4DV0Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 16
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv0Q00
3LGJA 2JA8G 1VQ6A 4JV5L 3CPFA 4JBJA 5JEAJ 4IPCA 1PH1A 1CKNA 3A0JA 2K50A 3FKIG 4O0AA 1A8VA 1VQ7A 2OCEA 3S17H 4DR4L 4X6AH 2I5MX 3STBC 2VW9A 2YV5A 2RHSB 2K5NA 3BZKA 2UXBQ 1E7ZA 1YVCA 2E5LQ 2R92H 2QA4A 3U50C 3HOYG 1X6OA 3CMAA 2Q2TA 3S1MH 1VQBA 1I3QH 4YY3L 4R4OA 1EIFA 2ZM6Q 1XNRQ 5JJLA 4GLVB 4A93G 1CSPA 5FJ8G 3PUWA 5GAGC 4KHPQ 4AIMA 1V43A 1Y1VH 5IYDH 3RLFA 1QVCA 2VL6A 3K7UC 3S2HH 3GTJH 3K8AA 4A3DG 1K9MC 1VQDA 1N9WA 3NEMA 1UE1A 1G51A 1ASZA 4DUZQ 4WJ3M 3AFQA 3CD6A 5GQOA 5IYCH 3TQYA 1YIJA 2DGYA 3BZCA 4HIDA 2PQAA 3NBHB 3S24A 4AQYL 4YHHL 1IBML 2KCTA 4IPHA 1CKMA 3HKZE 2ZJQA 2ZJRA 2UXCL 2YYZA 4LWCA 1B7YB 2L15A 5C0XI 2K14A 2KBNA 4X64Q 1WYDA 1JE5A 3J81c 5M3FH 1P16A 1X3GA 2F52A 3HOXG 1UWVA 2E2JH 4LFBL 1X55A 4P71A 1YHQA 3H0GH 5E7NA 1TWGH 2GVBA 3PIOA 1D8LA 1NE3A 3RN5A 2Q2IA 1J5EL 2OTJA 1Y14B 2VNUD 2UU9L 3CW2C 4GN4B 3PO2G 1PH9A 4HIMA 1N33L 4APVA 2JEBI 4R4CA 5C4XH 4A3IG 5C0XG 1K83H 3HOWG 1V1QA 4BBSH 4IJLA 1YITA 1KD1C 1X65A 2R7FA 3I56A 1I94Q 3M4QA 5HGQA 1N32Q 1SLJA 1C0AA 4BBRH 2FXQA 4X66Q 3J81i 1L1OC 1IBKL 1IL2A 4JYAQ 3T1YQ 2BH8A 4A3BG 1PH3A 4L5SA 4Y7NH 5LMNL 4JI3Q 4JC0A 4X62Q 2BH2A 2UUBQ 1YBYA 2YTVA 4OX9L 2F4VL 2OQ0A 5AJ3Q 3CMEA 1W3SA 1YZ6A 3B6YA 2NVTH 3I4NH 1O7IA 2QGQA 3PGZA 4LFAQ 4IJHA 3HOVH 4K0KL 2RF4A 2LXKA 4PZ6A 3RN2A 1KQSA 4LF7L 5FLMH 3PV0A 3M85A 4DV2Q 4DV5L 2JA5G 2R7ZH 1Q1EA 5GROA 1V9PA 4JBWA 1VQOA 3ULLA 4B3ML 3PIPA 3TS0A 2KHJA 4JOIC 1MIUA 2Q2UA 4GOPC 1U5KA 4JI8Q 4DV4Q 2NVQH 3H3VI 3HOUH 1XMQL 4IO9A 3ERSX 3PO3H 4A3KH 4MNOA 4A3JG 1EYGA 5IWAL 2VQFQ 4DV1L 1N8RC 4LFCL 4EX5A 1PYSB 2JA9A 2VQEQ 3CF5A 1D7QA 1Y1WH 1PH7A 3JC66 1Q46A 1C9OA 3MXNB 4LF9L 4A3LH 3KFUA 1HR0L 1SN8A 3PSIA 4A3EH 4LF6Q 1L0WA 1HZ9A 2WAQG 4DV0L 4B3RQ 2B63G 1KXLA 4LF5L 2YTXA 1Q7YC 3T1HQ 3K7AH 4UP7A 4HJ5A 1PH6A 3AFPA 1MJCA 1GO3E 4PG3A 4BY1G 4A76A 4A3FG 1EWIA 2JK8A 4R4TA 3RZDH 3K80C 1PH8A 4LF8Q 3I4MG 1XMOQ 1VQKA 2UUCQ 3F8TA 1CKOA 1AE3A 3H15A 1XPRA 3S2DH 3J7ZC 1SE8A 2CWAA 1WOCA 3ULPA 1PH5A 1BKBA 2PI2A 4PZ7A 4DV3Q 1N34L 3RLOA 4DR1L 4DUYQ 3ZJYC 3F2DA 2MO1A 3Q8DA 2F3IA 4UPAA 4AYBE 4GNXC 1YI2A 1GVPA 1YJNA 4GOPB 2UXDQ 4QY7A 4POFA 4A75A 4A3MH 4HJ8A 4JI1L 4NXNQ 2EXDA 1I5FA 2IHEA 2XTIA 3GO5A 3KDFB 2E2HH 4NXML 3SGIA 1KL9A 4LNQA 5C44H 1G291 1HJPA 5DLQE 1K0RA 4PMWA 3OW2A 1K8GA 1JJGA 4JI5L 3E9IA 4L5RC 4B3SL 1FJGL 2LSSA 3FKIH 4JCVE 1JJCB 1M90C 5JEAG 3UDIA 1K8AC 4IPDA 1IZ6A 2IX0A 1X3EA 3JAMc 1Q86C 2N8NA 2IX1A 3HOYH 4OXPA 1N36L 3UDXA 2MQHA 4GKKQ 2E8GA 2A1AA 5K36G 1IYJB 3DM3A 4DR7L 1GKHA 5FJ8H 3STBD 3CCSA 2WB1G 3KJOA 1HNZQ 1SRUA 2B29A 3HOZG 1VQAA 2D62A 1WJJA 2Y0SE 1Q82C 1VQ8A 2NZOA 3UDFA 5IT9c 2AWOA 4GNXB 5IYBG 3TS2A 1YJWA 1WFQA 1VQ9A 5HY6A 5BR8Q 3JAMi 1XNRL 3GDEA 1KRTA 4DR5Q 2ZTEA 3IRBA 1RIPA 1I6HH 3UE0A 1EOVA 3D0FA 3A74A 5C3EG 5M3MG 1YNXA 3KDFA 3CCEA 1S40A 2OWOA 4H02A 1FL0A 1TWAH 2XGTA 4RG1A 1PHJA 5EAYA 2HIVA 2NVYH 3HOXH 4JG2A 1EUJA 2R7DA 3F2CA 2WP8J 1BBUA 1VS0A 4DPGA 1C7YA 4P73A 2JA6G 2Z6KC 1MJEA 1L2FA 3GTMH 3PO2H 4BXXG 2JJQA 3EIVA 3K81C 1IXRA 5H1SE 1Z47A 4X64L 4UY8C 1A63A 1IBMQ 1YHAA 3HOWH 2I0QA 2HHHL 1NJIC 3S1RH 3J81j 2CCZA 3GTLH 4A4IA 4EQ5A 1JB7A 1KHIA 4HJAA 3GTPH 1Q81C 3S1NH 3M4OH 3S1QH 2UU9Q 3I4OA 3KF6B 4GKJQ 1N33Q 4DR3L 4AH6A 3U4ZA 1I94L 1N32L 3U4VA 4X65L 4GS3A 4X66L 1E1OA 4BA2I 3TEHB 4WJ4A 3T1YL 5GAEC 1VCIA 1OXXK 3G6EA 1JMCA 4A3CG 4LUZA 2DUDA 5IP7H 5GADC 3GTKH 4JI7L 3KYHC 4LUVA 2AKWB 1XNQL 1IBKQ 1QUQB 1BVSA 2RHQB 1DGSA 3S14H 1HNXL 4TQUS 5C4XG 1HNWL 2KHIA 4B3TQ 1NY4A 5LMNQ 1WCMH 3F1ZA 3W1GA 4BBSG 1VQCA 4DV6Q 3CCMA 1VQNA 4GLAC 3FHWA 1NTGA 5GAHC 2F4VQ 5LMUQ 2N78A 1GM5A 3CC7A 1VQ4A 3S15H 1X3FA 3MEFA 3PCOB 1IBLQ 4DV2L 3S16H 1JT8A 1JJ2A 4XIGS 3FP9A 1FVIA 3OTOQ 2NN6I 3KJPA 1PFSA 1L1OB 4JBMA 4Y52H 1KRSA 1LYLA 1FGUA 4DV4L 4JI8L 1KC8C 1LM0A 1EQQA 4B3MQ 4C3JH 3H3VH 1QVFA 5JJKA 3RZOH 2E2IH 3HOVG 1E1TA 3W1BA 4YWKA 4DR2L 1XMQQ 4NPSA 3RLNA 2D0PA 2EIFA 4OONA 3I4MH 4BY7G 5IP9H 2R7ZG 2NN6G 1MKHA 2H5XA 5IWAQ 3HFZB 4DV1Q 1U0LA 1PH2A 3F2BA 4LF6L 4DR6L 3KLWA 2B3GA 4B3RL 4O2DA 3NENA 2UUAQ 1VQEA 2JQOA 3T1HL 1QZGA 1QVGA 1HR0Q 2VUMG 2R93G 3BU2A 4JI4Q 4JI6L 2OQKA 4YWMA 3A5ZB 4LF8L 3AYHB 1XMOL 1PH4A 2UUCL 2GN5A 4P74A 5C4JH 3CAMA 4DV7Q 2K5VA 1SR3A 4QIWE 1AE2A 1BBWA 3CC2A 4LF4Q 2JE6I 3HKZG 4KHZA 4R4QA 4DV3L 4UP8A 1LUZA 3U58A 4A3EG 2Z0SA 1R9TH 4JI0L 3NELA 4OO1I 2UXDL 4A3GG 2K52A 4DK6C 3CCVA 1L1OA 2JA8H 1KIXA 2JA7G 2BA0A 4C3IH 1HZAA 2VZAA 3HKSA 2D0OA 2VS1A 1X9NA 1NBWA 1XPOA 4C2MH 1NMGA 5IE8A 2LXJA 3CXCA 2CWPA 4JI2L 3L2PA 2KENA 1K73C 4OO1G 4A93H 1Q12A 2KCMA 1VQLA 4JI5Q 4FDBA 2ES2A 1XJVA 1HH2P 2CKZB 3J80c 4A3MG 4YCWA 4A3DH 1M1KC 2E5LL 4JV5Q 2UXBL 5FLXc 1X56A 3M7NA 1VQFA 2EQSA 4GN3B 4L5QA 1N36Q 4DR4Q 1PVOA 3BJUA 1VQHA 1OXTA 1ASYA 2YU9H 4JBKA 4IFDJ 3W5OA 2ZM6L 4JOIA 4DNIA 3PUYA 3EBEA 1J6QA 4DR7Q 5C3EH 5M3MH 2ASBA 4KHPL 4GOPA 2MO0A 4YY3Q 3ICEA 2ZTCA 4XTCS 3CQZH 3UE1A 5BR8L 1OTCA 2PNHA 4DR5L 2WAQE 4LUOA 4DUZL 4HIOA 3J80i 4YWLA 2JA6H 2R92G 2MNAA 1KAWA 1TWCH 1YEZA 3M9BA 2QEXA 4BXXH 1CUKA 4J15A 4DAMA 1PA6A 1VQIA 3E0EA 2I5HA 4DAYB 2ATWA 1Y1VG 4R1JA 5IYDG 4AQYQ 1TWFH 3K0XA 4A3IH 4YHHQ 3GTGH 4P72A 3OYYA 2I5LX 2UXCQ 2ALYB 1S3OA 1EQRA 3L7ZC 4HJ9A 1A62A 1OXSC 4GN5A 3CP0A 3AQQA 4LFBQ 1XPUA 2PMZE 5IYCG 2R6GA 4DKAC 1FJGQ 1J5EQ 4A3BH 2NVXH 4GNXA 1UEBA 2K75A 1K3RA 4YCUA 3KF8B 2YTYA 1VQMA 1H95A 4TVAB 2A19A 2HHHQ 4NB3A 5M3FG 1B70B 4UP9A 4A3CH 1UE7A 3CCJA 4JYAL 5ELOA 4ME3A 3H0GG 4GKJL 3G4SA 1E24A 3GTQH 1G6PA 2K5HA 4JI3L 1X54A 1I50H 1TXYA 3I7FA 4X62L 4R4IA 2UUBL 2JA5H 5C0XJ 1LTLA 4AYBG 5AJ3L 4DR3Q 1A0IA 4QQBX 1OXUA 5M5XH 2WB1E 4X65Q 4P75A 1UE6A 2JEAI 4HIKA 4OX9Q 4LFAL 4BBRG 4DK3C 4B3TL 3E9HA 4JI7Q 1YHBA 1XNQQ 3CCRA 4A3JH 2HT1A 1NMFA 3L0OA 4MTNA 4DV6L 4MZ9A 1HNXQ 4K0KQ 1SROA 5LMUL 1HNWQ 2IHFA 4LF7Q 2IT1A 4QGUA 2ZJPA 4DV5Q 3M4PA 3G71A 3CCQA 1IBLL 1CSQA 2AHOB 4QJFA 2VY3A 2GVAA 3PUVA 5IP7G 5ELNA 3OTOL 3CC4A 2B63H 3KF6A 3D31A 3CPWA 1Q8KA 3I4NG 4BY7H 2VQFL 2WFWA 1HZBA 1EFWA 4BY1H 3RR5A 3ULJA 4A3FH 1B8AA 1SFOH 2VQEL 3VDYA 3GD7A 5FLMG 1WCMG 4IOAA 1AH9A 5IY0A 3A5UA 2C35B 2Y0SG 1WI5A 4KLKA 2VUMH 1TWHH 3PF5A 4LFCQ 2R93H 1XTDA 2Q2HA 4LF9Q 1QUQA 1RL2A 1UE5A 2PI2E 2AWNA 2Z6KA 3AEVA 2MFIA 3PUZA 4IPGA 4QL5A 4PZ8A 4DV0Q 1EIYB 3HOUG 1E3PA 1SMXA 2ZTDA 4L5TA 4DR2Q 3PO3G 4BA1I 1P8LA 1VQJA 5LMNW 4A3KG 1YJ9A 4LF5Q 5J3BA 3I2ZA 3DLLA 1PV4A 2UUAL 3I55A 4LW1A 4GLXA 1CKNB 2N3SA 4IOCA 1Y1WG 3TRZA 4JI4L 4A3LG 4DR6Q 4KI0A 3KOJA 2HIXA 5M5WH 4A3GH 4DUYL 2JA7H 3ER0A 1PYBA 2K4KA 4JI6Q 2NZHA 4DV7L 2RCNA 2V1CC 3PF4A 3WWVA 4LF4L 1N34Q 2OTLA 5IP9G 4DR1Q 1W2BA 4NXNL 3UDGA 4C3HH 2BA1A 4POGA 2CQOA 2IY5B 2ID0A 1T9HA 5JJIA 4OWTB 4JI1Q 4OWWB 4IFDI 3RNUA 4ALPA 4NXMQ 1VQGA 4JI0Q 2HQLA 3HOZH 2CFMA 3J7A5 2A8VA 1E22A 3M3YH 1S72A 4YCVA 2N49A 3CCLA 4OWXB 5M5YH 4B3SQ 3PUXA 1VQPA 4RMFA 1HZCA 1Q1BA 2PQAB 3TREA 1QZHA 3EN2A 4GKKL 3GTOH 5IYBH 1Z9FA 2AMCB 4HJ7A 3CCUA 1HR0W 1GD7A 1HNZL 4IFDG 3G48A 5C44G 4JI2Q 1OXVA 1VQ5A
chains in the Genus database with same CATH superfamily
3LGJA 1DOLA 5EKIA 5M9OA 1HRJA 2P5ZX 1CQFA 1PH1A 2F1MA 1KNEA 3FKIG 2K50A 3OSOA 4O0AA 1A8VA 1VQ7A 2G9DA 2VW9A 3BZKA 1EEID 1E7ZA 1TVXA 1WD1A 1HQRD 1UNSA 5IGGA 3S1MH 5CR3A 5JJLA 1XNRQ 1NR4A 1SSOA 2R61A 3RLFA 4HEDA 1A15A 3NEMA 1UE1A 2JXMB 3AFQA 3DMUA 5IYCH 1KLUD 1HCZA 4HIDA 3NBHB 2R3ZA 3S24A 4IPHA 4G57A 2QCPX 3HKZE 1TY0A 4NKLA 3ND9A 5ELCA 2ZJQA 4LWCA 1STYA 2KBNA 1WYDA 5D3DA 1P16A 1X3GA 1UWVA 3EROA 4P71A 5ELEA 3J81L 1J5EL 1NE3A 3I4LA 5A35A 2UU9L 3TMEA 3HOZB 2O2LD 2IJ0A 2C5CA 4GN4B 3M3YB 2JEBI 4CJ0B 5C0XG 5M5YB 1K83H 1V1PA 1CQVA 1I4PA 1QWYA 2Q8RE 5EKLA 3SXHA 2PPBC 4EQNA 1I94Q 1SLJA 4K6DA 4XT1B 2YU9B 2VXWA 1EY6A 2BH8A 3A55A 2EYMA 4A3BG 4L5SA 4Y7NH 1F2LA 4G7HC 4HSPA 3S17B 3D4DA 1F9PA 4OL7A 1JB3A 1W3SA 2O4XA 3C1FA 4IQZA 4NMZA 4IJHA 2LXKA 1XTCD 5FLMH 1UUPA 4DV2Q 2JA5G 2KJXA 1Q1EA 5GROA 4R9WA 1V9PA 2G9HD 4KD3A 5FLXE 3PIPA 1AN8A 3DEOA 4DV4Q 2ZXRA 3H3VI 4KY6A 3HOUH 3R2TA 3PIP3 1ICWA 1EYGA 2D5DA 4LFCL 3JC66 3MXNB 5IGCA 1SNCA 4L8JA 3VR2A 2WAQG 4B3RQ 1TWGB 2NTTA 2YTXA 2F0KA 1IKLA 3I73A 5C5MA 3U9SA 3T1HQ 1MJCA 3KUPA 4R4TA 5C4XB 1XMOQ 2UUCQ 1TU2B 3H15A 4K2LA 1TY2A 3J7ZC 2CW0D 1SE8A 2F0WA 1PH5A 1CT1D 3SE0A 4DV3Q 4IUQA 3VA7A 2MO1A 4FF2A 3MC0B 4L6TB 1EZ8A 4QY7A 4A3MH 3EQLC 4NXNQ 2EXDA 4OEMB 2E2HH 1STAA 4FXKC 5JVG3 2SEBD 1HJPA 4PMWA 3NSWA 1K8GA 4RKBA 4KK7A 2EJFC 4L5RC 2OXPA 4KJNA 4JCVE 1M90C 1JJCB 3HOVB 3MXNA 1CI3M 1DJRD 1LT4D 1NNXA 2RQXA 2LKVA 4IPDA 1SDFA 4OXPA 4RCNA 2R7ZB 1CA6A 4GKKQ 1RHPA 5FJ8H 3R3OA 3KJOA 2NVQB 3HOZG 1VQAA 3SDZA 2D62A 2NZOA 3UDFA 4DXGA 2MHVA 5J22A 5IYBG 3TS2A 1WFQA 2B2YA 4OHJA 3HKZB 3GDEA 2DJFC 4A3EB 2ZTEA 3D0FA 2NUCA 1YNXA 3LX0A 1WTQA 1FL0A 4IUTA 1ONLA 1SE4A 2F0PA 1LTBD 2F3VA 2R7DA 3F2CA 3S2DB 4DPGA 4KN4C 4N8FA 1L2FA 3GTMH 3X3NA 4BXXG 4X64L 3WOFA 4UY8C 3MXPA 1YHAA 1KAAA 3S1RH 1WTRA 1HQMC 2HCCA 4XYQA 4HJAA 1Q81C 4K8IA 2L55A 4XDXA 4F88A 4XQQA 3I4OA 3KF6B 5CORA 1Q3LA 3HOYB 4V0BA 4X66L 1GOZA 2AKWB 5JOBA 1QILA 3TSSA 1JWUD 5C4XG 1NY4A 1HTPA 3KBXA 1WCMH 3OWEB 1VQCA 3AU7A 1VQNA 2E2DC 1MSHA 2XNAC 4K14A 1DCZA 2N78A 3CC7A 3S15H 3PCOB 1IBLQ 3NBIA 3S16H 1XX8A 3KJPA 4JBMA 3K5OA 2VB3X 2NVYB 3OMCA 1LM0A 3I8ZA 5CV6A 4B3MQ 2F0NA 4C3JH 1QVFA 1KABA 2KQ3A 3HOVG 5C3WA 3PO2B 4NPSA 2EIFA 2R7ZG 2NN6G 1MKHA 5IWAQ 3HOWB 1U0LA 4LF6L 