1HZBA

Bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of mutant forms of the Bacillus caldolyticus cold shock protein differing in thermal stability.
pubmed doi rcsb
source organism Bacillus caldolyticus
molecule tags Transcription
molecule keywords COLD SHOCK PROTEIN CSPB
total genus 14
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hzbA00
3K0XA 1E22A 1YNXA 5ELOA 2RHQB 5FJ8G 2B63G 4DV7L 3PUVA 2KENA 1JJ2A 4A3BH 1K8AC 5C3EG 4LF9L 1N36Q 1C0AA 1HR0W 1JJGA 4JG2A 1H95A 1MJCA 2YTVA 2NVQH 3WWVA 3OTOL 3G71A 1C7YA 1OXSC 4DV0L 4LFCL 3CPWA 4BBRG 5H1SE 4BA1I 1XPOA 1SFOH 3KF6B 1KRSA 1FVIA 4DR2L 3GO5A 4XIGS 2HQLA 3HOZG 3GDEA 3KF6A 3I4OA 1UE6A 5BR8Q 4GLXA 3T1YQ 1Y14B 5C3EH 3BJUA 1NE3A 3S15H 2JA8G 5FLXc 1JJCB 5C0XG 4B3ML 3L7ZC 2JA7H 1E24A 4PZ8A 1VQHA 3W5OA 1JE5A 4GN5A 1I94Q 4JYAL 3CCUA 2HT1A 2IX0A 1XNQL 4DV4L 5C0XJ 2JJQA 4DUYL 4GNXB 4C3HH 1HNXL 2BH2A 2CKZB 2NVYH 4PG3A 3A5UA 1KRTA 3CC4A 2EIFA 2JK8A 3G48A 4OXPA 3ZJYC 1YJNA 1QZGA 2KHJA 4LF4L 3I4NH 2I5LX 4P73A 2UUCL 3PO3G 1AH9A 4LW1A 1IBLQ 1OXUA 1OXVA 2ATWA 4A3CG 4DV2L 2N8NA 3EBEA 4A3GH 1E1OA 2K4KA 2E8GA 1HZAA 4JI6L 1UE1A 3TS0A 1RL2A 3RN2A 2ZTDA 2BH8A 3EIVA 2NZHA 4GLVB 4O2DA 4JI7L 2JEAI 4K0KL 1X54A 1IZ6A 1X3GA 5GAEC 1SN8A 3RLFA 2PMZE 4C2MH 1UEBA 3U58A 3S1QH 3S2DH 2PQAA 2FXQA 2JQOA 1JB7A 4IPHA 4DAYB 1L1OB 3U4VA 3OW2A 4NB3A 2PQAB 1VQ7A 1KHIA 4WJ4A 1LTLA 2R7FA 4HJ7A 4DR5L 2PI2A 1KIXA 5IYBH 1YHBA 4DV5L 5DLQE 1FL0A 1Q7YC 1EFWA 1VQAA 3KOJA 4A3GG 4R4OA 3K81C 1X3EA 1X9NA 3UE1A 2LXJA 4X64Q 2NN6I 4DV0Q 1VQ9A 2WP8J 1NY4A 4OONA 3U4ZA 4X6AH 5LMNW 3NBHB 1I3QH 1WYDA 2MO1A 1CSPA 5ELNA 5FJ8H 1XMQL 1VQLA 3MXNB 4IFDG 1HNWQ 4JI0Q 3NEMA 3KDFB 1SROA 1UWVA 3HOXH 5GQOA 1IBMQ 1JT8A 1YVCA 4LF7Q 4QY7A 2ZM6Q 2F4VQ 2YU9H 1TWFH 4B3RL 1WI5A 1IXRA 3CCJA 1L2FA 1PYBA 1YZ6A 2UXDL 4YHHQ 4OX9Q 3J81c 1HNXQ 1LUZA 2RF4A 3F1ZA 1B7YB 3B6YA 4AQYL 4JI4Q 3HOVH 2KHIA 4LF4Q 2F52A 4X65Q 4JI3Q 4BY1G 1MIUA 2QEXA 4A3FH 4DR6Q 5IYCH 3STBD 3K7UC 4JI1L 2LXKA 1LYLA 3GTLH 4APVA 1TWAH 1A62A 2AHOB 5M3FH 4JI6Q 5K36G 3CCVA 4HJ9A 1PV4A 3G6EA 3K8AA 3MEFA 1VQGA 3ULJA 2D0PA 1FJGL 4A3JG 4JV5Q 3PUYA 2IHFA 4GNXA 1HR0Q 3M7NA 4BY7H 1VQKA 3RNUA 1PH1A 2DUDA 4C3IH 1VQPA 4DK6C 1X56A 4BXXG 1Q1EA 3ULPA 2PNHA 5IYCG 2QA4A 5IP7H 4A93G 2IHEA 1E3PA 1T9HA 2YYZA 3FHWA 5IT9c 1VS0A 2KBNA 4X66Q 2K14A 2MFIA 3CPFA 2OCEA 2Q2IA 4DPGA 5IY0A 4A3JH 4HJ8A 4DR4L 3L0OA 1B8AA 4A76A 4IPDA 1GM5A 3I56A 2EXDA 3W1BA 2E2JH 4LF8Q 5IWAQ 1XMQQ 3S1MH 4LF5Q 4YWLA 3HOZH 4KHPL 4DUZL 1CSQA 2YTXA 1EWIA 1C9OA 1K73C 4EQ5A 1S3OA 4DK3C 3F8TA 3CC7A 5IYDG 4Y52H 3AEVA 4B3RQ 1QVCA 2MNAA 1EIYB 4NXMQ 3H3VH 4NPSA 2NZOA 4LUZA 1XTDA 4R4CA 3F2DA 1PH2A 3KJOA 4JI2L 4IFDI 2ZJQA 1PVOA 1SLJA 4NXNL 3RR5A 1RIPA 1K0RA 4DV1Q 1WJJA 3HKSA 4IJHA 4DV7Q 1HZ9A 4GOPA 4UPAA 4DR6L 1KC8C 1PHJA 2R7ZH 1Q8KA 4BY7G 1XMOQ 2Q2HA 4GOPB 2Q2UA 3T1HL 3H0GG 1PH9A 4L5SA 1YI2A 1VQDA 3TRZA 5M5XH 4LF6Q 2ZTCA 4OWWB 3ICEA 1TXYA 3OTOQ 3D0FA 2CCZA 5GADC 4OO1G 2JE6I 1FJGQ 3PF4A 4LFCQ 3J80i 3CW2C 4HJ5A 4WJ3M 2NN6G 4A3DH 3J7ZC 3JC66 3J7A5 3KLWA 4DR2Q 1CKNB 1EQQA 1Q81C 1PH6A 2UUBQ 2EQSA 4A3FG 2A1AA 4L5TA 4LFBQ 1A0IA 1TWGH 4IFDJ 3ULLA 4GS3A 4DR3L 4B3TQ 1EYGA 4A3EH 3GTJH 3I4NG 4GKKQ 3CP0A 1I50H 1NTGA 3KFUA 3PO3H 5M3MG 4A3KG 2VNUD 2QGQA 2WAQG 4A4IA 1J6QA 4IO9A 1KAWA 1I5FA 2LSSA 3PCOB 4JCVE 5EAYA 4DUYQ 1B70B 3F2BA 3HOUH 1YJWA 1J5EL 2UU9L 4DR4Q 5JJKA 2R92H 2HIXA 2GVAA 4X62Q 4RG1A 3H15A 3FP9A 2OQKA 5IP9H 3PIOA 3H3VI 1IBKQ 4LF8L 3PSIA 3I4MG 4GKJL 2CQOA 5IE8A 1IBLL 4LF5L 1I6HH 4L5QA 4YCWA 2L15A 1VCIA 2Z0SA 3PUZA 4YWKA 4DUZQ 2I5MX 4DV2Q 2N49A 1L1OC 4YCUA 2H5XA 3S24A 1N32Q 2IT1A 3A74A 3NELA 1G6PA 3F2CA 4JC0A 4DV6Q 5HGQA 3S17H 5J3BA 4FDBA 4P71A 4JI7Q 1EUJA 4BXXH 4K0KQ 3CCRA 1BKBA 1VQ6A 4JI2Q 3STBC 3GTOH 4A75A 2D62A 4UP7A 5LMNQ 3H0GH 2OWOA 1IYJB 4B3SL 4NXNQ 3M4OH 4HIKA 2CWAA 4DV1L 2HHHQ 5IP9G 4O0AA 4YY3L 1YHAA 2K5HA 3HOWH 3GTMH 1PH3A 3HOYH 3GTQH 3J81i 1VQ5A 3G4SA 3M4QA 4LFAQ 5JEAJ 3TREA 1XMOL 3TQYA 4ALPA 5E7NA 4DR1L 3T1HQ 3CC2A 3I2ZA 1BVSA 1VQJA 5M3FG 4BBSH 4QQBX 4PZ6A 2HIVA 4KI0A 3K7AH 3CCSA 1KXLA 2UUAL 4X64L 1W3SA 5AJ3L 1WOCA 5C4XH 2VQEL 4A3EG 1UE5A 4PZ7A 4XTCS 1X6OA 1VQOA 2AKWB 1XPUA 1NMFA 2VY3A 1MKHA 2Q2TA 1HNZL 1HNWL 4JI0L 4LFBL 2MQHA 3M9BA 1GKHA 2VQFL 4L5RC 5HY6A 1KQSA 2K52A 1TWHH 2ZM6L 2JA5G 4P75A 3CCEA 1Z47A 2VZAA 3JAMc 1QVFA 2K5NA 3HFZB 1GD7A 3E9IA 2B29A 3PO2H 3U50C 1KL9A 4JI8Q 4A3IG 2VL6A 3GTKH 4ME3A 4YHHL 1Z9FA 1VQ4A 4LNQA 4AYBG 3GD7A 3GTPH 1Q46A 2ID0A 4LUVA 3KYHC 3UDIA 4X62L 1CKNA 4AQYQ 3PGZA 1A63A 4JI3L 4X65L 1NBWA 3CMEA 5LMUQ 1Q86C 4KHZA 2GVBA 4HJAA 2DGYA 4GN3B 1P8LA 4POGA 1YIJA 1ASYA 2R93H 3AQQA 4BBRH 4JBJA 2YV5A 1PFSA 3D31A 1EOVA 2JA9A 4YWMA 1LM0A 3DLLA 1N32L 1L0WA 3KJPA 5C44H 1PH8A 4OO1I 2KCTA 4DV6L 2F3IA 3PIPA 4DNIA 1VQCA 5GAGC 4DV3Q 1YHQA 1HR0L 2UXCQ 2YTYA 5LMNL 1OTCA 4B3SQ 3CXCA 2R6GA 1QZHA 1PH4A 1N33L 2JA7G 3S16H 3TS2A 4YY3Q 3S2HH 4H02A 4QL5A 4QJFA 3CCQA 4LF9Q 1JMCA 3M3YH 4P74A 5FLMH 2KCMA 4KLKA 1MJEA 1PH5A 3EN2A 1SMXA 2Z6KC 3AYHB 4R4TA 2K75A 4DR1Q 3HOVG 5JJIA 5C44G 1BBUA 2V1CC 2ZJPA 4UY8C 4JBMA 4BY1H 1OXTA 4X66L 3J81j 2IY5B 2XTIA 4EX5A 3UE0A 4DAMA 2UUAQ 2VUMG 2UXBL 1VQNA 1N34L 2VQEQ 4P72A 2Y0SE 5IYDH 3M85A 1G51A 2MO0A 4MZ9A 3S1NH 3PO2G 1HNZQ 4JBWA 2Y0SG 4Y7NH 4A3IH 3SGIA 4GLAC 1D8LA 4PMWA 4KHPQ 1VQIA 3TEHB 1VQBA 4A3MG 3W1GA 4B3MQ 3L2PA 2ES2A 1NJIC 1PH7A 3PUXA 2ASBA 1HZCA 3UDXA 5M3MH 4NXML 2R7ZG 2I0QA 1XNQQ 1U5KA 4DV4Q 1XNRL 4JI8L 2R93G 2AMCB 1X55A 4JOIC 5IP7G 4A93H 1XJVA 3ERSX 2K5VA 3UDFA 1CUKA 1YJ9A 1PA6A 3RLNA 3AFPA 2E5LQ 2NVXH 2IX1A 2VW9A 3RZOH 5LMUL 1R9TH 3BZCA 2VS1A 3CQZH 3FKIH 1BBWA 2XGTA 4IPGA 4UP9A 3I4MH 5C4XG 3E9HA 1CKOA 4A3DG 2AWNA 1QUQB 3M4PA 4A3MH 1SE8A 2JA5H 1QUQA 1HZBA 3BU2A 1Q82C 4LF6L 2A19A 2BA0A 1Y1WG 1CKMA 1Q12A 2AWOA 3J80c 4DV3L 2BA1A 1QVGA 4BA2I 1G291 1Q1BA 1K3RA 3HOXG 4R4QA 1A8VA 4RMFA 1N9WA 1X65A 3BZKA 1N33Q 4A3KH 2R7DA 4R1JA 3DM3A 4IOCA 1L1OA 2ZJRA 2UUBL 1YITA 4DR7Q 2VUMH 1D7QA 5M5WH 1UE7A 3PUWA 1DGSA 2N3SA 3FKIG 3RLOA 4DR5Q 4DR3Q 4DV5Q 3UDGA 4B3TL 4GKKL 3CCMA 1YBYA 2D0OA 1VQ8A 4AIMA 1E7ZA 1SR3A 4BBSG 2OQ0A 4JOIA 2OTJA 1K83H 4TQUS 4GNXC 1WFQA 2UXBQ 1KD1C 2RHSB 1N34Q 1N8RC 1J5EQ 2UU9Q 4MNOA 4LUOA 4GOPC 4LWCA 2OTLA 3A5ZB 2Z6KA 1IBKL 4AYBE 4JI5Q 1E1TA 4TVAB 1TWCH 4GKJQ 2WAQE 3KDFA 3CMAA 5GROA 5C0XI 3K80C 2JA6G 4IPCA 1VQMA 1K8GA 4J15A 4DKAC 2GN5A 1VQEA 2B3GA 4HIDA 3VDYA 1K9MC 1IBML 4LF7L 4C3JH 5GAHC 4HIOA 2F4VL 3HKZG 4QIWE 1XNRQ 2CFMA 3Q8DA 2UXDQ 4OX9L 3E0EA 1YEZA 2A8VA 2HHHL 1NMGA 1EQRA 2C35B 4JI4L 1HJPA 3PV0A 4HIMA 3S1RH 2E5LL 1HH2P 3ER0A 3AFQA 2I5HA 5IYBG 1N36L 3HOUG 4JI1Q 4LFAL 2PI2E 4GN4B 3PF5A 2JA8H 4UP8A 3IRBA 2JA6H 3KF8B 2R92G 1WCMG 1VQFA 1V1QA 5M5YH 2K50A 3CAMA 1P16A 4A3BG 5AJ3Q 4JV5L 3CD6A 4A3CH 2N78A 3NENA 1SRUA 1PYSB 4POFA 3I7FA 1XPRA 5JEAG 1M90C 2RCNA 4DR7L 2ALYB 5BR8L 1X3FA 3OYYA 1Y1VG 3T1YL 4A3LH 4AH6A 2VQFQ 1V9PA 3GTGH 5FLMG 2WB1E 1U0LA 4IJLA 1GO3E 3JAMi 1WCMH 1I94L 1OXXK 4JYAQ 4R4IA 3HOWG 4IOAA 1S72A 5C4JH 1S40A 2WFWA 2WB1G 1ASZA 3I55A 3HOYG 1AE3A 5JJLA 4JBKA 2B63H 1M1KC 2E2HH 2ZTEA 4JI5L 1Y1WH 1W2BA 2JEBI 5IWAL 2UUCQ 2NVTH 1Y1VH 4A3LG 1GVPA 3RZDH 4YCVA 2E2IH 3CCLA 1IL2A 4MTNA 3A0JA 1EIFA 1V43A 1FGUA 3CF5A 4QGUA 3RN5A 1O7IA 1AE2A 3HKZE 3S14H 2UXCL 2CWPA 3LGJA 4OWXB 4OWTB
chains in the Genus database with same CATH superfamily
3K0XA 2KENA 3DMUA 4F8MA 1N36Q 1C0AA 5L37A 1TWAB 4CJ1B 1JJGA 1H95A 2XSCA 2AQ3B 1AZPA 3BVMA 1MSHA 4DV0L 1SFOH 2EY1A 1KRSA 3T13A 3WDNA 5KNCA 3HOYB 3GO5A 2LY7A 2HQLA 3GDEA 1UE6A 5IGDA 4GLXA 1AZQA 1JC7A 1WTPA 2RDGA 5FLXc 2JA7H 1BCPB 2Q8IB 3W5OA 1EY0A 4L63B 2IX0A 1U4PA 4C3HH 2BH2A 3A5UA 2EIFA 2JK8A 3G48A 4DN4M 1YJNA 2B2VA 4LF4L 2KHJA 3PO3G 4P73A 2UUCL 1IBLQ 5JPMC 2ATWA 3OIQA 1D1IA 2N8NA 3EBEA 3KLSX 3GTOB 5ELCA 4NW2A 4C3JG 2BH8A 1Y1VB 3EIVA 2JEAI 3NQTA 2QF7A 4O2DA 1IZ6A 1SN8A 3S1QH 4RHRA 4DK0A 2PQAA 3S2DB 3IKJA 1MD2D 1VQ7A 5DM73 4DR5L 2PI2A 4DV5L 5EKIA 1FL0A 3K57A 1SEBD 1X9NA 1IYUA 2EDGA 3BDLA 4X64Q 1B1ZA 2NN6I 4K6LA 2WP8J 1U4MA 4OONA 2MGSA 1KNEA 3U4ZA 1WYDA 4IFDG 1VQLA 3MXNB 2EYJA 1SYBA 1PFBA 1SROA 1QG7A 3MXUA 1IBMQ 2ENBA 1I50B 1EYAA 4E6IA 4KD4A 2YU9H 5K36H 1TWFH 4B3RL 3SHLA 4K5WA 3CCJA 1L2FA 1PYBA 1YZ6A 4I65A 2UXDL 4HR7B 4OX9Q 3J81c 5TSSA 1HNXQ 4U68A 3F1ZA 2F52A 4JI3Q 2QEXA 4A3KB 4DR6Q 3STBD 1EIGA 4APVA 2X6LA 4UAIA 1T5XD 2K03A 2IJ0A 4HJ9A 1QOHA 3G6EA 2WIIB 4IQZA 4GNXA 3M7NA 3SK8A 4XQNA 3NE5B 4KY5A 2DUDA 1TS4A 3N52A 4C3IH 3PIO3 2QA4A 1F77A 5D14A 5CV8A 1YNND 2JYOA 2YYZA 3FHWA 2NBFA 3HZXA 5DEHA 2C5CA 2L1BA 3TBIB 4FP5D 4V190 4J6HA 2DNEA 5IY0A 4K2LA 4IPDA 3I56A 2E2JH 1GJXA 5IWAQ 1D5ZC 4F7XA 2YTXA 2PZWA 2XRSD 1E0BA 4EQ5A 3F8TA 4B08A 3A8IE 1RCVD 4ZQ3A 4NPSA 3L3OC 3KJOA 4JI2L 1PTOD 1SLJA 4NXNL 3RR5A 4FF1A 1RIPA 3GTPB 1JORA 1WJJA 2EYHA 2RDFA 2JA5B 3M4YA 1STYA 1ILQA 1KC8C 1XMOQ 4A3IB 2F0NA 3H0GG 2X69A 3TRZA 2K01A 2F0OA 1EL0A 4MIUA 5GADC 4OO1G 2JE6I 2QDBA 5CYUA 2EPBA 4DR2Q 1CKNB 1XX8A 1O7ZA 4QUFA 1A0IA 4TKOB 4GS3A 4DR3L 4B3TQ 1MGSA 3KFUA 4KK7A 2VNUD 4A4IA 1J6QA 2M9VA 3PCOB 3S15B 4I7AA 2G5DA 2R92H 2GVAA 3Q0AA 1F2MA 3H15A 5IP9H 3PIOA 3I4MG 5IE8A 1SYFA 4YCWA 2L15A 1VCIA 4DUZQ 4YWKA 3A8KE 1JWMD 3J80L 5M5WB 1MHWC 3NELA 3K5LA 4P71A 4K8JA 3A8JE 4JI7Q 1BKBA 4CDFC 4A93B 3STBC 4XQJA 3H0GH 4B3SL 3BDCA 4XT1B 2CWAA 2NVXB 4ABNA 4O0AA 4YY3L 4ZUJA 3URYA 2IPKD 3HOYH 3GTQH 3K59A 3G4SA 3M4QA 3TQYA 3SEBA 1XYIA 4RCNA 1H9RA 1R4PB 1JCKB 2NB0A 4X64L 2B2WC 1TS3A 3NBHA 1HNZL 2Q2TA 4U673 4NDXA 1ET9A 3HG9A 1HHVA 1CHPD 4L5RC 4XXEA 2K52A 4ZK9B 1AEXA 1Z47A 2VZAA 3QR8A 3ERQA 1LV9A 3PO2H 3MVVA 3U50C 4YHHL 3BS1A 3GD7A 5M9OA 1Q46A 4LUVA 1B9NA 2BDOA 1CKNA 4DNTB 3PGZA 1Q86C 4C2MB 3P1HA 2GVBA 1YIJA 3NUCA 2YV5A 1SNOA 1Q3LA 1EOVA 1TU2B 3DLLA 4A3FB 1AW7A 4K2KA 4DV6L 5M5XB 5GAGC 1A3UA 1HR0L 4KKSA 1SYDA 3T51B 1QZHA 4QIWB 1QE6A 3E3XA 3S16H 5NUCA 4YY3Q 3O13A 3CCQA 1JB3A 1JMCA 4LF9Q 3MFYA 4KLKA 5KNDA 1MJEA 3F2UA 2Z6KC 3AYHB 4DR1Q 3GTJB 1EY8A 3EA6A 1BBUA 1SE2A 4X66L 4MN3A 2RA4A 3KLSA 4EX5A 2UUAQ 1I4GA 2UXBL 4F87A 3ZYYX 4JW0A 2BCOA 1IHZA 1EY6A 2K7VA 3M85A 1GUGA 4MZ9A 4UHVA 3S1NH 1TY0A 1HNZQ 3PO2G 4Y7NH 2LMCB 4M1UB 1R4QB 2IW3A 1B50A 2KEDA 3FMCA 1K28A 2ES2A 3PUXA 1XXGA 5KRUA 4NXML 2P5ZX 4JI8L 2AMCB 1V1PA 1JR0D 1QNKA 1IKLA 3ERSX 3M7GA 1LABA 3RLNA 2K04A 2E5LQ 5LMUL 4R9WA 4A3EB 2IWHA 1CKOA 2HDMA 2YU9B 4A3MH 2SDFA 1X3PA 4LF6L 1F2ZA 2A19A 2BE5C 3HRZC 4DV3L 2BA1A 3HOVB 4BA2I 1Q1BA 3HOXG 1LTSD 1N9WA 2EY2A 2TMPA 1N33Q 3HGBA 4A3KH 1PDQA 4IOCA 1L1OA 1WCMB 3I73A 5FO9B 3SK6A 2N3SA 1ML0D 1YBYA 1FNUA 2D0OA 3VR2A 1QJOA 4J8QA 2AUKA 4G7ZC 3C46A 1HQMC 4TSSA 4X3UA 2B63B 1BR9A 4GNXC 1A2TA 2QILA 1N8RC 4PQXA 2OTLA 1ENFA 4CKBA 4JI5Q 3CMAA 5C0XI 1A15A 3S14B 1FR3A 4J15A 2A6ED 2GN5A 3GP7A 4HIDA 1LTAD 4LF7L 4C3JH 1PTOC 2B2WA 3HS0C 5C4XB 1CK1A 3U9SA 1YEZA 2A8VA 1DM0B 1HJPA 2OXPA 3E0JA 1N36L 3J81E 2HCIA 2PZTA 1Y8NB 2PI2E 4N8FA 4JI1Q 2QEJC 3T4AC 4CKCA 5J39A 2JA6H 2R92G 2PW7A 1M4VA 5I6WA 4H44C 1S4ZA 1I4QA 4ILWA 5C5LA 4BBSB 2F0DA 2R7ZB 1A6XA 2R93B 5D3IB 4DK1A 4C3JB 5BR8L 3OYYA 3CRLC 1B3QA 2VQFQ 3NHHA 1GUOA 4IJLA 3JAMi 1FD7D 4DAPA 3BYTB 3HOYG 2WFWA 1LT3D 5IGEA 2H4OA 1ZEQX 2B63H 3KUPA 4A3GB 3NWTA 2OF1A 4OO1H 4A3LG 1KLGD 3GTMB 5IT9L 1LACA 3A0JA 1TY2A 3DWPA 1HPCA 3E5SA 1JWUD 4FNFA 2XN9C 2K05A 2E76C 5EPJA 3SXHA 2UXCL 1TR5A 2CWPA 3DEPA 3H6MA 4G57A 1TQOA 1E22A 1VDZA 1YNXA 2RHQB 5CV4A 5FJ8G 4DV7L 1JJ2A 1K8AC 5DM63 3K6OA 2NTSA 3D4DA 3D8GA 3T16A 2PQEA 5C0XH 1MJCA 2WINB 2NVQH 1C4QA 2MJ8A 4OELB 3WWVA 3OTOL 2JA6B 1C7YA 1ZYRD 3J7YW 1EY4A 4LFCL 4DXFA 3CPWA 2FJ2A 4BA1I 1XPOA 3KF6B 1LLRD 4IZ8A 1EY7A 4XIGS 4DU9A 1ILPA 4YIJA 3T1YQ 1Y14B 5FO7B 5C3EH 1NE3A 3S15H 1EYDA 1I4PA 2O5IC 1E24A 4PZ8A 4HAEA 2EYLA 1W6KA 1SE3A 1I94Q 2JSOA 2JJQA 4GNXB 2CKZB 4BS9A 2NVYH 4PG3A 2NVYB 3I4NH 4OXPA 2SOBA 3S1RB 1ZXTA 3DM1A 1OXUA 2I07B 2EJMA 4K8IA 4A3GH 1DCZA 4ZYSA 1UE1A 1RL2A 2E2IB 3RN2A 2ZTDA 4GLVB 4JI7L 4BY1B 4ZRZA 3NQIA 1X3GA 1BCPD 4XYQA 4C2MH 1UEBA 1L0XB 2FXQA 3P75A 2EJGC 2JQOA 4B9WA 4IPHA 3OW2A 4WJ4A 4NB3A 1LTTD 1WTHA 5C6AA 1KDBA 5DLQE 1EFWA 2K5DA 5FLXL 1SE4A 2F0FA 4N9PA 3V2TA 5EPLA 4X6AH 2ICEC 2MO1A 5ELNA 5FJ8H 4OHJA 1TKWB 3HOXH 5GQOA 4RKBA 4LF7Q 2ZM6Q 5D65A 3TDQA 2F4VQ 2F0GA 5EBCA 3D3RA 3PMFA 4FYDA 3SE0A 4EGVA 1LUZA 3B6YA 4AQYL 4JI4Q 1PMRA 3HOVH 4X65Q 4J1MA 4BY1G 1E2ZA 5IYCH 1C8CA 1SSOA 1H9KA 3GTLH 4IUTA 1A62A 2AHOB 1Z6HA 2RSNA 1SAPA 5K36G 1E2WA 1PV4A 1ESRA 2D0PA 1FJGL 1SNQA 4CKEA 2B8GA 2IHFA 1HR0Q 4BY7H 1GUSA 2NZ1D 1B2TA 4M8AA 5C3XA 4DK6C 3BDOA 2XIWA 4LAAA 1BQQT 1PXUA 4A93G 3OPOA 2IHEA 2F0KA 4IURA 1E3PA 5IT9c 1CZGA 4A3JH 4HJ8A 1KNAA 4A76A 4PV1C 1GM5A 1A3TA 4K5VA 4LF8Q 1KABA 4YWLA 3TP6A 2DN8A 1STBA 5J1ZA 1S3OA 4CGYB 5IYDG 3M4OB 2MNAA 4NXMQ 2F0JA 2NZOA 2V4DA 3QB3A 4R4CA 1PH2A 1PVOA 3FVQA 2EOTA 4L8JA 1NCVA 4H0LC 4DV1Q 3HKSA 1BF4A 3NSWA 2WV6D 4K5XA 4UPAA 4DR6L 4CJ0B 2R7ZH 4BY7G 1STAA 2Q2UA 1YI2A 4LF6Q 5IGBA 1ZYRC 3OTOQ 3D0FA 3PF4A 1RD9D 4LFCQ 3J80i 1XTCD 3CW2C 4HJ5A 2ZXOA 2NN6G 4A3DH 3NK9A 1SNCA 1WTVA 1EQQA 1Q81C 1PH6A 2UUBQ 4C3HG 1TWGH 3C3LA 5I9OA 2XWJB 1B3AA 5IOCA 4GKKQ 1RTOA 3PO3H 4FO2A 5COYA 3P7JA 1I5FA 4JPBW 4G7OC 3F2BA 2HIXA 4RG1A 2EYMA 3H3VI 3QWNA 3TP8A 4LF8L 2CQOA 5E4XA 4L5QA 2B2UC 2Z0SA 2E75C 4DV2Q 3MA2B 2N49A 4JC0A 4FDBA 4BXXH 3CCRA 2IL8A 3BVZA 4UP7A 4A75A 5LMNQ 2HHHQ 5IP9G 1PFMA 1YHAA 4ZKCB 2RBMA 3GTMH 1SDFA 1V1OA 3TREA 4LFAQ 5JEAJ 1XMOL 1CI3M 4LMQD 3I2ZA 5M3FG 2Z8LA 2AQ2B 1EQVA 1KXLA 2Z4IA 4FF2A 4DGZA 4KN4C 3VR4A 2D2CC 1X32A 1HFGA 1HA5A 4H7BA 2K28A 1PTOH 2NYZD 4LFBL 4S3SA 1HCZA 1UUPA 2MQHA 2O5JC 1KQSA 2A73B 4P75A 2A5HA 1U4RA 1QVFA 2K5NA 1GD7A 4JI8Q 2VL6A 4NMZA 1J8IA 4C1NK 1VQ4A 2TSSA 4LNQA 2L9HA 3UDIA 1NSNS 1QWYA 1A63A 4KHZA 3X3NA 2DGYA 1ASYA 2R93H 4BBRH 4JBJA 2JA9A 2KCNA 1BNZA 1LM0A 1N32L 1F9RA 3ND8A 1L0WA 4FF3A 5C44H 4OO1I 2KCTA 1FYCA 4DNIA 4DV3Q 4FXDA 2R6GA 1N33L 4ID6A 5A2QL 3VR6A 3TS2A 4C56C 2NVQB 4QL5A 2R61A 4QJFA 3MTSA 3M3YH 4P74A 2B2YA 4NKLA 1SMXA 2DNCA 2FMCA 2M00A 3NBIA 4R4TA 2XRQD 3HOVG 5JJIA 1UAPA 3DEOA 2ZJPA 4BY1H 1OXTA 3J81j 3VA5A 2D5DA 2G9DA 4MTKA 4DAMA 4L6TB 1VQNA 2VQEQ 2DY8A 2Y0SE 4CDCC 1G51A 2Y0SG 1QILA 3SGIA 4GLAC 5JVG3 1VQIA 3TEHB 1VQBA 1B9MA 3WOEA 3R8BA 3L2PA 1GXDC 2A69D 2EY6A 3LWUA 3KBGA 2I0QA 1IYVA 1XNRL 2R93G 4JOIC 4A93H 2K5VA 3UDFA 2OTJA 3RZOH 1EZ8A 4RH6A 3VYRA 2NVXH 2LS01 2CQAA 4WFN3 3BZCA 2VS1A 3CQZH 4DF7A 1BBWA 3HOWB 4KKUA 2XGTA 4IPGA 2KCCA 1M8AA 5C4XG 4R8NA 1QUQB 3M4PA 3A54A 1HZBA 2RVLA 2BA0A 2DJGC 2AUJD 5A35A 1CKMA 1Q12A 4KKTA 4RKLA 1K3RA 5C44B 1A8VA 1X65A 5FK9C 2R7DA 4R1JA 3DM3A 2EYPA 2ZJRA 4RGTA 1UE7A 3PUWA 3FKIG 4DV5Q 4GKKL 1SR3A 4BBSG 3OSOA 1PLFA 1WFQA 1WVLA 1YNNC 1N34Q 1E2VA 4GOPC 1CA5A 4LWCA 3A5ZB 1IBKL 4AYBE 3P20A 2KA7A 3TSSA 4C1NI 5GROA 4IPCA 1W6JA 1S5DD 1K9MC 1IBML 4HSPA 3VDYA 3K5MA 5T1IA 3HKZG 1XNRQ 1PZKD 3Q8DA 1L0YB 2F0TA 2HHHL 1NMGA 2C35B 4HIMA 2Z4HA 4OL7A 3ER0A 2F1MA 1SYCA 4K14A 1U4LA 2JA8H 2E2HB 1GUNA 5M5YB 4IUUA 1HUNA 2NVTB 1ONLA 5M5YH 1KDAA 3J81L 1P16A 3CD6A 3NENA 3I7FA 5DNFA 1ENCA 3CRKC 1Y1VG 3GTGH 5FLMG 2WB1E 3MXGA 4OIKA 1WCMH 4JYAQ 1OXXK 2WB1G 5IGCA 1CFMA 1JE4A 1I6VC 4JBKA 3H09A 2E2HH 2JA8B 2ZTEA 5EQ0A 4JI5L 1W2BA 3RZDB 4DA2A 1O7YA 5G3LD 1IL2A 4KY6A 2ZT9C 1EIFA 1FGUA 2F4IA 4HSVA 2ZXPA 4RHSA 2E2DC 1O7IA 1DXMA 1LT5D 5CV6A 3RN5A 3S14H 1LT4D 2EYFA 3LGJA 4OWXB 1O78A 5CBAE 4A3BB 5ELOA 3H94A 1K8MA 3PUVA 4PNYA 3PQIA 4LF9L 4HN7A 5C5MA 4JG2A 2CW0C 5IGFA 2YTVA 4X3SA 5CORA 5C3WA 3J7AV 5JVH3 1OXSC 5FOBB 1S5BD 4BBRG 1TWGB 5H1SE 1LO5D 5EPKA 2BE5D 2WB1B 1CQVA 3I4OA 2JA8G 5C0XG 1JJCB 3IL8A 2A69C 3MHBA 2K32A 4GN5A 1TIID 3CCUA 2F0UA 2HT1A 2ZXRA 1HNXL 1KRTA 3ZJYC 2E2JB 1DONA 1QZGA 1D5MC 4LW1A 1OXVA 4RAUC 3VYSA 2N55A 3X3MA 4DV2L 3M3YB 2K4KA 1JOKA 5FO8B 3TS0A 5D3DA 2JXMB 3DXJC 5A2QE 3AU7A 2NZHA 3Q23A 4QB4A 3VR5A 4K0KL 1HTLD 3KLRA 3NTKA 3RLFA 2B2TC 1GHJA 2D9UA 2PMZE 3U58A 2VXWA 3QIAA 4HTHA 2KEEA 1L1OB 3U4VA 2R7FA 3CU7A 1KIXA 5IYBH 1KLUD 4IUQA 1VQAA 2M2LA 3KOJA 4R4OA 3NTHA 5BN3A 5F2DA 3EROA 3UE1A 2LXJA 4DV0Q 1PTOB 2MPMA 2B2UA 2F0QA 3DWQA 3NBHB 2KUMA 5JEAH 3H0GB 1H9JA 1CSPA 1SJED 1XMQL 1HNWQ 1JOOA 4JI0Q 3FEWX 3KDFB 2WACA 1F2YA 1XWEA 2EYOA 4YHHQ 2RF4A 1I4RA 1B7YB 1G8ZD 2KHIA 1MIUA 4A3FH 1EFID 1NAPA 1SNMA 2HQEA 3BG3A 2LXKA 1LYLA 2KQ3A 1TWAH 4RGNA 5M3FH 4JI6Q 4HMJA 5E3FA 3K8AA 1VQGA 4JV5Q 3PUYA 3RZOB 3T53B 1VQKA 2JP1A 1STHA 5BN5A 4BY7B 2CW0D 1DZ1A 2IX3A 3GTQB 2LFNA 1VQPA 1X56A 4BXXG 1Q1EA 5JJZA 3TP5A 1G2SA 5IP7H 2NWGA 2Z9HA 4MHEA 1T9HA 1VS0A 3J7AF 4X66Q 3CPFA 2OCEA 2WKDA 1UNSA 1JOQA 3L0OA 4C3HB 1WTXA 1B8AA 5CMDA 3LX0A 1DD2A 3S1MH 1XMQQ 1EY5A 3HOZH 1WD0A 4KHPL 1Q90A 1EWIA 2ICIA 4DK3C 4RA8A 3CC7A 3AEVA 4B3RQ 1QVCA 3ND9A 3I8ZA 2KHSA 1CA6A 3H3VH 5JPNC 4IFDI 2ZJQA 1FNWA 5LL6S 4EVOA 4IJHA 1HZ9A 2CH4W 4G4KA 2XWBB 4GOPB 3FPUB 3T1HL 1PH9A 4L5SA 5M5XH 1EYCA 1Z7TA 1RHPA 2F0MA 4FVMA 3VR3A 5FLXE 2RQXA 2PCFB 1TWHB 2EQSA 4A3FG 3QOJA 4XDXA 2A1AA 1VMPA 4IFDJ 3ULLA 4A3EH 3GTJH 3I4NG 5AFWA 1I50H 4ODGA 2QGQA 2MP1A 1QNUA 2FFKB 4JCVE 4WORA 1B70B 4DUYQ 3HOUH 4HMIA 1YJWA 1J5EL 2UU9L 5JJKA 2OQKA 2J7ZA 3KK7A 3PSIA 4A3JB 4GKJL 1IBLL 1I4HA 4QQBX 2N88A 1L1OC 4YCUA 2H5XA 1RF2D 1N32Q 3A74A 3OMGA 2MUYA 3F2CA 3I90A 5HGQA 3S17H 1EUJA 2Y0SB 4K0KQ 2F3WA 1DJRD 1SNDA 3AB9A 2LKVA 3I70A 4JI2Q 2D62A 2OWOA 3GTOH 3M4OH 1IYJB 3H91A 5EKLA 1BDOA 3E6ZX 1PH3A 1VQ5A 2A68D 2EJFC 4H13C 5CBEE 3TZDA 3SK5A 4ALPA 4DR1L 4JK1C 5K5PA 4BBSH 1VQJA 3EJIA 3W2DA 4PZ6A 5C4HA 3K7AH 3CCSA 2L4NA 3NP8A 5C4XH 1T5EA 1BCPC 2VQEL 4A3EG 1UE5A 4XTCS 1X6OA 3JAML 5CC4A 2AKWB 1XPUA 1NMFA 1MKHA 2CH4A 1HNWL 5IODA 1IW7D 1TWHH 1STEA 5DAUA 4X3KA 2JA5G 3CCEA 1LT6D 2B8FA 3DWAA 3E9IA 2K1BA 2B29A 4QUCA 1I6HB 1A3VA 3OOCA 3GTKH 4ME3A 3GTKB 4IUPA 4AYBG 3GTPH 2ID0A 4X62L 4AQYQ 4PMCA 1SNPA 3G6JB 5KYLA 4X65L 3CMEA 1NBWA 2H1EA 1G2TA 4HJAA 3D6WA 1CHQD 1P8LA 1TVXA 3JAME 2BDNA 4ZAIA 1CTMA 4YWMA 3KJPA 2F3IA 1VQCA 4GZYC 3S17B 2PNRC 4A3DB 2I46A 3S2HH 4H02A 3HKZB 2QDLA 5FLMH 2KCMA 1EU4A 4HCSA 1RJTA 1JWSD 2K75A 5C44G 2V1CC 3I4MB 4UY8C 2L5TA 1RKNA 2F0HA 3UE0A 1VF7A 1SYGA 1BUVT 3D4RA 5IYDH 2R92B 2MO0A 3AMUA 4JBWA 5G3LF 4PMWA 4CDDC 4DAYA 4B3MQ 3BYYB 2PYKA 1EOTA 1HZCA 3UDXA 1YNJC 1STNA 4XQQA 2F0WA 5M3MH 2R7ZG 4DV4Q 2NUCA 3TZUA 1B53A 1NUCA 5IP7G 5JOBA 1V1PB 1CUKA 1I6HH 1WTWA 5CV5A 1TT2A 3E9HA 2NN6H 4A3DG 2AWNA 1B4OA 3C2PA 1SE8A 3RD4A 2JA5H 3ITPA 1Q8IA 1EWCA 2RDHA 1QVGA 3U9OA 1K0SA 1F2LA 3BZKA 2SEBD 2R3ZA 2VUMB 1PRTF 3V05A 2K33A 2UUBL 1D5XC 1DGSA 2CVRA 4DR5Q 4DR3Q 4B3TL 3R2TA 4KJNA 3S2HB 3OWFA 3S16B 2EY5A 1VQ8A 4AIMA 1STGA 3W3AA 1E7ZA 4JVZA 2OQ0A 4JOIA 1K83H 4TQUS 1KD1C 4R8IA 1J5EQ 2UU9Q 4MNOA 4O42A 2Z6KA 1E1TA 4TVAB 2DJFC 2G9HD 1TS2A 2JA6G 1VQMA 1K8GA 2JA7B 1VQEA 2B3GA 1CQFA 4BBRB 2F4VL 4HIOA 4FXKC 2F0VA 2XNAC 1BXTA 2AQ1B 1WD1A 2CFMA 4OX9L 3GTLB 1PRTB 4JI4L 3PV0A 3S1RH 3HP3A 5HGTA 1HXYD 2E5LL 3C1EA 3I91A 3VA7A 5IIFA 4KY7A 5IYBG 4HEDA 2A6HC 3IAYA 4HCEA 