4KD4A

Crystal structure of staphylococcal nuclease variant v23l/l25v/v66i/i72v at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
132
Chain Sequence
LHKEPATLIKAIDGDTLKVMYKGQPMTFRLLLVDTPETKHPVEKYGPEASAFTKKMIENAKKVEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 132
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4kd4A00
1AEXA 5CV7A 2SNSA 5IODA 4PNYA 2F0IA 2F0TA 2SOBA 5C3XA 5C4HA 3D4DA 4K14A 2F0LA 3BDLA 4QF4A 4KY6A 1EZ8A 4K5VA 1A3VA 1U9RA 4KY7A 4DU9A 3BDCA 1JOOA 3NK9A 5KIXA 4N9TA 3TP5A 4PMCA 5IGCA 4HTHA 2EYLA 3PMFA 1STNA 5CR3A 2EYHA 2KHSA 1TR5A 4IALA 4ODGA 2KQ3A 3VA5A 3ITPA 1A2UA 2F0MA 3OWFA 1KDBA 2EYPA 5CGKA 5ISRA 3LX0A 1NUCA 2EYOA 1STAA 2PYKA 3QOLA 4WORA 1EY8A 5HGTA 2RDFA 1IHZA 4YIJA 5DEHA 5C5MA 4DF7A 5C6AA 1KABA 4G57A 1JOKA 2O4XA 4E6IA 2RBMA 2QDBA 1EQVA 4KJOA 5JAVA 5IGEA 5EKLA 4DFAA 3OMCA 1EZ6A 2F0HA 4TRDA 5CC4A 1II3A 1SYGA 1TT2A 3D6CA 2PZTA 4B9WA 4EQNA 4IZ8A 1F2ZA 1EY0A 4PMBA 2PW5A 2F0OA 3H6MA 1EY5A 1EY6A 5KEEA 2EYJA 1A3TA 4K2KA 5JOBA 3OMGA 5C3WA 2PQEA 3QB3A 5I9PA 3MVVA 3V2TA 3C1EA 2F0SA 3NQTA 2ENBA 2SNMA 3D4WA 2PZUA 2F3VA 1SNMA 4KV6A 4KD3A 3T16A 1ENCA 5EKKA 2PW7A 4ID6A 4B9XA 2F0DA 3EROA 2WACA 4IUNA 4ZUJA 3MZ5A 1SYBA 2RKSA 2EY1A 1JORA 3E5SA 3D8GA 3SK5A 2F0NA 1RKNA 5I9OA 4N9PA 1STYA 1KDAA 2F0GA 4NP5A 1SNCA 2F0EA 2LKVA 2OXPA 3P1HA 5J22A 3R3OA 4HMIA 4ZUIA 4EQPA 4K8JA 1A2TA 4RKLA 4QB4A 3S9WA 1EY4A 1KDCA 4NMZA 2EY5A 4KY5A 4QMGA 2EY6A 4HMJA 5KRUA 4KJNA 5IOCA 2EXZA 4NKLA 4I65A 4MIUA 5IGFA 1SNDA 2EYMA 5CV6A 5C5LA 3SR1A 2F3WA 4KD4A 3TP7A 1JOQA 5CV5A 3NXWA 1KAAA 4R8NA 4ZQ3A 5E1FA 2F0FA 3TP6A 1SYEA 1SNPA 2M00A 2EY2A 4K6DA 1SYCA 1EY9A 1F2MA 1SNQA 2NUCA 3NP8A 4KHVA 3QOJA 5CV8A 4F8MA 5I6WA 3C1FA 4K2LA 4J6HA 5IGGA 3RUZA 2PZWA 5KYIA 3TP8A 5IIFA 1A3UA 3DHQA 5F2DA 1EYAA 3T13A 5E3FA 3P75A 2HQEA 3SXHA 4RKBA 2OF1A 4F7XA 4K8IA 3TMEA 1EY7A 5M9OA 1SYDA 4EQOA 3MHBA 5K5PA 5IGBA 5J39A 4K5XA 2OEOA 4EVOA 3HZXA 5J1ZA 5KYLA 2EYFA 4OL7A 3U9OA 3MXPA 5KGUA 2F0KA 3EVQA 4WRDA 1STGA 5DAUA 5IGDA 4DGZA 1SYFA 4K5WA 2F0UA 3SK6A 4ME5A 3SK8A 1EYCA 2F0QA 5C4ZA 5I6YA 1EYDA 2F0VA 4J1MA 3HEJA 3OSOA 1F2YA 4LAAA 4NDXA 5HURA 3SK4A 2F0JA 1NSNS 2F0PA 4KTAA 3DMUA 1STBA 3NHHA 1ENAA 3EJIA 4S3SA 3MEHA 5CV9A 3SHLA 4H7BA 5NUCA 1SNOA 1TQOA 3ERQA 1STHA 2F0WA 5EGTA 5CV4A 3NUCA
chains in the Genus database with same CATH superfamily
4A3FG 2NN6H 5C3XA 3HOXG 2K5NA 1CT1D 3PUXA 2Q8RE 2WB1B 2UU9L 2K28A 3CRLC 2NN6G 1LTLA 1GUGA 1B1ZA 1HNZQ 1NTGA 1MSHA 2FHTA 1BBWA 4ODGA 1HUNA 4GLVB 3Q8DA 4MTNA 3CKIB 2A73B 2UXCQ 3KF6A 5FOBB 4KKSA 1EY8A 1A62A 4AQYQ 1UE5A 1PH8A 1K83H 1SMYC 2VS1A 4UDUC 4DV2Q 5EAYA 3GTMH 3S2DH 3BYTB 1Q8IA 4LFBL 4TRDA 2RVLA 2B2WC 2ZXPA 2DY8A 4X3UA 4IFDJ 2MO0A 1VF7A 3HKZG 2PQEA 2F0SA 2IW3A 5JJIA 1HZ9A 2F3VA 4KKUA 1LYLA 4JI1L 4JCVE 2F4VL 4ID6A 2E2JH 4B9XA 1K9MC 3FEWX 3U4ZA 1SSOA 1UEAB 3X3NA 1TWFB 2EPBA 2OQKA 3UDIA 5M3MG 2E8GA 3STBC 3ND8A 1XTDA 4RGNA 1CA5A 1PYWD 2E2IH 3S1MH 3PO2H 1F9RA 1S5BD 4BBSH 1ZEQX 2KJXA 5KRUA 2SDFA 4KJNA 1WD1A 4O1NA 2B2WA 3PO2G 3IKJA 4A3KG 4BBSG 4LF8Q 1HRJA 5EQ0A 1BCPF 2PQAB 2N3SA 2R92H 1IBLL 4LK1C 3J7YW 1IW7C 3S1NB 3NWSA 1SMYD 1CQVA 1ICWA 1S5CD 1E7ZA 4BY1H 1CK1A 2R92G 5K36G 2NVTB 2KCCA 4LF5Q 1Q1BA 5C0XH 4IN3A 5BN4A 4JBKA 5C4JB 3W1GA 3F8TA 3OSOA 1CUKA 5ELEA 1PH4A 1GKHA 3URYA 1STBA 3E0EA 4ZCKA 3G4SA 5CV9A 2JJQA 4CKCA 3LWEA 1PV4A 3D6WA 1QUQB 4BXXG 4DR4L 1I4XA 3VA7A 1HNXQ 1XYIA 3TZUA 2AMCB 2IHEA 3DWQA 4A3EB 4DXFA 1PRTB 3GTQB 1CSPA 1BQQT 2K52A 2VQFL 1FYCA 3RZOH 5EBCA 2PO4A 2RDGA 1V1QA 4A93H 3HKZE 3EIVA 4NXML 5M3FG 1HTLD 3J80c 3OWFA 3T1YL 2ICEC 4A3JH 1PXUA 2YV5A 5A2QE 5A35A 1SBBB 1VQ7A 3S1QB 1YVCA 3FKIH 1HQMC 2DNCA 4C1NK 2XWJB 1TWAB 4GKJL 2MJ8A 3PIO3 1N32L 3J81i 1JJGA 1OXVA 4C3JH 3S16B 4CDCC 3WOFA 2NTSA 3S2HH 1QNUA 3CCSA 2DNEA 1W3SA 5KEEA 4JI4L 2ATWA 4NW2A 4JPBW 2QILA 3MVVA 1V8QA 2ID0A 2E2HB 1G6PA 5JEAJ 1VQLA 4B3RL 1SNMA 3MFGA 4Y52H 3ULLA 1RODA 4LUVA 1NR4A 1DOLA 4RH6A 4A3IG 3EROA 1JWSD 3AFPA 2UXDL 3IRBA 2A69C 4OO1I 1RL2A 1U4PA 1I5FA 2PI2A 3W1BA 4Y7NB 5DNFA 2B63G 1HXYD 4DR7Q 1TIID 5GROA 1GM5A 4BY7B 5FLMG 4FXGC 1LT5D 3D31A 4QMGA 4DV0Q 1UUPA 3V96A 4I65A 3LWUA 1L2FA 4DAYA 1JWUD 2HIVA 4UPAA 2JA8B 3NXWA 3HKSA 2JXMB 1CZGA 1O7LA 4ZKCB 4IO9A 1Y1WB 2JA5H 3QG1A 4J6HA 5IT9E 1F77A 3T13A 4K8IA 4P73A 4KHPQ 5J39A 2B8FA 3K7UC 2OEOA 4X3SA 3BG3A 3BJUA 2KBNA 4DAPA 3PIPA 4DR6L 5IE8A 3CC7A 4IFDG 2UXBQ 2Q8IB 3TEHB 3DWAA 1NCVA 2KENA 1F2YA 4JI3Q 1DYQA 5HURA 3A74A 2OWOA 5FKAC 3CCJA 2N8NA 1Z6HA 1K8OA 2E2DC 2B39A 2K6AA 2Z1CA 1ESFA 2F0TA 3JAME 4JI6Q 3S1RB 3F2CA 1DXMA 5GADC 4MTKA 2HHHL 3K57A 4N9TA 4A3BB 2OTJA 3HOYB 4JG2A 1U4RA 4HJ7A 3I4OA 3I7FA 1DZ1A 1TXYA 5L37A 1TWFH 1IHZA 5C5MA 3VR4A 4GOPB 1B4OA 1ESRA 4JBJA 2UUCQ 5LL6S 1BNZA 5A2QL 2VY3A 1HH2P 5GAGC 2I07B 3S17B 4DK0A 1EWHA 1GHJA 1EY5A 1NR2A 4IQZA 3K81C 4X65L 2Z0SA 2AWOA 2Z9HA 4DNIA 1DM0B 1C8CA 4OWTB 1PRTC 1TWHB 3QWNA 1HR0W 3I4MG 2K5WA 2R7FA 4DA2A 2M9VA 3L9AX 5EPKA 3V05A 5C4JH 3R2TA 3KLWA 3FRPB 4YCUA 5E4XA 1I4PA 1A2TA 4OGQC 1EY4A 2WB1E 1JB7A 3BS1A 2EY6A 2R7ZB 2YYZA 5IOCA 2NVQH 1X3GA 2ZTCA 3DWPA 4ZLTF 3NTKA 3A8IE 1PH5A 1B70B 2EXDA 3AQQA 2K5HA 4ZRZA 3I90A 2L5TA 2M00A 4MIUA 2QKIC 1F2MA 2NUCA 1ZYRC 1NE3A 3Q6SA 4BBRB 4O2DA 1CQFA 3DHQA 1I4HA 3MXNB 4RG1A 1KLUD 4A3EG 3AU7A 4XIGS 1WCMB 4IJLA 4EX5A 5IT9L 3HOZB 3PF4A 2K5QA 2A5HA 1AFPA 3K5LA 4WRDA 1PZID 1XTCD 5H1SE 1Y1VH 2E74C 1EYCA 5IY0A 1LT4D 3SEBA 1MJCA 3SK4A 2F0JA 4I7AA 1KNAA 4FO2A 1UNSA 2K50A 4JI5L 3S16H 2LXJA 1S5ED 3ONAB 1HJPA 2SNSA 1QG7A 2WINB 2F0IA 1W2BA 4O0AA 1B3QA 4OIJA 1M90C 4GN3B 3OPOA 5AJ3Q 1Q7YC 2E2HH 2AQ1B 1B50A 4DXGA 3JAML 3E3XA 1ILQA 2G9HD 3UDFA 3MXGA 3J7A5 5M5WB 2K01A 1NUCA 2IY5B 3X3MA 2A1AA 2J0TD 1GD7A 4JW0A 3KLSX 4ZK9B 4X62L 2AUKA 4Y7NH 4G7ZC 2K14A 3FVQA 4MHEA 4BY7H 4C3HB 3IAYA 1EZ6A 1EEFD 1AW7A 3RNUA 1JR0D 3HOVB 4BY7G 4JYAL 1J5EL 3V2TA 4A76A 3FDTA 1U0LA 1BVSA 3SE0A 1ENFA 1TWGB 1Y1WH 3G71A 2JA8G 4X6AH 3I8ZA 1TVXA 4IUPA 4YY3L 2H5XA 4JI0L 3E5SA 3C46A 4K0KL 1SNCA 2F0EA 2BH8A 2LKVA 3P1HA 3HRZC 4A3FB 3BU2A 1QJOA 3HOXB 4DV7L 1FNUA 4A3LH 1PH3A 2IJ0A 4GOPC 2EY5A 3CMEA 1JICA 5FO7B 3BVGA 3R2IA 2IWHA 4IUVA 4A3LG 1WOCA 4L5RC 2DUDA 1JOQA 3C2PA 1RDPD 4P2CB 4N8FA 4R8NA 1I6HB 4QJFA 2BH2A 3E0JA 4QUCA 5I6WA 1B9NA 3S1RH 5DM73 4LF4L 2BDNA 4POFA 4BA2I 2BE5D 2UUAL 1GJXA 1I50B 5M9OA 4A3BH 4HIMA 1NJIC 1V1PB 2Z8LA 4EQOA 1XNQL 3HOYH 1PH1A 3BYYB 2MO1A 1STGA 4A3BG 3HOYG 1O7ZA 5G3LF 5CBEE 5IP9G 4NDXA 4EQ5A 1XPOA 1NSNS 1N33L 1HA6A 1LUZA 4H0LC 4QGUA 3WWVA 4UY8C 3T4AC 2MQHA 3GTOB 3S17H 1IYJB 3W5OA 1PTOB 2A68C 4ZYSA 3J7AV 4QF4A 2E5LQ 1H9SB 1QE6A 3NK9A 3TP5A 1TWHH 1SLJA 3CF5A 1HR0L 4OO1H 4A3KB 1XNRQ 1A2UA 2RHQB 3NTIA 4HCEA 4BWGB 2IL8A 1X3PA 1GUNA 3DM1A 2I0QA 2X69A 2D5DA 4GLXA 5C6AA 1UE1A 3M9BA 5LHY1 2RBMA 2PPBC 3GTKH 1BUVT 1M4VA 1WYDA 5E4WC 1HZCA 2A6ED 5JPMC 2JE6I 4IUUA 4EQNA 4IZ8A 1Y14B 5FO9B 1JWMD 3A0JA 2VXWA 2R7ZG 2R93G 2NVYB 1R4PB 3QB3A 3IFDA 2ZM6L 2QEXA 1JJ2A 3KLSA 1HA5A 5ELCA 1XMOL 2N78A 4IFDI 4LNQA 1L0YB 2F0DA 1SYBA 3M4YA 3MXNA 5C4XH 5I9OA 1WCMH 4XYQA 4BBRG 4PMWA 3NBHA 1QVFA 3HOZH 4HMIA 2Z6KA 3CPWA 3CCRA 4K8JA 2EDGA 4LFCQ 3I91A 4QB4A 1DJRD 2L1BA 1EIGA 3HFZB 1SN8A 4QY7A 5M5XB 3MC0B 2EXZA 2EYMA 1N34Q 5C5LA 5GQOA 3SR1A 2F3WA 3AMUA 3KDFA 4DV1Q 1Q46A 4K6DA 2ZTEA 4L5SA 5IGGA 5IYCH 5IIFA 2R6GA 2ZXRA 4RHSA 3GO5A 3K6OA 3KJPA 1CKMA 1N8RC 3TDQA 5E3FA 1HTPA 4RKBA 1JQYD 2PNHA 3MHBA 4X66Q 4LF6Q 2MPMA 3TN2A 5IYBG 4V0BA 1VQDA 4GNXC 1VS0A 5M5WH 1SYFA 4A3DB 5D65A 5IWAL 4YHHL 2F03A 1H9MA 5EJWA 3RD4A 3QO2A 3EQLC 3LGJA 4S3SA 4A3IB 1HHVA 4C3HH 3RZDB 3ULPA 1YHBA 1EOVA 1Q8KA 3HOVH 4RCNA 5IODA 2WFWA 3MXUA 2R61A 4OX9Q 4GZYC 1WI5A 2B63B 1Q90A 1U9RA 4IURA 2ASBA 1VMPA 1RTNA 2FXQA 3G48A 3CMAA 3G6EA 1TWGH 1PZJD 1J9OA 4J15A 1JB3A 2K5VA 1STAA 1I6VC 1TS4A 4DNRB 1HNWQ 4ILWA 4A3FH 3RLFA 3HOXH 3Q23A 4X64Q 4Z9CB 3OMCA 4KMUC 5ELDA 3JAMc 2A19A 1DCZA 4B3SQ 4G7HC 5I2XA 1EY6A 1L0WA 3WOEA 4DR2L 4K2KA 2K03A 1HFNA 1SRUA 4X3TA 1B3AA 1HNZL 1I6HH 1YBYA 1PTOC 3UI2A 2YTXA 4JC0A 4CHTB 4KV6A 2UXCL 1K8GA 1ENCA 2QDLA 2VZAA 3WDNA 1RF2D 4IUNA 4LF9L 4XQQA 1TS5A 1I50H 1S72A 1V1PA 3D8GA 3FMCA 4DV2L 1STYA 3CQZB 4QQBX 5J22A 1XMQL 4Q0FA 2BCOA 5C3EB 4FF1A 1QB5D 1OO9B 2UUBQ 3A7AB 2YU9H 4IOCA 5IGFA 5CV6A 1P8LA 1GVPA 1NBWA 3KF8B 1N36Q 2F0FA 2L55A 3GTOH 2EJFC 1I4QA 3P7JA 1B8AA 5CV8A 1BKBA 1PH6A 5M3MH 1T5EA 3A5ZB 3BZKA 3TP8A 1VDZA 1R9TB 3P75A 3CC2A 4LUZA 1EY7A 1T9HA 3J80i 2FINB 1PFNA 4A3KH 2K1BA 1N9WA 1O80A 4DGZA 4HSPA 1IKLA 5I6YA 1LTSD 4LF8L 4UP8A 1PTOD 3OTOL 4JI1Q 2F4VQ 4IPHA 2F0PA 5IYDG 3I4MB 2V1CC 3SHLA 5K36H 3M4OB 4DV5Q 3ERQA 2RA4A 1X9NA 