2PYKA

Crystal structure of staphylococcal nuclease variant v66q/p117g/h124l/s128a at room temperature
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
130
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKVEKYGPEASAFTKKMQENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystallographic study of hydration of an internal cavity in engineered proteins with buried polar or ionizable groups.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 38
structure length 130
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2pykA00
3MEHA 3ITPA 4ZUIA 4K8JA 1KABA 2SOBA 1A2UA 5C4ZA 1TT2A 3NQTA 4J6HA 5C5MA 3NHHA 3TMEA 5I6WA 5IGEA 4KV6A 3OMCA 1NUCA 1F2YA 1U9RA 5CGKA 4K5VA 3TP5A 1JOOA 3SHLA 3C1EA 2F0HA 4H7BA 3OWFA 1EYAA 1KDCA 2EYHA 3EROA 4I65A 4PMCA 3SK8A 3SXHA 5KRUA 4DFAA 4QB4A 5CV9A 4DU9A 4E6IA 4DF7A 3HEJA 1ENCA 2F0UA 2F0JA 3R3OA 4OL7A 4HMIA 1NSNS 4K2KA 4K8IA 2KHSA 5CV5A 3MZ5A 3H6MA 1STGA 2F0KA 2LKVA 2M00A 3MVVA 3OMGA 5DAUA 4ZQ3A 1TQOA 5ISRA 1RKNA 1EY0A 2F0TA 5F2DA 4K2LA 5M9OA 4K6DA 1EY5A 1EZ8A 2EY1A 1STHA 2OF1A 4IALA 2F0SA 4ZUJA 5C4HA 4NKLA 5EKLA 1SYBA 4N9PA 4KJNA 4F8MA 5KYIA 2EYFA 4MIUA 4NDXA 1SYFA 1KDBA 4IZ8A 3E5SA 3SK5A 5IGDA 5KYLA 2RKSA 5IIFA 1A3TA 2F0OA 1SNOA 1ENAA 4R8NA 4G57A 2F0GA 1SYDA 5CV7A 2PZUA 3BDCA 1EY7A 4PMBA 3NP8A 5IGCA 2PYKA 2F0EA 4HMJA 1IHZA 3D8GA 1KAAA 2F0VA 2SNSA 1II3A 4KHVA 1SNDA 3QB3A 3V2TA 4K5XA 3D6CA 4RKLA 5CR3A 1EQVA 3OSOA 4QMGA 4B9WA 5IGGA 3P75A 2ENBA 2NUCA 5J1ZA 3NXWA 5K5PA 2EY5A 2OXPA 5EKKA 5CV4A 2QDBA 4RKBA 3LX0A 2EYOA 3BDLA 3QOJA 2F3VA 3ERQA 3EVQA 4S3SA 2F0QA 3T16A 2HQEA 5JAVA 3EJIA 5J39A 5J22A 5IOCA 3HZXA 1STNA 4K5WA 4KY7A 3NUCA 4HTHA 2PW7A 3NK9A 1F2ZA 2EYPA 1F2MA 4ID6A 4DGZA 4ODGA 4EQOA 5CV6A 1STBA 1SYGA 2OEOA 2PQEA 3QOLA 2WACA 4KY5A 3PMFA 3SK4A 3T13A 2F0LA 5E1FA 5KIXA 5JOBA 1AEXA 2EY2A 1SNMA 3D4WA 5IGFA 2F0IA 2F0WA 1SYCA 4KD3A 5C3XA 1EY4A 2KQ3A 1EYDA 3MHBA 3RUZA 4KTAA 1JORA 4WRDA 4TRDA 4KJOA 4WORA 2PZWA 2EY6A 3D4DA 5E3FA 5HURA 5I6YA 2F3WA 3DHQA 4YIJA 3VA5A 1A3VA 2O4XA 4N9TA 3P1HA 2PW5A 4KD4A 4LAAA 2EYMA 2RDFA 4NMZA 4QF4A 3MXPA 1EZ6A 5C5LA 1EY6A 2EYJA 4EVOA 1SNPA 3TP8A 1EY9A 1EY8A 2RBMA 2F0FA 1STYA 3DMUA 2F0PA 4NP5A 4EQNA 3C1FA 4PNYA 1A2TA 3TP6A 5HGTA 5IGBA 2PZTA 5CV8A 5KGUA 1KDAA 4J1MA 4ME5A 2SNMA 1JOKA 5C6AA 5CC4A 1SNQA 3SK6A 2F0NA 5DEHA 5IODA 1STAA 5KEEA 1A3UA 4K14A 3S9WA 1EYCA 3TP7A 2F0MA 4IUNA 4EQPA 5I9OA 1SNCA 3U9OA 1TR5A 1SYEA 2F0DA 5NUCA 4F7XA 5C3WA 2EXZA 1JOQA 5I9PA 2EYLA 4KY6A 4B9XA 5EGTA 3SR1A
chains in the Genus database with same CATH superfamily
3RR5A 1NR2A 4HSVA 2CWAA 4A3FH 4RHRA 4BY7H 2MJ8A 4GS3A 5FLXE 4P72A 5IP9H 4KHPQ 1B7YB 2EYHA 1G91A 4K0KL 2B29A 4BBRG 1GD7A 3A8IE 1MSGA 4JI0L 2GN5A 2D5DA 3K7UC 4GKJL 1JICA 4A3MH 4IOAA 3GD7A 1JCKB 3DXJC 5JJKA 1EZ8A 2YTXA 1SMYD 4NKLA 4DK6C 2AWNA 3TN2A 1KDBA 4B3SQ 2HDMA 3NTKA 4HSPA 1WJJA 2L5TA 3F1ZA 5C3EG 1SNOA 3LWEA 3IRBA 3IL8A 1LT4D 5CYUA 4HMJA 4BS9A 1RHPA 1MGSA 2NVQB 4CHTB 1EWCA 1QVGA 1EQVA 2B8GA 1NJIC 3UDGA 4DR2Q 5EKKA 1O7ZA 2IJ0A 4LFCL 1CT1D 2NN6I 3T53B 3I90A 3IFDA 2LFNA 5M3MB 2B2TA 2ZXRA 1QZGA 4A3KB 2A8VA 4DV1L 2BH2A 1NY4A 4IPCA 3PMFA 2F0LA 2UUCL 4YCVA 4R1JA 4LUOA 1B9MA 2UXDQ 1WCMG 3VYUA 1M1KC 2NTSA 1Q8IA 2F3WA 3DHQA 3I55A 4Q0FA 2BA1A 4LUVA 2JA8G 1X9NA 2F0FA 1STYA 2K03A 1S3OA 1EQTA 2UUAL 2R93H 1HNWL 5C6AA 1YNND 2JN4A 4K14A 2XGTA 1V1PA 2ZTCA 1SNCA 2KA7A 3HOUH 5NUCA 1PHJA 3SE0A 5I9PA 3K0YA 1I4XA 1BCPB 3HOYH 5IE8A 1YHBA 2Y0SB 3KUPA 5FJ8H 2CKZB 3F2CA 5IP7G 2MNAA 1F2YA 1AH9A 3TP5A 1HNXQ 2LMCB 3BVGA 1F77A 1NMGA 2ZM6Q 1B44D 4C3IH 4LF8Q 3PUYA 3D3RA 4JBJA 1NSNS 4LF9L 2F0KA 1UUPA 1VQDA 4FXKC 5ISRA 1K8AC 5G3LD 1H9SA 3L0OA 2AQ1B 2IT1A 2UXCL 1NE3A 3TBIB 4LF5L 1X6OA 4CKEA 2JA6G 1A3TA 1VS0A 1GUNA 2AQ3B 4DV1Q 2IX1A 2UUCQ 2QKIC 3I4LA 1K83B 4PMBA 3RMHA 4Y7NH 3CMEA 1L0YB 3KDFB 5IYCH 3Q23A 1MD2D 1WFQA 2WKCA 3FHWA 3M7NA 2E76C 1PZKD 2EJMA 2L12A 4OWTB 4ILWA 3NE5B 2NVYB 2Q2UA 4DAVA 1KQSA 2EYOA 2F1MA 2QDLA 2PMZE 5A2QE 3KYHC 1XTDA 1GUGA 1XJVA 3GTPB 4KY7A 5GADC 2UUAQ 2Z8LA 1F2ZA 1ESRA 2NVTH 2WAQG 2CW0D 4DV3L 5DNFA 1KLGD 4GOPB 3I4MG 1J6QA 2ID0A 3KBXA 3N52A 4BA1I 2F0WA 2G5DA 3MHBA 1DJRD 2PNHA 1SN8A 3MXNB 1I4PA 4WORA 2EPBA 2RCNA 1F2LA 4NMZA 2HHHL 2EYJA 1QB5D 2MP1A 3CW2C 4Y52H 1RJTA 1EY9A 1EY8A 2DJFC 3M9BA 2Q8RE 4QQBX 2G9HD 3TDQA 2VL6A 1JWUD 4A3CH 4GNXA 4DV0L 3A5ZB 5GAGC 4GN4B 4LF9Q 2AUKA 3RLOA 3T4AC 4L5SA 2PCFB 3JAME 1E3PA 3AYHB 4O0AA 2K04A 4PZ8A 4YHHL 3KLWA 4A75A 2F0DA 2C5CA 3ULPA 1CI3M 3OW7A 5IT9E 2EYLA 2UXCQ 1XPRA 3MEHA 2A68C 4LF5Q 3P7JA 5FO7B 1E1OA 1EQRA 4IOCA 4X3UA 3OMCA 1HUNA 2R92G 1HA6A 3PO2H 1S5DD 3G4SA 2JP1A 2E2JB 2I5LX 4UAIA 4OX9L 3R3OA 4RCNA 2WP8J 4HMIA 2E2IB 2VUMH 1HHVA 2M00A 2RSOA 3FEWX 2VW9A 4JI5Q 5M9OA 3WOEA 4BBSH 4TVAB 2EJGC 3HFZB 2KEDA 1IW7D 4DV2L 1JT8A 1I50H 5IIFA 3TREA 3K8AA 4C3JH 3M3YH 4IFDJ 3GO5A 4MTNA 3RLFA 4QUFA 1PYSB 4O1NA 4DV3Q 5I2XA 1SMYC 4DXGA 4A3GH 1EU3A 4TQUS 3VYRA 4OIKA 3AFQA 2D0OA 3K59A 3VYTA 4X6AH 1EWHA 2B2WA 1HZBA 2NUCA 2HHHQ 2NZHA 1PTOH 3S2HH 4V0BA 4CDFC 3GTMH 3NSWA 3GTOB 2Z6KA 5TSSA 3MEFA 3MFYA 5AJ3L 1TVXA 4RGNA 4KK7A 4DV0Q 4HJAA 1GXDC 1B50A 2QILA 1HA5A 5T1GA 1FJGL 1QUQA 4YHHQ 4RAUC 4UY8C 2EQSA 4IUUA 1PH9A 1PRTB 2R93B 3NEMA 4XQQA 2FMMA 1HUMA 1K3BC 1JORA 3FKIG 1N33L 3PSIA 3VR3A 1E2VA 2BH8A 4NXNL 3UDFA 4P73A 2PQAA 4RMFA 2EYMA 3HOUB 3TP8A 4WJ3M 2Z6BA 2NN6G 1I4RA 1ENFA 1A2TA 3TP6A 2DNCA 1K8MA 4OX9Q 4QIWB 2JYOA 4J1MA 1RDPD 1UWVA 3PO3H 4OO1G 4A3DH 5C4XH 2M2LA 1NBWA 4A3LG 3AU7A 1ICFB 5ELDA 2K6AA 2FJ2A 3QIAA 2L15A 1GUWA 1TWAB 2JE6I 1S40A 1K28A 4JI6L 4K8JA 3CQZB 5C4ZA 1FVIA 3PF5A 1LTRD 1S5ED 1EEID 1QOHA 5I4DA 1TS2A 4UDUC 1YNXA 4PMCA 1CKMA 4DU9A 3VR4A 2K5HA 2ZTEA 4CKCA 1Y69U 2LKVA 1UE6A 2L55A 1R9TH 3RNUA 2LXKA 1E1TA 5K36G 1N9WA 5C4HA 3HRZC 5T1IA 3HOZG 2B2YC 3WOFA 2OTJA 3ND9A 2DGYA 4A76A 1JE4A 1CM9A 5C0XH 1PH1A 2VQFQ 1PZJD 5IYBG 1PVOA 1TS4A 1SYDA 1YJ9A 4DK3C 1IL8A 5JPMC 2Y0SE 1N33Q 4NXNQ 5FLMG 3DM1A 4OONA 2MQHA 4LF4L 4DR6L 3S1RB 4JVZA 5CV4A 5J39A 2DY7A 2FXQA 4HAEA 1PH5A 4DNRB 5M5WH 1EFWA 3NK9A 3KLSA 1L0WA 1IKMA 4JI1Q 1GUOA 1STBA 1OXTA 1Q1EA 4JCVE 3T13A 2HD3A 1O7IA 4A3FG 1I4GA 2NB0A 4MTKA 4BY7G 3J7A5 5IP9G 2C9OA 4JI6Q 1JWMD 2N55A 4C3HB 3HOVG 4NXMQ 1XYIA 2A1AA 3S14H 2GA4B 4A3MG 5CBAE 1E24A 2HCIA 1TWCB 5IGBA 2IHFA 1YHAA 1I6HH 2K1BA 1YITA 1VQ8A 3S1QB 4FF3A 4MN3A 2NVQH 5CC4A 3H0GG 1STAA 4LW1A 3S1NB 3PO2B 1V43A 2DNEA 3AQQA 4X3TA 2AKWB 2IW3A 3NBIA 3EFXD 3LWUA 2B2TC 2Q8IB 2EVBA 4HIOA 1PTOD 1M90C 3TEHB 4DPGA 2KECA 3GTQH 4BBSB 3H3VC 2XSCA 4A3KH 1X3PA 4MZ9A 4RA8A 1SR3A 1KDCA 1I50B 2B3GA 3SK8A 4DA2A 3I4OA 4DAYB 5C44B 3S15B 2A69D 1QVFA 1N8RC 3G7LA 3MZ5A 4CKBA 3OMGA 1E22A 4DR6Q 5F2DA 3J80L 4A3GB 1EY5A 1TWHH 2XWBB 1IYJB 2ZJRA 3OTOL 1ZXTA 3V05A 4DR5Q 5EAYA 1IBKL 1ESFA 3HKZG 4JOIC 3S2HB 4MHEA 4OHJA 3HOXB 3GTMB 2XVSA 2A5HA 1G291 1BR9A 3X3MA 1IW7C 1EY7A 4DV6L 1C7YA 1YJNA 3HOWB 1AW7A 1IHZA 2YV5A 3HP3A 3BVZA 3J81i 3BZKA 3K57A 1OXVA 4FVMA 1ZYRC 2Q2HA 2NZ1D 2Z1CA 4H44C 4RKBA 4FYDA 5C0XJ 3T1YL 1VQHA 3M4YA 3K58A 2JEAI 1QE6A 3E9IA 4FF2A 2FINB 5G3LF 1Y1VG 2N78A 3L9AX 4DR7L 1LYLA 1QNKA 1VQ5A 3HOYG 4DR4L 4RGMA 2TSSA 4OIJA 3J81c 4DNIA 5LL6X 1L2FA 3A56A 2F4VL 5KIXA 1AEXA 1BUVT 3I2ZA 1HPCA 4KD3A 4X64L 5ELBA 5C0XI 3PO3B 2EDGA 5ELFA 3NBHB 4C3IG 3PIOA 3VA5A 4DUZL 4IFDG 1CA5A 4KMUC 3RN5A 1MBYA 2SEBD 1HRJA 3PF4A 2K7VA 4ZRZA 1Y8PB 3MC0B 3DM3A 5FLXL 1L1OB 4ULLA 4NW2A 1S4ZA 1Y8NB 4UP7A 4HIDA 5DEHA 1G2SA 1M4VA 1MSHA 3KF8A 1WD1A 2JSOA 5C4JB 2TMPA 1R4PB 4A3IH 2NVYH 3UE0A 1JOQA 3HKZE 1LTLA 4LFBL 1LUZA 3GTPH 3AEVA 3GTGB 3PV0A 2WB1B 4AYBB 3OTOQ 1TT2A 1IKLA 2BDNA 2YTVA 3FMCA 4L6TB 1IBKQ 1NUCA 1HNZL 5CGKA 1X54A 1AZQA 2BA0A 3OWFA 1Y14B 2PPBC 2K05A 2Z9HA 2DJGC 3A0JA 1K8GA 1VQGA 1ET9A 1STGA 1SLJA 2XN9C 4A3EH 2F0TA 1F9QA 3VR2A 1EIYB 5IYDH 3T1YQ 4KJNA 3K5NA 4AH6A 4QIWE 4DR7Q 3T51B 4GOPA 1EIGA 2X69A 3NTIA 4R8NA 3MXNA 2F4VQ 5M5WB 5COYA 3RLNA 2J7ZA 4ZKBB 1KNAA 3D8GA 2J0TD 2SNSA 3BVMA 5D3DA 4A93B 3D0FA 4JV5L 3L2PA 5EKIA 4DUZQ 4B3TL 4M8AA 4A3CG 3BG3A 4IURA 3DLLA 4HJ7A 3NENA 1XNRQ 1IBML 3T16A 2E2JH 2R7ZG 3ONAB 3D6WA 3F2DA 2BE5D 2CVRA 3ZJYC 2E2IH 1VCIA 1AFPA 1TY0A 2PO4A 1HZAA 3S14B 4JI2L 1F9RA 1WTOA 1AP0A 1DD2A 2OCEA 2JA5H 2L1BA 1D8LA 3J7YW 2VQEL 1I6HB 4IJHA 2WV6D 4LFBQ 1PLFA 1DOLA 3CC4A 2UUBL 4LNQA 2PW5A 4GN5A 2Q2TA 2VUMG 1SNPA 4L5RC 4JC0A 4LF7L 2F0PA 1DM0B 1D5ZC 1NNXA 1Q3LA 5L37A 3GTQB 3D31A 2PI2E 1XNQQ 3K80C 3VA7A 2CCZA 1SROA 4HIKA 4GKKL 1IYVA 2MPMA 4JG2A 1AE2A 4C3JG 4B08A 2Z6KC 3NQIA 3A7LA 4F7XA 2KJXA 1VQ4A 3GTOH 1JJGA 2MGSA 1V1OA 3H09A 3BYYB 1KABA 4FF1A 5EPLA 3NQTA 3U4VA 1BO0A 1Q1BA 1U9RA 2KCNA 4OXPA 