2PYKA

Crystal structure of staphylococcal nuclease variant v66q/p117g/h124l/s128a at room temperature
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
135
structure length
130
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKVEKYGPEASAFTKKMQENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystallographic study of hydration of an internal cavity in engineered proteins with buried polar or ionizable groups.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 130
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2pykA00
5EKKA 3MHBA 4WORA 4J6HA 1EZ8A 3RUZA 5KYLA 2WACA 5C3WA 5CV6A 5J39A 4QB4A 2EY2A 5JAVA 1A3UA 3DHQA 2PZWA 2SNMA 4LAAA 2F3WA 1EY4A 3VA5A 2EYPA 5I9PA 3E5SA 2SOBA 3NP8A 5IGGA 4RKBA 2F0IA 2M00A 4ID6A 5C4HA 5E3FA 1EY0A 4RKLA 4WRDA 1STYA 5HGTA 2OF1A 3D8GA 3H6MA 5IGEA 1KDCA 2EYOA 3QOJA 2LKVA 4KJNA 1SYEA 4TRDA 4EVOA 4F8MA 1NSNS 2EY1A 5IIFA 1AEXA 1JOKA 3D6CA 1EYAA 4K8JA 4KY7A 5EKLA 2QDBA 4ZQ3A 2F0FA 3P75A 4I65A 5M9OA 5I6WA 3MEHA 5J22A 5CGKA 4KV6A 3NQTA 2F0DA 3NK9A 4KY5A 4KY6A 2EYLA 1EY9A 3BDCA 1F2YA 3P1HA 1RKNA 3QOLA 4IALA 3SK4A 3NXWA 4K5VA 1F2MA 1JORA 1F2ZA 3OSOA 4PNYA 4N9TA 4H7BA 1SYFA 1KAAA 3DMUA 4ZUIA 4B9XA 4EQNA 1EY8A 5C6AA 4NP5A 5CC4A 5DAUA 1JOQA 3SK8A 2F0QA 4IUNA 4K6DA 3MXPA 1SNCA 2F0OA 4K2KA 1KABA 1SYDA 5IOCA 1SNDA 2EY5A 3OWFA 3V2TA 3T13A 3ITPA 5CR3A 3OMCA 4HMIA 2KHSA 4DF7A 2PZTA 5C3XA 1IHZA 2OXPA 3MZ5A 5CV7A 3HEJA 4ME5A 3T16A 4F7XA 2F0PA 1EYDA 2F3VA 3OMGA 1EY7A 3PMFA 3LX0A 5E1FA 2O4XA 3TP5A 2PYKA 3SR1A 4DFAA 5IGBA 1EZ6A 2RBMA 1STBA 2EYJA 4HTHA 4B9WA 4E6IA 1ENCA 4K5WA 4QMGA 5IGFA 3MVVA 1STNA 5J1ZA 4OL7A 5C4ZA 4N9PA 1TR5A 4ODGA 2F0LA 1A3VA 3TP7A 4NDXA 5F2DA 3SHLA 4NKLA 1TQOA 4PMCA 2F0KA 4ZUJA 5C5MA 3SK5A 5KGUA 2F0WA 4KTAA 5IODA 2F0EA 1STGA 2EYMA 1STHA 4PMBA 3D4DA 5CV5A 4DU9A 1A3TA 1U9RA 5EGTA 3SXHA 1A2TA 1TT2A 2KQ3A 1SNOA 3ERQA 2NUCA 2OEOA 2PW5A 2PW7A 1SYCA 4K2LA 3C1EA 4QF4A 5C5LA 3U9OA 5CV4A 4G57A 1EY5A 4KD4A 3BDLA 1KDAA 4S3SA 2PZUA 3QB3A 5KYIA 2ENBA 3NUCA 3R3OA 4DGZA 5KEEA 2PQEA 1STAA 4KJOA 2F0TA 3EJIA 3EROA 2F0MA 4K14A 1SYBA 5ISRA 3TP8A 4KD3A 2F0GA 1SNPA 1EQVA 5IGCA 4HMJA 4R8NA 5CV9A 1SYGA 2SNSA 2RKSA 4YIJA 3TP6A 3D4WA 4J1MA 5IGDA 5KIXA 1NUCA 2EY6A 3EVQA 4MIUA 4KHVA 1SNMA 5KRUA 3S9WA 4NMZA 5I6YA 2F0SA 2EYFA 3C1FA 4EQOA 4EQPA 2F0UA 2HQEA 1SNQA 1JOOA 2RDFA 3TMEA 2F0NA 1ENAA 2EYHA 1EYCA 4IZ8A 5HURA 1EY6A 3HZXA 5DEHA 1A2UA 4K5XA 5K5PA 5NUCA 2F0JA 5CV8A 2F0HA 4K8IA 5JOBA 1KDBA 5I9OA 3SK6A 2F0VA 3NHHA 1II3A 2EXZA
chains in the Genus database with same CATH superfamily
2V4DA 3FKIB 4DR1L 1N8RC 4LJZC 2WACA 4QB4A 4A3MH 4FF4A 1YJWA 1EY4A 3I7FA 2NZ1D 2Z6KC 4HJ5A 1Q82C 1XMQQ 5D65A 1YJNA 3T1HQ 4C1NI 1HFNA 3BVZA 5T1IA 3K8AA 1X65A 2NN6H 2F0FA 2NVQH 2VUMH 1KD1C 5IYBH 3CRKC 3Q0AA 4LF9Q 1XMOL 1KRSA 3SK4A 4DV4L 3CW2C 1RKNA 2AQ2B 2K75A 2PMZE 1EQTA 4JOIC 5IODA 4PNYA 4DV1L 4DR2Q 3DMUA 2L15A 2I46A 1VQ6A 2OCEA 3PO3H 1S5DD 1NNXA 4JPBW 4A3BB 2EY5A 4YCVA 4ABNA 5FO9B 3J7AV 5IP7H 5AJ3Q 3GDEA 3V2TA 2ZTCA 2B2WA 4IOAA 2AWNA 3K57A 3CU7A 1JICA 3RNUA 1Z7TA 2PYKA 2QILA 3HGBA 4JI6L 1GKHA 4DAPA 3L9AX 3MVVA 2A1AA 2PQAA 1W6KA 4XTCS 1QVFA 1GVPA 1BOSA 2MNAA 1IYJB 3A74A 1LT3D 5A2QL 2NBFA 1KIXA 1PYBA 1S5ED 1YVCA 1TS5A 2JA6B 5CV4A 3RN2A 1YNNC 4A3DH 1DXMA 3QB3A 1VQIA 2JA6G 4JI4Q 4DGZA 4LUVA 4DR1Q 4KK7A 1K3BC 1DOMA 3GQBA 1JB3A 4KD3A 1U4RA 5IGCA 4O2DA 1LYLA 3VYUA 5IYBG 2IW3A 1FR3A 1VQ4A 4NMZA 1KLGD 2M2LA 3U50C 4AYBE 3WDNA 1WTPA 1CFMA 3PO3G 3H3VH 1U4LA 4M1UB 3I90A 3S1QB 1PFBA 1XMOQ 2IL8A 3OW7A 5EKKA 1SLJA 1AZQA 3UDIA 1XNQL 3LGJA 5FLXL 4QGUA 5LMUQ 3Q8DA 3S15B 4RAUC 4OIKA 4BBSH 4OEMB 4DV3L 2N8NA 1JWUD 5IWAL 4LFBL 4FO2A 2B2YC 1I4RA 4X3TA 1D2BA 4JI3Q 2G9HD 3LNNA 4YY3Q 1G8ZD 1Z6HA 2IT1A 1PRTC 4APVA 1HZCA 4GNXC 4QUCA 3JC66 4ZQ3A 4DKAC 5M9OA 2D2CC 2K5DA 1RHPA 1RTOA 4KY6A 2KCMA 1GUTA 2JK8A 4IALA 4RHRA 1WFQA 1NR4A 1H9SA 1LTID 1BXTA 2B2UC 3CCLA 4B9XA 2CQOA 1G2TA 3OWEB 4LF4L 5IYCG 4GS3A 3OWFA 3RN5A 1V1PB 1V1OA 1RIPA 1ZEQX 1MI2A 4HSVA 4DF7A 4OWWB 3C3LA 1E24A 2F4VL 1DOLA 2AMCB 1J5EQ 4OO1I 3AYHB 1HNZL 2B2TC 1SE4A 4GLVB 4GOPB 4N9PA 4BY1B 3TREA 5GROA 1TWGH 2QEJC 2RSOA 2O5JC 1A62A 5KGUA 1STHA 3BYTB 3FRPB 4ZCKA 4HIMA 1TT2A 2KCCA 2WB1B 1DYQA 4DK6C 5CBAE 4A93G 5M3MB 4BBSG 3NENA 2WB1G 3BDLA 3OPOA 2QEXA 1GHKA 5M3MG 1F9RA 3EROA 4YCUA 1HZBA 4JI1L 3PF4A 1XNQQ 3QO2A 4C56C 4JV5Q 3CXCA 2L9HA 4PZ8A 2WP8J 4WJWA 4HR7B 1AZPA 2MQHA 3NWSA 5IWAQ 2XTIA 1SEBD 4KHVA 4P73A 1SRUA 1N32L 3S9WA 4LF8L 4A3JG 3CMAA 1VMPA 4U68A 3TQYA 2HQEA 4HAEA 1ESFA 4FP5D 1PH5A 4CGYB 4LF5L 5NUCA 4JCVE 3DUZA 3T56B 5IT9c 2H4OA 4PZ7A 2EZVA 1W2BA 2AQ3B 4LMQD 3KOJA 4ILWA 5D3DA 4E6IA 1I94Q 4ZAIA 2K50A 1HZAA 3MHBA 4HCSA 4A76A 2WFWA 3TBIB 3CCMA 3IFDA 2KEEA 2DUDA 1U4MA 4X3KA 2A5HA 3NBHA 2OTJA 4DV2L 1I6VC 3FPUB 4BS9A 3A8IE 3NELA 3CQZB 2CKZB 2M9VA 1HA6A 2OF1A 2A73B 3KJOA 1Q3LA 1H9MA 1WTWA 1GUWA 4H44C 4L6TB 3ND8A 2B8FA 2EOTA 5C44G 3I73A 3K7AB 2R61A 1PH4A 1MJEA 2QGQA 1PXUA 2HUGA 5JJZA 2A19A 3SVMA 4A3GB 3J80L 5JPNC 3C46A 4A3KH 3JAML 3S1NH 2F0OA 5IOCA 3AFQA 4U673 4RGMA 2UXBL 1QILA 1EEID 2J0TD 2KHSA 5M5XB 2CQAA 2KEDA 3A54A 4DUZQ 1UE6A 1MBYA 4C3HB 3LX0A 2O4XA 4ME3A 4DFAA 5ELDA 2J4XA 4QY7A 4HTHA 4OXPA 2WIIB 4P71A 4A3IB 1TWAH 4NXNL 5L37A 4QIWB 1BO0A 5ELOA 2K33A 2TSSA 1NR2A 4XQQA 5FKAC 4OX9Q 1TWHH 2KQ3A 1I4XA 2LFNA 4K2LA 1N33L 1KHIA 1EL0A 1FJGQ 3V05A 2WINB 3W2DA 3PUVA 3HOYH 3E9IA 2Q2IA 2Z4HA 3DWPA 1QOHA 1ET6A 3D4RA 2ZT9C 4GKKQ 2GN5A 3K59A 1C0AA 1NJIC 1K83H 1SNPA 5C4XH 4LFCQ 2XWJB 1BCPB 5GAHC 2EQSA 4ZYSA 1BBXC 3HOXB 4RWSC 3HOZH 1BCPF 3GTGB 3HOXG 1GUNA 1L1OC 2JA8B 5GADC 1HR0Q 3UDXA 2JE6I 2N3SA 1PLFA 2KHIA 1VQCA 4A3KG 2KENA 1I3QH 2X69A 2P5ZX 2IY5B 2F0JA 3I70A 2UUCL 3AEVA 3MXGA 4K8IA 2UXDQ 1Z9FA 1VQLA 2K28A 3SK6A 1OO9B 2Q8TA 4L5RC 4R4TA 1JQYD 3A0JA 2ZTEA 5JAVA 1FL0A 1YEZA 4OGQC 1ZYRC 5IP9H 4LAAA 4DUYL 1E2ZA 2QKIC 2K14A 4Z9CB 3E6ZX 2SOBA 2UXBQ 1SMYC 3T1YQ 1F2LA 4JYAQ 1K0SA 1X3FA 4ID6A 1TY0A 5E3FA 4X6AH 3HFZB 1KTKA 3D8GA 3H6MA 2O2LD 2NVTH 4H13C 1VQGA 4FNFA 3RZDB 3J81L 1XPOA 4BXXH 1PFSA 1NMGA 5JEAH 2ZJRA 4I65A 2UXCQ 4NXNQ 3HOYG 3BJUA 2BE5C 1RL2A 1P8LA 4C1NK 1WI5A 4R4CA 1IL8A 3EQLC 1JORA 1F2ZA 3IFTA 3S1MH 4N9TA 2GVBA 4AYBB 4NP5A 5DAUA 1BCPD 1KXLA 2F0QA 4PZ6A 4AYBG 2RCNA 2IWHA 1IBKL 1C7YA 4XT1B 2YTYA 4YHHQ 1O7ZA 5LL6S 2A8VA 4RMFA 4A3CH 1EYDA 1EY7A 1V9PA 1YNJD 1PH2A 4LF6Q 5DM73 2DNEA 3SK5A 5CV5A 4DAYB 2Z6KA 3UE0A 2EDGA 1IZ6A 3M9BA 1CHPD 3NE5B 5IP9G 1IBML 1Q46A 4HEDA 5DLQE 2AUJD 4OHJA 1PTOH 1HNXL 3GTQB 1WTXA 2F0MA 1NMFA 2NTSA 1TVXA 3PO2H 1DZ1A 1SJHD 3QJYA 3H94A 3F8TA 4JOIA 2BDOA 2XVSA 3D4WA 4DN4M 2CH4A 2RDHA 3AU7A 3C1FA 2UU9Q 3R2IA 3M7NA 1JOOA 3M4PA 1RODA 2JA7B 2ZM6L 1YNXA 1B70B 1K9MC 3E0EA 2E2IH 4K0KL 1AP0A 3A8JE 1ET9A 2IJ0A 3TP7A 5E4XA 1XTCD 3A8KE 5EQ0A 2R7ZH 2QW7A 3BDOA 2E2DC 1UNSA 2F3WA 4A3FB 1IBKQ 5I9PA 3K58A 4A3FG 2RSNA 5JEAJ 2AWOA 3I4MB 2LKVA 3BG3A 1SYEA 3HKZE 4EVOA 4C2MB 5IIFA 3I4MG 2WKCA 3RZOH 3P75A 5JPMC 3J7YW 4POGA 2JEAI 2D5DA 1TY2A 1Y1WB 4JW0A 1VQAA 5EBDA 3VDYA 2KA7A 1J8IA 3OSOA 4JI7L 1HNWQ 3MAQA 3PO2G 5C4JB 1IBMQ 4BY7H 1I50B 4IUNA 4K6DA 1O7IA 3KLSA 5FOBB 3BZKA 4DK3C 3I4OA 4O0AA 1SXTA 1WJJA 4A3LH 4HMIA 3KUPA 2PZTA 1CKMA 2R93G 1SMXA 2FFKB 2LS01 4IFDG 3CD6A 1YHQA 4I7AA 1YHAA 1ESRA 1VQNA 4IO9A 1SFOH 2F52A 2C5CA 4ZUJA 2F0KA 5C5MA 5EPJA 1MGSA 1M4VA 1N9WA 1VF7A 2B2YA 1CA5A 1S5BD 4KI0A 2I5HA 2NUCA 2OEOA 1EFWA 1A63A 2JN4A 4RGOS 5C0XG 3FEWX 3NUCA 5K36H 2B63B 1XMQL 1SBBB 4FF1A 2F0GA 4PMWA 3DLLA 4CDCC 4G7OC 5KIXA 2K03A 2EY6A 3BVMA 3NTHA 4LF9L 4DV0L 1GUGA 1Y1VH 1WTRA 1B3QA 2EYFA 3I2ZA 4DR2L 2F0UA 2IHEA 4BY7G 2EYHA 1EYCA 3HG9A 5M5YH 5ELBA 1PTOC 5K5PA 1VQEA 5AJ3L 2E2HH 3HKSA 2JP1A 4A3LG 1SSOA 2KCTA 1YITA 3X3NA 4DNIA 1KNEA 3TZUA 2MUYA 3QR8A 3U9SA 4J6HA 1EZ8A 1H9RA 1HCZA 1GOZA 3M7GA 5C3WA 2RA4A 1PFNA 1X3GA 4L5TA 1EYGA 3GTPB 4WJ4A 1WD0A 5ELCA 5FLMH 3CPWA 3F2CA 3CPFA 1XJVA 3I8ZA 4MTNA 1NSNS 1WTOA 1CSQA 3D6CA 3LWUA 2QDBA 1G51A 2NZOA 4KV6A 4JI4L 5K36G 3VR4A 1S5FD 1E3PA 1FNWA 1H9JA 1LO5D 1Q8KA 2AHOB 4K5VA 3CC2A 3K5LA 1VQFA 1X3PA 1ZKOA 4DNTB 1WCMH 1SNCA 5CBEE 3U58A 1JE4A 1UEAB 3S14B 1PYSB 2X6GA 2HQLA 1JJGA 1Z47A 1IHZA 4MNOA 3ZJYC 3ULLA 5DM63 1E2WA 4QMGA 1TWCB 5J1ZA 4OL7A 3HOUB 4DV0Q 1PHJA 3K80C 3HOUG 3I4NG 4PMCA 3NTKA 4IUQA 1R4PB 2VY3A 3URYA 4CJ2C 2AUKA 4XQNA 3HOVH 1STGA 2K5NA 1HHVA 1SNOA 1Q1BA 5LMUL 2CVRA 2PW5A 1FNVA 1UAPA 4S3SA 1B4OA 3MXUA 4AQYQ 3M3YB 2E2JB 3CAMA 3E9HA 5FLMG 4JI3L 2F0TA 2R7FA 4YY3L 3GTOB 3S16B 2TMPA 1X32A 1YNND 3VA7A 1CM9A 2ASBA 2CW0D 4N8FA 3MEFA 3H09A 4TSSA 2QA4A 2CHBD 2K01A 5I6YA 3ND9A 1B9NA 1E0BA 4Y7NH 2X6LA 1W6JA 1UEBA 4A3MG 