4DV0Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 16
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv0Q00
1S72A 2RCNA 1Z9FA 3S15H 2HQLA 3ICEA 4JBJA 2UXCQ 3I4NG 1PFSA 1HNXL 1YVCA 2AKWB 2HIXA 5LMUQ 4IPCA 1P16A 4JI8Q 4DV7L 2KCMA 5GQOA 3CCJA 2JK8A 4LFAQ 3AYHB 3RLFA 1XMOL 5JJKA 1X3EA 3PF5A 1VQJA 1X55A 2GVAA 2JJQA 4JG2A 4IPDA 4JOIA 3I4MH 4IFDI 3E9HA 3G48A 1MJEA 4UY8C 2H5XA 4A3BG 4LUOA 1I6HH 1IBKL 4A3GH 4OWXB 2JA7G 1WYDA 3NELA 2OTLA 1GD7A 1VQEA 2D0OA 4OWTB 1X9NA 4JI4Q 2JA6G 1KHIA 1CKOA 3J80c 1XJVA 1EIFA 4POGA 1KIXA 3F2CA 4IFDG 2AMCB 3ULPA 4JV5L 2WP8J 4BBRH 1N34Q 4J15A 1HZCA 3K81C 2Z6KC 3D0FA 4PZ8A 1SLJA 1E1OA 5FLMH 4A3IG 3JAMi 2CQOA 2UUCQ 3A0JA 2NZHA 3EBEA 2JA8H 4A3BH 4P75A 3S1MH 2R7DA 4LUZA 4JBMA 4DAMA 1YIJA 3L2PA 2HHHL 4L5RC 2IX0A 5FJ8G 4GOPA 3HOYG 1WOCA 3S2DH 3CPWA 2I0QA 3G6EA 1C0AA 1A8VA 3RN2A 2BH2A 2PI2E 2ZTEA 4DV0L 4LF6L 1P8LA 2B29A 4P71A 5C4JH 2E5LL 1NMGA 3M4QA 4R1JA 2VW9A 4LFCQ 1VQ5A 4NXML 3H15A 2UUCL 3F1ZA 3KF6A 2UXDL 2CWPA 2R93H 3NBHB 5GAGC 1VQ6A 4OO1G 4Y7NH 1GKHA 2VS1A 4X65Q 2QEXA 3J80i 4AQYL 4B3ML 5GADC 1FGUA 4YWKA 3CCLA 5LMNQ 4BY1H 2E5LQ 2EXDA 2LSSA 3K7UC 2Y0SE 4LF6Q 4X66L 4LF9L 1Q1BA 4BXXG 4OX9Q 3KF8B 2WFWA 4JCVE 1A0IA 3F2DA 1PH1A 1EUJA 3T1YL 3AFPA 2F4VL 4YCWA 3PIOA 1L1OB 4R4CA 3HOWH 4A3CH 4OXPA 3Q8DA 5ELNA 4JI5Q 4DV4L 4NPSA 1IBLL 4DV2Q 3H3VH 5C3EG 4JI7Q 1HZAA 4DR5Q 1N32L 2UXBL 4QJFA 4KI0A 2BA1A 2JA6H 1K3RA 2R7ZH 4C2MH 4A3JG 1K8AC 2QA4A 2VY3A 3TREA 4OX9L 4IJLA 1O7IA 1I5FA 3H0GG 4LUVA 3GTMH 3KOJA 1VQFA 4A3DH 3RLOA 1JJ2A 2QGQA 3S16H 3E0EA 3EIVA 1PH4A 4DR6Q 1AE3A 4AH6A 4GKJL 3DLLA 1PH3A 2PQAA 3RZOH 1Q1EA 2IY5B 1PH2A 4IJHA 4DNIA 3UDFA 4P72A 4ALPA 1PV4A 1S40A 3ULLA 2DUDA 3I2ZA 3AFQA 5M5XH 4YCUA 3OTOQ 1SFOH 1PH7A 1KAWA 3W1GA 3FP9A 4NXMQ 1SE8A 3CQZH 4DR2Q 3H0GH 5AJ3L 3W1BA 3GDEA 4DR3Q 3CCSA 2K5NA 1E24A 3NENA 2WAQG 3CC7A 3T1HQ 1JJCB 3HKZG 3KLWA 4KLKA 5IWAL 1Q81C 2RF4A 1N36L 1HNZL 3HFZB 4BXXH 4A3LH 4IFDJ 3M3YH 1VQCA 2JE6I 3MEFA 1YEZA 2R93G 1UWVA 2OWOA 3KDFB 3BZCA 1HZ9A 1VQDA 1VQ8A 2DGYA 3CCMA 1YJWA 1M1KC 3PO3H 2GVBA 3CCRA 2UXCL 4B3SQ 1XNRL 3E9IA 5M5WH 1RIPA 3M4OH 4DV3Q 3T1HL 3TEHB 4LFAL 1BVSA 1J6QA 2KCTA 3PUWA 4QIWE 4YY3L 4DUZQ 1ASYA 2R7ZG 3GTJH 5LMNW 1I50H 4B3TL 3U4ZA 1KL9A 3A5ZB 3S1QH 1HZBA 3S2HH 1XMQQ 4HJ5A 1V9PA 4JI1L 4GN5A 4A3EH 2MQHA 5C0XI 4TQUS 5M3FG 1XNRQ 2F52A 5C3EH 1CKMA 3SGIA 3PV0A 3CCVA 2JA9A 5C4XH 2MO1A 3S24A 2NN6G 1EQRA 2VNUD 5JEAJ 3I55A 2UUBL 1Q86C 2JA5G 1OXUA 4PG3A 3ZJYC 1N33Q 2VQFL 1VQAA 4GKKL 1A62A 3GD7A 4NXNL 4LF7Q 2B63H 3I4NH 4A3DG 2B3GA 3HKSA 1X65A 5M5YH 3HOXH 1PH8A 4JI2L 1TWAH 3M7NA 3CAMA 3WWVA 4A3MG 1YHBA 3PUZA 3LGJA 1SR3A 4X66Q 3CXCA 3RZDH 2KBNA 3HOUG 4DR2L 4JC0A 2UU9L 1X3FA 2K50A 3GTPH 3J81i 3CCEA 1GVPA 2AWNA 2BH8A 2XTIA 3OYYA 2E8GA 1Q82C 3ERSX 4DUYL 3CPFA 2UUAQ 2Q2UA 4GLAC 2K5VA 1SMXA 4DV6L 4HIOA 2JA8G 2JEAI 2WAQE 3AQQA 2F3IA 3M9BA 1PH5A 4DR4Q 1N32Q 1IZ6A 2K4KA 2D62A 2A1AA 5C0XG 4JI6L 1L2FA 3I56A 2HT1A 4BBRG 1EIYB 4A3EG 1Q12A 4A3LG 4ME3A 4X64L 1X56A 1HH2P 4BY7H 3W5OA 4JBKA 2V1CC 2NVQH 5IP7G 3GTLH 4UPAA 4O0AA 4JI4L 4A3KG 3HOVG 4AQYQ 4Y52H 1N8RC 1D7QA 5BR8Q 1VQ4A 4QGUA 4YCVA 4JI0L 2RHQB 3CC2A 2VUMG 1JE5A 3I4OA 3PUVA 1YNXA 4GLVB 3D31A 3HOXG 1EOVA 1UE7A 1NE3A 1Y1VH 2ID0A 1HNXQ 4DR7L 4IPGA 1JMCA 4XIGS 5IWAQ 2R92G 1HNWL 4KHZA 1PHJA 4C3HH 4DR1Q 4K0KQ 1AH9A 3HOZH 1Z47A 1I94L 3RLNA 4GNXC 1LUZA 1WCMG 3J81j 4HIDA 3PO2H 4LWCA 4WJ3M 1VQBA 2CWAA 2K14A 4LFBL 3PCOB 3CCUA 4DR7Q 4BY7G 1OXXK 2YTXA 2KHIA 1DGSA 1K83H 3PSIA 1ASZA 2ATWA 1CSQA 4GLXA 3HOVH 1N9WA 4DV5Q 1G51A 1T9HA 4LF4L 1OXVA 1Q8KA 4OONA 1VS0A 4L5SA 1FJGL 1FL0A 2PI2A 2ZJQA 1UE5A 3HOUH 2VUMH 3PF4A 4HIMA 2HHHQ 5ELOA 4C3JH 3CMAA 4TVAB 4DR3L 2N78A 2Z6KA 4X64Q 2E2JH 1K8GA 4FDBA 1XPOA 1TWFH 2UUBQ 1B70B 1XPUA 2R92H 1KXLA 1HR0W 4JI3L 4AYBE 2A8VA 2YU9H 5HGQA 5DLQE 3UDXA 1J5EL 4DV1Q 3I7FA 3F2BA 1K73C 1M90C 1X6OA 3DM3A 3A74A 2KENA 1SROA 3U50C 4X62L 3A5UA 2E2IH 2UU9Q 4QY7A 2I5HA 4YY3Q 4DUZL 3M4PA 1BBWA 2D0PA 4UP7A 4A4IA 4A3GG 3F8TA 1KC8C 5C44H 1PYBA 1VQ9A 2WB1E 4B3MQ 3HKZE 2YTVA 2NVYH 1MJCA 1HNWQ 2Y0SG 1TXYA 1VCIA 1UE6A 1YITA 1WCMH 4PMWA 1NTGA 2N8NA 1W2BA 4JBWA 1NJIC 4DKAC 5FJ8H 3HOYH 2MNAA 1XNQQ 1YBYA 3KJOA 4A3MH 1Y1WH 1EWIA 1C9OA 4YWLA 1EYGA 4UP9A 1EFWA 3T1YQ 4UP8A 4LF5L 2F4VQ 1UE1A 3GTKH 1QVCA 4HJ7A 1VQMA 3UDGA 1QUQA 4R4QA 1E7ZA 3ER0A 2HIVA 2LXKA 1UEBA 5C44G 3CMEA 1CKNB 1KQSA 2Q2TA 4BA2I 4LF4Q 4IO9A 2ALYB 4PZ7A 2L15A 4DR5L 5IP9G 2UXBQ 1GO3E 1MIUA 3L7ZC 1RL2A 2I5LX 1L1OA 3PUXA 1L0WA 3G4SA 1IBKQ 1VQNA 3KFUA 3RR5A 4HJAA 2E2HH 4HIKA 3TRZA 4B3SL 3STBD 4BY1G 4DV6Q 2I5MX 3PIPA 2JA5H 3BJUA 4LNQA 3KJPA 2ZM6Q 1CUKA 4JV5Q 2R6GA 5M3MH 3OW2A 1EQQA 2PNHA 1I94Q 4R4TA 5IT9c 4JYAL 2K5HA 1IYJB 5GAHC 5M3FH 4OO1I 5JEAG 4A3CG 3H3VI 2AWOA 4B3RQ 5C4XG 1X54A 1MKHA 4DK6C 4O2DA 3UE1A 1U0LA 4GNXA 2NVXH 1Y1VG 5IYDH 3KF6B 4MZ9A 2YYZA 5AJ3Q 1PH9A 5K36G 2B63G 2YV5A 1YJNA 1W3SA 2PMZE 3RN5A 4DAYB 4DPGA 4R4IA 2K52A 1S3OA 3CF5A 5M3MG 3HOWG 4DV0Q 5GROA 2EIFA 3MXNB 2LXJA 4A3FH 4JI2Q 4AIMA 1VQKA 2IHEA 5IP7H 4OWWB 1WJJA 2UXDQ 1D8LA 4EQ5A 1K9MC 3NEMA 1YI2A 4LF5Q 1E1TA 1H95A 5IY0A 4B3TQ 3J7ZC 4DV3L 4BBSH 2BA0A 4POFA 2EQSA 5JJIA 2A19A 1J5EQ 2MFIA 1KRSA 3PUYA 5HY6A 1PYSB 1OTCA 5FLXc 2C35B 3TQYA 1WFQA 3ULJA 1NBWA 2ZJPA 1XMQL 4LF8Q 2MO0A 2CKZB 2ZTDA 3PGZA 4A93G 4WJ4A 1JT8A 3CP0A 1A63A 1IXRA 2RHSB 3IRBA 4X62Q 3AEVA 4QQBX 3U4VA 5IYBH 3S1NH 1PA6A 4A75A 4RG1A 4GOPC 4RMFA 3S14H 4QL5A 1FVIA 5EAYA 3L0OA 1G291 1BKBA 4LF7L 4NXNQ 3PO2G 2VQFQ 4BBSG 1FJGQ 4JYAQ 1L1OC 1XNQL 3CD6A 3UDIA 4YHHL 4IPHA 4DV2L 3J7A5 4H02A 1XPRA 1C7YA 4BA1I 3GTGH 1YHQA 4LF8L 1WI5A 1IL2A 3U58A 1NY4A 3BU2A 1KRTA 4HJ8A 2UUAL 1VQOA 1V1QA 3PO3G 4GKJQ 2IT1A 4GN3B 3KYHC 1OXTA 4YHHQ 4GOPB 4L5QA 5LMNL 1V43A 1QZGA 4MNOA 1QVGA 4DR1L 1OXSC 2XGTA 3G71A 4K0KL 1JJGA 1IBML 1VQ7A 2FXQA 2JEBI 3OTOL 4DR4L 2N49A 4LW1A 3CCQA 2KHJA 2ZTCA 5IE8A 1Y1WG 4LFBQ 2Q2HA 3GO5A 3J81c 5IYBG 2ES2A 3TS2A 2VQEL 3VDYA 1VQPA 2WB1G 4DV5L 1XMOQ 4R4OA 5J3BA 1XTDA 3FHWA 1QVFA 4L5TA 2CCZA 1HNZQ 5IP9H 1TWGH 2OTJA 1Q7YC 4GS3A 2JQOA 4B3RL 3BZKA 3K0XA 1IBMQ 4IOAA 1R9TH 3FKIH 2ASBA 3S17H 1VQIA 2VQEQ 3CC4A 2YTYA 1VQLA 4KHPL 2ZJRA 1B7YB 4DV1L 4A93H 2K75A 4JI0Q 2VZAA 1U5KA 4JI3Q 3GTQH 4JI1Q 4A3KH 5H1SE 3EN2A 1SN8A 3JC66 4LF9Q 4A3JH 1JB7A 1QUQB 2R7FA 2NVTH 4C3IH 1YJ9A 2N3SA 1LYLA 4AYBG 2NN6I 1CKNA 1BBUA 3FKIG 2OQ0A 5IYCG 5C0XJ 3STBC 5GAEC 2ZM6L 4IOCA 1SRUA 1X3GA 1G6PA 1QZHA 4EX5A 2PQAB 3S1RH 4APVA 1GM5A 4KHPQ 1NMFA 1TWHH 4GKKQ 4X6AH 4DV4Q 3GTOH 4JI7L 3K8AA 3CW2C 4DK3C 4LFCL 4A3FG 2Q2IA 3K7AH 5E7NA 2OCEA 3K80C 4P74A 2CFMA 4X65L 4A76A 1KD1C 1HR0Q 1AE2A 2GN5A 5JJLA 4P73A 1I3QH 3RNUA 3UE0A 4NB3A 1N34L 4DUYQ 1VQGA 2Z0SA 1E3PA 3B6YA 4DR6L 3M85A 2NZOA 1HJPA 1B8AA 2OQKA 4GN4B 4JI6Q 4GNXB 2IX1A 4MTNA 2JA7H 4HJ9A 5IYDG 5FLMG 4A3IH 4PZ6A 4YWMA 1YZ6A 3HOZG 2VL6A 1E22A 1LTLA 3KDFA 1HR0L 1LM0A 1PVOA 4JOIC 1N33L 1TWCH 1VQHA 1IBLQ 1Q46A 4JI8L 4JI5L 1Y14B 2AHOB 2IHFA 5IYCH 5LMUL 3I4MG 3JAMc 4DV7Q 4XTCS 1K0RA 5BR8L 1PH6A 3TS0A 1N36Q 1YHAA 1CSPA
chains in the Genus database with same CATH superfamily
2F1MA 2NVYB 1KABA 3ICEA 4FXKC 2AKWB 5JPMC 1HFGA 3VDYA 2KCMA 2DY7A 5GQOA 3CCJA 2Z4IA 3PF5A 2FINB 2JJQA 3E9HA 3G48A 2KJXA 1MJEA 2H5XA 4A3BG 3QWNA 4A3GH 4HN7A 2QDBA 1VQEA 5IGEA 2A68C 2ICEC 1GUNA 2F0NA 1XJVA 5EJWA 1KIXA 4BBRB 2EYOA 3D8GA 2WP8J 3D4RA 5AFWA 2Z6KC 1SLJA 3JAMi 2CQOA 3PIP3 2BE5D 4RFBA 2JA8H 4A3BH 1CM9A 3S1MH 3L2PA 3M4OB 4DU9A 3CPWA 4QIWB 1C0AA 2Z4HA 4WJWA 2B29A 5C4JH 1TWHB 2VW9A 1SE2A 2RKSA 4LK1C 2UUCL 3KF6A 2CWPA 3QIAA 3S17B 2F0SA 5M9OA 5D3DA 1GUGA 2KOLA 4AQYL 4BY7B 4YWKA 3HRZC 3K7UC 4OX9Q 1GHKA 4JCVE 2EDGA 1RODA 1EUJA 4ZUJA 1B4OA 3T4AC 2IJ0A 5ELNA 4R8NA 1EIHA 4DR5Q 2UXBL 3BYTB 2JA6H 4FO2A 4C2MH 2L1BA 4OX9L 1DJRD 4DXFA 1I5FA 3H0GG 3TP6A 1PDQA 4A3DH 2AQ1B 3RLOA 5KNCA 3E0EA 3EIVA 2PZWA 1PH3A 4C3HG 5BN5A 3SHLA 2KEEA 4K14A 1EL0A 1PH2A 4IJHA 1GUWA 4FNFA 1SFOH 1PH7A 1KAWA 2EY6A 5M5XB 1U4PA 4K2LA 3H0GH 3GDEA 3NENA 1JJCB 4CDDC 5IWAL 4BXXH 1SNDA 1HNZL 1EY8A 1VF7A 3P7JA 2A6EC 2JE6I 2R93G 1UWVA 2OWOA 3M3YB 1OO9B 1VQDA 1VQ8A 1YJWA 2KEDA 3PO3H 1M1KC 2UXCL 1ONLA 2WKCA 4B3SQ 1VF5C 3E9IA 3ZYYX 5M5WH 3E0JA 3M4OH 2AQ3B 1G2TA 4LFAL 1BVSA 4YY3L 2R7ZG 4B3TL 1YNNC 1EY0A 3A5ZB 5C4JB 3MXPA 4DF7A 4HJ5A 1G6ZA 3MHBA 2M00A 1UNSA 1S5ED 4DAVA 1TWFB 3SGIA 2JA9A 5DNFA 2EVBA 2NN6G 3BS1A 4FF1A 2JA5G 4O42A 1VQAA 2VXWA 3BG3A 3H94A 3LNNA 5M5YH 1X65A 4BA2I 2XNAC 2F0TA 1YHBA 2EJGC 4X66Q 3FDTA 1QOHA 1HQRD 5CV4A 2AWNA 3RZDB 2WIIB 2JXMB 1Q82C 3ERSX 1EYCA 4DUYL 4KN4C 3CPFA 1K8OA 2K5VA 1PLFA 2WAQE 5K36H 3AQQA 1K0SA 2JA6B 2F3IA 4DA2A 3H91A 1IZ6A 1A3UA 2D62A 2A1AA 3MA2B 4JI6L 2HT1A 4ILWA 2DNCA 1EIYB 5EQ0A 3VR6A 4X64L 1X56A 4A3KG 3NHHA 1B3AA 1JB3A 5BN3A 2KCCA 3FKIB 1KTKA 1SNOA 3CC2A 1JE5A 3I4OA 4XT1B 3OIPA 3D31A 1EOVA 1UE7A 3VYTA 1Y1VH 2ID0A 1HNXQ 2Q8TA 3KLRA 2EZVA 1JMCA 2F0WA 4DR1Q 4K0KQ 4PV1C 3HOZH 1Z47A 1XTCD 3MVVA 3DMUA 3PO2H 1QJOA 2K14A 1FNWA 1LTAD 2CW0C 5CORA 3CCUA 3PSIA 1K83H 2ATWA 1CSQA 4GLXA 3HOVH 5IGDA 1Y69U 3E3XA 1T9HA 3VA7A 1HUMA 1OXVA 4OONA 1HQMC 3M4YA 1S5CD 3EROA 2ZJQA 1FYCA 4HIMA 5DEHA 5ELOA 4C3JH 3C3LA 1QILA 4X64Q 2E2JH 5C3EB 1S5FD 2UUBQ 2B2TC 1EZ6A 4JI3L 2Y0SB 3W3AA 1M90C 5EBCA 2CH4A 2K05A 2E2IH 4QY7A 2I5HA 4PNYA 4DUZL 2AUJD 4XQNA 3EJIA 5EKLA 4B3MQ 5A35A 1MJCA 5ELEA 3OHXC 3MTSA 1TXYA 1UE6A 1SAPA 1WCMH 4R8IA 3NQIA 1SMYD 4DKAC 