4KD4A

Crystal structure of staphylococcal nuclease variant v23l/l25v/v66i/i72v at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
132
Chain Sequence
LHKEPATLIKAIDGDTLKVMYKGQPMTFRLLLVDTPETKHPVEKYGPEASAFTKKMIENAKKVEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
total genus 37
structure length 132
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4kd4A00
4NMZA 3R3OA 5IODA 5J1ZA 2RBMA 2ENBA 2PW5A 5NUCA 5I9OA 2EXZA 1EYAA 5E3FA 4TRDA 5HGTA 4HTHA 3QOLA 2F0GA 1EZ6A 3HZXA 2F0EA 5E1FA 2F0DA 3QOJA 1KDBA 5C3XA 5I9PA 5CV9A 3OMCA 5IGFA 1SYFA 1II3A 2QDBA 5EGTA 3SK4A 5DAUA 3BDCA 1STGA 1A3UA 2F0NA 4K6DA 2RDFA 3SR1A 2F0OA 4KJNA 2F0JA 4I65A 3D6CA 4KD3A 4ZQ3A 4ZUIA 5M9OA 1KABA 4NDXA 5I6WA 4OL7A 3NP8A 5J39A 3NK9A 3SHLA 1TT2A 2EYOA 2RKSA 1STAA 4RKBA 5CV7A 2EYLA 1A3VA 2OEOA 2SNMA 2EY5A 4KY7A 4J1MA 4N9TA 5IGEA 5JAVA 1A3TA 3LX0A 3TP7A 2PZWA 4PNYA 1STYA 1EY9A 1JOOA 1IHZA 1NSNS 2F0WA 4E6IA 1ENAA 4B9WA 5KEEA 5HURA 2F0UA 1F2ZA 1EQVA 3V2TA 1SYGA 2PW7A 4K5XA 5IGCA 4IUNA 1KDAA 3ITPA 1EY6A 4PMBA 5K5PA 4DF7A 5KIXA 4EQOA 3QB3A 2EYHA 3SK5A 5IGBA 3PMFA 3DHQA 1SYCA 3EVQA 1U9RA 4KHVA 3BDLA 2M00A 2F0LA 3SK8A 2F0PA 3C1FA 3MEHA 4RKLA 5F2DA 3NUCA 1RKNA 1NUCA 2WACA 1EY0A 4K5WA 4EVOA 5IOCA 4IZ8A 3D8GA 5C4HA 4S3SA 1SNPA 5CC4A 4WORA 4K8IA 2O4XA 1KAAA 2SNSA 4YIJA 4B9XA 1ENCA 1EZ8A 3EJIA 4KV6A 4KTAA 3RUZA 3ERQA 5KYIA 4H7BA 4KD4A 4N9PA 3DMUA 3E5SA 5CV5A 5C3WA 2KHSA 5C5LA 4IALA 4NKLA 3SXHA 4HMIA 1F2MA 4K8JA 3TP8A 3S9WA 1EYCA 2F0HA 4K5VA 4DGZA 2PZTA 1A2UA 1TR5A 4J6HA 2F0TA 4NP5A 3TMEA 4F7XA 4F8MA 5CGKA 1SYBA 5IIFA 5KRUA 1KDCA 5IGDA 2PYKA 1SYEA 1JOKA 4KY6A 2OF1A 3OMGA 2F3VA 2PQEA 1EY4A 1STNA 1EY8A 3NQTA 2EYPA 2F3WA 3T13A 3TP6A 1JOQA 1A2TA 3TP5A 2KQ3A 3MXPA 4WRDA 3T16A 5IGGA 3U9OA 5I6YA 4ME5A 5EKKA 2EY6A 5CV6A 5EKLA 4ZUJA 2EY1A 2SOBA 1STHA 3NHHA 5CV8A 5DEHA 5J22A 1SNOA 4QMGA 4K14A 2F0SA 2F0QA 4HMJA 4G57A 1SYDA 3D4DA 1SNQA 3HEJA 5JOBA 4K2LA 4QB4A 4DFAA 3MZ5A 1SNDA 4KY5A 1JORA 1AEXA 3D4WA 3EROA 3OSOA 4DU9A 4ODGA 1EY7A 4KJOA 2LKVA 4EQNA 1EYDA 2F0KA 3OWFA 3P1HA 3MHBA 5ISRA 4QF4A 3VA5A 2HQEA 5C5MA 4EQPA 3NXWA 2EYMA 3P75A 5CR3A 2EYFA 3SK6A 2PZUA 5KYLA 1SNMA 1TQOA 4K2KA 2F0MA 1SNCA 3MVVA 1STBA 1EY5A 4LAAA 5C4ZA 2F0FA 5KGUA 1F2YA 2EYJA 4PMCA 4R8NA 2OXPA 2EY2A 5CV4A 3C1EA 3H6MA 5C6AA 2NUCA 2F0IA 4MIUA 2F0VA 4ID6A
chains in the Genus database with same CATH superfamily
1YNXA 2K5DA 4LUOA 5I9OA 1J6QA 3HRZC 1HNWQ 1G2TA 3QOLA 5E1FA 2I5MX 3HZXA 3K6OA 1QVGA 3HOZB 3MXNA 1TWCH 1AW7A 1HZBA 3L2PA 4RHRA 4IFDG 1SJED 1VQJA 2CH4W 1Y8OB 2F0JA 2VQEQ 2BOSA 5IYDG 4YWLA 4BBSH 1YHQA 3NP8A 2PO4A 3H94A 2ZM6Q 1OXTA 5EPLA 5IGEA 5M5WH 2Q2IA 4ZLTF 3K57A 5C44H 5C4JH 4OIKA 3PUYA 1DM0B 1TWFH 3NPPA 4CBVA 1GUSA 4B3ML 1D5MC 3ITPA 2D5DA 1PFNA 1PRTD 3K5MA 4EX5A 3M4OB 1XPRA 3V05A 2K52A 2F0PA 1UAPA 2NB0A 4GNXB 4MNOA 2TMPA 1QWYA 2K7VA 4GNXC 1CUKA 1Z7TA 4JW0A 1LTRD 4LF7Q 3RUZA 5LL6S 5LMNL 4RGTA 3DMUA 3A5UA 1Y1WH 3LGJA 4L5QA 3STBD 2YYZA 2A19A 3CPFA 1F2MA 1HJPA 1B2TA 2E2IH 2PZTA 1UE7A 1WFQA 3UI2A 5IP9H 1N36Q 3VR4A 4DV0Q 3GV6A 3T51B 3NQTA 4MHEA 2JP1A 4PZ6A 5HY6A 3UE0A 1RJTA 1QZGA 5IYCH 4POGA 2UUAL 4C56C 4R4IA 4C3JB 1DZ1A 3TEHB 3NHHA 2SEBD 1CZGA 1MJEA 2F0QA 3H0GB 2R92H 4DXGA 2J4XA 3I72A 3MZ5A 3DLLA 1I6VC 1VQ7A 3S2DH 1X6OA 5DNFA 3KK7A 5BR8Q 4BY1G 4Y7NB 4B3RQ 5C5MA 5M3MH 1UNSA 1PA6A 3S1QB 3H3VC 5K36G 4K2KA 1JICA 3CMEA 3Q8DA 5IWAL 3TSSA 1SLJA 3C1EA 2DGYA 2CWAA 5DM63 3PUXA 1CFMA 1I50H 4TSSA 4PMWA 4Q0FA 1EYAA 5HGQA 4IUTA 4NXNL 4A3KH 1O7IA 5C3EH 3QOJA 2JA7G 4LF9L 3ND9A 3QR8A 4IOCA 5ELCA 5IGFA 1M1KC 5AFWA 2Y0SB 2NYZD 2F0OA 2NVYH 3NE5B 4A93G 1HNXQ 3Q23A 4DR1Q 1LTSD 3KF8A 4HJ7A 1JCKB 1WCMG 3K7AH 4JI3Q 4JOIA 1ET6A 1CKNB 3FPPA 3HOVH 5G3LF 4LMQD 2IL8A 1TWAH 2UU9L 4UP8A 5ELOA 4E6IA 2QILA 4A3GH 1OO9B 4A3FG 2LFNA 2JA6H 3RD4A 1P8LA 2F4VQ 2KCCA 1J5EL 1UWVA 1YNNC 1ZYRC 3DHQA 3FKIG 3AYHB 3HS0C 4J8QA 1B3AA 3ZJYC 4FXKC 4QJFA 4DUZQ 1K8MA 3CU7A 1V1OA 1K28A 3I4OA 1SNPA 4DV7L 2JXMB 2ATWA 4A3EB 5KYIA 3PV0A 3G48A 3WOFA 3UDXA 3E5SA 2BA0A 5AJ3Q 3S9WA 2F0HA 2R7DA 3OOCA 4L5SA 5CMDA 3S17B 5EKIA 2FFKB 3A8JE 1C8CA 3S16B 3OWEB 1CHPD 4IPCA 2B2UA 4IN3A 5A2QE 3M3YB 3EQLC 2AQ1B 1VQPA 5IGGA 3T16A 4YWMA 1TS4A 4UPAA 4IJLA 4GLVB 1DOLA 1VQFA 3BZCA 4NB3A 5M3FH 3RZDB 2EQSA 4DV1Q 1PH5A 3BZKA 4H02A 1UE1A 4J15A 4KKSA 1UEAB 4BBRH 4IUUA 4AH6A 4POFA 3E6ZX 4ULLA 1RD9D 4IUVA 1HNZQ 2RSNA 2EYJA 2JN4A 4DR2Q 3I4MH 1K8GA 3PQIA 1VQCA 2JA9A 3CCEA 2B63B 2K4KA 2MPMA 5CYUA 4GOPA 4GKKL 1XNQL 3BVZA 3S1NB 3QO2A 4DR5Q 3I4NH 4HTHA 4PZ7A 1DJRD 2AWOA 3R2IA 3F8TA 2VY3A 1KDBA 3HOUH 3F2DA 5CV9A 1PFMA 2E8GA 2ZJQA 5FLMH 4O0AA 5EGTA 4LFBQ 2VUMG 1D1KA 1ILQA 2BCOA 1Q8IA 3G6JB 4RCNA 3O13A 1LYLA 1HR0Q 2VS1A 5JAVA 1N32L 1KL9A 2LY7A 1T9HA 3BYTB 3PIO3 1PYWD 1IHZA 4OONA 1EIHA 4GZYC 2FMMA 1SYGA 2PW7A 2HQLA 1NBWA 1CHQD 2X6LA 2D62A 1AH9A 4DV5L 1VQKA 1MHWC 1YVCA 4ILWA 1SFOH 1CA6A 1U9RA 3L0OA 3BDLA 4ME3A 2WB1G 3DWPA 4C3IB 1BBUA 3CAMA 3NUCA 3D8GA 4V190 1HZCA 1MI2A 1KAAA 3NWSA 4IFDJ 5FLXE 1KNAA 4KV6A 4IFDH 5D65A 3GP7A 1VDZA 4PG3A 3NQIA 2CCZA 3K80C 1A62A 5IYDH 4HMIA 3TP8A 5KNDA 4HIKA 1IBML 1L0WA 2UUAQ 1PHJA 2XWJB 1S5CD 2CQAA 4IURA 4KHPL 1WTHA 2UXBL 1I5FA 4RA8A 4RG1A 1M90C 3J7A5 1Z6HA 4B08A 1ASZA 1TWCB 1IKLA 3CC7A 2K6AA 5IWAQ 2B8FA 2MQHA 1QNUA 1HHVA 4JPBW 1YEZA 1BCPB 1QJOA 3CC4A 2EYMA 4BBSB 2XTIA 4K0KL 2UUCL 1BCPC 4IJHA 2EPBA 2Z1CA 2JA8H 3ULPA 1PH8A 5M5WB 1XPOA 4LF9Q 3VYTA 2KHJA 3A8IE 3QJYA 4IPDA 5C44B 1BXTA 3R3OA 4HAEA 5C4JB 5J1ZA 3MXNB 4HSPA 4H13C 4JC0A 2XGTA 1E2WA 1WTVA 5I9PA 4IPHA 3DUZA 4RGMA 4LFAQ 1II3A 3GTPH 4FO2A 3W1GA 3HOXG 3G6EA 3GV3A 2OCEA 3I7FA 3HOYH 1VQ9A 4CHTB 1SE3A 3J81j 1CM9A 1Y1WB 2Z6KC 2EY5A 3CCSA 1B3QA 4KKUA 1J5EQ 2B2WC 3E0EA 3LX0A 1Y8NB 1YNJC 3TP7A 2E2IB 4PNYA 3PIPA 1STYA 5K36H 1AN8A 1H9RA 2Z4HA 4LNQA 4LFCL 1EWCA 1U5KA 2HHHL 1Q86C 4IUNA 3QB3A 1IBLL 3U9SA 3PMFA 4ZAIA 4GLAC 3I56A 4GKJL 3SK8A 1LT6D 3ERSX 2JA7H 1IW7D 4BA2I 2JEAI 4K8IA 3ICEA 2R92B 3HKZG 1BOSA 2EJFC 1NJIC 2UUBL 3S2DB 2JA5G 1WTOA 3BYYB 1WCMH 3WOEA 1PVOA 1HRJA 3W1BA 1NE3A 1A2UA 3IFDA 2PYKA 4X3SA 3VYRA 3S14H 2PQEA 1PLFA 3TP5A 4XT1B 1RF2D 2FXQA 5I6YA 4A3FH 3TQYA 1I50B 3GTOB 4MTNA 2QKIC 4LW1A 2WB1E 1EWIA 2PI2E 4QMGA 4A3KB 1B70B 5C3EB 1HUMA 2C9OA 4X66L 2Q8RE 4YCUA 3J7AV 2NVYB 4QF4A 3CC2A 4OO1H 1D8LA 1GUOA 2N88A 4GKKQ 1UEBA 1XNQQ 3UDGA 3K7AB 3DM3A 4NPSA 1V1QA 3JAML 4DAVA 3R8BA 3TDQA 2EY2A 2F3IA 2G9HD 3C3LA 1A63A 1ESFA 5T1IA 1SMYC 4NMZA 3DEPA 4A3LH 4A3GB 2EXZA 1MJCA 3IRBA 1NCVA 2JA6B 1Y8PB 2F0EA 1J8IA 1X55A 4DK3C 1SYFA 2QDBA 3NTIA 1N32Q 2ZTEA 3BDCA 1UE6A 4K6DA 5EQ0A 3WWVA 3WDNA 2HCIA 5CORA 1LTGD 4ZUIA 1KD1C 1KABA 1E0BA 1HPCA 4F87A 1STAA 1RODA 2AUJD 5C0XH 1U4MA 1CQFA 1PZID 1VQDA 3I70A 3K59A 3LWEA 1NMGA 1PTOC 1GUTA 4IQZA 1JWMD 1X3GA 2HIVA 3S1RH 4QCLA 1XMOQ 1SAPA 4DK0A 4A3BH 3T1HL 3X3NA 3HG9A 4L5TA 1C7YA 4QUCA 4CKEA 1CKMA 5C4HA 1D5ZC 2NTSA 2E2JH 1IBMQ 4X6AH 4DV6L 2AQ2B 3J7ZC 1K0RA 2NZOA 5M3FB 3PCOB 2KA7A 2B3GA 4JI7Q 2VUMH 5E4XA 2A73B 4KHPQ 3IKJA 2KHSA 4O42A 1G6PA 4BBRB 4NP5A 4JYAL 1QOHA 2OF1A 4RGNA 2J7ZA 4LF5L 4C3HG 3I4MB 2AMCB 2AUKA 2IWHA 3GTKB 1BBWA 4ZK9B 4IUQA 3D4RA 1DXMA 4B3TL 5CV6A 2IY5B 1TIID 2K5HA 1I94L 4LF6Q 3K0XA 2C5CA 3I4NB 4O1NA 3LWUA 2F0SA 4K0KQ 3TZDA 4B3SL 3HOUB 2V4DA 1YJWA 4XQNA 1CZWA 1JE5A 3DM1A 3BVGA 2L11A 4OELB 3HKZE 4LK1C 4U673 2JEBI 1IZ6A 3I3CA 4TVAB 5GAGC 1LT3D 2WFWA 4GOPB 3P7JA 1EQQA 4DR7L 1FD7D 4JI0L 1HTLD 1Z47A 1KLGD 2F52A 4K6LA 1WTXA 1DOMA 4FVMA 3GTMH 3MXGA 4DAPA 2PQAA 1HA6A 3VR5A 3SE0A 4DAYA 4TRDA 1GJXA 4Q5VA 4AYBE 2F0GA 1RDPD 2OTLA 4A3MG 3E9IA 1SFOB 4CDCC 4WJ3M 1WVLA 1PFBA 3MWYW 3CW2C 1I4RA 5EBCA 2R61A 5BN5A 3FRPB 4KKTA 2XRQD 1JMCA 2RKSA 2HHHQ 1CK1A 1I6HH 2SNMA 1PH1A 3D3RA 4J1MA 1IBLQ 2K32A 3OIPA 1LTBD 4XQQA 3H3VI 4OX9L 1CQVA 3PO2G 3B6YA 5KEEA 2K03A 2P5ZX 5FKAC 3VDYA 5IGCA 4A3JG 2R7ZH 1B4OA 4DF7A 1S5ED 2A6HD 3EVQA 3HOWG 3KBXA 2UUBQ 3C1FA 1X3EA 1ET9A 2O4XA 1J9OA 1BQQT 2N3SA 3NSWA 2CHBD 4N9PA 3HOXH 1Y1VG 1B53A 2Z6KA 2KJXA 2B2WA 2FINB 4J6HA 1K9MC 5CGKA 3H09A 2X6GA 2FJ2A 3MFYA 1JOKA 2M9VA 2A68C 2JA8B 3DEOA 1ASYA 2R93H 2KHIA 2JJQA 1X56A 4OO1I 1VCIA 1N9WA 2BA1A 3CF5A 1HXYD 1WI5A 3HOZG 2A6EC 4K14A 1SNQA 3JAMi 1BR9A 5IY0A 4Z9CB 1OXSC 3P1HA 1K8OA 3NWTA 1LT4D 4OWTB 1VMCA 2K75A 2CH4A 3P20A 4LF4L 3OIQA 4QIWB 2BE5C 1EEID 2JA5H 3HOYB 1N33L 3ONAB 1STBA 1V1PB 2QCPX 3KLWA 3W5OA 2IX3A 5C6AA 2RVLA 3V96A 1G91A 2JSOA 3AB9A 1H95A 2O5IC 2RHSB 2KENA 3H15A 1WTRA 3K81C 4ALPA 3TS2A 2UXDQ 2PCFB 4JI1L 2Z0SA 2CWPA 4X65Q 3CQZH 3PO3G 3OMCA 5L37A 5C0XI 2EJGC 1C0AA 5J3BA 2OT2A 1STGA 2JA7B 2GN5A 4I65A 1K3BC 3RR5A 2EXDA 4UAIA 