1HZBA

Bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
b'MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLD SHOCK PROTEIN CSPB
publication title Crystal structures of mutant forms of the Bacillus caldolyticus cold shock protein differing in thermal stability.
pubmed doi rcsb
source organism Bacillus caldolyticus
molecule tags Transcription
total genus 14
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hzbA00
4L5QA 4DR6Q 1J6QA 2KHJA 3U50C 1KD1C 2JA9A 1TWHH 3HOYG 4KHPL 1N32Q 4X6AH 2JA7G 1ASYA 4TQUS 4A3DG 5JEAG 2BH2A 2QEXA 4HJ9A 4JI4Q 4GKJL 2VL6A 1Q1BA 2JA5H 4DV2L 1NTGA 4JI2L 4JBKA 3GTQH 1JJ2A 3HOVH 4A3EG 3CCQA 5FLXc 2RHQB 4C2MH 3F2BA 2IX1A 4JI1L 1VQGA 1WFQA 1WYDA 1EOVA 3B6YA 2XTIA 4LUVA 1HR0L 4IPDA 4LFAQ 1KHIA 2EQSA 4BBRH 5HY6A 5FJ8G 4A75A 4A4IA 4C3HH 3GO5A 3FKIH 1PYBA 1SRUA 1N34Q 1NY4A 4XIGS 1Q82C 5M5WH 1VQFA 5LMUQ 1YHQA 4A3BG 4A3LG 3PUXA 3EIVA 3WWVA 2B63G 2AHOB 2OQ0A 4B3SQ 4JI5Q 4OXPA 4GKKQ 4DAYB 4GLVB 4UP9A 1SE8A 2HQLA 4JI6Q 3AEVA 4AQYL 2NVTH 1I3QH 4UPAA 4MTNA 1X65A 3I55A 4AH6A 4DR4Q 4JCVE 4IPGA 4UP8A 3JAMi 4DV4L 2UU9Q 3I4MH 2PQAA 1JE5A 3MXNB 5M5XH 4OWXB 3H3VH 3STBD 2VUMG 2OQKA 3G71A 2K5NA 3CW2C 1L0WA 4P72A 4J15A 3HOWH 3HOZG 1Q1EA 2UUBQ 4JV5L 1VQ6A 1A0IA 4KHZA 3HOUG 1I5FA 2K14A 1SFOH 4OWTB 2UXDL 4KHPQ 5AJ3L 2IY5B 1HZBA 2UXBQ 2KHIA 5IP9H 1N36L 4LF9L 2ZJPA 3J81j 2UUAL 4GKJQ 2R93H 2V1CC 4JI2Q 3UDIA 3I4OA 2JA8G 3K7UC 4AYBE 5LMNQ 2BA1A 2PI2E 5IYBG 2N8NA 2VQFL 4A3IH 4PZ8A 5C0XI 5IYDH 3E9HA 1AE2A 1PH8A 3CC2A 1I50H 2JJQA 4AYBG 4HIKA 1HR0Q 1NMGA 1UE7A 3HKSA 1VQ5A 1CKNB 1EUJA 4R1JA 1GKHA 1XPRA 3BZCA 5IY0A 3PO3G 2DGYA 3J80i 1I94L 1GVPA 3GTPH 1PH1A 2E2JH 2JA6G 1CKOA 1FL0A 3ZJYC 2K4KA 4LF4Q 3AFQA 1CKNA 5C4JH 4C3JH 3UE0A 1VS0A 3AYHB 5M5YH 1OXSC 2MO0A 3TS0A 1PH5A 4BBSH 5GAHC 3U58A 3ULPA 4POFA 1C0AA 1HNZQ 1Y14B 3FHWA 1EQRA 2D0PA 4DPGA 3VDYA 1AE3A 2A1AA 3FP9A 4FDBA 4YY3Q 3HOXG 4QJFA 2ASBA 3S15H 1PH4A 3KJOA 3CCUA 1JJGA 3KOJA 2OCEA 2PNHA 2VZAA 3PIOA 4DV4Q 1LUZA 4IJLA 2MO1A 2KBNA 1YHAA 4DV7L 2LXKA 3PUZA 1IL2A 1N34L 5K36G 3E0EA 1RIPA 2B29A 5M3FH 4K0KL 1LTLA 3K8AA 1OXUA 2VW9A 3ICEA 2AWOA 1Z47A 4GN5A 4JV5Q 4DK3C 4JI5L 2JEBI 3RR5A 2UXDQ 3AFPA 1EYGA 3PF4A 4OO1I 1C9OA 1PHJA 4JI6L 3PUVA 1N36Q 4DNIA 3H15A 2UXCL 4LF9Q 2FXQA 4GS3A 1WI5A 2ZJQA 2JA5G 1YJNA 4A3GG 3F1ZA 4YWLA 1VQOA 4GN3B 3HOVG 2UU9L 2ATWA 2LXJA 3PV0A 2VQFQ 1VQAA 2YTXA 1KRTA 2MNAA 4P71A 1TWCH 1FJGL 2F4VQ 2BA0A 3PUWA 4C3IH 2YYZA 1D8LA 3RN2A 4JC0A 3CMAA 2UUBL 2NN6I 4LFBL 4BBRG 3RN5A 2I5LX 5IWAL 2JK8A 2JE6I 4OONA 3RLOA 5C3EH 1R9TH 1I94Q 1YHBA 4A3JH 3J7A5 2UXBL 3J7ZC 4JBWA 1YITA 2HIVA 1VQMA 1GO3E 1X9NA 1IBML 2E5LL 3I4NH 2Z6KA 3F2DA 3H0GH 4JI7Q 1V1QA 1HZAA 1PFSA 1WOCA 4P74A 4YHHL 4WJ4A 5LMNL 3PSIA 3OW2A 1VQIA 1YJ9A 2A19A 5JJIA 3CCRA 4BXXH 4A93H 4JOIA 4DR1L 1ASZA 4GLXA 3K81C 1Y1WH 5C44H 1HJPA 2F3IA 5M3MH 1SR3A 4TVAB 3ERSX 2OWOA 4X66L 1FVIA 5HGQA 3I4MG 1QZHA 3T1HQ 3GTJH 3J81c 1VQ7A 1QVCA 4HJ5A 2RF4A 2ZTDA 4DV7Q 3L0OA 1UEBA 4GOPA 1XMQL 1PV4A 1K8GA 4LF5L 4LF4L 4K0KQ 4A3CH 1YVCA 3HOWG 1L2FA 1MKHA 3D0FA 2WP8J 1VQEA 4P75A 4DKAC 4A3FH 1HNWL 5JJKA 1PYSB 1A8VA 4RG1A 1Q8KA 2HT1A 1HNZL 1WJJA 3W1BA 5FLMH 2YTVA 2JQOA 3K80C 3PF5A 2LSSA 5H1SE 4YY3L 5IP9G 2BH8A 2R7ZH 2UXCQ 1PVOA 1OTCA 4O2DA 4LNQA 3TQYA 1X6OA 3S24A 2PQAB 1KQSA 3CAMA 3F2CA 2Q2IA 5GQOA 4JI0L 3CMEA 1Y1VH 3CD6A 1H95A 3M9BA 4WJ3M 2C35B 2L15A 1E22A 2VQEL 1WCMH 1Q81C 1NJIC 1JB7A 1FJGQ 4O0AA 1E1OA 1E7ZA 2YTYA 4GN4B 1EQQA 2E2IH 1JJCB 4EX5A 4LFBQ 1X3FA 4R4QA 5IYCH 3LGJA 1QUQB 2WAQE 2H5XA 5IWAQ 1S72A 1CKMA 5C0XJ 1N8RC 1PH9A 3KDFB 1PH2A 4R4CA 5JJLA 2KENA 4B3ML 3JAMc 1M1KC 1TWAH 1VQ4A 1IBMQ 1QUQA 1L1OA 4LF6L 4IOAA 4PG3A 2E5LQ 3GTGH 3KDFA 4YCVA 4BBSG 4A3MG 2IHEA 1YIJA 4APVA 4YHHQ 1TXYA 1MJEA 3A74A 4JG2A 4ALPA 4R4OA 4POGA 1YNXA 4HIDA 2PMZE 3PO2H 4BA1I 5J3BA 3I7FA 2RHSB 4BY1H 2F4VL 2NZOA 2JEAI 4IO9A 2VS1A 2IX0A 4DR1Q 1YI2A 3A5UA 3BU2A 4JBJA 3CCEA 1G6PA 1VQCA 4LW1A 2Z6KC 4HJ7A 4X66Q 1A63A 1RL2A 1XMQQ 4LF5Q 2N49A 2GVBA 3CCLA 1Q7YC 1VQ8A 3KFUA 1J5EQ 1Q12A 4JOIC 1GD7A 1YJWA 1HNWQ 1YZ6A 4JI7L 1G291 1BBUA 2Z0SA 1OXTA 1BKBA 3HKZE 1QVGA 4QQBX 3UDFA 3NELA 1QVFA 4P73A 3CC4A 5EAYA 3STBC 4GOPC 2VUMH 1U0LA 1XNRQ 3EBEA 3J80c 1N33L 3HKZG 4DUZL 1XPOA 1UE5A 2NVXH 2GVAA 3T1YL 1E24A 2CKZB 4DK6C 1W2BA 4JI0Q 4DV6Q 2R92H 1IBLL 1S3OA 3DLLA 1HZ9A 1T9HA 3T1HL 1PH6A 1E3PA 2B3GA 4ME3A 1SMXA 4X64L 4L5SA 2VQEQ 1XJVA 1C7YA 1VQBA 1IBKL 3S1MH 1A62A 3M7NA 1Z9FA 1VCIA 3KJPA 1OXXK 4A76A 3KF8B 4QGUA 2IT1A 4A3KH 3S1RH 4IFDI 2E8GA 5C0XG 2PI2A 2DUDA 3W1GA 3W5OA 3PCOB 5C3EG 4OX9L 1XNQL 4B3MQ 4A3JG 4HJAA 1KAWA 3RLFA 4UY8C 3GD7A 4LWCA 4DV5L 1SROA 4LF6Q 3KF6B 3I4NG 2HHHL 4JI3Q 2KCTA 4DV3L 2MQHA 3H0GG 1XMOL 1SLJA 2WB1E 1X3GA 3KF6A 1NBWA 3NBHB 2D0OA 4Y52H 2Q2HA 3A0JA 2NZHA 2CFMA 2WB1G 4BXXG 4DV1Q 1EWIA 4DV0L 1GM5A 4BY7H 1Y1WG 1L1OC 1MJCA 2QGQA 5C44G 4GNXB 5M3MG 3CF5A 4DR2Q 3M4OH 3ER0A 3UDXA 1LYLA 3FKIG 1TWGH 4GNXA 3K7AH 3TREA 2R7FA 4X62Q 2Q2TA 3D31A 4A3FG 1X55A 3ULJA 2K52A 1SN8A 1VQJA 1BVSA 5C4XH 3RZOH 1P8LA 2VY3A 5FLMG 3PIPA 2Y0SE 3I2ZA 1N9WA 2R6GA 2R7ZG 1IZ6A 4B3RQ 1I6HH 4PZ7A 3L7ZC 4DUZQ 1V43A 1N33Q 3S1NH 2Y0SG 4GOPB 4IFDG 3T1YQ 5BR8L 1QZGA 1S40A 2CCZA 3GTMH 1HH2P 3F8TA 1IBLQ 1JMCA 1Y1VG 4OO1G 1D7QA 2OTLA 3S2HH 4DR7Q 4LF7Q 3HFZB 4X64Q 1VQDA 1WCMG 3L2PA 1EIFA 4JI8L 1IBKQ 3IRBA 1J5EL 2ZM6Q 1K83H 2ZTCA 5IP7H 3J81i 3TS2A 4DR5Q 4A3GH 4DUYQ 4LF8L 5IYCG 3TEHB 1MIUA 1XNQQ 2K5HA 3M3YH 4OX9Q 4B3TQ 1IYJB 1K0RA 3S14H 1XNRL 2ZTEA 2NN6G 4DV5Q 2R7DA 5IE8A 2R93G 2HHHQ 2NVQH 4DV3Q 4DV6L 1XMOQ 1VQ9A 3CP0A 4KI0A 3CCSA 1G51A 3DM3A 3JC66 3HOYH 1X56A 1V9PA 3PO2G 4A3IG 2JA7H 5ELOA 3GTLH 1JT8A 5IT9c 4BY1G 4XTCS 5IYDG 4A3DH 4X65L 3OTOQ 1CSQA 4DV0Q 2WFWA 1EFWA 2I0QA 2EXDA 1PA6A 2D62A 4MZ9A 3RLNA 4YCUA 3UDGA 1L1OB 4NXML 4A3EH 1UE6A 1K8AC 3G4SA 2AKWB 4DR3L 1LM0A 1K3RA 4NXNL 4L5RC 1PH3A 2UUCQ 1UE1A 4LFCL 2AWNA 2WAQG 1HNXL 3KLWA 4JI3L 2N78A 3K0XA 1NMFA 3KYHC 1P16A 2KCMA 3MEFA 3Q8DA 5FJ8H 4JYAQ 1YEZA 4PMWA 2ES2A 3GDEA 3A5ZB 3I56A 2F52A 4QIWE 4GNXC 1AH9A 1XPUA 4DV1L 4A3BH 4YWKA 4A3LH 3U4VA 2R92G 2GN5A 2B63H 5GROA 5BR8Q 3CPFA 4IPCA 3M85A 1EIYB 2OTJA 2EIFA 2XGTA 2I5HA 4DR2L 3U4ZA 3GTKH 1VQLA 5ELNA 4IOCA 5DLQE 5M3FG 1OXVA 3CC7A 3EN2A 2YV5A 2Q2UA 4JI8Q 3RNUA 1XTDA 2K75A 4X62L 1BBWA 4LUOA 3M4PA 4YCWA 4Y7NH 4DV2Q 4LF8Q 4A3KG 3UE1A 3RZDH 3CPWA 2YU9H 3TRZA 5GADC 4B3RL 3CQZH 4PZ6A 1W3SA 3CCJA 4JI1Q 3HOZH 3BZKA 4QL5A 1U5KA 1X3EA 2RCNA 1KL9A 1K9MC 1VQKA 3S17H 4IFDJ 2QA4A 4DR6L 3HOUH 3G48A 1TWFH 1N32L 4IPHA 4DR7L 4HIMA 3OYYA 1B70B 2AMCB 4LF7L 1O7IA 4UP7A 1B8AA 4EQ5A 1YBYA 4KLKA 3ULLA 4BA2I 4AIMA 5JEAJ 4X65Q 3SGIA 4QY7A 4JI4L 2ZM6L 2A8VA 4BY7G 1KIXA 4A3MH 4DR5L 4DUYL 1VQHA 2JA8H 2K5VA 1DGSA 3S16H 1UWVA 2HIXA 3CXCA 4NXMQ 3CCMA 1FGUA 1K73C 5IYBH 4DR3Q 3NENA 4H02A 4B3TL 4NXNQ 3AQQA 3S1QH 5GAGC 4LUZA 2ALYB 4AQYQ 3E9IA 5LMNW 4OWWB 3G6EA 4LFCQ 1HNXQ 2E2HH 1CUKA 2I5MX 3PUYA 4LFAL 1B7YB 5C4XG 4NPSA 1CSPA 1Q46A 4HIOA 3PO3H 2MFIA 5GAEC 2K50A 1E1TA 1HR0W 2ID0A 3BJUA 2CQOA 4YWMA 2JA6H 2VNUD 4L5TA 1KXLA 3NEMA 3S2DH 3CCVA 5LMUL 4A93G 3OTOL 4R4TA 1NE3A 4JBMA 1Q86C 4B3SL 1X54A 1KC8C 4GKKL 1HZCA 5AJ3Q 1VQPA 4IJHA 5E7NA 1PH7A 3HOXH 1IXRA 1KRSA 2ZJRA 4A3CG 3H3VI 2CWPA 2UUCL 3PGZA 2UUAQ 4GLAC 4DR4L 5IP7G 1M90C 4JYAL 4DAMA 1VQNA 3GTOH 3M4QA 2N3SA 4HJ8A 2CWAA 4R4IA 4MNOA 2IHFA 4NB3A 4RMFA 2NVYH
chains in the Genus database with same CATH superfamily
4L5QA 4JW0A 1KD1C 3LX0A 2CHBD 4X6AH 4A3DG 2XNAC 2BH2A 4JI4Q 5CV5A 1ICWA 3WOEA 2A6HD 3URYA 2ICEC 4JI1L 1D5ZC 1WFQA 2XTIA 1HR0L 4LUVA 4RGNA 1KHIA 5HY6A 5CV8A 1WTVA 4A4IA 3GO5A 4N8X1 1FNVA 1VQFA 2DN8A 2ICIA 1YHQA 3I3CA 3I73A 4K5XA 3EIVA 2B63G 5J39A 2AHOB 3GV3A 4JI5Q 4OXPA 3IL8A 1SE8A 2PYKA 3OMCA 1A3TA 2EZVA 2XVSA 3AEVA 5A2QL 1A3VA 4UPAA 2F0TA 3QO2A 2ZXRA 4MTNA 1SYBA 2Q8RE 2EYLA 4BS9A 1CK1A 3KK7A 3MXNB 5ELFA 1F9PA 5M5XH 1TWAB 3G71A 3HOWH 2R93B 3HOZG 2CQAA 1ET9A 2PZUA 3RMHA 2UUBQ 2NTTA 1SBBB 4KHZA 2B2WC 5AJ3L 2IY5B 1DD2A 1JICA 1U4LA 3R3OA 1EQVA 5BN4A 5DNFA 1WD0A 4JI2Q 2JA8G 1Z7TA 1I4GA 1LV9A 2PI2E 4RH6A 3HS0C 1QB5D 1SNMA 2VQFL 5C0XI 5IYDH 3E9HA 1SE3A 1PH8A 1PTOF 1Y69U 2WACA 1BCPB 1CKNB 4R8NA 1EUJA 5E4WC 5IY0A 3A8IE 3OIQA 2E2JH 2DNCA 2K4KA 1TY0A 1LT3D 4C3JH 3AYHB 1X32A 4POFA 1WTHA 1K3BC 4DPGA 2A1AA 3FP9A 4YY3Q 3HOXG 1HTLD 2ASBA 3S1MB 1NNXA 3VA7A 1PH4A 1A3UA 1B9MA 1JJGA 3GV6A 1F2YA 3PIOA 4U673 4DV4Q 4IJLA 1K8OA 2MO1A 2FFKB 2RSNA 1N34L 2B29A 4K0KL 1AZPA 3K8AA 1LTID 1OXUA 3ICEA 4DK3C 1GJXA 1L0YB 4OO1I 1EL0A 1C9OA 1B1ZA 1BOSA 1PHJA 3AU7A 2A6ED 3PUVA 2C5CA 4RKLA 4XDXA 4DNIA 2ZT9C 1C48A 3H15A 5I6YA 5G3LF 3F1ZA 2UU9L 1AP0A 2LXJA 4K8IA 3K5LA 3CU7A 4P71A 3A55A 4FF2A 2Z8LA 2BA0A 4FXKC 5C4XB 2ZXPA 2EYFA 2MPMA 2A73B 2UXBL 1WTXA 3J7ZC 5A2QE 4OGQC 1IBML 3I4NH 4H0LC 4P2CB 1LTSD 1HZAA 1V1QA 3S2HB 2Z1CA 2WINB 3HG9A 1YJ9A 3V2TA 1GUTA 3P7JA 4BXXH 1JWSD 1K83B 3TBIB 3W2DA 4HMJA 1ASZA 4GLXA 3K81C 4TVAB 3ERSX 4X66L 1FVIA 3KUPA 1QVCA 4HJ5A 2RF4A 2ZTDA 5I2YA 4L63B 4LF5L 5EPLA 1ICFB 1D1KA 2NVQB 2WP8J 4DKAC 1HNWL 1JC7A 2HT1A 5FLMH 1RJTA 4B9WA 2LSSA 5IP9G 1BCPF 4A3DB 1PVOA 1OTCA 1DCZA 4RA8A 3CAMA 3K59A 3CMEA 3CD6A 1H95A 4XQNA 3WOFA 1WTOA 4WJ3M 2C35B 1H9KA 1EEID 1D1IA 3K5NA 1Q81C 3DUZA 1AFPA 2NZ1D 1E1OA 1E7ZA 2YTYA 1EQQA 4RAUC 1SNPA 1X3FA 5IYCH 5IWAQ 1QUQB 1PH9A 1N8RC 1CKMA 4LJZC 1F9RA 2A6HC 5C0XJ 2KEEA 2SNMA 1M1KC 1TWAH 1VQ4A 2NN6H 1L1OA 2B63B 4YCVA 4A3MG 2IHEA 1PZJD 5TSSA 