1HZBA

Bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLD SHOCK PROTEIN CSPB
publication title Crystal structures of mutant forms of the Bacillus caldolyticus cold shock protein differing in thermal stability.
pubmed doi rcsb
source organism Bacillus caldolyticus
molecule tags Transcription
total genus 14
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hzbA00
4JBJA 2EQSA 4YCWA 3RN5A 1XNRL 1VQGA 4TQUS 3UDFA 1C0AA 1AE3A 2KBNA 5M3FG 4B3MQ 3M4PA 3E9IA 1NJIC 1VQ6A 4BY7H 1P8LA 3HOWG 4WJ4A 1KRSA 3HOXH 4DR5Q 2VNUD 2JQOA 4QY7A 3J81i 4A3GG 2KHJA 3CC7A 3HFZB 5H1SE 3S16H 3ZJYC 4OWWB 1YNXA 3BZCA 4NPSA 1I94Q 1XJVA 2JA5G 4LFAL 3I4MH 4GKKL 1EIFA 3I7FA 5JEAJ 1E22A 2PQAB 1VQ5A 1KQSA 4DR6L 3KF8B 4GKJL 2YTYA 3S1RH 3AQQA 2WB1E 1HZCA 4BA1I 3FKIH 5K36G 3D31A 3TS2A 1X6OA 1UE5A 1VCIA 3W5OA 3HOYH 1IBKL 4C2MH 4UP9A 1EIYB 1XPUA 1VQLA 4DAYB 1TWGH 4DV6Q 1Z47A 1WJJA 2PNHA 4BBSG 5M3MG 5C44H 4IO9A 2R7DA 4C3HH 4HJ5A 2AMCB 3CQZH 4UP8A 3CCVA 3RR5A 2UXDQ 1EWIA 1TWAH 1YBYA 1VQHA 1WYDA 1QZHA 1CKNA 4A93G 1PYSB 2VW9A 5C4XG 4IFDI 3I4NH 2GVBA 1UWVA 5ELOA 3CC4A 1CUKA 4OO1G 4AYBG 4A3KG 4A3CH 2Y0SG 3CPFA 4OWXB 1OXTA 4DV2Q 2VUMH 3IRBA 5JEAG 4X65L 3PF4A 4MZ9A 4GNXB 3RNUA 5BR8L 4A3EG 1GKHA 2UU9Q 3KDFB 1QVCA 4R1JA 1VS0A 3CAMA 2ZJQA 1LUZA 4GN3B 4OO1I 3T1YL 1IYJB 3VDYA 1YJ9A 2IHFA 1ASZA 2YTXA 1G51A 1QUQB 3EIVA 1AH9A 1JJCB 2MFIA 5LMNQ 1NMFA 2NN6G 1Q8KA 2GN5A 5GAHC 2LSSA 4LF5Q 1QVGA 1VQNA 3K8AA 1PH4A 4A3IH 3TQYA 1L1OC 4QL5A 3EBEA 1E1OA 2PQAA 1HZBA 3NENA 1Y1VH 1SN8A 1PH9A 1I6HH 5HGQA 3HOVG 2Y0SE 2AWNA 1XMQQ 2R93G 1PA6A 3F1ZA 1H95A 4DUYQ 1SR3A 2FXQA 5IYCG 2ZM6Q 4R4OA 1J5EQ 1M90C 2N3SA 4LF4Q 2JEAI 1KL9A 5EAYA 1SE8A 1HNWQ 3H3VI 4JC0A 3OW2A 1SRUA 3I2ZA 2WP8J 3HOZG 3STBD 1N36Q 4L5SA 1VQ9A 4OX9Q 1YJNA 1RL2A 1WOCA 2IHEA 4XTCS 3LGJA 5AJ3Q 4A75A 4GOPC 2B3GA 2F4VQ 4A3BH 2UXBL 4JI1Q 4R4TA 4DR2L 3J80i 3CD6A 1WCMH 3MEFA 3PIOA 4A3FG 1OXSC 2F52A 3PIPA 1C7YA 5LMUQ 5J3BA 4YWKA 2QGQA 4A3DH 4KHZA 1VQIA 2L15A 2JEBI 4A3JG 1A8VA 1YIJA 4BXXH 3HOVH 5IE8A 5C0XI 4HIMA 1BBWA 3B6YA 2VQFQ 4DV3Q 5FJ8H 1Y1WG 3CCEA 1YITA 3CCMA 1CKNB 2Q2HA 4DV2L 1N33Q 4DV4Q 4DR7L 2WAQE 1Q81C 4X64L 2RHQB 3T1HL 4KHPL 3JAMi 4AIMA 4JYAL 2Q2IA 1QUQA 3PSIA 4LW1A 4OXPA 3CCQA 4HJ7A 1VQPA 3GTPH 3H0GH 4AH6A 5C3EH 3CMAA 4DR3L 1HNZQ 3W1GA 1WFQA 3S1MH 4IOAA 3RZDH 2Q2UA 2A1AA 2ID0A 4HJ9A 5IP7H 3WWVA 2HIXA 4YY3Q 4NXNQ 3A0JA 4B3RQ 3AFPA 2OQ0A 2VQEQ 3RN2A 2UUAQ 4TVAB 1Q1EA 4LF5L 1EOVA 5IWAL 2R7ZH 3KOJA 4P73A 2K4KA 4IPGA 4NB3A 3CXCA 4JBMA 1G291 3HOUH 1NY4A 4JV5Q 2K75A 1X55A 1I50H 3CW2C 4J15A 3OTOQ 3H15A 4POFA 3J81j 3CPWA 3GTOH 4DR4L 4A3GH 2V1CC 3MXNB 4JI5Q 4A4IA 1XMQL 1K8AC 2R6GA 1CKOA 1XNQL 4QQBX 2K52A 1VQCA 1JE5A 4JI3L 5IYBG 1E1TA 4LUVA 2PI2A 3CF5A 1J5EL 1Q82C 4P71A 2I5LX 1D8LA 3PUWA 4A3LH 1VQJA 3A5ZB 4Y7NH 4JOIA 2HHHQ 1MIUA 4DUZL 4LFCQ 4JI0L 2EXDA 1KD1C 2A8VA 2R7FA 2MO1A 2BA1A 1CKMA 3EN2A 1E3PA 3HOXG 1N34Q 1G6PA 1A62A 1FL0A 3U58A 1X9NA 3S24A 3GTMH 2F4VL 2D0OA 2NZOA 2RHSB 5AJ3L 4DV0L 1C9OA 1KXLA 1Z9FA 3I4MG 1YHQA 4JI1L 4QGUA 1MJEA 1TWCH 3RLFA 2E8GA 4BBRH 5LMUL 4K0KQ 2AKWB 4NXMQ 4JG2A 2E2IH 3K0XA 4PMWA 3W1BA 1JMCA 4LF9L 2ASBA 3FKIG 1PYBA 1EYGA 2UUCL 2UUBQ 1T9HA 4BY1H 3GTQH 2IY5B 4GNXC 1VQ4A 2VQFL 5C4XH 4DV3L 1PH3A 4LF6Q 3HOYG 1NTGA 4AQYL 3RZOH 2ES2A 1VQ7A 5C44G 1A63A 1N33L 1RIPA 4LF8Q 2B63H 3JC66 4A76A 2UXCL 2E5LQ 3NELA 1IBMQ 2D0PA 4A3EH 2BA0A 4O2DA 5HY6A 1IBLQ 3F8TA 3J80c 3F2CA 4B3TQ 2JA8H 3TRZA 1K8GA 5JJKA 1TXYA 2ZTCA 1VQBA 1L2FA 1KHIA 1E7ZA 1XMOL 4B3SL 3I4NG 1HNZL 2K14A 2JE6I 4QJFA 1SLJA 2N49A 3I55A 3KFUA 3ULLA 4A3CG 5IYDH 1UEBA 4JI4Q 1VQ8A 2VUMG 4GN5A 1YI2A 4LF7Q 1J6QA 4HJ8A 4DR3Q 1B70B 4GLAC 4R4CA 4R4QA 1Q12A 1S3OA 1N8RC 1GM5A 2N78A 4B3ML 3M7NA 4RG1A 4IPDA 1YZ6A 1QZGA 4DR5L 3S1QH 4AYBE 3I4OA 4DK6C 1HR0Q 2NN6I 3H3VH 2K5NA 4JBWA 2LXKA 1IL2A 1I94L 2KENA 3M4OH 4YCUA 4DV5Q 2JA9A 4DK3C 3ULPA 4RMFA 2N8NA 1TWHH 4X66Q 4P74A 3K80C 3CCSA 1EUJA 1XNRQ 3M3YH 5IYCH 1K9MC 3U50C 3PO3H 2IX0A 4IPCA 3Q8DA 1MKHA 4LFCL 5E7NA 5FLMG 3ERSX 1Y1VG 1V43A 3TS0A 1HNXL 2JA6H 2JK8A 1YHAA 4A3MH 4JI6Q 3K7AH 3S14H 4HJAA 1UE6A 1Q86C 2HT1A 5DLQE 4DV6L 1LM0A 1L1OB 1K83H 4LFAQ 3I56A 4LWCA 2JA7G 4GKKQ 3TREA 1BVSA 4A3FH 1SMXA 3J81c 3CCUA 4DR6Q 4LUOA 1EQRA 4JI8Q 4YHHQ 1MJCA 3DLLA 2R92H 3OYYA 3PUZA 2UXDL 5C4JH 1P16A 2VY3A 3D0FA 4KLKA 3GTJH 1V1QA 4HIOA 3PGZA 1TWFH 1UE1A 4C3IH 4BA2I 2C35B 3S2DH 1X65A 1W2BA 3AYHB 2K50A 1WCMG 1D7QA 1K0RA 2OCEA 2YU9H 2ZJRA 5LMNW 3HKZG 4P72A 1VQOA 2UU9L 5M5XH 4EX5A 2KCTA 2CCZA 4DR1Q 2NVQH 1UE7A 2VL6A 4JCVE 3NBHB 1IBLL 2HIVA 4BXXG 3UDGA 4PG3A 2PI2E 4PZ7A 5IP9H 3PO2H 3GTGH 1N32Q 1I3QH 3NEMA 5IY0A 4X62Q 2YV5A 5LMNL 1LTLA 1E24A 4IJHA 4X65Q 1QVFA 3CCRA 2ALYB 1U0LA 4LF7L 5BR8Q 4XIGS 3CCJA 1KRTA 5M3FH 2JA7H 1B7YB 1VQEA 2A19A 4QIWE 1HZAA 1Y14B 3H0GG 3HOWH 4P75A 5C3EG 2WB1G 2E2HH 1IXRA 4GN4B 1R9TH 5IP7G 4JI7Q 3G71A 2OTJA 4DV7Q 2Z0SA 2JA5H 2BH2A 4DUYL 1BBUA 3M85A 2ZM6L 4JI2Q 3G6EA 4LF4L 4IFDJ 4X66L 2DUDA 3ICEA 1HNWL 2VS1A 2CWPA 2I5MX 2ZTEA 4FDBA 3STBC 2WFWA 4L5RC 1Q7YC 2R7ZG 1U5KA 5GAGC 1VQMA 4BY7G 3HOUG 1L1OA 2Z6KC 1X3FA 1V9PA 2RCNA 1OTCA 1N36L 2IX1A 4OX9L 4Y52H 3ER0A 4JBKA 2PMZE 1L0WA 2ZJPA 1KC8C 4JI6L 1GD7A 3KYHC 4GLVB 1YVCA 2BH8A 2ZTDA 1YEZA 5ELNA 4BBSH 5JJIA 3S17H 4HIDA 5M3MH 2I5HA 1ASYA 2I0QA 3TEHB 1PH1A 4A3LG 3FHWA 4PZ6A 4JI8L 4YHHL 3GO5A 2Q2TA 1FJGQ 3KJOA 4L5TA 1X56A 3PF5A 2CWAA 4A93H 3M4QA 4IOCA 2YYZA 4GOPA 2UXBQ 2K5HA 2NZHA 1OXUA 1AE2A 4DR2Q 4A3KH 4IFDG 2JJQA 4BBRG 4LNQA 4DV4L 1VQAA 4LUZA 3SGIA 4MNOA 5GADC 3A74A 1YJWA 1SFOH 3G4SA 2AHOB 4YWLA 3AFQA 1Q1BA 3RLNA 3U4ZA 4DR1L 4R4IA 5GQOA 1KIXA 4BY1G 1X3GA 4LFBQ 4UY8C 1PV4A 4WJ3M 2OTLA 3GD7A 1N32L 2NVYH 1W3SA 4NXNL 4YY3L 5M5WH 4X62L 4DV1Q 4B3RL 2AWOA 2VQEL 1XPRA 3FP9A 5M5YH 1HZ9A 2UUAL 3UDIA 2B63G 4DR7Q 3K7UC 2F3IA 3GDEA 2D62A 4UP7A 3UE0A 1OXVA 4X64Q 4HIKA 3T1HQ 4KHPQ 1JB7A 2HQLA 4JYAQ 1DGSA 2JA8G 2CKZB 4IPHA 4JV5L 1HH2P 1X3EA 1X54A 3L0OA 3KF6A 2H5XA 1B8AA 3OTOL 1I5FA 1Q46A 2K5VA 3KLWA 2MNAA 3K81C 1GVPA 4YCVA 4GS3A 4JI5L 5IYDG 3JAMc 1JJ2A 4JI7L 2XGTA 2KHIA 3PUVA 4H02A 2R93H 1S72A 3PV0A 4DV7L 1HNXQ 2LXJA 3GTLH 5C0XJ 3S1NH 3GTKH 4JI2L 4EQ5A 1LYLA 1XTDA 3PCOB 3E9HA 4A3IG 2OQKA 4JOIC 5GAEC 5IWAQ 3RLOA 2HHHL 1BKBA 2IT1A 5GROA 1FVIA 2GVAA 3J7ZC 3S2HH 2ATWA 1YHBA 1N34L 3UDXA 3L7ZC 4PZ8A 4X6AH 3HOZH 5FLMH 4L5QA 1PH6A 4MTNA 5IT9c 1FGUA 1JT8A 4DR4Q 2XTIA 3HKSA 1VQFA 1EQQA 2EIFA 3DM3A 1XNQQ 3J7A5 2KCMA 4DPGA 4K0KL 1NMGA 4JI3Q 3CC2A 4NXML 3PO3G 3CP0A 4GKJQ 1N9WA 2VZAA 1PH7A 1SROA 3ULJA 1XPOA 4IJLA 4KI0A 2WAQG 4DUZQ 1FJGL 4A3JH 4JI0Q 3F2BA 4ME3A 2UUBL 2Z6KA 4A3BG 2JA6G 4A3MG 1PH2A 4APVA 1IBKQ 1Y1WH 3CCLA 4LF6L 2CFMA 4DV0Q 1EFWA 5C0XG 1PFSA 1IZ6A 4LF8L 1PH5A 4A3DG 2NVTH 3BJUA 2R92G 1WI5A 3BU2A 4GOPB 2E5LL 1PVOA 3KJPA 4UPAA 3L2PA 1IBML 5JJLA 2DGYA 2CQOA 4B3TL 4LF9Q 1HJPA 1M1KC 1CSPA 5FJ8G 4POGA 2UUCQ 4LFBL 1OXXK 4GNXA 1NE3A 1GO3E 3A5UA 4OONA 3F2DA 1HR0W 3G48A 1PHJA 1VQKA 1O7IA 4AQYQ 3KDFA 4JI4L 3E0EA 4DV1L 4OWTB 1CSQA 1VQDA 4DAMA 3AEVA 1KAWA 2MO0A 3UE1A 2MQHA 2YTVA 1JJGA 4YWMA 2UXCQ 4GLXA 4DNIA 3CMEA 2OWOA 3PUXA 3S15H 3U4VA 1PH8A 2RF4A 4C3JH 2QA4A 4DKAC 3BZKA 1HR0L 1NBWA 2E2JH 4O0AA 3T1YQ 5IP9G 3PO2G 4B3SQ 3PUYA 1K3RA 4ALPA 1XMOQ 2NVXH 1S40A 3HKZE 4DV5L 1K73C 5FLXc 3M9BA 2QEXA 2B29A 3KF6B 5IYBH 1A0IA
chains in the Genus database with same CATH superfamily
2XRSD 1K3BC 1VQGA 3UDFA 1ILPA 2E2HB 3VR3A 1MGSA 1PFMA 2QW7A 4KD4A 1VQ6A 1P8LA 3HOWG 4WJ4A 3HOXH 3J81i 4A3GG 3HFZB 4N9PA 2PO4A 3S16H 3ZJYC 1RCVD 1PZJD 1YNXA 3BZCA 1NAPA 1VF7A 4NPSA 4LFAL 3I4MH 1JOQA 2DJGC 4C56C 3AQQA 1HZCA 2FMMA 1SJED 3D4WA 3FKIH 1RD9D 5I9OA 4BBSB 1IBKL 1WD0A 4U673 1VQLA 1YNNC 1TWGH 1Z47A 4IO9A 2MPMA 4A93B 5C4XB 2UXDQ 1LLRD 1STEA 1QNKA 3Q24A 1QZHA 4A3KB 3Q23A 2Y0SB 4IFDI 3I4NH 1Y8OB 3A8IE 5ELOA 3OMCA 1SFOB 1CUKA 2A74C 1CI3M 1AZPA 1UNSA 1ESFA 5HGTA 4GNXB 5BR8L 2UU9Q 3KDFB 2OXPA 4M8AA 2FMCA 1IKLA 2ZJQA 3V96A 3T1YL 2IHFA 1MBYA 3NWTA 1QUQB 3MHBA 4JVZA 2AQ2B 4R8IA 5EBDA 2K5DA 5E4WC 1PH4A 2KEEA 4PNYA 2VB2X 1E1OA 1HZBA 1S5ED 3GTKB 3OOCA 5HGQA 3QR8A 2P5ZX 1SR3A 2FXQA 5IYCG 2ZM6Q 2TMPA 5FOBB 2RDHA 1SRUA 2ICEC 3STBD 2IL8A 1RL2A 1WOCA 5AJ3Q 4GOPC 2UXBL 4A3BH 1PTOH 2B3GA 3CKIB 3L9AX 2CVRA 2TSSA 3MEFA 2F0DA 2F52A 4EQOA 3GTJB 2EY6A 4A3DH 4KHZA 5CV6A 1ESRA 1VQIA 2CH4W 4K2KA 3OW7A 3DWQA 3TMEA 5D3DA 1BBWA 1QNUA 2PPBC 1Y1WG 3CCEA 1C4QA 3K5MA 1IW7C 3TZDA 2OF1A 2C5CA 1Q81C 4X64L 2RHQB 3T1HL 3PQIA 4AIMA 3K58A 1QUQA 3A7AB 3CCQA 5C3EH 3CMAA 2PMZB 1WFQA 4ZKCB 3S1MH 1TR5A 2A1AA 1EIGA 3WWVA 1AFPA 4YY3Q 3MFGA 3RN2A 1KABA 1R4PB 4C3JB 4TVAB 2B2TA 2K4KA 5C6AA 3QOJA 3HOUH 5ISRA 4RAUC 4IUTA 4TSSA 2K75A 3OHXC 1QCBD 1LT4D 3CPWA 1F9QA 2V1CC 4JI5Q 3TSSA 1DOLA 3VYUA 3CF5A 2XVSA 3SK4A 3TZUA 2G5DA 2K1BA 1Z7TA 2ZXRA 2A8VA 2R7FA 1ZYRD 1N34Q 4P2CB 1G6PA 2QF7A 1RJTA 2V4DA 3GTMH 2EE1A 2D0OA 2F0FA 3E5SA 5AJ3L 1K0SA 4QGUA 3S1RB 5JPNC 4K0KQ 3BVGA 4HEDA 4NXMQ 4DFAA 5CC4A 3HRZC 1JMCA 3HOYB 1EY6A 3R8BA 1PYBA 2IY5B 2UUBQ 5C4XH 5C44B 1YNJC 4C3HB 5IGDA 1VQ7A 3SDZA 4LF8Q 1V1OA 4KN7C 4B9XA 1PLFA 2D0PA 3WDNA 4K8IA 1IBLQ 1RKNA 4DNTB 3F2CA 4IALA 2Z8LA 4HR7B 3C1FA 4QJFA 1SLJA 3I55A 5IYDH 1IKMA 1HTLD 2B2UC 1VQ8A 1LTID 5EPKA 3T56B 2EYHA 4R4QA 1GM5A 4FF1A 2N78A 4RG1A 1K28A 1U4RA 1ZEQX 5CV7A 4ABNA 1QZGA 3DUZA 5KNBA 1IYVA 4JBWA 4XXEA 4E6IA 5CBAE 1IL2A 5CMDA 2EY5A 2NB0A 1F2LA 3A7LA 4X66Q 1NSNS 3PO3H 1LT6D 4IPCA 4G4KA 4CHTB 3Q8DA 4HN7A 