3M85A 1Q1EA 4XQNA 2AQ3B 1PH7A 1QVCA 3DLLA 1EU4A 4LF5L 4K14A 4C3IG 2GVBA 1TWCB 2NVYH 2XGTA 3VYUA 1B9MA 5GAEC 1GHKA 3BDCA 4RMFA 3GV6A 4DN4M 3DM3A 5CGKA 3U9SA 4BXXH 1L0XB 1QZHA 4DF7A 5GAHC 1SROA 1S4ZA 2NWGA 2G9DA 2GVAA 1NMFA 1EFWA 4TVAB 1HNXL 1LACA 3S14B 3E9HA 5M5XH 4JI7Q 3STBD 5M3FH 4DUYQ 2L4NA 1A3TA 1ZXTA 2CWAA 3OIQA 4DR3Q 2DN8A 1TY0A 3PIOA 3VR6A 4B3TL 1G91A 1KQSA 2D0OA 4MNOA 2SEBD 4G7OC 4MN3A 4ZUJA 5HY6A 1XXGA 3PUVA 4FXDA 3NELA 1IW7D 2VUMB 1KDAA 2QF7A 1IBML 2OXPA 1CA6A 2B2VC 2K33A 4ZUIA 1E2WA 3RN5A 4R8IA 4A3DG 3T1YQ 3U50C 2LFNA 2XRQD 4A3IH 1L1OC 2MNAA 3RZDH 4HSVA 4OONA 1EIYB 4TSSA 1WTXA 1PFBA 2ES2A 1ET6A 4HIDA 1IZ6A 4K2LA 1S5FD 1TU2B 1LO5D 2B63H 3TS2A 5FLMH 1B53A 4DV4L 4DR7L 4K5XA 4RWSC 5J1ZA 1I4GA 4JI4Q 2VB3X 2CVRA 4OWXB 1B44D 4K5WA 4NXNQ 4B3RQ 2E76C 5KNCA 1VQBA 4LAAA 1CZWA 5J3BA 2Q8TA 1XPRA 4WJ3M 1QWYA 4ALPA 1U4MA 1LABA 4JK1C 4HR7B 1G8ZD 3I4NG 1OTCA 2B29A 3GDEA 3GP7A 1JJCB 4KY6A 3HS0C 1A3VA 3B6YA 4IFDH 2L0CA 4CGYB 1JC7A 5KIXA 4CDEC 2JEBI 2KHSA 2KQ3A 3ITPA 3RLOA 2VQEQ 4U68A 2FFKB 2BA0A 2PYKA 4DR1Q 4BS9A 4LJZC 2RDFA 4DUZL 4DR5Q 5IP7G 2A69D 5EKLA 3MEFA 4DK6C 1JCKB 1MGSA 1LV9A 1SYGA 1F2ZA 5C3EG 1PA6A 4DR6Q 1VQKA 4IJHA 2XSCA 2PNRC 3KF8A 4GKKQ 3K8AA 3NQTA 3F2DA 2F52A 2QGQA 4PZ6A 2K5DA 4WFN3 1J8IA 4YWMA 4RFBA 4NPSA 4KK7A 3PIP3 3TSSA 3H94A 1EWIA 1RKNA 2RF4A 1U5KA 1Y8PB 2L11A 4JOIC 3BVZA 3H91A 3HOWB 2JA6B 1A0IA 5HGQA 2HHHQ 1HCZA 1Q12A 2JQOA 3NEMA 1VQMA 3GTGB 2KA7A 3CCLA 1QOHA 2PQAA 3MTSA 3KBGA 1LLRD 1EIFA 5AFWA 3I4MH 2OCEA 1D5XC 3PO3G 3NPPA 2NZOA 3S1NH 2B2TC 3K5MA 3NP8A 2NVTH 4H44C 4I7ZC 3QR8A 3W3AA 5KYIA 2X6GA 2F3IA 1BF4A 3RN2A 4N8X1 1SYDA 1VQNA 2RQXA 3PUZA 3ERSX 3GTLB 2R93B 2EQSA 4M1UB 4X65Q 2VNUD 2IX0A 4J1MA 4L63B 2EJMA 4EGVA 1QUQA 1EFID 2EVBA 1KL9A 2HUGA 1Y8NB 1ENAA 4FDBA 5NUCA 1SNOA 3S14H 4UHVA 3Q22A 2QCPX 1VQ5A 4A3EH 5CV7A 4A3GG 4X3KA 3CCMA 3GTQH 4FVMA 3K5NA 2O5JC 2K7VA 3F2BA 4JI8L 1VQGA 1UE7A 1E24A 2P5ZX 1KLGD 4R4CA 3PMFA 3CP0A 5JEAH 3VA5A 1YNNC 3FP9A 3S1QH 1SE3A 2EYOA 3QOLA 4IUQA 5JEAG 2K4KA 3A5UA 1TWAH 2X6LA 2MP1A 2VUMH 5DEHA 1PRTD 1CKNB 1O7IA 2O4XA 1PDQA 1FGUA 2VUMG 4MZ9A 2KUMA 1EU3A 2RCNA 4B3ML 3D6CA 1K3RA 5AJ3L 3T1HL 1K3BC 1FJGL 1UAPA 1C48A 3OMGA 1VQEA 2ALYB 5EBDA 1PMRA 3EA6A 1VQ8A 1NY4A 2L12A 1XX8A 4JI5Q 1AZQA 2RKSA 1G2SA 2EY1A 3NQIA 4JV5Q 2AWNA 4N9PA 1G51A 1ZYRD 1SE2A 1SDFA 1OXTA 3PSIA 2AQ2B 2EJGC 2XIWA 1FL0A 2MGSA 4DK1A 1Z9FA 2JA8H 1K73C 3TP7A 4JI2L 2I5HA 1IBKQ 2C9OA 1SYEA 4X62Q 3TS0A 1C4QA 2WKDA 4GNXB 1KRTA 1FNWA 3OHXC 4DAMA 4KI0A 2KOLA 1PHJA 3MWYW 3SXHA 4YCWA 3HZXA 3DEPA 4KLKA 3RR5A 3VYTA 2IX3A 2YTVA 3OIPA 1PYSB 1RIPA 3OWEB 1FD7D 3M7NA 2D9UA 1RHPA 4JI0Q 3GD7A 1AEXA 3VR5A 4DK3C 4K0KQ 3K0XA 3N52A 4DV7Q 2F0LA 3J7ZC 1X6OA 1VQ6A 1X3QA 1A8VA 5IP9H 4PQXA 4C56C 3CC4A 2R7DA 1XJVA 5T1GA 4GOPA 3LX0A 4LF7L 5LMNQ 1KABA 4L6TB 4LF4Q 3HOWH 1D5MC 4R9WA 3R8BA 2JA6H 4HAEA 2I5MX 1IKMA 4A4IA 1K0SA 3GTMB 2Q2IA 1TT2A 3HOWG 3ICEA 4B9WA 2JA6G 4IOAA 4PMBA 3J81E 1VQOA 1M8AA 2N88A 1X3FA 5JOBA 2HIXA 2NB0A 1KIXA 3H0GB 3NSWA 5I2YA 1M1KC 2SNMA 4DV6L 1N33Q 3MA2B 1UEBA 1YHQA 1I94L 2IHFA 4R4OA 4CBVA 3L7ZC 1F9PA 3EBEA 3MZ5A 1RD9D 5KNBA 1JORA 3AFQA 2E2JB 5BR8Q 1WTPA 2F0GA 2TMPA 1PZKD 4A75A 4C3IB 2R7ZH 4LFAQ 2R93H 4RKLA 5FO8B 1KDCA 2LS01 5D3IB 4HMJA 3GTJB 4CJ2C 2HCIA 1HR0Q 1SNDA 1ET9A 4YCVA 2Q2TA 1MJEA 3KFUA 1SNPA 4BBRH 4F8MA 3NWTA 2B2YC 2PZWA 3LNNA 3MAQA 3HGBA 2PMZB 4BA1I 4F7XA 4F88A 1WVLA 2A68D 3BVMA 2JEAI 4R4IA 2F0UA 1K0RA 3VDYA 3HEJA 1CKNA 3PQIA 3PGZA 3JAMi 4CDFC 3GV3A 4OHJA 2NZ1D 1ZKOA 2WAQB 3L3OC 1PH9A 4WJ4A 5IYBH 4OELB 2WIIB 3K59A 2K75A 1VQAA 4X66L 4YWLA 3ER0A 5C0XJ 4C1NI 1RJTA 2JYOA 2Y0SB 1K8MA 1LTBD 2EYHA 1TR5A 2HCCA 1OXXK 3S24A 5EKIA 2EYPA 4L5TA 4A93B 1TS2A 5D3DA 1H9JA 5ISRA 5CMDA 2QA4A 1SEBD 3A55A 4WORA 4KN7C 1CHPD 4ME3A 3RMHA 2QDBA 2JA7G 2F1MA 2N49A 1E1TA 1TY2A 4GN4B 3W2DA 2A6HC 3H15A 2PZTA 3U4VA 2XRSD 4KN4C 1VCIA 1SMXA 2WKCA 5FJ8G 4APVA 5IWAQ 1YNXA 4YHHQ 3NENA 5LMUL 3UDGA 1FNVA 3EFXD 3J81L 1X55A 4GNXA 1GO3E 1UWVA 3I70A 3K5OA 1SE4A 4DV3L 3OW2A 3CCQA 1SJHD 4O42A 5T1IA 1GXDC 3I2ZA 3I4NB 4X64L 3K7AB 1C9OA 3J7AF 1HZBA 1LTID 1L1OB 1SE8A 3S9WA 4A3MG 4B3SL 4HN7A 1B7YB 3HP3A 1EUJA 1Z7TA 2CWPA 2O5IC 1KAAA 1E1OA 1VQPA 1HQRD 4OXPA 4P75A 4AQYL 1AH9A 2B8GA 2KEEA 3T53B 3RUZA 1EYGA 5F2DA 2JA5B 3PV0A 2WV6D 3CHBD 2XNAC 3CCVA 2OF1A 2RDHA 2KCMA 2BA1A 2UU9Q 2A6HD 4EVOA 1AZPA 1DOMA 1PLFA 2NYZD 2HDMA 4OL7A 4DR2Q 2UUBL 3EVQA 1BCPB 3A56A 1BOSA 3TREA 4B08A 5ELOA 2D0PA 5KNDA 3HOUB 1A63A 2I5LX 3BZDB 1HFGA 1N36L 4PZ8A 4LF9Q 1Q3LA 1PTOH 2HQLA 5EGTA 1EQQA 3GTPB 4DPGA 4LFBQ 4HJ5A 1XMQQ 1H9SA 2RSNA 2XTIA 2CH4A 2LXKA 3D4DA 4OWWB 3BDLA 2CKZB 3H0GH 2E75C 2NTTA 1LT3D 2EZVA 4XYOA 4PMCA 2KCNA 1B2TA 3KOJA 3H0GG 5IYDH 1PYBA 1E2ZA 3PF5A 1VQFA 4NB3A 1DOKA 3QJYA 1Q86C 3PO3B 5HGTA 4QCLA 4U673 2H1EA 4E6IA 4DV5L 2A74C 2CH4W 1QVGA 4C3IH 3SDZA 1AE2A 1YJNA 1JMCA 3GTJH 1AN8A 1IYUA 3ZJYC 2CW0C 3A54A 1PVOA 3UE1A 5LL6X 4FXKC 4LWCA 1ICFB 1NMGA 3C1EA 3OTOQ 1KD1C 1Q81C 3T16A 3E6ZX 5JJLA 1IBLQ 2IPKD 2XVSA 4P72A 1VMCA 1BO0A 2ICIA 1LTAD 4HEDA 1V43A 1MSGA 4LUOA 4A3GB 2DGYA 2L9HA 1YEZA 1CM9A 5JJKA 2QEJC 4BY1G 4DKAC 5TSSA 4JI7L 4YWKA 4CDDC 1U4LA 1Y69U 2NBFA 4DUYL 5C0XG 1X65A 3OW7A 3TRZA 1QILA 3M4PA 4DR3L 3OOCA 2NVQB 2JA9A 4XT1B 3AB9A 3TP6A 2IX1A 2OTLA 4KHVA 3F2UA 2V4DA 3F1ZA 5JVH3 2IT1A 4DR4Q 1FR3A 2WAQG 1A3UA 1DGSA 1VF5C 3NBIA 4GLAC 1IL2A 1KC8C 2J7ZA 1LT6D 1OXSC 2D2CC 5JPNC 2VQFQ 4HIOA 2CW0D 4A3DH 1EOTA 2M2LA 2Y0SG 1CTMA 4R4TA 4NXMQ 2JN4A 4B3TQ 4AH6A 4A93G 1Y1VB 4FNFA 3DMUA 3NHHA 5EPLA 1I4RA 4H7BA 4A3JG 4GKJQ 1MKHA 2KEDA 1IBMQ 1N32Q 3FKIG 2TSSA 1X3EA 2SOBA 3I73A 4ULLA 5FLXE 5C4HA 2NVXB 5DM63 3K0YA 4K5VA 2GA4B 4KY7A 4C3JG 2Q2HA 1ML0D 3IL8A 4WJWA 2O2LD 2N55A 4H02A 4DV0L 2B2VA 4NXNL 1PRTF 4AYBB 3T51B 3O13A 2HT1A 3I3CA 1CI3M 3CRKC 3AEVA 2KHJA 3K7AH 4R4QA 1BCPC 3R93A 3I4NH 2UXDQ 1D2BA 3CD6A 1L1OA 3JC66 4P71A 4KJOA 5JAVA 4HJ8A 2G5DA 1H95A 5CC4A 3CCEA 2PMZE 4DV4Q 3OYYA 1I3QB 1G291 1RCVD 2AKWB 3I72A 4KHPL 3I56A 2EYJA 2AUJD 5C3WA 1BDOA 2UXBL 3D4WA 1DONA 4JBWA 3ULJA 4RA8A 2VQEL 5EKKA 4JI3L 4M8AA 4DR1L 5IP7H 1DD2A 4A3CH 5M5YB 3CQZH 4KKTA 3EN2A 4DR5L 1IYVA 2F0NA 1X54A 3A8KE 2WAQE 5C3EH 4GS3A 5COYA 2JA5G 4A3CG 1T5XD 4EQPA 4JI6L 2WB1G 5FK9C 2VW9A 3J81c 4V190 3A8JE 2Y0SE 3HOUH 3S15B 4GKKL 1YI2A 1VQ4A 3TBIB 4XT3B 1W6KA 4HIKA 3CCUA 3HOUG 3H3VI 3GTPH 3L2PA 1QCBD 5JJZA 1JE4A 4DNTB 4DUZQ 1SNQA 1BR9A 1R9TH 3QOJA 4HJAA 1BCPD 4F87A 1OXUA 5LMNW 1EYAA 1HUMA 2UUCL 2HQEA 1SR3A 4PZ7A 5K5PA 1EQRA 1WTQA 1YJ9A 1KHIA 5IGDA 1WTWA 3UDXA 4ME5A 2BDOA 3PO3H 5C44B 4L5QA 4XTCS 2LY7A 2HDLA 1D5ZC 1IXRA 3M4OH 3VR3A 2FJ2A 1F9QA 2LMCB 3SVMA 2J4XA 2FMCA 3ZYYX 5KYLA 2VB2X 2EE1A 5CV4A 3NUCA 1ASYA 1MIUA 2XN9C 1TWCH 2CCZA 4H13C 4TKOB 3A7LA 1EEID 1EZ8A 3KBXA 2DJGC 3D4RA 4XDXA 2PI2E 2DJFC 1YITA 1E3PA 5IGCA 1NAPA 1CFMA 2EYLA 5FLXL 1STNA 4JOIA 5CR3A 2EIFA 1PH2A 4FYDA 3DUZA 4Q5VA 1SJED 1Q82C 4RGMA 2XWBB 1EL0A 3Q0AA 1PFMA 1TS3A 4YIJA 4A3GH 2R3ZA 4AIMA 3FPUB 4IUTA 3GTKB 2B2TA 4UAIA 2KCTA 3CPFA 1CKOA 1YNJC 4FF2A 1LTGD 4QIWB 1X32A 1HPCA 1AE3A 2NN6I 1S3OA 3KYHC 1BBXC 4ZAIA 4XQJA 4GN5A 1F2LA 1VQCA 1YHAA 3L0OA 1X56A 1YIJA 4ABNA 4C2MB 4HCSA 5C4XB 4JI8Q 3CW2C 2DY7A 3NBHB 4NMZA 1MD2D 2GN5A 1WTHA 1FGBD 4ZKBB 2F4IA 2ZJRA 1S5DD 3TQYA 3P20A 3TZDA 4KD4A 4RAUC 5CV5A 2D62A 1Y1VG 3CXCA 3FPPA 2BOSA 4ZQ3A 2EY2A 3KDFB 3UE0A 2NVXH 1P16A 4JVZA 2JA7B 4JV5L 1YZ6A 4B3MQ 2K32A 1E2VA 3T1HQ 1D8LA 3VYRA 3MXPA 1YNJD 2LSSA 1FJGQ 1AP0A 5DAUA 3SK8A 5C4ZA 1XWEA 3J80E 2Z6BA 4AYBG 2ZJQA 3RLNA 4KTAA 1G6ZA 3SGIA 1YNND 2RSOA 1IBKL 1TKWB 4OEMB 3G6JB 1WTOA 1CSQA 3GQBA 3AYHB 2RCFA 2BE5C 1EIHA 2F0WA 4DAVA 1I3QH 1V1OA 1K8AC 2MFIA 1XPUA 3KJOA 1VQIA 1A6XA 1KXLA 4DU9A 4CJ1B 1LM0A 2B2UC 1K28A 2KVMA 4A3MB 4JYAQ 3G7LA 1F9SA 4HTHA 1J5EQ 1JT8A 4IALA 1STEA 3I55A 1QNKA 2F0MA 4JI2Q 5M5YH 5C0XI 1LTRD 4CKBA 4PG3A 1LTTD 1ONLA 3M4QA 3M3YB 4LMQD 5E7NA 1Y1WG 4YY3Q 1CHQD 3FHWA 1JOKA 1EQVA 2C5CA 2KECA 1MHWC 1SFOB 1II3A 4IPCA 1SXTA 3S15H 1UE6A 1EY0A 1GUOA 2PW5A 2F0OA 3H6MA 4K6LA 1R4QB 3VYSA 1KRSA 4RHRA 3H09A 3M7GA 4HJ9A 2ENBA 2B2UA 2CQAA 1BXTA 2Z4HA 4QUFA 2PW7A 5ELNA 3KK7A 1W6JA 2WACA 5LMNL 4PV1C 3KF6B 2A6EC 3KLRA 3BZCA 1GUSA 2K04A 4NP5A 2UUAQ 2PCFB 1MBYA 4CJ0B 1K83B 2A8VA 3D3RA 3GTGH 1XNQQ 3S2DB 4R1JA 1WTRA 1V9PA 2E5LL 2I46A 5C44H 2ZT9C 2H4OA 2KHIA 3HKZB 1WTVA 3KUPA 4L8JA 2YU9B 2JSOA 5DLQE 4FF4A 5C44G 2JP1A 4AYBE 1XNRL 3VR2A 1KTKA 3T56B 1NNXA 1Y8OB 4LF7Q 1VQJA 3PUYA 1Z47A 4LW1A 3C1FA 5BR8L 2YTYA 4OIKA 4XXEA 1S40A 3MFYA 5M3MB 2RHSB 3PUWA 4LFAL 4IPGA 3GTLH 1A15A 2EYFA 2QW7A 3N6RA 3U9OA 4POGA 3S1MB 2E2IB 1HZAA 2ZJPA 3PO2B 2F0QA 2VL6A 4FP5D 4DV6Q 2NZHA 4BBSB 2F0VA 4QL5A 1I94Q 5CYUA 4JBMA 1E22A 2HD3A 2L15A 4OO1G 5ELBA 2Z6KC 3DEOA 3J80L 1KAWA 1TQOA 1STHA 1JE5A 2MUYA 4RCOA 2R92B 3H3VC 1RTOA 1SAPA 4PNYA 1H9KA 3QIAA 4BY1B 2K05A 2CFMA 4LFCL 4IPDA 1JOOA 1PTOF 2FMMA 3K80C 1MI2A 2ZM6Q 3DXJC 1ASZA 1N34L 3HG9A 1KDBA 2C35B 1XMOQ 3BDOA 4DV1L 1GUWA 1J6QA 3Q24A 3ND9A 4C2MH 4G57A 3E9IA 3U58A 1C0AA 5IGEA 4DFAA 1H9RA 2B3GA 2F0HA 2ZTDA 5FLXc 5C4XG 1IL8A 2CQOA 1WCMG 4KHZA 5CORA 2EOTA 2B2YA 3HOZG 5CBAE 2OT2A 3H3VH 1WJJA 4LF6L 3NTHA 5I9PA 5M3FB 3RZOB 2AHOB 3K58A 4G4KA 2PZUA 1WD0A 2JA7H 1E0BA 1VQHA 2CHBD 1KNEA 3J81j 4UP9A 4A3JB 5JVG3 2ZXOA 3NE5B 1O78A 3SK5A 1ILPA 1EWCA 1BBUA 3FKIB 1EQTA 5D14A 3I4LA 3R3OA 1C7YA 5IYCG 5FJ8H 5ELFA 4J8QA 4OX9L 3CAMA 4C3JB 4KY5A 1G2TA 5BN5A 4RGTA 1D7QA 1FVIA 4NKLA 3D0FA 3PCOB 2Z4IA 3S2HB 5BN3A 1VQ9A 5E1FA 1SYCA 1EY9A 5EPJA 3C3LA 5IT9c 1HNWL 4FF3A 1GUTA 2MHVA 1O7YA 2Q2UA 4C3HG 4A3MH 1QZGA 1D1KA 4TQUS 4UP7A 3TMEA 3HOVG 5IGBA 1D6EC 5KGUA 2JK8A 4QIWE 2F0KA 4P74A 3SK6A 5LMUQ 4RGOS 1WFQA 2WP8J 3M3YH 1EYDA 3CU7A 5I4DA 1D1IA 4CKEA 3EJIA 4DV3Q 3MEHA 4DAYB 1PFSA 1SFOH 5G3LD 3IFTA 4KD3A 1GOZA 1YJWA 2OQ0A
