1SYFA

Engineering alternative beta-turn types in staphylococcal nuclease
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKTNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Engineering alternative beta-turn types in staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(phosphoric diester)
total genus 35
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1syfA00
1A2UA 4NDXA 4K14A 3D4WA 4B9XA 1EZ8A 2EY5A 3NHHA 2EXZA 3PMFA 3MZ5A 5CV4A 5IGEA 1SNDA 3MXPA 3OSOA 2EY2A 3TP6A 5C5LA 2EYJA 4N9TA 1KDAA 3MEHA 5IGGA 2PZUA 2QDBA 5DEHA 1STYA 4ODGA 3R3OA 2F0LA 4K8JA 2F0HA 3MHBA 5DAUA 1SYDA 4H7BA 4DF7A 5HURA 5EKLA 3P75A 2F3WA 5CV5A 2F0MA 3D8GA 5C5MA 5CC4A 4NMZA 2F0DA 3E5SA 4WRDA 1EYAA 3SK8A 5CV8A 2NUCA 4K5WA 3ERQA 3SK5A 4ZUJA 3DMUA 4YIJA 1SNCA 3S9WA 1EY9A 3BDCA 2EYHA 2F0FA 3C1EA 2ENBA 1IHZA 2LKVA 4KY5A 4OL7A 4RKLA 3TP8A 1RKNA 2SOBA 4ME5A 2F0VA 4MIUA 3OWFA 5C4ZA 1EY7A 2F0GA 2PZTA 4KY7A 2F0KA 3VA5A 1A3UA 1EYDA 4QF4A 3NP8A 5CV9A 4EQOA 5J39A 5IODA 2KHSA 1A3VA 2F0TA 3TP5A 4PMBA 2SNSA 3OMCA 3SR1A 5I9PA 5C4HA 5IGCA 4IALA 1EY0A 4ZUIA 5EGTA 1SNPA 1NUCA 3QOLA 4K5VA 5CGKA 2RKSA 1EQVA 5J1ZA 2KQ3A 5I6YA 4QMGA 1U9RA 2WACA 2EYFA 2OEOA 5EKKA 5IIFA 2O4XA 2PZWA 4NP5A 3RUZA 3QB3A 3NUCA 1SYFA 3EROA 1SYBA 2PQEA 2EY1A 4K2LA 1F2MA 1KDBA 1ENCA 2F3VA 4IZ8A 4G57A 1EY6A 4N9PA 4TRDA 4B9WA 5JAVA 4QB4A 3SXHA 3ITPA 2PYKA 3U9OA 5KRUA 4K8IA 1TR5A 5CV6A 3LX0A 1JOQA 1TQOA 3P1HA 5IGBA 4F8MA 4KHVA 1KAAA 1EZ6A 4K5XA 3NQTA 2EYMA 3DHQA 2SNMA 5F2DA 2M00A 4R8NA 4RKBA 5IGFA 1II3A 5NUCA 4PNYA 4DFAA 4HMIA 4K6DA 2F0UA 1KABA 2F0PA 5KEEA 4K2KA 4LAAA 1STHA 1SNQA 5K5PA 1F2YA 1STNA 5CR3A 2F0OA 3H6MA 4EVOA 2F0NA 1STBA 5E3FA 4S3SA 3T16A 1EY8A 4HTHA 1STGA 4ID6A 2F0JA 2PW5A 3QOJA 4IUNA 4KJOA 4E6IA 4EQNA 3D6CA 5C3WA 5C3XA 3MVVA 1AEXA 4KD3A 2EYLA 4KJNA 5M9OA 3D4DA 1SYCA 1SNOA 2EYOA 2PW7A 4KTAA 3NK9A 4PMCA 3SHLA 4F7XA 1EY4A 4DU9A 5I6WA 4KD4A 4WORA 3SK6A 4I65A 5KYLA 4DGZA 5CV7A 1NSNS 2EY6A 3OMGA 3TMEA 3HZXA 1A3TA 4HMJA 1KDCA 5I9OA 1SYEA 2RDFA 1STAA 3V2TA 5JOBA 4J6HA 5HGTA 3SK4A 5KYIA 1EYCA 1A2TA 1JOKA 3TP7A 1ENAA 2F0WA 4J1MA 1SYGA 5KIXA 2F0EA 2EYPA 4ZQ3A 5KGUA 3T13A 5IGDA 2F0SA 4KV6A 4EQPA 3C1FA 3EVQA 4NKLA 5IOCA 1F2ZA 1SNMA 1TT2A 4KY6A 3BDLA 2RBMA 3EJIA 2OF1A 3HEJA 5C6AA 5J22A 2F0IA 1EY5A 5E1FA 2OXPA 2F0QA 1JORA 1JOOA 3NXWA 2HQEA 5ISRA
chains in the Genus database with same CATH superfamily
1WTHA 1EZ8A 3T1HL 2BDNA 1LTID 2L4NA 5BN5A 2A8VA 1O78A 1C8CA 5EPLA 2LXKA 4ODGA 5IT9E 1HQMC 2AKWB 4DV2L 5EPKA 3ER0A 2Z1CA 3T1HQ 4A3KB 1IYVA 4A3EB 3DUZA 3VYTA 3S9WA 5IYDG 1BCPD 4KY5A 4UY8C 1W6JA 1Y1VG 5J3BA 2QF7A 2ZTDA 3TZDA 1B44D 4PZ7A 2JA8G 1LT6D 3UDGA 1A0IA 1EFWA 3GTLH 1EY0A 1IBMQ 3HOVG 5I6YA 2R92H 3Q8DA 4DR2L 1IYJB 1VQGA 3RZDH 4ILWA 1UE1A 3MXNA 5K36H 1OXUA 1DGSA 4C3IG 1K8GA 2DN8A 4JI6Q 2LY7A 1Z7TA 3NPPA 3GTKB 1EL0A 4CDDC 3MXNB 1XMQL 4KKSA 4R8NA 3J81i 2VZAA 3J81j 2DY8A 4HMIA 2D62A 5GAHC 3I4NG 2YTVA 4R4OA 2VB2X 1XMQQ 3W2DA 3QOJA 1VQAA 1Y1WG 3DWAA 4KD3A 3CMEA 1SNOA 3K57A 1VF5C 5DLQE 4JVZA 2B63B 4A3IH 4LF8L 4FXDA 2I0QA 4WORA 3SEBA 1QE6A 2AQ2B 4H44C 3W3AA 2JJQA 2A73B 2VQEL 4JW0A 1VQMA 4KN4C 3S1QB 1BVSA 1BR9A 1A2TA 1TKWB 1CKNA 4H02A 2CW0C 2M9VA 3I4MH 3U4ZA 2GVBA 1KL9A 2K7VA 4DPGA 2YU9H 1D5ZC 4BY7H 1K8OA 5IYBG 5IOCA 2NVQB 3OIPA 2K03A 3C3LA 3HEJA 1EQTA 3N6RA 2VQEQ 2O5IC 5H1SE 2IY5B 2GVAA 2B2TC 1Q8IA 3J7ZC 3H0GG 2QDBA 3K5LA 3FKIG 4IPDA 3KBGA 1O7LA 2I5MX 1MGSA 4B08A 2Q8IB 1BOSA 5IE8A 1I94Q 5HGQA 5M3MB 3KJPA 4YIJA 4GKJL 4M8AA 4DK6C 4POGA 4QUFA 1BXTA 5IP7H 2HT1A 1TVXA 1JWMD 3W5OA 2F0VA 1A6XA 1I6HH 1NR4A 4GNXC 1A3UA 4QF4A 4YY3L 2B8FA 3NSWA 4R9WA 3DWPA 1B4OA 1YI2A 1XPUA 4IALA 4HCSA 4IOCA 1LT4D 4GKJQ 4KKTA 3D6WA 4UP7A 4RA8A 2ZXPA 2D2CC 1PH9A 1BUVT 1H9MA 1SYFA 1IL8A 4GN5A 3GTOH 1YIJA 4YHHL 1N34Q 4WJ3M 3HOXB 5CV6A 3FEWX 1E2VA 1IYUA 1L1OC 3TZUA 1ILPA 4FYDA 4F8MA 4A3GG 3CCRA 1LLRD 2ES2A 2JEBI 1TS4A 4RGTA 4JI5Q 4B3RL 3ONAB 2O5JC 1C0AA 1Y8NB 1SNQA 5CR3A 1DXMA 4IPHA 1AH9A 2MPMA 4P73A 1QZGA 2L15A 3DXJC 2HIVA 4NW2A 3KUPA 5CBAE 5K5PA 4GNXA 3JAMc 4LF7L 1BKBA 3DEPA 1Y69U 1MJCA 2LMCB 3UE0A 2R93G 1J9OA 1Q8KA 4GNXB 1XJVA 4XXEA 3CC7A 3SK4A 3IL8A 1G91A 4LF7Q 5D3IB 2K5VA 1Y1VH 1B50A 1WTRA 4LF6Q 2MP1A 3V96A 5C44H 1L1OA 4DV3L 2XWJB 3HOVH 2R7DA 5DM63 1BCPB 4IUPA 3DEOA 4OHJA 4C3JG 5IGEA 2PQAB 4X62Q 1B9MA 5I4DA 3GTLB 4A3EG 4BBSG 1BF4A 1PHJA 4KKUA 4B3ML 1HFNA 4A3FG 2R61A 1JB3A 4F88A 5FJ8G 2R92B 5IY0A 2F3WA 2HCIA 4HIMA 3D8GA 2CH4W 3DM3A 2NVXH 2F4VQ 1GO3E 3TS2A 1K83H 1A62A 3FPUB 3RZDB 3ERQA 3BDCA 2EYHA 3ULJA 4AYBE 2ZTEA 4L5QA 1RKNA 5JEAG 1AW7A 1S3OA 5C4ZA 3KYHC 2KEDA 4PZ6A 1CZWA 3CC4A 4JC0A 2QW7A 3SR1A 3J80i 2RF4A 2KCCA 2DGYA 3I4NH 2RKSA 2VXWA 2BH8A 2WACA 2N8NA 1Y1WH 3OYYA 2N55A 2H5XA 1KDBA 1ENCA 4RG1A 2K32A 2PNRC 3T53B 2NN6H 1JJCB 3J81c 2OTJA 1VQ5A 2CWAA 3D0FA 4DV0L 3S1MH 1V1OA 4A3IB 1KLUD 1QVGA 2AMCB 3KFUA 3A7AB 2F03A 4JI7Q 3BJUA 3GTMH 2M00A 1OTCA 5LMUQ 5NUCA 1RODA 2Z6KC 1E3PA 1HNWL 3I4MB 1WVLA 2YU9B 2CQAA 3MXUA 4BY7B 4RAUC 1Q1EA 1FYCA 1JB7A 2IL8A 1E2ZA 5G3LD 3URYA 4ID6A 3K5OA 1BNZA 4FF1A 3H0GH 4RGNA 3VYSA 3NTKA 2DY7A 4IURA 4KJNA 1YHBA 5D3DA 1ZXTA 1U4PA 3SK6A 4KN7C 4QIWE 3IFDA 1STAA 3H94A 1JOKA 3TP7A 2V4DA 1HA5A 3WOFA 5EAYA 2B2YC 3TQYA 4B3TQ 3AQQA 1N8RC 2CHBD 2OF1A 2OT2A 3OHXC 1I6HB 3UE1A 3PO3G 2HQEA 5ISRA 4NDXA 5D65A 3S24A 1NMFA 3GTGH 4BY1G 3MXPA 4HJ8A 2R6GA 1PXUA 2Z6KA 2G5DA 4LMQD 1L2FA 2C9OA 4N9TA 1MD2D 4ZAIA 5ELFA 3P7JA 1B3AA 1K8MA 1P8LA 5CV5A 1TIID 3GTOB 2AQ1B 3S15H 3A5UA 1TWAH 4LF4L 4A3GH 1XWEA 3PQIA 5FO7B 3KBXA 4A3MH 1EY7A 3A8IE 1VQFA 2F0TA 2OCEA 1W6KA 2E75C 3CCLA 1HFGA 4HAEA 1V8QA 1CM9A 2B2YA 1I4PA 3I70A 3IRBA 3FVQA 1LTAD 1EIYB 1PTOD 3FP9A 4JI2Q 3JAME 5M3FG 1XMOL 4LFAQ 4TRDA 2E76C 4ZKBB 4OELB 2R93H 5JAVA 4A3LH 4HSPA 2IX0A 3BYTB 1H9RA 2UXBL 4IFDG 4BBRG 1WD0A 2N3SA 1FGUA 3IKJA 3NQTA 2SNMA 4HR7B 1MHWC 4NB3A 1B1ZA 1XMOQ 5C0XH 1DOKA 1VQ7A 4PNYA 4R4TA 1Y1VB 2UXCQ 1W2BA 1GOZA 5C44B 3I4OA 4C3JH 4OO1H 2JSOA 4BBSH 4EQNA 4RCNA 3CCMA 3T1YQ 1D5MC 3HOVB 4A3FH 5FJ8H 2ZJPA 2BE5D 4MN3A 1G51A 1V1PB 2PNHA 3OMGA 3TMEA 3HOZH 2NVYH 2XGTA 1UAPA 4X64L 4LF9L 3TDQA 1PH1A 1EOTA 3I3CA 5JEAH 2NVXB 1K83B 1DONA 4KV6A 1VQ4A 1NE3A 2A6HD 2KBNA 3EVQA 1D1KA 2VQFQ 1Q7YC 1AP0A 4LFBQ 1H9SB 2Y0SE 1EUJA 3TN2A 2R92G 1TS2A 4LF9Q 3BVZA 4B9XA 5FLXc 2FMMA 4IUUA 5C5LA 3I4NB 3GD7A 2PZUA 4DNIA 2F0LA 3PV0A 1Y1WB 3BU2A 5BN3A 1GM5A 4CGYB 2K01A 2NTSA 1SE8A 2F52A 4WRDA 1XXGA 3SDZA 1DJRD 2C5CA 3S1MB 3J80c 4ZYSA 1JJGA 3M4PA 4FDBA 3K81C 2RHQB 3R8BA 4HN7A 5EKIA 3GTMB 4JI4L 1O80A 4X3SA 1PH8A 4BXXG 3NELA 4JI3Q 2N88A 4K5VA 3I2ZA 4GS3A 4R8IA 4L5SA 1IXRA 1SYBA 1BO0A 3UI2A 4JI0Q 3RNUA 4DXFA 3H0GB 3KF8B 1HUMA 1U5KA 1S4ZA 3A74A 3O13A 2P5ZX 4C1NK 4LWCA 4CJ2C 4DK1A 1SROA 1B9NA 4IO9A 4Y52H 5EQ0A 5IGFA 4K6DA 3EQLC 3E0EA 4GKKL 4X3UA 4HJ5A 4DR6L 3PO3H 2EJGC 1PTOC 4X6AH 1STEA 1B70B 4DKAC 2DJFC 1FL0A 1AFPA 4S3SA 4BY1H 4LUZA 3Q22A 1B53A 1AZQA 2F0JA 2BA0A 2FHTA 4MTNA 5COYA 2JA6H 3D4DA 4F7XA 2K14A 4PMCA 4MTKA 5GAGC 4GKKQ 1F9QA 1N36L 4I65A 4AIMA 2KCTA 4DR7L 4RHSA 3TRZA 4DN4M 5IP7G 1GVPA 1CKMA 1VQCA 3CXCA 1PH4A 1ENAA 1EEID 1Y14B 2F0WA 2PI2A 5JJZA 1Q1BA 1MSHA 2EXDA 3VR3A 3S15B 1MJEA 1SMYC 4A3GB 2K05A 1LACA 3VYUA 1SRUA 2I07B 3V05A 3G6JB 2CQOA 4B3SQ 4DV4Q 4A3MB 3NBHB 1SFOH 3D4WA 4JBWA 4QJFA 4DV5L 2BE5C 4A3DG 3NENA 1KQSA 1RDPD 5HY6A 3JC66 2JP1A 4IFDJ 4TQUS 3TP6A 5M3FH 1XNQL 2EYJA 4XYQA 4LW1A 3ZYYX 4JI1Q 2JEAI 3RD4A 1YJWA 3NQIA 2RSOA 3G6EA 1GUTA 4P72A 5EKLA 4BBRH 5CC4A 1PYWD 3GV3A 3E5SA 5LL6S 4PV1C 4RGMA 2R93B 5CV8A 2A6HC 5G3LF 5DM73 4X65L 2MNAA 5BN4A 1E2WA 1JJ2A 1OXTA 4MIUA 2UU9Q 2PZTA 4PMWA 3DLLA 3I8ZA 4RCOA 1PZKD 3I90A 3OTOQ 1B7YB 4R4IA 2EJMA 2B2WC 4RH6A 2OTLA 5EGTA 1U4MA 2Z8LA 1ICFB 1IBKQ 4BA2I 2IHFA 4Y7NH 4A3JH 5ELEA 2PQEA 2R7ZG 4C3JB 4G57A 4BBSB 1EIFA 3SXHA 4A3FB 1NY4A 1FR3A 1N9WA 2VB3X 1TWHH 2I5LX 2AQ3B 3KF6A 4DV2Q 1EQQA 4IFDI 2I5HA 2NVYB 3PGZA 2KJXA 1DD2A 5C44G 1DM0B 4L6TB 3S2DH 4DR1L 4HIOA 3NWTA 2J7ZA 4DA2A 2DNEA 1J5EL 1R9TH 3B6YA 2F0NA 1STBA 2LSSA 1KLGD 3TSSA 2RDGA 1D7QA 3W1BA 1QUQA 2KOLA 1S5CD 4KJOA 4A4IA 5FLXE 2DUDA 1AEXA 1HNXL 3FPPA 3M7NA 1KC8C 4JG2A 2KVMA 1C4QA 5IWAL 2B2WA 2EE1A 4Z9CB 3BDOA 3CPFA 1J5EQ 4DR2Q 4M1UB 5I9OA 1KDCA 1S72A 3J7AF 4OX9L 1YVCA 4AYBB 3OW2A 1PTOF 2Z6BA 3T13A 2A6EC 2PPBC 2F1MA 2TMPA 3HKZE 1VMCA 4DNTB 4IJLA 2RBMA 1QJOA 1G6PA 4BXXH 1UUPA 1ASYA 1A2UA 2EY5A 3JAML 1DYQA 2HIXA 4FNFA 2FXQA 3S1RH 2DJGC 2FFKB 4Q5VA 1F77A 3GTQB 5IYCG 2NN6G 4EX5A 2Z9HA 4TKOB 3A55A 1RF2D 3P75A 2K5WA 4YWKA 3RMHA 1BDOA 3A56A 1RL2A 3CC2A 1MKHA 3SK5A 3HKZG 4LF8Q 3W1GA 3F2DA 1FNUA 5KNBA 1CKNB 