4IURA 2A68C 5FLMG 3ERSX 1MHWC 2K5QA 3K7AH 4KTAA 1BCPC 1JWUD 1UE6A 5DLQE 4DV6L 3TREA 3J81c 1PRTB 1GXDC 1MJCA 2NBFA 1SYDA 2D5DA 3QWNA 1KDBA 3IKJA 3D0FA 3GTJH 1Y8PB 1WCMB 3H6MA 4ZUJA 2BDNA 1TWFH 4X3KA 3KLRA 5FLXL 4F7XA 2E2DC 1DD2A 3QOLA 5C4ZA 5M9OA 2OCEA 2YU9H 3ONAB 2NTTA 1VQOA 2NTSA 1TQOA 4EX5A 2HUGA 2VL6A 1IBLL 4RCOA 1JICA 2A5HA 4OIKA 3K5LA 2YV5A 2F0TA 1EEID 3PIO3 2A6HD 1C8CA 3H0GB 5EKLA 5M3FH 2E74C 1I4GA 5LL6S 1B7YB 1RHPA 2A19A 3RZDB 1HZAA 5E3FA 1ML0D 1T5EA 4P75A 2CW0D 1R9TH 5JOBA 4HCEA 2R7ZB 2JA5H 4S3SA 5J39A 4DUYL 1BBUA 5I2YA 5HURA 5KIXA 5IODA 3M85A 4X66L 1HNWL 4FO2A 4L5RC 1U5KA 1I50B 1VQMA 1GUGA 3GQBA 1HFNA 2Z6KC 1V9PA 5JVG3 2RCNA 1N36L 4ULLA 3N6RA 4R8NA 1L0WA 2EOTA 1XWEA 1JQYD 2BE5C 4GLVB 4Y7NB 4K5WA 5ELNA 1JWMD 3S17H 5M3MH 2I5HA 5C3WA 3GO5A 4ZAIA 1Q3LA 1FJGQ 5BN3A 1F9SA 2L4NA 2B2VC 3M4QA 4CGYB 4IUNA 3JAME 1I4XA 4OEMB 4LJZC 1CM9A 4GOPA 2K5HA 4OO1H 2JJQA 5JEAH 4DV4L 1VQAA 1A6XA 4K6LA 3HZXA 4YWLA 1Q1BA 2F0UA 3RZOB 1X3GA 4LFBQ 2B63B 2Z1CA 4NXNL 4DV1Q 4KKTA 4B3RL 4DF7A 2UUAL 1GUSA 4RHSA 1EEFD 2PZTA 3K7UC 2D62A 4JYAQ 2JA8G 1EOTA 3HP3A 2B8FA 1X3EA 3L0OA 4ME5A 3KLWA 5LL6X 1GVPA 1H9KA 5CV4A 4YCVA 1JJ2A 3S1QB 5L37A 2XNAC 5C0XJ 4QMGA 5CV5A 5EPJA 1LYLA 2F0QA 3E9HA 4JOIC 4RHRA 2HHHL 3CRKC 5NUCA 5IGEA 3L7ZC 2A6EC 3HOZH 2RCFA 3KF8A 5J1ZA 4DR4Q 1VQFA 3I4LA 1G6ZA 2KCMA 4RKLA 4JI3Q 2WAQB 2F0GA 4O1NA 3J7YW 1BQQT 1HTPA 3URYA 3FPUB 4Z9CB 1FJGL 3L3OC 3K57A 2JA6G 4A3MG 3CCLA 4OIJA 4CJ0B 1LV9A 4KY5A 2NVTH 5T1GA 3C3LA 3BDLA 3CRLC 1CSPA 3D8GA 4POGA 2M9VA 4LFBL 4EGVA 1HR0W 3F2DA 1A3TA 4OONA 1VQKA 2RSOA 4AQYQ 2F03A 4JI4L 3BDCA 4DV1L 3AMUA 3AEVA 1KAWA 3UE1A 2MQHA 2YTVA 2UXCQ 4GLXA 2QDBA 4DNIA 4XYQA 3KBXA 2OWOA 4LK1C 3S15H 2RF4A 3BZDB 1HR0L 4O0AA 3VYRA 5IP9G 3PO2G 2KHSA 4ALPA 2NVXH 4M1UB 3HKZE 4DV5L 4OELB 2F0KA 4FVMA 2B29A 1SROA 2B2UA 5IGBA 3KF6B 5IYBH 1EU3A 2EQSA 4YCWA 4ODGA 3RN5A 1XNRL 4TQUS 3HOWB 2KBNA 4A3GB 3DMUA 1KAAA 2KA7A 4DXGA 4DR5Q 1H9SA 3RMHA 1DYQA 3CC7A 5H1SE 3A8JE 2JYOA 1ZXTA 4GKKL 4DK1A 2X6GA 1NNXA 4IZ8A 4DR6L 3HGBA 1KQSA 1PTOD 3J80L 2WB1E 4DU9A 4KHVA 2N55A 1XTCD 5ELDA 5C3XA 4MIUA 4C2MH 1EIYB 1X3QA 1EL0A 2PNHA 2LMCB 2F3WA 4HJ5A 2AMCB 1A2TA 3CQZH 2F0VA 4IUPA 1TWAH 1YBYA 1WYDA 2RDFA 3OWFA 4XQQA 3I73A 4NKLA 3FRPB 2IPKD 1EYDA 4WJWA 1OXTA 1BCPF 3IRBA 3PF4A 1EY5A 1M8AA 4MZ9A 3RNUA 1GKHA 5JAVA 4R1JA 1W6JA 1CK1A 1VS0A 2NVYB 3EQLC 3UI2A 2C9OA 3WOFA 3MWYW 3VDYA 3P75A 2YTXA 3EIVA 2F0IA 5EQ0A 2AQ3B 2NN6G 2GN5A 2LSSA 1G2TA 3Q0AA 1DZ1A 1ONLA 1EU4A 4QL5A 3MXNA 3EBEA 5G3LF 1SNOA 3MEHA 2XRQD 3BYYB 1SN8A 3HEJA 3HOVG 2Y0SE 1XMQQ 2R93G 4XQJA 2F4IA 1PA6A 3F1ZA 2JA7H 2F0OA 2O5JC 4LF4Q 1M90C 2XIWA 1KL9A 1SE8A 4JC0A 4JPBW 5KNDA 2DN8A 1QILA 2WP8J 4OX9Q 1YJNA 2F4VQ 2AUJD 4A75A 5FLXE 5EPLA 1BXTA 4DN4M 4JI1Q 4R4TA 4DR2L 1TU2B 3CD6A 3PIOA 4A3FG 1LTBD 1FNVA 1OXSC 3PIPA 1HHVA 3X3NA 1LTRD 2QGQA 3SEBA 4EQPA 3S2DB 2K32A 2L15A 2JEBI 1Y1WB 3NTKA 5KGUA 4FXGC 1GUTA 5IE8A 5C0XI 2B2VA 2VQFQ 1C48A 2ZT9C 5FJ8H 4DV3Q 1H9RA 1YITA 3CCMA 2KQ3A 4DR7L 3MTSA 5JPMC 4F88A 1STBA 3I8ZA 3IFTA 4HJ7A 4DR3L 4HAEA 1HNZQ 1Y8NB 1LTTD 3VYTA 5IP7H 2Z6BA 4QCLA 3AFPA 5TSSA 2VQEQ 1TS2A 4UHVA 4CKCA 4P73A 1EY9A 3VR4A 2KVMA 3NBIA 1NY4A 4RGMA 2XN9C 3VR6A 2E76C 2HQEA 3CW2C 3OTOQ 2CH4A 2FJ2A 4A3GH 4QQBX 1OO9B 1XMQL 4ZYSA 2PI2A 1Q82C 4P71A 1D8LA 4A3LH 3A5ZB 4JOIA 4LFCQ 5J22A 2EXDA 1WTVA 2MO1A 5KRUA 3EN2A 3HOXG 1TVXA 5E1FA 2HCIA 1FL0A 3U58A 2F4VL 5BN5A 1Z9FA 3I4MG 4JI1L 1GOZA 4I7AA 4V190 4IFDH 1TWCH 4BBRH 2E8GA 4K6DA 4JG2A 4MTKA 1A3UA 2E2IH 3NWSA 4PMWA 2J4XA 3W1BA 4LF9L 2L9HA 3BG3A 4RFBA 3ERQA 1BNZA 3FKIG 2K03A 2UUCL 4BY1H 3GTQH 1T9HA 3JAML 2VQFL 2EYOA 3R2TA 4DV3L 1HA5A 4LF6Q 5IGFA 5EGTA 1KNEA 3JC66 1PFNA 4WORA 2E5LQ 1ENAA 4O2DA 2QDLA 5M5WB 4ZUIA 3TRZA 4LAAA 2ZTCA 4CDEC 4B3SL 1KHIA 3I4NG 1XMOL 1HNZL 3H3VC 2ZXOA 1WTXA 1UEBA 5KNCA 4HJ8A 1B70B 4GLAC 1S3OA 1II3A 1YZ6A 3S1NB 4AYBE 4DK6C 1QOHA 5KYIA 2JA9A 4DK3C 1SE2A 3ULPA 4RMFA 2N8NA 5ELEA 3M3YH 4H13C 5IYCH 1PZKD 3U50C 3P1HA 3T13A 2EJGC 1I6HB 4LFCL 1MSHA 4IQZA 2JK8A 1YHAA 3S14H 5DAUA 1LM0A 1K83H 4LWCA 4A3JB 2Q8IB 1EQRA 4JI8Q 4YHHQ 2R92H 3DLLA 2UXDL 1D5MC 2L12A 4UAIA 4F8MA 1B9NA 2B8GA 2K28A 4HIOA 1UE1A 4C3IH 4BA2I 2C35B 3S2DH 1T5XD 2K50A 3OMGA 1D7QA 1K0RA 3W3AA 3HKZG 4P72A 4DK0A 2UU9L 1SMYD 1YNND 2KCTA 2CCZA 1CT1D 2M00A 2RA4A 1I3QH 3T51B 1JB3A 5CYUA 3PMFA 1LTLA 4WFN3 5IIFA 1E24A 3MVVA 4X65Q 3OWEB 3Q6SA 1KRTA 1O78A 2IX3A 4J6HA 1VQEA 1F9RA 4QIWE 4PV1C 1Y14B 5C3EG 2WB1G 2E2HH 3KLSX 3DM1A 4GN4B 1JOKA 4JI7Q 2OTJA 3V05A 3ND8A 2BH2A 2ZM6L 2EJFC 1IYUA 2OT2A 4N8FA 1HQMC 1PXUA 1EZ6A 2CWPA 3J80E 4BY7G 4K5VA 3GTOB 1F2MA 3HOUG 4JK1C 2KCNA 4DXFA 5K36H 2SNMA 3P20A 3FEWX 2ZJPA 1GD7A 4RGOS 1PRTD 2IJ0A 3BVMA 1YVCA 1YEZA 4BBSH 2I0QA 1PH1A 4JI8L 3H91A 4CKBA 4YHHL 1HRJA 2PZUA 3SHLA 3SR1A 5LHY1 4A93H 3I72A 3SK6A 4FXKC 2YYZA 2HD3A 1JE4A 2NZHA 4A3KH 4I7ZC 3KBGA 4PMBA 5IGCA 3C46A 5C5LA 4LUZA 1SFOH 3G4SA 3OSOA 3RLNA 1SNQA 4R4IA 1TKWB 1EFID 2VUMB 2PNRC 1SE4A 1CTMA 4WJ3M 2OTLA 4YY3L 5M5WH 1BOSA 2AWOA 1IL8A 2JA8B 1XX8A 1BR9A 2HDMA 3D4RA 2F3IA 4KHPQ 1JB7A 2HQLA 3K5NA 4IPHA 2O5IC 4DAYA 1V1PA 3MZ5A 1B8AA 2MNAA 3MA2B 3AB9A 3K81C 2EPBA 2X69A 4JI5L 5IYDG 4JI7L 4H02A 3EFXD 1HNXQ 3S1NH 1VMPA 3GTKH 3J81L 3D4DA 1Y1VB 4A3IG 3PCOB 4DA2A 4IUVA 3RLOA 5IWAQ 2GVAA 3J7ZC 3TP6A 1YHBA 2PZWA 1N34L 3UDXA 3M4OB 5FLMH 4L5QA 2F1MA 1TWHB 1PH6A 2XTIA 3HKSA 1EQQA 5D3IB 2EIFA 3DM3A 3FVQA 3CU7A 1XNQQ 3J7A5 4DPGA 4K0KL 4OGQC 4NXML 3PO3G 2VZAA 3M4YA 2JA6B 4DUZQ 4A3MB 2K5WA 4A3JH 4JI0Q 3F2BA 1ICFB 2UUBL 1PH2A 1ENCA 3MXUA 4FF3A 3K6OA 4DV0Q 1UEAB 1EFWA 4LF8L 4GOPB 1E2ZA 3KJPA 1PVOA 4G57A 2RQXA 5KYLA 1HJPA 1PFBA 1OXXK 3NHHA 1NE3A 2GA4B 1WD1A 4I65A 1PHJA 1O7IA 2L11A 4FXDA 2XWJB 1FD7D 1LT5D 3T16A 5CV8A 3PO2B 5K5PA 3GTGB 1PH8A 4C3JH 2QA4A 1NBWA 1U4MA 1I4PA 4ZKBB 1K73C 5FLXc 1LTSD 1HNXL 1A0IA 4JBJA 3K59A 1VMCA 1C0AA 1AE3A 1E0BA 5M3FG 4B3MQ 3M4PA 3E9IA 5I4DA 4GZYC 2VNUD 2PQEA 3BDOA 2KHJA 1G8ZD 3GP7A 4R9WA 3T4AC 2JA5G 1I94Q 1XJVA 1EIFA 4YIJA 3GV6A 3KF8B 3NPPA 3S1RH 3F2UA 3J7AV 1UE5A 1VCIA 5A35A 3W5OA 3HOYH 1SYGA 3KUPA 2F0WA 1B3QA 1EQTA 2B2WC 1WJJA 5M3MG 2E75C 5A2QL 5C44H 1D2BA 4C3HH 2X6LA 4UP8A 3I70A 1ET9A 1CKNA 1PYSB 2LFNA 2H4OA 3NQIA 2L1BA 2GVBA 1UWVA 3VA5A 4AYBG 4OO1G 4A3CH 3CPFA 4OWXB 4DV2Q 2VUMH 1QG7A 5JEAG 1DOMA 4A3EG 1WTQA 1SEBD 2EY1A 4ZRZA 3DEOA 3CAMA 4OO1I 4GN3B 1CHPD 3NK9A 5M5YB 2NYZD 1JJCB 5LMNQ 1NMFA 5GAHC 3QJYA 4LF5Q 1UAPA 1VQNA 3R2IA 3K8AA 1SYCA 3TBIB 1L1OC 3A54A 3HOVB 2R93B 3LWUA 3NENA 4QB4A 1Y1VH 3GTLB 1R4QB 1PH9A 2LY7A 2AWNA 1O7ZA 1PTOC 1H9SB 4R4OA 2N3SA 2JEAI 3VR2A 3H3VI 2RBMA 3FMCA 5JVH3 2DY8A 3HOZG 4NP5A 4A3FB 1JOOA 4XTCS 3C2PA 1AZQA 2NZ1D 4L6TB 5C4JB 1WCMH 1CFMA 5J3BA 5LMUQ 1B3AA 1HQRD 5E4XA 1BCPB 2BE5D 4NMZA 1YIJA 1A8VA 4BXXH 4U68A 3MXPA 4HMIA 3G6JB 5M5XB 3IAYA 2DY7A 1WTOA 1F9PA 2Q2HA 4DV2L 2HDLA 2KJXA 3JAMi 4JYAL 1VQPA 3H0GH 4AH6A 3W1GA 4IOAA 3RZDH 2JSOA 4HJ9A 2HIXA 3E0JA 2OQ0A 1S5DD 4LF5L 1TY2A 4BS9A 1EOVA 2PW5A 2R7ZH 2E2JB 4N8X1 1AP0A 3KOJA 1I4RA 4IPGA 4NB3A 5IGGA 2B2YA 4JV5Q 1Q90A 3G7LA 1X55A 1I50H 4J15A 3H15A 4DR4L 4POFA 3J81j 4FYDA 1D1KA 3MXNB 4FP5D 4A4IA 1K8AC 2R6GA 2RKSA 1VQCA 4JI3L 2BCOA 1E1TA 4LUVA 5IYBG 2EZVA 2CHBD 1KDAA 3PUWA 3HOXB 1KLUD 1VQJA 3OPOA 4Y7NH 1MIUA 3S16B 4FF2A 3A8KE 1CKMA 3I4MB 1Z6HA 2WKCA 3S24A 4O42A 2RHSB 4KD3A 1C9OA 4B08A 1KXLA 2A6ED 1STGA 1STAA 3RLFA 5LMUL 1NUCA 3FKIB 3NTIA 1HPCA 3K0XA 1RODA 3A56A 2ASBA 1EYGA 3D6CA 1TWGB 3D6WA 4MHEA 5BN4A 4GNXC 1PH3A 4HSPA 1WTRA 2F0SA 4FF4A 1NTGA 1I4QA 4AQYL 5COYA 3RZOH 4KMUC 2ES2A 2F0JA 3NBHA 2XWBB 1RIPA 2B63H 4A76A 2UXCL 1SAPA 3NELA 1IBMQ 2BA0A 5HY6A 1HFGA 3J80c 4B3TQ 1CHQD 4XYOA 5IT9L 3TP8A 2M2LA 2K14A 2O4XA 4EVOA 2N49A 3QIAA 1I6VC 3ULLA 3J81E 4OHJA 4GN5A 4RGTA 4ZQ3A 1YI2A 3MAQA 4LF7Q 2SOBA 4KY7A 4R4CA 3S1QH 1Q12A 1N8RC 1Q8IA 4OL7A 4IPDA 2WIIB 4CDDC 5FKAC 2KUMA 4DR5L 3I4OA 2NN6I 5CORA 2K5NA 1GUWA 1J8IA 2I07B 4CBVA 2K33A 4P74A 3CCSA 1EUJA 2J7ZA 4IN3A 1K9MC 5FO7B 2IX0A 1MKHA 5E7NA 1EY4A 4DGZA 1V43A 2MP1A 2WINB 4HJAA 3MXGA 1SYFA 1L1OB 4LFAQ 5JJZA 2JA7G 5C0XH 1H9JA 1BVSA 4A3FH 1SMXA 1VF5C 1DCZA 4NDXA 3OYYA 3J7AF 5C4JH 1P16A 2EXZA 1V1QA 3PGZA 3IFDA 1JWSD 3HKZB 2BOSA 1LTGD 1TS3A 2B2WA 2EYLA 3EJIA 5M5XH 1UE7A 4JCVE 4KJOA 2HIVA 4DAVA 5I9PA 2EY2A 1KTKA 1EQVA 4PZ7A 1RDPD 1N32Q 4CDFC 3NEMA 5F2DA 1PZID 2Z4HA 4IJHA 1QVFA 2G9DA 3CCRA 2A73B 2ALYB 4LF7L 5BR8Q 4CDCC 4XIGS 5C3EB 2F0EA 2WB1B 4EQNA 3S1MB 2RDGA 2RSNA 1L0YB 3SE0A 5ELBA 3HOWH 1IXRA 5IP7G 1B53A 4BY7B 3I90A 4JI2Q 3G6EA 1U9RA 4LF4L 3HOUB 2CQAA 2I5MX 3STBC 2A69D 5GAGC 3RUZA 4RA8A 1L1OA 1S5CD 1X3FA 1OTCA 4OX9L 4Y52H 2K05A 4JBKA 2PMZE 5C4HA 1KC8C 1AN8A 3KYHC 1LT3D 5JJIA 5A2QE 2K04A 4XQNA 4HIDA 1ASYA 1NR2A 1S5FD 3TEHB 2BDOA 4A3LG 3FHWA 1FGBD 2Q2TA 3GTMB 2EVBA 2SNSA 3PF5A 5CBEE 1X56A 2CWAA 4RKBA 1U4PA 2QCPX 4IOCA 2UXBQ 4K2LA 3K0YA 1AE2A 1FYCA 4IFDG 1SMYC 1PTOF 4H0LC 4BBRG 4KKUA 2AUKA 3SGIA 4MNOA 3A74A 5DM73 1YJWA 2AHOB 2I46A 2WKDA 3U4ZA 1G2SA 2OEOA 2WACA 4BY1G 1IHZA 4C1NK 3BS1A 2LS01 1PV4A 4Q0FA 1N32L 2NVYH 1W3SA 2VQEL 3HS0C 3FP9A 1XPRA 4UP7A 4X64Q 1OXVA 2JN4A 3T1HQ 2F0PA 1DGSA 1JORA 1STNA 1HH2P 1X54A 3C1EA 2H5XA 2ICIA 4H44C 3OTOL 2K5VA 1E2VA 3CCVA 3JAMc 4GS3A 1SYEA 2XGTA 1QWYA 3PUVA 4A3IB 3E3XA 2JP1A 4QUFA 4JI2L 4EQ5A 4ZK9B 1ZYRC 2OQKA 5GAEC 1BKBA 3X3MA 2ATWA 1WTPA 4PZ8A 4PMCA 1PRTC 3V2TA 5EBCA 3LWEA 1SSOA 2MJ8A 3PO3B 3OIPA 4F87A 1GHJA 3E6ZX 4GKJQ 3CP0A 1ICWA 1FNWA 3LX0A 4KI0A 3K7AB 4ME3A 4G7HC 4A3BG 2QKIC 1G91A 4L8JA 4LF6L 1ZKOA 3BYTB 3DEPA 4RH6A 2CFMA 4L63B 1Y1WH 1SNMA 1CA6A 1F2YA 3VA7A 4NW2A 1DJRD 4A3DG 3BJUA 2R92G 3BU2A 3FPPA 2E5LL 4K8JA 2L0CA 1TWFB 3D3RA 2DGYA 2CQOA 3EVQA 1FNUA 1AW7A 4KV6A 1WTWA 1M1KC 4C3IG 2YU9B 2MUYA 4GNXA 1GO3E 5DM63 3G48A 3KDFA 3E0EA 3TP7A 3GTPB 4HTHA 1MI2A 1LO5D 1VQDA 2Q8RE 4DAMA 3U9OA 4B9WA 3CMEA 1ENFA 4RWSC 1O7LA 1KNAA 1S5BD 1B9MA 3PUYA 1O7YA 3DXJC 1S40A 1QJOA 5M3FB 3M9BA 4TRDA 1V1PB 4DAYB 3PV0A 3TP5A 4HMJA 3WOEA 5D65A 1NJIC 1R9TB 3Q22A 4BY7H 3VR5A 1SDFA 2EJMA 1KRSA 4ID6A 3KLSA 2JA5B 2JQOA 4QY7A 3NP8A 5CV9A 4OWWB 3I7FA 5JEAJ 1E22A 2KCCA 2PQAB 4QUCA 1VQ5A 4GKJL 2YTYA 4WRDA 4BA1I 5IOCA 1B50A 5K36G 1CZGA 3D31A 3EROA 3TS2A 1X6OA 4KJNA 3KK7A 1A2UA 3S17B 5M3MB 4UP9A 4G7ZC 1XPUA 1GUOA 2R3ZA 4BWGB 1QB5D 4DV6Q 1X3PA 2F0LA 4BBSG 2IW3A 2R7DA 1STYA 1D6EC 1BUVT 1RF2D 3RR5A 1EWIA 5IT9E 3DHQA 1VQHA 4A93G 4TKOB 4AYBB 1HUNA 2VW9A 5C4XG 2A6HC 1J9OA 1ET6A 3CC4A 4A3KG 4A3EB 1JCKB 2Y0SG 1A15A 2QILA 4X65L 1SBBB 4XT1B 1QE6A 3SK8A 1IW7D 1U4LA 1EWHA 4X3UA 1QVCA 2CW0C 2NWGA 2B2YC 4ZLTF 3EA6A 2R61A 1LUZA 2KOLA 3QG1A 1IYJB 1YJ9A 1Y69U 1ASZA 1G51A 1AH9A 2MFIA 1Q8KA 5EJWA 4RCNA 3NQTA 1QVGA 2F0HA 1MSGA 4A3IH 3TQYA 2J0TD 1V8QA 1I4HA 2PQAA 3P7JA 5FO8B 1I6HH 4DAPA 1H95A 4DUYQ 1J5EQ 2G9HD 3ITPA 5EAYA 1HNWQ 3HOZB 5CGKA 1DXMA 2ENBA 2EYJA 3OW2A 1TS4A 1D5XC 2EYMA 3I2ZA 1N36Q 4L5SA 1VQ9A 1A3VA 2IHEA 3LGJA 4CJ2C 3J80i 1C7YA 2PYKA 4YWKA 3RD4A 4QIWB 4IUUA 4A3JG 1CQVA 4HIMA 3B6YA 2NVTB 3NUCA 2SEBD 2NVQB 1CKNB 1LABA 2VXWA 1N33Q 1YNJD 4N9TA 2EYPA 4DV4Q 2WAQE 4LMQD 3H94A 4KHPL 2Q2IA 4DNRB 3PSIA 4LW1A 4OXPA 3GTPH 1KDCA 3AU7A 1WTHA 1EIHA 1SJHD 2Q2UA 2H1EA 2ID0A 4JW0A 4NXNQ 3A0JA 4B3RQ 2EYFA 2FFKB 3S15B 2UUAQ 3CHBD 5EKIA 3PIP3 1Q1EA 3LNNA 5IWAL 2D9UA 5AFWA 3CXCA 4JBMA 2NVXB 1D1IA 2XSCA 4C3JG 1G291 3O13A 1RTNA 3BVZA 3GTOH 1LTAD 3I3CA 1XNQL 1CKOA 3IL8A 2K52A 2N88A 1EYCA 1JE5A 1CQFA 4RGNA 1J5EL 2I5LX 1VDZA 2HHHQ 4DUZL 4JI0L 1KD1C 3DWPA 2BA1A 1E3PA 2F0NA 1A62A 1X9NA 4KKSA 4X3TA 2A68D 2NZOA 4DV0L 4PQXA 1YHQA 1MJEA 4V0BA 1B44D 2HCCA 4H7BA 1BCPD 1XYIA 2AKWB 3SK5A 5I6YA 3FDTA 2K01A 1CZWA 1MD2D 4C2MB 1H9MA 2KECA 2EDGA 1VQ4A 3TN2A 3HOYG 1PRTF 3CQZB 3VYSA 4ILWA 1EY7A 5C44G 1A63A 1N33L 1TWAB 4C3HG 2DJFC 4A3EH 3F8TA 1HXYD 4HSVA 2JA8H 4XDXA 1K8GA 5JJKA 1TXYA 1W6KA 5G3LD 1VQBA 1L2FA 2NUCA 1E7ZA 2JE6I 5C5MA 4QF4A 3KFUA 4A3CG 3I91A 2MGSA 4JI4Q 4K5XA 2VUMG 2F3VA 2PW7A 1LACA 4J8QA 1D5ZC 1SNDA 5ELCA 1J6QA 3M7NA 4B3ML 4MN3A 3HG9A 1STHA 1SE3A 3QB3A 3SXHA 4CKEA 1HR0Q 3H3VH 1B4OA 2LXKA 3M4OH 1I94L 2KENA 3S2HB 2RVLA 4YCUA 4DV5Q 1TWHH 3K80C 1XNRQ 2K6AA 5DNFA 5D14A 1TIID 2L55A 1NCVA 1Y1VG 3TS0A 2JA7B 2JA6H 4IUQA 4A3MH 4JI6Q 2O2LD 1Q86C 4G7OC 2HT1A 3I56A 4GKKQ 1M4VA 1B2TA 3CCUA 4DR6Q 4LUOA 4K14A 2LKVA 3PUZA 2K7VA 4UDUC 2VY3A 1EZ8A 5I2XA 4KLKA 1SNCA 1RTOA 1X65A 3AYHB 1EYAA 2PCFB 1HUMA 1WCMG 4FNFA 1GJXA 1SNPA 2SDFA 3NE5B 2ZJRA 5LMNW 2ZXPA 5T1IA 4DR1Q 2NVQH 2FINB 4BXXG 3NBHB 3UDGA 4PG3A 2PI2E 5IP9H 3PO2H 1BO0A 3GTGH 3QO2A 2KEDA 5IY0A 4X62Q 3ZYYX 5LMNL 1L0XB 1FR3A 5ELFA 1U0LA 1F77A 1EY0A 3CCJA 3T53B 5DEHA 3H0GG 1DM0B 1AEXA 2AQ1B 2FHTA 4HCSA 3G71A 4DV7Q 2Z0SA 1PDQA 4IFDJ 2VB3X 5KEEA 2DUDA 3ICEA 2VS1A 2R7ZG 2ZTEA 4FDBA 2WFWA 4ZCKA 1Q7YC 5CR3A 1K8OA 2IX1A 3K5OA 2IWHA 3NXWA 3ER0A 3GV3A 4JI6L 2ZTDA 2BH8A 4C1NI 5FO9B 4PZ6A 1ILQA 3KJOA 4L5TA 4XT3B 1BDOA 2Z4IA 4KK7A 4J1MA 1TWCB 4BBRB 1BBXC 2E2IB 1OXUA 4DR2Q 1DOKA 4LNQA 2B39A 3S9WA 3R3OA 5GADC 5FK9C 4BY1B 3GTQB 3I4NB 4KN4C 3AFQA 2DNCA 1DONA 4DR1L 1KIXA 5GQOA 1SYBA 5EKKA 1NR4A 4UY8C 3GD7A 4X62L 2NN6H 5M5YH 1HZ9A 3UDIA 2B63G 1JC7A 4DR7Q 3GDEA 3UE0A 2B2TC 4HIKA 2CKZB 2DNEA 3N52A 3NSWA 4JV5L 3KF6A 4DR3Q 1I5FA 1Q46A 1TS5A 2L5TA 3HOVH 4Q5VA 1E2WA 2KHIA 1CA5A 2R93H 1S72A 4DV7L 3GTLH 2LXJA 1GUNA 2A69C 3R93A 2F0MA 1W2BA 1XTDA 3S2HH 2IT1A 5GROA 1FVIA 1JR0D 3TDQA 2Z9HA 1WVLA 4X6AH 3OIQA 4MTNA 5IT9c 1FGUA 1JT8A 1PMRA 2D2CC 2JXMB 2WV6D 3M3YB 5I6WA 1NMGA 3NTHA 3CC2A 1B1ZA 1N9WA 1PH7A 4CJ1B 3ULJA 4A3BB 1PTOB 1XPOA 4IJLA 1EWCA 1X32A 2WAQG 1TT2A 3SVMA 3S14B 3U9SA 2Z6KA 1K83B 1UUPA 1S4ZA 2Q8TA 1F2ZA 4APVA 1IBKQ 4A3DB 1KLGD 3A55A 2R92B 3W2DA 1GHKA 5C0XG 1PFSA 1IZ6A 1PH5A 1WI5A 4KY6A 3MC0B 4UPAA 3ND9A 3L2PA 1IBML 5JJLA 1TY0A 2QEJC 4C3IB 4LF9Q 4B3TL 1PYWD 3H09A 5FJ8G 2UUCQ 3A5UA 3M7GA 2MHVA 4OWTB 1CSQA 1HA6A 1EY8A 2MO0A 1BF4A 3MFYA 1JJGA 4YWMA 1K8MA 3PUXA 3U4VA 3DWAA 4X3SA 1I3QB 4DKAC 3BZKA 2E2JH 3T1YQ 1O80A 1XXGA 4B3SQ 1K3RA 1XMOQ 1HCZA 1SXTA 2QEXA
chains in the Genus database with same CATH topology
4JBJA 2EQSA 4YCWA 3RN5A 1XNRL 1VQGA 4TQUS 3UDFA 1C0AA 1AE3A 2KBNA 5M3FG 4B3MQ 3M4PA 3E9IA 1NJIC 1VQ6A 4BY7H 1P8LA 3HOWG 4WJ4A 1KRSA 3HOXH 4DR5Q 2VNUD 2JQOA 4QY7A 3J81i 4A3GG 2KHJA 3CC7A 3HFZB 5H1SE 3S16H 3ZJYC 4OWWB 1YNXA 3BZCA 4NPSA 1I94Q 1XJVA 2JA5G 4LFAL 3I4MH 4GKKL 1EIFA 3I7FA 5JEAJ 1E22A 2PQAB 1VQ5A 1KQSA 4DR6L 3KF8B 4GKJL 2YTYA 3S1RH 3AQQA 2WB1E 1HZCA 4BA1I 3FKIH 5K36G 3D31A 3TS2A 1X6OA 1UE5A 1VCIA 3W5OA 3HOYH 1IBKL 4C2MH 4UP9A 1EIYB 1XPUA 1VQLA 4DAYB 1TWGH 4DV6Q 1Z47A 1WJJA 2PNHA 4BBSG 5M3MG 5C44H 4IO9A 2R7DA 4C3HH 4HJ5A 2AMCB 3CQZH 4UP8A 3CCVA 3RR5A 2UXDQ 1EWIA 1TWAH 1YBYA 1VQHA 1WYDA 1QZHA 1CKNA 4A93G 1PYSB 2VW9A 5C4XG 4IFDI 3I4NH 2GVBA 1UWVA 5ELOA 3CC4A 1CUKA 4OO1G 4AYBG 4A3KG 4A3CH 2Y0SG 3CPFA 4OWXB 1OXTA 4DV2Q 2VUMH 3IRBA 5JEAG 4X65L 3PF4A 4MZ9A 4GNXB 3RNUA 5BR8L 4A3EG 1GKHA 2UU9Q 3KDFB 1QVCA 4R1JA 1VS0A 3CAMA 2ZJQA 1LUZA 4GN3B 4OO1I 3T1YL 1IYJB 3VDYA 1YJ9A 2IHFA 1ASZA 2YTXA 1G51A 1QUQB 3EIVA 1AH9A 1JJCB 2MFIA 5LMNQ 1NMFA 2NN6G 1Q8KA 2GN5A 5GAHC 2LSSA 4LF5Q 1QVGA 1VQNA 3K8AA 1PH4A 4A3IH 3TQYA 1L1OC 4QL5A 3EBEA 1E1OA 2PQAA 1HZBA 3NENA 1Y1VH 1SN8A 1PH9A 1I6HH 5HGQA 3HOVG 2Y0SE 2AWNA 1XMQQ 2R93G 1PA6A 3F1ZA 1H95A 4DUYQ 1SR3A 2FXQA 5IYCG 2ZM6Q 4R4OA 1J5EQ 1M90C 2N3SA 4LF4Q 2JEAI 1KL9A 5EAYA 1SE8A 1HNWQ 3H3VI 4JC0A 3OW2A 1SRUA 3I2ZA 2WP8J 3HOZG 3STBD 1N36Q 4L5SA 1VQ9A 4OX9Q 1YJNA 1RL2A 1WOCA 2IHEA 4XTCS 3LGJA 5AJ3Q 4A75A 4GOPC 2B3GA 2F4VQ 4A3BH 2UXBL 4JI1Q 4R4TA 4DR2L 3J80i 3CD6A 1WCMH 3MEFA 3PIOA 4A3FG 1OXSC 2F52A 3PIPA 1C7YA 5LMUQ 5J3BA 4YWKA 2QGQA 4A3DH 4KHZA 1VQIA 2L15A 2JEBI 4A3JG 1A8VA 1YIJA 4BXXH 3HOVH 5IE8A 5C0XI 4HIMA 1BBWA 3B6YA 2VQFQ 4DV3Q 5FJ8H 1Y1WG 3CCEA 1YITA 3CCMA 1CKNB 2Q2HA 4DV2L 1N33Q 4DV4Q 4DR7L 2WAQE 1Q81C 4X64L 2RHQB 3T1HL 4KHPL 3JAMi 4AIMA 4JYAL 2Q2IA 1QUQA 3PSIA 4LW1A 4OXPA 3CCQA 4HJ7A 1VQPA 3GTPH 3H0GH 4AH6A 5C3EH 3CMAA 4DR3L 1HNZQ 3W1GA 1WFQA 3S1MH 4IOAA 3RZDH 2Q2UA 2A1AA 2ID0A 4HJ9A 5IP7H 3WWVA 2HIXA 4YY3Q 4NXNQ 3A0JA 4B3RQ 3AFPA 2OQ0A 2VQEQ 3RN2A 2UUAQ 4TVAB 1Q1EA 4LF5L 1EOVA 5IWAL 2R7ZH 3KOJA 4P73A 2K4KA 4IPGA 4NB3A 3CXCA 4JBMA 1G291 3HOUH 1NY4A 4JV5Q 2K75A 1X55A 1I50H 3CW2C 4J15A 3OTOQ 3H15A 4POFA 3J81j 3CPWA 3GTOH 4DR4L 4A3GH 2V1CC 3MXNB 4JI5Q 4A4IA 1XMQL 1K8AC 2R6GA 1CKOA 1XNQL 4QQBX 2K52A 1VQCA 1JE5A 4JI3L 5IYBG 1E1TA 4LUVA 2PI2A 3CF5A 1J5EL 1Q82C 4P71A 2I5LX 1D8LA 3PUWA 4A3LH 1VQJA 3A5ZB 4Y7NH 4JOIA 2HHHQ 1MIUA 4DUZL 4LFCQ 4JI0L 2EXDA 1KD1C 2A8VA 2R7FA 2MO1A 2BA1A 1CKMA 3EN2A 1E3PA 3HOXG 1N34Q 1G6PA 1A62A 1FL0A 3U58A 1X9NA 3S24A 3GTMH 2F4VL 2D0OA 2NZOA 2RHSB 5AJ3L 4DV0L 1C9OA 1KXLA 1Z9FA 3I4MG 1YHQA 4JI1L 4QGUA 1MJEA 1TWCH 3RLFA 2E8GA 4BBRH 5LMUL 4K0KQ 2AKWB 4NXMQ 4JG2A 2E2IH 3K0XA 4PMWA 3W1BA 1JMCA 4LF9L 2ASBA 3FKIG 1PYBA 1EYGA 2UUCL 2UUBQ 1T9HA 4BY1H 3GTQH 2IY5B 4GNXC 1VQ4A 2VQFL 5C4XH 4DV3L 1PH3A 4LF6Q 3HOYG 1NTGA 4AQYL 3RZOH 2ES2A 1VQ7A 5C44G 1A63A 1N33L 1RIPA 4LF8Q 2B63H 3JC66 4A76A 2UXCL 2E5LQ 3NELA 1IBMQ 2D0PA 4A3EH 2BA0A 4O2DA 5HY6A 1IBLQ 3F8TA 3J80c 3F2CA 4B3TQ 2JA8H 3TRZA 1K8GA 5JJKA 1TXYA 2ZTCA 1VQBA 1L2FA 1KHIA 1E7ZA 1XMOL 4B3SL 3I4NG 1HNZL 2K14A 2JE6I 4QJFA 1SLJA 2N49A 3I55A 3KFUA 3ULLA 4A3CG 5IYDH 1UEBA 4JI4Q 1VQ8A 2VUMG 4GN5A 1YI2A 4LF7Q 1J6QA 4HJ8A 4DR3Q 1B70B 4GLAC 4R4CA 4R4QA 1Q12A 1S3OA 1N8RC 1GM5A 2N78A 4B3ML 3M7NA 4RG1A 4IPDA 1YZ6A 1QZGA 4DR5L 3S1QH 4AYBE 3I4OA 4DK6C 1HR0Q 2NN6I 3H3VH 2K5NA 4JBWA 2LXKA 1IL2A 1I94L 2KENA 3M4OH 4YCUA 4DV5Q 2JA9A 4DK3C 3ULPA 4RMFA 2N8NA 1TWHH 4X66Q 4P74A 3K80C 3CCSA 1EUJA 1XNRQ 3M3YH 5IYCH 1K9MC 3U50C 3PO3H 2IX0A 4IPCA 3Q8DA 1MKHA 4LFCL 5E7NA 5FLMG 3ERSX 1Y1VG 1V43A 3TS0A 1HNXL 2JA6H 2JK8A 1YHAA 4A3MH 4JI6Q 3K7AH 3S14H 4HJAA 1UE6A 1Q86C 2HT1A 5DLQE 4DV6L 1LM0A 1L1OB 1K83H 4LFAQ 3I56A 4LWCA 2JA7G 4GKKQ 3TREA 1BVSA 4A3FH 1SMXA 3J81c 3CCUA 4DR6Q 4LUOA 1EQRA 4JI8Q 4YHHQ 1MJCA 3DLLA 2R92H 3OYYA 3PUZA 2UXDL 5C4JH 1P16A 2VY3A 3D0FA 4KLKA 3GTJH 1V1QA 4HIOA 3PGZA 1TWFH 1UE1A 4C3IH 4BA2I 2C35B 3S2DH 1X65A 1W2BA 3AYHB 2K50A 1WCMG 1D7QA 1K0RA 2OCEA 2YU9H 2ZJRA 5LMNW 3HKZG 4P72A 1VQOA 2UU9L 5M5XH 4EX5A 2KCTA 2CCZA 4DR1Q 2NVQH 1UE7A 2VL6A 4JCVE 3NBHB 1IBLL 2HIVA 4BXXG 3UDGA 4PG3A 2PI2E 4PZ7A 5IP9H 3PO2H 3GTGH 1N32Q 1I3QH 3NEMA 5IY0A 4X62Q 2YV5A 5LMNL 1LTLA 1E24A 4IJHA 4X65Q 1QVFA 3CCRA 2ALYB 1U0LA 4LF7L 5BR8Q 4XIGS 3CCJA 1KRTA 5M3FH 2JA7H 1B7YB 1VQEA 2A19A 4QIWE 1HZAA 1Y14B 3H0GG 3HOWH 4P75A 5C3EG 2WB1G 2E2HH 1IXRA 4GN4B 1R9TH 5IP7G 4JI7Q 3G71A 2OTJA 4DV7Q 2Z0SA 2JA5H 2BH2A 4DUYL 1BBUA 3M85A 2ZM6L 4JI2Q 3G6EA 4LF4L 4IFDJ 4X66L 2DUDA 3ICEA 1HNWL 2VS1A 2CWPA 2I5MX 2ZTEA 4FDBA 3STBC 2WFWA 4L5RC 1Q7YC 2R7ZG 1U5KA 5GAGC 1VQMA 4BY7G 3HOUG 1L1OA 2Z6KC 1X3FA 1V9PA 2RCNA 1OTCA 1N36L 2IX1A 4OX9L 4Y52H 3ER0A 4JBKA 2PMZE 1L0WA 2ZJPA 1KC8C 4JI6L 1GD7A 