1HZBA

Bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of mutant forms of the Bacillus caldolyticus cold shock protein differing in thermal stability.
pubmed doi rcsb
source organism Bacillus caldolyticus
molecule tags Transcription
molecule keywords COLD SHOCK PROTEIN CSPB
total genus 14
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hzbA00
3E9IA 3S24A 1HNXL 4GOPA 2UXBL 1Y1WG 4R4CA 5JEAJ 3WWVA 1PH4A 4X65Q 1S72A 4JBKA 4WJ4A 1YHBA 4KHPQ 4A3GH 3ULPA 4UP8A 4DR1Q 3MXNB 2ALYB 4DV3L 4LF4L 4OWWB 4A4IA 1WI5A 1LYLA 1NBWA 2Y0SE 4A3LH 1MJCA 1YITA 3GTPH 1J5EQ 4QQBX 1Z9FA 5BR8Q 4LFBL 1Y14B 1GD7A 2UXCQ 2JE6I 2ZJRA 3OTOL 4LFAQ 1FGUA 2I5HA 1WYDA 4JV5L 4YCWA 2WB1G 1XMQQ 1WCMG 2HIXA 2ZTEA 3EN2A 4PZ8A 3K7AH 4JI1Q 1K9MC 1L0WA 2IT1A 2B63H 3OTOQ 3HOZG 1VQBA 4A3IG 1PHJA 2HIVA 4DAMA 2UXDQ 4PG3A 1QZHA 1PH8A 4YCVA 3KJPA 4DV1Q 2K52A 2HT1A 1UE6A 1IBLL 2YYZA 1XNQQ 5JJLA 2N49A 2CKZB 4DV7L 4JI6L 3SGIA 2UUAQ 3H3VI 3S17H 1VQFA 1VQAA 4DR1L 1K73C 1PA6A 4GLVB 2I5LX 5ELOA 1A8VA 4R4TA 4C2MH 4DV6L 4GKJQ 4B3RL 1NTGA 4AH6A 4DV7Q 4JI6Q 3CCVA 3RLFA 3PIOA 1IXRA 2IHFA 4R4QA 4A3MG 4QIWE 1PYSB 3G4SA 2GVBA 4AIMA 2AMCB 4A3JH 4JCVE 2A1AA 1TWAH 1CKNA 2K5HA 3KYHC 2BH2A 4GN5A 1L1OA 1YVCA 4OONA 2E2IH 1CKNB 3CPWA 4DV2Q 1KC8C 1N8RC 3CC2A 4LF8Q 4DR4L 1G6PA 4JG2A 5C44G 4DV4L 3RN2A 2D0OA 5C3EG 3S2HH 4JI7Q 1OXUA 5JEAG 3B6YA 1PH5A 1N36Q 3HOUG 1YJNA 2VS1A 4DV2L 4DR4Q 2FXQA 2E2JH 5K36G 3EIVA 1YI2A 4HJ9A 3LGJA 1JJCB 4UP7A 2K5VA 3CW2C 2K75A 3K7UC 1A62A 2ATWA 4X64L 2YTYA 4HIMA 2F52A 1PH7A 4B3RQ 2Q2UA 4DR6L 4IOCA 1X6OA 4DV5L 4A3EH 5AJ3Q 3F2BA 3K80C 4UPAA 2MO0A 2IX1A 5C3EH 4X62Q 2KHIA 3KF6B 4X64Q 3RNUA 3HOVG 5HY6A 2PMZE 4C3JH 3ZJYC 1HNZL 4GOPC 2Z0SA 4KHZA 4A3KG 1VQOA 1L1OB 4A93H 1X9NA 3PO2G 3CC4A 5JJKA 1HZAA 5IY0A 3PV0A 4A3JG 2A8VA 3JAMc 3I4NG 1B7YB 3RLOA 4C3IH 3EBEA 2DGYA 3NEMA 2H5XA 5C0XG 4HJ8A 2NVTH 1V43A 2B3GA 4GN3B 2HHHQ 1XNRL 4BY1G 5HGQA 3RZOH 2B29A 3CP0A 2GVAA 3F2DA 1D7QA 2F4VL 2OQKA 4JI2Q 1X3GA 3GTMH 1MJEA 4AQYQ 3STBD 1G291 1X55A 1U5KA 1YHAA 1XJVA 2B63G 5BR8L 1I6HH 3J7ZC 1W3SA 3K0XA 1BKBA 3M9BA 3GTJH 4A75A 3PUWA 4IO9A 1OTCA 5IP9H 5FLMH 2UUCQ 1EFWA 3I2ZA 5IP7G 1CSPA 1YZ6A 1HNXQ 4BBRG 4EQ5A 5FLXc 3PO3G 2ZM6Q 2F4VQ 3HOUH 4BXXG 2EIFA 3H0GH 3H15A 1EWIA 1I3QH 4A3EG 3H3VH 2JK8A 4JI5Q 5M3FG 1FJGL 1MKHA 4BBSG 3RR5A 4A3FH 5M5WH 3VDYA 1VQMA 2NN6I 3T1YL 3DLLA 1VQHA 4UP9A 5IP7H 3CCQA 3NBHB 1Z47A 1HNZQ 2UXCL 5LMNL 4LFAL 4LF9Q 1N34L 5ELNA 3UDFA 5M3MG 1J5EL 5J3BA 1C7YA 1VQ9A 4DV6Q 4IPGA 4BY7H 3FHWA 2N78A 3JAMi 4X66Q 3J81i 4DR5Q 4BA2I 1E1OA 1AE3A 2Q2HA 4AYBG 2NZOA 3J80c 1N34Q 4A3GG 2PI2E 4LW1A 4DUYL 2WP8J 4HIDA 1TWFH 3CD6A 3J7A5 1SLJA 3NELA 4JI2L 1IBLQ 3CCUA 1G51A 1KRTA 1XNQL 1VQ4A 3F2CA 1LUZA 1ASZA 4JOIC 1A0IA 2HHHL 1JJGA 1C9OA 3HKZG 2UXDL 2UXBQ 3Q8DA 4PMWA 1HZCA 4LFCL 4JI7L 2K50A 3F1ZA 1VCIA 2RHQB 4IPDA 5LMUQ 3S16H 3GO5A 1CUKA 4BXXH 1L1OC 1XMQL 4HJ5A 4GNXA 4LUVA 1UE5A 3PUYA 4GOPB 5M3FH 4DUYQ 2VQEL 3T1HQ 3KOJA 3UE0A 3E0EA 4JI3L 4X62L 2KENA 1TWCH 5GAEC 4POGA 1CKMA 2UU9Q 2R7ZH 3F8TA 1RIPA 2K14A 3W1GA 4YY3L 3A5UA 4A3KH 3A74A 3AFQA 4LF7L 1IL2A 4A3CG 3UE1A 4DR2Q 4R1JA 1Q7YC 5IE8A 2OWOA 1XPOA 4JI3Q 4IPCA 4IFDJ 2R7DA 5GADC 2AHOB 4P74A 1Y1WH 3S1QH 3M7NA 2I5MX 4EX5A 1KAWA 3FKIH 1GKHA 3HKSA 3CAMA 4ME3A 2VQEQ 1NMGA 1MIUA 4HIOA 3J80i 3T1HL 2E5LQ 4NXNQ 4IJHA 4OWTB 1N36L 5FJ8G 3DM3A 2JA8H 3J81c 3AEVA 1LTLA 1E1TA 2ES2A 3S14H 1UWVA 1YIJA 2GN5A 3PF4A 1KD1C 4NXMQ 3FP9A 4LF6L 4A76A 1X3EA 3UDXA 2KCMA 2E5LL 4LF8L 4A3CH 4DUZQ 2ZTDA 1KL9A 4LF5Q 2KHJA 2JA5G 4IPHA 3U50C 1KIXA 1EYGA 1KXLA 1KQSA 1N9WA 2AKWB 3CF5A 4OXPA 4BBSH 1PH3A 3FKIG 4YWLA 4IOAA 4DK6C 5C4XG 1NMFA 4A3DG 3TS2A 5H1SE 3M4OH 2JA8G 4XTCS 5C0XI 4JBMA 4L5RC 1Q12A 5C0XJ 4GKJL 4BA1I 4NB3A 2LXKA 1NY4A 1SE8A 4GN4B 4HJAA 3M3YH 2VL6A 2ASBA 4MNOA 2L15A 3GD7A 4A3BG 2QEXA 1HR0W 3K8AA 3KDFB 3T1YQ 1XPUA 2R92G 1SR3A 2LSSA 1XNRQ 2KBNA 1PH6A 3HOYH 4LUOA 2JQOA 4JI1L 4OO1I 1K83H 3KDFA 2NVXH 5IYBH 3J81j 1XPRA 4DNIA 2BA0A 4APVA 2WB1E 1Q8KA 3S1NH 3ER0A 1BBUA 2YU9H 2ZM6L 4K0KL 1VQCA 2JA9A 1B8AA 3H0GG 3PIPA 4A3BH 1HJPA 1WCMH 2V1CC 3JC66 1HZBA 5E7NA 1EIFA 5IT9c 1EIYB 5M5YH 5GQOA 2R92H 1PYBA 2CWAA 4DV3Q 3RZDH 2CFMA 1IBKL 4A3FG 1EQQA 4LF4Q 3GTOH 4K0KQ 1OXTA 2YTVA 1VQGA 1D8LA 3G71A 2OTLA 2R93G 2C35B 4DR3L 1SMXA 1KRSA 1SN8A 5IYBG 1T9HA 1S40A 1A63A 1E3PA 3GTGH 3U4VA 4QGUA 3I55A 4BY7G 4YCUA 4DK3C 1S3OA 1VQNA 1YHQA 1CSQA 1EUJA 2VY3A 1JJ2A 1HNWQ 5M5XH 5M3MH 4QY7A 3HOXG 1XMOL 3GTLH 4JI4L 2RCNA 2NN6G 5IWAQ 3I4OA 2I0QA 3ERSX 3W5OA 1WOCA 1UE1A 2NVYH 4L5TA 4XIGS 1FJGQ 4YWMA 4A93G 2NVQH 2HQLA 3HKZE 4PZ6A 2WAQG 3RLNA 1M1KC 3ICEA 1HR0Q 3HOWG 2N8NA 2K4KA 4MTNA 2E2HH 1P8LA 2UUCL 4LNQA 2PI2A 2Z6KA 1Q81C 1LM0A 2Q2IA 1I94L 3PF5A 1TWHH 1OXVA 4BY1H 3KFUA 3I56A 4AYBE 2AWOA 1XTDA 3TEHB 2R7FA 1K3RA 3HOZH 2IX0A 5GAHC 4O0AA 2DUDA 3AQQA 4TVAB 3A5ZB 1I94Q 3S1MH 4HJ7A 4L5QA 2UUBL 4FDBA 2R7ZG 1IBMQ 4DR7Q 2Q2TA 2OQ0A 4AQYL 4B3SQ 4GKKQ 1JE5A 1HNWL 1TWGH 1N32L 1JB7A 3PCOB 4P71A 1L2FA 4LWCA 4JI0L 5IWAL 3W1BA 2NZHA 4LUZA 1PH9A 1U0LA 2YTXA 1VQ5A 3MEFA 2JEBI 1FVIA 1VS0A 1YEZA 5EAYA 3KJOA 2EXDA 3NENA 5IYCH 2OCEA 4P75A 3I4MH 1N32Q 1YBYA 2JA7G 5IYDH 3PUVA 4B3ML 3G6EA 4NXNL 4A3MH 5AJ3L 4QL5A 2RF4A 1PV4A 1RL2A 4DAYB 1I50H 4OX9L 2XGTA 2CWPA 4DR3Q 1VQ6A 5JJIA 4L5SA 1IZ6A 1KHIA 5FJ8H 1WJJA 3L2PA 4GLXA 4POFA 1X3FA 1YNXA 3CQZH 4YHHL 1NE3A 4O2DA 3CCMA 2VW9A 4B3MQ 3GTKH 1GM5A 3BZKA 1ASYA 1GVPA 1Q46A 2BH8A 5IYDG 3CMEA 1AE2A 1TXYA 3CCRA 4OX9Q 2OTJA 4X6AH 1Y1VH 3BJUA 4X65L 3TQYA 4PZ7A 1HR0L 2CCZA 2CQOA 2K5NA 4JBJA 1R9TH 4A3IH 1VQIA 2VNUD 1HZ9A 4H02A 2VQFL 4GNXC 1NJIC 4RG1A 3GTQH 4DV4Q 1M90C 1B70B 2D0PA 3L0OA 4NPSA 2JA6H 4JV5Q 4ALPA 4JYAQ 5C4JH 4OWXB 1Y1VG 2R6GA 3CXCA 2VQFQ 1Q1EA 4WJ3M 2R93H 3AFPA 4DR7L 3A0JA 4JC0A 1X65A 3STBC 3CCEA 1VQJA 3CCJA 2JEAI 1QVCA 1K8GA 2LXJA 2VUMG 3PGZA 2PNHA 1SFOH 4YHHQ 3KF8B 3HOYG 1IBKQ 3OW2A 4DR5L 5LMNQ 1Q82C 1EQRA 1QUQB 4HIKA 1H95A 4BBRH 1N33L 1Q86C 1PH2A 3HOWH 3PO2H 1GO3E 3BU2A 1VQLA 4KHPL 1O7IA 3D0FA 2MFIA 3E9HA 3TS0A 3S15H 1E24A 2Y0SG 4MZ9A 4DPGA 1QVGA 4LF6Q 3KLWA 3M85A 3UDGA 2JJQA 2JA7H 4DV0Q 3HFZB 4P73A 3I7FA 4JI5L 4QJFA 2ZJPA 1UE7A 1XMOQ 4A3DH 3U4ZA 4JI4Q 3RN5A 3TRZA 1FL0A 4DV0L 4B3SL 4GKKL 3I4NH 2BA1A 4JBWA 5GROA 4UY8C 5FLMG 3GDEA 1HH2P 2VZAA 1BVSA 1VQEA 2F3IA 4X66L 4DV5Q 1W2BA 1EOVA 1PH1A 2WAQE 2MQHA 2N3SA 4YY3Q 5C44H 3HOXH 4LF7Q 4LFBQ 3HOVH 3ULLA 2MO1A 2JA5H 1UEBA 2A19A 2EQSA 1VQ8A 4GS3A 3CC7A 2IY5B 4DR6Q 4J15A 1QUQA 3PUZA 1OXXK 2UU9L 3BZCA 2MNAA 1WFQA 3M4PA 5C4XH 4OO1G 3I4MG 3D31A 2VUMH 2E8GA 1P16A 4Y7NH 1YJ9A 2XTIA 4LF9L 5IP9G 4GLAC 3KF6A 1VQPA 3CCLA 1PVOA 4R4IA 4JYAL 4P72A 4KI0A 1VQDA 1JT8A 3IRBA 3PO3H 1K0RA 5LMNW 2YV5A 4JI0Q 2AWNA 4R4OA 1J6QA 3CPFA 4LFCQ 5LMUL 3CCSA 1VQKA 1YJWA 4TQUS 3PUXA 4DKAC 1JMCA 3UDIA 3S1RH 3AYHB 1E22A 3OYYA 5GAGC 1QVFA 4Y52H 1Q1BA 2UUBQ 4IFDI 1IBML 1V9PA 4JOIA 1VQ7A 3G48A 1N33Q 1X56A 2WFWA 1K8AC 4JI8L 2IHEA 2ID0A 2Z6KC 3L7ZC 4IJLA 2ZTCA 4C3HH 1CKOA 3U58A 3S2DH 1SRUA 4DR2L 2JA6G 1X54A 2QGQA 3M4QA 4KLKA 5IYCG 4DV1L 1C0AA 4JI8Q 1BBWA 1OXSC 3TREA 3ULJA 1E7ZA 1V1QA 2PQAB 2D62A 4B3TQ 2UUAL 1SROA 3PSIA 1IYJB 4DUZL 4LF5L 1I5FA 1PFSA 3CMAA 4YWKA 2PQAA 3K81C 5DLQE 4A3LG 4IFDG 1AH9A 1DGSA 4RMFA 2KCTA 1QZGA 4NXML 4B3TL 2ZJQA 4GNXB 2RHSB 2QA4A
chains in the Genus database with same CATH superfamily
1LABA 1HNXL 3ND8A 1PH4A 5CR3A 1I3QB 5CGKA 4RFBA 4K5VA 4C3JG 2XRQD 3ULPA 4DV3L 1CHQD 4OWWB 1DCZA 4A4IA 1S5CD 1LYLA 1NBWA 3D4WA 4A3LH 1G2TA 4OL7A 3GTPH 1Z9FA 1K0SA 1I6HB 3TDQA 3OTOL 3HP3A 4O1NA 1MBYA 3GTMB 5FKAC 1JWUD 4NP5A 1A3UA 1XMQQ 5JPMC 1VMCA 2KHSA 3KBGA 2B63H 5C3WA 3OTOQ 2XNAC 3DMUA 2HIVA 3MEHA 4K2LA 4YCVA 3KJPA 5JVG3 1UE6A 1IBLL 5JJLA 4JI6L 1F9RA 1WD1A 2CH4A 3NQIA 3S17H 1VQAA 2XSCA 1QB5D 2L12A 2QCPX 1STHA 4B3RL 1NTGA 2PMZB 2RQXA 3QO2A 5ELCA 4DV7Q 4A3MG 4R4QA 2KCNA 3QB3A 4DF7A 4QIWE 3G4SA 4A3JH 2K5HA 5CYUA 3MVVA 2K1BA 4QF4A 1L1OA 2EYFA 2E2IH 4RHSA 2WACA 4DV2Q 2Q8IB 5C44G 4RGTA 3RN2A 3S2HH 4JI7Q 1OXUA 5JEAG 3S2HB 1LTRD 1A6XA 3I4LA 1A3VA 4Y7NB 2ICEC 3HOUG 2FXQA 1JWMD 5K36G 5IT9E 4HJ9A 3LGJA 2OXPA 1BO0A 1QCBD 4A3JB 5C44B 3HOXB 2B2VC 4DV5L 5AJ3Q 1PFNA 2F3WA 4UPAA 5FO8B 1NNXA 4X64Q 1BNZA 4KD4A 3S17B 1BCPF 2EPBA 2JP1A 4KHZA 3QOJA 1HZAA 2G9HD 4RH6A 3PQIA 3RLOA 3EBEA 2CHBD 5LL6S 5C0XG 1V43A 2HHHQ 1I4GA 1V1OA 2F4VL 4JI2Q 3HOWB 3TP6A 3GTMH 1QG7A 1XYIA 1CTMA 1F2YA 2B63G 1I6HH 3J7ZC 3PUWA 5IP9H 1A3TA 4DAVA 2R93B 3DM1A 4EQ5A 4RKLA 2MP1A 2F4VQ 2EIFA 1WD0A 1HUMA 3H15A 1I3QH 1BBXC 2A6EC 3RR5A 4A3IB 2CVRA 2FJ2A 3DWAA 4UP9A 4KTAA 1HNZQ 1N34L 5ELNA 1J5EL 1VDZA 1VQ9A 1I50B 3OIPA 4KD3A 1I4RA 4X66Q 1HQRD 1E1OA 2Q2HA 4A3GG 3CD6A 3J7A5 2E75C 1IBLQ 1ASZA 4N9TA 1C9OA 2F0MA 3HKZG 3MWYW 4QB4A 2UXDL 3ERQA 3WDNA 4R8NA 5LMUQ 1XMQL 2K01A 2H4OA 1LTID 3PUYA 2F4IA 5M3FH 4DUYQ 3T1HQ 1S5DD 3MXPA 5I2XA 2KENA 3ITPA 2UU9Q 3HKZB 2K14A 2ZT9C 3W1GA 3A5UA 3KF8A 4LF7L 3A74A 5C4XB 4DR2Q 5IGDA 2OWOA 4IFDJ 2ZXRA 1B3AA 2DJGC 5GADC 3I70A 1D5ZC 3S1QH 3M7NA 3VYRA 2BDNA 3BVGA 3FKIH 3SK6A 3T1HL 3P75A 1MIUA 4I65A 2A68C 2KEEA 3SR1A 1PMRA 4OWTB 3SK8A 5M3MB 3DM3A 1N36L 2JA8H 3S14H 4NXMQ 1Y8NB 3FP9A 5KIXA 2FFKB 4A76A 1X3EA 3UDXA 4A3CH 1YNJD 2E5LL 4LF8L 1LT3D 2ZTDA 1XXGA 2KHJA 3U50C 1KQSA 2JA7B 2K5DA 3K0YA 4LMQD 3HEJA 3GTOB 1PH3A 4IOAA 1NMFA 3SXHA 2NBFA 2JA8G 4L5RC 2M9VA 3HRZC 1Q12A 4PMBA 1NY4A 1AZQA 2VL6A 1HA5A 4MNOA 3GD7A 4N8X1 2QEXA 1K83B 3D6WA 3K8AA 1SR3A 