2SOBA 3OOCA 2ZXOA 1YZ6A 3M4YA 2K5NA 3L9AX 1F2LA 4PMBA 5CYUA 4CDCC 1T9HA 2HDMA 5J1ZA 5C4JH 3PUWA 3PO3B 5EBDA 4CJ1B 1WTQA 4BY1B 3K5NA 4B9WA 2Q8RE 4QIWB 1L0WA 1TWFH 3ITPA 2JA6B 3H3VC 1LUZA 1VQ6A 1K9MC 3ERSX 4XT3B 3KOJA 2KEEA 4MHEA 1CFMA 2EYMA 2PI2E 2L12A 2XSCA 2E74C 3BVGA 1SBBB 4GZYC 2CVRA 5T1IA 3D31A 1ZKOA 2QDLA 4JV5L 1MSGA 4TVAB 2MHVA 4A3DH 1M4VA 4YY3Q 2LFNA 1RIPA 1I4HA 2ALYB 4C56C 1IKMA 1YNXA 1KHIA 3MVVA 1SFOB 3BG3A 2ATWA 1FVIA 1FNWA 3PUXA 2PW7A 3S16H 1HQRD 1PMRA 4DR5L 1L0YB 3J81L 3F2CA 5M3FB 1NSNS 4GN3B 1SYEA 1QILA 3CKIB 3G7LA 1NBWA 1OXXK 2AWNA 4UHVA 4A3MG 3F8TA 4KMUC 3H15A 4I7AA 1EOVA 4YHHQ 1TXYA 4BBRB 1IL2A 4YWLA 4XQNA 3MFGA 1IW7C 2ZXRA 1YBYA 3RLOA 4KY6A 2L5TA 1PV4A 1UWVA 1K3BC 2HCCA 1HRJA 2CH4A 1FD7D 2WB1E 4N8FA 3QG1A 1PYBA 2K28A 4B3RQ 3PO2H 5ELNA 3J7AV 2I46A 1TWCH 5KNCA 1SNDA 4NXML 3EBEA 3CQZH 2ZTCA 3FHWA 2R7ZH 4A3LG 5ELOA 3S2HH 5JPMC 5DAUA 4Y7NB 4A3JB 5M5XH 1N32L 3FDTA 3J7A5 2E5LL 4APVA 5C0XG 2UUAL 3S1NH 4GLAC 4F87A 3M4OH 1JT8A 1B8AA 1TWHB 1YNJD 5GQOA 1WCMH 1ENFA 3MTSA 4UP9A 4DAYA 2WIIB 1Z6HA 5CV9A 2SDFA 1ONLA 4R1JA 4FO2A 5J39A 3KLSA 1VQDA 1X56A 1L1OB 2L1BA 3S2DB 4OO1G 1LTLA 3X3NA 1NUCA 4R4CA 2KQ3A 1QVCA 1JICA 4DV3Q 2ZJQA 3T4AC 1I3QH 1R9TB 4L63B 1EWHA 3Q23A 1PFNA 1YNND 3GTJH 3HOZG 2QILA 3FRPB 1ET6A 4LK1C 4QUCA 3ULPA 4B3MQ 4XDXA 5JVG3 4DAPA 5TSSA 3PIO3 4KHVA 3BVMA 1VQLA 4ABNA 5JVH3 1UEBA 1ML0D 4RKBA 1HZAA 2R7FA 2KA7A 4GLVB 2RCFA 2Y0SB 1TU2B 3CP0A 1PRTD 2WAQE 1IBLL 4FXKC 3K5MA 4L8JA 4CKBA 5GADC 5C3EG 1X3EA 2K5HA 2PW5A 4IUNA 3U50C 1YHQA 5IYCH 1GUOA 2KECA 2BDOA 1U0LA 4AYBG 2K1BA 4CBVA 4O0AA 3SHLA 1KAWA 5D14A 3S1RB 2UUCL 5CV7A 3HZXA 2JK8A 2Z4IA 2YYZA 4RHRA 1O7ZA 1X9NA 2LXJA 2K50A 2IX1A 3X3MA 1PZJD 4IPGA 4DV0Q 2Q2IA 4EQPA 1CHQD 2VW9A 1VQKA 2UUCQ 1H9JA 2XIWA 3BDLA 2HUGA 3R2TA 3I73A 3NXWA 4HTHA 4CDEC 1GUWA 1Q3LA 4K14A 4JBMA 1E24A 1HZCA 3NHHA 3RLFA 3PIP3 3PMFA 1HNWQ 2K5DA 2PMZE 1PH5A 5C4JB 4DUYL 4DAMA 2QCPX 2MGSA 2V1CC 2G9DA 2D9UA 1RJTA 2NN6I 3CD6A 1F9SA 1J6QA 4K5WA 4ZUJA 3CHBD 1TWFB 2NVTH 3CRKC 2IT1A 3HOWH 1CZGA 3T56B 2NWGA 1R4QB 4DUYQ 3OWFA 3Q0AA 5FOBB 4A3CH 1VQEA 4QQBX 5IODA 1CK1A 2X69A 2EOTA 5I9PA 3RR5A 2IPKD 2QA4A 3F2BA 1SNPA 1V1QA 4G7ZC 1GD7A 5FLXL 1ZYRD 5CMDA 1U9RA 5T1GA 2JA6G 2EYFA 4NXNL 1CQFA 2PZWA 4A3DB 1X55A 3K58A 4ALPA 3ICEA 4JYAL 1WTWA 3CRLC 3GP7A 2NZOA 3S16B 1WD1A 1YNJC 2PO4A 3F2UA 1K3RA 4IUVA 4NXNQ 3OIQA 3J80L 5F2DA 1CA5A 3U9SA 3M3YH 4A76A 4LF4Q 2F0UA 4QGUA 1TS5A 3CCUA 1F2YA 3MA2B 4V0BA 1YNNC 3S17H 4UP8A 3HFZB 5C4XG 1M1KC 3CCQA 1OO9B 1PTOH 4ULLA 2NYZD 2KCMA 1TWCB 2AHOB 2FMCA 3CQZB 4KLKA 5BR8L 2JA9A 2R7ZB 5IGCA 1A3TA 2MUYA 3S2HB 2X6LA 2MO1A 1LT3D 1EYCA 5M5XB 1KRSA 3S14H 4J1MA 4DK0A 1D5XC 4POFA 5KIXA 2UXBQ 1PRTC 1I50H 1U4RA 2F0SA 3ND9A 1SMXA 1SMYD 4JBJA 4OWXB 5IGDA 5LHY1 2AUJD 5CORA 3H91A 3NBIA 1GXDC 3M4OB 2HQLA 5LMNL 3EJIA 2JA7G 2F0IA 1A15A 5AJ3L 1WCMB 1C48A 1IHZA 1PFMA 4FF4A 3BS1A 4A3JG 2N78A 4RFBA 3K80C 1WFQA 2L55A 2A68D 2XWBB 1G6ZA 3OSOA 4C1NI 4KHZA 5JEAJ 5M5YH 1PH6A 4GLXA 3C46A 2L0CA 1MBYA 4IN3A 1I3QB 4U673 3GTJB 3SVMA 5IT9c 1N33L 2E8GA 4BS9A 2UXDL 3T51B 2KCNA 1EY9A 2WP8J 5C0XI 2F0GA 4OEMB 4X64Q 2F0KA 4IUTA 1EYDA 3E9IA 1N33Q 2MO0A 3PUYA 3I4LA 5C3EH 2JN4A 1JE4A 4DR3L 3KDFA 4QMGA 1UE5A 4OO1I 2A1AA 4K2LA 2EY1A 4HJ9A 3GDEA 1EY6A 3J81E 2YV5A 4QB4A 1LYLA 2E2DC 1F9PA 2PCFB 2Y0SG 3LX0A 4O42A 1K73C 4XYOA 4DR3Q 3AMUA 3E0JA 3K7AH 2GA4B 3HKZB 1LTGD 1ASZA 1WI5A 1KABA 1LO5D 2D0PA 4LUVA 1ZYRC 5AFWA 2F0OA 5FLMH 1HPCA 1QWYA 4JI4Q 1TY0A 1XTDA 3PUZA 4DK3C 5C3WA 1NCVA 3CAMA 4AQYL 1CHPD 1CUKA 3TS0A 2EYOA 5ELDA 3NK9A 5JPNC 1IKLA 1WTXA 1PA6A 1KIXA 3NEMA 1RTNA 2RDFA 3V2TA 3UDFA 5KYIA 1CSPA 1HR0W 4AQYQ 5IP9G 2QGQA 2A6ED 4GOPA 3K8AA 1WYDA 4JPBW 1WOCA 1BBXC 2NVTB 4J15A 2H1EA 4P75A 3HOWB 1SJHD 4OWWB 3CCSA 1ILQA 1VQHA 1Q86C 4HIKA 1QNUA 3GTGB 2EXZA 2EPBA 5CV4A 4DR6Q 1NNXA 5KNDA 5FKAC 1STYA 4R4QA 1X3PA 1PRTF 1D8LA 5FK9C 4DV7L 4JI8L 1HTPA 3HP3A 1TWAB 1N36Q 3SE0A 4OL7A 1WTVA 3C1EA 2LKVA 4DR7Q 3N52A 4PZ8A 4KK7A 2GN5A 3VA5A 2EVBA 3AFQA 3M3YB 3C2PA 4JI8Q 2A68C 3IFTA 3HOUG 3BZKA 1UE6A 4I7ZC 5LMNW 1PH2A 3D3RA 3VR5A 5C4XH 5A2QL 3EFXD 1Q82C 3NUCA 3S17B 3MAQA 2A69D 4L5RC 1U4LA 4DV5Q 2K6AA 2E2HH 1PTOB 1XNQQ 1HUNA 4K8IA 4WJ4A 1S5ED 3P1HA 3A5ZB 3CMAA 3JAMi 2FINB 3H3VH 2RSNA 1V43A 2J0TD 4XT1B 3S14B 1LTSD 4X65Q 2JA7H 4A75A 3MEFA 1P16A 2NTTA 2WB1B 4LAAA 1I50B 1UEAB 3PO2G 1EIHA 2VUMG 1GHJA 4IQZA 2NZHA 1X3GA 2A74C 3T16A 1X3FA 2EIFA 1JMCA 3I91A 3HOYG 2SEBD 2B39A 2E2JH 3LWEA 2RVLA 4P74A 4RMFA 4DV6L 5M5YB 4DGZA 3HOZB 1O7IA 1HNZL 3SGIA 5JOBA 3NTHA 2LS01 2KUMA 3G4SA 1WCMG 3AU7A 3MWYW 3KF6B 4C3HG 1FJGL 3L2PA 1QNKA 1UE7A 2ICEC 3TREA 1IW7D 1TS3A 3LGJA 1IBML 1CT1D 4GN4B 1XYIA 2JQOA 4DV6Q 3WDNA 5C6AA 1EIGA 5J22A 4KHPL 2OXPA 4CHTB 2A19A 1HNZQ 3H3VI 1M8AA 3PSIA 5C4HA 2Q8TA 4UAIA 1F9RA 1VQ8A 1Y8PB 4DR1Q 1G8ZD 1FJGQ 1QUQB 3H09A 5C3EB 1CTMA 5DEHA 4JI6L 1W3SA 3R3OA 1PFBA 1G2SA 4KHPQ 4DF7A 1GUNA 1ZEQX 3GO5A 2F0MA 4NMZA 3BZDB 2JA5H 1HNXQ 1LV9A 1X32A 1SDFA 1SE2A 3D4RA 1TWGH 4FP5D 4L5TA 4X66L 5IWAQ 1GUGA 3J80E 3KJOA 2ENBA 4RKLA 3K7AB 2D0OA 1PH7A 3UDXA 4DUZL 4OX9Q 1SE4A 3J7YW 1QCBD 2WAQB 4XQJA 1OXVA 3HS0C 4X66Q 1ESFA 1ESRA 4CKCA 5IIFA 3K0YA 4K6LA 3QWNA 1V9PA 4DUZQ 1NJIC 1ET9A 1XNRL 4ZCKA 1EWCA 4LFCL 1YHAA 1TR5A 5GROA 1TQOA 3MC0B 5IP9H 2EJFC 4IJHA 4WFN3 1HXYD 4C2MH 1XNRQ 1XX8A 4LUOA 4LFCQ 3ZJYC 1XPOA 1E7ZA 1HTLD 2A69C 4O1NA 4CKEA 1WTPA 2PMZB 1HZ9A 1I94L 1SXTA 4IPCA 4MNOA 3NTIA 2JE6I 2EYLA 4KTAA 1MIUA 3A0JA 4DU9A 5KYLA 1PFSA 1JWUD 1JQYD 3HOWG 1R4PB 1QVFA 4A3CG 1E1TA 1HJPA 5KGUA 3K59A 2E2IH 4OIJA 5LL6X 1AE3A 4O2DA 2B2UC 3M4QA 2CKZB 3HOUH 2BCOA 2BOSA 5E1FA 1EY5A 1OXSC 5E4WC 3OPOA 1AZPA 2K4KA 1H95A 1SJED 4A3BH 3RN5A 4JV5Q 1N34L 4J8QA 2RCNA 4A93H 5C4XB 4YCWA 2B3GA 1QZHA 2MJ8A 1SEBD 1VQJA 1ICWA 1GHKA 4DV1L 3PCOB 4JI5L 2RA4A 1EYGA 4EGVA 2NUCA 4DR5Q 2E2HB 1BCPC 1QG7A 2F0FA 4XIGS 3LWUA 2B2TA 1E22A 4ME3A 4P71A 4CDFC 3ULLA 3CCJA 4KY7A 3QIAA 1I4XA 1Z47A 2MQHA 1S5BD 1A3VA 1JWSD 2VUMH 4DV1Q 2JA7B 4LNQA 1NAPA 3HOYH 2OEOA 4YWMA 1BBWA 3QB3A 1CKOA 4G7HC 2B2UA 2K5QA 3L0OA 1F2MA 1Q90A 2F3VA 4IZ8A 4N9PA 2K33A 1T5EA 1DCZA 3HG9A 3OW7A 2E2JB 4NXMQ 4PG3A 2XRQD 1VQ9A 4BWGB 3R93A 5L37A 1QOHA 2WB1G 1LABA 3EA6A 3VR2A 4LF6L 4C3HH 5EBCA 4K5XA 1N32Q 4K0KL 1A63A 2E5LQ 1PZID 1BBUA 2IX3A 2ZJRA 5IYDH 3FMCA 4DAYB 4WJWA 2UUAQ 5KEEA 2X6GA 4X62L 3H6MA 1NMGA 1D6EC 3L3OC 1VQOA 2JA8H 2PQAA 4K0KQ 3CW2C 1STGA 2CFMA 4AH6A 2F4VL 1YJNA 4HIDA 4ZLTF 4KD4A 4A3KG 2NBFA 2EY6A 1XPRA 4OWTB 1KXLA 4J6HA 2XN9C 4C3IH 3RZOH 5FO8B 2JA5B 2VY3A 3A8KE 4ZQ3A 1EFID 4H13C 1EWIA 4X3TA 1TWGB 1BQQT 3VA7A 4NKLA 3HRZC 2XNAC 1WJJA 3CCVA 1JORA 4UPAA 4DR4L 1DZ1A 3RN2A 2AWOA 2L9HA 3K0XA 5A2QE 2B29A 1IBLQ 1KDAA 5IGGA 3GTPH 1AN8A 3GV6A 2F0HA 1JE5A 4JI7L 4H7BA 4DR4Q 1JOQA 3WWVA 1LTBD 1G291 1AE2A 1I5FA 2VL6A 4XQQA 5LMUL 5JJLA 1EEFD 1VF7A 2WAQG 1KRTA 4DNRB 3L7ZC 1LTRD 2XTIA 5JJIA 1GJXA 3A8JE 2BA1A 3A7LA 3E6ZX 1S5FD 2JYOA 4OONA 1SN8A 4EQOA 5FLMG 3NP8A 1VQNA 2WKCA 3A54A 2N49A 1KTKA 2SNSA 3OMCA 4C2MB 5CBEE 5IYBH 4ZUIA 2QEJC 5M5WH 1X6OA 2ZT9C 4IOAA 2O4XA 3VDYA 3PF4A 3KLWA 2B63G 1HH2P 3EROA 1S5DD 1BCPF 1I6VC 3LNNA 2NB0A 3CPWA 5ELBA 1E0BA 5IT9L 3F1ZA 4DAVA 3STBD 4PQXA 4OGQC 2PYKA 3U9OA 3E3XA 2CWPA 3FKIH 5KRUA 3P20A 4ZRZA 4B3TL 4N8X1 1EQRA 5IGBA 1C7YA 1EU4A 3G71A 2YTYA 1J8IA 1II3A 1Q46A 2RQXA 4YCUA 1KNAA 1KNEA 3AB9A 1E1OA 4U68A 1STNA 2B8GA 2E2IB 5I2XA 1PDQA 4LJZC 1C9OA 3TBIB 3HOUB 2VS1A 2EZVA 4E6IA 4MZ9A 2OWOA 1FNVA 1HR0L 5M9OA 3KLSX 4A3BB 1O7YA 5GAEC 3AEVA 1EY4A 4ZKCB 3UDIA 5M3MG 4A93B 3M85A 3MFYA 2WINB 2IW3A 4UDUC 4JYAQ 2EQSA 3I56A 3QO2A 1HR0Q 2O2LD 3RLNA 3PF5A 1WTOA 4RGOS 4G7OC 2A5HA 1XTCD 1F2ZA 1TT2A 3U58A 1RHPA 2HDLA 4JI2L 4HEDA 1D1IA 3TEHB 5C0XJ 1NTGA 1SR3A 3PO2B 1T5XD 1X54A 4LFAL 3MZ5A 2VUMB 1X65A 2EY2A 4HJ7A 2K04A 1VQBA 2WKDA 2XVSA 3MEHA 2H4OA 3HOYB 3HOXG 1DOMA 1SAPA 1SYDA 2EDGA 4FVMA 4Q0FA 5C5MA 1LM0A 1DOLA 2F0DA 1EYAA 3SK8A 4HJAA 3S1NB 3DMUA 5BR8Q 3K6OA 2RDHA 1SE3A 2DNCA 2UXCL 3TP8A 1LT5D 4C3HB 3CCEA 2D5DA 3HKSA 5FO9B 5JJKA 3T1YL 2Z4HA 2M2LA 4OXPA 3QOLA 5CGKA 2OQKA 4DXGA 1YEZA 5LMNQ 5EKKA 5A35A 4NP5A 5AJ3Q 3RUZA 2ASBA 1SLJA 1HHVA 2WV6D 2JA8B 2F3IA 5E4XA 4A3KH 4JBKA 2HHHL 1V1PA 4A3EH 2BH2A 3ND8A 4QCLA 4BA1I 1I4GA 1Q12A 3GQBA 2R3ZA 1EU3A 2K75A 1UNSA 1JCKB 2VQFL 1G2TA 4LFBL 1B3QA 2ZM6L 2IHEA 3DHQA 1L0XB 1CA6A 2K52A 1VQIA 3MXGA 2UXDQ 4DFAA 3OWEB 1H9SA 2HHHQ 1CQVA 1VS0A 2J4XA 5E7NA 3VR4A 2NZ1D 3R2IA 2B2VC 4C3IB 3RZOB 2F0PA 1IZ6A 1FGBD 1K28A 3U4VA 2Q2UA 5E3FA 2ZM6Q 4TSSA 1RTOA 2KHJA 2WFWA 1PRTB 1Z9FA 1PLFA 1HZBA 2RHSB 3KDFB 4GOPC 3STBC 1GKHA 2UUBL 3DM1A 4YCVA 2ID0A 2JA5G 3QJYA 4X3KA 1HCZA 1TY2A 3HGBA 4HCEA 3GTKH 2QKIC 4P2CB 1NR2A 3GTPB 5K36G 4OIKA 1PYSB 3CF5A 1I4RA 2VNUD 1VDZA 1RCVD 2UUBQ 2F0EA 1YITA 3KK7A 4QY7A 4JI3L 2TSSA 3NE5B 1QB5D 5EJWA 2F0QA 1PVOA 2C35B 4JI0L 2IWHA 2B63H 2MFIA 1LTTD 1H9KA 4FXGC 2B2VA 5M5WB 4IUQA 2CCZA 3GTQH 1HA6A 3S1QH 2JXMB 4FF2A 1Y8OB 3KF8A 3K7UC 4K8JA 1K8AC 3MHBA 5HURA 4A3IG 4V190 3E9HA 2HD3A 3BYYB 3CU7A 1SNCA 2QEXA 3EIVA 2NVQH 3G48A 3FKIB 4NPSA 2L11A 4ME5A 1X3QA 3I7FA 3I4MG 4BY7G 4GOPB 1M90C 1VMPA 4H0LC 2KHSA 3TP5A 5I2YA 5ELCA 3M9BA 3Q6SA 2OQ0A 4CJ0B 1EQVA 4ZK9B 1D2BA 4QL5A 4KI0A 4JOIC 2Q2TA 1KD1C 2XRSD 5M3MH 3PUVA 4LF5L 3PIOA 2KENA 2F4IA 3QR8A 2AUKA 4JCVE 2Q2HA 4HSVA 1YJ9A 1KAAA 3BZCA 1EZ6A 4G4KA 4B3SL 4DV4L 4RWSC 4DV7Q 1S40A 3VR6A 4FF3A 1K0RA 1I4QA 4LF5Q 2CW0D 4K2KA 1STHA 2FJ2A 3NBHA 4A3BG 3I72A 5DNFA 4EVOA 4XTCS 1RD9D 3AFPA 4JI1L 4A93G 1EY8A 1JR0D 2IJ0A 5C3XA 3D6CA 1JC7A 3VYRA 3HOXH 1SYCA 3NWSA 2YTXA 1K0SA 5I6WA 1VQPA 1Q81C 1GUSA 3Q24A 3IAYA 1B2TA 4HMJA 3WOEA 2UU9L 5HGTA 3KLRA 3AYHB 3EN2A 4JOIA 3I55A 1PH3A 2ICIA 1SYGA 4IFDH 3OTOL 2KHIA 2EYPA 1SSOA 1A8VA 4EQ5A 3C1FA 1CSQA 3DWQA 1SNMA 2Z0SA 1IBKL 1VCIA 5EPJA 1CI3M 4JK1C 3PIPA 2G9HD 3M7GA 1JOOA 1MI2A