1NJIC 3KJOA 1C9OA 1FGBD 4LF5L 3HOYB 3GTKH 1VQMA 1QUQA 3G7LA 1PTOB 1KQSA 1CKNB 2Q2TA 2EYHA 4J1MA 4OEMB 2ALYB 2KECA 4DR5L 1EEID 2UXBQ 3L7ZC 1RL2A 3D6WA 2F03A 4MTKA 2K03A 1VQNA 2X69A 1EEFD 2E2HH 3T56B 4LAAA 3BJUA 4XQJA 4LNQA 1D1IA 2ZM6Q 4ZK9B 5HURA 2PNHA 2F0IA 4JYAL 1UEAB 4XT3B 3VR4A 4A3CG 3H3VI 2PW5A 1X54A 1MKHA 4O2DA 3UE1A 1U0LA 5IOCA 3LWUA 4TRDA 3BYYB 4IUPA 5EGTA 1TT2A 2EY2A 1YJNA 1W3SA 2PMZE 3RN5A 4DPGA 5C3XA 2K52A 1S3OA 3HOWG 1C48A 2B8GA 1EFID 4JI2Q 4OWWB 3SE0A 2K5QA 3NEMA 1E1TA 1Q90A 1H95A 1ILQA 4B3TQ 1D1KA 4RGTA 5JJIA 5KIXA 1OTCA 1CK1A 5HY6A 1KRSA 2FMMA 3N6RA 1GHJA 5FLXc 4BBSB 3QOLA 5LL6S 1AFPA 3Q23A 1XMQL 2ZJPA 2ZTDA 4WJ4A 4A93G 1JT8A 1IXRA 2RHSB 2LY7A 1I4HA 5J22A 3S1NH 2G5DA 4RG1A 2MPMA 3GTMB 1CHPD 2VUMB 2VQFQ 1FJGQ 1XNQL 2A68D 4K6DA 4DV2L 4IPHA 3J7A5 1XPRA 4BA1I 1YHQA 4LF8L 1WI5A 2F0HA 1Y1WB 1NY4A 5NUCA 1BUVT 2CVRA 2B63B 2UUAL 4GKJQ 4OO1H 3S9WA 1OXTA 4YHHQ 1V43A 1QZGA 2Q8RE 4DR1L 4K0KL 1JORA 2FXQA 1WTQA 2JEBI 4IQZA 4DNRB 4LW1A 1AZPA 3C46A 2ZTCA 3GV6A 2C5CA 3M7GA 4X3SA 2ES2A 3NBHA 4RCOA 2WB1G 3PO3B 4KD3A 3O13A 4R4OA 1XMOQ 2XRSD 2XRQD 3FHWA 4QMGA 2OTJA 2A6HD 5JAVA 1IW7D 1IBMQ 3FKIH 3DEPA 5KRUA 1XWEA 5ELBA 2VQEQ 3CKIB 2Z9HA 1VQLA 4DV1L 3EA6A 3W2DA 5H1SE 3EN2A 3Q0AA 3Q6SA 3JC66 4LF9Q 4L6TB 1QUQB 4AYBG 2NTSA 3A8IE 3FKIG 4IOCA 2OQ0A 5C0XJ 4KTAA 2KUMA 4TSSA 1X3GA 1H9JA 2F0JA 5IGGA 1QZHA 4APVA 1E2VA 3K7AB 1K83B 4LFCL 2IPKD 2Q2IA 3K80C 4P74A 3J7AV 1XX8A 2EYLA 1YNJC 5L37A 4EQNA 4DUYQ 1VQGA 1N34L 4UHVA 3BVZA 2K04A 1B8AA 4GNXB 2IX1A 2JA7H 4HJ9A 4A3IH 4JW0A 4YWMA 1A3VA 3KDFA 2OT2A 3E6ZX 1HR0L 2V4DA 2B2WA 1VQHA 4KJNA 4JI8L 3PQIA 4JI5L 5IYCH 2IHFA 3I4MG 2XN9C 4XTCS 4HTHA 5BR8L 2EPBA 4OELB 1FGUA 4KK7A 1MGSA 4JBJA 3I4NG 5LMUQ 4IPCA 4JI8Q 1XMOL 1YNND 1ESRA 2JK8A 4LFAQ 1I6VC 1SXTA 5ELCA 1VQJA 3I4MH 4JOIA 4IFDI 2VB3X 4LUOA 1WYDA 1GD7A 4OWTB 4JI4Q 3WOEA 1EIFA 3F2CA 3Q22A 2AMCB 1AW7A 4ODGA 2SOBA 3T53B 1HZCA 3K81C 4I65A 4PZ8A 1E1OA 1HCZA 1DOLA 3S1MB 3EBEA 4CJ1B 3FEWX 4P75A 2RDGA 3FRPB 4JBMA 3V96A 3HZXA 3HOYG 3S2DH 1WOCA 3H6MA 3MXGA 3FPPA 2B39A 3RN2A 3GTPB 2PI2E 1I50B 3A7LA 3I8ZA 4DV0L 1O80A 4P71A 5FLXE 4R1JA 4NXML 4ZQ3A 4LFCQ 1AN8A 1JOKA 3A56A 2HDMA 3NBHB 4DNTB 4OO1G 1WCMB 1WTXA 3NXWA 2R61A 2K28A 3MAQA 3I91A 1NSNS 2VS1A 5E3FA 4B3ML 2E76C 4Q5VA 5LMNQ 3CCLA 1WTHA 4LF9L 2TMPA 3HG9A 4X66L 4FVMA 2JA7B 4KY5A 1A0IA 1PH1A 3T1YL 1WD0A 1F77A 2F4VL 1L1OB 4OXPA 4JI5Q 1QNUA 1TWCB 4NP5A 5C3EG 1N32L 1IKLA 4KI0A 5C5LA 1T5EA 3T51B 2QEJC 1K8AC 2VY3A 4G57A 3TREA 4IJLA 1O7IA 4NW2A 3GTMH 1HA5A 4AH6A 3I73A 2PQAA 2JP1A 3RZOH 1LO5D 1PV4A 4ALPA 4P72A 1S40A 2DN8A 4OL7A 3AFQA 5M5XH 3OTOQ 1O7ZA 3H0GB 4NXMQ 2FFKB 4KKUA 4H13C 1SE8A 3H3VC 1QE6A 5AJ3L 3HOUB 4DR3Q 2WACA 1NCVA 3DWQA 2K7VA 3T1HQ 3HKZG 3KLSX 4A3LH 2N55A 5IT9E 1TR5A 1ZEQX 3M3YH 3QJYA 2HDLA 3KDFB 4KHVA 4NKLA 2DGYA 2GVBA 3CCRA 4Q0FA 3K59A 4XYOA 1XNRL 1RIPA 1I6HB 1J6QA 3BDCA 3PUWA 4DUZQ 3GQBA 1HTPA 4QB4A 1DOKA 3S1NB 5D65A 1STBA 5EKKA 1XMQQ 4K5XA 4RHSA 4JI1L 5EPKA 4GN5A 3MZ5A 5C0XI 4TQUS 3VR3A 5M3FG 1XNRQ 5C4XH 5EPLA 4CDEC 1K28A 3GTQB 3R3OA 1EQRA 2IW3A 3BZDB 2UUBL 1X3QA 3A54A 3ZJYC 4PG3A 4F7XA 1N33Q 2VQFL 3I4NH 2B63H 2CHBD 2B3GA 3HOXH 2K01A 3DWAA 4A3MG 1EQTA 3PUZA 4OIJA 3RZDH 3HOUG 2ZXOA 1ENCA 1RHPA 4JC0A 5JPNC 1X3FA 2K50A 2BH8A 4M8AA 3C1FA 3HKZB 5J1ZA 4HIOA 1SMXA 1HXYD 2L11A 2JA5B 4C3IG 2B2VA 4DAYA 1PH5A 1N32Q 2K4KA 5C0XG 2NVQB 3SK6A 1Q12A 3I4LA 1HH2P 4BY7H 3W5OA 4JI4L 2OF1A 5HGTA 3R2TA 1N8RC 1D7QA 3NTKA 3PUVA 3TP5A 4IN3A 5C0XH 1II3A 3K5OA 5IWAQ 2F4IA 3CRLC 3V05A 5IT9L 1V1PA 4KKSA 1AH9A 2LS01 2L55A 2F0GA 4PMBA 1PTOC 1PRTC 4HIDA 3S16B 1U9RA 4LWCA 1C8CA 4OIKA 4WJ3M 2CWAA 1EY6A 3SK5A 3I4MB 4DR7Q 2KHIA 2XSCA 2O2LD 1N9WA 1PTOD 1G51A 3AB9A 5CV6A 4QCLA 1E2WA 1FJGL 1FL0A 4O1NA 3PF4A 2HUGA 4DFAA 1TWFH 3J81E 2K32A 3UDXA 3K58A 5FLXL 1PZJD 3A74A 4HSPA 1EY4A 2KENA 4M1UB 3UI2A 3A5UA 1FR3A 3M4PA 4UP7A 3F8TA 1VQ9A 4FF4A 2YTVA 4AYBB 3OSOA 2B2UA 1AP0A 5EBDA 4PMWA 1NTGA 4RCNA 4HCEA 4IFDH 2N8NA 1B53A 1W2BA 2DJGC 2MNAA 1Z6HA 1XNQQ 3SDZA 3TN2A 4UP9A 1D5ZC 3T1YQ 2F4VQ 1D6EC 3VYRA 1E7ZA 3ER0A 5M5YB 2MJ8A 1BQQT 2QDLA 2NZ1D 1MIUA 1VDZA 2F0MA 1TS4A 2EXZA 5LL6X 1Y1VB 1BR9A 5K5PA 4DV6Q 1SNPA 3PIPA 3P75A 3L3OC 1CUKA 5M3MH 3VR5A 3H09A 4LMQD 3OW2A 4RHRA 1DOMA 5IT9c 4ZLTF 2Z6BA 1IYJB 5GAHC 5M3FH 3A8KE 1BNZA 2AWOA 1JR0D 1Z7TA 1CZWA 5C4XG 4GNXA 1B3QA 4KV6A 3R93A 5I2XA 3BVGA 2B2YA 3EVQA 4KD4A 5AJ3Q 1PH9A 2B63G 2WV6D 4DAYB 5IGFA 3K5NA 3CF5A 4Y7NB 5M3MG 2HCIA 4K5WA 4A3FH 5CGKA 1VQKA 2IHEA 1CHQD 1WJJA 2EYFA 3I70A 4EQ5A 2QW7A 3VYUA 1DM0B 5KEEA 4LF5Q 2D5DA 4BWGB 1TU2B 4DV3L 1F9PA 3HS0C 3HOWB 3PO2B 1PYSB 3GTOB 3G6JB 1PTOF 1WFQA 1PRTF 3OIQA 3X3NA 2CKZB 1MHWC 1A63A 2KA7A 4RMFA 4QL5A 1W6JA 1FVIA 5EAYA 3L0OA 2WAQB 4JYAQ 4IUQA 4YHHL 1I4QA 3EFXD 4H02A 1PFBA 5C4XB 3GTGH 1EWHA 3BU2A 1KRTA 1R4PB 4HJ8A 2RBMA 1JCKB 1A3TA 1V1QA 4FF2A 3NBIA 2IT1A 1IKMA 1TWAB 1HHVA 1JJGA 5E4XA 1G91A 4ABNA 3QO2A 1EU3A 4KY6A 3S15B 1Y1WG 4ME5A 4RWSC 2NB0A 1IW7C 2Q2HA 3AU7A 3TS2A 1LT5D 4DV5L 1MI2A 1A2UA 1I4XA 1XTDA 2RQXA 5IP9H 1TWGH 3K0YA 5CBEE 2JQOA 4B3RL 3BZKA 3Q24A 4IOAA 3WDNA 1R9TH 1STAA 1SNQA 2ASBA 2YTYA 4KHPL 4KMUC 1U5KA 4JI3Q 3GTQH 4A3KH 1M4VA 4A3FB 4C3IB 1HUNA 4J8QA 5C6AA 1YJ9A 3I4NB 1LYLA 4HCSA 2NN6I 3OPOA 1JICA 5EPJA 4X3UA 2PQAB 1NMFA 2L4NA 5EKIA 4B08A 3GTOH 3S1RB 2A5HA 4KJOA 5E4WC 2CFMA 1I3QH 1JQYD 4NB3A 1E3PA 2F3WA 5F2DA 2NZOA 4A3IB 1TQOA 4L8JA 1BCPC 4WRDA 5IYDG 4E6IA 5FLMG 4J6HA 1KDCA 1YZ6A 2VL6A 1E22A 1LTLA 3KBXA 1KDBA 2M2LA 1PVOA 1AZQA 2CQAA 5CC4A 1BCPD 2K1BA 1LTID 2Z1CA 1YHAA 1U4LA 1CSPA 4G7OC 1S72A 2RCNA 3S15H 2HQLA 2UXCQ 1PFSA 1HNXL 1F9RA 2OXPA 3DUZA 2HIXA 1KAAA 1X55A 4JG2A 4IPDA 1D5XC 4EQPA 4ULLA 1NR2A 1IBKL 4OWXB 2JA7G 2BDOA 2ZXPA 1SBBB 4TKOB 1X9NA 3SK4A 2JA6G 4FXGC 4A3GB 4G4KA 3J80c 1RCVD 1STGA 1JOOA 4BBRH 1N34Q 1IL8A 3D0FA 4A3IG 4B9XA 2F0PA 5KNBA 1SSOA 1TY2A 1LLRD 5JVG3 1G2SA 2R7DA 1E0BA 4LUZA 5KYIA 4R9WA 4DAMA 4K2KA 2HHHL 1G8ZD 5FJ8G 1B9NA 4OGQC 4GOPA 2I0QA 2A73B 4LF6L 1D2BA 3S1QB 4XDXA 5C44B 3M4QA 2RA4A 1VQ5A 1LV9A 3F1ZA 1RDPD 1A6XA 5I9PA 2R93H 1VQ6A 5GAGC 2A6HC 3NUCA 4Y7NH 1EYAA 1I3QB 2QEXA 1RKNA 3NP8A 3OMGA 3VR2A 5ISRA 2B2WC 1K8MA 4BY1H 2LSSA 1JWMD 4A3JB 2NVTB 1BF4A 1DD2A 1Q1BA 3KF8B 2WFWA 4IURA 4CHTB 3AMUA 1F2YA 4H0LC 3AFPA 4YCWA 4R4CA 3HOWH 2I07B 4NPSA 1IBLL 4DV2Q 1PRTD 1HZAA 4QJFA 2BA1A 2QA4A 2HD3A 4DN4M 4U673 4NMZA 3OOCA 4ZKBB 2CW0D 4C2MB 2F0DA 3KOJA 4Z9CB 5IGBA 4RKBA 5M3FB 4HSVA 3GTLB 1JJ2A 2QGQA 4FP5D 2O5IC 4ZAIA 4CDFC 1KLUD 2LMCB 2IY5B 4JI0L 2F0VA 1QWYA 2PZTA 2KQ3A 3IFDA 4K8JA 4YCUA 1BCPF 2A69D 3CQZH 2BOSA 4DR2Q 3W1BA 1ET9A 1HRJA 1FNUA 3CCSA 1E24A 3CC7A 2WAQG 2QILA 3IKJA 1TS5A 1LTGD 4KLKA 3KLWA 4C3HB 1N36L 3HFZB 3MC0B 1YEZA 1WVLA 4QUFA 4YIJA 2PW7A 1CT1D 4C3JG 4MN3A 1STHA 4DV3Q 3J80E 3T1HL 3TEHB 1X3PA 5IIFA 1I50H 3D3RA 1R9TB 1HZBA 1TS3A 2P5ZX 3GTJB 1SE4A 3MWYW 3DM1A 4A3EH 2F52A 2KCNA 1CKMA 3PV0A 2GA4B 2DY8A 1MSGA 2R92B 3S24A 1Y8PB 2PNRC 5JEAJ 2SNMA 1EWCA 2R3ZA 3ERQA 3GD7A 4NXNL 4PMCA 4LF7Q 3HEJA 1R4QB 4A3DG 4K6LA 1PH8A 1TWAH 3WWVA 1SR3A 2KBNA 3ND9A 4DR2L 3GTPH 4F8MA 5J39A 1GVPA 3OYYA 3J81i 2XTIA 2E8GA 3SEBA 4DK1A 2XWBB 4HAEA 4GLAC 4DV6L 1MD2D 4EGVA 3V2TA 1EZ8A 4CGYB 2IL8A 3M9BA 2F0LA 3QOJA 4DR4Q 2QKIC 2PYKA 4MHEA 3I56A 4BBRG 1IYUA 4BXXG 4ME3A 1XXGA 2V1CC 1ENFA 2K6AA 1JWSD 4NDXA 4HR7B 4QGUA 2EJMA 2VUMG 3WOFA 5ELDA 3HOXG 1NE3A 3GP7A 4IPGA 4IUUA 2Z8LA 1TVXA 4XIGS 2R92G 1ILPA 1HNWL 1Y8OB 4C3HH 3A8JE 4JPBW 1NR4A 1O78A 1V1OA 2EY5A 3RLNA 1DZ1A 3J81j 1U4RA 4CJ0B 2RCFA 5JOBA 1WD1A 1VQBA 4LFBL 3PCOB 4BY7G 1OXXK 1DGSA 1EY9A 4LF4L 1Q8KA 4L5SA 2PI2A 1UE5A 3RUZA 2HHHQ 4TVAB 2Z6KA 1K8GA 1F2MA 1XPOA 2NTTA 2MUYA 1XPUA 1KXLA 1HR0W 1JWUD 2A8VA 3D6CA 1QG7A 3F2BA 3FPUB 3U9SA 5JEAH 1SROA 3U50C 1EIGA 5CYUA 3TDQA 4X62L 1BBWA 4A4IA 4A3GG 5C44H 3HKZE 1H9MA 1HNWQ 2Y0SG 2PZUA 3NE5B 1RTNA 1S5DD 4JBWA 3QB3A 3SR1A 3HOYH 3GTKB 1EFWA 1EWIA 4YWLA 4DK0A 1UE1A 1SYFA 3UDGA 1SEBD 4R4QA 2F0KA 4XQQA 2HIVA 1EQVA 1I4PA 4RH6A 5C44G 3CMEA 4LF4Q 4IO9A 1PTOH 3MXUA 1GO3E 4K8IA 1DYQA 4C1NI 1L1OA 2F0OA 3PUXA 4QF4A 3RR5A 3TRZA 4HIKA 4B3SL 3STBD 2RDFA 2I5MX 2R7ZB 3OWEB 2NUCA 4JV5Q 2FHTA 4R4TA 1EOTA 1STNA 2ZT9C 2NVXH 4JVZA 1Y1VG 5IYDH 3J80L 1CI3M 1H9RA 3OWFA 2WINB 4RGNA 4DGZA 5IGCA 4KN7C 2NYZD 5IP7H 2UXDQ 1K9MC 1YI2A 1B44D 2LKVA 5IY0A 2B2UC 3HGBA 3J7ZC 2JN4A 3HP3A 4BBSH 2BA0A 4ZYSA 2B2TA 2MFIA 1LACA 1S4ZA 4LF8Q 1SE3A 1QNKA 1ML0D 2JSOA 5BN4A 1LT6D 3IRBA 3HOVB 3U4VA 5IYBH 4IALA 1PA6A 3U9OA 4A75A 4GOPC 3S14H 3NSWA 1BKBA 3NTIA 1CQVA 4V0BA 3K6OA 4BBSG 1L1OC 4N9TA 3CD6A 3NWTA 4C3JB 3SXHA 3SK8A 3LWEA 1ZXTA 3PO3G 3C1EA 3KYHC 3GV3A 4GOPB 4L5QA 1HA6A 3R2IA 4N8X1 1OXSC 3NTHA 1IBML 1VQ7A 2E2DC 3OTOL 1JC7A 4DR4L 1KLGD 1SJED 2N49A 3CCQA 1CA6A 5IE8A 1B50A 3J81c 1TS2A 2VQEL 1VQPA 2PMZB 3NQTA 5J3BA 4DXGA 3EQLC 5T1IA 4L5TA 5T1GA 2IX3A 4EQOA 1HNZQ 1Q7YC 2G9HD 3K0XA 3JAME 3KF8A 3MFYA 2C9OA 1ZYRD 2WB1B 3S17H 3LX0A 1VQIA 4ZRZA 3CC4A 3K57A 4A93H 2SDFA 2K75A 1LT3D 2JA8B 3TBIB 1CA5A 4KY7A 4FYDA 4IZ8A 3CU7A 5KNDA 1NNXA 2N3SA 4H44C 3DHQA 2ZM6L 3STBC 2QF7A 1GUOA 2E75C 1GM5A 4KHPQ 1SYBA 1TWHH 5FOBB 4GKKQ 4JI7L 3K8AA 4DK3C 3L9AX 3K7AH 4S3SA 4N9PA 1XYIA 4P73A 3UE0A 2O4XA 5C3WA 1Q3LA 2Z0SA 3DWPA 1Y8NB 3B6YA 3MFGA 4DR6L 1DCZA 2OQKA 4GN4B 4MTNA 3I3CA 2E74C 2OEOA 1SYEA 3D4WA 3HOZG 3VYSA 2YU9B 1RTOA 1T5XD 4H7BA 2N88A 1EY7A 1Y14B 2AHOB 