1SYFA

Engineering alternative beta-turn types in staphylococcal nuclease
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKTNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Engineering alternative beta-turn types in staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(phosphoric diester)
total genus 35
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1syfA00
2F0LA 5CR3A 4LAAA 1SNDA 5IOCA 3NXWA 1EY8A 5C6AA 5CV9A 2EYJA 4TRDA 2F0HA 2HQEA 3BDCA 3LX0A 3P75A 4I65A 2SNMA 5EGTA 2PW7A 3SXHA 2F0KA 5I9OA 2F0UA 5F2DA 4OL7A 2F0JA 3H6MA 2NUCA 3TP7A 5DEHA 5EKLA 4KY7A 3OMGA 1SYBA 1SYDA 4PMBA 4QMGA 3VA5A 1STHA 2RBMA 5JOBA 4H7BA 1NUCA 3HEJA 1A3UA 2SNSA 2F0OA 2EXZA 4DGZA 1RKNA 4HTHA 3SK6A 1STAA 3EVQA 4R8NA 4E6IA 1EZ6A 5HURA 4HMIA 5CV6A 1A2TA 2M00A 4K2LA 3BDLA 4KY6A 2F0QA 3TP5A 5J1ZA 2PZUA 5C5MA 4ZUJA 3SK4A 4DFAA 3NQTA 4K6DA 4EQPA 1EZ8A 1II3A 5I6YA 3S9WA 5KIXA 4YIJA 4NDXA 1NSNS 1SNQA 3E5SA 4F8MA 4PMCA 4IALA 4B9WA 2PZTA 1EY5A 1JOKA 2F0IA 4ZUIA 1KDBA 1SYGA 1STBA 3TP8A 2EYLA 4DF7A 1SYFA 2LKVA 5M9OA 2KHSA 1IHZA 4F7XA 1U9RA 1SNMA 2OEOA 4IUNA 2QDBA 1SYEA 3SHLA 2F0MA 2PYKA 5I6WA 4WRDA 2RDFA 5E3FA 1TT2A 3EROA 4NMZA 4J6HA 2F0EA 2PZWA 4MIUA 4PNYA 2O4XA 5NUCA 4EQOA 3OMCA 4HMJA 3QB3A 4KJNA 1JOQA 4ZQ3A 1EY6A 2F3VA 5C4ZA 2PQEA 1KDCA 2F0FA 5HGTA 1F2MA 3V2TA 2EY2A 4EQNA 1STNA 2EYFA 4K8IA 2F0VA 4KJOA 5J22A 3D4DA 4KY5A 2WACA 1EY7A 1SNCA 4NKLA 1JOOA 4K8JA 3T13A 3T16A 4ODGA 5IIFA 5IGEA 3P1HA 3QOLA 5IODA 1JORA 4KHVA 5KGUA 2EYHA 2EY1A 3MVVA 1AEXA 3MZ5A 3NHHA 3EJIA 4K14A 4WORA 5C5LA 3SR1A 5IGBA 3SK8A 4KD4A 3TMEA 4B9XA 5KEEA 3D6CA 2EY5A 2PW5A 1KAAA 2EYPA 5CV7A 5CC4A 4K2KA 5JAVA 4KV6A 3D8GA 4K5XA 2EYMA 1EYDA 3MEHA 2F3WA 2OXPA 1SNPA 4ID6A 4RKBA 5CV4A 5EKKA 5C3WA 4N9PA 3PMFA 5IGGA 3ITPA 3D4WA 5C3XA 2F0GA 1SNOA 1ENAA 5IGDA 3NUCA 2F0TA 2F0WA 3ERQA 3OSOA 4NP5A 4QB4A 5CGKA 5C4HA 3HZXA 5IGCA 2F0DA 5KRUA 2OF1A 5CV5A 3NP8A 2EYOA 4QF4A 2RKSA 4S3SA 4K5VA 5DAUA 1EYCA 5I9PA 5KYLA 1EY0A 4KD3A 4KTAA 3C1EA 1SYCA 3U9OA 4EVOA 3RUZA 3OWFA 1EYAA 5KYIA 3C1FA 1KABA 1TR5A 3NK9A 3SK5A 1F2YA 1A3VA 1EY4A 1EY9A 1A2UA 2F0NA 1A3TA 3MHBA 3QOJA 4IZ8A 2SOBA 4N9TA 5E1FA 5CV8A 4DU9A 2F0SA 5J39A 4G57A 2KQ3A 5K5PA 3DHQA 3TP6A 2F0PA 4RKLA 3MXPA 1EQVA 2ENBA 4ME5A 1STGA 1ENCA 2EY6A 3DMUA 4J1MA 1TQOA 1STYA 3R3OA 4K5WA 5ISRA 1F2ZA 1KDAA 5IGFA
chains in the Genus database with same CATH superfamily
3SVMA 2RCFA 3P7JA 3FPUB 5EQ0A 4GNXC 3PO3G 4Q0FA 4HJ8A 1CHQD 2K32A 5AJ3Q 2A8VA 4V0BA 3AQQA 2K1BA 4QL5A 1EWCA 4DV7Q 1IW7C 2BA1A 1G6ZA 5EKLA 1GVPA 2YYZA 1HNZL 3MXUA 1D5XC 2Q8TA 4LW1A 1MKHA 4KKSA 5CYUA 4JYAL 1P8LA 3J81i 1HNWQ 1OXUA 2UXBQ 1CK1A 2M9VA 2JA5H 1E24A 3GTJH 4XYOA 3HOWH 5I6YA 2YU9H 1I3QB 1FGUA 3AB9A 2Q8IB 1KDBA 2RQXA 2NWGA 1PH9A 3E6ZX 4BA2I 4KLKA 2ID0A 3O13A 3I2ZA 1ICFB 1VQAA 1ILQA 3OMCA 4KJNA 1EFID 1UUPA 4LWCA 4C3JB 2RSOA 4JI4Q 1BXTA 1SN8A 4UP8A 1SBBB 4A3BB 4PMWA 3FRPB 3NBHA 4FXKC 1TKWB 4KJOA 2ATWA 1WJJA 1BDOA 4DPGA 1M1KC 4C1NI 1CA6A 2EJFC 1IW7D 1QUQA 5TSSA 3EN2A 3S17H 3SR1A 1KRSA 2JE6I 4C3HH 3TDQA 1JE5A 1LTID 2EYMA 1EYDA 1PRTB 2WAQE 4L63B 4ZYSA 3KFUA 4IN3A 1N33L 3ZJYC 4CHTB 1L2FA 4ZRZA 1WOCA 1B50A 5IGDA 4NP5A 1XTCD 4EQ5A 3FEWX 3QG1A 2AHOB 3BVMA 4R4QA 4A3IH 3S2HH 3TEHB 4QF4A 3UDFA 1EOVA 1LV9A 2NYZD 1DONA 2UU9L 1RTOA 3WDNA 4AYBG 2B2UC 3Q23A 1CUKA 5KYIA 2KCCA 3C1FA 2KJXA 4YY3Q 5C0XJ 1F2YA 4IUVA 2RHSB 2CFMA 1QVFA 3I4LA 1PRTF 2EE1A 4LUZA 1HNXQ 5CBEE 2OCEA 2V1CC 3HOYG 3K0YA 5BN4A 1J5EL 4FP5D 2I46A 4AQYL 1F2LA 1PFMA 3G71A 1HFGA 3G6EA 4C3IB 5JJIA 1TY2A 3M4QA 1HR0L 2QCPX 2MP1A 3KJOA 1NR2A 2SDFA 1X54A 1HHVA 5M3MG 5F2DA 4TVAB 2NUCA 1SJED 1I3QH 5IE8A 4QCLA 5ELDA 2YV5A 1UE7A 2RBMA 2LXKA 1GD7A 1CSQA 2SNSA 2F0OA 2NVXB 4HTHA 2DY8A 4E6IA 1K9MC 4HMIA 4X62Q 3BDLA 1FL0A 3E9IA 4G7HC 1H95A 5IYCH 1N9WA 1RCVD 4C3JH 3J7AF 5C6AA 1NSNS 4ZAIA 1NY4A 4A3MG 4A3BH 1I50H 4LF6L 1SYGA 1XMQL 2KBNA 1IHZA 4F7XA 3K5OA 2D62A 3I3CA 4B3MQ 2E5LL 2F0EA 4HR7B 1TXYA 2D5DA 1PZID 3HG9A 2MJ8A 3KF8B 1DZ1A 5H1SE 4LF5L 1EIGA 4DA2A 1LTLA 5KNCA 1TWGB 1KNEA 1PDQA 2EY2A 1ZEQX 4B3RQ 4XDXA 3T13A 4XQQA 2UUAQ 3K5MA 2CQOA 3QOLA 1I4HA 1W6KA 1ONLA 3TSSA 3N52A 5IGBA 4DR2Q 1PH4A 3CMAA 1E7ZA 2L9HA 2WB1E 3OIQA 2EIFA 4JI0Q 4GKJQ 4CBVA 3F2CA 3M4YA 1XJVA 3GP7A 1SNPA 2K03A 1E3PA 1B2TA 1L0YB 5KNDA 4PZ7A 3T56B 1L1OA 4IUPA 4MTKA 1LO5D 5G3LD 5IT9c 2R7ZG 2EYOA 1FGBD 1HCZA 3K57A 5CORA 3J7YW 1K8GA 3CCVA 4A3KH 1EY0A 2A68C 4DR4Q 2G9HD 2N55A 3J7A5 3OWFA 1Y8NB 2NN6H 4JK1C 2E2JB 1W2BA 3KLSA 5GQOA 3SK5A 3T51B 4HIOA 2IL8A 4C3IH 2PMZB 3A8JE 4IFDH 1W6JA 2JN4A 1A62A 4HJ5A 1WCMH 5A2QE 2F4IA 2V4DA 5D3DA 1BKBA 5JJZA 2Z4HA 5EPKA 5T1IA 5CR3A 1VQKA 2A69D 4LF4Q 2NVXH 4R4CA 4IQZA 5EBCA 1B9MA 5BR8L 2Q2UA 3VR3A 3J7ZC 3S1NB 4A3LG 3IAYA 3C3LA 3HEJA 1A3UA 2HCCA 4HJ7A 3SK6A 4MN3A 3EVQA 1K3BC 2A68D 5HURA 1PA6A 4C2MB 1HZAA 4BBRG 5C44G 2QA4A 4ZUJA 3PCOB 1EZ8A 1C9OA 5BN5A 4KKUA 4V190 1TWGH 1EY5A 1IKMA 1DXMA 4OGQC 2A74C 1GO3E 3I4OA 4OWXB 3CCJA 4DV3L 1XMOL 1PV4A 4Y7NB 4NMZA 4EQOA 1QNKA 2PO4A 2LFNA 1R4PB 4A93G 2QGQA 2WACA 4JI2L 1PTOF 2L4NA 2MQHA 3NTIA 2E75C 3OW7A 3A8IE 1VF5C 4X64L 1U4LA 3D6CA 3M4OH 1O7IA 3CPFA 4KV6A 4BY1B 2BE5D 1HJPA 2E2JH 2ZM6Q 2OQKA 4RKBA 5M3FB 1NE3A 5C3WA 4N9PA 2JK8A 3ITPA 4JG2A 3CCSA 2YTXA 4HSVA 3W5OA 4FF4A 2DJGC 4A3EB 1JT8A 2OQ0A 5CMDA 2RKSA 2E2IH 5FLXL 1Z47A 4DNRB 4HAEA 3NWTA 1SLJA 2BA0A 3OOCA 4Y52H 2KHIA 4R9WA 2VUMB 3UE1A 1SMXA 4A3FB 5E1FA 2GN5A 3K80C 3OWEB 3T1YL 1BCPD 3BG3A 1ENCA 5G3LF 1ML0D 5IP7G 2K7VA 3KK7A 3VR5A 1X3PA 1I4GA 3DLLA 1K8MA 4JBJA 1EL0A 4BBSH 2B2TA 4HSPA 2EYJA 4GN3B 1VS0A 3ZYYX 1XXGA 2HQEA 1GHJA 4C2MH 3W1GA 3F2BA 1ASYA 4DV4Q 3ULJA 1WD0A 3K7UC 2F0JA 3VDYA 2WAQB 5DEHA 2L12A 1SYBA 5K36G 1CQFA 5JOBA 3J80L 3C46A 2D9UA 2FINB 3HS0C 1SMYC 1XPRA 1KTKA 1UE6A 4RHSA 3HKZB 4IUTA 3HOUB 1K8AC 2QEJC 1C0AA 5FO8B 3URYA 2R92G 3E5SA 2D0OA 4JI7L 2A19A 2F0IA 3MWYW 2VQFL 1VQFA 1H9MA 3L0OA 2Q2IA 2OEOA 5IP9G 5C4XG 4H13C 1KL9A 4J6HA 2NVYB 1BOSA 4MIUA 1JOQA 4DUZL 4IUQA 4LFCQ 2PQEA 1XNRL 5HGTA 4AIMA 4O2DA 3S2DH 1QNUA 3DM1A 3OTOQ 4BY1H 2F0VA 2F4VQ 5M3FH 3D4DA 5IIFA 5IGEA 5GAGC 1WTVA 2EYHA 3KLRA 2LY7A 1PLFA 1VQBA 4A3EH 4GZYC 4GN5A 3V05A 1KXLA 1EQTA 2JP1A 3KF6A 1SMYD 3IFDA 4K5XA 3ER0A 4GKKQ 1X65A 1IBKL 4ZK9B 5KNBA 2VUMH 4P74A 2K75A 2UXDL 4A3FH 4A3DB 3SDZA 5KYLA 2HQLA 3J81E 4DR1L 5C3EB 4LFAQ 1L1OC 1MJEA 1BVSA 3GDEA 5FKAC 4RH6A 1HNWL 3A7LA 4JC0A 2XSCA 2SOBA 4IPGA 4DU9A 2B2VA 5BN3A 3A0JA 3MXPA 4J1MA 1BBXC 3ND9A 1YHBA 1QZHA 1F2ZA 4GLVB 2A6HD 4LF7L 2HDMA 1M4VA 1QUQB 4ABNA 3X3NA 2K28A 4GLAC 2VQEQ 2F0HA 4GOPB 2JA5G 1MD2D 5GAHC 2SEBD 1BCPF 3HOWG 3ERSX 3HOUH 1FVIA 3TP7A 3M4PA 4A3JB 2R7DA 3VA5A 3I70A 1RKNA 2AUJD 2A6ED 2RSNA 2NVYH 1G51A 2A5HA 3NQTA 1HXYD 3RD4A 5LMUQ 1B4OA 2VL6A 1TWHB 2EYLA 3K58A 3GTMB 5I4DA 2Q2HA 1VF7A 2F0MA 4DV2Q 5HY6A 4AYBE 2UUBQ 2Z6KA 4FXGC 5E3FA 4PNYA 2C35B 4C3HG 1X3QA 4PZ8A 2M2LA 2ZTCA 1Z6HA 3CAMA 1HNXL 1HZBA 4DUYQ 4ZKCB 3Q6SA 1PRTC 2E2HB 1WYDA 4K8JA 1UE5A 1OTCA 1GKHA 1IYVA 2EY1A 4A3DH 3G7LA 1D2BA 4KD4A 3Q8DA 4A3IG 1H9RA 3E0JA 1JCKB 4K2KA 3HOXB 5C3EH 1S72A 5EPJA 5EKKA 3S16B 3RZOH 5IGGA 2XIWA 4NB3A 5C3XA 1BNZA 2F0GA 3B6YA 3A7AB 5EAYA 1W3SA 4JI1L 1PH3A 1DOLA 3PQIA 3EA6A 2KCMA 4S3SA 4K5VA 2N78A 5M5WB 1A6XA 4QUFA 3TRZA 2FJ2A 4B3SQ 1XWEA 4N8FA 2J4XA 1GUSA 1LTBD 2NZHA 2F0NA 5LMNQ 1B7YB 4N9TA 1V8QA 5D65A 3Q22A 3I56A 3H09A 2L5TA 1WTRA 3OW2A 1YIJA 3HKSA 1LTSD 4A3JH 1Y1VB 1N34Q 5LHY1 2XNAC 4OO1I 2JXMB 4UY8C 2JEAI 3ULPA 2K5VA 5CBAE 5CV9A 1LUZA 2KEDA 2I5HA 3TREA 5IYCG 4OX9Q 2B2TC 2F0UA 4OL7A 2A73B 3FMCA 4C3JG 4FXDA 4RCOA 4A3BG 3U4ZA 5EPLA 1TWHH 3GTMH 4HJAA 4JI6L 1IBML 2XRSD 1FNWA 1O80A 4DV1Q 1YJWA 3KBGA 5C0XI 4A4IA 1QWYA 4K6DA 3KJPA 1OXSC 1KIXA 3PF5A 3PIPA 3EBEA 4BY7H 3NTKA 4OHJA 4QQBX 4LF9L 2KHSA 2UXCL 4RA8A 3BYYB 1SYEA 2E2HH 5DM73 4WRDA 4LFBQ 3DWPA 1TIID 3MFGA 2JA7B 5FO7B 1BBUA 1HPCA 2F3VA 3ND8A 1ENFA 1CKOA 3F2UA 3HOXH 1K73C 4JI8Q 4K8IA 1PFNA 3S16H 1EY7A 3AFQA 1DYQA 4ODGA 3UE0A 2O2LD 3I7FA 1DD2A 2X69A 4PZ6A 3C2PA 1IZ6A 2CWAA 3QJYA 4XT3B 3D0FA 1IBLL 1G8ZD 5M5WH 4A3KG 4LF4L 1EEID 2KUMA 4XYQA 2NN6G 1T9HA 4OWTB 3D4WA 1E2VA 3NSWA 4OXPA 4DV0Q 3OSOA 4GLXA 3ERQA 4C3IG 5CGKA 4QB4A 4IFDG 3I4MB 4RG1A 4ILWA 3A54A 1I94Q 2Z0SA 3GTOB 2ZXPA 4KN7C 1WCMG 4HEDA 3RUZA 2K05A 1TS2A 1Y1VH 3OPOA 1N32Q 4GOPA 2B63B 2VNUD 2AKWB 2D0PA 5CV8A 3S1QB 4G57A 1NBWA 3W1BA 4O42A 4RMFA 2Y0SB 3RR5A 5I2YA 2B2VC 1KDAA 2G5DA 1E0BA 3S1RB 1JC7A 4HN7A 1R4QB 4C56C 3I55A 3S1MB 5FK9C 1I4RA 1C8CA 2JJQA 3I4NB 3NXWA 4YCUA 1EY8A 1X9NA 4OO1H 5ELBA 3STBC 4JI3Q 2OWOA 4I65A 2R61A 1JWUD 3UDIA 2NTTA 2ES2A 1CSPA 2NB0A 4R4TA 1HUMA 