2LSSA 1XNRQ 3HOYH 4EQNA 3HOYB 5CV7A 5C4JB 1JOKA 1K83H 1GXDC 2JXMB 4FO2A 4DNIA 4APVA 2B2YC 1O7ZA 1S5ED 1VQCA 5HURA 2V1CC 5T1GA 1HZBA 1EIYB 1EIGA 4LF4Q 3GTOH 1EQQA 4K0KQ 3CQZB 2YTVA 2OTLA 3EQLC 3QJYA 4X3KA 2C35B 4HTHA 3G71A 5IYBG 1SN8A 1C48A 1S40A 5F2DA 5BN5A 1O78A 1PRTD 5J39A 1SJED 2F0TA 2Z6BA 2VY3A 1EUJA 3BYTB 1HNWQ 5M3MH 2JA8B 3HOXG 5IWAQ 2QILA 2BE5D 4XIGS 2E76C 3S1QB 4YWMA 2NVQH 3ICEA 3RLNA 1CFMA 4HCSA 3UI2A 2K4KA 2SDFA 4MTNA 4CJ0B 2PI2A 2Z6KA 3S1MB 2B2TA 4J8QA 3PF5A 4BY1H 3KFUA 5EKKA 3I72A 4AYBE 2AWOA 3HOZB 3G7LA 2O5IC 1E2ZA 3MA2B 1B50A 5GAHC 2HUGA 2PZTA 1IBMQ 2Q2TA 4KN4C 2DNCA 4GKKQ 4HCEA 1HNWL 2LFNA 4R9WA 1L2FA 4LWCA 5IWAL 1EY7A 3W1BA 4LUZA 1PH9A 2YTXA 4IUNA 1YEZA 3J7YW 5IYCH 2OCEA 4Z9CB 2A73B 1WTVA 3EVQA 2B2UC 3PUVA 3E5SA 4FYDA 3BYYB 1PV4A 1C4QA 1RL2A 4OX9L 1I50H 2F0GA 1GOZA 1TS2A 4L5SA 3OWEB 4GLXA 1BF4A 1X3FA 4YHHL 4O2DA 1DOKA 3GTKH 2M2LA 3U9OA 3CCRA 1AE2A 2OT2A 2EVBA 4X6AH 2KUMA 4X65L 2CQOA 2K5NA 2SNSA 4A3IH 1VQIA 2VNUD 4H02A 2E2DC 2O2LD 3K5NA 1NAPA 3LWEA 3I91A 4JV5Q 4OWXB 2VQFQ 2TMPA 4ZUJA 2R93H 4DR7L 2EY1A 1EOTA 5C4ZA 5HGTA 3J81L 3CCEA 2H1EA 3CCJA 3OWFA 4DAYA 1L0XB 2AQ2B 4DR5L 5LMNQ 4C1NI 1PH2A 3HOWH 3BU2A 3TZUA 5JJZA 1VQLA 2F0UA 4Q5VA 1LV9A 1SMYC 2A74C 2JJQA 3VR2A 1MSHA 3SE0A 1WTXA 2HD3A 1SBBB 2A5HA 1TS3A 1FL0A 4B3SL 2EZVA 5EPLA 4RCNA 2BA1A 1B2TA 3KUPA 1YNJC 1HH2P 1T5XD 4X66L 2F3IA 5BN4A 3HOXH 2N3SA 5C44H 4LF7Q 4LFBQ 1ENAA 3HOVH 3ULLA 2MO1A 1UEBA 1F2MA 5JEAH 3J81E 2F0JA 2RSNA 2VUMH 1B44D 4Y7NH 2XTIA 1FNVA 3JAME 5IP9G 3KF6A 1VQPA 4TSSA 2F0KA 1VQDA 2QDLA 3PO3H 5DM63 2E2IB 2JYOA 5LMUL 1TS5A 1VQKA 4ID6A 1LTBD 4TQUS 4XQNA 3UDIA 5FOBB 3OYYA 5KNCA 1QVFA 2HDLA 5GAGC 1CT1D 5JAVA 3G48A 3Q23A 3BDLA 4JI8L 2ID0A 1EYDA 3BG3A 1FD7D 1LT5D 1GUGA 2CW0D 2QGQA 1PRTB 3TREA 2B2YA 4KY6A 3FMCA 4Q0FA 4RCOA 2B63B 1SROA 1IYJB 1I5FA 1A2TA 2C9OA 1K28A 3KLSX 2SEBD 4A3LG 1DGSA 5M5WB 4RMFA 1QZGA 4B3TL 3K6OA 4GNXB 1S5BD 3S24A 4GOPA 4IQZA 3GTPB 4WJ4A 3VA7A 3NSWA 4UP8A 1UAPA 4DR1Q 1CZWA 4LF4L 2VXWA 4K8JA 1J5EQ 4QQBX 3NWSA 4IN3A 1GD7A 4ZK9B 4LFAQ 1WYDA 3VR5A 2HIXA 1K9MC 3K7AH 4JI1Q 2IT1A 3HS0C 3HOZG 4A3IG 1PHJA 1AFPA 3LX0A 1YNND 3QOLA 1PH8A 3R8BA 2L5TA 1CZGA 1XNQQ 4DV7L 4C3HB 1VQFA 1K73C 5ELOA 4QCLA 5C3EB 4C2MH 4DV6L 4GKJQ 2PQEA 4JI6Q 1GJXA 3CCVA 3PIOA 2IHFA 1PYSB 2AMCB 3C1EA 1CKNA 1V1PA 5KGUA 1WTWA 3V2TA 4DFAA 1CKNB 2PYKA 3CPWA 4LF8Q 3CC2A 4DV4L 2D0OA 5C3EG 1STBA 3QIAA 5DM73 3P20A 3B6YA 1QNUA 2ENBA 4DV2L 1GUNA 1SNDA 3Q0AA 3EIVA 3X3NA 3NTKA 1EU3A 4I7ZC 1ILPA 2ATWA 2K75A 5K5PA 1JQYD 4X64L 5EBCA 1BQQT 2F0WA 1F2LA 4KKTA 1PH7A 2Q2UA 4DR6L 3OSOA 5A2QE 4CKBA 4K8IA 2IX1A 1EY8A 1TY2A 2KHIA 3HOVG 3TMEA 4P2CB 2PMZE 1Q90A 3OMGA 1QNKA 3U9SA 3IKJA 4ZLTF 3S9WA 5CBAE 1VQOA 1X9NA 1DOLA 1PTOF 4A3JG 2DGYA 4HJ8A 4GN3B 4NMZA 5HGQA 2DNEA 2A6ED 2B29A 3EA6A 3F2DA 1D7QA 3KLRA 1HA6A 1PYWD 3SK5A 3STBD 5IOCA 4AQYQ 1Z6HA 1U5KA 1VF7A 1MD2D 1W3SA 3K0XA 1BKBA 3GTJH 1OTCA 3MAQA 5FLMH 3TZDA 2UUCQ 1WVLA 3I2ZA 5IP7G 1PXUA 1YZ6A 1HNXQ 4BBRG 5FLXc 2NB0A 2ZM6Q 4BXXG 3JAML 5M3FG 2HCIA 1EY6A 1R9TB 3MFYA 3VDYA 3DLLA 5ELEA 3CCQA 1V8QA 1CQVA 1K8OA 2QW7A 4CJ1B 4LFAL 4LF9Q 2AQ1B 2JN4A 1DM0B 2IPKD 3D3RA 2PNRC 4LAAA 5E3FA 4RWSC 3N52A 4ZQ3A 2F0OA 1DZ1A 4DUYL 3NELA 1KRTA 1XNQL 3F2CA 1CI3M 1JJGA 3Q8DA 1RKNA 4PMWA 4KKSA 1H9MA 1SEBD 3S16H 2A68D 1ENCA 1EWHA 1CUKA 4DK0A 1L1OC 4DGZA 4DA2A 1JB3A 4GOPB 5CV6A 4K6LA 2KCCA 1HXYD 5E4WC 2LKVA 4JI3L 1TWCH 2IL8A 3R2IA 2R7ZH 1TWHB 4A3KH 1HRJA 3SEBA 1CA5A 2FMCA 4R1JA 2PPBC 4JI3Q 2R7DA 1Y1WH 2I5MX 4EX5A 1KAWA 3HKSA 2VQEQ 4NXNQ 1X3PA 1NMGA 2MJ8A 4OHJA 3J80i 3VR4A 2E74C 2FHTA 4IJHA 2F0EA 2PW5A 3I4NB 1STEA 3H09A 2ES2A 3C2PA 4FF2A 3ND9A 4WJWA 2L1BA 2KCMA 4DUZQ 1RCVD 1KL9A 4LF5Q 2EY2A 5CV8A 1KXLA 1FGBD 3IFDA 1HHVA 2WKDA 2AKWB 2XIWA 3J7AV 3K5LA 3S15B 1DOMA 1TR5A 4A3DG 1NR2A 3PO2B 5C0XI 5C0XJ 4NB3A 4C3IG 4CDEC 3R2TA 4GN4B 1SFOB 4KV6A 2ASBA 5BN3A 1S5FD 3PIO3 1XPUA 4DK1A 1E0BA 2KBNA 1PH6A 4LUOA 2L0CA 3OIQA 4JI1L 4YIJA 1D6EC 2A6HC 4GZYC 5IYBH 2MPMA 2WB1E 3M3YB 3ER0A 1BBUA 4G7HC 1I4XA 3H0GG 3L9AX 1TT2A 3PIPA 3IAYA 3L3OC 4ZUIA 1B53A 3SHLA 2QEJC 2D5DA 3A56A 5IT9c 5M5YH 5GQOA 2R92H 2CW0C 4DV3Q 2Z8LA 1IBKL 2CFMA 4DR6Q 4BBSB 1OXTA 4AYBB 1CK1A 3QWNA 1RD9D 4DR3L 1HTLD 1D1IA 2A6HD 1E3PA 3GTGH 1EZ8A 2Q8TA 5C0XH 4DK3C 1S3OA 1YHQA 1CSQA 2BE5C 5M5XH 4KY5A 1SYBA 1EQTA 4QY7A 3BVMA 3W2DA 1XMOL 3GTLH 1JR0D 3NE5B 2NN6G 3I4OA 2I0QA 1WOCA 1IKMA 4A93G 4PZ6A 1HR0Q 1SNCA 2UUCL 2Q2IA 4DU9A 5CBEE 3I56A 4OELB 4N9PA 3TEHB 3NBIA 2F1MA 3K59A 1K3RA 2DUDA 4TVAB 2K5WA 3A5ZB 2EYMA 1KNAA 5K36H 4HJ7A 4L5QA 2KOLA 2UUBL 1UUPA 1U4RA 4MHEA 4AQYL 2SNMA 4B3SQ 1JE5A 1TVXA 1TWGH 4B9XA 1EEFD 2NVYB 3GQBA 1WTQA 4DN4M 3PIP3 1WTOA 1VQ5A 2J7ZA 3H6MA 3NENA 2DN8A 3I4MH 3G6EA 2EYLA 4WORA 4DXGA 1VQ6A 1WJJA 3CCMA 5C5LA 3RZDB 1GM5A 1ASYA 2R93G 1GVPA 3MXNA 3G6JB 4OX9Q 3BJUA 4A3BB 2I07B 1SXTA 2YU9B 1HZ9A 2VQFL 4XQQA 4L8JA 1Q8IA 5ISRA 1B70B 2JA6H 3L0OA 4NPSA 4JYAQ 1QE6A 4L63B 2F3VA 5DAUA 3CXCA 1KAAA 3AFPA 5E1FA 2RSOA 2VUMG 1K8GA 2LXJA 4RGMA 1PTOB 3PGZA 2F0PA 3OMCA 2R61A 3KF8B 4YHHQ 3V96A 3BS1A 1SMYD 1N33L 5IODA 3A54A 1BXTA 1A2UA 2OEOA 3D0FA 1Y69U 3RZOB 3D4DA 1FYCA 2IJ0A 3TS0A 2Y0SG 2NVTB 4DPGA 3M85A 2VB2X 4DV0Q 1EWCA 1AN8A 4JI5L 4QJFA 5FK9C 2ZJPA 3RN5A 2F0QA 4FNFA 4DV0L 4GKKL 3F2UA 4JBWA 2KVMA 4K5XA 4UY8C 5FLMG 3K5MA 2VZAA 1VQEA 4A3EB 1W2BA 3FPPA 1PH1A 2EJGC 1LTSD 2MQHA 4YY3Q 2FINB 2JA5H 1JOOA 2EQSA 2FMMA 4XYOA 3FEWX 1QUQA 3PUZA 4OGQC 1GUSA 3NTIA 4V0BA 4OO1G 3I4MG 1PRTF 5EPJA 4J6HA 3DWPA 1VMPA 2EY6A 4CGYB 1SNOA 4XDXA 2EJMA 2OF1A 4KK7A 4RHRA 3E3XA 1J6QA 3CPFA 3IL8A 5CORA 4Y52H 3S1RH 3AYHB 4IFDI 1VQ7A 1PZJD 3EFXD 1KNEA 3I3CA 1H9RA 1N33Q 4IFDH 1TWFB 4QIWB 2L9HA 1KABA 4IJLA 2ZTCA 3U58A 3S2DH 1U4LA 4DR2L 2JA6G 1X54A 3DHQA 1STAA 3CHBD 4DV1L 4JI8Q 1BBWA 1OXSC 3DWQA 5NUCA 3ULJA 1ZYRC 2K05A 1E2WA 2PQAB 2D62A 4B3TQ 2UUAL 3PSIA 1PFSA 4G4KA 2K5QA 1LLRD 2PQAA 3K81C 5DLQE 4NXML 1WTRA 3H91A 4A3FB 2VB3X 4BBRH 3C1FA 2QA4A 3E9IA 1EY4A 1GHJA 1Y1WG 2WKCA 1RTNA 3AU7A 1ENFA 1YHBA 1GUWA 3H0GB 4KHPQ 4FXKC 4A3GH 5ELFA 4WRDA 3AB9A 4FF3A 2Y0SE 1MJCA 1MI2A 2PZWA 1ESFA 5BR8Q 2EYJA 1JCKB 4LFBL 1Y14B 2UXCQ 2ZJRA 1FGUA 2I5HA 4JV5L 4RGOS 1JWSD 1PLFA 4DNTB 2L11A 1UEAB 1L0WA 4C3IB 1UNSA 1DD2A 5DEHA 2UXDQ 4NKLA 4IUPA 1QZHA 2HT1A 4DV1Q 4A93B 4OO1H 2N49A 2CKZB 2NZ1D 2UUAQ 1EIHA 4C3JB 1Q3LA 1B9NA 4HMJA 2I5LX 2EYPA 1A8VA 4R4TA 4AH6A 2NN6H 1IXRA 5FO7B 2GVBA 4KY7A 2A1AA 1TWAH 3KYHC 4QUFA 4OONA 1YVCA 3BDOA 1N8RC 2AQ3B 4DR4L 3TP7A 1G6PA 4JG2A 2F0FA 1SYGA 1N36Q 1SYFA 1YJNA 2C5CA 2VS1A 5EKLA 2E2JH 1YI2A 4IUVA 1BCPC 2WAQB 4UP7A 5KYLA 4TKOB 4HIMA 1TWAB 5D65A 3LWUA 1CQFA 1X6OA 1HQMC 3F2BA 3K80C 2MO0A 2F0HA 4ZKCB 2EE1A 2K28A 3RNUA 2B2WA 5HY6A 4C3JH 1H9JA 2DY8A 2ZXOA 4GOPC 1HNZL 2V4DA 4A3DB 2Z0SA 5JJKA 3NPPA 1QJOA 4A93H 3PO2G 3CC4A 1QWYA 5IY0A 3I4NG 1I4HA 3PV0A 3A55A 3JAMc 1IYUA 2HDMA 4C3IH 3NEMA 2H5XA 2P5ZX 1XNRL 2B3GA 1KLGD 2GVAA 1SYDA 2OQKA 2RKSA 1YHAA 5T1IA 2KJXA 1XJVA 4QUCA 3A8JE 1EY5A 4A75A 1ILQA 1JE4A 2F0VA 3N6RA 1EFWA 1LT6D 1F2ZA 1CSPA 3PO3G 4A3GB 1X32A 3HOUH 2PZUA 3H0GH 1EWIA 5ELBA 4A3EG 2RDHA 4JI5Q 3GTQB 4B9WA 1MKHA 2L55A 3O13A 1STNA 4A3FH 5D3IB 2EYOA 2QF7A 1VQMA 1TY0A 2NN6I 1J8IA 1Y1VB 3T1YL 5IP7H 2EY5A 3NBHB 1Z47A 2QDBA 5A2QL 4FF1A 4WFN3 5G3LF 4G57A 2X6LA 5J3BA 2LS01 1B1ZA 4IPGA 4BY7H 2N78A 3JAMi 1CA6A 2B2UA 3J81i 4A3MB 3S2DB 1ZYRD 3D4RA 1AE3A 4DNRB 2PI2E 3OPOA 4HIDA 1TWFH 4JI2L 2Z4HA 4XT3B 2MUYA 1D5XC 3CCUA 1VQ4A 4ULLA 2ZXPA 4JOIC 1A0IA 2HHHL 3S1RB 1XWEA 1HZCA 2K6AA 4JI7L 2K50A 4IPDA 2RHQB 4I7AA 1SJHD 4BXXH 3RUZA 4HJ5A 4XYQA 4GNXA 4LUVA 1UE5A 1LACA 2SOBA 3UE0A 3E6ZX 1T5EA 5EGTA 1RIPA 1II3A 3AFQA 1IL2A 2JSOA 1TQOA 3UE1A 2E2HB 1JOQA 5ELDA 5IE8A 2JA5B 2AHOB 4P74A 3CU7A 1R4QB 4ME3A 2EOTA 3CAMA 4HIOA 2E5LQ 4RA8A 5FJ8G 1E2VA 3H94A 3J81c 2XVSA 1UWVA 4LF6L 5IGCA 1H9SA 4F8MA 2MHVA 3FPUB 2JA5G 4IPHA 1WTHA 4X3SA 5DNFA 4ZYSA 4CDCC 4DXFA 3DEPA 4OXPA 3FKIG 2J4XA 5C4XG 1I4QA 3TS2A 1WCMB 5H1SE 3M4OH 4XTCS 2RDFA 4GKJL 1X3QA 2LXKA 3S1NB 3T13A 3VYSA 2L15A 1ZEQX 2NVXB 3T53B 1V1PB 2D9UA 1HR0W 3KDFB 3T1YQ 2WIIB 4OO1I 2JA6B 2NVXH 1XPRA 3J81j 4G7OC 4N8FA 1YNNC 1FNWA 2GA4B 1K8MA 1RDPD 3S1NH 2YU9H 2JA9A 4QMGA 3M4OB 4A3BH 1WCMH 3JC66 2NTSA 4JK1C 5E7NA 1EIFA 1IL8A 3RZDH 3FVQA 4B08A 4A3FG 5KEEA 1D8LA 2F0SA 5CV9A 1A63A 2B8GA 2F03A 3U4VA 1B9MA 4CKCA 4QGUA 5I9OA 4BY7G 4YCUA 2XRSD 1VQNA 1JJ2A 1EY9A 5JPNC 3KK7A 3W3AA 2N55A 4JI4L 3C46A 1HUNA 3ERSX 2NVYH 1HFGA 1TWGB 2HQLA 1M1KC 2WAQG 3HOWG 2E2HH 4LNQA 1DXMA 1I94L 3C3LA 1XTDA 1MSGA 3TSSA 3CRKC 2R7FA 3HGBA 4O0AA 1L0YB 1I94Q 1FNUA 5D3DA 4E6IA 2OQ0A 1LT4D 1PDQA 1JB7A 3PCOB 2AUJD 4P71A 4U68A 1FVIA 1VS0A 3KJOA 2EXDA 1SE2A 4P75A 3V05A 4L6TB 1N32Q 3OW7A 4MN3A 4B3ML 3NBHA 4NXNL 4A3MH 3A8IE 5AJ3L 4QL5A 2RF4A 4BY7B 1GUTA 4DAYB 2CWPA 3Q22A 5JJIA 3L2PA 2Z4IA 4PQXA 3DUZA 1NE3A 2VW9A 3BZKA 5IYDG 1TXYA 4K5WA 1Y1VH 1NSNS 1ONLA 3GP7A 3TQYA 4PZ7A 2CCZA 2EJFC 4G7ZC 3VR6A 1NJIC 4K14A 5E4XA 2F0IA 3GTQH 2G5DA 1M90C 1H9KA 3I90A 3HG9A 1PTOD 1U9RA 3HOUB 3NWTA 1BUVT 2EXZA 3AMUA 1Q1EA 1VF5C 2R3ZA 3A0JA 1ZXTA 1X65A 4IALA 4ZCKA 1EY0A 1QVCA 1SFOH 2PNHA 1RODA 1EQRA 1QUQB 4HIKA 1NCVA 3A7AB 3PO2H 1GO3E 4KHPL 1O7IA 1O7LA 2B2TC 3E9HA 3Q24A 3S15H 2BCOA 1QOHA 4LF6Q 1QVGA 4P73A 4R8IA 3A8KE 1UE7A 1XMOQ 4RAUC 4A3DH 4UHVA 1SSOA 3U4ZA 5KNDA 3WOFA 2X6GA 3FDTA 4U673 1BOSA 5J22A 3I4NH 1G8ZD 3GDEA 2CH4W 1SYCA 4H44C 3R3OA 