1U0LA 1O7YA 4PQXA 1K8MA 1WCMG 1O80A 5HURA 1JJCB 3HZXA 2C35B 4X62Q 3CKIB 1TS2A 3T53B 2BCOA 4C3JH 4HSPA 3M85A 1EOVA 5KYLA 1J5EL 2NN6G 4UP9A 1STEA 2VUMG 4DK1A 4KLKA 3F2UA 4QCLA 2CCZA 5ELNA 4JBWA 1UE5A 5HGTA 4X64L 3HOVG 2E76C 3PO3B 3TZDA 2R6GA 2E5LQ 3MWYW 4OWTB 5IP7G 4F87A 1N36Q 1G2SA 1JR0D 5BN4A 2HCIA 3QOLA 2K7VA 2K05A 2R3ZA 2GA4B 1EIYB 2NVYB 4JV5L 1L1OA 4FF2A 3R2TA 4B3TQ 2PO4A 3PV0A 1KABA 3RLNA 1SNDA 1XPUA 3K7UC 1QZHA 3MTSA 3T16A 1KAWA 4ME5A 5HGQA 2CFMA 2SDFA 3ONAB 1WYDA 4IQZA 3H15A 1STBA 4A3DG 1ENCA 1L0YB 5C4ZA 2PNRC 4X3UA 5E7NA 5C3EH 4C3JG 2F0LA 1NE3A 4YWLA 1QZGA 4NKLA 5LMNW 1I94L 2F0WA 4R1JA 4KHPQ 4DU9A 1A3TA 4IOCA 3OYYA 2CWPA 2PW7A 4CDFC 5KNDA 4ALPA 3HKZG 1EWCA 1Y69U 5GAGC 1C9OA 1FGUA 2ALYB 3EIVA 3L7ZC 4KJOA 4DK0A 4DR7Q 5IY0A 4OO1H 5ISRA 3RLFA 1FVIA 1VQJA 4EGVA 3VYSA 4DPGA 5BN3A 3KJPA 1EQQA 2K32A 4R8NA 4JI5Q 2SNSA 4YIJA 3VR2A 3CHBD 2CWAA 3VR5A 4MIUA 1HH2P 2DN8A 5KRUA 4X64Q 2PQAB 4A93B 3K81C 4LFAQ 3X3MA 4BBSB 4N8X1 3MFGA 3I72A 2F0NA 1S5CD 4IUTA 2MO1A 4OWXB 3WOEA 5JVG3 5DEHA 3KK7A 1HQMC 1KDBA 5I9OA 4DUZL 4RCNA 1B53A 2RHSB 3OTOL 2ES2A 2A6ED 1D7QA 1X54A 4A3JB 2LXJA 3NWTA 2RF4A 1T9HA 3CP0A 5C3EG 3W5OA 1HPCA 3VR6A 1Q1EA 1HUNA 1JE5A 1STYA 3PUXA 5FK9C 1LACA 1NTGA 1IKMA 4OX9L 1ML0D 1G6PA 1AEXA 3K0YA 1WTQA 5IT9L 1FJGL 3AB9A 1C4QA 2L55A 5EBCA 3CRLC 4NW2A 4GKKL 4IURA 2EYLA 1L0WA 1JC7A 3A56A 1SYFA 4C3IH 5C6AA 4GN3B 4TVAB 4LFCL 1B2TA 1EFID 4HIDA 1SR3A 1SYDA 4LNQA 1K8OA 4R9WA 3G7LA 2JXMB 2QDLA 3T13A 1HR0L 4V0BA 4XT3B 1XX8A 2AKWB 4NPSA 5C44B 4A3IH 3STBC 1OXUA 2NVXH 1JT8A 4B3RQ 2AQ1B 1X56A 3HRZC 1Y14B 3G4SA 1TR5A 4GN5A 2UXDL 1O78A 4CJ0B 4NDXA 4TQUS 5CYUA 1QUQA 2KOLA 5FJ8H 5C4HA 1A15A 3RMHA 3GTJB 1BUVT 2LSSA 1H9SB 4LUZA 4F88A 4IPCA 1LLRD 3QG1A 1RTNA 2PZUA 1G291 3T1YL 4JYAL 1E7ZA 3WWVA 1ILPA 2G5DA 2WKDA 3FDTA 4K14A 1KLUD 3OTOQ 4GOPC 2Z1CA 2L12A 1LTBD 3GTGH 1SYGA 3H0GH 4FXGC 2JA8H 3TS2A 5AFWA 2E74C 2UXCL 4BBRH 3G71A 1SNMA 3CCRA 2A69C 2HCCA 1I4GA 2I07B 1AE3A 1IYUA 1OXVA 1CHQD 3K5OA 1YHBA 2RDFA 4YWKA 5H1SE 4DA2A 2MP1A 4YHHL 2FJ2A 2B2VC 2NWGA 2PMZB 2VZAA 1QNKA 1O7LA 2NYZD 3S2DH 4FXDA 4LF7L 4A3EH 2JJQA 3RUZA 4ZK9B 4LF6L 5J39A 1PH1A 1OXXK 4DR6Q 1S4ZA 5J3BA 2L0CA 2DY8A 4LWCA 3RZDH 2UUBQ 4DV6Q 3A5ZB 4A3KB 2CH4W 3EFXD 1ZYRD 2EVBA 4HCEA 1S3OA 3O13A 1R4QB 1PV4A 3HP3A 1SMYD 1SE8A 2XSCA 3S17H 1I5FA 2QF7A 3MEHA 5J22A 1PZID 1VQ7A 3TSSA 2F0DA 3PGZA 1OTCA 1SAPA 1PA6A 4X66Q 2OWOA 1KAAA 1TWAB 1B1ZA 1E1OA 2V1CC 1GUOA 2FXQA 3GTLH 2HIVA 3MXPA 1MSHA 2B39A 3NBHB 3W3AA 4H0LC 3LWEA 4JI8Q 4BBRG 4J15A 1TWHB 2R92H 1MJCA 1ONLA 4DR3Q 2A6HC 5CV7A 1TXYA 3G6EA 3TS0A 4F7XA 2UU9L 2F0PA 2F3VA 5FLXE 5E1FA 3GTMH 3HOYB 1CKOA 4UAIA 1BKBA 1VDZA 1J6QA 1C48A 2Q2HA 4FDBA 1U5KA 3OHXC 1K83B 1Y8OB 4CDDC 3T4AC 4HJ9A 2N49A 1I6HB 4UPAA 4V190 4HJAA 5C4XG 3MA2B 3HOWH 3D4DA 3SXHA 2ZXPA 2J7ZA 3F2BA 1TWFH 2VXWA 1QUQB 3K6OA 5CORA 3HOZG 2NB0A 1OXSC 5DNFA 4B3ML 4O1NA 3S1RH 4LF7Q 3DEOA 1I3QB 2YV5A 3EBEA 3AMUA 2WV6D 4QJFA 1VQ8A 1DCZA 2F4IA 4O42A 5BR8Q 5M5WH 4J1MA 3VR3A 1NUCA 4L8JA 5IYDH 1XNRQ 3G48A 5M3FH 4A4IA 1QNUA 1HNWL 1MHWC 2MFIA 3M4YA 1S72A 2I0QA 3UDFA 3TMEA 1KQSA 4Q5VA 1KNAA 1EY6A 3ULPA 1A2UA 2NVTB 3ERSX 2VL6A 2EJFC 3PUYA 1BCPC 2F0VA 3D6WA 4BXXG 2OQ0A 3SGIA 3W1GA 5JEAG 4P74A 2KUMA 1GJXA 1V43A 3IAYA 3VYRA 2VQEQ 2OQKA 3VA5A 1B44D 1NBWA 3B6YA 4KN7C 4HJ8A 3S1MB 4RKBA 4NXMQ 2Q8RE 1EY0A 3GTKH 3HOWG 2GVAA 3TN2A 5JVH3 4JI0Q 4B3SQ 2D62A 5D14A 4G4KA 5I6WA 3G6JB 3DWAA 4A3CG 1QB5D 2LY7A 2ZXRA 1LT5D 2Y0SG 4EQNA 4ZUIA 1AH9A 2B3GA 2HD3A 5IYDG 4IFDI 3KDFA 4B3MQ 4UP8A 3NEMA 5M3FG 1VQ5A 2F03A 4CBVA 5IGFA 3PMFA 3L3OC 1SE2A 1WVLA 1DM0B 1EWIA 1T5XD 3P20A 2EYJA 1CKNA 3T51B 2BOSA 4DR4L 3M4OB 3W1BA 3PO2B 2ID0A 2K04A 4KTAA 4X3SA 2JA5H 5C0XI 4GKJQ 1Q86C 4XIGS 1JCKB 4PG3A 1VQ9A 4XDXA 4R8IA 2R93B 4X65L 1STAA 4R4IA 1N34Q 2D9UA 3D0FA 1K8GA 5JJKA 4DR5Q 3J80E 1Q90A 4KN4C 2KECA 4DAMA 3JAME 1EIGA 1BDOA 1EIFA 2EXDA 3N52A 4RGTA 4UHVA 2XRSD 2LMCB 4DV7Q 2K52A 2R7ZG 1SE3A 2KJXA 1WTVA 1HJPA 1X6OA 2PI2E 1YI2A 1KC8C 1SJED 4GNXA 1FGBD 1PH3A 4K5XA 1VQKA 3U4ZA 3R8BA 2XNAC 3KF8A 1J9OA 1IBLQ 3NHHA 3RZOB 1IW7C 1EQRA 4UDUC 1PTOD 3S2HB 4FVMA 2B2UA 2UUAQ 1HRJA 2SNMA 3BVGA 3CC7A 4IUPA 5ELEA 2BH2A 4P72A 1R9TH 1DJRD 4MZ9A 2F0IA 2M00A 2K5VA 1FYCA 4BY7B 5HY6A 2RDGA 5LMNQ 1BVSA 1KDCA 2EYOA 5CMDA 4YCWA 5EKLA 2VQFQ 5I2XA 3FKIH 3SE0A 4AQYL 4DR4Q 1XYIA 1XXGA 2B2TA 1ASZA 4RHSA 1A6XA 3MFYA 1GD7A 3EN2A 1SFOB 1EY8A 3J7AF 4ULLA 4XYQA 3SK8A 3PCOB 1F9PA 5KNCA 3RD4A 4X65Q 3CC4A 1D5ZC 2KCNA 3MZ5A 3HEJA 5LHY1 3NBIA 2PCFB 1LT6D 3SR1A 2K1BA 2OT2A 1VMCA 5ELFA 4KKSA 4K5WA 1HTLD 1SN8A 2YYZA 1GM5A 4X62L 2H5XA 2A68C 1CKNB 1LM0A 3J7A5 3SHLA 3PIOA 2RHQB 1CT1D 4JG2A 3K5NA 2Z0SA 3FVQA 3J81E 4A3BH 4WJ3M 1EUJA 1E1TA 2BA1A 3ERQA 5C5LA 1F77A 2ZXOA 1IL2A 2DNCA 3S16H 2L5TA 3MC0B 1Y1VG 4RGNA 1X55A 2F3IA 2YU9B 2PQEA 2EJMA 4IPHA 2K5WA 2DJGC 2E5LL 4JK1C 2E2HB 2EIFA 4POFA 2R7DA 4RCOA 1HA5A 3GD7A 4R4OA 4JI2Q 3FKIG 2NZHA 3I4NB 1CUKA 1N36L 5IGDA 1LTGD 1JWSD 1L2FA 5BN5A 4QIWE 2JA6H 1B3AA 1SNQA 4B3TL 4QL5A 4HIOA 3CCEA 2F0HA 4CKEA 1HZ9A 2NN6I 1PRTB 1DONA 4GNXB 2MGSA 3NTIA 4K6LA 3KF8B 1PRTF 3D3RA 4IJHA 4ZKCB 4JC0A 4L5SA 2LXKA 1V1PA 5I2YA 4DNRB 2DJFC 1G91A 3E5SA 1K73C 3NP8A 4A3MB 3BZCA 1JB7A 1Y8PB 4WRDA 4A3BG 1WCMB 4KHPL 3S1QH 1M1KC 2EJGC 3Q6SA 4GOPA 4BWGB 1QE6A 1D1KA 1CTMA 2NVYH 3OW2A 3S15H 4DR7L 1UWVA 2NVQB 1G6ZA 3KLRA 2VUMB 2PI2A 1MKHA 4CDEC 4JI5L 2QCPX 1JWMD 1QVCA 2L11A 2H1EA 2HHHL 3HOVB 3J80i 3PIP3 2CW0C 2WAQE 5A35A 3ITPA 4LFAL 3JAMi 3OMGA 5IE8A 2B2VA 1RF2D 4B9WA 1PMRA 1GXDC 1PRTD 5IYCH 4PV1C 4GLXA 3J7ZC 4UP7A 2BDNA 4PMBA 3NSWA 1H95A 1A2TA 3C1EA 5EPKA 4Y7NB 3K5MA 1CQFA 3H3VI 1NCVA 4IUUA 3CCSA 4DV4Q 2DGYA 4A3DB 3A5UA 1SYBA 4BY1H 4L5QA 3UDGA 4DV1Q 2K6AA 1M8AA 4C3JB 1ENFA 3IRBA 2JEBI 3TP6A 1YIJA 4A93H 5FLXc 3CCVA 2Z9HA 1F9QA 5EJWA 3NQIA 5M3MH 1BBUA 3A7AB 5T1GA 1VQMA 5LL6X 3HKZB 1Q7YC 5EKIA 1F9SA 4IZ8A 1LTRD 2JSOA 1CA6A 4JI6Q 3OIQA 2A74C 3OOCA 2B29A 1HTPA 2EXZA 3UI2A 4WORA 4A3JH 5CV6A 1D6EC 3QWNA 4B3RL 1X3EA 3RLOA 1FD7D 2HHHQ 4Q0FA 5D3IB 3ICEA 4RFBA 4G7ZC 3ULJA 4MHEA 2Y0SE 1AN8A 3R93A 4ZKBB 2YTVA 1BR9A 4RKLA 3U4VA 1ICFB 4F8MA 2O5IC 3SEBA 1RCVD 3FPPA 2IX3A 5I4DA 1TS4A 2N55A 2ICEC 3GV6A 1CQVA 1LABA 1UE1A 1PH7A 1B50A 3J81i 4KY5A 1PDQA 1EY9A 3BDCA 1I4QA 4BY1G 1HXYD 4XQJA 4LUOA 4H7BA 2RQXA 3PSIA 5C3EB 1JOQA 3N6RA 2VNUD 1LTLA 3CQZH 3PQIA 5JJLA 2JYOA 3J81j 1QJOA 4K2KA 3Q23A 5C44H 1VQPA 5C3XA 2K4KA 3K7AH 2IPKD 2OXPA 3Q22A 3BYYB 2BH8A 4JBJA 1GUSA 3F2DA 5FO8B 4A3GH 4DV3Q 1A3VA 3GTJH 2L4NA 4LFBQ 4OO1G 1TQOA 3STBD 3TEHB 1PVOA 1D1IA 1KRTA 4HN7A 1TWGB 4DR6L 1VQBA 5M5XH 1L1OB 1RD9D 4GN4B 1X9NA 4C3HH 2UUBL 2A6EC 4DV6L 2ENBA 1YJ9A 1BNZA 3EJIA 3K0XA 3DXJC 3V96A 1BQQT 3TP8A 2Q8IB 3WOFA 3RR5A 2IX0A 5CV9A 2ZJQA 1MSGA 4LF4Q 3PIO3 4DV5L 2VW9A 1LTSD 2PPBC 4X66L 5JJIA 1VQOA 2JA9A 2F4VQ 1EU3A 1V8QA 4BA2I 5FO7B 1PZKD 1ENAA 1QCBD 1Y8NB 3I4LA 1JJ2A 3H3VC 1EOTA 2B2WC 1D8LA 2A69D 1HNZQ 4JI8L 2XGTA 2K5QA 2RVLA 5COYA 1HFGA 4DR3L 3HS0C 3HOXH 4UY8C 2MO0A 2G9DA 2FMCA 4HJ7A 2BA0A 4A3GG 4OONA 3J80c 4I7ZC 3SDZA 1IYVA 1WD1A 1IXRA 4C3IB 3JAMc 1RDPD 1V1QA 4C3IG 4JI1Q 3QOJA 1K3RA 2I5LX 3FP9A 5KNBA 2E75C 2HDMA 4C3HG 1T5EA 3I91A 1DGSA 2KBNA 3NK9A 4DAYA 1N32Q 1HQRD 2NVXB 5A2QE 4A3IG 4LF8Q 3NXWA 3UE1A 3KBGA 3I3CA 3C2PA 5CC4A 4JBKA 1K28A 4P2CB 2ICIA 1B7YB 5BR8L 4AH6A 3D31A 3MXNA 5GAEC 1X3QA 1EIHA 4L63B 4LF5Q 2VS1A 1XNRL 2MHVA 3P7JA 2HIXA 5FJ8G 1EEFD 2HDLA 1LT4D 4IPDA 4CJ1B 3S1NB 2ATWA 1PFMA 1PH6A 1QVGA 1ASYA 1TS3A 1EZ6A 3BS1A 4DV2Q 4DV5Q 1I6HH 2DY7A 4A75A 2A6HD 3KLWA 1KL9A 2SEBD 3NPPA 4NB3A 3H0GB 3BU2A 4ZRZA 3H0GG 4BBRB 1PH9A 2JA8G 3FMCA 5G3LF 3EA6A 1UE7A 1K8AC 1SYCA 2BE5D 3ER0A 2VQEL 1KDAA 3DM3A 3TDQA 2ZTDA 3VYTA 4NXML 5KEEA 1ZXTA 3AFPA 3GO5A 3M4QA 4JI0L 4HMJA 4B3SL 1AE2A 2RKSA 4EQ5A 3S2DB 4A3EB 5C4XB 3EVQA 2YTXA 4IUVA 2Q2UA 4A3EG 1DD2A 1EWHA 2WAQB 1ILQA 2F0SA 3HOZB 3GV3A 2WAQG 1C8CA 3GTQH 1WTHA 3KLSX 2Z6BA 1PZJD 3J81c 1B9MA 1LUZA 4FF3A 2ZJPA 2N88A 3L2PA 1TU2B 1M90C 3S17B 2EPBA 4B08A 1MIUA 1VQDA 1JMCA 1A3UA 3DHQA 1N33Q 5EAYA 2EYPA 3KBXA 2JA7H 1GHJA 5G3LD 3QIAA 3GTLB 4EX5A 5IGEA 4GKJL 4GLAC 1ICWA 2EY1A 3KF6A 4K8JA 3DM1A 2R92B 3PF5A 3E3XA 4RH6A 3CCQA 5CGKA 2R92G 2FMMA 1E22A 3NQTA 5E4WC 3GTMB 1N34L 3KYHC 4IPGA 4DR5L 4H02A 4A3FH 3FHWA 1VQHA 1CK1A 4LW1A 2KVMA 1A8VA 1HUMA 3I4MH 3S24A 1YNJC 2I5MX 3AQQA 4R4QA 4C2MH 2UUCQ 3HOWB 4JVZA 1GO3E 1PH8A 3E0JA 4IJLA 1TWFB 3PIPA 3MXNB 4DV7L 3GP7A 1L0XB 1TKWB 2B8GA 3TP5A 1Y1WH 1CZGA 3M4OH 5IGBA 2RBMA 4DXFA 2FINB 3S1RB 3CCJA 1UUPA 1STNA 4DUYQ 4GZYC 5C4JH 1CI3M 3DWQA 4LK1C 2Y0SB 4MN3A 3DEPA 1I50H 1IBLL 3Q24A 1LV9A 