3QR8A 4RCNA 1PTOC 2CH4A 2ZT9C 3TS0A 4PG3A 3MXNA 3OHXC 2TSSA 1VQEA 5IT9L 3CRKC 4CKCA 1SSOA 1RODA 4H02A 1VQ4A 1A2TA 1GM5A 4DR6L 1I6HB 2JA7H 2ZM6L 1KNAA 4EGVA 1WTWA 3MTSA 5IWAL 4LNQA 3CF5A 5KIXA 2DN8A 3BJUA 4F8MA 4B3TL 4PMCA 3Q0AA 1KD1C 1CKNB 1AH9A 3F8TA 5FJ8H 2B39A 1U9RA 4NXMQ 3PUZA 3U50C 2L11A 3OYYA 3AFPA 2MO1A 4CKBA 4IUUA 2RCNA 5LL6S 1KDCA 1B9NA 1G291 2NTSA 2Z6KC 3K81C 4TKOB 3BVZA 3STBD 1LT4D 1MI2A 2UUCQ 2WKDA 3GTPB 1TWAB 1N36L 3HP3A 3I4MH 3SK8A 5FO9B 3J80i 1PTOD 4APVA 3OIPA 3LWUA 2F3IA 3EQLC 1X55A 4X65L 1STEA 4DV4L 2XWBB 4DNTB 3BU2A 2B63H 4OEMB 2EJMA 4YCWA 3LNNA 3S1QH 3M7GA 2DNCA 1EYCA 3CMEA 2X6GA 2JA8B 1SYCA 4DR7Q 1JR0D 1D8LA 3S1RH 2E76C 4XQNA 1I4PA 3GTLB 2A69C 3QOJA 2CQAA 3I4NH 4BBSG 1SE4A 1TWFB 5J39A 5K5PA 4JCVE 4JV5L 3FPPA 4R1JA 1LLRD 1SEBD 1O7LA 1PMRA 4QIWE 4P75A 2DJFC 4L5TA 2ALYB 4DV5Q 4RGTA 1Y69U 1A0IA 2HIXA 3DWQA 4TRDA 1VQOA 2IW3A 1VQ7A 3A55A 3P75A 4LUOA 3OTOL 2E74C 1XYIA 1IYUA 3FVQA 5EGTA 4JBMA 1I6HH 2ZJRA 3KF6B 3WOEA 4QY7A 5L37A 2XTIA 4HJ9A 3E3XA 5J3BA 4R4OA 5M3MB 4X3KA 3R8BA 4A3GB 4OIKA 3PF4A 1GUWA 5DNFA 4OELB 4H7BA 2RF4A 1S5FD 5A35A 4A3CH 4IPHA 4XT1B 4IFDJ 1CA5A 2OTJA 5LL6X 1PYWD 2R6GA 1M90C 1ZKOA 3NQIA 4P2CB 5ELFA 4BWGB 1DOKA 5GROA 5C5MA 1XNQL 1VDZA 4IJLA 1ET6A 1SROA 4FDBA 2B2WA 4X66L 3TP8A 4TSSA 4BY1G 1SAPA 5M3FG 2Q8RE 1SNMA 3GTPH 1KHIA 3EROA 1TWAH 1H9KA 1TY0A 3SEBA 4A3EG 1ZYRD 1VQ5A 4R8IA 3UDGA 1BQQT 2BE5C 2K33A 1NNXA 3WWVA 2Q2TA 1S5CD 1SNCA 1JOOA 1SE2A 3K8AA 2VUMG 4A3FG 3RLNA 4CGYB 1PTOB 3CC7A 1OXXK 1Y8OB 4JPBW 1UEAB 2Z8LA 1IL8A 2CWPA 1YI2A 2JA8H 1KRTA 3A56A 2ICEC 2ZTEA 5M5YB 2KHJA 2XVSA 3GTLH 1UWVA 2GVBA 4JOIA 1TWFH 1XX8A 3CCLA 1O7ZA 1BCPC 1SR3A 5CV5A 5EKIA 1X3FA 1PYSB 5M5XB 4KD3A 1V1OA 4EVOA 2IY5B 2WAQG 1PH5A 4K0KL 3NK9A 5ELCA 3K5LA 1EQQA 3K5NA 3PIOA 4UP7A 2F0SA 4RAUC 4DR3L 1ICWA 2F0PA 4JI5Q 1EQVA 4GOPC 1JQYD 3HKZG 1TU2B 1STYA 3HOUG 2QDLA 1A15A 2VS1A 3TBIB 3TQYA 4A3GH 1YJNA 2OTLA 1BR9A 4YWMA 2IJ0A 4NXNL 4UPAA 1V43A 1YEZA 4DNIA 1J5EQ 3JAMc 2EXDA 3PGZA 2BOSA 1CKNA 3PV0A 2HHHL 3MXGA 4AQYQ 1C48A 3BZCA 1L0XB 3VYUA 1HR0Q 4DV6L 4XIGS 1NUCA 1B3QA 2BDOA 1RF2D 4R8NA 4PV1C 5T1GA 1CTMA 4O0AA 3KUPA 3S1NH 1M8AA 4WJWA 4CJ0B 1QE6A 2AQ2B 1U4PA 2K50A 3TZDA 3FKIB 1JOKA 5COYA 3NWSA 4IOAA 4G4KA 4DF7A 1SYFA 3J81c 4IUNA 1RL2A 2PQAB 1S4ZA 3N6RA 4B3SL 3DEPA 4A3DG 2RVLA 2N88A 1PTOH 4ZQ3A 3L3OC 1JJCB 4ULLA 4LF6Q 1DCZA 1XMQQ 1VMCA 5C3EG 2EYFA 4CDCC 4Y7NH 1PH7A 5M5YH 4L5SA 3GTQB 2E5LQ 4YCVA 4HIMA 3MEFA 4G7OC 5IYDH 2F52A 1WTOA 4QJFA 2O5JC 2PW5A 5CV7A 5CC4A 5M5XH 4L5RC 1FD7D 1N8RC 4OX9L 4KHPL 4F88A 4YHHL 2CKZB 5I9PA 4DK6C 2B8GA 1CI3M 1PH2A 4CJ2C 1B53A 3SGIA 2A6HC 3RLFA 4A3JG 2PPBC 1TR5A 2NVTB 1BUVT 1TWCB 5JVG3 3FDTA 3U9SA 3KOJA 5AJ3L 4RKLA 4KKTA 4DAMA 1GOZA 4DV7L 1VQ6A 2CHBD 4RWSC 4LFBL 2NBFA 4LAAA 1RHPA 3NE5B 1DM0B 2Z4IA 2A6EC 3GV6A 1S5DD 4IPDA 1LTRD 1PH6A 1CKMA 2UXBL 3SXHA 4LF8Q 5I9OA 1NJIC 3AYHB 5JJLA 1BCPB 1CFMA 1STHA 3FKIH 2HUGA 4BY7G 3CQZB 4KMUC 3TZUA 1EQRA 2AWNA 4P73A 5BR8Q 4XQJA 1VQ9A 4CDEC 2JA6B 1QILA 1SDFA 4DFAA 2Z1CA 2GVAA 1X56A 2YTVA 3A5UA 4JI4L 2CH4W 2WB1B 3HOXG 1Y1WB 3JC66 1ESFA 3EIVA 3GTQH 1YVCA 2KOLA 5I6WA 2B2WC 1FR3A 1A63A 4HMJA 4DR5Q 3QB3A 3QIAA 1EU3A 3M3YB 4LUVA 1UE1A 1HQRD 3K7AB 1VQGA 4DV3Q 3M9BA 5JEAH 1XMOQ 4U673 1Q8KA 4WORA 3BYTB 1TS3A 2AMCB 1JWSD 3RN2A 1R9TB 5GAEC 2QEXA 2PNRC 1KLUD 2AQ3B 1FJGQ 1BO0A 2OXPA 1E1TA 1QCBD 3MXNB 3P20A 3PO2B 5ELNA 1F9RA 1Y1VG 1VQCA 2NVTH 4MTNA 1AZQA 5E4XA 4YY3L 1XPUA 3NUCA 1D5MC 3IFTA 2B2YA 2KA7A 1GUGA 4X64Q 5IGCA 4IURA 1AE2A 4FNFA 5FLXE 4HIKA 3U58A 2NZ1D 1PH1A 1ET9A 4JOIC 1HA5A 2HT1A 4FF3A 1EYAA 1S5ED 1EYGA 1Q46A 3PUYA 4LK1C 4AH6A 1HQMC 1PXUA 3GV3A 2XN9C 3PIP3 1WD1A 1A3VA 1EY4A 1EY9A 3MHBA 2IWHA 4DAYB 2QILA 2R93B 4OO1G 1AN8A 1Q3LA 3MAQA 4X3TA 2EQSA 1STGA 3W2DA 1CQVA 3DMUA 3R3OA 1JJ2A 2F03A 4KHZA 3CQZH 1YNXA 3BZDB 4QUCA 1F9PA 3VR4A 3T1YQ 3HOVB 4M8AA 3T1HQ 1Q86C 2BH8A 4DXFA 2HDLA 2JA6H 1CZWA 1MGSA 1X3GA 4X62L 2JA7G 3BS1A 1PFBA 3H6MA 4DKAC 2I5LX 3J80E 2PMZE 1S40A 1YJ9A 1Y1WH 2PQAA 1O78A 1FYCA 4DK1A 2EXZA 5FJ8G 1STAA 1EZ6A 1NAPA 4FO2A 1EWIA 5FLMH 4K2LA 3TS2A 2ZTDA 4B3ML 5J1ZA 3D4RA 4KI0A 2WKCA 1NR4A 3I73A 1V9PA 2N8NA 3D31A 4ZUIA 2AQ1B 4F87A 1YNJD 2LKVA 3K7AH 2P5ZX 1E1OA 4B3RL 2IT1A 3G4SA 2UUAL 2WV6D 3I4MG 3E9HA 3CCMA 2BH2A 2F0FA 4DR2L 1R9TH 4JI0L 4GKJL 2VQFQ 2L0CA 2EZVA 1PH8A 1JWMD 2C9OA 3PO2H 1B8AA 1JB3A 1SE3A 2JYOA 3T16A 4NKLA 4DUZQ 5KGUA 4IO9A 3A5ZB 4L6TB 2B63G 5C5LA 2JA9A 4HCEA 5KEEA 2VY3A 2VW9A 2WP8J 1KAAA 5IYBH 4N8X1 2IHFA 4RHRA 2Y0SG 3KBXA 4DR4L 1U5KA 1HA6A 1WI5A 1LT3D 1Z7TA 3JAMi 1QZGA 2F0WA 3I4NG 1WFQA 2R93H 1WVLA 1K0SA 4X3SA 4ZKBB 2DUDA 1GHKA 3H0GB 4I7ZC 3CXCA 2EOTA 2FFKB 4BXXH 1AE3A 1IBKQ 1KABA 2IX3A 1AFPA 4HCSA 2UXDQ 2R7FA 3R2TA 1K83B 4H44C 1PYBA 2VXWA 2HCIA 3HOVH 1LTTD 3DHQA 4DR1Q 1SJHD 1EEFD 1J6QA 3QO2A 3CRLC 5A2QL 3DXJC 5IGFA 1E2WA 3HGBA 1CT1D 4RGOS 3CP0A 3ULLA 4A3CG 1SNDA 3PUXA 2E2DC 2K4KA 2EJGC 5D14A 4BA1I 3UDXA 1MBYA 2K01A 2PCFB 2K52A 1IXRA 4BS9A 4LF7Q 1NMGA 4G7ZC 1EUJA 2X6LA 3X3MA 1I50B 1H9SA 1LTGD 3PUWA 1VQ8A 1EOTA 4JBWA 3CCQA 2B3GA 3HOZB 4A75A 4KY6A 1BBWA 2F0QA 3TP5A 2PZUA 1C7YA 1VQHA 3GQBA 1Q7YC 2FXQA 1VQIA 4NDXA 3CC4A 2ZJPA 2HD3A 3PO3B 1GUNA 1TS5A 1D6EC 3AU7A 1YHAA 1LACA 2RDFA 3ICEA 4FYDA 1J8IA 1Q1EA 4OIJA 4NPSA 1NTGA 1F2MA 4IJHA 3G6JB 3MFYA 4DAPA 3CHBD 1QJOA 3QWNA 2JA8G 2NN6I 3CC2A 1SRUA 4JI5L 2RHQB 5C0XH 3HKZE 4ZLTF 2ICIA 1AEXA 1DGSA 1ASZA 3AMUA 4IFDI 2LSSA 3CD6A 3H15A 1YBYA 2EY5A 2HIVA 2PI2E 3CW2C 5JPMC 2XRQD 2MHVA 1X32A 3H0GH 4WJ4A 2O5IC 5CV4A 4DAYA 3PMFA 4A3KB 1WTPA 5D3IB 1K83H 1NCVA 3R2IA 3TN2A 2MO0A 4O1NA 4UHVA 2K14A 1VMPA 2I5MX 4L8JA 1YITA 2B2YC 2H1EA 3DEOA 3U9OA 3L2PA 3I90A 3BZKA 1JJGA 1WCMB 5C4JB 4A3GG 4JI1Q 1VQLA 2KCNA 2MFIA 4IZ8A 3GTOH 4CJ1B 3VYRA 3RN5A 3VR2A 2K5WA 1OO9B 1HTLD 3K6OA 2L1BA 3E0EA 4KK7A 2F0LA 1TVXA 1CHPD 4P72A 2RA4A 2JSOA 5IOCA 2L15A 4MHEA 4OONA 3BDCA 3LX0A 2G9DA 3HOZH 2SNMA 2JQOA 2VB2X 1QG7A 5LMNW 2VZAA 4AYBB 1K3RA 3GTGB 4H0LC 4FF1A 3S1MH 1B44D 2CW0C 1HH2P 4KY7A 4QMGA 2NZOA 1G2TA 2DGYA 4WFN3 4GNXB 3PO3H 3CKIB 5E7NA 1CZGA 5CV6A 3HOYB 3BVGA 4C1NK 4Q5VA 1II3A 2QF7A 1OXVA 1ZYRC 4YIJA 4LFCL 2N49A 4B9WA 1U4MA 1V1PB 1PVOA 4JI6Q 1IBMQ 4CKEA 2F4VL 3U4VA 1Q82C 2PYKA 2ASBA 4K6LA 2O4XA 3F1ZA 3PIO3 3GD7A 5IYDG 3IL8A 2MGSA 3J81j 4LF9Q 1VCIA 2UXCQ 2H4OA 2BDNA 3M4OB 3NEMA 4CDDC 3GTKB 3BDOA 1GUOA 2J0TD 5EJWA 4DK0A 3JAML 4GKKL 1VQDA 2CW0D 2NVQB 3MZ5A 3EJIA 1HNZQ 3TMEA 3IKJA 4A3MB 4JYAQ 1JICA 4LJZC 1YNNC 4I7AA 4LFAL 2E2IB 5C4JH 1PHJA 2RDGA 2K5HA 4LF8L 3KLSX 3GO5A 2F0TA 1KQSA 3HZXA 3L9AX 2F0DA 1IBLQ 1QOHA 2IX0A 2J7ZA 2MUYA 1UEBA 2IPKD 3J81L 1J9OA 1LT5D 3DM3A 4J15A 4UDUC 2IHEA 1AP0A 4L5QA 1EIHA 4DXGA 2MNAA 3M7NA 3A8KE 1XTDA 2VQEL 4DK3C 5AFWA 1RDPD 4BBSB 2I0QA 2ENBA 4ME5A 1DOMA 3GTGH 1I4XA 2DY7A 5ISRA 2XGTA 1SFOB 2VB3X 3K59A 1EIFA 1LM0A 1F9SA 3FKIG 3R93A 4DR5L 3RNUA 4EX5A 1F77A 3HOYH 2R7ZB 5JVH3 1YNND 4IOCA 1N33Q 2I07B 1D7QA 1XPOA 2Z9HA 4QGUA 2F0KA 3CCEA 4HIDA 3KDFB 1SYDA 5LMUL 2KCTA 1VQPA 3H3VC 2UU9Q 1UNSA 4DGZA 5IT9E 1B70B 2K04A 1Q90A 2ZXRA 1LYLA 1FJGL 4UP9A 4DV2L 1E2ZA 2UUBL 1RIPA 5M3MH 3S9WA 4TQUS 2D2CC 1SNQA 2QW7A 5JPNC 1MHWC 3LWEA 1STBA 3RMHA 1WTXA 3S2DB 4UAIA 5M9OA 3GTKH 4DUYL 5JEAG 1JMCA 3SHLA 2QDBA 1RTNA 3NPPA 4DR6Q 3T53B 2PZWA 2NVQH 5IWAQ 3WOFA 4B3TQ 3NTHA 3V2TA 4A3MH 4JVZA 1ILPA 1STNA 4KY5A 1YHQA 2FMCA 2K5DA 1EU4A 3P1HA 4BBRB 1JORA 5C44B 4NW2A 1MSHA 3SE0A 2H5XA 3H91A 4B9XA 3PUVA 4P71A 4YWLA 1I6VC 2EYPA 3D8GA 3HFZB 2KECA 3MEHA 1Q12A 4RGNA 3T1HL 3NBIA 3D3RA 3AEVA 1N36Q 3I72A 2FMMA 2N3SA 1GJXA 2K6AA 5C4HA 5LMNL 1CM9A 4U68A 5KRUA 1T5EA 4B08A 4A93B 4X65Q 1BF4A 3EFXD 2K5QA 1SFOH 2TMPA 5ELOA 4LF5Q 3S24A 3H94A 5JJKA 1N34L 1C4QA 1YZ6A 1GUTA 2KQ3A 2QKIC 2R7ZH 1K8OA 2JEBI 2JA6G 3KF8A 3L7ZC 4GNXA 2WFWA 1KLGD 3VYSA 4X3UA 3I8ZA 3M85A 2WB1G 1Y1WG 3FHWA 2OT2A 4M1UB 1PFSA 4ALPA 4DN4M 3Q24A 4JV5Q 1HZCA 5FLMG 5E4WC 1E22A 1GXDC 4DV1L 1KC8C 1QVCA 1V1PA 2B8FA 5DLQE 1O7YA 4X6AH 2PNHA 3OMGA 2F1MA 1P16A 3NELA 4LMQD 1AZPA 1K0RA 4J8QA 1IL2A 1Q8IA 2M00A 2Y0SE 4MNOA 3J7AV 3JAME 1FNVA 4EQPA 3FP9A 3A74A 4A3LH 2PZTA 1F9QA 1L0WA 5FLXc 4Z9CB 1EIYB 1HTPA 2KENA 4JI8L 3PO2G 1D1IA 2CVRA 2AUKA 4BBRH 1TT2A 4IPCA 1Q1BA 5C44H 3H3VI 1PZKD 2ZJQA 1XNQQ 3KYHC 4X66Q 5IYBG 3W3AA 4EQNA 1OXTA 5IY0A 5J22A 4A76A 4JBKA 1TS4A 4POFA 2LXJA 3DWAA 4ZCKA 1Y8PB 2EDGA 3NHHA 3MVVA 4DV0L 3RZOB 1G6PA 4K14A 2R93G 1AW7A 2BCOA 1D1KA 1K28A 1Z9FA 2R92B 5JAVA 3LGJA 4A93H 1I94L 3ONAB 2A1AA 1MIUA 3NENA 2F3WA 4QIWB 4ID6A 1LTAD 3RZDB 2XWJB 4BXXG 1H9SB 3S14B 5C4XB 3F2DA 3NBHB 2K5NA 1SNOA 1ENAA 1ZXTA 1X3EA 2YTYA 3S15B 3J80c 1N32L 1RD9D 4R4IA 2B2UA 1G2SA 3CCUA 3HOVG 2OF1A 1VQNA 1WTHA 3NP8A 4ME3A 1KAWA 5DAUA 4CDFC 1SXTA 1MSGA 5JEAJ 4OWWB 4YWKA 5FOBB 1JE4A 1EWHA 2L55A 2WIIB 4GS3A 2KEEA 4KN4C 1JB7A 4WJ3M 1ESRA 1A3TA 1HFNA 1RJTA 4FF2A 1NMFA 3TP6A 4JI2Q 3KDFA 3V96A 4JI3L 4GN4B 3PSIA 1SE8A 4K0KQ 1TWCH 1V1QA 1MJCA 4RFBA 3VA7A 4DR3Q 2GA4B 4FVMA 1QB5D 2PW7A 5HGQA 5IP7H 2E8GA 2EPBA 1G91A 4PMBA 3CPWA 3D6WA 1WTQA 1YNJC 3DUZA 1EFWA 4NXNQ 4BY7B 4NXML 3I91A 2HHHQ 3KLWA 5DM63 5GADC 3G48A 2RDHA 1T5XD 3SK4A 3IRBA 5K36H 4IALA 4DV6Q 2EVBA 2MPMA 1A8VA 3RLOA 4RGMA 2UUCL 5C0XG 2JA5B 5NUCA 1HR0W 1IYJB 5IODA 3GTJB 3HOWB 1EY6A 5C4ZA 3H3VH 2YU9B 2R92H 2B29A 1IKLA 1B1ZA 2FHTA 3H0GG 1U4RA 2CCZA 1DJRD 3VYTA 1I4QA 1B3AA 3RZDH 1HRJA 2LMCB 5C4XH 5IP9H 1UAPA 2LS01 3CCRA 3S14H 2DNEA 4KHVA 2ZXOA 3S15H 3M3YH 1I5FA 4XTCS 1QVGA 3UI2A 1X6OA 1S5BD 1PZJD 3K0XA 3VR6A 2WINB 2C5CA 4MZ9A 2AWOA 5EBDA 1PRTD 4DR7L 1D5ZC 5ELEA 1S3OA 1HZ9A 4JI7Q 1HUNA 3CU7A 2IX1A 3S17B 2KVMA 4XXEA 4C3HB 4DAVA 3HRZC 1FNUA 1U0LA 1H9JA 4KTAA 3C1EA 3T4AC 2R3ZA 4KHPQ 1XNRQ 5I2XA 2Z6BA 2PI2A 1VQMA 4DV5L 1A2UA 4JW0A 4YHHQ 1Y14B 4A3IB 4PQXA 3S2HB 3HOZG 1L1OB 1LABA 4POGA 1LT6D 2EY6A 3MC0B 1TQOA 4K5WA 3MA2B 1VQJA 1Q81C