1OO9B 2IPKD 3H09A 2A5HA 5LL6X 2VUMG 2JQOA 1QVGA 1HR0Q 5I2YA 1RDPD 4JI4Q 4YWMA 4MIUA 3AYHB 4N9PA 4P74A 5C4JH 1HXYD 1FNWA 3V96A 3MA2B 5EKKA 2K5VA 1AE2A 3HKZG 4R4QA 1LUZA 3HGBA 4A3EG 3DWAA 3SEBA 4OO1I 2UXDL 4A3GG 5JEAH 3CCVA 1TS5A 3VR5A 2JA8H 4EQPA 2JA7G 4C3IH 2VZAA 2VS1A 1X9NA 1QNKA 3CXCA 3MAQA 1TKWB 2KENA 4A93H 4JI5Q 1ET9A 4FDBA 1PZKD 2CKZB 4A3DH 4L5QA 4GN3B 4IFDJ 5FLXL 3C46A 4NW2A 3EBEA 4DR7Q 3RZOB 2B2VC 5C3EH 2E2IB 5JPMC 3T4AC 2F0UA 2EVBA 3K6OA 3ICEA 3I4MB 3CQZH 1D2BA 1OTCA 4LUOA 2JA6H 2RA4A 1F9SA 1KAWA 4X3KA 2TMPA 1YEZA 2QEXA 3QOJA 1VQIA 2PMZB 3E0EA 1PFNA 4AQYQ 1TWFH 1LTTD 2UXCQ 2F0VA 1EQRA 3L7ZC 4HJ9A 1A62A 1R9TB 4LFBQ 4NP5A 2K5QA 1UEBA 2K75A 2D9UA 4CKBA 4TVAB 2RSOA 3MFYA 4UP9A 1UE7A 4ME3A 3H0GG 4GKJL 5BN4A 3K0YA 1TT2A 4JI3L 2WACA 4DU9A 1TXYA 3I7FA 4X62L 1EY7A 4H13C 2WB1E 3BYTB 3OW7A 2JEAI 4RKLA 4LFAL 1RJTA 2BDNA 4DK3C 4B3TL 1PYWD 1SJED 2CH4A 3CCRA 4KHVA 4MTNA 3JAME 4DV6L 1HNXQ 4MZ9A 4K0KQ 2O5JC 1HNWQ 1LTGD 5KRUA 2QW7A 4LF7Q 4JK1C 3O13A 2IT1A 2ZJPA 1GUNA 3M4PA 3G71A 2K7VA 3A7LA 3HP3A 1TWCB 2B63H 2KUMA 3I4NG 4BY7H 2VQFL 1HZBA 1RF2D 3GQBA 1B8AA 4A3IB 3X3MA 1AH9A 3A5UA 1I4RA 3GTGB 5KNBA 1WI5A 1TWHH 2R93H 2Q2HA 2DNEA 1H9JA 3PUZA 4PZ8A 5FO9B 4BS9A 4DV0Q 1E3PA 1SMXA 2ZTDA 4DR2Q 4JVZA 2UUAL 1EYDA 4HMJA 3I55A 5CBEE 4DR6Q 1Y1WG 1T5EA 1H9RA 2HIXA 2H1EA 4J8QA 1PYBA 2K4KA 1F9RA 4ZK9B 1N34Q 4ZAIA 1I50B 3UDGA 5JPNC 5ELFA 2WKDA 4JI1Q 3RNUA 4DA2A 4NXMQ 2H4OA 1K0SA 5EGTA 1S72A 4RGOS 4YCVA 1KNAA 1HZCA 1Q1BA 3EN2A 2RVLA 1JC7A 3NHHA 3G6JB 1GD7A 4IFDG 3G48A 1OXVA 1VQ5A 4PQXA 1D5XC 2KEEA 3L9AX 3ITPA 4JV5L 5F2DA 1ZYRC 4DR4L 4BY1B 2RDHA 3N52A 1SFOB 4X6AH 2I5MX 2RHSB 2UXBQ 1YVCA 1EZ6A 3V05A 5J1ZA 2QA4A 3U50C 1B1ZA 2E5LQ 1X6OA 2R92H 4PMCA 1I3QH 4YY3L 1NR2A 4GLVB 5KNDA 5GAGC 2F03A 1Y1VH 5IYDH 2KCCA 1QVCA 3S2HH 3HG9A 3WDNA 3EFXD 2K01A 1VQDA 5EBDA 1K9MC 2FJ2A 5KGUA 4DUZQ 1QNUA 3TN2A 5GQOA 1YIJA 4DNTB 3E5SA 2DGYA 5M5WB 1HFGA 3BZCA 3NTKA 2EJGC 4YHHL 2KCTA 2EXZA 2ZJRA 1TS3A 1B7YB 4C3HB 1EU3A 1D6EC 1JE5A 3J81c 1PMRA 2K1BA 3HOXG 2KCNA 5D65A 2GVBA 3RN5A 3J7AV 1BCPF 1D8LA 2OTJA 2VNUD 1Y14B 5NUCA 1STEA 1PH9A 4HIMA 1N33L 4A3IG 1G91A 5EJWA 4ID6A 3D4WA 1X65A 5HGQA 1N32Q 1C0AA 3OIPA 3J81i 1IBKL 4JYAQ 3T1YQ 4Q5VA 1LT3D 5LMNL 4JC0A 5IODA 4HCEA 2UUBQ 1F2ZA 5JJZA 4OX9L 2F4VL 5AJ3Q 3CMEA 1C48A 3S1MB 2NVTH 2B2VA 1JWSD 1KQSA 3BG3A 4LMQD 1HHVA 1VF7A 5IT9E 3ULLA 3V2TA 3FRPB 4X3TA 5HGTA 5I9OA 3OPOA 1SYEA 4HR7B 2X69A 4IO9A 3OWFA 1LTID 3D3RA 3PO3H 4A3KH 2NWGA 3OMGA 4MNOA 1N8RC 1D7QA 2VQEQ 2MUYA 4LF9L 1C9OA 3TP8A 1BCPB 3KFUA 3A54A 3PSIA 1L0WA 1HZ9A 4IUVA 4F8MA 3K7AH 1NUCA 4UP7A 1GO3E 4BY1G 4A76A 1EWIA 1J8IA 3K58A 4U68A 4LF8Q 1SJHD 1VQKA 1K83B 2K28A 1S5CD 1CHPD 1HUMA 2NYZD 3ULPA 5KIXA 3RLOA 4DR1L 4DUYQ 3ZJYC 1YI2A 1GVPA 4GOPB 4Y7NB 4A75A 1NAPA 2K5DA 1KDAA 2IHEA 1I5FA 4V190 4IZ8A 1BXTA 5JAVA 3DXJC 2I46A 4LNQA 1XWEA 5C44H 2KA7A 1JJGA 3SK8A 3E9IA 1FJGL 3FKIH 2IW3A 4C3HG 2IX1A 1N36L 5FK9C 5D14A 1DM0B 3I91A 2AQ3B 1JORA 3JAML 1O80A 1ZYRD 1BO0A 1GKHA 3HEJA 2WB1G 1SRUA 4DK0A 3HOUB 5DAUA 1GUSA 1QOHA 4IN3A 5IT9c 4GNXB 2IL8A 5CV8A 5BR8Q 1XNRL 4DR5Q 3HS0C 1BNZA 3A74A 5M3MG 3K59A 4CKEA 3CCEA 4H02A 1TWAH 1PHJA 4HCSA 5EAYA 1BBXC 4F7XA 4JG2A 4ZUIA 2WP8J 1M8AA 2L1BA 1H9SB 1SNDA 4DNRB 2JJQA 3EIVA 3W2DA 5C0XH 1Q90A 2EY6A 1IW7C 4CDEC 2I0QA 4A3MB 2HHHL 1NJIC 3SK5A 2RDFA 1EY5A 3J81j 3GTLH 2E2HB 4FF1A 3BZDB 3BVZA 4EQ5A 3GTPH 3S1NH 3S1QH 4C1NK 3VA5A 2UU9Q 5CV7A 1SE2A 4FF3A 3C3LA 3A8IE 4AH6A 4DR3L 1I94L 2J7ZA 3U4VA 2JYOA 4BA2I 1TS2A 4G4KA 3H6MA 1FR3A 3NBHA 1EQTA 4PNYA 3G6EA 1JMCA 4A3CG 5IP7H 3NQTA 5GADC 3GTKH 4JI7L 3KYHC 1SNPA 3KLSX 1BVSA 5BN5A 1DGSA 3S14H 2GA4B 2OT2A 2KHIA 2NB0A 2F0QA 2ENBA 2F0SA 4RFBA 5LMUQ 2J0TD 3EA6A 3P7JA 1PZID 4DV2L 1EIGA 1JT8A 1FVIA 2MGSA 1G6ZA 3OTOQ 4EQOA 3KK7A 1LT6D 4Y52H 1KRSA 1LYLA 4DV4L 4XYOA 5M3FB 3J7YW 2FMCA 3Q24A 1JICA 4MHEA 1E1TA 3W1BA 4YWKA 3GTMB 3RLNA 2D0PA 2KVMA 4OONA 1K3BC 4Z9CB 5CMDA 3H91A 1CK1A 3NQIA 2B3GA 3ONAB 4KY5A 3S1RB 4B3RL 4O2DA 3PMFA 3T1HL 1QZGA 3BU2A 4S3SA 4BBRB 1XMOL 2UUCL 2GN5A 1EYCA 3CAMA 1SR3A 1BBWA 3H3VC 2JE6I 2TSSA 4DV3L 3K5MA 2Z0SA 1MHWC 1X32A 4DK6C 1PLFA 4L63B 1KDBA 2Z1CA 2HDLA 1STHA 2F0JA 1A3TA 1GHKA 1UEAB 1XPOA 1WCMB 2XN9C 4MTKA 1Z7TA 1EY8A 4JI2L 2Q8TA 2FFKB 1VQLA 1MD2D 2JP1A 3S16B 2ES2A 1XJVA 1B9NA 1FGBD 4A3MG 4YCWA 1A2TA 4QB4A 5FLXc 2EQSA 1PVOA 2YU9H 1ASYA 4X3SA 2ZM6L 1CFMA 4C3JB 5IT9L 1JOOA 3DM1A 1YNNC 4KMUC 4KHPL 4N8X1 3IFDA 2MO0A 2BDOA 1DZ1A 4YIJA 1D5MC 3UE1A 1HPCA 2CH4W 2O5IC 3EJIA 2XVSA 2MNAA 4IUPA 5LHY1 3M9BA 4BXXH 2A69C 3M7GA 5C4ZA 4R1JA 5C4JB 3K0XA 5D3IB 4G7ZC 1B44D 1OXSC 3RMHA 3QIAA 1IW7D 1CM9A 4IUUA 3CP0A 3AQQA 3NXWA 3VR6A 2PMZE 4RCOA 2JA8B 2NVXH 4C3IB 2I07B 3AMUA 1GUWA 3NWSA 5M3FG 1PTOH 3CCJA 1STGA 3NUCA 4A93B 3OOCA 1X54A 4JPBW 5ELDA 1D1KA 1SEBD 2K6AA 5CV4A 4A3DB 1A0IA 1EYAA 3BVMA 2EE1A 4BBRG 2C9OA 2IX3A 5C3EB 5KYLA 3MZ5A 1YHBA 2V4DA 1HTLD 4A3JH 5E4WC 2XIWA 2EJMA 3CQZB 2QILA 4DV5Q 1TS4A 3CCQA 1IBLL 2JA6B 2AHOB 2GVAA 3PUVA 5ELNA 3KF6A 3D31A 5CGKA 2NN6H 1EFWA 1G2SA 3E6ZX 3ULJA 4A3FH 4RAUC 3GD7A 1WCMG 1TWFB 4IOAA 1ML0D 2OEOA 2VUMH 2EOTA 1RL2A 2PI2E 4IPGA 1B53A 4L5TA 1M4VA 1P8LA 4BA1I 5LMNW 4LF5Q 2FINB 3I2ZA 4ZLTF 4DXFA 1II3A 3Q22A 4JI4L 4A3LG 2B2TC 2SOBA 4A3GH 2L5TA 4CDCC 5L37A 2JA7H 2RCNA 1EY9A 4ZRZA 1STNA 2LMCB 3C1EA 1W6JA 4CJ2C 1WTXA 1PXUA 4OWTB 2CFMA 3J7A5 1E22A 3CCLA 5I2XA 4B3SQ 1VQPA 4RMFA 2PQAB 1A3UA 3TREA 1QZHA 3GTOH 1Z9FA 3C2PA 1HNZL 2M9VA 2KECA 4LK1C 2B63B 2JA8G 3CPFA 4IPCA 4BY7B 4DAVA 2OCEA 3STBC 1YNND 2K5NA 3HOYG 1PFBA 1R4PB 3S9WA 3CMAA 3CKIB 1TWHB 2Q2TA 2R93B 1VQBA 1EIFA 4A93G 3NTIA 1F2MA 2QKIC 2K05A 3PUWA 4K5VA 1V43A 4IUNA 3SK4A 4AIMA 3DEPA 2VL6A 3K7UC 5E1FA 1JR0D 3K8AA 4U673 3GTJH 1VMPA 4NDXA 4A3DG 2PQEA 2A69D 5J39A 1G51A 1BOSA 1B50A 2F0LA 2PQAA 1RTNA 5EPLA 4AQYL 1GUTA 1IBML 2UXCL 2YYZA 3IFTA 5C0XI 2K14A 1EWCA 2E2JH 1DONA 4LFBL 1CZWA 1A2UA 3H0GH 2HDMA 1ZXTA 5E7NA 5I6YA 3K5LA 3NTHA 3A8JE 3CW2C 3VR4A 3PO2G 4R4CA 3HOWG 1V1QA 4BBSH 4IJLA 2F3WA 1KD1C 1F77A 1PZJD 5C6AA 3I56A 3M4QA 3MTSA 2FXQA 2FHTA 5CV9A 1L1OC 2F0TA 1IL2A 5E3FA 1QG7A 1ICFB 1MBYA 2WINB 1E2VA 2AQ2B 1BCPC 2L4NA 4JI3Q 3G7LA 3BS1A 3TBIB 4X62Q 1YBYA 2YTVA 2R92B 3M4YA 3T53B 1Z6HA 3I4NH 1I3QB 1O7IA 1RCVD 2QGQA 4LFAQ 4K0KL 4PZ6A 4LF7L 1Y1VB 3J80E 3M85A 3S2HB 3QWNA 1DD2A 3DWQA 1L0XB 3TS0A 4JOIC 1MIUA 2RKSA 3QG1A 4GOPC 4JI8Q 1XMQL 1SNOA 3ERSX 2VQFQ 3EVQA 2EYJA 4DV1L 1WD0A 4K5WA 2DY8A 2JA9A 4B9XA 4EX5A 3CF5A 1Y1WH 1PH7A 1Q46A 3VYRA 5EBCA 1SN8A 4FVMA 1FYCA 1WVLA 4DV0L 4ULLA 1BR9A 2B63G 1KXLA 4WRDA 1Q7YC 1B2TA 3NK9A 3AFPA 4PG3A 3K5NA 4AYBB 3RZDH 1PH8A 3I4MG 1AE3A 1CKOA 5AFWA 1LV9A 1WOCA 3MVVA 2PI2A 1N34L 3W3AA 4KTAA 3F2DA 4UPAA 2F3IA 4GNXC 1SXTA 2NZ1D 4JI1L 2XTIA 4NXML 4IFDH 1G291 5DLQE 4GZYC 1K0RA 2SNSA 3OW2A 2ZT9C 3NP8A 4MN3A 2NVTB 1E2ZA 1DXMA 3BVGA 5EQ0A 3UDIA 1K8AC 2IX0A 1PRTC 1X3EA 3JAMc 2N8NA 4QUFA 3UDXA 4QCLA 2MQHA 4BWGB 5K36G 1IYJB 3DM3A 3STBD 2Z9HA 3CCSA 2L11A 3PO3B 1Q82C 1VQ8A 3OHXC 4A3KB 1SNMA 1AP0A 2F0HA 4KKUA 4HSVA 3KLRA 3E3XA 1LT5D 1YJWA 5HY6A 3JAMi 5IGDA 1SNQA 4K5XA 4TKOB 1KRTA 3T16A 1AW7A 3R8BA 1RIPA 1I6HH 1EOVA 1S40A 2E76C 3K7AB 2OWOA 3IL8A 4RG1A 2HIVA 2KEDA 3HOXH 1SBBB 1SAPA 1LTRD 1EUJA 1KTKA 2Z6KC 1MJEA 2B2TA 1O7YA 4M8AA 3K81C 1IXRA 4DN4M 2F0DA 3R2IA 2XRQD 2CCZA 1QCBD 2A6HC 4A4IA 5KYIA 4FP5D 3M4OH 1FD7D 4RGMA 3FKIB 2EYHA 4PMBA 1N33Q 3U4ZA 1N32L 4K8JA 2AQ1B 4X65L 4GS3A 1E1OA 3T1YL 1U4PA 1BCPD 1VCIA 1OXXK 3MXUA 1D5ZC 2F0FA 4KY7A 1XNQL 1W6KA 1IBKQ 1QUQB 2RHQB 2PNRC 4TQUS 1HA5A 4ODGA 1E2WA 5LMNQ 4UDUC 3F1ZA 3W1GA 3QB3A 4HAEA 3CCMA 1NTGA 5GAHC 2F4VQ 4ABNA 1GM5A 1VQ4A 5I9PA 1X3FA 2CVRA 1DOMA 1JJ2A 4XIGS 1RD9D 4ZUJA 2NN6I 1TWAB 4FXDA 1PFSA 1L1OB 1KLGD 4ZYSA 1FGUA 2B39A 1KC8C 5JJKA 2ICEC 3GP7A 2X6LA 5IP9H 1PH2A 3F2BA 3GTLB 4IURA 2WIIB 1AEXA 2X6GA 4JI6L 3GTPB 3S1NB 4LF8L 3S1QB 1PRTF 4J6HA 4DV7Q 4Q0FA 4QIWE 5CBAE 4FYDA 4LF4Q 4KHZA 5G3LF 3U58A 3IKJA 4JI0L 3ERQA 3TZUA 3GTKB 1L1OA 2BA0A 1IHZA 3S14B 1EY4A 1HZAA 1SE3A 2D0OA 1NBWA 2EY1A 2XRSD 3QR8A 4C2MH 5IE8A 2EPBA 2LXJA 1EOTA 2CWPA 2SNMA 1PRTD 5FO8B 4OO1G 1ZEQX 1HH2P 5G3LD 3NE5B 1SYFA 1X56A 3H94A 1VQFA 1N36Q 3ND8A 3J80L 1OXTA 1UAPA 1YNJD 2DNCA 4JBKA 3W5OA 4JOIA 5FO7B 1VMCA 5M3MH 2ASBA 4GOPA 1T5XD 3VYUA 1RTOA 2ZTCA 5BR8L 3NWTA 2PNHA 4DR5L 3A56A 4X3UA 4HIOA 1S5BD 1V1PB 2RSNA 4B9WA 2WKCA 1I6VC 1PRTB 3BDLA 1CUKA 4DAMA 3E0JA 2DN8A 3RD4A 2B8GA 2EZVA 4P72A 3OYYA 1KDCA 3Q23A 3P20A 1ENAA 3D6CA 4EVOA 4GN5A 2ZXPA 1MI2A 2LY7A 5IYCG 4G7OC 3VYSA 2A6HD 1J5EQ 4A3BH 4GNXA 2AUJD 3KF8B 2YTYA 1H95A 2A19A 2HHHQ 4NB3A 3VYTA 1B70B 4A3CH 5BN3A 2K32A 5C4HA 1CZGA 1O7ZA 1G2TA 1E0BA 1E24A 1GXDC 3GTQH 1G6PA 1PTOF 2HQEA 1Q8IA 3WOEA 2PYKA 3FVQA 2JA5H 4DR3Q 2RBMA 1EU4A 1OXUA 4K6LA 4WJWA 1ENCA 4DK1A 5M5XH 4P2CB 1UE6A 2IWHA 1MGSA 1H9SA 3ZYYX 3Q0AA 5EPKA 4JI7Q 5IIFA 2HT1A 1NMFA 3L0OA 5IGEA 1SROA 5LMUL 2IHFA 1XXGA 1S5FD 4B08A 1PTOD 4QJFA 1NSNS 2VY3A 4ILWA 5IP7G 3OTOL 3KF8A 1X3QA 2B2UC 1LTSD 2BE5C 4PV1C 2WFWA 3RR5A 3T56B 3GV6A 5FLMG 1HA6A 2KOLA 2MP1A 1B9MA 4LFCQ 4QIWB 2ZXOA 3QO2A 3AEVA 2Z6KA 2MFIA 4QL5A 3HOUG 1CHQD 1Y8PB 4EGVA 2NVXB 2PZUA 1SYGA 5J3BA 1LO5D 2Q8IB 1CKNB 1JWMD 3A8KE 3TRZA 2A68D 2AUKA 1PTOB 4RA8A 3P1HA 5IGFA 2V1CC 2OTLA 4XQNA 3I90A 4NXNL 4CDFC 4DFAA 1O7LA 1T9HA 5JJIA 1HFNA 4KKTA 4UHVA 4OWWB 4IFDI 2K04A 1VQGA 1TIID 3D4RA 2EYFA 1ET6A 3HOZH 