1TWHB 1ZEQX 4K0KQ 1JR0D 3I4NG 4DF7A 4JI0Q 4GKJQ 4B3ML 4K2KA 4JV5Q 4BY1H 4UHVA 4ZQ3A 5GQOA 3OIPA 1T9HA 1I4QA 4XT3B 4A3BB 5M3FB 1IBMQ 1K8OA 1GHKA 1FNUA 5IGDA 2GVAA 3VDYA 1LTBD 4OEMB 1Y1WH 3FP9A 5A2QL 1E0BA 4JI2Q 2A74C 2VQEQ 4WJWA 3BDCA 4X62L 3NP8A 2F0VA 1TWAH 3V2TA 2E75C 3CQZH 2UUBQ 5IGGA 1WTXA 3GDEA 3A8KE 1JMCA 1DZ1A 4LFCQ 1C4QA 5GAEC 4A3DG 4YWKA 4LF7Q 5C4XG 1S5BD 2HQEA 1MI2A 1U0LA 1YNJD 1SJHD 2K52A 4CDCC 3GTLB 4QGUA 1C8CA 4DV5L 4GKKQ 3M4OH 4CJ1B 2XWJB 4KN4C 1I94L 3EN2A 2BDOA 3F2BA 4LWCA 4LMQD 1I4HA 4XT1B 3JAML 1EY4A 3ULJA 2B2VA 4A3JB 2HUGA 4IUQA 2IX3A 2ES2A 4PQXA 4GLVB 3CCSA 2L9HA 4QCLA 4OWWB 2JA7B 4A3IB 1PDQA 3WDNA 4RFBA 3S16B 1VDZA 2E8GA 1LV9A 1QG7A 2B63B 4PNYA 4DK1A 5BR8L 1U4PA 2KCCA 2PZTA 1QJOA 4K6LA 1TWGH 1HNWQ 2JA9A 1DOMA 1I6VC 2O2LD 3SK6A 1A0IA 3FVQA 1U4RA 2IHEA 3S1RH 3ND8A 4IUNA 4KLKA 1OXXK 2NVXB 1QCBD 1Z7TA 5C0XG 2A19A 4G4KA 4KY6A 5JVG3 4A4IA 4A3EB 5EQ0A 2IWHA 1A2UA 3AMUA 4BXXG 3DUZA 4KV6A 1QNUA 3HKSA 1JOOA 2RHSB 2PI2A 4X62Q 1FNVA 1WTPA 1YIJA 4X66L 2MO0A 2RVLA 5FO8B 1J5EL 3H15A 4C3HH 4DV4L 1Z9FA 3NWTA 1PFNA 5JJLA 4BBRH 4ZAIA 1TWCH 1CZGA 4F8MA 5KYIA 3KJPA 3A5UA 2M9VA 3VYSA 3S1QH 1IBLL 3NTHA 4UP8A 4QL5A 1HCZA 3ERSX 5ELCA 3GTJB 3S1NH 1SE3A 2ZJQA 3UDXA 1RIPA 4HN7A 1CHPD 3N6RA 4FP5D 1PTOF 4F87A 4DUYL 5EJWA 4M1UB 3E6ZX 2JEBI 5E4WC 1TS5A 2K5VA 3A8JE 4K5XA 3OWEB 3CP0A 4H0LC 2JA5B 1HFNA 3FPUB 1BOSA 2B2UA 3NXWA 5K5PA 2EY5A 3BDLA 4IUPA 1F9PA 1FD7D 4R4CA 5BR8Q 5C44H 3KJOA 4YWLA 3S15H 1O7YA 3NUCA 1CQVA 2ZXPA 2I46A 4DGZA 1PRTD 3KOJA 5M3MG 4R4QA 2VB2X 3I73A 4PZ7A 1G2TA 4A3KG 1DOKA 1FNWA 2BE5C 2VZAA 4XTCS 5HURA 3W2DA 4DAYA 1VQJA 3HOXH 3DEPA 3DMUA 3CCRA 4C56C 3HOWH 3AFPA 1U4LA 2IX0A 2F0NA 1PXUA 3S9WA 1B2TA 5I9OA 1J5EQ 4DV4Q 2KEEA 4BWGB 4U68A 1OXSC 2RHQB 1IYUA 1X56A 2FHTA 4ZUIA 1CK1A 4BY1B 4IPHA 3IFTA 3CCQA 1IBLQ 1SE8A 1BXTA 1KRSA 2K5WA 3F2UA 4JW0A 2Y0SG 3SHLA 2A6ED 2N88A 4DUYQ 5KRUA 4LF6L 1Q7YC 4H13C 3M7GA 1IZ6A 1Y1WB 2CHBD 5JJIA 1QVCA 4K8IA 1YVCA 2NTTA 2K75A 4L5QA 1TQOA 1PZID 3VR5A 1VQMA 4C1NI 4DV2Q 4NPSA 1GO3E 1YNNC 1LACA 1F9SA 4XQNA 1EL0A 1QZHA 3W1GA 1W2BA 4EQ5A 1CZWA 4WFN3 4OWXB 1LLRD 2O5JC 3O13A 1ENAA 4G57A 5C4JH 1IXRA 2KCMA 1K73C 2YU9H 2AHOB 3NBHA 4XYOA 3OHXC 4IPGA 1BQQT 3GTGH 4DK0A 3OSOA 3M4OB 2NZOA 3Q8DA 2LSSA 1DCZA 1L1OA 1TKWB 5FOBB 4PZ6A 5JAVA 5AJ3Q 1ILPA 2KVMA 3QWNA 4OGQC 3MTSA 4ID6A 3IKJA 4ODGA 4EQOA 1ML0D 3CHBD 1FJGQ 1SNMA 3D4WA 1TWGB 2ALYB 1YNJC 1WTRA 3BZCA 1VQNA 4WRDA 1VQPA 1PV4A 1XX8A 2DUDA 4N9TA 3I4MH 3CXCA 4NP5A 3R8BA 3S1MB 2ASBA 5IYDG 2NBFA 5DLQE 1KDAA 2ZT9C 1MJCA 4DR3L 3FDTA 4A93H 4CJ0B 1SNQA 4JI3L 3E9HA 5IODA 1B3AA 1A3UA 1HZCA 1V8QA 4HIMA 4EQPA 4HCSA 1TR5A 3NWSA 2NWGA 1D1KA 4B9XA 3GV6A 3X3NA 1O80A 2SDFA 2CW0C 5C5MA 5I6WA 2KENA 4X3KA 3TMEA 5BN4A 2JQOA 4XYQA 4JK1C 1E7ZA 4BBRB 1PFSA 1B4OA 4I65A 3DWQA 4QB4A 1D2BA 3G6JB 1HH2P 1VMPA 3I56A 2UXBL 3J81E 4DAPA 3Q22A 2HQLA 2QA4A 4IUVA 3TS2A 5LL6S 3CCMA 1EY0A 3W5OA 1K3RA 1STHA 3BJUA 2F0SA 1I5FA 1PH3A 2I0QA 3AB9A 4NDXA 5C3EB 1SYFA 1FGUA 2OTLA 4G7OC 3I7FA 2B8FA 4U673 1KRTA 1SXTA 4YCWA 2RQXA 2EOTA 1EOTA 1KAWA 3PUVA 2D2CC 1JE5A 2BCOA 1LTGD 1Q86C 4P71A 3CPWA 4B9WA 4LF4Q 1TWFB 1XWEA 3P75A 5JPNC 3QG1A 5AFWA 1RL2A 3R93A 1FL0A 5HGQA 1YI2A 2F0QA 3SEBA 1EYGA 3T56B 4CGYB 1KLUD 1HR0L 1BBUA 1S5CD 1WTHA 3QJYA 1L0XB 4DR3Q 2CH4W 1VQAA 4JI3Q 3CF5A 1UEAB 1SYGA 1UE1A 3QOLA 3HS0C 5D65A 1D6EC 1WD0A 4A3BH 1WCMB 4DN4M 5M3FH 4PV1C 5IGFA 4AQYL 1R4QB 2RF4A 1Z6HA 1E2WA 2Z0SA 4XDXA 2JA8B 5E3FA 2R93G 1QUQB 1A3VA 5JVH3 1EIFA 4QF4A 3MXPA 1EZ6A 3KF6B 3B6YA 3F8TA 1D7QA 2ZJPA 3HOUG 3FKIH 4PG3A 1CTMA 1RF2D 4R4OA 4R4TA 5KGUA 1UE5A 2UXBQ 4X65L 3CCLA 3K0XA 3S2DB 5FJ8G 3Q6SA 1W6JA 2F0MA 2K50A 1LT6D 1N36L 4RHSA 4HJ9A 4CDEC 1WTVA 4OO1H 2HDLA 3GTLH 1ONLA 2CWPA 3UE1A 1K9MC 1S5FD 1N34L 3PUXA 4H02A 5GAHC 1G8ZD 1QWYA 3SXHA 4DR1L 3EA6A 2B2VC 1I3QB 2J4XA 4QJFA 1SFOB 2QF7A 1LM0A 4A3JH 3E0JA 3URYA 1N32L 2D0PA 3CRKC 2JA7H 3SVMA 2YU9B 2AMCB 3S16H 3G48A 1W3SA 2MFIA 2V1CC 2B63H 3S24A 2O5IC 5LMNW 3PIO3 1DXMA 3Q0AA 2JA6B 5ELOA 3SDZA 1VQIA 5DM63 1PH7A 2WKDA 1A63A 4GLAC 4C1NK 3KLRA 5IYCG 4Q5VA 2F0OA 1HXYD 2P5ZX 3KDFA 2XTIA 1GHJA 2F0GA 4DV6Q 2NVXH 4HJ8A 3HOZH 1CSPA 4AQYQ 2R3ZA 3TSSA 2F0EA 5IGCA 2A6HD 4POFA 1JWSD 1K0SA 1KAAA 3NPPA 1II3A 4L63B 5CR3A 4LK1C 2ZTDA 4JI7L 1AN8A 2RA4A 1YJWA 1VQKA 2OXPA 2EXDA 2EE1A 4FDBA 2VNUD 1H9MA 4GNXC 1PYBA 2WAQB 5EPJA 2VS1A 5FLMH 4DR4Q 4GLXA 2ATWA 1XPUA 3I4MB 5CV6A 1G6PA 1VF5C 1T5EA 2K14A 3CCVA 1WTWA 2L0CA 2K28A 4KHZA 4X64Q 1RODA 3K5LA 1WTQA 1N36Q 1SSOA 5CMDA 4ZYSA 3RZDB 1D1IA 3J80i 5I6YA 3HG9A 2E5LL 3TRZA 1JQYD 1LABA 3A7AB 4LAAA 3GTJH 1N34Q 4XXEA 2E2HH 1VQCA 1JJCB 3C1FA 4C3HG 4DR1Q 1H95A 3MAQA 2PNRC 4ME5A 1JOKA 3P20A 3PQIA 3HOVH 1N32Q 2B2UC 3J80c 3TP7A 1IL2A 5FKAC 3PO2G 1NCVA 2QCPX 3K6OA 1PRTF 3SR1A 1X55A 3ITPA 2VB3X 2R92B 1BVSA 3H0GH 5BN3A 1HNZQ 3GTKB 2RSNA 1CQFA 1ILQA 3W3AA 4K5VA 4H7BA 1HNXL 3T1HL 4BBSG 1D5XC 4DFAA 4GN3B 2B2WC 2WINB 2ZM6L 5FO9B 4LF8L 3CCJA 4OL7A 4ZK9B 1VQFA 3H3VH 3L7ZC 2KHSA 2L4NA 4JBWA 1U4MA 5C44G 4FO2A 1BCPD 4JI7Q 1RKNA 4K2LA 4KKTA 1J9OA 1K0RA 1EQQA 2OF1A 1MHWC 1Q46A 3S17H 1UAPA 4A3GG 1B8AA 1JB3A 3E5SA 5KYLA 2N3SA 1TS3A 1B3QA 2RKSA 2Z4HA 2OT2A 1V9PA 4BA2I 5JEAH 2WFWA 1YHQA 1TY2A 1A8VA 4KN7C 4OO1I 1GVPA 4DKAC 3J81j 3A74A 1PH2A 2CQOA 1V1QA 3U4ZA 3HOXG 1PTOC 4FF4A 2K5QA 4HR7B 2XRQD 2E5LQ 4B3TQ 2R6GA 3HOWG 4B3RL 1H9JA 1YBYA 2Q8TA 4CJ2C 1JJ2A 2A69C 2I5MX 3QOJA 1H9RA 4S3SA 1M8AA 5FLXc 2H5XA 2G9DA 1TU2B 4HTHA 1HQMC 2XRSD 4G7HC 3RN2A 3CAMA 3RZOB 3EIVA 4J8QA 3SK4A 5E1FA 1OXUA 4JOIA 3FKIB 4XIGS 2WIIB 2F0IA 3FPPA 1SYCA 1BBXC 3GP7A 1Y1VH 1EYDA 3CC2A 3RUZA 3K5MA 4TRDA 4YCUA 2ZXOA 4G7ZC 5D14A 4YIJA 2O4XA 3PO3G 2OQKA 2RDFA 1XXGA 4EVOA 4TKOB 3J7AV 1BF4A 1SBBB 2CFMA 4KKSA 4EQNA 5M5XB 3T1HQ 3BU2A 1CKNB 1PFMA 1GOZA 5EPKA 1T5XD 4R9WA 4IFDH 4DXFA 3ICEA 1ASZA 1L1OC 4QUCA 3MA2B 2MHVA 4N8X1 1XMQL 4RG1A 2R61A 2KOLA 5IT9L 1B9NA 3KF8B 4FXGC 1EIHA 4C2MB 5IGEA 5J3BA 4EX5A 1LTTD 1P8LA 4FNFA 2R7FA 2WB1G 2BOSA 4AYBG 1GJXA 4IO9A 1A6XA 1ET6A 5LMNL 2EZVA 4B3MQ 5CV5A 1PA6A 3E3XA 3H6MA 5DM73 3MVVA 3J7AF 2LXJA 4IUTA 1SEBD 3QR8A 4B3RQ 4JI5L 3HOZB 2QGQA 2EY1A 1U5KA 2ICEC 4IALA 4UP9A 5EKLA 1SYBA 4J15A 5ELNA 3FRPB 3S1MH 1DONA 2EYFA 1SE2A 1Q82C 3DWPA 1X65A 2JJQA 2YTYA 3OW2A 3L3OC 1PFBA 1LTID 1J8IA 1STEA 1Y8OB 2K5DA 4JI8L 3TZDA 2HIVA 1CHQD 1WYDA 3M85A 4LUZA 3K7AH 1KTKA 1VQ6A 4L8JA 4A93G 5H1SE 4V190 1NR4A 5JEAJ 2V4DA 3H3VI 3LX0A 4HJ5A 1X3GA 1QILA 2A6HC 1LTSD 1S72A 4K5WA 5M5YH 3ZYYX 1ASYA 2EYPA 4DV5Q 1EU4A 2MO1A 4A3FB 2PQEA 3CU7A 2E2HB 1I94Q 4BY7B 3OPOA 2F52A 2R7ZH 3CPFA 3STBD 1KNEA 1XMQQ 1PYWD 2E74C 4O2DA 1B53A 5C3XA 1GUSA 4ABNA 2KQ3A 2WB1E 2E2DC 5C3EH 4AYBE 5CORA 4KJOA 2IL8A 2MUYA 3I3CA 3D4DA 1XMOL 3HOVB 4A3MB 3BYTB 1Z47A 1WOCA 4KKUA 4RH6A 2VY3A 2RBMA 2RDHA 5HGTA 3HGBA 4JI4L 3H0GB 4L5TA 5LMNQ 4IPDA 4LFAL 2C35B 3MWYW 2EIFA 5JJZA 1TWFH 2HCCA 4I7AA 1CFMA 1SDFA 3PGZA 2F4IA 1HR0W 1SRUA 4DAMA 5E7NA 5LMUL 3VR6A 5C3WA 3G71A 3CD6A 2WAQE 1G51A 4RGOS 1KHIA 4LJZC 1X3FA 2QEJC 2QW7A 3IAYA 3NHHA 2K33A 3DWAA 2ICIA 2Q2IA 1VQEA 3S17B 1Q90A 1ZYRD 1WCMH 3EROA 1PMRA 4RWSC 4X66Q 3HEJA 2OQ0A 1BKBA 3OYYA 4JI8Q 3TS0A 3R2TA 2L11A 2JA8H 2K4KA 4HCEA 1PH4A 4POGA 3JAMi 4JBKA 3I4NH 5HY6A 5A35A 1WVLA 4IFDI 2HT1A 4HEDA 4N9PA 2KBNA 1CUKA 4AIMA 2K32A 4A3BG 1V1PB 1P16A 4MIUA 2OWOA 4IZ8A 5M3FG 3HKZB 3CKIB 1FYCA 5FK9C 1G6ZA 1BCPC 3S2DH 1A62A 2XNAC 5CV7A 2VQFL 2PZUA 3CMAA 2LY7A 5CBEE 3U9SA 4I7ZC 3ER0A 3JAMc 4FXDA 2PYKA 4YY3L 4ZCKA 2CH4A 4GZYC 5IP7H 3KF6A 2N8NA 5IT9c 3U50C 4IN3A 1XMOQ 1YZ6A 2XIWA 1DYQA 2LS01 1UNSA 1Y1VB 3EVQA 3EJIA 4JI4Q 5J22A 2HIXA 1I3QH 3HOYB 1STNA 3BS1A 1H9SB 1X3EA 2B39A 3OOCA 2PW7A 4LFAQ 4ZKCB 1SFOH 1HQRD 1ICWA 1F2MA 3PUZA 4JI1L 4QY7A 4KY5A 1CA6A 4EGVA 1KD1C 4NB3A 2K5NA 5LMUQ 1MKHA 3V96A 3M4PA 3M4QA 5BN5A 3CCUA 2JA6H 4OELB 4C3IB 2CQAA 2JK8A 4KTAA 4DNTB 2EY6A 1O78A 4X3SA 2AWOA 4KD4A 3EBEA 5C5LA 3ULLA 4A3JG 2IPKD 4RGTA 3I91A 4NXML 2JA7G 4A3IG 1E2ZA 1RTNA 3U58A 2EJFC 3KBGA 2AUJD 1EEFD 5KNBA 1KXLA 2H1EA 2B63G 1Q12A 2YYZA 4MNOA 2FMCA 1GUTA 1LT3D 2KCTA 1GM5A 4O42A 2KHIA 3K81C 5LHY1 3J81L 1HFGA 3U9OA 1SYEA 4Y7NB 1HJPA 1FR3A 4WJ4A 5EGTA 4GOPC 1FGBD 5I2YA 1C9OA 5E4XA 3I8ZA 3BDOA 1PH8A 4JYAL 4A3EG 2IY5B 1EYAA 4LF6Q 1GKHA 5EBCA 1RTOA 1EUJA 4YY3Q 1Q81C 1ENCA 2AQ2B 4RCOA 3RZDH 1VQOA 4BXXH 2NVTB 2N49A 5DAUA 3PUWA 4APVA 1X3QA 4JPBW 3CRLC 4K6DA 4GNXB 2RCFA 3WWVA 1XPOA 3SK5A 1BBWA 3LGJA 1W6KA 3K7AB 1KIXA 1Q8KA 4DR5L 2X6LA 3MFGA 3Q24A 3KFUA 1NAPA 4P2CB 1HTLD 3K5OA 1KC8C 5M5YB 1BDOA 4KHVA 1C0AA 4Z9CB 1SNDA 2I07B 5GROA 3PIPA 1VQ7A 3A55A 2R92H 3D6CA 1HZ9A 2A73B 4RKLA 