5LMUL 3MXNA 3JAMc 1K0RA 1LT4D 1QCBD 3MEHA 1KDAA 3TS0A 1N36Q 3QR8A 5D3IB 4A3DB 1Z9FA 1F2LA 1YVCA 4RAUC 1O7YA 1P16A 4DV7L 5JJKA 3RLFA 3AYHB 1X3EA 5M5WB 2GVAA 1I6HH 1GOZA 2KVMA 4UY8C 3P20A 1F9SA 1WTOA 4DAPA 3NELA 1BDOA 1WTWA 2OTLA 2D0OA 2CH4W 3TP7A 1KHIA 5JJZA 1CKOA 5G3LF 3ND8A 4POGA 1L0YB 4IFDG 3ULPA 4JV5L 5FKAC 4G7HC 4J15A 1UUPA 1PXUA 5FLMH 4UDUC 3URYA 4A93B 2UUCQ 3A0JA 2NZHA 2X6GA 3HOXB 1YIJA 2EY1A 4L5RC 5CMDA 2IX0A 4B9WA 2MP1A 1A15A 2I46A 3G6EA 1A8VA 2BH2A 2K33A 2ZTEA 1P8LA 2SNSA 2NVXB 2E5LL 3S2HB 1NMGA 2JYOA 4RA8A 1DXMA 3H15A 2PPBC 2UXDL 2H4OA 2F0EA 1W6KA 1GKHA 4X65Q 3J80i 4BY1B 5GADC 4JK1C 1ZYRC 1TY0A 1UAPA 2EXDA 2E5LQ 4LF6Q 2Y0SE 1SYGA 2QCPX 3I72A 2L12A 3F2DA 5CR3A 3PIOA 4A3CH 3Q8DA 1WTRA 4ZCKA 4DV4L 3H3VH 1FD7D 4JI7Q 1M8AA 1K3RA 2R7ZH 4A3JG 4LUVA 3S14B 3NWSA 1VQFA 1PRTB 3QG1A 2WKDA 3S16H 3RZOB 4DR6Q 1PH4A 1AE3A 4GKJL 5KYLA 3DLLA 3C2PA 1SNCA 1Q1EA 4PQXA 1BOSA 3ITPA 4RKLA 3UDFA 4DNIA 5CV8A 2DUDA 3I2ZA 3ULLA 2F3VA 3W1GA 3FP9A 1SFOB 4QUCA 2K5NA 3NPPA 2AUKA 2PQEA 4EVOA 4UAIA 3J7AF 1Q81C 2RF4A 5CBAE 1J8IA 2E2JB 4IFDJ 3A55A 2A69C 1VQCA 3MEFA 1GUSA 3BDOA 3BZCA 1HZ9A 3CCMA 4I7AA 5LHY1 4FF3A 2EOTA 1QB5D 2ICIA 1D5MC 1STYA 2BCOA 4I7ZC 2E2IB 2DJFC 4QIWE 2KCTA 1ASYA 3GTJH 5LMNW 1SMYC 3U4ZA 4HEDA 1KL9A 3S1QH 3CRKC 3IFTA 5E1FA 3S2HH 4CJ2C 2F0UA 1V9PA 1ET6A 1GXDC 5JVH3 2MQHA 2D9UA 1H9KA 2F0QA 5C3EH 1RF2D 3CCVA 1BBXC 2EYJA 2MO1A 1IYVA 2VNUD 3I55A 1Q86C 1OXUA 4GKKL 1V8QA 1A62A 2D2CC 3TSSA 3HKSA 3M7NA 4JI2L 3CAMA 3CXCA 3LGJA 5I4DA 3S2DB 2UU9L 1SYCA 3BVMA 3CCEA 2EE1A 3K5MA 5DAUA 3OMCA 4U68A 2Q2UA 2UUAQ 2JEAI 2JA8G 1PYWD 2R93B 1LTBD 2RSOA 4X3KA 1J9OA 4A3MB 3T16A 1L2FA 2RSNA 4A3EG 5C4HA 4A3LG 2J7ZA 4JBKA 2NVQH 5IP7G 3GTLH 4UPAA 4O0AA 2B8FA 5C4ZA 3HOVG 4AQYQ 4Y52H 2H1EA 5BR8Q 1VQ4A 2MHVA 4YCVA 2RHQB 5KGUA 1YNXA 4GLVB 1I4RA 4DR7L 3J81L 5C5MA 3NK9A 4KHZA 1PHJA 1SDFA 1CZGA 1CTMA 1I94L 2L9HA 1E2ZA 3HOZB 3KLSA 4GNXC 1LUZA 1WCMG 2TSSA 1RJTA 2HQEA 3PIO3 2YTXA 1SJHD 1ASZA 1H9SB 4DV5Q 3RD4A 4CDCC 2SEBD 4X3TA 1NAPA 1VS0A 1TIID 1K3BC 3HOUH 2VUMH 2G9DA 3FMCA 4IUTA 4A3EB 3CMAA 1LTRD 4DR3L 2N78A 2AQ2B 2NBFA 4FDBA 1B70B 2R92H 4A3BB 1BO0A 2FJ2A 4AYBE 2YU9H 5HGQA 5DLQE 1J5EL 4DV1Q 3I7FA 1LTTD 2NWGA 1K73C 1LTSD 1X6OA 3DM3A 4G7ZC 2BDNA 4F87A 1AEXA 2EJFC 2UU9Q 2K5WA 3CHBD 3OW7A 4YY3Q 5I2YA 5CV7A 2D0PA 1ZKOA 2O5JC 1KC8C 1PYBA 2WB1E 1C4QA 4C1NK 5D14A 4N8FA 2NVYH 1F9QA 1VCIA 1YITA 1JOQA 3P1HA 4XXEA 5FJ8H 3PMFA 4F88A 1YBYA 4A3MH 1Y1WH 1EYGA 4V190 1RD9D 4UP8A 2IWHA 3VA5A 4WFN3 2L0CA 1QVCA 3I90A 4HJ7A 1HPCA 3IL8A 2LXKA 1EYDA 1UEBA 2RDHA 5I9OA 3KUPA 4PZ7A 2L15A 5IP9G 1WTVA 2I5LX 1L0WA 1IBKQ 1FNVA 3G4SA 3KFUA 4HJAA 2NN6H 2FMCA 4BY1G 1BXTA 2JA5H 2E2HB 3KJPA 1SNMA 2R6GA 1ESFA 1EQQA 1I94Q 5M3MB 2ZXRA 2K5HA 4OO1I 3IAYA 5JEAG 2K5DA 4B3RQ 5FO7B 5COYA 2KHSA 3RMHA 4DK6C 2XWJB 4BS9A 2A74C 3KF6B 4MZ9A 2YYZA 4IUNA 5K36G 2YV5A 1ICFB 2XVSA 4R4IA 1O7LA 1HFNA 4DV0Q 5GROA 2EIFA 3MXNB 5CV5A 1U4MA 2LXJA 4FXDA 4LJZC 4AIMA 1D8LA 1PMRA 3SVMA 4HMJA 3T13A 2HCCA 3KK7A 4KKTA 4P2CB 2B2YC 4POFA 2M9VA 2EQSA 1WTPA 2A19A 1J5EQ 3PUYA 5DM63 2C35B 3TQYA 3JAML 3E5SA 3ULJA 1VMCA 1NBWA 1STEA 4CKCA 2MO0A 3PGZA 1MBYA 3CP0A 4C56C 4X62Q 4RGMA 3AEVA 4QQBX 5A2QE 1GJXA 5FO9B 5FO8B 1PFMA 1S5BD 1KNAA 1IHZA 1G291 1DONA 1CFMA 5IODA 3BDLA 4LF7L 4NXNQ 3PO2G 3GTGB 3UDIA 4CKEA 1MSHA 1C7YA 3DEOA 1IL2A 2VB2X 3U58A 3X3MA 1JE4A 1VMPA 1VQOA 3TMEA 3F2UA 4GN3B 2BE5C 5LMNL 4MNOA 3DXJC 1QVGA 2XGTA 3G71A 1NUCA 1HTLD 2XIWA 5ELFA 4LFBQ 2KHJA 3TP8A 4L63B 3GO5A 5IYBG 1BCPB 4OHJA 1PZKD 4MIUA 5I6YA 4GZYC 1EY5A 1PZID 1QVFA 2Q8IB 2DNEA 4ID6A 2CCZA 3D4DA 4GS3A 1L0XB 1TWGB 5I6WA 1ICWA 1PFNA 4HMIA 2RVLA 1KNEA 3TZUA 1B1ZA 3ONAB 1B9MA 2ZJRA 1B7YB 3N52A 4IUVA 4JI0Q 1I4GA 2VZAA 3J7YW 4JI1Q 1ENAA 1SN8A 5G3LD 1A2TA 3TZDA 4A3JH 2PO4A 2R7FA 4A3KB 1JB7A 2NVTH 4C3IH 4CKBA 1CKNA 1BBUA 4RGOS 5IYCG 5GAEC 1SRUA 4WORA 3FVQA 4ZUIA 1G6PA 4EX5A 1EU4A 5FK9C 3S1RH 3KBGA 4X6AH 1GUTA 4DV4Q 3R8BA 5DM73 3CW2C 4A3FG 5E7NA 2OCEA 4X65L 1H9SA 1KD1C 1Q8IA 4A76A 1HR0Q 4XYQA 1AE2A 2GN5A 5JJLA 3A7AB 3RNUA 2EYMA 2ENBA 3M85A 1HJPA 4JI6Q 1LABA 5A2QL 2L5TA 4PZ6A 5TSSA 1YNJD 2LFNA 2J0TD 1CQFA 1LM0A 2B2VC 4JOIC 1N33L 2PCFB 3CQZB 2X6LA 2F0FA 1TWCH 1F2ZA 1SYDA 1Q46A 1TKWB 2J4XA 4ZKCB 3K5LA 1IBLQ 2A6ED 1B2TA 4DV7Q 5CV9A 4CBVA 4K5VA 1X32A 1PH6A 1V1PB 2EYPA 2MGSA
chains in the Genus database with same CATH topology
1S72A 2RCNA 1Z9FA 3S15H 2HQLA 3ICEA 4JBJA 2UXCQ 3I4NG 1PFSA 1HNXL 1YVCA 2AKWB 2HIXA 5LMUQ 4IPCA 1P16A 4JI8Q 4DV7L 2KCMA 5GQOA 3CCJA 2JK8A 4LFAQ 3AYHB 3RLFA 1XMOL 5JJKA 1X3EA 3PF5A 1VQJA 1X55A 2GVAA 2JJQA 4JG2A 4IPDA 4JOIA 3I4MH 4IFDI 3E9HA 3G48A 1MJEA 4UY8C 2H5XA 4A3BG 4LUOA 1I6HH 1IBKL 4A3GH 4OWXB 2JA7G 1WYDA 3NELA 2OTLA 1GD7A 1VQEA 2D0OA 4OWTB 1X9NA 4JI4Q 2JA6G 1KHIA 1CKOA 3J80c 1XJVA 1EIFA 4POGA 1KIXA 3F2CA 4IFDG 2AMCB 3ULPA 4JV5L 2WP8J 4BBRH 1N34Q 4J15A 1HZCA 3K81C 2Z6KC 3D0FA 4PZ8A 1SLJA 1E1OA 5FLMH 4A3IG 3JAMi 2CQOA 2UUCQ 3A0JA 2NZHA 3EBEA 2JA8H 4A3BH 4P75A 3S1MH 2R7DA 4LUZA 4JBMA 4DAMA 1YIJA 3L2PA 2HHHL 4L5RC 2IX0A 5FJ8G 4GOPA 3HOYG 1WOCA 3S2DH 3CPWA 2I0QA 3G6EA 1C0AA 1A8VA 3RN2A 2BH2A 2PI2E 2ZTEA 4DV0L 4LF6L 1P8LA 2B29A 4P71A 5C4JH 2E5LL 1NMGA 3M4QA 4R1JA 2VW9A 4LFCQ 1VQ5A 4NXML 3H15A 2UUCL 3F1ZA 3KF6A 2UXDL 2CWPA 2R93H 3NBHB 5GAGC 1VQ6A 4OO1G 4Y7NH 1GKHA 2VS1A 4X65Q 2QEXA 3J80i 4AQYL 4B3ML 5GADC 1FGUA 4YWKA 3CCLA 5LMNQ 4BY1H 2E5LQ 2EXDA 2LSSA 3K7UC 2Y0SE 4LF6Q 4X66L 4LF9L 1Q1BA 4BXXG 4OX9Q 3KF8B 2WFWA 4JCVE 1A0IA 3F2DA 1PH1A 1EUJA 3T1YL 3AFPA 2F4VL 4YCWA 3PIOA 1L1OB 4R4CA 3HOWH 4A3CH 4OXPA 3Q8DA 5ELNA 4JI5Q 4DV4L 4NPSA 1IBLL 4DV2Q 3H3VH 5C3EG 4JI7Q 1HZAA 4DR5Q 1N32L 2UXBL 4QJFA 4KI0A 2BA1A 2JA6H 1K3RA 2R7ZH 4C2MH 4A3JG 1K8AC 2QA4A 2VY3A 3TREA 4OX9L 4IJLA 1O7IA 1I5FA 3H0GG 4LUVA 3GTMH 3KOJA 1VQFA 4A3DH 3RLOA 1JJ2A 2QGQA 3S16H 3E0EA 3EIVA 1PH4A 4DR6Q 1AE3A 4AH6A 4GKJL 3DLLA 1PH3A 2PQAA 3RZOH 1Q1EA 2IY5B 1PH2A 4IJHA 4DNIA 3UDFA 4P72A 4ALPA 1PV4A 1S40A 3ULLA 2DUDA 3I2ZA 3AFQA 5M5XH 4YCUA 3OTOQ 1SFOH 1PH7A 1KAWA 3W1GA 3FP9A 4NXMQ 1SE8A 3CQZH 4DR2Q 3H0GH 5AJ3L 3W1BA 3GDEA 4DR3Q 3CCSA 2K5NA 1E24A 3NENA 2WAQG 3CC7A 3T1HQ 1JJCB 3HKZG 3KLWA 4KLKA 5IWAL 1Q81C 2RF4A 1N36L 1HNZL 3HFZB 4BXXH 4A3LH 4IFDJ 3M3YH 1VQCA 2JE6I 3MEFA 1YEZA 2R93G 1UWVA 2OWOA 3KDFB 3BZCA 1HZ9A 1VQDA 1VQ8A 2DGYA 3CCMA 1YJWA 1M1KC 3PO3H 2GVBA 3CCRA 2UXCL 4B3SQ 1XNRL 3E9IA 5M5WH 1RIPA 3M4OH 4DV3Q 3T1HL 3TEHB 4LFAL 1BVSA 1J6QA 2KCTA 3PUWA 4QIWE 4YY3L 4DUZQ 1ASYA 2R7ZG 3GTJH 5LMNW 1I50H 4B3TL 3U4ZA 1KL9A 3A5ZB 3S1QH 1HZBA 3S2HH 1XMQQ 4HJ5A 1V9PA 4JI1L 4GN5A 4A3EH 2MQHA 5C0XI 4TQUS 5M3FG 1XNRQ 2F52A 5C3EH 1CKMA 3SGIA 3PV0A 3CCVA 2JA9A 5C4XH 2MO1A 3S24A 2NN6G 1EQRA 2VNUD 5JEAJ 3I55A 2UUBL 1Q86C 2JA5G 1OXUA 4PG3A 3ZJYC 1N33Q 2VQFL 1VQAA 4GKKL 1A62A 3GD7A 4NXNL 4LF7Q 2B63H 3I4NH 4A3DG 2B3GA 3HKSA 1X65A 5M5YH 3HOXH 1PH8A 4JI2L 1TWAH 3M7NA 3CAMA 3WWVA 4A3MG 1YHBA 3PUZA 3LGJA 1SR3A 4X66Q 3CXCA 3RZDH 2KBNA 3HOUG 4DR2L 4JC0A 2UU9L 1X3FA 2K50A 3GTPH 3J81i 3CCEA 1GVPA 2AWNA 2BH8A 2XTIA 3OYYA 2E8GA 1Q82C 3ERSX 4DUYL 3CPFA 2UUAQ 2Q2UA 4GLAC 2K5VA 1SMXA 4DV6L 4HIOA 2JA8G 2JEAI 2WAQE 3AQQA 2F3IA 3M9BA 1PH5A 4DR4Q 1N32Q 1IZ6A 2K4KA 2D62A 2A1AA 5C0XG 4JI6L 1L2FA 3I56A 2HT1A 4BBRG 1EIYB 4A3EG 1Q12A 4A3LG 4ME3A 4X64L 1X56A 1HH2P 4BY7H 3W5OA 4JBKA 2V1CC 2NVQH 5IP7G 3GTLH 4UPAA 4O0AA 4JI4L 4A3KG 3HOVG 4AQYQ 4Y52H 1N8RC 1D7QA 5BR8Q 1VQ4A 4QGUA 4YCVA 4JI0L 2RHQB 3CC2A 2VUMG 1JE5A 3I4OA 3PUVA 1YNXA 4GLVB 3D31A 3HOXG 1EOVA 1UE7A 1NE3A 1Y1VH 2ID0A 1HNXQ 4DR7L 4IPGA 1JMCA 4XIGS 5IWAQ 2R92G 1HNWL 4KHZA 1PHJA 4C3HH 4DR1Q 4K0KQ 1AH9A 3HOZH 1Z47A 1I94L 3RLNA 4GNXC 1LUZA 1WCMG 3J81j 4HIDA 3PO2H 4LWCA 4WJ3M 1VQBA 2CWAA 2K14A 4LFBL 3PCOB 3CCUA 4DR7Q 4BY7G 1OXXK 2YTXA 2KHIA 1DGSA 1K83H 3PSIA 1ASZA 2ATWA 1CSQA 4GLXA 3HOVH 1N9WA 4DV5Q 1G51A 1T9HA 4LF4L 1OXVA 1Q8KA 4OONA 1VS0A 4L5SA 1FJGL 1FL0A 2PI2A 2ZJQA 1UE5A 3HOUH 2VUMH 3PF4A 4HIMA 2HHHQ 5ELOA 4C3JH 3CMAA 4TVAB 4DR3L 2N78A 2Z6KA 4X64Q 2E2JH 1K8GA 4FDBA 1XPOA 1TWFH 2UUBQ 1B70B 1XPUA 2R92H 1KXLA 1HR0W 4JI3L 4AYBE 2A8VA 2YU9H 5HGQA 5DLQE 3UDXA 1J5EL 4DV1Q 3I7FA 3F2BA 1K73C 1M90C 1X6OA 3DM3A 3A74A 2KENA 1SROA 3U50C 4X62L 3A5UA 2E2IH 2UU9Q 4QY7A 2I5HA 4YY3Q 4DUZL 3M4PA 1BBWA 2D0PA 4UP7A 4A4IA 4A3GG 3F8TA 1KC8C 5C44H 1PYBA 1VQ9A 2WB1E 4B3MQ 3HKZE 2YTVA 2NVYH 1MJCA 1HNWQ 2Y0SG 1TXYA 1VCIA 1UE6A 1YITA 1WCMH 4PMWA 1NTGA 2N8NA 1W2BA 4JBWA 1NJIC 4DKAC 5FJ8H 3HOYH 2MNAA 1XNQQ 1YBYA 3KJOA 4A3MH 1Y1WH 1EWIA 1C9OA 4YWLA 1EYGA 4UP9A 1EFWA 3T1YQ 4UP8A 4LF5L 2F4VQ 1UE1A 3GTKH 1QVCA 4HJ7A 1VQMA 3UDGA 1QUQA 4R4QA 1E7ZA 3ER0A 2HIVA 2LXKA 1UEBA 5C44G 3CMEA 1CKNB 1KQSA 2Q2TA 4BA2I 4LF4Q 4IO9A 2ALYB 4PZ7A 2L15A 4DR5L 5IP9G 2UXBQ 1GO3E 1MIUA 3L7ZC 1RL2A 2I5LX 1L1OA 3PUXA 1L0WA 3G4SA 1IBKQ 1VQNA 3KFUA 3RR5A 4HJAA 2E2HH 4HIKA 3TRZA 4B3SL 3STBD 4BY1G 4DV6Q 2I5MX 3PIPA 2JA5H 3BJUA 4LNQA 3KJPA 2ZM6Q 1CUKA 4JV5Q 2R6GA 5M3MH 3OW2A 1EQQA 2PNHA 1I94Q 4R4TA 5IT9c 4JYAL 2K5HA 1IYJB 5GAHC 5M3FH 4OO1I 5JEAG 4A3CG 3H3VI 2AWOA 4B3RQ 5C4XG 1X54A 1MKHA 4DK6C 4O2DA 3UE1A 1U0LA 4GNXA 2NVXH 1Y1VG 5IYDH 3KF6B 4MZ9A 2YYZA 5AJ3Q 1PH9A 5K36G 2B63G 2YV5A 1YJNA 1W3SA 2PMZE 3RN5A 4DAYB 4DPGA 4R4IA 2K52A 1S3OA 3CF5A 5M3MG 3HOWG 4DV0Q 5GROA 2EIFA 3MXNB 2LXJA 4A3FH 4JI2Q 4AIMA 1VQKA 2IHEA 5IP7H 4OWWB 1WJJA 2UXDQ 1D8LA 4EQ5A 1K9MC 3NEMA 1YI2A 