chains in the Genus database with same CATH topology
2NN6H 5C3XA 1CT1D 3PUXA 2Q8RE 2WB1B 2K28A 3CRLC 2NN6G 1GUGA 1B1ZA 1MSHA 2FHTA 4ODGA 1HUNA 3CKIB 2A73B 5FOBB 4KKSA 1EY8A 1SMYC 4UDUC 3BYTB 1Q8IA 4TRDA 2RVLA 2B2WC 2ZXPA 2DY8A 4X3UA 4IFDJ 1VF7A 2PQEA 2F0SA 2IW3A 2F3VA 4KKUA 4ID6A 4B9XA 3FEWX 1SSOA 1UEAB 3X3NA 1TWFB 2EPBA 3ND8A 4RGNA 1CA5A 1PYWD 1F9RA 1S5BD 1ZEQX 2KJXA 5KRUA 2SDFA 4KJNA 1WD1A 4O1NA 2B2WA 3IKJA 1HRJA 5EQ0A 1BCPF 4LK1C 3J7YW 1IW7C 3S1NB 3NWSA 1SMYD 1CQVA 1S5CD 1ICWA 2NVTB 1CK1A 5K36G 2KCCA 1Q1BA 5C0XH 4IN3A 5BN4A 5C4JB 3OSOA 5ELEA 3URYA 1STBA 5CV9A 4CKCA 3LWEA 3D6WA 1I4XA 3VA7A 1XYIA 3TZUA 4A3EB 3DWQA 4DXFA 1PRTB 3GTQB 1BQQT 1FYCA 5EBCA 2PO4A 2RDGA 1HTLD 3OWFA 2ICEC 1PXUA 5A2QE 5A35A 1SBBB 3S1QB 1HQMC 2DNCA 4C1NK 2XWJB 1TWAB 2MJ8A 3PIO3 1OXVA 3S16B 3WOFA 2NTSA 1QNUA 2DNEA 5KEEA 4NW2A 2QILA 3MVVA 1V8QA 2ID0A 2E2HB 5JEAJ 1SNMA 3MFGA 1RODA 1NR4A 1DOLA 4RH6A 3EROA 1JWSD 2A69C 4OO1I 1U4PA 4Y7NB 5DNFA 1HXYD 1TIID 4BY7B 4FXGC 1LT5D 3D31A 4QMGA 1UUPA 3V96A 4I65A 3LWUA 4DAYA 1JWUD 2JA8B 3NXWA 2JXMB 1CZGA 1O7LA 4ZKCB 1Y1WB 3QG1A 4J6HA 5IT9E 1F77A 3T13A 4K8IA 5J39A 2B8FA 2OEOA 4X3SA 3BG3A 4DAPA 4IFDG 2Q8IB 3DWAA 1NCVA 1F2YA 1DYQA 5HURA 5FKAC 1Z6HA 1K8OA 2E2DC 2B39A 2K6AA 2Z1CA 1ESFA 2F0TA 3JAME 3S1RB 1DXMA 3K57A 4N9TA 4A3BB 3HOYB 1U4RA 1DZ1A 1IHZA 5C5MA 3VR4A 1B4OA 1ESRA 5LL6S 1BNZA 5A2QL 2I07B 3S17B 4DK0A 1EWHA 1GHJA 1EY5A 1NR2A 4IQZA 2AWOA 1DM0B 1C8CA 1PRTC 1TWHB 3QWNA 2K5WA 4DA2A 2M9VA 3L9AX 5EPKA 3V05A 3R2TA 3FRPB 5E4XA 1I4PA 1A2TA 4OGQC 1EY4A 3BS1A 2EY6A 2R7ZB 2YYZA 5IOCA 3DWPA 4ZLTF 3NTKA 3A8IE 4ZRZA 3I90A 2L5TA 2M00A 4MIUA 2QKIC 1F2MA 2NUCA 1ZYRC 3Q6SA 4BBRB 1CQFA 3DHQA 1I4HA 1KLUD 3AU7A 4XIGS 1WCMB 5IT9L 3HOZB 2K5QA 2A5HA 1AFPA 3K5LA 4WRDA 1PZID 1XTCD 2E74C 1EYCA 1LT4D 3SEBA 3SK4A 2F0JA 1KNAA 4FO2A 1UNSA 1S5ED 3ONAB 2SNSA 1QG7A 2WINB 2F0IA 4OIJA 3OPOA 2AQ1B 1B50A 4DXGA 3JAML 1ILQA 2G9HD 3MXGA 5M5WB 2K01A 1NUCA 3X3MA 2J0TD 3KLSX 4ZK9B 2AUKA 4G7ZC 4MHEA 3FVQA 4C3HB 3IAYA 1EZ6A 1EEFD 1AW7A 1JR0D 3HOVB 3V2TA 3FDTA 3SE0A 1ENFA 1TWGB 3I8ZA 1TVXA 4IUPA 3E5SA 3C46A 1SNCA 2F0EA 2LKVA 3HRZC 3P1HA 4A3FB 1QJOA 3HOXB 1FNUA 2IJ0A 2EY5A 1JICA 5FO7B 3BVGA 3R2IA 2IWHA 4IUVA 1JOQA 3C2PA 1RDPD 4P2CB 4R8NA 1I6HB 3E0JA 4QUCA 5I6WA 1B9NA 5DM73 4BA2I 2BDNA 2BE5D 1GJXA 1I50B 5M9OA 1V1PB 2Z8LA 4EQOA 3BYYB 1STGA 1O7ZA 5G3LF 5CBEE 4NDXA 1NSNS 1HA6A 4H0LC 3T4AC 3GTOB 1PTOB 2A68C 4ZYSA 3J7AV 4QF4A 1H9SB 1QE6A 3NK9A 3TP5A 4OO1H 4A3KB 1A2UA 3NTIA 4HCEA 4BWGB 2IL8A 1X3PA 1GUNA 3DM1A 2X69A 2D5DA 5C6AA 5LHY1 2RBMA 2PPBC 1BUVT 1M4VA 5E4WC 2A6ED 5JPMC 2JE6I 4IUUA 4EQNA 4IZ8A 5FO9B 1JWMD 2VXWA 2NVYB 1R4PB 3QB3A 3IFDA 3KLSA 1HA5A 5ELCA 4IFDI 1L0YB 2F0DA 1SYBA 3M4YA 3MXNA 5I9OA 4XYQA 4PMWA 3NBHA 4HMIA 4K8JA 2EDGA 3I91A 4QB4A 1DJRD 2L1BA 1EIGA 5M5XB 3MC0B 2EXZA 2EYMA 5C5LA 3SR1A 2F3WA 3AMUA 4K6DA 5IGGA 5IIFA 2R6GA 2ZXRA 4RHSA 3GO5A 3K6OA 3TDQA 5E3FA 1HTPA 4RKBA 1JQYD 3MHBA 2MPMA 3TN2A 4V0BA 1SYFA 4A3DB 5D65A 2F03A 1H9MA 5EJWA 3RD4A 3QO2A 3EQLC 4S3SA 4A3IB 1HHVA 3RZDB 4RCNA 5IODA 3MXUA 2R61A 4GZYC 2B63B 1Q90A 1U9RA 4IURA 1VMPA 1RTNA 1PZJD 1J9OA 1JB3A 1STAA 1I6VC 1TS4A 4DNRB 4ILWA 3RLFA 3Q23A 4Z9CB 3OMCA 4KMUC 5ELDA 1DCZA 4G7HC 5I2XA 1EY6A 3WOEA 4K2KA 2K03A 1HFNA 4X3TA 1B3AA 1PTOC 3UI2A 4CHTB 4KV6A 1ENCA 3WDNA 1RF2D 4IUNA 4XQQA 1TS5A 1V1PA 3D8GA 3FMCA 1STYA 3CQZB 5J22A 4Q0FA 2BCOA 5C3EB 4FF1A 1QB5D 1OO9B 3A7AB 5IGFA 5CV6A 2F0FA 2L55A 2EJFC 1I4QA 3P7JA 5CV8A 1T5EA 3TP8A 1VDZA 1R9TB 3P75A 1EY7A 2FINB 1PFNA 2K1BA 1O80A 4DGZA 4HSPA 1IKLA 5I6YA 1LTSD 1PTOD 2F0PA 3I4MB 3SHLA 5K36H 3M4OB 3ERQA 2RA4A 3M85A 1Q1EA 4XQNA 2AQ3B 1EU4A 4K14A 4C3IG 1TWCB 3VYUA 1B9MA 1GHKA 3BDCA 3GV6A 4DN4M 5CGKA 3U9SA 1L0XB 4DF7A 1S4ZA 2NWGA 2G9DA 1LACA 3S14B 2L4NA 1A3TA 1ZXTA 3OIQA 2DN8A 1TY0A 3VR6A 1G91A 2SEBD 4G7OC 4MN3A 4ZUJA 1XXGA 3PUVA 4FXDA 1IW7D 2VUMB 1KDAA 2QF7A 2OXPA 1CA6A 2B2VC 2K33A 4ZUIA 1E2WA 4R8IA 2LFNA 2XRQD 4HSVA 4TSSA 1WTXA 1PFBA 1ET6A 4K2LA 1S5FD 1TU2B 1LO5D 1B53A 4K5XA 4RWSC 5J1ZA 1I4GA 2VB3X 2CVRA 1B44D 4K5WA 2E76C 5KNCA 4LAAA 1CZWA 2Q8TA 1QWYA 1U4MA 1LABA 4JK1C 4HR7B 1G8ZD 3GP7A 4KY6A 3HS0C 1A3VA 4IFDH 2L0CA 4CGYB 1JC7A 5KIXA 2JEBI 2KHSA 2KQ3A 3ITPA 4U68A 2FFKB 2BA0A 2PYKA 4BS9A 4LJZC 2RDFA 2A69D 5EKLA 1JCKB 1MGSA 1LV9A 1SYGA 1F2ZA 2XSCA 2PNRC 3KF8A 3NQTA 2K5DA 4WFN3 1J8IA 4RFBA 4KK7A 3PIP3 3TSSA 3H94A 1RKNA 1Y8PB 2L11A 3BVZA 3H91A 3HOWB 2JA6B 1HCZA 1Q12A 3GTGB 2KA7A 1QOHA 3MTSA 3KBGA 1LLRD 5AFWA 1D5XC 3NPPA 2B2TC 3K5MA 3NP8A 4H44C 4I7ZC 3W3AA 5KYIA 2X6GA 1BF4A 1SYDA 2RQXA 3PUZA 3GTLB 2R93B 2VNUD 4M1UB 2IX0A 4J1MA 4L63B 2EJMA 4EGVA 2EVBA 1EFID 2HUGA 1Y8NB 1ENAA 5NUCA 1SNOA 3Q22A 2QCPX 5CV7A 4X3KA 4FVMA 3K5NA 2O5JC 2K7VA 1KLGD 3PMFA 5JEAH 3VA5A 1YNNC 1SE3A 2EYOA 3QOLA 4IUQA 5JEAG 2X6LA 2MP1A 5DEHA 1PRTD 2O4XA 1PDQA 2KUMA 1EU3A 3D6CA 1UAPA 1C48A 3OMGA 5EBDA 1PMRA 3EA6A 2L12A 1XX8A 1AZQA 2RKSA 1G2SA 2EY1A 3NQIA 2AWNA 4N9PA 1ZYRD 1SE2A 1SDFA 1OXTA 2AQ2B 2EJGC 2XIWA 2MGSA 4DK1A 3TP7A 2C9OA 1SYEA 1C4QA 2WKDA 1FNWA 3OHXC 4KI0A 2KOLA 3MWYW 3SXHA 3HZXA 3DEPA 3VYTA 2IX3A 3OIPA 3OWEB 1FD7D 3M7NA 2D9UA 1RHPA 3GD7A 1AEXA 3VR5A 3N52A 2F0LA 1X3QA 4PQXA 4C56C 5T1GA 3LX0A 1KABA 4L6TB 1D5MC 4R9WA 3R8BA 4HAEA 1IKMA 3GTMB 1TT2A 4B9WA 4PMBA 3J81E 1M8AA 2N88A 5JOBA 2NB0A 3H0GB 3NSWA 5I2YA 2SNMA 3MA2B 4CBVA 3L7ZC 1F9PA 3MZ5A 1RD9D 5KNBA 1JORA 2E2JB 1WTPA 2F0GA 2TMPA 1PZKD 4C3IB 4RKLA 5FO8B 1KDCA 2LS01 5D3IB 4HMJA 3GTJB 4CJ2C 2HCIA 1SNDA 1ET9A 1SNPA 4F8MA 3NWTA 2B2YC 2PZWA 3LNNA 3MAQA 3HGBA 2PMZB 4BA1I 4F7XA 4F88A 1WVLA 2A68D 3BVMA 2JEAI 2F0UA 3HEJA 3GV3A 4OHJA 2NZ1D 1ZKOA 2WAQB 3L3OC 2WIIB 3K59A 5C0XJ 4C1NI 1RJTA 2JYOA 2Y0SB 1K8MA 1LTBD 2EYHA 1TR5A 2HCCA 1OXXK 5EKIA 2EYPA 4A93B 1TS2A 5D3DA 1H9JA 5ISRA 5CMDA 1SEBD 3A55A 4WORA 4KN7C 1CHPD 3RMHA 2QDBA 2F1MA 3W2DA 1TY2A 2A6HC 2PZTA 2XRSD 4KN4C 1VCIA 2WKCA 1FNVA 3EFXD 3J81L 3I70A 3K5OA 1SE4A 1SJHD 4O42A 5T1IA 1GXDC 3I4NB 3K7AB 3J7AF 1LTID 3S9WA 4HN7A 3HP3A 1Z7TA 2O5IC 1KAAA 1HQRD 2B8GA 2KEEA 3T53B 3RUZA 5F2DA 2JA5B 3PV0A 2WV6D 3CHBD 2XNAC 2OF1A 2RDHA 2BA1A 2A6HD 4EVOA 1AZPA 1DOMA 1PLFA 2NYZD 2HDMA 4OL7A 3EVQA 1BCPB 3A56A 1BOSA 4B08A 5KNDA 3HOUB 3BZDB 1HFGA 1Q3LA 1PTOH 5EGTA 3GTPB 1H9SA 2RSNA 3D4DA 3BDLA 2E75C 2NTTA 1LT3D 2EZVA 4XYOA 4PMCA 2KCNA 1B2TA 1E2ZA 1DOKA 3QJYA 3PO3B 5HGTA 4QCLA 4U673 2H1EA 4E6IA 2A74C 3SDZA 1AN8A 1IYUA 2CW0C 3A54A 5LL6X 4FXKC 3C1EA 3T16A 3E6ZX 2IPKD 2XVSA 1VMCA 1BO0A 2ICIA 1LTAD 4HEDA 1V43A 1MSGA 4A3GB 2L9HA 1CM9A 2QEJC 5TSSA 1U4LA 1Y69U 2NBFA 5C0XG 3OW7A 1QILA 3OOCA 2NVQB 4XT1B 3AB9A 3TP6A 2IX1A 4KHVA 3F2UA 2V4DA 5JVH3 2IT1A 1FR3A 1A3UA 1VF5C 3NBIA 2J7ZA 1LT6D 1OXSC 2D2CC 5JPNC 2CW0D 1EOTA 2M2LA 1CTMA 1Y1VB 4FNFA 3DMUA 3NHHA 5EPLA 1I4RA 4H7BA 2KEDA 2TSSA 2SOBA 3I73A 4ULLA 5FLXE 5C4HA 2NVXB 5DM63 3K0YA 4K5VA 2GA4B 4KY7A 4C3JG 1ML0D 3IL8A 4WJWA 2O2LD 2N55A 2B2VA 1PRTF 4AYBB 3T51B 3O13A 3I3CA 1CI3M 3CRKC 3R93A 1BCPC 1D2BA 4KJOA 5JAVA 5CC4A 1I3QB 1G291 1RCVD 3I72A 2EYJA 2AUJD 5C3WA 1BDOA 3D4WA 1DONA 4JBWA 4RA8A 5EKKA 4M8AA 1DD2A 5M5YB 4KKTA 1IYVA 2F0NA 3A8KE 5COYA 1T5XD 4EQPA 5FK9C 4V190 3A8JE 3S15B 3TBIB 4XT3B 1W6KA 1QCBD 5JJZA 1JE4A 4DNTB 1SNQA 1BR9A 3QOJA 1BCPD 4F87A 1OXUA 1EYAA 1HUMA 2HQEA 5K5PA 1WTQA 5IGDA 1WTWA 4ME5A 2BDOA 5C44B 4XTCS 2LY7A 2HDLA 1D5ZC 3VR3A 2FJ2A 1F9QA 2LMCB 3SVMA 2J4XA 2FMCA 