4LFAL 4GN4B 3PF5A 3HOUG 4UP8A 3IRBA 5CR3A 3PO2B 1V1QA 3A7AB 1SFOB 4V0BA 3I72A 4A3BG 2F0SA 3FPPA 2N78A 1SRUA 1PYSB 5ELFA 5C3EB 5JEAG 2C9OA 1M90C 2RCNA 4DR7L 2PMZB 1SMYD 3SVMA 4AH6A 1V9PA 5KGUA 2A6EC 1U0LA 1SJHD 1MI2A 3S9WA 4R4IA 4IOAA 1S72A 5C4JH 1ASZA 1GHKA 1ICFB 3A56A 5C4JB 2B2YC 3HOZB 1AE3A 5JJLA 4CHTB 1H9MA 4N8X1 1AP0A 1H9SB 1Y1WB 4I7ZC 1Y1WH 2QW7A 2UUCQ 5IWAL 1Y69U 2EE1A 2NVTH 1Y1VH 1YNJD 3RZDH 2EZVA 3Q22A 1V43A 3CF5A 1HQRD 3OIPA 3HOUB 3S1QB 1AE2A 3HKZE 4OEMB 3K5OA 3QG1A 2B63G 4A3BH 1LTBD 5C3EG 2CHBD 1HR0W 2A6HD 1IL8A 2VB2X 5BN4A 5I9PA 3G71A 1HRJA 2DY7A 4ZLTF 1FVIA 4KTAA 4DR2L 3TN2A 3HOZG 3KF6A 5BR8Q 3NWSA 3BJUA 3R93A 4B3ML 3L7ZC 1JQYD 1WTRA 1VQHA 5CV9A 1JE5A 1SXTA 2A68C 3R3OA 3SR1A 2WKCA 4JYAL 1XNQL 4DV4L 5C0XJ 2GA4B 4DUYL 1SYEA 3CC4A 2PPBC 1AH9A 2I5LX 2K5QA 3SDZA 4A3CG 1E1OA 3NXWA 2E8GA 3TMEA 1HZAA 4JI6L 3GV3A 2SNMA 1DYQA 1RDPD 1X54A 3WOFA 5GAEC 1S5FD 1WTQA 3MZ5A 2QKIC 3S2DH 3K0YA 1JB7A 3G7LA 3RUZA 4DAYB 2PQAB 1KHIA 4ZKBB 1LTLA 4HJ7A 1YHBA 1Q7YC 4A3GG 3K81C 1UEAB 1X3EA 4RWSC 5FKAC 1VQ9A 1HTPA 2F3VA 1CM9A 1NY4A 5CV7A 1PRTD 4WRDA 5LMNW 4IN3A 1I3QH 5EJWA 2X6GA 1SBBB 5I2YA 1PZJD 3NEMA 4QF4A 1UWVA 1R9TB 1JT8A 4F88A 1YVCA 2F0IA 3PO3B 4QY7A 4ZUIA 1B44D 1OO9B 1WI5A 1IXRA 3MWYW 2J4XA 3LNNA 1EIHA 1CT1D 2RCFA 4LF4Q 4RCOA 4CBVA 2J0TD 2L12A 4DNRB 3K7UC 4JI1L 3NPPA 2L11A 4IUVA 3CCVA 1S5ED 1NNXA 4DFAA 3MEFA 3ULJA 4N9TA 1QB5D 3QOLA 4RGOS 4A3JG 3CHBD 4LJZC 4KJOA 3IFDA 5LL6X 1NR2A 3RNUA 5KEEA 1NR4A 1ZKOA 1PH1A 2HCCA 3QO2A 3FDTA 3N6RA 3ULPA 3OHXC 4KHVA 2EXZA 2PNHA 5IYCG 2F03A 1A2UA 2OT2A 4IUNA 3VYUA 2KBNA 2K14A 2MFIA 5ISRA 2O2LD 2Q2IA 4DPGA 1JICA 4DR4L 5EKKA 3H3VC 2EXDA 3W1BA 3I4NB 5M3FB 1VF5C 4LF5Q 3KF8A 5M3MB 4DUZL 1CSQA 3FRPB 1C9OA 1K73C 4KN7C 4Y52H 5EBDA 5ELDA 1EEID 3OWEB 1EIYB 3CQZB 1XTDA 4LUZA 3F2DA 1PFNA 4K6DA 3K5NA 4DAVA 1K0RA 4CJ2C 2JN4A 4ZCKA 1F9SA 1I4XA 4DV7Q 4GOPA 1ET6A 2L55A 4G7HC 1PHJA 1HFNA 1Q8KA 2VB3X 2Q2HA 1D6EC 4AYBB 1DOKA 1VQDA 2K5WA 2ZTCA 4OWWB 3ICEA 1TXYA 4P2CB 5ELEA 2CCZA 1TS5A 1FJGQ 4WJ3M 1G91A 3DUZA 3J7ZC 3JC66 3J7A5 3KLWA 1KAAA 3GQBA 1U9RA 4L5TA 1K83B 4LFBQ 3IFTA 1EYGA 2KOLA 3CP0A 4KD3A 1NTGA 5M3MG 1G6ZA 4A3KG 2WAQG 4IO9A 1ICWA 1KAWA 2LSSA 1S5CD 5EAYA 4DXGA 1KTKA 4DR4Q 4X62Q 1IW7C 3FP9A 3MFGA 1IBKQ 3I4LA 4LF5L 4IFDH 3PUZA 2E74C 1C48A 2I5MX 4CDEC 3MAQA 1IKMA 3S24A 1G6PA 2IT1A 3S1MB 4DV6Q 5J3BA 1PTOF 4FXGC 3BZDB 3CKIB 1VQ6A 3HEJA 2RKSA 2NTTA 3C1FA 4KMUC 4NXNQ 1MBYA 4HIKA 4DV1L 2K5HA 3HOWH 3Q6SA 4OGQC 1H9SA 3J81i 3UI2A 3OW7A 3A55A 4B9XA 5T1GA 1TWFB 5E7NA 3CC2A 2KECA 3QJYA 3T1HQ 1BVSA 1RODA 2HIVA 4KI0A 3S1NB 2UUAL 1LTRD 4QCLA 1W3SA 3OMCA 1WOCA 5AJ3L 4Z9CB 4Y7NB 4PZ7A 1AFPA 1DOMA 1VQOA 2WAQB 4EQPA 4IALA 2VY3A 1HUMA 4OIJA 4JI0L 3Q24A 2FHTA 3M9BA 1GKHA 2Q8TA 2VQFL 5HY6A 4O1NA 2ZM6L 3JAMc 3HFZB 3MEHA 3D4WA 1KL9A 2OEOA 4A3IG 1KDCA 1Z9FA 3FKIB 5JAVA 3KYHC 4A3MB 4JI3L 1EZ6A 5LMUQ 1EQTA 4LK1C 3VYTA 4GN3B 2PW5A 5C4ZA 4POGA 1BOSA 3AQQA 1PFSA 3D31A 2O4XA 1PH8A 1RTNA 3DHQA 3PIPA 2HD3A 1SMYC 1YHQA 2UXCQ 2YTYA 5LMNL 1OTCA 4B3SQ 3EFXD 3CXCA 3MXNA 1PH4A 2JA7G 2KJXA 2QCPX 2B2VC 1PH5A 3EN2A 2Z6BA 4JBMA 1EEFD 2FMMA 2IY5B 2XTIA 1BO0A 5KNBA 2VUMG 1N34L 2XVSA 4P72A 1EWHA 1MSGA 3T56B 3K7AB 1HA6A 4RGMA 4A3IH 1D8LA 4KHPQ 3I3CA 3K58A 3GTGB 4ULLA 4RFBA 4A3MG 3W1GA 1NJIC 1PH7A 2ASBA 4UDUC 1XNQQ 1U5KA 1VMCA 5E1FA 1X55A 5E4WC 1XJVA 1F9PA 2HDLA 5I2XA 1YJ9A 1PA6A 3J80E 5ELBA 3AFPA 2IX1A 2VW9A 1R9TH 1O80A 3EQLC 3FKIH 5IGGA 4UP9A 3I4MH 1PRTC 3MXPA 4EQNA 4C3IB 3LWEA 1EU3A 4TRDA 1QUQA 1Q82C 3BU2A 3NTIA 1Y1WG 2AWOA 3J80c 3KBXA 1PYWD 1G291 1K3BC 4R4QA 4RMFA 3BVGA 4DR7Q 1YITA 2VUMH 1D7QA 5M5WH 3RLOA 3UDGA 1X3QA 2L0CA 3CCMA 1AN8A 3D6CA 4Q5VA 1EY9A 5HURA 2HUGA 4X3TA 3MC0B 2UXBQ 4Q0FA 2RHSB 3TP7A 4LUOA 1GUWA 1K8OA 1TWCH 4GKJQ 2WAQE 3KDFA 1WTOA 3K80C 1BBXC 1FGBD 2A74C 4DKAC 3R2IA 3A7LA 5I4DA 1ENAA 5GAHC 1ESFA 2K6AA 5KYIA 4ME5A 4QIWE 4C3IG 3SK4A 3GV6A 2UXDQ 3E0EA 5LHY1 1EQRA 2MHVA 4EQOA 1HH2P 1V8QA 4FF4A 1FNVA 1I3QB 3AFQA 2I5HA 1Y8PB 5I6YA 5J22A 4BWGB 1F9QA 2Q8RE 3KF8B 2PZUA 1WCMG 1VQFA 2F0LA 5EGTA 1O7LA 1D2BA 2K50A 1DOLA 2KVMA 3CAMA 5AJ3Q 4JV5L 4KV6A 1QCBD 4NP5A 1TWCB 2BOSA 4A3CH 4QMGA 4POFA 1XPRA 2ALYB 3V96A 1LTID 3RMHA 5KIXA 1X3FA 4XYOA 2Z1CA 3T1YL 4A3LH 1CZWA 1GOZA 1GO3E 1I94L 4PMBA 3HOWG 1S40A 2F0EA 1LTGD 3I55A 3EVQA 2FINB 5CGKA 1II3A 2RSOA 5IT9E 4XT3B 1M1KC 1PZID 2JEBI 1Y8OB 2F0PA 2B2TA 4WJWA 1GVPA 3HOXB 4YCVA 2E2IH 2B39A 3CCLA 4MTNA 3ONAB 1J9OA 4QGUA 1BCPF 1GUTA 3L9AX 1D1KA 2EVBA 3PIP3 2SNSA 2PO4A 4OWTB
chains in the Genus database with same CATH topology
3K0XA 1E22A 1YNXA 5ELOA 2RHQB 5FJ8G 2B63G 4DV7L 3PUVA 2KENA 1JJ2A 4A3BH 1K8AC 5C3EG 4LF9L 1N36Q 1C0AA 1HR0W 1JJGA 4JG2A 1H95A 1MJCA 2YTVA 2NVQH 3WWVA 3OTOL 3G71A 1C7YA 1OXSC 4DV0L 4LFCL 3CPWA 4BBRG 5H1SE 4BA1I 1XPOA 1SFOH 3KF6B 1KRSA 1FVIA 4DR2L 3GO5A 4XIGS 2HQLA 3HOZG 3GDEA 3KF6A 3I4OA 1UE6A 5BR8Q 4GLXA 3T1YQ 1Y14B 5C3EH 3BJUA 1NE3A 3S15H 2JA8G 5FLXc 1JJCB 5C0XG 4B3ML 3L7ZC 2JA7H 1E24A 4PZ8A 1VQHA 3W5OA 1JE5A 4GN5A 1I94Q 4JYAL 3CCUA 2HT1A 2IX0A 1XNQL 4DV4L 5C0XJ 2JJQA 4DUYL 4GNXB 4C3HH 1HNXL 2BH2A 2CKZB 2NVYH 4PG3A 3A5UA 1KRTA 3CC4A 2EIFA 2JK8A 3G48A 4OXPA 3ZJYC 1YJNA 1QZGA 2KHJA 4LF4L 3I4NH 2I5LX 4P73A 2UUCL 3PO3G 1AH9A 4LW1A 1IBLQ 1OXUA 1OXVA 2ATWA 4A3CG 4DV2L 2N8NA 3EBEA 4A3GH 1E1OA 2K4KA 2E8GA 1HZAA 4JI6L 1UE1A 3TS0A 1RL2A 3RN2A 2ZTDA 2BH8A 3EIVA 2NZHA 4GLVB 4O2DA 4JI7L 2JEAI 4K0KL 1X54A 1IZ6A 1X3GA 5GAEC 1SN8A 3RLFA 2PMZE 4C2MH 1UEBA 3U58A 3S1QH 3S2DH 2PQAA 2FXQA 2JQOA 1JB7A 4IPHA 4DAYB 1L1OB 3U4VA 3OW2A 4NB3A 2PQAB 1VQ7A 1KHIA 4WJ4A 1LTLA 2R7FA 4HJ7A 4DR5L 2PI2A 1KIXA 5IYBH 1YHBA 4DV5L 5DLQE 1FL0A 1Q7YC 1EFWA 1VQAA 3KOJA 4A3GG 4R4OA 3K81C 1X3EA 1X9NA 3UE1A 2LXJA 4X64Q 2NN6I 4DV0Q 1VQ9A 2WP8J 1NY4A 4OONA 3U4ZA 4X6AH 5LMNW 3NBHB 1I3QH 1WYDA 2MO1A 1CSPA 5ELNA 5FJ8H 1XMQL 1VQLA 3MXNB 4IFDG 1HNWQ 4JI0Q 3NEMA 3KDFB 1SROA 1UWVA 3HOXH 5GQOA 1IBMQ 1JT8A 1YVCA 4LF7Q 4QY7A 2ZM6Q 2F4VQ 2YU9H 1TWFH 4B3RL 1WI5A 1IXRA 3CCJA 1L2FA 1PYBA 1YZ6A 2UXDL 4YHHQ 4OX9Q 3J81c 1HNXQ 1LUZA 2RF4A 3F1ZA 1B7YB 3B6YA 4AQYL 4JI4Q 3HOVH 2KHIA 4LF4Q 2F52A 4X65Q 4JI3Q 4BY1G 1MIUA 2QEXA 4A3FH 4DR6Q 5IYCH 3STBD 3K7UC 4JI1L 2LXKA 1LYLA 3GTLH 4APVA 1TWAH 1A62A 2AHOB 5M3FH 4JI6Q 5K36G 3CCVA 4HJ9A 1PV4A 3G6EA 3K8AA 3MEFA 1VQGA 3ULJA 2D0PA 1FJGL 4A3JG 4JV5Q 3PUYA 2IHFA 4GNXA 1HR0Q 3M7NA 4BY7H 1VQKA 3RNUA 1PH1A 2DUDA 4C3IH 1VQPA 4DK6C 1X56A 4BXXG 1Q1EA 3ULPA 2PNHA 5IYCG 2QA4A 5IP7H 4A93G 2IHEA 1E3PA 1T9HA 2YYZA 3FHWA 5IT9c 1VS0A 2KBNA 4X66Q 2K14A 2MFIA 3CPFA 2OCEA 2Q2IA 4DPGA 5IY0A 4A3JH 4HJ8A 4DR4L 3L0OA 1B8AA 4A76A 4IPDA 1GM5A 3I56A 2EXDA 3W1BA 2E2JH 4LF8Q 5IWAQ 1XMQQ 3S1MH 4LF5Q 4YWLA 3HOZH 4KHPL 4DUZL 1CSQA 2YTXA 1EWIA 1C9OA 1K73C 4EQ5A 1S3OA 4DK3C 3F8TA 3CC7A 5IYDG 4Y52H 3AEVA 4B3RQ 1QVCA 2MNAA 1EIYB 4NXMQ 3H3VH 4NPSA 2NZOA 4LUZA 1XTDA 4R4CA 3F2DA 1PH2A 3KJOA 4JI2L 4IFDI 2ZJQA 1PVOA 1SLJA 4NXNL 3RR5A 1RIPA 1K0RA 4DV1Q 1WJJA 3HKSA 4IJHA 4DV7Q 1HZ9A 4GOPA 4UPAA 4DR6L 1KC8C 1PHJA 2R7ZH 1Q8KA 4BY7G 1XMOQ 2Q2HA 4GOPB 2Q2UA 3T1HL 3H0GG 1PH9A 4L5SA 1YI2A 1VQDA 3TRZA 5M5XH 4LF6Q 2ZTCA 4OWWB 3ICEA 1TXYA 3OTOQ 3D0FA 2CCZA 5GADC 4OO1G 2JE6I 1FJGQ 3PF4A 4LFCQ 3J80i 3CW2C 4HJ5A 4WJ3M 2NN6G 4A3DH 3J7ZC 3JC66 3J7A5 3KLWA 4DR2Q 1CKNB 1EQQA 1Q81C 1PH6A 2UUBQ 2EQSA 4A3FG 2A1AA 4L5TA 4LFBQ 1A0IA 1TWGH 4IFDJ 3ULLA 4GS3A 4DR3L 4B3TQ 1EYGA 4A3EH 3GTJH 3I4NG 4GKKQ 3CP0A 1I50H 1NTGA 3KFUA 3PO3H 5M3MG 4A3KG 2VNUD 2QGQA 2WAQG 4A4IA 1J6QA 4IO9A 1KAWA 1I5FA 2LSSA 3PCOB 4JCVE 5EAYA 4DUYQ 1B70B 3F2BA 3HOUH 1YJWA 1J5EL 2UU9L 4DR4Q 5JJKA 2R92H 2HIXA 2GVAA 4X62Q 4RG1A 3H15A 3FP9A 2OQKA 5IP9H 3PIOA 3H3VI 1IBKQ 4LF8L 3PSIA 3I4MG 4GKJL 2CQOA 5IE8A 1IBLL 4LF5L 1I6HH 4L5QA 4YCWA 2L15A 1VCIA 2Z0SA 3PUZA 4YWKA 4DUZQ 2I5MX 4DV2Q 2N49A 1L1OC 4YCUA 2H5XA 3S24A 1N32Q 2IT1A 3A74A 3NELA 1G6PA 3F2CA 4JC0A 4DV6Q 5HGQA 3S17H 5J3BA 4FDBA 4P71A 4JI7Q 1EUJA 4BXXH 4K0KQ 3CCRA 1BKBA 1VQ6A 4JI2Q 3STBC 3GTOH 4A75A 2D62A 4UP7A 5LMNQ 3H0GH 2OWOA 1IYJB 4B3SL 4NXNQ 3M4OH 4HIKA 2CWAA 4DV1L 2HHHQ 5IP9G 4O0AA 4YY3L 1YHAA 2K5HA 3HOWH 3GTMH 1PH3A 3HOYH 3GTQH 3J81i 1VQ5A 3G4SA 3M4QA 4LFAQ 5JEAJ 3TREA 1XMOL 3TQYA 4ALPA 5E7NA 4DR1L 3T1HQ 3CC2A 3I2ZA 1BVSA 1VQJA 5M3FG 4BBSH 4QQBX 4PZ6A 2HIVA 4KI0A 3K7AH 3CCSA 1KXLA 2UUAL 4X64L 1W3SA 5AJ3L 1WOCA 5C4XH 2VQEL 4A3EG 1UE5A 4PZ7A 4XTCS 1X6OA 1VQOA 2AKWB 1XPUA 1NMFA 2VY3A 1MKHA 2Q2TA 1HNZL 1HNWL 4JI0L 4LFBL 2MQHA 3M9BA 1GKHA 2VQFL 4L5RC 5HY6A 1KQSA 2K52A 1TWHH 2ZM6L 2JA5G 4P75A 3CCEA 1Z47A 2VZAA 3JAMc 1QVFA 2K5NA 3HFZB 1GD7A 3E9IA 2B29A 3PO2H 3U50C 1KL9A 4JI8Q 4A3IG 2VL6A 3GTKH 4ME3A 4YHHL 1Z9FA 1VQ4A 4LNQA 4AYBG 3GD7A 3GTPH 1Q46A 2ID0A 4LUVA 3KYHC 3UDIA 4X62L 1CKNA 4AQYQ 3PGZA 1A63A 4JI3L 4X65L 1NBWA 3CMEA 5LMUQ 1Q86C 4KHZA 2GVBA 4HJAA 2DGYA 4GN3B 1P8LA 4POGA 1YIJA 1ASYA 2R93H 3AQQA 4BBRH 4JBJA 2YV5A 1PFSA 3D31A 1EOVA 2JA9A 4YWMA 1LM0A 3DLLA 1N32L 1L0WA 3KJPA 5C44H 1PH8A 4OO1I 2KCTA 4DV6L 2F3IA 3PIPA 4DNIA 1VQCA 5GAGC 4DV3Q 1YHQA 1HR0L 2UXCQ 2YTYA 5LMNL 1OTCA 4B3SQ 3CXCA 2R6GA 1QZHA 1PH4A 1N33L 2JA7G 3S16H 3TS2A 4YY3Q 3S2HH 4H02A 4QL5A 4QJFA 3CCQA 4LF9Q 1JMCA 3M3YH 4P74A 5FLMH 2KCMA 4KLKA 1MJEA 1PH5A 3EN2A 1SMXA 2Z6KC 3AYHB 4R4TA 2K75A 4DR1Q 3HOVG 5JJIA 5C44G 1BBUA 2V1CC 2ZJPA 4UY8C 4JBMA 4BY1H 1OXTA 4X66L 3J81j 2IY5B 2XTIA 4EX5A 3UE0A 4DAMA 2UUAQ 2VUMG 2UXBL 1VQNA 1N34L 2VQEQ 4P72A 