4ZQ3A 4KD3A 4G4KA 4OL7A 1F77A 3VR6A 1NTGA 3NBHA 1TT2A 4PZ8A 1QVFA 5M5XH 3AFQA 1WCMB 5IT9c 1VS0A 4OHJA 1JOOA 2CW0C 2QEJC 4KN4C 3UDFA 2L1BA 2A74C 3RMHA 2A69C 3S14B 4K5XA 4TQUS 4A3IB 5K5PA 1NY4A 2JQOA 4ZKBB 1FYCA 2ALYB 1BCPF 3E0JA 1I3QH 4C3JG 2X69A 4A3FB 1N34L 4A3DG 4RKLA 1QZHA 4K5WA 2VQFL 3CRLC 4IZ8A 5IOCA 3PUZA 3G4SA 1B8AA 4XXEA 4X3TA 1I4HA 3GD7A 1VQ8A 4DK6C 1DD2A 1FNWA 1SE4A 1O7YA 4G7OC 3K5NA 5C5LA 1S4ZA 3RN5A 5I4DA 1BBXC 1E22A 2DJGC 3TMEA 5GAHC 4B3TQ 1V8QA 4GN5A 1I94Q 4ZYSA 2AKWB 1PH2A 1GM5A 1MBYA 3JC66 2E2HH 3BS1A 1EIGA 4YHHQ 1AFPA 4CJ0B 5LHY1 3JAME 2L55A 2EY6A 4FNFA 3KJPA 3VR3A 1JWSD 1YNND 1XXGA 2CVRA 2MO1A 2CFMA 4QQBX 2Y0SG 4K2LA 1GUGA 3BZDB 4YY3L 3EROA 3OSOA 3NELA 4DR7Q 4KJOA 1PTOH 3PIP3 4JI0Q 1YJNA 1NR2A 1PFSA 3MHBA 4DR3Q 2PMZB 2VXWA 2H5XA 2ASBA 3NXWA 1I4XA 2KUMA 2IX0A 4RHSA 1IBKQ 3EBEA 1CT1D 1XTCD 4RFBA 2N49A 4DXFA 1DOKA 1TU2B 3FMCA 1HFNA 1LACA 4DR4Q 4AQYQ 2UXCL 2V1CC 2NUCA 1BVSA 1V43A 4C3HH 1SDFA 2I5LX 3S1RB 2PW5A 5NUCA 2KECA 5EJWA 3T1YL 1VQNA 4A3BB 1GUWA 5E3FA 4X62Q 1XPUA 1FGUA 3ULJA 3CCJA 3J80c 1E1OA 1SE2A 1F9PA 4A3CG 1WTWA 4R4TA 1A3UA 2GVAA 5GQOA 3OHXC 1XNRL 3NEMA 5A35A 3I73A 5J39A 1STEA 2VUMB 1YIJA 4I7ZC 1VQ4A 1PYBA 1AZPA 1VQIA 3GTQB 1BUVT 1XWEA 4HJ9A 2BH8A 5HURA 1E3PA 3M4QA 1AE3A 1KDAA 3GTGH 3TRZA 3CKIB 2E75C 2AQ3B 2NN6H 2NVXH 1EU4A 4XDXA 1H9KA 2F0LA 4MTKA 2FMCA 5IYBG 4A3MH 2SNSA 3FDTA 2HDLA 2ES2A 1MD2D 4B3MQ 4HCSA 3N52A 4X3KA 3S15B 1D1IA 3W2DA 2RHQB 4BA1I 4R9WA 1GD7A 1C9OA 1RIPA 1TR5A 3MFGA 5KRUA 1ICWA 2IJ0A 1P16A 1WOCA 4R4CA 2LSSA 1EY8A 5LMNQ 2B63G 1JOQA 3PO2H 3MXPA 2Z8LA 4XYOA 1JJCB 1HZAA 1DONA 2CKZB 1D2BA 3FP9A 3S24A 1HQRD 3MXUA 3GTMB 3KYHC 4A3JH 3FHWA 4ZUJA 3MC0B 2B2VC 4LF4Q 2NBFA 3HOWH 2LMCB 4G57A 5JOBA 1X32A 2RCNA 2R6GA 4F88A 4JVZA 4DNTB 1CTMA 4ODGA 4RH6A 4C2MB 4RWSC 4DK1A 4EQPA 3S2HB 1PZJD 1Y1VH 1ONLA 1VQBA 2NVTH 3KDFB 3MVVA 5FO9B 4JI1Q 1I6HB 2PQAB 2Q2UA 3J81c 4DAYB 5ELNA 3F1ZA 4DV3L 2YTVA 1Q46A 1VF7A 2L0CA 2IHEA 2R7ZB 3CCMA 2O2LD 1GKHA 1I4GA 3M4YA 4U68A 3I91A 2Y0SE 2QA4A 3SR1A 1XMQL 2YTYA 1Q90A 1Y14B 5M9OA 2M2LA 3PF5A 4ZRZA 4A75A 1H9MA 3CP0A 1R9TH 2NZ1D 1XYIA 4NXNQ 4HIDA 4KY7A 5I2YA 2BDOA 3HOXB 1WTQA 2WAQB 4HCEA 3ND8A 4GN3B 1DCZA 1V1PA 3AQQA 1BCPD 4WJ4A 1ILPA 1TWFB 2L12A 2BDNA 1JB7A 1PXUA 1PH9A 2FHTA 3GQBA 1QCBD 2R93B 1TWHH 2O5JC 2WP8J 2E76C 2LS01 5G3LD 4N8FA 1ESRA 4NXML 2UU9Q 1TWGH 2RDHA 2SDFA 1ICFB 2EVBA 3PO3H 1EZ8A 4BY1H 2XN9C 3T4AC 4KD4A 4HJAA 2B2TC 2K04A 1U0LA 2Z6BA 1L1OB 1R4PB 2EDGA 3HKZB 1L1OC 3I2ZA 4DV7Q 1SYBA 2ZTDA 2F1MA 3T53B 2JA5B 4O2DA 1GXDC 1YNJD 4CDDC 3T13A 3TP6A 4Y52H 2E74C 4WRDA 2Q8IB 4YY3Q 2N8NA 2K50A 3A8KE 3AEVA 1W6KA 4LUZA 5EKKA 4OXPA 4JCVE 2EJMA 4ABNA 4C3JH 4A3DH 4A93H 2HDMA 3CQZB 4KY5A 1YBYA 4JI5L 2D0OA 4DU9A 2QEXA 5M3MB 3OWFA 2RA4A 2UXCQ 1BO0A 5LMNW 1XJVA 4Y7NH 5KNCA 5GAEC 2PZUA 5KYLA 1SNMA 2VW9A 3T1YQ 1SNCA 5GADC 1EY5A 1VQEA 2F0FA 2HIXA 5M5XB 4AYBG 1SROA 1X3PA 4ZKCB 4PQXA 5DEHA 1MSHA 3FKIH 4P72A 2QDLA 2ENBA 1K73C 1SSOA 1XNRQ 5D3DA 1YITA 1PH4A 1LTLA 2A8VA 5E7NA 5IYCG 1QUQA 1UUPA 1SE8A 3Q6SA 3KJOA 2JYOA 2PNHA 2ZM6L 1O7LA 1RL2A 4DKAC 1SBBB 1VF5C 3DXJC 3NBHB 3D6CA 3TBIB 2ZXPA 5I6WA 1QILA 5JPMC 4JV5L 1HUNA 3C46A 4DR6L 2EYOA 1BDOA 3CPWA 4RAUC 3SK6A 2EYLA 1A3VA 2OEOA 2EIFA 3K8AA 3HOVB 2K1BA 5C4XG 2NN6I 2DJFC 1TWAB 3A54A 1Z9FA 1NNXA 3F2UA 1A0IA 1ZEQX 4RCOA 3CHBD 4NW2A 1EQVA 1Q8KA 1AZQA 2E2HB 4CGYB 4EQOA 3GO5A 1NMFA 4ZCKA 1Q3LA 4JBJA 3AU7A 2F03A 4EVOA 2WACA 1EY0A 4FYDA 4R4QA 1S72A 1N36L 5IP7G 4L5RC 3IL8A 4A3CH 1YI2A 1M4VA 1EFWA 4DV5Q 1ENFA 2MFIA 1PTOB 1GO3E 1G291 4K8JA 3HKSA 2I0QA 4F7XA 1EWHA 2OTJA 3L9AX 1Q82C 3ULLA 4XIGS 1KLUD 1JR0D 4QL5A 4YWKA 3S17H 4IFDI 1TS3A 2HD3A 2QW7A 1F9RA 1TY2A 3G71A 2K01A 1WD1A 2KEEA 4A3GG 5BR8L 3G7LA 2ZT9C 4C3HB 2JA6G 4B3RL 3NTKA 2OWOA 3M85A 4EGVA 1VMPA 4JBWA 5M5YH 5IYBH 2UXBQ 3RZDH 1E1TA 2PI2A 4X3UA 3I90A 1WYDA 4JI2L 2HQEA 2ZJRA 1M8AA 4BY7G 3FVQA 5EAYA 3E3XA 4LAAA 4RGOS 1YJ9A 2VB2X 4R8NA 2J0TD 3IAYA 1FGBD 1E2VA 1O78A 4APVA 2G9DA 2C35B 2B63H 2K5NA 1HTPA 1PV4A 4HJ5A 1IXRA 1SXTA 1XMQQ 2UUCQ 2ZJPA 5FOBB 3C2PA 3OW2A 4JI3L 3TREA 3GTGB 2B2VA 5FO8B 1SJHD 5DAUA 2KOLA 2NWGA 2K33A 1GUNA 3U4VA 5LMUL 1EOVA 2RQXA 3PGZA 4BBRG 3PF4A 4QY7A 4BXXG 4DV2L 3KDFA 2IW3A 5LL6X 2QF7A 2K5QA 1RTNA 2F0WA 4NXMQ 1GVPA 3RLFA 3F2BA 3RNUA 1K83H 1EY6A 1HQMC 2I07B 3A74A 3PO2B 2EYHA 3GTJH 1LLRD 5IGBA 1S40A 5AJ3L 4KLKA 1MSGA 3Q22A 3A55A 4A3JB 1ML0D 1B9NA 4LFCQ 2G5DA 3HOWB 1B50A 5D14A 3A7AB 4LF8L 3EFXD 4H7BA 2IPKD 1D6EC 2N78A 1W3SA 2Z9HA 5CV5A 4MZ9A 4GKJQ 4NKLA 4HN7A 1L0YB 2GA4B 2E5LL 3ZYYX 4F8MA 2R7FA 1Y1VB 3DWAA 1SN8A 2AWNA 2A5HA 3MAQA 2K05A 1EY4A 1STNA 3RZOH 1AP0A 1KNEA 2KQ3A 2YU9H 1OXXK 2AHOB 1IYVA 3NENA 4N8X1 1X3QA 3KOJA 1DGSA 1SR3A 5EKLA 3OTOL 3U4ZA 3OPOA 2XRSD 4CJ1B 1QNKA 4YCVA 4G7HC 2E2DC 4MN3A 1E2ZA 2B39A 1HNZL 5FLXc 3K0YA 2Z4IA 4FXGC 4DR2L 1GOZA 2LKVA 2B2TA 1WJJA 3KF6B 2KCMA 3VA7A 4JBMA 4GLXA 2MHVA 1L1OA 4DR5L 1R9TB 3MA2B 4XT3B 5C4ZA 3ER0A 1FNUA 1H9SA 1O80A 4X66Q 3CCQA 1PRTB 2K28A 2QGQA 4CKCA 1EOTA 1PRTC 4LFBL 1EU3A 2A68D 1ZKOA 2ZTCA 3R2TA 4JI6L 1HR0L 1EZ6A 4HIOA 4JV5Q 1TWHB 4DR6Q 1SRUA 3GTPB 3EA6A 3I8ZA 2F0NA 2A6ED 4JG2A 1TWGB 2D0PA 2ZXOA 3STBC 5IE8A 2XVSA 3PO3B 1L0XB 4BY1B 2A1AA 3A5ZB 1SMXA 3D0FA 3PUWA 5IT9L 4GN4B 1JQYD 2Q2TA 2IT1A 3SEBA 1LABA 1S5FD 3NTHA 1EY9A 2BE5D 5KNBA 2JA8G 4P73A 4UP9A 1G51A 2B2YA 3Q0AA 3S1MH 3D6WA 4KHVA 5FJ8G 1S5DD 1VQGA 3MEHA 4UDUC 5F2DA 4BS9A 4QGUA 3SGIA 3A7LA 2L9HA 1ENCA 1F9SA 1TS5A 3T1HQ 4A3DB 3EJIA 4A93B 1VQ6A 1JE4A 2LXJA 3I55A 4XQJA 2XWBB 4PV1C 3CRKC 3FEWX 3HOYG 5IIFA 5C4XH 4DV6Q 1Q12A 1IKMA 5DM73 4UY8C 1JWUD 2EYPA 1JJGA 2F3WA 3HGBA 2CW0D 2XIWA 3H0GG 5JJIA 2A69D 4P74A 3FKIB 4JYAQ 4JI2Q 3GTOH 1OXVA 1XTDA 4DV4L 2TSSA 1X9NA 4XTCS 4LF5Q 4FXDA 1JORA 1JT8A 4JI8L 3D4WA 1QB5D 1EY7A 2VL6A 3RLOA 4EQNA 3RN2A 5IP7H 3Q24A 3KBGA 1G8ZD 2K5WA 1U4LA 4L63B 4TKOB 2Q2HA 4B3SQ 4DNRB 3QG1A 3VR2A 5JJZA 4LFAL 2ID0A 5COYA 2HCCA 3BG3A 5CV4A 2ICIA 1QUQB 2F4IA 3R93A 3V2TA 4ID6A 4A3IG 3J80L 1ZYRD 5LMUQ 3SVMA 4OGQC 1MKHA 1XX8A 3BVMA 4DV2Q 2RDFA 1E7ZA 2K5VA 4KJNA 1TVXA 5EBDA 4NDXA 2L5TA 4DPGA 1JC7A 2NVQH 4KN7C 1EUJA 4OO1G 4HEDA 1KXLA 5JPNC 2XSCA 4OEMB 1LTAD 4BY7H 1LV9A 2PZWA 4R4OA 4M1UB 1ENAA 4A4IA 3KUPA 2RCFA 4P71A 3W3AA 4LF8Q 1SYCA 4DUYL 4A3LG 4HSVA 3U50C 2E2JB 1F2LA 1X54A 4A3EG 4OX9Q 3UDIA 5CC4A 5TSSA 2E5LQ 1RTOA 4IUPA 1S5BD 1LTTD 2WKDA 3AFPA 5M5YB 4CDEC 3CCVA 1TXYA 2KCTA 3TZUA 3SXHA 5FK9C 5GROA 1S3OA 1YHBA 5C0XG 4KY6A 3OTOQ 4BXXH 1B44D 1UE5A 5JEAG 2K14A 4HJ8A 3NBIA 1ZXTA 4CJ2C 2N55A 2RSOA 2B8GA 3KLSX 4A3BG 4IPGA 3GTKH 1D7QA 2BH2A 1K0SA 3HFZB 2WB1B 4R8IA 1FVIA 1QE6A 4FF2A 4QB4A 1LO5D 2DNEA 3K5OA 4L6TB 3CCLA 3FPUB 2F0KA 3VA5A 2KVMA 3M7NA 3P75A 3BJUA 3J81L 5D3IB 5FO7B 1X3FA 3GDEA 4QIWE 5DLQE 3CCUA 1FJGL 4JI6Q 1KIXA 1F2YA 1GHKA 2F0IA 2XNAC 1K83B 1SEBD 1PTOF 1N33Q 3URYA 1K8AC 5C3XA 3TS0A 3GTJB 1EIFA 4CKBA 2MNAA 1LT5D 1EQRA 1U4PA 1F9QA 1YHAA 3GTLH 4AIMA 4QUFA 1XMOL 2DNCA 1NAPA 3KF6A 1B1ZA 5CBEE 4RKBA 4N9TA 1A6XA 1A3TA 1JJ2A 1KC8C 5ELBA 3M7GA 2DN8A 2LXKA 2PPBC 4JBKA 3K58A 4WJWA 3KLSA 5ELFA 1EYGA 4WFN3 4C3IG 1BF4A 4HIMA 4LWCA 1JB3A 4JI7L 3RZOB 3SK5A 2YU9B 3HOZH 1MIUA 1KHIA 1KTKA 1VQHA 4FP5D 2WV6D 3T56B 1Y69U 5IODA 1RKNA 1NUCA 1HZ9A 2GVBA 3K5LA 4S3SA 4UHVA 1PYSB 1HH2P 3J7YW 3M9BA 1T5XD 3DWQA 4GNXA 1W6JA 1D5XC 1HA5A 1CSQA 3QIAA 5C3WA 1OTCA 2VNUD 5T1GA 1N34Q 1EYCA 2VQFQ 3X3MA 4LF6L 5IGDA 4LJZC 4DAMA 1VQOA 4DV4Q 3J7AF 1BNZA 3M4OH 2WINB 4JI8Q 2L15A 2JE6I 4ME5A 1A15A 2DUDA 3OYYA 2R7ZG 2NTTA 5JVG3 4FF1A 2B29A 1STHA 5CV8A 2Q8TA 5FJ8H 1CA5A 4DFAA 3HEJA 1RCVD 4JK1C 1LUZA 1EFID 4BBSG 3IFTA 5ISRA 3J80i 1T5EA 2MUYA 1H9SB 1N8RC 2PMZE 4KI0A 2WAQG 4M8AA 1TQOA 2F0MA 1B9MA 5C44G 2NZHA 5KGUA 1CI3M 3A56A 1C48A 2KCNA 5IT9E 5ELDA 3H6MA 2YTXA 1Q81C 2F0VA 2RF4A 2R93G 3QWNA 2MP1A 4X64L 4AYBB 1I4QA 3H0GH 1IW7C 2CQOA 2ZXRA 3UE1A 3S1MB 4FDBA 2MGSA 4YCWA 4JI4L 3F2CA 4IOAA 3SK4A 4L8JA 2HUGA 1Y1WG 1HR0W 1HNWL 3S1QH 4DA2A 3H3VH 2MJ8A 3L3OC 1LTID 3NK9A 4FF3A 1OXUA 5H1SE 1QVCA 5IP9G 2I46A 3CD6A 2B2YC 4V0BA 4DUYQ 3U58A 2DY7A 4XYQA 5BN3A 2H4OA 2VQEL 1NSNS 4KK7A 5C4XB 3K7UC 5EPJA 2VB3X 3L7ZC 1CKNA 1PH3A 1QG7A 1A8VA 1VQ5A 2MO0A 5EPKA 4PMBA 1KRSA 3M4PA 1VQAA 4EQ5A 5KIXA 1I3QB 4A3IH 2R92G 1KAWA 4BWGB 3KFUA 4WORA 4B9XA 1PRTF 3ERQA 5M3MG 1PZKD 3VYSA 3RLNA 3CXCA 2I5HA 4IALA 1Q1BA 4K5VA 4A76A 4P75A 4LF7L 4KHZA 4H44C 3CMAA 2R3ZA 1SMYD 1EIYB 1U4RA 1E24A 1IL8A 4A3KG 1L2FA 1PDQA 5C3EG 1PH6A 3J81i 3PIOA 2SOBA 4DV0L 3PSIA 3EN2A 1SNOA 3J80E 4HMJA 2OQKA 3D4DA 3SDZA 3I4LA 5CBAE 4A3EH 1SNDA 1FJGQ 1AEXA 2VZAA 1TY0A 1HFGA 3HP3A 3KF8B 1K3RA 2PNRC 1G6ZA 4OWWB 4OWXB 2D9UA 3MTSA 3S16H 4JOIC 2EYFA 3HOVG 2UXDL 3OW7A 5A2QL 1RHPA 4H0LC 2NVQB 1KRTA 1PTOD 4X65L 4OIJA 3PUVA 1AE2A 4PMCA 3M3YH 5C0XJ 1BKBA 1H9JA 3E9HA 5JEAJ 4BY7B 2JK8A 2WIIB 3BDOA 4MIUA 5JEAH 4DN4M 3JAMc 2HT1A 1B7YB 2RBMA 4HR7B 1MGSA 4C1NI 1W2BA 2F0DA 4P2CB 5E4WC 1R4QB 3CCRA 4DV3Q 1YZ6A 4I7AA 2KEDA 1KQSA 4C1NK 5JJLA 3EIVA 3SHLA 5CV7A 2OQ0A 3TN2A 2WAQE 1CSPA 5BN4A 2EE1A 1CKOA 1HNXL 1TKWB 3GTQH 4DR1L 5ELEA 4B9WA 2B2UC 1PH7A 3S1NH 2F0UA 1F2ZA 1I4PA 1PMRA 1EL0A 2KBNA 1Q7YC 4RMFA 3N6RA 1FNVA 1V9PA 1LM0A 1EEFD 2NVXB 1O7ZA 2WKCA 2EOTA 2L4NA 2M00A 5HGTA 4A3MB 5M3FG 1WD0A 1TS2A 2ICEC 1HCZA 4YIJA 2F4VL 2H1EA 3KLRA 1GHJA 4KTAA 4KMUC 4R1JA 4DUZL 2IHFA 1DYQA 1VQLA 4LUVA 3S15H 4YHHL 1C4QA 3AMUA 4DGZA 2F0TA 4GS3A 1Q1EA 3H91A 3I4MG 1KDCA 4UP7A 4FF4A 1NR4A 1SYEA 5JVH3 1FR3A 1EQTA 3OMGA 2F3VA 1IYUA 3J81E 3D31A 1FL0A 2EZVA 1A2TA 4GOPC 2DY8A 3I4NG 3U9OA 3MEFA 4C3IH 1IL2A 4DNIA 3HOUG 4DR3L 2RDGA 3BU2A 5FLMG 2YV5A 5FLXL 1IBKL 4IO9A 2EY1A 4CDFC 1G2SA 2NN6G 5J22A 5JJKA 1SYDA 2IX1A 3VYUA 4DR4L 4AQYL 3LNNA 5I2XA 1EYDA 4G7ZC 1IYJB 1X65A 4C2MH 5CR3A 3GTLB 2NVTB 2D2CC 3A0JA 4X62L 3S2HH 4X64Q 4DV1L 4JI5Q 1VQMA 2OXPA 4JI4Q 1WTPA 2A6HC