3GTKB 2PZWA 4CBVA 1YNXA 1JB3A 5J3BA 1STEA 2NZOA 3MXUA 4DR1Q 2EXZA 1SMYD 3A5UA 3CCEA 1G6PA 1ONLA 4XXEA 2HUGA 1F9QA 1RL2A 1MI2A 5JJZA 1XMQQ 2MHVA 2N49A 3HOZB 1VQ8A 2X69A 3AB9A 4JOIC 1YJWA 2KJXA 3L3OC 2Z0SA 4HCEA 1BKBA 4XT1B 3UDFA 2VUMH 2LY7A 1S5ED 4GOPC 1XNRQ 2G9DA 1N33L 1D6EC 4TRDA 4DK6C 2JA8B 1BDOA 3S16B 5I9PA 2QILA 4X64L 2NUCA 1C7YA 5D65A 1IBKL 3S1MH 2F0IA 5LL6X 1SDFA 3KF8B 4LMQD 4IFDI 2KCCA 2E8GA 3W5OA 5C3EG 1SYEA 3RLFA 3GD7A 4LWCA 4LF6Q 2F0JA 2HHHL 3ONAB 4DV3L 2MQHA 3H0GG 4JI3Q 1RF2D 1X3GA 4J8QA 3BVZA 3KF6A 3I4LA 3VYUA 3HOXB 2D5DA 2NZHA 4KKSA 1RDPD 2WB1G 1EWIA 4HTHA 1Y1WG 5C44G 1SYDA 2LS01 4LAAA 2L4NA 3MFYA 3TREA 1ML0D 4X62Q 1X55A 3ULJA 4DXGA 2H1EA 1ENFA 4KK7A 5C4XH 2Y0SE 2R6GA 2R7ZG 1ILQA 1EYDA 3P20A 4ZRZA 1I6HH 2BOSA 4DUZQ 1V43A 1JWUD 4IFDG 2CCZA 1QZGA 1HH2P 1IBLQ 1CA5A 1D7QA 3S2HH 4WORA 4N9PA 4IZ8A 2EE1A 1EIFA 4JI8L 3IRBA 1J5EL 1K83H 4KV6A 3OSOA 1RODA 3H09A 1VF7A 1XNQQ 3H91A 2B2UC 4EVOA 2NVQH 4QUCA 5EGTA 1JE4A 1VQ9A 4KI0A 1G51A 3JC66 5EQ0A 3A56A 1JT8A 1ILPA 5IYDG 1TKWB 4A3DH 3DWPA 1UUPA 1I6VC 3RLNA 4NXML 1L1OB 4CKBA 1UE6A 3PMFA 3G4SA 1BF4A 4HR7B 1PH3A 2UUCQ 4DAYA 4LFCL 2WAQG 1V1OA 3K0XA 1NMFA 4KKUA 4PV1C 3A5ZB 3R8BA 2F52A 2L11A 3A54A 1EY4A 4DV1L 3R2IA 1TVXA 2GN5A 4KD4A 5GROA 2B63H 5EKKA 3M85A 1CM9A 4NDXA 2EPBA 3GTKH 1I50B 2BE5D 3EN2A 3RNUA 1XTDA 3P1HA 3M4PA 2F0KA 1GUWA 1TS2A 5KYIA 3GTPB 3TP7A 3TRZA 3CQZH 4JI1Q 3HOZH 1XXGA 2RCNA 3Q23A 1VQKA 4IFDJ 2B2TC 4G7OC 4OIJA 4DR6L 5KYLA 2E74C 1EY0A 1N32L 4IPHA 3OYYA 5IODA 2F0HA 4EQ5A 4KLKA 3AMUA 5JEAJ 4K6DA 4X65Q 4QY7A 2I07B 2JXMB 2PMZB 2ZM6L 1EIGA 2PZTA 1KIXA 1NUCA 1VQHA 2JA8H 4L6TB 4X3SA 3S16H 1UWVA 2HIXA 5K5PA 4DR3Q 4B3TL 1S5BD 3AQQA 4K14A 4LUZA 4OWWB 5LMNW 3G6EA 1HNXQ 2E2HH 1SMYC 2I46A 5CMDA 4X3UA 4NPSA 2DJFC 2MFIA 2TMPA 2RVLA 5GAEC 5AFWA 1HR0W 2ID0A 2O2LD 3BJUA 3E5SA 3EJIA 1GHJA 1NE3A 3H3VC 3DXJC 5JVH3 4B3SL 1X54A 4GKKL 1HZCA 5AJ3Q 2QDBA 2SDFA 2B2YC 4IJHA 1PH7A 3HOXH 2CWPA 4QB4A 5DAUA 5C3EB 1R9TB 4JYAL 4HJ8A 2CWAA 1VMCA 1SNCA 3H0GB 3FPUB 3VR6A 4V190 4HCSA 4KHPL 4TQUS 2WB1B 1TS3A 2K6AA 5J22A 1Y1WB 4RFBA 3EFXD 5C44B 2VL6A 1Q1BA 2IL8A 2RCFA 1PRTC 1H9MA 4JBKA 1JJ2A 3CCQA 1JCKB 2RHQB 4E6IA 1CHPD 2IX1A 3VR3A 1VQGA 1WYDA 2B8FA 2EY5A 3O13A 5JPMC 1CHQD 4IPDA 5FKAC 4LFAQ 4XQQA 3FKIH 2R7ZB 1PYBA 1N34Q 1NY4A 3FEWX 1Q82C 2OT2A 1O7YA 4C1NK 4A3LG 3PUXA 4FF4A 3WWVA 2OQ0A 2J0TD 3I72A 4DAYB 4UP9A 4KMUC 1C8CA 5EKLA 5C3WA 1D5MC 4AQYL 3M4YA 1CZGA 4DR4Q 1SAPA 4OO1H 4UP8A 1TS5A 4K6LA 3JAMi 2UU9Q 2PQAA 4DGZA 4UHVA 3STBD 2VUMG 2F0WA 2OQKA 3CW2C 4P72A 2L12A 3GTGB 3BDLA 3D3RA 3MXNA 3NUCA 4F87A 4JV5L 1VQ6A 1I5FA 2K14A 1S4ZA 3MXGA 1WTRA 2UXBQ 5IP9H 4TSSA 5JPNC 4LF9L 4GKJQ 3K7UC 4AYBE 2BA1A 5IYBG 4A3IH 4CDEC 4PZ8A 1IHZA 2WAQB 1I50H 5DM63 3P75A 1UE7A 4KN7C 3HKSA 4RHSA 1TY2A 2G9HD 1S5CD 2EVBA 2L5TA 3C1FA 1GKHA 3BZCA 2DGYA 3J80i 1B44D 1CTMA 1GVPA 3GTPH 2JA6G 4JVZA 3SR1A 4ZCKA 3N52A 1CKNA 3UE0A 2NVXB 1QE6A 1PH5A 1ZYRD 3CRLC 4WRDA 1LABA 5ELCA 5GAHC 1EY5A 1EQRA 1AE3A 2BCOA 4EQPA 1LTAD 5KRUA 4R9WA 2K28A 1G2SA 2OCEA 2VZAA 3C3LA 1YHAA 4DV7L 3PUZA 1IL2A 5K36G 5M3FH 1RIPA 2BE5C 1HUNA 1LTLA 2KCNA 5KNBA 4ZYSA 2JEBI 2UXDQ 1EYGA 5CV6A 2B2VA 1S5DD 4JI6L 1EY6A 1N36Q 5A35A 2KUMA 2KEDA 5D3DA 5IOCA 5C6AA 2JA5G 3HOVG 4ZKCB 5IGBA 3G6JB 2F0GA 3PV0A 1VQAA 2NB0A 1TWCH 3OPOA 1FJGL 2MP1A 5ELDA 2QCPX 3TP8A 4LFBL 4BBRG 1H9RA 4RGMA 3TZDA 4C3HG 5C3EH 1R9TH 1I94Q 3J7A5 3M7GA 3Q24A 2K01A 3GTMB 1FD7D 3H0GH 1PFSA 4X3KA 5LMNL 3OW2A 1Y8OB 2A19A 3KLSX 5JJIA 2A68D 4KJOA 1Y1WH 5C44H 1SR3A 4IQZA 5HGQA 1QZHA 1VQ7A 4ZK9B 1PV4A 1QILA 1L2FA 3SK6A 4HAEA 2B2TA 1VQEA 4L8JA 1A8VA 3DMUA 4RG1A 2FMCA 1QJOA 3K6OA 3K80C 1CZWA 3PF5A 1ENCA 2R7ZH 2XN9C 2UXCQ 3TQYA 1X6OA 2PQAB 1KQSA 5GQOA 4IFDH 4JI0L 3C1EA 3HP3A 4BWGB 2L15A 1E22A 1NJIC 3NTHA 3VA5A 4G4KA 1JJCB 4EX5A 1R4PB 2WAQE 2H5XA 3KDFB 4R4CA 1LTGD 4B3ML 1QUQA 5KEEA 5E3FA 4IOAA 3GTGH 2E5LQ 3QOJA 4APVA 4YHHQ 1TXYA 1G2TA 3I7FA 2RHSB 2JEAI 2B8GA 1TIID 2F0SA 2IJ0A 4LW1A 2Z6KC 3QR8A 1A63A 2YU9B 4C56C 1DOLA 2VUMB 2PCFB 3BS1A 2PNRC 4MIUA 3S17B 1J5EQ 1Q12A 1YZ6A 5IGDA 4JI7L 1G6ZA 1BBUA 5J1ZA 5JOBA 1OXTA 4G57A 3HKZE 1QVGA 5IIFA 4QQBX 4RKBA 3CC4A 5EAYA 3A8KE 3STBC 1U0LA 3EBEA 1XPOA 2NVXH 3T1YL 1E24A 4GZYC 4DK1A 1S3OA 1B2TA 1HZ9A 2F0LA 3U9OA 5IT9L 3T1HL 2XRQD 1Q3LA 2VQEQ 2EJMA 1J9OA 4KD3A 2IT1A 2K5WA 5C0XG 2JA6B 4DK0A 4IUUA 4A3JG 4RHRA 3KF8A 5T1GA 2AUJD 3VR2A 1Y8PB 1KABA 5FO9B 1B50A 1SLJA 1GUNA 1PFNA 5EKIA 2F0VA 1NBWA 4DN4M 1B4OA 2Q2HA 4Y52H 3D8GA 3A0JA 2CFMA 3VYTA 5CGKA 4DV1Q 1GM5A 2QGQA 1ZYRC 1LT5D 3V05A 2ZXOA 1LYLA 3FKIG 1EY7A 2F0NA 4FNFA 1I6HB 1DJRD 1GXDC 4I65A 2NVYB 1NR4A 3PIO3 3D31A 5ELEA 1ENAA 2WV6D 1SN8A 1VQJA 3NTIA 3RZOH 3PIPA 3D4DA 1N9WA 5KNCA 1STAA 1KAAA 1IZ6A 1XYIA 3L7ZC 4ZUIA 2JA5B 2QKIC 3GTQB 3E3XA 3GTMH 3HOVB 4OO1G 1HA6A 4UDUC 1Y1VG 2OTLA 4H44C 1RTNA 4DNRB 4C2MB 1STBA 3L2PA 2ZM6Q 2HDLA 1DYQA 2ZTCA 4BBRB 3TEHB 4C3HB 1MIUA 4OX9Q 4B3TQ 4DV5Q 5IE8A 2DY8A 1XMOQ 3CP0A 3CHBD 3CCSA 4I7ZC 4A3IG 5ELOA 4BY1G 3C2PA 1I3QB 3HZXA 4DV0Q 3BDCA 4FO2A 2F1MA 2WFWA 4C1NI 4N9TA 2EXDA 3MA2B 4MZ9A 1PMRA 2QF7A 4YCUA 2F0OA 2AUKA 1IW7C 4CJ0B 4S3SA 2F0QA 1NR2A 2A68C 2MJ8A 1UE1A 5FO8B 1W6JA 2J7ZA 1SFOB 4KY6A 1P16A 3Q8DA 2M9VA 3NHHA 5IT9E 4JYAQ 3NQIA 4PMWA 3GDEA 1HHVA 3NBIA 4GNXC 1AH9A 3ND8A 3NSWA 4YWKA 4A3LH 3U4VA 2R92G 5BR8Q 2EIFA 2XGTA 4Z9CB 3W3AA 2F0PA 5T1IA 2RKSA 1VQLA 5ELNA 1QNUA 3CQZB 1O78A 5M3FG 2Q2UA 4EQNA 2IPKD 1EFID 2K75A 1BBWA 4YCWA 4LF8Q 3BVMA 4B08A 1EWHA 1BR9A 1GUGA 1FNUA 2YU9H 5C4JB 5GADC 3T13A 2KVMA 4CDDC 4B3RL 5M5YB 2VB2X 1W3SA 1WTPA 4ILWA 1X3EA 3S17H 1K9MC 2KOLA 1TR5A 2RBMA 1HFGA 4FF1A 4OL7A 3Q0AA 4UP7A 1VF5C 3S15B 3CKIB 5EBDA 4K5WA 2A8VA 2E2HB 1ZEQX 5HURA 4JI4L 1RKNA 1WTWA 3DWQA 3CXCA 1FGUA 5IYBH 4NXNQ 1O80A 3S1QH 4AQYQ 2A69D 3SHLA 1RHPA 1PRTD 1B7YB 1NAPA 1Q46A 3GQBA 2JA6H 1CI3M 1KXLA 3NEMA 1PYWD 2KQ3A 3S2DH 1FGBD 4R4TA 1Q86C 1TU2B 4O42A 1LTTD 4GLAC 5IP7G 1M90C 2B2WA 5BN5A 4DNTB 3K57A 2FHTA 4A3JB 1OO9B 4J1MA 5K36H 4MNOA 2F0DA 4EQOA 2NVYH 2Z9HA 2NBFA 3HRZC 2HCCA 2A5HA 1EZ8A 1J6QA 1STGA 2KHJA 3EROA 2JA9A 1TWHH 3HOYG 1ASYA 4A93B 1IYVA 5FOBB 5JEAG 2QEXA 4HJ9A 4K5VA 2JA5H 1NTGA 1PFBA 4V0BA 4F8MA 4JI2L 4XYQA 5KIXA 3GTJB 3GTQH 3HOVH 2K32A 3FKIB 4A3EG 1VMPA 1I4HA 4PMCA 4C2MH 3PQIA 5ISRA 2K5DA 2F03A 1I4PA 3B6YA 1EOVA 1WTQA 2EQSA 3TP5A 4BBRH 2BDOA 1RD9D 4C3HH 1W6KA 4XIGS 2R61A 5LMUQ 4A3BG 1I4QA 1Y1VB 1B53A 2RDGA 5FLXE 3F2UA 4EGVA 3GP7A 4JI6Q 1STHA 1I3QH 2DY7A 3I55A 1ET6A 4AH6A 4JCVE 3SEBA 3IFTA 1LT4D 4DV4L 3K58A 3H3VH 3HGBA 4KY5A 1I4XA 4NMZA 2F0UA 1STNA 1SFOH 1NCVA 4A3IB 4BY1B 2JP1A 1FYCA 3DEOA 4CGYB 2ZJPA 5IGCA 2Q8IB 2XWJB 3SE0A 3UDIA 5LMNQ 4JPBW 2PW7A 4XT3B 2N8NA 2K33A 4M8AA 5LL6S 3CC2A 4ABNA 3EVQA 2JJQA 2MGSA 4HIKA 1HR0Q 1NMGA 5C5MA 1U4MA 1XPRA 3PO3G 1A2TA 1A2UA 2TSSA 1PH1A 1CKOA 1FL0A 3DHQA 5C4JH 1J8IA 1VS0A 5M5YH 2R92B 1OXSC 2MO0A 1CQVA 3ULPA 2K5QA 1C0AA 4IN3A 3TP6A 1PDQA 2D0PA 4K2KA 2Z4IA 5M3FB 1RTOA 3NXWA 3BYTB 2EJGC 1D5XC 4FDBA 4Q5VA 1LO5D 4QJFA 3S15H 3OWEB 2SOBA 4XQJA 1KNAA 2PNHA 1LUZA 3TZUA 3E0EA 1X3PA 2PW5A 1SEBD 3AFPA 4NW2A 2F3VA 3PF4A 1AEXA 1TWCB 3OIPA 3NK9A 1SNDA 2F0EA 4GS3A 1WI5A 5L37A 2G5DA 2ZJQA 3ZYYX 5BN3A 5IGFA 4YWLA 1VQOA 1O7ZA 2X6GA 4YIJA 2VQFQ 1QG7A 1KRTA 2MNAA 2YYZA 4UAIA 2NN6I 2EY6A 5IWAL 5C0XH 2JE6I 3RLOA 1H9JA 5DEHA 4A3JH 1QOHA 3OHXC 3S1NB 1VQMA 1X9NA 2A69C 1IYUA 4JI7Q 4WJ4A 1SXTA 3PSIA 1VQIA 4F88A 4A93H 4JOIA 3OMGA 4DR1L 1EWCA 2L0CA 1NSNS 1R4QB 4H13C 1HJPA 2F3IA 3EA6A 1KTKA 3MXPA 3T1HQ 3GTJH 3J81c 3J7YW 3I4MG 2QDLA 4GOPA 3A7LA 1XMQL 1EQTA 2N55A 4LF4L 3DEPA 4K0KQ 4A3CH 1YVCA 1MKHA 3D0FA 2FJ2A 1DZ1A 3HEJA 1SJED 3HOYB 3T4AC 1HNZL 4QMGA 5H1SE 2BH8A 3S24A 2Q2IA 2JN4A 4CHTB 2D2CC 3FVQA 1Y1VH 4A3EB 2CVRA 2EYOA 5CBEE 2IX3A 4GN4B 1V1PA 4PQXA 4R4QA 3LGJA 1S72A 1B9NA 1PH2A 2KENA 4OHJA 4A3BB 1IBMQ 3TMEA 4LF6L 1STYA 4PG3A 3KDFA 4BBSG 1QWYA 1PLFA 1MJEA 4U68A 3A74A 2JYOA 4JG2A 4ALPA 4POGA 1SYGA 2PMZE 1EYCA 3FRPB 2WKCA 4LK1C 4BA1I 4BY1H 2F4VL 3R2TA 2IX0A 3KBXA 3BU2A 4JBJA 3J81L 1VQCA 4HJ7A 1U4PA 4X66Q 5EPKA 1T5EA 4LF5Q 5FK9C 2GVBA 3CCLA 1Q7YC 3KFUA 2EOTA 5IGGA 3MAQA 1HNWQ 1EOTA 1G291 1TWFB 4QIWB 5KNDA 2LMCB 1HFNA 4DUZL 4J6HA 1UE5A 2GVAA 2R92H 2CKZB 1CA6A 1IBLL 3IKJA 1T5XD 3BZDB 5E4XA 3L9AX 1E3PA 2B3GA 3R93A 4OEMB 1SMXA 4L5SA 5CR3A 2B2UA 2WKDA 1WD1A 3X3MA 4Q0FA 1HXYD 1A62A 3M7NA 1VCIA 5HGTA 1AN8A 5I6WA 4QGUA 3PO3B 1XNQL 3W1GA 3OW7A 1HQRD 1KAWA 3NPPA 3UI2A 4UY8C 2M2LA 2KCTA 3T56B 3SK8A 2WB1E 3NBHB 2D0OA 4IUTA 3C46A 3K0YA 1MGSA 4DAPA 1EZ6A 1UEAB 1L1OC 4GNXB 5EPJA 5M3MG 3RZOB 1LACA 3MFGA 1QCBD 1KNEA 1C4QA 5M5WB 4ZKBB 2Q2TA 4A3FG 1DOMA 2K52A 2O5JC 2AQ3B 3WDNA 1P8LA 3I2ZA 4DA2A 2IW3A 1IW7D 1HRJA 4B3RQ 1N33Q 3ERQA 3S1NH 2Y0SG 3X3NA 4GOPB 4JK1C 3F8TA 1JMCA 4X64Q 4FXGC 1WCMG 1IBKQ 1S5FD 1PTOD 5IP7H 3J81i 4A3GH 4K2LA 1MHWC 2K5HA 2IWHA 1IYJB 2NYZD 2R7DA 3I90A 2HHHQ 3J81E 4DV3Q 4DV6L 3I70A 3DM3A 1M8AA 3HOYH 1X56A 3PO2G 2F4IA 1V1PB 5IT9c 4XTCS 2NVTB 5JEAH 3SK5A 4X65L 5C3XA 1EFWA 3QG1A 3I4MB 2D62A 4QCLA 4RCNA 4MHEA 4WFN3 4A3EH 4DR3L 1A15A 1LM0A 1K3RA 5CORA 4L5RC 1LLRD 2AQ1B 4RCOA 1HNXL 2N78A 1YNNC 2KCMA 2B2YA 2ES2A 3G7LA 4QIWE 2RQXA 4A3BH 1E2WA 4CKEA 2OTJA 1EIYB 3CPFA 4FXDA 5G3LD 4DR2L 1ESRA 1SYFA 1B3AA 5DLQE 1OXVA 3CC7A 4JI8Q 4LUOA 2LKVA 3QJYA 4A3KG 1F9SA 3CCJA 2KHSA 5EJWA 3BZKA 4BBSB 1PFMA 3VYRA 1U5KA 2QA4A 3U9SA 2XIWA 3G48A 1TWFH 4KTAA 4CDCC 4DR7L 2FINB 4LF7L 