3KYHC 4GLVB 1YVCA 2BH8A 2ZTDA 1YEZA 5ELNA 4BBSH 5JJIA 3S17H 4HIDA 5M3MH 2I5HA 1ASYA 2I0QA 3TEHB 1PH1A 4A3LG 3FHWA 4PZ6A 4JI8L 4YHHL 3GO5A 2Q2TA 1FJGQ 3KJOA 4L5TA 1X56A 3PF5A 2CWAA 4A93H 3M4QA 4IOCA 2YYZA 4GOPA 2UXBQ 2K5HA 2NZHA 1OXUA 1AE2A 4DR2Q 4A3KH 4IFDG 2JJQA 4BBRG 4LNQA 4DV4L 1VQAA 4LUZA 3SGIA 4MNOA 5GADC 3A74A 1YJWA 1SFOH 3G4SA 2AHOB 4YWLA 3AFQA 1Q1BA 3RLNA 3U4ZA 4DR1L 4R4IA 5GQOA 1KIXA 4BY1G 1X3GA 4LFBQ 4UY8C 1PV4A 4WJ3M 2OTLA 3GD7A 1N32L 2NVYH 1W3SA 4NXNL 4YY3L 5M5WH 4X62L 4DV1Q 4B3RL 2AWOA 2VQEL 1XPRA 3FP9A 5M5YH 1HZ9A 2UUAL 3UDIA 2B63G 4DR7Q 3K7UC 2F3IA 3GDEA 2D62A 4UP7A 3UE0A 1OXVA 4X64Q 4HIKA 3T1HQ 4KHPQ 1JB7A 2HQLA 4JYAQ 1DGSA 2JA8G 2CKZB 4IPHA 4JV5L 1HH2P 1X3EA 1X54A 3L0OA 3KF6A 2H5XA 1B8AA 3OTOL 1I5FA 1Q46A 2K5VA 3KLWA 2MNAA 3K81C 1GVPA 4YCVA 4GS3A 4JI5L 5IYDG 3JAMc 1JJ2A 4JI7L 2XGTA 2KHIA 3PUVA 4H02A 2R93H 1S72A 3PV0A 4DV7L 1HNXQ 2LXJA 3GTLH 5C0XJ 3S1NH 3GTKH 4JI2L 4EQ5A 1LYLA 1XTDA 3PCOB 3E9HA 4A3IG 2OQKA 4JOIC 5GAEC 5IWAQ 3RLOA 2HHHL 1BKBA 2IT1A 5GROA 1FVIA 2GVAA 3J7ZC 3S2HH 2ATWA 1YHBA 1N34L 3UDXA 3L7ZC 4PZ8A 4X6AH 3HOZH 5FLMH 4L5QA 1PH6A 4MTNA 5IT9c 1FGUA 1JT8A 4DR4Q 2XTIA 3HKSA 1VQFA 1EQQA 2EIFA 3DM3A 1XNQQ 3J7A5 2KCMA 4DPGA 4K0KL 1NMGA 4JI3Q 3CC2A 4NXML 3PO3G 3CP0A 4GKJQ 1N9WA 2VZAA 1PH7A 1SROA 3ULJA 1XPOA 4IJLA 4KI0A 2WAQG 4DUZQ 1FJGL 4A3JH 4JI0Q 3F2BA 4ME3A 2UUBL 2Z6KA 4A3BG 2JA6G 4A3MG 1PH2A 4APVA 1IBKQ 1Y1WH 3CCLA 4LF6L 2CFMA 4DV0Q 1EFWA 5C0XG 1PFSA 1IZ6A 4LF8L 1PH5A 4A3DG 2NVTH 3BJUA 2R92G 1WI5A 3BU2A 4GOPB 2E5LL 1PVOA 3KJPA 4UPAA 3L2PA 1IBML 5JJLA 2DGYA 2CQOA 4B3TL 4LF9Q 1HJPA 1M1KC 1CSPA 5FJ8G 4POGA 2UUCQ 4LFBL 1OXXK 4GNXA 1NE3A 1GO3E 3A5UA 4OONA 3F2DA 1HR0W 3G48A 1PHJA 1VQKA 1O7IA 4AQYQ 3KDFA 4JI4L 3E0EA 4DV1L 4OWTB 1CSQA 1VQDA 4DAMA 3AEVA 1KAWA 2MO0A 3UE1A 2MQHA 2YTVA 1JJGA 4YWMA 2UXCQ 4GLXA 4DNIA 3CMEA 2OWOA 3PUXA 3S15H 3U4VA 1PH8A 2RF4A 4C3JH 2QA4A 4DKAC 3BZKA 1HR0L 1NBWA 2E2JH 4O0AA 3T1YQ 5IP9G 3PO2G 4B3SQ 3PUYA 1K3RA 4ALPA 1XMOQ 2NVXH 1S40A 3HKZE 4DV5L 1K73C 5FLXc 3M9BA 2QEXA 2B29A 3KF6B 5IYBH 1A0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JBJ A;  2EQS A;  4YCW A;  3RN5 A;  1XNR L;  1VQG A;  4TQU S;  3UDF A;  1C0A A;  1AE3 A;  2KBN A;  5M3F G;  4B3M Q;  3M4P A;  3E9I A;  1NJI C;  1VQ6 A;  4BY7 H;  1P8L A;  3HOW G;  4WJ4 A;  1KRS A;  3HOX H;  4DR5 Q;  2VNU D;  2JQO A;  4QY7 A;  3J81 i;  4A3G G;  2KHJ A;  3CC7 A;  3HFZ B;  5H1S E;  3S16 H;  3ZJY C;  4OWW B;  1YNX A;  3BZC A;  4NPS A;  1I94 Q;  1XJV A;  2JA5 G;  4LFA L;  3I4M H;  4GKK L;  1EIF A;  3I7F A;  5JEA J;  1E22 A;  2PQA B;  1VQ5 A;  1KQS A;  4DR6 L;  3KF8 B;  4GKJ L;  2YTY A;  3S1R H;  3AQQ A;  2WB1 E;  1HZC A;  4BA1 I;  3FKI H;  5K36 G;  3D31 A;  3TS2 A;  1X6O A;  1UE5 A;  1VCI A;  3W5O A;  3HOY H;  1IBK L;  4C2M H;  4UP9 A;  1EIY B;  1XPU A;  1VQL A;  4DAY B;  1TWG H;  4DV6 Q;  1Z47 A;  1WJJ A;  2PNH A;  4BBS G;  5M3M G;  5C44 H;  4IO9 A;  2R7D A;  4C3H H;  4HJ5 A;  2AMC B;  3CQZ H;  4UP8 A;  3CCV A;  3RR5 A;  2UXD Q;  1EWI A;  1TWA H;  1YBY A;  1VQH A;  1WYD A;  1QZH A;  1CKN A;  4A93 G;  1PYS B;  2VW9 A;  5C4X G;  4IFD I;  3I4N H;  2GVB A;  1UWV A;  5ELO A;  3CC4 A;  1CUK A;  4OO1 G;  4AYB G;  4A3K G;  4A3C H;  2Y0S G;  3CPF A;  4OWX B;  1OXT A;  4DV2 Q;  2VUM H;  3IRB A;  5JEA G;  4X65 L;  3PF4 A;  4MZ9 A;  4GNX B;  3RNU A;  5BR8 L;  4A3E G;  1GKH A;  2UU9 Q;  3KDF B;  1QVC A;  4R1J A;  1VS0 A;  3CAM A;  2ZJQ A;  1LUZ A;  4GN3 B;  4OO1 I;  3T1Y L;  1IYJ B;  3VDY A;  1YJ9 A;  2IHF A;  1ASZ A;  2YTX A;  1G51 A;  1QUQ B;  3EIV A;  1AH9 A;  1JJC B;  2MFI A;  5LMN Q;  1NMF A;  2NN6 G;  1Q8K A;  2GN5 A;  5GAH C;  2LSS A;  4LF5 Q;  1QVG A;  1VQN A;  3K8A A;  1PH4 A;  4A3I H;  3TQY A;  1L1O C;  4QL5 A;  3EBE A;  1E1O A;  2PQA A;  1HZB A;  3NEN A;  1Y1V H;  1SN8 A;  1PH9 A;  1I6H H;  5HGQ A;  3HOV G;  2Y0S E;  2AWN A;  1XMQ Q;  2R93 G;  1PA6 A;  3F1Z A;  1H95 A;  4DUY Q;  1SR3 A;  2FXQ A;  5IYC G;  2ZM6 Q;  4R4O A;  1J5E Q;  1M90 C;  2N3S A;  4LF4 Q;  2JEA I;  1KL9 A;  5EAY A;  1SE8 A;  1HNW Q;  3H3V I;  4JC0 A;  3OW2 A;  1SRU A;  3I2Z A;  2WP8 J;  3HOZ G;  3STB D;  1N36 Q;  4L5S A;  1VQ9 A;  4OX9 Q;  1YJN A;  1RL2 A;  1WOC A;  2IHE A;  4XTC S;  3LGJ A;  5AJ3 Q;  4A75 A;  4GOP C;  2B3G A;  2F4V Q;  4A3B H;  2UXB L;  4JI1 Q;  4R4T A;  4DR2 L;  3J80 i;  3CD6 A;  1WCM H;  3MEF A;  3PIO A;  4A3F G;  1OXS C;  2F52 A;  3PIP A;  1C7Y A;  5LMU Q;  5J3B A;  4YWK A;  2QGQ A;  4A3D H;  4KHZ A;  1VQI A;  2L15 A;  2JEB I;  4A3J G;  1A8V A;  1YIJ A;  4BXX H;  3HOV H;  5IE8 A;  5C0X I;  4HIM A;  1BBW A;  3B6Y A;  2VQF Q;  4DV3 Q;  5FJ8 H;  1Y1W G;  3CCE A;  1YIT A;  3CCM A;  1CKN B;  2Q2H A;  4DV2 L;  1N33 Q;  4DV4 Q;  4DR7 L;  2WAQ E;  1Q81 C;  4X64 L;  2RHQ B;  3T1H L;  4KHP L;  3JAM i;  4AIM A;  4JYA L;  2Q2I A;  1QUQ A;  3PSI A;  4LW1 A;  4OXP A;  3CCQ A;  4HJ7 A;  1VQP A;  3GTP H;  3H0G H;  4AH6 A;  5C3E H;  3CMA A;  4DR3 L;  1HNZ Q;  3W1G A;  1WFQ A;  3S1M H;  4IOA A;  3RZD H;  2Q2U A;  2A1A A;  2ID0 A;  4HJ9 A;  5IP7 H;  3WWV A;  2HIX A;  4YY3 Q;  4NXN Q;  3A0J A;  4B3R Q;  3AFP A;  2OQ0 A;  2VQE Q;  3RN2 A;  2UUA Q;  4TVA B;  1Q1E A;  4LF5 L;  1EOV A;  5IWA L;  2R7Z H;  3KOJ A;  4P73 A;  2K4K A;  4IPG A;  4NB3 A;  3CXC A;  4JBM A;  1G29 1;  3HOU H;  1NY4 A;  4JV5 Q;  2K75 A;  1X55 A;  1I50 H;  3CW2 C;  4J15 A;  3OTO Q;  3H15 A;  4POF A;  3J81 j;  3CPW A;  3GTO H;  4DR4 L;  4A3G H;  2V1C C;  3MXN B;  4JI5 Q;  4A4I A;  1XMQ L;  1K8A C;  2R6G A;  1CKO A;  1XNQ L;  4QQB X;  2K52 A;  1VQC A;  1JE5 A;  4JI3 L;  5IYB G;  1E1T A;  4LUV A;  2PI2 A;  3CF5 A;  1J5E L;  1Q82 C;  4P71 A;  2I5L X;  1D8L A;  3PUW A;  4A3L H;  1VQJ A;  3A5Z B;  4Y7N H;  4JOI A;  2HHH Q;  1MIU A;  4DUZ L;  4LFC Q;  4JI0 L;  2EXD A;  1KD1 C;  2A8V A;  2R7F A;  2MO1 A;  2BA1 A;  1CKM A;  3EN2 A;  1E3P A;  3HOX G;  1N34 Q;  1G6P A;  1A62 A;  1FL0 A;  3U58 A;  1X9N A;  3S24 A;  3GTM H;  2F4V L;  2D0O A;  2NZO A;  2RHS B;  5AJ3 L;  4DV0 L;  1C9O A;  1KXL A;  1Z9F A;  3I4M G;  1YHQ A;  4JI1 L;  4QGU A;  1MJE A;  1TWC H;  3RLF A;  2E8G A;  4BBR H;  5LMU L;  4K0K Q;  2AKW B;  4NXM Q;  4JG2 A;  2E2I H;  3K0X A;  4PMW A;  3W1B A;  1JMC A;  4LF9 L;  2ASB A;  3FKI G;  1PYB A;  1EYG A;  2UUC L;  2UUB Q;  1T9H A;  4BY1 H;  3GTQ H;  2IY5 B;  4GNX C;  1VQ4 A;  2VQF L;  5C4X H;  4DV3 L;  1PH3 A;  4LF6 Q;  3HOY G;  1NTG A;  4AQY L;  3RZO H;  2ES2 A;  1VQ7 A;  5C44 G;  1A63 A;  1N33 L;  1RIP A;  4LF8 Q;  2B63 H;  3JC6 6;  4A76 A;  2UXC L;  2E5L Q;  3NEL A;  1IBM Q;  2D0P A;  4A3E H;  2BA0 A;  4O2D A;  5HY6 A;  1IBL Q;  3F8T A;  3J80 c;  3F2C A;  4B3T Q;  2JA8 H;  3TRZ A;  1K8G A;  5JJK A;  1TXY A;  2ZTC A;  1VQB A;  1L2F A;  1KHI A;  1E7Z A;  1XMO L;  4B3S L;  3I4N G;  1HNZ L;  2K14 A;  2JE6 I;  4QJF A;  1SLJ A;  2N49 A;  3I55 A;  3KFU A;  3ULL A;  4A3C G;  5IYD H;  1UEB A;  4JI4 Q;  1VQ8 A;  2VUM G;  4GN5 A;  1YI2 A;  4LF7 Q;  1J6Q A;  4HJ8 A;  4DR3 Q;  1B70 B;  4GLA C;  4R4C A;  4R4Q A;  1Q12 A;  1S3O A;  1N8R C;  1GM5 A;  2N78 A;  4B3M L;  3M7N A;  4RG1 A;  4IPD A;  1YZ6 A;  1QZG A;  4DR5 L;  3S1Q H;  4AYB E;  3I4O A;  4DK6 C;  1HR0 Q;  2NN6 I;  3H3V H;  2K5N A;  4JBW A;  2LXK A;  1IL2 A;  1I94 L;  2KEN A;  3M4O H;  4YCU A;  4DV5 Q;  2JA9 A;  4DK3 C;  3ULP A;  4RMF A;  2N8N A;  1TWH H;  4X66 Q;  4P74 A;  3K80 C;  3CCS A;  1EUJ A;  1XNR Q;  3M3Y H;  5IYC H;  1K9M C;  3U50 C;  3PO3 H;  2IX0 A;  4IPC A;  3Q8D A;  1MKH A;  4LFC L;  5E7N A;  5FLM G;  3ERS X;  1Y1V G;  1V43 A;  3TS0 A;  1HNX L;  2JA6 H;  2JK8 A;  1YHA A;  4A3M H;  4JI6 Q;  3K7A H;  3S14 H;  4HJA A;  1UE6 A;  1Q86 C;  2HT1 A;  5DLQ E;  4DV6 L;  1LM0 A;  1L1O B;  1K83 H;  4LFA Q;  3I56 A;  4LWC A;  2JA7 G;  4GKK Q;  3TRE A;  1BVS A;  4A3F H;  1SMX A;  3J81 c;  3CCU A;  4DR6 Q;  4LUO A;  1EQR A;  4JI8 Q;  4YHH Q;  1MJC A;  3DLL A;  2R92 H;  3OYY A;  3PUZ A;  2UXD L;  5C4J H;  1P16 A;  2VY3 A;  3D0F A;  4KLK A;  3GTJ H;  1V1Q A;  4HIO A;  3PGZ A;  1TWF H;  1UE1 A;  4C3I H;  4BA2 I;  2C35 B;  3S2D H;  1X65 A;  1W2B A;  3AYH B;  2K50 A;  1WCM G;  1D7Q A;  1K0R A;  2OCE A;  2YU9 H;  2ZJR A;  5LMN W;  3HKZ G;  4P72 A;  1VQO A;  2UU9 L;  5M5X H;  4EX5 A;  2KCT A;  2CCZ A;  4DR1 Q;  2NVQ H;  1UE7 A;  2VL6 A;  4JCV E;  3NBH B;  1IBL L;  2HIV A;  4BXX G;  3UDG A;  4PG3 A;  2PI2 E;  4PZ7 A;  5IP9 H;  3PO2 H;  3GTG H;  1N32 Q;  1I3Q H;  3NEM A;  5IY0 A;  4X62 Q;  2YV5 A;  5LMN L;  1LTL A;  1E24 A;  4IJH A;  4X65 Q;  1QVF A;  3CCR A;  2ALY B;  1U0L A;  4LF7 L;  5BR8 Q;  4XIG S;  3CCJ A;  1KRT A;  5M3F H;  2JA7 H;  1B7Y B;  1VQE A;  2A19 A;  4QIW E;  1HZA A;  1Y14 B;  3H0G G;  3HOW H;  4P75 A;  5C3E G;  2WB1 G;  2E2H H;  1IXR A;  4GN4 B;  1R9T H;  5IP7 G;  4JI7 Q;  3G71 A;  2OTJ A;  4DV7 Q;  2Z0S A;  2JA5 H;  2BH2 A;  4DUY L;  1BBU A;  3M85 A;  2ZM6 L;  4JI2 Q;  3G6E A;  4LF4 L;  4IFD J;  4X66 L;  2DUD A;  3ICE A;  1HNW L;  2VS1 A;  2CWP A;  2I5M X;  2ZTE A;  4FDB A;  3STB C;  2WFW A;  4L5R C;  1Q7Y C;  2R7Z G;  1U5K A;  5GAG C;  1VQM A;  4BY7 G;  3HOU G;  1L1O A;  2Z6K C;  1X3F A;  1V9P A;  2RCN A;  1OTC A;  1N36 L;  2IX1 A;  4OX9 L;  4Y52 H;  3ER0 A;  4JBK A;  2PMZ E;  1L0W A;  2ZJP A;  1KC8 C;  4JI6 L;  1GD7 A;  3KYH C;  4GLV B;  1YVC A;  2BH8 A;  2ZTD A;  1YEZ A;  5ELN A;  4BBS H;  5JJI A;  3S17 H;  4HID A;  5M3M H;  2I5H A;  1ASY A;  2I0Q A;  3TEH B;  1PH1 A;  4A3L G;  3FHW A;  4PZ6 A;  4JI8 L;  4YHH L;  3GO5 A;  2Q2T A;  1FJG Q;  3KJO A;  4L5T A;  1X56 A;  3PF5 A;  2CWA A;  4A93 H;  3M4Q A;  4IOC A;  2YYZ A;  4GOP A;  2UXB Q;  2K5H A;  2NZH A;  1OXU A;  1AE2 A;  4DR2 Q;  4A3K H;  4IFD G;  2JJQ A;  4BBR G;  4LNQ A;  4DV4 L;  1VQA A;  4LUZ A;  3SGI A;  4MNO A;  5GAD C;  3A74 A;  1YJW A;  1SFO H;  3G4S A;  2AHO B;  4YWL A;  3AFQ A;  1Q1B A;  3RLN A;  3U4Z A;  4DR1 L;  4R4I A;  5GQO A;  1KIX A;  4BY1 G;  1X3G A;  4LFB Q;  4UY8 C;  1PV4 A;  4WJ3 M;  2OTL A;  3GD7 A;  1N32 L;  2NVY H;  1W3S A;  4NXN L;  4YY3 L;  5M5W H;  4X62 L;  4DV1 Q;  4B3R L;  2AWO A;  2VQE L;  1XPR A;  3FP9 A;  5M5Y H;  1HZ9 A;  2UUA L;  3UDI A;  2B63 G;  4DR7 Q;  3K7U C;  2F3I A;  3GDE A;  2D62 A;  4UP7 A;  3UE0 A;  1OXV A;  4X64 Q;  4HIK A;  3T1H Q;  4KHP Q;  1JB7 A;  2HQL A;  4JYA Q;  1DGS A;  2JA8 G;  2CKZ B;  4IPH A;  4JV5 L;  1HH2 P;  1X3E A;  1X54 A;  3L0O A;  3KF6 A;  2H5X A;  1B8A A;  3OTO L;  1I5F A;  1Q46 A;  2K5V A;  3KLW A;  2MNA A;  3K81 C;  1GVP A;  4YCV A;  4GS3 A;  4JI5 L;  5IYD G;  3JAM c;  1JJ2 A;  4JI7 L;  2XGT A;  2KHI A;  3PUV A;  4H02 A;  2R93 H;  1S72 A;  3PV0 A;  4DV7 L;  1HNX Q;  2LXJ A;  3GTL H;  5C0X J;  3S1N H;  3GTK H;  4JI2 L;  4EQ5 A;  1LYL A;  1XTD A;  3PCO B;  3E9H A;  4A3I G;  2OQK A;  4JOI C;  5GAE C;  5IWA Q;  3RLO A;  2HHH L;  1BKB A;  2IT1 A;  5GRO A;  1FVI A;  2GVA A;  3J7Z C;  3S2H H;  2ATW A;  1YHB A;  1N34 L;  3UDX A;  3L7Z C;  4PZ8 A;  4X6A H;  3HOZ H;  5FLM H;  4L5Q A;  1PH6 A;  4MTN A;  5IT9 c;  1FGU A;  1JT8 A;  4DR4 Q;  2XTI A;  3HKS A;  1VQF A;  1EQQ A;  2EIF A;  3DM3 A;  1XNQ Q;  3J7A 5;  2KCM A;  4DPG A;  4K0K L;  1NMG A;  4JI3 Q;  3CC2 A;  4NXM L;  3PO3 G;  3CP0 A;  4GKJ Q;  1N9W A;  2VZA A;  1PH7 A;  1SRO A;  3ULJ A;  1XPO A;  4IJL A;  4KI0 A;  2WAQ G;  4DUZ Q;  1FJG L;  4A3J H;  4JI0 Q;  3F2B A;  4ME3 A;  2UUB L;  2Z6K A;  4A3B G;  2JA6 G;  4A3M G;  1PH2 A;  4APV A;  1IBK Q;  1Y1W H;  3CCL A;  4LF6 L;  2CFM A;  4DV0 Q;  1EFW A;  5C0X G;  1PFS A;  1IZ6 A;  4LF8 L;  1PH5 A;  4A3D G;  2NVT H;  3BJU A;  2R92 G;  1WI5 A;  3BU2 A;  4GOP B;  2E5L L;  1PVO A;  3KJP A;  4UPA A;  3L2P A;  1IBM L;  5JJL A;  2DGY A;  2CQO A;  4B3T L;  4LF9 Q;  1HJP A;  1M1K C;  1CSP A;  5FJ8 G;  4POG A;  2UUC Q;  4LFB L;  1OXX K;  4GNX A;  1NE3 A;  1GO3 E;  3A5U A;  4OON A;  3F2D A;  1HR0 W;  3G48 A;  1PHJ A;  1VQK A;  1O7I A;  4AQY Q;  3KDF A;  4JI4 L;  3E0E A;  4DV1 L;  4OWT B;  1CSQ A;  1VQD A;  4DAM A;  3AEV A;  1KAW A;  2MO0 A;  3UE1 A;  2MQH A;  2YTV A;  1JJG A;  4YWM A;  2UXC Q;  4GLX A;  4DNI A;  3CME A;  2OWO A;  3PUX A;  3S15 H;  3U4V A;  1PH8 A;  2RF4 A;  4C3J H;  2QA4 A;  4DKA C;  3BZK A;  1HR0 L;  1NBW A;  2E2J H;  4O0A A;  3T1Y Q;  5IP9 G;  3PO2 G;  4B3S Q;  3PUY A;  1K3R A;  4ALP A;  1XMO Q;  2NVX H;  1S40 A;  3HKZ E;  4DV5 L;  1K73 C;  5FLX c;  3M9B A;  2QEX A;  2B29 A;  3KF6 B;  5IYB H;  1A0I A; 
#chains in the Genus database with same CATH topology
 2XRS D;  1K3B C;  1VQG A;  3UDF A;  1ILP A;  2E2H B;  3VR3 A;  1MGS A;  1PFM A;  2QW7 A;  4KD4 A;  1VQ6 A;  1P8L A;  3HOW G;  4WJ4 A;  3HOX H;  3J81 i;  4A3G G;  3HFZ B;  4N9P A;  2PO4 A;  3S16 H;  3ZJY C;  1RCV D;  1PZJ D;  1YNX A;  3BZC A;  1NAP A;  1VF7 A;  4NPS A;  4LFA L;  3I4M H;  1JOQ A;  2DJG C;  4C56 C;  3AQQ A;  1HZC A;  2FMM A;  1SJE D;  3D4W A;  3FKI H;  1RD9 D;  5I9O A;  4BBS B;  1IBK L;  1WD0 A;  4U67 3;  1VQL A;  1YNN C;  1TWG H;  1Z47 A;  4IO9 A;  2MPM A;  4A93 B;  5C4X B;  2UXD Q;  1LLR D;  1STE A;  1QNK A;  3Q24 A;  1QZH A;  4A3K B;  3Q23 A;  2Y0S B;  4IFD I;  3I4N H;  1Y8O B;  3A8I E;  5ELO A;  3OMC A;  1SFO B;  1CUK A;  2A74 C;  1CI3 M;  1AZP A;  1UNS A;  1ESF A;  5HGT A;  4GNX B;  5BR8 L;  2UU9 Q;  3KDF B;  2OXP A;  4M8A A;  2FMC A;  1IKL A;  2ZJQ A;  3V96 A;  3T1Y L;  2IHF A;  1MBY A;  3NWT A;  1QUQ B;  3MHB A;  4JVZ A;  2AQ2 B;  4R8I A;  5EBD A;  2K5D A;  5E4W C;  1PH4 A;  2KEE A;  4PNY A;  2VB2 X;  1E1O A;  1HZB A;  1S5E D;  3GTK B;  3OOC A;  5HGQ A;  3QR8 A;  2P5Z X;  1SR3 A;  2FXQ A;  5IYC G;  2ZM6 Q;  2TMP A;  5FOB B;  2RDH A;  1SRU A;  2ICE C;  3STB D;  2IL8 A;  1RL2 A;  1WOC A;  5AJ3 Q;  4GOP C;  2UXB L;  4A3B H;  1PTO H;  2B3G A;  3CKI B;  3L9A X;  2CVR A;  2TSS A;  3MEF A;  2F0D A;  2F52 A;  4EQO A;  3GTJ B;  2EY6 A;  4A3D H;  4KHZ A;  5CV6 A;  1ESR A;  1VQI A;  2CH4 W;  4K2K A;  3OW7 A;  3DWQ A;  3TME A;  5D3D A;  1BBW A;  1QNU A;  2PPB C;  1Y1W G;  3CCE A;  1C4Q A;  3K5M A;  1IW7 C;  3TZD A;  2OF1 A;  2C5C A;  1Q81 C;  4X64 L;  2RHQ B;  3T1H L;  3PQI A;  4AIM A;  3K58 A;  1QUQ A;  3A7A B;  3CCQ A;  5C3E H;  3CMA A;  2PMZ B;  1WFQ A;  4ZKC B;  3S1M H;  1TR5 A;  2A1A A;  1EIG A;  3WWV A;  1AFP A;  4YY3 Q;  3MFG A;  3RN2 A;  1KAB A;  1R4P B;  4C3J B;  4TVA B;  2B2T A;  2K4K A;  5C6A A;  3QOJ A;  3HOU H;  5ISR A;  4RAU C;  4IUT A;  4TSS A;  2K75 A;  3OHX C;  1QCB D;  1LT4 D;  3CPW A;  1F9Q A;  2V1C C;  4JI5 Q;  3TSS A;  1DOL A;  3VYU A;  3CF5 A;  2XVS A;  3SK4 A;  3TZU A;  2G5D A;  2K1B A;  1Z7T A;  2ZXR A;  2A8V A;  2R7F A;  1ZYR D;  1N34 Q;  4P2C B;  1G6P A;  2QF7 A;  1RJT A;  2V4D A;  3GTM H;  2EE1 A;  2D0O A;  2F0F A;  3E5S A;  5AJ3 L;  1K0S A;  4QGU A;  3S1R B;  5JPN C;  4K0K Q;  3BVG A;  4HED A;  4NXM Q;  4DFA A;  5CC4 A;  3HRZ C;  1JMC A;  3HOY B;  1EY6 A;  3R8B A;  1PYB A;  2IY5 B;  2UUB Q;  5C4X H;  5C44 B;  1YNJ C;  4C3H B;  5IGD A;  1VQ7 A;  3SDZ A;  4LF8 Q;  1V1O A;  4KN7 C;  4B9X A;  1PLF A;  2D0P A;  3WDN A;  4K8I A;  1IBL Q;  1RKN A;  4DNT B;  3F2C A;  4IAL A;  2Z8L A;  4HR7 B;  3C1F A;  4QJF A;  1SLJ A;  3I55 A;  5IYD H;  1IKM A;  1HTL D;  2B2U C;  1VQ8 A;  1LTI D;  5EPK A;  3T56 B;  2EYH A;  4R4Q A;  1GM5 A;  4FF1 A;  2N78 A;  4RG1 A;  1K28 A;  1U4R A;  1ZEQ X;  5CV7 A;  4ABN A;  1QZG A;  3DUZ A;  5KNB A;  1IYV A;  4JBW A;  4XXE A;  4E6I A;  5CBA E;  1IL2 A;  5CMD A;  2EY5 A;  2NB0 A;  1F2L A;  3A7L A;  4X66 Q;  1NSN S;  3PO3 H;  1LT6 D;  4IPC A;  4G4K A;  4CHT B;  3Q8D A;  4HN7 A;  4IUR A;  2A68 C;  5FLM G;  3ERS X;  1MHW C;  2K5Q A;  3K7A H;  4KTA A;  1BCP C;  1JWU D;  1UE6 A;  5DLQ E;  4DV6 L;  3TRE A;  3J81 c;  1PRT B;  1GXD C;  1MJC A;  2NBF A;  1SYD A;  2D5D A;  3QWN A;  1KDB A;  3IKJ A;  3D0F A;  3GTJ H;  1Y8P B;  1WCM B;  3H6M A;  4ZUJ A;  2BDN A;  1TWF H;  4X3K A;  3KLR A;  5FLX L;  4F7X A;  2E2D C;  1DD2 A;  3QOL A;  5C4Z A;  5M9O A;  2OCE A;  2YU9 H;  3ONA B;  2NTT A;  1VQO A;  2NTS A;  1TQO A;  4EX5 A;  2HUG A;  2VL6 A;  1IBL L;  4RCO A;  1JIC A;  2A5H A;  4OIK A;  3K5L A;  2YV5 A;  2F0T A;  1EEI D;  3PIO 3;  2A6H D;  1C8C A;  3H0G B;  5EKL A;  5M3F H;  2E74 C;  1I4G A;  5LL6 S;  1B7Y B;  1RHP A;  2A19 A;  3RZD B;  1HZA A;  5E3F A;  1ML0 D;  1T5E A;  4P75 A;  2CW0 D;  1R9T H;  5JOB A;  4HCE A;  2R7Z B;  2JA5 H;  4S3S A;  5J39 A;  4DUY L;  1BBU A;  5I2Y A;  5HUR A;  5KIX A;  5IOD A;  3M85 A;  4X66 L;  1HNW L;  4FO2 A;  4L5R C;  1U5K A;  1I50 B;  1VQM A;  1GUG A;  3GQB A;  1HFN A;  2Z6K C;  1V9P A;  5JVG 3;  2RCN A;  1N36 L;  4ULL A;  3N6R A;  4R8N A;  1L0W A;  2EOT A;  1XWE A;  1JQY D;  2BE5 C;  4GLV B;  4Y7N B;  4K5W A;  5ELN A;  1JWM D;  3S17 H;  5M3M H;  2I5H A;  5C3W A;  3GO5 A;  4ZAI A;  1Q3L A;  1FJG Q;  5BN3 A;  1F9S A;  2L4N A;  2B2V C;  3M4Q A;  4CGY B;  4IUN A;  3JAM E;  1I4X A;  4OEM B;  4LJZ C;  1CM9 A;  4GOP A;  2K5H A;  4OO1 H;  2JJQ A;  5JEA H;  4DV4 L;  1VQA A;  1A6X A;  4K6L A;  3HZX A;  4YWL A;  1Q1B A;  2F0U A;  3RZO B;  1X3G A;  4LFB Q;  2B63 B;  2Z1C A;  4NXN L;  4DV1 Q;  4KKT A;  4B3R L;  4DF7 A;  2UUA L;  1GUS A;  4RHS A;  1EEF D;  2PZT A;  3K7U C;  2D62 A;  4JYA Q;  2JA8 G;  1EOT A;  3HP3 A;  2B8F A;  1X3E A;  3L0O A;  4ME5 A;  3KLW A;  5LL6 X;  1GVP A;  1H9K A;  5CV4 A;  4YCV A;  1JJ2 A;  3S1Q B;  5L37 A;  2XNA C;  5C0X J;  4QMG A;  5CV5 A;  5EPJ A;  1LYL A;  2F0Q A;  3E9H A;  4JOI C;  4RHR A;  2HHH L;  3CRK C;  5NUC A;  5IGE A;  3L7Z C;  2A6E C;  3HOZ H;  2RCF A;  3KF8 A;  5J1Z A;  4DR4 Q;  1VQF A;  3I4L A;  1G6Z A;  2KCM A;  4RKL A;  4JI3 Q;  2WAQ B;  2F0G A;  4O1N A;  3J7Y W;  1BQQ T;  1HTP A;  3URY A;  3FPU B;  4Z9C B;  1FJG L;  3L3O C;  3K57 A;  2JA6 G;  4A3M G;  3CCL A;  4OIJ A;  4CJ0 B;  1LV9 A;  4KY5 A;  2NVT H;  5T1G A;  3C3L A;  3BDL A;  3CRL C;  1CSP A;  3D8G A;  4POG A;  2M9V A;  4LFB L;  4EGV A;  1HR0 W;  3F2D A;  1A3T A;  4OON A;  1VQK A;  2RSO A;  4AQY Q;  2F03 A;  4JI4 L;  3BDC A;  4DV1 L;  3AMU A;  3AEV A;  1KAW A;  3UE1 A;  2MQH A;  2YTV A;  2UXC Q;  4GLX A;  2QDB A;  4DNI A;  4XYQ A;  3KBX A;  2OWO A;  4LK1 C;  3S15 H;  2RF4 A;  3BZD B;  1HR0 L;  4O0A A;  3VYR A;  5IP9 G;  3PO2 G;  2KHS A;  4ALP A;  2NVX H;  4M1U B;  3HKZ E;  4DV5 L;  4OEL B;  2F0K A;  4FVM A;  2B29 A;  1SRO A;  2B2U A;  5IGB A;  3KF6 B;  5IYB H;  1EU3 A;  2EQS A;  4YCW A;  4ODG A;  3RN5 A;  1XNR L;  4TQU S;  3HOW B;  2KBN A;  4A3G B;  3DMU A;  1KAA A;  2KA7 A;  4DXG A;  4DR5 Q;  1H9S A;  3RMH A;  1DYQ A;  3CC7 A;  5H1S E;  3A8J E;  2JYO A;  1ZXT A;  4GKK L;  4DK1 A;  2X6G A;  1NNX A;  4IZ8 A;  4DR6 L;  3HGB A;  1KQS A;  1PTO D;  3J80 L;  2WB1 E;  4DU9 A;  4KHV A;  2N55 A;  1XTC D;  