chains in the Genus database with same CATH topology
2K5DA 5I9OA 3HRZC 1G2TA 3QOLA 5E1FA 3HZXA 3K6OA 3HOZB 3MXNA 1AW7A 4RHRA 4IFDG 1SJED 1Y8OB 2F0JA 2BOSA 3NP8A 2PO4A 3H94A 1OXTA 5EPLA 5IGEA 4ZLTF 3K57A 4OIKA 3PUYA 1DM0B 3NPPA 4CBVA 1GUSA 1D5MC 3ITPA 2D5DA 1PFNA 1PRTD 3K5MA 3M4OB 3V05A 2F0PA 1UAPA 2NB0A 2TMPA 1QWYA 2K7VA 1Z7TA 1LTRD 3RUZA 5LL6S 4RGTA 3DMUA 2YYZA 1F2MA 1B2TA 2PZTA 3UI2A 3VR4A 3GV6A 3T51B 3NQTA 4MHEA 2JP1A 1RJTA 4C56C 4C3JB 1DZ1A 3NHHA 2SEBD 1CZGA 2F0QA 3H0GB 4DXGA 2J4XA 3I72A 3MZ5A 1I6VC 5DNFA 3KK7A 4Y7NB 5C5MA 1UNSA 3S1QB 3H3VC 5K36G 4K2KA 1JICA 3TSSA 3C1EA 5DM63 3PUXA 1CFMA 4TSSA 4PMWA 4Q0FA 1EYAA 4IUTA 3QOJA 3ND9A 5ELCA 5IGFA 5AFWA 2Y0SB 2NYZD 2F0OA 3NE5B 3Q23A 1LTSD 3KF8A 1JCKB 1ET6A 3FPPA 5G3LF 4LMQD 2IL8A 4E6IA 2QILA 1OO9B 2LFNA 3RD4A 2KCCA 1YNNC 1ZYRC 3DHQA 3HS0C 4J8QA 1B3AA 4FXKC 1K8MA 3CU7A 1V1OA 1SNPA 2JXMB 4A3EB 5KYIA 3PV0A 3WOFA 3E5SA 2BA0A 3S9WA 2F0HA 3OOCA 5CMDA 3S17B 5EKIA 2FFKB 3A8JE 1C8CA 3S16B 3OWEB 1CHPD 2B2UA 4IN3A 5A2QE 3M3YB 3EQLC 2AQ1B 5IGGA 3T16A 1TS4A 1DOLA 3RZDB 4KKSA 1UEAB 4IUUA 3E6ZX 4ULLA 1RD9D 4IUVA 2RSNA 2EYJA 2B63B 2MPMA 5CYUA 3BVZA 3S1NB 3QO2A 4HTHA 1DJRD 2AWOA 3R2IA 1KDBA 5CV9A 1PFMA 5EGTA 1D1KA 1ILQA 2BCOA 1Q8IA 3G6JB 4RCNA 3O13A 5JAVA 2LY7A 3BYTB 3PIO3 1PYWD 1IHZA 1EIHA 4GZYC 2FMMA 1SYGA 2PW7A 1CHQD 2X6LA 2D62A 4ILWA 1CA6A 1U9RA 3BDLA 4C3IB 3DWPA 3NUCA 3D8GA 4V190 1MI2A 1KAAA 3NWSA 4IFDJ 5FLXE 1KNAA 4KV6A 4IFDH 5D65A 3GP7A 1VDZA 3NQIA 4HMIA 3TP8A 5KNDA 2XWJB 1S5CD 2CQAA 4IURA 4RA8A 1Z6HA 4B08A 1TWCB 1IKLA 2K6AA 2B8FA 1QNUA 1HHVA 1BCPB 1QJOA 2EYMA 4BBSB 1BCPC 2EPBA 2Z1CA 5M5WB 3VYTA 3QJYA 3A8IE 5C44B 1BXTA 3R3OA 4HAEA 5C4JB 5J1ZA 4HSPA 4H13C 1E2WA 1WTVA 5I9PA 3DUZA 4RGMA 1II3A 4FO2A 3GV3A 4CHTB 1SE3A 1CM9A 1Y1WB 2EY5A 4KKUA 2B2WC 3LX0A 3TP7A 1Y8NB 1YNJC 2E2IB 4PNYA 5K36H 1STYA 1AN8A 1H9RA 2Z4HA 1EWCA 4IUNA 3QB3A 3U9SA 3PMFA 4ZAIA 3SK8A 1LT6D 1IW7D 4BA2I 2JEAI 4K8IA 2R92B 1BOSA 2EJFC 3S2DB 1WTOA 3BYYB 3WOEA 1HRJA 1A2UA 3IFDA 2PYKA 4X3SA 3VYRA 2PQEA 1PLFA 3TP5A 4XT1B 1RF2D 5I6YA 1I50B 3GTOB 2QKIC 4QMGA 4A3KB 5C3EB 1HUMA 2C9OA 2Q8RE 3J7AV 2NVYB 4QF4A 4OO1H 1GUOA 2N88A 3K7AB 3JAML 4DAVA 3R8BA 3TDQA 2EY2A 2G9HD 3C3LA 1ESFA 5T1IA 1SMYC 4NMZA 3DEPA 4A3GB 2EXZA 1NCVA 2JA6B 1Y8PB 2F0EA 1J8IA 1SYFA 2QDBA 3NTIA 3BDCA 4K6DA 5EQ0A 3WDNA 2HCIA 5CORA 1LTGD 4ZUIA 1KABA 1E0BA 1HPCA 4F87A 1STAA 1RODA 2AUJD 5C0XH 1U4MA 1CQFA 1PZID 3I70A 3K59A 3LWEA 1PTOC 1GUTA 4IQZA 1JWMD 4QCLA 1SAPA 4DK0A 3X3NA 3HG9A 4QUCA 4CKEA 5C4HA 1D5ZC 2NTSA 2AQ2B 5M3FB 2KA7A 5E4XA 2A73B 3IKJA 2KHSA 4O42A 4BBRB 4NP5A 1QOHA 2OF1A 4RGNA 2J7ZA 4C3HG 3I4MB 2AUKA 2IWHA 3GTKB 4ZK9B 4IUQA 3D4RA 1DXMA 5CV6A 1TIID 2C5CA 3I4NB 4O1NA 3LWUA 2F0SA 3TZDA 3HOUB 2V4DA 4XQNA 1CZWA 3DM1A 3BVGA 2L11A 4LK1C 4U673 2JEBI 3I3CA 1LT3D 3P7JA 1FD7D 1HTLD 1Z47A 1KLGD 4K6LA 1WTXA 1DOMA 4FVMA 3MXGA 4DAPA 1HA6A 3VR5A 3SE0A 4DAYA 4TRDA 1GJXA 4Q5VA 2F0GA 1RDPD 1SFOB 1WVLA 1PFBA 3MWYW 1I4RA 5EBCA 2R61A 5BN5A 3FRPB 4KKTA 2XRQD 2RKSA 1CK1A 2SNMA 3D3RA 4J1MA 2K32A 3OIPA 1LTBD 4XQQA 1CQVA 5KEEA 2K03A 5FKAC 5IGCA 1B4OA 4DF7A 1S5ED 2A6HD 3EVQA 3KBXA 3C1FA 1ET9A 2O4XA 1J9OA 1BQQT 3NSWA 2CHBD 4N9PA 1B53A 2KJXA 2B2WA 2FINB 4J6HA 5CGKA 3H09A 2X6GA 2FJ2A 3MFYA 1JOKA 2M9VA 2A68C 2JA8B 3DEOA 4OO1I 1VCIA 2BA1A 1HXYD 2A6EC 4K14A 1SNQA 1BR9A 4Z9CB 1OXSC 3P1HA 1K8OA 3NWTA 1LT4D 1VMCA 3P20A 3OIQA 4QIWB 2BE5C 1EEID 3HOYB 3ONAB 1STBA 1V1PB 2QCPX 2IX3A 5C6AA 2RVLA 3V96A 1G91A 2JSOA 3AB9A 2O5IC 1WTRA 2PCFB 3OMCA 5C0XI 2EJGC 2OT2A 1STGA 2JA7B 4I65A 4UAIA 4ZQ3A 4KD3A 4G4KA 4OL7A 1F77A 3VR6A 3NBHA 1TT2A 1WCMB 4OHJA 1JOOA 2CW0C 2QEJC 4KN4C 2L1BA 2A74C 3RMHA 2A69C 3S14B 4K5XA 4TQUS 4A3IB 5K5PA 4ZKBB 1FYCA 1BCPF 3E0JA 4C3JG 2X69A 4A3FB 4RKLA 4K5WA 3CRLC 4IZ8A 5IOCA 3PUZA 4XXEA 4X3TA 1I4HA 3GD7A 1DD2A 1FNWA 1SE4A 1O7YA 4G7OC 3K5NA 5C5LA 1S4ZA 1BBXC 5I4DA 3TMEA 1V8QA 4ZYSA 1MBYA 3BS1A 1EIGA 1AFPA 4CJ0B 5LHY1 3JAME 2L55A 2EY6A 4FNFA 3VR3A 1JWSD 1YNND 1XXGA 2CVRA 4K2LA 1GUGA 3BZDB 3EROA 3OSOA 4KJOA 1PTOH 3PIP3 1NR2A 3MHBA 2PMZB 2VXWA 1I4XA 3NXWA 2KUMA 2IX0A 4RHSA 1CT1D 1XTCD 4RFBA 4DXFA 1DOKA 1TU2B 3FMCA 1HFNA 1LACA 2NUCA 1V43A 1SDFA 3S1RB 2PW5A 5NUCA 2KECA 5EJWA 1GUWA 4A3BB 5E3FA 1SE2A 1F9PA 1WTWA 1A3UA 3OHXC 5A35A 3I73A 5J39A 1STEA 2VUMB 4I7ZC 1AZPA 3GTQB 1BUVT 1XWEA 5HURA 1KDAA 3CKIB 2E75C 2AQ3B 2NN6H 1EU4A 4XDXA 1H9KA 2F0LA 2FMCA 2SNSA 3FDTA 2HDLA 1MD2D 4HCSA 3N52A 4X3KA 3S15B 1D1IA 3W2DA 4BA1I 4R9WA 1TR5A 3MFGA 5KRUA 1ICWA 2IJ0A 1EY8A 1JOQA 3MXPA 2Z8LA 4XYOA 1DONA 1D2BA 1HQRD 3MXUA 3GTMB 4ZUJA 3MC0B 2B2VC 2NBFA 2LMCB 4G57A 5JOBA 1X32A 2R6GA 4F88A 4DNTB 1CTMA 4ODGA 4RH6A 4C2MB 4RWSC 4DK1A 4EQPA 3S2HB 1PZJD 1ONLA 3MVVA 5FO9B 1I6HB 1VF7A 2L0CA 2R7ZB 2O2LD 1I4GA 3M4YA 4U68A 3I91A 3SR1A 1Q90A 5M9OA 2M2LA 4ZRZA 1H9MA 1XYIA 2NZ1D 4KY7A 5I2YA 2BDOA 3HOXB 1WTQA 2WAQB 4HCEA 3ND8A 1DCZA 1V1PA 1BCPD 1ILPA 1TWFB 2L12A 2BDNA 1PXUA 2FHTA 3GQBA 1QCBD 2R93B 2O5JC 2WP8J 2E76C 2LS01 5G3LD 1ESRA 2RDHA 2SDFA 2EVBA 1EZ8A 2XN9C 3T4AC 4KD4A 2B2TC 2K04A 1R4PB 2EDGA 3HKZB 1SYBA 2F1MA 3T53B 2JA5B 1GXDC 1YNJD 3T13A 3TP6A 2E74C 4WRDA 2Q8IB 3A8KE 1W6KA 5EKKA 2EJMA 4ABNA 2HDMA 3CQZB 4KY5A 4DU9A 5M3MB 3OWFA 2RA4A 1BO0A 5KNCA 2PZUA 5KYLA 1SNMA 1SNCA 1EY5A 2F0FA 5M5XB 1X3PA 4ZKCB 4PQXA 5DEHA 1MSHA 2ENBA 1SSOA 5D3DA 1UUPA 3Q6SA 2JYOA 1O7LA 1SBBB 1VF5C 3DXJC 3D6CA 3TBIB 2ZXPA 5I6WA 1QILA 5JPMC 1HUNA 3C46A 2EYOA 1BDOA 3SK6A 4RAUC 2EYLA 1A3VA 2OEOA 3HOVB 2K1BA 2NN6I 1TWAB 3A54A 3F2UA 1ZEQX 4RCOA 3CHBD 4NW2A 1EQVA 1AZQA 2E2HB 4CGYB 4EQOA 3GO5A 1Q3LA 3AU7A 2F03A 4EVOA 2WACA 1EY0A 4FYDA 3IL8A 1M4VA 1ENFA 1PTOB 1G291 4K8JA 4F7XA 1EWHA 3L9AX 4XIGS 1KLUD 1JR0D 4IFDI 1TS3A 1F9RA 1TY2A 1WD1A 2K01A 2KEEA 3G7LA 2ZT9C 4C3HB 3NTKA 3M85A 4EGVA 1VMPA 4JBWA 4X3UA 3I90A 2HQEA 1M8AA 3FVQA 4LAAA 4RGOS 2VB2X 4R8NA 2J0TD 3IAYA 1FGBD 1E2VA 1O78A 2G9DA 1HTPA 1SXTA 5FOBB 3C2PA 3GTGB 2B2VA 5FO8B 1SJHD 5DAUA 2KOLA 2NWGA 2K33A 1GUNA 2RQXA 2IW3A 5LL6X 2QF7A 2K5QA 1RTNA 2F0WA 3RLFA 1EY6A 1HQMC 2I07B 3PO2B 2EYHA 1LLRD 5IGBA 1MSGA 3Q22A 3A55A 4A3JB 1ML0D 1B9NA 3HOWB 1B50A 5D14A 3A7AB 3EFXD 4H7BA 2IPKD 1D6EC 5CV5A 4NKLA 4HN7A 1L0YB 2GA4B 3ZYYX 4F8MA 1Y1VB 3DWAA 2AWNA 2A5HA 3MAQA 2K05A 1EY4A 1STNA 1AP0A 1KNEA 2KQ3A 1IYVA 1OXXK 1X3QA 5EKLA 3OPOA 2XRSD 4CJ1B 1QNKA 4G7HC 2E2DC 4MN3A 1E2ZA 2B39A 3K0YA 2Z4IA 4FXGC 1GOZA 2LKVA 2B2TA 3VA7A 2MHVA 1R9TB 3MA2B 4XT3B 5C4ZA 1FNUA 1H9SA 1O80A 1PRTB 2K28A 4CKCA 1EOTA 1PRTC 1EU3A 2A68D 1ZKOA 3R2TA 1EZ6A 1TWHB 3GTPB 3EA6A 3I8ZA 2F0NA 2A6ED 1TWGB 2ZXOA 2XVSA 3PO3B 1L0XB 4BY1B 3PUWA 5IT9L 1JQYD 2IT1A 3SEBA 1LABA 1S5FD 3NTHA 1EY9A 2BE5D 5KNBA 2B2YA 3Q0AA 3D6WA 4KHVA 1S5DD 3MEHA 4UDUC 5F2DA 4BS9A 3A7LA 2L9HA 1ENCA 1F9SA 1TS5A 4A3DB 3EJIA 4A93B 1JE4A 4XQJA 2XWBB 4PV1C 3CRKC 3FEWX 5IIFA 1Q12A 1IKMA 5DM73 1JWUD 2EYPA 2F3WA 3HGBA 2CW0D 2XIWA 2A69D 3FKIB 1OXVA 2TSSA 4XTCS 4FXDA 1JORA 3D4WA 1QB5D 1EY7A 4EQNA 3Q24A 3KBGA 1G8ZD 2K5WA 1U4LA 4L63B 4TKOB 4DNRB 3QG1A 3VR2A 5JJZA 2ID0A 5COYA 2HCCA 3BG3A 5CV4A 2ICIA 3V2TA 2F4IA 3R93A 4ID6A 3J80L 1ZYRD 3SVMA 4OGQC 1XX8A 3BVMA 2RDFA 4KJNA 1TVXA 5EBDA 4NDXA 2L5TA 1JC7A 4KN7C 4OO1G 4HEDA 5JPNC 2XSCA 1LTAD 1LV9A 2PZWA 4M1UB 1ENAA 3KUPA 3W3AA 1SYCA 4HSVA 2E2JB 1F2LA 5CC4A 5TSSA 1RTOA 4IUPA 1S5BD 1LTTD 2WKDA 5M5YB 3TZUA 3SXHA 5FK9C 5C0XG 4KY6A 1B44D 