1E2VA 1O7IA 1IKLA 3S1QB 1B8AA 3BDOA 3ULLA 4BA2I 2OF1A 4AIMA 3SGIA 1GUSA 1H9SB 4BY7G 1O7LA 4DR5L 2H4OA 1JOOA 2PO4A 5E1FA 4DUYL 4IURA 4NXMQ 5IGEA 1K73C 5JVG3 3S2DB 5GAGC 3DWAA 2ALYB 3KLSA 3E9IA 3VR4A 4LFCQ 1K0SA 1CUKA 2HCIA 4QUFA 4LFAL 2O5IC 5CV7A 1MSGA 4IUPA 4HIOA 3PO3H 3MTSA 1E1TA 3MWYW 1L0XB 1PXUA 2VNUD 2CQOA 3BYYB 1BCPD 4A93G 3OTOL 1IL8A 1I4RA 4K8JA 1KC8C 2EYMA 1AZQA 1IXRA 1KRSA 4C3IB 4A3CG 2F0MA 4KN4C 3PGZA 1EY8A 4DR4L 4QF4A 1TWHB 5JAVA 1VQNA 3M4QA 1PTOH 2N3SA 4R4IA 2IHFA 2Z6BA 4NB3A 5M5WH 3Q22A 4GLVB 4B9XA 4DR6Q 4X3TA 3U50C 1N32Q 1ESFA 1PZID 2JA7G 2L1BA 1BNZA 4GKJL 5M3MB 4DV2L 5D3IB 1JR0D 4I7AA 2Q8TA 5LHY1 2CW0D 4IALA 3VYSA 1SYCA 4ZLTF 5FLXc 3F2BA 4A3FB 1JWMD 1E2ZA 1HCZA 4A75A 4TKOB 1KDAA 1UAPA 5FJ8G 2HD3A 1SRUA 1TT2A 2Y0SB 1YNJC 2L55A 2N88A 1GOZA 3PIP3 4IUQA 4B3SQ 4GKKQ 1WCMB 2HQLA 4ZAIA 2NVTH 2E2IB 1X65A 4IPGA 3SXHA 3I4MH 1Y8NB 1JE5A 4OWXB 2EDGA 2K5NA 1L0WA 4J15A 1E0BA 4CJ2C 1PTOC 1Q1EA 3N6RA 5C5LA 1BBXC 1A0IA 1EU4A 3HOUG 2UXDL 4OWTB 1SJHD 3PO2B 2NTSA 4KHPQ 1HZBA 2KHIA 2WIIB 1N36L 3J81j 2CH4W 2UUAL 2R93H 2V1CC 2F3WA 3I4OA 5FLXL 2AQ2B 1PRTB 2R3ZA 2JSOA 3NWSA 1XWEA 1AE2A 4AYBG 2EYPA 1HQMC 2E75C 4ZQ3A 1VQ5A 3TSSA 4R1JA 1I94L 3QOLA 3ZJYC 4LF4Q 3AFQA 5CV9A 1GHKA 4DXFA 3V96A 3ITPA 1DM0B 1U4RA 3TS0A 3NP8A 4BBSH 3U58A 1V8QA 1HNZQ 1Y14B 3FHWA 3VDYA 3A8JE 1EU3A 1K28A 3E6ZX 3TN2A 3KJOA 3CCUA 1WVLA 4A3KB 3S1RB 5KGUA 3J7AV 3KOJA 2CH4A 1K8MA 4RGTA 2KBNA 2RDFA 2LXKA 5CC4A 5DM73 3MZ5A 1SE4A 2VW9A 2AWOA 1Z47A 2HQEA 3RUZA 4GN5A 1MBYA 4DFAA 4JV5Q 4JI5L 3RR5A 3Q6SA 4XYOA 2UXCL 4RWSC 4LF9Q 1SSOA 2FXQA 4BY7B 1D2BA 1YJNA 4A3GG 4GN3B 3M4OB 2ATWA 1TWGB 3K7AB 2YTXA 1DXMA 2F4VQ 4C3IH 3PUWA 1D8LA 5CBAE 3RN2A 2C9OA 4JC0A 3CMAA 2UUBL 3KBGA 4DAVA 3RN5A 2PQEA 2I5LX 2JK8A 1SNOA 3LWEA 4OONA 1YHBA 3D6CA 4KY7A 1DOKA 4DU9A 4JBWA 1YITA 2HIVA 1GO3E 3K5OA 2V4DA 1BQQT 2E5LL 2Z6KA 3F2DA 3VR5A 1WOCA 4P74A 1EY9A 4YHHL 4FYDA 1SE2A 2K7VA 1B3QA 3CCRA 1BCPC 1QNKA 4MN3A 3T16A 2ENBA 5M3MH 2OWOA 3M3YB 3S14B 4DV7Q 1K8GA 3L0OA 1UEBA 3IFDA 2A6EC 2OEOA 1AW7A 3HOWG 5FO7B 3SK4A 3QWNA 1PRTF 4P75A 3NTKA 4A3FH 3ND9A 5JJKA 1PYSB 1Q8KA 2RDHA 2VB3X 1WJJA 3W1BA 2JA7B 1JOQA 2YTVA 3GTLB 2JQOA 1LTRD 4FP5D 4YY3L 1BO0A 2XSCA 4O2DA 4LNQA 3RD4A 4IUVA 3F2CA 4WJWA 3DM1A 3M9BA 2B2VC 2VQEL 1JB7A 1WCMH 3CRKC 3S9WA 1FJGQ 4O0AA 2E76C 4PMBA 2E2IH 3A7AB 4CJ1B 1TS4A 1Z6HA 5C4HA 4LFBQ 2F0FA 5EBCA 2CW0C 5JJLA 4MTKA 1ZKOA 3JAMc 1KDCA 2XWBB 4C3JG 4FVMA 1YIJA 2X6LA 4R4OA 3PO2H 4HIDA 3LNNA 2EYHA 4IO9A 1MSHA 2VS1A 4Y7NB 1YI2A 4HSPA 2D9UA 3RZDB 2EY1A 1EEFD 5COYA 1MD2D 3H94A 2M00A 1GD7A 3HOUB 1DONA 4KKTA 2VXWA 1GUOA 1F2ZA 2EJFC 3NELA 1QVFA 4P73A 1Q90A 5I2XA 2SEBD 3J80c 3HKZG 2FMMA 4A3MB 4HMIA 4RGOS 4JI0Q 1W2BA 1JORA 4DV6Q 3DLLA 4ZUJA 3EQLC 1T9HA 1PH6A 4ME3A 4AYBB 1XJVA 1VQBA 1Z9FA 3J7AF 3MHBA 3KJPA 1OXXK 1LTBD 4A76A 4A3KH 3S1RH 3JAML 2PI2A 2DUDA 5I4DA 3PCOB 4OX9L 3NWTA 4B3MQ 4HJAA 1BXTA 2NWGA 1SROA 4H7BA 4DV5L 3KF6B 1IKMA 3I4NG 4ID6A 1KDBA 3MVVA 1F2LA 1G8ZD 4G7HC 1HA5A 2K03A 1XMOL 3QB3A 5I9OA 3H6MA 1M4VA 1II3A 1UNSA 1JOKA 4BXXG 2DNEA 4DV0L 4PNYA 2O4XA 4BY7H 1MJCA 3NBHA 1VDZA 3CF5A 2QEJC 3K5MA 3GTOB 4DR2Q 3M4OH 3ER0A 3UDXA 1TWGH 4GNXA 3K7AH 3FMCA 5CV4A 2R7FA 3MEHA 4R8IA 1BVSA 4ME5A 2VY3A 5FLMG 3J80L 2PPBC 4CKCA 4PZ7A 1Q8IA 4NP5A 4A3GB 3T1YQ 5BR8L 1S40A 1YNND 4KHVA 4HEDA 4DR7Q 4LF7Q 1FR3A 3HFZB 4NKLA 1VQDA 5F2DA 3FPPA 3NE5B 3TS2A 4DR5Q 2J4XA 4DUYQ 4LF8L 2EY2A 5IYCG 2BDNA 4OELB 3M3YH 2P5ZX 1K0RA 3S14H 1XNRL 2ZTEA 2NN6G 2R93G 2OXPA 2Z4HA 2EYJA 3I91A 1X3QA 3TDQA 1U9RA 1V9PA 2JA7H 1HTPA 3GTLH 2KA7A 1F77A 3KLRA 1CSQA 3OTOQ 2RSOA 4IUNA 2I0QA 2RA4A 1PA6A 3UDGA 5M5XB 4ULLA 1K8AC 2AKWB 4NXNL 3HOWB 4F7XA 2AWNA 1LT6D 3KLWA 4JI3L 3KYHC 1F2MA 3MEFA 3I8ZA 2LFNA 5FJ8H 3BVGA 1YEZA 3I56A 3D4RA 5D14A 1XPUA 4M1UB 4IPCA 1CFMA 3OWFA 4O1NA 3JAME 2I5HA 3U4ZA 4G7ZC 3IAYA 5C4ZA 4IOCA 2YV5A 3QIAA 4X62L 4Y7NH 1JQYD 1HUMA 4DV2Q 4ODGA 3UE1A 3RZDH 4KJNA 3CPWA 2E2JB 4N8FA 5ELBA 4C3JB 2HDMA 3T51B 4PZ6A 4QL5A 3D4WA 1ZXTA 1KL9A 1G91A 3HOUH 4HSVA 4HIMA 1B70B 2AMCB 1KLUD 2GA4B 1YBYA 4C3IG 3E0JA 2MUYA 2QW7A 2K05A 3OOCA 1HPCA 4A3MH 4DF7A 2DJGC 2K5VA 1DGSA 4CDFC 2A74C 4OIKA 3J80E 3CCMA 1H9SA 3NENA 4H02A 1RCVD 2SNSA 3NQTA 2I5MX 1A6XA 3PUYA 5C4XG 1CSPA 2K50A 2L9HA 5CYUA 4YWMA 4FF3A 4L5TA 3D6WA 3HKZB 3CCVA 5LMUL 2KECA 1EIHA 2XRSD 4JBMA 5NUCA 1KLGD 3SDZA 1TQOA 3T53B 2E2DC 1PTOB 3MC0B 1VQPA 1FNWA 1PZKD 3FDTA 5E7NA 1CT1D 2K04A 1SNQA 2ZJRA 3LWUA 2UUCL 3H3VI 1YNJD 4HN7A 3BG3A 1CQFA 2UUAQ 1XX8A 1EYAA 3SVMA 2K1BA 2B39A 1BUVT 4DAMA 5M9OA 3GTOH 1XTCD 3I4NB 4RMFA
chains in the Genus database with same CATH topology
4L5QA 4DR6Q 1J6QA 2KHJA 3U50C 1KD1C 2JA9A 1TWHH 3HOYG 4KHPL 1N32Q 4X6AH 2JA7G 1ASYA 4TQUS 4A3DG 5JEAG 2BH2A 2QEXA 4HJ9A 4JI4Q 4GKJL 2VL6A 1Q1BA 2JA5H 4DV2L 1NTGA 4JI2L 4JBKA 3GTQH 1JJ2A 3HOVH 4A3EG 3CCQA 5FLXc 2RHQB 4C2MH 3F2BA 2IX1A 4JI1L 1VQGA 1WFQA 1WYDA 1EOVA 3B6YA 2XTIA 4LUVA 1HR0L 4IPDA 4LFAQ 1KHIA 2EQSA 4BBRH 5HY6A 5FJ8G 4A75A 4A4IA 4C3HH 3GO5A 3FKIH 1PYBA 1SRUA 1N34Q 1NY4A 4XIGS 1Q82C 5M5WH 1VQFA 5LMUQ 1YHQA 4A3BG 4A3LG 3PUXA 3EIVA 3WWVA 2B63G 2AHOB 2OQ0A 4B3SQ 4JI5Q 4OXPA 4GKKQ 4DAYB 4GLVB 4UP9A 1SE8A 2HQLA 4JI6Q 3AEVA 4AQYL 2NVTH 1I3QH 4UPAA 4MTNA 1X65A 3I55A 4AH6A 4DR4Q 4JCVE 4IPGA 4UP8A 3JAMi 4DV4L 2UU9Q 3I4MH 2PQAA 1JE5A 3MXNB 5M5XH 4OWXB 3H3VH 3STBD 2VUMG 2OQKA 3G71A 2K5NA 3CW2C 1L0WA 4P72A 4J15A 3HOWH 3HOZG 1Q1EA 2UUBQ 4JV5L 1VQ6A 1A0IA 4KHZA 3HOUG 1I5FA 2K14A 1SFOH 4OWTB 2UXDL 4KHPQ 5AJ3L 2IY5B 1HZBA 2UXBQ 2KHIA 5IP9H 1N36L 4LF9L 2ZJPA 3J81j 2UUAL 4GKJQ 2R93H 2V1CC 4JI2Q 3UDIA 3I4OA 2JA8G 3K7UC 4AYBE 5LMNQ 2BA1A 2PI2E 5IYBG 2N8NA 2VQFL 4A3IH 4PZ8A 5C0XI 5IYDH 3E9HA 1AE2A 1PH8A 3CC2A 1I50H 2JJQA 4AYBG 4HIKA 1HR0Q 1NMGA 1UE7A 3HKSA 1VQ5A 1CKNB 1EUJA 4R1JA 1GKHA 1XPRA 3BZCA 5IY0A 3PO3G 2DGYA 3J80i 1I94L 1GVPA 3GTPH 1PH1A 2E2JH 2JA6G 1CKOA 1FL0A 3ZJYC 2K4KA 4LF4Q 3AFQA 1CKNA 5C4JH 4C3JH 3UE0A 1VS0A 3AYHB 5M5YH 1OXSC 2MO0A 3TS0A 1PH5A 4BBSH 5GAHC 3U58A 3ULPA 4POFA 1C0AA 1HNZQ 1Y14B 3FHWA 1EQRA 2D0PA 4DPGA 3VDYA 1AE3A 2A1AA 3FP9A 4FDBA 4YY3Q 3HOXG 4QJFA 2ASBA 3S15H 1PH4A 3KJOA 3CCUA 1JJGA 3KOJA 2OCEA 2PNHA 2VZAA 3PIOA 4DV4Q 1LUZA 4IJLA 2MO1A 2KBNA 1YHAA 4DV7L 2LXKA 3PUZA 1IL2A 1N34L 5K36G 3E0EA 1RIPA 2B29A 5M3FH 4K0KL 1LTLA 3K8AA 1OXUA 2VW9A 3ICEA 2AWOA 1Z47A 4GN5A 4JV5Q 4DK3C 4JI5L 2JEBI 3RR5A 2UXDQ 3AFPA 1EYGA 3PF4A 4OO1I 1C9OA 1PHJA 4JI6L 3PUVA 1N36Q 4DNIA 3H15A 2UXCL 4LF9Q 2FXQA 4GS3A 1WI5A 2ZJQA 2JA5G 1YJNA 4A3GG 3F1ZA 4YWLA 1VQOA 4GN3B 3HOVG 2UU9L 2ATWA 2LXJA 3PV0A 2VQFQ 1VQAA 2YTXA 1KRTA 2MNAA 4P71A 1TWCH 1FJGL 2F4VQ 2BA0A 3PUWA 4C3IH 2YYZA 1D8LA 3RN2A 4JC0A 3CMAA 2UUBL 2NN6I 4LFBL 4BBRG 3RN5A 2I5LX 5IWAL 2JK8A 2JE6I 4OONA 3RLOA 5C3EH 1R9TH 1I94Q 1YHBA 4A3JH 3J7A5 2UXBL 3J7ZC 4JBWA 1YITA 2HIVA 1VQMA 1GO3E 1X9NA 1IBML 2E5LL 3I4NH 2Z6KA 3F2DA 3H0GH 4JI7Q 1V1QA 1HZAA 1PFSA 1WOCA 4P74A 4YHHL 4WJ4A 5LMNL 3PSIA 3OW2A 1VQIA 1YJ9A 2A19A 5JJIA 3CCRA 4BXXH 4A93H 4JOIA 4DR1L 1ASZA 4GLXA 3K81C 1Y1WH 5C44H 1HJPA 2F3IA 5M3MH 1SR3A 4TVAB 3ERSX 2OWOA 4X66L 1FVIA 5HGQA 3I4MG 1QZHA 3T1HQ 3GTJH 3J81c 1VQ7A 1QVCA 4HJ5A 2RF4A 2ZTDA 4DV7Q 3L0OA 1UEBA 4GOPA 1XMQL 1PV4A 1K8GA 4LF5L 4LF4L 4K0KQ 4A3CH 1YVCA 3HOWG 1L2FA 1MKHA 3D0FA 2WP8J 1VQEA 4P75A 4DKAC 4A3FH 1HNWL 5JJKA 1PYSB 1A8VA 4RG1A 1Q8KA 2HT1A 1HNZL 1WJJA 3W1BA 5FLMH 2YTVA 2JQOA 3K80C 3PF5A 2LSSA 5H1SE 4YY3L 5IP9G 2BH8A 2R7ZH 2UXCQ 1PVOA 1OTCA 4O2DA 4LNQA 3TQYA 1X6OA 3S24A 2PQAB 1KQSA 3CAMA 3F2CA 2Q2IA 5GQOA 4JI0L 3CMEA 1Y1VH 3CD6A 1H95A 3M9BA 4WJ3M 2C35B 2L15A 1E22A 2VQEL 1WCMH 1Q81C 1NJIC 1JB7A 1FJGQ 4O0AA 1E1OA 1E7ZA 2YTYA 4GN4B 1EQQA 2E2IH 1JJCB 4EX5A 4LFBQ 1X3FA 4R4QA 5IYCH 3LGJA 1QUQB 2WAQE 2H5XA 5IWAQ 1S72A 1CKMA 5C0XJ 1N8RC 1PH9A 3KDFB 1PH2A 4R4CA 5JJLA 2KENA 4B3ML 3JAMc 1M1KC 1TWAH 1VQ4A 1IBMQ 1QUQA 1L1OA 4LF6L 4IOAA 4PG3A 2E5LQ 3GTGH 3KDFA 4YCVA 4BBSG 4A3MG 2IHEA 1YIJA 4APVA 4YHHQ 1TXYA 1MJEA 3A74A 4JG2A 4ALPA 4R4OA 4POGA 1YNXA 4HIDA 2PMZE 3PO2H 4BA1I 5J3BA 3I7FA 2RHSB 4BY1H 2F4VL 2NZOA 2JEAI 4IO9A 2VS1A 2IX0A 4DR1Q 1YI2A 3A5UA 3BU2A 4JBJA 3CCEA 1G6PA 1VQCA 4LW1A 2Z6KC 4HJ7A 4X66Q 1A63A 1RL2A 1XMQQ 4LF5Q 2N49A 2GVBA 3CCLA 1Q7YC 1VQ8A 3KFUA 1J5EQ 1Q12A 4JOIC 1GD7A 1YJWA 1HNWQ 1YZ6A 4JI7L 1G291 1BBUA 2Z0SA 1OXTA 1BKBA 3HKZE 1QVGA 4QQBX 3UDFA 3NELA 1QVFA 4P73A 3CC4A 5EAYA 3STBC 4GOPC 2VUMH 1U0LA 1XNRQ 3EBEA 3J80c 1N33L 3HKZG 4DUZL 1XPOA 1UE5A 2NVXH 2GVAA 3T1YL 1E24A 2CKZB 4DK6C 1W2BA 4JI0Q 4DV6Q 2R92H 1IBLL 1S3OA 3DLLA 1HZ9A 1T9HA 3T1HL 1PH6A 1E3PA 2B3GA 4ME3A 1SMXA 4X64L 4L5SA 2VQEQ 1XJVA 1C7YA 1VQBA 1IBKL 3S1MH 1A62A 3M7NA 1Z9FA 1VCIA 3KJPA 1OXXK 4A76A 3KF8B 4QGUA 2IT1A 4A3KH 3S1RH 4IFDI 2E8GA 5C0XG 2PI2A 2DUDA 3W1GA 3W5OA 3PCOB 5C3EG 4OX9L 1XNQL 4B3MQ 4A3JG 4HJAA 1KAWA 3RLFA 4UY8C 3GD7A 4LWCA 4DV5L 1SROA 4LF6Q 3KF6B 3I4NG 2HHHL 4JI3Q 2KCTA 4DV3L 2MQHA 3H0GG 1XMOL 1SLJA 2WB1E 1X3GA 3KF6A 1NBWA 3NBHB 2D0OA 4Y52H 2Q2HA 3A0JA 2NZHA 2CFMA 2WB1G 4BXXG 4DV1Q 1EWIA 4DV0L 1GM5A 4BY7H 1Y1WG 1L1OC 1MJCA 2QGQA 5C44G 4GNXB 5M3MG 3CF5A 4DR2Q 3M4OH 3ER0A 3UDXA 1LYLA 3FKIG 1TWGH 4GNXA 3K7AH 3TREA 2R7FA 4X62Q 2Q2TA 3D31A 4A3FG 1X55A 3ULJA 2K52A 1SN8A 1VQJA 1BVSA 5C4XH 3RZOH 1P8LA 2VY3A 5FLMG 3PIPA 2Y0SE 3I2ZA 1N9WA 2R6GA 2R7ZG 1IZ6A 4B3RQ 1I6HH 4PZ7A 3L7ZC 4DUZQ 1V43A 1N33Q 3S1NH 2Y0SG 4GOPB 4IFDG 3T1YQ 5BR8L 1QZGA 1S40A 2CCZA 3GTMH 1HH2P 