4DV0Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 16
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv0Q00
1JMCA 1SFOH 3KJPA 3OTOL 1VQKA 2WAQG 5M3MH 3U50C 3J7ZC 3HOYH 3ICEA 4L5QA 4JI2L 4BY1H 3NELA 1XNRQ 4A3GG 1E24A 2JA9A 2WB1E 1B8AA 2UU9Q 1N9WA 3AQQA 3OTOQ 3L2PA 4DV6L 4L5RC 4QJFA 4DV0L 5EAYA 4JI2Q 4GOPA 4A3DH 4JI1L 5AJ3Q 4LNQA 1TWAH 2OWOA 4DV6Q 2A1AA 5BR8Q 3S24A 2WAQE 2ASBA 3FKIH 1VCIA 4A3LH 1IYJB 4JBMA 4HIDA 4JI1Q 3H15A 3I4NG 4JOIC 1Q12A 4A4IA 2OCEA 4LUVA 2H5XA 1PA6A 5IYDG 3M9BA 4BXXG 3GD7A 2UXBL 5C4XG 1OXSC 2I5MX 4PZ6A 3CW2C 3E9IA 3F2DA 2QA4A 1J5EQ 2GVBA 1EFWA 1XPUA 2MNAA 2F52A 4JC0A 4C3HH 1GKHA 1CKOA 1IXRA 4A3MG 3HOXG 1PH5A 3HOVH 2RHQB 1EUJA 5IYBG 4DV1L 2UXBQ 3RLNA 2CKZB 1X56A 4OWWB 4IOAA 1P8LA 1Y1WH 5C0XI 3GTGH 3CCEA 3NBHB 1VQ9A 4OWTB 5ELOA 4DR2L 3H3VI 1Y14B 3CC2A 2JA7H 4LWCA 4DV1Q 2MO1A 4P74A 4B3RL 1P16A 3BJUA 1VQEA 1S3OA 2K4KA 4OXPA 5IT9c 1XMOQ 3S17H 4KI0A 4IO9A 3U4ZA 4DUYQ 4DR2Q 3GTQH 3M4OH 1WCMG 3K7UC 4NPSA 4B3RQ 1X3EA 2IX0A 3J80c 3K7AH 1WOCA 2YTYA 4FDBA 2JA6H 5IP7H 2CFMA 4GKJQ 5IP9H 2VQFQ 1KHIA 4P72A 5LMUQ 4JI4L 1GO3E 5IWAL 2B63G 4DR7Q 1IZ6A 1OTCA 2NZOA 3UDXA 4HJAA 2Q2HA 1VQLA 1I94L 3OW2A 2JE6I 4TVAB 2XTIA 1EIFA 4JI4Q 5IWAQ 3RR5A 1HZAA 3PUXA 4JI7L 3MXNB 4NB3A 5K36G 4DV2L 1B70B 3CPFA 1E7ZA 1CUKA 1SROA 2UUCL 1E22A 3STBD 1M90C 4GOPC 2K50A 1TWHH 4JOIA 4JI7Q 2R92H 3RZDH 2ZTEA 3RN5A 3BZCA 4KHZA 2UUCQ 1Q81C 3PUVA 1VQHA 4B3SQ 3PO3G 2MFIA 1X55A 1YHBA 3GO5A 4UP8A 3ULLA 4A3CG 5E7NA 4P71A 1U0LA 3CCLA 1UE5A 3TS0A 1HZBA 4R4CA 3TREA 1XNQL 2VY3A 2YYZA 4ME3A 4GKKL 4HJ5A 4OX9Q 3A0JA 2OTLA 4IPDA 1Q46A 1YBYA 5JEAG 2B3GA 2ZTCA 2HHHL 4DV7Q 3UDFA 3PIPA 2OQKA 1MJEA 4C2MH 1A8VA 2LXKA 2ZTDA 5FJ8G 4A76A 4DR3L 2AWOA 2R7DA 1X9NA 3I56A 4NXML 1PH2A 1LYLA 1O7IA 2FXQA 3G6EA 1CKNB 4X65L 4GKKQ 2ALYB 1E3PA 1SE8A 2D62A 5H1SE 3CMEA 2HHHQ 3S2HH 2ZJRA 2XGTA 2LSSA 4MZ9A 4DR3Q 1VQCA 1N33Q 2Y0SE 4NXMQ 4K0KQ 2R93H 1Y1VG 4LF5L 1EOVA 4IFDJ 2I5LX 1A62A 2ATWA 3U58A 4B3TL 4H02A 4J15A 3A5UA 3RNUA 2PMZE 2R7ZH 1XTDA 3RLOA 2ZM6L 2KENA 1VQMA 1VQ5A 1MJCA 3E0EA 1L0WA 2UU9L 1FVIA 2MQHA 4JI6L 4AYBG 3KF8B 1I6HH 4LF5Q 4B3TQ 3S2DH 4TQUS 1I50H 1VQ4A 4JBKA 4DR4Q 4XIGS 1JJGA 2ZM6Q 1W2BA 5AJ3L 1N36L 5LMNL 3NEMA 2RHSB 3SGIA 1PH9A 2JA5H 4QQBX 4R4QA 4GOPB 1NMGA 1YJWA 4JI6Q 3CCMA 5BR8L 2A8VA 3F2CA 3JAMi 2N8NA 2UXDQ 2EXDA 3KJOA 3VDYA 1SLJA 5GAHC 5FLXc 1WCMH 4GN5A 3J7A5 2HQLA 1N36Q 5LMNQ 2AWNA 2RCNA 4PZ7A 3HKZE 1PH1A 3GTJH 3PO2G 1UE6A 4A93H 3H0GG 3HKSA 4AYBE 4DR1L 1KIXA 4BA2I 4DR6L 1K83H 2IHEA 3T1HQ 4A3IG 1J5EL 2VUMG 3G48A 5C4JH 3M85A 3HOWG 2UXCL 1EIYB 3CP0A 4IPHA 1WI5A 3H3VH 4APVA 2WP8J 2C35B 2R7FA 3PUZA 1RIPA 5J3BA 3ZJYC 4DR1Q 4DK6C 3CCVA 4DR6Q 4KHPL 4JI5L 4JBJA 3M7NA 1BBWA 2Q2UA 1VQDA 3J81i 5HY6A 4UY8C 2UXCQ 1I3QH 3NENA 4JI3L 4A75A 3HOUG 1Z9FA 1VQIA 4KHPQ 4A3JG 4JI5Q 4HIMA 2JEAI 4YCVA 1K9MC 1YEZA 4DAYB 3W1GA 5IYCG 4A3EH 4DK3C 1NTGA 1XMOL 4JI3Q 4A3BG 2Q2TA 3PUYA 1YHQA 3GTOH 3KOJA 4DUYL 5FLMG 4OONA 1LM0A 1CKMA 1N32L 1Q86C 3PO3H 3A5ZB 1MIUA 1NBWA 4MNOA 1PH4A 3I4MG 3TS2A 4A3CH 4BY7G 4GKJL 3UE1A 2VQFL 2CCZA 1GVPA 3CC4A 2D0PA 2E8GA 5LMUL 4YCUA 3K0XA 3F2BA 1PH6A 1D7QA 5GAEC 4LF6L 1L2FA 2GN5A 4DR7L 1N32Q 1M1KC 1VQFA 1SR3A 3JAMc 1YJNA 2E2IH 2NN6G 2CQOA 3HOZH 1VQ7A 4A3LG 3Q8DA 2JA8G 1X54A 4P75A 5LMNW 5FJ8H 4LF6Q 2RF4A 1DGSA 2R6GA 4LFAL 3GTKH 2JEBI 1LUZA 1D8LA 1C9OA 1VS0A 1KC8C 4DAMA 1VQBA 5M3FH 4DV4L 2HT1A 4JV5L 5M5WH 1HJPA 1IBKL 1G291 3L0OA 2HIVA 1IBML 1KAWA 4UP7A 4LFAQ 4AIMA 3CCQA 2K14A 4YCWA 3ERSX 5GQOA 5GAGC 3J81c 1RL2A 3I2ZA 1IL2A 2HIXA 1JT8A 4DV4Q 1QUQA 4JV5Q 4B3SL 1IBKQ 3L7ZC 3CD6A 3FKIG 4QL5A 1PV4A 1YZ6A 4BBSG 1IBMQ 1AH9A 2K5VA 1HZCA 3U4VA 1VQ6A 4BXXH 2VL6A 1GM5A 3TQYA 4DR5L 2N78A 4HJ8A 2IX1A 3TRZA 1W3SA 3PF4A 1YJ9A 2PI2A 4OX9L 2IHFA 5M5XH 4A3GH 3F8TA 4OO1I 3KYHC 3GTPH 1HZ9A 4IPCA 2NVYH 4DR5Q 5C44G 1A0IA 4DV7L 1H95A 2DGYA 1J6QA 2VNUD 1SRUA 4C3JH 3S1MH 4DV3L 3D0FA 3ER0A 3ULPA 1X3FA 2UUBQ 4DR4L 3DM3A 3H0GH 1PH3A 3CQZH 2NZHA 4DPGA 1XJVA 4K0KL 2BA0A 1CSPA 3PV0A 4DV3Q 2JA7G 2NVQH 2UUAL 4WJ4A 4X64Q 1C7YA 3PGZA 3HOWH 3I4NH 3PIOA 4HIOA 3I4OA 4YWMA 3UDIA 4O2DA 4OO1G 5IYDH 4DV5L 3WWVA 1K73C 1L1OC 5C4XH 4A3KG 2UUAQ 1X3GA 1G51A 1X6OA 4P73A 2JA6G 2AMCB 4EX5A 2EIFA 1V1QA 3ULJA 2I5HA 5C0XJ 4A3MH 2VQEQ 1HR0Q 3HOXH 1ASZA 4DV5Q 2IY5B 4IJHA 1YI2A 5IYBH 3GTMH 4LF8Q 1QVFA 3S1QH 1KRTA 2NVXH 3EBEA 4L5TA 1KL9A 1YIJA 2UXDL 2IT1A 2ZJQA 1PVOA 1EQRA 4OWXB 1PYSB 5FLMH 4EQ5A 1HNZL 1Q82C 4LFCQ 1KRSA 4ALPA 5M5YH 1XMQL 1WJJA 1VQ8A 2WB1G 4R1JA 4GLVB 2JK8A 5IY0A 1K8GA 2BH8A 3T1HL 1UE7A 2JJQA 4IOCA 1NJIC 2YU9H 1BKBA 4R4OA 1JB7A 2OQ0A 2ES2A 1HNZQ 2E2HH 1Q1BA 4QY7A 1XMQQ 1JE5A 1WFQA 5C3EG 3J81j 3IRBA 1EQQA 3GTLH 2R92G 5JJLA 2D0OA 3CXCA 4JYAL 2QGQA 4UP9A 4LUZA 2L15A 2F4VQ 2JA8H 3EIVA 1HNXL 4PG3A 1TWGH 2V1CC 4YWKA 4GLXA 2I0QA 1TWCH 3RLFA 2B63H 4LFBL 2E5LL 3S1NH 1E1TA 3K81C 4GN4B 4YWLA 2NVTH 4JYAQ 2KCMA 2Z0SA 4LF7L 3G71A 4HJ9A 1HNXQ 4JBWA 3J80i 3UE0A 3BU2A 2PQAB 5JEAJ 2E5LQ 1PYBA 4LFBQ 1OXUA 4YY3L 1BBUA 2Z6KC 3K80C 4O0AA 5DLQE 4QGUA 2PQAA 1KD1C 2K75A 2N49A 1FGUA 2NN6I 3FP9A 1EWIA 4YHHL 4LF7Q 4QIWE 2Q2IA 1X65A 1GD7A 3MEFA 2KCTA 4LUOA 1L1OB 4XTCS 4DV0Q 3PF5A 1HR0W 4BBSH 1CSQA 1JJCB 2PNHA 4YY3Q 1AE3A 3S16H 2OTJA 3CPWA 1L1OA 3CCSA 4BBRG 4UPAA 4YHHQ 2R93G 1UE1A 2BA1A 3CCUA 1A63A 1Q1EA 5IE8A 1VQJA 2PI2E 3F1ZA 3W1BA 1YVCA 4JI0L 5C44H 5ELNA 1XPRA 4A3FG 3CF5A 3BZKA 4JG2A 1KQSA 4R4IA 4AQYL 3K8AA 5HGQA 2R7ZG 1HNWL 2KHIA 4DUZL 4IFDI 3S1RH 4X6AH 3KLWA 4JI0Q 2JQOA 3LGJA 5M3MG 3HOYG 1WYDA 4PZ8A 1SMXA 4BY1G 1T9HA 4AQYQ 2GVAA 1HNWQ 1OXXK 2QEXA 3S14H 2YTXA 3PSIA 2B29A 1SN8A 1Z47A 3CC7A 4DUZQ 1ASYA 4KLKA 2JA5G 1PH7A 1S72A 1QVCA 3S15H 4MTNA 5GROA 3PUWA 1Y1VH 4A3DG 4PMWA 1QUQB 2ID0A 4JI8L 1B7YB 3TEHB 4A3KH 4LF4L 2LXJA 1S40A 2KHJA 4A93G 3D31A 4IFDG 4X62L 2YTVA 4B3ML 2A19A 3M4PA 1YNXA 5C0XG 1PFSA 2AHOB 4JI8Q 1OXTA 4GNXC 1R9TH 4LF4Q 4LF9L 1U5KA 1NMFA 2K52A 4X66L 1V9PA 4JCVE 4RMFA 4X62Q 1QVGA 4POFA 1VQOA 1LTLA 1Q7YC 4B3MQ 1FJGL 1PHJA 1EYGA 1YITA 2YV5A 2UUBL 4LF9Q 3M4QA 3RZOH 2Z6KA 1JJ2A 3W5OA 4X66Q 3HOVG 3CMAA 4POGA 3B6YA 1FJGQ 2BH2A 1I94Q 4Y52H 4X64L 2K5NA 1XPOA 4HJ7A 3EN2A 1BVSA 3T1YL 4A3EG 1Y1WG 1G6PA 1VQNA 3CCRA 3OYYA 3PO2H 3M3YH 5C3EH 1QZGA 1E1OA 4HIKA 1TXYA 3GDEA 4C3IH 4DV2Q 1MKHA 1NE3A 4A3IH 1AE2A 2CWPA 2VUMH 4BA1I 3G4SA 3KFUA 2KBNA 4GLAC 3T1YQ 3CAMA 3JC66 1HR0L 1OXVA 1I5FA 2F3IA 3KDFB 2VQEL 1NY4A 4RG1A 1N33L 4LF8L 1VQGA 1QZHA 2Y0SG 1VQAA 2MO0A 3KDFA 3CCJA 5JJIA 4AH6A 5JJKA 3AYHB 1Q8KA 4IPGA 5IP7G 1UEBA 2K5HA 1YHAA 3HOZG 3I7FA 5IP9G 3FHWA 4NXNL 1UWVA 1V43A 4IJLA 1N8RC 3HOUH 2DUDA 1K3RA 4A3JH 1PH8A 1K0RA 4LFCL 1N34L 2E2JH 1C0AA 3E9HA 5IYCH 2ZJPA 1XNQQ 3UDGA 5GADC 2CWAA 2VZAA 1K8AC 4A3BH 3I55A 3KF6B 1IBLL 5M3FG 4NXNQ 1KXLA 3AFPA 4L5SA 3A74A 3HFZB 4R4TA 1CKNA 4GN3B 4BBRH 1N34Q 1VQPA 3KF6A 2AKWB 4LW1A 3I4MH 4DNIA 4WJ3M 4X65Q 3AEVA 4BY7H 4DKAC 1HH2P 4GNXB 1IBLQ 2F4VL 2EQSA 4GS3A 3AFQA 2VS1A 4A3FH 1FL0A 4GNXA 1XNRL 4Y7NH 2VW9A 2WFWA 3DLLA 1TWFH 3PCOB 3RN2A 3STBC 3HKZG 2N3SA
chains in the Genus database with same CATH superfamily
5C44B 3KJPA 1BQQT 3U50C 2NUCA 2OXPA 4JI2L 3NELA 2LKVA 4CGYB 2HD3A 1N9WA 5AFWA 4DV6L 2RSOA 5C4HA 1EWCA 3S14B 4FXKC 1DOMA 3R93A 4A3DH 1WTPA 4JI1L 5AJ3Q 1EY5A 3LWEA 5ISRA 3A7AB 2PYKA 2ASBA 3ONAB 4HN7A 4A3KB 4HIDA 1HUMA 4A4IA 3DEOA 5ELBA 3GD7A 5C4XG 3BDLA 2I5MX 4IUUA 2GVBA 1XPUA 2ICIA 2AQ3B 1TY2A 1ET6A 1STAA 3E0JA 3BDOA 4A3MG 3FRPB 3HOVH 2RHQB 1EUJA 2A68C 2NZ1D 2UXBQ 2CKZB 2LY7A 4IOAA 3MZ5A 1Y1WH 2WACA 5C0XI 3DUZA 3MFGA 1AP0A 5JVG3 4XDXA 3V96A 4DAYA 4DV1Q 4B3RL 1S3OA 1XMOQ 2J0TD 2L1BA 3S17H 4FF1A 4IO9A 3U4ZA 3K7UC 1X3EA 3RMHA 2ZXRA 2JA6H 3DWAA 2CQAA 2CH4A 1MGSA 1GO3E 3I8ZA 4DR7Q 1IZ6A 3W2DA 2NZOA 2FMMA 2Z9HA 5DEHA 3HOUB 1I94L 5DM63 1CHQD 1CTMA 1BOSA 4EQPA 4NB3A 4DV2L 1B70B 3S2HB 1E7ZA 1SROA 1E22A 3NXWA 4GOPC 2F0PA 1FD7D 3RZDH 2G9HD 2R3ZA 2UUCQ 4A3FB 5A2QE 1VQHA 2MFIA 4Y7NB 4H13C 1I6HB 4GKKL 2OTLA 1DM0B 2B3GA 1LT5D 3PIPA 5CV8A 4IUQA 2R7DA 2IL8A 1O7IA 4DNTB 1TWAB 2D62A 3T51B 4XT1B 2HHHQ 2XGTA 2LSSA 1VQCA 1K83B 2Y0SE 4K0KQ 4DNRB 1EOVA 3EVQA 1DJRD 2A68D 3E6ZX 3A5UA 2PMZE 1NR2A 2X6GA 3RLOA 3A56A 1I3QB 1MJCA 3E0EA 4AYBG 4DR4Q 1I50H 1M4VA 1E0BA 4XXEA 5KEEA 1N36L 5LMNL 1PH9A 4R4QA 4JI6Q 1F2LA 5BR8L 2N8NA 1KLUD 3CHBD 3VDYA 5FLXc 4PZ7A 2RCNA 1UE6A 4A93H 2K04A 3NTHA 1KIXA 4DR6L 2IHEA 2HDLA 5C0XH 1X32A 2EOTA 3NP8A 3K6OA 3CP0A 4IPHA 3K7AB 4KTAA 2ZXPA 5CBAE 3PUZA 1J9OA 1DYQA 3MXUA 5HGTA 3M7NA 3MA2B 4UY8C 3OMGA 5CMDA 3J80L 3NQTA 1CA5A 1VF7A 2ICEC 4JW0A 4LMQD 5J39A 5M3FB 3HOUG 1BF4A 1ET9A 1VQIA 2IPKD 1XTCD 4KJOA 3A8JE 1K9MC 1YEZA 4HAEA 5IYCG 2F0MA 3ITPA 4TSSA 1EIHA 4CKBA 1Y8NB 3BYTB 4HR7B 4DUYL 1FR3A 1S5BD 4OONA 1CKMA 3PIO3 3I4MG 1TY0A 2OEOA 2CCZA 1RDPD 3CC4A 4PQXA 3VR5A 1PTOF 1PH6A 1D7QA 1B4OA 4RKLA 3K5LA 5CV4A 2B2TC 5G3LF 2CQOA 3GTPB 4A3LG 3MEHA 2JA8G 4P75A 5LMNW 2F0IA 3H09A 4IQZA 5LHY1 1DGSA 1TIID 1STGA 4LF6Q 1ONLA 1LUZA 1U4LA 4DAMA 1Z7TA 4DV4L 1HQRD 5M5WH 1HJPA 3L0OA 4U673 1F9SA 4AIMA 2BDNA 1FGBD 2K14A 3OSOA 1V1OA 1RL2A 1SJHD 1QB5D 1PZID 4BXXH 2K1BA 4HTHA 2B2WA 4ME5A 2N78A 4XT3B 4L6TB 1RKNA 1G2TA 5EKIA 2PI2A 4A3GH 3KYHC 4YIJA 4CDCC 2GA4B 4DR5Q 1A0IA 4C3HG 5BN4A 2DGYA 1J6QA 4C3JH 3ER0A 2Z1CA 2EXZA 4KN7C 1V8QA 3DM3A 4B9WA 3CQZH 3GV3A 1XJVA 3T16A 1CSPA 2NVQH 3C46A 2UUAL 1AN8A 4ODGA 1K28A 3I91A 3PIOA 3I4OA 3UDIA 4DAVA 5EKLA 