1EOVA 2WAQE 4UDUC 2HQEA 4JVZA 4HSVA 1F9SA 4KHVA 2A19A 2A69C 3Q6SA 2BDOA 2IY5B 1FR3A 4J15A 2EYHA 2UU9L 1OXXK 3BZCA 2AUKA 2E2JB 3NTHA 2MNAA 1WFQA 4CJ2C 1HPCA 3IFTA 2R7ZB 2E8GA 1TWCB 3ZYYX 4GLAC 1PVOA 2EDGA 4P72A 4KI0A 1EEID 3IRBA 5KRUA 2YV5A 3P1HA 4HR7B 2Z9HA 4JI0Q 2J0TD 4R4OA 1PFMA 1D1KA 3CCSA 1YJWA 4DKAC 3DEOA 4OEMB 1Q1BA 1LTTD 1MHWC 4V190 1IBML 2NTTA 2NYZD 2O5JC 2WFWA 3BVZA 2D2CC 2Z6KC 1F9QA 5IGBA 2TSSA 1CKOA 1PTOC 4FVMA 4BWGB 3M4QA 4KLKA 1M4VA 5IYCG 4IUTA 1E7ZA 1PZID 4RGNA 4DUZL 4LF5L 3CMAA 1K3BC 1LTGD 3H3VC 4IFDG 1EYCA 1J9OA 4M1UB 5CV5A 4TRDA 1CM9A 2UXBL 4R4CA 5JEAJ 3WWVA 4JBKA 4X65Q 1JICA 3MZ5A 1S72A 3M7GA 3K58A 2B2VA 4O42A 3MXNB 2ALYB 3GV6A 5G3LD 1WI5A 4C56C 5I2YA 1Z7TA 4JPBW 1YITA 2XWBB 3GTJB 2RDGA 4H13C 4BBRB 1ET6A 2JE6I 4HN7A 1EU4A 4YCWA 4KKUA 2WB1G 1EFID 1WCMG 2IWHA 2ZTEA 4PZ8A 3EN2A 3MTSA 1VQBA 4DAMA 3VYUA 4PG3A 4MTKA 2K52A 3HZXA 4HAEA 4IURA 2YYZA 2NUCA 1B4OA 3SGIA 1NUCA 4XXEA 5FLXE 3H3VI 4FF4A 5C4HA 4FP5D 4DR1L 1PA6A 4GLVB 1DJRD 1G2SA 4ILWA 5LL6X 4FXGC 3RLFA 4AIMA 3OOCA 4JCVE 2BH2A 3MHBA 4GN5A 5EJWA 4IUQA 1KC8C 5I6WA 4EQPA 1TKWB 1SNMA 4ZAIA 3LNNA 1PH5A 5AFWA 2XN9C 5EPKA 4DR4Q 5IT9L 1JJCB 2K5VA 3CW2C 3K7UC 1A62A 2X69A 2YTYA 2F52A 1MGSA 2K7VA 4CKEA 3TBIB 1F77A 3E0JA 4B3RQ 3BDCA 4IOCA 4A3EH 4C2MB 5C3EH 4X62Q 3KF6B 1RHPA 2XWJB 3KBXA 3ZJYC 1RTOA 1M8AA 2IW3A 4XT1B 3K5OA 1I6VC 2I46A 1BDOA 3M4YA 4A3KG 1L1OB 2A8VA 1I4PA 2K04A 1B7YB 4CBVA 3K57A 1ET9A 3NUCA 2NVTH 3K7AB 4BY1G 3RZOH 3CP0A 1RJTA 5JVH3 1X3GA 3WOEA 1MJEA 4IZ8A 1HTPA 1G6ZA 1G291 2A69D 1X55A 4CDDC 3NP8A 4K2KA 5BR8L 1PTOH 1NR4A 1EQVA 3M9BA 1LTAD 4IO9A 3T51B 2RVLA 1STGA 1PFBA 1JORA 3H3VH 2JK8A 5KYIA 2F0DA 3T56B 1FJGL 4BBSG 1GUOA 3VR3A 4KJNA 5M5WH 1TIID 2L4NA 3SVMA 1AZPA 4ME5A 4ABNA 1VQHA 2B2WC 4HSPA 2UXCL 4C3HG 5LMNL 1HFNA 4S3SA 5EKIA 4UAIA 3UDFA 5M3MG 3MXGA 1C7YA 3TN2A 4DV6Q 1G91A 3FHWA 4CDFC 1ICWA 4DR5Q 5A35A 4BA2I 1KDAA 1QILA 4AYBG 2NZOA 3J80c 1N34Q 1C0AA 4LW1A 3SK4A 3I4MB 2WP8J 1SLJA 3NHHA 1G51A 2HCCA 2Z1CA 1LUZA 2UXBQ 3NXWA 4LFCL 5FO9B 3F1ZA 1VCIA 3GO5A 4CHTB 3J80L 1IW7D 1U4MA 3D6CA 1SE3A 3PO3B 5TSSA 2VQEL 3KOJA 3VYTA 3E0EA 3NK9A 3TP8A 2LY7A 4PNYA 4X62L 5GAEC 4POGA 1CKMA 1R4PB 3I8ZA 2VUMB 3F8TA 4YY3L 3KLSA 2WINB 4A3CG 1SNPA 3X3MA 3VA5A 4BS9A 1Q7YC 1XPOA 4IPCA 3HOVB 4HMIA 2Y0SB 1IW7C 1GKHA 4PV1C 1SDFA 3GTLB 5IGGA 5M5XB 3AEVA 1LTLA 3D8GA 1E1TA 1O80A 1HCZA 1YIJA 2GN5A 3PF4A 1KD1C 3RD4A 3GTGB 1EZ6A 5IGEA 2G9DA 5C3XA 1SAPA 1XTCD 3MC0B 1KIXA 1EYGA 1N9WA 4ZRZA 3T16A 3J80E 3CF5A 4X3UA 4BBSH 4DAPA 4YWLA 2R92B 5M5YB 4DK6C 1AW7A 1D2BA 2WB1B 3URYA 1CHPD 4JBMA 1S4ZA 4BA1I 5IIFA 3P7JA 1SE8A 4HJAA 3M3YH 3SDZA 5I9PA 2K32A 3R93A 4A3BG 2NWGA 2R92G 3CKIB 2JQOA 5D14A 5L37A 1DYQA 3KDFA 3ONAB 1C8CA 2PW7A 2BA0A 4PMCA 2O4XA 2K33A 1Q8KA 3QG1A 1F9PA 2ZM6L 4K0KL 1B8AA 5EBDA 1HJPA 1EL0A 1TS4A 4EVOA 1PYBA 2CWAA 2QKIC 4H0LC 3GTKB 1VQGA 2PO4A 1SMXA 5JOBA 1KRSA 1BCPB 1T9HA 5IGFA 5M9OA 3I55A 1B3QA 1RF2D 2RCNA 4F87A 5C5MA 5FLXL 3W5OA 5COYA 1UE1A 4L5TA 4EGVA 1Y1WB 1FJGQ 3HKZE 3OHXC 1IYVA 1KTKA 1PRTC 2N8NA 1P8LA 2KA7A 1Q81C 1LM0A 2KEDA 1TWHH 1OXVA 4A3KB 4RKBA 2IX3A 4XQJA 1AEXA 3HOZH 1BCPD 1U4PA 2IX0A 1KDBA 3AQQA 5CV4A 4C1NK 4BY1B 1STYA 1EYAA 3S1MH 5I6YA 4FDBA 2R7ZG 4DR7Q 4JW0A 3TP5A 5C6AA 3A7LA 4K6DA 3S16B 1O7YA 1BR9A 2NVQB 1OO9B 2F0LA 1N32L 5CMDA 4JI0L 2NZHA 1U0LA 2WV6D 3MEFA 2JEBI 5EAYA 1SE4A 5EQ0A 1YBYA 2JA7G 5IYDH 3EROA 3DXJC 3FRPB 2ICIA 2XGTA 4DR3Q 2LMCB 2B39A 1IZ6A 1KHIA 5FJ8H 2DY7A 2PCFB 4POFA 1YNXA 3CQZH 4B3MQ 1D5MC 4KJOA 5KNBA 2B8FA 2BH8A 1Q46A 2CQAA 3CMEA 2OTJA 4NDXA 1HR0L 1R9TH 3CRLC 4JBJA 4M8AA 1H9SB 4KMUC 4GNXC 4RG1A 4H7BA 1IHZA 4DV4Q 2D0PA 4ALPA 1IKLA 5C4JH 1Y1VG 2R6GA 2DJFC 4WJ3M 3MXUA 2KQ3A 4J1MA 4JC0A 1ML0D 3STBC 1VQJA 2JEAI 3QR8A 5CC4A 3HOYG 1IBKQ 3OW2A 1SNQA 3NQTA 1Q82C 1H95A 4LJZC 3MFGA 1Q86C 4ZKBB 2MFIA 1E24A 4MZ9A 3KLWA 3UDGA 2JA7H 5J1ZA 4OIJA 3HFZB 2K03A 3EJIA 3I7FA 4JI4Q 3TRZA 1ICFB 3S14B 4FXDA 2KECA 5GROA 4IUUA 1BVSA 3GV3A 4DV5Q 3FKIB 4ODGA 1KLUD 1DONA 4HEDA 1VQ8A 4GS3A 3CC7A 1AP0A 5I4DA 1TU2B 3M4PA 3RMHA 5C4XH 3D31A 1P16A 1YJ9A 4LF9L 4EQOA 1ESRA 3CCLA 4R4IA 4JYAL 4X3TA 5M3FB 1JT8A 1K0RA 5LMNW 2AWNA 3I73A 4LFCQ 1JC7A 1WTPA 1W6KA 1XX8A 2Q8RE 3PUXA 1PZKD 1JMCA 1E22A 2RBMA 1Y8PB 2RA4A 2UUBQ 1V9PA 4JOIA 5LHY1 4F7XA 1W6JA 1X56A 1K8AC 4OIKA 3PMFA 2IHEA 3L7ZC 1ZKOA 4C3HH 1SRUA 4F88A 3T4AC 1GHKA 1Y8OB 1SYEA 2F0NA 4KN7C 1V1QA 3BZDB 1KDCA 2N88A 1A15A 2RCFA 4NW2A 4YWKA 2MGSA 2BOSA 1AH9A 2M00A 2KCTA 4MIUA 4LK1C 1LO5D 2ZJQA 3J7AF 2RHSB
chains in the Genus database with same CATH topology
3E9IA 3S24A 1HNXL 4GOPA 2UXBL 1Y1WG 4R4CA 5JEAJ 3WWVA 1PH4A 4X65Q 1S72A 4JBKA 4WJ4A 1YHBA 4KHPQ 4A3GH 3ULPA 4UP8A 4DR1Q 3MXNB 2ALYB 4DV3L 4LF4L 4OWWB 4A4IA 1WI5A 1LYLA 1NBWA 2Y0SE 4A3LH 1MJCA 1YITA 3GTPH 1J5EQ 4QQBX 1Z9FA 5BR8Q 4LFBL 1Y14B 1GD7A 2UXCQ 2JE6I 2ZJRA 3OTOL 4LFAQ 1FGUA 2I5HA 1WYDA 4JV5L 4YCWA 2WB1G 1XMQQ 1WCMG 2HIXA 2ZTEA 3EN2A 4PZ8A 3K7AH 4JI1Q 1K9MC 1L0WA 2IT1A 2B63H 3OTOQ 3HOZG 1VQBA 4A3IG 1PHJA 2HIVA 4DAMA 2UXDQ 4PG3A 1QZHA 1PH8A 4YCVA 3KJPA 4DV1Q 2K52A 2HT1A 1UE6A 1IBLL 2YYZA 1XNQQ 5JJLA 2N49A 2CKZB 4DV7L 4JI6L 3SGIA 2UUAQ 3H3VI 3S17H 1VQFA 1VQAA 4DR1L 1K73C 1PA6A 4GLVB 2I5LX 5ELOA 1A8VA 4R4TA 4C2MH 4DV6L 4GKJQ 4B3RL 1NTGA 4AH6A 4DV7Q 4JI6Q 3CCVA 3RLFA 3PIOA 1IXRA 2IHFA 4R4QA 4A3MG 4QIWE 1PYSB 3G4SA 2GVBA 4AIMA 2AMCB 4A3JH 4JCVE 2A1AA 1TWAH 1CKNA 2K5HA 3KYHC 2BH2A 4GN5A 1L1OA 1YVCA 4OONA 2E2IH 1CKNB 3CPWA 4DV2Q 1KC8C 1N8RC 3CC2A 4LF8Q 4DR4L 1G6PA 4JG2A 5C44G 4DV4L 3RN2A 2D0OA 5C3EG 3S2HH 4JI7Q 1OXUA 5JEAG 3B6YA 1PH5A 1N36Q 3HOUG 1YJNA 2VS1A 4DV2L 4DR4Q 2FXQA 2E2JH 5K36G 3EIVA 1YI2A 4HJ9A 3LGJA 1JJCB 4UP7A 2K5VA 3CW2C 2K75A 3K7UC 1A62A 2ATWA 4X64L 2YTYA 4HIMA 2F52A 1PH7A 4B3RQ 2Q2UA 4DR6L 4IOCA 1X6OA 4DV5L 4A3EH 5AJ3Q 3F2BA 3K80C 4UPAA 2MO0A 2IX1A 5C3EH 4X62Q 2KHIA 3KF6B 4X64Q 3RNUA 3HOVG 5HY6A 2PMZE 4C3JH 3ZJYC 1HNZL 4GOPC 2Z0SA 4KHZA 4A3KG 1VQOA 1L1OB 4A93H 1X9NA 3PO2G 3CC4A 5JJKA 1HZAA 5IY0A 3PV0A 4A3JG 2A8VA 3JAMc 3I4NG 1B7YB 3RLOA 4C3IH 3EBEA 2DGYA 3NEMA 2H5XA 5C0XG 4HJ8A 2NVTH 1V43A 2B3GA 4GN3B 2HHHQ 1XNRL 4BY1G 5HGQA 3RZOH 2B29A 3CP0A 2GVAA 3F2DA 1D7QA 2F4VL 2OQKA 4JI2Q 1X3GA 3GTMH 1MJEA 4AQYQ 3STBD 1G291 1X55A 1U5KA 1YHAA 1XJVA 2B63G 5BR8L 1I6HH 3J7ZC 1W3SA 3K0XA 1BKBA 3M9BA 3GTJH 4A75A 3PUWA 4IO9A 1OTCA 5IP9H 5FLMH 2UUCQ 1EFWA 3I2ZA 5IP7G 1CSPA 1YZ6A 1HNXQ 4BBRG 4EQ5A 5FLXc 3PO3G 2ZM6Q 2F4VQ 3HOUH 4BXXG 2EIFA 3H0GH 3H15A 1EWIA 1I3QH 4A3EG 3H3VH 2JK8A 4JI5Q 5M3FG 1FJGL 1MKHA 4BBSG 3RR5A 4A3FH 5M5WH 3VDYA 1VQMA 2NN6I 3T1YL 3DLLA 1VQHA 4UP9A 5IP7H 3CCQA 3NBHB 1Z47A 1HNZQ 2UXCL 5LMNL 4LFAL 4LF9Q 1N34L 5ELNA 3UDFA 5M3MG 1J5EL 5J3BA 1C7YA 1VQ9A 4DV6Q 4IPGA 4BY7H 3FHWA 2N78A 3JAMi 4X66Q 3J81i 4DR5Q 4BA2I 1E1OA 1AE3A 2Q2HA 4AYBG 2NZOA 3J80c 1N34Q 4A3GG 2PI2E 4LW1A 4DUYL 2WP8J 4HIDA 1TWFH 3CD6A 3J7A5 1SLJA 3NELA 4JI2L 1IBLQ 3CCUA 1G51A 1KRTA 1XNQL 1VQ4A 3F2CA 1LUZA 1ASZA 4JOIC 1A0IA 2HHHL 1JJGA 1C9OA 3HKZG 2UXDL 2UXBQ 3Q8DA 4PMWA 1HZCA 4LFCL 4JI7L 2K50A 3F1ZA 1VCIA 2RHQB 4IPDA 5LMUQ 3S16H 3GO5A 1CUKA 4BXXH 1L1OC 1XMQL 4HJ5A 4GNXA 4LUVA 1UE5A 3PUYA 4GOPB 5M3FH 4DUYQ 2VQEL 3T1HQ 3KOJA 3UE0A 3E0EA 4JI3L 4X62L 2KENA 1TWCH 5GAEC 4POGA 1CKMA 2UU9Q 2R7ZH 3F8TA 1RIPA 2K14A 3W1GA 4YY3L 3A5UA 4A3KH 3A74A 3AFQA 4LF7L 1IL2A 4A3CG 3UE1A 4DR2Q 4R1JA 1Q7YC 5IE8A 2OWOA 1XPOA 4JI3Q 4IPCA 4IFDJ 2R7DA 5GADC 2AHOB 4P74A 1Y1WH 3S1QH 3M7NA 2I5MX 4EX5A 1KAWA 3FKIH 1GKHA 3HKSA 3CAMA 4ME3A 2VQEQ 1NMGA 1MIUA 4HIOA 3J80i 3T1HL 2E5LQ 4NXNQ 4IJHA 4OWTB 1N36L 5FJ8G 3DM3A 2JA8H 3J81c 3AEVA 1LTLA 1E1TA 2ES2A 3S14H 1UWVA 1YIJA 2GN5A 3PF4A 1KD1C 4NXMQ 3FP9A 4LF6L 4A76A 1X3EA 3UDXA 2KCMA 2E5LL 4LF8L 4A3CH 4DUZQ 2ZTDA 1KL9A 4LF5Q 2KHJA 2JA5G 4IPHA 3U50C 1KIXA 1EYGA 1KXLA 1KQSA 1N9WA 2AKWB 3CF5A 4OXPA 4BBSH 1PH3A 3FKIG 4YWLA 4IOAA 4DK6C 5C4XG 1NMFA 4A3DG 3TS2A 5H1SE 3M4OH 2JA8G 4XTCS 5C0XI 4JBMA 4L5RC 1Q12A 5C0XJ 4GKJL 4BA1I 4NB3A 2LXKA 1NY4A 1SE8A 4GN4B 4HJAA 3M3YH 2VL6A 2ASBA 4MNOA 2L15A 3GD7A 4A3BG 2QEXA 1HR0W 3K8AA 3KDFB 3T1YQ 1XPUA 2R92G 1SR3A 2LSSA 1XNRQ 2KBNA 1PH6A 3HOYH 4LUOA 2JQOA 4JI1L 4OO1I 1K83H 3KDFA 2NVXH 5IYBH 3J81j 1XPRA 4DNIA 2BA0A 4APVA 2WB1E 1Q8KA 3S1NH 3ER0A 1BBUA 2YU9H 2ZM6L 4K0KL 1VQCA 2JA9A 1B8AA 3H0GG 3PIPA 4A3BH 1HJPA 1WCMH 2V1CC 3JC66 1HZBA 5E7NA 1EIFA 5IT9c 1EIYB 5M5YH 5GQOA 2R92H 1PYBA 2CWAA 4DV3Q 3RZDH 2CFMA 1IBKL 4A3FG 1EQQA 4LF4Q 3GTOH 4K0KQ 1OXTA 2YTVA 1VQGA 1D8LA 3G71A 2OTLA 2R93G 2C35B 4DR3L 1SMXA 1KRSA 1SN8A 5IYBG 1T9HA 1S40A 1A63A 1E3PA 3GTGH 3U4VA 4QGUA 3I55A 4BY7G 4YCUA 4DK3C 1S3OA 1VQNA 1YHQA 1CSQA 1EUJA 2VY3A 1JJ2A 1HNWQ 5M5XH 5M3MH 4QY7A 3HOXG 1XMOL 3GTLH 4JI4L 2RCNA 2NN6G 5IWAQ 3I4OA 2I0QA 3ERSX 3W5OA 1WOCA 1UE1A 2NVYH 4L5TA 4XIGS 1FJGQ 4YWMA 4A93G 2NVQH 2HQLA 3HKZE 4PZ6A 2WAQG 3RLNA 1M1KC 3ICEA 1HR0Q 3HOWG 2N8NA 2K4KA 4MTNA 2E2HH 1P8LA 2UUCL 4LNQA 2PI2A 2Z6KA 1Q81C 1LM0A 2Q2IA 1I94L 3PF5A 1TWHH 1OXVA 4BY1H 3KFUA 3I56A 4AYBE 2AWOA 1XTDA 3TEHB 2R7FA 1K3RA 3HOZH 2IX0A 5GAHC 4O0AA 2DUDA 3AQQA 4TVAB 3A5ZB 1I94Q 3S1MH 4HJ7A 4L5QA 2UUBL 4FDBA 2R7ZG 1IBMQ 4DR7Q 2Q2TA 2OQ0A 4AQYL 4B3SQ 4GKKQ 1JE5A 1HNWL 1TWGH 1N32L 1JB7A 3PCOB 4P71A 1L2FA 4LWCA 4JI0L 5IWAL 3W1BA 2NZHA 4LUZA 1PH9A 1U0LA 2YTXA 1VQ5A 3MEFA 2JEBI 1FVIA 1VS0A 1YEZA 5EAYA 3KJOA 2EXDA 3NENA 5IYCH 2OCEA 4P75A 3I4MH 1N32Q 1YBYA 2JA7G 5IYDH 3PUVA 4B3ML 3G6EA 