3S15B 3F2UA 3M3YH 3A7AB 4A3JB 5M5YH 1FNUA 3D6WA 1C4QA 4GKKL 5IYBH 2AMCB 4HJ7A 2A6ED 3CCUA 4JI2Q 4FXGC 3K57A 1VQ6A 4JBJA 5TSSA 5JEAJ 1I4XA 1CKNA 3A0JA 3S17H 4A3FB 4RHSA 2YV5A 1K28A 2L12A 1QB5D 3J7AF 2VUMB 4R4OA 2ZM6Q 1ENFA 1CSPA 5FJ8G 3SVMA 4KHPQ 1JOQA 4IALA 2L0CA 4O1NA 1N9WA 4M1UB 2SDFA 4XXEA 1QE6A 1ASZA 4WJ3M 5T1GA 3CD6A 3TQYA 4A3GB 5KNCA 4ZKBB 3P75A 2JA7B 5DM63 2DY7A 1CKMA 3N6RA 2L15A 4X64Q 2N55A 5M3FH 2F52A 1X55A 4CJ1B 1U4MA 1YHQA 3PIOA 1TWGH 2Q2IA 2PCFB 5LL6S 4APVA 1SMYC 5C4XH 1GUGA 3RUZA 3PIO3 1YITA 3GTOB 2R7FA 1AFPA 4BBRH 1O78A 4X66Q 2F4IA 1S5DD 1PH3A 2BH2A 5COYA 2OQ0A 2HUGA 1QJOA 1YZ6A 2B2WC 3B6YA 4ZCKA 2XSCA 3PGZA 2PO4A 3FMCA 3HOVH 2RF4A 3RN2A 2F0IA 3PV0A 3SK6A 4DV5L 4RWSC 2R7ZH 3GTJB 4JBWA 1EFID 1VQOA 2A73B 2BE5D 4B3ML 2FMMA 2KHJA 1K8MA 2Q2UA 1R4QB 1U5KA 2NVQH 4A3JG 5IWAL 5EPJA 3SHLA 1PYSB 1JCKB 2MJ8A 4A3LH 2E2JB 1HR0L 4LF6Q 4A3EH 1VF5C 2KHSA 3H0GB 4C3JG 4LF5L 4HJ5A 2CHBD 1PH6A 4A3FG 2OF1A 2F0EA 2JK8A 3K80C 1U4LA 4DGZA 3F8TA 4BBSB 1H9KA 1XPRA 3S2DH 1Y8NB 4RGNA 4E6IA 2CWAA 1BKBA 4PZ7A 4CKCA 2MPMA 5FOBB 3Q8DA 4AYBE 4OGQC 1YJNA 2UXDQ 4POFA 4HJ8A 4WORA 3UI2A 3KDFB 3GO5A 2N88A 3SGIA 1KL9A 5DM73 3TP7A 3VR3A 4JI5L 1LABA 4B3SL 3I4NB 2LSSA 2PZWA 5JEAG 1B3QA 2JN4A 1IZ6A 2Z6BA 1Q86C 4C3IG 3HOYH 1RKNA 3MHBA 3NPPA 2E8GA 3DHQA 2A1AA 4DR7L 1HNZQ 1A3VA 2B29A 1WJJA 1U4RA 2Y0SE 2B2UA 1EIHA 1WTHA 2AWOA 4C56C 1C8CA 1VQ9A 1EEFD 1Y1WB 1D1IA 3IRBA 3DUZA 1I4QA 3UE0A 1WTWA 4I7ZC 5C3EG 3KDFA 1CA5A 2XGTA 4XT3B 5DNFA 1IYUA 2PZTA 2NVYH 4R8IA 3RZDB 2XWBB 1GHJA 2F0MA 1BBUA 1JE4A 1VS0A 1C7YA 4P73A 2JA6G 4RH6A 3QJYA 3PO2H 2LFNA 5H1SE 2LS01 1A63A 1Z47A 2K33A 1IBMQ 3FPUB 3HOWH 5A2QE 1TQOA 1SMYD 1JB7A 1BF4A 1KHIA 4ZKCB 2RDGA 4KN7C 4KKSA 2D2CC 4GKJQ 4H44C 1CTMA 5DEHA 3TEHB 4WJ4A 5GAEC 2DUDA 2F0GA 4LUVA 5JVH3 1WTPA 1HNXL 4ME5A 4OELB 3TP5A 3FPPA 4I65A 1HNWL 1LLRD 4B3TQ 1H9MA 1U9RA 4BBSG 2CQAA 2L9HA 3LNNA 4CBVA 4DV6Q 1ZKOA 4GLAC 3FHWA 3MEFA 1XYIA 2EY2A 1I6HB 4LAAA 3CRLC 3FP9A 1Y8OB 3OIQA 4FO2A 4KJOA 2A74C 1HUNA 1VDZA 4H7BA 1I4HA 2K5WA 3CHBD 3HOXB 4KD4A 4JI8L 1EQQA 3H3VH 2NTSA 3RZOH 2E2IH 4DF7A 1SYBA 4DR2L 3FEWX 1XMQQ 2HCIA 3I4MH 1S5ED 3TDQA 4BY7G 1ESFA 1ILQA 2H5XA 3HFZB 4DV1Q 3BYYB 4DR6L 3KLWA 4R8NA 3U9OA 3NENA 5I4DA 2UUAQ 1VQEA 2R93G 5HURA 2OQKA 3M4OB 5T1IA 3A5ZB 1PH4A 3LWEA 2M2LA 3CC2A 3J81E 2B8FA 1V8QA 4HMIA 1X3PA 4UP8A 1R9TH 3NELA 4QF4A 1PFMA 3I3CA 5CYUA 2K52A 4RHRA 3KBGA 4CGYB 2QF7A 5I6WA 5ELBA 1KIXA 4FF4A 1WTVA 2JSOA 2PW5A 3HKSA 3QOLA 1K8OA 1NMGA 5K36H 2Y0SB 1FNVA 3CRKC 3T51B 3L2PA 2B2WA 2M00A 1K73C 1Q12A 1V1OA 2KCMA 4HN7A 1GJXA 1LACA 3I70A 3KLSA 1BDOA 3J80c 2UXBL 1YNJC 3I72A 1M1KC 1BUVT 2E5LL 4JV5Q 1JQYD 4LJZC 3M7NA 4HTHA 4DR4Q 2HD3A 3BJUA 1VQHA 5E4XA 4DNIA 3PUYA 1J6QA 4J1MA 4K2KA 4YY3Q 4XTCS 4C1NI 4DAPA 4OIKA 4QUCA 2WAQE 4DUZL 1WTOA 1BQQT 2E74C 3J80i 4YWLA 2R92G 1GUOA 2EYLA 1TWCH 3BDOA 4TRDA 2EY5A 4J15A 2DJGC 1PA6A 2EDGA 4DAYB 2I5HA 2ATWA 1Y1VG 4A3IH 5IYDG 2Z4HA 4YHHQ 4KV6A 3GTGH 2I5LX 2ALYB 1S3OA 4N9TA 2WV6D 4JW0A 5C44B 1XPUA 5ISRA 2R6GA 4ZQ3A 4DKAC 4TSSA 1DYQA 1F9QA 1L0YB 3TP6A 2QDLA 1K3RA 3BDCA 4YCUA 1I4GA 1VQMA 2K03A 1Y69U 4C2MB 1EWHA 4JYAL 2WB1B 4H0LC 5ELOA 3G4SA 4QMGA 2K5HA 4UAIA 4CHTB 1I50H 4R4IA 2UUBL 3L3OC 5C0XJ 3IAYA 3CU7A 1LTLA 4AYBG 2QDBA 5AJ3L 4QQBX 5CV5A 1B3AA 4X65Q 3HRZC 4P75A 1EL0A 4HIKA 4OX9Q 4DAYA 1IL8A 1J9OA 1JOKA 5M3MB 3SR1A 2EYPA 3E9HA 2J4XA 1XNQQ 1MSGA 1ILPA 3HZXA 3D8GA 3URYA 1PTOC 3Q6SA 1STBA 1TR5A 4RGTA 2QEJC 4QGUA 1EY0A 4CDDC 3GV3A 5C3XA 4O42A 1CSQA 1G8ZD 2E75C 3CC4A 5K5PA 3CPWA 1Q8KA 2BCOA 4BY1H 1SFOH 2VQEL 3VDYA 2G5DA 2B2YC 2RCFA 5IY0A 2C35B 2Y0SG 1AZQA 4KLKA 2BOSA 3PF5A 1NCVA 1XTDA 2XWJB 2EYOA 2Z4IA 4WFN3 4LF9Q 1QUQA 1UE5A 2F0OA 2AWNA 1EIYB 1IKMA 3MXGA 2NBFA 3PO3G 1B4OA 4A3BB 4FNFA 4A3KG 1VQJA 2A68C 1YJ9A 3FDTA 3DLLA 1PV4A 3AB9A 4LW1A 4GLXA 2N3SA 4IOCA 1SYCA 5C5LA 4KI0A 3KOJA 5M5WH 1LTAD 4DUYL 5A2QL 3ER0A 3MEHA 2NZHA 4DV7L 4JI6Q 5IGBA 3GTQB 3PF4A 2CW0C 3WWVA 2ICIA 5FKAC 4LF4L 5IP9G 4DR1Q 1W2BA 3MFGA 5CC4A 4C3HH 2BA1A 5KEEA 4POGA 2CQOA 2JA5B 1IYVA 2IY5B 2VB2X 1RODA 2ID0A 1ESRA 3T13A 5M5XB 1PDQA 4XQJA 4OO1H 4ALPA 1AZPA 2Z8LA 4OIJA 4JI0Q 2HQLA 4F87A 3DWPA 3R93A 2A8VA 2N49A 3TZDA 4OWXB 1FJGQ 2A6EC 3PUXA 3PQIA 4I7AA 5IOCA 1A6XA 3MWYW 2PW7A 1SYDA 3LWUA 1EQVA 1F2YA 1DOKA 1HR0W 4LUZA 5C44G 2WAQB 1S4ZA
chains in the Genus database with same CATH topology
3LGJA 2JA8G 1VQ6A 4JV5L 3CPFA 4JBJA 5JEAJ 4IPCA 1PH1A 1CKNA 3A0JA 2K50A 3FKIG 4O0AA 1A8VA 1VQ7A 2OCEA 3S17H 4DR4L 4X6AH 2I5MX 3STBC 2VW9A 2YV5A 2RHSB 2K5NA 3BZKA 2UXBQ 1E7ZA 1YVCA 2E5LQ 2R92H 2QA4A 3U50C 3HOYG 1X6OA 3CMAA 2Q2TA 3S1MH 1VQBA 1I3QH 4YY3L 4R4OA 1EIFA 2ZM6Q 1XNRQ 5JJLA 4GLVB 4A93G 1CSPA 5FJ8G 3PUWA 5GAGC 4KHPQ 4AIMA 1V43A 1Y1VH 5IYDH 3RLFA 1QVCA 2VL6A 3K7UC 3S2HH 3GTJH 3K8AA 4A3DG 1K9MC 1VQDA 1N9WA 3NEMA 1UE1A 1G51A 1ASZA 4DUZQ 4WJ3M 3AFQA 3CD6A 5GQOA 5IYCH 3TQYA 1YIJA 2DGYA 3BZCA 4HIDA 2PQAA 3NBHB 3S24A 4AQYL 4YHHL 1IBML 2KCTA 4IPHA 1CKMA 3HKZE 2ZJQA 2ZJRA 2UXCL 2YYZA 4LWCA 1B7YB 2L15A 5C0XI 2K14A 2KBNA 4X64Q 1WYDA 1JE5A 3J81c 5M3FH 1P16A 1X3GA 2F52A 3HOXG 1UWVA 2E2JH 4LFBL 1X55A 4P71A 1YHQA 3H0GH 5E7NA 1TWGH 2GVBA 3PIOA 1D8LA 1NE3A 3RN5A 2Q2IA 1J5EL 2OTJA 1Y14B 2VNUD 2UU9L 3CW2C 4GN4B 3PO2G 1PH9A 4HIMA 1N33L 4APVA 2JEBI 4R4CA 5C4XH 4A3IG 5C0XG 1K83H 3HOWG 1V1QA 4BBSH 4IJLA 1YITA 1KD1C 1X65A 2R7FA 3I56A 1I94Q 3M4QA 5HGQA 1N32Q 1SLJA 1C0AA 4BBRH 2FXQA 4X66Q 3J81i 1L1OC 1IBKL 1IL2A 4JYAQ 3T1YQ 2BH8A 4A3BG 1PH3A 4L5SA 4Y7NH 5LMNL 4JI3Q 4JC0A 4X62Q 2BH2A 2UUBQ 1YBYA 2YTVA 4OX9L 2F4VL 2OQ0A 5AJ3Q 3CMEA 1W3SA 1YZ6A 3B6YA 2NVTH 3I4NH 1O7IA 2QGQA 3PGZA 4LFAQ 4IJHA 3HOVH 4K0KL 2RF4A 2LXKA 4PZ6A 3RN2A 1KQSA 4LF7L 5FLMH 3PV0A 3M85A 4DV2Q 4DV5L 2JA5G 2R7ZH 1Q1EA 5GROA 1V9PA 4JBWA 1VQOA 3ULLA 4B3ML 3PIPA 3TS0A 2KHJA 4JOIC 1MIUA 2Q2UA 4GOPC 1U5KA 4JI8Q 4DV4Q 2NVQH 3H3VI 3HOUH 1XMQL 4IO9A 3ERSX 3PO3H 4A3KH 4MNOA 4A3JG 1EYGA 5IWAL 2VQFQ 4DV1L 1N8RC 4LFCL 4EX5A 1PYSB 2JA9A 2VQEQ 3CF5A 1D7QA 1Y1WH 1PH7A 3JC66 1Q46A 1C9OA 3MXNB 4LF9L 4A3LH 3KFUA 1HR0L 1SN8A 3PSIA 4A3EH 4LF6Q 1L0WA 1HZ9A 2WAQG 4DV0L 4B3RQ 2B63G 1KXLA 4LF5L 2YTXA 1Q7YC 3T1HQ 3K7AH 4UP7A 4HJ5A 1PH6A 3AFPA 1MJCA 1GO3E 4PG3A 4BY1G 4A76A 4A3FG 1EWIA 2JK8A 4R4TA 3RZDH 3K80C 1PH8A 4LF8Q 3I4MG 1XMOQ 1VQKA 2UUCQ 3F8TA 1CKOA 1AE3A 3H15A 1XPRA 3S2DH 3J7ZC 1SE8A 2CWAA 1WOCA 3ULPA 1PH5A 1BKBA 2PI2A 4PZ7A 4DV3Q 1N34L 3RLOA 4DR1L 4DUYQ 3ZJYC 3F2DA 2MO1A 3Q8DA 2F3IA 4UPAA 4AYBE 4GNXC 1YI2A 1GVPA 1YJNA 4GOPB 2UXDQ 4QY7A 4POFA 4A75A 4A3MH 4HJ8A 4JI1L 4NXNQ 2EXDA 1I5FA 2IHEA 2XTIA 3GO5A 3KDFB 2E2HH 4NXML 3SGIA 1KL9A 4LNQA 5C44H 1G291 1HJPA 5DLQE 1K0RA 4PMWA 3OW2A 1K8GA 1JJGA 4JI5L 3E9IA 4L5RC 4B3SL 1FJGL 2LSSA 3FKIH 4JCVE 1JJCB 1M90C 5JEAG 3UDIA 1K8AC 4IPDA 1IZ6A 2IX0A 1X3EA 3JAMc 1Q86C 2N8NA 2IX1A 3HOYH 4OXPA 1N36L 3UDXA 2MQHA 4GKKQ 2E8GA 2A1AA 5K36G 1IYJB 3DM3A 4DR7L 1GKHA 5FJ8H 3STBD 3CCSA 2WB1G 3KJOA 1HNZQ 1SRUA 2B29A 3HOZG 1VQAA 2D62A 1WJJA 2Y0SE 1Q82C 1VQ8A 2NZOA 3UDFA 5IT9c 2AWOA 4GNXB 5IYBG 3TS2A 1YJWA 1WFQA 1VQ9A 5HY6A 5BR8Q 3JAMi 1XNRL 3GDEA 1KRTA 4DR5Q 2ZTEA 3IRBA 1RIPA 1I6HH 3UE0A 1EOVA 3D0FA 3A74A 5C3EG 5M3MG 1YNXA 3KDFA 3CCEA 1S40A 2OWOA 4H02A 1FL0A 1TWAH 2XGTA 4RG1A 1PHJA 5EAYA 2HIVA 2NVYH 3HOXH 4JG2A 1EUJA 2R7DA 3F2CA 2WP8J 1BBUA 1VS0A 4DPGA 1C7YA 4P73A 2JA6G 2Z6KC 1MJEA 1L2FA 3GTMH 3PO2H 4BXXG 2JJQA 3EIVA 3K81C 1IXRA 5H1SE 1Z47A 4X64L 4UY8C 1A63A 1IBMQ 1YHAA 3HOWH 2I0QA 2HHHL 1NJIC 3S1RH 3J81j 2CCZA 3GTLH 4A4IA 4EQ5A 1JB7A 1KHIA 4HJAA 3GTPH 1Q81C 3S1NH 3M4OH 3S1QH 2UU9Q 3I4OA 3KF6B 4GKJQ 1N33Q 4DR3L 4AH6A 3U4ZA 1I94L 1N32L 3U4VA 4X65L 4GS3A 4X66L 1E1OA 4BA2I 3TEHB 4WJ4A 3T1YL 5GAEC 1VCIA 1OXXK 3G6EA 1JMCA 4A3CG 4LUZA 2DUDA 5IP7H 5GADC 3GTKH 4JI7L 3KYHC 4LUVA 2AKWB 1XNQL 1IBKQ 1QUQB 1BVSA 2RHQB 1DGSA 3S14H 1HNXL 4TQUS 5C4XG 1HNWL 2KHIA 4B3TQ 1NY4A 5LMNQ 1WCMH 3F1ZA 3W1GA 4BBSG 1VQCA 4DV6Q 3CCMA 1VQNA 4GLAC 3FHWA 1NTGA 5GAHC 2F4VQ 5LMUQ 2N78A 1GM5A 3CC7A 1VQ4A 3S15H 1X3FA 3MEFA 3PCOB 1IBLQ 4DV2L 3S16H 1JT8A 1JJ2A 4XIGS 3FP9A 1FVIA 3OTOQ 2NN6I 3KJPA 1PFSA 1L1OB 4JBMA 4Y52H 1KRSA 1LYLA 1FGUA 4DV4L 4JI8L 1KC8C 1LM0A 1EQQA 4B3MQ 4C3JH 3H3VH 1QVFA 5JJKA 3RZOH 2E2IH 3HOVG 1E1TA 3W1BA 4YWKA 4DR2L 1XMQQ 4NPSA 3RLNA 2D0PA 2EIFA 4OONA 3I4MH 4BY7G 5IP9H 2R7ZG 2NN6G 1MKHA 2H5XA 5IWAQ 3HFZB 4DV1Q 1U0LA 1PH2A 3F2BA 4LF6L 4DR6L 3KLWA 2B3GA 4B3RL 4O2DA 3NENA 2UUAQ 1VQEA 2JQOA 3T1HL 1QZGA 1QVGA 1HR0Q 2VUMG 2R93G 3BU2A 4JI4Q 4JI6L 2OQKA 4YWMA 3A5ZB 4LF8L 3AYHB 1XMOL 1PH4A 2UUCL 2GN5A 4P74A 5C4JH 3CAMA 4DV7Q 2K5VA 1SR3A 4QIWE 1AE2A 1BBWA 3CC2A 4LF4Q 2JE6I 3HKZG 4KHZA 4R4QA 4DV3L 4UP8A 1LUZA 3U58A 4A3EG 2Z0SA 1R9TH 4JI0L 3NELA 4OO1I 2UXDL 4A3GG 2K52A 4DK6C 3CCVA 1L1OA 2JA8H 1KIXA 2JA7G 2BA0A 4C3IH 1HZAA 2VZAA 3HKSA 2D0OA 2VS1A 1X9NA 1NBWA 1XPOA 4C2MH 1NMGA 5IE8A 2LXJA 3CXCA 2CWPA 4JI2L 3L2PA 2KENA 1K73C 4OO1G 4A93H 1Q12A 2KCMA 1VQLA 4JI5Q 4FDBA 2ES2A 1XJVA 1HH2P 2CKZB 3J80c 4A3MG 4YCWA 4A3DH 1M1KC 2E5LL 4JV5Q 2UXBL 5FLXc 1X56A 3M7NA 1VQFA 2EQSA 4GN3B 4L5QA 1N36Q 4DR4Q 1PVOA 3BJUA 1VQHA 1OXTA 1ASYA 2YU9H 4JBKA 4IFDJ 3W5OA 2ZM6L 4JOIA 4DNIA 3PUYA 3EBEA 1J6QA 4DR7Q 5C3EH 5M3MH 2ASBA 4KHPL 4GOPA 2MO0A 4YY3Q 3ICEA 2ZTCA 4XTCS 3CQZH 3UE1A 5BR8L 1OTCA 2PNHA 4DR5L 2WAQE 4LUOA 4DUZL 4HIOA 3J80i 4YWLA 2JA6H 2R92G 2MNAA 1KAWA 1TWCH 1YEZA 3M9BA 