3F8TA 1IBLQ 1JMCA 1Y1VG 4OO1G 1D7QA 2OTLA 3S2HH 4DR7Q 4LF7Q 3HFZB 4X64Q 1VQDA 1WCMG 3L2PA 1EIFA 4JI8L 1IBKQ 3IRBA 1J5EL 2ZM6Q 1K83H 2ZTCA 5IP7H 3J81i 3TS2A 4DR5Q 4A3GH 4DUYQ 4LF8L 5IYCG 3TEHB 1MIUA 1XNQQ 2K5HA 3M3YH 4OX9Q 4B3TQ 1IYJB 1K0RA 3S14H 1XNRL 2ZTEA 2NN6G 4DV5Q 2R7DA 5IE8A 2R93G 2HHHQ 2NVQH 4DV3Q 4DV6L 1XMOQ 1VQ9A 3CP0A 4KI0A 3CCSA 1G51A 3DM3A 3JC66 3HOYH 1X56A 1V9PA 3PO2G 4A3IG 2JA7H 5ELOA 3GTLH 1JT8A 5IT9c 4BY1G 4XTCS 5IYDG 4A3DH 4X65L 3OTOQ 1CSQA 4DV0Q 2WFWA 1EFWA 2I0QA 2EXDA 1PA6A 2D62A 4MZ9A 3RLNA 4YCUA 3UDGA 1L1OB 4NXML 4A3EH 1UE6A 1K8AC 3G4SA 2AKWB 4DR3L 1LM0A 1K3RA 4NXNL 4L5RC 1PH3A 2UUCQ 1UE1A 4LFCL 2AWNA 2WAQG 1HNXL 3KLWA 4JI3L 2N78A 3K0XA 1NMFA 3KYHC 1P16A 2KCMA 3MEFA 3Q8DA 5FJ8H 4JYAQ 1YEZA 4PMWA 2ES2A 3GDEA 3A5ZB 3I56A 2F52A 4QIWE 4GNXC 1AH9A 1XPUA 4DV1L 4A3BH 4YWKA 4A3LH 3U4VA 2R92G 2GN5A 2B63H 5GROA 5BR8Q 3CPFA 4IPCA 3M85A 1EIYB 2OTJA 2EIFA 2XGTA 2I5HA 4DR2L 3U4ZA 3GTKH 1VQLA 5ELNA 4IOCA 5DLQE 5M3FG 1OXVA 3CC7A 3EN2A 2YV5A 2Q2UA 4JI8Q 3RNUA 1XTDA 2K75A 4X62L 1BBWA 4LUOA 3M4PA 4YCWA 4Y7NH 4DV2Q 4LF8Q 4A3KG 3UE1A 3RZDH 3CPWA 2YU9H 3TRZA 5GADC 4B3RL 3CQZH 4PZ6A 1W3SA 3CCJA 4JI1Q 3HOZH 3BZKA 4QL5A 1U5KA 1X3EA 2RCNA 1KL9A 1K9MC 1VQKA 3S17H 4IFDJ 2QA4A 4DR6L 3HOUH 3G48A 1TWFH 1N32L 4IPHA 4DR7L 4HIMA 3OYYA 1B70B 2AMCB 4LF7L 1O7IA 4UP7A 1B8AA 4EQ5A 1YBYA 4KLKA 3ULLA 4BA2I 4AIMA 5JEAJ 4X65Q 3SGIA 4QY7A 4JI4L 2ZM6L 2A8VA 4BY7G 1KIXA 4A3MH 4DR5L 4DUYL 1VQHA 2JA8H 2K5VA 1DGSA 3S16H 1UWVA 2HIXA 3CXCA 4NXMQ 3CCMA 1FGUA 1K73C 5IYBH 4DR3Q 3NENA 4H02A 4B3TL 4NXNQ 3AQQA 3S1QH 5GAGC 4LUZA 2ALYB 4AQYQ 3E9IA 5LMNW 4OWWB 3G6EA 4LFCQ 1HNXQ 2E2HH 1CUKA 2I5MX 3PUYA 4LFAL 1B7YB 5C4XG 4NPSA 1CSPA 1Q46A 4HIOA 3PO3H 2MFIA 5GAEC 2K50A 1E1TA 1HR0W 2ID0A 3BJUA 2CQOA 4YWMA 2JA6H 2VNUD 4L5TA 1KXLA 3NEMA 3S2DH 3CCVA 5LMUL 4A93G 3OTOL 4R4TA 1NE3A 4JBMA 1Q86C 4B3SL 1X54A 1KC8C 4GKKL 1HZCA 5AJ3Q 1VQPA 4IJHA 5E7NA 1PH7A 3HOXH 1IXRA 1KRSA 2ZJRA 4A3CG 3H3VI 2CWPA 2UUCL 3PGZA 2UUAQ 4GLAC 4DR4L 5IP7G 1M90C 4JYAL 4DAMA 1VQNA 3GTOH 3M4QA 2N3SA 4HJ8A 2CWAA 4R4IA 4MNOA 2IHFA 4NB3A 4RMFA 2NVYH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L5Q A;  4DR6 Q;  1J6Q A;  2KHJ A;  3U50 C;  1KD1 C;  2JA9 A;  1TWH H;  3HOY G;  4KHP L;  1N32 Q;  4X6A H;  2JA7 G;  1ASY A;  4TQU S;  4A3D G;  5JEA G;  2BH2 A;  2QEX A;  4HJ9 A;  4JI4 Q;  4GKJ L;  2VL6 A;  1Q1B A;  2JA5 H;  4DV2 L;  1NTG A;  4JI2 L;  4JBK A;  3GTQ H;  1JJ2 A;  3HOV H;  4A3E G;  3CCQ A;  5FLX c;  2RHQ B;  4C2M H;  3F2B A;  2IX1 A;  4JI1 L;  1VQG A;  1WFQ A;  1WYD A;  1EOV A;  3B6Y A;  2XTI A;  4LUV A;  1HR0 L;  4IPD A;  4LFA Q;  1KHI A;  2EQS A;  4BBR H;  5HY6 A;  5FJ8 G;  4A75 A;  4A4I A;  4C3H H;  3GO5 A;  3FKI H;  1PYB A;  1SRU A;  1N34 Q;  1NY4 A;  4XIG S;  1Q82 C;  5M5W H;  1VQF A;  5LMU Q;  1YHQ A;  4A3B G;  4A3L G;  3PUX A;  3EIV A;  3WWV A;  2B63 G;  2AHO B;  2OQ0 A;  4B3S Q;  4JI5 Q;  4OXP A;  4GKK Q;  4DAY B;  4GLV B;  4UP9 A;  1SE8 A;  2HQL A;  4JI6 Q;  3AEV A;  4AQY L;  2NVT H;  1I3Q H;  4UPA A;  4MTN A;  1X65 A;  3I55 A;  4AH6 A;  4DR4 Q;  4JCV E;  4IPG A;  4UP8 A;  3JAM i;  4DV4 L;  2UU9 Q;  3I4M H;  2PQA A;  1JE5 A;  3MXN B;  5M5X H;  4OWX B;  3H3V H;  3STB D;  2VUM G;  2OQK A;  3G71 A;  2K5N A;  3CW2 C;  1L0W A;  4P72 A;  4J15 A;  3HOW H;  3HOZ G;  1Q1E A;  2UUB Q;  4JV5 L;  1VQ6 A;  1A0I A;  4KHZ A;  3HOU G;  1I5F A;  2K14 A;  1SFO H;  4OWT B;  2UXD L;  4KHP Q;  5AJ3 L;  2IY5 B;  1HZB A;  2UXB Q;  2KHI A;  5IP9 H;  1N36 L;  4LF9 L;  2ZJP A;  3J81 j;  2UUA L;  4GKJ Q;  2R93 H;  2V1C C;  4JI2 Q;  3UDI A;  3I4O A;  2JA8 G;  3K7U C;  4AYB E;  5LMN Q;  2BA1 A;  2PI2 E;  5IYB G;  2N8N A;  2VQF L;  4A3I H;  4PZ8 A;  5C0X I;  5IYD H;  3E9H A;  1AE2 A;  1PH8 A;  3CC2 A;  1I50 H;  2JJQ A;  4AYB G;  4HIK A;  1HR0 Q;  1NMG A;  1UE7 A;  3HKS A;  1VQ5 A;  1CKN B;  1EUJ A;  4R1J A;  1GKH A;  1XPR A;  3BZC A;  5IY0 A;  3PO3 G;  2DGY A;  3J80 i;  1I94 L;  1GVP A;  3GTP H;  1PH1 A;  2E2J H;  2JA6 G;  1CKO A;  1FL0 A;  3ZJY C;  2K4K A;  4LF4 Q;  3AFQ A;  1CKN A;  5C4J H;  4C3J H;  3UE0 A;  1VS0 A;  3AYH B;  5M5Y H;  1OXS C;  2MO0 A;  3TS0 A;  1PH5 A;  4BBS H;  5GAH C;  3U58 A;  3ULP A;  4POF A;  1C0A A;  1HNZ Q;  1Y14 B;  3FHW A;  1EQR A;  2D0P A;  4DPG A;  3VDY A;  1AE3 A;  2A1A A;  3FP9 A;  4FDB A;  4YY3 Q;  3HOX G;  4QJF A;  2ASB A;  3S15 H;  1PH4 A;  3KJO A;  3CCU A;  1JJG A;  3KOJ A;  2OCE A;  2PNH A;  2VZA A;  3PIO A;  4DV4 Q;  1LUZ A;  4IJL A;  2MO1 A;  2KBN A;  1YHA A;  4DV7 L;  2LXK A;  3PUZ A;  1IL2 A;  1N34 L;  5K36 G;  3E0E A;  1RIP A;  2B29 A;  5M3F H;  4K0K L;  1LTL A;  3K8A A;  1OXU A;  2VW9 A;  3ICE A;  2AWO A;  1Z47 A;  4GN5 A;  4JV5 Q;  4DK3 C;  4JI5 L;  2JEB I;  3RR5 A;  2UXD Q;  3AFP A;  1EYG A;  3PF4 A;  4OO1 I;  1C9O A;  1PHJ A;  4JI6 L;  3PUV A;  1N36 Q;  4DNI A;  3H15 A;  2UXC L;  4LF9 Q;  2FXQ A;  4GS3 A;  1WI5 A;  2ZJQ A;  2JA5 G;  1YJN A;  4A3G G;  3F1Z A;  4YWL A;  1VQO A;  4GN3 B;  3HOV G;  2UU9 L;  2ATW A;  2LXJ A;  3PV0 A;  2VQF Q;  1VQA A;  2YTX A;  1KRT A;  2MNA A;  4P71 A;  1TWC H;  1FJG L;  2F4V Q;  2BA0 A;  3PUW A;  4C3I H;  2YYZ A;  1D8L A;  3RN2 A;  4JC0 A;  3CMA A;  2UUB L;  2NN6 I;  4LFB L;  4BBR G;  3RN5 A;  2I5L X;  5IWA L;  2JK8 A;  2JE6 I;  4OON A;  3RLO A;  5C3E H;  1R9T H;  1I94 Q;  1YHB A;  4A3J H;  3J7A 5;  2UXB L;  3J7Z C;  4JBW A;  1YIT A;  2HIV A;  1VQM A;  1GO3 E;  1X9N A;  1IBM L;  2E5L L;  3I4N H;  2Z6K A;  3F2D A;  3H0G H;  4JI7 Q;  1V1Q A;  1HZA A;  1PFS A;  1WOC A;  4P74 A;  4YHH L;  4WJ4 A;  5LMN L;  3PSI A;  3OW2 A;  1VQI A;  1YJ9 A;  2A19 A;  5JJI A;  3CCR A;  4BXX H;  4A93 H;  4JOI A;  4DR1 L;  1ASZ A;  4GLX A;  3K81 C;  1Y1W H;  5C44 H;  1HJP A;  2F3I A;  5M3M H;  1SR3 A;  4TVA B;  3ERS X;  2OWO A;  4X66 L;  1FVI A;  5HGQ A;  3I4M G;  1QZH A;  3T1H Q;  3GTJ H;  3J81 c;  1VQ7 A;  1QVC A;  4HJ5 A;  2RF4 A;  2ZTD A;  4DV7 Q;  3L0O A;  1UEB A;  4GOP A;  1XMQ L;  1PV4 A;  1K8G A;  4LF5 L;  4LF4 L;  4K0K Q;  4A3C H;  1YVC A;  3HOW G;  1L2F A;  1MKH A;  3D0F A;  2WP8 J;  1VQE A;  4P75 A;  4DKA C;  4A3F H;  1HNW L;  5JJK A;  1PYS B;  1A8V A;  4RG1 A;  1Q8K A;  2HT1 A;  1HNZ L;  1WJJ A;  3W1B A;  5FLM H;  2YTV A;  2JQO A;  3K80 C;  3PF5 A;  2LSS A;  5H1S E;  4YY3 L;  5IP9 G;  2BH8 A;  2R7Z H;  2UXC Q;  1PVO A;  1OTC A;  4O2D A;  4LNQ A;  3TQY A;  1X6O A;  3S24 A;  2PQA B;  1KQS A;  3CAM A;  3F2C A;  2Q2I A;  5GQO A;  4JI0 L;  3CME A;  1Y1V H;  3CD6 A;  1H95 A;  3M9B A;  4WJ3 M;  2C35 B;  2L15 A;  1E22 A;  2VQE L;  1WCM H;  1Q81 C;  1NJI C;  1JB7 A;  1FJG Q;  4O0A A;  1E1O A;  1E7Z A;  2YTY A;  4GN4 B;  1EQQ A;  2E2I H;  1JJC B;  4EX5 A;  4LFB Q;  1X3F A;  4R4Q A;  5IYC H;  3LGJ A;  1QUQ B;  2WAQ E;  2H5X A;  5IWA Q;  1S72 A;  1CKM A;  5C0X J;  1N8R C;  1PH9 A;  3KDF B;  1PH2 A;  4R4C A;  5JJL A;  2KEN A;  4B3M L;  3JAM c;  1M1K C;  1TWA H;  1VQ4 A;  1IBM Q;  1QUQ A;  1L1O A;  4LF6 L;  4IOA A;  4PG3 A;  2E5L Q;  3GTG H;  3KDF A;  4YCV A;  4BBS G;  4A3M G;  2IHE A;  1YIJ A;  4APV A;  4YHH Q;  1TXY A;  1MJE A;  3A74 A;  4JG2 A;  4ALP A;  4R4O A;  4POG A;  1YNX A;  4HID A;  2PMZ E;  3PO2 H;  4BA1 I;  5J3B A;  3I7F A;  2RHS B;  4BY1 H;  2F4V L;  2NZO A;  2JEA I;  4IO9 A;  2VS1 A;  2IX0 A;  4DR1 Q;  1YI2 A;  3A5U A;  3BU2 A;  4JBJ A;  3CCE A;  1G6P A;  1VQC A;  4LW1 A;  2Z6K C;  4HJ7 A;  4X66 Q;  1A63 A;  1RL2 A;  1XMQ Q;  4LF5 Q;  2N49 A;  2GVB A;  3CCL A;  1Q7Y C;  1VQ8 A;  3KFU A;  1J5E Q;  1Q12 A;  4JOI C;  1GD7 A;  1YJW A;  1HNW Q;  1YZ6 A;  4JI7 L;  1G29 1;  1BBU A;  2Z0S A;  1OXT A;  1BKB A;  3HKZ E;  1QVG A;  4QQB X;  3UDF A;  3NEL A;  1QVF A;  4P73 A;  3CC4 A;  5EAY A;  3STB C;  4GOP C;  2VUM H;  1U0L A;  1XNR Q;  3EBE A;  3J80 c;  1N33 L;  3HKZ G;  4DUZ L;  1XPO A;  1UE5 A;  2NVX H;  2GVA A;  3T1Y L;  1E24 A;  2CKZ B;  4DK6 C;  1W2B A;  4JI0 Q;  4DV6 Q;  2R92 H;  1IBL L;  1S3O A;  3DLL A;  1HZ9 A;  1T9H A;  3T1H L;  1PH6 A;  1E3P A;  2B3G A;  4ME3 A;  1SMX A;  4X64 L;  4L5S A;  2VQE Q;  1XJV A;  1C7Y A;  1VQB A;  1IBK L;  3S1M H;  1A62 A;  3M7N A;  1Z9F A;  1VCI A;  3KJP A;  1OXX K;  4A76 A;  3KF8 B;  4QGU A;  2IT1 A;  4A3K H;  3S1R H;  4IFD I;  2E8G A;  5C0X G;  2PI2 A;  2DUD A;  3W1G A;  3W5O A;  3PCO B;  5C3E G;  4OX9 L;  1XNQ L;  4B3M Q;  4A3J G;  4HJA A;  1KAW A;  3RLF A;  4UY8 C;  3GD7 A;  4LWC A;  4DV5 L;  1SRO A;  4LF6 Q;  3KF6 B;  3I4N G;  2HHH L;  4JI3 Q;  2KCT A;  4DV3 L;  2MQH A;  3H0G G;  1XMO L;  1SLJ A;  2WB1 E;  1X3G A;  3KF6 A;  1NBW A;  3NBH B;  2D0O A;  4Y52 H;  2Q2H A;  3A0J A;  2NZH A;  2CFM A;  2WB1 G;  4BXX G;  4DV1 Q;  1EWI A;  4DV0 L;  1GM5 A;  4BY7 H;  1Y1W G;  1L1O C;  1MJC A;  2QGQ A;  5C44 G;  4GNX B;  5M3M G;  3CF5 A;  4DR2 Q;  3M4O H;  3ER0 A;  3UDX A;  1LYL A;  3FKI G;  1TWG H;  4GNX A;  3K7A H;  3TRE A;  2R7F A;  4X62 Q;  2Q2T A;  3D31 A;  4A3F G;  1X55 A;  3ULJ A;  2K52 A;  1SN8 A;  1VQJ A;  1BVS A;  5C4X H;  3RZO H;  1P8L A;  2VY3 A;  5FLM G;  3PIP A;  2Y0S E;  3I2Z A;  1N9W A;  2R6G A;  2R7Z G;  1IZ6 A;  4B3R Q;  1I6H H;  4PZ7 A;  3L7Z C;  4DUZ Q;  1V43 A;  1N33 Q;  3S1N H;  2Y0S G;  4GOP B;  4IFD G;  3T1Y Q;  5BR8 L;  1QZG A;  1S40 A;  2CCZ A;  3GTM H;  1HH2 P;  3F8T A;  1IBL Q;  1JMC A;  1Y1V G;  4OO1 G;  1D7Q A;  2OTL A;  3S2H H;  4DR7 