5T1IA 1K73C 5CYUA 5C4JB 2J4XA 3AMUA 1X6OA 4KV6A 3Q23A 5C0XJ 3ULJA 4DU9A 1Q3LA 2VQEQ 4DV5Q 3FPUB 5IYBH 4LF8Q 2QCPX 3SHLA 1KRTA 3MWYW 2NVXH 2XNAC 1Y8OB 1TKWB 1KL9A 1YIJA 1H9JA 2IT1A 1PVOA 1EQRA 4OWXB 4HSPA 4EQ5A 5M5YH 1VQ8A 4R1JA 4GLVB 1K8GA 4KN4C 5C5MA 1UE7A 4IOCA 4H44C 1HCZA 1HNZQ 2B2VA 2E2HH 1F77A 1JE5A 2DN8A 5C3EG 4IALA 3IRBA 2SEBD 4RHRA 3GTLH 2D0OA 4K5XA 3CXCA 4C3IG 2JA8H 2Y0SB 3EIVA 2I0QA 1GUSA 4PG3A 1QJOA 5IT9L 1QILA 2G5DA 1MHWC 1E1TA 1DONA 5COYA 1JC7A 3J80i 3UE0A 1MSGA 4LFBQ 3NWTA 5DLQE 3MVVA 1KD1C 2K75A 3FP9A 4UAIA 2KEEA 2K28A 3H6MA 2Q2IA 4LUOA 2JN4A 4XTCS 4ZLTF 3IFTA 3RUZA 1HTLD 3S16H 2PNHA 1HTPA 4BBRG 4UPAA 2R93G 2EZVA 1JQYD 2Z4HA 5IE8A 1R9TB 3J81L 3CF5A 4JG2A 5HGQA 5M5XB 5C3WA 4DUZL 4IFDI 3S1RH 2NVYB 2RA4A 2DNCA 3KLWA 5M3MG 3HOYG 4BY1G 2CHBD 2GVAA 4RKBA 2QEXA 3PSIA 2JA5G 1SN8A 1Z47A 1EU4A 1PH7A 3H0GB 2BOSA 3TMEA 2K5DA 2F0DA 5FKAC 5JVH3 1B7YB 4LF4L 3HOWB 1R4PB 1LT4D 1AZQA 1S40A 2WV6D 1KNEA 3D31A 3KLSX 1EYAA 4X62L 4IFDG 3M4PA 1YNXA 1IL8A 2AHOB 1OXTA 1WD0A 1NMFA 1HQMC 1V9PA 3I4LA 3HOXB 4RMFA 1QVGA 1ZKOA 3K59A 1Q7YC 1T5EA 2F0QA 2L0CA 4WORA 4LF9Q 1U4MA 3RZOH 1JJ2A 3RD4A 4X66Q 3CMAA 3MC0B 4FNFA 1I94Q 3TP5A 3MXNA 1XPOA 2L5TA 1BVSA 3OW7A 4LJZC 5C3EH 4XQQA 1QZGA 1CQVA 2AUKA 5CBEE 3GDEA 4C3IH 1SMYC 4DV2Q 3FMCA 1SNPA 3CAMA 1HR0L 1I5FA 1M8AA 5JPMC 1UUPA 2Y0SG 1HXYD 1RCVD 5CV9A 3I70A 3AYHB 1TU2B 5IP7G 1LV9A 3HOZG 1ILPA 4IJLA 2IWHA 4A3JH 2E2JH 4LFCL 4JK1C 3AU7A 3ZYYX 2A73B 3I55A 4NXNQ 1KXLA 5IGDA 3AFPA 1BBXC 3A74A 1D5XC 3HFZB 4BBRH 4PNYA 1N34Q 4BBSB 1V1PA 2KOLA 1K3BC 1HH2P 2VS1A 3TDQA 1ENCA 1FL0A 1SDFA 1XNRL 2LMCB 3DLLA 3STBC 2N3SA 1SFOH 4Q5VA 5M3MH 3HOYH 2F3WA 3ICEA 3M7GA 1D1KA 4BY1H 1R4QB 4NMZA 1B8AA 2C9OA 2HCIA 3OTOQ 4F88A 2X69A 4GOPA 2PPBC 2OWOA 1IW7C 1F2YA 3S17B 2A1AA 5BR8Q 4IFDH 3S24A 1EY9A 2WAQE 3FKIH 2Q8IB 1IYJB 3H91A 3I4NG 3C1FA 2OCEA 4LUVA 1PA6A 5IYDG 1PXUA 2EJMA 4JVZA 3CRLC 1OXSC 1EFWA 1BNZA 2F52A 1LACA 2IW3A 5KGUA 3HOXG 1PH5A 3NHHA 2BCOA 3G7LA 1A3VA 4OWWB 2C5CA 4E6IA 1P8LA 1CQFA 1SMYD 2WB1B 3GTGH 3CCEA 4ULLA 3BS1A 1VQ9A 5I2YA 2EYHA 3CC2A 2JA7H 4LWCA 2MO1A 1I4HA 2PW5A 1VQEA 1EQTA 4C1NK 2B2YA 4DR2Q 3GTQH 4DUYQ 4B08A 3M4OH 1WCMG 4NPSA 5CGKA 1RTNA 5IP7H 2FFKB 3K58A 5BN3A 5IWAL 2B63G 3VA5A 1OTCA 2EY1A 2RCFA 4KY5A 3UDXA 4HJAA 2JE6I 1JOQA 2EYOA 3MXPA 4TVAB 1EIFA 4JI4Q 3RR5A 1TR5A 2QKIC 5K36G 1YNNC 3NQIA 1CUKA 5CR3A 3NSWA 3STBD 4GZYC 1TWHH 1LT3D 3N52A 4JOIA 2H4OA 4JI7Q 2R92H 5I9PA 1STYA 4MTKA 4NP5A 1Q81C 3VA7A 4X3KA 3PO3G 1B53A 5E7NA 1SBBB 5FOBB 1I50B 1UE5A 1HRJA 5E4XA 3TS0A 1GXDC 1HZBA 3TREA 1MD2D 2VY3A 4ME3A 1IW7D 4IPDA 1GUTA 4I65A 2L9HA 1WTWA 3OOCA 1X9NA 4NXML 3I56A 1LYLA 1CKNB 2ALYB 1E3PA 2G9DA 4DXFA 4A93B 4OELB 1I4PA 1XWEA 4MZ9A 4DR3Q 1N33Q 4KY6A 1Y1VG 3QWNA 4IFDJ 2I5LX 1A62A 4V190 1SYBA 2B2UA 3U58A 4B3TL 4H02A 2R7ZH 4RHSA 1D1IA 2ZM6L 1HFNA 1VQ5A 1L0WA 2UU9L 1FVIA 2O5IC 1B44D 4XIGS 4M1UB 3NEMA 1EEID 2RHSB 3SGIA 1YJWA 1EY4A 2DY8A 3F2CA 3CKIB 2EJGC 1WCMH 4GN5A 5IGFA 2HQLA 3J7A5 5IOCA 3GTJH 3PO2G 1SE4A 3HKSA 4DR1L 5I6WA 4K6LA 1Y69U 4A3IG 2VUMG 5JPNC 3G48A 1WTVA 4MN3A 1B50A 1JWSD 4DK6C 4RCOA 4KHPL 4JI5L 3AB9A 1VQDA 3LWUA 2UXCQ 3NENA 1D2BA 1YNND 1NAPA 3NWSA 1Z9FA 1BCPC 1SYCA 4DAYB 1CK1A 4A3EH 4JI3Q 2KECA 1NTGA 1KDAA 5IGGA 3HRZC 3GTOH 3KOJA 2HQEA 1LM0A 1N32L 3PO3H 3A5ZB 1MIUA 4MNOA 4I7AA 1XYIA 3TS2A 4IUPA 3HKZB 4BY7G 2VQFL 2D0PA 5LMUL 3K0XA 3F2BA 2WAQB 2GN5A 1RD9D 4DF7A 1M1KC 4A3GB 2NN6G 1JICA 2K7VA 1LT6D 1TQOA 4L8JA 2RF4A 2R6GA 2JEBI 2D2CC 1GUWA 4C2MB 2HT1A 5NUCA 4JV5L 2XWBB 1JORA 1G291 3I90A 1IBML 3K5MA 2QDBA 4UP7A 4LFAQ 4C56C 2XVSA 3ERQA 3ERSX 5GQOA 1JT8A 1AW7A 1PTOB 1SJED 1IBKQ 5I2XA 3T4AC 1YZ6A 1AH9A 1OO9B 3GQBA 3KLSA 3TRZA 3PF4A 1TS5A 1O7LA 1QOHA 2NVXB 4IPCA 1F9PA 5C44G 4DV7L 2FJ2A 1H95A 4DV3L 3VR4A 1X3FA 2DNEA 4CBVA 3LX0A 3CU7A 4CJ2C 4DPGA 4MHEA 4CKCA 3GTLB 2F1MA 4HIOA 4YWMA 1TS3A 2PW7A 1CA6A 3WWVA 1L1OC 3BDCA 5C4XH 2WKCA 4A3KG 5FLXL 1X3GA 1KDCA 1G51A 2K03A 2AMCB 2EIFA 1V1QA 1HR0Q 3R2TA 4A3MH 1ASZA 1BCPD 2IY5B 2EYFA 3GTMH 1RTOA 3V05A 3SK4A 2RBMA 4N8FA 2UXDL 2ZJQA 2KHSA 4LFCQ 4G7OC 3D6WA 4ALPA 1XMQL 1KLGD 2JK8A 4JPBW 1F9RA 2JJQA 1NJIC 2OQ0A 1RHPA 4QY7A 2CW0C 1STBA 4JYAL 3URYA 4LUZA 1VF5C 1LTGD 4YWKA 1TWCH 3SDZA 2E5LL 5J22A 2E2IB 3K81C 1EOTA 2NVTH 4ZUJA 1EFID 2KCCA 1H9SA 2Z0SA 5ELEA 4LF7L 2EJFC 1HNXQ 3GTKB 4CJ1B 1PRTB 1E2VA 2PQAB 4YY3L 4O0AA 2Z6KC 5HURA 2F0FA 4QGUA 1S5CD 2PQAA 2DJGC 1QNKA 4QIWE 2JP1A 1X65A 2KCTA 1UAPA 3QJYA 1SE3A 2EY5A 2OTJA 4YHHQ 1UE1A 3O13A 2LFNA 2SDFA 5E1FA 4BS9A 1YVCA 4JI0L 2B39A 1LTSD 2MPMA 2SNSA 2VB2X 1EYCA 2Z8LA 3K5OA 5ELNA 3VYSA 5C44H 4A3FG 1XPRA 4R4IA 4AQYL 3K8AA 1HNWL 5J1ZA 1J8IA 5L37A 3RZOB 1ML0D 4FF4A 2JQOA 3S1MB 4PZ8A 1SMXA 3TBIB 1A2TA 1T9HA 1JOKA 3S14H 4KLKA 5D14A 3D3RA 3S15H 1SNDA 1ZXTA 1S5FD 4RGNA 4PMWA 4MIUA 2ID0A 4A3KH 2F0TA 1QG7A 1B3AA 2LXJA 4CJ0B 1Y8PB 2EE1A 2A19A 3SXHA 3VR3A 4JI8Q 4GNXC 1U5KA 2F0JA 1HA5A 3QIAA 3D4WA 4XQNA 5BN5A 4POFA 4B3MQ 1GHJA 5FO7B 1PHJA 4A3JB 3S1QB 1EYGA 2E2JB 1YITA 2UUBL 3M4QA 4DK0A 1KAAA 1SXTA 4NW2A 1FJGQ 2BH2A 5LL6S 3SK5A 2CW0D 3EROA 5ELFA 3T13A 3TP6A 1YNJC 5CORA 3CCRA 3OYYA 4DAPA 2B8GA 2YU9B 5LL6X 1EIGA 1MKHA 1A3UA 2Q8RE 3G4SA 3D6CA 3T1YQ 3WOEA 1WD1A 4IURA 1OXVA 2R61A 4I7ZC 1SAPA 1QZHA 2MO0A 5JJKA 3J80E 5FO8B 3BG3A 1YHAA 2N88A 3I7FA 3R2IA 3C1EA 3HOUH 1N8RC 4RFBA 2DUDA 1K3RA 1ZYRC 1PH8A 5IGBA 5IYCH 5GADC 4FVMA 1IYUA 1JR0D 3I73A 3KF6B 5M3FG 1IBLL 1UNSA 4L5SA 1MBYA 3FKIB 4G7ZC 3KF6A 5ELDA 1PRTF 3I4MH 3U9OA 3DEPA 2F4VL 3AFQA 4A3FH 2F0OA 2KVMA 4QUFA 4Y7NH 4P2CB 4A3LH 1JMCA 2K01A 2XSCA 1VQKA 1SNQA 1ZEQX 2JA9A 2WB1E 2P5ZX 2UU9Q 1I6VC 3GTGB 3L2PA 5FK9C 3WOFA 3TSSA 2PQEA 3EA6A 4L5RC 4QJFA 2JA7B 4DV0L 5EAYA 1AZPA 4JI2Q 4RWSC 4TKOB 3JAML 1LTAD 1TWAH 1O80A 4K8JA 4DV6Q 3GTQB 1C48A 1CFMA 5KNCA 4JI1Q 1PFBA 1PTOC 4TRDA 4PMBA 1Q12A 1HUNA 2UXBL 3E9IA 3F2DA 2RKSA 1NNXA 2JSOA 2MNAA 4K8IA 3EJIA 4C3HH 1GKHA 1CKOA 1IXRA 3C2PA 4RCNA 1YNJD 3KBXA 4DV1L 1ILQA 1X3QA 1X56A 5KNBA 4KD4A 1G6ZA 4PMCA 5ELOA 3H3VI 1Y14B 2MGSA 4P74A 3VYTA 4F8MA 2A69C 1P16A 3BJUA 4OXPA 5IT9c 2R92B 1KTKA 4KI0A 1CHPD 4QIWB 4B3RQ 4QB4A 2QF7A 5C6AA 3QO2A 3GV6A 1WOCA 2YTYA 3K7AH 3KLRA 4FDBA 1ZYRD 2CFMA 2VQFQ 1KHIA 5LMUQ 1LTRD 3MTSA 2EDGA 2MP1A 4FO2A 5EPKA 1JWMD 1HA6A 4K5VA 3KBGA 1VQLA 2EPBA 2XTIA 4K5WA 4CDDC 4C1NI 1HZAA 4A3BB 3MXNB 3FDTA 3OPOA 3CPFA 2UUCL 1M90C 3NTKA 2K50A 2DY7A 3DWPA 4IUTA 3MHBA 3EQLC 1A2UA 3BZCA 3ND9A 2F0KA 1KABA 3P20A 4KHZA 3PUVA 2R7ZB 5IT9E 1YHBA 2ZT9C 3ULLA 1Q8IA 2D5DA 1U0LA 4CDEC 4O42A 2M9VA 2YYZA 3BVGA 3TP8A 4HJ5A 5EBDA 4DK1A 2CVRA 1YBYA 2IX3A 2HHHL 4DV7Q 2EYLA 3UDFA 1MJEA 1A8VA 4A76A 5FJ8G 1JWUD 1W6JA 3MXGA 1PTOD 4A3DB 3G6EA 2FXQA 4GKKQ 4X65L 3A8KE 1SE8A 1V1PB 2A5HA 5DM73 3DM1A 5G3LD 2ZJRA 2R93H 4LF5L 2KA7A 5CC4A 1EY7A 2PZUA 4J15A 2QEJC 3RNUA 1H9MA 2NTSA 2RSNA 3A55A 1NUCA 4RGOS 5D65A 1XTDA 5IIFA 2KENA 1LABA 1G8ZD 3K0YA 2MQHA 4JI6L 1E2ZA 3DXJC 3KF8B 5DAUA 2MJ8A 1QWYA 1TVXA 3SEBA 3S2DH 4ZYSA 2A69D 3HOVB 1JJGA 3KF8A 1I4QA 1W2BA 1WTRA 1Y1WB 4A3EB 2JA5H 4XYOA 1O78A 3Q24A 4GOPB 3GTOB 5C3XA 3JAMi 2UXDQ 2EXDA 1LTID 1SLJA 3A7LA 4RAUC 1N36Q 2CH4W 5LMNQ 2AWNA 1PH1A 3HKZE 2KEDA 3H0GG 4J1MA 4AYBE 1EZ8A 1NSNS 5FO9B 1J5EL 5C4JH 3HOWG 1WI5A 1RJTA 2JA6B 3H3VH 1SNCA 3ZJYC 2C35B 2R7FA 1RIPA 2B2WC 1JB3A 2XN9C 3CCVA 1EZ6A 4DR6Q 1EEFD 2I46A 1BBWA 3J81i 2F0NA 4DFAA 5KYLA 4ZAIA 1B3QA 2N55A 4HIMA 1JOOA 4YCVA 4FP5D 4DK3C 2F0LA 4A3BG 2Q2TA 3L3OC 1K8OA 2AQ2B 1WTHA 4HCEA 1PH4A 2L12A 5KYIA 3RZDB 1BO0A 4GKJL 1EQVA 3UE1A 1I4GA 4N9TA 4YCUA 4LF6L 1L2FA 4HEDA 1VQFA 1YJNA 2KUMA 3HOZH 1EU3A 4RGTA 1VQ7A 2J7ZA 3W3AA 1X54A 3H3VC 2SNMA 5FJ8H 1O7YA 1D8LA 1C9OA 1VS0A 4CHTB 1VQBA 2A6HC 1PMRA 1K8MA 1KAWA 2HUGA 3CCQA 1SSOA 5GAGC 2HIXA 3S9WA 4DV4Q 2RDFA 1QUQA 4B3SL 2RVLA 3L7ZC 1A6XA 4QL5A 4BBSG 5C4XB 3OIQA 1SNOA 2B2VC 3U4VA 2VL6A 4DR5L 5D3IB 4LAAA 4HJ8A 3VYUA 4A3MB 5I9OA 1W3SA 4BWGB 2K32A 1YJ9A 3DMUA 3GTMB 4OX9L 1STHA 5M5XH 3F8TA 4OO1I 1LTBD 3CRKC 1HZ9A 2NVYH 2LS01 3E3XA 4HSVA 2VNUD 1SRUA 2D9UA 4KKSA 3ULPA 2UUBQ 2L4NA 4XQJA 3H0GH 1MSHA 1PH3A 2NZHA 3PV0A 2TSSA 4WJ4A 2IJ0A 3HOWH 1RODA 3PGZA 2WINB 3I4NH 1QNUA 4FXGC 4CKEA 4OO1G 5IYDH 2B8FA 4DV5L 1ESRA 2UUAQ 1XXGA 2B2TA 5E4WC 2JA6G 2NTTA 2SOBA 4O1NA 1BXTA 3HOXH 4IJHA 4RA8A 1QVFA 4DGZA 1X3PA 1I4RA 3SVMA 5KIXA 1EY0A 4OIJA 4L5TA 4EQOA 1IKLA 1CT1D 1AFPA 5JJZA 2ENBA 3LNNA 2PZTA 1HNZL 1KRSA 1IHZA 1LLRD 1EY8A 2WB1G 2AQ1B 5IY0A 4G7HC 2BH8A 3T1HL 2Z4IA 4R4OA 2E76C 2ES2A 3J7AV 2H1EA 1WFQA 3J81j 1S4ZA 5JJLA 2L15A 1I4XA 2F4VQ 4OEMB 5A2QL 1TWGH 2B63H 1F9QA 3RLFA 4LFBL 3S1NH 2O2LD 2A6HD 5TSSA 1L0XB 3N6RA 4ILWA 4HJ9A 4WRDA 2F4IA 1PYBA 1SYFA 1OXUA 1BBUA 3MAQA 5K36H 1T5XD 3IKJA 5M5WB 1PFNA 1FGUA 2NN6I 3S15B 1S5DD 3M3YH 4DV0Q 4BBSH 3PF5A 3D4DA 1U9RA 1Z6HA 1AE3A 2NBFA 3CPWA 2NB0A 4RGMA 1DD2A 1Q1EA 2WKDA 2PI2E 4IUNA 3J7YW 4AYBB 2I07B 3FVQA 3BZKA 1KQSA 4X3TA 2KHIA 4S3SA 3PIP3 3LGJA 1LO5D 1WYDA 3KK7A 4C3JB 3QOJA 2K5WA 2AUJD 1OXXK 4KHVA 2YTXA 4H7BA 2B29A 4DUZQ 1ASYA 1GUOA 3A8IE 3CQZB 1K0SA 3TZUA 4OO1H 3DHQA 2F0GA 3Q6SA 3BVMA 4MTNA 3PUWA 1Y1VH 2NVQB 3I3CA 4ZQ3A 3NE5B 4A93G 4QMGA 2NYZD 2YTVA 5C0XG 4LF4Q 4LF9L 2RQXA 4X66L 4JCVE 4X62Q 1LTLA 1HHVA 1DXMA 3TP7A 5K5PA 1STNA 2RDGA 4X3UA 2MUYA 3W5OA 5CV5A 3PMFA 1XX8A 1A15A 2K5NA 1FYCA 4X64L 3K57A 4HJ7A 5M5YB 3I4MB 3PO2H 1E1OA 4K6DA 1TXYA 5M9OA 1PYWD 5IODA 4A3IH 1NE3A 3KFUA 