5JEAG 3NBIA 1ZXTA 4CJ2C 2N55A 2RSOA 2B8GA 3KLSX 2WB1B 4R8IA 1QE6A 4FF2A 4QB4A 1LO5D 2DNEA 3K5OA 4L6TB 3FPUB 2F0KA 3VA5A 2KVMA 3M7NA 3P75A 3J81L 5D3IB 5FO7B 1F2YA 1GHKA 2F0IA 2XNAC 1K83B 1SEBD 1PTOF 3URYA 5C3XA 3GTJB 4CKBA 1LT5D 1U4PA 1F9QA 4QUFA 2DNCA 1NAPA 1B1ZA 5CBEE 4RKBA 4N9TA 1A6XA 1A3TA 5ELBA 3M7GA 2DN8A 2PPBC 3K58A 4WJWA 3KLSA 5ELFA 4WFN3 4C3IG 1BF4A 1JB3A 3RZOB 3SK5A 2YU9B 1KTKA 4FP5D 3T56B 2WV6D 1Y69U 5IODA 1RKNA 1NUCA 3K5LA 4S3SA 3J7YW 1T5XD 3DWQA 1W6JA 1D5XC 1HA5A 3QIAA 5C3WA 2VNUD 5T1GA 1EYCA 3X3MA 5IGDA 4LJZC 3J7AF 1BNZA 2WINB 2JE6I 4ME5A 1A15A 2NTTA 5JVG3 4FF1A 1STHA 5CV8A 2Q8TA 1CA5A 4DFAA 3HEJA 1RCVD 4JK1C 1EFID 3IFTA 5ISRA 1T5EA 2MUYA 1H9SB 4KI0A 4M8AA 1TQOA 2F0MA 1B9MA 5KGUA 1CI3M 3A56A 1C48A 2KCNA 5IT9E 5ELDA 3H6MA 2F0VA 3QWNA 2MP1A 4AYBB 1I4QA 1IW7C 2ZXRA 3S1MB 2MGSA 3SK4A 4L8JA 2HUGA 4DA2A 2MJ8A 3L3OC 1LTID 3NK9A 4FF3A 1OXUA 2I46A 2B2YC 4V0BA 2DY7A 4XYQA 5BN3A 2H4OA 1NSNS 4KK7A 5C4XB 5EPJA 2VB3X 3L7ZC 1QG7A 5EPKA 4PMBA 5KIXA 1I3QB 4BWGB 4WORA 4B9XA 1PRTF 3ERQA 1PZKD 3VYSA 4IALA 1Q1BA 4K5VA 4KHZA 4H44C 2R3ZA 1SMYD 1U4RA 1IL8A 1PDQA 2SOBA 1SNOA 3J80E 4HMJA 3D4DA 3SDZA 3I4LA 5CBAE 1SNDA 1AEXA 1TY0A 1HFGA 3HP3A 2PNRC 1G6ZA 2D9UA 3MTSA 2EYFA 3OW7A 5A2QL 1RHPA 4H0LC 2NVQB 1PTOD 4OIJA 3PUVA 4PMCA 5C0XJ 1H9JA 5JEAJ 4BY7B 2WIIB 3BDOA 4MIUA 5JEAH 4DN4M 2RBMA 4HR7B 1MGSA 4C1NI 2F0DA 4P2CB 5E4WC 1R4QB 2KEDA 4C1NK 3SHLA 5CV7A 3TN2A 5BN4A 2EE1A 1TKWB 5ELEA 4B9WA 2B2UC 2F0UA 1F2ZA 1I4PA 1PMRA 1EL0A 3N6RA 1FNVA 1EEFD 2NVXB 1O7ZA 2WKCA 2EOTA 2L4NA 2M00A 5HGTA 4A3MB 1WD0A 1TS2A 2ICEC 1HCZA 4YIJA 2H1EA 3KLRA 1GHJA 4KTAA 4KMUC 1DYQA 1C4QA 3AMUA 4DGZA 2F0TA 1Q1EA 3H91A 1KDCA 4FF4A 1NR4A 1SYEA 5JVH3 1FR3A 1EQTA 3OMGA 2F3VA 1IYUA 3J81E 3D31A 2EZVA 1A2TA 2DY8A 3U9OA 2RDGA 5FLXL 2EY1A 1G2SA 2NN6G 5J22A 1SYDA 2IX1A 3VYUA 3LNNA 5I2XA 1EYDA 4G7ZC 5CR3A 3GTLB 2NVTB 2D2CC 2OXPA 1WTPA 2A6HC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NMZ A;  3R3O A;  5IOD A;  5J1Z A;  2RBM A;  2ENB A;  2PW5 A;  5NUC A;  5I9O A;  2EXZ A;  1EYA A;  5E3F A;  4TRD A;  5HGT A;  4HTH A;  3QOL A;  2F0G A;  1EZ6 A;  3HZX A;  2F0E A;  5E1F A;  2F0D A;  3QOJ A;  1KDB A;  5C3X A;  5I9P A;  5CV9 A;  3OMC A;  5IGF A;  1SYF A;  1II3 A;  2QDB A;  5EGT A;  3SK4 A;  5DAU A;  3BDC A;  1STG A;  1A3U A;  2F0N A;  4K6D A;  2RDF A;  3SR1 A;  2F0O A;  4KJN A;  2F0J A;  4I65 A;  3D6C A;  4KD3 A;  4ZQ3 A;  4ZUI A;  5M9O A;  1KAB A;  4NDX A;  5I6W A;  4OL7 A;  3NP8 A;  5J39 A;  3NK9 A;  3SHL A;  1TT2 A;  2EYO A;  2RKS A;  1STA A;  4RKB A;  5CV7 A;  2EYL A;  1A3V A;  2OEO A;  2SNM A;  2EY5 A;  4KY7 A;  4J1M A;  4N9T A;  5IGE A;  5JAV A;  1A3T A;  3LX0 A;  3TP7 A;  2PZW A;  4PNY A;  1STY A;  1EY9 A;  1JOO A;  1IHZ A;  1NSN S;  2F0W A;  4E6I A;  1ENA A;  4B9W A;  5KEE A;  5HUR A;  2F0U A;  1F2Z A;  1EQV A;  3V2T A;  1SYG A;  2PW7 A;  4K5X A;  5IGC A;  4IUN A;  1KDA A;  3ITP A;  1EY6 A;  4PMB A;  5K5P A;  4DF7 A;  5KIX A;  4EQO A;  3QB3 A;  2EYH A;  3SK5 A;  5IGB A;  3PMF A;  3DHQ A;  1SYC A;  3EVQ A;  1U9R A;  4KHV A;  3BDL A;  2M00 A;  2F0L A;  3SK8 A;  2F0P A;  3C1F A;  3MEH A;  4RKL A;  5F2D A;  3NUC A;  1RKN A;  1NUC A;  2WAC A;  1EY0 A;  4K5W A;  4EVO A;  5IOC A;  4IZ8 A;  3D8G A;  5C4H A;  4S3S A;  1SNP A;  5CC4 A;  4WOR A;  4K8I A;  2O4X A;  1KAA A;  2SNS A;  4YIJ A;  4B9X A;  1ENC A;  1EZ8 A;  3EJI A;  4KV6 A;  4KTA A;  3RUZ A;  3ERQ A;  5KYI A;  4H7B A;  4KD4 A;  4N9P A;  3DMU A;  3E5S A;  5CV5 A;  5C3W A;  2KHS A;  5C5L A;  4IAL A;  4NKL A;  3SXH A;  4HMI A;  1F2M A;  4K8J A;  3TP8 A;  3S9W A;  1EYC A;  2F0H A;  4K5V A;  4DGZ A;  2PZT A;  1A2U A;  1TR5 A;  4J6H A;  2F0T A;  4NP5 A;  3TME A;  4F7X A;  4F8M A;  5CGK A;  1SYB A;  5IIF A;  5KRU A;  1KDC A;  5IGD A;  2PYK A;  1SYE A;  1JOK A;  4KY6 A;  2OF1 A;  3OMG A;  2F3V A;  2PQE A;  1EY4 A;  1STN A;  1EY8 A;  3NQT A;  2EYP A;  2F3W A;  3T13 A;  3TP6 A;  1JOQ A;  1A2T A;  3TP5 A;  2KQ3 A;  3MXP A;  4WRD A;  3T16 A;  5IGG A;  3U9O A;  5I6Y A;  4ME5 A;  5EKK A;  2EY6 A;  5CV6 A;  5EKL A;  4ZUJ A;  2EY1 A;  2SOB A;  1STH A;  3NHH A;  5CV8 A;  5DEH A;  5J22 A;  1SNO A;  4QMG A;  4K14 A;  2F0S A;  2F0Q A;  4HMJ A;  4G57 A;  1SYD A;  3D4D A;  1SNQ A;  3HEJ A;  5JOB A;  4K2L A;  4QB4 A;  4DFA A;  3MZ5 A;  1SND A;  4KY5 A;  1JOR A;  1AEX A;  3D4W A;  3ERO A;  3OSO A;  4DU9 A;  4ODG A;  1EY7 A;  4KJO A;  2LKV A;  4EQN A;  1EYD A;  2F0K A;  3OWF A;  3P1H A;  3MHB A;  5ISR A;  4QF4 A;  3VA5 A;  2HQE A;  5C5M A;  4EQP A;  3NXW A;  2EYM A;  3P75 A;  5CR3 A;  2EYF A;  3SK6 A;  2PZU A;  5KYL A;  1SNM A;  1TQO A;  4K2K A;  2F0M A;  1SNC A;  3MVV A;  1STB A;  1EY5 A;  4LAA A;  5C4Z A;  2F0F A;  5KGU A;  1F2Y A;  2EYJ A;  4PMC A;  4R8N A;  2OXP A;  2EY2 A;  5CV4 A;  3C1E A;  3H6M A;  5C6A A;  2NUC A;  2F0I A;  4MIU A;  2F0V A;  4ID6 A; 
#chains in the Genus database with same CATH topology
 1YNX A;  2K5D A;  4LUO A;  5I9O A;  1J6Q A;  3HRZ C;  1HNW Q;  1G2T A;  3QOL A;  5E1F A;  2I5M X;  3HZX A;  3K6O A;  1QVG A;  3HOZ B;  3MXN A;  1TWC H;  1AW7 A;  1HZB A;  3L2P A;  4RHR A;  4IFD G;  1SJE D;  1VQJ A;  2CH4 W;  1Y8O B;  2F0J A;  2VQE Q;  2BOS A;  5IYD G;  4YWL A;  4BBS H;  1YHQ A;  3NP8 A;  2PO4 A;  3H94 A;  2ZM6 Q;  1OXT A;  5EPL A;  5IGE A;  5M5W H;  2Q2I A;  4ZLT F;  3K57 A;  5C44 H;  5C4J H;  4OIK A;  3PUY A;  1DM0 B;  1TWF H;  3NPP A;  4CBV A;  1GUS A;  4B3M L;  1D5M C;  3ITP A;  2D5D A;  1PFN A;  1PRT D;  3K5M A;  4EX5 A;  3M4O B;  1XPR A;  3V05 A;  2K52 A;  2F0P A;  1UAP A;  2NB0 A;  4GNX B;  4MNO A;  2TMP A;  1QWY A;  2K7V A;  4GNX C;  1CUK A;  1Z7T A;  4JW0 A;  1LTR D;  4LF7 Q;  3RUZ A;  5LL6 S;  5LMN L;  4RGT A;  3DMU A;  3A5U A;  1Y1W H;  3LGJ A;  4L5Q A;  3STB D;  2YYZ A;  2A19 A;  3CPF A;  1F2M A;  1HJP A;  1B2T A;  2E2I H;  2PZT A;  1UE7 A;  1WFQ A;  3UI2 A;  5IP9 H;  1N36 Q;  3VR4 A;  4DV0 Q;  3GV6 A;  3T51 B;  3NQT A;  4MHE A;  2JP1 A;  4PZ6 A;  5HY6 A;  3UE0 A;  1RJT A;  1QZG A;  5IYC H;  4POG A;  2UUA L;  4C56 C;  4R4I A;  4C3J B;  1DZ1 A;  3TEH B;  3NHH A;  2SEB D;  1CZG A;  1MJE A;  2F0Q A;  3H0G B;  2R92 H;  4DXG A;  2J4X A;  3I72 A;  3MZ5 A;  3DLL A;  1I6V C;  1VQ7 A;  3S2D H;  1X6O A;  5DNF A;  3KK7 A;  5BR8 Q;  4BY1 G;  4Y7N B;  4B3R Q;  5C5M A;  5M3M H;  1UNS A;  1PA6 A;  3S1Q B;  3H3V C;  5K36 G;  4K2K A;  1JIC A;  3CME A;  3Q8D A;  5IWA L;  3TSS A;  1SLJ A;  3C1E A;  2DGY A;  2CWA A;  5DM6 3;  3PUX A;  1CFM A;  1I50 H;  4TSS A;  4PMW A;  4Q0F A;  1EYA A;  5HGQ A;  4IUT A;  4NXN L;  4A3K H;  1O7I A;  5C3E H;  3QOJ A;  2JA7 G;  4LF9 L;  3ND9 A;  3QR8 A;  4IOC A;  5ELC A;  5IGF A;  1M1K C;  5AFW A;  2Y0S B;  2NYZ D;  2F0O A;  2NVY H;  3NE5 B;  4A93 G;  1HNX Q;  3Q23 A;  4DR1 Q;  1LTS D;  3KF8 A;  4HJ7 A;  1JCK B;  1WCM G;  3K7A H;  4JI3 Q;  4JOI A;  1ET6 A;  1CKN B;  3FPP A;  3HOV H;  5G3L F;  4LMQ D;  2IL8 A;  1TWA H;  2UU9 L;  4UP8 A;  5ELO A;  4E6I A;  2QIL A;  4A3G H;  1OO9 B;  4A3F G;  2LFN A;  2JA6 H;  3RD4 A;  1P8L A;  2F4V Q;  2KCC A;  1J5E L;  1UWV A;  1YNN C;  1ZYR C;  3DHQ A;  3FKI G;  3AYH B;  3HS0 C;  4J8Q A;  1B3A A;  3ZJY C;  4FXK C;  4QJF A;  4DUZ Q;  1K8M A;  3CU7 A;  1V1O A;  1K28 A;  3I4O A;  1SNP A;  4DV7 L;  2JXM B;  2ATW A;  4A3E B;  5KYI A;  3PV0 A;  3G48 A;  3WOF A;  3UDX A;  3E5S A;  2BA0 A;  5AJ3 Q;  3S9W A;  2F0H A;  2R7D A;  3OOC A;  4L5S A;  5CMD A;  3S17 B;  5EKI A;  2FFK B;  3A8J E;  1C8C A;  3S16 B;  3OWE B;  1CHP D;  4IPC A;  2B2U A;  4IN3 A;  5A2Q E;  3M3Y B;  3EQL C;  2AQ1 B;  1VQP A;  5IGG A;  3T16 A;  4YWM A;  1TS4 A;  4UPA A;  4IJL A;  4GLV B;  1DOL A;  1VQF A;  3BZC A;  4NB3 A;  5M3F H;  3RZD B;  2EQS A;  4DV1 Q;  1PH5 A;  3BZK A;  4H02 A;  1UE1 A;  4J15 A;  4KKS A;  1UEA B;  4BBR H;  4IUU A;  4AH6 A;  4POF A;  3E6Z X;  4ULL A;  1RD9 D;  4IUV A;  1HNZ Q;  2RSN A;  2EYJ A;  2JN4 A;  4DR2 Q;  3I4M H;  1K8G A;  3PQI A;  1VQC A;  2JA9 A;  3CCE A;  2B63 B;  2K4K A;  2MPM A;  5CYU A;  4GOP A;  4GKK L;  1XNQ L;  3BVZ A;  3S1N B;  3QO2 A;  4DR5 Q;  3I4N H;  4HTH A;  4PZ7 A;  1DJR D;  2AWO A;  3R2I A;  3F8T A;  2VY3 A;  1KDB A;  3HOU H;  3F2D A;  5CV9 A;  1PFM A;  2E8G A;  2ZJQ A;  5FLM H;  4O0A A;  5EGT A;  4LFB Q;  2VUM G;  1D1K A;  1ILQ A;  2BCO A;  1Q8I A;  3G6J B;  4RCN A;  3O13 A;  1LYL A;  1HR0 Q;  2VS1 A;  5JAV A;  1N32 L;  1KL9 A;  2LY7 A;  1T9H A;  3BYT B;  3PIO 3;  1PYW D;  1IHZ A;  4OON A;  1EIH A;  4GZY C;  2FMM A;  1SYG A;  2PW7 A;  2HQL A;  1NBW