2Y0SE 5IYDH 3M85A 1G51A 2MO0A 4MZ9A 3S1NH 3PO2G 1HNZQ 4JBWA 2Y0SG 4Y7NH 4A3IH 3SGIA 4GLAC 1D8LA 4PMWA 4KHPQ 1VQIA 3TEHB 1VQBA 4A3MG 3W1GA 4B3MQ 3L2PA 2ES2A 1NJIC 1PH7A 3PUXA 2ASBA 1HZCA 3UDXA 5M3MH 4NXML 2R7ZG 2I0QA 1XNQQ 1U5KA 4DV4Q 1XNRL 4JI8L 2R93G 2AMCB 1X55A 4JOIC 5IP7G 4A93H 1XJVA 3ERSX 2K5VA 3UDFA 1CUKA 1YJ9A 1PA6A 3RLNA 3AFPA 2E5LQ 2NVXH 2IX1A 2VW9A 3RZOH 5LMUL 1R9TH 3BZCA 2VS1A 3CQZH 3FKIH 1BBWA 2XGTA 4IPGA 4UP9A 3I4MH 5C4XG 3E9HA 1CKOA 4A3DG 2AWNA 1QUQB 3M4PA 4A3MH 1SE8A 2JA5H 1QUQA 1HZBA 3BU2A 1Q82C 4LF6L 2A19A 2BA0A 1Y1WG 1CKMA 1Q12A 2AWOA 3J80c 4DV3L 2BA1A 1QVGA 4BA2I 1G291 1Q1BA 1K3RA 3HOXG 4R4QA 1A8VA 4RMFA 1N9WA 1X65A 3BZKA 1N33Q 4A3KH 2R7DA 4R1JA 3DM3A 4IOCA 1L1OA 2ZJRA 2UUBL 1YITA 4DR7Q 2VUMH 1D7QA 5M5WH 1UE7A 3PUWA 1DGSA 2N3SA 3FKIG 3RLOA 4DR5Q 4DR3Q 4DV5Q 3UDGA 4B3TL 4GKKL 3CCMA 1YBYA 2D0OA 1VQ8A 4AIMA 1E7ZA 1SR3A 4BBSG 2OQ0A 4JOIA 2OTJA 1K83H 4TQUS 4GNXC 1WFQA 2UXBQ 1KD1C 2RHSB 1N34Q 1N8RC 1J5EQ 2UU9Q 4MNOA 4LUOA 4GOPC 4LWCA 2OTLA 3A5ZB 2Z6KA 1IBKL 4AYBE 4JI5Q 1E1TA 4TVAB 1TWCH 4GKJQ 2WAQE 3KDFA 3CMAA 5GROA 5C0XI 3K80C 2JA6G 4IPCA 1VQMA 1K8GA 4J15A 4DKAC 2GN5A 1VQEA 2B3GA 4HIDA 3VDYA 1K9MC 1IBML 4LF7L 4C3JH 5GAHC 4HIOA 2F4VL 3HKZG 4QIWE 1XNRQ 2CFMA 3Q8DA 2UXDQ 4OX9L 3E0EA 1YEZA 2A8VA 2HHHL 1NMGA 1EQRA 2C35B 4JI4L 1HJPA 3PV0A 4HIMA 3S1RH 2E5LL 1HH2P 3ER0A 3AFQA 2I5HA 5IYBG 1N36L 3HOUG 4JI1Q 4LFAL 2PI2E 4GN4B 3PF5A 2JA8H 4UP8A 3IRBA 2JA6H 3KF8B 2R92G 1WCMG 1VQFA 1V1QA 5M5YH 2K50A 3CAMA 1P16A 4A3BG 5AJ3Q 4JV5L 3CD6A 4A3CH 2N78A 3NENA 1SRUA 1PYSB 4POFA 3I7FA 1XPRA 5JEAG 1M90C 2RCNA 4DR7L 2ALYB 5BR8L 1X3FA 3OYYA 1Y1VG 3T1YL 4A3LH 4AH6A 2VQFQ 1V9PA 3GTGH 5FLMG 2WB1E 1U0LA 4IJLA 1GO3E 3JAMi 1WCMH 1I94L 1OXXK 4JYAQ 4R4IA 3HOWG 4IOAA 1S72A 5C4JH 1S40A 2WFWA 2WB1G 1ASZA 3I55A 3HOYG 1AE3A 5JJLA 4JBKA 2B63H 1M1KC 2E2HH 2ZTEA 4JI5L 1Y1WH 1W2BA 2JEBI 5IWAL 2UUCQ 2NVTH 1Y1VH 4A3LG 1GVPA 3RZDH 4YCVA 2E2IH 3CCLA 1IL2A 4MTNA 3A0JA 1EIFA 1V43A 1FGUA 3CF5A 4QGUA 3RN5A 1O7IA 1AE2A 3HKZE 3S14H 2UXCL 2CWPA 3LGJA 4OWXB 4OWTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K0X A;  1E22 A;  1YNX A;  5ELO A;  2RHQ B;  5FJ8 G;  2B63 G;  4DV7 L;  3PUV A;  2KEN A;  1JJ2 A;  4A3B H;  1K8A C;  5C3E G;  4LF9 L;  1N36 Q;  1C0A A;  1HR0 W;  1JJG A;  4JG2 A;  1H95 A;  1MJC A;  2YTV A;  2NVQ H;  3WWV A;  3OTO L;  3G71 A;  1C7Y A;  1OXS C;  4DV0 L;  4LFC L;  3CPW A;  4BBR G;  5H1S E;  4BA1 I;  1XPO A;  1SFO H;  3KF6 B;  1KRS A;  1FVI A;  4DR2 L;  3GO5 A;  4XIG S;  2HQL A;  3HOZ G;  3GDE A;  3KF6 A;  3I4O A;  1UE6 A;  5BR8 Q;  4GLX A;  3T1Y Q;  1Y14 B;  5C3E H;  3BJU A;  1NE3 A;  3S15 H;  2JA8 G;  5FLX c;  1JJC B;  5C0X G;  4B3M L;  3L7Z C;  2JA7 H;  1E24 A;  4PZ8 A;  1VQH A;  3W5O A;  1JE5 A;  4GN5 A;  1I94 Q;  4JYA L;  3CCU A;  2HT1 A;  2IX0 A;  1XNQ L;  4DV4 L;  5C0X J;  2JJQ A;  4DUY L;  4GNX B;  4C3H H;  1HNX L;  2BH2 A;  2CKZ B;  2NVY H;  4PG3 A;  3A5U A;  1KRT A;  3CC4 A;  2EIF A;  2JK8 A;  3G48 A;  4OXP A;  3ZJY C;  1YJN A;  1QZG A;  2KHJ A;  4LF4 L;  3I4N H;  2I5L X;  4P73 A;  2UUC L;  3PO3 G;  1AH9 A;  4LW1 A;  1IBL Q;  1OXU A;  1OXV A;  2ATW A;  4A3C G;  4DV2 L;  2N8N A;  3EBE A;  4A3G H;  1E1O A;  2K4K A;  2E8G A;  1HZA A;  4JI6 L;  1UE1 A;  3TS0 A;  1RL2 A;  3RN2 A;  2ZTD A;  2BH8 A;  3EIV A;  2NZH A;  4GLV B;  4O2D A;  4JI7 L;  2JEA I;  4K0K L;  1X54 A;  1IZ6 A;  1X3G A;  5GAE C;  1SN8 A;  3RLF A;  2PMZ E;  4C2M H;  1UEB A;  3U58 A;  3S1Q H;  3S2D H;  2PQA A;  2FXQ A;  2JQO A;  1JB7 A;  4IPH A;  4DAY B;  1L1O B;  3U4V A;  3OW2 A;  4NB3 A;  2PQA B;  1VQ7 A;  1KHI A;  4WJ4 A;  1LTL A;  2R7F A;  4HJ7 A;  4DR5 L;  2PI2 A;  1KIX A;  5IYB H;  1YHB A;  4DV5 L;  5DLQ E;  1FL0 A;  1Q7Y C;  1EFW A;  1VQA A;  3KOJ A;  4A3G G;  4R4O A;  3K81 C;  1X3E A;  1X9N A;  3UE1 A;  2LXJ A;  4X64 Q;  2NN6 I;  4DV0 Q;  1VQ9 A;  2WP8 J;  1NY4 A;  4OON A;  3U4Z A;  4X6A H;  5LMN W;  3NBH B;  1I3Q H;  1WYD A;  2MO1 A;  1CSP A;  5ELN A;  5FJ8 H;  1XMQ L;  1VQL A;  3MXN B;  4IFD G;  1HNW Q;  4JI0 Q;  3NEM A;  3KDF B;  1SRO A;  1UWV A;  3HOX H;  5GQO A;  1IBM Q;  1JT8 A;  1YVC A;  4LF7 Q;  4QY7 A;  2ZM6 Q;  2F4V Q;  2YU9 H;  1TWF H;  4B3R L;  1WI5 A;  1IXR A;  3CCJ A;  1L2F A;  1PYB A;  1YZ6 A;  2UXD L;  4YHH Q;  4OX9 Q;  3J81 c;  1HNX Q;  1LUZ A;  2RF4 A;  3F1Z A;  1B7Y B;  3B6Y A;  4AQY L;  4JI4 Q;  3HOV H;  2KHI A;  4LF4 Q;  2F52 A;  4X65 Q;  4JI3 Q;  4BY1 G;  1MIU A;  2QEX A;  4A3F H;  4DR6 Q;  5IYC H;  3STB D;  3K7U C;  4JI1 L;  2LXK A;  1LYL A;  3GTL H;  4APV A;  1TWA H;  1A62 A;  2AHO B;  5M3F H;  4JI6 Q;  5K36 G;  3CCV A;  4HJ9 A;  1PV4 A;  3G6E A;  3K8A A;  3MEF A;  1VQG A;  3ULJ A;  2D0P A;  1FJG L;  4A3J G;  4JV5 Q;  3PUY A;  2IHF A;  4GNX A;  1HR0 Q;  3M7N A;  4BY7 H;  1VQK A;  3RNU A;  1PH1 A;  2DUD A;  4C3I H;  1VQP A;  4DK6 C;  1X56 A;  4BXX G;  1Q1E A;  3ULP A;  2PNH A;  5IYC G;  2QA4 A;  5IP7 H;  4A93 G;  2IHE A;  1E3P A;  1T9H A;  2YYZ A;  3FHW A;  5IT9 c;  1VS0 A;  2KBN A;  4X66 Q;  2K14 A;  2MFI A;  3CPF A;  2OCE A;  2Q2I A;  4DPG A;  5IY0 A;  4A3J H;  4HJ8 A;  4DR4 L;  3L0O A;  1B8A A;  4A76 A;  4IPD A;  1GM5 A;  3I56 A;  2EXD A;  3W1B A;  2E2J H;  4LF8 Q;  5IWA Q;  1XMQ Q;  3S1M H;  4LF5 Q;  4YWL A;  3HOZ H;  4KHP L;  4DUZ L;  1CSQ A;  2YTX A;  1EWI A;  1C9O A;  1K73 C;  4EQ5 A;  1S3O A;  4DK3 C;  3F8T A;  3CC7 A;  5IYD G;  4Y52 H;  3AEV A;  4B3R Q;  1QVC A;  2MNA A;  1EIY B;  4NXM Q;  3H3V H;  4NPS A;  2NZO A;  4LUZ A;  1XTD A;  4R4C A;  3F2D A;  1PH2 A;  3KJO A;  4JI2 L;  4IFD I;  2ZJQ A;  1PVO A;  1SLJ A;  4NXN L;  3RR5 A;  1RIP A;  1K0R A;  4DV1 Q;  1WJJ A;  3HKS A;  4IJH A;  4DV7 Q;  1HZ9 A;  4GOP A;  4UPA A;  4DR6 L;  1KC8 C;  1PHJ A;  2R7Z H;  1Q8K A;  4BY7 G;  1XMO Q;  2Q2H A;  4GOP B;  2Q2U A;  3T1H L;  3H0G G;  1PH9 A;  4L5S A;  1YI2 A;  1VQD A;  3TRZ A;  5M5X H;  4LF6 Q;  2ZTC A;  4OWW B;  3ICE A;  1TXY A;  3OTO Q;  3D0F A;  2CCZ A;  5GAD C;  4OO1 G;  2JE6 I;  1FJG Q;  3PF4 A;  4LFC Q;  3J80 i;  3CW2 C;  4HJ5 A;  4WJ3 M;  2NN6 G;  4A3D H;  3J7Z C;  3JC6 6;  3J7A 5;  3KLW A;  4DR2 Q;  1CKN B;  1EQQ A;  1Q81 C;  1PH6 A;  2UUB Q;  2EQS A;  4A3F G;  2A1A A;  4L5T A;  4LFB Q;  1A0I A;  1TWG H;  4IFD J;  3ULL A;  4GS3 A;  4DR3 L;  4B3T Q;  1EYG A;  4A3E H;  3GTJ H;  3I4N G;  4GKK Q;  3CP0 A;  1I50 H;  1NTG A;  3KFU A;  3PO3 H;  5M3M G;  4A3K G;  2VNU D;  2QGQ A;  2WAQ G;  4A4I A;  1J6Q A;  4IO9 A;  1KAW A;  1I5F A;  2LSS A;  3PCO B;  4JCV E;  5EAY A;  4DUY Q;  1B70 B;  3F2B A;  3HOU H;  1YJW A;  1J5E L;  2UU9 L;  4DR4 Q;  5JJK A;  2R92 H;  2HIX A;  2GVA A;  4X62 Q;  4RG1 A;  3H15 A;  3FP9 A;  2OQK A;  5IP9 H;  3PIO A;  3H3V I;  1IBK Q;  4LF8 L;  3PSI A;  3I4M G;  4GKJ L;  2CQO A;  5IE8 A;  1IBL L;  4LF5 L;  1I6H H;  4L5Q A;  4YCW A;  2L15 A;  1VCI A;  2Z0S A;  3PUZ A;  4YWK A;  4DUZ Q;  2I5M X;  4DV2 Q;  2N49 A;  1L1O C;  4YCU A;  2H5X A;  3S24 A;  1N32 Q;  2IT1 A;  3A74 A;  3NEL A;  1G6P A;  3F2C A;  4JC0 A;  4DV6 Q;  5HGQ A;  3S17 H;  5J3B A;  4FDB A;  4P71 A;  4JI7 Q;  1EUJ A;  4BXX H;  4K0K Q;  3CCR A;  1BKB A;  1VQ6 A;  4JI2 Q;  3STB C;  3GTO H;  4A75 A;  2D62 A;  4UP7 A;  5LMN Q;  3H0G H;  2OWO A;  1IYJ B;  4B3S L;  4NXN Q;  3M4O H;  4HIK A;  2CWA A;  4DV1 L;  2HHH Q;  5IP9 G;  4O0A A;  4YY3 L;  1YHA A;  2K5H A;  3HOW H;  3GTM H;  1PH3 A;  3HOY H;  3GTQ H;  3J81 i;  1VQ5 A;  3G4S A;  3M4Q A;  4LFA Q;  5JEA J;  3TRE A;  1XMO L;  3TQY A;  4ALP A;  5E7N A;  4DR1 L;  3T1H Q;  3CC2 A;  3I2Z A;  1BVS A;  1VQJ A;  5M3F G;  4BBS H;  4QQB X;  4PZ6 A;  2HIV A;  4KI0 A;  3K7A H;  3CCS A;  1KXL A;  2UUA L;  4X64 L;  1W3S A;  5AJ3 L;  1WOC A;  5C4X H;  2VQE L;  4A3E G;  1UE5 A;  4PZ7 A;  4XTC S;  1X6O A;  1VQO A;  2AKW B;  1XPU A;  1NMF A;  2VY3 A;  1MKH A;  2Q2T A;  1HNZ L;  1HNW L;  4JI0 L;  4LFB L;  2MQH A;  3M9B A;  1GKH A;  2VQF L;  4L5R C;  5HY6 A;  1KQS A;  2K52 A;  1TWH H;  2ZM6 L;  2JA5 G;  4P75 A;  3CCE A;  1Z47 A;  2VZA A;  3JAM c;  1QVF A;  2K5N A;  3HFZ B;  1GD7 A;  3E9I A;  2B29 A;  3PO2 H;  3U50 C;  1KL9 A;  4JI8 Q;  4A3I G;  2VL6 A;  3GTK H;  4ME3 A;  4YHH L;  1Z9F A;  1VQ4 A;  4LNQ A;  4AYB G;  3GD7 A;  3GTP H;  1Q46 A;  2ID0 A;  4LUV A;  3KYH C;  3UDI A;  4X62 L;  1CKN A;  4AQY Q;  3PGZ A;  1A63 A;  4JI3 L;  4X65 L;  1NBW A;  3CME A;  5LMU Q;  1Q86 C;  4KHZ A;  2GVB A;  4HJA A;  2DGY A;  4GN3 B;  1P8L A;  4POG A;  1YIJ A;  1ASY A;  2R93 H;  3AQQ A;  4BBR H;  4JBJ A;  2YV5 A;  1PFS A;  3D31 A;  1EOV A;  2JA9 A;  4YWM A;  1LM0 A;  3DLL A;  1N32 L;  1L0W A;  3KJP A;  5C44 H;  1PH8 A;  4OO1 I;  2KCT A;  4DV6 L;  2F3I A;  3PIP A;  4DNI A;  1VQC A;  5GAG C;  4DV3 Q;  1YHQ A;  1HR0 L;  2UXC Q;  2YTY A;  5LMN L;  1OTC A;  4B3S Q;  3CXC A;  2R6G A;  1QZH A;  1PH4 A;  1N33 L;  2JA7 G;  3S16 H;  3TS2 A;  4YY3 Q;  3S2H H;  4H02 A;  4QL5 A;  4QJF A;  3CCQ A;  4LF9 Q;  1JMC A;  3M3Y H;  4P74 A;  5FLM H;  2KCM A;  4KLK A;  1MJE A;  1PH5 A;  3EN2 A;  1SMX A;  2Z6K C;  3AYH B;  4R4T A;  2K75 A;  4DR1 Q;  3HOV G;  5JJI A;  5C44 G;  1BBU A;  2V1C C;  2ZJP A;  4UY8 C;  4JBM A;  4BY1 H;  1OXT A;  4X66 L;  3J81 j;  2IY5 B;  2XTI A;  4EX5 A;  3UE0 A;  4DAM A;  2UUA Q;  2VUM G;  2UXB L;  1VQN A;  1N34 L;  2VQE Q;  4P72 A;  2Y0S E;  5IYD H;  3M85 A;  1G51 A;  2MO0 