chains in the Genus database with same CATH topology
3SVMA 3P7JA 3FPUB 5EQ0A 4Q0FA 1CHQD 2K32A 4V0BA 2K1BA 1EWCA 1IW7C 2BA1A 1G6ZA 5EKLA 2YYZA 3MXUA 1D5XC 2Q8TA 4KKSA 5CYUA 1OXUA 1CK1A 2M9VA 4XYOA 5I6YA 1I3QB 3AB9A 2Q8IB 1KDBA 2RQXA 2NWGA 3E6ZX 4BA2I 2ID0A 3O13A 1ILQA 3OMCA 4KJNA 1EFID 1UUPA 4C3JB 2RSOA 1BXTA 1SBBB 4A3BB 4PMWA 3FRPB 3NBHA 4FXKC 1TKWB 4KJOA 1BDOA 4C1NI 1CA6A 2EJFC 1IW7D 5TSSA 3SR1A 2JE6I 3TDQA 1LTID 2EYMA 1EYDA 1PRTB 4L63B 4ZYSA 4IN3A 4CHTB 4ZRZA 1B50A 5IGDA 4NP5A 1XTCD 3FEWX 3QG1A 3BVMA 1DONA 4QF4A 1LV9A 2NYZD 1RTOA 3WDNA 2B2UC 3Q23A 5KYIA 2KCCA 3C1FA 2KJXA 5C0XJ 1F2YA 4IUVA 3I4LA 1PRTF 2EE1A 5CBEE 3K0YA 5BN4A 4FP5D 2I46A 1F2LA 1PFMA 1HFGA 4C3IB 1TY2A 2QCPX 2MP1A 1NR2A 2SDFA 1HHVA 5F2DA 2NUCA 1SJED 4QCLA 5ELDA 2RBMA 2SNSA 2F0OA 2NVXB 4HTHA 2DY8A 4E6IA 4HMIA 3BDLA 4G7HC 1RCVD 3J7AF 5C6AA 1NSNS 4ZAIA 1SYGA 1IHZA 4F7XA 3K5OA 2D62A 3I3CA 2F0EA 4HR7B 2D5DA 1PZID 3HG9A 2MJ8A 1DZ1A 1EIGA 4DA2A 5KNCA 1TWGB 1KNEA 1PDQA 2EY2A 1ZEQX 4XDXA 3T13A 4XQQA 3K5MA 3QOLA 1I4HA 1W6KA 1ONLA 3TSSA 3N52A 5IGBA 2L9HA 3OIQA 4CBVA 3M4YA 3GP7A 1SNPA 2K03A 1B2TA 1L0YB 5KNDA 3T56B 4IUPA 1LO5D 5G3LD 2EYOA 1FGBD 1HCZA 3K57A 5CORA 3J7YW 1EY0A 2A68C 2G9HD 2N55A 2E2JB 1Y8NB 3OWFA 2NN6H 4JK1C 3KLSA 3SK5A 3T51B 2IL8A 2PMZB 3A8JE 4IFDH 1W6JA 5A2QE 2F4IA 2V4DA 5D3DA 5JJZA 2Z4HA 5EPKA 5T1IA 5CR3A 2A69D 4IQZA 5EBCA 1B9MA 3VR3A 3S1NB 3IAYA 3C3LA 3HEJA 1A3UA 2HCCA 3SK6A 4MN3A 3EVQA 5HURA 2A68D 4C2MB 4ZUJA 1EZ8A 5BN5A 4KKUA 4V190 1EY5A 1IKMA 1DXMA 4OGQC 2A74C 4Y7NB 4NMZA 4EQOA 1QNKA 2PO4A 2LFNA 1R4PB 2WACA 1PTOF 2L4NA 3NTIA 2E75C 3OW7A 3A8IE 1VF5C 1U4LA 3D6CA 4KV6A 4BY1B 2BE5D 5M3FB 4RKBA 5C3WA 4N9PA 3ITPA 4HSVA 4FF4A 4A3EB 5CMDA 2RKSA 5FLXL 1Z47A 4DNRB 4HAEA 3NWTA 2BA0A 3OOCA 4R9WA 2VUMB 4A3FB 5E1FA 3OWEB 1BCPD 3BG3A 1ENCA 5G3LF 1ML0D 2K7VA 3KK7A 3VR5A 1X3PA 1I4GA 1K8MA 1EL0A 2B2TA 4HSPA 2EYJA 3ZYYX 1XXGA 2HQEA 1GHJA 1WD0A 2F0JA 2WAQB 5DEHA 2L12A 1SYBA 5K36G 1CQFA 5JOBA 3J80L 3C46A 2D9UA 2FINB 3HS0C 1SMYC 1KTKA 4RHSA 3HKZB 4IUTA 3HOUB 2QEJC 5FO8B 3URYA 3E5SA 2F0IA 3MWYW 1H9MA 2OEOA 4H13C 4J6HA 2NVYB 1BOSA 4MIUA 1JOQA 4IUQA 2PQEA 5HGTA 1QNUA 3DM1A 2F0VA 3D4DA 5IIFA 5IGEA 1WTVA 2EYHA 3KLRA 2LY7A 1PLFA 4GZYC 3V05A 1EQTA 2JP1A 1SMYD 3IFDA 4K5XA 4ZK9B 5KNBA 4A3DB 3SDZA 5KYLA 3J81E 5C3EB 5FKAC 4RH6A 3A7LA 2XSCA 2SOBA 4DU9A 2B2VA 5BN3A 3MXPA 4J1MA 1BBXC 3ND9A 1F2ZA 2A6HD 2HDMA 1M4VA 4ABNA 3X3NA 2K28A 2F0HA 1MD2D 2SEBD 1BCPF 3TP7A 4A3JB 3VA5A 3I70A 1RKNA 2AUJD 2A6ED 2RSNA 2A5HA 3NQTA 1HXYD 3RD4A 1B4OA 1TWHB 2EYLA 3K58A 3GTMB 5I4DA 1VF7A 2F0MA 5E3FA 4FXGC 4PNYA 4C3HG 1X3QA 2M2LA 1Z6HA 4ZKCB 3Q6SA 1PRTC 2E2HB 4K8JA 1IYVA 2EY1A 3G7LA 1D2BA 4KD4A 1H9RA 3E0JA 1JCKB 4K2KA 3HOXB 5EPJA 5EKKA 3S16B 5IGGA 2XIWA 5C3XA 1BNZA 2F0GA 3A7AB 1DOLA 3EA6A 4S3SA 4K5VA 5M5WB 1A6XA 4QUFA 2FJ2A 1XWEA 2J4XA 1GUSA 1LTBD 2F0NA 4N9TA 1V8QA 5D65A 3Q22A 3H09A 2L5TA 1WTRA 1LTSD 1Y1VB 5LHY1 2XNAC 4OO1I 2JXMB 2JEAI 5CBAE 5CV9A 2KEDA 2B2TC 2F0UA 4OL7A 2A73B 3FMCA 4C3JG 4FXDA 4RCOA 5EPLA 2XRSD 1FNWA 1O80A 3KBGA 5C0XI 1QWYA 4K6DA 1OXSC 3NTKA 4OHJA 2KHSA 4RA8A 3BYYB 1SYEA 5DM73 4WRDA 3DWPA 1TIID 3MFGA 2JA7B 5FO7B 1HPCA 2F3VA 3ND8A 1ENFA 3F2UA 4K8IA 1PFNA 1EY7A 1DYQA 4ODGA 2O2LD 1DD2A 2X69A 3C2PA 4XT3B 3QJYA 1G8ZD 1EEID 2KUMA 4XYQA 2NN6G 3D4WA 1E2VA 3NSWA 3OSOA 3ERQA 4C3IG 5CGKA 4QB4A 4IFDG 3I4MB 4ILWA 3A54A 3GTOB 2ZXPA 4KN7C 3RUZA 4HEDA 2K05A 1TS2A 3OPOA 2B63B 2VNUD 3S1QB 5CV8A 4G57A 4O42A 2Y0SB 5I2YA 2B2VC 1KDAA 1E0BA 3S1RB 1JC7A 4HN7A 1R4QB 4C56C 3S1MB 5FK9C 1I4RA 1C8CA 3I4NB 3NXWA 4OO1H 1EY8A 5ELBA 4I65A 2R61A 1JWUD 2NTTA 2NB0A 1HUMA 4RCNA 1PTOC 2ZT9C 3MXNA 3OHXC 2TSSA 5IT9L 3CRKC 4CKCA 1SSOA 1RODA 1A2TA 1I6HB 1WTWA 1KNAA 4EGVA 3MTSA 5KIXA 2DN8A 4F8MA 4PMCA 3Q0AA 2B39A 1U9RA 3PUZA 2L11A 4CKBA 4IUUA 5LL6S 1KDCA 1B9NA 1G291 2NTSA 4TKOB 3BVZA 1LT4D 1MI2A 2WKDA 3GTPB 1TWAB 3HP3A 3SK8A 5FO9B 1PTOD 3OIPA 3LWUA 3EQLC 1STEA 2XWBB 4DNTB 2EJMA 3LNNA 3M7GA 2DNCA 1EYCA 2X6GA 2JA8B 1SYCA 1JR0D 2E76C 4XQNA 1I4PA 3GTLB 2A69C 3QOJA 2CQAA 1SE4A 1TWFB 5J39A 5K5PA 3FPPA 1LLRD 1SEBD 1PMRA 1O7LA 4RGTA 1Y69U 3DWQA 4TRDA 2IW3A 3A55A 3P75A 2E74C 1XYIA 1IYUA 3FVQA 5EGTA 3WOEA 5M3MB 4X3KA 3R8BA 4A3GB 4OIKA 1GUWA 5DNFA 4H7BA 1S5FD 5A35A 4IFDJ 4XT1B 1CA5A 5LL6X 1PYWD 2R6GA 1ZKOA 3NQIA 4P2CB 5ELFA 4BWGB 1DOKA 5C5MA 1VDZA 1ET6A 2B2WA 3TP8A 4TSSA 1SAPA 2Q8RE 1SNMA 3EROA 1H9KA 1TY0A 1ZYRD 4R8IA 1BQQT 2BE5C 2K33A 1S5CD 1SNCA 1JOOA 1SE2A 4CGYB 1PTOB 1OXXK 1Y8OB 1UEAB 2Z8LA 1IL8A 3A56A 2ICEC 5M5YB 2XVSA 1XX8A 1O7ZA 1BCPC 5CV5A 5EKIA 5M5XB 4KD3A 1V1OA 4EVOA 3NK9A 5ELCA 3K5LA 3K5NA 2F0SA 4RAUC 1ICWA 2F0PA 1EQVA 1JQYD 1TU2B 1STYA 1A15A 3TBIB 1BR9A 2IJ0A 1V43A 2BOSA 3PV0A 3MXGA 1C48A 1L0XB 3VYUA 4XIGS 1NUCA 2BDOA 1RF2D 4R8NA 4PV1C 5T1GA 1CTMA 3KUPA 1M8AA 4WJWA 4CJ0B 1QE6A 2AQ2B 1U4PA 3TZDA 3FKIB 1JOKA 5COYA 3NWSA 4G4KA 4DF7A 1SYFA 4IUNA 1S4ZA 3N6RA 3DEPA 2RVLA 2N88A 1PTOH 4ZQ3A 3L3OC 4ULLA 1DCZA 1VMCA 2EYFA 3GTQB 4G7OC 1WTOA 2O5JC 2PW5A 5CV7A 5CC4A 1FD7D 4F88A 5I9PA 2B8GA 1CI3M 4CJ2C 1B53A 2A6HC 3RLFA 2PPBC 1TR5A 2NVTB 1BUVT 1TWCB 5JVG3 3FDTA 3U9SA 4RKLA 4KKTA 1GOZA 2CHBD 4RWSC 2NBFA 4LAAA 1RHPA 3NE5B 1DM0B 2Z4IA 2A6EC 3GV6A 1S5DD 1LTRD 3SXHA 5I9OA 1BCPB 1CFMA 1STHA 2HUGA 3CQZB 4KMUC 3TZUA 2AWNA 4XQJA 2JA6B 1QILA 1SDFA 4DFAA 2Z1CA 2WB1B 1Y1WB 1ESFA 2KOLA 5I6WA 2B2WC 1FR3A 4HMJA 3QB3A 3QIAA 1EU3A 3M3YB 1HQRD 3K7AB 5JEAH 4U673 4WORA 3BYTB 1TS3A 1JWSD 1R9TB 2PNRC 1KLUD 2AQ3B 1BO0A 2OXPA 1QCBD 3P20A 3PO2B 1F9RA 1AZQA 5E4XA 3NUCA 1D5MC 3IFTA 2B2YA 2KA7A 1GUGA 5IGCA 4IURA 4FNFA 5FLXE 2NZ1D 1ET9A 1HA5A 4FF3A 1EYAA 1S5ED 3PUYA 4LK1C 1HQMC 1PXUA 3GV3A 2XN9C 3PIP3 1WD1A 1A3VA 1EY4A 1EY9A 3MHBA 2IWHA 2QILA 2R93B 4OO1G 1AN8A 1Q3LA 3MAQA 4X3TA 1STGA 3W2DA 1CQVA 3DMUA 3R3OA 2F03A 4KHZA 3BZDB 4QUCA 1F9PA 3VR4A 3HOVB 4M8AA 4DXFA 2HDLA 1CZWA 1MGSA 3BS1A 1PFBA 3H6MA 3J80E 1O78A 1FYCA 4DK1A 2EXZA 1STAA 1EZ6A 1NAPA 4FO2A 4K2LA 5J1ZA 3D4RA 4KI0A 2WKCA 1NR4A 3I73A 3D31A 4ZUIA 2AQ1B 4F87A 1YNJD 2LKVA 2IT1A 2WV6D 2F0FA 2L0CA 2EZVA 1JWMD 2C9OA 2JYOA 1JB3A 1SE3A 3T16A 4NKLA 5KGUA 4L6TB 5C5LA 4HCEA 5KEEA 2WP8J 1KAAA 4RHRA 3KBXA 1HA6A 1LT3D 1Z7TA 2F0WA 1WVLA 4X3SA 4ZKBB 1GHKA 3H0GB 4I7ZC 2EOTA 2FFKB 1KABA 2IX3A 1AFPA 4HCSA 3R2TA 1K83B 4H44C 2VXWA 2HCIA 1LTTD 3DHQA 1SJHD 1EEFD 3QO2A 3CRLC 5A2QL 3DXJC 5IGFA 1E2WA 3HGBA 1CT1D 4RGOS 1SNDA 3PUXA 2E2DC 2EJGC 5D14A 4BA1I 1MBYA 2K01A 2PCFB 4BS9A 4G7ZC 2X6LA 3X3MA 1I50B 1H9SA 1LTGD 3PUWA 1EOTA 4JBWA 3HOZB 4KY6A 2F0QA 3TP5A 2PZUA 3GQBA 4NDXA 3PO3B 1GUNA 1TS5A 1D6EC 3AU7A 1LACA 2RDFA 4FYDA 1J8IA 1Q1EA 4OIJA 1F2MA 3G6JB 3MFYA 4DAPA 3CHBD 1QJOA 3QWNA 2NN6I 5C0XH 4ZLTF 2ICIA 1AEXA 3AMUA 4IFDI 2EY5A 5JPMC 2XRQD 2MHVA 1X32A 2O5IC 5CV4A 4DAYA 3PMFA 4A3KB 1WTPA 5D3IB 1NCVA 3R2IA 3TN2A 4O1NA 1VMPA 4L8JA 2B2YC 2H1EA 3DEOA 3U9OA 3I90A 1WCMB 5C4JB 2KCNA 4IZ8A 4CJ1B 3VYRA 3VR2A 2K5WA 1OO9B 1HTLD 3K6OA 2L1BA 4KK7A 2F0LA 1TVXA 1CHPD 2RA4A 2JSOA 5IOCA 4MHEA 3BDCA 3LX0A 2G9DA 2SNMA 2VB2X 1QG7A 4AYBB 3GTGB 4H0LC 4FF1A 1B44D 2CW0C 4KY7A 4QMGA 1G2TA 4WFN3 3CKIB 1CZGA 5CV6A 3HOYB 3BVGA 4C1NK 4Q5VA 1II3A 2QF7A 1OXVA 1ZYRC 4YIJA 4B9WA 1U4MA 1V1PB 4CKEA 2PYKA 4K6LA 2O4XA 3PIO3 3GD7A 3IL8A 2MGSA 1VCIA 2H4OA 2BDNA 3M4OB 3GTKB 3BDOA 1GUOA 2J0TD 5EJWA 4DK0A 3JAML 2CW0D 2NVQB 3MZ5A 3EJIA 3TMEA 