chains in the Genus database with same CATH topology
1EZ8A 2BDNA 1LTID 2L4NA 5BN5A 1O78A 1C8CA 5EPLA 4ODGA 5IT9E 1HQMC 5EPKA 2Z1CA 4A3KB 1IYVA 4A3EB 3DUZA 3VYTA 3S9WA 1BCPD 4KY5A 1W6JA 2QF7A 3TZDA 1B44D 1LT6D 1EY0A 5I6YA 4ILWA 3MXNA 5K36H 1OXUA 4C3IG 2DN8A 2LY7A 1Z7TA 3NPPA 3GTKB 1EL0A 4KKSA 4R8NA 2DY8A 4HMIA 2D62A 2VB2X 3W2DA 3QOJA 3DWAA 4KD3A 1SNOA 3K57A 1VF5C 2B63B 4FXDA 4WORA 3SEBA 1QE6A 2AQ2B 4H44C 3W3AA 2A73B 3S1QB 4KN4C 1BR9A 1A2TA 1TKWB 2CW0C 2M9VA 2K7VA 1D5ZC 1K8OA 5IOCA 2NVQB 3OIPA 2K03A 3C3LA 3HEJA 1EQTA 3N6RA 2O5IC 2B2TC 1Q8IA 2QDBA 3K5LA 3KBGA 1O7LA 1MGSA 4B08A 2Q8IB 1BOSA 5M3MB 4YIJA 4M8AA 4QUFA 1BXTA 1TVXA 1JWMD 2F0VA 1A6XA 1NR4A 1A3UA 4QF4A 2B8FA 3NSWA 4R9WA 3DWPA 1B4OA 4IALA 4HCSA 1LT4D 4KKTA 3D6WA 4RA8A 2ZXPA 2D2CC 1BUVT 1H9MA 1SYFA 1IL8A 3HOXB 5CV6A 3FEWX 1E2VA 1IYUA 3TZUA 1ILPA 4FYDA 4F8MA 1LLRD 2JEBI 1TS4A 4RGTA 3ONAB 2O5JC 1Y8NB 1SNQA 5CR3A 1DXMA 2MPMA 3DXJC 4NW2A 3KUPA 5CBAE 5K5PA 3DEPA 1Y69U 2LMCB 1J9OA 4XXEA 3SK4A 3IL8A 1G91A 5D3IB 1B50A 1WTRA 2MP1A 3V96A 2XWJB 5DM63 1BCPB 4IUPA 3DEOA 4OHJA 4C3JG 5IGEA 1B9MA 5I4DA 3GTLB 1BF4A 4KKUA 1HFNA 2R61A 1JB3A 4F88A 2R92B 2F3WA 2HCIA 3D8GA 3FPUB 3RZDB 3ERQA 3BDCA 2EYHA 1RKNA 5JEAG 1AW7A 5C4ZA 2KEDA 1CZWA 3SR1A 2KCCA 2RKSA 2VXWA 2WACA 2N55A 1KDBA 1ENCA 2K32A 2PNRC 3T53B 2NN6H 1V1OA 4A3IB 1KLUD 3A7AB 2F03A 2M00A 5NUCA 1RODA 3I4MB 1WVLA 2YU9B 2CQAA 3MXUA 4BY7B 4RAUC 1Q1EA 1FYCA 2IL8A 1E2ZA 5G3LD 3URYA 4ID6A 3K5OA 1BNZA 4FF1A 4RGNA 3VYSA 3NTKA 2DY7A 4IURA 4KJNA 5D3DA 1ZXTA 1U4PA 3SK6A 4KN7C 3IFDA 1STAA 3H94A 1JOKA 3TP7A 2V4DA 1HA5A 3WOFA 2B2YC 2CHBD 2OF1A 2OT2A 3OHXC 1I6HB 2HQEA 5ISRA 4NDXA 5D65A 3MXPA 2R6GA 1PXUA 4LMQD 4N9TA 2C9OA 1MD2D 4ZAIA 5ELFA 3P7JA 1B3AA 1K8MA 5CV5A 1TIID 3GTOB 2AQ1B 1XWEA 5FO7B 3KBXA 1EY7A 3A8IE 2F0TA 1W6KA 2E75C 1HFGA 4HAEA 1V8QA 1CM9A 2B2YA 1I4PA 3I70A 3FVQA 1LTAD 1PTOD 3JAME 4TRDA 2E76C 4ZKBB 5JAVA 4HSPA 2IX0A 3BYTB 1H9RA 4IFDG 1WD0A 3IKJA 3NQTA 2SNMA 4HR7B 1B1ZA 5C0XH 1DOKA 4PNYA 1Y1VB 1GOZA 5C44B 4OO1H 2JSOA 4EQNA 4RCNA 1D5MC 3HOVB 2BE5D 4MN3A 1V1PB 3OMGA 3TMEA 1UAPA 3TDQA 1EOTA 3I3CA 5JEAH 2NVXB 1K83B 1DONA 4KV6A 2A6HD 3EVQA 1AP0A 1D1KA 1H9SB 3TN2A 1TS2A 3BVZA 4B9XA 2FMMA 4IUUA 5C5LA 3I4NB 3GD7A 2PZUA 2F0LA 3PV0A 1Y1WB 5BN3A 4CGYB 2K01A 2NTSA 4WRDA 1XXGA 3SDZA 1DJRD 2C5CA 3S1MB 4ZYSA 3R8BA 4HN7A 5EKIA 3GTMB 1O80A 4X3SA 2N88A 4K5VA 4R8IA 1SYBA 1BO0A 3UI2A 4DXFA 3H0GB 1HUMA 1S4ZA 3O13A 4C1NK 4CJ2C 4DK1A 1B9NA 5EQ0A 5IGFA 4K6DA 3EQLC 4X3UA 2EJGC 1PTOC 1STEA 1AFPA 4S3SA 3Q22A 1B53A 1AZQA 2F0JA 2BA0A 2FHTA 5COYA 3D4DA 4F7XA 4PMCA 1F9QA 4I65A 4RHSA 4DN4M 1ENAA 1EEID 2F0WA 5JJZA 1Q1BA 1MSHA 3S15B 3VR3A 1SMYC 4A3GB 2K05A 1LACA 3VYUA 2I07B 3V05A 3G6JB 4A3MB 3D4WA 4JBWA 2BE5C 1RDPD 2JP1A 4IFDJ 4TQUS 3TP6A 2EYJA 4XYQA 3ZYYX 2JEAI 3RD4A 3NQIA 2RSOA 1GUTA 5EKLA 5CC4A 1PYWD 3GV3A 3E5SA 5LL6S 4PV1C 4RGMA 2R93B 5CV8A 2A6HC 5G3LF 5DM73 5BN4A 1E2WA 1OXTA 4MIUA 2PZTA 4PMWA 3I8ZA 4RCOA 1PZKD 3I90A 2EJMA 2B2WC 4RH6A 5EGTA 1U4MA 2Z8LA 4BA2I 5ELEA 2PQEA 4C3JB 4G57A 4BBSB 3SXHA 4A3FB 1FR3A 2VB3X 2AQ3B 4IFDI 2NVYB 2KJXA 1DD2A 1DM0B 4L6TB 3NWTA 2J7ZA 4DA2A 2DNEA 2F0NA 1STBA 1KLGD 3TSSA 2RDGA 2KOLA 1S5CD 4KJOA 5FLXE 1AEXA 3FPPA 3M7NA 2KVMA 1C4QA 2B2WA 2EE1A 4Z9CB 3BDOA 4M1UB 5I9OA 1KDCA 3J7AF 4AYBB 1PTOF 3T13A 2A6EC 2PPBC 2F1MA 2TMPA 1VMCA 4DNTB 2RBMA 1QJOA 1UUPA 1A2UA 2EY5A 3JAML 1DYQA 4FNFA 2FFKB 4Q5VA 1F77A 3GTQB 2NN6G 4TKOB 3A55A 1RF2D 3P75A 2K5WA 3RMHA 1BDOA 3A56A 3SK5A 1FNUA 5KNBA 2SOBA 3OOCA 2ZXOA 3M4YA 3L9AX 1F2LA 4PMBA 5CYUA 2HDMA 5J1ZA 3PUWA 3PO3B 5EBDA 4CJ1B 1WTQA 4BY1B 3K5NA 4B9WA 2Q8RE 4QIWB 3ITPA 2JA6B 3H3VC 4XT3B 2KEEA 4MHEA 1CFMA 2EYMA 2L12A 2XSCA 2E74C 3BVGA 1SBBB 4GZYC 2CVRA 5T1IA 3D31A 1ZKOA 1MSGA 2MHVA 1M4VA 2LFNA 1I4HA 4C56C 1IKMA 3MVVA 1SFOB 3BG3A 1FNWA 3PUXA 2PW7A 1HQRD 1PMRA 1L0YB 3J81L 5M3FB 1NSNS 1SYEA 1QILA 3CKIB 3G7LA 1OXXK 2AWNA 4KMUC 4BBRB 4XQNA 3MFGA 1IW7C 2ZXRA 4KY6A 2L5TA 2HCCA 1HRJA 1FD7D 3QG1A 2K28A 3J7AV 2I46A 5KNCA 1SNDA 5JPMC 5DAUA 4Y7NB 4A3JB 3FDTA 5C0XG 4F87A 1TWHB 1YNJD 1ENFA 3MTSA 4DAYA 2WIIB 1Z6HA 5CV9A 2SDFA 1ONLA 5J39A 4FO2A 3KLSA 2L1BA 3S2DB 4OO1G 3X3NA 1NUCA 2KQ3A 1JICA 3T4AC 1R9TB 4L63B 1EWHA 3Q23A 1PFNA 1YNND 2QILA 3FRPB 1ET6A 4LK1C 4QUCA 4XDXA 5JVG3 4DAPA 5TSSA 3PIO3 4KHVA 3BVMA 4ABNA 5JVH3 4RKBA 1ML0D 2KA7A 2Y0SB 1TU2B 1PRTD 4FXKC 3K5MA 4L8JA 4CKBA 2PW5A 4IUNA 1GUOA 2KECA 2BDOA 2K1BA 4CBVA 3SHLA 5D14A 3S1RB 5CV7A 3HZXA 2Z4IA 2YYZA 4RHRA 1O7ZA 2IX1A 3X3MA 1PZJD 4EQPA 1CHQD 1H9JA 2XIWA 3BDLA 2HUGA 3R2TA 3I73A 4HTHA 3NXWA 1GUWA 1Q3LA 4K14A 3NHHA 3RLFA 3PIP3 3PMFA 2K5DA 5C4JB 2QCPX 2MGSA 2G9DA 2D9UA 1RJTA 2NN6I 1F9SA 4K5WA 4ZUJA 3CHBD 1TWFB 3CRKC 2IT1A 1CZGA 3T56B 2NWGA 1R4QB 3OWFA 3Q0AA 5FOBB 5IODA 1CK1A 2X69A 2EOTA 5I9PA 2IPKD 1SNPA 4G7ZC 5FLXL 1ZYRD 5CMDA 1U9RA 5T1GA 2EYFA 1CQFA 2PZWA 4A3DB 3K58A 1WTWA 3CRLC 3GP7A 3S16B 1WD1A 1YNJC 2PO4A 3F2UA 4IUVA 3OIQA 3J80L 5F2DA 1CA5A 3U9SA 2F0UA 1TS5A 1F2YA 3MA2B 4V0BA 1YNNC 1OO9B 1PTOH 4ULLA 2NYZD 1TWCB 2FMCA 3CQZB 2R7ZB 5IGCA 1A3TA 2MUYA 3S2HB 2X6LA 1LT3D 1EYCA 5M5XB 4J1MA 4DK0A 1D5XC 5KIXA 5IGDA 1PRTC 1U4RA 2F0SA 1SMYD 3ND9A 5LHY1 2AUJD 5CORA 3H91A 3NBIA 1GXDC 3M4OB 3EJIA 2F0IA 1A15A 1WCMB 1C48A 1IHZA 1PFMA 4FF4A 3BS1A 4RFBA 2L55A 2A68D 2XWBB 1G6ZA 3OSOA 4C1NI 4KHZA 5JEAJ 3C46A 2L0CA 1MBYA 4IN3A 1I3QB 4U673 3GTJB 3SVMA 4BS9A 3T51B 2KCNA 1EY9A 2WP8J 5C0XI 2F0GA 2F0KA 4IUTA 1EYDA 3PUYA 3I4LA 1JE4A 4QMGA 4OO1I 4K2LA 2EY1A 1EY6A 3J81E 4QB4A 2E2DC 1F9PA 2PCFB 4O42A 3LX0A 4XYOA 3AMUA 3E0JA 2GA4B 3HKZB 1LTGD 1KABA 1LO5D 1ZYRC 5AFWA 2F0OA 1HPCA 1QWYA 1TY0A 3PUZA 5C3WA 1NCVA 1CHPD 2EYOA 5ELDA 3NK9A 5JPNC 1IKLA 1WTXA 1RTNA 2RDFA 3V2TA 5KYIA 2A6ED 1BBXC 2NVTB 2H1EA 3HOWB 1SJHD 1ILQA 1QNUA 3GTGB 2EXZA 2EPBA 5CV4A 5KNDA 5FKAC 1STYA 1X3PA 1PRTF 5FK9C 1HTPA 3HP3A 1TWAB 3SE0A 4OL7A 1WTVA 3C1EA 2LKVA 3N52A 4KK7A 3VA5A 2EVBA 3M3YB 3C2PA 2A68C 3IFTA 4I7ZC 3D3RA 3VR5A 5A2QL 3EFXD 3NUCA 3S17B 3MAQA 2A69D 1U4LA 2K6AA 1PTOB 1HUNA 4K8IA 1S5ED 3P1HA 2FINB 2RSNA 1V43A 2J0TD 4XT1B 3S14B 1LTSD 2NTTA 2WB1B 4LAAA 1I50B 1UEAB 1EIHA 1GHJA 4IQZA 2A74C 3T16A 3I91A 2SEBD 2B39A 3LWEA 2RVLA 5M5YB 4DGZA 3HOZB 5JOBA 3NTHA 2LS01 2KUMA 3AU7A 3MWYW 4C3HG 1QNKA 2ICEC 1IW7D 1TS3A 1CT1D 1XYIA 5C6AA 3WDNA 1EIGA 5J22A 2OXPA 4CHTB 1M8AA 5C4HA 2Q8TA 4UAIA 1F9RA 1Y8PB 1G8ZD 3H09A 5C3EB 1CTMA 5DEHA 3R3OA 1PFBA 1G2SA 4DF7A 1GUNA 1ZEQX 3GO5A 2F0MA 4NMZA 3BZDB 1LV9A 1X32A 1SDFA 1SE2A 3D4RA 4FP5D 3J80E 1GUGA 2ENBA 4RKLA 3K7AB 1SE4A 3J7YW 1QCBD 2WAQB 4XQJA 1OXVA 3HS0C 1ESFA 1ESRA 4CKCA 5IIFA 3K0YA 4K6LA 3QWNA 1ET9A 1EWCA 1TR5A 1TQOA 3MC0B 2EJFC 4WFN3 1HXYD 1XX8A 1HTLD 2A69C 4O1NA 4CKEA 1WTPA 2PMZB 1SXTA 3NTIA 2JE6I 2EYLA 4KTAA 4DU9A 5KYLA 1JWUD 1JQYD 1R4PB 5KGUA 3K59A 4OIJA 5LL6X 2B2UC 2BCOA 2BOSA 5E1FA 1EY5A 1OXSC 5E4WC 3OPOA 1AZPA 1SJED 4J8QA 5C4XB 2MJ8A 1SEBD 1ICWA 1GHKA 2RA4A 4EGVA 2NUCA 2E2HB 1BCPC 1QG7A 2F0FA 4XIGS 3LWUA 2B2TA 4KY7A 3QIAA 1I4XA 1Z47A 1S5BD 1A3VA 1JWSD 2JA7B 1NAPA 2OEOA 3QB3A 4G7HC 2B2UA 2K5QA 1F2MA 1Q90A 2F3VA 4IZ8A 4N9PA 2K33A 1T5EA 1DCZA 3HG9A 3OW7A 2E2JB 2XRQD 4BWGB 3R93A 1QOHA 1LABA 3EA6A 3VR2A 5EBCA 4K5XA 1PZID 2IX3A 3FMCA 4WJWA 5KEEA 2X6GA 3H6MA 1D6EC 3L3OC 1STGA 4ZLTF 4KD4A 2NBFA 2EY6A 4J6HA 2XN9C 5FO8B 2JA5B 4ZQ3A 3A8KE 1EFID 4H13C 4X3TA 1TWGB 