A;  4MZ9 A;  3S1N H;  3PO2 G;  1HNZ Q;  4JBW A;  2Y0S G;  4Y7N H;  4A3I H;  3SGI A;  4GLA C;  1D8L A;  4PMW A;  4KHP Q;  1VQI A;  3TEH B;  1VQB A;  4A3M G;  3W1G A;  4B3M Q;  3L2P A;  2ES2 A;  1NJI C;  1PH7 A;  3PUX A;  2ASB A;  1HZC A;  3UDX A;  5M3M H;  4NXM L;  2R7Z G;  2I0Q A;  1XNQ Q;  1U5K A;  4DV4 Q;  1XNR L;  4JI8 L;  2R93 G;  2AMC B;  1X55 A;  4JOI C;  5IP7 G;  4A93 H;  1XJV A;  3ERS X;  2K5V A;  3UDF A;  1CUK A;  1YJ9 A;  1PA6 A;  3RLN A;  3AFP A;  2E5L Q;  2NVX H;  2IX1 A;  2VW9 A;  3RZO H;  5LMU L;  1R9T H;  3BZC A;  2VS1 A;  3CQZ H;  3FKI H;  1BBW A;  2XGT A;  4IPG A;  4UP9 A;  3I4M H;  5C4X G;  3E9H A;  1CKO A;  4A3D G;  2AWN A;  1QUQ B;  3M4P A;  4A3M H;  1SE8 A;  2JA5 H;  1QUQ A;  1HZB A;  3BU2 A;  1Q82 C;  4LF6 L;  2A19 A;  2BA0 A;  1Y1W G;  1CKM A;  1Q12 A;  2AWO A;  3J80 c;  4DV3 L;  2BA1 A;  1QVG A;  4BA2 I;  1G29 1;  1Q1B A;  1K3R A;  3HOX G;  4R4Q A;  1A8V A;  4RMF A;  1N9W A;  1X65 A;  3BZK A;  1N33 Q;  4A3K H;  2R7D A;  4R1J A;  3DM3 A;  4IOC A;  1L1O A;  2ZJR A;  2UUB L;  1YIT A;  4DR7 Q;  2VUM H;  1D7Q A;  5M5W H;  1UE7 A;  3PUW A;  1DGS A;  2N3S A;  3FKI G;  3RLO A;  4DR5 Q;  4DR3 Q;  4DV5 Q;  3UDG A;  4B3T L;  4GKK L;  3CCM A;  1YBY A;  2D0O A;  1VQ8 A;  4AIM A;  1E7Z A;  1SR3 A;  4BBS G;  2OQ0 A;  4JOI A;  2OTJ A;  1K83 H;  4TQU S;  4GNX C;  1WFQ A;  2UXB Q;  1KD1 C;  2RHS B;  1N34 Q;  1N8R C;  1J5E Q;  2UU9 Q;  4MNO A;  4LUO A;  4GOP C;  4LWC A;  2OTL A;  3A5Z B;  2Z6K A;  1IBK L;  4AYB E;  4JI5 Q;  1E1T A;  4TVA B;  1TWC H;  4GKJ Q;  2WAQ E;  3KDF A;  3CMA A;  5GRO A;  5C0X I;  3K80 C;  2JA6 G;  4IPC A;  1VQM A;  1K8G A;  4J15 A;  4DKA C;  2GN5 A;  1VQE A;  2B3G A;  4HID A;  3VDY A;  1K9M C;  1IBM L;  4LF7 L;  4C3J H;  5GAH C;  4HIO A;  2F4V L;  3HKZ G;  4QIW E;  1XNR Q;  2CFM A;  3Q8D A;  2UXD Q;  4OX9 L;  3E0E A;  1YEZ A;  2A8V A;  2HHH L;  1NMG A;  1EQR A;  2C35 B;  4JI4 L;  1HJP A;  3PV0 A;  4HIM A;  3S1R H;  2E5L L;  1HH2 P;  3ER0 A;  3AFQ A;  2I5H A;  5IYB G;  1N36 L;  3HOU G;  4JI1 Q;  4LFA L;  2PI2 E;  4GN4 B;  3PF5 A;  2JA8 H;  4UP8 A;  3IRB A;  2JA6 H;  3KF8 B;  2R92 G;  1WCM G;  1VQF A;  1V1Q A;  5M5Y H;  2K50 A;  3CAM A;  1P16 A;  4A3B G;  5AJ3 Q;  4JV5 L;  3CD6 A;  4A3C H;  2N78 A;  3NEN A;  1SRU A;  1PYS B;  4POF A;  3I7F A;  1XPR A;  5JEA G;  1M90 C;  2RCN A;  4DR7 L;  2ALY B;  5BR8 L;  1X3F A;  3OYY A;  1Y1V G;  3T1Y L;  4A3L H;  4AH6 A;  2VQF Q;  1V9P A;  3GTG H;  5FLM G;  2WB1 E;  1U0L A;  4IJL A;  1GO3 E;  3JAM i;  1WCM H;  1I94 L;  1OXX K;  4JYA Q;  4R4I A;  3HOW G;  4IOA A;  1S72 A;  5C4J H;  1S40 A;  2WFW A;  2WB1 G;  1ASZ A;  3I55 A;  3HOY G;  1AE3 A;  5JJL A;  4JBK A;  2B63 H;  1M1K C;  2E2H H;  2ZTE A;  4JI5 L;  1Y1W H;  1W2B A;  2JEB I;  5IWA L;  2UUC Q;  2NVT H;  1Y1V H;  4A3L G;  1GVP A;  3RZD H;  4YCV A;  2E2I H;  3CCL A;  1IL2 A;  4MTN A;  3A0J A;  1EIF A;  1V43 A;  1FGU A;  3CF5 A;  4QGU A;  3RN5 A;  1O7I A;  1AE2 A;  3HKZ E;  3S14 H;  2UXC L;  2CWP A;  3LGJ A;  4OWX B;  4OWT B; 
#chains in the Genus database with same CATH topology
 3K0X A;  2KEN A;  3DMU A;  4F8M A;  1N36 Q;  1C0A A;  5L37 A;  1TWA B;  4CJ1 B;  1JJG A;  1H95 A;  2XSC A;  2AQ3 B;  1AZP A;  3BVM A;  1MSH A;  4DV0 L;  1SFO H;  2EY1 A;  1KRS A;  3T13 A;  3WDN A;  5KNC A;  3HOY B;  3GO5 A;  2LY7 A;  2HQL A;  3GDE A;  1UE6 A;  5IGD A;  4GLX A;  1AZQ A;  1JC7 A;  1WTP A;  2RDG A;  5FLX c;  2JA7 H;  1BCP B;  2Q8I B;  3W5O A;  1EY0 A;  4L63 B;  2IX0 A;  1U4P A;  4C3H H;  2BH2 A;  3A5U A;  2EIF A;  2JK8 A;  3G48 A;  4DN4 M;  1YJN A;  2B2V A;  4LF4 L;  2KHJ A;  3PO3 G;  4P73 A;  2UUC L;  1IBL Q;  5JPM C;  2ATW A;  3OIQ A;  1D1I A;  2N8N A;  3EBE A;  3KLS X;  3GTO B;  5ELC A;  4NW2 A;  4C3J G;  2BH8 A;  1Y1V B;  3EIV A;  2JEA I;  3NQT A;  2QF7 A;  4O2D A;  1IZ6 A;  1SN8 A;  3S1Q H;  4RHR A;  4DK0 A;  2PQA A;  3S2D B;  3IKJ A;  1MD2 D;  1VQ7 A;  5DM7 3;  4DR5 L;  2PI2 A;  4DV5 L;  5EKI A;  1FL0 A;  3K57 A;  1SEB D;  1X9N A;  1IYU A;  2EDG A;  3BDL A;  4X64 Q;  1B1Z A;  2NN6 I;  4K6L A;  2WP8 J;  1U4M A;  4OON A;  2MGS A;  1KNE A;  3U4Z A;  1WYD A;  4IFD G;  1VQL A;  3MXN B;  2EYJ A;  1SYB A;  1PFB A;  1SRO A;  1QG7 A;  3MXU A;  1IBM Q;  2ENB A;  1I50 B;  1EYA A;  4E6I A;  4KD4 A;  2YU9 H;  5K36 H;  1TWF H;  4B3R L;  3SHL A;  4K5W A;  3CCJ A;  1L2F A;  1PYB A;  1YZ6 A;  4I65 A;  2UXD L;  4HR7 B;  4OX9 Q;  3J81 c;  5TSS A;  1HNX Q;  4U68 A;  3F1Z A;  2F52 A;  4JI3 Q;  2QEX A;  4A3K B;  4DR6 Q;  3STB D;  1EIG A;  4APV A;  2X6L A;  4UAI A;  1T5X D;  2K03 A;  2IJ0 A;  4HJ9 A;  1QOH A;  3G6E A;  2WII B;  4IQZ A;  4GNX A;  3M7N A;  3SK8 A;  4XQN A;  3NE5 B;  4KY5 A;  2DUD A;  1TS4 A;  3N52 A;  4C3I H;  3PIO 3;  2QA4 A;  1F77 A;  5D14 A;  5CV8 A;  1YNN D;  2JYO A;  2YYZ A;  3FHW A;  2NBF A;  3HZX A;  5DEH A;  2C5C A;  2L1B A;  3TBI B;  4FP5 D;  4V19 0;  4J6H A;  2DNE A;  5IY0 A;  4K2L A;  4IPD A;  3I56 A;  2E2J H;  1GJX A;  5IWA Q;  1D5Z C;  4F7X A;  2YTX A;  2PZW A;  2XRS D;  1E0B A;  4EQ5 A;  3F8T A;  4B08 A;  3A8I E;  1RCV D;  4ZQ3 A;  4NPS A;  3L3O C;  3KJO A;  4JI2 L;  1PTO D;  1SLJ A;  4NXN L;  3RR5 A;  4FF1 A;  1RIP A;  3GTP B;  1JOR A;  1WJJ A;  2EYH A;  2RDF A;  2JA5 B;  3M4Y A;  1STY A;  1ILQ A;  1KC8 C;  1XMO Q;  4A3I B;  2F0N A;  3H0G G;  2X69 A;  3TRZ A;  2K01 A;  2F0O A;  1EL0 A;  4MIU A;  5GAD C;  4OO1 G;  2JE6 I;  2QDB A;  5CYU A;  2EPB A;  4DR2 Q;  1CKN B;  1XX8 A;  1O7Z A;  4QUF A;  1A0I A;  4TKO B;  4GS3 A;  4DR3 L;  4B3T Q;  1MGS A;  3KFU A;  4KK7 A;  2VNU D;  4A4I A;  1J6Q A;  2M9V A;  3PCO B;  3S15 B;  4I7A A;  2G5D A;  2R92 H;  2GVA A;  3Q0A A;  1F2M A;  3H15 A;  5IP9 H;  3PIO A;  3I4M G;  5IE8 A;  1SYF A;  4YCW A;  2L15 A;  1VCI A;  4DUZ Q;  4YWK A;  3A8K E;  1JWM D;  3J80 L;  5M5W B;  1MHW C;  3NEL A;  3K5L A;  4P71 A;  4K8J A;  3A8J E;  4JI7 Q;  1BKB A;  4CDF C;  4A93 B;  3STB C;  4XQJ A;  3H0G H;  4B3S L;  3BDC A;  4XT1 B;  2CWA A;  2NVX B;  4ABN A;  4O0A A;  4YY3 L;  4ZUJ A;  3URY A;  2IPK D;  3HOY H;  3GTQ H;  3K59 A;  3G4S A;  3M4Q A;  3TQY A;  3SEB A;  1XYI A;  4RCN A;  1H9R A;  1R4P B;  1JCK B;  2NB0 A;  4X64 L;  2B2W C;  1TS3 A;  3NBH A;  1HNZ L;  2Q2T A;  4U67 3;  4NDX A;  1ET9 A;  3HG9 A;  1HHV A;  1CHP D;  4L5R C;  4XXE A;  2K52 A;  4ZK9 B;  1AEX A;  1Z47 A;  2VZA A;  3QR8 A;  3ERQ A;  1LV9 A;  3PO2 H;  3MVV A;  3U50 C;  4YHH L;  3BS1 A;  3GD7 A;  5M9O A;  1Q46 A;  4LUV A;  1B9N A;  2BDO A;  1CKN A;  4DNT B;  3PGZ A;  1Q86 C;  4C2M B;  3P1H A;  2GVB A;  1YIJ A;  3NUC A;  2YV5 A;  1SNO A;  1Q3L A;  1EOV A;  1TU2 B;  3DLL A;  4A3F B;  1AW7 A;  4K2K A;  4DV6 L;  5M5X B;  5GAG C;  1A3U A;  1HR0 L;  4KKS A;  1SYD A;  3T51 B;  1QZH A;  4QIW B;  1QE6 A;  3E3X A;  3S16 H;  5NUC A;  4YY3 Q;  3O13 A;  3CCQ A;  1JB3 A;  1JMC A;  4LF9 Q;  3MFY A;  4KLK A;  5KND A;  1MJE A;  3F2U A;  2Z6K C;  3AYH B;  4DR1 Q;  3GTJ B;  1EY8 A;  3EA6 A;  1BBU A;  1SE2 A;  4X66 L;  4MN3 A;  2RA4 A;  3KLS A;  4EX5 A;  2UUA Q;  1I4G A;  2UXB L;  4F87 A;  3ZYY X;  4JW0 A;  2BCO A;  1IHZ A;  1EY6 A;  2K7V A;  3M85 A;  1GUG A;  4MZ9 A;  4UHV A;  3S1N H;  1TY0 A;  1HNZ Q;  3PO2 G;  4Y7N H;  2LMC B;  4M1U B;  1R4Q B;  2IW3 A;  1B50 A;  2KED A;  3FMC A;  1K28 A;  2ES2 A;  3PUX A;  1XXG A;  5KRU A;  4NXM L;  2P5Z X;  4JI8 L;  2AMC B;  1V1P A;  1JR0 D;  1QNK A;  1IKL A;  3ERS X;  3M7G A;  1LAB A;  3RLN A;  2K04 A;  2E5L Q;  5LMU L;  4R9W A;  4A3E B;  2IWH A;  1CKO A;  2HDM A;  2YU9 B;  4A3M H;  2SDF A;  1X3P A;  4LF6 L;  1F2Z A;  2A19 A;  2BE5 C;  3HRZ C;  4DV3 L;  2BA1 A;  3HOV B;  4BA2 I;  1Q1B A;  3HOX G;  1LTS D;  1N9W A;  2EY2 A;  2TMP A;  1N33 Q;  3HGB A;  4A3K H;  1PDQ A;  4IOC A;  1L1O A;  1WCM B;  3I73 A;  5FO9 B;  3SK6 A;  2N3S A;  1ML0 D;  1YBY A;  1FNU A;  2D0O A;  3VR2 A;  1QJO A;  4J8Q A;  2AUK A;  4G7Z C;  3C46 A;  1HQM C;  4TSS A;  4X3U A;  2B63 B;  1BR9 A;  4GNX C;  1A2T A;  2QIL A;  1N8R C;  4PQX A;  2OTL A;  1ENF A;  4CKB A;  4JI5 Q;  3CMA A;  5C0X I;  1A15 A;  3S14 B;  1FR3 A;  4J15 A;  2A6E D;  2GN5 A;  3GP7 A;  4HID A;  1LTA D;  4LF7 L;  4C3J H;  1PTO C;  2B2W A;  3HS0 C;  5C4X B;  1CK1 A;  3U9S A;  1YEZ A;  2A8V A;  1DM0 B;  1HJP A;  2OXP A;  3E0J A;  1N36 L;  3J81 E;  2HCI A;  2PZT A;  1Y8N B;  2PI2 E;  4N8F A;  4JI1 Q;  2QEJ C;  3T4A C;  4CKC A;  5J39 A;  2JA6 H;  2R92 G;  2PW7 A;  1M4V A;  5I6W A;  4H44 C;  1S4Z A;  1I4Q A;  4ILW A;  5C5L A;  4BBS B;  2F0D A;  2R7Z B;  1A6X A;  2R93 B;  5D3I B;  4DK1 A;  4C3J B;  5BR8 L;  3OYY A;  3CRL C;  1B3Q A;  2VQF Q;  3NHH A;  1GUO A;  4IJL A;  3JAM i;  1FD7 D;  4DAP A;  3BYT B;  3HOY G;  2WFW A;  1LT3 D;  5IGE A;  2H4O A;  1ZEQ X;  2B63 H;  3KUP A;  4A3G B;  3NWT A;  2OF1 A;  4OO1 H;  4A3L G;  1KLG D;  3GTM B;  5IT9 L;  1LAC A;  3A0J A;  1TY2 A;  3DWP A;  1HPC A;  3E5S A;  1JWU D;  4FNF A;  2XN9 C;  2K05 A;  2E76 C;  5EPJ A;  3SXH A;  2UXC L;  1TR5 A;  2CWP A;  3DEP A;  3H6M A;  4G57 A;  1TQO A;  1E22 A;  1VDZ A;  1YNX A;  2RHQ B;  5CV4 A;  5FJ8 G;  4DV7 L;  1JJ2 A;  1K8A C;  5DM6 3;  3K6O A;  2NTS A;  3D4D A;  3D8G A;  3T16 A;  2PQE A;  5C0X H;  1MJC A;  2WIN B;  2NVQ H;  1C4Q A;  2MJ8 A;  4OEL B;  3WWV A;  3OTO L;  2JA6 B;  1C7Y A;  1ZYR D;  3J7Y W;  1EY4 A;  4LFC L;  4DXF A;  