4NXNL 4A3MH 5AJ3L 4QL5A 2RF4A 1PV4A 1RL2A 4DAYB 1I50H 4OX9L 2XGTA 2CWPA 4DR3Q 1VQ6A 5JJIA 4L5SA 1IZ6A 1KHIA 5FJ8H 1WJJA 3L2PA 4GLXA 4POFA 1X3FA 1YNXA 3CQZH 4YHHL 1NE3A 4O2DA 3CCMA 2VW9A 4B3MQ 3GTKH 1GM5A 3BZKA 1ASYA 1GVPA 1Q46A 2BH8A 5IYDG 3CMEA 1AE2A 1TXYA 3CCRA 4OX9Q 2OTJA 4X6AH 1Y1VH 3BJUA 4X65L 3TQYA 4PZ7A 1HR0L 2CCZA 2CQOA 2K5NA 4JBJA 1R9TH 4A3IH 1VQIA 2VNUD 1HZ9A 4H02A 2VQFL 4GNXC 1NJIC 4RG1A 3GTQH 4DV4Q 1M90C 1B70B 2D0PA 3L0OA 4NPSA 2JA6H 4JV5Q 4ALPA 4JYAQ 5C4JH 4OWXB 1Y1VG 2R6GA 3CXCA 2VQFQ 1Q1EA 4WJ3M 2R93H 3AFPA 4DR7L 3A0JA 4JC0A 1X65A 3STBC 3CCEA 1VQJA 3CCJA 2JEAI 1QVCA 1K8GA 2LXJA 2VUMG 3PGZA 2PNHA 1SFOH 4YHHQ 3KF8B 3HOYG 1IBKQ 3OW2A 4DR5L 5LMNQ 1Q82C 1EQRA 1QUQB 4HIKA 1H95A 4BBRH 1N33L 1Q86C 1PH2A 3HOWH 3PO2H 1GO3E 3BU2A 1VQLA 4KHPL 1O7IA 3D0FA 2MFIA 3E9HA 3TS0A 3S15H 1E24A 2Y0SG 4MZ9A 4DPGA 1QVGA 4LF6Q 3KLWA 3M85A 3UDGA 2JJQA 2JA7H 4DV0Q 3HFZB 4P73A 3I7FA 4JI5L 4QJFA 2ZJPA 1UE7A 1XMOQ 4A3DH 3U4ZA 4JI4Q 3RN5A 3TRZA 1FL0A 4DV0L 4B3SL 4GKKL 3I4NH 2BA1A 4JBWA 5GROA 4UY8C 5FLMG 3GDEA 1HH2P 2VZAA 1BVSA 1VQEA 2F3IA 4X66L 4DV5Q 1W2BA 1EOVA 1PH1A 2WAQE 2MQHA 2N3SA 4YY3Q 5C44H 3HOXH 4LF7Q 4LFBQ 3HOVH 3ULLA 2MO1A 2JA5H 1UEBA 2A19A 2EQSA 1VQ8A 4GS3A 3CC7A 2IY5B 4DR6Q 4J15A 1QUQA 3PUZA 1OXXK 2UU9L 3BZCA 2MNAA 1WFQA 3M4PA 5C4XH 4OO1G 3I4MG 3D31A 2VUMH 2E8GA 1P16A 4Y7NH 1YJ9A 2XTIA 4LF9L 5IP9G 4GLAC 3KF6A 1VQPA 3CCLA 1PVOA 4R4IA 4JYAL 4P72A 4KI0A 1VQDA 1JT8A 3IRBA 3PO3H 1K0RA 5LMNW 2YV5A 4JI0Q 2AWNA 4R4OA 1J6QA 3CPFA 4LFCQ 5LMUL 3CCSA 1VQKA 1YJWA 4TQUS 3PUXA 4DKAC 1JMCA 3UDIA 3S1RH 3AYHB 1E22A 3OYYA 5GAGC 1QVFA 4Y52H 1Q1BA 2UUBQ 4IFDI 1IBML 1V9PA 4JOIA 1VQ7A 3G48A 1N33Q 1X56A 2WFWA 1K8AC 4JI8L 2IHEA 2ID0A 2Z6KC 3L7ZC 4IJLA 2ZTCA 4C3HH 1CKOA 3U58A 3S2DH 1SRUA 4DR2L 2JA6G 1X54A 2QGQA 3M4QA 4KLKA 5IYCG 4DV1L 1C0AA 4JI8Q 1BBWA 1OXSC 3TREA 3ULJA 1E7ZA 1V1QA 2PQAB 2D62A 4B3TQ 2UUAL 1SROA 3PSIA 1IYJB 4DUZL 4LF5L 1I5FA 1PFSA 3CMAA 4YWKA 2PQAA 3K81C 5DLQE 4A3LG 4IFDG 1AH9A 1DGSA 4RMFA 2KCTA 1QZGA 4NXML 4B3TL 2ZJQA 4GNXB 2RHSB 2QA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E9I A;  3S24 A;  1HNX L;  4GOP A;  2UXB L;  1Y1W G;  4R4C A;  5JEA J;  3WWV A;  1PH4 A;  4X65 Q;  1S72 A;  4JBK A;  4WJ4 A;  1YHB A;  4KHP Q;  4A3G H;  3ULP A;  4UP8 A;  4DR1 Q;  3MXN B;  2ALY B;  4DV3 L;  4LF4 L;  4OWW B;  4A4I A;  1WI5 A;  1LYL A;  1NBW A;  2Y0S E;  4A3L H;  1MJC A;  1YIT A;  3GTP H;  1J5E Q;  4QQB X;  1Z9F A;  5BR8 Q;  4LFB L;  1Y14 B;  1GD7 A;  2UXC Q;  2JE6 I;  2ZJR A;  3OTO L;  4LFA Q;  1FGU A;  2I5H A;  1WYD A;  4JV5 L;  4YCW A;  2WB1 G;  1XMQ Q;  1WCM G;  2HIX A;  2ZTE A;  3EN2 A;  4PZ8 A;  3K7A H;  4JI1 Q;  1K9M C;  1L0W A;  2IT1 A;  2B63 H;  3OTO Q;  3HOZ G;  1VQB A;  4A3I G;  1PHJ A;  2HIV A;  4DAM A;  2UXD Q;  4PG3 A;  1QZH A;  1PH8 A;  4YCV A;  3KJP A;  4DV1 Q;  2K52 A;  2HT1 A;  1UE6 A;  1IBL L;  2YYZ A;  1XNQ Q;  5JJL A;  2N49 A;  2CKZ B;  4DV7 L;  4JI6 L;  3SGI A;  2UUA Q;  3H3V I;  3S17 H;  1VQF A;  1VQA A;  4DR1 L;  1K73 C;  1PA6 A;  4GLV B;  2I5L X;  5ELO A;  1A8V A;  4R4T A;  4C2M H;  4DV6 L;  4GKJ Q;  4B3R L;  1NTG A;  4AH6 A;  4DV7 Q;  4JI6 Q;  3CCV A;  3RLF A;  3PIO A;  1IXR A;  2IHF A;  4R4Q A;  4A3M G;  4QIW E;  1PYS B;  3G4S A;  2GVB A;  4AIM A;  2AMC B;  4A3J H;  4JCV E;  2A1A A;  1TWA H;  1CKN A;  2K5H A;  3KYH C;  2BH2 A;  4GN5 A;  1L1O A;  1YVC A;  4OON A;  2E2I H;  1CKN B;  3CPW A;  4DV2 Q;  1KC8 C;  1N8R C;  3CC2 A;  4LF8 Q;  4DR4 L;  1G6P A;  4JG2 A;  5C44 G;  4DV4 L;  3RN2 A;  2D0O A;  5C3E G;  3S2H H;  4JI7 Q;  1OXU A;  5JEA G;  3B6Y A;  1PH5 A;  1N36 Q;  3HOU G;  1YJN A;  2VS1 A;  4DV2 L;  4DR4 Q;  2FXQ A;  2E2J H;  5K36 G;  3EIV A;  1YI2 A;  4HJ9 A;  3LGJ A;  1JJC B;  4UP7 A;  2K5V A;  3CW2 C;  2K75 A;  3K7U C;  1A62 A;  2ATW A;  4X64 L;  2YTY A;  4HIM A;  2F52 A;  1PH7 A;  4B3R Q;  2Q2U A;  4DR6 L;  4IOC A;  1X6O A;  4DV5 L;  4A3E H;  5AJ3 Q;  3F2B A;  3K80 C;  4UPA A;  2MO0 A;  2IX1 A;  5C3E H;  4X62 Q;  2KHI A;  3KF6 B;  4X64 Q;  3RNU A;  3HOV G;  5HY6 A;  2PMZ E;  4C3J H;  3ZJY C;  1HNZ L;  4GOP C;  2Z0S A;  4KHZ A;  4A3K G;  1VQO A;  1L1O B;  4A93 H;  1X9N A;  3PO2 G;  3CC4 A;  5JJK A;  1HZA A;  5IY0 A;  3PV0 A;  4A3J G;  2A8V A;  3JAM c;  3I4N G;  1B7Y B;  3RLO A;  4C3I H;  3EBE A;  2DGY A;  3NEM A;  2H5X A;  5C0X G;  4HJ8 A;  2NVT H;  1V43 A;  2B3G A;  4GN3 B;  2HHH Q;  1XNR L;  4BY1 G;  5HGQ A;  3RZO H;  2B29 A;  3CP0 A;  2GVA A;  3F2D A;  1D7Q A;  2F4V L;  2OQK A;  4JI2 Q;  1X3G A;  3GTM H;  1MJE A;  4AQY Q;  3STB D;  1G29 1;  1X55 A;  1U5K A;  1YHA A;  1XJV A;  2B63 G;  5BR8 L;  1I6H H;  3J7Z C;  1W3S A;  3K0X A;  1BKB A;  3M9B A;  3GTJ H;  4A75 A;  3PUW A;  4IO9 A;  1OTC A;  5IP9 H;  5FLM H;  2UUC Q;  1EFW A;  3I2Z A;  5IP7 G;  1CSP A;  1YZ6 A;  1HNX Q;  4BBR G;  4EQ5 A;  5FLX c;  3PO3 G;  2ZM6 Q;  2F4V Q;  3HOU H;  4BXX G;  2EIF A;  3H0G H;  3H15 A;  1EWI A;  1I3Q H;  4A3E G;  3H3V H;  2JK8 A;  4JI5 Q;  5M3F G;  1FJG L;  1MKH A;  4BBS G;  3RR5 A;  4A3F H;  5M5W H;  3VDY A;  1VQM A;  2NN6 I;  3T1Y L;  3DLL A;  1VQH A;  4UP9 A;  5IP7 H;  3CCQ A;  3NBH B;  1Z47 A;  1HNZ Q;  2UXC L;  5LMN L;  4LFA L;  4LF9 Q;  1N34 L;  5ELN A;  3UDF A;  5M3M G;  1J5E L;  5J3B A;  1C7Y A;  1VQ9 A;  4DV6 Q;  4IPG A;  4BY7 H;  3FHW A;  2N78 A;  3JAM i;  4X66 Q;  3J81 i;  4DR5 Q;  4BA2 I;  1E1O A;  1AE3 A;  2Q2H A;  4AYB G;  2NZO A;  3J80 c;  1N34 Q;  4A3G G;  2PI2 E;  4LW1 A;  4DUY L;  2WP8 J;  4HID A;  1TWF H;  3CD6 A;  3J7A 5;  1SLJ A;  3NEL A;  4JI2 L;  1IBL Q;  3CCU A;  1G51 A;  1KRT A;  1XNQ L;  1VQ4 A;  3F2C A;  1LUZ A;  1ASZ A;  4JOI C;  1A0I A;  2HHH L;  1JJG A;  1C9O A;  3HKZ G;  2UXD L;  2UXB Q;  3Q8D A;  4PMW A;  1HZC A;  4LFC L;  4JI7 L;  2K50 A;  3F1Z A;  1VCI A;  2RHQ B;  4IPD A;  5LMU Q;  3S16 H;  3GO5 A;  1CUK A;  4BXX H;  1L1O C;  1XMQ L;  4HJ5 A;  4GNX A;  4LUV A;  1UE5 A;  3PUY A;  4GOP B;  5M3F H;  4DUY Q;  2VQE L;  3T1H Q;  3KOJ A;  3UE0 A;  3E0E A;  4JI3 L;  4X62 L;  2KEN A;  1TWC H;  5GAE C;  4POG A;  1CKM A;  2UU9 Q;  2R7Z H;  3F8T A;  1RIP A;  2K14 A;  3W1G A;  4YY3 L;  3A5U A;  4A3K H;  3A74 A;  3AFQ A;  4LF7 L;  1IL2 A;  4A3C G;  3UE1 A;  4DR2 Q;  4R1J A;  1Q7Y C;  5IE8 A;  2OWO A;  1XPO A;  4JI3 Q;  4IPC A;  4IFD J;  2R7D A;  5GAD C;  2AHO B;  4P74 A;  1Y1W H;  3S1Q H;  3M7N A;  2I5M X;  4EX5 A;  1KAW A;  3FKI H;  1GKH A;  3HKS A;  3CAM A;  4ME3 A;  2VQE Q;  1NMG A;  1MIU A;  4HIO A;  3J80 i;  3T1H L;  2E5L Q;  4NXN Q;  4IJH A;  4OWT B;  1N36 L;  5FJ8 G;  3DM3 A;  2JA8 H;  3J81 c;  3AEV A;  1LTL A;  1E1T A;  2ES2 A;  3S14 H;  1UWV A;  1YIJ A;  2GN5 A;  3PF4 A;  1KD1 C;  4NXM Q;  3FP9 A;  4LF6 L;  4A76 A;  1X3E A;  3UDX A;  2KCM A;  2E5L L;  4LF8 L;  4A3C H;  4DUZ Q;  2ZTD A;  1KL9 A;  4LF5 Q;  2KHJ A;  2JA5 G;  4IPH A;  3U50 C;  1KIX A;  1EYG A;  1KXL A;  1KQS A;  1N9W A;  2AKW B;  3CF5 A;  4OXP A;  4BBS H;  1PH3 A;  3FKI G;  4YWL A;  4IOA A;  4DK6 C;  5C4X G;  1NMF A;  4A3D G;  3TS2 A;  5H1S E;  3M4O H;  2JA8 G;  4XTC S;  5C0X I;  4JBM A;  4L5R C;  1Q12 A;  5C0X J;  4GKJ L;  4BA1 I;  4NB3 A;  2LXK A;  1NY4 A;  1SE8 A;  4GN4 B;  4HJA A;  3M3Y H;  2VL6 A;  2ASB A;  4MNO A;  2L15 A;  3GD7 A;  4A3B G;  2QEX A;  1HR0 W;  3K8A A;  3KDF B;  3T1Y Q;  1XPU A;  2R92 G;  1SR3 A;  2LSS A;  1XNR Q;  2KBN A;  1PH6 A;  3HOY H;  4LUO A;  2JQO A;  4JI1 L;  4OO1 I;  1K83 H;  3KDF A;  2NVX H;  5IYB H;  3J81 j;  1XPR A;  4DNI A;  2BA0 A;  4APV A;  2WB1 E;  1Q8K A;  3S1N H;  3ER0 A;  1BBU A;  2YU9 H;  2ZM6 L;  4K0K L;  1VQC A;  2JA9 A;  1B8A A;  3H0G G;  3PIP A;  4A3B H;  1HJP A;  1WCM H;  2V1C C;  3JC6 6;  1HZB A;  5E7N A;  1EIF A;  5IT9 c;  1EIY B;  5M5Y H;  5GQO A;  2R92 H;  1PYB A;  2CWA A;  4DV3 Q;  3RZD H;  2CFM A;  1IBK L;  4A3F G;  1EQQ A;  4LF4 Q;  3GTO H;  4K0K Q;  1OXT A;  2YTV A;  1VQG A;  1D8L A;  3G71 A;  2OTL A;  2R93 G;  2C35 B;  4DR3 L;  1SMX A;  1KRS A;  1SN8 A;  5IYB G;  1T9H A;  1S40 A;  1A63 A;  1E3P A;  3GTG H;  3U4V A;  4QGU A;  3I55 A;  4BY7 G;  4YCU A;  4DK3 C;  1S3O A;  1VQN A;  1YHQ A;  1CSQ A;  1EUJ A;  2VY3 A;  1JJ2 A;  1HNW Q;  5M5X H;  5M3M H;  4QY7 A;  3HOX G;  1XMO L;  3GTL H;  4JI4 L;  2RCN A;  2NN6 G;  5IWA Q;  3I4O A;  2I0Q A;  3ERS X;  3W5O A;  1WOC A;  1UE1 A;  2NVY H;  4L5T A;  4XIG S;  1FJG Q;  4YWM A;  4A93 G;  2NVQ H;  2HQL A;  3HKZ E;  4PZ6 A;  2WAQ G;  3RLN A;  1M1K C;  3ICE A;  1HR0 Q;  3HOW G;  2N8N A;  2K4K A;  4MTN A;  2E2H H;  1P8L A;  2UUC L;  4LNQ A;  2PI2 A;  2Z6K A;  1Q81 C;  1LM0 A;  2Q2I A;  1I94 L;  3PF5 A;  1TWH H;  1OXV A;  4BY1 H;  3KFU A;  3I56 A;  4AYB E;  2AWO A;  1XTD A;  3TEH B;  2R7F A;  1K3R A;  3HOZ H;  2IX0 A;  5GAH C;  4O0A A;  2DUD A;  3AQQ A;  4TVA B;  3A5Z B;  1I94 Q;  3S1M H;  4HJ7 A;  4L5Q A;  2UUB L;  4FDB A;  2R7Z G;  1IBM Q;  4DR7 Q;  2Q2T A;  2OQ0 A;  4AQY L;  4B3S Q;  4GKK Q;  1JE5 A;  1HNW L;  1TWG H;  1N32 L;  1JB7 A;  3PCO B;  4P71 A;  1L2F A;  4LWC A;  4JI0 L;  5IWA L;  3W1B A;  2NZH A;  4LUZ A;  1PH9 A;  1U0L A;  2YTX A;  1VQ5 A;  3MEF A;  2JEB I;  1FVI A;  1VS0 A;  1YEZ A;  5EAY A;  3KJO A;  2EXD A;  3NEN A;  5IYC H;  2OCE A;  4P75 A;  3I4M H;  1N32 Q;  1YBY A;  2JA7 G;  5IYD H;  3PUV A;  4B3M L;  3G6E A;  4NXN L;  4A3M H;  5AJ3 L;  4QL5 A;  2RF4 