2VUMH 4BA1I 2E2HB 2KBNA 3VYRA 4CDFC 3JC66 5D3DA 2F3IA 4NDXA 3KDFB 1NY4A 4ZKBB 3I72A 2JA8B 3V2TA 3IL8A 2DJFC 3KDFA 3CCJA 4AH6A 1Q8KA 1JCKB 5EQ0A 3SK8A 1UEBA 2K5HA 5IP9G 3FHWA 4NXNL 2XRSD 1UWVA 3NBIA 1K0RA 1N34L 3Q0AA 1C0AA 3HEJA 5IGCA 3E9HA 4UDUC 3UDGA 4F7XA 2VZAA 4PV1C 1K8AC 4H0LC 4QF4A 4R4TA 1CM9A 2Z6BA 4GN3B 1VQPA 3S16B 4X65Q 3AEVA 5JAVA 3NTIA 2EVBA 4ZCKA 1C8CA 4BY7H 4DKAC 1QCBD 4L63B 2EQSA 4GS3A 2A6EC 3T53B 2B2YC 1UEAB 4LF5Q 1TWFH 4BXXG 3HKZG 2NN6H 2HDMA 4C3HB 3DWQA 2BE5C 3OTOL 2WAQG 3J7ZC 1STEA 3D8GA 4L5QA 4B9XA 4EGVA 1H9SB 1XNRQ 4A3GG 3S1RB 1E24A 3TZDA 3AQQA 2FMCA 2BDOA 4K2KA 4C3JG 3TN2A 1HPCA 4LNQA 2E2DC 4K14A 1BR9A 1VCIA 4JBMA 3QOLA 3H15A 3HP3A 4JOIC 3A54A 2H5XA 3M9BA 3K5NA 4PZ6A 1B2TA 3CW2C 1S5ED 2QA4A 1J5EQ 1F2ZA 4JC0A 5IYBG 5EBCA 5KNDA 3RLNA 4G57A 3KUPA 2MHVA 1MI2A 4KY7A 3NBHB 2PO4A 4OWTB 4DR2L 2XIWA 3UI2A 3NBHA 3X3MA 2K4KA 5C3EB 4X3SA 3PQIA 4C3IB 5CV6A 4FF2A 5FLXE 2IX0A 3J80c 2B2UC 2EY6A 1TS4A 2F0UA 5IP9H 4GKJQ 4P72A 4JI4L 3HG9A 1NR4A 3QR8A 4FXDA 2XWJB 2Q2HA 3OW2A 1LTTD 5IWAQ 1B9MA 3GP7A 3PUXA 4JI7L 4DN4M 2A6ED 2K5QA 4BBRB 2R93B 4Z9CB 3NPPA 2FHTA 2WIIB 5ELCA 2BE5D 3WDNA 2ZTEA 3RN5A 2Q8TA 1D6EC 3VR6A 4B3SQ 3GO5A 1X55A 2F0VA 3BVZA 1CZGA 3MFYA 4UP8A 4A3CG 1SFOB 4P71A 3CCLA 5M3MB 3S2DB 3SK6A 3HOYB 2X6LA 4BY1B 1O7ZA 4R4CA 2JYOA 4NKLA 4KMUC 1XNQL 4OX9Q 3A0JA 2JA5B 1Q46A 5JEAG 2ZTCA 2OQKA 4C2MH 2LXKA 2ZTDA 3T56B 4DR3L 4Q0FA 1AEXA 2AWOA 1N33L 1PH2A 3Q22A 1KDBA 4FF3A 1TT2A 5H1SE 1DCZA 3CMEA 4R8IA 3S2HH 1PTOH 3BYYB 3OWFA 4ZUIA 4NXMQ 1VMPA 2V4DA 4J8QA 1F2MA 4OHJA 2HCCA 1VQMA 1SNMA 5IGEA 1I6HH 4B3TQ 4TQUS 1VQ4A 4JBKA 1D5ZC 1CZWA 2ZM6Q 5AJ3L 4KJNA 4QQBX 1NMGA 2PZWA 4KD3A 5EPLA 3CCMA 2A8VA 2XRQD 3KJOA 5GAHC 1FNVA 1GHKA 3IFDA 4N8X1 2M2LA 5EPJA 4BA2I 2F0SA 2NWGA 1K83H 3T1HQ 3M4OB 5KRUA 2A74C 1DOKA 3M85A 2UXCL 1EIYB 4KKUA 4APVA 2WP8J 3HOZB 5J3BA 4DR1Q 1TS2A 3H94A 4JBJA 2PMZB 2Q2UA 2QDLA 5HY6A 1I3QH 4JI3L 4A75A 1WTQA 1VMCA 4KHPQ 4A3JG 4JI5Q 2JEAI 5C4ZA 1EL0A 2VB3X 2ZXOA 1XMOL 3W1GA 3PUYA 2VXWA 1YHQA 5FLMG 1HFGA 1TWHB 1Q86C 2E75C 1NBWA 4A3CH 1GVPA 2K33A 2E8GA 5GAEC 1SYGA 4DR7L 4QUCA 1N32Q 4ID6A 1U4RA 1SEBD 1SR3A 3JAMc 4FYDA 3P1HA 4N9PA 1H9RA 2E2IH 3F2UA 3Q8DA 5JEAH 1ENFA 2KCNA 1G91A 3GTKH 4LFAL 3P7JA 4ZKCB 1KC8C 5M3FH 3M4YA 1IBKL 2TMPA 3HGBA 2HIVA 1ENAA 1KNAA 4YCWA 3X3NA 3I4NB 3J81c 3I2ZA 1IL2A 4JV5Q 2L55A 1PDQA 4U68A 3CD6A 5E3FA 3FKIG 1EWHA 1PV4A 4KK7A 1IBMQ 2K5VA 1HZCA 1VQ6A 1JE4A 1GM5A 4ZRZA 3TQYA 2E74C 2IX1A 4DA2A 3G6JB 5EKKA 2O5JC 4G4KA 2IHFA 3EFXD 1EY6A 2EY2A 4DXGA 3GTPH 1BCPB 1PZKD 4R8NA 4OL7A 1RF2D 3C3LA 3S1MH 3D0FA 3JAME 4V0BA 1B1ZA 4RH6A 2KJXA 2QILA 1DOLA 4K0KL 1PRTC 2BA0A 2JA7G 5T1GA 4DV3Q 1WCMB 3HS0C 4X64Q 1C7YA 3GTJB 4LK1C 4HMIA 4O2DA 3OWEB 1L0YB 2K05A 1TWGB 4ABNA 2B63B 1CI3M 3J81E 3S1NB 3FPPA 4P73A 4EX5A 4DR4L 2I5HA 1YI2A 4OIKA 3S1QH 2M00A 3EBEA 1FNWA 3QG1A 1VDZA 1WVLA 5FLMH 1PYSB 5EGTA 1ICWA 1Q82C 3M3YB 3VR2A 1WJJA 2PCFB 2JXMB 3L9AX 2YU9H 1BKBA 1JB7A 1FNUA 3P75A 3PO3B 3OMCA 3QB3A 1Q1BA 1XMQQ 1BUVT 1EQQA 2R92G 1SYEA 5I6YA 2EYMA 2QGQA 4UP9A 1SYDA 1HNXL 2V1CC 4GLXA 4GN4B 4YWLA 4JYAQ 1GOZA 2KCMA 1G2SA 3G71A 4JBWA 5EJWA 3BU2A 5JEAJ 4IZ8A 2E5LQ 1IYVA 3K80C 3FEWX 2OF1A 4UHVA 2N49A 4YHHL 1EWIA 4LF7Q 4XYQA 3MEFA 1Y1VB 1GD7A 3D4RA 2ATWA 4F87A 1L1OB 1BDOA 1HR0W 1PZJD 2F0WA 1CSQA 1JJCB 3HZXA 4HCSA 4YY3Q 1L1OA 3CCSA 1D5MC 2BA1A 3BZDB 3CCUA 2EYPA 4IUVA 1SE2A 1A63A 1VQJA 3F1ZA 1PFMA 3SE0A 3W1BA 4WFN3 1U4PA 4EQNA 2R7ZG 2QW7A 1B9NA 5DNFA 5CV7A 1WTOA 2RDHA 1PRTD 4R9WA 4X6AH 4JI0Q 1Q90A 4AQYQ 3IAYA 2O4XA 1HNWQ 1II3A 4QCLA 3CC7A 1BCPF 3PO2B 1S72A 4EVOA 1QVCA 5F2DA 1A3TA 1GUNA 5GROA 4A3IB 4A3DG 2VUMB 1QUQB 1ESFA 4JI8L 3TEHB 5JOBA 3NK9A 1ICFB 2KHJA 1GJXA 4IN3A 3U9SA 3NUCA 4B3ML 1PFSA 2K6AA 1R9TH 4ZK9B 2K52A 1FJGL 2F0HA 1VQOA 1H9KA 2YV5A 4M8AA 3J7AF 2Z6KA 2EYJA 3SR1A 3HOVG 1WTXA 4POGA 3B6YA 3OHXC 4Y52H 4K2LA 1G6PA 3EN2A 3T1YL 1EYDA 4A3EG 3OIPA 1Y1WG 1VQNA 4BY7B 4HIKA 1W6KA 1NCVA 5A35A 1AE2A 2CWPA 1DZ1A 4GLAC 1E2WA 1PLFA 1TWFB 2VQEL 1GUGA 3R3OA 4RG1A 4LF8L 5I4DA 1VQGA 2F3VA 1IKMA 1VQAA 5JJIA 1TWCB 4HMJA 4IPGA 2F0EA 2NVTB 1V43A 1C4QA 3E5SA 2OT2A 4OGQC 2ZJPA 1XNQQ 4A3BH 2CWAA 1QE6A 4KKTA 3ND8A 1CKNA 2FINB 4LW1A 2AKWB 4J6HA 4DNIA 2F03A 4WJ3M 2PNRC 3R8BA 2L11A 4GNXB 1IBLQ 4WJWA 5C5LA 4GNXA 2VW9A 2WFWA 3PCOB 3RN2A 2KQ3A
chains in the Genus database with same CATH topology
1JMCA 1SFOH 3KJPA 3OTOL 1VQKA 2WAQG 5M3MH 3U50C 3J7ZC 3HOYH 3ICEA 4L5QA 4JI2L 4BY1H 3NELA 1XNRQ 4A3GG 1E24A 2JA9A 2WB1E 1B8AA 2UU9Q 1N9WA 3AQQA 3OTOQ 3L2PA 4DV6L 4L5RC 4QJFA 4DV0L 5EAYA 4JI2Q 4GOPA 4A3DH 4JI1L 5AJ3Q 4LNQA 1TWAH 2OWOA 4DV6Q 2A1AA 5BR8Q 3S24A 2WAQE 2ASBA 3FKIH 1VCIA 4A3LH 1IYJB 4JBMA 4HIDA 4JI1Q 3H15A 3I4NG 4JOIC 1Q12A 4A4IA 2OCEA 4LUVA 2H5XA 1PA6A 5IYDG 3M9BA 4BXXG 3GD7A 2UXBL 5C4XG 1OXSC 2I5MX 4PZ6A 3CW2C 3E9IA 3F2DA 2QA4A 1J5EQ 2GVBA 1EFWA 1XPUA 2MNAA 2F52A 4JC0A 4C3HH 1GKHA 1CKOA 1IXRA 4A3MG 3HOXG 1PH5A 3HOVH 2RHQB 1EUJA 5IYBG 4DV1L 2UXBQ 3RLNA 2CKZB 1X56A 4OWWB 4IOAA 1P8LA 1Y1WH 5C0XI 3GTGH 3CCEA 3NBHB 1VQ9A 4OWTB 5ELOA 4DR2L 3H3VI 1Y14B 3CC2A 2JA7H 4LWCA 4DV1Q 2MO1A 4P74A 4B3RL 1P16A 3BJUA 1VQEA 1S3OA 2K4KA 4OXPA 5IT9c 1XMOQ 3S17H 4KI0A 4IO9A 3U4ZA 4DUYQ 4DR2Q 3GTQH 3M4OH 1WCMG 3K7UC 4NPSA 4B3RQ 1X3EA 2IX0A 3J80c 3K7AH 1WOCA 2YTYA 4FDBA 2JA6H 5IP7H 2CFMA 4GKJQ 5IP9H 2VQFQ 1KHIA 4P72A 5LMUQ 4JI4L 1GO3E 5IWAL 2B63G 4DR7Q 1IZ6A 1OTCA 2NZOA 3UDXA 4HJAA 2Q2HA 1VQLA 1I94L 3OW2A 2JE6I 4TVAB 2XTIA 1EIFA 4JI4Q 5IWAQ 3RR5A 1HZAA 3PUXA 4JI7L 3MXNB 4NB3A 5K36G 4DV2L 1B70B 3CPFA 1E7ZA 1CUKA 1SROA 2UUCL 1E22A 3STBD 1M90C 4GOPC 2K50A 1TWHH 4JOIA 4JI7Q 2R92H 3RZDH 2ZTEA 3RN5A 3BZCA 4KHZA 2UUCQ 1Q81C 3PUVA 1VQHA 4B3SQ 3PO3G 2MFIA 1X55A 1YHBA 3GO5A 4UP8A 3ULLA 4A3CG 5E7NA 4P71A 1U0LA 3CCLA 1UE5A 3TS0A 1HZBA 4R4CA 3TREA 1XNQL 2VY3A 2YYZA 4ME3A 4GKKL 4HJ5A 4OX9Q 3A0JA 2OTLA 4IPDA 1Q46A 1YBYA 5JEAG 2B3GA 2ZTCA 2HHHL 4DV7Q 3UDFA 3PIPA 2OQKA 1MJEA 4C2MH 1A8VA 2LXKA 2ZTDA 5FJ8G 4A76A 4DR3L 2AWOA 2R7DA 1X9NA 3I56A 4NXML 1PH2A 1LYLA 1O7IA 2FXQA 3G6EA 1CKNB 4X65L 4GKKQ 2ALYB 1E3PA 1SE8A 2D62A 5H1SE 3CMEA 2HHHQ 3S2HH 2ZJRA 2XGTA 2LSSA 4MZ9A 4DR3Q 1VQCA 1N33Q 2Y0SE 4NXMQ 4K0KQ 2R93H 1Y1VG 4LF5L 1EOVA 4IFDJ 2I5LX 1A62A 2ATWA 3U58A 4B3TL 4H02A 4J15A 3A5UA 3RNUA 2PMZE 2R7ZH 1XTDA 3RLOA 2ZM6L 2KENA 1VQMA 1VQ5A 1MJCA 3E0EA 1L0WA 2UU9L 1FVIA 2MQHA 4JI6L 4AYBG 3KF8B 1I6HH 4LF5Q 4B3TQ 3S2DH 4TQUS 1I50H 1VQ4A 4JBKA 4DR4Q 4XIGS 1JJGA 2ZM6Q 1W2BA 5AJ3L 1N36L 5LMNL 3NEMA 2RHSB 3SGIA 1PH9A 2JA5H 4QQBX 4R4QA 4GOPB 1NMGA 1YJWA 4JI6Q 3CCMA 5BR8L 2A8VA 3F2CA 3JAMi 2N8NA 2UXDQ 2EXDA 3KJOA 3VDYA 1SLJA 5GAHC 5FLXc 1WCMH 4GN5A 3J7A5 2HQLA 1N36Q 5LMNQ 2AWNA 2RCNA 4PZ7A 3HKZE 1PH1A 3GTJH 3PO2G 1UE6A 4A93H 3H0GG 3HKSA 4AYBE 4DR1L 1KIXA 4BA2I 4DR6L 1K83H 2IHEA 3T1HQ 4A3IG 1J5EL 2VUMG 3G48A 5C4JH 3M85A 3HOWG 2UXCL 1EIYB 3CP0A 4IPHA 1WI5A 3H3VH 4APVA 2WP8J 2C35B 2R7FA 3PUZA 1RIPA 5J3BA 3ZJYC 4DR1Q 4DK6C 3CCVA 4DR6Q 4KHPL 4JI5L 4JBJA 3M7NA 1BBWA 2Q2UA 1VQDA 3J81i 5HY6A 4UY8C 2UXCQ 1I3QH 3NENA 4JI3L 4A75A 3HOUG 1Z9FA 1VQIA 4KHPQ 4A3JG 4JI5Q 4HIMA 2JEAI 4YCVA 1K9MC 1YEZA 4DAYB 3W1GA 5IYCG 4A3EH 4DK3C 1NTGA 1XMOL 4JI3Q 4A3BG 2Q2TA 3PUYA 1YHQA 3GTOH 3KOJA 4DUYL 5FLMG 4OONA 1LM0A 1CKMA 1N32L 1Q86C 3PO3H 3A5ZB 1MIUA 1NBWA 4MNOA 1PH4A 3I4MG 3TS2A 4A3CH 4BY7G 4GKJL 3UE1A 2VQFL 2CCZA 1GVPA 3CC4A 2D0PA 2E8GA 5LMUL 4YCUA 3K0XA 3F2BA 1PH6A 1D7QA 5GAEC 4LF6L 1L2FA 2GN5A 4DR7L 1N32Q 1M1KC 1VQFA 1SR3A 3JAMc 1YJNA 2E2IH 2NN6G 2CQOA 3HOZH 1VQ7A 4A3LG 3Q8DA 2JA8G 1X54A 4P75A 5LMNW 5FJ8H 4LF6Q 2RF4A 1DGSA 2R6GA 4LFAL 3GTKH 2JEBI 1LUZA 1D8LA 1C9OA 1VS0A 1KC8C 4DAMA 1VQBA 5M3FH 4DV4L 2HT1A 4JV5L 5M5WH 1HJPA 1IBKL 1G291 3L0OA 2HIVA 1IBML 1KAWA 4UP7A 4LFAQ 4AIMA 3CCQA 2K14A 4YCWA 3ERSX 5GQOA 5GAGC 3J81c 1RL2A 3I2ZA 1IL2A 2HIXA 1JT8A 4DV4Q 1QUQA 4JV5Q 4B3SL 1IBKQ 3L7ZC 3CD6A 3FKIG 4QL5A 1PV4A 1YZ6A 4BBSG 1IBMQ 1AH9A 2K5VA 1HZCA 3U4VA 1VQ6A 4BXXH 2VL6A 1GM5A 3TQYA 4DR5L 2N78A 4HJ8A 2IX1A 3TRZA 1W3SA 3PF4A 1YJ9A 2PI2A 4OX9L 2IHFA 5M5XH 4A3GH 3F8TA 4OO1I 3KYHC 3GTPH 1HZ9A 4IPCA 2NVYH 4DR5Q 5C44G 1A0IA 4DV7L 1H95A 2DGYA 1J6QA 2VNUD 1SRUA 4C3JH 3S1MH 4DV3L 3D0FA 3ER0A 3ULPA 1X3FA 2UUBQ 4DR4L 3DM3A 3H0GH 1PH3A 3CQZH 2NZHA 4DPGA 1XJVA 4K0KL 2BA0A 1CSPA 3PV0A 4DV3Q 2JA7G 2NVQH 2UUAL 4WJ4A 4X64Q 1C7YA 3PGZA 3HOWH 3I4NH 3PIOA 4HIOA 3I4OA 4YWMA 3UDIA 4O2DA 4OO1G 5IYDH 4DV5L 3WWVA 1K73C 1L1OC 5C4XH 4A3KG 2UUAQ 1X3GA 1G51A 1X6OA 4P73A 2JA6G 2AMCB 4EX5A 2EIFA 1V1QA 3ULJA 2I5HA 5C0XJ 4A3MH 2VQEQ 1HR0Q 3HOXH 1ASZA 4DV5Q 2IY5B 4IJHA 1YI2A 5IYBH 3GTMH 4LF8Q 1QVFA 3S1QH 1KRTA 2NVXH 3EBEA 4L5TA 1KL9A 1YIJA 2UXDL 2IT1A 2ZJQA 1PVOA 1EQRA 4OWXB 1PYSB 5FLMH 4EQ5A 1HNZL 1Q82C 4LFCQ 1KRSA 4ALPA 5M5YH 1XMQL 1WJJA 1VQ8A 2WB1G 4R1JA 4GLVB 2JK8A 5IY0A 1K8GA 2BH8A 3T1HL 1UE7A 2JJQA 4IOCA 1NJIC 2YU9H 1BKBA 4R4OA 1JB7A 2OQ0A 2ES2A 1HNZQ 2E2HH 1Q1BA 4QY7A 1XMQQ 1JE5A 1WFQA 5C3EG 3J81j 3IRBA 1EQQA 3GTLH 2R92G 5JJLA 2D0OA 3CXCA 4JYAL 2QGQA 4UP9A 4LUZA 2L15A 2F4VQ 2JA8H 3EIVA 1HNXL 4PG3A 1TWGH 2V1CC 4YWKA 4GLXA 2I0QA 1TWCH 3RLFA 2B63H 4LFBL 2E5LL 3S1NH 1E1TA 3K81C 4GN4B 4YWLA 2NVTH 4JYAQ 2KCMA 2Z0SA 4LF7L 3G71A 4HJ9A 1HNXQ 4JBWA 3J80i 3UE0A 3BU2A 2PQAB 5JEAJ 2E5LQ 1PYBA 4LFBQ 1OXUA 4YY3L 1BBUA 2Z6KC 3K80C 4O0AA 5DLQE 4QGUA 2PQAA 1KD1C 2K75A 2N49A 1FGUA 2NN6I 3FP9A 