4AIMA 4KKTA 3CF5A 4FXKC 3ZYYX 5M5WB 1BF4A 1U9RA 3BZDB 5IT9E 2R93H 2UUAL 2JQOA 1CSPA 4IFDH 3U9OA 1QWYA 5EPLA 5GQOA 5M3FB 2PNHA 1XPRA 1E2VA 2NTTA 5KYIA 2JA7G 3R3OA 3IL8A 4KHZA 5LMNL 1PTOB 2D0PA 2VB3X 1Q8IA 1B8AA 1EQVA 2VQFL 4MTKA 1PTOF 4XXEA 4CKBA 4HIKA 1H9KA 4WFN3 3I55A 2Q2TA 1SROA 5C0XH 3IKJA 2D0OA 4DXGA 3H91A 4EQOA 2B63H 4KMUC 3GTKB 4Y52H 5CV8A 3I56A 3S2HH 2EE1A 1BBWA 3CMEA 2E2IB 1Q81C 1Y1WG 2EY2A 2VB2X 1PYWD 4CHTB 2PZWA 1P16A 1IW7D 5IGGA 2R7ZB 2E8GA 1HNXQ 4RA8A 1XTDA 1CZWA 4KJNA 4TRDA 2WB1E 1AW7A 1NY4A 1JOKA 2XRQD 1EYAA 4KY7A 2IX1A 2MPMA 1QG7A 3OIPA 4M8AA 3KF6B 3GTPH 1NAPA 1HR0W 4RG1A 4IN3A 3P1HA 1F2YA 3TRZA 4BA1I 2XIWA 1F2MA 4JBMA 5TSSA 1K0RA 4JI2L 2XWBB 2ZM6Q 4QQBX 2HT1A 1SDFA 4K0KQ 2JA5B 1OXTA 4ZLTF 1D5MC 3F1ZA 5CR3A 3OMCA 2JA5G 3T1HL 1YZ6A 4P75A 2B63G 1VS0A 3A7LA 1FNUA 1MD2D 3L0OA 1TIID 4ODGA 4OELB 4FYDA 5F2DA 4IFDJ 1AFPA 2MJ8A 2IHFA 2F0EA 2EYMA 3S14H 3A55A 5EGTA 1VCIA 4G7HC 2YU9H 4QF4A 2OTLA 1U4PA 2A68D 4G57A 1EY5A 4KD4A 1WOCA 2RCFA 1S40A 3PUWA 1TWCH 1I4PA 3KDFB 4KKUA 4QUFA 1LTTD 2N78A 3HOUH 3I4NH 2Z4IA 4JI7Q 1Q12A 2C9OA 1LTAD 3PUZA 5C0XJ 4J8QA 4CKCA 2XN9C 1YBYA 2KHJA 1IKLA 4XYOA 2FHTA 1RJTA 3KFUA 2L1BA 1EU4A 4OIJA 1A0IA 2Z8LA 2E2JH 3M3YH 3CCUA 4EQPA 1DOKA 1R9TB 1Y1VB 1XWEA 3GTOH 2F1MA 2K5HA 4DAVA 5JOBA 1I4HA 4YWMA 4TKOB 5M5YB 1W3SA 1D5XC 1II3A 1VF5C
chains in the Genus database with same CATH topology
2V4DA 3FKIB 4LJZC 2WACA 4QB4A 4FF4A 1EY4A 2NZ1D 5D65A 4C1NI 1HFNA 3BVZA 5T1IA 2NN6H 2F0FA 3CRKC 3Q0AA 3SK4A 1RKNA 2AQ2B 1EQTA 5IODA 4PNYA 3DMUA 2I46A 1S5DD 4A3BB 2EY5A 4ABNA 5FO9B 3J7AV 3V2TA 2B2WA 2AWNA 3K57A 3CU7A 1JICA 1Z7TA 2PYKA 2QILA 3HGBA 4DAPA 3L9AX 3MVVA 1W6KA 4XTCS 1BOSA 1LT3D 5A2QL 2NBFA 1S5ED 1TS5A 2JA6B 5CV4A 1YNNC 1DXMA 3QB3A 4DGZA 4KK7A 1DOMA 3GQBA 1JB3A 4KD3A 1U4RA 5IGCA 3VYUA 2IW3A 1FR3A 4NMZA 1KLGD 2M2LA 3WDNA 1WTPA 1CFMA 1U4LA 4M1UB 3I90A 3S1QB 1PFBA 2IL8A 3OW7A 5EKKA 1AZQA 5FLXL 3S15B 4RAUC 4OIKA 1JWUD 4FO2A 2B2YC 1I4RA 4X3TA 1D2BA 2G9HD 3LNNA 1G8ZD 1Z6HA 2IT1A 1PRTC 4QUCA 4ZQ3A 5M9OA 2D2CC 2K5DA 1RHPA 1RTOA 4KY6A 1GUTA 4RHRA 4IALA 1NR4A 1H9SA 1LTID 1BXTA 2B2UC 4B9XA 1G2TA 3OWEB 3OWFA 1V1PB 1V1OA 1ZEQX 1MI2A 4HSVA 4DF7A 3C3LA 1DOLA 4OO1I 2B2TC 1SE4A 4N9PA 4BY1B 2QEJC 2RSOA 2O5JC 5KGUA 1STHA 3BYTB 3FRPB 1TT2A 2KCCA 2WB1B 1DYQA 5CBAE 5M3MB 3BDLA 3OPOA 1GHKA 1F9RA 3EROA 3QO2A 4C56C 2L9HA 2WP8J 4WJWA 4HR7B 1AZPA 3NWSA 1SEBD 4KHVA 3S9WA 1VMPA 4U68A 2HQEA 4HAEA 1ESFA 4FP5D 4CGYB 5NUCA 3DUZA 3T56B 2H4OA 2EZVA 2AQ3B 4LMQD 4ILWA 4E6IA 5D3DA 4ZAIA 4HCSA 3MHBA 3TBIB 3IFDA 2KEEA 1U4MA 4X3KA 2A5HA 3NBHA 1I6VC 3FPUB 4BS9A 3A8IE 3CQZB 2M9VA 1HA6A 2OF1A 2A73B 1Q3LA 1H9MA 1WTWA 1GUWA 4H44C 4L6TB 3ND8A 2B8FA 2EOTA 3I73A 3K7AB 2R61A 1PXUA 2HUGA 5JJZA 3SVMA 4A3GB 3J80L 5JPNC 3C46A 3JAML 2F0OA 5IOCA 4U673 4RGMA 1QILA 1EEID 2J0TD 2KHSA 5M5XB 2CQAA 2KEDA 3A54A 1MBYA 4C3HB 3LX0A 2O4XA 4DFAA 5ELDA 2J4XA 4HTHA 2WIIB 4A3IB 4QIWB 1BO0A 2K33A 2TSSA 1NR2A 4XQQA 5FKAC 2KQ3A 1I4XA 2LFNA 4K2LA 1EL0A 3V05A 2WINB 3W2DA 3PUVA 2Z4HA 3DWPA 1QOHA 1ET6A 3D4RA 2ZT9C 3K59A 1SNPA 2XWJB 1BCPB 4ZYSA 1BBXC 3HOXB 4RWSC 1BCPF 3GTGB 1GUNA 2JA8B 2JE6I 1PLFA 2X69A 2F0JA 3I70A 3MXGA 4K8IA 2K28A 3SK6A 1OO9B 2Q8TA 1JQYD 5JAVA 4OGQC 1ZYRC 4LAAA 1E2ZA 2QKIC 4Z9CB 3E6ZX 2SOBA 1SMYC 1F2LA 4ID6A 1TY0A 5E3FA 1KTKA 3D8GA 3H6MA 2O2LD 4H13C 4FNFA 3RZDB 3J81L 5JEAH 4I65A 2BE5C 4C1NK 1IL8A 3EQLC 1JORA 1F2ZA 3IFTA 4N9TA 4AYBB 4NP5A 5DAUA 1BCPD 2F0QA 2IWHA 4XT1B 1O7ZA 5LL6S 1EYDA 1EY7A 1YNJD 5DM73 2DNEA 3SK5A 5CV5A 2EDGA 1CHPD 3NE5B 4HEDA 2AUJD 4OHJA 1PTOH 3GTQB 1WTXA 2F0MA 2NTSA 1TVXA 1DZ1A 1SJHD 3QJYA 3H94A 2BDOA 2XVSA 3D4WA 4DN4M 2RDHA 3AU7A 3C1FA 3R2IA 3M7NA 1JOOA 1RODA 2JA7B 1AP0A 3A8JE 1ET9A 3TP7A 2IJ0A 5E4XA 1XTCD 3A8KE 5EQ0A 3BDOA 2E2DC 1UNSA 2F3WA 4A3FB 5I9PA 3K58A 2RSNA 5JEAJ 2AWOA 3I4MB 2LKVA 3BG3A 1SYEA 4EVOA 4C2MB 5IIFA 2WKCA 3P75A 5JPMC 3J7YW 2JEAI 2D5DA 1TY2A 1Y1WB 5EBDA 2KA7A 1J8IA 3OSOA 3MAQA 5C4JB 1I50B 4IUNA 4K6DA 3KLSA 5FOBB 1SXTA 4HMIA 3KUPA 2PZTA 2LS01 2FFKB 4IFDG 1ESRA 2C5CA 4ZUJA 2F0KA 5C5MA 5EPJA 1MGSA 1M4VA 1VF7A 2B2YA 1CA5A 1S5BD 4KI0A 2NUCA 2OEOA 5C0XG 4RGOS 3FEWX 3NUCA 5K36H 2B63B 1SBBB 4FF1A 2F0GA 4PMWA 4G7OC 5KIXA 2K03A 2EY6A 3BVMA 3NTHA 1GUGA 1WTRA 2EYFA 2F0UA 2EYHA 1EYCA 3HG9A 5ELBA 1PTOC 5K5PA 2JP1A 1SSOA 3X3NA 1KNEA 3TZUA 2MUYA 3U9SA 4J6HA 1EZ8A 1H9RA 1HCZA 1GOZA 3M7GA 5C3WA 2RA4A 1PFNA 3GTPB 1WD0A 5ELCA 3I8ZA 1NSNS 1WTOA 3D6CA 3LWUA 2QDBA 4KV6A 5K36G 3VR4A 1S5FD 1FNWA 1H9JA 1LO5D 4K5VA 3K5LA 1X3PA 1ZKOA 4DNTB 1SNCA 5CBEE 1JE4A 1UEAB 3S14B 2X6GA 1Z47A 1IHZA 5DM63 1E2WA 4QMGA 1TWCB 5J1ZA 4OL7A 3HOUB 4PMCA 3NTKA 4IUQA 1R4PB 3URYA 4CJ2C 4XQNA 2AUKA 1STGA 1HHVA 1SNOA 1Q1BA 2CVRA 2PW5A 1FNVA 1UAPA 4S3SA 1B4OA 3MXUA 3M3YB 2E2JB 2F0TA 3GTOB 3S16B 2TMPA 1X32A 1YNND 3VA7A 1CM9A 2CW0D 3H09A 4TSSA 2CHBD 2K01A 5I6YA 3ND9A 1B9NA 1E0BA 2X6LA 1W6JA 1O7YA 4PQXA 1K8MA 1O80A 5HURA 3HZXA 3CKIB 1TS2A 3T53B 2BCOA 4HSPA 3M85A 5KYLA 2NN6G 1STEA 4DK1A 3F2UA 4QCLA 4JBWA 5HGTA 2E76C 3PO3B 3TZDA 2R6GA 3MWYW 4F87A 1G2SA 1JR0D 5BN4A 2HCIA 3QOLA 2K7VA 2K05A 2R3ZA 2GA4B 2NVYB 4FF2A 3R2TA 2PO4A 3PV0A 1KABA 1SNDA 3MTSA 3T16A 4ME5A 2SDFA 3ONAB 4IQZA 1STBA 1ENCA 1L0YB 5C4ZA 2PNRC 4X3UA 4C3JG 2F0LA 4NKLA 2F0WA 4DU9A 1A3TA 2PW7A 5KNDA 1EWCA 1Y69U 3L7ZC 4KJOA 4DK0A 4OO1H 5ISRA 3RLFA 4EGVA 3VYSA 5BN3A 2K32A 4R8NA 2SNSA 4YIJA 3VR2A 3CHBD 3VR5A 4MIUA 5KRUA 2DN8A 4A93B 3X3MA 4BBSB 3MFGA 3I72A 2F0NA 1S5CD 4IUTA 3WOEA 5JVG3 5DEHA 3KK7A 1HQMC 1KDBA 5I9OA 4RCNA 1B53A 2A6ED 4A3JB 3NWTA 1HPCA 3VR6A 1Q1EA 1HUNA 1STYA 3PUXA 5FK9C 1LACA 1IKMA 1ML0D 1AEXA 3K0YA 1WTQA 5IT9L 3AB9A 1C4QA 2L55A 5EBCA 3CRLC 4NW2A 4IURA 2EYLA 1JC7A 3A56A 1SYFA 5C6AA 1B2TA 1EFID 1SYDA 1K8OA 4R9WA 3G7LA 2JXMB 3T13A 4V0BA 4XT3B 1XX8A 5C44B 1OXUA 2AQ1B 3HRZC 1TR5A 1O78A 4CJ0B 4NDXA 4TQUS 5CYUA 2KOLA 5C4HA 1A15A 3RMHA 3GTJB 1BUVT 1H9SB 4F88A 1LLRD 3QG1A 1RTNA 2PZUA 1G291 1ILPA 2WKDA 3FDTA 4K14A 1KLUD 2Z1CA 2L12A 1LTBD 1SYGA 4FXGC 5AFWA 2E74C 1SNMA 2A69C 2HCCA 1I4GA 2I07B 1IYUA 1OXVA 1CHQD 3K5OA 2RDFA 4DA2A 2MP1A 2FJ2A 2B2VC 2NWGA 2PMZB 1QNKA 1O7LA 2NYZD 4FXDA 3RUZA 4ZK9B 5J39A 1OXXK 1S4ZA 2L0CA 2DY8A 4A3KB 3EFXD 1ZYRD 2EVBA 4HCEA 3O13A 1R4QB 3HP3A 1SMYD 2XSCA 3MEHA 2QF7A 5J22A 1PZID 3TSSA 2F0DA 1SAPA 1KAAA 1TWAB 1B1ZA 1GUOA 3MXPA 1MSHA 2B39A 3W3AA 4H0LC 3LWEA 1TWHB 1ONLA 2A6HC 5CV7A 4F7XA 2F0PA 2F3VA 5FLXE 5E1FA 3HOYB 4UAIA 1VDZA 1C48A 3OHXC 1K83B 1Y8OB 3T4AC 1I6HB 4V190 3MA2B 3D4DA 3SXHA 2ZXPA 2J7ZA 2VXWA 3K6OA 5CORA 2NB0A 1OXSC 5DNFA 4O1NA 3DEOA 1I3QB 3AMUA 2WV6D 1DCZA 2F4IA 4O42A 4J1MA 3VR3A 1NUCA 4L8JA 1QNUA 3M4YA 3TMEA 4Q5VA 1KNAA 1EY6A 1A2UA 2NVTB 2EJFC 3PUYA 1BCPC 2F0VA 3D6WA 5JEAG 2KUMA 1GJXA 1V43A 3IAYA 3VYRA 3VA5A 1B44D 4KN7C 3S1MB 4RKBA 2Q8RE 1EY0A 3TN2A 5JVH3 2D62A 5D14A 4G4KA 5I6WA 3G6JB 3DWAA 1QB5D 2LY7A 2ZXRA 1LT5D 4EQNA 4ZUIA 4IFDI 2F03A 4CBVA 5IGFA 3PMFA 3L3OC 1SE2A 1WVLA 1DM0B 1T5XD 3P20A 2EYJA 3T51B 2BOSA 3M4OB 3PO2B 2ID0A 2K04A 4KTAA 4X3SA 5C0XI 4XIGS 1JCKB 4XDXA 4R8IA 2R93B 1STAA 2D9UA 3J80E 1Q90A 4KN4C 2KECA 3JAME 1EIGA 1BDOA 3N52A 4RGTA 2XRSD 2LMCB 1SE3A 2KJXA 1WTVA 1SJED 1FGBD 4K5XA 3R8BA 2XNAC 3KF8A 1J9OA 3NHHA 3RZOB 1IW7C 4UDUC 1PTOD 3S2HB 2B2UA 4FVMA 1HRJA 2SNMA 3BVGA 4IUPA 5ELEA 1DJRD 2F0IA 2M00A 1FYCA 4BY7B 2RDGA 1KDCA 2EYOA 5CMDA 5EKLA 5I2XA 3SE0A 1XYIA 1XXGA 2B2TA 4RHSA 1A6XA 3MFYA 1SFOB 1EY8A 3J7AF 4ULLA 4XYQA 3SK8A 1F9PA 5KNCA 3RD4A 1D5ZC 2KCNA 3MZ5A 3HEJA 5LHY1 3NBIA 2PCFB 1LT6D 3SR1A 2K1BA 2OT2A 1VMCA 5ELFA 4KKSA 4K5WA 1HTLD 2YYZA 2A68C 3SHLA 1CT1D 3K5NA 3FVQA 3J81E 2BA1A 3ERQA 5C5LA 1F77A 2ZXOA 2DNCA 2L5TA 3MC0B 4RGNA 2YU9B 2PQEA 2EJMA 2K5WA 4JK1C 2E2HB 4RCOA 1HA5A 3GD7A 3I4NB 5IGDA 1LTGD 1JWSD 5BN5A 1B3AA 1SNQA 2F0HA 4CKEA 2NN6I 1PRTB 1DONA 2MGSA 3NTIA 4K6LA 1PRTF 3D3RA 4ZKCB 1V1PA 5I2YA 4DNRB 1G91A 3E5SA 3NP8A 4A3MB 1Y8PB 4WRDA 1WCMB 2EJGC 3Q6SA 4BWGB 1QE6A 1D1KA 1CTMA 2NVQB 1G6ZA 3KLRA 2VUMB 2QCPX 1JWMD 2L11A 2H1EA 3HOVB 3PIP3 2CW0C 5A35A 3ITPA 3OMGA 2B2VA 1RF2D 4B9WA 1PMRA 1GXDC 1PRTD 4PV1C 2BDNA 4PMBA 3NSWA 1A2TA 3C1EA 5EPKA 4Y7NB 3K5MA 1CQFA 1NCVA 4IUUA 4A3DB 1SYBA 2K6AA 1M8AA 4C3JB 1ENFA 2JEBI 3TP6A 5EJWA 1F9QA 3NQIA 3A7AB 5T1GA 5LL6X 3HKZB 5EKIA 1F9SA 4IZ8A 1LTRD 2JSOA 1CA6A 3OIQA 2A74C 3OOCA 1HTPA 2EXZA 3UI2A 4WORA 5CV6A 1D6EC 3QWNA 1FD7D 4Q0FA 5D3IB 4RFBA 4G7ZC 4MHEA 1AN8A 3R93A 4ZKBB 1BR9A 4RKLA 4F8MA 2O5IC 3SEBA 1RCVD 3FPPA 2IX3A 5I4DA 1TS4A 2N55A 2ICEC 3GV6A 1CQVA 1LABA 1B50A 4KY5A 1PDQA 1EY9A 3BDCA 1I4QA 1HXYD 4XQJA 4H7BA 2RQXA 5C3EB 1JOQA 3N6RA 2VNUD 2JYOA 1QJOA 