A;  1CHQ D;  2X6L A;  2D62 A;  1AH9 A;  4DV5 L;  1VQK A;  1MHW C;  1YVC A;  4ILW A;  1SFO H;  1CA6 A;  1U9R A;  3L0O A;  3BDL A;  4ME3 A;  2WB1 G;  3DWP A;  4C3I B;  1BBU A;  3CAM A;  3NUC A;  3D8G A;  4V19 0;  1HZC A;  1MI2 A;  1KAA A;  3NWS A;  4IFD J;  5FLX E;  1KNA A;  4KV6 A;  4IFD H;  5D65 A;  3GP7 A;  1VDZ A;  4PG3 A;  3NQI A;  2CCZ A;  3K80 C;  1A62 A;  5IYD H;  4HMI A;  3TP8 A;  5KND A;  4HIK A;  1IBM L;  1L0W A;  2UUA Q;  1PHJ A;  2XWJ B;  1S5C D;  2CQA A;  4IUR A;  4KHP L;  1WTH A;  2UXB L;  1I5F A;  4RA8 A;  4RG1 A;  1M90 C;  3J7A 5;  1Z6H A;  4B08 A;  1ASZ A;  1TWC B;  1IKL A;  3CC7 A;  2K6A A;  5IWA Q;  2B8F A;  2MQH A;  1QNU A;  1HHV A;  4JPB W;  1YEZ A;  1BCP B;  1QJO A;  3CC4 A;  2EYM A;  4BBS B;  2XTI A;  4K0K L;  2UUC L;  1BCP C;  4IJH A;  2EPB A;  2Z1C A;  2JA8 H;  3ULP A;  1PH8 A;  5M5W B;  1XPO A;  4LF9 Q;  3VYT A;  2KHJ A;  3A8I E;  3QJY A;  4IPD A;  5C44 B;  1BXT A;  3R3O A;  4HAE A;  5C4J B;  5J1Z A;  3MXN B;  4HSP A;  4H13 C;  4JC0 A;  2XGT A;  1E2W A;  1WTV A;  5I9P A;  4IPH A;  3DUZ A;  4RGM A;  4LFA Q;  1II3 A;  3GTP H;  4FO2 A;  3W1G A;  3HOX G;  3G6E A;  3GV3 A;  2OCE A;  3I7F A;  3HOY H;  1VQ9 A;  4CHT B;  1SE3 A;  3J81 j;  1CM9 A;  1Y1W B;  2Z6K C;  2EY5 A;  3CCS A;  1B3Q A;  4KKU A;  1J5E Q;  2B2W C;  3E0E A;  3LX0 A;  1Y8N B;  1YNJ C;  3TP7 A;  2E2I B;  4PNY A;  3PIP A;  1STY A;  5K36 H;  1AN8 A;  1H9R A;  2Z4H A;  4LNQ A;  4LFC L;  1EWC A;  1U5K A;  2HHH L;  1Q86 C;  4IUN A;  3QB3 A;  1IBL L;  3U9S A;  3PMF A;  4ZAI A;  4GLA C;  3I56 A;  4GKJ L;  3SK8 A;  1LT6 D;  3ERS X;  2JA7 H;  1IW7 D;  4BA2 I;  2JEA I;  4K8I A;  3ICE A;  2R92 B;  3HKZ G;  1BOS A;  2EJF C;  1NJI C;  2UUB L;  3S2D B;  2JA5 G;  1WTO A;  3BYY B;  1WCM H;  3WOE A;  1PVO A;  1HRJ A;  3W1B A;  1NE3 A;  1A2U A;  3IFD A;  2PYK A;  4X3S A;  3VYR A;  3S14 H;  2PQE A;  1PLF A;  3TP5 A;  4XT1 B;  1RF2 D;  2FXQ A;  5I6Y A;  4A3F H;  3TQY A;  1I50 B;  3GTO B;  4MTN A;  2QKI C;  4LW1 A;  2WB1 E;  1EWI A;  2PI2 E;  4QMG A;  4A3K B;  1B70 B;  5C3E B;  1HUM A;  2C9O A;  4X66 L;  2Q8R E;  4YCU A;  3J7A V;  2NVY B;  4QF4 A;  3CC2 A;  4OO1 H;  1D8L A;  1GUO A;  2N88 A;  4GKK Q;  1UEB A;  1XNQ Q;  3UDG A;  3K7A B;  3DM3 A;  4NPS A;  1V1Q A;  3JAM L;  4DAV A;  3R8B A;  3TDQ A;  2EY2 A;  2F3I A;  2G9H D;  3C3L A;  1A63 A;  1ESF A;  5T1I A;  1SMY C;  4NMZ A;  3DEP A;  4A3L H;  4A3G B;  2EXZ A;  1MJC A;  3IRB A;  1NCV A;  2JA6 B;  1Y8P B;  2F0E A;  1J8I A;  1X55 A;  4DK3 C;  1SYF A;  2QDB A;  3NTI A;  1N32 Q;  2ZTE A;  3BDC A;  1UE6 A;  4K6D A;  5EQ0 A;  3WWV A;  3WDN A;  2HCI A;  5COR A;  1LTG D;  4ZUI A;  1KD1 C;  1KAB A;  1E0B A;  1HPC A;  4F87 A;  1STA A;  1ROD A;  2AUJ D;  5C0X H;  1U4M A;  1CQF A;  1PZI D;  1VQD A;  3I70 A;  3K59 A;  3LWE A;  1NMG A;  1PTO C;  1GUT A;  4IQZ A;  1JWM D;  1X3G A;  2HIV A;  3S1R H;  4QCL A;  1XMO Q;  1SAP A;  4DK0 A;  4A3B H;  3T1H L;  3X3N A;  3HG9 A;  4L5T A;  1C7Y A;  4QUC A;  4CKE A;  1CKM A;  5C4H A;  1D5Z C;  2NTS A;  2E2J H;  1IBM Q;  4X6A H;  4DV6 L;  2AQ2 B;  3J7Z C;  1K0R A;  2NZO A;  5M3F B;  3PCO B;  2KA7 A;  2B3G A;  4JI7 Q;  2VUM H;  5E4X A;  2A73 B;  4KHP Q;  3IKJ A;  2KHS A;  4O42 A;  1G6P A;  4BBR B;  4NP5 A;  4JYA L;  1QOH A;  2OF1 A;  4RGN A;  2J7Z A;  4LF5 L;  4C3H G;  3I4M B;  2AMC B;  2AUK A;  2IWH A;  3GTK B;  1BBW A;  4ZK9 B;  4IUQ A;  3D4R A;  1DXM A;  4B3T L;  5CV6 A;  2IY5 B;  1TII D;  2K5H A;  1I94 L;  4LF6 Q;  3K0X A;  2C5C A;  3I4N B;  4O1N A;  3LWU A;  2F0S A;  4K0K Q;  3TZD A;  4B3S L;  3HOU B;  2V4D A;  1YJW A;  4XQN A;  1CZW A;  1JE5 A;  3DM1 A;  3BVG A;  2L11 A;  4OEL B;  3HKZ E;  4LK1 C;  4U67 3;  2JEB I;  1IZ6 A;  3I3C A;  4TVA B;  5GAG C;  1LT3 D;  2WFW A;  4GOP B;  3P7J A;  1EQQ A;  4DR7 L;  1FD7 D;  4JI0 L;  1HTL D;  1Z47 A;  1KLG D;  2F52 A;  4K6L A;  1WTX A;  1DOM A;  4FVM A;  3GTM H;  3MXG A;  4DAP A;  2PQA A;  1HA6 A;  3VR5 A;  3SE0 A;  4DAY A;  4TRD A;  1GJX A;  4Q5V A;  4AYB E;  2F0G A;  1RDP D;  2OTL A;  4A3M G;  3E9I A;  1SFO B;  4CDC C;  4WJ3 M;  1WVL A;  1PFB A;  3MWY W;  3CW2 C;  1I4R A;  5EBC A;  2R61 A;  5BN5 A;  3FRP B;  4KKT A;  2XRQ D;  1JMC A;  2RKS A;  2HHH Q;  1CK1 A;  1I6H H;  2SNM A;  1PH1 A;  3D3R A;  4J1M A;  1IBL Q;  2K32 A;  3OIP A;  1LTB D;  4XQQ A;  3H3V I;  4OX9 L;  1CQV A;  3PO2 G;  3B6Y A;  5KEE A;  2K03 A;  2P5Z X;  5FKA C;  3VDY A;  5IGC A;  4A3J G;  2R7Z H;  1B4O A;  4DF7 A;  1S5E D;  2A6H D;  3EVQ A;  3HOW G;  3KBX A;  2UUB Q;  3C1F A;  1X3E A;  1ET9 A;  2O4X A;  1J9O A;  1BQQ T;  2N3S A;  3NSW A;  2CHB D;  4N9P A;  3HOX H;  1Y1V G;  1B53 A;  2Z6K A;  2KJX A;  2B2W A;  2FIN B;  4J6H A;  1K9M C;  5CGK A;  3H09 A;  2X6G A;  2FJ2 A;  3MFY A;  1JOK A;  2M9V A;  2A68 C;  2JA8 B;  3DEO A;  1ASY A;  2R93 H;  2KHI A;  2JJQ A;  1X56 A;  4OO1 I;  1VCI A;  1N9W A;  2BA1 A;  3CF5 A;  1HXY D;  1WI5 A;  3HOZ G;  2A6E C;  4K14 A;  1SNQ A;  3JAM i;  1BR9 A;  5IY0 A;  4Z9C B;  1OXS C;  3P1H A;  1K8O A;  3NWT A;  1LT4 D;  4OWT B;  1VMC A;  2K75 A;  2CH4 A;  3P20 A;  4LF4 L;  3OIQ A;  4QIW B;  2BE5 C;  1EEI D;  2JA5 H;  3HOY B;  1N33 L;  3ONA B;  1STB A;  1V1P B;  2QCP X;  3KLW A;  3W5O A;  2IX3 A;  5C6A A;  2RVL A;  3V96 A;  1G91 A;  2JSO A;  3AB9 A;  1H95 A;  2O5I C;  2RHS B;  2KEN A;  3H15 A;  1WTR A;  3K81 C;  4ALP A;  3TS2 A;  2UXD Q;  2PCF B;  4JI1 L;  2Z0S A;  2CWP A;  4X65 Q;  3CQZ H;  3PO3 G;  3OMC A;  5L37 A;  5C0X I;  2EJG C;  1C0A A;  5J3B A;  2OT2 A;  1STG A;  2JA7 B;  2GN5 A;  4I65 A;  1K3B C;  3RR5 A;  2EXD A;  4UAI A;  4ZQ3 A;  4KD3 A;  4G4K A;  4OL7 A;  1F77 A;  3VR6 A;  1NTG A;  3NBH A;  1TT2 A;  4PZ8 A;  1QVF A;  5M5X H;  3AFQ A;  1WCM B;  5IT9 c;  1VS0 A;  4OHJ A;  1JOO A;  2CW0 C;  2QEJ C;  4KN4 C;  3UDF A;  2L1B A;  2A74 C;  3RMH A;  2A69 C;  3S14 B;  4K5X A;  4TQU S;  4A3I B;  5K5P A;  1NY4 A;  2JQO A;  4ZKB B;  1FYC A;  2ALY B;  1BCP F;  3E0J A;  1I3Q H;  4C3J G;  2X69 A;  4A3F B;  1N34 L;  4A3D G;  4RKL A;  1QZH A;  4K5W A;  2VQF L;  3CRL C;  4IZ8 A;  5IOC A;  3PUZ A;  3G4S A;  1B8A A;  4XXE A;  4X3T A;  1I4H A;  3GD7 A;  1VQ8 A;  4DK6 C;  1DD2 A;  1FNW A;  1SE4 A;  1O7Y A;  4G7O C;  3K5N A;  5C5L A;  1S4Z A;  3RN5 A;  5I4D A;  1BBX C;  1E22 A;  2DJG C;  3TME A;  5GAH C;  4B3T Q;  1V8Q A;  4GN5 A;  1I94 Q;  4ZYS A;  2AKW B;  1PH2 A;  1GM5 A;  1MBY A;  3JC6 6;  2E2H H;  3BS1 A;  1EIG A;  4YHH Q;  1AFP A;  4CJ0 B;  5LHY 1;  3JAM E;  2L55 A;  2EY6 A;  4FNF A;  3KJP A;  3VR3 A;  1JWS D;  1YNN D;  1XXG A;  2CVR A;  2MO1 A;  2CFM A;  4QQB X;  2Y0S G;  4K2L A;  1GUG A;  3BZD B;  4YY3 L;  3ERO A;  3OSO A;  3NEL A;  4DR7 Q;  4KJO A;  1PTO H;  3PIP 3;  4JI0 Q;  1YJN A;  1NR2 A;  1PFS A;  3MHB A;  4DR3 Q;  2PMZ B;  2VXW A;  2H5X A;  2ASB A;  3NXW A;  1I4X A;  2KUM A;  2IX0 A;  4RHS A;  1IBK Q;  3EBE A;  1CT1 D;  1XTC D;  4RFB A;  2N49 A;  4DXF A;  1DOK A;  1TU2 B;  3FMC A;  1HFN A;  1LAC A;  4DR4 Q;  4AQY Q;  2UXC L;  2V1C C;  2NUC A;  1BVS A;  1V43 A;  4C3H H;  1SDF A;  2I5L X;  3S1R B;  2PW5 A;  5NUC A;  2KEC A;  5EJW A;  3T1Y L;  1VQN A;  4A3B B;  1GUW A;  5E3F A;  4X62 Q;  1XPU A;  1FGU A;  3ULJ A;  3CCJ A;  3J80 c;  1E1O A;  1SE2 A;  1F9P A;  4A3C G;  1WTW A;  4R4T A;  1A3U A;  2GVA A;  5GQO A;  3OHX C;  1XNR L;  3NEM A;  5A35 A;  3I73 A;  5J39 A;  1STE A;  2VUM B;  1YIJ A;  4I7Z C;  1VQ4 A;  1PYB A;  1AZP A;  1VQI A;  3GTQ B;  1BUV T;  1XWE A;  4HJ9 A;  2BH8 A;  5HUR A;  1E3P A;  3M4Q A;  1AE3 A;  1KDA A;  3GTG H;  3TRZ A;  3CKI B;  2E75 C;  2AQ3 B;  2NN6 H;  2NVX H;  1EU4 A;  4XDX A;  1H9K A;  2F0L A;  4MTK A;  2FMC A;  5IYB G;  4A3M H;  2SNS A;  3FDT A;  2HDL A;  2ES2 A;  1MD2 D;  4B3M Q;  4HCS A;  3N52 A;  4X3K A;  3S15 B;  1D1I A;  3W2D A;  2RHQ B;  4BA1 I;  4R9W A;  1GD7 A;  1C9O A;  1RIP A;  1TR5 A;  3MFG A;  5KRU A;  1ICW A;  2IJ0 A;  1P16 A;  1WOC A;  4R4C A;  2LSS A;  1EY8 A;  5LMN Q;  2B63 G;  1JOQ A;  3PO2 H;  3MXP A;  2Z8L A;  4XYO A;  1JJC B;  1HZA A;  1DON A;  2CKZ B;  1D2B A;  3FP9 A;  3S24 A;  1HQR D;  3MXU A;  3GTM B;  3KYH C;  4A3J H;  3FHW A;  4ZUJ A;  3MC0 B;  2B2V C;  4LF4 Q;  2NBF A;  3HOW H;  2LMC B;  4G57 A;  5JOB A;  1X32 A;  2RCN A;  2R6G A;  4F88 A;  4JVZ A;  4DNT B;  1CTM A;  4ODG A;  4RH6 A;  4C2M B;  4RWS C;  4DK1 A;  4EQP A;  3S2H B;  1PZJ D;  1Y1V H;  1ONL A;  1VQB A;  2NVT H;  3KDF B;  3MVV A;  5FO9 B;  4JI1 Q;  1I6H B;  2PQA B;  2Q2U A;  3J81 c;  4DAY B;  5ELN A;  3F1Z A;  4DV3 L;  