5ELD A;  5C3X A;  4MIU A;  4C2M H;  1EIY B;  1X3Q A;  1EL0 A;  2PNH A;  2LMC B;  2F3W A;  4HJ5 A;  2AMC B;  1A2T A;  3CQZ H;  2F0V A;  4IUP A;  1TWA H;  1YBY A;  1WYD A;  2RDF A;  3OWF A;  4XQQ A;  3I73 A;  4NKL A;  3FRP B;  2IPK D;  1EYD A;  4WJW A;  1OXT A;  1BCP F;  3IRB A;  3PF4 A;  1EY5 A;  1M8A A;  4MZ9 A;  3RNU A;  1GKH A;  5JAV A;  4R1J A;  1W6J A;  1CK1 A;  1VS0 A;  2NVY B;  3EQL C;  3UI2 A;  2C9O A;  3WOF A;  3MWY W;  3VDY A;  3P75 A;  2YTX A;  3EIV A;  2F0I A;  5EQ0 A;  2AQ3 B;  2NN6 G;  2GN5 A;  2LSS A;  1G2T A;  3Q0A A;  1DZ1 A;  1ONL A;  1EU4 A;  4QL5 A;  3MXN A;  3EBE A;  5G3L F;  1SNO A;  3MEH A;  2XRQ D;  3BYY B;  1SN8 A;  3HEJ A;  3HOV G;  2Y0S E;  1XMQ Q;  2R93 G;  4XQJ A;  2F4I A;  1PA6 A;  3F1Z A;  2JA7 H;  2F0O A;  2O5J C;  4LF4 Q;  1M90 C;  2XIW A;  1KL9 A;  1SE8 A;  4JC0 A;  4JPB W;  5KND A;  2DN8 A;  1QIL A;  2WP8 J;  4OX9 Q;  1YJN A;  2F4V Q;  2AUJ D;  4A75 A;  5FLX E;  5EPL A;  1BXT A;  4DN4 M;  4JI1 Q;  4R4T A;  4DR2 L;  1TU2 B;  3CD6 A;  3PIO A;  4A3F G;  1LTB D;  1FNV A;  1OXS C;  3PIP A;  1HHV A;  3X3N A;  1LTR D;  2QGQ A;  3SEB A;  4EQP A;  3S2D B;  2K32 A;  2L15 A;  2JEB I;  1Y1W B;  3NTK A;  5KGU A;  4FXG C;  1GUT A;  5IE8 A;  5C0X I;  2B2V A;  2VQF Q;  1C48 A;  2ZT9 C;  5FJ8 H;  4DV3 Q;  1H9R A;  1YIT A;  3CCM A;  2KQ3 A;  4DR7 L;  3MTS A;  5JPM C;  4F88 A;  1STB A;  3I8Z A;  3IFT A;  4HJ7 A;  4DR3 L;  4HAE A;  1HNZ Q;  1Y8N B;  1LTT D;  3VYT A;  5IP7 H;  2Z6B A;  4QCL A;  3AFP A;  5TSS A;  2VQE Q;  1TS2 A;  4UHV A;  4CKC A;  4P73 A;  1EY9 A;  3VR4 A;  2KVM A;  3NBI A;  1NY4 A;  4RGM A;  2XN9 C;  3VR6 A;  2E76 C;  2HQE A;  3CW2 C;  3OTO Q;  2CH4 A;  2FJ2 A;  4A3G H;  4QQB X;  1OO9 B;  1XMQ L;  4ZYS A;  2PI2 A;  1Q82 C;  4P71 A;  1D8L A;  4A3L H;  3A5Z B;  4JOI A;  4LFC Q;  5J22 A;  2EXD A;  1WTV A;  2MO1 A;  5KRU A;  3EN2 A;  3HOX G;  1TVX A;  5E1F A;  2HCI A;  1FL0 A;  3U58 A;  2F4V L;  5BN5 A;  1Z9F A;  3I4M G;  4JI1 L;  1GOZ A;  4I7A A;  4V19 0;  4IFD H;  1TWC H;  4BBR H;  2E8G A;  4K6D A;  4JG2 A;  4MTK A;  1A3U A;  2E2I H;  3NWS A;  4PMW A;  2J4X A;  3W1B A;  4LF9 L;  2L9H A;  3BG3 A;  4RFB A;  3ERQ A;  1BNZ A;  3FKI G;  2K03 A;  2UUC L;  4BY1 H;  3GTQ H;  1T9H A;  3JAM L;  2VQF L;  2EYO A;  3R2T A;  4DV3 L;  1HA5 A;  4LF6 Q;  5IGF A;  5EGT A;  1KNE A;  3JC6 6;  1PFN A;  4WOR A;  2E5L Q;  1ENA A;  4O2D A;  2QDL A;  5M5W B;  4ZUI A;  3TRZ A;  4LAA A;  2ZTC A;  4CDE C;  4B3S L;  1KHI A;  3I4N G;  1XMO L;  1HNZ L;  3H3V C;  2ZXO A;  1WTX A;  1UEB A;  5KNC A;  4HJ8 A;  1B70 B;  4GLA C;  1S3O A;  1II3 A;  1YZ6 A;  3S1N B;  4AYB E;  4DK6 C;  1QOH A;  5KYI A;  2JA9 A;  4DK3 C;  1SE2 A;  3ULP A;  4RMF A;  2N8N A;  5ELE A;  3M3Y H;  4H13 C;  5IYC H;  1PZK D;  3U50 C;  3P1H A;  3T13 A;  2EJG C;  1I6H B;  4LFC L;  1MSH A;  4IQZ A;  2JK8 A;  1YHA A;  3S14 H;  5DAU A;  1LM0 A;  1K83 H;  4LWC A;  4A3J B;  2Q8I B;  1EQR A;  4JI8 Q;  4YHH Q;  2R92 H;  3DLL A;  2UXD L;  1D5M C;  2L12 A;  4UAI A;  4F8M A;  1B9N A;  2B8G A;  2K28 A;  4HIO A;  1UE1 A;  4C3I H;  4BA2 I;  2C35 B;  3S2D H;  1T5X D;  2K50 A;  3OMG A;  1D7Q A;  1K0R A;  3W3A A;  3HKZ G;  4P72 A;  4DK0 A;  2UU9 L;  1SMY D;  1YNN D;  2KCT A;  2CCZ A;  1CT1 D;  2M00 A;  2RA4 A;  1I3Q H;  3T51 B;  1JB3 A;  5CYU A;  3PMF A;  1LTL A;  4WFN 3;  5IIF A;  1E24 A;  3MVV A;  4X65 Q;  3OWE B;  3Q6S A;  1KRT A;  1O78 A;  2IX3 A;  4J6H A;  1VQE A;  1F9R A;  4QIW E;  4PV1 C;  1Y14 B;  5C3E G;  2WB1 G;  2E2H H;  3KLS X;  3DM1 A;  4GN4 B;  1JOK A;  4JI7 Q;  2OTJ A;  3V05 A;  3ND8 A;  2BH2 A;  2ZM6 L;  2EJF C;  1IYU A;  2OT2 A;  4N8F A;  1HQM C;  1PXU A;  1EZ6 A;  2CWP A;  3J80 E;  4BY7 G;  4K5V A;  3GTO B;  1F2M A;  3HOU G;  4JK1 C;  2KCN A;  4DXF A;  5K36 H;  2SNM A;  3P20 A;  3FEW X;  2ZJP A;  1GD7 A;  4RGO S;  1PRT D;  2IJ0 A;  3BVM A;  1YVC A;  1YEZ A;  4BBS H;  2I0Q A;  1PH1 A;  4JI8 L;  3H91 A;  4CKB A;  4YHH L;  1HRJ A;  2PZU A;  3SHL A;  3SR1 A;  5LHY 1;  4A93 H;  3I72 A;  3SK6 A;  4FXK C;  2YYZ A;  2HD3 A;  1JE4 A;  2NZH A;  4A3K H;  4I7Z C;  3KBG A;  4PMB A;  5IGC A;  3C46 A;  5C5L A;  4LUZ A;  1SFO H;  3G4S A;  3OSO A;  3RLN A;  1SNQ A;  4R4I A;  1TKW B;  1EFI D;  2VUM B;  2PNR C;  1SE4 A;  1CTM A;  4WJ3 M;  2OTL A;  4YY3 L;  5M5W H;  1BOS A;  2AWO A;  1IL8 A;  2JA8 B;  1XX8 A;  1BR9 A;  2HDM A;  3D4R A;  2F3I A;  4KHP Q;  1JB7 A;  2HQL A;  3K5N A;  4IPH A;  2O5I C;  4DAY A;  1V1P A;  3MZ5 A;  1B8A A;  2MNA A;  3MA2 B;  3AB9 A;  3K81 C;  2EPB A;  2X69 A;  4JI5 L;  5IYD G;  4JI7 L;  4H02 A;  3EFX D;  1HNX Q;  3S1N H;  1VMP A;  3GTK H;  3J81 L;  3D4D A;  1Y1V B;  4A3I G;  3PCO B;  4DA2 A;  4IUV A;  3RLO A;  5IWA Q;  2GVA A;  3J7Z C;  3TP6 A;  1YHB A;  2PZW A;  1N34 L;  3UDX A;  3M4O B;  5FLM H;  4L5Q A;  2F1M A;  1TWH B;  1PH6 A;  2XTI A;  3HKS A;  1EQQ A;  5D3I B;  2EIF A;  3DM3 A;  3FVQ A;  3CU7 A;  1XNQ Q;  3J7A 5;  4DPG A;  4K0K L;  4OGQ C;  4NXM L;  3PO3 G;  2VZA A;  3M4Y A;  2JA6 B;  4DUZ Q;  4A3M B;  2K5W A;  4A3J H;  4JI0 Q;  3F2B A;  1ICF B;  2UUB L;  1PH2 A;  1ENC A;  3MXU A;  4FF3 A;  3K6O A;  4DV0 Q;  1UEA B;  1EFW A;  4LF8 L;  4GOP B;  1E2Z A;  3KJP A;  1PVO A;  4G57 A;  2RQX A;  5KYL A;  1HJP A;  1PFB A;  1OXX K;  3NHH A;  1NE3 A;  2GA4 B;  1WD1 A;  4I65 A;  1PHJ A;  1O7I A;  2L11 A;  4FXD A;  2XWJ B;  1FD7 D;  1LT5 D;  3T16 A;  5CV8 A;  3PO2 B;  5K5P A;  3GTG B;  1PH8 A;  4C3J H;  2QA4 A;  1NBW A;  1U4M A;  1I4P A;  4ZKB B;  1K73 C;  5FLX c;  1LTS D;  1HNX L;  1A0I A;  4JBJ A;  3K59 A;  1VMC A;  1C0A A;  1AE3 A;  1E0B A;  5M3F G;  4B3M Q;  3M4P A;  3E9I A;  5I4D A;  4GZY C;  2VNU D;  2PQE A;  3BDO A;  2KHJ A;  1G8Z D;  3GP7 A;  4R9W A;  3T4A C;  2JA5 G;  1I94 Q;  1XJV A;  1EIF A;  4YIJ A;  3GV6 A;  3KF8 B;  3NPP A;  3S1R H;  3F2U A;  3J7A V;  1UE5 A;  1VCI A;  5A35 A;  3W5O A;  3HOY H;  1SYG A;  3KUP A;  2F0W A;  1B3Q A;  1EQT A;  2B2W C;  1WJJ A;  5M3M G;  2E75 C;  5A2Q L;  5C44 H;  1D2B A;  4C3H H;  2X6L A;  4UP8 A;  3I70 A;  1ET9 A;  1CKN A;  1PYS B;  2LFN A;  2H4O A;  3NQI A;  2L1B A;  2GVB A;  1UWV A;  3VA5 A;  4AYB G;  4OO1 G;  4A3C H;  3CPF A;  4OWX B;  4DV2 Q;  2VUM H;  1QG7 A;  5JEA G;  1DOM A;  4A3E G;  1WTQ A;  1SEB D;  2EY1 A;  4ZRZ A;  3DEO A;  3CAM A;  4OO1 I;  4GN3 B;  1CHP D;  3NK9 A;  5M5Y B;  2NYZ D;  1JJC B;  5LMN Q;  1NMF A;  5GAH C;  3QJY A;  4LF5 Q;  1UAP A;  1VQN A;  3R2I A;  3K8A A;  1SYC A;  3TBI B;  1L1O C;  3A54 A;  3HOV B;  2R93 B;  3LWU A;  3NEN A;  4QB4 A;  1Y1V H;  3GTL B;  1R4Q B;  1PH9 A;  2LY7 A;  2AWN A;  1O7Z A;  1PTO C;  1H9S B;  4R4O A;  2N3S A;  2JEA I;  3VR2 A;  3H3V I;  2RBM A;  3FMC A;  5JVH 3;  2DY8 A;  3HOZ G;  4NP5 A;  4A3F B;  1JOO A;  4XTC S;  3C2P A;  1AZQ A;  2NZ1 D;  4L6T B;  5C4J B;  1WCM H;  1CFM A;  5J3B A;  5LMU Q;  1B3A A;  1HQR D;  5E4X A;  1BCP B;  2BE5 D;  4NMZ A;  1YIJ A;  1A8V A;  4BXX H;  4U68 A;  3MXP A;  4HMI A;  3G6J B;  5M5X B;  3IAY A;  2DY7 A;  1WTO A;  1F9P A;  2Q2H A;  4DV2 L;  2HDL A;  2KJX A;  3JAM i;  4JYA L;  1VQP A;  3H0G H;  4AH6 A;  3W1G A;  4IOA A;  3RZD H;  2JSO A;  4HJ9 A;  2HIX A;  3E0J A;  2OQ0 A;  1S5D D;  4LF5 L;  1TY2 A;  4BS9 A;  1EOV A;  2PW5 A;  2R7Z H;  2E2J B;  4N8X 1;  1AP0 A;  3KOJ A;  1I4R A;  4IPG A;  4NB3 A;  5IGG A;  2B2Y A;  4JV5 Q;  1Q90 A;  3G7L A;  1X55 A;  1I50 H;  4J15 A;  3H15 A;  4DR4 L;  4POF A;  3J81 j;  4FYD A;  1D1K A;  3MXN B;  4FP5 D;  4A4I A;  1K8A C;  2R6G A;  2RKS A;  1VQC A;  4JI3 L;  2BCO A;  1E1T A;  4LUV A;  5IYB G;  2EZV A;  2CHB D;  1KDA A;  3PUW A;  3HOX B;  1KLU D;  1VQJ A;  3OPO A;  4Y7N H;  1MIU A;  3S16 B;  4FF2 A;  3A8K E;  1CKM A;  3I4M B;  1Z6H A;  2WKC A;  3S24 A;  4O42 A;  2RHS B;  4KD3 A;  1C9O A;  4B08 A;  1KXL A;  2A6E D;  1STG A;  1STA A;  3RLF A;  5LMU L;  1NUC A;  3FKI B;  3NTI A;  1HPC A;  3K0X A;  1ROD A;  3A56 A;  2ASB A;  1EYG A;  3D6C A;  1TWG B;  3D6W A;  4MHE A;  5BN4 A;  4GNX C;  1PH3 A;  4HSP A;  1WTR A;  2F0S A;  4FF4 A;  1NTG A;  1I4Q A;  4AQY L;  5COY A;  3RZO H;  4KMU C;  2ES2 A;  2F0J A;  3NBH A;  2XWB B;  1RIP A;  2B63 H;  4A76 A;  2UXC L;  1SAP A;  3NEL A;  1IBM Q;  2BA0 A;  5HY6 A;  1HFG A;  3J80 c;  4B3T Q;  1CHQ D;  4XYO A;  5IT9 L;  3TP8 A;  2M2L A;  2K14 A;  2O4X A;  4EVO A;  2N49 A;  3QIA A;  1I6V C;  3ULL A;  3J81 E;  4OHJ A;  4GN5 A;  4RGT A;  4ZQ3 A;  1YI2 A;  3MAQ A;  4LF7 Q;  2SOB A;  4KY7 A;  4R4C A;  3S1Q H;  1Q12 A;  1N8R C;  1Q8I A;  4OL7 A;  4IPD A;  2WII B;  4CDD C;  5FKA C;  2KUM A;  4DR5 L;  3I4O A;  2NN6 I;  5COR A;  2K5N A;  1GUW A;  1J8I A;  2I07 B;  4CBV A;  2K33 A;  4P74 A;  3CCS A;  1EUJ A;  2J7Z A;  4IN3 A;  1K9M C;  5FO7 B;  2IX0 A;  1MKH A;  5E7N A;  1EY4 A;  4DGZ A;  1V43 A;  2MP1 A;  2WIN B;  4HJA A;  3MXG A;  1SYF A;  1L1O B;  4LFA Q;  5JJZ A;  2JA7 G;  5C0X H;  1H9J A;  1BVS A;  4A3F H;  1SMX A;  1VF5 C;  1DCZ A;  4NDX A;  3OYY A;  3J7A F;  5C4J H;  1P16 A;  2EXZ A;  1V1Q A;  3PGZ A;  3IFD A;  1JWS D;  3HKZ B;  2BOS A;  1LTG D;  1TS3 A;  2B2W A;  2EYL A;  3EJI A;  5M5X H;  1UE7 A;  4JCV E;  4KJO A;  2HIV A;  4DAV A;  5I9P A;  2EY2 A;  1KTK A;  1EQV A;  4PZ7 A;  1RDP D;  1N32 Q;  4CDF C;  3NEM A;  5F2D A;  1PZI D;  2Z4H A;  4IJH A;  1QVF A;  2G9D A;  3CCR A;  2A73 B;  2ALY B;  4LF7 L;  