3CPW A;  2FJ2 A;  4BA1 I;  1XPO A;  3KF6 B;  1LLR D;  4IZ8 A;  1EY7 A;  4XIG S;  4DU9 A;  1ILP A;  4YIJ A;  3T1Y Q;  1Y14 B;  5FO7 B;  5C3E H;  1NE3 A;  3S15 H;  1EYD A;  1I4P A;  2O5I C;  1E24 A;  4PZ8 A;  4HAE A;  2EYL A;  1W6K A;  1SE3 A;  1I94 Q;  2JSO A;  2JJQ A;  4GNX B;  2CKZ B;  4BS9 A;  2NVY H;  4PG3 A;  2NVY B;  3I4N H;  4OXP A;  2SOB A;  3S1R B;  1ZXT A;  3DM1 A;  1OXU A;  2I07 B;  2EJM A;  4K8I A;  4A3G H;  1DCZ A;  4ZYS A;  1UE1 A;  1RL2 A;  2E2I B;  3RN2 A;  2ZTD A;  4GLV B;  4JI7 L;  4BY1 B;  4ZRZ A;  3NQI A;  1X3G A;  1BCP D;  4XYQ A;  4C2M H;  1UEB A;  1L0X B;  2FXQ A;  3P75 A;  2EJG C;  2JQO A;  4B9W A;  4IPH A;  3OW2 A;  4WJ4 A;  4NB3 A;  1LTT D;  1WTH A;  5C6A A;  1KDB A;  5DLQ E;  1EFW A;  2K5D A;  5FLX L;  1SE4 A;  2F0F A;  4N9P A;  3V2T A;  5EPL A;  4X6A H;  2ICE C;  2MO1 A;  5ELN A;  5FJ8 H;  4OHJ A;  1TKW B;  3HOX H;  5GQO A;  4RKB A;  4LF7 Q;  2ZM6 Q;  5D65 A;  3TDQ A;  2F4V Q;  2F0G A;  5EBC A;  3D3R A;  3PMF A;  4FYD A;  3SE0 A;  4EGV A;  1LUZ A;  3B6Y A;  4AQY L;  4JI4 Q;  1PMR A;  3HOV H;  4X65 Q;  4J1M A;  4BY1 G;  1E2Z A;  5IYC H;  1C8C A;  1SSO A;  1H9K A;  3GTL H;  4IUT A;  1A62 A;  2AHO B;  1Z6H A;  2RSN A;  1SAP A;  5K36 G;  1E2W A;  1PV4 A;  1ESR A;  2D0P A;  1FJG L;  1SNQ A;  4CKE A;  2B8G A;  2IHF A;  1HR0 Q;  4BY7 H;  1GUS A;  2NZ1 D;  1B2T A;  4M8A A;  5C3X A;  4DK6 C;  3BDO A;  2XIW A;  4LAA A;  1BQQ T;  1PXU A;  4A93 G;  3OPO A;  2IHE A;  2F0K A;  4IUR A;  1E3P A;  5IT9 c;  1CZG A;  4A3J H;  4HJ8 A;  1KNA A;  4A76 A;  4PV1 C;  1GM5 A;  1A3T A;  4K5V A;  4LF8 Q;  1KAB A;  4YWL A;  3TP6 A;  2DN8 A;  1STB A;  5J1Z A;  1S3O A;  4CGY B;  5IYD G;  3M4O B;  2MNA A;  4NXM Q;  2F0J A;  2NZO A;  2V4D A;  3QB3 A;  4R4C A;  1PH2 A;  1PVO A;  3FVQ A;  2EOT A;  4L8J A;  1NCV A;  4H0L C;  4DV1 Q;  3HKS A;  1BF4 A;  3NSW A;  2WV6 D;  4K5X A;  4UPA A;  4DR6 L;  4CJ0 B;  2R7Z H;  4BY7 G;  1STA A;  2Q2U A;  1YI2 A;  4LF6 Q;  5IGB A;  1ZYR C;  3OTO Q;  3D0F A;  3PF4 A;  1RD9 D;  4LFC Q;  3J80 i;  1XTC D;  3CW2 C;  4HJ5 A;  2ZXO A;  2NN6 G;  4A3D H;  3NK9 A;  1SNC A;  1WTV A;  1EQQ A;  1Q81 C;  1PH6 A;  2UUB Q;  4C3H G;  1TWG H;  3C3L A;  5I9O A;  2XWJ B;  1B3A A;  5IOC A;  4GKK Q;  1RTO A;  3PO3 H;  4FO2 A;  5COY A;  3P7J A;  1I5F A;  4JPB W;  4G7O C;  3F2B A;  2HIX A;  4RG1 A;  2EYM A;  3H3V I;  3QWN A;  3TP8 A;  4LF8 L;  2CQO A;  5E4X A;  4L5Q A;  2B2U C;  2Z0S A;  2E75 C;  4DV2 Q;  3MA2 B;  2N49 A;  4JC0 A;  4FDB A;  4BXX H;  3CCR A;  2IL8 A;  3BVZ A;  4UP7 A;  4A75 A;  5LMN Q;  2HHH Q;  5IP9 G;  1PFM A;  1YHA A;  4ZKC B;  2RBM A;  3GTM H;  1SDF A;  1V1O A;  3TRE A;  4LFA Q;  5JEA J;  1XMO L;  1CI3 M;  4LMQ D;  3I2Z A;  5M3F G;  2Z8L A;  2AQ2 B;  1EQV A;  1KXL A;  2Z4I A;  4FF2 A;  4DGZ A;  4KN4 C;  3VR4 A;  2D2C C;  1X32 A;  1HFG A;  1HA5 A;  4H7B A;  2K28 A;  1PTO H;  2NYZ D;  4LFB L;  4S3S A;  1HCZ A;  1UUP A;  2MQH A;  2O5J C;  1KQS A;  2A73 B;  4P75 A;  2A5H A;  1U4R A;  1QVF A;  2K5N A;  1GD7 A;  4JI8 Q;  2VL6 A;  4NMZ A;  1J8I A;  4C1N K;  1VQ4 A;  2TSS A;  4LNQ A;  2L9H A;  3UDI A;  1NSN S;  1QWY A;  1A63 A;  4KHZ A;  3X3N A;  2DGY A;  1ASY A;  2R93 H;  4BBR H;  4JBJ A;  2JA9 A;  2KCN A;  1BNZ A;  1LM0 A;  1N32 L;  1F9R A;  3ND8 A;  1L0W A;  4FF3 A;  5C44 H;  4OO1 I;  2KCT A;  1FYC A;  4DNI A;  4DV3 Q;  4FXD A;  2R6G A;  1N33 L;  4ID6 A;  5A2Q L;  3VR6 A;  3TS2 A;  4C56 C;  2NVQ B;  4QL5 A;  2R61 A;  4QJF A;  3MTS A;  3M3Y H;  4P74 A;  2B2Y A;  4NKL A;  1SMX A;  2DNC A;  2FMC A;  2M00 A;  3NBI A;  4R4T A;  2XRQ D;  3HOV G;  5JJI A;  1UAP A;  3DEO A;  2ZJP A;  4BY1 H;  1OXT A;  3J81 j;  3VA5 A;  2D5D A;  2G9D A;  4MTK A;  4DAM A;  4L6T B;  1VQN A;  2VQE Q;  2DY8 A;  2Y0S E;  4CDC C;  1G51 A;  2Y0S G;  1QIL A;  3SGI A;  4GLA C;  5JVG 3;  1VQI A;  3TEH B;  1VQB A;  1B9M A;  3WOE A;  3R8B A;  3L2P A;  1GXD C;  2A69 D;  2EY6 A;  3LWU A;  3KBG A;  2I0Q A;  1IYV A;  1XNR L;  2R93 G;  4JOI C;  4A93 H;  2K5V A;  3UDF A;  2OTJ A;  3RZO H;  1EZ8 A;  4RH6 A;  3VYR A;  2NVX H;  2LS0 1;  2CQA A;  4WFN 3;  3BZC A;  2VS1 A;  3CQZ H;  4DF7 A;  1BBW A;  3HOW B;  4KKU A;  2XGT A;  4IPG A;  2KCC A;  1M8A A;  5C4X G;  4R8N A;  1QUQ B;  3M4P A;  3A54 A;  1HZB A;  2RVL A;  2BA0 A;  2DJG C;  2AUJ D;  5A35 A;  1CKM A;  1Q12 A;  4KKT A;  4RKL A;  1K3R A;  5C44 B;  1A8V A;  1X65 A;  5FK9 C;  2R7D A;  4R1J A;  3DM3 A;  2EYP A;  2ZJR A;  4RGT A;  1UE7 A;  3PUW A;  3FKI G;  4DV5 Q;  4GKK L;  1SR3 A;  4BBS G;  3OSO A;  1PLF A;  1WFQ A;  1WVL A;  1YNN C;  1N34 Q;  1E2V A;  4GOP C;  1CA5 A;  4LWC A;  3A5Z B;  1IBK L;  4AYB E;  3P20 A;  2KA7 A;  3TSS A;  4C1N I;  5GRO A;  4IPC A;  1W6J A;  1S5D D;  1K9M C;  1IBM L;  4HSP A;  3VDY A;  3K5M A;  5T1I A;  3HKZ G;  1XNR Q;  1PZK D;  3Q8D A;  1L0Y B;  2F0T A;  2HHH L;  1NMG A;  2C35 B;  4HIM A;  2Z4H A;  4OL7 A;  3ER0 A;  2F1M A;  1SYC A;  4K14 A;  1U4L A;  2JA8 H;  2E2H B;  1GUN A;  5M5Y B;  4IUU A;  1HUN A;  2NVT B;  1ONL A;  5M5Y H;  1KDA A;  3J81 L;  1P16 A;  3CD6 A;  3NEN A;  3I7F A;  5DNF A;  1ENC A;  3CRK C;  1Y1V G;  3GTG H;  5FLM G;  2WB1 E;  3MXG A;  4OIK A;  1WCM H;  4JYA Q;  1OXX K;  2WB1 G;  5IGC A;  1CFM A;  1JE4 A;  1I6V C;  4JBK A;  3H09 A;  2E2H H;  2JA8 B;  2ZTE A;  5EQ0 A;  4JI5 L;  1W2B A;  3RZD B;  4DA2 A;  1O7Y A;  5G3L D;  1IL2 A;  4KY6 A;  2ZT9 C;  1EIF A;  1FGU A;  2F4I A;  4HSV A;  2ZXP A;  4RHS A;  2E2D C;  1O7I A;  1DXM A;  1LT5 D;  5CV6 A;  3RN5 A;  3S14 H;  1LT4 D;  2EYF A;  3LGJ A;  4OWX B;  1O78 A;  5CBA E;  4A3B B;  5ELO A;  3H94 A;  1K8M A;  3PUV A;  4PNY A;  3PQI A;  4LF9 L;  4HN7 A;  5C5M A;  4JG2 A;  2CW0 C;  5IGF A;  2YTV A;  4X3S A;  5COR A;  5C3W A;  3J7A V;  5JVH 3;  1OXS C;  5FOB B;  1S5B D;  4BBR G;  1TWG B;  5H1S E;  1LO5 D;  5EPK A;  2BE5 D;  2WB1 B;  1CQV A;  3I4O A;  2JA8 G;  5C0X G;  1JJC B;  3IL8 A;  2A69 C;  3MHB A;  2K32 A;  4GN5 A;  1TII D;  3CCU A;  2F0U A;  2HT1 A;  2ZXR A;  1HNX L;  1KRT A;  3ZJY C;  2E2J B;  1DON A;  1QZG A;  1D5M C;  4LW1 A;  1OXV A;  4RAU C;  3VYS A;  2N55 A;  3X3M A;  4DV2 L;  3M3Y B;  2K4K A;  1JOK A;  5FO8 B;  3TS0 A;  5D3D A;  2JXM B;  3DXJ C;  5A2Q E;  3AU7 A;  2NZH A;  3Q23 A;  4QB4 A;  3VR5 A;  4K0K L;  1HTL D;  3KLR A;  3NTK A;  3RLF A;  2B2T C;  1GHJ A;  2D9U A;  2PMZ E;  3U58 A;  2VXW A;  3QIA A;  4HTH A;  2KEE A;  1L1O B;  3U4V A;  2R7F A;  3CU7 A;  1KIX A;  5IYB H;  1KLU D;  4IUQ A;  1VQA A;  2M2L A;  3KOJ A;  4R4O A;  3NTH A;  5BN3 A;  5F2D A;  3ERO A;  3UE1 A;  2LXJ A;  4DV0 Q;  1PTO B;  2MPM A;  2B2U A;  2F0Q A;  3DWQ A;  3NBH B;  2KUM A;  5JEA H;  3H0G B;  1H9J A;  1CSP A;  1SJE D;  1XMQ L;  1HNW Q;  1JOO A;  4JI0 Q;  3FEW X;  3KDF B;  2WAC A;  1F2Y A;  1XWE A;  2EYO A;  4YHH Q;  2RF4 A;  1I4R A;  1B7Y B;  1G8Z D;  2KHI A;  1MIU A;  4A3F H;  1EFI D;  1NAP A;  1SNM A;  2HQE A;  3BG3 A;  2LXK A;  1LYL A;  2KQ3 A;  1TWA H;  4RGN A;  5M3F H;  4JI6 Q;  4HMJ A;  5E3F A;  3K8A A;  1VQG A;  4JV5 Q;  3PUY A;  3RZO B;  3T53 B;  1VQK A;  2JP1 A;  1STH A;  5BN5 A;  4BY7 B;  2CW0 D;  1DZ1 A;  2IX3 A;  3GTQ B;  2LFN A;  1VQP A;  1X56 A;  4BXX G;  1Q1E A;  5JJZ A;  3TP5 A;  1G2S A;  5IP7 H;  2NWG A;  2Z9H A;  4MHE A;  1T9H A;  1VS0 A;  3J7A F;  4X66 Q;  3CPF A;  2OCE A;  2WKD A;  1UNS A;  1JOQ A;  3L0O A;  4C3H B;  1WTX A;  1B8A A;  5CMD A;  3LX0 A;  1DD2 A;  3S1M H;  1XMQ Q;  1EY5 A;  3HOZ H;  1WD0 A;  4KHP L;  1Q90 A;  1EWI A;  2ICI A;  4DK3 C;  4RA8 A;  3CC7 A;  3AEV A;  4B3R Q;  1QVC A;  3ND9 A;  3I8Z A;  2KHS A;  1CA6 A;  3H3V H;  5JPN C;  4IFD I;  2ZJQ A;  1FNW A;  5LL6 S;  4EVO A;  4IJH A;  1HZ9 A;  2CH4 W;  4G4K A;  2XWB B;  4GOP B;  3FPU B;  3T1H L;  1PH9 A;  4L5S A;  5M5X H;  1EYC A;  1Z7T A;  1RHP A;  2F0M A;  4FVM A;  3VR3 A;  5FLX E;  2RQX A;  2PCF B;  1TWH B;  2EQS A;  4A3F G;  3QOJ A;  4XDX A;  2A1A A;  1VMP A;  4IFD J;  3ULL A;  4A3E H;  3GTJ H;  3I4N G;  5AFW A;  1I50 H;  4ODG A;  2QGQ A;  2MP1 A;  1QNU A;  2FFK B;  4JCV E;  4WOR A;  1B70 B;  4DUY Q;  3HOU H;  4HMI A;  1YJW A;  1J5E L;  2UU9 L;  5JJK A;  2OQK A;  2J7Z A;  3KK7 A;  3PSI A;  4A3J B;  4GKJ L;  1IBL L;  1I4H A;  4QQB X;  2N88 A;  1L1O C;  4YCU A;  2H5X A;  1RF2 D;  1N32 Q;  3A74 A;  3OMG A;  2MUY A;  3F2C A;  3I90 A;  5HGQ A;  3S17 H;  1EUJ A;  2Y0S B;  4K0K Q;  2F3W A;  1DJR D;  1SND A;  3AB9 A;  2LKV A;  3I70 A;  4JI2 Q;  2D62 A;  2OWO A;  3GTO H;  3M4O H;  1IYJ B;  3H91 A;  5EKL A;  1BDO A;  3E6Z X;  1PH3 A;  1VQ5 A;  2A68 D;  2EJF C;  4H13 C;  5CBE E;  3TZD A;  3SK5 A;  4ALP A;  4DR1 L;  4JK1 C;  5K5P A;  4BBS H;  1VQJ A;  3EJI A;  3W2D A;  4PZ6 A;  5C4H A;  3K7A H;  3CCS A;  2L4N A;  3NP8 A;  5C4X H;  1T5E A;  1BCP C;  2VQE L;  4A3E G;  1UE5 A;  4XTC S;  1X6O A;  3JAM L;  5CC4 A;  2AKW B;  1XPU A;  1NMF A;  1MKH A;  2CH4 A;  1HNW L;  5IOD A;  1IW7 D;  1TWH H;  1STE A;  5DAU A;  4X3K A;  2JA5 G;  3CCE A;  1LT6 D;  2B8F A;  3DWA A;  3E9I A;  2K1B A;  2B29 A;  4QUC A;  1I6H B;  1A3V A;  3OOC A;  3GTK H;  4ME3 A;  3GTK B;  4IUP A;  4AYB G;  3GTP H;  2ID0 A;  4X62 L;  4AQY Q;  4PMC A;  1SNP A;  3G6J B;  5KYL A;  4X65 L;  3CME A;  1NBW A;  2H1E A;  1G2T A;  4HJA A;  3D6W A;  1CHQ D;  1P8L A;  1TVX A;  3JAM E;  2BDN A;  4ZAI A;  1CTM A;  4YWM A;  3KJP