3IKJA 4A3MB 1JICA 4LJZC 1YNNC 2E2IB 2RDGA 3KLSX 3GO5A 2F0TA 3HZXA 3L9AX 2F0DA 1QOHA 2IX0A 2J7ZA 2MUYA 2IPKD 3J81L 1J9OA 1LT5D 4UDUC 1AP0A 1EIHA 4DXGA 3M7NA 3A8KE 5AFWA 1RDPD 4BBSB 2ENBA 4ME5A 1DOMA 1I4XA 2DY7A 5ISRA 1SFOB 2VB3X 3K59A 3R93A 1F9SA 1F77A 2R7ZB 5JVH3 1YNND 2I07B 2F0KA 1SYDA 3H3VC 1UNSA 4DGZA 5IT9E 2K04A 1Q90A 2ZXRA 1E2ZA 3S9WA 4TQUS 2D2CC 1SNQA 5JPNC 3LWEA 1STBA 3RMHA 1WTXA 3S2DB 4UAIA 5M9OA 5JEAG 3SHLA 2QDBA 1RTNA 3NPPA 3T53B 2PZWA 3WOFA 3NTHA 3V2TA 1ILPA 1STNA 4KY5A 2FMCA 2K5DA 1EU4A 3P1HA 4BBRB 1JORA 5C44B 4NW2A 1MSHA 3SE0A 3H91A 4B9XA 3PUVA 1I6VC 2EYPA 3D8GA 2KECA 3MEHA 1Q12A 4RGNA 3NBIA 3D3RA 3I72A 2FMMA 1GJXA 2K6AA 5C4HA 1CM9A 4U68A 5KRUA 1T5EA 4B08A 4A93B 1BF4A 3EFXD 2K5QA 2TMPA 3H94A 1C4QA 1GUTA 2KQ3A 2QKIC 1K8OA 2JEBI 3KF8A 3L7ZC 1KLGD 3VYSA 4X3UA 3I8ZA 3M85A 2OT2A 4M1UB 4DN4M 3Q24A 5E4WC 1GXDC 1V1PA 2B8FA 1O7YA 3OMGA 2F1MA 4LMQD 1AZPA 4J8QA 1Q8IA 2M00A 3J7AV 3JAME 1FNVA 4EQPA 2PZTA 1F9QA 4Z9CB 1HTPA 1D1IA 2CVRA 2AUKA 1TT2A 1Q1BA 1PZKD 3W3AA 4EQNA 1OXTA 5J22A 1TS4A 3DWAA 1Y8PB 2EDGA 3NHHA 3MVVA 3RZOB 4K14A 1AW7A 2BCOA 1D1KA 2R92B 5JAVA 3ONAB 2F3WA 4QIWB 4ID6A 1LTAD 3RZDB 2XWJB 1H9SB 3S14B 5C4XB 1SNOA 1ENAA 1ZXTA 3S15B 1RD9D 2B2UA 1G2SA 2OF1A 3NP8A 5DAUA 1SXTA 1MSGA 5JEAJ 5FOBB 1JE4A 1EWHA 2L55A 2WIIB 2KEEA 4KN4C 1ESRA 1A3TA 1HFNA 1RJTA 4FF2A 3TP6A 3V96A 4RFBA 3VA7A 2GA4B 4FVMA 1QB5D 2PW7A 2EPBA 1G91A 4PMBA 3D6WA 1WTQA 1YNJC 3DUZA 4BY7B 3I91A 5DM63 2RDHA 1T5XD 3SK4A 5K36H 4IALA 2EVBA 2MPMA 4RGMA 5C0XG 2JA5B 5NUCA 5IODA 3GTJB 3HOWB 1EY6A 5C4ZA 2YU9B 1IKLA 1B1ZA 2FHTA 1U4RA 1DJRD 3VYTA 1I4QA 1B3AA 1HRJA 2LMCB 1UAPA 2LS01 2DNEA 4KHVA 2ZXOA 4XTCS 3UI2A 1S5BD 1PZJD 3VR6A 2WINB 2C5CA 2AWOA 5EBDA 1PRTD 1D5ZC 5ELEA 1HUNA 3CU7A 2IX1A 3S17B 2KVMA 4XXEA 4C3HB 4DAVA 3HRZC 1FNUA 1H9JA 4KTAA 3C1EA 3T4AC 2R3ZA 5I2XA 1A2UA 4A3IB 4PQXA 3S2HB 1LABA 1LT6D 2EY6A 3MC0B 1TQOA 4K5WA 3MA2B 3SEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0L A;  5CR3 A;  4LAA A;  1SND A;  5IOC A;  3NXW A;  1EY8 A;  5C6A A;  5CV9 A;  2EYJ A;  4TRD A;  2F0H A;  2HQE A;  3BDC A;  3LX0 A;  3P75 A;  4I65 A;  2SNM A;  5EGT A;  2PW7 A;  3SXH A;  2F0K A;  5I9O A;  2F0U A;  5F2D A;  4OL7 A;  2F0J A;  3H6M A;  2NUC A;  3TP7 A;  5DEH A;  5EKL A;  4KY7 A;  3OMG A;  1SYB A;  1SYD A;  4PMB A;  4QMG A;  3VA5 A;  1STH A;  2RBM A;  5JOB A;  4H7B A;  1NUC A;  3HEJ A;  1A3U A;  2SNS A;  2F0O A;  2EXZ A;  4DGZ A;  1RKN A;  4HTH A;  3SK6 A;  1STA A;  3EVQ A;  4R8N A;  4E6I A;  1EZ6 A;  5HUR A;  4HMI A;  5CV6 A;  1A2T A;  2M00 A;  4K2L A;  3BDL A;  4KY6 A;  2F0Q A;  3TP5 A;  5J1Z A;  2PZU A;  5C5M A;  4ZUJ A;  3SK4 A;  4DFA A;  3NQT A;  4K6D A;  4EQP A;  1EZ8 A;  1II3 A;  5I6Y A;  3S9W A;  5KIX A;  4YIJ A;  4NDX A;  1NSN S;  1SNQ A;  3E5S A;  4F8M A;  4PMC A;  4IAL A;  4B9W A;  2PZT A;  1EY5 A;  1JOK A;  2F0I A;  4ZUI A;  1KDB A;  1SYG A;  1STB A;  3TP8 A;  2EYL A;  4DF7 A;  1SYF A;  2LKV A;  5M9O A;  2KHS A;  1IHZ A;  4F7X A;  1U9R A;  1SNM A;  2OEO A;  4IUN A;  2QDB A;  1SYE A;  3SHL A;  2F0M A;  2PYK A;  5I6W A;  4WRD A;  2RDF A;  5E3F A;  1TT2 A;  3ERO A;  4NMZ A;  4J6H A;  2F0E A;  2PZW A;  4MIU A;  4PNY A;  2O4X A;  5NUC A;  4EQO A;  3OMC A;  4HMJ A;  3QB3 A;  4KJN A;  1JOQ A;  4ZQ3 A;  1EY6 A;  2F3V A;  5C4Z A;  2PQE A;  1KDC A;  2F0F A;  5HGT A;  1F2M A;  3V2T A;  2EY2 A;  4EQN A;  1STN A;  2EYF A;  4K8I A;  2F0V A;  4KJO A;  5J22 A;  3D4D A;  4KY5 A;  2WAC A;  1EY7 A;  1SNC A;  4NKL A;  1JOO A;  4K8J A;  3T13 A;  3T16 A;  4ODG A;  5IIF A;  5IGE A;  3P1H A;  3QOL A;  5IOD A;  1JOR A;  4KHV A;  5KGU A;  2EYH A;  2EY1 A;  3MVV A;  1AEX A;  3MZ5 A;  3NHH A;  3EJI A;  4K14 A;  4WOR A;  5C5L A;  3SR1 A;  5IGB A;  3SK8 A;  4KD4 A;  3TME A;  4B9X A;  5KEE A;  3D6C A;  2EY5 A;  2PW5 A;  1KAA A;  2EYP A;  5CV7 A;  5CC4 A;  4K2K A;  5JAV A;  4KV6 A;  3D8G A;  4K5X A;  2EYM A;  1EYD A;  3MEH A;  2F3W A;  2OXP A;  1SNP A;  4ID6 A;  4RKB A;  5CV4 A;  5EKK A;  5C3W A;  4N9P A;  3PMF A;  5IGG A;  3ITP A;  3D4W A;  5C3X A;  2F0G A;  1SNO A;  1ENA A;  5IGD A;  3NUC A;  2F0T A;  2F0W A;  3ERQ A;  3OSO A;  4NP5 A;  4QB4 A;  5CGK A;  5C4H A;  3HZX A;  5IGC A;  2F0D A;  5KRU A;  2OF1 A;  5CV5 A;  3NP8 A;  2EYO A;  4QF4 A;  2RKS A;  4S3S A;  4K5V A;  5DAU A;  1EYC A;  5I9P A;  5KYL A;  1EY0 A;  4KD3 A;  4KTA A;  3C1E A;  1SYC A;  3U9O A;  4EVO A;  3RUZ A;  3OWF A;  1EYA A;  5KYI A;  3C1F A;  1KAB A;  1TR5 A;  3NK9 A;  3SK5 A;  1F2Y A;  1A3V A;  1EY4 A;  1EY9 A;  1A2U A;  2F0N A;  1A3T A;  3MHB A;  3QOJ A;  4IZ8 A;  2SOB A;  4N9T A;  5E1F A;  5CV8 A;  4DU9 A;  2F0S A;  5J39 A;  4G57 A;  2KQ3 A;  5K5P A;  3DHQ A;  3TP6 A;  2F0P A;  4RKL A;  3MXP A;  1EQV A;  2ENB A;  4ME5 A;  1STG A;  1ENC A;  2EY6 A;  3DMU A;  4J1M A;  1TQO A;  1STY A;  3R3O A;  4K5W A;  5ISR A;  1F2Z A;  1KDA A;  5IGF A; 
#chains in the Genus database with same CATH topology
 3SVM A;  2RCF A;  3P7J A;  3FPU B;  5EQ0 A;  4GNX C;  3PO3 G;  4Q0F A;  4HJ8 A;  1CHQ D;  2K32 A;  5AJ3 Q;  2A8V A;  4V0B A;  3AQQ A;  2K1B A;  4QL5 A;  1EWC A;  4DV7 Q;  1IW7 C;  2BA1 A;  1G6Z A;  5EKL A;  1GVP A;  2YYZ A;  1HNZ L;  3MXU A;  1D5X C;  2Q8T A;  4LW1 A;  1MKH A;  4KKS A;  5CYU A;  4JYA L;  1P8L A;  3J81 i;  1HNW Q;  1OXU A;  2UXB Q;  1CK1 A;  2M9V A;  2JA5 H;  1E24 A;  3GTJ H;  4XYO A;  3HOW H;  5I6Y A;  2YU9 H;  1I3Q B;  1FGU A;  3AB9 A;  2Q8I B;  1KDB A;  2RQX A;  2NWG A;  1PH9 A;  3E6Z X;  4BA2 I;  4KLK A;  2ID0 A;  3O13 A;  3I2Z A;  1ICF B;  1VQA A;  1ILQ A;  3OMC A;  4KJN A;  1EFI D;  1UUP A;  4LWC A;  4C3J B;  2RSO A;  4JI4 Q;  1BXT A;  1SN8 A;  4UP8 A;  1SBB B;  4A3B B;  4PMW A;  3FRP B;  3NBH A;  4FXK C;  1TKW B;  4KJO A;  2ATW A;  1WJJ A;  1BDO A;  4DPG A;  1M1K C;  4C1N I;  1CA6 A;  2EJF C;  1IW7 D;  1QUQ A;  5TSS A;  3EN2 A;  3S17 H;  3SR1 A;  1KRS A;  2JE6 I;  4C3H H;  3TDQ A;  1JE5 A;  1LTI D;  2EYM A;  1EYD A;  1PRT B;  2WAQ E;  4L63 B;  4ZYS A;  3KFU A;  4IN3 A;  1N33 L;  3ZJY C;  4CHT B;  1L2F A;  4ZRZ A;  1WOC A;  1B50 A;  5IGD A;  4NP5 A;  1XTC D;  4EQ5 A;  3FEW X;  3QG1 A;  2AHO B;  3BVM A;  4R4Q A;  4A3I H;  3S2H H;  3TEH B;  4QF4 A;  3UDF A;  1EOV A;  1LV9 A;  2NYZ D;  1DON A;  2UU9 L;  1RTO A;  3WDN A;  4AYB G;  2B2U C;  3Q23 A;  1CUK A;  5KYI A;  2KCC A;  3C1F A;  2KJX A;  4YY3 Q;  5C0X J;  1F2Y A;  4IUV A;  2RHS B;  2CFM A;  1QVF A;  3I4L A;  1PRT F;  2EE1 A;  4LUZ A;  1HNX Q;  5CBE E;  2OCE A;  2V1C C;  3HOY G;  3K0Y A;  5BN4 A;  1J5E L;  4FP5 D;  2I46 A;  4AQY L;  1F2L A;  1PFM A;  3G71 A;  1HFG A;  3G6E A;  4C3I B;  5JJI A;  1TY2 A;  3M4Q A;  1HR0 L;  2QCP X;  2MP1 A;  3KJO A;  1NR2 A;  2SDF A;  1X54 A;  1HHV A;  5M3M G;  5F2D A;  4TVA B;  2NUC A;  1SJE D;  1I3Q H;  5IE8 A;  4QCL A;  5ELD A;  2YV5 A;  1UE7 A;  2RBM A;  2LXK A;  1GD7 A;  1CSQ A;  2SNS A;  2F0O A;  2NVX B;  4HTH A;  2DY8 A;  4E6I A;  1K9M C;  4HMI A;  4X62 Q;  3BDL A;  1FL0 A;  3E9I A;  4G7H C;  1H95 A;  5IYC H;  1N9W A;  1RCV D;  4C3J H;  3J7A F;  5C6A A;  1NSN S;  4ZAI A;  1NY4 A;  4A3M G;  4A3B H;  1I50 H;  4LF6 L;  1SYG A;  1XMQ L;  2KBN A;  1IHZ A;  4F7X A;  3K5O A;  2D62 A;  3I3C A;  4B3M Q;  2E5L L;  2F0E A;  4HR7 B;  1TXY A;  2D5D A;  1PZI D;  3HG9 A;  2MJ8 A;  3KF8 B;  1DZ1 A;  5H1S E;  4LF5 L;  1EIG A;  4DA2 A;  1LTL A;  5KNC A;  1TWG B;  1KNE A;  1PDQ A;  2EY2 A;  1ZEQ X;  4B3R Q;  4XDX A;  3T13 A;  4XQQ A;  2UUA Q;  3K5M A;  2CQO A;  3QOL A;  1I4H A;  1W6K A;  1ONL A;  3TSS A;  3N52 A;  5IGB A;  4DR2 Q;  1PH4 A;  3CMA A;  1E7Z A;  2L9H A;  2WB1 E;  3OIQ A;  2EIF A;  4JI0 Q;  4GKJ Q;  4CBV A;  3F2C A;  3M4Y A;  1XJV A;  3GP7 A;  1SNP A;  2K03 A;  1E3P A;  1B2T A;  1L0Y B;  5KND A;  4PZ7 A;  3T56 B;  1L1O A;  4IUP A;  4MTK A;  1LO5 D;  5G3L D;  5IT9 c;  2R7Z G;  2EYO A;  1FGB D;  1HCZ A;  3K57 A;  5COR A;  3J7Y W;  1K8G A;  3CCV A;  4A3K H;  1EY0 A;  2A68 C;  4DR4 Q;  2G9H D;  2N55 A;  3J7A 5;  3OWF A;  1Y8N B;  2NN6 H;  4JK1 C;  2E2J B;  1W2B A;  3KLS A;  5GQO A;  3SK5 A;  3T51 B;  4HIO A;  2IL8 A;  4C3I H;  2PMZ B;  3A8J E;  4IFD H;  1W6J A;  2JN4 A;  1A62 A;  4HJ5 A;  1WCM H;  5A2Q E;  2F4I A;  2V4D A;  5D3D A;  1BKB A;  5JJZ A;  2Z4H A;  5EPK A;  5T1I A;  5CR3 A;  1VQK A;  2A69 D;  4LF4 Q;  2NVX H;  4R4C A;  4IQZ A;  5EBC A;  1B9M A;  5BR8 L;  2Q2U A;  3VR3 A;  3J7Z C;  3S1N B;  4A3L G;  3IAY A;  3C3L A;  3HEJ A;  1A3U A;  2HCC A;  4HJ7 A;  3SK6 A;  4MN3 A;  3EVQ A;  1K3B C;  2A68 D;  5HUR A;  1PA6 A;  