5BR8 Q;  4CDC C;  4XIG S;  5C3E B;  2F0E A;  2WB1 B;  4EQN A;  3S1M B;  2RDG A;  2RSN A;  1L0Y B;  3SE0 A;  5ELB A;  3HOW H;  1IXR A;  5IP7 G;  1B53 A;  4BY7 B;  3I90 A;  4JI2 Q;  3G6E A;  1U9R A;  4LF4 L;  3HOU B;  2CQA A;  2I5M X;  3STB C;  2A69 D;  5GAG C;  3RUZ A;  4RA8 A;  1L1O A;  1S5C D;  1X3F A;  1OTC A;  4OX9 L;  4Y52 H;  2K05 A;  4JBK A;  2PMZ E;  5C4H A;  1KC8 C;  1AN8 A;  3KYH C;  1LT3 D;  5JJI A;  5A2Q E;  2K04 A;  4XQN A;  4HID A;  1ASY A;  1NR2 A;  1S5F D;  3TEH B;  2BDO A;  4A3L G;  3FHW A;  1FGB D;  2Q2T A;  3GTM B;  2EVB A;  2SNS A;  3PF5 A;  5CBE E;  1X56 A;  2CWA A;  4RKB A;  1U4P A;  2QCP X;  4IOC A;  2UXB Q;  4K2L A;  3K0Y A;  1AE2 A;  1FYC A;  4IFD G;  1SMY C;  1PTO F;  4H0L C;  4BBR G;  4KKU A;  2AUK A;  3SGI A;  4MNO A;  3A74 A;  5DM7 3;  1YJW A;  2AHO B;  2I46 A;  2WKD A;  3U4Z A;  1G2S A;  2OEO A;  2WAC A;  4BY1 G;  1IHZ A;  4C1N K;  3BS1 A;  2LS0 1;  1PV4 A;  4Q0F A;  1N32 L;  2NVY H;  1W3S A;  2VQE L;  3HS0 C;  3FP9 A;  1XPR A;  4UP7 A;  4X64 Q;  1OXV A;  2JN4 A;  3T1H Q;  2F0P A;  1DGS A;  1JOR A;  1STN A;  1HH2 P;  1X54 A;  3C1E A;  2H5X A;  2ICI A;  4H44 C;  3OTO L;  2K5V A;  1E2V A;  3CCV A;  3JAM c;  4GS3 A;  1SYE A;  2XGT A;  1QWY A;  3PUV A;  4A3I B;  3E3X A;  2JP1 A;  4QUF A;  4JI2 L;  4EQ5 A;  4ZK9 B;  1ZYR C;  2OQK A;  5GAE C;  1BKB A;  3X3M A;  2ATW A;  1WTP A;  4PZ8 A;  4PMC A;  1PRT C;  3V2T A;  5EBC A;  3LWE A;  1SSO A;  2MJ8 A;  3PO3 B;  3OIP A;  4F87 A;  1GHJ A;  3E6Z X;  4GKJ Q;  3CP0 A;  1ICW A;  1FNW A;  3LX0 A;  4KI0 A;  3K7A B;  4ME3 A;  4G7H C;  4A3B G;  2QKI C;  1G91 A;  4L8J A;  4LF6 L;  1ZKO A;  3BYT B;  3DEP A;  4RH6 A;  2CFM A;  4L63 B;  1Y1W H;  1SNM A;  1CA6 A;  1F2Y A;  3VA7 A;  4NW2 A;  1DJR D;  4A3D G;  3BJU A;  2R92 G;  3BU2 A;  3FPP A;  2E5L L;  4K8J A;  2L0C A;  1TWF B;  3D3R A;  2DGY A;  2CQO A;  3EVQ A;  1FNU A;  1AW7 A;  4KV6 A;  1WTW A;  1M1K C;  4C3I G;  2YU9 B;  2MUY A;  4GNX A;  1GO3 E;  5DM6 3;  3G48 A;  3KDF A;  3E0E A;  3TP7 A;  3GTP B;  4HTH A;  1MI2 A;  1LO5 D;  1VQD A;  2Q8R E;  4DAM A;  3U9O A;  4B9W A;  3CME A;  1ENF A;  4RWS C;  1O7L A;  1KNA A;  1S5B D;  1B9M A;  3PUY A;  1O7Y A;  3DXJ C;  1S40 A;  1QJO A;  5M3F B;  3M9B A;  4TRD A;  1V1P B;  4DAY B;  3PV0 A;  3TP5 A;  4HMJ A;  3WOE A;  5D65 A;  1NJI C;  1R9T B;  3Q22 A;  4BY7 H;  3VR5 A;  1SDF A;  2EJM A;  1KRS A;  4ID6 A;  3KLS A;  2JA5 B;  2JQO A;  4QY7 A;  3NP8 A;  5CV9 A;  4OWW B;  3I7F A;  5JEA J;  1E22 A;  2KCC A;  2PQA B;  4QUC A;  1VQ5 A;  4GKJ L;  2YTY A;  4WRD A;  4BA1 I;  5IOC A;  1B50 A;  5K36 G;  1CZG A;  3D31 A;  3ERO A;  3TS2 A;  1X6O A;  4KJN A;  3KK7 A;  1A2U A;  3S17 B;  5M3M B;  4UP9 A;  4G7Z C;  1XPU A;  1GUO A;  2R3Z A;  4BWG B;  1QB5 D;  4DV6 Q;  1X3P A;  2F0L A;  4BBS G;  2IW3 A;  2R7D A;  1STY A;  1D6E C;  1BUV T;  1RF2 D;  3RR5 A;  1EWI A;  5IT9 E;  3DHQ A;  1VQH A;  4A93 G;  4TKO B;  4AYB B;  1HUN A;  2VW9 A;  5C4X G;  2A6H C;  1J9O A;  1ET6 A;  3CC4 A;  4A3K G;  4A3E B;  1JCK B;  2Y0S G;  1A15 A;  2QIL A;  4X65 L;  1SBB B;  4XT1 B;  1QE6 A;  3SK8 A;  1IW7 D;  1U4L A;  1EWH A;  4X3U A;  1QVC A;  2CW0 C;  2NWG A;  2B2Y C;  4ZLT F;  3EA6 A;  2R61 A;  1LUZ A;  2KOL A;  3QG1 A;  1IYJ B;  1YJ9 A;  1Y69 U;  1ASZ A;  1G51 A;  1AH9 A;  2MFI A;  1Q8K A;  5EJW A;  4RCN A;  3NQT A;  1QVG A;  2F0H A;  1MSG A;  4A3I H;  3TQY A;  2J0T D;  1V8Q A;  1I4H A;  2PQA A;  3P7J A;  5FO8 B;  1I6H H;  4DAP A;  1H95 A;  4DUY Q;  1J5E Q;  2G9H D;  3ITP A;  5EAY A;  1HNW Q;  3HOZ B;  5CGK A;  1DXM A;  2ENB A;  2EYJ A;  3OW2 A;  1TS4 A;  1D5X C;  2EYM A;  3I2Z A;  1N36 Q;  4L5S A;  1VQ9 A;  1A3V A;  2IHE A;  3LGJ A;  4CJ2 C;  3J80 i;  1C7Y A;  2PYK A;  4YWK A;  3RD4 A;  4QIW B;  4IUU A;  4A3J G;  1CQV A;  4HIM A;  3B6Y A;  2NVT B;  3NUC A;  2SEB D;  2NVQ B;  1CKN B;  1LAB A;  2VXW A;  1N33 Q;  1YNJ D;  4N9T A;  2EYP A;  4DV4 Q;  2WAQ E;  4LMQ D;  3H94 A;  4KHP L;  2Q2I A;  4DNR B;  3PSI A;  4LW1 A;  4OXP A;  3GTP H;  1KDC A;  3AU7 A;  1WTH A;  1EIH A;  1SJH D;  2Q2U A;  2H1E A;  2ID0 A;  4JW0 A;  4NXN Q;  3A0J A;  4B3R Q;  2EYF A;  2FFK B;  3S15 B;  2UUA Q;  3CHB D;  5EKI A;  3PIP 3;  1Q1E A;  3LNN A;  5IWA L;  2D9U A;  5AFW A;  3CXC A;  4JBM A;  2NVX B;  1D1I A;  2XSC A;  4C3J G;  1G29 1;  3O13 A;  1RTN A;  3BVZ A;  3GTO H;  1LTA D;  3I3C A;  1XNQ L;  1CKO A;  3IL8 A;  2K52 A;  2N88 A;  1EYC A;  1JE5 A;  1CQF A;  4RGN A;  1J5E L;  2I5L X;  1VDZ A;  2HHH Q;  4DUZ L;  4JI0 L;  1KD1 C;  3DWP A;  2BA1 A;  1E3P A;  2F0N A;  1A62 A;  1X9N A;  4KKS A;  4X3T A;  2A68 D;  2NZO A;  4DV0 L;  4PQX A;  1YHQ A;  1MJE A;  4V0B A;  1B44 D;  2HCC A;  4H7B A;  1BCP D;  1XYI A;  2AKW B;  3SK5 A;  5I6Y A;  3FDT A;  2K01 A;  1CZW A;  1MD2 D;  4C2M B;  1H9M A;  2KEC A;  2EDG A;  1VQ4 A;  3TN2 A;  3HOY G;  1PRT F;  3CQZ B;  3VYS A;  4ILW A;  1EY7 A;  5C44 G;  1A63 A;  1N33 L;  1TWA B;  4C3H G;  2DJF C;  4A3E H;  3F8T A;  1HXY D;  4HSV A;  2JA8 H;  4XDX A;  1K8G A;  5JJK A;  1TXY A;  1W6K A;  5G3L D;  1VQB A;  1L2F A;  2NUC A;  1E7Z A;  2JE6 I;  5C5M A;  4QF4 A;  3KFU A;  4A3C G;  3I91 A;  2MGS A;  4JI4 Q;  4K5X A;  2VUM G;  2F3V A;  2PW7 A;  1LAC A;  4J8Q A;  1D5Z C;  1SND A;  5ELC A;  1J6Q A;  3M7N A;  4B3M L;  4MN3 A;  3HG9 A;  1STH A;  1SE3 A;  3QB3 A;  3SXH A;  4CKE A;  1HR0 Q;  3H3V H;  1B4O A;  2LXK A;  3M4O H;  1I94 L;  2KEN A;  3S2H B;  2RVL A;  4YCU A;  4DV5 Q;  1TWH H;  3K80 C;  1XNR Q;  2K6A A;  5DNF A;  5D14 A;  1TII D;  2L55 A;  1NCV A;  1Y1V G;  3TS0 A;  2JA7 B;  2JA6 H;  4IUQ A;  4A3M H;  4JI6 Q;  2O2L D;  1Q86 C;  4G7O C;  2HT1 A;  3I56 A;  4GKK Q;  1M4V A;  1B2T A;  3CCU A;  4DR6 Q;  4LUO A;  4K14 A;  2LKV A;  3PUZ A;  2K7V A;  4UDU C;  2VY3 A;  1EZ8 A;  5I2X A;  4KLK A;  1SNC A;  1RTO A;  1X65 A;  3AYH B;  1EYA A;  2PCF B;  1HUM A;  1WCM G;  4FNF A;  1GJX A;  1SNP A;  2SDF A;  3NE5 B;  2ZJR A;  5LMN W;  2ZXP A;  5T1I A;  4DR1 Q;  2NVQ H;  2FIN B;  4BXX G;  3NBH B;  3UDG A;  4PG3 A;  2PI2 E;  5IP9 H;  3PO2 H;  1BO0 A;  3GTG H;  3QO2 A;  2KED A;  5IY0 A;  4X62 Q;  3ZYY X;  5LMN L;  1L0X B;  1FR3 A;  5ELF A;  1U0L A;  1F77 A;  1EY0 A;  3CCJ A;  3T53 B;  5DEH A;  3H0G G;  1DM0 B;  1AEX A;  2AQ1 B;  2FHT A;  4HCS A;  3G71 A;  4DV7 Q;  2Z0S A;  1PDQ A;  4IFD J;  2VB3 X;  5KEE A;  2DUD A;  3ICE A;  2VS1 A;  2R7Z G;  2ZTE A;  4FDB A;  2WFW A;  4ZCK A;  1Q7Y C;  5CR3 A;  1K8O A;  2IX1 A;  3K5O A;  2IWH A;  3NXW A;  3ER0 A;  3GV3 A;  4JI6 L;  2ZTD A;  2BH8 A;  4C1N I;  5FO9 B;  4PZ6 A;  1ILQ A;  3KJO A;  4L5T A;  4XT3 B;  1BDO A;  2Z4I A;  4KK7 A;  4J1M A;  1TWC B;  4BBR B;  1BBX C;  2E2I B;  1OXU A;  4DR2 Q;  1DOK A;  4LNQ A;  2B39 A;  3S9W A;  3R3O A;  5GAD C;  5FK9 C;  4BY1 B;  3GTQ B;  3I4N B;  4KN4 C;  3AFQ A;  2DNC A;  1DON A;  4DR1 L;  1KIX A;  5GQO A;  1SYB A;  5EKK A;  1NR4 A;  4UY8 C;  3GD7 A;  4X62 L;  2NN6 H;  5M5Y H;  1HZ9 A;  3UDI A;  2B63 G;  1JC7 A;  4DR7 Q;  3GDE A;  3UE0 A;  2B2T C;  4HIK A;  2CKZ B;  2DNE A;  3N52 A;  3NSW A;  4JV5 L;  3KF6 A;  4DR3 Q;  1I5F A;  1Q46 A;  1TS5 A;  2L5T A;  3HOV H;  4Q5V A;  1E2W A;  2KHI A;  1CA5 A;  2R93 H;  1S72 A;  4DV7 L;  3GTL H;  2LXJ A;  1GUN A;  2A69 C;  3R93 A;  2F0M A;  1W2B A;  1XTD A;  3S2H H;  2IT1 A;  5GRO A;  1FVI A;  1JR0 D;  3TDQ A;  2Z9H A;  1WVL A;  4X6A H;  3OIQ A;  4MTN A;  5IT9 c;  1FGU A;  1JT8 A;  1PMR A;  2D2C C;  2JXM B;  2WV6 D;  3M3Y B;  5I6W A;  1NMG A;  3NTH A;  3CC2 A;  1B1Z A;  1N9W A;  1PH7 A;  4CJ1 B;  3ULJ A;  4A3B B;  1PTO B;  1XPO A;  4IJL A;  1EWC A;  1X32 A;  2WAQ G;  1TT2 A;  3SVM A;  3S14 B;  3U9S A;  2Z6K A;  1K83 B;  1UUP A;  1S4Z A;  2Q8T A;  1F2Z A;  4APV A;  1IBK Q;  4A3D B;  1KLG D;  3A55 A;  2R92 B;  3W2D A;  1GHK A;  5C0X G;  1PFS A;  1IZ6 A;  1PH5 A;  1WI5 A;  4KY6 A;  3MC0 B;  4UPA A;  3ND9 A;  3L2P A;  1IBM L;  5JJL A;  1TY0 A;  2QEJ C;  4C3I B;  4LF9 Q;  4B3T L;  1PYW D;  3H09 A;  5FJ8 G;  2UUC Q;  3A5U A;  3M7G A;  2MHV A;  4OWT B;  1CSQ A;  1HA6 A;  1EY8 A;  2MO0 A;  1BF4 A;  3MFY A;  1JJG A;  4YWM A;  1K8M A;  3PUX A;  3U4V A;  3DWA A;  4X3S A;  1I3Q B;  4DKA C;  3BZK A;  2E2J H;  3T1Y Q;  1O80 A;  1XXG A;  4B3S Q;  1K3R A;  1XMO Q;  1HCZ A;  1SXT A;  2QEX A; 
#chains in the Genus database with same CATH homology