A;  1PV4 A;  1RL2 A;  4DAY B;  1I50 H;  4OX9 L;  2XGT A;  2CWP A;  4DR3 Q;  1VQ6 A;  5JJI A;  4L5S A;  1IZ6 A;  1KHI A;  5FJ8 H;  1WJJ A;  3L2P A;  4GLX A;  4POF A;  1X3F A;  1YNX A;  3CQZ H;  4YHH L;  1NE3 A;  4O2D A;  3CCM A;  2VW9 A;  4B3M Q;  3GTK H;  1GM5 A;  3BZK A;  1ASY A;  1GVP A;  1Q46 A;  2BH8 A;  5IYD G;  3CME A;  1AE2 A;  1TXY A;  3CCR A;  4OX9 Q;  2OTJ A;  4X6A H;  1Y1V H;  3BJU A;  4X65 L;  3TQY A;  4PZ7 A;  1HR0 L;  2CCZ A;  2CQO A;  2K5N A;  4JBJ A;  1R9T H;  4A3I H;  1VQI A;  2VNU D;  1HZ9 A;  4H02 A;  2VQF L;  4GNX C;  1NJI C;  4RG1 A;  3GTQ H;  4DV4 Q;  1M90 C;  1B70 B;  2D0P A;  3L0O A;  4NPS A;  2JA6 H;  4JV5 Q;  4ALP A;  4JYA Q;  5C4J H;  4OWX B;  1Y1V G;  2R6G A;  3CXC A;  2VQF Q;  1Q1E A;  4WJ3 M;  2R93 H;  3AFP A;  4DR7 L;  3A0J A;  4JC0 A;  1X65 A;  3STB C;  3CCE A;  1VQJ A;  3CCJ A;  2JEA I;  1QVC A;  1K8G A;  2LXJ A;  2VUM G;  3PGZ A;  2PNH A;  1SFO H;  4YHH Q;  3KF8 B;  3HOY G;  1IBK Q;  3OW2 A;  4DR5 L;  5LMN Q;  1Q82 C;  1EQR A;  1QUQ B;  4HIK A;  1H95 A;  4BBR H;  1N33 L;  1Q86 C;  1PH2 A;  3HOW H;  3PO2 H;  1GO3 E;  3BU2 A;  1VQL A;  4KHP L;  1O7I A;  3D0F A;  2MFI A;  3E9H A;  3TS0 A;  3S15 H;  1E24 A;  2Y0S G;  4MZ9 A;  4DPG A;  1QVG A;  4LF6 Q;  3KLW A;  3M85 A;  3UDG A;  2JJQ A;  2JA7 H;  4DV0 Q;  3HFZ B;  4P73 A;  3I7F A;  4JI5 L;  4QJF A;  2ZJP A;  1UE7 A;  1XMO Q;  4A3D H;  3U4Z A;  4JI4 Q;  3RN5 A;  3TRZ A;  1FL0 A;  4DV0 L;  4B3S L;  4GKK L;  3I4N H;  2BA1 A;  4JBW A;  5GRO A;  4UY8 C;  5FLM G;  3GDE A;  1HH2 P;  2VZA A;  1BVS A;  1VQE A;  2F3I A;  4X66 L;  4DV5 Q;  1W2B A;  1EOV A;  1PH1 A;  2WAQ E;  2MQH A;  2N3S A;  4YY3 Q;  5C44 H;  3HOX H;  4LF7 Q;  4LFB Q;  3HOV H;  3ULL A;  2MO1 A;  2JA5 H;  1UEB A;  2A19 A;  2EQS A;  1VQ8 A;  4GS3 A;  3CC7 A;  2IY5 B;  4DR6 Q;  4J15 A;  1QUQ A;  3PUZ A;  1OXX K;  2UU9 L;  3BZC A;  2MNA A;  1WFQ A;  3M4P A;  5C4X H;  4OO1 G;  3I4M G;  3D31 A;  2VUM H;  2E8G A;  1P16 A;  4Y7N H;  1YJ9 A;  2XTI A;  4LF9 L;  5IP9 G;  4GLA C;  3KF6 A;  1VQP A;  3CCL A;  1PVO A;  4R4I A;  4JYA L;  4P72 A;  4KI0 A;  1VQD A;  1JT8 A;  3IRB A;  3PO3 H;  1K0R A;  5LMN W;  2YV5 A;  4JI0 Q;  2AWN A;  4R4O A;  1J6Q A;  3CPF A;  4LFC Q;  5LMU L;  3CCS A;  1VQK A;  1YJW A;  4TQU S;  3PUX A;  4DKA C;  1JMC A;  3UDI A;  3S1R H;  3AYH B;  1E22 A;  3OYY A;  5GAG C;  1QVF A;  4Y52 H;  1Q1B A;  2UUB Q;  4IFD I;  1IBM L;  1V9P A;  4JOI A;  1VQ7 A;  3G48 A;  1N33 Q;  1X56 A;  2WFW A;  1K8A C;  4JI8 L;  2IHE A;  2ID0 A;  2Z6K C;  3L7Z C;  4IJL A;  2ZTC A;  4C3H H;  1CKO A;  3U58 A;  3S2D H;  1SRU A;  4DR2 L;  2JA6 G;  1X54 A;  2QGQ A;  3M4Q A;  4KLK A;  5IYC G;  4DV1 L;  1C0A A;  4JI8 Q;  1BBW A;  1OXS C;  3TRE A;  3ULJ A;  1E7Z A;  1V1Q A;  2PQA B;  2D62 A;  4B3T Q;  2UUA L;  1SRO A;  3PSI A;  1IYJ B;  4DUZ L;  4LF5 L;  1I5F A;  1PFS A;  3CMA A;  4YWK A;  2PQA A;  3K81 C;  5DLQ E;  4A3L G;  4IFD G;  1AH9 A;  1DGS A;  4RMF A;  2KCT A;  1QZG A;  4NXM L;  4B3T L;  2ZJQ A;  4GNX B;  2RHS B;  2QA4 A; 
#chains in the Genus database with same CATH topology
 1LAB A;  1HNX L;  3ND8 A;  1PH4 A;  5CR3 A;  1I3Q B;  5CGK A;  4RFB A;  4K5V A;  4C3J G;  2XRQ D;  3ULP A;  4DV3 L;  1CHQ D;  4OWW B;  1DCZ A;  4A4I A;  1S5C D;  1LYL A;  1NBW A;  3D4W A;  4A3L H;  1G2T A;  4OL7 A;  3GTP H;  1Z9F A;  1K0S A;  1I6H B;  3TDQ A;  3OTO L;  3HP3 A;  4O1N A;  1MBY A;  3GTM B;  5FKA C;  1JWU D;  4NP5 A;  1A3U A;  1XMQ Q;  5JPM C;  1VMC A;  2KHS A;  3KBG A;  2B63 H;  5C3W A;  3OTO Q;  2XNA C;  3DMU A;  2HIV A;  3MEH A;  4K2L A;  4YCV A;  3KJP A;  5JVG 3;  1UE6 A;  1IBL L;  5JJL A;  4JI6 L;  1F9R A;  1WD1 A;  2CH4 A;  3NQI A;  3S17 H;  1VQA A;  2XSC A;  1QB5 D;  2L12 A;  2QCP X;  1STH A;  4B3R L;  1NTG A;  2PMZ B;  2RQX A;  3QO2 A;  5ELC A;  4DV7 Q;  4A3M G;  4R4Q A;  2KCN A;  3QB3 A;  4DF7 A;  4QIW E;  3G4S A;  4A3J H;  2K5H A;  5CYU A;  3MVV A;  2K1B A;  4QF4 A;  1L1O A;  2EYF A;  2E2I H;  4RHS A;  2WAC A;  4DV2 Q;  2Q8I B;  5C44 G;  4RGT A;  3RN2 A;  3S2H H;  4JI7 Q;  1OXU A;  5JEA G;  3S2H B;  1LTR D;  1A6X A;  3I4L A;  1A3V A;  4Y7N B;  2ICE C;  3HOU G;  2FXQ A;  1JWM D;  5K36 G;  5IT9 E;  4HJ9 A;  3LGJ A;  2OXP A;  1BO0 A;  1QCB D;  4A3J B;  5C44 B;  3HOX B;  2B2V C;  4DV5 L;  5AJ3 Q;  1PFN A;  2F3W A;  4UPA A;  5FO8 B;  1NNX A;  4X64 Q;  1BNZ A;  4KD4 A;  3S17 B;  1BCP F;  2EPB A;  2JP1 A;  4KHZ A;  3QOJ A;  1HZA A;  2G9H D;  4RH6 A;  3PQI A;  3RLO A;  3EBE A;  2CHB D;  5LL6 S;  5C0X G;  1V43 A;  2HHH Q;  1I4G A;  1V1O A;  2F4V L;  4JI2 Q;  3HOW B;  3TP6 A;  3GTM H;  1QG7 A;  1XYI A;  1CTM A;  1F2Y A;  2B63 G;  1I6H H;  3J7Z C;  3PUW A;  5IP9 H;  1A3T A;  4DAV A;  2R93 B;  3DM1 A;  4EQ5 A;  4RKL A;  2MP1 A;  2F4V Q;  2EIF A;  1WD0 A;  1HUM A;  3H15 A;  1I3Q H;  1BBX C;  2A6E C;  3RR5 A;  4A3I B;  2CVR A;  2FJ2 A;  3DWA A;  4UP9 A;  4KTA A;  1HNZ Q;  1N34 L;  5ELN A;  1J5E L;  1VDZ A;  1VQ9 A;  1I50 B;  3OIP A;  4KD3 A;  1I4R A;  4X66 Q;  1HQR D;  1E1O A;  2Q2H A;  4A3G G;  3CD6 A;  3J7A 5;  2E75 C;  1IBL Q;  1ASZ A;  4N9T A;  1C9O A;  2F0M A;  3HKZ G;  3MWY W;  4QB4 A;  2UXD L;  3ERQ A;  3WDN A;  4R8N A;  5LMU Q;  1XMQ L;  2K01 A;  2H4O A;  1LTI D;  3PUY A;  2F4I A;  5M3F H;  4DUY Q;  3T1H Q;  1S5D D;  3MXP A;  5I2X A;  2KEN A;  3ITP A;  2UU9 Q;  3HKZ B;  2K14 A;  2ZT9 C;  3W1G A;  3A5U A;  3KF8 A;  4LF7 L;  3A74 A;  5C4X B;  4DR2 Q;  5IGD A;  2OWO A;  4IFD J;  2ZXR A;  1B3A A;  2DJG C;  5GAD C;  3I70 A;  1D5Z C;  3S1Q H;  3M7N A;  3VYR A;  2BDN A;  3BVG A;  3FKI H;  3SK6 A;  3T1H L;  3P75 A;  1MIU A;  4I65 A;  2A68 C;  2KEE A;  3SR1 A;  1PMR A;  4OWT B;  3SK8 A;  5M3M B;  3DM3 A;  1N36 L;  2JA8 H;  3S14 H;  4NXM Q;  1Y8N B;  3FP9 A;  5KIX A;  2FFK B;  4A76 A;  1X3E A;  3UDX A;  4A3C H;  1YNJ D;  2E5L L;  4LF8 L;  1LT3 D;  2ZTD A;  1XXG A;  2KHJ A;  3U50 C;  1KQS A;  2JA7 B;  2K5D A;  3K0Y A;  4LMQ D;  3HEJ A;  3GTO B;  1PH3 A;  4IOA A;  1NMF A;  3SXH A;  2NBF A;  2JA8 G;  4L5R C;  2M9V A;  3HRZ C;  1Q12 A;  4PMB A;  1NY4 A;  1AZQ A;  2VL6 A;  1HA5 A;  4MNO A;  3GD7 A;  4N8X 1;  2QEX A;  1K83 B;  3D6W A;  3K8A A;  1SR3 A;  2LSS A;  1XNR Q;  3HOY H;  4EQN A;  3HOY B;  5CV7 A;  5C4J B;  1JOK A;  1K83 H;  1GXD C;  2JXM B;  4FO2 A;  4DNI A;  4APV A;  2B2Y C;  1O7Z A;  1S5E D;  1VQC A;  5HUR A;  2V1C C;  5T1G A;  1HZB A;  1EIY B;  1EIG A;  4LF4 Q;  3GTO H;  1EQQ A;  4K0K Q;  3CQZ B;  2YTV A;  2OTL A;  3EQL C;  3QJY A;  4X3K A;  2C35 B;  4HTH A;  3G71 A;  5IYB G;  1SN8 A;  1C48 A;  1S40 A;  5F2D A;  5BN5 A;  1O78 A;  1PRT D;  5J39 A;  1SJE D;  2F0T A;  2Z6B A;  2VY3 A;  1EUJ A;  3BYT B;  1HNW Q;  5M3M H;  2JA8 B;  3HOX G;  5IWA Q;  2QIL A;  2BE5 D;  4XIG S;  2E76 C;  3S1Q B;  4YWM A;  2NVQ H;  3ICE A;  3RLN A;  1CFM A;  4HCS A;  3UI2 A;  2K4K A;  2SDF A;  4MTN A;  4CJ0 B;  2PI2 A;  2Z6K A;  3S1M B;  2B2T A;  4J8Q A;  3PF5 A;  4BY1 H;  3KFU A;  5EKK A;  3I72 A;  4AYB E;  2AWO A;  3HOZ B;  3G7L A;  2O5I C;  1E2Z A;  3MA2 B;  1B50 A;  5GAH C;  2HUG A;  2PZT A;  1IBM Q;  2Q2T A;  4KN4 C;  2DNC A;  4GKK Q;  4HCE A;  1HNW L;  2LFN A;  4R9W A;  1L2F A;  4LWC A;  5IWA L;  1EY7 A;  3W1B A;  4LUZ A;  1PH9 A;  2YTX A;  4IUN A;  1YEZ A;  3J7Y W;  5IYC H;  2OCE A;  4Z9C B;  2A73 B;  1WTV A;  3EVQ A;  2B2U C;  3PUV A;  3E5S A;  4FYD A;  3BYY B;  1PV4 A;  1C4Q A;  1RL2 A;  4OX9 L;  1I50 H;  2F0G A;  1GOZ A;  1TS2 A;  4L5S A;  3OWE B;  4GLX A;  1BF4 A;  1X3F A;  4YHH L;  4O2D A;  1DOK A;  3GTK H;  2M2L A;  3U9O A;  3CCR A;  1AE2 A;  2OT2 A;  2EVB A;  4X6A H;  2KUM A;  4X65 L;  2CQO A;  2K5N A;  2SNS A;  4A3I H;  1VQI A;  2VNU D;  4H02 A;  2E2D C;  2O2L D;  3K5N A;  1NAP A;  3LWE A;  3I91 A;  4JV5 Q;  4OWX B;  2VQF Q;  2TMP A;  4ZUJ A;  2R93 H;  4DR7 L;  2EY1 A;  1EOT A;  5C4Z A;  5HGT A;  3J81 L;  3CCE A;  2H1E A;  3CCJ A;  3OWF A;  4DAY A;  1L0X B;  2AQ2 B;  4DR5 L;  5LMN Q;  4C1N I;  1PH2 A;  3HOW H;  3BU2 A;  3TZU A;  5JJZ A;  1VQL A;  2F0U A;  4Q5V A;  1LV9 A;  1SMY C;  2A74 C;  2JJQ A;  3VR2 A;  1MSH A;  3SE0 A;  1WTX A;  2HD3 A;  1SBB B;  2A5H A;  1TS3 A;  1FL0 A;  4B3S L;  2EZV A;  5EPL A;  4RCN A;  2BA1 A;  1B2T A;  3KUP A;  1YNJ C;  1HH2 P;  1T5X D;  4X66 L;  2F3I A;  5BN4 A;  3HOX H;  2N3S A;  5C44 H;  4LF7 Q;  4LFB Q;  1ENA A;  3HOV H;  3ULL A;  2MO1 A;  1UEB A;  1F2M A;  5JEA H;  3J81 E;  2F0J A;  2RSN A;  2VUM H;  1B44 D;  4Y7N H;  2XTI A;  1FNV A;  3JAM E;  5IP9 G;  3KF6 A;  1VQP A;  4TSS A;  2F0K A;  1VQD A;  2QDL A;  3PO3 H;  5DM6 3;  2E2I B;  2JYO A;  5LMU L;  1TS5 A;  1VQK A;  4ID6 A;  1LTB D;  4TQU S;  4XQN A;  3UDI A;  5FOB B;  3OYY A;  5KNC A;  1QVF A;  2HDL A;  5GAG C;  1CT1 D;  5JAV A;  3G48 A;  3Q23 A;  3BDL A;  4JI8 L;  2ID0 A;  1EYD A;  3BG3 A;  1FD7 D;  1LT5 D;  1GUG A;  2CW0 D;  2QGQ A;  1PRT B;  3TRE A;  2B2Y A;  4KY6 A;  3FMC A;  4Q0F A;  4RCO A;  2B63 B;  1SRO A;  1IYJ B;  1I5F A;  1A2T A;  2C9O A;  1K28 A;  3KLS X;  2SEB D;  4A3L G;  1DGS A;  5M5W B;  4RMF A;  1QZG A;  4B3T L;  3K6O A;  4GNX B;  1S5B D;  3S24 A;  4GOP A;  4IQZ A;  3GTP B;  4WJ4 A;  3VA7 A;  3NSW A;  4UP8 A;  1UAP A;  4DR1 Q;  1CZW A;  4LF4 L;  2VXW A;  4K8J A;  1J5E Q;  4QQB X;  3NWS A;  4IN3 A;  1GD7 A;  4ZK9 B;  4LFA Q;  1WYD A;  3VR5 A;  2HIX A;  