4K2KA 3Q23A 5C3XA 2IPKD 2OXPA 3Q22A 3BYYB 1GUSA 5FO8B 1A3VA 2L4NA 4OO1G 1TQOA 1D1IA 4HN7A 1TWGB 1RD9D 2A6EC 2ENBA 1BNZA 3EJIA 3DXJC 3V96A 1BQQT 3TP8A 2Q8IB 3WOFA 2IX0A 5CV9A 1MSGA 3PIO3 1LTSD 2PPBC 1EU3A 1V8QA 4BA2I 5FO7B 1PZKD 1ENAA 1QCBD 1Y8NB 3I4LA 3H3VC 1EOTA 2B2WC 2A69D 2K5QA 2RVLA 5COYA 1HFGA 3HS0C 2G9DA 2FMCA 2BA0A 4I7ZC 3SDZA 1IYVA 1WD1A 4C3IB 1RDPD 4C3IG 3QOJA 5KNBA 2E75C 2HDMA 4C3HG 1T5EA 3I91A 3NK9A 4DAYA 2NVXB 1HQRD 5A2QE 3NXWA 3KBGA 3I3CA 3C2PA 5CC4A 4P2CB 2ICIA 3D31A 3MXNA 1X3QA 1EIHA 4L63B 2MHVA 3P7JA 1EEFD 2HDLA 1LT4D 4CJ1B 3S1NB 1PFMA 1TS3A 1EZ6A 3BS1A 2DY7A 2A6HD 2SEBD 3NPPA 3H0GB 4ZRZA 4BBRB 3FMCA 5G3LF 3EA6A 1SYCA 2BE5D 1KDAA 3TDQA 3VYTA 5KEEA 1ZXTA 3GO5A 4HMJA 2RKSA 3S2DB 4A3EB 5C4XB 3EVQA 4IUVA 1DD2A 1EWHA 2WAQB 1ILQA 2F0SA 3HOZB 3GV3A 1C8CA 3KLSX 1PZJD 1B9MA 4FF3A 2N88A 1TU2B 3S17B 2EPBA 4B08A 1A3UA 3DHQA 2EYPA 3KBXA 1GHJA 5G3LD 3QIAA 3GTLB 5IGEA 1ICWA 2EY1A 4K8JA 3DM1A 2R92B 4RH6A 5CGKA 2FMMA 3NQTA 5E4WC 3GTMB 1CK1A 2KVMA 1HUMA 1YNJC 3HOWB 3E0JA 1TWFB 1L0XB 3GP7A 1TKWB 2B8GA 3TP5A 1CZGA 5IGBA 2RBMA 4DXFA 2FINB 3S1RB 1UUPA 1STNA 4GZYC 1CI3M 3DWQA 4LK1C 2Y0SB 4MN3A 3DEPA 3Q24A 1LV9A 4KKTA 4FXKC 3ZYYX 5M5WB 1BF4A 1U9RA 3BZDB 5IT9E 4IFDH 3U9OA 1QWYA 5EPLA 5M3FB 1E2VA 2NTTA 5KYIA 3R3OA 3IL8A 4KHZA 1PTOB 2VB3X 1Q8IA 1EQVA 1PTOF 4XXEA 4CKBA 1H9KA 4WFN3 5C0XH 3IKJA 4DXGA 3H91A 4EQOA 4KMUC 3GTKB 5CV8A 2EE1A 2E2IB 2EY2A 2VB2X 1PYWD 4CHTB 2PZWA 1IW7D 5IGGA 2R7ZB 4RA8A 1CZWA 4KJNA 4TRDA 1AW7A 1JOKA 2XRQD 1EYAA 4KY7A 2IX1A 2MPMA 1QG7A 3OIPA 4M8AA 1NAPA 4IN3A 3P1HA 1F2YA 4BA1I 2XIWA 1F2MA 5TSSA 2XWBB 1SDFA 2JA5B 1OXTA 4ZLTF 1D5MC 5CR3A 3OMCA 3A7LA 1FNUA 1MD2D 1TIID 4ODGA 4FYDA 5F2DA 4IFDJ 1AFPA 2MJ8A 2F0EA 2EYMA 3A55A 5EGTA 1VCIA 4G7HC 4QF4A 1U4PA 2A68D 4G57A 1EY5A 4KD4A 3PUWA 4KKUA 1I4PA 4QUFA 1LTTD 2Z4IA 1Q12A 2C9OA 1LTAD 3PUZA 5C0XJ 4J8QA 4CKCA 2XN9C 1IKLA 4XYOA 2FHTA 1RJTA 2L1BA 1EU4A 4OIJA 2Z8LA 4EQPA 1DOKA 1R9TB 1Y1VB 1XWEA 2F1MA 4DAVA 5JOBA 1I4HA 4TKOB 5M5YB 1D5XC 1II3A 1VF5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EKK A;  3MHB A;  4WOR A;  4J6H A;  1EZ8 A;  3RUZ A;  5KYL A;  2WAC A;  5C3W A;  5CV6 A;  5J39 A;  4QB4 A;  2EY2 A;  5JAV A;  1A3U A;  3DHQ A;  2PZW A;  2SNM A;  4LAA A;  2F3W A;  1EY4 A;  3VA5 A;  2EYP A;  5I9P A;  3E5S A;  2SOB A;  3NP8 A;  5IGG A;  4RKB A;  2F0I A;  2M00 A;  4ID6 A;  5C4H A;  5E3F A;  1EY0 A;  4RKL A;  4WRD A;  1STY A;  5HGT A;  2OF1 A;  3D8G A;  3H6M A;  5IGE A;  1KDC A;  2EYO A;  3QOJ A;  2LKV A;  4KJN A;  1SYE A;  4TRD A;  4EVO A;  4F8M A;  1NSN S;  2EY1 A;  5IIF A;  1AEX A;  1JOK A;  3D6C A;  1EYA A;  4K8J A;  4KY7 A;  5EKL A;  2QDB A;  4ZQ3 A;  2F0F A;  3P75 A;  4I65 A;  5M9O A;  5I6W A;  3MEH A;  5J22 A;  5CGK A;  4KV6 A;  3NQT A;  2F0D A;  3NK9 A;  4KY5 A;  4KY6 A;  2EYL A;  1EY9 A;  3BDC A;  1F2Y A;  3P1H A;  1RKN A;  3QOL A;  4IAL A;  3SK4 A;  3NXW A;  4K5V A;  1F2M A;  1JOR A;  1F2Z A;  3OSO A;  4PNY A;  4N9T A;  4H7B A;  1SYF A;  1KAA A;  3DMU A;  4ZUI A;  4B9X A;  4EQN A;  1EY8 A;  5C6A A;  4NP5 A;  5CC4 A;  5DAU A;  1JOQ A;  3SK8 A;  2F0Q A;  4IUN A;  4K6D A;  3MXP A;  1SNC A;  2F0O A;  4K2K A;  1KAB A;  1SYD A;  5IOC A;  1SND A;  2EY5 A;  3OWF A;  3V2T A;  3T13 A;  3ITP A;  5CR3 A;  3OMC A;  4HMI A;  2KHS A;  4DF7 A;  2PZT A;  5C3X A;  1IHZ A;  2OXP A;  3MZ5 A;  5CV7 A;  3HEJ A;  4ME5 A;  3T16 A;  4F7X A;  2F0P A;  1EYD A;  2F3V A;  3OMG A;  1EY7 A;  3PMF A;  3LX0 A;  5E1F A;  2O4X A;  3TP5 A;  2PYK A;  3SR1 A;  4DFA A;  5IGB A;  1EZ6 A;  2RBM A;  1STB A;  2EYJ A;  4HTH A;  4B9W A;  4E6I A;  1ENC A;  4K5W A;  4QMG A;  5IGF A;  3MVV A;  1STN A;  5J1Z A;  4OL7 A;  5C4Z A;  4N9P A;  1TR5 A;  4ODG A;  2F0L A;  1A3V A;  3TP7 A;  4NDX A;  5F2D A;  3SHL A;  4NKL A;  1TQO A;  4PMC A;  2F0K A;  4ZUJ A;  5C5M A;  3SK5 A;  5KGU A;  2F0W A;  4KTA A;  5IOD A;  2F0E A;  1STG A;  2EYM A;  1STH A;  4PMB A;  3D4D A;  5CV5 A;  4DU9 A;  1A3T A;  1U9R A;  5EGT A;  3SXH A;  1A2T A;  1TT2 A;  2KQ3 A;  1SNO A;  3ERQ A;  2NUC A;  2OEO A;  2PW5 A;  2PW7 A;  1SYC A;  4K2L A;  3C1E A;  4QF4 A;  5C5L A;  3U9O A;  5CV4 A;  4G57 A;  1EY5 A;  4KD4 A;  3BDL A;  1KDA A;  4S3S A;  2PZU A;  3QB3 A;  5KYI A;  2ENB A;  3NUC A;  3R3O A;  4DGZ A;  5KEE A;  2PQE A;  1STA A;  4KJO A;  2F0T A;  3EJI A;  3ERO A;  2F0M A;  4K14 A;  1SYB A;  5ISR A;  3TP8 A;  4KD3 A;  2F0G A;  1SNP A;  1EQV A;  5IGC A;  4HMJ A;  4R8N A;  5CV9 A;  1SYG A;  2SNS A;  2RKS A;  4YIJ A;  3TP6 A;  3D4W A;  4J1M A;  5IGD A;  5KIX A;  1NUC A;  2EY6 A;  3EVQ A;  4MIU A;  4KHV A;  1SNM A;  5KRU A;  3S9W A;  4NMZ A;  5I6Y A;  2F0S A;  2EYF A;  3C1F A;  4EQO A;  4EQP A;  2F0U A;  2HQE A;  1SNQ A;  1JOO A;  2RDF A;  3TME A;  2F0N A;  1ENA A;  2EYH A;  1EYC A;  4IZ8 A;  5HUR A;  1EY6 A;  3HZX A;  5DEH A;  1A2U A;  4K5X A;  5K5P A;  5NUC A;  2F0J A;  5CV8 A;  2F0H A;  4K8I A;  5JOB A;  1KDB A;  5I9O A;  3SK6 A;  2F0V A;  3NHH A;  1II3 A;  2EXZ A; 
#chains in the Genus database with same CATH topology
 2V4D A;  3FKI B;  4DR1 L;  1N8R C;  4LJZ C;  2WAC A;  4QB4 A;  4A3M H;  4FF4 A;  1YJW A;  1EY4 A;  3I7F A;  2NZ1 D;  2Z6K C;  4HJ5 A;  1Q82 C;  1XMQ Q;  5D65 A;  1YJN A;  3T1H Q;  4C1N I;  1HFN A;  3BVZ A;  5T1I A;  3K8A A;  1X65 A;  2NN6 H;  2F0F A;  2NVQ H;  2VUM H;  1KD1 C;  5IYB H;  3CRK C;  3Q0A A;  4LF9 Q;  1XMO L;  1KRS A;  3SK4 A;  4DV4 L;  3CW2 C;  1RKN A;  2AQ2 B;  2K75 A;  2PMZ E;  1EQT A;  4JOI C;  5IOD A;  4PNY A;  4DV1 L;  4DR2 Q;  3DMU A;  2L15 A;  2I46 A;  1VQ6 A;  2OCE A;  3PO3 H;  1S5D D;  1NNX A;  4JPB W;  4A3B B;  2EY5 A;  4YCV A;  4ABN A;  5FO9 B;  3J7A V;  5IP7 H;  5AJ3 Q;  3GDE A;  3V2T A;  2ZTC A;  2B2W A;  4IOA A;  2AWN A;  3K57 A;  3CU7 A;  1JIC A;  3RNU A;  1Z7T A;  2PYK A;  2QIL A;  3HGB A;  4JI6 L;  1GKH A;  4DAP A;  3L9A X;  3MVV A;  2A1A A;  2PQA A;  1W6K A;  4XTC S;  1QVF A;  1GVP A;  1BOS A;  2MNA A;  1IYJ B;  3A74 A;  1LT3 D;  5A2Q L;  2NBF A;  1KIX A;  1PYB A;  1S5E D;  1YVC A;  1TS5 A;  2JA6 B;  5CV4 A;  3RN2 A;  1YNN C;  4A3D H;  1DXM A;  3QB3 A;  1VQI A;  2JA6 G;  4JI4 Q;  4DGZ A;  4LUV A;  4DR1 Q;  4KK7 A;  1K3B C;  1DOM A;  3GQB A;  1JB3 A;  4KD3 A;  1U4R A;  5IGC A;  4O2D A;  1LYL A;  3VYU A;  5IYB G;  2IW3 A;  1FR3 A;  1VQ4 A;  4NMZ A;  1KLG D;  2M2L A;  3U50 C;  4AYB E;  3WDN A;  1WTP A;  1CFM A;  3PO3 G;  3H3V H;  1U4L A;  4M1U B;  3I90 A;  3S1Q B;  1PFB A;  1XMO Q;  2IL8 A;  3OW7 A;  5EKK A;  1SLJ A;  1AZQ A;  3UDI A;  1XNQ L;  3LGJ A;  5FLX L;  4QGU A;  5LMU Q;  3Q8D A;  3S15 B;  4RAU C;  4OIK A;  4BBS H;  4OEM B;  4DV3 L;  2N8N A;  1JWU D;  5IWA L;  4LFB L;  4FO2 A;  2B2Y C;  1I4R A;  4X3T A;  1D2B A;  4JI3 Q;  2G9H D;  3LNN A;  4YY3 Q;  1G8Z D;  1Z6H A;  2IT1 A;  1PRT C;  4APV A;  1HZC A;  4GNX C;  4QUC A;  3JC6 6;  4ZQ3 A;  4DKA C;  5M9O A;  2D2C C;  2K5D A;  1RHP A;  1RTO A;  4KY6 A;  2KCM A;  1GUT A;  2JK8 A;  4IAL A;  4RHR A;  1WFQ A;  1NR4 A;  1H9S A;  1LTI D;  1BXT A;  2B2U C;  3CCL A;  4B9X A;  2CQO A;  1G2T A;  3OWE B;  4LF4 L;  5IYC G;  4GS3 A;  3OWF A;  3RN5 A;  1V1P B;  1V1O A;  1RIP A;  1ZEQ X;  1MI2 A;  4HSV A;  4DF7 A;  4OWW B;  3C3L A;  1E24 A;  2F4V L;  1DOL A;  2AMC B;  1J5E Q;  4OO1 I;  3AYH B;  1HNZ L;  2B2T C;  1SE4 A;  4GLV B;  4GOP B;  4N9P A;  4BY1 B;  3TRE A;  5GRO A;  1TWG H;  2QEJ C;  2RSO A;  2O5J C;  1A62 A;  5KGU A;  1STH A;  3BYT B;  3FRP B;  4ZCK A;  4HIM A;  1TT2 A;  2KCC A;  2WB1 B;  1DYQ A;  4DK6 C;  5CBA E;  4A93 G;  5M3M B;  4BBS G;  3NEN A;  2WB1 G;  3BDL A;  3OPO A;  2QEX A;  1GHK A;  5M3M G;  1F9R A;  3ERO A;  4YCU A;  1HZB A;  4JI1 L;  3PF4 A;  1XNQ Q;  3QO2 A;  4C56 C;  4JV5 Q;  3CXC A;  2L9H A;  4PZ8 A;  2WP8 J;  4WJW A;  4HR7 B;  1AZP A;  2MQH A;  3NWS A;  5IWA Q;  2XTI A;  1SEB D;  4KHV A;  4P73 A;  1SRU A;  1N32 L;  3S9W A;  4LF8 L;  4A3J G;  3CMA A;  1VMP A;  4U68 A;  3TQY A;  2HQE A;  4HAE A;  1ESF A;  4FP5 D;  1PH5 A;  4CGY B;  4LF5 L;  5NUC A;  4JCV E;  3DUZ A;  3T56 B;  5IT9 c;  2H4O A;  4PZ7 A;  2EZV A;  1W2B A;  2AQ3 B;  4LMQ D;  3KOJ A;  4ILW A;  5D3D A;  4E6I A;  1I94 Q;  4ZAI A;  2K50 A;  1HZA A;  3MHB A;  4HCS A;  4A76 A;  2WFW A;  3TBI B;  3CCM A;  3IFD A;  2KEE A;  2DUD A;  1U4M A;  4X3K A;  2A5H A;  3NBH A;  2OTJ A;  4DV2 L;  1I6V C;  3FPU B;  4BS9 A;  3A8I E;  3NEL A;  3CQZ B;  2CKZ B;  2M9V A;  1HA6 A;  2OF1 A;  2A73 B;  3KJO A;  1Q3L A;  1H9M A;  1WTW A;  1GUW A;  4H44 C;  4L6T B;  3ND8 A;  2B8F A;  2EOT A;  5C44 G;  3I73 A;  3K7A