F0U A;  1WD1 A;  3QOJ A;  5D3I B;  3OIQ A;  1F9P A;  2YYZ A;  2K05 A;  1Z6H A;  3C46 A;  3K5N A;  1QG7 A;  5M5Y B;  4IFD I;  1FNV A;  1W6J A;  1S4Z A;  1Z7T A;  4C3I B;  2KHS A;  3BVG A;  5IGB A;  4C3J B;  1CQF A;  1DJR D;  1E2W A;  1OXS C;  2EZV A;  5DM7 3;  1MI2 A;  3VR6 A;  1J9O A;  4B9W A;  3V2T A;  1SYF A;  1EFI D;  2O4X A;  2K04 A;  5J39 A;  3TP6 A;  1MSG A;  2ICE C;  3GV3 A;  3R93 A;  3K5L A;  2IT1 A;  3RUZ A;  1IW7 D;  1V43 A;  5K36 H;  1KDC A;  4XTC S;  4CKE A;  2E2I B;  2K32 A;  2Z4H A;  2R3Z A;  3GTQ B;  1NAP A;  3DMU A;  5CV9 A;  4XQJ A;  1GJX A;  4ZKB B;  1BCP C;  2F0H A;  1HQM C;  1EIH A;  1PRT C;  3TZU A;  3M4Y A;  2R92 B;  1U4P A;  2XWB B;  1EY7 A;  3HOU B;  3KBG A;  2ZXP A;  1Q12 A;  5E1F A;  2IX1 A;  2C9O A;  5G3L D;  1FYC A;  2K28 A;  2OF1 A;  2L5T A;  4BBR B;  3I73 A;  2Q8I B;  1PTO D;  5J22 A;  3T56 B;  3M7N A;  5A2Q E;  5FK9 C;  1LAC A;  4XIG S;  1S5B D;  4H7B A;  4S3S A;  1EIG A;  1XYI A;  3MZ5 A;  3R2I A;  4YIJ A;  3FVQ A;  5F2D A;  2MUY A;  3L7Z C;  4ZAI A;  4ODG A;  5CYU A;  2EYO A;  4DXG A;  3MXN A;  3NUC A;  1AN8 A;  1ZYR D;  3DWQ A;  2XRQ D;  2JSO A;  5JEA G;  3A8I E;  2K1B A;  1SJH D;  4XYQ A;  3VA7 A;  1A2U A;  4C1N K;  4B9X A;  5CV7 A;  3I90 A;  1M8A A;  4U68 A;  2VXW A;  4BY7 B;  2JA5 B;  4KY7 A;  1GUW A;  2ZXO A;  3CU7 A;  2KCN A;  4DGZ A;  5EPL A;  1E0B A;  1L0Y B;  4ZRZ A;  1RHP A;  1M4V A;  1AP0 A;  4XT3 B;  2O5I C;  3FPP A;  2JA7 B;  1V1P A;  3SEB A;  4ABN A;  4UAI A;  4NP5 A;  4G7H C;  1RCV D;  4DA2 A;  1LT4 D;  4AYB B;  1EEF D;  2VB3 X;  3QB3 A;  5ELF A;  4TRD A;  4ZYS A;  1BF4 A;  1R4P B;  1D5M C;  4WOR A;  3E0J A;  3CKI B;  2NVY B;  1LT3 D;  1JB3 A;  4OO1 I;  4GZY C;  4BS9 A;  1TKW B;  4DAY A;  4EQP A;  1CZG A;  1V1O A;  4L63 B;  2E75 C;  4FF4 A;  4MIU A;  1LO5 D;  3BDL A;  2RBM A;  1CK1 A;  2I46 A;  1F2Y A;  2RDG A;  1WCM B;  2F0I A;  4EQN A;  1IL8 A;  3NQI A;  4IZ8 A;  2EJG C;  2LMC B;  4OIJ A;  1A2T A;  4A3J B;  3NXW A;  5C4Z A;  3TP5 A;  1AFP A;  3KLR A;  1X32 A;  1A3U A;  2V4D A;  2QDB A;  5C6A A;  5I2Y A;  5G3L F;  1IYV A;  2D5D A;  5EGT A;  2F0Q A;  4KTA A;  1V1P B;  1PTO