4LF5Q 1E1TA 1H95A 5IY0A 4B3TQ 3J7ZC 4DV3L 4BBSH 2BA0A 4POFA 2EQSA 5JJIA 2A19A 1J5EQ 2MFIA 1KRSA 3PUYA 5HY6A 1PYSB 1OTCA 5FLXc 2C35B 3TQYA 1WFQA 3ULJA 1NBWA 2ZJPA 1XMQL 4LF8Q 2MO0A 2CKZB 2ZTDA 3PGZA 4A93G 4WJ4A 1JT8A 3CP0A 1A63A 1IXRA 2RHSB 3IRBA 4X62Q 3AEVA 4QQBX 3U4VA 5IYBH 3S1NH 1PA6A 4A75A 4RG1A 4GOPC 4RMFA 3S14H 4QL5A 1FVIA 5EAYA 3L0OA 1G291 1BKBA 4LF7L 4NXNQ 3PO2G 2VQFQ 4BBSG 1FJGQ 4JYAQ 1L1OC 1XNQL 3CD6A 3UDIA 4YHHL 4IPHA 4DV2L 3J7A5 4H02A 1XPRA 1C7YA 4BA1I 3GTGH 1YHQA 4LF8L 1WI5A 1IL2A 3U58A 1NY4A 3BU2A 1KRTA 4HJ8A 2UUAL 1VQOA 1V1QA 3PO3G 4GKJQ 2IT1A 4GN3B 3KYHC 1OXTA 4YHHQ 4GOPB 4L5QA 5LMNL 1V43A 1QZGA 4MNOA 1QVGA 4DR1L 1OXSC 2XGTA 3G71A 4K0KL 1JJGA 1IBML 1VQ7A 2FXQA 2JEBI 3OTOL 4DR4L 2N49A 4LW1A 3CCQA 2KHJA 2ZTCA 5IE8A 1Y1WG 4LFBQ 2Q2HA 3GO5A 3J81c 5IYBG 2ES2A 3TS2A 2VQEL 3VDYA 1VQPA 2WB1G 4DV5L 1XMOQ 4R4OA 5J3BA 1XTDA 3FHWA 1QVFA 4L5TA 2CCZA 1HNZQ 5IP9H 1TWGH 2OTJA 1Q7YC 4GS3A 2JQOA 4B3RL 3BZKA 3K0XA 1IBMQ 4IOAA 1R9TH 3FKIH 2ASBA 3S17H 1VQIA 2VQEQ 3CC4A 2YTYA 1VQLA 4KHPL 2ZJRA 1B7YB 4DV1L 4A93H 2K75A 4JI0Q 2VZAA 1U5KA 4JI3Q 3GTQH 4JI1Q 4A3KH 5H1SE 3EN2A 1SN8A 3JC66 4LF9Q 4A3JH 1JB7A 1QUQB 2R7FA 2NVTH 4C3IH 1YJ9A 2N3SA 1LYLA 4AYBG 2NN6I 1CKNA 1BBUA 3FKIG 2OQ0A 5IYCG 5C0XJ 3STBC 5GAEC 2ZM6L 4IOCA 1SRUA 1X3GA 1G6PA 1QZHA 4EX5A 2PQAB 3S1RH 4APVA 1GM5A 4KHPQ 1NMFA 1TWHH 4GKKQ 4X6AH 4DV4Q 3GTOH 4JI7L 3K8AA 3CW2C 4DK3C 4LFCL 4A3FG 2Q2IA 3K7AH 5E7NA 2OCEA 3K80C 4P74A 2CFMA 4X65L 4A76A 1KD1C 1HR0Q 1AE2A 2GN5A 5JJLA 4P73A 1I3QH 3RNUA 3UE0A 4NB3A 1N34L 4DUYQ 1VQGA 2Z0SA 1E3PA 3B6YA 4DR6L 3M85A 2NZOA 1HJPA 1B8AA 2OQKA 4GN4B 4JI6Q 4GNXB 2IX1A 4MTNA 2JA7H 4HJ9A 5IYDG 5FLMG 4A3IH 4PZ6A 4YWMA 1YZ6A 3HOZG 2VL6A 1E22A 1LTLA 3KDFA 1HR0L 1LM0A 1PVOA 4JOIC 1N33L 1TWCH 1VQHA 1IBLQ 1Q46A 4JI8L 4JI5L 1Y14B 2AHOB 2IHFA 5IYCH 5LMUL 3I4MG 3JAMc 4DV7Q 4XTCS 1K0RA 5BR8L 1PH6A 3TS0A 1N36Q 1YHAA 1CSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 A;  2RCN A;  1Z9F A;  3S15 H;  2HQL A;  3ICE A;  4JBJ A;  2UXC Q;  3I4N G;  1PFS A;  1HNX L;  1YVC A;  2AKW B;  2HIX A;  5LMU Q;  4IPC A;  1P16 A;  4JI8 Q;  4DV7 L;  2KCM A;  5GQO A;  3CCJ A;  2JK8 A;  4LFA Q;  3AYH B;  3RLF A;  1XMO L;  5JJK A;  1X3E A;  3PF5 A;  1VQJ A;  1X55 A;  2GVA A;  2JJQ A;  4JG2 A;  4IPD A;  4JOI A;  3I4M H;  4IFD I;  3E9H A;  3G48 A;  1MJE A;  4UY8 C;  2H5X A;  4A3B G;  4LUO A;  1I6H H;  1IBK L;  4A3G H;  4OWX B;  2JA7 G;  1WYD A;  3NEL A;  2OTL A;  1GD7 A;  1VQE A;  2D0O A;  4OWT B;  1X9N A;  4JI4 Q;  2JA6 G;  1KHI A;  1CKO A;  3J80 c;  1XJV A;  1EIF A;  4POG A;  1KIX A;  3F2C A;  4IFD G;  2AMC B;  3ULP A;  4JV5 L;  2WP8 J;  4BBR H;  1N34 Q;  4J15 A;  1HZC A;  3K81 C;  2Z6K C;  3D0F A;  4PZ8 A;  1SLJ A;  1E1O A;  5FLM H;  4A3I G;  3JAM i;  2CQO A;  2UUC Q;  3A0J A;  2NZH A;  3EBE A;  2JA8 H;  4A3B H;  4P75 A;  3S1M H;  2R7D A;  4LUZ A;  4JBM A;  4DAM A;  1YIJ A;  3L2P A;  2HHH L;  4L5R C;  2IX0 A;  5FJ8 G;  4GOP A;  3HOY G;  1WOC A;  3S2D H;  3CPW A;  2I0Q A;  3G6E A;  1C0A A;  1A8V A;  3RN2 A;  2BH2 A;  2PI2 E;  2ZTE A;  4DV0 L;  4LF6 L;  1P8L A;  2B29 A;  4P71 A;  5C4J H;  2E5L L;  1NMG A;  3M4Q A;  4R1J A;  2VW9 A;  4LFC Q;  1VQ5 A;  4NXM L;  3H15 A;  2UUC L;  3F1Z A;  3KF6 A;  2UXD L;  2CWP A;  2R93 H;  3NBH B;  5GAG C;  1VQ6 A;  4OO1 G;  4Y7N H;  1GKH A;  2VS1 A;  4X65 Q;  2QEX A;  3J80 i;  4AQY L;  4B3M L;  5GAD C;  1FGU A;  4YWK A;  3CCL A;  5LMN Q;  4BY1 H;  2E5L Q;  2EXD A;  2LSS A;  3K7U C;  2Y0S E;  4LF6 Q;  4X66 L;  4LF9 L;  1Q1B A;  4BXX G;  4OX9 Q;  3KF8 B;  2WFW A;  4JCV E;  1A0I A;  3F2D A;  1PH1 A;  1EUJ A;  3T1Y L;  3AFP A;  2F4V L;  4YCW A;  3PIO A;  1L1O B;  4R4C A;  3HOW H;  4A3C H;  4OXP A;  3Q8D A;  5ELN A;  4JI5 Q;  4DV4 L;  4NPS A;  1IBL L;  4DV2 Q;  3H3V H;  5C3E G;  4JI7 Q;  1HZA A;  4DR5 Q;  1N32 L;  2UXB L;  4QJF A;  4KI0 A;  2BA1 A;  2JA6 H;  1K3R A;  2R7Z H;  4C2M H;  4A3J G;  1K8A C;  2QA4 A;  2VY3 A;  3TRE A;  4OX9 L;  4IJL A;  1O7I A;  1I5F A;  3H0G G;  4LUV A;  3GTM H;  3KOJ A;  1VQF A;  4A3D H;  3RLO A;  1JJ2 A;  2QGQ A;  3S16 H;  3E0E A;  3EIV A;  1PH4 A;  4DR6 Q;  1AE3 A;  4AH6 A;  4GKJ L;  3DLL A;  1PH3 A;  2PQA A;  3RZO H;  1Q1E A;  2IY5 B;  1PH2 A;  4IJH A;  4DNI A;  3UDF A;  4P72 A;  4ALP A;  1PV4 A;  1S40 A;  3ULL A;  2DUD A;  3I2Z A;  3AFQ A;  5M5X H;  4YCU A;  3OTO Q;  1SFO H;  1PH7 A;  1KAW A;  3W1G A;  3FP9 A;  4NXM Q;  1SE8 A;  3CQZ H;  4DR2 Q;  3H0G H;  5AJ3 L;  3W1B A;  3GDE A;  4DR3 Q;  3CCS A;  2K5N A;  1E24 A;  3NEN A;  2WAQ G;  3CC7 A;  3T1H Q;  1JJC B;  3HKZ G;  3KLW A;  4KLK A;  5IWA L;  1Q81 C;  2RF4 A;  1N36 L;  1HNZ L;  3HFZ B;  4BXX H;  4A3L H;  4IFD J;  3M3Y H;  1VQC A;  2JE6 I;  3MEF A;  1YEZ A;  2R93 G;  1UWV A;  2OWO A;  3KDF B;  3BZC A;  1HZ9 A;  1VQD A;  1VQ8 A;  2DGY A;  3CCM A;  1YJW A;  1M1K C;  3PO3 H;  2GVB A;  3CCR A;  2UXC L;  4B3S Q;  1XNR L;  3E9I A;  5M5W H;  1RIP A;  3M4O H;  4DV3 Q;  3T1H L;  3TEH B;  4LFA L;  1BVS A;  1J6Q A;  2KCT A;  3PUW A;  4QIW E;  4YY3 L;  4DUZ Q;  1ASY A;  2R7Z G;  3GTJ H;  5LMN W;  1I50 H;  4B3T L;  3U4Z A;  1KL9 A;  3A5Z B;  3S1Q H;  1HZB A;  3S2H H;  1XMQ Q;  4HJ5 A;  1V9P A;  4JI1 L;  4GN5 A;  4A3E H;  2MQH A;  5C0X I;  4TQU S;  5M3F G;  1XNR Q;  2F52 A;  5C3E H;  1CKM A;  3SGI A;  3PV0 A;  3CCV A;  2JA9 A;  5C4X H;  2MO1 A;  3S24 A;  2NN6 G;  1EQR A;  2VNU D;  5JEA J;  3I55 A;  2UUB L;  1Q86 C;  2JA5 G;  1OXU A;  4PG3 A;  3ZJY C;  1N33 Q;  2VQF L;  1VQA A;  4GKK L;  1A62 A;  3GD7 A;  4NXN L;  4LF7 Q;  2B63 H;  3I4N H;  4A3D G;  2B3G A;  3HKS A;  1X65 A;  5M5Y H;  3HOX H;  1PH8 A;  4JI2 L;  1TWA H;  3M7N A;  3CAM A;  3WWV A;  4A3M G;  1YHB A;  3PUZ A;  3LGJ A;  1SR3 A;  4X66 Q;  3CXC A;  3RZD H;  2KBN A;  3HOU G;  4DR2 L;  4JC0 A;  2UU9 L;  1X3F A;  2K50 A;  3GTP H;  3J81 i;  3CCE A;  1GVP A;  2AWN A;  2BH8 A;  2XTI A;  3OYY A;  2E8G A;  1Q82 C;  3ERS X;  4DUY L;  3CPF A;  2UUA Q;  2Q2U A;  4GLA C;  2K5V A;  1SMX A;  4DV6 L;  4HIO A;  2JA8 G;  2JEA I;  2WAQ E;  3AQQ A;  2F3I A;  3M9B A;  1PH5 A;  4DR4 Q;  1N32 Q;  1IZ6 A;  2K4K A;  2D62 A;  2A1A A;  5C0X G;  4JI6 L;  1L2F A;  3I56 A;  2HT1 A;  4BBR G;  1EIY B;  4A3E G;  1Q12 A;  4A3L G;  4ME3 A;  4X64 L;  1X56 A;  1HH2 P;  4BY7 H;  3W5O A;  4JBK A;  2V1C C;  2NVQ H;  5IP7 G;  3GTL H;  4UPA A;  4O0A A;  4JI4 L;  4A3K G;  3HOV G;  4AQY Q;  4Y52 H;  1N8R C;  1D7Q A;  5BR8 Q;  1VQ4 A;  4QGU A;  4YCV A;  4JI0 L;  2RHQ B;  3CC2 A;  2VUM G;  1JE5 A;  3I4O A;  3PUV A;  1YNX A;  4GLV B;  3D31 A;  3HOX G;  1EOV A;  1UE7 A;  1NE3 A;  1Y1V H;  2ID0 A;  1HNX Q;  4DR7 L;  4IPG A;  1JMC A;  4XIG S;  5IWA Q;  2R92 G;  1HNW L;  4KHZ A;  1PHJ A;  4C3H H;  4DR1 Q;  4K0K Q;  1AH9 A;  3HOZ H;  1Z47 A;  1I94 L;  3RLN A;  4GNX C;  1LUZ A;  1WCM G;  3J81 j;  4HID A;  3PO2 H;  4LWC A;  4WJ3 M;  1VQB A;  2CWA A;  2K14 A;  4LFB L;  3PCO B;  3CCU A;  4DR7 Q;  4BY7 G;  1OXX K;  2YTX A;  2KHI A;  1DGS A;  1K83 H;  3PSI A;  1ASZ A;  2ATW A;  1CSQ A;  4GLX A;  3HOV H;  1N9W A;  4DV5 Q;  1G51 A;  1T9H A;  4LF4 L;  1OXV A;  1Q8K A;  4OON A;  1VS0 A;  4L5S A;  1FJG L;  1FL0 A;  2PI2 A;  2ZJQ A;  1UE5 A;  3HOU H;  2VUM H;  3PF4 A;  4HIM A;  2HHH Q;  5ELO A;  4C3J H;  3CMA A;  4TVA B;  4DR3 L;  2N78 A;  2Z6K A;  4X64 Q;  2E2J H;  1K8G A;  4FDB A;  1XPO A;  1TWF H;  2UUB Q;  1B70 B;  1XPU A;  2R92 H;  1KXL A;  1HR0 W;  4JI3 L;  4AYB E;  2A8V A;  2YU9 H;  5HGQ A;  5DLQ E;  3UDX A;  1J5E L;  4DV1 Q;  3I7F A;  3F2B A;  1K73 C;  1M90 C;  1X6O A;  3DM3 A;  3A74 A;  2KEN A;  1SRO A;  3U50 C;  4X62 L;  3A5U A;  2E2I H;  2UU9 Q;  4QY7 A;  2I5H A;  4YY3 Q;  4DUZ L;  3M4P A;  1BBW A;  2D0P A;  4UP7 A;  4A4I A;  4A3G G;  3F8T A;  1KC8 C;  5C44 H;  1PYB A;  1VQ9 A;  2WB1 E;  4B3M Q;  3HKZ E;  2YTV A;  2NVY H;  1MJC A;  1HNW Q;  2Y0S G;  1TXY A;  1VCI A;  1UE6 A;  1YIT A;  1WCM H;  4PMW A;  1NTG A;  2N8N A;  1W2B A;  4JBW A;  1NJI C;  4DKA C;  5FJ8 H;  3HOY H;  2MNA A;  1XNQ Q;  1YBY A;  3KJO A;  4A3M H;  1Y1W H;  1EWI A;  1C9O A;  4YWL A;  1EYG A;  4UP9 A;  1EFW A;  3T1Y Q;  4UP8 A;  4LF5 L;  2F4V Q;  1UE1 A;  3GTK H;  1QVC A;  4HJ7 A;  1VQM A;  3UDG A;  1QUQ A;  4R4Q A;  1E7Z A;  3ER0 A;  2HIV A;  2LXK A;  1UEB A;  5C44 G;  3CME A;  1CKN B;  1KQS A;  2Q2T A;  4BA2 I;  4LF4 Q;  4IO9 A;  2ALY B;  4PZ7 A;  2L15 A;  4DR5 L;  5IP9 G;  2UXB Q;  1GO3 E;  1MIU A;  3L7Z C;  1RL2 A;  2I5L X;  1L1O A;  3PUX A;  1L0W A;  3G4S A;  1IBK Q;  1VQN A;  3KFU A;  3RR5 A;  4HJA A;  2E2H H;  4HIK A;  3TRZ A;  4B3S L;  3STB D;  4BY1 G;  4DV6 Q;  2I5M X;  3PIP A;  2JA5 H;  3BJU A;  4LNQ A;  3KJP A;  2ZM6 Q;  1CUK A;  4JV5 Q;  2R6G A;  5M3M H;  3OW2 A;  1EQQ A;  2PNH A;  1I94 Q;  4R4T A;  5IT9 c;  4JYA L;  2K5H A;  1IYJ B;  5GAH C;  5M3F H;  4OO1 I;  5JEA G;  4A3C G;  3H3V I;  2AWO A;  4B3R Q;  5C4X G;  1X54 A;  1MKH A;  4DK6 C;  4O2D A;  3UE1 A;  1U0L A;  4GNX A;  2NVX H;  1Y1V G;  5IYD H;  3KF6 B;  4MZ9 A;  2YYZ A;  5AJ3 Q;  1PH9 A;  5K36 G;  2B63 G;  2YV5 A;  1YJN A;  1W3S A;  2PMZ E;  3RN5 A;  4DAY B;  4DPG A;  4R4I A;  2K52 A;  1S3O A;  3CF5 A;  5M3M G;  3HOW G;  4DV0 Q;  5GRO A;  2EIF A;  3MXN B;  2LXJ A;  4A3F H;  4JI2 Q;  4AIM A;  1VQK A;  2IHE A;  5IP7 H;  4OWW B;  1WJJ A;  2UXD Q;  1D8L A;  4EQ5 A;  1K9M C;  3NEM A;  1YI2 A;  4LF5 Q;  1E1T A;  1H95 A;  5IY0 A;  4B3T Q;  3J7Z C;  4DV3 L;  4BBS H;  2BA0 A;  4POF A;  2EQS A;  5JJI A;  2A19 A;  1J5E Q;  2MFI A;  1KRS A;  3PUY A;  5HY6 A;  1PYS B;  1OTC A;  5FLX c;  2C35 B;  3TQY A;  1WFQ A;  3ULJ A;  1NBW A;  2ZJP A;  1XMQ L;  4LF8 Q;  2MO0 A;  2CKZ B;  2ZTD A;  3PGZ A;  4A93 G;  4WJ4 A;  1JT8 A;  3CP0 A;  1A63 A;  1IXR A;  2RHS B;  3IRB A;  4X62 Q;  3AEV A;  4QQB X;  3U4V A;  5IYB H;  3S1N H;  1PA6 A;  4A75 A;  4RG1 A;  4GOP C;  4RMF A;  3S14 H;  4QL5 A;  1FVI A;  5EAY A;  3L0O A;  1G29 1;  1BKB A;  4LF7 L;  4NXN Q;  3PO2 G;  2VQF Q;  4BBS G;  1FJG Q;  4JYA Q;  1L1O C;  1XNQ L;  3CD6 A;  3UDI A;  4YHH L;  4IPH A;  4DV2 L;  3J7A 5;  4H02 A;  1XPR A;  1C7Y A;  4BA1 I;  3GTG H;  1YHQ A;  4LF8 L;  1WI5 A;  1IL2 A;  3U58 A;  1NY4 A;  3BU2 A;  1KRT A;  4HJ8 A;  2UUA L;  1VQO A;  1V1Q A;  3PO3 G;  4GKJ Q;  2IT1 A;  4GN3 B;  3KYH C;  1OXT A;  4YHH Q;  4GOP B;  4L5Q A;  5LMN L;  1V43 A;  1QZG A;  4MNO A;  1QVG A;  4DR1 L;  1OXS C;  2XGT A;  3G71 A;  4K0K L;  1JJG A;  1IBM L;  1VQ7 A;  2FXQ A;  2JEB I;  3OTO L;  4DR4 L;  2N49 A;  4LW1 A;  3CCQ A;  2KHJ A;  2ZTC A;  5IE8 A;  1Y1W G;  4LFB Q;  2Q2H A;  3GO5 A;  3J81 c;  5IYB G;  2ES2 A;  3TS2 A;  2VQE L;  3VDY A;  1VQP A;  2WB1 G;  4DV5 L;  1XMO Q;  4R4O A;  5J3B A;  1XTD A;  3FHW A;  1QVF A;  4L5T A;  2CCZ A;  1HNZ Q;  5IP9 H;  1TWG H;  2OTJ A;  1Q7Y C;  4GS3 A;  2JQO A;  4B3R L;  3BZK A;  3K0X A;  1IBM Q;  4IOA A;  1R9T H;  3FKI H;  2ASB A;  3S17 H;  1VQI A;  2VQE Q;  3CC4 A;  2YTY A;  1VQL A;  4KHP L;  2ZJR A;  1B7Y B;  4DV1 L;  4A93 H;  2K75 A;  4JI0 Q;  2VZA A;  1U5K A;  4JI3 Q;  3GTQ H;  4JI1 Q;  4A3K H;  5H1S E;  3EN2 A;  1SN8 A;  3JC6 6;  4LF9 Q;  4A3J H;  1JB7 A;  1QUQ B;  2R7F A;  2NVT H;  4C3I H;  1YJ9 A;  2N3S A;  1LYL A;  4AYB G;  2NN6 I;  1CKN A;  1BBU A;  3FKI G;  2OQ0 A;  5IYC G;  5C0X J;  3STB C;  5GAE C;  2ZM6 L;  4IOC A;  1SRU A;  1X3G A;  1G6P A;  1QZH A;  4EX5 A;  2PQA B;  3S1R H;  4APV A;  1GM5 A;  4KHP Q;  1NMF A;  1TWH H;  4GKK Q;  4X6A H;  4DV4 Q;  3GTO H;  4JI7 L;  3K8A A;  3CW2 C;  4DK3 C;  4LFC L;  4A3F G;  2Q2I A;  3K7A H;  5E7N A;  2OCE A;  3K80 C;  4P74 A;  2CFM A;  4X65 L;  4A76 A;  1KD1 C;  1HR0 Q;  1AE2 A;  2GN5 A;  5JJL A;  4P73 A;  1I3Q H;  3RNU A;  3UE0 A;  4NB3 A;  1N34 L;  4DUY Q;  1VQG A;  2Z0S A;  1E3P A;  3B6Y A;  4DR6 L;  3M85 A;  2NZO A;  1HJP A;  1B8A A;  2OQK A;  4GN4 B;  4JI6 Q;  4GNX B;  2IX1 A;  4MTN A;  2JA7 H;  4HJ9 A;  5IYD G;  5FLM G;  4A3I H;  4PZ6 A;  4YWM A;  1YZ6 A;  3HOZ G;  2VL6 A;  1E22 A;  1LTL A;  3KDF A;  1HR0 L;  1LM0 A;  1PVO A;  4JOI C;  1N33 L;  1TWC H;  1VQH A;  1IBL Q;  1Q46 A;  4JI8 L;  4JI5 L;  1Y14 B;  2AHO B;  2IHF A;  5IYC H;  5LMU L;  3I4M G;  3JAM c;  4DV7 Q;  4XTC S;  1K0R A;  5BR8 L;  1PH6 A;  3TS0 A;  1N36 Q;  1YHA A;  1CSP A; 
#chains in the Genus database with same CATH topology
 2F1M A;  2NVY B;  1KAB A;  3ICE A;  4FXK C;  2AKW B;  5JPM C;  1HFG A;  3VDY A;  2KCM A;  2DY7 A;  5GQO A;  3CCJ A;  2Z4I A;  3PF5 A;  2FIN B;  2JJQ A;  3E9H A;  3G48 A;  2KJX A;  1MJE A;  2H5X A;  4A3B G;  3QWN A;  4A3G H;  4HN7 A;  2QDB A;  1VQE A;  5IGE A;  2A68 C;  2ICE C;  1GUN A;  2F0N A;  1XJV A;  5EJW A;  1KIX A;  4BBR B;  2EYO A;  3D8G A;  2WP8 J;  3D4R A;  5AFW A;  2Z6K C;  1SLJ A;  3JAM i;  2CQO A;  3PIP 3;  2BE5 D;  4RFB A;  2JA8 H;  4A3B H;  1CM9 A;  3S1M H;  3L2P A;  3M4O B;  4DU9 A;  3CPW A;  4QIW B;  1C0A A;  2Z4H A;  4WJW A;  2B29 A;  5C4J H;  1TWH B;  2VW9 A;  1SE2 A;  2RKS A;  4LK1 C;  2UUC L;  3KF6 A;  2CWP A;  3QIA A;  3S17 B;  2F0S A;  5M9O A;  5D3D A;  1GUG A;  2KOL A;  4AQY L;  4BY7 B;  4YWK A;  3HRZ C;  3K7U C;  4OX9 Q;  1GHK A;  4JCV E;  2EDG A;  1ROD A;  1EUJ A;  4ZUJ A;  1B4O A;  3T4A C;  2IJ0 A;  5ELN A;  4R8N A;  1EIH A;  4DR5 Q;  2UXB L;  3BYT B;  2JA6 H;  4FO2 A;  4C2M H;  2L1B A;  4OX9 L;  1DJR D;  4DXF A;  1I5F A;  3H0G G;  3TP6 A;  1PDQ A;  4A3D H;  2AQ1 B;  3RLO A;  5KNC A;  3E0E A;  3EIV A;  2PZW A;  1PH3 A;  4C3H G;  5BN5 A;  3SHL A;  2KEE A;  4K14 A;  1EL0 A;  1PH2 A;  4IJH A;  1GUW A;  4FNF A;  1SFO H;  1PH7 A;  1KAW A;  2EY6 A;  5M5X B;  1U4P A;  4K2L A;  3H0G H;  3GDE A;  3NEN A;  1JJC B;  4CDD C;  5IWA L;  4BXX H;  1SND A;  1HNZ L;  1EY8 A;  1VF7 A;  3P7J A;  2A6E C;  2JE6 I;  2R93 G;  1UWV A;  2OWO A;  3M3Y B;  1OO9 B;  1VQD A;  1VQ8 A;  1YJW A;  2KED A;  3PO3 H;  1M1K C;  2UXC L;  1ONL A;  2WKC A;  4B3S Q;  1VF5 C;  3E9I A;  3ZYY X;  5M5W H;  3E0J A;  3M4O H;  2AQ3 B;  1G2T A;  4LFA L;  1BVS A;  4YY3 L;  2R7Z G;  4B3T L;  1YNN C;  1EY0 A;  3A5Z B;  5C4J B;  3MXP A;  4DF7 A;  4HJ5 A;  1G6Z A;  3MHB A;  2M00 A;  1UNS A;  1S5E D;  4DAV A;  1TWF B;  3SGI A;  2JA9 A;  5DNF A;  2EVB A;  2NN6 G;  3BS1 A;  4FF1 A;  2JA5 G;  4O42 A;  1VQA A;  2VXW A;  3BG3 A;  3H94 A;  3LNN A;  5M5Y H;  1X65 A;  4BA2 I;  2XNA C;  2F0T A;  1YHB A;  2EJG C;  4X66 Q;  3FDT A;  1QOH A;  1HQR D;  5CV4 A;  2AWN A;  3RZD B;  2WII B;  2JXM B;  1Q82 C;  3ERS X;  1EYC A;  4DUY L;  4KN4 C;  3CPF A;  1K8O A;  2K5V A;  1PLF A;  2WAQ E;  5K36 H;  3AQQ A;  1K0S A;  2JA6 B;  2F3I A;  4DA2 A;  3H91 A;  1IZ6 A;  1A3U A;  2D62 A;  2A1A A;  3MA2 B;  4JI6 L;  2HT1 A;  4ILW A;  2DNC A;  1EIY B;  5EQ0 A;  3VR6 A;  4X64 L;  1X56 A;  4A3K G;  3NHH A;  1B3A A;  1JB3 A;  5BN3 A;  2KCC A;  3FKI B;  1KTK A;  1SNO A;  3CC2 A;  1JE5 A;  3I4O A;  4XT1 B;  3OIP A;  3D31 A;  1EOV A;  1UE7 A;  3VYT A;  1Y1V H;  2ID0 A;  1HNX Q;  2Q8T A;  3KLR A;  2EZV A;  1JMC A;  2F0W A;  4DR1 Q;  4K0K Q;  4PV1 C;  3HOZ H;  1Z47 A;  1XTC D;  3MVV A;  3DMU A;  3PO2 H;  1QJO A;  2K14 A;  1FNW A;  1LTA D;  2CW0 C;  5COR A;  3CCU A;  3PSI A;  1K83 H;  2ATW A;  1CSQ A;  4GLX A;  3HOV H;  5IGD A;  1Y69 U;  3E3X A;  1T9H A;  3VA7 A;  1HUM A;  1OXV A;  4OON A;  1HQM C;  3M4Y A;  1S5C D;  3ERO A;  2ZJQ A;  1FYC A;  4HIM A;  5DEH A;  5ELO A;  4C3J H;  3C3L A;  1QIL A;  4X64 Q;  2E2J H;  5C3E B;  1S5F D;  2UUB Q;  2B2T C;  1EZ6 A;  4JI3 L;  2Y0S B;  3W3A A;  1M90 C;  5EBC A;  2CH4 A;  2K05 A;  2E2I H;  4QY7 A;  2I5H A;  4PNY A;  4DUZ L;  2AUJ D;  4XQN A;  3EJI A;  5EKL A;  4B3M Q;  5A35 A;  1MJC A;  5ELE A;  3OHX C;  3MTS A;  1TXY A;  1UE6 A;  1SAP A;  1WCM H;  4R8I A;  3NQI A;  1SMY D;  4DKA C;  1NJI C;  3KJO A;  1C9O A;  1FGB D;  4LF5 L;  3HOY B;  3GTK H;  1VQM A;  1QUQ A;  3G7L A;  1PTO B;  1KQS A;  1CKN B;  2Q2T A;  2EYH A;  4J1M A;  4OEM B;  2ALY B;  2KEC A;  4DR5 L;  1EEI D;  2UXB Q;  3L7Z C;  1RL2 A;  3D6W A;  2F03 A;  4MTK A;  2K03 A;  1VQN A;  2X69 A;  1EEF D;  2E2H H;  3T56 B;  4LAA A;  3BJU A;  4XQJ A;  4LNQ A;  1D1I A;  2ZM6 Q;  4ZK9 B;  5HUR A;  2PNH A;  2F0I A;  4JYA L;  1UEA B;  4XT3 B;  3VR4 A;  4A3C G;  3H3V I;  2PW5 A;  1X54 A;  1MKH A;  4O2D A;  3UE1 A;  1U0L A;  5IOC A;  3LWU A;  4TRD A;  3BYY B;  4IUP A;  5EGT A;  1TT2 A;  2EY2 A;  1YJN A;  1W3S A;  2PMZ E;  3RN5 A;  4DPG A;  5C3X A;  2K52 A;  1S3O A;  3HOW G;  1C48 A;  2B8G A;  1EFI D;  4JI2 Q;  4OWW B;  3SE0 A;  2K5Q A;  3NEM A;  1E1T A;  1Q90 A;  1H95 A;  1ILQ A;  4B3T Q;  1D1K A;  4RGT A;  5JJI A;  5KIX A;  1OTC A;  1CK1 A;  5HY6 A;  1KRS A;  2FMM A;  3N6R A;  1GHJ A;  5FLX c;  4BBS B;  3QOL A;  5LL6 S;  1AFP A;  3Q23 A;  1XMQ L;  2ZJP A;  2ZTD A;  4WJ4 A;  4A93 G;  1JT8 A;  1IXR A;  2RHS B;  2LY7 A;  1I4H A;  5J22 A;  3S1N H;  2G5D A;  4RG1 A;  2MPM A;  3GTM B;  1CHP D;  2VUM B;  2VQF Q;  1FJG Q;  1XNQ L;  2A68 D;  4K6D A;  4DV2 L;  4IPH A;  3J7A 5;  1XPR A;  4BA1 I;  1YHQ A;  4LF8 L;  1WI5 A;  2F0H A;  1Y1W B;  1NY4 A;  5NUC A;  1BUV T;  2CVR A;  2B63 B;  2UUA L;  4GKJ Q;  4OO1 H;  3S9W A;  1OXT A;  4YHH Q;  1V43 A;  1QZG A;  2Q8R E;  4DR1 L;  4K0K L;  1JOR A;  2FXQ A;  1WTQ A;  2JEB I;  4IQZ A;  4DNR B;  4LW1 A;  1AZP A;  3C46 A;  2ZTC A;  3GV6 A;  2C5C A;  3M7G A;  4X3S A;  2ES2 A;  3NBH A;  4RCO A;  2WB1 G;  3PO3 B;  4KD3 A;  3O13 A;  4R4O A;  1XMO Q;  2XRS D;  2XRQ D;  3FHW A;  4QMG A;  2OTJ A;  2A6H D;  5JAV A;  1IW7 D;  1IBM Q;  3FKI H;  3DEP A;  5KRU A;  1XWE A;  5ELB A;  2VQE Q;  3CKI B;  2Z9H A;  1VQL A;  4DV1 L;  3EA6 A;  3W2D A;  5H1S E;  3EN2 A;  3Q0A A;  3Q6S A;  3JC6 6;  4LF9 Q;  4L6T B;  1QUQ B;  4AYB G;  2NTS A;  3A8I E;  3FKI G;  4IOC A;  2OQ0 A;  5C0X J;  4KTA A;  2KUM A;  4TSS A;  1X3G A;  1H9J A;  2F0J A;  5IGG A;  1QZH A;  4APV A;  1E2V A;  3K7A B;  1K83 B;  4LFC L;  2IPK D;  2Q2I A;  3K80 C;  4P74 A;  3J7A V;  1XX8 A;  2EYL A;  1YNJ C;  5L37 A;  4EQN A;  4DUY Q;  1VQG A;  1N34 L;  4UHV A;  3BVZ A;  2K04 A;  1B8A A;  4GNX B;  2IX1 A;  2JA7 H;  4HJ9 A;  4A3I H;  4JW0 A;  4YWM A;  1A3V A;  3KDF A;  2OT2 A;  3E6Z X;  1HR0 L;  2V4D A;  2B2W A;  1VQH A;  4KJN A;  4JI8 L;  3PQI A;  4JI5 L;  5IYC H;  2IHF A;  3I4M G;  2XN9 C;  4XTC S;  4HTH A;  5BR8 L;  2EPB A;  4OEL B;  1FGU A;  4KK7 A;  1MGS A;  4JBJ A;  3I4N G;  5LMU Q;  4IPC A;  4JI8 Q;  1XMO L;  1YNN D;  1ESR A;  2JK8 A;  4LFA Q;  1I6V C;  1SXT A;  5ELC A;  1VQJ A;  3I4M H;  4JOI A;  4IFD I;  2VB3 X;  4LUO A;  1WYD A;  1GD7 A;  4OWT B;  4JI4 Q;  3WOE A;  1EIF A;  3F2C A;  3Q22 A;  2AMC B;  1AW7 A;  4ODG A;  2SOB A;  3T53 B;  1HZC A;  3K81 C;  