Q;  4LF7 Q;  3HFZ B;  4X64 Q;  1VQD A;  1WCM G;  3L2P A;  1EIF A;  4JI8 L;  1IBK Q;  3IRB A;  1J5E L;  2ZM6 Q;  1K83 H;  2ZTC A;  5IP7 H;  3J81 i;  3TS2 A;  4DR5 Q;  4A3G H;  4DUY Q;  4LF8 L;  5IYC G;  3TEH B;  1MIU A;  1XNQ Q;  2K5H A;  3M3Y H;  4OX9 Q;  4B3T Q;  1IYJ B;  1K0R A;  3S14 H;  1XNR L;  2ZTE A;  2NN6 G;  4DV5 Q;  2R7D A;  5IE8 A;  2R93 G;  2HHH Q;  2NVQ H;  4DV3 Q;  4DV6 L;  1XMO Q;  1VQ9 A;  3CP0 A;  4KI0 A;  3CCS A;  1G51 A;  3DM3 A;  3JC6 6;  3HOY H;  1X56 A;  1V9P A;  3PO2 G;  4A3I G;  2JA7 H;  5ELO A;  3GTL H;  1JT8 A;  5IT9 c;  4BY1 G;  4XTC S;  5IYD G;  4A3D H;  4X65 L;  3OTO Q;  1CSQ A;  4DV0 Q;  2WFW A;  1EFW A;  2I0Q A;  2EXD A;  1PA6 A;  2D62 A;  4MZ9 A;  3RLN A;  4YCU A;  3UDG A;  1L1O B;  4NXM L;  4A3E H;  1UE6 A;  1K8A C;  3G4S A;  2AKW B;  4DR3 L;  1LM0 A;  1K3R A;  4NXN L;  4L5R C;  1PH3 A;  2UUC Q;  1UE1 A;  4LFC L;  2AWN A;  2WAQ G;  1HNX L;  3KLW A;  4JI3 L;  2N78 A;  3K0X A;  1NMF A;  3KYH C;  1P16 A;  2KCM A;  3MEF A;  3Q8D A;  5FJ8 H;  4JYA Q;  1YEZ A;  4PMW A;  2ES2 A;  3GDE A;  3A5Z B;  3I56 A;  2F52 A;  4QIW E;  4GNX C;  1AH9 A;  1XPU A;  4DV1 L;  4A3B H;  4YWK A;  4A3L H;  3U4V A;  2R92 G;  2GN5 A;  2B63 H;  5GRO A;  5BR8 Q;  3CPF A;  4IPC A;  3M85 A;  1EIY B;  2OTJ A;  2EIF A;  2XGT A;  2I5H A;  4DR2 L;  3U4Z A;  3GTK H;  1VQL A;  5ELN A;  4IOC A;  5DLQ E;  5M3F G;  1OXV A;  3CC7 A;  3EN2 A;  2YV5 A;  2Q2U A;  4JI8 Q;  3RNU A;  1XTD A;  2K75 A;  4X62 L;  1BBW A;  4LUO A;  3M4P A;  4YCW A;  4Y7N H;  4DV2 Q;  4LF8 Q;  4A3K G;  3UE1 A;  3RZD H;  3CPW A;  2YU9 H;  3TRZ A;  5GAD C;  4B3R L;  3CQZ H;  4PZ6 A;  1W3S A;  3CCJ A;  4JI1 Q;  3HOZ H;  3BZK A;  4QL5 A;  1U5K A;  1X3E A;  2RCN A;  1KL9 A;  1K9M C;  1VQK A;  3S17 H;  4IFD J;  2QA4 A;  4DR6 L;  3HOU H;  3G48 A;  1TWF H;  1N32 L;  4IPH A;  4DR7 L;  4HIM A;  3OYY A;  1B70 B;  2AMC B;  4LF7 L;  1O7I A;  4UP7 A;  1B8A A;  4EQ5 A;  1YBY A;  4KLK A;  3ULL A;  4BA2 I;  4AIM A;  5JEA J;  4X65 Q;  3SGI A;  4QY7 A;  4JI4 L;  2ZM6 L;  2A8V A;  4BY7 G;  1KIX A;  4A3M H;  4DR5 L;  4DUY L;  1VQH A;  2JA8 H;  2K5V A;  1DGS A;  3S16 H;  1UWV A;  2HIX A;  3CXC A;  4NXM Q;  3CCM A;  1FGU A;  1K73 C;  5IYB H;  4DR3 Q;  3NEN A;  4H02 A;  4B3T L;  4NXN Q;  3AQQ A;  3S1Q H;  5GAG C;  4LUZ A;  2ALY B;  4AQY Q;  3E9I A;  5LMN W;  4OWW B;  3G6E A;  4LFC Q;  1HNX Q;  2E2H H;  1CUK A;  2I5M X;  3PUY A;  4LFA L;  1B7Y B;  5C4X G;  4NPS A;  1CSP A;  1Q46 A;  4HIO A;  3PO3 H;  2MFI A;  5GAE C;  2K50 A;  1E1T A;  1HR0 W;  2ID0 A;  3BJU A;  2CQO A;  4YWM A;  2JA6 H;  2VNU D;  4L5T A;  1KXL A;  3NEM A;  3S2D H;  3CCV A;  5LMU L;  4A93 G;  3OTO L;  4R4T A;  1NE3 A;  4JBM A;  1Q86 C;  4B3S L;  1X54 A;  1KC8 C;  4GKK L;  1HZC A;  5AJ3 Q;  1VQP A;  4IJH A;  5E7N A;  1PH7 A;  3HOX H;  1IXR A;  1KRS A;  2ZJR A;  4A3C G;  3H3V I;  2CWP A;  2UUC L;  3PGZ A;  2UUA Q;  4GLA C;  4DR4 L;  5IP7 G;  1M90 C;  4JYA L;  4DAM A;  1VQN A;  3GTO H;  3M4Q A;  2N3S A;  4HJ8 A;  2CWA A;  4R4I A;  4MNO A;  2IHF A;  4NB3 A;  4RMF A;  2NVY H; 
#chains in the Genus database with same CATH topology
 4L5Q A;  4JW0 A;  1KD1 C;  3LX0 A;  2CHB D;  4X6A H;  4A3D G;  2XNA C;  2BH2 A;  4JI4 Q;  5CV5 A;  1ICW A;  3WOE A;  2A6H D;  3URY A;  2ICE C;  4JI1 L;  1D5Z C;  1WFQ A;  2XTI A;  1HR0 L;  4LUV A;  4RGN A;  1KHI A;  5HY6 A;  5CV8 A;  1WTV A;  4A4I A;  3GO5 A;  4N8X 1;  1FNV A;  1VQF A;  2DN8 A;  2ICI A;  1YHQ A;  3I3C A;  3I73 A;  4K5X A;  3EIV A;  2B63 G;  5J39 A;  2AHO B;  3GV3 A;  4JI5 Q;  4OXP A;  3IL8 A;  1SE8 A;  2PYK A;  3OMC A;  1A3T A;  2EZV A;  2XVS A;  3AEV A;  5A2Q L;  1A3V A;  4UPA A;  2F0T A;  3QO2 A;  2ZXR A;  4MTN A;  1SYB A;  2Q8R E;  2EYL A;  4BS9 A;  1CK1 A;  3KK7 A;  3MXN B;  5ELF A;  1F9P A;  5M5X H;  1TWA B;  3G71 A;  3HOW H;  2R93 B;  3HOZ G;  2CQA A;  1ET9 A;  2PZU A;  3RMH A;  2UUB Q;  2NTT A;  1SBB B;  4KHZ A;  2B2W C;  5AJ3 L;  2IY5 B;  1DD2 A;  1JIC A;  1U4L A;  3R3O A;  1EQV A;  5BN4 A;  5DNF A;  1WD0 A;  4JI2 Q;  2JA8 G;  1Z7T A;  1I4G A;  1LV9 A;  2PI2 E;  4RH6 A;  3HS0 C;  1QB5 D;  1SNM A;  2VQF L;  5C0X I;  5IYD H;  3E9H A;  1SE3 A;  1PH8 A;  1PTO F;  1Y69 U;  2WAC A;  1BCP B;  1CKN B;  4R8N A;  1EUJ A;  5E4W C;  5IY0 A;  3A8I E;  3OIQ A;  2E2J H;  2DNC A;  2K4K A;  1TY0 A;  1LT3 D;  4C3J H;  3AYH B;  1X32 A;  4POF A;  1WTH A;  1K3B C;  4DPG A;  2A1A A;  3FP9 A;  4YY3 Q;  3HOX G;  1HTL D;  2ASB A;  3S1M B;  1NNX A;  3VA7 A;  1PH4 A;  1A3U A;  1B9M A;  1JJG A;  3GV6 A;  1F2Y A;  3PIO A;  4U67 3;  4DV4 Q;  4IJL A;  1K8O A;  2MO1 A;  2FFK B;  2RSN A;  1N34 L;  2B29 A;  4K0K L;  1AZP A;  3K8A A;  1LTI D;  1OXU A;  3ICE A;  4DK3 C;  1GJX A;  1L0Y B;  4OO1 I;  1EL0 A;  1C9O A;  1B1Z A;  1BOS A;  1PHJ A;  3AU7 A;  2A6E D;  3PUV A;  2C5C A;  4RKL A;  4XDX A;  4DNI A;  2ZT9 C;  1C48 A;  3H15 A;  5I6Y A;  5G3L F;  3F1Z A;  2UU9 L;  1AP0 A;  2LXJ A;  4K8I A;  3K5L A;  3CU7 A;  4P71 A;  3A55 A;  4FF2 A;  2Z8L A;  2BA0 A;  4FXK C;  5C4X B;  2ZXP A;  2EYF A;  2MPM A;  2A73 B;  2UXB L;  1WTX A;  3J7Z C;  5A2Q E;  4OGQ C;  1IBM L;  3I4N H;  4H0L C;  4P2C B;  1LTS D;  1HZA A;  1V1Q A;  3S2H B;  2Z1C A;  2WIN B;  3HG9 A;  1YJ9 A;  3V2T A;  1GUT A;  3P7J A;  4BXX H;  1JWS D;  1K83 B;  3TBI B;  3W2D A;  4HMJ A;  1ASZ A;  4GLX A;  3K81 C;  4TVA B;  3ERS X;  4X66 L;  1FVI A;  3KUP A;  1QVC A;  4HJ5 A;  2RF4 A;  2ZTD A;  5I2Y A;  4L63 B;  4LF5 L;  5EPL A;  1ICF B;  1D1K A;  2NVQ B;  2WP8 J;  4DKA C;  1HNW L;  1JC7 A;  2HT1 A;  5FLM H;  1RJT A;  4B9W A;  2LSS A;  5IP9 G;  1BCP F;  4A3D B;  1PVO A;  1OTC A;  1DCZ A;  4RA8 A;  3CAM A;  3K59 A;  3CME A;  3CD6 A;  1H95 A;  4XQN A;  3WOF A;  1WTO A;  4WJ3 M;  2C35 B;  1H9K A;  1EEI D;  1D1I A;  3K5N A;  1Q81 C;  3DUZ A;  1AFP A;  2NZ1 D;  1E1O A;  1E7Z A;  2YTY A;  1EQQ A;  4RAU C;  1SNP A;  1X3F A;  5IYC H;  5IWA Q;  1QUQ B;  1PH9 A;  1N8R C;  1CKM A;  4LJZ C;  1F9R A;  2A6H C;  5C0X J;  2KEE A;  2SNM A;  1M1K C;  1TWA H;  1VQ4 A;  2NN6 H;  1L1O A;  2B63 B;  4YCV A;  4A3M G;  2IHE A;  1PZJ D;  5TSS A;  3GTK B;  2PZW A;  4CBV A;  1YNX A;  1JB3 A;  5J3B A;  1STE A;  2NZO A;  3MXU A;  4DR1 Q;  2EXZ A;  1SMY D;  3A5U A;  3CCE A;  1G6P A;  1ONL A;  4XXE A;  2HUG A;  1F9Q A;  1RL2 A;  1MI2 A;  5JJZ A;  1XMQ Q;  2MHV A;  2N49 A;  3HOZ B;  1VQ8 A;  2X69 A;  3AB9 A;  4JOI C;  1YJW A;  2KJX A;  3L3O C;  2Z0S A;  4HCE A;  1BKB A;  4XT1 B;  3UDF A;  2VUM H;  2LY7 A;  1S5E D;  4GOP C;  1XNR Q;  2G9D A;  1N33 L;  1D6E C;  4TRD A;  4DK6 C;  2JA8 B;  1BDO A;  3S16 B;  5I9P A;  2QIL A;  4X64 L;  2NUC A;  1C7Y A;  5D65 A;  1IBK L;  3S1M H;  2F0I A;  5LL6 X;  1SDF A;  3KF8 B;  4LMQ D;  4IFD I;  2KCC A;  2E8G A;  3W5O A;  5C3E G;  1SYE A;  3RLF A;  3GD7 A;  4LWC A;  4LF6 Q;  2F0J A;  2HHH L;  3ONA B;  4DV3 L;  2MQH A;  3H0G G;  4JI3 Q;  1RF2 D;  1X3G A;  4J8Q A;  3BVZ A;  3KF6 A;  3I4L A;  3VYU A;  3HOX B;  2D5D A;  2NZH A;  4KKS A;  1RDP D;  2WB1 G;  1EWI A;  4HTH A;  1Y1W G;  5C44 G;  1SYD A;  2LS0 1;  4LAA A;  2L4N A;  3MFY A;  3TRE A;  1ML0 D;  4X62 Q;  1X55 A;  3ULJ A;  4DXG A;  2H1E A;  1ENF A;  4KK7 A;  5C4X H;  2Y0S E;  2R6G A;  2R7Z G;  1ILQ A;  1EYD A;  3P20 A;  4ZRZ A;  1I6H H;  2BOS A;  4DUZ Q;  1V43 A;  1JWU D;  4IFD G;  2CCZ A;  1QZG A;  1HH2 P;  1IBL Q;  1CA5 A;  1D7Q A;  3S2H H;  4WOR A;  4N9P A;  4IZ8 A;  2EE1 A;  1EIF A;  4JI8 L;  3IRB A;  1J5E L;  1K83 H;  4KV6 A;  3OSO A;  1ROD A;  3H09 A;  1VF7 A;  1XNQ Q;  3H91 A;  2B2U C;  4EVO A;  2NVQ H;  4QUC A;  5EGT A;  1JE4 A;  1VQ9 A;  4KI0 A;  1G51 A;  3JC6 6;  5EQ0 A;  3A56 A;  1JT8 A;  1ILP A;  5IYD G;  1TKW B;  4A3D H;  3DWP A;  1UUP A;  1I6V C;  3RLN A;  4NXM L;  1L1O B;  4CKB A;  1UE6 A;  3PMF A;  3G4S A;  1BF4 A;  4HR7 B;  1PH3 A;  2UUC Q;  4DAY A;  4LFC L;  2WAQ G;  1V1O A;  3K0X A;  1NMF A;  4KKU A;  4PV1 C;  3A5Z B;  3R8B A;  2F52 A;  2L11 A;  3A54 A;  1EY4 A;  4DV1 L;  3R2I A;  1TVX A;  2GN5 A;  4KD4 A;  5GRO A;  2B63 H;  5EKK A;  3M85 A;  1CM9 A;  4NDX A;  2EPB A;  3GTK H;  1I50 B;  2BE5 D;  3EN2 A;  3RNU A;  1XTD A;  3P1H A;  3M4P A;  2F0K A;  1GUW A;  1TS2 A;  5KYI A;  3GTP B;  3TP7 A;  3TRZ A;  3CQZ H;  4JI1 Q;  3HOZ H;  1XXG A;  2RCN A;  3Q23 A;  1VQK A;  4IFD J;  2B2T C;  4G7O C;  4OIJ A;  4DR6 L;  5KYL A;  2E74 C;  1EY0 A;  1N32 L;  4IPH A;  3OYY A;  5IOD A;  2F0H A;  4EQ5 A;  4KLK A;  3AMU A;  5JEA J;  4K6D A;  4X65 Q;  4QY7 A;  2I07 B;  2JXM B;  2PMZ B;  2ZM6 L;  1EIG A;  2PZT A;  1KIX A;  1NUC A;  1VQH A;  2JA8 H;  4L6T B;  4X3S A;  3S16 H;  1UWV A;  2HIX A;  5K5P A;  4DR3 Q;  4B3T L;  1S5B D;  3AQQ A;  4K14 A;  4LUZ A;  4OWW B;  5LMN W;  3G6E A;  1HNX Q;  2E2H H;  1SMY C;  2I46 A;  5CMD A;  4X3U A;  4NPS A;  2DJF C;  2MFI A;  2TMP A;  2RVL A;  5GAE C;  5AFW A;  1HR0 W;  2ID0 A;  2O2L D;  3BJU A;  3E5S A;  3EJI A;  1GHJ A;  1NE3 A;  3H3V C;  3DXJ C;  5JVH 3;  4B3S L;  1X54 A;  4GKK L;  1HZC A;  5AJ3 Q;  2QDB A;  2SDF A;  2B2Y C;  4IJH A;  1PH7 A;  3HOX H;  2CWP A;  4QB4 A;  5DAU A;  5C3E B;  1R9T B;  4JYA L;  4HJ8 A;  2CWA A;  1VMC A;  1SNC A;  3H0G B;  3FPU B;  3VR6 A;  4V19 0;  4HCS A;  4KHP L;  4TQU S;  2WB1 B;  1TS3 A;  2K6A A;  5J22 A;  1Y1W B;  4RFB A;  3EFX D;  5C44 B;  2VL6 A;  1Q1B A;  2IL8 A;  2RCF A;  