F;  3M7G A;  2DY7 A;  5KRU A;  1NUC A;  2X6L A;  1BCP B;  1O7Y A;  4HMI A;  1PRT B;  1I4X A;  2AQ2 B;  1I3Q B;  1SYG A;  3V05 A;  4P2C B;  4FXK C;  5EKK A;  1TY2 A;  4KN7 C;  1JQY D;  3NHH A;  3K6O A;  1BUV T;  1O7Z A;  3UI2 A;  1Q1B A;  2G9D A;  2F0G A;  2L0C A;  3MEH A;  4TQU S;  1SMY C;  5I6Y A;  4HAE A;  3IFD A;  5LL6 X;  1ENC A;  4A3F B;  1I6V C;  4FXG C;  1RF2 D;  1T5E A;  2KA7 A;  1ILQ A;  5C0X G;  4M1U B;  5IGE A;  3K0Y A;  2Q8R E;  2SNS A;  3VR5 A;  4ULL A;  1YNJ C;  2WAQ B;  3K7A B;  5M3M B;  3T51 B;  2RSO A;  2WII B;  2IJ0 A;  4RGO S;  2K6A A;  1BDO A;  3P7J A;  1CQV A;  1LTB D;  4A93 B;  1TQO A;  3BYT B;  1QOH A;  3S1Q B;  1HTP A;  3PMF A;  1VCI A;  2WKD A;  4V0B A;  2A6H C;  2CHB D;  1BR9 A;  3DXJ C;  1TVX A;  2EDG A;  2L55 A;  5IGD A;  1SNQ A;  3M3Y B;  3K5M A;  1QNK A;  3T16 A;  4DF7 A;  5D14 A;  3BVZ A;  1WTR A;  3FDT A;  5LL6 S;  1R9T B;  2Q8T A;  5DEH A;  1Y8N B;  5JPN C;  5JAV A;  3MXP A;  4RGT A;  5COR A;  3DWP A;  4J1M A;  2EXZ A;  3DWA A;  4Q0F A;  1EYC A;  2B2W C;  2EJF C;  1I6H B;  4LMQ D;  1CM9 A;  1D1K A;  1CTM A;  2NTT A;  4WRD A;  4RFB A;  1X3Q A;  1PLF A;  5T1G A;  3NPP A;  1STE A;  1OO9 B;  5C44 B;  5CBE E;  1B3A A;  3FRP B;  5C4X B;  1IW7 C;  3RZD B;  2JA6 B;  3K59 A;  2EPB A;  5DAU A;  1K8M A;  2WAC A;  2NN6 G;  1GHJ A;  1LTI D;  4MN3 A;  1EYD A;  1CA5 A;  4DFA A;  4ME5 A;  3C3L A;  3L3O C;  1WTP A;  3SHL A;  1BBX C;  4QUF A;  1OXU A;  4ZUI A;  2J4X A;  1O78 A;  5C4H A;  2WV6 D;  1SDF A;  4EGV A;  2KOL A;  4BA1 I;  2O5J C;  2K03 A;  1EY6 A;  1PFN A;  4J6H A;  4KKU A;  2O2L D;  3ND9 A;  1T5X D;  2DN8 A;  1NR4 A;  2OEO A;  2F0M A;  3IAY A;  3OOC A;  1LV9 A;  5I9O A;  5KNB A;  4XDX A;  3OMC A;  1Q1E A;  1U4M A;  2CW0 C;  3PUW A;  1NR2 A;  1AZP A;  5ELE A;  3J7A V;  4QIW B;  1ZYR C;  5JVG 3;  3NQT A;  2JP1 A;  4K2K A;  1HCZ A;  3I70 A;  1GHK A;  4FVM A;  3TSS A;  5I4D A;  2B2W A;  4KKS A;  5M3F B;  1BO0 A;  3CQZ B;  2HCI A;  1PMR A;  5K36 G;  3S14 B;  1AZQ A;  1C4Q A;  3DHQ A;  2KVM A;  1STA A;  5JEA J;  1ROD A;  2SNM A;  3EJI A;  1DD2 A;  3QG1 A;  3KLS A;  3I4N B;  1UUP A;  2BE5 C;  2EYJ A;  