4I65 A;  4PZ8 A;  1E1O A;  1HCZ A;  1DOL A;  3S1M B;  3EBE A;  4CJ1 B;  3FEW X;  4P75 A;  2RDG A;  3FRP B;  4JBM A;  3V96 A;  3HZX A;  3HOY G;  3S2D H;  1WOC A;  3H6M A;  3MXG A;  3FPP A;  2B39 A;  3RN2 A;  3GTP B;  2PI2 E;  1I50 B;  3A7L A;  3I8Z A;  4DV0 L;  1O80 A;  4P71 A;  5FLX E;  4R1J A;  4NXM L;  4ZQ3 A;  4LFC Q;  1AN8 A;  1JOK A;  3A56 A;  2HDM A;  3NBH B;  4DNT B;  4OO1 G;  1WCM B;  1WTX A;  3NXW A;  2R61 A;  2K28 A;  3MAQ A;  3I91 A;  1NSN S;  2VS1 A;  5E3F A;  4B3M L;  2E76 C;  4Q5V A;  5LMN Q;  3CCL A;  1WTH A;  4LF9 L;  2TMP A;  3HG9 A;  4X66 L;  4FVM A;  2JA7 B;  4KY5 A;  1A0I A;  1PH1 A;  3T1Y L;  1WD0 A;  1F77 A;  2F4V L;  1L1O B;  4OXP A;  4JI5 Q;  1QNU A;  1TWC B;  4NP5 A;  5C3E G;  1N32 L;  1IKL A;  4KI0 A;  5C5L A;  1T5E A;  3T51 B;  2QEJ C;  1K8A C;  2VY3 A;  4G57 A;  3TRE A;  4IJL A;  1O7I A;  4NW2 A;  3GTM H;  1HA5 A;  4AH6 A;  3I73 A;  2PQA A;  2JP1 A;  3RZO H;  1LO5 D;  1PV4 A;  4ALP A;  4P72 A;  1S40 A;  2DN8 A;  4OL7 A;  3AFQ A;  5M5X H;  3OTO Q;  1O7Z A;  3H0G B;  4NXM Q;  2FFK B;  4KKU A;  4H13 C;  1SE8 A;  3H3V C;  1QE6 A;  5AJ3 L;  3HOU B;  4DR3 Q;  2WAC A;  1NCV A;  3DWQ A;  2K7V A;  3T1H Q;  3HKZ G;  3KLS X;  4A3L H;  2N55 A;  5IT9 E;  1TR5 A;  1ZEQ X;  3M3Y H;  3QJY A;  2HDL A;  3KDF B;  4KHV A;  4NKL A;  2DGY A;  2GVB A;  3CCR A;  4Q0F A;  3K59 A;  4XYO A;  1XNR L;  1RIP A;  1I6H B;  1J6Q A;  3BDC A;  3PUW A;  4DUZ Q;  3GQB A;  1HTP A;  4QB4 A;  1DOK A;  3S1N B;  5D65 A;  1STB A;  5EKK A;  1XMQ Q;  4K5X A;  4RHS A;  4JI1 L;  5EPK A;  4GN5 A;  3MZ5 A;  5C0X I;  4TQU S;  3VR3 A;  5M3F G;  1XNR Q;  5C4X H;  5EPL A;  4CDE C;  1K28 A;  3GTQ B;  3R3O A;  1EQR A;  2IW3 A;  3BZD B;  2UUB L;  1X3Q A;  3A54 A;  3ZJY C;  4PG3 A;  4F7X A;  1N33 Q;  2VQF L;  3I4N H;  2B63 H;  2CHB D;  2B3G A;  3HOX H;  2K01 A;  3DWA A;  4A3M G;  1EQT A;  3PUZ A;  4OIJ A;  3RZD H;  3HOU G;  2ZXO A;  1ENC A;  1RHP A;  4JC0 A;  5JPN C;  1X3F A;  2K50 A;  2BH8 A;  4M8A A;  3C1F A;  3HKZ B;  5J1Z A;  4HIO A;  1SMX A;  1HXY D;  2L11 A;  2JA5 B;  4C3I G;  2B2V A;  4DAY A;  1PH5 A;  1N32 Q;  2K4K A;  5C0X G;  2NVQ B;  3SK6 A;  1Q12 A;  3I4L A;  1HH2 P;  4BY7 H;  3W5O A;  4JI4 L;  2OF1 A;  5HGT A;  3R2T A;  1N8R C;  1D7Q A;  3NTK A;  3PUV A;  3TP5 A;  4IN3 A;  5C0X H;  1II3 A;  3K5O A;  5IWA Q;  2F4I A;  3CRL C;  3V05 A;  5IT9 L;  1V1P A;  4KKS A;  1AH9 A;  2LS0 1;  2L55 A;  2F0G A;  4PMB A;  1PTO C;  1PRT C;  4HID A;  3S16 B;  1U9R A;  4LWC A;  1C8C A;  4OIK A;  4WJ3 M;  2CWA A;  1EY6 A;  3SK5 A;  3I4M B;  4DR7 Q;  2KHI A;  2XSC A;  2O2L D;  1N9W A;  1PTO D;  1G51 A;  3AB9 A;  5CV6 A;  4QCL A;  1E2W A;  1FJG L;  1FL0 A;  4O1N A;  3PF4 A;  2HUG A;  4DFA A;  1TWF H;  3J81 E;  2K32 A;  3UDX A;  3K58 A;  5FLX L;  1PZJ D;  3A74 A;  4HSP A;  1EY4 A;  2KEN A;  4M1U B;  3UI2 A;  3A5U A;  1FR3 A;  3M4P A;  4UP7 A;  3F8T A;  1VQ9 A;  4FF4 A;  2YTV A;  4AYB B;  3OSO A;  2B2U A;  1AP0 A;  5EBD A;  4PMW A;  1NTG A;  4RCN A;  4HCE A;  4IFD H;  2N8N A;  1B53 A;  1W2B A;  2DJG C;  2MNA A;  1Z6H A;  1XNQ Q;  3SDZ A;  3TN2 A;  4UP9 A;  1D5Z C;  3T1Y Q;  2F4V Q;  1D6E C;  3VYR A;  1E7Z A;  3ER0 A;  5M5Y B;  2MJ8 A;  1BQQ T;  2QDL A;  2NZ1 D;  1MIU A;  1VDZ A;  2F0M A;  1TS4 A;  2EXZ A;  5LL6 X;  1Y1V B;  1BR9 A;  5K5P A;  4DV6 Q;  1SNP A;  3PIP A;  3P75 A;  3L3O C;  1CUK A;  5M3M H;  3VR5 A;  3H09 A;  4LMQ D;  3OW2 A;  4RHR A;  1DOM A;  5IT9 c;  4ZLT F;  2Z6B A;  1IYJ B;  5GAH C;  5M3F H;  3A8K E;  1BNZ A;  2AWO A;  1JR0 D;  1Z7T A;  1CZW A;  5C4X G;  4GNX A;  1B3Q A;  4KV6 A;  3R93 A;  5I2X A;  3BVG A;  2B2Y A;  3EVQ A;  4KD4 A;  5AJ3 Q;  1PH9 A;  2B63 G;  2WV6 D;  4DAY B;  5IGF A;  3K5N A;  3CF5 A;  4Y7N B;  5M3M G;  2HCI A;  4K5W A;  4A3F H;  5CGK A;  1VQK A;  2IHE A;  1CHQ D;  1WJJ A;  2EYF A;  3I70 A;  4EQ5 A;  2QW7 A;  3VYU A;  1DM0 B;  5KEE A;  4LF5 Q;  2D5D A;  4BWG B;  1TU2 B;  4DV3 L;  1F9P A;  3HS0 C;  3HOW B;  3PO2 B;  1PYS B;  3GTO B;  3G6J B;  1PTO F;  1WFQ A;  1PRT F;  3OIQ A;  3X3N A;  2CKZ B;  1MHW C;  1A63 A;  2KA7 A;  4RMF A;  4QL5 A;  1W6J A;  1FVI A;  5EAY A;  3L0O A;  2WAQ B;  4JYA Q;  4IUQ A;  4YHH L;  1I4Q A;  3EFX D;  4H02 A;  1PFB A;  5C4X B;  3GTG H;  1EWH A;  3BU2 A;  1KRT A;  1R4P B;  4HJ8 A;  2RBM A;  1JCK B;  1A3T A;  1V1Q A;  4FF2 A;  3NBI A;  2IT1 A;  1IKM A;  1TWA B;  1HHV A;  1JJG A;  5E4X A;  1G91 A;  4ABN A;  3QO2 A;  1EU3 A;  4KY6 A;  3S15 B;  1Y1W G;  4ME5 A;  4RWS C;  2NB0 A;  1IW7 C;  2Q2H A;  3AU7 A;  3TS2 A;  1LT5 D;  4DV5 L;  1MI2 A;  1A2U A;  1I4X A;  1XTD A;  2RQX A;  5IP9 H;  1TWG H;  3K0Y A;  5CBE E;  2JQO A;  4B3R L;  3BZK A;  3Q24 A;  4IOA A;  3WDN A;  1R9T H;  1STA A;  1SNQ A;  2ASB A;  2YTY A;  4KHP L;  4KMU C;  1U5K A;  4JI3 Q;  3GTQ H;  4A3K H;  1M4V A;  4A3F B;  4C3I B;  1HUN A;  4J8Q A;  5C6A A;  1YJ9 A;  3I4N B;  1LYL A;  4HCS A;  2NN6 I;  3OPO A;  1JIC A;  5EPJ A;  4X3U A;  2PQA B;  1NMF A;  2L4N A;  5EKI A;  4B08 A;  3GTO H;  3S1R B;  2A5H A;  4KJO A;  5E4W C;  2CFM A;  1I3Q H;  1JQY D;  4NB3 A;  1E3P A;  2F3W A;  5F2D A;  2NZO A;  4A3I B;  1TQO A;  4L8J A;  1BCP C;  4WRD A;  5IYD G;  4E6I A;  5FLM G;  4J6H A;  1KDC A;  1YZ6 A;  2VL6 A;  1E22 A;  1LTL A;  3KBX A;  1KDB A;  2M2L A;  1PVO A;  1AZQ A;  2CQA A;  5CC4 A;  1BCP D;  2K1B A;  1LTI D;  2Z1C A;  1YHA A;  1U4L A;  1CSP A;  4G7O C;  1S72 A;  2RCN A;  3S15 H;  2HQL A;  2UXC Q;  1PFS A;  1HNX L;  1F9R A;  2OXP A;  3DUZ A;  2HIX A;  1KAA A;  1X55 A;  4JG2 A;  4IPD A;  1D5X C;  4EQP A;  4ULL A;  1NR2 A;  1IBK L;  4OWX B;  2JA7 G;  2BDO A;  2ZXP A;  1SBB B;  4TKO B;  1X9N A;  3SK4 A;  2JA6 G;  4FXG C;  4A3G B;  4G4K A;  3J80 c;  1RCV D;  1STG A;  1JOO A;  4BBR H;  1N34 Q;  1IL8 A;  3D0F A;  4A3I G;  4B9X A;  2F0P A;  5KNB A;  1SSO A;  1TY2 A;  1LLR D;  5JVG 3;  1G2S A;  2R7D A;  1E0B A;  4LUZ A;  5KYI A;  4R9W A;  4DAM A;  4K2K A;  2HHH L;  1G8Z D;  5FJ8 G;  1B9N A;  4OGQ C;  4GOP A;  2I0Q A;  2A73 B;  4LF6 L;  1D2B A;  3S1Q B;  4XDX A;  5C44 B;  3M4Q A;  2RA4 A;  1VQ5 A;  1LV9 A;  3F1Z A;  1RDP D;  1A6X A;  5I9P A;  2R93 H;  1VQ6 A;  5GAG C;  2A6H C;  3NUC A;  4Y7N H;  1EYA A;  1I3Q B;  2QEX A;  1RKN A;  3NP8 A;  3OMG A;  3VR2 A;  5ISR A;  2B2W C;  1K8M A;  4BY1 H;  2LSS A;  1JWM D;  4A3J B;  2NVT B;  1BF4 A;  1DD2 A;  1Q1B A;  3KF8 B;  2WFW A;  4IUR A;  4CHT B;  3AMU A;  1F2Y A;  4H0L C;  3AFP A;  4YCW A;  4R4C A;  3HOW H;  2I07 B;  4NPS A;  1IBL L;  4DV2 Q;  1PRT D;  1HZA A;  4QJF A;  2BA1 A;  2QA4 A;  2HD3 A;  4DN4 M;  4U67 3;  4NMZ A;  3OOC A;  4ZKB B;  2CW0 D;  4C2M B;  2F0D A;  3KOJ A;  4Z9C B;  5IGB A;  4RKB A;  5M3F B;  4HSV A;  3GTL B;  1JJ2 A;  2QGQ A;  4FP5 D;  2O5I C;  4ZAI A;  4CDF C;  1KLU D;  2LMC B;  2IY5 B;  4JI0 L;  2F0V A;  1QWY A;  2PZT A;  2KQ3 A;  3IFD A;  4K8J A;  4YCU A;  1BCP F;  2A69 D;  3CQZ H;  2BOS A;  4DR2 Q;  3W1B A;  1ET9 A;  1HRJ A;  1FNU A;  3CCS A;  1E24 A;  3CC7 A;  2WAQ G;  2QIL A;  3IKJ A;  1TS5 A;  1LTG D;  4KLK A;  3KLW A;  4C3H B;  1N36 L;  3HFZ B;  3MC0 B;  1YEZ A;  1WVL A;  4QUF A;  4YIJ A;  2PW7 A;  1CT1 D;  4C3J G;  4MN3 A;  1STH A;  4DV3 Q;  3J80 E;  3T1H L;  3TEH B;  1X3P A;  5IIF A;  1I50 H;  3D3R A;  1R9T B;  1HZB A;  1TS3 A;  2P5Z X;  3GTJ B;  1SE4 A;  3MWY W;  3DM1 A;  4A3E H;  2F52 A;  2KCN A;  1CKM A;  3PV0 A;  2GA4 B;  2DY8 A;  1MSG A;  2R92 B;  3S24 A;  1Y8P B;  2PNR C;  5JEA J;  2SNM A;  1EWC A;  2R3Z A;  3ERQ A;  3GD7 A;  4NXN L;  4PMC A;  4LF7 Q;  3HEJ A;  1R4Q B;  4A3D G;  4K6L A;  1PH8 A;  1TWA H;  3WWV A;  1SR3 A;  2KBN A;  3ND9 A;  4DR2 L;  3GTP H;  4F8M A;  5J39 A;  1GVP A;  3OYY A;  3J81 i;  2XTI A;  2E8G A;  3SEB A;  4DK1 A;  2XWB B;  4HAE A;  4GLA C;  4DV6 L;  1MD2 D;  4EGV A;  3V2T A;  1EZ8 A;  4CGY B;  2IL8 A;  3M9B A;  2F0L A;  3QOJ A;  4DR4 Q;  2QKI C;  2PYK A;  4MHE A;  3I56 A;  4BBR G;  1IYU A;  4BXX G;  4ME3 A;  1XXG A;  2V1C C;  1ENF A;  2K6A A;  1JWS D;  4NDX A;  4HR7 B;  4QGU A;  2EJM A;  2VUM G;  3WOF A;  5ELD A;  3HOX G;  1NE3 A;  3GP7 A;  4IPG A;  4IUU A;  2Z8L A;  1TVX A;  4XIG S;  2R92 G;  1ILP A;  1HNW L;  1Y8O B;  4C3H H;  3A8J E;  4JPB W;  1NR4 A;  1O78 A;  1V1O A;  2EY5 A;  3RLN A;  1DZ1 A;  3J81 j;  1U4R A;  4CJ0 B;  2RCF A;  5JOB A;  1WD1 A;  1VQB A;  4LFB L;  3PCO B;  4BY7 G;  1OXX K;  1DGS A;  1EY9 A;  4LF4 L;  1Q8K A;  4L5S A;  2PI2 A;  1UE5 A;  3RUZ A;  2HHH Q;  4TVA B;  2Z6K A;  1K8G A;  1F2M A;  1XPO A;  2NTT A;  2MUY A;  1XPU A;  1KXL A;  1HR0 W;  1JWU D;  2A8V A;  3D6C A;  1QG7 A;  3F2B A;  3FPU B;  3U9S A;  5JEA H;  1SRO A;  3U50 C;  1EIG A;  5CYU A;  3TDQ A;  4X62 L;  1BBW A;  4A4I A;  4A3G G;  5C44 H;  3HKZ E;  1H9M A;  1HNW Q;  2Y0S G;  2PZU A;  3NE5 B;  1RTN A;  1S5D D;  4JBW A;  3QB3 A;  3SR1 A;  3HOY H;  3GTK B;  1EFW A;  1EWI A;  4YWL A;  4DK0 A;  1UE1 A;  1SYF A;  3UDG A;  1SEB D;  4R4Q A;  2F0K A;  4XQQ A;  2HIV A;  1EQV A;  1I4P A;  4RH6 A;  5C44 G;  3CME A;  4LF4 Q;  4IO9 A;  1PTO H;  3MXU A;  1GO3 E;  4K8I A;  1DYQ A;  4C1N I;  1L1O A;  2F0O A;  3PUX A;  4QF4 A;  3RR5 A;  3TRZ A;  4HIK A;  4B3S L;  3STB D;  2RDF A;  2I5M X;  2R7Z B;  3OWE B;  2NUC A;  4JV5 Q;  2FHT A;  4R4T A;  1EOT A;  1STN A;  2ZT9 C;  2NVX H;  4JVZ A;  