3ZYYX 5KYLA 2VB2X 2EE1A 5CV4A 3NUCA 2XN9C 4H13C 4TKOB 3A7LA 1EEID 1EZ8A 3D4RA 3KBXA 4XDXA 5IGCA 1NAPA 1CFMA 2EYLA 5FLXL 1STNA 5CR3A 4FYDA 3DUZA 4Q5VA 1SJED 4RGMA 2XWBB 1EL0A 3Q0AA 1PFMA 1TS3A 4YIJA 2R3ZA 3FPUB 4IUTA 3GTKB 2B2TA 4UAIA 1YNJC 4FF2A 1LTGD 4QIWB 1X32A 1HPCA 2NN6I 1BBXC 4ZAIA 4XQJA 1F2LA 4ABNA 4C2MB 4HCSA 5C4XB 2DY7A 4NMZA 1MD2D 1FGBD 4ZKBB 2F4IA 1S5DD 3P20A 3TZDA 4KD4A 4RAUC 5CV5A 2D62A 3FPPA 2BOSA 4ZQ3A 2EY2A 2JA7B 2K32A 1E2VA 3VYRA 3MXPA 1YNJD 1AP0A 5DAUA 3SK8A 5C4ZA 1XWEA 3J80E 1G6ZA 4KTAA 1YNND 2RSOA 1TKWB 3G6JB 1WTOA 3GQBA 1EIHA 2BE5C 2F0WA 4DAVA 1V1OA 1A6XA 4DU9A 4CJ1B 2B2UC 2KVMA 4A3MB 3G7LA 1F9SA 4HTHA 4IALA 1STEA 1QNKA 2F0MA 5C0XI 1LTRD 4CKBA 1LTTD 1ONLA 3M3YB 4LMQD 1CHQD 1JOKA 1EQVA 2C5CA 2KECA 1SFOB 1II3A 1SXTA 1EY0A 1GUOA 2PW5A 2F0OA 3H6MA 4K6LA 1R4QB 3VYSA 4RHRA 3H09A 3M7GA 2ENBA 2B2UA 2CQAA 1BXTA 2Z4HA 4QUFA 2PW7A 3KK7A 1W6JA 2WACA 4PV1C 2A6EC 3KLRA 1GUSA 2K04A 4NP5A 2PCFB 4CJ0B 1MBYA 1K83B 3D3RA 3S2DB 1WTRA 2I46A 2ZT9C 2H4OA 1WTVA 3HKZB 3KUPA 4L8JA 2YU9B 2JSOA 4FF4A 2JP1A 3VR2A 1KTKA 3T56B 1Y8OB 3PUYA 1Z47A 3C1FA 4OIKA 4XXEA 3MFYA 5M3MB 3PUWA 1A15A 2EYFA 3N6RA 3U9OA 3S1MB 2E2IB 3PO2B 2F0QA 4FP5D 4BBSB 2F0VA 5CYUA 4OO1G 5ELBA 3DEOA 3J80L 1TQOA 1STHA 2MUYA 4RCOA 2R92B 3H3VC 1RTOA 1SAPA 4PNYA 1H9KA 3QIAA 4BY1B 2K05A 1JOOA 1PTOF 2FMMA 1MI2A 3DXJC 3HG9A 1KDBA 3BDOA 1GUWA 3Q24A 3ND9A 4G57A 5IGEA 4DFAA 1H9RA 2F0HA 1IL8A 4KHZA 5CORA 2EOTA 2B2YA 5CBAE 2OT2A 3NTHA 5I9PA 5M3FB 3RZOB 3K58A 4G4KA 2PZUA 1WD0A 1E0BA 2CHBD 1KNEA 4A3JB 5JVG3 2ZXOA 3NE5B 1O78A 3SK5A 1ILPA 1EWCA 3FKIB 5D14A 1EQTA 3I4LA 3R3OA 5ELFA 4J8QA 4C3JB 4KY5A 1G2TA 5BN5A 4RGTA 4NKLA 2Z4IA 3S2HB 5BN3A 5E1FA 1SYCA 1EY9A 5EPJA 3C3LA 4FF3A 1GUTA 2MHVA 1O7YA 4C3HG 1D1KA 4TQUS 3TMEA 5IGBA 1D6EC 5KGUA 2F0KA 3SK6A 4RGOS 2WP8J 1EYDA 3CU7A 5I4DA 1D1IA 4CKEA 3EJIA 3MEHA 5G3LD 3IFTA 4KD3A 1GOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AEX A;  5CV7 A;  2SNS A;  5IOD A;  4PNY A;  2F0I A;  2F0T A;  2SOB A;  5C3X A;  5C4H A;  3D4D A;  4K14 A;  2F0L A;  3BDL A;  4QF4 A;  4KY6 A;  1EZ8 A;  4K5V A;  1A3V A;  1U9R A;  4KY7 A;  4DU9 A;  3BDC A;  1JOO A;  3NK9 A;  5KIX A;  4N9T A;  3TP5 A;  4PMC A;  5IGC A;  4HTH A;  2EYL A;  3PMF A;  1STN A;  5CR3 A;  2EYH A;  2KHS A;  1TR5 A;  4IAL A;  4ODG A;  2KQ3 A;  3VA5 A;  3ITP A;  1A2U A;  2F0M A;  3OWF A;  1KDB A;  2EYP A;  5CGK A;  5ISR A;  3LX0 A;  1NUC A;  2EYO A;  1STA A;  2PYK A;  3QOL A;  4WOR A;  1EY8 A;  5HGT A;  2RDF A;  1IHZ A;  4YIJ A;  5DEH A;  5C5M A;  4DF7 A;  5C6A A;  1KAB A;  4G57 A;  1JOK A;  2O4X A;  4E6I A;  2RBM A;  2QDB A;  1EQV A;  4KJO A;  5JAV A;  5IGE A;  5EKL A;  4DFA A;  3OMC A;  1EZ6 A;  2F0H A;  4TRD A;  5CC4 A;  1II3 A;  1SYG A;  1TT2 A;  3D6C A;  2PZT A;  4B9W A;  4EQN A;  4IZ8 A;  1F2Z A;  1EY0 A;  4PMB A;  2PW5 A;  2F0O A;  3H6M A;  1EY5 A;  1EY6 A;  5KEE A;  2EYJ A;  1A3T A;  4K2K A;  5JOB A;  3OMG A;  5C3W A;  2PQE A;  3QB3 A;  5I9P A;  3MVV A;  3V2T A;  3C1E A;  2F0S A;  3NQT A;  2ENB A;  2SNM A;  3D4W A;  2PZU A;  2F3V A;  1SNM A;  4KV6 A;  4KD3 A;  3T16 A;  1ENC A;  5EKK A;  2PW7 A;  4ID6 A;  4B9X A;  2F0D A;  3ERO A;  2WAC A;  4IUN A;  4ZUJ A;  3MZ5 A;  1SYB A;  2RKS A;  2EY1 A;  1JOR A;  3E5S A;  3D8G A;  3SK5 A;  2F0N A;  1RKN A;  5I9O A;  4N9P A;  1STY A;  1KDA A;  2F0G A;  4NP5 A;  1SNC A;  2F0E A;  2LKV A;  2OXP A;  3P1H A;  5J22 A;  3R3O A;  4HMI A;  4ZUI A;  4EQP A;  4K8J A;  1A2T A;  4RKL A;  4QB4 A;  3S9W A;  1EY4 A;  1KDC A;  4NMZ A;  2EY5 A;  4KY5 A;  4QMG A;  2EY6 A;  4HMJ A;  5KRU A;  4KJN A;  5IOC A;  2EXZ A;  4NKL A;  4I65 A;  4MIU A;  5IGF A;  1SND A;  2EYM A;  5CV6 A;  5C5L A;  3SR1 A;  2F3W A;  4KD4 A;  3TP7 A;  1JOQ A;  5CV5 A;  3NXW A;  1KAA A;  4R8N A;  4ZQ3 A;  5E1F A;  2F0F A;  3TP6 A;  1SYE A;  1SNP A;  2M00 A;  2EY2 A;  4K6D A;  1SYC A;  1EY9 A;  1F2M A;  1SNQ A;  2NUC A;  3NP8 A;  4KHV A;  3QOJ A;  5CV8 A;  4F8M A;  5I6W A;  3C1F A;  4K2L A;  4J6H A;  5IGG A;  3RUZ A;  2PZW A;  5KYI A;  3TP8 A;  5IIF A;  1A3U A;  3DHQ A;  5F2D A;  1EYA A;  3T13 A;  5E3F A;  3P75 A;  2HQE A;  3SXH A;  4RKB A;  2OF1 A;  4F7X A;  4K8I A;  3TME A;  1EY7 A;  5M9O A;  1SYD A;  4EQO A;  3MHB A;  5K5P A;  5IGB A;  5J39 A;  4K5X A;  2OEO A;  4EVO A;  3HZX A;  5J1Z A;  5KYL A;  2EYF A;  4OL7 A;  3U9O A;  3MXP A;  5KGU A;  2F0K A;  3EVQ A;  4WRD A;  1STG A;  5DAU A;  5IGD A;  4DGZ A;  1SYF A;  4K5W A;  2F0U A;  3SK6 A;  4ME5 A;  3SK8 A;  1EYC A;  2F0Q A;  5C4Z A;  5I6Y A;  1EYD A;  2F0V A;  4J1M A;  3HEJ A;  3OSO A;  1F2Y A;  4LAA A;  4NDX A;  5HUR A;  3SK4 A;  2F0J A;  1NSN S;  2F0P A;  4KTA A;  3DMU A;  1STB A;  3NHH A;  1ENA A;  3EJI A;  4S3S A;  3MEH A;  5CV9 A;  3SHL A;  4H7B A;  5NUC A;  1SNO A;  1TQO A;  3ERQ A;  1STH A;  2F0W A;  5EGT A;  5CV4 A;  3NUC A; 
#chains in the Genus database with same CATH topology
 4A3F G;  2NN6 H;  5C3X A;  3HOX G;  2K5N A;  1CT1 D;  3PUX A;  2Q8R E;  2WB1 B;  2UU9 L;  2K28 A;  3CRL C;  2NN6 G;  1LTL A;  1GUG A;  1B1Z A;  1HNZ Q;  1NTG A;  1MSH A;  2FHT A;  1BBW A;  4ODG A;  1HUN A;  4GLV B;  3Q8D A;  4MTN A;  3CKI B;  2A73 B;  2UXC Q;  3KF6 A;  5FOB B;  4KKS A;  1EY8 A;  1A62 A;  4AQY Q;  1UE5 A;  1PH8 A;  1K83 H;  1SMY C;  2VS1 A;  4UDU C;  4DV2 Q;  5EAY A;  3GTM H;  3S2D H;  3BYT B;  1Q8I A;  4LFB L;  4TRD A;  2RVL A;  2B2W C;  2ZXP A;  2DY8 A;  4X3U A;  4IFD J;  2MO0 A;  1VF7 A;  3HKZ G;  2PQE A;  2F0S A;  2IW3 A;  5JJI A;  1HZ9 A;  2F3V A;  4KKU A;  1LYL A;  4JI1 L;  4JCV E;  2F4V L;  4ID6 A;  2E2J H;  4B9X A;  1K9M C;  3FEW X;  3U4Z A;  1SSO A;  1UEA B;  3X3N A;  1TWF B;  2EPB A;  2OQK A;  3UDI A;  5M3M G;  2E8G A;  3STB C;  3ND8 A;  1XTD A;  4RGN A;  1CA5 A;  1PYW D;  2E2I H;  3S1M H;  3PO2 H;  1F9R A;  1S5B D;  4BBS H;  1ZEQ X;  2KJX A;  5KRU A;  2SDF A;  4KJN A;  1WD1 A;  4O1N A;  2B2W A;  3PO2 G;  3IKJ A;  4A3K G;  4BBS G;  4LF8 Q;  1HRJ A;  5EQ0 A;  1BCP F;  2PQA B;  2N3S A;  2R92 H;  1IBL L;  4LK1 C;  3J7Y W;  1IW7 C;  3S1N B;  3NWS A;  1SMY D;  1CQV A;  1ICW A;  1S5C D;  1E7Z A;  4BY1 H;  1CK1 A;  2R92 G;  5K36 G;  2NVT B;  2KCC A;  4LF5 Q;  1Q1B A;  5C0X H;  4IN3 A;  5BN4 A;  4JBK A;  5C4J B;  3W1G A;  3F8T A;  3OSO A;  1CUK A;  5ELE A;  1PH4 A;  1GKH A;  3URY A;  1STB A;  3E0E A;  4ZCK A;  3G4S A;  5CV9 A;  2JJQ A;  4CKC A;  3LWE A;  1PV4 A;  3D6W A;  1QUQ B;  4BXX G;  4DR4 L;  1I4X A;  3VA7 A;  1HNX Q;  1XYI A;  3TZU A;  2AMC B;  2IHE A;  3DWQ A;  4A3E B;  4DXF A;  1PRT B;  3GTQ B;  1CSP A;  1BQQ T;  2K52 A;  2VQF L;  1FYC A;  3RZO H;  5EBC A;  2PO4 A;  2RDG A;  1V1Q A;  4A93 H;  3HKZ E;  3EIV A;  4NXM L;  5M3F G;  1HTL D;  3J80 c;  3OWF A;  3T1Y L;  2ICE C;  4A3J H;  1PXU A;  2YV5 A;  5A2Q E;  5A35 A;  1SBB B;  1VQ7 A;  3S1Q B;  1YVC A;  3FKI H;  1HQM C;  2DNC A;  4C1N K;  2XWJ B;  1TWA B;  4GKJ L;  2MJ8 A;  3PIO 3;  1N32 L;  3J81 i;  1JJG A;  1OXV A;  4C3J H;  3S16 B;  4CDC C;  3WOF A;  2NTS A;  3S2H H;  1QNU A;  3CCS A;  2DNE A;  1W3S A;  5KEE A;  4JI4 L;  2ATW A;  4NW2 A;  4JPB W;  2QIL A;  3MVV A;  1V8Q A;  2ID0 A;  2E2H B;  1G6P A;  5JEA J;  1VQL A;  4B3R L;  1SNM A;  3MFG A;  4Y52 H;  3ULL A;  1ROD A;  4LUV A;  1NR4 A;  1DOL A;  4RH6 A;  4A3I G;  3ERO A;  1JWS D;  3AFP A;  2UXD L;  3IRB A;  2A69 C;  4OO1 I;  1RL2 A;  1U4P A;  1I5F A;  2PI2 A;  3W1B A;  4Y7N B;  5DNF A;  2B63 G;  1HXY D;  4DR7 Q;  1TII D;  5GRO A;  1GM5 A;  4BY7 B;  5FLM G;  4FXG C;  1LT5 D;  3D31 A;  4QMG A;  4DV0 Q;  1UUP A;  3V96 A;  4I65 A;  3LWU A;  1L2F A;  4DAY A;  1JWU D;  2HIV A;  4UPA A;  2JA8 B;  3NXW A;  3HKS A;  2JXM B;  1CZG A;  1O7L A;  4ZKC B;  4IO9 A;  1Y1W B;  2JA5 H;  3QG1 A;  4J6H A;  5IT9 E;  1F77 A;  3T13 A;  4K8I A;  4P73 A;  4KHP Q;  5J39 A;  2B8F A;  3K7U C;  2OEO A;  4X3S A;  3BG3 A;  3BJU A;  2KBN A;  4DAP A;  3PIP A;  4DR6 L;  5IE8 A;  3CC7 A;  4IFD G;  2UXB Q;  2Q8I B;  3TEH B;  3DWA A;  1NCV A;  2KEN A;  1F2Y A;  4JI3 Q;  1DYQ A;  5HUR A;  3A74 A;  2OWO A;  5FKA C;  3CCJ A;  2N8N A;  1Z6H A;  1K8O A;  2E2D C;  2B39 A;  2K6A A;  2Z1C A;  1ESF A;  2F0T A;  3JAM E;  4JI6 Q;  3S1R B;  3F2C A;  1DXM A;  5GAD C;  4MTK A;  2HHH L;  3K57 A;  4N9T A;  4A3B B;  2OTJ A;  3HOY B;  4JG2 A;  1U4R A;  4HJ7 A;  3I4O A;  3I7F A;  1DZ1 A;  1TXY A;  5L37 A;  1TWF H;  1IHZ A;  5C5M A;  3VR4 A;  4GOP B;  1B4O A;  1ESR A;  4JBJ A;  2UUC Q;  5LL6 S;  1BNZ A;  5A2Q L;  2VY3 A;  1HH2 P;  5GAG C;  2I07 B;  3S17 B;  4DK0 A;  