3SK4 A;  1F2M A;  2EYL A;  5E4W C;  2RDH A;  3NBI A;  3TME A;  4ID6 A;  2FJ2 A;  2JEA I;  1LTT D;  2VUM B;  4RGN A;  1G8Z D;  2AQ1 B;  2QIL A;  3MWY W;  2A74 C;  2XN9 C;  2A69 D;  5FLX E;  2QKI C;  3S2H B;  4K8J A;  1WTO A;  5I6W A;  1SNM A;  3RMH A;  3J80 L;  3PUY A;  3OWF A;  5IT9 E;  2NYZ D;  4FP5 D;  4OGQ C;  4DAV A;  1LTS D;  1B53 A;  4O1N A;  2B2T C;  3E6Z X;  3NTH A;  5AFW A;  3JAM E;  3F2U A;  2AQ3 B;  3EFX D;  4EVO A;  4K2L A;  4K6D A;  4CKC A;  2F0T A;  1TWH B;  4KN4 C;  1DXM A;  2PW7 A;  4XYO A;  2RSN A;  1EY5 A;  4HR7 B;  1TWG B;  4DAP A;  1XTC D;  1LT6 D;  2NVQ B;  4QB4 A;  2MHV A;  2WIN B;  2F0W A;  1XXG A;  4R9W A;  3Q0A A;  4KD4 A;  4F88 A;  4F87 A;  3D4W A;  4CGY B;  3J7Y W;  3BZD B;  2NWG A;  1YNN D;  4HSP A;  4DN4 M;  4KD3 A;  2AWN A;  4O42 A;  4M8A A;  3A55 A;  3SK6 A;  3J7A F;  2L4N A;  4K5V A;  4KJN A;  3HOZ B;  5C0X I;  1QJO A;  1PTO H;  2K33 A;  1II3 A;  2A68 C;  4RKB A;  1FNU A;  1F2L A;  2I07 B;  3P1H A;  4HTH A;  1MD2 D;  3C1E A;  2A73 B;  1B2T A;  5C5M A;  3NWS A;  1E2Z A;  1H9M A;  1ILP A;  3MA2 B;  1SYD A;  1LLR D;  3GP7 A;  3N6R A;  1BOS A;  2ZXR A;  4A3D B;  5C0X J;  5CMD A;  2M9V A;  1TY0 A;  4H0L C;  2DNE A;  2B2T A;  3S17 B;  4LJZ C;  1PXU A;  4HCS A;  4DNR B;  2MP1 A;  3Q23 A;  1S5D D;  1KDA A;  2HQE A;  3ZYY X;  3H0G B;  1TWF B;  5HGT A;  2F0P A;  1L0X B;  2Z4I A;  2EOT A;  2B63 B;  4L6T B;  2VB2 X;  2GA4 B;  3TDQ A;  2A6E D;  2ENB A;  4HMJ A;  4KK7 A;  4C56 C;  2XSC A;  4RAU C;  3C1F A;  4WJW A;  5C3W A;  2IL8 A;  2EYP A;  1TS3 A;  4BA2 I;  4H44 C;  4CJ0 B;  3D4R A;  3NTK A;  1SXT A;  3EA6 A;  1GUG A;  1STH A;  1FNW A;  5FOB B;  3GTJ B;  3N52 A;  4IUQ A;  3A7A B;  1ONL A;  1G2T A;  4PMC A;  1C48 A;  3HOX B;  2WKC A;  1LAB A;  3HP3 A;  3NK9 A;  3K58 A;  1D6E C;  1UNS A;  1TWC B;  1KAA A;  1IHZ A;  3PUX A;  3MVV A;  2BA1 A;  1HXY D;  3VYR A;  3VYU A;  2NN6 I;  1G29 1;  3J81 L;  1Q8I A;  2CQA A;  3G6J B;  4IUU A;  2DY8 A;  3GTK B;  2G9H D;  1RTN A;  1HFN A;  1KNA A;  2QF7 A;  2LS0 1;  1ICW A;  2RKS A;  1A6X A;  2EY6 A;  2X69 A;  1E2V A;  4KKT A;  3J81 E;  4ILW A;  4HED A;  3MFG A;  