2H4OA 3GTKH 2ENBA 1PH6A 2R7ZB 1BNZA 3H94A 2QDBA 2JA5G 2KHJA 3EQLC 5IOCA 1BCPF 3HZXA 1RD9D 3J7ZC 3LNNA 1AZPA 2GVBA 2KUMA 1UE7A 3G6EA 1LTAD 3PIP3 1OO9B 2UU9L 2VUMB 1ZKOA 5M3MH 3P1HA 1TIID 2F3IA 4JYAQ 3CCEA 3STBC 2Z4IA 4JBMA 1B70B 1NMFA 5CV8A 2VXWA 3W1BA 1SMXA 2SNMA 4C3JB 3SGIA 3M3YB 3QO2A 1C48A 3I70A 1SE4A 2D9UA 1WI5A 5IWAL 1RCVD 5JEAG 1UEBA 1MIUA 2RDGA 2DY8A 2EXZA 1VQ9A 4DV7L 4IJLA 1HTPA 1MJEA 3DEOA 1PRTC 2SOBA 3I72A 5KNCA 2DN8A 4J6HA 3RZOH 1VF7A 4UPAA 4BY1G 3I4NB 4KI0A 2FFKB 3C1EA 2F0HA 1PTOB 2JXMB 4XQJA 4CDDC 2PMZB 2PQAB 1EOVA 2D62A 5CV9A 4E6IA 2F0UA 1VMCA 1TXYA 2F0JA 1EFID 3NELA 1CKOA 1OTCA 3H91A 1Y1WG 3C3LA 2NN6H 1VQLA 2R7DA 1KL9A 3GV3A 3RD4A 4ZUJA 5M5XH 3JC66 3OIQA 1CSQA 1DGSA 4A3LH 1X32A 4F88A 2K01A 4KHPL 3KK7A 1JB7A 1LT5D 3GQBA 4TSSA 1LO5D 4ZLTF 4IQZA 1AE3A 3R2IA 4P74A 3QB3A 3A54A 2UU9Q 3UI2A 3J80E 3D4RA 4QMGA 4C2MH 4A3DB 5C4XB 4CBVA 1CKNA 1H9KA 2A6EC 5J1ZA 3KLSX 5ELEA 3C46A 3TZUA 3UDIA 3ERQA 1EWIA 2F3VA 5KNDA 1XTCD 5IY0A 1HR0Q 1B1ZA 1XNRL 4B3SL 3TQYA 1K83H 1O7LA 4N8FA 3C2PA 5K36H 1JC7A 1NTGA 3PCOB 2OEOA 1SAPA 3E0EA 2WACA 5IWAQ 5JOBA 2EY2A 5D3IB 4YWMA 4DV7Q 4R8IA 4ALPA 1A15A 2PZWA 2I5HA 4R4IA 5IYBH 2QEXA 3MXGA 3MXUA 1VQBA 1R9TB 4P75A 4DR2L 1EY6A 1D5MC 4ME3A 1SJED 2F03A 2B2YA 2NYZD 3CC7A 1YEZA 4X65Q 2A68D 3BZDB 1XNQL 5KEEA 1EYCA 5EBDA 4PMWA 2UXDL 2X6GA
chains in the Genus database with same CATH topology
1NR2A 4HSVA 4RHRA 2MJ8A 5FLXE 1G91A 2EYHA 3A8IE 1MSGA 2D5DA 1JICA 3GD7A 1JCKB 3DXJC 1EZ8A 1SMYD 4NKLA 2AWNA 3TN2A 1KDBA 2HDMA 3NTKA 4HSPA 2L5TA 1SNOA 3LWEA 3IL8A 1LT4D 5CYUA 4HMJA 4BS9A 1RHPA 1MGSA 2NVQB 4CHTB 1EWCA 1EQVA 2B8GA 5EKKA 1O7ZA 2IJ0A 1CT1D 2NN6I 3T53B 3I90A 3IFDA 2LFNA 5M3MB 2B2TA 2ZXRA 4A3KB 3PMFA 2F0LA 1B9MA 3VYUA 2NTSA 1Q8IA 2F3WA 3DHQA 4Q0FA 2BA1A 2F0FA 1STYA 2K03A 1EQTA 5C6AA 1YNND 4K14A 1V1PA 1SNCA 2KA7A 5NUCA 3SE0A 5I9PA 3K0YA 1I4XA 1BCPB 2Y0SB 3KUPA 1F2YA 3TP5A 2LMCB 3BVGA 1F77A 1B44D 3PUYA 3D3RA 1NSNS 2F0KA 1UUPA 4FXKC 5ISRA 5G3LD 1H9SA 2AQ1B 2IT1A 3TBIB 4CKEA 1A3TA 1GUNA 2AQ3B 2IX1A 2QKIC 3I4LA 1K83B 4PMBA 3RMHA 1L0YB 3Q23A 1MD2D 2WKCA 3M7NA 2E76C 1PZKD 2EJMA 2L12A 4ILWA 3NE5B 2NVYB 4DAVA 2EYOA 2F1MA 5A2QE 1GUGA 3GTPB 4KY7A 2Z8LA 1F2ZA 1ESRA 2CW0D 5DNFA 1KLGD 2ID0A 3KBXA 3N52A 4BA1I 2F0WA 3MHBA 1DJRD 1I4PA 4WORA 2EPBA 1F2LA 4NMZA 2EYJA 1QB5D 2MP1A 1RJTA 1EY9A 1EY8A 2Q8RE 2G9HD 3TDQA 1JWUD 2AUKA 3T4AC 2PCFB 3JAME 2K04A 2F0DA 2C5CA 1CI3M 3OW7A 5IT9E 2EYLA 3MEHA 2A68C 3P7JA 5FO7B 4X3UA 3OMCA 1HUNA 1HA6A 1S5DD 2JP1A 2E2JB 4UAIA 3R3OA 4RCNA 2WP8J 4HMIA 2E2IB 1HHVA 2M00A 2RSOA 3FEWX 5M9OA 3WOEA 2EJGC 2KEDA 1IW7D 5IIFA 4IFDJ 3GO5A 3RLFA 4QUFA 4O1NA 5I2XA 1SMYC 4DXGA 1EU3A 4TQUS 3VYRA 4OIKA 3K59A 3VYTA 1EWHA 2B2WA 2NUCA 1PTOH 4V0BA 3GTOB 3NSWA 5TSSA 3MFYA 1TVXA 4RGNA 4KK7A 1GXDC 1B50A 2QILA 1HA5A 5T1GA 4RAUC 4IUUA 1PRTB 2R93B 4XQQA 2FMMA 1HUMA 1JORA 3VR3A 1E2VA 2EYMA 3HOUB 3TP8A 2NN6G 1I4RA 1ENFA 1A2TA 3TP6A 2DNCA 1K8MA 4QIWB 2JYOA 4J1MA 1RDPD 4OO1G 2M2LA 3AU7A 5ELDA 2K6AA 2FJ2A 3QIAA 1GUWA 1TWAB 2JE6I 4K8JA 3CQZB 5C4ZA 1LTRD 1S5ED 1EEID 1QOHA 5I4DA 1TS2A 4UDUC 4PMCA 4DU9A 3VR4A 4CKCA 1Y69U 2LKVA 2L55A 5K36G 5C4HA 3HRZC 5T1IA 2B2YC 3WOFA 3ND9A 1JE4A 1CM9A 5C0XH 1PZJD 1TS4A 1SYDA 1IL8A 5JPMC 3DM1A 3S1RB 5CV4A 5J39A 2DY7A 4HAEA 4DNRB 3NK9A 3KLSA 1IKMA 1GUOA 1STBA 1OXTA 1Q1EA 3T13A 1I4GA 2NB0A 2C9OA 1JWMD 2N55A 4C3HB 1XYIA 2GA4B 5CBAE 2HCIA 1TWCB 5IGBA 2K1BA 3S1QB 4FF3A 4MN3A 5CC4A 1STAA 3S1NB 3PO2B 1V43A 2DNEA 4X3TA 2IW3A 3NBIA 3EFXD 3LWUA 2B2TC 2Q8IB 2EVBA 1PTOD 2KECA 4BBSB 3H3VC 2XSCA 1X3PA 4RA8A 1KDCA 1I50B 3SK8A 4DA2A 5C44B 3S15B 2A69D 3G7LA 3MZ5A 4CKBA 3OMGA 5F2DA 3J80L 4A3GB 1EY5A 2XWBB 1ZXTA 3V05A 1ESFA 3S2HB 4MHEA 4OHJA 3HOXB 3GTMB 2XVSA 2A5HA 1G291 1BR9A 3X3MA 1IW7C 1EY7A 3HOWB 1AW7A 1IHZA 3HP3A 3BVZA 3K57A 1OXVA 4FVMA 1ZYRC 2NZ1D 2Z1CA 4H44C 4RKBA 4FYDA 5C0XJ 3M4YA 3K58A 2JEAI 1QE6A 4FF2A 2FINB 5G3LF 3L9AX 1QNKA 4RGMA 2TSSA 4OIJA 5LL6X 3A56A 5KIXA 1AEXA 1BUVT 1HPCA 4KD3A 5ELBA 5C0XI 3PO3B 2EDGA 5ELFA 4C3IG 3VA5A 4IFDG 1CA5A 4KMUC 1MBYA 2SEBD 1HRJA 2K7VA 4ZRZA 1Y8PB 3MC0B 5FLXL 4ULLA 4NW2A 1S4ZA 1Y8NB 5DEHA 1G2SA 1M4VA 1MSHA 3KF8A 1WD1A 2JSOA 5C4JB 2TMPA 1R4PB 1JOQA 3GTGB 3PV0A 2WB1B 4AYBB 1TT2A 1IKLA 2BDNA 3FMCA 4L6TB 1NUCA 5CGKA 1AZQA 2BA0A 3OWFA 2PPBC 2K05A 1ET9A 1STGA 2XN9C 2F0TA 1F9QA 3VR2A 4KJNA 3K5NA 3T51B 1EIGA 2X69A 3NTIA 4R8NA 3MXNA 5M5WB 5COYA 2J7ZA 4ZKBB 1KNAA 3D8GA 2J0TD 2SNSA 3BVMA 5D3DA 4A93B 5EKIA 4M8AA 3BG3A 4IURA 3T16A 3ONAB 3D6WA 2BE5D 2CVRA 1VCIA 1AFPA 1TY0A 2PO4A 3S14B 1F9RA 1WTOA 1AP0A 1DD2A 2L1BA 3J7YW 1I6HB 2WV6D 1PLFA 1DOLA 2PW5A 1SNPA 2F0PA 1DM0B 1D5ZC 1Q3LA 3GTQB 3D31A 3VA7A 1IYVA 2MPMA 4C3JG 4B08A 3NQIA 3A7LA 4F7XA 2KJXA 2MGSA 1V1OA 3H09A 3BYYB 1KABA 4FF1A 5EPLA 3NQTA 1BO0A 1Q1BA 1U9RA 2KCNA 1TWHB 1ZEQX 1JR0D 4DF7A 4K2KA 4ZQ3A 3OIPA 1I4QA 4XT3B 4A3BB 5M3FB 1K8OA 1GHKA 1FNUA 5IGDA 1LTBD 5A2QL 1E0BA 2A74C 4WJWA 3BDCA 3NP8A 2F0VA 3V2TA 2E75C 5IGGA 1WTXA 3A8KE 1DZ1A 1C4QA 1S5BD 2HQEA 1MI2A 1YNJD 1SJHD 3GTLB 1C8CA 4CJ1B 2XWJB 4KN4C 2BDOA 4LMQD 1I4HA 4XT1B 3JAML 1EY4A 2B2VA 4A3JB 2HUGA 4IUQA 2IX3A 4PQXA 4QCLA 2L9HA 2JA7B 4A3IB 1PDQA 3WDNA 4RFBA 3S16B 1VDZA 1LV9A 1QG7A 2B63B 4PNYA 4DK1A 1U4PA 2KCCA 2PZTA 1QJOA 4K6LA 1DOMA 1I6VC 2O2LD 3SK6A 3FVQA 1U4RA 3ND8A 4IUNA 1OXXK 2NVXB 1QCBD 1Z7TA 5C0XG 4G4KA 4KY6A 5JVG3 4A3EB 5EQ0A 2IWHA 1A2UA 3AMUA 3DUZA 4KV6A 1QNUA 1JOOA 1FNVA 1WTPA 2RVLA 5FO8B 3NWTA 1PFNA 4ZAIA 4F8MA 1CZGA 5KYIA 2M9VA 3VYSA 3NTHA 5ELCA 1HCZA 3GTJB 1SE3A 4HN7A 1CHPD 3N6RA 4FP5D 1PTOF 4F87A 5EJWA 4M1UB 3E6ZX 2JEBI 5E4WC 1TS5A 3A8JE 4K5XA 3OWEB 4H0LC 2JA5B 1HFNA 3FPUB 1BOSA 2B2UA 3NXWA 5K5PA 2EY5A 3BDLA 4IUPA 1F9PA 1FD7D 1O7YA 3NUCA 1CQVA 2ZXPA 2I46A 4DGZA 1PRTD 2VB2X 3I73A 1G2TA 1DOKA 1FNWA 2BE5C 4XTCS 5HURA 3W2DA 4DAYA 3DEPA 3DMUA 4C56C 1U4LA 2IX0A 2F0NA 1PXUA 3S9WA 1B2TA 5I9OA 2KEEA 4BWGB 4U68A 1OXSC 1IYUA 2FHTA 4ZUIA 1CK1A 4BY1B 3IFTA 1BXTA 2K5WA 3F2UA 3SHLA 2A6ED 2N88A 5KRUA 4H13C 3M7GA 1Y1WB 2CHBD 4K8IA 2NTTA 1TQOA 1PZID 3VR5A 4C1NI 1YNNC 1LACA 1F9SA 4XQNA 1EL0A 1CZWA 4WFN3 1LLRD 2O5JC 3O13A 1ENAA 4G57A 3NBHA 4XYOA 3OHXC 1BQQT 4DK0A 3OSOA 3M4OB 1DCZA 1TKWB 5FOBB 5JAVA 1ILPA 2KVMA 3QWNA 4OGQC 3MTSA 4ID6A 3IKJA 4ODGA 4EQOA 1ML0D 3CHBD 1SNMA 3D4WA 1TWGB 1YNJC 1WTRA 4WRDA 1XX8A 4N9TA 4NP5A 3R8BA 3S1MB 2NBFA 1KDAA 2ZT9C 3FDTA 4CJ0B 1SNQA 5IODA 1B3AA 1A3UA 1V8QA 4EQPA 4HCSA 1TR5A 3NWSA 2NWGA 1D1KA 4B9XA 3GV6A 3X3NA 1O80A 2SDFA 2CW0C 5C5MA 5I6WA 4X3KA 3TMEA 5BN4A 4XYQA 4JK1C 4BBRB 1B4OA 4I65A 3DWQA 4QB4A 1D2BA 3G6JB 1VMPA 3J81E 4DAPA 3Q22A 4IUVA 5LL6S 1EY0A 1STHA 2F0SA 3AB9A 4NDXA 5C3EB 1SYFA 4G7OC 2B8FA 4U673 1SXTA 2RQXA 2EOTA 1EOTA 3PUVA 2D2CC 2BCOA 1LTGD 4B9WA 1TWFB 1XWEA 3P75A 5JPNC 3QG1A 5AFWA 3R93A 2F0QA 3SEBA 3T56B 4CGYB 1KLUD 1S5CD 3QJYA 1L0XB 1UEAB 1SYGA 3QOLA 3HS0C 5D65A 1D6EC 1WD0A 1WCMB 4DN4M 4PV1C 5IGFA 1R4QB 1Z6HA 1E2WA 4XDXA 2JA8B 5E3FA 1A3VA 5JVH3 4QF4A 3MXPA 1EZ6A 5KGUA 1CTMA 1RF2D 3S2DB 3Q6SA 1W6JA 2F0MA 1LT6D 4RHSA 1WTVA 4OO1H 2HDLA 1ONLA 1S5FD 3PUXA 1G8ZD 1QWYA 3SXHA 3EA6A 2B2VC 1I3QB 2J4XA 1SFOB 2QF7A 3E0JA 3URYA 3CRKC 3SVMA 2YU9B 2O5IC 3PIO3 1DXMA 3Q0AA 2JA6B 3SDZA 5DM63 2WKDA 4C1NK 3KLRA 4Q5VA 2F0OA 1HXYD 1GHJA 2F0GA 2R3ZA 3TSSA 2F0EA 5IGCA 2A6HD 1JWSD 1KAAA 3NPPA 1II3A 4L63B 5CR3A 4LK1C 1AN8A 2RA4A 2OXPA 2EE1A 2VNUD 1H9MA 2WAQB 5EPJA 3I4MB 5CV6A 1VF5C 1T5EA 1WTWA 2L0CA 2K28A 4KHZA 3K5LA 1RODA 1WTQA 1SSOA 5CMDA 4ZYSA 3RZDB 1D1IA 5I6YA 3HG9A 1JQYD 1LABA 3A7AB 4LAAA 4XXEA 3C1FA 4C3HG 3MAQA 2PNRC 4ME5A 1JOKA 3P20A 2B2UC 3TP7A 5FKAC 1NCVA 2QCPX 3K6OA 1PRTF 3SR1A 3ITPA 2VB3X 2R92B 5BN3A 3GTKB 2RSNA 1CQFA 1ILQA 3W3AA 4K5VA 4H7BA 1D5XC 4DFAA 2B2WC 2WINB 5FO9B 4OL7A 4ZK9B 3L7ZC 2KHSA 2L4NA 4JBWA 1U4MA 4FO2A 1BCPD 1RKNA 4K2LA 4KKTA 1J9OA 2OF1A 1UAPA 1JB3A 3E5SA 5KYLA 1TS3A 2Z4HA 2RKSA 2OT2A 4BA2I 5JEAH 4KN7C 1TY2A 4OO1I 1PTOC 4FF4A 2K5QA 4HR7B 2XRQD 2R6GA 1H9JA 2Q8TA 4CJ2C 2A69C 3QOJA 1H9RA 4S3SA 1M8AA 2G9DA 1TU2B 4HTHA 1HQMC 2XRSD 4G7HC 3RZOB 4J8QA 3SK4A 5E1FA 1OXUA 3FKIB 4XIGS 2WIIB 2F0IA 3FPPA 1SYCA 1BBXC 3GP7A 1EYDA 3RUZA 3K5MA 4TRDA 2ZXOA 4G7ZC 5D14A 4YIJA 2O4XA 2RDFA 1XXGA 4EVOA 4TKOB 3J7AV 1BF4A 1SBBB 4KKSA 4EQNA 5M5XB 1PFMA 1GOZA 5EPKA 1T5XD 4R9WA 4IFDH 4DXFA 4QUCA 3MA2B 2MHVA 2R61A 2KOLA 5IT9L 1B9NA 4FXGC 1EIHA 4C2MB 5IGEA 1LTTD 4FNFA 2BOSA 1GJXA 1A6XA 1ET6A 2EZVA 5CV5A 3H6MA 5DM73 3MVVA 3J7AF 4IUTA 1SEBD 3HOZB 2EY1A 2ICEC 4IALA 5EKLA 1SYBA 3FRPB 1DONA 2EYFA 1SE2A 3DWPA 3L3OC 1PFBA 1LTID 1J8IA 1STEA 1Y8OB 2K5DA 3TZDA 1CHQD 3M85A 1KTKA 4L8JA 4V190 1NR4A 