B;  2R61 A;  1PH4 A;  1MJE A;  2QGQ A;  1PXU A;  2HUG A;  5JJZ A;  2A19 A;  3SVM A;  4A3G B;  3J80 L;  5JPN C;  3C46 A;  4A3K H;  3JAM L;  3S1N H;  2F0O A;  5IOC A;  3AFQ A;  4U67 3;  4RGM A;  2UXB L;  1QIL A;  1EEI D;  2J0T D;  2KHS A;  5M5X B;  2CQA A;  2KED A;  3A54 A;  4DUZ Q;  1UE6 A;  1MBY A;  4C3H B;  3LX0 A;  2O4X A;  4ME3 A;  4DFA A;  5ELD A;  2J4X A;  4QY7 A;  4HTH A;  4OXP A;  2WII B;  4P71 A;  4A3I B;  1TWA H;  4NXN L;  5L37 A;  4QIW B;  1BO0 A;  5ELO A;  2K33 A;  2TSS A;  1NR2 A;  4XQQ A;  5FKA C;  4OX9 Q;  1TWH H;  2KQ3 A;  1I4X A;  2LFN A;  4K2L A;  1N33 L;  1KHI A;  1EL0 A;  1FJG Q;  3V05 A;  2WIN B;  3W2D A;  3PUV A;  3HOY H;  3E9I A;  2Q2I A;  2Z4H A;  3DWP A;  1QOH A;  1ET6 A;  3D4R A;  2ZT9 C;  4GKK Q;  2GN5 A;  3K59 A;  1C0A A;  1NJI C;  1K83 H;  1SNP A;  5C4X H;  4LFC Q;  2XWJ B;  1BCP B;  5GAH C;  2EQS A;  4ZYS A;  1BBX C;  3HOX B;  4RWS C;  3HOZ H;  1BCP F;  3GTG B;  3HOX G;  1GUN A;  1L1O C;  2JA8 B;  5GAD C;  1HR0 Q;  3UDX A;  2JE6 I;  2N3S A;  1PLF A;  2KHI A;  1VQC A;  4A3K G;  2KEN A;  1I3Q H;  2X69 A;  2P5Z X;  2IY5 B;  2F0J A;  3I70 A;  2UUC L;  3AEV A;  3MXG A;  4K8I A;  2UXD Q;  1Z9F A;  1VQL A;  2K28 A;  3SK6 A;  1OO9 B;  2Q8T A;  4L5R C;  4R4T A;  1JQY D;  3A0J A;  2ZTE A;  5JAV A;  1FL0 A;  1YEZ A;  4OGQ C;  1ZYR C;  5IP9 H;  4LAA A;  4DUY L;  1E2Z A;  2QKI C;  2K14 A;  4Z9C B;  3E6Z X;  2SOB A;  2UXB Q;  1SMY C;  3T1Y Q;  1F2L A;  4JYA Q;  1K0S A;  1X3F A;  4ID6 A;  1TY0 A;  5E3F A;  4X6A H;  3HFZ B;  1KTK A;  3D8G A;  3H6M A;  2O2L D;  2NVT H;  4H13 C;  1VQG A;  4FNF A;  3RZD B;  3J81 L;  1XPO A;  4BXX H;  1PFS A;  1NMG A;  5JEA H;  2ZJR A;  4I65 A;  2UXC Q;  4NXN Q;  3HOY G;  3BJU A;  2BE5 C;  1RL2 A;  1P8L A;  4C1N K;  1WI5 A;  4R4C A;  1IL8 A;  3EQL C;  1JOR A;  1F2Z A;  3IFT A;  3S1M H;  4N9T A;  2GVB A;  4AYB B;  4NP5 A;  5DAU A;  1BCP D;  1KXL A;  2F0Q A;  4PZ6 A;  4AYB G;  2RCN A;  2IWH A;  1IBK L;  1C7Y A;  4XT1 B;  2YTY A;  4YHH Q;  1O7Z A;  5LL6 S;  2A8V A;  4RMF A;  4A3C H;  1EYD A;  1EY7 A;  1V9P A;  1YNJ D;  1PH2 A;  4LF6 Q;  5DM7 3;  2DNE A;  3SK5 A;  5CV5 A;  4DAY B;  2Z6K A;  3UE0 A;  2EDG A;  1IZ6 A;  3M9B A;  1CHP D;  3NE5 B;  5IP9 G;  1IBM L;  1Q46 A;  4HED A;  5DLQ E;  2AUJ D;  4OHJ A;  1PTO H;  1HNX L;  3GTQ B;  1WTX A;  2F0M A;  1NMF A;  2NTS A;  1TVX A;  3PO2 H;  1DZ1 A;  1SJH D;  3QJY A;  3H94 A;  3F8T A;  4JOI A;  2BDO A;  2XVS A;  3D4W A;  4DN4 M;  2CH4 A;  2RDH A;  3AU7 A;  3C1F A;  2UU9 Q;  3R2I A;  3M7N A;  1JOO A;  3M4P A;  1ROD A;  2JA7 B;  2ZM6 L;  1YNX A;  1B70 B;  1K9M C;  3E0E A;  2E2I H;  4K0K L;  1AP0 A;  3A8J E;  1ET9 A;  2IJ0 A;  3TP7 A;  5E4X A;  1XTC D;  3A8K E;  5EQ0 A;  2R7Z H;  2QW7 A;  3BDO A;  2E2D C;  1UNS A;  2F3W A;  4A3F B;  1IBK Q;  5I9P A;  3K58 A;  4A3F G;  2RSN A;  5JEA J;  2AWO A;  3I4M B;  2LKV A;  3BG3 A;  1SYE A;  3HKZ E;  4EVO A;  4C2M B;  5IIF A;  3I4M G;  2WKC A;  3RZO H;  3P75 A;  5JPM C;  3J7Y W;  4POG A;  2JEA I;  2D5D A;  1TY2 A;  1Y1W B;  4JW0 A;  1VQA A;  5EBD A;  3VDY A;  2KA7 A;  1J8I A;  3OSO A;  4JI7 L;  1HNW Q;  3MAQ A;  3PO2 G;  5C4J B;  1IBM Q;  4BY7 H;  1I50 B;  4IUN A;  4K6D A;  1O7I A;  3KLS A;  5FOB B;  3BZK A;  4DK3 C;  3I4O A;  4O0A A;  1SXT A;  1WJJ A;  4A3L H;  4HMI A;  3KUP A;  2PZT A;  1CKM A;  2R93 G;  1SMX A;  2FFK B;  2LS0 1;  4IFD G;  3CD6 A;  1YHQ A;  4I7A A;  1YHA A;  1ESR A;  1VQN A;  4IO9 A;  1SFO H;  2F52 A;  2C5C A;  4ZUJ A;  2F0K A;  5C5M A;  5EPJ A;  1MGS A;  1M4V A;  1N9W A;  1VF7 A;  2B2Y A;  1CA5 A;  1S5B D;  4KI0 A;  2I5H A;  2NUC A;  2OEO A;  1EFW A;  1A63 A;  2JN4 A;  4RGO S;  5C0X G;  3FEW X;  3NUC A;  5K36 H;  2B63 B;  1XMQ L;  1SBB B;  4FF1 A;  2F0G A;  4PMW A;  3DLL A;  4CDC C;  4G7O C;  5KIX A;  2K03 A;  2EY6 A;  3BVM A;  3NTH A;  4LF9 L;  4DV0 L;  1GUG A;  1Y1V H;  1WTR A;  1B3Q A;  2EYF A;  3I2Z A;  4DR2 L;  2F0U A;  2IHE A;  4BY7 G;  2EYH A;  1EYC A;  3HG9 A;  5M5Y H;  5ELB A;  1PTO C;  5K5P A;  1VQE A;  5AJ3 L;  2E2H H;  3HKS A;  2JP1 A;  4A3L G;  1SSO A;  2KCT A;  1YIT A;  3X3N A;  4DNI A;  1KNE A;  3TZU A;  2MUY A;  3QR8 A;  3U9S A;  4J6H A;  1EZ8 A;  1H9R A;  1HCZ A;  1GOZ A;  3M7G A;  5C3W A;  2RA4 A;  1PFN A;  1X3G A;  4L5T A;  1EYG A;  3GTP B;  4WJ4 A;  1WD0 A;  5ELC A;  5FLM H;  3CPW A;  3F2C A;  3CPF A;  1XJV A;  3I8Z A;  4MTN A;  1NSN S;  1WTO A;  1CSQ A;  3D6C A;  3LWU A;  2QDB A;  1G51 A;  2NZO A;  4KV6 A;  4JI4 L;  5K36 G;  3VR4 A;  1S5F D;  1E3P A;  1FNW A;  1H9J A;  1LO5 D;  1Q8K A;  2AHO B;  4K5V A;  3CC2 A;  3K5L A;  1VQF A;  1X3P A;  1ZKO A;  4DNT B;  1WCM H;  1SNC A;  5CBE E;  3U58 A;  1JE4 A;  1UEA B;  3S14 B;  1PYS B;  2X6G A;  2HQL A;  1JJG A;  1Z47 A;  1IHZ A;  4MNO A;  3ZJY C;  3ULL A;  5DM6 3;  1E2W A;  4QMG A;  1TWC B;  5J1Z A;  4OL7 A;  3HOU B;  4DV0 Q;  1PHJ A;  3K80 C;  3HOU G;  3I4N G;  4PMC A;  3NTK A;  4IUQ A;  1R4P B;  2VY3 A;  3URY A;  4CJ2 C;  2AUK A;  4XQN A;  3HOV H;  1STG A;  2K5N A;  1HHV A;  1SNO A;  1Q1B A;  5LMU L;  2CVR A;  2PW5 A;  1FNV A;  1UAP A;  4S3S A;  1B4O A;  3MXU A;  4AQY Q;  3M3Y B;  2E2J B;  3CAM A;  3E9H A;  5FLM G;  4JI3 L;  2F0T A;  2R7F A;  4YY3 L;  3GTO B;  3S16 B;  2TMP A;  1X32 A;  1YNN D;  3VA7 A;  1CM9 A;  2ASB A;  2CW0 D;  4N8F A;  3MEF A;  3H09 A;  4TSS A;  2QA4 A;  2CHB D;  2K01 A;  5I6Y A;  3ND9 A;  1B9N A;  1E0B A;  4Y7N H;  2X6L A;  1W6J A;  1UEB A;  4A3M G;  1U0L A;  1O7Y A;  4PQX A;  1K8M A;  1WCM G;  1O80 A;  5HUR A;  1JJC B;  3HZX A;  2C35 B;  4X62 Q;  3CKI B;  1TS2 A;  3T53 B;  2BCO A;  4C3J H;  4HSP A;  3M85 A;  1EOV A;  5KYL A;  1J5E L;  2NN6 G;  4UP9 A;  1STE A;  2VUM G;  4DK1 A;  4KLK A;  3F2U A;  4QCL A;  2CCZ A;  5ELN A;  4JBW A;  1UE5 A;  5HGT A;  4X64 L;  3HOV G;  2E76 C;  3PO3 B;  3TZD A;  2R6G A;  2E5L Q;  3MWY W;  4OWT B;  5IP7 G;  4F87 A;  1N36 Q;  1G2S A;  1JR0 D;  5BN4 A;  2HCI A;  3QOL A;  2K7V A;  2K05 A;  2R3Z A;  2GA4 B;  1EIY B;  2NVY B;  4JV5 L;  1L1O A;  4FF2 A;  3R2T A;  4B3T Q;  2PO4 A;  3PV0 A;  1KAB A;  3RLN A;  1SND A;  1XPU A;  3K7U C;  1QZH A;  3MTS A;  3T16 A;  1KAW A;  4ME5 A;  5HGQ A;  2CFM A;  2SDF A;  3ONA B;  1WYD A;  4IQZ A;  3H15 A;  1STB A;  4A3D G;  1ENC A;  1L0Y B;  5C4Z A;  2PNR C;  4X3U A;  5E7N A;  5C3E H;  4C3J G;  2F0L A;  1NE3 A;  4YWL A;  1QZG A;  4NKL A;  5LMN W;  1I94 L;  2F0W A;  4R1J A;  4KHP Q;  4DU9 A;  1A3T A;  4IOC A;  3OYY A;  2CWP A;  2PW7 A;  4CDF C;  5KND A;  4ALP A;  3HKZ G;  1EWC A;  1Y69 U;  5GAG C;  1C9O A;  1FGU A;  2ALY B;  3EIV A;  3L7Z C;  4KJO A;  4DK0 A;  4DR7 Q;  5IY0 A;  4OO1 H;  5ISR A;  3RLF A;  1FVI A;  1VQJ A;  4EGV A;  3VYS A;  4DPG A;  5BN3 A;  3KJP A;  1EQQ A;  2K32 A;  4R8N A;  4JI5 Q;  2SNS A;  4YIJ A;  3VR2 A;  3CHB D;  2CWA A;  3VR5 A;  4MIU A;  1HH2 P;  2DN8 A;  5KRU A;  4X64 Q;  2PQA B;  4A93 B;  3K81 C;  4LFA Q;  3X3M A;  4BBS B;  4N8X 1;  3MFG A;  3I72 A;  2F0N A;  1S5C D;  4IUT A;  2MO1 A;  4OWX B;  3WOE A;  5JVG 3;  5DEH A;  3KK7 A;  1HQM C;  1KDB A;  5I9O A;  4DUZ L;  4RCN A;  1B53 A;  2RHS B;  3OTO L;  2ES2 A;  2A6E D;  1D7Q A;  1X54 A;  4A3J B;  2LXJ A;  3NWT A;  2RF4 A;  1T9H A;  3CP0 A;  5C3E G;  3W5O A;  1HPC A;  3VR6 A;  1Q1E A;  1HUN A;  1JE5 A;  1STY A;  3PUX A;  5FK9 C;  1LAC A;  1NTG A;  1IKM A;  4OX9 L;  1ML0 D;  1G6P A;  1AEX A;  3K0Y A;  1WTQ A;  5IT9 L;  1FJG L;  3AB9 A;  1C4Q A;  2L55 A;  5EBC A;  3CRL C;  4NW2 A;  4GKK L;  4IUR A;  2EYL A;  1L0W A;  1JC7 A;  3A56 A;  1SYF A;  4C3I H;  5C6A A;  4GN3 B;  4TVA B;  4LFC L;  1B2T A;  1EFI D;  4HID A;  1SR3 A;  1SYD A;  4LNQ A;  1K8O A;  4R9W A;  3G7L A;  2JXM B;  2QDL A;  3T13 A;  1HR0 L;  4V0B A;  4XT3 B;  1XX8 A;  2AKW B;  4NPS A;  5C44 B;  4A3I H;  3STB C;  1OXU A;  2NVX H;  1JT8 A;  4B3R Q;  2AQ1 B;  1X56 A;  3HRZ C;  1Y14 B;  3G4S A;  1TR5 A;  4GN5 A;  2UXD L;  1O78 A;  4CJ0 B;  4NDX A;  4TQU S;  5CYU A;  1QUQ A;  2KOL A;  5FJ8 H;  5C4H A;  1A15 A;  3RMH A;  3GTJ B;  1BUV T;  2LSS A;  1H9S B;  4LUZ A;  4F88 A;  4IPC A;  1LLR D;  3QG1 A;  1RTN A;  2PZU A;  1G29 1;  3T1Y L;  4JYA L;  1E7Z A;  3WWV A;  1ILP A;  2G5D A;  2WKD A;  3FDT A;  4K14 A;  1KLU D;  3OTO Q;  4GOP C;  2Z1C A;  2L12 A;  1LTB D;  3GTG H;  1SYG A;  3H0G H;  4FXG C;  2JA8 H;  3TS2 A;  5AFW A;  2E74 C;  2UXC L;  4BBR H;  3G71 A;  1SNM A;  3CCR A;  2A69 C;  2HCC A;  1I4G A;  2I07 B;  1AE3 A;  1IYU A;  1OXV A;  1CHQ D;  3K5O A;  1YHB A;  2RDF A;  4YWK A;  5H1S E;  4DA2 A;  2MP1 A;  4YHH L;  2FJ2 