2QEXA 4BXXH 1CUKA 4J15A 4DAMA 1PA6A 1VQIA 3E0EA 2I5HA 4DAYB 2ATWA 1Y1VG 4R1JA 5IYDG 4AQYQ 1TWFH 3K0XA 4A3IH 4YHHQ 3GTGH 4P72A 3OYYA 2I5LX 2UXCQ 2ALYB 1S3OA 1EQRA 3L7ZC 4HJ9A 1A62A 1OXSC 4GN5A 3CP0A 3AQQA 4LFBQ 1XPUA 2PMZE 5IYCG 2R6GA 4DKAC 1FJGQ 1J5EQ 4A3BH 2NVXH 4GNXA 1UEBA 2K75A 1K3RA 4YCUA 3KF8B 2YTYA 1VQMA 1H95A 4TVAB 2A19A 2HHHQ 4NB3A 5M3FG 1B70B 4UP9A 4A3CH 1UE7A 3CCJA 4JYAL 5ELOA 4ME3A 3H0GG 4GKJL 3G4SA 1E24A 3GTQH 1G6PA 2K5HA 4JI3L 1X54A 1I50H 1TXYA 3I7FA 4X62L 4R4IA 2UUBL 2JA5H 5C0XJ 1LTLA 4AYBG 5AJ3L 4DR3Q 1A0IA 4QQBX 1OXUA 5M5XH 2WB1E 4X65Q 4P75A 1UE6A 2JEAI 4HIKA 4OX9Q 4LFAL 4BBRG 4DK3C 4B3TL 3E9HA 4JI7Q 1YHBA 1XNQQ 3CCRA 4A3JH 2HT1A 1NMFA 3L0OA 4MTNA 4DV6L 4MZ9A 1HNXQ 4K0KQ 1SROA 5LMUL 1HNWQ 2IHFA 4LF7Q 2IT1A 4QGUA 2ZJPA 4DV5Q 3M4PA 3G71A 3CCQA 1IBLL 1CSQA 2AHOB 4QJFA 2VY3A 2GVAA 3PUVA 5IP7G 5ELNA 3OTOL 3CC4A 2B63H 3KF6A 3D31A 3CPWA 1Q8KA 3I4NG 4BY7H 2VQFL 2WFWA 1HZBA 1EFWA 4BY1H 3RR5A 3ULJA 4A3FH 1B8AA 1SFOH 2VQEL 3VDYA 3GD7A 5FLMG 1WCMG 4IOAA 1AH9A 5IY0A 3A5UA 2C35B 2Y0SG 1WI5A 4KLKA 2VUMH 1TWHH 3PF5A 4LFCQ 2R93H 1XTDA 2Q2HA 4LF9Q 1QUQA 1RL2A 1UE5A 2PI2E 2AWNA 2Z6KA 3AEVA 2MFIA 3PUZA 4IPGA 4QL5A 4PZ8A 4DV0Q 1EIYB 3HOUG 1E3PA 1SMXA 2ZTDA 4L5TA 4DR2Q 3PO3G 4BA1I 1P8LA 1VQJA 5LMNW 4A3KG 1YJ9A 4LF5Q 5J3BA 3I2ZA 3DLLA 1PV4A 2UUAL 3I55A 4LW1A 4GLXA 1CKNB 2N3SA 4IOCA 1Y1WG 3TRZA 4JI4L 4A3LG 4DR6Q 4KI0A 3KOJA 2HIXA 5M5WH 4A3GH 4DUYL 2JA7H 3ER0A 1PYBA 2K4KA 4JI6Q 2NZHA 4DV7L 2RCNA 2V1CC 3PF4A 3WWVA 4LF4L 1N34Q 2OTLA 5IP9G 4DR1Q 1W2BA 4NXNL 3UDGA 4C3HH 2BA1A 4POGA 2CQOA 2IY5B 2ID0A 1T9HA 5JJIA 4OWTB 4JI1Q 4OWWB 4IFDI 3RNUA 4ALPA 4NXMQ 1VQGA 4JI0Q 2HQLA 3HOZH 2CFMA 3J7A5 2A8VA 1E22A 3M3YH 1S72A 4YCVA 2N49A 3CCLA 4OWXB 5M5YH 4B3SQ 3PUXA 1VQPA 4RMFA 1HZCA 1Q1BA 2PQAB 3TREA 1QZHA 3EN2A 4GKKL 3GTOH 5IYBH 1Z9FA 2AMCB 4HJ7A 3CCUA 1HR0W 1GD7A 1HNZL 4IFDG 3G48A 5C44G 4JI2Q 1OXVA 1VQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LGJ A;  2JA8 G;  1VQ6 A;  4JV5 L;  3CPF A;  4JBJ A;  5JEA J;  4IPC A;  1PH1 A;  1CKN A;  3A0J A;  2K50 A;  3FKI G;  4O0A A;  1A8V A;  1VQ7 A;  2OCE A;  3S17 H;  4DR4 L;  4X6A H;  2I5M X;  3STB C;  2VW9 A;  2YV5 A;  2RHS B;  2K5N A;  3BZK A;  2UXB Q;  1E7Z A;  1YVC A;  2E5L Q;  2R92 H;  2QA4 A;  3U50 C;  3HOY G;  1X6O A;  3CMA A;  2Q2T A;  3S1M H;  1VQB A;  1I3Q H;  4YY3 L;  4R4O A;  1EIF A;  2ZM6 Q;  1XNR Q;  5JJL A;  4GLV B;  4A93 G;  1CSP A;  5FJ8 G;  3PUW A;  5GAG C;  4KHP Q;  4AIM A;  1V43 A;  1Y1V H;  5IYD H;  3RLF A;  1QVC A;  2VL6 A;  3K7U C;  3S2H H;  3GTJ H;  3K8A A;  4A3D G;  1K9M C;  1VQD A;  1N9W A;  3NEM A;  1UE1 A;  1G51 A;  1ASZ A;  4DUZ Q;  4WJ3 M;  3AFQ A;  3CD6 A;  5GQO A;  5IYC H;  3TQY A;  1YIJ A;  2DGY A;  3BZC A;  4HID A;  2PQA A;  3NBH B;  3S24 A;  4AQY L;  4YHH L;  1IBM L;  2KCT A;  4IPH A;  1CKM A;  3HKZ E;  2ZJQ A;  2ZJR A;  2UXC L;  2YYZ A;  4LWC A;  1B7Y B;  2L15 A;  5C0X I;  2K14 A;  2KBN A;  4X64 Q;  1WYD A;  1JE5 A;  3J81 c;  5M3F H;  1P16 A;  1X3G A;  2F52 A;  3HOX G;  1UWV A;  2E2J H;  4LFB L;  1X55 A;  4P71 A;  1YHQ A;  3H0G H;  5E7N A;  1TWG H;  2GVB A;  3PIO A;  1D8L A;  1NE3 A;  3RN5 A;  2Q2I A;  1J5E L;  2OTJ A;  1Y14 B;  2VNU D;  2UU9 L;  3CW2 C;  4GN4 B;  3PO2 G;  1PH9 A;  4HIM A;  1N33 L;  4APV A;  2JEB I;  4R4C A;  5C4X H;  4A3I G;  5C0X G;  1K83 H;  3HOW G;  1V1Q A;  4BBS H;  4IJL A;  1YIT A;  1KD1 C;  1X65 A;  2R7F A;  3I56 A;  1I94 Q;  3M4Q A;  5HGQ A;  1N32 Q;  1SLJ A;  1C0A A;  4BBR H;  2FXQ A;  4X66 Q;  3J81 i;  1L1O C;  1IBK L;  1IL2 A;  4JYA Q;  3T1Y Q;  2BH8 A;  4A3B G;  1PH3 A;  4L5S A;  4Y7N H;  5LMN L;  4JI3 Q;  4JC0 A;  4X62 Q;  2BH2 A;  2UUB Q;  1YBY A;  2YTV A;  4OX9 L;  2F4V L;  2OQ0 A;  5AJ3 Q;  3CME A;  1W3S A;  1YZ6 A;  3B6Y A;  2NVT H;  3I4N H;  1O7I A;  2QGQ A;  3PGZ A;  4LFA Q;  4IJH A;  3HOV H;  4K0K L;  2RF4 A;  2LXK A;  4PZ6 A;  3RN2 A;  1KQS A;  4LF7 L;  5FLM H;  3PV0 A;  3M85 A;  4DV2 Q;  4DV5 L;  2JA5 G;  2R7Z H;  1Q1E A;  5GRO A;  1V9P A;  4JBW A;  1VQO A;  3ULL A;  4B3M L;  3PIP A;  3TS0 A;  2KHJ A;  4JOI C;  1MIU A;  2Q2U A;  4GOP C;  1U5K A;  4JI8 Q;  4DV4 Q;  2NVQ H;  3H3V I;  3HOU H;  1XMQ L;  4IO9 A;  3ERS X;  3PO3 H;  4A3K H;  4MNO A;  4A3J G;  1EYG A;  5IWA L;  2VQF Q;  4DV1 L;  1N8R C;  4LFC L;  4EX5 A;  1PYS B;  2JA9 A;  2VQE Q;  3CF5 A;  1D7Q A;  1Y1W H;  1PH7 A;  3JC6 6;  1Q46 A;  1C9O A;  3MXN B;  4LF9 L;  4A3L H;  3KFU A;  1HR0 L;  1SN8 A;  3PSI A;  4A3E H;  4LF6 Q;  1L0W A;  1HZ9 A;  2WAQ G;  4DV0 L;  4B3R Q;  2B63 G;  1KXL A;  4LF5 L;  2YTX A;  1Q7Y C;  3T1H Q;  3K7A H;  4UP7 A;  4HJ5 A;  1PH6 A;  3AFP A;  1MJC A;  1GO3 E;  4PG3 A;  4BY1 G;  4A76 A;  4A3F G;  1EWI A;  2JK8 A;  4R4T A;  3RZD H;  3K80 C;  1PH8 A;  4LF8 Q;  3I4M G;  1XMO Q;  1VQK A;  2UUC Q;  3F8T A;  1CKO A;  1AE3 A;  3H15 A;  1XPR A;  3S2D H;  3J7Z C;  1SE8 A;  2CWA A;  1WOC A;  3ULP A;  1PH5 A;  1BKB A;  2PI2 A;  4PZ7 A;  4DV3 Q;  1N34 L;  3RLO A;  4DR1 L;  4DUY Q;  3ZJY C;  3F2D A;  2MO1 A;  3Q8D A;  2F3I A;  4UPA A;  4AYB E;  4GNX C;  1YI2 A;  1GVP A;  1YJN A;  4GOP B;  2UXD Q;  4QY7 A;  4POF A;  4A75 A;  4A3M H;  4HJ8 A;  4JI1 L;  4NXN Q;  2EXD A;  1I5F A;  2IHE A;  2XTI A;  3GO5 A;  3KDF B;  2E2H H;  4NXM L;  3SGI A;  1KL9 A;  4LNQ A;  5C44 H;  1G29 1;  1HJP A;  5DLQ E;  1K0R A;  4PMW A;  3OW2 A;  1K8G A;  1JJG A;  4JI5 L;  3E9I A;  4L5R C;  4B3S L;  1FJG L;  2LSS A;  3FKI H;  4JCV E;  1JJC B;  1M90 C;  5JEA G;  3UDI A;  1K8A C;  4IPD A;  1IZ6 A;  2IX0 A;  1X3E A;  3JAM c;  1Q86 C;  2N8N A;  2IX1 A;  3HOY H;  4OXP A;  1N36 L;  3UDX A;  2MQH A;  4GKK Q;  2E8G A;  2A1A A;  5K36 G;  1IYJ B;  3DM3 A;  4DR7 L;  1GKH A;  5FJ8 H;  3STB D;  3CCS A;  2WB1 G;  3KJO A;  1HNZ Q;  1SRU A;  2B29 A;  3HOZ G;  1VQA A;  2D62 A;  1WJJ A;  2Y0S E;  1Q82 C;  1VQ8 A;  2NZO A;  3UDF A;  5IT9 c;  2AWO A;  4GNX B;  5IYB G;  3TS2 A;  1YJW A;  1WFQ A;  1VQ9 A;  5HY6 A;  5BR8 Q;  3JAM i;  1XNR L;  3GDE A;  1KRT A;  4DR5 Q;  2ZTE A;  3IRB A;  1RIP A;  1I6H H;  3UE0 A;  1EOV A;  3D0F A;  3A74 A;  5C3E G;  5M3M G;  1YNX A;  3KDF A;  3CCE A;  1S40 A;  2OWO A;  4H02 A;  1FL0 A;  1TWA H;  2XGT A;  4RG1 A;  1PHJ A;  5EAY A;  2HIV A;  2NVY H;  3HOX H;  4JG2 A;  1EUJ A;  2R7D A;  3F2C A;  2WP8 J;  1BBU A;  1VS0 A;  4DPG A;  1C7Y A;  4P73 A;  2JA6 G;  2Z6K C;  1MJE A;  1L2F A;  3GTM H;  3PO2 H;  4BXX G;  2JJQ A;  3EIV A;  3K81 C;  1IXR A;  5H1S E;  1Z47 A;  4X64 L;  4UY8 C;  1A63 A;  1IBM Q;  1YHA A;  3HOW H;  2I0Q A;  2HHH L;  1NJI C;  3S1R H;  3J81 j;  2CCZ A;  3GTL H;  4A4I A;  4EQ5 A;  1JB7 A;  1KHI A;  4HJA A;  3GTP H;  1Q81 C;  3S1N H;  3M4O H;  3S1Q H;  2UU9 Q;  3I4O A;  3KF6 B;  4GKJ Q;  1N33 Q;  4DR3 L;  4AH6 A;  3U4Z A;  1I94 L;  1N32 L;  3U4V A;  4X65 L;  4GS3 A;  4X66 L;  1E1O A;  4BA2 I;  3TEH B;  4WJ4 A;  3T1Y L;  5GAE C;  1VCI A;  1OXX K;  3G6E A;  1JMC A;  4A3C G;  4LUZ A;  2DUD A;  5IP7 H;  5GAD C;  3GTK H;  4JI7 L;  3KYH C;  4LUV A;  2AKW B;  1XNQ L;  1IBK Q;  1QUQ B;  1BVS A;  2RHQ B;  1DGS A;  3S14 H;  1HNX L;  4TQU S;  5C4X G;  1HNW L;  2KHI A;  4B3T Q;  1NY4 A;  5LMN Q;  1WCM H;  3F1Z A;  3W1G A;  4BBS G;  1VQC A;  4DV6 Q;  3CCM A;  1VQN A;  4GLA C;  3FHW A;  1NTG A;  5GAH C;  2F4V Q;  5LMU Q;  2N78 A;  1GM5 A;  3CC7 A;  1VQ4 A;  3S15 H;  1X3F A;  3MEF A;  3PCO B;  1IBL Q;  4DV2 L;  3S16 H;  1JT8 A;  1JJ2 A;  4XIG S;  3FP9 A;  1FVI A;  3OTO Q;  2NN6 I;  3KJP A;  1PFS A;  1L1O B;  4JBM A;  4Y52 H;  1KRS A;  1LYL A;  1FGU A;  4DV4 L;  4JI8 L;  1KC8 C;  1LM0 A;  1EQQ A;  4B3M Q;  4C3J H;  3H3V H;  1QVF A;  5JJK A;  3RZO H;  2E2I H;  3HOV G;  1E1T A;  3W1B A;  4YWK A;  4DR2 L;  1XMQ Q;  4NPS A;  3RLN A;  2D0P A;  2EIF A;  4OON A;  3I4M H;  4BY7 G;  5IP9 H;  2R7Z G;  2NN6 G;  1MKH A;  2H5X A;  5IWA Q;  3HFZ B;  4DV1 Q;  1U0L A;  1PH2 A;  3F2B A;  4LF6 L;  4DR6 L;  3KLW A;  2B3G A;  4B3R L;  4O2D A;  3NEN A;  2UUA Q;  1VQE A;  2JQO A;  3T1H L;  1QZG A;  1QVG A;  1HR0 Q;  2VUM G;  2R93 G;  3BU2 A;  4JI4 Q;  4JI6 L;  2OQK A;  4YWM A;  3A5Z B;  4LF8 L;  3AYH B;  1XMO L;  1PH4 A;  2UUC L;  2GN5 A;  4P74 A;  5C4J H;  3CAM A;  4DV7 Q;  2K5V A;  1SR3 A;  4QIW E;  1AE2 A;  1BBW A;  3CC2 A;  4LF4 Q;  2JE6 I;  3HKZ G;  4KHZ A;  4R4Q A;  4DV3 L;  4UP8 A;  1LUZ A;  3U58 A;  4A3E G;  2Z0S A;  1R9T H;  4JI0 L;  3NEL A;  4OO1 I;  2UXD L;  4A3G G;  2K52 A;  4DK6 C;  3CCV A;  1L1O A;  2JA8 H;  1KIX A;  2JA7 G;  2BA0 A;  4C3I H;  1HZA A;  2VZA A;  3HKS A;  2D0O A;  2VS1 A;  1X9N A;  1NBW A;  1XPO A;  4C2M H;  1NMG A;  5IE8 A;  2LXJ A;  3CXC A;  2CWP A;  4JI2 L;  3L2P A;  2KEN A;  1K73 C;  4OO1 G;  4A93 H;  1Q12 A;  2KCM A;  1VQL A;  4JI5 Q;  4FDB A;  2ES2 A;  1XJV A;  1HH2 P;  2CKZ B;  3J80 c;  4A3M G;  4YCW A;  4A3D H;  1M1K C;  2E5L L;  4JV5 Q;  2UXB L;  5FLX c;  1X56 A;  3M7N A;  1VQF A;  2EQS A;  4GN3 B;  4L5Q A;  1N36 Q;  4DR4 Q;  1PVO A;  3BJU A;  1VQH A;  1OXT A;  1ASY A;  2YU9 H;  4JBK A;  4IFD J;  3W5O A;  2ZM6 L;  4JOI A;  4DNI A;  3PUY A;  3EBE A;  1J6Q A;  4DR7 Q;  5C3E H;  5M3M H;  2ASB A;  4KHP L;  4GOP A;  2MO0 A;  4YY3 Q;  3ICE A;  2ZTC A;  4XTC S;  3CQZ H;  3UE1 A;  5BR8 L;  1OTC A;  2PNH A;  4DR5 L;  2WAQ E;  4LUO A;  4DUZ L;  4HIO A;  3J80 i;  4YWL A;  2JA6 