1EWIA 4YHHL 4LF7Q 4QIWE 2Q2IA 1X65A 1GD7A 3MEFA 2KCTA 4LUOA 1L1OB 4XTCS 4DV0Q 3PF5A 1HR0W 4BBSH 1CSQA 1JJCB 2PNHA 4YY3Q 1AE3A 3S16H 2OTJA 3CPWA 1L1OA 3CCSA 4BBRG 4UPAA 4YHHQ 2R93G 1UE1A 2BA1A 3CCUA 1A63A 1Q1EA 5IE8A 1VQJA 2PI2E 3F1ZA 3W1BA 1YVCA 4JI0L 5C44H 5ELNA 1XPRA 4A3FG 3CF5A 3BZKA 4JG2A 1KQSA 4R4IA 4AQYL 3K8AA 5HGQA 2R7ZG 1HNWL 2KHIA 4DUZL 4IFDI 3S1RH 4X6AH 3KLWA 4JI0Q 2JQOA 3LGJA 5M3MG 3HOYG 1WYDA 4PZ8A 1SMXA 4BY1G 1T9HA 4AQYQ 2GVAA 1HNWQ 1OXXK 2QEXA 3S14H 2YTXA 3PSIA 2B29A 1SN8A 1Z47A 3CC7A 4DUZQ 1ASYA 4KLKA 2JA5G 1PH7A 1S72A 1QVCA 3S15H 4MTNA 5GROA 3PUWA 1Y1VH 4A3DG 4PMWA 1QUQB 2ID0A 4JI8L 1B7YB 3TEHB 4A3KH 4LF4L 2LXJA 1S40A 2KHJA 4A93G 3D31A 4IFDG 4X62L 2YTVA 4B3ML 2A19A 3M4PA 1YNXA 5C0XG 1PFSA 2AHOB 4JI8Q 1OXTA 4GNXC 1R9TH 4LF4Q 4LF9L 1U5KA 1NMFA 2K52A 4X66L 1V9PA 4JCVE 4RMFA 4X62Q 1QVGA 4POFA 1VQOA 1LTLA 1Q7YC 4B3MQ 1FJGL 1PHJA 1EYGA 1YITA 2YV5A 2UUBL 4LF9Q 3M4QA 3RZOH 2Z6KA 1JJ2A 3W5OA 4X66Q 3HOVG 3CMAA 4POGA 3B6YA 1FJGQ 2BH2A 1I94Q 4Y52H 4X64L 2K5NA 1XPOA 4HJ7A 3EN2A 1BVSA 3T1YL 4A3EG 1Y1WG 1G6PA 1VQNA 3CCRA 3OYYA 3PO2H 3M3YH 5C3EH 1QZGA 1E1OA 4HIKA 1TXYA 3GDEA 4C3IH 4DV2Q 1MKHA 1NE3A 4A3IH 1AE2A 2CWPA 2VUMH 4BA1I 3G4SA 3KFUA 2KBNA 4GLAC 3T1YQ 3CAMA 3JC66 1HR0L 1OXVA 1I5FA 2F3IA 3KDFB 2VQEL 1NY4A 4RG1A 1N33L 4LF8L 1VQGA 1QZHA 2Y0SG 1VQAA 2MO0A 3KDFA 3CCJA 5JJIA 4AH6A 5JJKA 3AYHB 1Q8KA 4IPGA 5IP7G 1UEBA 2K5HA 1YHAA 3HOZG 3I7FA 5IP9G 3FHWA 4NXNL 1UWVA 1V43A 4IJLA 1N8RC 3HOUH 2DUDA 1K3RA 4A3JH 1PH8A 1K0RA 4LFCL 1N34L 2E2JH 1C0AA 3E9HA 5IYCH 2ZJPA 1XNQQ 3UDGA 5GADC 2CWAA 2VZAA 1K8AC 4A3BH 3I55A 3KF6B 1IBLL 5M3FG 4NXNQ 1KXLA 3AFPA 4L5SA 3A74A 3HFZB 4R4TA 1CKNA 4GN3B 4BBRH 1N34Q 1VQPA 3KF6A 2AKWB 4LW1A 3I4MH 4DNIA 4WJ3M 4X65Q 3AEVA 4BY7H 4DKAC 1HH2P 4GNXB 1IBLQ 2F4VL 2EQSA 4GS3A 3AFQA 2VS1A 4A3FH 1FL0A 4GNXA 1XNRL 4Y7NH 2VW9A 2WFWA 3DLLA 1TWFH 3PCOB 3RN2A 3STBC 3HKZG 2N3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JMC A;  1SFO H;  3KJP A;  3OTO L;  1VQK A;  2WAQ G;  5M3M H;  3U50 C;  3J7Z C;  3HOY H;  3ICE A;  4L5Q A;  4JI2 L;  4BY1 H;  3NEL A;  1XNR Q;  4A3G G;  1E24 A;  2JA9 A;  2WB1 E;  1B8A A;  2UU9 Q;  1N9W A;  3AQQ A;  3OTO Q;  3L2P A;  4DV6 L;  4L5R C;  4QJF A;  4DV0 L;  5EAY A;  4JI2 Q;  4GOP A;  4A3D H;  4JI1 L;  5AJ3 Q;  4LNQ A;  1TWA H;  2OWO A;  4DV6 Q;  2A1A A;  5BR8 Q;  3S24 A;  2WAQ E;  2ASB A;  3FKI H;  1VCI A;  4A3L H;  1IYJ B;  4JBM A;  4HID A;  4JI1 Q;  3H15 A;  3I4N G;  4JOI C;  1Q12 A;  4A4I A;  2OCE A;  4LUV A;  2H5X A;  1PA6 A;  5IYD G;  3M9B A;  4BXX G;  3GD7 A;  2UXB L;  5C4X G;  1OXS C;  2I5M X;  4PZ6 A;  3CW2 C;  3E9I A;  3F2D A;  2QA4 A;  1J5E Q;  2GVB A;  1EFW A;  1XPU A;  2MNA A;  2F52 A;  4JC0 A;  4C3H H;  1GKH A;  1CKO A;  1IXR A;  4A3M G;  3HOX G;  1PH5 A;  3HOV H;  2RHQ B;  1EUJ A;  5IYB G;  4DV1 L;  2UXB Q;  3RLN A;  2CKZ B;  1X56 A;  4OWW B;  4IOA A;  1P8L A;  1Y1W H;  5C0X I;  3GTG H;  3CCE A;  3NBH B;  1VQ9 A;  4OWT B;  5ELO A;  4DR2 L;  3H3V I;  1Y14 B;  3CC2 A;  2JA7 H;  4LWC A;  4DV1 Q;  2MO1 A;  4P74 A;  4B3R L;  1P16 A;  3BJU A;  1VQE A;  1S3O A;  2K4K A;  4OXP A;  5IT9 c;  1XMO Q;  3S17 H;  4KI0 A;  4IO9 A;  3U4Z A;  4DUY Q;  4DR2 Q;  3GTQ H;  3M4O H;  1WCM G;  3K7U C;  4NPS A;  4B3R Q;  1X3E A;  2IX0 A;  3J80 c;  3K7A H;  1WOC A;  2YTY A;  4FDB A;  2JA6 H;  5IP7 H;  2CFM A;  4GKJ Q;  5IP9 H;  2VQF Q;  1KHI A;  4P72 A;  5LMU Q;  4JI4 L;  1GO3 E;  5IWA L;  2B63 G;  4DR7 Q;  1IZ6 A;  1OTC A;  2NZO A;  3UDX A;  4HJA A;  2Q2H A;  1VQL A;  1I94 L;  3OW2 A;  2JE6 I;  4TVA B;  2XTI A;  1EIF A;  4JI4 Q;  5IWA Q;  3RR5 A;  1HZA A;  3PUX A;  4JI7 L;  3MXN B;  4NB3 A;  5K36 G;  4DV2 L;  1B70 B;  3CPF A;  1E7Z A;  1CUK A;  1SRO A;  2UUC L;  1E22 A;  3STB D;  1M90 C;  4GOP C;  2K50 A;  1TWH H;  4JOI A;  4JI7 Q;  2R92 H;  3RZD H;  2ZTE A;  3RN5 A;  3BZC A;  4KHZ A;  2UUC Q;  1Q81 C;  3PUV A;  1VQH A;  4B3S Q;  3PO3 G;  2MFI A;  1X55 A;  1YHB A;  3GO5 A;  4UP8 A;  3ULL A;  4A3C G;  5E7N A;  4P71 A;  1U0L A;  3CCL A;  1UE5 A;  3TS0 A;  1HZB A;  4R4C A;  3TRE A;  1XNQ L;  2VY3 A;  2YYZ A;  4ME3 A;  4GKK L;  4HJ5 A;  4OX9 Q;  3A0J A;  2OTL A;  4IPD A;  1Q46 A;  1YBY A;  5JEA G;  2B3G A;  2ZTC A;  2HHH L;  4DV7 Q;  3UDF A;  3PIP A;  2OQK A;  1MJE A;  4C2M H;  1A8V A;  2LXK A;  2ZTD A;  5FJ8 G;  4A76 A;  4DR3 L;  2AWO A;  2R7D A;  1X9N A;  3I56 A;  4NXM L;  1PH2 A;  1LYL A;  1O7I A;  2FXQ A;  3G6E A;  1CKN B;  4X65 L;  4GKK Q;  2ALY B;  1E3P A;  1SE8 A;  2D62 A;  5H1S E;  3CME A;  2HHH Q;  3S2H H;  2ZJR A;  2XGT A;  2LSS A;  4MZ9 A;  4DR3 Q;  1VQC A;  1N33 Q;  2Y0S E;  4NXM Q;  4K0K Q;  2R93 H;  1Y1V G;  4LF5 L;  1EOV A;  4IFD J;  2I5L X;  1A62 A;  2ATW A;  3U58 A;  4B3T L;  4H02 A;  4J15 A;  3A5U A;  3RNU A;  2PMZ E;  2R7Z H;  1XTD A;  3RLO A;  2ZM6 L;  2KEN A;  1VQM A;  1VQ5 A;  1MJC A;  3E0E A;  1L0W A;  2UU9 L;  1FVI A;  2MQH A;  4JI6 L;  4AYB G;  3KF8 B;  1I6H H;  4LF5 Q;  4B3T Q;  3S2D H;  4TQU S;  1I50 H;  1VQ4 A;  4JBK A;  4DR4 Q;  4XIG S;  1JJG A;  2ZM6 Q;  1W2B A;  5AJ3 L;  1N36 L;  5LMN L;  3NEM A;  2RHS B;  3SGI A;  1PH9 A;  2JA5 H;  4QQB X;  4R4Q A;  4GOP B;  1NMG A;  1YJW A;  4JI6 Q;  3CCM A;  5BR8 L;  2A8V A;  3F2C A;  3JAM i;  2N8N A;  2UXD Q;  2EXD A;  3KJO A;  3VDY A;  1SLJ A;  5GAH C;  5FLX c;  1WCM H;  4GN5 A;  3J7A 5;  2HQL A;  1N36 Q;  5LMN Q;  2AWN A;  2RCN A;  4PZ7 A;  3HKZ E;  1PH1 A;  3GTJ H;  3PO2 G;  1UE6 A;  4A93 H;  3H0G G;  3HKS A;  4AYB E;  4DR1 L;  1KIX A;  4BA2 I;  4DR6 L;  1K83 H;  2IHE A;  3T1H Q;  4A3I G;  1J5E L;  2VUM G;  3G48 A;  5C4J H;  3M85 A;  3HOW G;  2UXC L;  1EIY B;  3CP0 A;  4IPH A;  1WI5 A;  3H3V H;  4APV A;  2WP8 J;  2C35 B;  2R7F A;  3PUZ A;  1RIP A;  5J3B A;  3ZJY C;  4DR1 Q;  4DK6 C;  3CCV A;  4DR6 Q;  4KHP L;  4JI5 L;  4JBJ A;  3M7N A;  1BBW A;  2Q2U A;  1VQD A;  3J81 i;  5HY6 A;  4UY8 C;  2UXC Q;  1I3Q H;  3NEN A;  4JI3 L;  4A75 A;  3HOU G;  1Z9F A;  1VQI A;  4KHP Q;  4A3J G;  4JI5 Q;  4HIM A;  2JEA I;  4YCV A;  1K9M C;  1YEZ A;  4DAY B;  3W1G A;  5IYC G;  4A3E H;  4DK3 C;  1NTG A;  1XMO L;  4JI3 Q;  4A3B G;  2Q2T A;  3PUY A;  1YHQ A;  3GTO H;  3KOJ A;  4DUY L;  5FLM G;  4OON A;  1LM0 A;  1CKM A;  1N32 L;  1Q86 C;  3PO3 H;  3A5Z B;  1MIU A;  1NBW A;  4MNO A;  1PH4 A;  3I4M G;  3TS2 A;  4A3C H;  4BY7 G;  4GKJ L;  3UE1 A;  2VQF L;  2CCZ A;  1GVP A;  3CC4 A;  2D0P A;  2E8G A;  5LMU L;  4YCU A;  3K0X A;  3F2B A;  1PH6 A;  1D7Q A;  5GAE C;  4LF6 L;  1L2F A;  2GN5 A;  4DR7 L;  1N32 Q;  1M1K C;  1VQF A;  1SR3 A;  3JAM c;  1YJN A;  2E2I H;  2NN6 G;  2CQO A;  3HOZ H;  1VQ7 A;  4A3L G;  3Q8D A;  2JA8 G;  1X54 A;  4P75 A;  5LMN W;  5FJ8 H;  4LF6 Q;  2RF4 A;  1DGS A;  2R6G A;  4LFA L;  3GTK H;  2JEB I;  1LUZ A;  1D8L A;  1C9O A;  1VS0 A;  1KC8 C;  4DAM A;  1VQB A;  5M3F H;  4DV4 L;  2HT1 A;  4JV5 L;  5M5W H;  1HJP A;  1IBK L;  1G29 1;  3L0O A;  2HIV A;  1IBM L;  1KAW A;  4UP7 A;  4LFA Q;  4AIM A;  3CCQ A;  2K14 A;  4YCW A;  3ERS X;  5GQO A;  5GAG C;  3J81 c;  1RL2 A;  3I2Z A;  1IL2 A;  2HIX A;  1JT8 A;  4DV4 Q;  1QUQ A;  4JV5 Q;  4B3S L;  1IBK Q;  3L7Z C;  3CD6 A;  3FKI G;  4QL5 A;  1PV4 A;  1YZ6 A;  4BBS G;  1IBM Q;  1AH9 A;  2K5V A;  1HZC A;  3U4V A;  1VQ6 A;  4BXX H;  2VL6 A;  1GM5 A;  3TQY A;  4DR5 L;  2N78 A;  4HJ8 A;  2IX1 A;  3TRZ A;  1W3S A;  3PF4 A;  1YJ9 A;  2PI2 A;  4OX9 L;  2IHF A;  5M5X H;  4A3G H;  3F8T A;  4OO1 I;  3KYH C;  3GTP H;  1HZ9 A;  4IPC A;  2NVY H;  4DR5 Q;  5C44 G;  1A0I A;  4DV7 L;  1H95 A;  2DGY A;  1J6Q A;  2VNU D;  1SRU A;  4C3J H;  3S1M H;  4DV3 L;  3D0F A;  3ER0 A;  3ULP A;  1X3F A;  2UUB Q;  4DR4 L;  3DM3 A;  3H0G H;  1PH3 A;  3CQZ H;  2NZH A;  4DPG A;  1XJV A;  4K0K L;  2BA0 A;  1CSP A;  3PV0 A;  4DV3 Q;  2JA7 G;  2NVQ H;  2UUA L;  4WJ4 A;  4X64 Q;  1C7Y A;  3PGZ A;  3HOW H;  3I4N H;  3PIO A;  4HIO A;  3I4O A;  4YWM A;  3UDI A;  4O2D A;  4OO1 G;  5IYD H;  4DV5 L;  3WWV A;  1K73 C;  1L1O C;  5C4X H;  4A3K G;  2UUA Q;  1X3G A;  1G51 A;  1X6O A;  4P73 A;  2JA6 G;  2AMC B;  4EX5 A;  2EIF A;  1V1Q A;  3ULJ A;  2I5H A;  5C0X J;  4A3M H;  2VQE Q;  1HR0 Q;  3HOX H;  1ASZ A;  4DV5 Q;  2IY5 B;  4IJH A;  1YI2 A;  5IYB H;  3GTM H;  4LF8 Q;  1QVF A;  3S1Q H;  1KRT A;  2NVX H;  3EBE A;  4L5T A;  1KL9 A;  1YIJ A;  2UXD L;  2IT1 A;  2ZJQ A;  1PVO A;  1EQR A;  4OWX B;  1PYS B;  5FLM H;  4EQ5 A;  1HNZ L;  1Q82 C;  4LFC Q;  1KRS A;  4ALP A;  5M5Y H;  1XMQ L;  1WJJ A;  1VQ8 A;  2WB1 G;  4R1J A;  4GLV B;  2JK8 A;  5IY0 A;  1K8G A;  2BH8 A;  3T1H L;  1UE7 A;  2JJQ A;  4IOC A;  1NJI C;  2YU9 H;  1BKB A;  4R4O A;  1JB7 A;  2OQ0 A;  2ES2 A;  1HNZ Q;  2E2H H;  1Q1B A;  4QY7 A;  1XMQ Q;  1JE5 A;  1WFQ A;  5C3E G;  3J81 j;  3IRB A;  1EQQ A;  3GTL H;  2R92 G;  5JJL A;  2D0O A;  3CXC A;  4JYA L;  2QGQ A;  4UP9 A;  4LUZ A;  2L15 A;  2F4V Q;  2JA8 H;  3EIV A;  1HNX L;  4PG3 A;  1TWG H;  2V1C C;  4YWK A;  4GLX A;  2I0Q A;  1TWC H;  3RLF A;  2B63 H;  4LFB L;  2E5L L;  3S1N H;  1E1T A;  3K81 C;  4GN4 B;  4YWL A;  2NVT H;  4JYA Q;  2KCM A;  2Z0S A;  4LF7 L;  3G71 A;  4HJ9 A;  1HNX Q;  4JBW A;  3J80 i;  3UE0 A;  3BU2 A;  2PQA B;  5JEA J;  2E5L Q;  1PYB A;  4LFB Q;  1OXU A;  4YY3 L;  1BBU A;  2Z6K C;  3K80 C;  4O0A A;  5DLQ E;  4QGU A;  2PQA