1Y1V B;  3HOY B;  3WOF A;  1HQR D;  2B2V C;  2NZ1 D;  1TWA B;  1IYU A;  5IGC A;  1U9R A;  1RDP D;  1KNE A;  2BDN A;  1F77 A;  2HUG A;  3H6M A;  2EYF A;  5E4X A;  4X3S A;  2XNA C;  1CHP D;  3LNN A;  4NDX A;  4IFD G;  1RTO A;  1TS5 A;  4RHS A;  1B9M A;  3OW7 A;  4HCE A;  1EEI D;  4FXD A;  1STN A;  3NWT A;  5KEE A;  3HEJ A;  1CZW A;  4C3H G;  4IUT A;  2D62 A;  4G7Z C;  1EQT A;  3I4M B;  3LWU A;  2F0N A;  2F0V A;  2SOB A;  1SE2 A;  3OHX C;  4DU9 A;  4NW2 A;  1IKL A;  2F0J A;  1SE3 A;  1A3T A;  3BYY B;  3R3O A;  3KK7 A;  4G57 A;  4V19 0;  1D5Z C;  4FF3 A;  3VA5 A;  1JWU D;  2AWO A;  1BCP D;  4X3K A;  3SK5 A;  1JOK A;  1B9N A;  2EY2 A;  3DEO A;  2R93 B;  3A8K E;  3S1M B;  4PNY A;  2QCP X;  5ELC A;  4A3M B;  1JOR A;  5KIX A;  1G91 A;  3VYT A;  3S1N B;  2D9U A;  2WB1 B;  1U4R A;  2MPM A;  1ML0 D;  1ZXT A;  3EQL C;  3IL8 A;  2B2V A;  5KYL A;  3HKZ B;  4QUC A;  2JE6 I;  1A15 A;  1MSH A;  1EU4 A;  1SYB A;  1SSO A;  1Y69 U;  5T1I A;  1XWE A;  3DM1 A;  1IKM A;  5BN4 A;  1EQV A;  1HRJ A;  2NUC A;  2OXP A;  3H94 A;  2PNR C;  2K01 A;  5C4J B;  1D1I A;  1JR0 D;  1QWY A;  4Q5V A;  1SAP A;  2ID0 A;  2MJ8 A;  1VMC A;  4IFD H;  4JBW A;  2KQ3 A;  3O13 A;  4IAL A;  4C3H B;  5TSS A;  2PMZ B;  3QOL A;  1JE4 A;  2EE1 A;  5IOD A;  3AB9 A;  4OIK A;  3RZO B;  5A35 A;  2PZU A;  1PFB A;  3MXU A;  5D3D A;  1EYA A;  3GTL B;  1STB A;  4IQZ A;  1TS2 A;  2PZW A;  2FMM A;  2Z1C A;  1DOM A;  5CV4 A;  3HGB A;  1ENA A;  4PMB A;  3SDZ A;  3A8J E;  1EOT A;  3I72 A;  4Y7N B;  3T13 A;  2BCO A;  1F9S A;  3I4L A;  3H91 A;  5NUC A;  1WVL A;  5EPK A;  4CHT B;  1BCP F;  3GO5 A;  4JK1 C;  4RHR A;  3TBI B;  4EQO A;  1PTO C;  1B44 D;  2K5Q A;  1WTV A;  1HFG A;  1GUN A;  2FFK B;  1JC7 A;  1JOQ A;  5KYI A;  3PIP 3;  3VYS A;  3I91 A;  3QIA A;  2TSS A;  2IX0 A;  1S5C D;  1TT2 A;  1ENF A;  3WDN A;  3D6C A;  2Z8L A;  3RD4 A;  5J1Z A;  4A3E B;  1PYW D;  1TU2 B;  1DZ1 A;  4ZK9 B;  1WD0 A;  4LK1 C;  1DOK A;  2A6E C;  1A3V A;  1DM0 B;  1VMP A;  3BVM A;  3H3V C;  2F3W A;  3GTO B;  3E5S A;  4N9P A;  4NMZ A;  1TS4 A;  3GV6 A;  2K5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...