H;  2R92 G;  2MNA A;  1KAW A;  1TWC H;  1YEZ A;  3M9B A;  2QEX A;  4BXX H;  1CUK A;  4J15 A;  4DAM A;  1PA6 A;  1VQI A;  3E0E A;  2I5H A;  4DAY B;  2ATW A;  1Y1V G;  4R1J A;  5IYD G;  4AQY Q;  1TWF H;  3K0X A;  4A3I H;  4YHH Q;  3GTG H;  4P72 A;  3OYY A;  2I5L X;  2UXC Q;  2ALY B;  1S3O A;  1EQR A;  3L7Z C;  4HJ9 A;  1A62 A;  1OXS C;  4GN5 A;  3CP0 A;  3AQQ A;  4LFB Q;  1XPU A;  2PMZ E;  5IYC G;  2R6G A;  4DKA C;  1FJG Q;  1J5E Q;  4A3B H;  2NVX H;  4GNX A;  1UEB A;  2K75 A;  1K3R A;  4YCU A;  3KF8 B;  2YTY A;  1VQM A;  1H95 A;  4TVA B;  2A19 A;  2HHH Q;  4NB3 A;  5M3F G;  1B70 B;  4UP9 A;  4A3C H;  1UE7 A;  3CCJ A;  4JYA L;  5ELO A;  4ME3 A;  3H0G G;  4GKJ L;  3G4S A;  1E24 A;  3GTQ H;  1G6P A;  2K5H A;  4JI3 L;  1X54 A;  1I50 H;  1TXY A;  3I7F A;  4X62 L;  4R4I A;  2UUB L;  2JA5 H;  5C0X J;  1LTL A;  4AYB G;  5AJ3 L;  4DR3 Q;  1A0I A;  4QQB X;  1OXU A;  5M5X H;  2WB1 E;  4X65 Q;  4P75 A;  1UE6 A;  2JEA I;  4HIK A;  4OX9 Q;  4LFA L;  4BBR G;  4DK3 C;  4B3T L;  3E9H A;  4JI7 Q;  1YHB A;  1XNQ Q;  3CCR A;  4A3J H;  2HT1 A;  1NMF A;  3L0O A;  4MTN A;  4DV6 L;  4MZ9 A;  1HNX Q;  4K0K Q;  1SRO A;  5LMU L;  1HNW Q;  2IHF A;  4LF7 Q;  2IT1 A;  4QGU A;  2ZJP A;  4DV5 Q;  3M4P A;  3G71 A;  3CCQ A;  1IBL L;  1CSQ A;  2AHO B;  4QJF A;  2VY3 A;  2GVA A;  3PUV A;  5IP7 G;  5ELN A;  3OTO L;  3CC4 A;  2B63 H;  3KF6 A;  3D31 A;  3CPW A;  1Q8K A;  3I4N G;  4BY7 H;  2VQF L;  2WFW A;  1HZB A;  1EFW A;  4BY1 H;  3RR5 A;  3ULJ A;  4A3F H;  1B8A A;  1SFO H;  2VQE L;  3VDY A;  3GD7 A;  5FLM G;  1WCM G;  4IOA A;  1AH9 A;  5IY0 A;  3A5U A;  2C35 B;  2Y0S G;  1WI5 A;  4KLK A;  2VUM H;  1TWH H;  3PF5 A;  4LFC Q;  2R93 H;  1XTD A;  2Q2H A;  4LF9 Q;  1QUQ A;  1RL2 A;  1UE5 A;  2PI2 E;  2AWN A;  2Z6K A;  3AEV A;  2MFI A;  3PUZ A;  4IPG A;  4QL5 A;  4PZ8 A;  4DV0 Q;  1EIY B;  3HOU G;  1E3P A;  1SMX A;  2ZTD A;  4L5T A;  4DR2 Q;  3PO3 G;  4BA1 I;  1P8L A;  1VQJ A;  5LMN W;  4A3K G;  1YJ9 A;  4LF5 Q;  5J3B A;  3I2Z A;  3DLL A;  1PV4 A;  2UUA L;  3I55 A;  4LW1 A;  4GLX A;  1CKN B;  2N3S A;  4IOC A;  1Y1W G;  3TRZ A;  4JI4 L;  4A3L G;  4DR6 Q;  4KI0 A;  3KOJ A;  2HIX A;  5M5W H;  4A3G H;  4DUY L;  2JA7 H;  3ER0 A;  1PYB A;  2K4K A;  4JI6 Q;  2NZH A;  4DV7 L;  2RCN A;  2V1C C;  3PF4 A;  3WWV A;  4LF4 L;  1N34 Q;  2OTL A;  5IP9 G;  4DR1 Q;  1W2B A;  4NXN L;  3UDG A;  4C3H H;  2BA1 A;  4POG A;  2CQO A;  2IY5 B;  2ID0 A;  1T9H A;  5JJI A;  4OWT B;  4JI1 Q;  4OWW B;  4IFD I;  3RNU A;  4ALP A;  4NXM Q;  1VQG A;  4JI0 Q;  2HQL A;  3HOZ H;  2CFM A;  3J7A 5;  2A8V A;  1E22 A;  3M3Y H;  1S72 A;  4YCV A;  2N49 A;  3CCL A;  4OWX B;  5M5Y H;  4B3S Q;  3PUX A;  1VQP A;  4RMF A;  1HZC A;  1Q1B A;  2PQA B;  3TRE A;  1QZH A;  3EN2 A;  4GKK L;  3GTO H;  5IYB H;  1Z9F A;  2AMC B;  4HJ7 A;  3CCU A;  1HR0 W;  1GD7 A;  1HNZ L;  4IFD G;  3G48 A;  5C44 G;  4JI2 Q;  1OXV A;  1VQ5 A; 
#chains in the Genus database with same CATH topology
 3LGJ A;  1DOL A;  5EKI A;  5M9O A;  1HRJ A;  2P5Z X;  1CQF A;  1PH1 A;  2F1M A;  1KNE A;  3FKI G;  2K50 A;  3OSO A;  4O0A A;  1A8V A;  1VQ7 A;  2G9D A;  2VW9 A;  3BZK A;  1EEI D;  1E7Z A;  1TVX A;  1WD1 A;  1HQR D;  1UNS A;  5IGG A;  3S1M H;  5CR3 A;  5JJL A;  1XNR Q;  1NR4 A;  1SSO A;  2R61 A;  3RLF A;  4HED A;  1A15 A;  3NEM A;  1UE1 A;  2JXM B;  3AFQ A;  3DMU A;  5IYC H;  1KLU D;  1HCZ A;  4HID A;  3NBH B;  2R3Z A;  3S24 A;  4IPH A;  4G57 A;  2QCP X;  3HKZ E;  1TY0 A;  4NKL A;  3ND9 A;  5ELC A;  2ZJQ A;  4LWC A;  1STY A;  2KBN A;  1WYD A;  5D3D A;  1P16 A;  1X3G A;  1UWV A;  3ERO A;  4P71 A;  5ELE A;  3J81 L;  1J5E L;  1NE3 A;  3I4L A;  5A35 A;  2UU9 L;  3TME A;  3HOZ B;  2O2L D;  2IJ0 A;  2C5C A;  4GN4 B;  3M3Y B;  2JEB I;  4CJ0 B;  5C0X G;  5M5Y B;  1K83 H;  1V1P A;  1CQV A;  1I4P A;  1QWY A;  2Q8R E;  5EKL A;  3SXH A;  2PPB C;  4EQN A;  1I94 Q;  1SLJ A;  4K6D A;  4XT1 B;  2YU9 B;  2VXW A;  1EY6 A;  2BH8 A;  3A55 A;  2EYM A;  4A3B G;  4L5S A;  4Y7N H;  1F2L A;  4G7H C;  4HSP A;  3S17 B;  3D4D A;  1F9P A;  4OL7 A;  1JB3 A;  1W3S A;  2O4X A;  3C1F A;  4IQZ A;  4NMZ A;  4IJH A;  2LXK A;  1XTC D;  5FLM H;  1UUP A;  4DV2 Q;  2JA5 G;  2KJX A;  1Q1E A;  5GRO A;  4R9W A;  1V9P A;  2G9H D;  4KD3 A;  5FLX E;  3PIP A;  1AN8 A;  3DEO A;  4DV4 Q;  2ZXR A;  3H3V I;  4KY6 A;  3HOU H;  3R2T A;  3PIP 3;  1ICW A;  1EYG A;  2D5D A;  4LFC L;  3JC6 6;  3MXN B;  5IGC A;  1SNC A;  4L8J A;  3VR2 A;  2WAQ G;  4B3R Q;  1TWG B;  2NTT A;  2YTX A;  2F0K A;  1IKL A;  3I73 A;  5C5M A;  3U9S A;  3T1H Q;  1MJC A;  3KUP A;  4R4T A;  5C4X B;  1XMO Q;  2UUC Q;  1TU2 B;  3H15 A;  4K2L A;  1TY2 A;  3J7Z C;  2CW0 D;  1SE8 A;  2F0W A;  1PH5 A;  1CT1 D;  3SE0 A;  4DV3 Q;  4IUQ A;  3VA7 A;  2MO1 A;  4FF2 A;  3MC0 B;  4L6T B;  1EZ8 A;  4QY7 A;  4A3M H;  3EQL C;  4NXN Q;  2EXD A;  4OEM B;  2E2H H;  1STA A;  4FXK C;  5JVG 3;  2SEB D;  1HJP A;  4PMW A;  3NSW A;  1K8G A;  4RKB A;  4KK7 A;  2EJF C;  4L5R C;  2OXP A;  4KJN A;  4JCV E;  1M90 C;  1JJC B;  3HOV B;  3MXN A;  1CI3 M;  1DJR D;  1LT4 D;  1NNX A;  2RQX A;  2LKV A;  4IPD A;  1SDF A;  4OXP A;  4RCN A;  2R7Z B;  1CA6 A;  4GKK Q;  1RHP A;  5FJ8 H;  3R3O A;  3KJO A;  2NVQ B;  3HOZ G;  1VQA A;  3SDZ A;  2D62 A;  2NZO A;  3UDF A;  4DXG A;  2MHV A;  5J22 A;  5IYB G;  3TS2 A;  1WFQ A;  2B2Y A;  4OHJ A;  3HKZ B;  3GDE A;  2DJF C;  4A3E B;  2ZTE A;  3D0F A;  2NUC A;  1YNX A;  3LX0 A;  1WTQ A;  1FL0 A;  4IUT A;  1ONL A;  1SE4 A;  2F0P A;  1LTB D;  2F3V A;  2R7D A;  3F2C A;  3S2D B;  4DPG A;  4KN4 C;  4N8F A;  1L2F A;  3GTM H;  3X3N A;  4BXX G;  4X64 L;  3WOF A;  4UY8 C;  3MXP A;  1YHA A;  1KAA A;  3S1R H;  1WTR A;  1HQM C;  2HCC A;  4XYQ A;  4HJA A;  1Q81 C;  4K8I A;  2L55 A;  4XDX A;  4F88 A;  4XQQ A;  3I4O A;  3KF6 B;  5COR A;  1Q3L A;  3HOY B;  4V0B A;  4X66 L;  1GOZ A;  2AKW B;  5JOB A;  1QIL A;  3TSS A;  1JWU D;  5C4X G;  1NY4 A;  1HTP A;  3KBX A;  1WCM H;  3OWE B;  1VQC A;  3AU7 A;  1VQN A;  2E2D C;  1MSH A;  2XNA C;  4K14 A;  1DCZ A;  2N78 A;  3CC7 A;  3S15 H;  3PCO B;  1IBL Q;  3NBI A;  3S16 H;  1XX8 A;  3KJP A;  4JBM A;  3K5O A;  2VB3 X;  2NVY B;  3OMC A;  1LM0 A;  3I8Z A;  5CV6 A;  4B3M Q;  2F0N A;  4C3J H;  1QVF A;  1KAB A;  2KQ3 A;  3HOV G;  5C3W A;  3PO2 B;  4NPS A;  2EIF A;  2R7Z G;  2NN6 G;  1MKH A;  5IWA Q;  3HOW B;  1U0L A;  4LF6 L;  1OO9 B;  2IPK D;  3H09 A;  2A5H A;  5LL6 X;  2VUM G;  2JQO A;  1QVG A;  1HR0 Q;  5I2Y A;  1RDP D;  4JI4 Q;  4YWM A;  4MIU A;  3AYH B;  4N9P A;  4P74 A;  5C4J H;  1HXY D;  1FNW A;  3V96 A;  3MA2 B;  5EKK A;  2K5V A;  1AE2 A;  3HKZ G;  4R4Q A;  1LUZ A;  3HGB A;  4A3E G;  3DWA A;  3SEB A;  4OO1 I;  2UXD L;  4A3G G;  5JEA H;  3CCV A;  1TS5 A;  3VR5 A;  2JA8 H;  4EQP A;  2JA7 G;  4C3I H;  2VZA A;  2VS1 A;  1X9N A;  1QNK A;  3CXC A;  3MAQ A;  1TKW B;  2KEN A;  4A93 H;  4JI5 Q;  1ET9 A;  4FDB A;  1PZK D;  2CKZ B;  4A3D H;  4L5Q A;  4GN3 B;  4IFD J;  5FLX L;  3C46 A;  4NW2 A;  3EBE A;  4DR7 Q;  3RZO B;  2B2V C;  5C3E H;  2E2I B;  5JPM C;  3T4A C;  2F0U A;  2EVB A;  3K6O A;  3ICE A;  3I4M B;  3CQZ H;  1D2B A;  1OTC A;  4LUO A;  2JA6 H;  2RA4 A;  1F9S A;  1KAW A;  4X3K A;  2TMP A;  1YEZ A;  2QEX A;  3QOJ A;  1VQI A;  2PMZ B;  3E0E A;  1PFN A;  4AQY Q;  1TWF H;  1LTT D;  2UXC Q;  2F0V A;  1EQR A;  3L7Z C;  4HJ9 A;  1A62 A;  1R9T B;  4LFB Q;  4NP5 A;  2K5Q A;  1UEB A;  2K75 A;  2D9U A;  4CKB A;  4TVA B;  2RSO A;  3MFY A;  4UP9 A;  1UE7 A;  4ME3 A;  3H0G G;  4GKJ L;  5BN4 A;  3K0Y A;  1TT2 A;  4JI3 L;  2WAC A;  4DU9 A;  1TXY A;  3I7F A;  4X62 L;  1EY7 A;  4H13 C;  2WB1 E;  3BYT B;  3OW7 A;  2JEA I;  4RKL A;  4LFA L;  1RJT A;  2BDN A;  4DK3 C;  4B3T L;  1PYW D;  1SJE D;  2CH4 A;  3CCR A;  4KHV A;  4MTN A;  3JAM E;  4DV6 L;  1HNX Q;  4MZ9 A;  4K0K Q;  2O5J C;  1HNW Q;  1LTG D;  5KRU A;  2QW7 A;  4LF7 Q;  4JK1 C;  3O13 A;  2IT1 A;  2ZJP A;  1GUN A;  3M4P A;  3G71 A;  2K7V A;  3A7L A;  3HP3 A;  1TWC B;  2B63 H;  2KUM A;  3I4N G;  4BY7 H;  2VQF L;  1HZB A;  1RF2 D;  3GQB A;  1B8A A;  4A3I B;  3X3M A;  1AH9 A;  3A5U A;  1I4R A;  3GTG B;  5KNB A;  1WI5 A;  1TWH H;  2R93 H;  2Q2H A;  2DNE A;  1H9J A;  3PUZ A;  4PZ8 A;  5FO9 B;  4BS9 A;  4DV0 Q;  1E3P A;  1SMX A;  2ZTD A;  4DR2 Q;  4JVZ A;  2UUA L;  1EYD A;  4HMJ A;  3I55 A;  5CBE E;  4DR6 Q;  1Y1W G;  1T5E A;  1H9R A;  2HIX A;  2H1E A;  4J8Q A;  1PYB A;  2K4K A;  1F9R A;  4ZK9 B;  1N34 Q;  4ZAI A;  1I50 B;  3UDG A;  5JPN C;  5ELF A;  2WKD A;  4JI1 Q;  3RNU A;  4DA2 A;  4NXM Q;  2H4O A;  1K0S A;  5EGT A;  1S72 A;  4RGO S;  4YCV A;  1KNA A;  1HZC A;  1Q1B A;  3EN2 A;  2RVL A;  1JC7 A;  3NHH A;  3G6J B;  1GD7 A;  4IFD G;  3G48 A;  1OXV A;  1VQ5 A;  4PQX A;  1D5X C;  2KEE A;  3L9A X;  3ITP A;  4JV5 L;  5F2D A;  1ZYR C;  4DR4 L;  4BY1 B;  2RDH A;  3N52 A;  1SFO B;  4X6A H;  2I5M X;  2RHS B;  2UXB Q;  1YVC A;  1EZ6 A;  3V05 A;  5J1Z A;  2QA4 A;  3U50 C;  1B1Z A;  2E5L Q;  1X6O A;  2R92 H;  4PMC A;  1I3Q H;  4YY3 L;  1NR2 A;  4GLV B;  5KND A;  5GAG C;  2F03 A;  1Y1V H;  5IYD H;  2KCC A;  1QVC A;  3S2H H;  3HG9 A;  3WDN A;  3EFX D;  2K01 A;  1VQD A;  5EBD A;  1K9M C;  2FJ2 A;  5KGU A;  4DUZ Q;  1QNU A;  3TN2 A;  5GQO A;  1YIJ A;  4DNT B;  3E5S A;  2DGY A;  5M5W B;  1HFG A;  