1EWH A;  1GHJ A;  1EY5 A;  1NR2 A;  4IQZ A;  3K81 C;  4X65 L;  2Z0S A;  2AWO A;  2Z9H A;  4DNI A;  1DM0 B;  1C8C A;  4OWT B;  1PRT C;  1TWH B;  3QWN A;  1HR0 W;  3I4M G;  2K5W A;  2R7F A;  4DA2 A;  2M9V A;  3L9A X;  5EPK A;  3V05 A;  5C4J H;  3R2T A;  3KLW A;  3FRP B;  4YCU A;  5E4X A;  1I4P A;  1A2T A;  4OGQ C;  1EY4 A;  2WB1 E;  1JB7 A;  3BS1 A;  2EY6 A;  2R7Z B;  2YYZ A;  5IOC A;  2NVQ H;  1X3G A;  2ZTC A;  3DWP A;  4ZLT F;  3NTK A;  3A8I E;  1PH5 A;  1B70 B;  2EXD A;  3AQQ A;  2K5H A;  4ZRZ A;  3I90 A;  2L5T A;  2M00 A;  4MIU A;  2QKI C;  1F2M A;  2NUC A;  1ZYR C;  1NE3 A;  3Q6S A;  4BBR B;  4O2D A;  1CQF A;  3DHQ A;  1I4H A;  3MXN B;  4RG1 A;  1KLU D;  4A3E G;  3AU7 A;  4XIG S;  1WCM B;  4IJL A;  4EX5 A;  5IT9 L;  3HOZ B;  3PF4 A;  2K5Q A;  2A5H A;  1AFP A;  3K5L A;  4WRD A;  1PZI D;  1XTC D;  5H1S E;  1Y1V H;  2E74 C;  1EYC A;  5IY0 A;  1LT4 D;  3SEB A;  1MJC A;  3SK4 A;  2F0J A;  4I7A A;  1KNA A;  4FO2 A;  1UNS A;  2K50 A;  4JI5 L;  3S16 H;  2LXJ A;  1S5E D;  3ONA B;  1HJP A;  2SNS A;  1QG7 A;  2WIN B;  2F0I A;  1W2B A;  4O0A A;  1B3Q A;  4OIJ A;  1M90 C;  4GN3 B;  3OPO A;  5AJ3 Q;  1Q7Y C;  2E2H H;  2AQ1 B;  1B50 A;  4DXG A;  3JAM L;  3E3X A;  1ILQ A;  2G9H D;  3UDF A;  3MXG A;  3J7A 5;  5M5W B;  2K01 A;  1NUC A;  2IY5 B;  3X3M A;  2A1A A;  2J0T D;  1GD7 A;  4JW0 A;  3KLS X;  4ZK9 B;  4X62 L;  2AUK A;  4Y7N H;  4G7Z C;  2K14 A;  3FVQ A;  4MHE A;  4BY7 H;  4C3H B;  3IAY A;  1EZ6 A;  1EEF D;  1AW7 A;  3RNU A;  1JR0 D;  3HOV B;  4BY7 G;  4JYA L;  1J5E L;  3V2T A;  4A76 A;  3FDT A;  1U0L A;  1BVS A;  3SE0 A;  1ENF A;  1TWG B;  1Y1W H;  3G71 A;  2JA8 G;  4X6A H;  3I8Z A;  1TVX A;  4IUP A;  4YY3 L;  2H5X A;  4JI0 L;  3E5S A;  3C46 A;  4K0K L;  1SNC A;  2F0E A;  2BH8 A;  2LKV A;  3P1H A;  3HRZ C;  4A3F B;  3BU2 A;  1QJO A;  3HOX B;  4DV7 L;  1FNU A;  4A3L H;  1PH3 A;  2IJ0 A;  4GOP C;  2EY5 A;  3CME A;  1JIC A;  5FO7 B;  3BVG A;  3R2I A;  2IWH A;  4IUV A;  4A3L G;  1WOC A;  4L5R C;  2DUD A;  1JOQ A;  3C2P A;  1RDP D;  4P2C B;  4N8F A;  4R8N A;  1I6H B;  4QJF A;  2BH2 A;  3E0J A;  4QUC A;  5I6W A;  1B9N A;  3S1R H;  5DM7 3;  4LF4 L;  2BDN A;  4POF A;  4BA2 I;  2BE5 D;  2UUA L;  1GJX A;  1I50 B;  5M9O A;  4A3B H;  4HIM A;  1NJI C;  1V1P B;  2Z8L A;  4EQO A;  1XNQ L;  3HOY H;  1PH1 A;  3BYY B;  2MO1 A;  1STG A;  4A3B G;  3HOY G;  1O7Z A;  5G3L F;  5CBE E;  5IP9 G;  4NDX A;  4EQ5 A;  1XPO A;  1NSN S;  1N33 L;  1HA6 A;  1LUZ A;  4H0L C;  4QGU A;  3WWV A;  4UY8 C;  3T4A C;  2MQH A;  3GTO B;  3S17 H;  1IYJ B;  3W5O A;  1PTO B;  2A68 C;  4ZYS A;  3J7A V;  4QF4 A;  2E5L Q;  1H9S B;  1QE6 A;  3NK9 A;  3TP5 A;  1TWH H;  1SLJ A;  3CF5 A;  1HR0 L;  4OO1 H;  4A3K B;  1XNR Q;  1A2U A;  2RHQ B;  3NTI A;  4HCE A;  4BWG B;  2IL8 A;  1X3P A;  1GUN A;  3DM1 A;  2I0Q A;  2X69 A;  2D5D A;  4GLX A;  5C6A A;  1UE1 A;  3M9B A;  5LHY 1;  2RBM A;  2PPB C;  3GTK H;  1BUV T;  1M4V A;  1WYD A;  5E4W C;  1HZC A;  2A6E D;  5JPM C;  2JE6 I;  4IUU A;  4EQN A;  4IZ8 A;  1Y14 B;  5FO9 B;  1JWM D;  3A0J A;  2VXW A;  2R7Z G;  2R93 G;  2NVY B;  1R4P B;  3QB3 A;  3IFD A;  2ZM6 L;  2QEX A;  1JJ2 A;  3KLS A;  1HA5 A;  5ELC A;  1XMO L;  2N78 A;  4IFD I;  4LNQ A;  1L0Y B;  2F0D A;  1SYB A;  3M4Y A;  3MXN A;  5C4X H;  5I9O A;  1WCM H;  4XYQ A;  4BBR G;  4PMW A;  3NBH A;  1QVF A;  3HOZ H;  4HMI A;  2Z6K A;  3CPW A;  3CCR A;  4K8J A;  2EDG A;  4LFC Q;  3I91 A;  4QB4 A;  1DJR D;  2L1B A;  1EIG A;  3HFZ B;  1SN8 A;  4QY7 A;  5M5X B;  3MC0 B;  2EXZ A;  2EYM A;  1N34 Q;  5C5L A;  5GQO A;  3SR1 A;  2F3W A;  3AMU A;  3KDF A;  4DV1 Q;  1Q46 A;  4K6D A;  2ZTE A;  4L5S A;  5IGG A;  5IYC H;  5IIF A;  2R6G A;  2ZXR A;  4RHS A;  3GO5 A;  3K6O A;  3KJP A;  1CKM A;  1N8R C;  3TDQ A;  5E3F A;  1HTP A;  4RKB A;  1JQY D;  2PNH A;  3MHB A;  4X66 Q;  4LF6 Q;  2MPM A;  3TN2 A;  5IYB G;  4V0B A;  1VQD A;  4GNX C;  1VS0 A;  5M5W H;  1SYF A;  4A3D B;  5D65 A;  5IWA L;  4YHH L;  2F03 A;  1H9M A;  5EJW A;  3RD4 A;  3QO2 A;  3EQL C;  3LGJ A;  4S3S A;  4A3I B;  1HHV A;  4C3H H;  3RZD B;  3ULP A;  1YHB A;  1EOV A;  1Q8K A;  3HOV H;  4RCN A;  5IOD A;  2WFW A;  3MXU A;  2R61 A;  4OX9 Q;  4GZY C;  1WI5 A;  2B63 B;  1Q90 A;  1U9R A;  4IUR A;  2ASB A;  1VMP A;  1RTN A;  2FXQ A;  3G48 A;  3CMA A;  3G6E A;  1TWG H;  1PZJ D;  1J9O A;  4J15 A;  1JB3 A;  2K5V A;  1STA A;  1I6V C;  1TS4 A;  4DNR B;  1HNW Q;  4ILW A;  4A3F H;  3RLF A;  3HOX H;  3Q23 A;  4X64 Q;  4Z9C B;  3OMC A;  4KMU C;  5ELD A;  3JAM c;  2A19 A;  1DCZ A;  4B3S Q;  4G7H C;  5I2X A;  1EY6 A;  1L0W A;  3WOE A;  4DR2 L;  4K2K A;  2K03 A;  1HFN A;  1SRU A;  4X3T A;  1B3A A;  1HNZ L;  1I6H H;  1YBY A;  1PTO C;  3UI2 A;  2YTX A;  4JC0 A;  4CHT B;  4KV6 A;  2UXC L;  1K8G A;  1ENC A;  2QDL A;  2VZA A;  3WDN A;  1RF2 D;  4IUN A;  4LF9 L;  4XQQ A;  1TS5 A;  1I50 H;  1S72 A;  1V1P A;  3D8G A;  3FMC A;  4DV2 L;  1STY A;  3CQZ B;  4QQB X;  5J22 A;  1XMQ L;  4Q0F A;  2BCO A;  5C3E B;  4FF1 A;  1QB5 D;  1OO9 B;  2UUB Q;  3A7A B;  2YU9 H;  4IOC A;  5IGF A;  5CV6 A;  1P8L A;  1GVP A;  1NBW A;  3KF8 B;  1N36 Q;  2F0F A;  2L55 A;  3GTO H;  2EJF C;  1I4Q A;  3P7J A;  1B8A A;  5CV8 A;  1BKB A;  1PH6 A;  5M3M H;  1T5E A;  3A5Z B;  3BZK A;  3TP8 A;  1VDZ A;  1R9T B;  3P75 A;  3CC2 A;  4LUZ A;  1EY7 A;  1T9H A;  3J80 i;  2FIN B;  1PFN A;  4A3K H;  2K1B A;  1N9W A;  1O80 A;  4DGZ A;  4HSP A;  1IKL A;  5I6Y A;  1LTS D;  4LF8 L;  4UP8 A;  1PTO D;  3OTO L;  4JI1 Q;  2F4V Q;  4IPH A;  2F0P A;  5IYD G;  3I4M B;  2V1C C;  3SHL A;  5K36 H;  3M4O B;  4DV5 Q;  3ERQ A;  2RA4 A;  1X9N A;  3M85 A;  1Q1E A;  4XQN A;  2AQ3 B;  1PH7 A;  1QVC A;  3DLL A;  1EU4 A;  4LF5 L;  4K14 A;  4C3I G;  2GVB A;  1TWC B;  2NVY H;  2XGT A;  3VYU A;  1B9M A;  5GAE C;  1GHK A;  3BDC A;  4RMF A;  3GV6 A;  4DN4 M;  3DM3 A;  5CGK A;  3U9S A;  4BXX H;  1L0X B;  1QZH A;  4DF7 A;  5GAH C;  1SRO A;  1S4Z A;  2NWG A;  2G9D A;  2GVA A;  1NMF A;  1EFW A;  4TVA B;  1HNX L;  1LAC A;  3S14 B;  3E9H A;  5M5X H;  4JI7 Q;  3STB D;  5M3F H;  4DUY Q;  2L4N A;  1A3T A;  1ZXT A;  2CWA A;  3OIQ A;  4DR3 Q;  2DN8 A;  1TY0 A;  3PIO A;  3VR6 A;  4B3T L;  1G91 A;  1KQS A;  2D0O A;  4MNO A;  2SEB D;  4G7O C;  4MN3 A;  4ZUJ A;  5HY6 A;  1XXG A;  3PUV A;  4FXD A;  3NEL A;  1IW7 D;  2VUM B;  1KDA A;  2QF7 A;  1IBM L;  2OXP A;  1CA6 A;  2B2V C;  2K33 A;  4ZUI A;  1E2W A;  3RN5 A;  4R8I A;  4A3D G;  3T1Y Q;  3U50 C;  2LFN A;  2XRQ D;  4A3I H;  1L1O C;  2MNA A;  3RZD H;  4HSV A;  4OON A;  1EIY B;  4TSS A;  1WTX A;  1PFB A;  2ES2 A;  1ET6 A;  4HID A;  1IZ6 A;  4K2L A;  1S5F D;  1TU2 B;  1LO5 D;  2B63 H;  3TS2 A;  5FLM H;  1B53 A;  4DV4 L;  4DR7 L;  4K5X A;  4RWS C;  5J1Z A;  1I4G A;  4JI4 Q;  2VB3 X;  2CVR A;  4OWX B;  1B44 D;  4K5W A;  4NXN Q;  4B3R Q;  2E76 C;  5KNC A;  1VQB A;  4LAA A;  1CZW A;  5J3B A;  2Q8T A;  1XPR A;  4WJ3 M;  1QWY A;  4ALP A;  1U4M A;  1LAB A;  4JK1 C;  4HR7 B;  1G8Z D;  3I4N G;  1OTC A;  2B29 A;  3GDE A;  3GP7 A;  1JJC B;  4KY6 A;  3HS0 C;  1A3V A;  3B6Y A;  4IFD H;  2L0C A;  4CGY B;  1JC7 A;  5KIX A;  4CDE C;  2JEB I;  2KHS A;  2KQ3 A;  3ITP A;  3RLO A;  2VQE Q;  4U68 A;  2FFK B;  2BA0 A;  2PYK A;  4DR1 Q;  4BS9 A;  4LJZ C;  2RDF A;  4DUZ L;  4DR5 Q;  5IP7 G;  2A69 D;  5EKL A;  3MEF A;  4DK6 C;  1JCK B;  1MGS A;  1LV9 A;  1SYG A;  1F2Z A;  5C3E G;  1PA6 A;  4DR6 Q;  1VQK A;  4IJH A;  2XSC A;  2PNR C;  3KF8 A;  4GKK Q;  3K8A A;  3NQT A;  3F2D A;  2F52 A;  2QGQ A;  4PZ6 A;  2K5D A;  4WFN 3;  1J8I A;  4YWM A;  4RFB A;  4NPS A;  4KK7 A;  3PIP 3;  3TSS A;  3H94 A;  1EWI A;  1RKN A;  2RF4 A;  1U5K A;  1Y8P B;  2L11 A;  4JOI C;  3BVZ A;  3H91 A;  3HOW B;  2JA6 B;  1A0I A;  5HGQ A;  2HHH Q;  1HCZ A;  1Q12 A;  2JQO A;  3NEM A;  1VQM A;  3GTG B;  2KA7 A;  3CCL A;  1QOH A;  2PQA A;  3MTS A;  3KBG A;  1LLR D;  1EIF A;  5AFW A;  3I4M H;  2OCE A;  1D5X C;  3PO3 G;  3NPP A;  2NZO A;  3S1N H;  2B2T C;  3K5M A;  3NP8 A;  2NVT H;  4H44 C;  4I7Z C;  3QR8 A;  3W3A A;  5KYI A;  2X6G A;  2F3I A;  1BF4 A;  3RN2 A;  4N8X 1;  1SYD A;  1VQN A;  2RQX A;  3PUZ A;  3ERS X;  3GTL B;  2R93 B;  2EQS A;  4M1U B;  4X65 Q;  2VNU D;  2IX0 A;  4J1M A;  4L63 B;  2EJM A;  4EGV A;  1QUQ A;  1EFI D;  2EVB A;  1KL9 A;  2HUG A;  1Y8N B;  1ENA A;  4FDB A;  5NUC A;  1SNO A;  3S14 H;  4UHV A;  3Q22 A;  2QCP X;  1VQ5 A;  4A3E H;  5CV7 A;  4A3G G;  4X3K A;  3CCM A;  3GTQ H;  4FVM A;  3K5N A;  2O5J C;  2K7V A;  3F2B A;  4JI8 L;  