4C2M B;  1HZA A;  4BBR G;  5C44 G;  2QA4 A;  4ZUJ A;  3PCO B;  1EZ8 A;  1C9O A;  5BN5 A;  4KKU A;  4V19 0;  1TWG H;  1EY5 A;  1IKM A;  1DXM A;  4OGQ C;  2A74 C;  1GO3 E;  3I4O A;  4OWX B;  3CCJ A;  4DV3 L;  1XMO L;  1PV4 A;  4Y7N B;  4NMZ A;  4EQO A;  1QNK A;  2PO4 A;  2LFN A;  1R4P B;  4A93 G;  2QGQ A;  2WAC A;  4JI2 L;  1PTO F;  2L4N A;  2MQH A;  3NTI A;  2E75 C;  3OW7 A;  3A8I E;  1VF5 C;  4X64 L;  1U4L A;  3D6C A;  3M4O H;  1O7I A;  3CPF A;  4KV6 A;  4BY1 B;  2BE5 D;  1HJP A;  2E2J H;  2ZM6 Q;  2OQK A;  4RKB A;  5M3F B;  1NE3 A;  5C3W A;  4N9P A;  2JK8 A;  3ITP A;  4JG2 A;  3CCS A;  2YTX A;  4HSV A;  3W5O A;  4FF4 A;  2DJG C;  4A3E B;  1JT8 A;  2OQ0 A;  5CMD A;  2RKS A;  2E2I H;  5FLX L;  1Z47 A;  4DNR B;  4HAE A;  3NWT A;  1SLJ A;  2BA0 A;  3OOC A;  4Y52 H;  2KHI A;  4R9W A;  2VUM B;  3UE1 A;  1SMX A;  4A3F B;  5E1F A;  2GN5 A;  3K80 C;  3OWE B;  3T1Y L;  1BCP D;  3BG3 A;  1ENC A;  5G3L F;  1ML0 D;  5IP7 G;  2K7V A;  3KK7 A;  3VR5 A;  1X3P A;  1I4G A;  3DLL A;  1K8M A;  4JBJ A;  1EL0 A;  4BBS H;  2B2T A;  4HSP A;  2EYJ A;  4GN3 B;  1VS0 A;  3ZYY X;  1XXG A;  2HQE A;  1GHJ A;  4C2M H;  3W1G A;  3F2B A;  1ASY A;  4DV4 Q;  3ULJ A;  1WD0 A;  3K7U C;  2F0J A;  3VDY A;  2WAQ B;  5DEH A;  2L12 A;  1SYB A;  5K36 G;  1CQF A;  5JOB A;  3J80 L;  3C46 A;  2D9U A;  2FIN B;  3HS0 C;  1SMY C;  1XPR A;  1KTK A;  1UE6 A;  4RHS A;  3HKZ B;  4IUT A;  3HOU B;  1K8A C;  2QEJ C;  1C0A A;  5FO8 B;  3URY A;  2R92 G;  3E5S A;  2D0O A;  4JI7 L;  2A19 A;  2F0I A;  3MWY W;  2VQF L;  1VQF A;  1H9M A;  3L0O A;  2Q2I A;  2OEO A;  5IP9 G;  5C4X G;  4H13 C;  1KL9 A;  4J6H A;  2NVY B;  1BOS A;  4MIU A;  1JOQ A;  4DUZ L;  4IUQ A;  4LFC Q;  2PQE A;  1XNR L;  5HGT A;  4AIM A;  4O2D A;  3S2D H;  1QNU A;  3DM1 A;  3OTO Q;  4BY1 H;  2F0V A;  2F4V Q;  5M3F H;  3D4D A;  5IIF A;  5IGE A;  5GAG C;  1WTV A;  2EYH A;  3KLR A;  2LY7 A;  1PLF A;  1VQB A;  4A3E H;  4GZY C;  4GN5 A;  3V05 A;  1KXL A;  1EQT A;  2JP1 A;  3KF6 A;  1SMY D;  3IFD A;  4K5X A;  3ER0 A;  4GKK Q;  1X65 A;  1IBK L;  4ZK9 B;  5KNB A;  2VUM H;  4P74 A;  2K75 A;  2UXD L;  4A3F H;  4A3D B;  3SDZ A;  5KYL A;  2HQL A;  3J81 E;  4DR1 L;  5C3E B;  4LFA Q;  1L1O C;  1MJE A;  1BVS A;  3GDE A;  5FKA C;  4RH6 A;  1HNW L;  3A7L A;  4JC0 A;  2XSC A;  2SOB A;  4IPG A;  4DU9 A;  2B2V A;  5BN3 A;  3A0J A;  3MXP A;  4J1M A;  1BBX C;  3ND9 A;  1YHB A;  1QZH A;  1F2Z A;  4GLV B;  2A6H D;  4LF7 L;  2HDM A;  1M4V A;  1QUQ B;  4ABN A;  3X3N A;  2K28 A;  4GLA C;  2VQE Q;  2F0H A;  4GOP B;  2JA5 G;  1MD2 D;  5GAH C;  2SEB D;  1BCP F;  3HOW G;  3ERS X;  3HOU H;  1FVI A;  3TP7 A;  3M4P A;  4A3J B;  2R7D A;  3VA5 A;  3I70 A;  1RKN A;  2AUJ D;  2A6E D;  2RSN A;  2NVY H;  1G51 A;  2A5H A;  3NQT A;  1HXY D;  3RD4 A;  5LMU Q;  1B4O A;  2VL6 A;  1TWH B;  2EYL A;  3K58 A;  3GTM B;  5I4D A;  2Q2H A;  1VF7 A;  2F0M A;  4DV2 Q;  5HY6 A;  4AYB E;  2UUB Q;  2Z6K A;  4FXG C;  5E3F A;  4PNY A;  2C35 B;  4C3H G;  1X3Q A;  4PZ8 A;  2M2L A;  2ZTC A;  1Z6H A;  3CAM A;  1HNX L;  1HZB A;  4DUY Q;  4ZKC B;  3Q6S A;  1PRT C;  2E2H B;  1WYD A;  4K8J A;  1UE5 A;  1OTC A;  1GKH A;  1IYV A;  2EY1 A;  4A3D H;  3G7L A;  1D2B A;  4KD4 A;  3Q8D A;  4A3I G;  1H9R A;  3E0J A;  1JCK B;  4K2K A;  3HOX B;  5C3E H;  1S72 A;  5EPJ A;  5EKK A;  3S16 B;  3RZO H;  5IGG A;  2XIW A;  4NB3 A;  5C3X A;  1BNZ A;  2F0G A;  3B6Y A;  3A7A B;  5EAY A;  1W3S A;  4JI1 L;  1PH3 A;  1DOL A;  3PQI A;  3EA6 A;  2KCM A;  4S3S A;  4K5V A;  2N78 A;  5M5W B;  1A6X A;  4QUF A;  3TRZ A;  2FJ2 A;  4B3S Q;  1XWE A;  4N8F A;  2J4X A;  1GUS A;  1LTB D;  2NZH A;  2F0N A;  5LMN Q;  1B7Y B;  4N9T A;  1V8Q A;  5D65 A;  3Q22 A;  3I56 A;  3H09 A;  2L5T A;  1WTR A;  3OW2 A;  1YIJ A;  3HKS A;  1LTS D;  4A3J H;  1Y1V B;  1N34 Q;  5LHY 1;  2XNA C;  4OO1 I;  2JXM B;  4UY8 C;  2JEA I;  3ULP A;  2K5V A;  5CBA E;  5CV9 A;  1LUZ A;  2KED A;  2I5H A;  3TRE A;  5IYC G;  4OX9 Q;  2B2T C;  2F0U A;  4OL7 A;  2A73 B;  3FMC A;  4C3J G;  4FXD A;  4RCO A;  4A3B G;  3U4Z A;  5EPL A;  1TWH H;  3GTM H;  4HJA A;  4JI6 L;  1IBM L;  2XRS D;  1FNW A;  1O80 A;  4DV1 Q;  1YJW A;  3KBG A;  5C0X I;  4A4I A;  1QWY A;  4K6D A;  3KJP A;  1OXS C;  1KIX A;  3PF5 A;  3PIP A;  3EBE A;  4BY7 H;  3NTK A;  4OHJ A;  4QQB X;  4LF9 L;  2KHS A;  2UXC L;  4RA8 A;  3BYY B;  1SYE A;  2E2H H;  5DM7 3;  4WRD A;  4LFB Q;  3DWP A;  1TII D;  3MFG A;  2JA7 B;  5FO7 B;  1BBU A;  1HPC A;  2F3V A;  3ND8 A;  1ENF A;  1CKO A;  3F2U A;  3HOX H;  1K73 C;  4JI8 Q;  4K8I A;  1PFN A;  3S16 H;  1EY7 A;  3AFQ A;  1DYQ A;  4ODG A;  3UE0 A;  2O2L D;  3I7F A;  1DD2 A;  2X69 A;  4PZ6 A;  3C2P A;  1IZ6 A;  2CWA A;  3QJY A;  4XT3 B;  3D0F A;  1IBL L;  1G8Z D;  5M5W H;  4A3K G;  4LF4 L;  1EEI D;  2KUM A;  4XYQ A;  2NN6 G;  1T9H A;  4OWT B;  3D4W A;  1E2V A;  3NSW A;  4OXP A;  4DV0 Q;  3OSO A;  4GLX A;  3ERQ A;  4C3I G;  5CGK A;  4QB4 A;  4IFD G;  3I4M B;  4RG1 A;  4ILW A;  3A54 A;  1I94 Q;  2Z0S A;  3GTO B;  2ZXP A;  4KN7 C;  1WCM G;  4HED A;  3RUZ A;  2K05 A;  1TS2 A;  1Y1V H;  3OPO A;  1N32 Q;  4GOP A;  2B63 B;  2VNU D;  2AKW B;  2D0P A;  5CV8 A;  3S1Q B;  4G57 A;  1NBW A;  3W1B A;  4O42 A;  4RMF A;  2Y0S B;  3RR5 A;  5I2Y A;  2B2V C;  1KDA A;  2G5D A;  1E0B A;  3S1R B;  1JC7 A;  4HN7 A;  1R4Q B;  4C56 C;  3I55 A;  3S1M B;  5FK9 C;  1I4R A;  1C8C A;  2JJQ A;  3I4N B;  3NXW A;  4YCU A;  1EY8 A;  1X9N A;  4OO1 H;  5ELB A;  3STB C;  4JI3 Q;  2OWO A;  4I65 A;  2R61 A;  1JWU D;  3UDI A;  2NTT A;  2ES2 A;  1CSP A;  2NB0 A;  4R4T A;  1HUM A;  3QR8 A;  4RCN A;  1PTO C;  2CH4 A;  2ZT9 C;  3TS0 A;  4PG3 A;  3MXN A;  3OHX C;  2TSS A;  1VQE A;  5IT9 L;  3CRK C;  4CKC A;  1SSO A;  1ROD A;  4H02 A;  1VQ4 A;  1A2T A;  1GM5 A;  4DR6 L;  1I6H B;  2JA7 H;  2ZM6 L;  1KNA A;  4EGV A;  1WTW A;  3MTS A;  5IWA L;  4LNQ A;  3CF5 A;  5KIX A;  2DN8 A;  3BJU A;  4F8M A;  4B3T L;  4PMC A;  3Q0A A;  1KD1 C;  1CKN B;  1AH9 A;  3F8T A;  5FJ8 H;  2B39 A;  1U9R A;  4NXM Q;  3PUZ A;  3U50 C;  2L11 A;  3OYY A;  3AFP A;  2MO1 A;  4CKB A;  4IUU A;  2RCN A;  5LL6 S;  1KDC A;  1B9N A;  1G29 1;  2NTS A;  2Z6K C;  3K81 C;  4TKO B;  3BVZ A;  3STB D;  1LT4 D;  1MI2 A;  2UUC Q;  2WKD A;  3GTP B;  1TWA B;  1N36 L;  3HP3 A;  3I4M H;  3SK8 A;  5FO9 B;  3J80 i;  1PTO D;  4APV A;  3OIP A;  3LWU A;  2F3I A;  3EQL C;  1X55 A;  4X65 L;  1STE A;  4DV4 L;  2XWB B;  4DNT B;  3BU2 A;  2B63 H;  4OEM B;  2EJM A;  4YCW A;  3LNN A;  3S1Q H;  3M7G A;  2DNC A;  1EYC A;  3CME A;  2X6G A;  2JA8 B;  1SYC A;  4DR7 Q;  1JR0 D;  1D8L A;  3S1R H;  2E76 C;  4XQN A;  1I4P A;  3GTL B;  2A69 C;  3QOJ A;  2CQA A;  3I4N H;  4BBS G;  1SE4 A;  1TWF B;  5J39 A;  5K5P A;  4JCV E;  4JV5 L;  3FPP A;  4R1J A;  1LLR D;  1SEB D;  1O7L A;  1PMR A;  4QIW E;  4P75 A;  2DJF C;  4L5T A;  2ALY B;  4DV5 Q;  4RGT A;  1Y69 U;  1A0I A;  2HIX A;  3DWQ A;  4TRD A;  1VQO A;  2IW3 A;  1VQ7 A;  3A55 A;  3P75 A;  4LUO A;  3OTO L;  2E74 C;  1XYI A;  1IYU A;  3FVQ A;  5EGT A;  4JBM A;  1I6H H;  2ZJR A;  3KF6 B;  3WOE A;  4QY7 A;  5L37 A;  2XTI A;  4HJ9 A;  3E3X A;  5J3B A;  4R4O A;  5M3M B;  4X3K A;  3R8B A;  4A3G B;  4OIK A;  3PF4 A;  1GUW A;  5DNF A;  4OEL B;  4H7B A;  2RF4 A;  1S5F D;  5A35 A;  4A3C H;  4IPH A;  4XT1 B;  4IFD J;  1CA5 A;  2OTJ A;  5LL6 X;  1PYW D;  2R6G A;  1M90 C;  1ZKO A;  3NQI A;  4P2C B;  5ELF A;  4BWG B;  1DOK A;  5GRO A;  5C5M A;  1XNQ L;  1VDZ A;  4IJL A;  1ET6 A;  1SRO A;  4FDB A;  2B2W A;  4X66 L;  3TP8 A;  4TSS A;  4BY1 G;  1SAP A;  5M3F G;  2Q8R E;  1SNM A;  3GTP H;  1KHI A;  3ERO A;  1TWA H;  1H9K A;  1TY0 A;  3SEB A;  4A3E G;  1ZYR D;  1VQ5 A;  4R8I A;  3UDG A;  1BQQ T;  2BE5 C;  2K33 A;  1NNX A;  3WWV A;  2Q2T A;  1S5C D;  1SNC A;  1JOO A;  1SE2 A;  3K8A A;  2VUM G;  4A3F G;  3RLN A;  4CGY B;  1PTO B;  3CC7 A;  1OXX K;  1Y8O B;  4JPB W;  1UEA B;  2Z8L A;  1IL8 A;  2CWP A;  1YI2 A;  2JA8 H;  1KRT A;  3A56 A;  2ICE C;  2ZTE A;  5M5Y B;  2KHJ A;  2XVS A;  3GTL H;  1UWV A;  2GVB A;  4JOI A;  1TWF H;  1XX8 A;  3CCL A;  1O7Z A;  1BCP C;  1SR3 A;  5CV5 A;  5EKI A;  1X3F A;  1PYS B;  5M5X B;  4KD3 A;  1V1O A;  4EVO A;  2IY5 B;  2WAQ G;  1PH5 A;  4K0K L;  3NK9 A;  5ELC A;  3K5L A;  1EQQ A;  3K5N A;  3PIO A;  4UP7 A;  2F0S A;  4RAU C;  4DR3 L;  1ICW A;  2F0P A;  4JI5 Q;  1EQV A;  4GOP C;  1JQY D;  3HKZ G;  1TU2 B;  1STY A;  3HOU G;  2QDL A;  1A15 A;  2VS1 A;  3TBI B;  3TQY A;  4A3G H;  1YJN A;  2OTL A;  1BR9 A;  4YWM