3BZC A;  3NTK A;  2EJG C;  4YHH L;  2KCT A;  2EXZ A;  2ZJR A;  1TS3 A;  1B7Y B;  4C3H B;  1EU3 A;  1D6E C;  1JE5 A;  3J81 c;  1PMR A;  2K1B A;  3HOX G;  2KCN A;  5D65 A;  2GVB A;  3RN5 A;  3J7A V;  1BCP F;  1D8L A;  2OTJ A;  2VNU D;  1Y14 B;  5NUC A;  1STE A;  1PH9 A;  4HIM A;  1N33 L;  4A3I G;  1G91 A;  5EJW A;  4ID6 A;  3D4W A;  1X65 A;  5HGQ A;  1N32 Q;  1C0A A;  3OIP A;  3J81 i;  1IBK L;  4JYA Q;  3T1Y Q;  4Q5V A;  1LT3 D;  5LMN L;  4JC0 A;  5IOD A;  4HCE A;  2UUB Q;  1F2Z A;  5JJZ A;  4OX9 L;  2F4V L;  5AJ3 Q;  3CME A;  1C48 A;  3S1M B;  2NVT H;  2B2V A;  1JWS D;  1KQS A;  3BG3 A;  4LMQ D;  1HHV A;  1VF7 A;  5IT9 E;  3ULL A;  3V2T A;  3FRP B;  4X3T A;  5HGT A;  5I9O A;  3OPO A;  1SYE A;  4HR7 B;  2X69 A;  4IO9 A;  3OWF A;  1LTI D;  3D3R A;  3PO3 H;  4A3K H;  2NWG A;  3OMG A;  4MNO A;  1N8R C;  1D7Q A;  2VQE Q;  2MUY A;  4LF9 L;  1C9O A;  3TP8 A;  1BCP B;  3KFU A;  3A54 A;  3PSI A;  1L0W A;  1HZ9 A;  4IUV A;  4F8M A;  3K7A H;  1NUC A;  4UP7 A;  1GO3 E;  4BY1 G;  4A76 A;  1EWI A;  1J8I A;  3K58 A;  4U68 A;  4LF8 Q;  1SJH D;  1VQK A;  1K83 B;  2K28 A;  1S5C D;  1CHP D;  1HUM A;  2NYZ D;  3ULP A;  5KIX A;  3RLO A;  4DR1 L;  4DUY Q;  3ZJY C;  1YI2 A;  1GVP A;  4GOP B;  4Y7N B;  4A75 A;  1NAP A;  2K5D A;  1KDA A;  2IHE A;  1I5F A;  4V19 0;  4IZ8 A;  1BXT A;  5JAV A;  3DXJ C;  2I46 A;  4LNQ A;  1XWE A;  5C44 H;  2KA7 A;  1JJG A;  3SK8 A;  3E9I A;  1FJG L;  3FKI H;  2IW3 A;  4C3H G;  2IX1 A;  1N36 L;  5FK9 C;  5D14 A;  1DM0 B;  3I91 A;  2AQ3 B;  1JOR A;  3JAM L;  1O80 A;  1ZYR D;  1BO0 A;  1GKH A;  3HEJ A;  2WB1 G;  1SRU A;  4DK0 A;  3HOU B;  5DAU A;  1GUS A;  1QOH A;  4IN3 A;  5IT9 c;  4GNX B;  2IL8 A;  5CV8 A;  5BR8 Q;  1XNR L;  4DR5 Q;  3HS0 C;  1BNZ A;  3A74 A;  5M3M G;  3K59 A;  4CKE A;  3CCE A;  4H02 A;  1TWA H;  1PHJ A;  4HCS A;  5EAY A;  1BBX C;  4F7X A;  4JG2 A;  4ZUI A;  2WP8 J;  1M8A A;  2L1B A;  1H9S B;  1SND A;  4DNR B;  2JJQ A;  3EIV A;  3W2D A;  5C0X H;  1Q90 A;  2EY6 A;  1IW7 C;  4CDE C;  2I0Q A;  4A3M B;  2HHH L;  1NJI C;  3SK5 A;  2RDF A;  1EY5 A;  3J81 j;  3GTL H;  2E2H B;  4FF1 A;  3BZD B;  3BVZ A;  4EQ5 A;  3GTP H;  3S1N H;  3S1Q H;  4C1N K;  3VA5 A;  2UU9 Q;  5CV7 A;  1SE2 A;  4FF3 A;  3C3L A;  3A8I E;  4AH6 A;  4DR3 L;  1I94 L;  2J7Z A;  3U4V A;  2JYO A;  4BA2 I;  1TS2 A;  4G4K A;  3H6M A;  1FR3 A;  3NBH A;  1EQT A;  4PNY A;  3G6E A;  1JMC A;  4A3C G;  5IP7 H;  3NQT A;  5GAD C;  3GTK H;  4JI7 L;  3KYH C;  1SNP A;  3KLS X;  1BVS A;  5BN5 A;  1DGS A;  3S14 H;  2GA4 B;  2OT2 A;  2KHI A;  2NB0 A;  2F0Q A;  2ENB A;  2F0S A;  4RFB A;  5LMU Q;  2J0T D;  3EA6 A;  3P7J A;  1PZI D;  4DV2 L;  1EIG A;  1JT8 A;  1FVI A;  2MGS A;  1G6Z A;  3OTO Q;  4EQO A;  3KK7 A;  1LT6 D;  4Y52 H;  1KRS A;  1LYL A;  4DV4 L;  4XYO A;  5M3F B;  3J7Y W;  2FMC A;  3Q24 A;  1JIC A;  4MHE A;  1E1T A;  3W1B A;  4YWK A;  3GTM B;  3RLN A;  2D0P A;  2KVM A;  4OON A;  1K3B C;  4Z9C B;  5CMD A;  3H91 A;  1CK1 A;  3NQI A;  2B3G A;  3ONA B;  4KY5 A;  3S1R B;  4B3R L;  4O2D A;  3PMF A;  3T1H L;  1QZG A;  3BU2 A;  4S3S A;  4BBR B;  1XMO L;  2UUC L;  2GN5 A;  1EYC A;  3CAM A;  1SR3 A;  1BBW A;  3H3V C;  2JE6 I;  2TSS A;  4DV3 L;  3K5M A;  2Z0S A;  1MHW C;  1X32 A;  4DK6 C;  1PLF A;  4L63 B;  1KDB A;  2Z1C A;  2HDL A;  1STH A;  2F0J A;  1A3T A;  1GHK A;  1UEA B;  1XPO A;  1WCM B;  2XN9 C;  4MTK A;  1Z7T A;  1EY8 A;  4JI2 L;  2Q8T A;  2FFK B;  1VQL A;  1MD2 D;  2JP1 A;  3S16 B;  2ES2 A;  1XJV A;  1B9N A;  1FGB D;  4A3M G;  4YCW A;  1A2T A;  4QB4 A;  5FLX c;  2EQS A;  1PVO A;  2YU9 H;  1ASY A;  4X3S A;  2ZM6 L;  1CFM A;  4C3J B;  5IT9 L;  1JOO A;  3DM1 A;  1YNN C;  4KMU C;  4KHP L;  4N8X 1;  3IFD A;  2MO0 A;  2BDO A;  1DZ1 A;  4YIJ A;  1D5M C;  3UE1 A;  1HPC A;  2CH4 W;  2O5I C;  3EJI A;  2XVS A;  2MNA A;  4IUP A;  5LHY 1;  3M9B A;  4BXX H;  2A69 C;  3M7G A;  5C4Z A;  4R1J A;  5C4J B;  3K0X A;  5D3I B;  4G7Z C;  1B44 D;  1OXS C;  3RMH A;  3QIA A;  1IW7 D;  1CM9 A;  4IUU A;  3CP0 A;  3AQQ A;  3NXW A;  3VR6 A;  2PMZ E;  4RCO A;  2JA8 B;  2NVX H;  4C3I B;  2I07 B;  3AMU A;  1GUW A;  3NWS A;  5M3F G;  1PTO H;  3CCJ A;  1STG A;  3NUC A;  4A93 B;  3OOC A;  1X54 A;  4JPB W;  5ELD A;  1D1K A;  1SEB D;  2K6A A;  5CV4 A;  4A3D B;  1A0I A;  1EYA A;  3BVM A;  2EE1 A;  4BBR G;  2C9O A;  2IX3 A;  5C3E B;  5KYL A;  3MZ5 A;  1YHB A;  2V4D A;  1HTL D;  4A3J H;  5E4W C;  2XIW A;  2EJM A;  3CQZ B;  2QIL A;  4DV5 Q;  1TS4 A;  3CCQ A;  1IBL L;  2JA6 B;  2AHO B;  2GVA A;  3PUV A;  5ELN A;  3KF6 A;  3D31 A;  5CGK A;  2NN6 H;  1EFW A;  1G2S A;  3E6Z X;  3ULJ A;  4A3F H;  4RAU C;  3GD7 A;  1WCM G;  1TWF B;  4IOA A;  1ML0 D;  2OEO A;  2VUM H;  2EOT A;  1RL2 A;  2PI2 E;  4IPG A;  1B53 A;  4L5T A;  1M4V A;  1P8L A;  4BA1 I;  5LMN W;  4LF5 Q;  2FIN B;  3I2Z A;  4ZLT F;  4DXF A;  1II3 A;  3Q22 A;  4JI4 L;  4A3L G;  2B2T C;  2SOB A;  4A3G H;  2L5T A;  4CDC C;  5L37 A;  2JA7 H;  2RCN A;  1EY9 A;  4ZRZ A;  1STN A;  2LMC B;  3C1E A;  1W6J A;  4CJ2 C;  1WTX A;  1PXU A;  4OWT B;  2CFM A;  3J7A 5;  1E22 A;  3CCL A;  5I2X A;  4B3S Q;  1VQP A;  4RMF A;  2PQA B;  1A3U A;  3TRE A;  1QZH A;  3GTO H;  1Z9F A;  3C2P A;  1HNZ L;  2M9V A;  2KEC A;  4LK1 C;  2B63 B;  2JA8 G;  3CPF A;  4IPC A;  4BY7 B;  4DAV A;  2OCE A;  3STB C;  1YNN D;  2K5N A;  3HOY G;  1PFB A;  1R4P B;  3S9W A;  3CMA A;  3CKI B;  1TWH B;  2Q2T A;  2R93 B;  1VQB A;  1EIF A;  4A93 G;  3NTI A;  1F2M A;  2QKI C;  2K05 A;  3PUW A;  4K5V A;  1V43 A;  4IUN A;  3SK4 A;  4AIM A;  3DEP A;  2VL6 A;  3K7U C;  5E1F A;  1JR0 D;  3K8A A;  4U67 3;  3GTJ H;  1VMP A;  4NDX A;  4A3D G;  2PQE A;  2A69 D;  5J39 A;  1G51 A;  1BOS A;  1B50 A;  2F0L A;  2PQA A;  1RTN A;  5EPL A;  4AQY L;  1GUT A;  1IBM L;  2UXC L;  2YYZ A;  3IFT A;  5C0X I;  2K14 A;  1EWC A;  2E2J H;  1DON A;  4LFB L;  1CZW A;  1A2U A;  3H0G H;  2HDM A;  1ZXT A;  5E7N A;  5I6Y A;  3K5L A;  3NTH A;  3A8J E;  3CW2 C;  3VR4 A;  3PO2 G;  4R4C A;  3HOW G;  1V1Q A;  4BBS H;  4IJL A;  2F3W A;  1KD1 C;  1F77 A;  1PZJ D;  5C6A A;  3I56 A;  3M4Q A;  3MTS A;  2FXQ A;  2FHT A;  5CV9 A;  1L1O C;  2F0T A;  1IL2 A;  5E3F A;  1QG7 A;  1ICF B;  1MBY A;  2WIN B;  1E2V A;  2AQ2 B;  1BCP C;  2L4N A;  4JI3 Q;  3G7L A;  3BS1 A;  3TBI B;  4X62 Q;  1YBY A;  2YTV A;  2R92 B;  3M4Y A;  3T53 B;  1Z6H A;  3I4N H;  1I3Q B;  1O7I A;  1RCV D;  2QGQ A;  4LFA Q;  4K0K L;  4PZ6 A;  4LF7 L;  1Y1V B;  3J80 E;  3M85 A;  3S2H B;  3QWN A;  1DD2 A;  3DWQ A;  1L0X B;  3TS0 A;  4JOI C;  1MIU A;  2RKS A;  3QG1 A;  4GOP C;  4JI8 Q;  1XMQ L;  1SNO A;  3ERS X;  2VQF Q;  3EVQ A;  2EYJ A;  4DV1 L;  1WD0 A;  4K5W A;  2DY8 A;  2JA9 A;  4B9X A;  4EX5 A;  3CF5 A;  1Y1W H;  1PH7 A;  1Q46 A;  3VYR A;  5EBC A;  1SN8 A;  4FVM A;  1FYC A;  1WVL A;  4DV0 L;  4ULL A;  1BR9 A;  2B63 G;  1KXL A;  4WRD A;  1Q7Y C;  1B2T A;  3NK9 A;  3AFP A;  4PG3 A;  3K5N A;  4AYB B;  3RZD H;  1PH8 A;  3I4M G;  1AE3 A;  1CKO A;  5AFW A;  1LV9 A;  1WOC A;  3MVV A;  2PI2 A;  1N34 L;  3W3A A;  4KTA A;  3F2D A;  4UPA A;  2F3I A;  4GNX C;  1SXT A;  2NZ1 D;  4JI1 L;  2XTI A;  4NXM L;  4IFD H;  1G29 1;  5DLQ E;  4GZY C;  1K0R A;  2SNS A;  3OW2 A;  2ZT9 C;  3NP8 A;  4MN3 A;  2NVT B;  1E2Z A;  1DXM A;  3BVG A;  5EQ0 A;  3UDI A;  1K8A C;  2IX0 A;  1PRT C;  1X3E A;  3JAM c;  2N8N A;  4QUF A;  3UDX A;  4QCL A;  2MQH A;  4BWG B;  5K36 G;  1IYJ B;  3DM3 A;  3STB D;  2Z9H A;  3CCS A;  2L11 A;  3PO3 B;  1Q82 C;  1VQ8 A;  3OHX C;  4A3K B;  1SNM A;  1AP0 A;  2F0H A;  4KKU A;  4HSV A;  3KLR A;  3E3X A;  1LT5 D;  1YJW A;  5HY6 A;  3JAM i;  5IGD A;  1SNQ A;  4K5X A;  4TKO B;  1KRT A;  3T16 A;  1AW7 A;  3R8B A;  1RIP A;  1I6H H;  1EOV A;  1S40 A;  2E76 C;  3K7A B;  2OWO A;  3IL8 A;  4RG1 A;  2HIV A;  2KED A;  3HOX H;  1SBB B;  1SAP A;  1LTR D;  1EUJ A;  1KTK A;  2Z6K C;  1MJE A;  2B2T A;  1O7Y A;  4M8A A;  3K81 C;  1IXR A;  4DN4 M;  2F0D A;  3R2I A;  2XRQ D;  2CCZ A;  1QCB D;  2A6H C;  4A4I A;  5KYI A;  4FP5 D;  3M4O H;  1FD7 D;  4RGM A;  3FKI B;  2EYH A;  4PMB A;  1N33 Q;  3U4Z A;  1N32 L;  4K8J A;  2AQ1 B;  4X65 L;  4GS3 A;  1E1O A;  3T1Y L;  1U4P A;  1BCP D;  1VCI A;  1OXX K;  3MXU A;  1D5Z C;  2F0F A;  4KY7 A;  1XNQ L;  1W6K A;  1IBK Q;  1QUQ B;  2RHQ B;  2PNR C;  4TQU S;  1HA5 A;  4ODG A;  1E2W A;  5LMN Q;  4UDU C;  3F1Z A;  3W1G A;  3QB3 A;  4HAE A;  3CCM A;  1NTG A;  5GAH C;  2F4V Q;  4ABN A;  1GM5 A;  1VQ4 A;  5I9P A;  1X3F A;  2CVR A;  1DOM A;  1JJ2 A;  4XIG S;  1RD9 D;  4ZUJ A;  2NN6 I;  1TWA B;  4FXD A;  1PFS A;  1L1O B;  1KLG D;  4ZYS A;  1FGU A;  2B39 A;  1KC8 C;  5JJK A;  2ICE C;  3GP7 A;  2X6L A;  5IP9 H;  1PH2 A;  3F2B A;  3GTL B;  4IUR A;  2WII B;  1AEX A;  2X6G A;  4JI6 L;  3GTP B;  3S1N B;  4LF8 L;  3S1Q B;  1PRT F;  4J6H A;  4DV7 Q;  4Q0F A;  4QIW E;  5CBA E;  4FYD A;  4LF4 Q;  4KHZ A;  5G3L F;  3U58 A;  3IKJ A;  4JI0 L;  3ERQ A;  3TZU A;  3GTK B;  1L1O A;  2BA0 A;  1IHZ A;  3S14 B;  1EY4 A;  1HZA A;  1SE3 A;  2D0O A;  1NBW A;  2EY1 A;  2XRS D;  3QR8 A;  4C2M H;  5IE8 A;  2EPB A;  2LXJ A;  1EOT A;  2CWP A;  2SNM A;  1PRT D;  5FO8 B;  4OO1 G;  1ZEQ X;  1HH2 P;  5G3L D;  3NE5 B;  1SYF A;  1X56 A;  3H94 A;  1VQF A;  1N36 Q;  3ND8 A;  3J80 L;  1OXT A;  1UAP A;  