A;  2F3I A;  1VQC A;  4GZY C;  3S17 B;  2PNR C;  4A3D B;  2I46 A;  3S2H H;  4H02 A;  3HKZ B;  2QDL A;  5FLM H;  2KCM A;  1EU4 A;  4HCS A;  1RJT A;  1JWS D;  2K75 A;  5C44 G;  2V1C C;  3I4M B;  4UY8 C;  2L5T A;  1RKN A;  2F0H A;  3UE0 A;  1VF7 A;  1SYG A;  1BUV T;  3D4R A;  5IYD H;  2R92 B;  2MO0 A;  3AMU A;  4JBW A;  5G3L F;  4PMW A;  4CDD C;  4DAY A;  4B3M Q;  3BYY B;  2PYK A;  1EOT A;  1HZC A;  3UDX A;  1YNJ C;  1STN A;  4XQQ A;  2F0W A;  5M3M H;  2R7Z G;  4DV4 Q;  2NUC A;  3TZU A;  1B53 A;  1NUC A;  5IP7 G;  5JOB A;  1V1P B;  1CUK A;  1I6H H;  1WTW A;  5CV5 A;  1TT2 A;  3E9H A;  2NN6 H;  4A3D G;  2AWN A;  1B4O A;  3C2P A;  1SE8 A;  3RD4 A;  2JA5 H;  3ITP A;  1Q8I A;  1EWC A;  2RDH A;  1QVG A;  3U9O A;  1K0S A;  1F2L A;  3BZK A;  2SEB D;  2R3Z A;  2VUM B;  1PRT F;  3V05 A;  2K33 A;  2UUB L;  1D5X C;  1DGS A;  2CVR A;  4DR5 Q;  4DR3 Q;  4B3T L;  3R2T A;  4KJN A;  3S2H B;  3OWF A;  3S16 B;  2EY5 A;  1VQ8 A;  4AIM A;  1STG A;  3W3A A;  1E7Z A;  4JVZ A;  2OQ0 A;  4JOI A;  1K83 H;  4TQU S;  1KD1 C;  4R8I A;  1J5E Q;  2UU9 Q;  4MNO A;  4O42 A;  2Z6K A;  1E1T A;  4TVA B;  2DJF C;  2G9H D;  1TS2 A;  2JA6 G;  1VQM A;  1K8G A;  2JA7 B;  1VQE A;  2B3G A;  1CQF A;  4BBR B;  2F4V L;  4HIO A;  4FXK C;  2F0V A;  2XNA C;  1BXT A;  2AQ1 B;  1WD1 A;  2CFM A;  4OX9 L;  3GTL B;  1PRT B;  4JI4 L;  3PV0 A;  3S1R H;  3HP3 A;  5HGT A;  1HXY D;  2E5L L;  3C1E A;  3I91 A;  3VA7 A;  5IIF A;  4KY7 A;  5IYB G;  4HED A;  2A6H C;  3IAY A;  4HCE A;  4LFA L;  4GN4 B;  3PF5 A;  3HOU G;  4UP8 A;  3IRB A;  5CR3 A;  3PO2 B;  1V1Q A;  3A7A B;  1SFO B;  4V0B A;  3I72 A;  4A3B G;  2F0S A;  3FPP A;  2N78 A;  1SRU A;  1PYS B;  5ELF A;  5C3E B;  5JEA G;  2C9O A;  1M90 C;  2RCN A;  4DR7 L;  2PMZ B;  1SMY D;  3SVM A;  4AH6 A;  1V9P A;  5KGU A;  2A6E C;  1U0L A;  1SJH D;  1MI2 A;  3S9W A;  4R4I A;  4IOA A;  1S72 A;  5C4J H;  1ASZ A;  1GHK A;  1ICF B;  3A56 A;  5C4J B;  2B2Y C;  3HOZ B;  1AE3 A;  5JJL A;  4CHT B;  1H9M A;  4N8X 1;  1AP0 A;  1H9S B;  1Y1W B;  4I7Z C;  1Y1W H;  2QW7 A;  2UUC Q;  5IWA L;  1Y69 U;  2EE1 A;  2NVT H;  1Y1V H;  1YNJ D;  3RZD H;  2EZV A;  3Q22 A;  1V43 A;  3CF5 A;  1HQR D;  3OIP A;  3HOU B;  3S1Q B;  1AE2 A;  3HKZ E;  4OEM B;  3K5O A;  3QG1 A;  2B63 G;  4A3B H;  1LTB D;  5C3E G;  2CHB D;  1HR0 W;  2A6H D;  1IL8 A;  2VB2 X;  5BN4 A;  5I9P A;  3G71 A;  1HRJ A;  2DY7 A;  4ZLT F;  1FVI A;  4KTA A;  4DR2 L;  3TN2 A;  3HOZ G;  3KF6 A;  5BR8 Q;  3NWS A;  3BJU A;  3R93 A;  4B3M L;  3L7Z C;  1JQY D;  1WTR A;  1VQH A;  5CV9 A;  1JE5 A;  1SXT A;  2A68 C;  3R3O A;  3SR1 A;  2WKC A;  4JYA L;  1XNQ L;  4DV4 L;  5C0X J;  2GA4 B;  4DUY L;  1SYE A;  3CC4 A;  2PPB C;  1AH9 A;  2I5L X;  2K5Q A;  3SDZ A;  4A3C G;  1E1O A;  3NXW A;  2E8G A;  3TME A;  1HZA A;  4JI6 L;  3GV3 A;  2SNM A;  1DYQ A;  1RDP D;  1X54 A;  3WOF A;  5GAE C;  1S5F D;  1WTQ A;  3MZ5 A;  2QKI C;  3S2D H;  3K0Y A;  1JB7 A;  3G7L A;  3RUZ A;  4DAY B;  2PQA B;  1KHI A;  4ZKB B;  1LTL A;  4HJ7 A;  1YHB A;  1Q7Y C;  4A3G G;  3K81 C;  1UEA B;  1X3E A;  4RWS C;  5FKA C;  1VQ9 A;  1HTP A;  2F3V A;  1CM9 A;  1NY4 A;  5CV7 A;  1PRT D;  4WRD A;  5LMN W;  4IN3 A;  1I3Q H;  5EJW A;  2X6G A;  1SBB B;  5I2Y A;  1PZJ D;  3NEM A;  4QF4 A;  1UWV A;  1R9T B;  1JT8 A;  4F88 A;  1YVC A;  2F0I A;  3PO3 B;  4QY7 A;  4ZUI A;  1B44 D;  1OO9 B;  1WI5 A;  1IXR A;  3MWY W;  2J4X A;  3LNN A;  1EIH A;  1CT1 D;  2RCF A;  4LF4 Q;  4RCO A;  4CBV A;  2J0T D;  2L12 A;  4DNR B;  3K7U C;  4JI1 L;  3NPP A;  2L11 A;  4IUV A;  3CCV A;  1S5E D;  1NNX A;  4DFA A;  3MEF A;  3ULJ A;  4N9T A;  1QB5 D;  3QOL A;  4RGO S;  4A3J G;  3CHB D;  4LJZ C;  4KJO A;  3IFD A;  5LL6 X;  1NR2 A;  3RNU A;  5KEE A;  1NR4 A;  1ZKO A;  1PH1 A;  2HCC A;  3QO2 A;  3FDT A;  3N6R A;  3ULP A;  3OHX C;  4KHV A;  2EXZ A;  2PNH A;  5IYC G;  2F03 A;  1A2U A;  2OT2 A;  4IUN A;  3VYU A;  2KBN A;  2K14 A;  2MFI A;  5ISR A;  2O2L D;  2Q2I A;  4DPG A;  1JIC A;  4DR4 L;  5EKK A;  3H3V C;  2EXD A;  3W1B A;  3I4N B;  5M3F B;  1VF5 C;  4LF5 Q;  3KF8 A;  5M3M B;  4DUZ L;  1CSQ A;  3FRP B;  1C9O A;  1K73 C;  4KN7 C;  4Y52 H;  5EBD A;  5ELD A;  1EEI D;  3OWE B;  1EIY B;  3CQZ B;  1XTD A;  4LUZ A;  3F2D A;  1PFN A;  4K6D A;  3K5N A;  4DAV A;  1K0R A;  4CJ2 C;  2JN4 A;  4ZCK A;  1F9S A;  1I4X A;  4DV7 Q;  4GOP A;  1ET6 A;  2L55 A;  4G7H C;  1PHJ A;  1HFN A;  1Q8K A;  2VB3 X;  2Q2H A;  1D6E C;  4AYB B;  1DOK A;  1VQD A;  2K5W A;  2ZTC A;  4OWW B;  3ICE A;  1TXY A;  4P2C B;  5ELE A;  2CCZ A;  1TS5 A;  1FJG Q;  4WJ3 M;  1G91 A;  3DUZ A;  3J7Z C;  3JC6 6;  3J7A 5;  3KLW A;  1KAA A;  3GQB A;  1U9R A;  4L5T A;  1K83 B;  4LFB Q;  3IFT A;  1EYG A;  2KOL A;  3CP0 A;  4KD3 A;  1NTG A;  5M3M G;  1G6Z A;  4A3K G;  2WAQ G;  4IO9 A;  1ICW A;  1KAW A;  2LSS A;  1S5C D;  5EAY A;  4DXG A;  1KTK A;  4DR4 Q;  4X62 Q;  1IW7 C;  3FP9 A;  3MFG A;  1IBK Q;  3I4L A;  4LF5 L;  4IFD H;  3PUZ A;  2E74 C;  1C48 A;  2I5M X;  4CDE C;  3MAQ A;  1IKM A;  3S24 A;  1G6P A;  2IT1 A;  3S1M B;  4DV6 Q;  5J3B A;  1PTO F;  4FXG C;  3BZD B;  3CKI B;  1VQ6 A;  3HEJ A;  2RKS A;  2NTT A;  3C1F A;  4KMU C;  4NXN Q;  1MBY A;  4HIK A;  4DV1 L;  2K5H A;  3HOW H;  3Q6S A;  4OGQ C;  1H9S A;  3J81 i;  3UI2 A;  3OW7 A;  3A55 A;  4B9X A;  5T1G A;  1TWF B;  5E7N A;  3CC2 A;  2KEC A;  3QJY A;  3T1H Q;  1BVS A;  1ROD A;  2HIV A;  4KI0 A;  3S1N B;  2UUA L;  1LTR D;  4QCL A;  1W3S A;  3OMC A;  1WOC A;  5AJ3 L;  4Z9C B;  4Y7N B;  4PZ7 A;  1AFP A;  1DOM A;  1VQO A;  2WAQ B;  4EQP A;  4IAL A;  2VY3 A;  1HUM A;  4OIJ A;  4JI0 L;  3Q24 A;  2FHT A;  3M9B A;  1GKH A;  2Q8T A;  2VQF L;  5HY6 A;  4O1N A;  2ZM6 L;  3JAM c;  3HFZ B;  3MEH A;  3D4W A;  1KL9 A;  2OEO A;  4A3I G;  1KDC A;  1Z9F A;  3FKI B;  5JAV A;  3KYH C;  4A3M B;  4JI3 L;  1EZ6 A;  5LMU Q;  1EQT A;  4LK1 C;  3VYT A;  4GN3 B;  2PW5 A;  5C4Z A;  4POG A;  1BOS A;  3AQQ A;  1PFS A;  3D31 A;  2O4X A;  1PH8 A;  1RTN A;  3DHQ A;  3PIP A;  2HD3 A;  1SMY C;  1YHQ A;  2UXC Q;  2YTY A;  5LMN L;  1OTC A;  4B3S Q;  3EFX D;  3CXC A;  3MXN A;  1PH4 A;  2JA7 G;  2KJX A;  2QCP X;  2B2V C;  1PH5 A;  3EN2 A;  2Z6B A;  4JBM A;  1EEF D;  2FMM A;  2IY5 B;  2XTI A;  1BO0 A;  5KNB A;  2VUM G;  1N34 L;  2XVS A;  4P72 A;  1EWH A;  1MSG A;  3T56 B;  3K7A B;  1HA6 A;  4RGM A;  4A3I H;  1D8L A;  4KHP Q;  3I3C A;  3K58 A;  3GTG B;  4ULL A;  4RFB A;  4A3M G;  3W1G A;  1NJI C;  1PH7 A;  2ASB A;  4UDU C;  1XNQ Q;  1U5K A;  1VMC A;  5E1F A;  1X55 A;  5E4W C;  1XJV A;  1F9P A;  2HDL A;  5I2X A;  1YJ9 A;  1PA6 A;  3J80 E;  5ELB A;  3AFP A;  2IX1 A;  2VW9 A;  1R9T H;  1O80 A;  3EQL C;  3FKI H;  5IGG A;  4UP9 A;  3I4M H;  1PRT C;  3MXP A;  4EQN A;  4C3I B;  3LWE A;  1EU3 A;  4TRD A;  1QUQ A;  1Q82 C;  3BU2 A;  3NTI A;  1Y1W G;  2AWO A;  3J80 c;  3KBX A;  1PYW D;  1G29 1;  1K3B C;  4R4Q A;  4RMF A;  3BVG A;  4DR7 Q;  1YIT A;  2VUM H;  1D7Q A;  5M5W H;  3RLO A;  3UDG A;  1X3Q A;  2L0C A;  3CCM A;  1AN8 A;  3D6C A;  4Q5V A;  1EY9 A;  5HUR A;  2HUG A;  4X3T A;  3MC0 B;  2UXB Q;  4Q0F A;  2RHS B;  3TP7 A;  4LUO A;  1GUW A;  1K8O A;  1TWC H;  4GKJ Q;  2WAQ E;  3KDF A;  1WTO A;  3K80 C;  1BBX C;  1FGB D;  2A74 C;  4DKA C;  3R2I A;  3A7L A;  5I4D A;  1ENA A;  5GAH C;  1ESF A;  2K6A A;  5KYI A;  4ME5 A;  4QIW E;  4C3I G;  3SK4 A;  3GV6 A;  2UXD Q;  3E0E A;  5LHY 1;  1EQR A;  2MHV A;  4EQO A;  1HH2 P;  1V8Q A;  4FF4 A;  1FNV A;  1I3Q B;  3AFQ A;  2I5H A;  1Y8P B;  5I6Y A;  5J22 A;  4BWG B;  1F9Q A;  2Q8R E;  3KF8 B;  2PZU A;  1WCM G;  1VQF A;  2F0L A;  5EGT A;  1O7L A;  1D2B A;  2K50 A;  1DOL A;  2KVM A;  3CAM A;  5AJ3 Q;  4JV5 L;  4KV6 A;  1QCB D;  4NP5 A;  1TWC B;  2BOS A;  4A3C H;  4QMG A;  4POF A;  1XPR A;  2ALY B;  3V96 A;  1LTI D;  3RMH A;  5KIX A;  1X3F A;  4XYO A;  2Z1C A;  3T1Y L;  4A3L H;  1CZW A;  1GOZ A;  1GO3 E;  1I94 L;  4PMB A;  3HOW G;  1S40 A;  2F0E A;  1LTG D;  3I55 A;  3EVQ A;  2FIN B;  5CGK A;  1II3 A;  2RSO A;  5IT9 E;  4XT3 B;  1M1K C;  1PZI D;  2JEB I;  1Y8O B;  2F0P A;  2B2T A;  4WJW A;  1GVP A;  3HOX B;  4YCV A;  2E2I H;  2B39 A;  3CCL A;  4MTN A;  3ONA B;  1J9O A;  4QGU A;  1BCP F;  1GUT A;  3L9A X;  1D1K A;  2EVB A;  3PIP 3;  2SNS A;  2PO4 A;  4OWT B; 
#chains in the Genus database with same CATH homology