1BQQT 3VA7A 4NKLA 3HRZC 2XNAC 1JORA 1DZ1A 2AWOA 2L9HA 5A2QE 1KDAA 5IGGA 1AN8A 3GV6A 2F0HA 1JOQA 4H7BA 1LTBD 1G291 4XQQA 1EEFD 1VF7A 4DNRB 3L7ZC 1LTRD 1GJXA 3A8JE 2BA1A 3A7LA 3E6ZX 1S5FD 2JYOA 4EQOA 3NP8A 2WKCA 3A54A 1KTKA 2SNSA 3OMCA 4C2MB 5CBEE 4ZUIA 2QEJC 2ZT9C 2O4XA 3EROA 1S5DD 1BCPF 1I6VC 3LNNA 2NB0A 5ELBA 1E0BA 5IT9L 4DAVA 4PQXA 4OGQC 2PYKA 3U9OA 5KRUA 3P20A 4ZRZA 5IGBA 1EU4A 1J8IA 1II3A 2RQXA 1KNAA 1KNEA 3AB9A 4U68A 1STNA 2B8GA 2E2IB 5I2XA 1PDQA 4LJZC 3TBIB 3HOUB 2EZVA 4E6IA 1FNVA 5M9OA 3KLSX 4A3BB 1O7YA 1EY4A 4ZKCB 4A93B 3M85A 3MFYA 2WINB 2IW3A 4UDUC 3QO2A 2O2LD 1WTOA 4RGOS 4G7OC 2A5HA 1XTCD 1F2ZA 1TT2A 1RHPA 2HDLA 4HEDA 1D1IA 5C0XJ 3PO2B 1T5XD 3MZ5A 2VUMB 2EY2A 2K04A 2WKDA 2XVSA 3MEHA 2H4OA 3HOYB 1DOMA 1SAPA 1SYDA 2EDGA 4FVMA 4Q0FA 5C5MA 1DOLA 2F0DA 1EYAA 3SK8A 3S1NB 3DMUA 3K6OA 2RDHA 1SE3A 2DNCA 3TP8A 1LT5D 4C3HB 2D5DA 5FO9B 2Z4HA 2M2LA 3QOLA 5CGKA 4DXGA 5EKKA 5A35A 4NP5A 3RUZA 1HHVA 2WV6D 2JA8B 5E4XA 4QCLA 1V1PA 3ND8A 4BA1I 1I4GA 1Q12A 3GQBA 2R3ZA 1EU3A 1UNSA 1JCKB 1G2TA 3DHQA 1L0XB 1CA6A 3MXGA 4DFAA 3OWEB 1H9SA 1CQVA 2J4XA 4C3IB 3VR4A 2NZ1D 2B2VC 3R2IA 3RZOB 2F0PA 1FGBD 5E3FA 4TSSA 1RTOA 1PRTB 1PLFA 3DM1A 2ID0A 3QJYA 4X3KA 1HCZA 1TY2A 3HGBA 4HCEA 2QKIC 4P2CB 1NR2A 3GTPB 5K36G 4OIKA 1I4RA 2VNUD 1VDZA 1RCVD 2F0EA 3KK7A 2TSSA 3NE5B 1QB5D 5EJWA 2F0QA 2IWHA 1LTTD 1H9KA 4FXGC 2B2VA 5M5WB 4IUQA 1HA6A 2JXMB 4FF2A 1Y8OB 3KF8A 4K8JA 3MHBA 5HURA 4V190 3CU7A 3BYYB 1SNCA 3FKIB 2L11A 4ME5A 1X3QA 1VMPA 4H0LC 2KHSA 3TP5A 5I2YA 5ELCA 3Q6SA 4CJ0B 1EQVA 4ZK9B 1D2BA 4KI0A 2XRSD 3PUVA 2F4IA 2AUKA 4HSVA 1KAAA 1EZ6A 4G4KA 4RWSC 3VR6A 4FF3A 1I4QA 2CW0D 4K2KA 1STHA 2FJ2A 3NBHA 3I72A 5DNFA 4EVOA 4XTCS 1RD9D 1EY8A 1JR0D 2IJ0A 5C3XA 3D6CA 1JC7A 3VYRA 1SYCA 3NWSA 5I6WA 1GUSA 3Q24A 3IAYA 1B2TA 4HMJA 3WOEA 5HGTA 3KLRA 4IFDH 2ICIA 1SYGA 2EYPA 1SSOA 3C1FA 3DWQA 1SNMA 1VCIA 5EPJA 1CI3M 4JK1C 2G9HD 3M7GA 1JOOA 1MI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A2U A;  4NDX A;  4K14 A;  3D4W A;  4B9X A;  1EZ8 A;  2EY5 A;  3NHH A;  2EXZ A;  3PMF A;  3MZ5 A;  5CV4 A;  5IGE A;  1SND A;  3MXP A;  3OSO A;  2EY2 A;  3TP6 A;  5C5L A;  2EYJ A;  4N9T A;  1KDA A;  3MEH A;  5IGG A;  2PZU A;  2QDB A;  5DEH A;  1STY A;  4ODG A;  3R3O A;  2F0L A;  4K8J A;  2F0H A;  3MHB A;  5DAU A;  1SYD A;  4H7B A;  4DF7 A;  5HUR A;  5EKL A;  3P75 A;  2F3W A;  5CV5 A;  2F0M A;  3D8G A;  5C5M A;  5CC4 A;  4NMZ A;  2F0D A;  3E5S A;  4WRD A;  1EYA A;  3SK8 A;  5CV8 A;  2NUC A;  4K5W A;  3ERQ A;  3SK5 A;  4ZUJ A;  3DMU A;  4YIJ A;  1SNC A;  3S9W A;  1EY9 A;  3BDC A;  2EYH A;  2F0F A;  3C1E A;  2ENB A;  1IHZ A;  2LKV A;  4KY5 A;  4OL7 A;  4RKL A;  3TP8 A;  1RKN A;  2SOB A;  4ME5 A;  2F0V A;  4MIU A;  3OWF A;  5C4Z A;  1EY7 A;  2F0G A;  2PZT A;  4KY7 A;  2F0K A;  3VA5 A;  1A3U A;  1EYD A;  4QF4 A;  3NP8 A;  5CV9 A;  4EQO A;  5J39 A;  5IOD A;  2KHS A;  1A3V A;  2F0T A;  3TP5 A;  4PMB A;  2SNS A;  3OMC A;  3SR1 A;  5I9P A;  5C4H A;  5IGC A;  4IAL A;  1EY0 A;  4ZUI A;  5EGT A;  1SNP A;  1NUC A;  3QOL A;  4K5V A;  5CGK A;  2RKS A;  1EQV A;  5J1Z A;  2KQ3 A;  5I6Y A;  4QMG A;  1U9R A;  2WAC A;  2EYF A;  2OEO A;  5EKK A;  5IIF A;  2O4X A;  2PZW A;  4NP5 A;  3RUZ A;  3QB3 A;  3NUC A;  1SYF A;  3ERO A;  1SYB A;  2PQE A;  2EY1 A;  4K2L A;  1F2M A;  1KDB A;  1ENC A;  2F3V A;  4IZ8 A;  4G57 A;  1EY6 A;  4N9P A;  4TRD A;  4B9W A;  5JAV A;  4QB4 A;  3SXH A;  3ITP A;  2PYK A;  3U9O A;  5KRU A;  4K8I A;  1TR5 A;  5CV6 A;  3LX0 A;  1JOQ A;  1TQO A;  3P1H A;  5IGB A;  4F8M A;  4KHV A;  1KAA A;  1EZ6 A;  4K5X A;  3NQT A;  2EYM A;  3DHQ A;  2SNM A;  5F2D A;  2M00 A;  4R8N A;  4RKB A;  5IGF A;  1II3 A;  5NUC A;  4PNY A;  4DFA A;  4HMI A;  4K6D A;  2F0U A;  1KAB A;  2F0P A;  5KEE A;  4K2K A;  4LAA A;  1STH A;  1SNQ A;  5K5P A;  1F2Y A;  1STN A;  5CR3 A;  2F0O A;  3H6M A;  4EVO A;  2F0N A;  1STB A;  5E3F A;  4S3S A;  3T16 A;  1EY8 A;  4HTH A;  1STG A;  4ID6 A;  2F0J A;  2PW5 A;  3QOJ A;  4IUN A;  4KJO A;  4E6I A;  4EQN A;  3D6C A;  5C3W A;  5C3X A;  3MVV A;  1AEX A;  4KD3 A;  2EYL A;  4KJN A;  5M9O A;  3D4D A;  1SYC A;  1SNO A;  2EYO A;  2PW7 A;  4KTA A;  3NK9 A;  4PMC A;  3SHL A;  4F7X A;  1EY4 A;  4DU9 A;  5I6W A;  4KD4 A;  4WOR A;  3SK6 A;  4I65 A;  5KYL A;  4DGZ A;  5CV7 A;  1NSN S;  2EY6 A;  3OMG A;  3TME A;  3HZX A;  1A3T A;  4HMJ A;  1KDC A;  5I9O A;  1SYE A;  2RDF A;  1STA A;  3V2T A;  5JOB A;  4J6H A;  5HGT A;  3SK4 A;  5KYI A;  1EYC A;  1A2T A;  1JOK A;  3TP7 A;  1ENA A;  2F0W A;  4J1M A;  1SYG A;  5KIX A;  2F0E A;  2EYP A;  4ZQ3 A;  5KGU A;  3T13 A;  5IGD A;  2F0S A;  4KV6 A;  4EQP A;  3C1F A;  3EVQ A;  4NKL A;  5IOC A;  1F2Z A;  1SNM A;  1TT2 A;  4KY6 A;  3BDL A;  2RBM A;  3EJI A;  2OF1 A;  3HEJ A;  5C6A A;  5J22 A;  2F0I A;  1EY5 A;  5E1F A;  2OXP A;  2F0Q A;  1JOR A;  1JOO A;  3NXW A;  2HQE A;  5ISR A; 
#chains in the Genus database with same CATH topology
 1WTH A;  1EZ8 A;  3T1H L;  2BDN A;  1LTI D;  2L4N A;  5BN5 A;  2A8V A;  1O78 A;  1C8C A;  5EPL A;  2LXK A;  4ODG A;  5IT9 E;  1HQM C;  2AKW B;  4DV2 L;  5EPK A;  3ER0 A;  2Z1C A;  3T1H Q;  4A3K B;  1IYV A;  4A3E B;  3DUZ A;  3VYT A;  3S9W A;  5IYD G;  1BCP D;  4KY5 A;  4UY8 C;  1W6J A;  1Y1V G;  5J3B A;  2QF7 A;  2ZTD A;  3TZD A;  1B44 D;  4PZ7 A;  2JA8 G;  1LT6 D;  3UDG A;  1A0I A;  1EFW A;  3GTL H;  1EY0 A;  1IBM Q;  3HOV G;  5I6Y A;  2R92 H;  3Q8D A;  4DR2 L;  1IYJ B;  1VQG A;  3RZD H;  4ILW A;  1UE1 A;  3MXN A;  5K36 H;  1OXU A;  1DGS A;  4C3I G;  1K8G A;  2DN8 A;  4JI6 Q;  2LY7 A;  1Z7T A;  3NPP A;  3GTK B;  1EL0 A;  4CDD C;  3MXN B;  1XMQ L;  4KKS A;  4R8N A;  3J81 i;  2VZA A;  3J81 j;  2DY8 A;  4HMI A;  2D62 A;  5GAH C;  3I4N G;  2YTV A;  4R4O A;  2VB2 X;  1XMQ Q;  3W2D A;  3QOJ A;  1VQA A;  1Y1W G;  3DWA A;  4KD3 A;  3CME A;  1SNO A;  3K57 A;  1VF5 C;  5DLQ E;  4JVZ A;  2B63 B;  4A3I H;  4LF8 L;  4FXD A;  2I0Q A;  4WOR A;  3SEB A;  1QE6 A;  2AQ2 B;  4H44 C;  3W3A A;  2JJQ A;  2A73 B;  2VQE L;  4JW0 A;  1VQM A;  4KN4 C;  3S1Q B;  1BVS A;  1BR9 A;  1A2T A;  1TKW B;  1CKN A;  4H02 A;  2CW0 C;  2M9V A;  3I4M H;  3U4Z A;  2GVB A;  1KL9 A;  2K7V A;  4DPG A;  2YU9 H;  1D5Z C;  4BY7 H;  1K8O A;  5IYB G;  5IOC A;  2NVQ B;  3OIP A;  2K03 A;  3C3L A;  3HEJ A;  1EQT A;  3N6R A;  2VQE Q;  2O5I C;  5H1S E;  2IY5 B;  2GVA A;  2B2T C;  1Q8I A;  3J7Z C;  3H0G G;  2QDB A;  3K5L A;  3FKI G;  4IPD A;  3KBG A;  1O7L A;  2I5M X;  1MGS A;  4B08 A;  2Q8I B;  1BOS A;  5IE8 A;  1I94 Q;  5HGQ A;  5M3M B;  3KJP A;  4YIJ A;  4GKJ L;  4M8A A;  4DK6 C;  4POG A;  4QUF A;  1BXT A;  5IP7 H;  2HT1 A;  1TVX A;  1JWM D;  3W5O A;  2F0V A;  1A6X A;  1I6H H;  1NR4 A;  4GNX C;  1A3U A;  4QF4 A;  4YY3 L;  2B8F A;  3NSW A;  4R9W A;  3DWP A;  1B4O A;  1YI2 A;  1XPU A;  4IAL A;  4HCS A;  4IOC A;  1LT4 D;  4GKJ Q;  4KKT A;  3D6W A;  4UP7 A;  4RA8 A;  2ZXP A;  2D2C C;  1PH9 A;  1BUV T;  1H9M A;  1SYF A;  1IL8 A;  4GN5 A;  3GTO H;  1YIJ A;  4YHH L;  1N34 Q;  4WJ3 M;  3HOX B;  5CV6 A;  3FEW X;  1E2V A;  1IYU A;  1L1O C;  3TZU A;  1ILP A;  4FYD A;  4F8M A;  4A3G G;  3CCR A;  1LLR D;  2ES2 A;  2JEB I;  1TS4 A;  4RGT A;  4JI5 Q;  4B3R L;  3ONA B;  2O5J C;  1C0A A;  1Y8N B;  1SNQ A;  5CR3 A;  1DXM A;  4IPH A;  1AH9 A;  2MPM A;  4P73 A;  1QZG A;  2L15 A;  3DXJ C;  2HIV A;  4NW2 A;  3KUP A;  5CBA E;  5K5P A;  4GNX A;  3JAM c;  4LF7 L;  1BKB A;  3DEP A;  1Y69 U;  1MJC A;  2LMC B;  3UE0 A;  2R93 G;  1J9O A;  1Q8K A;  4GNX B;  1XJV A;  4XXE A;  3CC7 A;  3SK4 A;  3IL8 A;  1G91 A;  4LF7 Q;  5D3I B;  2K5V A;  1Y1V H;  1B50 A;  1WTR A;  4LF6 Q;  2MP1 A;  3V96 A;  5C44 H;  1L1O A;  4DV3 L;  2XWJ B;  3HOV H;  2R7D A;  5DM6 3;  1BCP B;  4IUP A;  3DEO A;  4OHJ A;  4C3J G;  5IGE A;  2PQA B;  4X62 Q;  1B9M A;  5I4D A;  3GTL B;  4A3E G;  4BBS G;  1BF4 A;  1PHJ A;  4KKU A;  4B3M L;  1HFN A;  4A3F G;  2R61 A;  1JB3 A;  4F88 A;  5FJ8 G;  2R92 B;  5IY0 A;  2F3W A;  2HCI A;  4HIM A;  3D8G A;  2CH4 W;  3DM3 A;  2NVX H;  2F4V Q;  1GO3 E;  3TS2 A;  1K83 H;  1A62 A;  3FPU B;  3RZD B;  3ERQ A;  3BDC A;  2EYH A;  3ULJ A;  4AYB E;  2ZTE A;  4L5Q A;  1RKN A;  5JEA G;  1AW7 A;  1S3O A;  5C4Z A;  3KYH C;  2KED A;  4PZ6 A;  1CZW A;  3CC4 A;  4JC0 A;  2QW7 A;  3SR1 A;  3J80 i;  2RF4 A;  2KCC A;  2DGY A;  3I4N H;  2RKS A;  2VXW A;  2BH8 A;  2WAC A;  2N8N A;  1Y1W H;  3OYY A;  2N55 A;  2H5X A;  1KDB A;  1ENC A;  4RG1 A;  2K32 A;  2PNR C;  3T53 B;  2NN6 H;  1JJC B;  3J81 c;  2OTJ A;  1VQ5 A;  2CWA