1YNJ D;  2DNC A;  4JBK A;  3W5O A;  4JOI A;  5FO7 B;  1VMC A;  5M3M H;  2ASB A;  4GOP A;  1T5X D;  3VYU A;  1RTO A;  2ZTC A;  5BR8 L;  3NWT A;  2PNH A;  4DR5 L;  3A56 A;  4X3U A;  4HIO A;  1S5B D;  1V1P B;  2RSN A;  4B9W A;  2WKC A;  1I6V C;  1PRT B;  3BDL A;  1CUK A;  4DAM A;  3E0J A;  2DN8 A;  3RD4 A;  2B8G A;  2EZV A;  4P72 A;  3OYY A;  1KDC A;  3Q23 A;  3P20 A;  1ENA A;  3D6C A;  4EVO A;  4GN5 A;  2ZXP A;  1MI2 A;  2LY7 A;  5IYC G;  4G7O C;  3VYS A;  2A6H D;  1J5E Q;  4A3B H;  4GNX A;  2AUJ D;  3KF8 B;  2YTY A;  1H95 A;  2A19 A;  2HHH Q;  4NB3 A;  3VYT A;  1B70 B;  4A3C H;  5BN3 A;  2K32 A;  5C4H A;  1CZG A;  1O7Z A;  1G2T A;  1E0B A;  1E24 A;  1GXD C;  3GTQ H;  1G6P A;  1PTO F;  2HQE A;  1Q8I A;  3WOE A;  2PYK A;  3FVQ A;  2JA5 H;  4DR3 Q;  2RBM A;  1EU4 A;  1OXU A;  4K6L A;  4WJW A;  1ENC A;  4DK1 A;  5M5X H;  4P2C B;  1UE6 A;  2IWH A;  1MGS A;  1H9S A;  3ZYY X;  3Q0A A;  5EPK A;  4JI7 Q;  5IIF A;  2HT1 A;  1NMF A;  3L0O A;  5IGE A;  1SRO A;  5LMU L;  2IHF A;  1XXG A;  1S5F D;  4B08 A;  1PTO D;  4QJF A;  1NSN S;  2VY3 A;  4ILW A;  5IP7 G;  3OTO L;  3KF8 A;  1X3Q A;  2B2U C;  1LTS D;  2BE5 C;  4PV1 C;  2WFW A;  3RR5 A;  3T56 B;  3GV6 A;  5FLM G;  1HA6 A;  2KOL A;  2MP1 A;  1B9M A;  4LFC Q;  4QIW B;  2ZXO A;  3QO2 A;  3AEV A;  2Z6K A;  2MFI A;  4QL5 A;  3HOU G;  1CHQ D;  1Y8P B;  4EGV A;  2NVX B;  2PZU A;  1SYG A;  5J3B A;  1LO5 D;  2Q8I B;  1CKN B;  1JWM D;  3A8K E;  3TRZ A;  2A68 D;  2AUK A;  1PTO B;  4RA8 A;  3P1H A;  5IGF A;  2V1C C;  2OTL A;  4XQN A;  3I90 A;  4NXN L;  4CDF C;  4DFA A;  1O7L A;  1T9H A;  5JJI A;  1HFN A;  4KKT A;  4UHV A;  4OWW B;  4IFD I;  2K04 A;  1VQG A;  1TII D;  3D4R A;  2EYF A;  1ET6 A;  3HOZ H;  3S15 B;  3F2U A;  3M3Y H;  3A7A B;  4A3J B;  5M5Y H;  1FNU A;  3D6W A;  1C4Q A;  4GKK L;  5IYB H;  2AMC B;  4HJ7 A;  2A6E D;  3CCU A;  4JI2 Q;  4FXG C;  3K57 A;  1VQ6 A;  4JBJ A;  5TSS A;  5JEA J;  1I4X A;  1CKN A;  3A0J A;  3S17 H;  4A3F B;  4RHS A;  2YV5 A;  1K28 A;  2L12 A;  1QB5 D;  3J7A F;  2VUM B;  4R4O A;  2ZM6 Q;  1ENF A;  1CSP A;  5FJ8 G;  3SVM A;  4KHP Q;  1JOQ A;  4IAL A;  2L0C A;  4O1N A;  1N9W A;  4M1U B;  2SDF A;  4XXE A;  1QE6 A;  1ASZ A;  4WJ3 M;  5T1G A;  3CD6 A;  3TQY A;  4A3G B;  5KNC A;  4ZKB B;  3P75 A;  2JA7 B;  5DM6 3;  2DY7 A;  1CKM A;  3N6R A;  2L15 A;  4X64 Q;  2N55 A;  5M3F H;  2F52 A;  1X55 A;  4CJ1 B;  1U4M A;  1YHQ A;  3PIO A;  1TWG H;  2Q2I A;  2PCF B;  5LL6 S;  4APV A;  1SMY C;  5C4X H;  1GUG A;  3RUZ A;  3PIO 3;  1YIT A;  3GTO B;  2R7F A;  1AFP A;  4BBR H;  1O78 A;  4X66 Q;  2F4I A;  1S5D D;  1PH3 A;  2BH2 A;  5COY A;  2OQ0 A;  2HUG A;  1QJO A;  1YZ6 A;  2B2W C;  3B6Y A;  4ZCK A;  2XSC A;  3PGZ A;  2PO4 A;  3FMC A;  3HOV H;  2RF4 A;  3RN2 A;  2F0I A;  3PV0 A;  3SK6 A;  4DV5 L;  4RWS C;  2R7Z H;  3GTJ B;  4JBW A;  1EFI D;  1VQO A;  2A73 B;  2BE5 D;  4B3M L;  2FMM A;  2KHJ A;  1K8M A;  2Q2U A;  1R4Q B;  1U5K A;  2NVQ H;  4A3J G;  5IWA L;  5EPJ A;  3SHL A;  1PYS B;  1JCK B;  2MJ8 A;  4A3L H;  2E2J B;  1HR0 L;  4LF6 Q;  4A3E H;  1VF5 C;  2KHS A;  3H0G B;  4C3J G;  4LF5 L;  4HJ5 A;  2CHB D;  1PH6 A;  4A3F G;  2OF1 A;  2F0E A;  2JK8 A;  3K80 C;  1U4L A;  4DGZ A;  3F8T A;  4BBS B;  1H9K A;  1XPR A;  3S2D H;  1Y8N B;  4RGN A;  4E6I A;  2CWA A;  1BKB A;  4PZ7 A;  4CKC A;  2MPM A;  5FOB B;  3Q8D A;  4AYB E;  4OGQ C;  1YJN A;  2UXD Q;  4POF A;  4HJ8 A;  4WOR A;  3UI2 A;  3KDF B;  3GO5 A;  2N88 A;  3SGI A;  1KL9 A;  5DM7 3;  3TP7 A;  3VR3 A;  4JI5 L;  1LAB A;  4B3S L;  3I4N B;  2LSS A;  2PZW A;  5JEA G;  1B3Q A;  2JN4 A;  1IZ6 A;  2Z6B A;  1Q86 C;  4C3I G;  3HOY H;  1RKN A;  3MHB A;  3NPP A;  2E8G A;  3DHQ A;  2A1A A;  4DR7 L;  1HNZ Q;  1A3V A;  2B29 A;  1WJJ A;  1U4R A;  2Y0S E;  2B2U A;  1EIH A;  1WTH A;  2AWO A;  4C56 C;  1C8C A;  1VQ9 A;  1EEF D;  1Y1W B;  1D1I A;  3IRB A;  3DUZ A;  1I4Q A;  3UE0 A;  1WTW A;  4I7Z C;  5C3E G;  3KDF A;  1CA5 A;  2XGT A;  4XT3 B;  5DNF A;  1IYU A;  2PZT A;  2NVY H;  4R8I A;  3RZD B;  2XWB B;  1GHJ A;  2F0M A;  1BBU A;  1JE4 A;  1VS0 A;  1C7Y A;  4P73 A;  2JA6 G;  4RH6 A;  3QJY A;  3PO2 H;  2LFN A;  5H1S E;  2LS0 1;  1A63 A;  1Z47 A;  2K33 A;  1IBM Q;  3FPU B;  3HOW H;  5A2Q E;  1TQO A;  1SMY D;  1JB7 A;  1BF4 A;  1KHI A;  4ZKC B;  2RDG A;  4KN7 C;  4KKS A;  2D2C C;  4GKJ Q;  4H44 C;  1CTM A;  5DEH A;  3TEH B;  4WJ4 A;  5GAE C;  2DUD A;  2F0G A;  4LUV A;  5JVH 3;  1WTP A;  1HNX L;  4ME5 A;  4OEL B;  3TP5 A;  3FPP A;  4I65 A;  1HNW L;  1LLR D;  4B3T Q;  1H9M A;  1U9R A;  4BBS G;  2CQA A;  2L9H A;  3LNN A;  4CBV A;  4DV6 Q;  1ZKO A;  4GLA C;  3FHW A;  3MEF A;  1XYI A;  2EY2 A;  1I6H B;  4LAA A;  3CRL C;  3FP9 A;  1Y8O B;  3OIQ A;  4FO2 A;  4KJO A;  2A74 C;  1HUN A;  1VDZ A;  4H7B A;  1I4H A;  2K5W A;  3CHB D;  3HOX B;  4KD4 A;  4JI8 L;  1EQQ A;  3H3V H;  2NTS A;  3RZO H;  2E2I H;  4DF7 A;  1SYB A;  4DR2 L;  3FEW X;  1XMQ Q;  2HCI A;  3I4M H;  1S5E D;  3TDQ A;  4BY7 G;  1ESF A;  1ILQ A;  2H5X A;  3HFZ B;  4DV1 Q;  3BYY B;  4DR6 L;  3KLW A;  4R8N A;  3U9O A;  3NEN A;  5I4D A;  2UUA Q;  1VQE A;  2R93 G;  5HUR A;  2OQK A;  3M4O B;  5T1I A;  3A5Z B;  1PH4 A;  3LWE A;  2M2L A;  3CC2 A;  3J81 E;  2B8F A;  1V8Q A;  4HMI A;  1X3P A;  4UP8 A;  1R9T H;  3NEL A;  4QF4 A;  1PFM A;  3I3C A;  5CYU A;  2K52 A;  4RHR A;  3KBG A;  4CGY B;  2QF7 A;  5I6W A;  5ELB A;  1KIX A;  4FF4 A;  1WTV A;  2JSO A;  2PW5 A;  3HKS A;  3QOL A;  1K8O A;  1NMG A;  5K36 H;  2Y0S B;  1FNV A;  3CRK C;  3T51 B;  3L2P A;  2B2W A;  2M00 A;  1K73 C;  1Q12 A;  1V1O A;  2KCM A;  4HN7 A;  1GJX A;  1LAC A;  3I70 A;  3KLS A;  1BDO A;  3J80 c;  2UXB L;  1YNJ C;  3I72 A;  1M1K C;  1BUV T;  2E5L L;  4JV5 Q;  1JQY D;  4LJZ C;  3M7N A;  4HTH A;  4DR4 Q;  2HD3 A;  3BJU A;  1VQH A;  5E4X A;  4DNI A;  3PUY A;  1J6Q A;  4J1M A;  4K2K A;  4YY3 Q;  4XTC S;  4C1N I;  4DAP A;  4OIK A;  4QUC A;  2WAQ E;  4DUZ L;  1WTO A;  1BQQ T;  2E74 C;  3J80 i;  4YWL A;  2R92 G;  1GUO A;  2EYL A;  1TWC H;  3BDO A;  4TRD A;  2EY5 A;  4J15 A;  2DJG C;  1PA6 A;  2EDG A;  4DAY B;  2I5H A;  2ATW A;  1Y1V G;  4A3I H;  5IYD G;  2Z4H A;  4YHH Q;  4KV6 A;  3GTG H;  2I5L X;  2ALY B;  1S3O A;  4N9T A;  2WV6 D;  4JW0 A;  5C44 B;  1XPU A;  5ISR A;  2R6G A;  4ZQ3 A;  4DKA C;  4TSS A;  1DYQ A;  1F9Q A;  1L0Y B;  3TP6 A;  2QDL A;  1K3R A;  3BDC A;  4YCU A;  1I4G A;  1VQM A;  2K03 A;  1Y69 U;  4C2M B;  1EWH A;  4JYA L;  2WB1 B;  4H0L C;  5ELO A;  3G4S A;  4QMG A;  2K5H A;  4UAI A;  4CHT B;  1I50 H;  4R4I A;  2UUB L;  3L3O C;  5C0X J;  3IAY A;  3CU7 A;  1LTL A;  4AYB G;  2QDB A;  5AJ3 L;  4QQB X;  5CV5 A;  1B3A A;  4X65 Q;  3HRZ C;  4P75 A;  1EL0 A;  4HIK A;  4OX9 Q;  4DAY A;  1IL8 A;  1J9O A;  1JOK A;  5M3M B;  3SR1 A;  2EYP A;  3E9H A;  2J4X A;  1XNQ Q;  1MSG A;  1ILP A;  3HZX A;  3D8G A;  3URY A;  1PTO C;  3Q6S A;  1STB A;  1TR5 A;  4RGT A;  2QEJ C;  4QGU A;  1EY0 A;  4CDD C;  3GV3 A;  5C3X A;  4O42 A;  1CSQ A;  1G8Z D;  2E75 C;  3CC4 A;  5K5P A;  3CPW A;  1Q8K A;  2BCO A;  4BY1 H;  1SFO H;  2VQE L;  3VDY A;  2G5D A;  2B2Y C;  2RCF A;  5IY0 A;  2C35 B;  2Y0S G;  1AZQ A;  4KLK A;  2BOS A;  3PF5 A;  1NCV A;  1XTD A;  2XWJ B;  2EYO A;  2Z4I A;  4WFN 3;  4LF9 Q;  1QUQ A;  1UE5 A;  2F0O A;  2AWN A;  1EIY B;  1IKM A;  3MXG A;  2NBF A;  3PO3 G;  1B4O A;  4A3B B;  4FNF A;  4A3K G;  1VQJ A;  2A68 C;  1YJ9 A;  3FDT A;  3DLL A;  1PV4 A;  3AB9 A;  4LW1 A;  4GLX A;  2N3S A;  4IOC A;  1SYC A;  5C5L A;  4KI0 A;  3KOJ A;  5M5W H;  1LTA D;  4DUY L;  5A2Q L;  3ER0 A;  3MEH A;  2NZH A;  4DV7 L;  4JI6 Q;  5IGB A;  3GTQ B;  3PF4 A;  2CW0 C;  3WWV A;  2ICI A;  5FKA C;  4LF4 L;  5IP9 G;  4DR1 Q;  1W2B A;  3MFG A;  5CC4 A;  4C3H H;  2BA1 A;  5KEE A;  4POG A;  2CQO A;  2JA5 B;  1IYV A;  2IY5 B;  2VB2 X;  1ROD A;  2ID0 A;  1ESR A;  3T13 A;  5M5X B;  1PDQ A;  4XQJ A;  4OO1 H;  4ALP A;  1AZP A;  2Z8L A;  4OIJ A;  4JI0 Q;  2HQL A;  4F87 A;  3DWP A;  3R93 A;  2A8V A;  2N49 A;  3TZD A;  4OWX B;  1FJG Q;  2A6E C;  3PUX A;  3PQI A;  4I7A A;  5IOC A;  1A6X A;  3MWY W;  2PW7 A;  1SYD A;  3LWU A;  1EQV A;  1F2Y A;  1DOK A;  1HR0 W;  4LUZ A;  5C44 G;  2WAQ B;  1S4Z A; 
#chains in the Genus database with same CATH homology