2YTV A;  1Q46 A;  1VF7 A;  2L0C A;  2IHE A;  2R7Z B;  3CCM A;  2O2L D;  1GKH A;  1I4G A;  3M4Y A;  4U68 A;  3I91 A;  2Y0S E;  2QA4 A;  3SR1 A;  1XMQ L;  2YTY A;  1Q90 A;  1Y14 B;  5M9O A;  2M2L A;  3PF5 A;  4ZRZ A;  4A75 A;  1H9M A;  3CP0 A;  1R9T H;  2NZ1 D;  1XYI A;  4NXN Q;  4HID A;  4KY7 A;  5I2Y A;  2BDO A;  3HOX B;  1WTQ A;  2WAQ B;  4HCE A;  3ND8 A;  4GN3 B;  1DCZ A;  1V1P A;  3AQQ A;  1BCP D;  4WJ4 A;  1ILP A;  1TWF B;  2L12 A;  2BDN A;  1JB7 A;  1PXU A;  1PH9 A;  2FHT A;  3GQB A;  1QCB D;  2R93 B;  1TWH H;  2O5J C;  2WP8 J;  2E76 C;  2LS0 1;  5G3L D;  4N8F A;  1ESR A;  4NXM L;  2UU9 Q;  1TWG H;  2RDH A;  2SDF A;  1ICF B;  2EVB A;  3PO3 H;  1EZ8 A;  4BY1 H;  2XN9 C;  3T4A C;  4KD4 A;  4HJA A;  2B2T C;  2K04 A;  1U0L A;  2Z6B A;  1L1O B;  1R4P B;  2EDG A;  3HKZ B;  1L1O C;  3I2Z A;  4DV7 Q;  1SYB A;  2ZTD A;  2F1M A;  3T53 B;  2JA5 B;  4O2D A;  1GXD C;  1YNJ D;  4CDD C;  3T13 A;  3TP6 A;  4Y52 H;  2E74 C;  4WRD A;  2Q8I B;  4YY3 Q;  2N8N A;  2K50 A;  3A8K E;  3AEV A;  1W6K A;  4LUZ A;  5EKK A;  4OXP A;  4JCV E;  2EJM A;  4ABN A;  4C3J H;  4A3D H;  4A93 H;  2HDM A;  3CQZ B;  4KY5 A;  1YBY A;  4JI5 L;  2D0O A;  4DU9 A;  2QEX A;  5M3M B;  3OWF A;  2RA4 A;  2UXC Q;  1BO0 A;  5LMN W;  1XJV A;  4Y7N H;  5KNC A;  5GAE C;  2PZU A;  5KYL A;  1SNM A;  2VW9 A;  3T1Y Q;  1SNC A;  5GAD C;  1EY5 A;  1VQE A;  2F0F A;  2HIX A;  5M5X B;  4AYB G;  1SRO A;  1X3P A;  4ZKC B;  4PQX A;  5DEH A;  1MSH A;  3FKI H;  4P72 A;  2QDL A;  2ENB A;  1K73 C;  1SSO A;  1XNR Q;  5D3D A;  1YIT A;  1PH4 A;  1LTL A;  2A8V A;  5E7N A;  5IYC G;  1QUQ A;  1UUP A;  1SE8 A;  3Q6S A;  3KJO A;  2JYO A;  2PNH A;  2ZM6 L;  1O7L A;  1RL2 A;  4DKA C;  1SBB B;  1VF5 C;  3DXJ C;  3NBH B;  3D6C A;  3TBI B;  2ZXP A;  5I6W A;  1QIL A;  5JPM C;  4JV5 L;  1HUN A;  3C46 A;  4DR6 L;  2EYO A;  1BDO A;  3CPW A;  4RAU C;  3SK6 A;  2EYL A;  1A3V A;  2OEO A;  2EIF A;  3K8A A;  3HOV B;  2K1B A;  5C4X G;  2NN6 I;  2DJF C;  1TWA B;  3A54 A;  1Z9F A;  1NNX A;  3F2U A;  1A0I A;  1ZEQ X;  4RCO A;  3CHB D;  4NW2 A;  1EQV A;  1Q8K A;  1AZQ A;  2E2H B;  4CGY B;  4EQO A;  3GO5 A;  1NMF A;  4ZCK A;  1Q3L A;  4JBJ A;  3AU7 A;  2F03 A;  4EVO A;  2WAC A;  1EY0 A;  4FYD A;  4R4Q A;  1S72 A;  1N36 L;  5IP7 G;  4L5R C;  3IL8 A;  4A3C H;  1YI2 A;  1M4V A;  1EFW A;  4DV5 Q;  1ENF A;  2MFI A;  1PTO B;  1GO3 E;  1G29 1;  4K8J A;  3HKS A;  2I0Q A;  4F7X A;  1EWH A;  2OTJ A;  3L9A X;  1Q82 C;  3ULL A;  4XIG S;  1KLU D;  1JR0 D;  4QL5 A;  4YWK A;  3S17 H;  4IFD I;  1TS3 A;  2HD3 A;  2QW7 A;  1F9R A;  1TY2 A;  3G71 A;  2K01 A;  1WD1 A;  2KEE A;  4A3G G;  5BR8 L;  3G7L A;  2ZT9 C;  4C3H B;  2JA6 G;  4B3R L;  3NTK A;  2OWO A;  3M85 A;  4EGV A;  1VMP A;  4JBW A;  5M5Y H;  5IYB H;  2UXB Q;  3RZD H;  1E1T A;  2PI2 A;  4X3U A;  3I90 A;  1WYD A;  4JI2 L;  2HQE A;  2ZJR A;  1M8A A;  4BY7 G;  3FVQ A;  5EAY A;  3E3X A;  4LAA A;  4RGO S;  1YJ9 A;  2VB2 X;  4R8N A;  2J0T D;  3IAY A;  1FGB D;  1E2V A;  1O78 A;  4APV A;  2G9D A;  2C35 B;  2B63 H;  2K5N A;  1HTP A;  1PV4 A;  4HJ5 A;  1IXR A;  1SXT A;  1XMQ Q;  2UUC Q;  2ZJP A;  5FOB B;  3C2P A;  3OW2 A;  4JI3 L;  3TRE A;  3GTG B;  2B2V A;  5FO8 B;  1SJH D;  5DAU A;  2KOL A;  2NWG A;  2K33 A;  1GUN A;  3U4V A;  5LMU L;  1EOV A;  2RQX A;  3PGZ A;  4BBR G;  3PF4 A;  4QY7 A;  4BXX G;  4DV2 L;  3KDF A;  2IW3 A;  5LL6 X;  2QF7 A;  2K5Q A;  1RTN A;  2F0W A;  4NXM Q;  1GVP A;  3RLF A;  3F2B A;  3RNU A;  1K83 H;  1EY6 A;  1HQM C;  2I07 B;  3A74 A;  3PO2 B;  2EYH A;  3GTJ H;  1LLR D;  5IGB A;  1S40 A;  5AJ3 L;  4KLK A;  1MSG A;  3Q22 A;  3A55 A;  4A3J B;  1ML0 D;  1B9N A;  4LFC Q;  2G5D A;  3HOW B;  1B50 A;  5D14 A;  3A7A B;  4LF8 L;  3EFX D;  4H7B A;  2IPK D;  1D6E C;  2N78 A;  1W3S A;  2Z9H A;  5CV5 A;  4MZ9 A;  4GKJ Q;  4NKL A;  4HN7 A;  1L0Y B;  2GA4 B;  2E5L L;  3ZYY X;  4F8M A;  2R7F A;  1Y1V B;  3DWA A;  1SN8 A;  2AWN A;  2A5H A;  3MAQ A;  2K05 A;  1EY4 A;  1STN A;  3RZO H;  1AP0 A;  1KNE A;  2KQ3 A;  2YU9 H;  1OXX K;  2AHO B;  1IYV A;  3NEN A;  4N8X 1;  1X3Q A;  3KOJ A;  1DGS A;  1SR3 A;  5EKL A;  3OTO L;  3U4Z A;  3OPO A;  2XRS D;  4CJ1 B;  1QNK A;  4YCV A;  4G7H C;  2E2D C;  4MN3 A;  1E2Z A;  2B39 A;  1HNZ L;  5FLX c;  3K0Y A;  2Z4I A;  4FXG C;  4DR2 L;  1GOZ A;  2LKV A;  2B2T A;  1WJJ A;  3KF6 B;  2KCM A;  3VA7 A;  4JBM A;  4GLX A;  2MHV A;  1L1O A;  4DR5 L;  1R9T B;  3MA2 B;  4XT3 B;  5C4Z A;  3ER0 A;  1FNU A;  1H9S A;  1O80 A;  4X66 Q;  3CCQ A;  1PRT B;  2K28 A;  2QGQ A;  4CKC A;  1EOT A;  1PRT C;  4LFB L;  1EU3 A;  2A68 D;  1ZKO A;  2ZTC A;  3R2T A;  4JI6 L;  1HR0 L;  1EZ6 A;  4HIO A;  4JV5 Q;  1TWH B;  4DR6 Q;  1SRU A;  3GTP B;  3EA6 A;  3I8Z A;  2F0N A;  2A6E D;  4JG2 A;  1TWG B;  2D0P A;  2ZXO A;  3STB C;  5IE8 A;  2XVS A;  3PO3 B;  1L0X B;  4BY1 B;  2A1A A;  3A5Z B;  1SMX A;  3D0F A;  3PUW A;  5IT9 L;  4GN4 B;  1JQY D;  2Q2T A;  2IT1 A;  3SEB A;  1LAB A;  1S5F D;  3NTH A;  1EY9 A;  2BE5 D;  5KNB A;  2JA8 G;  4P73 A;  4UP9 A;  1G51 A;  2B2Y A;  3Q0A A;  3S1M H;  3D6W A;  4KHV A;  5FJ8 G;  1S5D D;  1VQG A;  3MEH A;  4UDU C;  5F2D A;  4BS9 A;  4QGU A;  3SGI A;  3A7L A;  2L9H A;  1ENC A;  1F9S A;  1TS5 A;  3T1H Q;  4A3D B;  3EJI A;  4A93 B;  1VQ6 A;  1JE4 A;  2LXJ A;  3I55 A;  4XQJ A;  2XWB B;  4PV1 C;  3CRK C;  3FEW X;  3HOY G;  5IIF A;  5C4X H;  4DV6 Q;  1Q12 A;  1IKM A;  5DM7 3;  4UY8 C;  1JWU D;  2EYP A;  1JJG A;  2F3W A;  3HGB A;  2CW0 D;  2XIW A;  3H0G G;  5JJI A;  2A69 D;  4P74 A;  3FKI B;  4JYA Q;  4JI2 Q;  3GTO H;  1OXV A;  1XTD A;  4DV4 L;  2TSS A;  1X9N A;  4XTC S;  4LF5 Q;  4FXD A;  1JOR A;  1JT8 A;  4JI8 L;  3D4W A;  1QB5 D;  1EY7 A;  2VL6 A;  3RLO A;  4EQN A;  3RN2 A;  5IP7 H;  3Q24 A;  3KBG A;  1G8Z D;  2K5W A;  1U4L A;  4L63 B;  4TKO B;  2Q2H A;  4B3S Q;  4DNR B;  3QG1 A;  3VR2 A;  5JJZ A;  4LFA L;  2ID0 A;  5COY A;  2HCC A;  3BG3 A;  5CV4 A;  2ICI A;  1QUQ B;  2F4I A;  3R93 A;  3V2T A;  4ID6 A;  4A3I G;  3J80 L;  1ZYR D;  5LMU Q;  3SVM A;  4OGQ C;  1MKH A;  1XX8 A;  3BVM A;  4DV2 Q;  2RDF A;  1E7Z A;  2K5V A;  4KJN A;  1TVX A;  5EBD A;  4NDX A;  2L5T A;  4DPG A;  1JC7 A;  2NVQ H;  4KN7 C;  1EUJ A;  4OO1 G;  4HED A;  1KXL A;  5JPN C;  2XSC A;  4OEM B;  1LTA D;  4BY7 H;  1LV9 A;  2PZW A;  4R4O A;  4M1U B;  1ENA A;  4A4I A;  3KUP A;  2RCF A;  4P71 A;  3W3A A;  4LF8 Q;  1SYC A;  4DUY L;  4A3L G;  4HSV A;  3U50 C;  2E2J B;  1F2L A;  1X54 A;  4A3E G;  4OX9 Q;  3UDI A;  5CC4 A;  5TSS A;  2E5L Q;  1RTO A;  4IUP A;  1S5B D;  1LTT D;  2WKD A;  3AFP A;  5M5Y B;  4CDE C;  3CCV A;  1TXY A;  2KCT A;  3TZU A;  3SXH A;  5FK9 C;  5GRO A;  1S3O A;  1YHB A;  5C0X G;  4KY6 A;  3OTO Q;  4BXX H;  1B44 D;  1UE5 A;  5JEA G;  2K14 A;  4HJ8 A;  3NBI A;  1ZXT A;  4CJ2 C;  2N55 A;  2RSO A;  2B8G A;  3KLS X;  4A3B G;  4IPG A;  3GTK H;  1D7Q A;  2BH2 A;  1K0S A;  3HFZ B;  2WB1 B;  4R8I A;  1FVI A;  1QE6 A;  4FF2 A;  4QB4 A;  1LO5 D;  2DNE A;  3K5O A;  4L6T B;  3CCL A;  3FPU B;  2F0K A;  3VA5 A;  2KVM A;  3M7N A;  3P75 A;  3BJU A;  3J81 L;  5D3I B;  5FO7 B;  1X3F A;  3GDE A;  4QIW E;  5DLQ E;  3CCU A;  1FJG L;  4JI6 Q;  1KIX A;  1F2Y A;  1GHK A;  2F0I A;  2XNA C;  1K83 B;  1SEB D;  1PTO F;  1N33 Q;  3URY A;  1K8A C;  5C3X A;  3TS0 A;  3GTJ B;  1EIF A;  4CKB A;  2MNA A;  1LT5 D;  1EQR A;  1U4P A;  1F9Q A;  1YHA A;  3GTL H;  4AIM A;  4QUF A;  1XMO L;  2DNC A;  1NAP A;  3KF6 A;  1B1Z A;  5CBE E;  4RKB A;  4N9T A;  1A6X A;  1A3T A;  1JJ2 A;  1KC8 C;  5ELB A;  3M7G A;  2DN8 A;  2LXK A;  2PPB C;  4JBK A;  3K58 A;  4WJW A;  3KLS A;  5ELF A;  1EYG A;  4WFN 3;  4C3I G;  1BF4 A;  4HIM A;  4LWC A;  1JB3 A;  4JI7 L;  3RZO B;  3SK5 A;  2YU9 B;  3HOZ H;  1MIU A;  1KHI A;  1KTK A;  1VQH A;  4FP5 D;  2WV6 D;  3T56 B;  1Y69 U;  5IOD A;  1RKN A;  1NUC A;  1HZ9 A;  2GVB A;  3K5L A;  4S3S A;  4UHV A;  1PYS B;  1HH2 P;  3J7Y W;  3M9B A;  1T5X D;  3DWQ A;  4GNX A;  1W6J A;  1D5X C;  1HA5 A;  1CSQ A;  3QIA A;  5C3W A;  1OTC A;  2VNU D;  5T1G A;  1N34 Q;  1EYC A;  2VQF Q;  3X3M A;  4LF6 L;  5IGD A;  4LJZ C;  4DAM A;  1VQO A;  4DV4 Q;  3J7A F;  1BNZ A;  3M4O H;  2WIN B;  4JI8 Q;  2L15 A;  2JE6 I;  4ME5 A;  1A15 A;  2DUD A;  3OYY A;  2R7Z G;  2NTT A;  5JVG 3;  4FF1 A;  2B29 A;  1STH A;  5CV8 A;  2Q8T A;  5FJ8 H;  1CA5 A;  4DFA A;  3HEJ A;  1RCV D;  4JK1 C;  1LUZ A;  1EFI D;  4BBS G;  3IFT A;  5ISR A;  3J80 i;  1T5E A;  2MUY A;  1H9S B;  1N8R C;  2PMZ E;  4KI0 A;  2WAQ G;  4M8A A;  1TQO