A;  2B2V C;  2NWG A;  2PMZ B;  2VZA A;  1QNK A;  1O7L A;  2NYZ D;  3S2D H;  4FXD A;  4LF7 L;  4A3E H;  2JJQ A;  3RUZ A;  4ZK9 B;  4LF6 L;  5J39 A;  1PH1 A;  1OXX K;  4DR6 Q;  1S4Z A;  5J3B A;  2L0C A;  2DY8 A;  4LWC A;  3RZD H;  2UUB Q;  4DV6 Q;  3A5Z B;  4A3K B;  2CH4 W;  3EFX D;  1ZYR D;  2EVB A;  4HCE A;  1S3O A;  3O13 A;  1R4Q B;  1PV4 A;  3HP3 A;  1SMY D;  1SE8 A;  2XSC A;  3S17 H;  1I5F A;  2QF7 A;  3MEH A;  5J22 A;  1PZI D;  1VQ7 A;  3TSS A;  2F0D A;  3PGZ A;  1OTC A;  1SAP A;  1PA6 A;  4X66 Q;  2OWO A;  1KAA A;  1TWA B;  1B1Z A;  1E1O A;  2V1C C;  1GUO A;  2FXQ A;  3GTL H;  2HIV A;  3MXP A;  1MSH A;  2B39 A;  3NBH B;  3W3A A;  4H0L C;  3LWE A;  4JI8 Q;  4BBR G;  4J15 A;  1TWH B;  2R92 H;  1MJC A;  1ONL A;  4DR3 Q;  2A6H C;  5CV7 A;  1TXY A;  3G6E A;  3TS0 A;  4F7X A;  2UU9 L;  2F0P A;  2F3V A;  5FLX E;  5E1F A;  3GTM H;  3HOY B;  1CKO A;  4UAI A;  1BKB A;  1VDZ A;  1J6Q A;  1C48 A;  2Q2H A;  4FDB A;  1U5K A;  3OHX C;  1K83 B;  1Y8O B;  4CDD C;  3T4A C;  4HJ9 A;  2N49 A;  1I6H B;  4UPA A;  4V19 0;  4HJA A;  5C4X G;  3MA2 B;  3HOW H;  3D4D A;  3SXH A;  2ZXP A;  2J7Z A;  3F2B A;  1TWF H;  2VXW A;  1QUQ B;  3K6O A;  5COR A;  3HOZ G;  2NB0 A;  1OXS C;  5DNF A;  4B3M L;  4O1N A;  3S1R H;  4LF7 Q;  3DEO A;  1I3Q B;  2YV5 A;  3EBE A;  3AMU A;  2WV6 D;  4QJF A;  1VQ8 A;  1DCZ A;  2F4I A;  4O42 A;  5BR8 Q;  5M5W H;  4J1M A;  3VR3 A;  1NUC A;  4L8J A;  5IYD H;  1XNR Q;  3G48 A;  5M3F H;  4A4I A;  1QNU A;  1HNW L;  1MHW C;  2MFI A;  3M4Y A;  1S72 A;  2I0Q A;  3UDF A;  3TME A;  1KQS A;  4Q5V A;  1KNA A;  1EY6 A;  3ULP A;  1A2U A;  2NVT B;  3ERS X;  2VL6 A;  2EJF C;  3PUY A;  1BCP C;  2F0V A;  3D6W A;  4BXX G;  2OQ0 A;  3SGI A;  3W1G A;  5JEA G;  4P74 A;  2KUM A;  1GJX A;  1V43 A;  3IAY A;  3VYR A;  2VQE Q;  2OQK A;  3VA5 A;  1B44 D;  1NBW A;  3B6Y A;  4KN7 C;  4HJ8 A;  3S1M B;  4RKB A;  4NXM Q;  2Q8R E;  1EY0 A;  3GTK H;  3HOW G;  2GVA A;  3TN2 A;  5JVH 3;  4JI0 Q;  4B3S Q;  2D62 A;  5D14 A;  4G4K A;  5I6W A;  3G6J B;  3DWA A;  4A3C G;  1QB5 D;  2LY7 A;  2ZXR A;  1LT5 D;  2Y0S G;  4EQN A;  4ZUI A;  1AH9 A;  2B3G A;  2HD3 A;  5IYD G;  4IFD I;  3KDF A;  4B3M Q;  4UP8 A;  3NEM A;  5M3F G;  1VQ5 A;  2F03 A;  4CBV A;  5IGF A;  3PMF A;  3L3O C;  1SE2 A;  1WVL A;  1DM0 B;  1EWI A;  1T5X D;  3P20 A;  2EYJ A;  1CKN A;  3T51 B;  2BOS A;  4DR4 L;  3M4O B;  3W1B A;  3PO2 B;  2ID0 A;  2K04 A;  4KTA A;  4X3S A;  2JA5 H;  5C0X I;  4GKJ Q;  1Q86 C;  4XIG S;  1JCK B;  4PG3 A;  1VQ9 A;  4XDX A;  4R8I A;  2R93 B;  4X65 L;  1STA A;  4R4I A;  1N34 Q;  2D9U A;  3D0F A;  1K8G A;  5JJK A;  4DR5 Q;  3J80 E;  1Q90 A;  4KN4 C;  2KEC A;  4DAM A;  3JAM E;  1EIG A;  1BDO A;  1EIF A;  2EXD A;  3N52 A;  4RGT A;  4UHV A;  2XRS D;  2LMC B;  4DV7 Q;  2K52 A;  2R7Z G;  1SE3 A;  2KJX A;  1WTV A;  1HJP A;  1X6O A;  2PI2 E;  1YI2 A;  1KC8 C;  1SJE D;  4GNX A;  1FGB D;  1PH3 A;  4K5X A;  1VQK A;  3U4Z A;  3R8B A;  2XNA C;  3KF8 A;  1J9O A;  1IBL Q;  3NHH A;  3RZO B;  1IW7 C;  1EQR A;  4UDU C;  1PTO D;  3S2H B;  4FVM A;  2B2U A;  2UUA Q;  1HRJ A;  2SNM A;  3BVG A;  3CC7 A;  4IUP A;  5ELE A;  2BH2 A;  4P72 A;  1R9T H;  1DJR D;  4MZ9 A;  2F0I A;  2M00 A;  2K5V A;  1FYC A;  4BY7 B;  5HY6 A;  2RDG A;  5LMN Q;  1BVS A;  1KDC A;  2EYO A;  5CMD A;  4YCW A;  5EKL A;  2VQF Q;  5I2X A;  3FKI H;  3SE0 A;  4AQY L;  4DR4 Q;  1XYI A;  1XXG A;  2B2T A;  1ASZ A;  4RHS A;  1A6X A;  3MFY A;  1GD7 A;  3EN2 A;  1SFO B;  1EY8 A;  3J7A F;  4ULL A;  4XYQ A;  3SK8 A;  3PCO B;  1F9P A;  5KNC A;  3RD4 A;  4X65 Q;  3CC4 A;  1D5Z C;  2KCN A;  3MZ5 A;  3HEJ A;  5LHY 1;  3NBI A;  2PCF B;  1LT6 D;  3SR1 A;  2K1B A;  2OT2 A;  1VMC A;  5ELF A;  4KKS A;  4K5W A;  1HTL D;  1SN8 A;  2YYZ A;  1GM5 A;  4X62 L;  2H5X A;  2A68 C;  1CKN B;  1LM0 A;  3J7A 5;  3SHL A;  3PIO A;  2RHQ B;  1CT1 D;  4JG2 A;  3K5N A;  2Z0S A;  3FVQ A;  3J81 E;  4A3B H;  4WJ3 M;  1EUJ A;  1E1T A;  2BA1 A;  3ERQ A;  5C5L A;  1F77 A;  2ZXO A;  1IL2 A;  2DNC A;  3S16 H;  2L5T A;  3MC0 B;  1Y1V G;  4RGN A;  1X55 A;  2F3I A;  2YU9 B;  2PQE A;  2EJM A;  4IPH A;  2K5W A;  2DJG C;  2E5L L;  4JK1 C;  2E2H B;  2EIF A;  4POF A;  2R7D A;  4RCO A;  1HA5 A;  3GD7 A;  4R4O A;  4JI2 Q;  3FKI G;  2NZH A;  3I4N B;  1CUK A;  1N36 L;  5IGD A;  1LTG D;  1JWS D;  1L2F A;  5BN5 A;  4QIW E;  2JA6 H;  1B3A A;  1SNQ A;  4B3T L;  4QL5 A;  4HIO A;  3CCE A;  2F0H A;  4CKE A;  1HZ9 A;  2NN6 I;  1PRT B;  1DON A;  4GNX B;  2MGS A;  3NTI A;  4K6L A;  3KF8 B;  1PRT F;  3D3R A;  4IJH A;  4ZKC B;  4JC0 A;  4L5S A;  2LXK A;  1V1P A;  5I2Y A;  4DNR B;  2DJF C;  1G91 A;  3E5S A;  1K73 C;  3NP8 A;  4A3M B;  3BZC A;  1JB7 A;  1Y8P B;  4WRD A;  4A3B G;  1WCM B;  4KHP L;  3S1Q H;  1M1K C;  2EJG C;  3Q6S A;  4GOP A;  4BWG B;  1QE6 A;  1D1K A;  1CTM A;  2NVY H;  3OW2 A;  3S15 H;  4DR7 L;  1UWV A;  2NVQ B;  1G6Z A;  3KLR A;  2VUM B;  2PI2 A;  1MKH A;  4CDE C;  4JI5 L;  2QCP X;  1JWM D;  1QVC A;  2L11 A;  2H1E A;  2HHH L;  3HOV B;  3J80 i;  3PIP 3;  2CW0 C;  2WAQ E;  5A35 A;  3ITP A;  4LFA L;  3JAM i;  3OMG A;  5IE8 A;  2B2V A;  1RF2 D;  4B9W A;  1PMR A;  1GXD C;  1PRT D;  5IYC H;  4PV1 C;  4GLX A;  3J7Z C;  4UP7 A;  2BDN A;  4PMB A;  3NSW A;  1H95 A;  1A2T A;  3C1E A;  5EPK A;  4Y7N B;  3K5M A;  1CQF A;  3H3V I;  1NCV A;  4IUU A;  3CCS A;  4DV4 Q;  2DGY A;  4A3D B;  3A5U A;  1SYB A;  4BY1 H;  4L5Q A;  3UDG A;  4DV1 Q;  2K6A A;  1M8A A;  4C3J B;  1ENF A;  3IRB A;  2JEB I;  3TP6 A;  1YIJ A;  4A93 H;  5FLX c;  3CCV A;  2Z9H A;  1F9Q A;  5EJW A;  3NQI A;  5M3M H;  1BBU A;  3A7A B;  5T1G A;  1VQM A;  5LL6 X;  3HKZ B;  1Q7Y C;  5EKI A;  1F9S A;  4IZ8 A;  1LTR D;  2JSO A;  1CA6 A;  4JI6 Q;  3OIQ A;  2A74 C;  3OOC A;  2B29 A;  1HTP A;  2EXZ A;  3UI2 A;  4WOR A;  4A3J H;  5CV6 A;  1D6E C;  3QWN A;  4B3R L;  1X3E A;  3RLO A;  1FD7 D;  2HHH Q;  4Q0F A;  5D3I B;  3ICE A;  4RFB A;  4G7Z C;  3ULJ A;  4MHE A;  2Y0S E;  1AN8 A;  3R93 A;  4ZKB B;  2YTV A;  1BR9 A;  4RKL A;  3U4V A;  1ICF B;  4F8M A;  2O5I C;  3SEB A;  1RCV D;  3FPP A;  2IX3 A;  5I4D A;  1TS4 A;  2N55 A;  2ICE C;  3GV6 A;  1CQV A;  1LAB A;  1UE1 A;  1PH7 A;  1B50 A;  3J81 i;  4KY5 A;  1PDQ A;  1EY9 A;  3BDC A;  1I4Q A;  4BY1 G;  1HXY D;  4XQJ A;  4LUO A;  4H7B A;  2RQX A;  3PSI A;  5C3E B;  1JOQ A;  3N6R A;  2VNU D;  1LTL A;  3CQZ H;  3PQI A;  5JJL A;  2JYO A;  3J81 j;  1QJO A;  4K2K A;  3Q23 A;  5C44 H;  1VQP A;  5C3X A;  2K4K A;  3K7A H;  2IPK D;  2OXP A;  3Q22 A;  3BYY B;  2BH8 A;  4JBJ A;  1GUS A;  3F2D A;  5FO8 B;  4A3G H;  4DV3 Q;  1A3V A;  3GTJ H;  2L4N A;  4LFB Q;  4OO1 G;  1TQO A;  3STB D;  3TEH B;  1PVO A;  1D1I A;  1KRT A;  4HN7 A;  1TWG B;  4DR6 L;  1VQB A;  5M5X H;  1L1O B;  1RD9 D;  4GN4 B;  1X9N A;  4C3H H;  2UUB L;  2A6E C;  4DV6 L;  2ENB A;  1YJ9 A;  1BNZ A;  3EJI A;  3K0X A;  3DXJ C;  3V96 A;  1BQQ T;  3TP8 A;  2Q8I B;  3WOF A;  3RR5 A;  2IX0 A;  5CV9 A;  2ZJQ A;  1MSG A;  4LF4 Q;  3PIO 3;  4DV5 L;  2VW9 A;  1LTS D;  2PPB C;  4X66 L;  5JJI A;  1VQO A;  2JA9 A;  2F4V Q;  1EU3 A;  1V8Q A;  4BA2 I;  5FO7 B;  1PZK D;  1ENA A;  1QCB D;  1Y8N B;  3I4L A;  1JJ2 A;  3H3V C;  1EOT A;  2B2W C;  1D8L A;  2A69 D;  1HNZ Q;  4JI8 L;  2XGT A;  2K5Q A;  2RVL A;  5COY A;  1HFG A;  4DR3 L;  3HS0 C;  3HOX H;  4UY8 C;  2MO0 A;  2G9D A;  2FMC A;  4HJ7 A;  2BA0 A;  4A3G G;  4OON A;  3J80 c;  4I7Z C;  3SDZ A;  1IYV A;  1WD1 A;  1IXR A;  4C3I B;  3JAM c;  1RDP D;  1V1Q A;  4C3I G;  4JI1 Q;  3QOJ A;  1K3R A;  2I5L X;  3FP9 A;  5KNB A;  2E75 C;  2HDM A;  4C3H G;  1T5E A;  3I91 A;  1DGS A;  2KBN A;  3NK9 A;  4DAY A;  1N32 Q;  1HQR D;  2NVX B;  5A2Q E;  4A3I G;  4LF8 Q;  3NXW A;  3UE1 A;  3KBG A;  3I3C A;  3C2P A;  5CC4 A;  4JBK A;  1K28 A;  4P2C B;  2ICI A;  1B7Y B;  5BR8 L;  4AH6 A;  3D31 A;  3MXN A;  5GAE C;  1X3Q A;  1EIH A;  4L63 B;  4LF5 Q;  2VS1 A;  1XNR L;  2MHV A;  3P7J A;  2HIX A;  5FJ8 G;  1EEF D;  2HDL A;  1LT4 D;  4IPD A;  4CJ1 B;  3S1N B;  2ATW A;  1PFM A;  1PH6 A;  1QVG A;  1ASY A;  1TS3 A;  1EZ6 A;  3BS1 A;  4DV2 Q;  4DV5 Q;  1I6H H;  2DY7 A;  4A75 A;  2A6H D;  3KLW A;  1KL9 A;  2SEB D;  3NPP A;  4NB3 A;  3H0G B;  3BU2 A;  4ZRZ A;  3H0G G;  4BBR B;  1PH9 A;  2JA8 G;  3FMC A;  5G3L F;  3EA6 A;  1UE7 A;  1K8A C;  1SYC A;  2BE5 D;  3ER0 A;  2VQE L;  1KDA A;  3DM3 A;  3TDQ A;  2ZTD A;  3VYT A;  4NXM L;  5KEE A;  1ZXT A;  3AFP A;  3GO5 A;  3M4Q A;  4JI0 L;  4HMJ A;  4B3S L;  1AE2 A;  2RKS A;  4EQ5 A;  3S2D B;  4A3E B;  5C4X B;  3EVQ A;  2YTX A;  4IUV A;  2Q2U A;  4A3E G;  1DD2 A;  1EWH A;  2WAQ B;  1ILQ A;  2F0S A;  3HOZ B;  3GV3 A;  2WAQ G;  1C8C A;  3GTQ H;  1WTH A;  3KLS X;  2Z6B A;  1PZJ D;  3J81 c;  1B9M A;  1LUZ A;  4FF3 A;  2ZJP A;  2N88 A;  3L2P A;  1TU2 B;  1M90 C;  3S17 B;  2EPB A;  4B08 A;  1MIU A;  1VQD A;  1JMC A;  1A3U A;  3DHQ A;  1N33 Q;  5EAY A;  2EYP A;  3KBX A;  2JA7 H;  1GHJ A;  5G3L D;  3QIA A;  3GTL B;  4EX5 A;  5IGE A;  4GKJ L;  4GLA C;  1ICW A;  2EY1 A;  3KF6 A;  4K8J A;  3DM1 A;  2R92 B;  3PF5 A;  3E3X A;  4RH6 A;  3CCQ A;  5CGK A;  2R92 G;  2FMM A;  1E22 A;  3NQT A;  5E4W C;  3GTM B;  1N34 L;  3KYH C;  4IPG A;  4DR5 L;  4H02 A;  4A3F H;  3FHW A;  1VQH A;  1CK1 A;  4LW1 A;  2KVM A;  1A8V A;  1HUM A;  3I4M H;  3S24 A;  1YNJ C;  2I5M X;  3AQQ A;  4R4Q A;  4C2M H;  2UUC Q;  3HOW B;  4JVZ A;  1GO3 E;  1PH8 A;  3E0J A;  4IJL A;  1TWF B;  3PIP A;  3MXN B;  4DV7 L;  3GP7 A;  1L0X B;  1TKW B;  2B8G A;  3TP5 A;  1Y1W H;  1CZG A;  3M4O H;  5IGB A;  2RBM A;  4DXF A;  2FIN B;  3S1R B;  3CCJ A;  1UUP A;  1STN A;  4DUY Q;  4GZY C;  5C4J H;  1CI3 M;  3DWQ A;  4LK1 C;  2Y0S B;  4MN3 A;  3DEP A;  1I50 H;  1IBL L;  3Q24 A;  1LV9 A;  4AIM A;  4KKT A;  3CF5 A;  4FXK C;  3ZYY X;  5M5W B;  1BF4 A;  1U9R A;  3BZD B;  5IT9 E;  2R93 H;  2UUA L;  2JQO A;  1CSP A;  4IFD H;  3U9O A;  1QWY A;  5EPL A;  5GQO A;  5M3F B;  2PNH A;  1XPR A;  1E2V A;  2NTT A;  5KYI A;  2JA7 G;  3R3O A;  3IL8 A;  4KHZ A;  5LMN L;  1PTO B;  2D0P A;  2VB3 X;  1Q8I A;  1B8A A;  1EQV A;  2VQF L;  4MTK A;  1PTO F;  4XXE A;  4CKB A;  4HIK A;  1H9K A;  4WFN 3;  3I55 A;  2Q2T A;  1SRO A;  5C0X H;  3IKJ A;  2D0O A;  4DXG A;  3H91 A;  4EQO A;  2B63 H;  4KMU C;  3GTK B;  4Y52 H;  5CV8 A;  3I56 A;  3S2H H;  2EE1 A;  1BBW A;  3CME A;  2E2I B;  1Q81 C;  1Y1W G;  2EY2 A;  2VB2 X;  1PYW D;  4CHT B;  2PZW A;  1P16 A;  1IW7 D;  5IGG A;  2R7Z B;  2E8G A;  1HNX Q;  4RA8 A;  1XTD A;  1CZW A;  4KJN A;  4TRD A;  2WB1 E;  1AW7 A;  1NY4 A;  1JOK A;  2XRQ D;  1EYA A;  4KY7 A;  2IX1 A;  2MPM A;  1QG7 A;  3OIP A;  4M8A A;  3KF6 B;  3GTP H;  1NAP A;  1HR0 W;  4RG1 A;  4IN3 A;  3P1H A;  1F2Y A;  3TRZ A;  4BA1 I;  2XIW A;  1F2M A;  4JBM A;  5TSS A;  1K0R A;  4JI2 L;  2XWB B;  2ZM6 Q;  4QQB X;  2HT1 A;  1SDF A;  4K0K Q;  2JA5 B;  1OXT A;  4ZLT F;  1D5M C;  3F1Z A;  5CR3 A;  3OMC A;  2JA5 G;  3T1H L;  1YZ6 A;  4P75 A;  2B63 G;  1VS0 A;  3A7L A;  1FNU A;  1MD2 D;  3L0O A;  1TII D;  4ODG A;  4OEL B;  4FYD A;  5F2D A;  4IFD J;  1AFP A;  2MJ8 A;  2IHF A;  2F0E A;  2EYM A;  3S14 H;  3A55 A;  5EGT A;  1VCI A;  4G7H C;  2YU9 H;  4QF4 A;  2OTL A;  1U4P A;  2A68 D;  4G57 A;  1EY5 A;  4KD4 A;  1WOC A;  2RCF A;  1S40 A;  3PUW A;  1TWC H;  1I4P A;  3KDF B;  4KKU A;  4QUF A;  1LTT D;  2N78 A;  3HOU H;  3I4N H;  2Z4I A;  4JI7 Q;  1Q12 A;  2C9O A;  1LTA D;  3PUZ A;  5C0X J;  4J8Q A;  4CKC A;  2XN9 C;  1YBY A;  2KHJ A;  1IKL A;  4XYO A;  2FHT A;  1RJT A;  3KFU A;  2L1B A;  1EU4 A;  4OIJ A;  1A0I A;  2Z8L A;  2E2J H;  3M3Y H;  3CCU A;  4EQP A;  1DOK A;  1R9T B;  1Y1V B;  1XWE A;  3GTO H;  2F1M A;  2K5H A;  4DAV A;  5JOB A;  1I4H A;  4YWM A;  4TKO B;  5M5Y B;  1W3S A;  1D5X C;  1II3 A;  1VF5 C; 
#chains in the Genus database with same CATH homology
 2V4D A;  3FKI B;  4LJZ C;  2WAC A;  4QB4 A;  4FF4 A;  1EY4 A;  2NZ1 D;  5D65 A;  4C1N I;  1HFN A;  3BVZ A;  5T1I A;  2NN6 H;  2F0F A;  3CRK C;  3Q0A A;  3SK4 A;  1RKN A;  2AQ2 B;  1EQT A;  5IOD A;  4PNY A;  3DMU A;  2I46 A;  1S5D D;  4A3B B;  2EY5 A;  4ABN A;  5FO9 B;  3J7A V;  3V2T A;  2B2W A;  2AWN A;  3K57 A;  3CU7 A;  1JIC A;  1Z7T A;  2PYK A;  2QIL A;  3HGB A;  4DAP A;  3L9A X;  3MVV A;  1W6K A;  4XTC S;  1BOS A;  1LT3 D;  5A2Q L;  2NBF A;  1S5E D;  1TS5 A;  2JA6 B;  5CV4 A;  1YNN C;  1DXM A;  3QB3 A;  4DGZ A;  4KK7 A;  1DOM A;  3GQB A;  1JB3 A;  4KD3 A;  1U4R A;  5IGC A;  3VYU A;  2IW3 A;  1FR3 A;  4NMZ A;  1KLG D;  2M2L A;  3WDN A;  1WTP A;  1CFM A;  1U4L A;  4M1U B;  3I90 A;  3S1Q B;  1PFB A;  2IL8 A;  3OW7 A;  5EKK A;  1AZQ A;  5FLX L;  3S15 B;  4RAU C;  4OIK A;  1JWU D;  4FO2 A;  2B2Y C;  1I4R A;  4X3T A;  1D2B A;  2G9H D;  3LNN A;  1G8Z D;  1Z6H A;  2IT1 A;  1PRT C;  4QUC A;  4ZQ3 A;  5M9O A;  2D2C C;  2K5D A;  1RHP A;  1RTO A;  4KY6 A;  1GUT A;  4RHR A;  4IAL A;  1NR4 A;  1H9S A;  1LTI D;  1BXT A;  2B2U C;  4B9X A;  1G2T A;  3OWE B;  3OWF A;  1V1P B;  1V1O A;  1ZEQ X;  1MI2 A;  4HSV A;  4DF7 A;  3C3L A;  1DOL A;  4OO1 I;  2B2T C;  1SE4 A;  4N9P A;  4BY1 B;  2QEJ C;  2RSO A;  2O5J C;  5KGU A;  1STH A;  3BYT B;  3FRP B;  1TT2 A;  2KCC A;  2WB1 B;  1DYQ A;  5CBA E;  5M3M B;  3BDL A;  3OPO A;  1GHK A;  1F9R A;  3ERO A;  3QO2 A;  4C56 C;  2L9H A;  2WP8 J;  4WJW A;  4HR7 B;  1AZP A;  3NWS A;  1SEB D;  4KHV A;  3S9W A;  1VMP A;  4U68 A;  2HQE A;  4HAE A;  1ESF A;  4FP5 D;  4CGY B;  5NUC A;  3DUZ A;  3T56 B;  2H4O A;  2EZV A;  2AQ3 B;  4LMQ D;  4ILW A;  4E6I A;  5D3D A;  4ZAI A;  4HCS A;  3MHB A;  3TBI B;  3IFD A;  2KEE A;  1U4M A;  4X3K A;  2A5H A;  3NBH A;  1I6V C;  3FPU B;  4BS9 A;  3A8I E;  3CQZ B;  2M9V A;  1HA6 A;  2OF1 A;  2A73 B;  1Q3L A;  1H9M A;  1WTW A;  1GUW A;  4H44 C;  4L6T B;  3ND8 A;  2B8F A;  2EOT A;  3I73 A;  3K7A B;  2R61 A;  1PXU A;  2HUG A;  5JJZ A;  3SVM A;  4A3G B;  3J80 L;  5JPN C;  3C46 A;  3JAM L;  2F0O A;  5IOC A;  4U67 3;  4RGM A;  1QIL A;  1EEI D;  2J0T D;  2KHS A;  5M5X B;  2CQA A;  2KED A;  3A54 A;  1MBY A;  4C3H B;  3LX0 A;  2O4X A;  4DFA A;  5ELD A;  2J4X A;  4HTH A;  2WII B;  4A3I B;  4QIW B;  1BO0 A;  2K33 A;  2TSS A;  1NR2 A;  4XQQ A;  5FKA C;  2KQ3 A;  1I4X A;  2LFN A;  4K2L A;  1EL0 A;  3V05 A;  2WIN B;  3W2D A;  3PUV A;  2Z4H A;  3DWP A;  1QOH A;  1ET6 A;  3D4R A;  2ZT9 C;  3K59 A;  1SNP A;  2XWJ B;  1BCP B;  4ZYS A;  1BBX C;  3HOX B;  4RWS C;  1BCP F;  3GTG B;  1GUN A;  2JA8 B;  2JE6 I;  1PLF A;  2X69 A;  2F0J A;  3I70 A;  3MXG A;  4K8I A;  2K28 A;  3SK6 A;  1OO9 B;  2Q8T A;  1JQY D;  5JAV A;  4OGQ C;  1ZYR C;  4LAA A;  1E2Z A;  2QKI C;  4Z9C B;  3E6Z X;  2SOB A;  1SMY C;  1F2L A;  4ID6 A;  1TY0 A;  5E3F A;  1KTK A;  3D8G A;  3H6M A;  2O2L D;  4H13 C;  4FNF A;  3RZD B;  3J81 L;  5JEA H;  4I65 A;  2BE5 C;  4C1N K;  1IL8 A;  3EQL C;  1JOR A;  1F2Z A;  3IFT A;  4N9T A;  4AYB B;  4NP5 A;  5DAU A;  1BCP D;  2F0Q A;  2IWH A;  4XT1 B;  1O7Z A;  5LL6 S;  1EYD A;  1EY7 A;  1YNJ D;  5DM7 3;  2DNE A;  3SK5 A;  5CV5 A;  2EDG A;  1CHP D;  3NE5 B;  4HED A;  2AUJ D;  4OHJ A;  1PTO H;  3GTQ B;  1WTX A;  2F0M A;  2NTS A;  1TVX A;  1DZ1 A;  1SJH D;  3QJY A;  3H94 A;  2BDO A;  2XVS A;  3D4W A;  4DN4 M;  2RDH A;  3AU7 A;  3C1F A;  3R2I A;  3M7N A;  1JOO A;  1ROD A;  2JA7 B;  1AP0 A;  3A8J E;  1ET9 A;  3TP7 A;  2IJ0 A;  5E4X A;  1XTC D;  3A8K E;  5EQ0 A;  3BDO A;  2E2D C;  1UNS A;  2F3W A;  4A3F B;  5I9P A;  3K58 A;  2RSN A;  5JEA J;  2AWO A;  3I4M B;  2LKV A;  3BG3 A;  1SYE A;  4EVO A;  4C2M B;  5IIF A;  2WKC A;  3P75 A;  5JPM C;  3J7Y W;  2JEA I;  2D5D A;  1TY2 A;  1Y1W B;  5EBD A;  2KA7 A;  1J8I A;  3OSO A;  3MAQ A;  5C4J B;  1I50 B;  4IUN A;  4K6D A;  3KLS A;  5FOB B;  1SXT A;  4HMI A;  3KUP A;  2PZT A;  2LS0 1;  2FFK B;  4IFD G;  1ESR A;  2C5C A;  4ZUJ A;  2F0K A;  5C5M A;  5EPJ A;  1MGS A;  1M4V A;  1VF7 A;  2B2Y A;  1CA5 A;  1S5B D;  4KI0 A;  2NUC A;  2OEO A;  5C0X G;  4RGO S;  3FEW X;  3NUC A;  5K36 H;  2B63 B;  1SBB B;  4FF1 A;  2F0G A;  4PMW A;  4G7O C;  5KIX A;  2K03 A;  2EY6 A;  3BVM A;  3NTH A;  1GUG A;  1WTR A;  2EYF A;  2F0U A;  2EYH A;  1EYC A;  3HG9 A;  5ELB A;  1PTO C;  5K5P A;  2JP1 A;  1SSO A;  3X3N A;  1KNE A;  3TZU A;  2MUY A;  3U9S A;  4J6H A;  1EZ8 A;  1H9R A;  1HCZ A;  1GOZ A;  3M7G A;  5C3W A;  2RA4 A;  1PFN A;  3GTP B;  1WD0 A;  5ELC A;  3I8Z A;  1NSN S;  1WTO A;  3D6C A;  3LWU A;  2QDB A;  4KV6 A;  5K36 G;  3VR4 A;  1S5F D;  1FNW A;  1H9J A;  1LO5 D;  4K5V A;  3K5L A;  1X3P A;  1ZKO A;  4DNT B;  1SNC A;  5CBE E;  1JE4 A;  1UEA B;  3S14 B;  2X6G A;  1Z47 A;  1IHZ A;  5DM6 3;  1E2W A;  4QMG A;  1TWC B;  5J1Z A;  4OL7 A;  3HOU B;  4PMC A;  3NTK A;  4IUQ A;  1R4P B;  3URY A;  4CJ2 C;  4XQN A;  2AUK A;  1STG A;  1HHV A;  1SNO A;  1Q1B A;  2CVR A;  2PW5 A;  1FNV A;  1UAP A;  4S3S A;  1B4O A;  3MXU A;  3M3Y B;  2E2J B;  2F0T A;  3GTO B;  3S16 B;  2TMP A;  1X32 A;  1YNN D;  3VA7 A;  1CM9 A;  2CW0 D;  3H09 A;  4TSS A;  2CHB D;  2K01 A;  5I6Y A;  3ND9 A;  1B9N A;  1E0B A;  2X6L A;  1W6J A;  1O7Y A;  4PQX A;  1K8M A;  1O80 A;  5HUR A;  3HZX A;  3CKI