 3LGJ A;  2JA8 G;  1VQ6 A;  4JV5 L;  3CPF A;  4JBJ A;  5JEA J;  4IPC A;  1PH1 A;  1CKN A;  3A0J A;  2K50 A;  3FKI G;  4O0A A;  1A8V A;  1VQ7 A;  2OCE A;  3S17 H;  4DR4 L;  4X6A H;  2I5M X;  3STB C;  2VW9 A;  2YV5 A;  2RHS B;  2K5N A;  3BZK A;  2UXB Q;  1E7Z A;  1YVC A;  2E5L Q;  2R92 H;  2QA4 A;  3U50 C;  3HOY G;  1X6O A;  3CMA A;  2Q2T A;  3S1M H;  1VQB A;  1I3Q H;  4YY3 L;  4R4O A;  1EIF A;  2ZM6 Q;  1XNR Q;  5JJL A;  4GLV B;  4A93 G;  1CSP A;  5FJ8 G;  3PUW A;  5GAG C;  4KHP Q;  4AIM A;  1V43 A;  1Y1V H;  5IYD H;  3RLF A;  1QVC A;  2VL6 A;  3K7U C;  3S2H H;  3GTJ H;  3K8A A;  4A3D G;  1K9M C;  1VQD A;  1N9W A;  3NEM A;  1UE1 A;  1G51 A;  1ASZ A;  4DUZ Q;  4WJ3 M;  3AFQ A;  3CD6 A;  5GQO A;  5IYC H;  3TQY A;  1YIJ A;  2DGY A;  3BZC A;  4HID A;  2PQA A;  3NBH B;  3S24 A;  4AQY L;  4YHH L;  1IBM L;  2KCT A;  4IPH A;  1CKM A;  3HKZ E;  2ZJQ A;  2ZJR A;  2UXC L;  2YYZ A;  4LWC A;  1B7Y B;  2L15 A;  5C0X I;  2K14 A;  2KBN A;  4X64 Q;  1WYD A;  1JE5 A;  3J81 c;  5M3F H;  1P16 A;  1X3G A;  2F52 A;  3HOX G;  1UWV A;  2E2J H;  4LFB L;  1X55 A;  4P71 A;  1YHQ A;  3H0G H;  5E7N A;  1TWG H;  2GVB A;  3PIO A;  1D8L A;  1NE3 A;  3RN5 A;  2Q2I A;  1J5E L;  2OTJ A;  1Y14 B;  2VNU D;  2UU9 L;  3CW2 C;  4GN4 B;  3PO2 G;  1PH9 A;  4HIM A;  1N33 L;  4APV A;  2JEB I;  4R4C A;  5C4X H;  4A3I G;  5C0X G;  1K83 H;  3HOW G;  1V1Q A;  4BBS H;  4IJL A;  1YIT A;  1KD1 C;  1X65 A;  2R7F A;  3I56 A;  1I94 Q;  3M4Q A;  5HGQ A;  1N32 Q;  1SLJ A;  1C0A A;  4BBR H;  2FXQ A;  4X66 Q;  3J81 i;  1L1O C;  1IBK L;  1IL2 A;  4JYA Q;  3T1Y Q;  2BH8 A;  4A3B G;  1PH3 A;  4L5S A;  4Y7N H;  5LMN L;  4JI3 Q;  4JC0 A;  4X62 Q;  2BH2 A;  2UUB Q;  1YBY A;  2YTV A;  4OX9 L;  2F4V L;  2OQ0 A;  5AJ3 Q;  3CME A;  1W3S A;  1YZ6 A;  3B6Y A;  2NVT H;  3I4N H;  1O7I A;  2QGQ A;  3PGZ A;  4LFA Q;  4IJH A;  3HOV H;  4K0K L;  2RF4 A;  2LXK A;  4PZ6 A;  3RN2 A;  1KQS A;  4LF7 L;  5FLM H;  3PV0 A;  3M85 A;  4DV2 Q;  4DV5 L;  2JA5 G;  2R7Z H;  1Q1E A;  5GRO A;  1V9P A;  4JBW A;  1VQO A;  3ULL A;  4B3M L;  3PIP A;  3TS0 A;  2KHJ A;  4JOI C;  1MIU A;  2Q2U A;  4GOP C;  1U5K A;  4JI8 Q;  4DV4 Q;  2NVQ H;  3H3V I;  3HOU H;  1XMQ L;  4IO9 A;  3ERS X;  3PO3 H;  4A3K H;  4MNO A;  4A3J G;  1EYG A;  5IWA L;  2VQF Q;  4DV1 L;  1N8R C;  4LFC L;  4EX5 A;  1PYS B;  2JA9 A;  2VQE Q;  3CF5 A;  1D7Q A;  1Y1W H;  1PH7 A;  3JC6 6;  1Q46 A;  1C9O A;  3MXN B;  4LF9 L;  4A3L H;  3KFU A;  1HR0 L;  1SN8 A;  3PSI A;  4A3E H;  4LF6 Q;  1L0W A;  1HZ9 A;  2WAQ G;  4DV0 L;  4B3R Q;  2B63 G;  1KXL A;  4LF5 L;  2YTX A;  1Q7Y C;  3T1H Q;  3K7A H;  4UP7 A;  4HJ5 A;  1PH6 A;  3AFP A;  1MJC A;  1GO3 E;  4PG3 A;  4BY1 G;  4A76 A;  4A3F G;  1EWI A;  2JK8 A;  4R4T A;  3RZD H;  3K80 C;  1PH8 A;  4LF8 Q;  3I4M G;  1XMO Q;  1VQK A;  2UUC Q;  3F8T A;  1CKO A;  1AE3 A;  3H15 A;  1XPR A;  3S2D H;  3J7Z C;  1SE8 A;  2CWA A;  1WOC A;  3ULP A;  1PH5 A;  1BKB A;  2PI2 A;  4PZ7 A;  4DV3 Q;  1N34 L;  3RLO A;  4DR1 L;  4DUY Q;  3ZJY C;  3F2D A;  2MO1 A;  3Q8D A;  2F3I A;  4UPA A;  4AYB E;  4GNX C;  1YI2 A;  1GVP A;  1YJN A;  4GOP B;  2UXD Q;  4QY7 A;  4POF A;  4A75 A;  4A3M H;  4HJ8 A;  4JI1 L;  4NXN Q;  2EXD A;  1I5F A;  2IHE A;  2XTI A;  3GO5 A;  3KDF B;  2E2H H;  4NXM L;  3SGI A;  1KL9 A;  4LNQ A;  5C44 H;  1G29 1;  1HJP A;  5DLQ E;  1K0R A;  4PMW A;  3OW2 A;  1K8G A;  1JJG A;  4JI5 L;  3E9I A;  4L5R C;  4B3S L;  1FJG L;  2LSS A;  3FKI H;  4JCV E;  1JJC B;  1M90 C;  5JEA G;  3UDI A;  1K8A C;  4IPD A;  1IZ6 A;  2IX0 A;  1X3E A;  3JAM c;  1Q86 C;  2N8N A;  2IX1 A;  3HOY H;  4OXP A;  1N36 L;  3UDX A;  2MQH A;  4GKK Q;  2E8G A;  2A1A A;  5K36 G;  1IYJ B;  3DM3 A;  4DR7 L;  1GKH A;  5FJ8 H;  3STB D;  3CCS A;  2WB1 G;  3KJO A;  1HNZ Q;  1SRU A;  2B29 A;  3HOZ G;  1VQA A;  2D62 A;  1WJJ A;  2Y0S E;  1Q82 C;  1VQ8 A;  2NZO A;  3UDF A;  5IT9 c;  2AWO A;  4GNX B;  5IYB G;  3TS2 A;  1YJW A;  1WFQ A;  1VQ9 A;  5HY6 A;  5BR8 Q;  3JAM i;  1XNR L;  3GDE A;  1KRT A;  4DR5 Q;  2ZTE A;  3IRB A;  1RIP A;  1I6H H;  3UE0 A;  1EOV A;  3D0F A;  3A74 A;  5C3E G;  5M3M G;  1YNX A;  3KDF A;  3CCE A;  1S40 A;  2OWO A;  4H02 A;  1FL0 A;  1TWA H;  2XGT A;  4RG1 A;  1PHJ A;  5EAY A;  2HIV A;  2NVY H;  3HOX H;  4JG2 A;  1EUJ A;  2R7D A;  3F2C A;  2WP8 J;  1BBU A;  1VS0 A;  4DPG A;  1C7Y A;  4P73 A;  2JA6 G;  2Z6K C;  1MJE A;  1L2F A;  3GTM H;  3PO2 H;  4BXX G;  2JJQ A;  3EIV A;  3K81 C;  1IXR A;  5H1S E;  1Z47 A;  4X64 L;  4UY8 C;  1A63 A;  1IBM Q;  1YHA A;  3HOW H;  2I0Q A;  2HHH L;  1NJI C;  3S1R H;  3J81 j;  2CCZ A;  3GTL H;  4A4I A;  4EQ5 A;  1JB7 A;  1KHI A;  4HJA A;  3GTP H;  1Q81 C;  3S1N H;  3M4O H;  3S1Q H;  2UU9 Q;  3I4O A;  3KF6 B;  4GKJ Q;  1N33 Q;  4DR3 L;  4AH6 A;  3U4Z A;  1I94 L;  1N32 L;  3U4V A;  4X65 L;  4GS3 A;  4X66 L;  1E1O A;  4BA2 I;  3TEH B;  4WJ4 A;  3T1Y L;  5GAE C;  1VCI A;  1OXX K;  3G6E A;  1JMC A;  4A3C G;  4LUZ A;  2DUD A;  5IP7 H;  5GAD C;  3GTK H;  4JI7 L;  3KYH C;  4LUV A;  2AKW B;  1XNQ L;  1IBK Q;  1QUQ B;  1BVS A;  2RHQ B;  1DGS A;  3S14 H;  1HNX L;  4TQU S;  5C4X G;  1HNW L;  2KHI A;  4B3T Q;  1NY4 A;  5LMN Q;  1WCM H;  3F1Z A;  3W1G A;  4BBS G;  1VQC A;  4DV6 Q;  3CCM A;  1VQN A;  4GLA C;  3FHW A;  1NTG A;  5GAH C;  2F4V Q;  5LMU Q;  2N78 A;  1GM5 A;  3CC7 A;  1VQ4 A;  3S15 H;  1X3F A;  3MEF A;  3PCO B;  1IBL Q;  4DV2 L;  3S16 H;  1JT8 A;  1JJ2 A;  4XIG S;  3FP9 A;  1FVI A;  3OTO Q;  2NN6 I;  3KJP A;  1PFS A;  1L1O B;  4JBM A;  4Y52 H;  1KRS A;  1LYL A;  1FGU A;  4DV4 L;  4JI8 L;  1KC8 C;  1LM0 A;  1EQQ A;  4B3M Q;  4C3J H;  3H3V H;  1QVF A;  5JJK A;  3RZO H;  2E2I H;  3HOV G;  1E1T A;  3W1B A;  4YWK A;  4DR2 L;  1XMQ Q;  4NPS A;  3RLN A;  2D0P A;  2EIF A;  4OON A;  3I4M H;  4BY7 G;  5IP9 H;  2R7Z G;  2NN6 G;  1MKH A;  2H5X A;  5IWA Q;  3HFZ B;  4DV1 Q;  1U0L A;  1PH2 A;  3F2B A;  4LF6 L;  4DR6 L;  3KLW A;  2B3G A;  4B3R L;  4O2D A;  3NEN A;  2UUA Q;  1VQE A;  2JQO A;  3T1H L;  1QZG A;  1QVG A;  1HR0 Q;  2VUM G;  2R93 G;  3BU2 A;  4JI4 Q;  4JI6 L;  2OQK A;  4YWM A;  3A5Z B;  4LF8 L;  3AYH B;  1XMO L;  1PH4 A;  2UUC L;  2GN5 A;  4P74 A;  5C4J H;  3CAM A;  4DV7 Q;  2K5V A;  1SR3 A;  4QIW E;  1AE2 A;  1BBW A;  3CC2 A;  4LF4 Q;  2JE6 I;  3HKZ G;  4KHZ A;  4R4Q A;  4DV3 L;  4UP8 A;  1LUZ A;  3U58 A;  4A3E G;  2Z0S A;  1R9T H;  4JI0 L;  3NEL A;  4OO1 I;  2UXD L;  4A3G G;  2K52 A;  4DK6 C;  3CCV A;  1L1O A;  2JA8 H;  1KIX A;  2JA7 G;  2BA0 A;  4C3I H;  1HZA A;  2VZA A;  3HKS A;  2D0O A;  2VS1 A;  1X9N A;  1NBW A;  1XPO A;  4C2M H;  1NMG A;  5IE8 A;  2LXJ A;  3CXC A;  2CWP A;  4JI2 L;  3L2P A;  2KEN A;  1K73 C;  4OO1 G;  4A93 H;  1Q12 A;  2KCM A;  1VQL A;  4JI5 Q;  4FDB A;  2ES2 A;  1XJV A;  1HH2 P;  2CKZ B;  3J80 c;  4A3M G;  4YCW A;  4A3D H;  1M1K C;  2E5L L;  4JV5 Q;  2UXB L;  5FLX c;  1X56 A;  3M7N A;  1VQF A;  2EQS A;  4GN3 B;  4L5Q A;  1N36 Q;  4DR4 Q;  1PVO A;  3BJU A;  1VQH A;  1OXT A;  1ASY A;  2YU9 H;  4JBK A;  4IFD J;  3W5O A;  2ZM6 L;  4JOI A;  4DNI A;  3PUY A;  3EBE A;  1J6Q A;  4DR7 Q;  5C3E H;  5M3M H;  2ASB A;  4KHP L;  4GOP A;  2MO0 A;  4YY3 Q;  3ICE A;  2ZTC A;  4XTC S;  3CQZ H;  3UE1 A;  5BR8 L;  1OTC A;  2PNH A;  4DR5 L;  2WAQ E;  4LUO A;  4DUZ L;  4HIO A;  3J80 i;  4YWL A;  2JA6 H;  2R92 G;  2MNA A;  1KAW A;  1TWC H;  1YEZ A;  3M9B A;  2QEX A;  4BXX H;  1CUK A;  4J15 A;  4DAM A;  1PA6 A;  1VQI A;  3E0E A;  2I5H A;  4DAY B;  2ATW A;  1Y1V G;  4R1J A;  5IYD G;  4AQY Q;  1TWF H;  3K0X A;  4A3I H;  4YHH Q;  3GTG H;  4P72 A;  3OYY A;  2I5L X;  2UXC Q;  2ALY B;  1S3O A;  1EQR A;  3L7Z C;  4HJ9 A;  1A62 A;  1OXS C;  4GN5 A;  3CP0 A;  3AQQ A;  4LFB Q;  1XPU A;  2PMZ E;  5IYC G;  2R6G A;  4DKA C;  1FJG Q;  1J5E Q;  4A3B H;  2NVX H;  4GNX A;  1UEB A;  2K75 A;  1K3R A;  4YCU A;  3KF8 B;  2YTY A;  1VQM A;  1H95 A;  4TVA B;  2A19 A;  2HHH Q;  4NB3 A;  5M3F G;  1B70 B;  4UP9 A;  4A3C H;  1UE7 A;  3CCJ A;  4JYA L;  5ELO A;  4ME3 A;  3H0G G;  4GKJ L;  3G4S A;  1E24 A;  3GTQ H;  1G6P A;  2K5H A;  4JI3 L;  1X54 A;  1I50 H;  1TXY A;  3I7F A;  4X62 L;  4R4I A;  2UUB L;  2JA5 H;  5C0X J;  1LTL A;  4AYB G;  5AJ3 L;  4DR3 Q;  1A0I A;  4QQB X;  1OXU A;  5M5X H;  2WB1 E;  4X65 Q;  4P75 A;  1UE6 A;  2JEA I;  4HIK A;  4OX9 Q;  4LFA L;  4BBR G;  4DK3 C;  4B3T L;  3E9H A;  4JI7 Q;  1YHB A;  1XNQ Q;  3CCR A;  4A3J H;  2HT1 A;  1NMF A;  3L0O A;  4MTN A;  4DV6 L;  4MZ9 A;  1HNX Q;  4K0K Q;  1SRO A;  5LMU L;  1HNW Q;  2IHF A;  4LF7 Q;  2IT1 A;  4QGU A;  2ZJP A;  4DV5 Q;  3M4P A;  3G71 A;  3CCQ A;  1IBL L;  1CSQ A;  2AHO B;  4QJF A;  2VY3 A;  2GVA A;  3PUV A;  5IP7 G;  5ELN A;  3OTO L;  3CC4 A;  2B63 H;  3KF6 A;  3D31 A;  3CPW A;  1Q8K A;  3I4N G;  4BY7 H;  2VQF L;  2WFW A;  1HZB A;  1EFW A;  4BY1 H;  3RR5 A;  3ULJ A;  4A3F H;  1B8A A;  1SFO H;  2VQE L;  3VDY A;  3GD7 A;  5FLM G;  1WCM G;  4IOA A;  1AH9 A;  5IY0 A;  3A5U A;  2C35 B;  2Y0S G;  1WI5 A;  4KLK A;  2VUM H;  1TWH H;  3PF5 A;  4LFC Q;  2R93 H;  1XTD A;  2Q2H A;  4LF9 Q;  1QUQ A;  1RL2 A;  1UE5 A;  2PI2 E;  2AWN A;  2Z6K A;  3AEV A;  2MFI A;  3PUZ A;  4IPG A;  4QL5 A;  4PZ8 A;  4DV0 Q;  1EIY B;  3HOU G;  1E3P A;  1SMX A;  2ZTD A;  4L5T A;  4DR2 Q;  3PO3 G;  4BA1 I;  1P8L A;  1VQJ A;  5LMN W;  4A3K G;  1YJ9 A;  4LF5 Q;  5J3B A;  3I2Z A;  3DLL A;  1PV4 A;  2UUA L;  3I55 A;  4LW1 A;  4GLX A;  1CKN B;  2N3S A;  4IOC A;  1Y1W G;  3TRZ A;  4JI4 L;  4A3L G;  4DR6 Q;  4KI0 A;  3KOJ A;  2HIX A;  5M5W H;  4A3G H;  4DUY L;  2JA7 H;  3ER0 A;  1PYB A;  2K4K A;  4JI6 Q;  2NZH A;  4DV7 L;  2RCN A;  2V1C C;  3PF4 A;  3WWV A;  4LF4 L;  1N34 Q;  2OTL A;  5IP9 G;  4DR1 Q;  1W2B A;  4NXN L;  3UDG A;  4C3H H;  2BA1 A;  4POG A;  2CQO A;  2IY5 B;  2ID0 A;  1T9H A;  5JJI A;  4OWT B;  4JI1 Q;  4OWW B;  4IFD I;  3RNU A;  4ALP A;  4NXM Q;  1VQG A;  4JI0 Q;  2HQL A;  3HOZ H;  2CFM A;  3J7A 5;  2A8V A;  1E22 A;  3M3Y H;  1S72 A;  4YCV A;  2N49 A;  3CCL A;  4OWX B;  5M5Y H;  4B3S Q;  3PUX A;  1VQP A;  4RMF A;  1HZC A;  1Q1B A;  2PQA B;  3TRE A;  1QZH A;  3EN2 A;  4GKK L;  3GTO H;  5IYB H;  1Z9F A;  2AMC B;  4HJ7 A;  3CCU A;  1HR0 W;  1GD7 A;  1HNZ L;  4IFD G;  3G48 A;  5C44 G;  4JI2 Q;  1OXV A;  1VQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...