A;  3D0F A;  4DV0 L;  3S1M H;  1V1O A;  4A3I B;  1KLU D;  1QVG A;  2AMC B;  3KFU A;  3A7A B;  2F03 A;  4JI7 Q;  3BJU A;  3GTM H;  2M00 A;  1OTC A;  5LMU Q;  5NUC A;  1ROD A;  2Z6K C;  1E3P A;  1HNW L;  3I4M B;  1WVL A;  2YU9 B;  2CQA A;  3MXU A;  4BY7 B;  4RAU C;  1Q1E A;  1FYC A;  1JB7 A;  2IL8 A;  1E2Z A;  5G3L D;  3URY A;  4ID6 A;  3K5O A;  1BNZ A;  4FF1 A;  3H0G H;  4RGN A;  3VYS A;  3NTK A;  2DY7 A;  4IUR A;  4KJN A;  1YHB A;  5D3D A;  1ZXT A;  1U4P A;  3SK6 A;  4KN7 C;  4QIW E;  3IFD A;  1STA A;  3H94 A;  1JOK A;  3TP7 A;  2V4D A;  1HA5 A;  3WOF A;  5EAY A;  2B2Y C;  3TQY A;  4B3T Q;  3AQQ A;  1N8R C;  2CHB D;  2OF1 A;  2OT2 A;  3OHX C;  1I6H B;  3UE1 A;  3PO3 G;  2HQE A;  5ISR A;  4NDX A;  5D65 A;  3S24 A;  1NMF A;  3GTG H;  4BY1 G;  3MXP A;  4HJ8 A;  2R6G A;  1PXU A;  2Z6K A;  2G5D A;  4LMQ D;  1L2F A;  2C9O A;  4N9T A;  1MD2 D;  4ZAI A;  5ELF A;  3P7J A;  1B3A A;  1K8M A;  1P8L A;  5CV5 A;  1TII D;  3GTO B;  2AQ1 B;  3S15 H;  3A5U A;  1TWA H;  4LF4 L;  4A3G H;  1XWE A;  3PQI A;  5FO7 B;  3KBX A;  4A3M H;  1EY7 A;  3A8I E;  1VQF A;  2F0T A;  2OCE A;  1W6K A;  2E75 C;  3CCL A;  1HFG A;  4HAE A;  1V8Q A;  1CM9 A;  2B2Y A;  1I4P A;  3I70 A;  3IRB A;  3FVQ A;  1LTA D;  1EIY B;  1PTO D;  3FP9 A;  4JI2 Q;  3JAM E;  5M3F G;  1XMO L;  4LFA Q;  4TRD A;  2E76 C;  4ZKB B;  4OEL B;  2R93 H;  5JAV A;  4A3L H;  4HSP A;  2IX0 A;  3BYT B;  1H9R A;  2UXB L;  4IFD G;  4BBR G;  1WD0 A;  2N3S A;  1FGU A;  3IKJ A;  3NQT A;  2SNM A;  4HR7 B;  1MHW C;  4NB3 A;  1B1Z A;  1XMO Q;  5C0X H;  1DOK A;  1VQ7 A;  4PNY A;  4R4T A;  1Y1V B;  2UXC Q;  1W2B A;  1GOZ A;  5C44 B;  3I4O A;  4C3J H;  4OO1 H;  2JSO A;  4BBS H;  4EQN A;  4RCN A;  3CCM A;  3T1Y Q;  1D5M C;  3HOV B;  4A3F H;  5FJ8 H;  2ZJP A;  2BE5 D;  4MN3 A;  1G51 A;  1V1P B;  2PNH A;  3OMG A;  3TME A;  3HOZ H;  2NVY H;  2XGT A;  1UAP A;  4X64 L;  4LF9 L;  3TDQ A;  1PH1 A;  1EOT A;  3I3C A;  5JEA H;  2NVX B;  1K83 B;  1DON A;  4KV6 A;  1VQ4 A;  1NE3 A;  2A6H D;  2KBN A;  3EVQ A;  1D1K A;  2VQF Q;  1Q7Y C;  1AP0 A;  4LFB Q;  1H9S B;  2Y0S E;  1EUJ A;  3TN2 A;  2R92 G;  1TS2 A;  4LF9 Q;  3BVZ A;  4B9X A;  5FLX c;  2FMM A;  4IUU A;  5C5L A;  3I4N B;  3GD7 A;  2PZU A;  4DNI A;  2F0L A;  3PV0 A;  1Y1W B;  3BU2 A;  5BN3 A;  1GM5 A;  4CGY B;  2K01 A;  2NTS A;  1SE8 A;  2F52 A;  4WRD A;  1XXG A;  3SDZ A;  1DJR D;  2C5C A;  3S1M B;  3J80 c;  4ZYS A;  1JJG A;  3M4P A;  4FDB A;  3K81 C;  2RHQ B;  3R8B A;  4HN7 A;  5EKI A;  3GTM B;  4JI4 L;  1O80 A;  4X3S A;  1PH8 A;  4BXX G;  3NEL A;  4JI3 Q;  2N88 A;  4K5V A;  3I2Z A;  4GS3 A;  4R8I A;  4L5S A;  1IXR A;  1SYB A;  1BO0 A;  3UI2 A;  4JI0 Q;  3RNU A;  4DXF A;  3H0G B;  3KF8 B;  1HUM A;  1U5K A;  1S4Z A;  3A74 A;  3O13 A;  2P5Z X;  4C1N K;  4LWC A;  4CJ2 C;  4DK1 A;  1SRO A;  1B9N A;  4IO9 A;  4Y52 H;  5EQ0 A;  5IGF A;  4K6D A;  3EQL C;  3E0E A;  4GKK L;  4X3U A;  4HJ5 A;  4DR6 L;  3PO3 H;  2EJG C;  1PTO C;  4X6A H;  1STE A;  1B70 B;  4DKA C;  2DJF C;  1FL0 A;  1AFP A;  4S3S A;  4BY1 H;  4LUZ A;  3Q22 A;  1B53 A;  1AZQ A;  2F0J A;  2BA0 A;  2FHT A;  4MTN A;  5COY A;  2JA6 H;  3D4D A;  4F7X A;  2K14 A;  4PMC A;  4MTK A;  5GAG C;  4GKK Q;  1F9Q A;  1N36 L;  4I65 A;  4AIM A;  2KCT A;  4DR7 L;  4RHS A;  3TRZ A;  4DN4 M;  5IP7 G;  1GVP A;  1CKM A;  1VQC A;  3CXC A;  1PH4 A;  1ENA A;  1EEI D;  1Y14 B;  2F0W A;  2PI2 A;  5JJZ A;  1Q1B A;  1MSH A;  2EXD A;  3VR3 A;  3S15 B;  1MJE A;  1SMY C;  4A3G B;  2K05 A;  1LAC A;  3VYU A;  1SRU A;  2I07 B;  3V05 A;  3G6J B;  2CQO A;  4B3S Q;  4DV4 Q;  4A3M B;  3NBH B;  1SFO H;  3D4W A;  4JBW A;  4QJF A;  4DV5 L;  2BE5 C;  4A3D G;  3NEN A;  1KQS A;  1RDP D;  5HY6 A;  3JC6 6;  2JP1 A;  4IFD J;  4TQU S;  3TP6 A;  5M3F H;  1XNQ L;  2EYJ A;  4XYQ A;  4LW1 A;  3ZYY X;  4JI1 Q;  2JEA I;  3RD4 A;  1YJW A;  3NQI A;  2RSO A;  3G6E A;  1GUT A;  4P72 A;  5EKL A;  4BBR H;  5CC4 A;  1PYW D;  3GV3 A;  3E5S A;  5LL6 S;  4PV1 C;  4RGM A;  2R93 B;  5CV8 A;  2A6H C;  5G3L F;  5DM7 3;  4X65 L;  2MNA A;  5BN4 A;  1E2W A;  1JJ2 A;  1OXT A;  4MIU A;  2UU9 Q;  2PZT A;  4PMW A;  3DLL A;  3I8Z A;  4RCO A;  1PZK D;  3I90 A;  3OTO Q;  1B7Y B;  4R4I A;  2EJM A;  2B2W C;  4RH6 A;  2OTL A;  5EGT A;  1U4M A;  2Z8L A;  1ICF B;  1IBK Q;  4BA2 I;  2IHF A;  4Y7N H;  4A3J H;  5ELE A;  2PQE A;  2R7Z G;  4C3J B;  4G57 A;  4BBS B;  1EIF A;  3SXH A;  4A3F B;  1NY4 A;  1FR3 A;  1N9W A;  2VB3 X;  1TWH H;  2I5L X;  2AQ3 B;  3KF6 A;  4DV2 Q;  1EQQ A;  4IFD I;  2I5H A;  2NVY B;  3PGZ A;  2KJX A;  1DD2 A;  5C44 G;  1DM0 B;  4L6T B;  3S2D H;  4DR1 L;  4HIO A;  3NWT A;  2J7Z A;  4DA2 A;  2DNE A;  1J5E L;  1R9T H;  3B6Y A;  2F0N A;  1STB A;  2LSS A;  1KLG D;  3TSS A;  2RDG A;  1D7Q A;  3W1B A;  1QUQ A;  2KOL A;  1S5C D;  4KJO A;  4A4I A;  5FLX E;  2DUD A;  1AEX A;  1HNX L;  3FPP A;  3M7N A;  1KC8 C;  4JG2 A;  2KVM A;  1C4Q A;  5IWA L;  2B2W A;  2EE1 A;  4Z9C B;  3BDO A;  3CPF A;  1J5E Q;  4DR2 Q;  4M1U B;  5I9O A;  1KDC A;  1S72 A;  3J7A F;  4OX9 L;  1YVC A;  4AYB B;  3OW2 A;  1PTO F;  2Z6B A;  3T13 A;  2A6E C;  2PPB C;  2F1M A;  2TMP A;  3HKZ E;  1VMC A;  4DNT B;  4IJL A;  2RBM A;  1QJO A;  1G6P A;  4BXX H;  1UUP A;  1ASY A;  1A2U A;  2EY5 A;  3JAM L;  1DYQ A;  2HIX A;  4FNF A;  2FXQ A;  3S1R H;  2DJG C;  2FFK B;  4Q5V A;  1F77 A;  3GTQ B;  5IYC G;  2NN6 G;  4EX5 A;  2Z9H A;  4TKO B;  3A55 A;  1RF2 D;  3P75 A;  2K5W A;  4YWK A;  3RMH A;  1BDO A;  3A56 A;  1RL2 A;  3CC2 A;  1MKH A;  3SK5 A;  3HKZ G;  4LF8 Q;  3W1G A;  3F2D A;  1FNU A;  5KNB A;  1CKN B;  2SOB A;  3OOC A;  2ZXO A;  1YZ6 A;  3M4Y A;  2K5N A;  3L9A X;  1F2L A;  4PMB A;  5CYU A;  4CDC C;  1T9H A;  2HDM A;  5J1Z A;  5C4J H;  3PUW A;  3PO3 B;  5EBD A;  4CJ1 B;  1WTQ A;  4BY1 B;  3K5N A;  4B9W A;  2Q8R E;  4QIW B;  1L0W A;  1TWF H;  3ITP A;  2JA6 B;  3H3V C;  1LUZ A;  1VQ6 A;  1K9M C;  3ERS X;  4XT3 B;  3KOJ A;  2KEE A;  4MHE A;  1CFM A;  2EYM A;  2PI2 E;  2L12 A;  2XSC A;  2E74 C;  3BVG A;  1SBB B;  4GZY C;  2CVR A;  5T1I A;  3D31 A;  1ZKO A;  2QDL A;  4JV5 L;  1MSG A;  4TVA B;  2MHV A;  4A3D H;  1M4V A;  4YY3 Q;  2LFN A;  1RIP A;  1I4H A;  2ALY B;  4C56 C;  1IKM A;  1YNX A;  1KHI A;  3MVV A;  1SFO B;  3BG3 A;  2ATW A;  1FVI A;  1FNW A;  3PUX A;  2PW7 A;  3S16 H;  1HQR D;  1PMR A;  4DR5 L;  1L0Y B;  3J81 L;  3F2C A;  5M3F B;  1NSN S;  4GN3 B;  1SYE A;  1QIL A;  3CKI B;  3G7L A;  1NBW A;  1OXX K;  2AWN A;  4UHV A;  4A3M G;  3F8T A;  4KMU C;  3H15 A;  4I7A A;  1EOV A;  4YHH Q;  1TXY A;  4BBR B;  1IL2 A;  4YWL A;  4XQN A;  3MFG A;  1IW7 C;  2ZXR A;  1YBY A;  3RLO A;  4KY6 A;  2L5T A;  1PV4 A;  1UWV A;  1K3B C;  2HCC A;  1HRJ A;  2CH4 A;  1FD7 D;  2WB1 E;  4N8F A;  3QG1 A;  1PYB A;  2K28 A;  4B3R Q;  3PO2 H;  5ELN A;  3J7A V;  2I46 A;  1TWC H;  5KNC A;  1SND A;  4NXM L;  3EBE A;  3CQZ H;  2ZTC A;  3FHW A;  2R7Z H;  4A3L G;  5ELO A;  3S2H H;  5JPM C;  5DAU A;  4Y7N B;  4A3J B;  5M5X H;  1N32 L;  3FDT A;  3J7A 5;  2E5L L;  4APV A;  5C0X G;  2UUA L;  3S1N H;  4GLA C;  4F87 A;  3M4O H;  1JT8 A;  1B8A A;  1TWH B;  1YNJ D;  5GQO A;  1WCM H;  1ENF A;  3MTS A;  4UP9 A;  4DAY A;  2WII B;  1Z6H A;  5CV9 A;  2SDF A;  1ONL A;  4R1J A;  4FO2 A;  5J39 A;  3KLS A;  1VQD A;  1X56 A;  1L1O B;  2L1B A;  3S2D B;  4OO1 G;  1LTL A;  3X3N A;  1NUC A;  4R4C A;  2KQ3 A;  1QVC A;  1JIC A;  4DV3 Q;  2ZJQ A;  3T4A C;  1I3Q H;  1R9T B;  4L63 B;  1EWH A;  3Q23 A;  1PFN A;  1YNN D;  3GTJ H;  3HOZ G;  2QIL A;  3FRP B;  1ET6 A;  4LK1 C;  4QUC A;  3ULP A;  4B3M Q;  4XDX A;  5JVG 3;  4DAP A;  5TSS A;  3PIO 3;  4KHV A;  3BVM A;  1VQL A;  4ABN A;  5JVH 3;  1UEB A;  1ML0 D;  4RKB A;  1HZA A;  2R7F A;  2KA7 A;  4GLV B;  2RCF A;  2Y0S B;  1TU2 B;  3CP0 A;  1PRT D;  2WAQ E;  1IBL L;  4FXK C;  3K5M A;  4L8J A;  4CKB A;  5GAD C;  5C3E G;  1X3E A;  2K5H A;  2PW5 A;  4IUN A;  3U50 C;  1YHQ A;  5IYC H;  1GUO A;  2KEC A;  2BDO A;  1U0L A;  4AYB G;  2K1B A;  4CBV A;  4O0A A;  3SHL A;  1KAW A;  5D14 A;  3S1R B;  2UUC L;  5CV7 A;  3HZX A;  2JK8 A;  2Z4I A;  2YYZ A;  4RHR A;  1O7Z A;  1X9N A;  2LXJ A;  2K50 A;  2IX1 A;  3X3M A;  1PZJ D;  4IPG A;  4DV0 Q;  2Q2I A;  4EQP A;  1CHQ D;  2VW9 A;  1VQK A;  2UUC Q;  1H9J A;  2XIW A;  3BDL A;  2HUG A;  3R2T A;  3I73 A;  3NXW A;  4HTH A;  4CDE C;  1GUW A;  1Q3L A;  4K14 A;  4JBM A;  1E24 A;  1HZC A;  3NHH A;  3RLF A;  3PIP 3;  3PMF A;  1HNW Q;  2K5D A;  2PMZ E;  1PH5 A;  5C4J B;  4DUY L;  4DAM A;  2QCP X;  2MGS