A;  2IJ0 A;  4NXN L;  4UPA A;  1V43 A;  1YEZ A;  4DNI A;  1J5E Q;  3JAM c;  2EXD A;  3PGZ A;  2BOS A;  1CKN A;  3PV0 A;  2HHH L;  3MXG A;  4AQY Q;  1C48 A;  3BZC A;  1L0X B;  3VYU A;  1HR0 Q;  4DV6 L;  4XIG S;  1NUC A;  1B3Q A;  2BDO A;  1RF2 D;  4R8N A;  4PV1 C;  5T1G A;  1CTM A;  4O0A A;  3KUP A;  3S1N H;  1M8A A;  4WJW A;  4CJ0 B;  1QE6 A;  2AQ2 B;  1U4P A;  2K50 A;  3TZD A;  3FKI B;  1JOK A;  5COY A;  3NWS A;  4IOA A;  4G4K A;  4DF7 A;  1SYF A;  3J81 c;  4IUN A;  1RL2 A;  2PQA B;  1S4Z A;  3N6R A;  4B3S L;  3DEP A;  4A3D G;  2RVL A;  2N88 A;  1PTO H;  4ZQ3 A;  3L3O C;  1JJC B;  4ULL A;  4LF6 Q;  1DCZ A;  1XMQ Q;  1VMC A;  5C3E G;  2EYF A;  4CDC C;  4Y7N H;  1PH7 A;  5M5Y H;  4L5S A;  3GTQ B;  2E5L Q;  4YCV A;  4HIM A;  3MEF A;  4G7O C;  5IYD H;  2F52 A;  1WTO A;  4QJF A;  2O5J C;  2PW5 A;  5CV7 A;  5CC4 A;  5M5X H;  4L5R C;  1FD7 D;  1N8R C;  4OX9 L;  4KHP L;  4F88 A;  4YHH L;  2CKZ B;  5I9P A;  4DK6 C;  2B8G A;  1CI3 M;  1PH2 A;  4CJ2 C;  1B53 A;  3SGI A;  2A6H C;  3RLF A;  4A3J G;  2PPB C;  1TR5 A;  2NVT B;  1BUV T;  1TWC B;  5JVG 3;  3FDT A;  3U9S A;  3KOJ A;  5AJ3 L;  4RKL A;  4KKT A;  4DAM A;  1GOZ A;  4DV7 L;  1VQ6 A;  2CHB D;  4RWS C;  4LFB L;  2NBF A;  4LAA A;  1RHP A;  3NE5 B;  1DM0 B;  2Z4I A;  2A6E C;  3GV6 A;  1S5D D;  4IPD A;  1LTR D;  1PH6 A;  1CKM A;  2UXB L;  3SXH A;  4LF8 Q;  5I9O A;  1NJI C;  3AYH B;  5JJL A;  1BCP B;  1CFM A;  1STH A;  3FKI H;  2HUG A;  4BY7 G;  3CQZ B;  4KMU C;  3TZU A;  1EQR A;  2AWN A;  4P73 A;  5BR8 Q;  4XQJ A;  1VQ9 A;  4CDE C;  2JA6 B;  1QIL A;  1SDF A;  4DFA A;  2Z1C A;  2GVA A;  1X56 A;  2YTV A;  3A5U A;  4JI4 L;  2CH4 W;  2WB1 B;  3HOX G;  1Y1W B;  3JC6 6;  1ESF A;  3EIV A;  3GTQ H;  1YVC A;  2KOL A;  5I6W A;  2B2W C;  1FR3 A;  1A63 A;  4HMJ A;  4DR5 Q;  3QB3 A;  3QIA A;  1EU3 A;  3M3Y B;  4LUV A;  1UE1 A;  1HQR D;  3K7A B;  1VQG A;  4DV3 Q;  3M9B A;  5JEA H;  1XMO Q;  4U67 3;  1Q8K A;  4WOR A;  3BYT B;  1TS3 A;  2AMC B;  1JWS D;  3RN2 A;  1R9T B;  5GAE C;  2QEX A;  2PNR C;  1KLU D;  2AQ3 B;  1FJG Q;  1BO0 A;  2OXP A;  1E1T A;  1QCB D;  3MXN B;  3P20 A;  3PO2 B;  5ELN A;  1F9R A;  1Y1V G;  1VQC A;  2NVT H;  4MTN A;  1AZQ A;  5E4X A;  4YY3 L;  1XPU A;  3NUC A;  1D5M C;  3IFT A;  2B2Y A;  2KA7 A;  1GUG A;  4X64 Q;  5IGC A;  4IUR A;  1AE2 A;  4FNF A;  5FLX E;  4HIK A;  3U58 A;  2NZ1 D;  1PH1 A;  1ET9 A;  4JOI C;  1HA5 A;  2HT1 A;  4FF3 A;  1EYA A;  1S5E D;  1EYG A;  1Q46 A;  3PUY A;  4LK1 C;  4AH6 A;  1HQM C;  1PXU A;  3GV3 A;  2XN9 C;  3PIP 3;  1WD1 A;  1A3V A;  1EY4 A;  1EY9 A;  3MHB A;  2IWH A;  4DAY B;  2QIL A;  2R93 B;  4OO1 G;  1AN8 A;  1Q3L A;  3MAQ A;  4X3T A;  2EQS A;  1STG A;  3W2D A;  1CQV A;  3DMU A;  3R3O A;  1JJ2 A;  2F03 A;  4KHZ A;  3CQZ H;  1YNX A;  3BZD B;  4QUC A;  1F9P A;  3VR4 A;  3T1Y Q;  3HOV B;  4M8A A;  3T1H Q;  1Q86 C;  2BH8 A;  4DXF A;  2HDL A;  2JA6 H;  1CZW A;  1MGS A;  1X3G A;  4X62 L;  2JA7 G;  3BS1 A;  1PFB A;  3H6M A;  4DKA C;  2I5L X;  3J80 E;  2PMZ E;  1S40 A;  1YJ9 A;  1Y1W H;  2PQA A;  1O78 A;  1FYC A;  4DK1 A;  2EXZ A;  5FJ8 G;  1STA A;  1EZ6 A;  1NAP A;  4FO2 A;  1EWI A;  5FLM H;  4K2L A;  3TS2 A;  2ZTD A;  4B3M L;  5J1Z A;  3D4R A;  4KI0 A;  2WKC A;  1NR4 A;  3I73 A;  1V9P A;  2N8N A;  3D31 A;  4ZUI A;  2AQ1 B;  4F87 A;  1YNJ D;  2LKV A;  3K7A H;  2P5Z X;  1E1O A;  4B3R L;  2IT1 A;  3G4S A;  2UUA L;  2WV6 D;  3I4M G;  3E9H A;  3CCM A;  2BH2 A;  2F0F A;  4DR2 L;  1R9T H;  4JI0 L;  4GKJ L;  2VQF Q;  2L0C A;  2EZV A;  1PH8 A;  1JWM D;  2C9O A;  3PO2 H;  1B8A A;  1JB3 A;  1SE3 A;  2JYO A;  3T16 A;  4NKL A;  4DUZ Q;  5KGU A;  4IO9 A;  3A5Z B;  4L6T B;  2B63 G;  5C5L A;  2JA9 A;  4HCE A;  5KEE A;  2VY3 A;  2VW9 A;  2WP8 J;  1KAA A;  5IYB H;  4N8X 1;  2IHF A;  4RHR A;  2Y0S G;  3KBX A;  4DR4 L;  1U5K A;  1HA6 A;  1WI5 A;  1LT3 D;  1Z7T A;  3JAM i;  1QZG A;  2F0W A;  3I4N G;  1WFQ A;  2R93 H;  1WVL A;  1K0S A;  4X3S A;  4ZKB B;  2DUD A;  1GHK A;  3H0G B;  4I7Z C;  3CXC A;  2EOT A;  2FFK B;  4BXX H;  1AE3 A;  1IBK Q;  1KAB A;  2IX3 A;  1AFP A;  4HCS A;  2UXD Q;  2R7F A;  3R2T A;  1K83 B;  4H44 C;  1PYB A;  2VXW A;  2HCI A;  3HOV H;  1LTT D;  3DHQ A;  4DR1 Q;  1SJH D;  1EEF D;  1J6Q A;  3QO2 A;  3CRL C;  5A2Q L;  3DXJ C;  5IGF A;  1E2W A;  3HGB A;  1CT1 D;  4RGO S;  3CP0 A;  3ULL A;  4A3C G;  1SND A;  3PUX A;  2E2D C;  2K4K A;  2EJG C;  5D14 A;  4BA1 I;  3UDX A;  1MBY A;  2K01 A;  2PCF B;  2K52 A;  1IXR A;  4BS9 A;  4LF7 Q;  1NMG A;  4G7Z C;  1EUJ A;  2X6L A;  3X3M A;  1I50 B;  1H9S A;  1LTG D;  3PUW A;  1VQ8 A;  1EOT A;  4JBW A;  3CCQ A;  2B3G A;  3HOZ B;  4A75 A;  4KY6 A;  1BBW A;  2F0Q A;  3TP5 A;  2PZU A;  1C7Y A;  1VQH A;  3GQB A;  1Q7Y C;  2FXQ A;  1VQI A;  4NDX A;  3CC4 A;  2ZJP A;  2HD3 A;  3PO3 B;  1GUN A;  1TS5 A;  1D6E C;  3AU7 A;  1YHA A;  1LAC A;  2RDF A;  3ICE A;  4FYD A;  1J8I A;  1Q1E A;  4OIJ A;  4NPS A;  1NTG A;  1F2M A;  4IJH A;  3G6J B;  3MFY A;  4DAP A;  3CHB D;  1QJO A;  3QWN A;  2JA8 G;  2NN6 I;  3CC2 A;  1SRU A;  4JI5 L;  2RHQ B;  5C0X H;  3HKZ E;  4ZLT F;  2ICI A;  1AEX A;  1DGS A;  1ASZ A;  3AMU A;  4IFD I;  2LSS A;  3CD6 A;  3H15 A;  1YBY A;  2EY5 A;  2HIV A;  2PI2 E;  3CW2 C;  5JPM C;  2XRQ D;  2MHV A;  1X32 A;  3H0G H;  4WJ4 A;  2O5I C;  5CV4 A;  4DAY A;  3PMF A;  4A3K B;  1WTP A;  5D3I B;  1K83 H;  1NCV A;  3R2I A;  3TN2 A;  2MO0 A;  4O1N A;  4UHV A;  2K14 A;  1VMP A;  2I5M X;  4L8J A;  1YIT A;  2B2Y C;  2H1E A;  3DEO A;  3U9O A;  3L2P A;  3I90 A;  3BZK A;  1JJG A;  1WCM B;  5C4J B;  4A3G G;  4JI1 Q;  1VQL A;  2KCN A;  2MFI A;  4IZ8 A;  3GTO H;  4CJ1 B;  3VYR A;  3RN5 A;  3VR2 A;  2K5W A;  1OO9 B;  1HTL D;  3K6O A;  2L1B A;  3E0E A;  4KK7 A;  2F0L A;  1TVX A;  1CHP D;  4P72 A;  2RA4 A;  2JSO A;  5IOC A;  2L15 A;  4MHE A;  4OON A;  3BDC A;  3LX0 A;  2G9D A;  3HOZ H;  2SNM A;  2JQO A;  2VB2 X;  1QG7 A;  5LMN W;  2VZA A;  4AYB B;  1K3R A;  3GTG B;  4H0L C;  4FF1 A;  3S1M H;  1B44 D;  2CW0 C;  1HH2 P;  4KY7 A;  4QMG A;  2NZO A;  1G2T A;  2DGY A;  4WFN 3;  4GNX B;  3PO3 H;  3CKI B;  5E7N A;  1CZG A;  5CV6 A;  3HOY B;  3BVG A;  4C1N K;  4Q5V A;  1II3 A;  2QF7 A;  1OXV A;  1ZYR C;  4YIJ A;  4LFC L;  2N49 A;  4B9W A;  1U4M A;  1V1P B;  1PVO A;  4JI6 Q;  1IBM Q;  4CKE A;  2F4V L;  3U4V A;  1Q82 C;  2PYK A;  2ASB A;  4K6L A;  2O4X A;  3F1Z A;  3PIO 3;  3GD7 A;  5IYD G;  3IL8 A;  2MGS A;  3J81 j;  4LF9 Q;  1VCI A;  2UXC Q;  2H4O A;  2BDN A;  3M4O B;  3NEM A;  4CDD C;  3GTK B;  3BDO A;  1GUO A;  2J0T D;  5EJW A;  4DK0 A;  3JAM L;  4GKK L;  1VQD A;  2CW0 D;  2NVQ B;  3MZ5 A;  3EJI A;  1HNZ Q;  3TME A;  3IKJ A;  4A3M B;  4JYA Q;  1JIC A;  4LJZ C;  1YNN C;  4I7A A;  4LFA L;  2E2I B;  5C4J H;  1PHJ A;  2RDG A;  2K5H A;  4LF8 L;  3KLS X;  3GO5 A;  2F0T A;  1KQS A;  3HZX A;  3L9A X;  2F0D A;  1IBL Q;  1QOH A;  2IX0 A;  2J7Z A;  2MUY A;  1UEB A;  2IPK D;  3J81 L;  1J9O A;  1LT5 D;  3DM3 A;  4J15 A;  4UDU C;  2IHE A;  1AP0 A;  4L5Q A;  1EIH A;  4DXG A;  2MNA A;  3M7N A;  3A8K E;  1XTD A;  2VQE L;  4DK3 C;  5AFW A;  1RDP D;  4BBS B;  2I0Q A;  2ENB A;  4ME5 A;  1DOM A;  3GTG H;  1I4X A;  2DY7 A;  5ISR A;  2XGT A;  1SFO B;  2VB3 X;  3K59 A;  1EIF A;  1LM0 A;  1F9S A;  3FKI G;  3R93 A;  4DR5 L;  3RNU A;  4EX5 A;  1F77 A;  3HOY H;  2R7Z B;  5JVH 3;  1YNN D;  4IOC A;  1N33 Q;  2I07 B;  1D7Q A;  1XPO A;  2Z9H A;  4QGU A;  2F0K A;  3CCE A;  4HID A;  3KDF B;  1SYD A;  5LMU L;  2KCT A;  1VQP A;  3H3V C;  2UU9 Q;  1UNS A;  4DGZ A;  5IT9 E;  1B70 B;  2K04 A;  1Q90 A;  2ZXR A;  1LYL A;  1FJG L;  4UP9 A;  4DV2 L;  1E2Z A;  2UUB L;  1RIP A;  5M3M H;  3S9W A;  4TQU S;  2D2C C;  1SNQ A;  2QW7 A;  5JPN C;  1MHW C;  3LWE A;  1STB A;  3RMH A;  1WTX A;  3S2D B;  4UAI A;  5M9O A;  3GTK H;  4DUY L;  5JEA G;  1JMC A;  3SHL A;  2QDB A;  1RTN A;  3NPP A;  4DR6 Q;  3T53 B;  2PZW A;  2NVQ H;  5IWA Q;  3WOF A;  4B3T Q;  3NTH A;  3V2T A;  4A3M H;  4JVZ A;  1ILP A;  1STN A;  4KY5 A;  1YHQ A;  2FMC A;  2K5D A;  1EU4 A;  3P1H A;  4BBR B;  1JOR A;  5C44 B;  4NW2 A;  1MSH A;  3SE0 A;  2H5X A;  3H91 A;  4B9X A;  3PUV A;  4P71 A;  4YWL A;  1I6V C;  2EYP A;  3D8G A;  3HFZ B;  2KEC A;  3MEH A;  1Q12 A;  4RGN A;  3T1H L;  3NBI A;  3D3R A;  3AEV A;  1N36 Q;  3I72 A;  2FMM A;  2N3S A;  1GJX A;  2K6A A;  5C4H A;  5LMN L;  1CM9 A;  4U68 A;  5KRU A;  1T5E A;  4B08 A;  4A93 B;  4X65 Q;  1BF4 A;  3EFX D;  2K5Q A;  1SFO H;  2TMP A;  5ELO A;  4LF5 Q;  3S24 A;  3H94 A;  