 3K0X A;  1E22 A;  1YNX A;  5ELO A;  2RHQ B;  5FJ8 G;  2B63 G;  4DV7 L;  3PUV A;  2KEN A;  1JJ2 A;  4A3B H;  1K8A C;  5C3E G;  4LF9 L;  1N36 Q;  1C0A A;  1HR0 W;  1JJG A;  4JG2 A;  1H95 A;  1MJC A;  2YTV A;  2NVQ H;  3WWV A;  3OTO L;  3G71 A;  1C7Y A;  1OXS C;  4DV0 L;  4LFC L;  3CPW A;  4BBR G;  5H1S E;  4BA1 I;  1XPO A;  1SFO H;  3KF6 B;  1KRS A;  1FVI A;  4DR2 L;  3GO5 A;  4XIG S;  2HQL A;  3HOZ G;  3GDE A;  3KF6 A;  3I4O A;  1UE6 A;  5BR8 Q;  4GLX A;  3T1Y Q;  1Y14 B;  5C3E H;  3BJU A;  1NE3 A;  3S15 H;  2JA8 G;  5FLX c;  1JJC B;  5C0X G;  4B3M L;  3L7Z C;  2JA7 H;  1E24 A;  4PZ8 A;  1VQH A;  3W5O A;  1JE5 A;  4GN5 A;  1I94 Q;  4JYA L;  3CCU A;  2HT1 A;  2IX0 A;  1XNQ L;  4DV4 L;  5C0X J;  2JJQ A;  4DUY L;  4GNX B;  4C3H H;  1HNX L;  2BH2 A;  2CKZ B;  2NVY H;  4PG3 A;  3A5U A;  1KRT A;  3CC4 A;  2EIF A;  2JK8 A;  3G48 A;  4OXP A;  3ZJY C;  1YJN A;  1QZG A;  2KHJ A;  4LF4 L;  3I4N H;  2I5L X;  4P73 A;  2UUC L;  3PO3 G;  1AH9 A;  4LW1 A;  1IBL Q;  1OXU A;  1OXV A;  2ATW A;  4A3C G;  4DV2 L;  2N8N A;  3EBE A;  4A3G H;  1E1O A;  2K4K A;  2E8G A;  1HZA A;  4JI6 L;  1UE1 A;  3TS0 A;  1RL2 A;  3RN2 A;  2ZTD A;  2BH8 A;  3EIV A;  2NZH A;  4GLV B;  4O2D A;  4JI7 L;  2JEA I;  4K0K L;  1X54 A;  1IZ6 A;  1X3G A;  5GAE C;  1SN8 A;  3RLF A;  2PMZ E;  4C2M H;  1UEB A;  3U58 A;  3S1Q H;  3S2D H;  2PQA A;  2FXQ A;  2JQO A;  1JB7 A;  4IPH A;  4DAY B;  1L1O B;  3U4V A;  3OW2 A;  4NB3 A;  2PQA B;  1VQ7 A;  1KHI A;  4WJ4 A;  1LTL A;  2R7F A;  4HJ7 A;  4DR5 L;  2PI2 A;  1KIX A;  5IYB H;  1YHB A;  4DV5 L;  5DLQ E;  1FL0 A;  1Q7Y C;  1EFW A;  1VQA A;  3KOJ A;  4A3G G;  4R4O A;  3K81 C;  1X3E A;  1X9N A;  3UE1 A;  2LXJ A;  4X64 Q;  2NN6 I;  4DV0 Q;  1VQ9 A;  2WP8 J;  1NY4 A;  4OON A;  3U4Z A;  4X6A H;  5LMN W;  3NBH B;  1I3Q H;  1WYD A;  2MO1 A;  1CSP A;  5ELN A;  5FJ8 H;  1XMQ L;  1VQL A;  3MXN B;  4IFD G;  1HNW Q;  4JI0 Q;  3NEM A;  3KDF B;  1SRO A;  1UWV A;  3HOX H;  5GQO A;  1IBM Q;  1JT8 A;  1YVC A;  4LF7 Q;  4QY7 A;  2ZM6 Q;  2F4V Q;  2YU9 H;  1TWF H;  4B3R L;  1WI5 A;  1IXR A;  3CCJ A;  1L2F A;  1PYB A;  1YZ6 A;  2UXD L;  4YHH Q;  4OX9 Q;  3J81 c;  1HNX Q;  1LUZ A;  2RF4 A;  3F1Z A;  1B7Y B;  3B6Y A;  4AQY L;  4JI4 Q;  3HOV H;  2KHI A;  4LF4 Q;  2F52 A;  4X65 Q;  4JI3 Q;  4BY1 G;  1MIU A;  2QEX A;  4A3F H;  4DR6 Q;  5IYC H;  3STB D;  3K7U C;  4JI1 L;  2LXK A;  1LYL A;  3GTL H;  4APV A;  1TWA H;  1A62 A;  2AHO B;  5M3F H;  4JI6 Q;  5K36 G;  3CCV A;  4HJ9 A;  1PV4 A;  3G6E A;  3K8A A;  3MEF A;  1VQG A;  3ULJ A;  2D0P A;  1FJG L;  4A3J G;  4JV5 Q;  3PUY A;  2IHF A;  4GNX A;  1HR0 Q;  3M7N A;  4BY7 H;  1VQK A;  3RNU A;  1PH1 A;  2DUD A;  4C3I H;  1VQP A;  4DK6 C;  1X56 A;  4BXX G;  1Q1E A;  3ULP A;  2PNH A;  5IYC G;  2QA4 A;  5IP7 H;  4A93 G;  2IHE A;  1E3P A;  1T9H A;  2YYZ A;  3FHW A;  5IT9 c;  1VS0 A;  2KBN A;  4X66 Q;  2K14 A;  2MFI A;  3CPF A;  2OCE A;  2Q2I A;  4DPG A;  5IY0 A;  4A3J H;  4HJ8 A;  4DR4 L;  3L0O A;  1B8A A;  4A76 A;  4IPD A;  1GM5 A;  3I56 A;  2EXD A;  3W1B A;  2E2J H;  4LF8 Q;  5IWA Q;  1XMQ Q;  3S1M H;  4LF5 Q;  4YWL A;  3HOZ H;  4KHP L;  4DUZ L;  1CSQ A;  2YTX A;  1EWI A;  1C9O A;  1K73 C;  4EQ5 A;  1S3O A;  4DK3 C;  3F8T A;  3CC7 A;  5IYD G;  4Y52 H;  3AEV A;  4B3R Q;  1QVC A;  2MNA A;  1EIY B;  4NXM Q;  3H3V H;  4NPS A;  2NZO A;  4LUZ A;  1XTD A;  4R4C A;  3F2D A;  1PH2 A;  3KJO A;  4JI2 L;  4IFD I;  2ZJQ A;  1PVO A;  1SLJ A;  4NXN L;  3RR5 A;  1RIP A;  1K0R A;  4DV1 Q;  1WJJ A;  3HKS A;  4IJH A;  4DV7 Q;  1HZ9 A;  4GOP A;  4UPA A;  4DR6 L;  1KC8 C;  1PHJ A;  2R7Z H;  1Q8K A;  4BY7 G;  1XMO Q;  2Q2H A;  4GOP B;  2Q2U A;  3T1H L;  3H0G G;  1PH9 A;  4L5S A;  1YI2 A;  1VQD A;  3TRZ A;  5M5X H;  4LF6 Q;  2ZTC A;  4OWW B;  3ICE A;  1TXY A;  3OTO Q;  3D0F A;  2CCZ A;  5GAD C;  4OO1 G;  2JE6 I;  1FJG Q;  3PF4 A;  4LFC Q;  3J80 i;  3CW2 C;  4HJ5 A;  4WJ3 M;  2NN6 G;  4A3D H;  3J7Z C;  3JC6 6;  3J7A 5;  3KLW A;  4DR2 Q;  1CKN B;  1EQQ A;  1Q81 C;  1PH6 A;  2UUB Q;  2EQS A;  4A3F G;  2A1A A;  4L5T A;  4LFB Q;  1A0I A;  1TWG H;  4IFD J;  3ULL A;  4GS3 A;  4DR3 L;  4B3T Q;  1EYG A;  4A3E H;  3GTJ H;  3I4N G;  4GKK Q;  3CP0 A;  1I50 H;  1NTG A;  3KFU A;  3PO3 H;  5M3M G;  4A3K G;  2VNU D;  2QGQ A;  2WAQ G;  4A4I A;  1J6Q A;  4IO9 A;  1KAW A;  1I5F A;  2LSS A;  3PCO B;  4JCV E;  5EAY A;  4DUY Q;  1B70 B;  3F2B A;  3HOU H;  1YJW A;  1J5E L;  2UU9 L;  4DR4 Q;  5JJK A;  2R92 H;  2HIX A;  2GVA A;  4X62 Q;  4RG1 A;  3H15 A;  3FP9 A;  2OQK A;  5IP9 H;  3PIO A;  3H3V I;  1IBK Q;  4LF8 L;  3PSI A;  3I4M G;  4GKJ L;  2CQO A;  5IE8 A;  1IBL L;  4LF5 L;  1I6H H;  4L5Q A;  4YCW A;  2L15 A;  1VCI A;  2Z0S A;  3PUZ A;  4YWK A;  4DUZ Q;  2I5M X;  4DV2 Q;  2N49 A;  1L1O C;  4YCU A;  2H5X A;  3S24 A;  1N32 Q;  2IT1 A;  3A74 A;  3NEL A;  1G6P A;  3F2C A;  4JC0 A;  4DV6 Q;  5HGQ A;  3S17 H;  5J3B A;  4FDB A;  4P71 A;  4JI7 Q;  1EUJ A;  4BXX H;  4K0K Q;  3CCR A;  1BKB A;  1VQ6 A;  4JI2 Q;  3STB C;  3GTO H;  4A75 A;  2D62 A;  4UP7 A;  5LMN Q;  3H0G H;  2OWO A;  1IYJ B;  4B3S L;  4NXN Q;  3M4O H;  4HIK A;  2CWA A;  4DV1 L;  2HHH Q;  5IP9 G;  4O0A A;  4YY3 L;  1YHA A;  2K5H A;  3HOW H;  3GTM H;  1PH3 A;  3HOY H;  3GTQ H;  3J81 i;  1VQ5 A;  3G4S A;  3M4Q A;  4LFA Q;  5JEA J;  3TRE A;  1XMO L;  3TQY A;  4ALP A;  5E7N A;  4DR1 L;  3T1H Q;  3CC2 A;  3I2Z A;  1BVS A;  1VQJ A;  5M3F G;  4BBS H;  4QQB X;  4PZ6 A;  2HIV A;  4KI0 A;  3K7A H;  3CCS A;  1KXL A;  2UUA L;  4X64 L;  1W3S A;  5AJ3 L;  1WOC A;  5C4X H;  2VQE L;  4A3E G;  1UE5 A;  4PZ7 A;  4XTC S;  1X6O A;  1VQO A;  2AKW B;  1XPU A;  1NMF A;  2VY3 A;  1MKH A;  2Q2T A;  1HNZ L;  1HNW L;  4JI0 L;  4LFB L;  2MQH A;  3M9B A;  1GKH A;  2VQF L;  4L5R C;  5HY6 A;  1KQS A;  2K52 A;  1TWH H;  2ZM6 L;  2JA5 G;  4P75 A;  3CCE A;  1Z47 A;  2VZA A;  3JAM c;  1QVF A;  2K5N A;  3HFZ B;  1GD7 A;  3E9I A;  2B29 A;  3PO2 H;  3U50 C;  1KL9 A;  4JI8 Q;  4A3I G;  2VL6 A;  3GTK H;  4ME3 A;  4YHH L;  1Z9F A;  1VQ4 A;  4LNQ A;  4AYB G;  3GD7 A;  3GTP H;  1Q46 A;  2ID0 A;  4LUV A;  3KYH C;  3UDI A;  4X62 L;  1CKN A;  4AQY Q;  3PGZ A;  1A63 A;  4JI3 L;  4X65 L;  1NBW A;  3CME A;  5LMU Q;  1Q86 C;  4KHZ A;  2GVB A;  4HJA A;  2DGY A;  4GN3 B;  1P8L A;  4POG A;  1YIJ A;  1ASY A;  2R93 H;  3AQQ A;  4BBR H;  4JBJ A;  2YV5 A;  1PFS A;  3D31 A;  1EOV A;  2JA9 A;  4YWM A;  1LM0 A;  3DLL A;  1N32 L;  1L0W A;  3KJP A;  5C44 H;  1PH8 A;  4OO1 I;  2KCT A;  4DV6 L;  2F3I A;  3PIP A;  4DNI A;  1VQC A;  5GAG C;  4DV3 Q;  1YHQ A;  1HR0 L;  2UXC Q;  2YTY A;  5LMN L;  1OTC A;  4B3S Q;  3CXC A;  2R6G A;  1QZH A;  1PH4 A;  1N33 L;  2JA7 G;  3S16 H;  3TS2 A;  4YY3 Q;  3S2H H;  4H02 A;  4QL5 A;  4QJF A;  3CCQ A;  4LF9 Q;  1JMC A;  3M3Y H;  4P74 A;  5FLM H;  2KCM A;  4KLK A;  1MJE A;  1PH5 A;  3EN2 A;  1SMX A;  2Z6K C;  3AYH B;  4R4T A;  2K75 A;  4DR1 Q;  3HOV G;  5JJI A;  5C44 G;  1BBU A;  2V1C C;  2ZJP A;  4UY8 C;  4JBM A;  4BY1 H;  1OXT A;  4X66 L;  3J81 j;  2IY5 B;  2XTI A;  4EX5 A;  3UE0 A;  4DAM A;  2UUA Q;  2VUM G;  2UXB L;  1VQN A;  1N34 L;  2VQE Q;  4P72 A;  2Y0S E;  5IYD H;  3M85 A;  1G51 A;  2MO0 A;  4MZ9 A;  3S1N H;  3PO2 G;  1HNZ Q;  4JBW A;  2Y0S G;  4Y7N H;  4A3I H;  3SGI A;  4GLA C;  1D8L A;  4PMW A;  4KHP Q;  1VQI A;  3TEH B;  1VQB A;  4A3M G;  3W1G A;  4B3M Q;  3L2P A;  2ES2 A;  1NJI C;  1PH7 A;  3PUX A;  2ASB A;  1HZC A;  3UDX A;  5M3M H;  4NXM L;  2R7Z G;  2I0Q A;  1XNQ Q;  1U5K A;  4DV4 Q;  1XNR L;  4JI8 L;  2R93 G;  2AMC B;  1X55 A;  4JOI C;  5IP7 G;  4A93 H;  1XJV A;  3ERS X;  2K5V A;  3UDF A;  1CUK A;  1YJ9 A;  1PA6 A;  3RLN A;  3AFP A;  2E5L Q;  2NVX H;  2IX1 A;  2VW9 A;  3RZO H;  5LMU L;  1R9T H;  3BZC A;  2VS1 A;  3CQZ H;  3FKI H;  1BBW A;  2XGT A;  4IPG A;  4UP9 A;  3I4M H;  5C4X G;  3E9H A;  1CKO A;  4A3D G;  2AWN A;  1QUQ B;  3M4P A;  4A3M H;  1SE8 A;  2JA5 H;  1QUQ A;  1HZB A;  3BU2 A;  1Q82 C;  4LF6 L;  2A19 A;  2BA0 A;  1Y1W G;  1CKM A;  1Q12 A;  2AWO A;  3J80 c;  4DV3 L;  2BA1 A;  1QVG A;  4BA2 I;  1G29 1;  1Q1B A;  1K3R A;  3HOX G;  4R4Q A;  1A8V A;  4RMF A;  1N9W A;  1X65 A;  3BZK A;  1N33 Q;  4A3K H;  2R7D A;  4R1J A;  3DM3 A;  4IOC A;  1L1O A;  2ZJR A;  2UUB L;  1YIT A;  4DR7 Q;  2VUM H;  1D7Q A;  5M5W H;  1UE7 A;  3PUW A;  1DGS A;  2N3S A;  3FKI G;  3RLO A;  4DR5 Q;  4DR3 Q;  4DV5 Q;  3UDG A;  4B3T L;  4GKK L;  3CCM A;  1YBY A;  2D0O A;  1VQ8 A;  4AIM A;  1E7Z A;  1SR3 A;  4BBS G;  2OQ0 A;  4JOI A;  2OTJ A;  1K83 H;  4TQU S;  4GNX C;  1WFQ A;  2UXB Q;  1KD1 C;  2RHS B;  1N34 Q;  1N8R C;  1J5E Q;  2UU9 Q;  4MNO A;  4LUO A;  4GOP C;  4LWC A;  2OTL A;  3A5Z B;  2Z6K A;  1IBK L;  4AYB E;  4JI5 Q;  1E1T A;  4TVA B;  1TWC H;  4GKJ Q;  2WAQ E;  3KDF A;  3CMA A;  5GRO A;  5C0X I;  3K80 C;  2JA6 G;  4IPC A;  1VQM A;  1K8G A;  4J15 A;  4DKA C;  2GN5 A;  1VQE A;  2B3G A;  4HID A;  3VDY A;  1K9M C;  1IBM L;  4LF7 L;  4C3J H;  5GAH C;  4HIO A;  2F4V L;  3HKZ G;  4QIW E;  1XNR Q;  2CFM A;  3Q8D A;  2UXD Q;  4OX9 L;  3E0E A;  1YEZ A;  2A8V A;  2HHH L;  1NMG A;  1EQR A;  2C35 B;  4JI4 L;  1HJP A;  3PV0 A;  4HIM A;  3S1R H;  2E5L L;  1HH2 P;  3ER0 A;  3AFQ A;  2I5H A;  5IYB G;  1N36 L;  3HOU G;  4JI1 Q;  4LFA L;  2PI2 E;  4GN4 B;  3PF5 A;  2JA8 H;  4UP8 A;  3IRB A;  2JA6 H;  3KF8 B;  2R92 G;  1WCM G;  1VQF A;  1V1Q A;  5M5Y H;  2K50 A;  3CAM A;  1P16 A;  4A3B G;  5AJ3 Q;  4JV5 L;  3CD6 A;  4A3C H;  2N78 A;  3NEN A;  1SRU A;  1PYS B;  4POF A;  3I7F A;  1XPR A;  5JEA G;  1M90 C;  2RCN A;  4DR7 L;  2ALY B;  5BR8 L;  1X3F A;  3OYY A;  1Y1V G;  3T1Y L;  4A3L H;  4AH6 A;  2VQF Q;  1V9P A;  3GTG H;  5FLM G;  2WB1 E;  1U0L A;  4IJL A;  1GO3 E;  3JAM i;  1WCM H;  1I94 L;  1OXX K;  4JYA Q;  4R4I A;  3HOW G;  4IOA A;  1S72 A;  5C4J H;  1S40 A;  2WFW A;  2WB1 G;  1ASZ A;  3I55 A;  3HOY G;  1AE3 A;  5JJL A;  4JBK A;  2B63 H;  1M1K C;  2E2H H;  2ZTE A;  4JI5 L;  1Y1W H;  1W2B A;  2JEB I;  5IWA L;  2UUC Q;  2NVT H;  1Y1V H;  4A3L G;  1GVP A;  3RZD H;  4YCV A;  2E2I H;  3CCL A;  1IL2 A;  4MTN A;  3A0J A;  1EIF A;  1V43 A;  1FGU A;  3CF5 A;  4QGU A;  3RN5 A;  1O7I A;  1AE2 A;  3HKZ E;  3S14 H;  2UXC L;  2CWP A;  3LGJ A;  4OWX B;  4OWT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...