1VQG A;  1UE7 A;  1E24 A;  2P5Z X;  1KLG D;  4R4C A;  3PMF A;  3CP0 A;  5JEA H;  3VA5 A;  1YNN C;  3FP9 A;  3S1Q H;  1SE3 A;  2EYO A;  3QOL A;  4IUQ A;  5JEA G;  2K4K A;  3A5U A;  1TWA H;  2X6L A;  2MP1 A;  2VUM H;  5DEH A;  1PRT D;  1CKN B;  1O7I A;  2O4X A;  1PDQ A;  1FGU A;  2VUM G;  4MZ9 A;  2KUM A;  1EU3 A;  2RCN A;  4B3M L;  3D6C A;  1K3R A;  5AJ3 L;  3T1H L;  1K3B C;  1FJG L;  1UAP A;  1C48 A;  3OMG A;  1VQE A;  2ALY B;  5EBD A;  1PMR A;  3EA6 A;  1VQ8 A;  1NY4 A;  2L12 A;  1XX8 A;  4JI5 Q;  1AZQ A;  2RKS A;  1G2S A;  2EY1 A;  3NQI A;  4JV5 Q;  2AWN A;  4N9P A;  1G51 A;  1ZYR D;  1SE2 A;  1SDF A;  1OXT A;  3PSI A;  2AQ2 B;  2EJG C;  2XIW A;  1FL0 A;  2MGS A;  4DK1 A;  1Z9F A;  2JA8 H;  1K73 C;  3TP7 A;  4JI2 L;  2I5H A;  1IBK Q;  2C9O A;  1SYE A;  4X62 Q;  3TS0 A;  1C4Q A;  2WKD A;  4GNX B;  1KRT A;  1FNW A;  3OHX C;  4DAM A;  4KI0 A;  2KOL A;  1PHJ A;  3MWY W;  3SXH A;  4YCW A;  3HZX A;  3DEP A;  4KLK A;  3RR5 A;  3VYT A;  2IX3 A;  2YTV A;  3OIP A;  1PYS B;  1RIP A;  3OWE B;  1FD7 D;  3M7N A;  2D9U A;  1RHP A;  4JI0 Q;  3GD7 A;  1AEX A;  3VR5 A;  4DK3 C;  4K0K Q;  3K0X A;  3N52 A;  4DV7 Q;  2F0L A;  3J7Z C;  1X6O A;  1VQ6 A;  1X3Q A;  1A8V A;  5IP9 H;  4PQX A;  4C56 C;  3CC4 A;  2R7D A;  1XJV A;  5T1G A;  4GOP A;  3LX0 A;  4LF7 L;  5LMN Q;  1KAB A;  4L6T B;  4LF4 Q;  3HOW H;  1D5M C;  4R9W A;  3R8B A;  2JA6 H;  4HAE A;  2I5M X;  1IKM A;  4A4I A;  1K0S A;  3GTM B;  2Q2I A;  1TT2 A;  3HOW G;  3ICE A;  4B9W A;  2JA6 G;  4IOA A;  4PMB A;  3J81 E;  1VQO A;  1M8A A;  2N88 A;  1X3F A;  5JOB A;  2HIX A;  2NB0 A;  1KIX A;  3H0G B;  3NSW A;  5I2Y A;  1M1K C;  2SNM A;  4DV6 L;  1N33 Q;  3MA2 B;  1UEB A;  1YHQ A;  1I94 L;  2IHF A;  4R4O A;  4CBV A;  3L7Z C;  1F9P A;  3EBE A;  3MZ5 A;  1RD9 D;  5KNB A;  1JOR A;  3AFQ A;  2E2J B;  5BR8 Q;  1WTP A;  2F0G A;  2TMP A;  1PZK D;  4A75 A;  4C3I B;  2R7Z H;  4LFA Q;  2R93 H;  4RKL A;  5FO8 B;  1KDC A;  2LS0 1;  5D3I B;  4HMJ A;  3GTJ B;  4CJ2 C;  2HCI A;  1HR0 Q;  1SND A;  1ET9 A;  4YCV A;  2Q2T A;  1MJE A;  3KFU A;  1SNP A;  4BBR H;  4F8M A;  3NWT A;  2B2Y C;  2PZW A;  3LNN A;  3MAQ A;  3HGB A;  2PMZ B;  4BA1 I;  4F7X A;  4F88 A;  1WVL A;  2A68 D;  3BVM A;  2JEA I;  4R4I A;  2F0U A;  1K0R A;  3VDY A;  3HEJ A;  1CKN A;  3PQI A;  3PGZ A;  3JAM i;  4CDF C;  3GV3 A;  4OHJ A;  2NZ1 D;  1ZKO A;  2WAQ B;  3L3O C;  1PH9 A;  4WJ4 A;  5IYB H;  4OEL B;  2WII B;  3K59 A;  2K75 A;  1VQA A;  4X66 L;  4YWL A;  3ER0 A;  5C0X J;  4C1N I;  1RJT A;  2JYO A;  2Y0S B;  1K8M A;  1LTB D;  2EYH A;  1TR5 A;  2HCC A;  1OXX K;  3S24 A;  5EKI A;  2EYP A;  4L5T A;  4A93 B;  1TS2 A;  5D3D A;  1H9J A;  5ISR A;  5CMD A;  2QA4 A;  1SEB D;  3A55 A;  4WOR A;  4KN7 C;  1CHP D;  4ME3 A;  3RMH A;  2QDB A;  2JA7 G;  2F1M A;  2N49 A;  1E1T A;  1TY2 A;  4GN4 B;  3W2D A;  2A6H C;  3H15 A;  2PZT A;  3U4V A;  2XRS D;  4KN4 C;  1VCI A;  1SMX A;  2WKC A;  5FJ8 G;  4APV A;  5IWA Q;  1YNX A;  4YHH Q;  3NEN A;  5LMU L;  3UDG A;  1FNV A;  3EFX D;  3J81 L;  1X55 A;  4GNX A;  1GO3 E;  1UWV A;  3I70 A;  3K5O A;  1SE4 A;  4DV3 L;  3OW2 A;  3CCQ A;  1SJH D;  4O42 A;  5T1I A;  1GXD C;  3I2Z A;  3I4N B;  4X64 L;  3K7A B;  1C9O A;  3J7A F;  1HZB A;  1LTI D;  1L1O B;  1SE8 A;  3S9W A;  4A3M G;  4B3S L;  4HN7 A;  1B7Y B;  3HP3 A;  1EUJ A;  1Z7T A;  2CWP A;  2O5I C;  1KAA A;  1E1O A;  1VQP A;  1HQR D;  4OXP A;  4P75 A;  4AQY L;  1AH9 A;  2B8G A;  2KEE A;  3T53 B;  3RUZ A;  1EYG A;  5F2D A;  2JA5 B;  3PV0 A;  2WV6 D;  3CHB D;  2XNA C;  3CCV A;  2OF1 A;  2RDH A;  2KCM A;  2BA1 A;  2UU9 Q;  2A6H D;  4EVO A;  1AZP A;  1DOM A;  1PLF A;  2NYZ D;  2HDM A;  4OL7 A;  4DR2 Q;  2UUB L;  3EVQ A;  1BCP B;  3A56 A;  1BOS A;  3TRE A;  4B08 A;  5ELO A;  2D0P A;  5KND A;  3HOU B;  1A63 A;  2I5L X;  3BZD B;  1HFG A;  1N36 L;  4PZ8 A;  4LF9 Q;  1Q3L A;  1PTO H;  2HQL A;  5EGT A;  1EQQ A;  3GTP B;  4DPG A;  4LFB Q;  4HJ5 A;  1XMQ Q;  1H9S A;  2RSN A;  2XTI A;  2CH4 A;  2LXK A;  3D4D A;  4OWW B;  3BDL A;  2CKZ B;  3H0G H;  2E75 C;  2NTT A;  1LT3 D;  2EZV A;  4XYO A;  4PMC A;  2KCN A;  1B2T A;  3KOJ A;  3H0G G;  5IYD H;  1PYB A;  1E2Z A;  3PF5 A;  1VQF A;  4NB3 A;  1DOK A;  3QJY A;  1Q86 C;  3PO3 B;  5HGT A;  4QCL A;  4U67 3;  2H1E A;  4E6I A;  4DV5 L;  2A74 C;  2CH4 W;  1QVG A;  4C3I H;  3SDZ A;  1AE2 A;  1YJN A;  1JMC A;  3GTJ H;  1AN8 A;  1IYU A;  3ZJY C;  2CW0 C;  3A54 A;  1PVO A;  3UE1 A;  5LL6 X;  4FXK C;  4LWC A;  1ICF B;  1NMG A;  3C1E A;  3OTO Q;  1KD1 C;  1Q81 C;  3T16 A;  3E6Z X;  5JJL A;  1IBL Q;  2IPK D;  2XVS A;  4P72 A;  1VMC A;  1BO0 A;  2ICI A;  1LTA D;  4HED A;  1V43 A;  1MSG A;  4LUO A;  4A3G B;  2DGY A;  2L9H A;  1YEZ A;  1CM9 A;  5JJK A;  2QEJ C;  4BY1 G;  4DKA C;  5TSS A;  4JI7 L;  4YWK A;  4CDD C;  1U4L A;  1Y69 U;  2NBF A;  4DUY L;  5C0X G;  1X65 A;  3OW7 A;  3TRZ A;  1QIL A;  3M4P A;  4DR3 L;  3OOC A;  2NVQ B;  2JA9 A;  4XT1 B;  3AB9 A;  3TP6 A;  2IX1 A;  2OTL A;  4KHV A;  3F2U A;  2V4D A;  3F1Z A;  5JVH 3;  2IT1 A;  4DR4 Q;  1FR3 A;  2WAQ G;  1A3U A;  1DGS A;  1VF5 C;  3NBI A;  4GLA C;  1IL2 A;  1KC8 C;  2J7Z A;  1LT6 D;  1OXS C;  2D2C C;  5JPN C;  2VQF Q;  4HIO A;  2CW0 D;  4A3D H;  1EOT A;  2M2L A;  2Y0S G;  1CTM A;  4R4T A;  4NXM Q;  2JN4 A;  4B3T Q;  4AH6 A;  4A93 G;  1Y1V B;  4FNF A;  3DMU A;  3NHH A;  5EPL A;  1I4R A;  4H7B A;  4A3J G;  4GKJ Q;  1MKH A;  2KED A;  1IBM Q;  1N32 Q;  3FKI G;  2TSS A;  1X3E A;  2SOB A;  3I73 A;  4ULL A;  5FLX E;  5C4H A;  2NVX B;  5DM6 3;  3K0Y A;  4K5V A;  2GA4 B;  4KY7 A;  4C3J G;  2Q2H A;  1ML0 D;  3IL8 A;  4WJW A;  2O2L D;  2N55 A;  4H02 A;  4DV0 L;  2B2V A;  4NXN L;  1PRT F;  4AYB B;  3T51 B;  3O13 A;  2HT1 A;  3I3C A;  1CI3 M;  3CRK C;  3AEV A;  2KHJ A;  3K7A H;  4R4Q A;  1BCP C;  3R93 A;  3I4N H;  2UXD Q;  1D2B A;  3CD6 A;  1L1O A;  3JC6 6;  4P71 A;  4KJO A;  5JAV A;  4HJ8 A;  2G5D A;  1H95 A;  5CC4 A;  3CCE A;  2PMZ E;  4DV4 Q;  3OYY A;  1I3Q B;  1G29 1;  1RCV D;  2AKW B;  3I72 A;  4KHP L;  3I56 A;  2EYJ A;  2AUJ D;  5C3W A;  1BDO A;  2UXB L;  3D4W A;  1DON A;  4JBW A;  3ULJ A;  4RA8 A;  2VQE L;  5EKK A;  4JI3 L;  4M8A A;  4DR1 L;  5IP7 H;  1DD2 A;  4A3C H;  5M5Y B;  3CQZ H;  4KKT A;  3EN2 A;  4DR5 L;  1IYV A;  2F0N A;  1X54 A;  3A8K E;  2WAQ E;  5C3E H;  4GS3 A;  5COY A;  2JA5 G;  4A3C G;  1T5X D;  4EQP A;  4JI6 L;  2WB1 G;  5FK9 C;  2VW9 A;  3J81 c;  4V19 0;  3A8J E;  2Y0S E;  3HOU H;  3S15 B;  4GKK L;  1YI2 A;  1VQ4 A;  3TBI B;  4XT3 B;  1W6K A;  4HIK A;  3CCU A;  3HOU G;  3H3V I;  3GTP H;  3L2P A;  1QCB D;  5JJZ A;  1JE4 A;  4DNT B;  4DUZ Q;  1SNQ A;  1BR9 A;  1R9T H;  3QOJ A;  4HJA A;  1BCP D;  4F87 A;  1OXU A;  5LMN W;  1EYA A;  1HUM A;  2UUC L;  2HQE A;  1SR3 A;  4PZ7 A;  5K5P A;  1EQR A;  1WTQ A;  1YJ9 A;  1KHI A;  5IGD A;  1WTW A;  3UDX A;  4ME5 A;  2BDO A;  3PO3 H;  5C44 B;  4L5Q A;  4XTC S;  2LY7 A;  2HDL A;  1D5Z C;  1IXR A;  3M4O H;  3VR3 A;  2FJ2 A;  1F9Q A;  2LMC B;  3SVM A;  2J4X A;  2FMC A;  3ZYY X;  5KYL A;  2VB2 X;  2EE1 A;  5CV4 A;  3NUC A;  1ASY A;  1MIU A;  2XN9 C;  1TWC H;  2CCZ A;  4H13 C;  4TKO B;  3A7L A;  1EEI D;  1EZ8 A;  3KBX A;  2DJG C;  3D4R A;  4XDX A;  2PI2 E;  2DJF C;  1YIT A;  1E3P A;  5IGC A;  1NAP A;  1CFM A;  2EYL A;  5FLX L;  1STN A;  4JOI A;  5CR3 A;  2EIF A;  1PH2 A;  4FYD A;  3DUZ A;  4Q5V A;  1SJE D;  1Q82 C;  4RGM A;  2XWB B;  1EL0 A;  3Q0A A;  1PFM A;  1TS3 A;  4YIJ A;  4A3G H;  2R3Z A;  4AIM A;  3FPU B;  4IUT A;  3GTK B;  2B2T A;  4UAI A;  2KCT A;  3CPF A;  1CKO A;  1YNJ C;  4FF2 A;  1LTG D;  4QIW B;  1X32 A;  1HPC A;  1AE3 A;  2NN6 I;  1S3O A;  3KYH C;  1BBX C;  4ZAI A;  4XQJ A;  4GN5 A;  1F2L A;  1VQC A;  1YHA A;  3L0O A;  1X56 A;  1YIJ A;  4ABN A;  4C2M B;  4HCS A;  5C4X B;  4JI8 Q;  3CW2 C;  2DY7 A;  3NBH B;  4NMZ A;  1MD2 D;  2GN5 A;  1WTH A;  1FGB D;  4ZKB B;  2F4I A;  2ZJR A;  1S5D D;  3TQY A;  3P20 A;  3TZD A;  4KD4 A;  4RAU C;  5CV5 A;  2D62 A;  1Y1V G;  3CXC A;  3FPP A;  2BOS A;  4ZQ3 A;  2EY2 A;  3KDF B;  3UE0 A;  2NVX H;  1P16 A;  4JVZ A;  2JA7 B;  4JV5 L;  1YZ6 A;  4B3M Q;  2K32 A;  1E2V A;  3T1H Q;  1D8L A;  3VYR A;  3MXP A;  1YNJ D;  2LSS A;  1FJG Q;  1AP0 A;  5DAU A;  3SK8 A;  5C4Z A;  1XWE A;  3J80 E;  2Z6B A;  4AYB G;  2ZJQ A;  3RLN A;  4KTA A;  1G6Z A;  3SGI A;  1YNN D;  2RSO A;  1IBK L;  1TKW B;  4OEM B;  3G6J B;  1WTO A;  1CSQ A;  3GQB A;  3AYH B;  2RCF A;  2BE5 C;  1EIH A;  2F0W A;  4DAV A;  1I3Q H;  1V1O A;  1K8A