A;  1KD1 C;  2K75 A;  2N49 A;  1FGU A;  2NN6 I;  3FP9 A;  1EWI A;  4YHH L;  4LF7 Q;  4QIW E;  2Q2I A;  1X65 A;  1GD7 A;  3MEF A;  2KCT A;  4LUO A;  1L1O B;  4XTC S;  4DV0 Q;  3PF5 A;  1HR0 W;  4BBS H;  1CSQ A;  1JJC B;  2PNH A;  4YY3 Q;  1AE3 A;  3S16 H;  2OTJ A;  3CPW A;  1L1O A;  3CCS A;  4BBR G;  4UPA A;  4YHH Q;  2R93 G;  1UE1 A;  2BA1 A;  3CCU A;  1A63 A;  1Q1E A;  5IE8 A;  1VQJ A;  2PI2 E;  3F1Z A;  3W1B A;  1YVC A;  4JI0 L;  5C44 H;  5ELN A;  1XPR A;  4A3F G;  3CF5 A;  3BZK A;  4JG2 A;  1KQS A;  4R4I A;  4AQY L;  3K8A A;  5HGQ A;  2R7Z G;  1HNW L;  2KHI A;  4DUZ L;  4IFD I;  3S1R H;  4X6A H;  3KLW A;  4JI0 Q;  2JQO A;  3LGJ A;  5M3M G;  3HOY G;  1WYD A;  4PZ8 A;  1SMX A;  4BY1 G;  1T9H A;  4AQY Q;  2GVA A;  1HNW Q;  1OXX K;  2QEX A;  3S14 H;  2YTX A;  3PSI A;  2B29 A;  1SN8 A;  1Z47 A;  3CC7 A;  4DUZ Q;  1ASY A;  4KLK A;  2JA5 G;  1PH7 A;  1S72 A;  1QVC A;  3S15 H;  4MTN A;  5GRO A;  3PUW A;  1Y1V H;  4A3D G;  4PMW A;  1QUQ B;  2ID0 A;  4JI8 L;  1B7Y B;  3TEH B;  4A3K H;  4LF4 L;  2LXJ A;  1S40 A;  2KHJ A;  4A93 G;  3D31 A;  4IFD G;  4X62 L;  2YTV A;  4B3M L;  2A19 A;  3M4P A;  1YNX A;  5C0X G;  1PFS A;  2AHO B;  4JI8 Q;  1OXT A;  4GNX C;  1R9T H;  4LF4 Q;  4LF9 L;  1U5K A;  1NMF A;  2K52 A;  4X66 L;  1V9P A;  4JCV E;  4RMF A;  4X62 Q;  1QVG A;  4POF A;  1VQO A;  1LTL A;  1Q7Y C;  4B3M Q;  1FJG L;  1PHJ A;  1EYG A;  1YIT A;  2YV5 A;  2UUB L;  4LF9 Q;  3M4Q A;  3RZO H;  2Z6K A;  1JJ2 A;  3W5O A;  4X66 Q;  3HOV G;  3CMA A;  4POG A;  3B6Y A;  1FJG Q;  2BH2 A;  1I94 Q;  4Y52 H;  4X64 L;  2K5N A;  1XPO A;  4HJ7 A;  3EN2 A;  1BVS A;  3T1Y L;  4A3E G;  1Y1W G;  1G6P A;  1VQN A;  3CCR A;  3OYY A;  3PO2 H;  3M3Y H;  5C3E H;  1QZG A;  1E1O A;  4HIK A;  1TXY A;  3GDE A;  4C3I H;  4DV2 Q;  1MKH A;  1NE3 A;  4A3I H;  1AE2 A;  2CWP A;  2VUM H;  4BA1 I;  3G4S A;  3KFU A;  2KBN A;  4GLA C;  3T1Y Q;  3CAM A;  3JC6 6;  1HR0 L;  1OXV A;  1I5F A;  2F3I A;  3KDF B;  2VQE L;  1NY4 A;  4RG1 A;  1N33 L;  4LF8 L;  1VQG A;  1QZH A;  2Y0S G;  1VQA A;  2MO0 A;  3KDF A;  3CCJ A;  5JJI A;  4AH6 A;  5JJK A;  3AYH B;  1Q8K A;  4IPG A;  5IP7 G;  1UEB A;  2K5H A;  1YHA A;  3HOZ G;  3I7F A;  5IP9 G;  3FHW A;  4NXN L;  1UWV A;  1V43 A;  4IJL A;  1N8R C;  3HOU H;  2DUD A;  1K3R A;  4A3J H;  1PH8 A;  1K0R A;  4LFC L;  1N34 L;  2E2J H;  1C0A A;  3E9H A;  5IYC H;  2ZJP A;  1XNQ Q;  3UDG A;  5GAD C;  2CWA A;  2VZA A;  1K8A C;  4A3B H;  3I55 A;  3KF6 B;  1IBL L;  5M3F G;  4NXN Q;  1KXL A;  3AFP A;  4L5S A;  3A74 A;  3HFZ B;  4R4T A;  1CKN A;  4GN3 B;  4BBR H;  1N34 Q;  1VQP A;  3KF6 A;  2AKW B;  4LW1 A;  3I4M H;  4DNI A;  4WJ3 M;  4X65 Q;  3AEV A;  4BY7 H;  4DKA C;  1HH2 P;  4GNX B;  1IBL Q;  2F4V L;  2EQS A;  4GS3 A;  3AFQ A;  2VS1 A;  4A3F H;  1FL0 A;  4GNX A;  1XNR L;  4Y7N H;  2VW9 A;  2WFW A;  3DLL A;  1TWF H;  3PCO B;  3RN2 A;  3STB C;  3HKZ G;  2N3S A; 
#chains in the Genus database with same CATH topology
 5C44 B;  3KJP A;  1BQQ T;  3U50 C;  2NUC A;  2OXP A;  4JI2 L;  3NEL A;  2LKV A;  4CGY B;  2HD3 A;  1N9W A;  5AFW A;  4DV6 L;  2RSO A;  5C4H A;  1EWC A;  3S14 B;  4FXK C;  1DOM A;  3R93 A;  4A3D H;  1WTP A;  4JI1 L;  5AJ3 Q;  1EY5 A;  3LWE A;  5ISR A;  3A7A B;  2PYK A;  2ASB A;  3ONA B;  4HN7 A;  4A3K B;  4HID A;  1HUM A;  4A4I A;  3DEO A;  5ELB A;  3GD7 A;  5C4X G;  3BDL A;  2I5M X;  4IUU A;  2GVB A;  1XPU A;  2ICI A;  2AQ3 B;  1TY2 A;  1ET6 A;  1STA A;  3E0J A;  3BDO A;  4A3M G;  3FRP B;  3HOV H;  2RHQ B;  1EUJ A;  2A68 C;  2NZ1 D;  2UXB Q;  2CKZ B;  2LY7 A;  4IOA A;  3MZ5 A;  1Y1W H;  2WAC A;  5C0X I;  3DUZ A;  3MFG A;  1AP0 A;  5JVG 3;  4XDX A;  3V96 A;  4DAY A;  4DV1 Q;  4B3R L;  1S3O A;  1XMO Q;  2J0T D;  2L1B A;  3S17 H;  4FF1 A;  4IO9 A;  3U4Z A;  3K7U C;  1X3E A;  3RMH A;  2ZXR A;  2JA6 H;  3DWA A;  2CQA A;  2CH4 A;  1MGS A;  1GO3 E;  3I8Z A;  4DR7 Q;  1IZ6 A;  3W2D A;  2NZO A;  2FMM A;  2Z9H A;  5DEH A;  3HOU B;  1I94 L;  5DM6 3;  1CHQ D;  1CTM A;  1BOS A;  4EQP A;  4NB3 A;  4DV2 L;  1B70 B;  3S2H B;  1E7Z A;  1SRO A;  1E22 A;  3NXW A;  4GOP C;  2F0P A;  1FD7 D;  3RZD H;  2G9H D;  2R3Z A;  2UUC Q;  4A3F B;  5A2Q E;  1VQH A;  2MFI A;  4Y7N B;  4H13 C;  1I6H B;  4GKK L;  2OTL A;  1DM0 B;  2B3G A;  1LT5 D;  3PIP A;  5CV8 A;  4IUQ A;  2R7D A;  2IL8 A;  1O7I A;  4DNT B;  1TWA B;  2D62 A;  3T51 B;  4XT1 B;  2HHH Q;  2XGT A;  2LSS A;  1VQC A;  1K83 B;  2Y0S E;  4K0K Q;  4DNR B;  1EOV A;  3EVQ A;  1DJR D;  2A68 D;  3E6Z X;  3A5U A;  2PMZ E;  1NR2 A;  2X6G A;  3RLO A;  3A56 A;  1I3Q B;  1MJC A;  3E0E A;  4AYB G;  4DR4 Q;  1I50 H;  1M4V A;  1E0B A;  4XXE A;  5KEE A;  1N36 L;  5LMN L;  1PH9 A;  4R4Q A;  4JI6 Q;  1F2L A;  5BR8 L;  2N8N A;  1KLU D;  3CHB D;  3VDY A;  5FLX c;  4PZ7 A;  2RCN A;  1UE6 A;  4A93 H;  2K04 A;  3NTH A;  1KIX A;  4DR6 L;  2IHE A;  2HDL A;  5C0X H;  1X32 A;  2EOT A;  3NP8 A;  3K6O A;  3CP0 A;  4IPH A;  3K7A B;  4KTA A;  2ZXP A;  5CBA E;  3PUZ A;  1J9O A;  1DYQ A;  3MXU A;  5HGT A;  3M7N A;  3MA2 B;  4UY8 C;  3OMG A;  5CMD A;  3J80 L;  3NQT A;  1CA5 A;  1VF7 A;  2ICE C;  4JW0 A;  4LMQ D;  5J39 A;  5M3F B;  3HOU G;  1BF4 A;  1ET9 A;  1VQI A;  2IPK D;  1XTC D;  4KJO A;  3A8J E;  1K9M C;  1YEZ A;  4HAE A;  5IYC G;  2F0M A;  3ITP A;  4TSS A;  1EIH A;  4CKB A;  1Y8N B;  3BYT B;  4HR7 B;  4DUY L;  1FR3 A;  1S5B D;  4OON A;  1CKM A;  3PIO 3;  3I4M G;  1TY0 A;  2OEO A;  2CCZ A;  1RDP D;  3CC4 A;  4PQX A;  3VR5 A;  1PTO F;  1PH6 A;  1D7Q A;  1B4O A;  4RKL A;  3K5L A;  5CV4 A;  2B2T C;  5G3L F;  2CQO A;  3GTP B;  4A3L G;  3MEH A;  2JA8 G;  4P75 A;  5LMN W;  2F0I A;  3H09 A;  4IQZ A;  5LHY 1;  1DGS A;  1TII D;  1STG A;  4LF6 Q;  1ONL A;  1LUZ A;  1U4L A;  4DAM A;  1Z7T A;  4DV4 L;  1HQR D;  5M5W H;  1HJP A;  3L0O A;  4U67 3;  1F9S A;  4AIM A;  2BDN A;  1FGB D;  2K14 A;  3OSO A;  1V1O A;  1RL2 A;  1SJH D;  1QB5 D;  1PZI D;  4BXX H;  2K1B A;  4HTH A;  2B2W A;  4ME5 A;  2N78 A;  4XT3 B;  4L6T B;  1RKN A;  1G2T A;  5EKI A;  2PI2 A;  4A3G H;  3KYH C;  4YIJ A;  4CDC C;  2GA4 B;  4DR5 Q;  1A0I A;  4C3H G;  5BN4 A;  2DGY A;  1J6Q A;  4C3J H;  3ER0 A;  2Z1C A;  2EXZ A;  4KN7 C;  1V8Q A;  3DM3 A;  4B9W A;  3CQZ H;  3GV3 A;  1XJV A;  3T16 A;  1CSP A;  2NVQ H;  3C46 A;  2UUA L;  1AN8 A;  4ODG A;  1K28 A;  3I91 A;  3PIO A;  3I4O A;  3UDI A;  4DAV A;  5EKL A;  5T1I A;  1K73 C;  5CYU A;  5C4J B;  2J4X A;  3AMU A;  1X6O A;  4KV6 A;  3Q23 A;  5C0X J;  3ULJ A;  4DU9 A;  1Q3L A;  2VQE Q;  4DV5 Q;  3FPU B;  5IYB H;  4LF8 Q;  2QCP X;  3SHL A;  1KRT A;  3MWY W;  2NVX H;  2XNA C;  1Y8O B;  1TKW B;  1KL9 A;  1YIJ A;  1H9J A;  2IT1 A;  1PVO A;  1EQR A;  4OWX B;  4HSP A;  4EQ5 A;  5M5Y H;  1VQ8 A;  4R1J A;  4GLV B;  1K8G A;  4KN4 C;  5C5M A;  1UE7 A;  4IOC A;  4H44 C;  1HCZ A;  1HNZ Q;  2B2V A;  2E2H H;  1F77 A;  1JE5 A;  2DN8 A;  5C3E G;  4IAL A;  3IRB A;  2SEB D;  4RHR A;  3GTL H;  2D0O A;  4K5X A;  3CXC A;  4C3I G;  2JA8 H;  2Y0S B;  3EIV A;  2I0Q A;  1GUS A;  4PG3 A;  1QJO A;  5IT9 L;  1QIL A;  2G5D A;  1MHW C;  1E1T A;  1DON A;  5COY A;  1JC7 A;  3J80 i;  3UE0 A;  1MSG A;  4LFB Q;  3NWT A;  5DLQ E;  3MVV A;  1KD1 C;  2K75 A;  3FP9 A;  4UAI A;  2KEE A;  2K28 A;  3H6M A;  2Q2I A;  4LUO A;  2JN4 A;  4XTC S;  4ZLT F;  3IFT A;  3RUZ A;  1HTL D;  3S16 H;  2PNH A;  1HTP A;  4BBR G;  4UPA A;  2R93 G;  2EZV A;  1JQY D;  2Z4H A;  5IE8 A;  1R9T B;  3J81 L;  3CF5 A;  4JG2 A;  5HGQ A;  5M5X B;  5C3W A;  4DUZ L;  4IFD I;  3S1R H;  2NVY B;  2RA4 A;  2DNC A;  3KLW A;  5M3M G;  3HOY G;  4BY1 G;  2CHB D;  2GVA A;  4RKB A;  2QEX A;  3PSI A;  2JA5 G;  1SN8 A;  1Z47 A;  1EU4 A;  1PH7 A;  3H0G B;  2BOS A;  3TME A;  2K5D A;  2F0D A;  5FKA C;  5JVH 3;  1B7Y B;  4LF4 L;  3HOW B;  1R4P B;  1LT4 D;  1AZQ A;  1S40 A;  2WV6 D;  1KNE A;  3D31 A;  3KLS X;  1EYA A;  4X62 L;  4IFD G;  3M4P A;  1YNX A;  1IL8 A;  2AHO B;  1OXT A;  1WD0 A;  1NMF A;  1HQM C;  1V9P A;  3I4L A;  3HOX B;  4RMF A;  1QVG A;  1ZKO A;  3K59 A;  1Q7Y C;  1T5E A;  2F0Q A;  2L0C A;  4WOR A;  4LF9 Q;  1U4M A;  3RZO H;  1JJ2 A;  3RD4 A;  4X66 Q;  3CMA A;  3MC0 B;  4FNF A;  1I94 Q;  3TP5 A;  3MXN A;  1XPO A;  2L5T A;  1BVS A;  3OW7 A;  4LJZ C;  5C3E H;  4XQQ A;  1QZG A;  1CQV A;  2AUK A;  5CBE E;  3GDE A;  4C3I H;  1SMY C;  4DV2 Q;  3FMC A;  1SNP A;  3CAM A;  1HR0 L;  1I5F A;  1M8A A;  5JPM C;  1UUP A;  2Y0S G;  1HXY D;  1RCV D;  5CV9 A;  3I70 A;  3AYH B;  1TU2 B;  5IP7 G;  1LV9 A;  3HOZ G;  1ILP A;  4IJL A;  2IWH A;  4A3J H;  2E2J H;  4LFC L;  4JK1 C;  3AU7 A;  3ZYY X;  2A73 B;  3I55 A;  4NXN Q;  1KXL A;  5IGD A;  3AFP A;  1BBX C;  3A74 A;  1D5X C;  3HFZ B;  4BBR H;  4PNY A;  1N34 Q;  4BBS B;  1V1P A;  2KOL A;  1K3B C;  1HH2 P;  2VS1 A;  3TDQ A;  1ENC A;  1FL0 A;  1SDF A;  1XNR L;  2LMC B;  3DLL A;  3STB C;  2N3S A;  1SFO H;  4Q5V A;  5M3M H;  3HOY H;  2F3W A;  3ICE A;  3M7G A;  1D1K A;  4BY1 H;  1R4Q B;  4NMZ A;  1B8A A;  2C9O A;  2HCI A;  3OTO Q;  4F88 A;  2X69 A;  4GOP A;  2PPB C;  2OWO A;  1IW7 C;  1F2Y A;  3S17 B;  2A1A A;  5BR8 Q;  4IFD H;  3S24 A;  1EY9 A;  2WAQ E;  3FKI H;  2Q8I B;  1IYJ B;  3H91 A;  3I4N G;  3C1F A;  2OCE A;  4LUV A;  1PA6 A;  5IYD G;  1PXU A;  2EJM A;  4JVZ A;  3CRL C;  1OXS C;  1EFW A;  1BNZ A;  