1PRT C;  1H9M A;  4JBK A;  1JJ2 A;  3CCQ A;  1JCK B;  2RHQ B;  4E6I A;  1CHP D;  2IX1 A;  3VR3 A;  1VQG A;  1WYD A;  2B8F A;  2EY5 A;  3O13 A;  5JPM C;  1CHQ D;  4IPD A;  5FKA C;  4LFA Q;  4XQQ A;  3FKI H;  2R7Z B;  1PYB A;  1N34 Q;  1NY4 A;  3FEW X;  1Q82 C;  2OT2 A;  1O7Y A;  4C1N K;  4A3L G;  3PUX A;  4FF4 A;  3WWV A;  2OQ0 A;  2J0T D;  3I72 A;  4DAY B;  4UP9 A;  4KMU C;  1C8C A;  5EKL A;  5C3W A;  1D5M C;  4AQY L;  3M4Y A;  1CZG A;  4DR4 Q;  1SAP A;  4OO1 H;  4UP8 A;  1TS5 A;  4K6L A;  3JAM i;  2UU9 Q;  2PQA A;  4DGZ A;  4UHV A;  3STB D;  2VUM G;  2F0W A;  2OQK A;  3CW2 C;  4P72 A;  2L12 A;  3GTG B;  3BDL A;  3D3R A;  3MXN A;  3NUC A;  4F87 A;  4JV5 L;  1VQ6 A;  1I5F A;  2K14 A;  1S4Z A;  3MXG A;  1WTR A;  2UXB Q;  5IP9 H;  4TSS A;  5JPN C;  4LF9 L;  4GKJ Q;  3K7U C;  4AYB E;  2BA1 A;  5IYB G;  4A3I H;  4CDE C;  4PZ8 A;  1IHZ A;  2WAQ B;  1I50 H;  5DM6 3;  3P75 A;  1UE7 A;  4KN7 C;  3HKS A;  4RHS A;  1TY2 A;  2G9H D;  1S5C D;  2EVB A;  2L5T A;  3C1F A;  1GKH A;  3BZC A;  2DGY A;  3J80 i;  1B44 D;  1CTM A;  1GVP A;  3GTP H;  2JA6 G;  4JVZ A;  3SR1 A;  4ZCK A;  3N52 A;  1CKN A;  3UE0 A;  2NVX B;  1QE6 A;  1PH5 A;  1ZYR D;  3CRL C;  4WRD A;  1LAB A;  5ELC A;  5GAH C;  1EY5 A;  1EQR A;  1AE3 A;  2BCO A;  4EQP A;  1LTA D;  5KRU A;  4R9W A;  2K28 A;  1G2S A;  2OCE A;  2VZA A;  3C3L A;  1YHA A;  4DV7 L;  3PUZ A;  1IL2 A;  5K36 G;  5M3F H;  1RIP A;  2BE5 C;  1HUN A;  1LTL A;  2KCN A;  5KNB A;  4ZYS A;  2JEB I;  2UXD Q;  1EYG A;  5CV6 A;  2B2V A;  1S5D D;  4JI6 L;  1EY6 A;  1N36 Q;  5A35 A;  2KUM A;  2KED A;  5D3D A;  5IOC A;  5C6A A;  2JA5 G;  3HOV G;  4ZKC B;  5IGB A;  3G6J B;  2F0G A;  3PV0 A;  1VQA A;  2NB0 A;  1TWC H;  3OPO A;  1FJG L;  2MP1 A;  5ELD A;  2QCP X;  3TP8 A;  4LFB L;  4BBR G;  1H9R A;  4RGM A;  3TZD A;  4C3H G;  5C3E H;  1R9T H;  1I94 Q;  3J7A 5;  3M7G A;  3Q24 A;  2K01 A;  3GTM B;  1FD7 D;  3H0G H;  1PFS A;  4X3K A;  5LMN L;  3OW2 A;  1Y8O B;  2A19 A;  3KLS X;  5JJI A;  2A68 D;  4KJO A;  1Y1W H;  5C44 H;  1SR3 A;  4IQZ A;  5HGQ A;  1QZH A;  1VQ7 A;  4ZK9 B;  1PV4 A;  1QIL A;  1L2F A;  3SK6 A;  4HAE A;  2B2T A;  1VQE A;  4L8J A;  1A8V A;  3DMU A;  4RG1 A;  2FMC A;  1QJO A;  3K6O A;  3K80 C;  1CZW A;  3PF5 A;  1ENC A;  2R7Z H;  2XN9 C;  2UXC Q;  3TQY A;  1X6O A;  2PQA B;  1KQS A;  5GQO A;  4IFD H;  4JI0 L;  3C1E A;  3HP3 A;  4BWG B;  2L15 A;  1E22 A;  1NJI C;  3NTH A;  3VA5 A;  4G4K A;  1JJC B;  4EX5 A;  1R4P B;  2WAQ E;  2H5X A;  3KDF B;  4R4C A;  1LTG D;  4B3M L;  1QUQ A;  5KEE A;  5E3F A;  4IOA A;  3GTG H;  2E5L Q;  3QOJ A;  4APV A;  4YHH Q;  1TXY A;  1G2T A;  3I7F A;  2RHS B;  2JEA I;  2B8G A;  1TII D;  2F0S A;  2IJ0 A;  4LW1 A;  2Z6K C;  3QR8 A;  1A63 A;  2YU9 B;  4C56 C;  1DOL A;  2VUM B;  2PCF B;  3BS1 A;  2PNR C;  4MIU A;  3S17 B;  1J5E Q;  1Q12 A;  1YZ6 A;  5IGD A;  4JI7 L;  1G6Z A;  1BBU A;  5J1Z A;  5JOB A;  1OXT A;  4G57 A;  3HKZ E;  1QVG A;  5IIF A;  4QQB X;  4RKB A;  3CC4 A;  5EAY A;  3A8K E;  3STB C;  1U0L A;  3EBE A;  1XPO A;  2NVX H;  3T1Y L;  1E24 A;  4GZY C;  4DK1 A;  1S3O A;  1B2T A;  1HZ9 A;  2F0L A;  3U9O A;  5IT9 L;  3T1H L;  2XRQ D;  1Q3L A;  2VQE Q;  2EJM A;  1J9O A;  4KD3 A;  2IT1 A;  2K5W A;  5C0X G;  2JA6 B;  4DK0 A;  4IUU A;  4A3J G;  4RHR A;  3KF8 A;  5T1G A;  2AUJ D;  3VR2 A;  1Y8P B;  1KAB A;  5FO9 B;  1B50 A;  1SLJ A;  1GUN A;  1PFN A;  5EKI A;  2F0V A;  1NBW A;  4DN4 M;  1B4O A;  2Q2H A;  4Y52 H;  3D8G A;  3A0J A;  2CFM A;  3VYT A;  5CGK A;  4DV1 Q;  1GM5 A;  2QGQ A;  1ZYR C;  1LT5 D;  3V05 A;  2ZXO A;  1LYL A;  3FKI G;  1EY7 A;  2F0N A;  4FNF A;  1I6H B;  1DJR D;  1GXD C;  4I65 A;  2NVY B;  1NR4 A;  3PIO 3;  3D31 A;  5ELE A;  1ENA A;  2WV6 D;  1SN8 A;  1VQJ A;  3NTI A;  3RZO H;  3PIP A;  3D4D A;  1N9W A;  5KNC A;  1STA A;  1KAA A;  1IZ6 A;  1XYI A;  3L7Z C;  4ZUI A;  2JA5 B;  2QKI C;  3GTQ B;  3E3X A;  3GTM H;  3HOV B;  4OO1 G;  1HA6 A;  4UDU C;  1Y1V G;  2OTL A;  4H44 C;  1RTN A;  4DNR B;  4C2M B;  1STB A;  3L2P A;  2ZM6 Q;  2HDL A;  1DYQ A;  2ZTC A;  4BBR B;  3TEH B;  4C3H B;  1MIU A;  4OX9 Q;  4B3T Q;  4DV5 Q;  5IE8 A;  2DY8 A;  1XMO Q;  3CP0 A;  3CHB D;  3CCS A;  4I7Z C;  4A3I G;  5ELO A;  4BY1 G;  3C2P A;  1I3Q B;  3HZX A;  4DV0 Q;  3BDC A;  4FO2 A;  2F1M A;  2WFW A;  4C1N I;  4N9T A;  2EXD A;  3MA2 B;  4MZ9 A;  1PMR A;  2QF7 A;  4YCU A;  2F0O A;  2AUK A;  1IW7 C;  4CJ0 B;  4S3S A;  2F0Q A;  1NR2 A;  2A68 C;  2MJ8 A;  1UE1 A;  5FO8 B;  1W6J A;  2J7Z A;  1SFO B;  4KY6 A;  1P16 A;  3Q8D A;  2M9V A;  3NHH A;  5IT9 E;  4JYA Q;  3NQI A;  4PMW A;  3GDE A;  1HHV A;  3NBI A;  4GNX C;  1AH9 A;  3ND8 A;  3NSW A;  4YWK A;  4A3L H;  3U4V A;  2R92 G;  5BR8 Q;  2EIF A;  2XGT A;  4Z9C B;  3W3A A;  2F0P A;  5T1I A;  2RKS A;  1VQL A;  5ELN A;  1QNU A;  3CQZ B;  1O78 A;  5M3F G;  2Q2U A;  4EQN A;  2IPK D;  1EFI D;  2K75 A;  1BBW A;  4YCW A;  4LF8 Q;  3BVM A;  4B08 A;  1EWH A;  1BR9 A;  1GUG A;  1FNU A;  2YU9 H;  5C4J B;  5GAD C;  3T13 A;  2KVM A;  4CDD C;  4B3R L;  5M5Y B;  2VB2 X;  1W3S A;  1WTP A;  4ILW A;  1X3E A;  3S17 H;  1K9M C;  2KOL A;  1TR5 A;  2RBM A;  1HFG A;  4FF1 A;  4OL7 A;  3Q0A A;  4UP7 A;  1VF5 C;  3S15 B;  3CKI B;  5EBD A;  4K5W A;  2A8V A;  2E2H B;  1ZEQ X;  5HUR A;  4JI4 L;  1RKN A;  1WTW A;  3DWQ A;  3CXC A;  1FGU A;  5IYB H;  4NXN Q;  1O80 A;  3S1Q H;  4AQY Q;  2A69 D;  3SHL A;  1RHP A;  1PRT D;  1B7Y B;  1NAP A;  1Q46 A;  3GQB A;  2JA6 H;  1CI3 M;  1KXL A;  3NEM A;  1PYW D;  2KQ3 A;  3S2D H;  1FGB D;  4R4T A;  1Q86 C;  1TU2 B;  4O42 A;  1LTT D;  4GLA C;  5IP7 G;  1M90 C;  2B2W A;  5BN5 A;  4DNT B;  3K57 A;  2FHT A;  4A3J B;  1OO9 B;  4J1M A;  5K36 H;  4MNO A;  2F0D A;  4EQO A;  2NVY H;  2Z9H A;  2NBF A;  3HRZ C;  2HCC A;  2A5H A;  1EZ8 A;  1J6Q A;  1STG A;  2KHJ A;  3ERO A;  2JA9 A;  1TWH H;  3HOY G;  1ASY A;  4A93 B;  1IYV A;  5FOB B;  5JEA G;  2QEX A;  4HJ9 A;  4K5V A;  2JA5 H;  1NTG A;  1PFB A;  4V0B A;  4F8M A;  4JI2 L;  4XYQ A;  5KIX A;  3GTJ B;  3GTQ H;  3HOV H;  2K32 A;  3FKI B;  4A3E G;  1VMP A;  1I4H A;  4PMC A;  4C2M H;  3PQI A;  5ISR A;  2K5D A;  2F03 A;  1I4P A;  3B6Y A;  1EOV A;  1WTQ A;  2EQS A;  3TP5 A;  4BBR H;  2BDO A;  1RD9 D;  4C3H H;  1W6K A;  4XIG S;  2R61 A;  5LMU Q;  4A3B G;  1I4Q A;  1Y1V B;  1B53 A;  2RDG A;  5FLX E;  3F2U A;  4EGV A;  3GP7 A;  4JI6 Q;  1STH A;  1I3Q H;  2DY7 A;  3I55 A;  1ET6 A;  4AH6 A;  4JCV E;  3SEB A;  3IFT A;  1LT4 D;  4DV4 L;  3K58 A;  3H3V H;  3HGB A;  4KY5 A;  1I4X A;  4NMZ A;  2F0U A;  1STN A;  1SFO H;  1NCV A;  4A3I B;  4BY1 B;  2JP1 A;  1FYC A;  3DEO A;  4CGY B;  2ZJP A;  5IGC A;  2Q8I B;  2XWJ B;  3SE0 A;  3UDI A;  5LMN Q;  4JPB W;  2PW7 A;  4XT3 B;  2N8N A;  2K33 A;  4M8A A;  5LL6 S;  3CC2 A;  4ABN A;  3EVQ A;  2JJQ A;  2MGS A;  4HIK A;  1HR0 Q;  1NMG A;  5C5M A;  1U4M A;  1XPR A;  3PO3 G;  1A2T A;  1A2U A;  2TSS A;  1PH1 A;  1CKO A;  1FL0 A;  3DHQ A;  5C4J H;  1J8I A;  1VS0 A;  5M5Y H;  2R92 B;  1OXS C;  2MO0 A;  1CQV A;  3ULP A;  2K5Q A;  1C0A A;  4IN3 A;  3TP6 A;  1PDQ A;  2D0P A;  4K2K A;  2Z4I A;  5M3F B;  1RTO A;  3NXW A;  3BYT B;  2EJG C;  1D5X C;  4FDB A;  4Q5V A;  1LO5 D;  4QJF A;  3S15 H;  3OWE B;  2SOB A;  4XQJ A;  1KNA A;  2PNH A;  1LUZ A;  3TZU A;  3E0E A;  1X3P A;  2PW5 A;  1SEB D;  3AFP A;  4NW2 A;  2F3V A;  3PF4 A;  1AEX A;  1TWC B;  3OIP A;  3NK9 A;  1SND A;  2F0E A;  4GS3 A;  1WI5 A;  5L37 A;  2G5D A;  2ZJQ A;  3ZYY X;  5BN3 A;  5IGF A;  4YWL A;  1VQO A;  1O7Z A;  2X6G A;  4YIJ A;  2VQF Q;  1QG7 A;  1KRT A;  2MNA A;  2YYZ A;  4UAI A;  2NN6 I;  2EY6 A;  5IWA L;  5C0X H;  2JE6 I;  3RLO A;  1H9J A;  5DEH A;  4A3J H;  1QOH A;  3OHX C;  3S1N B;  1VQM A;  1X9N A;  2A69 C;  1IYU A;  4JI7 Q;  4WJ4 A;  1SXT A;  3PSI A;  1VQI A;  4F88 A;  4A93 H;  4JOI A;  3OMG A;  4DR1 L;  1EWC A;  2L0C A;  1NSN S;  1R4Q B;  4H13 C;  1HJP A;  2F3I A;  3EA6 A;  1KTK A;  3MXP A;  3T1H Q;  3GTJ H;  3J81 c;  3J7Y W;  3I4M G;  2QDL A;  4GOP A;  3A7L A;  1XMQ L;  1EQT A;  2N55 A;  4LF4 L;  3DEP A;  4K0K Q;  4A3C H;  1YVC A;  1MKH A;  3D0F A;  2FJ2 A;  1DZ1 A;  3HEJ A;  1SJE D;  3HOY B;  3T4A C;  1HNZ L;  4QMG A;  5H1S E;  2BH8 A;  3S24 A;  2Q2I A;  2JN4 A;  4CHT B;  2D2C C;  3FVQ A;  1Y1V H;  4A3E B;  2CVR A;  2EYO A;  5CBE E;  2IX3 A;  4GN4 B;  1V1P A;  4PQX A;  4R4Q A;  3LGJ A;  1S72 A;  1B9N A;  1PH2 A;  2KEN A;  4OHJ A;  4A3B B;  1IBM Q;  3TME A;  4LF6 L;  1STY A;  4PG3 A;  3KDF A;  4BBS G;  1QWY A;  1PLF A;  1MJE A;  4U68 A;  3A74 A;  2JYO A;  4JG2 A;  4ALP A;  4POG A;  1SYG A;  2PMZ E;  1EYC A;  3FRP B;  2WKC A;  4LK1 C;  4BA1 I;  4BY1 H;  2F4V L;  3R2T A;  2IX0 A;  3KBX A;  3BU2 A;  4JBJ A;  3J81 L;  1VQC A;  4HJ7 A;  1U4P A;  4X66 Q;  5EPK A;  1T5E A;  4LF5 Q;  5FK9 C;  2GVB A;  3CCL A;  1Q7Y C;  3KFU A;  2EOT A;  5IGG A;  3MAQ A;  1HNW Q;  1EOT A;  1G29 1;  1TWF B;  4QIW B;  5KND A;  2LMC B;  1HFN A;  4DUZ L;  4J6H A;  1UE5 A;  2GVA A;  2R92 H;  2CKZ B;  1CA6 A;  1IBL L;  3IKJ A;  1T5X D;  3BZD B;  5E4X A;  3L9A X;  1E3P A;  2B3G A;  3R93 A;  4OEM B;  1SMX A;  4L5S A;  5CR3 A;  2B2U A;  2WKD A;  1WD1 A;  3X3M A;  4Q0F A;  1HXY D;  1A62 A;  3M7N A;  1VCI A;  5HGT A;  1AN8 A;  5I6W A;  4QGU A;  3PO3 B;  1XNQ L;  3W1G A;  3OW7 A;  1HQR D;  1KAW A;  3NPP