A;  2V1C C;  2G9D A;  2D9U A;  1RJT A;  2NN6 I;  3CD6 A;  1F9S A;  1J6Q A;  4K5W A;  4ZUJ A;  3CHB D;  1TWF B;  2NVT H;  3CRK C;  2IT1 A;  3HOW H;  1CZG A;  3T56 B;  2NWG A;  1R4Q B;  4DUY Q;  3OWF A;  3Q0A A;  5FOB B;  4A3C H;  1VQE A;  4QQB X;  5IOD A;  1CK1 A;  2X69 A;  2EOT A;  5I9P A;  3RR5 A;  2IPK D;  2QA4 A;  3F2B A;  1SNP A;  1V1Q A;  4G7Z C;  1GD7 A;  5FLX L;  1ZYR D;  5CMD A;  1U9R A;  5T1G A;  2JA6 G;  2EYF A;  4NXN L;  1CQF A;  2PZW A;  4A3D B;  1X55 A;  3K58 A;  4ALP A;  3ICE A;  4JYA L;  1WTW A;  3CRL C;  3GP7 A;  2NZO A;  3S16 B;  1WD1 A;  1YNJ C;  2PO4 A;  3F2U A;  1K3R A;  4IUV A;  4NXN Q;  3OIQ A;  3J80 L;  5F2D A;  1CA5 A;  3U9S A;  3M3Y H;  4A76 A;  4LF4 Q;  2F0U A;  4QGU A;  1TS5 A;  3CCU A;  1F2Y A;  3MA2 B;  4V0B A;  1YNN C;  3S17 H;  4UP8 A;  3HFZ B;  5C4X G;  1M1K C;  3CCQ A;  1OO9 B;  1PTO H;  4ULL A;  2NYZ D;  2KCM A;  1TWC B;  2AHO B;  2FMC A;  3CQZ B;  4KLK A;  5BR8 L;  2JA9 A;  2R7Z B;  5IGC A;  1A3T A;  2MUY A;  3S2H B;  2X6L A;  2MO1 A;  1LT3 D;  1EYC A;  5M5X B;  1KRS A;  3S14 H;  4J1M A;  4DK0 A;  1D5X C;  4POF A;  5KIX A;  2UXB Q;  1PRT C;  1I50 H;  1U4R A;  2F0S A;  3ND9 A;  1SMX A;  1SMY D;  4JBJ A;  4OWX B;  5IGD A;  5LHY 1;  2AUJ D;  5COR A;  3H91 A;  3NBI A;  1GXD C;  3M4O B;  2HQL A;  5LMN L;  3EJI A;  2JA7 G;  2F0I A;  1A15 A;  5AJ3 L;  1WCM B;  1C48 A;  1IHZ A;  1PFM A;  4FF4 A;  3BS1 A;  4A3J G;  2N78 A;  4RFB A;  3K80 C;  1WFQ A;  2L55 A;  2A68 D;  2XWB B;  1G6Z A;  3OSO A;  4C1N I;  4KHZ A;  5JEA J;  5M5Y H;  1PH6 A;  4GLX A;  3C46 A;  2L0C A;  1MBY A;  4IN3 A;  1I3Q B;  4U67 3;  3GTJ B;  3SVM A;  5IT9 c;  1N33 L;  2E8G A;  4BS9 A;  2UXD L;  3T51 B;  2KCN A;  1EY9 A;  2WP8 J;  5C0X I;  2F0G A;  4OEM B;  4X64 Q;  2F0K A;  4IUT A;  1EYD A;  3E9I A;  1N33 Q;  2MO0 A;  3PUY A;  3I4L A;  5C3E H;  2JN4 A;  1JE4 A;  4DR3 L;  3KDF A;  4QMG A;  1UE5 A;  4OO1 I;  2A1A A;  4K2L A;  2EY1 A;  4HJ9 A;  3GDE A;  1EY6 A;  3J81 E;  2YV5 A;  4QB4 A;  1LYL A;  2E2D C;  1F9P A;  2PCF B;  2Y0S G;  3LX0 A;  4O42 A;  1K73 C;  4XYO A;  4DR3 Q;  3AMU A;  3E0J A;  3K7A H;  2GA4 B;  3HKZ B;  1LTG D;  1ASZ A;  1WI5 A;  1KAB A;  1LO5 D;  2D0P A;  4LUV A;  1ZYR C;  5AFW A;  2F0O A;  5FLM H;  1HPC A;  1QWY A;  4JI4 Q;  1TY0 A;  1XTD A;  3PUZ A;  4DK3 C;  5C3W A;  1NCV A;  3CAM A;  4AQY L;  1CHP D;  1CUK A;  3TS0 A;  2EYO A;  5ELD A;  3NK9 A;  5JPN C;  1IKL A;  1WTX A;  1PA6 A;  1KIX A;  3NEM A;  1RTN A;  2RDF A;  3V2T A;  3UDF A;  5KYI A;  1CSP A;  1HR0 W;  4AQY Q;  5IP9 G;  2QGQ A;  2A6E D;  4GOP A;  3K8A A;  1WYD A;  4JPB W;  1WOC A;  1BBX C;  2NVT B;  4J15 A;  2H1E A;  4P75 A;  3HOW B;  1SJH D;  4OWW B;  3CCS A;  1ILQ A;  1VQH A;  1Q86 C;  4HIK A;  1QNU A;  3GTG B;  2EXZ A;  2EPB A;  5CV4 A;  4DR6 Q;  1NNX A;  5KND A;  5FKA C;  1STY A;  4R4Q A;  1X3P A;  1PRT F;  1D8L A;  5FK9 C;  4DV7 L;  4JI8 L;  1HTP A;  3HP3 A;  1TWA B;  1N36 Q;  3SE0 A;  4OL7 A;  1WTV A;  3C1E A;  2LKV A;  4DR7 Q;  3N52 A;  4PZ8 A;  4KK7 A;  2GN5 A;  3VA5 A;  2EVB A;  3AFQ A;  3M3Y B;  3C2P A;  4JI8 Q;  2A68 C;  3IFT A;  3HOU G;  3BZK A;  1UE6 A;  4I7Z C;  5LMN W;  1PH2 A;  3D3R A;  3VR5 A;  5C4X H;  5A2Q L;  3EFX D;  1Q82 C;  3NUC A;  3S17 B;  3MAQ A;  2A69 D;  4L5R C;  1U4L A;  4DV5 Q;  2K6A A;  2E2H H;  1PTO B;  1XNQ Q;  1HUN A;  4K8I A;  4WJ4 A;  1S5E D;  3P1H A;  3A5Z B;  3CMA A;  3JAM i;  2FIN B;  3H3V H;  2RSN A;  1V43 A;  2J0T D;  4XT1 B;  3S14 B;  1LTS D;  4X65 Q;  2JA7 H;  4A75 A;  3MEF A;  1P16 A;  2NTT A;  2WB1 B;  4LAA A;  1I50 B;  1UEA B;  3PO2 G;  1EIH A;  2VUM G;  1GHJ A;  4IQZ A;  2NZH A;  1X3G A;  2A74 C;  3T16 A;  1X3F A;  2EIF A;  1JMC A;  3I91 A;  3HOY G;  2SEB D;  2B39 A;  2E2J H;  3LWE A;  2RVL A;  4P74 A;  4RMF A;  4DV6 L;  5M5Y B;  4DGZ A;  3HOZ B;  1O7I A;  1HNZ L;  3SGI A;  5JOB A;  3NTH A;  2LS0 1;  2KUM A;  3G4S A;  1WCM G;  3AU7 A;  3MWY W;  3KF6 B;  4C3H G;  1FJG L;  3L2P A;  1QNK A;  1UE7 A;  2ICE C;  3TRE A;  1IW7 D;  1TS3 A;  3LGJ A;  1IBM L;  1CT1 D;  4GN4 B;  1XYI A;  2JQO A;  4DV6 Q;  3WDN A;  5C6A A;  1EIG A;  5J22 A;  4KHP L;  2OXP A;  4CHT B;  2A19 A;  1HNZ Q;  3H3V I;  1M8A A;  3PSI A;  5C4H A;  2Q8T A;  4UAI A;  1F9R A;  1VQ8 A;  1Y8P B;  4DR1 Q;  1G8Z D;  1FJG Q;  1QUQ B;  3H09 A;  5C3E B;  1CTM A;  5DEH A;  4JI6 L;  1W3S A;  3R3O A;  1PFB A;  1G2S A;  4KHP Q;  4DF7 A;  1GUN A;  1ZEQ X;  3GO5 A;  2F0M A;  4NMZ A;  3BZD B;  2JA5 H;  1HNX Q;  1LV9 A;  1X32 A;  1SDF A;  1SE2 A;  3D4R A;  1TWG H;  4FP5 D;  4L5T A;  4X66 L;  5IWA Q;  1GUG A;  3J80 E;  3KJO A;  2ENB A;  4RKL A;  3K7A B;  2D0O A;  1PH7 A;  3UDX A;  4DUZ L;  4OX9 Q;  1SE4 A;  3J7Y W;  1QCB D;  2WAQ B;  4XQJ A;  1OXV A;  3HS0 C;  4X66 Q;  1ESF A;  1ESR A;  4CKC A;  5IIF A;  3K0Y A;  4K6L A;  3QWN A;  1V9P A;  4DUZ Q;  1NJI C;  1ET9 A;  1XNR L;  4ZCK A;  1EWC A;  4LFC L;  1YHA A;  1TR5 A;  5GRO A;  1TQO A;  3MC0 B;  5IP9 H;  2EJF C;  4IJH A;  4WFN 3;  1HXY D;  4C2M H;  1XNR Q;  1XX8 A;  4LUO A;  4LFC Q;  3ZJY C;  1XPO A;  1E7Z A;  1HTL D;  2A69 C;  4O1N A;  4CKE A;  1WTP A;  2PMZ B;  1HZ9 A;  1I94 L;  1SXT A;  4IPC A;  4MNO A;  3NTI A;  2JE6 I;  2EYL A;  4KTA A;  1MIU A;  3A0J A;  4DU9 A;  5KYL A;  1PFS A;  1JWU D;  1JQY D;  3HOW G;  1R4P B;  1QVF A;  4A3C G;  1E1T A;  1HJP A;  5KGU A;  3K59 A;  2E2I H;  4OIJ A;  5LL6 X;  1AE3 A;  4O2D A;  2B2U C;  3M4Q A;  2CKZ B;  3HOU H;  2BCO A;  2BOS A;  5E1F A;  1EY5 A;  1OXS C;  5E4W C;  3OPO A;  1AZP A;  2K4K A;  1H95 A;  1SJE D;  4A3B H;  3RN5 A;  4JV5 Q;  1N34 L;  4J8Q A;  2RCN A;  4A93 H;  5C4X B;  4YCW A;  2B3G A;  1QZH A;  2MJ8 A;  1SEB D;  1VQJ A;  1ICW A;  1GHK A;  4DV1 L;  3PCO B;  4JI5 L;  2RA4 A;  1EYG A;  4EGV A;  2NUC A;  4DR5 Q;  2E2H B;  1BCP C;  1QG7 A;  2F0F A;  4XIG S;  3LWU A;  2B2T A;  1E22 A;  4ME3 A;  4P71 A;  4CDF C;  3ULL A;  3CCJ A;  4KY7 A;  3QIA A;  1I4X A;  1Z47 A;  2MQH A;  1S5B D;  1A3V A;  1JWS D;  2VUM H;  4DV1 Q;  2JA7 B;  4LNQ A;  1NAP A;  3HOY H;  2OEO A;  4YWM A;  1BBW A;  3QB3 A;  1CKO A;  4G7H C;  2B2U A;  2K5Q A;  3L0O A;  1F2M A;  1Q90 A;  2F3V A;  4IZ8 A;  4N9P A;  2K33 A;  1T5E A;  1DCZ A;  3HG9 A;  3OW7 A;  2E2J B;  4NXM Q;  4PG3 A;  2XRQ D;  1VQ9 A;  4BWG B;  3R93 A;  5L37 A;  1QOH A;  2WB1 G;  1LAB A;  3EA6 A;  3VR2 A;  4LF6 L;  4C3H H;  5EBC A;  4K5X A;  1N32 Q;  4K0K L;  1A63 A;  2E5L Q;  1PZI D;  1BBU A;  2IX3 A;  2ZJR A;  5IYD H;  3FMC A;  4DAY B;  4WJW A;  2UUA Q;  5KEE A;  2X6G A;  4X62 L;  3H6M A;  1NMG A;  1D6E C;  3L3O C;  1VQO A;  2JA8 H;  2PQA A;  4K0K Q;  3CW2 C;  1STG A;  2CFM A;  4AH6 A;  2F4V L;  1YJN A;  4HID A;  4ZLT F;  4KD4 A;  4A3K G;  2NBF A;  2EY6 A;  1XPR A;  4OWT B;  1KXL A;  4J6H A;  2XN9 C;  4C3I H;  3RZO H;  5FO8 B;  2JA5 B;  2VY3 A;  3A8K E;  4ZQ3 A;  1EFI D;  4H13 C;  1EWI A;  4X3T A;  1TWG B;  1BQQ T;  3VA7 A;  4NKL A;  3HRZ C;  2XNA C;  1WJJ A;  3CCV A;  1JOR A;  4UPA A;  4DR4 L;  1DZ1 A;  3RN2 A;  2AWO A;  2L9H A;  3K0X A;  5A2Q E;  2B29 A;  1IBL Q;  1KDA A;  5IGG A;  3GTP H;  1AN8 A;  3GV6 A;  2F0H A;  1JE5 A;  4JI7 L;  4H7B A;  4DR4 Q;  1JOQ A;  3WWV A;  1LTB D;  1G29 1;  1AE2 A;  1I5F A;  2VL6 A;  4XQQ A;  5LMU L;  5JJL A;  1EEF D;  1VF7 A;  2WAQ G;  1KRT A;  4DNR B;  3L7Z C;  1LTR D;  2XTI A;  5JJI A;  1GJX A;  3A8J E;  2BA1 A;  3A7L A;  3E6Z X;  1S5F D;  2JYO A;  4OON A;  1SN8 A;  4EQO A;  5FLM G;  3NP8 A;  1VQN A;  2WKC A;  3A54 A;  2N49 A;  1KTK A;  2SNS A;  3OMC A;  4C2M B;  5CBE E;  5IYB H;  4ZUI A;  2QEJ C;  5M5W H;  1X6O A;  2ZT9 C;  4IOA A;  2O4X A;  3VDY A;  3PF4 A;  3KLW A;  2B63 G;  1HH2 P;  3ERO A;  1S5D D;  1BCP F;  1I6V C;  3LNN A;  2NB0 A;  3CPW A;  5ELB A;  1E0B A;  5IT9 L;  3F1Z A;  4DAV A;  3STB D;  4PQX A;  4OGQ C;  2PYK A;  3U9O A;  3E3X A;  2CWP A;  3FKI H;  5KRU A;  3P20 A;  4ZRZ A;  4B3T L;  4N8X 1;  1EQR A;  5IGB A;  1C7Y A;  1EU4 A;  3G71 A;  2YTY A;  1J8I A;  1II3 A;  1Q46 A;  2RQX A;  4YCU A;  1KNA A;  1KNE A;  3AB9 A;  1E1O A;  4U68 A;  1STN A;  2B8G A;  2E2I B;  5I2X A;  1PDQ A;  4LJZ C;  1C9O A;  3TBI B;  3HOU B;  2VS1 A;  2EZV A;  4E6I A;  4MZ9 A;  2OWO A;  1FNV A;  1HR0 L;  5M9O A;  3KLS X;  4A3B B;  1O7Y A;  5GAE C;  3AEV A;  1EY4 A;  4ZKC B;  3UDI A;  5M3M G;  4A93 B;  3M85 A;  3MFY A;  2WIN B;  2IW3 A;  4UDU C;  4JYA Q;  2EQS A;  3I56 A;  3QO2 A;  1HR0 Q;  2O2L D;  3RLN A;  3PF5 A;  1WTO A;  4RGO S;  4G7O C;  2A5H A;  1XTC D;  1F2Z A;  1TT2 A;  3U58 A;  1RHP A;  