2F52 A;  1LAC A;  2IW3 A;  5KGU A;  3HOX G;  1PH5 A;  3NHH A;  2BCO A;  3G7L A;  1A3V A;  4OWW B;  2C5C A;  4E6I A;  1P8L A;  1CQF A;  1SMY D;  2WB1 B;  3GTG H;  3CCE A;  4ULL A;  3BS1 A;  1VQ9 A;  5I2Y A;  2EYH A;  3CC2 A;  2JA7 H;  4LWC A;  2MO1 A;  1I4H A;  2PW5 A;  1VQE A;  1EQT A;  4C1N K;  2B2Y A;  4DR2 Q;  3GTQ H;  4DUY Q;  4B08 A;  3M4O H;  1WCM G;  4NPS A;  5CGK A;  1RTN A;  5IP7 H;  2FFK B;  3K58 A;  5BN3 A;  5IWA L;  2B63 G;  3VA5 A;  1OTC A;  2EY1 A;  2RCF A;  4KY5 A;  3UDX A;  4HJA A;  2JE6 I;  1JOQ A;  2EYO A;  3MXP A;  4TVA B;  1EIF A;  4JI4 Q;  3RR5 A;  1TR5 A;  2QKI C;  5K36 G;  1YNN C;  3NQI A;  1CUK A;  5CR3 A;  3NSW A;  3STB D;  4GZY C;  1TWH H;  1LT3 D;  3N52 A;  4JOI A;  2H4O A;  4JI7 Q;  2R92 H;  5I9P A;  1STY A;  4MTK A;  4NP5 A;  1Q81 C;  3VA7 A;  4X3K A;  3PO3 G;  1B53 A;  5E7N A;  1SBB B;  5FOB B;  1I50 B;  1UE5 A;  1HRJ A;  5E4X A;  3TS0 A;  1GXD C;  1HZB A;  3TRE A;  1MD2 D;  2VY3 A;  4ME3 A;  1IW7 D;  4IPD A;  1GUT A;  4I65 A;  2L9H A;  1WTW A;  3OOC A;  1X9N A;  4NXM L;  3I56 A;  1LYL A;  1CKN B;  2ALY B;  1E3P A;  2G9D A;  4DXF A;  4A93 B;  4OEL B;  1I4P A;  1XWE A;  4MZ9 A;  4DR3 Q;  1N33 Q;  4KY6 A;  1Y1V G;  3QWN A;  4IFD J;  2I5L X;  1A62 A;  4V19 0;  1SYB A;  2B2U A;  3U58 A;  4B3T L;  4H02 A;  2R7Z H;  4RHS A;  1D1I A;  2ZM6 L;  1HFN A;  1VQ5 A;  1L0W A;  2UU9 L;  1FVI A;  2O5I C;  1B44 D;  4XIG S;  4M1U B;  3NEM A;  1EEI D;  2RHS B;  3SGI A;  1YJW A;  1EY4 A;  2DY8 A;  3F2C A;  3CKI B;  2EJG C;  1WCM H;  4GN5 A;  5IGF A;  2HQL A;  3J7A 5;  5IOC A;  3GTJ H;  3PO2 G;  1SE4 A;  3HKS A;  4DR1 L;  5I6W A;  4K6L A;  1Y69 U;  4A3I G;  2VUM G;  5JPN C;  3G48 A;  1WTV A;  4MN3 A;  1B50 A;  1JWS D;  4DK6 C;  4RCO A;  4KHP L;  4JI5 L;  3AB9 A;  1VQD A;  3LWU A;  2UXC Q;  3NEN A;  1D2B A;  1YNN D;  1NAP A;  3NWS A;  1Z9F A;  1BCP C;  1SYC A;  4DAY B;  1CK1 A;  4A3E H;  4JI3 Q;  2KEC A;  1NTG A;  1KDA A;  5IGG A;  3HRZ C;  3GTO H;  3KOJ A;  2HQE A;  1LM0 A;  1N32 L;  3PO3 H;  3A5Z B;  1MIU A;  4MNO A;  4I7A A;  1XYI A;  3TS2 A;  4IUP A;  3HKZ B;  4BY7 G;  2VQF L;  2D0P A;  5LMU L;  3K0X A;  3F2B A;  2WAQ B;  2GN5 A;  1RD9 D;  4DF7 A;  1M1K C;  4A3G B;  2NN6 G;  1JIC A;  2K7V A;  1LT6 D;  1TQO A;  4L8J A;  2RF4 A;  2R6G A;  2JEB I;  2D2C C;  1GUW A;  4C2M B;  2HT1 A;  5NUC A;  4JV5 L;  2XWB B;  1JOR A;  1G29 1;  3I90 A;  1IBM L;  3K5M A;  2QDB A;  4UP7 A;  4LFA Q;  4C56 C;  2XVS A;  3ERQ A;  3ERS X;  5GQO A;  1JT8 A;  1AW7 A;  1PTO B;  1SJE D;  1IBK Q;  5I2X A;  3T4A C;  1YZ6 A;  1AH9 A;  1OO9 B;  3GQB A;  3KLS A;  3TRZ A;  3PF4 A;  1TS5 A;  1O7L A;  1QOH A;  2NVX B;  4IPC A;  1F9P A;  5C44 G;  4DV7 L;  2FJ2 A;  1H95 A;  4DV3 L;  3VR4 A;  1X3F A;  2DNE A;  4CBV A;  3LX0 A;  3CU7 A;  4CJ2 C;  4DPG A;  4MHE A;  4CKC A;  3GTL B;  2F1M A;  4HIO A;  4YWM A;  1TS3 A;  2PW7 A;  1CA6 A;  3WWV A;  1L1O C;  3BDC A;  5C4X H;  2WKC A;  4A3K G;  5FLX L;  1X3G A;  1KDC A;  1G51 A;  2K03 A;  2AMC B;  2EIF A;  1V1Q A;  1HR0 Q;  3R2T A;  4A3M H;  1ASZ A;  1BCP D;  2IY5 B;  2EYF A;  3GTM H;  1RTO A;  3V05 A;  3SK4 A;  2RBM A;  4N8F A;  2UXD L;  2ZJQ A;  2KHS A;  4LFC Q;  4G7O C;  3D6W A;  4ALP A;  1XMQ L;  1KLG D;  2JK8 A;  4JPB W;  1F9R A;  2JJQ A;  1NJI C;  2OQ0 A;  1RHP A;  4QY7 A;  2CW0 C;  1STB A;  4JYA L;  3URY A;  4LUZ A;  1VF5 C;  1LTG D;  4YWK A;  1TWC H;  3SDZ A;  2E5L L;  5J22 A;  2E2I B;  3K81 C;  1EOT A;  2NVT H;  4ZUJ A;  1EFI D;  2KCC A;  1H9S A;  2Z0S A;  5ELE A;  4LF7 L;  2EJF C;  1HNX Q;  3GTK B;  4CJ1 B;  1PRT B;  1E2V A;  2PQA B;  4YY3 L;  4O0A A;  2Z6K C;  5HUR A;  2F0F A;  4QGU A;  1S5C D;  2PQA A;  2DJG C;  1QNK A;  4QIW E;  2JP1 A;  1X65 A;  2KCT A;  1UAP A;  3QJY A;  1SE3 A;  2EY5 A;  2OTJ A;  4YHH Q;  1UE1 A;  3O13 A;  2LFN A;  2SDF A;  5E1F A;  4BS9 A;  1YVC A;  4JI0 L;  2B39 A;  1LTS D;  2MPM A;  2SNS A;  2VB2 X;  1EYC A;  2Z8L A;  3K5O A;  5ELN A;  3VYS A;  5C44 H;  4A3F G;  1XPR A;  4R4I A;  4AQY L;  3K8A A;  1HNW L;  5J1Z A;  1J8I A;  5L37 A;  3RZO B;  1ML0 D;  4FF4 A;  2JQO A;  3S1M B;  4PZ8 A;  1SMX A;  3TBI B;  1A2T A;  1T9H A;  1JOK A;  3S14 H;  4KLK A;  5D14 A;  3D3R A;  3S15 H;  1SND A;  1ZXT A;  1S5F D;  4RGN A;  4PMW A;  4MIU A;  2ID0 A;  4A3K H;  2F0T A;  1QG7 A;  1B3A A;  2LXJ A;  4CJ0 B;  1Y8P B;  2EE1 A;  2A19 A;  3SXH A;  3VR3 A;  4JI8 Q;  4GNX C;  1U5K A;  2F0J A;  1HA5 A;  3QIA A;  3D4W A;  4XQN A;  5BN5 A;  4POF A;  4B3M Q;  1GHJ A;  5FO7 B;  1PHJ A;  4A3J B;  3S1Q B;  1EYG A;  2E2J B;  1YIT A;  2UUB L;  3M4Q A;  4DK0 A;  1KAA A;  1SXT A;  4NW2 A;  1FJG Q;  2BH2 A;  5LL6 S;  3SK5 A;  2CW0 D;  3ERO A;  5ELF A;  3T13 A;  3TP6 A;  1YNJ C;  5COR A;  3CCR A;  3OYY A;  4DAP A;  2B8G A;  2YU9 B;  5LL6 X;  1EIG A;  1MKH A;  1A3U A;  2Q8R E;  3G4S A;  3D6C A;  3T1Y Q;  3WOE A;  1WD1 A;  4IUR A;  1OXV A;  2R61 A;  4I7Z C;  1SAP A;  1QZH A;  2MO0 A;  5JJK A;  3J80 E;  5FO8 B;  3BG3 A;  1YHA A;  2N88 A;  3I7F A;  3R2I A;  3C1E A;  3HOU H;  1N8R C;  4RFB A;  2DUD A;  1K3R A;  1ZYR C;  1PH8 A;  5IGB A;  5IYC H;  5GAD C;  4FVM A;  1IYU A;  1JR0 D;  3I73 A;  3KF6 B;  5M3F G;  1IBL L;  1UNS A;  4L5S A;  1MBY A;  3FKI B;  4G7Z C;  3KF6 A;  5ELD A;  1PRT F;  3I4M H;  3U9O A;  3DEP A;  2F4V L;  3AFQ A;  4A3F H;  2F0O A;  2KVM A;  4QUF A;  4Y7N H;  4P2C B;  4A3L H;  1JMC A;  2K01 A;  2XSC A;  1VQK A;  1SNQ A;  1ZEQ X;  2JA9 A;  2WB1 E;  2P5Z X;  2UU9 Q;  1I6V C;  3GTG B;  3L2P A;  5FK9 C;  3WOF A;  3TSS A;  2PQE A;  3EA6 A;  4L5R C;  4QJF A;  2JA7 B;  4DV0 L;  5EAY A;  1AZP A;  4JI2 Q;  4RWS C;  4TKO B;  3JAM L;  1LTA D;  1TWA H;  1O80 A;  4K8J A;  4DV6 Q;  3GTQ B;  1C48 A;  1CFM A;  5KNC A;  4JI1 Q;  1PFB A;  1PTO C;  4TRD A;  4PMB A;  1Q12 A;  1HUN A;  2UXB L;  3E9I A;  3F2D A;  2RKS A;  1NNX A;  2JSO A;  2MNA A;  4K8I A;  3EJI A;  4C3H H;  1GKH A;  1CKO A;  1IXR A;  3C2P A;  4RCN A;  1YNJ D;  3KBX A;  4DV1 L;  1ILQ A;  1X3Q A;  1X56 A;  5KNB A;  4KD4 A;  1G6Z A;  4PMC A;  5ELO A;  3H3V I;  1Y14 B;  2MGS A;  4P74 A;  3VYT A;  4F8M A;  2A69 C;  1P16 A;  3BJU A;  4OXP A;  5IT9 c;  2R92 B;  1KTK A;  4KI0 A;  1CHP D;  4QIW B;  4B3R Q;  4QB4 A;  2QF7 A;  5C6A A;  3QO2 A;  3GV6 A;  1WOC A;  2YTY A;  3K7A H;  3KLR A;  4FDB A;  1ZYR D;  2CFM A;  2VQF Q;  1KHI A;  5LMU Q;  1LTR D;  3MTS A;  2EDG A;  2MP1 A;  4FO2 A;  5EPK A;  1JWM D;  1HA6 A;  4K5V A;  3KBG A;  1VQL A;  2EPB A;  2XTI A;  4K5W A;  4CDD C;  4C1N I;  1HZA A;  4A3B B;  3MXN B;  3FDT A;  3OPO A;  3CPF A;  2UUC L;  1M90 C;  3NTK A;  2K50 A;  2DY7 A;  3DWP A;  4IUT A;  3MHB A;  3EQL C;  1A2U A;  3BZC A;  3ND9 A;  2F0K A;  1KAB A;  3P20 A;  4KHZ A;  3PUV A;  2R7Z B;  5IT9 E;  1YHB A;  2ZT9 C;  3ULL A;  1Q8I A;  2D5D A;  1U0L A;  4CDE C;  4O42 A;  2M9V A;  2YYZ A;  3BVG A;  3TP8 A;  4HJ5 A;  5EBD A;  4DK1 A;  2CVR A;  1YBY A;  2IX3 A;  2HHH L;  4DV7 Q;  2EYL A;  3UDF A;  1MJE A;  1A8V A;  4A76 A;  5FJ8 G;  1JWU D;  1W6J A;  3MXG A;  1PTO D;  4A3D B;  3G6E A;  2FXQ A;  4GKK Q;  4X65 L;  3A8K E;  1SE8 A;  1V1P B;  2A5H A;  5DM7 3;  3DM1 A;  5G3L D;  2ZJR A;  2R93 H;  4LF5 L;  2KA7 A;  5CC4 A;  1EY7 A;  2PZU A;  4J15 A;  2QEJ C;  3RNU A;  1H9M A;  2NTS A;  2RSN A;  3A55 A;  1NUC A;  4RGO S;  5D65 A;  1XTD A;  5IIF A;  2KEN A;  1LAB A;  1G8Z D;  3K0Y A;  2MQH A;  4JI6 L;  1E2Z A;  3DXJ C;  3KF8 B;  5DAU A;  2MJ8 A;  1QWY A;  1TVX A;  3SEB A;  3S2D H;  4ZYS A;  2A69 D;  3HOV B;  1JJG A;  3KF8 A;  1I4Q A;  1W2B A;  1WTR A;  1Y1W B;  4A3E B;  2JA5 H;  4XYO A;  1O78 A;  3Q24 A;  4GOP B;  3GTO B;  5C3X A;  3JAM i;  2UXD Q;  2EXD A;  1LTI D;  1SLJ A;  3A7L A;  4RAU C;  1N36 Q;  2CH4 W;  5LMN Q;  2AWN A;  1PH1 A;  3HKZ E;  2KED A;  3H0G G;  4J1M A;  4AYB E;  1EZ8 A;  1NSN S;  5FO9 B;  1J5E L;  5C4J H;  3HOW G;  1WI5 A;  1RJT A;  2JA6 B;  3H3V H;  1SNC A;  3ZJY C;  2C35 B;  2R7F A;  1RIP A;  2B2W C;  1JB3 A;  2XN9 C;  3CCV A;  1EZ6 A;  4DR6 Q;  1EEF D;  2I46 A;  1BBW A;  3J81 i;  2F0N A;  4DFA A;  5KYL A;  4ZAI A;  1B3Q A;  2N55 A;  4HIM A;  1JOO A;  4YCV A;  4FP5 D;  4DK3 C;  2F0L A;  4A3B G;  2Q2T A;  3L3O C;  1K8O A;  2AQ2 B;  1WTH A;  4HCE A;  1PH4 A;  2L12 A;  5KYI A;  3RZD B;  1BO0 A;  4GKJ L;  1EQV A;  3UE1 A;  1I4G A;  4N9T A;  4YCU A;  4LF6 L;  1L2F A;  4HED A;  1VQF A;  1YJN A;  2KUM A;  3HOZ H;  1EU3 A;  4RGT A;  1VQ7 A;  2J7Z A;  3W3A A;  1X54 A;  3H3V C;  2SNM A;  5FJ8 H;  1O7Y A;  1D8L A;  1C9O A;  1VS0 A;  4CHT B;  1VQB A;  2A6H C;  1PMR A;  1K8M A;  1KAW A;  2HUG A;  3CCQ A;  1SSO A;  5GAG C;  2HIX A;  3S9W A;  4DV4 Q;  2RDF A;  1QUQ A;  4B3S L;  2RVL A;  3L7Z C;  1A6X A;  4QL5 A;  4BBS G;  5C4X B;  3OIQ A;  1SNO A;  2B2V C;  3U4V A;  2VL6 A;  4DR5 L;  5D3I B;  4LAA A;  4HJ8 A;  3VYU A;  4A3M B;  5I9O A;  1W3S A;  4BWG B;  2K32 A;  1YJ9 A;  3DMU A;  3GTM B;  4OX9 L;  1STH A;  5M5X H;  3F8T A;  4OO1 I;  1LTB D;  3CRK C;  1HZ9 A;  2NVY H;  2LS0 1;  3E3X A;  4HSV A;  2VNU D;  1SRU A;  2D9U A;  4KKS A;  3ULP A;  2UUB Q;  2L4N A;  4XQJ A;  3H0G H;  1MSH A;  1PH3 A;  2NZH A;  3PV0 A;  2TSS A;  4WJ4 A;  2IJ0 A;  3HOW H;  1ROD A;  3PGZ A;  2WIN B;  3I4N H;  1QNU A;  4FXG C;  4CKE A;  4OO1 G;  5IYD H;  2B8F A;  4DV5 L;  1ESR A;  2UUA Q;  