1K9M C;  3K7A H;  4JI1 Q;  2IT1 A;  3HS0 C;  3HOZ G;  4A3I G;  1PHJ A;  1AFP A;  3LX0 A;  1YNN D;  3QOL A;  1PH8 A;  3R8B A;  2L5T A;  1CZG A;  1XNQ Q;  4DV7 L;  4C3H B;  1VQF A;  1K73 C;  5ELO A;  4QCL A;  5C3E B;  4C2M H;  4DV6 L;  4GKJ Q;  2PQE A;  4JI6 Q;  1GJX A;  3CCV A;  3PIO A;  2IHF A;  1PYS B;  2AMC B;  3C1E A;  1CKN A;  1V1P A;  5KGU A;  1WTW A;  3V2T A;  4DFA A;  1CKN B;  2PYK A;  3CPW A;  4LF8 Q;  3CC2 A;  4DV4 L;  2D0O A;  5C3E G;  1STB A;  3QIA A;  5DM7 3;  3P20 A;  3B6Y A;  1QNU A;  2ENB A;  4DV2 L;  1GUN A;  1SND A;  3Q0A A;  3EIV A;  3X3N A;  3NTK A;  1EU3 A;  4I7Z C;  1ILP A;  2ATW A;  2K75 A;  5K5P A;  1JQY D;  4X64 L;  5EBC A;  1BQQ T;  2F0W A;  1F2L A;  4KKT A;  1PH7 A;  2Q2U A;  4DR6 L;  3OSO A;  5A2Q E;  4CKB A;  4K8I A;  2IX1 A;  1EY8 A;  1TY2 A;  2KHI A;  3HOV G;  3TME A;  4P2C B;  2PMZ E;  1Q90 A;  3OMG A;  1QNK A;  3U9S A;  3IKJ A;  4ZLT F;  3S9W A;  5CBA E;  1VQO A;  1X9N A;  1DOL A;  1PTO F;  4A3J G;  2DGY A;  4HJ8 A;  4GN3 B;  4NMZ A;  5HGQ A;  2DNE A;  2A6E D;  2B29 A;  3EA6 A;  3F2D A;  1D7Q A;  3KLR A;  1HA6 A;  1PYW D;  3SK5 A;  3STB D;  5IOC A;  4AQY Q;  1Z6H A;  1U5K A;  1VF7 A;  1MD2 D;  1W3S A;  3K0X A;  1BKB A;  3GTJ H;  1OTC A;  3MAQ A;  5FLM H;  3TZD A;  2UUC Q;  1WVL A;  3I2Z A;  5IP7 G;  1PXU A;  1YZ6 A;  1HNX Q;  4BBR G;  5FLX c;  2NB0 A;  2ZM6 Q;  4BXX G;  3JAM L;  5M3F G;  2HCI A;  1EY6 A;  1R9T B;  3MFY A;  3VDY A;  3DLL A;  5ELE A;  3CCQ A;  1V8Q A;  1CQV A;  1K8O A;  2QW7 A;  4CJ1 B;  4LFA L;  4LF9 Q;  2AQ1 B;  2JN4 A;  1DM0 B;  2IPK D;  3D3R A;  2PNR C;  4LAA A;  5E3F A;  4RWS C;  3N52 A;  4ZQ3 A;  2F0O A;  1DZ1 A;  4DUY L;  3NEL A;  1KRT A;  1XNQ L;  3F2C A;  1CI3 M;  1JJG A;  3Q8D A;  1RKN A;  4PMW A;  4KKS A;  1H9M A;  1SEB D;  3S16 H;  2A68 D;  1ENC A;  1EWH A;  1CUK A;  4DK0 A;  1L1O C;  4DGZ A;  4DA2 A;  1JB3 A;  4GOP B;  5CV6 A;  4K6L A;  2KCC A;  1HXY D;  5E4W C;  2LKV A;  4JI3 L;  1TWC H;  2IL8 A;  3R2I A;  2R7Z H;  1TWH B;  4A3K H;  1HRJ A;  3SEB A;  1CA5 A;  2FMC A;  4R1J A;  2PPB C;  4JI3 Q;  2R7D A;  1Y1W H;  2I5M X;  4EX5 A;  1KAW A;  3HKS A;  2VQE Q;  4NXN Q;  1X3P A;  1NMG A;  2MJ8 A;  4OHJ A;  3J80 i;  3VR4 A;  2E74 C;  2FHT A;  4IJH A;  2F0E A;  2PW5 A;  3I4N B;  1STE A;  3H09 A;  2ES2 A;  3C2P A;  4FF2 A;  3ND9 A;  4WJW A;  2L1B A;  2KCM A;  4DUZ Q;  1RCV D;  1KL9 A;  4LF5 Q;  2EY2 A;  5CV8 A;  1KXL A;  1FGB D;  3IFD A;  1HHV A;  2WKD A;  2AKW B;  2XIW A;  3J7A V;  3K5L A;  3S15 B;  1DOM A;  1TR5 A;  4A3D G;  1NR2 A;  3PO2 B;  5C0X I;  5C0X J;  4NB3 A;  4C3I G;  4CDE C;  3R2T A;  4GN4 B;  1SFO B;  4KV6 A;  2ASB A;  5BN3 A;  1S5F D;  3PIO 3;  1XPU A;  4DK1 A;  1E0B A;  2KBN A;  1PH6 A;  4LUO A;  2L0C A;  3OIQ A;  4JI1 L;  4YIJ A;  1D6E C;  2A6H C;  4GZY C;  5IYB H;  2MPM A;  2WB1 E;  3M3Y B;  3ER0 A;  1BBU A;  4G7H C;  1I4X A;  3H0G G;  3L9A X;  1TT2 A;  3PIP A;  3IAY A;  3L3O C;  4ZUI A;  1B53 A;  3SHL A;  2QEJ C;  2D5D A;  3A56 A;  5IT9 c;  5M5Y H;  5GQO A;  2R92 H;  2CW0 C;  4DV3 Q;  2Z8L A;  1IBK L;  2CFM A;  4DR6 Q;  4BBS B;  1OXT A;  4AYB B;  1CK1 A;  3QWN A;  1RD9 D;  4DR3 L;  1HTL D;  1D1I A;  2A6H D;  1E3P A;  3GTG H;  1EZ8 A;  2Q8T A;  5C0X H;  4DK3 C;  1S3O A;  1YHQ A;  1CSQ A;  2BE5 C;  5M5X H;  4KY5 A;  1SYB A;  1EQT A;  4QY7 A;  3BVM A;  3W2D A;  1XMO L;  3GTL H;  1JR0 D;  3NE5 B;  2NN6 G;  3I4O A;  2I0Q A;  1WOC A;  1IKM A;  4A93 G;  4PZ6 A;  1HR0 Q;  1SNC A;  2UUC L;  2Q2I A;  4DU9 A;  5CBE E;  3I56 A;  4OEL B;  4N9P A;  3TEH B;  3NBI A;  2F1M A;  3K59 A;  1K3R A;  2DUD A;  4TVA B;  2K5W A;  3A5Z B;  2EYM A;  1KNA A;  5K36 H;  4HJ7 A;  4L5Q A;  2KOL A;  2UUB L;  1UUP A;  1U4R A;  4MHE A;  4AQY L;  2SNM A;  4B3S Q;  1JE5 A;  1TVX A;  1TWG H;  4B9X A;  1EEF D;  2NVY B;  3GQB A;  1WTQ A;  4DN4 M;  3PIP 3;  1WTO A;  1VQ5 A;  2J7Z A;  3H6M A;  3NEN A;  2DN8 A;  3I4M H;  3G6E A;  2EYL A;  4WOR A;  4DXG A;  1VQ6 A;  1WJJ A;  3CCM A;  5C5L A;  3RZD B;  1GM5 A;  1ASY A;  2R93 G;  1GVP A;  3MXN A;  3G6J B;  4OX9 Q;  3BJU A;  4A3B B;  2I07 B;  1SXT A;  2YU9 B;  1HZ9 A;  2VQF L;  4XQQ A;  4L8J A;  1Q8I A;  5ISR A;  1B70 B;  2JA6 H;  3L0O A;  4NPS A;  4JYA Q;  1QE6 A;  4L63 B;  2F3V A;  5DAU A;  3CXC A;  1KAA A;  3AFP A;  5E1F A;  2RSO A;  2VUM G;  1K8G A;  2LXJ A;  4RGM A;  1PTO B;  3PGZ A;  2F0P A;  3OMC A;  2R61 A;  3KF8 B;  4YHH Q;  3V96 A;  3BS1 A;  1SMY D;  1N33 L;  5IOD A;  3A54 A;  1BXT A;  1A2U A;  2OEO A;  3D0F A;  1Y69 U;  3RZO B;  3D4D A;  1FYC A;  2IJ0 A;  3TS0 A;  2Y0S G;  2NVT B;  4DPG A;  3M85 A;  2VB2 X;  4DV0 Q;  1EWC A;  1AN8 A;  4JI5 L;  4QJF A;  5FK9 C;  2ZJP A;  3RN5 A;  2F0Q A;  4FNF A;  4DV0 L;  4GKK L;  3F2U A;  4JBW A;  2KVM A;  4K5X A;  4UY8 C;  5FLM G;  3K5M A;  2VZA A;  1VQE A;  4A3E B;  1W2B A;  3FPP A;  1PH1 A;  2EJG C;  1LTS D;  2MQH A;  4YY3 Q;  2FIN B;  2JA5 H;  1JOO A;  2EQS A;  2FMM A;  4XYO A;  3FEW X;  1QUQ A;  3PUZ A;  4OGQ C;  1GUS A;  3NTI A;  4V0B A;  4OO1 G;  3I4M G;  1PRT F;  5EPJ A;  4J6H A;  3DWP A;  1VMP A;  2EY6 A;  4CGY B;  1SNO A;  4XDX A;  2EJM A;  2OF1 A;  4KK7 A;  4RHR A;  3E3X A;  1J6Q A;  3CPF A;  3IL8 A;  5COR A;  4Y52 H;  3S1R H;  3AYH B;  4IFD I;  1VQ7 A;  1PZJ D;  3EFX D;  1KNE A;  3I3C A;  1H9R A;  1N33 Q;  4IFD H;  1TWF B;  4QIW B;  2L9H A;  1KAB A;  4IJL A;  2ZTC A;  3U58 A;  3S2D H;  1U4L A;  4DR2 L;  2JA6 G;  1X54 A;  3DHQ A;  1STA A;  3CHB D;  4DV1 L;  4JI8 Q;  1BBW A;  1OXS C;  3DWQ A;  5NUC A;  3ULJ A;  1ZYR C;  2K05 A;  1E2W A;  2PQA B;  2D62 A;  4B3T Q;  2UUA L;  3PSI A;  1PFS A;  4G4K A;  2K5Q A;  1LLR D;  2PQA A;  3K81 C;  5DLQ E;  4NXM L;  1WTR A;  3H91 A;  4A3F B;  2VB3 X;  4BBR H;  3C1F A;  2QA4 A;  3E9I A;  1EY4 A;  1GHJ A;  1Y1W G;  2WKC A;  1RTN A;  3AU7 A;  1ENF A;  1YHB A;  1GUW A;  3H0G B;  4KHP Q;  4FXK C;  4A3G H;  5ELF A;  4WRD A;  3AB9 A;  4FF3 A;  2Y0S E;  1MJC A;  1MI2 A;  2PZW A;  1ESF A;  5BR8 Q;  2EYJ A;  1JCK B;  4LFB L;  1Y14 B;  2UXC Q;  2ZJR A;  1FGU A;  2I5H A;  4JV5 L;  4RGO S;  1JWS D;  1PLF A;  4DNT B;  2L11 A;  1UEA B;  1L0W A;  4C3I B;  1UNS A;  1DD2 A;  5DEH A;  2UXD Q;  4NKL A;  4IUP A;  1QZH A;  2HT1 A;  4DV1 Q;  4A93 B;  4OO1 H;  2N49 A;  2CKZ B;  2NZ1 D;  2UUA Q;  1EIH A;  4C3J B;  1Q3L A;  1B9N A;  4HMJ A;  2I5L X;  2EYP A;  1A8V A;  4R4T A;  4AH6 A;  2NN6 H;  1IXR A;  5FO7 B;  2GVB A;  4KY7 A;  2A1A A;  1TWA H;  3KYH C;  4QUF A;  4OON A;  1YVC A;  3BDO A;  1N8R C;  2AQ3 B;  4DR4 L;  3TP7 A;  1G6P A;  4JG2 A;  2F0F A;  1SYG A;  1N36 Q;  1SYF A;  1YJN A;  2C5C A;  2VS1 A;  5EKL A;  2E2J H;  1YI2 A;  4IUV A;  1BCP C;  2WAQ B;  4UP7 A;  5KYL A;  4TKO B;  4HIM A;  1TWA B;  5D65 A;  3LWU A;  1CQF A;  1X6O A;  1HQM C;  3F2B A;  3K80 C;  2MO0 A;  2F0H A;  4ZKC B;  2EE1 A;  2K28 A;  3RNU A;  2B2W A;  5HY6 A;  4C3J H;  1H9J A;  2DY8 A;  2ZXO A;  4GOP C;  1HNZ L;  2V4D A;  4A3D B;  2Z0S A;  5JJK A;  3NPP A;  1QJO A;  4A93 H;  3PO2 G;  3CC4 A;  1QWY A;  5IY0 A;  3I4N G;  1I4H A;  3PV0 A;  3A55 A;  3JAM c;  1IYU A;  2HDM A;  4C3I H;  3NEM A;  2H5X A;  2P5Z X;  1XNR L;  2B3G A;  1KLG D;  2GVA A;  1SYD A;  2OQK A;  2RKS A;  1YHA A;  5T1I A;  2KJX A;  1XJV A;  4QUC A;  3A8J E;  1EY5 A;  4A75 A;  1ILQ A;  1JE4 A;  2F0V A;  3N6R A;  1EFW A;  1LT6 D;  1F2Z A;  1CSP A;  3PO3 G;  4A3G B;  1X32 A;  3HOU H;  2PZU A;  3H0G H;  1EWI A;  5ELB A;  4A3E G;  2RDH A;  4JI5 Q;  3GTQ B;  4B9W A;  1MKH A;  2L55 A;  3O13 A;  1STN A;  4A3F H;  5D3I B;  2EYO A;  2QF7 A;  1VQM A;  1TY0 A;  2NN6 I;  1J8I A;  1Y1V B;  3T1Y L;  5IP7 H;  2EY5 A;  3NBH B;  1Z47 A;  2QDB A;  5A2Q L;  4FF1 A;  4WFN 3;  5G3L F;  4G57 A;  2X6L A;  5J3B A;  2LS0 1;  1B1Z A;  4IPG A;  4BY7 H;  2N78 A;  3JAM i;  1CA6 A;  2B2U A;  3J81 i;  4A3M B;  3S2D B;  1ZYR D;  3D4R A;  1AE3 A;  4DNR B;  2PI2 E;  3OPO A;  4HID A;  1TWF H;  4JI2 L;  2Z4H A;  4XT3 B;  2MUY A;  1D5X C;  3CCU A;  1VQ4 A;  4ULL A;  2ZXP A;  4JOI C;  1A0I A;  2HHH L;  3S1R B;  1XWE A;  1HZC A;  2K6A A;  4JI7 L;  2K50 A;  4IPD A;  2RHQ B;  4I7A A;  1SJH D;  4BXX H;  3RUZ A;  4HJ5 A;  4XYQ A;  4GNX A;  4LUV A;  1UE5 A;  1LAC A;  2SOB A;  3UE0 A;  3E6Z X;  1T5E A;  5EGT A;  1RIP A;  1II3 A;  3AFQ A;  1IL2 A;  2JSO A;  1TQO A;  3UE1 A;  2E2H B;  1JOQ A;  5ELD A;  5IE8 A;  2JA5 B;  2AHO B;  4P74 A;  3CU7 A;  1R4Q B;  4ME3 A;  2EOT A;  3CAM A;  4HIO A;  2E5L Q;  4RA8 A;  5FJ8 G;  1E2V A;  3H94 A;  3J81 c;  2XVS A;  1UWV A;  4LF6 L;  5IGC A;  1H9S A;  4F8M A;  2MHV A;  3FPU B;  2JA5 G;  4IPH A;  1WTH A;  4X3S A;  5DNF A;  4ZYS A;  4CDC C;  4DXF A;  3DEP A;  4OXP A;  3FKI G;  2J4X A;  5C4X G;  1I4Q A;  3TS2 A;  1WCM B;  5H1S E;  3M4O H;  4XTC S;  2RDF A;  4GKJ L;  1X3Q A;  2LXK A;  3S1N B;  3T13 A;  3VYS A;  2L15 A;  1ZEQ X;  2NVX B;  3T53 B;  1V1P B;  2D9U A;  1HR0 W;  3KDF B;  3T1Y Q;  2WII B;  4OO1 I;  2JA6 B;  2NVX H;  1XPR A;  3J81 j;  4G7O C;  4N8F A;  1YNN C;  1FNW A;  2GA4 B;  1K8M A;  1RDP D;  3S1N H;  2YU9 H;  2JA9 A;  4QMG A;  3M4O B;  4A3B H;  1WCM H;  3JC6 6;  2NTS A;  4JK1 C;  5E7N A;  1EIF A;  1IL8 A;  3RZD H;  3FVQ A;  4B08 A;  4A3F G;  5KEE A;  1D8L A;  2F0S A;  5CV9 A;  1A63 A;  2B8G A;  2F03 A;  3U4V A;  1B9M A;  4CKC A;  4QGU A;  5I9O A;  4BY7 G;  4YCU A;  2XRS