2HDL A;  4JI2 L;  4HED A;  1D1I A;  3TEH B;  5C0X J;  1NTG A;  1SR3 A;  3PO2 B;  1T5X D;  1X54 A;  4LFA L;  3MZ5 A;  2VUM B;  1X65 A;  2EY2 A;  4HJ7 A;  2K04 A;  1VQB A;  2WKD A;  2XVS A;  3MEH A;  2H4O A;  3HOY B;  3HOX G;  1DOM A;  1SAP A;  1SYD A;  2EDG A;  4FVM A;  4Q0F A;  5C5M A;  1LM0 A;  1DOL A;  2F0D A;  1EYA A;  3SK8 A;  4HJA A;  3S1N B;  3DMU A;  5BR8 Q;  3K6O A;  2RDH A;  1SE3 A;  2DNC A;  2UXC L;  3TP8 A;  1LT5 D;  4C3H B;  3CCE A;  2D5D A;  3HKS A;  5FO9 B;  5JJK A;  3T1Y L;  2Z4H A;  2M2L A;  4OXP A;  3QOL A;  5CGK A;  2OQK A;  4DXG A;  1YEZ A;  5LMN Q;  5EKK A;  5A35 A;  4NP5 A;  5AJ3 Q;  3RUZ A;  2ASB A;  1SLJ A;  1HHV A;  2WV6 D;  2JA8 B;  2F3I A;  5E4X A;  4A3K H;  4JBK A;  2HHH L;  1V1P A;  4A3E H;  2BH2 A;  3ND8 A;  4QCL A;  4BA1 I;  1I4G A;  1Q12 A;  3GQB A;  2R3Z A;  1EU3 A;  2K75 A;  1UNS A;  1JCK B;  2VQF L;  1G2T A;  4LFB L;  1B3Q A;  2ZM6 L;  2IHE A;  3DHQ A;  1L0X B;  1CA6 A;  2K52 A;  1VQI A;  3MXG A;  2UXD Q;  4DFA A;  3OWE B;  1H9S A;  2HHH Q;  1CQV A;  1VS0 A;  2J4X A;  5E7N A;  3VR4 A;  2NZ1 D;  3R2I A;  2B2V C;  4C3I B;  3RZO B;  2F0P A;  1IZ6 A;  1FGB D;  1K28 A;  3U4V A;  2Q2U A;  5E3F A;  2ZM6 Q;  4TSS A;  1RTO A;  2KHJ A;  2WFW A;  1PRT B;  1Z9F A;  1PLF A;  1HZB A;  2RHS B;  3KDF B;  4GOP C;  3STB C;  1GKH A;  2UUB L;  3DM1 A;  4YCV A;  2ID0 A;  2JA5 G;  3QJY A;  4X3K A;  1HCZ A;  1TY2 A;  3HGB A;  4HCE A;  3GTK H;  2QKI C;  4P2C B;  1NR2 A;  3GTP B;  5K36 G;  4OIK A;  1PYS B;  3CF5 A;  1I4R A;  2VNU D;  1VDZ A;  1RCV D;  2UUB Q;  2F0E A;  1YIT A;  3KK7 A;  4QY7 A;  4JI3 L;  2TSS A;  3NE5 B;  1QB5 D;  5EJW A;  2F0Q A;  1PVO A;  2C35 B;  4JI0 L;  2IWH A;  2B63 H;  2MFI A;  1LTT D;  1H9K A;  4FXG C;  2B2V A;  5M5W B;  4IUQ A;  2CCZ A;  3GTQ H;  1HA6 A;  3S1Q H;  2JXM B;  4FF2 A;  1Y8O B;  3KF8 A;  3K7U C;  4K8J A;  1K8A C;  3MHB A;  5HUR A;  4A3I G;  4V19 0;  3E9H A;  2HD3 A;  3BYY B;  3CU7 A;  1SNC A;  2QEX A;  3EIV A;  2NVQ H;  3G48 A;  3FKI B;  4NPS A;  2L11 A;  4ME5 A;  1X3Q A;  3I7F A;  3I4M G;  4BY7 G;  4GOP B;  1M90 C;  1VMP A;  4H0L C;  2KHS A;  3TP5 A;  5I2Y A;  5ELC A;  3M9B A;  3Q6S A;  2OQ0 A;  4CJ0 B;  1EQV A;  4ZK9 B;  1D2B A;  4QL5 A;  4KI0 A;  4JOI C;  2Q2T A;  1KD1 C;  2XRS D;  5M3M H;  3PUV A;  4LF5 L;  3PIO A;  2KEN A;  2F4I A;  3QR8 A;  2AUK A;  4JCV E;  2Q2H A;  4HSV A;  1YJ9 A;  1KAA A;  3BZC A;  1EZ6 A;  4G4K A;  4B3S L;  4DV4 L;  4RWS C;  4DV7 Q;  1S40 A;  3VR6 A;  4FF3 A;  1K0R A;  1I4Q A;  4LF5 Q;  2CW0 D;  4K2K A;  1STH A;  2FJ2 A;  3NBH A;  4A3B G;  3I72 A;  5DNF A;  4EVO A;  4XTC S;  1RD9 D;  3AFP A;  4JI1 L;  4A93 G;  1EY8 A;  1JR0 D;  2IJ0 A;  5C3X A;  3D6C A;  1JC7 A;  3VYR A;  3HOX H;  1SYC A;  3NWS A;  2YTX A;  1K0S A;  5I6W A;  1VQP A;  1Q81 C;  1GUS A;  3Q24 A;  3IAY A;  1B2T A;  4HMJ A;  3WOE A;  2UU9 L;  5HGT A;  3KLR A;  3AYH B;  3EN2 A;  4JOI A;  3I55 A;  1PH3 A;  2ICI A;  1SYG A;  4IFD H;  3OTO L;  2KHI A;  2EYP A;  1SSO A;  1A8V A;  4EQ5 A;  3C1F A;  1CSQ A;  3DWQ A;  1SNM A;  2Z0S A;  1IBK L;  1VCI A;  5EPJ A;  1CI3 M;  4JK1 C;  3PIP A;  2G9H D;  3M7G A;  1JOO A;  1MI2 A; 
#chains in the Genus database with same CATH homology
 1EZ8 A;  2BDN A;  1LTI D;  2L4N A;  5BN5 A;  1O78 A;  1C8C A;  5EPL A;  4ODG A;  5IT9 E;  1HQM C;  5EPK A;  2Z1C A;  4A3K B;  1IYV A;  4A3E B;  3DUZ A;  3VYT A;  3S9W A;  1BCP D;  4KY5 A;  1W6J A;  2QF7 A;  3TZD A;  1B44 D;  1LT6 D;  1EY0 A;  5I6Y A;  4ILW A;  3MXN A;  5K36 H;  1OXU A;  4C3I G;  2DN8 A;  2LY7 A;  1Z7T A;  3NPP A;  3GTK B;  1EL0 A;  4KKS A;  4R8N A;  2DY8 A;  4HMI A;  2D62 A;  2VB2 X;  3W2D A;  3QOJ A;  3DWA A;  4KD3 A;  1SNO A;  3K57 A;  1VF5 C;  2B63 B;  4FXD A;  4WOR A;  3SEB A;  1QE6 A;  2AQ2 B;  4H44 C;  3W3A A;  2A73 B;  3S1Q B;  4KN4 C;  1BR9 A;  1A2T A;  1TKW B;  2CW0 C;  2M9V A;  2K7V A;  1D5Z C;  1K8O A;  5IOC A;  2NVQ B;  3OIP A;  2K03 A;  3C3L A;  3HEJ A;  1EQT A;  3N6R A;  2O5I C;  2B2T C;  1Q8I A;  2QDB A;  3K5L A;  3KBG A;  1O7L A;  1MGS A;  4B08 A;  2Q8I B;  1BOS A;  5M3M B;  4YIJ A;  4M8A A;  4QUF A;  1BXT A;  1TVX A;  1JWM D;  2F0V A;  1A6X A;  1NR4 A;  1A3U A;  4QF4 A;  2B8F A;  3NSW A;  4R9W A;  3DWP A;  1B4O A;  4IAL A;  4HCS A;  1LT4 D;  4KKT A;  3D6W A;  4RA8 A;  2ZXP A;  2D2C C;  1BUV T;  1H9M A;  1SYF A;  1IL8 A;  3HOX B;  5CV6 A;  3FEW X;  1E2V A;  1IYU A;  3TZU A;  1ILP A;  4FYD A;  4F8M A;  1LLR D;  2JEB I;  1TS4 A;  4RGT A;  3ONA B;  2O5J C;  1Y8N B;  1SNQ A;  5CR3 A;  1DXM A;  2MPM A;  3DXJ C;  4NW2 A;  3KUP A;  5CBA E;  5K5P A;  3DEP A;  1Y69 U;  2LMC B;  1J9O A;  4XXE A;  3SK4 A;  3IL8 A;  1G91 A;  5D3I B;  1B50 A;  1WTR A;  2MP1 A;  3V96 A;  2XWJ B;  5DM6 3;  1BCP B;  4IUP A;  3DEO A;  4OHJ A;  4C3J G;  5IGE A;  1B9M A;  5I4D A;  3GTL B;  1BF4 A;  4KKU A;  1HFN A;  2R61 A;  1JB3 A;  4F88 A;  2R92 B;  2F3W A;  2HCI A;  3D8G A;  3FPU B;  3RZD B;  3ERQ A;  3BDC A;  2EYH A;  1RKN A;  5JEA G;  1AW7 A;  5C4Z A;  2KED A;  1CZW A;  3SR1 A;  2KCC A;  2RKS A;  2VXW A;  2WAC A;  2N55 A;  1KDB A;  1ENC A;  2K32 A;  2PNR C;  3T53 B;  2NN6 H;  1V1O A;  4A3I B;  1KLU D;  3A7A B;  2F03 A;  2M00 A;  5NUC A;  1ROD A;  3I4M B;  1WVL A;  2YU9 B;  2CQA A;  3MXU A;  4BY7 B;  4RAU C;  1Q1E A;  1FYC A;  2IL8 A;  1E2Z A;  5G3L D;  3URY A;  4ID6 A;  3K5O A;  1BNZ A;  4FF1 A;  4RGN A;  3VYS A;  3NTK A;  2DY7 A;  4IUR A;  4KJN A;  5D3D A;  1ZXT A;  1U4P A;  3SK6 A;  4KN7 C;  3IFD A;  1STA A;  3H94 A;  1JOK A;  3TP7 A;  2V4D A;  1HA5 A;  3WOF A;  2B2Y C;  2CHB D;  2OF1 A;  2OT2 A;  3OHX C;  1I6H B;  2HQE A;  5ISR A;  4NDX A;  5D65 A;  3MXP A;  2R6G A;  1PXU A;  4LMQ D;  4N9T A;  2C9O A;  1MD2 D;  4ZAI A;  5ELF A;  3P7J A;  1B3A A;  1K8M A;  5CV5 A;  1TII D;  3GTO B;  2AQ1 B;  1XWE A;  5FO7 B;  3KBX A;  1EY7 A;  3A8I E;  2F0T A;  1W6K A;  2E75 C;  1HFG A;  4HAE A;  1V8Q A;  1CM9 A;  2B2Y A;  1I4P A;  3I70 A;  3FVQ A;  1LTA D;  1PTO D;  3JAM E;  4TRD A;  2E76 C;  4ZKB B;  5JAV A;  4HSP A;  2IX0 A;  3BYT B;  1H9R A;  4IFD G;  1WD0 A;  3IKJ A;  3NQT A;  2SNM A;  4HR7 B;  1B1Z A;  5C0X H;  1DOK A;  4PNY A;  1Y1V B;  1GOZ A;  5C44 B;  4OO1 H;  2JSO A;  4EQN A;  4RCN A;  1D5M C;  3HOV B;  2BE5 D;  4MN3 A;  1V1P B;  3OMG A;  3TME A;  1UAP A;  3TDQ A;  1EOT A;  3I3C A;  5JEA H;  2NVX B;  1K83 B;  1DON A;  4KV6 A;  2A6H D;  3EVQ A;  1AP0 A;  1D1K A;  1H9S B;  3TN2 A;  1TS2 A;  3BVZ A;  4B9X A;  2FMM A;  4IUU A;  5C5L A;  3I4N B;  3GD7 A;  2PZU A;  2F0L A;  3PV0 A;  1Y1W B;  5BN3 A;  4CGY B;  2K01 A;  2NTS A;  4WRD A;  1XXG A;  3SDZ A;  1DJR D;  2C5C A;  3S1M B;  4ZYS A;  3R8B A;  4HN7 A;  5EKI A;  3GTM B;  1O80 A;  4X3S A;  2N88 A;  4K5V A;  4R8I A;  1SYB A;  1BO0 A;  3UI2 A;  4DXF A;  3H0G B;  1HUM A;  1S4Z A;  3O13 A;  4C1N K;  4CJ2 C;  4DK1 A;  1B9N A;  5EQ0 A;  5IGF A;  4K6D A;  3EQL C;  4X3U A;  2EJG C;  1PTO C;  1STE A;  1AFP A;  4S3S A;  3Q22 A;  1B53 A;  1AZQ A;  2F0J A;  2BA0 A;  2FHT A;  5COY A;  3D4D A;  4F7X A;  4PMC A;  1F9Q A;  4I65 A;  4RHS A;  4DN4 M;  1ENA A;  1EEI D;  2F0W A;  5JJZ A;  1Q1B A;  1MSH A;  3S15 B;  3VR3 A;  1SMY C;  4A3G B;  2K05 A;  1LAC A;  3VYU A;  2I07 B;  3V05 A;  3G6J B;  4A3M B;  3D4W A;  4JBW A;  2BE5 C;  1RDP D;  2JP1 A;  4IFD J;  4TQU S;  3TP6 A;  2EYJ A;  4XYQ A;  3ZYY X;  2JEA I;  3RD4 A;  3NQI A;  2RSO A;  1GUT A;  5EKL A;  5CC4 A;  1PYW D;  3GV3 A;  3E5S A;  5LL6 S;  4PV1 C;  4RGM A;  2R93 B;  5CV8 A;  2A6H C;  5G3L F;  5DM7 3;  5BN4 A;  1E2W A;  1OXT A;  4MIU A;  2PZT A;  4PMW A;  3I8Z A;  4RCO A;  1PZK D;  3I90 A;  2EJM A;  2B2W C;  4RH6 A;  5EGT A;  1U4M A;  2Z8L A;  4BA2 I;  5ELE A;  2PQE A;  4C3J B;  4G57 A;  4BBS B;  3SXH A;  4A3F B;  1FR3 A;  2VB3 X;  2AQ3 B;  4IFD I;  2NVY B;  2KJX A;  1DD2 A;  1DM0 B;  4L6T B;  3NWT A;  2J7Z A;  4DA2 A;  2DNE A;  2F0N A;  1STB A;  1KLG D;  3TSS A;  2RDG A;  2KOL A;  1S5C D;  4KJO A;  5FLX E;  1AEX A;  3FPP A;  3M7N A;  2KVM A;  1C4Q A;  2B2W A;  2EE1 A;  4Z9C B;  3BDO A;  4M1U B;  5I9O A;  1KDC A;  3J7A F;  4AYB B;  1PTO F;  3T13 A;  2A6E C;  2PPB C;  2F1M A;  2TMP A;  1VMC A;  4DNT B;  2RBM A;  1QJO A;  1UUP A;  1A2U A;  2EY5 A;  3JAM L;  1DYQ A;  4FNF A;  2FFK B;  4Q5V A;  1F77 A;  3GTQ B;  2NN6 G;  4TKO B;  3A55 A;  1RF2 D;  3P75 A;  2K5W A;  3RMH A;  1BDO A;  3A56 A;  3SK5 A;  1FNU A;  5KNB A;  2SOB A;  3OOC A;  2ZXO A;  3M4Y A;  3L9A X;  1F2L A;  4PMB A;  5CYU A;  2HDM A;  5J1Z A;  3PUW A;  3PO3 B;  5EBD A;  