C;  2MFI A;  1XPU A;  3KJO A;  1VQI A;  1A6X A;  1KXL A;  4DU9 A;  4CJ1 B;  1LM0 A;  2B2U C;  1K28 A;  2KVM A;  4A3M B;  4JYA Q;  3G7L A;  1F9S A;  4HTH A;  1J5E Q;  1JT8 A;  4IAL A;  1STE A;  3I55 A;  1QNK A;  2F0M A;  4JI2 Q;  5M5Y H;  5C0X I;  1LTR D;  4CKB A;  4PG3 A;  1LTT D;  1ONL A;  3M4Q A;  3M3Y B;  4LMQ D;  5E7N A;  1Y1W G;  4YY3 Q;  1CHQ D;  3FHW A;  1JOK A;  1EQV A;  2C5C A;  2KEC A;  1MHW C;  1SFO B;  1II3 A;  4IPC A;  1SXT A;  3S15 H;  1UE6 A;  1EY0 A;  1GUO A;  2PW5 A;  2F0O A;  3H6M A;  4K6L A;  1R4Q B;  3VYS A;  1KRS A;  4RHR A;  3H09 A;  3M7G A;  4HJ9 A;  2ENB A;  2B2U A;  2CQA A;  1BXT A;  2Z4H A;  4QUF A;  2PW7 A;  5ELN A;  3KK7 A;  1W6J A;  2WAC A;  5LMN L;  4PV1 C;  3KF6 B;  2A6E C;  3KLR A;  3BZC A;  1GUS A;  2K04 A;  4NP5 A;  2UUA Q;  2PCF B;  1MBY A;  4CJ0 B;  1K83 B;  2A8V A;  3D3R A;  3GTG H;  1XNQ Q;  3S2D B;  4R1J A;  1WTR A;  1V9P A;  2E5L L;  2I46 A;  5C44 H;  2ZT9 C;  2H4O A;  2KHI A;  3HKZ B;  1WTV A;  3KUP A;  4L8J A;  2YU9 B;  2JSO A;  5DLQ E;  4FF4 A;  5C44 G;  2JP1 A;  4AYB E;  1XNR L;  3VR2 A;  1KTK A;  3T56 B;  1NNX A;  1Y8O B;  4LF7 Q;  1VQJ A;  3PUY A;  1Z47 A;  4LW1 A;  3C1F A;  5BR8 L;  2YTY A;  4OIK A;  4XXE A;  1S40 A;  3MFY A;  5M3M B;  2RHS B;  3PUW A;  4LFA L;  4IPG A;  3GTL H;  1A15 A;  2EYF A;  2QW7 A;  3N6R A;  3U9O A;  4POG A;  3S1M B;  2E2I B;  1HZA A;  2ZJP A;  3PO2 B;  2F0Q A;  2VL6 A;  4FP5 D;  4DV6 Q;  2NZH A;  4BBS B;  2F0V A;  4QL5 A;  1I94 Q;  5CYU A;  4JBM A;  1E22 A;  2HD3 A;  2L15 A;  4OO1 G;  5ELB A;  2Z6K C;  3DEO A;  3J80 L;  1KAW A;  1TQO A;  1STH A;  1JE5 A;  2MUY A;  4RCO A;  2R92 B;  3H3V C;  1RTO A;  1SAP A;  4PNY A;  1H9K A;  3QIA A;  4BY1 B;  2K05 A;  2CFM A;  4LFC L;  4IPD A;  1JOO A;  1PTO F;  2FMM A;  3K80 C;  1MI2 A;  2ZM6 Q;  3DXJ C;  1ASZ A;  1N34 L;  3HG9 A;  1KDB A;  2C35 B;  1XMO Q;  3BDO A;  4DV1 L;  1GUW A;  1J6Q A;  3Q24 A;  3ND9 A;  4C2M H;  4G57 A;  3E9I A;  3U58 A;  1C0A A;  5IGE A;  4DFA A;  1H9R A;  2B3G A;  2F0H A;  2ZTD A;  5FLX c;  5C4X G;  1IL8 A;  2CQO A;  1WCM G;  4KHZ A;  5COR A;  2EOT A;  2B2Y A;  3HOZ G;  5CBA E;  2OT2 A;  3H3V H;  1WJJ A;  4LF6 L;  3NTH A;  5I9P A;  5M3F B;  3RZO B;  2AHO B;  3K58 A;  4G4K A;  2PZU A;  1WD0 A;  2JA7 H;  1E0B A;  1VQH A;  2CHB D;  1KNE A;  3J81 j;  4UP9 A;  4A3J B;  5JVG 3;  2ZXO A;  3NE5 B;  1O78 A;  3SK5 A;  1ILP A;  1EWC A;  1BBU A;  3FKI B;  1EQT A;  5D14 A;  3I4L A;  3R3O A;  1C7Y A;  5IYC G;  5FJ8 H;  5ELF A;  4J8Q A;  4OX9 L;  3CAM A;  4C3J B;  4KY5 A;  1G2T A;  5BN5 A;  4RGT A;  1D7Q A;  1FVI A;  4NKL A;  3D0F A;  3PCO B;  2Z4I A;  3S2H B;  5BN3 A;  1VQ9 A;  5E1F A;  1SYC A;  1EY9 A;  5EPJ A;  3C3L A;  5IT9 c;  1HNW L;  4FF3 A;  1GUT A;  2MHV A;  1O7Y A;  2Q2U A;  4C3H G;  4A3M H;  1QZG A;  1D1K A;  4TQU S;  4UP7 A;  3TME A;  3HOV G;  5IGB A;  1D6E C;  5KGU A;  2JK8 A;  4QIW E;  2F0K A;  4P74 A;  3SK6 A;  5LMU Q;  4RGO S;  1WFQ A;  2WP8 J;  3M3Y H;  1EYD A;  3CU7 A;  5I4D A;  1D1I A;  4CKE A;  3EJI A;  4DV3 Q;  3MEH A;  4DAY B;  1PFS A;  1SFO H;  5G3L D;  3IFT A;  4KD3 A;  1GOZ A;  1YJW A;  2OQ0 A; 
#chains in the Genus database with same CATH homology
 2NN6 H;  5C3X A;  1CT1 D;  3PUX A;  2Q8R E;  2WB1 B;  2K28 A;  3CRL C;  2NN6 G;  1GUG A;  1B1Z A;  1MSH A;  2FHT A;  4ODG A;  1HUN A;  3CKI B;  2A73 B;  5FOB B;  4KKS A;  1EY8 A;  1SMY C;  4UDU C;  3BYT B;  1Q8I A;  4TRD A;  2RVL A;  2B2W C;  2ZXP A;  2DY8 A;  4X3U A;  4IFD J;  1VF7 A;  2PQE A;  2F0S A;  2IW3 A;  2F3V A;  4KKU A;  4ID6 A;  4B9X A;  3FEW X;  1SSO A;  1UEA B;  3X3N A;  1TWF B;  2EPB A;  3ND8 A;  4RGN A;  1CA5 A;  1PYW D;  1F9R A;  1S5B D;  1ZEQ X;  2KJX A;  5KRU A;  2SDF A;  4KJN A;  1WD1 A;  4O1N A;  2B2W A;  3IKJ A;  1HRJ A;  5EQ0 A;  1BCP F;  4LK1 C;  3J7Y W;  1IW7 C;  3S1N B;  3NWS A;  1SMY D;  1CQV A;  1S5C D;  1ICW A;  2NVT B;  1CK1 A;  5K36 G;  2KCC A;  1Q1B A;  5C0X H;  4IN3 A;  5BN4 A;  5C4J B;  3OSO A;  5ELE A;  3URY A;  1STB A;  5CV9 A;  4CKC A;  3LWE A;  3D6W A;  1I4X A;  3VA7 A;  1XYI A;  3TZU A;  4A3E B;  3DWQ A;  4DXF A;  1PRT B;  3GTQ B;  1BQQ T;  1FYC A;  5EBC A;  2PO4 A;  2RDG A;  1HTL D;  3OWF A;  2ICE C;  1PXU A;  5A2Q E;  5A35 A;  1SBB B;  3S1Q B;  1HQM C;  2DNC A;  4C1N K;  2XWJ B;  1TWA B;  2MJ8 A;  3PIO 3;  1OXV A;  3S16 B;  3WOF A;  2NTS A;  1QNU A;  2DNE A;  5KEE A;  4NW2 A;  2QIL A;  3MVV A;  1V8Q A;  2ID0 A;  2E2H B;  5JEA J;  1SNM A;  3MFG A;  1ROD A;  1NR4 A;  1DOL A;  4RH6 A;  3ERO A;  1JWS D;  2A69 C;  4OO1 I;  1U4P A;  4Y7N B;  5DNF A;  1HXY D;  1TII D;  4BY7 B;  4FXG C;  1LT5 D;  3D31 A;  4QMG A;  1UUP A;  3V96 A;  4I65 A;  3LWU A;  4DAY A;  1JWU D;  2JA8 B;  3NXW A;  2JXM B;  1CZG A;  1O7L A;  4ZKC B;  1Y1W B;  3QG1 A;  4J6H A;  5IT9 E;  1F77 A;  3T13 A;  4K8I A;  5J39 A;  2B8F A;  2OEO A;  4X3S A;  3BG3 A;  4DAP A;  4IFD G;  2Q8I B;  3DWA A;  1NCV A;  1F2Y A;  1DYQ A;  5HUR A;  5FKA C;  1Z6H A;  1K8O A;  2E2D C;  2B39 A;  2K6A A;  2Z1C A;  1ESF A;  2F0T A;  3JAM E;  3S1R B;  1DXM A;  3K57 A;  4N9T A;  4A3B B;  3HOY B;  1U4R A;  1DZ1 A;  1IHZ A;  5C5M A;  3VR4 A;  1B4O A;  1ESR A;  5LL6 S;  1BNZ A;  5A2Q L;  2I07 B;  3S17 B;  4DK0 A;  1EWH A;  1GHJ A;  1EY5 A;  1NR2 A;  4IQZ A;  2AWO A;  1DM0 B;  1C8C A;  1PRT C;  1TWH B;  3QWN A;  2K5W A;  4DA2 A;  2M9V A;  3L9A X;  5EPK A;  3V05 A;  3R2T A;  3FRP B;  5E4X A;  1I4P A;  1A2T A;  4OGQ C;  1EY4 A;  3BS1 A;  2EY6 A;  2R7Z B;  2YYZ A;  5IOC A;  3DWP A;  4ZLT F;  3NTK A;  3A8I E;  4ZRZ A;  3I90 A;  2L5T A;  2M00 A;  4MIU A;  2QKI C;  1F2M A;  2NUC A;  1ZYR C;  3Q6S A;  4BBR B;  1CQF A;  3DHQ A;  1I4H A;  1KLU D;  3AU7 A;  4XIG S;  1WCM B;  5IT9 L;  3HOZ B;  2K5Q A;  2A5H A;  1AFP A;  3K5L A;  4WRD A;  1PZI D;  1XTC D;  2E74 C;  1EYC A;  1LT4 D;  3SEB A;  3SK4 A;  2F0J A;  1KNA A;  4FO2 A;  1UNS A;  1S5E D;  3ONA B;  2SNS A;  1QG7 A;  2WIN B;  2F0I A;  4OIJ A;  3OPO A;  2AQ1 B;  1B50 A;  4DXG A;  3JAM L;  1ILQ A;  2G9H D;  3MXG A;  5M5W B;  2K01 A;  1NUC A;  3X3M A;  2J0T D;  3KLS X;  4ZK9 B;  2AUK A;  4G7Z C;  4MHE A;  3FVQ A;  4C3H B;  3IAY A;  1EZ6 A;  1EEF D;  1AW7 A;  1JR0 D;  3HOV B;  3V2T A;  3FDT A;  3SE0 A;  1ENF A;  1TWG B;  3I8Z A;  1TVX A;  4IUP A;  3E5S A;  3C46 A;  1SNC A;  2F0E A;  2LKV A;  3HRZ C;  3P1H A;  4A3F B;  1QJO A;  3HOX B;  1FNU A;  2IJ0 A;  2EY5 A;  1JIC A;  5FO7 B;  3BVG A;  3R2I A;  2IWH A;  4IUV A;  1JOQ A;  3C2P A;  1RDP D;  4P2C B;  4R8N A;  1I6H B;  3E0J A;  4QUC A;  5I6W A;  1B9N A;  5DM7 3;  4BA2 I;  2BDN A;  2BE5 D;  1GJX A;  1I50 B;  5M9O A;  1V1P B;  2Z8L A;  4EQO A;  3BYY B;  1STG A;  1O7Z A;  5G3L F;  5CBE E;  4NDX A;  1NSN S;  1HA6 A;  4H0L C;  3T4A C;  3GTO B;  1PTO B;  2A68 C;  4ZYS A;  3J7A V;  4QF4 A;  1H9S B;  1QE6 A;  3NK9 A;  3TP5 A;  4OO1 H;  4A3K B;  1A2U A;  3NTI A;  4HCE A;  4BWG B;  2IL8 A;  1X3P A;  1GUN A;  3DM1 A;  2X69 A;  2D5D A;  5C6A A;  5LHY 1;  2RBM A;  2PPB C;  1BUV T;  1M4V A;  5E4W C;  2A6E D;  5JPM C;  2JE6 I;  4IUU A;  4EQN A;  4IZ8 A;  5FO9 B;  1JWM D;  2VXW A;  2NVY B;  1R4P B;  3QB3 A;  3IFD A;  3KLS A;  1HA5 A;  5ELC A;  4IFD I;  1L0Y B;  2F0D A;  1SYB A;  3M4Y A;  3MXN A;  5I9O A;  4XYQ A;  4PMW A;  3NBH A;  4HMI A;  4K8J A;  2EDG A;  3I91 A;  4QB4 A;  1DJR D;  2L1B A;  1EIG A;  5M5X B;  3MC0 B;  2EXZ A;  2EYM A;  5C5L A;  3SR1 A;  2F3W A;  3AMU A;  4K6D A;  5IGG A;  5IIF A;  2R6G A;  2ZXR A;  4RHS A;  3GO5 A;  3K6O A;  3TDQ A;  5E3F A;  1HTP A;  4RKB A;  1JQY D;  3MHB A;  2MPM A;  3TN2 A;  4V0B A;  1SYF A;  4A3D B;  5D65 A;  2F03 A;  1H9M A;  5EJW A;  3RD4 A;  3QO2 A;  3EQL C;  4S3S A;  4A3I B;  1HHV A;  3RZD B;  4RCN A;  5IOD A;  3MXU A;  2R61 A;  4GZY C;  2B63 B;  1Q90 A;  1U9R A;  4IUR A;  1VMP A;  1RTN A;  1PZJ D;  1J9O A;  1JB3 A;  1STA A;  1I6V C;  1TS4 A;  4DNR B;  4ILW A;  3RLF A;  3Q23 A;  4Z9C B;  3OMC A;  4KMU C;  5ELD A;  1DCZ A;  4G7H C;  5I2X A;  1EY6 A;  3WOE A;  4K2K A;  2K03 A;  1HFN A;  4X3T A;  1B3A A;  1PTO C;  3UI2 A;  4CHT B;  4KV6 A;  1ENC A;  3WDN A;  1RF2 D;  4IUN A;  4XQQ A;  1TS5 A;  1V1P A;  3D8G A;  3FMC A;  1STY A;  3CQZ B;  5J22 A;  4Q0F A;  2BCO A;  5C3E B;  4FF1 A;  1QB5 D;  1OO9 B;  3A7A B;  5IGF A;  5CV6 A;  2F0F A;  2L55 A;  2EJF C;  1I4Q A;  3P7J A;  5CV8 A;  1T5E A;  3TP8 A;  1VDZ A;  1R9T B;  3P75 A;  1EY7 A;  2FIN B;  1PFN A;  2K1B A;  1O80 A;  4DGZ A;  4HSP A;  1IKL A;  5I6Y A;  1LTS D;  1PTO D;  2F0P A;  3I4M