 4JBJ A;  2EQS A;  4YCW A;  3RN5 A;  1XNR L;  1VQG A;  4TQU S;  3UDF A;  1C0A A;  1AE3 A;  2KBN A;  5M3F G;  4B3M Q;  3M4P A;  3E9I A;  1NJI C;  1VQ6 A;  4BY7 H;  1P8L A;  3HOW G;  4WJ4 A;  1KRS A;  3HOX H;  4DR5 Q;  2VNU D;  2JQO A;  4QY7 A;  3J81 i;  4A3G G;  2KHJ A;  3CC7 A;  3HFZ B;  5H1S E;  3S16 H;  3ZJY C;  4OWW B;  1YNX A;  3BZC A;  4NPS A;  1I94 Q;  1XJV A;  2JA5 G;  4LFA L;  3I4M H;  4GKK L;  1EIF A;  3I7F A;  5JEA J;  1E22 A;  2PQA B;  1VQ5 A;  1KQS A;  4DR6 L;  3KF8 B;  4GKJ L;  2YTY A;  3S1R H;  3AQQ A;  2WB1 E;  1HZC A;  4BA1 I;  3FKI H;  5K36 G;  3D31 A;  3TS2 A;  1X6O A;  1UE5 A;  1VCI A;  3W5O A;  3HOY H;  1IBK L;  4C2M H;  4UP9 A;  1EIY B;  1XPU A;  1VQL A;  4DAY B;  1TWG H;  4DV6 Q;  1Z47 A;  1WJJ A;  2PNH A;  4BBS G;  5M3M G;  5C44 H;  4IO9 A;  2R7D A;  4C3H H;  4HJ5 A;  2AMC B;  3CQZ H;  4UP8 A;  3CCV A;  3RR5 A;  2UXD Q;  1EWI A;  1TWA H;  1YBY A;  1VQH A;  1WYD A;  1QZH A;  1CKN A;  4A93 G;  1PYS B;  2VW9 A;  5C4X G;  4IFD I;  3I4N H;  2GVB A;  1UWV A;  5ELO A;  3CC4 A;  1CUK A;  4OO1 G;  4AYB G;  4A3K G;  4A3C H;  2Y0S G;  3CPF A;  4OWX B;  1OXT A;  4DV2 Q;  2VUM H;  3IRB A;  5JEA G;  4X65 L;  3PF4 A;  4MZ9 A;  4GNX B;  3RNU A;  5BR8 L;  4A3E G;  1GKH A;  2UU9 Q;  3KDF B;  1QVC A;  4R1J A;  1VS0 A;  3CAM A;  2ZJQ A;  1LUZ A;  4GN3 B;  4OO1 I;  3T1Y L;  1IYJ B;  3VDY A;  1YJ9 A;  2IHF A;  1ASZ A;  2YTX A;  1G51 A;  1QUQ B;  3EIV A;  1AH9 A;  1JJC B;  2MFI A;  5LMN Q;  1NMF A;  2NN6 G;  1Q8K A;  2GN5 A;  5GAH C;  2LSS A;  4LF5 Q;  1QVG A;  1VQN A;  3K8A A;  1PH4 A;  4A3I H;  3TQY A;  1L1O C;  4QL5 A;  3EBE A;  1E1O A;  2PQA A;  1HZB A;  3NEN A;  1Y1V H;  1SN8 A;  1PH9 A;  1I6H H;  5HGQ A;  3HOV G;  2Y0S E;  2AWN A;  1XMQ Q;  2R93 G;  1PA6 A;  3F1Z A;  1H95 A;  4DUY Q;  1SR3 A;  2FXQ A;  5IYC G;  2ZM6 Q;  4R4O A;  1J5E Q;  1M90 C;  2N3S A;  4LF4 Q;  2JEA I;  1KL9 A;  5EAY A;  1SE8 A;  1HNW Q;  3H3V I;  4JC0 A;  3OW2 A;  1SRU A;  3I2Z A;  2WP8 J;  3HOZ G;  3STB D;  1N36 Q;  4L5S A;  1VQ9 A;  4OX9 Q;  1YJN A;  1RL2 A;  1WOC A;  2IHE A;  4XTC S;  3LGJ A;  5AJ3 Q;  4A75 A;  4GOP C;  2B3G A;  2F4V Q;  4A3B H;  2UXB L;  4JI1 Q;  4R4T A;  4DR2 L;  3J80 i;  3CD6 A;  1WCM H;  3MEF A;  3PIO A;  4A3F G;  1OXS C;  2F52 A;  3PIP A;  1C7Y A;  5LMU Q;  5J3B A;  4YWK A;  2QGQ A;  4A3D H;  4KHZ A;  1VQI A;  2L15 A;  2JEB I;  4A3J G;  1A8V A;  1YIJ A;  4BXX H;  3HOV H;  5IE8 A;  5C0X I;  4HIM A;  1BBW A;  3B6Y A;  2VQF Q;  4DV3 Q;  5FJ8 H;  1Y1W G;  3CCE A;  1YIT A;  3CCM A;  1CKN B;  2Q2H A;  4DV2 L;  1N33 Q;  4DV4 Q;  4DR7 L;  2WAQ E;  1Q81 C;  4X64 L;  2RHQ B;  3T1H L;  4KHP L;  3JAM i;  4AIM A;  4JYA L;  2Q2I A;  1QUQ A;  3PSI A;  4LW1 A;  4OXP A;  3CCQ A;  4HJ7 A;  1VQP A;  3GTP H;  3H0G H;  4AH6 A;  5C3E H;  3CMA A;  4DR3 L;  1HNZ Q;  3W1G A;  1WFQ A;  3S1M H;  4IOA A;  3RZD H;  2Q2U A;  2A1A A;  2ID0 A;  4HJ9 A;  5IP7 H;  3WWV A;  2HIX A;  4YY3 Q;  4NXN Q;  3A0J A;  4B3R Q;  3AFP A;  2OQ0 A;  2VQE Q;  3RN2 A;  2UUA Q;  4TVA B;  1Q1E A;  4LF5 L;  1EOV A;  5IWA L;  2R7Z H;  3KOJ A;  4P73 A;  2K4K A;  4IPG A;  4NB3 A;  3CXC A;  4JBM A;  1G29 1;  3HOU H;  1NY4 A;  4JV5 Q;  2K75 A;  1X55 A;  1I50 H;  3CW2 C;  4J15 A;  3OTO Q;  3H15 A;  4POF A;  3J81 j;  3CPW A;  3GTO H;  4DR4 L;  4A3G H;  2V1C C;  3MXN B;  4JI5 Q;  4A4I A;  1XMQ L;  1K8A C;  2R6G A;  1CKO A;  1XNQ L;  4QQB X;  2K52 A;  1VQC A;  1JE5 A;  4JI3 L;  5IYB G;  1E1T A;  4LUV A;  2PI2 A;  3CF5 A;  1J5E L;  1Q82 C;  4P71 A;  2I5L X;  1D8L A;  3PUW A;  4A3L H;  1VQJ A;  3A5Z B;  4Y7N H;  4JOI A;  2HHH Q;  1MIU A;  4DUZ L;  4LFC Q;  4JI0 L;  2EXD A;  1KD1 C;  2A8V A;  2R7F A;  2MO1 A;  2BA1 A;  1CKM A;  3EN2 A;  1E3P A;  3HOX G;  1N34 Q;  1G6P A;  1A62 A;  1FL0 A;  3U58 A;  1X9N A;  3S24 A;  3GTM H;  2F4V L;  2D0O A;  2NZO A;  2RHS B;  5AJ3 L;  4DV0 L;  1C9O A;  1KXL A;  1Z9F A;  3I4M G;  1YHQ A;  4JI1 L;  4QGU A;  1MJE A;  1TWC H;  3RLF A;  2E8G A;  4BBR H;  5LMU L;  4K0K Q;  2AKW B;  4NXM Q;  4JG2 A;  2E2I H;  3K0X A;  4PMW A;  3W1B A;  1JMC A;  4LF9 L;  2ASB A;  3FKI G;  1PYB A;  1EYG A;  2UUC L;  2UUB Q;  1T9H A;  4BY1 H;  3GTQ H;  2IY5 B;  4GNX C;  1VQ4 A;  2VQF L;  5C4X H;  4DV3 L;  1PH3 A;  4LF6 Q;  3HOY G;  1NTG A;  4AQY L;  3RZO H;  2ES2 A;  1VQ7 A;  5C44 G;  1A63 A;  1N33 L;  1RIP A;  4LF8 Q;  2B63 H;  3JC6 6;  4A76 A;  2UXC L;  2E5L Q;  3NEL A;  1IBM Q;  2D0P A;  4A3E H;  2BA0 A;  4O2D A;  5HY6 A;  1IBL Q;  3F8T A;  3J80 c;  3F2C A;  4B3T Q;  2JA8 H;  3TRZ A;  1K8G A;  5JJK A;  1TXY A;  2ZTC A;  1VQB A;  1L2F A;  1KHI A;  1E7Z A;  1XMO L;  4B3S L;  3I4N G;  1HNZ L;  2K14 A;  2JE6 I;  4QJF A;  1SLJ A;  2N49 A;  3I55 A;  3KFU A;  3ULL A;  4A3C G;  5IYD H;  1UEB A;  4JI4 Q;  1VQ8 A;  2VUM G;  4GN5 A;  1YI2 A;  4LF7 Q;  1J6Q A;  4HJ8 A;  4DR3 Q;  1B70 B;  4GLA C;  4R4C A;  4R4Q A;  1Q12 A;  1S3O A;  1N8R C;  1GM5 A;  2N78 A;  4B3M L;  3M7N A;  4RG1 A;  4IPD A;  1YZ6 A;  1QZG A;  4DR5 L;  3S1Q H;  4AYB E;  3I4O A;  4DK6 C;  1HR0 Q;  2NN6 I;  3H3V H;  2K5N A;  4JBW A;  2LXK A;  1IL2 A;  1I94 L;  2KEN A;  3M4O H;  4YCU A;  4DV5 Q;  2JA9 A;  4DK3 C;  3ULP A;  4RMF A;  2N8N A;  1TWH H;  4X66 Q;  4P74 A;  3K80 C;  3CCS A;  1EUJ A;  1XNR Q;  3M3Y H;  5IYC H;  1K9M C;  3U50 C;  3PO3 H;  2IX0 A;  4IPC A;  3Q8D A;  1MKH A;  4LFC L;  5E7N A;  5FLM G;  3ERS X;  1Y1V G;  1V43 A;  3TS0 A;  1HNX L;  2JA6 H;  2JK8 A;  1YHA A;  4A3M H;  4JI6 Q;  3K7A H;  3S14 H;  4HJA A;  1UE6 A;  1Q86 C;  2HT1 A;  5DLQ E;  4DV6 L;  1LM0 A;  1L1O B;  1K83 H;  4LFA Q;  3I56 A;  4LWC A;  2JA7 G;  4GKK Q;  3TRE A;  1BVS A;  4A3F H;  1SMX A;  3J81 c;  3CCU A;  4DR6 Q;  4LUO A;  1EQR A;  4JI8 Q;  4YHH Q;  1MJC A;  3DLL A;  2R92 H;  3OYY A;  3PUZ A;  2UXD L;  5C4J H;  1P16 A;  2VY3 A;  3D0F A;  4KLK A;  3GTJ H;  1V1Q A;  4HIO A;  3PGZ A;  1TWF H;  1UE1 A;  4C3I H;  4BA2 I;  2C35 B;  3S2D H;  1X65 A;  1W2B A;  3AYH B;  2K50 A;  1WCM G;  1D7Q A;  1K0R A;  2OCE A;  2YU9 H;  2ZJR A;  5LMN W;  3HKZ G;  4P72 A;  1VQO A;  2UU9 L;  5M5X H;  4EX5 A;  2KCT A;  2CCZ A;  4DR1 Q;  2NVQ H;  1UE7 A;  2VL6 A;  4JCV E;  3NBH B;  1IBL L;  2HIV A;  4BXX G;  3UDG A;  4PG3 A;  2PI2 E;  4PZ7 A;  5IP9 H;  3PO2 H;  3GTG H;  1N32 Q;  1I3Q H;  3NEM A;  5IY0 A;  4X62 Q;  2YV5 A;  5LMN L;  1LTL A;  1E24 A;  4IJH A;  4X65 Q;  1QVF A;  3CCR A;  2ALY B;  1U0L A;  4LF7 L;  5BR8 Q;  4XIG S;  3CCJ A;  1KRT A;  5M3F H;  2JA7 H;  1B7Y B;  1VQE A;  2A19 A;  4QIW E;  1HZA A;  1Y14 B;  3H0G G;  3HOW H;  4P75 A;  5C3E G;  2WB1 G;  2E2H H;  1IXR A;  4GN4 B;  1R9T H;  5IP7 G;  4JI7 Q;  3G71 A;  2OTJ A;  4DV7 Q;  2Z0S A;  2JA5 H;  2BH2 A;  4DUY L;  1BBU A;  3M85 A;  2ZM6 L;  4JI2 Q;  3G6E A;  4LF4 L;  4IFD J;  4X66 L;  2DUD A;  3ICE A;  1HNW L;  2VS1 A;  2CWP A;  2I5M X;  2ZTE A;  4FDB A;  3STB C;  2WFW A;  4L5R C;  1Q7Y C;  2R7Z G;  1U5K A;  5GAG C;  1VQM A;  4BY7 G;  3HOU G;  1L1O A;  2Z6K C;  1X3F A;  1V9P A;  2RCN A;  1OTC A;  1N36 L;  2IX1 A;  4OX9 L;  4Y52 H;  3ER0 A;  4JBK A;  2PMZ E;  1L0W A;  2ZJP A;  1KC8 C;  4JI6 L;  1GD7 A;  3KYH C;  4GLV B;  1YVC A;  2BH8 A;  2ZTD A;  1YEZ A;  5ELN A;  4BBS H;  5JJI A;  3S17 H;  4HID A;  5M3M H;  2I5H A;  1ASY A;  2I0Q A;  3TEH B;  1PH1 A;  4A3L G;  3FHW A;  4PZ6 A;  4JI8 L;  4YHH L;  3GO5 A;  2Q2T A;  1FJG Q;  3KJO A;  4L5T A;  1X56 A;  3PF5 A;  2CWA A;  4A93 H;  3M4Q A;  4IOC A;  2YYZ A;  4GOP A;  2UXB Q;  2K5H A;  2NZH A;  1OXU A;  1AE2 A;  4DR2 Q;  4A3K H;  4IFD G;  2JJQ A;  4BBR G;  4LNQ A;  4DV4 L;  1VQA A;  4LUZ A;  3SGI A;  4MNO A;  5GAD C;  3A74 A;  1YJW A;  1SFO H;  3G4S A;  2AHO B;  4YWL A;  3AFQ A;  1Q1B A;  3RLN A;  3U4Z A;  4DR1 L;  4R4I A;  5GQO A;  1KIX A;  4BY1 G;  1X3G A;  4LFB Q;  4UY8 C;  1PV4 A;  4WJ3 M;  2OTL A;  3GD7 A;  1N32 L;  2NVY H;  1W3S A;  4NXN L;  4YY3 L;  5M5W H;  4X62 L;  4DV1 Q;  4B3R L;  2AWO A;  2VQE L;  1XPR A;  3FP9 A;  5M5Y H;  1HZ9 A;  2UUA L;  3UDI A;  2B63 G;  4DR7 Q;  3K7U C;  2F3I A;  3GDE A;  2D62 A;  4UP7 A;  3UE0 A;  1OXV A;  4X64 Q;  4HIK A;  3T1H Q;  4KHP Q;  1JB7 A;  2HQL A;  4JYA Q;  1DGS A;  2JA8 G;  2CKZ B;  4IPH A;  4JV5 L;  1HH2 P;  1X3E A;  1X54 A;  3L0O A;  3KF6 A;  2H5X A;  1B8A A;  3OTO L;  1I5F A;  1Q46 A;  2K5V A;  3KLW A;  2MNA A;  3K81 C;  1GVP A;  4YCV A;  4GS3 A;  4JI5 L;  5IYD G;  3JAM c;  1JJ2 A;  4JI7 L;  2XGT A;  2KHI A;  3PUV A;  4H02 A;  2R93 H;  1S72 A;  3PV0 A;  4DV7 L;  1HNX Q;  2LXJ A;  3GTL H;  5C0X J;  3S1N H;  3GTK H;  4JI2 L;  4EQ5 A;  1LYL A;  1XTD A;  3PCO B;  3E9H A;  4A3I G;  2OQK A;  4JOI C;  5GAE C;  5IWA Q;  3RLO A;  2HHH L;  1BKB A;  2IT1 A;  5GRO A;  1FVI A;  2GVA A;  3J7Z C;  3S2H H;  2ATW A;  1YHB A;  1N34 L;  3UDX A;  3L7Z C;  4PZ8 A;  4X6A H;  3HOZ H;  5FLM H;  4L5Q A;  1PH6 A;  4MTN A;  5IT9 c;  1FGU A;  1JT8 A;  4DR4 Q;  2XTI A;  3HKS A;  1VQF A;  1EQQ A;  2EIF A;  3DM3 A;  1XNQ Q;  3J7A 5;  2KCM A;  4DPG A;  4K0K L;  1NMG A;  4JI3 Q;  3CC2 A;  4NXM L;  3PO3 G;  3CP0 A;  4GKJ Q;  1N9W A;  2VZA A;  1PH7 A;  1SRO A;  3ULJ A;  1XPO A;  4IJL A;  4KI0 A;  2WAQ G;  4DUZ Q;  1FJG L;  4A3J H;  4JI0 Q;  3F2B A;  4ME3 A;  2UUB L;  2Z6K A;  4A3B G;  2JA6 G;  4A3M G;  1PH2 A;  4APV A;  1IBK Q;  1Y1W H;  3CCL A;  4LF6 L;  2CFM A;  4DV0 Q;  1EFW A;  5C0X G;  1PFS A;  1IZ6 A;  4LF8 L;  1PH5 A;  4A3D G;  2NVT H;  3BJU A;  2R92 G;  1WI5 A;  3BU2 A;  4GOP B;  2E5L L;  1PVO A;  3KJP A;  4UPA A;  3L2P A;  1IBM L;  5JJL A;  2DGY A;  2CQO A;  4B3T L;  4LF9 Q;  1HJP A;  1M1K C;  1CSP A;  5FJ8 G;  4POG A;  2UUC Q;  4LFB L;  1OXX K;  4GNX A;  1NE3 A;  1GO3 E;  3A5U A;  4OON A;  3F2D A;  1HR0 W;  3G48 A;  1PHJ A;  1VQK A;  1O7I A;  4AQY Q;  3KDF A;  4JI4 L;  3E0E A;  4DV1 L;  4OWT B;  1CSQ A;  1VQD A;  4DAM A;  3AEV A;  1KAW A;  2MO0 A;  3UE1 A;  2MQH A;  2YTV A;  1JJG A;  4YWM A;  2UXC Q;  4GLX A;  4DNI A;  3CME A;  2OWO A;  3PUX A;  3S15 H;  3U4V A;  1PH8 A;  2RF4 A;  4C3J H;  2QA4 A;  4DKA C;  3BZK A;  1HR0 L;  1NBW A;  2E2J H;  4O0A A;  3T1Y Q;  5IP9 G;  3PO2 G;  4B3S Q;  3PUY A;  1K3R A;  4ALP A;  1XMO Q;  2NVX H;  1S40 A;  3HKZ E;  4DV5 L;  1K73 C;  5FLX c;  3M9B A;  2QEX A;  2B29 A;  3KF6 B;  5IYB H;  1A0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...