A;  2F0M A;  1B9M A;  5C44 G;  2NZH A;  5KGU A;  1CI3 M;  3A56 A;  1C48 A;  2KCN A;  5IT9 E;  5ELD A;  3H6M A;  2YTX A;  1Q81 C;  2F0V A;  2RF4 A;  2R93 G;  3QWN A;  2MP1 A;  4X64 L;  4AYB B;  1I4Q A;  3H0G H;  1IW7 C;  2CQO A;  2ZXR A;  3UE1 A;  3S1M B;  4FDB A;  2MGS A;  4YCW A;  4JI4 L;  3F2C A;  4IOA A;  3SK4 A;  4L8J A;  2HUG A;  1Y1W G;  1HR0 W;  1HNW L;  3S1Q H;  4DA2 A;  3H3V H;  2MJ8 A;  3L3O C;  1LTI D;  3NK9 A;  4FF3 A;  1OXU A;  5H1S E;  1QVC A;  5IP9 G;  2I46 A;  3CD6 A;  2B2Y C;  4V0B A;  4DUY Q;  3U58 A;  2DY7 A;  4XYQ A;  5BN3 A;  2H4O A;  2VQE L;  1NSN S;  4KK7 A;  5C4X B;  3K7U C;  5EPJ A;  2VB3 X;  3L7Z C;  1CKN A;  1PH3 A;  1QG7 A;  1A8V A;  1VQ5 A;  2MO0 A;  5EPK A;  4PMB A;  1KRS A;  3M4P A;  1VQA A;  4EQ5 A;  5KIX A;  1I3Q B;  4A3I H;  2R92 G;  1KAW A;  4BWG B;  3KFU A;  4WOR A;  4B9X A;  1PRT F;  3ERQ A;  5M3M G;  1PZK D;  3VYS A;  3RLN A;  3CXC A;  2I5H A;  4IAL A;  1Q1B A;  4K5V A;  4A76 A;  4P75 A;  4LF7 L;  4KHZ A;  4H44 C;  3CMA A;  2R3Z A;  1SMY D;  1EIY B;  1U4R A;  1E24 A;  1IL8 A;  4A3K G;  1L2F A;  1PDQ A;  5C3E G;  1PH6 A;  3J81 i;  3PIO A;  2SOB A;  4DV0 L;  3PSI A;  3EN2 A;  1SNO A;  3J80 E;  4HMJ A;  2OQK A;  3D4D A;  3SDZ A;  3I4L A;  5CBA E;  4A3E H;  1SND A;  1FJG Q;  1AEX A;  2VZA A;  1TY0 A;  1HFG A;  3HP3 A;  3KF8 B;  1K3R A;  2PNR C;  1G6Z A;  4OWW B;  4OWX B;  2D9U A;  3MTS A;  3S16 H;  4JOI C;  2EYF A;  3HOV G;  2UXD L;  3OW7 A;  5A2Q L;  1RHP A;  4H0L C;  2NVQ B;  1KRT A;  1PTO D;  4X65 L;  4OIJ A;  3PUV A;  1AE2 A;  4PMC A;  3M3Y H;  5C0X J;  1BKB A;  1H9J A;  3E9H A;  5JEA J;  4BY7 B;  2JK8 A;  2WII B;  3BDO A;  4MIU A;  5JEA H;  4DN4 M;  3JAM c;  2HT1 A;  1B7Y B;  2RBM A;  4HR7 B;  1MGS A;  4C1N I;  1W2B A;  2F0D A;  4P2C B;  5E4W C;  1R4Q B;  3CCR A;  4DV3 Q;  1YZ6 A;  4I7A A;  2KED A;  1KQS A;  4C1N K;  5JJL A;  3EIV A;  3SHL A;  5CV7 A;  2OQ0 A;  3TN2 A;  2WAQ E;  1CSP A;  5BN4 A;  2EE1 A;  1CKO A;  1HNX L;  1TKW B;  3GTQ H;  4DR1 L;  5ELE A;  4B9W A;  2B2U C;  1PH7 A;  3S1N H;  2F0U A;  1F2Z A;  1I4P A;  1PMR A;  1EL0 A;  2KBN A;  1Q7Y C;  4RMF A;  3N6R A;  1FNV A;  1V9P A;  1LM0 A;  1EEF D;  2NVX B;  1O7Z A;  2WKC A;  2EOT A;  2L4N A;  2M00 A;  5HGT A;  4A3M B;  5M3F G;  1WD0 A;  1TS2 A;  2ICE C;  1HCZ A;  4YIJ A;  2F4V L;  2H1E A;  3KLR A;  1GHJ A;  4KTA A;  4KMU C;  4R1J A;  4DUZ L;  2IHF A;  1DYQ A;  1VQL A;  4LUV A;  3S15 H;  4YHH L;  1C4Q A;  3AMU A;  4DGZ A;  2F0T A;  4GS3 A;  1Q1E A;  3H91 A;  3I4M G;  1KDC A;  4UP7 A;  4FF4 A;  1NR4 A;  1SYE A;  5JVH 3;  1FR3 A;  1EQT A;  3OMG A;  2F3V A;  1IYU A;  3J81 E;  3D31 A;  1FL0 A;  2EZV A;  1A2T A;  4GOP C;  2DY8 A;  3I4N G;  3U9O A;  3MEF A;  4C3I H;  1IL2 A;  4DNI A;  3HOU G;  4DR3 L;  2RDG A;  3BU2 A;  5FLM G;  2YV5 A;  5FLX L;  1IBK L;  4IO9 A;  2EY1 A;  4CDF C;  1G2S A;  2NN6 G;  5J22 A;  5JJK A;  1SYD A;  2IX1 A;  3VYU A;  4DR4 L;  4AQY L;  3LNN A;  5I2X A;  1EYD A;  4G7Z C;  1IYJ B;  1X65 A;  4C2M H;  5CR3 A;  3GTL B;  2NVT B;  2D2C C;  3A0J A;  4X62 L;  3S2H H;  4X64 Q;  4DV1 L;  4JI5 Q;  1VQM A;  2OXP A;  4JI4 Q;  1WTP A;  2A6H C; 
#chains in the Genus database with same CATH homology
 2K5D A;  5I9O A;  3HRZ C;  1G2T A;  3QOL A;  5E1F A;  3HZX A;  3K6O A;  3HOZ B;  3MXN A;  1AW7 A;  4RHR A;  4IFD G;  1SJE D;  1Y8O B;  2F0J A;  2BOS A;  3NP8 A;  2PO4 A;  3H94 A;  1OXT A;  5EPL A;  5IGE A;  4ZLT F;  3K57 A;  4OIK A;  3PUY A;  1DM0 B;  3NPP A;  4CBV A;  1GUS A;  1D5M C;  3ITP A;  2D5D A;  1PFN A;  1PRT D;  3K5M A;  3M4O B;  3V05 A;  2F0P A;  1UAP A;  2NB0 A;  2TMP A;  1QWY A;  2K7V A;  1Z7T A;  1LTR D;  3RUZ A;  5LL6 S;  4RGT A;  3DMU A;  2YYZ A;  1F2M A;  1B2T A;  2PZT A;  3UI2 A;  3VR4 A;  3GV6 A;  3T51 B;  3NQT A;  4MHE A;  2JP1 A;  1RJT A;  4C56 C;  4C3J B;  1DZ1 A;  3NHH A;  2SEB D;  1CZG A;  2F0Q A;  3H0G B;  4DXG A;  2J4X A;  3I72 A;  3MZ5 A;  1I6V C;  5DNF A;  3KK7 A;  4Y7N B;  5C5M A;  1UNS A;  3S1Q B;  3H3V C;  5K36 G;  4K2K A;  1JIC A;  3TSS A;  3C1E A;  5DM6 3;  3PUX A;  1CFM A;  4TSS A;  4PMW A;  4Q0F A;  1EYA A;  4IUT A;  3QOJ A;  3ND9 A;  5ELC A;  5IGF A;  5AFW A;  2Y0S B;  2NYZ D;  2F0O A;  3NE5 B;  3Q23 A;  1LTS D;  3KF8 A;  1JCK B;  1ET6 A;  3FPP A;  5G3L F;  4LMQ D;  2IL8 A;  4E6I A;  2QIL A;  1OO9 B;  2LFN A;  3RD4 A;  2KCC A;  1YNN C;  1ZYR C;  3DHQ A;  3HS0 C;  4J8Q A;  1B3A A;  4FXK C;  1K8M A;  3CU7 A;  1V1O A;  1SNP A;  2JXM B;  4A3E B;  5KYI A;  3PV0 A;  3WOF A;  3E5S A;  2BA0 A;  3S9W A;  2F0H A;  3OOC A;  5CMD A;  3S17 B;  5EKI A;  2FFK B;  3A8J E;  1C8C A;  3S16 B;  3OWE B;  1CHP D;  2B2U A;  4IN3 A;  5A2Q E;  3M3Y B;  3EQL C;  2AQ1 B;  5IGG A;  3T16 A;  1TS4 A;  1DOL A;  3RZD B;  4KKS A;  1UEA B;  4IUU A;  3E6Z X;  4ULL A;  1RD9 D;  4IUV A;  2RSN A;  2EYJ A;  2B63 B;  2MPM A;  5CYU A;  3BVZ A;  3S1N B;  3QO2 A;  4HTH A;  1DJR D;  2AWO A;  3R2I A;  1KDB A;  5CV9 A;  1PFM A;  5EGT A;  1D1K A;  1ILQ A;  2BCO A;  1Q8I A;  3G6J B;  4RCN A;  3O13 A;  5JAV A;  2LY7 A;  3BYT B;  3PIO 3;  1PYW D;  1IHZ A;  1EIH A;  4GZY C;  2FMM A;  1SYG A;  2PW7 A;  1CHQ D;  2X6L A;  2D62 A;  4ILW A;  1CA6 A;  1U9R A;  3BDL A;  4C3I B;  3DWP A;  3NUC A;  3D8G A;  4V19 0;  1MI2 A;  1KAA A;  3NWS A;  4IFD J;  5FLX E;  1KNA A;  4KV6 A;  4IFD H;  5D65 A;  3GP7 A;  1VDZ A;  3NQI A;  4HMI A;  3TP8 A;  5KND A;  2XWJ B;  1S5C D;  2CQA A;  4IUR A;  4RA8 A;  1Z6H A;  4B08 A;  1TWC B;  1IKL A;  2K6A A;  2B8F A;  1QNU A;  1HHV A;  1BCP B;  1QJO A;  2EYM A;  4BBS B;  1BCP C;  2EPB A;  2Z1C A;  5M5W B;  3VYT A;  3QJY A;  3A8I E;  5C44 B;  1BXT A;  3R3O A;  4HAE A;  5C4J B;  5J1Z A;  4HSP A;  4H13 C;  1E2W A;  1WTV A;  5I9P A;  3DUZ A;  4RGM A;  1II3 A;  4FO2 A;  3GV3 A;  4CHT B;  1SE3 A;  1CM9 A;  1Y1W B;  2EY5 A;  4KKU A;  2B2W C;  3LX0 A;  3TP7 A;  1Y8N B;  1YNJ C;  2E2I B;  4PNY A;  5K36 H;  1STY A;  1AN8 A;  1H9R A;  2Z4H A;  1EWC A;  4IUN A;  3QB3 A;  3U9S A;  3PMF A;  4ZAI A;  3SK8 A;  1LT6 D;  1IW7 D;  4BA2 I;  2JEA I;  4K8I A;  2R92 B;  1BOS A;  2EJF C;  3S2D B;  1WTO A;  3BYY B;  3WOE A;  1HRJ A;  1A2U A;  3IFD A;  2PYK A;  4X3S A;  3VYR A;  2PQE A;  1PLF A;  3TP5 A;  4XT1 B;  1RF2 D;  5I6Y A;  1I50 B;  3GTO B;  2QKI C;  4QMG A;  4A3K B;  5C3E B;  1HUM A;  2C9O A;  2Q8R E;  3J7A V;  2NVY B;  4QF4 A;  4OO1 H;  1GUO A;  2N88 A;  3K7A B;  3JAM L;  4DAV A;  3R8B A;  3TDQ A;  2EY2 A;  2G9H D;  3C3L A;  1ESF A;  5T1I A;  1SMY C;  4NMZ A;  3DEP A;  4A3G B;  2EXZ A;  1NCV A;  2JA6 B;  1Y8P B;  2F0E A;  1J8I A;  1SYF A;  2QDB A;  3NTI A;  3BDC A;  4K6D A;  5EQ0 A;  3WDN A;  2HCI A;  5COR A;  1LTG D;  4ZUI A;  1KAB A;  1E0B A;  1HPC A;  4F87 A;  1STA A;  1ROD A;  2AUJ D;  5C0X H;  1U4M A;  1CQF A;  1PZI D;  3I70 A;  3K59 A;  3LWE A;  1PTO C;  1GUT A;  4IQZ A;  1JWM D;  4QCL A;  1SAP A;  4DK0 A;  3X3N A;  3HG9 A;  4QUC A;  4CKE A;  5C4H A;  1D5Z C;  2NTS A;  2AQ2 B;  5M3F B;  2KA7 A;  5E4X A;  2A73 B;  3IKJ A;  2KHS A;  4O42 A;  4BBR B;  4NP5 A;  1QOH A;  2OF1 A;  4RGN A;  2J7Z A;  4C3H G;  3I4M B;  2AUK A;  2IWH A;  3GTK B;  4ZK9 B;  4IUQ A;  3D4R A;  1DXM A;  5CV6 A;  1TII D;  2C5C A;  3I4N B;  4O1N A;  3LWU A;  2F0S A;  3TZD A;  3HOU B;  2V4D A;  4XQN A;  1CZW A;  3DM1 A;  3BVG A;  2L11 A;  4LK1 C;  4U67 3;  2JEB I;  3I3C A;  1LT3 D;  3P7J A;  1FD7 D;  1HTL D;  1Z47 A;  1KLG D;  4K6L A;  1WTX A;  1DOM A;  4FVM A;  3MXG A;  4DAP A;  1HA6 A;  3VR5 A;  3SE0 A;  4DAY A;  4TRD A;  1GJX A;  4Q5V A;  2F0G A;  1RDP D;  1SFO B;  1WVL A;  1PFB A;  3MWY W;  1I4R A;  5EBC A;  2R61 A;  5BN5 A;  3FRP B;  4KKT A;  2XRQ D;  2RKS A;  1CK1 A;  2SNM A;  3D3R A;  4J1M A;  2K32 A;  3OIP A;  1LTB D;  4XQQ A;  1CQV A;  5KEE A;  2K03 A;  5FKA C;  5IGC A;  1B4O A;  4DF7 A;  1S5E D;  2A6H D;  3EVQ A;  3KBX A;  3C1F A;  1ET9 A;  2O4X A;  1J9O A;  1BQQ T;  3NSW A;  2CHB D;  4N9P A;  1B53 A;  2KJX A;  2B2W A;  2FIN B;  4J6H A;  5CGK A;  3H09 A;  2X6G A;  2FJ2 A;  3MFY A;  1JOK A;  2M9V A;  2A68 C;  2JA8 B;  3DEO A;  4OO1 I;  1VCI A;  2BA1 A;  1HXY D;  2A6E C;  4K14 A;  1SNQ A;  1BR9 A;  4Z9C B;  1OXS C;  3P1H A;  1K8O A;  3NWT A;  1LT4 D;  1VMC A;  3P20 A;  3OIQ A;  4QIW B;  2BE5 C;  1EEI D;  3HOY B;  3ONA B;  1STB A;  1V1P B;  2QCP X;  2IX3 A;  5C6A A;  2RVL A;  3V96 A;  1G91 A;  2JSO A;  3AB9 A;  2O5I C;  1WTR A;  2PCF B;  3OMC A;  5C0X I;  2EJG C;  2OT2 A;  1STG A;  2JA7 B;  4I65 A;  4UAI A;  4ZQ3 A;  4KD3 A;  4G4K A;  4OL7 A;  