D;  1VQN A;  1JJ2 A;  1EY9 A;  5JPN C;  3KK7 A;  3W3A A;  2N55 A;  4JI4 L;  3C46 A;  1HUN A;  3ERS X;  2NVY H;  1HFG A;  1TWG B;  2HQL A;  1M1K C;  2WAQ G;  3HOW G;  2E2H H;  4LNQ A;  1DXM A;  1I94 L;  3C3L A;  1XTD A;  1MSG A;  3TSS A;  3CRK C;  2R7F A;  3HGB A;  4O0A A;  1L0Y B;  1I94 Q;  1FNU A;  5D3D A;  4E6I A;  2OQ0 A;  1LT4 D;  1PDQ A;  1JB7 A;  3PCO B;  2AUJ D;  4P71 A;  4U68 A;  1FVI A;  1VS0 A;  3KJO A;  2EXD A;  1SE2 A;  4P75 A;  3V05 A;  4L6T B;  1N32 Q;  3OW7 A;  4MN3 A;  4B3M L;  3NBH A;  4NXN L;  4A3M H;  3A8I E;  5AJ3 L;  4QL5 A;  2RF4 A;  4BY7 B;  1GUT A;  4DAY B;  2CWP A;  3Q22 A;  5JJI A;  3L2P A;  2Z4I A;  4PQX A;  3DUZ A;  1NE3 A;  2VW9 A;  3BZK A;  5IYD G;  1TXY A;  4K5W A;  1Y1V H;  1NSN S;  1ONL A;  3GP7 A;  3TQY A;  4PZ7 A;  2CCZ A;  2EJF C;  4G7Z C;  3VR6 A;  1NJI C;  4K14 A;  5E4X A;  2F0I A;  3GTQ H;  2G5D A;  1M90 C;  1H9K A;  3I90 A;  3HG9 A;  1PTO D;  1U9R A;  3HOU B;  3NWT A;  1BUV T;  2EXZ A;  3AMU A;  1Q1E A;  1VF5 C;  2R3Z A;  3A0J A;  1ZXT A;  1X65 A;  4IAL A;  4ZCK A;  1EY0 A;  1QVC A;  1SFO H;  2PNH A;  1ROD A;  1EQR A;  1QUQ B;  4HIK A;  1NCV A;  3A7A B;  3PO2 H;  1GO3 E;  4KHP L;  1O7I A;  1O7L A;  2B2T C;  3E9H A;  3Q24 A;  3S15 H;  2BCO A;  1QOH A;  4LF6 Q;  1QVG A;  4P73 A;  4R8I A;  3A8K E;  1UE7 A;  1XMO Q;  4RAU C;  4A3D H;  4UHV A;  1SSO A;  3U4Z A;  5KND A;  3WOF A;  2X6G A;  3FDT A;  4U67 3;  1BOS A;  5J22 A;  3I4N H;  1G8Z D;  3GDE A;  2CH4 W;  1SYC A;  4H44 C;  3R3O A;  1EOV A;  2WAQ E;  4UDU C;  2HQE A;  4JVZ A;  4HSV A;  1F9S A;  4KHV A;  2A19 A;  2A69 C;  3Q6S A;  2BDO A;  2IY5 B;  1FR3 A;  4J15 A;  2EYH A;  2UU9 L;  1OXX K;  3BZC A;  2AUK A;  2E2J B;  3NTH A;  2MNA A;  1WFQ A;  4CJ2 C;  1HPC A;  3IFT A;  2R7Z B;  2E8G A;  1TWC B;  3ZYY X;  4GLA C;  1PVO A;  2EDG A;  4P72 A;  4KI0 A;  1EEI D;  3IRB A;  5KRU A;  2YV5 A;  3P1H A;  4HR7 B;  2Z9H A;  4JI0 Q;  2J0T D;  4R4O A;  1PFM A;  1D1K A;  3CCS A;  1YJW A;  4DKA C;  3DEO A;  4OEM B;  1Q1B A;  1LTT D;  1MHW C;  4V19 0;  1IBM L;  2NTT A;  2NYZ D;  2O5J C;  2WFW A;  3BVZ A;  2D2C C;  2Z6K C;  1F9Q A;  5IGB A;  2TSS A;  1CKO A;  1PTO C;  4FVM A;  4BWG B;  3M4Q A;  4KLK A;  1M4V A;  5IYC G;  4IUT A;  1E7Z A;  1PZI D;  4RGN A;  4DUZ L;  4LF5 L;  3CMA A;  1K3B C;  1LTG D;  3H3V C;  4IFD G;  1EYC A;  1J9O A;  4M1U B;  5CV5 A;  4TRD A;  1CM9 A;  2UXB L;  4R4C A;  5JEA J;  3WWV A;  4JBK A;  4X65 Q;  1JIC A;  3MZ5 A;  1S72 A;  3M7G A;  3K58 A;  2B2V A;  4O42 A;  3MXN B;  2ALY B;  3GV6 A;  5G3L D;  1WI5 A;  4C56 C;  5I2Y A;  1Z7T A;  4JPB W;  1YIT A;  2XWB B;  3GTJ B;  2RDG A;  4H13 C;  4BBR B;  1ET6 A;  2JE6 I;  4HN7 A;  1EU4 A;  4YCW A;  4KKU A;  2WB1 G;  1EFI D;  1WCM G;  2IWH A;  2ZTE A;  4PZ8 A;  3EN2 A;  3MTS A;  1VQB A;  4DAM A;  3VYU A;  4PG3 A;  4MTK A;  2K52 A;  3HZX A;  4HAE A;  4IUR A;  2YYZ A;  2NUC A;  1B4O A;  3SGI A;  1NUC A;  4XXE A;  5FLX E;  3H3V I;  4FF4 A;  5C4H A;  4FP5 D;  4DR1 L;  1PA6 A;  4GLV B;  1DJR D;  1G2S A;  4ILW A;  5LL6 X;  4FXG C;  3RLF A;  4AIM A;  3OOC A;  4JCV E;  2BH2 A;  3MHB A;  4GN5 A;  5EJW A;  4IUQ A;  1KC8 C;  5I6W A;  4EQP A;  1TKW B;  1SNM A;  4ZAI A;  3LNN A;  1PH5 A;  5AFW A;  2XN9 C;  5EPK A;  4DR4 Q;  5IT9 L;  1JJC B;  2K5V A;  3CW2 C;  3K7U C;  1A62 A;  2X69 A;  2YTY A;  2F52 A;  1MGS A;  2K7V A;  4CKE A;  3TBI B;  1F77 A;  3E0J A;  4B3R Q;  3BDC A;  4IOC A;  4A3E H;  4C2M B;  5C3E H;  4X62 Q;  3KF6 B;  1RHP A;  2XWJ B;  3KBX A;  3ZJY C;  1RTO A;  1M8A A;  2IW3 A;  4XT1 B;  3K5O A;  1I6V C;  2I46 A;  1BDO A;  3M4Y A;  4A3K G;  1L1O B;  2A8V A;  1I4P A;  2K04 A;  1B7Y B;  4CBV A;  3K57 A;  1ET9 A;  3NUC A;  2NVT H;  3K7A B;  4BY1 G;  3RZO H;  3CP0 A;  1RJT A;  5JVH 3;  1X3G A;  3WOE A;  1MJE A;  4IZ8 A;  1HTP A;  1G6Z A;  1G29 1;  2A69 D;  1X55 A;  4CDD C;  3NP8 A;  4K2K A;  5BR8 L;  1PTO H;  1NR4 A;  1EQV A;  3M9B A;  1LTA D;  4IO9 A;  3T51 B;  2RVL A;  1STG A;  1PFB A;  1JOR A;  3H3V H;  2JK8 A;  5KYI A;  2F0D A;  3T56 B;  1FJG L;  4BBS G;  1GUO A;  3VR3 A;  4KJN A;  5M5W H;  1TII D;  2L4N A;  3SVM A;  1AZP A;  4ME5 A;  4ABN A;  1VQH A;  2B2W C;  4HSP A;  2UXC L;  4C3H G;  5LMN L;  1HFN A;  4S3S A;  5EKI A;  4UAI A;  3UDF A;  5M3M G;  3MXG A;  1C7Y A;  3TN2 A;  4DV6 Q;  1G91 A;  3FHW A;  4CDF C;  1ICW A;  4DR5 Q;  5A35 A;  4BA2 I;  1KDA A;  1QIL A;  4AYB G;  2NZO A;  3J80 c;  1N34 Q;  1C0A A;  4LW1 A;  3SK4 A;  3I4M B;  2WP8 J;  1SLJ A;  3NHH A;  1G51 A;  2HCC A;  2Z1C A;  1LUZ A;  2UXB Q;  3NXW A;  4LFC L;  5FO9 B;  3F1Z A;  1VCI A;  3GO5 A;  4CHT B;  3J80 L;  1IW7 D;  1U4M A;  3D6C A;  1SE3 A;  3PO3 B;  5TSS A;  2VQE L;  3KOJ A;  3VYT A;  3E0E A;  3NK9 A;  3TP8 A;  2LY7 A;  4PNY A;  4X62 L;  5GAE C;  4POG A;  1CKM A;  1R4P B;  3I8Z A;  2VUM B;  3F8T A;  4YY3 L;  3KLS A;  2WIN B;  4A3C G;  1SNP A;  3X3M A;  3VA5 A;  4BS9 A;  1Q7Y C;  1XPO A;  4IPC A;  3HOV B;  4HMI A;  2Y0S B;  1IW7 C;  1GKH A;  4PV1 C;  1SDF A;  3GTL B;  5IGG A;  5M5X B;  3AEV A;  1LTL A;  3D8G A;  1E1T A;  1O80 A;  1HCZ A;  1YIJ A;  2GN5 A;  3PF4 A;  1KD1 C;  3RD4 A;  3GTG B;  1EZ6 A;  5IGE A;  2G9D A;  5C3X A;  1SAP A;  1XTC D;  3MC0 B;  1KIX A;  1EYG A;  1N9W A;  4ZRZ A;  3T16 A;  3J80 E;  3CF5 A;  4X3U A;  4BBS H;  4DAP A;  4YWL A;  2R92 B;  5M5Y B;  4DK6 C;  1AW7 A;  1D2B A;  2WB1 B;  3URY A;  1CHP D;  4JBM A;  1S4Z A;  4BA1 I;  5IIF A;  3P7J A;  1SE8 A;  4HJA A;  3M3Y H;  3SDZ A;  5I9P A;  2K32 A;  3R93 A;  4A3B G;  2NWG A;  2R92 G;  3CKI B;  2JQO A;  5D14 A;  5L37 A;  1DYQ A;  3KDF A;  3ONA B;  1C8C A;  2PW7 A;  2BA0 A;  4PMC A;  2O4X A;  2K33 A;  1Q8K A;  3QG1 A;  1F9P A;  2ZM6 L;  4K0K L;  1B8A A;  5EBD A;  1HJP A;  1EL0 A;  1TS4 A;  4EVO A;  1PYB A;  2CWA A;  2QKI C;  4H0L C;  3GTK B;  1VQG A;  2PO4 A;  1SMX A;  5JOB A;  1KRS A;  1BCP B;  1T9H A;  5IGF A;  5M9O A;  3I55 A;  1B3Q A;  1RF2 D;  2RCN A;  4F87 A;  5C5M A;  5FLX L;  3W5O A;  5COY A;  1UE1 A;  4L5T A;  4EGV A;  1Y1W B;  1FJG Q;  3HKZ E;  3OHX C;  1IYV A;  1KTK A;  1PRT C;  2N8N A;  1P8L A;  2KA7 A;  1Q81 C;  1LM0 A;  2KED A;  1TWH H;  1OXV A;  4A3K B;  4RKB A;  2IX3 A;  4XQJ A;  1AEX A;  3HOZ H;  1BCP D;  1U4P A;  2IX0 A;  1KDB A;  3AQQ A;  5CV4 A;  4C1N K;  4BY1 B;  1STY A;  1EYA A;  3S1M H;  5I6Y A;  4FDB A;  2R7Z G;  4DR7 Q;  4JW0 A;  3TP5 A;  5C6A A;  3A7L A;  4K6D A;  3S16 B;  1O7Y A;  1BR9 A;  2NVQ B;  1OO9 B;  2F0L A;  1N32 L;  5CMD A;  4JI0 L;  2NZH A;  1U0L A;  2WV6 D;  3MEF A;  2JEB I;  5EAY A;  1SE4 A;  5EQ0 A;  1YBY A;  2JA7 G;  5IYD H;  3ERO A;  3DXJ C;  3FRP B;  2ICI A;  2XGT A;  4DR3 Q;  2LMC B;  2B39 A;  1IZ6 A;  1KHI A;  5FJ8 H;  2DY7 A;  2PCF B;  4POF A;  1YNX A;  3CQZ H;  4B3M Q;  1D5M C;  4KJO A;  5KNB A;  2B8F A;  2BH8 A;  1Q46 A;  2CQA A;  3CME A;  2OTJ A;  4NDX A;  1HR0 L;  1R9T H;  3CRL C;  4JBJ A;  4M8A A;  1H9S B;  4KMU C;  4GNX C;  4RG1 A;  4H7B A;  1IHZ A;  4DV4 Q;  2D0P A;  4ALP A;  1IKL A;  5C4J H;  1Y1V G;  2R6G A;  2DJF C;  4WJ3 M;  3MXU A;  2KQ3 A;  4J1M A;  4JC0 A;  1ML0 D;  3STB C;  1VQJ A;  2JEA I;  3QR8 A;  5CC4 A;  3HOY G;  1IBK Q;  3OW2 A;  1SNQ A;  3NQT A;  1Q82 C;  1H95 A;  4LJZ C;  3MFG A;  1Q86 C;  4ZKB B;  2MFI A;  1E24 A;  4MZ9 A;  3KLW A;  3UDG A;  2JA7 H;  5J1Z A;  4OIJ A;  3HFZ B;  2K03 A;  3EJI A;  3I7F A;  4JI4 Q;  3TRZ A;  1ICF B;  3S14 B;  4FXD A;  2KEC A;  5GRO A;  4IUU A;  1BVS A;  3GV3 A;  4DV5 Q;  3FKI B;  4ODG A;  1KLU D;  1DON A;  4HED A;  1VQ8 A;  4GS3 A;  3CC7 A;  1AP0 A;  5I4D A;  1TU2 B;  3M4P A;  3RMH A;  5C4X H;  3D31 A;  1P16 A;  1YJ9 A;  4LF9 L;  4EQO A;  1ESR A;  3CCL A;  4R4I A;  4JYA L;  4X3T A;  5M3F B;  1JT8 A;  1K0R A;  5LMN W;  2AWN A;  3I73 A;  4LFC Q;  1JC7 A;  1WTP A;  1W6K A;  1XX8 A;  2Q8R E;  3PUX A;  1PZK D;  1JMC A;  1E22 A;  2RBM A;  1Y8P B;  2RA4 A;  2UUB Q;  1V9P A;  4JOI A;  5LHY 1;  4F7X A;  1W6J A;  1X56 A;  1K8A C;  4OIK A;  3PMF A;  2IHE A;  3L7Z C;  1ZKO A;  4C3H H;  1SRU A;  4F88 A;  3T4A C;  1GHK A;  1Y8O B;  1SYE A;  2F0N A;  4KN7 C;  1V1Q A;  3BZD B;  1KDC A;  2N88 A;  1A15 A;  2RCF A;  4NW2 A;  4YWK A;  2MGS A;  2BOS A;  1AH9 A;  2M00 A;  2KCT A;  4MIU A;  4LK1 C;  1LO5 D;  2ZJQ A;  3J7A F;  2RHS B; 
#chains in the Genus database with same CATH homology