5JEAJ 2V4DA 3LX0A 1QILA 2A6HC 1LTSD 4K5WA 3ZYYX 2EYPA 1EU4A 4A3FB 2PQEA 3CU7A 2E2HB 4BY7B 3OPOA 1KNEA 1PYWD 2E74C 5C3XA 1B53A 1GUSA 4ABNA 2KQ3A 2E2DC 5CORA 4KJOA 2IL8A 2MUYA 3I3CA 3D4DA 3HOVB 4A3MB 3BYTB 1Z47A 4KKUA 4RH6A 2RBMA 2RDHA 5HGTA 3HGBA 3H0GB 3MWYW 5JJZA 2HCCA 1CFMA 1SDFA 2F4IA 3VR6A 5C3WA 4RGOS 4LJZC 2QEJC 3IAYA 3NHHA 2K33A 3DWAA 2ICIA 3S17B 1Q90A 1ZYRD 3EROA 1PMRA 4RWSC 3HEJA 3R2TA 2L11A 4HCEA 5A35A 4IFDI 1WVLA 4HEDA 4N9PA 2K32A 1V1PB 4MIUA 4IZ8A 3HKZB 3CKIB 1FYCA 5FK9C 1G6ZA 1BCPC 2XNAC 5CV7A 2PZUA 2LY7A 5CBEE 3U9SA 4I7ZC 4FXDA 2PYKA 4GZYC 4IN3A 2XIWA 1DYQA 2LS01 1UNSA 1Y1VB 3EVQA 3EJIA 5J22A 3HOYB 1STNA 3BS1A 1H9SB 3OOCA 2B39A 2PW7A 4ZKCB 1HQRD 1ICWA 1F2MA 3PUZA 4KY5A 1CA6A 4EGVA 3V96A 5BN5A 4C3IB 2CQAA 4KTAA 4DNTB 2EY6A 1O78A 4X3SA 2AWOA 4KD4A 5C5LA 2IPKD 4RGTA 3I91A 1E2ZA 1RTNA 2EJFC 3KBGA 2AUJD 1EEFD 5KNBA 2H1EA 1Q12A 2YYZA 2FMCA 1GUTA 1LT3D 4O42A 3J81L 5LHY1 1HFGA 3U9OA 1SYEA 4Y7NB 1FR3A 5EGTA 1FGBD 5I2YA 5E4XA 3I8ZA 3BDOA 1EYAA 5EBCA 1RTOA 1ENCA 2AQ2B 4RCOA 2NVTB 5DAUA 3PUWA 1X3QA 3CRLC 4K6DA 3SK5A 1W6KA 3K7AB 2X6LA 3MFGA 3Q24A 1NAPA 4P2CB 1HTLD 3K5OA 5M5YB 1BDOA 4KHVA 4Z9CB 1SNDA 2I07B 3A55A 3D6CA 2A73B 4RKLA 2H4OA 2ENBA 2R7ZB 1BNZA 3H94A 2QDBA 3EQLC 5IOCA 1BCPF 3HZXA 1RD9D 3LNNA 1AZPA 2KUMA 1LTAD 3PIP3 1OO9B 2VUMB 1ZKOA 3P1HA 1TIID 2Z4IA 5CV8A 2VXWA 2SNMA 4C3JB 3M3YB 3QO2A 1C48A 3I70A 1SE4A 2D9UA 1RCVD 5JEAG 2RDGA 2DY8A 2EXZA 1HTPA 3DEOA 1PRTC 2SOBA 3I72A 5KNCA 2DN8A 4J6HA 1VF7A 3I4NB 4KI0A 2FFKB 3C1EA 2F0HA 1PTOB 2JXMB 4XQJA 2PMZB 2D62A 5CV9A 4E6IA 2F0UA 1VMCA 2F0JA 1EFID 3H91A 3C3LA 2NN6H 3GV3A 3RD4A 4ZUJA 3OIQA 1X32A 4F88A 2K01A 3KK7A 1LT5D 3GQBA 4TSSA 1LO5D 4ZLTF 4IQZA 3R2IA 3QB3A 3A54A 3UI2A 3J80E 3D4RA 4QMGA 4A3DB 5C4XB 4CBVA 2A6EC 1H9KA 5J1ZA 3KLSX 5ELEA 3C46A 3TZUA 2F3VA 3ERQA 5KNDA 1XTCD 1B1ZA 1O7LA 3C2PA 5K36H 1JC7A 2OEOA 1SAPA 2WACA 5JOBA 2EY2A 5D3IB 4R8IA 1A15A 2PZWA 3MXGA 3MXUA 1R9TB 1EY6A 1D5MC 1SJED 2F03A 2B2YA 2NYZD 2A68D 3BZDB 5KEEA 1EYCA 5EBDA 4PMWA 2X6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MEH A;  3ITP A;  4ZUI A;  4K8J A;  1KAB A;  2SOB A;  1A2U A;  5C4Z A;  1TT2 A;  3NQT A;  4J6H A;  5C5M A;  3NHH A;  3TME A;  5I6W A;  5IGE A;  4KV6 A;  3OMC A;  1NUC A;  1F2Y A;  1U9R A;  5CGK A;  4K5V A;  3TP5 A;  1JOO A;  3SHL A;  3C1E A;  2F0H A;  4H7B A;  3OWF A;  1EYA A;  1KDC A;  2EYH A;  3ERO A;  4I65 A;  4PMC A;  3SK8 A;  3SXH A;  5KRU A;  4DFA A;  4QB4 A;  5CV9 A;  4DU9 A;  4E6I A;  4DF7 A;  3HEJ A;  1ENC A;  2F0U A;  2F0J A;  3R3O A;  4OL7 A;  4HMI A;  1NSN S;  4K2K A;  4K8I A;  2KHS A;  5CV5 A;  3MZ5 A;  3H6M A;  1STG A;  2F0K A;  2LKV A;  2M00 A;  3MVV A;  3OMG A;  5DAU A;  4ZQ3 A;  1TQO A;  5ISR A;  1RKN A;  1EY0 A;  2F0T A;  5F2D A;  4K2L A;  5M9O A;  4K6D A;  1EY5 A;  1EZ8 A;  2EY1 A;  1STH A;  2OF1 A;  4IAL A;  2F0S A;  4ZUJ A;  5C4H A;  4NKL A;  5EKL A;  1SYB A;  4N9P A;  4KJN A;  4F8M A;  5KYI A;  2EYF A;  4MIU A;  4NDX A;  1SYF A;  1KDB A;  4IZ8 A;  3E5S A;  3SK5 A;  5IGD A;  5KYL A;  2RKS A;  5IIF A;  1A3T A;  2F0O A;  1SNO A;  1ENA A;  4R8N A;  4G57 A;  2F0G A;  1SYD A;  5CV7 A;  2PZU A;  3BDC A;  1EY7 A;  4PMB A;  3NP8 A;  5IGC A;  2PYK A;  2F0E A;  4HMJ A;  1IHZ A;  3D8G A;  1KAA A;  2F0V A;  2SNS A;  1II3 A;  4KHV A;  1SND A;  3QB3 A;  3V2T A;  4K5X A;  3D6C A;  4RKL A;  5CR3 A;  1EQV A;  3OSO A;  4QMG A;  4B9W A;  5IGG A;  3P75 A;  2ENB A;  2NUC A;  5J1Z A;  3NXW A;  5K5P A;  2EY5 A;  2OXP A;  5EKK A;  5CV4 A;  2QDB A;  4RKB A;  3LX0 A;  2EYO A;  3BDL A;  3QOJ A;  2F3V A;  3ERQ A;  3EVQ A;  4S3S A;  2F0Q A;  3T16 A;  2HQE A;  5JAV A;  3EJI A;  5J39 A;  5J22 A;  5IOC A;  3HZX A;  1STN A;  4K5W A;  4KY7 A;  3NUC A;  4HTH A;  2PW7 A;  3NK9 A;  1F2Z A;  2EYP A;  1F2M A;  4ID6 A;  4DGZ A;  4ODG A;  4EQO A;  5CV6 A;  1STB A;  1SYG A;  2OEO A;  2PQE A;  3QOL A;  2WAC A;  4KY5 A;  3PMF A;  3SK4 A;  3T13 A;  2F0L A;  5E1F A;  5KIX A;  5JOB A;  1AEX A;  2EY2 A;  1SNM A;  3D4W A;  5IGF A;  2F0I A;  2F0W A;  1SYC A;  4KD3 A;  5C3X A;  1EY4 A;  2KQ3 A;  1EYD A;  3MHB A;  3RUZ A;  4KTA A;  1JOR A;  4WRD A;  4TRD A;  4KJO A;  4WOR A;  2PZW A;  2EY6 A;  3D4D A;  5E3F A;  5HUR A;  5I6Y A;  2F3W A;  3DHQ A;  4YIJ A;  3VA5 A;  1A3V A;  2O4X A;  4N9T A;  3P1H A;  2PW5 A;  4KD4 A;  4LAA A;  2EYM A;  2RDF A;  4NMZ A;  4QF4 A;  3MXP A;  1EZ6 A;  5C5L A;  1EY6 A;  2EYJ A;  4EVO A;  1SNP A;  3TP8 A;  1EY9 A;  1EY8 A;  2RBM A;  2F0F A;  1STY A;  3DMU A;  2F0P A;  4NP5 A;  4EQN A;  3C1F A;  4PNY A;  1A2T A;  3TP6 A;  5HGT A;  5IGB A;  2PZT A;  5CV8 A;  5KGU A;  1KDA A;  4J1M A;  4ME5 A;  2SNM A;  1JOK A;  5C6A A;  5CC4 A;  1SNQ A;  3SK6 A;  2F0N A;  5DEH A;  5IOD A;  1STA A;  5KEE A;  1A3U A;  4K14 A;  3S9W A;  1EYC A;  3TP7 A;  2F0M A;  4IUN A;  4EQP A;  5I9O A;  1SNC A;  3U9O A;  1TR5 A;  1SYE A;  2F0D A;  5NUC A;  4F7X A;  5C3W A;  2EXZ A;  1JOQ A;  5I9P A;  2EYL A;  4KY6 A;  4B9X A;  5EGT A;  3SR1 A; 
#chains in the Genus database with same CATH topology
 3RR5 A;  1NR2 A;  4HSV A;  2CWA A;  4A3F H;  4RHR A;  4BY7 H;  2MJ8 A;  4GS3 A;  5FLX E;  4P72 A;  5IP9 H;  4KHP Q;  1B7Y B;  2EYH A;  1G91 A;  4K0K L;  2B29 A;  4BBR G;  1GD7 A;  3A8I E;  1MSG A;  4JI0 L;  2GN5 A;  2D5D A;  3K7U C;  4GKJ L;  1JIC A;  4A3M H;  4IOA A;  3GD7 A;  1JCK B;  3DXJ C;  5JJK A;  1EZ8 A;  2YTX A;  1SMY D;  4NKL A;  4DK6 C;  2AWN A;  3TN2 A;  1KDB A;  4B3S Q;  2HDM A;  3NTK A;  4HSP A;  1WJJ A;  2L5T A;  3F1Z A;  5C3E G;  1SNO A;  3LWE A;  3IRB A;  3IL8 A;  1LT4 D;  5CYU A;  4HMJ A;  4BS9 A;  1RHP A;  1MGS A;  2NVQ B;  4CHT B;  1EWC A;  1QVG A;  1EQV A;  2B8G A;  1NJI C;  3UDG A;  4DR2 Q;  5EKK A;  1O7Z A;  2IJ0 A;  4LFC L;  1CT1 D;  2NN6 I;  3T53 B;  3I90 A;  3IFD A;  2LFN A;  5M3M B;  2B2T A;  2ZXR A;  1QZG A;  4A3K B;  2A8V A;  4DV1 L;  2BH2 A;  1NY4 A;  4IPC A;  3PMF A;  2F0L A;  2UUC L;  4YCV A;  4R1J A;  4LUO A;  1B9M A;  2UXD Q;  1WCM G;  3VYU A;  1M1K C;  2NTS A;  1Q8I A;  2F3W A;  3DHQ A;  3I55 A;  4Q0F A;  2BA1 A;  4LUV A;  2JA8 G;  1X9N A;  2F0F A;  1STY A;  2K03 A;  1S3O A;  1EQT A;  2UUA L;  2R93 H;  1HNW L;  5C6A A;  1YNN D;  2JN4 A;  4K14 A;  2XGT A;  1V1P A;  2ZTC A;  1SNC A;  2KA7 A;  3HOU H;  5NUC A;  1PHJ A;  3SE0 A;  5I9P A;  3K0Y A;  1I4X A;  1BCP B;  3HOY H;  5IE8 A;  1YHB A;  2Y0S B;  3KUP A;  5FJ8 H;  2CKZ B;  3F2C A;  5IP7 G;  2MNA A;  1F2Y A;  1AH9 A;  3TP5 A;  1HNX Q;  2LMC B;  3BVG A;  1F77 A;  1NMG A;  2ZM6 Q;  1B44 D;  4C3I H;  4LF8 Q;  3PUY A;  3D3R A;  4JBJ A;  1NSN S;  4LF9 L;  2F0K A;  1UUP A;  1VQD A;  4FXK C;  5ISR A;  1K8A C;  5G3L D;  1H9S A;  3L0O A;  2AQ1 B;  2IT1 A;  2UXC L;  1NE3 A;  3TBI B;  4LF5 L;  1X6O A;  4CKE A;  2JA6 G;  1A3T A;  1VS0 A;  1GUN A;  2AQ3 B;  4DV1 Q;  2IX1 A;  2UUC Q;  2QKI C;  3I4L A;  1K83 B;  4PMB A;  3RMH A;  4Y7N H;  3CME A;  1L0Y B;  3KDF B;  5IYC H;  3Q23 A;  1MD2 D;  1WFQ A;  2WKC A;  3FHW A;  3M7N A;  2E76 C;  1PZK D;  2EJM A;  2L12 A;  4OWT B;  4ILW A;  3NE5 B;  2NVY B;  2Q2U A;  4DAV A;  1KQS A;  2EYO A;  2F1M A;  2QDL A;  2PMZ E;  5A2Q E;  3KYH C;  1XTD A;  1GUG A;  1XJV A;  3GTP B;  4KY7 A;  5GAD C;  2UUA Q;  2Z8L A;  1F2Z A;  1ESR A;  2NVT H;  2WAQ G;  2CW0 D;  4DV3 L;  5DNF A;  1KLG D;  4GOP B;  3I4M G;  1J6Q A;  2ID0 A;  3KBX A;  3N52 A;  4BA1 I;  2F0W A;  2G5D A;  3MHB A;  1DJR D;  2PNH A;  1SN8 A;  3MXN B;  1I4P A;  4WOR A;  2EPB A;  2RCN A;  1F2L A;  4NMZ A;  2HHH L;  2EYJ A;  1QB5 D;  2MP1 A;  3CW2 C;  4Y52 H;  1RJT A;  1EY9 A;  1EY8 A;  2DJF C;  3M9B A;  2Q8R E;  4QQB X;  2G9H D;  3TDQ A;  2VL6 A;  1JWU D;  4A3C H;  4GNX A;  4DV0 L;  3A5Z B;  5GAG C;  4GN4 B;  4LF9 Q;  2AUK A;  3RLO A;  3T4A C;  4L5S A;  2PCF B;  3JAM E;  1E3P A;  3AYH B;  4O0A A;  2K04 A;  4PZ8 A;  4YHH L;  3KLW A;  4A75 A;  2F0D A;  2C5C A;  3ULP A;  1CI3 M;  3OW7 A;  5IT9 E;  2EYL A;  2UXC Q;  1XPR A;  3MEH A;  2A68 C;  4LF5 Q;  3P7J A;  5FO7 B;  1E1O A;  1EQR A;  4IOC A;  4X3U A;  3OMC A;  1HUN A;  2R92 G;  1HA6 A;  3PO2 H;  1S5D D;  3G4S A;  2JP1 A;  2E2J B;  2I5L X;  4UAI A;  4OX9 L;  3R3O A;  4RCN A;  2WP8 J;  4HMI A;  2E2I B;  2VUM H;  1HHV A;  2M00 A;  2RSO A;  3FEW X;  2VW9 A;  4JI5 Q;  5M9O A;  3WOE A;  4BBS H;  4TVA B;  2EJG C;  3HFZ B;  2KED A;  1IW7 D;  4DV2 L;  1JT8 A;  1I50 H;  5IIF A;  3TRE A;  3K8A A;  4C3J H;  3M3Y H;  4IFD J;  3GO5 A;  4MTN A;  3RLF A;  4QUF A;  1PYS B;  4O1N A;  4DV3 Q;  5I2X A;  1SMY C;  4DXG A;  4A3G H;  1EU3 A;  4TQU S;  3VYR