1XXG A;  2B2T A;  5E4W C;  2JA6 G;  2NTT A;  2SOB A;  4O1N A;  1BXT A;  3HOX H;  4IJH A;  4RA8 A;  1QVF A;  4DGZ A;  1X3P A;  1I4R A;  3SVM A;  5KIX A;  1EY0 A;  4OIJ A;  4L5T A;  4EQO A;  1IKL A;  1CT1 D;  1AFP A;  5JJZ A;  2ENB A;  3LNN A;  2PZT A;  1HNZ L;  1KRS A;  1IHZ A;  1LLR D;  1EY8 A;  2WB1 G;  2AQ1 B;  5IY0 A;  4G7H C;  2BH8 A;  3T1H L;  2Z4I A;  4R4O A;  2E76 C;  2ES2 A;  3J7A V;  2H1E A;  1WFQ A;  3J81 j;  1S4Z A;  5JJL A;  2L15 A;  1I4X A;  2F4V Q;  4OEM B;  5A2Q L;  1TWG H;  2B63 H;  1F9Q A;  3RLF A;  4LFB L;  3S1N H;  2O2L D;  2A6H D;  5TSS A;  1L0X B;  3N6R A;  4ILW A;  4HJ9 A;  4WRD A;  2F4I A;  1PYB A;  1SYF A;  1OXU A;  1BBU A;  3MAQ A;  5K36 H;  1T5X D;  3IKJ A;  5M5W B;  1PFN A;  1FGU A;  2NN6 I;  3S15 B;  1S5D D;  3M3Y H;  4DV0 Q;  4BBS H;  3PF5 A;  3D4D A;  1U9R A;  1Z6H A;  1AE3 A;  2NBF A;  3CPW A;  2NB0 A;  4RGM A;  1DD2 A;  1Q1E A;  2WKD A;  2PI2 E;  4IUN A;  3J7Y W;  4AYB B;  2I07 B;  3FVQ A;  3BZK A;  1KQS A;  4X3T A;  2KHI A;  4S3S A;  3PIP 3;  3LGJ A;  1LO5 D;  1WYD A;  3KK7 A;  4C3J B;  3QOJ A;  2K5W A;  2AUJ D;  1OXX K;  4KHV A;  2YTX A;  4H7B A;  2B29 A;  4DUZ Q;  1ASY A;  1GUO A;  3A8I E;  3CQZ B;  1K0S A;  3TZU A;  4OO1 H;  3DHQ A;  2F0G A;  3Q6S A;  3BVM A;  4MTN A;  3PUW A;  1Y1V H;  2NVQ B;  3I3C A;  4ZQ3 A;  3NE5 B;  4A93 G;  4QMG A;  2NYZ D;  2YTV A;  5C0X G;  4LF4 Q;  4LF9 L;  2RQX A;  4X66 L;  4JCV E;  4X62 Q;  1LTL A;  1HHV A;  1DXM A;  3TP7 A;  5K5P A;  1STN A;  2RDG A;  4X3U A;  2MUY A;  3W5O A;  5CV5 A;  3PMF A;  1XX8 A;  1A15 A;  2K5N A;  1FYC A;  4X64 L;  3K57 A;  4HJ7 A;  5M5Y B;  3I4M B;  3PO2 H;  1E1O A;  4K6D A;  1TXY A;  5M9O A;  1PYW D;  5IOD A;  4A3I H;  1NE3 A;  3KFU A;  2VUM H;  4BA1 I;  2E2H B;  2KBN A;  3VYR A;  4CDF C;  3JC6 6;  5D3D A;  2F3I A;  4NDX A;  3KDF B;  1NY4 A;  4ZKB B;  3I72 A;  2JA8 B;  3V2T A;  3IL8 A;  2DJF C;  3KDF A;  3CCJ A;  4AH6 A;  1Q8K A;  1JCK B;  5EQ0 A;  3SK8 A;  1UEB A;  2K5H A;  5IP9 G;  3FHW A;  4NXN L;  2XRS D;  1UWV A;  3NBI A;  1K0R A;  1N34 L;  3Q0A A;  1C0A A;  3HEJ A;  5IGC A;  3E9H A;  4UDU C;  3UDG A;  4F7X A;  2VZA A;  4PV1 C;  1K8A C;  4H0L C;  4QF4 A;  4R4T A;  1CM9 A;  2Z6B A;  4GN3 B;  1VQP A;  3S16 B;  4X65 Q;  3AEV A;  5JAV A;  3NTI A;  2EVB A;  4ZCK A;  1C8C A;  4BY7 H;  4DKA C;  1QCB D;  4L63 B;  2EQS A;  4GS3 A;  2A6E C;  3T53 B;  2B2Y C;  1UEA B;  4LF5 Q;  1TWF H;  4BXX G;  3HKZ G;  2NN6 H;  2HDM A;  4C3H B;  3DWQ A;  2BE5 C;  3OTO L;  2WAQ G;  3J7Z C;  1STE A;  3D8G A;  4L5Q A;  4B9X A;  4EGV A;  1H9S B;  1XNR Q;  4A3G G;  3S1R B;  1E24 A;  3TZD A;  3AQQ A;  2FMC A;  2BDO A;  4K2K A;  4C3J G;  3TN2 A;  1HPC A;  4LNQ A;  2E2D C;  4K14 A;  1BR9 A;  1VCI A;  4JBM A;  3QOL A;  3H15 A;  3HP3 A;  4JOI C;  3A54 A;  2H5X A;  3M9B A;  3K5N A;  4PZ6 A;  1B2T A;  3CW2 C;  1S5E D;  2QA4 A;  1J5E Q;  1F2Z A;  4JC0 A;  5IYB G;  5EBC A;  5KND A;  3RLN A;  4G57 A;  3KUP A;  2MHV A;  1MI2 A;  4KY7 A;  3NBH B;  2PO4 A;  4OWT B;  4DR2 L;  2XIW A;  3UI2 A;  3NBH A;  3X3M A;  2K4K A;  5C3E B;  4X3S A;  3PQI A;  4C3I B;  5CV6 A;  4FF2 A;  5FLX E;  2IX0 A;  3J80 c;  2B2U C;  2EY6 A;  1TS4 A;  2F0U A;  5IP9 H;  4GKJ Q;  4P72 A;  4JI4 L;  3HG9 A;  1NR4 A;  3QR8 A;  4FXD A;  2XWJ B;  2Q2H A;  3OW2 A;  1LTT D;  5IWA Q;  1B9M A;  3GP7 A;  3PUX A;  4JI7 L;  4DN4 M;  2A6E D;  2K5Q A;  4BBR B;  2R93 B;  4Z9C B;  3NPP A;  2FHT A;  2WII B;  5ELC A;  2BE5 D;  3WDN A;  2ZTE A;  3RN5 A;  2Q8T A;  1D6E C;  3VR6 A;  4B3S Q;  3GO5 A;  1X55 A;  2F0V A;  3BVZ A;  1CZG A;  3MFY A;  4UP8 A;  4A3C G;  1SFO B;  4P71 A;  3CCL A;  5M3M B;  3S2D B;  3SK6 A;  3HOY B;  2X6L A;  4BY1 B;  1O7Z A;  4R4C A;  2JYO A;  4NKL A;  4KMU C;  1XNQ L;  4OX9 Q;  3A0J A;  2JA5 B;  1Q46 A;  5JEA G;  2ZTC A;  2OQK A;  4C2M H;  2LXK A;  2ZTD A;  3T56 B;  4DR3 L;  4Q0F A;  1AEX A;  2AWO A;  1N33 L;  1PH2 A;  3Q22 A;  1KDB A;  4FF3 A;  1TT2 A;  5H1S E;  1DCZ A;  3CME A;  4R8I A;  3S2H H;  1PTO H;  3BYY B;  3OWF A;  4ZUI A;  4NXM Q;  1VMP A;  2V4D A;  4J8Q A;  1F2M A;  4OHJ A;  2HCC A;  1VQM A;  1SNM A;  5IGE A;  1I6H H;  4B3T Q;  4TQU S;  1VQ4 A;  4JBK A;  1D5Z C;  1CZW A;  2ZM6 Q;  5AJ3 L;  4KJN A;  4QQB X;  1NMG A;  2PZW A;  4KD3 A;  5EPL A;  3CCM A;  2A8V A;  2XRQ D;  3KJO A;  5GAH C;  1FNV A;  1GHK A;  3IFD A;  4N8X 1;  2M2L A;  5EPJ A;  4BA2 I;  2F0S A;  2NWG A;  1K83 H;  3T1H Q;  3M4O B;  5KRU A;  2A74 C;  1DOK A;  3M85 A;  2UXC L;  1EIY B;  4KKU A;  4APV A;  2WP8 J;  3HOZ B;  5J3B A;  4DR1 Q;  1TS2 A;  3H94 A;  4JBJ A;  2PMZ B;  2Q2U A;  2QDL A;  5HY6 A;  1I3Q H;  4JI3 L;  4A75 A;  1WTQ A;  1VMC A;  4KHP Q;  4A3J G;  4JI5 Q;  2JEA I;  5C4Z A;  1EL0 A;  2VB3 X;  2ZXO A;  1XMO L;  3W1G A;  3PUY A;  2VXW A;  1YHQ A;  5FLM G;  1HFG A;  1TWH B;  1Q86 C;  2E75 C;  1NBW A;  4A3C H;  1GVP A;  2K33 A;  2E8G A;  5GAE C;  1SYG A;  4DR7 L;  4QUC A;  1N32 Q;  4ID6 A;  1U4R A;  1SEB D;  1SR3 A;  3JAM c;  4FYD A;  3P1H A;  4N9P A;  1H9R A;  2E2I H;  3F2U A;  3Q8D A;  5JEA H;  1ENF A;  2KCN A;  1G91 A;  3GTK H;  4LFA L;  3P7J A;  4ZKC B;  1KC8 C;  5M3F H;  3M4Y A;  1IBK L;  2TMP A;  3HGB A;  2HIV A;  1ENA A;  1KNA A;  4YCW A;  3X3N A;  3I4N B;  3J81 c;  3I2Z A;  1IL2 A;  4JV5 Q;  2L55 A;  1PDQ A;  4U68 A;  3CD6 A;  5E3F A;  3FKI G;  1EWH A;  1PV4 A;  4KK7 A;  1IBM Q;  2K5V A;  1HZC A;  1VQ6 A;  1JE4 A;  1GM5 A;  4ZRZ A;  3TQY A;  2E74 C;  2IX1 A;  4DA2 A;  3G6J B;  5EKK A;  2O5J C;  4G4K A;  2IHF A;  3EFX D;  1EY6 A;  2EY2 A;  4DXG A;  3GTP H;  1BCP B;  1PZK D;  4R8N A;  4OL7 A;  1RF2 D;  3C3L A;  3S1M H;  3D0F A;  3JAM E;  4V0B A;  1B1Z A;  4RH6 A;  2KJX A;  2QIL A;  1DOL A;  4K0K L;  1PRT C;  2BA0 A;  2JA7 G;  5T1G A;  4DV3 Q;  1WCM B;  3HS0 C;  4X64 Q;  1C7Y A;  3GTJ B;  4LK1 C;  4HMI A;  4O2D A;  3OWE B;  1L0Y B;  2K05 A;  1TWG B;  4ABN A;  2B63 B;  1CI3 M;  3J81 E;  3S1N B;  3FPP A;  4P73 A;  4EX5 A;  4DR4 L;  2I5H A;  1YI2 A;  4OIK A;  3S1Q H;  2M00 A;  3EBE A;  1FNW A;  3QG1 A;  1VDZ A;  1WVL A;  5FLM H;  1PYS B;  5EGT A;  1ICW A;  1Q82 C;  3M3Y B;  3VR2 A;  1WJJ A;  2PCF B;  2JXM B;  3L9A X;  2YU9 H;  1BKB A;  1JB7 A;  1FNU A;  3P75 A;  3PO3 B;  3OMC A;  3QB3 A;  1Q1B A;  1XMQ Q;  1BUV T;  1EQQ A;  2R92 G;  1SYE A;  5I6Y A;  2EYM A;  2QGQ A;  4UP9 A;  1SYD A;  1HNX L;  2V1C C;  4GLX A;  4GN4 B;  4YWL A;  4JYA Q;  1GOZ A;  2KCM A;  1G2S A;  3G71 A;  4JBW A;  5EJW A;  3BU2 A;  5JEA J;  4IZ8 A;  2E5L Q;  1IYV A;  3K80 C;  3FEW X;  2OF1 A;  4UHV A;  2N49 A;  4YHH L;  1EWI A;  4LF7 Q;  4XYQ A;  3MEF A;  1Y1V B;  1GD7 A;  3D4R A;  2ATW A;  4F87 A;  1L1O B;  1BDO A;  1HR0 W;  1PZJ D;  2F0W A;  1CSQ A;  1JJC B;  3HZX A;  4HCS A;  4YY3 Q;  1L1O A;  3CCS A;  1D5M C;  2BA1 A;  3BZD B;  3CCU A;  2EYP A;  4IUV A;  1SE2 A;  1A63 A;  1VQJ A;  3F1Z A;  1PFM A;  3SE0 A;  3W1B A;  4WFN 3;  1U4P A;  4EQN A;  2R7Z G;  2QW7 A;  1B9N A;  5DNF A;  5CV7 A;  1WTO A;  2RDH A;  1PRT D;  4R9W A;  4X6A H;  4JI0 Q;  1Q90 A;  4AQY Q;  3IAY A;  2O4X A;  1HNW Q;  1II3 A;  4QCL A;  3CC7 A;  1BCP F;  3PO2 B;  1S72 A;  4EVO A;  1QVC A;  5F2D A;  1A3T A;  1GUN A;  5GRO A;  4A3I B;  4A3D G;  2VUM B;  1QUQ B;  1ESF A;  4JI8 L;  3TEH B;  5JOB A;  3NK9 A;  1ICF B;  2KHJ A;  1GJX A;  4IN3 A;  3U9S A;  3NUC A;  4B3M L;  1PFS A;  2K6A A;  1R9T H;  4ZK9 B;  2K52 A;  1FJG L;  2F0H A;  1VQO A;  1H9K A;  2YV5 A;  4M8A A;  3J7A F;  2Z6K A;  2EYJ A;  3SR1 A;  3HOV G;  1WTX A;  4POG A;  3B6Y A;  3OHX C;  4Y52 H;  4K2L A;  1G6P A;  3EN2 A;  3T1Y L;  1EYD A;  4A3E G;  3OIP A;  1Y1W G;  1VQN A;  4BY7 B;  4HIK A;  1W6K A;  1NCV A;  5A35 A;  1AE2 A;  2CWP A;  1DZ1 A;  4GLA C;  1E2W A;  1PLF A;  1TWF B;  2VQE L;  1GUG A;  3R3O A;  4RG1 A;  4LF8 L;  5I4D A;  1VQG A;  2F3V A;  1IKM A;  1VQA A;  5JJI A;  1TWC B;  4HMJ A;  4IPG A;  2F0E A;  2NVT B;  1V43 A;  1C4Q A;  3E5S A;  2OT2 A;  4OGQ C;  2ZJP A;  1XNQ Q;  4A3B H;  2CWA A;  1QE6 A;  4KKT A;  3ND8 A;  1CKN A;  2FIN B;  4LW1 A;  2AKW B;  4J6H A;  4DNI A;  2F03 A;  4WJ3 M;  2PNR C;  3R8B A;  2L11 A;  4GNX B;  1IBL Q;  4WJW A;  5C5L A;  4GNX A;  2VW9 A;  2WFW A;  3PCO B;  3RN2 A;  2KQ3 A; 
#chains in the Genus database with same CATH homology