5JJK A;  1N34 L;  1C4Q A;  1YZ6 A;  1GUT A;  2KQ3 A;  2QKI C;  2R7Z H;  1K8O A;  2JEB I;  2JA6 G;  3KF8 A;  3L7Z C;  4GNX A;  2WFW A;  1KLG D;  3VYS A;  4X3U A;  3I8Z A;  3M85 A;  2WB1 G;  1Y1W G;  3FHW A;  2OT2 A;  4M1U B;  1PFS A;  4ALP A;  4DN4 M;  3Q24 A;  4JV5 Q;  1HZC A;  5FLM G;  5E4W C;  1E22 A;  1GXD C;  4DV1 L;  1KC8 C;  1QVC A;  1V1P A;  2B8F A;  5DLQ E;  1O7Y A;  4X6A H;  2PNH A;  3OMG A;  2F1M A;  1P16 A;  3NEL A;  4LMQ D;  1AZP A;  1K0R A;  4J8Q A;  1IL2 A;  1Q8I A;  2M00 A;  2Y0S E;  4MNO A;  3J7A V;  3JAM E;  1FNV A;  4EQP A;  3FP9 A;  3A74 A;  4A3L H;  2PZT A;  1F9Q A;  1L0W A;  5FLX c;  4Z9C B;  1EIY B;  1HTP A;  2KEN A;  4JI8 L;  3PO2 G;  1D1I A;  2CVR A;  2AUK A;  4BBR H;  1TT2 A;  4IPC A;  1Q1B A;  5C44 H;  3H3V I;  1PZK D;  2ZJQ A;  1XNQ Q;  3KYH C;  4X66 Q;  5IYB G;  3W3A A;  4EQN A;  1OXT A;  5IY0 A;  5J22 A;  4A76 A;  4JBK A;  1TS4 A;  4POF A;  2LXJ A;  3DWA A;  4ZCK A;  1Y8P B;  2EDG A;  3NHH A;  3MVV A;  4DV0 L;  3RZO B;  1G6P A;  4K14 A;  2R93 G;  1AW7 A;  2BCO A;  1D1K A;  1K28 A;  1Z9F A;  2R92 B;  5JAV A;  3LGJ A;  4A93 H;  1I94 L;  3ONA B;  2A1A A;  1MIU A;  3NEN A;  2F3W A;  4QIW B;  4ID6 A;  1LTA D;  3RZD B;  2XWJ B;  4BXX G;  1H9S B;  3S14 B;  5C4X B;  3F2D A;  3NBH B;  2K5N A;  1SNO A;  1ENA A;  1ZXT A;  1X3E A;  2YTY A;  3S15 B;  3J80 c;  1N32 L;  1RD9 D;  4R4I A;  2B2U A;  1G2S A;  3CCU A;  3HOV G;  2OF1 A;  1VQN A;  1WTH A;  3NP8 A;  4ME3 A;  1KAW A;  5DAU A;  4CDF C;  1SXT A;  1MSG A;  5JEA J;  4OWW B;  4YWK A;  5FOB B;  1JE4 A;  1EWH A;  2L55 A;  2WII B;  4GS3 A;  2KEE A;  4KN4 C;  1JB7 A;  4WJ3 M;  1ESR A;  1A3T A;  1HFN A;  1RJT A;  4FF2 A;  1NMF A;  3TP6 A;  4JI2 Q;  3KDF A;  3V96 A;  4JI3 L;  4GN4 B;  3PSI A;  1SE8 A;  4K0K Q;  1TWC H;  1V1Q A;  1MJC A;  4RFB A;  3VA7 A;  4DR3 Q;  2GA4 B;  4FVM A;  1QB5 D;  2PW7 A;  5HGQ A;  5IP7 H;  2E8G A;  2EPB A;  1G91 A;  4PMB A;  3CPW A;  3D6W A;  1WTQ A;  1YNJ C;  3DUZ A;  1EFW A;  4NXN Q;  4BY7 B;  4NXM L;  3I91 A;  2HHH Q;  3KLW A;  5DM6 3;  5GAD C;  3G48 A;  2RDH A;  1T5X D;  3SK4 A;  3IRB A;  5K36 H;  4IAL A;  4DV6 Q;  2EVB A;  2MPM A;  1A8V A;  3RLO A;  4RGM A;  2UUC L;  5C0X G;  2JA5 B;  5NUC A;  1HR0 W;  1IYJ B;  5IOD A;  3GTJ B;  3HOW B;  1EY6 A;  5C4Z A;  3H3V H;  2YU9 B;  2R92 H;  2B29 A;  1IKL A;  1B1Z A;  2FHT A;  3H0G G;  1U4R A;  2CCZ A;  1DJR D;  3VYT A;  1I4Q A;  1B3A A;  3RZD H;  1HRJ A;  2LMC B;  5C4X H;  5IP9 H;  1UAP A;  2LS0 1;  3CCR A;  3S14 H;  2DNE A;  4KHV A;  2ZXO A;  3S15 H;  3M3Y H;  1I5F A;  4XTC S;  1QVG A;  3UI2 A;  1X6O A;  1S5B D;  1PZJ D;  3K0X A;  3VR6 A;  2WIN B;  2C5C A;  4MZ9 A;  2AWO A;  5EBD A;  1PRT D;  4DR7 L;  1D5Z C;  5ELE A;  1S3O A;  1HZ9 A;  4JI7 Q;  1HUN A;  3CU7 A;  2IX1 A;  3S17 B;  2KVM A;  4XXE A;  4C3H B;  4DAV A;  3HRZ C;  1FNU A;  1U0L A;  1H9J A;  4KTA A;  3C1E A;  3T4A C;  2R3Z A;  4KHP Q;  1XNR Q;  5I2X A;  2Z6B A;  2PI2 A;  1VQM A;  4DV5 L;  1A2U A;  4JW0 A;  4YHH Q;  1Y14 B;  4A3I B;  4PQX A;  3S2H B;  3HOZ G;  1L1O B;  1LAB A;  4POG A;  1LT6 D;  2EY6 A;  3MC0 B;  1TQO A;  4K5W A;  3MA2 B;  1VQJ A;  1Q81 C; 
#chains in the Genus database with same CATH homology
 3SVM A;  3P7J A;  3FPU B;  5EQ0 A;  4Q0F A;  1CHQ D;  2K32 A;  4V0B A;  2K1B A;  1EWC A;  1IW7 C;  2BA1 A;  1G6Z A;  5EKL A;  2YYZ A;  3MXU A;  1D5X C;  2Q8T A;  4KKS A;  5CYU A;  1OXU A;  1CK1 A;  2M9V A;  4XYO A;  5I6Y A;  1I3Q B;  3AB9 A;  2Q8I B;  1KDB A;  2RQX A;  2NWG A;  3E6Z X;  4BA2 I;  2ID0 A;  3O13 A;  1ILQ A;  3OMC A;  4KJN A;  1EFI D;  1UUP A;  4C3J B;  2RSO A;  1BXT A;  1SBB B;  4A3B B;  4PMW A;  3FRP B;  3NBH A;  4FXK C;  1TKW B;  4KJO A;  1BDO A;  4C1N I;  1CA6 A;  2EJF C;  1IW7 D;  5TSS A;  3SR1 A;  2JE6 I;  3TDQ A;  1LTI D;  2EYM A;  1EYD A;  1PRT B;  4L63 B;  4ZYS A;  4IN3 A;  4CHT B;  4ZRZ A;  1B50 A;  5IGD A;  4NP5 A;  1XTC D;  3FEW X;  3QG1 A;  3BVM A;  1DON A;  4QF4 A;  1LV9 A;  2NYZ D;  1RTO A;  3WDN A;  2B2U C;  3Q23 A;  5KYI A;  2KCC A;  3C1F A;  2KJX A;  5C0X J;  1F2Y A;  4IUV A;  3I4L A;  1PRT F;  2EE1 A;  5CBE E;  3K0Y A;  5BN4 A;  4FP5 D;  2I46 A;  1F2L A;  1PFM A;  1HFG A;  4C3I B;  1TY2 A;  2QCP X;  2MP1 A;  1NR2 A;  2SDF A;  1HHV A;  5F2D A;  2NUC A;  1SJE D;  4QCL A;  5ELD A;  2RBM A;  2SNS A;  2F0O A;  2NVX B;  4HTH A;  2DY8 A;  4E6I A;  4HMI A;  3BDL A;  4G7H C;  1RCV D;  3J7A F;  5C6A A;  1NSN S;  4ZAI A;  1SYG A;  1IHZ A;  4F7X A;  3K5O A;  2D62 A;  3I3C A;  2F0E A;  4HR7 B;  2D5D A;  1PZI D;  3HG9 A;  2MJ8 A;  1DZ1 A;  1EIG A;  4DA2 A;  5KNC A;  1TWG B;  1KNE A;  1PDQ A;  2EY2 A;  1ZEQ X;  4XDX A;  3T13 A;  4XQQ A;  3K5M A;  3QOL A;  1I4H A;  1W6K A;  1ONL A;  3TSS A;  3N52 A;  5IGB A;  2L9H A;  3OIQ A;  4CBV A;  3M4Y A;  3GP7 A;  1SNP A;  2K03 A;  1B2T A;  1L0Y B;  5KND A;  3T56 B;  4IUP A;  1LO5 D;  5G3L D;  2EYO A;  1FGB D;  1HCZ A;  3K57 A;  5COR A;  3J7Y W;  1EY0 A;  2A68 C;  2G9H D;  2N55 A;  2E2J B;  1Y8N B;  3OWF A;  2NN6 H;  4JK1 C;  3KLS A;  3SK5 A;  3T51 B;  2IL8 A;  2PMZ B;  3A8J E;  4IFD H;  1W6J A;  5A2Q E;  2F4I A;  2V4D A;  5D3D A;  5JJZ A;  2Z4H A;  5EPK A;  5T1I A;  5CR3 A;  2A69 D;  4IQZ A;  5EBC A;  1B9M A;  3VR3 A;  3S1N B;  3IAY A;  3C3L A;  3HEJ A;  1A3U A;  2HCC A;  3SK6 A;  4MN3 A;  3EVQ A;  5HUR A;  2A68 D;  4C2M B;  4ZUJ A;  1EZ8 A;  5BN5 A;  4KKU A;  4V19 0;  1EY5 A;  1IKM A;  1DXM A;  4OGQ C;  2A74 C;  4Y7N B;  4NMZ A;  4EQO A;  1QNK A;  2PO4 A;  2LFN A;  1R4P B;  2WAC A;  1PTO F;  2L4N A;  3NTI A;  2E75 C;  3OW7 A;  3A8I E;  1VF5 C;  1U4L A;  3D6C A;  4KV6 A;  4BY1 B;  2BE5 D;  5M3F B;  4RKB A;  5C3W A;  4N9P A;  3ITP A;  4HSV A;  4FF4 A;  4A3E B;  5CMD A;  2RKS A;  5FLX L;  1Z47 A;  4DNR B;  4HAE A;  3NWT A;  2BA0 A;  3OOC A;  4R9W A;  2VUM B;  4A3F B;  5E1F A;  3OWE B;  1BCP D;  3BG3 A;  1ENC A;  5G3L F;  1ML0 D;  2K7V A;  3KK7 A;  3VR5 A;  1X3P A;  1I4G A;  1K8M A;  1EL0 A;  2B2T A;  4HSP A;  2EYJ A;  3ZYY X;  1XXG A;  2HQE A;  1GHJ A;  1WD0 A;  2F0J A;  2WAQ B;  5DEH A;  2L12 A;  1SYB A;  5K36 G;  1CQF A;  5JOB A;  3J80 L;  3C46 A;  2D9U A;  2FIN B;  3HS0 C;  1SMY C;  1KTK A;  4RHS A;  3HKZ B;  4IUT A;  3HOU B;  2QEJ C;  5FO8 B;  3URY A;  3E5S A;  2F0I A;  3MWY W;  1H9M A;  2OEO A;  4H13 C;  4J6H A;  2NVY B;  1BOS A;  4MIU A;  1JOQ A;  4IUQ A;  2PQE A;  5HGT A;  1QNU A;  3DM1 A;  2F0V A;  3D4D A;  5IIF A;  5IGE A;  1WTV A;  2EYH A;  3KLR A;  2LY7 A;  1PLF A;  4GZY C;  3V05 A;  1EQT A;  2JP1 A;  1SMY D;  3IFD A;  4K5X A;  4ZK9 B;  5KNB A;  4A3D B;  3SDZ A;  5KYL A;  3J81 E;  5C3E B;  5FKA C;  4RH6 A;  3A7L A;  2XSC A;  2SOB A;  4DU9 A;  2B2V A;  5BN3 A;  3MXP A;  4J1M A;  1BBX C;  3ND9 A;  1F2Z A;  2A6H D;  2HDM A;  1M4V A;  4ABN A;  3X3N A;  2K28 A;  2F0H A;  1MD2 D;  2SEB D;  1BCP F;  3TP7 A;  4A3J B;  3VA5 A;  3I70 A;  1RKN A;  2AUJ D;  2A6E D;  2RSN A;  2A5H A;  3NQT A;  1HXY D;  3RD4 A;  1B4O A;  1TWH B;  2EYL A;  3K58 A;  3GTM B;  5I4D A;  1VF7 A;  2F0M A;  5E3F A;  4FXG C;  4PNY A;  4C3H G;  1X3Q A;  2M2L A;  1Z6H A;  4ZKC B;  3Q6S A;  1PRT C;  2E2H B;  4K8J A;  1IYV A;  2EY1 A;  3G7L A;  1D2B A;  4KD4 A;  1H9R A;  3E0J A;  1JCK B;  4K2K A;  3HOX B;  5EPJ A;  5EKK A;  3S16 B;  5IGG A;  2XIW A;  5C3X A;  1BNZ A;  2F0G A;  3A7A B;  1DOL A;  3EA6 A;  4S3S A;  4K5V A;  5M5W B;  1A6X A;  4QUF A;  2FJ2 A;  1XWE A;  2J4X A;  1GUS A;  1LTB D;  2F0N A;  4N9T A;  1V8Q A;  5D65 A;  3Q22 A;  3H09 A;  2L5T A;  1WTR A;  1LTS D;  1Y1V B;  5LHY 1;  2XNA C;  4OO1 I;  2JXM B;  2JEA I;  5CBA E;  5CV9 A;  2KED A;  2B2T C;  2F0U A;  4OL7 A;  2A73 B;  3FMC A;  4C3J G;  4FXD A;  4RCO A;  5EPL A;  2XRS D;  1FNW A;  1O80 A;  3KBG A;  5C0X I;  1QWY A;  4K6D A;  1OXS C;  3NTK A;  4OHJ A;  2KHS A;  4RA8 A;  3BYY B;  1SYE A;  5DM7 3;  4WRD A;  3DWP A;  1TII D;  3MFG A;  2JA7 B;  5FO7 B;  1HPC A;  2F3V A;  3ND8 A;  1ENF A;  3F2U A;  4K8I A;  1PFN A;  1EY7 A;  1DYQ A;  4ODG A;  2O2L D;  1DD2 A;  2X69 A;  3C2P A;  4XT3 B;  3QJY A;  1G8Z D;  1EEI D;  2KUM A;  4XYQ A;  2NN6 G;  3D4W A;  1E2V A;  3NSW A;  3OSO A;  3ERQ A;  4C3I G;  5CGK A;  4QB4 A;  4IFD G;  3I4M B;  4ILW A;  3A54 A;  3GTO B;  2ZXP A;  4KN7 C;  3RUZ A;  4HED A;  2K05 A;  1TS2 A;  3OPO A;  2B63 B;  2VNU D;  3S1Q B;  5CV8 A;  4G57 A;  4O42 A;  2Y0S B;  5I2Y A;  2B2V C;  1KDA A;  1E0B A;  3S1R B;  1JC7 A;  4HN7 A;  1R4Q B;  4C56 C;  3S1M B;  5FK9 C;  1I4R A;  1C8C A;  3I4N B;  3NXW A;  4OO1 H;  1EY8 A;  