B;  3SHL A;  5K36 H;  3M4O B;  3ERQ A;  2RA4 A;  3M85 A;  1Q1E A;  4XQN A;  2AQ3 B;  1EU4 A;  4K14 A;  4C3I G;  1TWC B;  3VYU A;  1B9M A;  1GHK A;  3BDC A;  3GV6 A;  4DN4 M;  5CGK A;  3U9S A;  1L0X B;  4DF7 A;  1S4Z A;  2NWG A;  2G9D A;  1LAC A;  3S14 B;  2L4N A;  1A3T A;  1ZXT A;  3OIQ A;  2DN8 A;  1TY0 A;  3VR6 A;  1G91 A;  2SEB D;  4G7O C;  4MN3 A;  4ZUJ A;  1XXG A;  3PUV A;  4FXD A;  1IW7 D;  2VUM B;  1KDA A;  2QF7 A;  2OXP A;  1CA6 A;  2B2V C;  2K33 A;  4ZUI A;  1E2W A;  4R8I A;  2LFN A;  2XRQ D;  4HSV A;  4TSS A;  1WTX A;  1PFB A;  1ET6 A;  4K2L A;  1S5F D;  1TU2 B;  1LO5 D;  1B53 A;  4K5X A;  4RWS C;  5J1Z A;  1I4G A;  2VB3 X;  2CVR A;  1B44 D;  4K5W A;  2E76 C;  5KNC A;  4LAA A;  1CZW A;  2Q8T A;  1QWY A;  1U4M A;  1LAB A;  4JK1 C;  4HR7 B;  1G8Z D;  3GP7 A;  4KY6 A;  3HS0 C;  1A3V A;  4IFD H;  2L0C A;  4CGY B;  1JC7 A;  5KIX A;  2JEB I;  2KHS A;  2KQ3 A;  3ITP A;  4U68 A;  2FFK B;  2BA0 A;  2PYK A;  4BS9 A;  4LJZ C;  2RDF A;  2A69 D;  5EKL A;  1JCK B;  1MGS A;  1LV9 A;  1SYG A;  1F2Z A;  2XSC A;  2PNR C;  3KF8 A;  3NQT A;  2K5D A;  4WFN 3;  1J8I A;  4RFB A;  4KK7 A;  3PIP 3;  3TSS A;  3H94 A;  1RKN A;  1Y8P B;  2L11 A;  3BVZ A;  3H91 A;  3HOW B;  2JA6 B;  1HCZ A;  1Q12 A;  3GTG B;  2KA7 A;  1QOH A;  3MTS A;  3KBG A;  1LLR D;  5AFW A;  1D5X C;  3NPP A;  2B2T C;  3K5M A;  3NP8 A;  4H44 C;  4I7Z C;  3W3A A;  5KYI A;  2X6G A;  1BF4 A;  1SYD A;  2RQX A;  3PUZ A;  3GTL B;  2R93 B;  2VNU D;  4M1U B;  2IX0 A;  4J1M A;  4L63 B;  2EJM A;  4EGV A;  2EVB A;  1EFI D;  2HUG A;  1Y8N B;  1ENA A;  5NUC A;  1SNO A;  3Q22 A;  2QCP X;  5CV7 A;  4X3K A;  4FVM A;  3K5N A;  2O5J C;  2K7V A;  1KLG D;  3PMF A;  5JEA H;  3VA5 A;  1YNN C;  1SE3 A;  2EYO A;  3QOL A;  4IUQ A;  5JEA G;  2X6L A;  2MP1 A;  5DEH A;  1PRT D;  2O4X A;  1PDQ A;  2KUM A;  1EU3 A;  3D6C A;  1UAP A;  1C48 A;  3OMG A;  5EBD A;  1PMR A;  3EA6 A;  2L12 A;  1XX8 A;  1AZQ A;  2RKS A;  1G2S A;  2EY1 A;  3NQI A;  2AWN A;  4N9P A;  1ZYR D;  1SE2 A;  1SDF A;  1OXT A;  2AQ2 B;  2EJG C;  2XIW A;  2MGS A;  4DK1 A;  3TP7 A;  2C9O A;  1SYE A;  1C4Q A;  2WKD A;  1FNW A;  3OHX C;  4KI0 A;  2KOL A;  3MWY W;  3SXH A;  3HZX A;  3DEP A;  3VYT A;  2IX3 A;  3OIP A;  3OWE B;  1FD7 D;  3M7N A;  2D9U A;  1RHP A;  3GD7 A;  1AEX A;  3VR5 A;  3N52 A;  2F0L A;  1X3Q A;  4PQX A;  4C56 C;  5T1G A;  3LX0 A;  1KAB A;  4L6T B;  1D5M C;  4R9W A;  3R8B A;  4HAE A;  1IKM A;  3GTM B;  1TT2 A;  4B9W A;  4PMB A;  3J81 E;  1M8A A;  2N88 A;  5JOB A;  2NB0 A;  3H0G B;  3NSW A;  5I2Y A;  2SNM A;  3MA2 B;  4CBV A;  3L7Z C;  1F9P A;  3MZ5 A;  1RD9 D;  5KNB A;  1JOR A;  2E2J B;  1WTP A;  2F0G A;  2TMP A;  1PZK D;  4C3I B;  4RKL A;  5FO8 B;  1KDC A;  2LS0 1;  5D3I B;  4HMJ A;  3GTJ B;  4CJ2 C;  2HCI A;  1SND A;  1ET9 A;  1SNP A;  4F8M A;  3NWT A;  2B2Y C;  2PZW A;  3LNN A;  3MAQ A;  3HGB A;  2PMZ B;  4BA1 I;  4F7X A;  4F88 A;  1WVL A;  2A68 D;  3BVM A;  2JEA I;  2F0U A;  3HEJ A;  3GV3 A;  4OHJ A;  2NZ1 D;  1ZKO A;  2WAQ B;  3L3O C;  2WII B;  3K59 A;  5C0X J;  4C1N I;  1RJT A;  2JYO A;  2Y0S B;  1K8M A;  1LTB D;  2EYH A;  1TR5 A;  2HCC A;  1OXX K;  5EKI A;  2EYP A;  4A93 B;  1TS2 A;  5D3D A;  1H9J A;  5ISR A;  5CMD A;  1SEB D;  3A55 A;  4WOR A;  4KN7 C;  1CHP D;  3RMH A;  2QDB A;  2F1M A;  3W2D A;  1TY2 A;  2A6H C;  2PZT A;  2XRS D;  4KN4 C;  1VCI A;  2WKC A;  1FNV A;  3EFX D;  3J81 L;  3I70 A;  3K5O A;  1SE4 A;  1SJH D;  4O42 A;  5T1I A;  1GXD C;  3I4N B;  3K7A B;  3J7A F;  1LTI D;  3S9W A;  4HN7 A;  3HP3 A;  1Z7T A;  2O5I C;  1KAA A;  1HQR D;  2B8G A;  2KEE A;  3T53 B;  3RUZ A;  5F2D A;  2JA5 B;  3PV0 A;  2WV6 D;  3CHB D;  2XNA C;  2OF1 A;  2RDH A;  2BA1 A;  2A6H D;  4EVO A;  1AZP A;  1DOM A;  1PLF A;  2NYZ D;  2HDM A;  4OL7 A;  3EVQ A;  1BCP B;  3A56 A;  1BOS A;  4B08 A;  5KND A;  3HOU B;  3BZD B;  1HFG A;  1Q3L A;  1PTO H;  5EGT A;  3GTP B;  1H9S A;  2RSN A;  3D4D A;  3BDL A;  2E75 C;  2NTT A;  1LT3 D;  2EZV A;  4XYO A;  4PMC A;  2KCN A;  1B2T A;  1E2Z A;  1DOK A;  3QJY A;  3PO3 B;  5HGT A;  4QCL A;  4U67 3;  2H1E A;  4E6I A;  2A74 C;  3SDZ A;  1AN8 A;  1IYU A;  2CW0 C;  3A54 A;  5LL6 X;  4FXK C;  3C1E A;  3T16 A;  3E6Z X;  2IPK D;  2XVS A;  1VMC A;  1BO0 A;  2ICI A;  1LTA D;  4HED A;  1V43 A;  1MSG A;  4A3G B;  2L9H A;  1CM9 A;  2QEJ C;  5TSS A;  1U4L A;  1Y69 U;  2NBF A;  5C0X G;  3OW7 A;  1QIL A;  3OOC A;  2NVQ B;  4XT1 B;  3AB9 A;  3TP6 A;  2IX1 A;  4KHV A;  3F2U A;  2V4D A;  5JVH 3;  2IT1 A;  1FR3 A;  1A3U A;  1VF5 C;  3NBI A;  2J7Z A;  1LT6 D;  1OXS C;  2D2C C;  5JPN C;  2CW0 D;  1EOT A;  2M2L A;  1CTM A;  1Y1V B;  4FNF A;  3DMU A;  3NHH A;  5EPL A;  1I4R A;  4H7B A;  2KED A;  2TSS A;  2SOB A;  3I73 A;  4ULL A;  5FLX E;  5C4H A;  2NVX B;  5DM6 3;  3K0Y A;  4K5V A;  2GA4 B;  4KY7 A;  4C3J G;  1ML0 D;  3IL8 A;  4WJW A;  2O2L D;  2N55 A;  2B2V A;  1PRT F;  4AYB B;  3T51 B;  3O13 A;  3I3C A;  1CI3 M;  3CRK C;  3R93 A;  1BCP C;  1D2B A;  4KJO A;  5JAV A;  5CC4 A;  1I3Q B;  1G29 1;  1RCV D;  3I72 A;  2EYJ A;  2AUJ D;  5C3W A;  1BDO A;  3D4W A;  1DON A;  4JBW A;  4RA8 A;  5EKK A;  4M8A A;  1DD2 A;  5M5Y B;  4KKT A;  1IYV A;  2F0N A;  3A8K E;  5COY A;  1T5X D;  4EQP A;  5FK9 C;  4V19 0;  3A8J E;  3S15 B;  3TBI B;  4XT3 B;  1W6K A;  1QCB D;  5JJZ A;  1JE4 A;  4DNT B;  1SNQ A;  1BR9 A;  3QOJ A;  1BCP D;  4F87 A;  1OXU A;  1EYA A;  1HUM A;  2HQE A;  5K5P A;  1WTQ A;  5IGD A;  1WTW A;  4ME5 A;  2BDO A;  5C44 B;  4XTC S;  2LY7 A;  2HDL A;  1D5Z C;  3VR3 A;  2FJ2 A;  1F9Q A;  2LMC B;  3SVM A;  2J4X A;  2FMC A;  3ZYY X;  5KYL A;  2VB2 X;  2EE1 A;  5CV4 A;  3NUC A;  2XN9 C;  4H13 C;  4TKO B;  3A7L A;  1EEI D;  1EZ8 A;  3D4R A;  3KBX A;  4XDX A;  5IGC A;  1NAP A;  1CFM A;  2EYL A;  5FLX L;  1STN A;  5CR3 A;  4FYD A;  3DUZ A;  4Q5V A;  1SJE D;  4RGM A;  2XWB B;  1EL0 A;  3Q0A A;  1PFM A;  1TS3 A;  4YIJ A;  2R3Z A;  3FPU B;  4IUT A;  3GTK B;  2B2T A;  4UAI A;  1YNJ C;  4FF2 A;  1LTG D;  4QIW B;  1X32 A;  1HPC A;  2NN6 I;  1BBX C;  4ZAI A;  4XQJ A;  1F2L A;  4ABN A;  4C2M B;  4HCS A;  5C4X B;  2DY7 A;  4NMZ A;  1MD2 D;  1FGB D;  4ZKB B;  2F4I A;  1S5D D;  3P20 A;  3TZD A;  4KD4 A;  4RAU C;  5CV5 A;  2D62 A;  3FPP A;  2BOS A;  4ZQ3 A;  2EY2 A;  2JA7 B;  2K32 A;  1E2V A;  3VYR A;  3MXP A;  1YNJ D;  1AP0 A;  5DAU A;  3SK8 A;  5C4Z A;  1XWE A;  3J80 E;  1G6Z A;  4KTA A;  1YNN D;  2RSO A;  1TKW B;  3G6J B;  1WTO A;  3GQB A;  1EIH A;  2BE5 C;  2F0W A;  4DAV A;  1V1O A;  1A6X A;  4DU9 A;  4CJ1 B;  2B2U C;  2KVM A;  4A3M B;  3G7L A;  1F9S A;  4HTH A;  4IAL A;  1STE A;  1QNK A;  2F0M A;  5C0X I;  1LTR D;  4CKB A;  1LTT D;  1ONL A;  3M3Y B;  4LMQ D;  1CHQ D;  1JOK A;  1EQV A;  2C5C A;  2KEC A;  1SFO B;  1II3 A;  1SXT A;  1EY0 A;  1GUO A;  2PW5 A;  2F0O A;  3H6M A;  4K6L A;  1R4Q B;  3VYS A;  4RHR A;  3H09 A;  3M7G A;  2ENB A;  2B2U A;  2CQA A;  1BXT A;  2Z4H A;  4QUF A;  2PW7 A;  3KK7 A;  1W6J A;  2WAC A;  4PV1 C;  2A6E C;  3KLR A;  1GUS A;  2K04 A;  4NP5 A;  2PCF B;  4CJ0 B;  1MBY A;  1K83 B;  3D3R A;  3S2D B;  1WTR A;  2I46 A;  2ZT9 C;  2H4O A;  1WTV A;  3HKZ B;  3KUP A;  4L8J A;  2YU9 B;  2JSO A;  4FF4 A;  2JP1 A;  3VR2 A;  1KTK A;  3T56 B;  1Y8O B;  3PUY A;  1Z47 A;  3C1F A;  4OIK A;  4XXE A;  3MFY A;  5M3M B;  3PUW A;  1A15 A;  2EYF A;  3N6R A;  3U9O A;  3S1M B;  2E2I B;  3PO2 B;  2F0Q A;  4FP5 D;  4BBS B;  2F0V A;  5CYU A;  4OO1 G;  5ELB A;  3DEO A;  3J80 L;  1TQO A;  1STH A;  2MUY A;  4RCO A;  2R92 B;  3H3V C;  1RTO A;  1SAP A;  4PNY A;  1H9K A;  3QIA A;  4BY1 B;  2K05 A;  1JOO A;  1PTO F;  2FMM A;  1MI2 A;  3DXJ C;  3HG9 A;  1KDB A;  3BDO A;  1GUW A;  3Q24 A;  3ND9 A;  4G57 A;  5IGE A;  4DFA A;  1H9R A;  2F0H A;  1IL8 A;  4KHZ A;  5COR A;  2EOT A;  2B2Y A;  5CBA E;  2OT2 A;  3NTH A;  5I9P A;  5M3F B;  3RZO B;  3K58 A;  4G4K A;  2PZU A;  1WD0 A;  1E0B A;  2CHB D;  1KNE A;  4A3J B;  5JVG 3;  2ZXO A;  3NE5 B;  1O78 A;  3SK5 A;  1ILP A;  1EWC A;  3FKI B;  5D14 A;  1EQT A;  3I4L A;  3R3O A;  5ELF A;  4J8Q A;  4C3J B;  4KY5 A;  1G2T A;  5BN5 A;  4RGT A;  4NKL A;  2Z4I A;  3S2H B;  5BN3 A;  5E1F A;  1SYC A;  1EY9 A;  5EPJ A;  3C3L A;  4FF3 A;  1GUT A;  2MHV A;  1O7Y A;  4C3H G;  1D1K A;  4TQU S;  3TME A;  5IGB A;  1D6E C;  5KGU A;  2F0K A;  3SK6 A;  4RGO S;  2WP8 J;  1EYD A;  3CU7 A;  5I4D A;  1D1I A;  4CKE A;  3EJI A;  3MEH A;  5G3L D;  3IFT A;  4KD3 A;  1GOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...