1Y1V G;  5IYD H;  3J80 L;  1CI3 M;  1H9R A;  3OWF A;  2WIN B;  4RGN A;  4DGZ A;  5IGC A;  4KN7 C;  2NYZ D;  5IP7 H;  2UXD Q;  1K9M C;  1YI2 A;  1B44 D;  2LKV A;  5IY0 A;  2B2U C;  3HGB A;  3J7Z C;  2JN4 A;  3HP3 A;  4BBS H;  2BA0 A;  4ZYS A;  2B2T A;  2MFI A;  1LAC A;  1S4Z A;  4LF8 Q;  1SE3 A;  1QNK A;  1ML0 D;  2JSO A;  5BN4 A;  1LT6 D;  3IRB A;  3HOV B;  3U4V A;  5IYB H;  4IAL A;  1PA6 A;  3U9O A;  4A75 A;  4GOP C;  3S14 H;  3NSW A;  1BKB A;  3NTI A;  1CQV A;  4V0B A;  3K6O A;  4BBS G;  1L1O C;  4N9T A;  3CD6 A;  3NWT A;  4C3J B;  3SXH A;  3SK8 A;  3LWE A;  1ZXT A;  3PO3 G;  3C1E A;  3KYH C;  3GV3 A;  4GOP B;  4L5Q A;  1HA6 A;  3R2I A;  4N8X 1;  1OXS C;  3NTH A;  1IBM L;  1VQ7 A;  2E2D C;  3OTO L;  1JC7 A;  4DR4 L;  1KLG D;  1SJE D;  2N49 A;  3CCQ A;  1CA6 A;  5IE8 A;  1B50 A;  3J81 c;  1TS2 A;  2VQE L;  1VQP A;  2PMZ B;  3NQT A;  5J3B A;  4DXG A;  3EQL C;  5T1I A;  4L5T A;  5T1G A;  2IX3 A;  4EQO A;  1HNZ Q;  1Q7Y C;  2G9H D;  3K0X A;  3JAM E;  3KF8 A;  3MFY A;  2C9O A;  1ZYR D;  2WB1 B;  3S17 H;  3LX0 A;  1VQI A;  4ZRZ A;  3CC4 A;  3K57 A;  4A93 H;  2SDF A;  2K75 A;  1LT3 D;  2JA8 B;  3TBI B;  1CA5 A;  4KY7 A;  4FYD A;  4IZ8 A;  3CU7 A;  5KND A;  1NNX A;  2N3S A;  4H44 C;  3DHQ A;  2ZM6 L;  3STB C;  2QF7 A;  1GUO A;  2E75 C;  1GM5 A;  4KHP Q;  1SYB A;  1TWH H;  5FOB B;  4GKK Q;  4JI7 L;  3K8A A;  4DK3 C;  3L9A X;  3K7A H;  4S3S A;  4N9P A;  1XYI A;  4P73 A;  3UE0 A;  2O4X A;  5C3W A;  1Q3L A;  2Z0S A;  3DWP A;  1Y8N B;  3B6Y A;  3MFG A;  4DR6 L;  1DCZ A;  2OQK A;  4GN4 B;  4MTN A;  3I3C A;  2E74 C;  2OEO A;  1SYE A;  3D4W A;  3HOZ G;  3VYS A;  2YU9 B;  1RTO A;  1T5X D;  4H7B A;  2N88 A;  1EY7 A;  1Y14 B;  2AHO B;  5LMU L;  3MXN A;  3JAM c;  1K0R A;  1LT4 D;  1QCB D;  3MEH A;  1KDA A;  3TS0 A;  1N36 Q;  3QR8 A;  5D3I B;  4A3D B;  1Z9F A;  1F2L A;  1YVC A;  4RAU C;  1O7Y A;  1P16 A;  4DV7 L;  5JJK A;  3RLF A;  3AYH B;  1X3E A;  5M5W B;  2GVA A;  1I6H H;  1GOZ A;  2KVM A;  4UY8 C;  3P20 A;  1F9S A;  1WTO A;  4DAP A;  3NEL A;  1BDO A;  1WTW A;  2OTL A;  2D0O A;  2CH4 W;  3TP7 A;  1KHI A;  5JJZ A;  1CKO A;  5G3L F;  3ND8 A;  4POG A;  1L0Y B;  4IFD G;  3ULP A;  4JV5 L;  5FKA C;  4G7H C;  4J15 A;  1UUP A;  1PXU A;  5FLM H;  4UDU C;  3URY A;  4A93 B;  2UUC Q;  3A0J A;  2NZH A;  2X6G A;  3HOX B;  1YIJ A;  2EY1 A;  4L5R C;  5CMD A;  2IX0 A;  4B9W A;  2MP1 A;  1A15 A;  2I46 A;  3G6E A;  1A8V A;  2BH2 A;  2K33 A;  2ZTE A;  1P8L A;  2SNS A;  2NVX B;  2E5L L;  3S2H B;  1NMG A;  2JYO A;  4RA8 A;  1DXM A;  3H15 A;  2PPB C;  2UXD L;  2H4O A;  2F0E A;  1W6K A;  1GKH A;  4X65 Q;  3J80 i;  4BY1 B;  5GAD C;  4JK1 C;  1ZYR C;  1TY0 A;  1UAP A;  2EXD A;  2E5L Q;  4LF6 Q;  2Y0S E;  1SYG A;  2QCP X;  3I72 A;  2L12 A;  3F2D A;  5CR3 A;  3PIO A;  4A3C H;  3Q8D A;  1WTR A;  4ZCK A;  4DV4 L;  3H3V H;  1FD7 D;  4JI7 Q;  1M8A A;  1K3R A;  2R7Z H;  4A3J G;  4LUV A;  3S14 B;  3NWS A;  1VQF A;  1PRT B;  3QG1 A;  2WKD A;  3S16 H;  3RZO B;  4DR6 Q;  1PH4 A;  1AE3 A;  4GKJ L;  5KYL A;  3DLL A;  3C2P A;  1SNC A;  1Q1E A;  4PQX A;  1BOS A;  3ITP A;  4RKL A;  3UDF A;  4DNI A;  5CV8 A;  2DUD A;  3I2Z A;  3ULL A;  2F3V A;  3W1G A;  3FP9 A;  1SFO B;  4QUC A;  2K5N A;  3NPP A;  2AUK A;  2PQE A;  4EVO A;  4UAI A;  3J7A F;  1Q81 C;  2RF4 A;  5CBA E;  1J8I A;  2E2J B;  4IFD J;  3A55 A;  2A69 C;  1VQC A;  3MEF A;  1GUS A;  3BDO A;  3BZC A;  1HZ9 A;  3CCM A;  4I7A A;  5LHY 1;  4FF3 A;  2EOT A;  1QB5 D;  2ICI A;  1D5M C;  1STY A;  2BCO A;  4I7Z C;  2E2I B;  2DJF C;  4QIW E;  2KCT A;  1ASY A;  3GTJ H;  5LMN W;  1SMY C;  3U4Z A;  4HED A;  1KL9 A;  3S1Q H;  3CRK C;  3IFT A;  5E1F A;  3S2H H;  4CJ2 C;  2F0U A;  1V9P A;  1ET6 A;  1GXD C;  5JVH 3;  2MQH A;  2D9U A;  1H9K A;  2F0Q A;  5C3E H;  1RF2 D;  3CCV A;  1BBX C;  2EYJ A;  2MO1 A;  1IYV A;  2VNU D;  3I55 A;  1Q86 C;  1OXU A;  4GKK L;  1V8Q A;  1A62 A;  2D2C C;  3TSS A;  3HKS A;  3M7N A;  4JI2 L;  3CAM A;  3CXC A;  3LGJ A;  5I4D A;  3S2D B;  2UU9 L;  1SYC A;  3BVM A;  3CCE A;  2EE1 A;  3K5M A;  5DAU A;  3OMC A;  4U68 A;  2Q2U A;  2UUA Q;  2JEA I;  2JA8 G;  1PYW D;  2R93 B;  1LTB D;  2RSO A;  4X3K A;  1J9O A;  4A3M B;  3T16 A;  1L2F A;  2RSN A;  4A3E G;  5C4H A;  4A3L G;  2J7Z A;  4JBK A;  2NVQ H;  5IP7 G;  3GTL H;  4UPA A;  4O0A A;  2B8F A;  5C4Z A;  3HOV G;  4AQY Q;  4Y52 H;  2H1E A;  5BR8 Q;  1VQ4 A;  2MHV A;  4YCV A;  2RHQ B;  5KGU A;  1YNX A;  4GLV B;  1I4R A;  4DR7 L;  3J81 L;  5C5M A;  3NK9 A;  4KHZ A;  1PHJ A;  1SDF A;  1CZG A;  1CTM A;  1I94 L;  2L9H A;  1E2Z A;  3HOZ B;  3KLS A;  4GNX C;  1LUZ A;  1WCM G;  2TSS A;  1RJT A;  2HQE A;  3PIO 3;  2YTX A;  1SJH D;  1ASZ A;  1H9S B;  4DV5 Q;  3RD4 A;  4CDC C;  2SEB D;  4X3T A;  1NAP A;  1VS0 A;  1TII D;  1K3B C;  3HOU H;  2VUM H;  2G9D A;  3FMC A;  4IUT A;  4A3E B;  3CMA A;  1LTR D;  4DR3 L;  2N78 A;  2AQ2 B;  2NBF A;  4FDB A;  1B70 B;  2R92 H;  4A3B B;  1BO0 A;  2FJ2 A;  4AYB E;  2YU9 H;  5HGQ A;  5DLQ E;  1J5E L;  4DV1 Q;  3I7F A;  1LTT D;  2NWG A;  1K73 C;  1LTS D;  1X6O A;  3DM3 A;  4G7Z C;  2BDN A;  4F87 A;  1AEX A;  2EJF C;  2UU9 Q;  2K5W A;  3CHB D;  3OW7 A;  4YY3 Q;  5I2Y A;  5CV7 A;  2D0P A;  1ZKO A;  2O5J C;  1KC8 C;  1PYB A;  2WB1 E;  1C4Q A;  4C1N K;  5D14 A;  4N8F A;  2NVY H;  1F9Q A;  1VCI A;  1YIT A;  1JOQ A;  3P1H A;  4XXE A;  5FJ8 H;  3PMF A;  4F88 A;  1YBY A;  4A3M H;  1Y1W H;  1EYG A;  4V19 0;  1RD9 D;  4UP8 A;  2IWH A;  3VA5 A;  4WFN 3;  2L0C A;  1QVC A;  3I90 A;  4HJ7 A;  1HPC A;  3IL8 A;  2LXK A;  1EYD A;  1UEB A;  2RDH A;  5I9O A;  3KUP A;  4PZ7 A;  2L15 A;  5IP9 G;  1WTV A;  2I5L X;  1L0W A;  1IBK Q;  1FNV A;  3G4S A;  3KFU A;  4HJA A;  2NN6 H;  2FMC A;  4BY1 G;  1BXT A;  2JA5 H;  2E2H B;  3KJP A;  1SNM A;  2R6G A;  1ESF A;  1EQQ A;  1I94 Q;  5M3M B;  2ZXR A;  2K5H A;  4OO1 I;  3IAY A;  5JEA G;  2K5D A;  4B3R Q;  5FO7 B;  5COY A;  2KHS A;  3RMH A;  4DK6 C;  2XWJ B;  4BS9 A;  2A74 C;  3KF6 B;  4MZ9 A;  2YYZ A;  4IUN A;  5K36 G;  2YV5 A;  1ICF B;  2XVS A;  4R4I A;  1O7L A;  1HFN A;  4DV0 Q;  5GRO A;  2EIF A;  3MXN B;  5CV5 A;  1U4M A;  2LXJ A;  4FXD A;  4LJZ C;  4AIM A;  1D8L A;  1PMR A;  3SVM A;  4HMJ A;  3T13 A;  2HCC A;  3KK7 A;  4KKT A;  4P2C B;  2B2Y C;  4POF A;  2M9V A;  2EQS A;  1WTP A;  2A19 A;  1J5E Q;  3PUY A;  5DM6 3;  2C35 B;  3TQY A;  3JAM L;  3E5S A;  3ULJ A;  1VMC A;  1NBW A;  1STE A;  4CKC A;  2MO0 A;  3PGZ A;  1MBY A;  3CP0 A;  4C56 C;  4X62 Q;  4RGM A;  3AEV A;  4QQB X;  5A2Q E;  1GJX A;  5FO9 B;  5FO8 B;  1PFM A;  1S5B D;  1KNA A;  1IHZ A;  1G29 1;  1DON A;  1CFM A;  5IOD A;  3BDL A;  4LF7 L;  4NXN Q;  3PO2 G;  3GTG B;  3UDI A;  4CKE A;  1MSH A;  1C7Y A;  3DEO A;  1IL2 A;  2VB2 X;  3U58 A;  3X3M A;  1JE4 A;  1VMP A;  1VQO A;  3TME A;  3F2U A;  4GN3 B;  2BE5 C;  5LMN L;  4MNO A;  3DXJ C;  1QVG A;  2XGT A;  3G71 A;  1NUC A;  1HTL D;  2XIW A;  5ELF A;  4LFB Q;  2KHJ A;  3TP8 A;  4L63 B;  3GO5 A;  5IYB G;  1BCP B;  4OHJ A;  1PZK D;  4MIU A;  5I6Y A;  4GZY C;  1EY5 A;  1PZI D;  1QVF A;  2Q8I B;  2DNE A;  4ID6 A;  2CCZ A;  3D4D A;  4GS3 A;  1L0X B;  1TWG B;  5I6W A;  1ICW A;  1PFN A;  4HMI A;  2RVL A;  1KNE A;  3TZU A;  1B1Z A;  3ONA B;  1B9M A;  2ZJR A;  1B7Y B;  3N52 A;  4IUV A;  4JI0 Q;  1I4G A;  2VZA A;  3J7Y W;  4JI1 Q;  1ENA A;  1SN8 A;  5G3L D;  1A2T A;  3TZD A;  4A3J H;  2PO4 A;  2R7F A;  4A3K B;  1JB7 A;  2NVT H;  4C3I H;  4CKB A;  1CKN A;  1BBU A;  4RGO S;  5IYC G;  5GAE C;  1SRU A;  4WOR A;  3FVQ A;  4ZUI A;  1G6P A;  4EX5 A;  1EU4 A;  5FK9 C;  3S1R H;  3KBG A;  4X6A H;  1GUT A;  4DV4 Q;  3R8B A;  5DM7 3;  3CW2 C;  4A3F G;  5E7N A;  2OCE A;  4X65 L;  1H9S A;  1KD1 C;  1Q8I A;  4A76 A;  1HR0 Q;  4XYQ A;  1AE2 A;  2GN5 A;  5JJL A;  3A7A B;  3RNU A;  2EYM A;  2ENB A;  3M85 A;  1HJP A;  4JI6 Q;  1LAB A;  5A2Q L;  2L5T A;  4PZ6 A;  5TSS A;  1YNJ D;  2LFN A;  2J0T D;  1CQF A;  1LM0 A;  2B2V C;  4JOI C;  1N33 L;  2PCF B;  3CQZ B;  2X6L A;  2F0F A;  1TWC H;  1F2Z A;  1SYD A;  1Q46 A;  1TKW B;  2J4X A;  4ZKC B;  3K5L A;  1IBL Q;  2A6E D;  1B2T A;  4DV7 Q;  5CV9 A;  4CBV A;  4K5V A;  1X32 A;  1PH6 A;  1V1P B;  2EYP A;  2MGS A; 
#chains in the Genus database with same CATH homology