1F77 A;  3VR6 A;  3NBH A;  1TT2 A;  1WCM B;  4OHJ A;  1JOO A;  2CW0 C;  2QEJ C;  4KN4 C;  2L1B A;  2A74 C;  3RMH A;  2A69 C;  3S14 B;  4K5X A;  4TQU S;  4A3I B;  5K5P A;  4ZKB B;  1FYC A;  1BCP F;  3E0J A;  4C3J G;  2X69 A;  4A3F B;  4RKL A;  4K5W A;  3CRL C;  4IZ8 A;  5IOC A;  3PUZ A;  4XXE A;  4X3T A;  1I4H A;  3GD7 A;  1DD2 A;  1FNW A;  1SE4 A;  1O7Y A;  4G7O C;  3K5N A;  5C5L A;  1S4Z A;  1BBX C;  5I4D A;  3TME A;  1V8Q A;  4ZYS A;  1MBY A;  3BS1 A;  1EIG A;  1AFP A;  4CJ0 B;  5LHY 1;  3JAM E;  2L55 A;  2EY6 A;  4FNF A;  3VR3 A;  1JWS D;  1YNN D;  1XXG A;  2CVR A;  4K2L A;  1GUG A;  3BZD B;  3ERO A;  3OSO A;  4KJO A;  1PTO H;  3PIP 3;  1NR2 A;  3MHB A;  2PMZ B;  2VXW A;  1I4X A;  3NXW A;  2KUM A;  2IX0 A;  4RHS A;  1CT1 D;  1XTC D;  4RFB A;  4DXF A;  1DOK A;  1TU2 B;  3FMC A;  1HFN A;  1LAC A;  2NUC A;  1V43 A;  1SDF A;  3S1R B;  2PW5 A;  5NUC A;  2KEC A;  5EJW A;  1GUW A;  4A3B B;  5E3F A;  1SE2 A;  1F9P A;  1WTW A;  1A3U A;  3OHX C;  5A35 A;  3I73 A;  5J39 A;  1STE A;  2VUM B;  4I7Z C;  1AZP A;  3GTQ B;  1BUV T;  1XWE A;  5HUR A;  1KDA A;  3CKI B;  2E75 C;  2AQ3 B;  2NN6 H;  1EU4 A;  4XDX A;  1H9K A;  2F0L A;  2FMC A;  2SNS A;  3FDT A;  2HDL A;  1MD2 D;  4HCS A;  3N52 A;  4X3K A;  3S15 B;  1D1I A;  3W2D A;  4BA1 I;  4R9W A;  1TR5 A;  3MFG A;  5KRU A;  1ICW A;  2IJ0 A;  1EY8 A;  1JOQ A;  3MXP A;  2Z8L A;  4XYO A;  1DON A;  1D2B A;  1HQR D;  3MXU A;  3GTM B;  4ZUJ A;  3MC0 B;  2B2V C;  2NBF A;  2LMC B;  4G57 A;  5JOB A;  1X32 A;  2R6G A;  4F88 A;  4DNT B;  1CTM A;  4ODG A;  4RH6 A;  4C2M B;  4RWS C;  4DK1 A;  4EQP A;  3S2H B;  1PZJ D;  1ONL A;  3MVV A;  5FO9 B;  1I6H B;  1VF7 A;  2L0C A;  2R7Z B;  2O2L D;  1I4G A;  3M4Y A;  4U68 A;  3I91 A;  3SR1 A;  1Q90 A;  5M9O A;  2M2L A;  4ZRZ A;  1H9M A;  1XYI A;  2NZ1 D;  4KY7 A;  5I2Y A;  2BDO A;  3HOX B;  1WTQ A;  2WAQ B;  4HCE A;  3ND8 A;  1DCZ A;  1V1P A;  1BCP D;  1ILP A;  1TWF B;  2L12 A;  2BDN A;  1PXU A;  2FHT A;  3GQB A;  1QCB D;  2R93 B;  2O5J C;  2WP8 J;  2E76 C;  2LS0 1;  5G3L D;  1ESR A;  2RDH A;  2SDF A;  2EVB A;  1EZ8 A;  2XN9 C;  3T4A C;  4KD4 A;  2B2T C;  2K04 A;  1R4P B;  2EDG A;  3HKZ B;  1SYB A;  2F1M A;  3T53 B;  2JA5 B;  1GXD C;  1YNJ D;  3T13 A;  3TP6 A;  2E74 C;  4WRD A;  2Q8I B;  3A8K E;  1W6K A;  5EKK A;  2EJM A;  4ABN A;  2HDM A;  3CQZ B;  4KY5 A;  4DU9 A;  5M3M B;  3OWF A;  2RA4 A;  1BO0 A;  5KNC A;  2PZU A;  5KYL A;  1SNM A;  1SNC A;  1EY5 A;  2F0F A;  5M5X B;  1X3P A;  4ZKC B;  4PQX A;  5DEH A;  1MSH A;  2ENB A;  1SSO A;  5D3D A;  1UUP A;  3Q6S A;  2JYO A;  1O7L A;  1SBB B;  1VF5 C;  3DXJ C;  3D6C A;  3TBI B;  2ZXP A;  5I6W A;  1QIL A;  5JPM C;  1HUN A;  3C46 A;  2EYO A;  1BDO A;  3SK6 A;  4RAU C;  2EYL A;  1A3V A;  2OEO A;  3HOV B;  2K1B A;  2NN6 I;  1TWA B;  3A54 A;  3F2U A;  1ZEQ X;  4RCO A;  3CHB D;  4NW2 A;  1EQV A;  1AZQ A;  2E2H B;  4CGY B;  4EQO A;  3GO5 A;  1Q3L A;  3AU7 A;  2F03 A;  4EVO A;  2WAC A;  1EY0 A;  4FYD A;  3IL8 A;  1M4V A;  1ENF A;  1PTO B;  1G29 1;  4K8J A;  4F7X A;  1EWH A;  3L9A X;  4XIG S;  1KLU D;  1JR0 D;  4IFD I;  1TS3 A;  1F9R A;  1TY2 A;  1WD1 A;  2K01 A;  2KEE A;  3G7L A;  2ZT9 C;  4C3H B;  3NTK A;  3M85 A;  4EGV A;  1VMP A;  4JBW A;  4X3U A;  3I90 A;  2HQE A;  1M8A A;  3FVQ A;  4LAA A;  4RGO S;  2VB2 X;  4R8N A;  2J0T D;  3IAY A;  1FGB D;  1E2V A;  1O78 A;  2G9D A;  1HTP A;  1SXT A;  5FOB B;  3C2P A;  3GTG B;  2B2V A;  5FO8 B;  1SJH D;  5DAU A;  2KOL A;  2NWG A;  2K33 A;  1GUN A;  2RQX A;  2IW3 A;  5LL6 X;  2QF7 A;  2K5Q A;  1RTN A;  2F0W A;  3RLF A;  1EY6 A;  1HQM C;  2I07 B;  3PO2 B;  2EYH A;  1LLR D;  5IGB A;  1MSG A;  3Q22 A;  3A55 A;  4A3J B;  1ML0 D;  1B9N A;  3HOW B;  1B50 A;  5D14 A;  3A7A B;  3EFX D;  4H7B A;  2IPK D;  1D6E C;  5CV5 A;  4NKL A;  4HN7 A;  1L0Y B;  2GA4 B;  3ZYY X;  4F8M A;  1Y1V B;  3DWA A;  2AWN A;  2A5H A;  3MAQ A;  2K05 A;  1EY4 A;  1STN A;  1AP0 A;  1KNE A;  2KQ3 A;  1IYV A;  1OXX K;  1X3Q A;  5EKL A;  3OPO A;  2XRS D;  4CJ1 B;  1QNK A;  4G7H C;  2E2D C;  4MN3 A;  1E2Z A;  2B39 A;  3K0Y A;  2Z4I A;  4FXG C;  1GOZ A;  2LKV A;  2B2T A;  3VA7 A;  2MHV A;  1R9T B;  3MA2 B;  4XT3 B;  5C4Z A;  1FNU A;  1H9S A;  1O80 A;  1PRT B;  2K28 A;  4CKC A;  1EOT A;  1PRT C;  1EU3 A;  2A68 D;  1ZKO A;  3R2T A;  1EZ6 A;  1TWH B;  3GTP B;  3EA6 A;  3I8Z A;  2F0N A;  2A6E D;  1TWG B;  2ZXO A;  2XVS A;  3PO3 B;  1L0X B;  4BY1 B;  3PUW A;  5IT9 L;  1JQY D;  2IT1 A;  3SEB A;  1LAB A;  1S5F D;  3NTH A;  1EY9 A;  2BE5 D;  5KNB A;  2B2Y A;  3Q0A A;  3D6W A;  4KHV A;  1S5D D;  3MEH A;  4UDU C;  5F2D A;  4BS9 A;  3A7L A;  2L9H A;  1ENC A;  1F9S A;  1TS5 A;  4A3D B;  3EJI A;  4A93 B;  1JE4 A;  4XQJ A;  2XWB B;  4PV1 C;  3CRK C;  3FEW X;  5IIF A;  1Q12 A;  1IKM A;  5DM7 3;  1JWU D;  2EYP A;  2F3W A;  3HGB A;  2CW0 D;  2XIW A;  2A69 D;  3FKI B;  1OXV A;  2TSS A;  4XTC S;  4FXD A;  1JOR A;  3D4W A;  1QB5 D;  1EY7 A;  4EQN A;  3Q24 A;  3KBG A;  1G8Z D;  2K5W A;  1U4L A;  4L63 B;  4TKO B;  4DNR B;  3QG1 A;  3VR2 A;  5JJZ A;  2ID0 A;  5COY A;  2HCC A;  3BG3 A;  5CV4 A;  2ICI A;  3V2T A;  2F4I A;  3R93 A;  4ID6 A;  3J80 L;  1ZYR D;  3SVM A;  4OGQ C;  1XX8 A;  3BVM A;  2RDF A;  4KJN A;  1TVX A;  5EBD A;  4NDX A;  2L5T A;  1JC7 A;  4KN7 C;  4OO1 G;  4HED A;  5JPN C;  2XSC A;  1LTA D;  1LV9 A;  2PZW A;  4M1U B;  1ENA A;  3KUP A;  3W3A A;  1SYC A;  4HSV A;  2E2J B;  1F2L A;  5CC4 A;  5TSS A;  1RTO A;  4IUP A;  1S5B D;  1LTT D;  2WKD A;  5M5Y B;  3TZU A;  3SXH A;  5FK9 C;  5C0X G;  4KY6 A;  1B44 D;  5JEA G;  3NBI A;  1ZXT A;  4CJ2 C;  2N55 A;  2RSO A;  2B8G A;  3KLS X;  2WB1 B;  4R8I A;  1QE6 A;  4FF2 A;  4QB4 A;  1LO5 D;  2DNE A;  3K5O A;  4L6T B;  3FPU B;  2F0K A;  3VA5 A;  2KVM A;  3M7N A;  3P75 A;  3J81 L;  5D3I B;  5FO7 B;  1F2Y A;  1GHK A;  2F0I A;  2XNA C;  1K83 B;  1SEB D;  1PTO F;  3URY A;  5C3X A;  3GTJ B;  4CKB A;  1LT5 D;  1U4P A;  1F9Q A;  4QUF A;  2DNC A;  1NAP A;  1B1Z A;  5CBE E;  4RKB A;  4N9T A;  1A6X A;  1A3T A;  5ELB A;  3M7G A;  2DN8 A;  2PPB C;  3K58 A;  4WJW A;  3KLS A;  5ELF A;  4WFN 3;  4C3I G;  1BF4 A;  1JB3 A;  3RZO B;  3SK5 A;  2YU9 B;  1KTK A;  4FP5 D;  3T56 B;  2WV6 D;  1Y69 U;  5IOD A;  1RKN A;  1NUC A;  3K5L A;  4S3S A;  3J7Y W;  1T5X D;  3DWQ A;  1W6J A;  1D5X C;  1HA5 A;  3QIA A;  5C3W A;  2VNU D;  5T1G A;  1EYC A;  3X3M A;  5IGD A;  4LJZ C;  3J7A F;  1BNZ A;  2WIN B;  2JE6 I;  4ME5 A;  1A15 A;  2NTT A;  5JVG 3;  4FF1 A;  1STH A;  5CV8 A;  2Q8T A;  1CA5 A;  4DFA A;  3HEJ A;  1RCV D;  4JK1 C;  1EFI D;  3IFT A;  5ISR A;  1T5E A;  2MUY A;  1H9S B;  4KI0 A;  4M8A A;  1TQO A;  2F0M A;  1B9M A;  5KGU A;  1CI3 M;  3A56 A;  1C48 A;  2KCN A;  5IT9 E;  5ELD A;  3H6M A;  2F0V A;  3QWN A;  2MP1 A;  4AYB B;  1I4Q A;  1IW7 C;  2ZXR A;  3S1M B;  2MGS A;  3SK4 A;  4L8J A;  2HUG A;  4DA2 A;  2MJ8 A;  3L3O C;  1LTI D;  3NK9 A;  4FF3 A;  1OXU A;  2I46 A;  2B2Y C;  4V0B A;  2DY7 A;  4XYQ A;  5BN3 A;  2H4O A;  1NSN S;  4KK7 A;  5C4X B;  5EPJ A;  2VB3 X;  3L7Z C;  1QG7 A;  5EPK A;  4PMB A;  5KIX A;  1I3Q B;  4BWG B;  4WOR A;  4B9X A;  1PRT F;  3ERQ A;  1PZK D;  3VYS A;  4IAL A;  1Q1B A;  4K5V A;  4KHZ A;  4H44 C;  2R3Z A;  1SMY D;  1U4R A;  1IL8 A;  1PDQ A;  2SOB A;  1SNO A;  3J80 E;  4HMJ A;  3D4D A;  3SDZ A;  3I4L A;  5CBA E;  1SND A;  1AEX A;  1TY0 A;  1HFG A;  3HP3 A;  2PNR C;  1G6Z A;  2D9U A;  3MTS A;  2EYF A;  3OW7 A;  5A2Q L;  1RHP A;  4H0L C;  2NVQ B;  1PTO D;  4OIJ A;  3PUV A;  4PMC A;  5C0X J;  1H9J A;  5JEA J;  4BY7 B;  2WII B;  3BDO A;  4MIU A;  5JEA H;  4DN4 M;  2RBM A;  4HR7 B;  1MGS A;  4C1N I;  2F0D A;  4P2C B;  5E4W C;  1R4Q B;  2KED A;  4C1N K;  3SHL A;  5CV7 A;  3TN2 A;  5BN4 A;  2EE1 A;  1TKW B;  5ELE A;  4B9W A;  2B2U C;  2F0U A;  1F2Z A;  1I4P A;  1PMR A;  1EL0 A;  3N6R A;  1FNV A;  1EEF D;  2NVX B;  1O7Z A;  2WKC A;  2EOT A;  2L4N A;  2M00 A;  5HGT A;  4A3M B;  1WD0 A;  1TS2 A;  2ICE C;  1HCZ A;  4YIJ A;  2H1E A;  3KLR A;  1GHJ A;  4KTA A;  4KMU C;  1DYQ A;  1C4Q A;  3AMU A;  4DGZ A;  2F0T A;  1Q1E A;  3H91 A;  1KDC A;  4FF4 A;  1NR4 A;  1SYE A;  5JVH 3;  1FR3 A;  1EQT A;  3OMG A;  2F3V A;  1IYU A;  3J81 E;  3D31 A;  2EZV A;  1A2T A;  2DY8 A;  3U9O A;  2RDG A;  5FLX L;  2EY1 A;  1G2S A;  2NN6 G;  5J22 A;  1SYD A;  2IX1 A;  3VYU A;  3LNN A;  5I2X A;  1EYD A;  4G7Z C;  5CR3 A;  3GTL B;  2NVT B;  2D2C C;  2OXP A;  1WTP A;  2A6H C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...