A;  3UI2 A;  4UY8 C;  2M2L A;  2KCT A;  3T56 B;  3SK8 A;  2WB1 E;  3NBH B;  2D0O A;  4IUT A;  3C46 A;  3K0Y A;  1MGS A;  4DAP A;  1EZ6 A;  1UEA B;  1L1O C;  4GNX B;  5EPJ A;  5M3M G;  3RZO B;  1LAC A;  3MFG A;  1QCB D;  1KNE A;  1C4Q A;  5M5W B;  4ZKB B;  2Q2T A;  4A3F G;  1DOM A;  2K52 A;  2O5J C;  2AQ3 B;  3WDN A;  1P8L A;  3I2Z A;  4DA2 A;  2IW3 A;  1IW7 D;  1HRJ A;  4B3R Q;  1N33 Q;  3ERQ A;  3S1N H;  2Y0S G;  3X3N A;  4GOP B;  4JK1 C;  3F8T A;  1JMC A;  4X64 Q;  4FXG C;  1WCM G;  1IBK Q;  1S5F D;  1PTO D;  5IP7 H;  3J81 i;  4A3G H;  4K2L A;  1MHW C;  2K5H A;  2IWH A;  1IYJ B;  2NYZ D;  2R7D A;  3I90 A;  2HHH Q;  3J81 E;  4DV3 Q;  4DV6 L;  3I70 A;  3DM3 A;  1M8A A;  3HOY H;  1X56 A;  3PO2 G;  2F4I A;  1V1P B;  5IT9 c;  4XTC S;  2NVT B;  5JEA H;  3SK5 A;  4X65 L;  5C3X A;  1EFW A;  3QG1 A;  3I4M B;  2D62 A;  4QCL A;  4RCN A;  4MHE A;  4WFN 3;  4A3E H;  4DR3 L;  1A15 A;  1LM0 A;  1K3R A;  5COR A;  4L5R C;  1LLR D;  2AQ1 B;  4RCO A;  1HNX L;  2N78 A;  1YNN C;  2KCM A;  2B2Y A;  2ES2 A;  3G7L A;  4QIW E;  2RQX A;  4A3B H;  1E2W A;  4CKE A;  2OTJ A;  1EIY B;  3CPF A;  4FXD A;  5G3L D;  4DR2 L;  1ESR A;  1SYF A;  1B3A A;  5DLQ E;  1OXV A;  3CC7 A;  4JI8 Q;  4LUO A;  2LKV A;  3QJY A;  4A3K G;  1F9S A;  3CCJ A;  2KHS A;  5EJW A;  3BZK A;  4BBS B;  1PFM A;  3VYR A;  1U5K A;  2QA4 A;  3U9S A;  2XIW A;  3G48 A;  1TWF H;  4KTA A;  4CDC C;  4DR7 L;  2FIN B;  4LF7 L;  1E2V A;  1O7I A;  1IKL A;  3S1Q B;  1B8A A;  3BDO A;  3ULL A;  4BA2 I;  2OF1 A;  4AIM A;  3SGI A;  1GUS A;  1H9S B;  4BY7 G;  1O7L A;  4DR5 L;  2H4O A;  1JOO A;  2PO4 A;  5E1F A;  4DUY L;  4IUR A;  4NXM Q;  5IGE A;  1K73 C;  5JVG 3;  3S2D B;  5GAG C;  3DWA A;  2ALY B;  3KLS A;  3E9I A;  3VR4 A;  4LFC Q;  1K0S A;  1CUK A;  2HCI A;  4QUF A;  4LFA L;  2O5I C;  5CV7 A;  1MSG A;  4IUP A;  4HIO A;  3PO3 H;  3MTS A;  1E1T A;  3MWY W;  1L0X B;  1PXU A;  2VNU D;  2CQO A;  3BYY B;  1BCP D;  4A93 G;  3OTO L;  1IL8 A;  1I4R A;  4K8J A;  1KC8 C;  2EYM A;  1AZQ A;  1IXR A;  1KRS A;  4C3I B;  4A3C G;  2F0M A;  4KN4 C;  3PGZ A;  1EY8 A;  4DR4 L;  4QF4 A;  1TWH B;  5JAV A;  1VQN A;  3M4Q A;  1PTO H;  2N3S A;  4R4I A;  2IHF A;  2Z6B A;  4NB3 A;  5M5W H;  3Q22 A;  4GLV B;  4B9X A;  4DR6 Q;  4X3T A;  3U50 C;  1N32 Q;  1ESF A;  1PZI D;  2JA7 G;  2L1B A;  1BNZ A;  4GKJ L;  5M3M B;  4DV2 L;  5D3I B;  1JR0 D;  4I7A A;  2Q8T A;  5LHY 1;  2CW0 D;  4IAL A;  3VYS A;  1SYC A;  4ZLT F;  5FLX c;  3F2B A;  4A3F B;  1JWM D;  1E2Z A;  1HCZ A;  4A75 A;  4TKO B;  1KDA A;  1UAP A;  5FJ8 G;  2HD3 A;  1SRU A;  1TT2 A;  2Y0S B;  1YNJ C;  2L55 A;  2N88 A;  1GOZ A;  3PIP 3;  4IUQ A;  4B3S Q;  4GKK Q;  1WCM B;  2HQL A;  4ZAI A;  2NVT H;  2E2I B;  1X65 A;  4IPG A;  3SXH A;  3I4M H;  1Y8N B;  1JE5 A;  4OWX B;  2EDG A;  2K5N A;  1L0W A;  4J15 A;  1E0B A;  4CJ2 C;  1PTO C;  1Q1E A;  3N6R A;  5C5L A;  1BBX C;  1A0I A;  1EU4 A;  3HOU G;  2UXD L;  4OWT B;  1SJH D;  3PO2 B;  2NTS A;  4KHP Q;  1HZB A;  2KHI A;  2WII B;  1N36 L;  3J81 j;  2CH4 W;  2UUA L;  2R93 H;  2V1C C;  2F3W A;  3I4O A;  5FLX L;  2AQ2 B;  1PRT B;  2R3Z A;  2JSO A;  3NWS A;  1XWE A;  1AE2 A;  4AYB G;  2EYP A;  1HQM C;  2E75 C;  4ZQ3 A;  1VQ5 A;  3TSS A;  4R1J A;  1I94 L;  3QOL A;  3ZJY C;  4LF4 Q;  3AFQ A;  5CV9 A;  1GHK A;  4DXF A;  3V96 A;  3ITP A;  1DM0 B;  1U4R A;  3TS0 A;  3NP8 A;  4BBS H;  3U58 A;  1V8Q A;  1HNZ Q;  1Y14 B;  3FHW A;  3VDY A;  3A8J E;  1EU3 A;  1K28 A;  3E6Z X;  3TN2 A;  3KJO A;  3CCU A;  1WVL A;  4A3K B;  3S1R B;  5KGU A;  3J7A V;  3KOJ A;  2CH4 A;  1K8M A;  4RGT A;  2KBN A;  2RDF A;  2LXK A;  5CC4 A;  5DM7 3;  3MZ5 A;  1SE4 A;  2VW9 A;  2AWO A;  1Z47 A;  2HQE A;  3RUZ A;  4GN5 A;  1MBY A;  4DFA A;  4JV5 Q;  4JI5 L;  3RR5 A;  3Q6S A;  4XYO A;  2UXC L;  4RWS C;  4LF9 Q;  1SSO A;  2FXQ A;  4BY7 B;  1D2B A;  1YJN A;  4A3G G;  4GN3 B;  3M4O B;  2ATW A;  1TWG B;  3K7A B;  2YTX A;  1DXM A;  2F4V Q;  4C3I H;  3PUW A;  1D8L A;  5CBA E;  3RN2 A;  2C9O A;  4JC0 A;  3CMA A;  2UUB L;  3KBG A;  4DAV A;  3RN5 A;  2PQE A;  2I5L X;  2JK8 A;  1SNO A;  3LWE A;  4OON A;  1YHB A;  3D6C A;  4KY7 A;  1DOK A;  4DU9 A;  4JBW A;  1YIT A;  2HIV A;  1GO3 E;  3K5O A;  2V4D A;  1BQQ T;  2E5L L;  2Z6K A;  3F2D A;  3VR5 A;  1WOC A;  4P74 A;  1EY9 A;  4YHH L;  4FYD A;  1SE2 A;  2K7V A;  1B3Q A;  3CCR A;  1BCP C;  1QNK A;  4MN3 A;  3T16 A;  2ENB A;  5M3M H;  2OWO A;  3M3Y B;  3S14 B;  4DV7 Q;  1K8G A;  3L0O A;  1UEB A;  3IFD A;  2A6E C;  2OEO A;  1AW7 A;  3HOW G;  5FO7 B;  3SK4 A;  3QWN A;  1PRT F;  4P75 A;  3NTK A;  4A3F H;  3ND9 A;  5JJK A;  1PYS B;  1Q8K A;  2RDH A;  2VB3 X;  1WJJ A;  3W1B A;  2JA7 B;  1JOQ A;  2YTV A;  3GTL B;  2JQO A;  1LTR D;  4FP5 D;  4YY3 L;  1BO0 A;  2XSC A;  4O2D A;  4LNQ A;  3RD4 A;  4IUV A;  3F2C A;  4WJW A;  3DM1 A;  3M9B A;  2B2V C;  2VQE L;  1JB7 A;  1WCM H;  3CRK C;  3S9W A;  1FJG Q;  4O0A A;  2E76 C;  4PMB A;  2E2I H;  3A7A B;  4CJ1 B;  1TS4 A;  1Z6H A;  5C4H A;  4LFB Q;  2F0F A;  5EBC A;  2CW0 C;  5JJL A;  4MTK A;  1ZKO A;  3JAM c;  1KDC A;  2XWB B;  4C3J G;  4FVM A;  1YIJ A;  2X6L A;  4R4O A;  3PO2 H;  4HID A;  3LNN A;  2EYH A;  4IO9 A;  1MSH A;  2VS1 A;  4Y7N B;  1YI2 A;  4HSP A;  2D9U A;  3RZD B;  2EY1 A;  1EEF D;  5COY A;  1MD2 D;  3H94 A;  2M00 A;  1GD7 A;  3HOU B;  1DON A;  4KKT A;  2VXW A;  1GUO A;  1F2Z A;  2EJF C;  3NEL A;  1QVF A;  4P73 A;  1Q90 A;  5I2X A;  2SEB D;  3J80 c;  3HKZ G;  2FMM A;  4A3M B;  4HMI A;  4RGO S;  4JI0 Q;  1W2B A;  1JOR A;  4DV6 Q;  3DLL A;  4ZUJ A;  3EQL C;  1T9H A;  1PH6 A;  4ME3 A;  4AYB B;  1XJV A;  1VQB A;  1Z9F A;  3J7A F;  3MHB A;  3KJP A;  1OXX K;  1LTB D;  4A76 A;  4A3K H;  3S1R H;  3JAM L;  2PI2 A;  2DUD A;  5I4D A;  3PCO B;  4OX9 L;  3NWT A;  4B3M Q;  4HJA A;  1BXT A;  2NWG A;  1SRO A;  4H7B A;  4DV5 L;  3KF6 B;  1IKM A;  3I4N G;  4ID6 A;  1KDB A;  3MVV A;  1F2L A;  1G8Z D;  4G7H C;  1HA5 A;  2K03 A;  1XMO L;  3QB3 A;  5I9O A;  3H6M A;  1M4V A;  1II3 A;  1UNS A;  1JOK A;  4BXX G;  2DNE A;  4DV0 L;  4PNY A;  2O4X A;  4BY7 H;  1MJC A;  3NBH A;  1VDZ A;  3CF5 A;  2QEJ C;  3K5M A;  3GTO B;  4DR2 Q;  3M4O H;  3ER0 A;  3UDX A;  1TWG H;  4GNX A;  3K7A H;  3FMC A;  5CV4 A;  2R7F A;  3MEH A;  4R8I A;  1BVS A;  4ME5 A;  2VY3 A;  5FLM G;  3J80 L;  2PPB C;  4CKC A;  4PZ7 A;  1Q8I A;  4NP5 A;  4A3G B;  3T1Y Q;  5BR8 L;  1S40 A;  1YNN D;  4KHV A;  4HED A;  4DR7 Q;  4LF7 Q;  1FR3 A;  3HFZ B;  4NKL A;  1VQD A;  5F2D A;  3FPP A;  3NE5 B;  3TS2 A;  4DR5 Q;  2J4X A;  4DUY Q;  4LF8 L;  2EY2 A;  5IYC G;  2BDN A;  4OEL B;  3M3Y H;  2P5Z X;  1K0R A;  3S14 H;  1XNR L;  2ZTE A;  2NN6 G;  2R93 G;  2OXP A;  2Z4H A;  2EYJ A;  3I91 A;  1X3Q A;  3TDQ A;  1U9R A;  1V9P A;  2JA7 H;  1HTP A;  3GTL H;  2KA7 A;  1F77 A;  3KLR A;  1CSQ A;  3OTO Q;  2RSO A;  4IUN A;  2I0Q A;  2RA4 A;  1PA6 A;  3UDG A;  5M5X B;  4ULL A;  1K8A C;  2AKW B;  4NXN L;  3HOW B;  4F7X A;  2AWN A;  1LT6 D;  3KLW A;  4JI3 L;  3KYH C;  1F2M A;  3MEF A;  3I8Z A;  2LFN A;  5FJ8 H;  3BVG A;  1YEZ A;  3I56 A;  3D4R A;  5D14 A;  1XPU A;  4M1U B;  4IPC A;  1CFM A;  3OWF A;  4O1N A;  3JAM E;  2I5H A;  3U4Z A;  4G7Z C;  3IAY A;  5C4Z A;  4IOC A;  2YV5 A;  3QIA A;  4X62 L;  4Y7N H;  1JQY D;  1HUM A;  4DV2 Q;  4ODG A;  3UE1 A;  3RZD H;  4KJN A;  3CPW A;  2E2J B;  4N8F A;  5ELB A;  4C3J B;  2HDM A;  3T51 B;  4PZ6 A;  4QL5 A;  3D4W A;  1ZXT A;  1KL9 A;  1G91 A;  3HOU H;  4HSV A;  4HIM A;  1B70 B;  2AMC B;  1KLU D;  2GA4 B;  1YBY A;  4C3I G;  3E0J A;  2MUY A;  2QW7 A;  2K05 A;  3OOC A;  1HPC A;  4A3M H;  4DF7 A;  2DJG C;  2K5V A;  1DGS A;  4CDF C;  2A74 C;  4OIK A;  3J80 E;  3CCM A;  1H9S A;  3NEN A;  4H02 A;  1RCV D;  2SNS A;  3NQT A;  2I5M X;  1A6X A;  3PUY A;  5C4X G;  1CSP A;  2K50 A;  2L9H A;  5CYU A;  4YWM A;  4FF3 A;  4L5T A;  3D6W A;  3HKZ B;  3CCV A;  5LMU L;  2KEC A;  1EIH A;  2XRS D;  4JBM A;  5NUC A;  1KLG D;  3SDZ A;  1TQO A;  3T53 B;  2E2D C;  1PTO B;  3MC0 B;  1VQP A;  1FNW A;  1PZK D;  3FDT A;  5E7N A;  1CT1 D;  2K04 A;  1SNQ A;  2ZJR A;  3LWU A;  2UUC L;  3H3V I;  1YNJ D;  4HN7 A;  3BG3 A;  1CQF A;  2UUA Q;  1XX8 A;  1EYA A;  3SVM A;  2K1B A;  2B39 A;  1BUV T;  4DAM A;  5M9O A;  3GTO H;  1XTC D;  3I4N B;  4RMF A; 
#chains in the Genus database with same CATH homology