A;  4OIK A;  3AFQ A;  2D0O A;  3K59 A;  3VYT A;  4X6A H;  1EWH A;  2B2W A;  1HZB A;  2NUC A;  2HHH Q;  2NZH A;  1PTO H;  3S2H H;  4V0B A;  4CDF C;  3GTM H;  3NSW A;  3GTO B;  2Z6K A;  5TSS A;  3MEF A;  3MFY A;  5AJ3 L;  1TVX A;  4RGN A;  4KK7 A;  4DV0 Q;  4HJA A;  1GXD C;  1B50 A;  2QIL A;  1HA5 A;  5T1G A;  1FJG L;  1QUQ A;  4YHH Q;  4RAU C;  4UY8 C;  2EQS A;  4IUU A;  1PH9 A;  1PRT B;  2R93 B;  3NEM A;  4XQQ A;  2FMM A;  1HUM A;  1K3B C;  1JOR A;  3FKI G;  1N33 L;  3PSI A;  3VR3 A;  1E2V A;  2BH8 A;  4NXN L;  3UDF A;  4P73 A;  2PQA A;  4RMF A;  2EYM A;  3HOU B;  3TP8 A;  4WJ3 M;  2Z6B A;  2NN6 G;  1I4R A;  1ENF A;  1A2T A;  3TP6 A;  2DNC A;  1K8M A;  4OX9 Q;  4QIW B;  2JYO A;  4J1M A;  1RDP D;  1UWV A;  3PO3 H;  4OO1 G;  4A3D H;  5C4X H;  2M2L A;  1NBW A;  4A3L G;  3AU7 A;  1ICF B;  5ELD A;  2K6A A;  2FJ2 A;  3QIA A;  2L15 A;  1GUW A;  1TWA B;  2JE6 I;  1S40 A;  1K28 A;  4JI6 L;  4K8J A;  3CQZ B;  5C4Z A;  1FVI A;  3PF5 A;  1LTR D;  1S5E D;  1EEI D;  1QOH A;  5I4D A;  1TS2 A;  4UDU C;  1YNX A;  4PMC A;  1CKM A;  4DU9 A;  3VR4 A;  2K5H A;  2ZTE A;  4CKC A;  1Y69 U;  2LKV A;  1UE6 A;  2L55 A;  1R9T H;  3RNU A;  2LXK A;  1E1T A;  5K36 G;  1N9W A;  5C4H A;  3HRZ C;  5T1I A;  3HOZ G;  2B2Y C;  3WOF A;  2OTJ A;  3ND9 A;  2DGY A;  4A76 A;  1JE4 A;  1CM9 A;  5C0X H;  1PH1 A;  2VQF Q;  1PZJ D;  5IYB G;  1PVO A;  1TS4 A;  1SYD A;  1YJ9 A;  4DK3 C;  1IL8 A;  5JPM C;  2Y0S E;  1N33 Q;  4NXN Q;  5FLM G;  3DM1 A;  4OON A;  2MQH A;  4LF4 L;  4DR6 L;  3S1R B;  4JVZ A;  5CV4 A;  5J39 A;  2DY7 A;  2FXQ A;  4HAE A;  1PH5 A;  4DNR B;  5M5W H;  1EFW A;  3NK9 A;  3KLS A;  1L0W A;  1IKM A;  4JI1 Q;  1GUO A;  1STB A;  1OXT A;  1Q1E A;  4JCV E;  3T13 A;  2HD3 A;  1O7I A;  4A3F G;  1I4G A;  2NB0 A;  4MTK A;  4BY7 G;  3J7A 5;  5IP9 G;  2C9O A;  4JI6 Q;  1JWM D;  2N55 A;  4C3H B;  3HOV G;  4NXM Q;  1XYI A;  2A1A A;  3S14 H;  2GA4 B;  4A3M G;  5CBA E;  1E24 A;  2HCI A;  1TWC B;  5IGB A;  2IHF A;  1YHA A;  1I6H H;  2K1B A;  1YIT A;  1VQ8 A;  3S1Q B;  4FF3 A;  4MN3 A;  2NVQ H;  5CC4 A;  3H0G G;  1STA A;  4LW1 A;  3S1N B;  3PO2 B;  1V43 A;  2DNE A;  3AQQ A;  4X3T A;  2AKW B;  2IW3 A;  3NBI A;  3EFX D;  3LWU A;  2B2T C;  2Q8I B;  2EVB A;  4HIO A;  1PTO D;  1M90 C;  3TEH B;  4DPG A;  2KEC A;  3GTQ H;  4BBS B;  3H3V C;  2XSC A;  4A3K H;  1X3P A;  4MZ9 A;  4RA8 A;  1SR3 A;  1KDC A;  1I50 B;  2B3G A;  3SK8 A;  4DA2 A;  3I4O A;  4DAY B;  5C44 B;  3S15 B;  2A69 D;  1QVF A;  1N8R C;  3G7L A;  3MZ5 A;  4CKB A;  3OMG A;  1E22 A;  4DR6 Q;  5F2D A;  3J80 L;  4A3G B;  1EY5 A;  1TWH H;  2XWB B;  1IYJ B;  2ZJR A;  3OTO L;  1ZXT A;  3V05 A;  4DR5 Q;  5EAY A;  1IBK L;  1ESF A;  3HKZ G;  4JOI C;  3S2H B;  4MHE A;  4OHJ A;  3HOX B;  3GTM B;  2XVS A;  2A5H A;  1G29 1;  1BR9 A;  3X3M A;  1IW7 C;  1EY7 A;  4DV6 L;  1C7Y A;  1YJN A;  3HOW B;  1AW7 A;  1IHZ A;  2YV5 A;  3HP3 A;  3BVZ A;  3J81 i;  3BZK A;  3K57 A;  1OXV A;  4FVM A;  1ZYR C;  2Q2H A;  2NZ1 D;  2Z1C A;  4H44 C;  4RKB A;  4FYD A;  5C0X J;  3T1Y L;  1VQH A;  3M4Y A;  3K58 A;  2JEA I;  1QE6 A;  3E9I A;  4FF2 A;  2FIN B;  5G3L F;  1Y1V G;  2N78 A;  3L9A X;  4DR7 L;  1LYL A;  1QNK A;  1VQ5 A;  3HOY G;  4DR4 L;  4RGM A;  2TSS A;  4OIJ A;  3J81 c;  4DNI A;  5LL6 X;  1L2F A;  3A56 A;  2F4V L;  5KIX A;  1AEX A;  1BUV T;  3I2Z A;  1HPC A;  4KD3 A;  4X64 L;  5ELB A;  5C0X I;  3PO3 B;  2EDG A;  5ELF A;  3NBH B;  4C3I G;  3PIO A;  3VA5 A;  4DUZ L;  4IFD G;  1CA5 A;  4KMU C;  3RN5 A;  1MBY A;  2SEB D;  1HRJ A;  3PF4 A;  2K7V A;  4ZRZ A;  1Y8P B;  3MC0 B;  3DM3 A;  5FLX L;  1L1O B;  4ULL A;  4NW2 A;  1S4Z A;  1Y8N B;  4UP7 A;  4HID A;  5DEH A;  1G2S A;  1M4V A;  1MSH A;  3KF8 A;  1WD1 A;  2JSO A;  5C4J B;  2TMP A;  1R4P B;  4A3I H;  2NVY H;  3UE0 A;  1JOQ A;  3HKZ E;  1LTL A;  4LFB L;  1LUZ A;  3GTP H;  3AEV A;  3GTG B;  3PV0 A;  2WB1 B;  4AYB B;  3OTO Q;  1TT2 A;  1IKL A;  2BDN A;  2YTV A;  3FMC A;  4L6T B;  1IBK Q;  1NUC A;  1HNZ L;  5CGK A;  1X54 A;  1AZQ A;  2BA0 A;  3OWF A;  1Y14 B;  2PPB C;  2K05 A;  2Z9H A;  2DJG C;  3A0J A;  1K8G A;  1VQG A;  1ET9 A;  1STG A;  1SLJ A;  2XN9 C;  4A3E H;  2F0T A;  1F9Q A;  3VR2 A;  1EIY B;  5IYD H;  3T1Y Q;  4KJN A;  3K5N A;  4AH6 A;  4QIW E;  4DR7 Q;  3T51 B;  4GOP A;  1EIG A;  2X69 A;  3NTI A;  4R8N A;  3MXN A;  2F4V Q;  5M5W B;  5COY A;  3RLN A;  2J7Z A;  4ZKB B;  1KNA A;  3D8G A;  2J0T D;  2SNS A;  3BVM A;  5D3D A;  4A93 B;  3D0F A;  4JV5 L;  3L2P A;  5EKI A;  4DUZ Q;  4B3T L;  4M8A A;  4A3C G;  3BG3 A;  4IUR A;  3DLL A;  4HJ7 A;  3NEN A;  1XNR Q;  1IBM L;  3T16 A;  2E2J H;  2R7Z G;  3ONA B;  3D6W A;  3F2D A;  2BE5 D;  2CVR A;  3ZJY C;  2E2I H;  1VCI A;  1AFP A;  1TY0 A;  2PO4 A;  1HZA A;  3S14 B;  4JI2 L;  1F9R A;  1WTO A;  1AP0 A;  1DD2 A;  2OCE A;  2JA5 H;  2L1B A;  1D8L A;  3J7Y W;  2VQE L;  1I6H B;  4IJH A;  2WV6 D;  4LFB Q;  1PLF A;  1DOL A;  3CC4 A;  2UUB L;  4LNQ A;  2PW5 A;  4GN5 A;  2Q2T A;  2VUM G;  1SNP A;  4L5R C;  4JC0 A;  4LF7 L;  2F0P A;  1DM0 B;  1D5Z C;  1NNX A;  1Q3L A;  5L37 A;  3GTQ B;  3D31 A;  2PI2 E;  1XNQ Q;  3K80 C;  3VA7 A;  2CCZ A;  1SRO A;  4HIK A;  4GKK L;  1IYV A;  2MPM A;  4JG2 A;  1AE2 A;  4C3J G;  4B08 A;  2Z6K C;  3NQI A;  3A7L A;  4F7X A;  2KJX A;  1VQ4 A;  3GTO H;  1JJG A;  2MGS A;  1V1O A;  3H09 A;  3BYY B;  1KAB A;  4FF1 A;  5EPL A;  3NQT A;  3U4V A;  1BO0 A;  1Q1B A;  1U9R A;  2KCN A;  4OXP A;  1TWH B;  1ZEQ X;  4K0K Q;  1JR0 D;  3I4N G;  4DF7 A;  4JI0 Q;  4GKJ Q;  4B3M L;  4K2K A;  4JV5 Q;  4BY1 H;  4UHV A;  4ZQ3 A;  5GQO A;  3OIP A;  1T9H A;  1I4Q A;  4XT3 B;  4A3B B;  5M3F B;  1IBM Q;  1K8O A;  1GHK A;  1FNU A;  5IGD A;  2GVA A;  3VDY A;  1LTB D;  4OEM B;  1Y1W H;  3FP9 A;  5A2Q L;  1E0B A;  4JI2 Q;  2A74 C;  2VQE Q;  4WJW A;  3BDC A;  4X62 L;  3NP8 A;  2F0V A;  1TWA H;  3V2T A;  2E75 C;  3CQZ H;  2UUB Q;  5IGG A;  1WTX A;  3GDE A;  3A8K E;  1JMC A;  1DZ1 A;  4LFC Q;  1C4Q A;  5GAE C;  4A3D G;  4YWK A;  4LF7 Q;  5C4X G;  1S5B D;  2HQE A;  1MI2 A;  1U0L A;  1YNJ D;  1SJH D;  2K52 A;  4CDC C;  3GTL B;  4QGU A;  1C8C A;  4DV5 L;  4GKK Q;  3M4O H;  4CJ1 B;  2XWJ B;  4KN4 C;  1I94 L;  3EN2 A;  2BDO A;  3F2B A;  4LWC A;  4LMQ D;  1I4H A;  4XT1 B;  3JAM L;  1EY4 A;  3ULJ A;  2B2V A;  4A3J B;  2HUG A;  4IUQ A;  2IX3 A;  2ES2 A;  4PQX A;  4GLV B;  3CCS A;  2L9H A;  4QCL A;  4OWW B;  2JA7 B;  4A3I B;  1PDQ A;  3WDN A;  4RFB A;  3S16 B;  1VDZ A;  2E8G A;  1LV9 A;  1QG7 A;  2B63 B;  4PNY A;  4DK1 A;  5BR8 L;  1U4P A;  2KCC A;  2PZT A;  1QJO A;  4K6L A;  1TWG H;  1HNW Q;  2JA9 A;  1DOM A;  1I6V C;  2O2L D;  3SK6 A;  1A0I A;  3FVQ A;  1U4R A;  2IHE A;  3S1R H;  3ND8 A;  4IUN A;  4KLK A;  1OXX K;  2NVX B;  1QCB D;  1Z7T A;  5C0X G;  2A19 A;  4G4K A;  4KY6 A;  5JVG 3;  4A4I A;  4A3E B;  5EQ0 A;  2IWH A;  1A2U A;  3AMU A;  4BXX G;  3DUZ A;  4KV6 A;  1QNU A;  3HKS A;  1JOO A;  2RHS B;  2PI2 A;  4X62 Q;  1FNV A;  1WTP A;  1YIJ A;  4X66 L;  2MO0 A;  2RVL A;  5FO8 B;  1J5E L;  3H15 A;  4C3H H;  4DV4 L;  1Z9F A;  3NWT A;  1PFN A;  5JJL A;  4BBR H;  4ZAI A;  1TWC H;  1CZG A;  4F8M A;  5KYI A;  3KJP A;  3A5U A;  2M9V A;  3VYS A;  3S1Q H;  1IBL L;  3NTH A;  4UP8 A;  4QL5 A;  1HCZ A;  3ERS X;  5ELC A;  3GTJ B;  3S1N H;  1SE3 A;  2ZJQ A;  3UDX A;  1RIP A;  4HN7 A;  1CHP D;  3N6R A;  4FP5 D;  1PTO F;  4F87 A;  4DUY L;  5EJW A;  4M1U B;  3E6Z X;  2JEB I;  5E4W C;  1TS5 A;  2K5V A;  3A8J E;  4K5X A;  3OWE B;  3CP0 A;  4H0L C;  2JA5 B;  1HFN A;  3FPU B;  1BOS A;  2B2U A;  3NXW A;  5K5P A;  2EY5 A;  3BDL A;  4IUP A;  1F9P A;  1FD7 D;  4R4C A;  5BR8 Q;  5C44 H;  3KJO A;  4YWL A;  3S15 H;  1O7Y A;  3NUC A;  1CQV A;  2ZXP A;  2I46 A;  4DGZ A;  1PRT D;  3KOJ A;  5M3M G;  4R4Q A;  2VB2 X;  3I73 A;  4PZ7 A;  1G2T A;  4A3K G;  1DOK A;  1FNW A;  2BE5 C;  2VZA A;  4XTC S;  5HUR A;  3W2D A;  4DAY A;  1VQJ A;  3HOX H;  3DEP A;  3DMU A;  3CCR A;  4C56 C;  3HOW H;  3AFP A;  1U4L A;  2IX0 A;  2F0N A;  1PXU A;  3S9W A;  1B2T A;  5I9O A;  1J5E Q;  4DV4 Q;  2KEE A;  4BWG B;  4U68 A;  1OXS C;  2RHQ B;  1IYU A;  1X56 A;  2FHT A;  4ZUI A;  1CK1 A;  4BY1 B;  4IPH A;  3IFT A;  3CCQ A;  1IBL Q;  1SE8 A;  1BXT A;  1KRS A;  2K5W A;  3F2U A;  4JW0 A;  2Y0S G;  3SHL A;  2A6E D;  2N88 A;  4DUY Q;  5KRU A;  4LF6 L;  1Q7Y C;  4H13 C;  3M7G A;  1IZ6 A;  1Y1W B;  2CHB D;  5JJI A;  1QVC A;  4K8I A;  1YVC A;  2NTT A;  2K75 A;  4L5Q A;  1TQO A;  1PZI D;  3VR5 A;  1VQM A;  4C1N I;  4DV2 Q;  4NPS A;  1GO3 E;  1YNN