B;  1TS2 A;  3T53 B;  2BCO A;  4HSP A;  3M85 A;  5KYL A;  2NN6 G;  1STE A;  4DK1 A;  3F2U A;  4QCL A;  4JBW A;  5HGT A;  2E76 C;  3PO3 B;  3TZD A;  2R6G A;  3MWY W;  4F87 A;  1G2S A;  1JR0 D;  5BN4 A;  2HCI A;  3QOL A;  2K7V A;  2K05 A;  2R3Z A;  2GA4 B;  2NVY B;  4FF2 A;  3R2T A;  2PO4 A;  3PV0 A;  1KAB A;  1SND A;  3MTS A;  3T16 A;  4ME5 A;  2SDF A;  3ONA B;  4IQZ A;  1STB A;  1ENC A;  1L0Y B;  5C4Z A;  2PNR C;  4X3U A;  4C3J G;  2F0L A;  4NKL A;  2F0W A;  4DU9 A;  1A3T A;  2PW7 A;  5KND A;  1EWC A;  1Y69 U;  3L7Z C;  4KJO A;  4DK0 A;  4OO1 H;  5ISR A;  3RLF A;  4EGV A;  3VYS A;  5BN3 A;  2K32 A;  4R8N A;  2SNS A;  4YIJ A;  3VR2 A;  3CHB D;  3VR5 A;  4MIU A;  5KRU A;  2DN8 A;  4A93 B;  3X3M A;  4BBS B;  3MFG A;  3I72 A;  2F0N A;  1S5C D;  4IUT A;  3WOE A;  5JVG 3;  5DEH A;  3KK7 A;  1HQM C;  1KDB A;  5I9O A;  4RCN A;  1B53 A;  2A6E D;  4A3J B;  3NWT A;  1HPC A;  3VR6 A;  1Q1E A;  1HUN A;  1STY A;  3PUX A;  5FK9 C;  1LAC A;  1IKM A;  1ML0 D;  1AEX A;  3K0Y A;  1WTQ A;  5IT9 L;  3AB9 A;  1C4Q A;  2L55 A;  5EBC A;  3CRL C;  4NW2 A;  4IUR A;  2EYL A;  1JC7 A;  3A56 A;  1SYF A;  5C6A A;  1B2T A;  1EFI D;  1SYD A;  1K8O A;  4R9W A;  3G7L A;  2JXM B;  3T13 A;  4V0B A;  4XT3 B;  1XX8 A;  5C44 B;  1OXU A;  2AQ1 B;  3HRZ C;  1TR5 A;  1O78 A;  4CJ0 B;  4NDX A;  4TQU S;  5CYU A;  2KOL A;  5C4H A;  1A15 A;  3RMH A;  3GTJ B;  1BUV T;  1H9S B;  4F88 A;  1LLR D;  3QG1 A;  1RTN A;  2PZU A;  1G29 1;  1ILP A;  2WKD A;  3FDT A;  4K14 A;  1KLU D;  2Z1C A;  2L12 A;  1LTB D;  1SYG A;  4FXG C;  5AFW A;  2E74 C;  1SNM A;  2A69 C;  2HCC A;  1I4G A;  2I07 B;  1IYU A;  1OXV A;  1CHQ D;  3K5O A;  2RDF A;  4DA2 A;  2MP1 A;  2FJ2 A;  2B2V C;  2NWG A;  2PMZ B;  1QNK A;  1O7L A;  2NYZ D;  4FXD A;  3RUZ A;  4ZK9 B;  5J39 A;  1OXX K;  1S4Z A;  2L0C A;  2DY8 A;  4A3K B;  3EFX D;  1ZYR D;  2EVB A;  4HCE A;  3O13 A;  1R4Q B;  3HP3 A;  1SMY D;  2XSC A;  3MEH A;  2QF7 A;  5J22 A;  1PZI D;  3TSS A;  2F0D A;  1SAP A;  1KAA A;  1TWA B;  1B1Z A;  1GUO A;  3MXP A;  1MSH A;  2B39 A;  3W3A A;  4H0L C;  3LWE A;  1TWH B;  1ONL A;  2A6H C;  5CV7 A;  4F7X A;  2F0P A;  2F3V A;  5FLX E;  5E1F A;  3HOY B;  4UAI A;  1VDZ A;  1C48 A;  3OHX C;  1K83 B;  1Y8O B;  3T4A C;  1I6H B;  4V19 0;  3MA2 B;  3D4D A;  3SXH A;  2ZXP A;  2J7Z A;  2VXW A;  3K6O A;  5COR A;  2NB0 A;  1OXS C;  5DNF A;  4O1N A;  3DEO A;  1I3Q B;  3AMU A;  2WV6 D;  1DCZ A;  2F4I A;  4O42 A;  4J1M A;  3VR3 A;  1NUC A;  4L8J A;  1QNU A;  3M4Y A;  3TME A;  4Q5V A;  1KNA A;  1EY6 A;  1A2U A;  2NVT B;  2EJF C;  3PUY A;  1BCP C;  2F0V A;  3D6W A;  5JEA G;  2KUM A;  1GJX A;  1V43 A;  3IAY A;  3VYR A;  3VA5 A;  1B44 D;  4KN7 C;  3S1M B;  4RKB A;  2Q8R E;  1EY0 A;  3TN2 A;  5JVH 3;  2D62 A;  5D14 A;  4G4K A;  5I6W A;  3G6J B;  3DWA A;  1QB5 D;  2LY7 A;  2ZXR A;  1LT5 D;  4EQN A;  4ZUI A;  4IFD I;  2F03 A;  4CBV A;  5IGF A;  3PMF A;  3L3O C;  1SE2 A;  1WVL A;  1DM0 B;  1T5X D;  3P20 A;  2EYJ A;  3T51 B;  2BOS A;  3M4O B;  3PO2 B;  2ID0 A;  2K04 A;  4KTA A;  4X3S A;  5C0X I;  4XIG S;  1JCK B;  4XDX A;  4R8I A;  2R93 B;  1STA A;  2D9U A;  3J80 E;  1Q90 A;  4KN4 C;  2KEC A;  3JAM E;  1EIG A;  1BDO A;  3N52 A;  4RGT A;  2XRS D;  2LMC B;  1SE3 A;  2KJX A;  1WTV A;  1SJE D;  1FGB D;  4K5X A;  3R8B A;  2XNA C;  3KF8 A;  1J9O A;  3NHH A;  3RZO B;  1IW7 C;  4UDU C;  1PTO D;  3S2H B;  2B2U A;  4FVM A;  1HRJ A;  2SNM A;  3BVG A;  4IUP A;  5ELE A;  1DJR D;  2F0I A;  2M00 A;  1FYC A;  4BY7 B;  2RDG A;  1KDC A;  2EYO A;  5CMD A;  5EKL A;  5I2X A;  3SE0 A;  1XYI A;  1XXG A;  2B2T A;  4RHS A;  1A6X A;  3MFY A;  1SFO B;  1EY8 A;  3J7A F;  4ULL A;  4XYQ A;  3SK8 A;  1F9P A;  5KNC A;  3RD4 A;  1D5Z C;  2KCN A;  3MZ5 A;  3HEJ A;  5LHY 1;  3NBI A;  2PCF B;  1LT6 D;  3SR1 A;  2K1B A;  2OT2 A;  1VMC A;  5ELF A;  4KKS A;  4K5W A;  1HTL D;  2YYZ A;  2A68 C;  3SHL A;  1CT1 D;  3K5N A;  3FVQ A;  3J81 E;  2BA1 A;  3ERQ A;  5C5L A;  1F77 A;  2ZXO A;  2DNC A;  2L5T A;  3MC0 B;  4RGN A;  2YU9 B;  2PQE A;  2EJM A;  2K5W A;  4JK1 C;  2E2H B;  4RCO A;  1HA5 A;  3GD7 A;  3I4N B;  5IGD A;  1LTG D;  1JWS D;  5BN5 A;  1B3A A;  1SNQ A;  2F0H A;  4CKE A;  2NN6 I;  1PRT B;  1DON A;  2MGS A;  3NTI A;  4K6L A;  1PRT F;  3D3R A;  4ZKC B;  1V1P A;  5I2Y A;  4DNR B;  1G91 A;  3E5S A;  3NP8 A;  4A3M B;  1Y8P B;  4WRD A;  1WCM B;  2EJG C;  3Q6S A;  4BWG B;  1QE6 A;  1D1K A;  1CTM A;  2NVQ B;  1G6Z A;  3KLR A;  2VUM B;  2QCP X;  1JWM D;  2L11 A;  2H1E A;  3HOV B;  3PIP 3;  2CW0 C;  5A35 A;  3ITP A;  3OMG A;  2B2V A;  1RF2 D;  4B9W A;  1PMR A;  1GXD C;  1PRT D;  4PV1 C;  2BDN A;  4PMB A;  3NSW A;  1A2T A;  3C1E A;  5EPK A;  4Y7N B;  3K5M A;  1CQF A;  1NCV A;  4IUU A;  4A3D B;  1SYB A;  2K6A A;  1M8A A;  4C3J B;  1ENF A;  2JEB I;  3TP6 A;  5EJW A;  1F9Q A;  3NQI A;  3A7A B;  5T1G A;  5LL6 X;  3HKZ B;  5EKI A;  1F9S A;  4IZ8 A;  1LTR D;  2JSO A;  1CA6 A;  3OIQ A;  2A74 C;  3OOC A;  1HTP A;  2EXZ A;  3UI2 A;  4WOR A;  5CV6 A;  1D6E C;  3QWN A;  1FD7 D;  4Q0F A;  5D3I B;  4RFB A;  4G7Z C;  4MHE A;  1AN8 A;  3R93 A;  4ZKB B;  1BR9 A;  4RKL A;  4F8M A;  2O5I C;  3SEB A;  1RCV D;  3FPP A;  2IX3 A;  5I4D A;  1TS4 A;  2N55 A;  2ICE C;  3GV6 A;  1CQV A;  1LAB A;  1B50 A;  4KY5 A;  1PDQ A;  1EY9 A;  3BDC A;  1I4Q A;  1HXY D;  4XQJ A;  4H7B A;  2RQX A;  5C3E B;  1JOQ A;  3N6R A;  2VNU D;  2JYO A;  1QJO A;  4K2K A;  3Q23 A;  5C3X A;  2IPK D;  2OXP A;  3Q22 A;  3BYY B;  1GUS A;  5FO8 B;  1A3V A;  2L4N A;  4OO1 G;  1TQO A;  1D1I A;  4HN7 A;  1TWG B;  1RD9 D;  2A6E C;  2ENB A;  1BNZ A;  3EJI A;  3DXJ C;  3V96 A;  1BQQ T;  3TP8 A;  2Q8I B;  3WOF A;  2IX0 A;  5CV9 A;  1MSG A;  3PIO 3;  1LTS D;  2PPB C;  1EU3 A;  1V8Q A;  4BA2 I;  5FO7 B;  1PZK D;  1ENA A;  1QCB D;  1Y8N B;  3I4L A;  3H3V C;  1EOT A;  2B2W C;  2A69 D;  2K5Q A;  2RVL A;  5COY A;  1HFG A;  3HS0 C;  2G9D A;  2FMC A;  2BA0 A;  4I7Z C;  3SDZ A;  1IYV A;  1WD1 A;  4C3I B;  1RDP D;  4C3I G;  3QOJ A;  5KNB A;  2E75 C;  2HDM A;  4C3H G;  1T5E A;  3I91 A;  3NK9 A;  4DAY A;  2NVX B;  1HQR D;  5A2Q E;  3NXW A;  3KBG A;  3I3C A;  3C2P A;  5CC4 A;  4P2C B;  2ICI A;  3D31 A;  3MXN A;  1X3Q A;  1EIH A;  4L63 B;  2MHV A;  3P7J A;  1EEF D;  2HDL A;  1LT4 D;  4CJ1 B;  3S1N B;  1PFM A;  1TS3 A;  1EZ6 A;  3BS1 A;  2DY7 A;  2A6H D;  2SEB D;  3NPP A;  3H0G B;  4ZRZ A;  4BBR B;  3FMC A;  5G3L F;  3EA6 A;  1SYC A;  2BE5 D;  1KDA A;  3TDQ A;  3VYT A;  5KEE A;  1ZXT A;  3GO5 A;  4HMJ A;  2RKS A;  3S2D B;  4A3E B;  5C4X B;  3EVQ A;  4IUV A;  1DD2 A;  1EWH A;  2WAQ B;  1ILQ A;  2F0S A;  3HOZ B;  3GV3 A;  1C8C A;  3KLS X;  1PZJ D;  1B9M A;  4FF3 A;  2N88 A;  1TU2 B;  3S17 B;  2EPB A;  4B08 A;  1A3U A;  3DHQ A;  2EYP A;  3KBX A;  1GHJ A;  5G3L D;  3QIA A;  3GTL B;  5IGE A;  1ICW A;  2EY1 A;  4K8J A;  3DM1 A;  2R92 B;  4RH6 A;  5CGK A;  2FMM A;  3NQT A;  5E4W C;  3GTM B;  1CK1 A;  2KVM A;  1HUM A;  1YNJ C;  3HOW B;  3E0J A;  1TWF B;  1L0X B;  3GP7 A;  1TKW B;  2B8G A;  3TP5 A;  1CZG A;  5IGB A;  2RBM A;  4DXF A;  2FIN B;  3S1R B;  1UUP A;  1STN A;  4GZY C;  1CI3 M;  3DWQ A;  4LK1 C;  2Y0S B;  4MN3 A;  3DEP A;  3Q24 A;  1LV9 A;  4KKT A;  4FXK C;  3ZYY X;  5M5W B;  1BF4 A;  1U9R A;  3BZD B;  5IT9 E;  4IFD H;  3U9O A;  1QWY A;  5EPL A;  5M3F B;  1E2V A;  2NTT A;  5KYI A;  3R3O A;  3IL8 A;  4KHZ A;  1PTO B;  2VB3 X;  1Q8I A;  1EQV A;  1PTO F;  4XXE A;  4CKB A;  1H9K A;  4WFN 3;  5C0X H;  3IKJ A;  4DXG A;  3H91 A;  4EQO A;  4KMU C;  3GTK B;  5CV8 A;  2EE1 A;  2E2I B;  2EY2 A;  2VB2 X;  1PYW D;  4CHT B;  2PZW A;  1IW7 D;  5IGG A;  2R7Z B;  4RA8 A;  1CZW A;  4KJN A;  4TRD A;  1AW7 A;  1JOK A;  2XRQ D;  1EYA A;  4KY7 A;  2IX1 A;  2MPM A;  1QG7 A;  3OIP A;  4M8A A;  1NAP A;  4IN3 A;  3P1H A;  1F2Y A;  4BA1 I;  2XIW A;  1F2M A;  5TSS A;  2XWB B;  1SDF A;  2JA5 B;  1OXT A;  4ZLT F;  1D5M C;  5CR3 A;  3OMC A;  3A7L A;  1FNU A;  1MD2 D;  1TII D;  4ODG A;  4FYD A;  5F2D A;  4IFD J;  1AFP A;  2MJ8 A;  2F0E A;  2EYM A;  3A55 A;  5EGT A;  1VCI A;  4G7H C;  4QF4 A;  1U4P A;  2A68 D;  4G57 A;  1EY5 A;  4KD4 A;  3PUW A;  4KKU A;  1I4P A;  4QUF A;  1LTT D;  2Z4I A;  1Q12 A;  2C9O A;  1LTA D;  3PUZ A;  5C0X J;  4J8Q A;  4CKC A;  2XN9 C;  1IKL A;  4XYO A;  2FHT A;  1RJT A;  2L1B A;  1EU4 A;  4OIJ A;  2Z8L A;  4EQP A;  1DOK A;  1R9T B;  1Y1V B;  1XWE A;  2F1M A;  4DAV A;  5JOB A;  1I4H A;  4TKO B;  5M5Y B;  1D5X C;  1II3 A;  1VF5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...