 3E9I A;  3S24 A;  1HNX L;  4GOP A;  2UXB L;  1Y1W G;  4R4C A;  5JEA J;  3WWV A;  1PH4 A;  4X65 Q;  1S72 A;  4JBK A;  4WJ4 A;  1YHB A;  4KHP Q;  4A3G H;  3ULP A;  4UP8 A;  4DR1 Q;  3MXN B;  2ALY B;  4DV3 L;  4LF4 L;  4OWW B;  4A4I A;  1WI5 A;  1LYL A;  1NBW A;  2Y0S E;  4A3L H;  1MJC A;  1YIT A;  3GTP H;  1J5E Q;  4QQB X;  1Z9F A;  5BR8 Q;  4LFB L;  1Y14 B;  1GD7 A;  2UXC Q;  2JE6 I;  2ZJR A;  3OTO L;  4LFA Q;  1FGU A;  2I5H A;  1WYD A;  4JV5 L;  4YCW A;  2WB1 G;  1XMQ Q;  1WCM G;  2HIX A;  2ZTE A;  3EN2 A;  4PZ8 A;  3K7A H;  4JI1 Q;  1K9M C;  1L0W A;  2IT1 A;  2B63 H;  3OTO Q;  3HOZ G;  1VQB A;  4A3I G;  1PHJ A;  2HIV A;  4DAM A;  2UXD Q;  4PG3 A;  1QZH A;  1PH8 A;  4YCV A;  3KJP A;  4DV1 Q;  2K52 A;  2HT1 A;  1UE6 A;  1IBL L;  2YYZ A;  1XNQ Q;  5JJL A;  2N49 A;  2CKZ B;  4DV7 L;  4JI6 L;  3SGI A;  2UUA Q;  3H3V I;  3S17 H;  1VQF A;  1VQA A;  4DR1 L;  1K73 C;  1PA6 A;  4GLV B;  2I5L X;  5ELO A;  1A8V A;  4R4T A;  4C2M H;  4DV6 L;  4GKJ Q;  4B3R L;  1NTG A;  4AH6 A;  4DV7 Q;  4JI6 Q;  3CCV A;  3RLF A;  3PIO A;  1IXR A;  2IHF A;  4R4Q A;  4A3M G;  4QIW E;  1PYS B;  3G4S A;  2GVB A;  4AIM A;  2AMC B;  4A3J H;  4JCV E;  2A1A A;  1TWA H;  1CKN A;  2K5H A;  3KYH C;  2BH2 A;  4GN5 A;  1L1O A;  1YVC A;  4OON A;  2E2I H;  1CKN B;  3CPW A;  4DV2 Q;  1KC8 C;  1N8R C;  3CC2 A;  4LF8 Q;  4DR4 L;  1G6P A;  4JG2 A;  5C44 G;  4DV4 L;  3RN2 A;  2D0O A;  5C3E G;  3S2H H;  4JI7 Q;  1OXU A;  5JEA G;  3B6Y A;  1PH5 A;  1N36 Q;  3HOU G;  1YJN A;  2VS1 A;  4DV2 L;  4DR4 Q;  2FXQ A;  2E2J H;  5K36 G;  3EIV A;  1YI2 A;  4HJ9 A;  3LGJ A;  1JJC B;  4UP7 A;  2K5V A;  3CW2 C;  2K75 A;  3K7U C;  1A62 A;  2ATW A;  4X64 L;  2YTY A;  4HIM A;  2F52 A;  1PH7 A;  4B3R Q;  2Q2U A;  4DR6 L;  4IOC A;  1X6O A;  4DV5 L;  4A3E H;  5AJ3 Q;  3F2B A;  3K80 C;  4UPA A;  2MO0 A;  2IX1 A;  5C3E H;  4X62 Q;  2KHI A;  3KF6 B;  4X64 Q;  3RNU A;  3HOV G;  5HY6 A;  2PMZ E;  4C3J H;  3ZJY C;  1HNZ L;  4GOP C;  2Z0S A;  4KHZ A;  4A3K G;  1VQO A;  1L1O B;  4A93 H;  1X9N A;  3PO2 G;  3CC4 A;  5JJK A;  1HZA A;  5IY0 A;  3PV0 A;  4A3J G;  2A8V A;  3JAM c;  3I4N G;  1B7Y B;  3RLO A;  4C3I H;  3EBE A;  2DGY A;  3NEM A;  2H5X A;  5C0X G;  4HJ8 A;  2NVT H;  1V43 A;  2B3G A;  4GN3 B;  2HHH Q;  1XNR L;  4BY1 G;  5HGQ A;  3RZO H;  2B29 A;  3CP0 A;  2GVA A;  3F2D A;  1D7Q A;  2F4V L;  2OQK A;  4JI2 Q;  1X3G A;  3GTM H;  1MJE A;  4AQY Q;  3STB D;  1G29 1;  1X55 A;  1U5K A;  1YHA A;  1XJV A;  2B63 G;  5BR8 L;  1I6H H;  3J7Z C;  1W3S A;  3K0X A;  1BKB A;  3M9B A;  3GTJ H;  4A75 A;  3PUW A;  4IO9 A;  1OTC A;  5IP9 H;  5FLM H;  2UUC Q;  1EFW A;  3I2Z A;  5IP7 G;  1CSP A;  1YZ6 A;  1HNX Q;  4BBR G;  4EQ5 A;  5FLX c;  3PO3 G;  2ZM6 Q;  2F4V Q;  3HOU H;  4BXX G;  2EIF A;  3H0G H;  3H15 A;  1EWI A;  1I3Q H;  4A3E G;  3H3V H;  2JK8 A;  4JI5 Q;  5M3F G;  1FJG L;  1MKH A;  4BBS G;  3RR5 A;  4A3F H;  5M5W H;  3VDY A;  1VQM A;  2NN6 I;  3T1Y L;  3DLL A;  1VQH A;  4UP9 A;  5IP7 H;  3CCQ A;  3NBH B;  1Z47 A;  1HNZ Q;  2UXC L;  5LMN L;  4LFA L;  4LF9 Q;  1N34 L;  5ELN A;  3UDF A;  5M3M G;  1J5E L;  5J3B A;  1C7Y A;  1VQ9 A;  4DV6 Q;  4IPG A;  4BY7 H;  3FHW A;  2N78 A;  3JAM i;  4X66 Q;  3J81 i;  4DR5 Q;  4BA2 I;  1E1O A;  1AE3 A;  2Q2H A;  4AYB G;  2NZO A;  3J80 c;  1N34 Q;  4A3G G;  2PI2 E;  4LW1 A;  4DUY L;  2WP8 J;  4HID A;  1TWF H;  3CD6 A;  3J7A 5;  1SLJ A;  3NEL A;  4JI2 L;  1IBL Q;  3CCU A;  1G51 A;  1KRT A;  1XNQ L;  1VQ4 A;  3F2C A;  1LUZ A;  1ASZ A;  4JOI C;  1A0I A;  2HHH L;  1JJG A;  1C9O A;  3HKZ G;  2UXD L;  2UXB Q;  3Q8D A;  4PMW A;  1HZC A;  4LFC L;  4JI7 L;  2K50 A;  3F1Z A;  1VCI A;  2RHQ B;  4IPD A;  5LMU Q;  3S16 H;  3GO5 A;  1CUK A;  4BXX H;  1L1O C;  1XMQ L;  4HJ5 A;  4GNX A;  4LUV A;  1UE5 A;  3PUY A;  4GOP B;  5M3F H;  4DUY Q;  2VQE L;  3T1H Q;  3KOJ A;  3UE0 A;  3E0E A;  4JI3 L;  4X62 L;  2KEN A;  1TWC H;  5GAE C;  4POG A;  1CKM A;  2UU9 Q;  2R7Z H;  3F8T A;  1RIP A;  2K14 A;  3W1G A;  4YY3 L;  3A5U A;  4A3K H;  3A74 A;  3AFQ A;  4LF7 L;  1IL2 A;  4A3C G;  3UE1 A;  4DR2 Q;  4R1J A;  1Q7Y C;  5IE8 A;  2OWO A;  1XPO A;  4JI3 Q;  4IPC A;  4IFD J;  2R7D A;  5GAD C;  2AHO B;  4P74 A;  1Y1W H;  3S1Q H;  3M7N A;  2I5M X;  4EX5 A;  1KAW A;  3FKI H;  1GKH A;  3HKS A;  3CAM A;  4ME3 A;  2VQE Q;  1NMG A;  1MIU A;  4HIO A;  3J80 i;  3T1H L;  2E5L Q;  4NXN Q;  4IJH A;  4OWT B;  1N36 L;  5FJ8 G;  3DM3 A;  2JA8 H;  3J81 c;  3AEV A;  1LTL A;  1E1T A;  2ES2 A;  3S14 H;  1UWV A;  1YIJ A;  2GN5 A;  3PF4 A;  1KD1 C;  4NXM Q;  3FP9 A;  4LF6 L;  4A76 A;  1X3E A;  3UDX A;  2KCM A;  2E5L L;  4LF8 L;  4A3C H;  4DUZ Q;  2ZTD A;  1KL9 A;  4LF5 Q;  2KHJ A;  2JA5 G;  4IPH A;  3U50 C;  1KIX A;  1EYG A;  1KXL A;  1KQS A;  1N9W A;  2AKW B;  3CF5 A;  4OXP A;  4BBS H;  1PH3 A;  3FKI G;  4YWL A;  4IOA A;  4DK6 C;  5C4X G;  1NMF A;  4A3D G;  3TS2 A;  5H1S E;  3M4O H;  2JA8 G;  4XTC S;  5C0X I;  4JBM A;  4L5R C;  1Q12 A;  5C0X J;  4GKJ L;  4BA1 I;  4NB3 A;  2LXK A;  1NY4 A;  1SE8 A;  4GN4 B;  4HJA A;  3M3Y H;  2VL6 A;  2ASB A;  4MNO A;  2L15 A;  3GD7 A;  4A3B G;  2QEX A;  1HR0 W;  3K8A A;  3KDF B;  3T1Y Q;  1XPU A;  2R92 G;  1SR3 A;  2LSS A;  1XNR Q;  2KBN A;  1PH6 A;  3HOY H;  4LUO A;  2JQO A;  4JI1 L;  4OO1 I;  1K83 H;  3KDF A;  2NVX H;  5IYB H;  3J81 j;  1XPR A;  4DNI A;  2BA0 A;  4APV A;  2WB1 E;  1Q8K A;  3S1N H;  3ER0 A;  1BBU A;  2YU9 H;  2ZM6 L;  4K0K L;  1VQC A;  2JA9 A;  1B8A A;  3H0G G;  3PIP A;  4A3B H;  1HJP A;  1WCM H;  2V1C C;  3JC6 6;  1HZB A;  5E7N A;  1EIF A;  5IT9 c;  1EIY B;  5M5Y H;  5GQO A;  2R92 H;  1PYB A;  2CWA A;  4DV3 Q;  3RZD H;  2CFM A;  1IBK L;  4A3F G;  1EQQ A;  4LF4 Q;  3GTO H;  4K0K Q;  1OXT A;  2YTV A;  1VQG A;  1D8L A;  3G71 A;  2OTL A;  2R93 G;  2C35 B;  4DR3 L;  1SMX A;  1KRS A;  1SN8 A;  5IYB G;  1T9H A;  1S40 A;  1A63 A;  1E3P A;  3GTG H;  3U4V A;  4QGU A;  3I55 A;  4BY7 G;  4YCU A;  4DK3 C;  1S3O A;  1VQN A;  1YHQ A;  1CSQ A;  1EUJ A;  2VY3 A;  1JJ2 A;  1HNW Q;  5M5X H;  5M3M H;  4QY7 A;  3HOX G;  1XMO L;  3GTL H;  4JI4 L;  2RCN A;  2NN6 G;  5IWA Q;  3I4O A;  2I0Q A;  3ERS X;  3W5O A;  1WOC A;  1UE1 A;  2NVY H;  4L5T A;  4XIG S;  1FJG Q;  4YWM A;  4A93 G;  2NVQ H;  2HQL A;  3HKZ E;  4PZ6 A;  2WAQ G;  3RLN A;  1M1K C;  3ICE A;  1HR0 Q;  3HOW G;  2N8N A;  2K4K A;  4MTN A;  2E2H H;  1P8L A;  2UUC L;  4LNQ A;  2PI2 A;  2Z6K A;  1Q81 C;  1LM0 A;  2Q2I A;  1I94 L;  3PF5 A;  1TWH H;  1OXV A;  4BY1 H;  3KFU A;  3I56 A;  4AYB E;  2AWO A;  1XTD A;  3TEH B;  2R7F A;  1K3R A;  3HOZ H;  2IX0 A;  5GAH C;  4O0A A;  2DUD A;  3AQQ A;  4TVA B;  3A5Z B;  1I94 Q;  3S1M H;  4HJ7 A;  4L5Q A;  2UUB L;  4FDB A;  2R7Z G;  1IBM Q;  4DR7 Q;  2Q2T A;  2OQ0 A;  4AQY L;  4B3S Q;  4GKK Q;  1JE5 A;  1HNW L;  1TWG H;  1N32 L;  1JB7 A;  3PCO B;  4P71 A;  1L2F A;  4LWC A;  4JI0 L;  5IWA L;  3W1B A;  2NZH A;  4LUZ A;  1PH9 A;  1U0L A;  2YTX A;  1VQ5 A;  3MEF A;  2JEB I;  1FVI A;  1VS0 A;  1YEZ A;  5EAY A;  3KJO A;  2EXD A;  3NEN A;  5IYC H;  2OCE A;  4P75 A;  3I4M H;  1N32 Q;  1YBY A;  2JA7 G;  5IYD H;  3PUV A;  4B3M L;  3G6E A;  4NXN L;  4A3M H;  5AJ3 L;  4QL5 A;  2RF4 A;  1PV4 A;  1RL2 A;  4DAY B;  1I50 H;  4OX9 L;  2XGT A;  2CWP A;  4DR3 Q;  1VQ6 A;  5JJI A;  4L5S A;  1IZ6 A;  1KHI A;  5FJ8 H;  1WJJ A;  3L2P A;  4GLX A;  4POF A;  1X3F A;  1YNX A;  3CQZ H;  4YHH L;  1NE3 A;  4O2D A;  3CCM A;  2VW9 A;  4B3M Q;  3GTK H;  1GM5 A;  3BZK A;  1ASY A;  1GVP A;  1Q46 A;  2BH8 A;  5IYD G;  3CME A;  1AE2 A;  1TXY A;  3CCR A;  4OX9 Q;  2OTJ A;  4X6A H;  1Y1V H;  3BJU A;  4X65 L;  3TQY A;  4PZ7 A;  1HR0 L;  2CCZ A;  2CQO A;  2K5N A;  4JBJ A;  1R9T H;  4A3I H;  1VQI A;  2VNU D;  1HZ9 A;  4H02 A;  2VQF L;  4GNX C;  1NJI C;  4RG1 A;  3GTQ H;  4DV4 Q;  1M90 C;  1B70 B;  2D0P A;  3L0O A;  4NPS A;  2JA6 H;  4JV5 Q;  4ALP A;  4JYA Q;  5C4J H;  4OWX B;  1Y1V G;  2R6G A;  3CXC A;  2VQF Q;  1Q1E A;  4WJ3 M;  2R93 H;  3AFP A;  4DR7 L;  3A0J A;  4JC0 A;  1X65 A;  3STB C;  3CCE A;  1VQJ A;  3CCJ A;  2JEA I;  1QVC A;  1K8G A;  2LXJ A;  2VUM G;  3PGZ A;  2PNH A;  1SFO H;  4YHH Q;  3KF8 B;  3HOY G;  1IBK Q;  3OW2 A;  4DR5 L;  5LMN Q;  1Q82 C;  1EQR A;  1QUQ B;  4HIK A;  1H95 A;  4BBR H;  1N33 L;  1Q86 C;  1PH2 A;  3HOW H;  3PO2 H;  1GO3 E;  3BU2 A;  1VQL A;  4KHP L;  1O7I A;  3D0F A;  2MFI A;  3E9H A;  3TS0 A;  3S15 H;  1E24 A;  2Y0S G;  4MZ9 A;  4DPG A;  1QVG A;  4LF6 Q;  3KLW A;  3M85 A;  3UDG A;  2JJQ A;  2JA7 H;  4DV0 Q;  3HFZ B;  4P73 A;  3I7F A;  4JI5 L;  4QJF A;  2ZJP A;  1UE7 A;  1XMO Q;  4A3D H;  3U4Z A;  4JI4 Q;  3RN5 A;  3TRZ A;  1FL0 A;  4DV0 L;  4B3S L;  4GKK L;  3I4N H;  2BA1 A;  4JBW A;  5GRO A;  4UY8 C;  5FLM G;  3GDE A;  1HH2 P;  2VZA A;  1BVS A;  1VQE A;  2F3I A;  4X66 L;  4DV5 Q;  1W2B A;  1EOV A;  1PH1 A;  2WAQ E;  2MQH A;  2N3S A;  4YY3 Q;  5C44 H;  3HOX H;  4LF7 Q;  4LFB Q;  3HOV H;  3ULL A;  2MO1 A;  2JA5 H;  1UEB A;  2A19 A;  2EQS A;  1VQ8 A;  4GS3 A;  3CC7 A;  2IY5 B;  4DR6 Q;  4J15 A;  1QUQ A;  3PUZ A;  1OXX K;  2UU9 L;  3BZC A;  2MNA A;  1WFQ A;  3M4P A;  5C4X H;  4OO1 G;  3I4M G;  3D31 A;  2VUM H;  2E8G A;  1P16 A;  4Y7N H;  1YJ9 A;  2XTI A;  4LF9 L;  5IP9 G;  4GLA C;  3KF6 A;  1VQP A;  3CCL A;  1PVO A;  4R4I A;  4JYA L;  4P72 A;  4KI0 A;  1VQD A;  1JT8 A;  3IRB A;  3PO3 H;  1K0R A;  5LMN W;  2YV5 A;  4JI0 Q;  2AWN A;  4R4O A;  1J6Q A;  3CPF A;  4LFC Q;  5LMU L;  3CCS A;  1VQK A;  1YJW A;  4TQU S;  3PUX A;  4DKA C;  1JMC A;  3UDI A;  3S1R H;  3AYH B;  1E22 A;  3OYY A;  5GAG C;  1QVF A;  4Y52 H;  1Q1B A;  2UUB Q;  4IFD I;  1IBM L;  1V9P A;  4JOI A;  1VQ7 A;  3G48 A;  1N33 Q;  1X56 A;  2WFW A;  1K8A C;  4JI8 L;  2IHE A;  2ID0 A;  2Z6K C;  3L7Z C;  4IJL A;  2ZTC A;  4C3H H;  1CKO A;  3U58 A;  3S2D H;  1SRU A;  4DR2 L;  2JA6 G;  1X54 A;  2QGQ A;  3M4Q A;  4KLK A;  5IYC G;  4DV1 L;  1C0A A;  4JI8 Q;  1BBW A;  1OXS C;  3TRE A;  3ULJ A;  1E7Z A;  1V1Q A;  2PQA B;  2D62 A;  4B3T Q;  2UUA L;  1SRO A;  3PSI A;  1IYJ B;  4DUZ L;  4LF5 L;  1I5F A;  1PFS A;  3CMA A;  4YWK A;  2PQA A;  3K81 C;  5DLQ E;  4A3L G;  4IFD G;  1AH9 A;  1DGS A;  4RMF A;  2KCT A;  1QZG A;  4NXM L;  4B3T L;  2ZJQ A;  4GNX B;  2RHS B;  2QA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...