C;  1LAC A;  1F9S A;  4XQN A;  1EL0 A;  1QZH A;  3W1G A;  1W2B A;  4EQ5 A;  1CZW A;  4WFN 3;  4OWX B;  1LLR D;  2O5J C;  3O13 A;  1ENA A;  4G57 A;  5C4J H;  1IXR A;  2KCM A;  1K73 C;  2YU9 H;  2AHO B;  3NBH A;  4XYO A;  3OHX C;  4IPG A;  1BQQ T;  3GTG H;  4DK0 A;  3OSO A;  3M4O B;  2NZO A;  3Q8D A;  2LSS A;  1DCZ A;  1L1O A;  1TKW B;  5FOB B;  4PZ6 A;  5JAV A;  5AJ3 Q;  1ILP A;  2KVM A;  3QWN A;  4OGQ C;  3MTS A;  4ID6 A;  3IKJ A;  4ODG A;  4EQO A;  1ML0 D;  3CHB D;  1FJG Q;  1SNM A;  3D4W A;  1TWG B;  2ALY B;  1YNJ C;  1WTR A;  3BZC A;  1VQN A;  4WRD A;  1VQP A;  1PV4 A;  1XX8 A;  2DUD A;  4N9T A;  3I4M H;  3CXC A;  4NP5 A;  3R8B A;  3S1M B;  2ASB A;  5IYD G;  2NBF A;  5DLQ E;  1KDA A;  2ZT9 C;  1MJC A;  4DR3 L;  3FDT A;  4A93 H;  4CJ0 B;  1SNQ A;  4JI3 L;  3E9H A;  5IOD A;  1B3A A;  1A3U A;  1HZC A;  1V8Q A;  4HIM A;  4EQP A;  4HCS A;  1TR5 A;  3NWS A;  2NWG A;  1D1K A;  4B9X A;  3GV6 A;  3X3N A;  1O80 A;  2SDF A;  2CW0 C;  5C5M A;  5I6W A;  2KEN A;  4X3K A;  3TME A;  5BN4 A;  2JQO A;  4XYQ A;  4JK1 C;  1E7Z A;  4BBR B;  1PFS A;  1B4O A;  4I65 A;  3DWQ A;  4QB4 A;  1D2B A;  3G6J B;  1HH2 P;  1VMP A;  3I56 A;  2UXB L;  3J81 E;  4DAP A;  3Q22 A;  2HQL A;  2QA4 A;  4IUV A;  3TS2 A;  5LL6 S;  3CCM A;  1EY0 A;  3W5O A;  1K3R A;  1STH A;  3BJU A;  2F0S A;  1I5F A;  1PH3 A;  2I0Q A;  3AB9 A;  4NDX A;  5C3E B;  1SYF A;  1FGU A;  2OTL A;  4G7O C;  3I7F A;  2B8F A;  4U67 3;  1KRT A;  1SXT A;  4YCW A;  2RQX A;  2EOT A;  1EOT A;  1KAW A;  3PUV A;  2D2C C;  1JE5 A;  2BCO A;  1LTG D;  1Q86 C;  4P71 A;  3CPW A;  4B9W A;  4LF4 Q;  1TWF B;  1XWE A;  3P75 A;  5JPN C;  3QG1 A;  5AFW A;  1RL2 A;  3R93 A;  1FL0 A;  5HGQ A;  1YI2 A;  2F0Q A;  3SEB A;  1EYG A;  3T56 B;  4CGY B;  1KLU D;  1HR0 L;  1BBU A;  1S5C D;  1WTH A;  3QJY A;  1L0X B;  4DR3 Q;  2CH4 W;  1VQA A;  4JI3 Q;  3CF5 A;  1UEA B;  1SYG A;  1UE1 A;  3QOL A;  3HS0 C;  5D65 A;  1D6E C;  1WD0 A;  4A3B H;  1WCM B;  4DN4 M;  5M3F H;  4PV1 C;  5IGF A;  4AQY L;  1R4Q B;  2RF4 A;  1Z6H A;  1E2W A;  2Z0S A;  4XDX A;  2JA8 B;  5E3F A;  2R93 G;  1QUQ B;  1A3V A;  5JVH 3;  1EIF A;  4QF4 A;  3MXP A;  1EZ6 A;  3KF6 B;  3B6Y A;  3F8T A;  1D7Q A;  2ZJP A;  3HOU G;  3FKI H;  4PG3 A;  1CTM A;  1RF2 D;  4R4O A;  4R4T A;  5KGU A;  1UE5 A;  2UXB Q;  4X65 L;  3CCL A;  3K0X A;  3S2D B;  5FJ8 G;  3Q6S A;  1W6J A;  2F0M A;  2K50 A;  1LT6 D;  1N36 L;  4RHS A;  4HJ9 A;  4CDE C;  1WTV A;  4OO1 H;  2HDL A;  3GTL H;  1ONL A;  2CWP A;  3UE1 A;  1K9M C;  1S5F D;  1N34 L;  3PUX A;  4H02 A;  5GAH C;  1G8Z D;  1QWY A;  3SXH A;  4DR1 L;  3EA6 A;  2B2V C;  1I3Q B;  2J4X A;  4QJF A;  1SFO B;  2QF7 A;  1LM0 A;  4A3J H;  3E0J A;  3URY A;  1N32 L;  2D0P A;  3CRK C;  2JA7 H;  3SVM A;  2YU9 B;  2AMC B;  3S16 H;  3G48 A;  1W3S A;  2MFI A;  2V1C C;  2B63 H;  3S24 A;  2O5I C;  5LMN W;  3PIO 3;  1DXM A;  3Q0A A;  2JA6 B;  5ELO A;  3SDZ A;  1VQI A;  5DM6 3;  1PH7 A;  2WKD A;  1A63 A;  4GLA C;  4C1N K;  3KLR A;  5IYC G;  4Q5V A;  2F0O A;  1HXY D;  2P5Z X;  3KDF A;  2XTI A;  1GHJ A;  2F0G A;  4DV6 Q;  2NVX H;  4HJ8 A;  3HOZ H;  1CSP A;  4AQY Q;  2R3Z A;  3TSS A;  2F0E A;  5IGC A;  2A6H D;  4POF A;  1JWS D;  1K0S A;  1KAA A;  3NPP A;  1II3 A;  4L63 B;  5CR3 A;  4LK1 C;  2ZTD A;  4JI7 L;  1AN8 A;  2RA4 A;  1YJW A;  1VQK A;  2OXP A;  2EXD A;  2EE1 A;  4FDB A;  2VNU D;  1H9M A;  4GNX C;  1PYB A;  2WAQ B;  5EPJ A;  2VS1 A;  5FLM H;  4DR4 Q;  4GLX A;  2ATW A;  1XPU A;  3I4M B;  5CV6 A;  1G6P A;  1VF5 C;  1T5E A;  2K14 A;  3CCV A;  1WTW A;  2L0C A;  2K28 A;  4KHZ A;  4X64 Q;  1ROD A;  3K5L A;  1WTQ A;  1N36 Q;  1SSO A;  5CMD A;  4ZYS A;  3RZD B;  1D1I A;  3J80 i;  5I6Y A;  3HG9 A;  2E5L L;  3TRZ A;  1JQY D;  1LAB A;  3A7A B;  4LAA A;  3GTJ H;  1N34 Q;  4XXE A;  2E2H H;  1VQC A;  1JJC B;  3C1F A;  4C3H G;  4DR1 Q;  1H95 A;  3MAQ A;  2PNR C;  4ME5 A;  1JOK A;  3P20 A;  3PQI A;  3HOV H;  1N32 Q;  2B2U C;  3J80 c;  3TP7 A;  1IL2 A;  5FKA C;  3PO2 G;  1NCV A;  2QCP X;  3K6O A;  1PRT F;  3SR1 A;  1X55 A;  3ITP A;  2VB3 X;  2R92 B;  1BVS A;  3H0G H;  5BN3 A;  1HNZ Q;  3GTK B;  2RSN A;  1CQF A;  1ILQ A;  3W3A A;  4K5V A;  4H7B A;  1HNX L;  3T1H L;  4BBS G;  1D5X C;  4DFA A;  4GN3 B;  2B2W C;  2WIN B;  2ZM6 L;  5FO9 B;  4LF8 L;  3CCJ A;  4OL7 A;  4ZK9 B;  1VQF A;  3H3V H;  3L7Z C;  2KHS A;  2L4N A;  4JBW A;  1U4M A;  5C44 G;  4FO2 A;  1BCP D;  4JI7 Q;  1RKN A;  4K2L A;  4KKT A;  1J9O A;  1K0R A;  1EQQ A;  2OF1 A;  1MHW C;  1Q46 A;  3S17 H;  1UAP A;  4A3G G;  1B8A A;  1JB3 A;  3E5S A;  5KYL A;  2N3S A;  1TS3 A;  1B3Q A;  2RKS A;  2Z4H A;  2OT2 A;  1V9P A;  4BA2 I;  5JEA H;  2WFW A;  1YHQ A;  1TY2 A;  1A8V A;  4KN7 C;  4OO1 I;  1GVP A;  4DKA C;  3J81 j;  3A74 A;  1PH2 A;  2CQO A;  1V1Q A;  3U4Z A;  3HOX G;  1PTO C;  4FF4 A;  2K5Q A;  4HR7 B;  2XRQ D;  2E5L Q;  4B3T Q;  2R6G A;  3HOW G;  4B3R L;  1H9J A;  1YBY A;  2Q8T A;  4CJ2 C;  1JJ2 A;  2A69 C;  2I5M X;  3QOJ A;  1H9R A;  4S3S A;  1M8A A;  5FLX c;  2H5X A;  2G9D A;  1TU2 B;  4HTH A;  1HQM C;  2XRS D;  4G7H C;  3RN2 A;  3CAM A;  3RZO B;  3EIV A;  4J8Q A;  3SK4 A;  5E1F A;  1OXU A;  4JOI A;  3FKI B;  4XIG S;  2WII B;  2F0I A;  3FPP A;  1SYC A;  1BBX C;  3GP7 A;  1Y1V H;  1EYD A;  3CC2 A;  3RUZ A;  3K5M A;  4TRD A;  4YCU A;  2ZXO A;  4G7Z C;  5D14 A;  4YIJ A;  2O4X A;  3PO3 G;  2OQK A;  2RDF A;  1XXG A;  4EVO A;  4TKO B;  3J7A V;  1BF4 A;  1SBB B;  2CFM A;  4KKS A;  4EQN A;  5M5X B;  3T1H Q;  3BU2 A;  1CKN B;  1PFM A;  1GOZ A;  5EPK A;  1T5X D;  4R9W A;  4IFD H;  4DXF A;  3ICE A;  1ASZ A;  1L1O C;  4QUC A;  3MA2 B;  2MHV A;  4N8X 1;  1XMQ L;  4RG1 A;  2R61 A;  2KOL A;  5IT9 L;  1B9N A;  3KF8 B;  4FXG C;  1EIH A;  4C2M B;  5IGE A;  5J3B A;  4EX5 A;  1LTT D;  1P8L A;  4FNF A;  2R7F A;  2WB1 G;  2BOS A;  4AYB G;  1GJX A;  4IO9 A;  1A6X A;  1ET6 A;  5LMN L;  2EZV A;  4B3M Q;  5CV5 A;  1PA6 A;  3E3X A;  3H6M A;  5DM7 3;  3MVV A;  3J7A F;  2LXJ A;  4IUT A;  1SEB D;  3QR8 A;  4B3R Q;  4JI5 L;  3HOZ B;  2QGQ A;  2EY1 A;  1U5K A;  2ICE C;  4IAL A;  4UP9 A;  5EKL A;  1SYB A;  4J15 A;  5ELN A;  3FRP B;  3S1M H;  1DON A;  2EYF A;  1SE2 A;  1Q82 C;  3DWP A;  1X65 A;  2JJQ A;  2YTY A;  3OW2 A;  3L3O C;  1PFB A;  1LTI D;  1J8I A;  1STE A;  1Y8O B;  2K5D A;  4JI8 L;  3TZD A;  2HIV A;  1CHQ D;  1WYD A;  3M85 A;  4LUZ A;  3K7A H;  1KTK A;  1VQ6 A;  4L8J A;  4A93 G;  5H1S E;  4V19 0;  1NR4 A;  5JEA J;  2V4D A;  3H3V I;  3LX0 A;  4HJ5 A;  1X3G A;  1QIL A;  2A6H C;  1LTS D;  1S72 A;  4K5W A;  5M5Y H;  3ZYY X;  1ASY A;  2EYP A;  4DV5 Q;  1EU4 A;  2MO1 A;  4A3F B;  2PQE A;  3CU7 A;  2E2H B;  1I94 Q;  4BY7 B;  3OPO A;  2F52 A;  2R7Z H;  3CPF A;  3STB D;  1KNE A;  1XMQ Q;  1PYW D;  2E74 C;  4O2D A;  1B53 A;  5C3X A;  1GUS A;  4ABN A;  2KQ3 A;  2WB1 E;  2E2D C;  5C3E H;  4AYB E;  5COR A;  4KJO A;  2IL8 A;  2MUY A;  3I3C A;  3D4D A;  1XMO L;  3HOV B;  4A3M B;  3BYT B;  1Z47 A;  1WOC A;  4KKU A;  4RH6 A;  2VY3 A;  2RBM A;  2RDH A;  5HGT A;  3HGB A;  4JI4 L;  3H0G B;  4L5T A;  5LMN Q;  4IPD A;  4LFA L;  2C35 B;  3MWY W;  2EIF A;  5JJZ A;  1TWF H;  2HCC A;  4I7A A;  1CFM A;  1SDF A;  3PGZ A;  2F4I A;  1HR0 W;  1SRU A;  4DAM A;  5E7N A;  5LMU L;  3VR6 A;  5C3W A;  3G71 A;  3CD6 A;  2WAQ E;  1G51 A;  4RGO S;  1KHI A;  4LJZ C;  1X3F A;  2QEJ C;  2QW7 A;  3IAY A;  3NHH A;  2K33 A;  3DWA A;  2ICI A;  2Q2I A;  1VQE A;  3S17 B;  1Q90 A;  1ZYR D;  1WCM H;  3ERO A;  1PMR A;  4RWS C;  4X66 Q;  3HEJ A;  2OQ0 A;  1BKB A;  3OYY A;  4JI8 Q;  3TS0 A;  3R2T A;  2L11 A;  2JA8 H;  2K4K A;  4HCE A;  1PH4 A;  4POG A;  3JAM i;  4JBK A;  3I4N H;  5HY6 A;  5A35 A;  1WVL A;  4IFD I;  2HT1 A;  4HED A;  4N9P A;  2KBN A;  1CUK A;  4AIM A;  2K32 A;  4A3B G;  1V1P B;  1P16 A;  4MIU A;  2OWO A;  4IZ8 A;  5M3F G;  3HKZ B;  3CKI B;  1FYC A;  5FK9 C;  1G6Z A;  1BCP C;  3S2D H;  1A62 A;  2XNA C;  5CV7 A;  2VQF L;  2PZU A;  3CMA A;  2LY7 A;  5CBE E;  3U9S A;  4I7Z C;  3ER0 A;  3JAM c;  4FXD A;  2PYK A;  4YY3 L;  4ZCK A;  2CH4 A;  4GZY C;  5IP7 H;  3KF6 A;  2N8N A;  5IT9 c;  3U50 C;  4IN3 A;  1XMO Q;  1YZ6 A;  2XIW A;  1DYQ A;  2LS0 1;  1UNS A;  1Y1V B;  3EVQ A;  3EJI A;  4JI4 Q;  5J22 A;  2HIX A;  1I3Q H;  3HOY B;  1STN A;  3BS1 A;  1H9S B;  1X3E A;  2B39 A;  3OOC A;  2PW7 A;  4LFA Q;  4ZKC B;  1SFO H;  1HQR D;  1ICW A;  1F2M A;  3PUZ A;  4JI1 L;  4QY7 A;  4KY5 A;  1CA6 A;  4EGV A;  1KD1 C;  4NB3 A;  2K5N A;  5LMU Q;  1MKH A;  3V96 A;  3M4P A;  3M4Q A;  5BN5 A;  3CCU