4CJ1 B;  1WTQ A;  4BY1 B;  3K5N A;  4B9W A;  2Q8R E;  4QIW B;  3ITP A;  2JA6 B;  3H3V C;  4XT3 B;  2KEE A;  4MHE A;  1CFM A;  2EYM A;  2L12 A;  2XSC A;  2E74 C;  3BVG A;  1SBB B;  4GZY C;  2CVR A;  5T1I A;  3D31 A;  1ZKO A;  1MSG A;  2MHV A;  1M4V A;  2LFN A;  1I4H A;  4C56 C;  1IKM A;  3MVV A;  1SFO B;  3BG3 A;  1FNW A;  3PUX A;  2PW7 A;  1HQR D;  1PMR A;  1L0Y B;  3J81 L;  5M3F B;  1NSN S;  1SYE A;  1QIL A;  3CKI B;  3G7L A;  1OXX K;  2AWN A;  4KMU C;  4BBR B;  4XQN A;  3MFG A;  1IW7 C;  2ZXR A;  4KY6 A;  2L5T A;  2HCC A;  1HRJ A;  1FD7 D;  3QG1 A;  2K28 A;  3J7A V;  2I46 A;  5KNC A;  1SND A;  5JPM C;  5DAU A;  4Y7N B;  4A3J B;  3FDT A;  5C0X G;  4F87 A;  1TWH B;  1YNJ D;  1ENF A;  3MTS A;  4DAY A;  2WII B;  1Z6H A;  5CV9 A;  2SDF A;  1ONL A;  5J39 A;  4FO2 A;  3KLS A;  2L1B A;  3S2D B;  4OO1 G;  3X3N A;  1NUC A;  2KQ3 A;  1JIC A;  3T4A C;  1R9T B;  4L63 B;  1EWH A;  3Q23 A;  1PFN A;  1YNN D;  2QIL A;  3FRP B;  1ET6 A;  4LK1 C;  4QUC A;  4XDX A;  5JVG 3;  4DAP A;  5TSS A;  3PIO 3;  4KHV A;  3BVM A;  4ABN A;  5JVH 3;  4RKB A;  1ML0 D;  2KA7 A;  2Y0S B;  1TU2 B;  1PRT D;  4FXK C;  3K5M A;  4L8J A;  4CKB A;  2PW5 A;  4IUN A;  1GUO A;  2KEC A;  2BDO A;  2K1B A;  4CBV A;  3SHL A;  5D14 A;  3S1R B;  5CV7 A;  3HZX A;  2Z4I A;  2YYZ A;  4RHR A;  1O7Z A;  2IX1 A;  3X3M A;  1PZJ D;  4EQP A;  1CHQ D;  1H9J A;  2XIW A;  3BDL A;  2HUG A;  3R2T A;  3I73 A;  4HTH A;  3NXW A;  1GUW A;  1Q3L A;  4K14 A;  3NHH A;  3RLF A;  3PIP 3;  3PMF A;  2K5D A;  5C4J B;  2QCP X;  2MGS A;  2G9D A;  2D9U A;  1RJT A;  2NN6 I;  1F9S A;  4K5W A;  4ZUJ A;  3CHB D;  1TWF B;  3CRK C;  2IT1 A;  1CZG A;  3T56 B;  2NWG A;  1R4Q B;  3OWF A;  3Q0A A;  5FOB B;  5IOD A;  1CK1 A;  2X69 A;  2EOT A;  5I9P A;  2IPK D;  1SNP A;  4G7Z C;  5FLX L;  1ZYR D;  5CMD A;  1U9R A;  5T1G A;  2EYF A;  1CQF A;  2PZW A;  4A3D B;  3K58 A;  1WTW A;  3CRL C;  3GP7 A;  3S16 B;  1WD1 A;  1YNJ C;  2PO4 A;  3F2U A;  4IUV A;  3OIQ A;  3J80 L;  5F2D A;  1CA5 A;  3U9S A;  2F0U A;  1TS5 A;  1F2Y A;  3MA2 B;  4V0B A;  1YNN C;  1OO9 B;  1PTO H;  4ULL A;  2NYZ D;  1TWC B;  2FMC A;  3CQZ B;  2R7Z B;  5IGC A;  1A3T A;  2MUY A;  3S2H B;  2X6L A;  1LT3 D;  1EYC A;  5M5X B;  4J1M A;  4DK0 A;  1D5X C;  5KIX A;  5IGD A;  1PRT C;  1U4R A;  2F0S A;  1SMY D;  3ND9 A;  5LHY 1;  2AUJ D;  5COR A;  3H91 A;  3NBI A;  1GXD C;  3M4O B;  3EJI A;  2F0I A;  1A15 A;  1WCM B;  1C48 A;  1IHZ A;  1PFM A;  4FF4 A;  3BS1 A;  4RFB A;  2L55 A;  2A68 D;  2XWB B;  1G6Z A;  3OSO A;  4C1N I;  4KHZ A;  5JEA J;  3C46 A;  2L0C A;  1MBY A;  4IN3 A;  1I3Q B;  4U67 3;  3GTJ B;  3SVM A;  4BS9 A;  3T51 B;  2KCN A;  1EY9 A;  2WP8 J;  5C0X I;  2F0G A;  2F0K A;  4IUT A;  1EYD A;  3PUY A;  3I4L A;  1JE4 A;  4QMG A;  4OO1 I;  4K2L A;  2EY1 A;  1EY6 A;  3J81 E;  4QB4 A;  2E2D C;  1F9P A;  2PCF B;  4O42 A;  3LX0 A;  4XYO A;  3AMU A;  3E0J A;  2GA4 B;  3HKZ B;  1LTG D;  1KAB A;  1LO5 D;  1ZYR C;  5AFW A;  2F0O A;  1HPC A;  1QWY A;  1TY0 A;  3PUZ A;  5C3W A;  1NCV A;  1CHP D;  2EYO A;  5ELD A;  3NK9 A;  5JPN C;  1IKL A;  1WTX A;  1RTN A;  2RDF A;  3V2T A;  5KYI A;  2A6E D;  1BBX C;  2NVT B;  2H1E A;  3HOW B;  1SJH D;  1ILQ A;  1QNU A;  3GTG B;  2EXZ A;  2EPB A;  5CV4 A;  5KND A;  5FKA C;  1STY A;  1X3P A;  1PRT F;  5FK9 C;  1HTP A;  3HP3 A;  1TWA B;  3SE0 A;  4OL7 A;  1WTV A;  3C1E A;  2LKV A;  3N52 A;  4KK7 A;  3VA5 A;  2EVB A;  3M3Y B;  3C2P A;  2A68 C;  3IFT A;  4I7Z C;  3D3R A;  3VR5 A;  5A2Q L;  3EFX D;  3NUC A;  3S17 B;  3MAQ A;  2A69 D;  1U4L A;  2K6A A;  1PTO B;  1HUN A;  4K8I A;  1S5E D;  3P1H A;  2FIN B;  2RSN A;  1V43 A;  2J0T D;  4XT1 B;  3S14 B;  1LTS D;  2NTT A;  2WB1 B;  4LAA A;  1I50 B;  1UEA B;  1EIH A;  1GHJ A;  4IQZ A;  2A74 C;  3T16 A;  3I91 A;  2SEB D;  2B39 A;  3LWE A;  2RVL A;  5M5Y B;  4DGZ A;  3HOZ B;  5JOB A;  3NTH A;  2LS0 1;  2KUM A;  3AU7 A;  3MWY W;  4C3H G;  1QNK A;  2ICE C;  1IW7 D;  1TS3 A;  1CT1 D;  1XYI A;  5C6A A;  3WDN A;  1EIG A;  5J22 A;  2OXP A;  4CHT B;  1M8A A;  5C4H A;  2Q8T A;  4UAI A;  1F9R A;  1Y8P B;  1G8Z D;  3H09 A;  5C3E B;  1CTM A;  5DEH A;  3R3O A;  1PFB A;  1G2S A;  4DF7 A;  1GUN A;  1ZEQ X;  3GO5 A;  2F0M A;  4NMZ A;  3BZD B;  1LV9 A;  1X32 A;  1SDF A;  1SE2 A;  3D4R A;  4FP5 D;  3J80 E;  1GUG A;  2ENB A;  4RKL A;  3K7A B;  1SE4 A;  3J7Y W;  1QCB D;  2WAQ B;  4XQJ A;  1OXV A;  3HS0 C;  1ESF A;  1ESR A;  4CKC A;  5IIF A;  3K0Y A;  4K6L A;  3QWN A;  1ET9 A;  1EWC A;  1TR5 A;  1TQO A;  3MC0 B;  2EJF C;  4WFN 3;  1HXY D;  1XX8 A;  1HTL D;  2A69 C;  4O1N A;  4CKE A;  1WTP A;  2PMZ B;  1SXT A;  3NTI A;  2JE6 I;  2EYL A;  4KTA A;  4DU9 A;  5KYL A;  1JWU D;  1JQY D;  1R4P B;  5KGU A;  3K59 A;  4OIJ A;  5LL6 X;  2B2U C;  2BCO A;  2BOS A;  5E1F A;  1EY5 A;  1OXS C;  5E4W C;  3OPO A;  1AZP A;  1SJE D;  4J8Q A;  5C4X B;  2MJ8 A;  1SEB D;  1ICW A;  1GHK A;  2RA4 A;  4EGV A;  2NUC A;  2E2H B;  1BCP C;  1QG7 A;  2F0F A;  4XIG S;  3LWU A;  2B2T A;  4KY7 A;  3QIA A;  1I4X A;  1Z47 A;  1S5B D;  1A3V A;  1JWS D;  2JA7 B;  1NAP A;  2OEO A;  3QB3 A;  4G7H C;  2B2U A;  2K5Q A;  1F2M A;  1Q90 A;  2F3V A;  4IZ8 A;  4N9P A;  2K33 A;  1T5E A;  1DCZ A;  3HG9 A;  3OW7 A;  2E2J B;  2XRQ D;  4BWG B;  3R93 A;  1QOH A;  1LAB A;  3EA6 A;  3VR2 A;  5EBC A;  4K5X A;  1PZI D;  2IX3 A;  3FMC A;  4WJW A;  5KEE A;  2X6G A;  3H6M A;  1D6E C;  3L3O C;  1STG A;  4ZLT F;  4KD4 A;  2NBF A;  2EY6 A;  4J6H A;  2XN9 C;  5FO8 B;  2JA5 B;  4ZQ3 A;  3A8K E;  1EFI D;  4H13 C;  4X3T A;  1TWG B;  1BQQ T;  3VA7 A;  4NKL A;  3HRZ C;  2XNA C;  1JOR A;  1DZ1 A;  2AWO A;  2L9H A;  5A2Q E;  1KDA A;  5IGG A;  1AN8 A;  3GV6 A;  2F0H A;  1JOQ A;  4H7B A;  1LTB D;  1G29 1;  4XQQ A;  1EEF D;  1VF7 A;  4DNR B;  3L7Z C;  1LTR D;  1GJX A;  3A8J E;  2BA1 A;  3A7L A;  3E6Z X;  1S5F D;  2JYO A;  4EQO A;  3NP8 A;  2WKC A;  3A54 A;  1KTK A;  2SNS A;  3OMC A;  4C2M B;  5CBE E;  4ZUI A;  2QEJ C;  2ZT9 C;  2O4X A;  3ERO A;  1S5D D;  1BCP F;  1I6V C;  3LNN A;  2NB0 A;  5ELB A;  1E0B A;  5IT9 L;  4DAV A;  4PQX A;  4OGQ C;  2PYK A;  3U9O A;  5KRU A;  3P20 A;  4ZRZ A;  5IGB A;  1EU4 A;  1J8I A;  1II3 A;  2RQX A;  1KNA A;  1KNE A;  3AB9 A;  4U68 A;  1STN A;  2B8G A;  2E2I B;  5I2X A;  1PDQ A;  4LJZ C;  3TBI B;  3HOU B;  2EZV A;  4E6I A;  1FNV A;  5M9O A;  3KLS X;  4A3B B;  1O7Y A;  1EY4 A;  4ZKC B;  4A93 B;  3M85 A;  3MFY A;  2WIN B;  2IW3 A;  4UDU C;  3QO2 A;  2O2L D;  1WTO A;  4RGO S;  4G7O C;  2A5H A;  1XTC D;  1F2Z A;  1TT2 A;  1RHP A;  2HDL A;  4HED A;  1D1I A;  5C0X J;  3PO2 B;  1T5X D;  3MZ5 A;  2VUM B;  2EY2 A;  2K04 A;  2WKD A;  2XVS A;  3MEH A;  2H4O A;  3HOY B;  1DOM A;  1SAP A;  1SYD A;  2EDG A;  4FVM A;  4Q0F A;  5C5M A;  1DOL A;  2F0D A;  1EYA A;  3SK8 A;  3S1N B;  3DMU A;  3K6O A;  2RDH A;  1SE3 A;  2DNC A;  3TP8 A;  1LT5 D;  4C3H B;  2D5D A;  5FO9 B;  2Z4H A;  2M2L A;  3QOL A;  5CGK A;  4DXG A;  5EKK A;  5A35 A;  4NP5 A;  3RUZ A;  1HHV A;  2WV6 D;  2JA8 B;  5E4X A;  4QCL A;  1V1P A;  3ND8 A;  4BA1 I;  1I4G A;  1Q12 A;  3GQB A;  2R3Z A;  1EU3 A;  1UNS A;  1JCK B;  1G2T A;  3DHQ A;  1L0X B;  1CA6 A;  3MXG A;  4DFA A;  3OWE B;  1H9S A;  1CQV A;  2J4X A;  4C3I B;  3VR4 A;  2NZ1 D;  2B2V C;  3R2I A;  3RZO B;  2F0P A;  1FGB D;  5E3F A;  4TSS A;  1RTO A;  1PRT B;  1PLF A;  3DM1 A;  2ID0 A;  3QJY A;  4X3K A;  1HCZ A;  1TY2 A;  3HGB A;  4HCE A;  2QKI C;  4P2C B;  1NR2 A;  3GTP B;  5K36 G;  4OIK A;  1I4R A;  2VNU D;  1VDZ A;  1RCV D;  2F0E A;  3KK7 A;  2TSS A;  3NE5 B;  1QB5 D;  5EJW A;  2F0Q A;  2IWH A;  1LTT D;  1H9K A;  4FXG C;  2B2V A;  5M5W B;  4IUQ A;  1HA6 A;  2JXM B;  4FF2 A;  1Y8O B;  3KF8 A;  4K8J A;  3MHB A;  5HUR A;  4V19 0;  3CU7 A;  3BYY B;  1SNC A;  3FKI B;  2L11 A;  4ME5 A;  1X3Q A;  1VMP A;  4H0L C;  2KHS A;  3TP5 A;  5I2Y A;  5ELC A;  3Q6S A;  4CJ0 B;  1EQV A;  4ZK9 B;  1D2B A;  4KI0 A;  2XRS D;  3PUV A;  2F4I A;  2AUK A;  4HSV A;  1KAA A;  1EZ6 A;  4G4K A;  4RWS C;  3VR6 A;  4FF3 A;  1I4Q A;  2CW0 D;  4K2K A;  1STH A;  2FJ2 A;  3NBH A;  3I72 A;  5DNF A;  4EVO A;  4XTC S;  1RD9 D;  1EY8 A;  1JR0 D;  2IJ0 A;  5C3X A;  3D6C A;  1JC7 A;  3VYR A;  1SYC A;  3NWS A;  5I6W A;  1GUS A;  3Q24 A;  3IAY A;  1B2T A;  4HMJ A;  3WOE A;  5HGT A;  3KLR A;  4IFD H;  2ICI A;  1SYG A;  2EYP A;  1SSO A;  3C1F A;  3DWQ A;  1SNM A;  1VCI A;  5EPJ A;  1CI3 M;  4JK1 C;  2G9H D;  3M7G A;  1JOO A;  1MI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...