5ELB A;  4I65 A;  2R61 A;  1JWU D;  2NTT A;  2NB0 A;  1HUM A;  4RCN A;  1PTO C;  2ZT9 C;  3MXN A;  3OHX C;  2TSS A;  5IT9 L;  3CRK C;  4CKC A;  1SSO A;  1ROD A;  1A2T A;  1I6H B;  1WTW A;  1KNA A;  4EGV A;  3MTS A;  5KIX A;  2DN8 A;  4F8M A;  4PMC A;  3Q0A A;  2B39 A;  1U9R A;  3PUZ A;  2L11 A;  4CKB A;  4IUU A;  5LL6 S;  1KDC A;  1B9N A;  1G29 1;  2NTS A;  4TKO B;  3BVZ A;  1LT4 D;  1MI2 A;  2WKD A;  3GTP B;  1TWA B;  3HP3 A;  3SK8 A;  5FO9 B;  1PTO D;  3OIP A;  3LWU A;  3EQL C;  1STE A;  2XWB B;  4DNT B;  2EJM A;  3LNN A;  3M7G A;  2DNC A;  1EYC A;  2X6G A;  2JA8 B;  1SYC A;  1JR0 D;  2E76 C;  4XQN A;  1I4P A;  3GTL B;  2A69 C;  3QOJ A;  2CQA A;  1SE4 A;  1TWF B;  5J39 A;  5K5P A;  3FPP A;  1LLR D;  1SEB D;  1PMR A;  1O7L A;  4RGT A;  1Y69 U;  3DWQ A;  4TRD A;  2IW3 A;  3A55 A;  3P75 A;  2E74 C;  1XYI A;  1IYU A;  3FVQ A;  5EGT A;  3WOE A;  5M3M B;  4X3K A;  3R8B A;  4A3G B;  4OIK A;  1GUW A;  5DNF A;  4H7B A;  1S5F D;  5A35 A;  4IFD J;  4XT1 B;  1CA5 A;  5LL6 X;  1PYW D;  2R6G A;  1ZKO A;  3NQI A;  4P2C B;  5ELF A;  4BWG B;  1DOK A;  5C5M A;  1VDZ A;  1ET6 A;  2B2W A;  3TP8 A;  4TSS A;  1SAP A;  2Q8R E;  1SNM A;  3ERO A;  1H9K A;  1TY0 A;  1ZYR D;  4R8I A;  1BQQ T;  2BE5 C;  2K33 A;  1S5C D;  1SNC A;  1JOO A;  1SE2 A;  4CGY B;  1PTO B;  1OXX K;  1Y8O B;  1UEA B;  2Z8L A;  1IL8 A;  3A56 A;  2ICE C;  5M5Y B;  2XVS A;  1XX8 A;  1O7Z A;  1BCP C;  5CV5 A;  5EKI A;  5M5X B;  4KD3 A;  1V1O A;  4EVO A;  3NK9 A;  5ELC A;  3K5L A;  3K5N A;  2F0S A;  4RAU C;  1ICW A;  2F0P A;  1EQV A;  1JQY D;  1TU2 B;  1STY A;  1A15 A;  3TBI B;  1BR9 A;  2IJ0 A;  1V43 A;  2BOS A;  3PV0 A;  3MXG A;  1C48 A;  1L0X B;  3VYU A;  4XIG S;  1NUC A;  2BDO A;  1RF2 D;  4R8N A;  4PV1 C;  5T1G A;  1CTM A;  3KUP A;  1M8A A;  4WJW A;  4CJ0 B;  1QE6 A;  2AQ2 B;  1U4P A;  3TZD A;  3FKI B;  1JOK A;  5COY A;  3NWS A;  4G4K A;  4DF7 A;  1SYF A;  4IUN A;  1S4Z A;  3N6R A;  3DEP A;  2RVL A;  2N88 A;  1PTO H;  4ZQ3 A;  3L3O C;  4ULL A;  1DCZ A;  1VMC A;  2EYF A;  3GTQ B;  4G7O C;  1WTO A;  2O5J C;  2PW5 A;  5CV7 A;  5CC4 A;  1FD7 D;  4F88 A;  5I9P A;  2B8G A;  1CI3 M;  4CJ2 C;  1B53 A;  2A6H C;  3RLF A;  2PPB C;  1TR5 A;  2NVT B;  1BUV T;  1TWC B;  5JVG 3;  3FDT A;  3U9S A;  4RKL A;  4KKT A;  1GOZ A;  2CHB D;  4RWS C;  2NBF A;  4LAA A;  1RHP A;  3NE5 B;  1DM0 B;  2Z4I A;  2A6E C;  3GV6 A;  1S5D D;  1LTR D;  3SXH A;  5I9O A;  1BCP B;  1CFM A;  1STH A;  2HUG A;  3CQZ B;  4KMU C;  3TZU A;  2AWN A;  4XQJ A;  2JA6 B;  1QIL A;  1SDF A;  4DFA A;  2Z1C A;  2WB1 B;  1Y1W B;  1ESF A;  2KOL A;  5I6W A;  2B2W C;  1FR3 A;  4HMJ A;  3QB3 A;  3QIA A;  1EU3 A;  3M3Y B;  1HQR D;  3K7A B;  5JEA H;  4U67 3;  4WOR A;  3BYT B;  1TS3 A;  1JWS D;  1R9T B;  2PNR C;  1KLU D;  2AQ3 B;  1BO0 A;  2OXP A;  1QCB D;  3P20 A;  3PO2 B;  1F9R A;  1AZQ A;  5E4X A;  3NUC A;  1D5M C;  3IFT A;  2B2Y A;  2KA7 A;  1GUG A;  5IGC A;  4IUR A;  4FNF A;  5FLX E;  2NZ1 D;  1ET9 A;  1HA5 A;  4FF3 A;  1EYA A;  1S5E D;  3PUY A;  4LK1 C;  1HQM C;  1PXU A;  3GV3 A;  2XN9 C;  3PIP 3;  1WD1 A;  1A3V A;  1EY4 A;  1EY9 A;  3MHB A;  2IWH A;  2QIL A;  2R93 B;  4OO1 G;  1AN8 A;  1Q3L A;  3MAQ A;  4X3T A;  1STG A;  3W2D A;  1CQV A;  3DMU A;  3R3O A;  2F03 A;  4KHZ A;  3BZD B;  4QUC A;  1F9P A;  3VR4 A;  3HOV B;  4M8A A;  4DXF A;  2HDL A;  1CZW A;  1MGS A;  3BS1 A;  1PFB A;  3H6M A;  3J80 E;  1O78 A;  1FYC A;  4DK1 A;  2EXZ A;  1STA A;  1EZ6 A;  1NAP A;  4FO2 A;  4K2L A;  5J1Z A;  3D4R A;  4KI0 A;  2WKC A;  1NR4 A;  3I73 A;  3D31 A;  4ZUI A;  2AQ1 B;  4F87 A;  1YNJ D;  2LKV A;  2IT1 A;  2WV6 D;  2F0F A;  2L0C A;  2EZV A;  1JWM D;  2C9O A;  2JYO A;  1JB3 A;  1SE3 A;  3T16 A;  4NKL A;  5KGU A;  4L6T B;  5C5L A;  4HCE A;  5KEE A;  2WP8 J;  1KAA A;  4RHR A;  3KBX A;  1HA6 A;  1LT3 D;  1Z7T A;  2F0W A;  1WVL A;  4X3S A;  4ZKB B;  1GHK A;  3H0G B;  4I7Z C;  2EOT A;  2FFK B;  1KAB A;  2IX3 A;  1AFP A;  4HCS A;  3R2T A;  1K83 B;  4H44 C;  2VXW A;  2HCI A;  1LTT D;  3DHQ A;  1SJH D;  1EEF D;  3QO2 A;  3CRL C;  5A2Q L;  3DXJ C;  5IGF A;  1E2W A;  3HGB A;  1CT1 D;  4RGO S;  1SND A;  3PUX A;  2E2D C;  2EJG C;  5D14 A;  4BA1 I;  1MBY A;  2K01 A;  2PCF B;  4BS9 A;  4G7Z C;  2X6L A;  3X3M A;  1I50 B;  1H9S A;  1LTG D;  3PUW A;  1EOT A;  4JBW A;  3HOZ B;  4KY6 A;  2F0Q A;  3TP5 A;  2PZU A;  3GQB A;  4NDX A;  3PO3 B;  1GUN A;  1TS5 A;  1D6E C;  3AU7 A;  1LAC A;  2RDF A;  4FYD A;  1J8I A;  1Q1E A;  4OIJ A;  1F2M A;  3G6J B;  3MFY A;  4DAP A;  3CHB D;  1QJO A;  3QWN A;  2NN6 I;  5C0X H;  4ZLT F;  2ICI A;  1AEX A;  3AMU A;  4IFD I;  2EY5 A;  5JPM C;  2XRQ D;  2MHV A;  1X32 A;  2O5I C;  5CV4 A;  4DAY A;  3PMF A;  4A3K B;  1WTP A;  5D3I B;  1NCV A;  3R2I A;  3TN2 A;  4O1N A;  1VMP A;  4L8J A;  2B2Y C;  2H1E A;  3DEO A;  3U9O A;  3I90 A;  1WCM B;  5C4J B;  2KCN A;  4IZ8 A;  4CJ1 B;  3VYR A;  3VR2 A;  2K5W A;  1OO9 B;  1HTL D;  3K6O A;  2L1B A;  4KK7 A;  2F0L A;  1TVX A;  1CHP D;  2RA4 A;  2JSO A;  5IOC A;  4MHE A;  3BDC A;  3LX0 A;  2G9D A;  2SNM A;  2VB2 X;  1QG7 A;  4AYB B;  3GTG B;  4H0L C;  4FF1 A;  1B44 D;  2CW0 C;  4KY7 A;  4QMG A;  1G2T A;  4WFN 3;  3CKI B;  1CZG A;  5CV6 A;  3HOY B;  3BVG A;  4C1N K;  4Q5V A;  1II3 A;  2QF7 A;  1OXV A;  1ZYR C;  4YIJ A;  4B9W A;  1U4M A;  1V1P B;  4CKE A;  2PYK A;  4K6L A;  2O4X A;  3PIO 3;  3GD7 A;  3IL8 A;  2MGS A;  1VCI A;  2H4O A;  2BDN A;  3M4O B;  3GTK B;  3BDO A;  1GUO A;  2J0T D;  5EJW A;  4DK0 A;  3JAM L;  2CW0 D;  2NVQ B;  3MZ5 A;  3EJI A;  3TME A;  3IKJ A;  4A3M B;  1JIC A;  4LJZ C;  1YNN C;  2E2I B;  2RDG A;  3KLS X;  3GO5 A;  2F0T A;  3HZX A;  3L9A X;  2F0D A;  1QOH A;  2IX0 A;  2J7Z A;  2MUY A;  2IPK D;  3J81 L;  1J9O A;  1LT5 D;  4UDU C;  1AP0 A;  1EIH A;  4DXG A;  3M7N A;  3A8K E;  5AFW A;  1RDP D;  4BBS B;  2ENB A;  4ME5 A;  1DOM A;  1I4X A;  2DY7 A;  5ISR A;  1SFO B;  2VB3 X;  3K59 A;  3R93 A;  1F9S A;  1F77 A;  2R7Z B;  5JVH 3;  1YNN D;  2I07 B;  2F0K A;  1SYD A;  3H3V C;  1UNS A;  4DGZ A;  5IT9 E;  2K04 A;  1Q90 A;  2ZXR A;  1E2Z A;  3S9W A;  4TQU S;  2D2C C;  1SNQ A;  5JPN C;  3LWE A;  1STB A;  3RMH A;  1WTX A;  3S2D B;  4UAI A;  5M9O A;  5JEA G;  3SHL A;  2QDB A;  1RTN A;  3NPP A;  3T53 B;  2PZW A;  3WOF A;  3NTH A;  3V2T A;  1ILP A;  1STN A;  4KY5 A;  2FMC A;  2K5D A;  1EU4 A;  3P1H A;  4BBR B;  1JOR A;  5C44 B;  4NW2 A;  1MSH A;  3SE0 A;  3H91 A;  4B9X A;  3PUV A;  1I6V C;  2EYP A;  3D8G A;  2KEC A;  3MEH A;  1Q12 A;  4RGN A;  3NBI A;  3D3R A;  3I72 A;  2FMM A;  1GJX A;  2K6A A;  5C4H A;  1CM9 A;  4U68 A;  5KRU A;  1T5E A;  4B08 A;  4A93 B;  1BF4 A;  3EFX D;  2K5Q A;  2TMP A;  3H94 A;  1C4Q A;  1GUT A;  2KQ3 A;  2QKI C;  1K8O A;  2JEB I;  3KF8 A;  3L7Z C;  1KLG D;  3VYS A;  4X3U A;  3I8Z A;  3M85 A;  2OT2 A;  4M1U B;  4DN4 M;  3Q24 A;  5E4W C;  1GXD C;  1V1P A;  2B8F A;  1O7Y A;  3OMG A;  2F1M A;  4LMQ D;  1AZP A;  4J8Q A;  1Q8I A;  2M00 A;  3J7A V;  3JAM E;  1FNV A;  4EQP A;  2PZT A;  1F9Q A;  4Z9C B;  1HTP A;  1D1I A;  2CVR A;  2AUK A;  1TT2 A;  1Q1B A;  1PZK D;  3W3A A;  4EQN A;  1OXT A;  5J22 A;  1TS4 A;  3DWA A;  1Y8P B;  2EDG A;  3NHH A;  3MVV A;  3RZO B;  4K14 A;  1AW7 A;  2BCO A;  1D1K A;  2R92 B;  5JAV A;  3ONA B;  2F3W A;  4QIW B;  4ID6 A;  1LTA D;  3RZD B;  2XWJ B;  1H9S B;  3S14 B;  5C4X B;  1SNO A;  1ENA A;  1ZXT A;  3S15 B;  1RD9 D;  2B2U A;  1G2S A;  2OF1 A;  3NP8 A;  5DAU A;  1SXT A;  1MSG A;  5JEA J;  5FOB B;  1JE4 A;  1EWH A;  2L55 A;  2WII B;  2KEE A;  4KN4 C;  1ESR A;  1A3T A;  1HFN A;  1RJT A;  4FF2 A;  3TP6 A;  3V96 A;  4RFB A;  3VA7 A;  2GA4 B;  4FVM A;  1QB5 D;  2PW7 A;  2EPB A;  1G91 A;  4PMB A;  3D6W A;  1WTQ A;  1YNJ C;  3DUZ A;  4BY7 B;  3I91 A;  5DM6 3;  2RDH A;  1T5X D;  3SK4 A;  5K36 H;  4IAL A;  2EVB A;  2MPM A;  4RGM A;  5C0X G;  2JA5 B;  5NUC A;  5IOD A;  3GTJ B;  3HOW B;  1EY6 A;  5C4Z A;  2YU9 B;  1IKL A;  1B1Z A;  2FHT A;  1U4R A;  1DJR D;  3VYT A;  1I4Q A;  1B3A A;  1HRJ A;  2LMC B;  1UAP A;  2LS0 1;  2DNE A;  4KHV A;  2ZXO A;  4XTC S;  3UI2 A;  1S5B D;  1PZJ D;  3VR6 A;  2WIN B;  2C5C A;  2AWO A;  5EBD A;  1PRT D;  1D5Z C;  5ELE A;  1HUN A;  3CU7 A;  2IX1 A;  3S17 B;  2KVM A;  4XXE A;  4C3H B;  4DAV A;  3HRZ C;  1FNU A;  1H9J A;  4KTA A;  3C1E A;  3T4A C;  2R3Z A;  5I2X A;  1A2U A;  4A3I B;  4PQX A;  3S2H B;  1LAB A;  1LT6 D;  2EY6 A;  3MC0 B;  1TQO A;  4K5W A;  3MA2 B;  3SEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...