A;  2JA6 H;  4OEL B;  4C3I B;  2CQA A;  2JK8 A;  4KTA A;  4DNT B;  2EY6 A;  1O78 A;  4X3S A;  2AWO A;  4KD4 A;  3EBE A;  5C5L A;  3ULL A;  4A3J G;  2IPK D;  4RGT A;  3I91 A;  4NXM L;  2JA7 G;  4A3I G;  1E2Z A;  1RTN A;  3U58 A;  2EJF C;  3KBG A;  2AUJ D;  1EEF D;  5KNB A;  1KXL A;  2H1E A;  2B63 G;  1Q12 A;  2YYZ A;  4MNO A;  2FMC A;  1GUT A;  1LT3 D;  2KCT A;  1GM5 A;  4O42 A;  2KHI A;  3K81 C;  5LHY 1;  3J81 L;  1HFG A;  3U9O A;  1SYE A;  4Y7N B;  1HJP A;  1FR3 A;  4WJ4 A;  5EGT A;  4GOP C;  1FGB D;  5I2Y A;  1C9O A;  5E4X A;  3I8Z A;  3BDO A;  1PH8 A;  4JYA L;  4A3E G;  2IY5 B;  1EYA A;  4LF6 Q;  1GKH A;  5EBC A;  1RTO A;  1EUJ A;  4YY3 Q;  1Q81 C;  1ENC A;  2AQ2 B;  4RCO A;  3RZD H;  1VQO A;  4BXX H;  2NVT B;  2N49 A;  5DAU A;  3PUW A;  4APV A;  1X3Q A;  4JPB W;  3CRL C;  4K6D A;  4GNX B;  2RCF A;  3WWV A;  1XPO A;  3SK5 A;  1BBW A;  3LGJ A;  1W6K A;  3K7A B;  1KIX A;  1Q8K A;  4DR5 L;  2X6L A;  3MFG A;  3Q24 A;  3KFU A;  1NAP A;  4P2C B;  1HTL D;  3K5O A;  1KC8 C;  5M5Y B;  1BDO A;  4KHV A;  1C0A A;  4Z9C B;  1SND A;  2I07 B;  5GRO A;  3PIP A;  1VQ7 A;  3A55 A;  2R92 H;  3D6C A;  1HZ9 A;  2A73 B;  4RKL A;  2H4O A;  3GTK H;  2ENB A;  1PH6 A;  2R7Z B;  1BNZ A;  3H94 A;  2QDB A;  2JA5 G;  2KHJ A;  3EQL C;  5IOC A;  1BCP F;  3HZX A;  1RD9 D;  3J7Z C;  3LNN A;  1AZP A;  2GVB A;  2KUM A;  1UE7 A;  3G6E A;  1LTA D;  3PIP 3;  1OO9 B;  2UU9 L;  2VUM B;  1ZKO A;  5M3M H;  3P1H A;  1TII D;  2F3I A;  4JYA Q;  3CCE A;  3STB C;  2Z4I A;  4JBM A;  1B70 B;  1NMF A;  5CV8 A;  2VXW A;  3W1B A;  1SMX A;  2SNM A;  4C3J B;  3SGI A;  3M3Y B;  3QO2 A;  1C48 A;  3I70 A;  1SE4 A;  2D9U A;  1WI5 A;  5IWA L;  1RCV D;  5JEA G;  1UEB A;  1MIU A;  2RDG A;  2DY8 A;  2EXZ A;  1VQ9 A;  4DV7 L;  4IJL A;  1HTP A;  1MJE A;  3DEO A;  1PRT C;  2SOB A;  3I72 A;  5KNC A;  2DN8 A;  4J6H A;  3RZO H;  1VF7 A;  4UPA A;  4BY1 G;  3I4N B;  4KI0 A;  2FFK B;  3C1E A;  2F0H A;  1PTO B;  2JXM B;  4XQJ A;  4CDD C;  2PMZ B;  2PQA B;  1EOV A;  2D62 A;  5CV9 A;  4E6I A;  2F0U A;  1VMC A;  1TXY A;  2F0J A;  1EFI D;  3NEL A;  1CKO A;  1OTC A;  3H91 A;  1Y1W G;  3C3L A;  2NN6 H;  1VQL A;  2R7D A;  1KL9 A;  3GV3 A;  3RD4 A;  4ZUJ A;  5M5X H;  3JC6 6;  3OIQ A;  1CSQ A;  1DGS A;  4A3L H;  1X32 A;  4F88 A;  2K01 A;  4KHP L;  3KK7 A;  1JB7 A;  1LT5 D;  3GQB A;  4TSS A;  1LO5 D;  4ZLT F;  4IQZ A;  1AE3 A;  3R2I A;  4P74 A;  3QB3 A;  3A54 A;  2UU9 Q;  3UI2 A;  3J80 E;  3D4R A;  4QMG A;  4C2M H;  4A3D B;  5C4X B;  4CBV A;  1CKN A;  1H9K A;  2A6E C;  5J1Z A;  3KLS X;  5ELE A;  3C46 A;  3TZU A;  3UDI A;  3ERQ A;  1EWI A;  2F3V A;  5KND A;  1XTC D;  5IY0 A;  1HR0 Q;  1B1Z A;  1XNR L;  4B3S L;  3TQY A;  1K83 H;  1O7L A;  4N8F A;  3C2P A;  5K36 H;  1JC7 A;  1NTG A;  3PCO B;  2OEO A;  1SAP A;  3E0E A;  2WAC A;  5IWA Q;  5JOB A;  2EY2 A;  5D3I B;  4YWM A;  4DV7 Q;  4R8I A;  4ALP A;  1A15 A;  2PZW A;  2I5H A;  4R4I A;  5IYB H;  2QEX A;  3MXG A;  3MXU A;  1VQB A;  1R9T B;  4P75 A;  4DR2 L;  1EY6 A;  1D5M C;  4ME3 A;  1SJE D;  2F03 A;  2B2Y A;  2NYZ D;  3CC7 A;  1YEZ A;  4X65 Q;  2A68 D;  3BZD B;  1XNQ L;  5KEE A;  1EYC A;  5EBD A;  4PMW A;  2UXD L;  2X6G A; 
#chains in the Genus database with same CATH homology
 1NR2 A;  4HSV A;  4RHR A;  2MJ8 A;  5FLX E;  1G91 A;  2EYH A;  3A8I E;  1MSG A;  2D5D A;  1JIC A;  3GD7 A;  1JCK B;  3DXJ C;  1EZ8 A;  1SMY D;  4NKL A;  2AWN A;  3TN2 A;  1KDB A;  2HDM A;  3NTK A;  4HSP A;  2L5T A;  1SNO A;  3LWE A;  3IL8 A;  1LT4 D;  5CYU A;  4HMJ A;  4BS9 A;  1RHP A;  1MGS A;  2NVQ B;  4CHT B;  1EWC A;  1EQV A;  2B8G A;  5EKK A;  1O7Z A;  2IJ0 A;  1CT1 D;  2NN6 I;  3T53 B;  3I90 A;  3IFD A;  2LFN A;  5M3M B;  2B2T A;  2ZXR A;  4A3K B;  3PMF A;  2F0L A;  1B9M A;  3VYU A;  2NTS A;  1Q8I A;  2F3W A;  3DHQ A;  4Q0F A;  2BA1 A;  2F0F A;  1STY A;  2K03 A;  1EQT A;  5C6A A;  1YNN D;  4K14 A;  1V1P A;  1SNC A;  2KA7 A;  5NUC A;  3SE0 A;  5I9P A;  3K0Y A;  1I4X A;  1BCP B;  2Y0S B;  3KUP A;  1F2Y A;  3TP5 A;  2LMC B;  3BVG A;  1F77 A;  1B44 D;  3PUY A;  3D3R A;  1NSN S;  2F0K A;  1UUP A;  4FXK C;  5ISR A;  5G3L D;  1H9S A;  2AQ1 B;  2IT1 A;  3TBI B;  4CKE A;  1A3T A;  1GUN A;  2AQ3 B;  2IX1 A;  2QKI C;  3I4L A;  1K83 B;  4PMB A;  3RMH A;  1L0Y B;  3Q23 A;  1MD2 D;  2WKC A;  3M7N A;  2E76 C;  1PZK D;  2EJM A;  2L12 A;  4ILW A;  3NE5 B;  2NVY B;  4DAV A;  2EYO A;  2F1M A;  5A2Q E;  1GUG A;  3GTP B;  4KY7 A;  2Z8L A;  1F2Z A;  1ESR A;  2CW0 D;  5DNF A;  1KLG D;  2ID0 A;  3KBX A;  3N52 A;  4BA1 I;  2F0W A;  3MHB A;  1DJR D;  1I4P A;  4WOR A;  2EPB A;  1F2L A;  4NMZ A;  2EYJ A;  1QB5 D;  2MP1 A;  1RJT A;  1EY9 A;  1EY8 A;  2Q8R E;  2G9H D;  3TDQ A;  1JWU D;  2AUK A;  3T4A C;  2PCF B;  3JAM E;  2K04 A;  2F0D A;  2C5C A;  1CI3 M;  3OW7 A;  5IT9 E;  2EYL A;  3MEH A;  2A68 C;  3P7J A;  5FO7 B;  4X3U A;  3OMC A;  1HUN A;  1HA6 A;  1S5D D;  2JP1 A;  2E2J B;  4UAI A;  3R3O A;  4RCN A;  2WP8 J;  4HMI A;  2E2I B;  1HHV A;  2M00 A;  2RSO A;  3FEW X;  5M9O A;  3WOE A;  2EJG C;  2KED A;  1IW7 D;  5IIF A;  4IFD J;  3GO5 A;  3RLF A;  4QUF A;  4O1N A;  5I2X A;  1SMY C;  4DXG A;  1EU3 A;  4TQU S;  3VYR A;  4OIK A;  3K59 A;  3VYT A;  1EWH A;  2B2W A;  2NUC A;  1PTO H;  4V0B A;  3GTO B;  3NSW A;  5TSS A;  3MFY A;  1TVX A;  4RGN A;  4KK7 A;  1GXD C;  1B50 A;  2QIL A;  1HA5 A;  5T1G A;  4RAU C;  4IUU A;  1PRT B;  2R93 B;  4XQQ A;  2FMM A;  1HUM A;  1JOR A;  3VR3 A;  1E2V A;  2EYM A;  3HOU B;  3TP8 A;  2NN6 G;  1I4R A;  1ENF A;  1A2T A;  3TP6 A;  2DNC A;  1K8M A;  4QIW B;  2JYO A;  4J1M A;  1RDP D;  4OO1 G;  2M2L A;  3AU7 A;  5ELD A;  2K6A A;  2FJ2 A;  3QIA A;  1GUW A;  1TWA B;  2JE6 I;  4K8J A;  3CQZ B;  5C4Z A;  1LTR D;  1S5E D;  1EEI D;  1QOH A;  5I4D A;  1TS2 A;  4UDU C;  4PMC A;  4DU9 A;  3VR4 A;  4CKC A;  1Y69 U;  2LKV A;  2L55 A;  5K36 G;  5C4H A;  3HRZ C;  5T1I A;  2B2Y C;  3WOF A;  3ND9 A;  1JE4 A;  1CM9 A;  5C0X H;  1PZJ D;  1TS4 A;  1SYD A;  1IL8 A;  5JPM C;  3DM1 A;  3S1R B;  5CV4 A;  5J39 A;  2DY7 A;  4HAE A;  4DNR B;  3NK9 A;  3KLS A;  1IKM A;  1GUO A;  1STB A;  1OXT A;  1Q1E A;  3T13 A;  1I4G A;  2NB0 A;  2C9O A;  1JWM D;  2N55 A;  4C3H B;  1XYI A;  2GA4 B;  5CBA E;  2HCI A;  1TWC B;  5IGB A;  2K1B A;  3S1Q B;  4FF3 A;  4MN3 A;  5CC4 A;  1STA A;  3S1N B;  3PO2 B;  1V43 A;  2DNE A;  4X3T A;  2IW3 A;  3NBI A;  3EFX D;  3LWU A;  2B2T C;  2Q8I B;  2EVB A;  1PTO D;  2KEC A;  4BBS B;  3H3V C;  2XSC A;  1X3P A;  4RA8 A;  1KDC A;  1I50 B;  3SK8 A;  4DA2 A;  5C44 B;  3S15 B;  2A69 D;  3G7L A;  3MZ5 A;  4CKB A;  3OMG A;  5F2D A;  3J80 L;  4A3G B;  1EY5 A;  2XWB B;  1ZXT A;  3V05 A;  1ESF A;  3S2H B;  4MHE A;  4OHJ A;  3HOX B;  3GTM B;  2XVS A;  2A5H A;  1G29 1;  1BR9 A;  3X3M A;  1IW7 C;  1EY7 A;  3HOW B;  1AW7 A;  1IHZ A;  3HP3 A;  3BVZ A;  3K57 A;  1OXV A;  4FVM A;  1ZYR C;  2NZ1 D;  2Z1C A;  4H44 C;  4RKB A;  4FYD A;  5C0X J;  3M4Y A;  3K58 A;  2JEA I;  1QE6 A;  4FF2 A;  2FIN B;  5G3L F;  3L9A X;  1QNK A;  4RGM A;  2TSS A;  4OIJ A;  5LL6 X;  3A56 A;  5KIX A;  1AEX A;  1BUV T;  1HPC A;  4KD3 A;  5ELB A;  5C0X I;  3PO3 B;  2EDG A;  5ELF A;  4C3I G;  3VA5 A;  4IFD G;  1CA5 A;  4KMU C;  1MBY A;  2SEB D;  1HRJ A;  2K7V A;  4ZRZ A;  1Y8P B;  3MC0 B;  5FLX L;  4ULL A;  4NW2 A;  1S4Z A;  1Y8N B;  5DEH A;  1G2S A;  1M4V A;  1MSH A;  3KF8 A;  1WD1 A;  2JSO A;  5C4J B;  2TMP A;  1R4P B;  1JOQ A;  3GTG B;  3PV0 A;  2WB1 B;  4AYB B;  1TT2 A;  1IKL A;  2BDN A;  3FMC A;  4L6T B;  1NUC A;  5CGK A;  1AZQ A;  2BA0 A;  3OWF A;  2PPB C;  2K05 A;  1ET9 A;  1STG A;  2XN9 C;  2F0T A;  1F9Q A;  3VR2 A;  4KJN A;  3K5N A;  3T51 B;  1EIG A;  2X69 A;  3NTI A;  4R8N A;  3MXN A;  5M5W B;  5COY A;  2J7Z A;  4ZKB B;  1KNA A;  3D8G A;  2J0T D;  2SNS A;  3BVM A;  5D3D A;  4A93 B;  5EKI A;  4M8A A;  3BG3 A;  4IUR A;  3T16 A;  3ONA B;  3D6W A;  2BE5 D;  2CVR A;  1VCI A;  1AFP A;  1TY0 A;  2PO4 A;  3S14 B;  1F9R A;  1WTO A;  1AP0 A;  1DD2 A;  2L1B A;  3J7Y W;  1I6H B;  2WV6 D;  1PLF A;  1DOL A;  2PW5 A;  1SNP A;  2F0P A;  1DM0 B;  1D5Z C;  1Q3L A;  3GTQ B;  3D31 A;  3VA7 A;  1IYV A;  2MPM A;  4C3J G;  4B08 A;  3NQI A;  3A7L A;  4F7X A;  2KJX A;  2MGS A;  1V1O A;  3H09 A;  3BYY B;  1KAB A;  4FF1 A;  5EPL A;  3NQT A;  1BO0 A;  1Q1B A;  1U9R A;  2KCN A;  1TWH B;  1ZEQ X;  1JR0 D;  4DF7 A;  4K2K A;  4ZQ3 A;  3OIP A;  1I4Q A;  4XT3 B;  4A3B B;  5M3F B;  1K8O A;  1GHK A;  1FNU A;  5IGD A;  1LTB D;  5A2Q L;  1E0B A;  2A74 C;  4WJW A;  3BDC