 1JMC A;  1SFO H;  3KJP A;  3OTO L;  1VQK A;  2WAQ G;  5M3M H;  3U50 C;  3J7Z C;  3HOY H;  3ICE A;  4L5Q A;  4JI2 L;  4BY1 H;  3NEL A;  1XNR Q;  4A3G G;  1E24 A;  2JA9 A;  2WB1 E;  1B8A A;  2UU9 Q;  1N9W A;  3AQQ A;  3OTO Q;  3L2P A;  4DV6 L;  4L5R C;  4QJF A;  4DV0 L;  5EAY A;  4JI2 Q;  4GOP A;  4A3D H;  4JI1 L;  5AJ3 Q;  4LNQ A;  1TWA H;  2OWO A;  4DV6 Q;  2A1A A;  5BR8 Q;  3S24 A;  2WAQ E;  2ASB A;  3FKI H;  1VCI A;  4A3L H;  1IYJ B;  4JBM A;  4HID A;  4JI1 Q;  3H15 A;  3I4N G;  4JOI C;  1Q12 A;  4A4I A;  2OCE A;  4LUV A;  2H5X A;  1PA6 A;  5IYD G;  3M9B A;  4BXX G;  3GD7 A;  2UXB L;  5C4X G;  1OXS C;  2I5M X;  4PZ6 A;  3CW2 C;  3E9I A;  3F2D A;  2QA4 A;  1J5E Q;  2GVB A;  1EFW A;  1XPU A;  2MNA A;  2F52 A;  4JC0 A;  4C3H H;  1GKH A;  1CKO A;  1IXR A;  4A3M G;  3HOX G;  1PH5 A;  3HOV H;  2RHQ B;  1EUJ A;  5IYB G;  4DV1 L;  2UXB Q;  3RLN A;  2CKZ B;  1X56 A;  4OWW B;  4IOA A;  1P8L A;  1Y1W H;  5C0X I;  3GTG H;  3CCE A;  3NBH B;  1VQ9 A;  4OWT B;  5ELO A;  4DR2 L;  3H3V I;  1Y14 B;  3CC2 A;  2JA7 H;  4LWC A;  4DV1 Q;  2MO1 A;  4P74 A;  4B3R L;  1P16 A;  3BJU A;  1VQE A;  1S3O A;  2K4K A;  4OXP A;  5IT9 c;  1XMO Q;  3S17 H;  4KI0 A;  4IO9 A;  3U4Z A;  4DUY Q;  4DR2 Q;  3GTQ H;  3M4O H;  1WCM G;  3K7U C;  4NPS A;  4B3R Q;  1X3E A;  2IX0 A;  3J80 c;  3K7A H;  1WOC A;  2YTY A;  4FDB A;  2JA6 H;  5IP7 H;  2CFM A;  4GKJ Q;  5IP9 H;  2VQF Q;  1KHI A;  4P72 A;  5LMU Q;  4JI4 L;  1GO3 E;  5IWA L;  2B63 G;  4DR7 Q;  1IZ6 A;  1OTC A;  2NZO A;  3UDX A;  4HJA A;  2Q2H A;  1VQL A;  1I94 L;  3OW2 A;  2JE6 I;  4TVA B;  2XTI A;  1EIF A;  4JI4 Q;  5IWA Q;  3RR5 A;  1HZA A;  3PUX A;  4JI7 L;  3MXN B;  4NB3 A;  5K36 G;  4DV2 L;  1B70 B;  3CPF A;  1E7Z A;  1CUK A;  1SRO A;  2UUC L;  1E22 A;  3STB D;  1M90 C;  4GOP C;  2K50 A;  1TWH H;  4JOI A;  4JI7 Q;  2R92 H;  3RZD H;  2ZTE A;  3RN5 A;  3BZC A;  4KHZ A;  2UUC Q;  1Q81 C;  3PUV A;  1VQH A;  4B3S Q;  3PO3 G;  2MFI A;  1X55 A;  1YHB A;  3GO5 A;  4UP8 A;  3ULL A;  4A3C G;  5E7N A;  4P71 A;  1U0L A;  3CCL A;  1UE5 A;  3TS0 A;  1HZB A;  4R4C A;  3TRE A;  1XNQ L;  2VY3 A;  2YYZ A;  4ME3 A;  4GKK L;  4HJ5 A;  4OX9 Q;  3A0J A;  2OTL A;  4IPD A;  1Q46 A;  1YBY A;  5JEA G;  2B3G A;  2ZTC A;  2HHH L;  4DV7 Q;  3UDF A;  3PIP A;  2OQK A;  1MJE A;  4C2M H;  1A8V A;  2LXK A;  2ZTD A;  5FJ8 G;  4A76 A;  4DR3 L;  2AWO A;  2R7D A;  1X9N A;  3I56 A;  4NXM L;  1PH2 A;  1LYL A;  1O7I A;  2FXQ A;  3G6E A;  1CKN B;  4X65 L;  4GKK Q;  2ALY B;  1E3P A;  1SE8 A;  2D62 A;  5H1S E;  3CME A;  2HHH Q;  3S2H H;  2ZJR A;  2XGT A;  2LSS A;  4MZ9 A;  4DR3 Q;  1VQC A;  1N33 Q;  2Y0S E;  4NXM Q;  4K0K Q;  2R93 H;  1Y1V G;  4LF5 L;  1EOV A;  4IFD J;  2I5L X;  1A62 A;  2ATW A;  3U58 A;  4B3T L;  4H02 A;  4J15 A;  3A5U A;  3RNU A;  2PMZ E;  2R7Z H;  1XTD A;  3RLO A;  2ZM6 L;  2KEN A;  1VQM A;  1VQ5 A;  1MJC A;  3E0E A;  1L0W A;  2UU9 L;  1FVI A;  2MQH A;  4JI6 L;  4AYB G;  3KF8 B;  1I6H H;  4LF5 Q;  4B3T Q;  3S2D H;  4TQU S;  1I50 H;  1VQ4 A;  4JBK A;  4DR4 Q;  4XIG S;  1JJG A;  2ZM6 Q;  1W2B A;  5AJ3 L;  1N36 L;  5LMN L;  3NEM A;  2RHS B;  3SGI A;  1PH9 A;  2JA5 H;  4QQB X;  4R4Q A;  4GOP B;  1NMG A;  1YJW A;  4JI6 Q;  3CCM A;  5BR8 L;  2A8V A;  3F2C A;  3JAM i;  2N8N A;  2UXD Q;  2EXD A;  3KJO A;  3VDY A;  1SLJ A;  5GAH C;  5FLX c;  1WCM H;  4GN5 A;  3J7A 5;  2HQL A;  1N36 Q;  5LMN Q;  2AWN A;  2RCN A;  4PZ7 A;  3HKZ E;  1PH1 A;  3GTJ H;  3PO2 G;  1UE6 A;  4A93 H;  3H0G G;  3HKS A;  4AYB E;  4DR1 L;  1KIX A;  4BA2 I;  4DR6 L;  1K83 H;  2IHE A;  3T1H Q;  4A3I G;  1J5E L;  2VUM G;  3G48 A;  5C4J H;  3M85 A;  3HOW G;  2UXC L;  1EIY B;  3CP0 A;  4IPH A;  1WI5 A;  3H3V H;  4APV A;  2WP8 J;  2C35 B;  2R7F A;  3PUZ A;  1RIP A;  5J3B A;  3ZJY C;  4DR1 Q;  4DK6 C;  3CCV A;  4DR6 Q;  4KHP L;  4JI5 L;  4JBJ A;  3M7N A;  1BBW A;  2Q2U A;  1VQD A;  3J81 i;  5HY6 A;  4UY8 C;  2UXC Q;  1I3Q H;  3NEN A;  4JI3 L;  4A75 A;  3HOU G;  1Z9F A;  1VQI A;  4KHP Q;  4A3J G;  4JI5 Q;  4HIM A;  2JEA I;  4YCV A;  1K9M C;  1YEZ A;  4DAY B;  3W1G A;  5IYC G;  4A3E H;  4DK3 C;  1NTG A;  1XMO L;  4JI3 Q;  4A3B G;  2Q2T A;  3PUY A;  1YHQ A;  3GTO H;  3KOJ A;  4DUY L;  5FLM G;  4OON A;  1LM0 A;  1CKM A;  1N32 L;  1Q86 C;  3PO3 H;  3A5Z B;  1MIU A;  1NBW A;  4MNO A;  1PH4 A;  3I4M G;  3TS2 A;  4A3C H;  4BY7 G;  4GKJ L;  3UE1 A;  2VQF L;  2CCZ A;  1GVP A;  3CC4 A;  2D0P A;  2E8G A;  5LMU L;  4YCU A;  3K0X A;  3F2B A;  1PH6 A;  1D7Q A;  5GAE C;  4LF6 L;  1L2F A;  2GN5 A;  4DR7 L;  1N32 Q;  1M1K C;  1VQF A;  1SR3 A;  3JAM c;  1YJN A;  2E2I H;  2NN6 G;  2CQO A;  3HOZ H;  1VQ7 A;  4A3L G;  3Q8D A;  2JA8 G;  1X54 A;  4P75 A;  5LMN W;  5FJ8 H;  4LF6 Q;  2RF4 A;  1DGS A;  2R6G A;  4LFA L;  3GTK H;  2JEB I;  1LUZ A;  1D8L A;  1C9O A;  1VS0 A;  1KC8 C;  4DAM A;  1VQB A;  5M3F H;  4DV4 L;  2HT1 A;  4JV5 L;  5M5W H;  1HJP A;  1IBK L;  1G29 1;  3L0O A;  2HIV A;  1IBM L;  1KAW A;  4UP7 A;  4LFA Q;  4AIM A;  3CCQ A;  2K14 A;  4YCW A;  3ERS X;  5GQO A;  5GAG C;  3J81 c;  1RL2 A;  3I2Z A;  1IL2 A;  2HIX A;  1JT8 A;  4DV4 Q;  1QUQ A;  4JV5 Q;  4B3S L;  1IBK Q;  3L7Z C;  3CD6 A;  3FKI G;  4QL5 A;  1PV4 A;  1YZ6 A;  4BBS G;  1IBM Q;  1AH9 A;  2K5V A;  1HZC A;  3U4V A;  1VQ6 A;  4BXX H;  2VL6 A;  1GM5 A;  3TQY A;  4DR5 L;  2N78 A;  4HJ8 A;  2IX1 A;  3TRZ A;  1W3S A;  3PF4 A;  1YJ9 A;  2PI2 A;  4OX9 L;  2IHF A;  5M5X H;  4A3G H;  3F8T A;  4OO1 I;  3KYH C;  3GTP H;  1HZ9 A;  4IPC A;  2NVY H;  4DR5 Q;  5C44 G;  1A0I A;  4DV7 L;  1H95 A;  2DGY A;  1J6Q A;  2VNU D;  1SRU A;  4C3J H;  3S1M H;  4DV3 L;  3D0F A;  3ER0 A;  3ULP A;  1X3F A;  2UUB Q;  4DR4 L;  3DM3 A;  3H0G H;  1PH3 A;  3CQZ H;  2NZH A;  4DPG A;  1XJV A;  4K0K L;  2BA0 A;  1CSP A;  3PV0 A;  4DV3 Q;  2JA7 G;  2NVQ H;  2UUA L;  4WJ4 A;  4X64 Q;  1C7Y A;  3PGZ A;  3HOW H;  3I4N H;  3PIO A;  4HIO A;  3I4O A;  4YWM A;  3UDI A;  4O2D A;  4OO1 G;  5IYD H;  4DV5 L;  3WWV A;  1K73 C;  1L1O C;  5C4X H;  4A3K G;  2UUA Q;  1X3G A;  1G51 A;  1X6O A;  4P73 A;  2JA6 G;  2AMC B;  4EX5 A;  2EIF A;  1V1Q A;  3ULJ A;  2I5H A;  5C0X J;  4A3M H;  2VQE Q;  1HR0 Q;  3HOX H;  1ASZ A;  4DV5 Q;  2IY5 B;  4IJH A;  1YI2 A;  5IYB H;  3GTM H;  4LF8 Q;  1QVF A;  3S1Q H;  1KRT A;  2NVX H;  3EBE A;  4L5T A;  1KL9 A;  1YIJ A;  2UXD L;  2IT1 A;  2ZJQ A;  1PVO A;  1EQR A;  4OWX B;  1PYS B;  5FLM H;  4EQ5 A;  1HNZ L;  1Q82 C;  4LFC Q;  1KRS A;  4ALP A;  5M5Y H;  1XMQ L;  1WJJ A;  1VQ8 A;  2WB1 G;  4R1J A;  4GLV B;  2JK8 A;  5IY0 A;  1K8G A;  2BH8 A;  3T1H L;  1UE7 A;  2JJQ A;  4IOC A;  1NJI C;  2YU9 H;  1BKB A;  4R4O A;  1JB7 A;  2OQ0 A;  2ES2 A;  1HNZ Q;  2E2H H;  1Q1B A;  4QY7 A;  1XMQ Q;  1JE5 A;  1WFQ A;  5C3E G;  3J81 j;  3IRB A;  1EQQ A;  3GTL H;  2R92 G;  5JJL A;  2D0O A;  3CXC A;  4JYA L;  2QGQ A;  4UP9 A;  4LUZ A;  2L15 A;  2F4V Q;  2JA8 H;  3EIV A;  1HNX L;  4PG3 A;  1TWG H;  2V1C C;  4YWK A;  4GLX A;  2I0Q A;  1TWC H;  3RLF A;  2B63 H;  4LFB L;  2E5L L;  3S1N H;  1E1T A;  3K81 C;  4GN4 B;  4YWL A;  2NVT H;  4JYA Q;  2KCM A;  2Z0S A;  4LF7 L;  3G71 A;  4HJ9 A;  1HNX Q;  4JBW A;  3J80 i;  3UE0 A;  3BU2 A;  2PQA B;  5JEA J;  2E5L Q;  1PYB A;  4LFB Q;  1OXU A;  4YY3 L;  1BBU A;  2Z6K C;  3K80 C;  4O0A A;  5DLQ E;  4QGU A;  2PQA A;  1KD1 C;  2K75 A;  2N49 A;  1FGU A;  2NN6 I;  3FP9 A;  1EWI A;  4YHH L;  4LF7 Q;  4QIW E;  2Q2I A;  1X65 A;  1GD7 A;  3MEF A;  2KCT A;  4LUO A;  1L1O B;  4XTC S;  4DV0 Q;  3PF5 A;  1HR0 W;  4BBS H;  1CSQ A;  1JJC B;  2PNH A;  4YY3 Q;  1AE3 A;  3S16 H;  2OTJ A;  3CPW A;  1L1O A;  3CCS A;  4BBR G;  4UPA A;  4YHH Q;  2R93 G;  1UE1 A;  2BA1 A;  3CCU A;  1A63 A;  1Q1E A;  5IE8 A;  1VQJ A;  2PI2 E;  3F1Z A;  3W1B A;  1YVC A;  4JI0 L;  5C44 H;  5ELN A;  1XPR A;  4A3F G;  3CF5 A;  3BZK A;  4JG2 A;  1KQS A;  4R4I A;  4AQY L;  3K8A A;  5HGQ A;  2R7Z G;  1HNW L;  2KHI A;  4DUZ L;  4IFD I;  3S1R H;  4X6A H;  3KLW A;  4JI0 Q;  2JQO A;  3LGJ A;  5M3M G;  3HOY G;  1WYD A;  4PZ8 A;  1SMX A;  4BY1 G;  1T9H A;  4AQY Q;  2GVA A;  1HNW Q;  1OXX K;  2QEX A;  3S14 H;  2YTX A;  3PSI A;  2B29 A;  1SN8 A;  1Z47 A;  3CC7 A;  4DUZ Q;  1ASY A;  4KLK A;  2JA5 G;  1PH7 A;  1S72 A;  1QVC A;  3S15 H;  4MTN A;  5GRO A;  3PUW A;  1Y1V H;  4A3D G;  4PMW A;  1QUQ B;  2ID0 A;  4JI8 L;  1B7Y B;  3TEH B;  4A3K H;  4LF4 L;  2LXJ A;  1S40 A;  2KHJ A;  4A93 G;  3D31 A;  4IFD G;  4X62 L;  2YTV A;  4B3M L;  2A19 A;  3M4P A;  1YNX A;  5C0X G;  1PFS A;  2AHO B;  4JI8 Q;  1OXT A;  4GNX C;  1R9T H;  4LF4 Q;  4LF9 L;  1U5K A;  1NMF A;  2K52 A;  4X66 L;  1V9P A;  4JCV E;  4RMF A;  4X62 Q;  1QVG A;  4POF A;  1VQO A;  1LTL A;  1Q7Y C;  4B3M Q;  1FJG L;  1PHJ A;  1EYG A;  1YIT A;  2YV5 A;  2UUB L;  4LF9 Q;  3M4Q A;  3RZO H;  2Z6K A;  1JJ2 A;  3W5O A;  4X66 Q;  3HOV G;  3CMA A;  4POG A;  3B6Y A;  1FJG Q;  2BH2 A;  1I94 Q;  4Y52 H;  4X64 L;  2K5N A;  1XPO A;  4HJ7 A;  3EN2 A;  1BVS A;  3T1Y L;  4A3E G;  1Y1W G;  1G6P A;  1VQN A;  3CCR A;  3OYY A;  3PO2 H;  3M3Y H;  5C3E H;  1QZG A;  1E1O A;  4HIK A;  1TXY A;  3GDE A;  4C3I H;  4DV2 Q;  1MKH A;  1NE3 A;  4A3I H;  1AE2 A;  2CWP A;  2VUM H;  4BA1 I;  3G4S A;  3KFU A;  2KBN A;  4GLA C;  3T1Y Q;  3CAM A;  3JC6 6;  1HR0 L;  1OXV A;  1I5F A;  2F3I A;  3KDF B;  2VQE L;  1NY4 A;  4RG1 A;  1N33 L;  4LF8 L;  1VQG A;  1QZH A;  2Y0S G;  1VQA A;  2MO0 A;  3KDF A;  3CCJ A;  5JJI A;  4AH6 A;  5JJK A;  3AYH B;  1Q8K A;  4IPG A;  5IP7 G;  1UEB A;  2K5H A;  1YHA A;  3HOZ G;  3I7F A;  5IP9 G;  3FHW A;  4NXN L;  1UWV A;  1V43 A;  4IJL A;  1N8R C;  3HOU H;  2DUD A;  1K3R A;  4A3J H;  1PH8 A;  1K0R A;  4LFC L;  1N34 L;  2E2J H;  1C0A A;  3E9H A;  5IYC H;  2ZJP A;  1XNQ Q;  3UDG A;  5GAD C;  2CWA A;  2VZA A;  1K8A C;  4A3B H;  3I55 A;  3KF6 B;  1IBL L;  5M3F G;  4NXN Q;  1KXL A;  3AFP A;  4L5S A;  3A74 A;  3HFZ B;  4R4T A;  1CKN A;  4GN3 B;  4BBR H;  1N34 Q;  1VQP A;  3KF6 A;  2AKW B;  4LW1 A;  3I4M H;  4DNI A;  4WJ3 M;  4X65 Q;  3AEV A;  4BY7 H;  4DKA C;  1HH2 P;  4GNX B;  1IBL Q;  2F4V L;  2EQS A;  4GS3 A;  3AFQ A;  2VS1 A;  4A3F H;  1FL0 A;  4GNX A;  1XNR L;  4Y7N H;  2VW9 A;  2WFW A;  3DLL A;  1TWF H;  3PCO B;  3RN2 A;  3STB C;  3HKZ G;  2N3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...