 4L5Q A;  4DR6 Q;  1J6Q A;  2KHJ A;  3U50 C;  1KD1 C;  2JA9 A;  1TWH H;  3HOY G;  4KHP L;  1N32 Q;  4X6A H;  2JA7 G;  1ASY A;  4TQU S;  4A3D G;  5JEA G;  2BH2 A;  2QEX A;  4HJ9 A;  4JI4 Q;  4GKJ L;  2VL6 A;  1Q1B A;  2JA5 H;  4DV2 L;  1NTG A;  4JI2 L;  4JBK A;  3GTQ H;  1JJ2 A;  3HOV H;  4A3E G;  3CCQ A;  5FLX c;  2RHQ B;  4C2M H;  3F2B A;  2IX1 A;  4JI1 L;  1VQG A;  1WFQ A;  1WYD A;  1EOV A;  3B6Y A;  2XTI A;  4LUV A;  1HR0 L;  4IPD A;  4LFA Q;  1KHI A;  2EQS A;  4BBR H;  5HY6 A;  5FJ8 G;  4A75 A;  4A4I A;  4C3H H;  3GO5 A;  3FKI H;  1PYB A;  1SRU A;  1N34 Q;  1NY4 A;  4XIG S;  1Q82 C;  5M5W H;  1VQF A;  5LMU Q;  1YHQ A;  4A3B G;  4A3L G;  3PUX A;  3EIV A;  3WWV A;  2B63 G;  2AHO B;  2OQ0 A;  4B3S Q;  4JI5 Q;  4OXP A;  4GKK Q;  4DAY B;  4GLV B;  4UP9 A;  1SE8 A;  2HQL A;  4JI6 Q;  3AEV A;  4AQY L;  2NVT H;  1I3Q H;  4UPA A;  4MTN A;  1X65 A;  3I55 A;  4AH6 A;  4DR4 Q;  4JCV E;  4IPG A;  4UP8 A;  3JAM i;  4DV4 L;  2UU9 Q;  3I4M H;  2PQA A;  1JE5 A;  3MXN B;  5M5X H;  4OWX B;  3H3V H;  3STB D;  2VUM G;  2OQK A;  3G71 A;  2K5N A;  3CW2 C;  1L0W A;  4P72 A;  4J15 A;  3HOW H;  3HOZ G;  1Q1E A;  2UUB Q;  4JV5 L;  1VQ6 A;  1A0I A;  4KHZ A;  3HOU G;  1I5F A;  2K14 A;  1SFO H;  4OWT B;  2UXD L;  4KHP Q;  5AJ3 L;  2IY5 B;  1HZB A;  2UXB Q;  2KHI A;  5IP9 H;  1N36 L;  4LF9 L;  2ZJP A;  3J81 j;  2UUA L;  4GKJ Q;  2R93 H;  2V1C C;  4JI2 Q;  3UDI A;  3I4O A;  2JA8 G;  3K7U C;  4AYB E;  5LMN Q;  2BA1 A;  2PI2 E;  5IYB G;  2N8N A;  2VQF L;  4A3I H;  4PZ8 A;  5C0X I;  5IYD H;  3E9H A;  1AE2 A;  1PH8 A;  3CC2 A;  1I50 H;  2JJQ A;  4AYB G;  4HIK A;  1HR0 Q;  1NMG A;  1UE7 A;  3HKS A;  1VQ5 A;  1CKN B;  1EUJ A;  4R1J A;  1GKH A;  1XPR A;  3BZC A;  5IY0 A;  3PO3 G;  2DGY A;  3J80 i;  1I94 L;  1GVP A;  3GTP H;  1PH1 A;  2E2J H;  2JA6 G;  1CKO A;  1FL0 A;  3ZJY C;  2K4K A;  4LF4 Q;  3AFQ A;  1CKN A;  5C4J H;  4C3J H;  3UE0 A;  1VS0 A;  3AYH B;  5M5Y H;  1OXS C;  2MO0 A;  3TS0 A;  1PH5 A;  4BBS H;  5GAH C;  3U58 A;  3ULP A;  4POF A;  1C0A A;  1HNZ Q;  1Y14 B;  3FHW A;  1EQR A;  2D0P A;  4DPG A;  3VDY A;  1AE3 A;  2A1A A;  3FP9 A;  4FDB A;  4YY3 Q;  3HOX G;  4QJF A;  2ASB A;  3S15 H;  1PH4 A;  3KJO A;  3CCU A;  1JJG A;  3KOJ A;  2OCE A;  2PNH A;  2VZA A;  3PIO A;  4DV4 Q;  1LUZ A;  4IJL A;  2MO1 A;  2KBN A;  1YHA A;  4DV7 L;  2LXK A;  3PUZ A;  1IL2 A;  1N34 L;  5K36 G;  3E0E A;  1RIP A;  2B29 A;  5M3F H;  4K0K L;  1LTL A;  3K8A A;  1OXU A;  2VW9 A;  3ICE A;  2AWO A;  1Z47 A;  4GN5 A;  4JV5 Q;  4DK3 C;  4JI5 L;  2JEB I;  3RR5 A;  2UXD Q;  3AFP A;  1EYG A;  3PF4 A;  4OO1 I;  1C9O A;  1PHJ A;  4JI6 L;  3PUV A;  1N36 Q;  4DNI A;  3H15 A;  2UXC L;  4LF9 Q;  2FXQ A;  4GS3 A;  1WI5 A;  2ZJQ A;  2JA5 G;  1YJN A;  4A3G G;  3F1Z A;  4YWL A;  1VQO A;  4GN3 B;  3HOV G;  2UU9 L;  2ATW A;  2LXJ A;  3PV0 A;  2VQF Q;  1VQA A;  2YTX A;  1KRT A;  2MNA A;  4P71 A;  1TWC H;  1FJG L;  2F4V Q;  2BA0 A;  3PUW A;  4C3I H;  2YYZ A;  1D8L A;  3RN2 A;  4JC0 A;  3CMA A;  2UUB L;  2NN6 I;  4LFB L;  4BBR G;  3RN5 A;  2I5L X;  5IWA L;  2JK8 A;  2JE6 I;  4OON A;  3RLO A;  5C3E H;  1R9T H;  1I94 Q;  1YHB A;  4A3J H;  3J7A 5;  2UXB L;  3J7Z C;  4JBW A;  1YIT A;  2HIV A;  1VQM A;  1GO3 E;  1X9N A;  1IBM L;  2E5L L;  3I4N H;  2Z6K A;  3F2D A;  3H0G H;  4JI7 Q;  1V1Q A;  1HZA A;  1PFS A;  1WOC A;  4P74 A;  4YHH L;  4WJ4 A;  5LMN L;  3PSI A;  3OW2 A;  1VQI A;  1YJ9 A;  2A19 A;  5JJI A;  3CCR A;  4BXX H;  4A93 H;  4JOI A;  4DR1 L;  1ASZ A;  4GLX A;  3K81 C;  1Y1W H;  5C44 H;  1HJP A;  2F3I A;  5M3M H;  1SR3 A;  4TVA B;  3ERS X;  2OWO A;  4X66 L;  1FVI A;  5HGQ A;  3I4M G;  1QZH A;  3T1H Q;  3GTJ H;  3J81 c;  1VQ7 A;  1QVC A;  4HJ5 A;  2RF4 A;  2ZTD A;  4DV7 Q;  3L0O A;  1UEB A;  4GOP A;  1XMQ L;  1PV4 A;  1K8G A;  4LF5 L;  4LF4 L;  4K0K Q;  4A3C H;  1YVC A;  3HOW G;  1L2F A;  1MKH A;  3D0F A;  2WP8 J;  1VQE A;  4P75 A;  4DKA C;  4A3F H;  1HNW L;  5JJK A;  1PYS B;  1A8V A;  4RG1 A;  1Q8K A;  2HT1 A;  1HNZ L;  1WJJ A;  3W1B A;  5FLM H;  2YTV A;  2JQO A;  3K80 C;  3PF5 A;  2LSS A;  5H1S E;  4YY3 L;  5IP9 G;  2BH8 A;  2R7Z H;  2UXC Q;  1PVO A;  1OTC A;  4O2D A;  4LNQ A;  3TQY A;  1X6O A;  3S24 A;  2PQA B;  1KQS A;  3CAM A;  3F2C A;  2Q2I A;  5GQO A;  4JI0 L;  3CME A;  1Y1V H;  3CD6 A;  1H95 A;  3M9B A;  4WJ3 M;  2C35 B;  2L15 A;  1E22 A;  2VQE L;  1WCM H;  1Q81 C;  1NJI C;  1JB7 A;  1FJG Q;  4O0A A;  1E1O A;  1E7Z A;  2YTY A;  4GN4 B;  1EQQ A;  2E2I H;  1JJC B;  4EX5 A;  4LFB Q;  1X3F A;  4R4Q A;  5IYC H;  3LGJ A;  1QUQ B;  2WAQ E;  2H5X A;  5IWA Q;  1S72 A;  1CKM A;  5C0X J;  1N8R C;  1PH9 A;  3KDF B;  1PH2 A;  4R4C A;  5JJL A;  2KEN A;  4B3M L;  3JAM c;  1M1K C;  1TWA H;  1VQ4 A;  1IBM Q;  1QUQ A;  1L1O A;  4LF6 L;  4IOA A;  4PG3 A;  2E5L Q;  3GTG H;  3KDF A;  4YCV A;  4BBS G;  4A3M G;  2IHE A;  1YIJ A;  4APV A;  4YHH Q;  1TXY A;  1MJE A;  3A74 A;  4JG2 A;  4ALP A;  4R4O A;  4POG A;  1YNX A;  4HID A;  2PMZ E;  3PO2 H;  4BA1 I;  5J3B A;  3I7F A;  2RHS B;  4BY1 H;  2F4V L;  2NZO A;  2JEA I;  4IO9 A;  2VS1 A;  2IX0 A;  4DR1 Q;  1YI2 A;  3A5U A;  3BU2 A;  4JBJ A;  3CCE A;  1G6P A;  1VQC A;  4LW1 A;  2Z6K C;  4HJ7 A;  4X66 Q;  1A63 A;  1RL2 A;  1XMQ Q;  4LF5 Q;  2N49 A;  2GVB A;  3CCL A;  1Q7Y C;  1VQ8 A;  3KFU A;  1J5E Q;  1Q12 A;  4JOI C;  1GD7 A;  1YJW A;  1HNW Q;  1YZ6 A;  4JI7 L;  1G29 1;  1BBU A;  2Z0S A;  1OXT A;  1BKB A;  3HKZ E;  1QVG A;  4QQB X;  3UDF A;  3NEL A;  1QVF A;  4P73 A;  3CC4 A;  5EAY A;  3STB C;  4GOP C;  2VUM H;  1U0L A;  1XNR Q;  3EBE A;  3J80 c;  1N33 L;  3HKZ G;  4DUZ L;  1XPO A;  1UE5 A;  2NVX H;  2GVA A;  3T1Y L;  1E24 A;  2CKZ B;  4DK6 C;  1W2B A;  4JI0 Q;  4DV6 Q;  2R92 H;  1IBL L;  1S3O A;  3DLL A;  1HZ9 A;  1T9H A;  3T1H L;  1PH6 A;  1E3P A;  2B3G A;  4ME3 A;  1SMX A;  4X64 L;  4L5S A;  2VQE Q;  1XJV A;  1C7Y A;  1VQB A;  1IBK L;  3S1M H;  1A62 A;  3M7N A;  1Z9F A;  1VCI A;  3KJP A;  1OXX K;  4A76 A;  3KF8 B;  4QGU A;  2IT1 A;  4A3K H;  3S1R H;  4IFD I;  2E8G A;  5C0X G;  2PI2 A;  2DUD A;  3W1G A;  3W5O A;  3PCO B;  5C3E G;  4OX9 L;  1XNQ L;  4B3M Q;  4A3J G;  4HJA A;  1KAW A;  3RLF A;  4UY8 C;  3GD7 A;  4LWC A;  4DV5 L;  1SRO A;  4LF6 Q;  3KF6 B;  3I4N G;  2HHH L;  4JI3 Q;  2KCT A;  4DV3 L;  2MQH A;  3H0G G;  1XMO L;  1SLJ A;  2WB1 E;  1X3G A;  3KF6 A;  1NBW A;  3NBH B;  2D0O A;  4Y52 H;  2Q2H A;  3A0J A;  2NZH A;  2CFM A;  2WB1 G;  4BXX G;  4DV1 Q;  1EWI A;  4DV0 L;  1GM5 A;  4BY7 H;  1Y1W G;  1L1O C;  1MJC A;  2QGQ A;  5C44 G;  4GNX B;  5M3M G;  3CF5 A;  4DR2 Q;  3M4O H;  3ER0 A;  3UDX A;  1LYL A;  3FKI G;  1TWG H;  4GNX A;  3K7A H;  3TRE A;  2R7F A;  4X62 Q;  2Q2T A;  3D31 A;  4A3F G;  1X55 A;  3ULJ A;  2K52 A;  1SN8 A;  1VQJ A;  1BVS A;  5C4X H;  3RZO H;  1P8L A;  2VY3 A;  5FLM G;  3PIP A;  2Y0S E;  3I2Z A;  1N9W A;  2R6G A;  2R7Z G;  1IZ6 A;  4B3R Q;  1I6H H;  4PZ7 A;  3L7Z C;  4DUZ Q;  1V43 A;  1N33 Q;  3S1N H;  2Y0S G;  4GOP B;  4IFD G;  3T1Y Q;  5BR8 L;  1QZG A;  1S40 A;  2CCZ A;  3GTM H;  1HH2 P;  3F8T A;  1IBL Q;  1JMC A;  1Y1V G;  4OO1 G;  1D7Q A;  2OTL A;  3S2H H;  4DR7 Q;  4LF7 Q;  3HFZ B;  4X64 Q;  1VQD A;  1WCM G;  3L2P A;  1EIF A;  4JI8 L;  1IBK Q;  3IRB A;  1J5E L;  2ZM6 Q;  1K83 H;  2ZTC A;  5IP7 H;  3J81 i;  3TS2 A;  4DR5 Q;  4A3G H;  4DUY Q;  4LF8 L;  5IYC G;  3TEH B;  1MIU A;  1XNQ Q;  2K5H A;  3M3Y H;  4OX9 Q;  4B3T Q;  1IYJ B;  1K0R A;  3S14 H;  1XNR L;  2ZTE A;  2NN6 G;  4DV5 Q;  2R7D A;  5IE8 A;  2R93 G;  2HHH Q;  2NVQ H;  4DV3 Q;  4DV6 L;  1XMO Q;  1VQ9 A;  3CP0 A;  4KI0 A;  3CCS A;  1G51 A;  3DM3 A;  3JC6 6;  3HOY H;  1X56 A;  1V9P A;  3PO2 G;  4A3I G;  2JA7 H;  5ELO A;  3GTL H;  1JT8 A;  5IT9 c;  4BY1 G;  4XTC S;  5IYD G;  4A3D H;  4X65 L;  3OTO Q;  1CSQ A;  4DV0 Q;  2WFW A;  1EFW A;  2I0Q A;  2EXD A;  1PA6 A;  2D62 A;  4MZ9 A;  3RLN A;  4YCU A;  3UDG A;  1L1O B;  4NXM L;  4A3E H;  1UE6 A;  1K8A C;  3G4S A;  2AKW B;  4DR3 L;  1LM0 A;  1K3R A;  4NXN L;  4L5R C;  1PH3 A;  2UUC Q;  1UE1 A;  4LFC L;  2AWN A;  2WAQ G;  1HNX L;  3KLW A;  4JI3 L;  2N78 A;  3K0X A;  1NMF A;  3KYH C;  1P16 A;  2KCM A;  3MEF A;  3Q8D A;  5FJ8 H;  4JYA Q;  1YEZ A;  4PMW A;  2ES2 A;  3GDE A;  3A5Z B;  3I56 A;  2F52 A;  4QIW E;  4GNX C;  1AH9 A;  1XPU A;  4DV1 L;  4A3B H;  4YWK A;  4A3L H;  3U4V A;  2R92 G;  2GN5 A;  2B63 H;  5GRO A;  5BR8 Q;  3CPF A;  4IPC A;  3M85 A;  1EIY B;  2OTJ A;  2EIF A;  2XGT A;  2I5H A;  4DR2 L;  3U4Z A;  3GTK H;  1VQL A;  5ELN A;  4IOC A;  5DLQ E;  5M3F G;  1OXV A;  3CC7 A;  3EN2 A;  2YV5 A;  2Q2U A;  4JI8 Q;  3RNU A;  1XTD A;  2K75 A;  4X62 L;  1BBW A;  4LUO A;  3M4P A;  4YCW A;  4Y7N H;  4DV2 Q;  4LF8 Q;  4A3K G;  3UE1 A;  3RZD H;  3CPW A;  2YU9 H;  3TRZ A;  5GAD C;  4B3R L;  3CQZ H;  4PZ6 A;  1W3S A;  3CCJ A;  4JI1 Q;  3HOZ H;  3BZK A;  4QL5 A;  1U5K A;  1X3E A;  2RCN A;  1KL9 A;  1K9M C;  1VQK A;  3S17 H;  4IFD J;  2QA4 A;  4DR6 L;  3HOU H;  3G48 A;  1TWF H;  1N32 L;  4IPH A;  4DR7 L;  4HIM A;  3OYY A;  1B70 B;  2AMC B;  4LF7 L;  1O7I A;  4UP7 A;  1B8A A;  4EQ5 A;  1YBY A;  4KLK A;  3ULL A;  4BA2 I;  4AIM A;  5JEA J;  4X65 Q;  3SGI A;  4QY7 A;  4JI4 L;  2ZM6 L;  2A8V A;  4BY7 G;  1KIX A;  4A3M H;  4DR5 L;  4DUY L;  1VQH A;  2JA8 H;  2K5V A;  1DGS A;  3S16 H;  1UWV A;  2HIX A;  3CXC A;  4NXM Q;  3CCM A;  1FGU A;  1K73 C;  5IYB H;  4DR3 Q;  3NEN A;  4H02 A;  4B3T L;  4NXN Q;  3AQQ A;  3S1Q H;  5GAG C;  4LUZ A;  2ALY B;  4AQY Q;  3E9I A;  5LMN W;  4OWW B;  3G6E A;  4LFC Q;  1HNX Q;  2E2H H;  1CUK A;  2I5M X;  3PUY A;  4LFA L;  1B7Y B;  5C4X G;  4NPS A;  1CSP A;  1Q46 A;  4HIO A;  3PO3 H;  2MFI A;  5GAE C;  2K50 A;  1E1T A;  1HR0 W;  2ID0 A;  3BJU A;  2CQO A;  4YWM A;  2JA6 H;  2VNU D;  4L5T A;  1KXL A;  3NEM A;  3S2D H;  3CCV A;  5LMU L;  4A93 G;  3OTO L;  4R4T A;  1NE3 A;  4JBM A;  1Q86 C;  4B3S L;  1X54 A;  1KC8 C;  4GKK L;  1HZC A;  5AJ3 Q;  1VQP A;  4IJH A;  5E7N A;  1PH7 A;  3HOX H;  1IXR A;  1KRS A;  2ZJR A;  4A3C G;  3H3V I;  2CWP A;  2UUC L;  3PGZ A;  2UUA Q;  4GLA C;  4DR4 L;  5IP7 G;  1M90 C;  4JYA L;  4DAM A;  1VQN A;  3GTO H;  3M4Q A;  2N3S A;  4HJ8 A;  2CWA A;  4R4I A;  4MNO A;  2IHF A;  4NB3 A;  4RMF A;  2NVY H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...