 1S72 A;  2RCN A;  1Z9F A;  3S15 H;  2HQL A;  3ICE A;  4JBJ A;  2UXC Q;  3I4N G;  1PFS A;  1HNX L;  1YVC A;  2AKW B;  2HIX A;  5LMU Q;  4IPC A;  1P16 A;  4JI8 Q;  4DV7 L;  2KCM A;  5GQO A;  3CCJ A;  2JK8 A;  4LFA Q;  3AYH B;  3RLF A;  1XMO L;  5JJK A;  1X3E A;  3PF5 A;  1VQJ A;  1X55 A;  2GVA A;  2JJQ A;  4JG2 A;  4IPD A;  4JOI A;  3I4M H;  4IFD I;  3E9H A;  3G48 A;  1MJE A;  4UY8 C;  2H5X A;  4A3B G;  4LUO A;  1I6H H;  1IBK L;  4A3G H;  4OWX B;  2JA7 G;  1WYD A;  3NEL A;  2OTL A;  1GD7 A;  1VQE A;  2D0O A;  4OWT B;  1X9N A;  4JI4 Q;  2JA6 G;  1KHI A;  1CKO A;  3J80 c;  1XJV A;  1EIF A;  4POG A;  1KIX A;  3F2C A;  4IFD G;  2AMC B;  3ULP A;  4JV5 L;  2WP8 J;  4BBR H;  1N34 Q;  4J15 A;  1HZC A;  3K81 C;  2Z6K C;  3D0F A;  4PZ8 A;  1SLJ A;  1E1O A;  5FLM H;  4A3I G;  3JAM i;  2CQO A;  2UUC Q;  3A0J A;  2NZH A;  3EBE A;  2JA8 H;  4A3B H;  4P75 A;  3S1M H;  2R7D A;  4LUZ A;  4JBM A;  4DAM A;  1YIJ A;  3L2P A;  2HHH L;  4L5R C;  2IX0 A;  5FJ8 G;  4GOP A;  3HOY G;  1WOC A;  3S2D H;  3CPW A;  2I0Q A;  3G6E A;  1C0A A;  1A8V A;  3RN2 A;  2BH2 A;  2PI2 E;  2ZTE A;  4DV0 L;  4LF6 L;  1P8L A;  2B29 A;  4P71 A;  5C4J H;  2E5L L;  1NMG A;  3M4Q A;  4R1J A;  2VW9 A;  4LFC Q;  1VQ5 A;  4NXM L;  3H15 A;  2UUC L;  3F1Z A;  3KF6 A;  2UXD L;  2CWP A;  2R93 H;  3NBH B;  5GAG C;  1VQ6 A;  4OO1 G;  4Y7N H;  1GKH A;  2VS1 A;  4X65 Q;  2QEX A;  3J80 i;  4AQY L;  4B3M L;  5GAD C;  1FGU A;  4YWK A;  3CCL A;  5LMN Q;  4BY1 H;  2E5L Q;  2EXD A;  2LSS A;  3K7U C;  2Y0S E;  4LF6 Q;  4X66 L;  4LF9 L;  1Q1B A;  4BXX G;  4OX9 Q;  3KF8 B;  2WFW A;  4JCV E;  1A0I A;  3F2D A;  1PH1 A;  1EUJ A;  3T1Y L;  3AFP A;  2F4V L;  4YCW A;  3PIO A;  1L1O B;  4R4C A;  3HOW H;  4A3C H;  4OXP A;  3Q8D A;  5ELN A;  4JI5 Q;  4DV4 L;  4NPS A;  1IBL L;  4DV2 Q;  3H3V H;  5C3E G;  4JI7 Q;  1HZA A;  4DR5 Q;  1N32 L;  2UXB L;  4QJF A;  4KI0 A;  2BA1 A;  2JA6 H;  1K3R A;  2R7Z H;  4C2M H;  4A3J G;  1K8A C;  2QA4 A;  2VY3 A;  3TRE A;  4OX9 L;  4IJL A;  1O7I A;  1I5F A;  3H0G G;  4LUV A;  3GTM H;  3KOJ A;  1VQF A;  4A3D H;  3RLO A;  1JJ2 A;  2QGQ A;  3S16 H;  3E0E A;  3EIV A;  1PH4 A;  4DR6 Q;  1AE3 A;  4AH6 A;  4GKJ L;  3DLL A;  1PH3 A;  2PQA A;  3RZO H;  1Q1E A;  2IY5 B;  1PH2 A;  4IJH A;  4DNI A;  3UDF A;  4P72 A;  4ALP A;  1PV4 A;  1S40 A;  3ULL A;  2DUD A;  3I2Z A;  3AFQ A;  5M5X H;  4YCU A;  3OTO Q;  1SFO H;  1PH7 A;  1KAW A;  3W1G A;  3FP9 A;  4NXM Q;  1SE8 A;  3CQZ H;  4DR2 Q;  3H0G H;  5AJ3 L;  3W1B A;  3GDE A;  4DR3 Q;  3CCS A;  2K5N A;  1E24 A;  3NEN A;  2WAQ G;  3CC7 A;  3T1H Q;  1JJC B;  3HKZ G;  3KLW A;  4KLK A;  5IWA L;  1Q81 C;  2RF4 A;  1N36 L;  1HNZ L;  3HFZ B;  4BXX H;  4A3L H;  4IFD J;  3M3Y H;  1VQC A;  2JE6 I;  3MEF A;  1YEZ A;  2R93 G;  1UWV A;  2OWO A;  3KDF B;  3BZC A;  1HZ9 A;  1VQD A;  1VQ8 A;  2DGY A;  3CCM A;  1YJW A;  1M1K C;  3PO3 H;  2GVB A;  3CCR A;  2UXC L;  4B3S Q;  1XNR L;  3E9I A;  5M5W H;  1RIP A;  3M4O H;  4DV3 Q;  3T1H L;  3TEH B;  4LFA L;  1BVS A;  1J6Q A;  2KCT A;  3PUW A;  4QIW E;  4YY3 L;  4DUZ Q;  1ASY A;  2R7Z G;  3GTJ H;  5LMN W;  1I50 H;  4B3T L;  3U4Z A;  1KL9 A;  3A5Z B;  3S1Q H;  1HZB A;  3S2H H;  1XMQ Q;  4HJ5 A;  1V9P A;  4JI1 L;  4GN5 A;  4A3E H;  2MQH A;  5C0X I;  4TQU S;  5M3F G;  1XNR Q;  2F52 A;  5C3E H;  1CKM A;  3SGI A;  3PV0 A;  3CCV A;  2JA9 A;  5C4X H;  2MO1 A;  3S24 A;  2NN6 G;  1EQR A;  2VNU D;  5JEA J;  3I55 A;  2UUB L;  1Q86 C;  2JA5 G;  1OXU A;  4PG3 A;  3ZJY C;  1N33 Q;  2VQF L;  1VQA A;  4GKK L;  1A62 A;  3GD7 A;  4NXN L;  4LF7 Q;  2B63 H;  3I4N H;  4A3D G;  2B3G A;  3HKS A;  1X65 A;  5M5Y H;  3HOX H;  1PH8 A;  4JI2 L;  1TWA H;  3M7N A;  3CAM A;  3WWV A;  4A3M G;  1YHB A;  3PUZ A;  3LGJ A;  1SR3 A;  4X66 Q;  3CXC A;  3RZD H;  2KBN A;  3HOU G;  4DR2 L;  4JC0 A;  2UU9 L;  1X3F A;  2K50 A;  3GTP H;  3J81 i;  3CCE A;  1GVP A;  2AWN A;  2BH8 A;  2XTI A;  3OYY A;  2E8G A;  1Q82 C;  3ERS X;  4DUY L;  3CPF A;  2UUA Q;  2Q2U A;  4GLA C;  2K5V A;  1SMX A;  4DV6 L;  4HIO A;  2JA8 G;  2JEA I;  2WAQ E;  3AQQ A;  2F3I A;  3M9B A;  1PH5 A;  4DR4 Q;  1N32 Q;  1IZ6 A;  2K4K A;  2D62 A;  2A1A A;  5C0X G;  4JI6 L;  1L2F A;  3I56 A;  2HT1 A;  4BBR G;  1EIY B;  4A3E G;  1Q12 A;  4A3L G;  4ME3 A;  4X64 L;  1X56 A;  1HH2 P;  4BY7 H;  3W5O A;  4JBK A;  2V1C C;  2NVQ H;  5IP7 G;  3GTL H;  4UPA A;  4O0A A;  4JI4 L;  4A3K G;  3HOV G;  4AQY Q;  4Y52 H;  1N8R C;  1D7Q A;  5BR8 Q;  1VQ4 A;  4QGU A;  4YCV A;  4JI0 L;  2RHQ B;  3CC2 A;  2VUM G;  1JE5 A;  3I4O A;  3PUV A;  1YNX A;  4GLV B;  3D31 A;  3HOX G;  1EOV A;  1UE7 A;  1NE3 A;  1Y1V H;  2ID0 A;  1HNX Q;  4DR7 L;  4IPG A;  1JMC A;  4XIG S;  5IWA Q;  2R92 G;  1HNW L;  4KHZ A;  1PHJ A;  4C3H H;  4DR1 Q;  4K0K Q;  1AH9 A;  3HOZ H;  1Z47 A;  1I94 L;  3RLN A;  4GNX C;  1LUZ A;  1WCM G;  3J81 j;  4HID A;  3PO2 H;  4LWC A;  4WJ3 M;  1VQB A;  2CWA A;  2K14 A;  4LFB L;  3PCO B;  3CCU A;  4DR7 Q;  4BY7 G;  1OXX K;  2YTX A;  2KHI A;  1DGS A;  1K83 H;  3PSI A;  1ASZ A;  2ATW A;  1CSQ A;  4GLX A;  3HOV H;  1N9W A;  4DV5 Q;  1G51 A;  1T9H A;  4LF4 L;  1OXV A;  1Q8K A;  4OON A;  1VS0 A;  4L5S A;  1FJG L;  1FL0 A;  2PI2 A;  2ZJQ A;  1UE5 A;  3HOU H;  2VUM H;  3PF4 A;  4HIM A;  2HHH Q;  5ELO A;  4C3J H;  3CMA A;  4TVA B;  4DR3 L;  2N78 A;  2Z6K A;  4X64 Q;  2E2J H;  1K8G A;  4FDB A;  1XPO A;  1TWF H;  2UUB Q;  1B70 B;  1XPU A;  2R92 H;  1KXL A;  1HR0 W;  4JI3 L;  4AYB E;  2A8V A;  2YU9 H;  5HGQ A;  5DLQ E;  3UDX A;  1J5E L;  4DV1 Q;  3I7F A;  3F2B A;  1K73 C;  1M90 C;  1X6O A;  3DM3 A;  3A74 A;  2KEN A;  1SRO A;  3U50 C;  4X62 L;  3A5U A;  2E2I H;  2UU9 Q;  4QY7 A;  2I5H A;  4YY3 Q;  4DUZ L;  3M4P A;  1BBW A;  2D0P A;  4UP7 A;  4A4I A;  4A3G G;  3F8T A;  1KC8 C;  5C44 H;  1PYB A;  1VQ9 A;  2WB1 E;  4B3M Q;  3HKZ E;  2YTV A;  2NVY H;  1MJC A;  1HNW Q;  2Y0S G;  1TXY A;  1VCI A;  1UE6 A;  1YIT A;  1WCM H;  4PMW A;  1NTG A;  2N8N A;  1W2B A;  4JBW A;  1NJI C;  4DKA C;  5FJ8 H;  3HOY H;  2MNA A;  1XNQ Q;  1YBY A;  3KJO A;  4A3M H;  1Y1W H;  1EWI A;  1C9O A;  4YWL A;  1EYG A;  4UP9 A;  1EFW A;  3T1Y Q;  4UP8 A;  4LF5 L;  2F4V Q;  1UE1 A;  3GTK H;  1QVC A;  4HJ7 A;  1VQM A;  3UDG A;  1QUQ A;  4R4Q A;  1E7Z A;  3ER0 A;  2HIV A;  2LXK A;  1UEB A;  5C44 G;  3CME A;  1CKN B;  1KQS A;  2Q2T A;  4BA2 I;  4LF4 Q;  4IO9 A;  2ALY B;  4PZ7 A;  2L15 A;  4DR5 L;  5IP9 G;  2UXB Q;  1GO3 E;  1MIU A;  3L7Z C;  1RL2 A;  2I5L X;  1L1O A;  3PUX A;  1L0W A;  3G4S A;  1IBK Q;  1VQN A;  3KFU A;  3RR5 A;  4HJA A;  2E2H H;  4HIK A;  3TRZ A;  4B3S L;  3STB D;  4BY1 G;  4DV6 Q;  2I5M X;  3PIP A;  2JA5 H;  3BJU A;  4LNQ A;  3KJP A;  2ZM6 Q;  1CUK A;  4JV5 Q;  2R6G A;  5M3M H;  3OW2 A;  1EQQ A;  2PNH A;  1I94 Q;  4R4T A;  5IT9 c;  4JYA L;  2K5H A;  1IYJ B;  5GAH C;  5M3F H;  4OO1 I;  5JEA G;  4A3C G;  3H3V I;  2AWO A;  4B3R Q;  5C4X G;  1X54 A;  1MKH A;  4DK6 C;  4O2D A;  3UE1 A;  1U0L A;  4GNX A;  2NVX H;  1Y1V G;  5IYD H;  3KF6 B;  4MZ9 A;  2YYZ A;  5AJ3 Q;  1PH9 A;  5K36 G;  2B63 G;  2YV5 A;  1YJN A;  1W3S A;  2PMZ E;  3RN5 A;  4DAY B;  4DPG A;  4R4I A;  2K52 A;  1S3O A;  3CF5 A;  5M3M G;  3HOW G;  4DV0 Q;  5GRO A;  2EIF A;  3MXN B;  2LXJ A;  4A3F H;  4JI2 Q;  4AIM A;  1VQK A;  2IHE A;  5IP7 H;  4OWW B;  1WJJ A;  2UXD Q;  1D8L A;  4EQ5 A;  1K9M C;  3NEM A;  1YI2 A;  4LF5 Q;  1E1T A;  1H95 A;  5IY0 A;  4B3T Q;  3J7Z C;  4DV3 L;  4BBS H;  2BA0 A;  4POF A;  2EQS A;  5JJI A;  2A19 A;  1J5E Q;  2MFI A;  1KRS A;  3PUY A;  5HY6 A;  1PYS B;  1OTC A;  5FLX c;  2C35 B;  3TQY A;  1WFQ A;  3ULJ A;  1NBW A;  2ZJP A;  1XMQ L;  4LF8 Q;  2MO0 A;  2CKZ B;  2ZTD A;  3PGZ A;  4A93 G;  4WJ4 A;  1JT8 A;  3CP0 A;  1A63 A;  1IXR A;  2RHS B;  3IRB A;  4X62 Q;  3AEV A;  4QQB X;  3U4V A;  5IYB H;  3S1N H;  1PA6 A;  4A75 A;  4RG1 A;  4GOP C;  4RMF A;  3S14 H;  4QL5 A;  1FVI A;  5EAY A;  3L0O A;  1G29 1;  1BKB A;  4LF7 L;  4NXN Q;  3PO2 G;  2VQF Q;  4BBS G;  1FJG Q;  4JYA Q;  1L1O C;  1XNQ L;  3CD6 A;  3UDI A;  4YHH L;  4IPH A;  4DV2 L;  3J7A 5;  4H02 A;  1XPR A;  1C7Y A;  4BA1 I;  3GTG H;  1YHQ A;  4LF8 L;  1WI5 A;  1IL2 A;  3U58 A;  1NY4 A;  3BU2 A;  1KRT A;  4HJ8 A;  2UUA L;  1VQO A;  1V1Q A;  3PO3 G;  4GKJ Q;  2IT1 A;  4GN3 B;  3KYH C;  1OXT A;  4YHH Q;  4GOP B;  4L5Q A;  5LMN L;  1V43 A;  1QZG A;  4MNO A;  1QVG A;  4DR1 L;  1OXS C;  2XGT A;  3G71 A;  4K0K L;  1JJG A;  1IBM L;  1VQ7 A;  2FXQ A;  2JEB I;  3OTO L;  4DR4 L;  2N49 A;  4LW1 A;  3CCQ A;  2KHJ A;  2ZTC A;  5IE8 A;  1Y1W G;  4LFB Q;  2Q2H A;  3GO5 A;  3J81 c;  5IYB G;  2ES2 A;  3TS2 A;  2VQE L;  3VDY A;  1VQP A;  2WB1 G;  4DV5 L;  1XMO Q;  4R4O A;  5J3B A;  1XTD A;  3FHW A;  1QVF A;  4L5T A;  2CCZ A;  1HNZ Q;  5IP9 H;  1TWG H;  2OTJ A;  1Q7Y C;  4GS3 A;  2JQO A;  4B3R L;  3BZK A;  3K0X A;  1IBM Q;  4IOA A;  1R9T H;  3FKI H;  2ASB A;  3S17 H;  1VQI A;  2VQE Q;  3CC4 A;  2YTY A;  1VQL A;  4KHP L;  2ZJR A;  1B7Y B;  4DV1 L;  4A93 H;  2K75 A;  4JI0 Q;  2VZA A;  1U5K A;  4JI3 Q;  3GTQ H;  4JI1 Q;  4A3K H;  5H1S E;  3EN2 A;  1SN8 A;  3JC6 6;  4LF9 Q;  4A3J H;  1JB7 A;  1QUQ B;  2R7F A;  2NVT H;  4C3I H;  1YJ9 A;  2N3S A;  1LYL A;  4AYB G;  2NN6 I;  1CKN A;  1BBU A;  3FKI G;  2OQ0 A;  5IYC G;  5C0X J;  3STB C;  5GAE C;  2ZM6 L;  4IOC A;  1SRU A;  1X3G A;  1G6P A;  1QZH A;  4EX5 A;  2PQA B;  3S1R H;  4APV A;  1GM5 A;  4KHP Q;  1NMF A;  1TWH H;  4GKK Q;  4X6A H;  4DV4 Q;  3GTO H;  4JI7 L;  3K8A A;  3CW2 C;  4DK3 C;  4LFC L;  4A3F G;  2Q2I A;  3K7A H;  5E7N A;  2OCE A;  3K80 C;  4P74 A;  2CFM A;  4X65 L;  4A76 A;  1KD1 C;  1HR0 Q;  1AE2 A;  2GN5 A;  5JJL A;  4P73 A;  1I3Q H;  3RNU A;  3UE0 A;  4NB3 A;  1N34 L;  4DUY Q;  1VQG A;  2Z0S A;  1E3P A;  3B6Y A;  4DR6 L;  3M85 A;  2NZO A;  1HJP A;  1B8A A;  2OQK A;  4GN4 B;  4JI6 Q;  4GNX B;  2IX1 A;  4MTN A;  2JA7 H;  4HJ9 A;  5IYD G;  5FLM G;  4A3I H;  4PZ6 A;  4YWM A;  1YZ6 A;  3HOZ G;  2VL6 A;  1E22 A;  1LTL A;  3KDF A;  1HR0 L;  1LM0 A;  1PVO A;  4JOI C;  1N33 L;  1TWC H;  1VQH A;  1IBL Q;  1Q46 A;  4JI8 L;  4JI5 L;  1Y14 B;  2AHO B;  2IHF A;  5IYC H;  5LMU L;  3I4M G;  3JAM c;  4DV7 Q;  4XTC S;  1K0R A;  5BR8 L;  1PH6 A;  3TS0 A;  1N36 Q;  1YHA A;  1CSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...