A;  3NP8 A;  2F0V A;  3V2T A;  2E75 C;  5IGG A;  1WTX A;  3A8K E;  1DZ1 A;  1C4Q A;  1S5B D;  2HQE A;  1MI2 A;  1YNJ D;  1SJH D;  3GTL B;  1C8C A;  4CJ1 B;  2XWJ B;  4KN4 C;  2BDO A;  4LMQ D;  1I4H A;  4XT1 B;  3JAM L;  1EY4 A;  2B2V A;  4A3J B;  2HUG A;  4IUQ A;  2IX3 A;  4PQX A;  4QCL A;  2L9H A;  2JA7 B;  4A3I B;  1PDQ A;  3WDN A;  4RFB A;  3S16 B;  1VDZ A;  1LV9 A;  1QG7 A;  2B63 B;  4PNY A;  4DK1 A;  1U4P A;  2KCC A;  2PZT A;  1QJO A;  4K6L A;  1DOM A;  1I6V C;  2O2L D;  3SK6 A;  3FVQ A;  1U4R A;  3ND8 A;  4IUN A;  1OXX K;  2NVX B;  1QCB D;  1Z7T A;  5C0X G;  4G4K A;  4KY6 A;  5JVG 3;  4A3E B;  5EQ0 A;  2IWH A;  1A2U A;  3AMU A;  3DUZ A;  4KV6 A;  1QNU A;  1JOO A;  1FNV A;  1WTP A;  2RVL A;  5FO8 B;  3NWT A;  1PFN A;  4ZAI A;  4F8M A;  1CZG A;  5KYI A;  2M9V A;  3VYS A;  3NTH A;  5ELC A;  1HCZ A;  3GTJ B;  1SE3 A;  4HN7 A;  1CHP D;  3N6R A;  4FP5 D;  1PTO F;  4F87 A;  5EJW A;  4M1U B;  3E6Z X;  2JEB I;  5E4W C;  1TS5 A;  3A8J E;  4K5X A;  3OWE B;  4H0L C;  2JA5 B;  1HFN A;  3FPU B;  1BOS A;  2B2U A;  3NXW A;  5K5P A;  2EY5 A;  3BDL A;  4IUP A;  1F9P A;  1FD7 D;  1O7Y A;  3NUC A;  1CQV A;  2ZXP A;  2I46 A;  4DGZ A;  1PRT D;  2VB2 X;  3I73 A;  1G2T A;  1DOK A;  1FNW A;  2BE5 C;  4XTC S;  5HUR A;  3W2D A;  4DAY A;  3DEP A;  3DMU A;  4C56 C;  1U4L A;  2IX0 A;  2F0N A;  1PXU A;  3S9W A;  1B2T A;  5I9O A;  2KEE A;  4BWG B;  4U68 A;  1OXS C;  1IYU A;  2FHT A;  4ZUI A;  1CK1 A;  4BY1 B;  3IFT A;  1BXT A;  2K5W A;  3F2U A;  3SHL A;  2A6E D;  2N88 A;  5KRU A;  4H13 C;  3M7G A;  1Y1W B;  2CHB D;  4K8I A;  2NTT A;  1TQO A;  1PZI D;  3VR5 A;  4C1N I;  1YNN C;  1LAC A;  1F9S A;  4XQN A;  1EL0 A;  1CZW A;  4WFN 3;  1LLR D;  2O5J C;  3O13 A;  1ENA A;  4G57 A;  3NBH A;  4XYO A;  3OHX C;  1BQQ T;  4DK0 A;  3OSO A;  3M4O B;  1DCZ A;  1TKW B;  5FOB B;  5JAV A;  1ILP A;  2KVM A;  3QWN A;  4OGQ C;  3MTS A;  4ID6 A;  3IKJ A;  4ODG A;  4EQO A;  1ML0 D;  3CHB D;  1SNM A;  3D4W A;  1TWG B;  1YNJ C;  1WTR A;  4WRD A;  1XX8 A;  4N9T A;  4NP5 A;  3R8B A;  3S1M B;  2NBF A;  1KDA A;  2ZT9 C;  3FDT A;  4CJ0 B;  1SNQ A;  5IOD A;  1B3A A;  1A3U A;  1V8Q A;  4EQP A;  4HCS A;  1TR5 A;  3NWS A;  2NWG A;  1D1K A;  4B9X A;  3GV6 A;  3X3N A;  1O80 A;  2SDF A;  2CW0 C;  5C5M A;  5I6W A;  4X3K A;  3TME A;  5BN4 A;  4XYQ A;  4JK1 C;  4BBR B;  1B4O A;  4I65 A;  3DWQ A;  4QB4 A;  1D2B A;  3G6J B;  1VMP A;  3J81 E;  4DAP A;  3Q22 A;  4IUV A;  5LL6 S;  1EY0 A;  1STH A;  2F0S A;  3AB9 A;  4NDX A;  5C3E B;  1SYF A;  4G7O C;  2B8F A;  4U67 3;  1SXT A;  2RQX A;  2EOT A;  1EOT A;  3PUV A;  2D2C C;  2BCO A;  1LTG D;  4B9W A;  1TWF B;  1XWE A;  3P75 A;  5JPN C;  3QG1 A;  5AFW A;  3R93 A;  2F0Q A;  3SEB A;  3T56 B;  4CGY B;  1KLU D;  1S5C D;  3QJY A;  1L0X B;  1UEA B;  1SYG A;  3QOL A;  3HS0 C;  5D65 A;  1D6E C;  1WD0 A;  1WCM B;  4DN4 M;  4PV1 C;  5IGF A;  1R4Q B;  1Z6H A;  1E2W A;  4XDX A;  2JA8 B;  5E3F A;  1A3V A;  5JVH 3;  4QF4 A;  3MXP A;  1EZ6 A;  5KGU A;  1CTM A;  1RF2 D;  3S2D B;  3Q6S A;  1W6J A;  2F0M A;  1LT6 D;  4RHS A;  1WTV A;  4OO1 H;  2HDL A;  1ONL A;  1S5F D;  3PUX A;  1G8Z D;  1QWY A;  3SXH A;  3EA6 A;  2B2V C;  1I3Q B;  2J4X A;  1SFO B;  2QF7 A;  3E0J A;  3URY A;  3CRK C;  3SVM A;  2YU9 B;  2O5I C;  3PIO 3;  1DXM A;  3Q0A A;  2JA6 B;  3SDZ A;  5DM6 3;  2WKD A;  4C1N K;  3KLR A;  4Q5V A;  2F0O A;  1HXY D;  1GHJ A;  2F0G A;  2R3Z A;  3TSS A;  2F0E A;  5IGC A;  2A6H D;  1JWS D;  1KAA A;  3NPP A;  1II3 A;  4L63 B;  5CR3 A;  4LK1 C;  1AN8 A;  2RA4 A;  2OXP A;  2EE1 A;  2VNU D;  1H9M A;  2WAQ B;  5EPJ A;  3I4M B;  5CV6 A;  1VF5 C;  1T5E A;  1WTW A;  2L0C A;  2K28 A;  4KHZ A;  3K5L A;  1ROD A;  1WTQ A;  1SSO A;  5CMD A;  4ZYS A;  3RZD B;  1D1I A;  5I6Y A;  3HG9 A;  1JQY D;  1LAB A;  3A7A B;  4LAA A;  4XXE A;  3C1F A;  4C3H G;  3MAQ A;  2PNR C;  4ME5 A;  1JOK A;  3P20 A;  2B2U C;  3TP7 A;  5FKA C;  1NCV A;  2QCP X;  3K6O A;  1PRT F;  3SR1 A;  3ITP A;  2VB3 X;  2R92 B;  5BN3 A;  3GTK B;  2RSN A;  1CQF A;  1ILQ A;  3W3A A;  4K5V A;  4H7B A;  1D5X C;  4DFA A;  2B2W C;  2WIN B;  5FO9 B;  4OL7 A;  4ZK9 B;  3L7Z C;  2KHS A;  2L4N A;  4JBW A;  1U4M A;  4FO2 A;  1BCP D;  1RKN A;  4K2L A;  4KKT A;  1J9O A;  2OF1 A;  1UAP A;  1JB3 A;  3E5S A;  5KYL A;  1TS3 A;  2Z4H A;  2RKS A;  2OT2 A;  4BA2 I;  5JEA H;  4KN7 C;  1TY2 A;  4OO1 I;  1PTO C;  4FF4 A;  2K5Q A;  4HR7 B;  2XRQ D;  2R6G A;  1H9J A;  2Q8T A;  4CJ2 C;  2A69 C;  3QOJ A;  1H9R A;  4S3S A;  1M8A A;  2G9D A;  1TU2 B;  4HTH A;  1HQM C;  2XRS D;  4G7H C;  3RZO B;  4J8Q A;  3SK4 A;  5E1F A;  1OXU A;  3FKI B;  4XIG S;  2WII B;  2F0I A;  3FPP A;  1SYC A;  1BBX C;  3GP7 A;  1EYD A;  3RUZ A;  3K5M A;  4TRD A;  2ZXO A;  4G7Z C;  5D14 A;  4YIJ A;  2O4X A;  2RDF A;  1XXG A;  4EVO A;  4TKO B;  3J7A V;  1BF4 A;  1SBB B;  4KKS A;  4EQN A;  5M5X B;  1PFM A;  1GOZ A;  5EPK A;  1T5X D;  4R9W A;  4IFD H;  4DXF A;  4QUC A;  3MA2 B;  2MHV A;  2R61 A;  2KOL A;  5IT9 L;  1B9N A;  4FXG C;  1EIH A;  4C2M B;  5IGE A;  1LTT D;  4FNF A;  2BOS A;  1GJX A;  1A6X A;  1ET6 A;  2EZV A;  5CV5 A;  3H6M A;  5DM7 3;  3MVV A;  3J7A F;  4IUT A;  1SEB D;  3HOZ B;  2EY1 A;  2ICE C;  4IAL A;  5EKL A;  1SYB A;  3FRP B;  1DON A;  2EYF A;  1SE2 A;  3DWP A;  3L3O C;  1PFB A;  1LTI D;  1J8I A;  1STE A;  1Y8O B;  2K5D A;  3TZD A;  1CHQ D;  3M85 A;  1KTK A;  4L8J A;  4V19 0;  1NR4 A;  5JEA J;  2V4D A;  3LX0 A;  1QIL A;  2A6H C;  1LTS D;  4K5W A;  3ZYY X;  2EYP A;  1EU4 A;  4A3F B;  2PQE A;  3CU7 A;  2E2H B;  4BY7 B;  3OPO A;  1KNE A;  1PYW D;  2E74 C;  5C3X A;  1B53 A;  1GUS A;  4ABN A;  2KQ3 A;  2E2D C;  5COR A;  4KJO A;  2IL8 A;  2MUY A;  3I3C A;  3D4D A;  3HOV B;  4A3M B;  3BYT B;  1Z47 A;  4KKU A;  4RH6 A;  2RBM A;  2RDH A;  5HGT A;  3HGB A;  3H0G B;  3MWY W;  5JJZ A;  2HCC A;  1CFM A;  1SDF A;  2F4I A;  3VR6 A;  5C3W A;  4RGO S;  4LJZ C;  2QEJ C;  3IAY A;  3NHH A;  2K33 A;  3DWA A;  2ICI A;  3S17 B;  1Q90 A;  1ZYR D;  3ERO A;  1PMR A;  4RWS C;  3HEJ A;  3R2T A;  2L11 A;  4HCE A;  5A35 A;  4IFD I;  1WVL A;  4HED A;  4N9P A;  2K32 A;  1V1P B;  4MIU A;  4IZ8 A;  3HKZ B;  3CKI B;  1FYC A;  5FK9 C;  1G6Z A;  1BCP C;  2XNA C;  5CV7 A;  2PZU A;  2LY7 A;  5CBE E;  3U9S A;  4I7Z C;  4FXD A;  2PYK A;  4GZY C;  4IN3 A;  2XIW A;  1DYQ A;  2LS0 1;  1UNS A;  1Y1V B;  3EVQ A;  3EJI A;  5J22 A;  3HOY B;  1STN A;  3BS1 A;  1H9S B;  3OOC A;  2B39 A;  2PW7 A;  4ZKC B;  1HQR D;  1ICW A;  1F2M A;  3PUZ A;  4KY5 A;  1CA6 A;  4EGV A;  3V96 A;  5BN5 A;  4C3I B;  2CQA A;  4KTA A;  4DNT B;  2EY6 A;  1O78 A;  4X3S A;  2AWO A;  4KD4 A;  5C5L A;  2IPK D;  4RGT A;  3I91 A;  1E2Z A;  1RTN A;  2EJF C;  3KBG A;  2AUJ D;  1EEF D;  5KNB A;  2H1E A;  1Q12 A;  2YYZ A;  2FMC A;  1GUT A;  1LT3 D;  4O42 A;  3J81 L;  5LHY 1;  1HFG A;  3U9O A;  1SYE A;  4Y7N B;  1FR3 A;  5EGT A;  1FGB D;  5I2Y A;  5E4X A;  3I8Z A;  3BDO A;  1EYA A;  5EBC A;  1RTO A;  1ENC A;  2AQ2 B;  4RCO A;  2NVT B;  5DAU A;  3PUW A;  1X3Q A;  3CRL C;  4K6D A;  3SK5 A;  1W6K A;  3K7A B;  2X6L A;  3MFG A;  3Q24 A;  1NAP A;  4P2C B;  1HTL D;  3K5O A;  5M5Y B;  1BDO A;  4KHV A;  4Z9C B;  1SND A;  2I07 B;  3A55 A;  3D6C A;  2A73 B;  4RKL A;  2H4O A;  2ENB A;  2R7Z B;  1BNZ A;  3H94 A;  2QDB A;  3EQL C;  5IOC A;  1BCP F;  3HZX A;  1RD9 D;  3LNN A;  1AZP A;  2KUM A;  1LTA D;  3PIP 3;  1OO9 B;  2VUM B;  1ZKO A;  3P1H A;  1TII D;  2Z4I A;  5CV8 A;  2VXW A;  2SNM A;  4C3J B;  3M3Y B;  3QO2 A;  1C48 A;  3I70 A;  1SE4 A;  2D9U A;  1RCV D;  5JEA G;  2RDG A;  2DY8 A;  2EXZ A;  1HTP A;  3DEO A;  1PRT C;  2SOB A;  3I72 A;  5KNC A;  2DN8 A;  4J6H A;  1VF7 A;  3I4N B;  4KI0 A;  2FFK B;  3C1E A;  2F0H A;  1PTO B;  2JXM B;  4XQJ A;  2PMZ B;  2D62 A;  5CV9 A;  4E6I A;  2F0U A;  1VMC A;  2F0J A;  1EFI D;  3H91 A;  3C3L A;  2NN6 H;  3GV3 A;  3RD4 A;  4ZUJ A;  3OIQ A;  1X32 A;  4F88 A;  2K01 A;  3KK7 A;  1LT5 D;  3GQB A;  4TSS A;  1LO5 D;  4ZLT F;  4IQZ A;  3R2I A;  3QB3 A;  3A54 A;  3UI2 A;  3J80 E;  3D4R A;  4QMG A;  4A3D B;  5C4X B;  4CBV A;  2A6E C;  1H9K A;  5J1Z A;  3KLS X;  5ELE A;  3C46 A;  3TZU A;  2F3V A;  3ERQ A;  5KND A;  1XTC D;  1B1Z A;  1O7L A;  3C2P A;  5K36 H;  1JC7 A;  2OEO A;  1SAP A;  2WAC A;  5JOB A;  2EY2 A;  5D3I B;  4R8I A;  1A15 A;  2PZW A;  3MXG A;  3MXU A;  1R9T B;  1EY6 A;  1D5M C;  1SJE D;  2F03 A;  2B2Y A;  2NYZ D;  2A68 D;  3BZD B;  5KEE A;  1EYC A;  5EBD A;  4PMW A;  2X6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...